4A3KG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3kG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3kG01
1C9OA 3ZJYC 1XNQQ 4GN4B 5M3FG 4A3MH 1JMCA 4QQBX 1UE7A 4AQYL 4ME3A 1I5FA 3RZDH 4IPCA 3S1RH 3J81i 4DR7L 2YTVA 4JI1Q 1IZ6A 4HJ7A 4PMWA 4A3IH 2R92H 1LM0A 4DV4L 4P74A 4JI3Q 5FLXc 4Y52H 1CSPA 1CKNA 4PZ7A 1MJEA 1QUQA 1N33Q 1PYSB 2KHJA 3KF8B 4YHHQ 4LF6Q 4OWWB 4JI1L 5IYCG 4DR4Q 1GKHA 1X55A 2N8NA 1SROA 4NXMQ 3RR5A 2LXKA 5IP9G 1VQMA 1G291 5GAEC 1K73C 1KRSA 2HQLA 1EIFA 2RF4A 2CWAA 1A8VA 3Q8DA 2BA1A 2K52A 3CCJA 5LMNQ 4ALPA 2H5XA 3GDEA 1XMQQ 2B63G 2YYZA 3U58A 1XPUA 3PCOB 2R93G 2IY5B 1BKBA 4LFAQ 4LUZA 1VQEA 4C3JH 2ZJQA 4A3GG 4LFCL 4BBSH 4KHPQ 2VNUD 3NELA 4OX9L 1B70B 1P8LA 2PI2A 3ULLA 2UUBL 5IE8A 1M1KC 3ULJA 2UXDL 1CKOA 3EBEA 2OTLA 1N34L 3EIVA 4X64Q 1YITA 3U4ZA 2ZJPA 4DUYL 2E2JH 1SRUA 3PUWA 4DV1Q 2GN5A 3CMEA 1CSQA 2ZTCA 2VQFQ 3T1HQ 1YI2A 1UEBA 3KFUA 1K8GA 3J7ZC 3W1BA 4DV3Q 1KC8C 4HIDA 3CW2C 3FHWA 1QVGA 4L5SA 1N34Q 1VQDA 3STBC 4A3JH 4R4IA 4X6AH 4IJHA 4C2MH 3F2DA 1XPRA 1FL0A 5IP7H 1R9TH 2JA6H 2HIXA 2UUCQ 2Z6KC 1NBWA 2NN6I 4IFDG 4A3KH 1A63A 5C4XH 1VQHA 2WFWA 1N36Q 4HJ8A 1VCIA 3GTOH 4JI5L 4JOIA 4RG1A 5HY6A 1Z47A 4QY7A 1IYJB 2ES2A 2ZTEA 1Q1BA 2WAQE 2VS1A 5FLMG 2E5LQ 4X62Q 2R7ZG 1K0RA 1TXYA 3PUYA 3J80i 4DPGA 4XIGS 4LWCA 4JI7L 1Y1VH 3I7FA 4UP9A 4A3FG 3D31A 2VQFL 2JA8G 3E0EA 4R1JA 3TS0A 4JYAQ 1EWIA 1VQ6A 1RL2A 4X65Q 3PO2H 3SGIA 1VQ9A 2YV5A 4DR2L 1Q81C 4A3CG 2R7DA 3HFZB 1CUKA 2EXDA 4LUOA 4LFBQ 2R7FA 3RLOA 3ER0A 4P75A 2Z0SA 4LF5Q 4LF9Q 4JV5L 4BY7H 2JE6I 4UP8A 1SR3A 1U0LA 3FP9A 3B6YA 5LMUL 2CWPA 3GTQH 4WJ3M 4LUVA 5M3MH 2UUBQ 3M7NA 3GTGH 1HZAA 1PFSA 3BJUA 2ALYB 3CC2A 1HR0L 4LFAL 3S17H 3CAMA 4APVA 1J6QA 2D0OA 2E8GA 1I3QH 2GVBA 3AFQA 5ELNA 5C0XG 2ZM6Q 1GVPA 1Q1EA 2K14A 3GO5A 1VQCA 3K7UC 2B3GA 3I56A 4DV5L 2D0PA 1UE5A 3HOVG 2MO0A 4X64L 1TWGH 2QEXA 2JK8A 1Y1WH 4UY8C 5C3EG 4JI2Q 3PO3H 1YZ6A 3F1ZA 4LF7L 5C3EH 3M9BA 4X66L 4HJ9A 4A3LG 3IRBA 4L5TA 2VZAA 1OXVA 1E3PA 4WJ4A 2IHFA 4NXNL 1VQIA 3PUZA 4DR5Q 4A3EG 4J15A 5AJ3Q 5GROA 4GKKL 4MZ9A 4DK6C 3CC7A 2ZJRA 4DR7Q 4GN5A 3RNUA 1VQLA 3TEHB 1AE3A 3D0FA 4OONA 4PG3A 2VY3A 1NY4A 3HOZH 4DR3Q 4GOPB 1X3GA 1XNRL 1UWVA 5E7NA 4HIMA 2N78A 3A5ZB 3E9IA 4P71A 3KF6B 1Q7YC 2MFIA 5BR8L 3F2CA 3KYHC 4OX9Q 5H1SE 4JC0A 3RLFA 1Q82C 3UDGA 4LFBL 3HOWH 2UUAL 1PHJA 5IWAL 1IBLL 3CXCA 4POGA 1S3OA 1IXRA 2Q2UA 4B3MQ 1I50H 1VQKA 4A3EH 4BBRG 4OO1I 3PV0A 3BU2A 4LF4Q 2IX1A 3H3VI 5IWAQ 1IBLQ 1HNWL 4KLKA 1B8AA 3RN5A 4A75A 2JA7G 1YEZA 4KHZA 3GTKH 3PO3G 2IHEA 3F2BA 4GLXA 1PVOA 2JA5G 1Y1WG 1JB7A 3H15A 4DV7L 3W1GA 3HOVH 1V1QA 4JI4Q 3HOYG 2UXBL 1VQAA 5DLQE 4JI8L 1NE3A 3AYHB 1VQ7A 1KQSA 4JI0Q 1KHIA 1X65A 4C3IH 3K80C 2Q2TA 3GTPH 3HKSA 1E22A 3CCSA 4DV4Q 1WCMG 4QL5A 4YCVA 3H3VH 3S1QH 4JYAL 4LF8Q 4DV0Q 2UXBQ 4JI5Q 1VQ5A 4GKJQ 4TVAB 1K9MC 1AE2A 1SLJA 2OTJA 1KAWA 4Y7NH 3G4SA 2KCTA 3HOUG 4XTCS 5HGQA 2R93H 2VL6A 4GKJL 1D7QA 1LTLA 3PO2G 1LYLA 4BXXH 1C0AA 3L7ZC 3K8AA 4LF8L 4A3FH 2F4VQ 4DR6Q 1TWFH 1QZGA 3CQZH 1HR0Q 1BVSA 4L5QA 2VQEL 2N3SA 4POFA 2QA4A 3VDYA 2R7ZH 4B3ML 4IO9A 2LXJA 5FLMH 3CP0A 4DV5Q 3L0OA 3I2ZA 3HOYH 2UXCL 1YHBA 2HHHL 4GLAC 1HJPA 4UP7A 1A0IA 2B29A 2BH8A 5C0XJ 5C4XG 4B3RQ 3PF5A 3JAMc 3OTOL 5JEAJ 1EFWA 1AH9A 2JA6G 4OWXB 5IP7G 1VQ8A 2R92G 4A3IG 5JJKA 2VW9A 2L15A 4EQ5A 1E1OA 2OCEA 2VQEQ 4A3JG 1HNXL 2N49A 2PMZE 4GOPA 1X56A 5ELOA 3RLNA 1XMOQ 2FXQA 2OQ0A 4DR4L 3G71A 4LF4L 4A3MG 5M3FH 4BXXG 2WB1G 4GKKQ 1YBYA 3KDFA 1EUJA 1U5KA 3GTLH 3HOUH 1SMXA 2BA0A 1S72A 4JBKA 1PH3A 2JEAI 3M4PA 4IOCA 5J3BA 5IT9c 2NZOA 2ZTDA 4NXML 3HOWG 1YJNA 1PH2A 1Q12A 3EN2A 1UE6A 1G51A 1VQ4A 1WYDA 3CMAA 3S1MH 5GQOA 4DR5L 1L0WA 1WCMH 3G6EA 3HOZG 4LFCQ 3S1NH 3GTJH 4QJFA 2ZM6L 2MNAA 3CCEA 2XTIA 1VQNA 4JBWA 2I5HA 5IYCH 3MEFA 4HJAA 1C7YA 1KRTA 3UDIA 3I55A 1N33L 3HOXG 3RZOH 3J7A5 2ID0A 1XTDA 1N8RC 1HR0W 1YNXA 2JA5H 3OYYA 1QUQB 4YY3L 3AQQA 1KIXA 4QIWE 3HKZG 3UE0A 4MTNA 2JA7H 4HIKA 2PQAA 4GLVB 3CPWA 1I94Q 2CCZA 4YHHL 1VQBA 2WAQG 5LMNL 3J81j 5C4JH 4NXNQ 4FDBA 4X65L 2KCMA 4NPSA 4BBRH 2Q2IA 4X66Q 1VQGA 1HNWQ 1IBMQ 3U50C 4GS3A 2IX0A 2IT1A 4X62L 5M5WH 4LF5L 2UXCQ 2UXDQ 4B3TL 1EQQA 1K3RA 1N9WA 4PZ8A 3PUVA 2NVYH 2PQAB 2RHQB 1S40A 4R4OA 4OO1G 4YCUA 3TREA 1L2FA 2K5NA 1J5EQ 1MJCA 1SN8A 4C3HH 5K36G 4YWKA 5M5XH 1FJGL 3MXNB 2C35B 4O0AA 4A4IA 1BBUA 3RN2A 3ULPA 3J81c 1K8AC 4B3SL 4PZ6A 4AQYQ 2JJQA 1NJIC 1HNZQ 1FVIA 4JI3L 3UDXA 1PH5A 3M3YH 3S15H 4DK3C 5M5YH 1IL2A 3AEVA 4DV6Q 1JJGA 2JA8H 4L5RC 1FJGQ 2YTYA 2DUDA 1OTCA 4DR3L 3CD6A 4A3LH 1PH1A 2EQSA 3A74A 3NENA 2YU9H 3PF4A 1ASZA 3KF6A 3BZCA 1EQRA 1TWAH 3CCLA 1OXTA 3K81C 2ATWA 1RIPA 4A3KG 4AYBE 4LF7Q 4JI8Q 1X54A 4JV5Q 1N32Q 2AWOA 1YJ9A 4JI7Q 1EOVA 3JAMi 2PI2E 3CCMA 4DV7Q 4DR2Q 4DR1Q 2E5LL 1MIUA 5FJ8G 1L1OA 4KI0A 5M3MG 4JI6L 4A93H 3S16H 3NBHB 1I94L 1QVCA 1GD7A 2RHSB 1JE5A 1N32L 3UE1A 4DV1L 2KHIA 3T1HL 2NVTH 1IBML 1PH4A 4DUZQ 4BY7G 5JJIA 3S14H 1HZ9A 2UUCL 4P73A 3JC66 1M90C 4JI6Q 4JOIC 4A3CH 1H95A 2OWOA 2EIFA 1HZBA 3HKZE 4A3GH 4DR1L 1K83H 1HH2P 2JEBI 3NEMA 4DNIA 4GNXB 4TQUS 2B63H 2UUAQ 1VQJA 1A62A 4H02A 3I4NG 2KBNA 4LF6L 1XJVA 1OXUA 1Y1VG 2RCNA 4OWTB 4NB3A 1P16A 1G6PA 3KOJA 4B3SQ 5IP9H 1PH7A 5IYBG 5LMNW 2F4VL 2DGYA 5JJLA 2GVAA 4IPHA 4KHPL 5IYBH 4MNOA 2Y0SG 3WWVA 3ICEA 3T1YQ 1VQPA 3S2HH 2K50A 5AJ3L 1YHQA 4K0KL 1KXLA 4IOAA 1XPOA 5GAGC 1O7IA 4IFDJ 3G48A 1BBWA 4A3BH 3STBD 4DV3L 4LF9L 3CCUA 5IY0A 1ASYA 4YCWA 1OXXK 1D8LA 3PUXA 3M85A 4DUYQ 1WFQA 2WB1E 2K4KA 2BH2A 4A3DG 2PNHA 1NMGA 1YHAA 2AMCB 1SE8A 2A19A 3I4OA 2JQOA 1FGUA 2A8VA 3GD7A 4B3TQ 3E9HA 3KLWA 1V43A 1WI5A 2VUMH 4BBSG 1CKMA 1VS0A 2I5LX 2I5MX 2E2IH 4A93G 4IPGA 4JBJA 3CCRA 3PIPA 2E2HH 4A3BG 2WP8J 2AWNA 2XGTA 4AH6A 1HZCA 3BZKA 3ERSX 2UU9L 1QVFA 1KL9A 3K7AH 4JCVE 2KENA 4OXPA 4O2DA 1YVCA 2R6GA 4DUZL 1E24A 1E7ZA 2Q2HA 3KDFB 4UPAA 1KD1C 1Y14B 1N36L 1TWHH 1XMQL 4IPDA 1LUZA 2HHHQ 4DV6L 2YTXA 1PV4A 1IBKQ 3I4MG 1X3EA 4DAYB 3S2DH 4IJLA 3KJPA 2NN6G 2F3IA 1PH8A 4IFDI 4B3RL 1L1OC 2HIVA 1XNRQ 4JG2A 4RMFA 4R4CA 3I4NH 4HIOA 1CKNB 1UE1A 2MO1A 1I6HH 4QGUA 5BR8Q 1T9HA 2V1CC 2Z6KA 1MKHA 4DV2Q 1TWCH 2K5VA 4R4TA 3K0XA 4LW1A 5JEAG 1Q8KA 3DLLA 1L1OB 1YJWA 4JI0L 4K0KQ 1Q86C 4A76A 3CCVA 5LMUQ 4DAMA 3M4OH 1PH6A 4JI4L 1OXSC 5EAYA 3OW2A 3T1YL 4BY1H 4BA1I 1X6OA 1GM5A 1HNXQ 5IYDH 2HT1A 1PA6A 3CF5A 3LGJA 4DKAC 3U4VA 2ASBA 3PSIA 1WJJA 5FJ8H 3GTMH 1V9PA 4P72A 5IYDG 3FKIG 2CQOA 3H0GG 4DR6L 1PYBA 4YWLA 2K75A 3AFPA 1PH9A 4GN3B 1EIYB 4GOPC 4EX5A 3W5OA 3TS2A 4AIMA 1NTGA 3A0JA 2D62A 3UDFA 5C44H 2I0QA 1VQFA 3PGZA 1NMFA 4GNXA 2OQKA 1JJ2A 4JBMA 2LSSA 2CKZB 2AKWB 1GO3E 4GNXC 1W2BA 4YWMA 2F52A 1E1TA 3J80c 2AHOB 1J5EL 1JJCB 1XMOL 5GAHC 3TQYA 4LNQA 1Q46A 2JA9A 4DV0L 3HOXH 4HJ5A 2NZHA 4R4QA 3I4MH 3L2PA 1XNQL 1IBKL 1DGSA 3CCQA 1Z9FA 1HNZL 1YIJA 3OTOQ 1VQOA 2UU9Q 5C44G 2A1AA 1WOCA 1QZHA 1W3SA 2K5HA 3M4QA 4YY3Q 5GADC 3PIOA 3CPFA 1B7YB 2QGQA 3H0GH 2MQHA 3FKIH 4BA2I 1X3FA 4DV2L 2NVXH 3KJOA 1JT8A 3S24A 2VUMG 1EYGA 2NVQH 3F8TA 4JI2L 3CC4A 3TRZA 4BY1G 3DM3A 4AYBG 5C0XI 1SFOH 3A5UA 4A3DH 2Y0SE 2CFMA 1X9NA
chains in the Genus database with same CATH superfamily
1C9OA 2BDOA 4GN4B 4A3MH 1V1OA 3DHQA 1I6VC 1I5FA 1SE2A 2B2UA 3I90A 3RV4A 3J81i 2B63B 4DR7L 3MFHA 2R8IA 4JI6H 1W6KA 1IZ6A 4PMWA 4FBTA 3GTMA 3RB6A 3JSLA 5KT6A 4DV1H 4CC5A 2QCPX 4HNTA 3PZPA 1CKNA 4PZ7A 2GLTA 4IWYA 4YHHQ 4LF6Q 1LACA 2R85A 5IYCG 4RKBA 4DR4Q 1GKHA 5D65A 1E2WA 3RR5A 4DR1H 1VF5C 1G291 2JXMB 2W6QA 4QWBA 3MWDA 1EQTA 3UI2A 4DK1A 1KRSA 3HRZC 3Q6SA 4IR9A 1A3UA 1A8VA 2K52A 4LF6H 3CCJA 4K2KA 2YYZA 1XPUA 5BPFA 4LAAA 1VDZA 1BKBA 4C3JH 3K5MA 2ZJQA 4A3GG 4BBSH 1G2TA 5HURA 1B70B 4DL5A 3ULLA 5D3IB 1EL0A 1M1KC 2ASLA 5I2XA 2OTLA 3EIVA 3GTKA 2ZJPA 4DUYL 1Q8IA 1SBBB 1SRUA 2WB1B 3T1HQ 4YAKB 4ED2A 1JWSD 2VA3A 1QE6A 5KFZA 3L9AX 3V6JA 3FHWA 4L5SA 1N34Q 4HCSA 4R4IA 2V59A 5IGFA 3KLSA 3F2DA 1NSNS 2OEOA 2K7VA 3S16B 1STAA 2UUCQ 1A63A 4EQNA 2VUMA 3GTOH 4MHEA 4F4ZA 1X3PA 5A2QE 3NK9A 5HY6A 4QCLA 2F4IA 3E3XA 5CC4A 2W6NA 2CH4W 4X62Q 1K0RA 1TXYA 1TKWB 3PUYA 3J80i 4DPGA 1LT4D 1PZJD 1EY7A 5KEEA 2W70A 5L1LA 4DL4A 3D31A 3BS1A 5KFJA 4JYAQ 3Q8SB 1EWIA 2F0FA 1RL2A 4X65Q 4KKTA 4BBRB 2OT2A 4DUZH 3SGIA 4UCOA 4G3IA 3GIPA 4A3CG 2HCCA 1QOHA 1CUKA 2I46A 4DAVA 1N33H 3ER0A 3L3OC 4N8X1 4P75A 2AUKA 4JV5L 2VUGA 3JRXA 4XDXA 2W9BA 3SXHA 1WH2A 1Y1WB 1HQMC 4BBSB 4LUVA 5M3MH 2F0JA 4YHHH 3BJUA 2F03A 1HR0L 2R61A 2L12A 3S17H 3CRLC 2R7NA 1J6QA 1L0XB 1PZID 4GNXA 2B63A 1YNNC 3T4AC 3I56A 4DV5L 3I4NB 1S5DD 4OL7A 3BDLA 4OIKA 4X3UA 5EGTA 5DG7A 2L4NA 1Y1WH 4FF1A 4UY8C 4A3JB 3GTQB 4X62H 4ZAIA 3KF8A 4JI2Q 1U4PA 1DOMA 5DQIA 2NU8B 3M9BA 4HJ9A 5J2TF 3UFXB 5CA1F 2ZJTA 3I72A 2IHFA 2VUMB 4NXNL 2IA6A 5FO9B 5GROA 1S0OA 3F8NA 2EVBA 2XIWA 3TEHB 5IT9W 1AE3A 1SJED 2E2DC 2K33A 4OONA 3TDQA 2R8GA 3GTKB 3HBLA 1D5MC 2F0PA 4LJZC 3SE0A 4GOPB 1XNRL 1UWVA 1TWAB 5K36H 4ED8A 2E74C 4DR3H 1XMOH 4MTEA 1Q90A 1KBLA 1JXLA 2MFIA 5BR8L 4DL7A 3F2CA 3KYHC 3OUZA 3RLFA 3H4BA 3HOWH 5IWAL 1IBLL 4JV1A 3S2HB 2Q2UA 1I50H 4BBRG 3SHLA 3KALA 2G9HD 4QUFA 4LF4Q 2RDGA 4U68A 3H3VI 1SNPA 1G6ZA 1EEID 2EJMA 3GTKH 4KHZA 1PTOD 3GLKA 1N32H 1PVOA 3NQIA 4TQRA 1PFMA 4DFAA 4RGMA 5C4XB 4DLKA 2O5IC 3DXJC 2DY7A 5M3MB 3J81W 2XGPA 1T5EA 2W9AA 3RJ0A 5D14A 2ASDA 4JI0Q 2B2TC 2NTTA 4C3IH 4J9OA 1GJXA 2Q2TA 1MSHA 3HKSA 1E22A 4DXFA 3CCSA 4OEMB 1B33N 4LF8Q 4DV4H 1VQ5A 1ZETA 2CQYA 2JA7A 1K9MC 3IAYA 2W6OA 4QWDA 5DM63 1VBHA 1AE2A 3OWFA 3RB3A 2OTJA 4KHPH 3TP5A 3G4SA 1ET9A 1KDCA 3GV3A 4EBEA 4J9RA 1LTLA 1LO5D 4ED7A 1LYLA 3L7ZC 2RDJA 1U9RA 3K8AA 2DLNA 4RAYA 3TP7A 1CE8A 3NUCA 1ENAA 2N3SA 2QA4A 3MFGA 2R7ZH 4LF9H 4MIUA 1B4OA 2YZGA 3CP0A 3PMFA 4DV5Q 4OX9H 5JQWA 1D5ZC 2HHHL 2E2IB 4GLAC 1PFNA 3A7LA 1A0IA 2B29A 4RB1A 4KY5A 5C0XJ 4QMGA 1HUNA 2A68C 1KAAA 1S4ZA 2JA6G 3OIQA 5IP7G 3H0GA 5JJKA 2EYFA 4GOPA 2DIKA 5JOBA 4J9NA 1T94A 4DR4L 2OQ0A 2L5TA 3G71A 3EA6A 1WTXA 4FXGC 4GKKQ 4BXXG 1YBYA 3KDFA 4XQQA 5EWEA 4O3RA 1U5KA 2O4XA 1SMXA 1S72A 1PH3A 3M4PA 5J3BA 4LMQD 4DV6H 1S5ED 1I6HB 1YJNA 4FF4A 1K83B 3EN2A 2RVLA 4L8JA 4UCVA 1UE6A 3N42B 4XYLB 1VQ4A 1WYDA 2R87A 3HOVB 2B2WA 5D1OB 3CMAA 5GQOA 1I4HA 2R7ZA 1L0WA 1WCMH 3G6EA 2QW7A 3MTSA 2JA7B 3DM1A 1SYCA 4LFCQ 1TWFA 1F9QA 1HRJA 2MNAA 1EWCA 4QB4A 5HGTA 1HQRD 4JBWA 4YP3A 2I5HA 5EBCA 1FYCA 1H9SB 4HJAA 3T5HA 4JI4H 3MXGA 3TSSA 5AFWA 2B2YA 3R5HA 5COYA 1KIXA 3UE0A 3RF2A 4MTNA 1CQVA 4HIKA 5L1IA 3HKZB 2CCZA 2PPBC 5KFPA 4J9QA 3NGDA 3J81E 1DONA 1PK8A 1HR0H 5LOVF 2DPJA 2KSWA 5LMNL 2AGPA 4RZRA 4K2LA 2KCMA 2Q8IB 3G6YA 4X66Q 1HNWQ 2J6SA 3H0GB 5KYLA 2IT1A 3H94A 4B3TL 1K3RA 4PZ8A 2UVUA 2E75C 1SMYD 4QUCA 2NVYH 2RHQB 1BXTA 3GP7A 2V5AA 1V4YA 5KFNA 4ABNA 2K5NA 4C3HH 3MXNB 1DXMA 3ORQA 1K8AC 3J81c 4FNFA 2PBZA 2JJQA 4BWGB 4K5XA 4C5AA 2PNRC 1A3TA 3BQ2A 2W6MA 1JJGA 3TINA 1KNEA 1XNRH 1FJGQ 2AQ4A 3WO0A 4QW9A 4A3LH 4ED1A 2W71A 2KEDA 1M4VA 2EQSA 4DN4M 3PF4A 3BYYB 5BR8H 3BZCA 4A2BA 1UEAB 4KD3A 5IWAH 1IBLH 4ETSA 3MWMA 3S14B 2SNMA 4JI8Q 4JV5Q 2AWOA 1B2TA 1RYRA 1EOVA 3ND9A 5A35A 3JAMi 3CCMA 4DV7Q 1M0TA 4DR1Q 4WFN3 1BCPD 4YAJB 3K5LA 1HNWH 4A93H 2K04A 3S16H 5J1ZA 2F0QA 1GD7A 2RHSB 1N32L 1SYFA 1S97A 5C4HA 5IODA 5JJIA 2WYOA 3K7AB 1FGBD 4P73A 1Y1WA 1M90C 1ZQ7A 4JI6Q 1G8ZD 4EFEA 2EIFA 4A3GH 4C3JG 3M7GA 1HH2P 3C1EA 4NW2A 1CQIB 1F2YA 4H13C 3JSNA 2UUAQ 1VQJA 1SSOA 3OHXC 5KFKA 2LS01 4NB3A 5F9NA 1V1PA 1SNCA 2MPMA 4YB8B 1ZEQX 4J6HA 1I7NA 5LMNW 4LFCH 5KFWA 1CA5A 2GVAA 2W7OA 3ONAB 4IPHA 1MBYA 5LYJF 1WVLA 1PTOB 3SK6A 1IKLA 2F0KA 3KK7A 2B2VC 4MNOA 5EBDA 3BAAA 3CVZA 3OHAA 4GKJH 1C3OA 1KLGD 3K0YA 5ELDA 4IOAA 3ETJA 4C3IB 1H9JA 4ECZA 2VQEH 2YZNA 3STBD 1PFBA 1ASYA 1VBGA 1OXXK 5D1OA 1MI2A 3MXUA 3PUXA 5NUCA 1F77A 2Z9HA 3A55A 5EZYF 4A3DG 3T5KA 1NMGA 2A19A 2RDHA 3FDTA 3D8GA 1CI3M 3VR2A 2XWBB 3TQTA 1WI5A 1VS0A 2I5LX 1F2LA 1R9TA 2UU9L 1QVFA 1B53A 1KL9A 1K1QA 3NTKA 3TP8A 2N55A 3K7AH 1W93A 3MA2B 4DR4H 2FMMA 2KENA 4OXPA 2FE3A 5KG5A 2J0TD 1E7ZA 4TQSA 4IPDA 4DR2H 2HHHQ 4NXMH 2B8FA 1A9XA 2KJXA 4IRKA 3I4MG 2IL8A 4CC6A 4IJLA 5LL6S 4IFDI 5I4DA 1PH8A 2L11A 2EY1A 1XNRQ 5LMUH 3GV7B 2N88A 4CGYB 4JG2A 1V1PB 5KFHA 3I4NH 4Q8EA 2DWCA 2CQAA 4QGUA 4RFBA 5ELCA 4HTHA 3H4DA 3K0XA 5JEAG 3DLLA 1AUXA 1TA8A 4K0KQ 2G5DA 5LMUQ 3GTLB 4DAMA 4JI4L 1OXSC 5EAYA 3T1YL 1SFOB 1I4PA 1HNXQ 5L1KA 2HT1A 4CDFC 3LGJA 1VMCA 2RDFA 1PTOC 2PW5A 4X66H 3MEHA 5LMNH 4YWLA 4C3HB 4Q43A 3H20A 3W5OA 1D1IA 2VR1A 3S1NB 3GTJA 2VB2X 2BCOA 3UDFA 4JBMA 1JJ2A 4NLGA 2DZDA 2CKZB 4MN3A 2ICEC 3CHBD 1W2BA 4B3TH 3H3VC 2YCHA 5ELEA 1NAPA 2I07B 3K6OA 5IOCA 4ED3A 2XSCA 2NZHA 3FKIA 4LFBH 4KD4A 1EYAA 1HNZL 2A6HC 4KV6A 1E4EA 3CU7A 2KEEA 2C28A 1WOCA 1XXGA 1W3SA 4J9KA 4ECVA 3X3NA 3VA7A 2A5HA 2F0DA 2QGQA 2MQHA 4DV2L 2EYLA 1IOVA 3S24A 4DL2A 1EHIA 1GUGA 4OELB 5IGCA 3KBGA 3DM3A 1SFOH 3A5UA 1ZHSA 4XYQA 1X9NA 5M5XB 3ZJYC 1XNQQ 2UXBH 4AQYL 4ME3A 1D5XC 1TWFB 3HXLA 5FPOA 3LP8A 3QOLA 3RZDH 1STGA 1JR0D 3K3VA 2YTVA 5C6AA 4JI1Q 1TAEA 2R93A 2HDMA 5KNCA 4P74A 5FLXc 1M8AA 1CSPA 3P75A 1KEEA 4IURA 1QUQA 3RD4A 4XQJA 4U6PA 4RGOS 4JI1L 4FYDA 4QWAA 2N8NA 5IP9G 1KJ9A 1VQMA 4TV8F 5JH7F 1GHKA 1M0WA 1K73C 2HQLA 5A2QW 2RF4A 4EQOA 1TWCA 3Q8DA 2BA1A 4ALPA 4A3MB 1PDQA 1XMQQ 2B63G 1HTPA 4B3MH 4LFAQ 4LUZA 1VQEA 2EYOA 4M8AA 4KHPQ 4LFCL 3D4DA 3ULJA 4EFBA 5EOYA 3K5HA 2DNEA 3BABA 1YITA 1TWHA 2GN5A 4NP5A 3J7ZC 1HNXH 3I73A 3OMGA 1SNOA 1VQDA 5BPHA 3FMAA 3U9TA 4X6AH 4DV3H 1TR5A 4C2MH 1XPRA 5IP7H 1HA5A 2JA6H 2VQDA 5KFGA 2C2DA 1LT6D 2FJZA 2ZDHA 1N36Q 3D4WA 4HJ8A 1VCIA 1H9MA 1IYJB 2ZTEA 2WAQE 2VS1A 3KHHA 2VB3X 4XIGS 4LWCA 4JI7L 1Y1VH 3HOZB 1AFPA 2RDIA 3LNNA 4R1JA 2F0IA 2C00A 2ZM6H 2FMCA 3NTIA 1Q81C 1SNQA 4N9PA 4LFBQ 2R7FA 1KLUD 1SYEA 3J80E 4FF2A 4FS2A 4LF9Q 4FBUA 4BY7H 1FNVA 1U0LA 2IWHA 5LMUL 1HPCA 3JAME 3K58A 4PMBA 2UVRA 2UUBQ 2EY5A 3GTGH 1JIHA 4QW8A 1PFSA 4XX0B 1NR2A 2EPBA 4APVA 2BQUA 2D0OA 3LWEA 3MHBA 5ELNA 4X65H 4IUTA 3LWUA 2ALZA 2B3GA 2D0PA 3IN5A 4UHVA 2NYZD 1UE5A 3HOVG 4JV0A 4A2AA 4ODGA 2MO0A 3T1YH 2FLLA 2V4QA 1PTOF 2XRQD 1Y69U 3VYRA 1AZPA 3GQCA 1E2VA 1FD7D 4LF7L 1N48A 3U9SA 1UNNC 4IALA 1A15A 1WTRA 2FPPB 2M9VA 4RNNA 2Y0SB 2KECA 3IRBA 2EYMA 4WJ4A 2FLNA 4M1UB 4GKKL 4J15A 5LA6F 4YR0A 4ZYSA 1RK6A 2OH2A 1B9NA 2CW0D 2K5DA 1NY4A 4KKUA 1L2ZA 1AZQA 4EBDA 1J5EH 3QWNA 3H09A 4RB0A 4OX9Q 5H1SE 3BYTB 2XC9A 5DAUA 1IBKH 3Q24A 3CXCA 3N8DA 1FR3A 4A3BB 4IUQA 1Y8OB 2FB9A 3VPDA 3PV0A 2V4RA 5CV9A 2IX1A 4I4TF 3D6WA 2FPGB 1TY0A 3QJYA 2JA7G 2NWGA 4CHTB 1I94H 2MUYA 1B04A 1Y1WG 1JB7A 2LFNA 2WINB 5DLQE 1C48A 2O5JC 2R7ZG 4AQYH 1KHIA 2GA4B 5I47A 4RCNA 4RB3C 1ULZA 3DWPA 4HSVA 5JPMC 4DR7H 5BMVF 2RQXA 4YCVA 3H91A 3BVZA 4DV0Q 4JI5Q 2F0GA 1M6VA 2NVYB 3Q8PB 1A2UA 2RKSA 2R8KA 1VMPA 5KNDA 3F2UA 3HOUG 2VL6A 1LTID 1D7QA 5KX5F 5KFXA 4LH6A 1C0AA 1OWTA 4LF8L 1XWEA 4A3FH 4RAZA 2F4VQ 4RUAA 1Z2NX 3CQZH 1ONLA 4WJWA 1BVSA 3VDYA 3DMUA 2JSOA 1GSOA 2M2LA 2VPQA 4IO9A 2LXJA 1STYA 3L0OA 1FNWA 3HOYH 2UXCL 5EKIA 1KJJA 3P7JA 2F3VA 4PMCA 4DUYH 4OWXB 2RGVA 1VQ8A 2IBKA 4Y7NB 2L15A 1SE4A 2OCEA 2X6LA 5C3EB 1HNXL 1X56A 2FXQA 2JN4A 5KFIA 2B2VA 4LF4L 1LTRD 3C2PA 1EUJA 2A74C 3GTLH 4LSAA 3HOUH 4JBKA 2R7LA 2M00A 1N36H 4IOCA 4HEDA 5IT9c 2ZTDA 2IJ0A 2RSOA 1AN8A 2B2WC 1XDNA 1C8CA 3TQ1A 2EYJA 3ND8A 5CR3A 5E4WC 4J9SA 5JAVA 2DPIA 5JVG3 4DR5L 1EY4A 4UCRA 5ELBA 3HOZG 2F0WA 1T3NA 2K03A 3RGZA 1EIGA 1A2TA 1STEA 3M9MB 4CKEA 3CCEA 2B2YC 1E0BA 5H80A 4HSPA 2EOTA 5IYCH 1BJTA 3MEFA 1GUWA 1CM9A 1C7YA 5E3FA 3UDIA 1N33L 3GTMB 3HOXG 3RZOH 2ID0A 4XT1B 1XTDA 4RHSA 1N8RC 3PO2B 4YY3L 5IT9E 3NXWA 3DWAA 2W6ZA 1BQQT 4YHHL 5KIXA 1VQBA 2NZ1D 1CHQD 3S1RB 5C4JH 3OWEB 4OGQC 4FDBA 4X65L 3LMLA 3NHHA 4DV5H 1LV9A 3JRWA 1IKMA 1CHPD 1VQGA 1WSCA 3RUZA 4H44C 5K5PA 4K6DA 2IX0A 4X62L 4LF5L 2UXCQ 2UXDQ 3RV3A 4O3NA 3VPCA 3QB3A 4O4HF 4LF7H 3PUVA 4YJ2F 2PQAB 1S40A 4FM9A 3PVXA 2PVPA 4YCUA 3TREA 2A6EC 1MJCA 1LTBD 4I7HA 2W7PA 4DK0A 1XNQH 2C35B 4A4IA 5BN5A 3RN2A 3RAXA 4JI3L 3UDXA 2C22A 2KQ3A 2E76C 5M5YH 1IL2A 3AEVA 4L5RC 2DUDA 1RTOA 4DR3L 2EZVA 3CD6A 3A54A 2W9CA 2V58A 2D2CC 3A74A 3NWTA 1ASZA 3SE7A 3KF6A 1GSAA 4AYBA 3VR4A 4F88A 4R8UA 1EQRA 2EJFC 1TWAH 2WACA 3CCLA 4GC7A 1RIPA 3PW0A 2BQ3A 1CK1A 4HMIA 2CHBD 1N32Q 5IGDA 5C0XH 4JI7Q 3IFDA 1M7JA 2A6HD 4R8IA 1MIUA 5CV5A 4IZOA 4A3IB 1L1OA 4O3PA 3HOYB 1S68A 5C5JA 5L1JA 3NBHB 1I94L 1QVCA 1CQJB 1JE5A 4IAJA 3T1HL 5E1FA 5DQGA 1AEXA 1IBML 2CZGA 1AW7A 2JP1A 4DUZQ 4YR3A 1YNJC 3S14H 1E4GT 5E4XA 4RH6A 1S5FD 3MJFA 5T14A 5M5WB 2CW0C 4Q44A 1QILA 1SJHD 5KFBA 3NEMA 4DA2A 4DNIA 4TQUS 3T51B 1RODA 4ZUIA 4ZCKA 2K1BA 3JAML 3IKJA 1OXUA 2R92B 3GTGA 3OPOA 3G6JB 3KOJA 3GTQA 4K8IA 3JAMW 2F4VL 4ECQA 4KHPL 4P2CB 3PR5B 1GOZA 1N34H 2Y0SG 4MV8A 3NPPA 4B9WA 2VPSA 4Q45A 1YHQA 1KXLA 5BN3A 4LF8H 1ML0D 1XPOA 5IGGA 1O7IA 3S17B 3SDZA 3D4RA 4IWXA 4R8NA 4LF9L 3CCUA 5IY0A 4YCWA 1ICWA 3G8CA 2FFKB 4DUYQ 1WFQA 3ITPA 4KJOA 4UAIA 2K4KA 2HHHH 2B2TA 4ZQ3A 3CQZB 1D1KA 2A6ED 2PNHA 1A3VA 1SE8A 2AMCB 4HMJA 3GD7A 1STNA 2AU0A 2EYPA 1V43A 1CA6A 2F0VA 1UC9A 3MXPA 1BDOA 4A93G 4IPGA 3PIPA 4A3BG 1WTHA 3MFIA 2WP8J 4B3RQ 3BZKA 4KK7A 4O2DA 1YVCA 2G9DA 5KG4A 4F50A 1GUSA 2R6GA 4AYBB 1E24A 4UPAA 3KDFB 1KD1C 1Z2PX 2FK1A 4YR2A 1Y14B 1JOKA 1N36L 3I4MB 4N8FA 1LLRD 2IX3A 4DV6L 1IW7C 1SDFA 2J4XA 1PV4A 1IBKQ 2FP4B 3PO3B 2NUCA 3VYUA 5KG7A 1H9RA 2HIVA 3OSOA 1I50B 3H6MA 4DR5H 1JLLB 3GTGB 3R5XA 3KLRA 1CKNB 1UE1A 2MO1A 3E6ZX 1WTOA 1I6HH 5KT3A 5C44B 2V1CC 4J9PA 2KCNA 4IUVA 4R4TA 3I91A 2TSSA 5C4JB 1Q8KA 1QG7A 1L1OB 2DJFC 4MV1A 4ED6A 4A76A 3HS0C 5EJWA 4L6TB 3OW2A 4LMYA 4X64H 4A3DB 1SYBA 3K57A 1X6OA 1GUTA 3V05A 4F87A 5IYDH 4QWEA 3KHLA 4CKBA 2VA2A 2JEGA 3U4VA 1ILQA 1WJJA 4KY6A 4J1MA 5FJ8H 5IYDG 4DAPA 4UCUA 2CQOA 1B6RA 2R92A 1RJTA 1TS4A 2K75A 3AFPA 5C1OA 4PQXA 1EIYB 4O2BF 1X3QA 5KT2A 2WTFA 1NTGA 1I4RA 5CBEE 2LMCB 2M05A 4LH7A 3PGZA 2YZMA 2LSSA 2R7ZB 2AKWB 5C8YF 5EKLA 1LABA 2SNSA 4X3SA 5DM73 4QIWB 2GPSA 5KRUA 2HDLA 1EY6A 2JA9A 4C56C 1K1SA 4HJ5A 2NB0A 3A8IE 4R4QA 1XNQL 1KJIA 1T36A 1F9RA 4JK1C 4C1NI 1PRTB 1VQOA 5TSSA 3R3OA 2H1EA 1XYIA 1WTQA 4EGQA 5LL6b 4JI3H 5KYIA 2ZXOA 2K5HA 3A8JE 5CV8A 5KFYA 5KFDA 4DXGA 1UC8A 3PIOA 5CMDA 2F0EA 4IUUA 2NVXH 1JT8A 3BG3A 2VUMG 4ZI7F 1EYGA 2NVQH 5FO8B 4RGTA 3CC4A 1ZHQA 5BN4A 2W9BB 1WD0A 4MV4A 3TN2A 4AYBG 5FPRA 4EEQA 2PCFB 1L0YB 4BY1B 1UAPA 2KA7A 3L4KA 2C9OA 4RA8A 2R82A 5M3FG 1GHJA 1JMCA 5JEAH 4QQBX 2Z8LA 1XX8A 3PW5A 4TKOB 4YJ3F 3S1RH 4IPCA 2PMZB 3N6RA 3I8ZA 4R7RA 2BE5C 4IRCA 1HFGA 1LM0A 4JPBW 5DEHA 4XYMB 2D9UA 1RHPA 2PYKA 4EYIB 1N33Q 1HTLD 3MR5A 3KF8B 1A6XA 2B2UC 2UVVA 1DJRD 3GIMA 2BE5D 2LXKA 5GAEC 4O4IF 3GTPB 1Q3LA 3FVQA 1TT2A 2CWAA 4G7OC 4KTAA 2CH4A 2R93G 3PR4A 2KHSA 5JUMA 1P8LA 2PI2A 2UUBL 4NMZA 3QZ8A 1HXYD 4PDBA 1N34L 2XN9C 1CTMA 5IGEA 1JC7A 1BNCA 5DG9A 3U4ZA 2E2JH 3PUWA 1YI2A 3Q8RB 1CSQA 2ZTCA 2VQFQ 3J7YW 1KDAA 3M4YA 3QG1A 1K8GA 3KFUA 4DV3Q 4M9UA 5EPLA 2FLPA 1KC8C 1TWCB 1QVGA 3CW2C 3BA8A 3E5SA 3VR6A 4O1NA 4C3IG 4A3JH 2EDGA 2XVSA 3NP8A 4IJHA 1I50A 2JYOA 3N6XA 5FLXW 1R9TH 2XIGA 3WDNA 3OSPA 2Z6KC 4IFDG 1KNAA 4A3KH 1VQHA 4C5BA 1CT1D 4JOIA 2IMWP 4RG1A 4MTKA 3DEOA 3D3RA 4QY7A 1Q1BA 5F9LA 5EPJA 5FLMG 5DGBA 2UU9H 4UP9A 2O2LD 3FRPB 4H0LC 1R9TB 5EDWA 3IL8A 2JA8G 1N56A 2AQ2B 1VQ6A 4ID6A 5FO7B 2P5ZX 4FXDA 3GTOB 2JEJA 1VQ9A 2YV5A 4MV3A 4RZQA 4DR2L 2R7DA 4K5VA 2EXDA 5LHY1 4LF5Q 2DN8A 3RLOA 2UXDL 2Z0SA 3K5OA 5I6WA 2EYHA 1DV1A 5KKNB 5C3XA 4K14A 4UP8A 5LXTF 2NVTB 3FP9A 4WJ3M 4ULLA 3S1MB 3GV8B 1EYDA 3M7NA 1I4QA 1TWGA 3J80L 4ECXA 3BDCA 2Q8RE 1EY5A 3MZ5A 3CC2A 3CAMA 4LFAL 4QIWA 3QZ7A 2E8GA 1ESFA 2GVBA 1I3QH 4L63B 1VKZA 5C0XG 1I3QA 1Q1EA 4Q5VA 2Q8TA 1I7LA 5JVDF 5C4ZA 5GONF 1K83A 1T5XD 3WOEA 4R8UB 2HVRA 4X64L 3V4SA 2W8KA 2W8LA 1TWGH 2QEXA 1JOQA 1LTGD 1AN7A 4CDCC 1STBA 3KHGA 2K32A 1YZ6A 5CYUA 4I50F 3F1ZA 3DF7A 5KG0A 5IYZF 4J9MA 4X66L 4DL3A 3NWSA 4KJNA 4L5TA 1I6UA 2VZAA 2ASJA 1E3PA 1FJGH 1VQIA 3PUZA 4DR5Q 4A3EG 5D1PA 4MZ9A 1EU4A 3CC7A 4JUZA 5J2UF 3GTJB 1K8MA 1VQLA 4C5CA 1QNUA 4FXKC 2YW2A 1Y1VB 2VY3A 3HOZH 4C3HG 1PYWD 4RAUC 5E7NA 2N78A 3E9IA 1KJQA 2YS6A 4Y8VB 3KF6B 1Q7YC 2K28A 1W6JA 4JC0A 3GTOA 2Y0SA 3UDGA 4N9TA 4LFBL 2UUAL 1MD2D 4ED0A 4EBCA 1S10A 4A3GB 4POGA 3V2TA 4HN7A 3FPUB 1IL8A 4OO1I 4EEYA 3BU2A 3I70A 3RZOB 2XD4A 1QB5D 4RKLA 2E5LH 4UDUC 4KLKA 3RN5A 4MA0A 1TU2B 2NVYA 1YEZA 3DWQA 3PO3G 1JORA 2IHEA 1F2ZA 3F2BA 4X3KA 4I55F 4HQ6A 3H15A 4DV7L 2OLSA 3SVMA 2UUCH 1TY2A 1V1QA 4RWSC 3HOYG 2X0SA 2UXBL 2XCAA 4JI8L 4LSXA 1NE3A 2MJ8A 1RYSA 1X65A 2WKCA 3GTPH 1B3QA 1S5BD 4QL5A 3H3VH 3S1QH 4JYAL 1E4EB 3P1HA 4GKJQ 4TVAB 3U9OA 1OO9B 4MV7A 1SLJA 4HYKA 3SK8A 4ECRA 4Y7NH 1EIHA 3HP3A 3HB9A 3NBIA 1J8IA 1RF2D 1Z7TA 1DIKA 1EUCB 3PO2G 3RUPA 4IUPA 4BXXH 2I8CA 2QILA 3RBEA 2A69C 4DR6Q 1TWFH 1B44D 2LY7A 3AB9A 4QF4A 3WOFA 4POFA 3MAQA 4B3ML 5FLMH 2X6GA 4WD3A 3MR2A 3ORRA 1BR9A 4U7CA 1YHBA 2NVQB 2Z4IA 3QOJA 2VOBA 5C4XG 3PF5A 4ME5A 3OTOL 5JEAJ 1AH9A 2NVXA 4J0MA 4ECSA 2F1MA 2R92G 1EWHA 4K6LA 4A3IG 3OMCA 3Q2OA 1EY9A 1O7LA 4EQ5A 4A3JG 2VQEQ 2N49A 5J22A 2KUMA 1DYQA 3E0JA 5I9OA 4ZKCB 3HGBA 4A3MG 2WB1G 4Q0FA 4DNTB 1TWGB 1TVXA 3M4OB 2BA0A 3NSWA 3T13A 2JEAI 3I12A 1B1ZA 1LTTD 1ENCA 2XWJB 5HBRB 5CAEB 4G57A 5KFVA 1WTPA 4IZ8A 2OF1A 1PX2A 2WIIB 3OW7A 1JWUD 1C30A 3S1MH 2XNAC 1TS3A 2FK3A 1EZ8A 4QJFA 1CS0A 4HNVA 2ZM6L 1E2ZA 2A69D 1VQNA 4CKCA 4JI0H 4A3KB 2B39A 1RJPA 2HGSA 3J81L 3I55A 2UXDH 2R86A 4TV9F 3J7A5 5KGUA 3G6VA 2FPIB 3T56B 1B3AA 3MR3A 2KOLA 2QYZA 3HKZG 2AUJD 4EVOA 2JA7H 3GIJA 2PQAA 3FEWX 4GLVB 1I94Q 4RNMA 1PXUA 5KFTA 1EZ6A 3T16A 3RZDB 1JDEA 4DR6H 3J81j 3GTPA 4NXNQ 1YNND 4NPSA 5IT9L 4BBRH 2I87A 2Q2IA 5F2DA 2PN1A 3U50C 3OSNA 1I4XA 5I2YA 2MGSA 5M5WH 2W9CB 1EQQA 1N9WA 1R4PB 3TZDA 1IHZA 2Z6BA 2XCPA 4R4OA 3VA5A 4LK1C 1J5EQ 2PMZA 1R4QB 4YWKA 3GIDA 4EG0A 4CJ0B 1BBUA 4O4LF 4PZ6A 4AQYQ 1HNZQ 2MHVA 1PH5A 3TBIB 4YIJA 4DK3C 1BNZA 2JA8H 4JW0A 2PZWA 1EQVA 1GXDC 4KN4C 1OTCA 2E2IA 2KVMA 1PH1A 3NENA 3NE5B 1IW7D 4JI2H 3Q1KA 3PIP3 2SDFA 2HCIA 4UCTA 3PW4A 4B08A 2K5QA 2CW8A 3K81C 3FPPA 4CBVA 3BA9A 4A3KG 1HUMA 5CB4F 4LF7Q 3R2TA 1KDBA 4A3EB 1U4LA 4DR2Q 1GSHA 5I6YA 2EE1A 3M9NB 5FK9C 3EFXD 4XXEA 3SR1A 4FU0A 4DV1L 1K3BC 2KHIA 4KKSA 3MWYW 4BY7G 1EFID 1EU3A 1HZ9A 3GIQA 4I7ZC 2UUCL 4DV7H 4JOIC 4A3CH 3WNZA 1LT5D 1KC7A 4JI8H 2OWOA 4H7BA 4K5WA 1K83H 1H9SA 2JEBI 4WBNF 1NUCA 3RMHA 2B63H 2YRWA 4G7ZC 3W2DA 1A62A 4H02A 2NU6B 4JYAH 1EYZA 2KBNA 1Y1VG 3E5NA 1LTSD 1P16A 2F0TA 4B3SQ 5IP9H 5KFOA 1DCZA 3RTXA 5IYBG 3ZYYX 5KT5A 1V8QA 5JJLA 5KG3A 3MC0B 3C0FB 5CV4A 5IYBH 3QFFA 3ICEA 3T1YQ 1VQPA 4FS1A 1RJQA 3S2HH 2K50A 1SNMA 4K0KL 5KFQA 2IW3A 3V96A 5GAGC 4IFDJ 5JVLA 4ECUA 3SK4A 4RUCA 1TS5A 4YBZB 5M3FB 2UXCH 1TWAA 1EOTA 5FLXE 3I4OA 2J9GA 2JQOA 5FOBB 5M9OA 2L55A 2YU9A 2RCFA 3HZXA 2HD3A 2DNCA 2VUMH 4BBSG 2I5MX 3CCRA 4E4TA 5KFMA 2AWNA 4ECYA 5G3LD 4HR7A 4PV1C 2R8JA 4LF4H 3OUUA 3KAJA 3Q22A 4GZYC 1JB3A 3OHBA 4DUZL 2RGRA 2FHTA 1Y8NB 1XMQL 3N44B 3C46A 2YTXA 2FMAA 4E6IA 2RBMA 5KFEA 4FVMA 3KJPA 4B3RL 5CBAE 5KNBA 1L1OC 3GIKA 1JQYD 3KXYT 2HVSA 4RMFA 3J7AV 1F9SA 4RU9A 5BR8Q 1T9HA 5K2MA 1I3QB 1MKHA 4LW1A 3N43B 5CORA 3O13A 1BCPF 3CCVA 5DGAA 1WCMB 1PH6A 3MXNA 4OO1H 4BA1I 3CKIB 1GM5A 1WTWA 4YY3H 2JA5A 1PA6A 1B9MA 1SAPA 3PSIA 1JCKB 3S2DB 5C1PA 3GTMH 2IPKD 4P72A 2R93B 3FKIG 3Q0AA 3FMCA 1RCVD 1Y8PB 3RGXA 4DR6L 3G6XA 4GOPC 4NXNH 3TS2A 2WAQA 4AIMA 2ATLA 2I0QA 3IFTA 2OXPA 1S9FA 1VQFA 1NMFA 4R9WA 5IGBA 1MHWC 3OIPA 4LF5H 1U4MA 4C3JB 1GO3E 3BZDB 4GNXC 3GV5B 3PIO3 3BQ0A 2F52A 2ICIA 5L37A 3R23A 3KTMA 1BUVT 1SNDA 3J80c 1JJCB 1XMOL 5DG8A 1DV2A 4B9XA 3TQYA 1QJOA 1Q46A 4ZOLF 1JDBB 1DZ1A 4ZRZA 2L9HA 3L2PA 1DGSA 4F7XA 1YIJA 3R93A 5L9XA 2UU9Q 5KFLA 4Q8FA 2A1AA 2FINB 4MA5A 4NDXA 3M4QA 1VF7A 4YY3Q 4ZHQF 1IYUA 1X3FA 3VMMA 3T5JA 2YU9B 5M5YB 5EKKA 1SXTA 2D5DA 3R5FA 4BY1G 3GILA 1G2SA 5C0XI 2A73B 1S0MA 3C3LA 2J6UA 1WD1A 2Y0SE 3PQIA 3R8BA 3A56A 1RTNA 1RK5A 1II3A 1UE7A 3AU7A 4A3FB 1PRTF 1TIID 1ICFB 4UCSA 4CJ2C 4HJ7A 4A3IH 2R92H 3EQLC 4DV4L 3T1HH 4JI3Q 4Y52H 3TMEA 2QK4A 2NN6H 1IBMH 1MJEA 1JX4A 1PYSB 2KHJA 3TP6A 5ISRA 4OWWB 1B50A 1X55A 3DUZA 2CVRA 1SROA 4NXMQ 1B6SA 1EY8A 2F0OA 2L1BA 1S5CD 1E4FT 1EIFA 5LMNQ 4XZ3B 2NUAB 4QWCA 2H5XA 3GDEA 1ZKOA 4HCEA 1JWMD 3U58A 3PCOB 2K5WA 2RSNA 3HOUB 2IY5B 2VXWA 2J7ZA 2VNUD 1EUDB 5KG2A 4ECTA 2F4VH 3NELA 4OX9L 3HOWB 3BVGA 3W3AA 2NTSA 1FNUA 5IE8A 1BO0A 1HA6A 1CKOA 3EBEA 4X64Q 4RHRA 2TMPA 2R7KA 4DV1Q 3CMEA 4K0KH 2K6AA 1UEBA 1GLVA 4IR1A 3W1BA 4O3SA 4HIDA 5JJZA 3STBC 1X32A 4YQWA 2PZUA 1FL0A 5C3WA 3OOCA 2HIXA 4JVZA 1UNSA 1NBWA 2NN6I 2E2HA 2O03A 5EWGA 5C4XH 2WFWA 3FKIB 3EROA 4JI5L 2P0AA 1S0NA 2WE6A 5J39A 2FK2A 1Z47A 2ES2A 5C5MA 3K59A 1Z2OX 4DL6A 3KLSX 3EPIA 1MGSA 2E5LQ 2YYAA 5CV7A 3I7FA 1DD2A 4A3FG 2V4DA 2VQFL 2WKDA 4RCOA 3E0EA 3V4ZA 3TS0A 1ZYRD 4C1NK 3PO2H 4A93B 2R6FA 1XMQH 1CQFA 3HFZB 1SYGA 4LUOA 2C2RA 2JE6I 3RIZA 1HCZA 3I4LA 4B3RH 1SR3A 3B6YA 2CWPA 3GTQH 1SE3A 5LP6F 2C5CA 1HZAA 2ALYB 5FD5A 3KAKA 2HJWA 2ZM6Q 4DR3Q 3AFQA 2WDTA 4ECWA 2JEIA 1GVPA 2K14A 3GO5A 3K7UC 1VQCA 2W57A 1FKAH 3GQBA 1TWHB 4GC6A 5IIFA 1UUPA 2JK8A 5C3EG 1BBXC 3PO3H 1JICA 1JE4A 2L0CA 5C3EH 4IQZA 4A3LG 3CRKC 1D6EC 1OXVA 1BCPC 3HOXB 5CV6A 2JA8B 1J9OA 3SEBA 3N40P 5AJ3Q 5FLXL 3LWBA 3K3PA 3RAQA 4DK6C 4DR7Q 2ZJRA 4GN5A 1VAJA 1ZYRC 3RNUA 4B3SH 4KN7C 4PG3A 3D0FA 1ESRA 1X3GA 4ME6A 4MAMA 4OHJA 4HIMA 1ILPA 3A5ZB 3J7AK 2ENBA 4ILWA 4P71A 4O2AF 5LL6X 3EYYA 2V9WA 2QF7A 2PZTA 1BXRA 5KG6A 2QKIC 1Q82C 2J6TA 3RBDA 1PHJA 2AGQA 4ZLTF 3WO1A 1S3OA 1IXRA 4ZQIA 2E2HB 4B3MQ 1VQKA 4C2MA 4A3EH 5KFAA 5FD6A 2IP4A 2R3ZA 3D6CA 1AP0A 4HNUA 3NQTA 5IWAQ 1IBLQ 1AUVA 2YRXA 1HNWL 3BG5A 1B8AA 2NU7B 3KHRA 4J9LA 4A75A 1NR4A 4DAYA 1ENFA 4GLXA 1F9PA 4ZKBB 2JA5G 4FF3A 4F8MA 4G7HC 1PLFA 3W1GA 1STHA 1KABA 3HOVH 2Z1CA 4DNRB 4JI4Q 1VQAA 2SCUB 3AYHB 1VQ7A 2H4OA 2NBFA 1KQSA 3K80C 3R2IA 2PO4A 4DV4Q 3VYSA 1WCMG 3T5LA 2UXBQ 4TUYF 1KJ8A 1F2MA 1BCPB 2NU9B 1KAWA 3GV6A 2KCTA 3X3MA 3BQ1A 5KT7A 4XTCS 5HGQA 2R93H 4GKJL 1ZXTA 4WRDA 5D3DA 3S1QB 2E2JB 1LT3D 1PMRA 2W6PA 1QZGA 1HR0Q 4L5QA 3SI8A 2VQEL 4ZK9B 5JPNC 5T1IA 5I9PA 1S03G 4TRDA 3I2ZA 2UUBH 1EY0A 2SEBD 4K8JA 1HJPA 4UP7A 2Z4HA 4IN3A 2BH8A 4RGNA 4IFDH 3JAMc 1EFWA 4XYOA 1BGWA 2AQ3B 3UQ8A 3GTLA 2VW9A 3V6KA 1E1OA 2PMZE 5ELOA 3RLNA 1XMOQ 4U673 5KFFA 5EWFA 5M3FH 3RFCA 3HEJA 1K28A 4O3OA 2PW7A 5KFCA 2CW7A 4JI5H 3G7LA 5JVH3 2AGOA 1GUOA 2NZOA 4X3TA 2WV6D 4NXML 2A68D 3HOWG 5D8DA 3VPBA 1PH2A 4DU9A 1Q12A 4MV6A 3EVQA 1DOKA 5T1GA 1MSGA 1G51A 2FJ2A 1EZ1A 1QWYA 4EQPA 2XCLA 2VQFH 3PW2A 3CQZA 1PZKD 3GTJH 3S1NH 3K5NA 4G4KA 1BF4A 3QR8A 2BOSA 2XTIA 4CJ1B 2WB1A 3J7AF 3M4IA 4JV2A 2EJGC 1K0SA 1IOWA 1KRTA 4KY7A 4PWQA 1O7YA 3RB4A 2EXZA 1JOOA 3MVVA 3QO2A 5FKAC 1D2BA 1HR0W 1YNXA 2JA5H 3MWEA 3OYYA 1QUQB 1WTVA 2HVQA 3AQQA 4QIWE 5C5LA 1PRTD 3TIIA 3Q8QB 3CPWA 4CDEC 3LX0A 4KHVA 2UVWA 3QIAA 2WAQG 4LFAH 1QNKA 2R8HA 4DF7A 2ZXRA 4L1KA 1V51A 1IBMQ 4GS3A 4Z9CB 2BR0A 1H9KA 1DOLA 4O3QA 5KFRA 4C2MB 2DY8A 3S15B 3M3YB 3RB0A 4I65A 4M7EA 1EEFD 4I7AA 3H40A 3N41B 3HKZA 1KTKA 4OO1G 3V6HA 4DV0H 1L2FA 2HQEA 1SN8A 3SK5A 5K36G 2ZDQA 5M5XH 1FJGL 1I4GA 4IUNA 1HNZH 1HFNA 4O0AA 3HG9A 3ULPA 1Z6HA 2HUGA 5A2QL 4B3SL 1NJIC 1FVIA 3M3YH 3S15H 2BQRA 5EPKA 2PQEA 4DV6Q 4OIJA 2CFMA 2F0HA 2YTYA 4PNYA 4RNOA 4DV2H 5DLGA 4WORA 2YU9H 4MV9A 2MP1A 1CFMA 3N52A 3I3CA 4NKLA 5DQHA 2UUAH 4ZUJA 2MCTA 2KCCA 1OXTA 2ATWA 4AYBE 1RD9D 1X54A 4V0BA 2F3WA 2FKLA 1YJ9A 2PI2E 5KFUA 1SYDA 2E5LL 3NTHA 5FJ8G 4KI0A 5M3MG 4JI6L 1K8OA 2JA6B 3AMUA 2QDLA 3UE1A 1SMYC 3T53B 2NVTH 1PH4A 2ZT9C 2R84A 3JC66 4BS9A 4JI1H 1H95A 3HKZE 1HZBA 5KG1A 1SEBD 4DR1L 1TS2A 1TQOA 5HV6A 4GNXB 3S9WA 5CGKA 3Q23A 3I4NG 1LTAD 2SOBA 4LF6L 3URYA 1XJVA 3GIIA 2RCNA 3J80W 4OWTB 1G6PA 1PH7A 3EJIA 2DGYA 2XGQA 1QCBD 4BY7B 4F4WA 4BWSC 2F0MA 2YS7A 3WWVA 4RB2C 4J8QA 1JKJB 5AJ3L 3K5IA 3DEPA 3EPGA 1SCUB 2RA4A 4DGZA 3G48A 2QDBA 2F0NA 4HR7B 1BBWA 2DJGC 2X69A 4A3BH 4DV3L 1O80A 4Q0YA 1Y1VA 1D8LA 3BVMA 1U4RA 4S3SA 3M85A 4KMUC 2WB1E 2BH2A 1IYVA 4XT3B 5EQ0A 2ZDGA 1YHAA 1FGUA 2A8VA 3OTOH 1DM0B 4B3TQ 3KLWA 3E9HA 1CKMA 1NNXA 3A8KE 2E2IH 4JBJA 2E2HH 2JA6A 3NBHA 2XGTA 1G91A 4AH6A 1HZCA 4JI7H 3ERSX 3VR5A 4F4YA 2R7MA 4JCVE 2LKVA 2Q2HA 1TWHH 1LUZA 3BDOA 1CZGA 1X3EA 4DAYB 1PRTC 2K01A 3S2DH 2ZXPA 1SEIA 4JV5H 2NN6G 1C4QA 2EY2A 2F3IA 2JA5B 3ETHA 5KFSA 4TSSA 4R4CA 4HIOA 4MTDA 4FP5D 2Z6KA 2QEJC 4DV2Q 1TWCH 2K5VA 4CDDC 1RKNA 4JI0L 2AQ1B 1YJWA 2B8GA 1Q86C 3M4OH 4XQNA 3FDSA 3BJYA 1O78A 4BY1H 1GUNA 3MFYA 1SYXB 3CF5A 2YL2A 4DKAC 2ASBA 1W96A 1V9PA 4IRDA 3MR6A 3H0GG 5DLFA 1PYBA 4EGVA 1PH9A 2GPWA 1XTCD 2F0LA 4GN3B 4EX5A 3KBXA 5G3LF 2BDNA 4V190 4GKKH 3KUPA 4IHJF 1GYFA 3A0JA 3PW7A 2D62A 5C44H 1MZBA 1WCMA 3C1FA 3A7AB 4F4XA 4O42A 2OQKA 3P20A 1SFOA 4YWMA 1GGOA 1YNJD 1E1TA 2F0SA 4FO2A 5ELFA 2AHOB 1J5EL 1WR2A 5GAHC 3PN1A 4LNQA 3VR3A 2F0UA 4DV0L 3TIGA 4HAEA 3HOXH 2NVXB 3IG0A 3I4MH 1BOSA 1IBKL 3CCQA 3M9OB 1Z9FA 3OTOQ 1PTOH 2WAQB 5C44G 4UFZA 4EYHB 1HHVA 2I80A 1NCVA 1QZHA 1O7ZA 1ET6A 5GADC 4EGJA 3CPFA 3ERQA 1B7YB 1EYCA 3H0GH 5DNFA 3VYTA 3FKIH 4BA2I 1RJRA 3JZIA 3KJOA 5KT4A 2K05A 2JEFA 3TZUA 5CA0F 1CZWA 3L4JA 2C2EA 3F8TA 4JI2L 3TRZA 2EY6A 4APMA 4A3DH 1O75A 1RDPD 2XRSD
chains in the Genus database with same CATH topology
1C9OA 3ZJYC 1XNQQ 4GN4B 5M3FG 4A3MH 1JMCA 4QQBX 1UE7A 4AQYL 4ME3A 1I5FA 3RZDH 4IPCA 3S1RH 3J81i 4DR7L 2YTVA 4JI1Q 1IZ6A 4HJ7A 4PMWA 4A3IH 2R92H 1LM0A 4DV4L 4P74A 4JI3Q 5FLXc 4Y52H 1CSPA 1CKNA 4PZ7A 1MJEA 1QUQA 1N33Q 1PYSB 2KHJA 3KF8B 4YHHQ 4LF6Q 4OWWB 4JI1L 5IYCG 4DR4Q 1GKHA 1X55A 2N8NA 1SROA 4NXMQ 3RR5A 2LXKA 5IP9G 1VQMA 1G291 5GAEC 1K73C 1KRSA 2HQLA 1EIFA 2RF4A 2CWAA 1A8VA 3Q8DA 2BA1A 2K52A 3CCJA 5LMNQ 4ALPA 2H5XA 3GDEA 1XMQQ 2B63G 2YYZA 3U58A 1XPUA 3PCOB 2R93G 2IY5B 1BKBA 4LFAQ 4LUZA 1VQEA 4C3JH 2ZJQA 4A3GG 4LFCL 4BBSH 4KHPQ 2VNUD 3NELA 4OX9L 1B70B 1P8LA 2PI2A 3ULLA 2UUBL 5IE8A 1M1KC 3ULJA 2UXDL 1CKOA 3EBEA 2OTLA 1N34L 3EIVA 4X64Q 1YITA 3U4ZA 2ZJPA 4DUYL 2E2JH 1SRUA 3PUWA 4DV1Q 2GN5A 3CMEA 1CSQA 2ZTCA 2VQFQ 3T1HQ 1YI2A 1UEBA 3KFUA 1K8GA 3J7ZC 3W1BA 4DV3Q 1KC8C 4HIDA 3CW2C 3FHWA 1QVGA 4L5SA 1N34Q 1VQDA 3STBC 4A3JH 4R4IA 4X6AH 4IJHA 4C2MH 3F2DA 1XPRA 1FL0A 5IP7H 1R9TH 2JA6H 2HIXA 2UUCQ 2Z6KC 1NBWA 2NN6I 4IFDG 4A3KH 1A63A 5C4XH 1VQHA 2WFWA 1N36Q 4HJ8A 1VCIA 3GTOH 4JI5L 4JOIA 4RG1A 5HY6A 1Z47A 4QY7A 1IYJB 2ES2A 2ZTEA 1Q1BA 2WAQE 2VS1A 5FLMG 2E5LQ 4X62Q 2R7ZG 1K0RA 1TXYA 3PUYA 3J80i 4DPGA 4XIGS 4LWCA 4JI7L 1Y1VH 3I7FA 4UP9A 4A3FG 3D31A 2VQFL 2JA8G 3E0EA 4R1JA 3TS0A 4JYAQ 1EWIA 1VQ6A 1RL2A 4X65Q 3PO2H 3SGIA 1VQ9A 2YV5A 4DR2L 1Q81C 4A3CG 2R7DA 3HFZB 1CUKA 2EXDA 4LUOA 4LFBQ 2R7FA 3RLOA 3ER0A 4P75A 2Z0SA 4LF5Q 4LF9Q 4JV5L 4BY7H 2JE6I 4UP8A 1SR3A 1U0LA 3FP9A 3B6YA 5LMUL 2CWPA 3GTQH 4WJ3M 4LUVA 5M3MH 2UUBQ 3M7NA 3GTGH 1HZAA 1PFSA 3BJUA 2ALYB 3CC2A 1HR0L 4LFAL 3S17H 3CAMA 4APVA 1J6QA 2D0OA 2E8GA 1I3QH 2GVBA 3AFQA 5ELNA 5C0XG 2ZM6Q 1GVPA 1Q1EA 2K14A 3GO5A 1VQCA 3K7UC 2B3GA 3I56A 4DV5L 2D0PA 1UE5A 3HOVG 2MO0A 4X64L 1TWGH 2QEXA 2JK8A 1Y1WH 4UY8C 5C3EG 4JI2Q 3PO3H 1YZ6A 3F1ZA 4LF7L 5C3EH 3M9BA 4X66L 4HJ9A 4A3LG 3IRBA 4L5TA 2VZAA 1OXVA 1E3PA 4WJ4A 2IHFA 4NXNL 1VQIA 3PUZA 4DR5Q 4A3EG 4J15A 5AJ3Q 5GROA 4GKKL 4MZ9A 4DK6C 3CC7A 2ZJRA 4DR7Q 4GN5A 3RNUA 1VQLA 3TEHB 1AE3A 3D0FA 4OONA 4PG3A 2VY3A 1NY4A 3HOZH 4DR3Q 4GOPB 1X3GA 1XNRL 1UWVA 5E7NA 4HIMA 2N78A 3A5ZB 3E9IA 4P71A 3KF6B 1Q7YC 2MFIA 5BR8L 3F2CA 3KYHC 4OX9Q 5H1SE 4JC0A 3RLFA 1Q82C 3UDGA 4LFBL 3HOWH 2UUAL 1PHJA 5IWAL 1IBLL 3CXCA 4POGA 1S3OA 1IXRA 2Q2UA 4B3MQ 1I50H 1VQKA 4A3EH 4BBRG 4OO1I 3PV0A 3BU2A 4LF4Q 2IX1A 3H3VI 5IWAQ 1IBLQ 1HNWL 4KLKA 1B8AA 3RN5A 4A75A 2JA7G 1YEZA 4KHZA 3GTKH 3PO3G 2IHEA 3F2BA 4GLXA 1PVOA 2JA5G 1Y1WG 1JB7A 3H15A 4DV7L 3W1GA 3HOVH 1V1QA 4JI4Q 3HOYG 2UXBL 1VQAA 5DLQE 4JI8L 1NE3A 3AYHB 1VQ7A 1KQSA 4JI0Q 1KHIA 1X65A 4C3IH 3K80C 2Q2TA 3GTPH 3HKSA 1E22A 3CCSA 4DV4Q 1WCMG 4QL5A 4YCVA 3H3VH 3S1QH 4JYAL 4LF8Q 4DV0Q 2UXBQ 4JI5Q 1VQ5A 4GKJQ 4TVAB 1K9MC 1AE2A 1SLJA 2OTJA 1KAWA 4Y7NH 3G4SA 2KCTA 3HOUG 4XTCS 5HGQA 2R93H 2VL6A 4GKJL 1D7QA 1LTLA 3PO2G 1LYLA 4BXXH 1C0AA 3L7ZC 3K8AA 4LF8L 4A3FH 2F4VQ 4DR6Q 1TWFH 1QZGA 3CQZH 1HR0Q 1BVSA 4L5QA 2VQEL 2N3SA 4POFA 2QA4A 3VDYA 2R7ZH 4B3ML 4IO9A 2LXJA 5FLMH 3CP0A 4DV5Q 3L0OA 3I2ZA 3HOYH 2UXCL 1YHBA 2HHHL 4GLAC 1HJPA 4UP7A 1A0IA 2B29A 2BH8A 5C0XJ 5C4XG 4B3RQ 3PF5A 3JAMc 3OTOL 5JEAJ 1EFWA 1AH9A 2JA6G 4OWXB 5IP7G 1VQ8A 2R92G 4A3IG 5JJKA 2VW9A 2L15A 4EQ5A 1E1OA 2OCEA 2VQEQ 4A3JG 1HNXL 2N49A 2PMZE 4GOPA 1X56A 5ELOA 3RLNA 1XMOQ 2FXQA 2OQ0A 4DR4L 3G71A 4LF4L 4A3MG 5M3FH 4BXXG 2WB1G 4GKKQ 1YBYA 3KDFA 1EUJA 1U5KA 3GTLH 3HOUH 1SMXA 2BA0A 1S72A 4JBKA 1PH3A 2JEAI 3M4PA 4IOCA 5J3BA 5IT9c 2NZOA 2ZTDA 4NXML 3HOWG 1YJNA 1PH2A 1Q12A 3EN2A 1UE6A 1G51A 1VQ4A 1WYDA 3CMAA 3S1MH 5GQOA 4DR5L 1L0WA 1WCMH 3G6EA 3HOZG 4LFCQ 3S1NH 3GTJH 4QJFA 2ZM6L 2MNAA 3CCEA 2XTIA 1VQNA 4JBWA 2I5HA 5IYCH 3MEFA 4HJAA 1C7YA 1KRTA 3UDIA 3I55A 1N33L 3HOXG 3RZOH 3J7A5 2ID0A 1XTDA 1N8RC 1HR0W 1YNXA 2JA5H 3OYYA 1QUQB 4YY3L 3AQQA 1KIXA 4QIWE 3HKZG 3UE0A 4MTNA 2JA7H 4HIKA 2PQAA 4GLVB 3CPWA 1I94Q 2CCZA 4YHHL 1VQBA 2WAQG 5LMNL 3J81j 5C4JH 4NXNQ 4FDBA 4X65L 2KCMA 4NPSA 4BBRH 2Q2IA 4X66Q 1VQGA 1HNWQ 1IBMQ 3U50C 4GS3A 2IX0A 2IT1A 4X62L 5M5WH 4LF5L 2UXCQ 2UXDQ 4B3TL 1EQQA 1K3RA 1N9WA 4PZ8A 3PUVA 2NVYH 2PQAB 2RHQB 1S40A 4R4OA 4OO1G 4YCUA 3TREA 1L2FA 2K5NA 1J5EQ 1MJCA 1SN8A 4C3HH 5K36G 4YWKA 5M5XH 1FJGL 3MXNB 2C35B 4O0AA 4A4IA 1BBUA 3RN2A 3ULPA 3J81c 1K8AC 4B3SL 4PZ6A 4AQYQ 2JJQA 1NJIC 1HNZQ 1FVIA 4JI3L 3UDXA 1PH5A 3M3YH 3S15H 4DK3C 5M5YH 1IL2A 3AEVA 4DV6Q 1JJGA 2JA8H 4L5RC 1FJGQ 2YTYA 2DUDA 1OTCA 4DR3L 3CD6A 4A3LH 1PH1A 2EQSA 3A74A 3NENA 2YU9H 3PF4A 1ASZA 3KF6A 3BZCA 1EQRA 1TWAH 3CCLA 1OXTA 3K81C 2ATWA 1RIPA 4A3KG 4AYBE 4LF7Q 4JI8Q 1X54A 4JV5Q 1N32Q 2AWOA 1YJ9A 4JI7Q 1EOVA 3JAMi 2PI2E 3CCMA 4DV7Q 4DR2Q 4DR1Q 2E5LL 1MIUA 5FJ8G 1L1OA 4KI0A 5M3MG 4JI6L 4A93H 3S16H 3NBHB 1I94L 1QVCA 1GD7A 2RHSB 1JE5A 1N32L 3UE1A 4DV1L 2KHIA 3T1HL 2NVTH 1IBML 1PH4A 4DUZQ 4BY7G 5JJIA 3S14H 1HZ9A 2UUCL 4P73A 3JC66 1M90C 4JI6Q 4JOIC 4A3CH 1H95A 2OWOA 2EIFA 1HZBA 3HKZE 4A3GH 4DR1L 1K83H 1HH2P 2JEBI 3NEMA 4DNIA 4GNXB 4TQUS 2B63H 2UUAQ 1VQJA 1A62A 4H02A 3I4NG 2KBNA 4LF6L 1XJVA 1OXUA 1Y1VG 2RCNA 4OWTB 4NB3A 1P16A 1G6PA 3KOJA 4B3SQ 5IP9H 1PH7A 5IYBG 5LMNW 2F4VL 2DGYA 5JJLA 2GVAA 4IPHA 4KHPL 5IYBH 4MNOA 2Y0SG 3WWVA 3ICEA 3T1YQ 1VQPA 3S2HH 2K50A 5AJ3L 1YHQA 4K0KL 1KXLA 4IOAA 1XPOA 5GAGC 1O7IA 4IFDJ 3G48A 1BBWA 4A3BH 3STBD 4DV3L 4LF9L 3CCUA 5IY0A 1ASYA 4YCWA 1OXXK 1D8LA 3PUXA 3M85A 4DUYQ 1WFQA 2WB1E 2K4KA 2BH2A 4A3DG 2PNHA 1NMGA 1YHAA 2AMCB 1SE8A 2A19A 3I4OA 2JQOA 1FGUA 2A8VA 3GD7A 4B3TQ 3E9HA 3KLWA 1V43A 1WI5A 2VUMH 4BBSG 1CKMA 1VS0A 2I5LX 2I5MX 2E2IH 4A93G 4IPGA 4JBJA 3CCRA 3PIPA 2E2HH 4A3BG 2WP8J 2AWNA 2XGTA 4AH6A 1HZCA 3BZKA 3ERSX 2UU9L 1QVFA 1KL9A 3K7AH 4JCVE 2KENA 4OXPA 4O2DA 1YVCA 2R6GA 4DUZL 1E24A 1E7ZA 2Q2HA 3KDFB 4UPAA 1KD1C 1Y14B 1N36L 1TWHH 1XMQL 4IPDA 1LUZA 2HHHQ 4DV6L 2YTXA 1PV4A 1IBKQ 3I4MG 1X3EA 4DAYB 3S2DH 4IJLA 3KJPA 2NN6G 2F3IA 1PH8A 4IFDI 4B3RL 1L1OC 2HIVA 1XNRQ 4JG2A 4RMFA 4R4CA 3I4NH 4HIOA 1CKNB 1UE1A 2MO1A 1I6HH 4QGUA 5BR8Q 1T9HA 2V1CC 2Z6KA 1MKHA 4DV2Q 1TWCH 2K5VA 4R4TA 3K0XA 4LW1A 5JEAG 1Q8KA 3DLLA 1L1OB 1YJWA 4JI0L 4K0KQ 1Q86C 4A76A 3CCVA 5LMUQ 4DAMA 3M4OH 1PH6A 4JI4L 1OXSC 5EAYA 3OW2A 3T1YL 4BY1H 4BA1I 1X6OA 1GM5A 1HNXQ 5IYDH 2HT1A 1PA6A 3CF5A 3LGJA 4DKAC 3U4VA 2ASBA 3PSIA 1WJJA 5FJ8H 3GTMH 1V9PA 4P72A 5IYDG 3FKIG 2CQOA 3H0GG 4DR6L 1PYBA 4YWLA 2K75A 3AFPA 1PH9A 4GN3B 1EIYB 4GOPC 4EX5A 3W5OA 3TS2A 4AIMA 1NTGA 3A0JA 2D62A 3UDFA 5C44H 2I0QA 1VQFA 3PGZA 1NMFA 4GNXA 2OQKA 1JJ2A 4JBMA 2LSSA 2CKZB 2AKWB 1GO3E 4GNXC 1W2BA 4YWMA 2F52A 1E1TA 3J80c 2AHOB 1J5EL 1JJCB 1XMOL 5GAHC 3TQYA 4LNQA 1Q46A 2JA9A 4DV0L 3HOXH 4HJ5A 2NZHA 4R4QA 3I4MH 3L2PA 1XNQL 1IBKL 1DGSA 3CCQA 1Z9FA 1HNZL 1YIJA 3OTOQ 1VQOA 2UU9Q 5C44G 2A1AA 1WOCA 1QZHA 1W3SA 2K5HA 3M4QA 4YY3Q 5GADC 3PIOA 3CPFA 1B7YB 2QGQA 3H0GH 2MQHA 3FKIH 4BA2I 1X3FA 4DV2L 2NVXH 3KJOA 1JT8A 3S24A 2VUMG 1EYGA 2NVQH 3F8TA 4JI2L 3CC4A 3TRZA 4BY1G 3DM3A 4AYBG 5C0XI 1SFOH 3A5UA 4A3DH 2Y0SE 2CFMA 1X9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9O A;  3ZJY C;  1XNQ Q;  4GN4 B;  5M3F G;  4A3M H;  1JMC A;  4QQB X;  1UE7 A;  4AQY L;  4ME3 A;  1I5F A;  3RZD H;  4IPC A;  3S1R H;  3J81 i;  4DR7 L;  2YTV A;  4JI1 Q;  1IZ6 A;  4HJ7 A;  4PMW A;  4A3I H;  2R92 H;  1LM0 A;  4DV4 L;  4P74 A;  4JI3 Q;  5FLX c;  4Y52 H;  1CSP A;  1CKN A;  4PZ7 A;  1MJE A;  1QUQ A;  1N33 Q;  1PYS B;  2KHJ A;  3KF8 B;  4YHH Q;  4LF6 Q;  4OWW B;  4JI1 L;  5IYC G;  4DR4 Q;  1GKH A;  1X55 A;  2N8N A;  1SRO A;  4NXM Q;  3RR5 A;  2LXK A;  5IP9 G;  1VQM A;  1G29 1;  5GAE C;  1K73 C;  1KRS A;  2HQL A;  1EIF A;  2RF4 A;  2CWA A;  1A8V A;  3Q8D A;  2BA1 A;  2K52 A;  3CCJ A;  5LMN Q;  4ALP A;  2H5X A;  3GDE A;  1XMQ Q;  2B63 G;  2YYZ A;  3U58 A;  1XPU A;  3PCO B;  2R93 G;  2IY5 B;  1BKB A;  4LFA Q;  4LUZ A;  1VQE A;  4C3J H;  2ZJQ A;  4A3G G;  4LFC L;  4BBS H;  4KHP Q;  2VNU D;  3NEL A;  4OX9 L;  1B70 B;  1P8L A;  2PI2 A;  3ULL A;  2UUB L;  5IE8 A;  1M1K C;  3ULJ A;  2UXD L;  1CKO A;  3EBE A;  2OTL A;  1N34 L;  3EIV A;  4X64 Q;  1YIT A;  3U4Z A;  2ZJP A;  4DUY L;  2E2J H;  1SRU A;  3PUW A;  4DV1 Q;  2GN5 A;  3CME A;  1CSQ A;  2ZTC A;  2VQF Q;  3T1H Q;  1YI2 A;  1UEB A;  3KFU A;  1K8G A;  3J7Z C;  3W1B A;  4DV3 Q;  1KC8 C;  4HID A;  3CW2 C;  3FHW A;  1QVG A;  4L5S A;  1N34 Q;  1VQD A;  3STB C;  4A3J H;  4R4I A;  4X6A H;  4IJH A;  4C2M H;  3F2D A;  1XPR A;  1FL0 A;  5IP7 H;  1R9T H;  2JA6 H;  2HIX A;  2UUC Q;  2Z6K C;  1NBW A;  2NN6 I;  4IFD G;  4A3K H;  1A63 A;  5C4X H;  1VQH A;  2WFW A;  1N36 Q;  4HJ8 A;  1VCI A;  3GTO H;  4JI5 L;  4JOI A;  4RG1 A;  5HY6 A;  1Z47 A;  4QY7 A;  1IYJ B;  2ES2 A;  2ZTE A;  1Q1B A;  2WAQ E;  2VS1 A;  5FLM G;  2E5L Q;  4X62 Q;  2R7Z G;  1K0R A;  1TXY A;  3PUY A;  3J80 i;  4DPG A;  4XIG S;  4LWC A;  4JI7 L;  1Y1V H;  3I7F A;  4UP9 A;  4A3F G;  3D31 A;  2VQF L;  2JA8 G;  3E0E A;  4R1J A;  3TS0 A;  4JYA Q;  1EWI A;  1VQ6 A;  1RL2 A;  4X65 Q;  3PO2 H;  3SGI A;  1VQ9 A;  2YV5 A;  4DR2 L;  1Q81 C;  4A3C G;  2R7D A;  3HFZ B;  1CUK A;  2EXD A;  4LUO A;  4LFB Q;  2R7F A;  3RLO A;  3ER0 A;  4P75 A;  2Z0S A;  4LF5 Q;  4LF9 Q;  4JV5 L;  4BY7 H;  2JE6 I;  4UP8 A;  1SR3 A;  1U0L A;  3FP9 A;  3B6Y A;  5LMU L;  2CWP A;  3GTQ H;  4WJ3 M;  4LUV A;  5M3M H;  2UUB Q;  3M7N A;  3GTG H;  1HZA A;  1PFS A;  3BJU A;  2ALY B;  3CC2 A;  1HR0 L;  4LFA L;  3S17 H;  3CAM A;  4APV A;  1J6Q A;  2D0O A;  2E8G A;  1I3Q H;  2GVB A;  3AFQ A;  5ELN A;  5C0X G;  2ZM6 Q;  1GVP A;  1Q1E A;  2K14 A;  3GO5 A;  1VQC A;  3K7U C;  2B3G A;  3I56 A;  4DV5 L;  2D0P A;  1UE5 A;  3HOV G;  2MO0 A;  4X64 L;  1TWG H;  2QEX A;  2JK8 A;  1Y1W H;  4UY8 C;  5C3E G;  4JI2 Q;  3PO3 H;  1YZ6 A;  3F1Z A;  4LF7 L;  5C3E H;  3M9B A;  4X66 L;  4HJ9 A;  4A3L G;  3IRB A;  4L5T A;  2VZA A;  1OXV A;  1E3P A;  4WJ4 A;  2IHF A;  4NXN L;  1VQI A;  3PUZ A;  4DR5 Q;  4A3E G;  4J15 A;  5AJ3 Q;  5GRO A;  4GKK L;  4MZ9 A;  4DK6 C;  3CC7 A;  2ZJR A;  4DR7 Q;  4GN5 A;  3RNU A;  1VQL A;  3TEH B;  1AE3 A;  3D0F A;  4OON A;  4PG3 A;  2VY3 A;  1NY4 A;  3HOZ H;  4DR3 Q;  4GOP B;  1X3G A;  1XNR L;  1UWV A;  5E7N A;  4HIM A;  2N78 A;  3A5Z B;  3E9I A;  4P71 A;  3KF6 B;  1Q7Y C;  2MFI A;  5BR8 L;  3F2C A;  3KYH C;  4OX9 Q;  5H1S E;  4JC0 A;  3RLF A;  1Q82 C;  3UDG A;  4LFB L;  3HOW H;  2UUA L;  1PHJ A;  5IWA L;  1IBL L;  3CXC A;  4POG A;  1S3O A;  1IXR A;  2Q2U A;  4B3M Q;  1I50 H;  1VQK A;  4A3E H;  4BBR G;  4OO1 I;  3PV0 A;  3BU2 A;  4LF4 Q;  2IX1 A;  3H3V I;  5IWA Q;  1IBL Q;  1HNW L;  4KLK A;  1B8A A;  3RN5 A;  4A75 A;  2JA7 G;  1YEZ A;  4KHZ A;  3GTK H;  3PO3 G;  2IHE A;  3F2B A;  4GLX A;  1PVO A;  2JA5 G;  1Y1W G;  1JB7 A;  3H15 A;  4DV7 L;  3W1G A;  3HOV H;  1V1Q A;  4JI4 Q;  3HOY G;  2UXB L;  1VQA A;  5DLQ E;  4JI8 L;  1NE3 A;  3AYH B;  1VQ7 A;  1KQS A;  4JI0 Q;  1KHI A;  1X65 A;  4C3I H;  3K80 C;  2Q2T A;  3GTP H;  3HKS A;  1E22 A;  3CCS A;  4DV4 Q;  1WCM G;  4QL5 A;  4YCV A;  3H3V H;  3S1Q H;  4JYA L;  4LF8 Q;  4DV0 Q;  2UXB Q;  4JI5 Q;  1VQ5 A;  4GKJ Q;  4TVA B;  1K9M C;  1AE2 A;  1SLJ A;  2OTJ A;  1KAW A;  4Y7N H;  3G4S A;  2KCT A;  3HOU G;  4XTC S;  5HGQ A;  2R93 H;  2VL6 A;  4GKJ L;  1D7Q A;  1LTL A;  3PO2 G;  1LYL A;  4BXX H;  1C0A A;  3L7Z C;  3K8A A;  4LF8 L;  4A3F H;  2F4V Q;  4DR6 Q;  1TWF H;  1QZG A;  3CQZ H;  1HR0 Q;  1BVS A;  4L5Q A;  2VQE L;  2N3S A;  4POF A;  2QA4 A;  3VDY A;  2R7Z H;  4B3M L;  4IO9 A;  2LXJ A;  5FLM H;  3CP0 A;  4DV5 Q;  3L0O A;  3I2Z A;  3HOY H;  2UXC L;  1YHB A;  2HHH L;  4GLA C;  1HJP A;  4UP7 A;  1A0I A;  2B29 A;  2BH8 A;  5C0X J;  5C4X G;  4B3R Q;  3PF5 A;  3JAM c;  3OTO L;  5JEA J;  1EFW A;  1AH9 A;  2JA6 G;  4OWX B;  5IP7 G;  1VQ8 A;  2R92 G;  4A3I G;  5JJK A;  2VW9 A;  2L15 A;  4EQ5 A;  1E1O A;  2OCE A;  2VQE Q;  4A3J G;  1HNX L;  2N49 A;  2PMZ E;  4GOP A;  1X56 A;  5ELO A;  3RLN A;  1XMO Q;  2FXQ A;  2OQ0 A;  4DR4 L;  3G71 A;  4LF4 L;  4A3M G;  5M3F H;  4BXX G;  2WB1 G;  4GKK Q;  1YBY A;  3KDF A;  1EUJ A;  1U5K A;  3GTL H;  3HOU H;  1SMX A;  2BA0 A;  1S72 A;  4JBK A;  1PH3 A;  2JEA I;  3M4P A;  4IOC A;  5J3B A;  5IT9 c;  2NZO A;  2ZTD A;  4NXM L;  3HOW G;  1YJN A;  1PH2 A;  1Q12 A;  3EN2 A;  1UE6 A;  1G51 A;  1VQ4 A;  1WYD A;  3CMA A;  3S1M H;  5GQO A;  4DR5 L;  1L0W A;  1WCM H;  3G6E A;  3HOZ G;  4LFC Q;  3S1N H;  3GTJ H;  4QJF A;  2ZM6 L;  2MNA A;  3CCE A;  2XTI A;  1VQN A;  4JBW A;  2I5H A;  5IYC H;  3MEF A;  4HJA A;  1C7Y A;  1KRT A;  3UDI A;  3I55 A;  1N33 L;  3HOX G;  3RZO H;  3J7A 5;  2ID0 A;  1XTD A;  1N8R C;  1HR0 W;  1YNX A;  2JA5 H;  3OYY A;  1QUQ B;  4YY3 L;  3AQQ A;  1KIX A;  4QIW E;  3HKZ G;  3UE0 A;  4MTN A;  2JA7 H;  4HIK A;  2PQA A;  4GLV B;  3CPW A;  1I94 Q;  2CCZ A;  4YHH L;  1VQB A;  2WAQ G;  5LMN L;  3J81 j;  5C4J H;  4NXN Q;  4FDB A;  4X65 L;  2KCM A;  4NPS A;  4BBR H;  2Q2I A;  4X66 Q;  1VQG A;  1HNW Q;  1IBM Q;  3U50 C;  4GS3 A;  2IX0 A;  2IT1 A;  4X62 L;  5M5W H;  4LF5 L;  2UXC Q;  2UXD Q;  4B3T L;  1EQQ A;  1K3R A;  1N9W A;  4PZ8 A;  3PUV A;  2NVY H;  2PQA B;  2RHQ B;  1S40 A;  4R4O A;  4OO1 G;  4YCU A;  3TRE A;  1L2F A;  2K5N A;  1J5E Q;  1MJC A;  1SN8 A;  4C3H H;  5K36 G;  4YWK A;  5M5X H;  1FJG L;  3MXN B;  2C35 B;  4O0A A;  4A4I A;  1BBU A;  3RN2 A;  3ULP A;  3J81 c;  1K8A C;  4B3S L;  4PZ6 A;  4AQY Q;  2JJQ A;  1NJI C;  1HNZ Q;  1FVI A;  4JI3 L;  3UDX A;  1PH5 A;  3M3Y H;  3S15 H;  4DK3 C;  5M5Y H;  1IL2 A;  3AEV A;  4DV6 Q;  1JJG A;  2JA8 H;  4L5R C;  1FJG Q;  2YTY A;  2DUD A;  1OTC A;  4DR3 L;  3CD6 A;  4A3L H;  1PH1 A;  2EQS A;  3A74 A;  3NEN A;  2YU9 H;  3PF4 A;  1ASZ A;  3KF6 A;  3BZC A;  1EQR A;  1TWA H;  3CCL A;  1OXT A;  3K81 C;  2ATW A;  1RIP A;  4A3K G;  4AYB E;  4LF7 Q;  4JI8 Q;  1X54 A;  4JV5 Q;  1N32 Q;  2AWO A;  1YJ9 A;  4JI7 Q;  1EOV A;  3JAM i;  2PI2 E;  3CCM A;  4DV7 Q;  4DR2 Q;  4DR1 Q;  2E5L L;  1MIU A;  5FJ8 G;  1L1O A;  4KI0 A;  5M3M G;  4JI6 L;  4A93 H;  3S16 H;  3NBH B;  1I94 L;  1QVC A;  1GD7 A;  2RHS B;  1JE5 A;  1N32 L;  3UE1 A;  4DV1 L;  2KHI A;  3T1H L;  2NVT H;  1IBM L;  1PH4 A;  4DUZ Q;  4BY7 G;  5JJI A;  3S14 H;  1HZ9 A;  2UUC L;  4P73 A;  3JC6 6;  1M90 C;  4JI6 Q;  4JOI C;  4A3C H;  1H95 A;  2OWO A;  2EIF A;  1HZB A;  3HKZ E;  4A3G H;  4DR1 L;  1K83 H;  1HH2 P;  2JEB I;  3NEM A;  4DNI A;  4GNX B;  4TQU S;  2B63 H;  2UUA Q;  1VQJ A;  1A62 A;  4H02 A;  3I4N G;  2KBN A;  4LF6 L;  1XJV A;  1OXU A;  1Y1V G;  2RCN A;  4OWT B;  4NB3 A;  1P16 A;  1G6P A;  3KOJ A;  4B3S Q;  5IP9 H;  1PH7 A;  5IYB G;  5LMN W;  2F4V L;  2DGY A;  5JJL A;  2GVA A;  4IPH A;  4KHP L;  5IYB H;  4MNO A;  2Y0S G;  3WWV A;  3ICE A;  3T1Y Q;  1VQP A;  3S2H H;  2K50 A;  5AJ3 L;  1YHQ A;  4K0K L;  1KXL A;  4IOA A;  1XPO A;  5GAG C;  1O7I A;  4IFD J;  3G48 A;  1BBW A;  4A3B H;  3STB D;  4DV3 L;  4LF9 L;  3CCU A;  5IY0 A;  1ASY A;  4YCW A;  1OXX K;  1D8L A;  3PUX A;  3M85 A;  4DUY Q;  1WFQ A;  2WB1 E;  2K4K A;  2BH2 A;  4A3D G;  2PNH A;  1NMG A;  1YHA A;  2AMC B;  1SE8 A;  2A19 A;  3I4O A;  2JQO A;  1FGU A;  2A8V A;  3GD7 A;  4B3T Q;  3E9H A;  3KLW A;  1V43 A;  1WI5 A;  2VUM H;  4BBS G;  1CKM A;  1VS0 A;  2I5L X;  2I5M X;  2E2I H;  4A93 G;  4IPG A;  4JBJ A;  3CCR A;  3PIP A;  2E2H H;  4A3B G;  2WP8 J;  2AWN A;  2XGT A;  4AH6 A;  1HZC A;  3BZK A;  3ERS X;  2UU9 L;  1QVF A;  1KL9 A;  3K7A H;  4JCV E;  2KEN A;  4OXP A;  4O2D A;  1YVC A;  2R6G A;  4DUZ L;  1E24 A;  1E7Z A;  2Q2H A;  3KDF B;  4UPA A;  1KD1 C;  1Y14 B;  1N36 L;  1TWH H;  1XMQ L;  4IPD A;  1LUZ A;  2HHH Q;  4DV6 L;  2YTX A;  1PV4 A;  1IBK Q;  3I4M G;  1X3E A;  4DAY B;  3S2D H;  4IJL A;  3KJP A;  2NN6 G;  2F3I A;  1PH8 A;  4IFD I;  4B3R L;  1L1O C;  2HIV A;  1XNR Q;  4JG2 A;  4RMF A;  4R4C A;  3I4N H;  4HIO A;  1CKN B;  1UE1 A;  2MO1 A;  1I6H H;  4QGU A;  5BR8 Q;  1T9H A;  2V1C C;  2Z6K A;  1MKH A;  4DV2 Q;  1TWC H;  2K5V A;  4R4T A;  3K0X A;  4LW1 A;  5JEA G;  1Q8K A;  3DLL A;  1L1O B;  1YJW A;  4JI0 L;  4K0K Q;  1Q86 C;  4A76 A;  3CCV A;  5LMU Q;  4DAM A;  3M4O H;  1PH6 A;  4JI4 L;  1OXS C;  5EAY A;  3OW2 A;  3T1Y L;  4BY1 H;  4BA1 I;  1X6O A;  1GM5 A;  1HNX Q;  5IYD H;  2HT1 A;  1PA6 A;  3CF5 A;  3LGJ A;  4DKA C;  3U4V A;  2ASB A;  3PSI A;  1WJJ A;  5FJ8 H;  3GTM H;  1V9P A;  4P72 A;  5IYD G;  3FKI G;  2CQO A;  3H0G G;  4DR6 L;  1PYB A;  4YWL A;  2K75 A;  3AFP A;  1PH9 A;  4GN3 B;  1EIY B;  4GOP C;  4EX5 A;  3W5O A;  3TS2 A;  4AIM A;  1NTG A;  3A0J A;  2D62 A;  3UDF A;  5C44 H;  2I0Q A;  1VQF A;  3PGZ A;  1NMF A;  4GNX A;  2OQK A;  1JJ2 A;  4JBM A;  2LSS A;  2CKZ B;  2AKW B;  1GO3 E;  4GNX C;  1W2B A;  4YWM A;  2F52 A;  1E1T A;  3J80 c;  2AHO B;  1J5E L;  1JJC B;  1XMO L;  5GAH C;  3TQY A;  4LNQ A;  1Q46 A;  2JA9 A;  4DV0 L;  3HOX H;  4HJ5 A;  2NZH A;  4R4Q A;  3I4M H;  3L2P A;  1XNQ L;  1IBK L;  1DGS A;  3CCQ A;  1Z9F A;  1HNZ L;  1YIJ A;  3OTO Q;  1VQO A;  2UU9 Q;  5C44 G;  2A1A A;  1WOC A;  1QZH A;  1W3S A;  2K5H A;  3M4Q A;  4YY3 Q;  5GAD C;  3PIO A;  3CPF A;  1B7Y B;  2QGQ A;  3H0G H;  2MQH A;  3FKI H;  4BA2 I;  1X3F A;  4DV2 L;  2NVX H;  3KJO A;  1JT8 A;  3S24 A;  2VUM G;  1EYG A;  2NVQ H;  3F8T A;  4JI2 L;  3CC4 A;  3TRZ A;  4BY1 G;  3DM3 A;  4AYB G;  5C0X I;  1SFO H;  3A5U A;  4A3D H;  2Y0S E;  2CFM A;  1X9N A; 
#chains in the Genus database with same CATH topology
 1C9O A;  2BDO A;  4GN4 B;  4A3M H;  1V1O A;  3DHQ A;  1I6V C;  1I5F A;  1SE2 A;  2B2U A;  3I90 A;  3RV4 A;  3J81 i;  2B63 B;  4DR7 L;  3MFH A;  2R8I A;  4JI6 H;  1W6K A;  1IZ6 A;  4PMW A;  4FBT A;  3GTM A;  3RB6 A;  3JSL A;  5KT6 A;  4DV1 H;  4CC5 A;  2QCP X;  4HNT A;  3PZP A;  1CKN A;  4PZ7 A;  2GLT A;  4IWY A;  4YHH Q;  4LF6 Q;  1LAC A;  2R85 A;  5IYC G;  4RKB A;  4DR4 Q;  1GKH A;  5D65 A;  1E2W A;  3RR5 A;  4DR1 H;  1VF5 C;  1G29 1;  2JXM B;  2W6Q A;  4QWB A;  3MWD A;  1EQT A;  3UI2 A;  4DK1 A;  1KRS A;  3HRZ C;  3Q6S A;  4IR9 A;  1A3U A;  1A8V A;  2K52 A;  4LF6 H;  3CCJ A;  4K2K A;  2YYZ A;  1XPU A;  5BPF A;  4LAA A;  1VDZ A;  1BKB A;  4C3J H;  3K5M A;  2ZJQ A;  4A3G G;  4BBS H;  1G2T A;  5HUR A;  1B70 B;  4DL5 A;  3ULL A;  5D3I B;  1EL0 A;  1M1K C;  2ASL A;  5I2X A;  2OTL A;  3EIV A;  3GTK A;  2ZJP A;  4DUY L;  1Q8I A;  1SBB B;  1SRU A;  2WB1 B;  3T1H Q;  4YAK B;  4ED2 A;  1JWS D;  2VA3 A;  1QE6 A;  5KFZ A;  3L9A X;  3V6J A;  3FHW A;  4L5S A;  1N34 Q;  4HCS A;  4R4I A;  2V59 A;  5IGF A;  3KLS A;  3F2D A;  1NSN S;  2OEO A;  2K7V A;  3S16 B;  1STA A;  2UUC Q;  1A63 A;  4EQN A;  2VUM A;  3GTO H;  4MHE A;  4F4Z A;  1X3P A;  5A2Q E;  3NK9 A;  5HY6 A;  4QCL A;  2F4I A;  3E3X A;  5CC4 A;  2W6N A;  2CH4 W;  4X62 Q;  1K0R A;  1TXY A;  1TKW B;  3PUY A;  3J80 i;  4DPG A;  1LT4 D;  1PZJ D;  1EY7 A;  5KEE A;  2W70 A;  5L1L A;  4DL4 A;  3D31 A;  3BS1 A;  5KFJ A;  4JYA Q;  3Q8S B;  1EWI A;  2F0F A;  1RL2 A;  4X65 Q;  4KKT A;  4BBR B;  2OT2 A;  4DUZ H;  3SGI A;  4UCO A;  4G3I A;  3GIP A;  4A3C G;  2HCC A;  1QOH A;  1CUK A;  2I46 A;  4DAV A;  1N33 H;  3ER0 A;  3L3O C;  4N8X 1;  4P75 A;  2AUK A;  4JV5 L;  2VUG A;  3JRX A;  4XDX A;  2W9B A;  3SXH A;  1WH2 A;  1Y1W B;  1HQM C;  4BBS B;  4LUV A;  5M3M H;  2F0J A;  4YHH H;  3BJU A;  2F03 A;  1HR0 L;  2R61 A;  2L12 A;  3S17 H;  3CRL C;  2R7N A;  1J6Q A;  1L0X B;  1PZI D;  4GNX A;  2B63 A;  1YNN C;  3T4A C;  3I56 A;  4DV5 L;  3I4N B;  1S5D D;  4OL7 A;  3BDL A;  4OIK A;  4X3U A;  5EGT A;  5DG7 A;  2L4N A;  1Y1W H;  4FF1 A;  4UY8 C;  4A3J B;  3GTQ B;  4X62 H;  4ZAI A;  3KF8 A;  4JI2 Q;  1U4P A;  1DOM A;  5DQI A;  2NU8 B;  3M9B A;  4HJ9 A;  5J2T F;  3UFX B;  5CA1 F;  2ZJT A;  3I72 A;  2IHF A;  2VUM B;  4NXN L;  2IA6 A;  5FO9 B;  5GRO A;  1S0O A;  3F8N A;  2EVB A;  2XIW A;  3TEH B;  5IT9 W;  1AE3 A;  1SJE D;  2E2D C;  2K33 A;  4OON A;  3TDQ A;  2R8G A;  3GTK B;  3HBL A;  1D5M C;  2F0P A;  4LJZ C;  3SE0 A;  4GOP B;  1XNR L;  1UWV A;  1TWA B;  5K36 H;  4ED8 A;  2E74 C;  4DR3 H;  1XMO H;  4MTE A;  1Q90 A;  1KBL A;  1JXL A;  2MFI A;  5BR8 L;  4DL7 A;  3F2C A;  3KYH C;  3OUZ A;  3RLF A;  3H4B A;  3HOW H;  5IWA L;  1IBL L;  4JV1 A;  3S2H B;  2Q2U A;  1I50 H;  4BBR G;  3SHL A;  3KAL A;  2G9H D;  4QUF A;  4LF4 Q;  2RDG A;  4U68 A;  3H3V I;  1SNP A;  1G6Z A;  1EEI D;  2EJM A;  3GTK H;  4KHZ A;  1PTO D;  3GLK A;  1N32 H;  1PVO A;  3NQI A;  4TQR A;  1PFM A;  4DFA A;  4RGM A;  5C4X B;  4DLK A;  2O5I C;  3DXJ C;  2DY7 A;  5M3M B;  3J81 W;  2XGP A;  1T5E A;  2W9A A;  3RJ0 A;  5D14 A;  2ASD A;  4JI0 Q;  2B2T C;  2NTT A;  4C3I H;  4J9O A;  1GJX A;  2Q2T A;  1MSH A;  3HKS A;  1E22 A;  4DXF A;  3CCS A;  4OEM B;  1B33 N;  4LF8 Q;  4DV4 H;  1VQ5 A;  1ZET A;  2CQY A;  2JA7 A;  1K9M C;  3IAY A;  2W6O A;  4QWD A;  5DM6 3;  1VBH A;  1AE2 A;  3OWF A;  3RB3 A;  2OTJ A;  4KHP H;  3TP5 A;  3G4S A;  1ET9 A;  1KDC A;  3GV3 A;  4EBE A;  4J9R A;  1LTL A;  1LO5 D;  4ED7 A;  1LYL A;  3L7Z C;  2RDJ A;  1U9R A;  3K8A A;  2DLN A;  4RAY A;  3TP7 A;  1CE8 A;  3NUC A;  1ENA A;  2N3S A;  2QA4 A;  3MFG A;  2R7Z H;  4LF9 H;  4MIU A;  1B4O A;  2YZG A;  3CP0 A;  3PMF A;  4DV5 Q;  4OX9 H;  5JQW A;  1D5Z C;  2HHH L;  2E2I B;  4GLA C;  1PFN A;  3A7L A;  1A0I A;  2B29 A;  4RB1 A;  4KY5 A;  5C0X J;  4QMG A;  1HUN A;  2A68 C;  1KAA A;  1S4Z A;  2JA6 G;  3OIQ A;  5IP7 G;  3H0G A;  5JJK A;  2EYF A;  4GOP A;  2DIK A;  5JOB A;  4J9N A;  1T94 A;  4DR4 L;  2OQ0 A;  2L5T A;  3G71 A;  3EA6 A;  1WTX A;  4FXG C;  4GKK Q;  4BXX G;  1YBY A;  3KDF A;  4XQQ A;  5EWE A;  4O3R A;  1U5K A;  2O4X A;  1SMX A;  1S72 A;  1PH3 A;  3M4P A;  5J3B A;  4LMQ D;  4DV6 H;  1S5E D;  1I6H B;  1YJN A;  4FF4 A;  1K83 B;  3EN2 A;  2RVL A;  4L8J A;  4UCV A;  1UE6 A;  3N42 B;  4XYL B;  1VQ4 A;  1WYD A;  2R87 A;  3HOV B;  2B2W A;  5D1O B;  3CMA A;  5GQO A;  1I4H A;  2R7Z A;  1L0W A;  1WCM H;  3G6E A;  2QW7 A;  3MTS A;  2JA7 B;  3DM1 A;  1SYC A;  4LFC Q;  1TWF A;  1F9Q A;  1HRJ A;  2MNA A;  1EWC A;  4QB4 A;  5HGT A;  1HQR D;  4JBW A;  4YP3 A;  2I5H A;  5EBC A;  1FYC A;  1H9S B;  4HJA A;  3T5H A;  4JI4 H;  3MXG A;  3TSS A;  5AFW A;  2B2Y A;  3R5H A;  5COY A;  1KIX A;  3UE0 A;  3RF2 A;  4MTN A;  1CQV A;  4HIK A;  5L1I A;  3HKZ B;  2CCZ A;  2PPB C;  5KFP A;  4J9Q A;  3NGD A;  3J81 E;  1DON A;  1PK8 A;  1HR0 H;  5LOV F;  2DPJ A;  2KSW A;  5LMN L;  2AGP A;  4RZR A;  4K2L A;  2KCM A;  2Q8I B;  3G6Y A;  4X66 Q;  1HNW Q;  2J6S A;  3H0G B;  5KYL A;  2IT1 A;  3H94 A;  4B3T L;  1K3R A;  4PZ8 A;  2UVU A;  2E75 C;  1SMY D;  4QUC A;  2NVY H;  2RHQ B;  1BXT A;  3GP7 A;  2V5A A;  1V4Y A;  5KFN A;  4ABN A;  2K5N A;  4C3H H;  3MXN B;  1DXM A;  3ORQ A;  1K8A C;  3J81 c;  4FNF A;  2PBZ A;  2JJQ A;  4BWG B;  4K5X A;  4C5A A;  2PNR C;  1A3T A;  3BQ2 A;  2W6M A;  1JJG A;  3TIN A;  1KNE A;  1XNR H;  1FJG Q;  2AQ4 A;  3WO0 A;  4QW9 A;  4A3L H;  4ED1 A;  2W71 A;  2KED A;  1M4V A;  2EQS A;  4DN4 M;  3PF4 A;  3BYY B;  5BR8 H;  3BZC A;  4A2B A;  1UEA B;  4KD3 A;  5IWA H;  1IBL H;  4ETS A;  3MWM A;  3S14 B;  2SNM A;  4JI8 Q;  4JV5 Q;  2AWO A;  1B2T A;  1RYR A;  1EOV A;  3ND9 A;  5A35 A;  3JAM i;  3CCM A;  4DV7 Q;  1M0T A;  4DR1 Q;  4WFN 3;  1BCP D;  4YAJ B;  3K5L A;  1HNW H;  4A93 H;  2K04 A;  3S16 H;  5J1Z A;  2F0Q A;  1GD7 A;  2RHS B;  1N32 L;  1SYF A;  1S97 A;  5C4H A;  5IOD A;  5JJI A;  2WYO A;  3K7A B;  1FGB D;  4P73 A;  1Y1W A;  1M90 C;  1ZQ7 A;  4JI6 Q;  1G8Z D;  4EFE A;  2EIF A;  4A3G H;  4C3J G;  3M7G A;  1HH2 P;  3C1E A;  4NW2 A;  1CQI B;  1F2Y A;  4H13 C;  3JSN A;  2UUA Q;  1VQJ A;  1SSO A;  3OHX C;  5KFK A;  2LS0 1;  4NB3 A;  5F9N A;  1V1P A;  1SNC A;  2MPM A;  4YB8 B;  1ZEQ X;  4J6H A;  1I7N A;  5LMN W;  4LFC H;  5KFW A;  1CA5 A;  2GVA A;  2W7O A;  3ONA B;  4IPH A;  1MBY A;  5LYJ F;  1WVL A;  1PTO B;  3SK6 A;  1IKL A;  2F0K A;  3KK7 A;  2B2V C;  4MNO A;  5EBD A;  3BAA A;  3CVZ A;  3OHA A;  4GKJ H;  1C3O A;  1KLG D;  3K0Y A;  5ELD A;  4IOA A;  3ETJ A;  4C3I B;  1H9J A;  4ECZ A;  2VQE H;  2YZN A;  3STB D;  1PFB A;  1ASY A;  1VBG A;  1OXX K;  5D1O A;  1MI2 A;  3MXU A;  3PUX A;  5NUC A;  1F77 A;  2Z9H A;  3A55 A;  5EZY F;  4A3D G;  3T5K A;  1NMG A;  2A19 A;  2RDH A;  3FDT A;  3D8G A;  1CI3 M;  3VR2 A;  2XWB B;  3TQT A;  1WI5 A;  1VS0 A;  2I5L X;  1F2L A;  1R9T A;  2UU9 L;  1QVF A;  1B53 A;  1KL9 A;  1K1Q A;  3NTK A;  3TP8 A;  2N55 A;  3K7A H;  1W93 A;  3MA2 B;  4DR4 H;  2FMM A;  2KEN A;  4OXP A;  2FE3 A;  5KG5 A;  2J0T D;  1E7Z A;  4TQS A;  4IPD A;  4DR2 H;  2HHH Q;  4NXM H;  2B8F A;  1A9X A;  2KJX A;  4IRK A;  3I4M G;  2IL8 A;  4CC6 A;  4IJL A;  5LL6 S;  4IFD I;  5I4D A;  1PH8 A;  2L11 A;  2EY1 A;  1XNR Q;  5LMU H;  3GV7 B;  2N88 A;  4CGY B;  4JG2 A;  1V1P B;  5KFH A;  3I4N H;  4Q8E A;  2DWC A;  2CQA A;  4QGU A;  4RFB A;  5ELC A;  4HTH A;  3H4D A;  3K0X A;  5JEA G;  3DLL A;  1AUX A;  1TA8 A;  4K0K Q;  2G5D A;  5LMU Q;  3GTL B;  4DAM A;  4JI4 L;  1OXS C;  5EAY A;  3T1Y L;  1SFO B;  1I4P A;  1HNX Q;  5L1K A;  2HT1 A;  4CDF C;  3LGJ A;  1VMC A;  2RDF A;  1PTO C;  2PW5 A;  4X66 H;  3MEH A;  5LMN H;  4YWL A;  4C3H B;  4Q43 A;  3H20 A;  3W5O A;  1D1I A;  2VR1 A;  3S1N B;  3GTJ A;  2VB2 X;  2BCO A;  3UDF A;  4JBM A;  1JJ2 A;  4NLG A;  2DZD A;  2CKZ B;  4MN3 A;  2ICE C;  3CHB D;  1W2B A;  4B3T H;  3H3V C;  2YCH A;  5ELE A;  1NAP A;  2I07 B;  3K6O A;  5IOC A;  4ED3 A;  2XSC A;  2NZH A;  3FKI A;  4LFB H;  4KD4 A;  1EYA A;  1HNZ L;  2A6H C;  4KV6 A;  1E4E A;  3CU7 A;  2KEE A;  2C28 A;  1WOC A;  1XXG A;  1W3S A;  4J9K A;  4ECV A;  3X3N A;  3VA7 A;  2A5H A;  2F0D A;  2QGQ A;  2MQH A;  4DV2 L;  2EYL A;  1IOV A;  3S24 A;  4DL2 A;  1EHI A;  1GUG A;  4OEL B;  5IGC A;  3KBG A;  3DM3 A;  1SFO H;  3A5U A;  1ZHS A;  4XYQ A;  1X9N A;  5M5X B;  3ZJY C;  1XNQ Q;  2UXB H;  4AQY L;  4ME3 A;  1D5X C;  1TWF B;  3HXL A;  5FPO A;  3LP8 A;  3QOL A;  3RZD H;  1STG A;  1JR0 D;  3K3V A;  2YTV A;  5C6A A;  4JI1 Q;  1TAE A;  2R93 A;  2HDM A;  5KNC A;  4P74 A;  5FLX c;  1M8A A;  1CSP A;  3P75 A;  1KEE A;  4IUR A;  1QUQ A;  3RD4 A;  4XQJ A;  4U6P A;  4RGO S;  4JI1 L;  4FYD A;  4QWA A;  2N8N A;  5IP9 G;  1KJ9 A;  1VQM A;  4TV8 F;  5JH7 F;  1GHK A;  1M0W A;  1K73 C;  2HQL A;  5A2Q W;  2RF4 A;  4EQO A;  1TWC A;  3Q8D A;  2BA1 A;  4ALP A;  4A3M B;  1PDQ A;  1XMQ Q;  2B63 G;  1HTP A;  4B3M H;  4LFA Q;  4LUZ A;  1VQE A;  2EYO A;  4M8A A;  4KHP Q;  4LFC L;  3D4D A;  3ULJ A;  4EFB A;  5EOY A;  3K5H A;  2DNE A;  3BAB A;  1YIT A;  1TWH A;  2GN5 A;  4NP5 A;  3J7Z C;  1HNX H;  3I73 A;  3OMG A;  1SNO A;  1VQD A;  5BPH A;  3FMA A;  3U9T A;  4X6A H;  4DV3 H;  1TR5 A;  4C2M H;  1XPR A;  5IP7 H;  1HA5 A;  2JA6 H;  2VQD A;  5KFG A;  2C2D A;  1LT6 D;  2FJZ A;  2ZDH A;  1N36 Q;  3D4W A;  4HJ8 A;  1VCI A;  1H9M A;  1IYJ B;  2ZTE A;  2WAQ E;  2VS1 A;  3KHH A;  2VB3 X;  4XIG S;  4LWC A;  4JI7 L;  1Y1V H;  3HOZ B;  1AFP A;  2RDI A;  3LNN A;  4R1J A;  2F0I A;  2C00 A;  2ZM6 H;  2FMC A;  3NTI A;  1Q81 C;  1SNQ A;  4N9P A;  4LFB Q;  2R7F A;  1KLU D;  1SYE A;  3J80 E;  4FF2 A;  4FS2 A;  4LF9 Q;  4FBU A;  4BY7 H;  1FNV A;  1U0L A;  2IWH A;  5LMU L;  1HPC A;  3JAM E;  3K58 A;  4PMB A;  2UVR A;  2UUB Q;  2EY5 A;  3GTG H;  1JIH A;  4QW8 A;  1PFS A;  4XX0 B;  1NR2 A;  2EPB A;  4APV A;  2BQU A;  2D0O A;  3LWE A;  3MHB A;  5ELN A;  4X65 H;  4IUT A;  3LWU A;  2ALZ A;  2B3G A;  2D0P A;  3IN5 A;  4UHV A;  2NYZ D;  1UE5 A;  3HOV G;  4JV0 A;  4A2A A;  4ODG A;  2MO0 A;  3T1Y H;  2FLL A;  2V4Q A;  1PTO F;  2XRQ D;  1Y69 U;  3VYR A;  1AZP A;  3GQC A;  1E2V A;  1FD7 D;  4LF7 L;  1N48 A;  3U9S A;  1UNN C;  4IAL A;  1A15 A;  1WTR A;  2FPP B;  2M9V A;  4RNN A;  2Y0S B;  2KEC A;  3IRB A;  2EYM A;  4WJ4 A;  2FLN A;  4M1U B;  4GKK L;  4J15 A;  5LA6 F;  4YR0 A;  4ZYS A;  1RK6 A;  2OH2 A;  1B9N A;  2CW0 D;  2K5D A;  1NY4 A;  4KKU A;  1L2Z A;  1AZQ A;  4EBD A;  1J5E H;  3QWN A;  3H09 A;  4RB0 A;  4OX9 Q;  5H1S E;  3BYT B;  2XC9 A;  5DAU A;  1IBK H;  3Q24 A;  3CXC A;  3N8D A;  1FR3 A;  4A3B B;  4IUQ A;  1Y8O B;  2FB9 A;  3VPD A;  3PV0 A;  2V4R A;  5CV9 A;  2IX1 A;  4I4T F;  3D6W A;  2FPG B;  1TY0 A;  3QJY A;  2JA7 G;  2NWG A;  4CHT B;  1I94 H;  2MUY A;  1B04 A;  1Y1W G;  1JB7 A;  2LFN A;  2WIN B;  5DLQ E;  1C48 A;  2O5J C;  2R7Z G;  4AQY H;  1KHI A;  2GA4 B;  5I47 A;  4RCN A;  4RB3 C;  1ULZ A;  3DWP A;  4HSV A;  5JPM C;  4DR7 H;  5BMV F;  2RQX A;  4YCV A;  3H91 A;  3BVZ A;  4DV0 Q;  4JI5 Q;  2F0G A;  1M6V A;  2NVY B;  3Q8P B;  1A2U A;  2RKS A;  2R8K A;  1VMP A;  5KND A;  3F2U A;  3HOU G;  2VL6 A;  1LTI D;  1D7Q A;  5KX5 F;  5KFX A;  4LH6 A;  1C0A A;  1OWT A;  4LF8 L;  1XWE A;  4A3F H;  4RAZ A;  2F4V Q;  4RUA A;  1Z2N X;  3CQZ H;  1ONL A;  4WJW A;  1BVS A;  3VDY A;  3DMU A;  2JSO A;  1GSO A;  2M2L A;  2VPQ A;  4IO9 A;  2LXJ A;  1STY A;  3L0O A;  1FNW A;  3HOY H;  2UXC L;  5EKI A;  1KJJ A;  3P7J A;  2F3V A;  4PMC A;  4DUY H;  4OWX B;  2RGV A;  1VQ8 A;  2IBK A;  4Y7N B;  2L15 A;  1SE4 A;  2OCE A;  2X6L A;  5C3E B;  1HNX L;  1X56 A;  2FXQ A;  2JN4 A;  5KFI A;  2B2V A;  4LF4 L;  1LTR D;  3C2P A;  1EUJ A;  2A74 C;  3GTL H;  4LSA A;  3HOU H;  4JBK A;  2R7L A;  2M00 A;  1N36 H;  4IOC A;  4HED A;  5IT9 c;  2ZTD A;  2IJ0 A;  2RSO A;  1AN8 A;  2B2W C;  1XDN A;  1C8C A;  3TQ1 A;  2EYJ A;  3ND8 A;  5CR3 A;  5E4W C;  4J9S A;  5JAV A;  2DPI A;  5JVG 3;  4DR5 L;  1EY4 A;  4UCR A;  5ELB A;  3HOZ G;  2F0W A;  1T3N A;  2K03 A;  3RGZ A;  1EIG A;  1A2T A;  1STE A;  3M9M B;  4CKE A;  3CCE A;  2B2Y C;  1E0B A;  5H80 A;  4HSP A;  2EOT A;  5IYC H;  1BJT A;  3MEF A;  1GUW A;  1CM9 A;  1C7Y A;  5E3F A;  3UDI A;  1N33 L;  3GTM B;  3HOX G;  3RZO H;  2ID0 A;  4XT1 B;  1XTD A;  4RHS A;  1N8R C;  3PO2 B;  4YY3 L;  5IT9 E;  3NXW A;  3DWA A;  2W6Z A;  1BQQ T;  4YHH L;  5KIX A;  1VQB A;  2NZ1 D;  1CHQ D;  3S1R B;  5C4J H;  3OWE B;  4OGQ C;  4FDB A;  4X65 L;  3LML A;  3NHH A;  4DV5 H;  1LV9 A;  3JRW A;  1IKM A;  1CHP D;  1VQG A;  1WSC A;  3RUZ A;  4H44 C;  5K5P A;  4K6D A;  2IX0 A;  4X62 L;  4LF5 L;  2UXC Q;  2UXD Q;  3RV3 A;  4O3N A;  3VPC A;  3QB3 A;  4O4H F;  4LF7 H;  3PUV A;  4YJ2 F;  2PQA B;  1S40 A;  4FM9 A;  3PVX A;  2PVP A;  4YCU A;  3TRE A;  2A6E C;  1MJC A;  1LTB D;  4I7H A;  2W7P A;  4DK0 A;  1XNQ H;  2C35 B;  4A4I A;  5BN5 A;  3RN2 A;  3RAX A;  4JI3 L;  3UDX A;  2C22 A;  2KQ3 A;  2E76 C;  5M5Y H;  1IL2 A;  3AEV A;  4L5R C;  2DUD A;  1RTO A;  4DR3 L;  2EZV A;  3CD6 A;  3A54 A;  2W9C A;  2V58 A;  2D2C C;  3A74 A;  3NWT A;  1ASZ A;  3SE7 A;  3KF6 A;  1GSA A;  4AYB A;  3VR4 A;  4F88 A;  4R8U A;  1EQR A;  2EJF C;  1TWA H;  2WAC A;  3CCL A;  4GC7 A;  1RIP A;  3PW0 A;  2BQ3 A;  1CK1 A;  4HMI A;  2CHB D;  1N32 Q;  5IGD A;  5C0X H;  4JI7 Q;  3IFD A;  1M7J A;  2A6H D;  4R8I A;  1MIU A;  5CV5 A;  4IZO A;  4A3I B;  1L1O A;  4O3P A;  3HOY B;  1S68 A;  5C5J A;  5L1J A;  3NBH B;  1I94 L;  1QVC A;  1CQJ B;  1JE5 A;  4IAJ A;  3T1H L;  5E1F A;  5DQG A;  1AEX A;  1IBM L;  2CZG A;  1AW7 A;  2JP1 A;  4DUZ Q;  4YR3 A;  1YNJ C;  3S14 H;  1E4G T;  5E4X A;  4RH6 A;  1S5F D;  3MJF A;  5T14 A;  5M5W B;  2CW0 C;  4Q44 A;  1QIL A;  1SJH D;  5KFB A;  3NEM A;  4DA2 A;  4DNI A;  4TQU S;  3T51 B;  1ROD A;  4ZUI A;  4ZCK A;  2K1B A;  3JAM L;  3IKJ A;  1OXU A;  2R92 B;  3GTG A;  3OPO A;  3G6J B;  3KOJ A;  3GTQ A;  4K8I A;  3JAM W;  2F4V L;  4ECQ A;  4KHP L;  4P2C B;  3PR5 B;  1GOZ A;  1N34 H;  2Y0S G;  4MV8 A;  3NPP A;  4B9W A;  2VPS A;  4Q45 A;  1YHQ A;  1KXL A;  5BN3 A;  4LF8 H;  1ML0 D;  1XPO A;  5IGG A;  1O7I A;  3S17 B;  3SDZ A;  3D4R A;  4IWX A;  4R8N A;  4LF9 L;  3CCU A;  5IY0 A;  4YCW A;  1ICW A;  3G8C A;  2FFK B;  4DUY Q;  1WFQ A;  3ITP A;  4KJO A;  4UAI A;  2K4K A;  2HHH H;  2B2T A;  4ZQ3 A;  3CQZ B;  1D1K A;  2A6E D;  2PNH A;  1A3V A;  1SE8 A;  2AMC B;  4HMJ A;  3GD7 A;  1STN A;  2AU0 A;  2EYP A;  1V43 A;  1CA6 A;  2F0V A;  1UC9 A;  3MXP A;  1BDO A;  4A93 G;  4IPG A;  3PIP A;  4A3B G;  1WTH A;  3MFI A;  2WP8 J;  4B3R Q;  3BZK A;  4KK7 A;  4O2D A;  1YVC A;  2G9D A;  5KG4 A;  4F50 A;  1GUS A;  2R6G A;  4AYB B;  1E24 A;  4UPA A;  3KDF B;  1KD1 C;  1Z2P X;  2FK1 A;  4YR2 A;  1Y14 B;  1JOK A;  1N36 L;  3I4M B;  4N8F A;  1LLR D;  2IX3 A;  4DV6 L;  1IW7 C;  1SDF A;  2J4X A;  1PV4 A;  1IBK Q;  2FP4 B;  3PO3 B;  2NUC A;  3VYU A;  5KG7 A;  1H9R A;  2HIV A;  3OSO A;  1I50 B;  3H6M A;  4DR5 H;  1JLL B;  3GTG B;  3R5X A;  3KLR A;  1CKN B;  1UE1 A;  2MO1 A;  3E6Z X;  1WTO A;  1I6H H;  5KT3 A;  5C44 B;  2V1C C;  4J9P A;  2KCN A;  4IUV A;  4R4T A;  3I91 A;  2TSS A;  5C4J B;  1Q8K A;  1QG7 A;  1L1O B;  2DJF C;  4MV1 A;  4ED6 A;  4A76 A;  3HS0 C;  5EJW A;  4L6T B;  3OW2 A;  4LMY A;  4X64 H;  4A3D B;  1SYB A;  3K57 A;  1X6O A;  1GUT A;  3V05 A;  4F87 A;  5IYD H;  4QWE A;  3KHL A;  4CKB A;  2VA2 A;  2JEG A;  3U4V A;  1ILQ A;  1WJJ A;  4KY6 A;  4J1M A;  5FJ8 H;  5IYD G;  4DAP A;  4UCU A;  2CQO A;  1B6R A;  2R92 A;  1RJT A;  1TS4 A;  2K75 A;  3AFP A;  5C1O A;  4PQX A;  1EIY B;  4O2B F;  1X3Q A;  5KT2 A;  2WTF A;  1NTG A;  1I4R A;  5CBE E;  2LMC B;  2M05 A;  4LH7 A;  3PGZ A;  2YZM A;  2LSS A;  2R7Z B;  2AKW B;  5C8Y F;  5EKL A;  1LAB A;  2SNS A;  4X3S A;  5DM7 3;  4QIW B;  2GPS A;  5KRU A;  2HDL A;  1EY6 A;  2JA9 A;  4C56 C;  1K1S A;  4HJ5 A;  2NB0 A;  3A8I E;  4R4Q A;  1XNQ L;  1KJI A;  1T36 A;  1F9R A;  4JK1 C;  4C1N I;  1PRT B;  1VQO A;  5TSS A;  3R3O A;  2H1E A;  1XYI A;  1WTQ A;  4EGQ A;  5LL6 b;  4JI3 H;  5KYI A;  2ZXO A;  2K5H A;  3A8J E;  5CV8 A;  5KFY A;  5KFD A;  4DXG A;  1UC8 A;  3PIO A;  5CMD A;  2F0E A;  4IUU A;  2NVX H;  1JT8 A;  3BG3 A;  2VUM G;  4ZI7 F;  1EYG A;  2NVQ H;  5FO8 B;  4RGT A;  3CC4 A;  1ZHQ A;  5BN4 A;  2W9B B;  1WD0 A;  4MV4 A;  3TN2 A;  4AYB G;  5FPR A;  4EEQ A;  2PCF B;  1L0Y B;  4BY1 B;  1UAP A;  2KA7 A;  3L4K A;  2C9O A;  4RA8 A;  2R82 A;  5M3F G;  1GHJ A;  1JMC A;  5JEA H;  4QQB X;  2Z8L A;  1XX8 A;  3PW5 A;  4TKO B;  4YJ3 F;  3S1R H;  4IPC A;  2PMZ B;  3N6R A;  3I8Z A;  4R7R A;  2BE5 C;  4IRC A;  1HFG A;  1LM0 A;  4JPB W;  5DEH A;  4XYM B;  2D9U A;  1RHP A;  2PYK A;  4EYI B;  1N33 Q;  1HTL D;  3MR5 A;  3KF8 B;  1A6X A;  2B2U C;  2UVV A;  1DJR D;  3GIM A;  2BE5 D;  2LXK A;  5GAE C;  4O4I F;  3GTP B;  1Q3L A;  3FVQ A;  1TT2 A;  2CWA A;  4G7O C;  4KTA A;  2CH4 A;  2R93 G;  3PR4 A;  2KHS A;  5JUM A;  1P8L A;  2PI2 A;  2UUB L;  4NMZ A;  3QZ8 A;  1HXY D;  4PDB A;  1N34 L;  2XN9 C;  1CTM A;  5IGE A;  1JC7 A;  1BNC A;  5DG9 A;  3U4Z A;  2E2J H;  3PUW A;  1YI2 A;  3Q8R B;  1CSQ A;  2ZTC A;  2VQF Q;  3J7Y W;  1KDA A;  3M4Y A;  3QG1 A;  1K8G A;  3KFU A;  4DV3 Q;  4M9U A;  5EPL A;  2FLP A;  1KC8 C;  1TWC B;  1QVG A;  3CW2 C;  3BA8 A;  3E5S A;  3VR6 A;  4O1N A;  4C3I G;  4A3J H;  2EDG A;  2XVS A;  3NP8 A;  4IJH A;  1I50 A;  2JYO A;  3N6X A;  5FLX W;  1R9T H;  2XIG A;  3WDN A;  3OSP A;  2Z6K C;  4IFD G;  1KNA A;  4A3K H;  1VQH A;  4C5B A;  1CT1 D;  4JOI A;  2IMW P;  4RG1 A;  4MTK A;  3DEO A;  3D3R A;  4QY7 A;  1Q1B A;  5F9L A;  5EPJ A;  5FLM G;  5DGB A;  2UU9 H;  4UP9 A;  2O2L D;  3FRP B;  4H0L C;  1R9T B;  5EDW A;  3IL8 A;  2JA8 G;  1N56 A;  2AQ2 B;  1VQ6 A;  4ID6 A;  5FO7 B;  2P5Z X;  4FXD A;  3GTO B;  2JEJ A;  1VQ9 A;  2YV5 A;  4MV3 A;  4RZQ A;  4DR2 L;  2R7D A;  4K5V A;  2EXD A;  5LHY 1;  4LF5 Q;  2DN8 A;  3RLO A;  2UXD L;  2Z0S A;  3K5O A;  5I6W A;  2EYH A;  1DV1 A;  5KKN B;  5C3X A;  4K14 A;  4UP8 A;  5LXT F;  2NVT B;  3FP9 A;  4WJ3 M;  4ULL A;  3S1M B;  3GV8 B;  1EYD A;  3M7N A;  1I4Q A;  1TWG A;  3J80 L;  4ECX A;  3BDC A;  2Q8R E;  1EY5 A;  3MZ5 A;  3CC2 A;  3CAM A;  4LFA L;  4QIW A;  3QZ7 A;  2E8G A;  1ESF A;  2GVB A;  1I3Q H;  4L63 B;  1VKZ A;  5C0X G;  1I3Q A;  1Q1E A;  4Q5V A;  2Q8T A;  1I7L A;  5JVD F;  5C4Z A;  5GON F;  1K83 A;  1T5X D;  3WOE A;  4R8U B;  2HVR A;  4X64 L;  3V4S A;  2W8K A;  2W8L A;  1TWG H;  2QEX A;  1JOQ A;  1LTG D;  1AN7 A;  4CDC C;  1STB A;  3KHG A;  2K32 A;  1YZ6 A;  5CYU A;  4I50 F;  3F1Z A;  3DF7 A;  5KG0 A;  5IYZ F;  4J9M A;  4X66 L;  4DL3 A;  3NWS A;  4KJN A;  4L5T A;  1I6U A;  2VZA A;  2ASJ A;  1E3P A;  1FJG H;  1VQI A;  3PUZ A;  4DR5 Q;  4A3E G;  5D1P A;  4MZ9 A;  1EU4 A;  3CC7 A;  4JUZ A;  5J2U F;  3GTJ B;  1K8M A;  1VQL A;  4C5C A;  1QNU A;  4FXK C;  2YW2 A;  1Y1V B;  2VY3 A;  3HOZ H;  4C3H G;  1PYW D;  4RAU C;  5E7N A;  2N78 A;  3E9I A;  1KJQ A;  2YS6 A;  4Y8V B;  3KF6 B;  1Q7Y C;  2K28 A;  1W6J A;  4JC0 A;  3GTO A;  2Y0S A;  3UDG A;  4N9T A;  4LFB L;  2UUA L;  1MD2 D;  4ED0 A;  4EBC A;  1S10 A;  4A3G B;  4POG A;  3V2T A;  4HN7 A;  3FPU B;  1IL8 A;  4OO1 I;  4EEY A;  3BU2 A;  3I70 A;  3RZO B;  2XD4 A;  1QB5 D;  4RKL A;  2E5L H;  4UDU C;  4KLK A;  3RN5 A;  4MA0 A;  1TU2 B;  2NVY A;  1YEZ A;  3DWQ A;  3PO3 G;  1JOR A;  2IHE A;  1F2Z A;  3F2B A;  4X3K A;  4I55 F;  4HQ6 A;  3H15 A;  4DV7 L;  2OLS A;  3SVM A;  2UUC H;  1TY2 A;  1V1Q A;  4RWS C;  3HOY G;  2X0S A;  2UXB L;  2XCA A;  4JI8 L;  4LSX A;  1NE3 A;  2MJ8 A;  1RYS A;  1X65 A;  2WKC A;  3GTP H;  1B3Q A;  1S5B D;  4QL5 A;  3H3V H;  3S1Q H;  4JYA L;  1E4E B;  3P1H A;  4GKJ Q;  4TVA B;  3U9O A;  1OO9 B;  4MV7 A;  1SLJ A;  4HYK A;  3SK8 A;  4ECR A;  4Y7N H;  1EIH A;  3HP3 A;  3HB9 A;  3NBI A;  1J8I A;  1RF2 D;  1Z7T A;  1DIK A;  1EUC B;  3PO2 G;  3RUP A;  4IUP A;  4BXX H;  2I8C A;  2QIL A;  3RBE A;  2A69 C;  4DR6 Q;  1TWF H;  1B44 D;  2LY7 A;  3AB9 A;  4QF4 A;  3WOF A;  4POF A;  3MAQ A;  4B3M L;  5FLM H;  2X6G A;  4WD3 A;  3MR2 A;  3ORR A;  1BR9 A;  4U7C A;  1YHB A;  2NVQ B;  2Z4I A;  3QOJ A;  2VOB A;  5C4X G;  3PF5 A;  4ME5 A;  3OTO L;  5JEA J;  1AH9 A;  2NVX A;  4J0M A;  4ECS A;  2F1M A;  2R92 G;  1EWH A;  4K6L A;  4A3I G;  3OMC A;  3Q2O A;  1EY9 A;  1O7L A;  4EQ5 A;  4A3J G;  2VQE Q;  2N49 A;  5J22 A;  2KUM A;  1DYQ A;  3E0J A;  5I9O A;  4ZKC B;  3HGB A;  4A3M G;  2WB1 G;  4Q0F A;  4DNT B;  1TWG B;  1TVX A;  3M4O B;  2BA0 A;  3NSW A;  3T13 A;  2JEA I;  3I12 A;  1B1Z A;  1LTT D;  1ENC A;  2XWJ B;  5HBR B;  5CAE B;  4G57 A;  5KFV A;  1WTP A;  4IZ8 A;  2OF1 A;  1PX2 A;  2WII B;  3OW7 A;  1JWU D;  1C30 A;  3S1M H;  2XNA C;  1TS3 A;  2FK3 A;  1EZ8 A;  4QJF A;  1CS0 A;  4HNV A;  2ZM6 L;  1E2Z A;  2A69 D;  1VQN A;  4CKC A;  4JI0 H;  4A3K B;  2B39 A;  1RJP A;  2HGS A;  3J81 L;  3I55 A;  2UXD H;  2R86 A;  4TV9 F;  3J7A 5;  5KGU A;  3G6V A;  2FPI B;  3T56 B;  1B3A A;  3MR3 A;  2KOL A;  2QYZ A;  3HKZ G;  2AUJ D;  4EVO A;  2JA7 H;  3GIJ A;  2PQA A;  3FEW X;  4GLV B;  1I94 Q;  4RNM A;  1PXU A;  5KFT A;  1EZ6 A;  3T16 A;  3RZD B;  1JDE A;  4DR6 H;  3J81 j;  3GTP A;  4NXN Q;  1YNN D;  4NPS A;  5IT9 L;  4BBR H;  2I87 A;  2Q2I A;  5F2D A;  2PN1 A;  3U50 C;  3OSN A;  1I4X A;  5I2Y A;  2MGS A;  5M5W H;  2W9C B;  1EQQ A;  1N9W A;  1R4P B;  3TZD A;  1IHZ A;  2Z6B A;  2XCP A;  4R4O A;  3VA5 A;  4LK1 C;  1J5E Q;  2PMZ A;  1R4Q B;  4YWK A;  3GID A;  4EG0 A;  4CJ0 B;  1BBU A;  4O4L F;  4PZ6 A;  4AQY Q;  1HNZ Q;  2MHV A;  1PH5 A;  3TBI B;  4YIJ A;  4DK3 C;  1BNZ A;  2JA8 H;  4JW0 A;  2PZW A;  1EQV A;  1GXD C;  4KN4 C;  1OTC A;  2E2I A;  2KVM A;  1PH1 A;  3NEN A;  3NE5 B;  1IW7 D;  4JI2 H;  3Q1K A;  3PIP 3;  2SDF A;  2HCI A;  4UCT A;  3PW4 A;  4B08 A;  2K5Q A;  2CW8 A;  3K81 C;  3FPP A;  4CBV A;  3BA9 A;  4A3K G;  1HUM A;  5CB4 F;  4LF7 Q;  3R2T A;  1KDB A;  4A3E B;  1U4L A;  4DR2 Q;  1GSH A;  5I6Y A;  2EE1 A;  3M9N B;  5FK9 C;  3EFX D;  4XXE A;  3SR1 A;  4FU0 A;  4DV1 L;  1K3B C;  2KHI A;  4KKS A;  3MWY W;  4BY7 G;  1EFI D;  1EU3 A;  1HZ9 A;  3GIQ A;  4I7Z C;  2UUC L;  4DV7 H;  4JOI C;  4A3C H;  3WNZ A;  1LT5 D;  1KC7 A;  4JI8 H;  2OWO A;  4H7B A;  4K5W A;  1K83 H;  1H9S A;  2JEB I;  4WBN F;  1NUC A;  3RMH A;  2B63 H;  2YRW A;  4G7Z C;  3W2D A;  1A62 A;  4H02 A;  2NU6 B;  4JYA H;  1EYZ A;  2KBN A;  1Y1V G;  3E5N A;  1LTS D;  1P16 A;  2F0T A;  4B3S Q;  5IP9 H;  5KFO A;  1DCZ A;  3RTX A;  5IYB G;  3ZYY X;  5KT5 A;  1V8Q A;  5JJL A;  5KG3 A;  3MC0 B;  3C0F B;  5CV4 A;  5IYB H;  3QFF A;  3ICE A;  3T1Y Q;  1VQP A;  4FS1 A;  1RJQ A;  3S2H H;  2K50 A;  1SNM A;  4K0K L;  5KFQ A;  2IW3 A;  3V96 A;  5GAG C;  4IFD J;  5JVL A;  4ECU A;  3SK4 A;  4RUC A;  1TS5 A;  4YBZ B;  5M3F B;  2UXC H;  1TWA A;  1EOT A;  5FLX E;  3I4O A;  2J9G A;  2JQO A;  5FOB B;  5M9O A;  2L55 A;  2YU9 A;  2RCF A;  3HZX A;  2HD3 A;  2DNC A;  2VUM H;  4BBS G;  2I5M X;  3CCR A;  4E4T A;  5KFM A;  2AWN A;  4ECY A;  5G3L D;  4HR7 A;  4PV1 C;  2R8J A;  4LF4 H;  3OUU A;  3KAJ A;  3Q22 A;  4GZY C;  1JB3 A;  3OHB A;  4DUZ L;  2RGR A;  2FHT A;  1Y8N B;  1XMQ L;  3N44 B;  3C46 A;  2YTX A;  2FMA A;  4E6I A;  2RBM A;  5KFE A;  4FVM A;  3KJP A;  4B3R L;  5CBA E;  5KNB A;  1L1O C;  3GIK A;  1JQY D;  3KXY T;  2HVS A;  4RMF A;  3J7A V;  1F9S A;  4RU9 A;  5BR8 Q;  1T9H A;  5K2M A;  1I3Q B;  1MKH A;  4LW1 A;  3N43 B;  5COR A;  3O13 A;  1BCP F;  3CCV A;  5DGA A;  1WCM B;  1PH6 A;  3MXN A;  4OO1 H;  4BA1 I;  3CKI B;  1GM5 A;  1WTW A;  4YY3 H;  2JA5 A;  1PA6 A;  1B9M A;  1SAP A;  3PSI A;  1JCK B;  3S2D B;  5C1P A;  3GTM H;  2IPK D;  4P72 A;  2R93 B;  3FKI G;  3Q0A A;  3FMC A;  1RCV D;  1Y8P B;  3RGX A;  4DR6 L;  3G6X A;  4GOP C;  4NXN H;  3TS2 A;  2WAQ A;  4AIM A;  2ATL A;  2I0Q A;  3IFT A;  2OXP A;  1S9F A;  1VQF A;  1NMF A;  4R9W A;  5IGB A;  1MHW C;  3OIP A;  4LF5 H;  1U4M A;  4C3J B;  1GO3 E;  3BZD B;  4GNX C;  3GV5 B;  3PIO 3;  3BQ0 A;  2F52 A;  2ICI A;  5L37 A;  3R23 A;  3KTM A;  1BUV T;  1SND A;  3J80 c;  1JJC B;  1XMO L;  5DG8 A;  1DV2 A;  4B9X A;  3TQY A;  1QJO A;  1Q46 A;  4ZOL F;  1JDB B;  1DZ1 A;  4ZRZ A;  2L9H A;  3L2P A;  1DGS A;  4F7X A;  1YIJ A;  3R93 A;  5L9X A;  2UU9 Q;  5KFL A;  4Q8F A;  2A1A A;  2FIN B;  4MA5 A;  4NDX A;  3M4Q A;  1VF7 A;  4YY3 Q;  4ZHQ F;  1IYU A;  1X3F A;  3VMM A;  3T5J A;  2YU9 B;  5M5Y B;  5EKK A;  1SXT A;  2D5D A;  3R5F A;  4BY1 G;  3GIL A;  1G2S A;  5C0X I;  2A73 B;  1S0M A;  3C3L A;  2J6U A;  1WD1 A;  2Y0S E;  3PQI A;  3R8B A;  3A56 A;  1RTN A;  1RK5 A;  1II3 A;  1UE7 A;  3AU7 A;  4A3F B;  1PRT F;  1TII D;  1ICF B;  4UCS A;  4CJ2 C;  4HJ7 A;  4A3I H;  2R92 H;  3EQL C;  4DV4 L;  3T1H H;  4JI3 Q;  4Y52 H;  3TME A;  2QK4 A;  2NN6 H;  1IBM H;  1MJE A;  1JX4 A;  1PYS B;  2KHJ A;  3TP6 A;  5ISR A;  4OWW B;  1B50 A;  1X55 A;  3DUZ A;  2CVR A;  1SRO A;  4NXM Q;  1B6S A;  1EY8 A;  2F0O A;  2L1B A;  1S5C D;  1E4F T;  1EIF A;  5LMN Q;  4XZ3 B;  2NUA B;  4QWC A;  2H5X A;  3GDE A;  1ZKO A;  4HCE A;  1JWM D;  3U58 A;  3PCO B;  2K5W A;  2RSN A;  3HOU B;  2IY5 B;  2VXW A;  2J7Z A;  2VNU D;  1EUD B;  5KG2 A;  4ECT A;  2F4V H;  3NEL A;  4OX9 L;  3HOW B;  3BVG A;  3W3A A;  2NTS A;  1FNU A;  5IE8 A;  1BO0 A;  1HA6 A;  1CKO A;  3EBE A;  4X64 Q;  4RHR A;  2TMP A;  2R7K A;  4DV1 Q;  3CME A;  4K0K H;  2K6A A;  1UEB A;  1GLV A;  4IR1 A;  3W1B A;  4O3S A;  4HID A;  5JJZ A;  3STB C;  1X32 A;  4YQW A;  2PZU A;  1FL0 A;  5C3W A;  3OOC A;  2HIX A;  4JVZ A;  1UNS A;  1NBW A;  2NN6 I;  2E2H A;  2O03 A;  5EWG A;  5C4X H;  2WFW A;  3FKI B;  3ERO A;  4JI5 L;  2P0A A;  1S0N A;  2WE6 A;  5J39 A;  2FK2 A;  1Z47 A;  2ES2 A;  5C5M A;  3K59 A;  1Z2O X;  4DL6 A;  3KLS X;  3EPI A;  1MGS A;  2E5L Q;  2YYA A;  5CV7 A;  3I7F A;  1DD2 A;  4A3F G;  2V4D A;  2VQF L;  2WKD A;  4RCO A;  3E0E A;  3V4Z A;  3TS0 A;  1ZYR D;  4C1N K;  3PO2 H;  4A93 B;  2R6F A;  1XMQ H;  1CQF A;  3HFZ B;  1SYG A;  4LUO A;  2C2R A;  2JE6 I;  3RIZ A;  1HCZ A;  3I4L A;  4B3R H;  1SR3 A;  3B6Y A;  2CWP A;  3GTQ H;  1SE3 A;  5LP6 F;  2C5C A;  1HZA A;  2ALY B;  5FD5 A;  3KAK A;  2HJW A;  2ZM6 Q;  4DR3 Q;  3AFQ A;  2WDT A;  4ECW A;  2JEI A;  1GVP A;  2K14 A;  3GO5 A;  3K7U C;  1VQC A;  2W57 A;  1FKA H;  3GQB A;  1TWH B;  4GC6 A;  5IIF A;  1UUP A;  2JK8 A;  5C3E G;  1BBX C;  3PO3 H;  1JIC A;  1JE4 A;  2L0C A;  5C3E H;  4IQZ A;  4A3L G;  3CRK C;  1D6E C;  1OXV A;  1BCP C;  3HOX B;  5CV6 A;  2JA8 B;  1J9O A;  3SEB A;  3N40 P;  5AJ3 Q;  5FLX L;  3LWB A;  3K3P A;  3RAQ A;  4DK6 C;  4DR7 Q;  2ZJR A;  4GN5 A;  1VAJ A;  1ZYR C;  3RNU A;  4B3S H;  4KN7 C;  4PG3 A;  3D0F A;  1ESR A;  1X3G A;  4ME6 A;  4MAM A;  4OHJ A;  4HIM A;  1ILP A;  3A5Z B;  3J7A K;  2ENB A;  4ILW A;  4P71 A;  4O2A F;  5LL6 X;  3EYY A;  2V9W A;  2QF7 A;  2PZT A;  1BXR A;  5KG6 A;  2QKI C;  1Q82 C;  2J6T A;  3RBD A;  1PHJ A;  2AGQ A;  4ZLT F;  3WO1 A;  1S3O A;  1IXR A;  4ZQI A;  2E2H B;  4B3M Q;  1VQK A;  4C2M A;  4A3E H;  5KFA A;  5FD6 A;  2IP4 A;  2R3Z A;  3D6C A;  1AP0 A;  4HNU A;  3NQT A;  5IWA Q;  1IBL Q;  1AUV A;  2YRX A;  1HNW L;  3BG5 A;  1B8A A;  2NU7 B;  3KHR A;  4J9L A;  4A75 A;  1NR4 A;  4DAY A;  1ENF A;  4GLX A;  1F9P A;  4ZKB B;  2JA5 G;  4FF3 A;  4F8M A;  4G7H C;  1PLF A;  3W1G A;  1STH A;  1KAB A;  3HOV H;  2Z1C A;  4DNR B;  4JI4 Q;  1VQA A;  2SCU B;  3AYH B;  1VQ7 A;  2H4O A;  2NBF A;  1KQS A;  3K80 C;  3R2I A;  2PO4 A;  4DV4 Q;  3VYS A;  1WCM G;  3T5L A;  2UXB Q;  4TUY F;  1KJ8 A;  1F2M A;  1BCP B;  2NU9 B;  1KAW A;  3GV6 A;  2KCT A;  3X3M A;  3BQ1 A;  5KT7 A;  4XTC S;  5HGQ A;  2R93 H;  4GKJ L;  1ZXT A;  4WRD A;  5D3D A;  3S1Q B;  2E2J B;  1LT3 D;  1PMR A;  2W6P A;  1QZG A;  1HR0 Q;  4L5Q A;  3SI8 A;  2VQE L;  4ZK9 B;  5JPN C;  5T1I A;  5I9P A;  1S03 G;  4TRD A;  3I2Z A;  2UUB H;  1EY0 A;  2SEB D;  4K8J A;  1HJP A;  4UP7 A;  2Z4H A;  4IN3 A;  2BH8 A;  4RGN A;  4IFD H;  3JAM c;  1EFW A;  4XYO A;  1BGW A;  2AQ3 B;  3UQ8 A;  3GTL A;  2VW9 A;  3V6K A;  1E1O A;  2PMZ E;  5ELO A;  3RLN A;  1XMO Q;  4U67 3;  5KFF A;  5EWF A;  5M3F H;  3RFC A;  3HEJ A;  1K28 A;  4O3O A;  2PW7 A;  5KFC A;  2CW7 A;  4JI5 H;  3G7L A;  5JVH 3;  2AGO A;  1GUO A;  2NZO A;  4X3T A;  2WV6 D;  4NXM L;  2A68 D;  3HOW G;  5D8D A;  3VPB A;  1PH2 A;  4DU9 A;  1Q12 A;  4MV6 A;  3EVQ A;  1DOK A;  5T1G A;  1MSG A;  1G51 A;  2FJ2 A;  1EZ1 A;  1QWY A;  4EQP A;  2XCL A;  2VQF H;  3PW2 A;  3CQZ A;  1PZK D;  3GTJ H;  3S1N H;  3K5N A;  4G4K A;  1BF4 A;  3QR8 A;  2BOS A;  2XTI A;  4CJ1 B;  2WB1 A;  3J7A F;  3M4I A;  4JV2 A;  2EJG C;  1K0S A;  1IOW A;  1KRT A;  4KY7 A;  4PWQ A;  1O7Y A;  3RB4 A;  2EXZ A;  1JOO A;  3MVV A;  3QO2 A;  5FKA C;  1D2B A;  1HR0 W;  1YNX A;  2JA5 H;  3MWE A;  3OYY A;  1QUQ B;  1WTV A;  2HVQ A;  3AQQ A;  4QIW E;  5C5L A;  1PRT D;  3TII A;  3Q8Q B;  3CPW A;  4CDE C;  3LX0 A;  4KHV A;  2UVW A;  3QIA A;  2WAQ G;  4LFA H;  1QNK A;  2R8H A;  4DF7 A;  2ZXR A;  4L1K A;  1V51 A;  1IBM Q;  4GS3 A;  4Z9C B;  2BR0 A;  1H9K A;  1DOL A;  4O3Q A;  5KFR A;  4C2M B;  2DY8 A;  3S15 B;  3M3Y B;  3RB0 A;  4I65 A;  4M7E A;  1EEF D;  4I7A A;  3H40 A;  3N41 B;  3HKZ A;  1KTK A;  4OO1 G;  3V6H A;  4DV0 H;  1L2F A;  2HQE A;  1SN8 A;  3SK5 A;  5K36 G;  2ZDQ A;  5M5X H;  1FJG L;  1I4G A;  4IUN A;  1HNZ H;  1HFN A;  4O0A A;  3HG9 A;  3ULP A;  1Z6H A;  2HUG A;  5A2Q L;  4B3S L;  1NJI C;  1FVI A;  3M3Y H;  3S15 H;  2BQR A;  5EPK A;  2PQE A;  4DV6 Q;  4OIJ A;  2CFM A;  2F0H A;  2YTY A;  4PNY A;  4RNO A;  4DV2 H;  5DLG A;  4WOR A;  2YU9 H;  4MV9 A;  2MP1 A;  1CFM A;  3N52 A;  3I3C A;  4NKL A;  5DQH A;  2UUA H;  4ZUJ A;  2MCT A;  2KCC A;  1OXT A;  2ATW A;  4AYB E;  1RD9 D;  1X54 A;  4V0B A;  2F3W A;  2FKL A;  1YJ9 A;  2PI2 E;  5KFU A;  1SYD A;  2E5L L;  3NTH A;  5FJ8 G;  4KI0 A;  5M3M G;  4JI6 L;  1K8O A;  2JA6 B;  3AMU A;  2QDL A;  3UE1 A;  1SMY C;  3T53 B;  2NVT H;  1PH4 A;  2ZT9 C;  2R84 A;  3JC6 6;  4BS9 A;  4JI1 H;  1H95 A;  3HKZ E;  1HZB A;  5KG1 A;  1SEB D;  4DR1 L;  1TS2 A;  1TQO A;  5HV6 A;  4GNX B;  3S9W A;  5CGK A;  3Q23 A;  3I4N G;  1LTA D;  2SOB A;  4LF6 L;  3URY A;  1XJV A;  3GII A;  2RCN A;  3J80 W;  4OWT B;  1G6P A;  1PH7 A;  3EJI A;  2DGY A;  2XGQ A;  1QCB D;  4BY7 B;  4F4W A;  4BWS C;  2F0M A;  2YS7 A;  3WWV A;  4RB2 C;  4J8Q A;  1JKJ B;  5AJ3 L;  3K5I A;  3DEP A;  3EPG A;  1SCU B;  2RA4 A;  4DGZ A;  3G48 A;  2QDB A;  2F0N A;  4HR7 B;  1BBW A;  2DJG C;  2X69 A;  4A3B H;  4DV3 L;  1O80 A;  4Q0Y A;  1Y1V A;  1D8L A;  3BVM A;  1U4R A;  4S3S A;  3M85 A;  4KMU C;  2WB1 E;  2BH2 A;  1IYV A;  4XT3 B;  5EQ0 A;  2ZDG A;  1YHA A;  1FGU A;  2A8V A;  3OTO H;  1DM0 B;  4B3T Q;  3KLW A;  3E9H A;  1CKM A;  1NNX A;  3A8K E;  2E2I H;  4JBJ A;  2E2H H;  2JA6 A;  3NBH A;  2XGT A;  1G91 A;  4AH6 A;  1HZC A;  4JI7 H;  3ERS X;  3VR5 A;  4F4Y A;  2R7M A;  4JCV E;  2LKV A;  2Q2H A;  1TWH H;  1LUZ A;  3BDO A;  1CZG A;  1X3E A;  4DAY B;  1PRT C;  2K01 A;  3S2D H;  2ZXP A;  1SEI A;  4JV5 H;  2NN6 G;  1C4Q A;  2EY2 A;  2F3I A;  2JA5 B;  3ETH A;  5KFS A;  4TSS A;  4R4C A;  4HIO A;  4MTD A;  4FP5 D;  2Z6K A;  2QEJ C;  4DV2 Q;  1TWC H;  2K5V A;  4CDD C;  1RKN A;  4JI0 L;  2AQ1 B;  1YJW A;  2B8G A;  1Q86 C;  3M4O H;  4XQN A;  3FDS A;  3BJY A;  1O78 A;  4BY1 H;  1GUN A;  3MFY A;  1SYX B;  3CF5 A;  2YL2 A;  4DKA C;  2ASB A;  1W96 A;  1V9P A;  4IRD A;  3MR6 A;  3H0G G;  5DLF A;  1PYB A;  4EGV A;  1PH9 A;  2GPW A;  1XTC D;  2F0L A;  4GN3 B;  4EX5 A;  3KBX A;  5G3L F;  2BDN A;  4V19 0;  4GKK H;  3KUP A;  4IHJ F;  1GYF A;  3A0J A;  3PW7 A;  2D62 A;  5C44 H;  1MZB A;  1WCM A;  3C1F A;  3A7A B;  4F4X A;  4O42 A;  2OQK A;  3P20 A;  1SFO A;  4YWM A;  1GGO A;  1YNJ D;  1E1T A;  2F0S A;  4FO2 A;  5ELF A;  2AHO B;  1J5E L;  1WR2 A;  5GAH C;  3PN1 A;  4LNQ A;  3VR3 A;  2F0U A;  4DV0 L;  3TIG A;  4HAE A;  3HOX H;  2NVX B;  3IG0 A;  3I4M H;  1BOS A;  1IBK L;  3CCQ A;  3M9O B;  1Z9F A;  3OTO Q;  1PTO H;  2WAQ B;  5C44 G;  4UFZ A;  4EYH B;  1HHV A;  2I80 A;  1NCV A;  1QZH A;  1O7Z A;  1ET6 A;  5GAD C;  4EGJ A;  3CPF A;  3ERQ A;  1B7Y B;  1EYC A;  3H0G H;  5DNF A;  3VYT A;  3FKI H;  4BA2 I;  1RJR A;  3JZI A;  3KJO A;  5KT4 A;  2K05 A;  2JEF A;  3TZU A;  5CA0 F;  1CZW A;  3L4J A;  2C2E A;  3F8T A;  4JI2 L;  3TRZ A;  2EY6 A;  4APM A;  4A3D H;  1O75 A;  1RDP D;  2XRS D; 
#chains in the Genus database with same CATH homology
 1C9O A;  3ZJY C;  1XNQ Q;  4GN4 B;  5M3F G;  4A3M H;  1JMC A;  4QQB X;  1UE7 A;  4AQY L;  4ME3 A;  1I5F A;  3RZD H;  4IPC A;  3S1R H;  3J81 i;  4DR7 L;  2YTV A;  4JI1 Q;  1IZ6 A;  4HJ7 A;  4PMW A;  4A3I H;  2R92 H;  1LM0 A;  4DV4 L;  4P74 A;  4JI3 Q;  5FLX c;  4Y52 H;  1CSP A;  1CKN A;  4PZ7 A;  1MJE A;  1QUQ A;  1N33 Q;  1PYS B;  2KHJ A;  3KF8 B;  4YHH Q;  4LF6 Q;  4OWW B;  4JI1 L;  5IYC G;  4DR4 Q;  1GKH A;  1X55 A;  2N8N A;  1SRO A;  4NXM Q;  3RR5 A;  2LXK A;  5IP9 G;  1VQM A;  1G29 1;  5GAE C;  1K73 C;  1KRS A;  2HQL A;  1EIF A;  2RF4 A;  2CWA A;  1A8V A;  3Q8D A;  2BA1 A;  2K52 A;  3CCJ A;  5LMN Q;  4ALP A;  2H5X A;  3GDE A;  1XMQ Q;  2B63 G;  2YYZ A;  3U58 A;  1XPU A;  3PCO B;  2R93 G;  2IY5 B;  1BKB A;  4LFA Q;  4LUZ A;  1VQE A;  4C3J H;  2ZJQ A;  4A3G G;  4LFC L;  4BBS H;  4KHP Q;  2VNU D;  3NEL A;  4OX9 L;  1B70 B;  1P8L A;  2PI2 A;  3ULL A;  2UUB L;  5IE8 A;  1M1K C;  3ULJ A;  2UXD L;  1CKO A;  3EBE A;  2OTL A;  1N34 L;  3EIV A;  4X64 Q;  1YIT A;  3U4Z A;  2ZJP A;  4DUY L;  2E2J H;  1SRU A;  3PUW A;  4DV1 Q;  2GN5 A;  3CME A;  1CSQ A;  2ZTC A;  2VQF Q;  3T1H Q;  1YI2 A;  1UEB A;  3KFU A;  1K8G A;  3J7Z C;  3W1B A;  4DV3 Q;  1KC8 C;  4HID A;  3CW2 C;  3FHW A;  1QVG A;  4L5S A;  1N34 Q;  1VQD A;  3STB C;  4A3J H;  4R4I A;  4X6A H;  4IJH A;  4C2M H;  3F2D A;  1XPR A;  1FL0 A;  5IP7 H;  1R9T H;  2JA6 H;  2HIX A;  2UUC Q;  2Z6K C;  1NBW A;  2NN6 I;  4IFD G;  4A3K H;  1A63 A;  5C4X H;  1VQH A;  2WFW A;  1N36 Q;  4HJ8 A;  1VCI A;  3GTO H;  4JI5 L;  4JOI A;  4RG1 A;  5HY6 A;  1Z47 A;  4QY7 A;  1IYJ B;  2ES2 A;  2ZTE A;  1Q1B A;  2WAQ E;  2VS1 A;  5FLM G;  2E5L Q;  4X62 Q;  2R7Z G;  1K0R A;  1TXY A;  3PUY A;  3J80 i;  4DPG A;  4XIG S;  4LWC A;  4JI7 L;  1Y1V H;  3I7F A;  4UP9 A;  4A3F G;  3D31 A;  2VQF L;  2JA8 G;  3E0E A;  4R1J A;  3TS0 A;  4JYA Q;  1EWI A;  1VQ6 A;  1RL2 A;  4X65 Q;  3PO2 H;  3SGI A;  1VQ9 A;  2YV5 A;  4DR2 L;  1Q81 C;  4A3C G;  2R7D A;  3HFZ B;  1CUK A;  2EXD A;  4LUO A;  4LFB Q;  2R7F A;  3RLO A;  3ER0 A;  4P75 A;  2Z0S A;  4LF5 Q;  4LF9 Q;  4JV5 L;  4BY7 H;  2JE6 I;  4UP8 A;  1SR3 A;  1U0L A;  3FP9 A;  3B6Y A;  5LMU L;  2CWP A;  3GTQ H;  4WJ3 M;  4LUV A;  5M3M H;  2UUB Q;  3M7N A;  3GTG H;  1HZA A;  1PFS A;  3BJU A;  2ALY B;  3CC2 A;  1HR0 L;  4LFA L;  3S17 H;  3CAM A;  4APV A;  1J6Q A;  2D0O A;  2E8G A;  1I3Q H;  2GVB A;  3AFQ A;  5ELN A;  5C0X G;  2ZM6 Q;  1GVP A;  1Q1E A;  2K14 A;  3GO5 A;  1VQC A;  3K7U C;  2B3G A;  3I56 A;  4DV5 L;  2D0P A;  1UE5 A;  3HOV G;  2MO0 A;  4X64 L;  1TWG H;  2QEX A;  2JK8 A;  1Y1W H;  4UY8 C;  5C3E G;  4JI2 Q;  3PO3 H;  1YZ6 A;  3F1Z A;  4LF7 L;  5C3E H;  3M9B A;  4X66 L;  4HJ9 A;  4A3L G;  3IRB A;  4L5T A;  2VZA A;  1OXV A;  1E3P A;  4WJ4 A;  2IHF A;  4NXN L;  1VQI A;  3PUZ A;  4DR5 Q;  4A3E G;  4J15 A;  5AJ3 Q;  5GRO A;  4GKK L;  4MZ9 A;  4DK6 C;  3CC7 A;  2ZJR A;  4DR7 Q;  4GN5 A;  3RNU A;  1VQL A;  3TEH B;  1AE3 A;  3D0F A;  4OON A;  4PG3 A;  2VY3 A;  1NY4 A;  3HOZ H;  4DR3 Q;  4GOP B;  1X3G A;  1XNR L;  1UWV A;  5E7N A;  4HIM A;  2N78 A;  3A5Z B;  3E9I A;  4P71 A;  3KF6 B;  1Q7Y C;  2MFI A;  5BR8 L;  3F2C A;  3KYH C;  4OX9 Q;  5H1S E;  4JC0 A;  3RLF A;  1Q82 C;  3UDG A;  4LFB L;  3HOW H;  2UUA L;  1PHJ A;  5IWA L;  1IBL L;  3CXC A;  4POG A;  1S3O A;  1IXR A;  2Q2U A;  4B3M Q;  1I50 H;  1VQK A;  4A3E H;  4BBR G;  4OO1 I;  3PV0 A;  3BU2 A;  4LF4 Q;  2IX1 A;  3H3V I;  5IWA Q;  1IBL Q;  1HNW L;  4KLK A;  1B8A A;  3RN5 A;  4A75 A;  2JA7 G;  1YEZ A;  4KHZ A;  3GTK H;  3PO3 G;  2IHE A;  3F2B A;  4GLX A;  1PVO A;  2JA5 G;  1Y1W G;  1JB7 A;  3H15 A;  4DV7 L;  3W1G A;  3HOV H;  1V1Q A;  4JI4 Q;  3HOY G;  2UXB L;  1VQA A;  5DLQ E;  4JI8 L;  1NE3 A;  3AYH B;  1VQ7 A;  1KQS A;  4JI0 Q;  1KHI A;  1X65 A;  4C3I H;  3K80 C;  2Q2T A;  3GTP H;  3HKS A;  1E22 A;  3CCS A;  4DV4 Q;  1WCM G;  4QL5 A;  4YCV A;  3H3V H;  3S1Q H;  4JYA L;  4LF8 Q;  4DV0 Q;  2UXB Q;  4JI5 Q;  1VQ5 A;  4GKJ Q;  4TVA B;  1K9M C;  1AE2 A;  1SLJ A;  2OTJ A;  1KAW A;  4Y7N H;  3G4S A;  2KCT A;  3HOU G;  4XTC S;  5HGQ A;  2R93 H;  2VL6 A;  4GKJ L;  1D7Q A;  1LTL A;  3PO2 G;  1LYL A;  4BXX H;  1C0A A;  3L7Z C;  3K8A A;  4LF8 L;  4A3F H;  2F4V Q;  4DR6 Q;  1TWF H;  1QZG A;  3CQZ H;  1HR0 Q;  1BVS A;  4L5Q A;  2VQE L;  2N3S A;  4POF A;  2QA4 A;  3VDY A;  2R7Z H;  4B3M L;  4IO9 A;  2LXJ A;  5FLM H;  3CP0 A;  4DV5 Q;  3L0O A;  3I2Z A;  3HOY H;  2UXC L;  1YHB A;  2HHH L;  4GLA C;  1HJP A;  4UP7 A;  1A0I A;  2B29 A;  2BH8 A;  5C0X J;  5C4X G;  4B3R Q;  3PF5 A;  3JAM c;  3OTO L;  5JEA J;  1EFW A;  1AH9 A;  2JA6 G;  4OWX B;  5IP7 G;  1VQ8 A;  2R92 G;  4A3I G;  5JJK A;  2VW9 A;  2L15 A;  4EQ5 A;  1E1O A;  2OCE A;  2VQE Q;  4A3J G;  1HNX L;  2N49 A;  2PMZ E;  4GOP A;  1X56 A;  5ELO A;  3RLN A;  1XMO Q;  2FXQ A;  2OQ0 A;  4DR4 L;  3G71 A;  4LF4 L;  4A3M G;  5M3F H;  4BXX G;  2WB1 G;  4GKK Q;  1YBY A;  3KDF A;  1EUJ A;  1U5K A;  3GTL H;  3HOU H;  1SMX A;  2BA0 A;  1S72 A;  4JBK A;  1PH3 A;  2JEA I;  3M4P A;  4IOC A;  5J3B A;  5IT9 c;  2NZO A;  2ZTD A;  4NXM L;  3HOW G;  1YJN A;  1PH2 A;  1Q12 A;  3EN2 A;  1UE6 A;  1G51 A;  1VQ4 A;  1WYD A;  3CMA A;  3S1M H;  5GQO A;  4DR5 L;  1L0W A;  1WCM H;  3G6E A;  3HOZ G;  4LFC Q;  3S1N H;  3GTJ H;  4QJF A;  2ZM6 L;  2MNA A;  3CCE A;  2XTI A;  1VQN A;  4JBW A;  2I5H A;  5IYC H;  3MEF A;  4HJA A;  1C7Y A;  1KRT A;  3UDI A;  3I55 A;  1N33 L;  3HOX G;  3RZO H;  3J7A 5;  2ID0 A;  1XTD A;  1N8R C;  1HR0 W;  1YNX A;  2JA5 H;  3OYY A;  1QUQ B;  4YY3 L;  3AQQ A;  1KIX A;  4QIW E;  3HKZ G;  3UE0 A;  4MTN A;  2JA7 H;  4HIK A;  2PQA A;  4GLV B;  3CPW A;  1I94 Q;  2CCZ A;  4YHH L;  1VQB A;  2WAQ G;  5LMN L;  3J81 j;  5C4J H;  4NXN Q;  4FDB A;  4X65 L;  2KCM A;  4NPS A;  4BBR H;  2Q2I A;  4X66 Q;  1VQG A;  1HNW Q;  1IBM Q;  3U50 C;  4GS3 A;  2IX0 A;  2IT1 A;  4X62 L;  5M5W H;  4LF5 L;  2UXC Q;  2UXD Q;  4B3T L;  1EQQ A;  1K3R A;  1N9W A;  4PZ8 A;  3PUV A;  2NVY H;  2PQA B;  2RHQ B;  1S40 A;  4R4O A;  4OO1 G;  4YCU A;  3TRE A;  1L2F A;  2K5N A;  1J5E Q;  1MJC A;  1SN8 A;  4C3H H;  5K36 G;  4YWK A;  5M5X H;  1FJG L;  3MXN B;  2C35 B;  4O0A A;  4A4I A;  1BBU A;  3RN2 A;  3ULP A;  3J81 c;  1K8A C;  4B3S L;  4PZ6 A;  4AQY Q;  2JJQ A;  1NJI C;  1HNZ Q;  1FVI A;  4JI3 L;  3UDX A;  1PH5 A;  3M3Y H;  3S15 H;  4DK3 C;  5M5Y H;  1IL2 A;  3AEV A;  4DV6 Q;  1JJG A;  2JA8 H;  4L5R C;  1FJG Q;  2YTY A;  2DUD A;  1OTC A;  4DR3 L;  3CD6 A;  4A3L H;  1PH1 A;  2EQS A;  3A74 A;  3NEN A;  2YU9 H;  3PF4 A;  1ASZ A;  3KF6 A;  3BZC A;  1EQR A;  1TWA H;  3CCL A;  1OXT A;  3K81 C;  2ATW A;  1RIP A;  4A3K G;  4AYB E;  4LF7 Q;  4JI8 Q;  1X54 A;  4JV5 Q;  1N32 Q;  2AWO A;  1YJ9 A;  4JI7 Q;  1EOV A;  3JAM i;  2PI2 E;  3CCM A;  4DV7 Q;  4DR2 Q;  4DR1 Q;  2E5L L;  1MIU A;  5FJ8 G;  1L1O A;  4KI0 A;  5M3M G;  4JI6 L;  4A93 H;  3S16 H;  3NBH B;  1I94 L;  1QVC A;  1GD7 A;  2RHS B;  1JE5 A;  1N32 L;  3UE1 A;  4DV1 L;  2KHI A;  3T1H L;  2NVT H;  1IBM L;  1PH4 A;  4DUZ Q;  4BY7 G;  5JJI A;  3S14 H;  1HZ9 A;  2UUC L;  4P73 A;  3JC6 6;  1M90 C;  4JI6 Q;  4JOI C;  4A3C H;  1H95 A;  2OWO A;  2EIF A;  1HZB A;  3HKZ E;  4A3G H;  4DR1 L;  1K83 H;  1HH2 P;  2JEB I;  3NEM A;  4DNI A;  4GNX B;  4TQU S;  2B63 H;  2UUA Q;  1VQJ A;  1A62 A;  4H02 A;  3I4N G;  2KBN A;  4LF6 L;  1XJV A;  1OXU A;  1Y1V G;  2RCN A;  4OWT B;  4NB3 A;  1P16 A;  1G6P A;  3KOJ A;  4B3S Q;  5IP9 H;  1PH7 A;  5IYB G;  5LMN W;  2F4V L;  2DGY A;  5JJL A;  2GVA A;  4IPH A;  4KHP L;  5IYB H;  4MNO A;  2Y0S G;  3WWV A;  3ICE A;  3T1Y Q;  1VQP A;  3S2H H;  2K50 A;  5AJ3 L;  1YHQ A;  4K0K L;  1KXL A;  4IOA A;  1XPO A;  5GAG C;  1O7I A;  4IFD J;  3G48 A;  1BBW A;  4A3B H;  3STB D;  4DV3 L;  4LF9 L;  3CCU A;  5IY0 A;  1ASY A;  4YCW A;  1OXX K;  1D8L A;  3PUX A;  3M85 A;  4DUY Q;  1WFQ A;  2WB1 E;  2K4K A;  2BH2 A;  4A3D G;  2PNH A;  1NMG A;  1YHA A;  2AMC B;  1SE8 A;  2A19 A;  3I4O A;  2JQO A;  1FGU A;  2A8V A;  3GD7 A;  4B3T Q;  3E9H A;  3KLW A;  1V43 A;  1WI5 A;  2VUM H;  4BBS G;  1CKM A;  1VS0 A;  2I5L X;  2I5M X;  2E2I H;  4A93 G;  4IPG A;  4JBJ A;  3CCR A;  3PIP A;  2E2H H;  4A3B G;  2WP8 J;  2AWN A;  2XGT A;  4AH6 A;  1HZC A;  3BZK A;  3ERS X;  2UU9 L;  1QVF A;  1KL9 A;  3K7A H;  4JCV E;  2KEN A;  4OXP A;  4O2D A;  1YVC A;  2R6G A;  4DUZ L;  1E24 A;  1E7Z A;  2Q2H A;  3KDF B;  4UPA A;  1KD1 C;  1Y14 B;  1N36 L;  1TWH H;  1XMQ L;  4IPD A;  1LUZ A;  2HHH Q;  4DV6 L;  2YTX A;  1PV4 A;  1IBK Q;  3I4M G;  1X3E A;  4DAY B;  3S2D H;  4IJL A;  3KJP A;  2NN6 G;  2F3I A;  1PH8 A;  4IFD I;  4B3R L;  1L1O C;  2HIV A;  1XNR Q;  4JG2 A;  4RMF A;  4R4C A;  3I4N H;  4HIO A;  1CKN B;  1UE1 A;  2MO1 A;  1I6H H;  4QGU A;  5BR8 Q;  1T9H A;  2V1C C;  2Z6K A;  1MKH A;  4DV2 Q;  1TWC H;  2K5V A;  4R4T A;  3K0X A;  4LW1 A;  5JEA G;  1Q8K A;  3DLL A;  1L1O B;  1YJW A;  4JI0 L;  4K0K Q;  1Q86 C;  4A76 A;  3CCV A;  5LMU Q;  4DAM A;  3M4O H;  1PH6 A;  4JI4 L;  1OXS C;  5EAY A;  3OW2 A;  3T1Y L;  4BY1 H;  4BA1 I;  1X6O A;  1GM5 A;  1HNX Q;  5IYD H;  2HT1 A;  1PA6 A;  3CF5 A;  3LGJ A;  4DKA C;  3U4V A;  2ASB A;  3PSI A;  1WJJ A;  5FJ8 H;  3GTM H;  1V9P A;  4P72 A;  5IYD G;  3FKI G;  2CQO A;  3H0G G;  4DR6 L;  1PYB A;  4YWL A;  2K75 A;  3AFP A;  1PH9 A;  4GN3 B;  1EIY B;  4GOP C;  4EX5 A;  3W5O A;  3TS2 A;  4AIM A;  1NTG A;  3A0J A;  2D62 A;  3UDF A;  5C44 H;  2I0Q A;  1VQF A;  3PGZ A;  1NMF A;  4GNX A;  2OQK A;  1JJ2 A;  4JBM A;  2LSS A;  2CKZ B;  2AKW B;  1GO3 E;  4GNX C;  1W2B A;  4YWM A;  2F52 A;  1E1T A;  3J80 c;  2AHO B;  1J5E L;  1JJC B;  1XMO L;  5GAH C;  3TQY A;  4LNQ A;  1Q46 A;  2JA9 A;  4DV0 L;  3HOX H;  4HJ5 A;  2NZH A;  4R4Q A;  3I4M H;  3L2P A;  1XNQ L;  1IBK L;  1DGS A;  3CCQ A;  1Z9F A;  1HNZ L;  1YIJ A;  3OTO Q;  1VQO A;  2UU9 Q;  5C44 G;  2A1A A;  1WOC A;  1QZH A;  1W3S A;  2K5H A;  3M4Q A;  4YY3 Q;  5GAD C;  3PIO A;  3CPF A;  1B7Y B;  2QGQ A;  3H0G H;  2MQH A;  3FKI H;  4BA2 I;  1X3F A;  4DV2 L;  2NVX H;  3KJO A;  1JT8 A;  3S24 A;  2VUM G;  1EYG A;  2NVQ H;  3F8T A;  4JI2 L;  3CC4 A;  3TRZ A;  4BY1 G;  3DM3 A;  4AYB G;  5C0X I;  1SFO H;  3A5U A;  4A3D H;  2Y0S E;  2CFM A;  1X9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...