4A3KG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3kG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3kG01
1G51A 3HOVH 4A76A 4DR6L 3UDGA 1D7QA 4A3CH 4OWTB 1MJEA 4IFDI 1N33Q 4OO1G 4HIMA 1TWCH 2I5MX 3KLWA 4JC0A 2KCMA 5IE8A 5IYCG 1VQMA 1VQLA 4LF5L 1QUQA 2Z0SA 3ER0A 3HFZB 4GN3B 2A1AA 1CSPA 4A93G 1MJCA 2KHIA 5IP9G 4A3KH 3HOYH 3E9IA 3Q8DA 1W2BA 3GTLH 2UUCQ 1VQ9A 3PO3H 3RN5A 3CCLA 3RLOA 4ALPA 4DR2L 3K81C 4IPDA 4R4CA 4O2DA 4EX5A 1CKMA 1X3GA 2Q2HA 3EIVA 1YIJA 4IFDG 4AQYQ 4PZ6A 2HIVA 3W1GA 2NVTH 4JYAQ 5C0XI 4DV0L 4R1JA 1KIXA 1RIPA 2UXBQ 4WJ3M 3JAMi 1FL0A 1OTCA 2UXDQ 1FJGQ 2YTVA 3PIPA 1K83H 3J80i 3CCVA 2EIFA 4JI0L 1I5FA 2Z6KC 4UP7A 1V9PA 4POFA 1L1OC 3TEHB 4GOPB 3MEFA 4B3ML 1N36L 3GTOH 1VQJA 2DUDA 1B7YB 1UE1A 5GQOA 2VUMH 1GVPA 1I50H 1PA6A 2B3GA 4DR3L 4JV5L 2ZTDA 4A3LH 1IBML 1I6HH 1LYLA 1WI5A 5C44H 2VZAA 1FVIA 4YCWA 4YWMA 1A0IA 1UE5A 2NZOA 3CP0A 3L7ZC 3HOVG 3G6EA 5C4JH 2I5LX 3K7UC 1CKNB 4JBMA 1E7ZA 3KF8B 4B3TL 2K4KA 3J80c 1TWHH 3M9BA 3CPWA 4A4IA 3NEMA 1XMOQ 3NBHB 3S1NH 2A19A 5LMNQ 1Z9FA 3JAMc 2JA8G 1C7YA 4IPCA 4MTNA 4P73A 4X64Q 2HHHQ 4DV4L 4GNXB 4L5RC 4ME3A 1A63A 3M4PA 3CXCA 1CUKA 1LM0A 3AEVA 3A5UA 4HJ8A 1T9HA 2MO1A 2BH2A 3CCSA 2XGTA 1Q8KA 3J81j 3J7ZC 4Y7NH 1YZ6A 3OTOQ 2ZTCA 3TS2A 4DR7L 3HKZE 4LF9Q 1SR3A 4QJFA 4OX9L 1PH9A 2JA7G 1VQFA 3D31A 3UE0A 1A8VA 4AYBG 4BBRH 2MFIA 1KXLA 3I4NG 3S1MH 2Z6KA 1PYBA 5C3EG 2CQOA 3CC2A 3U4VA 1I3QH 5FLMH 2E5LL 3CQZH 2ATWA 5JJIA 4PG3A 3RLFA 3FKIG 1E22A 5IP7G 4IFDJ 5DLQE 2K5NA 3GTJH 4DR7Q 1NE3A 1YEZA 3F2DA 3SGIA 1C9OA 2KHJA 5JEAJ 2I5HA 1EUJA 2BA0A 4BBSH 4JI3L 2R92G 3H3VI 2D62A 3T1YL 4LFCL 5JEAG 5C44G 2YTYA 4DV7Q 4A3JH 4B3TQ 1HNXL 2H5XA 4A3IG 3M4OH 5IP7H 3L0OA 3T1HQ 4JI6L 1N8RC 1Q86C 4NPSA 2K75A 1XNRL 5IWAL 1Q1EA 2FXQA 1NMFA 1PHJA 2ES2A 1NJIC 3FP9A 4NB3A 5C0XG 1K9MC 4JV5Q 4R4OA 1U5KA 4BY7H 3RZOH 3TQYA 4LNQA 3I7FA 4DV3L 2R7ZH 3HOWH 3S24A 1N36Q 4LW1A 4A3JG 3F1ZA 5IWAQ 2EXDA 1XJVA 4K0KL 1JJGA 4A3MG 4YY3L 2OCEA 5GADC 3T1HL 2OWOA 4JI6Q 1N32L 4QGUA 4PZ7A 1YNXA 2D0OA 4DR1L 3GTGH 4DK6C 1HR0L 5LMUQ 3S2HH 4DV0Q 1V43A 1HNWL 2WAQE 4LFBL 4X6AH 4DUYQ 5IYDH 3CCMA 1HZBA 4JYAL 3AFPA 4BY7G 1EOVA 1X65A 1AH9A 1QVGA 4DR5L 1YITA 2UXBL 1L0WA 1K0RA 3KF6A 5M3FH 2NN6I 3CW2C 1PH1A 2UUCL 4OWXB 4DUYL 1I94Q 3I56A 4QIWE 2E2JH 2WAQG 4JI2L 1TWFH 1HH2P 3NENA 4C2MH 4EQ5A 5IYDG 4DR1Q 4A3KG 3HOYG 3PGZA 1V1QA 1SE8A 1X54A 2EQSA 4YWKA 3RR5A 1OXSC 2UUBQ 4KI0A 4LUVA 2PI2A 5J3BA 3OW2A 4A3GH 2K5VA 4LF9L 2I0QA 4A3EG 3G71A 1VQEA 2NZHA 1Q1BA 2GVBA 2JE6I 3W5OA 1J5EL 4A3CG 3A74A 1VQDA 4NXNL 2AWOA 4JBKA 3GTQH 1BKBA 1NTGA 3BJUA 3F8TA 4C3HH 5AJ3Q 3F2BA 2VQEQ 4B3MQ 3AQQA 2JEAI 4X62Q 1PH5A 2Q2IA 3AYHB 1HNXQ 4GKKQ 3HOWG 2UXCL 1VQ8A 3ULJA 3TS0A 1EIYB 3TRZA 2PMZE 4HIOA 1VQGA 1VQAA 4HIKA 1QVFA 1E1TA 1B8AA 4DV1Q 4DV5Q 4JI8Q 4GNXA 1N34L 4OWWB 3U4ZA 4A3DH 3EN2A 3ULPA 1SFOH 3TREA 2NVXH 3PCOB 5M3MH 3HOUG 3S14H 3NELA 4DR2Q 1ASZA 3GDEA 1PFSA 1VQOA 1WCMH 2AHOB 4YCUA 5IYBG 3GTPH 4YHHL 3GO5A 4X66L 1PH2A 4BXXG 2NN6G 1S72A 4L5TA 4GLVB 4KHPL 3FHWA 4IJLA 3DLLA 1M1KC 4LF4L 4OO1I 3KF6B 2VNUD 1HZAA 2Y0SE 1L2FA 4A3DG 1Y1VG 4JI7Q 3I55A 1S3OA 4P71A 4DUZQ 1YHQA 2UU9Q 3U50C 1Y14B 1YHBA 4R4IA 2NVYH 4RG1A 2BA1A 3PUWA 1WYDA 2R93H 2BH8A 2B63G 2OTJA 4LWCA 1SRUA 4DPGA 4PZ8A 2JA5G 2IX1A 3H3VH 4BA2I 2F52A 3U58A 4A3EH 2DGYA 2JA7H 1NMGA 1PVOA 4P72A 4L5QA 1N9WA 1PV4A 2E2HH 1VQPA 2AWNA 3PIOA 2UUAL 3G48A 1KHIA 3PUZA 5M5WH 4GNXC 2JA8H 1KD1C 4DV6L 2N49A 1VQCA 4B3SQ 3KJOA 2ZTEA 1DGSA 1X3EA 3PF5A 3PO2H 4LF5Q 1OXVA 2HQLA 3LGJA 3S17H 1C0AA 2IY5B 4LF6Q 2JA9A 4IO9A 1NY4A 3HOXG 2JJQA 4BBSG 3ULLA 1OXXK 4DV6Q 1GKHA 4GN4B 5HGQA 1TWGH 1CKNA 1JB7A 1HJPA 1U0LA 3PUYA 2K52A 1Q46A 4C3IH 4DV7L 4LFCQ 1OXUA 3I4NH 1VCIA 4XIGS 4NXMQ 1D8LA 5C3EH 1EQQA 4IOAA 5IYCH 5FLMG 2ZJRA 2F4VL 1SLJA 1E1OA 1IBKL 2K5HA 4UP8A 3STBC 1UE6A 2N78A 4A75A 1A62A 1W3SA 5M5YH 5LMNW 2UU9L 3HKSA 2Y0SG 5IYBH 1VQ5A 4NXML 4LF7L 1S40A 4X65L 1P16A 2ZM6Q 1YJWA 4JI4L 2ID0A 3KYHC 4JI1Q 5LMUL 1HR0W 1M90C 1JMCA 4AYBE 4YHHQ 1HZ9A 3G4SA 2B63H 4JBJA 1XTDA 5FJ8G 1N32Q 4A3BG 4QY7A 1E24A 3GTKH 3JC66 2ZM6L 4JI4Q 2HIXA 4JI1L 3J81i 3CF5A 4B3SL 2A8VA 3S16H 3KDFB 1B70B 4A3FH 1VQ6A 1VQKA 4LFAQ 2VQFL 1Q7YC 2JA6H 4B3RL 1XNRQ 3K8AA 1QUQB 4BY1H 4DR6Q 1JT8A 1OXTA 2ASBA 3MXNB 2VUMG 5ELNA 4YWLA 3HOZH 3I2ZA 1HR0Q 4DV2L 5HY6A 1IYJB 4AIMA 2CWPA 1AE3A 2LXKA 1J5EQ 4A3FG 3VDYA 1VQNA 4LF8Q 1J6QA 2QGQA 2VQEL 1EIFA 3I4MG 1IBMQ 2MQHA 4MNOA 4JI7L 1SMXA 4J15A 4JCVE 4DAYB 1L1OB 1HNZL 2IHEA 5H1SE 2CWAA 4DR4L 1O7IA 1TXYA 2WB1E 2E5LQ 3M4QA 1XMQQ 4H02A 1BBUA 3E0EA 4LF8L 4TVAB 4IJHA 3CC7A 3GTMH 1VQIA 1SN8A 4KLKA 2F3IA 1EFWA 1JJ2A 1PYSB 4JI2Q 1MKHA 4AH6A 4HJ7A 1XPRA 2Q2UA 2IHFA 1EWIA 2AKWB 5GAGC 2ZJPA 4DV5L 4JI3Q 4GOPC 2K50A 2GN5A 1IXRA 3I4OA 3PSIA 4UPAA 2AMCB 4IPGA 2CFMA 2F4VQ 4X64L 2HHHL 1X6OA 4JOIA 4A93H 2VQFQ 4LFAL 3KFUA 3S15H 1XNQQ 4BXXH 2PI2E 4DUZL 4HIDA 2YTXA 2PQAA 1KAWA 1WFQA 3UDXA 4DAMA 2WFWA 3STBD 3PF4A 4KHPQ 3A5ZB 2E8GA 4OONA 3CCQA 2B29A 3CCUA 2VY3A 4LF4Q 2R92H 3K0XA 2CCZA 1GO3E 1Y1VH 3PUVA 1XPOA 2R7FA 2ZJQA 1IBLL 3CCRA 3K80C 2N3SA 4TQUS 4XTCS 2K14A 1PH8A 4DKAC 4HJ5A 1VQ7A 3H15A 2RCNA 2UXCQ 3ZJYC 2ALYB 2UUBL 4DR4Q 3M85A 1UEBA 4GN5A 4LUZA 4RMFA 4JI8L 3PV0A 5C4XG 1ASYA 3KOJA 2E2IH 3L2PA 3K7AH 5IT9c 1FGUA 3T1YQ 1H95A 4DV4Q 3PO2G 1VQBA 2WP8J 1VQHA 1EQRA 2KCTA 1KL9A 1PH7A 1LUZA 4JI0Q 4KHZA 1Z47A 1IBKQ 3AFQA 3H0GH 2JQOA 3CC4A 3S1RH 1BBWA 2L15A 2KBNA 4X62L 1K8AC 1X9NA 4GKJQ 1CSQA 2QA4A 1NBWA 1MIUA 2QEXA 4BBRG 1JE5A 1WJJA 4NXNQ 5AJ3L 2R7ZG 1CKOA 4GOPA 5C4XH 1YHAA 4AQYL 2LXJA 1UE7A 3DM3A 1IZ6A 3RZDH 4POGA 5EAYA 4A3MH 2PQAB 3M3YH 2JK8A 4QQBX 1SROA 1K73C 4JOIC 3UDIA 3PO3G 4UY8C 4YY3Q 5GAEC 4R4QA 3F2CA 1PH4A 1XMQL 3A0JA 1GD7A 2IT1A 5M3FG 1P8LA 2KENA 2YU9H 2LSSA 4X66Q 3RNUA 1KC8C 2D0PA 3EBEA 5M3MG 3HOUH 1Q12A 5JJKA 4HJAA 2C35B 1LTLA 2N8NA 1XPUA 4A3LG 4A3IH 3CD6A 2V1CC 2OQKA 3WWVA 1BVSA 4YCVA 1PH6A 4IPHA 3OTOL 1PH3A 2JEBI 1KQSA 1K8GA 2R6GA 4DR5Q 3B6YA 1QVCA 1G6PA 1K3RA 3D0FA 2RF4A 1Y1WG 5C0XJ 4GKJL 4JG2A 4R4TA 5LMNL 4JI5L 5FJ8H 3E9HA 4BY1G 4IOCA 3ICEA 1X3FA 4K0KQ 2R93G 4LUOA 3CMEA 4APVA 3CCJA 1R9TH 4B3RQ 1KRTA 4DV3Q 1KRSA 3M7NA 4P75A 3CAMA 3BZKA 4MZ9A 1Q81C 1HNZQ 1Y1WH 2OTLA 2Q2TA 2UXDL 1YJ9A 1IL2A 3GD7A 1IBLQ 3BU2A 4C3JH 2PNHA 1TWAH 5GROA 3H0GG 4DR3Q 4GLAC 1EYGA 4OX9Q 2OQ0A 4JI5Q 4DV2Q 5FLXc 3KJPA 1VQ4A 1E3PA 2VW9A 5BR8Q 1WCMG 3KDFA 2UUAQ 3HOZG 2VL6A 4WJ4A 2HT1A 2RHSB 3CPFA 3CMAA 1Q82C 2GVAA 3OYYA 4PMWA 1XNQL 2NVQH 3FKIH 3UE1A 1FJGL 5GAHC 4BA1I 1X55A 4UP9A 3J7A5 4P74A 2JA6G 1JJCB 4FDBA 1QZHA 2MNAA 1RL2A 1UWVA 1HZCA 1YVCA 2R7DA 3IRBA 4GS3A 1HNWQ 3BZCA 3ERSX 3RN2A 4JBWA 5IY0A 5M5XH 1WOCA 5E7NA 1AE2A 3W1BA 4GLXA 1YBYA 2VS1A 5K36G 1G291 4LF6L 1GM5A 4L5SA 5ELOA 2JA5H 2WB1G 4X65Q 2XTIA 3J81c 1X56A 3PUXA 3UDFA 3CCEA 2YV5A 1QZGA 4LF7Q 4Y52H 1YJNA 2IX0A 2RHQB 1I94L 1N34Q 3I4MH 1YI2A 1N33L 3S1QH 4HJ9A 4A3BH 4GKKL 2MO0A 4QL5A 3HKZG 3RLNA 4DK3C 2YYZA 1VS0A 4OXPA 3S2DH 2CKZB 3HOXH 4DV1L 1XMOL 4LFBQ 4O0AA 5IP9H 5JJLA 1L1OA 4A3GG 5BR8L 4DNIA
chains in the Genus database with same CATH superfamily
4KD3A 3UDGA 4OWTB 1MJEA 4G3IA 4HIMA 1VQLA 4JC0A 3KLWA 3HOYB 1VQMA 5IYCG 2W7OA 3GV8B 4B3MH 1WTHA 2O03A 4MV6A 2RDGA 1MJCA 4A3KH 2PW5A 2LKVA 3E9IA 4CDFC 4O3NA 3GTLH 2N55A 3BYYB 2E76C 2IW3A 2LFNA 3KK7A 4Q5VA 3PO3H 4DR2L 4IPDA 2R8HA 2G5DA 1X3GA 4YR3A 1YIJA 2EYOA 3IKJA 3GV7B 1OWTA 1ML0D 3Q22A 1O7ZA 4CC5A 4QW9A 4DV7H 1BO0A 2HIVA 3PQIA 4PZ6A 4O4HF 1I6HB 3KLSX 1EEID 1HA6A 1RIPA 1FL0A 1G6ZA 4HNUA 4QW8A 3K5NA 3PIPA 1EEFD 3S1NB 4MA5A 5I9OA 3M9MB 4JI0H 4JI0L 3RBEA 2Z6KC 2ZJTA 3RUPA 2UXDQ 2WAQB 3TEHB 3MEFA 2ZDQA 1VQJA 1B7YB 1UE1A 5GQOA 1RJQA 4XXEA 1KLGD 4DR3L 4JV5L 3HP3A 2ZTDA 3A8JE 2JSOA 4R8IA 1IBML 1WI5A 3R5HA 2VZAA 4UCOA 4RUCA 1FVIA 4YCWA 2K05A 2SEBD 3CP0A 3HOVG 4WRDA 4I7HA 4JBMA 4DR2H 5G3LD 4B3TL 1YNJD 2K4KA 3M9BA 4APMA 3HGBA 4A4IA 4J9QA 2F0TA 2VA3A 3R23A 1ENAA 2A6EC 1KNAA 5C1PA 1C7YA 4MTNA 4AQYH 4ME3A 2NUAB 3CXCA 1ZEQX 3A5UA 4HJ8A 1S5BD 1Q8KA 3GTGA 4RH6A 4Y7NH 2ZTCA 4A3EB 4OGQC 2ZDHA 1S5ED 1UC8A 3D31A 4UHVA 5KG3A 4BBRH 3I4NG 2Z6KA 5KG4A 5JUMA 2Q8IB 3CC2A 2FB9A 1AEXA 3GTPA 1GUSA 3A7AB 1RYRA 3SK5A 2R92A 5JJIA 1D6EC 2F0JA 4ECVA 1IOWA 5DLQE 1SXTA 3GTJH 2B8GA 1B04A 2FKLA 4XQQA 2J9GA 4HSVA 5JEAJ 4ED8A 3VR6A 1H9RA 1JOKA 3M7GA 2ZXRA 1EUJA 2HD3A 4XYOA 5ELFA 4DL2A 4MV4A 2IMWP 2C00A 3EPIA 4B3TQ 4E4TA 5KG5A 2BQUA 5EBCA 3FPPA 2KHSA 1Q86C 1LT6D 1QNUA 4M1UB 1JX4A 2F3VA 3EVQA 3FP9A 4NB3A 1K9MC 1U5KA 4ED1A 5AFWA 5JVH3 1I7LA 2FPPB 3I7FA 2R7ZH 3Q0AA 3S24A 3MFGA 2Q8TA 4A3JG 5TSSA 4UAIA 4C1NK 2NVQB 2OCEA 3T1HL 4JI6Q 2A68C 4DFAA 3VYUA 5FD5A 3N44B 5DM73 4DR1L 3GTGH 2VB2X 1KJIA 4KN7C 2MHVA 5IYDH 4LFBL 3SK4A 1HZBA 4JYAL 2X6GA 3NBIA 4LFCH 3T4AC 1AH9A 4MTEA 2HDLA 2F4VH 1RCVD 2UXBL 1FYCA 2W9BB 1K0RA 3RMHA 2DJGC 2JA6A 3K59A 5JPNC 1I94Q 1ICFB 2C5CA 2DY7A 1GLVA 4LMQD 1TWFH 4EEYA 1HFNA 4LH6A 3S2HB 2CHBD 4ZLTF 1X54A 4XX0B 5FPOA 5IGDA 2AGPA 4ZK9B 3E5SA 4UFZA 5J3BA 3OW2A 1E4GT 1TS3A 2EYLA 2SOBA 1N32H 4A3EG 3G71A 1EFID 2ASDA 1BJTA 4A3DB 1VQDA 3HS0C 3K5IA 4ECWA 1PK8A 1XNQH 2G9DA 4B3MQ 1F2MA 1X3QA 3RZOB 4M7EA 2Q8RE 3AYHB 3J80L 3BS1A 4GKKQ 4KJOA 3R5FA 5E1FA 4NKLA 1EIYB 3TRZA 1Q3LA 1JICA 4HIOA 4I7ZC 3MXUA 4FF2A 4RUAA 3PR4A 2FPGB 3D4DA 4HEDA 4DF7A 3U4ZA 4YIJA 2R8GA 1AW7A 4GC7A 4NLGA 2XIGA 2JA6B 3PCOB 3HOUG 3NELA 3OSPA 1ONLA 4DR2Q 2MCTA 4C5CA 2J4XA 3CQZA 3SE7A 1BOSA 4LF6H 1AFPA 4X66L 3BAAA 1A3TA 3IL8A 4L5TA 2NU8B 3RV3A 4GLVB 3DLLA 1R4PB 1SAPA 4OO1I 2VNUD 4YHHH 4HMIA 3FMAA 4EYIB 4JI7Q 1S3OA 3U50C 1VDZA 3PIO3 3JZIA 1PXUA 4R4IA 2IBKA 1DD2A 4FXGC 2SNMA 3FEWX 2B63G 1SRUA 1KJJA 1FNWA 1QOHA 2JA5G 5KFWA 2XWBB 3BVMA 3L4KA 3U58A 3E6ZX 2TMPA 1RK6A 2EE1A 4ED7A 4P72A 2FMCA 3BYTB 3PZPA 3J80E 1PV4A 2AWNA 4KV6A 1HTLD 4DR3H 5J39A 1KABA 3PUZA 4LSAA 4DV6L 2NVTB 4DU9A 5IYZF 1VQCA 3PO2H 2RBMA 4LF5Q 3LGJA 2IY5B 3CHBD 1IYVA 3TP7A 2KSWA 2EY6A 4J1MA 4Z9CB 4DV6Q 1Y1VB 5HGTA 3VR2A 2VB3X 5HGQA 4EGVA 1TWGH 3A7LA 4CDDC 3JSNA 4QIWA 4IWXA 2K52A 4C3IH 1C8CA 3M4OB 3I4NH 2R84A 4IOAA 5C3EH 4DV1H 4YJ2F 1E1OA 1IBKL 2QCPX 4PMCA 1D2BA 5KFHA 5LMNW 1W6JA 1HNXH 5IYBH 2W71A 4LF7L 5EPJA 4L6TB 5BN3A 4JI4L 2ID0A 3KYHC 5KNCA 5LOVF 1M90C 2IPKD 4AYBE 4YHHQ 1HRJA 4K8IA 4KHPH 4MTKA 2F0SA 3GTKH 3JC66 2AQ4A 2A8VA 4BWSC 4RNMA 3GV6A 1B70B 3H6MA 5HURA 2X6LA 4LFAQ 2JA6H 1CE8A 2I87A 3K8AA 1QUQB 1UAPA 4O3QA 4KY6A 5IIFA 1GUWA 3GIQA 5CBAE 3OMGA 2VUMG 3JAML 4QWEA 2QW7A 1K1SA 4R8UA 2R93B 4AIMA 4DV2H 1AE3A 5LYJF 1GJXA 4A3FG 2A69C 4LF7H 1SSOA 4LF8Q 1DV1A 1EIFA 5FKAC 1EWCA 3I4MG 2MQHA 4MNOA 2HDMA 4JI7L 4JCVE 2BR0A 2D2CC 4DAYB 1L1OB 5ISRA 3I12A 5KFMA 4J9MA 5H1SE 1DJRD 1SBBB 2WB1E 5K5PA 4WD3A 1XMQQ 3QOLA 2YZNA 3WO0A 3FVQA 3A8IE 4TVAB 4IJHA 2B39A 3OOCA 4X3SA 3U9SA 5M3MB 2PN1A 1JJ2A 2ICIA 1PYSB 2V59A 4JI2Q 3M9NB 4ZCKA 2FK1A 5EKIA 2Q2UA 2GPSA 2B63B 4RNNA 5GAGC 5IGEA 4DV5L 2AMCB 2IX3A 4I55F 1NAPA 1X6OA 2V4QA 2OLSA 3KFUA 2HJWA 3RIZA 2WDTA 2YRXA 2V4RA 2YTXA 1KAWA 1WFQA 1K28A 2WFWA 3PF4A 4KHPQ 4OONA 3CCQA 3CCUA 4LF4Q 2VY3A 5BN5A 2CCZA 1Y1VH 1G8ZD 1QG7A 1IBLL 3K80C 5KG0A 4TQUS 4XTCS 1F9SA 5D14A 3KTMA 4HJ5A 3I4NB 2J0TD 3Q24A 4DR4Q 4DR1H 1UEBA 4GN5A 4RMFA 1TWCA 4DXFA 3TZDA 4LMYA 3L2PA 5IODA 5IT9c 2HUGA 2YS7A 5BPFA 1H95A 4LAAA 5KGUA 1R9TB 3HKZA 1EQRA 2RGRA 1PH7A 4C3JG 2YRWA 3V4SA 2CQYA 2KBNA 1EZ8A 4GKJQ 1S03G 1Q90A 1CSQA 1EOTA 1I4GA 4BBRG 3GTPB 4NXNQ 3R3OA 1CKOA 4R8UB 1E2VA 4AQYL 3EYYA 1SE3A 1IZ6A 2PQAB 4HR7A 1JOOA 1SROA 4U673 3UDIA 3PO3G 2W70A 2F0GA 5J2TF 4RCNA 4XQJA 5EDWA 3ERQA 4LK1C 1GD7A 2IT1A 2PNRC 2YU9H 2LSSA 4FO2A 4X66Q 4A3BB 2VUMA 5JJKA 1CT1D 2E75C 4HJAA 4A3LG 5DGBA 3GLKA 2I80A 4A3IH 2DJFC 2V1CC 3WWVA 3WOEA 3SHLA 4ME6A 2KUMA 4IPHA 1MZBA 2BOSA 1PH3A 1M7JA 2CZGA 1EYDA 2R6GA 4DR5Q 3B6YA 2Z4IA 1STGA 3SXHA 5JOBA 4JUZA 2NYZD 3H0GA 3QFFA 2YZGA 3V96A 5T1GA 2BCOA 3N6XA 4BY1G 1M6VA 3M4IA 1X3FA 4K0KQ 3KBGA 1SYBA 2E2IA 2EY5A 3K57A 3CMEA 4APVA 4B3RQ 1KRTA 4DR4H 4QIWB 4MV8A 2AU0A 1Y1WH 2W6MA 3K5MA 1HHVA 3JRXA 3GD7A 3OHBA 5CMDA 5GROA 1C4QA 4OX9Q 1EYGA 1LV9A 2CW0C 2OQ0A 4JI5Q 5FLXc 3KJPA 2IP4A 2QK4A 1WCMG 2CQAA 5ELBA 3T1HH 1LTGD 3TSSA 2QILA 2NUCA 3HEJA 3MXPA 1Q82C 2NVQH 1S10A 5L37A 1HUNA 1JB3A 4MV3A 4JI5H 1WH2A 1NUCA 2EVBA 3GV3A 1TY2A 4FDBA 2L1BA 2F0MA 3R2IA 2MNAA 1RL2A 1HZCA 3SK8A 2HGSA 5CV8A 3DEPA 4ZKCB 2W6QA 4JBWA 2AGOA 5E7NA 2GPWA 3W1BA 3DXJC 1YBYA 2L12A 3JRWA 3VR4A 1GM5A 1I94H 3BVZA 5KFNA 2L55A 2WB1G 3J81c 3CCEA 1QZGA 2X0SA 4U7CA 2YL2A 1KAAA 2IX0A 1I94L 3I4MH 1XXGA 3V05A 1O80A 4G7OC 2Z1CA 1U4MA 1E4FT 3CQZB 4F8MA 1UNSA 1S5FD 2YYZA 1VS0A 4OXPA 3S2DH 3MFIA 3QZ8A 5KFZA 4LFBQ 4O0AA 2L11A 1U4LA 5IP9H 3GIPA 4DV5H 2DN8A 4A3GG 3MTSA 4GNXB 4JI6H 4BS9A 2R93A 1EY7A 3K7AB 1D7QA 2E2IB 1SYEA 1D5XC 2R6FA 3NSWA 2B2YA 3EPGA 4A3KB 1WTQA 1SJED 4I65A 1K3BC 5I2XA 4F4YA 2QDLA 2A1AA 1CSPA 3KUPA 4A93G 4L63B 1CA6A 4C3IB 3PN1A 2PO4A 5IP9G 1II3A 3HOYH 2A6ED 1E4EA 3PMFA 2B63A 4DK0A 5C3EB 4PWQA 4O2AF 4YB8B 3P20A 1KDCA 3Q8DA 1W2BA 1T3NA 2UVVA 1SYFA 1OO9B 3K81C 1SFOA 4R4CA 1WTWA 1O7YA 5LHY1 1O78A 2MP1A 2WACA 3PW4A 2NVTH 4JYAQ 4IR1A 1S0OA 3OHAA 1KJ9A 3N8DA 4WJ3M 4HNTA 5JJZA 1WSCA 1JWSD 1IW7C 2YTVA 1TR5A 2CW8A 1K83H 1D1KA 3J80i 3C46A 4GZYC 3RB0A 5KT3A 2CVRA 3DHQA 1L1OC 5C4ZA 3GTOH 3U9TA 1HNZH 2DUDA 2EYPA 1H9JA 2CH4W 1LTBD 1I6HH 4CC6A 3SK6A 1PYWD 3S9WA 1A0IA 1FNVA 1YNND 2NZOA 1JWUD 3L7ZC 2I5LX 3K7UC 2XGPA 2W6OA 3NWTA 3HOZB 3KAJA 4ZI7F 3X3MA 4DL4A 1TWHH 1PX2A 3NEMA 4HTHA 4YJ3F 1B50A 4KKUA 3S1NH 1G2SA 3JAMc 2JA8G 4EGQA 4X3KA 1S0NA 3LMLA 2XRQD 2HHHQ 4XT1B 5C6AA 1G2TA 3MWDA 1SJHD 3GQCA 1PRTD 2ZT9C 4H0LC 2MO1A 2XGTA 3J81j 3J7ZC 2BQ3A 3TS2A 3GIDA 3GV5B 5KFRA 3HKZE 4QMGA 4LF9Q 3HOUB 1SR3A 4QJFA 5CORA 1PH9A 1N36H 5C3XA 1A8VA 2KQ3A 3PW0A 4OELB 1GUNA 3S1MH 3VYSA 3U4VA 1I3QH 2E5LL 3CQZH 4BWGB 3KLRA 1BCPF 2I46A 5IT9L 2FK2A 2R7NA 4DR7Q 5CAEB 3L9AX 2K03A 1GUGA 2PMZB 2I5HA 2BA0A 2W6NA 1BNZA 4TQRA 2KOLA 2R92G 3H3VI 4RKBA 5KFAA 1IOVA 1EUDB 4X62H 2SDFA 5JEAG 5C44G 4DV7Q 4A3JH 4A3IG 2UU9H 5A35A 5EWEA 4UCRA 4X64H 3T1HQ 4JI6L 3KHLA 3T5JA 2K75A 1T5XD 5IWAL 1XNRL 3H4BA 2UVUA 4IN3A 1NMFA 2AGQA 4ZUIA 3R2TA 4JV5Q 1I3QA 2UXCH 1RJTA 4LNQA 3HOWH 4FBTA 3F1ZA 5IWAQ 1XJVA 1ILPA 3V2TA 4ED6A 4A3MG 4YY3L 1ILQA 5GADC 4J6HA 1WTRA 1RKNA 1N32L 5I9PA 2WB1A 5LMUQ 3S2HH 1HNWL 4Q43A 2R8JA 3K58A 4EQOA 1X65A 1GHKA 3H09A 2NN6H 4TKOB 3D8GA 1RJPA 3RGXA 2R7ZB 4M8AA 1TWFB 2W9BA 1I50B 2KEDA 1M0WA 3V6JA 2C2EA 2PZTA 5C4JB 5KG2A 3I56A 2W6PA 1STEA 1UEAB 1EQVA 4DR1Q 4EQ5A 2XRSD 5M5YB 3RR5A 5KIXA 4KI0A 4A3GH 5KRUA 4KK7A 4LF9L 1K1QA 2NVXB 3N43B 3NBHA 2NZHA 5KNBA 1Q1BA 4IZOA 3W5OA 4RU9A 1L2ZA 1DOKA 4R8NA 1CZGA 3A74A 4NXNL 2DNCA 4JBKA 2E2JB 4KD4A 4C3HH 4CJ2C 5AJ3Q 3F2BA 1I3QB 2VQEQ 5L1KA 4QF4A 4X62Q 1F9QA 3UFXB 5JVDF 4HMJA 3MJFA 3PO2B 1HQRD 1VQ8A 4G57A 3TS0A 1RD9D 4HIKA 4NXMH 1DIKA 4KHVA 4DV1Q 1N34L 4HN7A 3H4DA 3TREA 1TWGB 4A3JB 1I4QA 5DG9A 2F0HA 1ASZA 1IKLA 1KDAA 3GTPH 2SCUB 1BQQT 4YHHL 3GO5A 2ZM6H 2XN9C 1SNPA 3BDLA 4IALA 3R8BA 4K6LA 3T56B 4EVOA 5FOBB 1PFBA 4V190 2CW7A 1STAA 1PTOF 3ND8A 1WVLA 1TWFA 5KFIA 5D3IB 3TQTA 4DNRB 5CA0F 1YHBA 4KY7A 2GA4B 5M9OA 3OTOH 2BA1A 3PUWA 4C5BA 4RB2C 2RA4A 2M00A 4LWCA 2M2LA 4XZ3B 2IL8A 4IZ8A 4PZ8A 1ZETA 4IAJA 2F52A 4A3EH 5K2MA 3VPBA 3GTMB 1LABA 1NMGA 4KTAA 1PVOA 4L5QA 1DZ1A 4PQXA 3J81W 1EYCA 1WTPA 2CH4A 1EIHA 3HBLA 2UUAL 1KHIA 3M4YA 4S3SA 4GNXC 2ZTEA 3LWEA 2F0VA 2HQLA 2EY2A 2R85A 2YZMA 3AU7A 1C0AA 2Y0SA 3K5OA 2JJQA 3HOXG 4BBSG 3GTOA 3NXWA 3RV4A 4GN4B 2J7ZA 5EQ0A 1JB7A 1Q46A 4LFCQ 1S97A 1RTNA 4NXMQ 4XIGS 3MR3A 4JVZA 1EQQA 4C3JB 4DV4H 2K5HA 1EHIA 2AUKA 2N78A 4A75A 5M5YH 2Y0SG 1VQ5A 2A69D 3ORQA 1RDPD 3T1YH 2NTSA 2ZM6Q 5IT9W 4RAYA 1HZ9A 1UC9A 4JBJA 1XTDA 1B53A 1U4RA 2H4OA 4YAJB 2ZM6L 1EY0A 4B3SL 4J8QA 5KNDA 1E4EB 4A3FH 1VQ6A 3RB4A 3L3OC 2VQFL 1BXTA 2ATLA 2Z9HA 5LXTF 3PW5A 1JT8A 2RDIA 4KJNA 5DLGA 4L8JA 2ASBA 1MD2D 1FJGH 2QEJC 4QUCA 4YWLA 3L4JA 3NTIA 1Z2OX 3I70A 1HQMC 4PV1C 1KJQA 5CR3A 4DV2L 3NGDA 2CWPA 2B2VA 1FR3A 5LMUH 4CGYB 2VR1A 3GTQB 1VQNA 1EQTA 2FMAA 1FGBD 1PDQA 3K3PA 1EY4A 3PW2A 2YU9A 5FLXE 4Q8FA 3X3NA 1TXYA 4LF9H 3NPPA 3P75A 4H02A 1BBUA 3E0EA 3C0FB 2FINB 2KCNA 4EBEA 3GTMH 1VQIA 4KLKA 4EFEA 1CS0A 4ME5A 2EJFC 4AH6A 4Q0YA 2VXWA 3CRKC 4DXGA 2BDNA 4ID6A 2F0NA 3I4OA 4UPAA 3RGZA 4IPGA 2HHHL 3I73A 4JOIA 4KKSA 2QYZA 4JI2H 3OUZA 3S15H 2Z4HA 1XNQQ 4BXXH 2PI2E 2B8FA 4DUZL 4HIDA 1K0SA 1PFMA 3GTGB 1EYZA 5L1LA 3STBD 4ILWA 1JWMD 3A5ZB 1N56A 5KYIA 3M9OB 3K0XA 1DOLA 1GO3E 1TT2A 4I7AA 3MC0B 4PNYA 3ZYYX 4UCSA 1Y1WA 2ZJQA 2NTTA 2W57A 1IBMH 4A2BA 5LL6b 2K14A 4WBNF 5DNFA 4DKAC 2UXCQ 4JV5H 3H15A 5A2QE 2AQ1B 1GUTA 2ALYB 5A2QL 4LUZA 4RCOA 3IAYA 3BQ2A 1ASYA 2PBZA 1BGWA 3K7AH 3TBIB 3T1YQ 1STHA 1VQHA 3P7JA 1ENFA 4J0MA 3BDOA 4UCVA 2C9OA 2JQOA 3CRLC 1SNCA 4X62L 3DWQA 2F4IA 2R3ZA 3J81E 3TIGA 2QA4A 3CKIB 1SEIA 1JE5A 1WJJA 1QNKA 2R7ZG 4RB3C 2L4NA 3JAMW 1YHAA 3M3YH 4POGA 4QQBX 5DG8A 5EAYA 1XTCD 4FXKC 4F4ZA 1B44D 4IUNA 4UY8C 2X69A 1PTOH 4R4QA 5KFUA 1RTOA 1B1ZA 5M3FG 3KHGA 4ZRZA 2D0PA 2EYMA 2DY8A 2Z8LA 3K3VA 2W8LA 4CJ1B 4B9XA 2JA5B 2EOTA 1KQSA 4YBZB 3RZDB 1QVCA 4O42A 3OMCA 1G6PA 5ELEA 3D0FA 1Y1WG 5C0XJ 3T5KA 5NUCA 2WKCA 1SE4A 1AUXA 5KFEA 5FJ8H 2ICEC 1AUVA 1LT5D 5LA6F 5CGKA 3CCJA 1E2ZA 1D5MC 3K6OA 1KRSA 1ET9A 1SNQA 3BZKA 4IUPA 4QCLA 4LJZC 1H9KA 3BQ1A 2OTLA 2UXDL 4DL6A 1XMQH 3NQIA 1YJ9A 3BU2A 4TV8F 4QWCA 3SE0A 4GLAC 1B33N 4Y8VB 4TUYF 1E3PA 5BR8Q 3KDFA 3HOZG 2EYFA 1A2TA 3ORRA 4FS2A 4PMWA 3T53B 3Q8PB 1FJGL 1QJOA 2WE6A 5GAHC 2RVLA 4DN4M 1Y1WB 2PW7A 1X55A 1MGSA 3G6XA 1U4PA 3RB6A 4ECTA 4P74A 2JA6G 2RGVA 3LNNA 5D3DA 4IUQA 4DGZA 5D1PA 2R7DA 1HNWQ 1EUCB 4ED3A 1WOCA 2JA7B 5FD6A 2VS1A 4LF6L 3Q6SA 4L5SA 3RTXA 2JA5H 3UDFA 5L9XA 4LF7Q 1JOQA 1NR4A 3TIIA 4RKLA 1B9MA 1TKWB 3UQ8A 2RHQB 2C2DA 5EPLA 3J7AV 3M3YB 4IR9A 1N33L 1MSHA 5CV9A 3PVXA 4X3TA 2MO0A 3HKZG 5KYLA 3MWEA 4DK3C 1QB5D 4JPBW 5K36H 1UNNC 5J2UF 1PTOB 3SEBA 2R82A 1BDOA 4JV0A 4F4XA 4RHRA 2JEIA 3FDSA 5JJLA 2KECA 1K8MA 4DNIA 5KEEA 1E0BA 1SMYC 4A76A 1VBHA 4DR6L 1GUOA 2J6SA 4OO1G 2UXCL 3NP8A 2KCMA 4IRKA 4K2KA 4LF5L 1QUQA 4GN3B 1Z2PX 3DMUA 4DLKA 4K5VA 2ASJA 2O4XA 4K14A 1T5EA 4X3UA 1VQ9A 4O4LF 3RN5A 3RLOA 3IN5A 4RGTA 4O2DA 2ZDGA 1CKMA 4JW0A 2Q2HA 3NHHA 2P0AA 3LWBA 2W8KA 3GP7A 2FLPA 5EKLA 2HVQA 1VF5C 3BDCA 5GONF 4J9LA 3F8NA 1D5ZC 5C0XI 4C3HG 4DV0L 2K28A 4R1JA 3JAMi 2KJXA 5EBDA 1OTCA 1FJGQ 3QG1A 4BY1B 1LT4D 1I5FA 5J1ZA 3BVGA 4IUVA 4GOPB 1BUVT 4DAYA 3S16B 2FE3A 1N36L 1TWAB 2VUMH 1C48A 3NWSA 2F0EA 4B9WA 5G3LF 5C8YF 1A9XA 1IBLH 4L1KA 1LTSD 2J6UA 3FRPB 4YWMA 4MV1A 1UE5A 4WORA 1RK5A 4C2MA 4XQNA 1CKNB 3KF8B 2FK3A 3J80c 1I6UA 3URYA 2E74C 3CPWA 5C4XB 4EBCA 5I47A 3NBHB 1HNWH 5LMNQ 2Y0SB 3D4WA 4NMZA 4P73A 4DV4L 1ENCA 2ENBA 3M4PA 1CUKA 4ECQA 1BCPC 2A74C 4KMUC 3Q1KA 3CCSA 3OTOQ 1YZ6A 3P1HA 3IG0A 1TA8A 4DR7L 3N42B 3HZXA 3GTKA 1CA5A 1JC7A 2K33A 4FNFA 2YW2A 2CQOA 3I8ZA 1NCVA 4J9NA 4YR0A 1QILA 4PG3A 3RLFA 3FKIG 4G7ZC 1S4ZA 2K5NA 2ZXPA 3A55A 2WB1B 3MWYW 1L0YB 2E2HB 4EG0A 1YEZA 3F2DA 3HG9A 3SGIA 1C9OA 2KHJA 2R61A 4FF1A 5KFQA 3PW7A 2F0KA 1Z7TA 3QJYA 1F9RA 1I6VC 1V1PB 3PIP3 2D62A 4WFN3 2W9CB 4LFCL 4LFAH 1HNXL 1CZWA 5M5XB 1B2TA 2NVYB 5IP7H 1KC7A 3L0OA 5DQIA 1N8RC 1LT3D 1DV2A 1IYUA 3PO3B 3N52A 4NPSA 4YQWA 3GTJA 2OF1A 5KFBA 3S1QB 2FXQA 1LTID 1PHJA 1SNMA 2ES2A 1NJIC 4YP3A 3QWNA 4R4OA 5C4HA 3I4LA 3RZOH 3MR5A 4EBDA 3TQYA 4JI1H 3MXNA 1QCBD 5DEHA 4CKBA 3HOXB 5KFTA 1N36Q 3VR5A 4K0KL 4LF8H 1JJGA 4FU0A 2OT2A 4CDCC 4LSXA 2FPIB 3TP6A 1JIHA 2FLLA 2FHTA 4PZ7A 1CHQD 3EQLC 2D0OA 2I8CA 2E2HA 1HR0L 4DV0Q 4X6AH 4CBVA 1SNDA 3CCMA 1RODA 4JYAH 3AFPA 5DQGA 3HOVB 4BY7G 1EOVA 1QVGA 5IOCA 3NK9A 1RJRA 4NDXA 4AYBA 2NU9B 1Y8NB 1L0WA 2OH2A 1TU2B 2NN6I 4H44C 1PH1A 2UUCL 4DUYL 4FBUA 2WAQG 1G91A 1HH2P 4C2MH 4A3KG 4ED2A 1EYAA 4K2LA 1DYQA 2UUBQ 3MXGA 4LUVA 2PI2A 4XDXA 2C2RA 1A2UA 2K5VA 5C5LA 1CTMA 1VQEA 2XVSA 5CV6A 4ETSA 1JDEA 2GVBA 1JLLB 2JE6I 1J5EL 2A68D 1BXRA 2SNSA 5KT6A 3WDNA 5IGGA 2VQDA 1TVXA 2AWOA 5EPKA 1NTGA 3F8TA 2EZVA 2LY7A 2JEAI 1PH5A 5E4XA 3V4ZA 5I4DA 4DAVA 4JV1A 2NU7B 2FFKB 3HOWG 2A6HC 3ULJA 4FYDA 2G9HD 4Q8EA 3H94A 4ODGA 1B8AA 3MZ5A 1ESFA 3SR1A 1J8IA 4OWWB 5D1OA 3I4MB 2JEGA 1KBLA 1SFOH 4RAZA 3GTJB 2NVXH 2XNAC 4ED0A 4LF5H 4HAEA 1VQOA 1WCMH 4YCUA 4AYBB 5IYBG 3MEHA 1PH2A 2NN6G 5EWFA 4IRDA 1S72A 4KHPL 1M1KC 5I6YA 1JCKB 1M0TA 2D9UA 3T13A 1Y1VG 3I55A 4DUZQ 1SCUB 4Y7NB 2UU9Q 2IJ0A 2L9HA 3BABA 4QB4A 4O3OA 2NVYH 3UI2A 1WR2A 1ZQ7A 3T5HA 2HVSA 2R93H 2O5JC 2BH8A 4Q45A 2OTJA 5L1JA 4DPGA 4HSPA 1S5DD 3OWFA 3KXYT 4CKEA 1KEEA 5FK9C 2JA7H 2UXBH 1D1IA 5KFLA 2F0FA 4TSSA 2F03A 4IRCA 2E2HH 1VQPA 4FVMA 2NU6B 5KFSA 2QDBA 2F0IA 4JI7H 3PIOA 5DG7A 3G48A 2JA8H 1BCPB 1KD1C 3H20A 3H40A 1DGSA 3PF5A 2A6HD 4QWDA 4LF6Q 2JA9A 1XYIA 1OXXK 3D6CA 5FO7B 4J9RA 4IQZA 4NP5A 1B3QA 1CKNA 1UUPA 1K83A 3DWPA 3PUYA 4DV7L 1BR9A 1OXUA 5FO8B 5EWGA 5IYCH 1XMOH 2EXZA 2ZJRA 2F4VL 1SLJA 3DF7A 2K5DA 1UE6A 3LWUA 1AN7A 1F9PA 3FKIA 4MA0A 1RHPA 2R92B 1XDNA 1RF2D 4X65L 2R7LA 2C22A 1YJWA 2B2WC 5LMUL 5KFGA 1B6SA 1JMCA 3BG3A 4ULLA 2F0LA 2B63H 1N32Q 3E0JA 5D1OB 4JI4Q 1PMRA 2HIXA 5IGBA 1WCMB 4HYKA 5L1IA 3KDFB 4RWSC 5D8DA 2KEEA 1SFOB 2AUJD 4YY3H 5HBRB 3MHBA 1XNRQ 3OHXC 4BY1H 2DNEA 4DR6Q 4EYHB 3SDZA 1EY9A 2W7PA 4DL5A 5LL6S 5KG6A 2K5WA 3HOZH 1DM0B 3I2ZA 4XYLB 1N48A 1TWHB 1IYJB 1XNRH 2R8IA 2LXKA 1J5EQ 5LL6X 2QGQA 2MGSA 4DAPA 2VQEL 3NE5B 3FDTA 1F77A 1ESRA 4J15A 1HNZL 5KFFA 2IHEA 2CWAA 4KY5A 4DR4L 4FS1A 2B2WA 2E5LQ 3M4QA 2XWJB 2DPIA 3TQ1A 5J22A 4FM9A 5KT2A 3CC7A 1QE6A 4J9KA 1S0MA 2F3IA 4N9PA 5CV4A 4DA2A 5JPMC 1EFWA 2XD4A 3VPDA 1MKHA 3NUCA 1B4OA 4N8X1 1EWIA 2PYKA 2Z6BA 1AZPA 4JI3Q 2K50A 2GN5A 1IXRA 2CFMA 2V4DA 4OIJA 4DL3A 2VQFQ 5CA1F 3MR2A 4DV0H 2VQEH 1AZQA 4HR7B 4DUYH 2AQ3B 3UDXA 4DAMA 2B2TC 2L5TA 4MAMA 5EZYF 2R92H 4U68A 1I4PA 5KFVA 5KFDA 1EZ6A 3OPOA 3C1EA 3CCRA 1SYDA 2HCIA 1PH8A 3J7YW 3TP8A 5F9NA 1VQ7A 2RCNA 2WYOA 1B3AA 3ZJYC 2UUBL 1J5EH 1C30A 4UCUA 4JI8L 5KT5A 4ECSA 1EY5A 2R7KA 4F4WA 5E3FA 3KOJA 5CC4A 2E2IH 3ND9A 2A5HA 1ZYRD 4RZRA 1CK1A 1FGUA 1V1PA 2BE5D 2PMZA 4HNVA 4C1NI 2KCTA 4JI0Q 4JI8H 1KL9A 1LUZA 3LP8A 4KHZA 1E2WA 1Z47A 3AFQA 3H0GH 3GTLB 4Q44A 2F0WA 3BQ0A 2L15A 2YS6A 1K8AC 1I4XA 3J80W 1X9NA 2NZ1D 1JKJB 2JN4A 1NBWA 1MIUA 2QEXA 1Y8OB 3EJIA 4R7RA 2UUCH 5C5MA 5AJ3L 1TWHA 1BNCA 2B2UC 5C4XH 3FMCA 2XSCA 2LXJA 1UE7A 3RZDH 4Y52H 4A3MH 3OUUA 2IWHA 3MAQA 1K73C 4OIKA 2UUAH 3KALA 3U9OA 1Y69U 1ULZA 3S2DB 1PH4A 1JE4A 2WTFA 2B2TA 1JQYD 3DM1A 1I4RA 1P8LA 2KENA 1F2LA 3RNUA 1KC8C 5M3MG 1Q12A 2C35B 4A3MB 3CD6A 2OQKA 5JAVA 1PTOD 2K04A 1PH6A 3OTOL 4J9OA 2VOBA 3OWEB 2PZUA 4M9UA 2LMCB 1K3RA 5KFJA 4TRDA 2OXPA 4R4TA 3WOFA 4OEMB 5LMNL 4A3FB 2HVRA 2NBFA 5H80A 4IOCA 3ICEA 4A3IB 4EGJA 4F87A 1NR2A 2R93G 1S5CD 3GTLA 4ZOLF 1LTAD 1TWAA 3DEOA 4DV3Q 4C5AA 2B2UA 3M7NA 5BMVF 4N9TA 3Q8RB 4MZ9A 1Q81C 3KHRA 3J7AF 1CQIB 3F2UA 1GGOA 4XYMB 3KBXA 5JH7F 2UUBH 1IL2A 1MSGA 1HUMA 4C3JH 2PNHA 2UXDH 1DOMA 2F3WA 3BZDB 1VQ4A 2UUAQ 1VMCA 4WJ4A 1DXMA 1LACA 2RHSB 3SVMA 2VUGA 3Q8QB 4RGNA 2GVAA 4RNOA 1VKZA 1VAJA 1NNXA 1O7LA 1C3OA 4BBRB 3NQTA 3W2DA 4RAUC 2OEOA 2XCPA 2B2YC 1MHWC 1ICWA 5BR8H 4GKJH 2YYAA 3J7A5 3N40P 4P2CB 4RGMA 1IL8A 1B9NA 1QZHA 4X65H 1UWVA 3HRZC 4HQ6A 3ERSX 3RN2A 5IY0A 5M5XH 2KA7A 4DNTB 5CB4F 2XCAA 5K36G 2JXMB 5DAUA 4IHJF 1EWHA 1G291 3WO1A 4F7XA 1CM9A 5T14A 2XTIA 1X56A 2RSNA 3PUXA 2YV5A 1YJNA 4RB0A 4OHJA 4H13C 4B08A 1YI2A 3IFDA 4A3BH 1GSAA 1CI3M 1CQFA 3S1MB 2FP4B 1F2ZA 4DV1L 2A73B 4MN3A 1L1OA 5C44B 4ABNA 5BR8L 1G51A 3HOVH 5KFXA 4U6PA 4DR6H 4A3CH 2D5DA 4IFDI 1N33Q 1TWCH 2I5MX 5IE8A 3MWMA 4RB1A 3SI8A 2L0CA 2Z0SA 3HFZB 3ER0A 4EEQA 4O3PA 3LX0A 3G6VA 1SMYD 1SYXB 2W9AA 4DV6H 1KDBA 2KHIA 1X32A 1WCMA 5DLFA 3J81L 3R5XA 4K5XA 2UUCQ 3CCLA 1ZHSA 4ALPA 2NVXA 1SDFA 4EX5A 4IUTA 3D4RA 3EIVA 4ZHQF 3C1FA 4G7HC 2XCLA 4IFDG 1TY0A 4AQYQ 2FMMA 3W1GA 3EFXD 1TS2A 4I50F 3VA5A 1KIXA 2UXBQ 1V8QA 3RAXA 4IWYA 3N6RA 4RA8A 4N8FA 1XX8A 1PRTC 3Q23A 3VA7A 3RBDA 3DUZA 3VYTA 1JDBB 1TWGA 1I4HA 3O13A 5EOYA 3CCVA 2EIFA 1JXLA 1A15A 4UP7A 4POFA 4B3ML 1V9PA 5KFOA 5COYA 1SE2A 5C3WA 1M8AA 1NSNS 2K5QA 4GC6A 2UVRA 1GVPA 1I50H 4JK1C 4RHSA 2B3GA 2RSOA 1PA6A 3V6HA 4LF4H 4X66H 1LYLA 5JEAH 5C44H 2AQ2B 3ETJA 2M9VA 5FPRA 1S68A 1MBYA 5T1IA 3G6EA 3TN2A 5C4JH 2F0OA 3T5LA 1WTOA 1R9TA 1E7ZA 2VPQA 4OO1H 1ZYRC 4IUUA 1HPCA 1SNOA 2K32A 4DK1A 1XMOQ 5F9LA 2A19A 1Z9FA 4XT3B 5KKNB 2MUYA 1IBKH 1CQJB 4IPCA 3A54A 4X64Q 3HOWB 4L5RC 2VUMB 1A63A 1F2YA 5C1OA 2NVYA 1LM0A 3AEVA 1T9HA 2BH2A 4DR7H 5C5JA 4ZUJA 4RZQA 5JQWA 4XYQA 3I3CA 2XIWA 5M3FB 4OX9L 1PLFA 1VQFA 3UE0A 2JA7G 5IWAH 3ETHA 4AYBG 2MFIA 1KXLA 4G4KA 1PYBA 5C3EG 4OX9H 5BPHA 5FLMH 5IGCA 2ATWA 1ZKOA 1GOZA 1E22A 1H9SB 5IP7G 4IFDJ 3T16A 5IGFA 4E6IA 1HR0H 4QUFA 3K5HA 3GTOB 3OSNA 5KFCA 1NE3A 4PMBA 1KLUD 5EGTA 4BBSH 4KN4C 4JI3L 2F0UA 4I4TF 1TWCB 3T1YL 4A3GB 4O4IF 1WD1A 3S14B 1HXYD 2YTYA 4ZKBB 5KFPA 2H5XA 3M4OH 2HHHH 1WTVA 2C28A 3H3VC 3GTQA 3GTMA 1Q1EA 1U9RA 3NTKA 5C0XG 4CHTB 3WNZA 4BY7H 1FNUA 4DV3L 3C3LA 5ELDA 2RDFA 4LW1A 3QR8A 2EXDA 1TS4A 3GILA 2UVWA 2OWOA 2RCFA 1SYCA 5KT4A 4QGUA 1HFGA 2CW0D 1DCZA 1DONA 1YNXA 2WV6D 4DK6C 3EA6A 1B6RA 4DR5H 1V43A 2WAQE 1MI2A 3JSLA 4DUYQ 4GKKH 4BY7B 2QF7A 4DR5L 3RFCA 1YITA 2F0QA 3GQBA 2O2LD 4DL7A 3KF6A 5M3FH 3CW2C 1EU3A 4OWXB 3A56A 1GSOA 4QWAA 4QIWE 2E2JH 2MPMA 2YU9B 2E2DC 4JI2L 1V51A 3NENA 3HOYG 5IYDG 1L0XB 4ZQ3A 3AMUA 3PGZA 1V1QA 1SE8A 2EQSA 4YWKA 3FKIB 2V5AA 1OXSC 4J9SA 2I07B 4FXDA 5EJWA 2R7ZA 2HCCA 2BDOA 2I0QA 4O3RA 1AN8A 3QB3A 1EIGA 1J9OA 2TSSA 4A3CG 2K1BA 1GYFA 1WTXA 4B3SH 2LS01 1N33H 2RDHA 1K83B 3A8KE 1KJ8A 3GTQH 1BKBA 3BJUA 4ECYA 5I6WA 3AQQA 3R93A 3I91A 2Q2IA 1KTKA 3ITPA 2RQXA 1HNXQ 3K5LA 2PMZE 4DUZH 1VQGA 1VQAA 3GIMA 1QVFA 1E1TA 4DV5Q 4JI8Q 4GNXA 3OW7A 1AP0A 4A3DH 2W9CA 3EN2A 3ULPA 4MIUA 1W6KA 5M3MH 3S14H 1W93A 3GDEA 1PFSA 2AHOB 3TINA 5F2DA 4BBSB 4BXXG 1TQOA 2N88A 2DLNA 2ZXOA 2W6ZA 1H9SA 3FHWA 4IJLA 4LF4L 3BA8A 2M05A 3KF6B 1HZAA 2Y0SE 1STNA 5JVLA 1L2FA 3G8CA 4RGOS 4A3DG 4MV9A 1IKMA 4P71A 3G6JB 1YHQA 4CKCA 4UCTA 4FF4A 1Y14B 5E4WC 2YCHA 2JA7A 5ELCA 4RG1A 1WYDA 3Q8SB 4LFBH 2VPSA 4TV9F 1JORA 2IA6A 2IX1A 3H3VH 4BA2I 4ZQIA 1T94A 2DGYA 4UDUC 5HV6A 3KLSA 1N9WA 2F1MA 4IFDH 1Z6HA 5A2QW 4ECRA 3HXLA 5M5WH 3ONAB 4A93B 3JAME 2N49A 4B3SQ 3KJOA 1EY6A 1X3EA 1OXVA 2H1EA 4HCSA 3S17H 2PQEA 4IO9A 1NY4A 1PZID 2PVPA 3ULLA 1YNNC 3G7LA 3RB3A 1GKHA 5FLXL 1WD0A 4FF3A 3AB9A 1HJPA 1STBA 1U0LA 4R9WA 1TAEA 3QZ7A 1VCIA 2V9WA 4B3RH 1D8LA 1PFNA 3S15B 2B2VC 2EJGC 4NW2A 5FLMG 3GTKB 2P5ZX 4C56C 1W96A 2EYJA 4UP8A 3STBC 5DM63 1PRTB 1A62A 1W3SA 2DIKA 2UU9L 1IW7D 3HKSA 4NXML 2FJZA 1LTRD 2WAQA 5JVG3 1S40A 4J9PA 5DGAA 3N41B 1P16A 1A6XA 2RKSA 4ZYSA 4JI1Q 5FO9B 1HR0W 3OSOA 3G4SA 5FJ8G 4A3BG 4K8JA 4QY7A 2JEJA 2EYHA 1E24A 2NWGA 1A3VA 4JI1L 3J81i 3CF5A 5KFYA 3S16H 2RDJA 4ECZA 5CYUA 3KF8A 3E5NA 4C2MB 4K5WA 1VQKA 3C2PA 3BJYA 1Q7YC 4B3RL 4ZAIA 4ECUA 1X3PA 1OXTA 2F0PA 2K6AA 2EDGA 3MXNB 1BF4A 2XGQA 5ELNA 3J7AK 1HR0Q 4FP5D 2KCCA 5HY6A 1EL0A 3CU7A 4O3SA 3VYRA 2JEFA 3VDYA 1Y8PB 1J6QA 3S17B 1ZHQA 1IBMQ 4OL7A 1SMXA 1VMPA 1V1OA 3Q2OA 2FLNA 1T36A 1O7IA 4K6DA 3E3XA 4KKTA 1I50A 3PR5B 3GIKA 4F50A 4HCEA 5EKKA 3QO2A 4LF8L 4K0KH 3OIQA 3TDQA 3BG5A 1SN8A 3I72A 4QWBA 4Q0FA 1HA5A 2JYOA 4HJ7A 1XPRA 2IHFA 3G6YA 2AKWB 2ZJPA 4CDEC 4GOPC 1JR0D 3DWAA 3PSIA 1PZKD 2F4VQ 4X64L 5M5WB 4A93H 1S9FA 1TIID 4H7BA 3VR3A 4LFAL 1N34H 4EQNA 5IT9E 3K0YA 1LLRD 1A3UA 1R4QB 4A3LH 2PQAA 3GIJA 2J6TA 4WJWA 1GHJA 4TQSA 5BN4A 2E8GA 2B29A 3TP5A 4O1NA 3D3RA 3PUVA 2DWCA 1XPOA 2R7FA 1K8OA 2N3SA 4DV3H 2R8KA 1QWYA 5CV5A 4YAKB 2R87A 3I90A 1Z2NX 4RFBA 3M85A 2E5LH 1VF7A 5C4XG 3PV0A 2HQEA 2FJ2A 2O5IC 4MTDA 5KG7A 1YNJC 1PTOC 3MFHA 2JP1A 2WKDA 4DV4Q 1VQBA 2WP8J 3PO2G 5KT7A 1IBKQ 3CC4A 2PZWA 3S1RH 5CBEE 1BBWA 4JI3H 2JA8B 2MJ8A 4PDBA 3MA2B 4GOPA 2EY1A 4A2AA 4EQPA 1HCZA 3DM3A 1RYSA 1SYGA 3GIIA 2JK8A 1LO5D 1GSHA 1HTPA 4JOIC 3D6WA 3MR6A 4CJ0B 2JA5A 4YY3Q 5GAEC 2R86A 3H0GB 3F2CA 3MFYA 1XMQL 3HB9A 3A0JA 2EPBA 4C3IG 3EBEA 3HOUH 1XPUA 1LTLA 2N8NA 4V0BA 2DZDA 1BBXC 4NXNH 1BVSA 4YCVA 3QOJA 1I7NA 2JEBI 1K8GA 2BQRA 1XWEA 4IURA 1FKAH 2RF4A 4GKJL 1O75A 2PPBC 2V58A 4JG2A 4JI5L 3RF2A 2KVMA 3E9HA 3QIAA 3T51B 1V4YA 4LUOA 5CV7A 1R9TH 3MVVA 1EZ1A 4P75A 3CAMA 3H91A 1HNZQ 2VA2A 4JI4H 3V6KA 1ZXTA 2K7VA 5KX5F 1LTTD 1Q8IA 2Q2TA 2NB0A 4JV2A 4MV7A 1Y1VA 5KG1A 1IBLQ 5LP6F 1GXDC 2R7MA 1CHPD 1TWAH 4DR3Q 3H0GG 3HKZB 4EFBA 5KFKA 4B3TH 4DV2Q 1ET6A 4YR2A 2WINB 2VW9A 2VQFH 2DPJA 2VL6A 2HT1A 3CPFA 2XC9A 3CMAA 3OYYA 1XNQL 1H9MA 3FKIH 3CVZA 3UE1A 3RD4A 3W3AA 1FD7D 3BA9A 1EY8A 2K01A 3OIPA 5LMNH 4BA1I 1CFMA 1PZJD 4UP9A 3TMEA 4O2BF 3RUZA 3KAKA 1JJCB 3TZUA 2WIIB 3RAQA 5I2YA 3IRBA 4GS3A 1IHZA 1YVCA 4C3HB 3VPCA 3KHHA 3IFTA 3RJ0A 3BZCA 1PRTF 1EU4A 1AE2A 1CQVA 4GLXA 1TS5A 3VMMA 5DQHA 1BCPD 5ELOA 4X65Q 1M4VA 3S1RB 1KNEA 3FPUB 3EROA 2QKIC 1N34Q 2PCFB 1STYA 3S1QH 4HJ9A 2BE5C 1VBGA 4GKKL 2ALZA 4QL5A 3RLNA 4ECXA 2EJMA 4MHEA 3NTHA 2ASLA 2CKZB 3HOXH 4F88A 2F0DA 5D65A 5C0XH 1XMOL 5FLXW 1SEBD 4LH7A 2GLTA
chains in the Genus database with same CATH topology
1G51A 3HOVH 4A76A 4DR6L 3UDGA 1D7QA 4A3CH 4OWTB 1MJEA 4IFDI 1N33Q 4OO1G 4HIMA 1TWCH 2I5MX 3KLWA 4JC0A 2KCMA 5IE8A 5IYCG 1VQMA 1VQLA 4LF5L 1QUQA 2Z0SA 3ER0A 3HFZB 4GN3B 2A1AA 1CSPA 4A93G 1MJCA 2KHIA 5IP9G 4A3KH 3HOYH 3E9IA 3Q8DA 1W2BA 3GTLH 2UUCQ 1VQ9A 3PO3H 3RN5A 3CCLA 3RLOA 4ALPA 4DR2L 3K81C 4IPDA 4R4CA 4O2DA 4EX5A 1CKMA 1X3GA 2Q2HA 3EIVA 1YIJA 4IFDG 4AQYQ 4PZ6A 2HIVA 3W1GA 2NVTH 4JYAQ 5C0XI 4DV0L 4R1JA 1KIXA 1RIPA 2UXBQ 4WJ3M 3JAMi 1FL0A 1OTCA 2UXDQ 1FJGQ 2YTVA 3PIPA 1K83H 3J80i 3CCVA 2EIFA 4JI0L 1I5FA 2Z6KC 4UP7A 1V9PA 4POFA 1L1OC 3TEHB 4GOPB 3MEFA 4B3ML 1N36L 3GTOH 1VQJA 2DUDA 1B7YB 1UE1A 5GQOA 2VUMH 1GVPA 1I50H 1PA6A 2B3GA 4DR3L 4JV5L 2ZTDA 4A3LH 1IBML 1I6HH 1LYLA 1WI5A 5C44H 2VZAA 1FVIA 4YCWA 4YWMA 1A0IA 1UE5A 2NZOA 3CP0A 3L7ZC 3HOVG 3G6EA 5C4JH 2I5LX 3K7UC 1CKNB 4JBMA 1E7ZA 3KF8B 4B3TL 2K4KA 3J80c 1TWHH 3M9BA 3CPWA 4A4IA 3NEMA 1XMOQ 3NBHB 3S1NH 2A19A 5LMNQ 1Z9FA 3JAMc 2JA8G 1C7YA 4IPCA 4MTNA 4P73A 4X64Q 2HHHQ 4DV4L 4GNXB 4L5RC 4ME3A 1A63A 3M4PA 3CXCA 1CUKA 1LM0A 3AEVA 3A5UA 4HJ8A 1T9HA 2MO1A 2BH2A 3CCSA 2XGTA 1Q8KA 3J81j 3J7ZC 4Y7NH 1YZ6A 3OTOQ 2ZTCA 3TS2A 4DR7L 3HKZE 4LF9Q 1SR3A 4QJFA 4OX9L 1PH9A 2JA7G 1VQFA 3D31A 3UE0A 1A8VA 4AYBG 4BBRH 2MFIA 1KXLA 3I4NG 3S1MH 2Z6KA 1PYBA 5C3EG 2CQOA 3CC2A 3U4VA 1I3QH 5FLMH 2E5LL 3CQZH 2ATWA 5JJIA 4PG3A 3RLFA 3FKIG 1E22A 5IP7G 4IFDJ 5DLQE 2K5NA 3GTJH 4DR7Q 1NE3A 1YEZA 3F2DA 3SGIA 1C9OA 2KHJA 5JEAJ 2I5HA 1EUJA 2BA0A 4BBSH 4JI3L 2R92G 3H3VI 2D62A 3T1YL 4LFCL 5JEAG 5C44G 2YTYA 4DV7Q 4A3JH 4B3TQ 1HNXL 2H5XA 4A3IG 3M4OH 5IP7H 3L0OA 3T1HQ 4JI6L 1N8RC 1Q86C 4NPSA 2K75A 1XNRL 5IWAL 1Q1EA 2FXQA 1NMFA 1PHJA 2ES2A 1NJIC 3FP9A 4NB3A 5C0XG 1K9MC 4JV5Q 4R4OA 1U5KA 4BY7H 3RZOH 3TQYA 4LNQA 3I7FA 4DV3L 2R7ZH 3HOWH 3S24A 1N36Q 4LW1A 4A3JG 3F1ZA 5IWAQ 2EXDA 1XJVA 4K0KL 1JJGA 4A3MG 4YY3L 2OCEA 5GADC 3T1HL 2OWOA 4JI6Q 1N32L 4QGUA 4PZ7A 1YNXA 2D0OA 4DR1L 3GTGH 4DK6C 1HR0L 5LMUQ 3S2HH 4DV0Q 1V43A 1HNWL 2WAQE 4LFBL 4X6AH 4DUYQ 5IYDH 3CCMA 1HZBA 4JYAL 3AFPA 4BY7G 1EOVA 1X65A 1AH9A 1QVGA 4DR5L 1YITA 2UXBL 1L0WA 1K0RA 3KF6A 5M3FH 2NN6I 3CW2C 1PH1A 2UUCL 4OWXB 4DUYL 1I94Q 3I56A 4QIWE 2E2JH 2WAQG 4JI2L 1TWFH 1HH2P 3NENA 4C2MH 4EQ5A 5IYDG 4DR1Q 4A3KG 3HOYG 3PGZA 1V1QA 1SE8A 1X54A 2EQSA 4YWKA 3RR5A 1OXSC 2UUBQ 4KI0A 4LUVA 2PI2A 5J3BA 3OW2A 4A3GH 2K5VA 4LF9L 2I0QA 4A3EG 3G71A 1VQEA 2NZHA 1Q1BA 2GVBA 2JE6I 3W5OA 1J5EL 4A3CG 3A74A 1VQDA 4NXNL 2AWOA 4JBKA 3GTQH 1BKBA 1NTGA 3BJUA 3F8TA 4C3HH 5AJ3Q 3F2BA 2VQEQ 4B3MQ 3AQQA 2JEAI 4X62Q 1PH5A 2Q2IA 3AYHB 1HNXQ 4GKKQ 3HOWG 2UXCL 1VQ8A 3ULJA 3TS0A 1EIYB 3TRZA 2PMZE 4HIOA 1VQGA 1VQAA 4HIKA 1QVFA 1E1TA 1B8AA 4DV1Q 4DV5Q 4JI8Q 4GNXA 1N34L 4OWWB 3U4ZA 4A3DH 3EN2A 3ULPA 1SFOH 3TREA 2NVXH 3PCOB 5M3MH 3HOUG 3S14H 3NELA 4DR2Q 1ASZA 3GDEA 1PFSA 1VQOA 1WCMH 2AHOB 4YCUA 5IYBG 3GTPH 4YHHL 3GO5A 4X66L 1PH2A 4BXXG 2NN6G 1S72A 4L5TA 4GLVB 4KHPL 3FHWA 4IJLA 3DLLA 1M1KC 4LF4L 4OO1I 3KF6B 2VNUD 1HZAA 2Y0SE 1L2FA 4A3DG 1Y1VG 4JI7Q 3I55A 1S3OA 4P71A 4DUZQ 1YHQA 2UU9Q 3U50C 1Y14B 1YHBA 4R4IA 2NVYH 4RG1A 2BA1A 3PUWA 1WYDA 2R93H 2BH8A 2B63G 2OTJA 4LWCA 1SRUA 4DPGA 4PZ8A 2JA5G 2IX1A 3H3VH 4BA2I 2F52A 3U58A 4A3EH 2DGYA 2JA7H 1NMGA 1PVOA 4P72A 4L5QA 1N9WA 1PV4A 2E2HH 1VQPA 2AWNA 3PIOA 2UUAL 3G48A 1KHIA 3PUZA 5M5WH 4GNXC 2JA8H 1KD1C 4DV6L 2N49A 1VQCA 4B3SQ 3KJOA 2ZTEA 1DGSA 1X3EA 3PF5A 3PO2H 4LF5Q 1OXVA 2HQLA 3LGJA 3S17H 1C0AA 2IY5B 4LF6Q 2JA9A 4IO9A 1NY4A 3HOXG 2JJQA 4BBSG 3ULLA 1OXXK 4DV6Q 1GKHA 4GN4B 5HGQA 1TWGH 1CKNA 1JB7A 1HJPA 1U0LA 3PUYA 2K52A 1Q46A 4C3IH 4DV7L 4LFCQ 1OXUA 3I4NH 1VCIA 4XIGS 4NXMQ 1D8LA 5C3EH 1EQQA 4IOAA 5IYCH 5FLMG 2ZJRA 2F4VL 1SLJA 1E1OA 1IBKL 2K5HA 4UP8A 3STBC 1UE6A 2N78A 4A75A 1A62A 1W3SA 5M5YH 5LMNW 2UU9L 3HKSA 2Y0SG 5IYBH 1VQ5A 4NXML 4LF7L 1S40A 4X65L 1P16A 2ZM6Q 1YJWA 4JI4L 2ID0A 3KYHC 4JI1Q 5LMUL 1HR0W 1M90C 1JMCA 4AYBE 4YHHQ 1HZ9A 3G4SA 2B63H 4JBJA 1XTDA 5FJ8G 1N32Q 4A3BG 4QY7A 1E24A 3GTKH 3JC66 2ZM6L 4JI4Q 2HIXA 4JI1L 3J81i 3CF5A 4B3SL 2A8VA 3S16H 3KDFB 1B70B 4A3FH 1VQ6A 1VQKA 4LFAQ 2VQFL 1Q7YC 2JA6H 4B3RL 1XNRQ 3K8AA 1QUQB 4BY1H 4DR6Q 1JT8A 1OXTA 2ASBA 3MXNB 2VUMG 5ELNA 4YWLA 3HOZH 3I2ZA 1HR0Q 4DV2L 5HY6A 1IYJB 4AIMA 2CWPA 1AE3A 2LXKA 1J5EQ 4A3FG 3VDYA 1VQNA 4LF8Q 1J6QA 2QGQA 2VQEL 1EIFA 3I4MG 1IBMQ 2MQHA 4MNOA 4JI7L 1SMXA 4J15A 4JCVE 4DAYB 1L1OB 1HNZL 2IHEA 5H1SE 2CWAA 4DR4L 1O7IA 1TXYA 2WB1E 2E5LQ 3M4QA 1XMQQ 4H02A 1BBUA 3E0EA 4LF8L 4TVAB 4IJHA 3CC7A 3GTMH 1VQIA 1SN8A 4KLKA 2F3IA 1EFWA 1JJ2A 1PYSB 4JI2Q 1MKHA 4AH6A 4HJ7A 1XPRA 2Q2UA 2IHFA 1EWIA 2AKWB 5GAGC 2ZJPA 4DV5L 4JI3Q 4GOPC 2K50A 2GN5A 1IXRA 3I4OA 3PSIA 4UPAA 2AMCB 4IPGA 2CFMA 2F4VQ 4X64L 2HHHL 1X6OA 4JOIA 4A93H 2VQFQ 4LFAL 3KFUA 3S15H 1XNQQ 4BXXH 2PI2E 4DUZL 4HIDA 2YTXA 2PQAA 1KAWA 1WFQA 3UDXA 4DAMA 2WFWA 3STBD 3PF4A 4KHPQ 3A5ZB 2E8GA 4OONA 3CCQA 2B29A 3CCUA 2VY3A 4LF4Q 2R92H 3K0XA 2CCZA 1GO3E 1Y1VH 3PUVA 1XPOA 2R7FA 2ZJQA 1IBLL 3CCRA 3K80C 2N3SA 4TQUS 4XTCS 2K14A 1PH8A 4DKAC 4HJ5A 1VQ7A 3H15A 2RCNA 2UXCQ 3ZJYC 2ALYB 2UUBL 4DR4Q 3M85A 1UEBA 4GN5A 4LUZA 4RMFA 4JI8L 3PV0A 5C4XG 1ASYA 3KOJA 2E2IH 3L2PA 3K7AH 5IT9c 1FGUA 3T1YQ 1H95A 4DV4Q 3PO2G 1VQBA 2WP8J 1VQHA 1EQRA 2KCTA 1KL9A 1PH7A 1LUZA 4JI0Q 4KHZA 1Z47A 1IBKQ 3AFQA 3H0GH 2JQOA 3CC4A 3S1RH 1BBWA 2L15A 2KBNA 4X62L 1K8AC 1X9NA 4GKJQ 1CSQA 2QA4A 1NBWA 1MIUA 2QEXA 4BBRG 1JE5A 1WJJA 4NXNQ 5AJ3L 2R7ZG 1CKOA 4GOPA 5C4XH 1YHAA 4AQYL 2LXJA 1UE7A 3DM3A 1IZ6A 3RZDH 4POGA 5EAYA 4A3MH 2PQAB 3M3YH 2JK8A 4QQBX 1SROA 1K73C 4JOIC 3UDIA 3PO3G 4UY8C 4YY3Q 5GAEC 4R4QA 3F2CA 1PH4A 1XMQL 3A0JA 1GD7A 2IT1A 5M3FG 1P8LA 2KENA 2YU9H 2LSSA 4X66Q 3RNUA 1KC8C 2D0PA 3EBEA 5M3MG 3HOUH 1Q12A 5JJKA 4HJAA 2C35B 1LTLA 2N8NA 1XPUA 4A3LG 4A3IH 3CD6A 2V1CC 2OQKA 3WWVA 1BVSA 4YCVA 1PH6A 4IPHA 3OTOL 1PH3A 2JEBI 1KQSA 1K8GA 2R6GA 4DR5Q 3B6YA 1QVCA 1G6PA 1K3RA 3D0FA 2RF4A 1Y1WG 5C0XJ 4GKJL 4JG2A 4R4TA 5LMNL 4JI5L 5FJ8H 3E9HA 4BY1G 4IOCA 3ICEA 1X3FA 4K0KQ 2R93G 4LUOA 3CMEA 4APVA 3CCJA 1R9TH 4B3RQ 1KRTA 4DV3Q 1KRSA 3M7NA 4P75A 3CAMA 3BZKA 4MZ9A 1Q81C 1HNZQ 1Y1WH 2OTLA 2Q2TA 2UXDL 1YJ9A 1IL2A 3GD7A 1IBLQ 3BU2A 4C3JH 2PNHA 1TWAH 5GROA 3H0GG 4DR3Q 4GLAC 1EYGA 4OX9Q 2OQ0A 4JI5Q 4DV2Q 5FLXc 3KJPA 1VQ4A 1E3PA 2VW9A 5BR8Q 1WCMG 3KDFA 2UUAQ 3HOZG 2VL6A 4WJ4A 2HT1A 2RHSB 3CPFA 3CMAA 1Q82C 2GVAA 3OYYA 4PMWA 1XNQL 2NVQH 3FKIH 3UE1A 1FJGL 5GAHC 4BA1I 1X55A 4UP9A 3J7A5 4P74A 2JA6G 1JJCB 4FDBA 1QZHA 2MNAA 1RL2A 1UWVA 1HZCA 1YVCA 2R7DA 3IRBA 4GS3A 1HNWQ 3BZCA 3ERSX 3RN2A 4JBWA 5IY0A 5M5XH 1WOCA 5E7NA 1AE2A 3W1BA 4GLXA 1YBYA 2VS1A 5K36G 1G291 4LF6L 1GM5A 4L5SA 5ELOA 2JA5H 2WB1G 4X65Q 2XTIA 3J81c 1X56A 3PUXA 3UDFA 3CCEA 2YV5A 1QZGA 4LF7Q 4Y52H 1YJNA 2IX0A 2RHQB 1I94L 1N34Q 3I4MH 1YI2A 1N33L 3S1QH 4HJ9A 4A3BH 4GKKL 2MO0A 4QL5A 3HKZG 3RLNA 4DK3C 2YYZA 1VS0A 4OXPA 3S2DH 2CKZB 3HOXH 4DV1L 1XMOL 4LFBQ 4O0AA 5IP9H 5JJLA 1L1OA 4A3GG 5BR8L 4DNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G51 A;  3HOV H;  4A76 A;  4DR6 L;  3UDG A;  1D7Q A;  4A3C H;  4OWT B;  1MJE A;  4IFD I;  1N33 Q;  4OO1 G;  4HIM A;  1TWC H;  2I5M X;  3KLW A;  4JC0 A;  2KCM A;  5IE8 A;  5IYC G;  1VQM A;  1VQL A;  4LF5 L;  1QUQ A;  2Z0S A;  3ER0 A;  3HFZ B;  4GN3 B;  2A1A A;  1CSP A;  4A93 G;  1MJC A;  2KHI A;  5IP9 G;  4A3K H;  3HOY H;  3E9I A;  3Q8D A;  1W2B A;  3GTL H;  2UUC Q;  1VQ9 A;  3PO3 H;  3RN5 A;  3CCL A;  3RLO A;  4ALP A;  4DR2 L;  3K81 C;  4IPD A;  4R4C A;  4O2D A;  4EX5 A;  1CKM A;  1X3G A;  2Q2H A;  3EIV A;  1YIJ A;  4IFD G;  4AQY Q;  4PZ6 A;  2HIV A;  3W1G A;  2NVT H;  4JYA Q;  5C0X I;  4DV0 L;  4R1J A;  1KIX A;  1RIP A;  2UXB Q;  4WJ3 M;  3JAM i;  1FL0 A;  1OTC A;  2UXD Q;  1FJG Q;  2YTV A;  3PIP A;  1K83 H;  3J80 i;  3CCV A;  2EIF A;  4JI0 L;  1I5F A;  2Z6K C;  4UP7 A;  1V9P A;  4POF A;  1L1O C;  3TEH B;  4GOP B;  3MEF A;  4B3M L;  1N36 L;  3GTO H;  1VQJ A;  2DUD A;  1B7Y B;  1UE1 A;  5GQO A;  2VUM H;  1GVP A;  1I50 H;  1PA6 A;  2B3G A;  4DR3 L;  4JV5 L;  2ZTD A;  4A3L H;  1IBM L;  1I6H H;  1LYL A;  1WI5 A;  5C44 H;  2VZA A;  1FVI A;  4YCW A;  4YWM A;  1A0I A;  1UE5 A;  2NZO A;  3CP0 A;  3L7Z C;  3HOV G;  3G6E A;  5C4J H;  2I5L X;  3K7U C;  1CKN B;  4JBM A;  1E7Z A;  3KF8 B;  4B3T L;  2K4K A;  3J80 c;  1TWH H;  3M9B A;  3CPW A;  4A4I A;  3NEM A;  1XMO Q;  3NBH B;  3S1N H;  2A19 A;  5LMN Q;  1Z9F A;  3JAM c;  2JA8 G;  1C7Y A;  4IPC A;  4MTN A;  4P73 A;  4X64 Q;  2HHH Q;  4DV4 L;  4GNX B;  4L5R C;  4ME3 A;  1A63 A;  3M4P A;  3CXC A;  1CUK A;  1LM0 A;  3AEV A;  3A5U A;  4HJ8 A;  1T9H A;  2MO1 A;  2BH2 A;  3CCS A;  2XGT A;  1Q8K A;  3J81 j;  3J7Z C;  4Y7N H;  1YZ6 A;  3OTO Q;  2ZTC A;  3TS2 A;  4DR7 L;  3HKZ E;  4LF9 Q;  1SR3 A;  4QJF A;  4OX9 L;  1PH9 A;  2JA7 G;  1VQF A;  3D31 A;  3UE0 A;  1A8V A;  4AYB G;  4BBR H;  2MFI A;  1KXL A;  3I4N G;  3S1M H;  2Z6K A;  1PYB A;  5C3E G;  2CQO A;  3CC2 A;  3U4V A;  1I3Q H;  5FLM H;  2E5L L;  3CQZ H;  2ATW A;  5JJI A;  4PG3 A;  3RLF A;  3FKI G;  1E22 A;  5IP7 G;  4IFD J;  5DLQ E;  2K5N A;  3GTJ H;  4DR7 Q;  1NE3 A;  1YEZ A;  3F2D A;  3SGI A;  1C9O A;  2KHJ A;  5JEA J;  2I5H A;  1EUJ A;  2BA0 A;  4BBS H;  4JI3 L;  2R92 G;  3H3V I;  2D62 A;  3T1Y L;  4LFC L;  5JEA G;  5C44 G;  2YTY A;  4DV7 Q;  4A3J H;  4B3T Q;  1HNX L;  2H5X A;  4A3I G;  3M4O H;  5IP7 H;  3L0O A;  3T1H Q;  4JI6 L;  1N8R C;  1Q86 C;  4NPS A;  2K75 A;  1XNR L;  5IWA L;  1Q1E A;  2FXQ A;  1NMF A;  1PHJ A;  2ES2 A;  1NJI C;  3FP9 A;  4NB3 A;  5C0X G;  1K9M C;  4JV5 Q;  4R4O A;  1U5K A;  4BY7 H;  3RZO H;  3TQY A;  4LNQ A;  3I7F A;  4DV3 L;  2R7Z H;  3HOW H;  3S24 A;  1N36 Q;  4LW1 A;  4A3J G;  3F1Z A;  5IWA Q;  2EXD A;  1XJV A;  4K0K L;  1JJG A;  4A3M G;  4YY3 L;  2OCE A;  5GAD C;  3T1H L;  2OWO A;  4JI6 Q;  1N32 L;  4QGU A;  4PZ7 A;  1YNX A;  2D0O A;  4DR1 L;  3GTG H;  4DK6 C;  1HR0 L;  5LMU Q;  3S2H H;  4DV0 Q;  1V43 A;  1HNW L;  2WAQ E;  4LFB L;  4X6A H;  4DUY Q;  5IYD H;  3CCM A;  1HZB A;  4JYA L;  3AFP A;  4BY7 G;  1EOV A;  1X65 A;  1AH9 A;  1QVG A;  4DR5 L;  1YIT A;  2UXB L;  1L0W A;  1K0R A;  3KF6 A;  5M3F H;  2NN6 I;  3CW2 C;  1PH1 A;  2UUC L;  4OWX B;  4DUY L;  1I94 Q;  3I56 A;  4QIW E;  2E2J H;  2WAQ G;  4JI2 L;  1TWF H;  1HH2 P;  3NEN A;  4C2M H;  4EQ5 A;  5IYD G;  4DR1 Q;  4A3K G;  3HOY G;  3PGZ A;  1V1Q A;  1SE8 A;  1X54 A;  2EQS A;  4YWK A;  3RR5 A;  1OXS C;  2UUB Q;  4KI0 A;  4LUV A;  2PI2 A;  5J3B A;  3OW2 A;  4A3G H;  2K5V A;  4LF9 L;  2I0Q A;  4A3E G;  3G71 A;  1VQE A;  2NZH A;  1Q1B A;  2GVB A;  2JE6 I;  3W5O A;  1J5E L;  4A3C G;  3A74 A;  1VQD A;  4NXN L;  2AWO A;  4JBK A;  3GTQ H;  1BKB A;  1NTG A;  3BJU A;  3F8T A;  4C3H H;  5AJ3 Q;  3F2B A;  2VQE Q;  4B3M Q;  3AQQ A;  2JEA I;  4X62 Q;  1PH5 A;  2Q2I A;  3AYH B;  1HNX Q;  4GKK Q;  3HOW G;  2UXC L;  1VQ8 A;  3ULJ A;  3TS0 A;  1EIY B;  3TRZ A;  2PMZ E;  4HIO A;  1VQG A;  1VQA A;  4HIK A;  1QVF A;  1E1T A;  1B8A A;  4DV1 Q;  4DV5 Q;  4JI8 Q;  4GNX A;  1N34 L;  4OWW B;  3U4Z A;  4A3D H;  3EN2 A;  3ULP A;  1SFO H;  3TRE A;  2NVX H;  3PCO B;  5M3M H;  3HOU G;  3S14 H;  3NEL A;  4DR2 Q;  1ASZ A;  3GDE A;  1PFS A;  1VQO A;  1WCM H;  2AHO B;  4YCU A;  5IYB G;  3GTP H;  4YHH L;  3GO5 A;  4X66 L;  1PH2 A;  4BXX G;  2NN6 G;  1S72 A;  4L5T A;  4GLV B;  4KHP L;  3FHW A;  4IJL A;  3DLL A;  1M1K C;  4LF4 L;  4OO1 I;  3KF6 B;  2VNU D;  1HZA A;  2Y0S E;  1L2F A;  4A3D G;  1Y1V G;  4JI7 Q;  3I55 A;  1S3O A;  4P71 A;  4DUZ Q;  1YHQ A;  2UU9 Q;  3U50 C;  1Y14 B;  1YHB A;  4R4I A;  2NVY H;  4RG1 A;  2BA1 A;  3PUW A;  1WYD A;  2R93 H;  2BH8 A;  2B63 G;  2OTJ A;  4LWC A;  1SRU A;  4DPG A;  4PZ8 A;  2JA5 G;  2IX1 A;  3H3V H;  4BA2 I;  2F52 A;  3U58 A;  4A3E H;  2DGY A;  2JA7 H;  1NMG A;  1PVO A;  4P72 A;  4L5Q A;  1N9W A;  1PV4 A;  2E2H H;  1VQP A;  2AWN A;  3PIO A;  2UUA L;  3G48 A;  1KHI A;  3PUZ A;  5M5W H;  4GNX C;  2JA8 H;  1KD1 C;  4DV6 L;  2N49 A;  1VQC A;  4B3S Q;  3KJO A;  2ZTE A;  1DGS A;  1X3E A;  3PF5 A;  3PO2 H;  4LF5 Q;  1OXV A;  2HQL A;  3LGJ A;  3S17 H;  1C0A A;  2IY5 B;  4LF6 Q;  2JA9 A;  4IO9 A;  1NY4 A;  3HOX G;  2JJQ A;  4BBS G;  3ULL A;  1OXX K;  4DV6 Q;  1GKH A;  4GN4 B;  5HGQ A;  1TWG H;  1CKN A;  1JB7 A;  1HJP A;  1U0L A;  3PUY A;  2K52 A;  1Q46 A;  4C3I H;  4DV7 L;  4LFC Q;  1OXU A;  3I4N H;  1VCI A;  4XIG S;  4NXM Q;  1D8L A;  5C3E H;  1EQQ A;  4IOA A;  5IYC H;  5FLM G;  2ZJR A;  2F4V L;  1SLJ A;  1E1O A;  1IBK L;  2K5H A;  4UP8 A;  3STB C;  1UE6 A;  2N78 A;  4A75 A;  1A62 A;  1W3S A;  5M5Y H;  5LMN W;  2UU9 L;  3HKS A;  2Y0S G;  5IYB H;  1VQ5 A;  4NXM L;  4LF7 L;  1S40 A;  4X65 L;  1P16 A;  2ZM6 Q;  1YJW A;  4JI4 L;  2ID0 A;  3KYH C;  4JI1 Q;  5LMU L;  1HR0 W;  1M90 C;  1JMC A;  4AYB E;  4YHH Q;  1HZ9 A;  3G4S A;  2B63 H;  4JBJ A;  1XTD A;  5FJ8 G;  1N32 Q;  4A3B G;  4QY7 A;  1E24 A;  3GTK H;  3JC6 6;  2ZM6 L;  4JI4 Q;  2HIX A;  4JI1 L;  3J81 i;  3CF5 A;  4B3S L;  2A8V A;  3S16 H;  3KDF B;  1B70 B;  4A3F H;  1VQ6 A;  1VQK A;  4LFA Q;  2VQF L;  1Q7Y C;  2JA6 H;  4B3R L;  1XNR Q;  3K8A A;  1QUQ B;  4BY1 H;  4DR6 Q;  1JT8 A;  1OXT A;  2ASB A;  3MXN B;  2VUM G;  5ELN A;  4YWL A;  3HOZ H;  3I2Z A;  1HR0 Q;  4DV2 L;  5HY6 A;  1IYJ B;  4AIM A;  2CWP A;  1AE3 A;  2LXK A;  1J5E Q;  4A3F G;  3VDY A;  1VQN A;  4LF8 Q;  1J6Q A;  2QGQ A;  2VQE L;  1EIF A;  3I4M G;  1IBM Q;  2MQH A;  4MNO A;  4JI7 L;  1SMX A;  4J15 A;  4JCV E;  4DAY B;  1L1O B;  1HNZ L;  2IHE A;  5H1S E;  2CWA A;  4DR4 L;  1O7I A;  1TXY A;  2WB1 E;  2E5L Q;  3M4Q A;  1XMQ Q;  4H02 A;  1BBU A;  3E0E A;  4LF8 L;  4TVA B;  4IJH A;  3CC7 A;  3GTM H;  1VQI A;  1SN8 A;  4KLK A;  2F3I A;  1EFW A;  1JJ2 A;  1PYS B;  4JI2 Q;  1MKH A;  4AH6 A;  4HJ7 A;  1XPR A;  2Q2U A;  2IHF A;  1EWI A;  2AKW B;  5GAG C;  2ZJP A;  4DV5 L;  4JI3 Q;  4GOP C;  2K50 A;  2GN5 A;  1IXR A;  3I4O A;  3PSI A;  4UPA A;  2AMC B;  4IPG A;  2CFM A;  2F4V Q;  4X64 L;  2HHH L;  1X6O A;  4JOI A;  4A93 H;  2VQF Q;  4LFA L;  3KFU A;  3S15 H;  1XNQ Q;  4BXX H;  2PI2 E;  4DUZ L;  4HID A;  2YTX A;  2PQA A;  1KAW A;  1WFQ A;  3UDX A;  4DAM A;  2WFW A;  3STB D;  3PF4 A;  4KHP Q;  3A5Z B;  2E8G A;  4OON A;  3CCQ A;  2B29 A;  3CCU A;  2VY3 A;  4LF4 Q;  2R92 H;  3K0X A;  2CCZ A;  1GO3 E;  1Y1V H;  3PUV A;  1XPO A;  2R7F A;  2ZJQ A;  1IBL L;  3CCR A;  3K80 C;  2N3S A;  4TQU S;  4XTC S;  2K14 A;  1PH8 A;  4DKA C;  4HJ5 A;  1VQ7 A;  3H15 A;  2RCN A;  2UXC Q;  3ZJY C;  2ALY B;  2UUB L;  4DR4 Q;  3M85 A;  1UEB A;  4GN5 A;  4LUZ A;  4RMF A;  4JI8 L;  3PV0 A;  5C4X G;  1ASY A;  3KOJ A;  2E2I H;  3L2P A;  3K7A H;  5IT9 c;  1FGU A;  3T1Y Q;  1H95 A;  4DV4 Q;  3PO2 G;  1VQB A;  2WP8 J;  1VQH A;  1EQR A;  2KCT A;  1KL9 A;  1PH7 A;  1LUZ A;  4JI0 Q;  4KHZ A;  1Z47 A;  1IBK Q;  3AFQ A;  3H0G H;  2JQO A;  3CC4 A;  3S1R H;  1BBW A;  2L15 A;  2KBN A;  4X62 L;  1K8A C;  1X9N A;  4GKJ Q;  1CSQ A;  2QA4 A;  1NBW A;  1MIU A;  2QEX A;  4BBR G;  1JE5 A;  1WJJ A;  4NXN Q;  5AJ3 L;  2R7Z G;  1CKO A;  4GOP A;  5C4X H;  1YHA A;  4AQY L;  2LXJ A;  1UE7 A;  3DM3 A;  1IZ6 A;  3RZD H;  4POG A;  5EAY A;  4A3M H;  2PQA B;  3M3Y H;  2JK8 A;  4QQB X;  1SRO A;  1K73 C;  4JOI C;  3UDI A;  3PO3 G;  4UY8 C;  4YY3 Q;  5GAE C;  4R4Q A;  3F2C A;  1PH4 A;  1XMQ L;  3A0J A;  1GD7 A;  2IT1 A;  5M3F G;  1P8L A;  2KEN A;  2YU9 H;  2LSS A;  4X66 Q;  3RNU A;  1KC8 C;  2D0P A;  3EBE A;  5M3M G;  3HOU H;  1Q12 A;  5JJK A;  4HJA A;  2C35 B;  1LTL A;  2N8N A;  1XPU A;  4A3L G;  4A3I H;  3CD6 A;  2V1C C;  2OQK A;  3WWV A;  1BVS A;  4YCV A;  1PH6 A;  4IPH A;  3OTO L;  1PH3 A;  2JEB I;  1KQS A;  1K8G A;  2R6G A;  4DR5 Q;  3B6Y A;  1QVC A;  1G6P A;  1K3R A;  3D0F A;  2RF4 A;  1Y1W G;  5C0X J;  4GKJ L;  4JG2 A;  4R4T A;  5LMN L;  4JI5 L;  5FJ8 H;  3E9H A;  4BY1 G;  4IOC A;  3ICE A;  1X3F A;  4K0K Q;  2R93 G;  4LUO A;  3CME A;  4APV A;  3CCJ A;  1R9T H;  4B3R Q;  1KRT A;  4DV3 Q;  1KRS A;  3M7N A;  4P75 A;  3CAM A;  3BZK A;  4MZ9 A;  1Q81 C;  1HNZ Q;  1Y1W H;  2OTL A;  2Q2T A;  2UXD L;  1YJ9 A;  1IL2 A;  3GD7 A;  1IBL Q;  3BU2 A;  4C3J H;  2PNH A;  1TWA H;  5GRO A;  3H0G G;  4DR3 Q;  4GLA C;  1EYG A;  4OX9 Q;  2OQ0 A;  4JI5 Q;  4DV2 Q;  5FLX c;  3KJP A;  1VQ4 A;  1E3P A;  2VW9 A;  5BR8 Q;  1WCM G;  3KDF A;  2UUA Q;  3HOZ G;  2VL6 A;  4WJ4 A;  2HT1 A;  2RHS B;  3CPF A;  3CMA A;  1Q82 C;  2GVA A;  3OYY A;  4PMW A;  1XNQ L;  2NVQ H;  3FKI H;  3UE1 A;  1FJG L;  5GAH C;  4BA1 I;  1X55 A;  4UP9 A;  3J7A 5;  4P74 A;  2JA6 G;  1JJC B;  4FDB A;  1QZH A;  2MNA A;  1RL2 A;  1UWV A;  1HZC A;  1YVC A;  2R7D A;  3IRB A;  4GS3 A;  1HNW Q;  3BZC A;  3ERS X;  3RN2 A;  4JBW A;  5IY0 A;  5M5X H;  1WOC A;  5E7N A;  1AE2 A;  3W1B A;  4GLX A;  1YBY A;  2VS1 A;  5K36 G;  1G29 1;  4LF6 L;  1GM5 A;  4L5S A;  5ELO A;  2JA5 H;  2WB1 G;  4X65 Q;  2XTI A;  3J81 c;  1X56 A;  3PUX A;  3UDF A;  3CCE A;  2YV5 A;  1QZG A;  4LF7 Q;  4Y52 H;  1YJN A;  2IX0 A;  2RHQ B;  1I94 L;  1N34 Q;  3I4M H;  1YI2 A;  1N33 L;  3S1Q H;  4HJ9 A;  4A3B H;  4GKK L;  2MO0 A;  4QL5 A;  3HKZ G;  3RLN A;  4DK3 C;  2YYZ A;  1VS0 A;  4OXP A;  3S2D H;  2CKZ B;  3HOX H;  4DV1 L;  1XMO L;  4LFB Q;  4O0A A;  5IP9 H;  5JJL A;  1L1O A;  4A3G G;  5BR8 L;  4DNI A; 
#chains in the Genus database with same CATH topology
 4KD3 A;  3UDG A;  4OWT B;  1MJE A;  4G3I A;  4HIM A;  1VQL A;  4JC0 A;  3KLW A;  3HOY B;  1VQM A;  5IYC G;  2W7O A;  3GV8 B;  4B3M H;  1WTH A;  2O03 A;  4MV6 A;  2RDG A;  1MJC A;  4A3K H;  2PW5 A;  2LKV A;  3E9I A;  4CDF C;  4O3N A;  3GTL H;  2N55 A;  3BYY B;  2E76 C;  2IW3 A;  2LFN A;  3KK7 A;  4Q5V A;  3PO3 H;  4DR2 L;  4IPD A;  2R8H A;  2G5D A;  1X3G A;  4YR3 A;  1YIJ A;  2EYO A;  3IKJ A;  3GV7 B;  1OWT A;  1ML0 D;  3Q22 A;  1O7Z A;  4CC5 A;  4QW9 A;  4DV7 H;  1BO0 A;  2HIV A;  3PQI A;  4PZ6 A;  4O4H F;  1I6H B;  3KLS X;  1EEI D;  1HA6 A;  1RIP A;  1FL0 A;  1G6Z A;  4HNU A;  4QW8 A;  3K5N A;  3PIP A;  1EEF D;  3S1N B;  4MA5 A;  5I9O A;  3M9M B;  4JI0 H;  4JI0 L;  3RBE A;  2Z6K C;  2ZJT A;  3RUP A;  2UXD Q;  2WAQ B;  3TEH B;  3MEF A;  2ZDQ A;  1VQJ A;  1B7Y B;  1UE1 A;  5GQO A;  1RJQ A;  4XXE A;  1KLG D;  4DR3 L;  4JV5 L;  3HP3 A;  2ZTD A;  3A8J E;  2JSO A;  4R8I A;  1IBM L;  1WI5 A;  3R5H A;  2VZA A;  4UCO A;  4RUC A;  1FVI A;  4YCW A;  2K05 A;  2SEB D;  3CP0 A;  3HOV G;  4WRD A;  4I7H A;  4JBM A;  4DR2 H;  5G3L D;  4B3T L;  1YNJ D;  2K4K A;  3M9B A;  4APM A;  3HGB A;  4A4I A;  4J9Q A;  2F0T A;  2VA3 A;  3R23 A;  1ENA A;  2A6E C;  1KNA A;  5C1P A;  1C7Y A;  4MTN A;  4AQY H;  4ME3 A;  2NUA B;  3CXC A;  1ZEQ X;  3A5U A;  4HJ8 A;  1S5B D;  1Q8K A;  3GTG A;  4RH6 A;  4Y7N H;  2ZTC A;  4A3E B;  4OGQ C;  2ZDH A;  1S5E D;  1UC8 A;  3D31 A;  4UHV A;  5KG3 A;  4BBR H;  3I4N G;  2Z6K A;  5KG4 A;  5JUM A;  2Q8I B;  3CC2 A;  2FB9 A;  1AEX A;  3GTP A;  1GUS A;  3A7A B;  1RYR A;  3SK5 A;  2R92 A;  5JJI A;  1D6E C;  2F0J A;  4ECV A;  1IOW A;  5DLQ E;  1SXT A;  3GTJ H;  2B8G A;  1B04 A;  2FKL A;  4XQQ A;  2J9G A;  4HSV A;  5JEA J;  4ED8 A;  3VR6 A;  1H9R A;  1JOK A;  3M7G A;  2ZXR A;  1EUJ A;  2HD3 A;  4XYO A;  5ELF A;  4DL2 A;  4MV4 A;  2IMW P;  2C00 A;  3EPI A;  4B3T Q;  4E4T A;  5KG5 A;  2BQU A;  5EBC A;  3FPP A;  2KHS A;  1Q86 C;  1LT6 D;  1QNU A;  4M1U B;  1JX4 A;  2F3V A;  3EVQ A;  3FP9 A;  4NB3 A;  1K9M C;  1U5K A;  4ED1 A;  5AFW A;  5JVH 3;  1I7L A;  2FPP B;  3I7F A;  2R7Z H;  3Q0A A;  3S24 A;  3MFG A;  2Q8T A;  4A3J G;  5TSS A;  4UAI A;  4C1N K;  2NVQ B;  2OCE A;  3T1H L;  4JI6 Q;  2A68 C;  4DFA A;  3VYU A;  5FD5 A;  3N44 B;  5DM7 3;  4DR1 L;  3GTG H;  2VB2 X;  1KJI A;  4KN7 C;  2MHV A;  5IYD H;  4LFB L;  3SK4 A;  1HZB A;  4JYA L;  2X6G A;  3NBI A;  4LFC H;  3T4A C;  1AH9 A;  4MTE A;  2HDL A;  2F4V H;  1RCV D;  2UXB L;  1FYC A;  2W9B B;  1K0R A;  3RMH A;  2DJG C;  2JA6 A;  3K59 A;  5JPN C;  1I94 Q;  1ICF B;  2C5C A;  2DY7 A;  1GLV A;  4LMQ D;  1TWF H;  4EEY A;  1HFN A;  4LH6 A;  3S2H B;  2CHB D;  4ZLT F;  1X54 A;  4XX0 B;  5FPO A;  5IGD A;  2AGP A;  4ZK9 B;  3E5S A;  4UFZ A;  5J3B A;  3OW2 A;  1E4G T;  1TS3 A;  2EYL A;  2SOB A;  1N32 H;  4A3E G;  3G71 A;  1EFI D;  2ASD A;  1BJT A;  4A3D B;  1VQD A;  3HS0 C;  3K5I A;  4ECW A;  1PK8 A;  1XNQ H;  2G9D A;  4B3M Q;  1F2M A;  1X3Q A;  3RZO B;  4M7E A;  2Q8R E;  3AYH B;  3J80 L;  3BS1 A;  4GKK Q;  4KJO A;  3R5F A;  5E1F A;  4NKL A;  1EIY B;  3TRZ A;  1Q3L A;  1JIC A;  4HIO A;  4I7Z C;  3MXU A;  4FF2 A;  4RUA A;  3PR4 A;  2FPG B;  3D4D A;  4HED A;  4DF7 A;  3U4Z A;  4YIJ A;  2R8G A;  1AW7 A;  4GC7 A;  4NLG A;  2XIG A;  2JA6 B;  3PCO B;  3HOU G;  3NEL A;  3OSP A;  1ONL A;  4DR2 Q;  2MCT A;  4C5C A;  2J4X A;  3CQZ A;  3SE7 A;  1BOS A;  4LF6 H;  1AFP A;  4X66 L;  3BAA A;  1A3T A;  3IL8 A;  4L5T A;  2NU8 B;  3RV3 A;  4GLV B;  3DLL A;  1R4P B;  1SAP A;  4OO1 I;  2VNU D;  4YHH H;  4HMI A;  3FMA A;  4EYI B;  4JI7 Q;  1S3O A;  3U50 C;  1VDZ A;  3PIO 3;  3JZI A;  1PXU A;  4R4I A;  2IBK A;  1DD2 A;  4FXG C;  2SNM A;  3FEW X;  2B63 G;  1SRU A;  1KJJ A;  1FNW A;  1QOH A;  2JA5 G;  5KFW A;  2XWB B;  3BVM A;  3L4K A;  3U58 A;  3E6Z X;  2TMP A;  1RK6 A;  2EE1 A;  4ED7 A;  4P72 A;  2FMC A;  3BYT B;  3PZP A;  3J80 E;  1PV4 A;  2AWN A;  4KV6 A;  1HTL D;  4DR3 H;  5J39 A;  1KAB A;  3PUZ A;  4LSA A;  4DV6 L;  2NVT B;  4DU9 A;  5IYZ F;  1VQC A;  3PO2 H;  2RBM A;  4LF5 Q;  3LGJ A;  2IY5 B;  3CHB D;  1IYV A;  3TP7 A;  2KSW A;  2EY6 A;  4J1M A;  4Z9C B;  4DV6 Q;  1Y1V B;  5HGT A;  3VR2 A;  2VB3 X;  5HGQ A;  4EGV A;  1TWG H;  3A7L A;  4CDD C;  3JSN A;  4QIW A;  4IWX A;  2K52 A;  4C3I H;  1C8C A;  3M4O B;  3I4N H;  2R84 A;  4IOA A;  5C3E H;  4DV1 H;  4YJ2 F;  1E1O A;  1IBK L;  2QCP X;  4PMC A;  1D2B A;  5KFH A;  5LMN W;  1W6J A;  1HNX H;  5IYB H;  2W71 A;  4LF7 L;  5EPJ A;  4L6T B;  5BN3 A;  4JI4 L;  2ID0 A;  3KYH C;  5KNC A;  5LOV F;  1M90 C;  2IPK D;  4AYB E;  4YHH Q;  1HRJ A;  4K8I A;  4KHP H;  4MTK A;  2F0S A;  3GTK H;  3JC6 6;  2AQ4 A;  2A8V A;  4BWS C;  4RNM A;  3GV6 A;  1B70 B;  3H6M A;  5HUR A;  2X6L A;  4LFA Q;  2JA6 H;  1CE8 A;  2I87 A;  3K8A A;  1QUQ B;  1UAP A;  4O3Q A;  4KY6 A;  5IIF A;  1GUW A;  3GIQ A;  5CBA E;  3OMG A;  2VUM G;  3JAM L;  4QWE A;  2QW7 A;  1K1S A;  4R8U A;  2R93 B;  4AIM A;  4DV2 H;  1AE3 A;  5LYJ F;  1GJX A;  4A3F G;  2A69 C;  4LF7 H;  1SSO A;  4LF8 Q;  1DV1 A;  1EIF A;  5FKA C;  1EWC A;  3I4M G;  2MQH A;  4MNO A;  2HDM A;  4JI7 L;  4JCV E;  2BR0 A;  2D2C C;  4DAY B;  1L1O B;  5ISR A;  3I12 A;  5KFM A;  4J9M A;  5H1S E;  1DJR D;  1SBB B;  2WB1 E;  5K5P A;  4WD3 A;  1XMQ Q;  3QOL A;  2YZN A;  3WO0 A;  3FVQ A;  3A8I E;  4TVA B;  4IJH A;  2B39 A;  3OOC A;  4X3S A;  3U9S A;  5M3M B;  2PN1 A;  1JJ2 A;  2ICI A;  1PYS B;  2V59 A;  4JI2 Q;  3M9N B;  4ZCK A;  2FK1 A;  5EKI A;  2Q2U A;  2GPS A;  2B63 B;  4RNN A;  5GAG C;  5IGE A;  4DV5 L;  2AMC B;  2IX3 A;  4I55 F;  1NAP A;  1X6O A;  2V4Q A;  2OLS A;  3KFU A;  2HJW A;  3RIZ A;  2WDT A;  2YRX A;  2V4R A;  2YTX A;  1KAW A;  1WFQ A;  1K28 A;  2WFW A;  3PF4 A;  4KHP Q;  4OON A;  3CCQ A;  3CCU A;  4LF4 Q;  2VY3 A;  5BN5 A;  2CCZ A;  1Y1V H;  1G8Z D;  1QG7 A;  1IBL L;  3K80 C;  5KG0 A;  4TQU S;  4XTC S;  1F9S A;  5D14 A;  3KTM A;  4HJ5 A;  3I4N B;  2J0T D;  3Q24 A;  4DR4 Q;  4DR1 H;  1UEB A;  4GN5 A;  4RMF A;  1TWC A;  4DXF A;  3TZD A;  4LMY A;  3L2P A;  5IOD A;  5IT9 c;  2HUG A;  2YS7 A;  5BPF A;  1H95 A;  4LAA A;  5KGU A;  1R9T B;  3HKZ A;  1EQR A;  2RGR A;  1PH7 A;  4C3J G;  2YRW A;  3V4S A;  2CQY A;  2KBN A;  1EZ8 A;  4GKJ Q;  1S03 G;  1Q90 A;  1CSQ A;  1EOT A;  1I4G A;  4BBR G;  3GTP B;  4NXN Q;  3R3O A;  1CKO A;  4R8U B;  1E2V A;  4AQY L;  3EYY A;  1SE3 A;  1IZ6 A;  2PQA B;  4HR7 A;  1JOO A;  1SRO A;  4U67 3;  3UDI A;  3PO3 G;  2W70 A;  2F0G A;  5J2T F;  4RCN A;  4XQJ A;  5EDW A;  3ERQ A;  4LK1 C;  1GD7 A;  2IT1 A;  2PNR C;  2YU9 H;  2LSS A;  4FO2 A;  4X66 Q;  4A3B B;  2VUM A;  5JJK A;  1CT1 D;  2E75 C;  4HJA A;  4A3L G;  5DGB A;  3GLK A;  2I80 A;  4A3I H;  2DJF C;  2V1C C;  3WWV A;  3WOE A;  3SHL A;  4ME6 A;  2KUM A;  4IPH A;  1MZB A;  2BOS A;  1PH3 A;  1M7J A;  2CZG A;  1EYD A;  2R6G A;  4DR5 Q;  3B6Y A;  2Z4I A;  1STG A;  3SXH A;  5JOB A;  4JUZ A;  2NYZ D;  3H0G A;  3QFF A;  2YZG A;  3V96 A;  5T1G A;  2BCO A;  3N6X A;  4BY1 G;  1M6V A;  3M4I A;  1X3F A;  4K0K Q;  3KBG A;  1SYB A;  2E2I A;  2EY5 A;  3K57 A;  3CME A;  4APV A;  4B3R Q;  1KRT A;  4DR4 H;  4QIW B;  4MV8 A;  2AU0 A;  1Y1W H;  2W6M A;  3K5M A;  1HHV A;  3JRX A;  3GD7 A;  3OHB A;  5CMD A;  5GRO A;  1C4Q A;  4OX9 Q;  1EYG A;  1LV9 A;  2CW0 C;  2OQ0 A;  4JI5 Q;  5FLX c;  3KJP A;  2IP4 A;  2QK4 A;  1WCM G;  2CQA A;  5ELB A;  3T1H H;  1LTG D;  3TSS A;  2QIL A;  2NUC A;  3HEJ A;  3MXP A;  1Q82 C;  2NVQ H;  1S10 A;  5L37 A;  1HUN A;  1JB3 A;  4MV3 A;  4JI5 H;  1WH2 A;  1NUC A;  2EVB A;  3GV3 A;  1TY2 A;  4FDB A;  2L1B A;  2F0M A;  3R2I A;  2MNA A;  1RL2 A;  1HZC A;  3SK8 A;  2HGS A;  5CV8 A;  3DEP A;  4ZKC B;  2W6Q A;  4JBW A;  2AGO A;  5E7N A;  2GPW A;  3W1B A;  3DXJ C;  1YBY A;  2L12 A;  3JRW A;  3VR4 A;  1GM5 A;  1I94 H;  3BVZ A;  5KFN A;  2L55 A;  2WB1 G;  3J81 c;  3CCE A;  1QZG A;  2X0S A;  4U7C A;  2YL2 A;  1KAA A;  2IX0 A;  1I94 L;  3I4M H;  1XXG A;  3V05 A;  1O80 A;  4G7O C;  2Z1C A;  1U4M A;  1E4F T;  3CQZ B;  4F8M A;  1UNS A;  1S5F D;  2YYZ A;  1VS0 A;  4OXP A;  3S2D H;  3MFI A;  3QZ8 A;  5KFZ A;  4LFB Q;  4O0A A;  2L11 A;  1U4L A;  5IP9 H;  3GIP A;  4DV5 H;  2DN8 A;  4A3G G;  3MTS A;  4GNX B;  4JI6 H;  4BS9 A;  2R93 A;  1EY7 A;  3K7A B;  1D7Q A;  2E2I B;  1SYE A;  1D5X C;  2R6F A;  3NSW A;  2B2Y A;  3EPG A;  4A3K B;  1WTQ A;  1SJE D;  4I65 A;  1K3B C;  5I2X A;  4F4Y A;  2QDL A;  2A1A A;  1CSP A;  3KUP A;  4A93 G;  4L63 B;  1CA6 A;  4C3I B;  3PN1 A;  2PO4 A;  5IP9 G;  1II3 A;  3HOY H;  2A6E D;  1E4E A;  3PMF A;  2B63 A;  4DK0 A;  5C3E B;  4PWQ A;  4O2A F;  4YB8 B;  3P20 A;  1KDC A;  3Q8D A;  1W2B A;  1T3N A;  2UVV A;  1SYF A;  1OO9 B;  3K81 C;  1SFO A;  4R4C A;  1WTW A;  1O7Y A;  5LHY 1;  1O78 A;  2MP1 A;  2WAC A;  3PW4 A;  2NVT H;  4JYA Q;  4IR1 A;  1S0O A;  3OHA A;  1KJ9 A;  3N8D A;  4WJ3 M;  4HNT A;  5JJZ A;  1WSC A;  1JWS D;  1IW7 C;  2YTV A;  1TR5 A;  2CW8 A;  1K83 H;  1D1K A;  3J80 i;  3C46 A;  4GZY C;  3RB0 A;  5KT3 A;  2CVR A;  3DHQ A;  1L1O C;  5C4Z A;  3GTO H;  3U9T A;  1HNZ H;  2DUD A;  2EYP A;  1H9J A;  2CH4 W;  1LTB D;  1I6H H;  4CC6 A;  3SK6 A;  1PYW D;  3S9W A;  1A0I A;  1FNV A;  1YNN D;  2NZO A;  1JWU D;  3L7Z C;  2I5L X;  3K7U C;  2XGP A;  2W6O A;  3NWT A;  3HOZ B;  3KAJ A;  4ZI7 F;  3X3M A;  4DL4 A;  1TWH H;  1PX2 A;  3NEM A;  4HTH A;  4YJ3 F;  1B50 A;  4KKU A;  3S1N H;  1G2S A;  3JAM c;  2JA8 G;  4EGQ A;  4X3K A;  1S0N A;  3LML A;  2XRQ D;  2HHH Q;  4XT1 B;  5C6A A;  1G2T A;  3MWD A;  1SJH D;  3GQC A;  1PRT D;  2ZT9 C;  4H0L C;  2MO1 A;  2XGT A;  3J81 j;  3J7Z C;  2BQ3 A;  3TS2 A;  3GID A;  3GV5 B;  5KFR A;  3HKZ E;  4QMG A;  4LF9 Q;  3HOU B;  1SR3 A;  4QJF A;  5COR A;  1PH9 A;  1N36 H;  5C3X A;  1A8V A;  2KQ3 A;  3PW0 A;  4OEL B;  1GUN A;  3S1M H;  3VYS A;  3U4V A;  1I3Q H;  2E5L L;  3CQZ H;  4BWG B;  3KLR A;  1BCP F;  2I46 A;  5IT9 L;  2FK2 A;  2R7N A;  4DR7 Q;  5CAE B;  3L9A X;  2K03 A;  1GUG A;  2PMZ B;  2I5H A;  2BA0 A;  2W6N A;  1BNZ A;  4TQR A;  2KOL A;  2R92 G;  3H3V I;  4RKB A;  5KFA A;  1IOV A;  1EUD B;  4X62 H;  2SDF A;  5JEA G;  5C44 G;  4DV7 Q;  4A3J H;  4A3I G;  2UU9 H;  5A35 A;  5EWE A;  4UCR A;  4X64 H;  3T1H Q;  4JI6 L;  3KHL A;  3T5J A;  2K75 A;  1T5X D;  5IWA L;  1XNR L;  3H4B A;  2UVU A;  4IN3 A;  1NMF A;  2AGQ A;  4ZUI A;  3R2T A;  4JV5 Q;  1I3Q A;  2UXC H;  1RJT A;  4LNQ A;  3HOW H;  4FBT A;  3F1Z A;  5IWA Q;  1XJV A;  1ILP A;  3V2T A;  4ED6 A;  4A3M G;  4YY3 L;  1ILQ A;  5GAD C;  4J6H A;  1WTR A;  1RKN A;  1N32 L;  5I9P A;  2WB1 A;  5LMU Q;  3S2H H;  1HNW L;  4Q43 A;  2R8J A;  3K58 A;  4EQO A;  1X65 A;  1GHK A;  3H09 A;  2NN6 H;  4TKO B;  3D8G A;  1RJP A;  3RGX A;  2R7Z B;  4M8A A;  1TWF B;  2W9B A;  1I50 B;  2KED A;  1M0W A;  3V6J A;  2C2E A;  2PZT A;  5C4J B;  5KG2 A;  3I56 A;  2W6P A;  1STE A;  1UEA B;  1EQV A;  4DR1 Q;  4EQ5 A;  2XRS D;  5M5Y B;  3RR5 A;  5KIX A;  4KI0 A;  4A3G H;  5KRU A;  4KK7 A;  4LF9 L;  1K1Q A;  2NVX B;  3N43 B;  3NBH A;  2NZH A;  5KNB A;  1Q1B A;  4IZO A;  3W5O A;  4RU9 A;  1L2Z A;  1DOK A;  4R8N A;  1CZG A;  3A74 A;  4NXN L;  2DNC A;  4JBK A;  2E2J B;  4KD4 A;  4C3H H;  4CJ2 C;  5AJ3 Q;  3F2B A;  1I3Q B;  2VQE Q;  5L1K A;  4QF4 A;  4X62 Q;  1F9Q A;  3UFX B;  5JVD F;  4HMJ A;  3MJF A;  3PO2 B;  1HQR D;  1VQ8 A;  4G57 A;  3TS0 A;  1RD9 D;  4HIK A;  4NXM H;  1DIK A;  4KHV A;  4DV1 Q;  1N34 L;  4HN7 A;  3H4D A;  3TRE A;  1TWG B;  4A3J B;  1I4Q A;  5DG9 A;  2F0H A;  1ASZ A;  1IKL A;  1KDA A;  3GTP H;  2SCU B;  1BQQ T;  4YHH L;  3GO5 A;  2ZM6 H;  2XN9 C;  1SNP A;  3BDL A;  4IAL A;  3R8B A;  4K6L A;  3T56 B;  4EVO A;  5FOB B;  1PFB A;  4V19 0;  2CW7 A;  1STA A;  1PTO F;  3ND8 A;  1WVL A;  1TWF A;  5KFI A;  5D3I B;  3TQT A;  4DNR B;  5CA0 F;  1YHB A;  4KY7 A;  2GA4 B;  5M9O A;  3OTO H;  2BA1 A;  3PUW A;  4C5B A;  4RB2 C;  2RA4 A;  2M00 A;  4LWC A;  2M2L A;  4XZ3 B;  2IL8 A;  4IZ8 A;  4PZ8 A;  1ZET A;  4IAJ A;  2F52 A;  4A3E H;  5K2M A;  3VPB A;  3GTM B;  1LAB A;  1NMG A;  4KTA A;  1PVO A;  4L5Q A;  1DZ1 A;  4PQX A;  3J81 W;  1EYC A;  1WTP A;  2CH4 A;  1EIH A;  3HBL A;  2UUA L;  1KHI A;  3M4Y A;  4S3S A;  4GNX C;  2ZTE A;  3LWE A;  2F0V A;  2HQL A;  2EY2 A;  2R85 A;  2YZM A;  3AU7 A;  1C0A A;  2Y0S A;  3K5O A;  2JJQ A;  3HOX G;  4BBS G;  3GTO A;  3NXW A;  3RV4 A;  4GN4 B;  2J7Z A;  5EQ0 A;  1JB7 A;  1Q46 A;  4LFC Q;  1S97 A;  1RTN A;  4NXM Q;  4XIG S;  3MR3 A;  4JVZ A;  1EQQ A;  4C3J B;  4DV4 H;  2K5H A;  1EHI A;  2AUK A;  2N78 A;  4A75 A;  5M5Y H;  2Y0S G;  1VQ5 A;  2A69 D;  3ORQ A;  1RDP D;  3T1Y H;  2NTS A;  2ZM6 Q;  5IT9 W;  4RAY A;  1HZ9 A;  1UC9 A;  4JBJ A;  1XTD A;  1B53 A;  1U4R A;  2H4O A;  4YAJ B;  2ZM6 L;  1EY0 A;  4B3S L;  4J8Q A;  5KND A;  1E4E B;  4A3F H;  1VQ6 A;  3RB4 A;  3L3O C;  2VQF L;  1BXT A;  2ATL A;  2Z9H A;  5LXT F;  3PW5 A;  1JT8 A;  2RDI A;  4KJN A;  5DLG A;  4L8J A;  2ASB A;  1MD2 D;  1FJG H;  2QEJ C;  4QUC A;  4YWL A;  3L4J A;  3NTI A;  1Z2O X;  3I70 A;  1HQM C;  4PV1 C;  1KJQ A;  5CR3 A;  4DV2 L;  3NGD A;  2CWP A;  2B2V A;  1FR3 A;  5LMU H;  4CGY B;  2VR1 A;  3GTQ B;  1VQN A;  1EQT A;  2FMA A;  1FGB D;  1PDQ A;  3K3P A;  1EY4 A;  3PW2 A;  2YU9 A;  5FLX E;  4Q8F A;  3X3N A;  1TXY A;  4LF9 H;  3NPP A;  3P75 A;  4H02 A;  1BBU A;  3E0E A;  3C0F B;  2FIN B;  2KCN A;  4EBE A;  3GTM H;  1VQI A;  4KLK A;  4EFE A;  1CS0 A;  4ME5 A;  2EJF C;  4AH6 A;  4Q0Y A;  2VXW A;  3CRK C;  4DXG A;  2BDN A;  4ID6 A;  2F0N A;  3I4O A;  4UPA A;  3RGZ A;  4IPG A;  2HHH L;  3I73 A;  4JOI A;  4KKS A;  2QYZ A;  4JI2 H;  3OUZ A;  3S15 H;  2Z4H A;  1XNQ Q;  4BXX H;  2PI2 E;  2B8F A;  4DUZ L;  4HID A;  1K0S A;  1PFM A;  3GTG B;  1EYZ A;  5L1L A;  3STB D;  4ILW A;  1JWM D;  3A5Z B;  1N56 A;  5KYI A;  3M9O B;  3K0X A;  1DOL A;  1GO3 E;  1TT2 A;  4I7A A;  3MC0 B;  4PNY A;  3ZYY X;  4UCS A;  1Y1W A;  2ZJQ A;  2NTT A;  2W57 A;  1IBM H;  4A2B A;  5LL6 b;  2K14 A;  4WBN F;  5DNF A;  4DKA C;  2UXC Q;  4JV5 H;  3H15 A;  5A2Q E;  2AQ1 B;  1GUT A;  2ALY B;  5A2Q L;  4LUZ A;  4RCO A;  3IAY A;  3BQ2 A;  1ASY A;  2PBZ A;  1BGW A;  3K7A H;  3TBI B;  3T1Y Q;  1STH A;  1VQH A;  3P7J A;  1ENF A;  4J0M A;  3BDO A;  4UCV A;  2C9O A;  2JQO A;  3CRL C;  1SNC A;  4X62 L;  3DWQ A;  2F4I A;  2R3Z A;  3J81 E;  3TIG A;  2QA4 A;  3CKI B;  1SEI A;  1JE5 A;  1WJJ A;  1QNK A;  2R7Z G;  4RB3 C;  2L4N A;  3JAM W;  1YHA A;  3M3Y H;  4POG A;  4QQB X;  5DG8 A;  5EAY A;  1XTC D;  4FXK C;  4F4Z A;  1B44 D;  4IUN A;  4UY8 C;  2X69 A;  1PTO H;  4R4Q A;  5KFU A;  1RTO A;  1B1Z A;  5M3F G;  3KHG A;  4ZRZ A;  2D0P A;  2EYM A;  2DY8 A;  2Z8L A;  3K3V A;  2W8L A;  4CJ1 B;  4B9X A;  2JA5 B;  2EOT A;  1KQS A;  4YBZ B;  3RZD B;  1QVC A;  4O42 A;  3OMC A;  1G6P A;  5ELE A;  3D0F A;  1Y1W G;  5C0X J;  3T5K A;  5NUC A;  2WKC A;  1SE4 A;  1AUX A;  5KFE A;  5FJ8 H;  2ICE C;  1AUV A;  1LT5 D;  5LA6 F;  5CGK A;  3CCJ A;  1E2Z A;  1D5M C;  3K6O A;  1KRS A;  1ET9 A;  1SNQ A;  3BZK A;  4IUP A;  4QCL A;  4LJZ C;  1H9K A;  3BQ1 A;  2OTL A;  2UXD L;  4DL6 A;  1XMQ H;  3NQI A;  1YJ9 A;  3BU2 A;  4TV8 F;  4QWC A;  3SE0 A;  4GLA C;  1B33 N;  4Y8V B;  4TUY F;  1E3P A;  5BR8 Q;  3KDF A;  3HOZ G;  2EYF A;  1A2T A;  3ORR A;  4FS2 A;  4PMW A;  3T53 B;  3Q8P B;  1FJG L;  1QJO A;  2WE6 A;  5GAH C;  2RVL A;  4DN4 M;  1Y1W B;  2PW7 A;  1X55 A;  1MGS A;  3G6X A;  1U4P A;  3RB6 A;  4ECT A;  4P74 A;  2JA6 G;  2RGV A;  3LNN A;  5D3D A;  4IUQ A;  4DGZ A;  5D1P A;  2R7D A;  1HNW Q;  1EUC B;  4ED3 A;  1WOC A;  2JA7 B;  5FD6 A;  2VS1 A;  4LF6 L;  3Q6S A;  4L5S A;  3RTX A;  2JA5 H;  3UDF A;  5L9X A;  4LF7 Q;  1JOQ A;  1NR4 A;  3TII A;  4RKL A;  1B9M A;  1TKW B;  3UQ8 A;  2RHQ B;  2C2D A;  5EPL A;  3J7A V;  3M3Y B;  4IR9 A;  1N33 L;  1MSH A;  5CV9 A;  3PVX A;  4X3T A;  2MO0 A;  3HKZ G;  5KYL A;  3MWE A;  4DK3 C;  1QB5 D;  4JPB W;  5K36 H;  1UNN C;  5J2U F;  1PTO B;  3SEB A;  2R82 A;  1BDO A;  4JV0 A;  4F4X A;  4RHR A;  2JEI A;  3FDS A;  5JJL A;  2KEC A;  1K8M A;  4DNI A;  5KEE A;  1E0B A;  1SMY C;  4A76 A;  1VBH A;  4DR6 L;  1GUO A;  2J6S A;  4OO1 G;  2UXC L;  3NP8 A;  2KCM A;  4IRK A;  4K2K A;  4LF5 L;  1QUQ A;  4GN3 B;  1Z2P X;  3DMU A;  4DLK A;  4K5V A;  2ASJ A;  2O4X A;  4K14 A;  1T5E A;  4X3U A;  1VQ9 A;  4O4L F;  3RN5 A;  3RLO A;  3IN5 A;  4RGT A;  4O2D A;  2ZDG A;  1CKM A;  4JW0 A;  2Q2H A;  3NHH A;  2P0A A;  3LWB A;  2W8K A;  3GP7 A;  2FLP A;  5EKL A;  2HVQ A;  1VF5 C;  3BDC A;  5GON F;  4J9L A;  3F8N A;  1D5Z C;  5C0X I;  4C3H G;  4DV0 L;  2K28 A;  4R1J A;  3JAM i;  2KJX A;  5EBD A;  1OTC A;  1FJG Q;  3QG1 A;  4BY1 B;  1LT4 D;  1I5F A;  5J1Z A;  3BVG A;  4IUV A;  4GOP B;  1BUV T;  4DAY A;  3S16 B;  2FE3 A;  1N36 L;  1TWA B;  2VUM H;  1C48 A;  3NWS A;  2F0E A;  4B9W A;  5G3L F;  5C8Y F;  1A9X A;  1IBL H;  4L1K A;  1LTS D;  2J6U A;  3FRP B;  4YWM A;  4MV1 A;  1UE5 A;  4WOR A;  1RK5 A;  4C2M A;  4XQN A;  1CKN B;  3KF8 B;  2FK3 A;  3J80 c;  1I6U A;  3URY A;  2E74 C;  3CPW A;  5C4X B;  4EBC A;  5I47 A;  3NBH B;  1HNW H;  5LMN Q;  2Y0S B;  3D4W A;  4NMZ A;  4P73 A;  4DV4 L;  1ENC A;  2ENB A;  3M4P A;  1CUK A;  4ECQ A;  1BCP C;  2A74 C;  4KMU C;  3Q1K A;  3CCS A;  3OTO Q;  1YZ6 A;  3P1H A;  3IG0 A;  1TA8 A;  4DR7 L;  3N42 B;  3HZX A;  3GTK A;  1CA5 A;  1JC7 A;  2K33 A;  4FNF A;  2YW2 A;  2CQO A;  3I8Z A;  1NCV A;  4J9N A;  4YR0 A;  1QIL A;  4PG3 A;  3RLF A;  3FKI G;  4G7Z C;  1S4Z A;  2K5N A;  2ZXP A;  3A55 A;  2WB1 B;  3MWY W;  1L0Y B;  2E2H B;  4EG0 A;  1YEZ A;  3F2D A;  3HG9 A;  3SGI A;  1C9O A;  2KHJ A;  2R61 A;  4FF1 A;  5KFQ A;  3PW7 A;  2F0K A;  1Z7T A;  3QJY A;  1F9R A;  1I6V C;  1V1P B;  3PIP 3;  2D62 A;  4WFN 3;  2W9C B;  4LFC L;  4LFA H;  1HNX L;  1CZW A;  5M5X B;  1B2T A;  2NVY B;  5IP7 H;  1KC7 A;  3L0O A;  5DQI A;  1N8R C;  1LT3 D;  1DV2 A;  1IYU A;  3PO3 B;  3N52 A;  4NPS A;  4YQW A;  3GTJ A;  2OF1 A;  5KFB A;  3S1Q B;  2FXQ A;  1LTI D;  1PHJ A;  1SNM A;  2ES2 A;  1NJI C;  4YP3 A;  3QWN A;  4R4O A;  5C4H A;  3I4L A;  3RZO H;  3MR5 A;  4EBD A;  3TQY A;  4JI1 H;  3MXN A;  1QCB D;  5DEH A;  4CKB A;  3HOX B;  5KFT A;  1N36 Q;  3VR5 A;  4K0K L;  4LF8 H;  1JJG A;  4FU0 A;  2OT2 A;  4CDC C;  4LSX A;  2FPI B;  3TP6 A;  1JIH A;  2FLL A;  2FHT A;  4PZ7 A;  1CHQ D;  3EQL C;  2D0O A;  2I8C A;  2E2H A;  1HR0 L;  4DV0 Q;  4X6A H;  4CBV A;  1SND A;  3CCM A;  1ROD A;  4JYA H;  3AFP A;  5DQG A;  3HOV B;  4BY7 G;  1EOV A;  1QVG A;  5IOC A;  3NK9 A;  1RJR A;  4NDX A;  4AYB A;  2NU9 B;  1Y8N B;  1L0W A;  2OH2 A;  1TU2 B;  2NN6 I;  4H44 C;  1PH1 A;  2UUC L;  4DUY L;  4FBU A;  2WAQ G;  1G91 A;  1HH2 P;  4C2M H;  4A3K G;  4ED2 A;  1EYA A;  4K2L A;  1DYQ A;  2UUB Q;  3MXG A;  4LUV A;  2PI2 A;  4XDX A;  2C2R A;  1A2U A;  2K5V A;  5C5L A;  1CTM A;  1VQE A;  2XVS A;  5CV6 A;  4ETS A;  1JDE A;  2GVB A;  1JLL B;  2JE6 I;  1J5E L;  2A68 D;  1BXR A;  2SNS A;  5KT6 A;  3WDN A;  5IGG A;  2VQD A;  1TVX A;  2AWO A;  5EPK A;  1NTG A;  3F8T A;  2EZV A;  2LY7 A;  2JEA I;  1PH5 A;  5E4X A;  3V4Z A;  5I4D A;  4DAV A;  4JV1 A;  2NU7 B;  2FFK B;  3HOW G;  2A6H C;  3ULJ A;  4FYD A;  2G9H D;  4Q8E A;  3H94 A;  4ODG A;  1B8A A;  3MZ5 A;  1ESF A;  3SR1 A;  1J8I A;  4OWW B;  5D1O A;  3I4M B;  2JEG A;  1KBL A;  1SFO H;  4RAZ A;  3GTJ B;  2NVX H;  2XNA C;  4ED0 A;  4LF5 H;  4HAE A;  1VQO A;  1WCM H;  4YCU A;  4AYB B;  5IYB G;  3MEH A;  1PH2 A;  2NN6 G;  5EWF A;  4IRD A;  1S72 A;  4KHP L;  1M1K C;  5I6Y A;  1JCK B;  1M0T A;  2D9U A;  3T13 A;  1Y1V G;  3I55 A;  4DUZ Q;  1SCU B;  4Y7N B;  2UU9 Q;  2IJ0 A;  2L9H A;  3BAB A;  4QB4 A;  4O3O A;  2NVY H;  3UI2 A;  1WR2 A;  1ZQ7 A;  3T5H A;  2HVS A;  2R93 H;  2O5J C;  2BH8 A;  4Q45 A;  2OTJ A;  5L1J A;  4DPG A;  4HSP A;  1S5D D;  3OWF A;  3KXY T;  4CKE A;  1KEE A;  5FK9 C;  2JA7 H;  2UXB H;  1D1I A;  5KFL A;  2F0F A;  4TSS A;  2F03 A;  4IRC A;  2E2H H;  1VQP A;  4FVM A;  2NU6 B;  5KFS A;  2QDB A;  2F0I A;  4JI7 H;  3PIO A;  5DG7 A;  3G48 A;  2JA8 H;  1BCP B;  1KD1 C;  3H20 A;  3H40 A;  1DGS A;  3PF5 A;  2A6H D;  4QWD A;  4LF6 Q;  2JA9 A;  1XYI A;  1OXX K;  3D6C A;  5FO7 B;  4J9R A;  4IQZ A;  4NP5 A;  1B3Q A;  1CKN A;  1UUP A;  1K83 A;  3DWP A;  3PUY A;  4DV7 L;  1BR9 A;  1OXU A;  5FO8 B;  5EWG A;  5IYC H;  1XMO H;  2EXZ A;  2ZJR A;  2F4V L;  1SLJ A;  3DF7 A;  2K5D A;  1UE6 A;  3LWU A;  1AN7 A;  1F9P A;  3FKI A;  4MA0 A;  1RHP A;  2R92 B;  1XDN A;  1RF2 D;  4X65 L;  2R7L A;  2C22 A;  1YJW A;  2B2W C;  5LMU L;  5KFG A;  1B6S A;  1JMC A;  3BG3 A;  4ULL A;  2F0L A;  2B63 H;  1N32 Q;  3E0J A;  5D1O B;  4JI4 Q;  1PMR A;  2HIX A;  5IGB A;  1WCM B;  4HYK A;  5L1I A;  3KDF B;  4RWS C;  5D8D A;  2KEE A;  1SFO B;  2AUJ D;  4YY3 H;  5HBR B;  3MHB A;  1XNR Q;  3OHX C;  4BY1 H;  2DNE A;  4DR6 Q;  4EYH B;  3SDZ A;  1EY9 A;  2W7P A;  4DL5 A;  5LL6 S;  5KG6 A;  2K5W A;  3HOZ H;  1DM0 B;  3I2Z A;  4XYL B;  1N48 A;  1TWH B;  1IYJ B;  1XNR H;  2R8I A;  2LXK A;  1J5E Q;  5LL6 X;  2QGQ A;  2MGS A;  4DAP A;  2VQE L;  3NE5 B;  3FDT A;  1F77 A;  1ESR A;  4J15 A;  1HNZ L;  5KFF A;  2IHE A;  2CWA A;  4KY5 A;  4DR4 L;  4FS1 A;  2B2W A;  2E5L Q;  3M4Q A;  2XWJ B;  2DPI A;  3TQ1 A;  5J22 A;  4FM9 A;  5KT2 A;  3CC7 A;  1QE6 A;  4J9K A;  1S0M A;  2F3I A;  4N9P A;  5CV4 A;  4DA2 A;  5JPM C;  1EFW A;  2XD4 A;  3VPD A;  1MKH A;  3NUC A;  1B4O A;  4N8X 1;  1EWI A;  2PYK A;  2Z6B A;  1AZP A;  4JI3 Q;  2K50 A;  2GN5 A;  1IXR A;  2CFM A;  2V4D A;  4OIJ A;  4DL3 A;  2VQF Q;  5CA1 F;  3MR2 A;  4DV0 H;  2VQE H;  1AZQ A;  4HR7 B;  4DUY H;  2AQ3 B;  3UDX A;  4DAM A;  2B2T C;  2L5T A;  4MAM A;  5EZY F;  2R92 H;  4U68 A;  1I4P A;  5KFV A;  5KFD A;  1EZ6 A;  3OPO A;  3C1E A;  3CCR A;  1SYD A;  2HCI A;  1PH8 A;  3J7Y W;  3TP8 A;  5F9N A;  1VQ7 A;  2RCN A;  2WYO A;  1B3A A;  3ZJY C;  2UUB L;  1J5E H;  1C30 A;  4UCU A;  4JI8 L;  5KT5 A;  4ECS A;  1EY5 A;  2R7K A;  4F4W A;  5E3F A;  3KOJ A;  5CC4 A;  2E2I H;  3ND9 A;  2A5H A;  1ZYR D;  4RZR A;  1CK1 A;  1FGU A;  1V1P A;  2BE5 D;  2PMZ A;  4HNV A;  4C1N I;  2KCT A;  4JI0 Q;  4JI8 H;  1KL9 A;  1LUZ A;  3LP8 A;  4KHZ A;  1E2W A;  1Z47 A;  3AFQ A;  3H0G H;  3GTL B;  4Q44 A;  2F0W A;  3BQ0 A;  2L15 A;  2YS6 A;  1K8A C;  1I4X A;  3J80 W;  1X9N A;  2NZ1 D;  1JKJ B;  2JN4 A;  1NBW A;  1MIU A;  2QEX A;  1Y8O B;  3EJI A;  4R7R A;  2UUC H;  5C5M A;  5AJ3 L;  1TWH A;  1BNC A;  2B2U C;  5C4X H;  3FMC A;  2XSC A;  2LXJ A;  1UE7 A;  3RZD H;  4Y52 H;  4A3M H;  3OUU A;  2IWH A;  3MAQ A;  1K73 C;  4OIK A;  2UUA H;  3KAL A;  3U9O A;  1Y69 U;  1ULZ A;  3S2D B;  1PH4 A;  1JE4 A;  2WTF A;  2B2T A;  1JQY D;  3DM1 A;  1I4R A;  1P8L A;  2KEN A;  1F2L A;  3RNU A;  1KC8 C;  5M3M G;  1Q12 A;  2C35 B;  4A3M B;  3CD6 A;  2OQK A;  5JAV A;  1PTO D;  2K04 A;  1PH6 A;  3OTO L;  4J9O A;  2VOB A;  3OWE B;  2PZU A;  4M9U A;  2LMC B;  1K3R A;  5KFJ A;  4TRD A;  2OXP A;  4R4T A;  3WOF A;  4OEM B;  5LMN L;  4A3F B;  2HVR A;  2NBF A;  5H80 A;  4IOC A;  3ICE A;  4A3I B;  4EGJ A;  4F87 A;  1NR2 A;  2R93 G;  1S5C D;  3GTL A;  4ZOL F;  1LTA D;  1TWA A;  3DEO A;  4DV3 Q;  4C5A A;  2B2U A;  3M7N A;  5BMV F;  4N9T A;  3Q8R B;  4MZ9 A;  1Q81 C;  3KHR A;  3J7A F;  1CQI B;  3F2U A;  1GGO A;  4XYM B;  3KBX A;  5JH7 F;  2UUB H;  1IL2 A;  1MSG A;  1HUM A;  4C3J H;  2PNH A;  2UXD H;  1DOM A;  2F3W A;  3BZD B;  1VQ4 A;  2UUA Q;  1VMC A;  4WJ4 A;  1DXM A;  1LAC A;  2RHS B;  3SVM A;  2VUG A;  3Q8Q B;  4RGN A;  2GVA A;  4RNO A;  1VKZ A;  1VAJ A;  1NNX A;  1O7L A;  1C3O A;  4BBR B;  3NQT A;  3W2D A;  4RAU C;  2OEO A;  2XCP A;  2B2Y C;  1MHW C;  1ICW A;  5BR8 H;  4GKJ H;  2YYA A;  3J7A 5;  3N40 P;  4P2C B;  4RGM A;  1IL8 A;  1B9N A;  1QZH A;  4X65 H;  1UWV A;  3HRZ C;  4HQ6 A;  3ERS X;  3RN2 A;  5IY0 A;  5M5X H;  2KA7 A;  4DNT B;  5CB4 F;  2XCA A;  5K36 G;  2JXM B;  5DAU A;  4IHJ F;  1EWH A;  1G29 1;  3WO1 A;  4F7X A;  1CM9 A;  5T14 A;  2XTI A;  1X56 A;  2RSN A;  3PUX A;  2YV5 A;  1YJN A;  4RB0 A;  4OHJ A;  4H13 C;  4B08 A;  1YI2 A;  3IFD A;  4A3B H;  1GSA A;  1CI3 M;  1CQF A;  3S1M B;  2FP4 B;  1F2Z A;  4DV1 L;  2A73 B;  4MN3 A;  1L1O A;  5C44 B;  4ABN A;  5BR8 L;  1G51 A;  3HOV H;  5KFX A;  4U6P A;  4DR6 H;  4A3C H;  2D5D A;  4IFD I;  1N33 Q;  1TWC H;  2I5M X;  5IE8 A;  3MWM A;  4RB1 A;  3SI8 A;  2L0C A;  2Z0S A;  3HFZ B;  3ER0 A;  4EEQ A;  4O3P A;  3LX0 A;  3G6V A;  1SMY D;  1SYX B;  2W9A A;  4DV6 H;  1KDB A;  2KHI A;  1X32 A;  1WCM A;  5DLF A;  3J81 L;  3R5X A;  4K5X A;  2UUC Q;  3CCL A;  1ZHS A;  4ALP A;  2NVX A;  1SDF A;  4EX5 A;  4IUT A;  3D4R A;  3EIV A;  4ZHQ F;  3C1F A;  4G7H C;  2XCL A;  4IFD G;  1TY0 A;  4AQY Q;  2FMM A;  3W1G A;  3EFX D;  1TS2 A;  4I50 F;  3VA5 A;  1KIX A;  2UXB Q;  1V8Q A;  3RAX A;  4IWY A;  3N6R A;  4RA8 A;  4N8F A;  1XX8 A;  1PRT C;  3Q23 A;  3VA7 A;  3RBD A;  3DUZ A;  3VYT A;  1JDB B;  1TWG A;  1I4H A;  3O13 A;  5EOY A;  3CCV A;  2EIF A;  1JXL A;  1A15 A;  4UP7 A;  4POF A;  4B3M L;  1V9P A;  5KFO A;  5COY A;  1SE2 A;  5C3W A;  1M8A A;  1NSN S;  2K5Q A;  4GC6 A;  2UVR A;  1GVP A;  1I50 H;  4JK1 C;  4RHS A;  2B3G A;  2RSO A;  1PA6 A;  3V6H A;  4LF4 H;  4X66 H;  1LYL A;  5JEA H;  5C44 H;  2AQ2 B;  3ETJ A;  2M9V A;  5FPR A;  1S68 A;  1MBY A;  5T1I A;  3G6E A;  3TN2 A;  5C4J H;  2F0O A;  3T5L A;  1WTO A;  1R9T A;  1E7Z A;  2VPQ A;  4OO1 H;  1ZYR C;  4IUU A;  1HPC A;  1SNO A;  2K32 A;  4DK1 A;  1XMO Q;  5F9L A;  2A19 A;  1Z9F A;  4XT3 B;  5KKN B;  2MUY A;  1IBK H;  1CQJ B;  4IPC A;  3A54 A;  4X64 Q;  3HOW B;  4L5R C;  2VUM B;  1A63 A;  1F2Y A;  5C1O A;  2NVY A;  1LM0 A;  3AEV A;  1T9H A;  2BH2 A;  4DR7 H;  5C5J A;  4ZUJ A;  4RZQ A;  5JQW A;  4XYQ A;  3I3C A;  2XIW A;  5M3F B;  4OX9 L;  1PLF A;  1VQF A;  3UE0 A;  2JA7 G;  5IWA H;  3ETH A;  4AYB G;  2MFI A;  1KXL A;  4G4K A;  1PYB A;  5C3E G;  4OX9 H;  5BPH A;  5FLM H;  5IGC A;  2ATW A;  1ZKO A;  1GOZ A;  1E22 A;  1H9S B;  5IP7 G;  4IFD J;  3T16 A;  5IGF A;  4E6I A;  1HR0 H;  4QUF A;  3K5H A;  3GTO B;  3OSN A;  5KFC A;  1NE3 A;  4PMB A;  1KLU D;  5EGT A;  4BBS H;  4KN4 C;  4JI3 L;  2F0U A;  4I4T F;  1TWC B;  3T1Y L;  4A3G B;  4O4I F;  1WD1 A;  3S14 B;  1HXY D;  2YTY A;  4ZKB B;  5KFP A;  2H5X A;  3M4O H;  2HHH H;  1WTV A;  2C28 A;  3H3V C;  3GTQ A;  3GTM A;  1Q1E A;  1U9R A;  3NTK A;  5C0X G;  4CHT B;  3WNZ A;  4BY7 H;  1FNU A;  4DV3 L;  3C3L A;  5ELD A;  2RDF A;  4LW1 A;  3QR8 A;  2EXD A;  1TS4 A;  3GIL A;  2UVW A;  2OWO A;  2RCF A;  1SYC A;  5KT4 A;  4QGU A;  1HFG A;  2CW0 D;  1DCZ A;  1DON A;  1YNX A;  2WV6 D;  4DK6 C;  3EA6 A;  1B6R A;  4DR5 H;  1V43 A;  2WAQ E;  1MI2 A;  3JSL A;  4DUY Q;  4GKK H;  4BY7 B;  2QF7 A;  4DR5 L;  3RFC A;  1YIT A;  2F0Q A;  3GQB A;  2O2L D;  4DL7 A;  3KF6 A;  5M3F H;  3CW2 C;  1EU3 A;  4OWX B;  3A56 A;  1GSO A;  4QWA A;  4QIW E;  2E2J H;  2MPM A;  2YU9 B;  2E2D C;  4JI2 L;  1V51 A;  3NEN A;  3HOY G;  5IYD G;  1L0X B;  4ZQ3 A;  3AMU A;  3PGZ A;  1V1Q A;  1SE8 A;  2EQS A;  4YWK A;  3FKI B;  2V5A A;  1OXS C;  4J9S A;  2I07 B;  4FXD A;  5EJW A;  2R7Z A;  2HCC A;  2BDO A;  2I0Q A;  4O3R A;  1AN8 A;  3QB3 A;  1EIG A;  1J9O A;  2TSS A;  4A3C G;  2K1B A;  1GYF A;  1WTX A;  4B3S H;  2LS0 1;  1N33 H;  2RDH A;  1K83 B;  3A8K E;  1KJ8 A;  3GTQ H;  1BKB A;  3BJU A;  4ECY A;  5I6W A;  3AQQ A;  3R93 A;  3I91 A;  2Q2I A;  1KTK A;  3ITP A;  2RQX A;  1HNX Q;  3K5L A;  2PMZ E;  4DUZ H;  1VQG A;  1VQA A;  3GIM A;  1QVF A;  1E1T A;  4DV5 Q;  4JI8 Q;  4GNX A;  3OW7 A;  1AP0 A;  4A3D H;  2W9C A;  3EN2 A;  3ULP A;  4MIU A;  1W6K A;  5M3M H;  3S14 H;  1W93 A;  3GDE A;  1PFS A;  2AHO B;  3TIN A;  5F2D A;  4BBS B;  4BXX G;  1TQO A;  2N88 A;  2DLN A;  2ZXO A;  2W6Z A;  1H9S A;  3FHW A;  4IJL A;  4LF4 L;  3BA8 A;  2M05 A;  3KF6 B;  1HZA A;  2Y0S E;  1STN A;  5JVL A;  1L2F A;  3G8C A;  4RGO S;  4A3D G;  4MV9 A;  1IKM A;  4P71 A;  3G6J B;  1YHQ A;  4CKC A;  4UCT A;  4FF4 A;  1Y14 B;  5E4W C;  2YCH A;  2JA7 A;  5ELC A;  4RG1 A;  1WYD A;  3Q8S B;  4LFB H;  2VPS A;  4TV9 F;  1JOR A;  2IA6 A;  2IX1 A;  3H3V H;  4BA2 I;  4ZQI A;  1T94 A;  2DGY A;  4UDU C;  5HV6 A;  3KLS A;  1N9W A;  2F1M A;  4IFD H;  1Z6H A;  5A2Q W;  4ECR A;  3HXL A;  5M5W H;  3ONA B;  4A93 B;  3JAM E;  2N49 A;  4B3S Q;  3KJO A;  1EY6 A;  1X3E A;  1OXV A;  2H1E A;  4HCS A;  3S17 H;  2PQE A;  4IO9 A;  1NY4 A;  1PZI D;  2PVP A;  3ULL A;  1YNN C;  3G7L A;  3RB3 A;  1GKH A;  5FLX L;  1WD0 A;  4FF3 A;  3AB9 A;  1HJP A;  1STB A;  1U0L A;  4R9W A;  1TAE A;  3QZ7 A;  1VCI A;  2V9W A;  4B3R H;  1D8L A;  1PFN A;  3S15 B;  2B2V C;  2EJG C;  4NW2 A;  5FLM G;  3GTK B;  2P5Z X;  4C56 C;  1W96 A;  2EYJ A;  4UP8 A;  3STB C;  5DM6 3;  1PRT B;  1A62 A;  1W3S A;  2DIK A;  2UU9 L;  1IW7 D;  3HKS A;  4NXM L;  2FJZ A;  1LTR D;  2WAQ A;  5JVG 3;  1S40 A;  4J9P A;  5DGA A;  3N41 B;  1P16 A;  1A6X A;  2RKS A;  4ZYS A;  4JI1 Q;  5FO9 B;  1HR0 W;  3OSO A;  3G4S A;  5FJ8 G;  4A3B G;  4K8J A;  4QY7 A;  2JEJ A;  2EYH A;  1E24 A;  2NWG A;  1A3V A;  4JI1 L;  3J81 i;  3CF5 A;  5KFY A;  3S16 H;  2RDJ A;  4ECZ A;  5CYU A;  3KF8 A;  3E5N A;  4C2M B;  4K5W A;  1VQK A;  3C2P A;  3BJY A;  1Q7Y C;  4B3R L;  4ZAI A;  4ECU A;  1X3P A;  1OXT A;  2F0P A;  2K6A A;  2EDG A;  3MXN B;  1BF4 A;  2XGQ A;  5ELN A;  3J7A K;  1HR0 Q;  4FP5 D;  2KCC A;  5HY6 A;  1EL0 A;  3CU7 A;  4O3S A;  3VYR A;  2JEF A;  3VDY A;  1Y8P B;  1J6Q A;  3S17 B;  1ZHQ A;  1IBM Q;  4OL7 A;  1SMX A;  1VMP A;  1V1O A;  3Q2O A;  2FLN A;  1T36 A;  1O7I A;  4K6D A;  3E3X A;  4KKT A;  1I50 A;  3PR5 B;  3GIK A;  4F50 A;  4HCE A;  5EKK A;  3QO2 A;  4LF8 L;  4K0K H;  3OIQ A;  3TDQ A;  3BG5 A;  1SN8 A;  3I72 A;  4QWB A;  4Q0F A;  1HA5 A;  2JYO A;  4HJ7 A;  1XPR A;  2IHF A;  3G6Y A;  2AKW B;  2ZJP A;  4CDE C;  4GOP C;  1JR0 D;  3DWA A;  3PSI A;  1PZK D;  2F4V Q;  4X64 L;  5M5W B;  4A93 H;  1S9F A;  1TII D;  4H7B A;  3VR3 A;  4LFA L;  1N34 H;  4EQN A;  5IT9 E;  3K0Y A;  1LLR D;  1A3U A;  1R4Q B;  4A3L H;  2PQA A;  3GIJ A;  2J6T A;  4WJW A;  1GHJ A;  4TQS A;  5BN4 A;  2E8G A;  2B29 A;  3TP5 A;  4O1N A;  3D3R A;  3PUV A;  2DWC A;  1XPO A;  2R7F A;  1K8O A;  2N3S A;  4DV3 H;  2R8K A;  1QWY A;  5CV5 A;  4YAK B;  2R87 A;  3I90 A;  1Z2N X;  4RFB A;  3M85 A;  2E5L H;  1VF7 A;  5C4X G;  3PV0 A;  2HQE A;  2FJ2 A;  2O5I C;  4MTD A;  5KG7 A;  1YNJ C;  1PTO C;  3MFH A;  2JP1 A;  2WKD A;  4DV4 Q;  1VQB A;  2WP8 J;  3PO2 G;  5KT7 A;  1IBK Q;  3CC4 A;  2PZW A;  3S1R H;  5CBE E;  1BBW A;  4JI3 H;  2JA8 B;  2MJ8 A;  4PDB A;  3MA2 B;  4GOP A;  2EY1 A;  4A2A A;  4EQP A;  1HCZ A;  3DM3 A;  1RYS A;  1SYG A;  3GII A;  2JK8 A;  1LO5 D;  1GSH A;  1HTP A;  4JOI C;  3D6W A;  3MR6 A;  4CJ0 B;  2JA5 A;  4YY3 Q;  5GAE C;  2R86 A;  3H0G B;  3F2C A;  3MFY A;  1XMQ L;  3HB9 A;  3A0J A;  2EPB A;  4C3I G;  3EBE A;  3HOU H;  1XPU A;  1LTL A;  2N8N A;  4V0B A;  2DZD A;  1BBX C;  4NXN H;  1BVS A;  4YCV A;  3QOJ A;  1I7N A;  2JEB I;  1K8G A;  2BQR A;  1XWE A;  4IUR A;  1FKA H;  2RF4 A;  4GKJ L;  1O75 A;  2PPB C;  2V58 A;  4JG2 A;  4JI5 L;  3RF2 A;  2KVM A;  3E9H A;  3QIA A;  3T51 B;  1V4Y A;  4LUO A;  5CV7 A;  1R9T H;  3MVV A;  1EZ1 A;  4P75 A;  3CAM A;  3H91 A;  1HNZ Q;  2VA2 A;  4JI4 H;  3V6K A;  1ZXT A;  2K7V A;  5KX5 F;  1LTT D;  1Q8I A;  2Q2T A;  2NB0 A;  4JV2 A;  4MV7 A;  1Y1V A;  5KG1 A;  1IBL Q;  5LP6 F;  1GXD C;  2R7M A;  1CHP D;  1TWA H;  4DR3 Q;  3H0G G;  3HKZ B;  4EFB A;  5KFK A;  4B3T H;  4DV2 Q;  1ET6 A;  4YR2 A;  2WIN B;  2VW9 A;  2VQF H;  2DPJ A;  2VL6 A;  2HT1 A;  3CPF A;  2XC9 A;  3CMA A;  3OYY A;  1XNQ L;  1H9M A;  3FKI H;  3CVZ A;  3UE1 A;  3RD4 A;  3W3A A;  1FD7 D;  3BA9 A;  1EY8 A;  2K01 A;  3OIP A;  5LMN H;  4BA1 I;  1CFM A;  1PZJ D;  4UP9 A;  3TME A;  4O2B F;  3RUZ A;  3KAK A;  1JJC B;  3TZU A;  2WII B;  3RAQ A;  5I2Y A;  3IRB A;  4GS3 A;  1IHZ A;  1YVC A;  4C3H B;  3VPC A;  3KHH A;  3IFT A;  3RJ0 A;  3BZC A;  1PRT F;  1EU4 A;  1AE2 A;  1CQV A;  4GLX A;  1TS5 A;  3VMM A;  5DQH A;  1BCP D;  5ELO A;  4X65 Q;  1M4V A;  3S1R B;  1KNE A;  3FPU B;  3ERO A;  2QKI C;  1N34 Q;  2PCF B;  1STY A;  3S1Q H;  4HJ9 A;  2BE5 C;  1VBG A;  4GKK L;  2ALZ A;  4QL5 A;  3RLN A;  4ECX A;  2EJM A;  4MHE A;  3NTH A;  2ASL A;  2CKZ B;  3HOX H;  4F88 A;  2F0D A;  5D65 A;  5C0X H;  1XMO L;  5FLX W;  1SEB D;  4LH7 A;  2GLT A; 
#chains in the Genus database with same CATH homology
 1G51 A;  3HOV H;  4A76 A;  4DR6 L;  3UDG A;  1D7Q A;  4A3C H;  4OWT B;  1MJE A;  4IFD I;  1N33 Q;  4OO1 G;  4HIM A;  1TWC H;  2I5M X;  3KLW A;  4JC0 A;  2KCM A;  5IE8 A;  5IYC G;  1VQM A;  1VQL A;  4LF5 L;  1QUQ A;  2Z0S A;  3ER0 A;  3HFZ B;  4GN3 B;  2A1A A;  1CSP A;  4A93 G;  1MJC A;  2KHI A;  5IP9 G;  4A3K H;  3HOY H;  3E9I A;  3Q8D A;  1W2B A;  3GTL H;  2UUC Q;  1VQ9 A;  3PO3 H;  3RN5 A;  3CCL A;  3RLO A;  4ALP A;  4DR2 L;  3K81 C;  4IPD A;  4R4C A;  4O2D A;  4EX5 A;  1CKM A;  1X3G A;  2Q2H A;  3EIV A;  1YIJ A;  4IFD G;  4AQY Q;  4PZ6 A;  2HIV A;  3W1G A;  2NVT H;  4JYA Q;  5C0X I;  4DV0 L;  4R1J A;  1KIX A;  1RIP A;  2UXB Q;  4WJ3 M;  3JAM i;  1FL0 A;  1OTC A;  2UXD Q;  1FJG Q;  2YTV A;  3PIP A;  1K83 H;  3J80 i;  3CCV A;  2EIF A;  4JI0 L;  1I5F A;  2Z6K C;  4UP7 A;  1V9P A;  4POF A;  1L1O C;  3TEH B;  4GOP B;  3MEF A;  4B3M L;  1N36 L;  3GTO H;  1VQJ A;  2DUD A;  1B7Y B;  1UE1 A;  5GQO A;  2VUM H;  1GVP A;  1I50 H;  1PA6 A;  2B3G A;  4DR3 L;  4JV5 L;  2ZTD A;  4A3L H;  1IBM L;  1I6H H;  1LYL A;  1WI5 A;  5C44 H;  2VZA A;  1FVI A;  4YCW A;  4YWM A;  1A0I A;  1UE5 A;  2NZO A;  3CP0 A;  3L7Z C;  3HOV G;  3G6E A;  5C4J H;  2I5L X;  3K7U C;  1CKN B;  4JBM A;  1E7Z A;  3KF8 B;  4B3T L;  2K4K A;  3J80 c;  1TWH H;  3M9B A;  3CPW A;  4A4I A;  3NEM A;  1XMO Q;  3NBH B;  3S1N H;  2A19 A;  5LMN Q;  1Z9F A;  3JAM c;  2JA8 G;  1C7Y A;  4IPC A;  4MTN A;  4P73 A;  4X64 Q;  2HHH Q;  4DV4 L;  4GNX B;  4L5R C;  4ME3 A;  1A63 A;  3M4P A;  3CXC A;  1CUK A;  1LM0 A;  3AEV A;  3A5U A;  4HJ8 A;  1T9H A;  2MO1 A;  2BH2 A;  3CCS A;  2XGT A;  1Q8K A;  3J81 j;  3J7Z C;  4Y7N H;  1YZ6 A;  3OTO Q;  2ZTC A;  3TS2 A;  4DR7 L;  3HKZ E;  4LF9 Q;  1SR3 A;  4QJF A;  4OX9 L;  1PH9 A;  2JA7 G;  1VQF A;  3D31 A;  3UE0 A;  1A8V A;  4AYB G;  4BBR H;  2MFI A;  1KXL A;  3I4N G;  3S1M H;  2Z6K A;  1PYB A;  5C3E G;  2CQO A;  3CC2 A;  3U4V A;  1I3Q H;  5FLM H;  2E5L L;  3CQZ H;  2ATW A;  5JJI A;  4PG3 A;  3RLF A;  3FKI G;  1E22 A;  5IP7 G;  4IFD J;  5DLQ E;  2K5N A;  3GTJ H;  4DR7 Q;  1NE3 A;  1YEZ A;  3F2D A;  3SGI A;  1C9O A;  2KHJ A;  5JEA J;  2I5H A;  1EUJ A;  2BA0 A;  4BBS H;  4JI3 L;  2R92 G;  3H3V I;  2D62 A;  3T1Y L;  4LFC L;  5JEA G;  5C44 G;  2YTY A;  4DV7 Q;  4A3J H;  4B3T Q;  1HNX L;  2H5X A;  4A3I G;  3M4O H;  5IP7 H;  3L0O A;  3T1H Q;  4JI6 L;  1N8R C;  1Q86 C;  4NPS A;  2K75 A;  1XNR L;  5IWA L;  1Q1E A;  2FXQ A;  1NMF A;  1PHJ A;  2ES2 A;  1NJI C;  3FP9 A;  4NB3 A;  5C0X G;  1K9M C;  4JV5 Q;  4R4O A;  1U5K A;  4BY7 H;  3RZO H;  3TQY A;  4LNQ A;  3I7F A;  4DV3 L;  2R7Z H;  3HOW H;  3S24 A;  1N36 Q;  4LW1 A;  4A3J G;  3F1Z A;  5IWA Q;  2EXD A;  1XJV A;  4K0K L;  1JJG A;  4A3M G;  4YY3 L;  2OCE A;  5GAD C;  3T1H L;  2OWO A;  4JI6 Q;  1N32 L;  4QGU A;  4PZ7 A;  1YNX A;  2D0O A;  4DR1 L;  3GTG H;  4DK6 C;  1HR0 L;  5LMU Q;  3S2H H;  4DV0 Q;  1V43 A;  1HNW L;  2WAQ E;  4LFB L;  4X6A H;  4DUY Q;  5IYD H;  3CCM A;  1HZB A;  4JYA L;  3AFP A;  4BY7 G;  1EOV A;  1X65 A;  1AH9 A;  1QVG A;  4DR5 L;  1YIT A;  2UXB L;  1L0W A;  1K0R A;  3KF6 A;  5M3F H;  2NN6 I;  3CW2 C;  1PH1 A;  2UUC L;  4OWX B;  4DUY L;  1I94 Q;  3I56 A;  4QIW E;  2E2J H;  2WAQ G;  4JI2 L;  1TWF H;  1HH2 P;  3NEN A;  4C2M H;  4EQ5 A;  5IYD G;  4DR1 Q;  4A3K G;  3HOY G;  3PGZ A;  1V1Q A;  1SE8 A;  1X54 A;  2EQS A;  4YWK A;  3RR5 A;  1OXS C;  2UUB Q;  4KI0 A;  4LUV A;  2PI2 A;  5J3B A;  3OW2 A;  4A3G H;  2K5V A;  4LF9 L;  2I0Q A;  4A3E G;  3G71 A;  1VQE A;  2NZH A;  1Q1B A;  2GVB A;  2JE6 I;  3W5O A;  1J5E L;  4A3C G;  3A74 A;  1VQD A;  4NXN L;  2AWO A;  4JBK A;  3GTQ H;  1BKB A;  1NTG A;  3BJU A;  3F8T A;  4C3H H;  5AJ3 Q;  3F2B A;  2VQE Q;  4B3M Q;  3AQQ A;  2JEA I;  4X62 Q;  1PH5 A;  2Q2I A;  3AYH B;  1HNX Q;  4GKK Q;  3HOW G;  2UXC L;  1VQ8 A;  3ULJ A;  3TS0 A;  1EIY B;  3TRZ A;  2PMZ E;  4HIO A;  1VQG A;  1VQA A;  4HIK A;  1QVF A;  1E1T A;  1B8A A;  4DV1 Q;  4DV5 Q;  4JI8 Q;  4GNX A;  1N34 L;  4OWW B;  3U4Z A;  4A3D H;  3EN2 A;  3ULP A;  1SFO H;  3TRE A;  2NVX H;  3PCO B;  5M3M H;  3HOU G;  3S14 H;  3NEL A;  4DR2 Q;  1ASZ A;  3GDE A;  1PFS A;  1VQO A;  1WCM H;  2AHO B;  4YCU A;  5IYB G;  3GTP H;  4YHH L;  3GO5 A;  4X66 L;  1PH2 A;  4BXX G;  2NN6 G;  1S72 A;  4L5T A;  4GLV B;  4KHP L;  3FHW A;  4IJL A;  3DLL A;  1M1K C;  4LF4 L;  4OO1 I;  3KF6 B;  2VNU D;  1HZA A;  2Y0S E;  1L2F A;  4A3D G;  1Y1V G;  4JI7 Q;  3I55 A;  1S3O A;  4P71 A;  4DUZ Q;  1YHQ A;  2UU9 Q;  3U50 C;  1Y14 B;  1YHB A;  4R4I A;  2NVY H;  4RG1 A;  2BA1 A;  3PUW A;  1WYD A;  2R93 H;  2BH8 A;  2B63 G;  2OTJ A;  4LWC A;  1SRU A;  4DPG A;  4PZ8 A;  2JA5 G;  2IX1 A;  3H3V H;  4BA2 I;  2F52 A;  3U58 A;  4A3E H;  2DGY A;  2JA7 H;  1NMG A;  1PVO A;  4P72 A;  4L5Q A;  1N9W A;  1PV4 A;  2E2H H;  1VQP A;  2AWN A;  3PIO A;  2UUA L;  3G48 A;  1KHI A;  3PUZ A;  5M5W H;  4GNX C;  2JA8 H;  1KD1 C;  4DV6 L;  2N49 A;  1VQC A;  4B3S Q;  3KJO A;  2ZTE A;  1DGS A;  1X3E A;  3PF5 A;  3PO2 H;  4LF5 Q;  1OXV A;  2HQL A;  3LGJ A;  3S17 H;  1C0A A;  2IY5 B;  4LF6 Q;  2JA9 A;  4IO9 A;  1NY4 A;  3HOX G;  2JJQ A;  4BBS G;  3ULL A;  1OXX K;  4DV6 Q;  1GKH A;  4GN4 B;  5HGQ A;  1TWG H;  1CKN A;  1JB7 A;  1HJP A;  1U0L A;  3PUY A;  2K52 A;  1Q46 A;  4C3I H;  4DV7 L;  4LFC Q;  1OXU A;  3I4N H;  1VCI A;  4XIG S;  4NXM Q;  1D8L A;  5C3E H;  1EQQ A;  4IOA A;  5IYC H;  5FLM G;  2ZJR A;  2F4V L;  1SLJ A;  1E1O A;  1IBK L;  2K5H A;  4UP8 A;  3STB C;  1UE6 A;  2N78 A;  4A75 A;  1A62 A;  1W3S A;  5M5Y H;  5LMN W;  2UU9 L;  3HKS A;  2Y0S G;  5IYB H;  1VQ5 A;  4NXM L;  4LF7 L;  1S40 A;  4X65 L;  1P16 A;  2ZM6 Q;  1YJW A;  4JI4 L;  2ID0 A;  3KYH C;  4JI1 Q;  5LMU L;  1HR0 W;  1M90 C;  1JMC A;  4AYB E;  4YHH Q;  1HZ9 A;  3G4S A;  2B63 H;  4JBJ A;  1XTD A;  5FJ8 G;  1N32 Q;  4A3B G;  4QY7 A;  1E24 A;  3GTK H;  3JC6 6;  2ZM6 L;  4JI4 Q;  2HIX A;  4JI1 L;  3J81 i;  3CF5 A;  4B3S L;  2A8V A;  3S16 H;  3KDF B;  1B70 B;  4A3F H;  1VQ6 A;  1VQK A;  4LFA Q;  2VQF L;  1Q7Y C;  2JA6 H;  4B3R L;  1XNR Q;  3K8A A;  1QUQ B;  4BY1 H;  4DR6 Q;  1JT8 A;  1OXT A;  2ASB A;  3MXN B;  2VUM G;  5ELN A;  4YWL A;  3HOZ H;  3I2Z A;  1HR0 Q;  4DV2 L;  5HY6 A;  1IYJ B;  4AIM A;  2CWP A;  1AE3 A;  2LXK A;  1J5E Q;  4A3F G;  3VDY A;  1VQN A;  4LF8 Q;  1J6Q A;  2QGQ A;  2VQE L;  1EIF A;  3I4M G;  1IBM Q;  2MQH A;  4MNO A;  4JI7 L;  1SMX A;  4J15 A;  4JCV E;  4DAY B;  1L1O B;  1HNZ L;  2IHE A;  5H1S E;  2CWA A;  4DR4 L;  1O7I A;  1TXY A;  2WB1 E;  2E5L Q;  3M4Q A;  1XMQ Q;  4H02 A;  1BBU A;  3E0E A;  4LF8 L;  4TVA B;  4IJH A;  3CC7 A;  3GTM H;  1VQI A;  1SN8 A;  4KLK A;  2F3I A;  1EFW A;  1JJ2 A;  1PYS B;  4JI2 Q;  1MKH A;  4AH6 A;  4HJ7 A;  1XPR A;  2Q2U A;  2IHF A;  1EWI A;  2AKW B;  5GAG C;  2ZJP A;  4DV5 L;  4JI3 Q;  4GOP C;  2K50 A;  2GN5 A;  1IXR A;  3I4O A;  3PSI A;  4UPA A;  2AMC B;  4IPG A;  2CFM A;  2F4V Q;  4X64 L;  2HHH L;  1X6O A;  4JOI A;  4A93 H;  2VQF Q;  4LFA L;  3KFU A;  3S15 H;  1XNQ Q;  4BXX H;  2PI2 E;  4DUZ L;  4HID A;  2YTX A;  2PQA A;  1KAW A;  1WFQ A;  3UDX A;  4DAM A;  2WFW A;  3STB D;  3PF4 A;  4KHP Q;  3A5Z B;  2E8G A;  4OON A;  3CCQ A;  2B29 A;  3CCU A;  2VY3 A;  4LF4 Q;  2R92 H;  3K0X A;  2CCZ A;  1GO3 E;  1Y1V H;  3PUV A;  1XPO A;  2R7F A;  2ZJQ A;  1IBL L;  3CCR A;  3K80 C;  2N3S A;  4TQU S;  4XTC S;  2K14 A;  1PH8 A;  4DKA C;  4HJ5 A;  1VQ7 A;  3H15 A;  2RCN A;  2UXC Q;  3ZJY C;  2ALY B;  2UUB L;  4DR4 Q;  3M85 A;  1UEB A;  4GN5 A;  4LUZ A;  4RMF A;  4JI8 L;  3PV0 A;  5C4X G;  1ASY A;  3KOJ A;  2E2I H;  3L2P A;  3K7A H;  5IT9 c;  1FGU A;  3T1Y Q;  1H95 A;  4DV4 Q;  3PO2 G;  1VQB A;  2WP8 J;  1VQH A;  1EQR A;  2KCT A;  1KL9 A;  1PH7 A;  1LUZ A;  4JI0 Q;  4KHZ A;  1Z47 A;  1IBK Q;  3AFQ A;  3H0G H;  2JQO A;  3CC4 A;  3S1R H;  1BBW A;  2L15 A;  2KBN A;  4X62 L;  1K8A C;  1X9N A;  4GKJ Q;  1CSQ A;  2QA4 A;  1NBW A;  1MIU A;  2QEX A;  4BBR G;  1JE5 A;  1WJJ A;  4NXN Q;  5AJ3 L;  2R7Z G;  1CKO A;  4GOP A;  5C4X H;  1YHA A;  4AQY L;  2LXJ A;  1UE7 A;  3DM3 A;  1IZ6 A;  3RZD H;  4POG A;  5EAY A;  4A3M H;  2PQA B;  3M3Y H;  2JK8 A;  4QQB X;  1SRO A;  1K73 C;  4JOI C;  3UDI A;  3PO3 G;  4UY8 C;  4YY3 Q;  5GAE C;  4R4Q A;  3F2C A;  1PH4 A;  1XMQ L;  3A0J A;  1GD7 A;  2IT1 A;  5M3F G;  1P8L A;  2KEN A;  2YU9 H;  2LSS A;  4X66 Q;  3RNU A;  1KC8 C;  2D0P A;  3EBE A;  5M3M G;  3HOU H;  1Q12 A;  5JJK A;  4HJA A;  2C35 B;  1LTL A;  2N8N A;  1XPU A;  4A3L G;  4A3I H;  3CD6 A;  2V1C C;  2OQK A;  3WWV A;  1BVS A;  4YCV A;  1PH6 A;  4IPH A;  3OTO L;  1PH3 A;  2JEB I;  1KQS A;  1K8G A;  2R6G A;  4DR5 Q;  3B6Y A;  1QVC A;  1G6P A;  1K3R A;  3D0F A;  2RF4 A;  1Y1W G;  5C0X J;  4GKJ L;  4JG2 A;  4R4T A;  5LMN L;  4JI5 L;  5FJ8 H;  3E9H A;  4BY1 G;  4IOC A;  3ICE A;  1X3F A;  4K0K Q;  2R93 G;  4LUO A;  3CME A;  4APV A;  3CCJ A;  1R9T H;  4B3R Q;  1KRT A;  4DV3 Q;  1KRS A;  3M7N A;  4P75 A;  3CAM A;  3BZK A;  4MZ9 A;  1Q81 C;  1HNZ Q;  1Y1W H;  2OTL A;  2Q2T A;  2UXD L;  1YJ9 A;  1IL2 A;  3GD7 A;  1IBL Q;  3BU2 A;  4C3J H;  2PNH A;  1TWA H;  5GRO A;  3H0G G;  4DR3 Q;  4GLA C;  1EYG A;  4OX9 Q;  2OQ0 A;  4JI5 Q;  4DV2 Q;  5FLX c;  3KJP A;  1VQ4 A;  1E3P A;  2VW9 A;  5BR8 Q;  1WCM G;  3KDF A;  2UUA Q;  3HOZ G;  2VL6 A;  4WJ4 A;  2HT1 A;  2RHS B;  3CPF A;  3CMA A;  1Q82 C;  2GVA A;  3OYY A;  4PMW A;  1XNQ L;  2NVQ H;  3FKI H;  3UE1 A;  1FJG L;  5GAH C;  4BA1 I;  1X55 A;  4UP9 A;  3J7A 5;  4P74 A;  2JA6 G;  1JJC B;  4FDB A;  1QZH A;  2MNA A;  1RL2 A;  1UWV A;  1HZC A;  1YVC A;  2R7D A;  3IRB A;  4GS3 A;  1HNW Q;  3BZC A;  3ERS X;  3RN2 A;  4JBW A;  5IY0 A;  5M5X H;  1WOC A;  5E7N A;  1AE2 A;  3W1B A;  4GLX A;  1YBY A;  2VS1 A;  5K36 G;  1G29 1;  4LF6 L;  1GM5 A;  4L5S A;  5ELO A;  2JA5 H;  2WB1 G;  4X65 Q;  2XTI A;  3J81 c;  1X56 A;  3PUX A;  3UDF A;  3CCE A;  2YV5 A;  1QZG A;  4LF7 Q;  4Y52 H;  1YJN A;  2IX0 A;  2RHQ B;  1I94 L;  1N34 Q;  3I4M H;  1YI2 A;  1N33 L;  3S1Q H;  4HJ9 A;  4A3B H;  4GKK L;  2MO0 A;  4QL5 A;  3HKZ G;  3RLN A;  4DK3 C;  2YYZ A;  1VS0 A;  4OXP A;  3S2D H;  2CKZ B;  3HOX H;  4DV1 L;  1XMO L;  4LFB Q;  4O0A A;  5IP9 H;  5JJL A;  1L1O A;  4A3G G;  5BR8 L;  4DNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...