4RB3C

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
molecule keywords DNA (25-MER)
total genus 37
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb3C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb3C02
1FT9A 3V7RA 4HW0A 3R60A 2H27A 3R61A 4RS8A 4YFXF 1FYKA 2QBYB 3LFKA 4AWXB 3CUQC 3U9GA 5JFRA 3QOPA 1BI1A 1MZBA 2P5KA 1RI7A 1ZARA 1XB4A 3V8JA 2HS5A 4LG0A 4HX7A 3FX3A 1LVAA 4WF2A 3V7SA 4OU0A 1FSEA 1YFHA 1JHHA 4ENKA 3KFWX 3IWFA 1RNLA 5H6QA 1RIOH 1FBSA 3KEQA 1LQ1A 2XAQA 2K7LA 1SD7A 1USSA 2E1CA 1T98A 4MTEA 1USTA 2P7CB 2V1DA 2XKPA 3QP6A 4KYWA 1WQ2A 1J75A 1ZAOA 2HR3A 3ZP5A 2DTRA 4LMYA 2EFPA 1HKQA 4HQEA 2D1HA 2EFNA 5L3BA 1P4AA 4LK0F 3REOA 3VOEA 2EWNA 3L7WA 4HV5A 5EEHA 5DCMB 1H9GA 2VOOA 3M1EA 4O6JA 2FBHA 4ESFA 3FZVA 4UV8A 4QLCU 1TQMA 2XROA 4YFKF 1SD6A 5ILSA 1FBUA 5DV5A 3MFKA 1EV7A 1MD0A 1L3LA 4A0YA 4G9YA 1IXSB 4MGRA 1YS7A 3LA3A 5ERIA 2RDPA 2KIMA 4M6XA 3TO7A 4HF0A 4I02A 5DUIA 3B02A 4MNUA 3T0YA 1U78A 2QBYA 5IT9K 1XN7A 4KN4X 4S04A 2PQ8A 2WWYA 4I01A 3RPQA 2MBFA 1KQ8A 1T0FA 3PQJA 2RV8A 1W7PA 2IPQX 4EJVA 1HW2A 2FF4A 2FNAA 2OAZA 1R00A 1R58A 2KJCA 1BC8C 1FP2A 3L09A 3IRQA 1CGPA 4U7DA 4O3MA 1ON1A 1C0WA 2NAZA 3ABTA 2LDUA 4D0PA 2KIFA 4L5JA 2CGPA 1G3SA 2VODA 2UZKA 4XSXF 2DK5A 1W5TA 3TQNA 5BOXA 1K79A 5E20A 2OZ6A 3OOPA 2FA5A 5BMZA 4FHTA 2NS0A 3D5LA 3QAHA 5AONA 1XCBA 1S7OA 4R8HA 1HBXG 1YYVA 2RKHA 2MC3A 4UHTA 2HWVA 3F8MA 4A0XA 3HYIA 4KIFA 1U8RA 3BY6A 1Z1DA 4OMZA 2CWEA 2XRNA 4LGWA 2P6SA 1K78A 5JHUA 1D8KA 2A3SA 3GFIA 1UHWA 3TDZC 4XBFA 2VONA 2Y0MA 1O3QA 1T2KA 3ULQB 1DDNA 3NEUA 1Q1HA 3T1BA 1XGOA 3ZQ7A 2YSRA 3KCCA 4CZZA 2B0LA 5FLXK 1RUOA 1SD5A 3R0AA 5BPIA 4HDVA 4RB3C 1XGSA 1V4RA 4KA4A 3WU0A 2A5YB 3WTZA 2IT0A 2HOEA 1FYMA 3V8KA 2EV0A 3ZMZA 3CLOA 3WGIA 4R1HA 1BC7C 4N9HA 4HF1A 3N97A 2EFOA 4GO1A 5DUKA 1QBJA 3CO6C 1ULYA 3EDPA 1R36A 4L9JA 1ZLKA 1YTYA 1EH7A 3QPHA 3GLXA 1OMIA 5BS6A 4UVBA 2QWWA 5ICCA 2BGCA 2M8EA 3GX4X 3GFLA 2M87A 2GIVA 4I0AA 2VC0A 5CJ9A 5J8FA 1HW5A 3DPTA 4BAYA 5L3GA 2OD5A 4RGRA 4ZH4F 5KVRA 3KZYA 5F64A 4N0BA 2C6YA 2FEZA 5E8GA 3QPTA 4M9SA 5HLHA 4AIHA 4G7HF 1BI0A 1U5TC 1I6XA 2EA4A 5ICEA 4HLYA 3K2ZA 5ILUA 2IVMA 3WGHA 1KU7A 4EQQA 3CUQB 5JVTA 1TW2A 4NB5A 2CQKA 2YR2A 2P8TA 2EB7A 2P6TA 2HEOA 2PJPA 2DQRA 2R3SA 4HAMA 2DU9A 4PGGA 3OV8A 2QVOA 4RB0A 4UVAA 1L0OC 2K4JA 2W57A 5BPDA 2HQNA 2J5OA 4N9IA 1SFXA 4Y15A 3GZ5A 3C1DA 2STWA 2F5DA 3I59A 3F3XA 3F6VA 1HKTA 4HV6A 1K78B 1G3WA 3IWZA 2D45A 2UXXA 2ZFWA 4IRHA 2QUFA 4YFNF 5FD6A 2G7UA 3E6CC 1YIOA 1IN6A 2VN2A 1KGSA 3HSRA 4CHUA 4H0EA 4A6DA 4M73A 3J80Z 1RUNA 3TO6A 4CDGA 2HQRA 1S7AA 3F6OA 3ERED 3TOBA 4AVPA 3IKTA 1BI3A 3ML6A 4BNCA 3KP3A 1DPUA 3SXYA 1T38A 5LGUA 3HIFA 2GQQA 2O03A 1XDUA 3IKVA 2A68F 3RPUA 4LD5A 3QP5A 3RI4A 5HOOA 2X4HA 2WC2A 5D5UB 2Y48A 3K1MA 1YW7A 4EMSA 4HA8A 1O3RA 4GCVA 3J7AO 4BQAA 1I27A 1W7PB 3KETA 3WTWC 3M9AA 1Z91A 4G94A 1QZYA 2HYGD 2M45A 3SZTA 1G3TA 3HRTA 4KMFA 3VODA 1R1VA 4MQ9F 3HRMA 5LEKA 2DBBA 2LNBA 3O6BB 1TLHB 2WV0A 3L9FA 5ED4A 2ELHA 1LB2A 3LAPA 4P9UA 1IN8A 1EH6A 2D2WA 4QWQA 5CYVA 5LEJA 3LQRA 1ZG5A 1OYWA 1FP1D 5E1ZB 2Q2EA 3P9IA 4UUVA 2YPRA 5D8LB 3E6MA 4BHCA 2FXAA 1WI9A 2FQ3A 2Z9OA 1GXQA 3RKWA 4PDKA 3W6JB 2KKOA 3ISPA 3GFMA 2AS5F 1KA8A 1YO5C 4M72A 1J0RA 2YX4A 4L9VA 4RAZA 2P5VA 5HLGA 4L18B 1HSTA 4IHTA 3P7NA 3FHZA 4I98B 1BIAA 3HRUA 2RQPA 3BROA 1IRFA 2W24A 2XAGA 4U0VA 5CVUA 5J6XA 1KQ9A 4RB2C 3R4KA 2JPCA 3KE2A 2DAOA 3I64A 3GXOA 2FU4A 4OIOF 3I54A 2DK8A 3GEZA 1TQPA 2RNJA 3C3WA 4KIBA 2V1XA 1LNWA 3TOAA 1OPCA 2K4BA 2MLGA 3FM3A 1IN5A 4ASNA 2GA1A 2A6EF 3KP4A 1JHFA 1GXPA 2IJLA 5F1RA 2NNNA 4TV7A 2CFXA 4JBAA 5TJJA 1G6NA 4KMUX 1O3TA 1FY7A 4L9TA 4BXUA 2F5FA 4WK8F 4FX0A 3H3ZA 5F6FA 2J5PA 4U0WA 4BYYA 3DEUA 2KIUA 1OYIA 4LK1F 4LB6B 1FC3A 2CG4A 3RYRA 4FT8A 2BEOA 2F2EA 5K5RA 3P9CA 4LB5A 3FXQA 1HXDA 3KP2A 4M6YA 5H6RA 3FMSA 4EGYA 3KP6A 2DT5A 2AXLA 3LAJA 1P4XA 5J8CA 1XD7A 2A07F 1O7FA 3KEOA 5E1XA 2G9WA 2H6BA 2LSOA 3KLOA 3JW4A 3GWZA 3WE3A 2FE3A 2FOKA 5HLIA 4UV9A 5D5WB 1J7KA 3TO9A 2K27A 2OZUA 4M71A 3FMRA 2Y75A 3HHGA 1WSUA 3ELKA 1W4MA 2OQRA 3VB2A 3DV8A 4JQFA 1E2XA 1JXSA 4EJUA 5AIPA 3DXJF 1D5VA 1LDDA 2STTA 3FMQA 3I59B 1I1GA 1REPC 4Q47A 4ENMA 3MZHA 2BBYA 1NHAA 5LGNA 4EV0A 1R23A 2ADUA 2MA3A 2PEXA 3MCZA 4PCQA 1ZN2A 1R22A 1CF7A 3B73A 1XMAA 5D5VB 5HVQC 3CO7C 1OR7A 3EYIA 2V6CA 1TNTA 4GGGA 4A12A 1FLIA 3E97A 1HKSA 1XMKA 1BBYA 2HZTA 2JSCA 1XCVA 1GHCA 2RGVA 2YX7A 5D6EA 2P5LC 1R1UA 2XGXA 1FYLA 5CVIA 5LHHA 1YS6A 1R5HA 4ZZLA 1B9MA 4PZJA 1J9IA 3KP7A 2DPDA 1STZA 2L4AA 3HTUA 4IRGA 2R7FA 1QPMA 2UWMA 3SFZA 1KYZA 4JK1X 3GVAA 4RGXA 1BM9A 2DPUA 4EJTA 1PP7U 2G7HA 3Q5FA 1ODDA 5K5QA 3MQ0A 3E5UA 5ILVA 2ESHA 4ENJA 1J2XA 1BI2A 5D5XB 3Q9VA 1I1SA 2M30A 1F5TA 4LJZF 2XAHA 2DW4A 4LG0B 1ZH5A 3K69A 4M9ZA 3EETA 1IW7F 3GF2A 2O8XA 5A2QK 1XGMA 2L54A 4Q5SF 5H20A 2JTVA 4GYIA 5DD8A 3RYPA 2ZXJA 3AAFA 1XSDA 2EV6A 2LF7A 4ZZDA 2VT3A 2Z3YA 3E3VA 4G6QA 2HKOA 4M74A 2VT2A 5ICGA 1U5TA 1FOKA 1R1TA 3RKXA 2CO5A 2VOPA 1IAWA 2VBZA 1Z9CA 2ACJA 3FXUA 1FBQA 1XSVA 3HSEA 2BYVE 1Z05A 2VE9A 2FMLA 4I0BA 1IRGA 4CICA 4G6DA 1LEAA 2VC1A 4XLNF 2LKPA 3P9KA 1IXCA 5D4RA 1U6GA 1MKMA 1V3FA 3CUOA 2IA0A 2PG4A 5FFXA 3RDIA 3E5QA 3L2CA 2K86A 4HLXA 3R0JA 2KJBA 3T5XA 4I09A 4NHJA 4E70A 2GXBA 1YG2A 2ZBKA 3SZPA 3G3ZA 3EYYA 2P7VB 4U88A 3HSFA 3HUGA 2UXNA 1SD4A 4ON0A 3NRVA 1ON2A 3DQVC 3W6KB 2O0YA 1MGTA 3MAJA 3I71A 4PGHA 2VBXA 3MWMA 4U7BA 3F72A 2FMYA 2EJRA 5L3DA 1DPRA 1TTYA 1B59A 2F5EA 1H0MA 2H94A 5D6FA 4IF4A 4KDPA 3JAMZ 3JTHA 5E1WA 4BH9A 3RIRA 2JPBA 2EA2A 2IP2A 1FWZA 3BPVA 1QGPA 4YIFA 2V1UA 5HS8A 2D1VA 2H09A 4UXNA 4YG2F 1ZYRF 2MH2A 3BOQA 2OA4A 3BP8A 5CLSA 3KP5A 1HW1A 3V4GA 2QQAA 1B1BA 2W84A 5LLQA 4K2EA 3IC7A 3MEXA 4Q4ZF 3DP7A 4BHBA 2Z99A 2XVCA 3WE2A 4B09A 1SAXA 1ZRDA 1HSJA 3LA7A 4MTDA 4A5MA 5LGTA 3NQOA 4RAYA 4WXHA 2GA2A 2PBIA 4L9NA 3CUQA 4OINF 2L3DA 3DFGA 4FX4A 3E6BA 1J59A 1W7PD 5L3FA 5DD4A 3D0SA 1UCRA 3BPXA 4ENNA 3HOTA 3GW2A 3K1NA 4G8XA 1GVJA 5LHGA 5D4SA 5IT9Z 4CXFA 3G73A 4WWCA 1MJBA 3F8NA 3PFIA 4IXAA 2IA2A 1KU9A 1OKRA 1ZG3A 1DP7P 1BJAA 1EH8A 3ZPLA 2HFHA 3JAMK 5DCFA 2EFWA 3O2PE 4LLNA 3HTSB 1SFUA 2FNPA 2W85A 5CVVA 5L3EA 1UHMA 1YLFA 3U1DA 2E7WA 2W25A 1UB9A 5E18F 3GO5A 1B4AA 3M8EA 1B9NA 1O57A 1YQAA 4L5IA 4S05A 2TDXA 2ZNYA 5CVJA 1E17A 2EFQA 3V7CA 1IZ1A 3ZMSA 2H6CA 3WGGA 2XV4S 3IRRA 1U3EM 1FPQA 1R7JA 3F8CA 4LLLA 2X0LA 2RN7A 3H3UA 2BV6A 2ETHA 2NYXA 3K9TA 2XAJA 2LF8A 2ZNZA 1LEBA 1G4DA 1KU2A 2GAUA 1PDNC 3S2WA 5FGMA 3HHHA 1F1ZA 1XDSA 1XGNA 2IRFG 3F21A 2NRAC 5FFZA 2Z5UA 3ABUA 5TRDA 4ETSA 4AD9A 1MJ9A 1Z6TA 3F8BA 1TNSA 4EM2A 4WXCA 3BJAA 5EEGA 1H9TA 1I5ZA 5K5OA 4ZYDA 2V9VA 1ZLJA 2A6HF 2M5WA 3QU3A 1P2FA 1T6SA 5LHIA 5A2QZ 2V79A 2O61A 5FD5A 2ZKZA 4I2OA 4BHPA 3LWFA 4DNCA 5L3CA 2JRTA 4EM1A 2MD5A 4OMYA 1FSHA 1ONVA 1ZHFA 1KQ0A 1P92A 4IVNA 4A0ZA 3VFZA 5HDKA 5BQTA 3DKWA 2GWRA 2M1BA 1IUYA 3R6SA 2YU3A 4RGSA 3I0TA 4HOBA 4DQ2A 5KK1A 2OBPA 1YW9A 4IHSA 2HKXA 4HQMA 1X3UA 1LDKB 2COMA 2FBKA 3Q9SA 3CTAA 5DDGA 3J81K 3ZN1A 5IT3A 2QYOA 1IN7A 1WWXA 3ZMDA 4HX4A 3BJ6A 1O3SA 1HQCA 4CO8A 4G7OF 3TKYA 2Q8KA 3TDUC 2DLLA 1Y0UA 2MH9A 3M7GA 3QRFF 4CYDA 1J5YA 4I7HA 2RC4A 2VBYA 1JGSA 4MHGA 4ZYGA 2F5CA 4EGZA 1MDMA 3WG9A 4AIKA 3U2RA 4MEXF 2OQGA 5LRSA 3PQKA 5LRRA 1QQIA 2DO7A 2R7DA 2PI0A 3RTRA 2HDCA 2PLYA 3MZYA 5HDGA 5K1YA 1WKMA 3DPLC 2QM3A 1U5TB 2DI3A 2PMHA 3I58A 4RGUA 2VE8A 1MJAA 4HDUA 4IJAA 5E17F 1P6RA 4KNYA 4HYEA 3F8FA 1P4WA 5ICFA 4EJWA 1MDMB 4EJOA 2O6GE 1IN4A 1ZGJA 1ZREA 1CF7B 1KU3A 2PN6A 1W5SA 2HTSA 2CYYA 3KZZA 4Q48A 2IW5A 3LSTA 3LA2A 1FZPB 4U0YA 1KYWA 3SQNA 2XKOA 3GYHX 2IA1A 4WCGA 2ZCWA 4A5NA 1B6AA 1ZRFA 2KRFA 3BWGA 2DQLA 3FM5A 1K6OA 3QU6A 4HZFA 3ECHA 1XSXA 2XUBA 2JZYA 4GXOA 1ZG1A 1K7AA 5AIQA 1IF1A 3JTGA 2NNYA 1TW3A 3J80K 3FWEA 4KN7X 4P9FA 1QO0D 2QENA 4Y13A 3M8FA 2QZ8A 3ROUA 3I5UA 3C7JA 4KICA 3WU1B 2ZJ2A 4XLPF 3C18A 3GFJA 1AOYA 3JSOA 4GYGA 3F23A 3L00A 2XAFA 1AWCA 1SMTA 1VTNC 1Z7UA 1QZZA 4O5VA 4IRIA 2L02A 1UFMA 2VBWA 2Q0OA 4WXDA 1Z6RA 4UVCA 4KT5C 2XIGA 4LFUA 5HS9A 2A69F 4R79A 3K1PA 6PAXA 3K0LA 2PMUA 2P4WA 3RJPA 1QNTA 2GZWA 3I4PA 2EK5A 2L01A 1BIBA 4XRFA 3WTTC 1LJ9A 3JSPA 1D8JA 2HYFA 1LDJA 4WX9A 4MEYF 1U2WA 4KIGA 2CW0F 4MQVA 1FX7A 3N4MA 3T8RA 5HDNA 5CVRA 5FLXZ 2ESNA 3WTYC 3H92A 3WTSC 2JT1A 4HF2A 2ZO4A 4A6EA 2O3FA 1BN5A 4EM0B 3BJOA 1O7LA 3RKYA 3CJNA 3V8LA 3IL2A 4L0ZB 1S8NA 2ZMEB 1PP8F 1YW8A 4OIQF 2DFIA 1IXRC 1OYYA 5E8IA 1FNNA 4ESBA 2MLKA 2FSWA 5HS7A 4ZYHA 3J81Z 3BZ6A 5FO5A 3GZ6A 5LBQA 2Z33A 3WTXC 2L4MA 1R5GA 2FRHA 2ZMEA 1SMYF 1ZGAA 3BDDA 4AIJA 3COAC 3SHFA 2K02A 5JI6A 4P5OA 4CGZA 1BOAA 1T39A 4P55A 2VXZA 4ZYEA 1G3YA 4OIRF 1D3YA 1DUXC 5D8KB 3HRSA 3DF8A 4NQWA 5DYMA 3E6DA 1JE8A 4IPAA 2HTJA 4Z2YA 5DCMA 3E5XA 4F7ZA 3CDHA 5FB2A 3ZMVA 4UNOA 2FBIA 2CSOA 3LQQA 3IHUA 2ISYA 3I53A 2OU2A 4RB1A 2A61A 3WODF 2EV5A 1PUEE 2PFBA 4ESJA 2WTEA 2QQBA 3WTVC 4L0YB 2RVCA 1S6LA 3ECOA 4P96A 4B8XA 4LLGF 2XASA 2QQ9A 4OIPF 1S3JA 3T8TA 3ZMUA 3EUHA 3TGNA 1A04A 3FXRA 1SFEA 1ZRCA 2GXGA 4KUMA 1TBXA 4HX8A 4YIIA 4HBLA 3HOSA 4G7ZF 3F22A 1TQIA 3ZMTA 2HGCA 1WRJA 1F9NA 1S29A 3EQLF 3WTUC 2BE5F 5DEQA 4M9XA 1F4KA 3KLNA 2E7XA 2QLZA 4A2UA 4XSZF 4Y17A 5JR3A 2E1NA 3FF5A 2XHKA 3O3KA 3VEPA 4OOIA 2ISZA 3GUDA 4EVIA 3ZN0A 4KFCA 1RZ4A
chains in the Genus database with same CATH superfamily
1FT9A 2V59A 3V7RA 2EIKH 1IGNA 4HW0A 2KL4A 3JRXA 2YS9A 3R60A 2H27A 2FKLA 3CCYA 3R61A 2W71A 2X85A 4RS8A 2JEGA 2IBDA 3A0HC 2HI3A 2FMAA 4YFXF 3VPCA 2DPIA 1FYKA 2QBYB 2BXZA 3CVZA 3FMAA 3K5IA 2LMDA 3LFKA 4AWXB 3SDBA 1G8XA 2W6PA 3CUQC 3U9GA 5JFRA 1JGGA 3QOPA 2E5ZA 4YBZB 1N32H 4JI1H 4DOZA 1V54H 2WTFA 1BI1A 1MZBA 4O3RA 1GV5A 3A01B 2P5KA 2XF6A 1RI7A 2R0QC 4EEYA 1ZARA 1XB4A 3V8JA 2HS5A 2DA6A 2AU0A 2PVPA 3KHGA 5C3EG 4LG0A 1R49A 1TWHA 4HX7A 3FX3A 1LVAA 4WF2A 4QPQA 3BR3A 1HNZH 5FKKA 4JI8H 2ZJRF 4J01A 3IH2A 1NG6A 3V7SA 4OU0A 1FSEA 1HDPA 1JHHA 1YFHA 4ENKA 4BL0B 3KFWX 2YZNA 3IWFA 2ZC2A 1S68A 1X2MA 2W9CA 1N36H 5LMNH 1RNLA 5H6QA 3K3PA 2R8KA 2GPSA 1RIOH 4MV8A 2BQUA 1N75A 3K70D 1FBSA 1IJWC 5GAGJ 4O3NA 1B72B 3KEQA 5KFRA 3TEDA 1RYRA 1VQNI 3CJRB 2R5YB 2E1OA 1LQ1A 3BQ0A 2XAQA 3NWTA 4B3SH 2K7LA 5IYDJ 1D0YA 1SD7A 1USSA 1T98A 4MTEA 1USTA 2E1CA 3CC4I 3MR3A 1RKTA 4IHJF 2IGMA 3KYLA 1RJPA 4X62H 1Z3YA 3PSIA 2P7CB 2UVWA 2V1DA 2XKPA 3QP6A 4RLFA 2R5ZB 4KYWA 4IWXA 1WQ2A 1J75A 5IP9G 1ZAOA 2E19A 2HR3A 2KDOA 3ZP5A 4C2MA 5CB4F 2DTRA 4DL3A 2LFBA 4LMYA 2J6TA 3FKJA 3BR2A 1LE8A 4HSTA 4Y3OA 5CAEB 2EFPA 1HKQA 3TP3A 3IH4A 3OYFA 4HQEA 1BNCA 2CZGA 5L1JA 2D1HA 3G8CA 4E4TA 2VUMJ 2EFNA 2CMPA 4HPQA 3BCBA 4II2A 3WG7H 3RGZA 1BW6A 5L3BA 2IP4A 1P4AA 4LK0F 3REOA 4BXFA 3VOEA 2YRXA 3L4KA 2GPWA 4F52A 2EWNA 4HEA2 5KFKA 1QHGA 3L7WA 4HV5A 5EEHA 1LE8B 4U6PA 4Q44A 5DCMB 1H9GA 1D5YA 2VOOA 3M1EA 4O6JA 2FBHA 4LOCA 5FJ8G 3MR2A 4ESFA 2KRCA 4F92B 3BR0A 3FZVA 4UV8A 3M4IA 4QLCU 1TQMA 1MSFC 2XROA 3FK6A 2VIXA 4YFKF 1SD6A 5ILSA 3S15J 4DR7H 3DEWA 3ETJA 4V2GA 1FBUA 2ZM6H 2EBIA 5DV5A 5KG5A 4EYIB 5IYZF 3L2PA 4TV8F 3DBHB 1ULZA 4C9YA 3GTLJ 2NU7B 3MFKA 2L7ZA 4J0MA 4A3CJ 1EV7A 3OUUA 5KG0A 2R7ZA 1MD0A 4XRSA 4DBQA 1L3LA 4A0YA 1SEIA 2CW8A 1E3PA 4G9YA 2MC4A 4A3JJ 1UAAA 2R7TA 4BUPA 1IXSB 3IG0A 4M3GA 4MGRA 1YS7A 1MNMC 2E60A 3LA3A 5ERIA 1V4YA 2NOGA 2RDPA 4UY8I 2ASLA 3X2QH 5E3LA 4A3IG 2KIMA 4ED8A 4M6XA 3TO7A 2IS1A 4HF0A 1HR0H 1MBHA 5KFSA 4I02A 3HPHA 3W2VA 2V9WA 5DUIA 3B02A 1LFPA 4MNUA 2DODA 3T0YA 5KFUA 2JA8G 1U78A 2QBYA 1OCTC 4YJ3F 2NU9B 5IT9K 1XN7A 3CCEI 3RCOA 2QKMB 3SEQA 4KN4X 4S04A 5HNHA 4R7RA 2JA6A 2X0SA 1T3NA 1GSAA 4FM9A 4ECUA 3LSKA 3AG3H 2KIQA 2PQ8A 1QHHD 2WWYA 1W0TA 5F9LA 2MABA 4I01A 3OMYA 2PX9A 4UUTA 3RPQA 4QWDA 2MBFA 2J9GA 3KYCB 4CUGA 3ORQA 4RUAA 1JKQC 3OYEA 1KQ8A 1H89C 1BA5A 2B63J 2R92A 1UHSA 3S2HJ 3PZPA 1T0FA 3PQJA 3EUKL 2RV8A 3M4OJ 3ERMA 1W7PA 4NC7A 2IPQX 3CCVI 4EJVA 3LMMA 1K83A 4F4XA 5KG4A 1HW2A 2FF4A 2FNAA 4FTHA 2OAZA 2WYOA 1R00A 3KAJA 4B3MH 4X66H 1R58A 2I5UA 2KJCA 3A2KA 4ECWA 1FP2A 3L09A 1BC8C 2H8WA 3IRQA 1CGPA 2M4KA 1RPWA 4U7DA 4O3MA 3HKZA 1EUCB 1MW7A 1ON1A 5HV6A 1VF9A 1LPQA 1C0WA 2NAZA 3ABTA 1MH4A 2LDUA 1YI2I 4CC6A 4D0PA 2KIFA 4L5JA 1T56A 4A2AA 3D5SC 2R8JA 1U8BA 2CGPA 3SZGA 2JJ7A 2NU6B 2KPMA 3LSMA 1ZHSA 1QVUA 5FLMJ 2W4SA 3BZKA 1G3SA 4A69C 2VODA 1CS0A 5J2UF 2UZKA 4XSXF 2DK5A 1ZK8A 3BTIA 3J81W 1W5TA 2VL8A 3TQNA 5BOXA 1K79A 1VQ8I 2XGDA 4XM3A 1MMGA 5E20A 3RB6A 1T0FC 1FOXA 1X2NA 1ZR2A 3AG1H 2OZ6A 1BJZA 3OOPA 2GLOA 2JSPA 2FA5A 1WJBA 5BMZA 4FHTA 1N77A 4ME6A 3FXLA 2NS0A 3D5LA 3HOUJ 3OHAA 3QAHA 4J00A 4MV3A 3UQ8A 5AONA 3JR9A 4XN0A 1XCBA 1S7OA 2HGSA 1MH3A 3NWSA 2EZLA 4R8HA 1HBXG 2V58A 1YYVA 3W2AA 2RKHA 1Z2NX 5DLGA 3JRAA 4JI4H 2MC3A 4HRIA 2PJRA 1AHDP 3R5XA 1SVOA 4UHTA 5KFWA 2HWVA 1Z0XA 2XCPA 3EPZA 2DT6A 3F8MA 4Y7NJ 3G6VA 4A0XA 1RC9A 3HYIA 4KIFA 4BBRJ 1U8RA 3BY6A 1FIAA 5KFPA 4RM2A 5CKTA 1Z1DA 2R7NA 4OMZA 4M3EA 1TT5B 1QPIA 1YE9A 2DJNA 2CWEA 1MBKA 2KFDA 2XRNA 3NAUA 3O8HA 4LGWA 5FROA 5JUMA 2IA6A 2P6SA 1K78A 4J9RA 1TP4A 2D5VA 2HOAA 5B66C 4EATA 5JHUA 1D8KA 2A3SA 3GFIA 3HL2A 5A2QW 2B7EA 1OQYA 1UHWA 3TDZC 4XBFA 2V6EA 2VONA 2Y0MA 4DR3H 1O3QA 2JRMA 1T2KA 1K1QA 4M7EA 3ULQB 2YS6A 1DDNA 3NEUA 2F5VA 1X1PA 3T5KA 3H0GA 1S9FA 5BMVF 1D0XA 1Q1HA 3T1BA 1XGOA 3ZQ7A 3S14J 2GM4A 3RUPA 2YSRA 4IOAF 2VA3A 3KCCA 2K85A 4CZZA 3CDIA 4ZDLA 1SC7A 2B0LA 4R8UA 3Q8SB 5FLXK 1RUOA 1SD5A 4M3DA 3R0AA 4A3DJ 3FKIA 2C22A 5BPIA 4XNFA 4A3GG 2Y9YA 4HDVA 4A3BJ 4RB3C 2R7LA 1XGSA 1I50A 1V4RA 3UFXB 4KA4A 3HUGB 4OAZA 2VJ4A 3WU0A 4O3QA 2A5YB 2Z16A 2JN6A 3K4BA 4ED6A 3WTZA 2IT0A 2PMZE 3JZIA 3CCJI 4XONA 4IHVA 4XIDA 4YY3H 5KFMA 4YQWA 3K4JA 1X19A 2HOEA 3S8PA 1FYMA 3V8KA 2EV0A 3RZDJ 3BG3A 2ID6A 5E79C 3ZMZA 3CLOA 5K7ZA 3WGIA 3OSPA 4R1HA 2NVYJ 4J9QA 1BC7C 3OS1A 4N9HA 4PJMA 4QPOA 3JSNA 4HF1A 4EFEA 2NVQJ 3PO3G 4JX4A 3N97A 3HOXG 4RDUA 3S1MJ 2EFOA 4GO1A 5DUKA 2C2EA 3ZQCA 1QBJA 3VSLA 3CO6C 3BQ2A 4HNUA 1T95A 1ULYA 2G0EA 3U9TA 4B3RH 5EDNA 2M9HA 4HQ6A 3EDPA 2FP4B 1HLVA 1E4EA 4M3BA 1PVEA 1R36A 1PUFB 1E3OC 3ZQIA 1W36D 4L9JA 1AKHB 1ZLKA 1YTYA 2LY2A 4E7JA 1EH7A 2QKLB 3QPHA 1B8IA 2PBZA 3GLXA 1OMIA 2VKEA 4J9SA 4D7NA 5BS6A 2JA2A 2CQQA 4UVBA 1B04A 2QWWA 4A3KG 3H9GA 4HSRA 5ICCA 2BGCA 2XD4A 2M8EA 3GX4X 3PIOF 3CF5F 1EYZA 4DBRA 2VPLA 4XZ3B 3GFLA 2W8LA 2HOTA 3OWTA 2M87A 4M6VA 2GIVA 4DZPA 4I0AA 2E2JJ 2VC0A 1V5FA 3QOEA 5CJ9A 5J8FA 5LFAA 2BQRA 2PMZN 1HW5A 4CCLA 3DPTA 4BAYA 3K4KA 2DXIA 5L3GA 2OD5A 4RGRA 4UCVA 1IG7A 5KHDA 1TAEA 2R7KA 3KYDB 2OPTA 4ZH4F 5KVRA 1GSOA 4EBEA 5DM7F 3KZYA 5F64A 3DPUA 3CF2A 3BZCA 4N0BA 3ZQFA 1FIPA 1ENHA 5B1AH 2FEZA 3HG9A 2C6YA 1TWGJ 4IHYA 1WJAA 2W8KA 5E8GA 3KZIC 3QPTA 4M9SA 5HLHA 4AIHA 2DTZA 3K4MA 4G7HF 1ZELA 1BI0A 2X6XA 5KFFA 1SFOA 1U5TC 2ASDA 4PDBA 3K2AA 5GTIC 4RAGA 1I6XA 5JLWA 2EA4A 2QF7A 1NK3P 2J6UA 4M9UA 1TWFJ 3DKYA 5ICEA 3PW0A 4CSWA 4DUYH 4HLYA 3K2ZA 1TWCA 2E2HA 1YX3A 4B44A 3HKZN 5ILUA 1VQMI 3ASNH 5BPHA 2IVMA 3L2WA 3GTKA 3KALA 3KAKA 5TISC 3OYHA 2R86A 1MNEA 3WGHA 1KU7A 1MMDA 4EQQA 3GTPJ 3CUQB 3G1MA 5DGBA 2VPRA 3RTXA 1DV1A 5JVTA 4J19A 1TW2A 4B48A 1GGOA 4NB5A 4DV7H 4LFAH 2Q2EB 2CQKA 2YR2A 2P8TA 2EB7A 3FISA 5DGAA 3FDSA 4O3OA 5KNLA 1ZR4A 4FU0A 2HZDA 3MKZA 1VQ4I 2P6TA 2HEOA 3QWLA 2PJPA 1EF4A 2DQRA 2R3SA 4HAMA 3GTQA 1AN7A 1K1SA 3GIKA 2DU9A 2E34A 4PGGA 4HR7A 2M7AA 2QVOA 3OV8A 2X6OA 4RB0A 4NXNH 4XOPA 4UVAA 2F4VH 3H5AA 2LD5A 1L0OC 3FXOA 4B43A 2K4JA 2DFEA 2W57A 3VYSB 2LKXA 3GIJA 3LSPA 5BPDA 3GBGA 5FKLA 2HQNA 2J5OA 1OFCX 4N9IA 4UUSB 1SFXA 1KJIA 4RMNA 4ZDOA 4Y15A 3EUHC 5HBRB 4GC7A 3GZ5A 2HQAA 3QODA 3C1DA 3BR5A 3PNYA 2F5DA 2STWA 3I59A 3OIPA 3F3XA 3F6VA 4ZJZA 1HKTA 4HV6A 3PUFA 4G6TB 3UKGA 3GTOA 1QZEA 1K78B 2UU9H 3CCLI 1Z21A 1G3WA 3IWZA 5FKOA 2D45A 2UXXA 1UJ8A 3MVPA 5EG0A 2ZFWA 3K10A 4IRHA 2QUFA 3HKZE 1IDZA 1RK5A 4IWYA 3OS2A 1Z2OX 2R84A 4YFNF 3SYTA 2G7UA 5FD6A 3E6CC 2ZDGA 1WH7A 2QSGX 1YIOA 4B3AA 1IN6A 2IGOA 1IUFA 2E1MB 3M8JA 2VN2A 1OLTA 4I99C 1KGSA 3HSRA 2DT7B 4CHUA 4QJFA 4H0EA 5FRMA 4ZOLF 1E4GT 4HG2A 4A6DA 1UC9A 1IBMH 3TBIA 4M73A 1K4TA 3J80Z 5DG7A 1RUNA 3TO6A 1N78A 4CDGA 2F4IA 1S7AA 2HQRA 4JV1A 3ZGKA 3CC7I 4DR2H 1OR7C 3M07A 4FCYA 3F6OA 1YOVB 3ERED 1BW5A 3WO1A 3H9JA 3TOBA 3J7AK 4AVPA 2R7QA 4O4LF 4IZZA 1OCRH 3AKZA 2ELJA 1S97A 2R8IA 3IKTA 2KQRA 3DU5A 1BI3A 1CQIB 2R7MA 3H4BA 2V5AA 3C0FB 2A5WA 3ML6A 1DIKA 4BNCA 3DBRB 3FXJA 3K4NA 3KP3A 4D1QA 2M7BA 2QA4I 2JA7J 1DPUA 5GAHJ 3SXYA 1XPXA 5LGUA 1T38A 3HIFA 4BBSG 2GQQA 2ZJTA 2C2DA 5EGOA 2O03A 1XDUA 3IKVA 2QQ8A 4AU7A 2L0KA 2A68F 3RPUA 1Y1WA 2VQDA 4LD5A 3QP5A 3RI4A 3ASOH 5HOOA 2X4HA 2WC2A 5D5UB 1FOYA 3GLLA 2Y48A 3RPUD 3K1MA 3I4NG 1YW7A 2DOAA 4EMSA 4BJ6C 2IGKA 4JI6H 3GTJA 4HA8A 1O3RA 4GCVA 3N44B 3J7AO 4BKXA 4BQAA 1I27A 1W7PB 2BW3B 2ZMEC 1NG7A 2P0WA 3ZQGA 4C5CA 3S16J 3KETA 3OYBA 2NVTJ 4UCRA 2RDIA 4J9LA 3WTWC 2W82A 5M5YJ 3M9AA 1Z91A 2UXBH 4G94A 2DZDA 1QZYA 2HYGD 4HNTA 2XGPA 2M45A 1R4NB 3A4CA 3SZTA 1JTXA 1G3TA 2WE6A 3HRTA 4AYBE 4QWCA 1ETQA 4KMFA 3VODA 3LNQA 1R1VA 5CQEA 2R7ZJ 4BXXJ 4MQ9F 4W97A 3HRMA 3RQ4A 1B8IB 2LTPA 2DBBA 5LEKA 2LNBA 1WCMJ 3O6BB 1AKHA 1TLHB 2DYRH 2WV0A 3L9FA 3LSIA 2ELHA 3Q0VA 5ED4A 4WD3A 3WNZA 4TQSA 3GTLA 3T5JA 5GTHC 2C2RA 1F36A 1LB2A 2ME6A 3LAPA 4P9UA 1IN8A 1EH6A 4XLCA 4CCKA 1JT6A 2D2WA 4JOMA 4ZYAA 4QWQA 4EG0A 3M9NB 5CYVA 4BBRG 5KFIA 3JRFA 3PNVA 2Q1ZB 5J4YA 5D8DA 5LOVF 4RZRA 5LEJA 3LWBA 1I3QJ 2UV1A 3KEYA 3LQRA 1ZG5A 3PW7A 1OYWA 3CESA 2CUJA 1FP1D 5E1ZB 2Q2EA 3G2BA 3P9IA 1LFBA 1UG2A 3JRCA 4UUVA 2YPRA 1WR2A 3M9MB 1Z7LA 2DDBA 2LY9A 5D8LB 1C30A 1LUJB 5J2TF 2IXSA 3E6MA 4BHCA 2FXAA 1B72A 2JA6J 1WI9A 5BPFA 2FQ3A 1JKOC 2Z9OA 4DR1H 2RDJA 1GXQA 2MGQA 4J9OA 3RKWA 3G6XA 4IHWA 4PDKA 4JI0H 3W6JB 4XLEA 2KKOA 3ISPA 2JEFA 3GFMA 3GV7B 2AS5F 1KA8A 1YO5C 4M72A 4LFBH 4BS9A 1J0RA 2YX4A 4L9VA 1OISA 4RAZA 4DL2A 3L2RA 3T1YH 4O3PA 2P5VA 2OJED 4KITB 1GLNA 5HLGA 1QU3A 1ZGWA 5K7FA 2ZB9A 3PW4A 4L18B 2MFZA 4DV5H 4DYRA 4A3LG 4E7HA 1HSTA 2C28A 4IHTA 3ZR8X 1X9NA 3P7NA 2JA8J 5HNFA 3FHZA 1WVRA 2YZGA 1SVMA 3VYTB 2C35B 4I98B 4IR1A 1BIAA 3MKLA 4XLAA 3ORRA 1T94A 2ZDHA 3HRUA 2VQLA 1KJQA 2RQPA 3TW7A 3BROA 1IRFA 2W24A 4NBQA 4JV2A 5C1PA 2XAGA 4U0VA 1RETA 4PUSA 5CVUA 5J6XA 2HQ5A 2KSWA 2MCTA 1KQ9A 4RB2C 5EJCA 2JVGA 3W3CA 3R4KA 4RM3A 1MBJA 2JPCA 2KZGA 3KE2A 4PFOA 2W7OA 3GIPA 2DAOA 1E4EB 2JMWA 4DJAA 3C2BA 4BE0A 3I64A 3K4LA 3GXOA 4XICA 4V2FA 1O4XA 2X1EA 2R5ZA 4BEHB 1N33H 1PX2A 3H36A 3H9QA 2FU4A 4OIOF 2ATLA 1QRYA 4AM3A 2RAEA 3I54A 2DK8A 3ZCOA 3GEZA 1TQPA 1KC7A 2WAQA 2RNJA 3C3WA 4KIBA 4DW6A 3BC8A 5JQWA 2BVMA 4DV2H 3GTMA 3S2DJ 1XNRH 1IV8A 2AO9A 2V1XA 1TA8A 2VA2A 1ZTRA 1UMQA 1LNWA 4E7IA 5L1KA 3TOAA 3RV3A 3EPGA 1OPCA 1JDBB 3B6CA 2K4BA 1XMXA 2MLGA 2XSJC 3FM3A 3QYFA 3M3YJ 4OWRB 1IN5A 4ASNA 3TMOA 3FKIG 2GA1A 2W1OA 5F27A 2A6EF 3KP4A 3QQAA 1VQLI 1JHFA 2M05A 2Q2TA 1GXPA 4XL9A 2IJLA 3RAQA 5F1RA 4DIQA 2NNNA 1WI3A 3KX2A 4TV7A 4ECVA 2CFXA 5KFCA 4A3JG 2OC6A 3CP2A 4JBAA 5TJJA 4YHHH 1G6NA 3MN2A 4KMUX 1O3TA 1FY7A 4AYBA 1IOWA 4A3EJ 5KFEA 4L9TA 4BXUA 2R82A 1DGRM 3NARA 2F5FA 1YJNI 4WK8F 4FX0A 4JI2H 5LA6F 3RAXA 3RBEA 3H3ZA 2FJ1A 4ED3A 1YHQI 4LF6H 1VQ7I 2BQ3A 4C2TA 5F6FA 2J5PA 5E3OA 4U0WA 2HPIA 4BYYA 3DEUA 2XPUA 2KIUA 2N8GA 1OYIA 4DV0H 4A3EG 4BY7G 3SJMA 4LK1F 4LB6B 3PN1A 5JH7F 3IUOA 3Q1KA 3V6JA 4X0GA 3PL8A 1FC3A 3CMYA 4TQRA 2CG4A 3RYRA 3GTKJ 2WY8Q 5LXTF 1WH5A 4FT8A 2BEOA 2F2EA 3AFHA 5K5RA 2M0MA 3VPDA 1B6SA 1U9NA 3P9CA 4LB5A 3FXQA 1N56A 3HXLA 1HXDA 3KP2A 2EIMH 2JVHA 2YYAA 3ONQA 3AG2H 5D1OA 1XMQH 2EH3A 1WJEA 2XPVA 4M6YA 5H6RA 4FISA 3FMSA 3CCMI 4EGYA 3KP6A 4DV4H 2YRWA 4ED1A 1P8LA 5GPAA 2EPFA 4NLGA 2DMTA 2AXLA 2DT5A 3LAJA 1RKWA 2NVYA 2W9BA 4IL6C 3RB0A 1P4XA 2V4JC 5FLXW 3K6GA 1ORKA 5KX5F 4HYKA 5J8CA 1XD7A 3LL7A 3V4ZA 3RQIA 2A07F 5C3EJ 2LYCA 3GILA 4A3GJ 1O7FA 2VI6A 5HLTA 3KEOA 5E1XA 3OIQA 2VPQA 2K3FA 2G9WA 2H6BA 2XC9A 2LSOA 1CQJB 3KLOA 4PJ0C 3JW4A 1ZKGA 5KFTA 3GWZA 2WBMA 2FE3A 2FOKA 3WE3A 5HLIA 4DGWB 4UV9A 4E7LA 1I7LA 5D5WB 4IZOA 4E7KA 2XSDC 1U9OA 2JWTA 3J7ZI 3I56I 2I87A 2FJZA 2WB1E 2L7FP 1J7KA 3TO9A 1RJQA 5T14A 2K27A 2OZUA 5EZHA 4M71A 2NVXA 3FMRA 2Y75A 4BGDA 1F43A 3HHGA 1WSUA 3ELKA 1A0IA 1W4MA 1NTCA 3KIOA 2OQRA 3VB2A 1GLVA 3DV8A 4JQFA 5EDWA 1SCUB 2ZJPF 2V7FA 5D1PA 3PNTA 5IT9W 5KG6A 1E2XA 3HDDA 1JXSA 2HOSA 4EJUA 5AIPA 2XDVA 3IAS2 3DXJF 4L5EA 1JDEA 2ELKA 1FKAH 1Y39A 1D5VA 1LDDA 1W5CC 5KT2A 2STTA 3FMQA 4XRSG 1P7IA 1I1GA 3I59B 1REPC 4BBSJ 4Q47A 4CZCA 4ENMA 3MZHA 2W6ZA 1D1CA 4RNOA 1SFKA 2BBYA 1NHAA 4F3QA 5LGNA 1XS9A 3W6VA 2QCOA 4A93G 5LD2C 3N05A 3PM1A 2LH9A 5E3NA 3JAMW 2BVLA 2F4OB 1DP3A 3J80W 1N34H 2L9RA 4EV0A 5B5EC 1R23A 2ADUA 2MA3A 2K9QA 2PEXA 3MCZA 5F9NA 4PCQA 2JA7A 1ZN2A 3FHNA 1R22A 5KFOA 5F0CA 1CF7A 3B73A 3NGDA 2ME0A 3HOWJ 1XMAA 1XC5A 1XTAA 5D5VB 5HVQC 2DOEA 3CO7C 1VAJA 3K5HA 2Y0SN 1OR7A 1WHUA 4L1KA 2AGPA 5KT4A 3EYIA 2BR0A 2V6CA 3GIDA 3I55I 2IS4A 1TNTA 5DM6F 4GGGA 2CKZB 4A12A 1MMAA 2O5RA 4MFEA 1FLIA 3E97A 5FRNA 3D5RC 1HKSA 1SEUA 1XMKA 1BBYA 4DL7A 1LKXA 2W48A 2R92J 2HZTA 3G1LA 2B63A 2JSCA 1XCVA 1JKJB 4LIUA 2QK4A 2OWOA 1GHCA 3JRBA 2RGVA 2YX7A 1GO3E 3FIWA 5D6EA 3BG7A 2P5LC 1R1UA 2DFHA 2KISA 2WAEA 2XGXA 3BQZA 5CVIA 5LHHA 1FYLA 2WDTA 1RESA 5GP9A 1YS6A 2M4GA 1YJWI 2FLPA 4KJZA 1R5HA 4ZZLA 2CV1A 1DGWY 1B9MA 2VASA 4PZJA 3ZOBA 1J9IA 3KP7A 1RRJA 2DPDA 3I4MJ 3PO3J 1STZA 2Y31A 4IRDA 2JUCA 3GTMJ 5DTDA 1E0EA 2L4AA 2FD5A 3HTUA 4M3FA 2HHHH 4MAMA 4IRGA 4JV5H 4QW9A 4ED2A 2R7FA 1QPMA 3G4SI 2W6QA 1KJ9A 1APLC 1Y1VG 2UWMA 3SFZA 2YW2A 2GIZA 3I4MG 1KYZA 3MFHA 4JK1X 3GVAA 2Z2SB 3ABLH 1WCMA 4RGXA 2E5NA 4LF4H 1BM9A 2FOWA 1A36A 2DPUA 3TIGA 3FK7A 4EJTA 1YRNA 5DG8A 3H40A 1PP7U 2R8HA 4GKKH 1WJDA 4AYBN 2G7HA 2L2OA 3Q5FA 1ODDA 5K5QA 1JKPC 3MQ0A 3SFIA 4Q45A 1HA8A 3E5UA 5ILVA 2ESHA 4Y4RA 2XB0X 3IH3A 4ENJA 2CW7A 2M2EA 1J2XA 1S7EA 1M1EB 3OYMA 1BI2A 5C8YF 1WJ5A 3G6EI 3P5JA 5D5XB 3HJEA 3OIOA 3Q9VA 3GMEA 2X6WA 3TQ1A 4CYCB 1OCPA 1I1SA 2DIKA 4YR3A 3UR3C 4B4CA 2M30A 5IP7J 1F5TA 4LJZF 2XAHA 5LYJF 3OYDA 2DW4A 3WHCA 1I6UA 4F91B 4LG0B 1ZH5A 2M8GX 2XAUA 3K69A 1S0MA 1HF0A 5FPRA 4M9ZA 2Z1DA 1IW7F 3EETA 2QEXI 3GF2A 2O8XA 3CZ6A 4J9KA 5A2QK 1XGMA 4UCTA 3OSNA 5M5XJ 1TWHJ 2L54A 4IX7A 4Q5SF 3BG5A 5H20A 2JTVA 4GYIA 5DD8A 1MBGA 3DWLE 4QWAA 3GIMA 5EZGA 3RYPA 3SE7A 2ZXJA 3AAFA 1XSDA 2EV6A 5J3LA 1GDTA 4RBOA 2R93J 2HJWA 4O2AF 4JV0A 4IR9A 1JI8A 2DWCA 2MW8A 2LF7A 3C2GA 1YJ9I 3EPIA 2CH0A 2VT3A 2Z3YA 4ZZDA 3E3VA 4G6QA 2HKOA 4M74A 3ZQLA 2VT2A 2DA1A 3HOXJ 5ICGA 4Y33A 2DCEA 1U5TA 4XMYA 2W00A 2VJ5A 2VQCA 1FOKA 2FK3A 1T8IA 1K83J 5KKNB 1R5ID 1R1TA 3S93A 2DOFA 2ZDQA 4G3IA 3RKXA 2CO5A 4YP3A 2VOPA 3OYAA 2VBZA 5CPRB 1IAWA 1S03G 1Z9CA 4LF5H 4IEJA 3FXUA 2ACJA 4XKVA 3AL0B 5JHFA 4B1RA 5IYDG 1FBQA 2AGQA 4KHPH 1XSVA 3HSEA 4GFBA 2BYVE 1Z05A 3CJTB 3T5HA 2VE9A 3IN5A 2FMLA 2AXTC 4I0BA 1IRGA 1ERDA 4CICA 4IAJA 4G6DA 2HXOA 3BG6A 3FXMA 4CA0A 1LEAA 2VKVA 2VC1A 1IRZA 5KG3A 4XLNF 2LKPA 2BW3A 3SI8A 3P9KA 1IXCA 4A3MG 5D4RA 3RB4A 2LREA 1U6GA 1JLLB 1R71A 1I3QA 4PSXA 2XRLA 1MKMA 1V3FA 4XLFA 3CUOA 2IA0A 2PG4A 2VXDA 1H8AC 1PK8A 3PO2J 2VOBA 2UUAH 1A6IA 2O9LA 1IO2A 5FFXA 4C3HJ 2ECBA 3CMEI 4MV4A 3RDIA 3S3OA 3E5QA 1S10A 3L2CA 3RFCA 5L1IA 2K86A 1UG0A 2XCAA 4HLXA 3R0JA 5EYRA 1KZHA 2KJBA 2LP0A 3S1RJ 2PJRB 3T5XA 4ECRA 4I09A 4A3FG 3MKWB 4HNVA 4NHJA 1I3AA 4FBUA 4E70A 2GXBA 1YG2A 1U0JA 1JKRC 2ZBKA 1KEEA 3F0CA 3IAM2 3SZPA 3G3ZA 2BHZA 4FASD 4I50F 4XQFA 4AUXA 3HB9A 1V51A 5LMUH 3EYYA 5IP9J 3GTOJ 2P7VB 3DTEA 4U88A 5FLVA 3HSFA 3HUGA 2UXNA 2MD0A 1JUMA 1SD4A 4ON0A 1M6VA 2IMWP 4K0KH 3NRVA 4IO9F 1S5LC 1ON2A 3DQVC 4BY7J 4NUBA 3HC7A 3W6KB 2E71A 3E1SA 4I76A 1GV2A 2O0YA 3E5NA 3GIIA 1MGTA 4D7MA 3MAJA 2VJJA 3A01A 3I71A 4PGHA 5LL6b 1W1WE 5FPOA 2VBXA 3JCUC 3MWMA 4QWEA 4U7BA 3F72A 5DS9A 2W9BB 2FMYA 2EJRA 3H0DA 5L3DA 1DPRA 1TTYA 1B59A 2DA5A 2JK3A 2LLKA 3DF7A 4ECYA 2F5EA 5B1BH 1H0MA 5BR8H 3OL4A 5J1RA 4IHXA 2H94A 5D6FA 4IF4A 4KDPA 1Y1VA 4MO7A 3JAMZ 1SVLA 3JTHA 5E1WA 2JEJA 2MG4A 1WPKA 3K4CA 4RNMA 2AHQA 4N4OB 2A6TA 2LOOA 3H0GJ 2TCTA 2VUMA 1PYVA 4BH9A 3GLKA 2ZJQF 2CQXA 3RIRA 3JRGA 2JPBA 2EA2A 2IP2A 2R6FA 5F1JA 1FWZA 3BPVA 1QGPA 4FS1A 4YIFA 1LFUP 2V1UA 5HS8A 4ZHQF 3B6AA 2D1VA 2H09A 3PJRA 2BY0A 4UXNA 3BLYA 4YG2F 1ZYRF 2MH2A 1C3OA 1X1DA 3BOQA 2LG4A 2OA4A 3BP8A 2PMZA 5CLSA 4C2UA 1AUXA 2WADA 1I50J 3KP5A 3DLLF 1HW1A 3OTOH 3V4GA 1X1CA 2QQAA 4PJJA 4A3IJ 1B1BA 2W84A 5LLQA 2EZKA 1H88C 4K2EA 1TL8A 4MV9A 4GDFA 3IC7A 3MEXA 5JLXA 3MR5A 1XG1A 3A0BC 1EUDB 2WV1A 1VQ5I 4O3SA 4Q4ZF 4G12A 3DP7A 4Z6YA 4BHBA 1D1AA 4QWBA 2Z99A 2XVCA 3WE2A 1OCCH 4B09A 1X3WB 1SAXA 1ZRDA 1HC8A 4UCOA 2VQHA 5C1OA 1HSJA 2I80A 3BA8A 1N25A 4X65H 5J47A 2CV0A 3MZ8A 1MIJA 2ZXWH 3LA7A 4A5MA 4MTDA 4A3DG 5KFNA 2XF5A 4F4ZA 4Q43A 4NQWB 2WB1N 2VPSA 5LGTA 1GVDA 3NQOA 4RAYA 4WXHA 2R8GA 1TC3C 1ETOA 3ESWB 2FPPB 1SAUA 1BXRA 2GA2A 2PBIA 4L9NA 3CUQA 4OINF 5FKMA 2GLTA 2RREA 2CRGA 2L3DA 2FUG2 2CS3A 3DFGA 3I9V2 1ETKA 2W6OA 4FX4A 4A2BA 2BZTA 2Y69H 3E6BA 1J59A 1W7PD 5L3FA 1VBGA 2BY3A 4LH7A 3FDYA 1HNWH 2I10A 5DD4A 3H3VK 1B33N 5BNGA 2CJJA 3D0SA 1UCRA 4X1EA 3BPXA 2DDAA 4YELA 3DTIA 2KMUA 1ETYA 4NC6A 4ENNA 4BY1G 5KFLA 2X48A 3HOTA 5H80A 3GW2A 1L2ZA 4XN3A 2WY7Q 2R7WA 3H35A 3K1NA 1VBHA 1WGXA 3LSHA 4G8XA 1GVJA 1RR7A 5LHGA 1BR2A 5D4SA 4D5CA 4EFBA 5IT9Z 5KG2A 4CXFA 3G73A 4YEJA 4X6AJ 3HOVJ 4WWCA 1DU6A 1BJTA 3DLAA 1MJBA 3Q3SA 3F8NA 3PFIA 4IXAA 4ECQA 3BJYA 3E0JB 3GV5B 4RZQA 2W9AA 3CQZJ 2DMQA 2IA2A 1KU9A 2NS8A 5C44G 2OV7A 1OKRA 4ZTJA 3RZOJ 1BOBA 3OR1C 3OSGA 4QIWA 1ZG3A 1DP7P 4U7CA 3QZ7A 2L9SA 4XOTA 1BJAA 3OSFA 1EH8A 3ZPLA 3RGXA 3PW2A 2HFHA 1JUSA 3MKYB 3VPBA 1TWAA 3PR5B 4PK4A 5DLFA 1WFXA 3JAMK 1YITI 4DL4A 5DCFA 2EFWA 1MMSA 2V4QA 3O2PE 4LLNA 3U1KA 3RBDA 3HTSB 2FK2A 4XKCA 1SFUA 3O8GA 5FKNA 1UNNC 2FNPA 2VQGA 1WZ2A 4C3JJ 2W85A 4QIWN 4YRVA 4XX0B 2Y0SA 4Q0YA 5CVVA 3MMYB 4GRIA 3H1CA 5L3EA 3CLQA 1UHMA 3A1YA 2UVRA 1YLFA 2NUAB 5IP6A 2JA5G 3U1DA 2E7WA 2W25A 1UB9A 2W9CB 2ECCA 3L4JA 5E18F 5KFYA 1Q1VA 5IYBG 3GO5A 3MD2A 1B4AA 3M8EA 2HU9A 2DA2A 2O8KA 3H20A 1J5EH 1B9NA 1O57A 3BTCA 1YQAA 4L5IA 3ZXSA 3LSGA 3CCQI 4S05A 3JREA 2TDXA 3N41B 2ZNYA 5CVJA 4ANJA 2K9SA 1E17A 2EFQA 3VPRA 3V7CA 5J1YA 1IZ1A 3WHBA 3ZMSA 2H6CA 4LITA 4MV7A 1AA7A 5IYBJ 3WGGA 2XV4S 3L2QA 3IRRA 1U3EM 1FPQA 1IBKH 4ZTFA 1R7JA 3F8CA 4LLLA 4C5AA 4ZDPA 2X0LA 5DQGA 3BR6A 2RN7A 5KAFC 3H3UA 4UB8C 2B63G 2VUMG 4CCMA 2BV6A 2XGEA 3TL4X 4FQGA 2ETHA 2NYXA 3K9TA 4MLOA 2H1LA 2XAJA 2LF8A 2ZNZA 3OUZA 1LEBA 1VQ6I 3Q8QB 1G4DA 4A3BG 1KU2A 2KHMA 4E7ZA 2GAUA 1GT0C 1PDNC 5KFHA 5KFQA 2HDDA 3S2WA 3MFIA 5FGMA 2P0AA 2R7VA 1JT0A 3HHHA 5CA1F 1F1ZA 1XDSA 4II3A 4A3LJ 3R23A 4MA0A 1XDNA 5GADJ 3PW5A 1S0OA 1XGNA 1EKEA 1RR8C 3E7LA 2IRFG 1GUUA 1MNDA 3HZJA 3F21A 1NH3A 2NRAC 1G2HA 1VQKI 1V5EA 5FFZA 1IV6A 2AQEA 2Y2ZA 1X1BA 2Z5UA 2ZXHA 3ABUA 9ANTA 1IRXA 3FBIB 1OWTA 4OX9H 3JRWA 2DJIA 5CA0F 5TRDA 1S0NA 2C00A 4ETSA 4IKFA 1MBEA 3OY9A 4AD9A 1MJ9A 4GC6A 1Z6TA 3OYKA 3U21A 3F8BA 1BGWA 5KG1A 1TNSA 4EM2A 4DV3H 2F4MB 1K6YA 4WXCA 1YIJI 3FXKA 3BJAA 5EEGA 4E6KG 2OH2A 2K9LA 3AYHB 1H9TA 2P81A 1I5ZA 2E35A 2IS6A 2VKHA 2F6CA 5K5OA 1IDYA 3V42A 2RNGA 4O4HF 3U9SA 3OHBA 4ZYDA 4DR4H 2V9VA 1ZLJA 2A6HF 4IOCF 1PJRA 4CCOA 5C4XG 2CV2A 3DTKA 4RNNA 2M5WA 3QU3A 2EZHA 1P2FA 3N42B 4APMA 1ITYA 5IYCG 1T6SA 5LHIA 5A2QZ 2V79A 4AQYH 2O61A 5KFZA 5FD5A 2ZKZA 4I2OA 2HNHA 4BHPA 3CCSI 3LWFA 4A3KJ 1E3HA 5KT6A 5KT3A 4DV1H 4ECSA 4MA5A 4DNCA 5L3CA 5EOYA 3ZRGA 1JXLA 4I55F 1V9PA 2HVRA 2JRTA 2ZFUA 4BWSC 4EM1A 2MD5A 3C2HA 4OMYA 1FSHA 3GTPA 3KXYT 1ONVA 3BT9A 1ZHFA 1VNDA 1KQ0A 1CE8A 2E5LH 1P92A 4IVNA 1I94H 5F04A 4A0ZA 1JUPA 1Y0NA 3VFZA 2R85A 3MJFA 5HDKA 3SEZA 5BQTA 2CUFA 4R8UB 1Y6IA 2BY2A 3DKWA 2DMPA 2GWRA 2M1BA 1G59A 1IUYA 2XB5A 1DV2A 4C2MJ 2FQ4A 3R6SA 4ITVA 3OOUA 2JEIA 3TW6A 2YU3A 4F4YA 2WB1A 3QFFA 4RGSA 2XPWA 3I0TA 4HOBA 2WAQE 4DQ2A 1A6QA 5KK1A 4XLHA 4NNJA 2OBPA 3PR4A 1YW9A 3KHRA 4J9NA 1I39A 4IHSA 2HKXA 3T5LA 2OUMA 3HOZG 4HQMA 4XYMB 3S1QJ 1TWGA 2EILH 1X3UA 1HOMA 1LDKB 2COMA 2FBKA 3Q9SA 4ZI7F 1QA6A 5C4JJ 3CTAA 5JVGF 1K61A 5DDGA 1DQUA 2VR1A 3A02A 1XMOH 2R7RA 3J81K 3CDLA 4QSHA 3ZN1A 5IT3A 2GBYA 2QYOA 1IN7A 1WWXA 1CQTA 3Q8PB 5HODA 2R7XA 3HPGA 4FBTA 3Q0UA 2KDZA 2DMNA 3ZMDA 5KG7A 4GKJH 2R7UA 3DEEA 1WSCA 4HX4A 1Z77A 1IC8A 2WA0A 3G71I 3BJ6A 2EQRA 3IP4B 1O3SA 4XK4A 1WJCA 1HQCA 4CO8A 4IQ4A 4A3MJ 4AVZA 1AU7A 5FLMG 1X4OA 4PWQA 1MSEC 5F0HA 4G7OF 4O2BF 3TKYA 2L9VA 2Q8KA 3TDUC 5C44J 2NS7A 3RB3A 2DLLA 1Y0UA 2MH9A 4FS2A 4JX5A 3ZQHA 3M7GA 4UCUA 3QRFF 3A03A 2R7OA 4CYDA 2MYSA 5F0FA 1ETXA 3HM5A 1J5YA 4I7HA 4XR6A 4MV6A 2W70A 2HXIA 4NC8A 2ZSIB 2RC4A 2VBYA 1TWAJ 1JGSA 2OTLI 4TUYF 4MHGA 4DV6H 3V6HA 2FX0A 4I6ZA 1W0UA 3RSNA 1BL0A 3ABMH 1T08B 4ZYGA 2EINH 4Q8EA 2F5CA 4EGZA 2UVVA 2KT0A 1MDMA 4KISA 5K2MA 2IAIA 2E1MC 3WG9A 1JX4A 1OCOH 1Z67A 4AIKA 3OYLA 3U2RA 4MEXF 2OQGA 3BABA 1FMVA 5LRSA 2VUGA 2BHYA 3PQKA 5LRRA 1QQIA 2JA6G 5KFXA 4E4HA 2DO7A 3H4DA 4IRKA 3GTGA 2R7DA 3HOYJ 2JQ7A 2PI0A 2CQYA 3RTRA 4NXMH 1ZQ3P 2CQNA 2HDCA 4F55A 3PSFA 2PLYA 3LSRA 5LP6F 3MZYA 5HDGA 5K1YA 1WKMA 2HYJA 5KFGA 2OTJI 3DPLC 2QM3A 1M7JA 4ECZA 1U5TB 4DYCA 3SDGA 5C4XJ 3LFUA 5M5WJ 4BU2A 2DI3A 4CH7A 2AQFA 4QTRA 2PMHA 3I58A 4D9JA 5EF6A 2H8RA 4RGUA 2VE8A 1POGA 1MJAA 4HDUA 4XKWA 4IJAA 3HOZJ 3GCMA 5GONF 2COBA 5E17F 2UUCH 4RA2A 2DYSH 4MV1A 2GOXB 2X1CA 2PN1A 1HCRA 2OCCH 2VKDA 4KFCA 1P6RA 4KNYA 1E4FT 4HYEA 4IQJA 2Y0SE 4UCSA 4YAKB 2XGQA 3F8FA 3BCAA 1P4WA 3BR1A 3D1NI 5ICFA 4EJWA 1MDMB 4C3IJ 4EJOA 2W6MA 4FE4A 3LP8A 2O6GE 1IN4A 1ZGJA 3KTMA 3N8DA 1ACIA 1ZREA 2O7OA 1KU3A 2K5CA 3QYEA 2PN6A 1CF7B 1W5SA 4EBDA 5KFDA 2R92G 1FEXA 2HTSA 2YZMA 2K9MA 2CYYA 2R5YA 5H2FC 3KZZA 4LH6A 3N43B 4S0HB 1KONA 4Q48A 2IW5A 2H1KA 2MSYA 4LIVA 2V9PA 4D5FA 2DA4A 3LSTA 3WO0A 4EEFG 3CQZA 5E3MA 3LA2A 2E2IA 1FZPB 4U0YA 1KYWA 4Y8VB 3TINA 2JA5A 2YUSA 5I47A 3SQNA 2YU9A 1Y1VJ 1JIHA 4Q8FA 1V5GA 4EGJA 3BQ1A 1VI0A 3QPSA 2XKOA 2LK2A 3GYHX 2W6NA 2IA1A 4WCGA 3S32A 4XRMA 2ZCWA 3KHLA 4A5NA 1B6AA 1ZRFA 3AG4H 2HPMA 1AUVA 4PFPA 3MWEA 4EEQA 2KRFA 4IRCA 3BWGA 2DQLA 3FM5A 1D1BA 4F50A 1K6OA 5J40A 3L1PA 1Y1WG 3QU6A 4MIMA 2L5QA 4YB8B 4HZFA 4TV9F 2JA5J 5D1OB 3ECHA 1VQPI 1XSXA 2XUBA 4BDZA 2JZYA 5KFBA 4GXOA 1ZG1A 1K7AA 5AIQA 2HVSA 1IF1A 3S3NA 1OCZH 3IV5A 3JTGA 2NNYA 1Y1WJ 4EYHB 2K40A 2V26A 2DN0A 2VB6A 1LVKA 1TW3A 3PUBA 2Q2UA 3J80K 2WAFA 3OL3A 3FWEA 3J7YJ 1A9XA 1SYXB 5IYCJ 4KN7X 4H4KC 1RJRA 4P9FA 3ZQQA 2I8DA 4J9MA 3RKQA 1RYSA 1QO0D 2QENA 4Y13A 3HOYG 1EA3A 3Q0WA 1X58A 3M8FA 1TWFA 2QZ8A 2IGNA 2M0CA 5IOZA 3ROUA 4DL5A 3I5UA 4X64H 3C7JA 2R93A 2GOMA 1IOVA 4KICA 4DYQA 3WU1B 1KJ8A 2ZJ2A 4RLQA 4XLPF 2HDWA 3RV4A 3C18A 2WAQN 3GFJA 1AOYA 3JSOA 4F93B 4GYGA 1W36C 1A35A 2FK1A 2NVXJ 4P1WA 3F23A 3CCUI 3DCFA 1TT0A 3ETHA 2UVUA 3L00A 2XAFA 4UFZA 1P9QC 4C30A 1Z2PX 3RJ0A 1R4MB 4OAYA 4DZJA 1AWCA 3KHHA 1SMTA 2KP6A 2DFFA 2LY1A 1UZCA 2K3PA 3GZNB 1VTNC 1FJGH 4CCJA 2RGRA 4JI7H 4BE1A 4F4WA 4I4TF 5J4VA 1Z7UA 1QZZA 4O5VA 4IRIA 4MFDA 3WU2C 2CUEA 3JRDA 1UC8A 2L02A 2IEKA 3DBLB 4QIWE 2R4GA 1UFMA 2VBWA 4ABZA 4CCNA 2I8CA 2UUBH 5EEAA 2DA3A 5EGOB 2NXNB 2Q0OA 4BQNA 5KFJA 3QZ8A 2X9DA 2Y30A 3QYBA 4UUSA 3R5FA 1R6RA 2OCEA 4WXDA 1Z6RA 3G6YA 3HGGA 4LF7H 5J1UA 5DG9A 1Y14B 1VS0A 4UVCA 3HOWG 2V1NA 2A05A 4KT5C 2XIGA 4LFUA 5HS9A 4QW8A 2NU8B 1DU0A 2A69F 4R79A 3K1PA 2QSHX 5JVLA 4B3XA 6PAXA 3K0LA 5F08A 3GTJJ 5DQHA 1Y8RB 2PMUA 3OYIA 2DPJA 3LSJA 1ZQ7A 2E36A 2P4WA 3H0GG 1HNXH 1WCMG 4YR2A 1ZETA 3RJPA 1QNTA 2GZWA 3K70C 4AC0A 1ZHQA 4JI5H 3HBLA 3I4PA 2EK5A 2L01A 1BIBA 2VJIA 4XRFA 5GPCA 3CD6I 3WTTC 3N40P 1VFCA 1LJ9A 1ETWA 1FTTA 2BY1A 3Q2OA 3JSPA 4YR0A 4EBCA 1D8JA 4JI3H 1MBFA 2FB9A 1KBLA 5KCMA 3VMMA 4YAJB 4BDYA 4BQOA 2HYFA 1LDJA 2XGCA 4WX9A 1X1AA 4MEYF 1U2WA 1Y8QB 3F9KA 1EHIA 4KIGA 5M3FJ 2CW0F 4MQVA 1FX7A 3BTLA 5EWFA 4RU9A 2FPIB 3N4MA 3M1CA 3T8RA 2ALZA 2W7PA 1GSHA 3K3VA 5HDNA 1R9TA 5CVRA 5IY5H 2QGUA 2L9NA 2E2HJ 1TWCJ 2X1DA 5FLXZ 2NOJB 4BE2A 2FLLA 1VZ0A 4JX6A 2ESNA 3AL0C 3WTYC 3H92A 4RAFA 4PJNA 2ASJA 4KT6A 2OF7A 4CYCA 1Z3XA 5M3MJ 1S9HA 1M0WA 3JSLA 2XC7A 3RIZA 2M34A 3M9OB 3I12A 1FVIA 2QSFX 2X51A 3WTSC 1BR1A 3H5RA 2R93G 2RQQA 4ED0A 4ECXA 2JT1A 4HF2A 2ZO4A 4A6EA 2CUZA 2X6YA 2EIJH 2LKSA 3OYJA 3GIQA 2KRHA 5DQIA 4XORA 2O3FA 1BN5A 4LG3A 3VYRB 4EM0B 1T36A 3OR2C 3BJOA 1O7LA 3HOVG 3RKYA 5CQGA 4RUCA 2AGOA 2YCHA 4FETA 3CJNA 3V8LA 1R9TJ 4V19K 5EZYF 3IL2A 1EJ9A 3K7AJ 4L0ZB 1S8NA 5KT5A 2ZMEB 4DLKA 1PP8F 1WJFA 1YW8A 3TP0A 2XF7A 4OIQF 3PVXA 2DFIA 4XYLB 2LBFB 2FLNA 3I3LA 3CP8A 1VQ9I 5IP7G 2VQFH 4BY1J 2F48A 3S1NJ 1IXRC 3DKXA 3TQTA 1J09A 3BTJA 4ECTA 1KJJA 3LOCA 1O75A 1GYFA 1JJ8C 1OYYA 5E8IA 1UELB 4A3CG 2CFOA 2R7ZG 1FNNA 3L2UA 1MMNA 2LVSA 5KFAA 4ESBA 2MLKA 1PUFA 5EWGA 2FSWA 5HS7A 4ZYHA 3J81Z 3G1OA 4LF9H 3BZ6A 2LBFA 5KFVA 5FO5A 3GZ6A 5LBQA 2Z33A 4PJLA 1NK2P 3WTXC 2DA7A 4DUZH 3HOUG 5L1LA 3CMMA 2UUZA 3VSKA 2L4MA 1R5GA 2ID3A 3UNGC 1WH2A 2FRHA 2ZMEA 3DU6A 3N6XA 1SMYF 1ZGAA 3BDDA 5FJ8J 4AIJA 3COAC 2R7SA 3PO2G 1Y56A 3H5NA 2UXCH 3BA9A 2RF4A 4ZQIA 4LSXA 2KZVA 4B47A 3LMLA 3T1HH 1K4SA 3SHFA 5IPAA 2K02A 3CJQB 5JI6A 3VWBA 2OLSA 3MR6A 1T33A 4P5OA 4J9PA 4CGZA 1BOAA 3OYGA 3PFYA 4AIDA 2V9KA 5KT7A 4EGQA 1XNQH 1W96A 1T39A 1S72I 5EWEA 3OS0A 3CMAI 3OYCA 4BACA 2UXDH 4W1UA 2LR8A 4P55A 2VXZA 4ZYEA 1G3YA 2NVUB 4OIRF 1D3YA 5IWAH 1DUXC 5D8KB 3HRSA 2EZIA 3DF8A 4NQWA 4DR5H 2IBKA 3J7AY 3BAAA 4ED7A 5GAEJ 5DYMA 1JTYA 3E6DA 1JE8A 1I7NA 4YIRX 4IPAA 3H3VH 2AQ4A 5B3SH 2ZXIA 2HTJA 1SFOJ 4BQQA 4Z2YA 5DCMA 3E5XA 2DMUA 3VYUB 1BR4A 4F7ZA 1V55H 3GV8B 3CDHA 4NDLA 5FB2A 3S3MA 3ZMVA 4UNOA 1W93A 5IOYA 4N4NB 2FBIA 2CSOA 3LQQA 4BJTA 3IHUA 4C5BA 2ISYA 3I53A 3CC2I 2CQ7A 5TGTA 2VLAA 4LSAA 1IBLH 2OU2A 2TRTA 2K9NA 4RB1A 4O4IF 1RK6A 2A61A 3GTGJ 3WODF 4JYAH 2EV5A 1PUEE 2PFBA 4LF8H 1N48A 4ESJA 2WTEA 2QQBA 3WTVC 2ZSHB 1OJLA 2IS2A 4L0YB 2RVCA 3HEFA 1X3ZB 2Y9ZA 2SCUB 4WBNF 4FE7A 3W2WA 4DR6H 2QYZA 1S6LA 2KLOA 3GTQJ 3ECOA 4P96A 4PSWA 4U87A 4B8XA 3RF2A 1I6HJ 4LLGF 5L9XA 4UB6C 4B3TH 2XASA 1VKZA 2QQ9A 3BG9A 1B6RA 1FOWA 4JYKA 1ETVA 3CCRI 2L7MP 4OIPF 4YJ2F 2BOLA 3GQCA 1S3JA 1HDDC 3L2VA 4BJ5C 3QPLA 3T8TA 3ZMUA 1X4PA 1YX5A 2LRDA 3EUHA 3HGYA 4LFCH 4BXXG 3MWDA 5C5JA 3VDXA 3EUAA 2YS7A 2W7NA 3TGNA 2R87A 4A93J 2BXYA 1A04A 1JJ6C 5JVDF 3FXRA 4A3FJ 1SFEA 2LC2A 1ZRCA 4JUZA 2JA7G 2GXGA 3KPHA 4KUMA 1EZ1A 1DGSA 3V6KA 1TBXA 1TZLA 4ZC3A 3JRHA 3R5HA 2HVQA 4HX8A 2ICWG 4HBLA 4YIIA 3HOSA 5EG0B 4G7ZF 4DL6A 4XKBA 5K7HA 2JUGA 3F22A 3FKIJ 3S17J 2XCLA 1TQIA 3ZMTA 2HGCA 2M3AA 1WRJA 1QVTA 1F9NA 2B9SA 1S29A 3EQLF 3WTUC 3I4NJ 2BE5F 3ABKH 3JRIA 2FPGB 5DEQA 1SANA 4M9XA 1F4KA 3KLNA 2E7XA 2QLZA 3BQYA 4A2UA 2V4RA 2E2IJ 4XSZF 4GLXA 4JP0A 4Y17A 1FTZA 5JR3A 3OYNA 2E1NA 3FF5A 2XHKA 3O3KA 1XX5A 3VEPA 2L7KA 1M0TA 2YL2A 2YU9J 1A5JA 4Y52J 2GXAA 1P7JA 3TIIA 4E7SA 4OOIA 3Q8RB 2VQEH 2ISZA 3GUDA 1A31A 2DLNA 1FJLA 5KAIC 4EVIA 1D0ZA 3V4SA 3ZN0A 4CC5A 1VQOI 3PIPF 3FBNB 1FMWA 4BEHA 1YRNB 2CU7A 1RZ4A 2J6SA
chains in the Genus database with same CATH topology
1FT9A 3V7RA 4HW0A 3R60A 2H27A 3R61A 4RS8A 4YFXF 1FYKA 2QBYB 3CVZA 3FMAA 3LFKA 4AWXB 3CUQC 3U9GA 5JFRA 3QOPA 1N32H 4JI1H 1BI1A 1MZBA 2P5KA 1RI7A 1ZARA 1XB4A 3V8JA 2HS5A 4LG0A 4HX7A 3FX3A 1LVAA 4WF2A 1HNZH 4JI8H 3V7SA 4OU0A 1FSEA 1YFHA 1JHHA 4ENKA 3KFWX 3IWFA 1N36H 1S68A 5LMNH 1RNLA 5H6QA 1RIOH 1FBSA 3KEQA 1LQ1A 2XAQA 4B3SH 2K7LA 1SD7A 1USSA 2E1CA 1T98A 4MTEA 1USTA 4X62H 2P7CB 2V1DA 2XKPA 3QP6A 4KYWA 1WQ2A 1J75A 1ZAOA 2HR3A 3ZP5A 2DTRA 4LMYA 2EFPA 1HKQA 4HQEA 2D1HA 2EFNA 3RGZA 5L3BA 1P4AA 4LK0F 3REOA 3VOEA 3L4KA 2EWNA 3L7WA 4HV5A 5EEHA 5DCMB 1H9GA 2VOOA 3M1EA 4O6JA 2FBHA 4ESFA 3FZVA 4UV8A 3M4IA 4QLCU 1TQMA 2XROA 4YFKF 1SD6A 5ILSA 4DR7H 1FBUA 5DV5A 3L2PA 3MFKA 4J0MA 1EV7A 1MD0A 1L3LA 4A0YA 1SEIA 4G9YA 2CW8A 1IXSB 3IG0A 4MGRA 1YS7A 3LA3A 5ERIA 2RDPA 2KIMA 4M6XA 3TO7A 4HF0A 1HR0H 4I02A 5DUIA 3B02A 4MNUA 3T0YA 1U78A 2QBYA 5IT9K 1XN7A 4KN4X 4S04A 4R7RA 4FM9A 2PQ8A 2WWYA 4I01A 3RPQA 2MBFA 1KQ8A 1T0FA 3PQJA 2RV8A 1W7PA 2IPQX 4EJVA 1HW2A 2FF4A 2FNAA 2WYOA 2OAZA 1R00A 3KAJA 4B3MH 4X66H 1R58A 2KJCA 1BC8C 1FP2A 3L09A 3IRQA 1CGPA 4U7DA 4O3MA 1ON1A 1C0WA 2NAZA 3ABTA 2LDUA 4CC6A 4D0PA 2KIFA 4L5JA 4A2AA 2CGPA 1ZHSA 1G3SA 2VODA 2UZKA 4XSXF 2DK5A 3J81W 1W5TA 3TQNA 5BOXA 1K79A 5E20A 2OZ6A 3OOPA 2FA5A 5BMZA 4FHTA 2NS0A 3D5LA 3QAHA 3UQ8A 5AONA 1XCBA 1S7OA 2HGSA 4R8HA 1HBXG 1YYVA 2RKHA 1Z2NX 4JI4H 2MC3A 4UHTA 2HWVA 3F8MA 4A0XA 3HYIA 4KIFA 1U8RA 3BY6A 1Z1DA 4OMZA 2CWEA 2XRNA 4LGWA 2P6SA 1K78A 5JHUA 1D8KA 2A3SA 3GFIA 5A2QW 1UHWA 3TDZC 4XBFA 2VONA 2Y0MA 4DR3H 1O3QA 1T2KA 4M7EA 3ULQB 1DDNA 3NEUA 1Q1HA 3T1BA 1XGOA 3ZQ7A 2YSRA 3KCCA 4CZZA 2B0LA 5FLXK 1RUOA 1SD5A 3R0AA 5BPIA 4HDVA 4RB3C 1XGSA 1V4RA 4KA4A 3WU0A 2A5YB 3WTZA 2IT0A 4YY3H 2HOEA 1FYMA 3V8KA 2EV0A 3ZMZA 3CLOA 3WGIA 4R1HA 1BC7C 3JSNA 4N9HA 4HF1A 4EFEA 3N97A 2EFOA 4GO1A 5DUKA 1QBJA 3CO6C 1ULYA 4B3RH 3EDPA 1R36A 4L9JA 1ZLKA 1YTYA 1EH7A 3QPHA 3GLXA 1OMIA 5BS6A 1B04A 4UVBA 2QWWA 5ICCA 2BGCA 2M8EA 3GX4X 3GFLA 2M87A 2GIVA 4I0AA 2VC0A 5CJ9A 5J8FA 1HW5A 3DPTA 4BAYA 5L3GA 2OD5A 4RGRA 4UCVA 1TAEA 4ZH4F 5KVRA 3KZYA 5F64A 4N0BA 2C6YA 2FEZA 5E8GA 3QPTA 4M9SA 5HLHA 4AIHA 4G7HF 1BI0A 1U5TC 4PDBA 1I6XA 2EA4A 5ICEA 4DUYH 4HLYA 3K2ZA 5ILUA 2IVMA 3KALA 3KAKA 3WGHA 1KU7A 4EQQA 3CUQB 3RTXA 5JVTA 1TW2A 4LFAH 4NB5A 4DV7H 2CQKA 2YR2A 2P8TA 2EB7A 2P6TA 2HEOA 2PJPA 2DQRA 2R3SA 4HAMA 1AN7A 2DU9A 4PGGA 3OV8A 2QVOA 4RB0A 4NXNH 4UVAA 2F4VH 1L0OC 2K4JA 2W57A 5BPDA 2HQNA 2J5OA 4N9IA 1SFXA 4Y15A 3GZ5A 3C1DA 2STWA 2F5DA 3I59A 3F3XA 3F6VA 1HKTA 4HV6A 1K78B 2UU9H 1G3WA 3IWZA 2D45A 2UXXA 2ZFWA 4IRHA 2QUFA 1Z2OX 4YFNF 5FD6A 2G7UA 3E6CC 1YIOA 1IN6A 2VN2A 1KGSA 3HSRA 4CHUA 4H0EA 1E4GT 4A6DA 1IBMH 4M73A 3J80Z 1RUNA 3TO6A 4CDGA 2HQRA 1S7AA 4DR2H 3F6OA 3ERED 3J7AK 3TOBA 4AVPA 3IKTA 1BI3A 3C0FB 3ML6A 4BNCA 3KP3A 1DPUA 3SXYA 1T38A 5LGUA 3HIFA 2GQQA 2ZJTA 2O03A 1XDUA 3IKVA 2A68F 3RPUA 4LD5A 3QP5A 3RI4A 5HOOA 2X4HA 2WC2A 5D5UB 2Y48A 3K1MA 1YW7A 4EMSA 4JI6H 4HA8A 1O3RA 4GCVA 3N44B 3J7AO 4BQAA 1I27A 1W7PB 3KETA 4UCRA 3WTWC 3M9AA 1Z91A 2UXBH 4G94A 1QZYA 2HYGD 2M45A 3SZTA 1G3TA 2WE6A 3HRTA 4KMFA 3VODA 1R1VA 4MQ9F 3HRMA 5LEKA 2DBBA 2LNBA 3O6BB 1TLHB 2WV0A 3L9FA 5ED4A 2ELHA 1LB2A 3LAPA 4P9UA 1IN8A 1EH6A 2D2WA 4QWQA 5CYVA 5LEJA 3LQRA 1ZG5A 1OYWA 1FP1D 5E1ZB 2Q2EA 3P9IA 4UUVA 2YPRA 5D8LB 3E6MA 4BHCA 2FXAA 1WI9A 2FQ3A 2Z9OA 4DR1H 1GXQA 3RKWA 4PDKA 4JI0H 3W6JB 2KKOA 3ISPA 3GFMA 2AS5F 1KA8A 1YO5C 4M72A 4LFBH 1J0RA 2YX4A 4L9VA 4RAZA 3T1YH 2P5VA 5HLGA 4L18B 4DV5H 1HSTA 4IHTA 1X9NA 3P7NA 3FHZA 4I98B 1BIAA 3HRUA 2RQPA 3BROA 1IRFA 2W24A 2XAGA 4U0VA 5CVUA 5J6XA 2KSWA 2MCTA 1KQ9A 4RB2C 3R4KA 2JPCA 3KE2A 2DAOA 3I64A 3GXOA 1N33H 2FU4A 4OIOF 3I54A 2DK8A 3GEZA 1TQPA 2RNJA 3C3WA 4KIBA 1XNRH 1TA8A 2V1XA 1LNWA 3TOAA 1OPCA 2K4BA 2MLGA 3FM3A 1IN5A 4ASNA 2GA1A 2A6EF 3KP4A 1JHFA 2Q2TA 1GXPA 2IJLA 5F1RA 2NNNA 4TV7A 2CFXA 4JBAA 5TJJA 4YHHH 1G6NA 4KMUX 1O3TA 1FY7A 4L9TA 4BXUA 4JI2H 2F5FA 4WK8F 4FX0A 3H3ZA 4LF6H 5F6FA 2J5PA 4U0WA 4BYYA 3DEUA 2KIUA 4DV0H 1OYIA 4LK1F 4LB6B 3PN1A 1FC3A 2CG4A 3RYRA 4FT8A 2BEOA 2F2EA 5K5RA 3P9CA 4LB5A 3FXQA 3HXLA 1HXDA 3KP2A 5D1OA 1XMQH 4M6YA 5H6RA 4DV4H 3FMSA 4EGYA 3KP6A 1P8LA 2DT5A 2AXLA 3LAJA 1P4XA 5FLXW 5J8CA 1XD7A 2A07F 1O7FA 3KEOA 5E1XA 2G9WA 2H6BA 2LSOA 3KLOA 3JW4A 4EEQA 3GWZA 3WE3A 2FE3A 2FOKA 2ZM6H 5HLIA 4UV9A 5D5WB 1J7KA 3TO9A 2K27A 2OZUA 4M71A 3FMRA 2Y75A 3HHGA 1WSUA 3ELKA 1A0IA 1W4MA 2OQRA 3VB2A 3DV8A 4JQFA 5D1PA 5IT9W 1E2XA 1JXSA 4EJUA 5AIPA 3DXJF 1FKAH 1D5VA 1LDDA 2STTA 3FMQA 3I59B 1I1GA 1REPC 4Q47A 4ENMA 3MZHA 2BBYA 1NHAA 5LGNA 3JAMW 3J80W 1N34H 4EV0A 1R23A 2ADUA 2MA3A 2PEXA 3MCZA 4PCQA 1ZN2A 1R22A 1CF7A 3B73A 1XMAA 5D5VB 5HVQC 3CO7C 1OR7A 3EYIA 2V6CA 1TNTA 4GGGA 4A12A 1FLIA 3E97A 1HKSA 1XMKA 1BBYA 2HZTA 2JSCA 1XCVA 2OWOA 1GHCA 2RGVA 2YX7A 5D6EA 2P5LC 1R1UA 2XGXA 1FYLA 5CVIA 5LHHA 2WDTA 1YS6A 1R5HA 4ZZLA 1B9MA 4PZJA 1J9IA 3KP7A 2DPDA 1STZA 2L4AA 3HTUA 2HHHH 4IRGA 4JV5H 2R7FA 1QPMA 2UWMA 3SFZA 1KYZA 4JK1X 3GVAA 4RGXA 4LF4H 1BM9A 2DPUA 4EJTA 1PP7U 4GKKH 2G7HA 3Q5FA 1ODDA 5K5QA 3MQ0A 3E5UA 5ILVA 2ESHA 4ENJA 2CW7A 1J2XA 1BI2A 5D5XB 3Q9VA 1I1SA 2M30A 1F5TA 4LJZF 2XAHA 2DW4A 1I6UA 4LG0B 1ZH5A 3K69A 5FPRA 4M9ZA 3EETA 1IW7F 3GF2A 2O8XA 5A2QK 1XGMA 4UCTA 2L54A 4Q5SF 5H20A 2JTVA 4GYIA 5DD8A 3RYPA 2ZXJA 3AAFA 1XSDA 2EV6A 2LF7A 4ZZDA 2VT3A 2Z3YA 3E3VA 4G6QA 2HKOA 4M74A 2VT2A 5ICGA 1U5TA 1FOKA 1R1TA 3RKXA 2CO5A 2VOPA 1IAWA 2VBZA 1S03G 1Z9CA 4LF5H 2ACJA 3FXUA 1FBQA 4KHPH 1XSVA 3HSEA 2BYVE 1Z05A 2VE9A 2FMLA 4I0BA 1IRGA 4CICA 4IAJA 4G6DA 1LEAA 2VC1A 4XLNF 2LKPA 3P9KA 1IXCA 5D4RA 1U6GA 1MKMA 1V3FA 3CUOA 2IA0A 2PG4A 2VOBA 2UUAH 5FFXA 3RDIA 3E5QA 3L2CA 2K86A 4HLXA 3R0JA 2KJBA 3T5XA 4I09A 4NHJA 4E70A 2GXBA 1YG2A 2ZBKA 3SZPA 3G3ZA 5LMUH 3EYYA 2P7VB 4U88A 3HSFA 3HUGA 2UXNA 1SD4A 4ON0A 4K0KH 3NRVA 1ON2A 3DQVC 3W6KB 2O0YA 1MGTA 3MAJA 5LL6b 3I71A 4PGHA 5FPOA 2VBXA 3MWMA 4U7BA 3F72A 2FMYA 2EJRA 5L3DA 1DPRA 1TTYA 1B59A 3DF7A 2F5EA 1H0MA 5BR8H 2H94A 5D6FA 4IF4A 4KDPA 3JAMZ 3JTHA 5E1WA 4BH9A 3RIRA 2JPBA 2EA2A 2IP2A 1FWZA 3BPVA 1QGPA 4YIFA 2V1UA 5HS8A 2D1VA 2H09A 4UXNA 4YG2F 1ZYRF 2MH2A 3BOQA 2OA4A 3BP8A 5CLSA 3KP5A 1HW1A 3OTOH 3V4GA 2QQAA 1B1BA 2W84A 5LLQA