4RB3C

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (25-MER)
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 37
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb3C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb3C02
1I1GA 4AIJA 1EV7A 1QQIA 2PEXA 2LKPA 5H20A 1OPCA 4KIGA 3QU6A 1REPC 4IPAA 4MGRA 3MQ0A 3IWFA 1ZARA 1JHFA 4RGUA 3HOSA 2F5FA 5LHIA 4U0VA 3NEUA 3TQNA 1LQ1A 4BQAA 3P9CA 4M74A 3FMQA 3R6SA 4K2EA 5ICGA 3BJOA 1R36A 1IXRC 3QAHA 1W7PB 3CTAA 1BM9A 4RGXA 3U2RA 4LK0F 1YS7A 4ZYHA 2H6CA 4ZZLA 4HX8A 3KZYA 2RQPA 5JI6A 5A2QK 4RB1A 4WF2A 2QENA 4M6YA 1DPUA 1ON2A 1RI7A 1O3RA 4RB3C 3ZN1A 3I53A 3I58A 1S8NA 2R7DA 1ONVA 3BOQA 1W7PA 3RPUA 3FWEA 5BQTA 3HTSB 5D6FA 4KUMA 5L3CA 2XAGA 1H9GA 2YX7A 2ZMEA 4UVBA 1IN7A 3DPLC 1FP2A 1SD4A 1EH7A 5DV5A 1U5TB 1IN8A 3IKVA 3KETA 1XGOA 3FXQA 2Z3YA 2AXLA 2D1VA 1J7KA 3V8LA 1UCRA 3K2ZA 3Q5FA 3T8RA 1U8RA 1CF7B 4LG0A 3L9FA 2RC4A 3WGGA 1MDMB 1HSJA 5K1YA 4S05A 2F5CA 4KA4A 2PMUA 1U5TA 2Z9OA 4KN4X 1GHCA 1CGPA 2HEOA 3HHHA 2VODA 2QZ8A 4YG2F 5D8KB 4HF2A 3LAJA 2Z33A 3DF8A 3N97A 4R1HA 5HS9A 3I4PA 5A2QZ 1DP7P 2QYOA 4Z2YA 2G7HA 5ED4A 3F3XA 2XASA 2YX4A 3BP8A 4N9IA 3DPTA 2F5DA 2FNAA 4WWCA 3TOBA 1B1BA 5E17F 1F4KA 4IHSA 4KFCA 4HQEA 2HWVA 3DQVC 2W57A 3G73A 3BJ6A 2FA5A 2XAFA 4FX4A 3DP7A 1R1VA 3J80K 4U7DA 4UHTA 3WG9A 1FNNA 1ZRFA 2VC0A 1ZYRF 2Z99A 2VONA 1P4AA 1FT9A 2W24A 4OIQF 1T0FA 3U9GA 3IRRA 4L9TA 2H94A 4IRGA 2H27A 2A3SA 1KQ0A 1LEAA 1TLHB 3ZN0A 3OOPA 3VOEA 1O3QA 1W4MA 1FBQA 2NNYA 5AONA 3E5UA 5CVVA 1WI9A 4MTDA 4M9ZA 1FZPB 4L0ZB 1T38A 1MJ9A 4EGYA 5AIQA 5BOXA 5FLXK 4HDVA 4HV6A 1OR7A 1YIOA 4KICA 2HZTA 3GUDA 2LSOA 1X3UA 3WTVC 2HDCA 2M1BA 3KP4A 3F6OA 2JZYA 1SFUA 1XDSA 3HRTA 2XUBA 3QU3A 1KQ8A 4OIPF 3P9KA 2MC3A 3FM3A 1W7PD 4UNOA 3ULQB 1B4AA 4F7ZA 3F21A 3TO6A 4OU0A 1KU2A 3FF5A 3O6BB 1P92A 1FOKA 4LGWA 3ERED 4G94A 1SFEA 2A68F 5J6XA 3I5UA 4XLPF 3IL2A 4RB2C 2IW5A 2GA2A 3JSPA 2GZWA 5CVRA 5CVJA 3D0SA 2LF7A 3K1PA 1QNTA 4Y17A 3MCZA 2FU4A 4G9YA 2MD5A 4G7OF 4EJUA 4Q5SF 3L09A 5H6RA 1XCBA 4HBLA 1YW7A 3GYHX 2OZUA 2MLGA 5EEGA 2VE9A 2DPUA 4HF1A 2A61A 5LGNA 4BAYA 4I09A 3FMSA 5J8FA 2O03A 1H0MA 2ELHA 3IHUA 3QPHA 2PG4A 1HW1A 3I59B 5FLXZ 5ILSA 3ZMDA 5HLHA 1B6AA 3DEUA 2L3DA 2PBIA 3CO6C 4OMZA 5D5VB 4A0XA 2CG4A 2STWA 3K1NA 2P5KA 2IP2A 1MGTA 1L3LA 1UHMA 2YU3A 3GFJA 3V7RA 4O5VA 2DBBA 3IKTA 3QP5A 3F22A 5JR3A 2EA4A 1RUNA 2H6BA 5TJJA 1BIAA 3BPVA 4Y15A 3RPQA 5DD8A 5HS7A 1BN5A 5HVQC 5ICEA 2UXNA 1FYMA 1W5TA 1K7AA 3GWZA 4M71A 1KYWA 3HSFA 3JW4A 5LGTA 2IVMA 2EFQA 5D4RA 2A6EF 1LB2A 3H3ZA 4A12A 6PAXA 4XSZF 1S7AA 4HF0A 4BYYA 4G7HF 1R23A 5J8CA 3I71A 2EK5A 4Q4ZF 1Z91A 1IAWA 3V8KA 1PP8F 4LMYA 2QBYB 1R7JA 1OYWA 3L2CA 2XHKA 2A07F 2OD5A 3ZMZA 4WXHA 3RTRA 1YG2A 4M73A 2STTA 4GCVA 1J0RA 3HUGA 1W5SA 5K5OA 1FY7A 3B02A 4JBAA 3BROA 2W25A 4CDGA 1I6XA 2K4BA 1U2WA 2C6YA 1O3SA 2OQRA 2GAUA 1UFMA 1BI2A 1GXQA 2EV0A 5L3FA 4EM0B 2KKOA 4MNUA 3JAMK 4XSXF 2AS5F 3O3KA 4KIBA 1DPRA 2GXGA 3ECOA 1IW7F 3TOAA 2X0LA 3WTZA 1J59A 2FMYA 5CVUA 2HOEA 2VOPA 1XGMA 1D8JA 2DFIA 2OZ6A 1J9IA 3HTUA 1USSA 2L4AA 4GO1A 3KE2A 4ENJA 3HSEA 4HOBA 2Q8KA 2JPBA 2V9VA 2YSRA 1TW3A 1XGSA 4XBFA 1FYKA 4UXNA 3BPXA 2WWYA 1FBUA 4D0PA 1FP1D 1YW9A 2O61A 2MH9A 4KMFA 1P6RA 4HX4A 3SQNA 4EJTA 4IJAA 2RV8A 4M9SA 4Q47A 3DV8A 4HA8A 2ZMEB 2IA0A 4IRIA 3DKWA 2XROA 3M8EA 5D6EA 2PLYA 1KU3A 4AIKA 4WK8F 1SD7A 1RUOA 1HXDA 1R5GA 4HX7A 1PP7U 3FXUA 2VN2A 3WU1B 3KEQA 1IXCA 2ESHA 1P4WA 1LDDA 2KIFA 5FGMA 4LG0B 1G3SA 1WSUA 1KYZA 5HLGA 1G3WA 3EUHA 3R4KA 2QQAA 1SFXA 3KP3A 1MD0A 2VBZA 1R5HA 2P8TA 1S7OA 4CGZA 2CW0F 1LVAA 1T98A 3GEZA 3JAMZ 2V6CA 4HZFA 1A04A 4HV5A 5D5WB 3T5XA 3JTGA 3REOA 4JQFA 4P96A 5LHGA 2GIVA 4FHTA 4P55A 2Y75A 4ZYGA 2W84A 3LAPA 1SD5A 2M8EA 2D45A 1K79A 4OIRF 1ZGAA 2L54A 3COAC 4LD5A 4BH9A 3GZ5A 3ZQ7A 2PMHA 3KEOA 5FD6A 1ZLJA 1H9TA 1NHAA 3I54A 5HDKA 1UB9A 4QWQA 1HKSA 5CYVA 4HW0A 2HS5A 1SMYF 1SAXA 1ZG5A 4U88A 5BPDA 3PQKA 1ZH5A 1XMAA 4DQ2A 2ZFWA 1ZLKA 2EFOA 4YIFA 2DTRA 5DYMA 3F8MA 5F1RA 2EFWA 2VT3A 3GFMA 4YIIA 2CYYA 2HYFA 4KDPA 1FC3A 4LB5A 3FM5A 5BPIA 2GXBA 1I27A 2LF8A 3E6DA 4I0BA 3F8BA 1IRFA 3ZMTA 4WX9A 2K02A 4M72A 1YS6A 2HYGD 4KIFA 4ZH4F 3M9AA 1B59A 1J5YA 3HRUA 1UHWA 1XDUA 2HKOA 2P5VA 2XRNA 3M7GA 2FSWA 4GGGA 2BYVE 1XB4A 3ABTA 3K1MA 1BI0A 1SD6A 3TDUC 2ACJA 3R61A 4AIHA 4U0YA 3WTTC 2P7CB 2OU2A 2QQBA 3BY6A 2MLKA 2HR3A 5FB2A 5DEQA 2LNBA 3GLXA 3LFKA 5D4SA 4PZJA 2DK8A 4LLLA 3BZ6A 1XMKA 2PFBA 1ZG3A 4L18B 3HRMA 2V1UA 2ZKZA 1ULYA 2PJPA 2QLZA 3HRSA 1LNWA 5DCMA 2EFPA 2HKXA 2QWWA 2Z5UA 3H92A 2DLLA 1T2KA 1YO5C 3VB2A 1OMIA 2QM3A 3ML6A 5ERIA 1AOYA 5HDGA 4CZZA 1I5ZA 4IHTA 1YQAA 4N9HA 1Y0UA 3BDDA 3ZMSA 4PCQA 2RDPA 4EMSA 4MQ9F 1B9NA 1KU7A 3CO7C 4BXUA 4G7ZF 4ENNA 2MBFA 5TRDA 2ZJ2A 4H0EA 1RNLA 3GF2A 4O6JA 1QZYA 2DI3A 5E1XA 5L3EA 1TNTA 3ELKA 2VE8A 5ICCA 2MH2A 2WV0A 1AWCA 4G6DA 2UXXA 3R0JA 3NRVA 3KFWX 2JPCA 4CICA 3W6JB 1R1UA 2RVCA 4MEXF 3ISPA 5LRSA 2Y0MA 3GW2A 2FXAA 3WTWC 1ZRCA 4A0ZA 3WTUC 3N4MA 1TNSA 4WXDA 2BEOA 3J81K 1J75A 2IT0A 1S29A 1BC8C 3ROUA 5L3BA 2VBWA 1B9MA 4KNYA 4NB5A 1KU9A 3JSOA 3LWFA 1XGNA 2WTEA 4N0BA 2NS0A 2EV6A 4PDKA 2XKPA 1LDJA 2PI0A 4NQWA 1R00A 2IA1A 1GVJA 1BBYA 4XLNF 4A2UA 1HKQA 3FZVA 4TV7A 3PQJA 3WTSC 2XKOA 4A5NA 1V3FA 2ZO4A 1GXPA 3MFKA 1JHHA 3CUQA 2UZKA 1SMTA 4A0YA 2E1NA 3WU0A 4Q48A 5HS8A 3GXOA 1FLIA 1JGSA 3E5XA 4YFNF 4MTEA 4CYDA 4ON0A 4I02A 2EWNA 2M45A 1U3EM 1TQIA 2ESNA 5LEKA 3V7SA 1MKMA 3E97A 2HGCA 1WKMA 4UVCA 4CO8A 2ZBKA 1XD7A 2CWEA 1Z05A 3I64A 2XV4S 2V1XA 3ZP5A 3CUQC 3RKWA 1Z9CA 2VOOA 4OIOF 5JVTA 2HFHA 3WE2A 3WE3A 2L4MA 1EH6A 4HQMA 3TGNA 1Z6RA 3GZ6A 4IVNA 3GX4X 4B09A 5LLQA 3U1DA 1HSTA 1MJAA 1OKRA 3J81Z 2JT1A 5CLSA 5IT9K 3L7WA 3SZTA 2NYXA 4R8HA 3WODF 1U6GA 4EQQA 1KGSA 2WC2A 5H6QA 1TTYA 2O0YA 4IF4A 3L00A 4HAMA 4JK1X 3RJPA 3KZZA 2O8XA 5F64A 4B8XA 2BBYA 1PDNC 1L0OC 4AWXB 1QO0D 2G9WA 3M1EA 2VT2A 2P5LC 1XSDA 1IZ1A 5AIPA 4UUVA 2Q0OA 2FMLA 1FWZA 4KMUX 5E20A 4GYGA 1ZAOA 4ESFA 4MQVA 3KP7A 4FT8A 3CUOA 1FX7A 3LA7A 1C0WA 4BNCA 1P2FA 1VTNC 2HQRA 5FFXA 4I98B 2KRFA 4BHCA 1E17A 3IC7A 2RGVA 1FSHA 4ZZDA 1O3TA 3FHZA 4NHJA 4L9JA 3T1BA 5DD4A 1XCVA 4KYWA 3E6BA 3F6VA 2UWMA 2FE3A 3EDPA 2ZXJA 4UV9A 3T0YA 1QZZA 3E5QA 4LJZF 3GFLA 1K6OA 3QRFF 3MAJA 3E6CC 2F5EA 3C3WA 5FFZA 2FEZA 3EQLF 4I01A 2NRAC 2CFXA 1Q1HA 4YFKF 2EA2A 5IT9Z 2A5YB 2B0LA 2GA1A 2O6GE 4IRHA 4MEYF 3K69A 1FBSA 3GO5A 1STZA 1Z6TA 1ZN2A 1WWXA 3HHGA 3ABUA 1WRJA 2FBIA 3J7AO 3EYIA 3VEPA 1IF1A 3HIFA 4L5IA 3AAFA 5CJ9A 1ON1A 2FQ3A 1U78A 2HTSA 2BGCA 4I0AA 2ETHA 3QP6A 3KP6A 3WTXC 5LBQA 4P5OA 2M5WA 4WXCA 4S04A 2K86A 2E1CA 1K78B 2EFNA 4OOIA 2EB7A 2QVOA 1XSVA 4A6EA 2MA3A 1LJ9A 2XAJA 1YW8A 3H3UA 2COMA 2KIUA 5LGUA 2FNPA 3P7NA 5DUIA 5E1ZB 3I0TA 2E7WA 1YYVA 4QLCU 4RB0A 2V1DA 3CJNA 3K9TA 3QPTA 1YLFA 3GFIA 1K78A 3F8NA 1BC7C 3O2PE 4ENMA 2RKHA 3E6MA 2VC1A 2W85A 1QPMA 5CVIA 3EYYA 1F5TA 2PN6A 2DPDA 2VBXA 3MEXA 2KJBA 3ZPLA 2LDUA 2P6SA 1MZBA 1HKTA 1MJBA 3MWMA 3HOTA 1I1SA 4WCGA 2NAZA 1G4DA 2DT5A 1FPQA 2OQGA 4GYIA 3T8TA 1O7LA 1CF7A 1S6LA 4KN7X 3F72A 5L3GA 2P4WA 1MDMA 1HBXG 4HLYA 2KIMA 4AVPA 2IJLA 2XGXA 2DU9A 3HYIA 1TQPA 4PGHA 1LEBA 2K4JA 2DQRA 5LRRA 2YPRA 3EETA 2V79A 2JSCA 3V7CA 1U5TC 4ETSA 1Z1DA 2IPQX 3LQQA 4RAYA 2RN7A 4P9UA 2K7LA 3BJAA 3K0LA 3WGHA 5ILVA 5JHUA 5DDGA 1S3JA 4RGSA 1Z7UA 4ASNA 2RNJA 2QQ9A 3SZPA 2FF4A 3W6KB 1ZGJA 5HDNA 2CO5A 3SFZA 4EVIA 2OBPA 5DCMB 3TDZC 5KVRA 1YFHA 4I7HA 1BOAA 5DUKA 1IN5A 1EH8A 3DFGA 1XN7A 4EJVA 1LDKB 3WGIA 1BIBA 4IXAA 2CGPA 2D1HA 5LEJA 3D5LA 1O7FA 1RZ4A 4ZYDA 3ECHA 3FMRA 5K5RA 2FBKA 2R3SA 4R79A 5E8GA 2A69F 1KQ9A 5L3DA 2P7VB 3E3VA 5DCFA 3F23A 1P4XA 1D8KA 2E7XA 4M6XA 2ZNZA 4CXFA 2BE5F 2ISZA 1ZRDA 3LSTA 3TO7A 1T39A 2FRHA 4YFXF 4LB6B 3MZHA 5E18F 2ZCWA 4EGZA 1V4RA 2M87A 1WQ2A 4Y13A 1R1TA 2F2EA 2M30A 4L5JA 4O3MA 4E70A 2K27A 3NQOA 4U0WA 4A6DA 2IA2A 2XIGA 2Q2EA 4UVAA 5E1WA 3V8JA 5FD5A 4P9FA 5HLIA 3S2WA 4LK1F 4FX0A 4RAZA 4L9VA 1IRGA 4EV0A 4ESBA 2J5OA 3QOPA 1QBJA 1HW2A 3KCCA 2JRTA 3MZYA 3TKYA 5EEHA 3J80Z 4U7BA 2OA4A 1JXSA 3BWGA 1FYLA 2PQ8A 4G6QA 4AD9A 1HQCA 1USTA 3V4GA 2J5PA 2Y48A 5ILUA 3HSRA 5F6FA 1BI1A 3CUQB 4CHUA 1OYIA 2TDXA 2P6TA 1TBXA 3FXRA 3RKYA 4XRFA 4HLXA 3IRQA 1QGPA 1JE8A 1OYYA 2CSOA 3Q9VA 2EJRA 2VBYA 4EJOA 3C7JA 3LQRA 3TO9A 1E2XA 3DXJF 2OAZA 2R7FA 4HDUA 1DDNA 3RI4A 2O3FA 4OMYA 2L01A 2XAHA 2HQNA 4EJWA 4ESJA 2H09A 3CLOA 3FX3A 4ZYEA 2JTVA 2DO7A 5D5UB 1F9NA 1TQMA 3RIRA 3M8FA 3PFIA 1HW5A 4ENKA 3CDHA 3OV8A 3KP2A 3RKXA 4BHBA 3SXYA 5IT3A 4L0YB 3VFZA 1J2XA 3LA3A 3IWZA 2FOKA 4M9XA 4OINF 1T6SA 2DK5A 1D5VA 2KJCA 4LFUA 3I59A 3KP5A 1R22A 5K5QA 2A6HF 2IRFG 5JFRA 1DUXC 1FSEA 1ZG1A 1O57A 4LLGF 4I2OA 3WTYC 3R0AA 2DQLA 4HYEA 1G3YA 3C1DA 2X4HA 2EV5A 5LHHA 3RYRA 1BI3A 2GQQA 1G6NA 3B73A 4UV8A 1IN6A 2QUFA 4BHPA 3Q9SA 5HOOA 2XVCA 1IUYA 4MHGA 1RIOH 1D3YA 1YTYA 2GWRA 1IXSB 3ZMUA 2CQKA 4DNCA 3VODA 3KLNA 3KLOA 2HTJA 2ADUA 4L9NA 3R60A 4GXOA 3RDIA 4A5MA 3F8FA 1ODDA 5ICFA 1ZREA 3F8CA 4EM2A 2XAQA 4LLNA 1IN4A 3GVAA 1R58A 2L02A 2YR2A 2NNNA 4RS8A 4PGGA 2VXZA 2ZNYA 3C18A 1TW2A 1F1ZA 1KA8A 1XSXA 5BMZA 1G3TA 5D8LB 5E8IA 5KK1A 3JTHA 2DAOA 5BS6A 3G3ZA 1BJAA 3P9IA 2QBYA 5FO5A 2BV6A 2G7UA 4G8XA 3LA2A 4RGRA 5D5XB 4EM1A 1PUEE 3RYPA 3SHFA 2DW4A 2ISYA 1ZHFA 4KT5C 3ZMVA 2FBHA 2D2WA
chains in the Genus database with same CATH superfamily
3H9JA 3KIOA 5LYJF 4A3DG 1PYVA 1I1GA 5DM7F 5K7ZA 3N42B 3PO2G 1M0TA 4ZYAA 4AIJA 3DF7A 5D1OA 5EWGA 4ECRA 2UVRA 3OS1A 1EKEA 4C5AA 2UUBH 1EV7A 4BQQA 5M3FJ 1QQIA 1A6IA 2PEXA 2LKPA 3LWBA 4ED0A 5H20A 1OPCA 2XSDC 4Y8VB 4KIGA 5KT5A 3QU6A 5EGOA 1REPC 4IPAA 4MGRA 3S3NA 3MQ0A 2DFEA 3IWFA 5D1PA 1H89C 1ZARA 5DG8A 1JHFA 3AG3H 3IV5A 1IGNA 1WCMG 4LOCA 4RGUA 3HOSA 3TEDA 2DXIA 2R93G 2F5FA 5LHIA 4AU7A 4U0VA 3V4ZA 1VZ0A 3NEUA 3TQNA 1LQ1A 4BQAA 3P9CA 4XKBA 5CA0F 3JR9A 4M74A 2W6OA 3FMQA 2XPUA 3R6SA 3TW6A 3M4OJ 2M4GA 4K2EA 5ICGA 2JUCA 3BJOA 5F27A 1AU7A 1NK2P 1R36A 2WDTA 2EZLA 1IXRC 2WAEA 3K4LA 3QAHA 4BJTA 3R5HA 4B3RH 5FKKA 1W7PB 1VAJA 3CTAA 4NLGA 1BM9A 2WB1N 4RGXA 3U2RA 5KX5F 3DBHB 1VBGA 2VIXA 4EFBA 2LFBA 4LK0F 3JRCA 1YS7A 4ZYHA 4RUCA 2H6CA 2VB6A 2J9GA 3N43B 4ZZLA 4F52A 1RK5A 1TAEA 4HX8A 2MD0A 3KZYA 2RQPA 5JI6A 5A2QK 2ATLA 2EIMH 3ZCOA 3BR6A 5IYDG 4RB1A 4HQ6A 2OC6A 2UXDH 3E5NA 1Q1VA 4WF2A 4XYLB 2QENA 1QPIA 1WJFA 4M6YA 3FXKA 1DPUA 1ON2A 1RI7A 4BL0B 5IYBJ 4NXNH 1O3RA 4RB3C 3ZN1A 3I53A 5LMNH 2V26A 3I58A 1S8NA 4XLEA 2LH9A 2R7DA 4JV1A 1IUFA 5M5WJ 2W4SA 3OUUA 2ZJPF 2R7QA 3G4SI 1ONVA 1RPWA 3BOQA 4QPQA 2RGRA 5J2TF 4IZZA 3J7AK 2QK4A 3LMLA 2M2EA 3N8DA 4JI6H 5H80A 2C2DA 1W7PA 3RPUA 4Z6YA 3FWEA 4L5EA 5BQTA 3HTSB 1MH4A 2BW3A 1ETKA 4KUMA 5D6FA 5L3CA 1LUJB 3P5JA 2XAGA 1WR2A 2JA2A 4BQNA 1H9GA 4XK4A 1JJ6C 3JRXA 4XKWA 3W2WA 1SEIA 2YX7A 2ZMEA 4JI7H 4UVBA 2X6YA 2ZXWH 2E60A 3BR2A 4RM2A 2BZTA 1XNQH 1JJ8C 2K9MA 1Z3XA 1VQ4I 1ETQA 4BE1A 3S2HJ 3HXLA 2COBA 1Y0NA 2W6ZA 2R5ZA 1N77A 1KONA 1IN7A 1N78A 2PN1A 4TQSA 1YITI 3DPLC 1FP2A 2CU7A 1SD4A 4II3A 1EH7A 1MIJA 5DV5A 1U5TB 5M5YJ 4A3KJ 3H36A 1IN8A 3IKVA 2VR1A 3KETA 1XGOA 3FXQA 3VPRA 5KFRA 2Z3YA 2FPGB 2M0CA 2PMZA 2AXLA 2D1VA 4F3QA 4M3BA 1J7KA 3V8LA 2OWOA 1CQIB 1UCRA 2FLPA 4A3CG 2ZXIA 3K2ZA 4XLFA 2XRLA 4KITB 3Q5FA 3T8RA 3L1PA 2XGQA 1U8RA 2YL2A 1CF7B 1DGWY 3RCOA 4LG0A 5JHFA 4IRKA 3BG9A 3GTMJ 3L9FA 4Q8EA 2RC4A 3MJFA 1WVRA 2JEIA 4BGDA 3WGGA 4IEJA 4B3AA 4J00A 1HSJA 1V5GA 2X1CA 3RQ4A 1MDMB 5K1YA 3OYNA 1VQ8I 1V54H 4S05A 3EPIA 2F5CA 4KA4A 2PMUA 1U5TA 3ERMA 2WAFA 4IL6C 4RAFA 4DW6A 1S72I 2DJIA 4M7EA 3H5AA 2Z9OA 2BY3A 2ZMEC 4KN4X 4XRSG 4G12A 1GHCA 4DV5H 1CGPA 2HEOA 3H0GA 4JX4A 3AYHB 3H40A 3HHHA 5IWAH 1JX4A 2KRHA 5LA6F 2VODA 2QZ8A 4YG2F 1WGXA 5LXTF 4J9LA 4CYCA 3EUHC 3MWEA 5C1OA 1VQKI 1ZETA 4JV5H 3HOYJ 2W8LA 3WU2C 3HKZA 5DLFA 3N05A 4DBQA 2YZNA 1M0WA 4ABZA 4MV6A 5D8KB 3FKIA 4HF2A 2EBIA 2VPRA 4QTRA 3LSPA 3LAJA 4DV7H 1ZTRA 3FMAA 3E1SA 1Z2PX 3JRGA 2NU9B 2L2OA 4I76A 2Z33A 3DF8A 2W9BB 2XGDA 1K1SA 5B3SH 3N97A 3V6KA 5IYCG 3H0GG 4R1HA 5HS9A 2BY2A 3I4PA 3H35A 5A2QZ 3BQ0A 5CPRB 1DP7P 3KHGA 2QYOA 5F9NA 3BTIA 4Z2YA 2G7HA 4XM3A 4ECQA 5F0CA 5ED4A 1GLVA 2L7ZA 1MMNA 4IZOA 3SEZA 3F3XA 2XASA 2YX4A 1B72B 3BP8A 4N9IA 3DPTA 2F5DA 4JOMA 1VQPI 2C22A 3DEWA 2FNAA 1R49A 2R7ZG 4WWCA 1SYXB 3FKIG 3TOBA 1B1BA 1R4MB 3UFXB 4DV4H 5E17F 1F4KA 3A0HC 4IHSA 4GKJH 3RIZA 1E4FT 2LKSA 1P9QC 4HQEA 4KFCA 2W70A 2HWVA 4UCUA 4A3FG 2R5YB 3DQVC 5FRMA 2W57A 3G73A 3BJ6A 3N44B 2FA5A 2OCEA 3PNYA 2XAFA 2H8RA 4FX4A 2W9BA 4NC6A 3DP7A 4II2A 1XC5A 2HXOA 1A0IA 2I80A 1R1VA 3J80K 2ME6A 4U7DA 4UHTA 1MBFA 3WG9A 1FNNA 1ZRFA 4RNMA 3MWDA 2VC0A 1ZYRF 3OYMA 4DV3H 3CLQA 3GIMA 1IBKH 2AGPA 2Z99A 2VONA 1P4AA 1D0YA 3RBEA 2KQRA 1FT9A 2W24A 4DIQA 2DJNA 4OIQF 5KFQA 2JVHA 4A3GJ 1T0FA 3U9GA 3IRRA 5LD2C 4L9TA 1X1BA 5M3MJ 2PJRA 1OCOH 2DT6A 2H94A 3QQAA 5KT6A 4IRGA 2H27A 2A3SA 1KQ0A 1LEAA 2X9DA 2XAUA 1TLHB 2W6PA 3OL4A 3LL7A 2IS1A 3ZN0A 3OOPA 1UMQA 2R5YA 1KC7A 2V4RA 2IMWP 1KJIA 1E3HA 3Q8RB 1YJNI 2FK1A 2VUMA 3VOEA 5KFNA 2GLTA 2Y9ZA 4C2TA 1UG2A 1O3QA 2IGMA 1W4MA 1FBQA 2NNYA 4BBRJ 3OYJA 5KG2A 4U7CA 5F0HA 5AONA 3E5UA 2KZGA 5CVVA 1WI9A 3HPGA 4MTDA 4BEHB 4ME6A 3QYEA 4M9ZA 1FZPB 4IWXA 4H4KC 4L0ZB 4GDFA 2Q2UA 2FQ4A 4F4ZA 1ULZA 2TRTA 4BY7J 1DU0A 1A31A 1ERDA 1T38A 2CQ7A 1MJ9A 4FBUA 4EGYA 4C5CA 2RF4A 1W1WE 4BBSG 3CJTB 3VYTB 5F0FA 2ME0A 3CESA 5AIQA 5BOXA 1RR8C 2GPWA 5FLXK 4D7NA 4HDVA 2VUMG 1BJZA 1YOVB 4HV6A 1OR7A 2Q2EB 1YIOA 2IGOA 1W36C 1DU6A 3T1HH 4AM3A 1T0FC 4KICA 1E4GT 4RNOA 4YJ2F 3DTEA 2HZTA 4JX6A 1A35A 3NGDA 2VQCA 3GUDA 2LSOA 3IP4B 1X3UA 1FVIA 1I3QA 3WTVC 1JUSA 5B66C 1X3ZB 4IHJF 4ZQIA 3N40P 4QWEA 2A05A 4P1WA 2HDCA 4DUZH 1TWHA 2M1BA 3BTCA 2CUFA 4BEHA 4XZ3B 3GILA 1F43A 1I50J 3KP4A 3F6OA 2JZYA 1SFUA 4W97A 1XDSA 3HRTA 1X19A 2FJ1A 4I4TF 2XUBA 3CDIA 4J9KA 3QU3A 1HCRA 1UNNC 5KG1A 3OWTA 4C2MJ 1KQ8A 5HBRB 3BT9A 4OIPF 4AYBE 3P9KA 1EA3A 3PO2J 4RZRA 5EEAA 2PVPA 2MC3A 3FM3A 5DTDA 1JGGA 3D5SC 1W7PD 4UNOA 3RPUD 3ULQB 1IC8A 2H1LA 1GGOA 1B4AA 4LF8H 4QSHA 4F7ZA 3F21A 1WI3A 1DGRM 1D5YA 3TO6A 2KSWA 4BKXA 4OU0A 1KU2A 3FF5A 3O6BB 4XKVA 3BG5A 4BY1G 1P92A 2I5UA 1FOKA 4LGWA 4XIDA 3ERED 4G94A 5DG7A 3G6YA 1OR7C 3HOUG 2RDIA 1SFEA 2A68F 3I4NJ 4O4LF 4Y33A 4PK4A 5J6XA 3I4MJ 1B6RA 4DV0H 3I5UA 3GTJJ 4XLPF 3IL2A 3JRWA 3CC7I 2IW5A 5GADJ 4RB2C 2GA2A 2YCHA 1X1AA 2ZFUA 3JSPA 3FDYA 2GZWA 4LFCH 5CVRA 5CVJA 4HR7A 3D0SA 5L1LA 2H8WA 4PSXA 2LF7A 3K1PA 2O8KA 1QNTA 4A2AA 1Z2OX 4Y17A 3MCZA 4TQRA 2FU4A 3J81W 1GYFA 4G9YA 2UXCH 2MD5A 1MMDA 2L9SA 3J7ZI 1FTTA 5GAGJ 5C3EJ 4G7OF 3RTXA 5FLMG 1HF0A 5J4YA 4DR4H 4EJUA 4YEJA 4Q5SF 1TWAJ 4R7RA 4M6VA 3L09A 5H6RA 3VSLA 4B3TH 5L1IA 5IYDJ 2R6FA 1TT0A 3Q0VA 1DQUA 1XCBA 1VBHA 2VQEH 2I8DA 1YW7A 2WY7Q 4HBLA 3DLLF 3T5KA 4IWYA 2EQRA 4ED7A 3GYHX 2OZUA 2MLGA 2E2JJ 3JRHA 5EEGA 2VE9A 2DPUA 4HF1A 5EZYF 2A61A 3BR1A 2YRXA 1W0TA 1JTYA 4BAYA 5LGNA 3CCUI 4Q45A 4I09A 3FMSA 5J8FA 2C2RA 2O03A 2R7SA 1H0MA 3HB9A 2H1KA 2ELHA 2DOEA 3IHUA 3QPHA 1FMVA 3AG1H 2PG4A 1HW1A 4O2BF 3I59B 3Q0UA 5B1AH 5EJCA 1MNMC 4IR9A 2RNGA 4FQGA 5FLXZ 5ILSA 4AQYH 1E4EB 4QIWA 2XF6A 4D1QA 3LSIA 2XPVA 4YELA 3ZMDA 5HLHA 2ZJRF 1AN7A 1O75A 1B6AA 4F91B 3OTOH 3I56I 3DEUA 2L3DA 3CCSI 1HNXH 2ZSHB 3I9V2 2PBIA 2KMUA 3CO6C 4OMZA 3SDGA 3GTPJ 5D5VB 3OHBA 5C8YF 4XL9A 2QQ8A 4A0XA 3AFHA 4BJ5C 2V9KA 2LTPA 1V4YA 5B5EC 2R7TA 3N41B 2CG4A 2STWA 3K1NA 2P5KA 2Y30A 1Z3YA 4XOPA 3X2QH 4LF7H 2IP2A 2O9LA 1MGTA 1Y56A 1L3LA 1NG7A 1UHMA 2X48A 2YU3A 1RJQA 1FJLA 3PR5B 3GFJA 3BZKA 2CW8A 3V7RA 2XGPA 4O5VA 2R7VA 4YAKB 1W0UA 4D5FA 4HNTA 3LNQA 1E4EA 1OLTA 4E7KA 2DBBA 3IKTA 3QP5A 3EUKL 3F22A 3WO1A 1BOBA 4EBEA 3T5HA 5F9LA 1JXLA 5JR3A 2EA4A 5IOZA 2HDDA 3L4KA 2CZGA 4PDBA 2ASJA 1MMGA 4MV8A 1RUNA 3VPDA 1X2NA 2ELKA 2H6BA 5TJJA 1BIAA 2LG4A 3D1NI 1AHDP 3BPVA 3H3VK 4O3SA 2X6WA 2NUAB 2CUEA 2Y0SA 2DA4A 2ECBA 3Q8PB 5EWFA 1GT0C 1X1CA 4Y15A 3RPQA 1VQLI 5C44J 1ETYA 2ZC2A 5DD8A 5HS7A 3GV8B 1EJ9A 1BN5A 5H2FC 5HVQC 5GAEJ 3BR0A 5ICEA 3G1OA 3PIOF 4QIWN 4FE4A 5EDNA 1HLVA 2UXNA 4ZTJA 1FYMA 3KALA 5BPHA 5LMUH 4GKKH 1W5TA 1W36D 1PJRA 1K7AA 2GPSA 4F4WA 2AU0A 2DMPA 2JA6G 4IAJA 2X6XA 1YX3A 4Q43A 1Z77A 3OUZA 3GWZA 1WJAA 4HPQA 5J4VA 1LFBA 4M71A 1KYWA 2XF5A 4YHHH 1XX5A 3HSFA 4UCTA 3JW4A 5LGTA 2IVMA 2EFQA 5DQHA 5D4RA 3ASOH 2A6EF 5IT9W 3RBDA 4NC8A 3HOXJ 2G0EA 3JRIA 3O8HA 5DS9A 2M0MA 4C3HJ 4B3SH 4QPOA 3OYLA 1LB2A 3H3ZA 1N32H 4ED3A 1UC9A 4A12A 6PAXA 4GC7A 3KEYA 4XSZF 1S7AA 2X51A 4HF0A 1Y6IA 4QW8A 3HUGB 1MW7A 4BYYA 4A3BG 3CQZJ 4G7HF 1R23A 2ZDHA 4UCVA 5J8CA 3I71A 3S3MA 1WJEA 4XLCA 2EK5A 4ANJA 3LSGA 3ONQA 2R7ZJ 4Q4ZF 1R6RA 1Z91A 1IAWA 2FK3A 4DL6A 3ESWB 1TWFA 5C4XG 3V8KA 3R5XA 1VFCA 2EZHA 2XF7A 1PP8F 1DV2A 4LMYA 2Y0SN 2QBYB 1R7JA 1OYWA 3V42A 4CSWA 3KAKA 3JRDA 4HNUA 3L2CA 3GTGA 3FBNB 4XLAA 3HOWG 2XHKA 2A07F 2VI6A 1BR4A 3GTKA 2OD5A 3OSPA 2DDBA 3BG7A 2L7FP 3ZMZA 4XX0B 3TIIA 3CP8A 4A3LJ 5CQEA 2UVWA 2R4GA 2CRGA 3CCVI 2AGOA 2R92A 5C5JA 4UY8I 4WXHA 3RTRA 4A93G 4WBNF 1YG2A 5D8DA 3PM1A 4M73A 4S0HB 2STTA 2FK2A 4MO7A 2KDOA 4GCVA 1H88C 1J0RA 3HUGA 2J6UA 1W5SA 2N8GA 5K5OA 4V19K 2LREA 1PK8A 1FY7A 4DYCA 3B02A 1KZHA 3K70C 4IHXA 3G1LA 4JBAA 1I7NA 1CQJB 5D1OB 3UQ8A 3MR6A 2LY1A 5GONF 3BROA 3ZXSA 2W25A 1Y1WA 1BR2A 4UUTA 1IO2A 2DA6A 1SFKA 1S5LC 1I6XA 4CDGA 4Y4RA 2K4BA 4IQ4A 1MSEC 3K7AJ 1JUMA 3C0FB 3AG4H 2R92G 1U2WA 3BA9A 2C6YA 1O3SA 2CH0A 3G2BA 2OQRA 2GAUA 2WB1A 3OIQA 1TWCJ 4B43A 1UFMA 1BI2A 1GXQA 1K6YA 2W48A 3UKGA 2EV0A 2R7NA 5L3FA 5KCMA 2DYSH 2F5VA 3V6HA 4EM0B 2KKOA 4MNUA 5FJ8J 3JAMK 3OYHA 4XSXF 1IRZA 3RV3A 3M8JA 2ECCA 2AS5F 3O3KA 2MG4A 4KIBA 4DR3H 1DPRA 2GXGA 2DZDA 4E7JA 3ECOA 1Y1WG 1IW7F 3TOAA 3BA8A 2X0LA 3WTZA 4PJNA 1J59A 1SANA 1MBGA 2FMYA 2KISA 2GOXB 5CVUA 1IDYA 1IOWA 4A3JG 2HOEA 2VOPA 4QWCA 1XGMA 4UCSA 1D8JA 2DFIA 2OZ6A 1Y1VJ 1J9IA 3HTUA 1USSA 2L4AA 4GO1A 3KE2A 4MIMA 5E3OA 4U6PA 4K0KH 4ENJA 3EUAA 3HSEA 4HOBA 2Q8KA 3ORRA 4A2BA 2YU9A 1JUPA 3DPUA 2JPBA 1W96A 2V9VA 3VYSB 1HNZH 5CB4F 2YSRA 4NC7A 1TW3A 1XGSA 4XBFA 3OYFA 1FYKA 3GZNB 2KZVA 3BPXA 4UXNA 3G71I 3CCMI 3CMYA 4FCYA 5FRNA 2BQ3A 1S03G 1S97A 2WWYA 1FBUA 3KYCB 2WBMA 4D0PA 2X1DA 5DGAA 1FP1D 1YW9A 3D5RC 1WJ5A 3TP0A 3A01A 3M3YJ 1N25A 5JH7F 1R71A 2O61A 1C3OA 3RAXA 2MH9A 3DCFA 4KMFA 1P6RA 4HX4A 3SQNA 2YZMA 4EJTA 4IJAA 2RV8A 2DA7A 2W7NA 2EPFA 2BW3B 3QYFA 2E1MC 4M9SA 2CMPA 3CCYA 4Q47A 3DV8A 5E79C 2VKEA 3TL4X 4HA8A 2V59A 2ZMEB 2IA0A 4IRIA 5KFBA 2CQNA 5CAEB 3DKWA 2XROA 3M8EA 2CW7A 2R5ZB 1FTZA 4BY1J 2SCUB 3W3CA 1QHGA 5D6EA 1XMXA 2PLYA 1KU3A 2DFHA 4AIKA 2GXAA 3K5HA 2R7LA 3HOVJ 4WK8F 1SD7A 1WJBA 1U9OA 1RUOA 2KFDA 1WFXA 1P7IA 4E7ZA 2V1NA 3OL3A 2ZJQF 1B6SA 2F48A 1HXDA 1R5GA 1B33N 4HX7A 2FPPB 2QCOA 1ACIA 2JA5A 2JEFA 1PP7U 3FXUA 2C2EA 2LY9A 3OYKA 2VN2A 3WU1B 3KEQA 2VKHA 4PFOA 1IXCA 4IOAF 3HC7A 3VPBA 2JEGA 4YRVA 2ESHA 1P4WA 4J9QA 2KL4A 1LDDA 4MAMA 2ZXHA 4UB6C 5FROA 2KIFA 1VQ7I 2L9VA 4IHVA 3HBLA 5FGMA 4LG0B 2WAQE 3OR2C 1G3SA 1Y39A 1WSUA 1KYZA 2DYRH 5FLMJ 4QW9A 3GIKA 5KKNB 2QSHX 5HLGA 3AL0B 4V2GA 1G3WA 3M9MB 2JA7J 4XORA 3EUHA 3G8CA 5L9XA 3R4KA 4XN0A 4YJ3F 3KPHA 2QQAA 3OIOA 4PUSA 1SFXA 4C2UA 2FMAA 3W2VA 3RZDJ 1ETXA 1MD0A 2VBZA 3KP3A 4QJFA 1R5HA 2ELJA 2JA5G 2P8TA 2ZDQA 1S7OA 3N6XA 3BJYA 3BG6A 1N34H 4ZDLA 5BR8H 4CGZA 2CW0F 1ZR4A 1LVAA 4CYCB 4A3IJ 4KISA 1T98A 3GEZA 2XD4A 3JAMZ 4CC5A 4EFEA 2V6CA 4HZFA 1A04A 5KG7A 4CCJA 4UFZA 4HV5A 5D5WB 3FDSA 2NVYA 3T5XA 4KHPH 1K4TA 2X85A 4C9YA 3JTGA 3REOA 1W5CC 4JQFA 1XTAA 4J9RA 4P96A 5LHGA 3GTLJ 4E6KG 4BACA 1M6VA 3Q1KA 2CQXA 4DL3A 2GIVA 3OYDA 2E34A 3CJQB 2NVTJ 4FHTA 3PNVA 4P55A 3C2GA 2NVUB 2Y75A 4ZYGA 1BW6A 2W84A 2CQQA 3LAPA 3NWTA 2R7UA 4M3FA 2PMZE 4O4IF 1SFOA 1OFCX 2HVRA 2JSPA 4NBQA 3GQCA 1H8AC 1U9NA 3AKZA 2V4QA 1SD5A 2XB0X 4E7IA 4O3RA 2M8EA 3CP2A 2D45A 3M07A 3M9OB 1X1PA 1K79A 5IP9J 1VS0A 4OIRF 3HPHA 1ZGAA 3U21A 2L54A 3S3OA 2AGQA 2YS6A 3COAC 3I12A 1L2ZA 5K2MA 1FIAA 4LD5A 4BH9A 1OISA 5FPOA 4IRCA 2F4MB 3GZ5A 3ZQ7A 3RZOJ 1VNDA 2PMHA 3KEOA 5FD6A 1ZLJA 2NVXA 1H9TA 2W7OA 3CCQI 1NHAA 3I54A 3IH3A 4ECWA 5HDKA 4IOCF 1UB9A 4UUSA 4QWQA 4R8UB 1JKRC 4LFAH 2JA8G 2HOAA 1HKSA 3BABA 5CYVA 2HU9A 1JKOC 1FOYA 1OCCH 1MBEA 4RBOA 1SVMA 4HW0A 2HS5A 1SMYF 1SAXA 4W1UA 2R7MA 2UU9H 1ZG5A 2OTLI 1X3WB 3OIPA 4U88A 5BPDA 2B9SA 1AKHB 2K85A 1JDEA 3HKZE 3RUPA 5EZGA 3AL0C 5JVDF 4CA0A 4DV1H 3PQKA 1V5EA 1ZH5A 1I6HJ 2K9LA 3EPZA 1XMAA 3GCMA 4DQ2A 5LFAA 1TA8A 2FB9A 3ETJA 2PJRB 5C1PA 3Q3SA 2DFFA 2ZFWA 4DZJA 1YHQI 1ZLKA 4XRMA 2NU7B 1LFPA 3FBIB 3L2UA 2EFOA 4YIFA 3OYCA 2DTRA 1K83J 5DYMA 2W00A 1KJQA 3F8MA 5F1RA 2W1OA 1YRNB 2EFWA 3GMEA 4BUPA 4EGJA 4ZI7F 1PUFA 2VT3A 3GFMA 2E2IA 4YIIA 4PSWA 2JA6J 2CYYA 3MVPA 2HYFA 4KDPA 1FC3A 4LB5A 3FM5A 5BPIA 2GXBA 1I27A 1BL0A 2LF8A 3ABMH 4FS1A 3PO3G 3HOZJ 1S68A 3BTLA 4R8UA 3DU6A 4HSTA 3E6DA 4XMYA 1JDBB 4I0BA 5J2UF 2IAIA 3ZQCA 1DP3A 4B48A 4X1EA 2GM4A 2JWTA 3ZRGA 1VQ5I 2WYOA 1EZ1A 3L2RA 4FE7A 5FKNA 3F8BA 1MNEA 1IRFA 2F6CA 3F9KA 3ZMTA 1Z7LA 3GBGA 4WX9A 4MA0A 1ZR2A 2K02A 4M72A 2J6TA 5L1JA 5EG0A 1AKHA 2VQDA 1YS6A 2UUAH 3CF2A 2HYGD 3RB0A 4KIFA 3TQ1A 4A3BJ 4ZH4F 3M9AA 3CDLA 1B59A 1X4PA 1I39A 3RB3A 1E3PA 1J5YA 1POGA 2JRMA 3GTQJ 3HRUA 4ECSA 2DODA 1QRYA 1UHWA 1XDUA 3H9GA 1YRNA 2HKOA 2ID3A 2P5VA 1YJ9I 2XRNA 3KZIC 3M7GA 5C4XJ 2Y2ZA 5IP7J 2FSWA 2Z2SB 4GGGA 2BYVE 3RFCA 2F4IA 2MGQA 1XB4A 3S8PA 3ABTA 3K1MA 2OTJI 2B7EA 2M3AA 1BI0A 3CC4I 2YS7A 1SD6A 2O5RA 2Y69H 3TDUC 2ACJA 3R61A 3HOWJ 4AIHA 4U0YA 3WTTC 2E2HA 1FJGH 2P7CB 3CC2I 1ZHSA 2FJZA 5FLVA 2OU2A 2QQBA 2W6QA 4ZHQF 1RYRA 2DCEA 3BY6A 2XC7A 5HNHA 3ORQA 4FISA 2MLKA 4M3EA 4C5BA 1I3AA 2HYJA 3QPSA 2HR3A 4B44A 5DEQA 2LNBA 3A0BC 5FB2A 3GLXA 3LFKA 3QODA 1KJ9A 5D4SA 3J7AY 3PSFA 2KP6A 3KYDB 2UUCH 4PZJA 2DK8A 1TZLA 4ED8A 4LLLA 3BZ6A 5J47A 1XMKA 4JYKA 4B4CA 3GTOJ 4ECXA 3QYBA 4DV2H 4RU9A 3AG2H 3Q8QB 2PFBA 1ZG3A 4L18B 3DTIA 3RB4A 3FXOA 3HRMA 1A9XA 2V1UA 3RGXA 4MA5A 4DGWB 2VPSA 4I55F 1IV6A 2ZKZA 5KFMA 4E4TA 1ULYA 5E3MA 3E0JB 2QLZA 2PJPA 3HRSA 1LNWA 3PN1A 1HA8A 4CCKA 2VJJA 5DCMA 2EFPA 1Z2NX 2HKXA 2QWWA 2Z5UA 3CCRI 5KFJA 4RZQA 3H92A 1GO3E 2K40A 2XDVA 3TINA 2DLLA 1T2KA 1LKXA 4F4YA 1YO5C 3VB2A 1OMIA 2QM3A 3ML6A 5ERIA 1AOYA 5HDGA 2CFOA 1SEUA 2NU6B 4CZZA 1I5ZA 3HEFA 4IHTA 1YQAA 5KFXA 2WY8Q 1WH5A 4N9HA 4A3DJ 1Y0UA 3BDDA 4JI3H 3ZMSA 3KX2A 3GLKA 4PCQA 5EYRA 5KFSA 2RDPA 3FISA 4EMSA 4IR1A 3WG7H 2Z1DA 1GDTA 4MQ9F 5GTHC 3ZOBA 4YB8B 1B9NA 3H4BA 1KU7A 1SC7A 3CO7C 1EUDB 4PJMA 4BXUA 3H9QA 4G7ZF 4ENNA 1RC9A 4YY3H 2FLNA 2A5WA 2MBFA 2DOFA 1WCMJ 5TRDA 2R93J 2ZJ2A 4H0EA 2JVGA 4BXFA 1RNLA 4O2AF 3U9TA 3M9NB 1F36A 1ETOA 3GF2A 4O6JA 4LH7A 3MKWB 3KTMA 3RJ0A 1QVUA 1QZYA 2MYSA 1EYZA 2DI3A 5E1XA 5L3EA 1TNTA 5J1UA 1UC8A 3ELKA 2VE8A 5ICCA 1Y14B 3RKQA 5DGBA 4IRDA 2MH2A 2WV0A 5GPCA 1AWCA 5FPRA 4AVZA 4G6DA 4DL7A 2UXXA 3R0JA 5IYBG 4FM9A 2GLOA 4FETA 3PIPF 2GIZA 4BQOA 4JI2H 1ORKA 1YJWI 3NRVA 3KFWX 2JPCA 4GC6A 4CICA 3CCJI 4DR7H 3W6JB 1HNWH 5BNGA 1R1UA 1GV5A 2RVCA 1MH3A 3JREA 4MEXF 3ABLH 3ISPA 5LRSA 4ZDPA 2Y0MA 3GW2A 2FXAA 4NQWB 3WTWC 1DV1A 1ETVA 1N36H 3G6EI 4DR2H 4N4NB 4RA2A 2DMUA 2DTZA 1ZRCA 2JQ7A 3T1YH 4LG3A 4A0ZA 3WTUC 3N4MA 3K6GA 2HOTA 1XG1A 3S1NJ 1TNSA 4WXDA 1JKPC 2BEOA 3J81K 1V9PA 3DBLB 3MR5A 1J75A 2IT0A 5KFCA 3MR3A 4RMNA 1S29A 1ZHQA 2R8JA 2XSJC 3ZGKA 1ZQ3P 2V58A 3KHLA 1D1AA 1BC8C 3TIGA 5K7FA 3K5IA 3PL8A 3ROUA 5L3BA 2VBWA 3BQ1A 1Y8QB 2OJED 1IBLH 1B9MA 4KNYA 4NB5A 1KU9A 3JSOA 3GTMA 1WZ2A 4UCRA 3LWFA 1XGNA 2WTEA 4N0BA 3KAJA 4A3KG 2M34A 3BQZA 3FK6A 2NS0A 2IS4A 1XMQH 2EV6A 4PDKA 2XKPA 1LDJA 2ZDGA 1R9TA 4MFDA 2UVVA 2PI0A 4NQWA 1R00A 2IA1A 1GVJA 5KFKA 1JIHA 1BBYA 4XLNF 4DZPA 2W9CA 4QWDA 4A2UA 1T36A 1HKQA 1WPKA 3FZVA 4TV7A 3PQJA 2YUSA 3WTSC 2XKOA 4A5NA 1VKZA 1V3FA 2O7OA 2ZO4A 1AA7A 2QSFX 3MFKA 1JHHA 1GXPA 2JA5J 3CUQA 2HI3A 2UZKA 2CV1A 3BAAA 1E0EA 1SMTA 4ZC3A 3PZPA 5EOYA 2QKLB 4A0YA 5KT2A 4ECTA 2E1NA 3WU0A 5F08A 1G2HA 2W8KA 5KG0A 2CV0A 4Q48A 5HS8A 3T5JA 3WHBA 3GXOA 4M3DA 1T56A 1JGSA 2E1OA 4A3CJ 1FLIA 4UB8C 1UAAA 1X9NA 3E5XA 4YFNF 3VWBA 4MTEA 3ZQGA 1RESA 3ZQQA 2HOSA 3A2KA 4MV9A 2FX0A 2TCTA 4JX5A 3MR2A 4CYDA 1UELB 4ON0A 3ZQFA 4I02A 2XGCA 2EWNA 2M45A 1U3EM 2IXSA 3S1RJ 1EF4A 3TP3A 3FK7A 4XQFA 3KHRA 4YAJB 3K4BA 1T08B 1TQIA 4DOZA 2ESNA 4LF9H 1BXRA 2VA3A 5LEKA 5TISC 1S0NA 3V7SA 4BDZA 5IYZF 1MKMA 5KFUA 5DLGA 5IPAA 2K9NA 3E97A 2HGCA 2HNHA 1WKMA 4UVCA 4CO8A 3T5LA 5GP9A 2ZBKA 1XD7A 2VKDA 3G6VA 3TMOA 2CWEA 5KFZA 3F0CA 1Z05A 2EIKH 4JUZA 3I64A 2XV4S 3DU5A 2V1XA 3ZP5A 4MV3A 4UCOA 4QWBA 3CUQC 1ENHA 3QZ7A 1XDNA 3RKWA 4AUXA 2EIJH 3B6AA 4C3JJ 1Z9CA 2VOOA 3U1KA 4DYRA 2Y0SE 2B63A 4OIOF 1ZK8A 5KFDA 5JVTA 2HFHA 3WE2A 3FXMA 3LFUA 3WE3A 1CQTA 4F55A 2L4MA 4E7SA 2XCPA 1K1QA 4YQWA 1EH6A 5IYCJ 3H0GJ 4HQMA 2X1EA 3FXLA 4MLOA 3DBRB 3BTJA 3NARA 5IOYA 2BXZA 2J6SA 3TGNA 1Z6RA 3GZ6A 5KNLA 3BR3A 3OR1C 3MKZA 2CUZA 4QWAA 4IVNA 3GX4X 4B09A 2R84A 5LLQA 3U1DA 5J1YA 1HSTA 1MJAA 4NXMH 3W2AA 1OKRA 3J81Z 5B1BH 2WADA 4O4HF 2M8GX 4O3PA 1EHIA 4BXXG 2JT1A 5CLSA 5IT9K 1BW5A 4LF6H 3K4MA 3L7WA 3FKIJ 3SZTA 4JV0A 2NYXA 2VKVA 2QA4I 1ETWA 3OYGA 1CS0A 2B63G 4YR0A 2M05A 4R8HA 5HLTA 2MC4A 3CF5F 3WODF 1U6GA 4EQQA 4DL4A 4A3FJ 1KGSA 2BQRA 4A3GG 2WC2A 2R7RA 3RV4A 5H6QA 1IRXA 1TTYA 2AO9A 3I55I 5GTIC 2L7KA 2O0YA 1P7JA 1IG7A 4Y52J 4RAGA 4IF4A 3L00A 4HAMA 4JK1X 3RJPA 3KZZA 5BMVF 3J7YJ 3PW2A 2O8XA 2MW8A 4RLFA 5F64A 5KAIC 1W93A 4B8XA 2VPLA 3PW4A 2BBYA 1QA6A 2E1MB 3MN2A 3GIQA 5GAHJ 1PDNC 4DLKA 3Q0WA 1FKAH 3VMMA 1L0OC 5KFLA 3WNZA 3BQ2A 4EYHB 4AWXB 1KBLA 4DL5A 1QO0D 2G9WA 3M1EA 2RAEA 2VT2A 5CA1F 4X64H 2P5LC 1SCUB 1XSDA 4BBRG 3JCUC 2LBFA 3PSIA 4J9OA 2PX9A 2R7OA 1IZ1A 5AIPA 4UUVA 2Q0OA 2FMLA 1FWZA 2Y9YA 4KMUX 5E20A 2EINH 4GRIA 3FXJA 1VQOI 4GYGA 3S1MJ 1ZAOA 4ESFA 4MQVA 2WA0A 3KP7A 4FT8A 4APMA 3CZ6A 3SYTA 3S17J 3Q8SB 4BY7G 4A3EG 1SVLA 3CUOA 2VPQA 1MMSA 3L2QA 4EEQA 1I50A 1FX7A 3LA7A 3LSKA 4B3MH 2E36A 3VDXA 5KFAA 1C0WA 4BNCA 1P2FA 1VTNC 2HQRA 2LMDA 2DA5A 5FFXA 1WSCA 2ICWG 2F4OB 2MFZA 4I98B 2KRFA 1RJPA 4C2MA 1WJCA 2V9WA 3RAQA 2BXYA 4CC6A 4Y7NJ 3A1YA 4BHCA 3A01B 1E17A 3IC7A 4CCOA 2RGVA 1FSHA 2VA2A 2EZKA 2AQ4A 4ZZDA 1O3TA 3FHZA 4NHJA 2E71A 2LP0A 3BCAA 4L9JA 3T1BA 5DD4A 3WHCA 1XCVA 4BBSJ 2UXBH 1FMWA 2M7AA 1S0OA 4FASD 2ZSIB 4KYWA 1IOVA 2XCAA 3E6BA 4YP3A 2DMQA 3F6VA 3QWLA 2VUMJ 2NOGA 2UWMA 2WB1E 1MMAA 4ED6A 2FE3A 2OUMA 3EDPA 3LSHA 2ZXJA 2F4VH 2AHQA 1E3OC 4LSAA 1S0MA 2DPIA 4UV9A 3T0YA 3DKXA 5FKLA 3GTJA 2LLKA 2P0WA 1QZZA 4CUGA 3E5QA 4LJZF 3GFLA 3K2AA 3S32A 4AC0A 4HNVA 1K6OA 3QRFF 2V5AA 3MAJA 4X6AJ 2W6MA 4LSXA 3E6CC 1WH2A 2F5EA 2MABA 1RETA 3C3WA 4EEYA 3DEEA 5FFZA 2FEZA 3EQLF 5LL6b 3NWSA 1LE8B 4I01A 3RSNA 2NRAC 2Q1ZB 4I6ZA 4HRIA 1V51A 5DQGA 2CFXA 1M7JA 4ECYA 1Q1HA 4BU2A 4YFKF 1TWAA 3I4NG 3I4MG 4B47A 2W9AA 4TUYF 2EA2A 2HXIA 1Z0XA 5CKTA 5IT9Z 1B8IA 1VQNI 2A5YB 3OSGA 3QZ8A 3OY9A 1SAUA 2B0LA 1I3QJ 2GA1A 2O6GE 5A2QW 4IRHA 3HG9A 2KPMA 4MEYF 3CCLI 3K69A 1TWHJ 1KEEA 2HVSA 1FBSA 5L1KA 3GO5A 1STZA 2GBYA 1Z6TA 1ZN2A 1WWXA 3HHGA 1IJWC 3ABUA 3HOUJ 3VSKA 4DJAA 5FKMA 1BJTA 1WRJA 2FBIA 4NNJA 3J7AO 4JI1H 1VQ6I 3EYIA 3KXYT 4CCLA 1WHUA 2IP4A 5IP6A 4PJ0C 5C3EG 1K4SA 2BVMA 5F04A 3VEPA 1LE8A 2E5LH 4ZDOA 1IF1A 3HIFA 4Y3OA 1FEXA 3H3VH 3IH4A 4HG2A 4NDLA 2PBZA 4L5IA 3TBIA 2V6EA 4X0GA 2JEJA 3HGGA 3AAFA 5CJ9A 2WAQA 1ON1A 4BE0A 2OPTA 1D1BA 2AXTC 1TP4A 3S15J 5JQWA 2FQ3A 3JRAA 1U78A 1RJRA 2HTSA 2BGCA 4I0AA 5E3LA 3CMEI 4IQJA 1ITYA 2DT7B 2HQAA 3GTPA 2KHMA 2ETHA 4JI4H 4MV7A 3QP6A 5T14A 2FLLA 2VOBA 2K3FA 3KP6A 1RKTA 4M3GA 3WTXC 2W82A 5LBQA 3H0DA 2BHYA 1YI2I 3U9SA 4P5OA 2DMTA 2M5WA 4WXCA 4S04A 2K86A 4RLQA 2E1CA 3MZ8A 1UZCA 1K78B 4FTHA 3K10A 2EFNA 1HDDC 4YBZB 4OOIA 2EB7A 2QVOA 5HV6A 2ZM6H 3PJRA 4JP0A 1T94A 3SI8A 4ED2A 2RQQA 1TWGA 2XC9A 1XSVA 2YS9A 4A6EA 5M5XJ 4DUYH 3OS0A 2MA3A 1LJ9A 2XAJA 1YW8A 3H3UA 1GSOA 2COMA 2KIUA 5LGUA 2VQLA 2FNPA 3S16J 3P7NA 4UUSB 5CQGA 1LPQA 5DUIA 3FHNA 5E1ZB 3JZIA 3RB6A 1I6UA 3SJMA 3I0TA 1G8XA 2E7WA 4TV8F 4A3MG 4XRSA 1YYVA 4QLCU 3VYRB 2M7BA 4RB0A 1RYSA 3H4DA 2V1DA 4XLHA 4J0MA 3EPGA 4RM3A 3CJNA 3K9TA 2I87A 2WAQN 3QPTA 1YLFA 2WTFA 3GFIA 3K70D 5EZHA 3KYLA 1K78A 3F8NA 1S7EA 1BC7C 3O2PE 1V55H 4ENMA 2ID6A 3BLYA 2OH2A 2RKHA 3E6MA 4DBRA 2VC1A 2D5VA 2BHZA 2W85A 1QPMA 1JTXA 1X1DA 3BCBA 4RUAA 5CVIA 5KFTA 3K4JA 3EYYA 3OMYA 1F5TA 3TQTA 4XICA 3PR4A 3OS2A 1VF9A 1UHSA 1FOWA 2PN6A 1PUFB 2R86A 1A6QA 4OAZA 2DPDA 2VBXA 3MEXA 3RF2A 5C44G 2KJBA 3V6JA 4DR6H 1JKJB 1R9TJ 2LDUA 1XPXA 3ZPLA 5HNFA 4BS9A 1KJJA 2R7KA 5KFIA 3CMAI 1IBMH 2P6SA 1MZBA 2HQ5A 2RREA 3M1CA 3OYIA 3HZJA 1HKTA 3GV7B 2WE6A 1UJ8A 1MJBA 2VL8A 4PFPA 1ZQ7A 1N33H 3ZQHA 2CKZB 3CQZA 4PJLA 3OSNA 5I47A 4KJZA 3MWMA 3C2BA 3HOTA 2P0AA 1I1SA 4WCGA 2DN0A 4IO9F 2NAZA 4LF4H 2R7ZA 1G4DA 5J40A 2DT5A 2K9SA 5EG0B 2YYAA 1TL8A 4AIDA 4OAYA 1FPQA 2OQGA 4GYIA 2LY2A 3T8TA 1O7LA 1FIPA 1CF7A 1S6LA 3L2VA 4KN7X 3F72A 5JVLA 1DGSA 5L3GA 1OWTA 1HDPA 3HOXG 2P4WA 4I50F 2IS2A 2KIQA 1D1CA 2PMZN 3IAM2 3ZQLA 3K3VA 1MDMA 5KG4A 2LK2A 2DA3A 1HBXG 2HPMA 4HLYA 2KIMA 4AVPA 2IJLA 3O8GA 4X65H 2XGXA 1T3NA 2DU9A 3HYIA 1TQPA 4PGHA 1LEBA 5J1RA 3PNTA 2K4JA 3H1CA 2DQRA 2NU8B 4DYQA 2NS8A 2LC2A 2YPRA 3EETA 5LRRA 4EBDA 3OYBA 2V79A 4BJ6C 2FP4B 5F1JA 4L1KA 3J80W 2JSCA 2BVLA 1U5TC 3V7CA 4ETSA 4J9PA 4X66H 1Z1DA 4J9SA 2IPQX 4DR1H 4C30A 3LQQA 2EH3A 3LP8A 2OV7A 1RKWA 2KDZA 4RAYA 2RN7A 4EYIB 4ED1A 4P9UA 2K7LA 4G3IA 3BJAA 1X58A 3K0LA 2HJWA 2YRWA 2JN6A 4E7HA 2LKXA 3WO0A 3CCEI 5EDWA 3R5FA 4A3LG 5KFPA 1MBKA 4BXXJ 3SFIA 1OJLA 3WGHA 5C4JJ 5ILVA 2HZDA 4D7MA 5JHUA 1U0JA 4ECZA 5DDGA 3HKZN 4XYMB 1S3JA 3DWLE 3LSMA 2B63J 4RGSA 1TWCA 2RDJA 2ASDA 4OX9H 2HDWA 2LRDA 3GV5B 4A69C 3C2HA 1Z7UA 4ASNA 4WD3A 2HGSA 2RNJA 2QQ9A 4ZTFA 2DA2A 2FF4A 3S93A 3SZPA 3W6KB 1ZGJA 1B72A 1U8BA 2DWCA 5HDNA 4CCMA 1OCTC 1X4OA 3IG0A 2DPJA 2CO5A 3SFZA 5KG3A 4EVIA 1WH7A 2OBPA 1VQMI 2E19A 5DCMB 4ECVA 3TDZC 3HM5A 5KVRA 1YFHA 1RK6A 4J19A 4I7HA 1BOAA 5DUKA 3PFYA 2VJ5A 1OCRH 4A93J 1KJ8A 1IN5A 3A02A 1EH8A 3JSLA 2P81A 3DFGA 4JI5H 1XN7A 1TWFJ 3LSJA 4EJVA 3Q2OA 2NXNB 2L9RA 1Y1VA 1FOXA 4X62H 1NH3A 1LDKB 3SE7A 5FLXW 4JV2A 3WGIA 4ZOLF 1BIBA 1GVDA 3A03A 1B04A 1GUUA 4IXAA 4ECUA 2CGPA 1T8IA 3GTGJ 2D1HA 5LEJA 5FJ8G 3D5LA 1O7FA 1RZ4A 2BY1A 3S1QJ 1MBJA 3GTKJ 5KFWA 4ZYDA 2EZIA 3ECHA 5KT7A 3FMRA 5K5RA 4A3EJ 2FBKA 2OCCH 2R3SA 2X6OA 4R79A 3L2WA 2V9PA 2R92J 5E8GA 4IKFA 5DQIA 2A69F 1KQ9A 4YIRX 1AUVA 3E7LA 5L3DA 4XNFA 2P7VB 5E3NA 4F4XA 3E3VA 2YW2A 3KHHA 3L2PA 4IHYA 5DCFA 1BGWA 3TW7A 3F23A 1Y1VG 1P4XA 4XR6A 2EILH 1D8KA 1VI0A 1ZELA 2DDAA 2E7XA 3B6CA 4M6XA 4Q44A 1R5ID 2ZNZA 4AYBA 3R23A 4CXFA 4LITA 1A5JA 4EG0A 2BE5F 2ISZA 1Y1WJ 3S2DJ 5JVGF 2VQFH 1ZRDA 3PW7A 3LSTA 3BC8A 4XN3A 3TO7A 2VJ4A 1S9HA 1T39A 3HL2A 1HR0H 2FRHA 3PUBA 4YFXF 4LB6B 2DMNA 3ABKH 2E5ZA 1Y8RB 3MZHA 5E18F 4A3JJ 2ZCWA 3A4CA 4N4OB 4EGZA 1V4RA 2M87A 1WQ2A 4Y13A 3QPLA 1R1TA 3K4KA 3GIDA 2F2EA 2M30A 4L5JA 4EBCA 2IBDA 3IN5A 4OWRB 3MD2A 4CZCA 4O3MA 2IS6A 4E70A 3IH2A 5KG5A 2VQGA 2K27A 2V4JC 3NQOA 3K3PA 4U0WA 4A6DA 2IA2A 1N56A 4D5CA 2NS7A 2XIGA 2UVUA 3H20A 1YIJI 1OQYA 2Q2EA 2R8HA 2YZGA 4UVAA 5E1WA 3V8JA 5FD5A 4P9FA 2VASA 4HSRA 2R8GA 5HLIA 1YE9A 3S2WA 5LOVF 2BQUA 4LK1F 3ZR8X 4O3QA 4FX0A 4RAZA 4L9VA 4E4HA 4EV0A 1IRGA 2CUJA 1C30A 4IHWA 4ESBA 2K9QA 2J5OA 2XGEA 4F93B 2E5NA 4HYKA 4PWQA 2JUGA 2OLSA 4U87A 3HOVG 3QOPA 1QBJA 1VQ9I 1HW2A 2JA7A 3PUFA 3KCCA 4JI0H 3GLLA 3VPCA 2JRTA 2R7WA 3MZYA 4C3IJ 3TKYA 1O4XA 1IDZA 5BPFA 2R0QC 4F50A 5EEHA 2YU9J 2R82A 3J80Z 4U7BA 4IX7A 1NG6A 2OA4A 1P8LA 3PW5A 2C00A 3FKJA 3V4SA 2BR0A 1JXSA 1OCPA 3BWGA 4AYBN 1FYLA 2PQ8A 4G6QA 4Q8FA 1JLLB 1ZGWA 2CS3A 4AD9A 2W6NA 1HQCA 1USTA 4XKCA 3V4GA 2J5PA 2Y48A 4EATA 5KAFC 2W9CB 2QGUA 2L0KA 3K4NA 5ILUA 3PW0A 2R87A 1GLNA 3HSRA 5F6FA 5JLXA 2LYCA 1BI1A 3LMMA 1IV8A 3CUQB 4CHUA 1OYIA 1I7LA 2XB5A 3QOEA 3L4JA 2TDXA 2P6TA 5KFFA 1TBXA 3FXRA 4GFBA 1WJDA 2LD5A 4LH6A 2JA7G 3RKYA 1S10A 4XRFA 4HLXA 3IRQA 3GTLA 1JKQC 1HC8A 2IA6A 4BDYA 1QGPA 1BNCA 1JE8A 1OYYA 3HDDA 2CSOA 5HODA 5J3LA 3Q9VA 2W71A 2EJRA 2VBYA 2R8IA 2QF7A 4ZJZA 2QEXI 4A3IG 4EJOA 2ALZA 3K4CA 3C7JA 2ZB9A 3LQRA 3TO9A 4B1RA 2VLAA 2IEKA 1GV2A 1E2XA 2XPWA 3DXJF 2OAZA 4MFEA 3SEQA 1X2MA 4YR3A 2R7FA 2I10A 4HDUA 1DDNA 1Z67A 3RI4A 1I94H 2O3FA 4D9JA 4OMYA 3VYUB 1N48A 3S14J 2L01A 2XAHA 1N75A 3RGZA 1MBHA 2HQNA 4EJWA 4ESJA 4O3NA 2H09A 3CLOA 3FX3A 2A6TA 3H5NA 4ZYEA 2JTVA 4QIWE 2VQHA 3CJRB 2DO7A 3W6VA 2M4KA 5D5UB 1F9NA 3BG3A 1TQMA 2DOAA 3SZGA 4XOTA 3RIRA 1MNDA 3M8FA 3OYEA 2QSGX 3CMMA 3PFIA 1HW5A 4ENKA 2IBKA 3BZCA 1R4NB 1Z21A 3CDHA 3RQIA 4V2FA 3OV8A 4LIVA 2ASLA 3CD6I 3KP2A 3RKXA 3NAUA 4BHBA 1LFUP 1GSAA 1T95A 4HEA2 3SXYA 5IT3A 1JT0A 2ZJTA 5IP9G 3MKLA 5DM6F 4L0YB 3VFZA 5KT4A 3HOYG 2XCLA 3DTKA 4A3MJ 1HOMA 1J2XA 2FOWA 3LA3A 3IWZA 2FOKA 4M9XA 2AQEA 4OINF 1T6SA 2MSYA 2DK5A 1D5VA 2KJCA 2Z16A 1K83A 4LFUA 3SDBA 3I59A 1V5FA 2KRCA 3KP5A 1R22A 4RDUA 3JRBA 4LFBH 2UV1A 5K5QA 3GIJA 2A6HF 2IRFG 1TWGJ 5JFRA 1DUXC 2JA6A 2BY0A 2QKMB 3DKYA 5IY5H 4EGQA 3JSNA 2NVYJ 1D0ZA 3UNGC 5LP6F 1QZEA 1FSEA 1ZG1A 1O57A 3GIIA 5KFEA 3IUOA 4LLGF 4I2OA 2AQFA 2R7XA 5JLWA 1J09A 3WTYC 4J01A 3BQYA 2VUGA 3CVZA 1XS9A 5KFVA 3R0AA 5EF6A 3LSRA 2JMWA 5JUMA 2W7PA 2E35A 1CE8A 2DQLA 3MMYB 2X0SA 2GOMA 2M9HA 3OHAA 1XMOH 2L5QA 4HYEA 1SFOJ 3H5RA 1G3YA 2JA8J 3C1DA 3G6XA 2X4HA 2EV5A 1BR1A 1K61A 5LHHA 2BOLA 3RYRA 1BI3A 2GQQA 2CQYA 4Q0YA 1PVEA 5EWEA 3B73A 1G6NA 1OCZH 4UV8A 1IN6A 3GTQA 3OOUA 1NK3P 4TV9F 2QUFA 4BHPA 3UR3C 1DIKA 5DG9A 1ZKGA 3Q9SA 3HOZG 1GSHA 5HOOA 2XVCA 3G1MA 2K5CA 1IUYA 4KT6A 4MHGA 1RIOH 2C35B 5FKOA 1D3YA 2LBFB 5KFYA 1MSFC 1JI8A 2VJIA 1YTYA 1J5EH 2R8KA 1EUCB 2VXDA 2NVXJ 2GWRA 1AUXA 1IXSB 4FBTA 1UG0A 4BE2A 3ZMUA 2CQKA 4DNCA 3PVXA 2L9NA 2NVQJ 4FU0A 4DR5H 1RR7A 3VODA 1G59A 2CV2A 2FKLA 4G6TB 1LVKA 2FD5A 4CH7A 3IAS2 4JI8H 1SVOA 3KLNA 3PO3J 2MCTA 4LF5H 1QVTA 2LOOA 3KLOA 3OYAA 2FUG2 5K7HA 2HTJA 2ADUA 4L9NA 2DA1A 1T33A 3LOCA 4BWSC 1XNRH 1QHHD 4XONA 3R60A 4CCNA 1YX5A 4GXOA 3RDIA 4A5MA 5IP7G 2K3PA 2I8CA 3F8FA 2Y31A 1ODDA 2NOJB 4MV1A 2IGKA 4F92B 2IGNA 2L7MP 2LR8A 1NTCA 2Q2TA 3GTOA 2HPIA 5ICFA 5KT3A 1ZREA 3F8CA 1PX2A 4EM2A 1TC3C 2XAQA 3BR5A 4LLNA 1RRJA 1JT6A 2CJJA 1QU3A 4DV6H 1IN4A 1TT5B 3GVAA 2E2IJ 4ITVA 3JRFA 1R58A 2HVQA 2L02A 2UUZA 2YR2A 2QYZA 4M9UA 4J9MA 3FIWA 4J9NA 1APLC 2NNNA 4MV4A 1M1EB 4RS8A 1S9FA 4PGGA 3I3LA 2VXZA 3DLAA 5KFOA 2ZNYA 3C18A 1A36A 3QFFA 4FS2A 5KFHA 2WV1A 5KHDA 1TW2A 2KT0A 1F1ZA 1KA8A 1XSXA 5TGTA 9ANTA 2FPIB 2KLOA 5BMZA 1G3TA 4YR2A 5D8LB 3OSFA 4EEFG 3MFIA 1D0XA 4I99C 5E8IA 2LVSA 2DIKA 2HHHH 5KK1A 4O3OA 4DL2A 3JTHA 4PJJA 2DAOA 5BS6A 3G3ZA 1BJAA 3JAMW 3P9IA 2QBYA 4B3XA 4RNNA 3HGYA 5GPAA 3ASNH 5KFGA 5FO5A 5EGOB 2BV6A 2G7UA 2JJ7A 4G8XA 3LA2A 2R85A 4NUBA 2V7FA 4RGRA 4LIUA 3HJEA 4E7LA 5D5XB 4EM1A 3ETHA 3M4IA 5KG6A 1PUEE 4JYAH 3GIPA 3RYPA 2JK3A 3SHFA 2DLNA 4GLXA 2DW4A 3MKYB 1BA5A 3MFHA 2OF7A 1WCMA 2R93A 1B8IB 2ISYA 2C28A 1ZHFA 4KT5C 3ZQIA 3ZMVA 2E2HJ 2FBHA 2D2WA
chains in the Genus database with same CATH topology
1I1GA 3N42B 1M0TA 3DF7A 4AIJA 5D1OA 2UUBH 1EV7A 1QQIA 2PEXA 2LKPA 5H20A 1OPCA 4KIGA 3QU6A 1REPC 4IPAA 4MGRA 3MQ0A 3IWFA 5D1PA 1ZARA 1JHFA 4RGUA 3HOSA 2F5FA 5LHIA 4U0VA 3NEUA 3TQNA 1LQ1A 4BQAA 3P9CA 4M74A 3FMQA 3R6SA 4K2EA 5ICGA 3BJOA 2WDTA 1R36A 1IXRC 4B3RH 3QAHA 1W7PB 3CTAA 1BM9A 4RGXA 3U2RA 4EFBA 4LK0F 1YS7A 4ZYHA 2H6CA 3N43B 4ZZLA 1TAEA 4HX8A 3KZYA 2RQPA 5JI6A 5A2QK 4RB1A 2UXDH 4WF2A 2QENA 4M6YA 1DPUA 1ON2A 1RI7A 4NXNH 1O3RA 4RB3C 3ZN1A 3I53A 5LMNH 3I58A 1S8NA 2R7DA 1ONVA 3BOQA 2RGRA 3J7AK 3LMLA 4JI6H 1W7PA 3RPUA 3FWEA 5BQTA 3HTSB 5D6FA 4KUMA 5L3CA 2XAGA 1H9GA 1SEIA 2YX7A 2ZMEA 4JI7H 4UVBA 1XNQH 3HXLA 1IN7A 3DPLC 1FP2A 1SD4A 1EH7A 5DV5A 1U5TB 1IN8A 3IKVA 3KETA 1XGOA 3FXQA 2Z3YA 2AXLA 2D1VA 1J7KA 3V8LA 2OWOA 1UCRA 3K2ZA 3Q5FA 3T8RA 1U8RA 1CF7B 4LG0A 3L9FA 2RC4A 3WGGA 1MDMB 1HSJA 5K1YA 4S05A 2F5CA 4KA4A 2PMUA 1U5TA 4M7EA 2Z9OA 4KN4X 1GHCA 1CGPA 2HEOA 3HHHA 5IWAH 2VODA 2QZ8A 4YG2F 4JV5H 1M0WA 5D8KB 4HF2A 3LAJA 4DV7H 3FMAA 1Z2PX 2Z33A 3DF8A 3N97A 4R1HA 5HS9A 3I4PA 5A2QZ 1DP7P 2QYOA 4Z2YA 2G7HA 5ED4A 3F3XA 2XASA 2YX4A 3BP8A 4N9IA 3DPTA 2F5DA 2FNAA 4WWCA 1SYXB 3TOBA 1B1BA 4DV4H 5E17F 1F4KA 4IHSA 4GKJH 3RIZA 1E4FT 4KFCA 4HQEA 2HWVA 4UCUA 3DQVC 2W57A 3G73A 3BJ6A 3N44B 2FA5A 2XAFA 4FX4A 3DP7A 1A0IA 1R1VA 3J80K 4U7DA 4UHTA 3WG9A 1FNNA 1ZRFA 2VC0A 1ZYRF 4DV3H 1IBKH 2Z99A 2VONA 1P4AA 1FT9A 2W24A 4OIQF 1T0FA 3U9GA 3IRRA 4L9TA 2H94A 4IRGA 2H27A 2A3SA 1KQ0A 1LEAA 1TLHB 3ZN0A 3OOPA 3VOEA 1O3QA 1W4MA 1FBQA 2NNYA 5AONA 3E5UA 5CVVA 1WI9A 4MTDA 4M9ZA 1FZPB 4L0ZB 2Q2UA 1T38A 1MJ9A 4EGYA 5AIQA 5BOXA 5FLXK 4HDVA 4HV6A 1OR7A 1YIOA 3T1HH 4KICA 1E4GT 2HZTA 3GUDA 2LSOA 1FVIA 1X3UA 3WTVC 3N40P 2HDCA 4DUZH 2M1BA 3KP4A 3F6OA 2JZYA 1SFUA 1XDSA 3HRTA 2XUBA 3QU3A 1KQ8A 4OIPF 3P9KA 2MC3A 3FM3A 1W7PD 4UNOA 3ULQB 1B4AA 4LF8H 4F7ZA 3F21A 3TO6A 2KSWA 4OU0A 1KU2A 3FF5A 3O6BB 1P92A 1FOKA 4LGWA 3ERED 4G94A 1SFEA 2A68F 5J6XA 4DV0H 3I5UA 4XLPF 3IL2A 4RB2C 2IW5A 2GA2A 2YCHA 3JSPA 2GZWA 4LFCH 5CVRA 5CVJA 3D0SA 2LF7A 3K1PA 1QNTA 4A2AA 1Z2OX 4Y17A 3MCZA 2FU4A 3J81W 1GYFA 4G9YA 2UXCH 2MD5A 3RTXA 4G7OF 4DR4H 4EJUA 4Q5SF 4R7RA 3L09A 5H6RA 4B3TH 1XCBA 2VQEH 4HBLA 1YW7A 3GYHX 2OZUA 2MLGA 5EEGA 2VE9A 2DPUA 4HF1A 2A61A 5LGNA 4BAYA 4I09A 3FMSA 5J8FA 2O03A 1H0MA 2ELHA 3IHUA 3QPHA 2PG4A 1HW1A 3I59B 5FLXZ 5ILSA 4AQYH 3ZMDA 5HLHA 1AN7A 1O75A 1B6AA 3OTOH 3DEUA 2L3DA 1HNXH 2PBIA 3CO6C 4OMZA 5D5VB 4A0XA 3N41B 2CG4A 2STWA 3K1NA 2P5KA 2IP2A 1MGTA 1L3LA 1UHMA 2YU3A 3GFJA 3V7RA 2CW8A 4O5VA 2DBBA 3IKTA 3QP5A 3F22A 5JR3A 2EA4A 3L4KA 4PDBA 1RUNA 2H6BA 5TJJA 1BIAA 3BPVA 4Y15A 3RPQA 5DD8A 5HS7A 1BN5A 5HVQC 5ICEA 4X64H 3KALA 2UXNA 1FYMA 5LMUH 4GKKH 1W5TA 1K7AA 4IAJA 3GWZA 4M71A 1KYWA 4YHHH 3HSFA 4UCTA 3JW4A 5LGTA 2IVMA 2EFQA 5D4RA 2A6EF 5IT9W 4B3SH 1LB2A 3H3ZA 1N32H 4A12A 6PAXA 4XSZF 1S7AA 4HF0A 4BYYA 4G7HF 1R23A 4UCVA 5J8CA 3I71A 2EK5A 4Q4ZF 1Z91A 1IAWA 3V8KA 1PP8F 4LMYA 2QBYB 1R7JA 1OYWA 3KAKA 3L2CA 2XHKA 2A07F 2OD5A 3ZMZA 4WXHA 3RTRA 1YG2A 4M73A 2STTA 4GCVA 1J0RA 3HUGA 1W5SA 5K5OA 1FY7A 3B02A 3UQ8A 4JBAA 5D1OB 3BROA 2W25A 4CDGA 1I6XA 2K4BA 3C0FB 1U2WA 3BA9A 2C6YA 1O3SA 2OQRA 2GAUA 1UFMA 1BI2A 1GXQA 2EV0A 5L3FA 4EM0B 2KKOA 4MNUA 3JAMK 4XSXF 2AS5F 3O3KA 4KIBA 4DR3H 1DPRA 2GXGA 3ECOA 1IW7F 3TOAA 3BA8A 2X0LA 3WTZA 1J59A 2FMYA 5CVUA 2HOEA 2VOPA 1XGMA 4UCSA 1D8JA 2DFIA 2OZ6A 1J9IA 3HTUA 1USSA 2L4AA 4GO1A 3KE2A 4K0KH 4ENJA 3HSEA 4HOBA 2Q8KA 4A2BA 2JPBA 2V9VA 1HNZH 2YSRA 1TW3A 1XGSA 4XBFA 1FYKA 4UXNA 3BPXA 1S03G 2WWYA 1FBUA 4D0PA 1FP1D 1YW9A 2O61A 2MH9A 4KMFA 1P6RA 4HX4A 3SQNA 4EJTA 4IJAA 2RV8A 4M9SA 4Q47A 3DV8A 4HA8A 2ZMEB 2IA0A 4IRIA 3DKWA 2XROA 3M8EA 2CW7A 5D6EA 2PLYA 1KU3A 4AIKA 4WK8F 1SD7A 1RUOA 1HXDA 1R5GA 4HX7A 1PP7U 3FXUA 2VN2A 3WU1B 3KEQA 1IXCA 2ESHA 1P4WA 1LDDA 2KIFA 4DV5H 5FGMA 4LG0B 1G3SA 1WSUA 1KYZA 5HLGA 1G3WA 3EUHA 3R4KA 2QQAA 1SFXA 3KP3A 1MD0A 2VBZA 1R5HA 2P8TA 1S7OA 3N6XA 1N34H 5BR8H 4CGZA 2CW0F 1LVAA 1T98A 3GEZA 4CC5A 3JAMZ 4EFEA 2V6CA 4HZFA 1A04A 4UFZA 4HV5A 5D5WB 3T5XA 4KHPH 3JTGA 3REOA 4JQFA 4P96A 5LHGA 2GIVA 4FHTA 4P55A 2Y75A 4ZYGA 2W84A 3LAPA 2HVRA 1SD5A 2M8EA 2D45A 1K79A 1VS0A 4OIRF 1ZGAA 2L54A 3COAC 1L2ZA 4LD5A 4BH9A 5FPOA 3GZ5A 3ZQ7A 2PMHA 3KEOA 5FD6A 1ZLJA 1H9TA 1NHAA 3I54A 5HDKA 1UB9A 4QWQA 4LFAH 1HKSA 3BABA 5CYVA 4HW0A 2HS5A 1SMYF 1SAXA 2UU9H 1ZG5A 4U88A 5BPDA 4DV1H 3PQKA 1ZH5A 1TA8A 1XMAA 4DQ2A 2ZFWA 1ZLKA 2EFOA 4YIFA 2DTRA 5DYMA 3F8MA 5F1RA 2EFWA 2VT3A 3GFMA 4YIIA 2CYYA 2HYFA 4KDPA 1FC3A 4LB5A 3FM5A 5BPIA 2GXBA 1I27A 2LF8A 1S68A 3E6DA 4I0BA 2WYOA 3F8BA 1IRFA 3ZMTA 4WX9A 2K02A 4M72A 1YS6A 2UUAH 2HYGD 4KIFA 4ZH4F 3M9AA 1B59A 1J5YA 3HRUA 1UHWA 1XDUA 2HKOA 2P5VA 2XRNA 3M7GA 2FSWA 4GGGA 2BYVE 1XB4A 3ABTA 3K1MA 1BI0A 1SD6A 3TDUC 2ACJA 3R61A 4AIHA 4U0YA 3WTTC 1FJGH 2P7CB 1ZHSA 2OU2A 2QQBA 3BY6A 2MLKA 2HR3A 5FB2A 5DEQA 2LNBA 3GLXA 3LFKA 5D4SA 2UUCH 4PZJA 2DK8A 4LLLA 3BZ6A 1XMKA 4DV2H 2PFBA 1ZG3A 4L18B 3HRMA 3RGXA 2V1UA 2VPSA 2ZKZA 1ULYA 2PJPA 2QLZA 3HRSA 1LNWA 3PN1A 5DCMA 2EFPA 1Z2NX 2HKXA 2QWWA 2Z5UA 4RZQA 3H92A 2DLLA 1T2KA 1YO5C 3VB2A 1OMIA 2QM3A 3ML6A 5ERIA 1AOYA 5HDGA 4CZZA 1I5ZA 4IHTA 1YQAA 4N9HA 4JI3H 1Y0UA 3BDDA 3ZMSA 4PCQA 2RDPA 4EMSA 4MQ9F 1B9NA 1KU7A 3CO7C 4BXUA 4G7ZF 4ENNA 4YY3H 2MBFA 5TRDA 2ZJ2A 4H0EA 1RNLA 3GF2A 4O6JA 4LH7A 3RJ0A 1QZYA 2DI3A 5E1XA 5L3EA 1TNTA 3ELKA 2VE8A 5ICCA 2MH2A 2WV0A 1AWCA 5FPRA 4G6DA 2UXXA 3R0JA 4FM9A 4JI2H 3NRVA 3KFWX 2JPCA 4CICA 4DR7H 3W6JB 1HNWH 1R1UA 2RVCA 4MEXF 3ISPA 5LRSA 2Y0MA 3GW2A 2FXAA 3WTWC 1N36H 4DR2H 1ZRCA 3T1YH 4A0ZA 3WTUC 3N4MA 1TNSA 4WXDA 2BEOA 3J81K 1V9PA 1J75A 2IT0A 1S29A 1ZHQA 1BC8C 3ROUA 5L3BA 2VBWA 1IBLH 1B9MA 4KNYA 4NB5A 1KU9A 3JSOA 4UCRA 3LWFA 1XGNA 2WTEA 4N0BA 3KAJA 2NS0A 1XMQH 2EV6A 4PDKA 2XKPA 1LDJA 2PI0A 4NQWA 1R00A 2IA1A 1GVJA 1BBYA 4XLNF 4A2UA 1HKQA 3FZVA 4TV7A 3PQJA 3WTSC 2XKOA 4A5NA 1V3FA 2ZO4A 1GXPA 3MFKA 1JHHA 3CUQA 3BAAA 2UZKA 1SMTA 5EOYA 4A0YA 2E1NA 3WU0A 4Q48A 5HS8A 3GXOA 1FLIA 1JGSA 1X9NA 3E5XA 4YFNF 4MTEA 4MV9A 4CYDA 4ON0A 4I02A 2EWNA 2M45A 1U3EM 1TQIA 2ESNA 4LF9H 5LEKA 3V7SA 1MKMA 3E97A 2HGCA 1WKMA 4UVCA 4CO8A 2ZBKA 1XD7A 2CWEA 1Z05A 3I64A 2XV4S 2V1XA 3ZP5A 4UCOA 3CUQC 1XDNA 3RKWA 1Z9CA 2VOOA 4OIOF