4A3KG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3kG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3kG01
5IWAL 1HR0W 3H3VI 2HIXA 5GAHC 4OO1I 1OXUA 4YHHL 1Q82C 2N78A 1Z47A 3UE1A 1CKNB 5C0XG 4B3TL 3HKSA 3PUXA 2PI2E 2R7DA 5ELOA 4GOPA 1G291 1E24A 3I4OA 3STBD 5EAYA 5H1SE 1X3EA 1Q81C 4GOPC 2DUDA 1K8GA 3HKZE 3J80i 4L5TA 3CCVA 4KLKA 3S24A 2R6GA 1PYSB 3S1QH 5HY6A 1N9WA 1R9TH 4K0KQ 3RLNA 3UDIA 4PZ7A 1PVOA 4GN5A 3GTQH 2HHHQ 4JI6L 2CKZB 4KHZA 2ZM6Q 1VQGA 4A93G 1KXLA 1EYGA 1E22A 4HIDA 4X66Q 2VUMG 1UWVA 4JI0Q 1JJCB 2BA1A 2Z6KA 2PI2A 1OXTA 2WAQG 4JG2A 2AWNA 1MJCA 2R92H 1WFQA 2VQEQ 1NBWA 1OXSC 4PZ6A 1VQNA 5C4JH 1VQ7A 1WCMG 1CKMA 1WCMH 1X3FA 4JI1Q 1KAWA 5BR8L 2VZAA 4IO9A 2I0QA 4JI7Q 5LMNQ 2F4VQ 5JJLA 1A63A 3AYHB 3PO2G 3PO2H 1VQBA 1IBKL 1JJ2A 3RLFA 2LXJA 3JAMi 1PYBA 4O0AA 4QL5A 2JJQA 2Q2IA 2ZTDA 3PUVA 5AJ3Q 2UUAL 2VQFL 1VQOA 5M5WH 2JA5G 3PF5A 3VDYA 4YY3Q 4LF7Q 3EN2A 1PFSA 2I5LX 3B6YA 1M90C 2OTJA 3J81j 1K3RA 4DR4Q 5IYDG 1M1KC 5LMUQ 1E1TA 1SR3A 1YEZA 3A5ZB 4LFBQ 3K0XA 1VS0A 1XMOQ 4DR2Q 2YTXA 1BBWA 4OWXB 2OQKA 3KFUA 3TREA 4MZ9A 2RF4A 4RG1A 1BBUA 1U0LA 2ALYB 4LF9Q 1GVPA 4GOPB 3I4NG 3I4NH 1J6QA 4R1JA 4EQ5A 1Y1WG 2Q2HA 1Y1WH 1V1QA 1Z9FA 3Q8DA 4A3LG 1QUQB 1XTDA 4IFDI 4DKAC 1HJPA 2ID0A 4JI3Q 1OXVA 4LFAL 3CD6A 4YCUA 4LF8L 1PH1A 4P74A 1JB7A 1IL2A 4LF5L 1X54A 2JA9A 1LYLA 4A3GG 1C7YA 3A74A 1PV4A 3CCLA 2HHHL 3AQQA 2FXQA 2H5XA 2K5HA 3I4MG 3I4MH 1YHBA 4B3TQ 4X62Q 1VQ5A 2UXCL 4X66L 1JE5A 3J80c 3S2HH 1FVIA 1CUKA 4YCVA 2C35B 4LFCL 3UDXA 3CXCA 1YJWA 4RMFA 1VQEA 4A3JG 4A4IA 1HNWL 2Y0SG 2KCMA 3CCQA 2MO0A 1HH2P 1D8LA 2JA8G 5C4XH 5C4XG 4KHPL 3U4ZA 3W1GA 4JI8L 1VQDA 3S15H 2YU9H 3AEVA 4IFDG 4QGUA 4JI6Q 4JI7L 1MIUA 4HIKA 1PH4A 1YVCA 1YITA 2WB1E 2XGTA 3TEHB 3F2CA 1UE5A 3CCUA 5AJ3L 4DR7Q 3M4PA 2EXDA 4YY3L 2B29A 2BA0A 2E2HH 2B3GA 2K75A 4NXNL 5FLXc 2AHOB 3L0OA 4GN4B 4JBKA 2YYZA 5LMUL 4POFA 1KRSA 3K80C 4LF4L 4IPHA 2UUBL 3NBHB 5BR8Q 3OTOL 4DR6L 3JAMc 3I7FA 3L7ZC 4JBMA 3CC7A 4C3JH 1SN8A 2PQAB 3OW2A 1IBKQ 4C2MH 4LNQA 4JYAL 2NN6G 4IJLA 5JEAJ 4DR5Q 4BA1I 1CKOA 1NE3A 2VQFQ 2CFMA 3L2PA 1EUJA 1YZ6A 1JJGA 2Q2TA 5IP9G 3PF4A 2NVYH 1P8LA 5M3MG 5M3MH 4A3BG 3KDFB 2K52A 2PNHA 4TQUS 3H15A 2MO1A 4AYBG 3FKIH 3KF6A 2I5HA 4POGA 2GN5A 1C0AA 2D62A 3M4OH 3S1RH 4GNXC 2KENA 2ZTCA 1YHAA 3GTKH 1TWGH 4JI2L 4X62L 3U58A 1XMQL 3CC2A 4LW1A 3RR5A 2MQHA 3RZOH 1AH9A 1PH7A 1EIYB 4HJ8A 3J81i 3S1NH 4IOAA 2VL6A 1Q8KA 3CCRA 1EIFA 1IYJB 1YJ9A 1SE8A 2N49A 4DK6C 1X55A 2E8GA 4HJ9A 4LFAQ 1VQPA 3IRBA 1GM5A 3F2BA 4LF8Q 1WOCA 2UU9Q 4LF5Q 3DLLA 4DV5L 1PH8A 2E5LL 5GQOA 4IPGA 3ER0A 2Y0SE 4JV5L 3G71A 4R4OA 4A93H 4BBSG 1K83H 4MTNA 3G4SA 1VQKA 3NENA 1QVGA 2VUMH 4BBSH 2UXCQ 1NMFA 5C3EG 5C3EH 2VS1A 4DUZL 4LFCQ 4DR7L 5GADC 1DGSA 2BH2A 3H3VH 2A19A 2UXDL 2Z6KC 5JEAG 4OO1G 1HNWQ 1X6OA 1FL0A 1S40A 3HOVG 2CQOA 3HOVH 1HZBA 2Q2UA 2UUCQ 4KHPQ 4OXPA 2ES2A 1E3PA 2V1CC 3CP0A 4JI8Q 4ALPA 1PH3A 3PGZA 1L1OA 2LSSA 4GKKL 2NVXH 1KRTA 1CSPA 1WYDA 2ZTEA 4PZ8A 1VQHA 3M9BA 5ELNA 4DV7Q 4DR5L 4DPGA 4LF6Q 2KHIA 3CC4A 1IBLQ 4X65L 2OQ0A 1ASYA 1K8AC 4IJHA 2JA5H 2YTYA 1W3SA 1PH6A 2ZJRA 3GTGH 1H95A 4NXNQ 5IT9c 3WWVA 4Y7NH 5IYDH 1JT8A 4R4IA 3KF6B 1CSQA 3ULLA 4GNXB 3ZJYC 4LF4Q 4IFDJ 2UUBQ 2AKWB 1I5FA 1Y1VH 1V43A 1TWCH 1Y1VG 3OTOQ 5C44G 1KC8C 4P71A 1NJIC 2JA6G 4DR6Q 2HT1A 3AFQA 3TQYA 3NEMA 2B63G 2IHFA 3GDEA 4JOIA 4AH6A 3CCSA 1SRUA 4JYAQ 4YWMA 4A3GH 3KOJA 3M3YH 4AYBE 3ERSX 3W5OA 1Q12A 4HIMA 4OWTB 1HZ9A 5IYBG 4EX5A 1LUZA 5IYBH 4DV1L 3CAMA 1PA6A 3S16H 2UU9L 4KI0A 4BBRG 4B3ML 1T9HA 1KL9A 2GVBA 1AE2A 3G48A 2RCNA 1I6HH 5DLQE 4JI2Q 2JQOA 4AQYL 2IT1A 1XMQQ 2UXBQ 1N34L 2IX1A 3HOZG 2NVQH 3S1MH 3HOZH 5JJKA 3CPWA 1JMCA 2CCZA 3SGIA 2ASBA 3I56A 4PMWA 3EBEA 4UP8A 4A3JH 1MJEA 5IE8A 1VQ9A 3A5UA 2JA8H 2UUCL 1PHJA 1Q46A 1HNXL 4GLAC 1XNRL 4X64L 4BXXG 4DV5Q 4OX9L 2E5LQ 2WAQE 2VNUD 1SMXA 2DGYA 3KLWA 3GTOH 1EWIA 3RZDH 4JV5Q 1BKBA 3M4QA 3RN5A 1KD1C 1IXRA 5IP7G 3HKZG 4TVAB 3GTJH 4DV7L 3T1HQ 1HNZL 2I5MX 1N36L 4LF6L 1VCIA 4DUZQ 4AIMA 1IBLL 2JK8A 1EFWA 3GTPH 2UXDQ 1E7ZA 2K4KA 1XPRA 3ULPA 1FGUA 4J15A 1CKNA 3UDFA 4DV0L 4R4QA 1Q1EA 4IOCA 1YJNA 5GROA 5HGQA 4ME3A 4OWWB 3S2DH 3K7AH 3F1ZA 1N32L 2KHJA 1AE3A 3RLOA 1IBMQ 4B3SQ 4GKKQ 1WI5A 2JE6I 4A75A 3M7NA 2JEBI 5M5XH 3K8AA 2E2JH 1X56A 3D0FA 4DV1Q 4L5RC 4A3DG 4JI4L 2R93G 2JEAI 2R93H 1HZAA 4X65Q 5FLMG 1V9PA 5FLMH 2K5VA 4QIWE 3T1YL 4DV6L 3E9IA 1N8RC 2MNAA 4C3HH 1EQQA 3HFZB 5IP9H 3HOWG 3HOWH 3U50C 3RNUA 4A3BH 3PIPA 4A3IG 1A62A 1TWHH 3CF5A 4NB3A 3ICEA 4JBWA 5C0XI 5J3BA 4JBJA 3HOXG 3HOXH 4YWKA 1C9OA 2RHQB 2CWPA 1I50H 2K50A 4DNIA 4HJAA 3BJUA 1Q7YC 4A3MG 3S14H 4A3MH 3FHWA 5JJIA 1W2BA 2KCTA 2UXBL 3PIOA 5GAEC 3W1BA 2ZJQA 2R7ZH 2R7ZG 4B3RL 2Z0SA 1BVSA 1VQAA 1QVCA 2AMCB 4JCVE 4P72A 3BZCA 4R4CA 4XTCS 3CCEA 4C3IH 2E2IH 1N33L 4GN3B 3I55A 1SROA 3S17H 4B3MQ 1I94Q 4BA2I 1VQJA 2ZJPA 3PUZA 4AQYQ 4L5SA 4DUYQ 1YI2A 1KQSA 3GTLH 1N34Q 3T1HL 5IYCG 3M85A 3ULJA 3A0JA 5IYCH 4GLXA 4DR1L 1P16A 4OONA 4DAMA 1PH5A 4WJ3M 2YTVA 2YV5A 2QEXA 1FJGL 1UE1A 2BH8A 3GTMH 3RN2A 4IPDA 1HNXQ 1QUQA 1XNRQ 4YWLA 3DM3A 4X64Q 3CCJA 2K14A 1X9NA 3KJPA 4OX9Q 2JA7G 2JA7H 3PUYA 1SFOH 4B3SL 1K9MC 1IBML 1EQRA 1L1OC 5K36G 1VQ6A 3TS2A 1D7QA 1I3QH 2JA6H 3E0EA 4DV4L 1HNZQ 4QY7A 2F52A 1N36Q 3LGJA 1YIJA 1UE7A 4UP7A 4DV0Q 1LTLA 3BU2A 2R92G 2VY3A 3HOYG 3K81C 3HOYH 4DR3Q 1HR0L 2WB1G 2QGQA 1N32Q 5C44H 1VQ8A 4JI5Q 1UE6A 2OTLA 2NZOA 2WFWA 2EIFA 1PH9A 2B63H 1XPUA 4YCWA 4GKJL 1GKHA 4NXMQ 4BY1G 4JOIC 4BY1H 4LUZA 4JI4Q 1XNQL 2OCEA 1E1OA 4O2DA 3T1YQ 1K73C 4DAYB 4R4TA 3D31A 4DV6Q 3UDGA 1Q86C 5M5YH 2IX0A 3U4VA 1GD7A 3UE0A 1GO3E 4IPCA 3J7ZC 4BBRH 4PG3A 3STBC 1VQIA 1I94L 2K5NA 2N3SA 1KIXA 2IY5B 4Y52H 3KYHC 1B7YB 2D0OA 3CQZH 4DV2Q 2XTIA 3J81c 1NTGA 4DUYL 4A3FG 4A3FH 1U5KA 2VW9A 1L0WA 1KHIA 1K0RA 2PQAA 4HJ5A 1J5EQ 4DV3Q 4B3RQ 1O7IA 2NVTH 5LMNW 4GLVB 4QQBX 4L5QA 4DK3C 4HJ7A 1L1OB 1N33Q 3PO3G 3PO3H 1LM0A 3KF8B 4APVA 2HQLA 2LXKA 4BXXH 1L2FA 2MFIA 1MKHA 3KDFA 4A3CG 4A3CH 1VQLA 4K0KL 1G6PA 1XPOA 5IWAQ 1B8AA 1XJVA 2N8NA 1QZHA 4P73A 5IP7H 2PMZE 2IHEA 2ZM6L 1A0IA 1X3GA 4FDBA 4YHHQ 2KBNA 4DR1Q 3TS0A 2NZHA 1J5EL 3NELA 2RHSB 2L15A 3CMEA 4JI0L 4NPSA 1FJGQ 2ATWA 4UY8C 3AFPA 4XIGS 1PH2A 4DR3L 3CW2C 4LUVA 2VQEL 3FP9A 1Y14B 4A76A 4MNOA 4JI1L 4JI5L 2NN6I 1VQMA 1QVFA 2OWOA 3PV0A 4JC0A 4UP9A 5C0XJ 2EQSA 1TXYA 1G51A 3GO5A 1EOVA 5LMNL 4DV4Q 4NXML 1B70B 4P75A 2F4VL 3KJOA 3G6EA 2A8VA 4A3DH 4A3EG 4A3EH 1NY4A 5E7NA 1SLJA 3E9HA 2QA4A 2WP8J 1YHQA 4BY7G 4BY7H 3CCMA 4LUOA 3JC66 4LF7L 3J7A5 4H02A 1HR0Q 3HOUG 3HOUH 4A3IH 1TWAH 4DR4L 1RIPA 3TRZA 2A1AA 2GVAA 2HIVA 1VQCA 1X65A 1YNXA 3GD7A 5M3FH 5M3FG 4LFBL 1XMOL 3BZKA 1S3OA 3EIVA 3CPFA 4DR2L 1OTCA 4GKJQ 4DV2L 1RL2A 1XNQQ 4X6AH 3MEFA 5IY0A 4A3KG 1TWFH 3OYYA 3PUWA 1IZ6A 4A3KH 1VQ4A 4LF9L 3PSIA 3PCOB 2CWAA 2UUAQ 2D0PA 1VQFA 1YBYA 3H0GG 3H0GH 3I2ZA 3F8TA 4GS3A 2R7FA 1WJJA 3K7UC 4DV3L 1S72A 4A3LH 4WJ4A 4LWCA 1A8VA 1OXXK 4UPAA 1ASZA 2AWOA 4QJFA 5FJ8G 5FJ8H 1NMGA 4JI3L 3F2DA 3CMAA 2F3IA 3FKIG 1QZGA 1Q1BA 1HZCA 3MXNB 1UEBA 5GAGC 4HIOA 4GNXA
chains in the Genus database with same CATH superfamily
2HIXA 1KTKA 1EWHA 1GUOA 1OXUA 4O2AF 3RMHA 5BR8H 3UE1A 4XX0B 3OMGA 2PI2E 2R7DA 2EPBA 2A73B 3PUXA 1A3VA 5ELOA 4GOPA 1C48A 5L1JA 3K57A 5T1IA 4GOPC 1EEFD 5GONF 1ENAA 5KKNB 4L5TA 3CCVA 3S24A 3O13A 2O5IC 1PYSB 3NTIA 1EL0A 5EWEA 4P2CB 5HY6A 4K0KQ 5K36H 3UDIA 3GTQH 1WTQA 2HHHQ 2B2UA 2CKZB 2PMZB 1Z2NX 4KHZA 2B2UC 1Y69U 3BQ0A 2JA7B 4JI0Q 2E75C 2V4QA 1RTNA 2Z6KA 2WAQG 2R92H 3J7AV 2F0IA 1FGBD 1OXSC 1BQQT 3OUUA 4X3UA 1VQ7A 4IZOA 1CKMA 1WCMH 3FMCA 3MVVA 1Y8PB 4ZOLF 2A69D 2AGOA 2XCAA 2VXWA 2KA7A 3AYHB 4UCUA 1E0BA 1LTGD 1TS2A 4LF5H 3RLFA 2LXJA 3BVZA 2K05A 1PYBA 1NR4A 3RV3A 1S03G 1EWCA 2Q2IA 2ZTDA 2B63B 4KY5A 2F0GA 3EN2A 4K8IA 1M90C 4BY1B 3J81j 2SDFA 5IYDG 4DA2A 1E1TA 4RB1A 3HG9A 1YEZA 1RHPA 3A5ZB 3K0XA 1VS0A 3L4JA 2J9GA 1BBWA 5M5YB 4KHPH 4IR9A 2ALYB 1T5EA 3CU7A 4BBRB 4EQOA 3RIZA 1X3PA 3L9AX 1Y1WH 1Z9FA 3CQZB 5EPLA 3N44B 1XTDA 1AUVA 1AP0A 4IFDI 1ZQ7A 4LK1C 2W6QA 1SEIA 2KEEA 2A6HC 3HOZB 5ELFA 5I9PA 4Q5VA 1KAAA 1OXVA 4LF8L 4RGNA 3BDCA 1SE3A 2F03A 1PV4A 3H0GA 3QIAA 4FP5D 3OTOH 1YHBA 5KG2A 4QCLA 4X66L 1TY2A 4LSAA 5EPJA 1CUKA 4RMFA 4RKLA 4TV9F 1DOMA 1HH2P 4RCOA 5C4XH 1A3UA 3SEBA 3LNNA 4YJ3F 3U4ZA 3W1GA 4JI8L 5D3DA 4JUZA 1EFID 1JOOA 2EOTA 4QF4A 5IIFA 4QGUA 5HURA 2WIIB 1YITA 3K7AB 5KNCA 1C30A 1ONLA 1HTPA 2M00A 5AJ3L 4YY3L 2B29A 1OWTA 3BDOA 2R93B 2J6UA 4RCNA 1S97A 4POFA 1RYRA 1I4HA 1TS4A 1KRSA 5CV7A 4KKUA 2UUBL 2W9CA 3P1HA 4DR6L 2IA6A 3I7FA 3PN1A 4N8X1 2NU6B 1TWAB 2F0KA 3NWSA 1WSCA 4CC5A 4PWQA 1PYWD 5KFEA 1EY5A 4G4KA 4DV5H 4JYAL 3BQ2A 4IJLA 2E5LH 2WB1A 1SJED 5L9XA 3HOXB 5D1OA 5EWFA 4JV5H 3K5OA 3L2PA 2P0AA 2F0HA 2YRWA 2ICEC 5IP9G 1CQJB 3T1HH 3MFGA 2F0OA 4ZK9B 5M3MG 2L55A 3NK9A 4A3KB 5FO8B 3H15A 5BPHA 3BG5A 4RNOA 4AYBG 2UXDH 3KF6A 4POGA 3UFXB 1CQFA 2SCUB 2B2TC 1QOHA 4U673 4Y8VB 1BBXC 2WACA 4RGMA 5DAUA 2DN8A 3GTKH 2VA3A 4JI2L 3MXUA 1FNVA 2F4IA 5KFPA 1SMYD 4FF1A 4GKKH 4FVMA 2K04A 2I8CA 5KFFA 2FJ2A 3S1NH 4DNRB 2VL6A 3JSNA 4RB0A 2JEJA 2OT2A 1IYJB 1SCUB 4DK6C 4X65H 1CK1A 2HDLA 2ICIA 3CRLC 3IRBA 5I47A 4LF8Q 4FM9A 5LL6S 2UU9Q 1MHWC 5BN5A 2QKIC 1WD0A 4O1NA 1PTOF 4DF7A 2HUGA 3G71A 4BBSG 3G4SA 5C3EH 2VS1A 4DR7L 5EDWA 1WTPA 2BH2A 1GUGA 4XT1B 4OO1H 4O3SA 5DG7A 1F2LA 1S40A 4G7HC 3HOVG 4ECXA 1LTID 2UUCQ 4JI8Q 3CP0A 4ALPA 5KNDA 1EY0A 1PH3A 2RBMA 4ZKCB 3GIKA 3KBXA 3KF8A 4YIJA 2R92B 1XDNA 4CC6A 2NUAB 2ZXRA 3TP7A 5I2XA 4K14A 4DV7Q 3KTMA 1BF4A 1WCMB 4B3MH 4DR5L 1L2ZA 2KHIA 4QWBA 1M0TA 1TT2A 5L1LA 2JA5H 4MV7A 2ZJRA 3GTGH 1N34H 2R8IA 5DEHA 1SE2A 4WORA 3AB9A 3WWVA 4Y7NH 2FMCA 1CSQA 4GNXB 4HEDA 3T5KA 2UUBQ 1I5FA 1D5ZC 4ECRA 1V43A 1TWCH 4RHSA 5BN4A 4DR6Q 2R7MA 5J2UF 2R8GA 4HQ6A 3R2TA 5KFOA 1BO0A 3BQ1A 2IHFA 2RGRA 4XT3B 4AH6A 2YZMA 1XNRH 2E2HA 1AZQA 1SRUA 4JYAQ 1DJRD 4ED6A 3M3YH 3ZYYX 4AYBE 1BUVT 4EBCA 4O3PA 1Q12A 1GLVA 4A3FB 4OWTB 4I4TF 1HZ9A 4DV1L 2AGQA 1F9RA 2XIWA 3TP8A 1YNND 3S16H 5L1IA 1KJ9A 4KI0A 3FPUB 1T9HA 1KL9A 2VB2X 3BZDB 4CGYB 3G48A 5D14A 3PO3B 2PZTA 4JI2Q 4AQYL 5L37A 1H9MA 2P5ZX 3CPWA 4U6PA 3I56A 4RGOS 4A3JH 1AFPA 4FBTA 1PRTB 3QOLA 4ETSA 4MIUA 3KLSA 2JA8H 3JAME 1TWGA 3ND8A 5KX5F 1HNXL 1H9RA 1Q46A 2KVMA 3PW5A 5CV4A 2VNUD 1UNSA 3GV7B 5IT9W 3T16A 5J39A 1TS3A 5IP7G 2ZXOA 1S0OA 1ENCA 4TKOB 4AIMA 1IBLL 2K4KA 2YRXA 2FINB 4J15A 5IYZF 4DK0A 3VR2A 5FKAC 5JVDF 1LV9A 3H6MA 2MGSA 4ME3A 3S2DH 4IALA 5K2MA 3PZPA 1J5EH 2OF1A 1JDEA 2C00A 2VUMA 3V4SA 1IBMQ 1Z2PX 3GIMA 3D4DA 1S5CD 5T14A 4A3DG 4L5RC 5KT4A 1HZAA 4MV8A 4HMIA 1EHIA 1R4PB 1E4EA 1PRTD 4C3HG 3HFZB 5IT9L 3G6XA 2NVXA 4ED3A 2JEFA 3IKJA 3BVMA 4A3IG 1A62A 2R61A 3C2PA 1TWHH 4NB3A 1I3QA 3ICEA 3H0GB 4JBWA 1K28A 1SNCA 2ASDA 5C8YF 2RHQB 2BDOA 3QZ8A 4A3MH 5JJIA 2UXBL 4B3SH 1B33N 3CHBD 3KAJA 3W1BA 2ZJQA 4QIWA 4DAYA 4B3RL 3HZXA 3GTKB 4J9MA 1N48A 4DV1Q 3RV4A 3BZCA 3CCEA 4C3IG 5KFMA 1N33L 3IFDA 1SROA 3S1NB 4BA2I 1STBA 3SK4A 4KJOA 1V8QA 4AQYQ 4DUYQ 2Z9HA 1YI2A 4UCRA 4Q45A 5IYCG 3ULJA 3VR3A 5EJWA 3JAMW 1PFMA 3SDZA 4YP3A 2YTVA 2AQ2B 2R86A 1LTAD 2BH8A 1M4VA 1WTXA 2W9CB 2UVRA 3NXWA 1HNXQ 1QUQA 2RDGA 4ECYA 3PUYA 1SFOH 1K9MC 1QNKA 1F2ZA 4LH7A 1D7QA 1EIGA 1I3QH 4GZYC 3E0EA 2NZ1D 4DV4L 2IX3A 2PZWA 1YIJA 5FK9C 1CHQD 3R5HA 1FNUA 3T13A 5CA1F 5F9NA 1GSHA 3PO2B 4RUAA 5EBCA 3BU2A 4DK1A 3MR3A 2WB1G 4I7AA 2XD4A 2CZGA 2DJGC 1VQ8A 2JA5B 2SOBA 4J9NA 3IN5A 1BNCA 2NZOA 1PH9A 2EIFA 4Y7NB 4CJ2C 5K5PA 4YCWA 5CV6A 1KJIA 4NXMQ 4JOIC 1I4RA 4I55F 2OCEA 1TWCB 1E1OA 4O2DA 1K73C 2F0EA 3PR4A 4ECQA 1H9SB 1QWYA 3NBIA 1WH2A 1B4OA 1XWEA 2IJ0A 2ZDGA 4TV8F 3U4VA 4X66H 3UE0A 2HDMA 4IPCA 1BR9A 5IGGA 3H4DA 4RGTA 1MSGA 1I94L 4H44C 2VPQA 4MV1A 4Y52H 1MGSA 4K2LA 2D0OA 4XQNA 4DV2Q 2M05A 2FHTA 3NBHA 3V2TA 1SBBB 4JI1H 1U5KA 3X3MA 3TMEA 4MV4A 3A7LA 1KHIA 5LMNH 2F4VH 5CC4A 2Q8IB 4DV3Q 2I87A 4B3RQ 2R8HA 3I4MB 4NKLA 4EGVA 2PN1A 4MAMA 1N33Q 4MTKA 2KECA 3KF8B 4DXGA 3Q22A 3ETJA 4YY3H 4A3JB 4A3CH 1VQLA 1G6PA 4JV1A 1XPOA 4ECVA 1QZHA 4J0MA 2R7ZA 2JA8B 2ZM6L 1X3GA 4X3KA 4G57A 3J7AF 2NZHA 3NELA 4HNVA 3CMEA 1CHPD 2A69C 4UCVA 3R5FA 1GUSA 3KHRA 3K5NA 2DJFC 4J9PA 1PH2A 3RBEA 1JIHA 5C1PA 3FP9A 1Y14B 1D2BA 2B2VA 4YBZB 2E2HB 1VQMA 1QVFA 4PDBA 5C0XJ 2EQSA 4A3GH 1AEXA 1G51A 4DV4Q 1AN8A 3KJOA 2A8VA 1HA5A 4A3EG 3S2DB 4V0BA 1NY4A 5E7NA 2PMZA 3SHLA 5CGKA 3IAYA 5KT3A 2WP8J 2K03A 4BY7H 5HBRB 2JSOA 5KT5A 3J81W 1N56A 3K59A 1EIHA 4B3TH 1CQIB 2JA7A 1TVXA 1M8AA 4DR4L 1EY4A 4PQXA 4U68A 5FPOA 2A1AA 2HIVA 3GD7A 5M3FG 3LMLA 1JICA 5KFNA 3BZKA 1S3OA 3CPFA 1HTLD 5T1GA 3PW4A 1TKWB 4C3JG 1TWHB 2V5AA 2YYAA 3NUCA 4LF9L 3C1FA 4ULLA 1YBYA 4A3LG 3I2ZA 4GS3A 4O4HF 2R7FA 1WJJA 3K7UC 1S10A 1HUNA 5JVG3 2EYFA 4LWCA 4H13C 5KRUA 2B63A 2AWOA 3NQIA 2XCLA 5KFHA 4DR7H 1NMGA 4JI3L 1ML0D 5BN3A 5GAGC 4C1NK 4MV6A 1HA6A 4J9QA 4M8AA 3J81L 4OO1I 3U9OA 3I12A 4YHHL 1Q82C 3VR5A 5C0XG 4JW0A 1Z2OX 5C6AA 1JKJB 3I4OA 1Q81C 1XXGA 3R93A 4MTEA 4FF3A 1ZHQA 1IBKH 3R5XA 3R2IA 1K8GA 3HKZE 3J80i 3CQZA 4DR5H 1K3BC 1HUMA 4KLKA 2L4NA 2R84A 3CVZA 2VQFH 3S1QH 4CDFC 2W6ZA 2XSCA 1R9TH 4MTDA 1PZKD 1PVOA 2C5CA 4JI6L 4WFN3 2ZM6Q 4E6IA 1E4EB 1SEBD 4JV0A 4A93G 2F0FA 2WKDA 2WYOA 2VUMG 3K6OA 1B9MA 1JJCB 2NVXB 2BA1A 1TAEA 1NUCA 1OXTA 4JG2A 1I3QB 1WFQA 1SYDA 2W57A 1I4PA 3I4LA 4HTHA 5C4JH 2FP4B 3MWEA 3HEJA 4XQQA 4ABNA 4JI7Q 5C5MA 1KBLA 3DWQA 3JSLA 2FB9A 1JJ2A 2ZT9C 3C1EA 2JJQA 2UUAL 4HCEA 1O7LA 4ZYSA 5M5WH 2MJ8A 3PF5A 2BQ3A 3EA6A 1PFSA 1KLGD 2I5LX 3B6YA 5KEEA 2UXCH 4DR4Q 1K3RA 3U9TA 1SMYC 5KG5A 4LFCH 1SR3A 1HNWH 1S0MA 2YTXA 2M9VA 2OQKA 3PMFA 2XGPA 4RG1A 5DLGA 1EYZA 4LF9Q 4F87A 1TWAA 2D5DA 1QCBD 3OWEB 4Q44A 2Q2HA 1PTOH 3LWBA 1QUQB 4IUTA 3G6VA 4DKAC 2RVLA 3G7LA 1HHVA 1HJPA 1IBLH 4JI3Q 4LFAL 4BWGB 4YCUA 4WD3A 2K01A 4NXNH 2SNSA 3TQ1A 1C7YA 3A74A 2QYZA 4CKEA 2HHHL 2FXQA 2L0CA 4IUUA 1VQ5A 1TQOA 2FJZA 2CQYA 5LYJF 1FVIA 2HJWA 4YCVA 3UDXA 3CXCA 5CAEB 1G91A 3RUZA 3FKIA 3K3VA 1EUDB 5CBEE 2JA6A 3HRZC 2Y0SG 1CA5A 3FDSA 1CI3M 2KCMA 3CCQA 2MO0A 2R87A 2R82A 1VQDA 1X3QA 3H94A 3S15H 2E2DC 1O7YA 4IFDG 4JI6Q 2NUCA 1MIUA 3D6CA 4HIKA 1PH4A 2O5JC 2YZNA 1RDPD 1LT3D 3TEHB 3E5NA 3RFCA 1UE5A 4DNTB 4J9RA 2W8LA 3OOCA 2E2JB 3VYSA 2GPSA 4ED1A 2UXBH 2AHOB 3DM1A 2EY2A 2YYZA 3TBIB 3GTQA 2WE6A 1DCZA 4LF4L 1LABA 3NBHB 3C46A 3JAMc 3HOWB 3N8DA 3HXLA 3KXYT 4UFZA 1SN8A 3OW2A 2R92A 1G2SA 2A74C 3BVGA 4NP5A 4LNQA 2LY7A 1VAJA 4BA1I 1WCMA 3T5JA 1JJGA 1EUCB 5JOBA 4FF4A 3PF4A 5M3MH 4A3BG 3QFFA 2K52A 4DUZH 1S5FD 3K0YA 3QJYA 2F0WA 3OHXC 2MO1A 5JAVA 3BS1A 3FKIH 3J80W 2R7ZB 5E1FA 3WOFA 2MHVA 3S1RH 4GNXC 2ATLA 2J6SA 3GIIA 3NHHA 2EYPA 1HFGA 2A68D 1XMQL 3CC2A 2RDIA 2XVSA 4LW1A 3BG3A 3FEWX 1EIYB 2FKLA 4HJ8A 5C5LA 2C2RA 3JZIA 3CCRA 1EIFA 2F1MA 4OIKA 1UC9A 4JK1C 1YJ9A 3TQTA 1TU2B 2N49A 2E8GA 1VQPA 4LFAQ 1JCKB 3DLLA 4IPGA 2IMWP 5FLXW 1Y1WA 2Y0SE 1W93A 1ZKOA 4BBSH 1SNOA 1VQKA 3NENA 3S1QB 1U4PA 1NMFA 3J80L 5DG8A 3TP6A 1WTHA 3N52A 3H3VH 2A19A 2Z6KC 4A2AA 5JPNC 4GC7A 1D1KA 4RH6A 2CQOA 3HOVH 1HZBA 2DLNA 3EQLC 2ES2A 4ZLTF 2V1CC 1PRTC 3PGZA 4EG0A 4G7ZC 1L1OA 2IWHA 3HOYB 4Q8FA 2PCFB 3NP8A 5JVH3 4K6LA 2W6NA 5C4JB 4OHJA 4ED7A 4EGQA 1VQHA 4LF6Q 1I94H 2V4RA 1IHZA 1ASYA 1I4QA 1H95A 5BPFA 4J9OA 1JR0D 2J0TD 5FLXL 4XZ3B 4FXDA 1JT8A 4R4IA 4LF4Q 1VBGA 3ZJYC 1Y1VG 1KC8C 5KT2A 3FDTA 4I7HA 1ZETA 5M5WB 1NJIC 2HT1A 4O4IF 2N88A 2FK2A 5KFUA 2B63G 2F0VA 2NU7B 4X64H 2CW0D 3DWPA 4PV1C 3U9SA 4CJ1B 2EYMA 2O03A 4A2BA 4DL7A 3W5OA 4QW8A 3K58A 4KHVA 3URYA 2XRQD 4HIMA 1BCPF 2K6AA 3WO1A 1HNZH 5FPRA 1LUZA 1QNUA 3QWNA 1B2TA 3SI8A 2KJXA 3GQBA 3D4WA 2UU9L 1PTOB 3FRPB 4BBRG 5I9OA 2NVTB 3RAQA 1AE2A 4EYIB 1QJOA 2UVWA 3E5SA 2JQOA 2R85A 2CW7A 1XMQQ 5JJKA 2IX1A 1WTVA 3HOZG 3S1MH 1N32H 3MJFA 4RU9A 3SGIA 2ASBA 3UI2A 4PMWA 4JI4H 4LMQD 4KMUC 2UUCL 3GTKA 5JH7F 4GLAC 4KN7C 1KC7A 4OX9L 1RK5A 2WAQE 2DGYA 3GTOH 2TSSA 1GSAA 3M4QA 1WD1A 1IXRA 5COYA 3GTJH 4DV7L 1N36L 1IYVA 4RAUC 3S15B 4XXEA 1EFWA 3GTPH 1E7ZA 2I07B 5A2QE 4V190 1FGUA 1CKNA 4TQSA 3RUPA 4DV0L 4R4QA 1Q1EA 4BWSC 5F2DA 5DG9A 1KNAA 1PTOD 3N41B 3OIQA 1W96A 1AW7A 1PFBA 1QILA 3KALA 1GYFA 3RLOA 4B3SQ 2NBFA 1U9RA 3HOUB 2ZXPA 4L8JA 5M5XH 3K8AA 2RCFA 2N55A 2R93G 3ORQA 2B8FA 4K5VA 3FMAA 3T1YL 1GJXA 3MHBA 5L1KA 4DV6L 1N8RC 3Q2OA 3RB3A 1CT1D 1EQTA 4C3HH 5HGTA 4YHHH 4DR1H 3PIPA 1CFMA 5KFKA 4O3RA 4RKBA 1I7NA 1FJGH 5I2YA 1EOTA 2MP1A 3HOXG 2JXMB 2IW3A 2CWPA 4DNIA 5M3MB 1Q7YC 3S14H 3BJUA 2NU8B 3GTGA 2JA5A 2EYHA 1KJ8A 2MPMA 3FKIB 3PIOA 1FD7D 2JA6B 4XYOA 2JYOA 4EEYA 3MR6A 5GAEC 1LLRD 3S1RB 1TWCA 4OIJA 1H9SA 2CH4A 4OELB 1QVCA 4JCVE 4R4CA 4C3IH 3NTKA 3NTHA 2ZJPA 2VQDA 3PUZA 4DL2A 2F0LA 3Q8QB 5CBAE 4FXKC 2HVSA 2NB0A 3TZUA 3M85A 5IYCH 3A0JA 4ECSA 2W9BA 2R8KA 4DAMA 5IT9E 1PH5A 4WJ3M 3GTQB 4ZAIA 2PVPA 3RN2A 2DNEA 4IPDA 3EYYA 2V59A 5KFLA 4PNYA 2UUAH 2JEIA 1K1QA 4YWLA 3DM3A 3M4YA 4OX9Q 3G6YA 1IBML 3MXPA 1EQRA 5DLFA 5K36G 5A2QW 3VPCA 1ILPA 4YR2A 4J1MA 2EJMA 4QY7A 2F52A 4ZRZA 1N36Q 3LGJA 3JRWA 1UE7A 3L3OC 4UP7A 4QUFA 1YNJD 4F4XA 4DV0Q 3K3PA 1A2UA 2R92G 4IRCA 3K81C 2WDTA 3SK5A 4DR3Q 1HR0L 1DYQA 2QGQA 3HKZA 4XDXA 5C44H 4JI5Q 1JORA 1SNQA 2V58A 2OTLA 4GKJL 5C1OA 1A15A 1XYIA 1XNQL 3M9OB 3GP7A 3T1YQ 4K0KH 1NNXA 4DV6Q 2RQXA 1EU3A 3Q8SB 2HHHH 3MXGA 3UDGA 1Q86C 5A2QL 5KG0A 1STGA 1GD7A 4JPBW 5TSSA 3I3CA 4JI0H 5G3LF 1M0WA 1Y1WB 4Z9CB 1O7ZA 3SK6A 2W7PA 1CTMA 4F4WA 1VQIA 3EFXD 3KYHC 1B7YB 1I6VC 1F2MA 2G5DA 1NTGA 2B2YA 4DUYL 2W6OA 2ZDQA 3W3AA 4A3FG 5KT7A 2C2EA 2B2YC 4ZCKA 2VW9A 1TIID 5KFZA 1L0WA 1K0RA 1TWHA 2A6ED 5CV8A 1ILQA 1O7IA 4CHTB 1D5XC 4J9KA 4EGJA 3PO3G 1L1OB 2Q8TA 2RKSA 1LM0A 4APVA 4IRDA 2LXKA 3BDLA 2IP4A 4BXXH 3KDFA 1R4QB 1HFNA 3RJ0A 4DAVA 4ILWA 5IWAQ 4G3IA 2LFNA 2GLTA 5C4XB 1A0IA 4FDBA 2EY1A 2KBNA 3VPBA 3TS0A 5D8DA 2OEOA 3NE5B 4MHEA 4NPSA 1G2TA 3GTOB 3ORRA 3AFPA 4XIGS 2LMCB 3CW2C 2RGVA 4LUVA 2VQEL 5KFAA 1BNZA 4DGZA 3GTPB 4ZQ3A 3N42B 2OWOA 3PV0A 5DM73 3OPOA 3NPPA 4FS1A 3GO5A 4NXML 3G6EA 4A3EH 1ICWA 5E4WC 4RA8A 4EQPA 1Y8OB 2QA4A 1EY6A 4J6HA 4C56C 2YS6A 1I6UA 1ENFA 1SFOA 4LSXA 4LF7L 3J7A5 1HR0Q 3TIGA 1EQVA 3MR2A 3HB9A 1XX8A 3EPGA 3OUZA 4DL4A 5KNBA 2C22A 1VQCA 5M3FH 4LFBL 1XMOL 1G6ZA 4DR2L 4GKJQ 1OTCA 4DV2L 1VDZA 4HR7A 1PX2A 1S0NA 1XNQQ 4X6AH 3MEFA 1QE6A 1E4GT 3MAQA 2CQAA 3TSSA 3OYYA 4RWSC 1GOZA 5KFCA 2D0PA 3SE0A 3H0GG 4DV3L 4QUCA 4A3LH 3OSNA 1RK6A 4KKSA 2QCPX 3N6RA 1OXXK 2GA4B 5KGUA 5FJ8G 1DV1A 5CR3A 3F2DA 1EYCA 1SYFA 1CS0A 2DY8A 4KY7A 1GUTA 4QW9A 2H4OA 4QMGA 3H3VI 4EEQA 1SYCA 2W7OA 2EZVA 3QR8A 4M1UB 1CKNB 5C0XH 5EOYA 1F77A 1G291 5H1SE 5EAYA 1X3EA 4X3TA 3PW2A 4OGQC 2AQ1B 1RYSA 4Q43A 5C3EB 4O2BF 4EVOA 5DGAA 4FYDA 3RLNA 2F0SA 4GN5A 5ISRA 3RB6A 1EYGA 5CV9A 1E22A 1JWUD 2JN4A 4EBDA 2RSNA 1AUXA 1ZEQX 2PI2A 3ND9A 2VQEQ 1NBWA 4PZ6A 4WBNF 4E4TA 5FD6A 3HS0C 5KFIA 1C8CA 1X3FA 1DD2A 3MFHA 1PRTF 3E0JA 5BR8L 3J81E 3GTGB 4IO9A 2I0QA 4RB2C 4Q0FA 1A63A 3PO2G 3C0FB 4LF8H 1UC8A 1FR3A 1RJQA 2UU9H 5C44B 2DWCA 4O0AA 4QL5A 4DXFA 5IGCA 2FPPB 1KLUD 3Q6SA 1OO9B 2JA5G 4LF7Q 1MBYA 2E74C 1PK8A 5J1ZA 2FE3A 3M3YB 5LMUQ 2A68C 2LS01 1F9SA 1KEEA 4LFBQ 1XMOQ 4DR2Q 4FBUA 2J6TA 2KSWA 1BOSA 3N40P 3TREA 4ED0A 1J9OA 2RF4A 2W9BB 2UUCH 1A2TA 1BBUA 3I4NG 3S16B 4JI8H 1J6QA 4TUYF 4YAKB 1JOQA 4F7XA 2W9AA 1L0XB 4EYHB 4IUPA 4KJNA 2VOBA 2C28A 3NQTA 4IN3A 4MV9A 4DV7H 4K2KA 3A8IE 1HPCA 1DOLA 2F0DA 2ID0A 1JWMD 2X6LA 5CMDA 1CQVA 3CD6A 1JC7A 1JB7A 3TN2A 4LF5L 1STHA 1X54A 2JA9A 2SEBD 1DV2A 5JVLA 3CCLA 4X3SA 3BABA 4F88A 3AQQA 2H5XA 2HCCA 2K5HA 3I4MG 2UUBH 3H09A 4DR6H 4X62Q 3R3OA 1JE5A 3S2HH 1RJRA 3SXHA 2DPJA 3IFTA 2EY5A 2XWJB 4A3JG 4A4IA 3HKZB 4F8MA 4JYAH 2M2LA 2JA8G 3FVQA 4KHPL 4RAYA 4B9XA 1SE4A 1EY8A 2YU9H 2Q8RE 1JQYD 3AEVA 2B2VC 2IL8A 4KY6A 4JI7L 1EEID 2WB1E 3BYYB 3F2CA 3C3LA 1NAPA 4J9LA 1D6EC 3CCUA 4G7OC 4JI2H 3JRXA 2BA0A 1R9TA 4JBKA 2CW0C 1STNA 1VBHA 4HSVA 4ZUJA 5BR8Q 3OTOL 3I90A 3W2DA 4IAJA 3KLRA 3CC7A 4C1NI 1SYEA 2WAQA 1G8ZD 4C2MH 2NN6G 1QG7A 5JEAJ 1NE3A 2XCPA 1I4GA 3PVXA 1EUJA 1YZ6A 3MC0B 4A3MB 2Q2TA 1LTTD 2NVYH 3KDFB 2QDBA 3A8KE 3OWFA 1W6JA 4TQUS 3Q8RB 4I7ZC 1WTOA 1FYCA 3DMUA 2QK4A 1C0AA 2D62A 4NMZA 3J7AK 2KENA 5JUMA 1FNWA 4I65A 1PZID 2VUGA 3U58A 1IL8A 1DZ1A 4TRDA 1IBMH 3RZOH 3MR5A 3PQIA 2K7VA 4IOAA 3NWTA 4RHRA 1II3A 1V1PB 1GM5A 4DL3A 3F2BA 1K1SA 1WOCA 2VR1A 4LF5Q 1ZHSA 4DV5L 2E5LL 3GIQA 5GQOA 4RAZA 4WJWA 4JV5L 3RGXA 1PTOC 1IOWA 4MTNA 2RA4A 3TIIA 2H1EA 1SFOB 4LMYA 4K6DA 3SK8A 2QF7A 5GADC 1U4RA 2UXDL 5JEAG 3P20A 1X6OA 3H40A 3M4IA 1S5BD 3E6ZX 4HYKA 3MEHA 4KHPQ 2CVRA 2K28A 4HR7B 4ZI7F 5I4DA 2VA2A 2LSSA 4GKKL 4DV1H 4ED8A 2QDLA 1KRTA 1CSPA 2W71A 3TINA 4PZ8A 1B1ZA 2F0NA 4DPGA 4R8IA 3GV3A 4X65L 1K8AC 3MWMA 4AQYH 3DF7A 4DUYH 1PH6A 1SYXB 3RB0A 5IT9c 2ALZA 1KABA 5IYDH 2BQUA 4IFDJ 1STAA 1EZ6A 5ELBA 1Y1VH 3OTOQ 4QB4A 3L4KA 5I6YA 3AFQA 3IL8A 4N9TA 3TQYA 4C5CA 5DQIA 1HNXH 3J80E 3AU7A 4TSSA 4FNFA 4YWMA 1PMRA 3KOJA 5ELDA 3ERSX 2HCIA 2X0SA 4J9SA 4C5AA 5IYBG 4EX5A 2XRSD 3OHAA 5E4XA 4R8UA 4HN7A 5A35A 3MFYA 4B3ML 2GVBA 1I6HH 2KQ3A 2IT1A 1SAPA 3P75A 1N34L 3HOZH 3S9WA 1AZPA 1T36A 1JMCA 3MWYW 2X69A 5FLXE 4AYBA 3N43B 4F50A 3EBEA 4UP8A 4NXMH 5IE8A 3LWEA 1BXTA 3Q24A 3GILA 1I50A 1DXMA 1S4ZA 1PHJA 2PYKA 1Z7TA 3S2HB 1XNRL 4DV5Q 2E5LQ 3A8JE 1YNJC 1VF7A 1PZJD 1ZYRD 5KIXA 1EWIA 3RZDH 4JV5Q 1KD1C 5JJLA 4TVAB 3T1HQ 2F0UA 4L1KA 4LF6L 2I5MX 1K8OA 1SXTA 1E4FT 1CZWA 2J4XA 4C5BA 1VCIA 2YU9B 5FD5A 4DV2H 1A6XA 2UXDQ 4IZ8A 4DFAA 1XPRA 4A3GB 5KFYA 2B39A 1PLFA 2XC9A 1YJNA 1JOKA 1O78A 3EPIA 4BY7B 3K7AH 4DV3H 4B3RH 3F1ZA 3T5LA 2X6GA 1AE3A 2EYJA 4GKKQ 2HQEA 4A75A 1N33H 4B08A 2NWGA 5DM63 1VF5C 1X56A 1YNNC 3D0FA 4DU9A 2AUJD 2R93H 4YB8B 1BCPB 4X65Q 5FLMG 4MA5A 2O2LD 5EPKA 4QIWE 2EDGA 1ESFA 2JP1A 3E9IA 2F0JA 5IP9H 3HOWG 3U50C 3K5MA 3D8GA 3Q0AA 3RNUA 5LP6F 4C2MB 1JLLB 5CORA 2A6EC 3OW7A 1S9FA 5FOBB 5C0XI 4HNUA 4JBJA 3EVQA 2DNCA 3HOXH 5F9LA 1C9OA 2NVYB 1I50H 2K50A 1Q8IA 2YL2A 5EQ0A 4CBVA 4FO2A 1GSOA 3RD4A 2SNMA 2FK3A 4DV4H 2R7ZG 2EYOA 2G9HD 4P72A 4XTCS 2FFKB 5M9OA 2E2IH 2PO4A 3V4ZA 4RNNA 3S17H 5H80A 4B3MQ 2OXPA 1VQJA 2Z1CA 3ONAB 1CM9A 4L5SA 3M9NB 1KQSA 3GTLH 1BCPD 1N34Q 4LJZC 1JX4A 1SSOA 1R9TB 3F2UA 5KG6A 2YV5A 2QEXA 1BXRA 3SR1A 3GTMH 3GLKA 3V6JA 1SDFA 1B04A 1I7LA 2QW7A 4FXGC 1XNRQ 3CCJA 2F0PA 2K14A 1X9NA 2JA7G 2D2CC 2WAQB 4NDXA 2PBZA 4B3SL 3BYTB 1L1OC 1M7JA 5NUCA 4DAPA 2HVQA 3VPDA 5KG4A 4DL6A 3F8NA 3VYTA 1B3AA 2KHSA 2HGSA 3DXJC 4H0LC 1LTLA 5D1PA 2VY3A 3HOYG 1X32A 3GTOA 3GTJA 4CJ0B 1UE6A 2WFWA 5J22A 3GTPA 1IW7D 1GKHA 4TQRA 2A5HA 4BY1G 4LUZA 3WNZA 3RTXA 1Y1VB 4R4TA 3GV8B 3PW7A 2ZM6H 3D6WA 5KFBA 2IX0A 1KDAA 1GO3E 1VMPA 5IODA 2B2WA 2N3SA 2IY5B 2B2WC 3J81c 4N8FA 4A3FH 1KDCA 3WDNA 3RAXA 5KFTA 2EXZA 2PQAA 4HJ5A 4JI7H 1J5EQ 3VYRA 1I6HB 3K5LA 5LMNW 1E2VA 1DIKA 4QQBX 4L5QA 1TS5A 3PO3H 2V9WA 1LT5D 2HQLA 3QZ7A 4CDDC 4IQZA 1L2FA 2RSOA 1MKHA 5KYIA 1TWFA 3KBGA 4DR4H 2NU9B 1B8AA 2N8NA 4P73A 5IP7H 2PMZE 2AUKA 3OSOA 3LP8A 2RHSB 2L12A 3GIJA 1EZ8A 1UAPA 3RZDB 4UY8C 4LF9H 2K1BA 4DR3L 4ECZA 1IYUA 3MTSA 5D3IB 2PPBC 4ME5A 4MNOA 4JI1L 4JI5L 4UP9A 1TXYA 1DONA 5LMNL 2VB3X 2F4VL 4A3DH 1B70B 1LACA 2EY6A 4P75A 3WOEA 4JI3H 2FLNA 1F2YA 4XYLB 1YHQA 2F3VA 1ZXTA 5IGBA 1NCVA 4LUOA 4R8UB 4H02A 3HOUG 4A3IH 2BE5D 2QILA 5FO7B 5BMVF 3PW0A 3TRZA 1YNXA 4ZKBB 2BCOA 3EIVA 1RL2A 4KV6A 1STEA 5IY0A 3A54A 3DEOA 4AYBB 1TWFH 3PUWA 3I70A 1IZ6A 4A3KG 2K32A 1VQ4A 2CWAA 2OLSA 2YW2A 4JI6H 2NTSA 3ETHA 1RODA 3H0GH 1I50B 4WJ4A 1S72A 1A8VA 3T56B 5C4ZA 1ASZA 2BQRA 3Q8PB 5FJ8H 4ME6A 3CMAA 3FKIG 2IBKA 1Q1BA 5KFXA 1HZCA 2JA6G 3MXNB 2B2TA 4OWWB 5E3FA 5IWAL 4IWYA 1HR0W 5GAHC 2E2IB 1JDBB 1E2ZA 4ZHQF 2N78A 1Z47A 4B3TL 3S17B 3HKSA 5G3LD 1E24A 3STBD 2MUYA 3V6HA 1ET6A 3GTLB 4BBSB 2DUDA 5KYLA 2R6GA 1U4MA 5LXTF 5KT6A 3OSPA 2XGQA 3D4RA 5AFWA 1NR2A 1N9WA 3A56A 2CHBD 3KUPA 4PZ7A 3GTMB 1KJJA 2D9UA 3HOVB 1SYGA 1E2WA 1VQGA 3A7AB 4ID6A 1KXLA 1HQMC 4RFBA 5ELEA 4HIDA 4X66Q 4O3NA 1UWVA 1GGOA 5C5JA 4NW2A 2L9HA 2G9DA 5CA0F 5LL6b 2W8KA 2AWNA 1MJCA 2RDJA 1KJQA 4EBEA 4NLGA 4ZUIA 4CKBA 4O3OA 1LT6D 1VQNA 1T94A 1WCMG 4JI1Q 4HCSA 1KAWA 2VZAA 1BGWA 3MA2B 1QB5D 3T4AC 4R7RA 4HSPA 5LMNQ 2F4VQ 5DGBA 4F4ZA 4LFAH 3PO2H 2XWBB 1VQBA 1IBKL 1RJPA 3JAMi 2ENBA 1WR2A 3PUVA 3J7YW 1I4XA 1V1OA 5AJ3Q 2VQFL 1VQOA 3KAKA 3VDYA 4YY3Q 5EKLA 5CB4F 1A9XA 2OTJA 3I73A 1M1KC 1CA6A 3I91A 4EFBA 4OWXB 1T5XD 3KFUA 4MZ9A 5EBDA 1L0YB 1V4YA 3EROA 1C4QA 1U0LA 1GVPA 4GOPB 3I4NH 2W6PA 1F9QA 3N6XA 4R1JA 4EQ5A 1Y1WG 1V1QA 3Q8DA 3VYUA 4DLKA 4LF6H 3S1MB 5C3WA 3T5HA 1PH1A 4P74A 1IL2A 1LYLA 3I8ZA 5C3XA 4LF4H 2L1BA 2LKVA 3I4MH 3V05A 1U4LA 4B3TQ 3WO0A 4CKCA 2UXCL 2EVBA 3J80c 2C35B 4LFCL 1YJWA 1VQEA 2Z8LA 3GTJB 1HNWL 1DOKA 1RJTA 4H7BA 1TA8A 1D8LA 5C4XG 2XNAC 1MSHA 2F0MA 2K5DA 1SNMA 1V1PA 2FLLA 3ERQA 4YR3A 3ITPA 4R8NA 5I6WA 3LX0A 4M7EA 1YVCA 1WTWA 4MA0A 2XGTA 4QWDA 3PR5B 2BDNA 1WVLA 4ECWA 4R9WA 4YAJB 2PW7A 1PDQA 4DR7Q 3M4PA 5M5XB 2EXDA 4I50F 2E2HH 1FKAH 2KCCA 2B3GA 2K75A 4NXNL 5FLXc 3L0OA 4GN4B 4A3DB 2GPWA 3I72A 5LMUL 3T53B 3UQ8A 3K80C 4IPHA 3H20A 3RF2A 2KEDA 1K83A 1EYDA 1A3TA 4C3HB 3L7ZC 1D5MC 4JBMA 3AMUA 4O4LF 4A3IB 2W6MA 5KFGA 1GUNA 4C3JH 2PQAB 1IBKQ 1Z6HA 4OL7A 4DR5Q 2NN6H 2WKCA 1CKOA 2MCTA 2VQFQ 3KHGA 2CFMA 3S14B 1F9PA 1P8LA 1TWFB 5EGTA 5C4HA 3V6KA 2DIKA 2PNHA 4OEMB 2FPGB 2I5HA 2GN5A 2FLPA 1B9NA 3M4OH 1UNNC 2ZTCA 3KHHA 1YHAA 4C3IB 1S5DD 1TWGH 2DY7A 3GV6A 4CDEC 3K5IA 4X62L 1KDBA 1M6VA 3OIPA 3MZ5A 1DM0B 3RR5A 1EU4A 2MQHA 1AH9A 3DHQA 1PH7A 1ZYRC 3J81i 4KD3A 5LOVF 1Q8KA 2DZDA 3VMMA 3RGZA 1SE8A 1S5ED 1IOVA 1X55A 3NGDA 4HJ9A 3CKIB 4L63B 3X3NA 2NTTA 1PFNA 1B6SA 5KFSA 5DNFA 1PH8A 4IUNA 5IOCA 1C3OA 1ESRA 3ER0A 1J8IA 1D1IA 4K5WA 2A6HD 4R4OA 4A93H 1K83H 2UXCQ 3HBLA 1QVGA 4UAIA 2VUMH 2AU0A 5C3EG 2AQ4A 4DL5A 4DUZL 4LFCQ 2OH2A 2E76C 1DGSA 5JEAH 4IUVA 4OO1G 1FL0A 2NYZD 1HNWQ 2R7NA 5KG3A 4HNTA 1H9JA 2XN9C 4KKTA 1UEAB 2Q2UA 1O75A 4OXPA 1E3PA 1HCZA 1BDOA 4IUQA 4CDCC 3Q1KA 2B8GA 5CV5A 2RDFA 2NVXH 3IG0A 4WRDA 1Q90A 2WB1B 1WYDA 1PXUA 2ZTEA 1NSNS 3M9BA 2K5WA 5ELNA 4B9WA 2Y0SA 5D1OB 3CC4A 2EJFC 1IBLQ 4O3QA 2OQ0A 4IJHA 2WV6D 2YTYA 1W3SA 1CZGA 1K8MA 4NXNQ 2YU9A 2Z4HA 3H4BA 2C9OA 3KF6B 3ULLA 2YCHA 2AKWB 3DUZA 5C44G 4P71A 3JAML 5IGEA 3NEMA 5KFQA 1T3NA 3VR6A 2RDHA 3GDEA 4JOIA 3CCSA 4HMJA 4K5XA 4UCOA 2R3ZA 4OX9H 3M9MB 3K5HA 2HVRA 5DQHA 2J7ZA 3BA8A 4LAAA 1N36H 3G8CA 5LA6F 1MZBA 1BCPC 3I4NB 5KFJA 4KTAA 5IYBH 5J2TF 3CAMA 1PA6A 4UCTA 4C2MA 4DV0H 3SE7A 4IRKA 4DR3H 1GHJA 2RCNA 5DLQE 3KK7A 1UUPA 1JB3A 2UXBQ 2NVYA 4JI5H 1HXYD 2NVQH 4IR1A 3Q23A 2CCZA 4IHJF 2AGPA 5KFRA 5KG7A 4RZQA 1IKMA 1Y8NB 4UHVA 1MJEA 1O80A 1VQ9A 3T1YH 1H9KA 3A5UA 4DV6H 4F4YA 3TZDA 4X64L 4BXXG 5FO9B 4IFDH 1SMXA 2L11A 3BJYA 3KLWA 2YS7A 2DPIA 1BKBA 3RN5A 3HKZG 1HNZL 3GIDA 5D65A 1VKZA 3OMCA 1JE4A 1EY9A 2I46A 4DUZQ 2JK8A 1LT4D 2UVUA 1ICFB 3ULPA 4ECUA 1IW7C 3UDFA 4IOCA 4A3EB 3MFIA 2F3WA 5GROA 5HGQA 2C2DA 1SNPA 4XYMB 1N32L 2KHJA 3GV5B 1WI5A 2JE6I 1RCVD 3M7NA 2QEJC 3VA5A 5IGFA 2JEBI 4KN4C 1CE8A 2E2JH 1IKLA 1B53A 1STYA 2AQ3B 4JI4L 5M3FB 2JEAI 4QWAA 4IURA 1ULZA 4GC6A 4J8QA 1BJTA 1V9PA 5FLMH 2K5VA 5IWAH 3RB4A 5EKIA 2MNAA 1EQQA 5CYUA 3E3XA 1GUWA 4C3JB 3HOWH 2ZDHA 3QG1A 4A3BH 2FK1A 3EJIA 1HRJA 3GIPA 3HP3A 2I80A 3GQCA 1LTBD 3CF5A 3KLSX 2PNRC 5J3BA 5ELCA 4QWEA 4YWKA 1LO5D 4EFEA 4HJAA 1EY7A 3MWDA 4A3MG 3FHWA 2PQEA 2KCTA 3A55A 1W2BA 1SNDA 2YZGA 1ET9A 4MN3A 3M4OB 1Y1VA 1JWSD 2R6FA 2R7ZH 2Z0SA 1TWGB 4YR0A 3VR4A 1BVSA 1VQAA 2AMCB 1KNEA 1RTOA 2EYLA 4UDUC 4GN3B 3I55A 2R8JA 1MD2D 4ED2A 2Z4IA 1I94Q 1HR0H 1K0SA 5JQWA 3BAAA 4S3SA 3T1HL 4GLXA 2R7KA 2FMAA 2KCNA 2VPSA 4DR1L 1EZ1A 4GKJH 1P16A 4Q8EA 4OONA 1B3QA 3LWUA 1RF2D 4FS2A 3DEPA 1XNQH 4PMCA 1FJGL 1UE1A 4A93B 3OHBA 1K83B 2PW5A 1LTRD 2VUMB 1LTSD 2K5QA 4X64Q 3KJPA 2JA7H 2BOSA 3G6JB 4EQNA 1VQ6A 1V51A 3TS2A 4M9UA 4ECTA 1HNZQ 2F0QA 2ASLA 2BE5C 3V96A 2ASJA 3VA7A 4KD4A 3CRKC 1RKNA 2EJGC 4HAEA 3SVMA 2CW8A 2XIGA 4JV2A 3FPPA 2WTFA 3HOYH 4PMBA 4ZQIA 4LH6A 4RUCA 4KK7A 1N32Q 1XTCD 4K8JA 4YJ2F 5LHY1 2B63H 2CH4W 1XPUA 3DWAA 4JI4Q 4BY1H 4U7CA 3KHLA 4RNMA 2W70A 2TMPA 4QIWB 4DAYB 3D31A 5EWGA 2JEGA 2K33A 3QB3A 5KFVA 3QO2A 5M5YH 4JVZA 2KOLA 2R7LA 2WINB 4O42A 3QOJA 2F0TA 4ODGA 3J7ZC 2R93A 4BBRH 4PG3A 3STBC 4XYQA 4XQJA 2K5NA 3R23A 5IGDA 1KIXA 1VMCA 3CQZH 2VQEH 1B44D 2XTIA 4UCSA 3H91A 1B50A 4RB3C 5HV6A 1EYAA 5JJZA 4FU0A 1WTRA 1TR5A 3TP5A 4L6TB 1W6KA 1RD9D 2NVTH 4YQWA 4GLVB 2HD3A 4DK3C 4HJ7A 3P7JA 2NVQB 4IWXA 2PZUA 4MV3A 2EE1A 4N9PA 4QWCA 2MFIA 3NSWA 2FPIB 4LF7H 4A3CG 4K0KL 2Y0SB 5LMUH 1XJVA 1XMQH 3MXNA 2IHEA 4YHHQ 4LFBH 1XMOH 3PIP3 4DR1Q 4DR2H 2E2IA 2V4DA 2L15A 1Q3LA 4JI0L 1FJGQ 2ATWA 5EZYF 5KG1A 1S68A 3GTLA 5LL6X 1GXDC 4A76A 1GHKA 1TY0A 5JPMC 3PIO3 2NN6I 3M7GA 1HQRD 4JC0A 3T51B 4A3GG 2KUMA 1EOVA 3H3VC 2BR0A 5KFWA 3GTMA 5KFDA 1MI2A 1SLJA 3E9HA 4BY7G 4FF2A 1SYBA 3CCMA 3JC66 3BA9A 4X62H 3HOUH 1TWAH 2FMMA 1RIPA 3R8BA 2GVAA 2O4XA 1X65A 3HGBA 1B6RA 5EKKA 4Q0YA 3RBDA 4A3BB 4BS9A 3TDQA 2ZJTA 4RZRA 2Z6BA 4A3KH 1SJHD 4APMA 1JXLA 3PSIA 3PCOB 2UUAQ 2IPKD 1VQFA 1J5EL 1AN7A 3F8TA 3D3RA 4UPAA 4DN4M 4QJFA 2L5TA 5DQGA 3RZOB 2F3IA 2UVVA 1QZGA 2JA6H 1UEBA 4HIOA 4GNXA
chains in the Genus database with same CATH topology
5IWAL 1HR0W 3H3VI 2HIXA 5GAHC 4OO1I 1OXUA 4YHHL 1Q82C 2N78A 1Z47A 3UE1A 1CKNB 5C0XG 4B3TL 3HKSA 3PUXA 2PI2E 2R7DA 5ELOA 4GOPA 1G291 1E24A 3I4OA 3STBD 5EAYA 5H1SE 1X3EA 1Q81C 4GOPC 2DUDA 1K8GA 3HKZE 3J80i 4L5TA 3CCVA 4KLKA 3S24A 2R6GA 1PYSB 3S1QH 5HY6A 1N9WA 1R9TH 4K0KQ 3RLNA 3UDIA 4PZ7A 1PVOA 4GN5A 3GTQH 2HHHQ 4JI6L 2CKZB 4KHZA 2ZM6Q 1VQGA 4A93G 1KXLA 1EYGA 1E22A 4HIDA 4X66Q 2VUMG 1UWVA 4JI0Q 1JJCB 2BA1A 2Z6KA 2PI2A 1OXTA 2WAQG 4JG2A 2AWNA 1MJCA 2R92H 1WFQA 2VQEQ 1NBWA 1OXSC 4PZ6A 1VQNA 5C4JH 1VQ7A 1WCMG 1CKMA 1WCMH 1X3FA 4JI1Q 1KAWA 5BR8L 2VZAA 4IO9A 2I0QA 4JI7Q 5LMNQ 2F4VQ 5JJLA 1A63A 3AYHB 3PO2G 3PO2H 1VQBA 1IBKL 1JJ2A 3RLFA 2LXJA 3JAMi 1PYBA 4O0AA 4QL5A 2JJQA 2Q2IA 2ZTDA 3PUVA 5AJ3Q 2UUAL 2VQFL 1VQOA 5M5WH 2JA5G 3PF5A 3VDYA 4YY3Q 4LF7Q 3EN2A 1PFSA 2I5LX 3B6YA 1M90C 2OTJA 3J81j 1K3RA 4DR4Q 5IYDG 1M1KC 5LMUQ 1E1TA 1SR3A 1YEZA 3A5ZB 4LFBQ 3K0XA 1VS0A 1XMOQ 4DR2Q 2YTXA 1BBWA 4OWXB 2OQKA 3KFUA 3TREA 4MZ9A 2RF4A 4RG1A 1BBUA 1U0LA 2ALYB 4LF9Q 1GVPA 4GOPB 3I4NG 3I4NH 1J6QA 4R1JA 4EQ5A 1Y1WG 2Q2HA 1Y1WH 1V1QA 1Z9FA 3Q8DA 4A3LG 1QUQB 1XTDA 4IFDI 4DKAC 1HJPA 2ID0A 4JI3Q 1OXVA 4LFAL 3CD6A 4YCUA 4LF8L 1PH1A 4P74A 1JB7A 1IL2A 4LF5L 1X54A 2JA9A 1LYLA 4A3GG 1C7YA 3A74A 1PV4A 3CCLA 2HHHL 3AQQA 2FXQA 2H5XA 2K5HA 3I4MG 3I4MH 1YHBA 4B3TQ 4X62Q 1VQ5A 2UXCL 4X66L 1JE5A 3J80c 3S2HH 1FVIA 1CUKA 4YCVA 2C35B 4LFCL 3UDXA 3CXCA 1YJWA 4RMFA 1VQEA 4A3JG 4A4IA 1HNWL 2Y0SG 2KCMA 3CCQA 2MO0A 1HH2P 1D8LA 2JA8G 5C4XH 5C4XG 4KHPL 3U4ZA 3W1GA 4JI8L 1VQDA 3S15H 2YU9H 3AEVA 4IFDG 4QGUA 4JI6Q 4JI7L 1MIUA 4HIKA 1PH4A 1YVCA 1YITA 2WB1E 2XGTA 3TEHB 3F2CA 1UE5A 3CCUA 5AJ3L 4DR7Q 3M4PA 2EXDA 4YY3L 2B29A 2BA0A 2E2HH 2B3GA 2K75A 4NXNL 5FLXc 2AHOB 3L0OA 4GN4B 4JBKA 2YYZA 5LMUL 4POFA 1KRSA 3K80C 4LF4L 4IPHA 2UUBL 3NBHB 5BR8Q 3OTOL 4DR6L 3JAMc 3I7FA 3L7ZC 4JBMA 3CC7A 4C3JH 1SN8A 2PQAB 3OW2A 1IBKQ 4C2MH 4LNQA 4JYAL 2NN6G 4IJLA 5JEAJ 4DR5Q 4BA1I 1CKOA 1NE3A 2VQFQ 2CFMA 3L2PA 1EUJA 1YZ6A 1JJGA 2Q2TA 5IP9G 3PF4A 2NVYH 1P8LA 5M3MG 5M3MH 4A3BG 3KDFB 2K52A 2PNHA 4TQUS 3H15A 2MO1A 4AYBG 3FKIH 3KF6A 2I5HA 4POGA 2GN5A 1C0AA 2D62A 3M4OH 3S1RH 4GNXC 2KENA 2ZTCA 1YHAA 3GTKH 1TWGH 4JI2L 4X62L 3U58A 1XMQL 3CC2A 4LW1A 3RR5A 2MQHA 3RZOH 1AH9A 1PH7A 1EIYB 4HJ8A 3J81i 3S1NH 4IOAA 2VL6A 1Q8KA 3CCRA 1EIFA 1IYJB 1YJ9A 1SE8A 2N49A 4DK6C 1X55A 2E8GA 4HJ9A 4LFAQ 1VQPA 3IRBA 1GM5A 3F2BA 4LF8Q 1WOCA 2UU9Q 4LF5Q 3DLLA 4DV5L 1PH8A 2E5LL 5GQOA 4IPGA 3ER0A 2Y0SE 4JV5L 3G71A 4R4OA 4A93H 4BBSG 1K83H 4MTNA 3G4SA 1VQKA 3NENA 1QVGA 2VUMH 4BBSH 2UXCQ 1NMFA 5C3EG 5C3EH 2VS1A 4DUZL 4LFCQ 4DR7L 5GADC 1DGSA 2BH2A 3H3VH 2A19A 2UXDL 2Z6KC 5JEAG 4OO1G 1HNWQ 1X6OA 1FL0A 1S40A 3HOVG 2CQOA 3HOVH 1HZBA 2Q2UA 2UUCQ 4KHPQ 4OXPA 2ES2A 1E3PA 2V1CC 3CP0A 4JI8Q 4ALPA 1PH3A 3PGZA 1L1OA 2LSSA 4GKKL 2NVXH 1KRTA 1CSPA 1WYDA 2ZTEA 4PZ8A 1VQHA 3M9BA 5ELNA 4DV7Q 4DR5L 4DPGA 4LF6Q 2KHIA 3CC4A 1IBLQ 4X65L 2OQ0A 1ASYA 1K8AC 4IJHA 2JA5H 2YTYA 1W3SA 1PH6A 2ZJRA 3GTGH 1H95A 4NXNQ 5IT9c 3WWVA 4Y7NH 5IYDH 1JT8A 4R4IA 3KF6B 1CSQA 3ULLA 4GNXB 3ZJYC 4LF4Q 4IFDJ 2UUBQ 2AKWB 1I5FA 1Y1VH 1V43A 1TWCH 1Y1VG 3OTOQ 5C44G 1KC8C 4P71A 1NJIC 2JA6G 4DR6Q 2HT1A 3AFQA 3TQYA 3NEMA 2B63G 2IHFA 3GDEA 4JOIA 4AH6A 3CCSA 1SRUA 4JYAQ 4YWMA 4A3GH 3KOJA 3M3YH 4AYBE 3ERSX 3W5OA 1Q12A 4HIMA 4OWTB 1HZ9A 5IYBG 4EX5A 1LUZA 5IYBH 4DV1L 3CAMA 1PA6A 3S16H 2UU9L 4KI0A 4BBRG 4B3ML 1T9HA 1KL9A 2GVBA 1AE2A 3G48A 2RCNA 1I6HH 5DLQE 4JI2Q 2JQOA 4AQYL 2IT1A 1XMQQ 2UXBQ 1N34L 2IX1A 3HOZG 2NVQH 3S1MH 3HOZH 5JJKA 3CPWA 1JMCA 2CCZA 3SGIA 2ASBA 3I56A 4PMWA 3EBEA 4UP8A 4A3JH 1MJEA 5IE8A 1VQ9A 3A5UA 2JA8H 2UUCL 1PHJA 1Q46A 1HNXL 4GLAC 1XNRL 4X64L 4BXXG 4DV5Q 4OX9L 2E5LQ 2WAQE 2VNUD 1SMXA 2DGYA 3KLWA 3GTOH 1EWIA 3RZDH 4JV5Q 1BKBA 3M4QA 3RN5A 1KD1C 1IXRA 5IP7G 3HKZG 4TVAB 3GTJH 4DV7L 3T1HQ 1HNZL 2I5MX 1N36L 4LF6L 1VCIA 4DUZQ 4AIMA 1IBLL 2JK8A 1EFWA 3GTPH 2UXDQ 1E7ZA 2K4KA 1XPRA 3ULPA 1FGUA 4J15A 1CKNA 3UDFA 4DV0L 4R4QA 1Q1EA 4IOCA 1YJNA 5GROA 5HGQA 4ME3A 4OWWB 3S2DH 3K7AH 3F1ZA 1N32L 2KHJA 1AE3A 3RLOA 1IBMQ 4B3SQ 4GKKQ 1WI5A 2JE6I 4A75A 3M7NA 2JEBI 5M5XH 3K8AA 2E2JH 1X56A 3D0FA 4DV1Q 4L5RC 4A3DG 4JI4L 2R93G 2JEAI 2R93H 1HZAA 4X65Q 5FLMG 1V9PA 5FLMH 2K5VA 4QIWE 3T1YL 4DV6L 3E9IA 1N8RC 2MNAA 4C3HH 1EQQA 3HFZB 5IP9H 3HOWG 3HOWH 3U50C 3RNUA 4A3BH 3PIPA 4A3IG 1A62A 1TWHH 3CF5A 4NB3A 3ICEA 4JBWA 5C0XI 5J3BA 4JBJA 3HOXG 3HOXH 4YWKA 1C9OA 2RHQB 2CWPA 1I50H 2K50A 4DNIA 4HJAA 3BJUA 1Q7YC 4A3MG 3S14H 4A3MH 3FHWA 5JJIA 1W2BA 2KCTA 2UXBL 3PIOA 5GAEC 3W1BA 2ZJQA 2R7ZH 2R7ZG 4B3RL 2Z0SA 1BVSA 1VQAA 1QVCA 2AMCB 4JCVE 4P72A 3BZCA 4R4CA 4XTCS 3CCEA 4C3IH 2E2IH 1N33L 4GN3B 3I55A 1SROA 3S17H 4B3MQ 1I94Q 4BA2I 1VQJA 2ZJPA 3PUZA 4AQYQ 4L5SA 4DUYQ 1YI2A 1KQSA 3GTLH 1N34Q 3T1HL 5IYCG 3M85A 3ULJA 3A0JA 5IYCH 4GLXA 4DR1L 1P16A 4OONA 4DAMA 1PH5A 4WJ3M 2YTVA 2YV5A 2QEXA 1FJGL 1UE1A 2BH8A 3GTMH 3RN2A 4IPDA 1HNXQ 1QUQA 1XNRQ 4YWLA 3DM3A 4X64Q 3CCJA 2K14A 1X9NA 3KJPA 4OX9Q 2JA7G 2JA7H 3PUYA 1SFOH 4B3SL 1K9MC 1IBML 1EQRA 1L1OC 5K36G 1VQ6A 3TS2A 1D7QA 1I3QH 2JA6H 3E0EA 4DV4L 1HNZQ 4QY7A 2F52A 1N36Q 3LGJA 1YIJA 1UE7A 4UP7A 4DV0Q 1LTLA 3BU2A 2R92G 2VY3A 3HOYG 3K81C 3HOYH 4DR3Q 1HR0L 2WB1G 2QGQA 1N32Q 5C44H 1VQ8A 4JI5Q 1UE6A 2OTLA 2NZOA 2WFWA 2EIFA 1PH9A 2B63H 1XPUA 4YCWA 4GKJL 1GKHA 4NXMQ 4BY1G 4JOIC 4BY1H 4LUZA 4JI4Q 1XNQL 2OCEA 1E1OA 4O2DA 3T1YQ 1K73C 4DAYB 4R4TA 3D31A 4DV6Q 3UDGA 1Q86C 5M5YH 2IX0A 3U4VA 1GD7A 3UE0A 1GO3E 4IPCA 3J7ZC 4BBRH 4PG3A 3STBC 1VQIA 1I94L 2K5NA 2N3SA 1KIXA 2IY5B 4Y52H 3KYHC 1B7YB 2D0OA 3CQZH 4DV2Q 2XTIA 3J81c 1NTGA 4DUYL 4A3FG 4A3FH 1U5KA 2VW9A 1L0WA 1KHIA 1K0RA 2PQAA 4HJ5A 1J5EQ 4DV3Q 4B3RQ 1O7IA 2NVTH 5LMNW 4GLVB 4QQBX 4L5QA 4DK3C 4HJ7A 1L1OB 1N33Q 3PO3G 3PO3H 1LM0A 3KF8B 4APVA 2HQLA 2LXKA 4BXXH 1L2FA 2MFIA 1MKHA 3KDFA 4A3CG 4A3CH 1VQLA 4K0KL 1G6PA 1XPOA 5IWAQ 1B8AA 1XJVA 2N8NA 1QZHA 4P73A 5IP7H 2PMZE 2IHEA 2ZM6L 1A0IA 1X3GA 4FDBA 4YHHQ 2KBNA 4DR1Q 3TS0A 2NZHA 1J5EL 3NELA 2RHSB 2L15A 3CMEA 4JI0L 4NPSA 1FJGQ 2ATWA 4UY8C 3AFPA 4XIGS 1PH2A 4DR3L 3CW2C 4LUVA 2VQEL 3FP9A 1Y14B 4A76A 4MNOA 4JI1L 4JI5L 2NN6I 1VQMA 1QVFA 2OWOA 3PV0A 4JC0A 4UP9A 5C0XJ 2EQSA 1TXYA 1G51A 3GO5A 1EOVA 5LMNL 4DV4Q 4NXML 1B70B 4P75A 2F4VL 3KJOA 3G6EA 2A8VA 4A3DH 4A3EG 4A3EH 1NY4A 5E7NA 1SLJA 3E9HA 2QA4A 2WP8J 1YHQA 4BY7G 4BY7H 3CCMA 4LUOA 3JC66 4LF7L 3J7A5 4H02A 1HR0Q 3HOUG 3HOUH 4A3IH 1TWAH 4DR4L 1RIPA 3TRZA 2A1AA 2GVAA 2HIVA 1VQCA 1X65A 1YNXA 3GD7A 5M3FH 5M3FG 4LFBL 1XMOL 3BZKA 1S3OA 3EIVA 3CPFA 4DR2L 1OTCA 4GKJQ 4DV2L 1RL2A 1XNQQ 4X6AH 3MEFA 5IY0A 4A3KG 1TWFH 3OYYA 3PUWA 1IZ6A 4A3KH 1VQ4A 4LF9L 3PSIA 3PCOB 2CWAA 2UUAQ 2D0PA 1VQFA 1YBYA 3H0GG 3H0GH 3I2ZA 3F8TA 4GS3A 2R7FA 1WJJA 3K7UC 4DV3L 1S72A 4A3LH 4WJ4A 4LWCA 1A8VA 1OXXK 4UPAA 1ASZA 2AWOA 4QJFA 5FJ8G 5FJ8H 1NMGA 4JI3L 3F2DA 3CMAA 2F3IA 3FKIG 1QZGA 1Q1BA 1HZCA 3MXNB 1UEBA 5GAGC 4HIOA 4GNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA L;  1HR0 W;  3H3V I;  2HIX A;  5GAH C;  4OO1 I;  1OXU A;  4YHH L;  1Q82 C;  2N78 A;  1Z47 A;  3UE1 A;  1CKN B;  5C0X G;  4B3T L;  3HKS A;  3PUX A;  2PI2 E;  2R7D A;  5ELO A;  4GOP A;  1G29 1;  1E24 A;  3I4O A;  3STB D;  5EAY A;  5H1S E;  1X3E A;  1Q81 C;  4GOP C;  2DUD A;  1K8G A;  3HKZ E;  3J80 i;  4L5T A;  3CCV A;  4KLK A;  3S24 A;  2R6G A;  1PYS B;  3S1Q H;  5HY6 A;  1N9W A;  1R9T H;  4K0K Q;  3RLN A;  3UDI A;  4PZ7 A;  1PVO A;  4GN5 A;  3GTQ H;  2HHH Q;  4JI6 L;  2CKZ B;  4KHZ A;  2ZM6 Q;  1VQG A;  4A93 G;  1KXL A;  1EYG A;  1E22 A;  4HID A;  4X66 Q;  2VUM G;  1UWV A;  4JI0 Q;  1JJC B;  2BA1 A;  2Z6K A;  2PI2 A;  1OXT A;  2WAQ G;  4JG2 A;  2AWN A;  1MJC A;  2R92 H;  1WFQ A;  2VQE Q;  1NBW A;  1OXS C;  4PZ6 A;  1VQN A;  5C4J H;  1VQ7 A;  1WCM G;  1CKM A;  1WCM H;  1X3F A;  4JI1 Q;  1KAW A;  5BR8 L;  2VZA A;  4IO9 A;  2I0Q A;  4JI7 Q;  5LMN Q;  2F4V Q;  5JJL A;  1A63 A;  3AYH B;  3PO2 G;  3PO2 H;  1VQB A;  1IBK L;  1JJ2 A;  3RLF A;  2LXJ A;  3JAM i;  1PYB A;  4O0A A;  4QL5 A;  2JJQ A;  2Q2I A;  2ZTD A;  3PUV A;  5AJ3 Q;  2UUA L;  2VQF L;  1VQO A;  5M5W H;  2JA5 G;  3PF5 A;  3VDY A;  4YY3 Q;  4LF7 Q;  3EN2 A;  1PFS A;  2I5L X;  3B6Y A;  1M90 C;  2OTJ A;  3J81 j;  1K3R A;  4DR4 Q;  5IYD G;  1M1K C;  5LMU Q;  1E1T A;  1SR3 A;  1YEZ A;  3A5Z B;  4LFB Q;  3K0X A;  1VS0 A;  1XMO Q;  4DR2 Q;  2YTX A;  1BBW A;  4OWX B;  2OQK A;  3KFU A;  3TRE A;  4MZ9 A;  2RF4 A;  4RG1 A;  1BBU A;  1U0L A;  2ALY B;  4LF9 Q;  1GVP A;  4GOP B;  3I4N G;  3I4N H;  1J6Q A;  4R1J A;  4EQ5 A;  1Y1W G;  2Q2H A;  1Y1W H;  1V1Q A;  1Z9F A;  3Q8D A;  4A3L G;  1QUQ B;  1XTD A;  4IFD I;  4DKA C;  1HJP A;  2ID0 A;  4JI3 Q;  1OXV A;  4LFA L;  3CD6 A;  4YCU A;  4LF8 L;  1PH1 A;  4P74 A;  1JB7 A;  1IL2 A;  4LF5 L;  1X54 A;  2JA9 A;  1LYL A;  4A3G G;  1C7Y A;  3A74 A;  1PV4 A;  3CCL A;  2HHH L;  3AQQ A;  2FXQ A;  2H5X A;  2K5H A;  3I4M G;  3I4M H;  1YHB A;  4B3T Q;  4X62 Q;  1VQ5 A;  2UXC L;  4X66 L;  1JE5 A;  3J80 c;  3S2H H;  1FVI A;  1CUK A;  4YCV A;  2C35 B;  4LFC L;  3UDX A;  3CXC A;  1YJW A;  4RMF A;  1VQE A;  4A3J G;  4A4I A;  1HNW L;  2Y0S G;  2KCM A;  3CCQ A;  2MO0 A;  1HH2 P;  1D8L A;  2JA8 G;  5C4X H;  5C4X G;  4KHP L;  3U4Z A;  3W1G A;  4JI8 L;  1VQD A;  3S15 H;  2YU9 H;  3AEV A;  4IFD G;  4QGU A;  4JI6 Q;  4JI7 L;  1MIU A;  4HIK A;  1PH4 A;  1YVC A;  1YIT A;  2WB1 E;  2XGT A;  3TEH B;  3F2C A;  1UE5 A;  3CCU A;  5AJ3 L;  4DR7 Q;  3M4P A;  2EXD A;  4YY3 L;  2B29 A;  2BA0 A;  2E2H H;  2B3G A;  2K75 A;  4NXN L;  5FLX c;  2AHO B;  3L0O A;  4GN4 B;  4JBK A;  2YYZ A;  5LMU L;  4POF A;  1KRS A;  3K80 C;  4LF4 L;  4IPH A;  2UUB L;  3NBH B;  5BR8 Q;  3OTO L;  4DR6 L;  3JAM c;  3I7F A;  3L7Z C;  4JBM A;  3CC7 A;  4C3J H;  1SN8 A;  2PQA B;  3OW2 A;  1IBK Q;  4C2M H;  4LNQ A;  4JYA L;  2NN6 G;  4IJL A;  5JEA J;  4DR5 Q;  4BA1 I;  1CKO A;  1NE3 A;  2VQF Q;  2CFM A;  3L2P A;  1EUJ A;  1YZ6 A;  1JJG A;  2Q2T A;  5IP9 G;  3PF4 A;  2NVY H;  1P8L A;  5M3M G;  5M3M H;  4A3B G;  3KDF B;  2K52 A;  2PNH A;  4TQU S;  3H15 A;  2MO1 A;  4AYB G;  3FKI H;  3KF6 A;  2I5H A;  4POG A;  2GN5 A;  1C0A A;  2D62 A;  3M4O H;  3S1R H;  4GNX C;  2KEN A;  2ZTC A;  1YHA A;  3GTK H;  1TWG H;  4JI2 L;  4X62 L;  3U58 A;  1XMQ L;  3CC2 A;  4LW1 A;  3RR5 A;  2MQH A;  3RZO H;  1AH9 A;  1PH7 A;  1EIY B;  4HJ8 A;  3J81 i;  3S1N H;  4IOA A;  2VL6 A;  1Q8K A;  3CCR A;  1EIF A;  1IYJ B;  1YJ9 A;  1SE8 A;  2N49 A;  4DK6 C;  1X55 A;  2E8G A;  4HJ9 A;  4LFA Q;  1VQP A;  3IRB A;  1GM5 A;  3F2B A;  4LF8 Q;  1WOC A;  2UU9 Q;  4LF5 Q;  3DLL A;  4DV5 L;  1PH8 A;  2E5L L;  5GQO A;  4IPG A;  3ER0 A;  2Y0S E;  4JV5 L;  3G71 A;  4R4O A;  4A93 H;  4BBS G;  1K83 H;  4MTN A;  3G4S A;  1VQK A;  3NEN A;  1QVG A;  2VUM H;  4BBS H;  2UXC Q;  1NMF A;  5C3E G;  5C3E H;  2VS1 A;  4DUZ L;  4LFC Q;  4DR7 L;  5GAD C;  1DGS A;  2BH2 A;  3H3V H;  2A19 A;  2UXD L;  2Z6K C;  5JEA G;  4OO1 G;  1HNW Q;  1X6O A;  1FL0 A;  1S40 A;  3HOV G;  2CQO A;  3HOV H;  1HZB A;  2Q2U A;  2UUC Q;  4KHP Q;  4OXP A;  2ES2 A;  1E3P A;  2V1C C;  3CP0 A;  4JI8 Q;  4ALP A;  1PH3 A;  3PGZ A;  1L1O A;  2LSS A;  4GKK L;  2NVX H;  1KRT A;  1CSP A;  1WYD A;  2ZTE A;  4PZ8 A;  1VQH A;  3M9B A;  5ELN A;  4DV7 Q;  4DR5 L;  4DPG A;  4LF6 Q;  2KHI A;  3CC4 A;  1IBL Q;  4X65 L;  2OQ0 A;  1ASY A;  1K8A C;  4IJH A;  2JA5 H;  2YTY A;  1W3S A;  1PH6 A;  2ZJR A;  3GTG H;  1H95 A;  4NXN Q;  5IT9 c;  3WWV A;  4Y7N H;  5IYD H;  1JT8 A;  4R4I A;  3KF6 B;  1CSQ A;  3ULL A;  4GNX B;  3ZJY C;  4LF4 Q;  4IFD J;  2UUB Q;  2AKW B;  1I5F A;  1Y1V H;  1V43 A;  1TWC H;  1Y1V G;  3OTO Q;  5C44 G;  1KC8 C;  4P71 A;  1NJI C;  2JA6 G;  4DR6 Q;  2HT1 A;  3AFQ A;  3TQY A;  3NEM A;  2B63 G;  2IHF A;  3GDE A;  4JOI A;  4AH6 A;  3CCS A;  1SRU A;  4JYA Q;  4YWM A;  4A3G H;  3KOJ A;  3M3Y H;  4AYB E;  3ERS X;  3W5O A;  1Q12 A;  4HIM A;  4OWT B;  1HZ9 A;  5IYB G;  4EX5 A;  1LUZ A;  5IYB H;  4DV1 L;  3CAM A;  1PA6 A;  3S16 H;  2UU9 L;  4KI0 A;  4BBR G;  4B3M L;  1T9H A;  1KL9 A;  2GVB A;  1AE2 A;  3G48 A;  2RCN A;  1I6H H;  5DLQ E;  4JI2 Q;  2JQO A;  4AQY L;  2IT1 A;  1XMQ Q;  2UXB Q;  1N34 L;  2IX1 A;  3HOZ G;  2NVQ H;  3S1M H;  3HOZ H;  5JJK A;  3CPW A;  1JMC A;  2CCZ A;  3SGI A;  2ASB A;  3I56 A;  4PMW A;  3EBE A;  4UP8 A;  4A3J H;  1MJE A;  5IE8 A;  1VQ9 A;  3A5U A;  2JA8 H;  2UUC L;  1PHJ A;  1Q46 A;  1HNX L;  4GLA C;  1XNR L;  4X64 L;  4BXX G;  4DV5 Q;  4OX9 L;  2E5L Q;  2WAQ E;  2VNU D;  1SMX A;  2DGY A;  3KLW A;  3GTO H;  1EWI A;  3RZD H;  4JV5 Q;  1BKB A;  3M4Q A;  3RN5 A;  1KD1 C;  1IXR A;  5IP7 G;  3HKZ G;  4TVA B;  3GTJ H;  4DV7 L;  3T1H Q;  1HNZ L;  2I5M X;  1N36 L;  4LF6 L;  1VCI A;  4DUZ Q;  4AIM A;  1IBL L;  2JK8 A;  1EFW A;  3GTP H;  2UXD Q;  1E7Z A;  2K4K A;  1XPR A;  3ULP A;  1FGU A;  4J15 A;  1CKN A;  3UDF A;  4DV0 L;  4R4Q A;  1Q1E A;  4IOC A;  1YJN A;  5GRO A;  5HGQ A;  4ME3 A;  4OWW B;  3S2D H;  3K7A H;  3F1Z A;  1N32 L;  2KHJ A;  1AE3 A;  3RLO A;  1IBM Q;  4B3S Q;  4GKK Q;  1WI5 A;  2JE6 I;  4A75 A;  3M7N A;  2JEB I;  5M5X H;  3K8A A;  2E2J H;  1X56 A;  3D0F A;  4DV1 Q;  4L5R C;  4A3D G;  4JI4 L;  2R93 G;  2JEA I;  2R93 H;  1HZA A;  4X65 Q;  5FLM G;  1V9P A;  5FLM H;  2K5V A;  4QIW E;  3T1Y L;  4DV6 L;  3E9I A;  1N8R C;  2MNA A;  4C3H H;  1EQQ A;  3HFZ B;  5IP9 H;  3HOW G;  3HOW H;  3U50 C;  3RNU A;  4A3B H;  3PIP A;  4A3I G;  1A62 A;  1TWH H;  3CF5 A;  4NB3 A;  3ICE A;  4JBW A;  5C0X I;  5J3B A;  4JBJ A;  3HOX G;  3HOX H;  4YWK A;  1C9O A;  2RHQ B;  2CWP A;  1I50 H;  2K50 A;  4DNI A;  4HJA A;  3BJU A;  1Q7Y C;  4A3M G;  3S14 H;  4A3M H;  3FHW A;  5JJI A;  1W2B A;  2KCT A;  2UXB L;  3PIO A;  5GAE C;  3W1B A;  2ZJQ A;  2R7Z H;  2R7Z G;  4B3R L;  2Z0S A;  1BVS A;  1VQA A;  1QVC A;  2AMC B;  4JCV E;  4P72 A;  3BZC A;  4R4C A;  4XTC S;  3CCE A;  4C3I H;  2E2I H;  1N33 L;  4GN3 B;  3I55 A;  1SRO A;  3S17 H;  4B3M Q;  1I94 Q;  4BA2 I;  1VQJ A;  2ZJP A;  3PUZ A;  4AQY Q;  4L5S A;  4DUY Q;  1YI2 A;  1KQS A;  3GTL H;  1N34 Q;  3T1H L;  5IYC G;  3M85 A;  3ULJ A;  3A0J A;  5IYC H;  4GLX A;  4DR1 L;  1P16 A;  4OON A;  4DAM A;  1PH5 A;  4WJ3 M;  2YTV A;  2YV5 A;  2QEX A;  1FJG L;  1UE1 A;  2BH8 A;  3GTM H;  3RN2 A;  4IPD A;  1HNX Q;  1QUQ A;  1XNR Q;  4YWL A;  3DM3 A;  4X64 Q;  3CCJ A;  2K14 A;  1X9N A;  3KJP A;  4OX9 Q;  2JA7 G;  2JA7 H;  3PUY A;  1SFO H;  4B3S L;  1K9M C;  1IBM L;  1EQR A;  1L1O C;  5K36 G;  1VQ6 A;  3TS2 A;  1D7Q A;  1I3Q H;  2JA6 H;  3E0E A;  4DV4 L;  1HNZ Q;  4QY7 A;  2F52 A;  1N36 Q;  3LGJ A;  1YIJ A;  1UE7 A;  4UP7 A;  4DV0 Q;  1LTL A;  3BU2 A;  2R92 G;  2VY3 A;  3HOY G;  3K81 C;  3HOY H;  4DR3 Q;  1HR0 L;  2WB1 G;  2QGQ A;  1N32 Q;  5C44 H;  1VQ8 A;  4JI5 Q;  1UE6 A;  2OTL A;  2NZO A;  2WFW A;  2EIF A;  1PH9 A;  2B63 H;  1XPU A;  4YCW A;  4GKJ L;  1GKH A;  4NXM Q;  4BY1 G;  4JOI C;  4BY1 H;  4LUZ A;  4JI4 Q;  1XNQ L;  2OCE A;  1E1O A;  4O2D A;  3T1Y Q;  1K73 C;  4DAY B;  4R4T A;  3D31 A;  4DV6 Q;  3UDG A;  1Q86 C;  5M5Y H;  2IX0 A;  3U4V A;  1GD7 A;  3UE0 A;  1GO3 E;  4IPC A;  3J7Z C;  4BBR H;  4PG3 A;  3STB C;  1VQI A;  1I94 L;  2K5N A;  2N3S A;  1KIX A;  2IY5 B;  4Y52 H;  3KYH C;  1B7Y B;  2D0O A;  3CQZ H;  4DV2 Q;  2XTI A;  3J81 c;  1NTG A;  4DUY L;  4A3F G;  4A3F H;  1U5K A;  2VW9 A;  1L0W A;  1KHI A;  1K0R A;  2PQA A;  4HJ5 A;  1J5E Q;  4DV3 Q;  4B3R Q;  1O7I A;  2NVT H;  5LMN W;  4GLV B;  4QQB X;  4L5Q A;  4DK3 C;  4HJ7 A;  1L1O B;  1N33 Q;  3PO3 G;  3PO3 H;  1LM0 A;  3KF8 B;  4APV A;  2HQL A;  2LXK A;  4BXX H;  1L2F A;  2MFI A;  1MKH A;  3KDF A;  4A3C G;  4A3C H;  1VQL A;  4K0K L;  1G6P A;  1XPO A;  5IWA Q;  1B8A A;  1XJV A;  2N8N A;  1QZH A;  4P73 A;  5IP7 H;  2PMZ E;  2IHE A;  2ZM6 L;  1A0I A;  1X3G A;  4FDB A;  4YHH Q;  2KBN A;  4DR1 Q;  3TS0 A;  2NZH A;  1J5E L;  3NEL A;  2RHS B;  2L15 A;  3CME A;  4JI0 L;  4NPS A;  1FJG Q;  2ATW A;  4UY8 C;  3AFP A;  4XIG S;  1PH2 A;  4DR3 L;  3CW2 C;  4LUV A;  2VQE L;  3FP9 A;  1Y14 B;  4A76 A;  4MNO A;  4JI1 L;  4JI5 L;  2NN6 I;  1VQM A;  1QVF A;  2OWO A;  3PV0 A;  4JC0 A;  4UP9 A;  5C0X J;  2EQS A;  1TXY A;  1G51 A;  3GO5 A;  1EOV A;  5LMN L;  4DV4 Q;  4NXM L;  1B70 B;  4P75 A;  2F4V L;  3KJO A;  3G6E A;  2A8V A;  4A3D H;  4A3E G;  4A3E H;  1NY4 A;  5E7N A;  1SLJ A;  3E9H A;  2QA4 A;  2WP8 J;  1YHQ A;  4BY7 G;  4BY7 H;  3CCM A;  4LUO A;  3JC6 6;  4LF7 L;  3J7A 5;  4H02 A;  1HR0 Q;  3HOU G;  3HOU H;  4A3I H;  1TWA H;  4DR4 L;  1RIP A;  3TRZ A;  2A1A A;  2GVA A;  2HIV A;  1VQC A;  1X65 A;  1YNX A;  3GD7 A;  5M3F H;  5M3F G;  4LFB L;  1XMO L;  3BZK A;  1S3O A;  3EIV A;  3CPF A;  4DR2 L;  1OTC A;  4GKJ Q;  4DV2 L;  1RL2 A;  1XNQ Q;  4X6A H;  3MEF A;  5IY0 A;  4A3K G;  1TWF H;  3OYY A;  3PUW A;  1IZ6 A;  4A3K H;  1VQ4 A;  4LF9 L;  3PSI A;  3PCO B;  2CWA A;  2UUA Q;  2D0P A;  1VQF A;  1YBY A;  3H0G G;  3H0G H;  3I2Z A;  3F8T A;  4GS3 A;  2R7F A;  1WJJ A;  3K7U C;  4DV3 L;  1S72 A;  4A3L H;  4WJ4 A;  4LWC A;  1A8V A;  1OXX K;  4UPA A;  1ASZ A;  2AWO A;  4QJF A;  5FJ8 G;  5FJ8 H;  1NMG A;  4JI3 L;  3F2D A;  3CMA A;  2F3I A;  3FKI G;  1QZG A;  1Q1B A;  1HZC A;  3MXN B;  1UEB A;  5GAG C;  4HIO A;  4GNX A; 
#chains in the Genus database with same CATH topology
 2HIX A;  1KTK A;  1EWH A;  1GUO A;  1OXU A;  4O2A F;  3RMH A;  5BR8 H;  3UE1 A;  4XX0 B;  3OMG A;  2PI2 E;  2R7D A;  2EPB A;  2A73 B;  3PUX A;  1A3V A;  5ELO A;  4GOP A;  1C48 A;  5L1J A;  3K57 A;  5T1I A;  4GOP C;  1EEF D;  5GON F;  1ENA A;  5KKN B;  4L5T A;  3CCV A;  3S24 A;  3O13 A;  2O5I C;  1PYS B;  3NTI A;  1EL0 A;  5EWE A;  4P2C B;  5HY6 A;  4K0K Q;  5K36 H;  3UDI A;  3GTQ H;  1WTQ A;  2HHH Q;  2B2U A;  2CKZ B;  2PMZ B;  1Z2N X;  4KHZ A;  2B2U C;  1Y69 U;  3BQ0 A;  2JA7 B;  4JI0 Q;  2E75 C;  2V4Q A;  1RTN A;  2Z6K A;  2WAQ G;  2R92 H;  3J7A V;  2F0I A;  1FGB D;  1OXS C;  1BQQ T;  3OUU A;  4X3U A;  1VQ7 A;  4IZO A;  1CKM A;  1WCM H;  3FMC A;  3MVV A;  1Y8P B;  4ZOL F;  2A69 D;  2AGO A;  2XCA A;  2VXW A;  2KA7 A;  3AYH B;  4UCU A;  1E0B A;  1LTG D;  1TS2 A;  4LF5 H;  3RLF A;  2LXJ A;  3BVZ A;  2K05 A;  1PYB A;  1NR4 A;  3RV3 A;  1S03 G;  1EWC A;  2Q2I A;  2ZTD A;  2B63 B;  4KY5 A;  2F0G A;  3EN2 A;  4K8I A;  1M90 C;  4BY1 B;  3J81 j;  2SDF A;  5IYD G;  4DA2 A;  1E1T A;  4RB1 A;  3HG9 A;  1YEZ A;  1RHP A;  3A5Z B;  3K0X A;  1VS0 A;  3L4J A;  2J9G A;  1BBW A;  5M5Y B;  4KHP H;  4IR9 A;  2ALY B;  1T5E A;  3CU7 A;  4BBR B;  4EQO A;  3RIZ A;  1X3P A;  3L9A X;  1Y1W H;  1Z9F A;  3CQZ B;  5EPL A;  3N44 B;  1XTD A;  1AUV A;  1AP0 A;  4IFD I;  1ZQ7 A;  4LK1 C;  2W6Q A;  1SEI A;  2KEE A;  2A6H C;  3HOZ B;  5ELF A;  5I9P A;  4Q5V A;  1KAA A;  1OXV A;  4LF8 L;  4RGN A;  3BDC A;  1SE3 A;  2F03 A;  1PV4 A;  3H0G A;  3QIA A;  4FP5 D;  3OTO H;  1YHB A;  5KG2 A;  4QCL A;  4X66 L;  1TY2 A;  4LSA A;  5EPJ A;  1CUK A;  4RMF A;  4RKL A;  4TV9 F;  1DOM A;  1HH2 P;  4RCO A;  5C4X H;  1A3U A;  3SEB A;  3LNN A;  4YJ3 F;  3U4Z A;  3W1G A;  4JI8 L;  5D3D A;  4JUZ A;  1EFI D;  1JOO A;  2EOT A;  4QF4 A;  5IIF A;  4QGU A;  5HUR A;  2WII B;  1YIT A;  3K7A B;  5KNC A;  1C30 A;  1ONL A;  1HTP A;  2M00 A;  5AJ3 L;  4YY3 L;  2B29 A;  1OWT A;  3BDO A;  2R93 B;  2J6U A;  4RCN A;  1S97 A;  4POF A;  1RYR A;  1I4H A;  1TS4 A;  1KRS A;  5CV7 A;  4KKU A;  2UUB L;  2W9C A;  3P1H A;  4DR6 L;  2IA6 A;  3I7F A;  3PN1 A;  4N8X 1;  2NU6 B;  1TWA B;  2F0K A;  3NWS A;  1WSC A;  4CC5 A;  4PWQ A;  1PYW D;  5KFE A;  1EY5 A;  4G4K A;  4DV5 H;  4JYA L;  3BQ2 A;  4IJL A;  2E5L H;  2WB1 A;  1SJE D;  5L9X A;  3HOX B;  5D1O A;  5EWF A;  4JV5 H;  3K5O A;  3L2P A;  2P0A A;  2F0H A;  2YRW A;  2ICE C;  5IP9 G;  1CQJ B;  3T1H H;  3MFG A;  2F0O A;  4ZK9 B;  5M3M G;  2L55 A;  3NK9 A;  4A3K B;  5FO8 B;  3H15 A;  5BPH A;  3BG5 A;  4RNO A;  4AYB G;  2UXD H;  3KF6 A;  4POG A;  3UFX B;  1CQF A;  2SCU B;  2B2T C;  1QOH A;  4U67 3;  4Y8V B;  1BBX C;  2WAC A;  4RGM A;  5DAU A;  2DN8 A;  3GTK H;  2VA3 A;  4JI2 L;  3MXU A;  1FNV A;  2F4I A;  5KFP A;  1SMY D;  4FF1 A;  4GKK H;  4FVM A;  2K04 A;  2I8C A;  5KFF A;  2FJ2 A;  3S1N H;  4DNR B;  2VL6 A;  3JSN A;  4RB0 A;  2JEJ A;  2OT2 A;  1IYJ B;  1SCU B;  4DK6 C;  4X65 H;  1CK1 A;  2HDL A;  2ICI A;  3CRL C;  3IRB A;  5I47 A;  4LF8 Q;  4FM9 A;  5LL6 S;  2UU9 Q;  1MHW C;  5BN5 A;  2QKI C;  1WD0 A;  4O1N A;  1PTO F;  4DF7 A;  2HUG A;  3G71 A;  4BBS G;  3G4S A;  5C3E H;  2VS1 A;  4DR7 L;  5EDW A;  1WTP A;  2BH2 A;  1GUG A;  4XT1 B;  4OO1 H;  4O3S A;  5DG7 A;  1F2L A;  1S40 A;  4G7H C;  3HOV G;  4ECX A;  1LTI D;  2UUC Q;  4JI8 Q;  3CP0 A;  4ALP A;  5KND A;  1EY0 A;  1PH3 A;  2RBM A;  4ZKC B;  3GIK A;  3KBX A;  3KF8 A;  4YIJ A;  2R92 B;  1XDN A;  4CC6 A;  2NUA B;  2ZXR A;  3TP7 A;  5I2X A;  4K14 A;  4DV7 Q;  3KTM A;  1BF4 A;  1WCM B;  4B3M H;  4DR5 L;  1L2Z A;  2KHI A;  4QWB A;  1M0T A;  1TT2 A;  5L1L A;  2JA5 H;  4MV7 A;  2ZJR A;  3GTG H;  1N34 H;  2R8I A;  5DEH A;  1SE2 A;  4WOR A;  3AB9 A;  3WWV A;  4Y7N H;  2FMC A;  1CSQ A;  4GNX B;  4HED A;  3T5K A;  2UUB Q;  1I5F A;  1D5Z C;  4ECR A;  1V43 A;  1TWC H;  4RHS A;  5BN4 A;  4DR6 Q;  2R7M A;  5J2U F;  2R8G A;  4HQ6 A;  3R2T A;  5KFO A;  1BO0 A;  3BQ1 A;  2IHF A;  2RGR A;  4XT3 B;  4AH6 A;  2YZM A;  1XNR H;  2E2H A;  1AZQ A;  1SRU A;  4JYA Q;  1DJR D;  4ED6 A;  3M3Y H;  3ZYY X;  4AYB E;  1BUV T;  4EBC A;  4O3P A;  1Q12 A;  1GLV A;  4A3F B;  4OWT B;  4I4T F;  1HZ9 A;  4DV1 L;  2AGQ A;  1F9R A;  2XIW A;  3TP8 A;  1YNN D;  3S16 H;  5L1I A;  1KJ9 A;  4KI0 A;  3FPU B;  1T9H A;  1KL9 A;  2VB2 X;  3BZD B;  4CGY B;  3G48 A;  5D14 A;  3PO3 B;  2PZT A;  4JI2 Q;  4AQY L;  5L37 A;  1H9M A;  2P5Z X;  3CPW A;  4U6P A;  3I56 A;  4RGO S;  4A3J H;  1AFP A;  4FBT A;  1PRT B;  3QOL A;  4ETS A;  4MIU A;  3KLS A;  2JA8 H;  3JAM E;  1TWG A;  3ND8 A;  5KX5 F;  1HNX L;  1H9R A;  1Q46 A;  2KVM A;  3PW5 A;  5CV4 A;  2VNU D;  1UNS A;  3GV7 B;  5IT9 W;  3T16 A;  5J39 A;  1TS3 A;  5IP7 G;  2ZXO A;  1S0O A;  1ENC A;  4TKO B;  4AIM A;  1IBL L;  2K4K A;  2YRX A;  2FIN B;  4J15 A;  5IYZ F;  4DK0 A;  3VR2 A;  5FKA C;  5JVD F;  1LV9 A;  3H6M A;  2MGS A;  4ME3 A;  3S2D H;  4IAL A;  5K2M A;  3PZP A;  1J5E H;  2OF1 A;  1JDE A;  2C00 A;  2VUM A;  3V4S A;  1IBM Q;  1Z2P X;  3GIM A;  3D4D A;  1S5C D;  5T14 A;  4A3D G;  4L5R C;  5KT4 A;  1HZA A;  4MV8 A;  4HMI A;  1EHI A;  1R4P B;  1E4E A;  1PRT D;  4C3H G;  3HFZ B;  5IT9 L;  3G6X A;  2NVX A;  4ED3 A;  2JEF A;  3IKJ A;  3BVM A;  4A3I G;  1A62 A;  2R61 A;  3C2P A;  1TWH H;  4NB3 A;  1I3Q A;  3ICE A;  3H0G B;  4JBW A;  1K28 A;  1SNC A;  2ASD A;  5C8Y F;  2RHQ B;  2BDO A;  3QZ8 A;  4A3M H;  5JJI A;  2UXB L;  4B3S H;  1B33 N;  3CHB D;  3KAJ A;  3W1B A;  2ZJQ A;  4QIW A;  4DAY A;  4B3R L;  3HZX A;  3GTK B;  4J9M A;  1N48 A;  4DV1 Q;  3RV4 A;  3BZC A;  3CCE A;  4C3I G;  5KFM A;  1N33 L;  3IFD A;  1SRO A;  3S1N B;  4BA2 I;  1STB A;  3SK4 A;  4KJO A;  1V8Q A;  4AQY Q;  4DUY Q;  2Z9H A;  1YI2 A;  4UCR A;  4Q45 A;  5IYC G;  3ULJ A;  3VR3 A;  5EJW A;  3JAM W;  1PFM A;  3SDZ A;  4YP3 A;  2YTV A;  2AQ2 B;  2R86 A;  1LTA D;  2BH8 A;  1M4V A;  1WTX A;  2W9C B;  2UVR A;  3NXW A;  1HNX Q;  1QUQ A;  2RDG A;  4ECY A;  3PUY A;  1SFO H;  1K9M C;  1QNK A;  1F2Z A;  4LH7 A;  1D7Q A;  1EIG A;  1I3Q H;  4GZY C;  3E0E A;  2NZ1 D;  4DV4 L;  2IX3 A;  2PZW A;  1YIJ A;  5FK9 C;  1CHQ D;  3R5H A;  1FNU A;  3T13 A;  5CA1 F;  5F9N A;  1GSH A;  3PO2 B;  4RUA A;  5EBC A;  3BU2 A;  4DK1 A;  3MR3 A;  2WB1 G;  4I7A A;  2XD4 A;  2CZG A;  2DJG C;  1VQ8 A;  2JA5 B;  2SOB A;  4J9N A;  3IN5 A;  1BNC A;  2NZO A;  1PH9 A;  2EIF A;  4Y7N B;  4CJ2 C;  5K5P A;  4YCW A;  5CV6 A;  1KJI A;  4NXM Q;  4JOI C;  1I4R A;  4I55 F;  2OCE A;  1TWC B;  1E1O A;  4O2D A;  1K73 C;  2F0E A;  3PR4 A;  4ECQ A;  1H9S B;  1QWY A;  3NBI A;  1WH2 A;  1B4O A;  1XWE A;  2IJ0 A;  2ZDG A;  4TV8 F;  3U4V A;  4X66 H;  3UE0 A;  2HDM A;  4IPC A;  1BR9 A;  5IGG A;  3H4D A;  4RGT A;  1MSG A;  1I94 L;  4H44 C;  2VPQ A;  4MV1 A;  4Y52 H;  1MGS A;  4K2L A;  2D0O A;  4XQN A;  4DV2 Q;  2M05 A;  2FHT A;  3NBH A;  3V2T A;  1SBB B;  4JI1 H;  1U5K A;  3X3M A;  3TME A;  4MV4 A;  3A7L A;  1KHI A;  5LMN H;  2F4V H;  5CC4 A;  2Q8I B;  4DV3 Q;  2I87 A;  4B3R Q;  2R8H A;  3I4M B;  4NKL A;  4EGV A;  2PN1 A;  4MAM A;  1N33 Q;  4MTK A;  2KEC A;  3KF8 B;  4DXG A;  3Q22 A;  3ETJ A;  4YY3 H;  4A3J B;  4A3C H;  1VQL A;  1G6P A;  4JV1 A;  1XPO A;  4ECV A;  1QZH A;  4J0M A;  2R7Z A;  2JA8 B;  2ZM6 L;  1X3G A;  4X3K A;  4G57 A;  3J7A F;  2NZH A;  3NEL A;  4HNV A;  3CME A;  1CHP D;  2A69 C;  4UCV A;  3R5F A;  1GUS A;  3KHR A;  3K5N A;  2DJF C;  4J9P A;  1PH2 A;  3RBE A;  1JIH A;  5C1P A;  3FP9 A;  1Y14 B;  1D2B A;  2B2V A;  4YBZ B;  2E2H B;  1VQM A;  1QVF A;  4PDB A;  5C0X J;  2EQS A;  4A3G H;  1AEX A;  1G51 A;  4DV4 Q;  1AN8 A;  3KJO A;  2A8V A;  1HA5 A;  4A3E G;  3S2D B;  4V0B A;  1NY4 A;  5E7N A;  2PMZ A;  3SHL A;  5CGK A;  3IAY A;  5KT3 A;  2WP8 J;  2K03 A;  4BY7 H;  5HBR B;  2JSO A;  5KT5 A;  3J81 W;  1N56 A;  3K59 A;  1EIH A;  4B3T H;  1CQI B;  2JA7 A;  1TVX A;  1M8A A;  4DR4 L;  1EY4 A;  4PQX A;  4U68 A;  5FPO A;  2A1A A;  2HIV A;  3GD7 A;  5M3F G;  3LML A;  1JIC A;  5KFN A;  3BZK A;  1S3O A;  3CPF A;  1HTL D;  5T1G A;  3PW4 A;  1TKW B;  4C3J G;  1TWH B;  2V5A A;  2YYA A;  3NUC A;  4LF9 L;  3C1F A;  4ULL A;  1YBY A;  4A3L G;  3I2Z A;  4GS3 A;  4O4H F;  2R7F A;  1WJJ A;  3K7U C;  1S10 A;  1HUN A;  5JVG 3;  2EYF A;  4LWC A;  4H13 C;  5KRU A;  2B63 A;  2AWO A;  3NQI A;  2XCL A;  5KFH A;  4DR7 H;  1NMG A;  4JI3 L;  1ML0 D;  5BN3 A;  5GAG C;  4C1N K;  4MV6 A;  1HA6 A;  4J9Q A;  4M8A A;  3J81 L;  4OO1 I;  3U9O A;  3I12 A;  4YHH L;  1Q82 C;  3VR5 A;  5C0X G;  4JW0 A;  1Z2O X;  5C6A A;  1JKJ B;  3I4O A;  1Q81 C;  1XXG A;  3R93 A;  4MTE A;  4FF3 A;  1ZHQ A;  1IBK H;  3R5X A;  3R2I A;  1K8G A;  3HKZ E;  3J80 i;  3CQZ A;  4DR5 H;  1K3B C;  1HUM A;  4KLK A;  2L4N A;  2R84 A;  3CVZ A;  2VQF H;  3S1Q H;  4CDF C;  2W6Z A;  2XSC A;  1R9T H;  4MTD A;  1PZK D;  1PVO A;  2C5C A;  4JI6 L;  4WFN 3;  2ZM6 Q;  4E6I A;  1E4E B;  1SEB D;  4JV0 A;  4A93 G;  2F0F A;  2WKD A;  2WYO A;  2VUM G;  3K6O A;  1B9M A;  1JJC B;  2NVX B;  2BA1 A;  1TAE A;  1NUC A;  1OXT A;  4JG2 A;  1I3Q B;  1WFQ A;  1SYD A;  2W57 A;  1I4P A;  3I4L A;  4HTH A;  5C4J H;  2FP4 B;  3MWE A;  3HEJ A;  4XQQ A;  4ABN A;  4JI7 Q;  5C5M A;  1KBL A;  3DWQ A;  3JSL A;  2FB9 A;  1JJ2 A;  2ZT9 C;  3C1E A;  2JJQ A;  2UUA L;  4HCE A;  1O7L A;  4ZYS A;  5M5W H;  2MJ8 A;  3PF5 A;  2BQ3 A;  3EA6 A;  1PFS A;  1KLG D;  2I5L X;  3B6Y A;  5KEE A;  2UXC H;  4DR4 Q;  1K3R A;  3U9T A;  1SMY C;  5KG5 A;  4LFC H;  1SR3 A;  1HNW H;  1S0M A;  2YTX A;  2M9V A;  2OQK A;  3PMF A;  2XGP A;  4RG1 A;  5DLG A;  1EYZ A;  4LF9 Q;  4F87 A;  1TWA A;  2D5D A;  1QCB D;  3OWE B;  4Q44 A;  2Q2H A;  1PTO H;  3LWB A;  1QUQ B;  4IUT A;  3G6V A;  4DKA C;  2RVL A;  3G7L A;  1HHV A;  1HJP A;  1IBL H;  4JI3 Q;  4LFA L;  4BWG B;  4YCU A;  4WD3 A;  2K01 A;  4NXN H;  2SNS A;  3TQ1 A;  1C7Y A;  3A74 A;  2QYZ A;  4CKE A;  2HHH L;  2FXQ A;  2L0C A;  4IUU A;  1VQ5 A;  1TQO A;  2FJZ A;  2CQY A;  5LYJ F;  1FVI A;  2HJW A;  4YCV A;  3UDX A;  3CXC A;  5CAE B;  1G91 A;  3RUZ A;  3FKI A;  3K3V A;  1EUD B;  5CBE E;  2JA6 A;  3HRZ C;  2Y0S G;  1CA5 A;  3FDS A;  1CI3 M;  2KCM A;  3CCQ A;  2MO0 A;  2R87 A;  2R82 A;  1VQD A;  1X3Q A;  3H94 A;  3S15 H;  2E2D C;  1O7Y A;  4IFD G;  4JI6 Q;  2NUC A;  1MIU A;  3D6C A;  4HIK A;  1PH4 A;  2O5J C;  2YZN A;  1RDP D;  1LT3 D;  3TEH B;  3E5N A;  3RFC A;  1UE5 A;  4DNT B;  4J9R A;  2W8L A;  3OOC A;  2E2J B;  3VYS A;  2GPS A;  4ED1 A;  2UXB H;  2AHO B;  3DM1 A;  2EY2 A;  2YYZ A;  3TBI B;  3GTQ A;  2WE6 A;  1DCZ A;  4LF4 L;  1LAB A;  3NBH B;  3C46 A;  3JAM c;  3HOW B;  3N8D A;  3HXL A;  3KXY T;  4UFZ A;  1SN8 A;  3OW2 A;  2R92 A;  1G2S A;  2A74 C;  3BVG A;  4NP5 A;  4LNQ A;  2LY7 A;  1VAJ A;  4BA1 I;  1WCM A;  3T5J A;  1JJG A;  1EUC B;  5JOB A;  4FF4 A;  3PF4 A;  5M3M H;  4A3B G;  3QFF A;  2K52 A;  4DUZ H;  1S5F D;  3K0Y A;  3QJY A;  2F0W A;  3OHX C;  2MO1 A;  5JAV A;  3BS1 A;  3FKI H;  3J80 W;  2R7Z B;  5E1F A;  3WOF A;  2MHV A;  3S1R H;  4GNX C;  2ATL A;  2J6S A;  3GII A;  3NHH A;  2EYP A;  1HFG A;  2A68 D;  1XMQ L;  3CC2 A;  2RDI A;  2XVS A;  4LW1 A;  3BG3 A;  3FEW X;  1EIY B;  2FKL A;  4HJ8 A;  5C5L A;  2C2R A;  3JZI A;  3CCR A;  1EIF A;  2F1M A;  4OIK A;  1UC9 A;  4JK1 C;  1YJ9 A;  3TQT A;  1TU2 B;  2N49 A;  2E8G A;  1VQP A;  4LFA Q;  1JCK B;  3DLL A;  4IPG A;  2IMW P;  5FLX W;  1Y1W A;  2Y0S E;  1W93 A;  1ZKO A;  4BBS H;  1SNO A;  1VQK A;  3NEN A;  3S1Q B;  1U4P A;  1NMF A;  3J80 L;  5DG8 A;  3TP6 A;  1WTH A;  3N52 A;  3H3V H;  2A19 A;  2Z6K C;  4A2A A;  5JPN C;  4GC7 A;  1D1K A;  4RH6 A;  2CQO A;  3HOV H;  1HZB A;  2DLN A;  3EQL C;  2ES2 A;  4ZLT F;  2V1C C;  1PRT C;  3PGZ A;  4EG0 A;  4G7Z C;  1L1O A;  2IWH A;  3HOY B;  4Q8F A;  2PCF B;  3NP8 A;  5JVH 3;  4K6L A;  2W6N A;  5C4J B;  4OHJ A;  4ED7 A;  4EGQ A;  1VQH A;  4LF6 Q;  1I94 H;  2V4R A;  1IHZ A;  1ASY A;  1I4Q A;  1H95 A;  5BPF A;  4J9O A;  1JR0 D;  2J0T D;  5FLX L;  4XZ3 B;  4FXD A;  1JT8 A;  4R4I A;  4LF4 Q;  1VBG A;  3ZJY C;  1Y1V G;  1KC8 C;  5KT2 A;  3FDT A;  4I7H A;  1ZET A;  5M5W B;  1NJI C;  2HT1 A;  4O4I F;  2N88 A;  2FK2 A;  5KFU A;  2B63 G;  2F0V A;  2NU7 B;  4X64 H;  2CW0 D;  3DWP A;  4PV1 C;  3U9S A;  4CJ1 B;  2EYM A;  2O03 A;  4A2B A;  4DL7 A;  3W5O A;  4QW8 A;  3K58 A;  4KHV A;  3URY A;  2XRQ D;  4HIM A;  1BCP F;  2K6A A;  3WO1 A;  1HNZ H;  5FPR A;  1LUZ A;  1QNU A;  3QWN A;  1B2T A;  3SI8 A;  2KJX A;  3GQB A;  3D4W A;  2UU9 L;  1PTO B;  3FRP B;  4BBR G;  5I9O A;  2NVT B;  3RAQ A;  1AE2 A;  4EYI B;  1QJO A;  2UVW A;  3E5S A;  2JQO A;  2R85 A;  2CW7 A;  1XMQ Q;  5JJK A;  2IX1 A;  1WTV A;  3HOZ G;  3S1M H;  1N32 H;  3MJF A;  4RU9 A;  3SGI A;  2ASB A;  3UI2 A;  4PMW A;  4JI4 H;  4LMQ D;  4KMU C;  2UUC L;  3GTK A;  5JH7 F;  4GLA C;  4KN7 C;  1KC7 A;  4OX9 L;  1RK5 A;  2WAQ E;  2DGY A;  3GTO H;  2TSS A;  1GSA A;  3M4Q A;  1WD1 A;  1IXR A;  5COY A;  3GTJ H;  4DV7 L;  1N36 L;  1IYV A;  4RAU C;  3S15 B;  4XXE A;  1EFW A;  3GTP H;  1E7Z A;  2I07 B;  5A2Q E;  4V19 0;  1FGU A;  1CKN A;  4TQS A;  3RUP A;  4DV0 L;  4R4Q A;  1Q1E A;  4BWS C;  5F2D A;  5DG9 A;  1KNA A;  1PTO D;  3N41 B;  3OIQ A;  1W96 A;  1AW7 A;  1PFB A;  1QIL A;  3KAL A;  1GYF A;  3RLO A;  4B3S Q;  2NBF A;  1U9R A;  3HOU B;  2ZXP A;  4L8J A;  5M5X H;  3K8A A;  2RCF A;  2N55 A;  2R93 G;  3ORQ A;  2B8F A;  4K5V A;  3FMA A;  3T1Y L;  1GJX A;  3MHB A;  5L1K A;  4DV6 L;  1N8R C;  3Q2O A;  3RB3 A;  1CT1 D;  1EQT A;  4C3H H;  5HGT A;  4YHH H;  4DR1 H;  3PIP A;  1CFM A;  5KFK A;  4O3R A;  4RKB A;  1I7N A;  1FJG H;  5I2Y A;  1EOT A;  2MP1 A;  3HOX G;  2JXM B;  2IW3 A;  2CWP A;  4DNI A;  5M3M B;  1Q7Y C;  3S14 H;  3BJU A;  2NU8 B;  3GTG A;  2JA5 A;  2EYH A;  1KJ8 A;  2MPM A;  3FKI B;  3PIO A;  1FD7 D;  2JA6 B;  4XYO A;  2JYO A;  4EEY A;  3MR6 A;  5GAE C;  1LLR D;  3S1R B;  1TWC A;  4OIJ A;  1H9S A;  2CH4 A;  4OEL B;  1QVC A;  4JCV E;  4R4C A;  4C3I H;  3NTK A;  3NTH A;  2ZJP A;  2VQD A;  3PUZ A;  4DL2 A;  2F0L A;  3Q8Q B;  5CBA E;  4FXK C;  2HVS A;  2NB0 A;  3TZU A;  3M85 A;  5IYC H;  3A0J A;  4ECS A;  2W9B A;  2R8K A;  4DAM A;  5IT9 E;  1PH5 A;  4WJ3 M;  3GTQ B;  4ZAI A;  2PVP A;  3RN2 A;  2DNE A;  4IPD A;  3EYY A;  2V59 A;  5KFL A;  4PNY A;  2UUA H;  2JEI A;  1K1Q A;  4YWL A;  3DM3 A;  3M4Y A;  4OX9 Q;  3G6Y A;  1IBM L;  3MXP A;  1EQR A;  5DLF A;  5K36 G;  5A2Q W;  3VPC A;  1ILP A;  4YR2 A;  4J1M A;  2EJM A;  4QY7 A;  2F52 A;  4ZRZ A;  1N36 Q;  3LGJ A;  3JRW A;  1UE7 A;  3L3O C;  4UP7 A;  4QUF A;  1YNJ D;  4F4X A;  4DV0 Q;  3K3P A;  1A2U A;  2R92 G;  4IRC A;  3K81 C;  2WDT A;  3SK5 A;  4DR3 Q;  1HR0 L;  1DYQ A;  2QGQ A;  3HKZ A;  4XDX A;  5C44 H;  4JI5 Q;  1JOR A;  1SNQ A;  2V58 A;  2OTL A;  4GKJ L;  5C1O A;  1A15 A;  1XYI A;  1XNQ L;  3M9O B;  3GP7 A;  3T1Y Q;  4K0K H;  1NNX A;  4DV6 Q;  2RQX A;  1EU3 A;  3Q8S B;  2HHH H;  3MXG A;  3UDG A;  1Q86 C;  5A2Q L;  5KG0 A;  1STG A;  1GD7 A;  4JPB W;  5TSS A;  3I3C A;  4JI0 H;  5G3L F;  1M0W A;  1Y1W B;  4Z9C B;  1O7Z A;  3SK6 A;  2W7P A;  1CTM A;  4F4W A;  1VQI A;  3EFX D;  3KYH C;  1B7Y B;  1I6V C;  1F2M A;  2G5D A;  1NTG A;  2B2Y A;  4DUY L;  2W6O A;  2ZDQ A;  3W3A A;  4A3F G;  5KT7 A;  2C2E A;  2B2Y C;  4ZCK A;  2VW9 A;  1TII D;  5KFZ A;  1L0W A;  1K0R A;  1TWH A;  2A6E D;  5CV8 A;  1ILQ A;  1O7I A;  4CHT B;  1D5X C;  4J9K A;  4EGJ A;  3PO3 G;  1L1O B;  2Q8T A;  2RKS A;  1LM0 A;  4APV A;  4IRD A;  2LXK A;  3BDL A;  2IP4 A;  4BXX H;  3KDF A;  1R4Q B;  1HFN A;  3RJ0 A;  4DAV A;  4ILW A;  5IWA Q;  4G3I A;  2LFN A;  2GLT A;  5C4X B;  1A0I A;  4FDB A;  2EY1 A;  2KBN A;  3VPB A;  3TS0 A;  5D8D A;  2OEO A;  3NE5 B;  4MHE A;  4NPS A;  1G2T A;  3GTO B;  3ORR A;  3AFP A;  4XIG S;  2LMC B;  3CW2 C;  2RGV A;  4LUV A;  2VQE L;  5KFA A;  1BNZ A;  4DGZ A;  3GTP B;  4ZQ3 A;  3N42 B;  2OWO A;  3PV0 A;  5DM7 3;  3OPO A;  3NPP A;  4FS1 A;  3GO5 A;  4NXM L;  3G6E A;  4A3E H;  1ICW A;  5E4W C;  4RA8 A;  4EQP A;  1Y8O B;  2QA4 A;  1EY6 A;  4J6H A;  4C56 C;  2YS6 A;  1I6U A;  1ENF A;  1SFO A;  4LSX A;  4LF7 L;  3J7A 5;  1HR0 Q;  3TIG A;  1EQV A;  3MR2 A;  3HB9 A;  1XX8 A;  3EPG A;  3OUZ A;  4DL4 A;  5KNB A;  2C22 A;  1VQC A;  5M3F H;  4LFB L;  1XMO L;  1G6Z A;  4DR2 L;  4GKJ Q;  1OTC A;  4DV2 L;  1VDZ A;  4HR7 A;  1PX2 A;  1S0N A;  1XNQ Q;  4X6A H;  3MEF A;  1QE6 A;  1E4G T;  3MAQ A;  2CQA A;  3TSS A;  3OYY A;  4RWS C;  1GOZ A;  5KFC A;  2D0P A;  3SE0 A;  3H0G G;  4DV3 L;  4QUC A;  4A3L H;  3OSN A;  1RK6 A;  4KKS A;  2QCP X;  3N6R A;  1OXX K;  2GA4 B;  5KGU A;  5FJ8 G;  1DV1 A;  5CR3 A;  3F2D A;  1EYC A;  1SYF A;  1CS0 A;  2DY8 A;  4KY7 A;  1GUT A;  4QW9 A;  2H4O A;  4QMG A;  3H3V I;  4EEQ A;  1SYC A;  2W7O A;  2EZV A;  3QR8 A;  4M1U B;  1CKN B;  5C0X H;  5EOY A;  1F77 A;  1G29 1;  5H1S E;  5EAY A;  1X3E A;  4X3T A;  3PW2 A;  4OGQ C;  2AQ1 B;  1RYS A;  4Q43 A;  5C3E B;  4O2B F;  4EVO A;  5DGA A;  4FYD A;  3RLN A;  2F0S A;  4GN5 A;  5ISR A;  3RB6 A;  1EYG A;  5CV9 A;  1E22 A;  1JWU D;  2JN4 A;  4EBD A;  2RSN A;  1AUX A;  1ZEQ X;  2PI2 A;  3ND9 A;  2VQE Q;  1NBW A;  4PZ6 A;  4WBN F;  4E4T A;  5FD6 A;  3HS0 C;  5KFI A;  1C8C A;  1X3F A;  1DD2 A;  3MFH A;  1PRT F;  3E0J A;  5BR8 L;  3J81 E;  3GTG B;  4IO9 A;  2I0Q A;  4RB2 C;  4Q0F A;  1A63 A;  3PO2 G;  3C0F B;  4LF8 H;  1UC8 A;  1FR3 A;  1RJQ A;  2UU9 H;  5C44 B;  2DWC A;  4O0A A;  4QL5 A;  4DXF A;  5IGC A;  2FPP B;  1KLU D;  3Q6S A;  1OO9 B;  2JA5 G;  4LF7 Q;  1MBY A;  2E74 C;  1PK8 A;  5J1Z A;  2FE3 A;  3M3Y B;  5LMU Q;  2A68 C;  2LS0 1;  1F9S A;  1KEE A;  4LFB Q;  1XMO Q;  4DR2 Q;  4FBU A;  2J6T A;  2KSW A;  1BOS A;  3N40 P;  3TRE A;  4ED0 A;  1J9O A;  2RF4 A;  2W9B B;  2UUC H;  1A2T A;  1BBU A;  3I4N G;  3S16 B;  4JI8 H;  1J6Q A;  4TUY F;  4YAK B;  1JOQ A;  4F7X A;  2W9A A;  1L0X B;  4EYH B;  4IUP A;  4KJN A;  2VOB A;  2C28 A;  3NQT A;  4IN3 A;  4MV9 A;  4DV7 H;  4K2K A;  3A8I E;  1HPC A;  1DOL A;  2F0D A;  2ID0 A;  1JWM D;  2X6L A;  5CMD A;  1CQV A;  3CD6 A;  1JC7 A;  1JB7 A;  3TN2 A;  4LF5 L;  1STH A;  1X54 A;  2JA9 A;  2SEB D;  1DV2 A;  5JVL A;  3CCL A;  4X3S A;  3BAB A;  4F88 A;  3AQQ A;  2H5X A;  2HCC A;  2K5H A;  3I4M G;  2UUB H;  3H09 A;  4DR6 H;  4X62 Q;  3R3O A;  1JE5 A;  3S2H H;  1RJR A;  3SXH A;  2DPJ A;  3IFT A;  2EY5 A;  2XWJ B;  4A3J G;  4A4I A;  3HKZ B;  4F8M A;  4JYA H;  2M2L A;  2JA8 G;  3FVQ A;  4KHP L;  4RAY A;  4B9X A;  1SE4 A;  1EY8 A;  2YU9 H;  2Q8R E;  1JQY D;  3AEV A;  2B2V C;  2IL8 A;  4KY6 A;  4JI7 L;  1EEI D;  2WB1 E;  3BYY B;  3F2C A;  3C3L A;  1NAP A;  4J9L A;  1D6E C;  3CCU A;  4G7O C;  4JI2 H;  3JRX A;  2BA0 A;  1R9T A;  4JBK A;  2CW0 C;  1STN A;  1VBH A;  4HSV A;  4ZUJ A;  5BR8 Q;  3OTO L;  3I90 A;  3W2D A;  4IAJ A;  3KLR A;  3CC7 A;  4C1N I;  1SYE A;  2WAQ A;  1G8Z D;  4C2M H;  2NN6 G;  1QG7 A;  5JEA J;  1NE3 A;  2XCP A;  1I4G A;  3PVX A;  1EUJ A;  1YZ6 A;  3MC0 B;  4A3M B;  2Q2T A;  1LTT D;  2NVY H;  3KDF B;  2QDB A;  3A8K E;  3OWF A;  1W6J A;  4TQU S;  3Q8R B;  4I7Z C;  1WTO A;  1FYC A;  3DMU A;  2QK4 A;  1C0A A;  2D62 A;  4NMZ A;  3J7A K;  2KEN A;  5JUM A;  1FNW A;  4I65 A;  1PZI D;  2VUG A;  3U58 A;  1IL8 A;  1DZ1 A;  4TRD A;  1IBM H;  3RZO H;  3MR5 A;  3PQI A;  2K7V A;  4IOA A;  3NWT A;  4RHR A;  1II3 A;  1V1P B;  1GM5 A;  4DL3 A;  3F2B A;  1K1S A;  1WOC A;  2VR1 A;  4LF5 Q;  1ZHS A;  4DV5 L;  2E5L L;  3GIQ A;  5GQO A;  4RAZ A;  4WJW A;  4JV5 L;  3RGX A;  1PTO C;  1IOW A;  4MTN A;  2RA4 A;  3TII A;  2H1E A;  1SFO B;  4LMY A;  4K6D A;  3SK8 A;  2QF7 A;  5GAD C;  1U4R A;  2UXD L;  5JEA G;  3P20 A;  1X6O A;  3H40 A;  3M4I A;  1S5B D;  3E6Z X;  4HYK A;  3MEH A;  4KHP Q;  2CVR A;  2K28 A;  4HR7 B;  4ZI7 F;  5I4D A;  2VA2 A;  2LSS A;  4GKK L;  4DV1 H;  4ED8 A;  2QDL A;  1KRT A;  1CSP A;  2W71 A;  3TIN A;  4PZ8 A;  1B1Z A;  2F0N A;  4DPG A;  4R8I A;  3GV3 A;  4X65 L;  1K8A C;  3MWM A;  4AQY H;  3DF7 A;  4DUY H;  1PH6 A;  1SYX B;  3RB0 A;  5IT9 c;  2ALZ A;  1KAB A;  5IYD H;  2BQU A;  4IFD J;  1STA A;  1EZ6 A;  5ELB A;  1Y1V H;  3OTO Q;  4QB4 A;  3L4K A;  5I6Y A;  3AFQ A;  3IL8 A;  4N9T A;  3TQY A;  4C5C A;  5DQI A;  1HNX H;  3J80 E;  3AU7 A;  4TSS A;  4FNF A;  4YWM A;  1PMR A;  3KOJ A;  5ELD A;  3ERS X;  2HCI A;  2X0S A;  4J9S A;  4C5A A;  5IYB G;  4EX5 A;  2XRS D;  3OHA A;  5E4X A;  4R8U A;  4HN7 A;  5A35 A;  3MFY A;  4B3M L;  2GVB A;  1I6H H;  2KQ3 A;  2IT1 A;  1SAP A;  3P75 A;  1N34 L;  3HOZ H;  3S9W A;  1AZP A;  1T36 A;  1JMC A;  3MWY W;  2X69 A;  5FLX E;  4AYB A;  3N43 B;  4F50 A;  3EBE A;  4UP8 A;  4NXM H;  5IE8 A;  3LWE A;  1BXT A;  3Q24 A;  3GIL A;  1I50 A;  1DXM A;  1S4Z A;  1PHJ A;  2PYK A;  1Z7T A;  3S2H B;  1XNR L;  4DV5 Q;  2E5L Q;  3A8J E;  1YNJ C;  1VF7 A;  1PZJ D;  1ZYR D;  5KIX A;  1EWI A;  3RZD H;  4JV5 Q;  1KD1 C;  5JJL A;  4TVA B;  3T1H Q;  2F0U A;  4L1K A;  4LF6 L;  2I5M X;  1K8O A;  1SXT A;  1E4F T;  1CZW A;  2J4X A;  4C5B A;  1VCI A;  2YU9 B;  5FD5 A;  4DV2 H;  1A6X A;  2UXD Q;  4IZ8 A;  4DFA A;  1XPR A;  4A3G B;  5KFY A;  2B39 A;  1PLF A;  2XC9 A;  1YJN A;  1JOK A;  1O78 A;  3EPI A;  4BY7 B;  3K7A H;  4DV3 H;  4B3R H;  3F1Z A;  3T5L A;  2X6G A;  1AE3 A;  2EYJ A;  4GKK Q;  2HQE A;  4A75 A;  1N33 H;  4B08 A;  2NWG A;  5DM6 3;  1VF5 C;  1X56 A;  1YNN C;  3D0F A;  4DU9 A;  2AUJ D;  2R93 H;  4YB8 B;  1BCP B;  4X65 Q;  5FLM G;  4MA5 A;  2O2L D;  5EPK A;  4QIW E;  2EDG A;  1ESF A;  2JP1 A;  3E9I A;  2F0J A;  5IP9 H;  3HOW G;  3U50 C;  3K5M A;  3D8G A;  3Q0A A;  3RNU A;  5LP6 F;  4C2M B;  1JLL B;  5COR A;  2A6E C;  3OW7 A;  1S9F A;  5FOB B;  5C0X I;  4HNU A;  4JBJ A;  3EVQ A;  2DNC A;  3HOX H;  5F9L A;  1C9O A;  2NVY B;  1I50 H;  2K50 A;  1Q8I A;  2YL2 A;  5EQ0 A;  4CBV A;  4FO2 A;  1GSO A;  3RD4 A;  2SNM A;  2FK3 A;  4DV4 H;  2R7Z G;  2EYO A;  2G9H D;  4P72 A;  4XTC S;  2FFK B;  5M9O A;  2E2I H;  2PO4 A;  3V4Z A;  4RNN A;  3S17 H;  5H80 A;  4B3M Q;  2OXP A;  1VQJ A;  2Z1C A;  3ONA B;  1CM9 A;  4L5S A;  3M9N B;  1KQS A;  3GTL H;  1BCP D;  1N34 Q;  4LJZ C;  1JX4 A;  1SSO A;  1R9T B;  3F2U A;  5KG6 A;  2YV5 A;  2QEX A;  1BXR A;  3SR1 A;  3GTM H;  3GLK A;  3V6J A;  1SDF A;  1B04 A;  1I7L A;  2QW7 A;  4FXG C;  1XNR Q;  3CCJ A;  2F0P A;  2K14 A;  1X9N A;  2JA7 G;  2D2C C;  2WAQ B;  4NDX A;  2PBZ A;  4B3S L;  3BYT B;  1L1O C;  1M7J A;  5NUC A;  4DAP A;  2HVQ A;  3VPD A;  5KG4 A;  4DL6 A;  3F8N A;  3VYT A;  1B3A A;  2KHS A;  2HGS A;  3DXJ C;  4H0L C;  1LTL A;  5D1P A;  2VY3 A;  3HOY G;  1X32 A;  3GTO A;  3GTJ A;  4CJ0 B;  1UE6 A;  2WFW A;  5J22 A;  3GTP A;  1IW7 D;  1GKH A;  4TQR A;  2A5H A;  4BY1 G;  4LUZ A;  3WNZ A;  3RTX A;  1Y1V B;  4R4T A;  3GV8 B;  3PW7 A;  2ZM6 H;  3D6W A;  5KFB A;  2IX0 A;  1KDA A;  1GO3 E;  1VMP A;  5IOD A;  2B2W A;  2N3S A;  2IY5 B;  2B2W C;  3J81 c;  4N8F A;  4A3F H;  1KDC A;  3WDN A;  3RAX A;  5KFT A;  2EXZ A;  2PQA A;  4HJ5 A;  4JI7 H;  1J5E Q;  3VYR A;  1I6H B;  3K5L A;  5LMN W;  1E2V A;  1DIK A;  4QQB X;  4L5Q A;  1TS5 A;  3PO3 H;  2V9W A;  1LT5 D;  2HQL A;  3QZ7 A;  4CDD C;  4IQZ A;  1L2F A;  2RSO A;  1MKH A;  5KYI A;  1TWF A;  3KBG A;  4DR4 H;  2NU9 B;  1B8A A;  2N8N A;  4P73 A;  5IP7 H;  2PMZ E;  2AUK A;  3OSO A;  3LP8 A;  2RHS B;  2L12 A;  3GIJ A;  1EZ8 A;  1UAP A;  3RZD B;  4UY8 C;  4LF9 H;  2K1B A;  4DR3 L;  4ECZ A;  1IYU A;  3MTS A;  5D3I B;  2PPB C;  4ME5 A;  4MNO A;  4JI1 L;  4JI5 L;  4UP9 A;  1TXY A;  1DON A;  5LMN L;  2VB3 X;  2F4V L;  4A3D H;  1B70 B;  1LAC A;  2EY6 A;  4P75 A;  3WOE A;  4JI3 H;  2FLN A;  1F2Y A;  4XYL B;  1YHQ A;  2F3V A;  1ZXT A;  5IGB A;  1NCV A;  4LUO A;  4R8U B;  4H02 A;  3HOU G;  4A3I H;  2BE5 D;  2QIL A;  5FO7 B;  5BMV F;  3PW0 A;  3TRZ A;  1YNX A;  4ZKB B;  2BCO A;  3EIV A;  1RL2 A;  4KV6 A;  1STE A;  5IY0 A;  3A54 A;  3DEO A;  4AYB B;  1TWF H;  3PUW A;  3I70 A;  1IZ6 A;  4A3K G;  2K32 A;  1VQ4 A;  2CWA A;  2OLS A;  2YW2 A;  4JI6 H;  2NTS A;  3ETH A;  1ROD A;  3H0G H;  1I50 B;  4WJ4 A;  1S72 A;  1A8V A;  3T56 B;  5C4Z A;  1ASZ A;  2BQR A;  3Q8P B;  5FJ8 H;  4ME6 A;  3CMA A;  3FKI G;  2IBK A;  1Q1B A;  5KFX A;  1HZC A;  2JA6 G;  3MXN B;  2B2T A;  4OWW B;  5E3F A;  5IWA L;  4IWY A;  1HR0 W;  5GAH C;  2E2I B;  1JDB B;  1E2Z A;  4ZHQ F;  2N78 A;  1Z47 A;  4B3T L;  3S17 B;  3HKS A;  5G3L D;  1E24 A;  3STB D;  2MUY A;  3V6H A;  1ET6 A;  3GTL B;  4BBS B;  2DUD A;  5KYL A;  2R6G A;  1U4M A;  5LXT F;  5KT6 A;  3OSP A;  2XGQ A;  3D4R A;  5AFW A;  1NR2 A;  1N9W A;  3A56 A;  2CHB D;  3KUP A;  4PZ7 A;  3GTM B;  1KJJ A;  2D9U A;  3HOV B;  1SYG A;  1E2W A;  1VQG A;  3A7A B;  4ID6 A;  1KXL A;  1HQM C;  4RFB A;  5ELE A;  4HID A;  4X66 Q;  4O3N A;  1UWV A;  1GGO A;  5C5J A;  4NW2 A;  2L9H A;  2G9D A;  5CA0 F;  5LL6 b;  2W8K A;  2AWN A;  1MJC A;  2RDJ A;  1KJQ A;  4EBE A;  4NLG A;  4ZUI A;  4CKB A;  4O3O A;  1LT6 D;  1VQN A;  1T94 A;  1WCM G;  4JI1 Q;  4HCS A;  1KAW A;  2VZA A;  1BGW A;  3MA2 B;  1QB5 D;  3T4A C;  4R7R A;  4HSP A;  5LMN Q;  2F4V Q;  5DGB A;  4F4Z A;  4LFA H;  3PO2 H;  2XWB B;  1VQB A;  1IBK L;  1RJP A;  3JAM i;  2ENB A;  1WR2 A;  3PUV A;  3J7Y W;  1I4X A;  1V1O A;  5AJ3 Q;  2VQF L;  1VQO A;  3KAK A;  3VDY A;  4YY3 Q;  5EKL A;  5CB4 F;  1A9X A;  2OTJ A;  3I73 A;  1M1K C;  1CA6 A;  3I91 A;  4EFB A;  4OWX B;  1T5X D;  3KFU A;  4MZ9 A;  5EBD A;  1L0Y B;  1V4Y A;  3ERO A;  1C4Q A;  1U0L A;  1GVP A;  4GOP B;  3I4N H;  2W6P A;  1F9Q A;  3N6X A;  4R1J A;  4EQ5 A;  1Y1W G;  1V1Q A;  3Q8D A;  3VYU A;  4DLK A;  4LF6 H;  3S1M B;  5C3W A;  3T5H A;  1PH1 A;  4P74 A;  1IL2 A;  1LYL A;  3I8Z A;  5C3X A;  4LF4 H;  2L1B A;  2LKV A;  3I4M H;  3V05 A;  1U4L A;  4B3T Q;  3WO0 A;  4CKC A;  2UXC L;  2EVB A;  3J80 c;  2C35 B;  4LFC L;  1YJW A;  1VQE A;  2Z8L A;  3GTJ B;  1HNW L;  1DOK A;  1RJT A;  4H7B A;  1TA8 A;  1D8L A;  5C4X G;  2XNA C;  1MSH A;  2F0M A;  2K5D A;  1SNM A;  1V1P A;  2FLL A;  3ERQ A;  4YR3 A;  3ITP A;  4R8N A;  5I6W A;  3LX0 A;  4M7E A;  1YVC A;  1WTW A;  4MA0 A;  2XGT A;  4QWD A;  3PR5 B;  2BDN A;  1WVL A;  4ECW A;  4R9W A;  4YAJ B;  2PW7 A;  1PDQ A;  4DR7 Q;  3M4P A;  5M5X B;  2EXD A;  4I50 F;  2E2H H;  1FKA H;  2KCC A;  2B3G A;  2K75 A;  4NXN L;  5FLX c;  3L0O A;  4GN4 B;  4A3D B;  2GPW A;  3I72 A;  5LMU L;  3T53 B;  3UQ8 A;  3K80 C;  4IPH A;  3H20 A;  3RF2 A;  2KED A;  1K83 A;  1EYD A;  1A3T A;  4C3H B;  3L7Z C;  1D5M C;  4JBM A;  3AMU A;  4O4L F;  4A3I B;  2W6M A;  5KFG A;  1GUN A;  4C3J H;  2PQA B;  1IBK Q;  1Z6H A;  4OL7 A;  4DR5 Q;  2NN6 H;  2WKC A;  1CKO A;  2MCT A;  2VQF Q;  3KHG A;  2CFM A;  3S14 B;  1F9P A;  1P8L A;  1TWF B;  5EGT A;  5C4H A;  3V6K A;  2DIK A;  2PNH A;  4OEM B;  2FPG B;  2I5H A;  2GN5 A;  2FLP A;  1B9N A;  3M4O H;  1UNN C;  2ZTC A;  3KHH A;  1YHA A;  4C3I B;  1S5D D;  1TWG H;  2DY7 A;  3GV6 A;  4CDE C;  3K5I A;  4X62 L;  1KDB A;  1M6V A;  3OIP A;  3MZ5 A;  1DM0 B;  3RR5 A;  1EU4 A;  2MQH A;  1AH9 A;  3DHQ A;  1PH7 A;  1ZYR C;  3J81 i;  4KD3 A;  5LOV F;  1Q8K A;  2DZD A;  3VMM A;  3RGZ A;  1SE8 A;  1S5E D;  1IOV A;  1X55 A;  3NGD A;  4HJ9 A;  3CKI B;  4L63 B;  3X3N A;  2NTT A;  1PFN A;  1B6S A;  5KFS A;  5DNF A;  1PH8 A;  4IUN A;  5IOC A;  1C3O A;  1ESR A;  3ER0 A;  1J8I A;  1D1I A;  4K5W A;  2A6H D;  4R4O A;  4A93 H;  1K83 H;  2UXC Q;  3HBL A;  1QVG A;  4UAI A;  2VUM H;  2AU0 A;  5C3E G;  2AQ4 A;  4DL5 A;  4DUZ L;  4LFC Q;  2OH2 A;  2E76 C;  1DGS A;  5JEA H;  4IUV A;  4OO1 G;  1FL0 A;  2NYZ D;  1HNW Q;  2R7N A;  5KG3 A;  4HNT A;  1H9J A;  2XN9 C;  4KKT A;  1UEA B;  2Q2U A;  1O75 A;  4OXP A;  1E3P A;  1HCZ A;  1BDO A;  4IUQ A;  4CDC C;  3Q1K A;  2B8G A;  5CV5 A;  2RDF A;  2NVX H;  3IG0 A;  4WRD A;  1Q90 A;  2WB1 B;  1WYD A;  1PXU A;  2ZTE A;  1NSN S;  3M9B A;  2K5W A;  5ELN A;  4B9W A;  2Y0S A;  5D1O B;  3CC4 A;  2EJF C;  1IBL Q;  4O3Q A;  2OQ0 A;  4IJH A;  2WV6 D;  2YTY A;  1W3S A;  1CZG A;  1K8M A;  4NXN Q;  2YU9 A;  2Z4H A;  3H4B A;  2C9O A;  3KF6 B;  3ULL A;  2YCH A;  2AKW B;  3DUZ A;  5C44 G;  4P71 A;  3JAM L;  5IGE A;  3NEM A;  5KFQ A;  1T3N A;  3VR6 A;  2RDH A;  3GDE A;  4JOI A;  3CCS A;  4HMJ A;  4K5X A;  4UCO A;  2R3Z A;  4OX9 H;  3M9M B;  3K5H A;  2HVR A;  5DQH A;  2J7Z A;  3BA8 A;  4LAA A;  1N36 H;  3G8C A;  5LA6 F;  1MZB A;  1BCP C;  3I4N B;  5KFJ A;  4KTA A;  5IYB H;  5J2T F;  3CAM A;  1PA6 A;  4UCT A;  4C2M A;  4DV0 H;  3SE7 A;  4IRK A;  4DR3 H;  1GHJ A;  2RCN A;  5DLQ E;  3KK7 A;  1UUP A;  1JB3 A;  2UXB Q;  2NVY A;  4JI5 H;  1HXY D;  2NVQ H;  4IR1 A;  3Q23 A;  2CCZ A;  4IHJ F;  2AGP A;  5KFR A;  5KG7 A;  4RZQ A;  1IKM A;  1Y8N B;  4UHV A;  1MJE A;  1O80 A;  1VQ9 A;  3T1Y H;  1H9K A;  3A5U A;  4DV6 H;  4F4Y A;  3TZD A;  4X64 L;  4BXX G;  5FO9 B;  4IFD H;  1SMX A;  2L11 A;  3BJY A;  3KLW A;  2YS7 A;  2DPI A;  1BKB A;  3RN5 A;  3HKZ G;  1HNZ L;  3GID A;  5D65 A;  1VKZ A;  3OMC A;  1JE4 A;  1EY9 A;  2I46 A;  4DUZ Q;  2JK8 A;  1LT4 D;  2UVU A;  1ICF B;  3ULP A;  4ECU A;  1IW7 C;  3UDF A;  4IOC A;  4A3E B;  3MFI A;  2F3W A;  5GRO A;  5HGQ A;  2C2D A;  1SNP A;  4XYM B;  1N32 L;  2KHJ A;  3GV5 B;  1WI5 A;  2JE6 I;  1RCV D;  3M7N A;  2QEJ C;  3VA5 A;  5IGF A;  2JEB I;  4KN4 C;  1CE8 A;  2E2J H;  1IKL A;  1B53 A;  1STY A;  2AQ3 B;  4JI4 L;  5M3F B;  2JEA I;  4QWA A;  4IUR A;  1ULZ A;  4GC6 A;  4J8Q A;  1BJT A;  1V9P A;  5FLM H;  2K5V A;  5IWA H;  3RB4 A;  5EKI A;  2MNA A;  1EQQ A;  5CYU A;  3E3X A;  1GUW A;  4C3J B;  3HOW H;  2ZDH A;  3QG1 A;  4A3B H;  2FK1 A;  3EJI A;  1HRJ A;  3GIP A;  3HP3 A;  2I80 A;  3GQC A;  1LTB D;  3CF5 A;  3KLS X;  2PNR C;  5J3B A;  5ELC A;  4QWE A;  4YWK A;  1LO5 D;  4EFE A;  4HJA A;  1EY7 A;  3MWD A;  4A3M G;  3FHW A;  2PQE A;  2KCT A;  3A55 A;  1W2B A;  1SND A;  2YZG A;  1ET9 A;  4MN3 A;  3M4O B;  1Y1V A;  1JWS D;  2R6F A;  2R7Z H;  2Z0S A;  1TWG B;  4YR0 A;  3VR4 A;  1BVS A;  1VQA A;  2AMC B;  1KNE A;  1RTO A;  2EYL A;  4UDU C;  4GN3 B;  3I55 A;  2R8J A;  1MD2 D;  4ED2 A;  2Z4I A;  1I94 Q;  1HR0 H;  1K0S A;  5JQW A;  3BAA A;  4S3S A;  3T1H L;  4GLX A;  2R7K A;  2FMA A;  2KCN A;  2VPS A;  4DR1 L;  1EZ1 A;  4GKJ H;  1P16 A;  4Q8E A;  4OON A;  1B3Q A;  3LWU A;  1RF2 D;  4FS2 A;  3DEP A;  1XNQ H;  4PMC A;  1FJG L;  1UE1 A;  4A93 B;  3OHB A;  1K83 B;  2PW5 A;  1LTR D;  2VUM B;  1LTS D;  2K5Q A;  4X64 Q;  3KJP A;  2JA7 H;  2BOS A;  3G6J B;  4EQN A;  1VQ6 A;  1V51 A;  3TS2 A;  4M9U A;  4ECT A;  1HNZ Q;  2F0Q A;  2ASL A;  2BE5 C;  3V96 A;  2ASJ A;  3VA7 A;  4KD4 A;  3CRK C;  1RKN A;  2EJG C;  4HAE A;  3SVM A;  2CW8 A;  2XIG A;  4JV2 A;  3FPP A;  2WTF A;  3HOY H;  4PMB A;  4ZQI A;  4LH6 A;  4RUC A;  4KK7 A;  1N32 Q;  1XTC D;  4K8J A;  4YJ2 F;  5LHY 1;  2B63 H;  2CH4 W;  1XPU A;  3DWA A;  4JI4 Q;  4BY1 H;  4U7C A;  3KHL A;  4RNM A;  2W70 A;  2TMP A;  4QIW B;  4DAY B;  3D31 A;  5EWG A;  2JEG A;  2K33 A;  3QB3 A;  5KFV A;  3QO2 A;  5M5Y H;  4JVZ A;  2KOL A;  2R7L A;  2WIN B;  4O42 A;  3QOJ A;  2F0T A;  4ODG A;  3J7Z C;  2R93 A;  4BBR H;  4PG3 A;  3STB C;  4XYQ A;  4XQJ A;  2K5N A;  3R23 A;  5IGD A;  1KIX A;  1VMC A;  3CQZ H;  2VQE H;  1B44 D;  2XTI A;  4UCS A;  3H91 A;  1B50 A;  4RB3 C;  5HV6 A;  1EYA A;  5JJZ A;  4FU0 A;  1WTR A;  1TR5 A;  3TP5 A;  4L6T B;  1W6K A;  1RD9 D;  2NVT H;  4YQW A;  4GLV B;  2HD3 A;  4DK3 C;  4HJ7 A;  3P7J A;  2NVQ B;  4IWX A;  2PZU A;  4MV3 A;  2EE1 A;  4N9P A;  4QWC A;  2MFI A;  3NSW A;  2FPI B;  4LF7 H;  4A3C G;  4K0K L;  2Y0S B;  5LMU H;  1XJV A;  1XMQ H;  3MXN A;  2IHE A;  4YHH Q;  4LFB H;  1XMO H;  3PIP 3;  4DR1 Q;  4DR2 H;  2E2I A;  2V4D A;  2L15 A;  1Q3L A;  4JI0 L;  1FJG Q;  2ATW A;  5EZY F;  5KG1 A;  1S68 A;  3GTL A;  5LL6 X;  1GXD C;  4A76 A;  1GHK A;  1TY0 A;  5JPM C;  3PIO 3;  2NN6 I;  3M7G A;  1HQR D;  4JC0 A;  3T51 B;  4A3G G;  2KUM A;  1EOV A;  3H3V C;  2BR0 A;  5KFW A;  3GTM A;  5KFD A;  1MI2 A;  1SLJ A;  3E9H A;  4BY7 G;  4FF2 A;  1SYB A;  3CCM A;  3JC6 6;  3BA9 A;  4X62 H;  3HOU H;  1TWA H;  2FMM A;  1RIP A;  3R8B A;  2GVA A;  2O4X A;  1X65 A;  3HGB A;  1B6R A;  5EKK A;  4Q0Y A;  3RBD A;  4A3B B;  4BS9 A;  3TDQ A;  2ZJT A;  4RZR A;  2Z6B A;  4A3K H;  1SJH D;  4APM A;  1JXL A;  3PSI A;  3PCO B;  2UUA Q;  2IPK D;  1VQF A;  1J5E L;  1AN7 A;  3F8T A;  3D3R A;  4UPA A;  4DN4 M;  4QJF A;  2L5T A;  5DQG A;  3RZO B;  2F3I A;  2UVV A;  1QZG A;  2JA6 H;  1UEB A;  4HIO A;  4GNX A; 
#chains in the Genus database with same CATH homology
 5IWA L;  1HR0 W;  3H3V I;  2HIX A;  5GAH C;  4OO1 I;  1OXU A;  4YHH L;  1Q82 C;  2N78 A;  1Z47 A;  3UE1 A;  1CKN B;  5C0X G;  4B3T L;  3HKS A;  3PUX A;  2PI2 E;  2R7D A;  5ELO A;  4GOP A;  1G29 1;  1E24 A;  3I4O A;  3STB D;  5EAY A;  5H1S E;  1X3E A;  1Q81 C;  4GOP C;  2DUD A;  1K8G A;  3HKZ E;  3J80 i;  4L5T A;  3CCV A;  4KLK A;  3S24 A;  2R6G A;  1PYS B;  3S1Q H;  5HY6 A;  1N9W A;  1R9T H;  4K0K Q;  3RLN A;  3UDI A;  4PZ7 A;  1PVO A;  4GN5 A;  3GTQ H;  2HHH Q;  4JI6 L;  2CKZ B;  4KHZ A;  2ZM6 Q;  1VQG A;  4A93 G;  1KXL A;  1EYG A;  1E22 A;  4HID A;  4X66 Q;  2VUM G;  1UWV A;  4JI0 Q;  1JJC B;  2BA1 A;  2Z6K A;  2PI2 A;  1OXT A;  2WAQ G;  4JG2 A;  2AWN A;  1MJC A;  2R92 H;  1WFQ A;  2VQE Q;  1NBW A;  1OXS C;  4PZ6 A;  1VQN A;  5C4J H;  1VQ7 A;  1WCM G;  1CKM A;  1WCM H;  1X3F A;  4JI1 Q;  1KAW A;  5BR8 L;  2VZA A;  4IO9 A;  2I0Q A;  4JI7 Q;  5LMN Q;  2F4V Q;  5JJL A;  1A63 A;  3AYH B;  3PO2 G;  3PO2 H;  1VQB A;  1IBK L;  1JJ2 A;  3RLF A;  2LXJ A;  3JAM i;  1PYB A;  4O0A A;  4QL5 A;  2JJQ A;  2Q2I A;  2ZTD A;  3PUV A;  5AJ3 Q;  2UUA L;  2VQF L;  1VQO A;  5M5W H;  2JA5 G;  3PF5 A;  3VDY A;  4YY3 Q;  4LF7 Q;  3EN2 A;  1PFS A;  2I5L X;  3B6Y A;  1M90 C;  2OTJ A;  3J81 j;  1K3R A;  4DR4 Q;  5IYD G;  1M1K C;  5LMU Q;  1E1T A;  1SR3 A;  1YEZ A;  3A5Z B;  4LFB Q;  3K0X A;  1VS0 A;  1XMO Q;  4DR2 Q;  2YTX A;  1BBW A;  4OWX B;  2OQK A;  3KFU A;  3TRE A;  4MZ9 A;  2RF4 A;  4RG1 A;  1BBU A;  1U0L A;  2ALY B;  4LF9 Q;  1GVP A;  4GOP B;  3I4N G;  3I4N H;  1J6Q A;  4R1J A;  4EQ5 A;  1Y1W G;  2Q2H A;  1Y1W H;  1V1Q A;  1Z9F A;  3Q8D A;  4A3L G;  1QUQ B;  1XTD A;  4IFD I;  4DKA C;  1HJP A;  2ID0 A;  4JI3 Q;  1OXV A;  4LFA L;  3CD6 A;  4YCU A;  4LF8 L;  1PH1 A;  4P74 A;  1JB7 A;  1IL2 A;  4LF5 L;  1X54 A;  2JA9 A;  1LYL A;  4A3G G;  1C7Y A;  3A74 A;  1PV4 A;  3CCL A;  2HHH L;  3AQQ A;  2FXQ A;  2H5X A;  2K5H A;  3I4M G;  3I4M H;  1YHB A;  4B3T Q;  4X62 Q;  1VQ5 A;  2UXC L;  4X66 L;  1JE5 A;  3J80 c;  3S2H H;  1FVI A;  1CUK A;  4YCV A;  2C35 B;  4LFC L;  3UDX A;  3CXC A;  1YJW A;  4RMF A;  1VQE A;  4A3J G;  4A4I A;  1HNW L;  2Y0S G;  2KCM A;  3CCQ A;  2MO0 A;  1HH2 P;  1D8L A;  2JA8 G;  5C4X H;  5C4X G;  4KHP L;  3U4Z A;  3W1G A;  4JI8 L;  1VQD A;  3S15 H;  2YU9 H;  3AEV A;  4IFD G;  4QGU A;  4JI6 Q;  4JI7 L;  1MIU A;  4HIK A;  1PH4 A;  1YVC A;  1YIT A;  2WB1 E;  2XGT A;  3TEH B;  3F2C A;  1UE5 A;  3CCU A;  5AJ3 L;  4DR7 Q;  3M4P A;  2EXD A;  4YY3 L;  2B29 A;  2BA0 A;  2E2H H;  2B3G A;  2K75 A;  4NXN L;  5FLX c;  2AHO B;  3L0O A;  4GN4 B;  4JBK A;  2YYZ A;  5LMU L;  4POF A;  1KRS A;  3K80 C;  4LF4 L;  4IPH A;  2UUB L;  3NBH B;  5BR8 Q;  3OTO L;  4DR6 L;  3JAM c;  3I7F A;  3L7Z C;  4JBM A;  3CC7 A;  4C3J H;  1SN8 A;  2PQA B;  3OW2 A;  1IBK Q;  4C2M H;  4LNQ A;  4JYA L;  2NN6 G;  4IJL A;  5JEA J;  4DR5 Q;  4BA1 I;  1CKO A;  1NE3 A;  2VQF Q;  2CFM A;  3L2P A;  1EUJ A;  1YZ6 A;  1JJG A;  2Q2T A;  5IP9 G;  3PF4 A;  2NVY H;  1P8L A;  5M3M G;  5M3M H;  4A3B G;  3KDF B;  2K52 A;  2PNH A;  4TQU S;  3H15 A;  2MO1 A;  4AYB G;  3FKI H;  3KF6 A;  2I5H A;  4POG A;  2GN5 A;  1C0A A;  2D62 A;  3M4O H;  3S1R H;  4GNX C;  2KEN A;  2ZTC A;  1YHA A;  3GTK H;  1TWG H;  4JI2 L;  4X62 L;  3U58 A;  1XMQ L;  3CC2 A;  4LW1 A;  3RR5 A;  2MQH A;  3RZO H;  1AH9 A;  1PH7 A;  1EIY B;  4HJ8 A;  3J81 i;  3S1N H;  4IOA A;  2VL6 A;  1Q8K A;  3CCR A;  1EIF A;  1IYJ B;  1YJ9 A;  1SE8 A;  2N49 A;  4DK6 C;  1X55 A;  2E8G A;  4HJ9 A;  4LFA Q;  1VQP A;  3IRB A;  1GM5 A;  3F2B A;  4LF8 Q;  1WOC A;  2UU9 Q;  4LF5 Q;  3DLL A;  4DV5 L;  1PH8 A;  2E5L L;  5GQO A;  4IPG A;  3ER0 A;  2Y0S E;  4JV5 L;  3G71 A;  4R4O A;  4A93 H;  4BBS G;  1K83 H;  4MTN A;  3G4S A;  1VQK A;  3NEN A;  1QVG A;  2VUM H;  4BBS H;  2UXC Q;  1NMF A;  5C3E G;  5C3E H;  2VS1 A;  4DUZ L;  4LFC Q;  4DR7 L;  5GAD C;  1DGS A;  2BH2 A;  3H3V H;  2A19 A;  2UXD L;  2Z6K C;  5JEA G;  4OO1 G;  1HNW Q;  1X6O A;  1FL0 A;  1S40 A;  3HOV G;  2CQO A;  3HOV H;  1HZB A;  2Q2U A;  2UUC Q;  4KHP Q;  4OXP A;  2ES2 A;  1E3P A;  2V1C C;  3CP0 A;  4JI8 Q;  4ALP A;  1PH3 A;  3PGZ A;  1L1O A;  2LSS A;  4GKK L;  2NVX H;  1KRT A;  1CSP A;  1WYD A;  2ZTE A;  4PZ8 A;  1VQH A;  3M9B A;  5ELN A;  4DV7 Q;  4DR5 L;  4DPG A;  4LF6 Q;  2KHI A;  3CC4 A;  1IBL Q;  4X65 L;  2OQ0 A;  1ASY A;  1K8A C;  4IJH A;  2JA5 H;  2YTY A;  1W3S A;  1PH6 A;  2ZJR A;  3GTG H;  1H95 A;  4NXN Q;  5IT9 c;  3WWV A;  4Y7N H;  5IYD H;  1JT8 A;  4R4I A;  3KF6 B;  1CSQ A;  3ULL A;  4GNX B;  3ZJY C;  4LF4 Q;  4IFD J;  2UUB Q;  2AKW B;  1I5F A;  1Y1V H;  1V43 A;  1TWC H;  1Y1V G;  3OTO Q;  5C44 G;  1KC8 C;  4P71 A;  1NJI C;  2JA6 G;  4DR6 Q;  2HT1 A;  3AFQ A;  3TQY A;  3NEM A;  2B63 G;  2IHF A;  3GDE A;  4JOI A;  4AH6 A;  3CCS A;  1SRU A;  4JYA Q;  4YWM A;  4A3G H;  3KOJ A;  3M3Y H;  4AYB E;  3ERS X;  3W5O A;  1Q12 A;  4HIM A;  4OWT B;  1HZ9 A;  5IYB G;  4EX5 A;  1LUZ A;  5IYB H;  4DV1 L;  3CAM A;  1PA6 A;  3S16 H;  2UU9 L;  4KI0 A;  4BBR G;  4B3M L;  1T9H A;  1KL9 A;  2GVB A;  1AE2 A;  3G48 A;  2RCN A;  1I6H H;  5DLQ E;  4JI2 Q;  2JQO A;  4AQY L;  2IT1 A;  1XMQ Q;  2UXB Q;  1N34 L;  2IX1 A;  3HOZ G;  2NVQ H;  3S1M H;  3HOZ H;  5JJK A;  3CPW A;  1JMC A;  2CCZ A;  3SGI A;  2ASB A;  3I56 A;  4PMW A;  3EBE A;  4UP8 A;  4A3J H;  1MJE A;  5IE8 A;  1VQ9 A;  3A5U A;  2JA8 H;  2UUC L;  1PHJ A;  1Q46 A;  1HNX L;  4GLA C;  1XNR L;  4X64 L;  4BXX G;  4DV5 Q;  4OX9 L;  2E5L Q;  2WAQ E;  2VNU D;  1SMX A;  2DGY A;  3KLW A;  3GTO H;  1EWI A;  3RZD H;  4JV5 Q;  1BKB A;  3M4Q A;  3RN5 A;  1KD1 C;  1IXR A;  5IP7 G;  3HKZ G;  4TVA B;  3GTJ H;  4DV7 L;  3T1H Q;  1HNZ L;  2I5M X;  1N36 L;  4LF6 L;  1VCI A;  4DUZ Q;  4AIM A;  1IBL L;  2JK8 A;  1EFW A;  3GTP H;  2UXD Q;  1E7Z A;  2K4K A;  1XPR A;  3ULP A;  1FGU A;  4J15 A;  1CKN A;  3UDF A;  4DV0 L;  4R4Q A;  1Q1E A;  4IOC A;  1YJN A;  5GRO A;  5HGQ A;  4ME3 A;  4OWW B;  3S2D H;  3K7A H;  3F1Z A;  1N32 L;  2KHJ A;  1AE3 A;  3RLO A;  1IBM Q;  4B3S Q;  4GKK Q;  1WI5 A;  2JE6 I;  4A75 A;  3M7N A;  2JEB I;  5M5X H;  3K8A A;  2E2J H;  1X56 A;  3D0F A;  4DV1 Q;  4L5R C;  4A3D G;  4JI4 L;  2R93 G;  2JEA I;  2R93 H;  1HZA A;  4X65 Q;  5FLM G;  1V9P A;  5FLM H;  2K5V A;  4QIW E;  3T1Y L;  4DV6 L;  3E9I A;  1N8R C;  2MNA A;  4C3H H;  1EQQ A;  3HFZ B;  5IP9 H;  3HOW G;  3HOW H;  3U50 C;  3RNU A;  4A3B H;  3PIP A;  4A3I G;  1A62 A;  1TWH H;  3CF5 A;  4NB3 A;  3ICE A;  4JBW A;  5C0X I;  5J3B A;  4JBJ A;  3HOX G;  3HOX H;  4YWK A;  1C9O A;  2RHQ B;  2CWP A;  1I50 H;  2K50 A;  4DNI A;  4HJA A;  3BJU A;  1Q7Y C;  4A3M G;  3S14 H;  4A3M H;  3FHW A;  5JJI A;  1W2B A;  2KCT A;  2UXB L;  3PIO A;  5GAE C;  3W1B A;  2ZJQ A;  2R7Z H;  2R7Z G;  4B3R L;  2Z0S A;  1BVS A;  1VQA A;  1QVC A;  2AMC B;  4JCV E;  4P72 A;  3BZC A;  4R4C A;  4XTC S;  3CCE A;  4C3I H;  2E2I H;  1N33 L;  4GN3 B;  3I55 A;  1SRO A;  3S17 H;  4B3M Q;  1I94 Q;  4BA2 I;  1VQJ A;  2ZJP A;  3PUZ A;  4AQY Q;  4L5S A;  4DUY Q;  1YI2 A;  1KQS A;  3GTL H;  1N34 Q;  3T1H L;  5IYC G;  3M85 A;  3ULJ A;  3A0J A;  5IYC H;  4GLX A;  4DR1 L;  1P16 A;  4OON A;  4DAM A;  1PH5 A;  4WJ3 M;  2YTV A;  2YV5 A;  2QEX A;  1FJG L;  1UE1 A;  2BH8 A;  3GTM H;  3RN2 A;  4IPD A;  1HNX Q;  1QUQ A;  1XNR Q;  4YWL A;  3DM3 A;  4X64 Q;  3CCJ A;  2K14 A;  1X9N A;  3KJP A;  4OX9 Q;  2JA7 G;  2JA7 H;  3PUY A;  1SFO H;  4B3S L;  1K9M C;  1IBM L;  1EQR A;  1L1O C;  5K36 G;  1VQ6 A;  3TS2 A;  1D7Q A;  1I3Q H;  2JA6 H;  3E0E A;  4DV4 L;  1HNZ Q;  4QY7 A;  2F52 A;  1N36 Q;  3LGJ A;  1YIJ A;  1UE7 A;  4UP7 A;  4DV0 Q;  1LTL A;  3BU2 A;  2R92 G;  2VY3 A;  3HOY G;  3K81 C;  3HOY H;  4DR3 Q;  1HR0 L;  2WB1 G;  2QGQ A;  1N32 Q;  5C44 H;  1VQ8 A;  4JI5 Q;  1UE6 A;  2OTL A;  2NZO A;  2WFW A;  2EIF A;  1PH9 A;  2B63 H;  1XPU A;  4YCW A;  4GKJ L;  1GKH A;  4NXM Q;  4BY1 G;  4JOI C;  4BY1 H;  4LUZ A;  4JI4 Q;  1XNQ L;  2OCE A;  1E1O A;  4O2D A;  3T1Y Q;  1K73 C;  4DAY B;  4R4T A;  3D31 A;  4DV6 Q;  3UDG A;  1Q86 C;  5M5Y H;  2IX0 A;  3U4V A;  1GD7 A;  3UE0 A;  1GO3 E;  4IPC A;  3J7Z C;  4BBR H;  4PG3 A;  3STB C;  1VQI A;  1I94 L;  2K5N A;  2N3S A;  1KIX A;  2IY5 B;  4Y52 H;  3KYH C;  1B7Y B;  2D0O A;  3CQZ H;  4DV2 Q;  2XTI A;  3J81 c;  1NTG A;  4DUY L;  4A3F G;  4A3F H;  1U5K A;  2VW9 A;  1L0W A;  1KHI A;  1K0R A;  2PQA A;  4HJ5 A;  1J5E Q;  4DV3 Q;  4B3R Q;  1O7I A;  2NVT H;  5LMN W;  4GLV B;  4QQB X;  4L5Q A;  4DK3 C;  4HJ7 A;  1L1O B;  1N33 Q;  3PO3 G;  3PO3 H;  1LM0 A;  3KF8 B;  4APV A;  2HQL A;  2LXK A;  4BXX H;  1L2F A;  2MFI A;  1MKH A;  3KDF A;  4A3C G;  4A3C H;  1VQL A;  4K0K L;  1G6P A;  1XPO A;  5IWA Q;  1B8A A;  1XJV A;  2N8N A;  1QZH A;  4P73 A;  5IP7 H;  2PMZ E;  2IHE A;  2ZM6 L;  1A0I A;  1X3G A;  4FDB A;  4YHH Q;  2KBN A;  4DR1 Q;  3TS0 A;  2NZH A;  1J5E L;  3NEL A;  2RHS B;  2L15 A;  3CME A;  4JI0 L;  4NPS A;  1FJG Q;  2ATW A;  4UY8 C;  3AFP A;  4XIG S;  1PH2 A;  4DR3 L;  3CW2 C;  4LUV A;  2VQE L;  3FP9 A;  1Y14 B;  4A76 A;  4MNO A;  4JI1 L;  4JI5 L;  2NN6 I;  1VQM A;  1QVF A;  2OWO A;  3PV0 A;  4JC0 A;  4UP9 A;  5C0X J;  2EQS A;  1TXY A;  1G51 A;  3GO5 A;  1EOV A;  5LMN L;  4DV4 Q;  4NXM L;  1B70 B;  4P75 A;  2F4V L;  3KJO A;  3G6E A;  2A8V A;  4A3D H;  4A3E G;  4A3E H;  1NY4 A;  5E7N A;  1SLJ A;  3E9H A;  2QA4 A;  2WP8 J;  1YHQ A;  4BY7 G;  4BY7 H;  3CCM A;  4LUO A;  3JC6 6;  4LF7 L;  3J7A 5;  4H02 A;  1HR0 Q;  3HOU G;  3HOU H;  4A3I H;  1TWA H;  4DR4 L;  1RIP A;  3TRZ A;  2A1A A;  2GVA A;  2HIV A;  1VQC A;  1X65 A;  1YNX A;  3GD7 A;  5M3F H;  5M3F G;  4LFB L;  1XMO L;  3BZK A;  1S3O A;  3EIV A;  3CPF A;  4DR2 L;  1OTC A;  4GKJ Q;  4DV2 L;  1RL2 A;  1XNQ Q;  4X6A H;  3MEF A;  5IY0 A;  4A3K G;  1TWF H;  3OYY A;  3PUW A;  1IZ6 A;  4A3K H;  1VQ4 A;  4LF9 L;  3PSI A;  3PCO B;  2CWA A;  2UUA Q;  2D0P A;  1VQF A;  1YBY A;  3H0G G;  3H0G H;  3I2Z A;  3F8T A;  4GS3 A;  2R7F A;  1WJJ A;  3K7U C;  4DV3 L;  1S72 A;  4A3L H;  4WJ4 A;  4LWC A;  1A8V A;  1OXX K;  4UPA A;  1ASZ A;  2AWO A;  4QJF A;  5FJ8 G;  5FJ8 H;  1NMG A;  4JI3 L;  3F2D A;  3CMA A;  2F3I A;  3FKI G;  1QZG A;  1Q1B A;  1HZC A;  3MXN B;  1UEB A;  5GAG C;  4HIO A;  4GNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...