4A3KG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3kG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3kG01
3SGIA 3NENA 3I55A 4DR3Q 1XPUA 4JI4Q 1Q46A 2N3SA 3PUWA 4IJLA 1KHIA 4JBWA 4DKAC 1Q86C 1XNRQ 3KJPA 4DR4Q 1HNWL 4BY1G 1PH1A 1TWGH 3M4PA 2JA5G 1W3SA 1KL9A 2JQOA 4O2DA 1NMFA 2Q2UA 4LF7Q 1IL2A 4JOIC 1VQDA 2K5HA 2UUBQ 4A3DG 5GROA 4NXMQ 4DR3L 1VS0A 4LFBQ 1HNZL 3TEHB 3S2DH 3HOVH 1IXRA 4MTNA 2LXJA 4A3KH 3K8AA 1X3GA 2ZM6L 3HOUH 3S17H 4JI8Q 3KF6A 3PO3G 5HGQA 2F52A 4O0AA 4GOPC 1Y1WG 1A8VA 3M85A 1HNZQ 2JA9A 5C44H 4DV3Q 1BKBA 4MZ9A 4DV5Q 4L5TA 1N34Q 1TWAH 2KHIA 1QVGA 1VQAA 2NZOA 5M3FH 5IE8A 4NPSA 4YWKA 3OTOQ 3E0EA 2Z0SA 2I5HA 4IFDI 3U58A 3TS0A 1YEZA 1P16A 1TWFH 5FLMG 3CF5A 3PUXA 4DUYQ 4A3CH 2I5LX 4EX5A 3CCSA 1I94L 4P75A 2D0PA 4YY3L 1X55A 3GD7A 1IBKL 3S1MH 3TRZA 1N32L 5LMNQ 3PGZA 4IFDJ 1OXVA 3U4VA 1L1OA 4JI2Q 3PF5A 5JJLA 3CCEA 3T1HL 2VQEL 2UUCQ 1SR3A 1Q8KA 2HIXA 4GS3A 4MNOA 2LXKA 1K73C 2Z6KC 4UPAA 3M4OH 4HJ9A 1CKNB 2HT1A 5LMUL 4AYBG 4JI5L 4BY1H 2B3GA 2VW9A 1CUKA 3CXCA 4DR2L 1PH9A 1Y1VH 2CQOA 1B7YB 3J81j 2GVAA 3I2ZA 4DK6C 2CCZA 4JOIA 2B63H 2IX0A 2WB1E 1X3EA 4A3KG 4C3JH 1NTGA 1VQPA 1WCMG 1V1QA 3D31A 1YITA 1V43A 4QJFA 2ZJRA 4HIKA 1K9MC 1X65A 2ZTEA 2JA8G 1VQ6A 3S14H 1FGUA 2N49A 1EFWA 3KFUA 1UE5A 2JJQA 3E9HA 3NEMA 1YIJA 2CKZB 4B3RQ 5C44G 4X64L 4OX9L 2BA0A 1RL2A 3GTKH 3CPFA 4C3HH 1C7YA 3VDYA 1PYBA 3B6YA 5GQOA 3HKZE 4JBKA 4LF6Q 3STBC 4GLVB 1TWHH 4YCWA 4A3GH 5FLMH 3T1HQ 1KXLA 2NVQH 3CAMA 1FJGL 3ULPA 3EN2A 4A3BH 1SLJA 1IZ6A 2VS1A 1AE2A 3H0GH 4IJHA 4POFA 4LF8Q 1XMQL 4IOAA 4A3EH 1N33Q 4JYAQ 4JBJA 4YCUA 4GOPA 1YHAA 5C0XI 2JA6G 3H3VH 4A93G 1OXSC 4DUYL 1YJ9A 2Q2HA 1X54A 4JI0Q 3J80i 3J81i 2Z6KA 4LFBL 1JJ2A 3UDFA 5JEAJ 5IYCH 1VQCA 1QVCA 2R92H 3HFZB 1GKHA 5HY6A 3G48A 3S16H 1OTCA 5BR8L 2HHHQ 1YBYA 3E9IA 2R93G 1E7ZA 1Y1VG 2EQSA 1HNWQ 3GTOH 3HOZH 2F4VL 1LYLA 4UP8A 4L5RC 4QL5A 5ELNA 3H3VI 2LSSA 4JI3Q 5C3EH 1YZ6A 2ZTDA 4DV2Q 1HR0L 4GKKQ 1WCMH 1X9NA 1I6HH 2EXDA 2DGYA 4A3MG 1XJVA 1Z47A 3PUYA 5IP9G 1VQMA 2JA7G 1JJCB 1EIFA 4TVAB 3EBEA 4HJ8A 2UXBL 2MO0A 1WFQA 4UP9A 1CSQA 3ULJA 3PF4A 4B3SL 2H5XA 4IPDA 4DV2L 4YY3Q 4DR5L 2YV5A 2C35B 1VQ5A 4A3IH 3M4QA 1IBLQ 1Q82C 1ASYA 3AFPA 1K8AC 2NVYH 4IPGA 5H1SE 4OWWB 3FHWA 2OQ0A 2R6GA 3Q8DA 4NXNL 4AQYL 4IPHA 1GO3E 1L0WA 4AIMA 4A3BG 1AE3A 4LF8L 4L5SA 1R9TH 2Q2TA 3H0GG 2UUAQ 2JE6I 2K5VA 1N36Q 4A3EG 4ALPA 4BBRH 3IRBA 4B3TL 1VQEA 4P71A 2YTYA 5E7NA 1KAWA 1G6PA 4DV1L 1IBMQ 1PFSA 1HZCA 4YCVA 5IWAL 4LF5Q 4Y52H 1J6QA 1PVOA 2R7ZH 2VL6A 2Y0SE 3GO5A 1HJPA 3K81C 4PG3A 4HJ5A 2R7FA 4X66L 4DR2Q 3HKSA 3NELA 3MEFA 1XMQQ 1DGSA 4X66Q 4QQBX 2PI2E 1L1OB 3RLFA 5IYCG 1QZGA 4KHPL 1FVIA 2R92G 2E2HH 3AQQA 4LF5L 3GDEA 1UE1A 1C0AA 1VQJA 2OTLA 2PQAA 1IYJB 1OXXK 3S1NH 2B29A 1IBML 3PO2H 4DR4L 4C3IH 4DV4L 3A0JA 3GTJH 2R93H 3CCUA 4BA1I 4KHZA 3HOZG 2PQAB 3M9BA 3CC7A 1P8LA 5C0XG 4JI2L 2UXDL 5FJ8H 2NVXH 2MQHA 2FXQA 3UE1A 3EIVA 2I0QA 3GTPH 1N9WA 2F3IA 5LMNW 4A3MH 3OYYA 5IP9H 1SMXA 1VQ8A 4GKJQ 1J5EQ 4X6AH 3KDFB 5IT9c 2AHOB 1PH5A 1EQRA 1VCIA 1JMCA 3W5OA 3I4MH 2PMZE 4BXXH 4P73A 2VZAA 3JC66 3ER0A 4QGUA 3HOYH 2YTXA 2IY5B 3STBD 2E2JH 1BVSA 2I5MX 5M3MH 2GN5A 2IHEA 3A5ZB 2EIFA 4DAYB 3AFQA 4AQYQ 1VQNA 2JA5H 4NXNQ 3FP9A 1X56A 2ASBA 3DM3A 4B3RL 1A63A 1UEBA 3PV0A 4A3DH 3RN2A 2KBNA 2IT1A 2UU9L 1VQLA 4DNIA 3HOXH 4HIDA 3CCVA 1M90C 4GN4B 3FKIG 3HOVG 2YTVA 1EQQA 3F2BA 3CPWA 4DUZQ 4GNXC 1UE6A 2VQEQ 2RF4A 4UP7A 4LFCL 2KENA 3OTOL 1YI2A 4OWTB 3F2DA 4A3FH 4IO9A 3GTLH 3ICEA 1W2BA 3H15A 3BJUA 3GTQH 1T9HA 2WAQG 2CFMA 2CWAA 3UDIA 3I4NG 1KIXA 2AMCB 1Q1EA 1C9OA 1XTDA 3CMAA 4GOPB 3GTMH 1SE8A 3RLOA 1YJWA 5JJIA 2K52A 5IYBH 5LMUQ 5M3FG 4TQUS 2BH2A 1EOVA 4Y7NH 2E5LL 3RZDH 4JI1L 1L2FA 1WOCA 3KF6B 2WB1G 3CQZH 4PZ6A 5BR8Q 5IP7G 3CD6A 2MNAA 1S40A 2UXCQ 2UUBL 4R1JA 4LF7L 1VQGA 3D0FA 1ASZA 3W1GA 5M5WH 4AYBE 4AH6A 2PI2A 4JI3L 4HJ7A 1VQFA 1CKOA 3K80C 5M5XH 1S72A 2MFIA 3CC4A 4GLXA 4B3SQ 1MKHA 4R4TA 3HOYG 3PCOB 5JEAG 2VUMH 2UXBQ 1X3FA 1O7IA 1FL0A 3L0OA 5M3MG 1VQHA 3AYHB 3RR5A 4ME3A 4JI7Q 3G71A 4DV3L 3RZOH 1HR0Q 2JK8A 4BBSH 4LFCQ 4GKKL 4BA2I 2E8GA 2PNHA 2ES2A 1I5FA 1KRTA 4PZ7A 3TQYA 2OQKA 4GN5A 5GADC 2NVTH 1VQBA 1JB7A 4OXPA 1CSPA 2VQFL 4DV0Q 1KD1C 1K83H 1Y14B 1I3QH 3HKZG 3CCQA 1G291 1NBWA 1SRUA 2R7DA 4HJAA 4A3FG 2E5LQ 2JEAI 4GNXA 2JA8H 5GAGC 4LWCA 1HNXQ 4QY7A 1GD7A 4DV7Q 2BA1A 3I4NH 1FJGQ 2IX1A 1OXTA 4YWMA 4C2MH 3HOUG 1XNRL 4A75A 1U0LA 5IYBG 4DPGA 5FLXc 5GAHC 2OWOA 4J15A 1PYSB 3G6EA 1N36L 1Q7YC 4DUZL 1J5EL 1PH6A 4WJ3M 4X62Q 5ELOA 5K36G 1XMOL 2WAQE 3K7UC 4R4CA 1XMOQ 2WP8J 3L2PA 1YJNA 4JI5Q 4A76A 2OTJA 2VY3A 1U5KA 1XNQQ 5J3BA 3CP0A 3PUVA 3F2CA 4LF4L 1B8AA 1A0IA 1LUZA 3UDXA 1QVFA 2KCMA 1HZAA 4R4OA 4KI0A 2UUCL 4LNQA 2JA6H 5C0XJ 4LF6L 2NN6G 4LUOA 5IY0A 2NZHA 3GTGH 4LUVA 3I4OA 1WJJA 4GKJL 1NY4A 3F1ZA 3NBHB 3JAMc 4B3MQ 3CW2C 4LUZA 2VUMG 5AJ3Q 4DR6L 1XNQL 1E22A 4DV0L 4HIMA 4OONA 2UXDQ 1N8RC 2YYZA 3AEVA 4DR7L 3BU2A 4BBSG 4JI8L 2VNUD 1EIYB 3PIPA 1OXUA 4IFDG 5IYDG 1I50H 1VQOA 1EUJA 4BY7H 1RIPA 1TXYA 3M7NA 3RLNA 2Y0SG 4LFAQ 3PUZA 4A4IA 3ULLA 3CCLA 4JI7L 2GVBA 2JA7H 3J80c 1E24A 1HNXL 4XIGS 1I94Q 1EYGA 1MJEA 1D8LA 2Q2IA 5C4JH 3PIOA 2B63G 3S2HH 4JI6Q 1E3PA 4DV1Q 1XPRA 3S24A 4PZ8A 5IWAQ 3F8TA 2HIVA 2XGTA 1YNXA 3A74A 3I7FA 1QZHA 2UUAL 4LF9L 3ERSX 4YHHL 2A8VA 2AKWB 4DV6Q 4DR1Q 3G4SA 1IBKQ 3KYHC 4DR1L 4GLAC 1CKMA 5M5YH 4JI1Q 4OO1G 4JI4L 1JT8A 4UY8C 2F4VQ 4JCVE 3PSIA 3RN5A 4JG2A 2JEBI 1A62A 3K0XA 4YWLA 5C4XH 4DR5Q 3RNUA 1E1TA 2CWPA 4EQ5A 2HHHL 4IOCA 3TREA 4A3GG 1L1OC 2ID0A 2K5NA 4X64Q 2RCNA 4NXML 2R7ZG 3L7ZC 1JJGA 3ZJYC 3BZCA 1SROA 2ALYB 2RHQB 4A3LG 2HQLA 4JV5Q 2A19A 4A93H 1BBWA 1MIUA 3BZKA 3JAMi 1VQKA 3S15H 2UXCL 1E1OA 2D62A 2RHSB 1KC8C 1AH9A 1HZ9A 2K14A 3KJOA 4RG1A 2YU9H 4FDBA 4DR7Q 2WFWA 1Q1BA 1V9PA 5IYDH 4OO1I 2UU9Q 4JV5L 4BY7G 5FJ8G 1HH2P 2NN6I 2ZJPA 2ZTCA 4LFAL 4B3ML 4GNXB 1LM0A 5EAYA 3S1RH 1NE3A 1M1KC 4RMFA 4DV6L 1KQSA 1QUQA 4A3JH 4JI0L 2A1AA 4R4QA 1CKNA 1Q12A 3I4MG 1PH7A 1K8GA 4APVA 1H95A 1MJCA 1Z9FA 1K3RA 2XTIA 5C3EG 4QIWE 3UE0A 3OW2A 5LMNL 1N32Q 1YHBA 3U50C 4X65Q 4K0KQ 2AWOA 4POGA 3KF8B 3J7A5 1G51A 2DUDA 3S1QH 2QA4A 4K0KL 4OWXB 3UDGA 1N33L 3HOWG 4JYAL 3W1BA 2L15A 1QUQB 1PH2A 2OCEA 3MXNB 1PH4A 1EWIA 1WI5A 4YHHQ 4DV4Q 1VQIA 1X6OA 3HOXG 1TWCH 3CCMA 5GAEC 2D0OA 4DK3C 4A3IG 1VQ7A 3FKIH 4P72A 1UE7A 1NMGA 5C4XG 4PMWA 4P74A 1BBUA 4OX9Q 2K4KA 1PV4A 4JC0A 4DV5L 1N34L 1GM5A 3J7ZC 3CCRA 1HR0W 2IHFA 1YVCA 1PA6A 4KHPQ 1VQ4A 1PH8A 2ZJQA 3LGJA 4HIOA 1XPOA 1D7QA 1S3OA 4L5QA 4BBRG 3TS2A 4A3LH 1PHJA 2ZM6Q 1PH3A 3PO3H 2ATWA 1UWVA 2MO1A 2QGQA 3CCJA 4DAMA 3T1YQ 3T1YL 4LW1A 1Y1WH 2K75A 2KHJA 4R4IA 3DLLA 2BH8A 3KOJA 5IP7H 4JBMA 1VQ9A 2V1CC 4KLKA 4DV7L 1YHQA 1JE5A 3I56A 2N8NA 3KDFA 5AJ3L 4DR6Q 3KLWA 3CC2A 1KRSA 2E2IH 2KCTA 3K7AH 3J81c 2N78A 1NJIC 3PO2G 4A3JG 3M3YH 1IBLL 4A3CG 3WWVA 2AWNA 1B70B 4WJ4A 3CMEA 5DLQE 1SN8A 4IPCA 3A5UA 4B3TQ 1GVPA 4GN3B 4H02A 1WYDA 1SFOH 2K50A 4LF4Q 1LTLA 4NB3A 2QEXA 4LF9Q 5JJKA 3HOWH 4XTCS 4X65L 4BXXG 1Q81C 4X62L 3U4ZA 2VQFQ 1K0RA 1HZBA 4JI6L
chains in the Genus database with same CATH superfamily
3SGIA 4CJ2C 4JI4Q 5KYLA 5KNDA 2OEOA 1XNRQ 1G2TA 3VMMA 3KJPA 1EUCB 3HP3A 4C5CA 4O2DA 1NMFA 1T94A 1VQDA 4OELB 2B8GA 3EPGA 5EOYA 2H1EA 3HOVH 3KBXA 4A3KH 3K8AA 2ZM6L 1RHPA 4RNMA 4DR5H 4JI8Q 3RBEA 2ZDGA 3IL8A 4L63B 1Y1WG 3T1HH 1PDQA 5C5MA 3BG5A 4UCOA 1HNZQ 1PX2A 4DV3Q 3FPUB 4MZ9A 4C1NI 4DV5Q 5FLXW 5LMUH 5M3FH 1SXTA 4FF2A 1B50A 4ABNA 2I5HA 2A6HD 2B2VA 5CV5A 2OH2A 3PUXA 4DUYQ 2XSCA 4X3UA 3CCSA 1I94L 4YY3L 4LMYA 1IBKL 3V2TA 3IAYA 2Z9HA 3GP7A 4ZKCB 4J9NA 4IFDJ 4IRKA 1OXVA 4IALA 5JAVA 1L1OA 4JI2Q 4F8MA 1G91A 3MWEA 3T1HL 2KCNA 2UUCQ 4GS3A 4UHVA 3SHLA 3OMGA 2Z6KC 2PPBC 1V1OA 2BOSA 5LMUL 4AYBG 4ECXA 1V4YA 5IT9E 5D1OA 4JI5L 3S17B 2A68C 5DQHA 3HS0C 2FK3A 5EZYF 2PCFB 3GQCA 4NLGA 4DK1A 4JV5H 3S15B 2L0CA 2MHVA 4GC6A 2NU8B 2EVBA 2IX0A 1TT2A 1TWAB 1F9RA 5FOBB 1VQPA 1V1QA 3D31A 1TWFA 1V43A 4QJFA 2ZJRA 3OUZA 3E9HA 1LTRD 4B3RQ 4X66H 4LFAH 2E75C 3KHGA 4OX9L 2PZUA 3GTKH 2XCPA 3CPFA 4QUCA 4C3HH 1C8CA 1WTWA 1JWSD 3DMUA 4H13C 1B6RA 1RJRA 1W6KA 1TWHH 4A3GH 4K8JA 1XXGA 5FLMH 5H80A 3RB0A 2NVQH 1RJTA 3CAMA 3KLRA 3H0GH 4LF8Q 2W7PA 4IOAA 1DCZA 4JYAQ 2I80A 2QK4A 5J2TF 2EOTA 5FPRA 4JBJA 5C0XI 4A93G 1I4RA 5DQIA 1KNEA 3MEHA 1OXSC 2JSOA 2TMPA 4OL7A 4U68A 1X54A 2FHTA 4UAIA 3J80i 3J81i 2CZGA 3M9MB 1KDAA 3UDFA 1C30A 4JI5H 1QVCA 2R92H 4RFBA 3GTOA 3MR5A 1PRTD 3QO2A 5HY6A 1JXLA 1OTCA 4C3IG 4K8IA 3E9IA 1IKMA 1Y1VG 2EQSA 4Q0FA 1HFGA 4HCEA 1LYLA 4UP8A 2K5DA 4L5RC 4JI3Q 1GUGA 1WCMH 3I73A 2R84A 3K5IA 2DGYA 4J8QA 4KY7A 4MV8A 2JA7G 5IP9G 4LF5H 5EWGA 4O2AF 1EIFA 1WFQA 3ULJA 3PF4A 4B3SL 4DV2L 1H9SB 5LOVF 5LMNH 3OWFA 2IA6A 2EE1A 5ELFA 2EYOA 2YV5A 1VQ5A 4A3IH 1AW7A 5H1SE 1ONLA 2R6GA 3N41B 4O3OA 4AQYL 4I7AA 4A3BG 4KN7C 2Q2TA 3OMCA 1CA6A 2UUAQ 4LF8H 4C3JB 1T5XD 4N8FA 2MCTA 4EEQA 4JI1H 4B3TL 1CQVA 5M5WB 4YCVA 1K28A 4I65A 3GO5A 1HJPA 4PG3A 1A3VA 5J22A 1S10A 3KHLA 1ILQA 3IFTA 1X32A 1DGSA 1Y1WB 4X66Q 4A2AA 3RTXA 3AMUA 4LF5L 1KTKA 2OTLA 3Q0AA 4PV1C 3T53B 2B29A 3PO2H 1ESRA 4LSAA 4DV4L 3C1EA 1SNMA 3UI2A 4F4ZA 3T51B 3QR8A 3ORQA 5C0XG 5FJ8H 4MV1A 2ICIA 2FXQA 4RAYA 4JI4H 2I0QA 1N9WA 5LMNW 1U4MA 3QOLA 4YBZB 4RWSC 1SMXA 1J5EQ 3KDFB 5ELBA 1EHIA 3HB9A 3I4MH 1M0TA 2DWCA 4ZQIA 3JC66 2EDGA 1GUWA 4IURA 2YTXA 2IY5B 3STBD 3R3OA 1BDOA 1BVSA 2PN1A 2IHEA 2AQ2B 4DAYB 1VQNA 4F4YA 4NXNQ 1F2ZA 2F0UA 4B3RL 2DNCA 2A6EC 3NBHA 2IT1A 3TZDA 3PIO3 1JDBB 3FKIG 3HOVG 1EUDB 4A3BB 2JA8B 2Z6BA 3CPWA 1LTSD 1PTOF 1E0BA 4UP7A 5LYJF 4ME6A 1YI2A 2ZDQA 4OWTB 2TSSA 3ICEA 3FKIA 2NZ1D 4MA0A 1WSCA 4RCNA 4JI0H 3J81L 3PIP3 1SYCA 2F3WA 4MV9A 3Q22A 2WAQG 2CFMA 2CWAA 3I4NG 2W9AA 2AMCB 1B1ZA 4GOPB 3S1RB 1SE8A 2BR0A 1KJ8A 5KFXA 3MWMA 2J6TA 5IYBH 5M3FG 2QCPX 4Y7NH 3KAJA 2OLSA 5DM63 1TVXA 1L2FA 3BVMA 3SDZA 3KF6B 2WB1G 3F2UA 1WD1A 2FB9A 1TKWB 2I8CA 4DV0H 2UXCQ 2WB1A 2EYPA 1TA8A 4R1JA 5AFWA 3QIAA 5CV4A 1B6SA 4AH6A 1HNWH 1QCBD 1HR0H 2QKIC 3M3YB 3K80C 4Q0YA 2HHHH 4EQNA 4ECZA 3OHXC 4RA8A 3I3CA 5HV6A 3V96A 3R23A 1X3FA 5CB4F 5M3MG 3WDNA 3RR5A 2B2UA 4ME3A 1AZQA 4EFEA 1EEFD 2JK8A 3OSOA 4BA2I 2E8GA 2PNHA 1I4GA 2J9GA 1IBLH 1KRTA 5D3DA 3A55A 2OQKA 2UVWA 4GN5A 3DWPA 1A9XA 5GADC 2NVTH 1TAEA 1VQBA 5I9OA 1CSPA 1UNNC 4DV0Q 1KD1C 3HKZG 1JB3A 3SVMA 2IL8A 5EPLA 3PN1A 2DPJA 4QY7A 4DV7Q 2KHSA 4C2MH 1TY0A 1M0WA 3WOFA 2HDLA 3DWQA 1D1KA 1U0LA 5EPJA 4A75A 1B04A 5FK9C 1W6JA 3U9OA 1N36L 1JIHA 2BQUA 2WAQE 1T5EA 3RZDB 4XXEA 3L2PA 4JI5Q 3H4BA 2VY3A 4LF4L 3PUVA 2LFNA 1A0IA 1I6VC 1UC8A 2KCCA 1Y1WA 4LNQA 4O3QA 3FEWX 3MA2B 1FNUA 4KKTA 3GTGH 4M1UB 4JYAH 1CM9A 1SE2A 1N48A 4B3MQ 4Y7NB 1JOOA 2VUMG 3LMLA 1E22A 1RK5A 3O13A 4OONA 5I2XA 1N8RC 3I4LA 4X3KA 4A93B 3BU2A 4BBSG 4JI8L 2VPSA 3G7LA 1EIYB 3T13A 1LTBD 4ME5A 1I50H 3NPPA 2F4VH 2NVQB 1VQOA 4DF7A 1EUJA 4A3GB 1RIPA 1PTOB 3RLNA 2Y0SG 3MFYA 2KVMA 1NUCA 4X3SA 4A4IA 1MD2D 2F0LA 1BJTA 5CA0F 1WTHA 1HNXL 1I94Q 2ZXRA 3BQ1A 5C4JH 2Q2IA 4O1NA 3S2HH 2WYOA 3BDOA 1LV9A 1E3PA 4DV1Q 5IYZF 4CKCA 2W6OA 5IWAQ 3A74A 3I90A 3MVVA 2C5CA 1QZHA 4IUVA 4LF9L 3M4YA 3NP8A 2A8VA 3PMFA 4DK0A 3G4SA 4MTDA 4DR1L 2R93A 1EIGA 5BN5A 1CFMA 3GV3A 5M5YH 2PQEA 4OO1G 3SE7A 2M2LA 4BWGB 2JEBI 1A62A 3K0XA 4YWLA 4DR5Q 2HHHL 2F1MA 2CWPA 3T5JA 2XNAC 1LTTD 4B9WA 4MTEA 2PW5A 3ZJYC 1HUMA 4IUQA 3NSWA 2A69D 2QYZA 2R8JA 1ULZA 2HQLA 2Z1CA 4A93H 4ECYA 3JAMi 1VQKA 4UCVA 4CDDC 2L4NA 5IWAH 5EDWA 1JICA 3BS1A 1GSHA 4ECTA 2BCOA 3M4IA 4IFDH 2E2DC 2K1BA 4JV5L 4BY7G 3HGBA 5FJ8G 1WTOA 5A35A 2ZJPA 2B63A 4GNXB 1AP0A 4FS1A 1BF4A 4A3JH 1CKNA 2R8KA 5C8YF 2RA4A 4QIWB 4APVA 4DLKA 2QEJC 3M9NB 1Z9FA 1ZKOA 2R8IA 1TR5A 1K3RA 2XTIA 3CQZB 4QIWE 3OW2A 3Q8QB 5LMNL 1S5ED 4NKLA 1N32Q 4X65Q 5KFKA 4X64H 3RAQA 5KG6A 4RHSA 5I6YA 3J7A5 1G51A 2QA4A 4K0KL 4OWXB 1RCVD 4JYAL 4XX0B 3MR2A 1Y1VA 4IRCA 1PH2A 2WE6A 5D14A 2JEGA 3VYSA 3HOXG 2D0OA 3L9AX 4A3IG 2AQ3B 2O2LD 4WJWA 2V4QA 5IGGA 4OX9Q 2K4KA 5L37A 3J7ZC 4XT1B 2XCLA 4KHPQ 2B2TC 1VQ4A 2ZJQA 3LGJA 4ZYSA 4O3NA 1D7QA 4BBRG 4R7RA 4A3LH 1PHJA 2ZM6Q 1PH3A 1PTOC 3PO3H 1UWVA 2MO1A 3T1YQ 3OIPA 2JA5B 3VR2A 3GIDA 4LW1A 5FLXE 5EBDA 3DLLA 3PR5B 4CKBA 3KOJA 2M00A 4FXGC 5CC4A 1WCMB 5L1IA 5EGTA 2IPKD 4DR3H 4PDBA 5KFGA 4DV7L 4QWDA 1QNKA 3SK6A 3JAML 3I56A 4JW0A 2F0GA 4GZYC 2XCAA 4YR0A 2F0VA 1TWFB 2E2HB 3GTJA 3GV8B 2R82A 2N78A 3V4SA 1K83A 1MBYA 1RK6A 1I6UA 1EEID 4A3CG 1VBGA 3RZOB 1K3BC 1SEBD 4B3TQ 1XDNA 1PTOH 5KFVA 3GTLB 5IGEA 1WYDA 4MAMA 1SFOH 4YAJB 3G6VA 4JVZA 4LF4Q 4NB3A 4KJNA 3TN2A 3GTJB 2E2HA 1ILPA 3HOWH 1Z2NX 4BXXG 4J9OA 3BYTB 1WTXA 3J80L 1Q46A 2N3SA 1Q86C 1KHIA 4DR4Q 4BY1G 1SFOB 4DAPA 2DLNA 1I4HA 1RTOA 1KL9A 1UEAB 3VA5A 4NXMQ 3TQTA 4DR3L 1S9FA 1VS0A 3TEHB 4JPBW 3S17H 2NVYA 5C1PA 5HGQA 4UCTA 5KFIA 4O0AA 5KG3A 1S0OA 1II3A 3EFXD 4FXKC 4X3TA 5KFMA 3M85A 4HSVA 5C44H 4HNVA 1BKBA 4AQYH 1TWAH 2KHIA 2IX3A 4V0BA 4RGMA 4Q8FA 4RHRA 1J8IA 4NPSA 3OTOQ 4YP3A 2Z0SA 5JPNC 3TS0A 1YEZA 3R8BA 2WAQA 1ENAA 5DM73 3H09A 2I87A 1H9SA 3RMHA 5JH7F 1X55A 3ETHA 2AQ1B 3LX0A 3GD7A 2W8LA 2CW0C 3S1MH 2CW7A 3KF8A 2VQFH 5KX5F 3PF5A 2SNSA 4CKEA 5JJLA 1OO9B 1VBHA 4QWBA 1Q8KA 4MNOA 4DV1H 2NVXA 1A2TA 2EZVA 5KNBA 2WV6D 4A3KB 2VW9A 4RZRA 4Z9CB 3JZIA 4JUZA 1CUKA 4JI2H 2B2UC 4DR2L 2CQOA 2XGQA 3J81j 2GVAA 3QFFA 4JOIA 2B63H 2WB1E 3N52A 4HSPA 1X3EA 4A3KG 2YS6A 2NUAB 4JV1A 1E2WA 4JI6H 1NTGA 3WNZA 1NR2A 4DL5A 1WTRA 1V51A 4IR9A 1QILA 3SK8A 2JJQA 3I91A 2CKZB 1EY7A 3DUZA 1RL2A 1C7YA 1SEIA 2D2CC 3ERQA 5KFYA 3VDYA 1LLRD 1HTLD 3B6YA 3CRLC 4U6PA 5C4HA 3HKZE 3K5HA 3STBC 1AEXA 4YCWA 3HKZB 1CE8A 3T1HQ 2AQ4A 1RYRA 1FJGL 3EN2A 2EJFC 5C4XB 3GTKA 1SLJA 4IJHA 2L11A 3T5LA 3VYTA 1N33Q 3N40P 2V58A 4K2LA 1YHAA 4ILWA 3H3VH 1WTQA 1U4LA 4ZUIA 3V6KA 5KG0A 4JI0Q 3RB3A 2Z6KA 4EGVA 4LFBL 5IYCH 4YY3H 3NXWA 3QG1A 1GKHA 1B4OA 2WTFA 2PMZA 1I50A 5BR8L 4LF9H 3OIQA 1HPCA 2NTSA 3TSSA 1EWCA 4QL5A 3H3VI 4GKKH 2VUMA 3J80E 2ZTDA 4ZAIA 1IW7C 2GA4B 1X9NA 1LT4D 4A3MG 2EY6A 1VQMA 3TP5A 5HBRB 4L6TB 2V5AA 4OIKA 3N42B 2L5TA 3GV6A 4O2BF 5KT3A 3EBEA 4HJ8A 2MO0A 1I50B 2PMZB 2CQYA 2C22A 4QWCA 1FNWA 2H5XA 1IOWA 4GKJH 2C9OA 3A56A 2IW3A 3M4QA 1Q82C 1ASYA 4J6HA 1U4RA 2KOLA 1PLFA 5I6WA 3UQ8A 4NXNL 1GO3E 1PFNA 1L0WA 4CGYB 1AE3A 1JOKA 4LF8L 2G5DA 1R9TH 3H0GG 4Q5VA 1KLUD 2K5VA 1N36Q 1DYQA 1RF2D 4A3EG 1FD7D 4BBRH 4C2MB 4F88A 2EJGC 4ALPA 2YTYA 1KAWA 1BGWA 5KFZA 1XX8A 4MA5A 2XC9A 1J6QA 4HYKA 3KLSA 4E4TA 5D1PA 1XMQQ 1SYXB 2PI2E 1L1OB 5E3FA 5FO9B 1FVIA 2R92G 2E2HH 1HQMC 1C0AA 4FF1A 1IYJB 4FU0A 4APMA 1I94H 2HVRA 3RV4A 1I4PA 4C3IH 2ICEC 3GTJH 3MJFA 1PTOD 1LO5D 4TKOB 4EBDA 3HOZG 2PQAB 3M9BA 3CC7A 3HOYB 2W6MA 3A8JE 2DY7A 2MQHA 3UE1A 1DOKA 1EWHA 3EIVA 3PO3B 1FYCA 2F3IA 4H44C 4O42A 5IT9L 3H94A 3OYYA 5IP9H 1GGOA 1VQ8A 2SEBD 3VYRA 4HR7A 5IT9c 2C00A 2AHOB 4C56C 1JMCA 2IP4A 4BXXH 2VZAA 3ER0A 3W3AA 1KJJA 1C48A 4QGUA 2NU7B 4UCUA 3GIPA 3A5ZB 1NAPA 4U7CA 4AQYQ 4IWYA 2JA5H 3Q8PB 1HQRD 4ECUA 5IGBA 2A6HC 5KT7A 1EZ6A 3K7AB 3PV0A 4EGQA 3RN2A 2O03A 3A7LA 4M9UA 3NWSA 3KXYT 3K0YA 4DNIA 3HOXH 4HIDA 4GN4B 2YTVA 1EQQA 2VQEQ 4WD3A 4A3FH 2R8GA 2NU6B 1W2BA 4IRDA 4B9XA 3C2PA 2B2TA 1T9HA 4NDXA 2YZMA 3HKZA 4DV5H 4HTHA 4DAVA 2E74C 3CMAA 2AGOA 1DOMA 3TP8A 4MV6A 4IN3A 2LKVA 5T1IA 1EOVA 3BDLA 3ZYYX 2VOBA 2E5LL 4ZK9B 4JI1L 1WOCA 2NVYB 2KJXA 3CD6A 4EGJA 5K36H 1S40A 3AB9A 1O7YA 2VA3A 1SCUB 2R93B 1LABA 1QJOA 3D0FA 4FNFA 1ASZA 3GLKA 4XDXA 3HOZB 3LWUA 3TQ1A 1DJRD 2PI2A 3MC0B 4JI3L 3BDCA 4HJ7A 3BABA 1CKOA 3N6XA 2CW8A 5M5XH 2MFIA 3OHAA 5KYIA 3KHHA 4RUAA 5KFAA 5KT6A 4R4TA 2UXBH 5KFSA 1C3OA 4R8UB 1HA5A 2A69C 3HOYG 3PCOB 5JEAG 3A54A 1O7IA 3AYHB 2M05A 3DM1A 3OTOH 1HR0Q 1I5FA 1L0XB 1JB7A 1Y14B 1EYGA 1G291 4HJAA 1SRUA 2BE5C 2XRQD 2JEAI 3VPDA 4GNXA 3G6JB 2JA8H 4RKLA 4LWCA 1HNXQ 1EFID 2WKCA 4LK1C 1KEEA 5C5JA 4EYHB 2QDLA 3HOUG 5CORA 1XNRL 4DPGA 5FKAC 3VPCA 1A3TA 5A2QL 1Q7YC 1A2UA 5LL6b 4DUZL 1XMOL 1PRTC 2G9HD 2CH4A 1FNVA 4R4CA 2WP8J 1IYVA 4Q44A 2OTJA 1S03G 2E76C 4LSXA 4KHPH 4F50A 3CP0A 3F2CA 1QVFA 3BJYA 3UDXA 1LUZA 2KCMA 3ND9A 3V4ZA 1SDFA 5KIXA 3QOJA 5EJWA 2NZHA 3NTIA 1DV2A 4OX9H 1SMYC 3X3MA 4J9RA 4FF4A 3F1ZA 2WACA 3KUPA 1SNDA 1N33H 5CBAE 3CW2C 4RCOA 1JLLB 3GV5B 2CH4W 3K5OA 2L55A 5AJ3Q 3U9SA 3H6MA 4DV0L 3GTKB 4DR6L 2FE3A 1W96A 1R9TB 3SI8A 1MSHA 4HIMA 2UXDQ 2JXMB 3H4DA 2NBFA 2YYZA 3AEVA 4NXMH 3BA8A 3K6OA 4BBRB 3SE0A 5I47A 3PIPA 3LNNA 1K0SA 4X65H 1JC7A 3MHBA 3QWNA 3I8ZA 1XNRH 5ELCA 2XIGA 3PUZA 4JI7L 3CCLA 5DQGA 2GVBA 3VR4A 1TS5A 2R85A 4FP5D 3ND8A 4R9WA 1AN7A 2B63G 2MPMA 4JI6Q 2UVVA 5IIFA 1XPRA 3S24A 4PZ8A 3MXUA 1BQQT 3F8TA 4EVOA 1SJHD 2YCHA 2UUAL 4N9PA 1IW7D 4KD4A 2W9CB 4DV3H 4ECVA 4DR1H 1S0NA 3KYHC 3QJYA 4JI1Q 3G6YA 1QE6A 1RKNA 4JCVE 3P1HA 3PSIA 5EWFA 5C4XH 3H40A 1E1TA 2EY1A 3D4DA 2J6UA 4IOCA 4HN7A 1C4QA 4HQ6A 5IT9W 1GHJA 2E2JB 5KG5A 1Y8NB 1B3QA 3L7ZC 5KT2A 1SROA 1EYCA 3LWBA 2RHQB 1TWHB 2A19A 1BBWA 3BZKA 3S15H 5KFLA 4DUYH 1E1OA 2RHSB 5T1GA 1KC8C 4OHJA 1HZ9A 4RG1A 3CRKC 2YU9H 1BNCA 4DR7Q 1HCZA 1U9RA 5IYDH 2BQRA 4OO1I 4OGQC 3HOVB 1QNUA 1HH2P 2NN6I 3UFXB 4DN4M 2FJZA 2ZTCA 5EAYA 3S1RH 4QMGA 5EKKA 1JCKB 1STGA 1M1KC 1HUNA 3M7GA 1QUQA 3I72A 2LY7A 4R4QA 3V6JA 4RZQA 1Q12A 4PQXA 1K8GA 2C2RA 1H95A 1MJCA 1XWEA 5C1OA 4EBEA 4ECRA 2V9WA 1YHBA 1D6EC 5I9PA 2AWOA 4POGA 3KF8B 4Q43A 2DUDA 3NTKA 1N33L 3W1BA 2L15A 4QB4A 1QUQB 1PH4A 5KT5A 4YHHQ 4DV4Q 4NW2A 1ENCA 1E4EA 2OXPA 5M3FB 2FKLA 1VQIA 4XYMB 1LTAD 3S1MB 4DK3C 1VQ7A 3T5HA 2F0HA 1NMGA 2HVQA 4PMWA 4P74A 1BBUA 1PV4A 4DV5L 3L3OC 1GM5A 1SE4A 5CV7A 5LXTF 1PH8A 3E0JA 1S5FD 4RNNA 3GV7B 1ICWA 2ZJTA 3CCJA 3A8KE 5C44B 4J0MA 1LTGD 2KHJA 3BZDB 4MV4A 5DLGA 3N44B 1SSOA 5CR3A 3WOEA 3H0GA 2FLPA 1N32H 1VQ9A 2V1CC 2F03A 5BMVF 1GYFA 1JE5A 4MN3A 5AJ3L 4DR6Q 4KY6A 4A3EB 2E2IH 3K7AH 1Z2PX 5F9NA 4A3JG 1STEA 4HAEA 5IOCA 3NBIA 3PO2B 1CI3M 4ED8A 2J6SA 5DGAA 2F0IA 3CMEA 1DV1A 2JA7B 5DLQE 2ZM6H 2K33A 3MAQA 1S4ZA 1SN8A 2MJ8A 3RGXA 2AU0A 4H02A 2VXWA 5DNFA 3WO0A 4CDFC 3GILA 5KFWA 1LT5D 2IJ0A 1Q81C 4MV3A 3U4ZA 1SE3A 4TQSA 4BS9A 4JI6L 3KAKA 2RVLA 3I55A 2DNEA 1AFPA 4DKAC 1HNWL 1H9MA 1XTCD 3LWEA 3I12A 5TSSA 4F7XA 1TWGH 3M4PA 2JA5G 1E4FT 4S3SA 3X3NA 2Q2UA 1IL2A 2UUBQ 1RTNA 2JEJA 5GROA 3N6RA 1HNZL 1IXRA 4MTNA 2LXJA 4DUZH 3HOUH 1X3GA 3TZUA 3S1QB 4C3JG 3KF6A 3PO3G 3GTQA 2W57A 4UCRA 2SOBA 1A8VA 1H9RA 2F0QA 2FK2A 1JWMD 5KKNB 2JA9A 4IUPA 1N34Q 4HMJA 2C2EA 1QVGA 2NZOA 5LL6S 4I50F 1IKLA 4YWKA 3OW7A 5EBCA 3E0EA 2B2YC 2K6AA 3U58A 1SNPA 2EY5A 3GTQB 1P16A 1TWFH 3CF5A 1QOHA 2KSWA 1PRTF 2NN6H 3TIIA 1JDEA 1J9OA 1I3QB 4WRDA 3J81W 2D5DA 3TRZA 1PFBA 1XMQH 1GSAA 1PYWD 5LMNQ 1O7LA 3RJ0A 3U4VA 2K04A 2X6GA 2HCCA 4PMBA 2RKSA 2VQEL 1EY9A 2HIXA 1PK8A 1K73C 4UPAA 3M4OH 4C2MA 3CKIB 4HJ9A 4YJ3F 4J9KA 1SMYD 1Y8OB 1R4QB 1BCPD 4BY1H 2B3GA 2PBZA 4ZUJA 4TSSA 3CXCA 1TWAA 4JV0A 1G6ZA 1ET6A 1Y1VH 1B7YB 1UAPA 2CCZA 1IBMH 3KHRA 1EY5A 1WCMG 1SNCA 1YITA 1ZYRD 4HIKA 3S14H 1BXTA 1X65A 2ZTEA 2JA8G 1FGUA 2N49A 1UUPA 1EFWA 1UE5A 3PR4A 1YIJA 5DAUA 4YIJA 1ICFB 4X64L 1A15A 3SK5A 3GTPA 2EY2A 1EY6A 2DJFC 1RJPA 4DL2A 4QWEA 2IMWP 2JYOA 2RQXA 4CDCC 4LF6Q 3EYYA 4G7OC 1I7LA 2W6NA 1YNJC 2PZWA 4GLVB 1JE4A 2DIKA 1NCVA 4ZI7F 2R87A 1KXLA 3ULPA 1RD9D 2IWHA 3DHQA 4POFA 1AE2A 3BA9A 4K5VA 1XMQL 1IOVA 1WD0A 3NWTA 5CA1F 1SNQA 4YCUA 2X69A 2EYFA 1YJ9A 2Q2HA 4WORA 4RKBA 4G4KA 4XT3B 5KEEA 1I6HB 5DG9A 1STHA 5JEAJ 4EBCA 4ECSA 1VQCA 4O3PA 3HFZB 3PW0A 2XWBB 2N88A 3G48A 1PZID 2HHHQ 2R93G 5CMDA 1HNWQ 5L9XA 3BQ0A 5D3IB 3GTOH 2X0SA 2R92A 3T5KA 2CVRA 2DJGC 5ELNA 2LSSA 4KK7A 5C0XH 1YZ6A 4DV2Q 1HR0L 2NYZD 3S14B 1I6HH 2EXDA 5LA6F 1STYA 5C4JB 1XJVA 3ONAB 1JJCB 1V8QA 2RDGA 3FMCA 4TVAB 3RUPA 2L12A 4RUCA 4K0KH 1DOLA 1H9JA 4UP9A 4YQWA 3QB3A 4ED2A 4IPDA 3OSNA 4YY3Q 3L4KA 5L1LA 5LP6F 1ZYRC 3QZ7A 2C35B 2PW7A 1IBLQ 1MGSA 3AFPA 4IPGA 3RB6A 2SDFA 1BOSA 2OQ0A 4AIMA 4DNRB 4DU9A 2JA6A 1KJQA 2Q8IB 3IRBA 2B63B 4P71A 1YNJD 4C5AA 1G6PA 4F87A 1IBMQ 1HZCA 4LF5Q 4DV6H 4Y52H 1EYDA 1SJED 2VL6A 1PVOA 2F0SA 5EWEA 3E5NA 2UVRA 2R7FA 2P5ZX 3HKSA 4ID6A 3MEFA 5E4XA 1KABA 4IAJA 1UNSA 1EYZA 1GUTA 5IYCG 1QZGA 4KHPL 3A8IE 3AQQA 4LFCH 1SAPA 2F0WA 3GDEA 4YB8B 4J9PA 1IBML 2WDTA 2UVUA 4MIUA 5JVDF 4BA1I 2I46A 4KHZA 2RCFA 1P8LA 2UXDL 4IHJF 3R5FA 5I4DA 4KKSA 3CHBD 5EKIA 4GKJQ 4X6AH 1EQVA 1PH5A 3HOWB 1SNOA 1EQRA 5D1OB 3W5OA 1TS2A 1SYDA 2ALZA 3H0GB 2CHBD 5KFPA 4KTAA 3EJIA 5KG2A 2UU9H 2W6PA 1BUVT 4O4HF 2F3VA 2I5MX 2GN5A 2EIFA 3URYA 3C46A 3MXGA 1R9TA 4ECQA 1X56A 1A63A 1UEBA 3N43B 3RV3A 4ZCKA 4G3IA 4OIJA 3CCVA 4KMUC 2Q8TA 1M90C 3F2BA 1MZBA 1EZ1A 1UE6A 2XD4A 2RF4A 2CW0D 4LFCL 1BXRA 1K83B 4K6DA 1BNZA 4CBVA 1D5MC 5FO8B 3F2DA 4X62H 4YR3A 4K5XA 3P75A 1I4QA 3GTQH 2RDHA 2FPGB 3TP6A 3CU7A 4IWXA 3R5XA 3GTLA 5KFFA 3QZ8A 2HJWA 3P7JA 3RLOA 2ZT9C 5CBEE 1YJWA 2K52A 2DPIA 4TQUS 2BH2A 3K5MA 2BQ3A 2AGQA 1RDPD 2KEDA 5C4ZA 5GONF 5CGKA 4PZ6A 3CQZH 5IP7G 2MNAA 5FLXL 2FMCA 4DR6H 3DXJC 4LF7L 2F0MA 5G3LD 1VQGA 3HOUB 4DL6A 2UUBH 4K5WA 4Q45A 5JVH3 2LS01 2QILA 5HURA 3NTHA 2W70A 1GJXA 4C3HB 1VDZA 5KFHA 1S72A 3CC4A 3Q1KA 3T1YH 1Q8IA 5C3XA 3OHBA 4A3DB 4B3SQ 1MKHA 5C5LA 3AU7A 3D6CA 2GPSA 4M8AA 3MWYW 2W6QA 3V05A 1SYBA 1EZ8A 1FL0A 3L0OA 1EQTA 1I3QA 4KY5A 1VQHA 4JI7Q 1IYUA 3G71A 4DV3L 4U673 5CV8A 4BBSH 1O78A 4LFCQ 3S1NB 4GKKL 3Q23A 4ETSA 3BG3A 2W6ZA 4QUFA 1VF7A 2FJ2A 3N8DA 3M9OB 2J0TD 1GLVA 5JJZA 3LP8A 1HXYD 2VQFL 3J81E 2E5LQ 3I4MB 3HBLA 5JUMA 4IQZA 5GAGC 4CJ0B 5C6AA 1D5XC 2DZDA 3FMAA 3I4NH 2BDNA 4YWMA 2FLLA 4FBUA 5IYBG 5FLXc 4J15A 1PYSB 3VR5A 2QF7A 2F0PA 2FLNA 1J5EL 4IZOA 3H3VC 5K36G 3K7UC 3S2HB 2Q8RE 1STAA 1YJNA 1U5KA 5J3BA 4OO1H 3IFDA 4B08A 1K1QA 1B8AA 3JRXA 4TV8F 5BPHA 1HZAA 5KG7A 4LJZC 3D4RA 4R4OA 2YYAA 2XIWA 2UUCL 3VPBA 3PW7A 1DXMA 1QB5D 1F77A 5C0XJ 2NN6G 4LF6H 2E5LH 3I4OA 4DV2H 1DIKA 1NY4A 5KFBA 4F4WA 2FINB 3JAMc 5BN4A 3NK9A 1D1IA 4ZLTF 4UFZA 4KV6A 4UDUC 4DR7L 3RD4A 1AN8A 1J5EH 1F2LA 2VNUD 3RFCA 1FKAH 1OXUA 4O3RA 3M4OB 2V4RA 3C3LA 4ECWA 3TIGA 3TBIB 4ZKBB 1ET9A 3ULLA 3TMEA 1LT3D 5C3EB 3J80c 4XIGS 4RH6A 2NTTA 1MJEA 1QG7A 3PIOA 1HA6A 5BPFA 1ZEQX 4O3SA 2Y0SB 1PZKD 1S97A 5J39A 2HIVA 2GLTA 3SEBA 2DY8A 5BR8H 4DV6Q 1TWCB 5A2QW 4O4IF 1CHQD 3J7AK 4GLAC 2R92B 2HVSA 1KLGD 4JI4L 1JT8A 1PXUA 5KRUA 4UY8C 1DD2A 2MUYA 2F4VQ 2VQDA 3RN5A 4EEYA 4CHTB 1L1OC 2K5NA 1D5ZC 2RCNA 4I7ZC 1JJGA 2ALYB 2HQEA 4A3LG 4JV5Q 4HNUA 1MIUA 1CTMA 2D62A 4RGOS 1V1PA 1AH9A 3K5LA 3MTSA 3R2IA 1Q1BA 4JK1C 2L9HA 2UU9Q 5FPOA 1G2SA 2YW2A 1GUSA 2F0EA 4LFAL 4B3ML 1LM0A 3SR1A 1KQSA 4TQRA 3Q24A 4JI0L 2A1AA 3MFIA 2X6LA 1PH7A 4KKUA 4WBNF 5CYUA 5C3EG 3DEOA 3TINA 2CQAA 4QIWA 3U50C 1XNQH 4K0KQ 3S1QH 2VA2A 5IGFA 3OWEB 3UDGA 4TRDA 3HOWG 3JAME 1EWIA 1WI5A 1X6OA 2F0OA 3CCMA 5GAEC 1STNA 5EKLA 2YRXA 1AUXA 2R7ZA 1B44D 2K5QA 5C4XG 1Y8PB 1S5DD 2K7VA 4DR2H 1BCPC 4DA2A 2K01A 3C1FA 4H7BA 1D2BA 3NE5B 4J9QA 2RGVA 2IHFA 1YVCA 4HIOA 1XPOA 3PW2A 1S3OA 2JA5A 2BDOA 2R7NA 4HEDA 3T1YL 1Y1WH 1Z7TA 3J7AV 4DV4H 2BH8A 2SNMA 2Z4HA 2M9VA 5IP7H 4C1NK 4FM9A 3BVGA 4NP5A 4JBMA 2EJMA 4DL4A 2MGSA 4KLKA 3D6WA 1YHQA 4N8X1 1BR9A 1KJIA 1X3PA 3KLWA 3CC2A 3R2TA 3J81c 1NJIC 4LAAA 3M3YH 1ZXTA 1EU4A 2J7ZA 1IBLL 2A73B 2BE5D 3GTPB 1B70B 2ZDHA 4RB0A 5KFJA 5BN3A 2FPPB 5KFEA 5J1ZA 1GVPA 5HGTA 1GXDC 4A3FB 1TIID 4DXGA 1Y69U 5D8DA 4LF9Q 4CC6A 1GOZA 2W9CA 1RYSA 5JJKA 3OSPA 1A6XA 4X65L 2YU9A 2R3ZA 1AZPA 4X62L 5FD6A 1PRTB 1NSNS 5ISRA 1LT6D 1XPUA 3NENA 2RGRA 4DR3Q 3Q8SB 3PUWA 4IJLA 4JBWA 2OT2A 1K8OA 4B3SH 2PYKA 3MFHA 1PH1A 1IL8A 3IG0A 5CV6A 3T16A 1W3SA 1EYAA 4B3RH 2JQOA 3MR6A 2Z4IA 5KGUA 4LF7Q 1U4PA 4JOIC 2K5HA 5IGDA 2YU9B 4A3DG 4LMQD 2HGSA 4LFBQ 2EPBA 1KDCA 2DN8A 5KNCA 3S2DH 3JAMW 1EY8A 2F52A 1SYGA 3JSLA 1CZWA 4GOPC 2YZNA 4FS2A 3C0FB 1HTPA 1E2VA 2XRSD 3HZXA 2JEIA 1LACA 4RAZA 1ESFA 3W2DA 4L5TA 2B8FA 4K6LA 2E2IA 1VQAA 2YL2A 5IE8A 5LHY1 1BBXC 1M6VA 3K57A 4IFDI 5FLMG 2W8KA 2FFKB 3GIKA 3D8GA 4A3CH 3J80W 2I5LX 4EX5A 3G8CA 2F0FA 4QW9A 4G7HC 4P75A 4RAUC 2D0PA 2WIIB 1LTID 3EVQA 1IBKH 4ED0A 5ELEA 4LH6A 1N32L 3T4AC 1FR3A 2B2VC 3FDTA 3PGZA 4XQQA 3PW5A 1BCPB 2R7KA 1FJGH 5KFRA 3CCEA 1ML0D 1E4EB 1SR3A 2VR1A 1KDBA 2LXKA 2WAQB 2F0NA 1CKNB 2HT1A 2JP1A 1WH2A 1M8AA 4G57A 2IBKA 2XVSA 2B2WA 1PH9A 4UCSA 2Z8LA 3I2ZA 4DK6C 5DLFA 2R7LA 3PZPA 1B53A 3IKJA 4C3JH 4PWQA 3PW4A 1TY2A 1K9MC 1VQ6A 1TS3A 1B2TA 3KFUA 4C3IB 4EYIB 3NEMA 3GIIA 5C44G 5L1JA 3K5NA 1MHWC 2BA0A 4A3IB 1CS0A 2EYJA 2RDFA 1O80A 5K2MA 1PYBA 5GQOA 3KBGA 3U9TA 4JBKA 4XYLB 1TWGA 1F2MA 5E4WC 1JX4A 4KJOA 5JOBA 2Y0SA 2QW7A 4IUTA 2QDBA 4A3BH 1A3UA 2VS1A 1IZ6A 4R8NA 2C2DA 4ZHQF 2PNRC 4A3EH 4YHHH 4J9LA 1GUNA 4GOPA 5F9LA 2JA6G 1TQOA 4ED7A 2UUAH 2EYLA 4Y8VB 5KFCA 4DUYL 4IUUA 1B33N 5C3WA 3DEPA 1JORA 1KAAA 1JJ2A 2V4DA 1PFMA 1RJQA 2FMMA 2R86A 2R6FA 4J9MA 5JPMC 5ELDA 3JRWA 3S16H 1KJ9A 1K8MA 1YBYA 5IODA 1E7ZA 4RB3C 1VMPA 3HOZH 2RSNA 2F4VL 3SK4A 2WB1B 5C3EH 1Q3LA 4BY7B 3J7YW 4GKKQ 1DM0B 1CHPD 1Z47A 3PUYA 3S2DB 4EQPA 1HNXH 1I7NA 2F4IA 2UXBL 2RDJA 1ZHSA 1CSQA 1MI2A 4YR2A 4DR5L 3R93A 3HRZC 1M7JA 4A3MB 2F0KA 4K2KA 1JR0D 1K8AC 1WR2A 2NVYH 4OWWB 1S5BD 4FBTA 1Q90A 1HFNA 3FHWA 3Q8DA 2ZXPA 3HXLA 4JI7H 4JV2A 3FPPA 4IPHA 2YZGA 4ED6A 3H20A 4L5SA 2HD3A 2EYMA 4C5BA 2JE6I 1Y1VB 2HUGA 3HOXB 2HCIA 1ZQ7A 1VQEA 5E7NA 4HNTA 2I07B 3RB4A 4DV1L 1PFSA 1S68A 4K14A 1T3NA 1HNZH 5E1FA 3E3XA 5IWAL 1CA5A 4CJ1B 4J9SA 2R7ZH 2Y0SE 3S9WA 3K81C 4HJ5A 4DR2Q 1H9KA 3F8NA 4A2BA 4X66L 2A5HA 3NELA 4NMZA 3CVZA 4QQBX 3RLFA 3WO1A 4FF3A 4FVMA 3EQLC 1UE1A 1VQJA 2PQAA 3S1NH 1OXXK 1EOTA 2PO4A 4DR4L 1E4GT 2UUCH 3A0JA 2OF1A 2R93H 3CCUA 4MV7A 2FMAA 2K5WA 2AUKA 3I4NB 3NUCA 2YRWA 1UC9A 4JI2L 2RSOA 4KHVA 2NVXH 2AUJD 3GTPH 4A3MH 1F9SA 4I4TF 3G6XA 3OPOA 3TP7A 1WTVA 2EYHA 1VCIA 5FO7B 2PMZE 2UXDH 1CQIB 4P73A 5KG1A 4IZ8A 4ZOLF 5DEHA 4RNOA 3HOYH 2WKDA 1YNND 5JEAH 2W71A 4QF4A 2E2JH 2JEFA 1WVLA 4JI3H 5M3MH 4ZQ3A 3AFQA 4PMCA 4HCSA 3FP9A 2ASBA 3DM3A 4A3DH 1EU3A 3VYUA 2KBNA 5DG8A 4ED3A 3GQBA 2UU9L 4Q8EA 1VQLA 4DNTB 3HEJA 4O4LF 5T14A 4MHEA 4DUZQ 2KUMA 1PZJD 4GNXC 2C28A 2KENA 3SXHA 3OTOL 3DF7A 3GTLH 1F2YA 4WFN3 4IO9A 3FVQA 3GTGB 3H15A 4TUYF 3BJUA 2ATLA 2NU9B 5KFTA 3UDIA 2K32A 3KLSX 1KIXA 1N34H 1Q1EA 1C9OA 1XTDA 3RF2A 5F2DA 3GTGA 3GTMH 5JJIA 5LMUQ 2ASLA 3VA7A 1L2ZA 3A7AB 4FO2A 2W7OA 4IR1A 3RZDH 1GSOA 2RBMA 5BR8Q 1JQYD 1ENFA 3VR6A 2WINB 1TWCA 3ITPA 4V190 2UUBL 3V6HA 2O5IC 3W1GA 1BCPF 5M5WH 5K5PA 4AYBA 3BYYB 4AYBE 2E2IB 1WTPA 5COYA 1VQFA 2R8HA 3BAAA 4FXDA 4YJ2F 3D4WA 1F9PA 4GLXA 1SBBB 1BO0A 2VUMH 2UXBQ 4N9TA 3MFGA 1XMOH 1SYEA 1W93A 3RZOH 2PZTA 5KT4A 4CDEC 4RGTA 2R61A 1V1PB 2ES2A 2FPIB 1GHKA 4PZ7A 3TQYA 1YNNC 4QWAA 5L1KA 4ZRZA 4EQOA 1JKJB 1T36A 4OXPA 1VAJA 1KBLA 3BVZA 1K83H 4BWSC 1I3QH 3CCQA 3MXNA 1NBWA 2R7DA 4A3FG 2NWGA 3RIZA 2RDIA 1I4XA 5KFUA 1GD7A 2BA1A 1FJGQ 2IX1A 3K3VA 5J2UF 3JSNA 1OXTA 4RGNA 1VKZA 1G8ZD 4EFBA 2NVXB 1M4VA 1B9MA 5GAHC 2OWOA 1DZ1A 4P2CB 3G6EA 3FDSA 4F4XA 2R7ZB 1PH6A 3KALA 4WJ3M 2VB2X 4X62Q 5ELOA 5M5XB 4IUNA 2KQ3A 3H91A 5JVG3 1XMOQ 3KTMA 3MWDA 3CQZA 1TU2B 4A76A 4XZ3B 4EG0A 1XNQQ 3P20A 4XQNA 3OUUA 2F0TA 4KI0A 1KC7A 2JA6H 3Q8RB 4LF6L 4KD3A 3NQIA 4LUOA 5IY0A 4LUVA 3ORRA 1WJJA 4GKJL 1PMRA 3NBHB 1SYFA 2VPQA 1WCMA 4LUZA 4ULLA 1ZETA 1XNQL 1B9NA 4DAYA 4MTKA 4XQJA 2JA7A 1CQJB 1RODA 2A6ED 2AGPA 3PQIA 1O7ZA 2ZXOA 5NUCA 4IFDG 3T56B 5IYDG 1E2ZA 3K3PA 5I2YA 4BY7H 1EL0A 2D9UA 3M7NA 1TXYA 2FP4B 3NGDA 2G9DA 5EPKA 1CZGA 5KFOA 4LFAQ 4NXNH 2JA7H 2XGPA 1VF5C 2K03A 1E24A 4H0LC 4LH7A 3J7AF 1D8LA 2ASJA 2B2WC 2VQEH 3I70A 4OEMB 2UXCH 2P0AA 3MXPA 2XGTA 1YNXA 3I7FA 2YS7A 4M7EA 2VUMB 3EROA 4E6IA 2O5JC 5JQWA 3ERSX 3RBDA 4YHHL 1NNXA 2AKWB 4DR1Q 3GIQA 1FGBD 3EA6A 1O75A 1N56A 1IBKQ 1K1SA 4BBSB 1SFOA 4C3HG 1CKMA 1CK1A 3MZ5A 3RUZA 4QCLA 1TWHA 4I7HA 1TS4A 4LFBH 5DGBA 2A74C 1MSGA 2F0DA 3S16B 3K58A 4JG2A 3RNUA 4A3GG 4EQ5A 2HDMA 3K59A 3TREA 1AUVA 4XYQA 2ID0A 4CC5A 4X64Q 2VUGA 4DXFA 3ETJA 4NXML 4ED1A 5DG7A 2R7ZG 4TV9F 4FYDA 1ZHQA 2VB3X 3BZCA 5G3LF 3GTOB 4J1MA 4GC7A 1R4PB 4ODGA 5M5YB 2UXCL 3Q2OA 4RU9A 1HHVA 2SCUB 2KECA 4AYBB 2B39A 3OOCA 2K14A 3KJOA 4QW8A 4FDBA 2WFWA 1V9PA 2K28A 4B3TH 4DR7H 2L1BA 4R8IA 4LF4H 3KK7A 2R7MA 5KG4A 5JVLA 4B3MH 2K05A 4DL3A 3TDQA 3VR3A 1NE3A 4R8UA 4RMFA 4DV6L 1VMCA 1HRJA 1CT1D 1JWUD 1QWYA 2LMCB 3D3RA 2JA6B 1JOQA 1OWTA 3I4MG 4JI8H 1GUOA 2JN4A 4DFAA 3UE0A 5LL6X 2N55A 2EXZA 2ENBA 4LF7H 2W9BB 4DGZA 3IN5A 2OCEA 3MXNB 4L8JA 3BQ2A 2W9BA 5KFDA 3GTMA 1TWCH 3FKIH 4P72A 3FRPB 1UE7A 2J4XA 3L4JA 1NR4A 4JC0A 1N34L 1DONA 1X3QA 2O4XA 4HR7B 2F0JA 3CCRA 1HR0W 4YAKB 1PA6A 5CV9A 5IGCA 5EQ0A 3MR3A 5FD5A 4L5QA 4L1KA 3GTMB 4RB1A 3TS2A 1N36H 4KN4C 5M9OA 5A2QE 5CAEB 2FK1A 3HG9A 5M3MB 1STBA 2XWJB 2ATWA 2NB0A 2QGQA 4BY1B 4DAMA 3GIJA 2KEEA 2K75A 2NVTB 4R4IA 2MP1A 4DR4H 3DWAA 1CQFA 5D65A 4G7ZC 1XYIA 2XN9C 1IHZA 4DV7H 2N8NA 2B2YA 4PNYA 5KFNA 1S0MA 3KDFA 3RAXA 1EY0A 1EY4A 1KRSA 2KCTA 4DL7A 4HMIA 4A3JB 3NHHA 3NQTA 3PO2G 3EPIA 3GIMA 2ASDA 4XYOA 3Q6SA 3WWVA 1B3AA 1L0YB 2AWNA 2KA7A 4WJ4A 2V59A 3E6ZX 2GPWA 3R5HA 4IPCA 3A5UA 4GN3B 1Z6HA 1TWGB 2K50A 2PVPA 1LTLA 3FKIB 2QEXA 4I55F 1KNAA 1Z2OX 2A68D 2NUCA 1S5CD 1EIHA 5KFQA 4XTCS 1F9QA 2VQFQ 3PVXA 1K0RA 3E5SA 4RB2C 3RGZA 1HZBA 2H4OA
chains in the Genus database with same CATH topology
3SGIA 3NENA 3I55A 4DR3Q 1XPUA 4JI4Q 1Q46A 2N3SA 3PUWA 4IJLA 1KHIA 4JBWA 4DKAC 1Q86C 1XNRQ 3KJPA 4DR4Q 1HNWL 4BY1G 1PH1A 1TWGH 3M4PA 2JA5G 1W3SA 1KL9A 2JQOA 4O2DA 1NMFA 2Q2UA 4LF7Q 1IL2A 4JOIC 1VQDA 2K5HA 2UUBQ 4A3DG 5GROA 4NXMQ 4DR3L 1VS0A 4LFBQ 1HNZL 3TEHB 3S2DH 3HOVH 1IXRA 4MTNA 2LXJA 4A3KH 3K8AA 1X3GA 2ZM6L 3HOUH 3S17H 4JI8Q 3KF6A 3PO3G 5HGQA 2F52A 4O0AA 4GOPC 1Y1WG 1A8VA 3M85A 1HNZQ 2JA9A 5C44H 4DV3Q 1BKBA 4MZ9A 4DV5Q 4L5TA 1N34Q 1TWAH 2KHIA 1QVGA 1VQAA 2NZOA 5M3FH 5IE8A 4NPSA 4YWKA 3OTOQ 3E0EA 2Z0SA 2I5HA 4IFDI 3U58A 3TS0A 1YEZA 1P16A 1TWFH 5FLMG 3CF5A 3PUXA 4DUYQ 4A3CH 2I5LX 4EX5A 3CCSA 1I94L 4P75A 2D0PA 4YY3L 1X55A 3GD7A 1IBKL 3S1MH 3TRZA 1N32L 5LMNQ 3PGZA 4IFDJ 1OXVA 3U4VA 1L1OA 4JI2Q 3PF5A 5JJLA 3CCEA 3T1HL 2VQEL 2UUCQ 1SR3A 1Q8KA 2HIXA 4GS3A 4MNOA 2LXKA 1K73C 2Z6KC 4UPAA 3M4OH 4HJ9A 1CKNB 2HT1A 5LMUL 4AYBG 4JI5L 4BY1H 2B3GA 2VW9A 1CUKA 3CXCA 4DR2L 1PH9A 1Y1VH 2CQOA 1B7YB 3J81j 2GVAA 3I2ZA 4DK6C 2CCZA 4JOIA 2B63H 2IX0A 2WB1E 1X3EA 4A3KG 4C3JH 1NTGA 1VQPA 1WCMG 1V1QA 3D31A 1YITA 1V43A 4QJFA 2ZJRA 4HIKA 1K9MC 1X65A 2ZTEA 2JA8G 1VQ6A 3S14H 1FGUA 2N49A 1EFWA 3KFUA 1UE5A 2JJQA 3E9HA 3NEMA 1YIJA 2CKZB 4B3RQ 5C44G 4X64L 4OX9L 2BA0A 1RL2A 3GTKH 3CPFA 4C3HH 1C7YA 3VDYA 1PYBA 3B6YA 5GQOA 3HKZE 4JBKA 4LF6Q 3STBC 4GLVB 1TWHH 4YCWA 4A3GH 5FLMH 3T1HQ 1KXLA 2NVQH 3CAMA 1FJGL 3ULPA 3EN2A 4A3BH 1SLJA 1IZ6A 2VS1A 1AE2A 3H0GH 4IJHA 4POFA 4LF8Q 1XMQL 4IOAA 4A3EH 1N33Q 4JYAQ 4JBJA 4YCUA 4GOPA 1YHAA 5C0XI 2JA6G 3H3VH 4A93G 1OXSC 4DUYL 1YJ9A 2Q2HA 1X54A 4JI0Q 3J80i 3J81i 2Z6KA 4LFBL 1JJ2A 3UDFA 5JEAJ 5IYCH 1VQCA 1QVCA 2R92H 3HFZB 1GKHA 5HY6A 3G48A 3S16H 1OTCA 5BR8L 2HHHQ 1YBYA 3E9IA 2R93G 1E7ZA 1Y1VG 2EQSA 1HNWQ 3GTOH 3HOZH 2F4VL 1LYLA 4UP8A 4L5RC 4QL5A 5ELNA 3H3VI 2LSSA 4JI3Q 5C3EH 1YZ6A 2ZTDA 4DV2Q 1HR0L 4GKKQ 1WCMH 1X9NA 1I6HH 2EXDA 2DGYA 4A3MG 1XJVA 1Z47A 3PUYA 5IP9G 1VQMA 2JA7G 1JJCB 1EIFA 4TVAB 3EBEA 4HJ8A 2UXBL 2MO0A 1WFQA 4UP9A 1CSQA 3ULJA 3PF4A 4B3SL 2H5XA 4IPDA 4DV2L 4YY3Q 4DR5L 2YV5A 2C35B 1VQ5A 4A3IH 3M4QA 1IBLQ 1Q82C 1ASYA 3AFPA 1K8AC 2NVYH 4IPGA 5H1SE 4OWWB 3FHWA 2OQ0A 2R6GA 3Q8DA 4NXNL 4AQYL 4IPHA 1GO3E 1L0WA 4AIMA 4A3BG 1AE3A 4LF8L 4L5SA 1R9TH 2Q2TA 3H0GG 2UUAQ 2JE6I 2K5VA 1N36Q 4A3EG 4ALPA 4BBRH 3IRBA 4B3TL 1VQEA 4P71A 2YTYA 5E7NA 1KAWA 1G6PA 4DV1L 1IBMQ 1PFSA 1HZCA 4YCVA 5IWAL 4LF5Q 4Y52H 1J6QA 1PVOA 2R7ZH 2VL6A 2Y0SE 3GO5A 1HJPA 3K81C 4PG3A 4HJ5A 2R7FA 4X66L 4DR2Q 3HKSA 3NELA 3MEFA 1XMQQ 1DGSA 4X66Q 4QQBX 2PI2E 1L1OB 3RLFA 5IYCG 1QZGA 4KHPL 1FVIA 2R92G 2E2HH 3AQQA 4LF5L 3GDEA 1UE1A 1C0AA 1VQJA 2OTLA 2PQAA 1IYJB 1OXXK 3S1NH 2B29A 1IBML 3PO2H 4DR4L 4C3IH 4DV4L 3A0JA 3GTJH 2R93H 3CCUA 4BA1I 4KHZA 3HOZG 2PQAB 3M9BA 3CC7A 1P8LA 5C0XG 4JI2L 2UXDL 5FJ8H 2NVXH 2MQHA 2FXQA 3UE1A 3EIVA 2I0QA 3GTPH 1N9WA 2F3IA 5LMNW 4A3MH 3OYYA 5IP9H 1SMXA 1VQ8A 4GKJQ 1J5EQ 4X6AH 3KDFB 5IT9c 2AHOB 1PH5A 1EQRA 1VCIA 1JMCA 3W5OA 3I4MH 2PMZE 4BXXH 4P73A 2VZAA 3JC66 3ER0A 4QGUA 3HOYH 2YTXA 2IY5B 3STBD 2E2JH 1BVSA 2I5MX 5M3MH 2GN5A 2IHEA 3A5ZB 2EIFA 4DAYB 3AFQA 4AQYQ 1VQNA 2JA5H 4NXNQ 3FP9A 1X56A 2ASBA 3DM3A 4B3RL 1A63A 1UEBA 3PV0A 4A3DH 3RN2A 2KBNA 2IT1A 2UU9L 1VQLA 4DNIA 3HOXH 4HIDA 3CCVA 1M90C 4GN4B 3FKIG 3HOVG 2YTVA 1EQQA 3F2BA 3CPWA 4DUZQ 4GNXC 1UE6A 2VQEQ 2RF4A 4UP7A 4LFCL 2KENA 3OTOL 1YI2A 4OWTB 3F2DA 4A3FH 4IO9A 3GTLH 3ICEA 1W2BA 3H15A 3BJUA 3GTQH 1T9HA 2WAQG 2CFMA 2CWAA 3UDIA 3I4NG 1KIXA 2AMCB 1Q1EA 1C9OA 1XTDA 3CMAA 4GOPB 3GTMH 1SE8A 3RLOA 1YJWA 5JJIA 2K52A 5IYBH 5LMUQ 5M3FG 4TQUS 2BH2A 1EOVA 4Y7NH 2E5LL 3RZDH 4JI1L 1L2FA 1WOCA 3KF6B 2WB1G 3CQZH 4PZ6A 5BR8Q 5IP7G 3CD6A 2MNAA 1S40A 2UXCQ 2UUBL 4R1JA 4LF7L 1VQGA 3D0FA 1ASZA 3W1GA 5M5WH 4AYBE 4AH6A 2PI2A 4JI3L 4HJ7A 1VQFA 1CKOA 3K80C 5M5XH 1S72A 2MFIA 3CC4A 4GLXA 4B3SQ 1MKHA 4R4TA 3HOYG 3PCOB 5JEAG 2VUMH 2UXBQ 1X3FA 1O7IA 1FL0A 3L0OA 5M3MG 1VQHA 3AYHB 3RR5A 4ME3A 4JI7Q 3G71A 4DV3L 3RZOH 1HR0Q 2JK8A 4BBSH 4LFCQ 4GKKL 4BA2I 2E8GA 2PNHA 2ES2A 1I5FA 1KRTA 4PZ7A 3TQYA 2OQKA 4GN5A 5GADC 2NVTH 1VQBA 1JB7A 4OXPA 1CSPA 2VQFL 4DV0Q 1KD1C 1K83H 1Y14B 1I3QH 3HKZG 3CCQA 1G291 1NBWA 1SRUA 2R7DA 4HJAA 4A3FG 2E5LQ 2JEAI 4GNXA 2JA8H 5GAGC 4LWCA 1HNXQ 4QY7A 1GD7A 4DV7Q 2BA1A 3I4NH 1FJGQ 2IX1A 1OXTA 4YWMA 4C2MH 3HOUG 1XNRL 4A75A 1U0LA 5IYBG 4DPGA 5FLXc 5GAHC 2OWOA 4J15A 1PYSB 3G6EA 1N36L 1Q7YC 4DUZL 1J5EL 1PH6A 4WJ3M 4X62Q 5ELOA 5K36G 1XMOL 2WAQE 3K7UC 4R4CA 1XMOQ 2WP8J 3L2PA 1YJNA 4JI5Q 4A76A 2OTJA 2VY3A 1U5KA 1XNQQ 5J3BA 3CP0A 3PUVA 3F2CA 4LF4L 1B8AA 1A0IA 1LUZA 3UDXA 1QVFA 2KCMA 1HZAA 4R4OA 4KI0A 2UUCL 4LNQA 2JA6H 5C0XJ 4LF6L 2NN6G 4LUOA 5IY0A 2NZHA 3GTGH 4LUVA 3I4OA 1WJJA 4GKJL 1NY4A 3F1ZA 3NBHB 3JAMc 4B3MQ 3CW2C 4LUZA 2VUMG 5AJ3Q 4DR6L 1XNQL 1E22A 4DV0L 4HIMA 4OONA 2UXDQ 1N8RC 2YYZA 3AEVA 4DR7L 3BU2A 4BBSG 4JI8L 2VNUD 1EIYB 3PIPA 1OXUA 4IFDG 5IYDG 1I50H 1VQOA 1EUJA 4BY7H 1RIPA 1TXYA 3M7NA 3RLNA 2Y0SG 4LFAQ 3PUZA 4A4IA 3ULLA 3CCLA 4JI7L 2GVBA 2JA7H 3J80c 1E24A 1HNXL 4XIGS 1I94Q 1EYGA 1MJEA 1D8LA 2Q2IA 5C4JH 3PIOA 2B63G 3S2HH 4JI6Q 1E3PA 4DV1Q 1XPRA 3S24A 4PZ8A 5IWAQ 3F8TA 2HIVA 2XGTA 1YNXA 3A74A 3I7FA 1QZHA 2UUAL 4LF9L 3ERSX 4YHHL 2A8VA 2AKWB 4DV6Q 4DR1Q 3G4SA 1IBKQ 3KYHC 4DR1L 4GLAC 1CKMA 5M5YH 4JI1Q 4OO1G 4JI4L 1JT8A 4UY8C 2F4VQ 4JCVE 3PSIA 3RN5A 4JG2A 2JEBI 1A62A 3K0XA 4YWLA 5C4XH 4DR5Q 3RNUA 1E1TA 2CWPA 4EQ5A 2HHHL 4IOCA 3TREA 4A3GG 1L1OC 2ID0A 2K5NA 4X64Q 2RCNA 4NXML 2R7ZG 3L7ZC 1JJGA 3ZJYC 3BZCA 1SROA 2ALYB 2RHQB 4A3LG 2HQLA 4JV5Q 2A19A 4A93H 1BBWA 1MIUA 3BZKA 3JAMi 1VQKA 3S15H 2UXCL 1E1OA 2D62A 2RHSB 1KC8C 1AH9A 1HZ9A 2K14A 3KJOA 4RG1A 2YU9H 4FDBA 4DR7Q 2WFWA 1Q1BA 1V9PA 5IYDH 4OO1I 2UU9Q 4JV5L 4BY7G 5FJ8G 1HH2P 2NN6I 2ZJPA 2ZTCA 4LFAL 4B3ML 4GNXB 1LM0A 5EAYA 3S1RH 1NE3A 1M1KC 4RMFA 4DV6L 1KQSA 1QUQA 4A3JH 4JI0L 2A1AA 4R4QA 1CKNA 1Q12A 3I4MG 1PH7A 1K8GA 4APVA 1H95A 1MJCA 1Z9FA 1K3RA 2XTIA 5C3EG 4QIWE 3UE0A 3OW2A 5LMNL 1N32Q 1YHBA 3U50C 4X65Q 4K0KQ 2AWOA 4POGA 3KF8B 3J7A5 1G51A 2DUDA 3S1QH 2QA4A 4K0KL 4OWXB 3UDGA 1N33L 3HOWG 4JYAL 3W1BA 2L15A 1QUQB 1PH2A 2OCEA 3MXNB 1PH4A 1EWIA 1WI5A 4YHHQ 4DV4Q 1VQIA 1X6OA 3HOXG 1TWCH 3CCMA 5GAEC 2D0OA 4DK3C 4A3IG 1VQ7A 3FKIH 4P72A 1UE7A 1NMGA 5C4XG 4PMWA 4P74A 1BBUA 4OX9Q 2K4KA 1PV4A 4JC0A 4DV5L 1N34L 1GM5A 3J7ZC 3CCRA 1HR0W 2IHFA 1YVCA 1PA6A 4KHPQ 1VQ4A 1PH8A 2ZJQA 3LGJA 4HIOA 1XPOA 1D7QA 1S3OA 4L5QA 4BBRG 3TS2A 4A3LH 1PHJA 2ZM6Q 1PH3A 3PO3H 2ATWA 1UWVA 2MO1A 2QGQA 3CCJA 4DAMA 3T1YQ 3T1YL 4LW1A 1Y1WH 2K75A 2KHJA 4R4IA 3DLLA 2BH8A 3KOJA 5IP7H 4JBMA 1VQ9A 2V1CC 4KLKA 4DV7L 1YHQA 1JE5A 3I56A 2N8NA 3KDFA 5AJ3L 4DR6Q 3KLWA 3CC2A 1KRSA 2E2IH 2KCTA 3K7AH 3J81c 2N78A 1NJIC 3PO2G 4A3JG 3M3YH 1IBLL 4A3CG 3WWVA 2AWNA 1B70B 4WJ4A 3CMEA 5DLQE 1SN8A 4IPCA 3A5UA 4B3TQ 1GVPA 4GN3B 4H02A 1WYDA 1SFOH 2K50A 4LF4Q 1LTLA 4NB3A 2QEXA 4LF9Q 5JJKA 3HOWH 4XTCS 4X65L 4BXXG 1Q81C 4X62L 3U4ZA 2VQFQ 1K0RA 1HZBA 4JI6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGI A;  3NEN A;  3I55 A;  4DR3 Q;  1XPU A;  4JI4 Q;  1Q46 A;  2N3S A;  3PUW A;  4IJL A;  1KHI A;  4JBW A;  4DKA C;  1Q86 C;  1XNR Q;  3KJP A;  4DR4 Q;  1HNW L;  4BY1 G;  1PH1 A;  1TWG H;  3M4P A;  2JA5 G;  1W3S A;  1KL9 A;  2JQO A;  4O2D A;  1NMF A;  2Q2U A;  4LF7 Q;  1IL2 A;  4JOI C;  1VQD A;  2K5H A;  2UUB Q;  4A3D G;  5GRO A;  4NXM Q;  4DR3 L;  1VS0 A;  4LFB Q;  1HNZ L;  3TEH B;  3S2D H;  3HOV H;  1IXR A;  4MTN A;  2LXJ A;  4A3K H;  3K8A A;  1X3G A;  2ZM6 L;  3HOU H;  3S17 H;  4JI8 Q;  3KF6 A;  3PO3 G;  5HGQ A;  2F52 A;  4O0A A;  4GOP C;  1Y1W G;  1A8V A;  3M85 A;  1HNZ Q;  2JA9 A;  5C44 H;  4DV3 Q;  1BKB A;  4MZ9 A;  4DV5 Q;  4L5T A;  1N34 Q;  1TWA H;  2KHI A;  1QVG A;  1VQA A;  2NZO A;  5M3F H;  5IE8 A;  4NPS A;  4YWK A;  3OTO Q;  3E0E A;  2Z0S A;  2I5H A;  4IFD I;  3U58 A;  3TS0 A;  1YEZ A;  1P16 A;  1TWF H;  5FLM G;  3CF5 A;  3PUX A;  4DUY Q;  4A3C H;  2I5L X;  4EX5 A;  3CCS A;  1I94 L;  4P75 A;  2D0P A;  4YY3 L;  1X55 A;  3GD7 A;  1IBK L;  3S1M H;  3TRZ A;  1N32 L;  5LMN Q;  3PGZ A;  4IFD J;  1OXV A;  3U4V A;  1L1O A;  4JI2 Q;  3PF5 A;  5JJL A;  3CCE A;  3T1H L;  2VQE L;  2UUC Q;  1SR3 A;  1Q8K A;  2HIX A;  4GS3 A;  4MNO A;  2LXK A;  1K73 C;  2Z6K C;  4UPA A;  3M4O H;  4HJ9 A;  1CKN B;  2HT1 A;  5LMU L;  4AYB G;  4JI5 L;  4BY1 H;  2B3G A;  2VW9 A;  1CUK A;  3CXC A;  4DR2 L;  1PH9 A;  1Y1V H;  2CQO A;  1B7Y B;  3J81 j;  2GVA A;  3I2Z A;  4DK6 C;  2CCZ A;  4JOI A;  2B63 H;  2IX0 A;  2WB1 E;  1X3E A;  4A3K G;  4C3J H;  1NTG A;  1VQP A;  1WCM G;  1V1Q A;  3D31 A;  1YIT A;  1V43 A;  4QJF A;  2ZJR A;  4HIK A;  1K9M C;  1X65 A;  2ZTE A;  2JA8 G;  1VQ6 A;  3S14 H;  1FGU A;  2N49 A;  1EFW A;  3KFU A;  1UE5 A;  2JJQ A;  3E9H A;  3NEM A;  1YIJ A;  2CKZ B;  4B3R Q;  5C44 G;  4X64 L;  4OX9 L;  2BA0 A;  1RL2 A;  3GTK H;  3CPF A;  4C3H H;  1C7Y A;  3VDY A;  1PYB A;  3B6Y A;  5GQO A;  3HKZ E;  4JBK A;  4LF6 Q;  3STB C;  4GLV B;  1TWH H;  4YCW A;  4A3G H;  5FLM H;  3T1H Q;  1KXL A;  2NVQ H;  3CAM A;  1FJG L;  3ULP A;  3EN2 A;  4A3B H;  1SLJ A;  1IZ6 A;  2VS1 A;  1AE2 A;  3H0G H;  4IJH A;  4POF A;  4LF8 Q;  1XMQ L;  4IOA A;  4A3E H;  1N33 Q;  4JYA Q;  4JBJ A;  4YCU A;  4GOP A;  1YHA A;  5C0X I;  2JA6 G;  3H3V H;  4A93 G;  1OXS C;  4DUY L;  1YJ9 A;  2Q2H A;  1X54 A;  4JI0 Q;  3J80 i;  3J81 i;  2Z6K A;  4LFB L;  1JJ2 A;  3UDF A;  5JEA J;  5IYC H;  1VQC A;  1QVC A;  2R92 H;  3HFZ B;  1GKH A;  5HY6 A;  3G48 A;  3S16 H;  1OTC A;  5BR8 L;  2HHH Q;  1YBY A;  3E9I A;  2R93 G;  1E7Z A;  1Y1V G;  2EQS A;  1HNW Q;  3GTO H;  3HOZ H;  2F4V L;  1LYL A;  4UP8 A;  4L5R C;  4QL5 A;  5ELN A;  3H3V I;  2LSS A;  4JI3 Q;  5C3E H;  1YZ6 A;  2ZTD A;  4DV2 Q;  1HR0 L;  4GKK Q;  1WCM H;  1X9N A;  1I6H H;  2EXD A;  2DGY A;  4A3M G;  1XJV A;  1Z47 A;  3PUY A;  5IP9 G;  1VQM A;  2JA7 G;  1JJC B;  1EIF A;  4TVA B;  3EBE A;  4HJ8 A;  2UXB L;  2MO0 A;  1WFQ A;  4UP9 A;  1CSQ A;  3ULJ A;  3PF4 A;  4B3S L;  2H5X A;  4IPD A;  4DV2 L;  4YY3 Q;  4DR5 L;  2YV5 A;  2C35 B;  1VQ5 A;  4A3I H;  3M4Q A;  1IBL Q;  1Q82 C;  1ASY A;  3AFP A;  1K8A C;  2NVY H;  4IPG A;  5H1S E;  4OWW B;  3FHW A;  2OQ0 A;  2R6G A;  3Q8D A;  4NXN L;  4AQY L;  4IPH A;  1GO3 E;  1L0W A;  4AIM A;  4A3B G;  1AE3 A;  4LF8 L;  4L5S A;  1R9T H;  2Q2T A;  3H0G G;  2UUA Q;  2JE6 I;  2K5V A;  1N36 Q;  4A3E G;  4ALP A;  4BBR H;  3IRB A;  4B3T L;  1VQE A;  4P71 A;  2YTY A;  5E7N A;  1KAW A;  1G6P A;  4DV1 L;  1IBM Q;  1PFS A;  1HZC A;  4YCV A;  5IWA L;  4LF5 Q;  4Y52 H;  1J6Q A;  1PVO A;  2R7Z H;  2VL6 A;  2Y0S E;  3GO5 A;  1HJP A;  3K81 C;  4PG3 A;  4HJ5 A;  2R7F A;  4X66 L;  4DR2 Q;  3HKS A;  3NEL A;  3MEF A;  1XMQ Q;  1DGS A;  4X66 Q;  4QQB X;  2PI2 E;  1L1O B;  3RLF A;  5IYC G;  1QZG A;  4KHP L;  1FVI A;  2R92 G;  2E2H H;  3AQQ A;  4LF5 L;  3GDE A;  1UE1 A;  1C0A A;  1VQJ A;  2OTL A;  2PQA A;  1IYJ B;  1OXX K;  3S1N H;  2B29 A;  1IBM L;  3PO2 H;  4DR4 L;  4C3I H;  4DV4 L;  3A0J A;  3GTJ H;  2R93 H;  3CCU A;  4BA1 I;  4KHZ A;  3HOZ G;  2PQA B;  3M9B A;  3CC7 A;  1P8L A;  5C0X G;  4JI2 L;  2UXD L;  5FJ8 H;  2NVX H;  2MQH A;  2FXQ A;  3UE1 A;  3EIV A;  2I0Q A;  3GTP H;  1N9W A;  2F3I A;  5LMN W;  4A3M H;  3OYY A;  5IP9 H;  1SMX A;  1VQ8 A;  4GKJ Q;  1J5E Q;  4X6A H;  3KDF B;  5IT9 c;  2AHO B;  1PH5 A;  1EQR A;  1VCI A;  1JMC A;  3W5O A;  3I4M H;  2PMZ E;  4BXX H;  4P73 A;  2VZA A;  3JC6 6;  3ER0 A;  4QGU A;  3HOY H;  2YTX A;  2IY5 B;  3STB D;  2E2J H;  1BVS A;  2I5M X;  5M3M H;  2GN5 A;  2IHE A;  3A5Z B;  2EIF A;  4DAY B;  3AFQ A;  4AQY Q;  1VQN A;  2JA5 H;  4NXN Q;  3FP9 A;  1X56 A;  2ASB A;  3DM3 A;  4B3R L;  1A63 A;  1UEB A;  3PV0 A;  4A3D H;  3RN2 A;  2KBN A;  2IT1 A;  2UU9 L;  1VQL A;  4DNI A;  3HOX H;  4HID A;  3CCV A;  1M90 C;  4GN4 B;  3FKI G;  3HOV G;  2YTV A;  1EQQ A;  3F2B A;  3CPW A;  4DUZ Q;  4GNX C;  1UE6 A;  2VQE Q;  2RF4 A;  4UP7 A;  4LFC L;  2KEN A;  3OTO L;  1YI2 A;  4OWT B;  3F2D A;  4A3F H;  4IO9 A;  3GTL H;  3ICE A;  1W2B A;  3H15 A;  3BJU A;  3GTQ H;  1T9H A;  2WAQ G;  2CFM A;  2CWA A;  3UDI A;  3I4N G;  1KIX A;  2AMC B;  1Q1E A;  1C9O A;  1XTD A;  3CMA A;  4GOP B;  3GTM H;  1SE8 A;  3RLO A;  1YJW A;  5JJI A;  2K52 A;  5IYB H;  5LMU Q;  5M3F G;  4TQU S;  2BH2 A;  1EOV A;  4Y7N H;  2E5L L;  3RZD H;  4JI1 L;  1L2F A;  1WOC A;  3KF6 B;  2WB1 G;  3CQZ H;  4PZ6 A;  5BR8 Q;  5IP7 G;  3CD6 A;  2MNA A;  1S40 A;  2UXC Q;  2UUB L;  4R1J A;  4LF7 L;  1VQG A;  3D0F A;  1ASZ A;  3W1G A;  5M5W H;  4AYB E;  4AH6 A;  2PI2 A;  4JI3 L;  4HJ7 A;  1VQF A;  1CKO A;  3K80 C;  5M5X H;  1S72 A;  2MFI A;  3CC4 A;  4GLX A;  4B3S Q;  1MKH A;  4R4T A;  3HOY G;  3PCO B;  5JEA G;  2VUM H;  2UXB Q;  1X3F A;  1O7I A;  1FL0 A;  3L0O A;  5M3M G;  1VQH A;  3AYH B;  3RR5 A;  4ME3 A;  4JI7 Q;  3G71 A;  4DV3 L;  3RZO H;  1HR0 Q;  2JK8 A;  4BBS H;  4LFC Q;  4GKK L;  4BA2 I;  2E8G A;  2PNH A;  2ES2 A;  1I5F A;  1KRT A;  4PZ7 A;  3TQY A;  2OQK A;  4GN5 A;  5GAD C;  2NVT H;  1VQB A;  1JB7 A;  4OXP A;  1CSP A;  2VQF L;  4DV0 Q;  1KD1 C;  1K83 H;  1Y14 B;  1I3Q H;  3HKZ G;  3CCQ A;  1G29 1;  1NBW A;  1SRU A;  2R7D A;  4HJA A;  4A3F G;  2E5L Q;  2JEA I;  4GNX A;  2JA8 H;  5GAG C;  4LWC A;  1HNX Q;  4QY7 A;  1GD7 A;  4DV7 Q;  2BA1 A;  3I4N H;  1FJG Q;  2IX1 A;  1OXT A;  4YWM A;  4C2M H;  3HOU G;  1XNR L;  4A75 A;  1U0L A;  5IYB G;  4DPG A;  5FLX c;  5GAH C;  2OWO A;  4J15 A;  1PYS B;  3G6E A;  1N36 L;  1Q7Y C;  4DUZ L;  1J5E L;  1PH6 A;  4WJ3 M;  4X62 Q;  5ELO A;  5K36 G;  1XMO L;  2WAQ E;  3K7U C;  4R4C A;  1XMO Q;  2WP8 J;  3L2P A;  1YJN A;  4JI5 Q;  4A76 A;  2OTJ A;  2VY3 A;  1U5K A;  1XNQ Q;  5J3B A;  3CP0 A;  3PUV A;  3F2C A;  4LF4 L;  1B8A A;  1A0I A;  1LUZ A;  3UDX A;  1QVF A;  2KCM A;  1HZA A;  4R4O A;  4KI0 A;  2UUC L;  4LNQ A;  2JA6 H;  5C0X J;  4LF6 L;  2NN6 G;  4LUO A;  5IY0 A;  2NZH A;  3GTG H;  4LUV A;  3I4O A;  1WJJ A;  4GKJ L;  1NY4 A;  3F1Z A;  3NBH B;  3JAM c;  4B3M Q;  3CW2 C;  4LUZ A;  2VUM G;  5AJ3 Q;  4DR6 L;  1XNQ L;  1E22 A;  4DV0 L;  4HIM A;  4OON A;  2UXD Q;  1N8R C;  2YYZ A;  3AEV A;  4DR7 L;  3BU2 A;  4BBS G;  4JI8 L;  2VNU D;  1EIY B;  3PIP A;  1OXU A;  4IFD G;  5IYD G;  1I50 H;  1VQO A;  1EUJ A;  4BY7 H;  1RIP A;  1TXY A;  3M7N A;  3RLN A;  2Y0S G;  4LFA Q;  3PUZ A;  4A4I A;  3ULL A;  3CCL A;  4JI7 L;  2GVB A;  2JA7 H;  3J80 c;  1E24 A;  1HNX L;  4XIG S;  1I94 Q;  1EYG A;  1MJE A;  1D8L A;  2Q2I A;  5C4J H;  3PIO A;  2B63 G;  3S2H H;  4JI6 Q;  1E3P A;  4DV1 Q;  1XPR A;  3S24 A;  4PZ8 A;  5IWA Q;  3F8T A;  2HIV A;  2XGT A;  1YNX A;  3A74 A;  3I7F A;  1QZH A;  2UUA L;  4LF9 L;  3ERS X;  4YHH L;  2A8V A;  2AKW B;  4DV6 Q;  4DR1 Q;  3G4S A;  1IBK Q;  3KYH C;  4DR1 L;  4GLA C;  1CKM A;  5M5Y H;  4JI1 Q;  4OO1 G;  4JI4 L;  1JT8 A;  4UY8 C;  2F4V Q;  4JCV E;  3PSI A;  3RN5 A;  4JG2 A;  2JEB I;  1A62 A;  3K0X A;  4YWL A;  5C4X H;  4DR5 Q;  3RNU A;  1E1T A;  2CWP A;  4EQ5 A;  2HHH L;  4IOC A;  3TRE A;  4A3G G;  1L1O C;  2ID0 A;  2K5N A;  4X64 Q;  2RCN A;  4NXM L;  2R7Z G;  3L7Z C;  1JJG A;  3ZJY C;  3BZC A;  1SRO A;  2ALY B;  2RHQ B;  4A3L G;  2HQL A;  4JV5 Q;  2A19 A;  4A93 H;  1BBW A;  1MIU A;  3BZK A;  3JAM i;  1VQK A;  3S15 H;  2UXC L;  1E1O A;  2D62 A;  2RHS B;  1KC8 C;  1AH9 A;  1HZ9 A;  2K14 A;  3KJO A;  4RG1 A;  2YU9 H;  4FDB A;  4DR7 Q;  2WFW A;  1Q1B A;  1V9P A;  5IYD H;  4OO1 I;  2UU9 Q;  4JV5 L;  4BY7 G;  5FJ8 G;  1HH2 P;  2NN6 I;  2ZJP A;  2ZTC A;  4LFA L;  4B3M L;  4GNX B;  1LM0 A;  5EAY A;  3S1R H;  1NE3 A;  1M1K C;  4RMF A;  4DV6 L;  1KQS A;  1QUQ A;  4A3J H;  4JI0 L;  2A1A A;  4R4Q A;  1CKN A;  1Q12 A;  3I4M G;  1PH7 A;  1K8G A;  4APV A;  1H95 A;  1MJC A;  1Z9F A;  1K3R A;  2XTI A;  5C3E G;  4QIW E;  3UE0 A;  3OW2 A;  5LMN L;  1N32 Q;  1YHB A;  3U50 C;  4X65 Q;  4K0K Q;  2AWO A;  4POG A;  3KF8 B;  3J7A 5;  1G51 A;  2DUD A;  3S1Q H;  2QA4 A;  4K0K L;  4OWX B;  3UDG A;  1N33 L;  3HOW G;  4JYA L;  3W1B A;  2L15 A;  1QUQ B;  1PH2 A;  2OCE A;  3MXN B;  1PH4 A;  1EWI A;  1WI5 A;  4YHH Q;  4DV4 Q;  1VQI A;  1X6O A;  3HOX G;  1TWC H;  3CCM A;  5GAE C;  2D0O A;  4DK3 C;  4A3I G;  1VQ7 A;  3FKI H;  4P72 A;  1UE7 A;  1NMG A;  5C4X G;  4PMW A;  4P74 A;  1BBU A;  4OX9 Q;  2K4K A;  1PV4 A;  4JC0 A;  4DV5 L;  1N34 L;  1GM5 A;  3J7Z C;  3CCR A;  1HR0 W;  2IHF A;  1YVC A;  1PA6 A;  4KHP Q;  1VQ4 A;  1PH8 A;  2ZJQ A;  3LGJ A;  4HIO A;  1XPO A;  1D7Q A;  1S3O A;  4L5Q A;  4BBR G;  3TS2 A;  4A3L H;  1PHJ A;  2ZM6 Q;  1PH3 A;  3PO3 H;  2ATW A;  1UWV A;  2MO1 A;  2QGQ A;  3CCJ A;  4DAM A;  3T1Y Q;  3T1Y L;  4LW1 A;  1Y1W H;  2K75 A;  2KHJ A;  4R4I A;  3DLL A;  2BH8 A;  3KOJ A;  5IP7 H;  4JBM A;  1VQ9 A;  2V1C C;  4KLK A;  4DV7 L;  1YHQ A;  1JE5 A;  3I56 A;  2N8N A;  3KDF A;  5AJ3 L;  4DR6 Q;  3KLW A;  3CC2 A;  1KRS A;  2E2I H;  2KCT A;  3K7A H;  3J81 c;  2N78 A;  1NJI C;  3PO2 G;  4A3J G;  3M3Y H;  1IBL L;  4A3C G;  3WWV A;  2AWN A;  1B70 B;  4WJ4 A;  3CME A;  5DLQ E;  1SN8 A;  4IPC A;  3A5U A;  4B3T Q;  1GVP A;  4GN3 B;  4H02 A;  1WYD A;  1SFO H;  2K50 A;  4LF4 Q;  1LTL A;  4NB3 A;  2QEX A;  4LF9 Q;  5JJK A;  3HOW H;  4XTC S;  4X65 L;  4BXX G;  1Q81 C;  4X62 L;  3U4Z A;  2VQF Q;  1K0R A;  1HZB A;  4JI6 L; 
#chains in the Genus database with same CATH topology
 3SGI A;  4CJ2 C;  4JI4 Q;  5KYL A;  5KND A;  2OEO A;  1XNR Q;  1G2T A;  3VMM A;  3KJP A;  1EUC B;  3HP3 A;  4C5C A;  4O2D A;  1NMF A;  1T94 A;  1VQD A;  4OEL B;  2B8G A;  3EPG A;  5EOY A;  2H1E A;  3HOV H;  3KBX A;  4A3K H;  3K8A A;  2ZM6 L;  1RHP A;  4RNM A;  4DR5 H;  4JI8 Q;  3RBE A;  2ZDG A;  3IL8 A;  4L63 B;  1Y1W G;  3T1H H;  1PDQ A;  5C5M A;  3BG5 A;  4UCO A;  1HNZ Q;  1PX2 A;  4DV3 Q;  3FPU B;  4MZ9 A;  4C1N I;  4DV5 Q;  5FLX W;  5LMU H;  5M3F H;  1SXT A;  4FF2 A;  1B50 A;  4ABN A;  2I5H A;  2A6H D;  2B2V A;  5CV5 A;  2OH2 A;  3PUX A;  4DUY Q;  2XSC A;  4X3U A;  3CCS A;  1I94 L;  4YY3 L;  4LMY A;  1IBK L;  3V2T A;  3IAY A;  2Z9H A;  3GP7 A;  4ZKC B;  4J9N A;  4IFD J;  4IRK A;  1OXV A;  4IAL A;  5JAV A;  1L1O A;  4JI2 Q;  4F8M A;  1G91 A;  3MWE A;  3T1H L;  2KCN A;  2UUC Q;  4GS3 A;  4UHV A;  3SHL A;  3OMG A;  2Z6K C;  2PPB C;  1V1O A;  2BOS A;  5LMU L;  4AYB G;  4ECX A;  1V4Y A;  5IT9 E;  5D1O A;  4JI5 L;  3S17 B;  2A68 C;  5DQH A;  3HS0 C;  2FK3 A;  5EZY F;  2PCF B;  3GQC A;  4NLG A;  4DK1 A;  4JV5 H;  3S15 B;  2L0C A;  2MHV A;  4GC6 A;  2NU8 B;  2EVB A;  2IX0 A;  1TT2 A;  1TWA B;  1F9R A;  5FOB B;  1VQP A;  1V1Q A;  3D31 A;  1TWF A;  1V43 A;  4QJF A;  2ZJR A;  3OUZ A;  3E9H A;  1LTR D;  4B3R Q;  4X66 H;  4LFA H;  2E75 C;  3KHG A;  4OX9 L;  2PZU A;  3GTK H;  2XCP A;  3CPF A;  4QUC A;  4C3H H;  1C8C A;  1WTW A;  1JWS D;  3DMU A;  4H13 C;  1B6R A;  1RJR A;  1W6K A;  1TWH H;  4A3G H;  4K8J A;  1XXG A;  5FLM H;  5H80 A;  3RB0 A;  2NVQ H;  1RJT A;  3CAM A;  3KLR A;  3H0G H;  4LF8 Q;  2W7P A;  4IOA A;  1DCZ A;  4JYA Q;  2I80 A;  2QK4 A;  5J2T F;  2EOT A;  5FPR A;  4JBJ A;  5C0X I;  4A93 G;  1I4R A;  5DQI A;  1KNE A;  3MEH A;  1OXS C;  2JSO A;  2TMP A;  4OL7 A;  4U68 A;  1X54 A;  2FHT A;  4UAI A;  3J80 i;  3J81 i;  2CZG A;  3M9M B;  1KDA A;  3UDF A;  1C30 A;  4JI5 H;  1QVC A;  2R92 H;  4RFB A;  3GTO A;  3MR5 A;  1PRT D;  3QO2 A;  5HY6 A;  1JXL A;  1OTC A;  4C3I G;  4K8I A;  3E9I A;  1IKM A;  1Y1V G;  2EQS A;  4Q0F A;  1HFG A;  4HCE A;  1LYL A;  4UP8 A;  2K5D A;  4L5R C;  4JI3 Q;  1GUG A;  1WCM H;  3I73 A;  2R84 A;  3K5I A;  2DGY A;  4J8Q A;  4KY7 A;  4MV8 A;  2JA7 G;  5IP9 G;  4LF5 H;  5EWG A;  4O2A F;  1EIF A;  1WFQ A;  3ULJ A;  3PF4 A;  4B3S L;  4DV2 L;  1H9S B;  5LOV F;  5LMN H;  3OWF A;  2IA6 A;  2EE1 A;  5ELF A;  2EYO A;  2YV5 A;  1VQ5 A;  4A3I H;  1AW7 A;  5H1S E;  1ONL A;  2R6G A;  3N41 B;  4O3O A;  4AQY L;  4I7A A;  4A3B G;  4KN7 C;  2Q2T A;  3OMC A;  1CA6 A;  2UUA Q;  4LF8 H;  4C3J B;  1T5X D;  4N8F A;  2MCT A;  4EEQ A;  4JI1 H;  4B3T L;  1CQV A;  5M5W B;  4YCV A;  1K28 A;  4I65 A;  3GO5 A;  1HJP A;  4PG3 A;  1A3V A;  5J22 A;  1S10 A;  3KHL A;  1ILQ A;  3IFT A;  1X32 A;  1DGS A;  1Y1W B;  4X66 Q;  4A2A A;  3RTX A;  3AMU A;  4LF5 L;  1KTK A;  2OTL A;  3Q0A A;  4PV1 C;  3T53 B;  2B29 A;  3PO2 H;  1ESR A;  4LSA A;  4DV4 L;  3C1E A;  1SNM A;  3UI2 A;  4F4Z A;  3T51 B;  3QR8 A;  3ORQ A;  5C0X G;  5FJ8 H;  4MV1 A;  2ICI A;  2FXQ A;  4RAY A;  4JI4 H;  2I0Q A;  1N9W A;  5LMN W;  1U4M A;  3QOL A;  4YBZ B;  4RWS C;  1SMX A;  1J5E Q;  3KDF B;  5ELB A;  1EHI A;  3HB9 A;  3I4M H;  1M0T A;  2DWC A;  4ZQI A;  3JC6 6;  2EDG A;  1GUW A;  4IUR A;  2YTX A;  2IY5 B;  3STB D;  3R3O A;  1BDO A;  1BVS A;  2PN1 A;  2IHE A;  2AQ2 B;  4DAY B;  1VQN A;  4F4Y A;  4NXN Q;  1F2Z A;  2F0U A;  4B3R L;  2DNC A;  2A6E C;  3NBH A;  2IT1 A;  3TZD A;  3PIO 3;  1JDB B;  3FKI G;  3HOV G;  1EUD B;  4A3B B;  2JA8 B;  2Z6B A;  3CPW A;  1LTS D;  1PTO F;  1E0B A;  4UP7 A;  5LYJ F;  4ME6 A;  1YI2 A;  2ZDQ A;  4OWT B;  2TSS A;  3ICE A;  3FKI A;  2NZ1 D;  4MA0 A;  1WSC A;  4RCN A;  4JI0 H;  3J81 L;  3PIP 3;  1SYC A;  2F3W A;  4MV9 A;  3Q22 A;  2WAQ G;  2CFM A;  2CWA A;  3I4N G;  2W9A A;  2AMC B;  1B1Z A;  4GOP B;  3S1R B;  1SE8 A;  2BR0 A;  1KJ8 A;  5KFX A;  3MWM A;  2J6T A;  5IYB H;  5M3F G;  2QCP X;  4Y7N H;  3KAJ A;  2OLS A;  5DM6 3;  1TVX A;  1L2F A;  3BVM A;  3SDZ A;  3KF6 B;  2WB1 G;  3F2U A;  1WD1 A;  2FB9 A;  1TKW B;  2I8C A;  4DV0 H;  2UXC Q;  2WB1 A;  2EYP A;  1TA8 A;  4R1J A;  5AFW A;  3QIA A;  5CV4 A;  1B6S A;  4AH6 A;  1HNW H;  1QCB D;  1HR0 H;  2QKI C;  3M3Y B;  3K80 C;  4Q0Y A;  2HHH H;  4EQN A;  4ECZ A;  3OHX C;  4RA8 A;  3I3C A;  5HV6 A;  3V96 A;  3R23 A;  1X3F A;  5CB4 F;  5M3M G;  3WDN A;  3RR5 A;  2B2U A;  4ME3 A;  1AZQ A;  4EFE A;  1EEF D;  2JK8 A;  3OSO A;  4BA2 I;  2E8G A;  2PNH A;  1I4G A;  2J9G A;  1IBL H;  1KRT A;  5D3D A;  3A55 A;  2OQK A;  2UVW A;  4GN5 A;  3DWP A;  1A9X A;  5GAD C;  2NVT H;  1TAE A;  1VQB A;  5I9O A;  1CSP A;  1UNN C;  4DV0 Q;  1KD1 C;  3HKZ G;  1JB3 A;  3SVM A;  2IL8 A;  5EPL A;  3PN1 A;  2DPJ A;  4QY7 A;  4DV7 Q;  2KHS A;  4C2M H;  1TY0 A;  1M0W A;  3WOF A;  2HDL A;  3DWQ A;  1D1K A;  1U0L A;  5EPJ A;  4A75 A;  1B04 A;  5FK9 C;  1W6J A;  3U9O A;  1N36 L;  1JIH A;  2BQU A;  2WAQ E;  1T5E A;  3RZD B;  4XXE A;  3L2P A;  4JI5 Q;  3H4B A;  2VY3 A;  4LF4 L;  3PUV A;  2LFN A;  1A0I A;  1I6V C;  1UC8 A;  2KCC A;  1Y1W A;  4LNQ A;  4O3Q A;  3FEW X;  3MA2 B;  1FNU A;  4KKT A;  3GTG H;  4M1U B;  4JYA H;  1CM9 A;  1SE2 A;  1N48 A;  4B3M Q;  4Y7N B;  1JOO A;  2VUM G;  3LML A;  1E22 A;  1RK5 A;  3O13 A;  4OON A;  5I2X A;  1N8R C;  3I4L A;  4X3K A;  4A93 B;  3BU2 A;  4BBS G;  4JI8 L;  2VPS A;  3G7L A;  1EIY B;  3T13 A;  1LTB D;  4ME5 A;  1I50 H;  3NPP A;  2F4V H;  2NVQ B;  1VQO A;  4DF7 A;  1EUJ A;  4A3G B;  1RIP A;  1PTO B;  3RLN A;  2Y0S G;  3MFY A;  2KVM A;  1NUC A;  4X3S A;  4A4I A;  1MD2 D;  2F0L A;  1BJT A;  5CA0 F;  1WTH A;  1HNX L;  1I94 Q;  2ZXR A;  3BQ1 A;  5C4J H;  2Q2I A;  4O1N A;  3S2H H;  2WYO A;  3BDO A;  1LV9 A;  1E3P A;  4DV1 Q;  5IYZ F;  4CKC A;  2W6O A;  5IWA Q;  3A74 A;  3I90 A;  3MVV A;  2C5C A;  1QZH A;  4IUV A;  4LF9 L;  3M4Y A;  3NP8 A;  2A8V A;  3PMF A;  4DK0 A;  3G4S A;  4MTD A;  4DR1 L;  2R93 A;  1EIG A;  5BN5 A;  1CFM A;  3GV3 A;  5M5Y H;  2PQE A;  4OO1 G;  3SE7 A;  2M2L A;  4BWG B;  2JEB I;  1A62 A;  3K0X A;  4YWL A;  4DR5 Q;  2HHH L;  2F1M A;  2CWP A;  3T5J A;  2XNA C;  1LTT D;  4B9W A;  4MTE A;  2PW5 A;  3ZJY C;  1HUM A;  4IUQ A;  3NSW A;  2A69 D;  2QYZ A;  2R8J A;  1ULZ A;  2HQL A;  2Z1C A;  4A93 H;  4ECY A;  3JAM i;  1VQK A;  4UCV A;  4CDD C;  2L4N A;  5IWA H;  5EDW A;  1JIC A;  3BS1 A;  1GSH A;  4ECT A;  2BCO A;  3M4I A;  4IFD H;  2E2D C;  2K1B A;  4JV5 L;  4BY7 G;  3HGB A;  5FJ8 G;  1WTO A;  5A35 A;  2ZJP A;  2B63 A;  4GNX B;  1AP0 A;  4FS1 A;  1BF4 A;  4A3J H;  1CKN A;  2R8K A;  5C8Y F;  2RA4 A;  4QIW B;  4APV A;  4DLK A;  2QEJ C;  3M9N B;  1Z9F A;  1ZKO A;  2R8I A;  1TR5 A;  1K3R A;  2XTI A;  3CQZ B;  4QIW E;  3OW2 A;  3Q8Q B;  5LMN L;  1S5E D;  4NKL A;  1N32 Q;  4X65 Q;  5KFK A;  4X64 H;  3RAQ A;  5KG6 A;  4RHS A;  5I6Y A;  3J7A 5;  1G51 A;  2QA4 A;  4K0K L;  4OWX B;  1RCV D;  4JYA L;  4XX0 B;  3MR2 A;  1Y1V A;  4IRC A;  1PH2 A;  2WE6 A;  5D14 A;  2JEG A;  3VYS A;  3HOX G;  2D0O A;  3L9A X;  4A3I G;  2AQ3 B;  2O2L D;  4WJW A;  2V4Q A;  5IGG A;  4OX9 Q;  2K4K A;  5L37 A;  3J7Z C;  4XT1 B;  2XCL A;  4KHP Q;  2B2T C;  1VQ4 A;  2ZJQ A;  3LGJ A;  4ZYS A;  4O3N A;  1D7Q A;  4BBR G;  4R7R A;  4A3L H;  1PHJ A;  2ZM6 Q;  1PH3 A;  1PTO C;  3PO3 H;  1UWV A;  2MO1 A;  3T1Y Q;  3OIP A;  2JA5 B;  3VR2 A;  3GID A;  4LW1 A;  5FLX E;  5EBD A;  3DLL A;  3PR5 B;  4CKB A;  3KOJ A;  2M00 A;  4FXG C;  5CC4 A;  1WCM B;  5L1I A;  5EGT A;  2IPK D;  4DR3 H;  4PDB A;  5KFG A;  4DV7 L;  4QWD A;  1QNK A;  3SK6 A;  3JAM L;  3I56 A;  4JW0 A;  2F0G A;  4GZY C;  2XCA A;  4YR0 A;  2F0V A;  1TWF B;  2E2H B;  3GTJ A;  3GV8 B;  2R82 A;  2N78 A;  3V4S A;  1K83 A;  1MBY A;  1RK6 A;  1I6U A;  1EEI D;  4A3C G;  1VBG A;  3RZO B;  1K3B C;  1SEB D;  4B3T Q;  1XDN A;  1PTO H;  5KFV A;  3GTL B;  5IGE A;  1WYD A;  4MAM A;  1SFO H;  4YAJ B;  3G6V A;  4JVZ A;  4LF4 Q;  4NB3 A;  4KJN A;  3TN2 A;  3GTJ B;  2E2H A;  1ILP A;  3HOW H;  1Z2N X;  4BXX G;  4J9O A;  3BYT B;  1WTX A;  3J80 L;  1Q46 A;  2N3S A;  1Q86 C;  1KHI A;  4DR4 Q;  4BY1 G;  1SFO B;  4DAP A;  2DLN A;  1I4H A;  1RTO A;  1KL9 A;  1UEA B;  3VA5 A;  4NXM Q;  3TQT A;  4DR3 L;  1S9F A;  1VS0 A;  3TEH B;  4JPB W;  3S17 H;  2NVY A;  5C1P A;  5HGQ A;  4UCT A;  5KFI A;  4O0A A;  5KG3 A;  1S0O A;  1II3 A;  3EFX D;  4FXK C;  4X3T A;  5KFM A;  3M85 A;  4HSV A;  5C44 H;  4HNV A;  1BKB A;  4AQY H;  1TWA H;  2KHI A;  2IX3 A;  4V0B A;  4RGM A;  4Q8F A;  4RHR A;  1J8I A;  4NPS A;  3OTO Q;  4YP3 A;  2Z0S A;  5JPN C;  3TS0 A;  1YEZ A;  3R8B A;  2WAQ A;  1ENA A;  5DM7 3;  3H09 A;  2I87 A;  1H9S A;  3RMH A;  5JH7 F;  1X55 A;  3ETH A;  2AQ1 B;  3LX0 A;  3GD7 A;  2W8L A;  2CW0 C;  3S1M H;  2CW7 A;  3KF8 A;  2VQF H;  5KX5 F;  3PF5 A;  2SNS A;  4CKE A;  5JJL A;  1OO9 B;  1VBH A;  4QWB A;  1Q8K A;  4MNO A;  4DV1 H;  2NVX A;  1A2T A;  2EZV A;  5KNB A;  2WV6 D;  4A3K B;  2VW9 A;  4RZR A;  4Z9C B;  3JZI A;  4JUZ A;  1CUK A;  4JI2 H;  2B2U C;  4DR2 L;  2CQO A;  2XGQ A;  3J81 j;  2GVA A;  3QFF A;  4JOI A;  2B63 H;  2WB1 E;  3N52 A;  4HSP A;  1X3E A;  4A3K G;  2YS6 A;  2NUA B;  4JV1 A;  1E2W A;  4JI6 H;  1NTG A;  3WNZ A;  1NR2 A;  4DL5 A;  1WTR A;  1V51 A;  4IR9 A;  1QIL A;  3SK8 A;  2JJQ A;  3I91 A;  2CKZ B;  1EY7 A;  3DUZ A;  1RL2 A;  1C7Y A;  1SEI A;  2D2C C;  3ERQ A;  5KFY A;  3VDY A;  1LLR D;  1HTL D;  3B6Y A;  3CRL C;  4U6P A;  5C4H A;  3HKZ E;  3K5H A;  3STB C;  1AEX A;  4YCW A;  3HKZ B;  1CE8 A;  3T1H Q;  2AQ4 A;  1RYR A;  1FJG L;  3EN2 A;  2EJF C;  5C4X B;  3GTK A;  1SLJ A;  4IJH A;  2L11 A;  3T5L A;  3VYT A;  1N33 Q;  3N40 P;  2V58 A;  4K2L A;  1YHA A;  4ILW A;  3H3V H;  1WTQ A;  1U4L A;  4ZUI A;  3V6K A;  5KG0 A;  4JI0 Q;  3RB3 A;  2Z6K A;  4EGV A;  4LFB L;  5IYC H;  4YY3 H;  3NXW A;  3QG1 A;  1GKH A;  1B4O A;  2WTF A;  2PMZ A;  1I50 A;  5BR8 L;  4LF9 H;  3OIQ A;  1HPC A;  2NTS A;  3TSS A;  1EWC A;  4QL5 A;  3H3V I;  4GKK H;  2VUM A;  3J80 E;  2ZTD A;  4ZAI A;  1IW7 C;  2GA4 B;  1X9N A;  1LT4 D;  4A3M G;  2EY6 A;  1VQM A;  3TP5 A;  5HBR B;  4L6T B;  2V5A A;  4OIK A;  3N42 B;  2L5T A;  3GV6 A;  4O2B F;  5KT3 A;  3EBE A;  4HJ8 A;  2MO0 A;  1I50 B;  2PMZ B;  2CQY A;  2C22 A;  4QWC A;  1FNW A;  2H5X A;  1IOW A;  4GKJ H;  2C9O A;  3A56 A;  2IW3 A;  3M4Q A;  1Q82 C;  1ASY A;  4J6H A;  1U4R A;  2KOL A;  1PLF A;  5I6W A;  3UQ8 A;  4NXN L;  1GO3 E;  1PFN A;  1L0W A;  4CGY B;  1AE3 A;  1JOK A;  4LF8 L;  2G5D A;  1R9T H;  3H0G G;  4Q5V A;  1KLU D;  2K5V A;  1N36 Q;  1DYQ A;  1RF2 D;  4A3E G;  1FD7 D;  4BBR H;  4C2M B;  4F88 A;  2EJG C;  4ALP A;  2YTY A;  1KAW A;  1BGW A;  5KFZ A;  1XX8 A;  4MA5 A;  2XC9 A;  1J6Q A;  4HYK A;  3KLS A;  4E4T A;  5D1P A;  1XMQ Q;  1SYX B;  2PI2 E;  1L1O B;  5E3F A;  5FO9 B;  1FVI A;  2R92 G;  2E2H H;  1HQM C;  1C0A A;  4FF1 A;  1IYJ B;  4FU0 A;  4APM A;  1I94 H;  2HVR A;  3RV4 A;  1I4P A;  4C3I H;  2ICE C;  3GTJ H;  3MJF A;  1PTO D;  1LO5 D;  4TKO B;  4EBD A;  3HOZ G;  2PQA B;  3M9B A;  3CC7 A;  3HOY B;  2W6M A;  3A8J E;  2DY7 A;  2MQH A;  3UE1 A;  1DOK A;  1EWH A;  3EIV A;  3PO3 B;  1FYC A;  2F3I A;  4H44 C;  4O42 A;  5IT9 L;  3H94 A;  3OYY A;  5IP9 H;  1GGO A;  1VQ8 A;  2SEB D;  3VYR A;  4HR7 A;  5IT9 c;  2C00 A;  2AHO B;  4C56 C;  1JMC A;  2IP4 A;  4BXX H;  2VZA A;  3ER0 A;  3W3A A;  1KJJ A;  1C48 A;  4QGU A;  2NU7 B;  4UCU A;  3GIP A;  3A5Z B;  1NAP A;  4U7C A;  4AQY Q;  4IWY A;  2JA5 H;  3Q8P B;  1HQR D;  4ECU A;  5IGB A;  2A6H C;  5KT7 A;  1EZ6 A;  3K7A B;  3PV0 A;  4EGQ A;  3RN2 A;  2O03 A;  3A7L A;  4M9U A;  3NWS A;  3KXY T;  3K0Y A;  4DNI A;  3HOX H;  4HID A;  4GN4 B;  2YTV A;  1EQQ A;  2VQE Q;  4WD3 A;  4A3F H;  2R8G A;  2NU6 B;  1W2B A;  4IRD A;  4B9X A;  3C2P A;  2B2T A;  1T9H A;  4NDX A;  2YZM A;  3HKZ A;  4DV5 H;  4HTH A;  4DAV A;  2E74 C;  3CMA A;  2AGO A;  1DOM A;  3TP8 A;  4MV6 A;  4IN3 A;  2LKV A;  5T1I A;  1EOV A;  3BDL A;  3ZYY X;  2VOB A;  2E5L L;  4ZK9 B;  4JI1 L;  1WOC A;  2NVY B;  2KJX A;  3CD6 A;  4EGJ A;  5K36 H;  1S40 A;  3AB9 A;  1O7Y A;  2VA3 A;  1SCU B;  2R93 B;  1LAB A;  1QJO A;  3D0F A;  4FNF A;  1ASZ A;  3GLK A;  4XDX A;  3HOZ B;  3LWU A;  3TQ1 A;  1DJR D;  2PI2 A;  3MC0 B;  4JI3 L;  3BDC A;  4HJ7 A;  3BAB A;  1CKO A;  3N6X A;  2CW8 A;  5M5X H;  2MFI A;  3OHA A;  5KYI A;  3KHH A;  4RUA A;  5KFA A;  5KT6 A;  4R4T A;  2UXB H;  5KFS A;  1C3O A;  4R8U B;  1HA5 A;  2A69 C;  3HOY G;  3PCO B;  5JEA G;  3A54 A;  1O7I A;  3AYH B;  2M05 A;  3DM1 A;  3OTO H;  1HR0 Q;  1I5F A;  1L0X B;  1JB7 A;  1Y14 B;  1EYG A;  1G29 1;  4HJA A;  1SRU A;  2BE5 C;  2XRQ D;  2JEA I;  3VPD A;  4GNX A;  3G6J B;  2JA8 H;  4RKL A;  4LWC A;  1HNX Q;  1EFI D;  2WKC A;  4LK1 C;  1KEE A;  5C5J A;  4EYH B;  2QDL A;  3HOU G;  5COR A;  1XNR L;  4DPG A;  5FKA C;  3VPC A;  1A3T A;  5A2Q L;  1Q7Y C;  1A2U A;  5LL6 b;  4DUZ L;  1XMO L;  1PRT C;  2G9H D;  2CH4 A;  1FNV A;  4R4C A;  2WP8 J;  1IYV A;  4Q44 A;  2OTJ A;  1S03 G;  2E76 C;  4LSX A;  4KHP H;  4F50 A;  3CP0 A;  3F2C A;  1QVF A;  3BJY A;  3UDX A;  1LUZ A;  2KCM A;  3ND9 A;  3V4Z A;  1SDF A;  5KIX A;  3QOJ A;  5EJW A;  2NZH A;  3NTI A;  1DV2 A;  4OX9 H;  1SMY C;  3X3M A;  4J9R A;  4FF4 A;  3F1Z A;  2WAC A;  3KUP A;  1SND A;  1N33 H;  5CBA E;  3CW2 C;  4RCO A;  1JLL B;  3GV5 B;  2CH4 W;  3K5O A;  2L55 A;  5AJ3 Q;  3U9S A;  3H6M A;  4DV0 L;  3GTK B;  4DR6 L;  2FE3 A;  1W96 A;  1R9T B;  3SI8 A;  1MSH A;  4HIM A;  2UXD Q;  2JXM B;  3H4D A;  2NBF A;  2YYZ A;  3AEV A;  4NXM H;  3BA8 A;  3K6O A;  4BBR B;  3SE0 A;  5I47 A;  3PIP A;  3LNN A;  1K0S A;  4X65 H;  1JC7 A;  3MHB A;  3QWN A;  3I8Z A;  1XNR H;  5ELC A;  2XIG A;  3PUZ A;  4JI7 L;  3CCL A;  5DQG A;  2GVB A;  3VR4 A;  1TS5 A;  2R85 A;  4FP5 D;  3ND8 A;  4R9W A;  1AN7 A;  2B63 G;  2MPM A;  4JI6 Q;  2UVV A;  5IIF A;  1XPR A;  3S24 A;  4PZ8 A;  3MXU A;  1BQQ T;  3F8T A;  4EVO A;  1SJH D;  2YCH A;  2UUA L;  4N9P A;  1IW7 D;  4KD4 A;  2W9C B;  4DV3 H;  4ECV A;  4DR1 H;  1S0N A;  3KYH C;  3QJY A;  4JI1 Q;  3G6Y A;  1QE6 A;  1RKN A;  4JCV E;  3P1H A;  3PSI A;  5EWF A;  5C4X H;  3H40 A;  1E1T A;  2EY1 A;  3D4D A;  2J6U A;  4IOC A;  4HN7 A;  1C4Q A;  4HQ6 A;  5IT9 W;  1GHJ A;  2E2J B;  5KG5 A;  1Y8N B;  1B3Q A;  3L7Z C;  5KT2 A;  1SRO A;  1EYC A;  3LWB A;  2RHQ B;  1TWH B;  2A19 A;  1BBW A;  3BZK A;  3S15 H;  5KFL A;  4DUY H;  1E1O A;  2RHS B;  5T1G A;  1KC8 C;  4OHJ A;  1HZ9 A;  4RG1 A;  3CRK C;  2YU9 H;  1BNC A;  4DR7 Q;  1HCZ A;  1U9R A;  5IYD H;  2BQR A;  4OO1 I;  4OGQ C;  3HOV B;  1QNU A;  1HH2 P;  2NN6 I;  3UFX B;  4DN4 M;  2FJZ A;  2ZTC A;  5EAY A;  3S1R H;  4QMG A;  5EKK A;  1JCK B;  1STG A;  1M1K C;  1HUN A;  3M7G A;  1QUQ A;  3I72 A;  2LY7 A;  4R4Q A;  3V6J A;  4RZQ A;  1Q12 A;  4PQX A;  1K8G A;  2C2R A;  1H95 A;  1MJC A;  1XWE A;  5C1O A;  4EBE A;  4ECR A;  2V9W A;  1YHB A;  1D6E C;  5I9P A;  2AWO A;  4POG A;  3KF8 B;  4Q43 A;  2DUD A;  3NTK A;  1N33 L;  3W1B A;  2L15 A;  4QB4 A;  1QUQ B;  1PH4 A;  5KT5 A;  4YHH Q;  4DV4 Q;  4NW2 A;  1ENC A;  1E4E A;  2OXP A;  5M3F B;  2FKL A;  1VQI A;  4XYM B;  1LTA D;  3S1M B;  4DK3 C;  1VQ7 A;  3T5H A;  2F0H A;  1NMG A;  2HVQ A;  4PMW A;  4P74 A;  1BBU A;  1PV4 A;  4DV5 L;  3L3O C;  1GM5 A;  1SE4 A;  5CV7 A;  5LXT F;  1PH8 A;  3E0J A;  1S5F D;  4RNN A;  3GV7 B;  1ICW A;  2ZJT A;  3CCJ A;  3A8K E;  5C44 B;  4J0M A;  1LTG D;  2KHJ A;  3BZD B;  4MV4 A;  5DLG A;  3N44 B;  1SSO A;  5CR3 A;  3WOE A;  3H0G A;  2FLP A;  1N32 H;  1VQ9 A;  2V1C C;  2F03 A;  5BMV F;  1GYF A;  1JE5 A;  4MN3 A;  5AJ3 L;  4DR6 Q;  4KY6 A;  4A3E B;  2E2I H;  3K7A H;  1Z2P X;  5F9N A;  4A3J G;  1STE A;  4HAE A;  5IOC A;  3NBI A;  3PO2 B;  1CI3 M;  4ED8 A;  2J6S A;  5DGA A;  2F0I A;  3CME A;  1DV1 A;  2JA7 B;  5DLQ E;  2ZM6 H;  2K33 A;  3MAQ A;  1S4Z A;  1SN8 A;  2MJ8 A;  3RGX A;  2AU0 A;  4H02 A;  2VXW A;  5DNF A;  3WO0 A;  4CDF C;  3GIL A;  5KFW A;  1LT5 D;  2IJ0 A;  1Q81 C;  4MV3 A;  3U4Z A;  1SE3 A;  4TQS A;  4BS9 A;  4JI6 L;  3KAK A;  2RVL A;  3I55 A;  2DNE A;  1AFP A;  4DKA C;  1HNW L;  1H9M A;  1XTC D;  3LWE A;  3I12 A;  5TSS A;  4F7X A;  1TWG H;  3M4P A;  2JA5 G;  1E4F T;  4S3S A;  3X3N A;  2Q2U A;  1IL2 A;  2UUB Q;  1RTN A;  2JEJ A;  5GRO A;  3N6R A;  1HNZ L;  1IXR A;  4MTN A;  2LXJ A;  4DUZ H;  3HOU H;  1X3G A;  3TZU A;  3S1Q B;  4C3J G;  3KF6 A;  3PO3 G;  3GTQ A;  2W57 A;  4UCR A;  2SOB A;  1A8V A;  1H9R A;  2F0Q A;  2FK2 A;  1JWM D;  5KKN B;  2JA9 A;  4IUP A;  1N34 Q;  4HMJ A;  2C2E A;  1QVG A;  2NZO A;  5LL6 S;  4I50 F;  1IKL A;  4YWK A;  3OW7 A;  5EBC A;  3E0E A;  2B2Y C;  2K6A A;  3U58 A;  1SNP A;  2EY5 A;  3GTQ B;  1P16 A;  1TWF H;  3CF5 A;  1QOH A;  2KSW A;  1PRT F;  2NN6 H;  3TII A;  1JDE A;  1J9O A;  1I3Q B;  4WRD A;  3J81 W;  2D5D A;  3TRZ A;  1PFB A;  1XMQ H;  1GSA A;  1PYW D;  5LMN Q;  1O7L A;  3RJ0 A;  3U4V A;  2K04 A;  2X6G A;  2HCC A;  4PMB A;  2RKS A;  2VQE L;  1EY9 A;  2HIX A;  1PK8 A;  1K73 C;  4UPA A;  3M4O H;  4C2M A;  3CKI B;  4HJ9 A;  4YJ3 F;  4J9K A;  1SMY D;  1Y8O B;  1R4Q B;  1BCP D;  4BY1 H;  2B3G A;  2PBZ A;  4ZUJ A;  4TSS A;  3CXC A;  1TWA A;  4JV0 A;  1G6Z A;  1ET6 A;  1Y1V H;  1B7Y B;  1UAP A;  2CCZ A;  1IBM H;  3KHR A;  1EY5 A;  1WCM G;  1SNC A;  1YIT A;  1ZYR D;  4HIK A;  3S14 H;  1BXT A;  1X65 A;  2ZTE A;  2JA8 G;  1FGU A;  2N49 A;  1UUP A;  1EFW A;  1UE5 A;  3PR4 A;  1YIJ A;  5DAU A;  4YIJ A;  1ICF B;  4X64 L;  1A15 A;  3SK5 A;  3GTP A;  2EY2 A;  1EY6 A;  2DJF C;  1RJP A;  4DL2 A;  4QWE A;  2IMW P;  2JYO A;  2RQX A;  4CDC C;  4LF6 Q;  3EYY A;  4G7O C;  1I7L A;  2W6N A;  1YNJ C;  2PZW A;  4GLV B;  1JE4 A;  2DIK A;  1NCV A;  4ZI7 F;  2R87 A;  1KXL A;  3ULP A;  1RD9 D;  2IWH A;  3DHQ A;  4POF A;  1AE2 A;  3BA9 A;  4K5V A;  1XMQ L;  1IOV A;  1WD0 A;  3NWT A;  5CA1 F;  1SNQ A;  4YCU A;  2X69 A;  2EYF A;  1YJ9 A;  2Q2H A;  4WOR A;  4RKB A;  4G4K A;  4XT3 B;  5KEE A;  1I6H B;  5DG9 A;  1STH A;  5JEA J;  4EBC A;  4ECS A;  1VQC A;  4O3P A;  3HFZ B;  3PW0 A;  2XWB B;  2N88 A;  3G48 A;  1PZI D;  2HHH Q;  2R93 G;  5CMD A;  1HNW Q;  5L9X A;  3BQ0 A;  5D3I B;  3GTO H;  2X0S A;  2R92 A;  3T5K A;  2CVR A;  2DJG C;  5ELN A;  2LSS A;  4KK7 A;  5C0X H;  1YZ6 A;  4DV2 Q;  1HR0 L;  2NYZ D;  3S14 B;  1I6H H;  2EXD A;  5LA6 F;  1STY A;  5C4J B;  1XJV A;  3ONA B;  1JJC B;  1V8Q A;  2RDG A;  3FMC A;  4TVA B;  3RUP A;  2L12 A;  4RUC A;  4K0K H;  1DOL A;  1H9J A;  4UP9 A;  4YQW A;  3QB3 A;  4ED2 A;  4IPD A;  3OSN A;  4YY3 Q;  3L4K A;  5L1L A;  5LP6 F;  1ZYR C;  3QZ7 A;  2C35 B;  2PW7 A;  1IBL Q;  1MGS A;  3AFP A;  4IPG A;  3RB6 A;  2SDF A;  1BOS A;  2OQ0 A;  4AIM A;  4DNR B;  4DU9 A;  2JA6 A;  1KJQ A;  2Q8I B;  3IRB A;  2B63 B;  4P71 A;  1YNJ D;  4C5A A;  1G6P A;  4F87 A;  1IBM Q;  1HZC A;  4LF5 Q;  4DV6 H;  4Y52 H;  1EYD A;  1SJE D;  2VL6 A;  1PVO A;  2F0S A;  5EWE A;  3E5N A;  2UVR A;  2R7F A;  2P5Z X;  3HKS A;  4ID6 A;  3MEF A;  5E4X A;  1KAB A;  4IAJ A;  1UNS A;  1EYZ A;  1GUT A;  5IYC G;  1QZG A;  4KHP L;  3A8I E;  3AQQ A;  4LFC H;  1SAP A;  2F0W A;  3GDE A;  4YB8 B;  4J9P A;  1IBM L;  2WDT A;  2UVU A;  4MIU A;  5JVD F;  4BA1 I;  2I46 A;  4KHZ A;  2RCF A;  1P8L A;  2UXD L;  4IHJ F;  3R5F A;  5I4D A;  4KKS A;  3CHB D;  5EKI A;  4GKJ Q;  4X6A H;  1EQV A;  1PH5 A;  3HOW B;  1SNO A;  1EQR A;  5D1O B;  3W5O A;  1TS2 A;  1SYD A;  2ALZ A;  3H0G B;  2CHB D;  5KFP A;  4KTA A;  3EJI A;  5KG2 A;  2UU9 H;  2W6P A;  1BUV T;  4O4H F;  2F3V A;  2I5M X;  2GN5 A;  2EIF A;  3URY A;  3C46 A;  3MXG A;  1R9T A;  4ECQ A;  1X56 A;  1A63 A;  1UEB A;  3N43 B;  3RV3 A;  4ZCK A;  4G3I A;  4OIJ A;  3CCV A;  4KMU C;  2Q8T A;  1M90 C;  3F2B A;  1MZB A;  1EZ1 A;  1UE6 A;  2XD4 A;  2RF4 A;  2CW0 D;  4LFC L;  1BXR A;  1K83 B;  4K6D A;  1BNZ A;  4CBV A;  1D5M C;  5FO8 B;  3F2D A;  4X62 H;  4YR3 A;  4K5X A;  3P75 A;  1I4Q A;  3GTQ H;  2RDH A;  2FPG B;  3TP6 A;  3CU7 A;  4IWX A;  3R5X A;  3GTL A;  5KFF A;  3QZ8 A;  2HJW A;  3P7J A;  3RLO A;  2ZT9 C;  5CBE E;  1YJW A;  2K52 A;  2DPI A;  4TQU S;  2BH2 A;  3K5M A;  2BQ3 A;  2AGQ A;  1RDP D;  2KED A;  5C4Z A;  5GON F;  5CGK A;  4PZ6 A;  3CQZ H;  5IP7 G;  2MNA A;  5FLX L;  2FMC A;  4DR6 H;  3DXJ C;  4LF7 L;  2F0M A;  5G3L D;  1VQG A;  3HOU B;  4DL6 A;  2UUB H;  4K5W A;  4Q45 A;  5JVH 3;  2LS0 1;  2QIL A;  5HUR A;  3NTH A;  2W70 A;  1GJX A;  4C3H B;  1VDZ A;  5KFH A;  1S72 A;  3CC4 A;  3Q1K A;  3T1Y H;  1Q8I A;  5C3X A;  3OHB A;  4A3D B;  4B3S Q;  1MKH A;  5C5L A;  3AU7 A;  3D6C A;  2GPS A;  4M8A A;  3MWY W;  2W6Q A;  3V05 A;  1SYB A;  1EZ8 A;  1FL0 A;  3L0O A;  1EQT A;  1I3Q A;  4KY5 A;  1VQH A;  4JI7 Q;  1IYU A;  3G71 A;  4DV3 L;  4U67 3;  5CV8 A;  4BBS H;  1O78 A;  4LFC Q;  3S1N B;  4GKK L;  3Q23 A;  4ETS A;  3BG3 A;  2W6Z A;  4QUF A;  1VF7 A;  2FJ2 A;  3N8D A;  3M9O B;  2J0T D;  1GLV A;  5JJZ A;  3LP8 A;  1HXY D;  2VQF L;  3J81 E;  2E5L Q;  3I4M B;  3HBL A;  5JUM A;  4IQZ A;  5GAG C;  4CJ0 B;  5C6A A;  1D5X C;  2DZD A;  3FMA A;  3I4N H;  2BDN A;  4YWM A;  2FLL A;  4FBU A;  5IYB G;  5FLX c;  4J15 A;  1PYS B;  3VR5 A;  2QF7 A;  2F0P A;  2FLN A;  1J5E L;  4IZO A;  3H3V C;  5K36 G;  3K7U C;  3S2H B;  2Q8R E;  1STA A;  1YJN A;  1U5K A;  5J3B A;  4OO1 H;  3IFD A;  4B08 A;  1K1Q A;  1B8A A;  3JRX A;  4TV8 F;  5BPH A;  1HZA A;  5KG7 A;  4LJZ C;  3D4R A;  4R4O A;  2YYA A;  2XIW A;  2UUC L;  3VPB A;  3PW7 A;  1DXM A;  1QB5 D;  1F77 A;  5C0X J;  2NN6 G;  4LF6 H;  2E5L H;  3I4O A;  4DV2 H;  1DIK A;  1NY4 A;  5KFB A;  4F4W A;  2FIN B;  3JAM c;  5BN4 A;  3NK9 A;  1D1I A;  4ZLT F;  4UFZ A;  4KV6 A;  4UDU C;  4DR7 L;  3RD4 A;  1AN8 A;  1J5E H;  1F2L A;  2VNU D;  3RFC A;  1FKA H;  1OXU A;  4O3R A;  3M4O B;  2V4R A;  3C3L A;  4ECW A;  3TIG A;  3TBI B;  4ZKB B;  1ET9 A;  3ULL A;  3TME A;  1LT3 D;  5C3E B;  3J80 c;  4XIG S;  4RH6 A;  2NTT A;  1MJE A;  1QG7 A;  3PIO A;  1HA6 A;  5BPF A;  1ZEQ X;  4O3S A;  2Y0S B;  1PZK D;  1S97 A;  5J39 A;  2HIV A;  2GLT A;  3SEB A;  2DY8 A;  5BR8 H;  4DV6 Q;  1TWC B;  5A2Q W;  4O4I F;  1CHQ D;  3J7A K;  4GLA C;  2R92 B;  2HVS A;  1KLG D;  4JI4 L;  1JT8 A;  1PXU A;  5KRU A;  4UY8 C;  1DD2 A;  2MUY A;  2F4V Q;  2VQD A;  3RN5 A;  4EEY A;  4CHT B;  1L1O C;  2K5N A;  1D5Z C;  2RCN A;  4I7Z C;  1JJG A;  2ALY B;  2HQE A;  4A3L G;  4JV5 Q;  4HNU A;  1MIU A;  1CTM A;  2D62 A;  4RGO S;  1V1P A;  1AH9 A;  3K5L A;  3MTS A;  3R2I A;  1Q1B A;  4JK1 C;  2L9H A;  2UU9 Q;  5FPO A;  1G2S A;  2YW2 A;  1GUS A;  2F0E A;  4LFA L;  4B3M L;  1LM0 A;  3SR1 A;  1KQS A;  4TQR A;  3Q24 A;  4JI0 L;  2A1A A;  3MFI A;  2X6L A;  1PH7 A;  4KKU A;  4WBN F;  5CYU A;  5C3E G;  3DEO A;  3TIN A;  2CQA A;  4QIW A;  3U50 C;  1XNQ H;  4K0K Q;  3S1Q H;  2VA2 A;  5IGF A;  3OWE B;  3UDG A;  4TRD A;  3HOW G;  3JAM E;  1EWI A;  1WI5 A;  1X6O A;  2F0O A;  3CCM A;  5GAE C;  1STN A;  5EKL A;  2YRX A;  1AUX A;  2R7Z A;  1B44 D;  2K5Q A;  5C4X G;  1Y8P B;  1S5D D;  2K7V A;  4DR2 H;  1BCP C;  4DA2 A;  2K01 A;  3C1F A;  4H7B A;  1D2B A;  3NE5 B;  4J9Q A;  2RGV A;  2IHF A;  1YVC A;  4HIO A;  1XPO A;  3PW2 A;  1S3O A;  2JA5 A;  2BDO A;  2R7N A;  4HED A;  3T1Y L;  1Y1W H;  1Z7T A;  3J7A V;  4DV4 H;  2BH8 A;  2SNM A;  2Z4H A;  2M9V A;  5IP7 H;  4C1N K;  4FM9 A;  3BVG A;  4NP5 A;  4JBM A;  2EJM A;  4DL4 A;  2MGS A;  4KLK A;  3D6W A;  1YHQ A;  4N8X 1;  1BR9 A;  1KJI A;  1X3P A;  3KLW A;  3CC2 A;  3R2T A;  3J81 c;  1NJI C;  4LAA A;  3M3Y H;  1ZXT A;  1EU4 A;  2J7Z A;  1IBL L;  2A73 B;  2BE5 D;  3GTP B;  1B70 B;  2ZDH A;  4RB0 A;  5KFJ A;  5BN3 A;  2FPP B;  5KFE A;  5J1Z A;  1GVP A;  5HGT A;  1GXD C;  4A3F B;  1TII D;  4DXG A;  1Y69 U;  5D8D A;  4LF9 Q;  4CC6 A;  1GOZ A;  2W9C A;  1RYS A;  5JJK A;  3OSP A;  1A6X A;  4X65 L;  2YU9 A;  2R3Z A;  1AZP A;  4X62 L;  5FD6 A;  1PRT B;  1NSN S;  5ISR A;  1LT6 D;  1XPU A;  3NEN A;  2RGR A;  4DR3 Q;  3Q8S B;  3PUW A;  4IJL A;  4JBW A;  2OT2 A;  1K8O A;  4B3S H;  2PYK A;  3MFH A;  1PH1 A;  1IL8 A;  3IG0 A;  5CV6 A;  3T16 A;  1W3S A;  1EYA A;  4B3R H;  2JQO A;  3MR6 A;  2Z4I A;  5KGU A;  4LF7 Q;  1U4P A;  4JOI C;  2K5H A;  5IGD A;  2YU9 B;  4A3D G;  4LMQ D;  2HGS A;  4LFB Q;  2EPB A;  1KDC A;  2DN8 A;  5KNC A;  3S2D H;  3JAM W;  1EY8 A;  2F52 A;  1SYG A;  3JSL A;  1CZW A;  4GOP C;  2YZN A;  4FS2 A;  3C0F B;  1HTP A;  1E2V A;  2XRS D;  3HZX A;  2JEI A;  1LAC A;  4RAZ A;  1ESF A;  3W2D A;  4L5T A;  2B8F A;  4K6L A;  2E2I A;  1VQA A;  2YL2 A;  5IE8 A;  5LHY 1;  1BBX C;  1M6V A;  3K57 A;  4IFD I;  5FLM G;  2W8K A;  2FFK B;  3GIK A;  3D8G A;  4A3C H;  3J80 W;  2I5L X;  4EX5 A;  3G8C A;  2F0F A;  4QW9 A;  4G7H C;  4P75 A;  4RAU C;  2D0P A;  2WII B;  1LTI D;  3EVQ A;  1IBK H;  4ED0 A;  5ELE A;  4LH6 A;  1N32 L;  3T4A C;  1FR3 A;  2B2V C;  3FDT A;  3PGZ A;  4XQQ A;  3PW5 A;  1BCP B;  2R7K A;  1FJG H;  5KFR A;  3CCE A;  1ML0 D;  1E4E B;  1SR3 A;  2VR1 A;  1KDB A;  2LXK A;  2WAQ B;  2F0N A;  1CKN B;  2HT1 A;  2JP1 A;  1WH2 A;  1M8A A;  4G57 A;  2IBK A;  2XVS A;  2B2W A;  1PH9 A;  4UCS A;  2Z8L A;  3I2Z A;  4DK6 C;  5DLF A;  2R7L A;  3PZP A;  1B53 A;  3IKJ A;  4C3J H;  4PWQ A;  3PW4 A;  1TY2 A;  1K9M C;  1VQ6 A;  1TS3 A;  1B2T A;  3KFU A;  4C3I B;  4EYI B;  3NEM A;  3GII A;  5C44 G;  5L1J A;  3K5N A;  1MHW C;  2BA0 A;  4A3I B;  1CS0 A;  2EYJ A;  2RDF A;  1O80 A;  5K2M A;  1PYB A;  5GQO A;  3KBG A;  3U9T A;  4JBK A;  4XYL B;  1TWG A;  1F2M A;  5E4W C;  1JX4 A;  4KJO A;  5JOB A;  2Y0S A;  2QW7 A;  4IUT A;  2QDB A;  4A3B H;  1A3U A;  2VS1 A;  1IZ6 A;  4R8N A;  2C2D A;  4ZHQ F;  2PNR C;  4A3E H;  4YHH H;  4J9L A;  1GUN A;  4GOP A;  5F9L A;  2JA6 G;  1TQO A;  4ED7 A;  2UUA H;  2EYL A;  4Y8V B;  5KFC A;  4DUY L;  4IUU A;  1B33 N;  5C3W A;  3DEP A;  1JOR A;  1KAA A;  1JJ2 A;  2V4D A;  1PFM A;  1RJQ A;  2FMM A;  2R86 A;  2R6F A;  4J9M A;  5JPM C;  5ELD A;  3JRW A;  3S16 H;  1KJ9 A;  1K8M A;  1YBY A;  5IOD A;  1E7Z A;  4RB3 C;  1VMP A;  3HOZ H;  2RSN A;  2F4V L;  3SK4 A;  2WB1 B;  5C3E H;  1Q3L A;  4BY7 B;  3J7Y W;  4GKK Q;  1DM0 B;  1CHP D;  1Z47 A;  3PUY A;  3S2D B;  4EQP A;  1HNX H;  1I7N A;  2F4I A;  2UXB L;  2RDJ A;  1ZHS A;  1CSQ A;  1MI2 A;  4YR2 A;  4DR5 L;  3R93 A;  3HRZ C;  1M7J A;  4A3M B;  2F0K A;  4K2K A;  1JR0 D;  1K8A C;  1WR2 A;  2NVY H;  4OWW B;  1S5B D;  4FBT A;  1Q90 A;  1HFN A;  3FHW A;  3Q8D A;  2ZXP A;  3HXL A;  4JI7 H;  4JV2 A;  3FPP A;  4IPH A;  2YZG A;  4ED6 A;  3H20 A;  4L5S A;  2HD3 A;  2EYM A;  4C5B A;  2JE6 I;  1Y1V B;  2HUG A;  3HOX B;  2HCI A;  1ZQ7 A;  1VQE A;  5E7N A;  4HNT A;  2I07 B;  3RB4 A;  4DV1 L;  1PFS A;  1S68 A;  4K14 A;  1T3N A;  1HNZ H;  5E1F A;  3E3X A;  5IWA L;  1CA5 A;  4CJ1 B;  4J9S A;  2R7Z H;  2Y0S E;  3S9W A;  3K81 C;  4HJ5 A;  4DR2 Q;  1H9K A;  3F8N A;  4A2B A;  4X66 L;  2A5H A;  3NEL A;  4NMZ A;  3CVZ A;  4QQB X;  3RLF A;  3WO1 A;  4FF3 A;  4FVM A;  3EQL C;  1UE1 A;  1VQJ A;  2PQA A;  3S1N H;  1OXX K;  1EOT A;  2PO4 A;  4DR4 L;  1E4G T;  2UUC H;  3A0J A;  2OF1 A;  2R93 H;  3CCU A;  4MV7 A;  2FMA A;  2K5W A;  2AUK A;  3I4N B;  3NUC A;  2YRW A;  1UC9 A;  4JI2 L;  2RSO A;  4KHV A;  2NVX H;  2AUJ D;  3GTP H;  4A3M H;  1F9S A;  4I4T F;  3G6X A;  3OPO A;  3TP7 A;  1WTV A;  2EYH A;  1VCI A;  5FO7 B;  2PMZ E;  2UXD H;  1CQI B;  4P73 A;  5KG1 A;  4IZ8 A;  4ZOL F;  5DEH A;  4RNO A;  3HOY H;  2WKD A;  1YNN D;  5JEA H;  2W71 A;  4QF4 A;  2E2J H;  2JEF A;  1WVL A;  4JI3 H;  5M3M H;  4ZQ3 A;  3AFQ A;  4PMC A;  4HCS A;  3FP9 A;  2ASB A;  3DM3 A;  4A3D H;  1EU3 A;  3VYU A;  2KBN A;  5DG8 A;  4ED3 A;  3GQB A;  2UU9 L;  4Q8E A;  1VQL A;  4DNT B;  3HEJ A;  4O4L F;  5T14 A;  4MHE A;  4DUZ Q;  2KUM A;  1PZJ D;  4GNX C;  2C28 A;  2KEN A;  3SXH A;  3OTO L;  3DF7 A;  3GTL H;  1F2Y A;  4WFN 3;  4IO9 A;  3FVQ A;  3GTG B;  3H15 A;  4TUY F;  3BJU A;  2ATL A;  2NU9 B;  5KFT A;  3UDI A;  2K32 A;  3KLS X;  1KIX A;  1N34 H;  1Q1E A;  1C9O A;  1XTD A;  3RF2 A;  5F2D A;  3GTG A;  3GTM H;  5JJI A;  5LMU Q;  2ASL A;  3VA7 A;  1L2Z A;  3A7A B;  4FO2 A;  2W7O A;  4IR1 A;  3RZD H;  1GSO A;  2RBM A;  5BR8 Q;  1JQY D;  1ENF A;  3VR6 A;  2WIN B;  1TWC A;  3ITP A;  4V19 0;  2UUB L;  3V6H A;  2O5I C;  3W1G A;  1BCP F;  5M5W H;  5K5P A;  4AYB A;  3BYY B;  4AYB E;  2E2I B;  1WTP A;  5COY A;  1VQF A;  2R8H A;  3BAA A;  4FXD A;  4YJ2 F;  3D4W A;  1F9P A;  4GLX A;  1SBB B;  1BO0 A;  2VUM H;  2UXB Q;  4N9T A;  3MFG A;  1XMO H;  1SYE A;  1W93 A;  3RZO H;  2PZT A;  5KT4 A;  4CDE C;  4RGT A;  2R61 A;  1V1P B;  2ES2 A;  2FPI B;  1GHK A;  4PZ7 A;  3TQY A;  1YNN C;  4QWA A;  5L1K A;  4ZRZ A;  4EQO A;  1JKJ B;  1T36 A;  4OXP A;  1VAJ A;  1KBL A;  3BVZ A;  1K83 H;  4BWS C;  1I3Q H;  3CCQ A;  3MXN A;  1NBW A;  2R7D A;  4A3F G;  2NWG A;  3RIZ A;  2RDI A;  1I4X A;  5KFU A;  1GD7 A;  2BA1 A;  1FJG Q;  2IX1 A;  3K3V A;  5J2U F;  3JSN A;  1OXT A;  4RGN A;  1VKZ A;  1G8Z D;  4EFB A;  2NVX B;  1M4V A;  1B9M A;  5GAH C;  2OWO A;  1DZ1 A;  4P2C B;  3G6E A;  3FDS A;  4F4X A;  2R7Z B;  1PH6 A;  3KAL A;  4WJ3 M;  2VB2 X;  4X62 Q;  5ELO A;  5M5X B;  4IUN A;  2KQ3 A;  3H91 A;  5JVG 3;  1XMO Q;  3KTM A;  3MWD A;  3CQZ A;  1TU2 B;  4A76 A;  4XZ3 B;  4EG0 A;  1XNQ Q;  3P20 A;  4XQN A;  3OUU A;  2F0T A;  4KI0 A;  1KC7 A;  2JA6 H;  3Q8R B;  4LF6 L;  4KD3 A;  3NQI A;  4LUO A;  5IY0 A;  4LUV A;  3ORR A;  1WJJ A;  4GKJ L;  1PMR A;  3NBH B;  1SYF A;  2VPQ A;  1WCM A;  4LUZ A;  4ULL A;  1ZET A;  1XNQ L;  1B9N A;  4DAY A;  4MTK A;  4XQJ A;  2JA7 A;  1CQJ B;  1ROD A;  2A6E D;  2AGP A;  3PQI A;  1O7Z A;  2ZXO A;  5NUC A;  4IFD G;  3T56 B;  5IYD G;  1E2Z A;  3K3P A;  5I2Y A;  4BY7 H;  1EL0 A;  2D9U A;  3M7N A;  1TXY A;  2FP4 B;  3NGD A;  2G9D A;  5EPK A;  1CZG A;  5KFO A;  4LFA Q;  4NXN H;  2JA7 H;  2XGP A;  1VF5 C;  2K03 A;  1E24 A;  4H0L C;  4LH7 A;  3J7A F;  1D8L A;  2ASJ A;  2B2W C;  2VQE H;  3I70 A;  4OEM B;  2UXC H;  2P0A A;  3MXP A;  2XGT A;  1YNX A;  3I7F A;  2YS7 A;  4M7E A;  2VUM B;  3ERO A;  4E6I A;  2O5J C;  5JQW A;  3ERS X;  3RBD A;  4YHH L;  1NNX A;  2AKW B;  4DR1 Q;  3GIQ A;  1FGB D;  3EA6 A;  1O75 A;  1N56 A;  1IBK Q;  1K1S A;  4BBS B;  1SFO A;  4C3H G;  1CKM A;  1CK1 A;  3MZ5 A;  3RUZ A;  4QCL A;  1TWH A;  4I7H A;  1TS4 A;  4LFB H;  5DGB A;  2A74 C;  1MSG A;  2F0D A;  3S16 B;  3K58 A;  4JG2 A;  3RNU A;  4A3G G;  4EQ5 A;  2HDM A;  3K59 A;  3TRE A;  1AUV A;  4XYQ A;  2ID0 A;  4CC5 A;  4X64 Q;  2VUG A;  4DXF A;  3ETJ A;  4NXM L;  4ED1 A;  5DG7 A;  2R7Z G;  4TV9 F;  4FYD A;  1ZHQ A;  2VB3 X;  3BZC A;  5G3L F;  3GTO B;  4J1M A;  4GC7 A;  1R4P B;  4ODG A;  5M5Y B;  2UXC L;  3Q2O A;  4RU9 A;  1HHV A;  2SCU B;  2KEC A;  4AYB B;  2B39 A;  3OOC A;  2K14 A;  3KJO A;  4QW8 A;  4FDB A;  2WFW A;  1V9P A;  2K28 A;  4B3T H;  4DR7 H;  2L1B A;  4R8I A;  4LF4 H;  3KK7 A;  2R7M A;  5KG4 A;  5JVL A;  4B3M H;  2K05 A;  4DL3 A;  3TDQ A;  3VR3 A;  1NE3 A;  4R8U A;  4RMF A;  4DV6 L;  1VMC A;  1HRJ A;  1CT1 D;  1JWU D;  1QWY A;  2LMC B;  3D3R A;  2JA6 B;  1JOQ A;  1OWT A;  3I4M G;  4JI8 H;  1GUO A;  2JN4 A;  4DFA A;  3UE0 A;  5LL6 X;  2N55 A;  2EXZ A;  2ENB A;  4LF7 H;  2W9B B;  4DGZ A;  3IN5 A;  2OCE A;  3MXN B;  4L8J A;  3BQ2 A;  2W9B A;  5KFD A;  3GTM A;  1TWC H;  3FKI H;  4P72 A;  3FRP B;  1UE7 A;  2J4X A;  3L4J A;  1NR4 A;  4JC0 A;  1N34 L;  1DON A;  1X3Q A;  2O4X A;  4HR7 B;  2F0J A;  3CCR A;  1HR0 W;  4YAK B;  1PA6 A;  5CV9 A;  5IGC A;  5EQ0 A;  3MR3 A;  5FD5 A;  4L5Q A;  4L1K A;  3GTM B;  4RB1 A;  3TS2 A;  1N36 H;  4KN4 C;  5M9O A;  5A2Q E;  5CAE B;  2FK1 A;  3HG9 A;  5M3M B;  1STB A;  2XWJ B;  2ATW A;  2NB0 A;  2QGQ A;  4BY1 B;  4DAM A;  3GIJ A;  2KEE A;  2K75 A;  2NVT B;  4R4I A;  2MP1 A;  4DR4 H;  3DWA A;  1CQF A;  5D65 A;  4G7Z C;  1XYI A;  2XN9 C;  1IHZ A;  4DV7 H;  2N8N A;  2B2Y A;  4PNY A;  5KFN A;  1S0M A;  3KDF A;  3RAX A;  1EY0 A;  1EY4 A;  1KRS A;  2KCT A;  4DL7 A;  4HMI A;  4A3J B;  3NHH A;  3NQT A;  3PO2 G;  3EPI A;  3GIM A;  2ASD A;  4XYO A;  3Q6S A;  3WWV A;  1B3A A;  1L0Y B;  2AWN A;  2KA7 A;  4WJ4 A;  2V59 A;  3E6Z X;  2GPW A;  3R5H A;  4IPC A;  3A5U A;  4GN3 B;  1Z6H A;  1TWG B;  2K50 A;  2PVP A;  1LTL A;  3FKI B;  2QEX A;  4I55 F;  1KNA A;  1Z2O X;  2A68 D;  2NUC A;  1S5C D;  1EIH A;  5KFQ A;  4XTC S;  1F9Q A;  2VQF Q;  3PVX A;  1K0R A;  3E5S A;  4RB2 C;  3RGZ A;  1HZB A;  2H4O A; 
#chains in the Genus database with same CATH homology
 3SGI A;  3NEN A;  3I55 A;  4DR3 Q;  1XPU A;  4JI4 Q;  1Q46 A;  2N3S A;  3PUW A;  4IJL A;  1KHI A;  4JBW A;  4DKA C;  1Q86 C;  1XNR Q;  3KJP A;  4DR4 Q;  1HNW L;  4BY1 G;  1PH1 A;  1TWG H;  3M4P A;  2JA5 G;  1W3S A;  1KL9 A;  2JQO A;  4O2D A;  1NMF A;  2Q2U A;  4LF7 Q;  1IL2 A;  4JOI C;  1VQD A;  2K5H A;  2UUB Q;  4A3D G;  5GRO A;  4NXM Q;  4DR3 L;  1VS0 A;  4LFB Q;  1HNZ L;  3TEH B;  3S2D H;  3HOV H;  1IXR A;  4MTN A;  2LXJ A;  4A3K H;  3K8A A;  1X3G A;  2ZM6 L;  3HOU H;  3S17 H;  4JI8 Q;  3KF6 A;  3PO3 G;  5HGQ A;  2F52 A;  4O0A A;  4GOP C;  1Y1W G;  1A8V A;  3M85 A;  1HNZ Q;  2JA9 A;  5C44 H;  4DV3 Q;  1BKB A;  4MZ9 A;  4DV5 Q;  4L5T A;  1N34 Q;  1TWA H;  2KHI A;  1QVG A;  1VQA A;  2NZO A;  5M3F H;  5IE8 A;  4NPS A;  4YWK A;  3OTO Q;  3E0E A;  2Z0S A;  2I5H A;  4IFD I;  3U58 A;  3TS0 A;  1YEZ A;  1P16 A;  1TWF H;  5FLM G;  3CF5 A;  3PUX A;  4DUY Q;  4A3C H;  2I5L X;  4EX5 A;  3CCS A;  1I94 L;  4P75 A;  2D0P A;  4YY3 L;  1X55 A;  3GD7 A;  1IBK L;  3S1M H;  3TRZ A;  1N32 L;  5LMN Q;  3PGZ A;  4IFD J;  1OXV A;  3U4V A;  1L1O A;  4JI2 Q;  3PF5 A;  5JJL A;  3CCE A;  3T1H L;  2VQE L;  2UUC Q;  1SR3 A;  1Q8K A;  2HIX A;  4GS3 A;  4MNO A;  2LXK A;  1K73 C;  2Z6K C;  4UPA A;  3M4O H;  4HJ9 A;  1CKN B;  2HT1 A;  5LMU L;  4AYB G;  4JI5 L;  4BY1 H;  2B3G A;  2VW9 A;  1CUK A;  3CXC A;  4DR2 L;  1PH9 A;  1Y1V H;  2CQO A;  1B7Y B;  3J81 j;  2GVA A;  3I2Z A;  4DK6 C;  2CCZ A;  4JOI A;  2B63 H;  2IX0 A;  2WB1 E;  1X3E A;  4A3K G;  4C3J H;  1NTG A;  1VQP A;  1WCM G;  1V1Q A;  3D31 A;  1YIT A;  1V43 A;  4QJF A;  2ZJR A;  4HIK A;  1K9M C;  1X65 A;  2ZTE A;  2JA8 G;  1VQ6 A;  3S14 H;  1FGU A;  2N49 A;  1EFW A;  3KFU A;  1UE5 A;  2JJQ A;  3E9H A;  3NEM A;  1YIJ A;  2CKZ B;  4B3R Q;  5C44 G;  4X64 L;  4OX9 L;  2BA0 A;  1RL2 A;  3GTK H;  3CPF A;  4C3H H;  1C7Y A;  3VDY A;  1PYB A;  3B6Y A;  5GQO A;  3HKZ E;  4JBK A;  4LF6 Q;  3STB C;  4GLV B;  1TWH H;  4YCW A;  4A3G H;  5FLM H;  3T1H Q;  1KXL A;  2NVQ H;  3CAM A;  1FJG L;  3ULP A;  3EN2 A;  4A3B H;  1SLJ A;  1IZ6 A;  2VS1 A;  1AE2 A;  3H0G H;  4IJH A;  4POF A;  4LF8 Q;  1XMQ L;  4IOA A;  4A3E H;  1N33 Q;  4JYA Q;  4JBJ A;  4YCU A;  4GOP A;  1YHA A;  5C0X I;  2JA6 G;  3H3V H;  4A93 G;  1OXS C;  4DUY L;  1YJ9 A;  2Q2H A;  1X54 A;  4JI0 Q;  3J80 i;  3J81 i;  2Z6K A;  4LFB L;  1JJ2 A;  3UDF A;  5JEA J;  5IYC H;  1VQC A;  1QVC A;  2R92 H;  3HFZ B;  1GKH A;  5HY6 A;  3G48 A;  3S16 H;  1OTC A;  5BR8 L;  2HHH Q;  1YBY A;  3E9I A;  2R93 G;  1E7Z A;  1Y1V G;  2EQS A;  1HNW Q;  3GTO H;  3HOZ H;  2F4V L;  1LYL A;  4UP8 A;  4L5R C;  4QL5 A;  5ELN A;  3H3V I;  2LSS A;  4JI3 Q;  5C3E H;  1YZ6 A;  2ZTD A;  4DV2 Q;  1HR0 L;  4GKK Q;  1WCM H;  1X9N A;  1I6H H;  2EXD A;  2DGY A;  4A3M G;  1XJV A;  1Z47 A;  3PUY A;  5IP9 G;  1VQM A;  2JA7 G;  1JJC B;  1EIF A;  4TVA B;  3EBE A;  4HJ8 A;  2UXB L;  2MO0 A;  1WFQ A;  4UP9 A;  1CSQ A;  3ULJ A;  3PF4 A;  4B3S L;  2H5X A;  4IPD A;  4DV2 L;  4YY3 Q;  4DR5 L;  2YV5 A;  2C35 B;  1VQ5 A;  4A3I H;  3M4Q A;  1IBL Q;  1Q82 C;  1ASY A;  3AFP A;  1K8A C;  2NVY H;  4IPG A;  5H1S E;  4OWW B;  3FHW A;  2OQ0 A;  2R6G A;  3Q8D A;  4NXN L;  4AQY L;  4IPH A;  1GO3 E;  1L0W A;  4AIM A;  4A3B G;  1AE3 A;  4LF8 L;  4L5S A;  1R9T H;  2Q2T A;  3H0G G;  2UUA Q;  2JE6 I;  2K5V A;  1N36 Q;  4A3E G;  4ALP A;  4BBR H;  3IRB A;  4B3T L;  1VQE A;  4P71 A;  2YTY A;  5E7N A;  1KAW A;  1G6P A;  4DV1 L;  1IBM Q;  1PFS A;  1HZC A;  4YCV A;  5IWA L;  4LF5 Q;  4Y52 H;  1J6Q A;  1PVO A;  2R7Z H;  2VL6 A;  2Y0S E;  3GO5 A;  1HJP A;  3K81 C;  4PG3 A;  4HJ5 A;  2R7F A;  4X66 L;  4DR2 Q;  3HKS A;  3NEL A;  3MEF A;  1XMQ Q;  1DGS A;  4X66 Q;  4QQB X;  2PI2 E;  1L1O B;  3RLF A;  5IYC G;  1QZG A;  4KHP L;  1FVI A;  2R92 G;  2E2H H;  3AQQ A;  4LF5 L;  3GDE A;  1UE1 A;  1C0A A;  1VQJ A;  2OTL A;  2PQA A;  1IYJ B;  1OXX K;  3S1N H;  2B29 A;  1IBM L;  3PO2 H;  4DR4 L;  4C3I H;  4DV4 L;  3A0J A;  3GTJ H;  2R93 H;  3CCU A;  4BA1 I;  4KHZ A;  3HOZ G;  2PQA B;  3M9B A;  3CC7 A;  1P8L A;  5C0X G;  4JI2 L;  2UXD L;  5FJ8 H;  2NVX H;  2MQH A;  2FXQ A;  3UE1 A;  3EIV A;  2I0Q A;  3GTP H;  1N9W A;  2F3I A;  5LMN W;  4A3M H;  3OYY A;  5IP9 H;  1SMX A;  1VQ8 A;  4GKJ Q;  1J5E Q;  4X6A H;  3KDF B;  5IT9 c;  2AHO B;  1PH5 A;  1EQR A;  1VCI A;  1JMC A;  3W5O A;  3I4M H;  2PMZ E;  4BXX H;  4P73 A;  2VZA A;  3JC6 6;  3ER0 A;  4QGU A;  3HOY H;  2YTX A;  2IY5 B;  3STB D;  2E2J H;  1BVS A;  2I5M X;  5M3M H;  2GN5 A;  2IHE A;  3A5Z B;  2EIF A;  4DAY B;  3AFQ A;  4AQY Q;  1VQN A;  2JA5 H;  4NXN Q;  3FP9 A;  1X56 A;  2ASB A;  3DM3 A;  4B3R L;  1A63 A;  1UEB A;  3PV0 A;  4A3D H;  3RN2 A;  2KBN A;  2IT1 A;  2UU9 L;  1VQL A;  4DNI A;  3HOX H;  4HID A;  3CCV A;  1M90 C;  4GN4 B;  3FKI G;  3HOV G;  2YTV A;  1EQQ A;  3F2B A;  3CPW A;  4DUZ Q;  4GNX C;  1UE6 A;  2VQE Q;  2RF4 A;  4UP7 A;  4LFC L;  2KEN A;  3OTO L;  1YI2 A;  4OWT B;  3F2D A;  4A3F H;  4IO9 A;  3GTL H;  3ICE A;  1W2B A;  3H15 A;  3BJU A;  3GTQ H;  1T9H A;  2WAQ G;  2CFM A;  2CWA A;  3UDI A;  3I4N G;  1KIX A;  2AMC B;  1Q1E A;  1C9O A;  1XTD A;  3CMA A;  4GOP B;  3GTM H;  1SE8 A;  3RLO A;  1YJW A;  5JJI A;  2K52 A;  5IYB H;  5LMU Q;  5M3F G;  4TQU S;  2BH2 A;  1EOV A;  4Y7N H;  2E5L L;  3RZD H;  4JI1 L;  1L2F A;  1WOC A;  3KF6 B;  2WB1 G;  3CQZ H;  4PZ6 A;  5BR8 Q;  5IP7 G;  3CD6 A;  2MNA A;  1S40 A;  2UXC Q;  2UUB L;  4R1J A;  4LF7 L;  1VQG A;  3D0F A;  1ASZ A;  3W1G A;  5M5W H;  4AYB E;  4AH6 A;  2PI2 A;  4JI3 L;  4HJ7 A;  1VQF A;  1CKO A;  3K80 C;  5M5X H;  1S72 A;  2MFI A;  3CC4 A;  4GLX A;  4B3S Q;  1MKH A;  4R4T A;  3HOY G;  3PCO B;  5JEA G;  2VUM H;  2UXB Q;  1X3F A;  1O7I A;  1FL0 A;  3L0O A;  5M3M G;  1VQH A;  3AYH B;  3RR5 A;  4ME3 A;  4JI7 Q;  3G71 A;  4DV3 L;  3RZO H;  1HR0 Q;  2JK8 A;  4BBS H;  4LFC Q;  4GKK L;  4BA2 I;  2E8G A;  2PNH A;  2ES2 A;  1I5F A;  1KRT A;  4PZ7 A;  3TQY A;  2OQK A;  4GN5 A;  5GAD C;  2NVT H;  1VQB A;  1JB7 A;  4OXP A;  1CSP A;  2VQF L;  4DV0 Q;  1KD1 C;  1K83 H;  1Y14 B;  1I3Q H;  3HKZ G;  3CCQ A;  1G29 1;  1NBW A;  1SRU A;  2R7D A;  4HJA A;  4A3F G;  2E5L Q;  2JEA I;  4GNX A;  2JA8 H;  5GAG C;  4LWC A;  1HNX Q;  4QY7 A;  1GD7 A;  4DV7 Q;  2BA1 A;  3I4N H;  1FJG Q;  2IX1 A;  1OXT A;  4YWM A;  4C2M H;  3HOU G;  1XNR L;  4A75 A;  1U0L A;  5IYB G;  4DPG A;  5FLX c;  5GAH C;  2OWO A;  4J15 A;  1PYS B;  3G6E A;  1N36 L;  1Q7Y C;  4DUZ L;  1J5E L;  1PH6 A;  4WJ3 M;  4X62 Q;  5ELO A;  5K36 G;  1XMO L;  2WAQ E;  3K7U C;  4R4C A;  1XMO Q;  2WP8 J;  3L2P A;  1YJN A;  4JI5 Q;  4A76 A;  2OTJ A;  2VY3 A;  1U5K A;  1XNQ Q;  5J3B A;  3CP0 A;  3PUV A;  3F2C A;  4LF4 L;  1B8A A;  1A0I A;  1LUZ A;  3UDX A;  1QVF A;  2KCM A;  1HZA A;  4R4O A;  4KI0 A;  2UUC L;  4LNQ A;  2JA6 H;  5C0X J;  4LF6 L;  2NN6 G;  4LUO A;  5IY0 A;  2NZH A;  3GTG H;  4LUV A;  3I4O A;  1WJJ A;  4GKJ L;  1NY4 A;  3F1Z A;  3NBH B;  3JAM c;  4B3M Q;  3CW2 C;  4LUZ A;  2VUM G;  5AJ3 Q;  4DR6 L;  1XNQ L;  1E22 A;  4DV0 L;  4HIM A;  4OON A;  2UXD Q;  1N8R C;  2YYZ A;  3AEV A;  4DR7 L;  3BU2 A;  4BBS G;  4JI8 L;  2VNU D;  1EIY B;  3PIP A;  1OXU A;  4IFD G;  5IYD G;  1I50 H;  1VQO A;  1EUJ A;  4BY7 H;  1RIP A;  1TXY A;  3M7N A;  3RLN A;  2Y0S G;  4LFA Q;  3PUZ A;  4A4I A;  3ULL A;  3CCL A;  4JI7 L;  2GVB A;  2JA7 H;  3J80 c;  1E24 A;  1HNX L;  4XIG S;  1I94 Q;  1EYG A;  1MJE A;  1D8L A;  2Q2I A;  5C4J H;  3PIO A;  2B63 G;  3S2H H;  4JI6 Q;  1E3P A;  4DV1 Q;  1XPR A;  3S24 A;  4PZ8 A;  5IWA Q;  3F8T A;  2HIV A;  2XGT A;  1YNX A;  3A74 A;  3I7F A;  1QZH A;  2UUA L;  4LF9 L;  3ERS X;  4YHH L;  2A8V A;  2AKW B;  4DV6 Q;  4DR1 Q;  3G4S A;  1IBK Q;  3KYH C;  4DR1 L;  4GLA C;  1CKM A;  5M5Y H;  4JI1 Q;  4OO1 G;  4JI4 L;  1JT8 A;  4UY8 C;  2F4V Q;  4JCV E;  3PSI A;  3RN5 A;  4JG2 A;  2JEB I;  1A62 A;  3K0X A;  4YWL A;  5C4X H;  4DR5 Q;  3RNU A;  1E1T A;  2CWP A;  4EQ5 A;  2HHH L;  4IOC A;  3TRE A;  4A3G G;  1L1O C;  2ID0 A;  2K5N A;  4X64 Q;  2RCN A;  4NXM L;  2R7Z G;  3L7Z C;  1JJG A;  3ZJY C;  3BZC A;  1SRO A;  2ALY B;  2RHQ B;  4A3L G;  2HQL A;  4JV5 Q;  2A19 A;  4A93 H;  1BBW A;  1MIU A;  3BZK A;  3JAM i;  1VQK A;  3S15 H;  2UXC L;  1E1O A;  2D62 A;  2RHS B;  1KC8 C;  1AH9 A;  1HZ9 A;  2K14 A;  3KJO A;  4RG1 A;  2YU9 H;  4FDB A;  4DR7 Q;  2WFW A;  1Q1B A;  1V9P A;  5IYD H;  4OO1 I;  2UU9 Q;  4JV5 L;  4BY7 G;  5FJ8 G;  1HH2 P;  2NN6 I;  2ZJP A;  2ZTC A;  4LFA L;  4B3M L;  4GNX B;  1LM0 A;  5EAY A;  3S1R H;  1NE3 A;  1M1K C;  4RMF A;  4DV6 L;  1KQS A;  1QUQ A;  4A3J H;  4JI0 L;  2A1A A;  4R4Q A;  1CKN A;  1Q12 A;  3I4M G;  1PH7 A;  1K8G A;  4APV A;  1H95 A;  1MJC A;  1Z9F A;  1K3R A;  2XTI A;  5C3E G;  4QIW E;  3UE0 A;  3OW2 A;  5LMN L;  1N32 Q;  1YHB A;  3U50 C;  4X65 Q;  4K0K Q;  2AWO A;  4POG A;  3KF8 B;  3J7A 5;  1G51 A;  2DUD A;  3S1Q H;  2QA4 A;  4K0K L;  4OWX B;  3UDG A;  1N33 L;  3HOW G;  4JYA L;  3W1B A;  2L15 A;  1QUQ B;  1PH2 A;  2OCE A;  3MXN B;  1PH4 A;  1EWI A;  1WI5 A;  4YHH Q;  4DV4 Q;  1VQI A;  1X6O A;  3HOX G;  1TWC H;  3CCM A;  5GAE C;  2D0O A;  4DK3 C;  4A3I G;  1VQ7 A;  3FKI H;  4P72 A;  1UE7 A;  1NMG A;  5C4X G;  4PMW A;  4P74 A;  1BBU A;  4OX9 Q;  2K4K A;  1PV4 A;  4JC0 A;  4DV5 L;  1N34 L;  1GM5 A;  3J7Z C;  3CCR A;  1HR0 W;  2IHF A;  1YVC A;  1PA6 A;  4KHP Q;  1VQ4 A;  1PH8 A;  2ZJQ A;  3LGJ A;  4HIO A;  1XPO A;  1D7Q A;  1S3O A;  4L5Q A;  4BBR G;  3TS2 A;  4A3L H;  1PHJ A;  2ZM6 Q;  1PH3 A;  3PO3 H;  2ATW A;  1UWV A;  2MO1 A;  2QGQ A;  3CCJ A;  4DAM A;  3T1Y Q;  3T1Y L;  4LW1 A;  1Y1W H;  2K75 A;  2KHJ A;  4R4I A;  3DLL A;  2BH8 A;  3KOJ A;  5IP7 H;  4JBM A;  1VQ9 A;  2V1C C;  4KLK A;  4DV7 L;  1YHQ A;  1JE5 A;  3I56 A;  2N8N A;  3KDF A;  5AJ3 L;  4DR6 Q;  3KLW A;  3CC2 A;  1KRS A;  2E2I H;  2KCT A;  3K7A H;  3J81 c;  2N78 A;  1NJI C;  3PO2 G;  4A3J G;  3M3Y H;  1IBL L;  4A3C G;  3WWV A;  2AWN A;  1B70 B;  4WJ4 A;  3CME A;  5DLQ E;  1SN8 A;  4IPC A;  3A5U A;  4B3T Q;  1GVP A;  4GN3 B;  4H02 A;  1WYD A;  1SFO H;  2K50 A;  4LF4 Q;  1LTL A;  4NB3 A;  2QEX A;  4LF9 Q;  5JJK A;  3HOW H;  4XTC S;  4X65 L;  4BXX G;  1Q81 C;  4X62 L;  3U4Z A;  2VQF Q;  1K0R A;  1HZB A;  4JI6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...