4RB3C

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (25-MER)
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 37
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb3C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb3C02
1O57A 3QAHA 5CVVA 4ZZLA 5LGTA 3ERED 3ABUA 3E5UA 4M6YA 2YR2A 3SZPA 2F5FA 4IXAA 1I27A 6PAXA 4S04A 3F6OA 5A2QZ 3J81Z 4HV6A 1J7KA 1ULYA 5L3BA 2PLYA 2QENA 2FF4A 5D5VB 5BOXA 1XSDA 5LBQA 2PN6A 1B4AA 1FBUA 4R8HA 3K2ZA 1MJ9A 1OYIA 1IZ1A 4LB6B 1U78A 4ENKA 2FRHA 4BH9A 4GXOA 3CDHA 2ZMEA 5D5UB 1FSEA 2OBPA 5BS6A 3P9CA 4BNCA 4XRFA 2QWWA 3BOQA 1HW1A 2OQRA 5DCMB 2E1CA 4KFCA 1ZHFA 4KIFA 1J59A 1W7PD 2F5EA 4WF2A 4LK1F 1UHMA 3CLOA 2QZ8A 4EM1A 5D4RA 4G7HF 2DU9A 3M9AA 5CLSA 3CJNA 4CICA 1YW7A 4NQWA 5K5RA 4M9ZA 2VC1A 5TJJA 3HYIA 5IT3A 2MLKA 2HWVA 2ELHA 4CZZA 3GF2A 2XKOA 1KQ0A 1I6XA 4UVCA 1FOKA 3B73A 3E5XA 4BAYA 3BJOA 3GEZA 2O61A 4EJTA 4IVNA 4KMUX 5HOOA 1HBXG 4LLGF 3F72A 1BI2A 3GLXA 2P7CB 3F3XA 1P92A 2K4JA 3IWZA 3LQRA 3TO6A 2WWYA 2K7LA 1T38A 4P55A 4L18B 1O3SA 5DD4A 3GUDA 2XHKA 4WXCA 1ZRFA 3U1DA 1R23A 2A07F 1JGSA 4IF4A 1IAWA 1T2KA 5D6FA 4CYDA 2JTVA 1I1SA 4XLNF 2QYOA 2RQPA 3T8RA 4RB0A 1WSUA 2VE9A 1HKSA 3N4MA 1ZGJA 2XAGA 1KYWA 2P5LC 2P5KA 2Q2EA 3KLNA 2FSWA 3K69A 3QPTA 1GVJA 1FZPB 1K7AA 1JXSA 2K27A 3GFLA 1J9IA 2XROA 3ELKA 3L9FA 2LNBA 1W5SA 3HUGA 1D3YA 1OR7A 3E3VA 3I4PA 5JR3A 3D5LA 2XV4S 3HRUA 2EFOA 2V79A 3B02A 2ZXJA 1Z9CA 4M72A 1BM9A 5EEHA 2CW0F 3SZTA 3RYRA 2BEOA 1XMKA 1T6SA 1LEAA 1R5GA 1B9MA 3F21A 1LDKB 3MAJA 3LAJA 3I53A 3M8FA 3DPLC 5K1YA 2UXNA 1S6LA 4HBLA 1PP7U 2YU3A 1BIAA 3DPTA 1EH8A 5H20A 1SD4A 5E1ZB 2AXLA 3HHGA 3QP6A 4OMYA 2DPUA 1TQPA 1MD0A 1LNWA 3WODF 5D8KB 2IW5A 5E8GA 2K4BA 5ICCA 1BIBA 2ZO4A 3R0AA 2LSOA 5FFZA 3NEUA 4IHSA 2X0LA 3FX3A 4I09A 1FC3A 3DFGA 1ODDA 4G6DA 4WXHA 3HSEA 4KDPA 4OINF 1DP7P 3CUQB 1CF7A 4OIQF 5H6QA 4B09A 2Z9OA 1BOAA 5KK1A 5BPDA 5FD6A 4HX7A 1FSHA 2HKXA 4EVIA 4KN7X 2IPQX 4O5VA 1SMTA 3DEUA 2OA4A 3WU1B 4M71A 3HRMA 1XGSA 3JAMK 3RI4A 1C0WA 4KN4X 3W6JB 1H9GA 3H3ZA 1DDNA 4UVBA 4LJZF 2V6CA 5HLGA 1U2WA 3V8JA 2R7FA 1B6AA 4L5JA 5LGNA 4GGGA 3KP6A 2EFQA 2Y75A 4RGUA 4KICA 3WGIA 3VEPA 2XIGA 1PDNC 4PGGA 3IWFA 2NAZA 2KKOA 1OYYA 2H27A 4A0ZA 2XAHA 3SQNA 4A6EA 1T0FA 3M7GA 1R5HA 3E97A 1DPRA 4HQEA 2H94A 1KU2A 1YIOA 3C3WA 3H92A 2CFXA 2G7UA 2Y0MA 3JTHA 4NHJA 1EV7A 3TOAA 1CGPA 3ULQB 3M8EA 3WTWC 2PMUA 3WE2A 3T1BA 4KMFA 2QLZA 3EETA 2HYFA 1YW8A 1NHAA 2M1BA 2NNYA 3QU6A 3ZP5A 1G3SA 3HSFA 2MA3A 2HGCA 2NNNA 1A04A 4A12A 3GFJA 4AIKA 4CO8A 1WKMA 3DV8A 2FBIA 4EJOA 4YFKF 2XVCA 4I98B 5DUKA 2H6CA 2Q8KA 1O3TA 1B59A 1XSVA 3E6BA 1MDMB 2GA2A 1S8NA 2HTSA 2BBYA 1S29A 1LDJA 2R7DA 1FPQA 1EH7A 4LG0A 3ZQ7A 1RIOH 5DCMA 2BV6A 4AD9A 4O6JA 2FMYA 3LA3A 5TRDA 5HS9A 4IRIA 4ZH4F 3MWMA 4EJWA 1KU7A 2VBZA 2BE5F 3WTSC 4KIGA 3DP7A 4I0AA 4RGXA 1K78B 3VB2A 3KZZA 5BQTA 3V8KA 4DQ2A 3IHUA 3HHHA 2CYYA 2FNAA 4U0WA 2P7VB 1HQCA 1ZN2A 3WTUC 4HX4A 4IJAA 3E6DA 4KNYA 3D0SA 3FF5A 3MZYA 4LLLA 1MKMA 1OYWA 1KGSA 1QNTA 4HF2A 2QBYA 4H0EA 4G6QA 3KP3A 4HF0A 1BI0A 2A6EF 4CXFA 1AOYA 1YFHA 5E1XA 1XGOA 3FXQA 4MEYF 5D4SA 2K02A 5DDGA 1ZRCA 4N9IA 2EV5A 1WI9A 4AVPA 1S7OA 1IW7F 1BI1A 3QOPA 3VOEA 2DLLA 4G94A 4NB5A 5E18F 1OPCA 4TV7A 2ZKZA 4HX8A 4UV8A 3J80Z 5FGMA 4WXDA 3F8BA 4ASNA 4LB5A 1KYZA 2CSOA 1MJBA 5L3EA 2DQRA 2Z33A 1U5TB 5AIQA 1IUYA 1DPUA 4HZFA 3CUOA 1U3EM 3KEOA 4CGZA 1D8KA 2NRAC 1STZA 3HTUA 2G9WA 4HW0A 3GWZA 2VN2A 1U8RA 2QVOA 3V7CA 4I01A 4GCVA 4G7ZF 5H6RA 2GZWA 3FXRA 3BY6A 3G3ZA 1IRGA 3V4GA 3BPVA 2P6TA 4KYWA 3WGHA 5HVQC 3CO6C 4AIJA 4JQFA 1ON2A 3F8NA 3AAFA 3FMQA 2ETHA 4ETSA 2CO5A 4M6XA 1IXCA 1GXQA 2VODA 1IXSB 1V3FA 3JTGA 3FM5A 3L09A 1IF1A 2LKPA 3WE3A 1VTNC 2L54A 3IRRA 4HA8A 2W84A 3WTVC 2DK8A 5L3FA 3CUQA 2JZYA 5LGUA 3WG9A 2A68F 2EFWA 2L3DA 1F4KA 1FNNA 4PGHA 2OU2A 5DYMA 2QQ9A 4CDGA 2CGPA 5AIPA 1L0OC 2KIUA 1F1ZA 4U0VA 2B0LA 4MQ9F 1IXRC 2PFBA 3REOA 2M87A 3JW4A 2HEOA 1YQAA 1R22A 1LB2A 1JE8A 1TW2A 3MFKA 5E8IA 3GFIA 2ZNYA 2RVCA 2VT3A 5DEQA 4K2EA 3FM3A 1SMYF 2VBYA 3ECHA 4KA4A 3TOBA 4HF1A 1G3TA 2EA4A 3FXUA 1K6OA 3ISPA 2OZ6A 2ACJA 5HDNA 3NQOA 5FFXA 2A5YB 3S2WA 3SFZA 4A2UA 2DW4A 1FBSA 2M30A 4ENMA 2VT2A 2FQ3A 4HLXA 1B1BA 4MTDA 5ICEA 2FBHA 2ADUA 2V1XA 3HTSB 4RB2C 1YO5C 1FY7A 1O7FA 3PQJA 3GZ5A 2A3SA 2GA1A 2JT1A 2KJBA 2YX7A 3GW2A 1XCBA 2F2EA 1KU3A 3FMSA 1SD6A 3I54A 4GYGA 3LA2A 4EQQA 3T5XA 5LRSA 4OIRF 2PG4A 2ESNA 4RB1A 2FU4A 2GQQA 4L9NA 3SHFA 1ZG3A 1TW3A 3RKWA 5FLXK 2GXGA 2WV0A 2UXXA 5ICGA 2Z99A 5FD5A 3HIFA 2HYGD 1O7LA 1W7PB 1J75A 5E17F 5LHIA 1FWZA 2JSCA 4WCGA 3FHZA 2A6HF 5K5OA 2F5CA 3O3KA 1SFUA 3I0TA 3C1DA 2G7HA 2IT0A 3KP2A 2W24A 4PCQA 1MDMA 2MH2A 1MGTA 3TGNA 4FT8A 3IL2A 4MQVA 3N97A 3I71A 3VFZA 2E7WA 1QO0D 5D5WB 2FNPA 4Q48A 4LMYA 1O3QA 1FYKA 1J5YA 2ZMEB 2JPCA 1LJ9A 2OD5A 2PEXA 3DF8A 4ENNA 1YG2A 3ABTA 4RB3C 1KU9A 1BJAA 1KA8A 4GYIA 4QWQA 4I2OA 5HDKA 5J6XA 1K78A 4MGRA 2W85A 2C6YA 2CWEA 1FP1D 2RC4A 4HYEA 2XUBA 3R60A 3ZPLA 1RUOA 3F8FA 3QRFF 2NS0A 3RYPA 4ZZDA 4U7BA 3PFIA 2DI3A 1R58A 1WWXA 1G3WA 1G6NA 1MJAA 4MNUA 2HDCA 2YX4A 3KP7A 3TKYA 1DUXC 1ZH5A 4LFUA 3LAPA 2D1VA 2K86A 1SFXA 5J8CA 1XB4A 2H09A 1LQ1A 2PBIA 2FBKA 4Z2YA 4XLPF 4XBFA 2GAUA 2XRNA 2R3SA 4P96A 1HXDA 2JPBA 1HKTA 5D5XB 1ZLJA 3KCCA 4OIPF 2PQ8A 2HQNA 4ZYGA 4EGZA 5L3CA 2ISZA 2L4MA 1PUEE 2CQKA 1E17A 3RKXA 5FB2A 3GX4X 1ZRDA 4KUMA 1U5TA 4N0BA 1EH6A 4HV5A 4R1HA 1IN8A 1AWCA 5FLXZ 2VOOA 1ZARA 3TDZC 4DNCA 4N9HA 3L00A 2LF8A 4BHPA 1YTYA 3TDUC 2QQBA 5LEJA 5EEGA 5KVRA 3K1PA 2FXAA 1R1VA 4BHCA 1H9TA 1RUNA 5K5QA 5HLHA 4LK0F 2ZFWA 2HTJA 1R00A 2H6BA 2EWNA 3EDPA 1P6RA 2MBFA 2L01A 2VBXA 4IRHA 2LDUA 1ZAOA 5D8LB 5ILVA 2RKHA 4Y13A 2A61A 3MZHA 2ISYA 1RNLA 1R1UA 3E6CC 3M1EA 3W6KB 3ZMVA 2STTA 3V8LA 3U2RA 2UZKA 2YPRA 4ESBA 5JI6A 2VXZA 2DQLA 2MH9A 3I59B 5DD8A 5ERIA 4L9JA 4F7ZA 1KQ8A 3LWFA 2CG4A 4BYYA 3BDDA 3HRTA 4M74A 2IP2A 3T0YA 4A5MA 4UVAA 3CO7C 5LLQA 3OV8A 1ZYRF 3LA7A 3EQLF 1J2XA 3RJPA 1QPMA 3JAMZ 4A0YA 2AS5F 1FP2A 3FZVA 3GFMA 1R1TA 2E7XA 3JSOA 4L5IA 5HDGA 4XSZF 4Q5SF 5HLIA 3EYIA 1V4RA 1WRJA 2V9VA 3DKWA 3F22A 1TBXA 1UHWA 2QUFA 2FA5A 1Y0UA 1HSTA 3BZ6A 1ZG5A 2J5PA 1MZBA 1LVAA 3ML6A 5BPIA 3E6MA 1TQIA 2RGVA 3NRVA 3Q9SA 3RTRA 1GHCA 2P6SA 4EM0B 2V1UA 1LEBA 1FYLA 4EJVA 2F5DA 1QBJA 2IA1A 1UCRA 2VE8A 5JHUA 2OAZA 2XAFA 4YG2F 4PDKA 4MEXF 4IHTA 4R79A 5J8FA 4HDUA 4M9SA 3MCZA 4OIOF 5F1RA 1XD7A 3O6BB 3E5QA 4ESJA 3LSTA 5LRRA 4JBAA 3IKTA 4ENJA 1BBYA 3F23A 4A6DA 2VOPA 5HS8A 3GVAA 5HS7A 2EV6A 2DO7A 4P9UA 4WX9A 2O8XA 3KFWX 1W7PA 2V1DA 1XN7A 3F8MA 4KIBA 3QPHA 2WTEA 4MHGA 2BYVE 3K1MA 2L4AA 4G9YA 3I58A 5D6EA 1QGPA 4HQMA 3VODA 3BWGA 1KQ9A 1W4MA 1LDDA 5JVTA 3LFKA 1UB9A 3C7JA 1ZG1A 2UWMA 4EJUA 2HR3A 2HS5A 3IKVA 2JRTA 2GXBA 2W25A 1YS7A 5CYVA 2QQAA 1X3UA 3R61A 3U9GA 3GXOA 4HLYA 2KIFA 2EK5A 4LG0B 5F64A 2XAJA 2D2WA 3RIRA 3EUHA 3WTTC 3K9TA 3GO5A 2IVMA 3EYYA 3HRSA 4U88A 5ILUA 4UHTA 2FMLA 5DCFA 1XGNA 1U6GA 4RS8A 1FBQA 2VC0A 2EA2A 4RAZA 3P7NA 2HFHA 2Z5UA 2XASA 2IA2A 2DAOA 2PI0A 3ZMSA 1IN5A 4ESFA 1I1GA 1TLHB 5CJ9A 3KLOA 2WC2A 2X4HA 2STWA 2XAQA 2O0YA 1Z6RA 4M9XA 4G8XA 4UUVA 4Q4ZF 3BP8A 4U7DA 3K0LA 3F8CA 4OMZA 2DT5A 2EFPA 4OU0A 2ZCWA 2IJLA 2QBYB 3ZMDA 4PZJA 4EMSA 2GIVA 3MEXA 4Q47A 3CUQC 4P9FA 3P9IA 1FX7A 3L7WA 3BPXA 3WGGA 4WWCA 3BJ6A 2OZUA 2IA0A 1JHFA 2FE3A 4MTEA 2Y48A 4YIFA 5DUIA 3BJAA 1TTYA 2D45A 1SD7A 1BN5A 3KEQA 5ILSA 1YW9A 3CTAA 5FO5A 4CHUA 1HSJA 2NYXA 1YLFA 3T8TA 2DTRA 4HAMA 1F9NA 3ZN1A 2MC3A 5L3DA 1QQIA 4UV9A 3FMRA 4ZYEA 1L3LA 3ROUA 3ECOA 4WK8F 1IN6A 4JK1X 3TO9A 3HSRA 2LF7A 1Q1HA 3O2PE 2GWRA 3R4KA 1K79A 3KETA 2P8TA 2YSRA 1I5ZA 2ZJ2A 1D5VA 1Z1DA 1E2XA 3I64A 2XGXA 2EV0A 4I7HA 1W5TA 1XGMA 3DQVC 4XSXF 1IN4A 3LQQA 3R0JA 1PP8F 1GXPA 1FT9A 1USTA 4L0ZB 1QZZA 3OOPA 3I59A 4A5NA 1P2FA 3COAC 4LD5A 3RDIA 1SAXA 4B8XA 2BGCA 3P9KA 3L2CA 5LHGA 5L3GA 4ZYHA 4A0XA 4IRGA 4BXUA 1UFMA 4Y15A 3WU0A 5AONA 2MD5A 2IRFG 2RV8A 5IT9K 1TQMA 3F6VA 4I0BA 4LLNA 1WQ2A 2VONA 2TDXA 3Q9VA 3R6SA 1OMIA 2DFIA 3KP5A 4AWXB 4E70A 1HKQA 2HOEA 1YYVA 4HOBA 4AIHA 2KIMA 4L9VA 3BROA 2M8EA 2ZBKA 3J7AO 1USSA 4G7OF 1Z7UA 3FWEA 3IC7A 3RPQA 3JSPA 2O03A 2M5WA 3H3UA 1SD5A 1H0MA 3HOSA 5F6FA 1BC7C 1P4WA 2FEZA 4FHTA 3DXJF 5CVUA 4EM2A 1J0RA 1XDUA 1RZ4A 1XMAA 1S3JA 4YFXF 5CVRA 2RDPA 2J5OA 5ICFA 4RGRA 3TQNA 1T98A 4OOIA 3PQKA 1F5TA 1TNSA 4GO1A 1QZYA 3Q5FA 1IN7A 3ZN0A 1OKRA 1YS6A 3J80K 5CVIA 4EV0A 2PMHA 2ESHA 2W57A 3KP4A 4UXNA 2MLGA 2RN7A 4QLCU 3ZMUA 1Z6TA 4U0YA 2HKOA 1G3YA 1P4XA 2EJRA 5A2QK 2PJPA 1ZGAA 2P4WA 3J81K 4HDVA 3KZYA 2KJCA 4LGWA 4L9TA 4Y17A 1B9NA 1D8JA 4M73A 1G4DA 4D0PA 3K1NA 5DV5A 1FYMA 1ON1A 3WTZA 2DPDA 5CVJA 1IRFA 4BHBA 3TO7A 3ZMZA 4YFNF 4UNOA 3GYHX 4RAYA 1O3RA 1BC8C 2M45A 4KT5C 3IRQA 2Z3YA 3QP5A 1P4AA 5LEKA 1ZLKA 4IPAA 2L02A 4FX4A 4RGSA 3HOTA 5LHHA 3GZ6A 4BQAA 3WTYC 5E20A 4S05A 3ZMTA 2HQRA 2HZTA 4FX0A 3V7SA 1U5TC 2A69F 1JHHA 1FLIA 1Z05A 2XKPA 1RI7A 3RKYA 3G73A 1CF7B 2DK5A 4YIIA 2OQGA 1R7JA 5IT9Z 1R36A 3SXYA 2Q0OA 2VBWA 3KE2A 2O3FA 3V7RA 1REPC 1XCVA 4ON0A 1TNTA 2ZNZA 2EFNA 2QM3A 4O3MA 2FOKA 2E1NA 4EGYA 2EB7A 1Z91A 3QU3A 5BMZA 2D1HA 1ONVA 1XDSA 3WTXC 3RPUA 1SFEA 4I02A 4P5OA 1HW2A 3C18A 2KRFA 4L0YB 1BI3A 2DBBA 2COMA 1T39A 3MQ0A 1HW5A 1XSXA 4ZYDA 1S7AA 2O6GE 2P5VA 5E1WA 1ZREA 5ED4A 5JFRA 3I5UA 2RNJA
chains in the Genus database with same CATH superfamily
3TBIA 1O57A 3HDDA 1E0EA 4C2MA 2L9NA 3QAHA 3S3MA 3NWTA 5CVVA 4ZZLA 1YRNA 5KFDA 5LGTA 3ERED 2LH9A 3UKGA 1T3NA 3ABUA 3E5UA 1VAJA 2W6OA 3K3PA 3SEZA 2I8CA 2W6PA 4LF7H 4BBSG 2V1NA 1OCCH 4BQQA 3L2RA 3MWEA 4M6YA 2YR2A 4PJNA 3SZPA 1HF0A 4ED0A 4B4CA 1N56A 5JHFA 2X0SA 5EZHA 4QSHA 2F5FA 4XR6A 1QVTA 1IV8A 4F55A 4U6PA 1C30A 3M4OJ 3MZ8A 1TWAA 2K3FA 5C1PA 3G8CA 4IXAA 3KHLA 1T94A 5KFUA 1I27A 1WSCA 3BTCA 2TRTA 2CRGA 6PAXA 4S04A 3G71I 1LFUP 3GIKA 3CZ6A 2GBYA 2KPMA 4BJTA 4O4IF 4D5CA 3BAAA 3K4LA 3F6OA 5A2QZ 3J81Z 2WV1A 1BA5A 2GPSA 1N34H 1AKHB 2YS9A 4HV6A 3VYUB 1GSHA 1TL8A 1J7KA 4IL6C 1ULYA 2R5YA 3FDSA 5L3BA 2PLYA 5KFPA 2QENA 2FF4A 5F04A 4ECZA 4J9LA 5D5VB 2EZHA 3CCMI 3PNYA 2B63J 5BOXA 2JA2A 1WR2A 2K3PA 3OS0A 1GV2A 5KFTA 2BW3B 5KKNB 2EINH 1XSDA 1JKPC 3MR3A 5LBQA 1WH5A 2R92J 4N4NB 2WAEA 2E2HA 3KX2A 4G12A 2M9HA 3W2VA 2PN6A 1LE8B 1B4AA 1TC3C 2E71A 1FBUA 4XQFA 4O3NA 2CH0A 5KG4A 1PYVA 1ZETA 2DJNA 5L1KA 4I4TF 4R8HA 3K2ZA 3H35A 1IDZA 4GDFA 3RBEA 1MJ9A 1S7EA 4R7RA 2PMZE 3C2HA 4EG0A 1OYIA 1IZ1A 5IP9J 2QSHX 4J9KA 1VNDA 4LB6B 4BL0B 1U78A 1YE9A 4ZHQF 2UV1A 2DCEA 3SYTA 4RNMA 4ENKA 2FRHA 2FJZA 1X2MA 4IWYA 4BH9A 3HKZN 4GXOA 3CDHA 5IOZA 2ZMEA 3BQYA 4C2TA 1YX3A 2H1LA 2MCTA 3N40P 4DW6A 5D5UB 2L9RA 1IJWC 5LMNH 1FSEA 2OBPA 4P1WA 5BS6A 1TWGJ 3P9CA 3HKZA 4BNCA 4XRFA 3LSMA 2R93J 2QWWA 3BOQA 1HW1A 2K9SA 4F50A 1ZR2A 2OQRA 1PJRA 3G2BA 3HXLA 3CC4I 3F9KA 4FTHA 3B6CA 2ME0A 5DCMB 5M5YJ 2E1CA 4KFCA 1ZHFA 2DA4A 4KIFA 2XSDC 1J59A 3DKXA 3ZQHA 3RB3A 3HOYG 1W7PD 1WVRA 2F5EA 4WF2A 4LK1F 1LKXA 4XKVA 4DV7H 5CQEA 3S1QJ 1UHMA 3GIJA 2DYRH 3CLOA 3MWDA 3KIOA 1JX4A 2QZ8A 4HSTA 4EM1A 1VQ4I 4PFPA 5D4RA 4G7HF 3OUZA 2DU9A 3M9AA 1K6YA 2L7MP 5CLSA 3S8PA 4X66H 3CJNA 3PR5B 3IV5A 2DJIA 4QPQA 4MV7A 4CICA 1YW7A 3BCBA 2L7KA 3WU2C 4IHJF 3CMYA 5J47A 5J3LA 1BR2A 1S0NA 4NQWA 5DTDA 5K5RA 2C28A 4WBNF 1U0JA 4M9ZA 2VC1A 3U1KA 5TJJA 4HRIA 3HYIA 3S1NJ 5IT3A 1ACIA 2MLKA 2HWVA 2ELHA 4CZZA 4A3KG 1XMOH 4B47A 2E34A 4BUPA 3OTOH 3GF2A 3I56I 2XKOA 4AIDA 1KQ0A 2H8WA 1I6XA 4UVCA 2JN6A 2R4GA 3B73A 1FOKA 3E5XA 2W9CB 4FISA 4BAYA 2C2RA 2AQEA 3BJOA 3Q0WA 3CCVI 3GEZA 4RUAA 2O61A 3MMYB 4C3HJ 3PIPF 4PUSA 4IQ4A 2GXAA 4EJTA 2ZXIA 3MFIA 3H4DA 2R7QA 2A05A 4IVNA 4KMUX 5HOOA 1HBXG 2GOMA 3VPBA 4LF4H 4LLGF 2B7EA 1BI2A 3F72A 3GLXA 2CV1A 2P7CB 4RA2A 3F3XA 5K7ZA 5KG6A 1P92A 2KISA 5DGAA 2K4JA 3IWZA 3LQRA 4A3EG 3TO6A 1ITYA 3HPGA 2WWYA 2EIKH 2K7LA 2JA6G 1T38A 2XF5A 3D5SC 4P55A 4XKBA 4OAYA 4XN0A 4ANJA 4L18B 3IAM2 4BXFA 4LF6H 2ZMEC 1X1BA 1HDPA 5DD4A 3GUDA 1O3SA 3KPHA 4D7MA 3PW0A 3L2UA 1YIJI 2XHKA 3CF5F 3S1MJ 3OIOA 4WXCA 2R5ZA 1ZRFA 2VQGA 3QPSA 1GSAA 3U1DA 3K6GA 5LA6F 1R23A 2A07F 5DG7A 1JGSA 4IF4A 1TWHJ 4GFBA 3FBIB 1IAWA 1T2KA 5D1PA 3ABMH 5D6FA 2X6OA 4I55F 3OIPA 4CYDA 2JTVA 3LFUA 2VUMJ 4BY7J 4XLNF 1I1SA 1KC7A 1JDBB 2QYOA 2MYSA 3O8GA 1MNMC 5F0CA 1ERDA 2ZXHA 1MBHA 2RQPA 3T8RA 4RB0A 1WSUA 4YBZB 5J1RA 2VE9A 1FIAA 1HKSA 3N4MA 2LY2A 4Y33A 4R8UA 1ZGJA 2XAGA 1QA6A 3GIPA 1KYWA 2P5LC 1E4EA 1Z77A 2P5KA 2VKVA 5GTHC 2Q2EA 3PW4A 2ZB9A 3KLNA 2FSWA 3K69A 3K7AJ 4JI0H 2VJIA 3QPTA 2UUBH 1GVJA 1FZPB 3AG1H 1K7AA 1JXSA 2K27A 1MBJA 3GFLA 1J9IA 2XROA 3ELKA 2JA5A 2GOXB 3L9FA 1TWFJ 1G8XA 3LSGA 2LNBA 1W5SA 3HUGA 1D3YA 4YAJB 1OR7A 3E3VA 5IYBJ 3I4PA 2W6MA 1PUFB 5JR3A 3D5LA 4O2AF 2XV4S 3HRUA 1QRYA 2EFOA 2RREA 3OR1C 2VPRA 5F9NA 2V79A 3H3VK 3B02A 5KFHA 3OSNA 1L2ZA 1HLVA 2ZXJA 3FBNB 1Z9CA 3DEWA 2W7PA 4LITA 2CUFA 4M72A 1BM9A 5EEHA 2CW0F 3SZTA 2LR8A 3MR2A 3BR6A 4ECWA 3AYHB 1K1QA 3RYRA 2BEOA 1F43A 4IZOA 1A9XA 1XMKA 1T6SA 4AU7A 2KSWA 4MA5A 4RMNA 1LEAA 2NVUB 2LC2A 1R5GA 1B9MA 3CQZA 4IAJA 4RNNA 2UVWA 3FXOA 2IS1A 5KG2A 2BHYA 3F21A 2FX0A 2DFEA 1LDKB 3R5HA 1D0XA 1R9TJ 3E5NA 3BZKA 3S17J 3MAJA 1LPQA 3LAJA 3GV8B 3OYEA 3I53A 2X1DA 3M8FA 3DPLC 5K1YA 2UXNA 1S6LA 3ABLH 4HBLA 4PFOA 4B3MH 2UXCH 1ETYA 3JRIA 4E4HA 1PP7U 5DQHA 5EGOA 2YU3A 1BIAA 3DPTA 1R6RA 4B3XA 3CC2I 1EH8A 1BR1A 5H20A 2E1MC 1X9NA 1SD4A 2AXLA 5E1ZB 3S15J 2BY2A 2DA3A 3HHGA 2OCEA 2QGUA 3QP6A 2ZJQF 3A2KA 3DF7A 2EH3A 4OMYA 3AKZA 2DPUA 5H80A 2HDDA 1TQPA 1MD0A 2ID3A 1LNWA 3WODF 4A3DG 5FRMA 5GPCA 4IHYA 3PNTA 5D8KB 2IW5A 3M1CA 5E8GA 5C4XJ 5HODA 3K4NA 3GTJJ 5HLTA 4J9MA 2K4BA 2FPGB 3TQ1A 2JVGA 2W6QA 5ICCA 4L5EA 1BIBA 2COBA 4F4ZA 4J9NA 1SCUB 5K2MA 2ZO4A 2IGOA 2LSOA 3R0AA 4BU2A 5FFZA 5KFLA 4DR4H 3JRGA 1N25A 5K7HA 3NEUA 1JJ8C 2B63A 4IHSA 2X0LA 3FX3A 4I09A 2YZMA 1FC3A 3DFGA 1ODDA 4G6DA 4WXHA 4C5AA 2C2DA 1E3OC 3HSEA 4KDPA 2W71A 1OR7C 4OINF 2R92A 1XG1A 1DP7P 3CUQB 4A3GG 2L0KA 1X1PA 2E5ZA 1CF7A 4OIQF 2OTLI 4RAGA 5H6QA 1OFCX 4B09A 2ZSHB 5JLWA 1BOAA 2Z9OA 2DPJA 2Q2UA 2UUAH 5KK1A 5BPDA 3C2GA 3H4BA 5FD6A 4A3CG 1W0TA 5I47A 3OYAA 4A69C 4HX7A 5FLMG 1HNZH 3H36A 3ZQCA 3V42A 4D1QA 2Y9ZA 1FSHA 2HKXA 4EVIA 4KN7X 2IPQX 1A0IA 2W00A 4KITB 2BXYA 3KAKA 2MC4A 1U9OA 3DBHB 4O5VA 5KFOA 1SMTA 1XC5A 5KG0A 1KONA 4FBUA 3DEUA 2OA4A 1WH7A 1BXRA 1O75A 4O3QA 3DKYA 1YITI 3QFFA 3J7AY 3WU1B 3HOWG 4M71A 2LFBA 2I87A 4QJFA 3HRMA 2R7VA 1UNNC 5F1JA 4O4HF 1TWGA 1XGSA 3BG6A 4GKKH 3JAMK 1RK6A 5B5EC 2R93A 3EPZA 3S1RJ 1RKTA 3RI4A 1C0WA 4KN4X 2LY9A 3QODA 4YJ2F 2PJRB 4B44A 4W1UA 4J9SA 4DV0H 3W6JB 1H9GA 1BR4A 3H3ZA 2DFFA 2FK1A 2P0AA 1DDNA 4UVBA 1FTZA 4XRMA 1XMXA 1MNDA 4XLHA 4LJZF 2V6CA 5HLGA 1FEXA 1ENHA 1U2WA 5EYRA 1Q1VA 3V8JA 3OHBA 2R7FA 3QYFA 3RJ0A 1B6AA 4L5JA 5LGNA 4GGGA 3PUFA 4MV8A 3V6KA 5KG1A 3KP6A 2HJWA 5BR8H 2EFQA 2Y75A 5B1BH 3HB9A 4RGUA 5KT2A 3G6XA 4KICA 1X3WB 3WGIA 3VEPA 3RIZA 2XCPA 1VQPI 2RQQA 2W6NA 2JA8G 4HG2A 2WE6A 4UUSB 2XIGA 1PDNC 2R7MA 4PGGA 3IWFA 1FIPA 2JEIA 2KDOA 4XORA 2NAZA 4J19A 3OYBA 4A3LG 2CUJA 2KKOA 3I3LA 1V5FA 1OYYA 2DMPA 1ZK8A 4I76A 4A0ZA 2H27A 5KT7A 4TQSA 1B04A 3DTEA 3I4NG 1Y39A 3OOUA 2XAHA 4ZDOA 2R8HA 3MR6A 2ZM6H 2RDJA 3SQNA 4A6EA 2NOJB 2DFHA 1T0FA 4MFEA 5KFMA 3M7GA 1R5HA 5HBRB 2DPIA 3E97A 1DPRA 4HQEA 2K9QA 2H94A 1S97A 4KHPH 1KU2A 4UY8I 1DV2A 4Y4RA 2BY1A 1YIOA 3C3WA 2ELJA 3H92A 4IKFA 4XYLB 1XTAA 2CFXA 2KLOA 3UQ8A 1CQTA 4PSXA 4X65H 2G7UA 2Y0MA 3AG2H 3BR3A 3JTHA 1BJZA 1EV7A 4NHJA 1SEUA 5J4YA 4RZQA 2R7ZJ 3TOAA 1Z2PX 1KJ8A 4PSWA 1CGPA 5F27A 3ULQB 3V6HA 3M8EA 4LFCH 3WTWC 2CQQA 2PMUA 2M7BA 1U8BA 3WE2A 2DYSH 5CKTA 3T1BA 4DUZH 1JT0A 1WCMG 4DZJA 2HVSA 1AKHA 4KMFA 4GRIA 2QKMB 2G0EA 2QLZA 3EETA 3ZRGA 2HYFA 2Z16A 1YW8A 2VA3A 3SDBA 1JT6A 5FLXW 3PW2A 3BCAA 2E19A 1VF9A 1NHAA 2D5VA 2NU6B 4LF5H 3PO2G 1X1CA 2M1BA 2NNYA 3QU6A 3CJRB 1G3SA 3ZP5A 4UFZA 1ZHSA 1EYZA 1TWHA 2WY8Q 3HSFA 3BLYA 3DLAA 2MA3A 3PO3G 1TP4A 2HGCA 1LE8A 2NNNA 1A04A 2VUMA 2LOOA 3GTOJ 4C3IJ 3L2PA 4A12A 2LKXA 2R6FA 3I12A 3GFJA 4AIKA 4CO8A 4RM2A 1WKMA 4ECYA 3RAQA 3DV8A 3LMLA 2FBIA 2XB0X 4EJOA 3PVXA 1Y1VJ 2XVCA 4YFKF 5F9LA 4I98B 5DUKA 1LVKA 2ASLA 3RZDJ 2H6CA 2Q8KA 1O3TA 1B59A 4Q45A 1XSVA 3E6BA 1JTYA 2E5NA 4OWRB 1MDMB 3K5HA 4EBEA 3SEQA 4UCUA 3WHBA 2BR0A 2JUCA 5J1UA 3KYCB 4G6TB 2GA2A 1S8NA 2HTSA 1TWFA 1M0TA 4ZQIA 2BBYA 1S29A 2Y30A 1LDJA 2R7DA 2CV2A 3M9MB 4MFDA 4YEJA 2CJJA 1FPQA 1EH7A 2PMZN 1T0FC 4LG0A 3ZQ7A 1HDDC 3HBLA 1RIOH 3L2WA 2IS6A 5DCMA 2V9WA 2ZXWH 2BV6A 4AD9A 3CMEI 2NUAB 4FS2A 2PMZA 4O6JA 2YU9J 4CC5A 1S5LC 2FMYA 5EWEA 2XPUA 4W97A 1TA8A 3NGDA 1ZELA 4DR3H 4A3FG 3LA3A 5TRDA 4XL9A 5HS9A 4IRIA 3PIOF 4ZH4F 1V51A 3DEEA 3FIWA 3MWMA 4XLCA 4EJWA 2Y69H 1KU7A 4IWXA 2YZNA 4ECUA 4RM3A 2VBZA 4YELA 2BE5F 2DXIA 1UELB 3WTSC 1GV5A 4DV6H 3GLKA 4KIGA 5KFFA 3DP7A 4I0AA 4CYCB 2WTFA 1T08B 1R9TA 4RGXA 5BNGA 1K78B 5LYJF 2K40A 1LFBA 5IYZF 1MNEA 1RESA 3VB2A 3A01B 2E5LH 3KZZA 5BQTA 5LXTF 5C5JA 3V8KA 4DQ2A 2KP6A 3IHUA 4A3MG 3K4JA 4JI6H 3DU5A 3HHHA 3LSKA 4EEFG 2CYYA 2FNAA 1W36D 2DA7A 4XICA 3ETJA 3RTXA 4PJMA 3LL7A 3FKIJ 3JRXA 4U0WA 2P7VB 1HQCA 2DT6A 5L1LA 5DLFA 4IX7A 2LKSA 1I3AA 1ZN2A 3DU6A 4HX4A 3WTUC 5GPAA 1Z7LA 4A3JJ 3RF2A 4IJAA 3HOXG 3E6DA 4KNYA 2HQAA 3D0SA 4YQWA 4B3TH 2V9PA 2ZDQA 4ZDPA 3BR0A 1Y8RB 5IYCG 1WCMA 4Z6YA 3W6VA 3GTJA 3FF5A 4NXMH 1WFXA 4FE4A 3RCOA 4MV3A 1W36C 3MZYA 1OCTC 1DIKA 4I99C 4LIVA 2KT0A 4LLLA 2FK3A 1IBKH 1MKMA 2R7SA 1VQMI 4NC8A 1OYWA 3G4SI 1KGSA 3RV4A 1JXLA 3CMAI 1QNTA 2B9SA 1EF4A 4HF2A 2QBYA 4H0EA 3SI8A 4G6QA 3KP3A 4HF0A 2Z1DA 3JRCA 1K1SA 1FMWA 4DLKA 1T8IA 2R0QC 1BI0A 1WJFA 2A6EF 4CXFA 1AOYA 4QTRA 4XLAA 1YFHA 1XNRH 5E1XA 1XGOA 4C9YA 4ZC3A 1SFOJ 9ANTA 3FXQA 4MEYF 5D4SA 2HQ5A 2K02A 3CCEI 3RGZA 5DDGA 1R4NB 4E7KA 1VQOI 1ZRCA 4N9IA 2EV5A 5KFEA 1WI9A 5DG8A 2IGKA 4AVPA 1S7OA 3H0DA 1IW7F 1K4TA 1V9PA 1BI1A 4DL4A 3QOPA 2VOBA 3KEYA 3OSGA 1W96A 3VOEA 2L7ZA 2DLLA 2YRWA 4G94A 4NB5A 5E18F 1OPCA 3ZXSA 2BOLA 4NDLA 3ZQFA 3FXKA 4TV7A 2LBFB 4E7IA 2XD4A 4GKJH 3M4IA 2ZKZA 4HX8A 3CF2A 3T5KA 4UV8A 3BQ0A 3Q8QB 3H5RA 3MN2A 4DV1H 3J80Z 5FGMA 2F48A 3FXMA 3Q0VA 4WXDA 5KFCA 3F8BA 4ASNA 3IH2A 1IRXA 1D5YA 1ETWA 2PN1A 3CCUI 4LB5A 1N75A 1RYSA 1B6SA 1KYZA 5KFWA 2V58A 3OSFA 3IH4A 1BOBA 3GTLJ 1PUFA 2CSOA 2X1EA 3BR2A 1MJBA 3DWLE 5L3EA 2DQRA 5GAEJ 3DBLB 2Z33A 1I7LA 3RPUD 2C35B 4HYKA 1U5TB 3RB0A 2BQUA 5AIQA 2W1OA 1IUYA 1DPUA 4HZFA 2JK3A 3CUOA 1LUJB 4E6KG 2CW8A 4JI8H 2C00A 1U3EM 3G1LA 4D5FA 2DOAA 3KEOA 2WYOA 4A2AA 4CGZA 1D8KA 3A0HC 2ZFUA 2R87A 4MV9A 3GTPJ 2I10A 3BA8A 3DCFA 2NRAC 1STZA 1XS9A 3HTUA 5BPHA 1D0ZA 1RK5A 2G9WA 4BDZA 2AQFA 5J2UF 3TINA 4J01A 4HW0A 3MR5A 4UB8C 5D1OB 1R4MB 4FBTA 3GWZA 4N4OB 2VN2A 3ASOH 4BQNA 1BGWA 2M4KA 1U8RA 3QOEA 4UCOA 1I94H 4EGJA 2DN0A 2QVOA 2DWCA 1P7IA 3P5JA 3V7CA 4IHVA 4I01A 3WO0A 4BBRG 4GCVA 4ECRA 4G7ZF 2RF4A 5H6RA 2GZWA 2J6SA 3FXRA 3BY6A 3FK7A 3G3ZA 1IRGA 4TUYF 4IRKA 3V4GA 3BPVA 1DGWY 2P6TA 4KYWA 3WGHA 5HVQC 4O2BF 1AHDP 3CO6C 3GIDA 2LG4A 4C30A 2VPSA 1I6UA 3OYCA 4BKXA 4AIJA 3SDGA 1RRJA 4BWSC 4JQFA 1N77A 5TISC 1POGA 2P0WA 4F91B 2R7ZA 1ON2A 2Y9YA 3F8NA 3GMEA 2OTJI 3HOZG 4BY1G 3AAFA 4EEYA 2HGSA 3FMQA 2W7OA 4X0GA 1YX5A 2ETHA 1E4FT 4ETSA 4A93G 2JA5G 3VPDA 1MBGA 2CO5A 4M6XA 3TL4X 1N32H 1XX5A 1IXCA 1GXQA 1JTXA 2VODA 1OISA 4XKCA 1JJ6C 3Q8RB 5IP7J 1IXSB 4F4XA 1V3FA 5GAHJ 3JTGA 3FM5A 1Z21A 3H0GJ 3L09A 4YRVA 1VQ7I 4UCSA 4QWEA 4JI7H 1IF1A 2C2EA 2LKPA 3HJEA 3WE3A 1VTNC 3RV3A 2DLNA 4IEJA 4CH7A 1GO3E 2DMQA 3K4BA 1APLC 2KZVA 4B3SH 2L54A 2VIXA 3IRRA 1ZQ3P 2GLTA 3BG3A 1ZHQA 4HA8A 2HVQA 2W84A 3EUKL 5KAFC 3LSRA 1VQ9I 4K0KH 3WTVC 3W2AA 2DK8A 5L3FA 3CUQA 4RDUA 3HOUJ 2XB5A 2JZYA 5IOYA 5LGUA 4MIMA 3WG9A 3GTOA 4XOTA 2FP4B 2A68F 2EFWA 2L3DA 1F4KA 1FNNA 2WAQN 3H9QA 4PGHA 1B6RA 5DGBA 3I9V2 1K4SA 1Y1VA 2JUGA 3J7AK 2OU2A 5DYMA 2QQ9A 3JSNA 4LOCA 4CDGA 4NLGA 2CGPA 5AIPA 1L0OC 2KIUA 1F1ZA 2WAQA 3MJFA 4U0VA 3R5XA 2B0LA 4MQ9F 2GLOA 4AYBN 1I50J 2ATLA 1IXRC 4DYCA 4BE1A 1SAUA 2PFBA 4UB6C 1RJQA 3REOA 1VQ6I 1MMSA 5IWAH 2M87A 3JW4A 2EIMH 3OYLA 2HEOA 2W9AA 1YQAA 4AYBA 3OYGA 3LSJA 4BJ6C 3TIIA 4JX4A 1R22A 2JSPA 2EIJH 4AM3A 1LB2A 1Y6IA 1JE8A 1Z2NX 1N48A 4O3SA 1UZCA 2ZSIB 3RSNA 1WZ2A 5CB4F 4A3BJ 1TW2A 3MFKA 5E8IA 3GFIA 3K5IA 2O9LA 3MD2A 4A2BA 2ZNYA 2F4MB 3OYMA 2YU9A 2RVCA 2VT3A 5DEQA 1RETA 3FM3A 1SMYF 4K2EA 3CCQI 4JV5H 2CKZB 2VBYA 3ECHA 5KFIA 3OMYA 4E7SA 4KA4A 2UXDH 4D7NA 3TOBA 2YZGA 2DA5A 4F93B 4HF1A 3BQ1A 1G3TA 2EA4A 3FXUA 4F92B 3ISPA 1K6OA 3QWLA 2M05A 2OZ6A 2NU9B 2B63G 4JI4H 2ACJA 2NVQJ 3KALA 2GIZA 2LY1A 3NQOA 5HDNA 2QSGX 5EG0A 5FFXA 2A5YB 3ZR8X 1H88C 1BW5A 2J9GA 3E1SA 3S2WA 3SFZA 2R92G 1JUMA 4A2UA 4XMYA 2DW4A 3UNGC 1FBSA 2M30A 2AGPA 3MKWB 5KHDA 4ENMA 1Y1WJ 2VT2A 2UXBH 2AU0A 4MV1A 3AFHA 5KG7A 3BT9A 2DA1A 1P9QC 2FQ3A 4HLXA 1B1BA 4MTDA 5ICEA 2Q2TA 2FBHA 2ADUA 2V1XA 1YJNI 2M3AA 4QWCA 3X2QH 1BJTA 3LWBA 4CCMA 4KISA 3HTSB 5IP9G 4RB2C 3T1YH 3A03A 1FTTA 4NUBA 1U9NA 3FKIA 2V4RA 3EPGA 2CMPA 2MABA 1YO5C 5FKLA 4YY3H 1FY7A 1O7FA 3PQJA 3BABA 2YW2A 3GZ5A 4M3EA 2A3SA 5M3FJ 1JKJB 2W6ZA 2GA1A 2CQNA 2OUMA 3K4CA 2JT1A 2KJBA 2F5VA 2YX7A 4X1EA 2ASDA 2RGRA 3GW2A 3K4MA 1MMGA 1XCBA 1V5GA 2F2EA 4V2GA 1GDTA 1KU3A 4AVZA 5J1YA 4IOAF 3BG7A 3CLQA 1SD6A 3FMSA 2JA7J 2R93G 4ED7A 3I54A 2OF7A 2HZDA 2VI6A 4GYGA 1B72B 2DMNA 2VJ5A 1PK8A 3LA2A 3BTIA 4EQQA 4ECVA 1QZEA 3SFIA 1RPWA 3T5XA 5LRSA 2DTZA 2V26A 4OIRF 3ZGKA 2PG4A 1FKAH 2UU9H 1OCRH 2DA2A 2ESNA 4RB1A 4ED8A 2Z2SB 2FU4A 2GQQA 4L9NA 5LL6b 3SHFA 1ZG3A 2PX9A 3JRWA 1TW3A 3NWSA 1S72I 3RKWA 2X51A 3GCMA 2E35A 5FLXK 3E7LA 4BXXJ 2GXGA 3H1CA 4YR2A 2WV0A 2UXXA 3FDYA 5ICGA 1ETXA 1SVOA 2Z99A 3HIFA 3PNVA 5FD5A 1WJ5A 1NTCA 2HYGD 2K5CA 1O7LA 1UMQA 1W7PB 1J75A 3PM1A 4LIUA 2VB6A 5E17F 2VPQA 5LHIA 1FWZA 2JSCA 4WCGA 3FHZA 3LP8A 2A6HF 5K5OA 2F5CA 3O3KA 3G1MA 4C2UA 1SFUA 1Y56A 2VJJA 3CESA 3I0TA 2HOTA 3C1DA 1EHIA 3Q1KA 5FJ8J 2G7HA 3E0JB 3KP2A 2IT0A 2W24A 3I4MJ 2IS2A 1JKQC 4PCQA 4YIRX 3ORQA 3QZ8A 2EZLA 1MDMA 2MH2A 4BEHB 4O3OA 3GV5B 3TMOA 2DMTA 2FD5A 1MGTA 3BTLA 5KFNA 1SVLA 3TGNA 2LD5A 4FT8A 1QPIA 3IL2A 4MQVA 1T33A 3N97A 3GTLA 3K10A 4E7ZA 4V19K 3I71A 3M8JA 1X2NA 2WADA 3VFZA 2E7WA 4EGQA 4EBDA 1ZTRA 1QO0D 4X6AJ 5D5WB 2FNPA 5GADJ 3JREA 1ZGWA 4ED6A 4DR6H 4Q48A 1I39A 4LMYA 1O3QA 5F0FA 2XCAA 2HYJA 2R8GA 2NXNB 3N43B 5FPRA 2LRDA 1FYKA 3BA9A 1J5YA 2WAQE 2ZMEB 2JPCA 1LJ9A 1I6HJ 2TCTA 5K7FA 3VPCA 2WDTA 1N36H 2OD5A 2PEXA 4EEQA 3DF8A 2L7FP 4ENNA 1YG2A 3ABTA 4NC6A 4RB3C 3KXYT 1KU9A 3M9NB 1BJAA 2FPPB 3RBDA 3JSLA 1KA8A 4AYBE 5FKKA 2XAUA 4GYIA 4QWQA 1VZ0A 3OY9A 4E7JA 4I2OA 4JYAH 4EFBA 1TWCJ 4BS9A 5HDKA 1WHUA 2R7RA 5J6XA 3QYEA 1K78A 3BQ2A 2VUMG 4BY7G 3JRFA 4MGRA 1WJBA 2W85A 2C6YA 2CWEA 2NVTJ 1FP1D 2DT7B 2RC4A 2L9VA 4I6ZA 3L1PA 2HOSA 4HYEA 3ZQLA 2XUBA 3R60A 2QQ8A 2EZKA 3CCYA 3ZPLA 2DDBA 4I50F 4QWAA 3S14J 1RUOA 2IMWP 4MO7A 3S2DJ 4NQWB 3F8FA 5JVGF 3QRFF 2LLKA 4ME6A 2AO9A 2CQYA 2NS0A 3RYPA 3S16J 3PSIA 4ZZDA 4U7BA 4MLOA 4FU0A 4JV0A 4J0MA 3PFIA 4C2MJ 5JLXA 2R82A 2VUGA 5KFGA 2LREA 2DI3A 5IYBG 2ZJPF 1R58A 1HC8A 1IBMH 1VS0A 3AL0C 3H0GA 4TQRA 4O3PA 1WWXA 1G3WA 1G6NA 1MJAA 2NS7A 1V54H 4MNUA 3OYKA 2HDCA 3HZJA 2YX4A 1DGSA 5BMVF 5IYDJ 1Y14B 3KP7A 3TKYA 3RZOJ 1DUXC 1ZH5A 3GTQJ 4G3IA 4ED2A 2LTPA 2XPWA 5EEAA 4PK4A 4LFUA 4GC7A 1HOMA 1G2HA 3LAPA 2D1VA 2K86A 4EFEA 5GP9A 1S10A 1IGNA 1SFXA 3IUOA 3FXJA 5J8CA 1XB4A 5IPAA 1W5CC 2H09A 1LQ1A 2PBIA 4H4KC 5FRNA 1TAEA 4JV2A 2FBKA 3JRBA 4Z2YA 3JZIA 4U7CA 4XLPF 1B8IA 3JRHA 3OL4A 2VKHA 2AXTC 4XBFA 1V4YA 2KMUA 2EQRA 4LG3A 4FQGA 5EZYF 2GAUA 5EF6A 2XRNA 2O8KA 4A3IJ 2R3SA 4P96A 1HXDA 2JPBA 1GT0C 1SANA 1HKTA 5D5XB 4DV3H 5C3EJ 1ZLJA 3L2VA 2R5ZB 4BQOA 1B33N 1I50A 1RJRA 2EILH 2LBFA 1EA3A 3KCCA 4J00A 4OIPF 3GTMJ 2PQ8A 3CCJI 3TQTA 3TP3A 2HQNA 1S0OA 2LVSA 4ZYGA 2E1MB 4EGZA 3N8DA 5L3CA 2QEXI 2ISZA 2L4MA 4M3BA 1PUEE 1YJWI 1GGOA 2YCHA 3OHAA 2XGPA 4GLXA 2VQDA 3DBRB 4D9JA 5GAGJ 2DA6A 4DV2H 3S32A 2CQKA 1E17A 3RKXA 5FB2A 5C4XG 3GX4X 2EBIA 1ZRDA 4KUMA 1U5TA 2Q2EB 4N0BA 1EH6A 1KJ9A 1ZQ7A 4HV5A 4R1HA 2ZJRF 2M4GA 1IN8A 1JUSA 1AWCA 1X19A 1EUCB 2YS7A 5FLXZ 2VOOA 2JWTA 1ZARA 2QYZA 2FLPA 5DQGA 4YP3A 4XM3A 2BW3A 1TT0A 3F0CA 1NG7A 1GLNA 3ERMA 4QPOA 3TDZC 4DNCA 3IAS2 1KJJA 3SE7A 4N9HA 1NH3A 3L00A 2LF8A 4HPQA 2I8DA 2JMWA 4BHPA 1YTYA 1ETVA 3BQZA 4Y8VB 3TDUC 1Y1WA 1ULZA 2LK2A 2QQBA 3K2AA 3CCLI 5D1OA 5LEJA 5EEGA 5CAEB 5KVRA 3HOVJ 3K1PA 5FKNA 2FXAA 1R1VA 3HPHA 2J6UA 4BHCA 1RR8C 4JUZA 1H9TA 2GM4A 3T5JA 5DS9A 1RUNA 5K5QA 4DV5H 4F52A 1HR0H 3T1HH 1KBLA 5HLHA 4LK0F 2ZFWA 3G6YA 2HTJA 1R00A 2H6BA 3CJTB 2FB9A 2EWNA 3EDPA 1TZLA 1P6RA 3UFXB 3VPRA 2R7XA 2MBFA 2L01A 2VBXA 3HG9A 4IRHA 4DZPA 2LDUA 3S93A 3VYSB 2XPVA 1ZAOA 5D8LB 4DUYH 1OQYA 4O3RA 5ILVA 4UCVA 3S3OA 2CQ7A 3FK6A 3Q8SB 2VKEA 2ME6A 2A5WA 2RKHA 1VQLI 4Y13A 2A61A 3MZHA 5KFBA 3L4KA 2ISYA 5KFJA 1AU7A 1RNLA 1R1UA 2X6XA 4BBSJ 2HU9A 5KFVA 1F36A 1QHHD 3M1EA 3E6CC 5JVDF 3H3VH 3W6KB 4BDYA 3ZMVA 1NK2P 1Z3YA 4CCKA 2STTA 3K4KA 3V8LA 3U2RA 4FASD 2R7KA 2UZKA 5EGOB 4LSXA 2YPRA 4DL7A 4ESBA 1W1WE 2F4VH 5JI6A 4CC6A 2VXZA 2DQLA 2MH9A 3OL3A 2FMAA 3I59B 5DD8A 5ERIA 4ED1A 1OJLA 3CP8A 3GILA 5KFZA 4L9JA 4F7ZA 4DYRA 2UUCH 1KQ8A 2VQLA 4QWBA 3LWFA 4DL3A 2IP4A 3CMMA 2CG4A 4BYYA 2F4OB 3BDDA 3HRTA 4M74A 2IP2A 3HGYA 3PW5A 1EKEA 3BTJA 3A4CA 3T0YA 1ETKA 4JI5H 3ZOBA 2HI3A 4HEA2 2DDAA 2DOEA 4J9QA 4A5MA 4QIWN 2FJ1A 4LFBH 4DIQA 4RAFA 4LH7A 4CCLA 4E7LA 2W70A 4UVAA 3CO7C 2LP0A 5LLQA 1YHQI 3BR1A 3KAJA 3GTGJ 3OV8A 5JQWA 1WJEA 4XNFA 3LSPA 3L4JA 1DGRM 4C3JJ 1ZYRF 1X4PA 3OYHA 3LA7A 3R5FA 2YS6A 4QIWA 5KFKA 3OYDA 2W9CA 2FLLA 2UVUA 3EQLF 2R7NA 1J2XA 5H2FC 3RJPA 1QPMA 1ORKA 5IT9W 3EPIA 4IR9A 3JAMZ 4A0YA 2AS5F 5FLVA 1FP2A 2LMDA 1Z2OX 3FZVA 4M3FA 3GFMA 2P81A 1R1TA 2E7XA 1Z67A 4PJJA 3JSOA 4L5IA 1VI0A 3KHHA 2R7ZG 5HDGA 4XSZF 4Q5SF 1FOXA 5HLIA 3EYIA 1V4RA 5T14A 1WRJA 2V9VA 2ZDHA 3DKWA 3F22A 1MBKA 4ABZA 3K70D 1TBXA 1UHWA 2QUFA 2A6TA 2FA5A 2NVYJ 3ORRA 1Y0UA 1HSTA 3BZ6A 3TEDA 3V4SA 2ID6A 3IN5A 4IR1A 2WB1A 5F0HA 1ZG5A 2Q1ZB 2JEGA 2FPIB 2J5PA 4F4WA 1MZBA 3RKQA 5HNFA 2NU7B 1LVAA 3ML6A 5BPIA 3E6MA 1TQIA 4B3AA 2RGVA 4KJZA 4B43A 4Q44A 3NRVA 3Q9SA 4FE7A 3OYNA 2K9LA 3K70C 3Q2OA 3RTRA 3HOYJ 5GTIC 5LMUH 5TGTA 1GHCA 2XGDA 1X3ZB 2V4QA 3FISA 2P6SA 4EM0B 1BL0A 2VASA 2V1UA 1VKZA 2R7TA 3HC7A 2KIQA 1LEBA 2VJ4A 3J7YJ 1D1BA 4EJVA 1FYLA 2F5DA 1QBJA 2IA1A 3S3NA 1UCRA 2VE8A 2WAFA 3FHNA 1Y1VG 2VQFH 5JHUA 4MV4A 2V5AA 2OAZA 1A6QA 5FKOA 2XAFA 4YG2F 2W9BB 4PDKA 4JI3H 5KNLA 4MEXF 2W4SA 5E3NA 4IHTA 1H89C 4FETA 4R79A 5J8FA 1CQJB 4XX0B 4HDUA 5CA0F 4M9SA 5KT3A 1O4XA 1AN7A 3MCZA 4A3KJ 1QHGA 4IZZA 4OIOF 5F1RA 4JP0A 1XD7A 2HVRA 3M3YJ 3O6BB 3E5QA 2KHMA 3OS2A 4ESJA 3LSTA 4JX5A 5LRRA 3H5NA 2H1KA 2QK4A 4JBAA 4DYQA 1J5EH 5E3MA 4CCNA 3IKTA 4UCRA 2UVVA 1B72A 2FLNA 1MMDA 3ASNH 4ENJA 1BBYA 3F23A 2R85A 4A6DA 5KT4A 2VOPA 5HS8A 3V6JA 1IO2A 3M07A 3J80W 2HNHA 3GTQA 2H8RA 1IRZA 3GVAA 5HS7A 3W2WA 3IH3A 2EV6A 2DO7A 4CCOA 1HA8A 2XGCA 1DV1A 4XZ3B 2HHHH 3G6EI 2KDZA 2I5UA 2BQ3A 1HNWH 2JVHA 4P9UA 1KJQA 2IS4A 4A3EJ 1FVIA 4WX9A 1A36A 4EATA 3FKJA 3KZIC 1R49A 2O8XA 2JA6J 5A2QW 1GYFA 3J81W 1Y8QB 1KEEA 5KCMA 3KFWX 1W7PA 4DL2A 4BACA 2V1DA 5KFYA 1XN7A 1WJDA 3B6AA 4LF8H 1MBEA 3F8MA 4X64H 3I55I 3KTMA 1Z0XA 2VQCA 4KIBA 5JUMA 5B3SH 4U87A 3QPHA 4OAZA 4Q43A 2R8JA 5J40A 2WTEA 4MHGA 2BYVE 1A5JA 3GTMA 3K1MA 2L4AA 2R8IA 4G9YA 5FPOA 4PJLA 1CS0A 3I58A 5D6EA 1QGPA 1IUFA 2CS3A 4HQMA 3N6XA 3LOCA 3VODA 4BEHA 3BWGA 1IOWA 3UR3C 1KQ9A 1W4MA 1LDDA 5C44J 3FKIG 4XIDA 3A1YA 5JVTA 4ZTJA 1RKWA 4XLFA 3LFKA 1MSFC 4A3JG 1UB9A 3Q3SA 4DL5A 1T56A 1FJGH 2MW8A 3KHGA 3OR2C 3FXLA 3H9GA 3VMMA 1Y0NA 4XRSA 3N42B 2K9MA 1AA7A 1X58A 2BQRA 1JKRC 3U21A 3C7JA 3MFHA 2CFOA 1MH3A 2HPIA 3PL8A 1ZG1A 2UWMA 2L5QA 4TV8F 3N44B 3TP0A 4QIWE 3BG5A 2X85A 2AHQA 4EJUA 2L2OA 2HR3A 2HS5A 3IKVA 2JRTA 2GXBA 1N78A 3CDLA 3ZCOA 1JLLB 2AGOA 3C2BA 2CU7A 1YS7A 2W25A 4WD3A 5CYVA 2QQAA 1X3UA 3R61A 4NXNH 3U9GA 2NOGA 2E2JJ 3HL2A 3GXOA 2QKLB 2KIFA 2KL4A 3PUBA 4HLYA 2EK5A 2KFDA 2XDVA 4LG0B 1UHSA 5F64A 5C8YF 3RGXA 2XAJA 2QSFX 2D2WA 3RIRA 3EUHA 3EUAA 3WTTC 4M9UA 3T5HA 5E79C 3K9TA 4DL6A 2W82A 3GO5A 1SC7A 3Q8PB 2IVMA 3EYYA 3HRSA 4U88A 5E3LA 4MV6A 5ILUA 4HQ6A 4UHTA 2FMLA 2WBMA 1WGXA 5DCFA 4BE2A 2ALZA 2XF6A 4DR2H 2V9KA 3H20A 1XGNA 1U6GA 4ECSA 4C5CA 3OYIA 1IBLH 4RS8A 3RB6A 2WB1E 4HNVA 2W48A 1FBQA 3TW6A 4XYMB 2VC0A 2E36A 2EA2A 2IGMA 2R7LA 2X1CA 3PZPA 2ECBA 4AQYH 1XMQH 3W3CA 2JEFA 4RAZA 2HXIA 3ZQGA 3P7NA 5LFAA 1X1AA 1S68A 2HFHA 4ZTFA 2Z5UA 2XASA 2V59A 3BG9A 2IA2A 2DAOA 4MA0A 1BNCA 5M5XJ 2PI0A 2Y2ZA 3ZMSA 4EYIB 2PJRA 3K3VA 1KZHA 1IN5A 4YHHH 2XRLA 4ESFA 1PX2A 2O7OA 1I1GA 1TLHB 2XC7A 3SJMA 1A6IA 2DIKA 1WI3A 5CJ9A 3KLOA 4JV1A 2E1OA 4CSWA 3PR4A 2KRCA 2WC2A 1YOVB 2X4HA 1IOVA 2STWA 2XAQA 2XSJC 4NC7A 2O0YA 3TW7A 1Z6RA 1EJ9A 4A3DJ 4M9XA 3VYRB 4G8XA 2BZTA 4UUVA 1AUVA 1WH2A 3GIIA 4Q4ZF 3BP8A 4U7DA 5B1AH 3K0LA 3T5LA 1WPKA 3F8CA 4OMZA 4CZCA 5JH7F 4Q0YA 2DT5A 4UUSA 1D1AA 1MSEC 2EFPA 4OU0A 2CUEA 1QU3A 3GTGA 2ZCWA 2IJLA 3CP2A 2QBYB 3ZMDA 4OX9H 4PZJA 4EMSA 5DLGA 1K83J 5J4VA 4RU9A 3GIMA 1MBFA 2GIVA 3MEXA 2DOFA 1P8LA 4V2FA 2XGEA 2YUSA 4A3GJ 1OWTA 5EDWA 4Q47A 4FS1A 3CUQC 4P9FA 4AUXA 2X48A 2VQHA 5D8DA 3P9IA 3SZGA 1FX7A 3EUHC 3RFCA 2XF7A 4FCYA 3L7WA 2LYCA 3BPXA 2IBDA 2NVXJ 3HGGA 3ETHA 1V55H 4A3CJ 4APMA 3WGGA 1UC8A 4WWCA 3BJ6A 3GTKJ 5FLMJ 4RZRA 2OZUA 2IA0A 1JHFA 2FE3A 4ITVA 2Y48A 4MTEA 3GQCA 3GZNB 3FMAA 2OWOA 1YRNB 1OLTA 4YIFA 4JYKA 3PW7A 5DUIA 3JCUC 5KFAA 5DQIA 5HNHA 2Y31A 3BJAA 1TTYA 4ECQA 3KYDB 2KZGA 4ZOLF 4ECTA 4JX6A 5IP7G 2FUG2 2OPTA 4Y7NJ 2D45A 3HOWJ 2NVYA 1SD7A 2YRXA 3H0GG 1BN5A 4II3A 4ZJZA 3QQAA 2IAIA 4EBCA 4UUTA 5KAIC 3KEQA 5ILSA 1TT5B 5KFRA 1A35A 3OS1A 1YW9A 2N8GA 3LNQA 4DBRA 4FM9A 5EZGA 2F4IA 3CTAA 1FMVA 2W8LA 3HEFA 5FO5A 3GIQA 4CHUA 2KRHA 1SFOA 1HSJA 2NYXA 1YLFA 4NNJA 3T8TA 2DTRA 1VQ8I 4LH6A 1S03G 3BR5A 4S0HB 4HAMA 3HOUG 1H8AC 1F9NA 1S9HA 2HDWA 3ZN1A 4MAMA 2MC3A 2NU8B 2XC9A 4IRCA 5L3DA 1QQIA 4RBOA 3L2QA 5M5WJ 2MGQA 2E2IJ 4UV9A 3OUUA 3FMRA 4ZYEA 2R5YB 2YL2A 5FROA 2IEKA 1L3LA 3ROUA 1OCZH 1GVDA 3ECOA 4WK8F 4QW8A 1IN6A 4F4YA 4JK1X 1D0YA 3LSHA 5M3MJ 3TO9A 3CCSI 4M3DA 4IOCF 3GV7B 3HSRA 4JI2H 5IY5H 2LF7A 4YR0A 1JKOC 3LSIA 4EYHB 1Q1HA 4Y3OA 2JA8J 3O2PE 2DZDA 3HKZE 2GWRA 2R8KA 3R4KA 2Y0SN 1K79A 4RNOA 4A3LJ 3KETA 3S2HJ 2XGQA 2J6TA 3I4NJ 1JUPA 2P8TA 2YSRA 4DOZA 1I5ZA 2PVPA 2ZJ2A 3MKLA 5FKMA 4PDBA 2OCCH 1D5VA 3V4ZA 1Z1DA 1E2XA 3I64A 2OJED 1V5EA 3OYFA 2XGXA 2EV0A 2Y0SA 1VBHA 4I7HA 4B3RH 1W5TA 1XGMA 3DQVC 1OCOH 3RQ4A 4XSXF 1IN4A 4IO9F 4A3BG 1KJIA 2WY7Q 4J9PA 3LQQA 4Y52J 3R0JA 3AG3H 4E7HA 1PP8F 1M0WA 1MMAA 1GXPA 1FT9A 4J9OA 2QA4I 4ED3A 4YB8B 1USTA 4KT6A 4L0ZB 1QZZA 3OOPA 2VA2A 3I59A 4XN3A 3GTPA 4A5NA 1P2FA 2VKDA 3COAC 1S0MA 4M6VA 1GUUA 4LD5A 4LFAH 3RDIA 4BJ5C 1IC8A 2HPMA 2JA6A 1SAXA 5L1JA 2CQXA 4B8XA 2JJ7A 1QVUA 2BGCA 1WCMJ 4XKWA 5EDNA 2VQEH 2F6CA 3P9KA 4CYCA 3VWBA 4BGDA 5EWGA 4GC6A 3BC8A 3L2CA 1MW7A 5LHGA 3C0FB 3A01A 1Y1WG 5L3GA 1SEIA 2M0CA 4ZYHA 3QZ7A 3PO2J 3OSPA 3PN1A 1ETQA 3PFYA 2MG4A 3CD6I 4HSRA 4A0XA 4IRGA 2E60A 4BXUA 1YI2I 1VBGA 1UFMA 2EZIA 3G6VA 4Y15A 3VYTB 4XK4A 3PO3J 1I3QJ 2VXDA 3WU0A 4J9RA 5AONA 2IGNA 3ONQA 2MD5A 3OWTA 4DR5H 2IRFG 2RV8A 3ZQIA 5EOYA 2ZJTA 3WNZA 3RUPA 2SCUB 2ASJA 1XDNA 2OV7A 5JVLA 5KG3A 5IT9K 5KT6A 1TQMA 1DU6A 3F6VA 4I0BA 4LLNA 5C44G 1WQ2A 3VSKA 2VONA 4C5BA 2JA7G 2TDXA 5CQGA 3Q9VA 5KG5A 3R6SA 2MD0A 3A0BC 1NK3P 1OMIA 2DFIA 3KP5A 3VSLA 4AWXB 4E70A 4IRDA 1HKQA 1MMNA 1SVMA 1YYVA 2HOEA 2RNGA 4HOBA 4AIHA 2W7NA 2KIMA 1C3OA 2IA6A 4L9VA 5LP6F 3BROA 3N05A 2M8EA 1TWAJ 2ECCA 2ZBKA 1E3HA 1DU0A 1EZ1A 3J7AO 5LD2C 2DODA 4YJ3F 4M3GA 4BXXG 1FOWA 3N41B 1ETOA 1USSA 2V6EA 2VR1A 4BE0A 4G7OF 1Z7UA 1JI8A 3FWEA 3IC7A 1VQKI 1R5ID 3DTIA 3RPQA 2I80A 3ABKH 4CA0A 2O03A 3JSPA 2M5WA 3H3UA 4A3FJ 2FQ4A 3BJYA 4QW9A 1SD5A 1P7JA 1H0MA 4RLQA 3HOSA 4ZYAA 2XCLA 2ELKA 5F6FA 2V4JC 4HNTA 1VFCA 2CZGA 1BC7C 4IQJA 3MKYB 2R7UA 1N33H 3OIQA 5EJCA 1P4WA 2FEZA 2M2EA 3DXJF 4FHTA 4II2A 5EG0B 5FJ8G 4RUCA 2W9BA 5EWFA 5C4JJ 2AGQA 5CVUA 3I4MG 1T36A 1OCPA 4EM2A 4DBQA 1J0RA 1YJ9I 1XDUA 5B66C 2E2HJ 1RZ4A 2NS8A 4YR3A 1JIHA 2VPLA 1JGGA 2ZC2A 3OYJA 1XMAA 4HR7A 5KX5F 2CW7A 3PSFA 4F3QA 5J2TF 5CPRB 4A3MJ 1J09A 1S3JA 4YFXF 5CVRA 4DGWB 1K61A 1GSOA 2X6YA 4R8UB 2RDPA 2J5OA 5ICFA 4RGRA 3TQNA 1D1CA 1T98A 1E4EB 4DV4H 3JR9A 2O5RA 4XONA 4B48A 5DG9A 1X4OA 3WG7H 4OOIA 4XLEA 3PQKA 2CV0A 1F5TA 1TNSA 2FOWA 5KFQA 1CE8A 5F08A 4CCJA 1UJ8A 4GO1A 3JRDA 2K85A 1QZYA 3HOXJ 3Q5FA 1IN7A 3ZN0A 1OKRA 1Z3XA 1YS6A 1AUXA 2W8KA 2IBKA 5IYCJ 5DM7F 3J80K 1VQ5I 2GPWA 1S9FA 3HUGB 5CVIA 4EV0A 2PMHA 3MVPA 3U9TA 2ESHA 2W57A 3KP4A 4UXNA 5IP6A 3VDXA 1VQNI 2MLGA 2YYAA 2RAEA 2HXOA 2RN7A 2BY3A 2FK2A 4QLCU 3ZMUA 2Y0SE 2QF7A 2R86A 1XNQH 2MSYA 4HNUA 1Z6TA 1R71A 1K83A 4U0YA 1T95A 1ZKGA 1G3YA 2HKOA 1P4XA 2BVMA 2EJRA 5A2QK 1ZGAA 2PJPA 2P4WA 3J81K 4HDVA 3KHRA 4NBQA 3U9SA 3KZYA 2KJCA 2M34A 4LGWA 4L9TA 4Y17A 1B9NA 1D8JA 2C22A 4M73A 3ZQQA 1G4DA 4D0PA 1SYXB 1E3PA 3K1NA 5DV5A 1FYMA 3H9JA 1ON1A 4Q8FA 3RAXA 2R7OA 2NVXA 2M0MA 3QPLA 3WTZA 3A02A 1IG7A 1RR7A 4O4LF 2DPDA 5CVJA 3WHCA 2VLAA 1IRFA 1LFPA 4JOMA 4BHBA 3R23A 3GTKA 2BXZA 3TO7A 1JDEA 3ZMZA 4YFNF 3D1NI 4UNOA 1SFKA 3IG0A 2EPFA 3NARA 3GYHX 4RAYA 2JA7A 5HV6A 4TV9F 1UG2A 1O3RA 2BVLA 3DPUA 1BC8C 4LF9H 2M45A 3LMMA 4KT5C 3IRQA 3AL0B 2FKLA 2ICWG 2Z3YA 3QP5A 3BZCA 3TIGA 2M8GX 1P4AA 1MH4A 2UUZA 5LEKA 1ZLKA 2UVRA 4IPAA 1CQIB 2L02A 5IYDG 4FX4A 1BW6A 1M6VA 4CUGA 3CCRI 5L1IA 1M1EB 4RGSA 3HOTA 5LHHA 1A31A 3GZ6A 3ESWB 1IV6A 4BQAA 1UC9A 1MIJA 1I7NA 3WTYC 5BPFA 2AQ4A 5E20A 4S05A 3ZMTA 4JI1H 2HQRA 3CC7I 2HZTA 4FX0A 3CJQB 1HNXH 3V7SA 2BY0A 1UAAA 5LOVF 2E2IA 1WJAA 1U5TC 2A69F 3HM5A 1X1DA 2OC6A 3Q0UA 3GLLA 2OLSA 4IHXA 3WO1A 1JHHA 4DJAA 1UG0A 4A3IG 1FLIA 1RJPA 2RDIA 2DMUA 1Z05A 2JQ7A 3H40A 4LSAA 4RLFA 2BHZA 3O8HA 2XKPA 5C3EG 5DM6F 1RI7A 1RC9A 3RKYA 4ZDLA 1DQUA 3G73A 1CF7B 3CDIA 2M7AA 2DK5A 2KQRA 4YIIA 1FJLA 2OQGA 4ZI7F 1R7JA 5KT5A 5IT9Z 4M7EA 1R36A 3SXYA 1W93A 1HCRA 2Q0OA 1WJCA 2VBWA 3KE2A 2JEJA 4E4TA 2V7FA 2O3FA 3V7RA 4BBRJ 3RB4A 1REPC 5L9XA 1XCVA 3H5AA 4ON0A 3GBGA 2ZNZA 1TNTA 1FOYA 2EFNA 3PJRA 2QM3A 2ZDGA 4O3MA 2IXSA 2CUZA 2PBZA 3NAUA 2FOKA 1GLVA 2E1NA 4YAKB 4EGYA 2WB1N 4XRSG 3JAMW 3QYBA 1ZR4A 3D5RC 2X6WA 4L1KA 4PJ0C 1RYRA 2EB7A 4AC0A 1Z91A 3DTKA 3J7ZI 3JRAA 3QU3A 5BMZA 3HOZJ 4ECXA 4BY1J 4IHWA 2D1HA 3CVZA 4A93J 1ONVA 2JA5J 3G1OA 1XDSA 2K9NA 5E3OA 1PVEA 2JRMA 2QCOA 3WTXC 2WA0A 4XOPA 3RPUA 1SFEA 4DR7H 1TWCA 4UCTA 3MKZA 1M7JA 2R7WA 4I02A 1G59A 4P5OA 1HW2A 1E4GT 3C18A 3RQIA 2KRFA 5KFSA 4L0YB 3HOVG 1BI3A 5CA1F 2DBBA 2X9DA 4B1RA 2COMA 3AG4H 1XPXA 1T39A 3MQ0A 1HW5A 2R84A 2VL8A 1XSXA 4DR1H 4ZYDA 1S7AA 2O6GE 3DLLF 1I3QA 2MFZA 2OH2A 4QWDA 5GONF 4Q8EA 2P5VA 5E1WA 1W0UA 5KFXA 1NG6A 4X62H 1ZREA 5C1OA 5ED4A 1EUDB 5JFRA 3M9OB 3I5UA 3CQZJ 1B8IB 2RNJA 3IP4B 3KYLA 1IDYA 2HOAA 2L9SA 1DP3A 4PWQA
chains in the Genus database with same CATH topology
1O57A 3QAHA 5CVVA 4ZZLA 5LGTA 3ERED 3ABUA 3E5UA 4LF7H 4M6YA 2YR2A 3SZPA 2F5FA 4IXAA 1I27A 6PAXA 4S04A 3BAAA 3F6OA 5A2QZ 3J81Z 1N34H 4HV6A 1J7KA 1ULYA 5L3BA 2PLYA 2QENA 2FF4A 5D5VB 5BOXA 1XSDA 5LBQA 2PN6A 1B4AA 1FBUA 4R8HA 3K2ZA 1MJ9A 4R7RA 1OYIA 1IZ1A 4LB6B 1U78A 4ENKA 2FRHA 4BH9A 4GXOA 3CDHA 2ZMEA 2MCTA 3N40P 5D5UB 5LMNH 1FSEA 2OBPA 5BS6A 3P9CA 4BNCA 4XRFA 2QWWA 3BOQA 1HW1A 2OQRA 3HXLA 5DCMB 2E1CA 4KFCA 1ZHFA 4KIFA 1J59A 1W7PD 2F5EA 4WF2A 4LK1F 4DV7H 1UHMA 3CLOA 2QZ8A 4EM1A 5D4RA 4G7HF 2DU9A 3M9AA 5CLSA 3CJNA 4MV7A 4CICA 1YW7A 4NQWA 5K5RA 4M9ZA 2VC1A 5TJJA 3HYIA 5IT3A 2MLKA 2HWVA 2ELHA 4CZZA 1XMOH 3OTOH 3GF2A 2XKOA 1KQ0A 1I6XA 4UVCA 1FOKA 3B73A 3E5XA 4BAYA 3BJOA 3GEZA 2O61A 4EJTA 4IVNA 4KMUX 5HOOA 1HBXG 4LF4H 4LLGF 3F72A 1BI2A 3GLXA 2P7CB 3F3XA 1P92A 2K4JA 3IWZA 3LQRA 3TO6A 2WWYA 2K7LA 1T38A 4P55A 4L18B 4LF6H 1O3SA 5DD4A 3GUDA 2XHKA 4WXCA 1ZRFA 3U1DA 1R23A 2A07F 1JGSA 4IF4A 1IAWA 1T2KA 5D1PA 5D6FA 4CYDA 2JTVA 1I1SA 4XLNF 2QYOA 2RQPA 3T8RA 4RB0A 1WSUA 2VE9A 1HKSA 3N4MA 1ZGJA 2XAGA 1KYWA 2P5LC 2P5KA 2Q2EA 3KLNA 2FSWA 3K69A 4JI0H 3QPTA 2UUBH 1GVJA 1FZPB 1K7AA 1JXSA 2K27A 3GFLA 1J9IA 2XROA 3ELKA 3L9FA 2LNBA 1W5SA 3HUGA 1D3YA 1OR7A 3E3VA 3I4PA 5JR3A 3D5LA 2XV4S 3HRUA 2EFOA 2V79A 3B02A 1L2ZA 2ZXJA 1Z9CA 4M72A 1BM9A 5EEHA 2CW0F 3SZTA 3RYRA 2BEOA 1XMKA 1T6SA 2KSWA 1LEAA 1R5GA 1B9MA 4IAJA 3F21A 1LDKB 3MAJA 3LAJA 3I53A 3M8FA 3DPLC 5K1YA 2UXNA 1S6LA 4HBLA 2UXCH 4B3MH 1PP7U 2YU3A 1BIAA 3DPTA 1EH8A 5H20A 1X9NA 1SD4A 5E1ZB 2AXLA 3HHGA 3QP6A 3DF7A 4OMYA 2DPUA 1TQPA 1MD0A 1LNWA 3WODF 5D8KB 2IW5A 5E8GA 2K4BA 5ICCA 1BIBA 2ZO4A 3R0AA 2LSOA 5FFZA 4DR4H 3NEUA 4IHSA 2X0LA 3FX3A 4I09A 1FC3A 3DFGA 1ODDA 4G6DA 4WXHA 3HSEA 4KDPA 4OINF 1DP7P 3CUQB 1CF7A 4OIQF 5H6QA 4B09A 2Z9OA 1BOAA 2Q2UA 2UUAH 5KK1A 5BPDA 5FD6A 1HNZH 4HX7A 1FSHA 2HKXA 4EVIA 4KN7X 2IPQX 1A0IA 3KAKA 4O5VA 1SMTA 3DEUA 2OA4A 1O75A 3WU1B 4M71A 3HRMA 1XGSA 4GKKH 3JAMK 3RI4A 1C0WA 4KN4X 4DV0H 3W6JB 1H9GA 3H3ZA 1DDNA 4UVBA 4LJZF 2V6CA 5HLGA 1U2WA 3V8JA 2R7FA 3RJ0A 1B6AA 4L5JA 5LGNA 4GGGA 3KP6A 5BR8H 2EFQA 2Y75A 4RGUA 4KICA 3WGIA 3VEPA 3RIZA 2WE6A 2XIGA 1PDNC 4PGGA 3IWFA 2NAZA 2KKOA 1OYYA 2H27A 4A0ZA 1B04A 2XAHA 2ZM6H 3SQNA 4A6EA 1T0FA 3M7GA 1R5HA 3E97A 1DPRA 4HQEA 2H94A 4KHPH 1KU2A 1YIOA 3C3WA 3H92A 2CFXA 3UQ8A 4X65H 2G7UA 2Y0MA 3JTHA 4NHJA 1EV7A 4RZQA 3TOAA 1Z2PX 4LFCH 1CGPA 3ULQB 3M8EA 3WTWC 2PMUA 3WE2A 3T1BA 4DUZH 2HVSA 4KMFA 2QLZA 3EETA 2HYFA 1YW8A 5FLXW 1NHAA 4LF5H 2M1BA 2NNYA 3QU6A 3ZP5A 1G3SA 4UFZA 1ZHSA 3HSFA 2MA3A 2HGCA 2NNNA 1A04A 3L2PA 4A12A 3GFJA 4AIKA 4CO8A 1WKMA 3DV8A 3LMLA 2FBIA 4EJOA 4YFKF 2XVCA 4I98B 5DUKA 2H6CA 2Q8KA 1O3TA 1B59A 1XSVA 3E6BA 1MDMB 4UCUA 2GA2A 1S8NA 2HTSA 1M0TA 2BBYA 1S29A 1LDJA 2R7DA 1FPQA 1EH7A 4LG0A 3ZQ7A 1RIOH 5DCMA 2BV6A 4AD9A 4O6JA 4CC5A 2FMYA 1TA8A 4DR3H 3LA3A 5TRDA 5HS9A 4IRIA 4ZH4F 3MWMA 4EJWA 1KU7A 2VBZA 2BE5F 3WTSC 4DV6H 4KIGA 3DP7A 4I0AA 4RGXA 1K78B 3VB2A 2E5LH 3KZZA 5BQTA 3V8KA 4DQ2A 3IHUA 4JI6H 3HHHA 2CYYA 2FNAA 3RTXA 4U0WA 2P7VB 1HQCA 1ZN2A 3WTUC 4HX4A 3RF2A 4IJAA 3E6DA 4KNYA 3D0SA 4B3TH 3FF5A 4NXMH 3MZYA 4LLLA 1IBKH 1MKMA 1OYWA 1KGSA 1QNTA 4HF2A 2QBYA 4H0EA 4G6QA 3KP3A 4HF0A 1BI0A 2A6EF 4CXFA 1AOYA 1YFHA 1XNRH 5E1XA 1XGOA 3FXQA 4MEYF 5D4SA 2K02A 3RGZA 5DDGA 1ZRCA 4N9IA 2EV5A 1WI9A 4AVPA 1S7OA 1IW7F 1V9PA 1BI1A 3QOPA 2VOBA 3VOEA 2DLLA 4G94A 4NB5A 5E18F 1OPCA 4TV7A 4GKJH 3M4IA 2ZKZA 4HX8A 4UV8A 4DV1H 3J80Z 5FGMA 4WXDA 3F8BA 4ASNA 4LB5A 1KYZA 2CSOA 1MJBA 5L3EA 2DQRA 2Z33A 1U5TB 5AIQA 1IUYA 1DPUA 4HZFA 3CUOA 4JI8H 2CW8A 1U3EM 4A2AA 3KEOA 2WYOA 4CGZA 1D8KA 4MV9A 3BA8A 2NRAC 1STZA 3HTUA 2G9WA 4HW0A 5D1OB 3GWZA 2VN2A 1BGWA 1I94H 1U8RA 4UCOA 2QVOA 3V7CA 4I01A 4GCVA 4G7ZF 5H6RA 2GZWA 3FXRA 3BY6A 3G3ZA 1IRGA 3V4GA 3BPVA 2P6TA 4KYWA 3WGHA 5HVQC 3CO6C 2VPSA 1I6UA 4AIJA 4BWSC 4JQFA 1ON2A 3F8NA 3AAFA 2HGSA 3FMQA 2ETHA 1E4FT 4ETSA 2CO5A 4M6XA 1N32H 1IXCA 1GXQA 2VODA 1IXSB 1V3FA 3JTGA 3FM5A 3L09A 4UCSA 4JI7H 1IF1A 2LKPA 3WE3A 1VTNC 4B3SH 2L54A 3IRRA 1ZHQA 4HA8A 2W84A 2HVQA 4K0KH 3WTVC 2DK8A 5L3FA 3CUQA 2JZYA 5LGUA 3WG9A 2A68F 2EFWA 2L3DA 1F4KA 1FNNA 4PGHA 3J7AK 2OU2A 5DYMA 2QQ9A 3JSNA 4CDGA 2CGPA 5AIPA 1L0OC 2KIUA 1F1ZA 4U0VA 2B0LA 4MQ9F 1IXRC 2PFBA 3REOA 5IWAH 2M87A 3JW4A 2HEOA 1YQAA 1R22A 1LB2A 1JE8A 1Z2NX 1TW2A 3MFKA 5E8IA 3GFIA 4A2BA 2ZNYA 2RVCA 2VT3A 5DEQA 4K2EA 3FM3A 1SMYF 4JV5H 2VBYA 3ECHA 2UXDH 4KA4A 3TOBA 4HF1A 1G3TA 2EA4A 3FXUA 1K6OA 3ISPA 2OZ6A 4JI4H 2ACJA 3KALA 5HDNA 3NQOA 5FFXA 2A5YB 3S2WA 3SFZA 4A2UA 2DW4A 1FBSA 2M30A 4ENMA 2VT2A 2UXBH 2FQ3A 4HLXA 1B1BA 4MTDA 5ICEA 2Q2TA 2FBHA 2ADUA 2V1XA 1BJTA 3HTSB 4RB2C 3T1YH 4LFBH 1YO5C 4YY3H 1FY7A 1O7FA 3PQJA 3BABA 3GZ5A 2A3SA 2GA1A 2JT1A 2KJBA 2YX7A 2RGRA 3GW2A 1XCBA 2F2EA 1KU3A 3FMSA 1SD6A 3I54A 4GYGA 3LA2A 4EQQA 3T5XA 5LRSA 4OIRF 2PG4A 1FKAH 2UU9H 2ESNA 4RB1A 2FU4A 2GQQA 4L9NA 5LL6b 3SHFA 1ZG3A 1TW3A 3RKWA 5FLXK 2GXGA 2WV0A 2UXXA 5ICGA 2Z99A 5FD5A 3HIFA 2HYGD 1O7LA 1W7PB 1J75A 5E17F 5LHIA 1FWZA 2JSCA 4WCGA 3FHZA 2A6HF 5K5OA 2F5CA 3O3KA 1SFUA 3I0TA 3C1DA 2G7HA 2IT0A 3KP2A 2W24A 4PCQA 1MDMA 2MH2A 1MGTA 3TGNA 4FT8A 3IL2A 4MQVA 3N97A 3I71A 3VFZA 2E7WA 1QO0D 5D5WB 2FNPA 4DR6H 4Q48A 4LMYA 1O3QA 3N43B 5FPRA 1FYKA 3BA9A 1J5YA 2ZMEB 2JPCA 1LJ9A 2WDTA 1N36H 2OD5A 2PEXA 4EEQA 3DF8A 4ENNA 1YG2A 3ABTA 4RB3C 3KXYT 1KU9A 1BJAA 3JSLA 1KA8A 4GYIA 4QWQA 4I2OA 4JYAH 4EFBA 5HDKA 5J6XA 1K78A 4MGRA 2W85A 2C6YA 2CWEA 1FP1D 2RC4A 4HYEA 2XUBA 3R60A 3ZPLA 1RUOA 3F8FA 3QRFF 2NS0A 3RYPA 4ZZDA 4U7BA 4J0MA 3PFIA 2VUGA 2DI3A 1R58A 1IBMH 1VS0A 1WWXA 1G3WA 1G6NA 1MJAA 4MNUA 2HDCA 2YX4A 1DGSA 3KP7A 3TKYA 1DUXC 1ZH5A 4LFUA 3LAPA 2D1VA 2K86A 4EFEA 1SFXA 5J8CA 1XB4A 2H09A 1LQ1A 2PBIA 1TAEA 2FBKA 4Z2YA 4XLPF 4XBFA 2GAUA 2XRNA 2R3SA 4P96A 1HXDA 2JPBA 1HKTA 5D5XB 4DV3H 1ZLJA 3KCCA 4OIPF 2PQ8A 2HQNA 4ZYGA 4EGZA 5L3CA 2ISZA 2L4MA 1PUEE 2YCHA 4GLXA 4DV2H 2CQKA 1E17A 3RKXA 5FB2A 3GX4X 1ZRDA 4KUMA 1U5TA 4N0BA 1EH6A 4HV5A 4R1HA 1IN8A 1AWCA 5FLXZ 2VOOA 1ZARA 3TDZC 4DNCA 4N9HA 3L00A 2LF8A 4BHPA 1YTYA 3TDUC 2QQBA 5D1OA 5LEJA 5EEGA 5KVRA 3K1PA 2FXAA 1R1VA 4BHCA 1H9TA 1RUNA 5K5QA 4DV5H 1HR0H 3T1HH 5HLHA 4LK0F 2ZFWA 2HTJA 1R00A 2H6BA 2EWNA 3EDPA 1P6RA