4RB3C

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (25-MER)
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 37
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb3C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb3C02
4HX8A 1T6SA 2CWEA 1L0OC 1FX7A 3R0JA 4IF4A 2CGPA 3FHZA 3WU1B 3GFIA 1T98A 2JTVA 1K78B 4KMUX 3B02A 3K2ZA 4G8XA 1O3QA 5TRDA 4R79A 2NRAC 3H3ZA 5BS6A 3IL2A 2BBYA 2XRNA 2EFNA 1I6XA 4OMYA 4JK1X 1FLIA 1PDNC 1RI7A 1IXSB 3DXJF 1NHAA 3ZMDA 3H3UA 2RN7A 2L4MA 4EM0B 1P4AA 3ABUA 1R1UA 2KJCA 4NB5A 5CVUA 1KU7A 1J5YA 3BPXA 1ON1A 4OIOF 1ZRDA 1F4KA 2R7DA 2EFWA 4A0XA 2R7FA 5LBQA 1G3YA 3O2PE 1R36A 1RUNA 3TO9A 5F6FA 1KYZA 3WTUC 3LQQA 1IRFA 1FWZA 2RV8A 2C6YA 4AWXB 2XKOA 1CF7B 2DAOA 3TOBA 3BDDA 3F3XA 1ZRCA 5LRRA 3L09A 4HF0A 3BPVA 3HHGA 5DCMB 3V7CA 2VC0A 2KJBA 4IJAA 4ENJA 3HHHA 4B8XA 1G3WA 4MNUA 2YPRA 4UUVA 1TQIA 3Q9VA 4CZZA 3JAMZ 3OOPA 2L02A 1XB4A 3HOTA 2DBBA 3EYYA 3NEUA 3SFZA 4UVBA 2DT5A 4PZJA 1B1BA 4HDVA 2K4BA 1SD7A 1YLFA 3RYRA 3IWZA 3NRVA 2DW4A 3CDHA 5J8CA 4WK8F 1O7LA 5D8LB 3R61A 3DPTA 5IT3A 2XIGA 2M1BA 2DU9A 3U1DA 2GIVA 1KU3A 3ZMZA 5D5WB 4UV8A 3CUQA 2Y48A 3L9FA 4M73A 2E1NA 4YFKF 5FLXK 4OIRF 1R22A 3JTHA 1YO5C 1G6NA 2MLKA 1V4RA 3I54A 4L0ZB 4LJZF 4IPAA 3RIRA 3KP3A 3KCCA 2TDXA 1XSDA 1D3YA 5E20A 4G7HF 4YIFA 3G3ZA 3HRMA 1U78A 2IP2A 2OU2A 3BJ6A 5E8GA 5KVRA 3BROA 1YW8A 5HDGA 1MGTA 3HSEA 4U7BA 1R58A 3LA2A 2VE9A 3ZMSA 1LNWA 2RKHA 2PEXA 2PMUA 2P5VA 1HW2A 4FX0A 1D8JA 2ZKZA 5JFRA 3RJPA 4HV6A 3RKWA 2K86A 2V9VA 1I5ZA 2VBZA 4HV5A 4ETSA 2F2EA 3GZ5A 5JHUA 3P9KA 1I1GA 2UXXA 3ULQB 1XMKA 1G4DA 4KIGA 3BJAA 3KLOA 1Z6RA 3IHUA 2FNPA 2O8XA 2HDCA 2LNBA 1B9MA 2F5CA 3E5QA 3KZZA 2CQKA 3QAHA 1R00A 4PGHA 2MD5A 3CJNA 1ZH5A 4UNOA 4EGYA 1HQCA 4IRGA 2P5LC 2CFXA 2ELHA 2GAUA 5F1RA 2HFHA 2COMA 5CYVA 4LLGF 3LFKA 5E1XA 2D45A 3R0AA 2VODA 1BIBA 5BOXA 5IT9K 3JSPA 1Z9CA 5L3CA 3PQKA 1S7OA 1ZGAA 3JTGA 1BBYA 4MQVA 3GZ6A 4KN7X 2HQRA 2HWVA 3FMQA 5ED4A 2G9WA 3IKVA 4P96A 1L3LA 1DPRA 3MZHA 5FD6A 1IN8A 1R5GA 2HYGD 4ENMA 3KP4A 4B09A 4I0AA 5L3BA 3COAC 2OQGA 4OOIA 5JI6A 3BP8A 2ZMEB 1ZGJA 2K7LA 1AOYA 5HS9A 3HSFA 2OZUA 3MWMA 4KICA 2KIUA 4KDPA 2HS5A 2EWNA 2VC1A 1OKRA 2GXGA 3I5UA 6PAXA 4WWCA 5ICEA 3ISPA 3ECHA 1EH8A 2MA3A 4L9VA 2XKPA 3HSRA 3CUOA 3R6SA 5D4RA 2DFIA 3KP5A 2EJRA 1HW5A 3TGNA 2EK5A 2FEZA 3RKXA 1MDMB 1B9NA 4H0EA 3F22A 1XDSA 1TLHB 4M6YA 1J0RA 1QNTA 2RGVA 4LD5A 5D6EA 1H9GA 2FA5A 4MTEA 2A6HF 2UWMA 2K27A 1SD5A 4I02A 2JSCA 4KYWA 2EFOA 4ESJA 1KGSA 3GFLA 2IW5A 2E7WA 4BNCA 3NQOA 4KT5C 4LG0B 3DEUA 1YS7A 3K0LA 2O0YA 3ZQ7A 5LRSA 1J2XA 2V6CA 2IA0A 2HGCA 3QPTA 4R1HA 3V7SA 3QPHA 2IPQX 2P6TA 1BOAA 1E17A 4JQFA 5FD5A 3T8TA 5DDGA 1SMYF 2VOPA 4BH9A 2KIMA 3JSOA 1S3JA 2DK5A 4RB1A 2XAGA 2OD5A 5L3FA 4OIQF 3WGGA 5HDKA 3EETA 1IF1A 4EMSA 2H27A 2ISZA 2IA2A 4EVIA 3K69A 3K1MA 1U2WA 1GHCA 3GX4X 1O3SA 3GLXA 5D5UB 4S04A 1SD4A 1KQ9A 3WTVC 3RYPA 1ZYRF 3CLOA 5ILUA 3JW4A 2A07F 2J5OA 3F21A 1EH7A 1LB2A 3L7WA 1RUOA 2STWA 2G7UA 4ENNA 3C7JA 1KYWA 3CO6C 3P9CA 5DD4A 1UB9A 3Q9SA 4M6XA 4L5IA 4FT8A 4RGSA 2QQBA 4K2EA 4CO8A 1IZ1A 4KN4X 3GVAA 4MTDA 1TQMA 2O6GE 3GEZA 1BI0A 3LSTA 4YFXF 1SFXA 3HRTA 5E17F 1BI1A 1BN5A 1UFMA 3I64A 1YIOA 3V8KA 1F5TA 2F5EA 1CGPA 4HQMA 3KETA 3S2WA 1FYLA 4LMYA 4WCGA 3TQNA 2GXBA 3M9AA 4M71A 1WSUA 2ZCWA 1BM9A 2Q2EA 1H9TA 2YR2A 3KFWX 3F72A 2EV0A 4ZH4F 2CG4A 5BMZA 2HR3A 1R23A 3I71A 3FMRA 5EEHA 5FFXA 5JVTA 4EV0A 4RAZA 4P9FA 4LB5A 1IXCA 2H94A 3VEPA 1W7PA 2WTEA 5CJ9A 5K5OA 2V79A 1YQAA 2WC2A 2FBHA 4AIKA 3F8CA 2NNYA 1USSA 5HVQC 1PP7U 1B59A 1T39A 2MBFA 2MLGA 2MC3A 3C3WA 4EJWA 1R7JA 1XN7A 2LKPA 3TDUC 1IW7F 2W85A 4P55A 5LHIA 4FX4A 1U3EM 4O5VA 3BZ6A 3HUGA 2LF7A 3WTYC 2MH9A 4UXNA 2L54A 4WF2A 3ZN1A 2PMHA 2VONA 3M1EA 5DV5A 3DPLC 1KU9A 3L00A 4BHPA 2DK8A 2QQAA 3K1NA 2H6BA 3FZVA 5HS7A 1JGSA 3JAMK 4I01A 2M8EA 2W57A 3GUDA 3V7RA 2UXNA 1MJBA 3DP7A 3DFGA 5D4SA 4YG2F 4TV7A 3WTXC 3HYIA 5LHHA 1GXQA 2W84A 2XV4S 4MGRA 3WE3A 3KE2A 4BXUA 4Q4ZF 4U88A 5E1ZB 1HKSA 1FP1D 1HSTA 2HKXA 3U9GA 1ZN2A 4HZFA 5DUKA 3K1PA 5HOOA 1G3TA 2DTRA 3WTWC 3F23A 1REPC 2ZBKA 1ZARA 5ILSA 4U0WA 5E1WA 2EFPA 1IN7A 1VTNC 1Q1HA 4YIIA 4ZZLA 4MEXF 1H0MA 2QENA 2E1CA 1IRGA 3F8NA 2FQ3A 3M8FA 4HQEA 4G7ZF 2P4WA 4I09A 3GWZA 1R5HA 4XLPF 4OINF 2IA1A 4XSZF 1IAWA 4M9ZA 2FRHA 1YTYA 1J75A 1ZHFA 1FY7A 2FNAA 3EUHA 1P4XA 5CVVA 3WODF 3ZMTA 4A6DA 1K79A 3IRRA 3MQ0A 3HIFA 2RQPA 3IC7A 3T0YA 4AVPA 2GA2A 1JE8A 4UV9A 4KIBA 2YX4A 1XSVA 2M45A 4RGXA 1W5TA 2A61A 4CDGA 4ON0A 2VE8A 4UVCA 1XCBA 1HKQA 3PQJA 5DUIA 4AD9A 4LFUA 4MHGA 3V8JA 1FOKA 2XAHA 4AIJA 3U2RA 4G6QA 2CO5A 5J6XA 2DPUA 3C1DA 4IXAA 2HEOA 2A68F 1ZAOA 1OYIA 1OPCA 4R8HA 3HTSB 1ZREA 4IHTA 1FPQA 4U7DA 1TW3A 2JPBA 1OR7A 3HOSA 5AONA 1K6OA 3TDZC 3N4MA 3QP6A 4N9IA 3FXRA 2GZWA 4IRIA 3E6BA 2L4AA 2IT0A 1DDNA 2M30A 2FSWA 3M8EA 2KRFA 3RI4A 2A3SA 1Y0UA 1HXDA 3GXOA 1R1VA 2XUBA 3E6CC 5ILVA 4RB0A 3KLNA 1WI9A 5EEGA 4WXDA 2L3DA 3IKTA 5TJJA 4HOBA 1S7AA 1T38A 4CHUA 1XGOA 2ZNYA 4ZYHA 2WWYA 2DO7A 3N97A 4QWQA 4A2UA 1MD0A 2VBXA 1J7KA 3FF5A 3QU3A 2ESHA 4GXOA 5HLHA 3CUQB 2ISYA 2H09A 3H92A 3B73A 4U0VA 3I53A 4NQWA 4XSXF 1P4WA 2Z33A 3WG9A 4N9HA 3EDPA 4OIPF 1QQIA 2V1XA 1UHMA 1ONVA 4YFNF 3KZYA 2DQLA 1EH6A 4KUMA 3F6VA 1IN6A 4HDUA 2O61A 2FBKA 1F1ZA 1KA8A 4UHTA 3VOEA 1TNSA 3TO6A 4AIHA 4D0PA 3FM3A 4ENKA 2K4JA 2GWRA 2CW0F 1WWXA 3I58A 2BYVE 4EJOA 4RB2C 1D8KA 1GXPA 5D8KB 4L18B 4OU0A 1ZLJA 3WU0A 4MEYF 2R3SA 1QZZA 1FYKA 4G7OF 5LEKA 4RS8A 3BJOA 4PDKA 1FNNA 4L9JA 2Z9OA 1XGMA 1YG2A 4DQ2A 2O3FA 5K5RA 1GVJA 1P2FA 1S29A 1UCRA 1P92A 2F5DA 1U5TA 4ESFA 2NAZA 2XROA 2IVMA 1F9NA 2FE3A 1BJAA 3F8FA 3GW2A 4HYEA 3ZN0A 2P7CB 3QOPA 4HX7A 1LEAA 5LGTA 2QLZA 2V1UA 2O03A 2Z5UA 4KA4A 1G3SA 5DCMA 5DCFA 2LSOA 2PG4A 4CYDA 2VBWA 3GFJA 4RGRA 3ZMVA 2DQRA 1LDJA 4HA8A 4XBFA 2PQ8A 2HZTA 2QYOA 2VBYA 3T5XA 2VXZA 5BQTA 4LK1F 1K7AA 2Y75A 3FXQA 2ZJ2A 1T0FA 4EJVA 3WTSC 5KK1A 1QO0D 1TNTA 2QZ8A 2RDPA 4PCQA 4LK0F 4L0YB 3E5UA 5H6QA 2Y0MA 3RPUA 3L2CA 4WX9A 1OMIA 3F6OA 1ON2A 3SXYA 1SFUA 3MAJA 1FYMA 3DQVC 4HLXA 3FMSA 4P9UA 2QM3A 2RNJA 3MZYA 4O3MA 4EGZA 1W4MA 5ICFA 1WKMA 1FBQA 2EV5A 2M5WA 4FHTA 4BHCA 5LLQA 2PLYA 2EA4A 4M9XA 5HLGA 4LB6B 3O3KA 2Q0OA 2A69F 1MJAA 3Q5FA 1T2KA 4EQQA 2XAJA 1Z7UA 4Y17A 1HKTA 3R4KA 2NS0A 5HS8A 2JT1A 2AXLA 2CSOA 1HSJA 4L9NA 4EM2A 1A04A 4M72A 3LA7A 4CXFA 3IRQA 1HBXG 3CUQC 1EV7A 3SZPA 2PI0A 1IN5A 3HTUA 4ZYGA 1LQ1A 3I59A 4RB3C 2OQRA 2L01A 1XMAA 5D6FA 1DP7P 1V3FA 2P5KA 1QPMA 1BC7C 4HBLA 5L3DA 4IHSA 4KNYA 1USTA 3BY6A 1U5TB 3KP6A 3ZPLA 4HLYA 1QZYA 3G73A 2YX7A 1JXSA 1JHHA 3GF2A 1XSXA 1E2XA 1UHWA 2LDUA 2FF4A 3K9TA 3WTZA 3ZP5A 4KMFA 4I98B 4GCVA 5E8IA 4O6JA 1U8RA 2XGXA 3AAFA 5DEQA 1ULYA 3I0TA 4KIFA 3FXUA 3FM5A 3W6KB 1LDDA 1ZG3A 3FX3A 2K02A 1MJ9A 3E5XA 5JR3A 2PJPA 4EJUA 4N0BA 4F7ZA 3MFKA 1FZPB 2FXAA 1ZLKA 2QBYA 3TKYA 1YYVA 4RAYA 1I1SA 1BC8C 3E97A 1R1TA 1Z91A 2Z99A 1STZA 4A5NA 1MZBA 2BEOA 2HKOA 5CVRA 4I7HA 4Y13A 2XASA 3SHFA 1TW2A 2EB7A 1LDKB 4BQAA 1RIOH 2QQ9A 2OZ6A 1DUXC 3KP2A 3T8RA 5BPDA 2ZMEA 3LQRA 1SFEA 2QWWA 5FLXZ 5BPIA 5LEJA 2NYXA 1TBXA 3VFZA 4A0YA 1O3RA 4LLNA 1O3TA 4GYIA 4IRHA 5L3EA 4Q47A 2ACJA 1IXRC 5DD8A 2PFBA 4LLLA 3J81Z 2VT2A 4A12A 3F8BA 2ADUA 5CVIA 1XCVA 5H20A 3J81K 1I27A 3R60A 2QUFA 1SAXA 4E70A 2KIFA 1MKMA 3ABTA 2D1HA 2V1DA 2M87A 5ICGA 2F5FA 1IN4A 4GGGA 1OYWA 3REOA 4BYYA 1MDMA 4RGUA 3RPQA 5LGUA 5E18F 1XD7A 4CGZA 2E7XA 2ZXJA 3RKYA 1S8NA 1Z1DA 2VOOA 1O57A 4S05A 1BIAA 1JHFA 3I59B 4G6DA 4M74A 1W7PB 2DLLA 2FOKA 4LGWA 4Z2YA 3CO7C 2LF8A 1BI2A 1U6GA 4HF2A 4DNCA 2HOEA 2OAZA 3C18A 3WGHA 3P9IA 4JBAA 1KQ0A 4Q48A 4LG0A 1S6LA 3IWFA 4WXCA 1XDUA 2ZO4A 2STTA 3E3VA 2JZYA 1LVAA 1YW9A 2HQNA 2P7VB 2ESNA 4L5JA 2DI3A 1B6AA 1XGNA 1YS6A 3P7NA 1LEBA 1LJ9A 3LAJA 5F64A 1C0WA 5IT9Z 1FBUA 2BGCA 2BE5F 5FB2A 1Z6TA 4EM1A 2VT3A 3O6BB 3ELKA 5AIQA 1J9IA 3D0SA 1PUEE 4A0ZA 2XVCA 3LA3A 3DF8A 5A2QZ 1BI3A 4MQ9F 4GO1A 5HDNA 3WTTC 3I4PA 2VN2A 2EFQA 1U5TC 3GFMA 2BV6A 2QBYB 4M9SA 4CICA 5A2QK 3SQNA 1FC3A 4HF1A 4Y15A 2YU3A 2A6EF 5HLIA 1D5VA 3HRUA 4XRFA 2ZFWA 2WV0A 3T1BA 1WRJA 3HRSA 2GQQA 3SZTA 2PN6A 3V8LA 5ERIA 3BOQA 1W7PD 5CLSA 5AIPA 2HYFA 3V4GA 3KP7A 4P5OA 1O7FA 3RTRA 4WXHA 4XLNF 4OMZA 4PGGA 2D1VA 1K78A 4HW0A 4UVAA 3VODA 4A6EA 2IJLA 3RDIA 2KKOA 3MEXA 1WQ2A 5FGMA 2B0LA 1RZ4A 5L3GA 2G7HA 2PBIA 3ERED 2RC4A 5FO5A 4NHJA 3QU6A 2Z3YA 2OA4A 3F8MA 5LHGA 1B4AA 3MCZA 2JRTA 1HW1A 3DKWA 4HX4A 5FFZA 2X4HA 4EJTA 1KQ8A 4ZZDA 1W5SA 1FSEA 4ZYEA 5J8FA 3GYHX 1ZRFA 2Q8KA 4ASNA 1FBSA 1YFHA 2H6CA 2FBIA 2GA1A 2NNNA 5K1YA 3E6DA 1KU2A 2FMLA 4QLCU 3CTAA 3LAPA 1IUYA 2IRFG 1FP2A 1DPUA 1SMTA 2XAQA 2HTSA 2FMYA 3KEOA 1FSHA 4I2OA 2ZNZA 2A5YB 2EA2A 4L9TA 1CF7A 5D5VB 4GYGA 2AS5F 5LGNA 1P6RA 5CVJA 4G94A 1QBJA 3ECOA 3EYIA 1X3UA 4U0YA 2DPDA 3ZMUA 5ICCA 2ETHA 3VB2A 4ESBA 4I0BA 3GO5A 3BWGA 3OV8A 4HAMA 3QRFF 2JPCA 3TOAA 3LWFA 2EV6A 4IVNA 1AWCA 5K5QA 3WE2A 2UZKA 1ZG1A 3J80Z 3W6JB 1J59A 3D5LA 3J7AO 1QGPA 1ZG5A 2FU4A 3E6MA 4BAYA 2XHKA 1PP8F 1ODDA 4Q5SF 2OBPA 3ML6A 5D5XB 3DV8A 2W25A 4A5MA 2W24A 3J80K 3FWEA 5DYMA 1OYYA 2D2WA 1TTYA 2MH2A 4ZYDA 2J5PA 3PFIA 4KFCA 1SD6A 3M7GA 3KEQA 4G9YA 3WGIA 1XGSA 2RVCA 5H6RA 2XAFA 1TQPA 2X0LA 2CYYA 2YSRA 3QP5A 4BHBA 1Z05A 2HTJA 3ROUA 3EQLF 2QVOA 1FT9A 1YW7A 2P6SA 2P8TA 3TO7A 1RNLA
chains in the Genus database with same CATH superfamily
2FK1A 4HX8A 1T6SA 5E3NA 2X1DA 3I3LA 4RMNA 2LY1A 3OS0A 2CWEA 3R23A 1L0OC 2WYOA 4B3RH 1FX7A 3FXOA 4PDBA 3R0JA 4F4XA 4IF4A 2BY3A 2CGPA 2KHMA 4NBQA 3H5RA 4DR4H 3ONQA 1G59A 4ZYAA 3DBHB 3CCJI 3N41B 1LE8B 5FLXW 3T5HA 3DKXA 3WU1B 3FHZA 3KALA 3GFIA 3HOWJ 1T98A 2JTVA 2EZIA 4NQWB 1K78B 2VPRA 4KMUX 4A93G 3CCVI 5E3OA 4E6KG 3RF2A 1RRJA 5KFOA 1D1CA 4NXMH 3B02A 1X4PA 1EKEA 2E5LH 3K2ZA 4G8XA 1O3QA 1I3QJ 3HXLA 3ZQLA 1IGNA 4DV4H 5TRDA 4R79A 2W9CB 2HI3A 3KHRA 2NRAC 2EINH 1DGSA 1ETYA 3H3ZA 2VUMJ 5BS6A 3MR3A 1MNDA 1PJRA 1APLC 2B63A 2MYSA 3QYBA 3IL2A 5KFPA 2X1EA 2BBYA 4MFEA 2XRNA 4ECQA 2EFNA 5EDWA 5LYJF 1I6XA 4OMYA 4JK1X 2VQEH 1FLIA 3K4NA 1VFCA 1PDNC 1RI7A 4M3GA 1GO3E 1IXSB 3DXJF 1NHAA 3ZMDA 3H3UA 3K10A 2XC7A 2LY2A 2RN7A 4EYHB 4ED6A 2L4MA 2RAEA 3ZXSA 4EM0B 1JUPA 5FKNA 3L4KA 1P4AA 3ABUA 1ZELA 1R1UA 1OCCH 2KJCA 4NB5A 2WV1A 5CVUA 1CE8A 5JH7F 4FASD 3VDXA 1KU7A 1FJLA 3W2VA 1GV5A 1J5YA 3BPXA 3R5FA 2A05A 3ZQCA 2R7TA 2DA2A 1ON1A 3CCQI 2YZNA 5C3EJ 4OIOF 1XMXA 2JWTA 2WADA 3CCEI 1ZRDA 1S03G 1FMWA 5DG9A 5BPFA 2YCHA 1F4KA 2R7DA 3VYRB 5DGAA 4O4HF 2EFWA 4MV7A 2M05A 2R7MA 4A0XA 3E5NA 1X58A 2R7FA 5LBQA 5IYDJ 1G3YA 4YR0A 3O2PE 2R7OA 1R36A 5EGOB 2DTZA 1RUNA 3TO9A 2CV2A 4QWDA 5F6FA 1F43A 1KYZA 4M3DA 3MD2A 2D5VA 2LBFB 3WTUC 4QWBA 2OTJI 1IOVA 1YI2I 3LQQA 3RTXA 4IO9F 1IRFA 3HZJA 3OSGA 2YW2A 4EBDA 1FWZA 2RV8A 2C6YA 1ZHSA 1OQYA 3K5HA 3L2RA 3UFXB 3RQIA 3M3YJ 4YHHH 1VBHA 4AWXB 3R5HA 1WR2A 2XKOA 4DBRA 1UZCA 1CF7B 4O3PA 2DAOA 1WCMJ 1X2MA 3TOBA 4JV1A 1XDNA 3BDDA 4C30A 1IBKH 3NAUA 1H89C 3F3XA 2EZHA 3TW7A 3CMEI 5KG1A 3LSPA 1ZRCA 2J6TA 3M4IA 3W3CA 5F0CA 2ZJRF 3G4SI 4BXXG 2M2EA 4F4YA 2PBZA 5LRRA 3EPIA 3OY9A 1ETWA 4XICA 3OIQA 2M9HA 4DW6A 2X0SA 3GTJJ 3L09A 4HF0A 3BPVA 3CMAI 2CV0A 2W6ZA 3HHGA 4PJJA 5DCMB 3V7CA 2VC0A 2CU7A 5DG7A 3C0FB 2KJBA 2JA6J 2ZDQA 4EEFG 4JI3H 4IJAA 4ENJA 3HHHA 1EHIA 3A4CA 4B8XA 1IBLH 1G3WA 4MNUA 2YPRA 4TQRA 2KT0A 4UUVA 3S2HJ 4YR2A 3CF2A 1TQIA 3Q9VA 4XRSG 4CZZA 3JAMZ 3HOZJ 3OOPA 2L02A 2GPWA 3GTGJ 4H4KC 4YBZB 3CQZJ 3WU2C 4DYRA 1YRNA 2DZDA 5EOYA 3OHBA 1TWAA 3RAXA 3RZOJ 3TEDA 4NUBA 2KQRA 2IBDA 5KG0A 4XIDA 1XB4A 3T5LA 3HOTA 5K7HA 5KFBA 2DBBA 4XL9A 3WG7H 3EYYA 3NEUA 3SFZA 4V19K 1W93A 4UVBA 2DT5A 4E7JA 2DOEA 4JUZA 4IEJA 2V1NA 4PZJA 1WZ2A 1UJ8A 2VQFH 1B1BA 4DJAA 4BY1G 4FE4A 3OSNA 2XAUA 4HDVA 2KMUA 1TWGJ 2K4BA 3V4SA 3ZQGA 1SD7A 3CP8A 1YLFA 4Y3OA 3IWZA 3RYRA 3NRVA 4BJ5C 2DW4A 2HGSA 3CDHA 1S5LC 5J8CA 1OR7C 4WK8F 5DG8A 1O7LA 4G6TB 1ZGWA 2N8GA 2BHZA 5D8LB 1WFXA 4A3MJ 2HNHA 3HPHA 1OCZH 3R61A 3DPTA 2J9GA 3PIPF 3IAM2 5IT3A 3I4NJ 4BE0A 1OCOH 2XIGA 1ETXA 1JGGA 2M1BA 2DU9A 1DQUA 3BCBA 1RYSA 3U1DA 2CUJA 2GIVA 1KU3A 1NG6A 3ZMZA 5D5WB 2HPIA 3CC2I 4UV8A 1I7NA 3VMMA 2JJ7A 2QK4A 4BE2A 3ZQQA 1S0MA 3CUQA 2Y48A 2RREA 3L9FA 4M73A 1P8LA 2CQXA 2IXSA 2E1NA 2NVXJ 4YFKF 5FLXK 4Q45A 4OIRF 1R22A 1WH5A 3JTHA 4F93B 1YO5C 1FVIA 4O3SA 1G6NA 5T14A 3ZCOA 2ELKA 2MLKA 1ZTRA 3E7LA 1V4RA 3I54A 4BKXA 4LH6A 4L0ZB 3ZGKA 4LJZF 4IPAA 3RIRA 1RESA 3KP3A 4E7HA 3KCCA 2R7RA 2TDXA 2V4RA 1POGA 2M0CA 4BDYA 4XKWA 5DM7F 1XSDA 1D3YA 5EF6A 5E20A 1TWHJ 4G7HF 4YIFA 2E34A 3G3ZA 3UKGA 1D0YA 3GIMA 3I4MG 1E4GT 1IDYA 3HRMA 3LSKA 1U78A 2IP2A 5FPOA 2OU2A 4V2FA 3BJ6A 5E8GA 3PO3G 1JLLB 5KVRA 1GT0C 3BROA 2BY1A 2V59A 1YW8A 3MR6A 5HDGA 3UQ8A 1MGTA 4DUZH 3HSEA 1ETQA 2ZFUA 1R58A 4PFPA 4U7BA 1Z2PX 4DL7A 3LA2A 2VE9A 1DV2A 3ZMSA 1LNWA 2RKHA 2PEXA 2NU7B 4UCTA 2PMUA 3PUBA 3W6VA 2P5VA 3RB3A 4A3LJ 2L9RA 4Y52J 3L4JA 1HW2A 2R82A 3GTLA 4FX0A 1D8JA 1S68A 2ZKZA 5JFRA 3H36A 3RJPA 4HV6A 3AL0B 4F4WA 2UVUA 1SFOA 3FXJA 3RKWA 2K86A 3ZQFA 3BG7A 2V9VA 4F50A 1I5ZA 4D7MA 3BABA 2VBZA 2W7NA 4UCSA 2JEIA 4HV5A 4DR1H 4ED8A 1QZEA 4ETSA 3SYTA 2F2EA 1AHDP 1BL0A 3GZ5A 2LFBA 5JHUA 3IH3A 3P9KA 4EYIB 2H1KA 1I1GA 2UXXA 3ULQB 5D8DA 4WBNF 4R8UB 2V4JC 1XMKA 2BZTA 4KIGA 4D1QA 1G4DA 2JUGA 1O75A 4EGJA 2Y9YA 5FKOA 3BJAA 1PYVA 3RPUD 3KLOA 4DZPA 1Z6RA 1PVEA 4KJZA 3IHUA 2XGPA 2FNPA 2O8XA 2RQQA 3HB9A 3PNVA 2HDCA 1Y1VG 3K4CA 1I50A 1N77A 5H2FC 2LNBA 4E4TA 3DTIA 1B9MA 1IG7A 4C5AA 5GTHC 3BQ2A 2BQRA 4BBSJ 3ASOH 4BL0B 2F5CA 1S72I 2B7EA 1V5FA 3DEEA 3E5QA 3KZZA 4LIVA 4AC0A 2CQKA 1EUDB 2YUSA 4KT6A 3QAHA 1R00A 2F4OB 4XLCA 3GIQA 4PGHA 2MD5A 4GLXA 1E0EA 4Y7NJ 5LFAA 2HYJA 3PNYA 2GIZA 2E71A 2LOOA 3CJNA 1ZH5A 2I87A 4J9KA 1BXRA 2W82A 4II2A 4UNOA 1RJQA 5GAHJ 2R8KA 3FKJA 2JA5J 4PJNA 1X9NA 4EGYA 3KTMA 1HQCA 4IRGA 2MW8A 4M3FA 2CFXA 2P5LC 3DLLF 2EIMH 3L1PA 2ELHA 2LR8A 3TIGA 2GAUA 1CQIB 2HFHA 5F1RA 1VQ6I 2COMA 5CYVA 4PSWA 4BEHB 3HJEA 4LLGF 2EZLA 3LFKA 5E1XA 4B44A 4LITA 4FETA 2VL8A 5IP7G 3G6XA 2AGPA 4LF9H 3PW0A 2D45A 3R0AA 4LIUA 3I56I 1BIBA 2VODA 5BOXA 4ZI7F 5IP6A 3ERMA 5IT9K 3JSPA 4LSAA 2HQ5A 2C2DA 1Z9CA 2ECCA 4BJ6C 3S17J 3MVPA 1SVMA 4IRKA 2UUBH 3PSFA 5L3CA 4E7ZA 3PQKA 2C2EA 1I94H 3HC7A 5FKKA 2KLOA 1S7OA 2NVTJ 4ECWA 1V51A 3RBEA 3A0HC 2BVMA 5CQGA 1ZGAA 3A01B 2ECBA 4D9JA 3TINA 3JTGA 1BBYA 2M34A 4MQVA 3GZ6A 3A0BC 4KN7X 3RB6A 2HQAA 3OS1A 1UC8A 2JA7G 2XCLA 5KFRA 2HQRA 3GIPA 2HWVA 5C8YF 5IYCG 4LF5H 3FMQA 1K4TA 5ED4A 1YRNB 2G9WA 5DQGA 2X6XA 3EUAA 4BJTA 3IKVA 3DKYA 2GLTA 4J9OA 4U7CA 4P96A 4FBUA 1WH7A 3S93A 4V2GA 4M9UA 3OL4A 1L3LA 1JKOC 4FQGA 2QKMB 1AN7A 1WJAA 2QSHX 1SVOA 1DPRA 1ENHA 2MCTA 2YS7A 4JP0A 3L2UA 3MZHA 5FD6A 3GIIA 4RUAA 1QHHD 2W9AA 4RZRA 1IN8A 1R5GA 2HYGD 2V9WA 2R7LA 4ENMA 4IOCF 4RNMA 1S9FA 1XMQH 4X6AJ 3KP4A 2ZJPF 3OYLA 3Q2OA 3W2WA 4B09A 3GTMJ 5KT7A 1R5ID 4I0AA 1E3OC 5L3BA 3SFIA 3COAC 4A3JG 2X9DA 2MABA 2OQGA 4A2AA 4OOIA 5JI6A 4RDUA 3BP8A 2I5UA 2ZMEB 2CW7A 3EUKL 2WAEA 3H3VK 2K9NA 4I4TF 5B1BH 1ZGJA 2UVRA 3OYIA 1RJRA 2HOTA 2DDBA 3NWSA 2M8GX 2QQ8A 4JI1H 3OUZA 2V7FA 2K7LA 4A93J 1AOYA 1X1PA 5HS9A 4EBCA 3HSFA 4QJFA 2OZUA 3MWMA 4KICA 5KKNB 3L2QA 2KIUA 3WO0A 4KDPA 2LVSA 2HOAA 2HS5A 1T0FC 2EWNA 2VC1A 1OKRA 2VKHA 3GCMA 1VQ7I 5GONF 1I3QA 2GXGA 4PFOA 4K0KH 3I5UA 4C3HJ 1IV6A 5CQEA 6PAXA 3BR2A 4FS2A 2SCUB 4WWCA 5ICEA 1U8BA 5FLMG 4JI8H 3ISPA 4XR6A 5IPAA 3M8JA 3OYCA 3ECHA 1EH8A 3MKZA 2MA3A 4L9VA 4A3FG 2FLPA 2XKPA 3HSRA 4OWRB 2HHHH 2OF7A 5HNFA 3CUOA 2R85A 3SEQA 2R7ZG 1MSFC 2JRMA 3CCYA 2E1OA 3R6SA 5D4RA 4NNJA 2R5ZB 2RGRA 2DFIA 2IS6A 4EGQA 1X3ZB 3KP5A 2O9LA 2EJRA 2NVUB 3MWDA 1HW5A 4LF8H 3VYSB 4ZTJA 3PO2G 3TGNA 2EK5A 4HG2A 1RK5A 2FEZA 3RKXA 4D5CA 4BY7J 3KYCB 2I10A 3KYDB 1LPQA 3BR0A 5M3FJ 1GSOA 3Q0WA 2OTLI 1MDMB 1PUFB 4PJLA 5FRNA 1B9NA 2ZXIA 3FIWA 4H0EA 3H0GG 2NS8A 3F22A 1XDSA 1TLHB 4M6YA 4ECYA 1J0RA 3BR3A 5KAFC 4BUPA 1FEXA 3ESWB 3F0CA 3OMYA 4Y4RA 4FM9A 2M4KA 2C22A 3L2PA 1QNTA 3GQCA 2BXZA 2RGVA 4LD5A 1V55H 5D6EA 5J1UA 1UG2A 4X1EA 4ZC3A 1H9GA 2FA5A 4MTEA 2A6HF 2DODA 2UWMA 1X1BA 2K27A 1SD5A 4CC5A 4I02A 3KHLA 2LKSA 2L7FP 2JSCA 1JKRC 4KYWA 2EFOA 4ESJA 1KGSA 3GFLA 4XMYA 3H9JA 3K4JA 2IW5A 3AFHA 2AHQA 2E7WA 3BZCA 3F9KA 1VQ5I 2K9MA 3H3VH 4PJ0C 4BNCA 5KNLA 2F5VA 5GAGJ 5BPHA 4ECVA 3V6JA 1K83J 3NQOA 4KT5C 1OWTA 5D1PA 4LG0B 1WCMA 2J6UA 3DEUA 1EA3A 1YS7A 1CS0A 1VZ0A 3K0LA 2O0YA 3ZQ7A 3E0JB 1T56A 5LRSA 3S3NA 1J2XA 4A3GG 1Y6IA 2V6CA 2IA0A 4BXXJ 1Y0NA 3PN1A 2HGCA 3QPTA 3HOXG 4R1HA 4J9NA 3T1HH 2JVGA 3V7SA 3QPHA 5HV6A 1ZETA 3BC8A 4FBTA 1GSHA 1RR7A 2VQLA 3OR2C 3CMYA 3GTJA 3PW7A 1KJ8A 2IPQX 2LP0A 2P6TA 4B47A 3RV4A 4A2BA 1GYFA 1BOAA 1E17A 2HVSA 4JQFA 2ASLA 1VNDA 2JMWA 3OWTA 5FD5A 3T8TA 5DDGA 1SMYF 1OISA 3AL0C 2VOPA 2I8DA 4XOPA 2JA6A 3CLQA 4II3A 1YJ9I 2C35B 5F0FA 4QW9A 3OYMA 4BH9A 2KIMA 3SDGA 2R7VA 3M07A 2JUCA 3S32A 2ID3A 3JSOA 1S3JA 2DK5A 4RB1A 2XAGA 2OD5A 4RA2A 5L3FA 4OIQF 1WHUA 4O2AF 2EZKA 3WGGA 1D5YA 4A3IG 5HDKA 3GTGA 5IOZA 1VI0A 3DLAA 3EETA 3CQZA 2PX9A 3M9NB 1S97A 1IF1A 4NC6A 2CUEA 2VPSA 4EMSA 2W48A 2H27A 2FJZA 4XRMA 1WSCA 2UVVA 2KIQA 2ISZA 5EZHA 4IHWA 4L5EA 2IA2A 4EVIA 3K69A 2VOBA 4JI5H 3K1MA 3BZKA 1U2WA 4YRVA 2VJJA 1GHCA 1TWCA 3GX4X 2FOWA 3GLXA 1O3SA 5D5UB 3PW5A 4S04A 1B33N 3JAMW 4BY1J 1SD4A 1KQ9A 3WTVC 1JTXA 3RYPA 1S10A 1ZYRF 3CLOA 3BLYA 5ILUA 1SEIA 4D7NA 4GC6A 3JW4A 2A07F 1TWGA 2J5OA 4IL6C 3F21A 1EH7A 3HG9A 1E4EA 1IBMH 1LB2A 3K3PA 3L7WA 4AM3A 1RUOA 2STWA 4GFBA 2G7UA 4ENNA 1B6SA 3FDYA 1EJ9A 3H20A 5JLWA 3C7JA 2W70A 1KYWA 3CO6C 1MBEA 2QA4I 3H40A 2CS3A 3P9CA 4XZ3B 2W9BB 4A3EG 1VKZA 2K40A 5DD4A 1UB9A 3Q9SA 4M6XA 1R9TJ 4DV6H 5KT5A 2L7ZA 1IC8A 4L5IA 3BG9A 5KHDA 5EEAA 2LMDA 3TP3A 4EFBA 3MZ8A 4FT8A 4RGSA 2QQBA 4K2EA 1HNWH 1MBJA 1Y56A 5F04A 4CO8A 1IDZA 4DGWB 1NTCA 3HPGA 1IZ1A 2W6OA 4KN4X 3GLLA 4B43A 3GVAA 4NDLA 2NXNB 4MTDA 2NVXA 1VS0A 1TQMA 2K85A 3IUOA 3CZ6A 2O6GE 3GV7B 3GEZA 1BI0A 2EIJH 3KZIC 1A6QA 3LSTA 4YFXF 1SFXA 3HRTA 5E17F 1BI1A 1TAEA 2DFEA 1BN5A 1UFMA 3BG5A 1RK6A 3ORQA 4F55A 3I64A 1Y8QB 1F36A 5M5XJ 1YIOA 1B72B 1IO2A 4X0GA 3Q8RB 3V8KA 4EFEA 4YR3A 1F5TA 5EWGA 2CW8A 2L7MP 1TWHA 3OYHA 2W6PA 2F5EA 1NG7A 5J1YA 4J9RA 1CGPA 2JVHA 1WJEA 2Q1ZB 4HQMA 3JR9A 1AKHB 3BR6A 3I4MJ 4A3DG 3KETA 4ECUA 1KJ9A 1SYXB 5L1KA 3CCMI 3E1SA 3JRXA 3PO3J 3S2WA 5J4VA 4LMYA 1FYLA 5BR8H 2WB1E 2LRDA 2DA3A 1OLTA 5KFHA 4QSHA 3PVXA 4WCGA 3JREA 3RAQA 3MMYB 3TQNA 3DWLE 2GXBA 1HNZH 3M9AA 4M71A 2BXYA 3BTIA 2OWOA 5HODA 1WSUA 2ZCWA 1R49A 1IJWC 1BM9A 2TRTA 4BBRG 2Q2EA 2DN0A 1H9TA 2YR2A 5LOVF 5L1LA 2DA5A 3KFWX 3F72A 2EV0A 4ZH4F 2CG4A 5BMZA 1GV2A 1R23A 2HR3A 3I71A 1BR2A 2ZJQF 3HOYG 3AG1H 3FMRA 3JSNA 5EEHA 4ZDOA 5FFXA 5KFAA 2NOJB 2ZMEC 4Y33A 1EZ1A 1JXLA 5JVTA 3KHGA 4EV0A 4R7RA 3OHAA 4LF4H 4RAZA 4GRIA 1N36H 2NU6B 4JI4H 4P9FA 4AYBE 1LFPA 4LB5A 3KX2A 4F92B 3GZNB 4X65H 3RIZA 1IXCA 2R7KA 5DLGA 2L0KA 2H94A 1ITYA 3K6GA 1XMOH 3HOVG 1Y1VJ 5F9NA 4XLEA 5BNGA 3VEPA 1W7PA 1DIKA 1N78A 5B1AH 2WTEA 5CJ9A 2QGUA 5K5OA 2V79A 1YQAA 2WC2A 5CA0F 4LG3A 2FBHA 3C2GA 2DOFA 4AIKA 4LH7A 3F8CA 3G1OA 4BDZA 2PMZE 4MFDA 2NNYA 5JQWA 3WHBA 1USSA 5HVQC 2R4GA 1N75A 1B59A 1D1BA 4YEJA 5TGTA 1PP7U 2YL2A 3G8CA 2FLLA 2FD5A 4C5BA 1T39A 3FMAA 5B5EC 3JRWA 1OCRH 2MBFA 2WB1N 2MLGA 3MJFA 2MC3A 2FUG2 2XCPA 3PW2A 3C3WA 2AXTC 5J2UF 4Y8VB 4EJWA 1R7JA 2JA5A 1XN7A 2YS9A 2LKPA 2YZGA 2EQRA 3TDUC 3SJMA 2R7SA 1IW7F 2W85A 4P55A 3JRHA 1DV1A 5FJ8G 5LHIA 1SANA 3EPGA 3GTOJ 2PVPA 3OS2A 5KFVA 4FX4A 4DR5H 4RBOA 3H1CA 1B8IA 1ETOA 4O5VA 5DS9A 1U3EM 1ACIA 3BZ6A 2DA6A 5IP7J 4EG0A 1Y1WG 1T36A 1Z3XA 3HUGA 4E7IA 1JJ8C 2JN6A 2HPMA 2M7BA 4BU2A 2OV7A 2LF7A 3WTYC 3G6VA 2MH9A 4UXNA 2E36A 2L54A 2WAFA 4WF2A 3R5XA 3UR3C 5DQIA 3ZN1A 5E79C 1NK2P 2PMHA 2XB0X 4A3BG 2VONA 1N48A 2H1LA 5KFYA 2EBIA 1BW6A 3M1EA 2R7WA 5DV5A 5LL6b 3JRFA 4AYBN 3DPLC 5CPRB 4J01A 1KU9A 3L00A 5KFCA 3A03A 4BHPA 4C2MA 2DK8A 1MBFA 2FMAA 1SAUA 4J9PA 2JA7J 2QQAA 2WE6A 1I39A 2I80A 3HBLA 1FJGH 5IYCJ 3S15J 3HL2A 3QZ8A 3S1RJ 1TWFJ 2KP6A 3K1NA 4RAFA 2H6BA 3FZVA 2PMZN 5HS7A 4IX7A 1YOVB 1JGSA 1B04A 3JAMK 1QU3A 4I01A 1TWCJ 2R86A 1WJCA 3BA9A 2M8EA 2W57A 3GUDA 3V7RA 2UXNA 3GLKA 4DV0H 2YU9J 2Y30A 1MJBA 3DP7A 3DFGA 2A5WA 5D4SA 3HM5A 2CUFA 4HNVA 4DOZA 3IP4B 1FIAA 4YG2F 5EG0A 4TV7A 4DYCA 1ZKGA 1R6RA 4ZJZA 3WTXC 4CC6A 3HYIA 5LHHA 3K4MA 1MNMC 3HGGA 1W0UA 1E4EB 5M5YJ 1GXQA 2W84A 2XV4S 4MGRA 3WE3A 4B4CA 3VYUB 3FXMA 4O3NA 3GTMA 3KE2A 4MV6A 4IHJF 4A3JJ 4BXUA 5DTDA 4Q4ZF 3A02A 4MLOA 4U88A 2VPLA 1HLVA 3GTPJ 4MV4A 1T3NA 5IWAH 2C28A 3FDSA 5E1ZB 1DU6A 1HKSA 1FP1D 4XKVA 1HSTA 2HKXA 3NWTA 1RKWA 5D1OA 4CCMA 3J7ZI 3U9GA 1ZN2A 5J4YA 4HZFA 5DUKA 3K1PA 5HOOA 1G3TA 2DFHA 4ITVA 2DTRA 3WTWC 4BE1A 4CH7A 2KRHA 4RLFA 3F23A 2FK3A 4I50F 1K1QA 1REPC 4IWXA 2ZBKA 1ZARA 2MGQA 3H9GA 5ILSA 5FLMJ 5JHFA 4ECTA 4U0WA 5E1WA 2EFPA 1IN7A 2EILH 1A6IA 2HVRA 1VTNC 2XPVA 1Q1HA 4YIIA 4ZZLA 4MEXF 1H0MA 1Q1VA 2FQ4A 2QENA 4A3FJ 4HRIA 3U9SA 2E1CA 1IRGA 3F8NA 2FQ3A 3M8FA 4HQEA 4G7ZF 2DMUA 2ME0A 1VQMI 2R7ZJ 3FISA 5KX5F 2W7OA 5DLFA 2P4WA 3AKZA 4I09A 3GWZA 5GAEJ 1R5HA 2UUZA 2R6FA 4FS1A 4XLPF 1QA6A 4CCKA 4OINF 2QYZA 2IA1A 4XSZF 1IAWA 4MA5A 2W8LA 2GM4A 1XNQH 4M9ZA 3PO2J 1Z0XA 1HR0H 1V5GA 2FRHA 1D1AA 3PIOF 3MKWB 1YTYA 2WB1A 2EH3A 1X3WB 1J75A 4IRCA 5L9XA 5E3MA 1ZHFA 5DQHA 3HOWG 1FY7A 1WJFA 2FNAA 3EUHA 5CKTA 1P4XA 1JIHA 5CVVA 3WODF 3ZMTA 4A6DA 3DF7A 1YIJI 4QWAA 1K79A 3IRRA 2X85A 1W0TA 1MMNA 3MQ0A 3BQYA 3DU6A 3HIFA 4BQOA 1S9HA 3H0GJ 2Q2EB 3ZR8X 2RQPA 3IC7A 3Q3SA 1R71A 3T0YA 4G3IA 1N32H 4TV9F 2K3FA 4AVPA 2GA2A 2R7NA 1JE8A 4UV9A 2R8GA 4JYKA 4KIBA 1N56A 1R4NB 2YX4A 1XSVA 1C3OA 4LF7H 2DJNA 2M45A 4IHXA 1UC9A 4RGXA 1W5TA 2CZGA 2IBKA 1A0IA 2EPFA 5JVDF 3OYBA 3BR5A 5F08A 2FPPB 3MFHA 2A61A 4PJMA 3OL3A 4AYBA 4CDGA 3H9QA 3JRAA 4ON0A 4C3JJ 2R92G 2VE8A 4UVCA 4HSTA 1N25A 1XCBA 2CQQA 3ZRGA 4BXFA 4JOMA 1HKQA 3DBLB 1SC7A 3PQJA 1K83A 5DUIA 2OH2A 2VI6A 4LFUA 4AD9A 5KFQA 2X51A 4F4ZA 4MHGA 3G6YA 3V8JA 3RGXA 1HDPA 1FOKA 4W1UA 2XAHA 3IG0A 4J9LA 4DV5H 3BA8A 4WD3A 4AIJA 4A3GJ 2PMZA 3GILA 2H8WA 4X66H 3U2RA 3SI8A 4G6QA 5E3LA 4CUGA 2CO5A 3HOXJ 5J6XA 2DPUA 3C1DA 1BR4A 2VQHA 2K5CA 4YP3A 4CCOA 3LFUA 4IXAA 2HEOA 2GXAA 2A68F 3H0DA 2MD0A 2F4MB 2QKLB 1B6RA 2MFZA 3LSHA 4JYAH 2R93G 1ZAOA 4E7LA 1OYIA 1OPCA 4XN0A 3PJRA 4R8HA 4CZCA 2WY7Q 1VBGA 1JX4A 3PL8A 3HTSB 1ZREA 5FPRA 4BBSG 4IHTA 1ERDA 2XGQA 3RUPA 4NC8A 1EYZA 4XRSA 1FPQA 3HGYA 1Z7LA 4A3IJ 4U7DA 3I12A 4G12A 3MWEA 5KFUA 1TW3A 2JPBA 4BWSC 1OR7A 3HOSA 5AONA 1WPKA 3G1MA 1MBGA 5KT2A 5TISC 1K6OA 2LG4A 3TDZC 3N4MA 1X19A 2UV1A 3QP6A 2FPIB 4N9IA 3FXRA 2GZWA 4HNUA 2E2HJ 4IRIA 2OPTA 3D5SC 2DMQA 3LP8A 3RV3A 3PW4A 3KIOA 3CJRB 4YELA 4AQYH 2KZVA 3E6BA 2BVLA 4C2MJ 4ED2A 4JV5H 2GBYA 2L4AA 2VUGA 2IT0A 1DDNA 4I76A 2M30A 2FSWA 3BTLA 4BS9A 1FOWA 3M8EA 2UVWA 3C2BA 2KRFA 2F48A 5KG3A 3RI4A 2A3SA 3IH4A 1Y0UA 2W6QA 4RNNA 1HCRA 1HXDA 3GXOA 1R1VA 2P81A 3FKIG 1DP3A 1EF4A 4XN3A 2DT7B 2XUBA 3E6CC 5ILVA 3CESA 4RB0A 4A3EJ 1XS9A 3KLNA 1WI9A 5EEGA 1R9TA 4WXDA 1JJ6C 2L3DA 4XOTA 2JA8G 2VB6A 4UUSA 3CCUI 3IKTA 5TJJA 5K2MA 1DGWY 4CA0A 5EG0B 1T95A 4HOBA 1S7AA 3S14J 4LOCA 4F3QA 2R5YA 2DDAA 1T38A 4A3KG 4J9MA 2QEXI 4CHUA 1XGOA 2L2OA 4RAGA 2ZNYA 4N4NB 4ZYHA 2XSDC 1WJDA 2DO7A 2WWYA 3WO1A 2W6MA 4EBEA 4U87A 3MFIA 4MV8A 5IYZF 1BR1A 2VPQA 4QTRA 3BQZA 1RETA 3QWLA 3OYGA 3N97A 4KISA 4LSXA 2DPJA 3VPRA 4JI7H 4QWQA 4A2UA 1MD0A 2LC2A 1ORKA 4C3IJ 2VBXA 3Q1KA 2GOMA 4EATA 4DR2H 1J7KA 3FF5A 5F1JA 3QU3A 5KFDA 4RLQA 3CJTB 1VQOI 2O7OA 1UHSA 2ESHA 4GXOA 4GDFA 2IGMA 5HLHA 4YAKB 5D1OB 3JSLA 4DR7H 3J7AK 3CUQB 1GLVA 4JI0H 2LTPA 2IS2A 2ISYA 2H09A 1HC8A 3N42B 3H92A 2IS4A 1HNXH 4A3DJ 4BGDA 1MSEC 4C2TA 4ZQIA 1LE8A 3GIJA 3B73A 2V26A 4U0VA 4ECXA 3KAJA 2UUAH 1FIPA 2UXDH 3I53A 3K4BA 1WJ5A 4NQWA 1IRXA 1BW5A 4XSXF 1BJZA 1OCTC 1P4WA 2Z33A 1ZQ7A 3WG9A 4JV2A 4N9HA 3EDPA 1JUSA 3ETJA 4YJ2F 4OIPF 3OR1C 5EJCA 3FXKA 1FTTA 4MV3A 5F27A 1QQIA 3AG4H 4BBRJ 2W1OA 4X62H 3K70D 3ABKH 2V1XA 1MH4A 1UHMA 4BQNA 2E2JJ 1ONVA 2IGOA 2OCEA 4YFNF 1RPWA 3KZYA 1I6UA 2WDTA 2DQLA 2W9CA 1EH6A 5KFKA 4XLAA 4KUMA 3F6VA 1Z21A 1UAAA 4CCLA 4UY8I 1IN6A 1I3AA 3ZQHA 4HDUA 2O61A 1JKQC 4UCVA 2HXIA 1RR8C 1BNCA 2FBKA 1F1ZA 1KA8A 3TIIA 2ZSIB 2XGDA 2Y9ZA 1KONA 4UHTA 3VOEA 1TNSA 2V4QA 2MSYA 1QHGA 2L9SA 4I55F 5FKMA 3TO6A 1RC9A 4ED3A 4AIHA 4D0PA 2FX0A 3FM3A 3TBIA 4ENKA 3CC7I 2OUMA 1LFBA 2F4IA 2K4JA 4ZDLA 2GWRA 1L2ZA 4ECSA 2CW0F 1G2HA 1OJLA 1WWXA 2NVYJ 3HOVJ 3I58A 1Y1VA 1MBKA 2BYVE 2LY9A 4EJOA 4RB2C 4XK4A 1D8KA 1GXPA 4EEQA 3MN2A 5KCMA 5F9LA 2B63G 5D8KB 2XDVA 4OU0A 1ZLJA 4L18B 2DFFA 3WU0A 3BT9A 4MEYF 3CF5F 1YITI 2AO9A 2R3SA 1QZZA 1FYKA 1JDBB 2CJJA 5IP9G 5KFZA 4G7OF 2X6OA 5LEKA 4RS8A 3BJOA 4PDKA 1FNNA 4L9JA 3BQ1A 1QVUA 2Z9OA 1XGMA 1YG2A 2ZC2A 4XYLB 4DQ2A 2O3FA 2YYAA 5K5RA 5EDNA 1GVJA 3H35A 1P2FA 3OSPA 4NC7A 5EGOA 1S29A 1UCRA 2IGNA 5FJ8J 2CRGA 3S3OA 4XQFA 1P92A 3N44B 1WI3A 3GTOA 1W1WE 5KAIC 3JRGA 3GTQA 4ANJA 5KFIA 3A2KA 2VKVA 2VKDA 4RUCA 2F5DA 1Y1WJ 1KJQA 1U5TA 4HR7A 4ESFA 1JTYA 1A35A 4RM3A 3PSIA 4ED1A 2NAZA 5K7FA 3M4OJ 2XROA 2IVMA 2IA6A 2NUAB 1BGWA 1F9NA 1TL8A 1V4YA 2FE3A 4XNFA 1AUVA 1BJAA 2BQ3A 4F52A 2PJRA 2XD4A 2YRWA 4E4HA 2HVQA 3F8FA 4A3BJ 4CYCA 2IGKA 2IAIA 3GW2A 3RQ4A 4APMA 4HYEA 5CB4F 3LWBA 2OCCH 2RDIA 2JSPA 3ZN0A 1WVRA 3JRCA 2P7CB 4C5CA 3QOPA 3IV5A 1X1AA 1VAJA 3DCFA 2FB9A 4HX7A 1LEAA 1MBHA 5LGTA 2DA7A 2JA7A 2QLZA 2Y0SE 2V1UA 2O03A 3ABLH 2Z5UA 4KA4A 2HDDA 1YJNI 1G3SA 2LREA 3N8DA 4DR6H 3MR2A 2Y31A 1QPIA 5DCMA 3GTKJ 3JRDA 1TWFA 2FK2A 1TZLA 5DCFA 1JKPC 2LSOA 2PG4A 1N33H 2DYSH 4CYDA 2VBWA 3AYHB 3B6AA 3GFJA 4RGRA 3ZMVA 2DQRA 4O4LF 1LDJA 3KPHA 4MA0A 4HA8A 5JLXA 4JI2H 4XBFA 2PQ8A 2HZTA 4D5FA 2W71A 2QYOA 2VBYA 2YU9A 4GKJH 3T5XA 5LD2C 3JCUC 2V5AA 2VXZA 2ZXWH 4E7SA 5BQTA 1TT0A 5GPAA 4LK1F 1K7AA 2Y75A 3FXQA 4O3QA 2ZJ2A 1HA8A 1T0FA 4IZOA 4EJVA 2ZJTA 5GPCA 3IAS2 1XPXA 3WTSC 1BA5A 1XX5A 2X6YA 5KK1A 1QO0D 1TNTA 2QZ8A 2RDPA 3G1LA 3X2QH 4BQQA 2P0AA 4PCQA 4LK0F 3GTPA 4L0YB 3E5UA 4DL4A 2MG4A 3K70C 5H6QA 3S1NJ 2K9LA 2Y0MA 1W36D 3RPUA 3KAKA 5KG6A 1YX5A 2VJIA 4IQ4A 3N43B 3L2CA 2KISA 4DV1H 4WX9A 3VPBA 1OMIA 3F6OA 1Y8RB 5FROA 2VA3A 1ON2A 3SXYA 1SFUA 2E1MB 3MAJA 1FYMA 3DQVC 2H8RA 4XKCA 2R5YB 3RGZA 4HLXA 1RJPA 4ECRA 4ECZA 5FRMA 3I55I 3FMSA 5C1OA 2HDWA 2YS6A 4O3RA 3QPLA 4Q0YA 1M0WA 4P9UA 2QM3A 3RZDJ 3S1QJ 2RNJA 3MZYA 1Z3YA 2W8KA 4O3MA 4KITB 1KJJA 5HBRB 3DU5A 4EGZA 2C2RA 2Y0SN 4UFZA 3HDDA 1YHQI 1ULZA 1W4MA 2F6CA 5ICFA 2BR0A 3OTOH 5LXTF 4DUYH 1V54H 1WKMA 1FBQA 3ABMH 2L5QA 2EV5A 2FP4B 2M5WA 3S16J 1O4XA 2V9PA 4PK4A 2R7ZA 3IH2A 1P7IA 3BAAA 4FHTA 2XPWA 4BHCA 2K9QA 1A5JA 2ICWG 2JK3A 5KFJA 3H5AA 1W5CC 4O2BF 4FE7A 4DLKA 1X1CA 5LLQA 4MV1A 3SZGA 2JQ7A 2PLYA 4L1KA 2EA4A 4M9XA 5HLGA 2ZSHB 4DZJA 4LB6B 3O3KA 1ZR4A 2Q0OA 1E3PA 2A69F 1MJAA 2WAQE 2L9NA 1ETKA 2AQ4A 3K4LA 3Q5FA 3OYJA 1T2KA 4EQQA 5L1IA 2XAJA 2QSFX 1Z7UA 3H0GA 2DMNA 3H5NA 4Y17A 2UXCH 4CCNA 4B3TH 3TP0A 4AUXA 4QIWE 2YRXA 1HKTA 4B48A 5KFWA 3J81W 2HU9A 3QOEA 4PWQA 3R4KA 2NS0A 4OAZA 5HS8A 2JT1A 3RKQA 4B3SH 2AXLA 1CQJB 3BQ0A 2CSOA 2VIXA 1HSJA 4B3AA 4L9NA 4J9SA 1JT6A 4EM2A 2Z1DA 1A04A 4M72A 3LA7A 4ME6A 9ANTA 3ASNH 4CXFA 3IRQA 1HBXG 2VQDA 2R92J 4XYMB 2JEGA 2R84A 3CUQC 1EV7A 3SZPA 2PI0A 1IN5A 3HTUA 4ZYGA 1LQ1A 4QPQA 3I59A 2LD5A 1U9OA 3T5JA 4Q44A 4RB3C 3BG6A 2CH0A 2R7QA 2OQRA 4F91B 3IN5A 1G8XA 2L01A 3P5JA 4BY7G 2L9VA 2KPMA 3BCAA 1WH2A 1XMAA 4P1WA 5D6FA 3OUUA 5EWEA 4RNOA 1U9NA 4DL2A 5HNHA 1DP7P 4R8UA 3TL4X 2X1CA 4YAJB 5JVGF 1V3FA 2P5KA 1U0JA 2WAQN 2Q2TA 1QPMA 2R93J 1T94A 1BC7C 3S2DJ 4QPOA 4HBLA 2RNGA 5L3DA 1S7EA 1VQKI 4IHSA 2XF5A 4IRDA 4XORA 3LMLA 1GDTA 4KNYA 2CMPA 1USTA 2COBA 3GTQJ 1PX2A 5I47A 2JEFA 3U1KA 3U9TA 3NGDA 2FLNA 3EUHC 3BY6A 4QIWN 1U5TB 2V9KA 3KP6A 3G6EI 3ZPLA 4PUSA 2ZB9A 4J0MA 4HLYA 1CQTA 1JI8A 2E2IJ 1QZYA 3G73A 2I8CA 1GVDA 2YX7A 5IY5H 2NU9B 3RJ0A 2R8HA 3Q8QB 1JXSA 3GIKA 1JHHA 3GF2A 4MIMA 3L2WA 2F4VH 2PJRB 1IUFA 1OFCX 1E2XA 1UHWA 1XSXA 2LDUA 4Z6YA 2FF4A 1MMSA 4TUYF 3K9TA 3WTZA 4IHYA 3OYEA 2IMWP 5M3MJ 1FOXA 4CYCB 3ZP5A 1W36C 2C00A 2BOLA 3ZOBA 4BEHA 1VQ4I 4KMFA 4JX4A 1ZHQA 4I98B 2E2HA 4GCVA 5HLTA 5C4XG 1W96A 5E8IA 4O6JA 1VF9A 1U8RA 1YE9A 2FKLA 2XGXA 3AAFA 5DEQA 2ZDHA 4YJ3F 1ULYA 3I0TA 4FCYA 4OAYA 2Y0SA 1VQNI 3MKYB 5KFFA 3QZ7A 4DL6A 4JV0A 1IOWA 3GV8B 2WTFA 1Y39A 4AVZA 4ED7A 3Q8SB 4KIFA 5IT9W 3FXUA 3HOUG 4ED0A 3FM5A 3FKIJ 3W6KB 3K7AJ 4IKFA 2XF6A 2WBMA 4ZHQF 3MR5A 4JI6H 1LDDA 3LSIA 3DEWA 3A1YA 5H80A 1ZG3A 5KG7A 3FX3A 4OX9H 2K02A 3A01A 1MJ9A 3E5XA 1QVTA 1T8IA 1HDDC 5LA6F 1MMGA 2E19A 5JR3A 4O4IF 3BTJA 2JA8J 2PJPA 4EJUA 4N0BA 3ZQIA 1Z77A 4F7ZA 2FXAA 3MFKA 1FZPB 3TKYA 1ZLKA 2QBYA 1UNNC 1P9QC 1YYVA 4MV9A 5M5WJ 1I6HJ 3LOCA 3D1NI 4M3BA 4RAYA 5B3SH 5DM6F 4Q8FA 5A2QW 2AGQA 4S0HB 4A3KJ 3G71I 1ZK8A 2KZGA 1I1SA 1K4SA 1BC8C 3E97A 4HYKA 1R1TA 4ZDPA 3CCSI 1Z91A 2HXOA 2Z99A 4UCOA 1STZA 2Y2ZA 4A5NA 1MZBA 4E7KA 4CSWA 3KEYA 2BEOA 2HKOA 4A3CG 2KRCA 4I99C 5CVRA 1VQ8I 4YQWA 3G2BA 4I7HA 2DWCA 1GUUA 4Y13A 4GKKH 2ASJA 2NOGA 2XASA 3SHFA 1TW2A 5J1RA 1QRYA 4HNTA 1C30A 4YB8B 3RFCA 1KBLA 1E4FT 2GLOA 2EB7A 3CJQB 1LDKB 4DL3A 4BQAA 1PK8A 1RIOH 2QQ9A 1V9PA 2OZ6A 3FXLA 1MMAA 5DGBA 2OLSA 1DUXC 4B3XA 5KG2A 2VQCA 5C44G 3KP2A 5IYBG 2VR1A 3T8RA 5BPDA 1H88C 1VQPI 4NXNH 3JRBA 2ZMEA 2KFDA 4KHPH 3LQRA 2CQNA 3QYFA 3QYEA 1SFEA 2QWWA 3RB4A 2W00A 5FLXZ 5BPIA 2K3PA 2X48A 3GMEA 5LEJA 2NYXA 3S8PA 4U6PA 2VA2A 3I9V2 1N34H 2HOSA 4J9QA 2E60A 3JRIA 1TBXA 4QWEA 1H8AC 4DBQA 3PM1A 1M0TA 2HJWA 3VFZA 4A0YA 3GIDA 1O3RA 2R0QC 4LLNA 1O3TA 4GYIA 4IRHA 5KFLA 1MNEA 3J7AY 2XSJC 1MH3A 2NU8B 5L3EA 4Q47A 3OSFA 2ACJA 3FK7A 1IXRC 1HF0A 1LVKA 5DD8A 4C9YA 2PN1A 2UUCH 1AA7A 1TP4A 3HKZE 2DMTA 2PFBA 2WAQA 4XKBA 4LLLA 3V42A 3J81Z 1NK3P 2YZMA 2XGEA 5KFTA 5KG5A 2VT2A 1Z2OX 3OIPA 1MMDA 3UNGC 3S3MA 4A12A 2E35A 3LMMA 4I6ZA 3F8BA 3HEFA 3RBDA 2E1MC 2HZDA 2R5ZA 2ADUA 3DPUA 5GADJ 5CVIA 1T08B 3PNTA 1RYRA 3LSMA 4YY3H 4IR1A 4QIWA 2DT6A 1XCVA 2M0MA 5H20A 1DGRM 3K3VA 3J81K 1GSAA 1I27A 2GOXB 3R60A 1MIJA 2ASDA 2QUFA 2NVYA 1X4OA 1SAXA 4N4OB 4E70A 4M6VA 4TV8F 2KIFA 1MKMA 2TCTA 2QCOA 3ABTA 2D1HA 2V1DA 2JEJA 2M87A 5ICGA 2VUMG 2B63J 2F5FA 1IN4A 2VXDA 1A31A 4QWCA 2VQGA 4GGGA 2R8JA 1OYWA 3REOA 4BYYA 5IP9J 1RKTA 1MDMA 4RGUA 3B6CA 3O8GA 3RPQA 3U21A 5IOYA 1BOBA 1PUFA 4C2UA 5CA1F 5LMUH 3T1YH 3WNZA 5LGUA 5E18F 2R7UA 1XD7A 3L2VA 4CGZA 1WGXA 2E7XA 2ATLA 1M7JA 4DV3H 2ZXJA 3RKYA 1S8NA 1KJIA 1Z1DA 2VOOA 1O57A 3Q0UA 4S05A 2Y69H 1BIAA 1JHFA 3I59B 4G6DA 5EZGA 4M74A 2Z2SB 1X1DA 1W7PB 1TA8A 1KZHA 3CVZA 1XG1A 4HEA2 2NVQJ 2DLLA 2R7XA 2FOKA 4LGWA 1JDEA 2M4GA 4Z2YA 2LF8A 3CO7C 1BI2A 2DXIA 1U6GA 4HF2A 1Y1WA 2EIKH 1FTZA 4M3EA 2AGOA 1GLNA 5C3EG 4X64H 4DNCA 2XC9A 2HOEA 2OAZA 2WY8Q 2V58A 5GP9A 1YX3A 3C18A 3HKZN 3SEZA 3WGHA 4HPQA 3P9IA 1M6VA 4JBAA 1KQ0A 3CDIA 2BY2A 5IYDG 4Q48A 4LG0A 2OJED 3BJYA 1S6LA 1VQ9I 3IWFA 4JX5A 4WXCA 4DYQA 1XDUA 1DU0A 2ZO4A 3EPZA 3H4BA 1E3HA 2AU0A 2IEKA 4AIDA 1XC5A 2STTA 3E3VA 2JZYA 3BG3A 1B8IB 1BJTA 4XLHA 1LVAA 1YW9A 2BY0A 3HUGB 5J3LA 3VSLA 2HQNA 2P7VB 1LFUP 2XF7A 2ESNA 2FJ1A 3PFYA 4L5JA 2VJ4A 2DI3A 4LFAH 1B6AA 2O8KA 3AG2H 3M9OB 1XGNA 1YS6A 3P7NA 3GTKA 3N6XA 1LEBA 1FOYA 1LUJB 2NS7A 1LJ9A 2UU9H 3LAJA 3FK6A 5F64A 1WCMG 1C0WA 2DMPA 5IT9Z 5KFGA 4W97A 1FBUA 2FPGB 2BGCA 3PUFA 2BE5F 2ID6A 5FB2A 4M7EA 3Q8PB 1Z6TA 3Q0VA 3RCOA 2VT3A 4EM1A 3CD6I 3O6BB 3ELKA 5AIQA 2DLNA 5KT4A 2DIKA 1S0NA 3DBRB 1J9IA 3OIOA 3D0SA 1PUEE 4A0ZA 3S1MJ 2XVCA 3LA3A 4FTHA 2LYCA 3OYKA 3J80W 3DF8A 1NH3A 5A2QZ 3CP2A 3VPCA 1BI3A 2JA6G 2CQYA 3V4ZA 4MQ9F 1IV8A 4GO1A 5HDNA 4CCJA 3WTTC 1AUXA 4DV7H 3I4PA 2VN2A 4JX6A 3CMMA 3GBGA 2EFQA 1U5TC 2BW3A 3GFMA 2BV6A 4UUTA 2QBYB 3HOZG 3PR4A 4M9SA 4CICA 2LLKA 5A2QK 4MO7A 3SQNA 1FC3A 2XB5A 2JA2A 3DTKA 4HF1A 2VJ5A 3K2AA 4Y15A 4DR3H 1TWAJ 2YU3A 2A6EF 2DYRH 5HLIA 2CV1A 1D5VA 2E5ZA 3HRUA 3D5RC 4RU9A 5EYRA 3KYLA 4XRFA 1X2NA 2CUZA 2ZFWA 2R8IA 2W9BA 2WV0A 3T1BA 4B3MH 1WRJA 3HRSA 2GQQA 3SZTA 2O5RA 4ZTFA 3MKLA 4UCUA 4HQ6A 2PN6A 3V8LA 4UCRA 5KFXA 4J00A 3OYDA 3VPDA 5ERIA 3BOQA 1W7PD 5CLSA 5AIPA 2Z16A 1M1EB 2MC4A 1T33A 3CCRI 5JUMA 5CAEB 2HYFA 5JVLA 3V4GA 3KP7A 1MW7A 4P5OA 1K61A 1K1SA 1O7FA 3RTRA 1FKAH 4A3MG 4DIQA 4XX0B 4WXHA 2CKZB 3N40P 4IHVA 4XLNF 4OMZA 1WJBA 2KL4A 1XNRH 1YJWI 3I4NG 4PGGA 2D1VA 1UG0A 1K78A 1UELB 1VQLI 4IQJA 2XCAA 1B72A 4HW0A 4UVAA 3VODA 4A6EA 5J47A 1TT5B 2VKEA 4PSXA 5EZYF 3AG3H 3OYFA 1JUMA 2IJLA 1J5EH 5F0HA 4LFCH 5FLVA 3RDIA 3LNQA 2KKOA 3MEXA 1AKHA 1WQ2A 5FGMA 4DV2H 2B0LA 1RZ4A 5L3GA 2G7HA 4B1RA 3HOYJ 2E5NA 2PBIA 3TMOA 3HKZA 3ERED 2RC4A 2VUMA 5FO5A 2ME6A 5J40A 4NHJA 3QFFA 3QU6A 4YIRX 2M3AA 2Z3YA 1JKJB 2OA4A 5EWFA 3F8MA 5LHGA 4XONA 3KXYT 5L1JA 1B4AA 3C2HA 3MCZA 1KC7A 2QSGX 5KFMA 2KSWA 2R92A 2XRLA 4IWYA 3LL7A 2JRTA 3M1CA 1HW1A 1Z2NX 4QW8A 3DKWA 2LK2A 3SDBA 1P7JA 4HX4A 4MAMA 3QODA 5FFZA 4RZQA 2DCEA 2X4HA 4EJTA 2DOAA 4EEYA 2OC6A 1KQ8A 5J2TF 2CQ7A 4ZZDA 1W5SA 1FSEA 3K4KA 2IS1A 2RF4A 5LP6F 4ZYEA 5J8FA 2ELJA 3GYHX 1KEEA 4IR9A 1ZRFA 3VWBA 2L7KA 2Q8KA 4ASNA 2W6NA 4GC7A 1FBSA 1YFHA 5B66C 4A3LG 4J19A 2H6CA 2FBIA 5GTIC 3JZIA 3SE7A 1S0OA 2GA1A 2AQFA 2ALZA 1LKXA 2NNNA 4Q43A 3GV5B 4FU0A 5K1YA 2R87A 3GTLJ 2ZM6H 2R93A 3E6DA 3QQAA 1KU2A 4FISA 1SFOJ 4XM3A 2FMLA 3DTEA 4QLCU 1XTAA 2G0EA 1UMQA 3OYAA 4IZZA 3CTAA 2LBFA 3FBNB 2IP4A 4UB8C 4XLFA 3LAPA 1SVLA 1HOMA 1IUYA 1ETVA 1OCPA 3WHCA 2IRFG 1FP2A 3H4DA 1DPUA 4LF6H 2AQEA 5FKLA 1SMTA 2XAQA 2LH9A 2E2IA 3OOUA 2K9SA 2KDZA 5C1PA 2HTSA 1SCUB 2FMYA 3KEOA 1FSHA 4I2OA 2ZNZA 2A5YB 2EA2A 4L9TA 1CF7A 5D5VB 4GYGA 1I50J 1SEUA 2AS5F 2XGCA 1JT0A 4A69C 3BR1A 2A6TA 1P6RA 3TW6A 5LGNA 5KFEA 2J6SA 1K6YA 2WA0A 3M9MB 5K7ZA 5CVJA 4G94A 1QBJA 3ECOA 3EYIA 4O3OA 1X3UA 4U0YA 2DPDA 2Q2UA 5C4XJ 3ZMUA 5ICCA 2ETHA 2P0WA 3VB2A 3VYTB 4ESBA 4I0BA 2DA4A 2DA1A 3FHNA 3GO5A 3BWGA 3OV8A 4HAMA 3QRFF 3V6KA 2BQUA 4NLGA 5BMVF 2JPCA 3TOAA 3LWFA 2VLAA 3KHHA 2EV6A 4RM2A 4IVNA 4IOAF 1AWCA 3FBIB 5K5QA 2X6WA 3WE2A 2UZKA 3HOUJ 3T5KA 2JA5G 3FKIA 1ZG1A 3RB0A 3J80Z 3W6JB 2ZDGA 4UB6C 1J59A 3D5LA 3TQTA 3J7AO 1QGPA 3W2AA 1ZG5A 2FU4A 1ZR2A 1R4MB 3E6MA 4ABZA 4BAYA 2XHKA 5KFNA 3PZPA 1PP8F 2DJIA 3LSJA 1ODDA 4Q5SF 2UXBH 2OBPA 1AU7A 3ML6A 5D5XB 3N05A 3DV8A 3PR5B 1Z67A 4Q8EA 2W25A 4A5MA 2W24A 1FMVA 3K5IA 4LFBH 3J80K 2BHYA 3CC4I 1IRZA 3FWEA 5DYMA 2W7PA 1OYYA 2D2WA 1Y14B 3ETHA 4DL5A 2GPSA 1TTYA 5LMNH 2RDJA 2VASA 1V5EA 2MH2A 5KT3A 4ZYDA 3CDLA 4BACA 1GGOA 3V6HA 3QPSA 1TC3C 2J5PA 4A3CJ 3PFIA 4IAJA 4KFCA 1SD6A 2B9SA 3TQ1A 3M7GA 3KEQA 4G9YA 3WGIA 2BW3B 4UUSB 4ZOLF 5KFSA 1XGSA 3NARA 3OYNA 2LKXA 3O8HA 4HSRA 2RVCA 5H6RA 3ORRA 2ZXHA 3RSNA 2XAFA 5C4JJ 2QF7A 3LSRA 1TQPA 2X0LA 5C5JA 1I7LA 2CYYA 2V6EA 2YSRA 2CFOA 5C44J 3QP5A 1D0ZA 2KDOA 4BHBA 1Z05A 5KT6A 2HTJA 1J09A 1D0XA 5KG4A 3ROUA 3EQLF 1A9XA 1SFKA 3BTCA 3LSGA 5IYBJ 2QVOA 2M7AA 1FT9A 1A36A 2W4SA 2XPUA 1EUCB 4AU7A 3VSKA 1YW7A 2P6SA 2P8TA 3TO7A 1RNLA 1ZQ3P 4TQSA 2DPIA 3J7YJ 3CCLI
chains in the Genus database with same CATH topology
4HX8A 1T6SA 2CWEA 1L0OC 2WYOA 4B3RH 1FX7A 4PDBA 3R0JA 4IF4A 2CGPA 4DR4H 5FLXW 3N41B 3FHZA 3WU1B 3KALA 3GFIA 1T98A 2JTVA 1K78B 4KMUX 3RF2A 4NXMH 3B02A 2E5LH 3K2ZA 4G8XA 1O3QA 3HXLA 4DV4H 5TRDA 4R79A 2NRAC 1DGSA 3H3ZA 5BS6A 3IL2A 2BBYA 2XRNA 2EFNA 1I6XA 4OMYA 4JK1X 2VQEH 1FLIA 1PDNC 1RI7A 1IXSB 3DXJF 1NHAA 3ZMDA 3H3UA 2RN7A 2L4MA 4EM0B 3L4KA 1P4AA 3ABUA 1R1UA 2KJCA 4NB5A 5CVUA 1KU7A 1J5YA 3BPXA 1ON1A 4OIOF 1ZRDA 1S03G 2YCHA 1F4KA 2R7DA 2EFWA 4MV7A 4A0XA 2R7FA 5LBQA 1G3YA 3O2PE 1R36A 1RUNA 3TO9A 5F6FA 1KYZA 3WTUC 3RTXA 3LQQA 1IRFA 1FWZA 2RV8A 2C6YA 1ZHSA 4YHHH 4AWXB 2XKOA 1CF7B 2DAOA 3TOBA 1XDNA 3BDDA 1IBKH 3F3XA 1ZRCA 3M4IA 5LRRA 3L09A 4HF0A 3BPVA 3HHGA 5DCMB 3V7CA 2VC0A 3C0FB 2KJBA 4JI3H 4IJAA 4ENJA 3HHHA 4B8XA 1IBLH 1G3WA 4MNUA 2YPRA 4UUVA 1TQIA 3Q9VA 4CZZA 3JAMZ 3OOPA 2L02A 5EOYA 1XB4A 3HOTA 2DBBA 3EYYA 3NEUA 3SFZA 4UVBA 2DT5A 4PZJA 2VQFH 1B1BA 4HDVA 2K4BA 1SD7A 1YLFA 3RYRA 3IWZA 3NRVA 2DW4A 2HGSA 3CDHA 5J8CA 4WK8F 1O7LA 5D8LB 3R61A 3DPTA 5IT3A 2XIGA 2M1BA 2DU9A 3U1DA 2GIVA 1KU3A 3ZMZA 5D5WB 4UV8A 3CUQA 2Y48A 3L9FA 4M73A 1P8LA 2E1NA 4YFKF 5FLXK 4OIRF 1R22A 3JTHA 1FVIA 1YO5C 1G6NA 2MLKA 1V4RA 3I54A 4LH6A 4L0ZB 4LJZF 4IPAA 3RIRA 3KP3A 3KCCA 2TDXA 1XSDA 1D3YA 5E20A 4G7HF 4YIFA 3G3ZA 1E4GT 3HRMA 1U78A 2IP2A 5FPOA 2OU2A 3BJ6A 5E8GA 5KVRA 3BROA 1YW8A 5HDGA 3UQ8A 1MGTA 4DUZH 3HSEA 4U7BA 1R58A 1Z2PX 3LA2A 2VE9A 3ZMSA 1LNWA 2RKHA 2PEXA 4UCTA 2PMUA 2P5VA 3L4JA 1HW2A 4FX0A 1D8JA 1S68A 2ZKZA 5JFRA 3RJPA 4HV6A 3RKWA 2K86A 2V9VA 1I5ZA 3BABA 2VBZA 4UCSA 4HV5A 4DR1H 4ETSA 2F2EA 3GZ5A 5JHUA 3P9KA 1I1GA 2UXXA 3ULQB 1XMKA 1G4DA 4KIGA 1O75A 3BJAA 3KLOA 1Z6RA 3IHUA 2FNPA 2O8XA 2HDCA 2LNBA 1B9MA 2F5CA 3E5QA 3KZZA 2CQKA 3QAHA 1R00A 4PGHA 2MD5A 4GLXA 3CJNA 1ZH5A 4UNOA 1X9NA 4EGYA 1HQCA 4IRGA 2P5LC 2CFXA 2ELHA 2GAUA 5F1RA 2HFHA 2COMA 5CYVA 4LLGF 3LFKA 5E1XA 4LF9H 2D45A 3R0AA 2VODA 1BIBA 5BOXA 5IT9K 3JSPA 4LSAA 1Z9CA 2UUBH 5L3CA 3PQKA 1I94H 1S7OA 1ZGAA 3JTGA 1BBYA 4MQVA 3GZ6A 4KN7X 2HQRA 2HWVA 4LF5H 3FMQA 5ED4A 2G9WA 3IKVA 4P96A 1L3LA 1AN7A 2MCTA 1DPRA 3MZHA 5FD6A 1IN8A 1R5GA 2HYGD 4ENMA 1XMQH 3KP4A 4B09A 4I0AA 5L3BA 3COAC 2OQGA 4A2AA 4OOIA 5JI6A 3BP8A 2ZMEB 2CW7A 1ZGJA 4JI1H 2K7LA 1AOYA 5HS9A 3HSFA 2OZUA 3MWMA 4KICA 2KIUA 4KDPA 2HS5A 2EWNA 2VC1A 1OKRA 4K0KH 2GXGA 3I5UA 6PAXA 4WWCA 5ICEA 4JI8H 3ISPA 3ECHA 1EH8A 2MA3A 4L9VA 2XKPA 3HSRA 2HHHH 3CUOA 3R6SA 5D4RA 2RGRA 2DFIA 3KP5A 2EJRA 4LF8H 1HW5A 3TGNA 2EK5A 2FEZA 3RKXA 1MDMB 1B9NA 4H0EA 3F22A 1XDSA 1TLHB 4M6YA 1J0RA 4FM9A 3L2PA 1QNTA 2RGVA 4LD5A 5D6EA 1H9GA 2FA5A 4MTEA 2A6HF 2UWMA 2K27A 1SD5A 4CC5A 4I02A 2JSCA 4KYWA 2EFOA 4ESJA 1KGSA 3GFLA 2IW5A 2E7WA 4BNCA 3NQOA 4KT5C 5D1PA 4LG0B 3DEUA 1YS7A 3K0LA 2O0YA 3ZQ7A 5LRSA 1J2XA 2V6CA 2IA0A 3PN1A 2HGCA 3QPTA 3T1HH 4R1HA 3V7SA 3QPHA 2IPQX 2P6TA 4A2BA 1GYFA 1BOAA 1E17A 2HVSA 4JQFA 5FD5A 3T8TA 5DDGA 1SMYF 2VOPA 4BH9A 2KIMA 3JSOA 1S3JA 2DK5A 4RB1A 2XAGA 2OD5A 5L3FA 4OIQF 3WGGA 5HDKA 3EETA 1IF1A 2VPSA 4EMSA 2H27A 2ISZA 2VOBA 2IA2A 4EVIA 3K69A 4JI5H 3K1MA 1U2WA 1GHCA 3GX4X 1O3SA 3GLXA 5D5UB 4S04A 3JAMW 1SD4A 1KQ9A 3WTVC 3RYPA 1ZYRF 3CLOA 5ILUA 1SEIA 3JW4A 2A07F 2J5OA 3F21A 1EH7A 1IBMH 1LB2A 3L7WA 1RUOA 2STWA 2G7UA 4ENNA 3H20A 3C7JA 1KYWA 3CO6C 3P9CA 5DD4A 1UB9A 3Q9SA 4M6XA 4DV6H 4L5IA 4EFBA 4FT8A 4RGSA 2QQBA 4K2EA 1HNWH 4CO8A 1IZ1A 4KN4X 3GVAA 4MTDA 1VS0A 1TQMA 2O6GE 3GEZA 1BI0A 3LSTA 4YFXF 1SFXA 3HRTA 5E17F 1BI1A 1TAEA 1BN5A 1UFMA 3I64A 1YIOA 3V8KA 4EFEA 1F5TA 2CW8A 2F5EA 1CGPA 4HQMA 3KETA 1SYXB 3S2WA 1FYLA 4LMYA 5BR8H 4WCGA 3TQNA 2GXBA 1HNZH 3M9AA 4M71A 2OWOA 1WSUA 2ZCWA 1BM9A 2Q2EA 1H9TA 2YR2A 3KFWX 3F72A 2EV0A 4ZH4F 2CG4A 5BMZA 2HR3A 1R23A 3I71A 3FMRA 3JSNA 5EEHA 5FFXA 5JVTA 4EV0A 4R7RA 4LF4H 4RAZA 1N36H 4JI4H 4P9FA 4LB5A 4X65H 3RIZA 1IXCA 2H94A 1XMOH 3VEPA 1W7PA 2WTEA 5CJ9A 5K5OA 2V79A 1YQAA 2WC2A 2FBHA 4AIKA 4LH7A 3F8CA 2NNYA 1USSA 5HVQC 1PP7U 1B59A 1T39A 3FMAA 2MBFA 2MLGA 2MC3A 3C3WA 4EJWA 1R7JA 1XN7A 2LKPA 3TDUC 1IW7F 2W85A 4P55A 5LHIA 4FX4A 4DR5H 1U3EM 4O5VA 3BZ6A 3HUGA 2LF7A 3WTYC 2MH9A 4UXNA 2L54A 4WF2A 3ZN1A 2PMHA 2VONA 3M1EA 5DV5A 5LL6b 3DPLC 1KU9A 3L00A 4BHPA 2DK8A 2QQAA 2WE6A 1FJGH 3K1NA 2H6BA 3FZVA 5HS7A 1JGSA 1B04A 3JAMK 4I01A 3BA9A 2M8EA 2W57A 3GUDA 3V7RA 2UXNA 4DV0H 1MJBA 3DP7A 3DFGA 5D4SA 4YG2F 4TV7A 3WTXC 4CC6A 3HYIA 5LHHA 1GXQA 2W84A 2XV4S 4MGRA 3WE3A 3KE2A 4BXUA 4Q4ZF 4U88A 5IWAH 5E1ZB 1HKSA 1FP1D 1HSTA 2HKXA 5D1OA 3U9GA 1ZN2A 4HZFA 5DUKA 3K1PA 5HOOA 1G3TA 2DTRA 3WTWC 3F23A 1REPC 2ZBKA 1ZARA 5ILSA 4U0WA 5E1WA 2EFPA 1IN7A 2HVRA 1VTNC 1Q1HA 4YIIA 4ZZLA 4MEXF 1H0MA 2QENA 2E1CA 1IRGA 3F8NA 2FQ3A 3M8FA 4HQEA 4G7ZF 2P4WA 4I09A 3GWZA 1R5HA 4XLPF 4OINF 2IA1A 4XSZF 1IAWA 1XNQH 4M9ZA 1HR0H 2FRHA 1YTYA 1J75A 1ZHFA 1FY7A 2FNAA 3EUHA 1P4XA 5CVVA 3WODF 3ZMTA 4A6DA 3DF7A 1K79A 3IRRA 3MQ0A 3HIFA 2RQPA 3IC7A 3T0YA 1N32H 4AVPA 2GA2A 1JE8A 4UV9A 4KIBA 2YX4A 1XSVA 4LF7H 2M45A 4RGXA 1W5TA 1A0IA 2A61A 4CDGA 4ON0A 2VE8A 4UVCA 1XCBA 1HKQA 3PQJA 5DUIA 4AD9A 4LFUA 4MHGA 3V8JA 3RGXA 1FOKA 3IG0A 2XAHA 4DV5H 3BA8A 4AIJA 4X66H 3U2RA 4G6QA 2CO5A 5J6XA 2DPUA 3C1DA 4IXAA 2HEOA 2A68F 4JYAH 1ZAOA 1OYIA 1OPCA 4R8HA 3HTSB 1ZREA 5FPRA 4IHTA 1FPQA 4U7DA 1TW3A 2JPBA 4BWSC 1OR7A 3HOSA 5AONA 1K6OA 3TDZC 3N4MA 3QP6A 4N9IA 3FXRA 2GZWA 4IRIA 4AQYH 3E6BA 4JV5H 2VUGA 2L4AA 2IT0A 1DDNA 2M30A 2FSWA 3M8EA 2KRFA 3RI4A 2A3SA 1Y0UA 1HXDA 3GXOA 1R1VA 2XUBA 3E6CC 5ILVA 4RB0A 3KLNA 1WI9A 5EEGA 4WXDA 2L3DA 3IKTA 5TJJA 4HOBA 1S7AA 1T38A 4CHUA 1XGOA 2ZNYA 4ZYHA 2WWYA 2DO7A 3N97A 4LSXA 4JI7H 4QWQA 4A2UA 1MD0A 2VBXA 4DR2H 1J7KA 3FF5A 3QU3A 2ESHA 4GXOA 5HLHA 4DR7H 5D1OB 3JSLA 3J7AK 3CUQB 4JI0H 3N42B 2ISYA 2H09A 3H92A 1HNXH 3B73A 4U0VA 3KAJA 2UUAH 2UXDH 3I53A 4NQWA 4XSXF 1P4WA 2Z33A 3WG9A 4N9HA 3EDPA 4OIPF 1QQIA 4X62H 2V1XA 1UHMA 1ONVA 4YFNF 3KZYA 1I6UA 2WDTA 2DQLA 1EH6A 4KUMA 3F6VA 1IN6A 4HDUA 2O61A 4UCVA 2FBKA 1F1ZA 1KA8A 4UHTA 3VOEA 1TNSA 3TO6A 4AIHA 4D0PA 3FM3A 4ENKA 2K4JA 2GWRA 1L2ZA 2CW0F 1WWXA 3I58A 2BYVE 4EJOA 4RB2C 1D8KA 1GXPA 4EEQA 5D8KB 4L18B 4OU0A 1ZLJA 3WU0A 4MEYF 2R3SA 1QZZA 1FYKA 4G7OF 5LEKA 4RS8A 3BJOA 4PDKA 1FNNA 4L9JA 2Z9OA 1XGMA 1YG2A 4DQ2A 2O3FA 5K5RA 1GVJA 1P2FA 1S29A 1UCRA 1P92A