4A3KG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transcription
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3kG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3kG01
4UP9A 4LUZA 4JI3Q 1CSPA 2NVTH 1YHAA 1N36Q 4IFDI 1ASYA 3KDFB 4DR3Q 1JJCB 3CCUA 1Q12A 4POFA 3D31A 4YY3Q 1PH4A 3CPWA 4OONA 2HHHL 1N36L 1IBKQ 1FJGQ 3L0OA 1QVGA 4YCVA 3T1YQ 4FDBA 3KJPA 1K9MC 4B3SQ 1CKNB 3BJUA 4YWMA 5J3BA 1E22A 2Q2UA 1E1OA 3ULLA 1HNZL 4B3ML 1HNXQ 2RF4A 2HHHQ 2R7FA 2MNAA 3CF5A 4OO1I 1KD1C 4A3MG 3T1YL 2HIVA 2K5HA 4DR6Q 2AWNA 1MJEA 3GTGH 2OCEA 4OWWB 3RZDH 1IBLL 4DPGA 3AYHB 4AYBG 4UPAA 4GOPB 2JQOA 2Z6KC 2DUDA 2K5NA 3UE0A 3PUVA 3I4MH 4DR6L 4DV5Q 3HKSA 1XMQQ 4DR2L 2UUCQ 4LFAL 4GKJL 4A3IG 4GLXA 1FVIA 3J81c 1Q46A 1SR3A 2JE6I 1RIPA 2ID0A 4O2DA 4JI8L 4GNXC 4JI0L 3I4NG 2NN6I 1LM0A 2JA8G 1D7QA 1KQSA 1I94Q 3F2CA 4A3IH 2E2JH 2N8NA 1G6PA 3BZCA 3RN5A 4A3DG 3I56A 1YI2A 4JI8Q 4BBSG 2IX0A 1SE8A 2JEBI 1CSQA 1M1KC 2HQLA 5C4XH 4AQYQ 1Q7YC 4QQBX 4P73A 4DUZL 1NE3A 2Z6KA 1Q86C 4IPCA 4DV6L 2LSSA 3KOJA 5IP7G 4JI6Q 2XTIA 2ZTCA 4KHPQ 1QZGA 3CCQA 3HOVG 3EIVA 3F2DA 5M3FG 3G6EA 4WJ4A 3HKZG 1WCMG 5C44G 2NZHA 2MO1A 3D0FA 1N8RC 4JI2L 1PFSA 1YIJA 2MFIA 3HOWG 1VQJA 1BVSA 3NELA 4KHPL 2D62A 1WCMH 4JOIC 4DK3C 1S3OA 3ZJYC 3PUYA 3UDXA 3U4ZA 4DV2L 2PQAA 1Q8KA 1VQFA 2E2HH 1YBYA 4JG2A 2VUMG 1OTCA 1IBML 1XJVA 1HNWQ 4JI3L 4K0KL 2VUMH 1QUQB 3FKIH 4XTCS 2E5LQ 4C3HH 1U5KA 3DM3A 1VQBA 3CD6A 4KI0A 4X66L 3FHWA 3E0EA 2RHQB 4X62L 4X65Q 1HJPA 2Q2IA 2UU9L 3CC4A 1D8LA 5IYCG 3HOUH 1X3EA 2PNHA 4GLVB 5IWAQ 1HR0Q 1XNRQ 4RMFA 4B3MQ 4BXXH 3FP9A 4QIWE 4B3RQ 5IYCH 4MNOA 2JA6H 4LNQA 5M3MG 1HZBA 2YTVA 3UDIA 1SROA 1TWFH 4MZ9A 2K4KA 2ALYB 2KENA 5IYBG 2UXDQ 5BR8Q 2ZTEA 2WAQG 2CWPA 1XNRL 4A3MH 4IPGA 5IE8A 3S1NH 4A3KG 5IYBH 1Y1WH 4BY7H 4EQ5A 2UXDL 5FJ8H 4NXML 4GOPC 2F4VQ 2UXBL 2NN6G 2AKWB 1U0LA 3OYYA 4LFAQ 4NXNL 1Y1WG 1N9WA 2AHOB 5C0XI 4JI7Q 2QGQA 4IJLA 1CKNA 3PUXA 3W1BA 4JYAQ 3J7ZC 4DR7Q 3TQYA 1PYSB 2A8VA 4R4OA 3S17H 5GAGC 3UDGA 2GVBA 2PMZE 1AE3A 2ES2A 3S2DH 2KBNA 1JB7A 1IYJB 1X9NA 1E3PA 1HZCA 3KF8B 5GADC 4A75A 1XMOL 4DR7L 1EQRA 4JV5Q 1V43A 2N78A 3M4QA 4DUZQ 2PQAB 3A0JA 5GQOA 3H3VI 4JV5L 1VQIA 3U50C 1EYGA 2GN5A 1PH8A 4RG1A 1KL9A 3PGZA 4DR3L 3I4NH 1JJGA 1X6OA 3TEHB 5LMNL 3H0GG 3OTOL 4HIOA 3F8TA 2BH2A 1K0RA 3T1HL 5HY6A 2F3IA 4Y52H 4DR4L 4HJAA 4DR1L 2B3GA 1YHQA 2R7ZH 4BBSH 4GNXB 2H5XA 5LMNQ 1HNZQ 3HOZH 1IBMQ 4LF7L 2R7ZG 4C3JH 5IP7H 1KRTA 2UUAQ 2OWOA 1VQ8A 4A3JG 1YJNA 2XGTA 4QY7A 4HJ8A 1VQ5A 1IBLQ 4J15A 3SGIA 5IY0A 3G71A 4NB3A 4QGUA 1VQLA 4LF7Q 1PHJA 3S1QH 3NBHB 2MQHA 1VQ4A 2I0QA 3PIPA 5C4JH 3PO3G 1V1QA 4YWKA 2GVAA 4A93H 5C0XJ 4DV5L 1XMQL 3HOXG 4IO9A 1N34L 2Q2TA 3K7UC 2ZJPA 3ERSX 3PIOA 1EIYB 3GTOH 4A93G 2A1AA 5K36G 4JI1L 4JI0Q 2CQOA 4O0AA 3RLNA 3A5ZB 1BBWA 4GLAC 5FLMG 4YHHQ 2WFWA 3TREA 5JJIA 2JA9A 2PI2E 1VQCA 3FKIG 4DAMA 4DV1L 1Q81C 4GN5A 4IFDG 5JJKA 2OTLA 1P8LA 3IRBA 5M5WH 3PO2G 1E1TA 3ULJA 4YHHL 2AWOA 1Q1BA 1VQOA 1TWAH 2ZJQA 4DV6Q 4A3KH 4PG3A 1BBUA 3I55A 2UXBQ 3W5OA 2QA4A 1O7IA 3JAMi 4OX9L 4A3LH 3K8AA 3KF6B 4PZ7A 1Q82C 1YVCA 2QEXA 4LFCQ 3NEMA 4A3LG 3M4OH 4L5QA 1KRSA 5GROA 1L1OC 3CCEA 4YCUA 2OQ0A 1VQAA 1SMXA 3WWVA 1GM5A 1QVCA 3M9BA 4LUVA 3KFUA 4LW1A 1HNWL 1YJWA 3H3VH 1L1OA 4DAYB 1S40A 3KLWA 1VQ9A 4K0KQ 1I5FA 5JJLA 4JBWA 4R4IA 5IYDG 4IOAA 1TWCH 1LTLA 1C7YA 1FGUA 2YV5A 2E5LL 1X3GA 3E9IA 2UUBQ 1NMGA 1PV4A 4X66Q 3UE1A 2JA7H 4X62Q 3RLOA 2ATWA 2WB1E 1Z9FA 5AJ3L 3I4MG 4EX5A 3M7NA 1HR0W 2D0PA 3PUWA 4DR4Q 1T9HA 2WP8J 3GTJH 5EAYA 1PVOA 3CCVA 3S15H 4HJ9A 4DV4L 1LUZA 3CXCA 4B3RL 3F1ZA 4LF6L 4L5SA 4YY3L 2IT1A 2I5HA 3CP0A 1V9PA 3AQQA 2UUAL 3HOZG 4HIDA 4LF4L 1Z47A 3J81i 1N32L 1VQ6A 4UP8A 1I50H 2Q2HA 4DV7L 1X3FA 1KC8C 4GS3A 4AIMA 1KIXA 4JI4L 3J7A5 3TRZA 1UE7A 1K3RA 4DR5Q 1SFOH 1VQ7A 1XPOA 1HZ9A 2C35B 3KDFA 2KHJA 4IOCA 4JI5L 1G291 3S16H 2JA5H 4NXMQ 3PO3H 2RCNA 3Q8DA 4XIGS 1HZAA 5DLQE 4DV7Q 4NXNQ 4JI7L 1Y14B 3LGJA 2I5MX 4DR5L 5ELNA 1XPRA 4JYAL 3ULPA 1UEBA 2E8GA 4KHZA 1B7YB 1LYLA 4DK6C 1XTDA 1GD7A 1X56A 1EQQA 2K75A 4YCWA 4DR2Q 1PH2A 1BKBA 1SRUA 1TWGH 3W1GA 3CC2A 4BBRH 1IBKL 1FJGL 3F2BA 1OXTA 4QL5A 1VQGA 2UXCL 1YJ9A 1I94L 3H15A 4X6AH 4BBRG 4HJ5A 4KLKA 3CQZH 4LF9L 1WJJA 2IX1A 4IPDA 5LMUL 1JE5A 1VQNA 1L1OB 2VQEQ 4OO1G 2N3SA 4WJ3M 5H1SE 1EIFA 2LXKA 3CCLA 1IZ6A 2L15A 1EOVA 4LFCL 3BZKA 5HGQA 4A76A 4A3EG 3M3YH 4GOPA 3RN2A 5LMUQ 4P71A 4DKAC 4DR1Q 2VQEL 5C3EG 4AH6A 2OQKA 1K8AC 2UUCL 4BXXG 4A3EH 4GKJQ 1R9TH 1PH3A 1WYDA 3DLLA 1PH6A 1QVFA 5M3MH 3GTKH 4BA2I 1Y1VG 5C3EH 4X64Q 4B3TL 2HT1A 4A3CG 1NBWA 2BA1A 3S24A 2ZM6L 1Y1VH 5C0XG 2EIFA 4H02A 4P72A 3OW2A 4A3GG 2YTYA 2N49A 3KF6A 5AJ3Q 3I7FA 3L2PA 2D0OA 5FJ8G 2VQFQ 1PH7A 3A5UA 1PH5A 1OXUA 4JI6L 2B29A 2WAQE 1EFWA 4GNXA 1YITA 1A62A 2YTXA 3CAMA 3ER0A 1YEZA 4GN4B 4DV4Q 4ALPA 1I6HH 1RL2A 2V1CC 3S1RH 4JI2Q 2CCZA 3GO5A 1YHBA 1CKMA 1VQHA 1CKOA 2R6GA 4TQUS 3CCRA 1QZHA 1PH9A 3HOYH 4JBMA 2E2IH 1A0IA 3GTLH 1VQEA 1N32Q 1HR0L 1UE6A 3RZOH 1IL2A 2CFMA 3S2HH 4HIMA 4JBJA 2JA7G 4DUYL 4JI4Q 1XNQL 4LFBL 1J5EQ 4A3CH 2JA8H 2R92G 4OWXB 1KXLA 4HIKA 1X65A 3U4VA 1VS0A 3G48A 4A3DH 5JEAG 2KHIA 2JJQA 2VL6A 2CWAA 3H0GH 2LXJA 4JCVE 4R1JA 1J5EL 4L5TA 4A4IA 4BY1G 3J80c 1SLJA 1L0WA 2VW9A 2UU9Q 1S72A 1EWIA 2Y0SE 4OWTB 4R4CA 3HOVH 2ASBA 4P75A 2EXDA 3I2ZA 3M4PA 5IWAL 3PF5A 2UXCQ 1OXVA 4QJFA 1OXSC 1SN8A 4C2MH 4A3FH 3U58A 5M5YH 1E24A 2JA5G 2WB1G 4LF5Q 1VQKA 2I5LX 4IFDJ 5JEAJ 4A3FG 4B3SL 3TS2A 1GVPA 2VS1A 1XMOQ 2AMCB 1N33Q 1AE2A 1K73C 3S14H 1KHIA 5ELOA 2K5VA 4GN3B 1K83H 1K8GA 3GDEA 1HNXL 2BA0A 3HOXH 1OXXK 1YZ6A 3CCJA 1DGSA 4LUOA 2B63G 1WFQA 4TVAB 4JC0A 2F4VL 4R4QA 3JC66 2NZOA 1JJ2A 1C9OA 3A74A 3I4OA 2NVYH 3OTOQ 4P74A 1M90C 2B63H 2R93H 3CW2C 1PA6A 1I3QH 4DNIA 4X64L 4LF4Q 2KCMA 2A19A 4Y7NH 2ZJRA 4AYBE 5LMNW 3PO2H 1L2FA 3HFZB 3STBC 1W3SA 5FLXc 3TS0A 1NY4A 2F52A 4JBKA 1TXYA 1CUKA 1W2BA 2VQFL 1Q1EA 2JA6G 4JI5Q 3PF4A 4DV3L 5GAHC 3CMEA 4AQYL 3EN2A 2FXQA 5E7NA 1J6QA 4DV0L 3BU2A 3PV0A 3RLFA 4BY7G 1E7ZA 3J80i 1B8AA 3ICEA 3T1HQ 3KJOA 2YU9H 3KYHC 3RNUA 1MKHA 1TWHH 1HH2P 5M5XH 3K80C 4A3GH 4LWCA 1XPUA 4LFBQ 1H95A 4NPSA 3GTMH 4IJHA 1UE5A 2BH8A 4C3IH 3STBD 2R7DA 4PZ6A 4LF9Q 1AH9A 2R92H 3MEFA 1UE1A 4DV2Q 1YNXA 3CPFA 2VZAA 4OXPA 4LF6Q 5IYDH 1KAWA 1PH1A 3CC7A 3J81j 1UWVA 4PMWA 3HOYG 3CMAA 2NVQH 1JT8A 3AEVA 2K14A 4MTNA 4UY8C 3AFPA 1EUJA 3UDFA 4OX9Q 1N34Q 1QUQA 3B6YA 4GKKL 1MIUA 2IHEA 5IP9H 1X54A 2IY5B 4JOIA 4JI1Q 4X65L 4UP7A 1B70B 2OTJA 4B3TQ 4YWLA 4HJ7A 4LF5L 5IP9G 3RR5A 3NENA 3GTQH 1WOCA 1IXRA 4DV1Q 2CKZB 2HIXA 3MXNB 2ZM6Q 3JAMc 1N33L 3HKZE 5C44H 2VY3A 3HOWH 4BY1H 1A63A 2KCTA 3K0XA 1MJCA 1VCIA 2VNUD 3PSIA 2K52A 3K81C 2ZTDA 3GTPH 4A3BG 1P16A 1FL0A 2PI2A 2Y0SG 5BR8L 1JMCA 2JK8A 5GAEC 4ME3A 3AFQA 4A3JH 1NJIC 1VQMA 2YYZA 5C4XG 1GKHA 1NTGA 4APVA 1G51A 4LF8Q 4A3BH 2JEAI 1GO3E 5IT9c 3CCMA 2RHSB 5M3FH 2R93G 3L7ZC 3G4SA 1C0AA 4PZ8A 2K50A 1X55A 2DGYA 3S1MH 2EQSA 4R4TA 3K7AH 1A8VA 4LF8L 1ASZA 3M85A 4DUYQ 3GD7A 1PYBA 3PUZA 2NVXH 1XNQQ 4BA1I 3E9HA 3PCOB 5FLMH 3VDYA 4POGA 1NMFA 2Z0SA 2IHFA 3HOUG 3CCSA 2MO0A 4DV3Q 2UUBL 1VQPA 4GKKQ 1VQDA 4L5RC 4IPHA 3EBEA 4DV0Q 1WI5A
chains in the Genus database with same CATH superfamily
4EGJA 1EYDA 3VYTA 2NVTH 1YHAA 2FK3A 4UAIA 1Q12A 3MVVA 3FEWX 3NQIA 4HMIA 1N36L 4O3QA 1RJPA 2WTFA 1IBKQ 1FJGQ 3GIPA 1QVGA 1K9MC 1CKNB 3Q0AA 2XIWA 4YWMA 2QDLA 2PW7A 4FXKC 1HNXH 3ULLA 3A8IE 3NWSA 4K8IA 5LMUH 4LAAA 4H7BA 3AU7A 4MV6A 4B3SH 5DM63 1M0TA 3RBEA 4DR6Q 3KHLA 4O3NA 2AQ1B 3AYHB 4UPAA 4ODGA 2JQOA 2Z6KC 2DUDA 2O5IC 2AUKA 2W8LA 2NN6H 4GKKH 3PUVA 2F0HA 1T94A 1U4RA 4LFAL 1FNUA 4GLXA 1FVIA 3J81c 1HXYD 1Q46A 1SR3A 1WTXA 1QJOA 1WTHA 1J5EH 1ZKOA 2PCFB 4A3IH 1DD2A 1STHA 2E2JH 1TWGA 2EY1A 3BZCA 1JWSD 1Y8NB 3RN5A 4E4TA 4BY1B 4JI8Q 1JB3A 4ECUA 1Q7YC 4QQBX 1XNQH 4RGMA 1NE3A 2Z6KA 3QO2A 2XSCA 3BDCA 2OT2A 2HHHH 2BDOA 3IFDA 5M5WB 3WO0A 1HNZH 2NZHA 1PZID 3I91A 4X3UA 1N8RC 4QB4A 3HOWG 5I47A 4K6DA 1VQJA 1BNZA 4HAEA 2PW5A 1XTCD 3SK6A 4MTDA 3UDXA 3U4ZA 5LOVF 2PQAA 1Q8KA 2VA2A 1YBYA 4JG2A 2JXMB 1OTCA 1I4XA 4DR5H 4RNNA 2NUAB 4C3HG 1CZGA 5KG2A 3GV7B 1YNNC 1RJRA 1QUQB 4V0BA 2E5LQ 4YR3A 4EG0A 3J7AK 4A3GB 4JUZA 1RTNA 2H1EA 3UFXB 3NP8A 3GTKB 1HA6A 1PRTD 3N40P 4O2BF 5A2QL 2UU9L 3CC4A 2K6AA 1DYQA 2W9CB 1X3EA 4QWBA 1VF5C 3H20A 3TIIA 2Z6BA 1XNRQ 4Q0YA 1LTTD 2M9VA 1LLRD 5IYCH 4MNOA 3DM1A 3SK5A 5KG1A 4DV4H 1K83A 3G6JB 4FP5D 2KENA 2ALYB 2NWGA 4H44C 2WAQG 4PV1C 4QUCA 5IE8A 3S1NH 2R8GA 5BN3A 5M9OA 1XWEA 5CC4A 5KFLA 3RFCA 2K04A 4KY6A 5IGGA 1JOOA 3E5SA 2UXDL 2HVQA 3V4SA 4NXML 1ENCA 3FMCA 1PVOA 5IYDH 3CHBD 1Y1WG 4R8NA 4UDUC 2AHOB 2RDHA 2RQXA 2QGQA 2FMCA 2KEDA 3EYYA 1KJ8A 2A6EC 1S5CD 3TQYA 4C1NI 4I65A 2R82A 2VB3X 2A8VA 5LP6F 1UAPA 3DXJC 3J80E 3VPCA 2GVBA 2Z4IA 1S5DD 1GGOA 5F9NA 1IYJB 1SYGA 2WB1B 5EPKA 1HZCA 3MTSA 2JA5B 3S14B 5GADC 4A75A 1JR0D 1Y1VA 1EQRA 4O2AF 1V43A 3SK8A 4DUZQ 5FLXL 2PQAB 1CA6A 1DZ1A 3GLKA 5KT4A 3H94A 1TS2A 1JOQA 5LYJF 2F3VA 4R8UA 2B2UC 3VPDA 4HR7A 1KL9A 3PGZA 2DNCA 2NVTB 4DR3L 1Z6HA 3ORRA 1WTQA 1CFMA 2OEOA 4ZK9B 1JJGA 3GILA 5DAUA 1RDPD 5HGTA 3H0GG 3OTOL 3F8TA 5CORA 3VR6A 1TWFB 3WOEA 5HY6A 5DLGA 2XRQD 2FLPA 4GNXB 1F9QA 2H5XA 4I4TF 5GONF 3N43B 1CQJB 2GPSA 1JE4A 1FD7D 2R7ZG 2VQDA 5IP7H 1N48A 1KRTA 2UUAQ 2OWOA 4QUFA 2LFNA 1EU4A 5I9OA 1VQ5A 4NB3A 2C22A 2MQHA 1VQ4A 2KVMA 2R8HA 2X69A 2KCCA 1V1QA 4K2LA 2F03A 5EWEA 4ED8A 1U4LA 2VA3A 3PIOA 4F4WA 4R8UB 5CBEE 1AEXA 3A5ZB 4GLAC 2L4NA 4YR2A 5C44B 3C3LA 1TS5A 1II3A 1CS0A 1PYWD 3OUUA 4IURA 2AWOA 5EPJA 1TWAH 2NBFA 5FD6A 5FOBB 2NU9B 2EYLA 1PTOC 5C4HA 5EPLA 4A3LH 4ME5A 4HNVA 1F9RA 1Y8OB 4Q45A 3EPIA 2QEXA 1BXTA 3NEMA 5FKAC 4L5QA 3RB3A 2D2CC 3L4JA 4ED7A 1QOHA 2OQ0A 2QYZA 2YCHA 1SMXA 4R9WA 2CVRA 1PDQA 2Q8IB 1I4QA 2ZM6H 1TQOA 1HNWL 4DFAA 3CQZB 1L1OA 5M5XB 4K0KQ 1I5FA 5IYDG 2YU9B 1FGUA 2YV5A 1X3GA 2W7PA 1VMCA 3A55A 2GPWA 4C3JB 2B2VC 2DN8A 3RLOA 2WB1E 1Z9FA 5AJ3L 4FXGC 4EX5A 3JRXA 3KBXA 4UCRA 3RTXA 2UVWA 4DR4Q 1T9HA 5DQIA 1SYFA 2R7ZB 4U68A 4ECVA 1LT3D 5JJZA 2KEEA 4B3RL 3MWYW 3BQ1A 2O4XA 4L5SA 2I5HA 4XDXA 3EROA 1K28A 1Z47A 2RGVA 1VQ6A 1R4PB 1I50H 2EE1A 3J7A5 3QIAA 5LXTF 4GS3A 4IWXA 1PFMA 2EY6A 4I7ZC 4DR5Q 1SFOH 1QB5D 3N8DA 2C35B 5IGDA 4IOCA 1NAPA 3PO3H 1HZAA 1TS3A 4DV7Q 5IOCA 4JI7L 1MD2D 2K05A 3FPUB 3RAXA 5ELNA 1E4GT 1H9RA 1LYLA 3NUCA 1XTDA 5CMDA 1PH2A 2K75A 4NXNH 1TWGH 4PQXA 2BCOA 4BBRH 2X6LA 1HTLD 4JI4H 2R7KA 1SMYC 1VQGA 2UXCL 1Y1WB 4X6AH 4LF9L 4KLKA 2F0NA 1WVLA 2RDJA 1VQNA 3T5KA 3BQ2A 5DQGA 1L1OB 4DR1H 3ONAB 4M8AA 2MUYA 5L1KA 4A76A 2K03A 4LFCL 2W6PA 4ABNA 1LT4D 4Y8VB 5LMUQ 4DR1Q 2YW2A 2UUCL 3G7LA 1EY7A 5C6AA 1PH3A 1WYDA 5M3MH 1WTRA 4X66H 5KYLA 4JI0H 5KRUA 4JPBW 5C3EH 1A6XA 4B3TL 3WNZA 1U4PA 2Q8TA 2FFKB 3BABA 4B9XA 4K8JA 1QCBD 2E75C 2EIFA 3OW2A 1FR3A 4YAKB 1EU3A 2L0CA 2F0JA 3ND8A 3KF6A 2A6HC 1PH7A 2XCPA 3GV5B 4JI6L 4U673 1RYRA 3FDTA 4F4ZA 1YITA 2XIGA 4IRCA 2YTXA 3ER0A 5KT3A 1B44D 5KKNB 1YHBA 1M6VA 1H9SB 1QZHA 2XNAC 1ML0D 2JEFA 1YNJD 1N32H 2VUGA 5JOBA 1EY6A 4F4XA 1UE6A 4LF6H 3RZOH 1KJQA 1IKMA 3T51B 4LFBL 2YZGA 3QR8A 4EBDA 1LTSD 4OWXB 1KXLA 2PMZA 2EY2A 3PN1A 4A3DH 2IJ0A 2JJQA 2VL6A 1EQVA 4DN4M 1EY4A 2LXJA 4DL4A 3J80c 2R85A 4HCEA 1SLJA 4DR2H 3QFFA 1EWIA 4MTKA 2VQFH 2EY5A 4XYQA 2ASBA 5L37A 1ENFA 3HEJA 3I2ZA 4ME6A 2DLNA 3K0YA 1OXSC 1DOLA 3U58A 5JEAJ 2B63B 4EBCA 5IIFA 3TS2A 1GVPA 3R2IA 3S14H 4ZQIA 3RB4A 1K8GA 2CW0C 3GDEA 3HOXB 4CDCC 2Y0SB 4LUOA 4DV1H 4TVAB 3PO3B 4YHHH 4PNYA 1ESFA 1C9OA 1EWHA 3I4OA 1F9SA 2XGPA 3RAQA 2B63H 1O80A 1EY9A 3CW2C 1PA6A 3QZ7A 1XYIA 4X64L 1GUNA 5JQWA 4Y7NH 2ZJRA 2P0AA 1K8MA 4OGQC 5NUCA 5KT7A 4Z9CB 5EBDA 5FLXE 4JI5Q 1B3AA 5L1LA 1STAA 4FM9A 4DV3L 5I9PA 1RKNA 4CGYB 3UQ8A 5EKIA 2EDGA 2JA7B 5K2MA 1B8AA 1STYA 3T1HQ 4X64H 3KYHC 2B39A 1MKHA 2JSOA 5M5XH 1HH2P 3V96A 4LWCA 2AGPA 4KHVA 1XNRH 4C56C 3N6XA 1HCZA 4PZ6A 4UCVA 5BPHA 3D6WA 3E3XA 3MR3A 4JV5H 3CC7A 3SR1A 5IGEA 5KFZA 1JT8A 2NVQH 3R23A 4MTNA 1AP0A 3UDFA 2R3ZA 4OX9Q 3B6YA 3QJYA 2XCLA 4DL6A 1XMOH 1Y1VB 1X54A 2NYZD 5DGBA 4XQQA 2OTJA 1PTOH 3QOLA 5L1IA 2F0QA 2RSNA 5C3EB 5KFTA 5IP9G 3GTQH 1MHWC 1WOCA 5M3MB 3KLRA 1SEIA 5C44H 1AUVA 1I6UA 4BY1H 2KCTA 2UXBH 4LJZC 2E2DC 3K0XA 1DONA 3PW7A 2K52A 5BMVF 4A3IB 4YP3A 1FL0A 4G3IA 3R5XA 3R5FA 2YYZA 1GKHA 2HDLA 5T1GA 4C3IB 1G51A 1I7NA 3T4AC 1GSAA 2JEAI 4XX0B 5IT9c 3CCMA 5M3FH 2R93G 3G4SA 2AQ4A 1GSHA 4PZ8A 3MR2A 2HGSA 2DGYA 2IMWP 3HBLA 3K3VA 1EFID 2F0OA 3K7AH 4CKCA 5KEEA 3NPPA 3TP7A 5A35A 4LF8L 5ISRA 4WBNF 5KYIA 3SE0A 3M85A 3GD7A 4DUYQ 1CI3M 5K36H 2XWJB 2R84A 3E9HA 3DEPA 5FLMH 4N9TA 4POGA 1NMFA 3DMUA 3FDSA 2ASDA 1MSHA 2KQ3A 2HVSA 2SEBD 4FF2A 4B08A 1V51A 2UUBL 4GKKQ 1VQPA 4X62H 2VPQA 3OOCA 1U4MA 3I70A 4HSVA 5L1JA 4YBZB 4UP9A 1O78A 2QDBA 4IFDI 1N36Q 3N44B 1B50A 1QE6A 4DR3Q 2EJMA 3H4DA 2PBZA 1B2TA 3OUZA 5I6WA 4DV7H 1XXGA 1PH4A 3N52A 3CPWA 5KG3A 4OONA 1EIHA 4LFCH 2HQEA 1RD9D 3BJUA 1E22A 1W6KA 4HQ6A 3MFYA 4IALA 1HUMA 2HHHQ 2R7FA 2IX3A 1KD1C 1AN7A 5DG7A 1MGSA 3VPBA 2HIVA 2AWNA 2OCEA 3RZDH 4LH7A 4DPGA 2NB0A 3OIPA 3GTKA 2HCCA 4GOPB 2W57A 3K58A 2K5NA 3S1NB 4JI8H 3J81E 5CV5A 3HKSA 3RD4A 1SDFA 2FB9A 4A3IG 1J9OA 3GIKA 4A3BB 4JI8L 1RIPA 4GNXC 3NBHA 1A3TA 1I94Q 3FRPB 3F2CA 2DPIA 2N8NA 3RGZA 2VQEH 4K2KA 3GTPA 3P1HA 3I56A 3I90A 1MZBA 4BBSG 5KFAA 1SE8A 4NW2A 1YNND 5C4XH 1IBLH 4AQYQ 4DUYH 2F0IA 1I3QA 4P73A 4DUZL 1Q86C 1H9MA 4IPCA 1QZGA 3CCQA 3VR4A 3F2DA 4RNOA 5KFUA 2F4IA 3G6EA 4WJ4A 3T5JA 1WCMG 4H13C 5C44G 2FKLA 3D4WA 1PFSA 2MFIA 4B9WA 4AYBB 1DOMA 1BVSA 4KHPL 2D62A 1I6HB 4JOIC 3J7AV 1G8ZD 3ZJYC 5K5PA 2FLLA 2F0GA 4O3SA 4DV2L 4JI1H 4YQWA 3J81L 1BNCA 4DNTB 1HNWQ 1M7JA 4FU0A 2OH2A 1STNA 4IUQA 4K0KL 1JKJB 4XTCS 1JXLA 1HNWH 4X65H 4C3HH 3DM3A 2LS01 3VA7A 3CD6A 2EOTA 1DCZA 4ECWA 2Q2IA 1Y1WA 4MIUA 4DK1A 5IYCG 3HOUH 5ELBA 4GLVB 4MA5A 2E2HA 5IWAQ 1HR0Q 4Q8FA 1BCPB 1I4HA 4B3RQ 1EUDB 1NNXA 3TP8A 2YTVA 3UDIA 5CAEB 4ZQ3A 4ZRZA 1TWFH 4TV8F 2K4KA 5LL6S 3K57A 2UXDQ 4AYBA 5BR8Q 4A3MH 1RCVD 3I4MB 2ATLA 3G6VA 5IYBH 5BR8H 2BDNA 1I3QB 4GOPC 2F4VQ 1BXRA 2NN6G 1U0LA 3SI8A 4JI7Q 1VDZA 1CKNA 1JIHA 5ELDA 3J7ZC 2YZNA 5IODA 3TSSA 1PYSB 3AMUA 4R4OA 3TZUA 3UDGA 1AE3A 2ES2A 2KBNA 2CH4A 4XQJA 1X9NA 1E3PA 4O4HF 3P7JA 4CDEC 5EZYF 5I2YA 4DR7L 2SDFA 5KG6A 3Q8PB 4EQNA 2Z1CA 2BQ3A 3M4QA 4JV5L 3A0JA 2R6FA 4I7AA 4J9NA 3BS1A 1TT2A 2GN5A 1CQFA 4HN7A 4RG1A 3KUPA 2Y0SA 4I7HA 3I4NH 5KT2A 4RAYA 4O1NA 1K0RA 4RB0A 4DR4L 3DWQA 4DR1L 2B3GA 1WTVA 4N9PA 3H0GB 5LMNQ 4ZAIA 3K5LA 4CDFC 3MXNA 1VQ8A 1ZYRD 4QY7A 3BJYA 4HJ8A 5KG0A 1IBLQ 3SGIA 5IY0A 2C28A 3I8ZA 1PHJA 3NBHB 1ZXTA 2ICIA 4TUYF 3Q8QB 5C4JH 1Q90A 3PO3G 1GSOA 2GVAA 1KTKA 4IO9A 3ERSX 1EIYB 3M4OB 3V6HA 2A1AA 5CBAE 4JI1L 5K36G 3I12A 3Q8RB 4O0AA 1BBWA 4DV2H 5FLMG 2RBMA 1EZ6A 4RB2C 1IW7D 3W3AA 2PI2E 1VQCA 3FKIG 4DV1L 1Q81C 4GN5A 3KLSA 2QK4A 4IFDG 2KOLA 3HRZC 5JJKA 1KJJA 3ULJA 3LWUA 4DV6Q 4A3KH 1K1SA 1E0BA 4H0LC 4C5CA 2R92A 2UXBQ 3K8AA 1S4ZA 1V1OA 4RZQA 2B2TC 4PZ7A 4RNMA 2AQ2B 3H6MA 4KN4C 4LFCQ 2FJZA 3GTOB 2ZDHA 3H09A 3GTLA 4IUVA 5KFWA 4O4IF 4QWEA 1HFNA 1F2ZA 2QW7A 4RUAA 1TWHB 4R4IA 2FINB 3S15H 1C7YA 3X3MA 1PV4A 2J7ZA 1D5ZC 4X66Q 1SE2A 4X62Q 2ATWA 1DJRD 3NWTA 3I4MG 1AUXA 2A6HD 3M7GA 2YS7A 3U9TA 1RTOA 3GV6A 2L5TA 1I4RA 2KHSA 3HZXA 3NTIA 5KIXA 1CA5A 3GTJH 1JLLB 4U6PA 5EWGA 1EEFD 4O42A 3CXCA 4DA2A 1JWMD 3WO1A 1V9PA 2RDGA 4IUPA 4K14A 4HIDA 1K0SA 2G5DA 4TQSA 2G9DA 3RMHA 4KMUC 4DV7L 3A56A 1KC8C 1X3FA 4A3CG 5KFGA 4AIMA 2FMMA 3TRZA 5BPFA 1UE7A 1LTRD 1VQ7A 1IBKH 1FJGH 1HZ9A 4DXFA 3PMFA 2KHJA 4JI5L 1G291 3S16H 1STEA 2RCNA 4OIKA 5DLQE 3PIP3 4NXNQ 3LGJA 2I5MX 3QOJA 1BF4A 2WYOA 1XPRA 4C5AA 2E8GA 2JEGA 1B7YB 4DK6C 5KFRA 4ED2A 2B2WA 3TN2A 3PW2A 3F2BA 4QL5A 2K1BA 1L2ZA 5KFPA 3A54A 2YS6A 3C0FB 3X3NA 2XVSA 2Q8RE 4LF4H 3SEBA 4A3MB 2EYOA 1LT5D 5M3FB 3HOVB 1KJIA 3OMGA 5LMUL 3ZYYX 1CE8A 1BCPF 4OO1G 2RDFA 4Q43A 5KNDA 4QMGA 1EIFA 1S0OA 1IZ6A 4F88A 2IPKD 2K28A 3G8CA 4RA8A 5HGQA 4J9PA 1EY5A 1PMRA 5DNFA 3M3YH 4GOPA 2NU8B 4P71A 3M4YA 5C3EG 4BXXG 2OQKA 4GKJQ 5KG5A 4A3EH 1R9TH 3MXGA 4JW0A 3DLLA 4DLKA 3GTQB 4YIJA 4X64Q 5BN5A 4TKOB 3S2HB 2HT1A 4JI7H 4K5VA 3RUZA 3A8KE 4J8QA 5KFOA 4K0KH 1STBA 2BA1A 4QIWB 2E2IB 1Y1VH 1BQQT 1WTWA 4H02A 5EGTA 4A3GG 3GIQA 3L2PA 2EVBA 1PH5A 3T16A 2YRWA 5FJ8G 2FPGB 3KLSX 3A5UA 3MC0B 1SNCA 5G3LD 1JQYD 1D2BA 4IAJA 1A62A 3CAMA 4RUCA 3V6JA 4KHPH 3QZ8A 1JX4A 4PMCA 1I6HH 4JI2Q 4LF6Q 1B1ZA 5JH7F 3HS0C 4FXDA 2R87A 4I50F 1A0IA 1SSOA 1N32Q 1X3QA 2F0TA 3CKIB 3S1QB 3BA8A 1IL2A 3J80L 4JBJA 4CJ1B 2JA7G 4DUYL 2FLNA 4RGNA 5EKKA 5JEAH 1AZPA 5C4XB 2N88A 3OIQA 1VS0A 3UI2A 1LTID 1CHPD 1LABA 2KHIA 2I87A 1NSNS 3MAQA 1EOTA 3T13A 4BBSB 4A4IA 2SOBA 4EFBA 2XC9A 2JYOA 2VW9A 1ET9A 1JDEA 2RDIA 3TP6A 4OIJA 4CDDC 1EL0A 1PX2A 2EXDA 2A73B 4CKBA 4QJFA 1BR9A 4F7XA 4IQZA 4FVMA 3H3VC 4ED6A 5M5YH 4S3SA 3D4DA 4IFDJ 3GTQA 1SE4A 1IOWA 2AMCB 3TIGA 1E2VA 5DG8A 4MA0A 1N56A 4QIWA 1K83H 5EQ0A 5E3FA 5C3WA 2BA0A 2F0PA 4IZ8A 3HOXH 1JORA 4RB1A 1OXXK 1DGSA 2DJGC 3RIZA 1WFQA 4JC0A 4ZCKA 1JJ2A 5CGKA 3A74A 2R93H 3OTOQ 1JC7A 4DNIA 1EZ8A 2WV6D 3KF8A 3RB0A 4LF4Q 3PQIA 3JAML 5LMNW 4MTEA 3HFZB 3TS0A 3KTMA 5FLXc 1JDBB 2MCTA 1W2BA 2DY8A 2VQFL 2JA6G 5EDWA 1BCPC 5KFBA 2KUMA 4EGVA 5FPOA 5GAHC 1TWCA 1H9JA 3N42B 4CHTB 1LTGD 4AQYL 5E7NA 2XD4A 3OPOA 3BU2A 5JVLA 3JZIA 1V8QA 2OLSA 1SNQA 3RNUA 4M9UA 2K7VA 1XPUA 1H95A 4NPSA 2VUMB 1UE5A 2BH8A 3GIJA 2C5CA 1GHKA 4DR3H 1EY8A 4A3JB 2R92H 1U9RA 1UE1A 2A69C 4DV2Q 3CPFA 4OXPA 3SDZA 5A2QE 3TQTA 4AQYH 1UWVA 2HCIA 2QILA 5HBRB 3CMAA 1WCMB 2B2WC 3HKZB 2K14A 5IT9W 4UY8C 2JEIA 2KA7A 2FPIB 1N34Q 2Z4HA 1UNSA 4RZRA 1A3UA 4JOIA 2WB1A 4XZ3B 4UP7A 1B70B 4F4YA 4DU9A 3KHHA 2W9BB 3GTOA 2CKZB 5KGUA 2ZXRA 3HKZE 2VY3A 3HOWH 4ID6A 2I46A 1A9XA 3IKJA 2ZTDA 3RJ0A 1P16A 5BR8L 2PI2A 5C4XG 5DGAA 5GAEC 4ME3A 3AFQA 4A3JH 2R92B 1VQMA 5IT9E 4IR1A 4M7EA 2BE5C 1KAAA 3H0GA 4LF8Q 2IA6A 4IN3A 3LNNA 4Q8EA 1TVXA 5HV6A 4DV6H 1MI2A 2ENBA 1VKZA 2V59A 2VOBA 4XQNA 2JN4A 3OHXC 5IGFA 1XNQQ 1IOVA 1WH2A 4MV7A 4CC6A 1PXUA 4FBTA 3C1EA 1AZQA 2Z0SA 1SNMA 5DG9A 3MHBA 2J6TA 3CCSA 3GV3A 4IZOA 4L5RC 5KNBA 1KNEA 1KLUD 3OSNA 4G7OC 5KFQA 3S9WA 3CRLC 4RAUC 3NTKA 5KFYA 2JEJA 1CSPA 2OF1A 1WSCA 2IBKA 3L9AX 4Y7NB 1ASYA 5C8YF 1WD0A 4RGOS 2QEJC 1EEID 1O7LA 1JJCB 4CJ0B 3Q24A 3D31A 2VB2X 1B6SA 4YY3Q 2ZDGA 5JVDF 3T1YH 1T3NA 2XRSD 3V2TA 2PNRC 2HHHL 1C3OA 5D1PA 2NTTA 3HGBA 2D9UA 3L0OA 2J6UA 2FP4B 4FDBA 3KJPA 4B3SQ 2IL8A 2MJ8A 1GJXA 1M4VA 5E4WC 5J3BA 4B3RH 3LWEA 1E1OA 3A7LA 3IL8A 1QNUA 1HNXQ 2RF4A 2RA4A 4A3MG 3T1YL 5HURA 1TS4A 2K5HA 1MJEA 2W6MA 3GTGH 4OWWB 1IBLL 2BR0A 3HP3A 4AYBG 3M9MB 3U9OA 3UE0A 4DR2L 2UUCQ 4FYDA 1GUTA 4UFZA 4O2DA 3OWEB 2NN6I 1LM0A 1D7QA 4LMYA 1K1QA 1W6JA 1GXDC 3ETJA 5FO7B 5FLXW 4APMA 1SJED 2MPMA 3VMMA 5KFKA 2NUCA 4A3DB 1YI2A 3H91A 2IP4A 2JEBI 2HQLA 4RWSC 2JA7A 4JV5Q 4DV6L 2LSSA 3KOJA 4L8JA 5IP7G 4JI6Q 2W6OA 4TV9F 2ZTCA 4KHPQ 3RZOB 5M3FG 4LSXA 4YY3H 3HKZG 4UCUA 4RB3C 1B9NA 3D0FA 4QW9A 1YIJA 3NELA 4A2AA 1WCMH 1DOKA 2J4XA 4DK3C 3PUYA 1SYDA 4LMQD 4JI6H 1UNNC 4KY7A 2VUMG 1HPCA 2E5LH 3FPPA 4WORA 1D1IA 2W9CA 4JI3L 3MZ5A 1S9FA 2QKIC 5FPRA 1RK6A 2CHBD 1JCKB 2K33A 2HDMA 4X66L 2RHQB 3E0EA 3FHWA 4X62L 4X65Q 1HJPA 1S5BD 4GZYC 1UC8A 1GUOA 4OHJA 3HOZB 2PNHA 3W2DA 2KSWA 3BAAA 2IW3A 2GLTA 4MAMA 4MV9A 4KY5A 4B3MQ 2AQ3B 3FP9A 4QIWE 3M3YB 5C5JA 2JA6H 1Q8IA 4LNQA 4L6TB 5M3MG 1SROA 5KFCA 2O5JC 5IYBG 2DZDA 1A2UA 1EYZA 2ZTEA 3TQ1A 2CWPA 2CH4W 2WINB 3MWDA 5C1PA 4A3KG 3PO2B 3CVZA 4BY7H 4EQ5A 4YJ3F 4P2CB 4EEYA 1PFNA 2UXBL 1PTOD 4HMJA 4NXNL 5EKLA 5C0XI 1VAJA 4DR7Q 4DNRB 2SCUB 3IFTA 1N34H 1KC7A 3S2DH 1EZ1A 3KF8B 2RVLA 3HG9A 1XMOL 1HTPA 2FHTA 2F0UA 2N78A 5DM73 1VQIA 1CQIB 1E4EA 2JA6A 2WKDA 3KHRA 3TBIB 1EYGA 1KEEA 3EQLC 3E0JA 3VR3A 2YU9A 4LF7H 3NHHA 3URYA 3HB9A 5LMNL 4C2MA 3T1HL 3RUPA 3MXPA 2ZT9C 4KD4A 4EFEA 3MWMA 1YHQA 5I2XA 3O13A 5CA0F 1HNZQ 1IBMQ 2NVYA 1N33H 3LX0A 4F87A 4QF4A 4A3JG 4KKSA 4NKLA 4KJOA 4YR0A 2UU9H 4LF5H 2VUMA 1SYXB 4L63B 5C5LA 4J15A 4RGTA 3G71A 1UEAB 4QGUA 4LF7Q 3S1QH 1TU2B 4NP5A 3PIPA 2I0QA 2PO4A 4F8MA 4YWKA 5T1IA 4DV5L 1XMQL 3ORQA 2HVRA 2F0LA 2Q2TA 3K7UC 2ZJPA 1AW7A 3HKZA 3JRWA 1I50A 3GTOH 3KAJA 4A93G 2CW8A 4JI0Q 2CQOA 1RYSA 2EPBA 3HOWB 3OW7A 2EYHA 1PRTF 2CW7A 1X3PA 5JJIA 1TR5A 1FYCA 3GIMA 4KKUA 3MR5A 2TMPA 4RH6A 3IRBA 1E2WA 5M5WH 4A3KB 1TKWB 3PO2G 1TWAB 3J80W 4YHHL 4ZYSA 2ZJQA 3FKIA 3DWPA 3I55A 1DV1A 3W5OA 2YRXA 3V6KA 3JAMi 4ECZA 5C0XH 4A3EB 5CV4A 4DR7H 1I6VC 4PMBA 2FPPB 5AFWA 3M4OH 1KRSA 1W96A 3F2UA 1L1OC 1QG7A 4YCUA 4EVOA 1VQAA 3WWVA 1B9MA 2F0SA 1GM5A 5FO8B 1QVCA 1VBGA 3M9BA 4EQPA 4LSAA 4LUVA 1VF7A 3KFUA 4LW1A 4GC6A 4I55F 4DAYB 1X32A 2MGSA 1VQ9A 4XT3B 5KFIA 3VR5A 1H9KA 2BQUA 1TWCH 2UUBQ 1CTMA 4GKKL 2W8KA 3UE1A 5EWFA 4N8FA 3AB9A 1TWAA 3KBGA 2D0PA 3PUWA 2WP8J 4FBUA 1ILPA 4HJ9A 4R8IA 4EYIB 3T53B 3F1ZA 4LF6L 2F0KA 2EJFC 3LP8A 2PZTA 5KT5A 1S5FD 3S16B 3BG5A 3HOZG 4LF4L 1GOZA 3J81i 1N32L 1WTPA 3OSOA 2A68C 1KIXA 2K5DA 3BVGA 1A15A 2A6ED 3KDFA 1CQVA 1TY0A 3I4LA 2E74C 3Q8DA 4IUUA 3H4BA 4IUNA 3RV4A 5JPMC 4G7HC 3TMEA 4JYAL 3ULPA 1UEBA 4KHZA 3GTJB 1B53A 2MHVA 1X56A 1IW7C 4JV2A 1BCPD 2B2UA 4B3TH 3KXYT 3W1GA 4JI5H 5BN4A 1IBKL 1FJGL 2W7OA 4K5XA 4X3TA 5M5YB 2M05A 4ECXA 1I94L 1TA8A 5JVH3 3ETHA 3Q6SA 1UUPA 4HJ5A 3GIIA 2PPBC 2WE6A 1HR0H 1BUVT 3M4IA 3OMCA 4DAYA 1HA5A 5KFNA 4WJ3M 5H1SE 4DUZH 5A2QW 1SEBD 2ZXOA 4A3EG 3IN5A 3RN2A 5L9XA 4LF9H 3MXUA 2VQEL 2A69D 1K8AC 4J9QA 1ZQ7A 2UXCH 1Z2NX 3TDQA 1PH6A 3M9OB 2JA8B 4C5BA 3GTKH 4BA2I 1Y1VG 2AUJD 3CQZA 1KDAA 4ECRA 3VR2A 2DWCA 5C0XG 3BZDB 3HOYB 1SYBA 2L12A 1ZETA 2QCPX 2VQFQ 2D0OA 4O3RA 1L0YB 4QW8A 2B29A 2R7LA 5JVG3 2L9HA 1DIKA 4DV4Q 4ALPA 2V1CC 2CQYA 2CCZA 2R6GA 1VQHA 3GO5A 1CKOA 3PZPA 4ZOLF 3HOYH 4JBMA 4E6IA 3GTLH 1FNVA 1TWHA 1HR0L 1HQRD 1VBHA 2CFMA 4CBVA 3S2HH 2VPSA 1XNQL 4JI4Q 1ONLA 2F1MA 1B6RA 3NBIA 1CZWA 2JA8H 2R92G 4A3CH 2C2DA 1A2TA 3FVQA 1X65A 1H9SA 5JEAG 4RU9A 1WD1A 2ASLA 3H0GH 1B04A 2KCNA 4JCVE 1J5EL 3K5NA 4ZKCB 4L5TA 4BY1G 2CZGA 3MWEA 5D8DA 2UU9Q 1EHIA 4KJNA 2Y0SE 3HOVH 4ZUJA 2W70A 4OL7A 4P75A 3PF5A 3M4PA 4JV1A 1W93A 5EOYA 2N55A 3OSPA 2PYKA 2WB1G 2I5LX 3FMAA 4A3FG 4B3SL 1AE2A 1K73C 2VR1A 1KHIA 4XYOA 1Y8PB 2K5VA 3EPGA 2K5QA 1HNXL 5IT9L 4MV1A 4DR4H 3CCJA 4R4QA 1V1PA 3DUZA 2LKVA 2X6GA 2NZOA 3BYTB 2B2YA 2NVYH 1M90C 4P74A 1G6ZA 5H80A 3PVXA 4O4LF 1I3QH 3I72A 2K32A 3QG1A 3QWNA 2HD3A 1F2MA 3D8GA 1BBXC 5CA1F 4C2MB 4J0MA 3V05A 3PO2H 1KDBA 1L2FA 3STBC 5DEHA 2F52A 5KFJA 4GC7A 3VYRA 2Z8LA 2AGQA 3Q2OA 1Q1EA 2F0MA 4IWYA 2JA6B 4X3SA 5IYZF 3CMEA 3EN2A 2FXQA 3PV0A 3RLFA 4JV0A 1CHQD 4ECSA 3J80i 1L0XB 4CJ2C 5JAVA 3KJOA 4K5WA 2J9GA 4ED3A 1TWCB 3K7AB 2QF7A 1ESRA 1GUWA 1SJHD 4C3HB 4N8X1 3GTLB 4IJHA 3RGXA 3PW0A 4RCNA 4C3IH 2R7DA 1O7ZA 1AH9A 2UVUA 2KJXA 4Q5VA 4RKBA 1KAWA 1RHPA 1PH1A 1EYCA 2EYJA 1S0MA 3HOYG 1FKAH 2MP1A 3AEVA 4DV3H 2ZDQA 4XXEA 2PZWA 4ILWA 1EUJA 3N41B 4J9RA 1QUQA 2W6QA 3WOFA 3CRKC 5F9LA 2EZVA 4K6LA 1PTOB 2IHEA 4X65L 3PW5A 1PRTC 1XX8A 2WAQB 2OXPA 4RKLA 4HJ7A 4LF5L 1IXRA 3N6RA 2ZM6Q 3SVMA 4OEMB 1N33L 1Q3LA 1Y69U 1HQMC 3BVZA 3SXHA 4JK1C 2EYFA 3VYSA 3PSIA 4A3BG 3K81C 1SNPA 2Y0SG 2JK8A 2K5WA 5F2DA 2FK1A 3OHBA 1NTGA 3DEOA 4APVA 3RF2A 3J81W 3T1HH 2EXZA 5C4JB 3GTMB 5LMNH 1SYCA 1GO3E 5IGBA 3MR6A 4J9LA 3ITPA 4ZLTF 2K50A 1X55A 2WIIB 3QB3A 3S1MH 3MFIA 1PLFA 1JWUD 2IWHA 2V4RA 1A8VA 3OHAA 1AFPA 4V190 1PYBA 2KECA 2TSSA 3GQBA 3PUZA 1PFBA 5JPNC 3E5NA 4BA1I 5ELFA 3PCOB 4DAPA 1O75A 5TSSA 3BDOA 3HOUG 4IR9A 4IRKA 3BDLA 4DAVA 2MO0A 4R7RA 4J9OA 2E76C 2AGOA 1VQDA 1KLGD 3KK7A 2V58A 2K01A 4C1NK 4DV0Q 1T5EA 4DK0A 4LUZA 4JI3Q 3A7AB 1BDOA 2O2LD 1GLVA 2V5AA 3KDFB 5KFVA 2D5DA 2V4DA 3C1FA 1IKLA 3CCUA 4LFBH 4POFA 2F4VH 2C2RA 1KDCA 3J7AF 2UUAH 3K59A 4J9MA 4YCVA 3T1YQ 4TSSA 5KFEA 2C00A 4B3ML 2Q2UA 1HNZL 1GUSA 1SAPA 1S68A 5C4ZA 4OO1I 2MNAA 3CF5A 3F8NA 4NDXA 1T36A 1S0NA 2R7NA 2NU6B 1I94H 1TY2A 1SYEA 1LV9A 2PMZB 4A3FB 3I4MH 4DR6L 1TWFA 4DV5Q 1XMQQ 4GKJL 1ZYRC 3D6CA 4JI3H 2JE6I 1R4QB 1STGA 2ID0A 4JVZA 3I4NG 4JI0L 1J8IA 2JA8G 3SE7A 2UUBH 1KQSA 3P20A 1G6PA 4O3PA 4ED1A 4A3DG 1ET6A 2IX0A 1CSQA 1M1KC 4LF8H 5KX5F 2V4QA 5EBCA 2XTIA 1TIID 1Z2OX 3HOVG 3EIVA 1D6EC 4UCOA 4G7ZC 2WKCA 2MO1A 4JI2L 1E4FT 1TAEA 1F2LA 5CV9A 5D65A 3S1RB 4A2BA 2NVQB 1SXTA 3NXWA 1S3OA 4WFN3 1VQFA 2E2HH 4QWCA 1IBML 4DF7A 1XJVA 3TINA 1E4EB 5CYUA 1NR4A 4DL7A 3EFXD 2VUMH 4EBEA 3FKIH 1BO0A 2CW0D 4HYKA 4IFDH 3D3RA 1U5KA 4LH6A 1VQBA 2BOSA 4KI0A 1QNKA 1D1KA 3NGDA 3JSNA 5C3XA 1D8LA 3VYUA 2NU7B 4KK7A 4MV3A 4RMFA 4BXXH 1ZHSA 3K3PA 1B3QA 3GTMA 1HZBA 4MZ9A 2YYAA 1XNRL 1LACA 3PW4A 2C9OA 4IPGA 2ZJTA 3I3CA 2F0WA 2P5ZX 4WJWA 1BOSA 1Y1WH 1QWYA 4MHEA 3L4KA 4ECYA 5CB4F 3RZDB 3T5LA 5FJ8H 3GTGB 2AKWB 4G57A 3OYYA 4LFAQ 1ENAA 1N9WA 1T5XD 5D14A 2R93B 2C2EA 4IJLA 3WDNA 3W1BA 3PUXA 4JYAQ 1RK5A 5D3DA 3V4ZA 3S2DB 3KALA 1NUCA 3S17B 2R8KA 4J9KA 2L11A 3S17H 5GAGC 5J1ZA 2PMZE 1JB7A 2FJ2A 1QILA 3PR5B 5CV7A 4QCLA 4HCSA 4FNFA 5CV8A 3H3VI 5GQOA 3U50C 5I4DA 1PH8A 2RKSA 4BY7B 5LL6b 5G3LF 4ZKBB 2LY7A 1X6OA 3TEHB 1V1PB 1F9PA 4HIOA 2BH2A 2WDTA 3RV3A 4Q0FA 2F3IA 5E4XA 4Y52H 4HJAA 2R7ZH 1SCUB 4BBSH 1S10A 1ZEQX 5KG4A 3HOZH 4LF7L 3ERQA 1LT6D 4C3JH 4DGZA 1RJTA 1B4OA 3GV8B 1KABA 4PWQA 4CKEA 5COYA 1LTBD 1YJNA 2XGTA 2J6SA 1VQLA 5CV6A 4M1UB 5ELCA 5FK9C 4A93H 5C0XJ 4DL5A 1IHZA 2G9HD 3HOXG 1N34L 1M0WA 4MV8A 3RB6A 2W6ZA 1FNWA 2E2HB 4OO1H 3T56B 4EYHB 3RLNA 3TP5A 5T14A 4YHHQ 2WFWA 1G2SA 3R3OA 1SFOA 2R7MA 4OX9H 1MBYA 3TREA 3LMLA 2JA9A 4DAMA 4DXGA 3NK9A 5D1OA 2OTLA 1P8LA 1G91A 2FMAA 4JI2H 1E1TA 2R86A 4U7CA 4FS1A 1Q1BA 1VQOA 3C46A 5KFDA 1JOKA 3EJIA 4PG3A 1PRTB 1BBUA 2QA4A 1K8OA 3K5MA 1O7IA 4OX9L 5E1FA 1R9TB 2I80A 1SNDA 3KF6B 3NTHA 1Q82C 1EUCB 1AN8A 1YVCA 5KFHA 1GYFA 4A3LG 4IUTA 5GROA 1JICA 1S03G 5KNCA 3CCEA 2R61A 3GP7A 3JSLA 3BYYB 4A93B 5IWAH 1I4GA 3NSWA 4FF1A 3K5HA 3J7YW 5D3IB 4GKJH 1YJWA 3H3VH 1S40A 3KHGA 4RHRA 3KLWA 5JJLA 4JBWA 1DM0B 4IOAA 2FK2A 1LTLA 2UXDH 2E5LL 3E9IA 1NMGA 4IRDA 5J22A 2JA7H 1S5ED 2B2TA 5LA6F 3JAME 2UUCH 1TWGB 3M7NA 2FE3A 1C30A 1HR0W 4J6HA 4Q44A 4RFBA 5LL6X 5EAYA 1C4QA 3CCVA 1ZHQA 4DV4L 3L3OC 1LUZA 3OWFA 2XGQA 4YY3L 2IT1A 3CP0A 1VMPA 3AQQA 4HTHA 3BVMA 2UUAL 3BG3A 4NMZA 5KFSA 4TQRA 4EEQA 1XDNA 2V9WA 1SFOB 2WACA 4UP8A 1S97A 2W71A 2Q2HA 4RCOA 4JI4L 3D4RA 2YZMA 1K3RA 1A3VA 2CQAA 3SHLA 1XPOA 1EY0A 4L1KA 2JA5H 4NXMQ 4XYMB 4XIGS 3BA9A 3K5IA 1C48A 1Y14B 3MJFA 4DR5L 4UCSA 3R5HA 1K83B 1NR2A 3EA6A 3E6ZX 4C3JG 1UC9A 4ETSA 1GD7A 1EQQA 1OWTA 4YCWA 2L1BA 4DR2Q 1V4YA 1BKBA 1SRUA 4KN7C 3CC2A 3A8JE 1KJ9A 1EIGA 4QWAA 4HEDA 1B33N 3GTJA 1OXTA 1IYUA 1YJ9A 2RSOA 3H15A 1O7YA 4BBRG 4EQOA 3S1MB 4ZI7F 3CQZH 2WAQA 3T5HA 4XT1B 2B8FA 1WJJA 1F77A 4YAJB 2IX1A 4IPDA 1JE5A 1I7LA 1EWCA 2VQEQ 4NLGA 2N3SA 2LXKA 3CCLA 2NZ1D 1OO9B 1EOVA 2L15A 1GUGA 3BZKA 4KV6A 3GQCA 2E2IA 2DJFC 2XWBB 2ZXPA 2DPJA 4DKAC 3JAMW 2JA5A 4AH6A 1BGWA 4J9SA 1QVFA 2LMCB 1WTOA 4ECTA 3IG0A 1D5MC 2A74C 4BS9A 1M8AA 3U9SA 4FF4A 4LFAH 3MA2B 1I4PA 1NBWA 3FKIB 4G4KA 3S24A 4EGQA 2ZM6L 5J39A 1IL8A 4P72A 1IBMH 4LK1C 3ND9A 1WR2A 2YTYA 3G6YA 2N49A 4RHSA 5AJ3Q 3I7FA 4ULLA 3PIO3 1OXUA 2O03A 2WAQE 2GA4B 1EFWA 4X3KA 4GNXA 2I07B 2L55A 4GN4B 1YEZA 3R8BA 2PVPA 3Q8SB 1NCVA 1RL2A 3S1RH 1ULZA 1CKMA 4TQUS 3CCRA 4YB8B 4BWSC 1PH9A 2BQRA 3BQ0A 2E2IH 1F2YA 1VQEA 2XN9C 1N36H 2PN1A 1DXMA 2Z9HA 4HIMA 2BE5D 4WRDA 2ASJA 2I8CA 1R9TA 1DV2A 3Q1KA 1J5EQ 5JUMA 4MV4A 1HRJA 4UCTA 4HIKA 2A5HA 2H4OA 3U4VA 3TZDA 3G48A 5KG7A 3K6OA 1RJQA 2NVXA 4UHVA 2CWAA 2EJGC 4R1JA 2SNSA 3VA5A 4KD3A 1G2TA 2RCFA 1Z7TA 1L0WA 5KT6A 2B2VA 2HUGA 1S72A 4DR6H 5LHY1 4OWTB 4R4CA 4XYLB 2F0EA 3I4NB 5IWAL 1PZJD 2UXCQ 2W9AA 1OXVA 2B63A 4A3FH 4C2MH 1SN8A 2R93A 2XCAA 1E24A 2JA5G 4LF5Q 1VQKA 4PDBA 4BBRB 2ICEC 5CR3A 2NVYB 2F0VA 2VS1A 1XMOQ 1N33Q 5ELOA 3PR4A 1KBLA 4GN3B 1HUNA 2YL2A 5FO9B 1PK8A 1BJTA 4B3MH 4WD3A 2M2LA 5J2TF 1YZ6A 3H40A 2B63G 2NTSA 2F4VL 3KAKA 3OTOH 5DLFA 3JC66 1E2ZA 3Q23A 1SBBB 2EYMA 2PZUA 2RGRA 1LO5D 1I50B 2F0DA 2R8IA 2KCMA 2A19A 1EYAA 5IGCA 4RAZA 4AYBE 4DV5H 1XMQH 5ELEA 2X0SA 3R93A 1RF2D 2A68D 2F3WA 4JBKA 1CK1A 1W3SA 1NY4A 1C8CA 1TXYA 1CUKA 4ZUIA 4HR7B 3I73A 1LTAD 3PF4A 2ALZA 1KNAA 4DL3A 2EYPA 2HJWA 1J6QA 4DV0L 2NVXB 3HOUB 4BY7G 1E7ZA 4NXMH 3ICEA 1Z2PX 2DIKA 2YU9H 5I6YA 3IAYA 3S15B 1RODA 1TWHH 3K80C 1HHVA 4A3GH 4HNUA 3P75A 4LFBQ 2R8JA 3NQTA 3GTMH 3MFGA 5C1OA 1D5XC 3STBD 4LF9Q 5FD5A 5KFFA 1K3BC 3MEFA 1FGBD 3R2TA 4FF3A 3GTPB 2J0TD 3HXLA 1YNXA 2VZAA 1SNOA 4C3IG 3G6XA 4CC5A 4DV0H 2DNEA 5D1OB 5C5MA 4OELB 3J81j 4PMWA 2AU0A 4ZHQF 2W9BA 3MEHA 1SE3A 3AFPA 4KTAA 4DL2A 1PTOF 5KFXA 1GHJA 1MIUA 5IP9H 3DHQA 2IY5B 1CT1D 4JI1Q 3EVQA 3CU7A 3Q22A 2B2YC 4B3TQ 4FS2A 4KKTA 4YWLA 3RR5A 3NENA 3GTGA 4DV1Q 1WCMA 4MN3A 2HIXA 3MXNB 4YJ2F 3JAMc 3M9NB 4O3OA 3C2PA 4F50A 1A63A 1ICFB 2JP1A 1MJCA 1VCIA 3K5OA 4BWGB 4FO2A 2VNUD 2E2JB 4IHJF 2VXWA 3GTPH 3DF7A 3LWBA 1JMCA 3RBDA 1NJIC 1ICWA 4HNTA 4A3BH 3MFHA 1EQTA 2RHSB 4TRDA 1YNJC 3L7ZC 1C0AA 2R7ZA 4ED0A 1MSGA 2UVRA 2EQSA 4R4TA 3SK4A 4ECQA 1IYVA 4HSPA 1ASZA 5KFMA 2DY7A 2F0FA 2B8GA 2PQEA 3DWAA 2NVXH 4QWDA 3NE5B 3VDYA 1PZKD 5J2UF 1ILQA 1HFGA 1SMYD 2IHFA 4J1MA 5EJWA 2W6NA 2SNMA 4DV3Q 2UVVA 3GIDA 1CM9A 4JYAH 5DQHA 4IPHA 3EBEA 2M00A 1WI5A
chains in the Genus database with same CATH topology
4UP9A 4LUZA 4JI3Q 1CSPA 2NVTH 1YHAA 1N36Q 4IFDI 1ASYA 3KDFB 4DR3Q 1JJCB 3CCUA 1Q12A 4POFA 3D31A 4YY3Q 1PH4A 3CPWA 4OONA 2HHHL 1N36L 1IBKQ 1FJGQ 3L0OA 1QVGA 4YCVA 3T1YQ 4FDBA 3KJPA 1K9MC 4B3SQ 1CKNB 3BJUA 4YWMA 5J3BA 1E22A 2Q2UA 1E1OA 3ULLA 1HNZL 4B3ML 1HNXQ 2RF4A 2HHHQ 2R7FA 2MNAA 3CF5A 4OO1I 1KD1C 4A3MG 3T1YL 2HIVA 2K5HA 4DR6Q 2AWNA 1MJEA 3GTGH 2OCEA 4OWWB 3RZDH 1IBLL 4DPGA 3AYHB 4AYBG 4UPAA 4GOPB 2JQOA 2Z6KC 2DUDA 2K5NA 3UE0A 3PUVA 3I4MH 4DR6L 4DV5Q 3HKSA 1XMQQ 4DR2L 2UUCQ 4LFAL 4GKJL 4A3IG 4GLXA 1FVIA 3J81c 1Q46A 1SR3A 2JE6I 1RIPA 2ID0A 4O2DA 4JI8L 4GNXC 4JI0L 3I4NG 2NN6I 1LM0A 2JA8G 1D7QA 1KQSA 1I94Q 3F2CA 4A3IH 2E2JH 2N8NA 1G6PA 3BZCA 3RN5A 4A3DG 3I56A 1YI2A 4JI8Q 4BBSG 2IX0A 1SE8A 2JEBI 1CSQA 1M1KC 2HQLA 5C4XH 4AQYQ 1Q7YC 4QQBX 4P73A 4DUZL 1NE3A 2Z6KA 1Q86C 4IPCA 4DV6L 2LSSA 3KOJA 5IP7G 4JI6Q 2XTIA 2ZTCA 4KHPQ 1QZGA 3CCQA 3HOVG 3EIVA 3F2DA 5M3FG 3G6EA 4WJ4A 3HKZG 1WCMG 5C44G 2NZHA 2MO1A 3D0FA 1N8RC 4JI2L 1PFSA 1YIJA 2MFIA 3HOWG 1VQJA 1BVSA 3NELA 4KHPL 2D62A 1WCMH 4JOIC 4DK3C 1S3OA 3ZJYC 3PUYA 3UDXA 3U4ZA 4DV2L 2PQAA 1Q8KA 1VQFA 2E2HH 1YBYA 4JG2A 2VUMG 1OTCA 1IBML 1XJVA 1HNWQ 4JI3L 4K0KL 2VUMH 1QUQB 3FKIH 4XTCS 2E5LQ 4C3HH 1U5KA 3DM3A 1VQBA 3CD6A 4KI0A 4X66L 3FHWA 3E0EA 2RHQB 4X62L 4X65Q 1HJPA 2Q2IA 2UU9L 3CC4A 1D8LA 5IYCG 3HOUH 1X3EA 2PNHA 4GLVB 5IWAQ 1HR0Q 1XNRQ 4RMFA 4B3MQ 4BXXH 3FP9A 4QIWE 4B3RQ 5IYCH 4MNOA 2JA6H 4LNQA 5M3MG 1HZBA 2YTVA 3UDIA 1SROA 1TWFH 4MZ9A 2K4KA 2ALYB 2KENA 5IYBG 2UXDQ 5BR8Q 2ZTEA 2WAQG 2CWPA 1XNRL 4A3MH 4IPGA 5IE8A 3S1NH 4A3KG 5IYBH 1Y1WH 4BY7H 4EQ5A 2UXDL 5FJ8H 4NXML 4GOPC 2F4VQ 2UXBL 2NN6G 2AKWB 1U0LA 3OYYA 4LFAQ 4NXNL 1Y1WG 1N9WA 2AHOB 5C0XI 4JI7Q 2QGQA 4IJLA 1CKNA 3PUXA 3W1BA 4JYAQ 3J7ZC 4DR7Q 3TQYA 1PYSB 2A8VA 4R4OA 3S17H 5GAGC 3UDGA 2GVBA 2PMZE 1AE3A 2ES2A 3S2DH 2KBNA 1JB7A 1IYJB 1X9NA 1E3PA 1HZCA 3KF8B 5GADC 4A75A 1XMOL 4DR7L 1EQRA 4JV5Q 1V43A 2N78A 3M4QA 4DUZQ 2PQAB 3A0JA 5GQOA 3H3VI 4JV5L 1VQIA 3U50C 1EYGA 2GN5A 1PH8A 4RG1A 1KL9A 3PGZA 4DR3L 3I4NH 1JJGA 1X6OA 3TEHB 5LMNL 3H0GG 3OTOL 4HIOA 3F8TA 2BH2A 1K0RA 3T1HL 5HY6A 2F3IA 4Y52H 4DR4L 4HJAA 4DR1L 2B3GA 1YHQA 2R7ZH 4BBSH 4GNXB 2H5XA 5LMNQ 1HNZQ 3HOZH 1IBMQ 4LF7L 2R7ZG 4C3JH 5IP7H 1KRTA 2UUAQ 2OWOA 1VQ8A 4A3JG 1YJNA 2XGTA 4QY7A 4HJ8A 1VQ5A 1IBLQ 4J15A 3SGIA 5IY0A 3G71A 4NB3A 4QGUA 1VQLA 4LF7Q 1PHJA 3S1QH 3NBHB 2MQHA 1VQ4A 2I0QA 3PIPA 5C4JH 3PO3G 1V1QA 4YWKA 2GVAA 4A93H 5C0XJ 4DV5L 1XMQL 3HOXG 4IO9A 1N34L 2Q2TA 3K7UC 2ZJPA 3ERSX 3PIOA 1EIYB 3GTOH 4A93G 2A1AA 5K36G 4JI1L 4JI0Q 2CQOA 4O0AA 3RLNA 3A5ZB 1BBWA 4GLAC 5FLMG 4YHHQ 2WFWA 3TREA 5JJIA 2JA9A 2PI2E 1VQCA 3FKIG 4DAMA 4DV1L 1Q81C 4GN5A 4IFDG 5JJKA 2OTLA 1P8LA 3IRBA 5M5WH 3PO2G 1E1TA 3ULJA 4YHHL 2AWOA 1Q1BA 1VQOA 1TWAH 2ZJQA 4DV6Q 4A3KH 4PG3A 1BBUA 3I55A 2UXBQ 3W5OA 2QA4A 1O7IA 3JAMi 4OX9L 4A3LH 3K8AA 3KF6B 4PZ7A 1Q82C 1YVCA 2QEXA 4LFCQ 3NEMA 4A3LG 3M4OH 4L5QA 1KRSA 5GROA 1L1OC 3CCEA 4YCUA 2OQ0A 1VQAA 1SMXA 3WWVA 1GM5A 1QVCA 3M9BA 4LUVA 3KFUA 4LW1A 1HNWL 1YJWA 3H3VH 1L1OA 4DAYB 1S40A 3KLWA 1VQ9A 4K0KQ 1I5FA 5JJLA 4JBWA 4R4IA 5IYDG 4IOAA 1TWCH 1LTLA 1C7YA 1FGUA 2YV5A 2E5LL 1X3GA 3E9IA 2UUBQ 1NMGA 1PV4A 4X66Q 3UE1A 2JA7H 4X62Q 3RLOA 2ATWA 2WB1E 1Z9FA 5AJ3L 3I4MG 4EX5A 3M7NA 1HR0W 2D0PA 3PUWA 4DR4Q 1T9HA 2WP8J 3GTJH 5EAYA 1PVOA 3CCVA 3S15H 4HJ9A 4DV4L 1LUZA 3CXCA 4B3RL 3F1ZA 4LF6L 4L5SA 4YY3L 2IT1A 2I5HA 3CP0A 1V9PA 3AQQA 2UUAL 3HOZG 4HIDA 4LF4L 1Z47A 3J81i 1N32L 1VQ6A 4UP8A 1I50H 2Q2HA 4DV7L 1X3FA 1KC8C 4GS3A 4AIMA 1KIXA 4JI4L 3J7A5 3TRZA 1UE7A 1K3RA 4DR5Q 1SFOH 1VQ7A 1XPOA 1HZ9A 2C35B 3KDFA 2KHJA 4IOCA 4JI5L 1G291 3S16H 2JA5H 4NXMQ 3PO3H 2RCNA 3Q8DA 4XIGS 1HZAA 5DLQE 4DV7Q 4NXNQ 4JI7L 1Y14B 3LGJA 2I5MX 4DR5L 5ELNA 1XPRA 4JYAL 3ULPA 1UEBA 2E8GA 4KHZA 1B7YB 1LYLA 4DK6C 1XTDA 1GD7A 1X56A 1EQQA 2K75A 4YCWA 4DR2Q 1PH2A 1BKBA 1SRUA 1TWGH 3W1GA 3CC2A 4BBRH 1IBKL 1FJGL 3F2BA 1OXTA 4QL5A 1VQGA 2UXCL 1YJ9A 1I94L 3H15A 4X6AH 4BBRG 4HJ5A 4KLKA 3CQZH 4LF9L 1WJJA 2IX1A 4IPDA 5LMUL 1JE5A 1VQNA 1L1OB 2VQEQ 4OO1G 2N3SA 4WJ3M 5H1SE 1EIFA 2LXKA 3CCLA 1IZ6A 2L15A 1EOVA 4LFCL 3BZKA 5HGQA 4A76A 4A3EG 3M3YH 4GOPA 3RN2A 5LMUQ 4P71A 4DKAC 4DR1Q 2VQEL 5C3EG 4AH6A 2OQKA 1K8AC 2UUCL 4BXXG 4A3EH 4GKJQ 1R9TH 1PH3A 1WYDA 3DLLA 1PH6A 1QVFA 5M3MH 3GTKH 4BA2I 1Y1VG 5C3EH 4X64Q 4B3TL 2HT1A 4A3CG 1NBWA 2BA1A 3S24A 2ZM6L 1Y1VH 5C0XG 2EIFA 4H02A 4P72A 3OW2A 4A3GG 2YTYA 2N49A 3KF6A 5AJ3Q 3I7FA 3L2PA 2D0OA 5FJ8G 2VQFQ 1PH7A 3A5UA 1PH5A 1OXUA 4JI6L 2B29A 2WAQE 1EFWA 4GNXA 1YITA 1A62A 2YTXA 3CAMA 3ER0A 1YEZA 4GN4B 4DV4Q 4ALPA 1I6HH 1RL2A 2V1CC 3S1RH 4JI2Q 2CCZA 3GO5A 1YHBA 1CKMA 1VQHA 1CKOA 2R6GA 4TQUS 3CCRA 1QZHA 1PH9A 3HOYH 4JBMA 2E2IH 1A0IA 3GTLH 1VQEA 1N32Q 1HR0L 1UE6A 3RZOH 1IL2A 2CFMA 3S2HH 4HIMA 4JBJA 2JA7G 4DUYL 4JI4Q 1XNQL 4LFBL 1J5EQ 4A3CH 2JA8H 2R92G 4OWXB 1KXLA 4HIKA 1X65A 3U4VA 1VS0A 3G48A 4A3DH 5JEAG 2KHIA 2JJQA 2VL6A 2CWAA 3H0GH 2LXJA 4JCVE 4R1JA 1J5EL 4L5TA 4A4IA 4BY1G 3J80c 1SLJA 1L0WA 2VW9A 2UU9Q 1S72A 1EWIA 2Y0SE 4OWTB 4R4CA 3HOVH 2ASBA 4P75A 2EXDA 3I2ZA 3M4PA 5IWAL 3PF5A 2UXCQ 1OXVA 4QJFA 1OXSC 1SN8A 4C2MH 4A3FH 3U58A 5M5YH 1E24A 2JA5G 2WB1G 4LF5Q 1VQKA 2I5LX 4IFDJ 5JEAJ 4A3FG 4B3SL 3TS2A 1GVPA 2VS1A 1XMOQ 2AMCB 1N33Q 1AE2A 1K73C 3S14H 1KHIA 5ELOA 2K5VA 4GN3B 1K83H 1K8GA 3GDEA 1HNXL 2BA0A 3HOXH 1OXXK 1YZ6A 3CCJA 1DGSA 4LUOA 2B63G 1WFQA 4TVAB 4JC0A 2F4VL 4R4QA 3JC66 2NZOA 1JJ2A 1C9OA 3A74A 3I4OA 2NVYH 3OTOQ 4P74A 1M90C 2B63H 2R93H 3CW2C 1PA6A 1I3QH 4DNIA 4X64L 4LF4Q 2KCMA 2A19A 4Y7NH 2ZJRA 4AYBE 5LMNW 3PO2H 1L2FA 3HFZB 3STBC 1W3SA 5FLXc 3TS0A 1NY4A 2F52A 4JBKA 1TXYA 1CUKA 1W2BA 2VQFL 1Q1EA 2JA6G 4JI5Q 3PF4A 4DV3L 5GAHC 3CMEA 4AQYL 3EN2A 2FXQA 5E7NA 1J6QA 4DV0L 3BU2A 3PV0A 3RLFA 4BY7G 1E7ZA 3J80i 1B8AA 3ICEA 3T1HQ 3KJOA 2YU9H 3KYHC 3RNUA 1MKHA 1TWHH 1HH2P 5M5XH 3K80C 4A3GH 4LWCA 1XPUA 4LFBQ 1H95A 4NPSA 3GTMH 4IJHA 1UE5A 2BH8A 4C3IH 3STBD 2R7DA 4PZ6A 4LF9Q 1AH9A 2R92H 3MEFA 1UE1A 4DV2Q 1YNXA 3CPFA 2VZAA 4OXPA 4LF6Q 5IYDH 1KAWA 1PH1A 3CC7A 3J81j 1UWVA 4PMWA 3HOYG 3CMAA 2NVQH 1JT8A 3AEVA 2K14A 4MTNA 4UY8C 3AFPA 1EUJA 3UDFA 4OX9Q 1N34Q 1QUQA 3B6YA 4GKKL 1MIUA 2IHEA 5IP9H 1X54A 2IY5B 4JOIA 4JI1Q 4X65L 4UP7A 1B70B 2OTJA 4B3TQ 4YWLA 4HJ7A 4LF5L 5IP9G 3RR5A 3NENA 3GTQH 1WOCA 1IXRA 4DV1Q 2CKZB 2HIXA 3MXNB 2ZM6Q 3JAMc 1N33L 3HKZE 5C44H 2VY3A 3HOWH 4BY1H 1A63A 2KCTA 3K0XA 1MJCA 1VCIA 2VNUD 3PSIA 2K52A 3K81C 2ZTDA 3GTPH 4A3BG 1P16A 1FL0A 2PI2A 2Y0SG 5BR8L 1JMCA 2JK8A 5GAEC 4ME3A 3AFQA 4A3JH 1NJIC 1VQMA 2YYZA 5C4XG 1GKHA 1NTGA 4APVA 1G51A 4LF8Q 4A3BH 2JEAI 1GO3E 5IT9c 3CCMA 2RHSB 5M3FH 2R93G 3L7ZC 3G4SA 1C0AA 4PZ8A 2K50A 1X55A 2DGYA 3S1MH 2EQSA 4R4TA 3K7AH 1A8VA 4LF8L 1ASZA 3M85A 4DUYQ 3GD7A 1PYBA 3PUZA 2NVXH 1XNQQ 4BA1I 3E9HA 3PCOB 5FLMH 3VDYA 4POGA 1NMFA 2Z0SA 2IHFA 3HOUG 3CCSA 2MO0A 4DV3Q 2UUBL 1VQPA 4GKKQ 1VQDA 4L5RC 4IPHA 3EBEA 4DV0Q 1WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP9 A;  4LUZ A;  4JI3 Q;  1CSP A;  2NVT H;  1YHA A;  1N36 Q;  4IFD I;  1ASY A;  3KDF B;  4DR3 Q;  1JJC B;  3CCU A;  1Q12 A;  4POF A;  3D31 A;  4YY3 Q;  1PH4 A;  3CPW A;  4OON A;  2HHH L;  1N36 L;  1IBK Q;  1FJG Q;  3L0O A;  1QVG A;  4YCV A;  3T1Y Q;  4FDB A;  3KJP A;  1K9M C;  4B3S Q;  1CKN B;  3BJU A;  4YWM A;  5J3B A;  1E22 A;  2Q2U A;  1E1O A;  3ULL A;  1HNZ L;  4B3M L;  1HNX Q;  2RF4 A;  2HHH Q;  2R7F A;  2MNA A;  3CF5 A;  4OO1 I;  1KD1 C;  4A3M G;  3T1Y L;  2HIV A;  2K5H A;  4DR6 Q;  2AWN A;  1MJE A;  3GTG H;  2OCE A;  4OWW B;  3RZD H;  1IBL L;  4DPG A;  3AYH B;  4AYB G;  4UPA A;  4GOP B;  2JQO A;  2Z6K C;  2DUD A;  2K5N A;  3UE0 A;  3PUV A;  3I4M H;  4DR6 L;  4DV5 Q;  3HKS A;  1XMQ Q;  4DR2 L;  2UUC Q;  4LFA L;  4GKJ L;  4A3I G;  4GLX A;  1FVI A;  3J81 c;  1Q46 A;  1SR3 A;  2JE6 I;  1RIP A;  2ID0 A;  4O2D A;  4JI8 L;  4GNX C;  4JI0 L;  3I4N G;  2NN6 I;  1LM0 A;  2JA8 G;  1D7Q A;  1KQS A;  1I94 Q;  3F2C A;  4A3I H;  2E2J H;  2N8N A;  1G6P A;  3BZC A;  3RN5 A;  4A3D G;  3I56 A;  1YI2 A;  4JI8 Q;  4BBS G;  2IX0 A;  1SE8 A;  2JEB I;  1CSQ A;  1M1K C;  2HQL A;  5C4X H;  4AQY Q;  1Q7Y C;  4QQB X;  4P73 A;  4DUZ L;  1NE3 A;  2Z6K A;  1Q86 C;  4IPC A;  4DV6 L;  2LSS A;  3KOJ A;  5IP7 G;  4JI6 Q;  2XTI A;  2ZTC A;  4KHP Q;  1QZG A;  3CCQ A;  3HOV G;  3EIV A;  3F2D A;  5M3F G;  3G6E A;  4WJ4 A;  3HKZ G;  1WCM G;  5C44 G;  2NZH A;  2MO1 A;  3D0F A;  1N8R C;  4JI2 L;  1PFS A;  1YIJ A;  2MFI A;  3HOW G;  1VQJ A;  1BVS A;  3NEL A;  4KHP L;  2D62 A;  1WCM H;  4JOI C;  4DK3 C;  1S3O A;  3ZJY C;  3PUY A;  3UDX A;  3U4Z A;  4DV2 L;  2PQA A;  1Q8K A;  1VQF A;  2E2H H;  1YBY A;  4JG2 A;  2VUM G;  1OTC A;  1IBM L;  1XJV A;  1HNW Q;  4JI3 L;  4K0K L;  2VUM H;  1QUQ B;  3FKI H;  4XTC S;  2E5L Q;  4C3H H;  1U5K A;  3DM3 A;  1VQB A;  3CD6 A;  4KI0 A;  4X66 L;  3FHW A;  3E0E A;  2RHQ B;  4X62 L;  4X65 Q;  1HJP A;  2Q2I A;  2UU9 L;  3CC4 A;  1D8L A;  5IYC G;  3HOU H;  1X3E A;  2PNH A;  4GLV B;  5IWA Q;  1HR0 Q;  1XNR Q;  4RMF A;  4B3M Q;  4BXX H;  3FP9 A;  4QIW E;  4B3R Q;  5IYC H;  4MNO A;  2JA6 H;  4LNQ A;  5M3M G;  1HZB A;  2YTV A;  3UDI A;  1SRO A;  1TWF H;  4MZ9 A;  2K4K A;  2ALY B;  2KEN A;  5IYB G;  2UXD Q;  5BR8 Q;  2ZTE A;  2WAQ G;  2CWP A;  1XNR L;  4A3M H;  4IPG A;  5IE8 A;  3S1N H;  4A3K G;  5IYB H;  1Y1W H;  4BY7 H;  4EQ5 A;  2UXD L;  5FJ8 H;  4NXM L;  4GOP C;  2F4V Q;  2UXB L;  2NN6 G;  2AKW B;  1U0L A;  3OYY A;  4LFA Q;  4NXN L;  1Y1W G;  1N9W A;  2AHO B;  5C0X I;  4JI7 Q;  2QGQ A;  4IJL A;  1CKN A;  3PUX A;  3W1B A;  4JYA Q;  3J7Z C;  4DR7 Q;  3TQY A;  1PYS B;  2A8V A;  4R4O A;  3S17 H;  5GAG C;  3UDG A;  2GVB A;  2PMZ E;  1AE3 A;  2ES2 A;  3S2D H;  2KBN A;  1JB7 A;  1IYJ B;  1X9N A;  1E3P A;  1HZC A;  3KF8 B;  5GAD C;  4A75 A;  1XMO L;  4DR7 L;  1EQR A;  4JV5 Q;  1V43 A;  2N78 A;  3M4Q A;  4DUZ Q;  2PQA B;  3A0J A;  5GQO A;  3H3V I;  4JV5 L;  1VQI A;  3U50 C;  1EYG A;  2GN5 A;  1PH8 A;  4RG1 A;  1KL9 A;  3PGZ A;  4DR3 L;  3I4N H;  1JJG A;  1X6O A;  3TEH B;  5LMN L;  3H0G G;  3OTO L;  4HIO A;  3F8T A;  2BH2 A;  1K0R A;  3T1H L;  5HY6 A;  2F3I A;  4Y52 H;  4DR4 L;  4HJA A;  4DR1 L;  2B3G A;  1YHQ A;  2R7Z H;  4BBS H;  4GNX B;  2H5X A;  5LMN Q;  1HNZ Q;  3HOZ H;  1IBM Q;  4LF7 L;  2R7Z G;  4C3J H;  5IP7 H;  1KRT A;  2UUA Q;  2OWO A;  1VQ8 A;  4A3J G;  1YJN A;  2XGT A;  4QY7 A;  4HJ8 A;  1VQ5 A;  1IBL Q;  4J15 A;  3SGI A;  5IY0 A;  3G71 A;  4NB3 A;  4QGU A;  1VQL A;  4LF7 Q;  1PHJ A;  3S1Q H;  3NBH B;  2MQH A;  1VQ4 A;  2I0Q A;  3PIP A;  5C4J H;  3PO3 G;  1V1Q A;  4YWK A;  2GVA A;  4A93 H;  5C0X J;  4DV5 L;  1XMQ L;  3HOX G;  4IO9 A;  1N34 L;  2Q2T A;  3K7U C;  2ZJP A;  3ERS X;  3PIO A;  1EIY B;  3GTO H;  4A93 G;  2A1A A;  5K36 G;  4JI1 L;  4JI0 Q;  2CQO A;  4O0A A;  3RLN A;  3A5Z B;  1BBW A;  4GLA C;  5FLM G;  4YHH Q;  2WFW A;  3TRE A;  5JJI A;  2JA9 A;  2PI2 E;  1VQC A;  3FKI G;  4DAM A;  4DV1 L;  1Q81 C;  4GN5 A;  4IFD G;  5JJK A;  2OTL A;  1P8L A;  3IRB A;  5M5W H;  3PO2 G;  1E1T A;  3ULJ A;  4YHH L;  2AWO A;  1Q1B A;  1VQO A;  1TWA H;  2ZJQ A;  4DV6 Q;  4A3K H;  4PG3 A;  1BBU A;  3I55 A;  2UXB Q;  3W5O A;  2QA4 A;  1O7I A;  3JAM i;  4OX9 L;  4A3L H;  3K8A A;  3KF6 B;  4PZ7 A;  1Q82 C;  1YVC A;  2QEX A;  4LFC Q;  3NEM A;  4A3L G;  3M4O H;  4L5Q A;  1KRS A;  5GRO A;  1L1O C;  3CCE A;  4YCU A;  2OQ0 A;  1VQA A;  1SMX A;  3WWV A;  1GM5 A;  1QVC A;  3M9B A;  4LUV A;  3KFU A;  4LW1 A;  1HNW L;  1YJW A;  3H3V H;  1L1O A;  4DAY B;  1S40 A;  3KLW A;  1VQ9 A;  4K0K Q;  1I5F A;  5JJL A;  4JBW A;  4R4I A;  5IYD G;  4IOA A;  1TWC H;  1LTL A;  1C7Y A;  1FGU A;  2YV5 A;  2E5L L;  1X3G A;  3E9I A;  2UUB Q;  1NMG A;  1PV4 A;  4X66 Q;  3UE1 A;  2JA7 H;  4X62 Q;  3RLO A;  2ATW A;  2WB1 E;  1Z9F A;  5AJ3 L;  3I4M G;  4EX5 A;  3M7N A;  1HR0 W;  2D0P A;  3PUW A;  4DR4 Q;  1T9H A;  2WP8 J;  3GTJ H;  5EAY A;  1PVO A;  3CCV A;  3S15 H;  4HJ9 A;  4DV4 L;  1LUZ A;  3CXC A;  4B3R L;  3F1Z A;  4LF6 L;  4L5S A;  4YY3 L;  2IT1 A;  2I5H A;  3CP0 A;  1V9P A;  3AQQ A;  2UUA L;  3HOZ G;  4HID A;  4LF4 L;  1Z47 A;  3J81 i;  1N32 L;  1VQ6 A;  4UP8 A;  1I50 H;  2Q2H A;  4DV7 L;  1X3F A;  1KC8 C;  4GS3 A;  4AIM A;  1KIX A;  4JI4 L;  3J7A 5;  3TRZ A;  1UE7 A;  1K3R A;  4DR5 Q;  1SFO H;  1VQ7 A;  1XPO A;  1HZ9 A;  2C35 B;  3KDF A;  2KHJ A;  4IOC A;  4JI5 L;  1G29 1;  3S16 H;  2JA5 H;  4NXM Q;  3PO3 H;  2RCN A;  3Q8D A;  4XIG S;  1HZA A;  5DLQ E;  4DV7 Q;  4NXN Q;  4JI7 L;  1Y14 B;  3LGJ A;  2I5M X;  4DR5 L;  5ELN A;  1XPR A;  4JYA L;  3ULP A;  1UEB A;  2E8G A;  4KHZ A;  1B7Y B;  1LYL A;  4DK6 C;  1XTD A;  1GD7 A;  1X56 A;  1EQQ A;  2K75 A;  4YCW A;  4DR2 Q;  1PH2 A;  1BKB A;  1SRU A;  1TWG H;  3W1G A;  3CC2 A;  4BBR H;  1IBK L;  1FJG L;  3F2B A;  1OXT A;  4QL5 A;  1VQG A;  2UXC L;  1YJ9 A;  1I94 L;  3H15 A;  4X6A H;  4BBR G;  4HJ5 A;  4KLK A;  3CQZ H;  4LF9 L;  1WJJ A;  2IX1 A;  4IPD A;  5LMU L;  1JE5 A;  1VQN A;  1L1O B;  2VQE Q;  4OO1 G;  2N3S A;  4WJ3 M;  5H1S E;  1EIF A;  2LXK A;  3CCL A;  1IZ6 A;  2L15 A;  1EOV A;  4LFC L;  3BZK A;  5HGQ A;  4A76 A;  4A3E G;  3M3Y H;  4GOP A;  3RN2 A;  5LMU Q;  4P71 A;  4DKA C;  4DR1 Q;  2VQE L;  5C3E G;  4AH6 A;  2OQK A;  1K8A C;  2UUC L;  4BXX G;  4A3E H;  4GKJ Q;  1R9T H;  1PH3 A;  1WYD A;  3DLL A;  1PH6 A;  1QVF A;  5M3M H;  3GTK H;  4BA2 I;  1Y1V G;  5C3E H;  4X64 Q;  4B3T L;  2HT1 A;  4A3C G;  1NBW A;  2BA1 A;  3S24 A;  2ZM6 L;  1Y1V H;  5C0X G;  2EIF A;  4H02 A;  4P72 A;  3OW2 A;  4A3G G;  2YTY A;  2N49 A;  3KF6 A;  5AJ3 Q;  3I7F A;  3L2P A;  2D0O A;  5FJ8 G;  2VQF Q;  1PH7 A;  3A5U A;  1PH5 A;  1OXU A;  4JI6 L;  2B29 A;  2WAQ E;  1EFW A;  4GNX A;  1YIT A;  1A62 A;  2YTX A;  3CAM A;  3ER0 A;  1YEZ A;  4GN4 B;  4DV4 Q;  4ALP A;  1I6H H;  1RL2 A;  2V1C C;  3S1R H;  4JI2 Q;  2CCZ A;  3GO5 A;  1YHB A;  1CKM A;  1VQH A;  1CKO A;  2R6G A;  4TQU S;  3CCR A;  1QZH A;  1PH9 A;  3HOY H;  4JBM A;  2E2I H;  1A0I A;  3GTL H;  1VQE A;  1N32 Q;  1HR0 L;  1UE6 A;  3RZO H;  1IL2 A;  2CFM A;  3S2H H;  4HIM A;  4JBJ A;  2JA7 G;  4DUY L;  4JI4 Q;  1XNQ L;  4LFB L;  1J5E Q;  4A3C H;  2JA8 H;  2R92 G;  4OWX B;  1KXL A;  4HIK A;  1X65 A;  3U4V A;  1VS0 A;  3G48 A;  4A3D H;  5JEA G;  2KHI A;  2JJQ A;  2VL6 A;  2CWA A;  3H0G H;  2LXJ A;  4JCV E;  4R1J A;  1J5E L;  4L5T A;  4A4I A;  4BY1 G;  3J80 c;  1SLJ A;  1L0W A;  2VW9 A;  2UU9 Q;  1S72 A;  1EWI A;  2Y0S E;  4OWT B;  4R4C A;  3HOV H;  2ASB A;  4P75 A;  2EXD A;  3I2Z A;  3M4P A;  5IWA L;  3PF5 A;  2UXC Q;  1OXV A;  4QJF A;  1OXS C;  1SN8 A;  4C2M H;  4A3F H;  3U58 A;  5M5Y H;  1E24 A;  2JA5 G;  2WB1 G;  4LF5 Q;  1VQK A;  2I5L X;  4IFD J;  5JEA J;  4A3F G;  4B3S L;  3TS2 A;  1GVP A;  2VS1 A;  1XMO Q;  2AMC B;  1N33 Q;  1AE2 A;  1K73 C;  3S14 H;  1KHI A;  5ELO A;  2K5V A;  4GN3 B;  1K83 H;  1K8G A;  3GDE A;  1HNX L;  2BA0 A;  3HOX H;  1OXX K;  1YZ6 A;  3CCJ A;  1DGS A;  4LUO A;  2B63 G;  1WFQ A;  4TVA B;  4JC0 A;  2F4V L;  4R4Q A;  3JC6 6;  2NZO A;  1JJ2 A;  1C9O A;  3A74 A;  3I4O A;  2NVY H;  3OTO Q;  4P74 A;  1M90 C;  2B63 H;  2R93 H;  3CW2 C;  1PA6 A;  1I3Q H;  4DNI A;  4X64 L;  4LF4 Q;  2KCM A;  2A19 A;  4Y7N H;  2ZJR A;  4AYB E;  5LMN W;  3PO2 H;  1L2F A;  3HFZ B;  3STB C;  1W3S A;  5FLX c;  3TS0 A;  1NY4 A;  2F52 A;  4JBK A;  1TXY A;  1CUK A;  1W2B A;  2VQF L;  1Q1E A;  2JA6 G;  4JI5 Q;  3PF4 A;  4DV3 L;  5GAH C;  3CME A;  4AQY L;  3EN2 A;  2FXQ A;  5E7N A;  1J6Q A;  4DV0 L;  3BU2 A;  3PV0 A;  3RLF A;  4BY7 G;  1E7Z A;  3J80 i;  1B8A A;  3ICE A;  3T1H Q;  3KJO A;  2YU9 H;  3KYH C;  3RNU A;  1MKH A;  1TWH H;  1HH2 P;  5M5X H;  3K80 C;  4A3G H;  4LWC A;  1XPU A;  4LFB Q;  1H95 A;  4NPS A;  3GTM H;  4IJH A;  1UE5 A;  2BH8 A;  4C3I H;  3STB D;  2R7D A;  4PZ6 A;  4LF9 Q;  1AH9 A;  2R92 H;  3MEF A;  1UE1 A;  4DV2 Q;  1YNX A;  3CPF A;  2VZA A;  4OXP A;  4LF6 Q;  5IYD H;  1KAW A;  1PH1 A;  3CC7 A;  3J81 j;  1UWV A;  4PMW A;  3HOY G;  3CMA A;  2NVQ H;  1JT8 A;  3AEV A;  2K14 A;  4MTN A;  4UY8 C;  3AFP A;  1EUJ A;  3UDF A;  4OX9 Q;  1N34 Q;  1QUQ A;  3B6Y A;  4GKK L;  1MIU A;  2IHE A;  5IP9 H;  1X54 A;  2IY5 B;  4JOI A;  4JI1 Q;  4X65 L;  4UP7 A;  1B70 B;  2OTJ A;  4B3T Q;  4YWL A;  4HJ7 A;  4LF5 L;  5IP9 G;  3RR5 A;  3NEN A;  3GTQ H;  1WOC A;  1IXR A;  4DV1 Q;  2CKZ B;  2HIX A;  3MXN B;  2ZM6 Q;  3JAM c;  1N33 L;  3HKZ E;  5C44 H;  2VY3 A;  3HOW H;  4BY1 H;  1A63 A;  2KCT A;  3K0X A;  1MJC A;  1VCI A;  2VNU D;  3PSI A;  2K52 A;  3K81 C;  2ZTD A;  3GTP H;  4A3B G;  1P16 A;  1FL0 A;  2PI2 A;  2Y0S G;  5BR8 L;  1JMC A;  2JK8 A;  5GAE C;  4ME3 A;  3AFQ A;  4A3J H;  1NJI C;  1VQM A;  2YYZ A;  5C4X G;  1GKH A;  1NTG A;  4APV A;  1G51 A;  4LF8 Q;  4A3B H;  2JEA I;  1GO3 E;  5IT9 c;  3CCM A;  2RHS B;  5M3F H;  2R93 G;  3L7Z C;  3G4S A;  1C0A A;  4PZ8 A;  2K50 A;  1X55 A;  2DGY A;  3S1M H;  2EQS A;  4R4T A;  3K7A H;  1A8V A;  4LF8 L;  1ASZ A;  3M85 A;  4DUY Q;  3GD7 A;  1PYB A;  3PUZ A;  2NVX H;  1XNQ Q;  4BA1 I;  3E9H A;  3PCO B;  5FLM H;  3VDY A;  4POG A;  1NMF A;  2Z0S A;  2IHF A;  3HOU G;  3CCS A;  2MO0 A;  4DV3 Q;  2UUB L;  1VQP A;  4GKK Q;  1VQD A;  4L5R C;  4IPH A;  3EBE A;  4DV0 Q;  1WI5 A; 
#chains in the Genus database with same CATH topology
 4EGJ A;  1EYD A;  3VYT A;  2NVT H;  1YHA A;  2FK3 A;  4UAI A;  1Q12 A;  3MVV A;  3FEW X;  3NQI A;  4HMI A;  1N36 L;  4O3Q A;  1RJP A;  2WTF A;  1IBK Q;  1FJG Q;  3GIP A;  1QVG A;  1K9M C;  1CKN B;  3Q0A A;  2XIW A;  4YWM A;  2QDL A;  2PW7 A;  4FXK C;  1HNX H;  3ULL A;  3A8I E;  3NWS A;  4K8I A;  5LMU H;  4LAA A;  4H7B A;  3AU7 A;  4MV6 A;  4B3S H;  5DM6 3;  1M0T A;  3RBE A;  4DR6 Q;  3KHL A;  4O3N A;  2AQ1 B;  3AYH B;  4UPA A;  4ODG A;  2JQO A;  2Z6K C;  2DUD A;  2O5I C;  2AUK A;  2W8L A;  2NN6 H;  4GKK H;  3PUV A;  2F0H A;  1T94 A;  1U4R A;  4LFA L;  1FNU A;  4GLX A;  1FVI A;  3J81 c;  1HXY D;  1Q46 A;  1SR3 A;  1WTX A;  1QJO A;  1WTH A;  1J5E H;  1ZKO A;  2PCF B;  4A3I H;  1DD2 A;  1STH A;  2E2J H;  1TWG A;  2EY1 A;  3BZC A;  1JWS D;  1Y8N B;  3RN5 A;  4E4T A;  4BY1 B;  4JI8 Q;  1JB3 A;  4ECU A;  1Q7Y C;  4QQB X;  1XNQ H;  4RGM A;  1NE3 A;  2Z6K A;  3QO2 A;  2XSC A;  3BDC A;  2OT2 A;  2HHH H;  2BDO A;  3IFD A;  5M5W B;  3WO0 A;  1HNZ H;  2NZH A;  1PZI D;  3I91 A;  4X3U A;  1N8R C;  4QB4 A;  3HOW G;  5I47 A;  4K6D A;  1VQJ A;  1BNZ A;  4HAE A;  2PW5 A;  1XTC D;  3SK6 A;  4MTD A;  3UDX A;  3U4Z A;  5LOV F;  2PQA A;  1Q8K A;  2VA2 A;  1YBY A;  4JG2 A;  2JXM B;  1OTC A;  1I4X A;  4DR5 H;  4RNN A;  2NUA B;  4C3H G;  1CZG A;  5KG2 A;  3GV7 B;  1YNN C;  1RJR A;  1QUQ B;  4V0B A;  2E5L Q;  4YR3 A;  4EG0 A;  3J7A K;  4A3G B;  4JUZ A;  1RTN A;  2H1E A;  3UFX B;  3NP8 A;  3GTK B;  1HA6 A;  1PRT D;  3N40 P;  4O2B F;  5A2Q L;  2UU9 L;  3CC4 A;  2K6A A;  1DYQ A;  2W9C B;  1X3E A;  4QWB A;  1VF5 C;  3H20 A;  3TII A;  2Z6B A;  1XNR Q;  4Q0Y A;  1LTT D;  2M9V A;  1LLR D;  5IYC H;  4MNO A;  3DM1 A;  3SK5 A;  5KG1 A;  4DV4 H;  1K83 A;  3G6J B;  4FP5 D;  2KEN A;  2ALY B;  2NWG A;  4H44 C;  2WAQ G;  4PV1 C;  4QUC A;  5IE8 A;  3S1N H;  2R8G A;  5BN3 A;  5M9O A;  1XWE A;  5CC4 A;  5KFL A;  3RFC A;  2K04 A;  4KY6 A;  5IGG A;  1JOO A;  3E5S A;  2UXD L;  2HVQ A;  3V4S A;  4NXM L;  1ENC A;  3FMC A;  1PVO A;  5IYD H;  3CHB D;  1Y1W G;  4R8N A;  4UDU C;  2AHO B;  2RDH A;  2RQX A;  2QGQ A;  2FMC A;  2KED A;  3EYY A;  1KJ8 A;  2A6E C;  1S5C D;  3TQY A;  4C1N I;  4I65 A;  2R82 A;  2VB3 X;  2A8V A;  5LP6 F;  1UAP A;  3DXJ C;  3J80 E;  3VPC A;  2GVB A;  2Z4I A;  1S5D D;  1GGO A;  5F9N A;  1IYJ B;  1SYG A;  2WB1 B;  5EPK A;  1HZC A;  3MTS A;  2JA5 B;  3S14 B;  5GAD C;  4A75 A;  1JR0 D;  1Y1V A;  1EQR A;  4O2A F;  1V43 A;  3SK8 A;  4DUZ Q;  5FLX L;  2PQA B;  1CA6 A;  1DZ1 A;  3GLK A;  5KT4 A;  3H94 A;  1TS2 A;  1JOQ A;  5LYJ F;  2F3V A;  4R8U A;  2B2U C;  3VPD A;  4HR7 A;  1KL9 A;  3PGZ A;  2DNC A;  2NVT B;  4DR3 L;  1Z6H A;  3ORR A;  1WTQ A;  1CFM A;  2OEO A;  4ZK9 B;  1JJG A;  3GIL A;  5DAU A;  1RDP D;  5HGT A;  3H0G G;  3OTO L;  3F8T A;  5COR A;  3VR6 A;  1TWF B;  3WOE A;  5HY6 A;  5DLG A;  2XRQ D;  2FLP A;  4GNX B;  1F9Q A;  2H5X A;  4I4T F;  5GON F;  3N43 B;  1CQJ B;  2GPS A;  1JE4 A;  1FD7 D;  2R7Z G;  2VQD A;  5IP7 H;  1N48 A;  1KRT A;  2UUA Q;  2OWO A;  4QUF A;  2LFN A;  1EU4 A;  5I9O A;  1VQ5 A;  4NB3 A;  2C22 A;  2MQH A;  1VQ4 A;  2KVM A;  2R8H A;  2X69 A;  2KCC A;  1V1Q A;  4K2L A;  2F03 A;  5EWE A;  4ED8 A;  1U4L A;  2VA3 A;  3PIO A;  4F4W A;  4R8U B;  5CBE E;  1AEX A;  3A5Z B;  4GLA C;  2L4N A;  4YR2 A;  5C44 B;  3C3L A;  1TS5 A;  1II3 A;  1CS0 A;  1PYW D;  3OUU A;  4IUR A;  2AWO A;  5EPJ A;  1TWA H;  2NBF A;  5FD6 A;  5FOB B;  2NU9 B;  2EYL A;  1PTO C;  5C4H A;  5EPL A;  4A3L H;  4ME5 A;  4HNV A;  1F9R A;  1Y8O B;  4Q45 A;  3EPI A;  2QEX A;  1BXT A;  3NEM A;  5FKA C;  4L5Q A;  3RB3 A;  2D2C C;  3L4J A;  4ED7 A;  1QOH A;  2OQ0 A;  2QYZ A;  2YCH A;  1SMX A;  4R9W A;  2CVR A;  1PDQ A;  2Q8I B;  1I4Q A;  2ZM6 H;  1TQO A;  1HNW L;  4DFA A;  3CQZ B;  1L1O A;  5M5X B;  4K0K Q;  1I5F A;  5IYD G;  2YU9 B;  1FGU A;  2YV5 A;  1X3G A;  2W7P A;  1VMC A;  3A55 A;  2GPW A;  4C3J B;  2B2V C;  2DN8 A;  3RLO A;  2WB1 E;  1Z9F A;  5AJ3 L;  4FXG C;  4EX5 A;  3JRX A;  3KBX A;  4UCR A;  3RTX A;  2UVW A;  4DR4 Q;  1T9H A;  5DQI A;  1SYF A;  2R7Z B;  4U68 A;  4ECV A;  1LT3 D;  5JJZ A;  2KEE A;  4B3R L;  3MWY W;  3BQ1 A;  2O4X A;  4L5S A;  2I5H A;  4XDX A;  3ERO A;  1K28 A;  1Z47 A;  2RGV A;  1VQ6 A;  1R4P B;  1I50 H;  2EE1 A;  3J7A 5;  3QIA A;  5LXT F;  4GS3 A;  4IWX A;  1PFM A;  2EY6 A;  4I7Z C;  4DR5 Q;  1SFO H;  1QB5 D;  3N8D A;  2C35 B;  5IGD A;  4IOC A;  1NAP A;  3PO3 H;  1HZA A;  1TS3 A;  4DV7 Q;  5IOC A;  4JI7 L;  1MD2 D;  2K05 A;  3FPU B;  3RAX A;  5ELN A;  1E4G T;  1H9R A;  1LYL A;  3NUC A;  1XTD A;  5CMD A;  1PH2 A;  2K75 A;  4NXN H;  1TWG H;  4PQX A;  2BCO A;  4BBR H;  2X6L A;  1HTL D;  4JI4 H;  2R7K A;  1SMY C;  1VQG A;  2UXC L;  1Y1W B;  4X6A H;  4LF9 L;  4KLK A;  2F0N A;  1WVL A;  2RDJ A;  1VQN A;  3T5K A;  3BQ2 A;  5DQG A;  1L1O B;  4DR1 H;  3ONA B;  4M8A A;  2MUY A;  5L1K A;  4A76 A;  2K03 A;  4LFC L;  2W6P A;  4ABN A;  1LT4 D;  4Y8V B;  5LMU Q;  4DR1 Q;  2YW2 A;  2UUC L;  3G7L A;  1EY7 A;  5C6A A;  1PH3 A;  1WYD A;  5M3M H;  1WTR A;  4X66 H;  5KYL A;  4JI0 H;  5KRU A;  4JPB W;  5C3E H;  1A6X A;  4B3T L;  3WNZ A;  1U4P A;  2Q8T A;  2FFK B;  3BAB A;  4B9X A;  4K8J A;  1QCB D;  2E75 C;  2EIF A;  3OW2 A;  1FR3 A;  4YAK B;  1EU3 A;  2L0C A;  2F0J A;  3ND8 A;  3KF6 A;  2A6H C;  1PH7 A;  2XCP A;  3GV5 B;  4JI6 L;  4U67 3;  1RYR A;  3FDT A;  4F4Z A;  1YIT A;  2XIG A;  4IRC A;  2YTX A;  3ER0 A;  5KT3 A;  1B44 D;  5KKN B;  1YHB A;  1M6V A;  1H9S B;  1QZH A;  2XNA C;  1ML0 D;  2JEF A;  1YNJ D;  1N32 H;  2VUG A;  5JOB A;  1EY6 A;  4F4X A;  1UE6 A;  4LF6 H;  3RZO H;  1KJQ A;  1IKM A;  3T51 B;  4LFB L;  2YZG A;  3QR8 A;  4EBD A;  1LTS D;  4OWX B;  1KXL A;  2PMZ A;  2EY2 A;  3PN1 A;  4A3D H;  2IJ0 A;  2JJQ A;  2VL6 A;  1EQV A;  4DN4 M;  1EY4 A;  2LXJ A;  4DL4 A;  3J80 c;  2R85 A;  4HCE A;  1SLJ A;  4DR2 H;  3QFF A;  1EWI A;  4MTK A;  2VQF H;  2EY5 A;  4XYQ A;  2ASB A;  5L37 A;  1ENF A;  3HEJ A;  3I2Z A;  4ME6 A;  2DLN A;  3K0Y A;  1OXS C;  1DOL A;  3U58 A;  5JEA J;  2B63 B;  4EBC A;  5IIF A;  3TS2 A;  1GVP A;  3R2I A;  3S14 H;  4ZQI A;  3RB4 A;  1K8G A;  2CW0 C;  3GDE A;  3HOX B;  4CDC C;  2Y0S B;  4LUO A;  4DV1 H;  4TVA B;  3PO3 B;  4YHH H;  4PNY A;  1ESF A;  1C9O A;  1EWH A;  3I4O A;  1F9S A;  2XGP A;  3RAQ A;  2B63 H;  1O80 A;  1EY9 A;  3CW2 C;  1PA6 A;  3QZ7 A;  1XYI A;  4X64 L;  1GUN A;  5JQW A;  4Y7N H;  2ZJR A;  2P0A A;  1K8M A;  4OGQ C;  5NUC A;  5KT7 A;  4Z9C B;  5EBD A;  5FLX E;  4JI5 Q;  1B3A A;  5L1L A;  1STA A;  4FM9 A;  4DV3 L;  5I9P A;  1RKN A;  4CGY B;  3UQ8 A;  5EKI A;  2EDG A;  2JA7 B;  5K2M A;  1B8A A;  1STY A;  3T1H Q;  4X64 H;  3KYH C;  2B39 A;  1MKH A;  2JSO A;  5M5X H;  1HH2 P;  3V96 A;  4LWC A;  2AGP A;  4KHV A;  1XNR H;  4C56 C;  3N6X A;  1HCZ A;  4PZ6 A;  4UCV A;  5BPH A;  3D6W A;  3E3X A;  3MR3 A;  4JV5 H;  3CC7 A;  3SR1 A;  5IGE A;  5KFZ A;  1JT8 A;  2NVQ H;  3R23 A;  4MTN A;  1AP0 A;  3UDF A;  2R3Z A;  4OX9 Q;  3B6Y A;  3QJY A;  2XCL A;  4DL6 A;  1XMO H;  1Y1V B;  1X54 A;  2NYZ D;  5DGB A;  4XQQ A;  2OTJ A;  1PTO H;  3QOL A;  5L1I A;  2F0Q A;  2RSN A;  5C3E B;  5KFT A;  5IP9 G;  3GTQ H;  1MHW C;  1WOC A;  5M3M B;  3KLR A;  1SEI A;  5C44 H;  1AUV A;  1I6U A;  4BY1 H;  2KCT A;  2UXB H;  4LJZ C;  2E2D C;  3K0X A;  1DON A;  3PW7 A;  2K52 A;  5BMV F;  4A3I B;  4YP3 A;  1FL0 A;  4G3I A;  3R5X A;  3R5F A;  2YYZ A;  1GKH A;  2HDL A;  5T1G A;  4C3I B;  1G51 A;  1I7N A;  3T4A C;  1GSA A;  2JEA I;  4XX0 B;  5IT9 c;  3CCM A;  5M3F H;  2R93 G;  3G4S A;  2AQ4 A;  1GSH A;  4PZ8 A;  3MR2 A;  2HGS A;  2DGY A;  2IMW P;  3HBL A;  3K3V A;  1EFI D;  2F0O A;  3K7A H;  4CKC A;  5KEE A;  3NPP A;  3TP7 A;  5A35 A;  4LF8 L;  5ISR A;  4WBN F;  5KYI A;  3SE0 A;  3M85 A;  3GD7 A;  4DUY Q;  1CI3 M;  5K36 H;  2XWJ B;  2R84 A;  3E9H A;  3DEP A;  5FLM H;  4N9T A;  4POG A;  1NMF A;  3DMU A;  3FDS A;  2ASD A;  1MSH A;  2KQ3 A;  2HVS A;  2SEB D;  4FF2 A;  4B08 A;  1V51 A;  2UUB L;  4GKK Q;  1VQP A;  4X62 H;  2VPQ A;  3OOC A;  1U4M A;  3I70 A;  4HSV A;  5L1J A;  4YBZ B;  4UP9 A;  1O78 A;  2QDB A;  4IFD I;  1N36 Q;  3N44 B;  1B50 A;  1QE6 A;  4DR3 Q;  2EJM A;  3H4D A;  2PBZ A;  1B2T A;  3OUZ A;  5I6W A;  4DV7 H;  1XXG A;  1PH4 A;  3N52 A;  3CPW A;  5KG3 A;  4OON A;  1EIH A;  4LFC H;  2HQE A;  1RD9 D;  3BJU A;  1E22 A;  1W6K A;  4HQ6 A;  3MFY A;  4IAL A;  1HUM A;  2HHH Q;  2R7F A;  2IX3 A;  1KD1 C;  1AN7 A;  5DG7 A;  1MGS A;  3VPB A;  2HIV A;  2AWN A;  2OCE A;  3RZD H;  4LH7 A;  4DPG A;  2NB0 A;  3OIP A;  3GTK A;  2HCC A;  4GOP B;  2W57 A;  3K58 A;  2K5N A;  3S1N B;  4JI8 H;  3J81 E;  5CV5 A;  3HKS A;  3RD4 A;  1SDF A;  2FB9 A;  4A3I G;  1J9O A;  3GIK A;  4A3B B;  4JI8 L;  1RIP A;  4GNX C;  3NBH A;  1A3T A;  1I94 Q;  3FRP B;  3F2C A;  2DPI A;  2N8N A;  3RGZ A;  2VQE H;  4K2K A;  3GTP A;  3P1H A;  3I56 A;  3I90 A;  1MZB A;  4BBS G;  5KFA A;  1SE8 A;  4NW2 A;  1YNN D;  5C4X H;  1IBL H;  4AQY Q;  4DUY H;  2F0I A;  1I3Q A;  4P73 A;  4DUZ L;  1Q86 C;  1H9M A;  4IPC A;  1QZG A;  3CCQ A;  3VR4 A;  3F2D A;  4RNO A;  5KFU A;  2F4I A;  3G6E A;  4WJ4 A;  3T5J A;  1WCM G;  4H13 C;  5C44 G;  2FKL A;  3D4W A;  1PFS A;  2MFI A;  4B9W A;  4AYB B;  1DOM A;  1BVS A;  4KHP L;  2D62 A;  1I6H B;  4JOI C;  3J7A V;  1G8Z D;  3ZJY C;  5K5P A;  2FLL A;  2F0G A;  4O3S A;  4DV2 L;  4JI1 H;  4YQW A;  3J81 L;  1BNC A;  4DNT B;  1HNW Q;  1M7J A;  4FU0 A;  2OH2 A;  1STN A;  4IUQ A;  4K0K L;  1JKJ B;  4XTC S;  1JXL A;  1HNW H;  4X65 H;  4C3H H;  3DM3 A;  2LS0 1;  3VA7 A;  3CD6 A;  2EOT A;  1DCZ A;  4ECW A;  2Q2I A;  1Y1W A;  4MIU A;  4DK1 A;  5IYC G;  3HOU H;  5ELB A;  4GLV B;  4MA5 A;  2E2H A;  5IWA Q;  1HR0 Q;  4Q8F A;  1BCP B;  1I4H A;  4B3R Q;  1EUD B;  1NNX A;  3TP8 A;  2YTV A;  3UDI A;  5CAE B;  4ZQ3 A;  4ZRZ A;  1TWF H;  4TV8 F;  2K4K A;  5LL6 S;  3K57 A;  2UXD Q;  4AYB A;  5BR8 Q;  4A3M H;  1RCV D;  3I4M B;  2ATL A;  3G6V A;  5IYB H;  5BR8 H;  2BDN A;  1I3Q B;  4GOP C;  2F4V Q;  1BXR A;  2NN6 G;  1U0L A;  3SI8 A;  4JI7 Q;  1VDZ A;  1CKN A;  1JIH A;  5ELD A;  3J7Z C;  2YZN A;  5IOD A;  3TSS A;  1PYS B;  3AMU A;  4R4O A;  3TZU A;  3UDG A;  1AE3 A;  2ES2 A;  2KBN A;  2CH4 A;  4XQJ A;  1X9N A;  1E3P A;  4O4H F;  3P7J A;  4CDE C;  5EZY F;  5I2Y A;  4DR7 L;  2SDF A;  5KG6 A;  3Q8P B;  4EQN A;  2Z1C A;  2BQ3 A;  3M4Q A;  4JV5 L;  3A0J A;  2R6F A;  4I7A A;  4J9N A;  3BS1 A;  1TT2 A;  2GN5 A;  1CQF A;  4HN7 A;  4RG1 A;  3KUP A;  2Y0S A;  4I7H A;  3I4N H;  5KT2 A;  4RAY A;  4O1N A;  1K0R A;  4RB0 A;  4DR4 L;  3DWQ A;  4DR1 L;  2B3G A;  1WTV A;  4N9P A;  3H0G B;  5LMN Q;  4ZAI A;  3K5L A;  4CDF C;  3MXN A;  1VQ8 A;  1ZYR D;  4QY7 A;  3BJY A;  4HJ8 A;  5KG0 A;  1IBL Q;  3SGI A;  5IY0 A;  2C28 A;  3I8Z A;  1PHJ A;  3NBH B;  1ZXT A;  2ICI A;  4TUY F;  3Q8Q B;  5C4J H;  1Q90 A;  3PO3 G;  1GSO A;  2GVA A;  1KTK A;  4IO9 A;  3ERS X;  1EIY B;  3M4O B;  3V6H A;  2A1A A;  5CBA E;  4JI1 L;  5K36 G;  3I12 A;  3Q8R B;  4O0A A;  1BBW A;  4DV2 H;  5FLM G;  2RBM A;  1EZ6 A;  4RB2 C;  1IW7 D;  3W3A A;  2PI2 E;  1VQC A;  3FKI G;  4DV1 L;  1Q81 C;  4GN5 A;  3KLS A;  2QK4 A;  4IFD G;  2KOL A;  3HRZ C;  5JJK A;  1KJJ A;  3ULJ A;  3LWU A;  4DV6 Q;  4A3K H;  1K1S A;  1E0B A;  4H0L C;  4C5C A;  2R92 A;  2UXB Q;  3K8A A;  1S4Z A;  1V1O A;  4RZQ A;  2B2T C;  4PZ7 A;  4RNM A;  2AQ2 B;  3H6M A;  4KN4 C;  4LFC Q;  2FJZ A;  3GTO B;  2ZDH A;  3H09 A;  3GTL A;  4IUV A;  5KFW A;  4O4I F;  4QWE A;  1HFN A;  1F2Z A;  2QW7 A;  4RUA A;  1TWH B;  4R4I A;  2FIN B;  3S15 H;  1C7Y A;  3X3M A;  1PV4 A;  2J7Z A;  1D5Z C;  4X66 Q;  1SE2 A;  4X62 Q;  2ATW A;  1DJR D;  3NWT A;  3I4M G;  1AUX A;  2A6H D;  3M7G A;  2YS7 A;  3U9T A;  1RTO A;  3GV6 A;  2L5T A;  1I4R A;  2KHS A;  3HZX A;  3NTI A;  5KIX A;  1CA5 A;  3GTJ H;  1JLL B;  4U6P A;  5EWG A;  1EEF D;  4O42 A;  3CXC A;  4DA2 A;  1JWM D;  3WO1 A;  1V9P A;  2RDG A;  4IUP A;  4K14 A;  4HID A;  1K0S A;  2G5D A;  4TQS A;  2G9D A;  3RMH A;  4KMU C;  4DV7 L;  3A56 A;  1KC8 C;  1X3F A;  4A3C G;  5KFG A;  4AIM A;  2FMM A;  3TRZ A;  5BPF A;  1UE7 A;  1LTR D;  1VQ7 A;  1IBK H;  1FJG H;  1HZ9 A;  4DXF A;  3PMF A;  2KHJ A;  4JI5 L;  1G29 1;  3S16 H;  1STE A;  2RCN A;  4OIK A;  5DLQ E;  3PIP 3;  4NXN Q;  3LGJ A;  2I5M X;  3QOJ A;  1BF4 A;  2WYO A;  1XPR A;  4C5A A;  2E8G A;  2JEG A;  1B7Y B;  4DK6 C;  5KFR A;  4ED2 A;  2B2W A;  3TN2 A;  3PW2 A;  3F2B A;  4QL5 A;  2K1B A;  1L2Z A;  5KFP A;  3A54 A;  2YS6 A;  3C0F B;  3X3N A;  2XVS A;  2Q8R E;  4LF4 H;  3SEB A;  4A3M B;  2EYO A;  1LT5 D;  5M3F B;  3HOV B;  1KJI A;  3OMG A;  5LMU L;  3ZYY X;  1CE8 A;  1BCP F;  4OO1 G;  2RDF A;  4Q43 A;  5KND A;  4QMG A;  1EIF A;  1S0O A;  1IZ6 A;  4F88 A;  2IPK D;  2K28 A;  3G8C A;  4RA8 A;  5HGQ A;  4J9P A;  1EY5 A;  1PMR A;  5DNF A;  3M3Y H;  4GOP A;  2NU8 B;  4P71 A;  3M4Y A;  5C3E G;  4BXX G;  2OQK A;  4GKJ Q;  5KG5 A;  4A3E H;  1R9T H;  3MXG A;  4JW0 A;  3DLL A;  4DLK A;  3GTQ B;  4YIJ A;  4X64 Q;  5BN5 A;  4TKO B;  3S2H B;  2HT1 A;  4JI7 H;  4K5V A;  3RUZ A;  3A8K E;  4J8Q A;  5KFO A;  4K0K H;  1STB A;  2BA1 A;  4QIW B;  2E2I B;  1Y1V H;  1BQQ T;  1WTW A;  4H02 A;  5EGT A;  4A3G G;  3GIQ A;  3L2P A;  2EVB A;  1PH5 A;  3T16 A;  2YRW A;  5FJ8 G;  2FPG B;  3KLS X;  3A5U A;  3MC0 B;  1SNC A;  5G3L D;  1JQY D;  1D2B A;  4IAJ A;  1A62 A;  3CAM A;  4RUC A;  3V6J A;  4KHP H;  3QZ8 A;  1JX4 A;  4PMC A;  1I6H H;  4JI2 Q;  4LF6 Q;  1B1Z A;  5JH7 F;  3HS0 C;  4FXD A;  2R87 A;  4I50 F;  1A0I A;  1SSO A;  1N32 Q;  1X3Q A;  2F0T A;  3CKI B;  3S1Q B;  3BA8 A;  1IL2 A;  3J80 L;  4JBJ A;  4CJ1 B;  2JA7 G;  4DUY L;  2FLN A;  4RGN A;  5EKK A;  5JEA H;  1AZP A;  5C4X B;  2N88 A;  3OIQ A;  1VS0 A;  3UI2 A;  1LTI D;  1CHP D;  1LAB A;  2KHI A;  2I87 A;  1NSN S;  3MAQ A;  1EOT A;  3T13 A;  4BBS B;  4A4I A;  2SOB A;  4EFB A;  2XC9 A;  2JYO A;  2VW9 A;  1ET9 A;  1JDE A;  2RDI A;  3TP6 A;  4OIJ A;  4CDD C;  1EL0 A;  1PX2 A;  2EXD A;  2A73 B;  4CKB A;  4QJF A;  1BR9 A;  4F7X A;  4IQZ A;  4FVM A;  3H3V C;  4ED6 A;  5M5Y H;  4S3S A;  3D4D A;  4IFD J;  3GTQ A;  1SE4 A;  1IOW A;  2AMC B;  3TIG A;  1E2V A;  5DG8 A;  4MA0 A;  1N56 A;  4QIW A;  1K83 H;  5EQ0 A;  5E3F A;  5C3W A;  2BA0 A;  2F0P A;  4IZ8 A;  3HOX H;  1JOR A;  4RB1 A;  1OXX K;  1DGS A;  2DJG C;  3RIZ A;  1WFQ A;  4JC0 A;  4ZCK A;  1JJ2 A;  5CGK A;  3A74 A;  2R93 H;  3OTO Q;  1JC7 A;  4DNI A;  1EZ8 A;  2WV6 D;  3KF8 A;  3RB0 A;  4LF4 Q;  3PQI A;  3JAM L;  5LMN W;  4MTE A;  3HFZ B;  3TS0 A;  3KTM A;  5FLX c;  1JDB B;  2MCT A;  1W2B A;  2DY8 A;  2VQF L;  2JA6 G;  5EDW A;  1BCP C;  5KFB A;  2KUM A;  4EGV A;  5FPO A;  5GAH C;  1TWC A;  1H9J A;  3N42 B;  4CHT B;  1LTG D;  4AQY L;  5E7N A;  2XD4 A;  3OPO A;  3BU2 A;  5JVL A;  3JZI A;  1V8Q A;  2OLS A;  1SNQ A;  3RNU A;  4M9U A;  2K7V A;  1XPU A;  1H95 A;  4NPS A;  2VUM B;  1UE5 A;  2BH8 A;  3GIJ A;  2C5C A;  1GHK A;  4DR3 H;  1EY8 A;  4A3J B;  2R92 H;  1U9R A;  1UE1 A;  2A69 C;  4DV2 Q;  3CPF A;  4OXP A;  3SDZ A;  5A2Q E;  3TQT A;  4AQY H;  1UWV A;  2HCI A;  2QIL A;  5HBR B;  3CMA A;  1WCM B;  2B2W C;  3HKZ B;  2K14 A;  5IT9 W;  4UY8 C;  2JEI A;  2KA7 A;  2FPI B;  1N34 Q;  2Z4H A;  1UNS A;  4RZR A;  1A3U A;  4JOI A;  2WB1 A;  4XZ3 B;  4UP7 A;  1B70 B;  4F4Y A;  4DU9 A;  3KHH A;  2W9B B;  3GTO A;  2CKZ B;  5KGU A;  2ZXR A;  3HKZ E;  2VY3 A;  3HOW H;  4ID6 A;  2I46 A;  1A9X A;  3IKJ A;  2ZTD A;  3RJ0 A;  1P16 A;  5BR8 L;  2PI2 A;  5C4X G;  5DGA A;  5GAE C;  4ME3 A;  3AFQ A;  4A3J H;  2R92 B;  1VQM A;  5IT9 E;  4IR1 A;  4M7E A;  2BE5 C;  1KAA A;  3H0G A;  4LF8 Q;  2IA6 A;  4IN3 A;  3LNN A;  4Q8E A;  1TVX A;  5HV6 A;  4DV6 H;  1MI2 A;  2ENB A;  1VKZ A;  2V59 A;  2VOB A;  4XQN A;  2JN4 A;  3OHX C;  5IGF A;  1XNQ Q;  1IOV A;  1WH2 A;  4MV7 A;  4CC6 A;  1PXU A;  4FBT A;  3C1E A;  1AZQ A;  2Z0S A;  1SNM A;  5DG9 A;  3MHB A;  2J6T A;  3CCS A;  3GV3 A;  4IZO A;  4L5R C;  5KNB A;  1KNE A;  1KLU D;  3OSN A;  4G7O C;  5KFQ A;  3S9W A;  3CRL C;  4RAU C;  3NTK A;  5KFY A;  2JEJ A;  1CSP A;  2OF1 A;  1WSC A;  2IBK A;  3L9A X;  4Y7N B;  1ASY A;  5C8Y F;  1WD0 A;  4RGO S;  2QEJ C;  1EEI D;  1O7L A;  1JJC B;  4CJ0 B;  3Q24 A;  3D31 A;  2VB2 X;  1B6S A;  4YY3 Q;  2ZDG A;  5JVD F;  3T1Y H;  1T3N A;  2XRS D;  3V2T A;  2PNR C;  2HHH L;  1C3O A;  5D1P A;  2NTT A;  3HGB A;  2D9U A;  3L0O A;  2J6U A;  2FP4 B;  4FDB A;  3KJP A;  4B3S Q;  2IL8 A;  2MJ8 A;  1GJX A;  1M4V A;  5E4W C;  5J3B A;  4B3R H;  3LWE A;  1E1O A;  3A7L A;  3IL8 A;  1QNU A;  1HNX Q;  2RF4 A;  2RA4 A;  4A3M G;  3T1Y L;  5HUR A;  1TS4 A;  2K5H A;  1MJE A;  2W6M A;  3GTG H;  4OWW B;  1IBL L;  2BR0 A;  3HP3 A;  4AYB G;  3M9M B;  3U9O A;  3UE0 A;  4DR2 L;  2UUC Q;  4FYD A;  1GUT A;  4UFZ A;  4O2D A;  3OWE B;  2NN6 I;  1LM0 A;  1D7Q A;  4LMY A;  1K1Q A;  1W6J A;  1GXD C;  3ETJ A;  5FO7 B;  5FLX W;  4APM A;  1SJE D;  2MPM A;  3VMM A;  5KFK A;  2NUC A;  4A3D B;  1YI2 A;  3H91 A;  2IP4 A;  2JEB I;  2HQL A;  4RWS C;  2JA7 A;  4JV5 Q;  4DV6 L;  2LSS A;  3KOJ A;  4L8J A;  5IP7 G;  4JI6 Q;  2W6O A;  4TV9 F;  2ZTC A;  4KHP Q;  3RZO B;  5M3F G;  4LSX A;  4YY3 H;  3HKZ G;  4UCU A;  4RB3 C;  1B9N A;  3D0F A;  4QW9 A;  1YIJ A;  3NEL A;  4A2A A;  1WCM H;  1DOK A;  2J4X A;  4DK3 C;  3PUY A;  1SYD A;  4LMQ D;  4JI6 H;  1UNN C;  4KY7 A;  2VUM G;  1HPC A;  2E5L H;  3FPP A;  4WOR A;  1D1I A;  2W9C A;  4JI3 L;  3MZ5 A;  1S9F A;  2QKI C;  5FPR A;  1RK6 A;  2CHB D;  1JCK B;  2K33 A;  2HDM A;  4X66 L;  2RHQ B;  3E0E A;  3FHW A;  4X62 L;  4X65 Q;  1HJP A;  1S5B D;  4GZY C;  1UC8 A;  1GUO A;  4OHJ A;  3HOZ B;  2PNH A;  3W2D A;  2KSW A;  3BAA A;  2IW3 A;  2GLT A;  4MAM A;  4MV9 A;  4KY5 A;  4B3M Q;  2AQ3 B;  3FP9 A;  4QIW E;  3M3Y B;  5C5J A;  2JA6 H;  1Q8I A;  4LNQ A;  4L6T B;  5M3M G;  1SRO A;  5KFC A;  2O5J C;  5IYB G;  2DZD A;  1A2U A;  1EYZ A;  2ZTE A;  3TQ1 A;  2CWP A;  2CH4 W;  2WIN B;  3MWD A;  5C1P A;  4A3K G;  3PO2 B;  3CVZ A;  4BY7 H;  4EQ5 A;  4YJ3 F;  4P2C B;  4EEY A;  1PFN A;  2UXB L;  1PTO D;  4HMJ A;  4NXN L;  5EKL A;  5C0X I;  1VAJ A;  4DR7 Q;  4DNR B;  2SCU B;  3IFT A;  1N34 H;  1KC7 A;  3S2D H;  1EZ1 A;  3KF8 B;  2RVL A;  3HG9 A;  1XMO L;  1HTP A;  2FHT A;  2F0U A;  2N78 A;  5DM7 3;  1VQI A;  1CQI B;  1E4E A;  2JA6 A;  2WKD A;  3KHR A;  3TBI B;  1EYG A;  1KEE A;  3EQL C;  3E0J A;  3VR3 A;  2YU9 A;  4LF7 H;  3NHH A;  3URY A;  3HB9 A;  5LMN L;  4C2M A;  3T1H L;  3RUP A;  3MXP A;  2ZT9 C;  4KD4 A;  4EFE A;  3MWM A;  1YHQ A;  5I2X A;  3O13 A;  5CA0 F;  1HNZ Q;  1IBM Q;  2NVY A;  1N33 H;  3LX0 A;  4F87 A;  4QF4 A;  4A3J G;  4KKS A;  4NKL A;  4KJO A;  4YR0 A;  2UU9 H;  4LF5 H;  2VUM A;  1SYX B;  4L63 B;  5C5L A;  4J15 A;  4RGT A;  3G71 A;  1UEA B;  4QGU A;  4LF7 Q;  3S1Q H;  1TU2 B;  4NP5 A;  3PIP A;  2I0Q A;  2PO4 A;  4F8M A;  4YWK A;  5T1I A;  4DV5 L;  1XMQ L;  3ORQ A;  2HVR A;  2F0L A;  2Q2T A;  3K7U C;  2ZJP A;  1AW7 A;  3HKZ A;  3JRW A;  1I50 A;  3GTO H;  3KAJ A;  4A93 G;  2CW8 A;  4JI0 Q;  2CQO A;  1RYS A;  2EPB A;  3HOW B;  3OW7 A;  2EYH A;  1PRT F;  2CW7 A;  1X3P A;  5JJI A;  1TR5 A;  1FYC A;  3GIM A;  4KKU A;  3MR5 A;  2TMP A;  4RH6 A;  3IRB A;  1E2W A;  5M5W H;  4A3K B;  1TKW B;  3PO2 G;  1TWA B;  3J80 W;  4YHH L;  4ZYS A;  2ZJQ A;  3FKI A;  3DWP A;  3I55 A;  1DV1 A;  3W5O A;  2YRX A;  3V6K A;  3JAM i;  4ECZ A;  5C0X H;  4A3E B;  5CV4 A;  4DR7 H;  1I6V C;  4PMB A;  2FPP B;  5AFW A;  3M4O H;  1KRS A;  1W96 A;  3F2U A;  1L1O C;  1QG7 A;  4YCU A;  4EVO A;  1VQA A;  3WWV A;  1B9M A;  2F0S A;  1GM5 A;  5FO8 B;  1QVC A;  1VBG A;  3M9B A;  4EQP A;  4LSA A;  4LUV A;  1VF7 A;  3KFU A;  4LW1 A;  4GC6 A;  4I55 F;  4DAY B;  1X32 A;  2MGS A;  1VQ9 A;  4XT3 B;  5KFI A;  3VR5 A;  1H9K A;  2BQU A;  1TWC H;  2UUB Q;  1CTM A;  4GKK L;  2W8K A;  3UE1 A;  5EWF A;  4N8F A;  3AB9 A;  1TWA A;  3KBG A;  2D0P A;  3PUW A;  2WP8 J;  4FBU A;  1ILP A;  4HJ9 A;  4R8I A;  4EYI B;  3T53 B;  3F1Z A;  4LF6 L;  2F0K A;  2EJF C;  3LP8 A;  2PZT A;  5KT5 A;  1S5F D;  3S16 B;  3BG5 A;  3HOZ G;  4LF4 L;  1GOZ A;  3J81 i;  1N32 L;  1WTP A;  3OSO A;  2A68 C;  1KIX A;  2K5D A;  3BVG A;  1A15 A;  2A6E D;  3KDF A;  1CQV A;  1TY0 A;  3I4L A;  2E74 C;  3Q8D A;  4IUU A;  3H4B A;  4IUN A;  3RV4 A;  5JPM C;  4G7H C;  3TME A;  4JYA L;  3ULP A;  1UEB A;  4KHZ A;  3GTJ B;  1B53 A;  2MHV A;  1X56 A;  1IW7 C;  4JV2 A;  1BCP D;  2B2U A;  4B3T H;  3KXY T;  3W1G A;  4JI5 H;  5BN4 A;  1IBK L;  1FJG L;  2W7O A;  4K5X A;  4X3T A;  5M5Y B;  2M05 A;  4ECX A;  1I94 L;  1TA8 A;  5JVH 3;  3ETH A;  3Q6S A;  1UUP A;  4HJ5 A;  3GII A;  2PPB C;  2WE6 A;  1HR0 H;  1BUV T;  3M4I A;  3OMC A;  4DAY A;  1HA5 A;  5KFN A;  4WJ3 M;  5H1S E;  4DUZ H;  5A2Q W;  1SEB D;  2ZXO A;  4A3E G;  3IN5 A;  3RN2 A;  5L9X A;  4LF9 H;  3MXU A;  2VQE L;  2A69 D;  1K8A C;  4J9Q A;  1ZQ7 A;  2UXC H;  1Z2N X;  3TDQ A;  1PH6 A;  3M9O B;  2JA8 B;  4C5B A;  3GTK H;  4BA2 I;  1Y1V G;  2AUJ D;  3CQZ A;  1KDA A;  4ECR A;  3VR2 A;  2DWC A;  5C0X G;  3BZD B;  3HOY B;  1SYB A;  2L12 A;  1ZET A;  2QCP X;  2VQF Q;  2D0O A;  4O3R A;  1L0Y B;  4QW8 A;  2B29 A;  2R7L A;  5JVG 3;  2L9H A;  1DIK A;  4DV4 Q;  4ALP A;  2V1C C;  2CQY A;  2CCZ A;  2R6G A;  1VQH A;  3GO5 A;  1CKO A;  3PZP A;  4ZOL F;  3HOY H;  4JBM A;  4E6I A;  3GTL H;  1FNV A;  1TWH A;  1HR0 L;  1HQR D;  1VBH A;  2CFM A;  4CBV A;  3S2H H;  2VPS A;  1XNQ L;  4JI4 Q;  1ONL A;  2F1M A;  1B6R A;  3NBI A;  1CZW A;  2JA8 H;  2R92 G;  4A3C H;  2C2D A;  1A2T A;  3FVQ A;  1X65 A;  1H9S A;  5JEA G;  4RU9 A;  1WD1 A;  2ASL A;  3H0G H;  1B04 A;  2KCN A;  4JCV E;  1J5E L;  3K5N A;  4ZKC B;  4L5T A;  4BY1 G;  2CZG A;  3MWE A;  5D8D A;  2UU9 Q;  1EHI A;  4KJN A;  2Y0S E;  3HOV H;  4ZUJ A;  2W70 A;  4OL7 A;  4P75 A;  3PF5 A;  3M4P A;  4JV1 A;  1W93 A;  5EOY A;  2N55 A;  3OSP A;  2PYK A;  2WB1 G;  2I5L X;  3FMA A;  4A3F G;  4B3S L;  1AE2 A;  1K73 C;  2VR1 A;  1KHI A;  4XYO A;  1Y8P B;  2K5V A;  3EPG A;  2K5Q A;  1HNX L;  5IT9 L;  4MV1 A;  4DR4 H;  3CCJ A;  4R4Q A;  1V1P A;  3DUZ A;  2LKV A;  2X6G A;  2NZO A;  3BYT B;  2B2Y A;  2NVY H;  1M90 C;  4P74 A;  1G6Z A;  5H80 A;  3PVX A;  4O4L F;  1I3Q H;  3I72 A;  2K32 A;  3QG1 A;  3QWN A;  2HD3 A;  1F2M A;  3D8G A;  1BBX C;  5CA1 F;  4C2M B;  4J0M A;  3V05 A;  3PO2 H;  1KDB A;  1L2F A;  3STB C;  5DEH A;  2F52 A;  5KFJ A;  4GC7 A;  3VYR A;  2Z8L A;  2AGQ A;  3Q2O A;  1Q1E A;  2F0M A;  4IWY A;  2JA6 B;  4X3S A;  5IYZ F;  3CME A;  3EN2 A;  2FXQ A;  3PV0 A;  3RLF A;  4JV0 A;  1CHQ D;  4ECS A;  3J80 i;  1L0X B;  4CJ2 C;  5JAV A;  3KJO A;  4K5W A;  2J9G A;  4ED3 A;  1TWC B;  3K7A B;  2QF7 A;  1ESR A;  1GUW A;  1SJH D;  4C3H B;  4N8X 1;  3GTL B;  4IJH A;  3RGX A;  3PW0 A;  4RCN A;  4C3I H;  2R7D A;  1O7Z A;  1AH9 A;  2UVU A;  2KJX A;  4Q5V A;  4RKB A;  1KAW A;  1RHP A;  1PH1 A;  1EYC A;  2EYJ A;  1S0M A;  3HOY G;  1FKA H;  2MP1 A;  3AEV A;  4DV3 H;  2ZDQ A;  4XXE A;  2PZW A;  4ILW A;  1EUJ A;  3N41 B;  4J9R A;  1QUQ A;  2W6Q A;  3WOF A;  3CRK C;  5F9L A;  2EZV A;  4K6L A;  1PTO B;  2IHE A;  4X65 L;  3PW5 A;  1PRT C;  1XX8 A;  2WAQ B;  2OXP A;  4RKL A;  4HJ7 A;  4LF5 L;  1IXR A;  3N6R A;  2ZM6 Q;  3SVM A;  4OEM B;  1N33 L;  1Q3L A;  1Y69 U;  1HQM C;  3BVZ A;  3SXH A;  4JK1 C;  2EYF A;  3VYS A;  3PSI A;  4A3B G;  3K81 C;  1SNP A;  2Y0S G;  2JK8 A;  2K5W A;  5F2D A;  2FK1 A;  3OHB A;  1NTG A;  3DEO A;  4APV A;  3RF2 A;  3J81 W;  3T1H H;  2EXZ A;  5C4J B;  3GTM B;  5LMN H;  1SYC A;  1GO3 E;  5IGB A;  3MR6 A;  4J9L A;  3ITP A;  4ZLT F;  2K50 A;  1X55 A;  2WII B;  3QB3 A;  3S1M H;  3MFI A;  1PLF A;  1JWU D;  2IWH A;  2V4R A;  1A8V A;  3OHA A;  1AFP A;  4V19 0;  1PYB A;  2KEC A;  2TSS A;  3GQB A;  3PUZ A;  1PFB A;  5JPN C;  3E5N A;  4BA1 I;  5ELF A;  3PCO B;  4DAP A;  1O75 A;  5TSS A;  3BDO A;  3HOU G;  4IR9 A;  4IRK A;  3BDL A;  4DAV A;  2MO0 A;  4R7R A;  4J9O A;  2E76 C;  2AGO A;  1VQD A;  1KLG D;  3KK7 A;  2V58 A;  2K01 A;  4C1N K;  4DV0 Q;  1T5E A;  4DK0 A;  4LUZ A;  4JI3 Q;  3A7A B;  1BDO A;  2O2L D;  1GLV A;  2V5A A;  3KDF B;  5KFV A;  2D5D A;  2V4D A;  3C1F A;  1IKL A;  3CCU A;  4LFB H;  4POF A;  2F4V H;  2C2R A;  1KDC A;  3J7A F;  2UUA H;  3K59 A;  4J9M A;  4YCV A;  3T1Y Q;  4TSS A;  5KFE A;  2C00 A;  4B3M L;  2Q2U A;  1HNZ L;  1GUS A;  1SAP A;  1S68 A;  5C4Z A;  4OO1 I;  2MNA A;  3CF5 A;  3F8N A;  4NDX A;  1T36 A;  1S0N A;  2R7N A;  2NU6 B;  1I94 H;  1TY2 A;  1SYE A;  1LV9 A;  2PMZ B;  4A3F B;  3I4M H;  4DR6 L;  1TWF A;  4DV5 Q;  1XMQ Q;  4GKJ L;  1ZYR C;  3D6C A;  4JI3 H;  2JE6 I;  1R4Q B;  1STG A;  2ID0 A;  4JVZ A;  3I4N G;  4JI0 L;  1J8I A;  2JA8 G;  3SE7 A;  2UUB H;  1KQS A;  3P20 A;  1G6P A;  4O3P A;  4ED1 A;  4A3D G;  1ET6 A;  2IX0 A;  1CSQ A;  1M1K C;  4LF8 H;  5KX5 F;  2V4Q A;  5EBC A;  2XTI A;  1TII D;  1Z2O X;  3HOV G;  3EIV A;  1D6E C;  4UCO A;  4G7Z C;  2WKC A;  2MO1 A;  4JI2 L;  1E4F T;  1TAE A;  1F2L A;  5CV9 A;  5D65 A;  3S1R B;  4A2B A;  2NVQ B;  1SXT A;  3NXW A;  1S3O A;  4WFN 3;  1VQF A;  2E2H H;  4QWC A;  1IBM L;  4DF7 A;  1XJV A;  3TIN A;  1E4E B;  5CYU A;  1NR4 A;  4DL7 A;  3EFX D;  2VUM H;  4EBE A;  3FKI H;  1BO0 A;  2CW0 D;  4HYK A;  4IFD H;  3D3R A;  1U5K A;  4LH6 A;  1VQB A;  2BOS A;  4KI0 A;  1QNK A;  1D1K A;  3NGD A;  3JSN A;  5C3X A;  1D8L A;  3VYU A;  2NU7 B;  4KK7 A;  4MV3 A;  4RMF A;  4BXX H;  1ZHS A;  3K3P A;  1B3Q A;  3GTM A;  1HZB A;  4MZ9 A;  2YYA A;  1XNR L;  1LAC A;  3PW4 A;  2C9O A;  4IPG A;  2ZJT A;  3I3C A;  2F0W A;  2P5Z X;  4WJW A;  1BOS A;  1Y1W H;  1QWY A;  4MHE A;  3L4K A;  4ECY A;  5CB4 F;  3RZD B;  3T5L A;  5FJ8 H;  3GTG B;  2AKW B;  4G57 A;  3OYY A;  4LFA Q;  1ENA A;  1N9W A;  1T5X D;  5D14 A;  2R93 B;  2C2E A;  4IJL A;  3WDN A;  3W1B A;  3PUX A;  4JYA Q;  1RK5 A;  5D3D A;  3V4Z A;  3S2D B;  3KAL A;  1NUC A;  3S17 B;  2R8K A;  4J9K A;  2L11 A;  3S17 H;  5GAG C;  5J1Z A;  2PMZ E;  1JB7 A;  2FJ2 A;  1QIL A;  3PR5 B;  5CV7 A;  4QCL A;  4HCS A;  4FNF A;  5CV8 A;  3H3V I;  5GQO A;  3U50 C;  5I4D A;  1PH8 A;  2RKS A;  4BY7 B;  5LL6 b;  5G3L F;  4ZKB B;  2LY7 A;  1X6O A;  3TEH B;  1V1P B;  1F9P A;  4HIO A;  2BH2 A;  2WDT A;  3RV3 A;  4Q0F A;  2F3I A;  5E4X A;  4Y52 H;  4HJA A;  2R7Z H;  1SCU B;  4BBS H;  1S10 A;  1ZEQ X;  5KG4 A;  3HOZ H;  4LF7 L;  3ERQ A;  1LT6 D;  4C3J H;  4DGZ A;  1RJT A;  1B4O A;  3GV8 B;  1KAB A;  4PWQ A;  4CKE A;  5COY A;  1LTB D;  1YJN A;  2XGT A;  2J6S A;  1VQL A;  5CV6 A;  4M1U B;  5ELC A;  5FK9 C;  4A93 H;  5C0X J;  4DL5 A;  1IHZ A;  2G9H D;  3HOX G;  1N34 L;  1M0W A;  4MV8 A;  3RB6 A;  2W6Z A;  1FNW A;  2E2H B;  4OO1 H;  3T56 B;  4EYH B;  3RLN A;  3TP5 A;  5T14 A;  4YHH Q;  2WFW A;  1G2S A;  3R3O A;  1SFO A;  2R7M A;  4OX9 H;  1MBY A;  3TRE A;  3LML A;  2JA9 A;  4DAM A;  4DXG A;  3NK9 A;  5D1O A;  2OTL A;  1P8L A;  1G91 A;  2FMA A;  4JI2 H;  1E1T A;  2R86 A;  4U7C A;  4FS1 A;  1Q1B A;  1VQO A;  3C46 A;  5KFD A;  1JOK A;  3EJI A;  4PG3 A;  1PRT B;  1BBU A;  2QA4 A;  1K8O A;  3K5M A;  1O7I A;  4OX9 L;  5E1F A;  1R9T B;  2I80 A;  1SND A;  3KF6 B;  3NTH A;  1Q82 C;  1EUC B;  1AN8 A;  1YVC A;  5KFH A;  1GYF A;  4A3L G;  4IUT A;  5GRO A;  1JIC A;  1S03 G;  5KNC A;  3CCE A;  2R61 A;  3GP7 A;  3JSL A;  3BYY B;  4A93 B;  5IWA H;  1I4G A;  3NSW A;  4FF1 A;  3K5H A;  3J7Y W;  5D3I B;  4GKJ H;  1YJW A;  3H3V H;  1S40 A;  3KHG A;  4RHR A;  3KLW A;  5JJL A;  4JBW A;  1DM0 B;  4IOA A;  2FK2 A;  1LTL A;  2UXD H;  2E5L L;  3E9I A;  1NMG A;  4IRD A;  5J22 A;  2JA7 H;  1S5E D;  2B2T A;  5LA6 F;  3JAM E;  2UUC H;  1TWG B;  3M7N A;  2FE3 A;  1C30 A;  1HR0 W;  4J6H A;  4Q44 A;  4RFB A;  5LL6 X;  5EAY A;  1C4Q A;  3CCV A;  1ZHQ A;  4DV4 L;  3L3O C;  1LUZ A;  3OWF A;  2XGQ A;  4YY3 L;  2IT1 A;  3CP0 A;  1VMP A;  3AQQ A;  4HTH A;  3BVM A;  2UUA L;  3BG3 A;  4NMZ A;  5KFS A;  4TQR A;  4EEQ A;  1XDN A;  2V9W A;  1SFO B;  2WAC A;  4UP8 A;  1S97 A;  2W71 A;  2Q2H A;  4RCO A;  4JI4 L;  3D4R A;  2YZM A;  1K3R A;  1A3V A;  2CQA A;  3SHL A;  1XPO A;  1EY0 A;  4L1K A;  2JA5 H;  4NXM Q;  4XYM B;  4XIG S;  3BA9 A;  3K5I A;  1C48 A;  1Y14 B;  3MJF A;  4DR5 L;  4UCS A;  3R5H A;  1K83 B;  1NR2 A;  3EA6 A;  3E6Z X;  4C3J G;  1UC9 A;  4ETS A;  1GD7 A;  1EQQ A;  1OWT A;  4YCW A;  2L1B A;  4DR2 Q;  1V4Y A;  1BKB A;  1SRU A;  4KN7 C;  3CC2 A;  3A8J E;  1KJ9 A;  1EIG A;  4QWA A;  4HED A;  1B33 N;  3GTJ A;  1OXT A;  1IYU A;  1YJ9 A;  2RSO A;  3H15 A;  1O7Y A;  4BBR G;  4EQO A;  3S1M B;  4ZI7 F;  3CQZ H;  2WAQ A;  3T5H A;  4XT1 B;  2B8F A;  1WJJ A;  1F77 A;  4YAJ B;  2IX1 A;  4IPD A;  1JE5 A;  1I7L A;  1EWC A;  2VQE Q;  4NLG A;  2N3S A;  2LXK A;  3CCL A;  2NZ1 D;  1OO9 B;  1EOV A;  2L15 A;  1GUG A;  3BZK A;  4KV6 A;  3GQC A;  2E2I A;  2DJF C;  2XWB B;  2ZXP A;  2DPJ A;  4DKA C;  3JAM W;  2JA5 A;  4AH6 A;  1BGW A;  4J9S A;  1QVF A;  2LMC B;  1WTO A;  4ECT A;  3IG0 A;  1D5M C;  2A74 C;  4BS9 A;  1M8A A;  3U9S A;  4FF4 A;  4LFA H;  3MA2 B;  1I4P A;  1NBW A;  3FKI B;  4G4K A;  3S24 A;  4EGQ A;  2ZM6 L;  5J39 A;  1IL8 A;  4P72 A;  1IBM H;  4LK1 C;  3ND9 A;  1WR2 A;  2YTY A;  3G6Y A;  2N49 A;  4RHS A;  5AJ3 Q;  3I7F A;  4ULL A;  3PIO 3;  1OXU A;  2O03 A;  2WAQ E;  2GA4 B;  1EFW A;  4X3K A;  4GNX A;  2I07 B;  2L55 A;  4GN4 B;  1YEZ A;  3R8B A;  2PVP A;  3Q8S B;  1NCV A;  1RL2 A;  3S1R H;  1ULZ A;  1CKM A;  4TQU S;  3CCR A;  4YB8 B;  4BWS C;  1PH9 A;  2BQR A;  3BQ0 A;  2E2I H;  1F2Y A;  1VQE A;  2XN9 C;  1N36 H;  2PN1 A;  1DXM A;  2Z9H A;  4HIM A;  2BE5 D;  4WRD A;  2ASJ A;  2I8C A;  1R9T A;  1DV2 A;  3Q1K A;  1J5E Q;  5JUM A;  4MV4 A;  1HRJ A;  4UCT A;  4HIK A;  2A5H A;  2H4O A;  3U4V A;  3TZD A;  3G48 A;  5KG7 A;  3K6O A;  1RJQ A;  2NVX A;  4UHV A;  2CWA A;  2EJG C;  4R1J A;  2SNS A;  3VA5 A;  4KD3 A;  1G2T A;  2RCF A;  1Z7T A;  1L0W A;  5KT6 A;  2B2V A;  2HUG A;  1S72 A;  4DR6 H;  5LHY 1;  4OWT B;  4R4C A;  4XYL B;  2F0E A;  3I4N B;  5IWA L;  1PZJ D;  2UXC Q;  2W9A A;  1OXV A;  2B63 A;  4A3F H;  4C2M H;  1SN8 A;  2R93 A;  2XCA A;  1E24 A;  2JA5 G;  4LF5 Q;  1VQK A;  4PDB A;  4BBR B;  2ICE C;  5CR3 A;  2NVY B;  2F0V A;  2VS1 A;  1XMO Q;  1N33 Q;  5ELO A;  3PR4 A;  1KBL A;  4GN3 B;  1HUN A;  2YL2 A;  5FO9 B;  1PK8 A;  1BJT A;  4B3M H;  4WD3 A;  2M2L A;  5J2T F;  1YZ6 A;  3H40 A;  2B63 G;  2NTS A;  2F4V L;  3KAK A;  3OTO H;  5DLF A;  3JC6 6;  1E2Z A;  3Q23 A;  1SBB B;  2EYM A;  2PZU A;  2RGR A;  1LO5 D;  1I50 B;  2F0D A;  2R8I A;  2KCM A;  2A19 A;  1EYA A;  5IGC A;  4RAZ A;  4AYB E;  4DV5 H;  1XMQ H;  5ELE A;  2X0S A;  3R93 A;  1RF2 D;  2A68 D;  2F3W A;  4JBK A;  1CK1 A;  1W3S A;  1NY4 A;  1C8C A;  1TXY A;  1CUK A;  4ZUI A;  4HR7 B;  3I73 A;  1LTA D;  3PF4 A;  2ALZ A;  1KNA A;  4DL3 A;  2EYP A;  2HJW A;  1J6Q A;  4DV0 L;  2NVX B;  3HOU B;  4BY7 G;  1E7Z A;  4NXM H;  3ICE A;  1Z2P X;  2DIK A;  2YU9 H;  5I6Y A;  3IAY A;  3S15 B;  1ROD A;  1TWH H;  3K80 C;  1HHV A;  4A3G H;  4HNU A;  3P75 A;  4LFB Q;  2R8J A;  3NQT A;  3GTM H;  3MFG A;  5C1O A;  1D5X C;  3STB D;  4LF9 Q;  5FD5 A;  5KFF A;  1K3B C;  3MEF A;  1FGB D;  3R2T A;  4FF3 A;  3GTP B;  2J0T D;  3HXL A;  1YNX A;  2VZA A;  1SNO A;  4C3I G;  3G6X A;  4CC5 A;  4DV0 H;  2DNE A;  5D1O B;  5C5M A;  4OEL B;  3J81 j;  4PMW A;  2AU0 A;  4ZHQ F;  2W9B A;  3MEH A;  1SE3 A;  3AFP A;  4KTA A;  4DL2 A;  1PTO F;  5KFX A;  1GHJ A;  1MIU A;  5IP9 H;  3DHQ A;  2IY5 B;  1CT1 D;  4JI1 Q;  3EVQ A;  3CU7 A;  3Q22 A;  2B2Y C;  4B3T Q;  4FS2 A;  4KKT A;  4YWL A;  3RR5 A;  3NEN A;  3GTG A;  4DV1 Q;  1WCM A;  4MN3 A;  2HIX A;  3MXN B;  4YJ2 F;  3JAM c;  3M9N B;  4O3O A;  3C2P A;  4F50 A;  1A63 A;  1ICF B;  2JP1 A;  1MJC A;  1VCI A;  3K5O A;  4BWG B;  4FO2 A;  2VNU D;  2E2J B;  4IHJ F;  2VXW A;  3GTP H;  3DF7 A;  3LWB A;  1JMC A;  3RBD A;  1NJI C;  1ICW A;  4HNT A;  4A3B H;  3MFH A;  1EQT A;  2RHS B;  4TRD A;  1YNJ C;  3L7Z C;  1C0A A;  2R7Z A;  4ED0 A;  1MSG A;  2UVR A;  2EQS A;  4R4T A;  3SK4 A;  4ECQ A;  1IYV A;  4HSP A;  1ASZ A;  5KFM A;  2DY7 A;  2F0F A;  2B8G A;  2PQE A;  3DWA A;  2NVX H;  4QWD A;  3NE5 B;  3VDY A;  1PZK D;  5J2U F;  1ILQ A;  1HFG A;  1SMY D;  2IHF A;  4J1M A;  5EJW A;  2W6N A;  2SNM A;  4DV3 Q;  2UVV A;  3GID A;  1CM9 A;  4JYA H;  5DQH A;  4IPH A;  3EBE A;  2M00 A;  1WI5 A; 
#chains in the Genus database with same CATH homology
 4UP9 A;  4LUZ A;  4JI3 Q;  1CSP A;  2NVT H;  1YHA A;  1N36 Q;  4IFD I;  1ASY A;  3KDF B;  4DR3 Q;  1JJC B;  3CCU A;  1Q12 A;  4POF A;  3D31 A;  4YY3 Q;  1PH4 A;  3CPW A;  4OON A;  2HHH L;  1N36 L;  1IBK Q;  1FJG Q;  3L0O A;  1QVG A;  4YCV A;  3T1Y Q;  4FDB A;  3KJP A;  1K9M C;  4B3S Q;  1CKN B;  3BJU A;  4YWM A;  5J3B A;  1E22 A;  2Q2U A;  1E1O A;  3ULL A;  1HNZ L;  4B3M L;  1HNX Q;  2RF4 A;  2HHH Q;  2R7F A;  2MNA A;  3CF5 A;  4OO1 I;  1KD1 C;  4A3M G;  3T1Y L;  2HIV A;  2K5H A;  4DR6 Q;  2AWN A;  1MJE A;  3GTG H;  2OCE A;  4OWW B;  3RZD H;  1IBL L;  4DPG A;  3AYH B;  4AYB G;  4UPA A;  4GOP B;  2JQO A;  2Z6K C;  2DUD A;  2K5N A;  3UE0 A;  3PUV A;  3I4M H;  4DR6 L;  4DV5 Q;  3HKS A;  1XMQ Q;  4DR2 L;  2UUC Q;  4LFA L;  4GKJ L;  4A3I G;  4GLX A;  1FVI A;  3J81 c;  1Q46 A;  1SR3 A;  2JE6 I;  1RIP A;  2ID0 A;  4O2D A;  4JI8 L;  4GNX C;  4JI0 L;  3I4N G;  2NN6 I;  1LM0 A;  2JA8 G;  1D7Q A;  1KQS A;  1I94 Q;  3F2C A;  4A3I H;  2E2J H;  2N8N A;  1G6P A;  3BZC A;  3RN5 A;  4A3D G;  3I56 A;  1YI2 A;  4JI8 Q;  4BBS G;  2IX0 A;  1SE8 A;  2JEB I;  1CSQ A;  1M1K C;  2HQL A;  5C4X H;  4AQY Q;  1Q7Y C;  4QQB X;  4P73 A;  4DUZ L;  1NE3 A;  2Z6K A;  1Q86 C;  4IPC A;  4DV6 L;  2LSS A;  3KOJ A;  5IP7 G;  4JI6 Q;  2XTI A;  2ZTC A;  4KHP Q;  1QZG A;  3CCQ A;  3HOV G;  3EIV A;  3F2D A;  5M3F G;  3G6E A;  4WJ4 A;  3HKZ G;  1WCM G;  5C44 G;  2NZH A;  2MO1 A;  3D0F A;  1N8R C;  4JI2 L;  1PFS A;  1YIJ A;  2MFI A;  3HOW G;  1VQJ A;  1BVS A;  3NEL A;  4KHP L;  2D62 A;  1WCM H;  4JOI C;  4DK3 C;  1S3O A;  3ZJY C;  3PUY A;  3UDX A;  3U4Z A;  4DV2 L;  2PQA A;  1Q8K A;  1VQF A;  2E2H H;  1YBY A;  4JG2 A;  2VUM G;  1OTC A;  1IBM L;  1XJV A;  1HNW Q;  4JI3 L;  4K0K L;  2VUM H;  1QUQ B;  3FKI H;  4XTC S;  2E5L Q;  4C3H H;  1U5K A;  3DM3 A;  1VQB A;  3CD6 A;  4KI0 A;  4X66 L;  3FHW A;  3E0E A;  2RHQ B;  4X62 L;  4X65 Q;  1HJP A;  2Q2I A;  2UU9 L;  3CC4 A;  1D8L A;  5IYC G;  3HOU H;  1X3E A;  2PNH A;  4GLV B;  5IWA Q;  1HR0 Q;  1XNR Q;  4RMF A;  4B3M Q;  4BXX H;  3FP9 A;  4QIW E;  4B3R Q;  5IYC H;  4MNO A;  2JA6 H;  4LNQ A;  5M3M G;  1HZB A;  2YTV A;  3UDI A;  1SRO A;  1TWF H;  4MZ9 A;  2K4K A;  2ALY B;  2KEN A;  5IYB G;  2UXD Q;  5BR8 Q;  2ZTE A;  2WAQ G;  2CWP A;  1XNR L;  4A3M H;  4IPG A;  5IE8 A;  3S1N H;  4A3K G;  5IYB H;  1Y1W H;  4BY7 H;  4EQ5 A;  2UXD L;  5FJ8 H;  4NXM L;  4GOP C;  2F4V Q;  2UXB L;  2NN6 G;  2AKW B;  1U0L A;  3OYY A;  4LFA Q;  4NXN L;  1Y1W G;  1N9W A;  2AHO B;  5C0X I;  4JI7 Q;  2QGQ A;  4IJL A;  1CKN A;  3PUX A;  3W1B A;  4JYA Q;  3J7Z C;  4DR7 Q;  3TQY A;  1PYS B;  2A8V A;  4R4O A;  3S17 H;  5GAG C;  3UDG A;  2GVB A;  2PMZ E;  1AE3 A;  2ES2 A;  3S2D H;  2KBN A;  1JB7 A;  1IYJ B;  1X9N A;  1E3P A;  1HZC A;  3KF8 B;  5GAD C;  4A75 A;  1XMO L;  4DR7 L;  1EQR A;  4JV5 Q;  1V43 A;  2N78 A;  3M4Q A;  4DUZ Q;  2PQA B;  3A0J A;  5GQO A;  3H3V I;  4JV5 L;  1VQI A;  3U50 C;  1EYG A;  2GN5 A;  1PH8 A;  4RG1 A;  1KL9 A;  3PGZ A;  4DR3 L;  3I4N H;  1JJG A;  1X6O A;  3TEH B;  5LMN L;  3H0G G;  3OTO L;  4HIO A;  3F8T A;  2BH2 A;  1K0R A;  3T1H L;  5HY6 A;  2F3I A;  4Y52 H;  4DR4 L;  4HJA A;  4DR1 L;  2B3G A;  1YHQ A;  2R7Z H;  4BBS H;  4GNX B;  2H5X A;  5LMN Q;  1HNZ Q;  3HOZ H;  1IBM Q;  4LF7 L;  2R7Z G;  4C3J H;  5IP7 H;  1KRT A;  2UUA Q;  2OWO A;  1VQ8 A;  4A3J G;  1YJN A;  2XGT A;  4QY7 A;  4HJ8 A;  1VQ5 A;  1IBL Q;  4J15 A;  3SGI A;  5IY0 A;  3G71 A;  4NB3 A;  4QGU A;  1VQL A;  4LF7 Q;  1PHJ A;  3S1Q H;  3NBH B;  2MQH A;  1VQ4 A;  2I0Q A;  3PIP A;  5C4J H;  3PO3 G;  1V1Q A;  4YWK A;  2GVA A;  4A93 H;  5C0X J;  4DV5 L;  1XMQ L;  3HOX G;  4IO9 A;  1N34 L;  2Q2T A;  3K7U C;  2ZJP A;  3ERS X;  3PIO A;  1EIY B;  3GTO H;  4A93 G;  2A1A A;  5K36 G;  4JI1 L;  4JI0 Q;  2CQO A;  4O0A A;  3RLN A;  3A5Z B;  1BBW A;  4GLA C;  5FLM G;  4YHH Q;  2WFW A;  3TRE A;  5JJI A;  2JA9 A;  2PI2 E;  1VQC A;  3FKI G;  4DAM A;  4DV1 L;  1Q81 C;  4GN5 A;  4IFD G;  5JJK A;  2OTL A;  1P8L A;  3IRB A;  5M5W H;  3PO2 G;  1E1T A;  3ULJ A;  4YHH L;  2AWO A;  1Q1B A;  1VQO A;  1TWA H;  2ZJQ A;  4DV6 Q;  4A3K H;  4PG3 A;  1BBU A;  3I55 A;  2UXB Q;  3W5O A;  2QA4 A;  1O7I A;  3JAM i;  4OX9 L;  4A3L H;  3K8A A;  3KF6 B;  4PZ7 A;  1Q82 C;  1YVC A;  2QEX A;  4LFC Q;  3NEM A;  4A3L G;  3M4O H;  4L5Q A;  1KRS A;  5GRO A;  1L1O C;  3CCE A;  4YCU A;  2OQ0 A;  1VQA A;  1SMX A;  3WWV A;  1GM5 A;  1QVC A;  3M9B A;  4LUV A;  3KFU A;  4LW1 A;  1HNW L;  1YJW A;  3H3V H;  1L1O A;  4DAY B;  1S40 A;  3KLW A;  1VQ9 A;  4K0K Q;  1I5F A;  5JJL A;  4JBW A;  4R4I A;  5IYD G;  4IOA A;  1TWC H;  1LTL A;  1C7Y A;  1FGU A;  2YV5 A;  2E5L L;  1X3G A;  3E9I A;  2UUB Q;  1NMG A;  1PV4 A;  4X66 Q;  3UE1 A;  2JA7 H;  4X62 Q;  3RLO A;  2ATW A;  2WB1 E;  1Z9F A;  5AJ3 L;  3I4M G;  4EX5 A;  3M7N A;  1HR0 W;  2D0P A;  3PUW A;  4DR4 Q;  1T9H A;  2WP8 J;  3GTJ H;  5EAY A;  1PVO A;  3CCV A;  3S15 H;  4HJ9 A;  4DV4 L;  1LUZ A;  3CXC A;  4B3R L;  3F1Z A;  4LF6 L;  4L5S A;  4YY3 L;  2IT1 A;  2I5H A;  3CP0 A;  1V9P A;  3AQQ A;  2UUA L;  3HOZ G;  4HID A;  4LF4 L;  1Z47 A;  3J81 i;  1N32 L;  1VQ6 A;  4UP8 A;  1I50 H;  2Q2H A;  4DV7 L;  1X3F A;  1KC8 C;  4GS3 A;  4AIM A;  1KIX A;  4JI4 L;  3J7A 5;  3TRZ A;  1UE7 A;  1K3R A;  4DR5 Q;  1SFO H;  1VQ7 A;  1XPO A;  1HZ9 A;  2C35 B;  3KDF A;  2KHJ A;  4IOC A;  4JI5 L;  1G29 1;  3S16 H;  2JA5 H;  4NXM Q;  3PO3 H;  2RCN A;  3Q8D A;  4XIG S;  1HZA A;  5DLQ E;  4DV7 Q;  4NXN Q;  4JI7 L;  1Y14 B;  3LGJ A;  2I5M X;  4DR5 L;  5ELN A;  1XPR A;  4JYA L;  3ULP A;  1UEB A;  2E8G A;  4KHZ A;  1B7Y B;  1LYL A;  4DK6 C;  1XTD A;  1GD7 A;  1X56 A;  1EQQ A;  2K75 A;  4YCW A;  4DR2 Q;  1PH2 A;  1BKB A;  1SRU A;  1TWG H;  3W1G A;  3CC2 A;  4BBR H;  1IBK L;  1FJG L;  3F2B A;  1OXT A;  4QL5 A;  1VQG A;  2UXC L;  1YJ9 A;  1I94 L;  3H15 A;  4X6A H;  4BBR G;  4HJ5 A;  4KLK A;  3CQZ H;  4LF9 L;  1WJJ A;  2IX1 A;  4IPD A;  5LMU L;  1JE5 A;  1VQN A;  1L1O B;  2VQE Q;  4OO1 G;  2N3S A;  4WJ3 M;  5H1S E;  1EIF A;  2LXK A;  3CCL A;  1IZ6 A;  2L15 A;  1EOV A;  4LFC L;  3BZK A;  5HGQ A;  4A76 A;  4A3E G;  3M3Y H;  4GOP A;  3RN2 A;  5LMU Q;  4P71 A;  4DKA C;  4DR1 Q;  2VQE L;  5C3E G;  4AH6 A;  2OQK A;  1K8A C;  2UUC L;  4BXX G;  4A3E H;  4GKJ Q;  1R9T H;  1PH3 A;  1WYD A;  3DLL A;  1PH6 A;  1QVF A;  5M3M H;  3GTK H;  4BA2 I;  1Y1V G;  5C3E H;  4X64 Q;  4B3T L;  2HT1 A;  4A3C G;  1NBW A;  2BA1 A;  3S24 A;  2ZM6 L;  1Y1V H;  5C0X G;  2EIF A;  4H02 A;  4P72 A;  3OW2 A;  4A3G G;  2YTY A;  2N49 A;  3KF6 A;  5AJ3 Q;  3I7F A;  3L2P A;  2D0O A;  5FJ8 G;  2VQF Q;  1PH7 A;  3A5U A;  1PH5 A;  1OXU A;  4JI6 L;  2B29 A;  2WAQ E;  1EFW A;  4GNX A;  1YIT A;  1A62 A;  2YTX A;  3CAM A;  3ER0 A;  1YEZ A;  4GN4 B;  4DV4 Q;  4ALP A;  1I6H H;  1RL2 A;  2V1C C;  3S1R H;  4JI2 Q;  2CCZ A;  3GO5 A;  1YHB A;  1CKM A;  1VQH A;  1CKO A;  2R6G A;  4TQU S;  3CCR A;  1QZH A;  1PH9 A;  3HOY H;  4JBM A;  2E2I H;  1A0I A;  3GTL H;  1VQE A;  1N32 Q;  1HR0 L;  1UE6 A;  3RZO H;  1IL2 A;  2CFM A;  3S2H H;  4HIM A;  4JBJ A;  2JA7 G;  4DUY L;  4JI4 Q;  1XNQ L;  4LFB L;  1J5E Q;  4A3C H;  2JA8 H;  2R92 G;  4OWX B;  1KXL A;  4HIK A;  1X65 A;  3U4V A;  1VS0 A;  3G48 A;  4A3D H;  5JEA G;  2KHI A;  2JJQ A;  2VL6 A;  2CWA A;  3H0G H;  2LXJ A;  4JCV E;  4R1J A;  1J5E L;  4L5T A;  4A4I A;  4BY1 G;  3J80 c;  1SLJ A;  1L0W A;  2VW9 A;  2UU9 Q;  1S72 A;  1EWI A;  2Y0S E;  4OWT B;  4R4C A;  3HOV H;  2ASB A;  4P75 A;  2EXD A;  3I2Z A;  3M4P A;  5IWA L;  3PF5 A;  2UXC Q;  1OXV A;  4QJF A;  1OXS C;  1SN8 A;  4C2M H;  4A3F H;  3U58 A;  5M5Y H;  1E24 A;  2JA5 G;  2WB1 G;  4LF5 Q;  1VQK A;  2I5L X;  4IFD J;  5JEA J;  4A3F G;  4B3S L;  3TS2 A;  1GVP A;  2VS1 A;  1XMO Q;  2AMC B;  1N33 Q;  1AE2 A;  1K73 C;  3S14 H;  1KHI A;  5ELO A;  2K5V A;  4GN3 B;  1K83 H;  1K8G A;  3GDE A;  1HNX L;  2BA0 A;  3HOX H;  1OXX K;  1YZ6 A;  3CCJ A;  1DGS A;  4LUO A;  2B63 G;  1WFQ A;  4TVA B;  4JC0 A;  2F4V L;  4R4Q A;  3JC6 6;  2NZO A;  1JJ2 A;  1C9O A;  3A74 A;  3I4O A;  2NVY H;  3OTO Q;  4P74 A;  1M90 C;  2B63 H;  2R93 H;  3CW2 C;  1PA6 A;  1I3Q H;  4DNI A;  4X64 L;  4LF4 Q;  2KCM A;  2A19 A;  4Y7N H;  2ZJR A;  4AYB E;  5LMN W;  3PO2 H;  1L2F A;  3HFZ B;  3STB C;  1W3S A;  5FLX c;  3TS0 A;  1NY4 A;  2F52 A;  4JBK A;  1TXY A;  1CUK A;  1W2B A;  2VQF L;  1Q1E A;  2JA6 G;  4JI5 Q;  3PF4 A;  4DV3 L;  5GAH C;  3CME A;  4AQY L;  3EN2 A;  2FXQ A;  5E7N A;  1J6Q A;  4DV0 L;  3BU2 A;  3PV0 A;  3RLF A;  4BY7 G;  1E7Z A;  3J80 i;  1B8A A;  3ICE A;  3T1H Q;  3KJO A;  2YU9 H;  3KYH C;  3RNU A;  1MKH A;  1TWH H;  1HH2 P;  5M5X H;  3K80 C;  4A3G H;  4LWC A;  1XPU A;  4LFB Q;  1H95 A;  4NPS A;  3GTM H;  4IJH A;  1UE5 A;  2BH8 A;  4C3I H;  3STB D;  2R7D A;  4PZ6 A;  4LF9 Q;  1AH9 A;  2R92 H;  3MEF A;  1UE1 A;  4DV2 Q;  1YNX A;  3CPF A;  2VZA A;  4OXP A;  4LF6 Q;  5IYD H;  1KAW A;  1PH1 A;  3CC7 A;  3J81 j;  1UWV A;  4PMW A;  3HOY G;  3CMA A;  2NVQ H;  1JT8 A;  3AEV A;  2K14 A;  4MTN A;  4UY8 C;  3AFP A;  1EUJ A;  3UDF A;  4OX9 Q;  1N34 Q;  1QUQ A;  3B6Y A;  4GKK L;  1MIU A;  2IHE A;  5IP9 H;  1X54 A;  2IY5 B;  4JOI A;  4JI1 Q;  4X65 L;  4UP7 A;  1B70 B;  2OTJ A;  4B3T Q;  4YWL A;  4HJ7 A;  4LF5 L;  5IP9 G;  3RR5 A;  3NEN A;  3GTQ H;  1WOC A;  1IXR A;  4DV1 Q;  2CKZ B;  2HIX A;  3MXN B;  2ZM6 Q;  3JAM c;  1N33 L;  3HKZ E;  5C44 H;  2VY3 A;  3HOW H;  4BY1 H;  1A63 A;  2KCT A;  3K0X A;  1MJC A;  1VCI A;  2VNU D;  3PSI A;  2K52 A;  3K81 C;  2ZTD A;  3GTP H;  4A3B G;  1P16 A;  1FL0 A;  2PI2 A;  2Y0S G;  5BR8 L;  1JMC A;  2JK8 A;  5GAE C;  4ME3 A;  3AFQ A;  4A3J H;  1NJI C;  1VQM A;  2YYZ A;  5C4X G;  1GKH A;  1NTG A;  4APV A;  1G51 A;  4LF8 Q;  4A3B H;  2JEA I;  1GO3 E;  5IT9 c;  3CCM A;  2RHS B;  5M3F H;  2R93 G;  3L7Z C;  3G4S A;  1C0A A;  4PZ8 A;  2K50 A;  1X55 A;  2DGY A;  3S1M H;  2EQS A;  4R4T A;  3K7A H;  1A8V A;  4LF8 L;  1ASZ A;  3M85 A;  4DUY Q;  3GD7 A;  1PYB A;  3PUZ A;  2NVX H;  1XNQ Q;  4BA1 I;  3E9H A;  3PCO B;  5FLM H;  3VDY A;  4POG A;  1NMF A;  2Z0S A;  2IHF A;  3HOU G;  3CCS A;  2MO0 A;  4DV3 Q;  2UUB L;  1VQP A;  4GKK Q;  1VQD A;  4L5R C;  4IPH A;  3EBE A;  4DV0 Q;  1WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...