4RB3C

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
molecule keywords DNA (25-MER)
total genus 37
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb3C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb3C02
2HGCA 1F1ZA 4N0BA 3VFZA 5D5XB 1BC7C 1FNNA 3WGIA 1UB9A 1SMTA 3ISPA 3WTTC 3U1DA 2A69F 3KEOA 2L54A 1W7PD 5E1WA 4EMSA 1B4AA 2VXZA 4BQAA 3CO7C 2Y0MA 1XMKA 1O3QA 2HQNA 2Q0OA 3H3UA 2RC4A 2XAJA 4RB0A 1A04A 5DCMA 2GXBA 3ERED 5IT9K 5KK1A 3DF8A 2FSWA 1T0FA 1J59A 2XIGA 1STZA 1SMYF 3VOEA 1R1UA 1K6OA 1GVJA 2CFXA 3E6MA 4HX4A 2DW4A 2V1DA 2QZ8A 3Q9SA 2PI0A 1ZGAA 1BM9A 3ULQB 1YIOA 3E97A 5L3FA 4CDGA 3ZN0A 1KQ8A 3LA7A 2VOOA 1RUOA 5D4RA 4HLXA 4KMUX 3KP5A 2CW0F 1LNWA 2EV6A 2RNJA 1KQ0A 1RZ4A 4ENMA 4LG0A 1QBJA 1IN4A 2BYVE 4RAZA 3LWFA 1LEBA 1GHCA 1KYZA 3BDDA 1I6XA 1JHFA 4Q4ZF 1RIOH 1O7LA 4Q47A 2RVCA 3JTHA 2GA1A 4LG0B 3BJ6A 2VBWA 2ZMEA 5CLSA 2ISYA 1BJAA 4IRHA 3RKXA 1IXSB 5J8CA 4KIBA 2ZNZA 2OQRA 2EA4A 2P4WA 3MZHA 4F7ZA 2ADUA 2DPDA 1HQCA 1T38A 5E8IA 3TGNA 3ZMVA 4UVAA 2FBIA 2BE5F 4M73A 3HSEA 3KP4A 4ON0A 4UV8A 2P5VA 2HTSA 4WWCA 1WSUA 2MBFA 3FMQA 5K5OA 2R7DA 4Q5SF 4AVPA 4OIOF 3F8BA 5F6FA 3LSTA 1PUEE 4RGRA 5CVVA 2HKOA 1XN7A 2V1XA 3KP2A 2JSCA 4EJTA 4ZZDA 2MC3A 3R60A 3IKTA 4KT5C 2LF8A 1FYMA 1ZGJA 5ICFA 1KGSA 3WG9A 2G9WA 4B09A 2M8EA 1XGMA 1MJ9A 3TQNA 3KEQA 1XGNA 4HOBA 4I09A 4QLCU 3P7NA 1BBYA 3QU3A 4CICA 3BY6A 2IJLA 3KP7A 3ZQ7A 1IN6A 2IW5A 2BGCA 1OYYA 4KN7X 1BI2A 2CSOA 3MAJA 1FYKA 1YW8A 5TJJA 4PGHA 3V7RA 1YFHA 4Y17A 4M72A 2EV5A 4OIRF 2M30A 1T2KA 4NQWA 2EFWA 2W85A 2M1BA 4G7ZF 4XSZF 3IRRA 1Z05A 4ZYEA 1S7AA 3ABTA 2XUBA 1RUNA 2YSRA 1XSVA 1ZHFA 2P5KA 2Y75A 5HLHA 2XKOA 1KU3A 1U5TC 3NRVA 2XAHA 3IRQA 3MZYA 3R6SA 2OAZA 3B73A 3K9TA 3F8NA 1XSXA 2W84A 2P8TA 3K1MA 3TOBA 3V7CA 5BPDA 1SD5A 4GO1A 1CF7A 1ZG3A 1E17A 4M71A 1HKTA 4ASNA 3GUDA 1TBXA 1RNLA 3J81Z 4ENNA 1TQMA 3JSOA 2K7LA 4H0EA 4LJZF 3EUHA 3D0SA 1J75A 1MJAA 1R5HA 5CVJA 1DPUA 3FMSA 1ZRCA 1FSEA 3I59B 2QVOA 4EJUA 3M7GA 1HKQA 2FF4A 2IP2A 2Z3YA 2L01A 3SXYA 4YFNF 4OMYA 3DPLC 3K0LA 4PDKA 2XAQA 3S2WA 2P7VB 3RDIA 3TDZC 2OD5A 4P5OA 3L09A 2F5EA 1YO5C 3LA2A 1U8RA 4HDUA 3F3XA 5L3GA 5HOOA 3G73A 1J0RA 1FWZA 3GXOA 5E17F 3HHHA 2EV0A 3ELKA 1OMIA 1YLFA 4D0PA 2VE8A 3KLNA 3GEZA 4A5MA 3J7AO 5FB2A 3F8MA 3ZP5A 2Z9OA 2FU4A 3WTYC 1W7PA 5D8LB 3FX3A 2ESHA 2FEZA 1MDMB 2P7CB 2V6CA 2KJCA 1ZN2A 1F9NA 2HEOA 4FT8A 1ZLJA 3RYPA 1U5TB 3F72A 2O03A 4BNCA 3FF5A 3I71A 4ZYHA 3DPTA 1ZRFA 2DU9A 4U7BA 3ABUA 5CYVA 3HIFA 5ICGA 1U2WA 3FXRA 1USSA 5KVRA 3WTWC 1BN5A 1Z6RA 2XRNA 1R00A 3M8FA 2P5LC 1J9IA 2WC2A 3M9AA 3SHFA 1AWCA 4KA4A 1KU7A 3EETA 5HS9A 2DTRA 1IN8A 2RGVA 4WCGA 3GVAA 1TNTA 3GFMA 2Z5UA 2FOKA 1FC3A 3KETA 1YTYA 3F6VA 3ECOA 3ECHA 2TDXA 2RDPA 1E2XA 5LGUA 4P9FA 3W6JB 3HRMA 2L02A 4WXDA 3WTXC 1UCRA 1FLIA 3R0AA 2F2EA 3BJAA 3E6DA 3I4PA 2GIVA 4WK8F 4I02A 1T39A 5CVUA 1G3WA 2OZ6A 2V9VA 2RQPA 3L7WA 3W6KB 3DP7A 2GXGA 3F21A 4PCQA 3GZ6A 1EH7A 1LJ9A 1U78A 1IRGA 2X0LA 4KNYA 3WGHA 1U3EM 4RS8A 3KZYA 5HLIA 4S05A 4A5NA 4WXHA 2H6BA 3QRFF 2UXXA 1IF1A 1QGPA 2ZXJA 4P55A 5E1XA 1P6RA 1FSHA 3GF2A 4WXCA 4G7OF 3WTZA 2AS5F 3BPXA 4U0WA 3NEUA 5ICCA 3Q9VA 1ZYRF 4LLGF 5A2QK 1XB4A 3QP5A 1UHMA 2NNNA 5LEJA 2COMA 3FXQA 5AIPA 2P6SA 3O2PE 3SZTA 5H6QA 5HLGA 3K1PA 3IHUA 4M9ZA 5DEQA 4A6DA 4KICA 4IVNA 3WTUC 3JTGA 1S8NA 4EJOA 4ZYGA 1OKRA 3VODA 4L0YB 2JPBA 3GW2A 3SFZA 5J6XA 3KLOA 4L18B 1L0OC 1WWXA 1QZZA 3I54A 5D4SA 3GFJA 2QM3A 2ZMEB 1W4MA 3IWZA 1O3TA 1QZYA 4IRIA 3QAHA 2A68F 2W57A 1WQ2A 5F1RA 2STTA 2PJPA 3V8JA 3WODF 5HDGA 2W25A 3QPHA 4HW0A 4KUMA 1IW7F 2KIUA 1G3YA 2KRFA 5LHIA 2DQRA 4L5JA 2R7FA 1IN5A 2CWEA 4G8XA 2MD5A 2OA4A 1SD4A 4M74A 3BOQA 4LK1F 4UNOA 1TQIA 4LK0F 3HOTA 4G9YA 4XLPF 2A61A 4XBFA 1IUYA 2YR2A 4MQVA 5D5VB 2ZNYA 4EM2A 1RI7A 5AIQA 2RV8A 4L0ZB 5F64A 4L5IA 1VTNC 1BIBA 4PGGA 1B9NA 1U5TA 4R8HA 2G7HA 2EK5A 1G3SA 2Q2EA 4FHTA 4ESFA 3CTAA 1LVAA 2DQLA 3CJNA 1LEAA 1X3UA 4RGXA 5LBQA 1FPQA 4NB5A 1B59A 4MEYF 5K1YA 2HYFA 4L9VA 5EEHA 2LF7A 2VOPA 1MZBA 2LKPA 2M5WA 5LRSA 2CG4A 4U0YA 2OQGA 2WV0A 4I7HA 2PFBA 2QBYA 1FZPB 3L9FA 5FLXK 2XHKA 3FMRA 1S7OA 4HF1A 1R7JA 3QU6A 3I0TA 1W7PB 3E5UA 3DEUA 2ZBKA 3RJPA 2GQQA 5HS8A 1WRJA 2H09A 5EEGA 2QBYB 3FXUA 4E70A 1I1SA 1HW2A 2XVCA 1SFEA 1LB2A 4BH9A 2UZKA 4JK1X 2MH9A 2E7WA 4AD9A 4CXFA 3V4GA 5CVIA 1D5VA 5FO5A 2MLGA 2FE3A 2VE9A 2HR3A 3FHZA 4AIJA 1H9TA 1ODDA 4BXUA 4HF2A 2QWWA 3GFIA 4LFUA 1QNTA 4ENJA 1BI0A 1P4AA 5DCFA 3DFGA 1MJBA 4KIFA 2HOEA 1S6LA 1Z1DA 2IRFG 4P9UA 1XCVA 2BV6A 1XSDA 2LDUA 2EWNA 1JHHA 2XV4S 1H0MA 2YU3A 4A0XA 2XKPA 1JXSA 2ETHA 3CLOA 2JRTA 5HDNA 1R5GA 3N97A 3M1EA 5D5UB 3KP3A 2PEXA 4HBLA 3I64A 1MGTA 1FP2A 2HFHA 1SD7A 1H9GA 2EA2A 5JR3A 1T98A 5D5WB 5D6FA 1DDNA 4BHPA 3ML6A 4LGWA 3FZVA 2CGPA 2OZUA 1SFUA 2HTJA 3E3VA 4M9XA 3RIRA 4RB2C 1FOKA 4HYEA 1DP7P 5K5RA 4MGRA 3C1DA 1Z6TA 1REPC 5LHGA 3EYYA 5D8KB 1YW7A 4WF2A 1FX7A 4MTEA 2NYXA 1P4XA 4KMFA 4EM1A 3I58A 2L4AA 1Z9CA 5H6RA 2FQ3A 2UXNA 3MFKA 1MKMA 5LHHA 2DK5A 1IXRC 5L3BA 1YG2A 2STWA 1GXQA 2X4HA 3N4MA 2JTVA 2HQRA 4BHCA 2NNYA 2GA2A 4EM0B 2PLYA 1W5SA 3JSPA 2HYGD 3HSFA 1W5TA 4IHTA 2CYYA 2OBPA 5LEKA 1G4DA 3PQKA 5DDGA 1YYVA 1XCBA 4ZZLA 3HTSB 3QPTA 1ZG1A 4UVCA 2EFQA 4Z2YA 1L3LA 1U6GA 1HSJA 4YFXF 1NHAA 4BYYA 4CGZA 2VBXA 2O6GE 3P9KA 2D1HA 2H6CA 1I1GA 2L4MA 2ZCWA 4LLLA 4L9TA 1K79A 4NHJA 4HDVA 3T8TA 2E1CA 4IJAA 1D8JA 4EJWA 4PZJA 4KFCA 4JBAA 3O6BB 2ZFWA 4JQFA 1TLHB 3TO6A 5A2QZ 4HZFA 3GFLA 1EH8A 1TQPA 2GWRA 1HBXG 1KU2A 1BI1A 2F5DA 4OINF 2QLZA 2IA2A 4L9NA 4XRFA 2WTEA 3V8LA 2YPRA 5LGTA 3P9IA 3HTUA 1K7AA 5LGNA 3OV8A 4I0AA 1TW2A 1XD7A 1DUXC 3H92A 2IPQX 4FX4A 2XGXA 1O3SA 4IXAA 3V8KA 2E1NA 2XAFA 3LQRA 5FD5A 3TO9A 5DUKA 5BPIA 3TOAA 2RKHA 3L00A 2KIFA 2D45A 3LQQA 4A6EA 3GLXA 3B02A 4DQ2A 1FYLA 3E5QA 2YX7A 3BP8A 2O0YA 1P92A 2F5CA 3E6CC 1PDNC 2XAGA 2D2WA 5ILSA 3OOPA 4B8XA 1WI9A 4AWXB 2MH2A 2VT3A 2O8XA 4AIHA 5FFZA 2FMYA 5L3EA 1Z91A 1IAWA 4Y13A 4P96A 2D1VA 4IHSA 3DQVC 2UWMA 1XDSA 3GO5A 4KDPA 4LB6B 2ZO4A 3LAPA 2J5OA 2Z33A 5IT9Z 4OIQF 2FMLA 2EJRA 3REOA 1QQIA 4KIGA 3FM3A 4A2UA 2O3FA 3F23A 3IL2A 1O3RA 1ZAOA 3BWGA 2VN2A 5ED4A 4RGSA 2VBYA 1GXPA 3C7JA 1ZRDA 3GX4X 3K1NA 4ZH4F 5HDKA 4A0ZA 2V1UA 1S29A 5ILVA 4GGGA 4O3MA 2AXLA 3RKWA 4RB1A 2FRHA 3GZ5A 3T1BA 1XDUA 4QWQA 5L3DA 2O61A 4HX8A 1BC8C 4GYIA 2NAZA 3D5LA 3KFWX 4OIPF 1QPMA 2HDCA 3K69A 4GCVA 4K2EA 4CZZA 2EFNA 6PAXA 3WE2A 3M8EA 2VT2A 4HF0A 3EDPA 3T8RA 1XGSA 4MTDA 5LRRA 4BHBA 2DAOA 3DXJF 4HV6A 2VONA 5BMZA 1AOYA 2K4BA 3JAMK 3C18A 1XMAA 3HHGA 3RYRA 4DNCA 1LDDA 2HS5A 2PN6A 2WWYA 2A07F 3U2RA 5E20A 4UV9A 1BI3A 4MQ9F 2BEOA 1YS7A 3CDHA 2CQKA 2ZJ2A 4R79A 2A6HF 2QQ9A 3KCCA 2JZYA 4EV0A 2VC0A 4LB5A 3ZMUA 5JI6A 2MA3A 1S3JA 4UXNA 1UHWA 1HXDA 3E5XA 2DFIA 1LDJA 1ONVA 2Z99A 3PFIA 1JE8A 1HW1A 1SFXA 4UHTA 3CO6C 1ZREA 1IRFA 1XGOA 1FT9A 1R23A 1BIAA 4TV7A 4Y15A 4HAMA 2H27A 4O6JA 1HKSA 4WX9A 5DCMB 1B1BA 3ZMDA 3O3KA 2M45A 2IA0A 1LQ1A 4YIIA 1J7KA 1Q1HA 1IN7A 4BAYA 2QQBA 3COAC 3IWFA 5FGMA 4CHUA 4YIFA 2JPCA 1JGSA 4A0YA 1F5TA 2FA5A 3F8CA 1ZG5A 2F5FA 2HZTA 4LD5A 5FD6A 2ELHA 3ZMTA 2L3DA 3HSRA 1R1VA 2IA1A 4R1HA 2Q8KA 4EQQA 2HWVA 4U7DA 2R3SA 2GZWA 4O5VA 3I59A 2MLKA 5K5QA 1R58A 1QO0D 2ACJA 5DD8A 1Y0UA 2W24A 1OPCA 3ZPLA 1K78B 1D3YA 1O57A 5ERIA 3WU0A 1ON1A 5LLQA 5FLXZ 2QYOA 3HRTA 5HS7A 3QOPA 2FXAA 3BROA 2K02A 3J81K 4EGYA 4UUVA 3SZPA 1SD6A 4G94A 5JHUA 1J2XA 3TKYA 2A3SA 4MEXF 3RPQA 1EH6A 3DKWA 3T5XA 1FBSA 4RB3C 3I5UA 2FNPA 5HVQC 2BBYA 5DYMA 2ZKZA 1O7FA 1YS6A 1FBUA 2M87A 2KJBA 2H94A 2QENA 3MWMA 5JVTA 4ZYDA 4HA8A 1KYWA 1I5ZA 2EFOA 4AIKA 1TTYA 4RAYA 2GAUA 2EFPA 3G3ZA 1TNSA 5L3CA 3P9CA 1DPRA 1R1TA 4ESJA 2JT1A 5CJ9A 4GXOA 4ESBA 1KU9A 3R0JA 2LSOA 3WU1B 4KYWA 4L9JA 5BOXA 4HQMA 3CUOA 3K2ZA 5BQTA 3IC7A 4KN4X 3LA3A 3J80K 4YG2F 3AAFA 3MCZA 2V79A 1LDKB 2ISZA 3CUQB 5DUIA 1V4RA 2PG4A 1IZ1A 2NS0A 2PMHA 4I98B 2VC1A 4CYDA 3ZN1A 5D6EA 1C0WA 4RGUA 3R61A 3JW4A 1OYWA 3CUQA 2DI3A 2XASA 3L2CA 3KZZA 3LAJA 3QP6A 5CVRA 1ON2A 3DV8A 4M6YA 4OU0A 5J8FA 5JFRA 3WTVC 1HSTA 2K86A 5ILUA 3RTRA 1FY7A 1P4WA 4IPAA 4XLNF 5TRDA 1WKMA 1Z7UA 2G7UA 4I2OA 4EVIA 2C6YA 5AONA 1CF7B 3RKYA 1FBQA 3MQ0A 4LLNA 2A5YB 3HRSA 3LFKA 3ROUA 2DT5A 3R4KA 2FNAA 2LNBA 3JAMZ 5H20A 2QUFA 5ICEA 5E1ZB 4HQEA 2DPUA 1CGPA 4S04A 1ZLKA 1G3TA 1OR7A 3GWZA 1ZARA 2PMUA 2K27A 4N9HA 3J80Z 3HUGA 2NRAC 2KIMA 3HRUA 3MEXA 3H3ZA 2P6TA 2DO7A 2A6EF 3F8FA 3I53A 4G6QA 2DLLA 2DBBA 2IVMA 1B9MA 3T0YA 3ZMZA 3ZMSA 4M6XA 3WE3A 4EGZA 4OOIA 4CO8A 3C3WA 3BZ6A 5BS6A 2FBKA 1IXCA 2RN7A 1J5YA 3GYHX 1UFMA 4EJVA 2DK8A 3FM5A 3HYIA 3EYIA 1MDMA 5E8GA 4HX7A 1D8KA 2CO5A 2OU2A 3V7SA 4A12A 4LMYA 1K78A 4ENKA 2KKOA 3TO7A 4G6DA 4FX0A 3SQNA 5DV5A 1OYIA 4ETSA 1BOAA 1MD0A 3NQOA 2EB7A 1ZH5A 2YX4A 4GYGA 3FWEA 4Q48A 2IT0A 3BPVA 4IRGA 3VEPA 3RI4A 3Q5FA 1FP1D 1USTA 2K4JA 3BJOA 4U88A 1B6AA 3TDUC 3WGGA 3F6OA 3HOSA 1T6SA 2VODA 4HLYA 1G6NA 2PBIA 4I01A 1KA8A 2B0LA 4YFKF 1PP8F 5IT3A 1SAXA 1P2FA 5DD4A 1YQAA 3KP6A 1I27A 4IF4A 2HKXA 1EV7A 3RPUA 3E6BA 2VBZA 2QQAA 1PP7U 3IKVA 4XSXF 2Y48A 5E18F 2ESNA 4MNUA 4N9IA 3F22A 4HV5A 1KQ9A 4G7HF 1R22A 3U9GA 3VB2A 2PQ8A 2XROA 1TW3A 1F4KA 1ULYA 4OMZA 4UVBA 1R36A 3PQJA 3WTSC 1HW5A 2FBHA 4U0VA 3KE2A 2E7XA 4MHGA 1YW9A 3EQLF 5FFXA 1V3FA 4M9SA 3CUQC 2J5PA 4I0BA
chains in the Genus database with same CATH superfamily
1VQNI 2HGCA 1F1ZA 1ZTRA 4YIRX 5KFFA 2KQRA 4E6KG 4N0BA 3VFZA 4XICA 3PN1A 5D5XB 1BC7C 2LMDA 1FNNA 1ACIA 3I12A 3WGIA 1UB9A 2VJ5A 3H9GA 1SMTA 1BXRA 3H0GA 3ISPA 3WTTC 3U1DA 1Z7LA 2A69F 3KEOA 1C30A 2L7MP 2FLLA 2L54A 3RQ4A 1W7PD 2XPVA 5E1WA 1I6HJ 2DCEA 1B4AA 2VXZA 2ZSIB 4EMSA 2HVSA 1GV5A 3CO7C 1UAAA 2Y0MA 4BQAA 5LP6F 1XMKA 2Q2EB 3SEQA 1O3QA 4V19K 2HQNA 4C2UA 2Q0OA 2HVRA 4BQNA 3H3UA 3S1RJ 2RC4A 1MBKA 1ZHQA 2DZDA 2XAJA 4RB0A 2VKHA 1A04A 5KG3A 4A2BA 2LFBA 1ZQ7A 5FRMA 3VWBA 5FLXW 2XAUA 1VQMI 5DCMA 2GXBA 3ERED 2AHQA 1N36H 1ZR2A 3S8PA 5IT9K 5KK1A 4J9RA 3GZNB 2GIZA 3DF8A 1DGWY 2HPMA 4B48A 4E7HA 2FSWA 3WO1A 3CCVI 2B7EA 1T0FA 1J59A 3O8HA 4I0BA 1Y8RB 2XIGA 4HNUA 1STZA 1SMYF 3VOEA 1R1UA 1K6OA 1GVJA 2CFXA 3E6MA 4UCSA 1S9FA 4HX4A 2DW4A 2V1DA 2VQHA 2QZ8A 3Q9SA 4PJ0C 3OYGA 2PI0A 1ZGAA 3J7AK 4BJ6C 1BM9A 3ULQB 4BGDA 1SAUA 3OYDA 1U9OA 3H3VK 1YIOA 4ED6A 4EEQA 4GKJH 1X2NA 5J4VA 3E97A 2W6QA 4Y8VB 2K85A 5L3FA 4Q8FA 4CDGA 1OCRH 3ZN0A 1KQ8A 3LA7A 3BG9A 2VOOA 4QPOA 1RUOA 5D4RA 4HLXA 4KMUX 3KP5A 2CW0F 1LNWA 2EV6A 2RNJA 4RAGA 1KQ0A 4FASD 1RZ4A 2KT0A 5HNFA 4ENMA 1QHGA 4F4YA 3PIOF 3GTKJ 2R92G 3BC8A 4LG0A 1QBJA 1IN4A 2BYVE 4RAZA 2RDIA 3LWFA 1S72I 1LEBA 1GHCA 1KYZA 3BDDA 2NU9B 1I6XA 1JHFA 2JA5J 3BZCA 5KFBA 4Q4ZF 3UR3C 1RIOH 1O7LA 3G8CA 4F3QA 4B44A 4Q47A 2OTJI 3BABA 5DG9A 2BQUA 3BA9A 1CQJB 3P5JA 2RVCA 2OLSA 3JTHA 1Y6IA 4XONA 2GA1A 4LG0B 1MBJA 2UVRA 2MW8A 2UVVA 3BJ6A 1N78A 2VBWA 2ZMEA 2GPSA 4HNVA 5CLSA 4DIQA 4ZTFA 3HOVJ 2YRWA 4NXMH 2ISYA 4AYBE 2I87A 1BJAA 4IRHA 3RKXA 1IXSB 1VKZA 5KFXA 5J8CA 4KIBA 4LIUA 5GTHC 3H9QA 4XQFA 2WY8Q 2P0WA 2VLAA 2ZNZA 2D5VA 2KZGA 2OQRA 1BGWA 2VQEH 2EA4A 2J6SA 3DEEA 2P4WA 2IXSA 2X48A 3MZHA 3FK6A 3HOUG 2R87A 4F7ZA 4OWRB 2M0MA 4ZC3A 2E2HJ 2GLTA 4B47A 2ADUA 1RR8C 2DPDA 3OL4A 1IG7A 2R85A 2W70A 3QYFA 1HQCA 1T38A 2DYSH 1WCMA 4ME6A 5E8IA 2UV1A 2ZJRF 3TGNA 2EIKH 3ZMVA 4UVAA 2ZDHA 2FBIA 3KHHA 2ZC2A 2BE5F 4NXNH 2BVMA 2JJ7A 3ONQA 3BG3A 3T5JA 1XNQH 4M73A 3HSEA 2M7BA 3F9KA 3FBIB 3KP4A 4ON0A 1YI2I 4A3FG 4UV8A 2ICWG 1CQIB 2P5VA 1W0UA 2HTSA 4WWCA 1WSUA 4ECXA 2MBFA 5L1KA 3FMQA 5K5OA 2R7DA 4Q5SF 4AVPA 4OIOF 3F8BA 5F6FA 5FROA 1BL0A 5DS9A 2JA5G 4PFPA 3K6GA 1X3ZB 2A5WA 3KYLA 3LSTA 1K1QA 1PUEE 1RYSA 2XRLA 1M1EB 4Y3OA 4QTRA 3HOWG 2R5YA 2CW8A 2W9BB 4X1EA 4RGRA 5CVVA 4NC7A 2HKOA 4XLEA 1WZ2A 3HOZJ 1XN7A 2J9GA 4ECTA 2AU0A 2V1XA 1Y39A 3KP2A 4C30A 3ZQQA 1FJLA 3IG0A 2JA8G 3MVPA 2DFHA 2JSCA 4EJTA 4NBQA 3EPZA 4JI6H 4ZZDA 1IGNA 5M5YJ 5EGOB 2MC3A 5KFHA 3R60A 3OSFA 1VS0A 3IKTA 3C0FB 3ORQA 2DYRH 5KG2A 1JT0A 2EZKA 4KT5C 3M9OB 2LF8A 2XD4A 1FYMA 3KIOA 1ZGJA 2VPSA 3MKZA 5L1LA 2GM4A 2IS2A 1POGA 1S68A 2R8GA 4PJJA 5ICFA 1JUSA 1KGSA 3WG9A 2OH2A 2G9WA 4B09A 3EPIA 2ME6A 2M8EA 1XGMA 1MJ9A 3CMMA 3TQNA 4RNNA 3GIPA 2E1MC 3KEQA 1XGNA 4HOBA 4I09A 4LFCH 2CFOA 4QLCU 2ZXHA 4C2MA 3P7NA 3AFHA 1BBYA 2MGQA 3QU3A 4CICA 2XGPA 3BY6A 3RIZA 2IJLA 2M8GX 3OYJA 1YHQI 1D1CA 3KP7A 3ZQ7A 1IN6A 1UZCA 3KPHA 4HRIA 1RJPA 3H3VH 2IW5A 2LLKA 2BGCA 3PNYA 1OYYA 4JX4A 4RLQA 1JKQC 3MR2A 4KN7X 4MLOA 1BI2A 2CSOA 2GOXB 4IRCA 3MAJA 3QQAA 2PVPA 3M1CA 1FYKA 3AG4H 3BG6A 1YW8A 2G0EA 2XF5A 5TJJA 3S3MA 1SCUB 5FPOA 5M5WJ 4PGHA 1OWTA 3SE7A 1WCMJ 1TWAJ 1Z21A 4D7MA 1RC9A 5KFYA 5C44J 3V7RA 4I50F 1YFHA 3VMMA 2E36A 5EF6A 4Y17A 1FIAA 3BR1A 4II2A 4RA2A 2X0SA 4M72A 4D5CA 4B3TH 2EV5A 1GYFA 4A3MG 1KJ8A 2VUMJ 4OIRF 4J9NA 1JTYA 3V4SA 2M30A 1T2KA 3RAQA 1ORKA 4NQWA 2EFWA 4LH7A 2W85A 5BR8H 5E3NA 2M1BA 1IOWA 1EUCB 5DG7A 4JI3H 2R0QC 2CS3A 2FJ1A 3CP2A 4G7ZF 4XSZF 3D5RC 3IRRA 2X6OA 1Z05A 3GV8B 4ZYEA 1R9TA 1S7AA 2QKMB 3ABTA 2XUBA 1QU3A 1M0TA 2VPRA 3NARA 1PUFB 1TWHA 1RUNA 4DR4H 4E4HA 3CDIA 2YSRA 1MSEC 1XSVA 2Y75A 1ZHFA 2P5KA 2KL4A 3OYEA 4YAKB 2Y31A 5DG8A 4NDLA 2R7UA 1HLVA 5HLHA 2XKOA 2E2IA 1KU3A 1U5TC 2KDOA 2GXAA 3NRVA 2XAHA 3IRQA 5FKLA 2UXCH 4JI4H 2QGUA 3VYRB 3MZYA 2WAQN 4IO9F 3R6SA 2EIJH 1X3WB 2OAZA 1VQ8I 3B73A 1RJRA 1X2MA 3K9TA 3F8NA 2HPIA 2PX9A 1XSXA 2W84A 4M3BA 1OISA 2AO9A 2P8TA 3K1MA 4ECYA 2ZM6H 2OF7A 2Q2TA 3CC4I 3TOBA 3V7CA 1KZHA 4XR6A 5LD2C 4HSTA 4UCRA 1T95A 5BPDA 1SD5A 4GO1A 3ZRGA 5EDWA 3MJFA 1CF7A 1ZG3A 3ETJA 2E35A 1E17A 2XGQA 4M71A 3PM1A 3BQ1A 1HKTA 2JEFA 2FUG2 4ASNA 3ZR8X 3GUDA 1TA8A 1LE8A 4A93J 4XOPA 3JRDA 1TBXA 4JYAH 1RNLA 3RB0A 3J81Z 3LWBA 4ENNA 2L2OA 1I6UA 3RPUD 2XGCA 1TQMA 3K3PA 3JSOA 2K7LA 3BT9A 5KFOA 4H0EA 3W6VA 4LJZF 3EUHA 3TW7A 1B8IA 3D0SA 1HNZH 2JEJA 3E1SA 3IUOA 3CESA 4DZJA 4PDBA 5B1AH 1J75A 2LREA 3PNTA 3DU5A 3SYTA 1JJ6C 3A4CA 2DFEA 4ED8A 1MJAA 1R5HA 3JCUC 3CCJI 4CYCB 4NC8A 1EKEA 3Q0VA 5CVJA 1DPUA 3VPBA 3FMSA 1ZRCA 2QK4A 3ORRA 1MH4A 1FSEA 2ID3A 2QVOA 3I59B 4EJUA 4C5CA 2R93J 1IBLH 3M7GA 3I4NG 3K5HA 3BTLA 3VYSB 4HNTA 4DL4A 4DR3H 4UY8I 1HKQA 2FF4A 2IP2A 2Z3YA 2L01A 3SXYA 2IS1A 4Y7NJ 3PFYA 4YFNF 4OMYA 1BJZA 2NU6B 3DPLC 3MFIA 3K0LA 5HV6A 2SCUB 4E7KA 5KFRA 4BY1J 2WB1A 2XAQA 4PDKA 1TT0A 2HQAA 2NVTJ 1IDYA 3S2WA 3WG7H 2P7VB 3RDIA 1JIHA 1S7EA 3GIJA 3TDZC 4RUAA 2O7OA 2OD5A 2EZLA 4IR1A 4P5OA 2ID6A 5B5EC 3TIGA 3L09A 3LNQA 2F5EA 5JVGF 3NGDA 1E0EA 2PMZE 1YO5C 3JRGA 3LA2A 1U8RA 4HDUA 3F3XA 5L3GA 1ERDA 5HOOA 3G73A 1J0RA 1FWZA 3FKIG 3WNZA 3T1HH 3TW6A 3GXOA 5E17F 3HHHA 5C44G 2UUBH 2WAQE 4BEHB 3RGXA 2EV0A 2M3AA 3ELKA 4YJ3F 1OMIA 1Y1WA 1YLFA 5CKTA 4D0PA 4DYRA 4CUGA 4WD3A 5HNHA 4A3MJ 2ECBA 2VE8A 3KLNA 3GEZA 2DJIA 3HB9A 5CQEA 4A5MA 2QSHX 3J7AO 5K7HA 3M4OJ 2LOOA 1DQUA 3TINA 5FB2A 4DL7A 3OWTA 3F8MA 3ZP5A 2GLOA 4BBSG 2Z9OA 1P9QC 2FU4A 2R7SA 1W7PA 3WTYC 3ZXSA 5D8LB 4B1RA 5I47A 2M4KA 3FX3A 2ESHA 2FEZA 1MDMB 4ZDPA 1W36D 4BEHA 2P7CB 3G2BA 4YP3A 2V6CA 2TCTA 2E19A 2KJCA 2R5ZB 4BE0A 4GKKH 3BCAA 1FMVA 3OYBA 3L1PA 1ZN2A 4GC6A 2ZFUA 2R7MA 1F9NA 2W4SA 2HEOA 2R7ZG 4FT8A 1ZLJA 1OCTC 3RYPA 4BJ5C 5IYZF 4RAFA 1U5TB 3F72A 1E4FT 1TWCJ 3PW7A 3J7AY 3IH2A 2O03A 3OUZA 4BNCA 3FF5A 3I71A 4ZYHA 5KHDA 3DPTA 1ZRFA 3G1MA 2DU9A 2HOTA 3OS0A 3T5KA 4U7BA 3ABUA 5KT2A 5CYVA 5KAFC 3IV5A 1X9NA 3HIFA 5ICGA 2L9SA 1S0NA 2CQYA 3L2WA 2YCHA 5JLWA 1XNRH 2WYOA 1U2WA 4EEYA 4Z6YA 3FXRA 5FLMJ 3HGGA 3GILA 1TWFA 1USSA 5KVRA 1K83J 3ESWB 4FQGA 3WTWC 3FISA 2W7PA 3S16J 4UCOA 2B63A 1G8XA 1BN5A 1Z6RA 5E3OA 4QWDA 4M3EA 3Q2OA 2DTZA 4UUSA 3QYBA 1XPXA 2ZJTA 2MCTA 2W7NA 2XRNA 1R00A 2GOMA 3M8FA 3GMEA 2FPPB 2E1OA 3DTKA 3FIWA 2WC2A 2P5LC 1J9IA 3M9AA 1W5CC 5J2TF 4EYIB 2C28A 4A3CJ 1SC7A 3DU6A 4CCMA 3SHFA 1AWCA 2VPLA 5DQIA 2JA8J 4O3NA 2XCLA 2KLOA 4YBZB 1FTZA 2DIKA 4LF4H 3RUPA 3H20A 4KA4A 3OR2C 3U21A 1KU7A 4BBRJ 3EETA 4QJFA 3KHRA 3BQZA 3K4LA 5LMUH 3HDDA 3OIQA 3JRXA 5HS9A 4ECVA 1DIKA 2DTRA 1IN8A 2JVGA 2RGVA 2VUMA 1X4PA 1N32H 4WCGA 3GVAA 4PK4A 3H4DA 1TNTA 2IA6A 3GFMA 3LSJA 2YS7A 2Z5UA 2FOKA 1FC3A 3KETA 2BW3A 1YTYA 3F6VA 5IYCG 2GBYA 3ECOA 4X6AJ 5DM7F 5KFTA 2W9AA 3ECHA 2ASLA 2TDXA 5KT4A 2RDPA 4IZZA 5FRNA 5D1OB 1E2XA 3DKYA 5LGUA 4IKFA 3B6AA 4TQSA 5L1IA 2H1LA 4P9FA 3W6JB 4YB8B 4AU7A 4C2TA 3E0JB 2JQ7A 2MC4A 3HKZA 1I7LA 4YHHH 1SFOA 1U0JA 3HRMA 3KAJA 4M7EA 2L02A 4WXDA 3WTXC 5J1RA 1UCRA 4CC6A 3C2HA 3S1MJ 1FLIA 4MAMA 4YJ2F 3R0AA 2VI6A 1DGRM 2VXDA 4DLKA 1SVOA 2Y0SE 5M3MJ 1TC3C 4LH6A 1N33H 1SVLA 4MO7A 2F2EA 2Y69H 3BJAA 3E6DA 4NQWB 1QHHD 1LVKA 2DOFA 1ZGWA 3L4JA 3I4PA 2GIVA 4WK8F 4ZDLA 4I02A 3LSKA 3HM5A 1VQ4I 1T39A 4MV4A 3NWTA 5CVUA 1G3WA 2OZ6A 2V9VA 2RQPA 3L7WA 4XLCA 2QYZA 4X66H 1IBMH 3IP4B 3PVXA 3W6KB 1FIPA 2XSJC 3ZQHA 3V6JA 3DP7A 2CMPA 2GXGA 5LYJF 3GTGJ 3F21A 5LA6F 1OCPA 2QCOA 1KONA 4ZJZA 3JRBA 5JQWA 1LFUP 4PCQA 4BE1A 3GQCA 5M5XJ 3GZ6A 4BBSJ 1EH7A 2LKXA 2CU7A 5GADJ 1LJ9A 1U78A 1IRGA 1ZK8A 1I50A 2W71A 2X0LA 3G6YA 4XKCA 3PW2A 1SVMA 4KNYA 3WGHA 1U3EM 3HGYA 4RS8A 1T56A 3RV3A 3KZYA 5HLIA 4S05A 2X6WA 4A5NA 4WXHA 3BTCA 2H6BA 3QRFF 3HOYJ 2O9LA 3HOYG 4FM9A 3R5HA 4RNMA 3H40A 2PJRB 2UXXA 1IF1A 1QGPA 2ZXJA 4P55A 5E1XA 1TAEA 2YRXA 2XSDC 1U9NA 5IYBJ 4CC5A 3E5NA 2E2IJ 1P6RA 2CV1A 1VQKI 4DV2H 3K70D 1FSHA 2I8DA 3DF7A 3GF2A 4WXCA 1P8LA 4G7OF 3WTZA 3S1QJ 2AS5F 5F9LA 3BPXA 2EZHA 3HOXG 1RESA 3A2KA 3ERMA 1EHIA 4U0WA 2QEXI 3NEUA 5KX5F 4IWYA 5ICCA 1E3HA 5EWEA 1MBGA 3Q9VA 3SZGA 4MV7A 1ZETA 4I76A 1ZYRF 5LL6b 4LLGF 4A3FJ 5IWAH 3I55I 3HBLA 4XKVA 5A2QK 2LBFB 1XB4A 3QP5A 1UHMA 2NNNA 2HXIA 2O5RA 4NC6A 3SDGA 1ETVA 3QYEA 5TGTA 5LEJA 3T5LA 2COMA 1J09A 3FXQA 5AIPA 2P6SA 3MWEA 2R7RA 1D0ZA 3O2PE 3SZTA 4ECZA 2DODA 1Y1WG 5H6QA 4BXXJ 5HLGA 3K1PA 3IHUA 4M9ZA 5DEQA 1ZR4A 4A6DA 1KEEA 1L2ZA 2NUAB 4KICA 2BHZA 4IVNA 2FLNA 2KPMA 3WTUC 3JTGA 2AQ4A 1S8NA 3PW0A 3RB6A 5KFDA 4KITB 4EJOA 4ZYGA 1MH3A 1OKRA 1HDPA 3VODA 4L0YB 4XZ3B 1X1AA 5A2QW 4DL6A 1BR4A 4AYBA 4MIMA 2K3PA 5F9NA 5B3SH 3OYKA 4R7RA 4EFBA 2JPBA 3GW2A 3SFZA 5D8DA 2X1CA 1RJQA 5J6XA 3KLOA 4L18B 2J6UA 4BWSC 5J4YA 1L0OC 1WWXA 1ETYA 1QZZA 3I54A 1GLVA 3OYNA 3MR5A 4DV6H 5IYBG 5D4SA 1I3QJ 3DTEA 2HI3A 3GFJA 4IEJA 2RREA 3SEZA 2WAFA 4CA0A 3OYIA 3OSNA 1APLC 3DEWA 2QM3A 2ZMEB 5H80A 1WSCA 1W4MA 3IWZA 4B43A 1O75A 1O3TA 1MSFC 1QZYA 4IRIA 3QAHA 2DA2A 3TQ1A 4DBRA 3CC2I 1RR7A 3LSHA 2A68F 2W57A 1WQ2A 1KJ9A 4J0MA 1VBGA 5F1RA 2STTA 4P1WA 3LOCA 3V8JA 2PJPA 3ZOBA 3HOXJ 3WODF 2R8JA 4JI7H 4F93B 4IWXA 5KFWA 1R9TJ 1K1SA 1FKAH 2IS4A 5HDGA 4IOAF 5KFQA 2W25A 1S0OA 4ED3A 3VYTB 1S0MA 1AUXA 4XM3A 4DOZA 2YU9A 2NOGA 1W1WE 3QPHA 3JRIA 4JV2A 4HW0A 2M4GA 4X64H 4KUMA 4F91B 1IW7F 1GSHA 2KIUA 5KG6A 3ABMH 4OX9H 1G3YA 4RMNA 2KRFA 5LHIA 2DQRA 4L5JA 4NUBA 2R7FA 1QZEA 5LMNH 4A3LG 2V9KA 1JKPC 3FKIJ 1IN5A 2C35B 2CWEA 2C2RA 4G8XA 4M3DA 1N25A 3PSFA 2MD5A 2OA4A 1DGSA 4F52A 2EQRA 3I4MG 5BMVF 2FQ4A 2OWOA 1SD4A 4M74A 3BOQA 4LK1F 5E79C 2VJJA 4UNOA 4ECWA 1TQIA 4LK0F 1X19A 1V5EA 3HOTA 3BCBA 4F92B 4DUYH 4G9YA 2JA5A 2Q2UA 2L7FP 1A31A 2HHHH 4LG3A 2OPTA 3WHBA 4XLPF 2A61A 2L7ZA 5T14A 2UU9H 4XBFA 3RF2A 2NOJB 1IUYA 1F36A 2CQ7A 4ZTJA 3HPHA 4U7CA 2NXNB 1WJFA 2UVUA 2YL2A 2YR2A 4MQVA 5KFPA 5D5VB 2ZNYA 4EM2A 1BOBA 3HZJA 2BQ3A 2V5AA 5CPRB 3LSPA 4IZOA 2H8WA 4QWBA 1RI7A 2DA1A 4LITA 5AIQA 3OS2A 3V4ZA 3DCFA 2RV8A 5J1YA 3OY9A 4AQYH 3RAXA 3K4CA 4L0ZB 2JA7A 5F64A 1SFKA 1YX5A 4L5IA 4BQQA 2V7FA 1VTNC 2N8GA 5L1JA 4B3XA 2AQEA 2EBIA 4A3IJ 1BIBA 4PGGA 2Y9ZA 2WV1A 2LR8A 1B9NA 1U5TA 4R8HA 1WH2A 2XB0X 3C2GA 2VOBA 2G7HA 4TV9F 1HCRA 4BJTA 2EK5A 4YR0A 1G3SA 3R5FA 1IOVA 4CCKA 2AQFA 2ZXIA 4B3MH 3BR5A 1B33N 3T5HA 2V26A 1CS0A 1OFCX 3OS1A 5F08A 2B9SA 1TT5B 2V1NA 1VQ6I 3Q1KA 3GTQA 3QZ7A 2C2EA 2VQFH 1T0FC 2Q2EA 4FHTA 3TL4X 4ESFA 2XPUA 2R93A 1XX5A 3CTAA 3K70C 1LVAA 2DQLA 2ZSHB 3CJNA 2YZNA 4K0KH 1LEAA 1X3UA 5KNLA 2WAQA 4RGXA 3S17J 5LBQA 3JZIA 3MKYB 3MKLA 1FPQA 4DJAA 1PUFA 5HBRB 3BR6A 4NB5A 2KSWA 1B59A 4J9SA 2UUZA 2L9VA 1TWCA 4O2AF 1TZLA 2L7KA 1XS9A 4MEYF 5K1YA 5DLFA 1UJ8A 2HYFA 4L9VA 5EEHA 4CH7A 2LBFA 2LF7A 4FETA 3L2VA 2VOPA 3FMAA 2OCEA 1MZBA 2LKPA 2M5WA 5LRSA 4RUCA 3SDBA 1FMWA 1D1BA 2CG4A 4U0YA 2OQGA 2WV0A 4HSRA 2PFBA 4I7HA 3OYFA 2FLPA 3PIPF 1A36A 2QBYA 2NVXA 2AXTC 1FZPB 3M8JA 3L9FA 5FLXK 1JGGA 1XDNA 2XHKA 3FMRA 5HODA 5EOYA 2DMPA 5GP9A 1XMXA 5EG0A 2ZMEC 5IP6A 1GT0C 2V4JC 5KFZA 2AGPA 1YIJI 3S32A 1S7OA 4W1UA 1OLTA 4HF1A 1VBHA 1QRYA 5DQGA 2WA0A 4DV3H 4QWEA 3H4BA 1R7JA 2Y9YA 3EUAA 3QU6A 4F50A 3I0TA 3E5UA 1W7PB 1IRXA 3DEUA 3PW5A 2BHYA 2ZBKA 3RJPA 3CZ6A 3L2RA 2DA5A 1WRJA 2GQQA 1X1BA 2H09A 5EEGA 5HS8A 3KYDB 2QBYB 2V59A 2FD5A 1Y8QB 1YX3A 3FXUA 3VPRA 4E70A 5LFAA 1HW2A 1I1SA 1S97A 4DL3A 2R8KA 2XGEA 2XVCA 1SFEA 1LB2A 2MSYA 5KT3A 4DR5H 3CCMI 3RGZA 3K4JA 4BH9A 3OHBA 2LYCA 3RZDJ 2UZKA 1N77A 4JK1X 2JA7G 3HG9A 2MH9A 5KFLA 4II3A 2E7WA 3Q8PB 4AD9A 1A6IA 4CXFA 4CCNA 1D1AA 3V4GA 4A3EG 5CVIA 3EUKL 2RAEA 1SANA 2QQ8A 1D5VA 4A3DG 5FO5A 2JVHA 2MLGA 4XL9A 3OL3A 5HLTA 2FE3A 1Z2NX 1TWFJ 1YE9A 5EWGA 2VE9A 4O4HF 2HR3A 2K40A 3FHZA 4AC0A 1ETXA 3FXKA 4AIJA 2VKEA 1Y1VA 2F6CA 1N56A 2EINH 1H9TA 2HGSA 1ODDA 4BXUA 4HF2A 4G12A 2QWWA 3CMEI 5KFIA 4H4KC 1RK5A 3GTMA 2LY9A 4LFUA 3GFIA 1QNTA 3RQIA 2Q1ZB 4KISA 5B1BH 1WJEA 3FBNB 3TBIA 4ENJA 3R23A 3RB4A 1BI0A 4JI2H 3ZGKA 1P4AA 2DLNA 1P7IA 5DCFA 3DFGA 2OUMA 2HXOA 1PYVA 1MJBA 4KIFA 1B6SA 2DDBA 2WBMA 1V5FA 4JV5H 2HOEA 4CYCA 1S6LA 1KC7A 5F1JA 4JI1H 4XLHA 2F4VH 1Z1DA 5E3MA 4XN0A 2IRFG 3U9TA 2XB5A 4P9UA 1XCVA 2BV6A 4YY3H 1XSDA 4QWCA 2LDUA 2EWNA 1JHHA 2XV4S 2K9QA 4BDYA 1H0MA 2YU3A 4A0XA 3LFUA 2XKPA 1JXSA 2ETHA 3CLOA 3N43B 3IH3A 2JRTA 4B4CA 3Q8RB 5HDNA 1R5GA 3N97A 5KG1A 1D5YA 3PR5B 4DR6H 4AIDA 5EDNA 5KG0A 3M1EA 3J80W 5D5UB 5FPRA 4RZQA 2VA2A 3KP3A 2HDWA 2PEXA 5FJ8G 4HBLA 3I64A 1MGTA 3RB3A 3Q8SB 1FP2A 2HFHA 1SD7A 3KALA 1H9GA 1JXLA 2EA2A 4E7ZA 1E3OC 5JR3A 3OYAA 1UG0A 1F43A 2W6PA 1PVEA 1T98A 4S0HB 1FOYA 1V5GA 2XCAA 5D5WB 4CSWA 5D6FA 3G1OA 4A93G 4DBQA 5EJCA 1IV6A 4A69C 2BXYA 4BHPA 5IOYA 1DDNA 2YS9A 5EZYF 4A3CG 3ML6A 4LGWA 3FZVA 2CGPA 2OZUA 3N40P 3RBEA 2DPJA 2CV0A 2WTFA 1SFUA 4O3RA 2Y30A 3GV7B 2HTJA 3ZCOA 4IQJA 3E3VA 4MA0A 4M9XA 3RIRA 3BQ2A 5IP7J 4RB2C 3QPLA 3MKWB 1FOKA 4R8UA 4QSHA 2HVQA 4HYEA 2HZDA 5K5RA 4D1QA 2M9HA 4MGRA 3C1DA 1DP7P 1Z6TA 1GDTA 2NVXJ 2VASA 1REPC 5LHGA 2BW3B 1VNDA 3EYYA 5D8KB 1YW7A 1VQLI 2B63J 4WF2A 1FX7A 1VQ7I 2NYXA 4MTEA 4A3GJ 1P4XA 3R5XA 3DBHB 4KMFA 1BW5A 1IDZA 1GSOA 4EM1A 2C00A 4MV1A 2LH9A 3I58A 1B72B 2L4AA 1I3QA 1Z9CA 1EA3A 2R4GA 5H6RA 4RM3A 2R7WA 1T8IA 1N75A 1IRZA 2FQ3A 2UXNA 3VSKA 2W6NA 3MFKA 2IGNA 1MKMA 4A3BJ 2XDVA 4DL5A 3CCUI 5LHHA 2DK5A 3AG2H 3GTKA 3TP3A 4XYLB 2PMZA 1IXRC 1I39A 4FS2A 5L3BA 4IX7A 5B66C 1YG2A 2STWA 4UCUA 4EBDA 1GXQA 2X4HA 4E7IA 5EZHA 4AUXA 3N4MA 4J9LA 5EGOA 2JTVA 2ASJA 3GTGA 2HQRA 4BHCA 3DKXA 1EYZA 2NNYA 1ZKGA 2GA2A 4EM0B 1VFCA 1BA5A 4TUYF 2UXDH 1IV8A 2PLYA 2DT6A 3H35A 4RBOA 1W5SA 1WJDA 5KFNA 4XLAA 1EUDB 3JSPA 3OHAA 2HYGD 3HSFA 4IHWA 1W5TA 4C3JJ 4XX0B 1AN7A 4IHTA 1MNDA 3EPGA 1MMSA 2RGRA 2CYYA 2OBPA 1TL8A 5LEKA 2ZJQF 4WBNF 1G4DA 3PQKA 5DDGA 1YYVA 4IHVA 1R4NB 1XCBA 3VSLA 2E60A 1M7JA 1T36A 1UG2A 4ZZLA 1GGOA 5IP7G 2QA4I 2W9CB 3HTSB 3QPTA 2V6EA 1ZG1A 3FXJA 1IUFA 1B04A 4ED0A 4I4TF 4UVCA 4EGQA 4BUPA 2EFQA 2JA6A 2R7ZJ 4HEA2 5JLXA 3BR3A 3W3CA 4BQOA 4Z2YA 3QODA 1L3LA 1WGXA 1U6GA 4A3KJ 1HSJA 5C1PA 4KJZA 4YFXF 3GTPA 1NHAA 4BYYA 4CGZA 1UMQA 2VBXA 2A05A 3TP0A 5F27A 4IOCF 2O6GE 2Z2SB 3D5SC 5C4JJ 4N4OB 2R8IA 2TRTA 4ECQA 3P9KA 2K9NA 2D1HA 4O4LF 2H6CA 3FK7A 2QSFX 2M0CA 1I1GA 1LPQA 1PK8A 4QW9A 2L4MA 2ZCWA 4LLLA 5FKKA 3AG3H 4L9TA 1K79A 4RM2A 4Q44A 3V6KA 3JR9A 4NHJA 4DV1H 4HDVA 3T8TA 2E1CA 4IJAA 5JH7F 1D0XA 1D8JA 4EJWA 2WY7Q 3RKQA 4C3HJ 4E7SA 2Z16A 2BOLA 4PZJA 4KFCA 4G6TB 5KFGA 4C3IJ 1Z0XA 3KZIC 4JBAA 3O6BB 4EYHB 2ZFWA 3X2QH 4JQFA 1JLLB 3ASNH 1TLHB 3TO6A 4DYCA 5KFVA 5A2QZ 4HZFA 2DXIA 3GIMA 3F0CA 3GFLA 3HOWJ 4ECSA 1EH8A 1P7JA 1TQPA 2E71A 1V4YA 2CV2A 2GWRA 1I7NA 1NG6A 1WJ5A 1UNNC 1KBLA 5F04A 1HBXG 1HOMA 4DV5H 3ZQCA 5GAHJ 1KU2A 1BI1A 2NU8B 4LFAH 2F5DA 1KJJA 1Z2PX 3GTJA 1LUJB 4OINF 4EATA 2QLZA 1QVUA 1WPKA 2W9BA 2R6FA 2IA2A 4J01A 4L9NA 2R93G 2XF6A 4XRFA 3RCOA 1PX2A 3UQ8A 4DR7H 3HUGB 2WTEA 3U9SA 1NG7A 1X1DA 2KISA 3V8LA 1U8BA 2YPRA 1WH7A 2DFFA 4DV0H 5LGTA 4OAYA 1Z77A 4BU2A 2CZGA 1MW7A 3GLLA 3P9IA 2M05A 3HTUA 1K7AA 2I5UA 2FJZA 5LGNA 3JSLA 2LRDA 2DA3A 3OV8A 1MNEA 4I0AA 4FU0A 1YRNB 3GCMA 3A0HC 1TW2A 1XD7A 1DUXC 3H92A 2VPQA 4ZHQF 5JVLA 1WHUA 4UFZA 2JA2A 2IPQX 2K3FA 4DW6A 1WJCA 2JA7J 4F55A 3GIKA 2JA6J 1R71A 4FX4A 5GTIC 4C9YA 3PO2J 3GLKA 5D1PA 3G4SI 2XGXA 1J5EH 3HOZG 3CLQA 3QWLA 1O3SA 1B8IB 1MMDA 1ETQA 1B6RA 1K4SA 3BG7A 4IXAA 2MYSA 2ZDQA 1JT6A 4N4NB 4JV0A 1I94H 3OMYA 3V8KA 2RQQA 3HJEA 4YRVA 3OYLA 2E1NA 4M6VA 3CCQI 5KT7A 2XAFA 4BBRG 4M3GA 4ANJA 3LQRA 5FD5A 3TO9A 1VQ5I 5H2FC 1LE8B 1JI8A 3SI8A 5DUKA 5BPIA 1AKHB 3TOAA 2RKHA 2R92A 5DM6F 3L00A 4HG2A 2KIFA 2D45A 3LQQA 1OQYA 2F4IA 4A6EA 1M0WA 1W36C 3GLXA 3O8GA 2EZIA 3B02A 4OAZA 4DQ2A 4IRKA 3OYMA 3AYHB 1FYLA 3CDLA 3E5QA 2YX7A 3OSPA 3LSMA 3BP8A 5GPAA 2O0YA 1P92A 2F5CA 3S2DJ 3E6CC 1PDNC 2BR0A 3GIIA 2XAGA 5LOVF 2WB1E 2YS6A 2D2WA 9ANTA 4PJNA 1NK2P 5ILSA 4PUSA 3OOPA 3G71I 1RRJA 4ZOLF 4ED1A 4ITVA 4B8XA 1WI9A 3BA8A 5IT9W 4AWXB 4F4WA 2MH2A 2VT3A 3LL7A 3CMYA 2O8XA 4AIHA 4YQWA 5EZGA 2HOAA 3K2AA 2BY2A 4JP0A 5FFZA 3GTPJ 2ALZA 2FMYA 5L3EA 1Z91A 3FHNA 2ATLA 4DR2H 1IAWA 1K61A 1WJAA 4Y13A 1UHSA 4P96A 2D1VA 4IR9A 3M9MB 4MV6A 4IHSA 4MV9A 5DGBA 3DQVC 2UUAH 2VKDA 4XORA 1G59A 2UWMA 4XIDA 1XDSA 2COBA 3GO5A 2LK2A 4M3FA 2ASDA 1VQOI 5JVDF 3OYCA 3HKZN 4KDPA 5KFEA 4V2GA 5IOZA 1RYRA 3S93A 2ELJA 3T1YH 4LB6B 1W96A 2ZO4A 2ZB9A 3LAPA 2J5OA 2Z33A 1CQTA 1OR7C 5IT9Z 2VQCA 4OIQF 1YJNI 5KCMA 1M6VA 3CF5F 5F0HA 1MMGA 4X65H 2L9RA 4XRSA 4ECRA 4QIWA 1YJWI 2AGQA 2FMLA 1RKWA 4JYKA 1H89C 2EJRA 1A6QA 4J9OA 2W00A 3REOA 1QQIA 4KIGA 2W8LA 2J6TA 4IHXA 3FM3A 2E1MB 3PO3J 4A2UA 2O3FA 3F23A 3IL2A 3DBLB 1H88C 2V4QA 1O3RA 3A02A 1ZAOA 3BWGA 4U87A 1OCOH 2VN2A 1TWHJ 4BY1G 2XC9A 1A0IA 5ED4A 1VI0A 2VQGA 3BR2A 4BE2A 3CQZA 4RGSA 4LF7H 2VBYA 1UC9A 1GXPA 2W7OA 3C7JA 2VKVA 1ZRDA 1HA8A 5FJ8J 2Y0SA 2FKLA 2VUGA 3GX4X 1BR2A 2KRCA 3K1NA 4A3LJ 4ZH4F 2DT7B 5HDKA 4A0ZA 1I3AA 4YEJA 2V1UA 4ED2A 2CJJA 1S29A 4E4TA 4DZPA 1V54H 5ILVA 5KFCA 4GGGA 4O3MA 2FX0A 4CCLA 3V42A 2AXLA 3EUHC 3A03A 1RETA 4EGJA 3RKWA 4RB1A 1MMAA 2DMUA 4L1KA 2R5ZA 4EEFG 5C8YF 5FKMA 3M4IA 4A3JJ 2DMTA 2FRHA 3GZ5A 2YYAA 3MWDA 5J2UF 3T1BA 2R7VA 1XDUA 4J9MA 4DYQA 3FXMA 4QWQA 5L3DA 2O61A 4O3SA 1FTTA 3OR1C 2L5QA 3A0BC 2HJWA 4HX8A 2V58A 1BC8C 4E7LA 4X62H 4V2FA 1N48A 3CVZA 4LFBH 4GYIA 3MFHA 2NAZA 5KG5A 3D5LA 1S9HA 3FXOA 3KFWX 2K9SA 1I50J 3SFIA 4OIPF 1GV2A 1QPMA 2HDCA 4BXFA 1EF4A 3KX2A 3K69A 4GCVA 4JX6A 4K2EA 4CZZA 1HC8A 3N8DA 2V4RA 2EFNA 2V9WA 2MD0A 3KYCB 1YRNA 3CJTB 4PJMA 3CMAI 2WDTA 6PAXA 3WE2A 1GLNA 4IHJF 3M8EA 2BY0A 2YW2A 2VT2A 5F0FA 3VPCA 3PSIA 1OJLA 2CUEA 4HF0A 5DGAA 4ZDOA 2K9LA 3EDPA 1FVIA 1W93A 2VIXA 3DBRB 2W6OA 1FJGH 4PSXA 3T8RA 1XGSA 3IH4A 2WB1N 4LIVA 4LOCA 2HU9A 5LRRA 4MTDA 1DU6A 3OYHA 4BHBA 5BPFA 2DAOA 3DXJF 4HV6A 1TP4A 2VONA 5BMZA 1AOYA 5KFUA 2FOWA 2K4BA 3JAMK 1JKRC 3C18A 1Y1WJ 2H1KA 1XMAA 3HXLA 3HHGA 1YITI 3RYRA 2CRGA 4DNCA 1LDDA 2HS5A 1T08B 2PN6A 2CQNA 2WWYA 1JDEA 4MFEA 1MIJA 3GTQJ 5KKNB 2A07F 5CAEB 2CQXA 1OCCH 3OSGA 2X1EA 4UUTA 3GIDA 3U2RA 2I10A 5IYDG 4UCVA 2X6YA 1UC8A 3CCLI 1AHDP 3HPGA 5E20A 4QWAA 3PZPA 4UV9A 1BI3A 4MQ9F 3M07A 2BEOA 1YS7A 3CDHA 2CQKA 3ASOH 5GAEJ 3I56I 2ZJ2A 4AM3A 4R79A 2I8CA 4A3JG 2A6HF 3B6CA 2QQ9A 2OCCH 3KCCA 4XOTA 4XNFA 4YELA 1ZQ3P 1Z2OX 2CH0A 1FOWA 2JZYA 3RJ0A 1AUVA 4EV0A 1XMQH 2VC0A 5C3EG 5J3LA 4B3SH 2WADA 4LB5A 3ZMUA 4XRMA 5JI6A 2MA3A 1S3JA 4UXNA 1UHWA 1HXDA 3E5XA 2DFIA 3L2UA 1LDJA 3UFXB 1ONVA 4HPQA 2Z99A 1Z3XA 3PFIA 1Y14B 1JE8A 3K4BA 1HW1A 2IEKA 2PN1A 1SFXA 2DA6A 3PUFA 4IRDA 2HOSA 4RLFA 3K10A 4UHTA 3CO6C 3IAS2 1ZREA 2JUCA 1IRFA 3GTJJ 1XGOA 1FOXA 3J7YJ 1KJIA 1DU0A 1FT9A 3M3YJ 1R23A 1BIAA 4TQRA 3CQZJ 3LSRA 2KDZA 5EYRA 4TV7A 4YR2A 4Y15A 4CCOA 4PWQA 1T94A 4HAMA 2H27A 4O6JA 1OCZH 4XKBA 2DMNA 1Z67A 1HKSA 2XF7A 4WX9A 5DCMB 3V6HA 1Q1VA 3AL0C 2DA7A 3H9JA 2H8RA 4DV4H 1B1BA 4DL2A 1SEIA 3ZMDA 3O3KA 3I4NJ 3GTOJ 1MBFA 3W2VA 1R49A 2IS6A 3N6XA 4UB6C 2E5LH 1GSAA 3BTIA 1HR0H 5GAGJ 5E3LA 2M45A 2IA0A 1LQ1A 1J7KA 4YIIA 1Q1HA 4A2AA 1IN7A 5J47A 2L9NA 2LY2A 3LMMA 4BKXA 4BAYA 2QQBA 3AG1H 3COAC 3IWFA 3CP8A 5FGMA 2FB9A 4CHUA 4GLXA 4PJLA 3FDYA 4YIFA 4LF9H 1VAJA 5C3EJ 2JPCA 2NVQJ 2LP0A 1JGSA 1X4OA 4A0YA 2IMWP 1F5TA 2FA5A 2WAEA 3DPUA 2E34A 5FKNA 3F8CA 4BY7J 4C2MJ 1ZG5A 2F5FA 2VR1A 2HZTA 4LD5A 4FE4A 4BS9A 1JX4A 4FBTA 2EIMH 4I55F 5FD6A 1GO3E 4GC7A 2ELHA 3ZMTA 2L3DA 3HSRA 1HDDC 1R1VA 4DUZH 2IBKA 3MR6A 4R8UB 1T3NA 2IA1A 4R1HA 2JEGA 3MD2A 2Q8KA 1D0YA 2QF7A 4EQQA 1DV1A 1IO2A 3GV5B 4A3KG 2OJED 1UELB 1R6RA 1WVRA 3E7LA 3W2WA 2HWVA 4U7DA 2R3SA 3VYUB 3QZ8A 4LF5H 5FLMG 2GZWA 4O5VA 2JUGA 3TQTA 2QKLB 1R4MB 3I59A 2MLKA 1A35A 4J9KA 1HNWH 5K5QA 1R58A 3Q3SA 5KT6A 3BAAA 2JN6A 5IP9J 4QIWE 1QO0D 2VQLA 2ACJA 3DTIA 5L9XA 5EWFA 2LTPA 2R7XA 5DD8A 1Y0UA 4A3EJ 1QA6A 4O3PA 2W24A 3CF2A 3DWLE 1E4EA 1OPCA 3ZPLA 4LSXA 1K78B 5K7ZA 3KHGA 1D3YA 1O57A 2E5ZA 2IGOA 2R7QA 3CCYA 1EZ1A 5ERIA 2JSPA 1ON1A 1VZ0A 3WU0A 5LLQA 3UKGA 4RZRA 3OOUA 1JKJB 3DLAA 1DP3A 1YJ9I 4IL6C 2KZVA 5FLXZ 2QYOA 3HRTA 5HS7A 3NAUA 2F48A 3QOPA 3TEDA 4EG0A 2FXAA 3JRHA 2KFDA 3BROA 1CE8A 2K02A 4MFDA 3GIQA 3J81K 1BJTA 4EGYA 4UUVA 2KP6A 1K6YA 1ITYA 3TMOA 4C5BA 2R8HA 2AGOA 2BQRA 5KT5A 2CQQA 2CUFA 3SZPA 4ZI7F 4RNOA 2W1OA 1SD6A 5IYCJ 1S10A 2ZXWH 3AKZA 1KJQA 4DGWB 2KMUA 4G94A 5JHUA 3KAKA 1MBHA 1J2XA 3NWSA 1TWGJ 2NVUB 1X58A 3S14J 2GPWA 5CB4F 4EBEA 1B72A 3CC7I 4BDZA 4LF6H 3TKYA 5C4XJ 3G6XA 5C4XG 3ZQGA 2A3SA 4MEXF 3BG5A 2W48A 3H1CA 2FK1A 4E7JA 2B63G 2E5NA 4CZCA 2R84A 2CW7A 3J81W 3IAM2 4FCYA 5JUMA 5FLVA 3RPQA 1EH6A 4J9PA 3DKWA 3GTOA 2RNGA 1HNXH 3T5XA 2DPIA 1TWAA 4NLGA 2P0AA 1FBSA 3A1YA 4Q45A 2R92J 2ZJPF 4A3GG 2LVSA 4JX5A 2P81A 3QOEA 4JI8H 4MV3A 4TV8F 4RB3C 5KFAA 3CJQB 3I5UA 2FNPA 5HVQC 2R7TA 2UUCH 4LSAA 4ABZA 1G2HA 2BBYA 5DYMA 3FDSA 2ZKZA 5GPCA 2FK2A 2DMQA 4W97A 1JJ8C 3KHLA 1Y56A 2IP4A 1O7FA 1YS6A 1FBUA 2M87A 3RSNA 2V9PA 3FKJA 3QFFA 2KJBA 4BL0B 2H94A 2MFZA 2QENA 3MWMA 4XK4A 4Y4RA 5JVTA 3J7ZI 3OIOA 2Y0SN 3L2PA 5KG4A 1SEUA 2DOEA 4ZYDA 4HA8A 2DA4A 3VDXA 2EH3A 4APMA 1A9XA 3BLYA 4O4IF 3ETHA 1E4GT 1SYXB 1QVTA 2ELKA 1KYWA 2ME0A 1I5ZA 2EFOA 4XLFA 1TTYA 2EILH 4AIKA 1XMOH 4RAYA 2VUMG 2GAUA 2EFPA 3G3ZA 1TNSA 5L3CA 1ETOA 1JDBB 4JI5H 3RFCA 1ZELA 1DV2A 2DWCA 3Q8QB 2UXBH 3K3VA 3P9CA 3AL0B 5EG0B 1DPRA 1R1TA 4ESJA 2JT1A 3BZKA 3PJRA 5CJ9A 4GXOA 4BY7G 4ESBA 3JRAA 4GFBA 1KU9A 4XYMB 1Y0NA 2K9MA 2C22A 3R0JA 2LSOA 3KEYA 3WU1B 1NH3A 4FISA 4L9JA 5BOXA 4KYWA 4EBCA 4HQMA 1MMNA 4YR3A 2BVLA 2C2DA 3WU2C 3CUOA 4XMYA 1TWGA 3WO0A 1XC5A 3K2ZA 5BQTA 3IC7A 3OTOH 3PL8A 5TISC 3LSIA 1X1PA 1VQ9I 1LFPA 3PNVA 4KN4X 4BACA 1Z3YA 2IAIA 3LA3A 1T33A 4XRSG 2X51A 3J80K 5LXTF 4YG2F 3GTMJ 2FPIB 3G6VA 4I99C 3AAFA 3MCZA 2FMAA 2V79A 3W2AA 1Y1VJ 3OUUA 1LDKB 2ISZA 3CUQB 1WFXA 5DUIA 1V4RA 2PG4A 1IZ1A 2JRMA 1EJ9A 3Q0UA 2F5VA 2NS0A 5F0CA 2HNHA 3JRFA 3H5RA 4C5AA 2PMHA 4I98B 2VC1A 1K4TA 1PJRA 3QPSA 4CYDA 4M9UA 2LKSA 3ZN1A 4DR1H 5D6EA 2LD5A 1C0WA 3M9NB 2NS8A 4RGUA 2YUSA 4JOMA 3R61A 4D7NA 2K5CA 3I3LA 3JW4A 3I4MJ 1OYWA 3CUQA 1ETWA 1K83A 2DI3A 3HKZE 2F4MB 2L0KA 4A3DJ 3I9V2 2VJ4A 2XASA 3L2CA 3KZZA 1AA7A 3LAJA 4F4ZA 3QP6A 3LMLA 3OIPA 2W82A 2JWTA 5CVRA 2XC7A 1ON2A 2R7NA 2VL8A 3DV8A 3U1KA 2XCPA 4M6YA 2E2JJ 4OU0A 2R86A 5J8FA 1WI3A 5JFRA 3WTVC 1HSTA 2K86A 3ABKH 4RDUA 4J00A 3S3OA 2W6ZA 5ILUA 3HOUJ 1NK3P 3RTRA 1FY7A 1P4WA 4F4XA 4I6ZA 3GBGA 3S15J 3RZOJ 4Q43A 2JK3A 3A01A 1ENHA 4IPAA 2VQDA 2EPFA 3N44B 4EFEA 4X0GA 4XLNF 2KHMA 1E4EB 2CUJA 1FEXA 3RBDA 1BNCA 5KFSA 2R7ZA 2HYJA 5TRDA 1WKMA 1Z7UA 2G7UA 4J19A 4A3IG 4FBUA 4I2OA 3A01B 4EVIA 2C6YA 3CD6I 5DLGA 2R5YB 5AONA 1VF9A 1CF7B 2DJNA 3RKYA 1FBQA 4ZQIA 3BQ0A 3MQ0A 3BQYA 3HL2A 4LLNA 2M2EA 3IN5A 3HC7A 2A5YB 3RTXA 3HRSA 3LFKA 3ROUA 5KFJA 5DQHA 2DT5A 3R4KA 1Y1VG 5IY5H 1RK6A 5CA0F 3MR3A 5JHFA 2YZGA 3K4KA 3S3NA 3K5IA 3GTLA 2FNAA 2LNBA 1V9PA 2NVYA 3CCEI 3S2HJ 2HQ5A 3JAMZ 5H20A 4IAJA 2PMZN 2A6TA 2QUFA 5M3FJ 5GONF 5ICEA 5D1OA 4KHPH 2CUZA 5E1ZB 4B3AA 4HQEA 2DPUA 5IP9G 1CGPA 1BR1A 2VB6A 4S04A 1BW6A 1ZLKA 2VA3A 1G3TA 4UB8C 1OR7A 3GWZA 1ZARA 1WCMG 2VJIA 2PMUA 2K27A 4N9HA 3J80Z 4UUSB 3HUGA 2NRAC 2KIMA 3KTMA 3HRUA 3MEXA 3H3ZA 3ZQIA 3ZQFA 2P6TA 2DO7A 4GDFA 2A6EF 2FP4B 2E2HA 3HOVG 3LP8A 2OV7A 1QPIA 1S5LC 3F8FA 4JV1A 3I53A 3H5NA 4FS1A 1LFBA 1XG1A 4G6QA 2DLLA 2DOAA 2XGDA 2DBBA 2FPGB 1NTCA 2YU9J 3UNGC 1MNMC 2IVMA 1B9MA 3T0YA 3ZMZA 3ZMSA 3JAMW 2R7LA 1ULZA 4M6XA 5IPAA 4ECUA 4LF8H 3WE3A 3KXYT 3CJRB 5KFKA 4EGZA 1MBEA 4OOIA 4CO8A 2OTLI 3HEFA 3C3WA 2IBDA 2IGMA 4KT6A 1GVDA 3BZ6A 5CA1F 5BS6A 4JI0H 2FBKA 2NVYJ 1IXCA 2XPWA 2M7AA 2RN7A 1J5YA 3H5AA 3GYHX 4U6PA 1UFMA 4EJVA 2DK8A 2KRHA 2W8KA 2R7OA 3FM5A 3HYIA 3EYIA 4Y52J 3PW4A 1MDMA 4FE7A 4NNJA 5E8GA 1C3OA 4HR7A 4MA5A 4A3BG 4HX7A 4PSWA 2RF4A 4YAJB 2MABA 1D8KA 2CO5A 2OU2A 3V7SA 4A12A 4XN3A 4LMYA 1JKOC 1K78A 4ENKA 3H36A 2KKOA 2NS7A 4Y33A 5J40A 3TO7A 4G6DA 4FX0A 3SQNA 1SFOJ 5DV5A 1R5ID 5DTDA 3JRCA 1OYIA 4ETSA 4L5EA 3VPDA 1BOAA 1MD0A 3MMYB 2EB7A 3NQOA 1ZH5A 2YX4A 4GYGA 4Q8EA 3FWEA 2FK3A 4Q48A 2IT0A 3FXLA 2YZMA 4IHYA 3BPVA 4IRGA 2QSGX 2DN0A 3VEPA 3RI4A 3Q5FA 1RKTA 1AU7A 1IC8A 4ED7A 4ZYAA 1FP1D 1USTA 2K4JA 1V55H 3BJOA 1B6AA 4U88A 3TDUC 3WGGA 3F6OA 3K4NA 1RPWA 3JREA 3HOSA 3D1NI 2LC2A 1T6SA 3K4MA 4HLYA 4FTHA 2VODA 1G6NA 2ZDGA 5K2MA 2PBIA 4J9QA 4D5FA 3GTLJ 3JSNA 3N41B 4I01A 2W6MA 1A5JA 1KA8A 4O3QA 3ZQLA 2W9CA 2B0LA 4YFKF 3BR0A 3G6EI 1PP8F 1ETKA 2O8KA 1X1CA 3H0DA 5CQGA 4QIWN 4Q0YA 5IT3A 1SAXA 2NU7B 3RV4A 4D9JA 3TIIA 3CCRI 1S03G 4O2BF 2WE6A 2MG4A 1WH5A 1LKXA 4HYKA 1ZHSA 5KAIC 1IJWC 1P2FA 5DD4A 1YQAA 3KP6A 4GRIA 2UVWA 1I27A 4IF4A 4XKWA 3G1LA 2X9DA 3L4KA 2DDAA 2HKXA 2Y2ZA 3JRWA 4RU9A 2M34A 1EV7A 3RPUA 3E6BA 2BZTA 2VBZA 2RDJA 4UCTA 3H0GG 2QQAA 4QW8A 4MV8A 2X1DA 1O4XA 1AKHA 3C2BA 2JEIA 3DLLF 2I80A 3WHCA 1PP7U 2CKZB 1N34H 4B3RH 1YOVB 3IKVA 4XSXF 4G3IA 2Y48A 4DV7H 5J1UA 5E18F 3CCSI 2ESNA 3H0GJ 2BY3A 3N05A 4MNUA 4N9IA 3F22A 2BY1A 5KG7A 3S1NJ 2LY1A 2JA6G 5K7FA 3N42B 3PO2G 1IBKH 4HV5A 1W0TA 5IYDJ 2PJRA 1JUPA 1KQ9A 4G7HF 5C1OA 2JMWA 1WR2A 3MZ8A 1R22A 3BTJA 3U9GA 3ABLH 5BNGA 3VB2A 4CCJA 2PQ8A 2LG4A 4BXXG 3LSGA 2XROA 1TW3A 2X85A 4AYBN 1V51A 1ULYA 2OC6A 1F4KA 4JUZA 4QPQA 4IQ4A 4OMZA 4PFOA 5C5JA 3PUBA 4UVBA 2HDDA 1R36A 3PQJA 3WTSC 4O3OA 2Z1DA 5KFMA 1VQPI 2IGKA 2PBZA 1JTXA 3MN2A 1HW5A 2FBHA 2R7KA 2R82A 4U0VA 1XTAA 1E3PA 3KE2A 2F4OB 1H8AC 3BJYA 5EEAA 1HF0A 3PR4A 2ECCA 2E7XA 1JUMA 4MHGA 3Q0WA 2X6XA 3SJMA 3K7AJ 3FKIA 1YW9A 3EQLF 2BXZA 2KIQA 3L2QA 5FKOA 3PO3G 4HQ6A 5FFXA 1V3FA 4M9SA 5BPHA 1WJBA 3CUQC 2J5PA 1GUUA 4AVZA
chains in the Genus database with same CATH topology
2HGCA 1F1ZA 4N0BA 3VFZA 3PN1A 5D5XB 1BC7C 1FNNA 3WGIA 1UB9A 1SMTA 3ISPA 3WTTC 3U1DA 2A69F 3KEOA 2L54A 1W7PD 5E1WA 4EMSA 1B4AA 2VXZA 4BQAA 2HVSA 3CO7C 2Y0MA 1XMKA 1O3QA 2HQNA 2Q0OA 2HVRA 3H3UA 2RC4A 1ZHQA 2XAJA 4RB0A 1A04A 4A2BA 5FLXW 5DCMA 2GXBA 3ERED 1N36H 5IT9K 5KK1A 3DF8A 2FSWA 1T0FA 1J59A 2XIGA 1STZA 1SMYF 3VOEA 1R1UA 1K6OA 1GVJA 2CFXA 3E6MA 4UCSA 4HX4A 2DW4A 2V1DA 2QZ8A 3Q9SA 2PI0A 1ZGAA 3J7AK 1BM9A 3ULQB 1YIOA 4EEQA 4GKJH 3E97A 5L3FA 4CDGA 3ZN0A 1KQ8A 3LA7A 2VOOA 1RUOA 5D4RA 4HLXA 4KMUX 3KP5A 2CW0F 1LNWA 2EV6A 2RNJA 1KQ0A 1RZ4A 4ENMA 4LG0A 1QBJA 1IN4A 2BYVE 4RAZA 3LWFA 1LEBA 1GHCA 1KYZA 3BDDA 1I6XA 1JHFA 4Q4ZF 1RIOH 1O7LA 4Q47A 3BABA 3BA9A 2RVCA 3JTHA 2GA1A 4LG0B 3BJ6A 2VBWA 2ZMEA 5CLSA 4NXMH 2ISYA 1BJAA 4IRHA 3RKXA 1IXSB 5J8CA 4KIBA 2ZNZA 2OQRA 1BGWA 2VQEH 2EA4A 2P4WA 3MZHA 4F7ZA 2ADUA 2DPDA 1HQCA 1T38A 5E8IA 3TGNA 3ZMVA 4UVAA 2FBIA 2BE5F 4NXNH 1XNQH 4M73A 3HSEA 3KP4A 4ON0A 4UV8A 2P5VA 2HTSA 4WWCA 1WSUA 2MBFA 3FMQA 5K5OA 2R7DA 4Q5SF 4AVPA 4OIOF 3F8BA 5F6FA 3LSTA 1PUEE 2CW8A 4RGRA 5CVVA 2HKOA 1XN7A 2V1XA 3KP2A 3IG0A 2JSCA 4EJTA 4JI6H 4ZZDA 2MC3A 3R60A 1VS0A 3C0FB 3IKTA 4KT5C 2LF8A 1FYMA 1ZGJA 2VPSA 1S68A 5ICFA 1KGSA 3WG9A 2G9WA 4B09A 2M8EA 1XGMA 1MJ9A 3TQNA 3KEQA 1XGNA 4HOBA 4I09A 4LFCH 4QLCU 3P7NA 1BBYA 3QU3A 4CICA 3BY6A 3RIZA 2IJLA 3KP7A 3ZQ7A 1IN6A 2IW5A 2BGCA 1OYYA 4KN7X 1BI2A 2CSOA 3MAJA 1FYKA 1YW8A 5TJJA 5FPOA 4PGHA 3V7RA 1YFHA 4Y17A 4M72A 4B3TH 2EV5A 4OIRF 2M30A 1T2KA 4NQWA 4LH7A 2EFWA 5BR8H 2W85A 1GYFA 2M1BA 4JI3H 4G7ZF 4XSZF 3IRRA 1Z05A 4ZYEA 1S7AA 3ABTA 2XUBA 1M0TA 4DR4H 1RUNA 2YSRA 1XSVA 1ZHFA 2P5KA 2Y75A 5HLHA 2XKOA 1KU3A 1U5TC 3NRVA 2XAHA 3IRQA 2UXCH 4JI4H 3MZYA 3R6SA 2OAZA 3B73A 3K9TA 3F8NA 1XSXA 2W84A 2P8TA 3K1MA 2ZM6H 2Q2TA 3TOBA 3V7CA 4UCRA 5BPDA 1SD5A 4GO1A 1CF7A 1ZG3A 1E17A 4M71A 1HKTA 4ASNA 3GUDA 1TA8A 1TBXA 4JYAH 1RNLA 3J81Z 4ENNA 1I6UA 1TQMA 3JSOA 2K7LA 4H0EA 4LJZF 3EUHA 1HNZH 3D0SA 4PDBA 1J75A 1MJAA 1R5HA 4B3SH 5CVJA 1DPUA 3FMSA 1ZRCA 1FSEA 3I59B 2QVOA 4EJUA 1IBLH 3M7GA 4DR3H 1HKQA 2FF4A 2IP2A 2Z3YA 2L01A 3SXYA 4YFNF 4OMYA 3DPLC 3K0LA 4PDKA 2XAQA 3S2WA 2P7VB 3RDIA 3TDZC 2OD5A 4P5OA 3L09A 2F5EA 1YO5C 3LA2A 1U8RA 4HDUA 3F3XA 5L3GA 5HOOA 3G73A 1J0RA 1FWZA 3T1HH 3GXOA 5E17F 3HHHA 2UUBH 3RGXA 2EV0A 3ELKA 1OMIA 1YLFA 4D0PA 2VE8A 3KLNA 3GEZA 4A5MA 3J7AO 5FB2A 3F8MA 3ZP5A 2Z9OA 2FU4A 3WTYC 1W7PA 5D8LB 3FX3A 2ESHA 2FEZA 1MDMB 2P7CB 2V6CA 2KJCA 4GKKH 1ZN2A 1F9NA 2HEOA 4FT8A 1ZLJA 3RYPA 1U5TB 3F72A 1E4FT 2O03A 4BNCA 3FF5A 3I71A 4ZYHA 3DPTA 1ZRFA 2DU9A 4U7BA 3ABUA 5CYVA 1X9NA 3HIFA 5ICGA 2YCHA 1XNRH 2WYOA 1U2WA 3FXRA 1USSA 5KVRA 3WTWC 4UCOA 1BN5A 1Z6RA 2ZJTA 2MCTA 2XRNA 1R00A 3M8FA 2P5LC 1J9IA 2WC2A 3M9AA 3SHFA 1AWCA 4LF4H 3H20A 4KA4A 1KU7A 3EETA 5LMUH 5HS9A 2DTRA 1IN8A 2RGVA 1N32H 4WCGA 3GVAA 1TNTA 3GFMA 2Z5UA 2FOKA 1FC3A 3KETA 1YTYA 3F6VA 3ECOA 3ECHA 2TDXA 2RDPA 5D1OB 1E2XA 5LGUA 4P9FA 3W6JB 4YHHH 3HRMA 3KAJA 4M7EA 2L02A 4WXDA 3WTXC 4CC6A 1UCRA 1FLIA 3R0AA 4LH6A 1N33H 2F2EA 3BJAA 3E6DA 3L4JA 3I4PA 2GIVA 4WK8F 4I02A 1T39A 5CVUA 1G3WA 2OZ6A 2V9VA 2RQPA 3L7WA 4X66H 1IBMH 3W6KB 3DP7A 2GXGA 3F21A 4PCQA 3GZ6A 1EH7A 1LJ9A 1U78A 1IRGA 2X0LA 4KNYA 3WGHA 1U3EM 4RS8A 3KZYA 5HLIA 4S05A 4A5NA 4WXHA 2H6BA 3QRFF 4FM9A 2UXXA 1IF1A 1QGPA 2ZXJA 4P55A 5E1XA 1TAEA 4CC5A 1P6RA 4DV2H 1FSHA 3DF7A 3GF2A 4WXCA 1P8LA 4G7OF 3WTZA 2AS5F 3BPXA 4U0WA 3NEUA 5ICCA 3Q9VA 4MV7A 1ZYRF 5LL6b 4LLGF 5IWAH 5A2QK 1XB4A 3QP5A 1UHMA 2NNNA 5LEJA 2COMA 3FXQA 5AIPA 2P6SA 3O2PE 3SZTA 5H6QA 5HLGA 3K1PA 3IHUA 4M9ZA 5DEQA 4A6DA 1L2ZA 4KICA 4IVNA 3WTUC 3JTGA 1S8NA 4EJOA 4ZYGA 1OKRA 3VODA 4L0YB 5A2QW 4R7RA 4EFBA 2JPBA 3GW2A 3SFZA 5J6XA 3KLOA 4L18B 4BWSC 1L0OC 1WWXA 1QZZA 3I54A 4DV6H 5D4SA 3GFJA 2QM3A 2ZMEB 1W4MA 3IWZA 1O75A 1O3TA 1QZYA 4IRIA 3QAHA 2A68F 2W57A 1WQ2A 5F1RA 2STTA 2PJPA 3V8JA 3WODF 4JI7H 1FKAH 5HDGA 2W25A 3QPHA 4HW0A 4X64H 4KUMA 1IW7F 2KIUA 4OX9H 1G3YA 2KRFA 5LHIA 2DQRA 4L5JA 5LMNH 2R7FA 1IN5A 2CWEA 4G8XA 2MD5A 2OA4A 1DGSA 2OWOA 1SD4A 4M74A 3BOQA 4LK1F 4UNOA 1TQIA 4LK0F 3HOTA 4DUYH 4G9YA 2Q2UA 2HHHH 2UU9H 4XLPF 2A61A 4XBFA 3RF2A 1IUYA 2YR2A 4MQVA 5D5VB 2ZNYA 4EM2A 1RI7A 5AIQA 2RV8A 4AQYH 4L0ZB 5F64A 4L5IA 1VTNC 1BIBA 4PGGA 1B9NA 1U5TA 4R8HA 1WH2A 2VOBA 2G7HA 2EK5A 1G3SA 4B3MH 2VQFH 2Q2EA 4FHTA 4ESFA 3CTAA 1LVAA 2DQLA 3CJNA 4K0KH 1LEAA 1X3UA 4RGXA 5LBQA 1FPQA 4NB5A 2KSWA 1B59A 4MEYF 5K1YA 2HYFA 4L9VA 5EEHA 2LF7A 2VOPA 3FMAA 1MZBA 2LKPA 2M5WA 5LRSA 2CG4A 4U0YA 2OQGA 2WV0A 4I7HA 2PFBA 2QBYA 1FZPB 3L9FA 5FLXK 1XDNA 2XHKA 3FMRA 5EOYA 1S7OA 4HF1A 4DV3H 1R7JA 3QU6A 3I0TA 1W7PB 3E5UA 3DEUA 2ZBKA 3RJPA 2GQQA 5HS8A 1WRJA 2H09A 5EEGA 2QBYB 3FXUA 4E70A 1I1SA 1HW2A 2XVCA 1SFEA 1LB2A 3RGZA 4BH9A 2UZKA 4JK1X 2MH9A 2E7WA 4AD9A 4CXFA 3V4GA 5CVIA 1D5VA 5FO5A 2MLGA 2FE3A 1Z2NX 2VE9A 2HR3A 3FHZA 4AIJA 1H9TA 2HGSA 1ODDA 4BXUA 4HF2A 2QWWA 3GFIA 4LFUA 1QNTA 4ENJA 1BI0A 4JI2H 1P4AA 5DCFA 3DFGA 1MJBA 4KIFA 4JV5H 2HOEA 1S6LA 4JI1H 2F4VH 1Z1DA 2IRFG 4P9UA 1XCVA 2BV6A 4YY3H 1XSDA 2LDUA 2EWNA 1JHHA 2XV4S 1H0MA 2YU3A 4A0XA 2XKPA 1JXSA 2ETHA 3CLOA 3N43B 2JRTA 5HDNA 1R5GA 3N97A 4DR6H 3J80W 3M1EA 5D5UB 5FPRA 4RZQA 3KP3A 2PEXA 4HBLA 3I64A 1MGTA 1FP2A 2HFHA 1SD7A 3KALA 1H9GA 2EA2A 5JR3A 1T98A 5D5WB 5D6FA 1DDNA 4BHPA 3ML6A 4LGWA 3FZVA 2CGPA 2OZUA 3N40P 1SFUA 2HTJA 3E3VA 4M9XA 3RIRA 4RB2C 1FOKA 2HVQA 4HYEA 1DP7P 5K5RA 4MGRA 3C1DA 1Z6TA 1REPC 5LHGA 3EYYA 5D8KB 1YW7A 4WF2A 1FX7A 4MTEA 2NYXA 1P4XA 4KMFA 4EM1A 3I58A 2L4AA 1Z9CA 5H6RA 2FQ3A 2UXNA 3MFKA 1MKMA 5LHHA 2DK5A 1IXRC 5L3BA 1YG2A 2STWA 4UCUA 1GXQA 2X4HA 3N4MA 2JTVA 2HQRA 4BHCA 2NNYA 2GA2A 4EM0B 2UXDH 2PLYA 1W5SA 3JSPA 2HYGD 3HSFA 1W5TA 1AN7A 4IHTA 2RGRA 2CYYA 2OBPA 5LEKA 1G4DA 3PQKA 5DDGA 1YYVA 1XCBA 4ZZLA 3HTSB 3QPTA 1B04A 1ZG1A 4UVCA 2EFQA 4Z2YA 1L3LA 1U6GA 1HSJA 4YFXF 1NHAA 4BYYA 4CGZA 2VBXA 2O6GE 3P9KA 2D1HA 2H6CA 1I1GA 2L4MA 2ZCWA 4LLLA 4L9TA 1K79A 4NHJA 4DV1H 4HDVA 3T8TA 2E1CA 4IJAA 1D8JA 4EJWA 4PZJA 4KFCA 4JBAA 3O6BB 2ZFWA 4JQFA 1TLHB 3TO6A 5A2QZ 4HZFA 3GFLA 1EH8A 1TQPA 2GWRA 1HBXG 4DV5H 1KU2A 1BI1A 4LFAH 2F5DA 1Z2PX 4OINF 2QLZA 2IA2A 4L9NA 4XRFA 3UQ8A 4DR7H 2WTEA 3V8LA 2YPRA 4DV0H 5LGTA 3P9IA 3HTUA 1K7AA 5LGNA 3JSLA