4A3KG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3kG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3kG01
1FGUA 3HOUH 2LXKA 3WWVA 2B3GA 3J7ZC 1GO3E 1UWVA 2CWAA 5JJIA 2NVXH 4DAYB 4DV1Q 2UXCL 2YYZA 4A3IH 1VQ5A 4GLXA 3S1MH 5IYDG 3G4SA 4A4IA 4BBSH 1U0LA 1C9OA 4PG3A 4R4TA 1Q1EA 2ZM6L 3HKZG 1GVPA 3F2DA 1GKHA 4AYBE 1Q8KA 5E7NA 2OTJA 2WP8J 1CSQA 3CD6A 4GNXA 4A3FG 3HOXH 4JBWA 3CPWA 2I5HA 2N49A 4GOPA 4UP9A 1XPRA 5GQOA 3KJOA 1NJIC 2RHSB 1Q1BA 2MO0A 4HJ9A 2BH2A 1U5KA 2VNUD 4DKAC 4DAMA 4DV4L 1XMOQ 4JI4Q 3RLOA 1HH2P 2YU9H 2JA6G 1W3SA 2HHHQ 1FVIA 3TEHB 1SR3A 2WB1G 4UP7A 1ASZA 4JI6L 5JJLA 3H0GG 4JI8L 4X65L 1UE6A 4YCVA 4BY1H 3CPFA 1QZGA 2JA8H 3TRZA 1SRUA 2HT1A 3HOVH 4A3DH 4UY8C 4LUZA 2D0OA 2F4VQ 4BBRH 3ULPA 3CC7A 4DR1L 2V1CC 1KAWA 4B3TQ 4JI2L 2E8GA 4DV2Q 1CKMA 1KC8C 1S3OA 3PO2H 3LGJA 2BH8A 4DV3Q 3M9BA 3E9HA 3W1GA 4O0AA 4IPHA 3I4MG 3EN2A 1VQNA 1YJWA 5IYDH 5LMUQ 4C3IH 2A19A 3HOZG 2ALYB 4IPDA 3UDFA 2R6GA 4B3SL 4NXML 2R7DA 4A3FH 1EUJA 3U4VA 5M3MG 4IOCA 2Q2TA 4JI1Q 1PH6A 3T1HL 1PH8A 4R1JA 4YCWA 3PUZA 5C44H 5IWAQ 4LF9Q 4B3ML 4DR5Q 3TREA 2VUMG 2F3IA 4L5QA 3FHWA 4YWLA 4APVA 3DLLA 4OWTB 4AQYL 1VQGA 1VQCA 1VQ4A 2JA6H 4IOAA 4A3KH 2RF4A 2KCTA 3MEFA 1GD7A 2HIVA 3H0GH 3B6YA 3UDXA 4C3HH 2QEXA 3VDYA 1K3RA 2C35B 4AH6A 3S1RH 4NXMQ 2E2IH 2PQAB 5DLQE 1YHQA 4IO9A 2UUAL 2JA7G 1Q12A 2YV5A 3M4QA 2ZJRA 4A3JG 4DV7Q 1AE2A 1G51A 2DUDA 3J81j 4GNXC 1QZHA 1PHJA 3J7A5 4GOPC 4AIMA 4DR3L 5AJ3L 3HOWH 5IP9G 4JCVE 4NB3A 3KDFB 3S2DH 1I94Q 4HIMA 1AE3A 2CFMA 4YHHQ 2VL6A 1S72A 1J5EQ 4HIDA 3I4NG 1JB7A 2UUCL 1PFSA 4C2MH 2I0QA 2VS1A 1K8GA 1PH7A 3HOZH 4DPGA 1TWFH 1VQOA 5IYCG 1XMOL 3KYHC 1UE7A 2ZJQA 4DR7L 3ER0A 4R4QA 5GAHC 4YWMA 1PYBA 1HNXL 3T1YQ 3CCUA 3UDGA 3KF8B 4JI5Q 2VUMH 1HR0W 4R4CA 3CCMA 4GNXB 1A63A 2NVQH 1WOCA 5LMNL 1GM5A 5GROA 2YTVA 2WAQE 4JOIA 4QGUA 4IFDJ 3TS2A 1IZ6A 1XNQL 1LUZA 3HKSA 4NXNL 1I50H 4A3MG 2Y0SE 3OW2A 4LF4Q 2LXJA 4UP8A 4DNIA 1R9TH 3H15A 4GKKQ 1MJCA 2K14A 1CKNB 2DGYA 3RNUA 1N34L 3PV0A 1FJGQ 1X3FA 1V43A 2XTIA 4KHZA 4JI7Q 4LF5L 3ULJA 2E2JH 3AEVA 5IP9H 3U50C 1BBUA 2EXDA 3L2PA 3I4NH 3CCSA 1L1OA 1FL0A 1I5FA 3AYHB 4WJ4A 4O2DA 2N78A 2ES2A 4JYAQ 4P75A 1H95A 3RR5A 3DM3A 4DR2Q 3K7UC 1S40A 2WAQG 4TVAB 3W5OA 3HKZE 5ELOA 4KHPQ 2VQEQ 2Y0SG 1VQKA 4JV5L 2OQ0A 3K81C 1IL2A 4LFAQ 4A3CH 4MZ9A 4X6AH 4GN3B 1UE5A 2KCMA 2MO1A 3J81i 1X54A 1XMQL 4JI0L 1IYJB 4A3MH 3JC66 4X62L 4JI3L 3PO2G 1WYDA 2CWPA 2VQFL 3PUXA 4HJAA 1Q86C 1Z47A 3RLNA 1VQLA 4A3EH 3GTPH 2I5MX 2CQOA 1VQMA 3Q8DA 4EX5A 4LF8L 1BBWA 1LTLA 5JEAJ 4QIWE 2UU9Q 3CAMA 1Q81C 1VQBA 1E1OA 5IYBG 3S15H 3JAMc 1HNZQ 1IBLQ 4NPSA 4GKJQ 5C4XG 2R7ZH 2B63G 4JV5Q 1X56A 5C44G 1JMCA 4DV6L 1CSPA 3GTJH 4A3LG 4DV0Q 4TQUS 3AQQA 4A3KG 4YY3L 1PH5A 2NVYH 1HNWQ 1CKNA 3UDIA 1T9HA 1NMFA 3KJPA 1N36Q 1LYLA 3FKIG 3ZJYC 1YHAA 4IJHA 1EQRA 4LF6Q 3OTOL 1IBKL 2IHEA 5EAYA 1HR0Q 5HGQA 5M3FH 3I4OA 4OX9Q 1PH3A 1Z9FA 3I7FA 3HOYG 3ULLA 2OTLA 1UEBA 3G71A 1MKHA 1Q82C 1EIYB 4LF7L 3HOWG 1E3PA 4X66Q 4IFDG 4QQBX 1KRSA 2OCEA 1P8LA 1Q7YC 5GAGC 3U58A 2JE6I 1VQ7A 1VQPA 3J81c 3TQYA 3SGIA 1X6OA 3HFZB 2E5LQ 1C7YA 4DR6L 1Y1VH 3BZCA 2I5LX 5IYBH 1X3EA 4JBMA 3K7AH 4DV5Q 2AWOA 2RCNA 1VQEA 2K75A 5C4XH 1XPOA 2B63H 4DR4Q 4KHPL 3GTQH 4A3LH 1WJJA 1PV4A 1HJPA 1X65A 4OONA 1L1OB 4LFCQ 1XNRQ 2BA0A 1JT8A 1YIJA 1QVCA 3A74A 4KLKA 1IBML 4K0KL 4LFAL 2UXBQ 1O7IA 3K0XA 1XJVA 1N32L 2IX1A 3FKIH 2L15A 4DV1L 2CCZA 2YTYA 5BR8Q 1KXLA 1XTDA 1K73C 1IBMQ 5IE8A 2JQOA 3CC2A 2KBNA 4B3RQ 3HOYH 2UUBQ 2UXDQ 4QL5A 2ZJPA 3CQZH 1N33Q 4GS3A 1E1TA 3E9IA 2OQKA 3PUYA 4PZ7A 1L0WA 2JEBI 4L5RC 1IBLL 4GKJL 3NBHB 3CCJA 1VQ9A 1NY4A 2K5NA 2YTXA 3BJUA 4IFDI 4DV0L 4JI4L 4PMWA 4A3BG 2JJQA 2HHHL 2JK8A 4POGA 4X64Q 2PI2E 1PH2A 5JEAG 1E24A 1HZ9A 1PYSB 4P73A 1YEZA 1HNWL 2LSSA 4A3CG 4JBJA 3CCVA 4HIKA 4XIGS 1C0AA 3S1QH 2ASBA 1DGSA 3GO5A 5FJ8H 5ELNA 2F4VL 2K5HA 3A0JA 1YVCA 3BU2A 1EWIA 2IHFA 4P71A 1K8AC 4OWWB 2UXCQ 4B3TL 4A93G 1Y1WH 2Q2UA 5GAEC 4DV2L 1BKBA 2GVAA 2ZM6Q 1AH9A 2IT1A 4DV3L 4A3EG 2R92H 3CP0A 2K50A 2AWNA 1HZAA 3PF5A 4C3JH 5LMUL 3A5ZB 2KENA 4YWKA 5LMNW 1OXUA 3RZDH 1X3GA 4DV4Q 5C0XI 4DUZQ 1SLJA 3D31A 4JI1L 4DUYQ 1YI2A 2R7ZG 1G6PA 2QA4A 1W2BA 1VQAA 2JA5G 4JI6Q 4JI8Q 4X65Q 2VW9A 4BY7H 4BA2I 3GTKH 5IWAL 3PSIA 1ASYA 4DR5L 4HJ7A 4LF9L 3GTMH 1X9NA 2A1AA 3AFPA 4LUVA 3CXCA 4A3BH 2PMZE 2PI2A 4OXPA 5C0XJ 3S14H 4DR1Q 3W1BA 1VQIA 4JI2Q 4A76A 3RN2A 1OXXK 1TWGH 4L5SA 1EYGA 5K36G 5M3FG 4DV7L 1OXVA 4A93H 3PUVA 1YJ9A 2AHOB 5IP7H 1M1KC 4K0KQ 3BZKA 4DK6C 1XPUA 4LFBQ 4R4OA 3PGZA 1UE1A 1VQDA 3I2ZA 3UE0A 1VQJA 3STBD 1I94L 4YHHL 3G6EA 1QVGA 1J5EL 1KQSA 5FLXc 4B3SQ 3EBEA 3KF6A 4JC0A 1TWCH 4J15A 3F8TA 3CF5A 2N8NA 4IPCA 2PNHA 4HJ8A 2AKWB 3T1HQ 1Y1VG 4R4IA 4B3MQ 4AQYQ 3F1ZA 1KIXA 1QUQB 1VQFA 4X64L 2D0PA 2K52A 4JOIC 2JA5H 5M5XH 3T1YL 2FXQA 4H02A 4LW1A 2NVTH 1X55A 2MQHA 3KOJA 4JI5L 4A3GH 1RIPA 4IJLA 1PH9A 3S1NH 2H5XA 4MNOA 4RG1A 1Y14B 1TXYA 2UUAQ 1MIUA 2NN6G 3PF4A 2E2HH 1A0IA 1KRTA 4P72A 1YJNA 4BA1I 4LF4L 1SFOH 2VZAA 3M85A 1K9MC 3S24A 4GKKL 5IT9c 5AJ3Q 4DR3Q 1J6QA 4WJ3M 2XGTA 1FJGL 1NBWA 1WI5A 4POFA 2OWOA 3M7NA 1VS0A 3RLFA 1L1OC 2JEAI 3ICEA 5JJKA 2UUCQ 2MNAA 1CUKA 2R7FA 4HIOA 4JI7L 1A8VA 1CKOA 4ME3A 2RHQB 4DUZL 3PUWA 5HY6A 1VCIA 3UE1A 1Q46A 4DUYL 4DR7Q 4JYAL 2R93G 4L5TA 1TWHH 5M5WH 4DR2L 1EOVA 1HNXQ 1KD1C 4JG2A 3GTLH 4PZ8A 2VY3A 3IRBA 3RN5A 1YHBA 4LWCA 2Q2IA 2VQEL 5LMNQ 2NZOA 1SN8A 4EQ5A 3PIPA 3GTOH 3KFUA 1LM0A 3G48A 1XNQQ 1OXSC 1JJ2A 3PO3G 1K83H 4NXNQ 5FJ8G 4PZ6A 3CW2C 4UPAA 4AYBG 3S17H 4BXXG 4QJFA 4GN4B 2IY5B 3GDEA 3U4ZA 5C4JH 1N8RC 1N34Q 1Y1WG 2K4KA 3PIOA 2N3SA 2JA9A 4Y52H 1SMXA 4IPGA 2ZTDA 4YCUA 4LF5Q 2MFIA 1KL9A 2NZHA 3J80i 5C0XG 1A62A 3CMEA 2R92G 2NN6I 3F2BA 1HZCA 1NTGA 3STBC 4HJ5A 1QUQA 1I6HH 3F2CA 2QGQA 3K8AA 2ZTEA 2UU9L 3GD7A 1HZBA 1I3QH 2GN5A 1K0RA 4ALPA 4RMFA 4OO1G 5FLMG 3L7ZC 1P16A 5GADC 1HNZL 3M4OH 1NMGA 1QVFA 1WCMG 1YZ6A 4FDBA 1B8AA 3M4PA 4BY7G 2CKZB 1OXTA 4GLAC 5C3EG 4P74A 2WFWA 1RL2A 1PA6A 2ZTCA 1VQ6A 3AFQA 4KI0A 5IY0A 1MJEA 3KF6B 4OWXB 2B29A 1PH4A 3OYYA 1E22A 3FP9A 1JE5A 1N36L 1BVSA 3PO3H 1XMQQ 4JI0Q 2Z6KA 3TS0A 4BXXH 1V9PA 4X62Q 4JI3Q 1EQQA 1E7ZA 1YBYA 1G291 4LF6L 1HR0L 3RZOH 2VQFQ 4OX9L 3NEMA 5IP7G 3MXNB 1KHIA 3I4MH 3CCQA 4LF8Q 4LNQA 4X66L 1JJGA 3S16H 2ID0A 2EQSA 4DK3C 1OTCA 2K5VA 3L0OA 1B7YB 3K80C 3CCLA 3EIVA 5M3MH 5H1SE 4XTCS 1PH1A 2E5LL 1EFWA 1YITA 2F52A 4DV6Q 3NELA 4QY7A 2HQLA 4JBKA 3H3VH 5FLMH 1VQ8A 3J80c 4GOPB 4DV5L 4YY3Q 3I56A 1WCMH 1N9WA 3I55A 4DR4L 1JJCB 2IX0A 5C3EH 4A3GG 3HOUG 3H3VI 4LFCL 1XNRL 4OO1I 3ERSX 3KLWA 3JAMi 3CMAA 3PCOB 1L2FA 3OTOQ 1EIFA 4A3IG 1IBKQ 2JA7H 2UXBL 2Q2HA 1D8LA 4A3JH 4BBSG 1WFQA 1D7QA 1YNXA 4GLVB 4LFBL 4LF7Q 1IXRA 5BR8L 3S2HH 1V1QA 4Y7NH 3E0EA 4MTNA 5M5YH 3HOXG 2BA1A 4B3RL 2GVBA 2R93H 1PVOA 1M90C 2UUBL 2UXDL 1N33L 3CCRA 2HIXA 5J3BA 4DR6Q 2AMCB 2KHIA 5IYCH 3CCEA 1SROA 2A8VA 3GTGH 3A5UA 2PQAA 4BY1G 2KHJA 2JA8G 3CC4A 2ATWA 2D62A 1TWAH 3NENA 4LUOA 2Z0SA 3HOVG 4A3DG 2Z6KC 1SE8A 4BBRG 4GN5A 1NE3A 3KDFA 4A75A 1VQHA 2WB1E 3D0FA 3M3YH 1N32Q 1B70B 2EIFA
chains in the Genus database with same CATH superfamily
1FGUA 3GTLA 2LXKA 1CT1D 5AFWA 3CVZA 5DGBA 5L1LA 2RCFA 2R8HA 4ZI7F 3NGDA 4I65A 4RGMA 2YZNA 5DM63 1K3BC 4GLXA 3RZDB 3G4SA 4A4IA 1AZQA 3N44B 4RCOA 1N33H 1EIGA 4G57A 4R4TA 3DF7A 1Q1EA 1K83A 3HKZG 2JYOA 2OTJA 4AYBE 3KF8A 5E7NA 2N49A 4BY7B 1NJIC 5KFQA 2W7OA 4ECWA 4ED2A 2MO0A 3OHXC 2BH2A 4JI4Q 2Q8TA 1W3SA 1LTTD 1D1KA 1FVIA 3K59A 1SR3A 2WB1G 5JJLA 3G8CA 4QW9A 3CPFA 2R8KA 1SRUA 5L9XA 1PFNA 3I3CA 4UY8C 4LUZA 2BOSA 1RJPA 5A2QL 1KAWA 2VXWA 3CKIB 1LACA 4B3TQ 5GONF 2R93A 2QK4A 1QNKA 3R5HA 3SE7A 2O03A 3W1GA 4FBTA 2VA2A 2BE5C 2J4XA 5DQIA 4NLGA 4FS2A 2F3VA 3HOZG 5KFMA 4DV4H 3EVQA 4Q0FA 4HAEA 4JI8H 3HGBA 1PH8A 3S1NB 2FFKB 4R1JA 4YCWA 5BMVF 3HEJA 3IFTA 5IWAQ 2VUMG 4YWLA 4OWTB 5KFOA 5C6AA 1DXMA 4A3KH 3E3XA 4UCRA 2HIVA 2V4DA 3PW0A 2GA4B 4ECSA 1F9SA 4YJ2F 2A5HA 4UCOA 4C3HH 2B2VA 3VDYA 2F0LA 2TMPA 5DLQE 5KFZA 4M8AA 1Q12A 2YV5A 1B6SA 4BWSC 2F0KA 2ICIA 1PHJA 4GNXC 1WR2A 2F1MA 3BDLA 4RB1A 3V2TA 4AIMA 4G7ZC 2EVBA 1B9MA 3S2DH 4NXMH 4I55F 3I4NG 1RJRA 2VL6A 3CHBD 2B8GA 4HIDA 1JB7A 5KFGA 2DIKA 2I0QA 4F8MA 3HOZH 1TWFH 3ORQA 3KYHC 3RTXA 1EYCA 4FO2A 2A6EC 2M05A 3UDGA 5JAVA 1GUOA 4KJOA 4DAPA 3I72A 2VUMH 1RODA 5C4JB 2C22A 5LMNL 3NWTA 5DG8A 2WAQE 3E0JA 1IZ6A 1XNQL 1ILPA 4RH6A 4YIJA 2W6PA 4NXNL 1I50H 2R7MA 5KT5A 1E4FT 3OW2A 1R9TH 4DNIA 5LL6X 3TN2A 1SYCA 1N34L 3SEBA 4ECRA 2DY7A 5EKLA 4O2BF 4XXEA 1V43A 3KLSX 4KHZA 4UCUA 2JA6B 3Q8RB 1XMOH 1BBUA 1KAAA 2EXDA 3I4NH 5EKKA 1QE6A 5KFNA 2N78A 4JYAQ 2FP4B 1HNXH 2MUYA 1YNJD 1S40A 1UUPA 2VPQA 3HKZE 2FK2A 2K05A 1HXYD 2CQAA 4UFZA 1EY6A 2Y0SG 3J7AV 1JICA 4Q8FA 2V4QA 2EY2A 4AYBB 3R93A 5EKIA 1GHKA 3RZOB 1UE5A 2KCMA 2B2UA 4DV2H 5T1GA 2YU9A 2EJMA 2MO1A 3EPIA 3I4MB 1STAA 3BQ2A 3S16B 1IYJB 2CH4A 2F0HA 4IQZA 2EYOA 4XQNA 3GV7B 4HJAA 2VQFL 3PUXA 1Z47A 3MA2B 1CA6A 3VYTA 4O3QA 2I5MX 2DY8A 1VQMA 4EX5A 4XYLB 1TQOA 1VQBA 5I4DA 1E1OA 4C5CA 5IYBG 4IUNA 4KKUA 3JAMc 3S15H 2FKLA 4GKJQ 1AEXA 1ZHQA 1X56A 3GTJH 1HA6A 4A3LG 2P5ZX 2ZDQA 3J7YW 3BJYA 4YY3L 3K58A 3H09A 1HNWQ 3QB3A 1CKNA 5KT3A 1T9HA 4ID6A 3KJPA 2XGPA 5DQGA 4JI0H 4Y7NB 1LYLA 3FKIG 1K0SA 1YHAA 4MV7A 4FXGC 2XCAA 4ECQA 1EQRA 3J80E 2EY1A 3OTOL 1IBKL 5EAYA 3H0GA 2WINB 2SNMA 3HOYG 3ULLA 4U6PA 3BABA 4JW0A 4X66Q 4IFDG 2QDLA 3GTGB 4I50F 3U58A 2ZXOA 4GZYC 2LS01 5CV7A 2E5LQ 1BO0A 4QIWA 1BXTA 2J9GA 1B4OA 2I5LX 1TKWB 1SMYD 4OGQC 5IYBH 5ISRA 5A2QW 1KC7A 1LTGD 2EYFA 2K75A 3M3YB 3HRZC 4A3MB 1JOOA 3OHAA 1PTOD 4A3LH 1WJJA 1PV4A 4CKCA 1LTAD 1KJIA 2BA0A 1SCUB 1YIJA 4IAJA 1IBML 4C5AA 1RTOA 3K0XA 1C4QA 5CV8A 2IX1A 5ELEA 3FKIH 2L15A 2YTYA 5BR8Q 4IUUA 5JVLA 4B3RQ 2V58A 4JV1A 4TV8F 3HOYH 2VPSA 1FNUA 4QL5A 2ZJPA 2YS7A 2WAQB 4IFDH 3QR8A 3PUYA 2OQKA 3I90A 3V6JA 1ET6A 5CA1F 4JV2A 1STHA 2QF7A 3NBHB 5A35A 2K5NA 3QIAA 1R4PB 2YTXA 3IFDA 4ODGA 4DV0L 1JWMD 1EL0A 4JI4L 1K1QA 4U673 4CC5A 1SJHD 4POGA 4MN3A 1PH2A 2PI2E 5JEAG 1E24A 1YEZA 2LSSA 4KK7A 2EYPA 4LFAH 4JBJA 4HIKA 1BXRA 1NCVA 3S1QH 1HA5A 5FJ8H 4QWBA 2K5HA 4DV1H 3A0JA 2NTSA 3RJ0A 5LL6b 3DM1A 4P71A 2UXCQ 3T5JA 4O1NA 2EOTA 4B3TL 4A93G 1QG7A 4XQQA 3HKZB 4MHEA 1TWAA 2ZM6Q 1AH9A 2IT1A 3CP0A 2K50A 4OEMB 2B63B 3IAYA 3A5ZB 5CGKA 1SNDA 2KENA 4YWKA 5LMNW 1OXUA 3H94A 5C5LA 1X3GA 1NAPA 4A3KB 1S9FA 5C0XI 1EY0A 2XD4A 3BS1A 1I6VC 1RJQA 3GTPA 4C3HB 3X3NA 5KFRA 4X65Q 2VW9A 4BA2I 3GTKH 5IWAL 1Q3LA 1K28A 2ICEC 1DV2A 2F4VH 3ZYYX 5JEAH 4H7BA 2FJ2A 4A76A 3D8GA 3RN2A 4RB2C 3S2DB 1A3UA 4O4IF 4L5SA 3WDNA 3G7LA 3NE5B 5K36G 4RUCA 2EDGA 4A93H 3R5FA 1TWFB 5IP7H 5BPHA 4MV6A 4LFBQ 2JXMB 3OWEB 3JAMW 1UE1A 3UE0A 1VQJA 3G6EA 1HQMC 1SYGA 1KQSA 3EBEA 5C3XA 1D1IA 5KNCA 1Q8IA 4IPCA 2VUMB 1NR4A 2AKWB 4ME6A 4LF9H 2AUKA 2BDOA 2LMCB 5KG1A 4PV1C 4IR1A 3J81L 1EOTA 2K52A 2AQ1B 4JOIC 4H02A 1R9TB 4A3GH 3KOJA 3QOLA 1RIPA 3MFYA 2PZTA 1ZEQX 1RD9D 2PMZA 1Y14B 1O7YA 2F4IA 1GUGA 3MZ5A 1RDPD 3I91A 2UUAQ 1X3PA 4BA1I 3GV5B 2P0AA 3SK4A 1K9MC 3S24A 2F0EA 4DR3Q 1J6QA 4YHHH 4ECZA 2MP1A 4EYHB 1L1OC 1D5ZC 3ICEA 1HRJA 4EYIB 3GTMB 3BG5A 2R7KA 3GIDA 4ME3A 2RHQB 3A54A 2B39A 3KHGA 1B1ZA 4R8UA 4DR7Q 4JYAL 1NNXA 4L5TA 1TWHH 3T1YH 1EOVA 5KFYA 4PZ8A 1WTPA 4TUYF 3TIIA 3IRBA 5M9OA 1JXLA 3EPGA 2Q2IA 4K8JA 1S10A 2NZOA 4EQ5A 3GTOH 3KFUA 2DZDA 3PO3G 1Y8PB 4LF4H 4ED3A 4BXXG 4GN4B 3FPUB 1L0XB 5DLFA 1Y1WG 2K4KA 1FJGH 2DJGC 2PO4A 3KXYT 2WIIB 3T53B 4MTEA 1SMXA 5KYLA 4IPGA 4OIJA 4LMYA 4LF5Q 3J80i 2NZHA 3S15B 4MV1A 3MFHA 3WO0A 4CJ1B 2F3WA 3STBC 3GTJB 5KFKA 4DUYH 4NW2A 1K8OA 4FS1A 2GN5A 1PTOF 3BA8A 2WKDA 2VQDA 3M4YA 3ERQA 2VQEH 2UVRA 1L2ZA 1WD1A 4FDBA 1EUDB 3M4PA 4BY7G 3SK6A 4Q44A 1VQ6A 4IUPA 2B29A 3N52A 2A73B 3OYYA 1PH4A 3GP7A 4EFEA 3PN1A 1BVSA 4R8NA 3PO3H 3VR2A 4BXXH 4JI3Q 3A56A 1E7ZA 1YBYA 3FPPA 5KT7A 5KG4A 2IBKA 1KHIA 4R9WA 3SK8A 4X66L 1JJGA 1HFGA 2LKVA 3RGXA 4DK3C 4OL7A 1TWGA 2GLTA 1ESFA 4DL7A 3CCLA 1GGOA 2X6GA 1EEFD 1K8MA 3EIVA 5M3MH 4XTCS 2E5LL 1K1SA 1XXGA 4LH7A 3M4IA 4QY7A 4JBKA 2DLNA 1G6ZA 5FLXL 1VQ8A 3J80c 4C5BA 1SMYC 3BYTB 3I55A 5TSSA 1TIID 2IX0A 3FKIB 5DG9A 1GLVA 1PTOC 4OO1I 3KLWA 1M0WA 3MEHA 1I4PA 4LF6H 3CMAA 1HR0H 1L2FA 2F0PA 3HOYB 1DZ1A 3M9OB 5I2YA 5EZYF 2I46A 2YRXA 5EDWA 1CK1A 2ZT9C 4LF7Q 1H9SA 5BR8L 4PMCA 1DYQA 5M5YH 4MV8A 4B3RL 1PZID 2PN1A 4J9NA 3CCRA 2I8CA 4DR6Q 2H1EA 3V05A 1FNWA 1SROA 3P75A 1SAPA 2CW0C 5KGUA 5KKNB 5IIFA 4DR4H 3S1QB 4OHJA 5JPNC 3E5SA 2W6ZA 3CC4A 3NENA 4LFCH 4A3DG 3ONAB 4IUTA 4BBRG 2DPJA 4GN5A 2UXBH 3VR4A 3OHBA 4K0KQ 3D0FA 1WTWA 1RK5A 3MXNA 2OTLA 1Y1VA 1D5XC 3WWVA 2B3GA 5JJIA 1GO3E 4Q43A 2R8JA 3V4ZA 2UXCL 2YYZA 3FVQA 4FYDA 1VQ5A 4IHJF 1U0LA 2UXDH 5CR3A 1C9OA 4PG3A 2ZM6L 4RHSA 3J81W 1GKHA 1S68A 2RQXA 4YAJB 1CSQA 5KFTA 2KCCA 5KEEA 4GOPA 4ZK9B 3PZPA 3GTKB 2RHSB 3HXLA 1U5KA 4DAMA 4L1KA 2JA6G 3VR5A 1H9RA 2HHHQ 5FOBB 4O3OA 2L5TA 3O13A 1R4QB 4X65L 4V190 1UE6A 2R84A 4RU9A 2OEOA 2XCPA 2R86A 4QUCA 5EGTA 4FF2A 3TRZA 4J0MA 1WTHA 3IL8A 4LSAA 2O5JC 4A3DH 4A93B 3TP7A 2QCPX 4BBRH 5DAUA 3CC7A 2V1CC 3ITPA 2X69A 4ME5A 3JRWA 4EFBA 1CKMA 1S3OA 3LGJA 4DV3Q 1F2ZA 1Z6HA 2WYOA 3V96A 1ENFA 4IPHA 3I4MG 2W6QA 4X3SA 4WFN3 1OWTA 5KT4A 1MI2A 3GQBA 1RTNA 1JKJB 3UDFA 3T5LA 4AYBA 5KG7A 2QYZA 2R7DA 4HQ6A 1EUJA 1SEBD 2PPBC 4A3GB 2V9WA 1B50A 5KX5F 1PZKD 2DNEA 1Z7TA 5DG7A 3CU7A 2NU7B 3TREA 4APVA 2NVXB 3FHWA 1VQ4A 2JA6H 3HG9A 4A3IB 4Q8EA 1MHWC 3B6YA 3DMUA 1DV1A 1DOLA 4DR1H 1IBKH 4XT3B 4JI2H 2WACA 2W71A 4KN7C 4AH6A 1EFID 2YYAA 4IWYA 2E2IH 2PQAB 1D2BA 2UUAL 2ZJRA 4U68A 2Z1CA 1AE2A 3J81j 1QZHA 3J7A5 4DR3L 3E5NA 5IP9G 4B3SH 4FXKC 2TSSA 4HIMA 1AE3A 1S72A 1J5EQ 1TWHB 3J7AF 5HURA 1PFSA 3T1HH 4C2MH 4RFBA 1K8GA 1PH7A 1VQOA 4OIKA 4B3MH 5IYCG 3GTOB 4DN4M 3NBIA 1B04A 4AQYH 1TS2A 2ZJQA 4EQOA 4DR7L 2UVUA 5D14A 5GAHC 3R5XA 2D5DA 1PTOH 4ZYSA 3ETHA 3JZIA 1EY5A 2VUGA 3CCMA 5ELFA 5GROA 1YNND 5BN5A 3H40A 1I4XA 4IFDJ 3GTGA 1LUZA 1ET9A 4A3MG 2Q8RE 5FD6A 2LXJA 4UP8A 3H15A 5I6YA 1MJCA 2K14A 4GKKQ 1ZYRD 3QG1A 4TSSA 1STEA 3PV0A 1X3FA 2EE1A 3W3AA 2UUCH 4J8QA 5KFLA 3G6VA 2XTIA 4LF5L 1S5DD 3SR1A 2E2JH 3BQ1A 1BCPD 5IP9H 3TZUA 3L2PA 3AYHB 2SDFA 4O2DA 4RNNA 4P75A 1H95A 4QWEA 2FLPA 1CE8A 1LO5D 3K7UC 2HCIA 2WAQG 3VR6A 2ASJA 3OIQA 4KHPQ 3PO3B 1CHQD 1V1PB 5E1FA 3K81C 1E4GT 2D9UA 4KY6A 4X6AH 1GUNA 2B2TA 2XN9C 4TQRA 3SE0A 3R2TA 3H20A 2BR0A 2ZDHA 4J9MA 2X0SA 4A3MH 3K57A 3JC66 4JI3L 3L4JA 1EUCB 1BNCA 4C56C 4ZQ3A 1JC7A 1C30A 1RKNA 4L6TB 5M3MB 1Q86C 1E0BA 3RUPA 4A3EH 2NU9B 4ECTA 1WD0A 2PYKA 1BBWA 2Z6BA 1RF2D 5JEAJ 2UU9Q 1Q81C 3PIP3 2B2YA 5IWAH 5HV6A 1J8IA 4IUQA 2CH4W 3K5IA 3MWEA 1SYFA 1E2ZA 2R7ZH 2B63G 4JV5Q 2ALZA 1OO9B 1JMCA 3TP5A 4DV0Q 4TQUS 3HKZA 2K5QA 3A8JE 4A3KG 2C00A 1PH5A 2NVYH 2G5DA 2XIGA 4C3HG 4JVZA 3PR5B 1N36Q 3F8NA 1XMQH 3RIZA 1EQVA 5IGDA 4X62H 3ZJYC 5M5YB 5I6WA 4KMUC 4F4YA 4NDXA 4F4ZA 3KAJA 5EWGA 4J1MA 2WB1A 5HGQA 5M3FH 3I4OA 1PH3A 1Z9FA 3NTHA 3RB6A 1UEAB 5LL6S 4LF8H 1BGWA 4LF7L 1MZBA 4QQBX 1BDOA 3DEOA 1Q7YC 3UFXB 2JE6I 1VQ7A 1W96A 1N56A 4F4WA 1QILA 1VQPA 3EJIA 3TQYA 1GSOA 2EZVA 1C7YA 4DR6L 4DV6H 1DOKA 4RAYA 2C28A 3BZCA 4O3RA 2L4NA 4XYOA 1BR9A 4LMQD 1II3A 3T16A 4Y8VB 1ICFB 2AWOA 2HUGA 1XPOA 2B2UC 2B63H 4ED8A 4DXFA 3OSOA 3GTQH 3KHLA 3URYA 1L1OB 1XNRQ 1TWFA 1JT8A 4O4HF 5L1KA 2HVQA 4K0KL 3NPPA 4KV6A 1XJVA 3EQLC 2VUMA 3R2IA 1NUCA 4J9SA 4C3JG 3TMEA 2E74C 4XZ3B 4ECYA 2KBNA 2KECA 3P1HA 1KDBA 3NQTA 2W8KA 1N33Q 1I50A 5L1IA 1R9TA 1CI3M 3E9IA 4L5RC 3MXGA 3M9NB 4CDEC 1SJED 1IBLL 4RB0A 4O3NA 1NY4A 2AQ4A 4EBCA 1GHJA 4ECUA 4A3DB 2A69D 4YAKB 4BBRB 2HHHL 2JK8A 2JEIA 4DK0A 2LFNA 2NWGA 1LLRD 3MAQA 1HZ9A 2HCCA 1HFNA 1N32H 4CJ2C 2ASBA 3GO5A 2RDGA 2W9CB 4NKLA 1YVCA 3BU2A 5KFBA 1EWIA 1B53A 3TSSA 2L55A 1ILQA 3I12A 1SNMA 1C8CA 2F0QA 2Q2UA 5GAEC 2PQEA 2KQ3A 4ZRZA 2GVAA 2R92H 5C0XH 2F0IA 2MHVA 4K5WA 4DV3L 1L0YB 4C3JH 4GKJH 3FMCA 4K14A 3T56B 3D4RA 4DV4Q 1SLJA 1YI2A 5KFSA 1G6PA 3A55A 2QA4A 1VQAA 2JA5G 4JI6Q 4JI8Q 1HNWH 4CC6A 1V51A 1ASYA 3GIQA 3GTMH 4FU0A 2E2IB 4XT1B 3CXCA 3JAML 2PI2A 4ZUJA 1KDCA 1PYWD 1SEIA 4MA0A 2PW5A 2VR1A 4FF1A 3GTJA 4WJWA 5IGBA 1EYGA 4ED7A 5BPFA 3BAAA 1BCPF 1JDEA 4C2MB 2Y0SA 5LMUH 1M1KC 2F0FA 4TV9F 5CV9A 1VQDA 3I2ZA 3PW5A 3STBD 4NXMQ 1J5EL 1SXTA 4JC0A 1PTOB 3CF5A 1TWCH 4JI1H 3F8TA 3RUZA 4UCSA 5FO9B 5HBRB 4DR5H 1EYDA 3GV6A 1QUQB 4X64L 2VB3X 2JA5H 1JOKA 3NTIA 5M5XH 2FXQA 2K03A 4RUAA 3GILA 3T5KA 2MQHA 4J9RA 5CMDA 4ZUIA 3PIO3 5K5PA 5E4WC 5BR8H 4QWDA 1JORA 1YNNC 1MIUA 3PF4A 4HNUA 1DOMA 2E2HH 1A0IA 1YJNA 4DV7H 2E2JB 1TS4A 2VZAA 3M85A 4GKKL 1WTXA 3ORRA 1I94H 1ZYRC 2MJ8A 1NBWA 3UI2A 1A3TA 4POFA 3M7NA 1VS0A 3RLFA 2RKSA 4IRDA 2R7FA 4HCEA 1CKOA 3FKIA 1BCPC 4DUZL 1TU2B 5HY6A 1VCIA 3UE1A 3U9TA 4DL6A 4GC6A 3SI8A 2WDTA 1HNXQ 2VY3A 2OH2A 2L12A 3RN5A 1YHBA 5DEHA 4KHPL 3KLRA 2BDNA 4PNYA 3G48A 4DNRB 4H0LC 3MFGA 3RB4A 1TVXA 2JEFA 2F0NA 4LK1C 1B3QA 1U4PA 5FJ8G 4UPAA 2MPMA 2QW7A 4QJFA 4A3EB 3GDEA 5DM73 1N8RC 3D4WA 2CHBD 3PIOA 2N3SA 4EGJA 1TR5A 2M9VA 5JVDF 1Y8NB 2KVMA 2KEEA 4JI7H 1MSGA 4YCUA 3C0FB 3CMEA 1A62A 3T4AC 3NTKA 2R7ZB 5FO8B 2NN6I 3F2BA 1HZCA 1NTGA 1TS3A 4BWGB 2FJZA 1F77A 2F0OA 3K8AA 2ZTEA 2UU9L 4DR2H 1I3QH 1DD2A 1FR3A 2NVYB 2CW0D 4OO1G 3RFCA 5CB4F 1NMGA 1BUVT 1EY4A 2FPPB 5KFFA 1JWUD 1WCMG 1YZ6A 4JV5L 1PLFA 2K6AA 4GLAC 5CORA 4CDCC 1GSAA 2FK1A 1RL2A 4KKSA 1EYZA 5FPOA 4UCTA 1X32A 5M3FB 3PQIA 3IG0A 1N36L 1B44D 3BDCA 4JI0Q 2Z6KA 1HQRD 3TS0A 3RGZA 1V9PA 2Q8IB 4LFBH 1PDQA 3MHBA 3BDOA 4HR7B 3OMGA 4TRDA 3OW7A 2IL8A 3PVXA 5IP7G 3C2PA 3NHHA 3GTLB 4EGQA 2R3ZA 4YBZB 2Z9HA 2KHSA 1LT4D 1OTCA 2K5VA 3QO2A 5J1ZA 3K80C 1HNZH 5H1SE 3GTQB 2O4XA 4HNVA 2LY7A 5CBAE 4OO1H 3K0YA 1PRTD 3I56A 1WCMH 4HEDA 1JJCB 4A3GG 2K1BA 3MWMA 1XNRL 4HSVA 4X3UA 5DLGA 3ND8A 4YJ3F 2HDLA 4A3IG 2JA7H 3N43B 4OX9H 2Q2HA 4A3JH 1EU3A 4BBSG 1WFQA 2OLSA 4GLVB 4KJNA 1IXRA 3S2HH 1V1QA 1C48A 3M4OB 4V0BA 2PZWA 2IWHA 3HOXG 4XDXA 1IYUA 2F0DA 4DR7H 2UVVA 1N33L 4ED6A 2SNSA 2W57A 2YW2A 2AMCB 3CCEA 1SE2A 4DV5H 3VPBA 2PQAA 1Y69U 4J9KA 4BY1G 3C1EA 2JA8G 1S0OA 5J22A 3OSNA 1TWAH 5IOCA 2A69C 2YCHA 3HOVG 3RAXA 3Q23A 4C1NI 2AUJD 1NE3A 2KSWA 4A75A 1VQHA 1HTLD 4LFAQ 1TWHA 4DL3A 2W70A 4RB3C 3FDSA 2R92B 5KFXA 1UWVA 2CWAA 2NVXH 1M7JA 4DAYB 4DV1Q 4C3JB 2KCNA 5JJZA 4A3IH 3S1MH 4BBSH 5FK9C 1STGA 3GIMA 1B6RA 2UUBH 1I7LA 3VPDA 1ZXTA 2O2LD 2I80A 4EBDA 3BVZA 3SDZA 5D1OA 1GVPA 1S97A 2PVPA 3C1FA 2WP8J 4A3FG 3HOXH 3CPWA 1FD7D 2I5HA 1XPRA 5GQOA 4X3KA 2F0MA 1Q1BA 4CBVA 2VNUD 4ABNA 4DV4L 1XDNA 1F9PA 1KJ8A 2F0VA 3TEHB 2R85A 4UP7A 2R61A 1ASZA 4JI6L 1WTQA 2F0GA 4JI8L 2W7PA 1RYRA 2A6HD 4BY1H 1ZETA 2JA8H 1QZGA 2R6FA 2HT1A 3HOVH 2GPWA 2F4VQ 5CA0F 2AQ3B 1C3OA 4ZHQF 1ML0D 4HNTA 2M2LA 2V4RA 1AUVA 1QOHA 2DPIA 1AN8A 3EA6A 3WNZA 3PO2H 1TWCB 4QWAA 1E4EB 2BH8A 4FP5D 1PK8A 3E9HA 2A68D 5F9NA 2FPGB 4C3IH 3ND9A 1V1PA 3D6WA 3C46A 2ALYB 2R6GA 4NXML 4I7HA 1XTCD 5EPKA 5EBCA 2JA5B 4JV0A 4H13C 5M3MG 3U4VA 5M5XB 4A3FH 2EJGC 1BNZA 3L3OC 1Y1WA 1PH6A 2WKCA 3R23A 4IZ8A 4L63B 1E2WA 2M00A 5C44H 2WTFA 1KJJA 4LF9Q 3EFXD 5JUMA 2F3IA 4L5QA 4K8IA 1S0MA 4IOAA 2E2HB 4DK1A 1LV9A 3MEFA 1GD7A 1TT2A 5G3LF 3FMAA 3MR6A 4YB8B 2AGOA 4JUZA 1K3RA 3MC0B 3S1RH 1YHQA 1S5FD 1TY0A 4IO9A 4FM9A 3WOFA 5I47A 1G51A 2DUDA 2XIWA 4GOPC 1A15A 1CZGA 3HOWH 3WO1A 4JCVE 4NB3A 4YHHQ 2I07B 1VKZA 1JX4A 1WTOA 2RVLA 4DPGA 5D1PA 3Q6SA 1XMOL 1S4ZA 4XYMB 5LA6F 5IT9E 1B2TA 2IP4A 3GIPA 3ER0A 4R4QA 1QB5D 2R82A 4YWMA 3OPOA 1HNXL 3T1YQ 3CCUA 5D8DA 4JI5Q 1F2YA 1LTSD 4GNXB 1A63A 1WOCA 1JE4A 4P2CB 2YTVA 4JOIA 1O7ZA 2K5DA 3HKSA 1ONLA 2B2WA 3BVMA 4LF4Q 4RZQA 1EY7A 4J9OA 2FE3A 4J9LA 1SYBA 2C2RA 1CKNB 2D2CC 1FJGQ 2N88A 1I3QB 2RA4A 2JSOA 5CV4A 2X6LA 4DL2A 3CCSA 1L1OA 3H0GB 5IGGA 4WJ4A 4JK1C 3P7JA 1PRTF 3DM3A 3X3MA 5D3DA 1EWHA 4QMGA 1JCKB 5ELOA 5LMNH 2VQEQ 3DWQA 1VQKA 1XNQH 2OQ0A 2KJXA 1JLLB 4KY7A 4A3CH 2R7LA 4NXNH 3SHLA 2FK3A 4J9PA 2E75C 3DWAA 1N34H 1VF7A 4JI0L 1GUSA 2ZXPA 5A2QE 5CV6A 2R8IA 3W2DA 5KRUA 1WYDA 3BZDB 4B08A 2CWPA 1O75A 1FKAH 4E4TA 4IR9A 5JPMC 3CAMA 4EG0A 1U9RA 1VF5C 1PFMA 1WCMB 1IOWA 1S0NA 1IBLQ 4NPSA 2W9CA 2EXZA 3Q2OA 1CSPA 3VYUA 1N48A 3NK9A 4ED1A 3AQQA 1WVLA 2JA7B 5EOYA 2KUMA 3QFFA 4A3JB 2QDBA 1SYXB 1PRTC 1NMFA 2W6OA 3Q8SB 3S2HB 3SXHA 2Z4HA 5KIXA 2RGRA 2JA6A 4J6HA 4K5XA 3FEWX 4LF6Q 1HR0Q 2VQFH 4DAVA 3I7FA 3MR3A 1UEBA 4N9PA 1E3PA 5C5JA 1KRSA 2F0TA 1P8LA 2OCEA 2RBMA 5GAGC 1TAEA 3GV3A 2E2IA 4O2AF 2CQYA 1X6OA 3HFZB 1TWAB 5COYA 4DU9A 2HVRA 2FMAA 1Y1VH 1TS5A 3VR3A 4JBMA 1FNVA 4RGNA 3EYYA 4O3PA 4YY3H 4F4XA 1LT6D 5CYUA 2CW8A 1VQEA 3PR4A 4DR4Q 4CDDC 4C2MA 1HUMA 1HJPA 1X65A 4OONA 4LFCQ 1QVCA 3S1MB 4BBSB 2AGPA 3OTOH 1Q90A 3QJYA 2UXBQ 4LFAL 4MV3A 1BCPB 4MV9A 2G9HD 4DV1L 3HOXB 1KXLA 2YS6A 1XTDA 1K73C 3GIKA 4I4TF 1M6VA 2B2YC 5IE8A 2JQOA 2DNCA 3KBXA 4G4KA 3MWDA 1FGBD 2UXDQ 2NUAB 4FBUA 3CQZH 3V6KA 2HDMA 5C5MA 1E1TA 1L0WA 5DQHA 2JEBI 2QILA 4B9WA 2R7NA 1F2MA 1SE3A 2MGSA 3K5LA 4BY1B 2CW7A 1VQ9A 2JA8B 4RCNA 3HZXA 3J80W 2E76C 3BJUA 3HOVB 4O3SA 2KA7A 2RDIA 5BN3A 3FDTA 4A3BG 2JJQA 3Q24A 4X64Q 1CS0A 1PYSB 4P73A 3JAME 3LP8A 1IBMH 1EZ6A 1KNAA 2A6HC 4XIGS 1C0AA 5KG0A 5LYJF 3PO2B 4HYKA 1VBHA 1T94A 2AQ2B 5ELNA 2F4VL 3U9SA 1HUNA 3RV3A 1RK6A 5C4HA 1IKLA 4OWWB 4C3IB 4RHRA 3LWBA 3V6HA 4DLKA 1CA5A 1BKBA 4A3FB 1MD2D 1F2LA 4A3EG 1U4RA 1W93A 5DNFA 2HQEA 1HZAA 5C44B 4CKBA 3GLKA 2A68C 1A6XA 4IRCA 5C4ZA 4DV0H 3IKJA 2J6UA 4JI4H 4YR0A 4DUZQ 4KTAA 3KLSA 5KNBA 2R7ZG 5KG6A 4ECVA 2EYJA 1BF4A 1G2TA 3PSIA 4LF9L 3S1RB 3D3RA 2A1AA 1BJTA 4LUVA 2B2VC 4A3BH 1A3VA 1B33N 4ECXA 4ULLA 1DM0B 3N40P 4R8UB 3T51B 4MA5A 2YRWA 5DGAA 3H91A 3S14H 4DA2A 4FF4A 1Z2NX 3HBLA 4LJZC 4FNFA 4DR1Q 4B3TH 3W1BA 1VQIA 4M1UB 4JI2Q 3HOWB 1KEEA 3R8BA 2XGQA 1STYA 2WAQA 1LT5D 4RWSC 5M3FG 3E6ZX 3OUUA 1OXVA 1U4LA 3NBHA 1YJ9A 3BZKA 2FINB 4DK6C 2YZMA 2Z8LA 3PGZA 2E2DC 3T13A 4B3SQ 4YHHL 4K5VA 2N8NA 2PNHA 4HJ8A 2UVWA 3T1HQ 3LWEA 2K01A 4B3MQ 2ZXRA 2IA6A 4F87A 4AQYQ 3F1ZA 1KIXA 1JOQA 2D0PA 4HR7A 2NVTH 3D4DA 3T1YL 2L0CA 1X55A 4JI5L 1IHZA 4IJLA 4MNOA 4RG1A 4R8IA 4LH6A 1XWEA 1I7NA 4BS9A 5CBEE 2W9BB 4RGOS 1EY9A 2NN6G 1GUTA 1O80A 5KFDA 2JEGA 2B63A 5CV5A 4LF4L 2DWCA 3VA7A 3GTQA 1SFOH 4WJ3M 5IT9c 5AJ3Q 3BG3A 5KFVA 2XGTA 4KKTA 4IURA 5C1PA 1FJGL 3GQCA 3BA9A 1NR2A 1WI5A 4A2AA 4WBNF 5KFHA 4G7OC 1B9NA 5JJKA 1AUXA 4RKBA 2UUCQ 4HIOA 1RJTA 3QWNA 1B3AA 4UHVA 1F9QA 1T3NA 4RAUC 1ZHSA 3K5OA 1SNOA 3GIJA 1TY2A 3PUWA 4KY5A 3WOEA 4DUYL 2R93G 2NU8B 2ZJTA 5M5WH 1M8AA 3GTLH 1TWGB 4LWCA 2VQEL 1Z2OX 1SN8A 2HJWA 3PIPA 1LM0A 1D6EC 4N8X1 4TKOB 4MV4A 1ESRA 1JJ2A 1K83H 4PZ6A 3CW2C 3S17H 2IY5B 4CKEA 2I87A 2N55A 1MBYA 1G91A 3RBEA 1G8ZD 3NWSA 1AZPA 2NN6H 4K6DA 1QCBD 3BVGA 3N42B 3SK5A 3AMUA 1KJ9A 2JA9A 2ZTDA 1KL9A 2R92G 5C0XG 2PW7A 1KABA 4LAAA 4ED0A 1I6HH 4JYAH 4JI6H 2F0UA 3F2CA 1H9SB 4YQWA 2CZGA 4IN3A 1K0RA 4ALPA 3A7AB 2F03A 4RMFA 5FLMG 3L7ZC 1P16A 3M4OH 4ZKBB 2R92A 1XYIA 2VOBA 2R93H 4DAYA 1KJQA 2CKZB 1OXTA 5C3EG 2WFWA 2NUCA 2FLLA 4KI0A 5IY0A 3KF6B 4OWXB 4DXGA 1E22A 3FP9A 4DL5A 3QOJA 1CQJB 2RDJA 1XMQQ 1AP0A 3GTMA 4JPBW 4X62Q 3TQ1A 3N41B 4XQJA 1Y8OB 5JVG3 4LF6L 1HR0L 2IW3A 2L11A 3PW2A 3MXNB 4EVOA 1Y1VB 4LF8Q 2HVSA 3N6RA 5KFIA 5FD5A 2OT2A 2EQSA 3PW4A 1IKMA 5J2TF 4UCVA 1EFWA 4IRKA 1YITA 5IODA 4DV6Q 1J9OA 1RHPA 2HQLA 4RNOA 2XC9A 5FLMH 4GOPB 3Q22A 1O78A 4DR4L 4O4LF 1TWCA 3CRKC 1E4EA 1HPCA 5C3EH 3J81E 2K04A 1SE4A 3HOUG 3H3VI 4LFCL 2IJ0A 3TBIB 3ERSX 4TQSA 3JAMi 3PCOB 2C2EA 2UXBL 1VBGA 5T1IA 3CQZB 1D8LA 2JA5A 1YNXA 2ATLA 4X66H 1A2UA 3SVMA 5KFAA 4WORA 2W6MA 3E0EA 4MTNA 3T5HA 3RBDA 2L9HA 2E2HA 2E5LH 2UXDL 3RV4A 1AFPA 5J3BA 2B8FA 3JSLA 1BOSA 5I9PA 5JH7F 3KHRA 3KBGA 4IUVA 1A9XA 2KOLA 3MFIA 5HGTA 2L1BA 5EQ0A 1W6JA 4ILWA 5KFWA 2ATWA 4G3IA 2D62A 4LUOA 2ENBA 4L8JA 2Z6KC 4IZOA 5I2XA 4ZOLF 3NQIA 4HTHA 2WB1E 5IT9W 4DF7A 1N32Q 1W2BA 3HOUH 1DCZA 3J7ZC 4NP5A 4RGTA 3PW7A 1UNSA 3RB0A 4B3RH 5IYDG 3K5HA 4DL4A 3F2DA 1GJXA 1V1OA 2NZ1D 1Q8KA 2EYHA 3CD6A 4GNXA 4JBWA 4UP9A 4YR3A 3AB9A 3KJOA 3I4LA 4MTKA 1V8QA 5ELDA 4A3BB 4HJ9A 2CVRA 1IL8A 2FB9A 4DKAC 3J7AK 1XMOQ 3RLOA 1HH2P 2YU9H 5L1JA 2IMWP 3S14B 5EJWA 3H0GG 3P20A 3MJFA 1JQYD 3U9OA 4YCVA 1JB3A 4E6IA 1I3QA 4N8FA 4EQNA 2DN8A 3S9WA 4CJ0B 2D0OA 1I4RA 1T5EA 3MXUA 1ENAA 1S5CD 2UXCH 2A74C 3ULPA 4DR1L 4JI2L 3AU7A 2E8GA 5G3LD 4ETSA 4DV2Q 2ZM6H 3KUPA 1KC8C 5LOVF 3M9BA 3I8ZA 4O0AA 2BQRA 2RSNA 3D6CA 3EN2A 1VQNA 1YJWA 5IYDH 4ZAIA 5LMUQ 3QZ7A 2A19A 1PRTB 4IPDA 4B3SL 1EHIA 5FPRA 2IX3A 5LXTF 5KFJA 1VAJA 3LWUA 3G6JB 2NVTB 2Q2TA 4IOCA 1KTKA 3KTMA 4JI1Q 5J2UF 4C1NK 2XSCA 4X65H 3T1HL 1JIHA 3PUZA 4B3ML 3FRPB 2K7VA 5D3IB 1EYAA 4DR5Q 2W9AA 3DLLA 4AQYL 2R87A 1VQGA 1VQCA 4I7AA 2RF4A 2KCTA 3OMCA 2IPKD 5FLXE 1JWSD 3H0GH 5KYIA 3UDXA 4HSPA 1SFOB 1DIKA 2QEXA 2ASLA 2C35B 5KT6A 1SNPA 2NBFA 4DNTB 2JA7G 1GUWA 1U4MA 3M4QA 3A7LA 4A3JG 1WCMA 4DV7Q 3LX0A 3G6XA 3GTKA 1EIHA 3KALA 3GV8B 5AJ3L 3OUZA 5FO7B 2OF1A 3KDFB 1I94Q 2CFMA 1SBBB 5M5WB 2BCOA 2JA7A 4Q5VA 1CTMA 2UUCL 4QB4A 3MR5A 2VS1A 1HTPA 1UE7A 4RAZA 5K2MA 4X3TA 5LHY1 1K83B 4PMBA 1PYBA 3S17B 2YZGA 5CAEB 3KF8B 1HR0W 1V4YA 1H9KA 4R4CA 4QW8A 2NVQH 1GM5A 3TQTA 1H9JA 4QGUA 3RD4A 3TIGA 2UUAH 4F7XA 4K2LA 3TS2A 1T36A 1QJOA 2Y0SE 4DR3H 2Z4IA 2DGYA 3MTSA 3R3OA 3RNUA 1I6HB 2RSOA 4IWXA 3K3VA 4YP3A 4XYQA 5EWEA 4JI7Q 3NXWA 3ULJA 4NMZA 3AEVA 2C2DA 3LNNA 3U50C 2NVXA 2WB1B 2R93B 4KHVA 1FL0A 1I5FA 1LABA 4EEYA 3TZDA 2ES2A 3TP8A 1STBA 3RR5A 5NUCA 4DR2Q 4TVAB 1ENCA 3GIIA 3W5OA 2F0JA 4N9TA 1SYDA 5F9LA 4UAIA 3VYSA 1IL2A 4MZ9A 4GN3B 4G7HC 2WE6A 3J81i 4RA8A 1X54A 1IOVA 2FHTA 1XMQL 2XRQD 3HOZB 1PZJD 4X62L 3A8IE 4MIUA 4LF5H 4F88A 3PO2G 3MWYW 1XX8A 2FLNA 1VQLA 3GTOA 3RLNA 3GTPH 1S5BD 3I70A 4RZRA 2CQOA 5JVH3 3Q8DA 5D65A 4C3IG 4LF8L 4RNMA 4CDFC 1LTLA 3DWPA 2NB0A 5KG2A 4QIWE 1IW7D 4K6LA 1HNZQ 5C3EB 4WRDA 2GPSA 5C4XG 1I50B 5C44G 3M7GA 4DV6L 5KFUA 3TP6A 1GYFA 3OWFA 1Z2PX 2B2WC 1ZQ7A 2W6NA 3UDIA 3RB3A 4RKLA 5ELBA 1FYCA 3JSNA 5KT2A 2DJFC 2BQ3A 1KNEA 4JI3H 3BYYB 3I4NB 4IJHA 4FXDA 5K36H 2IHEA 4OX9Q 2EJFC 5J39A 1KLUD 2OXPA 3G71A 1MKHA 1Q82C 1EIYB 3HOWG 2XCLA 2PNRC 1UAPA 1SDFA 3RF2A 3J81c 3SGIA 3K6OA 2HD3A 4JI5H 1EQTA 1X3EA 1YNJC 3K7AH 4HN7A 4DV5Q 2RCNA 4FVMA 4ZLTF 5C4XH 3HOUB 2NU6B 1D5MC 2F0SA 1G2SA 3K5MA 3A74A 3HS0C 4KLKA 5JOBA 1PFBA 1H9MA 1O7IA 1N32L 3J80L 4LF7H 2CCZA 2RDFA 1CQVA 4ZCKA 2MCTA 1JR0D 4UDUC 5F2DA 1BQQT 3CC2A 1UC8A 2UUBQ 4WD3A 2YU9B 1RCVD 4GS3A 4DR6H 2XWJB 4PZ7A 3PMFA 3DEPA 1VMCA 2ZDGA 3ETJA 2Y0SB 4EGVA 4GKJL 5T14A 3CCJA 2W9BA 3VYRA 1GSHA 1CZWA 4IFDI 1EY8A 1VMPA 4PMWA 1AN7A 3L9AX 2VA3A 5ELCA 1HNWL 2SEBD 4MAMA 4K0KH 4A3CG 3CCVA 4I7ZC 1WTRA 4ZKCB 1CFMA 1DGSA 4KN4C 1ICWA 4S3SA 4PWQA 3OIPA 2IHFA 1K8AC 4R7RA 1MSHA 4LSXA 5KNDA 1Y1WH 1A2TA 4DV2L 1LTID 3G6YA 3NP8A 1EU4A 1I4QA 2AWNA 3PF5A 3TDQA 1IBLH 2XRSD 5L37A 4EBEA 5LMUL 4KD3A 3RZDH 2NYZD 2EY6A 2O5IC 3VA5A 4CHTB 2HHHH 3D31A 4U7CA 4JI1L 4DUYQ 4DGZA 4BY7H 3RAQA 1PX2A 4ZQIA 4DR5L 4HJ7A 1X9NA 3AFPA 1X3QA 2FMMA 2PMZE 2J7ZA 5EPLA 1EEID 3H3VC 2JN4A 5KG3A 3L4KA 4OXPA 4QIWB 5C0XJ 3LMLA 3C3LA 4YR2A 3Q8QB 1OXXK 4Q0YA 1TWGH 1KLGD 3Q1KA 4M7EA 2J0TD 2V59A 3VPCA 4M9UA 4DV3H 2PZUA 1RYSA 2BE5D 4DV7L 2J6TA 3PUVA 3IN5A 2AHOB 1I4HA 3Q0AA 3I73A 1XPUA 4R4OA 1I94L 2WV6D 1QVGA 4K2KA 3CRLC 5FLXc 3KF6A 4J15A 2C9OA 1Y1VG 2NVQB 3KK7A 4EQPA 1VDZA 2EY5A 2H4OA 2RDHA 2XNAC 4R4IA 5LP6F 1ZKOA 3DXJC 3TINA 3UQ8A 3QZ8A 1PXUA 1VQFA 2F0WA 1UC9A 1HCZA 1WSCA 3H4DA 5IGFA 3H6MA 4LW1A 1PH9A 3S1NH 5EPJA 2H5XA 1LTRD 1JDBB 1QWYA 1TXYA 2NTTA 4A2BA 2HGSA 3MVVA 4PDBA 1KRTA 4P72A 2AGQA 1CQFA 3NUCA 5E3FA 5JQWA 1J5EH 2OWOA 2QEJC 1T5XD 2JEAI 4QWCA 2MNAA 1CUKA 2EPBA 3DHQA 4JI7L 1A8VA 3HB9A 4J9QA 1CQIB 4QF4A 5C1OA 1Q46A 2A6ED 1DJRD 4X64H 4DR2L 1PMRA 1KD1C 4JG2A 2C5CA 2KEDA 3CQZA 3KHHA 3A8KE 2B2TC 5LMNQ 1STNA 1XNQQ 1AW7A 1NSNS 1OXSC 3RMHA 4NXNQ 4AYBG 1UNNC 1TA8A 4O42A 4GKKH 2W8LA 3GTPB 3U4ZA 1BBXC 5C4JH 1F9RA 4B9XA 1N34Q 1SNQA 4DFAA 4KD4A 1EWCA 3DUZA 3MXPA 4Y52H 2K33A 2XWBB 1WTVA 4LFBL 3F2UA 1GOZA 2MFIA 4QCLA 4DUZH 3H4BA 2FPIB 2PBZA 4HJ5A 1QUQA 1EZ8A 1S5ED 1EZ1A 5IYZF 3OOCA 2QGQA 4HMJA 2K5WA 1HZBA 3GD7A 1SYEA 4OELB 3Q8PB 5GADC 1HNZL 3N6XA 1IW7C 3EROA 4KHPH 1QVFA 2K32A 1B8AA 4HMIA 1PA6A 4P74A 3OSPA 2ZTCA 3AFQA 3M9MB 1MJEA 4EEQA 2R8GA 1M4VA 1JE5A 1WH2A 1LT3D 1HHVA 1ULZA 1EQQA 3MR2A 1G291 3RZOH 2K28A 2VQFQ 4OX9L 3NEMA 2JEJA 1SNCA 3I4MH 3CCQA 2PMZB 4LNQA 3K5NA 2SCUB 5IGEA 3S16H 2JP1A 2UU9H 1I4GA 3HP3A 2ID0A 5C3WA 3K7AB 3L0OA 3JRXA 1B7YB 3K3PA 5C8YF 5EWFA 5C4XB 2BQUA 2EYMA 5IGCA 1IYVA 1PH1A 4JV5H 2F52A 5CC4A 2ASDA 5D1OB 3NELA 1SSOA 1O7LA 3H3VH 5BN4A 4PQXA 2G9DA 1E2VA 4DV5L 4YY3Q 1M0TA 2V5AA 1N9WA 4HCSA 1N36H 2VB2X 4MTDA 5H80A 4QUFA 5FKAC 2AU0A 5I9OA 1GXDC 1I6UA 1W6KA 3OTOQ 1EIFA 1IBKQ 1DONA 2R7ZA 3VMMA 2SOBA 1D7QA 4GC7A 1KDAA 3BQ0A 5FLXW 4Y7NH 4XX0B 5KFCA 2PCFB 1CM9A 5KFEA 2NVYA 5KG5A 2BA1A 1LTBD 2GVBA 2XVSA 3NSWA 1PVOA 3KAKA 1M90C 2UUBL 3V4SA 2QKIC 4APMA 1CHPD 2HIXA 4FF3A 5IT9L 2YL2A 1SFOA 2KHIA 5IYCH 5KFPA 2A8VA 3N8DA 3GTGH 4F50A 3A5UA 5E4XA 1QNUA 2EYLA 4H44C 2KHJA 1MGSA 2RGVA 2J6SA 1KBLA 1XNRH 2FMCA 2Z0SA 1S03G 4IALA 4CGYB 1SE8A 4Z9CB 1Y1WB 4Q45A 5EBDA 3KDFA 1IBMQ 3M3YH 1B70B 2EIFA
chains in the Genus database with same CATH topology
1FGUA 3HOUH 2LXKA 3WWVA 2B3GA 3J7ZC 1GO3E 1UWVA 2CWAA 5JJIA 2NVXH 4DAYB 4DV1Q 2UXCL 2YYZA 4A3IH 1VQ5A 4GLXA 3S1MH 5IYDG 3G4SA 4A4IA 4BBSH 1U0LA 1C9OA 4PG3A 4R4TA 1Q1EA 2ZM6L 3HKZG 1GVPA 3F2DA 1GKHA 4AYBE 1Q8KA 5E7NA 2OTJA 2WP8J 1CSQA 3CD6A 4GNXA 4A3FG 3HOXH 4JBWA 3CPWA 2I5HA 2N49A 4GOPA 4UP9A 1XPRA 5GQOA 3KJOA 1NJIC 2RHSB 1Q1BA 2MO0A 4HJ9A 2BH2A 1U5KA 2VNUD 4DKAC 4DAMA 4DV4L 1XMOQ 4JI4Q 3RLOA 1HH2P 2YU9H 2JA6G 1W3SA 2HHHQ 1FVIA 3TEHB 1SR3A 2WB1G 4UP7A 1ASZA 4JI6L 5JJLA 3H0GG 4JI8L 4X65L 1UE6A 4YCVA 4BY1H 3CPFA 1QZGA 2JA8H 3TRZA 1SRUA 2HT1A 3HOVH 4A3DH 4UY8C 4LUZA 2D0OA 2F4VQ 4BBRH 3ULPA 3CC7A 4DR1L 2V1CC 1KAWA 4B3TQ 4JI2L 2E8GA 4DV2Q 1CKMA 1KC8C 1S3OA 3PO2H 3LGJA 2BH8A 4DV3Q 3M9BA 3E9HA 3W1GA 4O0AA 4IPHA 3I4MG 3EN2A 1VQNA 1YJWA 5IYDH 5LMUQ 4C3IH 2A19A 3HOZG 2ALYB 4IPDA 3UDFA 2R6GA 4B3SL 4NXML 2R7DA 4A3FH 1EUJA 3U4VA 5M3MG 4IOCA 2Q2TA 4JI1Q 1PH6A 3T1HL 1PH8A 4R1JA 4YCWA 3PUZA 5C44H 5IWAQ 4LF9Q 4B3ML 4DR5Q 3TREA 2VUMG 2F3IA 4L5QA 3FHWA 4YWLA 4APVA 3DLLA 4OWTB 4AQYL 1VQGA 1VQCA 1VQ4A 2JA6H 4IOAA 4A3KH 2RF4A 2KCTA 3MEFA 1GD7A 2HIVA 3H0GH 3B6YA 3UDXA 4C3HH 2QEXA 3VDYA 1K3RA 2C35B 4AH6A 3S1RH 4NXMQ 2E2IH 2PQAB 5DLQE 1YHQA 4IO9A 2UUAL 2JA7G 1Q12A 2YV5A 3M4QA 2ZJRA 4A3JG 4DV7Q 1AE2A 1G51A 2DUDA 3J81j 4GNXC 1QZHA 1PHJA 3J7A5 4GOPC 4AIMA 4DR3L 5AJ3L 3HOWH 5IP9G 4JCVE 4NB3A 3KDFB 3S2DH 1I94Q 4HIMA 1AE3A 2CFMA 4YHHQ 2VL6A 1S72A 1J5EQ 4HIDA 3I4NG 1JB7A 2UUCL 1PFSA 4C2MH 2I0QA 2VS1A 1K8GA 1PH7A 3HOZH 4DPGA 1TWFH 1VQOA 5IYCG 1XMOL 3KYHC 1UE7A 2ZJQA 4DR7L 3ER0A 4R4QA 5GAHC 4YWMA 1PYBA 1HNXL 3T1YQ 3CCUA 3UDGA 3KF8B 4JI5Q 2VUMH 1HR0W 4R4CA 3CCMA 4GNXB 1A63A 2NVQH 1WOCA 5LMNL 1GM5A 5GROA 2YTVA 2WAQE 4JOIA 4QGUA 4IFDJ 3TS2A 1IZ6A 1XNQL 1LUZA 3HKSA 4NXNL 1I50H 4A3MG 2Y0SE 3OW2A 4LF4Q 2LXJA 4UP8A 4DNIA 1R9TH 3H15A 4GKKQ 1MJCA 2K14A 1CKNB 2DGYA 3RNUA 1N34L 3PV0A 1FJGQ 1X3FA 1V43A 2XTIA 4KHZA 4JI7Q 4LF5L 3ULJA 2E2JH 3AEVA 5IP9H 3U50C 1BBUA 2EXDA 3L2PA 3I4NH 3CCSA 1L1OA 1FL0A 1I5FA 3AYHB 4WJ4A 4O2DA 2N78A 2ES2A 4JYAQ 4P75A 1H95A 3RR5A 3DM3A 4DR2Q 3K7UC 1S40A 2WAQG 4TVAB 3W5OA 3HKZE 5ELOA 4KHPQ 2VQEQ 2Y0SG 1VQKA 4JV5L 2OQ0A 3K81C 1IL2A 4LFAQ 4A3CH 4MZ9A 4X6AH 4GN3B 1UE5A 2KCMA 2MO1A 3J81i 1X54A 1XMQL 4JI0L 1IYJB 4A3MH 3JC66 4X62L 4JI3L 3PO2G 1WYDA 2CWPA 2VQFL 3PUXA 4HJAA 1Q86C 1Z47A 3RLNA 1VQLA 4A3EH 3GTPH 2I5MX 2CQOA 1VQMA 3Q8DA 4EX5A 4LF8L 1BBWA 1LTLA 5JEAJ 4QIWE 2UU9Q 3CAMA 1Q81C 1VQBA 1E1OA 5IYBG 3S15H 3JAMc 1HNZQ 1IBLQ 4NPSA 4GKJQ 5C4XG 2R7ZH 2B63G 4JV5Q 1X56A 5C44G 1JMCA 4DV6L 1CSPA 3GTJH 4A3LG 4DV0Q 4TQUS 3AQQA 4A3KG 4YY3L 1PH5A 2NVYH 1HNWQ 1CKNA 3UDIA 1T9HA 1NMFA 3KJPA 1N36Q 1LYLA 3FKIG 3ZJYC 1YHAA 4IJHA 1EQRA 4LF6Q 3OTOL 1IBKL 2IHEA 5EAYA 1HR0Q 5HGQA 5M3FH 3I4OA 4OX9Q 1PH3A 1Z9FA 3I7FA 3HOYG 3ULLA 2OTLA 1UEBA 3G71A 1MKHA 1Q82C 1EIYB 4LF7L 3HOWG 1E3PA 4X66Q 4IFDG 4QQBX 1KRSA 2OCEA 1P8LA 1Q7YC 5GAGC 3U58A 2JE6I 1VQ7A 1VQPA 3J81c 3TQYA 3SGIA 1X6OA 3HFZB 2E5LQ 1C7YA 4DR6L 1Y1VH 3BZCA 2I5LX 5IYBH 1X3EA 4JBMA 3K7AH 4DV5Q 2AWOA 2RCNA 1VQEA 2K75A 5C4XH 1XPOA 2B63H 4DR4Q 4KHPL 3GTQH 4A3LH 1WJJA 1PV4A 1HJPA 1X65A 4OONA 1L1OB 4LFCQ 1XNRQ 2BA0A 1JT8A 1YIJA 1QVCA 3A74A 4KLKA 1IBML 4K0KL 4LFAL 2UXBQ 1O7IA 3K0XA 1XJVA 1N32L 2IX1A 3FKIH 2L15A 4DV1L 2CCZA 2YTYA 5BR8Q 1KXLA 1XTDA 1K73C 1IBMQ 5IE8A 2JQOA 3CC2A 2KBNA 4B3RQ 3HOYH 2UUBQ 2UXDQ 4QL5A 2ZJPA 3CQZH 1N33Q 4GS3A 1E1TA 3E9IA 2OQKA 3PUYA 4PZ7A 1L0WA 2JEBI 4L5RC 1IBLL 4GKJL 3NBHB 3CCJA 1VQ9A 1NY4A 2K5NA 2YTXA 3BJUA 4IFDI 4DV0L 4JI4L 4PMWA 4A3BG 2JJQA 2HHHL 2JK8A 4POGA 4X64Q 2PI2E 1PH2A 5JEAG 1E24A 1HZ9A 1PYSB 4P73A 1YEZA 1HNWL 2LSSA 4A3CG 4JBJA 3CCVA 4HIKA 4XIGS 1C0AA 3S1QH 2ASBA 1DGSA 3GO5A 5FJ8H 5ELNA 2F4VL 2K5HA 3A0JA 1YVCA 3BU2A 1EWIA 2IHFA 4P71A 1K8AC 4OWWB 2UXCQ 4B3TL 4A93G 1Y1WH 2Q2UA 5GAEC 4DV2L 1BKBA 2GVAA 2ZM6Q 1AH9A 2IT1A 4DV3L 4A3EG 2R92H 3CP0A 2K50A 2AWNA 1HZAA 3PF5A 4C3JH 5LMUL 3A5ZB 2KENA 4YWKA 5LMNW 1OXUA 3RZDH 1X3GA 4DV4Q 5C0XI 4DUZQ 1SLJA 3D31A 4JI1L 4DUYQ 1YI2A 2R7ZG 1G6PA 2QA4A 1W2BA 1VQAA 2JA5G 4JI6Q 4JI8Q 4X65Q 2VW9A 4BY7H 4BA2I 3GTKH 5IWAL 3PSIA 1ASYA 4DR5L 4HJ7A 4LF9L 3GTMH 1X9NA 2A1AA 3AFPA 4LUVA 3CXCA 4A3BH 2PMZE 2PI2A 4OXPA 5C0XJ 3S14H 4DR1Q 3W1BA 1VQIA 4JI2Q 4A76A 3RN2A 1OXXK 1TWGH 4L5SA 1EYGA 5K36G 5M3FG 4DV7L 1OXVA 4A93H 3PUVA 1YJ9A 2AHOB 5IP7H 1M1KC 4K0KQ 3BZKA 4DK6C 1XPUA 4LFBQ 4R4OA 3PGZA 1UE1A 1VQDA 3I2ZA 3UE0A 1VQJA 3STBD 1I94L 4YHHL 3G6EA 1QVGA 1J5EL 1KQSA 5FLXc 4B3SQ 3EBEA 3KF6A 4JC0A 1TWCH 4J15A 3F8TA 3CF5A 2N8NA 4IPCA 2PNHA 4HJ8A 2AKWB 3T1HQ 1Y1VG 4R4IA 4B3MQ 4AQYQ 3F1ZA 1KIXA 1QUQB 1VQFA 4X64L 2D0PA 2K52A 4JOIC 2JA5H 5M5XH 3T1YL 2FXQA 4H02A 4LW1A 2NVTH 1X55A 2MQHA 3KOJA 4JI5L 4A3GH 1RIPA 4IJLA 1PH9A 3S1NH 2H5XA 4MNOA 4RG1A 1Y14B 1TXYA 2UUAQ 1MIUA 2NN6G 3PF4A 2E2HH 1A0IA 1KRTA 4P72A 1YJNA 4BA1I 4LF4L 1SFOH 2VZAA 3M85A 1K9MC 3S24A 4GKKL 5IT9c 5AJ3Q 4DR3Q 1J6QA 4WJ3M 2XGTA 1FJGL 1NBWA 1WI5A 4POFA 2OWOA 3M7NA 1VS0A 3RLFA 1L1OC 2JEAI 3ICEA 5JJKA 2UUCQ 2MNAA 1CUKA 2R7FA 4HIOA 4JI7L 1A8VA 1CKOA 4ME3A 2RHQB 4DUZL 3PUWA 5HY6A 1VCIA 3UE1A 1Q46A 4DUYL 4DR7Q 4JYAL 2R93G 4L5TA 1TWHH 5M5WH 4DR2L 1EOVA 1HNXQ 1KD1C 4JG2A 3GTLH 4PZ8A 2VY3A 3IRBA 3RN5A 1YHBA 4LWCA 2Q2IA 2VQEL 5LMNQ 2NZOA 1SN8A 4EQ5A 3PIPA 3GTOH 3KFUA 1LM0A 3G48A 1XNQQ 1OXSC 1JJ2A 3PO3G 1K83H 4NXNQ 5FJ8G 4PZ6A 3CW2C 4UPAA 4AYBG 3S17H 4BXXG 4QJFA 4GN4B 2IY5B 3GDEA 3U4ZA 5C4JH 1N8RC 1N34Q 1Y1WG 2K4KA 3PIOA 2N3SA 2JA9A 4Y52H 1SMXA 4IPGA 2ZTDA 4YCUA 4LF5Q 2MFIA 1KL9A 2NZHA 3J80i 5C0XG 1A62A 3CMEA 2R92G 2NN6I 3F2BA 1HZCA 1NTGA 3STBC 4HJ5A 1QUQA 1I6HH 3F2CA 2QGQA 3K8AA 2ZTEA 2UU9L 3GD7A 1HZBA 1I3QH 2GN5A 1K0RA 4ALPA 4RMFA 4OO1G 5FLMG 3L7ZC 1P16A 5GADC 1HNZL 3M4OH 1NMGA 1QVFA 1WCMG 1YZ6A 4FDBA 1B8AA 3M4PA 4BY7G 2CKZB 1OXTA 4GLAC 5C3EG 4P74A 2WFWA 1RL2A 1PA6A 2ZTCA 1VQ6A 3AFQA 4KI0A 5IY0A 1MJEA 3KF6B 4OWXB 2B29A 1PH4A 3OYYA 1E22A 3FP9A 1JE5A 1N36L 1BVSA 3PO3H 1XMQQ 4JI0Q 2Z6KA 3TS0A 4BXXH 1V9PA 4X62Q 4JI3Q 1EQQA 1E7ZA 1YBYA 1G291 4LF6L 1HR0L 3RZOH 2VQFQ 4OX9L 3NEMA 5IP7G 3MXNB 1KHIA 3I4MH 3CCQA 4LF8Q 4LNQA 4X66L 1JJGA 3S16H 2ID0A 2EQSA 4DK3C 1OTCA 2K5VA 3L0OA 1B7YB 3K80C 3CCLA 3EIVA 5M3MH 5H1SE 4XTCS 1PH1A 2E5LL 1EFWA 1YITA 2F52A 4DV6Q 3NELA 4QY7A 2HQLA 4JBKA 3H3VH 5FLMH 1VQ8A 3J80c 4GOPB 4DV5L 4YY3Q 3I56A 1WCMH 1N9WA 3I55A 4DR4L 1JJCB 2IX0A 5C3EH 4A3GG 3HOUG 3H3VI 4LFCL 1XNRL 4OO1I 3ERSX 3KLWA 3JAMi 3CMAA 3PCOB 1L2FA 3OTOQ 1EIFA 4A3IG 1IBKQ 2JA7H 2UXBL 2Q2HA 1D8LA 4A3JH 4BBSG 1WFQA 1D7QA 1YNXA 4GLVB 4LFBL 4LF7Q 1IXRA 5BR8L 3S2HH 1V1QA 4Y7NH 3E0EA 4MTNA 5M5YH 3HOXG 2BA1A 4B3RL 2GVBA 2R93H 1PVOA 1M90C 2UUBL 2UXDL 1N33L 3CCRA 2HIXA 5J3BA 4DR6Q 2AMCB 2KHIA 5IYCH 3CCEA 1SROA 2A8VA 3GTGH 3A5UA 2PQAA 4BY1G 2KHJA 2JA8G 3CC4A 2ATWA 2D62A 1TWAH 3NENA 4LUOA 2Z0SA 3HOVG 4A3DG 2Z6KC 1SE8A 4BBRG 4GN5A 1NE3A 3KDFA 4A75A 1VQHA 2WB1E 3D0FA 3M3YH 1N32Q 1B70B 2EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGU A;  3HOU H;  2LXK A;  3WWV A;  2B3G A;  3J7Z C;  1GO3 E;  1UWV A;  2CWA A;  5JJI A;  2NVX H;  4DAY B;  4DV1 Q;  2UXC L;  2YYZ A;  4A3I H;  1VQ5 A;  4GLX A;  3S1M H;  5IYD G;  3G4S A;  4A4I A;  4BBS H;  1U0L A;  1C9O A;  4PG3 A;  4R4T A;  1Q1E A;  2ZM6 L;  3HKZ G;  1GVP A;  3F2D A;  1GKH A;  4AYB E;  1Q8K A;  5E7N A;  2OTJ A;  2WP8 J;  1CSQ A;  3CD6 A;  4GNX A;  4A3F G;  3HOX H;  4JBW A;  3CPW A;  2I5H A;  2N49 A;  4GOP A;  4UP9 A;  1XPR A;  5GQO A;  3KJO A;  1NJI C;  2RHS B;  1Q1B A;  2MO0 A;  4HJ9 A;  2BH2 A;  1U5K A;  2VNU D;  4DKA C;  4DAM A;  4DV4 L;  1XMO Q;  4JI4 Q;  3RLO A;  1HH2 P;  2YU9 H;  2JA6 G;  1W3S A;  2HHH Q;  1FVI A;  3TEH B;  1SR3 A;  2WB1 G;  4UP7 A;  1ASZ A;  4JI6 L;  5JJL A;  3H0G G;  4JI8 L;  4X65 L;  1UE6 A;  4YCV A;  4BY1 H;  3CPF A;  1QZG A;  2JA8 H;  3TRZ A;  1SRU A;  2HT1 A;  3HOV H;  4A3D H;  4UY8 C;  4LUZ A;  2D0O A;  2F4V Q;  4BBR H;  3ULP A;  3CC7 A;  4DR1 L;  2V1C C;  1KAW A;  4B3T Q;  4JI2 L;  2E8G A;  4DV2 Q;  1CKM A;  1KC8 C;  1S3O A;  3PO2 H;  3LGJ A;  2BH8 A;  4DV3 Q;  3M9B A;  3E9H A;  3W1G A;  4O0A A;  4IPH A;  3I4M G;  3EN2 A;  1VQN A;  1YJW A;  5IYD H;  5LMU Q;  4C3I H;  2A19 A;  3HOZ G;  2ALY B;  4IPD A;  3UDF A;  2R6G A;  4B3S L;  4NXM L;  2R7D A;  4A3F H;  1EUJ A;  3U4V A;  5M3M G;  4IOC A;  2Q2T A;  4JI1 Q;  1PH6 A;  3T1H L;  1PH8 A;  4R1J A;  4YCW A;  3PUZ A;  5C44 H;  5IWA Q;  4LF9 Q;  4B3M L;  4DR5 Q;  3TRE A;  2VUM G;  2F3I A;  4L5Q A;  3FHW A;  4YWL A;  4APV A;  3DLL A;  4OWT B;  4AQY L;  1VQG A;  1VQC A;  1VQ4 A;  2JA6 H;  4IOA A;  4A3K H;  2RF4 A;  2KCT A;  3MEF A;  1GD7 A;  2HIV A;  3H0G H;  3B6Y A;  3UDX A;  4C3H H;  2QEX A;  3VDY A;  1K3R A;  2C35 B;  4AH6 A;  3S1R H;  4NXM Q;  2E2I H;  2PQA B;  5DLQ E;  1YHQ A;  4IO9 A;  2UUA L;  2JA7 G;  1Q12 A;  2YV5 A;  3M4Q A;  2ZJR A;  4A3J G;  4DV7 Q;  1AE2 A;  1G51 A;  2DUD A;  3J81 j;  4GNX C;  1QZH A;  1PHJ A;  3J7A 5;  4GOP C;  4AIM A;  4DR3 L;  5AJ3 L;  3HOW H;  5IP9 G;  4JCV E;  4NB3 A;  3KDF B;  3S2D H;  1I94 Q;  4HIM A;  1AE3 A;  2CFM A;  4YHH Q;  2VL6 A;  1S72 A;  1J5E Q;  4HID A;  3I4N G;  1JB7 A;  2UUC L;  1PFS A;  4C2M H;  2I0Q A;  2VS1 A;  1K8G A;  1PH7 A;  3HOZ H;  4DPG A;  1TWF H;  1VQO A;  5IYC G;  1XMO L;  3KYH C;  1UE7 A;  2ZJQ A;  4DR7 L;  3ER0 A;  4R4Q A;  5GAH C;  4YWM A;  1PYB A;  1HNX L;  3T1Y Q;  3CCU A;  3UDG A;  3KF8 B;  4JI5 Q;  2VUM H;  1HR0 W;  4R4C A;  3CCM A;  4GNX B;  1A63 A;  2NVQ H;  1WOC A;  5LMN L;  1GM5 A;  5GRO A;  2YTV A;  2WAQ E;  4JOI A;  4QGU A;  4IFD J;  3TS2 A;  1IZ6 A;  1XNQ L;  1LUZ A;  3HKS A;  4NXN L;  1I50 H;  4A3M G;  2Y0S E;  3OW2 A;  4LF4 Q;  2LXJ A;  4UP8 A;  4DNI A;  1R9T H;  3H15 A;  4GKK Q;  1MJC A;  2K14 A;  1CKN B;  2DGY A;  3RNU A;  1N34 L;  3PV0 A;  1FJG Q;  1X3F A;  1V43 A;  2XTI A;  4KHZ A;  4JI7 Q;  4LF5 L;  3ULJ A;  2E2J H;  3AEV A;  5IP9 H;  3U50 C;  1BBU A;  2EXD A;  3L2P A;  3I4N H;  3CCS A;  1L1O A;  1FL0 A;  1I5F A;  3AYH B;  4WJ4 A;  4O2D A;  2N78 A;  2ES2 A;  4JYA Q;  4P75 A;  1H95 A;  3RR5 A;  3DM3 A;  4DR2 Q;  3K7U C;  1S40 A;  2WAQ G;  4TVA B;  3W5O A;  3HKZ E;  5ELO A;  4KHP Q;  2VQE Q;  2Y0S G;  1VQK A;  4JV5 L;  2OQ0 A;  3K81 C;  1IL2 A;  4LFA Q;  4A3C H;  4MZ9 A;  4X6A H;  4GN3 B;  1UE5 A;  2KCM A;  2MO1 A;  3J81 i;  1X54 A;  1XMQ L;  4JI0 L;  1IYJ B;  4A3M H;  3JC6 6;  4X62 L;  4JI3 L;  3PO2 G;  1WYD A;  2CWP A;  2VQF L;  3PUX A;  4HJA A;  1Q86 C;  1Z47 A;  3RLN A;  1VQL A;  4A3E H;  3GTP H;  2I5M X;  2CQO A;  1VQM A;  3Q8D A;  4EX5 A;  4LF8 L;  1BBW A;  1LTL A;  5JEA J;  4QIW E;  2UU9 Q;  3CAM A;  1Q81 C;  1VQB A;  1E1O A;  5IYB G;  3S15 H;  3JAM c;  1HNZ Q;  1IBL Q;  4NPS A;  4GKJ Q;  5C4X G;  2R7Z H;  2B63 G;  4JV5 Q;  1X56 A;  5C44 G;  1JMC A;  4DV6 L;  1CSP A;  3GTJ H;  4A3L G;  4DV0 Q;  4TQU S;  3AQQ A;  4A3K G;  4YY3 L;  1PH5 A;  2NVY H;  1HNW Q;  1CKN A;  3UDI A;  1T9H A;  1NMF A;  3KJP A;  1N36 Q;  1LYL A;  3FKI G;  3ZJY C;  1YHA A;  4IJH A;  1EQR A;  4LF6 Q;  3OTO L;  1IBK L;  2IHE A;  5EAY A;  1HR0 Q;  5HGQ A;  5M3F H;  3I4O A;  4OX9 Q;  1PH3 A;  1Z9F A;  3I7F A;  3HOY G;  3ULL A;  2OTL A;  1UEB A;  3G71 A;  1MKH A;  1Q82 C;  1EIY B;  4LF7 L;  3HOW G;  1E3P A;  4X66 Q;  4IFD G;  4QQB X;  1KRS A;  2OCE A;  1P8L A;  1Q7Y C;  5GAG C;  3U58 A;  2JE6 I;  1VQ7 A;  1VQP A;  3J81 c;  3TQY A;  3SGI A;  1X6O A;  3HFZ B;  2E5L Q;  1C7Y A;  4DR6 L;  1Y1V H;  3BZC A;  2I5L X;  5IYB H;  1X3E A;  4JBM A;  3K7A H;  4DV5 Q;  2AWO A;  2RCN A;  1VQE A;  2K75 A;  5C4X H;  1XPO A;  2B63 H;  4DR4 Q;  4KHP L;  3GTQ H;  4A3L H;  1WJJ A;  1PV4 A;  1HJP A;  1X65 A;  4OON A;  1L1O B;  4LFC Q;  1XNR Q;  2BA0 A;  1JT8 A;  1YIJ A;  1QVC A;  3A74 A;  4KLK A;  1IBM L;  4K0K L;  4LFA L;  2UXB Q;  1O7I A;  3K0X A;  1XJV A;  1N32 L;  2IX1 A;  3FKI H;  2L15 A;  4DV1 L;  2CCZ A;  2YTY A;  5BR8 Q;  1KXL A;  1XTD A;  1K73 C;  1IBM Q;  5IE8 A;  2JQO A;  3CC2 A;  2KBN A;  4B3R Q;  3HOY H;  2UUB Q;  2UXD Q;  4QL5 A;  2ZJP A;  3CQZ H;  1N33 Q;  4GS3 A;  1E1T A;  3E9I A;  2OQK A;  3PUY A;  4PZ7 A;  1L0W A;  2JEB I;  4L5R C;  1IBL L;  4GKJ L;  3NBH B;  3CCJ A;  1VQ9 A;  1NY4 A;  2K5N A;  2YTX A;  3BJU A;  4IFD I;  4DV0 L;  4JI4 L;  4PMW A;  4A3B G;  2JJQ A;  2HHH L;  2JK8 A;  4POG A;  4X64 Q;  2PI2 E;  1PH2 A;  5JEA G;  1E24 A;  1HZ9 A;  1PYS B;  4P73 A;  1YEZ A;  1HNW L;  2LSS A;  4A3C G;  4JBJ A;  3CCV A;  4HIK A;  4XIG S;  1C0A A;  3S1Q H;  2ASB A;  1DGS A;  3GO5 A;  5FJ8 H;  5ELN A;  2F4V L;  2K5H A;  3A0J A;  1YVC A;  3BU2 A;  1EWI A;  2IHF A;  4P71 A;  1K8A C;  4OWW B;  2UXC Q;  4B3T L;  4A93 G;  1Y1W H;  2Q2U A;  5GAE C;  4DV2 L;  1BKB A;  2GVA A;  2ZM6 Q;  1AH9 A;  2IT1 A;  4DV3 L;  4A3E G;  2R92 H;  3CP0 A;  2K50 A;  2AWN A;  1HZA A;  3PF5 A;  4C3J H;  5LMU L;  3A5Z B;  2KEN A;  4YWK A;  5LMN W;  1OXU A;  3RZD H;  1X3G A;  4DV4 Q;  5C0X I;  4DUZ Q;  1SLJ A;  3D31 A;  4JI1 L;  4DUY Q;  1YI2 A;  2R7Z G;  1G6P A;  2QA4 A;  1W2B A;  1VQA A;  2JA5 G;  4JI6 Q;  4JI8 Q;  4X65 Q;  2VW9 A;  4BY7 H;  4BA2 I;  3GTK H;  5IWA L;  3PSI A;  1ASY A;  4DR5 L;  4HJ7 A;  4LF9 L;  3GTM H;  1X9N A;  2A1A A;  3AFP A;  4LUV A;  3CXC A;  4A3B H;  2PMZ E;  2PI2 A;  4OXP A;  5C0X J;  3S14 H;  4DR1 Q;  3W1B A;  1VQI A;  4JI2 Q;  4A76 A;  3RN2 A;  1OXX K;  1TWG H;  4L5S A;  1EYG A;  5K36 G;  5M3F G;  4DV7 L;  1OXV A;  4A93 H;  3PUV A;  1YJ9 A;  2AHO B;  5IP7 H;  1M1K C;  4K0K Q;  3BZK A;  4DK6 C;  1XPU A;  4LFB Q;  4R4O A;  3PGZ A;  1UE1 A;  1VQD A;  3I2Z A;  3UE0 A;  1VQJ A;  3STB D;  1I94 L;  4YHH L;  3G6E A;  1QVG A;  1J5E L;  1KQS A;  5FLX c;  4B3S Q;  3EBE A;  3KF6 A;  4JC0 A;  1TWC H;  4J15 A;  3F8T A;  3CF5 A;  2N8N A;  4IPC A;  2PNH A;  4HJ8 A;  2AKW B;  3T1H Q;  1Y1V G;  4R4I A;  4B3M Q;  4AQY Q;  3F1Z A;  1KIX A;  1QUQ B;  1VQF A;  4X64 L;  2D0P A;  2K52 A;  4JOI C;  2JA5 H;  5M5X H;  3T1Y L;  2FXQ A;  4H02 A;  4LW1 A;  2NVT H;  1X55 A;  2MQH A;  3KOJ A;  4JI5 L;  4A3G H;  1RIP A;  4IJL A;  1PH9 A;  3S1N H;  2H5X A;  4MNO A;  4RG1 A;  1Y14 B;  1TXY A;  2UUA Q;  1MIU A;  2NN6 G;  3PF4 A;  2E2H H;  1A0I A;  1KRT A;  4P72 A;  1YJN A;  4BA1 I;  4LF4 L;  1SFO H;  2VZA A;  3M85 A;  1K9M C;  3S24 A;  4GKK L;  5IT9 c;  5AJ3 Q;  4DR3 Q;  1J6Q A;  4WJ3 M;  2XGT A;  1FJG L;  1NBW A;  1WI5 A;  4POF A;  2OWO A;  3M7N A;  1VS0 A;  3RLF A;  1L1O C;  2JEA I;  3ICE A;  5JJK A;  2UUC Q;  2MNA A;  1CUK A;  2R7F A;  4HIO A;  4JI7 L;  1A8V A;  1CKO A;  4ME3 A;  2RHQ B;  4DUZ L;  3PUW A;  5HY6 A;  1VCI A;  3UE1 A;  1Q46 A;  4DUY L;  4DR7 Q;  4JYA L;  2R93 G;  4L5T A;  1TWH H;  5M5W H;  4DR2 L;  1EOV A;  1HNX Q;  1KD1 C;  4JG2 A;  3GTL H;  4PZ8 A;  2VY3 A;  3IRB A;  3RN5 A;  1YHB A;  4LWC A;  2Q2I A;  2VQE L;  5LMN Q;  2NZO A;  1SN8 A;  4EQ5 A;  3PIP A;  3GTO H;  3KFU A;  1LM0 A;  3G48 A;  1XNQ Q;  1OXS C;  1JJ2 A;  3PO3 G;  1K83 H;  4NXN Q;  5FJ8 G;  4PZ6 A;  3CW2 C;  4UPA A;  4AYB G;  3S17 H;  4BXX G;  4QJF A;  4GN4 B;  2IY5 B;  3GDE A;  3U4Z A;  5C4J H;  1N8R C;  1N34 Q;  1Y1W G;  2K4K A;  3PIO A;  2N3S A;  2JA9 A;  4Y52 H;  1SMX A;  4IPG A;  2ZTD A;  4YCU A;  4LF5 Q;  2MFI A;  1KL9 A;  2NZH A;  3J80 i;  5C0X G;  1A62 A;  3CME A;  2R92 G;  2NN6 I;  3F2B A;  1HZC A;  1NTG A;  3STB C;  4HJ5 A;  1QUQ A;  1I6H H;  3F2C A;  2QGQ A;  3K8A A;  2ZTE A;  2UU9 L;  3GD7 A;  1HZB A;  1I3Q H;  2GN5 A;  1K0R A;  4ALP A;  4RMF A;  4OO1 G;  5FLM G;  3L7Z C;  1P16 A;  5GAD C;  1HNZ L;  3M4O H;  1NMG A;  1QVF A;  1WCM G;  1YZ6 A;  4FDB A;  1B8A A;  3M4P A;  4BY7 G;  2CKZ B;  1OXT A;  4GLA C;  5C3E G;  4P74 A;  2WFW A;  1RL2 A;  1PA6 A;  2ZTC A;  1VQ6 A;  3AFQ A;  4KI0 A;  5IY0 A;  1MJE A;  3KF6 B;  4OWX B;  2B29 A;  1PH4 A;  3OYY A;  1E22 A;  3FP9 A;  1JE5 A;  1N36 L;  1BVS A;  3PO3 H;  1XMQ Q;  4JI0 Q;  2Z6K A;  3TS0 A;  4BXX H;  1V9P A;  4X62 Q;  4JI3 Q;  1EQQ A;  1E7Z A;  1YBY A;  1G29 1;  4LF6 L;  1HR0 L;  3RZO H;  2VQF Q;  4OX9 L;  3NEM A;  5IP7 G;  3MXN B;  1KHI A;  3I4M H;  3CCQ A;  4LF8 Q;  4LNQ A;  4X66 L;  1JJG A;  3S16 H;  2ID0 A;  2EQS A;  4DK3 C;  1OTC A;  2K5V A;  3L0O A;  1B7Y B;  3K80 C;  3CCL A;  3EIV A;  5M3M H;  5H1S E;  4XTC S;  1PH1 A;  2E5L L;  1EFW A;  1YIT A;  2F52 A;  4DV6 Q;  3NEL A;  4QY7 A;  2HQL A;  4JBK A;  3H3V H;  5FLM H;  1VQ8 A;  3J80 c;  4GOP B;  4DV5 L;  4YY3 Q;  3I56 A;  1WCM H;  1N9W A;  3I55 A;  4DR4 L;  1JJC B;  2IX0 A;  5C3E H;  4A3G G;  3HOU G;  3H3V I;  4LFC L;  1XNR L;  4OO1 I;  3ERS X;  3KLW A;  3JAM i;  3CMA A;  3PCO B;  1L2F A;  3OTO Q;  1EIF A;  4A3I G;  1IBK Q;  2JA7 H;  2UXB L;  2Q2H A;  1D8L A;  4A3J H;  4BBS G;  1WFQ A;  1D7Q A;  1YNX A;  4GLV B;  4LFB L;  4LF7 Q;  1IXR A;  5BR8 L;  3S2H H;  1V1Q A;  4Y7N H;  3E0E A;  4MTN A;  5M5Y H;  3HOX G;  2BA1 A;  4B3R L;  2GVB A;  2R93 H;  1PVO A;  1M90 C;  2UUB L;  2UXD L;  1N33 L;  3CCR A;  2HIX A;  5J3B A;  4DR6 Q;  2AMC B;  2KHI A;  5IYC H;  3CCE A;  1SRO A;  2A8V A;  3GTG H;  3A5U A;  2PQA A;  4BY1 G;  2KHJ A;  2JA8 G;  3CC4 A;  2ATW A;  2D62 A;  1TWA H;  3NEN A;  4LUO A;  2Z0S A;  3HOV G;  4A3D G;  2Z6K C;  1SE8 A;  4BBR G;  4GN5 A;  1NE3 A;  3KDF A;  4A75 A;  1VQH A;  2WB1 E;  3D0F A;  3M3Y H;  1N32 Q;  1B70 B;  2EIF A; 
#chains in the Genus database with same CATH topology
 1FGU A;  3GTL A;  2LXK A;  1CT1 D;  5AFW A;  3CVZ A;  5DGB A;  5L1L A;  2RCF A;  2R8H A;  4ZI7 F;  3NGD A;  4I65 A;  4RGM A;  2YZN A;  5DM6 3;  1K3B C;  4GLX A;  3RZD B;  3G4S A;  4A4I A;  1AZQ A;  3N44 B;  4RCO A;  1N33 H;  1EIG A;  4G57 A;  4R4T A;  3DF7 A;  1Q1E A;  1K83 A;  3HKZ G;  2JYO A;  2OTJ A;  4AYB E;  3KF8 A;  5E7N A;  2N49 A;  4BY7 B;  1NJI C;  5KFQ A;  2W7O A;  4ECW A;  4ED2 A;  2MO0 A;  3OHX C;  2BH2 A;  4JI4 Q;  2Q8T A;  1W3S A;  1LTT D;  1D1K A;  1FVI A;  3K59 A;  1SR3 A;  2WB1 G;  5JJL A;  3G8C A;  4QW9 A;  3CPF A;  2R8K A;  1SRU A;  5L9X A;  1PFN A;  3I3C A;  4UY8 C;  4LUZ A;  2BOS A;  1RJP A;  5A2Q L;  1KAW A;  2VXW A;  3CKI B;  1LAC A;  4B3T Q;  5GON F;  2R93 A;  2QK4 A;  1QNK A;  3R5H A;  3SE7 A;  2O03 A;  3W1G A;  4FBT A;  2VA2 A;  2BE5 C;  2J4X A;  5DQI A;  4NLG A;  4FS2 A;  2F3V A;  3HOZ G;  5KFM A;  4DV4 H;  3EVQ A;  4Q0F A;  4HAE A;  4JI8 H;  3HGB A;  1PH8 A;  3S1N B;  2FFK B;  4R1J A;  4YCW A;  5BMV F;  3HEJ A;  3IFT A;  5IWA Q;  2VUM G;  4YWL A;  4OWT B;  5KFO A;  5C6A A;  1DXM A;  4A3K H;  3E3X A;  4UCR A;  2HIV A;  2V4D A;  3PW0 A;  2GA4 B;  4ECS A;  1F9S A;  4YJ2 F;  2A5H A;  4UCO A;  4C3H H;  2B2V A;  3VDY A;  2F0L A;  2TMP A;  5DLQ E;  5KFZ A;  4M8A A;  1Q12 A;  2YV5 A;  1B6S A;  4BWS C;  2F0K A;  2ICI A;  1PHJ A;  4GNX C;  1WR2 A;  2F1M A;  3BDL A;  4RB1 A;  3V2T A;  4AIM A;  4G7Z C;  2EVB A;  1B9M A;  3S2D H;  4NXM H;  4I55 F;  3I4N G;  1RJR A;  2VL6 A;  3CHB D;  2B8G A;  4HID A;  1JB7 A;  5KFG A;  2DIK A;  2I0Q A;  4F8M A;  3HOZ H;  1TWF H;  3ORQ A;  3KYH C;  3RTX A;  1EYC A;  4FO2 A;  2A6E C;  2M05 A;  3UDG A;  5JAV A;  1GUO A;  4KJO A;  4DAP A;  3I72 A;  2VUM H;  1ROD A;  5C4J B;  2C22 A;  5LMN L;  3NWT A;  5DG8 A;  2WAQ E;  3E0J A;  1IZ6 A;  1XNQ L;  1ILP A;  4RH6 A;  4YIJ A;  2W6P A;  4NXN L;  1I50 H;  2R7M A;  5KT5 A;  1E4F T;  3OW2 A;  1R9T H;  4DNI A;  5LL6 X;  3TN2 A;  1SYC A;  1N34 L;  3SEB A;  4ECR A;  2DY7 A;  5EKL A;  4O2B F;  4XXE A;  1V43 A;  3KLS X;  4KHZ A;  4UCU A;  2JA6 B;  3Q8R B;  1XMO H;  1BBU A;  1KAA A;  2EXD A;  3I4N H;  5EKK A;  1QE6 A;  5KFN A;  2N78 A;  4JYA Q;  2FP4 B;  1HNX H;  2MUY A;  1YNJ D;  1S40 A;  1UUP A;  2VPQ A;  3HKZ E;  2FK2 A;  2K05 A;  1HXY D;  2CQA A;  4UFZ A;  1EY6 A;  2Y0S G;  3J7A V;  1JIC A;  4Q8F A;  2V4Q A;  2EY2 A;  4AYB B;  3R93 A;  5EKI A;  1GHK A;  3RZO B;  1UE5 A;  2KCM A;  2B2U A;  4DV2 H;  5T1G A;  2YU9 A;  2EJM A;  2MO1 A;  3EPI A;  3I4M B;  1STA A;  3BQ2 A;  3S16 B;  1IYJ B;  2CH4 A;  2F0H A;  4IQZ A;  2EYO A;  4XQN A;  3GV7 B;  4HJA A;  2VQF L;  3PUX A;  1Z47 A;  3MA2 B;  1CA6 A;  3VYT A;  4O3Q A;  2I5M X;  2DY8 A;  1VQM A;  4EX5 A;  4XYL B;  1TQO A;  1VQB A;  5I4D A;  1E1O A;  4C5C A;  5IYB G;  4IUN A;  4KKU A;  3JAM c;  3S15 H;  2FKL A;  4GKJ Q;  1AEX A;  1ZHQ A;  1X56 A;  3GTJ H;  1HA6 A;  4A3L G;  2P5Z X;  2ZDQ A;  3J7Y W;  3BJY A;  4YY3 L;  3K58 A;  3H09 A;  1HNW Q;  3QB3 A;  1CKN A;  5KT3 A;  1T9H A;  4ID6 A;  3KJP A;  2XGP A;  5DQG A;  4JI0 H;  4Y7N B;  1LYL A;  3FKI G;  1K0S A;  1YHA A;  4MV7 A;  4FXG C;  2XCA A;  4ECQ A;  1EQR A;  3J80 E;  2EY1 A;  3OTO L;  1IBK L;  5EAY A;  3H0G A;  2WIN B;  2SNM A;  3HOY G;  3ULL A;  4U6P A;  3BAB A;  4JW0 A;  4X66 Q;  4IFD G;  2QDL A;  3GTG B;  4I50 F;  3U58 A;  2ZXO A;  4GZY C;  2LS0 1;  5CV7 A;  2E5L Q;  1BO0 A;  4QIW A;  1BXT A;  2J9G A;  1B4O A;  2I5L X;  1TKW B;  1SMY D;  4OGQ C;  5IYB H;  5ISR A;  5A2Q W;  1KC7 A;  1LTG D;  2EYF A;  2K75 A;  3M3Y B;  3HRZ C;  4A3M B;  1JOO A;  3OHA A;  1PTO D;  4A3L H;  1WJJ A;  1PV4 A;  4CKC A;  1LTA D;  1KJI A;  2BA0 A;  1SCU B;  1YIJ A;  4IAJ A;  1IBM L;  4C5A A;  1RTO A;  3K0X A;  1C4Q A;  5CV8 A;  2IX1 A;  5ELE A;  3FKI H;  2L15 A;  2YTY A;  5BR8 Q;  4IUU A;  5JVL A;  4B3R Q;  2V58 A;  4JV1 A;  4TV8 F;  3HOY H;  2VPS A;  1FNU A;  4QL5 A;  2ZJP A;  2YS7 A;  2WAQ B;  4IFD H;  3QR8 A;  3PUY A;  2OQK A;  3I90 A;  3V6J A;  1ET6 A;  5CA1 F;  4JV2 A;  1STH A;  2QF7 A;  3NBH B;  5A35 A;  2K5N A;  3QIA A;  1R4P B;  2YTX A;  3IFD A;  4ODG A;  4DV0 L;  1JWM D;  1EL0 A;  4JI4 L;  1K1Q A;  4U67 3;  4CC5 A;  1SJH D;  4POG A;  4MN3 A;  1PH2 A;  2PI2 E;  5JEA G;  1E24 A;  1YEZ A;  2LSS A;  4KK7 A;  2EYP A;  4LFA H;  4JBJ A;  4HIK A;  1BXR A;  1NCV A;  3S1Q H;  1HA5 A;  5FJ8 H;  4QWB A;  2K5H A;  4DV1 H;  3A0J A;  2NTS A;  3RJ0 A;  5LL6 b;  3DM1 A;  4P71 A;  2UXC Q;  3T5J A;  4O1N A;  2EOT A;  4B3T L;  4A93 G;  1QG7 A;  4XQQ A;  3HKZ B;  4MHE A;  1TWA A;  2ZM6 Q;  1AH9 A;  2IT1 A;  3CP0 A;  2K50 A;  4OEM B;  2B63 B;  3IAY A;  3A5Z B;  5CGK A;  1SND A;  2KEN A;  4YWK A;  5LMN W;  1OXU A;  3H94 A;  5C5L A;  1X3G A;  1NAP A;  4A3K B;  1S9F A;  5C0X I;  1EY0 A;  2XD4 A;  3BS1 A;  1I6V C;  1RJQ A;  3GTP A;  4C3H B;  3X3N A;  5KFR A;  4X65 Q;  2VW9 A;  4BA2 I;  3GTK H;  5IWA L;  1Q3L A;  1K28 A;  2ICE C;  1DV2 A;  2F4V H;  3ZYY X;  5JEA H;  4H7B A;  2FJ2 A;  4A76 A;  3D8G A;  3RN2 A;  4RB2 C;  3S2D B;  1A3U A;  4O4I F;  4L5S A;  3WDN A;  3G7L A;  3NE5 B;  5K36 G;  4RUC A;  2EDG A;  4A93 H;  3R5F A;  1TWF B;  5IP7 H;  5BPH A;  4MV6 A;  4LFB Q;  2JXM B;  3OWE B;  3JAM W;  1UE1 A;  3UE0 A;  1VQJ A;  3G6E A;  1HQM C;  1SYG A;  1KQS A;  3EBE A;  5C3X A;  1D1I A;  5KNC A;  1Q8I A;  4IPC A;  2VUM B;  1NR4 A;  2AKW B;  4ME6 A;  4LF9 H;  2AUK A;  2BDO A;  2LMC B;  5KG1 A;  4PV1 C;  4IR1 A;  3J81 L;  1EOT A;  2K52 A;  2AQ1 B;  4JOI C;  4H02 A;  1R9T B;  4A3G H;  3KOJ A;  3QOL A;  1RIP A;  3MFY A;  2PZT A;  1ZEQ X;  1RD9 D;  2PMZ A;  1Y14 B;  1O7Y A;  2F4I A;  1GUG A;  3MZ5 A;  1RDP D;  3I91 A;  2UUA Q;  1X3P A;  4BA1 I;  3GV5 B;  2P0A A;  3SK4 A;  1K9M C;  3S24 A;  2F0E A;  4DR3 Q;  1J6Q A;  4YHH H;  4ECZ A;  2MP1 A;  4EYH B;  1L1O C;  1D5Z C;  3ICE A;  1HRJ A;  4EYI B;  3GTM B;  3BG5 A;  2R7K A;  3GID A;  4ME3 A;  2RHQ B;  3A54 A;  2B39 A;  3KHG A;  1B1Z A;  4R8U A;  4DR7 Q;  4JYA L;  1NNX A;  4L5T A;  1TWH H;  3T1Y H;  1EOV A;  5KFY A;  4PZ8 A;  1WTP A;  4TUY F;  3TII A;  3IRB A;  5M9O A;  1JXL A;  3EPG A;  2Q2I A;  4K8J A;  1S10 A;  2NZO A;  4EQ5 A;  3GTO H;  3KFU A;  2DZD A;  3PO3 G;  1Y8P B;  4LF4 H;  4ED3 A;  4BXX G;  4GN4 B;  3FPU B;  1L0X B;  5DLF A;  1Y1W G;  2K4K A;  1FJG H;  2DJG C;  2PO4 A;  3KXY T;  2WII B;  3T53 B;  4MTE A;  1SMX A;  5KYL A;  4IPG A;  4OIJ A;  4LMY A;  4LF5 Q;  3J80 i;  2NZH A;  3S15 B;  4MV1 A;  3MFH A;  3WO0 A;  4CJ1 B;  2F3W A;  3STB C;  3GTJ B;  5KFK A;  4DUY H;  4NW2 A;  1K8O A;  4FS1 A;  2GN5 A;  1PTO F;  3BA8 A;  2WKD A;  2VQD A;  3M4Y A;  3ERQ A;  2VQE H;  2UVR A;  1L2Z A;  1WD1 A;  4FDB A;  1EUD B;  3M4P A;  4BY7 G;  3SK6 A;  4Q44 A;  1VQ6 A;  4IUP A;  2B29 A;  3N52 A;  2A73 B;  3OYY A;  1PH4 A;  3GP7 A;  4EFE A;  3PN1 A;  1BVS A;  4R8N A;  3PO3 H;  3VR2 A;  4BXX H;  4JI3 Q;  3A56 A;  1E7Z A;  1YBY A;  3FPP A;  5KT7 A;  5KG4 A;  2IBK A;  1KHI A;  4R9W A;  3SK8 A;  4X66 L;  1JJG A;  1HFG A;  2LKV A;  3RGX A;  4DK3 C;  4OL7 A;  1TWG A;  2GLT A;  1ESF A;  4DL7 A;  3CCL A;  1GGO A;  2X6G A;  1EEF D;  1K8M A;  3EIV A;  5M3M H;  4XTC S;  2E5L L;  1K1S A;  1XXG A;  4LH7 A;  3M4I A;  4QY7 A;  4JBK A;  2DLN A;  1G6Z A;  5FLX L;  1VQ8 A;  3J80 c;  4C5B A;  1SMY C;  3BYT B;  3I55 A;  5TSS A;  1TII D;  2IX0 A;  3FKI B;  5DG9 A;  1GLV A;  1PTO C;  4OO1 I;  3KLW A;  1M0W A;  3MEH A;  1I4P A;  4LF6 H;  3CMA A;  1HR0 H;  1L2F A;  2F0P A;  3HOY B;  1DZ1 A;  3M9O B;  5I2Y A;  5EZY F;  2I46 A;  2YRX A;  5EDW A;  1CK1 A;  2ZT9 C;  4LF7 Q;  1H9S A;  5BR8 L;  4PMC A;  1DYQ A;  5M5Y H;  4MV8 A;  4B3R L;  1PZI D;  2PN1 A;  4J9N A;  3CCR A;  2I8C A;  4DR6 Q;  2H1E A;  3V05 A;  1FNW A;  1SRO A;  3P75 A;  1SAP A;  2CW0 C;  5KGU A;  5KKN B;  5IIF A;  4DR4 H;  3S1Q B;  4OHJ A;  5JPN C;  3E5S A;  2W6Z A;  3CC4 A;  3NEN A;  4LFC H;  4A3D G;  3ONA B;  4IUT A;  4BBR G;  2DPJ A;  4GN5 A;  2UXB H;  3VR4 A;  3OHB A;  4K0K Q;  3D0F A;  1WTW A;  1RK5 A;  3MXN A;  2OTL A;  1Y1V A;  1D5X C;  3WWV A;  2B3G A;  5JJI A;  1GO3 E;  4Q43 A;  2R8J A;  3V4Z A;  2UXC L;  2YYZ A;  3FVQ A;  4FYD A;  1VQ5 A;  4IHJ F;  1U0L A;  2UXD H;  5CR3 A;  1C9O A;  4PG3 A;  2ZM6 L;  4RHS A;  3J81 W;  1GKH A;  1S68 A;  2RQX A;  4YAJ B;  1CSQ A;  5KFT A;  2KCC A;  5KEE A;  4GOP A;  4ZK9 B;  3PZP A;  3GTK B;  2RHS B;  3HXL A;  1U5K A;  4DAM A;  4L1K A;  2JA6 G;  3VR5 A;  1H9R A;  2HHH Q;  5FOB B;  4O3O A;  2L5T A;  3O13 A;  1R4Q B;  4X65 L;  4V19 0;  1UE6 A;  2R84 A;  4RU9 A;  2OEO A;  2XCP A;  2R86 A;  4QUC A;  5EGT A;  4FF2 A;  3TRZ A;  4J0M A;  1WTH A;  3IL8 A;  4LSA A;  2O5J C;  4A3D H;  4A93 B;  3TP7 A;  2QCP X;  4BBR H;  5DAU A;  3CC7 A;  2V1C C;  3ITP A;  2X69 A;  4ME5 A;  3JRW A;  4EFB A;  1CKM A;  1S3O A;  3LGJ A;  4DV3 Q;  1F2Z A;  1Z6H A;  2WYO A;  3V96 A;  1ENF A;  4IPH A;  3I4M G;  2W6Q A;  4X3S A;  4WFN 3;  1OWT A;  5KT4 A;  1MI2 A;  3GQB A;  1RTN A;  1JKJ B;  3UDF A;  3T5L A;  4AYB A;  5KG7 A;  2QYZ A;  2R7D A;  4HQ6 A;  1EUJ A;  1SEB D;  2PPB C;  4A3G B;  2V9W A;  1B50 A;  5KX5 F;  1PZK D;  2DNE A;  1Z7T A;  5DG7 A;  3CU7 A;  2NU7 B;  3TRE A;  4APV A;  2NVX B;  3FHW A;  1VQ4 A;  2JA6 H;  3HG9 A;  4A3I B;  4Q8E A;  1MHW C;  3B6Y A;  3DMU A;  1DV1 A;  1DOL A;  4DR1 H;  1IBK H;  4XT3 B;  4JI2 H;  2WAC A;  2W71 A;  4KN7 C;  4AH6 A;  1EFI D;  2YYA A;  4IWY A;  2E2I H;  2PQA B;  1D2B A;  2UUA L;  2ZJR A;  4U68 A;  2Z1C A;  1AE2 A;  3J81 j;  1QZH A;  3J7A 5;  4DR3 L;  3E5N A;  5IP9 G;  4B3S H;  4FXK C;  2TSS A;  4HIM A;  1AE3 A;  1S72 A;  1J5E Q;  1TWH B;  3J7A F;  5HUR A;  1PFS A;  3T1H H;  4C2M H;  4RFB A;  1K8G A;  1PH7 A;  1VQO A;  4OIK A;  4B3M H;  5IYC G;  3GTO B;  4DN4 M;  3NBI A;  1B04 A;  4AQY H;  1TS2 A;  2ZJQ A;  4EQO A;  4DR7 L;  2UVU A;  5D14 A;  5GAH C;  3R5X A;  2D5D A;  1PTO H;  4ZYS A;  3ETH A;  3JZI A;  1EY5 A;  2VUG A;  3CCM A;  5ELF A;  5GRO A;  1YNN D;  5BN5 A;  3H40 A;  1I4X A;  4IFD J;  3GTG A;  1LUZ A;  1ET9 A;  4A3M G;  2Q8R E;  5FD6 A;  2LXJ A;  4UP8 A;  3H15 A;  5I6Y A;  1MJC A;  2K14 A;  4GKK Q;  1ZYR D;  3QG1 A;  4TSS A;  1STE A;  3PV0 A;  1X3F A;  2EE1 A;  3W3A A;  2UUC H;  4J8Q A;  5KFL A;  3G6V A;  2XTI A;  4LF5 L;  1S5D D;  3SR1 A;  2E2J H;  3BQ1 A;  1BCP D;  5IP9 H;  3TZU A;  3L2P A;  3AYH B;  2SDF A;  4O2D A;  4RNN A;  4P75 A;  1H95 A;  4QWE A;  2FLP A;  1CE8 A;  1LO5 D;  3K7U C;  2HCI A;  2WAQ G;  3VR6 A;  2ASJ A;  3OIQ A;  4KHP Q;  3PO3 B;  1CHQ D;  1V1P B;  5E1F A;  3K81 C;  1E4G T;  2D9U A;  4KY6 A;  4X6A H;  1GUN A;  2B2T A;  2XN9 C;  4TQR A;  3SE0 A;  3R2T A;  3H20 A;  2BR0 A;  2ZDH A;  4J9M A;  2X0S A;  4A3M H;  3K57 A;  3JC6 6;  4JI3 L;  3L4J A;  1EUC B;  1BNC A;  4C56 C;  4ZQ3 A;  1JC7 A;  1C30 A;  1RKN A;  4L6T B;  5M3M B;  1Q86 C;  1E0B A;  3RUP A;  4A3E H;  2NU9 B;  4ECT A;  1WD0 A;  2PYK A;  1BBW A;  2Z6B A;  1RF2 D;  5JEA J;  2UU9 Q;  1Q81 C;  3PIP 3;  2B2Y A;  5IWA H;  5HV6 A;  1J8I A;  4IUQ A;  2CH4 W;  3K5I A;  3MWE A;  1SYF A;  1E2Z A;  2R7Z H;  2B63 G;  4JV5 Q;  2ALZ A;  1OO9 B;  1JMC A;  3TP5 A;  4DV0 Q;  4TQU S;  3HKZ A;  2K5Q A;  3A8J E;  4A3K G;  2C00 A;  1PH5 A;  2NVY H;  2G5D A;  2XIG A;  4C3H G;  4JVZ A;  3PR5 B;  1N36 Q;  3F8N A;  1XMQ H;  3RIZ A;  1EQV A;  5IGD A;  4X62 H;  3ZJY C;  5M5Y B;  5I6W A;  4KMU C;  4F4Y A;  4NDX A;  4F4Z A;  3KAJ A;  5EWG A;  4J1M A;  2WB1 A;  5HGQ A;  5M3F H;  3I4O A;  1PH3 A;  1Z9F A;  3NTH A;  3RB6 A;  1UEA B;  5LL6 S;  4LF8 H;  1BGW A;  4LF7 L;  1MZB A;  4QQB X;  1BDO A;  3DEO A;  1Q7Y C;  3UFX B;  2JE6 I;  1VQ7 A;  1W96 A;  1N56 A;  4F4W A;  1QIL A;  1VQP A;  3EJI A;  3TQY A;  1GSO A;  2EZV A;  1C7Y A;  4DR6 L;  4DV6 H;  1DOK A;  4RAY A;  2C28 A;  3BZC A;  4O3R A;  2L4N A;  4XYO A;  1BR9 A;  4LMQ D;  1II3 A;  3T16 A;  4Y8V B;  1ICF B;  2AWO A;  2HUG A;  1XPO A;  2B2U C;  2B63 H;  4ED8 A;  4DXF A;  3OSO A;  3GTQ H;  3KHL A;  3URY A;  1L1O B;  1XNR Q;  1TWF A;  1JT8 A;  4O4H F;  5L1K A;  2HVQ A;  4K0K L;  3NPP A;  4KV6 A;  1XJV A;  3EQL C;  2VUM A;  3R2I A;  1NUC A;  4J9S A;  4C3J G;  3TME A;  2E74 C;  4XZ3 B;  4ECY A;  2KBN A;  2KEC A;  3P1H A;  1KDB A;  3NQT A;  2W8K A;  1N33 Q;  1I50 A;  5L1I A;  1R9T A;  1CI3 M;  3E9I A;  4L5R C;  3MXG A;  3M9N B;  4CDE C;  1SJE D;  1IBL L;  4RB0 A;  4O3N A;  1NY4 A;  2AQ4 A;  4EBC A;  1GHJ A;  4ECU A;  4A3D B;  2A69 D;  4YAK B;  4BBR B;  2HHH L;  2JK8 A;  2JEI A;  4DK0 A;  2LFN A;  2NWG A;  1LLR D;  3MAQ A;  1HZ9 A;  2HCC A;  1HFN A;  1N32 H;  4CJ2 C;  2ASB A;  3GO5 A;  2RDG A;  2W9C B;  4NKL A;  1YVC A;  3BU2 A;  5KFB A;  1EWI A;  1B53 A;  3TSS A;  2L55 A;  1ILQ A;  3I12 A;  1SNM A;  1C8C A;  2F0Q A;  2Q2U A;  5GAE C;  2PQE A;  2KQ3 A;  4ZRZ A;  2GVA A;  2R92 H;  5C0X H;  2F0I A;  2MHV A;  4K5W A;  4DV3 L;  1L0Y B;  4C3J H;  4GKJ H;  3FMC A;  4K14 A;  3T56 B;  3D4R A;  4DV4 Q;  1SLJ A;  1YI2 A;  5KFS A;  1G6P A;  3A55 A;  2QA4 A;  1VQA A;  2JA5 G;  4JI6 Q;  4JI8 Q;  1HNW H;  4CC6 A;  1V51 A;  1ASY A;  3GIQ A;  3GTM H;  4FU0 A;  2E2I B;  4XT1 B;  3CXC A;  3JAM L;  2PI2 A;  4ZUJ A;  1KDC A;  1PYW D;  1SEI A;  4MA0 A;  2PW5 A;  2VR1 A;  4FF1 A;  3GTJ A;  4WJW A;  5IGB A;  1EYG A;  4ED7 A;  5BPF A;  3BAA A;  1BCP F;  1JDE A;  4C2M B;  2Y0S A;  5LMU H;  1M1K C;  2F0F A;  4TV9 F;  5CV9 A;  1VQD A;  3I2Z A;  3PW5 A;  3STB D;  4NXM Q;  1J5E L;  1SXT A;  4JC0 A;  1PTO B;  3CF5 A;  1TWC H;  4JI1 H;  3F8T A;  3RUZ A;  4UCS A;  5FO9 B;  5HBR B;  4DR5 H;  1EYD A;  3GV6 A;  1QUQ B;  4X64 L;  2VB3 X;  2JA5 H;  1JOK A;  3NTI A;  5M5X H;  2FXQ A;  2K03 A;  4RUA A;  3GIL A;  3T5K A;  2MQH A;  4J9R A;  5CMD A;  4ZUI A;  3PIO 3;  5K5P A;  5E4W C;  5BR8 H;  4QWD A;  1JOR A;  1YNN C;  1MIU A;  3PF4 A;  4HNU A;  1DOM A;  2E2H H;  1A0I A;  1YJN A;  4DV7 H;  2E2J B;  1TS4 A;  2VZA A;  3M85 A;  4GKK L;  1WTX A;  3ORR A;  1I94 H;  1ZYR C;  2MJ8 A;  1NBW A;  3UI2 A;  1A3T A;  4POF A;  3M7N A;  1VS0 A;  3RLF A;  2RKS A;  4IRD A;  2R7F A;  4HCE A;  1CKO A;  3FKI A;  1BCP C;  4DUZ L;  1TU2 B;  5HY6 A;  1VCI A;  3UE1 A;  3U9T A;  4DL6 A;  4GC6 A;  3SI8 A;  2WDT A;  1HNX Q;  2VY3 A;  2OH2 A;  2L12 A;  3RN5 A;  1YHB A;  5DEH A;  4KHP L;  3KLR A;  2BDN A;  4PNY A;  3G48 A;  4DNR B;  4H0L C;  3MFG A;  3RB4 A;  1TVX A;  2JEF A;  2F0N A;  4LK1 C;  1B3Q A;  1U4P A;  5FJ8 G;  4UPA A;  2MPM A;  2QW7 A;  4QJF A;  4A3E B;  3GDE A;  5DM7 3;  1N8R C;  3D4W A;  2CHB D;  3PIO A;  2N3S A;  4EGJ A;  1TR5 A;  2M9V A;  5JVD F;  1Y8N B;  2KVM A;  2KEE A;  4JI7 H;  1MSG A;  4YCU A;  3C0F B;  3CME A;  1A62 A;  3T4A C;  3NTK A;  2R7Z B;  5FO8 B;  2NN6 I;  3F2B A;  1HZC A;  1NTG A;  1TS3 A;  4BWG B;  2FJZ A;  1F77 A;  2F0O A;  3K8A A;  2ZTE A;  2UU9 L;  4DR2 H;  1I3Q H;  1DD2 A;  1FR3 A;  2NVY B;  2CW0 D;  4OO1 G;  3RFC A;  5CB4 F;  1NMG A;  1BUV T;  1EY4 A;  2FPP B;  5KFF A;  1JWU D;  1WCM G;  1YZ6 A;  4JV5 L;  1PLF A;  2K6A A;  4GLA C;  5COR A;  4CDC C;  1GSA A;  2FK1 A;  1RL2 A;  4KKS A;  1EYZ A;  5FPO A;  4UCT A;  1X32 A;  5M3F B;  3PQI A;  3IG0 A;  1N36 L;  1B44 D;  3BDC A;  4JI0 Q;  2Z6K A;  1HQR D;  3TS0 A;  3RGZ A;  1V9P A;  2Q8I B;  4LFB H;  1PDQ A;  3MHB A;  3BDO A;  4HR7 B;  3OMG A;  4TRD A;  3OW7 A;  2IL8 A;  3PVX A;  5IP7 G;  3C2P A;  3NHH A;  3GTL B;  4EGQ A;  2R3Z A;  4YBZ B;  2Z9H A;  2KHS A;  1LT4 D;  1OTC A;  2K5V A;  3QO2 A;  5J1Z A;  3K80 C;  1HNZ H;  5H1S E;  3GTQ B;  2O4X A;  4HNV A;  2LY7 A;  5CBA E;  4OO1 H;  3K0Y A;  1PRT D;  3I56 A;  1WCM H;  4HED A;  1JJC B;  4A3G G;  2K1B A;  3MWM A;  1XNR L;  4HSV A;  4X3U A;  5DLG A;  3ND8 A;  4YJ3 F;  2HDL A;  4A3I G;  2JA7 H;  3N43 B;  4OX9 H;  2Q2H A;  4A3J H;  1EU3 A;  4BBS G;  1WFQ A;  2OLS A;  4GLV B;  4KJN A;  1IXR A;  3S2H H;  1V1Q A;  1C48 A;  3M4O B;  4V0B A;  2PZW A;  2IWH A;  3HOX G;  4XDX A;  1IYU A;  2F0D A;  4DR7 H;  2UVV A;  1N33 L;  4ED6 A;  2SNS A;  2W57 A;  2YW2 A;  2AMC B;  3CCE A;  1SE2 A;  4DV5 H;  3VPB A;  2PQA A;  1Y69 U;  4J9K A;  4BY1 G;  3C1E A;  2JA8 G;  1S0O A;  5J22 A;  3OSN A;  1TWA H;  5IOC A;  2A69 C;  2YCH A;  3HOV G;  3RAX A;  3Q23 A;  4C1N I;  2AUJ D;  1NE3 A;  2KSW A;  4A75 A;  1VQH A;  1HTL D;  4LFA Q;  1TWH A;  4DL3 A;  2W70 A;  4RB3 C;  3FDS A;  2R92 B;  5KFX A;  1UWV A;  2CWA A;  2NVX H;  1M7J A;  4DAY B;  4DV1 Q;  4C3J B;  2KCN A;  5JJZ A;  4A3I H;  3S1M H;  4BBS H;  5FK9 C;  1STG A;  3GIM A;  1B6R A;  2UUB H;  1I7L A;  3VPD A;  1ZXT A;  2O2L D;  2I80 A;  4EBD A;  3BVZ A;  3SDZ A;  5D1O A;  1GVP A;  1S97 A;  2PVP A;  3C1F A;  2WP8 J;  4A3F G;  3HOX H;  3CPW A;  1FD7 D;  2I5H A;  1XPR A;  5GQO A;  4X3K A;  2F0M A;  1Q1B A;  4CBV A;  2VNU D;  4ABN A;  4DV4 L;  1XDN A;  1F9P A;  1KJ8 A;  2F0V A;  3TEH B;  2R85 A;  4UP7 A;  2R61 A;  1ASZ A;  4JI6 L;  1WTQ A;  2F0G A;  4JI8 L;  2W7P A;  1RYR A;  2A6H D;  4BY1 H;  1ZET A;  2JA8 H;  1QZG A;  2R6F A;  2HT1 A;  3HOV H;  2GPW A;  2F4V Q;  5CA0 F;  2AQ3 B;  1C3O A;  4ZHQ F;  1ML0 D;  4HNT A;  2M2L A;  2V4R A;  1AUV A;  1QOH A;  2DPI A;  1AN8 A;  3EA6 A;  3WNZ A;  3PO2 H;  1TWC B;  4QWA A;  1E4E B;  2BH8 A;  4FP5 D;  1PK8 A;  3E9H A;  2A68 D;  5F9N A;  2FPG B;  4C3I H;  3ND9 A;  1V1P A;  3D6W A;  3C46 A;  2ALY B;  2R6G A;  4NXM L;  4I7H A;  1XTC D;  5EPK A;  5EBC A;  2JA5 B;  4JV0 A;  4H13 C;  5M3M G;  3U4V A;  5M5X B;  4A3F H;  2EJG C;  1BNZ A;  3L3O C;  1Y1W A;  1PH6 A;  2WKC A;  3R23 A;  4IZ8 A;  4L63 B;  1E2W A;  2M00 A;  5C44 H;  2WTF A;  1KJJ A;  4LF9 Q;  3EFX D;  5JUM A;  2F3I A;  4L5Q A;  4K8I A;  1S0M A;  4IOA A;  2E2H B;  4DK1 A;  1LV9 A;  3MEF A;  1GD7 A;  1TT2 A;  5G3L F;  3FMA A;  3MR6 A;  4YB8 B;  2AGO A;  4JUZ A;  1K3R A;  3MC0 B;  3S1R H;  1YHQ A;  1S5F D;  1TY0 A;  4IO9 A;  4FM9 A;  3WOF A;  5I47 A;  1G51 A;  2DUD A;  2XIW A;  4GOP C;  1A15 A;  1CZG A;  3HOW H;  3WO1 A;  4JCV E;  4NB3 A;  4YHH Q;  2I07 B;  1VKZ A;  1JX4 A;  1WTO A;  2RVL A;  4DPG A;  5D1P A;  3Q6S A;  1XMO L;  1S4Z A;  4XYM B;  5LA6 F;  5IT9 E;  1B2T A;  2IP4 A;  3GIP A;  3ER0 A;  4R4Q A;  1QB5 D;  2R82 A;  4YWM A;  3OPO A;  1HNX L;  3T1Y Q;  3CCU A;  5D8D A;  4JI5 Q;  1F2Y A;  1LTS D;  4GNX B;  1A63 A;  1WOC A;  1JE4 A;  4P2C B;  2YTV A;  4JOI A;  1O7Z A;  2K5D A;  3HKS A;  1ONL A;  2B2W A;  3BVM A;  4LF4 Q;  4RZQ A;  1EY7 A;  4J9O A;  2FE3 A;  4J9L A;  1SYB A;  2C2R A;  1CKN B;  2D2C C;  1FJG Q;  2N88 A;  1I3Q B;  2RA4 A;  2JSO A;  5CV4 A;  2X6L A;  4DL2 A;  3CCS A;  1L1O A;  3H0G B;  5IGG A;  4WJ4 A;  4JK1 C;  3P7J A;  1PRT F;  3DM3 A;  3X3M A;  5D3D A;  1EWH A;  4QMG A;  1JCK B;  5ELO A;  5LMN H;  2VQE Q;  3DWQ A;  1VQK A;  1XNQ H;  2OQ0 A;  2KJX A;  1JLL B;  4KY7 A;  4A3C H;  2R7L A;  4NXN H;  3SHL A;  2FK3 A;  4J9P A;  2E75 C;  3DWA A;  1N34 H;  1VF7 A;  4JI0 L;  1GUS A;  2ZXP A;  5A2Q E;  5CV6 A;  2R8I A;  3W2D A;  5KRU A;  1WYD A;  3BZD B;  4B08 A;  2CWP A;  1O75 A;  1FKA H;  4E4T A;  4IR9 A;  5JPM C;  3CAM A;  4EG0 A;  1U9R A;  1VF5 C;  1PFM A;  1WCM B;  1IOW A;  1S0N A;  1IBL Q;  4NPS A;  2W9C A;  2EXZ A;  3Q2O A;  1CSP A;  3VYU A;  1N48 A;  3NK9 A;  4ED1 A;  3AQQ A;  1WVL A;  2JA7 B;  5EOY A;  2KUM A;  3QFF A;  4A3J B;  2QDB A;  1SYX B;  1PRT C;  1NMF A;  2W6O A;  3Q8S B;  3S2H B;  3SXH A;  2Z4H A;  5KIX A;  2RGR A;  2JA6 A;  4J6H A;  4K5X A;  3FEW X;  4LF6 Q;  1HR0 Q;  2VQF H;  4DAV A;  3I7F A;  3MR3 A;  1UEB A;  4N9P A;  1E3P A;  5C5J A;  1KRS A;  2F0T A;  1P8L A;  2OCE A;  2RBM A;  5GAG C;  1TAE A;  3GV3 A;  2E2I A;  4O2A F;  2CQY A;  1X6O A;  3HFZ B;  1TWA B;  5COY A;  4DU9 A;  2HVR A;  2FMA A;  1Y1V H;  1TS5 A;  3VR3 A;  4JBM A;  1FNV A;  4RGN A;  3EYY A;  4O3P A;  4YY3 H;  4F4X A;  1LT6 D;  5CYU A;  2CW8 A;  1VQE A;  3PR4 A;  4DR4 Q;  4CDD C;  4C2M A;  1HUM A;  1HJP A;  1X65 A;  4OON A;  4LFC Q;  1QVC A;  3S1M B;  4BBS B;  2AGP A;  3OTO H;  1Q90 A;  3QJY A;  2UXB Q;  4LFA L;  4MV3 A;  1BCP B;  4MV9 A;  2G9H D;  4DV1 L;  3HOX B;  1KXL A;  2YS6 A;  1XTD A;  1K73 C;  3GIK A;  4I4T F;  1M6V A;  2B2Y C;  5IE8 A;  2JQO A;  2DNC A;  3KBX A;  4G4K A;  3MWD A;  1FGB D;  2UXD Q;  2NUA B;  4FBU A;  3CQZ H;  3V6K A;  2HDM A;  5C5M A;  1E1T A;  1L0W A;  5DQH A;  2JEB I;  2QIL A;  4B9W A;  2R7N A;  1F2M A;  1SE3 A;  2MGS A;  3K5L A;  4BY1 B;  2CW7 A;  1VQ9 A;  2JA8 B;  4RCN A;  3HZX A;  3J80 W;  2E76 C;  3BJU A;  3HOV B;  4O3S A;  2KA7 A;  2RDI A;  5BN3 A;  3FDT A;  4A3B G;  2JJQ A;  3Q24 A;  4X64 Q;  1CS0 A;  1PYS B;  4P73 A;  3JAM E;  3LP8 A;  1IBM H;  1EZ6 A;  1KNA A;  2A6H C;  4XIG S;  1C0A A;  5KG0 A;  5LYJ F;  3PO2 B;  4HYK A;  1VBH A;  1T94 A;  2AQ2 B;  5ELN A;  2F4V L;  3U9S A;  1HUN A;  3RV3 A;  1RK6 A;  5C4H A;  1IKL A;  4OWW B;  4C3I B;  4RHR A;  3LWB A;  3V6H A;  4DLK A;  1CA5 A;  1BKB A;  4A3F B;  1MD2 D;  1F2L A;  4A3E G;  1U4R A;  1W93 A;  5DNF A;  2HQE A;  1HZA A;  5C44 B;  4CKB A;  3GLK A;  2A68 C;  1A6X A;  4IRC A;  5C4Z A;  4DV0 H;  3IKJ A;  2J6U A;  4JI4 H;  4YR0 A;  4DUZ Q;  4KTA A;  3KLS A;  5KNB A;  2R7Z G;  5KG6 A;  4ECV A;  2EYJ A;  1BF4 A;  1G2T A;  3PSI A;  4LF9 L;  3S1R B;  3D3R A;  2A1A A;  1BJT A;  4LUV A;  2B2V C;  4A3B H;  1A3V A;  1B33 N;  4ECX A;  4ULL A;  1DM0 B;  3N40 P;  4R8U B;  3T51 B;  4MA5 A;  2YRW A;  5DGA A;  3H91 A;  3S14 H;  4DA2 A;  4FF4 A;  1Z2N X;  3HBL A;  4LJZ C;  4FNF A;  4DR1 Q;  4B3T H;  3W1B A;  1VQI A;  4M1U B;  4JI2 Q;  3HOW B;  1KEE A;  3R8B A;  2XGQ A;  1STY A;  2WAQ A;  1LT5 D;  4RWS C;  5M3F G;  3E6Z X;  3OUU A;  1OXV A;  1U4L A;  3NBH A;  1YJ9 A;  3BZK A;  2FIN B;  4DK6 C;  2YZM A;  2Z8L A;  3PGZ A;  2E2D C;  3T13 A;  4B3S Q;  4YHH L;  4K5V A;  2N8N A;  2PNH A;  4HJ8 A;  2UVW A;  3T1H Q;  3LWE A;  2K01 A;  4B3M Q;  2ZXR A;  2IA6 A;  4F87 A;  4AQY Q;  3F1Z A;  1KIX A;  1JOQ A;  2D0P A;  4HR7 A;  2NVT H;  3D4D A;  3T1Y L;  2L0C A;  1X55 A;  4JI5 L;  1IHZ A;  4IJL A;  4MNO A;  4RG1 A;  4R8I A;  4LH6 A;  1XWE A;  1I7N A;  4BS9 A;  5CBE E;  2W9B B;  4RGO S;  1EY9 A;  2NN6 G;  1GUT A;  1O80 A;  5KFD A;  2JEG A;  2B63 A;  5CV5 A;  4LF4 L;  2DWC A;  3VA7 A;  3GTQ A;  1SFO H;  4WJ3 M;  5IT9 c;  5AJ3 Q;  3BG3 A;  5KFV A;  2XGT A;  4KKT A;  4IUR A;  5C1P A;  1FJG L;  3GQC A;  3BA9 A;  1NR2 A;  1WI5 A;  4A2A A;  4WBN F;  5KFH A;  4G7O C;  1B9N A;  5JJK A;  1AUX A;  4RKB A;  2UUC Q;  4HIO A;  1RJT A;  3QWN A;  1B3A A;  4UHV A;  1F9Q A;  1T3N A;  4RAU C;  1ZHS A;  3K5O A;  1SNO A;  3GIJ A;  1TY2 A;  3PUW A;  4KY5 A;  3WOE A;  4DUY L;  2R93 G;  2NU8 B;  2ZJT A;  5M5W H;  1M8A A;  3GTL H;  1TWG B;  4LWC A;  2VQE L;  1Z2O X;  1SN8 A;  2HJW A;  3PIP A;  1LM0 A;  1D6E C;  4N8X 1;  4TKO B;  4MV4 A;  1ESR A;  1JJ2 A;  1K83 H;  4PZ6 A;  3CW2 C;  3S17 H;  2IY5 B;  4CKE A;  2I87 A;  2N55 A;  1MBY A;  1G91 A;  3RBE A;  1G8Z D;  3NWS A;  1AZP A;  2NN6 H;  4K6D A;  1QCB D;  3BVG A;  3N42 B;  3SK5 A;  3AMU A;  1KJ9 A;  2JA9 A;  2ZTD A;  1KL9 A;  2R92 G;  5C0X G;  2PW7 A;  1KAB A;  4LAA A;  4ED0 A;  1I6H H;  4JYA H;  4JI6 H;  2F0U A;  3F2C A;  1H9S B;  4YQW A;  2CZG A;  4IN3 A;  1K0R A;  4ALP A;  3A7A B;  2F03 A;  4RMF A;  5FLM G;  3L7Z C;  1P16 A;  3M4O H;  4ZKB B;  2R92 A;  1XYI A;  2VOB A;  2R93 H;  4DAY A;  1KJQ A;  2CKZ B;  1OXT A;  5C3E G;  2WFW A;  2NUC A;  2FLL A;  4KI0 A;  5IY0 A;  3KF6 B;  4OWX B;  4DXG A;  1E22 A;  3FP9 A;  4DL5 A;  3QOJ A;  1CQJ B;  2RDJ A;  1XMQ Q;  1AP0 A;  3GTM A;  4JPB W;  4X62 Q;  3TQ1 A;  3N41 B;  4XQJ A;  1Y8O B;  5JVG 3;  4LF6 L;  1HR0 L;  2IW3 A;  2L11 A;  3PW2 A;  3MXN B;  4EVO A;  1Y1V B;  4LF8 Q;  2HVS A;  3N6R A;  5KFI A;  5FD5 A;  2OT2 A;  2EQS A;  3PW4 A;  1IKM A;  5J2T F;  4UCV A;  1EFW A;  4IRK A;  1YIT A;  5IOD A;  4DV6 Q;  1J9O A;  1RHP A;  2HQL A;  4RNO A;  2XC9 A;  5FLM H;  4GOP B;  3Q22 A;  1O78 A;  4DR4 L;  4O4L F;  1TWC A;  3CRK C;  1E4E A;  1HPC A;  5C3E H;  3J81 E;  2K04 A;  1SE4 A;  3HOU G;  3H3V I;  4LFC L;  2IJ0 A;  3TBI B;  3ERS X;  4TQS A;  3JAM i;  3PCO B;  2C2E A;  2UXB L;  1VBG A;  5T1I A;  3CQZ B;  1D8L A;  2JA5 A;  1YNX A;  2ATL A;  4X66 H;  1A2U A;  3SVM A;  5KFA A;  4WOR A;  2W6M A;  3E0E A;  4MTN A;  3T5H A;  3RBD A;  2L9H A;  2E2H A;  2E5L H;  2UXD L;  3RV4 A;  1AFP A;  5J3B A;  2B8F A;  3JSL A;  1BOS A;  5I9P A;  5JH7 F;  3KHR A;  3KBG A;  4IUV A;  1A9X A;  2KOL A;  3MFI A;  5HGT A;  2L1B A;  5EQ0 A;  1W6J A;  4ILW A;  5KFW A;  2ATW A;  4G3I A;  2D62 A;  4LUO A;  2ENB A;  4L8J A;  2Z6K C;  4IZO A;  5I2X A;  4ZOL F;  3NQI A;  4HTH A;  2WB1 E;  5IT9 W;  4DF7 A;  1N32 Q;  1W2B A;  3HOU H;  1DCZ A;  3J7Z C;  4NP5 A;  4RGT A;  3PW7 A;  1UNS A;  3RB0 A;  4B3R H;  5IYD G;  3K5H A;  4DL4 A;  3F2D A;  1GJX A;  1V1O A;  2NZ1 D;  1Q8K A;  2EYH A;  3CD6 A;  4GNX A;  4JBW A;  4UP9 A;  4YR3 A;  3AB9 A;  3KJO A;  3I4L A;  4MTK A;  1V8Q A;  5ELD A;  4A3B B;  4HJ9 A;  2CVR A;  1IL8 A;  2FB9 A;  4DKA C;  3J7A K;  1XMO Q;  3RLO A;  1HH2 P;  2YU9 H;  5L1J A;  2IMW P;  3S14 B;  5EJW A;  3H0G G;  3P20 A;  3MJF A;  1JQY D;  3U9O A;  4YCV A;  1JB3 A;  4E6I A;  1I3Q A;  4N8F A;  4EQN A;  2DN8 A;  3S9W A;  4CJ0 B;  2D0O A;  1I4R A;  1T5E A;  3MXU A;  1ENA A;  1S5C D;  2UXC H;  2A74 C;  3ULP A;  4DR1 L;  4JI2 L;  3AU7 A;  2E8G A;  5G3L D;  4ETS A;  4DV2 Q;  2ZM6 H;  3KUP A;  1KC8 C;  5LOV F;  3M9B A;  3I8Z A;  4O0A A;  2BQR A;  2RSN A;  3D6C A;  3EN2 A;  1VQN A;  1YJW A;  5IYD H;  4ZAI A;  5LMU Q;  3QZ7 A;  2A19 A;  1PRT B;  4IPD A;  4B3S L;  1EHI A;  5FPR A;  2IX3 A;  5LXT F;  5KFJ A;  1VAJ A;  3LWU A;  3G6J B;  2NVT B;  2Q2T A;  4IOC A;  1KTK A;  3KTM A;  4JI1 Q;  5J2U F;  4C1N K;  2XSC A;  4X65 H;  3T1H L;  1JIH A;  3PUZ A;  4B3M L;  3FRP B;  2K7V A;  5D3I B;  1EYA A;  4DR5 Q;  2W9A A;  3DLL A;  4AQY L;  2R87 A;  1VQG A;  1VQC A;  4I7A A;  2RF4 A;  2KCT A;  3OMC A;  2IPK D;  5FLX E;  1JWS D;  3H0G H;  5KYI A;  3UDX A;  4HSP A;  1SFO B;  1DIK A;  2QEX A;  2ASL A;  2C35 B;  5KT6 A;  1SNP A;  2NBF A;  4DNT B;  2JA7 G;  1GUW A;  1U4M A;  3M4Q A;  3A7L A;  4A3J G;  1WCM A;  4DV7 Q;  3LX0 A;  3G6X A;  3GTK A;  1EIH A;  3KAL A;  3GV8 B;  5AJ3 L;  3OUZ A;  5FO7 B;  2OF1 A;  3KDF B;  1I94 Q;  2CFM A;  1SBB B;  5M5W B;  2BCO A;  2JA7 A;  4Q5V A;  1CTM A;  2UUC L;  4QB4 A;  3MR5 A;  2VS1 A;  1HTP A;  1UE7 A;  4RAZ A;  5K2M A;  4X3T A;  5LHY 1;  1K83 B;  4PMB A;  1PYB A;  3S17 B;  2YZG A;  5CAE B;  3KF8 B;  1HR0 W;  1V4Y A;  1H9K A;  4R4C A;  4QW8 A;  2NVQ H;  1GM5 A;  3TQT A;  1H9J A;  4QGU A;  3RD4 A;  3TIG A;  2UUA H;  4F7X A;  4K2L A;  3TS2 A;  1T36 A;  1QJO A;  2Y0S E;  4DR3 H;  2Z4I A;  2DGY A;  3MTS A;  3R3O A;  3RNU A;  1I6H B;  2RSO A;  4IWX A;  3K3V A;  4YP3 A;  4XYQ A;  5EWE A;  4JI7 Q;  3NXW A;  3ULJ A;  4NMZ A;  3AEV A;  2C2D A;  3LNN A;  3U50 C;  2NVX A;  2WB1 B;  2R93 B;  4KHV A;  1FL0 A;  1I5F A;  1LAB A;  4EEY A;  3TZD A;  2ES2 A;  3TP8 A;  1STB A;  3RR5 A;  5NUC A;  4DR2 Q;  4TVA B;  1ENC A;  3GII A;  3W5O A;  2F0J A;  4N9T A;  1SYD A;  5F9L A;  4UAI A;  3VYS A;  1IL2 A;  4MZ9 A;  4GN3 B;  4G7H C;  2WE6 A;  3J81 i;  4RA8 A;  1X54 A;  1IOV A;  2FHT A;  1XMQ L;  2XRQ D;  3HOZ B;  1PZJ D;  4X62 L;  3A8I E;  4MIU A;  4LF5 H;  4F88 A;  3PO2 G;  3MWY W;  1XX8 A;  2FLN A;  1VQL A;  3GTO A;  3RLN A;  3GTP H;  1S5B D;  3I70 A;  4RZR A;  2CQO A;  5JVH 3;  3Q8D A;  5D65 A;  4C3I G;  4LF8 L;  4RNM A;  4CDF C;  1LTL A;  3DWP A;  2NB0 A;  5KG2 A;  4QIW E;  1IW7 D;  4K6L A;  1HNZ Q;  5C3E B;  4WRD A;  2GPS A;  5C4X G;  1I50 B;  5C44 G;  3M7G A;  4DV6 L;  5KFU A;  3TP6 A;  1GYF A;  3OWF A;  1Z2P X;  2B2W C;  1ZQ7 A;  2W6N A;  3UDI A;  3RB3 A;  4RKL A;  5ELB A;  1FYC A;  3JSN A;  5KT2 A;  2DJF C;  2BQ3 A;  1KNE A;  4JI3 H;  3BYY B;  3I4N B;  4IJH A;  4FXD A;  5K36 H;  2IHE A;  4OX9 Q;  2EJF C;  5J39 A;  1KLU D;  2OXP A;  3G71 A;  1MKH A;  1Q82 C;  1EIY B;  3HOW G;  2XCL A;  2PNR C;  1UAP A;  1SDF A;  3RF2 A;  3J81 c;  3SGI A;  3K6O A;  2HD3 A;  4JI5 H;  1EQT A;  1X3E A;  1YNJ C;  3K7A H;  4HN7 A;  4DV5 Q;  2RCN A;  4FVM A;  4ZLT F;  5C4X H;  3HOU B;  2NU6 B;  1D5M C;  2F0S A;  1G2S A;  3K5M A;  3A74 A;  3HS0 C;  4KLK A;  5JOB A;  1PFB A;  1H9M A;  1O7I A;  1N32 L;  3J80 L;  4LF7 H;  2CCZ A;  2RDF A;  1CQV A;  4ZCK A;  2MCT A;  1JR0 D;  4UDU C;  5F2D A;  1BQQ T;  3CC2 A;  1UC8 A;  2UUB Q;  4WD3 A;  2YU9 B;  1RCV D;  4GS3 A;  4DR6 H;  2XWJ B;  4PZ7 A;  3PMF A;  3DEP A;  1VMC A;  2ZDG A;  3ETJ A;  2Y0S B;  4EGV A;  4GKJ L;  5T14 A;  3CCJ A;  2W9B A;  3VYR A;  1GSH A;  1CZW A;  4IFD I;  1EY8 A;  1VMP A;  4PMW A;  1AN7 A;  3L9A X;  2VA3 A;  5ELC A;  1HNW L;  2SEB D;  4MAM A;  4K0K H;  4A3C G;  3CCV A;  4I7Z C;  1WTR A;  4ZKC B;  1CFM A;  1DGS A;  4KN4 C;  1ICW A;  4S3S A;  4PWQ A;  3OIP A;  2IHF A;  1K8A C;  4R7R A;  1MSH A;  4LSX A;  5KND A;  1Y1W H;  1A2T A;  4DV2 L;  1LTI D;  3G6Y A;  3NP8 A;  1EU4 A;  1I4Q A;  2AWN A;  3PF5 A;  3TDQ A;  1IBL H;  2XRS D;  5L37 A;  4EBE A;  5LMU L;  4KD3 A;  3RZD H;  2NYZ D;  2EY6 A;  2O5I C;  3VA5 A;  4CHT B;  2HHH H;  3D31 A;  4U7C A;  4JI1 L;  4DUY Q;  4DGZ A;  4BY7 H;  3RAQ A;  1PX2 A;  4ZQI A;  4DR5 L;  4HJ7 A;  1X9N A;  3AFP A;  1X3Q A;  2FMM A;  2PMZ E;  2J7Z A;  5EPL A;  1EEI D;  3H3V C;  2JN4 A;  5KG3 A;  3L4K A;  4OXP A;  4QIW B;  5C0X J;  3LML A;  3C3L A;  4YR2 A;  3Q8Q B;  1OXX K;  4Q0Y A;  1TWG H;  1KLG D;  3Q1K A;  4M7E A;  2J0T D;  2V59 A;  3VPC A;  4M9U A;  4DV3 H;  2PZU A;  1RYS A;  2BE5 D;  4DV7 L;  2J6T A;  3PUV A;  3IN5 A;  2AHO B;  1I4H A;  3Q0A A;  3I73 A;  1XPU A;  4R4O A;  1I94 L;  2WV6 D;  1QVG A;  4K2K A;  3CRL C;  5FLX c;  3KF6 A;  4J15 A;  2C9O A;  1Y1V G;  2NVQ B;  3KK7 A;  4EQP A;  1VDZ A;  2EY5 A;  2H4O A;  2RDH A;  2XNA C;  4R4I A;  5LP6 F;  1ZKO A;  3DXJ C;  3TIN A;  3UQ8 A;  3QZ8 A;  1PXU A;  1VQF A;  2F0W A;  1UC9 A;  1HCZ A;  1WSC A;  3H4D A;  5IGF A;  3H6M A;  4LW1 A;  1PH9 A;  3S1N H;  5EPJ A;  2H5X A;  1LTR D;  1JDB B;  1QWY A;  1TXY A;  2NTT A;  4A2B A;  2HGS A;  3MVV A;  4PDB A;  1KRT A;  4P72 A;  2AGQ A;  1CQF A;  3NUC A;  5E3F A;  5JQW A;  1J5E H;  2OWO A;  2QEJ C;  1T5X D;  2JEA I;  4QWC A;  2MNA A;  1CUK A;  2EPB A;  3DHQ A;  4JI7 L;  1A8V A;  3HB9 A;  4J9Q A;  1CQI B;  4QF4 A;  5C1O A;  1Q46 A;  2A6E D;  1DJR D;  4X64 H;  4DR2 L;  1PMR A;  1KD1 C;  4JG2 A;  2C5C A;  2KED A;  3CQZ A;  3KHH A;  3A8K E;  2B2T C;  5LMN Q;  1STN A;  1XNQ Q;  1AW7 A;  1NSN S;  1OXS C;  3RMH A;  4NXN Q;  4AYB G;  1UNN C;  1TA8 A;  4O42 A;  4GKK H;  2W8L A;  3GTP B;  3U4Z A;  1BBX C;  5C4J H;  1F9R A;  4B9X A;  1N34 Q;  1SNQ A;  4DFA A;  4KD4 A;  1EWC A;  3DUZ A;  3MXP A;  4Y52 H;  2K33 A;  2XWB B;  1WTV A;  4LFB L;  3F2U A;  1GOZ A;  2MFI A;  4QCL A;  4DUZ H;  3H4B A;  2FPI B;  2PBZ A;  4HJ5 A;  1QUQ A;  1EZ8 A;  1S5E D;  1EZ1 A;  5IYZ F;  3OOC A;  2QGQ A;  4HMJ A;  2K5W A;  1HZB A;  3GD7 A;  1SYE A;  4OEL B;  3Q8P B;  5GAD C;  1HNZ L;  3N6X A;  1IW7 C;  3ERO A;  4KHP H;  1QVF A;  2K32 A;  1B8A A;  4HMI A;  1PA6 A;  4P74 A;  3OSP A;  2ZTC A;  3AFQ A;  3M9M B;  1MJE A;  4EEQ A;  2R8G A;  1M4V A;  1JE5 A;  1WH2 A;  1LT3 D;  1HHV A;  1ULZ A;  1EQQ A;  3MR2 A;  1G29 1;  3RZO H;  2K28 A;  2VQF Q;  4OX9 L;  3NEM A;  2JEJ A;  1SNC A;  3I4M H;  3CCQ A;  2PMZ B;  4LNQ A;  3K5N A;  2SCU B;  5IGE A;  3S16 H;  2JP1 A;  2UU9 H;  1I4G A;  3HP3 A;  2ID0 A;  5C3W A;  3K7A B;  3L0O A;  3JRX A;  1B7Y B;  3K3P A;  5C8Y F;  5EWF A;  5C4X B;  2BQU A;  2EYM A;  5IGC A;  1IYV A;  1PH1 A;  4JV5 H;  2F52 A;  5CC4 A;  2ASD A;  5D1O B;  3NEL A;  1SSO A;  1O7L A;  3H3V H;  5BN4 A;  4PQX A;  2G9D A;  1E2V A;  4DV5 L;  4YY3 Q;  1M0T A;  2V5A A;  1N9W A;  4HCS A;  1N36 H;  2VB2 X;  4MTD A;  5H80 A;  4QUF A;  5FKA C;  2AU0 A;  5I9O A;  1GXD C;  1I6U A;  1W6K A;  3OTO Q;  1EIF A;  1IBK Q;  1DON A;  2R7Z A;  3VMM A;  2SOB A;  1D7Q A;  4GC7 A;  1KDA A;  3BQ0 A;  5FLX W;  4Y7N H;  4XX0 B;  5KFC A;  2PCF B;  1CM9 A;  5KFE A;  2NVY A;  5KG5 A;  2BA1 A;  1LTB D;  2GVB A;  2XVS A;  3NSW A;  1PVO A;  3KAK A;  1M90 C;  2UUB L;  3V4S A;  2QKI C;  4APM A;  1CHP D;  2HIX A;  4FF3 A;  5IT9 L;  2YL2 A;  1SFO A;  2KHI A;  5IYC H;  5KFP A;  2A8V A;  3N8D A;  3GTG H;  4F50 A;  3A5U A;  5E4X A;  1QNU A;  2EYL A;  4H44 C;  2KHJ A;  1MGS A;  2RGV A;  2J6S A;  1KBL A;  1XNR H;  2FMC A;  2Z0S A;  1S03 G;  4IAL A;  4CGY B;  1SE8 A;  4Z9C B;  1Y1W B;  4Q45 A;  5EBD A;  3KDF A;  1IBM Q;  3M3Y H;  1B70 B;  2EIF A; 
#chains in the Genus database with same CATH homology
 1FGU A;  3HOU H;  2LXK A;  3WWV A;  2B3G A;  3J7Z C;  1GO3 E;  1UWV A;  2CWA A;  5JJI A;  2NVX H;  4DAY B;  4DV1 Q;  2UXC L;  2YYZ A;  4A3I H;  1VQ5 A;  4GLX A;  3S1M H;  5IYD G;  3G4S A;  4A4I A;  4BBS H;  1U0L A;  1C9O A;  4PG3 A;  4R4T A;  1Q1E A;  2ZM6 L;  3HKZ G;  1GVP A;  3F2D A;  1GKH A;  4AYB E;  1Q8K A;  5E7N A;  2OTJ A;  2WP8 J;  1CSQ A;  3CD6 A;  4GNX A;  4A3F G;  3HOX H;  4JBW A;  3CPW A;  2I5H A;  2N49 A;  4GOP A;  4UP9 A;  1XPR A;  5GQO A;  3KJO A;  1NJI C;  2RHS B;  1Q1B A;  2MO0 A;  4HJ9 A;  2BH2 A;  1U5K A;  2VNU D;  4DKA C;  4DAM A;  4DV4 L;  1XMO Q;  4JI4 Q;  3RLO A;  1HH2 P;  2YU9 H;  2JA6 G;  1W3S A;  2HHH Q;  1FVI A;  3TEH B;  1SR3 A;  2WB1 G;  4UP7 A;  1ASZ A;  4JI6 L;  5JJL A;  3H0G G;  4JI8 L;  4X65 L;  1UE6 A;  4YCV A;  4BY1 H;  3CPF A;  1QZG A;  2JA8 H;  3TRZ A;  1SRU A;  2HT1 A;  3HOV H;  4A3D H;  4UY8 C;  4LUZ A;  2D0O A;  2F4V Q;  4BBR H;  3ULP A;  3CC7 A;  4DR1 L;  2V1C C;  1KAW A;  4B3T Q;  4JI2 L;  2E8G A;  4DV2 Q;  1CKM A;  1KC8 C;  1S3O A;  3PO2 H;  3LGJ A;  2BH8 A;  4DV3 Q;  3M9B A;  3E9H A;  3W1G A;  4O0A A;  4IPH A;  3I4M G;  3EN2 A;  1VQN A;  1YJW A;  5IYD H;  5LMU Q;  4C3I H;  2A19 A;  3HOZ G;  2ALY B;  4IPD A;  3UDF A;  2R6G A;  4B3S L;  4NXM L;  2R7D A;  4A3F H;  1EUJ A;  3U4V A;  5M3M G;  4IOC A;  2Q2T A;  4JI1 Q;  1PH6 A;  3T1H L;  1PH8 A;  4R1J A;  4YCW A;  3PUZ A;  5C44 H;  5IWA Q;  4LF9 Q;  4B3M L;  4DR5 Q;  3TRE A;  2VUM G;  2F3I A;  4L5Q A;  3FHW A;  4YWL A;  4APV A;  3DLL A;  4OWT B;  4AQY L;  1VQG A;  1VQC A;  1VQ4 A;  2JA6 H;  4IOA A;  4A3K H;  2RF4 A;  2KCT A;  3MEF A;  1GD7 A;  2HIV A;  3H0G H;  3B6Y A;  3UDX A;  4C3H H;  2QEX A;  3VDY A;  1K3R A;  2C35 B;  4AH6 A;  3S1R H;  4NXM Q;  2E2I H;  2PQA B;  5DLQ E;  1YHQ A;  4IO9 A;  2UUA L;  2JA7 G;  1Q12 A;  2YV5 A;  3M4Q A;  2ZJR A;  4A3J G;  4DV7 Q;  1AE2 A;  1G51 A;  2DUD A;  3J81 j;  4GNX C;  1QZH A;  1PHJ A;  3J7A 5;  4GOP C;  4AIM A;  4DR3 L;  5AJ3 L;  3HOW H;  5IP9 G;  4JCV E;  4NB3 A;  3KDF B;  3S2D H;  1I94 Q;  4HIM A;  1AE3 A;  2CFM A;  4YHH Q;  2VL6 A;  1S72 A;  1J5E Q;  4HID A;  3I4N G;  1JB7 A;  2UUC L;  1PFS A;  4C2M H;  2I0Q A;  2VS1 A;  1K8G A;  1PH7 A;  3HOZ H;  4DPG A;  1TWF H;  1VQO A;  5IYC G;  1XMO L;  3KYH C;  1UE7 A;  2ZJQ A;  4DR7 L;  3ER0 A;  4R4Q A;  5GAH C;  4YWM A;  1PYB A;  1HNX L;  3T1Y Q;  3CCU A;  3UDG A;  3KF8 B;  4JI5 Q;  2VUM H;  1HR0 W;  4R4C A;  3CCM A;  4GNX B;  1A63 A;  2NVQ H;  1WOC A;  5LMN L;  1GM5 A;  5GRO A;  2YTV A;  2WAQ E;  4JOI A;  4QGU A;  4IFD J;  3TS2 A;  1IZ6 A;  1XNQ L;  1LUZ A;  3HKS A;  4NXN L;  1I50 H;  4A3M G;  2Y0S E;  3OW2 A;  4LF4 Q;  2LXJ A;  4UP8 A;  4DNI A;  1R9T H;  3H15 A;  4GKK Q;  1MJC A;  2K14 A;  1CKN B;  2DGY A;  3RNU A;  1N34 L;  3PV0 A;  1FJG Q;  1X3F A;  1V43 A;  2XTI A;  4KHZ A;  4JI7 Q;  4LF5 L;  3ULJ A;  2E2J H;  3AEV A;  5IP9 H;  3U50 C;  1BBU A;  2EXD A;  3L2P A;  3I4N H;  3CCS A;  1L1O A;  1FL0 A;  1I5F A;  3AYH B;  4WJ4 A;  4O2D A;  2N78 A;  2ES2 A;  4JYA Q;  4P75 A;  1H95 A;  3RR5 A;  3DM3 A;  4DR2 Q;  3K7U C;  1S40 A;  2WAQ G;  4TVA B;  3W5O A;  3HKZ E;  5ELO A;  4KHP Q;  2VQE Q;  2Y0S G;  1VQK A;  4JV5 L;  2OQ0 A;  3K81 C;  1IL2 A;  4LFA Q;  4A3C H;  4MZ9 A;  4X6A H;  4GN3 B;  1UE5 A;  2KCM A;  2MO1 A;  3J81 i;  1X54 A;  1XMQ L;  4JI0 L;  1IYJ B;  4A3M H;  3JC6 6;  4X62 L;  4JI3 L;  3PO2 G;  1WYD A;  2CWP A;  2VQF L;  3PUX A;  4HJA A;  1Q86 C;  1Z47 A;  3RLN A;  1VQL A;  4A3E H;  3GTP H;  2I5M X;  2CQO A;  1VQM A;  3Q8D A;  4EX5 A;  4LF8 L;  1BBW A;  1LTL A;  5JEA J;  4QIW E;  2UU9 Q;  3CAM A;  1Q81 C;  1VQB A;  1E1O A;  5IYB G;  3S15 H;  3JAM c;  1HNZ Q;  1IBL Q;  4NPS A;  4GKJ Q;  5C4X G;  2R7Z H;  2B63 G;  4JV5 Q;  1X56 A;  5C44 G;  1JMC A;  4DV6 L;  1CSP A;  3GTJ H;  4A3L G;  4DV0 Q;  4TQU S;  3AQQ A;  4A3K G;  4YY3 L;  1PH5 A;  2NVY H;  1HNW Q;  1CKN A;  3UDI A;  1T9H A;  1NMF A;  3KJP A;  1N36 Q;  1LYL A;  3FKI G;  3ZJY C;  1YHA A;  4IJH A;  1EQR A;  4LF6 Q;  3OTO L;  1IBK L;  2IHE A;  5EAY A;  1HR0 Q;  5HGQ A;  5M3F H;  3I4O A;  4OX9 Q;  1PH3 A;  1Z9F A;  3I7F A;  3HOY G;  3ULL A;  2OTL A;  1UEB A;  3G71 A;  1MKH A;  1Q82 C;  1EIY B;  4LF7 L;  3HOW G;  1E3P A;  4X66 Q;  4IFD G;  4QQB X;  1KRS A;  2OCE A;  1P8L A;  1Q7Y C;  5GAG C;  3U58 A;  2JE6 I;  1VQ7 A;  1VQP A;  3J81 c;  3TQY A;  3SGI A;  1X6O A;  3HFZ B;  2E5L Q;  1C7Y A;  4DR6 L;  1Y1V H;  3BZC A;  2I5L X;  5IYB H;  1X3E A;  4JBM A;  3K7A H;  4DV5 Q;  2AWO A;  2RCN A;  1VQE A;  2K75 A;  5C4X H;  1XPO A;  2B63 H;  4DR4 Q;  4KHP L;  3GTQ H;  4A3L H;  1WJJ A;  1PV4 A;  1HJP A;  1X65 A;  4OON A;  1L1O B;  4LFC Q;  1XNR Q;  2BA0 A;  1JT8 A;  1YIJ A;  1QVC A;  3A74 A;  4KLK A;  1IBM L;  4K0K L;  4LFA L;  2UXB Q;  1O7I A;  3K0X A;  1XJV A;  1N32 L;  2IX1 A;  3FKI H;  2L15 A;  4DV1 L;  2CCZ A;  2YTY A;  5BR8 Q;  1KXL A;  1XTD A;  1K73 C;  1IBM Q;  5IE8 A;  2JQO A;  3CC2 A;  2KBN A;  4B3R Q;  3HOY H;  2UUB Q;  2UXD Q;  4QL5 A;  2ZJP A;  3CQZ H;  1N33 Q;  4GS3 A;  1E1T A;  3E9I A;  2OQK A;  3PUY A;  4PZ7 A;  1L0W A;  2JEB I;  4L5R C;  1IBL L;  4GKJ L;  3NBH B;  3CCJ A;  1VQ9 A;  1NY4 A;  2K5N A;  2YTX A;  3BJU A;  4IFD I;  4DV0 L;  4JI4 L;  4PMW A;  4A3B G;  2JJQ A;  2HHH L;  2JK8 A;  4POG A;  4X64 Q;  2PI2 E;  1PH2 A;  5JEA G;  1E24 A;  1HZ9 A;  1PYS B;  4P73 A;  1YEZ A;  1HNW L;  2LSS A;  4A3C G;  4JBJ A;  3CCV A;  4HIK A;  4XIG S;  1C0A A;  3S1Q H;  2ASB A;  1DGS A;  3GO5 A;  5FJ8 H;  5ELN A;  2F4V L;  2K5H A;  3A0J A;  1YVC A;  3BU2 A;  1EWI A;  2IHF A;  4P71 A;  1K8A C;  4OWW B;  2UXC Q;  4B3T L;  4A93 G;  1Y1W H;  2Q2U A;  5GAE C;  4DV2 L;  1BKB A;  2GVA A;  2ZM6 Q;  1AH9 A;  2IT1 A;  4DV3 L;  4A3E G;  2R92 H;  3CP0 A;  2K50 A;  2AWN A;  1HZA A;  3PF5 A;  4C3J H;  5LMU L;  3A5Z B;  2KEN A;  4YWK A;  5LMN W;  1OXU A;  3RZD H;  1X3G A;  4DV4 Q;  5C0X I;  4DUZ Q;  1SLJ A;  3D31 A;  4JI1 L;  4DUY Q;  1YI2 A;  2R7Z G;  1G6P A;  2QA4 A;  1W2B A;  1VQA A;  2JA5 G;  4JI6 Q;  4JI8 Q;  4X65 Q;  2VW9 A;  4BY7 H;  4BA2 I;  3GTK H;  5IWA L;  3PSI A;  1ASY A;  4DR5 L;  4HJ7 A;  4LF9 L;  3GTM H;  1X9N A;  2A1A A;  3AFP A;  4LUV A;  3CXC A;  4A3B H;  2PMZ E;  2PI2 A;  4OXP A;  5C0X J;  3S14 H;  4DR1 Q;  3W1B A;  1VQI A;  4JI2 Q;  4A76 A;  3RN2 A;  1OXX K;  1TWG H;  4L5S A;  1EYG A;  5K36 G;  5M3F G;  4DV7 L;  1OXV A;  4A93 H;  3PUV A;  1YJ9 A;  2AHO B;  5IP7 H;  1M1K C;  4K0K Q;  3BZK A;  4DK6 C;  1XPU A;  4LFB Q;  4R4O A;  3PGZ A;  1UE1 A;  1VQD A;  3I2Z A;  3UE0 A;  1VQJ A;  3STB D;  1I94 L;  4YHH L;  3G6E A;  1QVG A;  1J5E L;  1KQS A;  5FLX c;  4B3S Q;  3EBE A;  3KF6 A;  4JC0 A;  1TWC H;  4J15 A;  3F8T A;  3CF5 A;  2N8N A;  4IPC A;  2PNH A;  4HJ8 A;  2AKW B;  3T1H Q;  1Y1V G;  4R4I A;  4B3M Q;  4AQY Q;  3F1Z A;  1KIX A;  1QUQ B;  1VQF A;  4X64 L;  2D0P A;  2K52 A;  4JOI C;  2JA5 H;  5M5X H;  3T1Y L;  2FXQ A;  4H02 A;  4LW1 A;  2NVT H;  1X55 A;  2MQH A;  3KOJ A;  4JI5 L;  4A3G H;  1RIP A;  4IJL A;  1PH9 A;  3S1N H;  2H5X A;  4MNO A;  4RG1 A;  1Y14 B;  1TXY A;  2UUA Q;  1MIU A;  2NN6 G;  3PF4 A;  2E2H H;  1A0I A;  1KRT A;  4P72 A;  1YJN A;  4BA1 I;  4LF4 L;  1SFO H;  2VZA A;  3M85 A;  1K9M C;  3S24 A;  4GKK L;  5IT9 c;  5AJ3 Q;  4DR3 Q;  1J6Q A;  4WJ3 M;  2XGT A;  1FJG L;  1NBW A;  1WI5 A;  4POF A;  2OWO A;  3M7N A;  1VS0 A;  3RLF A;  1L1O C;  2JEA I;  3ICE A;  5JJK A;  2UUC Q;  2MNA A;  1CUK A;  2R7F A;  4HIO A;  4JI7 L;  1A8V A;  1CKO A;  4ME3 A;  2RHQ B;  4DUZ L;  3PUW A;  5HY6 A;  1VCI A;  3UE1 A;  1Q46 A;  4DUY L;  4DR7 Q;  4JYA L;  2R93 G;  4L5T A;  1TWH H;  5M5W H;  4DR2 L;  1EOV A;  1HNX Q;  1KD1 C;  4JG2 A;  3GTL H;  4PZ8 A;  2VY3 A;  3IRB A;  3RN5 A;  1YHB A;  4LWC A;  2Q2I A;  2VQE L;  5LMN Q;  2NZO A;  1SN8 A;  4EQ5 A;  3PIP A;  3GTO H;  3KFU A;  1LM0 A;  3G48 A;  1XNQ Q;  1OXS C;  1JJ2 A;  3PO3 G;  1K83 H;  4NXN Q;  5FJ8 G;  4PZ6 A;  3CW2 C;  4UPA A;  4AYB G;  3S17 H;  4BXX G;  4QJF A;  4GN4 B;  2IY5 B;  3GDE A;  3U4Z A;  5C4J H;  1N8R C;  1N34 Q;  1Y1W G;  2K4K A;  3PIO A;  2N3S A;  2JA9 A;  4Y52 H;  1SMX A;  4IPG A;  2ZTD A;  4YCU A;  4LF5 Q;  2MFI A;  1KL9 A;  2NZH A;  3J80 i;  5C0X G;  1A62 A;  3CME A;  2R92 G;  2NN6 I;  3F2B A;  1HZC A;  1NTG A;  3STB C;  4HJ5 A;  1QUQ A;  1I6H H;  3F2C A;  2QGQ A;  3K8A A;  2ZTE A;  2UU9 L;  3GD7 A;  1HZB A;  1I3Q H;  2GN5 A;  1K0R A;  4ALP A;  4RMF A;  4OO1 G;  5FLM G;  3L7Z C;  1P16 A;  5GAD C;  1HNZ L;  3M4O H;  1NMG A;  1QVF A;  1WCM G;  1YZ6 A;  4FDB A;  1B8A A;  3M4P A;  4BY7 G;  2CKZ B;  1OXT A;  4GLA C;  5C3E G;  4P74 A;  2WFW A;  1RL2 A;  1PA6 A;  2ZTC A;  1VQ6 A;  3AFQ A;  4KI0 A;  5IY0 A;  1MJE A;  3KF6 B;  4OWX B;  2B29 A;  1PH4 A;  3OYY A;  1E22 A;  3FP9 A;  1JE5 A;  1N36 L;  1BVS A;  3PO3 H;  1XMQ Q;  4JI0 Q;  2Z6K A;  3TS0 A;  4BXX H;  1V9P A;  4X62 Q;  4JI3 Q;  1EQQ A;  1E7Z A;  1YBY A;  1G29 1;  4LF6 L;  1HR0 L;  3RZO H;  2VQF Q;  4OX9 L;  3NEM A;  5IP7 G;  3MXN B;  1KHI A;  3I4M H;  3CCQ A;  4LF8 Q;  4LNQ A;  4X66 L;  1JJG A;  3S16 H;  2ID0 A;  2EQS A;  4DK3 C;  1OTC A;  2K5V A;  3L0O A;  1B7Y B;  3K80 C;  3CCL A;  3EIV A;  5M3M H;  5H1S E;  4XTC S;  1PH1 A;  2E5L L;  1EFW A;  1YIT A;  2F52 A;  4DV6 Q;  3NEL A;  4QY7 A;  2HQL A;  4JBK A;  3H3V H;  5FLM H;  1VQ8 A;  3J80 c;  4GOP B;  4DV5 L;  4YY3 Q;  3I56 A;  1WCM H;  1N9W A;  3I55 A;  4DR4 L;  1JJC B;  2IX0 A;  5C3E H;  4A3G G;  3HOU G;  3H3V I;  4LFC L;  1XNR L;  4OO1 I;  3ERS X;  3KLW A;  3JAM i;  3CMA A;  3PCO B;  1L2F A;  3OTO Q;  1EIF A;  4A3I G;  1IBK Q;  2JA7 H;  2UXB L;  2Q2H A;  1D8L A;  4A3J H;  4BBS G;  1WFQ A;  1D7Q A;  1YNX A;  4GLV B;  4LFB L;  4LF7 Q;  1IXR A;  5BR8 L;  3S2H H;  1V1Q A;  4Y7N H;  3E0E A;  4MTN A;  5M5Y H;  3HOX G;  2BA1 A;  4B3R L;  2GVB A;  2R93 H;  1PVO A;  1M90 C;  2UUB L;  2UXD L;  1N33 L;  3CCR A;  2HIX A;  5J3B A;  4DR6 Q;  2AMC B;  2KHI A;  5IYC H;  3CCE A;  1SRO A;  2A8V A;  3GTG H;  3A5U A;  2PQA A;  4BY1 G;  2KHJ A;  2JA8 G;  3CC4 A;  2ATW A;  2D62 A;  1TWA H;  3NEN A;  4LUO A;  2Z0S A;  3HOV G;  4A3D G;  2Z6K C;  1SE8 A;  4BBR G;  4GN5 A;  1NE3 A;  3KDF A;  4A75 A;  1VQH A;  2WB1 E;  3D0F A;  3M3Y H;  1N32 Q;  1B70 B;  2EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...