4RB3C

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
molecule keywords DNA (25-MER)
total genus 37
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb3C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb3C02
2QQAA 4RGUA 1YS6A 5D6FA 5D5UB 1KQ8A 2P7VB 2M30A 4I01A 3ZMUA 5LHHA 2FEZA 1EH6A 4KMFA 2G7UA 3LA3A 1IRFA 2ESHA 4LMYA 1U5TB 3FM3A 2P8TA 4U7BA 2A6HF 2VT3A 4EJTA 3SFZA 1B1BA 3EYIA 2XAFA 4P5OA 2ZMEA 3RDIA 1KA8A 4MQ9F 2DO7A 3WG9A 1V3FA 1FT9A 4WF2A 5CVVA 4EM0B 1BI3A 2L4AA 1A04A 4EM2A 2KJCA 2FMLA 3LAPA 5LRRA 2H6CA 4U0VA 1W7PA 3EETA 3I71A 3O6BB 3RKYA 4IHSA 1RIOH 1HKSA 1R23A 4KIFA 1BI0A 3I58A 3LQQA 4FT8A 1ZAOA 1XGSA 5LGTA 1OYIA 2W84A 5H6QA 2CGPA 1Z1DA 3S2WA 1PDNC 2VBXA 3E6MA 3HOSA 4FHTA 1KQ9A 4EMSA 4E70A 4N9IA 1HKTA 2HFHA 1TQMA 2VT2A 1BI1A 2RN7A 4IJAA 5K5OA 4GYIA 3TOAA 2PQ8A 3KZZA 1ZG5A 2XIGA 2A68F 4EJUA 3OOPA 5LHIA 4ZYHA 3ZMSA 5LBQA 3KP3A 1IN6A 3T8TA 4OMYA 4HAMA 3O2PE 4I09A 1TQPA 1PUEE 5D5XB 1CF7B 3TDUC 4OU0A 1XMKA 1O3RA 2L02A 2OBPA 4O5VA 5FD6A 1Z6TA 1T38A 1UHWA 1S8NA 3CTAA 2HEOA 1XDUA 2QBYB 2CFXA 3QOPA 1GVJA 2XHKA 1P4XA 2OZUA 4KIGA 2GXBA 3Q9VA 2LDUA 3KEQA 1KU7A 4B8XA 3VB2A 4GXOA 1NHAA 4L0ZB 2KRFA 3TQNA 1IXSB 3IC7A 4ZZLA 4UNOA 3WTUC 1P6RA 2XROA 2IT0A 4BHBA 1BN5A 1TW2A 1SD4A 2AS5F 3MEXA 2A3SA 2STTA 4ZZDA 4A12A 1E2XA 3KP4A 2E7WA 3BJ6A 4MEXF 2FBHA 3V7SA 3ZN0A 3DF8A 4IF4A 1BBYA 4S04A 3EDPA 1F5TA 4ZH4F 3GWZA 2Y0MA 1DDNA 2M5WA 4CO8A 1HSJA 1GXQA 1J2XA 1G4DA 3FXRA 1AOYA 5CVUA 4NHJA 5L3EA 5TJJA 5HDGA 5LHGA 5HOOA 2GWRA 5DYMA 1FY7A 2OQGA 2JT1A 2TDXA 4YFXF 1XCBA 4WK8F 3I54A 4N0BA 3E5UA 3RTRA 1J0RA 1QBJA 3C7JA 1SAXA 4KN7X 5H20A 3GFIA 2HDCA 5TRDA 2VBZA 3ZPLA 1R5HA 2P5KA 5L3DA 2EFNA 4I7HA 5DUKA 4EGZA 1SD7A 2DU9A 4Y13A 4TV7A 4Z2YA 2GZWA 3BDDA 3AAFA 1BC7C 4KT5C 1IN7A 4A0XA 1G3YA 1UFMA 1FSEA 5HLIA 3DXJF 3EYYA 2KKOA 4BNCA 2OQRA 3WE3A 3GFJA 1IXCA 3DPLC 3NRVA 4IXAA 2IA0A 2EJRA 5HDNA 4LB6B 4KYWA 1B6AA 4EJVA 3ZMZA 2KIFA 2O8XA 3V8JA 1XSVA 3PFIA 4M6YA 1P4WA 2ZBKA 2W85A 1U6GA 1W5TA 2HQNA 1O7LA 1MJ9A 1RUOA 1B9NA 1RNLA 1USTA 1YW7A 1W4MA 2MH9A 3WODF 1TTYA 3RPUA 2DLLA 2IVMA 3LAJA 5JFRA 3ZMTA 4BQAA 1GXPA 2PLYA 2F5EA 3ABTA 2EFQA 4XSXF 3VODA 1W5SA 2JPBA 4HDUA 3E3VA 4A2UA 4CICA 1FYMA 3F23A 3GFLA 3BP8A 2ELHA 1XCVA 3B73A 3MAJA 2VBWA 3FM5A 4MNUA 2QWWA 4EGYA 1BI2A 4GO1A 2IP2A 2M45A 1IUYA 5BPDA 2D2WA 5ILVA 1H0MA 3QPHA 1HKQA 4AD9A 5E8IA 1YLFA 1KGSA 1IZ1A 5E1XA 2FMYA 4A5NA 4HF2A 5A2QZ 1RUNA 1MD0A 1HW1A 2NAZA 2VN2A 4HYEA 2BE5F 2EFPA 3F8FA 4CYDA 3GZ5A 2H27A 1O3TA 1ZN2A 4EQQA 4CXFA 1S3JA 1QZYA 1T2KA 4P96A 2FBIA 5CVJA 3U2RA 5E1ZB 3TKYA 3I4PA 3IL2A 3JSPA 1LB2A 2XAHA 2LKPA 2JSCA 5LEKA 4UV8A 3F8BA 3T1BA 2BGCA 3M1EA 1T98A 2X4HA 5LGNA 2PJPA 3FWEA 3GXOA 3N97A 1XDSA 3HRUA 2ZCWA 4U0WA 1G3WA 4KDPA 1RI7A 2HKXA 1JGSA 1HW5A 5LEJA 4YFKF 3F6OA 3P9CA 1LDKB 2ZFWA 1QO0D 3IRRA 1STZA 1L0OC 5L3FA 2IJLA 2HYGD 4IHTA 2HS5A 3T0YA 2YSRA 3CUQB 2VOPA 4RB3C 3F22A 3RKWA 2OAZA 4MHGA 5E8GA 5K5QA 4LB5A 5F1RA 4PGHA 1KYZA 2ZO4A 2ZNYA 1R1UA 3SZTA 2XAGA 1JHHA 2CWEA 2DPDA 2XVCA 2E1NA 1YYVA 1MDMA 2P5VA 1ZLKA 1DUXC 1U78A 2GXGA 3MQ0A 2OZ6A 4G8XA 3WTSC 1SD5A 1XSXA 3R0AA 1MKMA 3QRFF 5ICCA 2HYFA 1JE8A 1ZRFA 3ZMDA 4FX4A 4M9SA 3ML6A 3LA2A 4M73A 1U5TA 2Q2EA 1QPMA 2DW4A 2ZXJA 1BOAA 3ECOA 2NYXA 1R36A 4BH9A 1IAWA 3HHHA 1J5YA 4LJZF 3RPQA 2WC2A 4CZZA 2GQQA 4IRGA 3I59A 2IPQX 4O3MA 4M6XA 4IRHA 2NNNA 3W6KB 4L0YB 1P4AA 2C6YA 2LF8A 1AWCA 1QNTA 2UWMA 1FYKA 2VC0A 1YIOA 1Z6RA 3P9KA 2IA1A 4AIKA 3R4KA 2K4JA 1TNTA 1BJAA 3ISPA 3SXYA 3F8CA 4L9VA 1R5GA 3ZQ7A 2D1HA 2QYOA 2VXZA 5ILUA 2GAUA 4ZYGA 2K27A 4FX0A 1SFEA 5FLXK 3QP6A 4HW0A 2XKPA 3HIFA 4AWXB 2Z33A 4WWCA 2CW0F 4ZYEA 2O03A 4KMUX 5BMZA 2H09A 2FRHA 4L5JA 3KLOA 4M74A 5LRSA 1G3TA 1MZBA 1R00A 3I53A 4QLCU 2FSWA 5BS6A 2VC1A 3KETA 4AIHA 2W57A 2FXAA 3QU3A 4EVIA 1WWXA 1ONVA 3L00A 5E17F 4DNCA 3CO6C 3WGIA 1U8RA 5D5WB 3EQLF 3KEOA 1QZZA 4LLGF 1JHFA 3BJAA 1MJAA 4IPAA 4B09A 2ETHA 1QGPA 1Z7UA 5JHUA 1EH7A 3V4GA 2V1UA 3L9FA 1FBSA 4YIFA 2HTJA 4GGGA 3CUQA 2BYVE 3COAC 3FHZA 3FZVA 3P9IA 1UHMA 4ON0A 2M8EA 2PFBA 1E17A 4OIRF 2R3SA 4M9ZA 1BIBA 2DT5A 4WCGA 4HX8A 1LNWA 4CGZA 4RGSA 3HSRA 4A5MA 2F5CA 1R22A 2OU2A 3GX4X 4HV5A 1ULYA 5D4RA 1W7PD 4YIIA 1KU3A 3BJOA 4BHCA 1EV7A 2F5FA 2B0LA 3HUGA 1K7AA 1ZRCA 5IT9K 5F64A 3TO6A 1XGOA 1W7PB 3TOBA 2MLKA 1IN5A 4L9JA 1BM9A 1D8KA 2COMA 4XSZF 2A5YB 1ZG3A 3KZYA 1P2FA 2M1BA 2P4WA 5JI6A 4S05A 5BPIA 3KP6A 1DPUA 4U7DA 2P5LC 5L3CA 3SZPA 3V7CA 5H6RA 3GEZA 1YQAA 1UB9A 4MEYF 1CGPA 5K1YA 4CDGA 5BOXA 2QQBA 1LEAA 4MQVA 2L4MA 2DPUA 1ZARA 2IA2A 1FP1D 3DV8A 2CO5A 4L5IA 3K2ZA 4RB1A 1O3SA 2UXNA 1S29A 4L9TA 2W24A 4JK1X 3ULQB 5ICFA 1XD7A 3F21A 3TGNA 4PCQA 2BEOA 2QQ9A 2F5DA 3QP5A 4R79A 3RI4A 2Z5UA 1IW7F 4UHTA 4EV0A 2CG4A 3MZHA 2RVCA 4F7ZA 4QWQA 2EWNA 2XAJA 3NQOA 1H9TA 2EFWA 1H9GA 2J5OA 3K9TA 4KUMA 3DFGA 4L18B 3HRMA 4LLLA 2QLZA 3NEUA 3L2CA 4EJOA 1TBXA 2F2EA 2MH2A 2PEXA 2G7HA 4BHPA 2NNYA 2FNPA 3H92A 2R7DA 2A61A 2FE3A 3H3UA 2PMUA 1LDJA 3M7GA 2L54A 1XSDA 4OIPF 1KYWA 3K1PA 3WU0A 1YFHA 2JRTA 2K86A 2QUFA 3GFMA 4PZJA 4OIOF 1WI9A 3F6VA 4RGXA 1WSUA 5KVRA 4KICA 1G3SA 2EV0A 5CVIA 2ISYA 3GZ6A 3I64A 2FOKA 1T6SA 1SMTA 1I27A 3L09A 3DKWA 2VE9A 3HTUA 3ZMVA 5FLXZ 1EH8A 3DQVC 4ZYDA 1QQIA 1HW2A 3ZN1A 2KJBA 4P9UA 2UXXA 2GA2A 4HZFA 2DTRA 4OIQF 3RKXA 1OYYA 2HZTA 2QZ8A 4A0YA 4WXDA 1Q1HA 4OINF 2OA4A 4LK1F 2V1XA 4Q47A 2DAOA 2K4BA 4UVCA 6PAXA 4LLNA 4MTEA 3R6SA 3WTZA 1ZH5A 3V7RA 3C1DA 1ZHFA 4HDVA 1F1ZA 5FD5A 4G7HF 1DP7P 3MFKA 3IKVA 2XGXA 2JTVA 1FOKA 4HV6A 4HLYA 2DFIA 5A2QK 3DEUA 3IWFA 2V9VA 1T39A 5J8CA 5FB2A 4ENJA 2GA1A 4HF0A 3WTWC 1DPRA 2M87A 4Y15A 1K78A 2DQLA 2HKOA 3WE2A 4UUVA 4G7OF 2YU3A 3G3ZA 2OD5A 2RNJA 1F4KA 2YX4A 4A6EA 2QM3A 5FGMA 4ENMA 2H6BA 1YW8A 1D8JA 1ZREA 3CLOA 5ICEA 2BV6A 1O7FA 4EJWA 2UZKA 3RJPA 5FFXA 1U2WA 4UVBA 2CSOA 2RGVA 5E18F 3J81K 1HXDA 3ROUA 2EFOA 3FXUA 2JPCA 3C3WA 3JAMZ 1Z9CA 4RGRA 3I5UA 3GF2A 2J5PA 4XBFA 2PG4A 2LSOA 2O6GE 2FQ3A 3O3KA 3TO9A 4ESFA 3HRSA 1YG2A 2O0YA 1J59A 3PQKA 5KK1A 1FC3A 3LA7A 3K0LA 1TQIA 4YFNF 2IRFG 4GYGA 2FA5A 1O57A 2EV6A 5CYVA 3CUOA 3HTSB 2RDPA 2V1DA 4ESBA 2L01A 1WRJA 3D5LA 3N4MA 2WV0A 1YO5C 1OYWA 1S6LA 1G6NA 2JZYA 5LLQA 2VBYA 1SFUA 4LG0A 5HS7A 1RZ4A 2VOOA 1HQCA 2V6CA 1ZG1A 3RYPA 4Q5SF 3IRQA 5L3GA 1FBUA 2Z99A 2W25A 4M9XA 4RB0A 3FMSA 1K6OA 3DPTA 3LFKA 4HBLA 5CVRA 5J8FA 1XMAA 2Q8KA 2VONA 5DCMA 1J7KA 4ENKA 1LVAA 4XRFA 4MGRA 3LQRA 1R1TA 5DD8A 1HSTA 3E97A 1IF1A 2Z9OA 4BYYA 3I59B 2YX7A 3MWMA 5DDGA 3Q5FA 3WTYC 4RB2C 3E6BA 2V79A 5L3BA 3HSEA 1FSHA 2DBBA 4ESJA 5E1WA 3D0SA 1Z91A 1XGMA 3M8FA 5AONA 1ON1A 3BOQA 1S7AA 1VTNC 4U88A 3IWZA 3F8MA 2Y48A 3REOA 3KE2A 4M72A 4OOIA 1OR7A 4LFUA 4HQMA 1FBQA 1LQ1A 4K2EA 1J75A 3ABUA 1B9MA 3IHUA 1WKMA 1FZPB 2ZKZA 3T8RA 5CLSA 1OPCA 3M8EA 2XUBA 1V4RA 1L3LA 1TNSA 4G9YA 2MBFA 5D8LB 1FYLA 3BPXA 2A6EF 2DK8A 1Z05A 1ZGJA 3J80K 1ZYRF 1R1VA 3RYRA 2RC4A 5FFZA 1I1SA 1MDMB 5CJ9A 2A07F 5D4SA 3GLXA 4UXNA 2ADUA 4AVPA 4ETSA 3TO7A 3RIRA 2HWVA 5EEGA 3E5XA 1B4AA 4P9FA 2PN6A 3CJNA 3E5QA 5DD4A 2Y75A 3G73A 3QPTA 1ON2A 3KCCA 1ZLJA 3J7AO 3Q9SA 3MZYA 3ZP5A 4LD5A 4WX9A 1R58A 2FF4A 5ERIA 3QAHA 1GHCA 1TW3A 4WXHA 4YG2F 4Y17A 1IRGA 2O3FA 5EEHA 4A6DA 3WGHA 3CDHA 1B59A 4HOBA 2HR3A 3JSOA 1XGNA 3FMQA 4U0YA 2L3DA 2P6SA 4AIJA 1YTYA 4LG0B 2KIMA 2HOEA 3WTTC 4R8HA 1BIAA 3U1DA 5HDKA 1S7OA 5HS9A 1K79A 4KFCA 1WQ2A 2IW5A 2EK5A 3ECHA 3IKTA 3HOTA 3M9AA 2EV5A 1J9IA 4M71A 3EUHA 3WGGA 5HS8A 2RV8A 4JQFA 3C18A 4LGWA 3FX3A 2NRAC 5JR3A 5FO5A 1ODDA 1CF7A 2O61A 2RQPA 3WTVC 4DQ2A 2D45A 2MLGA 5BQTA 4BAYA 2K02A 3E6CC 3I0TA 3PQJA 1SD6A 2HGCA 1ZRDA 3R61A 5AIQA 5ED4A 5D5VB 3TDZC 1LDDA 1C0WA 2QVOA 2H94A 2FBKA 1REPC 2NS0A 2WWYA 1FWZA 3FF5A 2ZJ2A 3F72A 2HQRA 4RAZA 4H0EA 2DI3A 3HSFA 2RKHA 3BPVA 3JTGA 1I5ZA 3K1MA 3JAMK 3BY6A 2EB7A 3QU6A 3CUQC 4P55A 3LSTA 3HYIA 3VFZA 1ZGAA 4RS8A 4A0ZA 2FNAA 2EA4A 3LWFA 5DEQA 4HQEA 2G9WA 5D6EA 3L7WA 1YW9A 5HVQC 1R7JA 1FX7A 1FLIA 5IT9Z 1FPQA 1U3EM 3WU1B 2K7LA 3WTXC 5F6FA 2CQKA 3B02A 2LF7A 1LJ9A 4WXCA 1Y0UA 4HX7A 2P6TA 1LEBA 1PP7U 5HLGA 2YR2A 3MCZA 2ACJA 3VOEA 2MC3A 4O6JA 5IT3A 2PI0A 4XLNF 3E6DA 1IN8A 4UV9A 5J6XA 5LGUA 5DV5A 1YS7A 2XASA 4I0AA 4KNYA 5E20A 3H3ZA 2FU4A 3ELKA 4HF1A 2DQRA 2KIUA 4NB5A 3ERED 1D3YA 3CO7C 2Q0OA 1KU9A 3SQNA 4HA8A 4NQWA 2D1VA 1BC8C 4IVNA 2XAQA 4HLXA 3T5XA 3OV8A 1XB4A 2PBIA 1P92A 5AIPA 3FXQA 3W6JB 3BZ6A 3SHFA 4I02A 3U9GA 5HLHA 3HRTA 2Z3YA 5DCMB 1JXSA 4BXUA 1UCRA 5ILSA 2GIVA 4ENNA 4GCVA 2XRNA 1MGTA 5DUIA 3R0JA 2X0LA 4UVAA 3V8LA 4CHUA 2AXLA 2ZNZA 5D8KB 2PMHA 2YPRA 4N9HA 3K1NA 3K69A 4I0BA 3F3XA 4MTDA 4I98B 1USSA 2STWA 3F8NA 1KU2A 3KP7A 4KA4A 3GVAA 1I6XA 3KP2A 2P7CB 3V8KA 2CYYA 2VE8A 4RAYA 1OMIA 2XKOA 2ZMEB 3GUDA 1SMYF 1PP8F 3GO5A 4L9NA 4JBAA 4KN4X 1F9NA 1U5TC 3HHGA 2XV4S 1KQ0A 4Q48A 4KIBA 3KP5A 1OKRA 3VEPA 1SFXA 1MJBA 1FNNA 3JW4A 3BROA 3JTHA 3R60A 2HTSA 2MA3A 2LNBA 4G7ZF 1FP2A 4LK0F 4PGGA 3KLNA 2EA2A 5DCFA 2QBYA 4G6QA 4G94A 4Q4ZF 3J80Z 2DK5A 2A69F 5JVTA 3KFWX 1D5VA 2R7FA 4XLPF 1IXRC 2ISZA 4HX4A 3GYHX 1TLHB 2E7XA 4OMZA 1HBXG 3FMRA 4R1HA 1XN7A 1O3QA 1X3UA 2MD5A 5ICGA 2E1CA 1K78B 4D0PA 3BWGA 1I1GA 5K5RA 4IRIA 4PDKA 4EM1A 1IN4A 3DP7A 2ESNA 4ASNA 1T0FA 2QENA 3P7NA 4I2OA 4G6DA 3J81Z 3GW2A 2VODA 2BBYA 2WTEA
chains in the Genus database with same CATH superfamily
2QQAA 4MFEA 2JJ7A 4RGUA 1YS6A 1RR7A 2HZDA 5D6FA 5D5UB 2VLAA 2P7VB 2M30A 5IP9J 1KQ8A 5FLXW 2BVMA 3CQZA 4GDFA 4MFDA 4I01A 1B04A 5GAHJ 3G1OA 3H35A 3ZMUA 5LHHA 2R8IA 2C28A 2FEZA 3N05A 1DQUA 4AM3A 4PWQA 1EH6A 4EBEA 4KMFA 2G7UA 3LA3A 1QHHD 3F9KA 5FLVA 1IRFA 2UVVA 4DL6A 2BY2A 1OCOH 2ESHA 2LKXA 2M2EA 5EWGA 4LMYA 2VUMJ 3I4NJ 2X6OA 2IGOA 3L1PA 2XD4A 1U5TB 3FM3A 2MG4A 1JT0A 1TC3C 2PX9A 2P8TA 2JK3A 4U7BA 2CMPA 2Q2EB 2A6HF 1A9XA 3PJRA 2AO9A 2VT3A 4EJTA 1MNDA 3HB9A 2RREA 1LUJB 1B1BA 3SFZA 2X6YA 4RLQA 2OCEA 3EYIA 5IYDJ 2XAFA 4P5OA 4A3BJ 2XPUA 3CP2A 2ZMEA 2RDJA 3CCJI 1JUSA 3RDIA 1BNCA 5K7FA 1KA8A 2MYSA 3LSJA 3SI8A 4MQ9F 2DO7A 3WG9A 3BTJA 1V3FA 1FT9A 1QA6A 4HRIA 1PX2A 4WF2A 5CVVA 4EBDA 1GSHA 5J47A 2Y9YA 1WGXA 2YZGA 4CCMA 4EM0B 1BI3A 3SEZA 3BR0A 1EKEA 2L4AA 1A04A 1VF9A 4LOCA 4EM2A 1VQMI 1S68A 3NGDA 2KJCA 2FMLA 4XLEA 3LAPA 3ZQIA 4JUZA 5KFKA 5LRRA 1P7JA 2L9RA 2H6CA 4U0VA 4BACA 1W7PA 3EETA 3I71A 3DEEA 3O6BB 3RKYA 3MWDA 2BXZA 3ORRA 4IHSA 3ZCOA 1RIOH 2ZM6H 5DS9A 4DV6H 1XMQH 1HKSA 2X51A 3H0GG 4BWSC 2BY0A 1YJWI 3ASNH 4JP0A 1R23A 1UJ8A 1VQOI 4KIFA 1BI0A 2CUEA 2DA1A 3I58A 2R92G 3LQQA 4FT8A 2E2HA 1V5GA 3LSGA 2Y0SN 1ZAOA 3CCRI 1YIJI 1XGSA 5LGTA 2NS8A 1OYIA 2QF7A 2W84A 5H6QA 2CGPA 3CMYA 4AYBN 3BLYA 1Z1DA 3OYGA 3T5JA 1DU0A 1GYFA 2VOBA 1SEIA 4LFBH 2E35A 3S2WA 1Z0XA 1PDNC 2VBXA 3E6MA 5LXTF 3HOSA 4FHTA 1O75A 1KQ9A 5KG3A 1KONA 4EMSA 4E70A 2GXAA 4N9IA 1HKTA 3TQ1A 5LL6b 4UCOA 2HFHA 1TQMA 2VT2A 2LY9A 3CDLA 1S03G 5KG2A 5KFEA 1BI1A 5EZYF 2RN7A 2M8GX 2UVUA 3QFFA 2L7KA 4IJAA 5K5OA 4I4TF 4GYIA 3TOAA 2PQ8A 3KZZA 3HXLA 2XIGA 2R5YA 2A68F 4EJUA 3OOPA 1ZG5A 5LHIA 1HNZH 1IDYA 2CRGA 4DBQA 4ZYHA 4QWEA 3ZMSA 2PVPA 5LBQA 3KP3A 2XB5A 3S16J 2QKMB 2HNHA 3NAUA 2E5ZA 4E7KA 4F52A 2ME6A 3TMOA 4F93B 3W2AA 1IN6A 3IH2A 1U0JA 3T8TA 4OMYA 1VQ9I 5EOYA 3OYAA 2W6OA 4HAMA 1OCCH 1TWAJ 3O2PE 4ECSA 1NK3P 4I76A 5IYZF 4I09A 2IRFG 2VQEH 1TQPA 5EG0A 4RAFA 4YR2A 4APMA 1PUEE 1V4YA 5D5XB 1CF7B 3KX2A 1X2NA 2R7LA 3TDUC 3Q8PB 1WFXA 4OU0A 1RYSA 1XMKA 1O3RA 2L02A 2OBPA 5D1PA 4O5VA 5FD6A 3CJTB 3MKYB 2IS1A 3QYEA 3TW7A 1MW7A 1Z6TA 4BJ5C 2R7RA 1T38A 2DPIA 3HL2A 4ANJA 4BXFA 1UHWA 2MC4A 1T36A 1S8NA 5GP9A 3FISA 1J09A 3CTAA 3DEWA 1Y1VG 3KAKA 2HEOA 2BHYA 3PL8A 2CV0A 1XDUA 2QBYB 1ITYA 2CFXA 3QOPA 1JDEA 1GVJA 2XHKA 1P4XA 2OZUA 2BXYA 1S5LC 4KIGA 3ZQLA 2F5VA 1Y1WJ 4LG3A 2W9CB 2J6SA 2GXBA 1V51A 2CUZA 3Q9VA 3L2WA 1RYRA 2LDUA 1Z2OX 4LF5H 3KEQA 1KU7A 1UC8A 4B8XA 2R7SA 3VB2A 2W7PA 2AHQA 3FKJA 4GXOA 1NHAA 4L0ZB 2R4GA 1EHIA 2KRFA 3TQNA 2YS7A 1IXSB 3IC7A 3P5JA 4ZZLA 4UNOA 3WTUC 1P6RA 3QYBA 2XROA 4XIDA 2CQXA 2IT0A 5KFOA 2XRLA 3ZQFA 4BHBA 1BN5A 1APLC 2GLOA 2R5ZB 3H0DA 1IOVA 1TW2A 4QSHA 3MD2A 1SD4A 2JMWA 2AS5F 4J9KA 4M3FA 3MEXA 3HKZE 2A3SA 4A3IJ 2STTA 3I9V2 3SEQA 1ZK8A 4AC0A 4ZZDA 2PMZA 4A12A 4BQQA 1SVMA 2VUGA 5LMNH 3HG9A 1E2XA 1SFOJ 3CD6I 3K4BA 1HR0H 3KP4A 5EJCA 1XMXA 2E7WA 3BJ6A 2W9CA 3PSFA 4DL5A 4MEXF 2FBHA 3V7SA 3ZN0A 3DF8A 2OF7A 4IF4A 1BBYA 2LOOA 2WAQN 3RKQA 4S04A 3EDPA 1MSFC 4B48A 5EGOB 1F5TA 4ZH4F 3RGZA 3GWZA 1IGNA 4A69C 2XGEA 4JYKA 2Y0MA 1I3QA 2HVQA 2C2RA 2R8HA 3K4JA 1DDNA 4DV7H 1Z77A 3ZGKA 3JRBA 2ASLA 3QOEA 2M5WA 1ETKA 4CO8A 1HSJA 2UV1A 3BQ1A 1GXQA 1J2XA 1G4DA 3FXRA 1AOYA 2Y0SE 5KFWA 2K9QA 2F4IA 2P0AA 4W1UA 4DUYH 2WBMA 5CVUA 3OYFA 5KFSA 3K10A 1VKZA 2JSPA 1N77A 4NHJA 1K83A 4F4WA 5L3EA 4B3MH 5KT5A 2EZIA 4MAMA 1WZ2A 4F4ZA 1KJ8A 1S0MA 5TJJA 3H20A 5BNGA 5HDGA 2VQGA 1MBEA 5LHGA 5HOOA 2GWRA 3JRCA 5DYMA 3U9TA 4S0HB 4IR9A 3V42A 1VQPI 1FY7A 5KG5A 3PSIA 2OQGA 3UKGA 1QU3A 5DG9A 2ZDQA 2JT1A 2TDXA 4CYCA 1YHQI 1KC7A 4YFXF 1XCBA 4C3HJ 5KT2A 2VUMA 5EGOA 4WK8F 2VI6A 3I54A 4IOCF 4N0BA 3BABA 5J1UA 4BU2A 3MR5A 3E5UA 1MBJA 4CSWA 2YZNA 1LFUP 3RTRA 1N75A 1EF4A 1NK2P 1J0RA 4ZDPA 1QBJA 3GMEA 5L1IA 3OIPA 2HGSA 3C7JA 3SJMA 3G1LA 1CQIB 4UCUA 1SAXA 2R8KA 1MNEA 2YS9A 2CV1A 3D5RC 4KN7X 4RA2A 5H20A 3GFIA 3K5HA 2HDCA 2KL4A 2IEKA 5LFAA 5TRDA 4EEYA 2VBZA 1RJRA 1TWGA 3ZPLA 3IG0A 2HI3A 1LE8A 3K4LA 1S0NA 2ZMEC 3FK6A 1R5HA 2P5KA 4BBRJ 4RLFA 5L3DA 4DL7A 1BOBA 2EFNA 3GV7B 2C00A 2AGQA 5T14A 2QK4A 4DZPA 4I7HA 5DUKA 2WAFA 1BR4A 1SD7A 2DU9A 4Y13A 4TV7A 4Z2YA 4EGZA 2GZWA 2ZJTA 1KBLA 1VQNI 3GIMA 3BDDA 3CF5F 4PSXA 3AAFA 1BC7C 4E4HA 3GZNB 2AGOA 4KT5C 1IN7A 2XSJC 4A0XA 2JA7A 3B6AA 1MMGA 3LWBA 1G3YA 2P0WA 1RRJA 3BZCA 5EDNA 2DYSH 1UFMA 1IV6A 1FSEA 5HLIA 1PJRA 2ZDGA 2DOEA 3DXJF 2VKEA 2X48A 1WH7A 2DMQA 2KKOA 2QQ8A 3EYYA 4UCTA 3M9NB 4XKVA 1R9TA 1W0UA 3PIPF 4BNCA 3PUBA 2OQRA 3WE3A 3GFJA 1IXCA 3DPLC 3NRVA 3IH3A 2IA0A 2EJRA 4IXAA 5HDNA 4LB6B 3KHGA 4KYWA 4DYCA 1B6AA 2CQYA 2HVSA 4EJVA 3DTKA 2DOFA 3ZMZA 2KIFA 4EEFG 5H2FC 3CJRB 2O8XA 3V8JA 2W9BA 3DU5A 1XSVA 5BPHA 3JRGA 2V4QA 5B5EC 3PFIA 4M6YA 4HR7A 1WJBA 1P4WA 1B8IB 2ZBKA 2W85A 3UQ8A 1U6GA 3S1RJ 2DA5A 3VYRB 3L2VA 2DMTA 4JOMA 3I4NG 3ZOBA 4LF8H 3EUHC 3Q8RB 1W5TA 4A3JJ 3OTOH 1ETYA 2HQNA 2EINH 1O7LA 3K6GA 4XONA 1MJ9A 1RUOA 1B9NA 1RNLA 1USTA 2FLPA 2X6WA 2JA5A 4J01A 1DIKA 3FBIB 1GUUA 3QWLA 3VWBA 4ABZA 1A31A 1H8AC 1YW7A 3MJFA 2WB1E 1W4MA 2H8RA 3TIIA 2MH9A 4NC7A 3WODF 1TTYA 2QSFX 5CKTA 4D7NA 3RPUA 4G12A 2DLLA 4LH6A 4NXMH 2IVMA 3LAJA 1HLVA 3JSLA 2W6MA 2XGCA 5JLXA 5JFRA 2MW8A 5FPOA 4AYBE 4II2A 3SZGA 3ZMTA 4JV0A 4BQAA 1GXPA 2PLYA 2F5EA 2E1OA 1H89C 3RB0A 3ABTA 3OHAA 2EFQA 3WO1A 3DTEA 5C4XJ 4FS2A 3PM1A 4XSXF 3VODA 4ZJZA 1E4EA 3DLAA 5K2MA 3PO3G 5F08A 3MFHA 4DV2H 3F0CA 4XLHA 1W5SA 2JPBA 2Y31A 2ME0A 4HDUA 4DR1H 3AG3H 3E3VA 4A2UA 3AG2H 4CICA 2DT7B 3OYCA 4DR6H 2CFOA 2RAEA 1EZ1A 1FYMA 3F23A 1JKRC 3KHHA 1ZR2A 2JA8G 5KNLA 3GFLA 3QPSA 3BP8A 1A0IA 2ELHA 1XCVA 3B73A 4JV5H 1X1DA 2VUMG 4XX0B 2IA6A 3MAJA 2VBWA 3DU6A 4ZTJA 5M5XJ 1T3NA 4V2GA 3FM5A 5LA6F 2F4OB 1RK5A 1WVRA 1I6UA 2R93G 3S15J 2E2IA 2JRMA 2KIQA 4MNUA 4O3SA 2M4KA 4KISA 2QWWA 4EGYA 5DQHA 1BI2A 4GO1A 3JR9A 2IP2A 3GTJA 3KAJA 3RFCA 2M45A 1UG2A 1U8BA 1IUYA 2Z1DA 4BE1A 2ASDA 3I56I 4YR0A 4U6PA 4RU9A 4IO9F 5BPDA 4TQRA 4MLOA 2D2WA 3KEYA 5ILVA 1YI2I 2KP6A 1H0MA 2IS4A 5J1RA 1UC9A 4L1KA 3QPHA 3S2DJ 3RZOJ 3CF2A 1I50J 1HKQA 4ECWA 4AD9A 5E8IA 5D1OB 5K7HA 4NC6A 1ENHA 3GTQA 1YLFA 1KGSA 3JRWA 5KFTA 2V9WA 1IZ1A 1YRNA 2JEIA 5E1XA 2CUFA 2XC7A 3FKIA 2VASA 1RR8C 4LF7H 3GTKJ 5KFFA 2FMYA 2OTJI 3BG3A 4A5NA 4HF2A 5A2QZ 1DV1A 2VPQA 1RUNA 1MD0A 1HW1A 2NAZA 1SYXB 2VN2A 2UXDH 4HYEA 2BE5F 2EFPA 3PR5B 2B63A 2RQQA 3F8FA 1MBHA 4CYDA 3GZ5A 4RUCA 2H27A 2FK1A 1FJLA 3GTPJ 3S8PA 1Y1VA 1WI3A 3HOWG 2DMNA 1O3TA 4CA0A 1TWFA 1QPIA 1ZN2A 5DM7F 3TIGA 1FMWA 4EQQA 4CXFA 5KFDA 3V6HA 4NDLA 3ZQCA 1S3JA 1QZYA 1M1EB 1T2KA 4YJ3F 4Q45A 1X3WB 3M8JA 4P96A 2FBIA 5FKKA 5CVJA 2EZHA 3U2RA 5E1ZB 3TKYA 5F27A 4BJ6C 3I4PA 4J0MA 3IL2A 3G6VA 4BBSG 1S10A 3JSPA 1LB2A 2XAHA 2W6PA 2LKPA 2Q1ZB 2JSCA 2OLSA 5LEKA 4UV8A 2ALZA 2K5CA 1S72I 3F8BA 3G1MA 4XMYA 3T1BA 2VJ5A 4CUGA 1L2ZA 2BGCA 3BG7A 4C3JJ 3KIOA 5JH7F 2UVWA 2OUMA 3W3CA 2HYJA 2ZDHA 3M1EA 1T98A 4XL9A 2X4HA 4NBQA 1D0YA 3HOXJ 3GTPA 1IJWC 4A3FJ 3Q0VA 2JA7J 2YCHA 1T94A 3IAS2 5LGNA 2BW3A 1NG6A 1SVLA 2PJPA 3FWEA 3HOYG 2FB9A 3GXOA 3N97A 2L9NA 3RF2A 1XDSA 3O8HA 5IYCG 3VPBA 3HRUA 5EWFA 2ZCWA 1JUPA 4U0WA 2GPSA 4EFEA 1G3WA 4KDPA 1RI7A 2HKXA 2JVGA 3GTGJ 2HOAA 1JGSA 4JX4A 1I50A 3FBNB 1BXRA 1HW5A 1KJIA 1R49A 3IH4A 4V19K 3PO3J 3VPDA 2RNGA 1ZHSA 5LEJA 1WPKA 1E4FT 4YFKF 5KG0A 3F6OA 3P9CA 4ME6A 5KCMA 3PIOF 4J9SA 5KFHA 5KFJA 3PN1A 1LDKB 4X64H 2ZFWA 5EZGA 1QO0D 3IRRA 1YJ9I 3VPCA 4CCOA 5CA1F 5K7ZA 4ZQIA 1HDDC 1CQJB 4Q8FA 2UXBH 1STZA 4Y8VB 1L0OC 5L3FA 4U7CA 2IJLA 2HYGD 4IHTA 2DJIA 2HS5A 3T0YA 2R85A 2YSRA 4MV4A 3TEDA 3PW5A 3CUQB 2LTPA 2VOPA 2JN6A 1O4XA 4RB3C 3F22A 3RKWA 3FXOA 4AIDA 4DBRA 4F91B 2OAZA 2HHHH 1Z7LA 2J9GA 1ZHQA 1CS0A 2BVLA 4MHGA 2R7OA 1IOWA 2ZJRF 5E8GA 3FK7A 5K5QA 2D5VA 1CE8A 4ED6A 2XF6A 3RSNA 4LB5A 4IWXA 3AKZA 3CCQI 2CQ7A 5F1RA 2FLLA 2KDOA 4PGHA 1F36A 1KYZA 1UZCA 1BGWA 4J9OA 2ZO4A 2ZNYA 1R1UA 5HODA 1T95A 3SZTA 2XAGA 1JHHA 3ZRGA 1T33A 2CWEA 2DPDA 2XVCA 4CCJA 2DODA 2VKDA 4DZJA 3I55I 4BY7J 1PUFA 2E1NA 1UELB 5LD2C 1YYVA 4RBOA 3S1MJ 5D8DA 5KG1A 4JI6H 1MDMA 2P5VA 1ZLKA 1DUXC 2XPVA 2L9SA 5F0CA 2NU6B 1U78A 2GXGA 3MQ0A 2OZ6A 4G8XA 3WTSC 3V6KA 2ECBA 1SD5A 1P9QC 1XSXA 3R0AA 2HOSA 4EYHB 1WR2A 4B3RH 2JA7G 1K6YA 3OR2C 1MKMA 3OYEA 3QRFF 4A2AA 4XK4A 5ICCA 2JUCA 2HYFA 2L7FP 1JE8A 5LP6F 4GKKH 1MMDA 3K4CA 2V1NA 1ZRFA 3O8GA 2ELKA 1E3PA 4IHWA 1HF0A 2EPFA 1Z3YA 5FKNA 3ZMDA 4A93J 4FX4A 4M9SA 2J6UA 3BG5A 1V5EA 3ML6A 1VBHA 3LA2A 3M9MB 4ECTA 4IWYA 1T56A 4M73A 1U5TA 4KJZA 2M0MA 2HDWA 3DKYA 3PW2A 3J7AY 2Q2EA 2L7MP 4F3QA 5KFZA 4ECXA 3FDYA 1QPMA 3ZQHA 2DW4A 2ZXJA 4OAYA 3G8CA 4TV8F 1BOAA 3ECOA 2NYXA 3OIQA 3BQ2A 1R36A 1RKTA 3H4DA 5F1JA 4JI8H 2YL2A 5DG8A 4BH9A 2OJED 2JA5G 1IAWA 5HLTA 3U1KA 5JVDF 4YAJB 2WV1A 3HHHA 1J5YA 3K4KA 4LJZF 3RPQA 2KLOA 3GTOJ 2JWTA 2V9KA 2WC2A 2BR0A 4BBRG 5DQIA 3A4CA 4XLFA 2ZJPF 2R7XA 5KFNA 2Q2UA 1Q1VA 4EG0A 2JEFA 3L2RA 1UMQA 3J7AK 5JVLA 4CZZA 2GQQA 4IRGA 1OCTC 3I59A 1IBKH 4DGWB 1S9HA 1MMAA 2IPQX 1JTXA 2E5NA 5B66C 4O3MA 3A2KA 4JI4H 4M6XA 4IRHA 2NNNA 3W6KB 2NOGA 4L0YB 1P4AA 1B8IA 2C6YA 2LF8A 2MSYA 1AWCA 1QNTA 2R82A 2UWMA 3OYMA 1FYKA 2VC0A 1YIOA 2M7AA 1VQ6I 1Z6RA 2OC6A 1IV8A 1Y0NA 4FE7A 3P9KA 5FJ8G 2W48A 3I12A 3HC7A 4XOTA 3BR3A 2IA1A 5IYDG 4HYKA 1R4MB 2C2EA 1NTCA 4AIKA 4EEQA 4FCYA 3R4KA 4YP3A 2BY1A 4HNTA 2K4JA 1X2MA 1TNTA 1BJAA 3ISPA 3CC4I 3SXYA 2L7ZA 3F8CA 2DPJA 1YX5A 4PFPA 4L9VA 3VYSB 1R5GA 5KFYA 2EQRA 3AFHA 4MV8A 3ZQ7A 2D1HA 1X1CA 2QYOA 2VXZA 5ILUA 1Y8QB 2GAUA 4M3BA 4ZYGA 2K27A 3RAXA 4FX0A 3AYHB 1SFEA 5FLXK 1IUFA 3QP6A 3RUPA 3NARA 4HW0A 2XKPA 3G4SI 3RGXA 3HIFA 4AWXB 2Z33A 4HNUA 1RPWA 1TWGJ 2FPIB 3OYKA 1SVOA 4WWCA 2CW0F 2EIKH 1DGSA 4ZYEA 2O03A 4X65H 4KMUX 5BMZA 2H09A 2HQ5A 5FROA 3VPRA 4Q43A 3CCEI 1P7IA 3OMYA 3LMLA 2LBFB 2FRHA 5C4JJ 4L5JA 3KLOA 4HG2A 5FLMJ 3LSPA 3IP4B 2AQ4A 2ZFUA 1W0TA 4M74A 1W36D 5LRSA 1G3TA 4E7JA 4IHYA 3H9QA 1MZBA 1R00A 3S3NA 2PN1A 3I53A 4IQ4A 1A36A 4YHHH 4NUBA 4J9RA 5E79C 4QLCU 1IBLH 1OCRH 2FSWA 5C1PA 3GIQA 4XORA 3PW7A 5BS6A 3Q0WA 2VC1A 3KETA 4AIHA 2W57A 2FKLA 3SE7A 1Z21A 2FXAA 3QU3A 5CQGA 2I8DA 2KFDA 4EVIA 4UY8I 4NXNH 1WWXA 2DOAA 1ONVA 3L00A 4V2FA 3H5AA 5E17F 4EGJA 5BR8H 2E1MC 4DNCA 3PR4A 3PO2G 1X4OA 3CO6C 2M7BA 3WGIA 4UUSA 3S17J 1F43A 1U8RA 2V5AA 3GILA 5LOVF 5D5WB 1FOXA 2N8GA 2KZGA 3EUAA 1VZ0A 3EQLF 3KEOA 4LIUA 4MO7A 1GSOA 1QZZA 4LLGF 3CCMI 3BA8A 1JHFA 4RMNA 3RQIA 4E7ZA 4LF6H 4O3QA 5DGBA 3BJAA 2BZTA 1MJAA 4NQWB 4QIWA 3GTOA 4BDZA 1I3QJ 2ASJA 4IPAA 3QPLA 4B09A 2ETHA 1Y14B 2VA3A 2W70A 2IS6A 4XKWA 1QGPA 1Z7UA 2DYRH 1ETVA 5JHUA 3AL0B 1Y56A 2G0EA 3HOVJ 1EH7A 4F4XA 4D7MA 2V4JC 2X1EA 3V4GA 3OS0A 2KDZA 2V1UA 4BQNA 3MFIA 2CUJA 3L9FA 1X19A 2M9HA 4XICA 1FBSA 4PUSA 2QSHX 4YIFA 4BBSJ 2HTJA 4RM2A 3JRDA 3K2AA 4QWDA 2F6CA 2LKSA 3V4SA 4GGGA 3CUQA 2BYVE 1TL8A 3COAC 3FHZA 3FZVA 5FJ8J 4TUYF 4HNVA 2Y9ZA 3P9IA 2R7ZG 1UHMA 2AQEA 2NUAB 4ON0A 4MV1A 2M8EA 4YR3A 2PFBA 1E17A 3OL3A 4DV4H 1BJTA 4O3RA 3OL4A 4OIRF 5CPRB 4UUTA 5C5JA 2R3SA 2R7MA 4F55A 4M9ZA 1BIBA 2DT5A 4WCGA 1VQ5I 4HX8A 2DA4A 3S32A 1LNWA 4CGZA 4XYLB 4RGSA 4M9UA 4PFOA 3HSRA 2IGMA 2F5CA 1R22A 2OU2A 3KYDB 4A5MA 4BS9A 3GX4X 3BT9A 1POGA 4BKXA 2FQ4A 2BQ3A 4HV5A 3EPIA 1ULYA 3RBDA 2EIJH 5D4RA 3BTCA 1W7PD 2ID3A 3GLLA 3M9OB 4YIIA 2W7NA 3G6XA 4EGQA 4FBTA 4ZTFA 3L4JA 1AUXA 1KU3A 4KHPH 3BJOA 1A5JA 4BHCA 1EV7A 5DQGA 2F5FA 2B0LA 3N43B 4M6VA 4ECRA 3HUGA 2VKHA 1K7AA 2FK3A 1D1CA 3KPHA 1ZRCA 2KSWA 3HOXG 1TT0A 2VPRA 4D1QA 5IT9K 4HSRA 1VQKI 4C2MJ 5F64A 3TO6A 1XGOA 2XGDA 3CC2I 1W7PB 3TOBA 1MNMC 1C30A 4XYMB 4YRVA 2LYCA 4O3OA 2MLKA 2C2DA 5FKOA 2TCTA 1JKPC 3TINA 4BQOA 3MMYB 1IN5A 3Q2OA 4L9JA 5KFLA 2C22A 1BM9A 2DMPA 4ED0A 1ETOA 5EYRA 3SYTA 1T8IA 1D8KA 1J5EH 3S93A 1SC7A 2VJ4A 4ECQA 2COMA 2NVQJ 1IRZA 4XSZF 2XSDC 2E2JJ 5KFIA 2VPSA 5IT9W 1RJPA 1YRNB 4GKJH 2YW2A 1JX4A 3K4NA 5H80A 3C0FB 2A5YB 4DW6A 4DV0H 3GIDA 1MH3A 3X2QH 3PO2J 5GAGJ 1ZG3A 2E60A 3RIZA 2R7KA 2PMZN 2R5ZA 5LYJF 1UG0A 3KZYA 2UUAH 1P2FA 2Y2ZA 3OUUA 5GTHC 2AU0A 1VFCA 1FVIA 1XX5A 2R7ZA 2IAIA 2M1BA 2RGRA 5C4XG 2P4WA 3ABKH 1ULZA 3ZQGA 5JI6A 3ABLH 4S05A 5BPIA 3H0GA 3RB3A 1N32H 3KP6A 1BJZA 2K3PA 1DPUA 1I6HJ 4U7DA 1TWHA 3BQ0A 2LR8A 4PSWA 2P5LC 2R7WA 1PUFB 2YRWA 5L3CA 2IS2A 3SZPA 5KG7A 3V7CA 4DOZA 3J7YJ 4J00A 4ED3A 3GEZA 5H6RA 3L4KA 3GV5B 2CU7A 1YQAA 2MD0A 3CC7I 4FASD 5KFXA 2E2HJ 1UB9A 1JKOC 4MEYF 1CGPA 3GTMJ 5K1YA 2FJ1A 4CDGA 2R8JA 3H5NA 2KMUA 4XRMA 5BOXA 2QQBA 1N36H 1LEAA 4MQVA 3E5NA 2L4MA 1D1AA 2DPUA 1SCUB 1ZARA 4XRSG 1S0OA 3CCUI 1HDPA 2IA2A 1FP1D 3DV8A 3BR2A 4A3IG 2CO5A 1MH4A 3K2ZA 2M3AA 4L5IA 4RB1A 1O3SA 4MV3A 2UXNA 1S29A 3I3LA 4L9TA 2W24A 4TQSA 1JJ6C 1XPXA 3DTIA 2R86A 5KT3A 4I99C 4JK1X 3ULQB 2X1DA 1YX3A 5ICFA 3PZPA 1XD7A 2IXSA 4IRDA 3F21A 2V26A 2R7TA 2ATLA 2BHZA 5IYCJ 2DT6A 3R5HA 3TGNA 3HEFA 2BEOA 4PCQA 2B63J 4ECVA 3M1CA 4LITA 3A02A 1BW5A 2QQ9A 2F5DA 3QP5A 3OSNA 4R79A 4A3FG 3RI4A 2Z5UA 4XR6A 1OLTA 2ZXHA 5TISC 1FTTA 1IW7F 4UHTA 1GO3E 4EV0A 1WJFA 2CG4A 2CW7A 3FKIJ 2RVCA 4F7ZA 1A6QA 3OYBA 4FISA 4QWQA 4BE0A 3MZHA 2EWNA 2XAJA 4A3LJ 1Y1WG 3NQOA 1H9TA 2EFWA 1H9GA 1RKWA 1X3ZB 1LE8B 1XNQH 1RC9A 2J5OA 4B43A 2DJNA 1CQTA 1IRXA 1S9FA 3K9TA 4KUMA 3DFGA 3DKXA 4L18B 3BC8A 1EA3A 3I4MG 3HRMA 5HNFA 4LLLA 3MWEA 2NU8B 2QLZA 4QW9A 3CZ6A 1VNDA 3IAM2 3JCUC 3NEUA 1TBXA 2F2EA 4EJOA 3L2CA 3N42B 5FLMG 2MH2A 2PEXA 4A3CG 1JKJB 1S7EA 2G7HA 4DYQA 4BHPA 2FJZA 2NNYA 2FNPA 3H92A 2R7DA 4BE2A 2A61A 3PUFA 4LH7A 2FE3A 3H3UA 2M34A 2PMUA 2BOLA 1LDJA 3M7GA 4A3CJ 2L54A 3H5RA 2WA0A 1XSDA 4OIPF 1ERDA 1KYWA 1T0FC 5IP7J 2Q2TA 3CQZJ 4YBZB 2KT0A 1TZLA 3NWTA 3K1PA 4C2UA 3WU0A 4LFAH 2LLKA 1YFHA 2JRTA 1WHUA 2K86A 2QUFA 3WU2C 2W9AA 3GFMA 4H4KC 1N34H 4PZJA 4OIOF 1WI9A 3F6VA 5KG4A 1NG7A 4E7HA 3R5XA 4RGXA 1WSUA 5KVRA 4KICA 1G3SA 2EV0A 5CVIA 2ISYA 3GZ6A 2XCAA 1WJDA 4GC6A 2W9BB 4DR4H 2L0KA 3I64A 5IYBG 4ECUA 4IHVA 2FOKA 1T6SA 3H36A 1Z2NX 2LD5A 2IMWP 1MMNA 2WAQA 1SMTA 2JEGA 3QYFA 1I27A 2BW3B 4EBCA 5B1BH 1XMOH 3L09A 5E3LA 3DKWA 2VE9A 2B63G 1AU7A 3HTUA 3LL7A 3ZMVA 5FLXZ 1EH8A 2M0CA 2E34A 3PW4A 3DQVC 1M6VA 3HOUG 4ZYDA 1QQIA 1HW2A 1B6RA 3DWLE 2NU9B 3ZN1A 3S3MA 2KJBA 2LY1A 2UXXA 4P9UA 3S3OA 2IGKA 2GA2A 3UNGC 4HZFA 1HNWH 2DTRA 3HGYA 4OIQF 2R93J 3RKXA 1TWHJ 1EUCB 3CCLI 1OYYA 2HZTA 2QZ8A 5M5YJ 2C35B 4ED7A 2Z2SB 4A0YA 4CH7A 4WXDA 3ONQA 2GPWA 1Q1HA 2W82A 4BEHB 1R4NB 2F48A 4OINF 3OYHA 2VQHA 1YJNI 2OA4A 3H3VK 3TQTA 3RB4A 3OUZA 4LF9H 4LK1F 2VJJA 2V1XA 4Q47A 1GGOA 1UNNC 3BCBA 3A0HC 1WJAA 2JA5J 4QPOA 2JA8J 4A3GJ 3EPGA 1QVUA 2DAOA 2FP4B 3BR1A 5FKLA 4QW8A 4FS1A 2K4BA 2L5QA 4UVCA 4ZDLA 6PAXA 4LLNA 4ZYAA 1WH2A 4MTEA 1JJ8C 1FIPA 3I4MJ 3R6SA 3WTZA 2R5YB 3V7RA 1AKHA 1ZH5A 3C1DA 1W93A 1ZHFA 4XNFA 4HDVA 2VQDA 4MV7A 1F1ZA 2BY3A 5FD5A 4G7HF 3FXMA 1YE9A 2WB1N 4IL6C 3ZXSA 3CVZA 1DP7P 4UB8C 2R93A 3MFKA 4CZCA 4U87A 1AN7A 3IKVA 2XGXA 2I80A 2JTVA 1FOKA 4M7EA 4HV6A 4HLYA 2VKVA 4AU7A 2DFIA 3K7AJ 2CQQA 5A2QK 3DEUA 3Q0UA 3IWFA 2V9VA 3ESWB 1T39A 1UAAA 1OFCX 3SDBA 5J8CA 1XS9A 4X62H 5FB2A 4RZQA 3CMMA 4C2MA 1Z2PX 5DGAA 4ENJA 2TRTA 2GA1A 4HF0A 4ED8A 1ZELA 1ETWA 2W00A 3WTWC 3S1NJ 2R92A 4BGDA 1M0WA 1DPRA 2M87A 2XPWA 4HEA2 4Y15A 1K78A 3HOYJ 4UCSA 2DQLA 5J2TF 2V9PA 5FPRA 2HKOA 1DGRM 3WE2A 4UUVA 1K1SA 4G7OF 2YU3A 3G3ZA 2OD5A 2RNJA 4QIWE 1F4KA 4ZHQF 3G2BA 2GOXB 1OJLA 2YX4A 4A3JG 3PVXA 4A6EA 3LSHA 2QM3A 3S2HJ 3BA9A 3GIPA 1XTAA 1X1AA 5FGMA 4D5CA 4ENMA 1FJGH 1YW8A 2H6BA 1D8JA 1ZREA 3CLOA 5ICEA 1EJ9A 3M3YJ 1R6RA 3Q1KA 2BV6A 3PFYA 2R87A 1O7FA 5LMUH 4M3EA 3L2QA 4IRCA 3CCSI 1EYZA 4EJWA 2XC9A 2UZKA 4X66H 3RJPA 3GBGA 5FFXA 1GLVA 4C5CA 3A03A 5KFRA 1U2WA 1VI0A 1FIAA 4UVBA 3FDSA 2CSOA 2RGVA 2COBA 5KKNB 5KFQA 4PJJA 5E18F 3H4BA 3J81K 3KHLA 2NVXJ 4M3GA 4RUAA 5GAEJ 4YAKB 1HXDA 1DV2A 2FPGB 4B44A 3ROUA 1BW6A 2EFOA 3FXUA 2E1MB 1N56A 2JPCA 3C3WA 3JAMZ 1Z9CA 2GLTA 1D0ZA 4RGRA 2KHMA 2GM4A 3JRXA 1VQ7I 3I5UA 3GF2A 2J5PA 4XBFA 3OSPA 2PG4A 3N44B 4L5EA 2NVXA 1OISA 3H9JA 2HU9A 1FKAH 3BQYA 2LSOA 2O6GE 2FQ3A 3E7LA 3KYCB 4PDBA 1WJEA 3O3KA 3TO9A 4ESFA 3HRSA 1YG2A 2O0YA 2DLNA 3K70C 1KJJA 3KHRA 1ZETA 4B3AA 4JI3H 1J59A 3PQKA 1VQ4I 2IGNA 5KK1A 4QJFA 5C44G 1FC3A 2GOMA 2EH3A 4J9LA 4DV5H 2EILH 4RNOA 5M3MJ 3LA7A 3K0LA 3CCVI 4E7LA 1MIJA 3AL0C 1RK6A 4BUPA 1AA7A 1TQIA 2WY7Q 3FIWA 4GYGA 2GIZA 2FA5A 4BEHA 4YFNF 1TP4A 2QCOA 1B33N 1O57A 2EV6A 3JRIA 1K1QA 5J40A 4BJTA 5CYVA 1GV5A 2W8KA 3CUOA 3WHCA 2P81A 2RDPA 2V1DA 5GPAA 4ESBA 2R0QC 3HTSB 1QVTA 2W6QA 2K40A 4O2BF 4YELA 4Q0YA 2L01A 4EFBA 2PJRB 2VQCA 2W6ZA 5GADJ 4AVZA 5KT6A 1WRJA 2CJJA 3D5LA 3N4MA 2OWOA 2WV0A 1YO5C 1OYWA 3FXJA 3LOCA 1S6LA 2ZC2A 4FU0A 3AG4H 2VIXA 3GCMA 3KTMA 4OAZA 1SAUA 1G6NA 2JZYA 2YS6A 5LLQA 3BR5A 2VBYA 9ANTA 3A01B 1M7JA 1SFUA 4LG0A 5HS7A 1RZ4A 5KAFC 1I7LA 4RAGA 2VOOA 3PW0A 5C3EG 1HQCA 2V6CA 3GTMA 1ZG1A 1ZKGA 4XKBA 3RYPA 4M3DA 3W6VA 2Y30A 1N33H 4Q5SF 1NH3A 3IRQA 4IHXA 5L3GA 4J9PA 1FBUA 2Z99A 3L2UA 1ORKA 2W25A 3MZ8A 4M9XA 1FOYA 1ACIA 4IRKA 4O4IF 1TAEA 1HA8A 4RB0A 2B9SA 3Q3SA 2YZMA 3UFXB 5FKMA 1IG7A 2HXOA 4CCLA 3FMSA 5EWEA 4JI1H 1K6OA 5BMVF 5J4YA 5DM6F 3DPTA 3LFKA 4CCNA 4HBLA 4A3MG 1UHSA 5CVRA 5F0HA 4PJ0C 2X1CA 2E36A 5J8FA 4FQGA 1V9PA 4O4HF 4DUZH 1XMAA 1IO2A 5JHFA 3HJEA 2Q8KA 4E7IA 2VONA 3OYLA 5DCMA 5CB4F 1J7KA 1V54H 4B47A 1JDBB 3A01A 2CZGA 5EEAA 4RNNA 4A3BG 4ENKA 4JI7H 1WJCA 1LVAA 2K9SA 4XRFA 4F92B 4N4OB 3MKZA 2HVRA 2K9NA 4MGRA 5TGTA 3LQRA 1R1TA 5DD8A 4FM9A 3MKLA 2VA2A 1HSTA 3E97A 2EIMH 3DBLB 3HPHA 4LIVA 5KFGA 5DLFA 1IF1A 4I50F 4BYYA 2Z9OA 3V6JA 2I8CA 2IBKA 1G2HA 3M07A 4MV6A 3I59B 3QZ8A 4DL3A 5HNHA 2YX7A 3MWMA 5DDGA 2MGQA 4G6TB 4HPQA 5C1OA 4X1EA 3ETHA 2NU7B 3ZR8X 5EG0B 4NC8A 4ZI7F 2HXIA 3LFUA 4X6AJ 3LMMA 2HQAA 3Q5FA 2SCUB 4IKFA 1RJQA 3WTYC 4RB2C 3C2BA 3E6BA 1A35A 2EBIA 2V79A 5L3BA 5KT7A 3K4MA 5L1JA 3HSEA 4PK4A 1FSHA 1OCPA 2DDAA 2DBBA 1JXLA 4ESJA 2QYZA 4K0KH 5E1WA 1BL0A 2ICWG 3D0SA 1Z91A 1XGMA 2DN0A 4R7RA 1I94H 3M8FA 4DV3H 5AONA 4Q8EA 3CP8A 1ON1A 2L2OA 4FE4A 3BOQA 1B72B 2QGUA 4IQJA 4LSAA 1S7AA 2QEXI 1VTNC 4U88A 3IWZA 2KISA 3BAAA 3DCFA 2OTLI 4TV9F 4JI5H 2LY2A 3F8MA 4RNMA 1ETQA 2Y48A 3REOA 4DR3H 3KE2A 4M72A 2H1LA 4OOIA 1N25A 3RZDJ 2OPTA 2K9LA 1S97A 1OR7A 4LFUA 1Y8RB 2FUG2 3LSMA 4HQMA 1FBQA 5DG7A 3RAQA 3RPUD 1LQ1A 1ZQ7A 2AGPA 4K2EA 1J75A 4IOAF 3ABUA 1B9MA 2JVHA 3IHUA 3TP0A 2FLNA 1SEUA 2FPPB 3HM5A 3RBEA 2GBYA 2KRCA 3BR6A 4ECZA 4ITVA 3TL4X 1TT5B 4YIRX 3MR2A 3G71I 1WKMA 3CJQB 4UCVA 1FZPB 2DA6A 3HKZN 1Y39A 2LBFA 2ZKZA 3T8RA 5CLSA 3OYIA 3RB6A 2XB0X 4A3EJ 2K85A 4PJMA 2JQ7A 1E0EA 2V4RA 1OPCA 3M8EA 2XUBA 3ZQQA 2JA6A 5F0FA 1V4RA 1E3OC 1GVDA 1L3LA 1XDNA 2PJRA 3JSNA 1TNSA 4G9YA 2MBFA 1AUVA 4GC7A 5D8LB 4FETA 1K83J 1FYLA 1I7NA 3H3VH 3BPXA 2R7UA 2A6EF 4J9QA 2LVSA 3BZKA 3UR3C 2DK8A 2QA4I 1Z05A 2DA7A 1GSAA 5GONF 4B3XA 3G6EI 1JUMA 1X1PA 1ZGJA 1ZYRF 3J80K 3HOUJ 4DYRA 5IWAH 1R1VA 4ZDOA 3RYRA 5IOYA 5IP9G 2RC4A 2VQFH 4WD3A 2XCLA 1XNRH 1GV2A 5KFPA 5FFZA 3KALA 1I1SA 5CJ9A 1MDMB 2A07F 4RM3A 4MV9A 2YRXA 5D4SA 4MA5A 3GLXA 4A3KG 4UXNA 2ADUA 4AVPA 3D5SC 4ETSA 3TO7A 2K3FA 1W1WE 3RIRA 2HWVA 5EEGA 2HPMA 3E5XA 4E7SA 3IN5A 1B4AA 3JRFA 5KT4A 5FRMA 4P9FA 1OR7C 2PN6A 3CJNA 3E5QA 3HKZA 4CC6A 3T1HH 4LSXA 5DD4A 2Y75A 3DBHB 3G73A 4IZOA 2VR1A 3QPTA 4R8UB 1ON2A 3KCCA 1ZLJA 3J7AO 3Q9SA 3RCOA 1IRGA 3MZYA 3VYUB 3ZP5A 3M4OJ 4E4TA 4QIWN 4LD5A 4WX9A 5F04A 3CMAI 3OHBA 2UVRA 1R58A 2MFZA 2FF4A 3J81W 3MN2A 3JREA 2W4SA 1EUDB 3HOZJ 3Q8QB 5ERIA 2HPIA 3QAHA 2JA6G 5JLWA 1GHCA 1TW3A 3H0GJ 3EPZA 2CW8A 4WXHA 4Y33A 2DXIA 2VJIA 4YG2F 4J9MA 4BY1G 5J4VA 2R7ZJ 2OH2A 4N4NB 4Y17A 2O3FA 3BTLA 1Z67A 5EEHA 4A6DA 1K4SA 4KITB 3WGHA 1A6IA 3CDHA 1B59A 1JI8A 4DIQA 3FMAA 2O7OA 1TA8A 4HOBA 2HR3A 3JSOA 4C5BA 1Z3XA 2DA3A 1K61A 4QPQA 1PYVA 1XGNA 2ZSIB 3FMQA 4DR2H 5EDWA 4U0YA 5DLGA 2L3DA 3GLKA 2NVTJ 2P6SA 3TBIA 4AIJA 4DL4A 4FBUA 1YTYA 2A05A 4XN3A 1B72A 4LG0B 4ZOLF 2KIMA 1JKQC 3T5LA 2UUCH 4YB8B 2HOEA 3WTTC 1PK8A 1IC8A 4R8HA 1BIAA 2I5UA 3U1DA 2XGQA 5HDKA 1S7OA 2YUSA 5M3FJ 3OR1C 5HS9A 1BR1A 2R84A 5KFCA 2DZDA 1K79A 1LPQA 4A3EG 2FD5A 3W2VA 3J7ZI 4KFCA 1VS0A 2HJWA 1WQ2A 1WSCA 4Y4RA 2IW5A 4XZ3B 5L1KA 3TP3A 1P8LA 3J80W 2EK5A 3ECHA 5IP6A 1YITI 1BR2A 3IKTA 3HOTA 3M9AA 4B4CA 5B3SH 4E6KG 1QHGA 2B7EA 2VPLA 2EV5A 1VBGA 1I39A 2W7OA 1J9IA 4M71A 3EUHA 3WGGA 2MABA 2RV8A 4JQFA 2KZVA 4PJLA 3C18A 4LGWA 5HS8A 3FX3A 1DU6A 3U9SA 4Q44A 2NRAC 2NVYA 4C3IJ 5JR3A 1HOMA 5FO5A 1ODDA 1CF7A 3GTLA 3DLLF 1G8XA 2I10A 2O61A 1HCRA 3VYTB 4XQFA 2X0SA 4FTHA 2RQPA 3PNTA 3ETJA 1MBGA 3WTVC 3WNZA 4GRIA 4DQ2A 2LP0A 1JLLB 3KXYT 2D45A 1U9OA 2MLGA 4C9YA 5BQTA 2DFFA 2NXNB 5EZHA 5E3NA 4CC5A 1OWTA 2E71A 4P1WA 1V55H 4BAYA 2K02A 4Y7NJ 3E6CC 2R7QA 3HPGA 3I0TA 4J9NA 3PQJA 1HC8A 1SD6A 3QZ7A 2LH9A 2RDIA 4UFZA 3LSIA 4JYAH 2M05A 2XGPA 2HDDA 4ECYA 2HGCA 4YEJA 1ZRDA 2JA6J 2XDVA 5IOZA 4XLAA 3HOVG 3R61A 5AIQA 3BG6A 5ED4A 5D5VB 2E19A 3TDZC 4GFBA 4QWCA 1LDDA 2JUGA 1C0WA 3N8DA 2A6TA 2L9VA 3A1YA 3H40A 5IPAA 4XOPA 2QVOA 2AXTC 4MA0A 2H94A 2FBKA 2V59A 4CYCB 3FXKA 1REPC 3K3PA 2NS0A 2WWYA 1FWZA 3R23A 3FF5A 2X9DA 5F9LA 2F4VH 3E1SA 3HBLA 4B3SH 4O3NA 2ZJ2A 5KFAA 3ASOH 2UU9H 3F72A 4KT6A 3E0JB 2ZSHB 2HQRA 4RAZA 2WAEA 4H0EA 4BL0B 3R5FA 2XCPA 3GQCA 4A3KJ 2DI3A 3HSFA 3EUKL 1FTZA 4DR5H 4A2BA 4WBNF 2UUBH 4LF4H 1WJ5A 2V7FA 5CA0F 1SFKA 2RKHA 2EZLA 5I47A 3BPVA 4XLCA 3MR6A 5GPCA 3JTGA 1I5ZA 2LK2A 3K1MA 3OIOA 2BQRA 4UB6C 3K5IA 3JAMK 3T1YH 4XRSA 3BY6A 4A3MJ 1QRYA 3K70D 2EB7A 3N40P 3QU6A 1HNXH 4IX7A 4I6ZA 2ZJQF 3CUQC 4IEJA 1E4EB 3QODA 2IP4A 1C3OA 4P55A 3BQZA 3LSTA 4IZZA 2PBZA 3HYIA 1D1BA 3VFZA 3OYJA 2R92J 5CAEB 2DCEA 1GLNA 1ZGWA 1ZGAA 4RS8A 3OYNA 5JQWA 5KFMA 4A0ZA 2FNAA 4A3GG 2EA4A 1FEXA 3LWFA 3VSKA 2DFEA 1B6SA 4O4LF 1ETXA 4X0GA 5DEQA 4HQEA 2DDBA 4Z6YA 4CCKA 2G9WA 3BCAA 5D6EA 3L7WA 1YW9A 5HVQC 1LVKA 1R7JA 1W5CC 1FX7A 2KPMA 2ZXIA 1KJQA 5BPFA 4OX9H 1BA5A 1FLIA 4BDYA 2EZKA 1D5YA 4B1RA 5IT9Z 1FPQA 2Y0SA 1Y6IA 1U3EM 3WU1B 2R7VA 2WE6A 4JI0H 2K7LA 2X6XA 3D1NI 2DA2A 3WTXC 5F6FA 5KHDA 4A3LG 3SFIA 2YU9J 4AQYH 3K3VA 2CQKA 4IR1A 3B02A 5B1AH 1ZR4A 3WO0A 2LF7A 4AYBA 5KFUA 4YJ2F 1LJ9A 5M5WJ 3DF7A 2AQFA 2NOJB 2W1OA 3GIIA 2R6FA 2LREA 4A3DJ 4WXCA 1X58A 1KZHA 3WHBA 1Y0UA 4HX7A 2P6TA 2H8WA 1LEBA 4JV2A 1N48A 1JT6A 1PP7U 2Z16A 5HLGA 1W96A 3TW6A 2YR2A 2DIKA 3FXLA 3MCZA 5IYBJ 5E3OA 2ACJA 2WADA 5C44J 2YYAA 3VOEA 4IAJA 5F9NA 2MC3A 2WYOA 4XM3A 4O6JA 1MSEC 5GTIC 5IT3A 2PI0A 4XLNF 3E6DA 1IN8A 4UV9A 3MVPA 5J6XA 4W97A 5EF6A 3OYDA 3CMEI 2LRDA 4DV1H 5LGUA 5HBRB 2DTZA 4O2AF 2J6TA 2NS7A 1IBMH 5DV5A 1YS7A 2XASA 1W36C 2WTFA 4I0AA 2LG4A 1KEEA 1MBFA 3GIKA 4F50A 2NVUB 4KNYA 5E20A 1AHDP 1JIHA 3H3ZA 2E5LH 3T5KA 2FU4A 3ELKA 4HF1A 3NWSA 4JI2H 5HV6A 1LFPA 2OV7A 2DQRA 2KIUA 3HGGA 2Y69H 4NB5A 3ERED 5FRNA 1D3YA 3IUOA 1TWCA 5KFBA 3N6XA 2W8LA 3CO7C 2Q0OA 1KU9A 3SQNA 4HA8A 2DMUA 1TWFJ 4NQWA 2D1VA 1OCZH 1BC8C 1GDTA 3RTXA 2ECCA 2FMAA 3OY9A 2V58A 4IVNA 2XAQA 4HLXA 2DFHA 2DWCA 3LP8A 3ABMH 3HZJA 3VMMA 2UXCH 5JUMA 3WG7H 3T5XA 1G59A 3OV8A 1XB4A 2PBIA 3C2HA 4D9JA 2QKLB 3N41B 2KQRA 2WAQE 1P92A 4OWRB 2LMDA 5AIPA 5J2UF 2HOTA 1WCMA 3FXQA 3LNQA 2KRHA 4RZRA 5IY5H 3GTKA 3W6JB 3BZ6A 2XAUA 2VQLA 3QQAA 4I02A 3SDGA 3SHFA 1FOWA 3U9GA 3VDXA 4AUXA 3HRTA 5HLHA 1KJ9A 2Z3YA 5DCMB 1JXSA 4QWAA 2IBDA 3GTQJ 2O5RA 4BXUA 1SANA 1UCRA 4RDUA 5ILSA 2YU9A 4C2TA 3U21A 2GIVA 4ENNA 1MMSA 1D0XA 3H9GA 4GCVA 4QWBA 5JVGF 3MR3A 4B3TH 2XRNA 5C8YF 1MGTA 3CLQA 5DUIA 1M0TA 4BY7G 3R0JA 2R7NA 2ZB9A 5C3EJ 5D1OA 5J3LA 1R5ID 3GTJJ 3OSGA 2X0LA 4HQ6A 3OS1A 2RF4A 3OWTA 3HDDA 4UVAA 4R8UA 2FOWA 3V8LA 2E2IJ 1VAJA 4CHUA 3LSRA 4DL2A 2AXLA 1I3AA 2ZNZA 3CESA 3FHNA 1DP3A 2VXDA 3IV5A 1WCMG 3GV8B 4JX6A 3PNVA 1R71A 4II3A 3KZIC 5D8KB 1RETA 3CCYA 2O8KA 2PMZE 2PMHA 2YPRA 3M4IA 4LFCH 2VL8A 4ED1A 2JA2A 3DBRB 1JGGA 4N9HA 3K1NA 1MBKA 2CKZB 2F4MB 3B6CA 4PJNA 3K69A 2WB1A 3HUGB 4I0BA 3F3XA 3ORQA 4QTRA 4MTDA 3JZIA 1GT0C 4I98B 1USSA 2H1KA 2STWA 3F8NA 4A3DG 4D5FA 1KU2A 3KP7A 2CH0A 4KA4A 1PVEA 2WY8Q 3BJYA 4UUSB 3GVAA 5KG6A 1I6XA 3KP2A 1ZQ3P 3V8KA 2CYYA 2VE8A 4RAYA 2XF7A 3OS2A 2P7CB 1OMIA 4BXXJ 1WH5A 3LSKA 2XKOA 4C5AA 5A2QW 2ZMEB 2R8GA 3KYLA 2OCCH 1SMYF 3DPUA 3GUDA 1PP8F 3HOZG 3GO5A 2FX0A 4L9NA 3ERMA 2M4GA 3H1CA 1X1BA 3PNYA 2X85A 3JAMW 3OOUA 3RJ0A 1YOVB 1XG1A 2UUZA 4JBAA 4KN4X 3RV3A 1QZEA 1F9NA 1LKXA 5KAIC 2JEJA 2QSGX 1U5TC 1LFBA 4NNJA 1SFOA 3HHGA 1X4PA 2XV4S 1KQ0A 2ZXWH 4Q48A 3GIJA 4KIBA 1E3HA 3W2WA 5E3MA 3KP5A 2V6EA 1OKRA 4BXXG 3VEPA 3T5HA 1T08B 1SFXA 4YY3H 1RESA 1MJBA 2ID6A 5DTDA 3RQ4A 1FNNA 3JW4A 2W71A 3BROA 3CDIA 3JTHA 3R60A 4XKCA 1AKHB 4I55F 2BQUA 2HTSA 2MA3A 2CS3A 3JRHA 2LNBA 4G7ZF 3GTGA 1N78A 1DGWY 1FP2A 4LK0F 2CV2A 4PGGA 3MKWB 1FMVA 3BG9A 2EA2A 3KLNA 1IDZA 2W6NA 5DCFA 4Y52J 4ED2A 3Q8SB 4EATA 1X9NA 1V5FA 2K9MA 3RV4A 4A93G 3VSLA 2QBYA 4G6QA 1WCMJ 4G94A 4Q4ZF 3J80Z 2DK5A 2A69F 2LC2A 4ZC3A 3JRAA 5JVTA 5KX5F 4NLGA 1JTYA 1XC5A 3KFWX 3BTIA 2R7FA 4XLPF 1D5VA 1IXRC 2ISZA 4HX4A 3GYHX 2XF5A 1K4TA 5IP7G 1TLHB 2E7XA 4OMZA 1HBXG 4J19A 2I87A 1Y1WA 3FMRA 4R1HA 3GTLJ 4BY1J 1XN7A 1O3QA 1X3UA 2MD5A 4DJAA 5ICGA 2E1CA 1K78B 4EYIB 4D0PA 4HSTA 2NVYJ 4UCRA 3BWGA 4JV1A 1I1GA 5K5RA 1TWCJ 2VB6A 4IRIA 1E4GT 3HOWJ 3V4ZA 4PDKA 2CQNA 1OQYA 1ZTRA 4EM1A 4DR7H 5L1LA 1VQLI 2MCTA 1IN4A 3S14J 3A0BC 2WDTA 5KFVA 3DP7A 1R9TJ 2ESNA 4ASNA 1T0FA 2LFBA 4IHJF 2QENA 3P7NA 4I2OA 4G3IA 4JX5A 4XN0A 4C30A 5J1YA 2A5WA 3G6YA 3C2GA 4G6DA 3J81Z 3OSFA 3AG1H 4MIMA 1H88C 4Y3OA 4YQWA 4GLXA 3FKIG 3L2PA 3GW2A 5CQEA 1U9NA 2ELJA 1TWAA 1Y1VJ 4O3PA 2VODA 5L9XA 4F4YA 4DLKA 2BBYA 2WTEA 1VQ8I 2FK2A 3S1QJ 2O9LA
chains in the Genus database with same CATH topology
2QQAA 4RGUA 1YS6A 5D6FA 5D5UB 1KQ8A 2P7VB 2M30A 5FLXW 4I01A 1B04A 3ZMUA 5LHHA 2FEZA 1EH6A 4KMFA 2G7UA 3LA3A 1IRFA 2ESHA 4LMYA 1U5TB 3FM3A 2P8TA 4U7BA 2A6HF 2VT3A 4EJTA 3SFZA 1B1BA 3EYIA 2XAFA 4P5OA 2ZMEA 3RDIA 1KA8A 4MQ9F 2DO7A 3WG9A 1V3FA 1FT9A 4WF2A 5CVVA 4EM0B 1BI3A 2L4AA 1A04A 4EM2A 1S68A 2KJCA 2FMLA 3LAPA 5LRRA 2H6CA 4U0VA 1W7PA 3EETA 3I71A 3O6BB 3RKYA 4IHSA 2ZM6H 1RIOH 1XMQH 4DV6H 1HKSA 4BWSC 1R23A 4KIFA 1BI0A 3I58A 3LQQA 4FT8A 1ZAOA 1XGSA 5LGTA 1OYIA 2W84A 5H6QA 2CGPA 1Z1DA 1GYFA 2VOBA 1SEIA 4LFBH 3S2WA 1PDNC 2VBXA 3E6MA 3HOSA 4FHTA 1O75A 1KQ9A 4EMSA 4E70A 4N9IA 1HKTA 5LL6b 4UCOA 2HFHA 1TQMA 2VT2A 1S03G 1BI1A 2RN7A 4IJAA 5K5OA 4GYIA 3TOAA 2PQ8A 3KZZA 1ZG5A 2XIGA 3HXLA 2A68F 4EJUA 3OOPA 5LHIA 1HNZH 4ZYHA 3ZMSA 5LBQA 3KP3A 1IN6A 3T8TA 4OMYA 5EOYA 4HAMA 3O2PE 4I09A 2VQEH 1TQPA 4APMA 1PUEE 5D5XB 1CF7B 3TDUC 4OU0A 1XMKA 1O3RA 2L02A 2OBPA 5D1PA 4O5VA 5FD6A 1Z6TA 1T38A 1UHWA 1S8NA 3CTAA 3KAKA 2HEOA 1XDUA 2QBYB 2CFXA 3QOPA 1GVJA 2XHKA 1P4XA 2OZUA 4KIGA 2GXBA 3Q9VA 2LDUA 1Z2OX 4LF5H 3KEQA 1KU7A 4B8XA 3VB2A 4GXOA 1NHAA 4L0ZB 2KRFA 3TQNA 1IXSB 3IC7A 4ZZLA 4UNOA 3WTUC 1P6RA 2XROA 2IT0A 4BHBA 1BN5A 1TW2A 1SD4A 2AS5F 3MEXA 2A3SA 2STTA 4ZZDA 4A12A 2VUGA 5LMNH 1E2XA 1HR0H 3KP4A 2E7WA 3BJ6A 4MEXF 2FBHA 3V7SA 3ZN0A 3DF8A 4IF4A 1BBYA 4S04A 3EDPA 1F5TA 4ZH4F 3RGZA 3GWZA 2Y0MA 2HVQA 1DDNA 4DV7H 2M5WA 4CO8A 1HSJA 1GXQA 1J2XA 1G4DA 3FXRA 1AOYA 4DUYH 5CVUA 4NHJA 5L3EA 4B3MH 5TJJA 3H20A 5HDGA 5LHGA 5HOOA 2GWRA 5DYMA 1FY7A 2OQGA 2JT1A 2TDXA 4YFXF 1XCBA 4WK8F 3I54A 3BABA 4N0BA 3E5UA 3RTRA 1J0RA 1QBJA 2HGSA 3C7JA 4UCUA 1SAXA 4KN7X 5H20A 3GFIA 2HDCA 5TRDA 2VBZA 3ZPLA 3IG0A 1R5HA 2P5KA 5L3DA 2EFNA 4I7HA 5DUKA 4EGZA 1SD7A 2DU9A 4Y13A 4TV7A 4Z2YA 2GZWA 2ZJTA 3BDDA 3AAFA 1BC7C 4KT5C 1IN7A 4A0XA 1G3YA 1UFMA 1FSEA 5HLIA 3DXJF 3EYYA 2KKOA 4UCTA 4BNCA 2OQRA 3WE3A 3GFJA 1IXCA 3DPLC 3NRVA 4IXAA 2IA0A 2EJRA 5HDNA 4LB6B 4KYWA 1B6AA 2HVSA 4EJVA 3ZMZA 2KIFA 2O8XA 3V8JA 1XSVA 3PFIA 4M6YA 1P4WA 2ZBKA 2W85A 3UQ8A 1U6GA 4LF8H 1W5TA 3OTOH 2HQNA 1O7LA 1MJ9A 1RUOA 1B9NA 1RNLA 1USTA 1YW7A 1W4MA 2MH9A 3WODF 1TTYA 3RPUA 2DLLA 4LH6A 4NXMH 2IVMA 3LAJA 3JSLA 5JFRA 5FPOA 3ZMTA 4BQAA 1GXPA 2PLYA 2F5EA 3ABTA 2EFQA 4XSXF 3VODA 4DV2H 1W5SA 2JPBA 4DR1H 4HDUA 3E3VA 4A2UA 4CICA 4DR6H 1FYMA 3F23A 3GFLA 3BP8A 1A0IA 2ELHA 1XCVA 3B73A 4JV5H 3MAJA 2VBWA 3FM5A 1I6UA 4MNUA 2QWWA 4EGYA 1BI2A 4GO1A 2IP2A 3KAJA 2M45A 1IUYA 5BPDA 2D2WA 5ILVA 1H0MA 3QPHA 1HKQA 4AD9A 5E8IA 5D1OB 1YLFA 1KGSA 1IZ1A 5E1XA 4LF7H 2FMYA 4A5NA 4HF2A 5A2QZ 1RUNA 1MD0A 1HW1A 2NAZA 1SYXB 2VN2A 2UXDH 4HYEA 2BE5F 2EFPA 3F8FA 4CYDA 3GZ5A 2H27A 1O3TA 1ZN2A 4EQQA 4CXFA 1S3JA 1QZYA 1T2KA 4P96A 2FBIA 5CVJA 3U2RA 5E1ZB 3TKYA 4J0MA 3I4PA 3IL2A 3JSPA 1LB2A 2XAHA 2LKPA 2JSCA 5LEKA 4UV8A 3F8BA 3T1BA 1L2ZA 2BGCA 3M1EA 1T98A 2X4HA 2YCHA 5LGNA 2PJPA 3FWEA 3GXOA 3N97A 3RF2A 1XDSA 3HRUA 2ZCWA 4U0WA 4EFEA 1G3WA 4KDPA 1RI7A 2HKXA 1JGSA 1HW5A 1ZHSA 5LEJA 1E4FT 4YFKF 3F6OA 3P9CA 3PN1A 1LDKB 4X64H 2ZFWA 1QO0D 3IRRA 2UXBH 1STZA 1L0OC 5L3FA 2IJLA 2HYGD 4IHTA 2HS5A 3T0YA 2YSRA 3CUQB 2VOPA 4RB3C 3F22A 3RKWA 2HHHH 2OAZA 1ZHQA 4MHGA 5E8GA 5K5QA 4LB5A 5F1RA 4PGHA 1KYZA 1BGWA 2ZO4A 2ZNYA 1R1UA 3SZTA 2XAGA 1JHHA 2CWEA 2DPDA 2XVCA 2E1NA 1YYVA 4JI6H 1MDMA 2P5VA 1ZLKA 1DUXC 1U78A 2GXGA 3MQ0A 2OZ6A 4G8XA 3WTSC 1SD5A 1XSXA 3R0AA 4B3RH 1MKMA 3QRFF 4A2AA 5ICCA 2HYFA 1JE8A 4GKKH 1ZRFA 3ZMDA 4FX4A 4M9SA 3ML6A 3LA2A 4M73A 1U5TA 2Q2EA 1QPMA 2DW4A 2ZXJA 1BOAA 3ECOA 2NYXA 1R36A 4JI8H 4BH9A 1IAWA 3HHHA 1J5YA 4LJZF 3RPQA 2WC2A 2Q2UA 3J7AK 4CZZA 2GQQA 4IRGA 3I59A 1IBKH 2IPQX 4O3MA 4JI4H 4M6XA 4IRHA 2NNNA 3W6KB 4L0YB 1P4AA 2C6YA 2LF8A 1AWCA 1QNTA 2UWMA 1FYKA 2VC0A 1YIOA 1Z6RA 3P9KA 2IA1A 4AIKA 4EEQA 3R4KA 2K4JA 1TNTA 1BJAA 3ISPA 3SXYA 3F8CA 4L9VA 1R5GA 3ZQ7A 2D1HA 2QYOA 2VXZA 5ILUA 2GAUA 4ZYGA 2K27A 4FX0A 1SFEA 5FLXK 3QP6A 4HW0A 2XKPA 3RGXA 3HIFA 4AWXB 2Z33A 4WWCA 2CW0F 1DGSA 4ZYEA 2O03A 4X65H 4KMUX 5BMZA 2H09A 3LMLA 2FRHA 4L5JA 3KLOA 4M74A 5LRSA 1G3TA 1MZBA 1R00A 3I53A 4YHHH 4QLCU 1IBLH 2FSWA 5BS6A 2VC1A 3KETA 4AIHA 2W57A 2FXAA 3QU3A 4EVIA 4NXNH 1WWXA 1ONVA 3L00A 5E17F 5BR8H 4DNCA 3CO6C 3WGIA 1U8RA 5D5WB 3EQLF 3KEOA 3BA8A 1QZZA 4LLGF 4LF6H 1JHFA 3BJAA 1MJAA 4IPAA 4B09A 2ETHA 1QGPA 1Z7UA 5JHUA 1EH7A 3V4GA 2V1UA 3L9FA 1FBSA 4YIFA 2HTJA 4GGGA 3CUQA 2BYVE 3COAC 3FHZA 3FZVA 3P9IA 1UHMA 4ON0A 2M8EA 2PFBA 1E17A 4DV4H 1BJTA 4OIRF 2R3SA 4M9ZA 1BIBA 2DT5A 4WCGA 4HX8A 1LNWA 4CGZA 4RGSA 3HSRA 4A5MA 2F5CA 1R22A 2OU2A 3GX4X 4HV5A 1ULYA 5D4RA 1W7PD 4YIIA 3L4JA 1KU3A 4KHPH 3BJOA 4BHCA 1EV7A 2F5FA 2B0LA 3N43B 3HUGA 1K7AA 1ZRCA 2KSWA 5IT9K 5F64A 3TO6A 1XGOA 1W7PB 3TOBA 2MLKA 1IN5A 4L9JA 1BM9A 1D8KA 1J5EH 2COMA 4XSZF 2VPSA 5IT9W 3C0FB 2A5YB 4DV0H 1ZG3A 3RIZA 3KZYA 2UUAH 1P2FA 1FVIA 2M1BA 2RGRA 2P4WA 5JI6A 4S05A 5BPIA 1N32H 3KP6A 1DPUA 4U7DA 2P5LC 5L3CA 3SZPA 3V7CA 5H6RA 3GEZA 3L4KA 1YQAA 1UB9A 4MEYF 1CGPA 5K1YA 4CDGA 5BOXA 2QQBA 1LEAA 4MQVA 2L4MA 2DPUA 1ZARA 2IA2A 1FP1D 3DV8A 2CO5A 4L5IA 3K2ZA 4RB1A 1O3SA 2UXNA 1S29A 4L9TA 2W24A 4JK1X 3ULQB 5ICFA 1XD7A 3F21A 3TGNA 4PCQA 2BEOA 2QQ9A 2F5DA 3QP5A 4R79A 3RI4A 2Z5UA 1IW7F 4UHTA 4EV0A 2CG4A 2CW7A 3MZHA 2RVCA 4F7ZA 4QWQA 2EWNA 2XAJA 3NQOA 1H9TA 2EFWA 1H9GA 1XNQH 2J5OA 3K9TA 4KUMA 3DFGA 4L18B 3HRMA 4LLLA 2QLZA 3NEUA 3L2CA 4EJOA 1TBXA 2F2EA 3N42B 2MH2A 2PEXA 2G7HA 4BHPA 2NNYA 2FNPA 3H92A 2R7DA 2A61A 4LH7A 2FE3A 3H3UA 2PMUA 1LDJA 3M7GA 2L54A 1XSDA 4OIPF 1KYWA 2Q2TA 3K1PA 3WU0A 4LFAH 1YFHA 2JRTA 2K86A 2QUFA 3GFMA 1N34H 4PZJA 4OIOF 1WI9A 3F6VA 4RGXA 1WSUA 5KVRA 4KICA 1G3SA 2EV0A 5CVIA 2ISYA 3GZ6A 4DR4H 3I64A 2FOKA 1T6SA 1Z2NX 1SMTA 1I27A 1XMOH 3L09A 3DKWA 2VE9A 3HTUA 3ZMVA 5FLXZ 1EH8A 3DQVC 4ZYDA 1QQIA 1HW2A 3ZN1A 2KJBA 4P9UA 2UXXA 2GA2A 4HZFA 1HNWH 2DTRA 4OIQF 3RKXA 1OYYA 2HZTA 2QZ8A 4A0YA 4WXDA 1Q1HA 4OINF 2OA4A 4LF9H 4LK1F 2V1XA 4Q47A 2DAOA 2K4BA 4UVCA 6PAXA 4LLNA 1WH2A 4MTEA 3R6SA 3WTZA 1ZH5A 3V7RA 3C1DA 1ZHFA 4HDVA 4MV7A 1F1ZA 5FD5A 4G7HF 3CVZA 1DP7P 3MFKA 1AN7A 3IKVA 2XGXA 4M7EA 2JTVA 1FOKA 4HV6A 4HLYA 2DFIA 5A2QK 3DEUA 3IWFA 2V9VA 1T39A 5J8CA 4X62H 5FB2A 4RZQA 1Z2PX 4ENJA 2GA1A 4HF0A 3WTWC 1M0WA 1DPRA 2M87A 4Y15A 1K78A 4UCSA 2DQLA 5FPRA