4RB3C

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/dna
molecule keywords DNA (25-MER)
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
total genus 37
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb3C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb3C02
5LHHA 4GO1A 1A04A 3NEUA 4HX7A 3F22A 3WU1B 1SAXA 4OOIA 3DF8A 1PP8F 3GEZA 1HXDA 4BXUA 3D5LA 4MQVA 2ZMEB 2E1NA 3H92A 4KN4X 3CTAA 1B1BA 2HS5A 2QUFA 3BJ6A 3F23A 3ML6A 1P2FA 4AVPA 2JZYA 3FZVA 4GXOA 3EDPA 2COMA 2E1CA 1F5TA 1FSHA 2A6EF 2OZUA 1G3SA 2ADUA 1LB2A 1ZGJA 3ELKA 1T38A 5FD5A 3VODA 1KYWA 2XAHA 4HOBA 1ZRCA 3JSPA 5K5OA 1KQ9A 2H09A 3KP5A 3HIFA 1TLHB 1IXSB 4Q48A 2OZ6A 4G94A 2H27A 2TDXA 3V4GA 1SFXA 1USSA 1ZRFA 5IT9Z 2QVOA 2FE3A 2HYGD 3LA3A 1ONVA 1HKTA 5D8KB 3LA7A 1Y0UA 4IVNA 1W5SA 2ESHA 1U8RA 1GHCA 3U1DA 2XKPA 3MFKA 1O3QA 2PMHA 2ZJ2A 3ROUA 2V1UA 2XIGA 3DPTA 2RV8A 1E2XA 4L9VA 3M9AA 1Q1HA 5KK1A 4CXFA 2HDCA 1MDMA 4OMYA 1MKMA 3J80Z 3E5UA 2MLKA 1L3LA 2WC2A 5D5UB 3BZ6A 3RKXA 5E20A 1IRGA 3CDHA 4MHGA 3KZYA 2CYYA 4RS8A 5LEJA 1HW1A 4ZYHA 4DNCA 4IRIA 1KQ0A 1O57A 5DV5A 3RIRA 1Z6RA 2UXNA 2EFNA 2ZMEA 3CJNA 2GXBA 1BI1A 2GA1A 1ZG5A 4M71A 3BPXA 1HQCA 4O5VA 2QENA 2MD5A 3ZMVA 2L4MA 2OBPA 2UXXA 4E70A 1LDKB 3L2CA 3MAJA 4XSXF 2MA3A 4FHTA 3BJOA 2D45A 3I0TA 4G6QA 2RKHA 4ZZLA 3LFKA 3I54A 5D4SA 4LLNA 3ABUA 5J6XA 4R79A 2C6YA 2FMLA 1YS7A 1HSJA 4B8XA 2J5OA 4CZZA 2VE9A 4HX8A 2MBFA 1RIOH 5HDGA 2NNYA 4L0ZB 2BBYA 1FNNA 2XAQA 1ODDA 5LRRA 4IRHA 4HF1A 4HQMA 3QU6A 4P55A 2NNNA 2WWYA 2VOPA 2YX7A 3WGGA 3WE3A 1XD7A 2Y0MA 2JPBA 2EFQA 3COAC 3QPTA 5HLIA 3ZMZA 1IN5A 2FMYA 2A3SA 2O03A 1PUEE 1HW2A 2HQRA 3B02A 4O3MA 3VEPA 3L9FA 1P92A 2H6CA 4BNCA 4UVAA 4EJUA 2RNJA 1FOKA 1FBUA 2FOKA 2ELHA 3TO7A 2V1XA 4KFCA 3PFIA 3KP6A 1FBQA 2GXGA 4AIKA 5DUKA 4KMUX 1YTYA 3VB2A 4I2OA 5L3FA 2MC3A 2DK5A 2F5FA 4A0ZA 5CVIA 1DDNA 3D0SA 2KRFA 3IHUA 3BY6A 1XSDA 1QGPA 1G6NA 2WTEA 1JGSA 2HTSA 1KQ8A 2Q0OA 5LGUA 3BDDA 4KIBA 4LG0B 4A6EA 1Z7UA 5ICCA 2RQPA 4OIPF 1PP7U 1TQPA 4A5MA 3WGHA 1JHFA 1IRFA 4I09A 3HHHA 3F8NA 3EETA 1CF7B 4ZYDA 2O6GE 3F8FA 1EH6A 2ZCWA 2K7LA 4HA8A 1F9NA 3GLXA 1S3JA 5HLGA 3AAFA 4XSZF 2YX4A 1MD0A 2W85A 2XVCA 4I02A 1B9NA 2EFWA 3FXUA 3IL2A 4H0EA 1IW7F 4MTEA 1YYVA 5D6EA 5A2QZ 2FBIA 2ZKZA 3MWMA 3EYYA 3HHGA 4IRGA 2F5CA 1BM9A 2BYVE 2A69F 1G3WA 3GFMA 1RUNA 1I6XA 2ETHA 5LGTA 4UHTA 2LF7A 5JVTA 4KA4A 4I7HA 1QQIA 3MQ0A 1HSTA 3RI4A 2FBHA 5FB2A 3ZPLA 1KA8A 2EV5A 3J80K 1ZN2A 3KLOA 1YFHA 3IRQA 4IHSA 1V4RA 4A0YA 1R1VA 2VT2A 2ZBKA 1XSVA 3HTUA 1P6RA 2K4BA 2CG4A 3Q9SA 3K1MA 4LLGF 2BV6A 4RGRA 4LG0A 3BOQA 1IN6A 3RYPA 2YSRA 1YQAA 4ENMA 2L54A 5H6QA 4M72A 4G7HF 1CF7A 2PG4A 5LHGA 3J81K 5AIQA 4U88A 1QNTA 3R0JA 4OINF 4RB1A 3V8LA 1U2WA 1WI9A 4KNYA 1DPRA 1RI7A 2L01A 1D5VA 5DDGA 4WXHA 1ZRDA 3DV8A 4WX9A 1F4KA 2X0LA 4M6XA 1YG2A 3KETA 4A0XA 5CVRA 5CVVA 2K4JA 5F1RA 2X4HA 1IXCA 3GZ6A 1J9IA 3DQVC 1I1SA 1J0RA 1WWXA 2G7HA 1JXSA 1KU3A 4GYGA 1XGOA 2VONA 1KU7A 1IN4A 1W7PA 1ULYA 3E6MA 3C3WA 2NRAC 1FC3A 3JTGA 3V7SA 4YIIA 2M87A 2RGVA 5DD4A 5E1XA 2MLGA 3I71A 3TO6A 1T2KA 3N97A 1P4WA 2M1BA 4ZZDA 3GUDA 5F6FA 1XCBA 5D8LB 4L5IA 2V1DA 3CO7C 4N0BA 5HOOA 4LB5A 2FEZA 5J8FA 4EJTA 1QPMA 3OV8A 5LLQA 3TOAA 2XROA 5TJJA 1FT9A 1QZYA 5ICFA 4RGXA 1TW2A 1ZAOA 4WCGA 3QRFF 1OPCA 1T39A 4YIFA 2O0YA 2LF8A 2DFIA 5DYMA 4S05A 2CSOA 1LDDA 2HR3A 1W7PD 1MJAA 2ISZA 3I64A 3RKWA 1K6OA 1IXRC 1F1ZA 2D1VA 3SQNA 5TRDA 3I58A 5AIPA 2KKOA 2GIVA 4G7OF 3P9CA 2XAGA 4HF0A 1DP7P 3B73A 4K2EA 2DU9A 4U0YA 3BPVA 2PJPA 1BI2A 2GA2A 1R00A 1XGNA 3V7CA 1LDJA 1X3UA 3F6OA 3ERED 1JE8A 4KT5C 2Z3YA 6PAXA 1YW8A 3I4PA 3U9GA 5IT3A 3LSTA 2L3DA 1WKMA 4EJVA 4JBAA 2PN6A 5A2QK 1FYMA 5D4RA 3E6CC 2K86A 4UV8A 5HDKA 3T1BA 5D5VB 4CHUA 4Y15A 3GYHX 4OIRF 5CJ9A 4KICA 4LGWA 2P4WA 2QLZA 1XCVA 4A2UA 2VXZA 3RPUA 1BI0A 3HSRA 4EVIA 5HS7A 5CVJA 1SFUA 2RDPA 3FMQA 3QP6A 4BYYA 3FXQA 4UUVA 5H20A 4M6YA 3KLNA 3TDZC 2P5KA 1L0OC 4I0BA 3ZMSA 1J7KA 2A5YB 1BBYA 2W57A 2FQ3A 3T5XA 3WTTC 4PGHA 5CLSA 4PZJA 1DUXC 3J81Z 1TW3A 3VFZA 5BMZA 5KVRA 5HLHA 5F64A 4EV0A 2UWMA 3KP3A 3F72A 4EGZA 3L09A 3U2RA 2M5WA 1EV7A 2OU2A 1Z1DA 5FGMA 2QYOA 1YLFA 1NHAA 2G9WA 3KE2A 4M9XA 4EM0B 3DXJF 2OA4A 4RGSA 4FT8A 3BP8A 5BS6A 2IT0A 5E18F 4ZH4F 4L9NA 3GXOA 1LQ1A 1ZLKA 2FRHA 1ZH5A 5FO5A 4P96A 4F7ZA 3IKVA 2QQ9A 4LD5A 3ECHA 3ECOA 4G7ZF 3FXRA 3ZMTA 3HTSB 3IWFA 5ICEA 4RAYA 5ERIA 4BH9A 1OYWA 3WTYC 1BJAA 5LHIA 3SHFA 4TV7A 3ZMDA 2P5LC 3MZHA 3BROA 3EQLF 4G6DA 4U0VA 4L18B 3T8RA 4RB0A 3P7NA 1AWCA 4ASNA 1R1UA 4LK1F 2VOOA 1R1TA 2JSCA 2FU4A 4MQ9F 2F5DA 2HOEA 4A6DA 2CFXA 3ZQ7A 4Q4ZF 4WXDA 4AIJA 3H3ZA 2P6SA 2QM3A 2VBWA 4CICA 4KN7X 4M73A 3Q5FA 3TKYA 1IZ1A 2JRTA 5L3GA 3M8FA 3GO5A 3FM3A 4QWQA 3V8JA 3E5XA 2E7XA 1S7AA 3K1PA 5EEHA 2IA0A 5E17F 1TQMA 2IPQX 2Z99A 1WSUA 1O3SA 4M9SA 2FA5A 5DCFA 4EJWA 2CGPA 1VTNC 4WF2A 4ENKA 2XAFA 5LRSA 1R23A 4LK0F 4MEXF 1HKQA 3GFJA 1XMAA 1UB9A 1S7OA 4KDPA 2QWWA 1YW7A 3FHZA 4JK1X 2EA4A 4HF2A 2HZTA 2CW0F 1FBSA 4BHBA 3E6DA 1HBXG 3G73A 3F6VA 1UCRA 1ON2A 2Z33A 3K0LA 2DBBA 2Q2EA 3REOA 1MJ9A 2P6TA 2FNAA 2KJCA 1J59A 4GGGA 5JFRA 3ABTA 3WTXC 1G4DA 1H9TA 3KFWX 1S6LA 2P7VB 5HVQC 4IXAA 3GZ5A 3J7AO 1EH7A 3RDIA 2ESNA 3M7GA 2M45A 4I01A 3IC7A 1U6GA 1R5HA 3RJPA 3WU0A 2WV0A 3I53A 2E7WA 1IN7A 1TBXA 3QAHA 3DEUA 2D2WA 2DTRA 2BEOA 3WE2A 2Z9OA 5E8IA 1KYZA 4OU0A 2RC4A 3E6BA 2AS5F 2QBYB 3TOBA 2L4AA 3I59B 1SD5A 1BC8C 2L02A 3V7RA 3O3KA 1H9GA 2A07F 3DFGA 2DT5A 2VBYA 3LQQA 3CUQC 4LFUA 1GXPA 2ZXJA 3CUQB 5H6RA 5J8CA 3C1DA 3GW2A 1FYLA 3SZPA 4A12A 5D5XB 4HQEA 4I0AA 1B59A 2KIFA 3HOSA 4HV6A 2DPDA 1B9MA 1J2XA 4EGYA 4GYIA 2HTJA 1W4MA 3NRVA 4KIGA 4ZYEA 1YS6A 1UHMA 1W5TA 1RUOA 3FMSA 4EMSA 2IA2A 1WQ2A 2HFHA 3LAPA 4P9UA 5K5RA 4NQWA 1FZPB 1FSEA 2BE5F 4HAMA 3M8EA 4MEYF 1S29A 1BIBA 3IRRA 3F8MA 2EWNA 5L3CA 3L7WA 1SD6A 1G3TA 1Z05A 4R1HA 4CYDA 2HWVA 2IP2A 4HW0A 2M8EA 2G7UA 2PBIA 3LA2A 4GCVA 1FLIA 1XGMA 2V9VA 3DKWA 3HOTA 4U7DA 3FF5A 2OQRA 4WWCA 2ZNZA 3O2PE 3QP5A 3MZYA 1GVJA 2PI0A 3OOPA 4HV5A 2VBZA 2XKOA 3GX4X 3BWGA 2FSWA 3F8BA 1Z91A 2FNPA 3E5QA 5E1ZB 3GWZA 4MTDA 2OAZA 4IPAA 4M9ZA 3R60A 4QLCU 1XMKA 2DLLA 4ETSA 5ILVA 4HX4A 2VBXA 2EV6A 3KP7A 2HKOA 5CYVA 5HDNA 3F21A 2QBYA 2STWA 2F2EA 3I59A 1STZA 1MJBA 1OYYA 3FX3A 2A68F 4IJAA 3CO6C 4Q47A 1REPC 2GAUA 3CUQA 4L9TA 3R4KA 1MGTA 1OYIA 1YW9A 4BHPA 5K5QA 1SMTA 2K27A 5LGNA 2LSOA 2OD5A 3PQKA 5BPIA 1FYKA 2STTA 3I5UA 4P5OA 1D8KA 1PDNC 1I27A 1ZG1A 1OR7A 1KU2A 5FLXZ 2HYFA 4UXNA 2V79A 2KJBA 3WG9A 1YIOA 2F5EA 1HKSA 3K2ZA 4S04A 3W6KB 1J5YA 3RKYA 3S2WA 4HLYA 1XSXA 2VC0A 2ZFWA 3LAJA 2FBKA 2ISYA 1JHHA 3WTVC 1I1GA 3HSEA 1O3RA 1ZARA 5BQTA 3WTWC 1IAWA 1XDUA 1TTYA 4PCQA 4OIOF 4UNOA 3JSOA 1R58A 5DEQA 1WRJA 1I5ZA 4KUMA 3CLOA 2QQBA 4MGRA 3TO9A 1LEAA 3Q9VA 2EA2A 4XLPF 4HBLA 3KEQA 4CGZA 2O3FA 1QO0D 1TNTA 1ZLJA 3LQRA 2UZKA 3VOEA 2R7FA 5ILSA 2KIMA 4ENJA 5DCMB 1O7LA 4Z2YA 1U78A 3K1NA 1ZYRF 1T0FA 3JAMK 1R7JA 1S8NA 3E97A 2RN7A 4M74A 1YO5C 2XUBA 3HRTA 2HQNA 4XBFA 5LBQA 1XN7A 5DUIA 1OMIA 4UVBA 2V6CA 2DAOA 4FX0A 1FPQA 2O61A 1G3YA 2LNBA 2XV4S 3ISPA 2EJRA 4NHJA 2DI3A 2PFBA 3GFIA 5FD6A 3T8TA 2KIUA 1UHWA 4YFXF 1T6SA 5LEKA 1SD4A 4HZFA 3WGIA 4Q5SF 3TDUC 4I98B 3HUGA 4NB5A 4U0WA 4RAZA 3ZN0A 1ON1A 4IF4A 3P9IA 3SFZA 4LLLA 2YPRA 4RGUA 5HS8A 3HSFA 2EFOA 2LKPA 1Z6TA 3HYIA 4WK8F 5ILUA 3KCCA 1EH8A 4ON0A 3GVAA 1LNWA 3PQJA 2VE8A 2IJLA 3V8KA 2GZWA 3R0AA 2RVCA 4XLNF 4ESJA 2EV0A 2XASA 4O6JA 3M1EA 2CO5A 4A5NA 3RPQA 2PLYA 3MEXA 5L3DA 4HYEA 1K78B 2DPUA 2HEOA 1LJ9A 1H0MA 3WODF 1FX7A 1LVAA 4WXCA 2IW5A 3FMRA 4EM1A 4CDGA 1FP2A 2CQKA 2VT3A 4B09A 5HS9A 4AD9A 1BIAA 4Y13A 3HRMA 4UV9A 1XB4A 2YR2A 2DQRA 3FWEA 3TGNA 4AWXB 1U5TC 2GWRA 1U5TB 5E1WA 5DCMA 3DP7A 4RB3C 1MZBA 2PMUA 4L9JA 4G9YA 2A61A 3FM5A 1E17A 3KEOA 3QPHA 1ZREA 4ESBA 5FFXA 3LWFA 2FXAA 1V3FA 3IKTA 4R8HA 1XGSA 3HRUA 5JI6A 4UVCA 3WTUC 4L5JA 3N4MA 1SFEA 1QZZA 1FP1D 2JTVA 1O3TA 1KU9A 5BOXA 3P9KA 3L00A 4BQAA 3NQOA 4HLXA 2R7DA 2M30A 4EJOA 1RZ4A 5D6FA 2Y48A 2JT1A 2P8TA 3GFLA 3EUHA 2EFPA 2DO7A 1R22A 4N9IA 4PDKA 1Z9CA 1BN5A 1XDSA 2J5PA 1C0WA 4JQFA 2NYXA 2Q8KA 2W84A 4OIQF 1FWZA 2DK8A 2O8XA 4D0PA 3E3VA 1QBJA 2Z5UA 5FLXK 3H3UA 3JTHA 2VODA 4EQQA 3SXYA 4HDUA 3F8CA 2A6HF 4N9HA 3JW4A 4Y17A 1TQIA 3BJAA 1R5GA 2W25A 1RNLA 4G8XA 3TQNA 4AIHA 3CUOA 4HDVA 2ZO4A 3EYIA 1B6AA 2OQGA 1DPUA 4YG2F 5E8GA 5CVUA 1K78A 4OMZA 4KMFA 1BC7C 1GXQA 5EEGA 4RB2C 2P5VA 1CGPA 5IT9K 2EK5A 3ULQB 3K69A 2DQLA 3R61A 2Y75A 1FY7A 4LJZF 3O6BB 3ZN1A 1W7PB 2VC1A 2MH9A 5DD8A 4BAYA 3JAMZ 2CWEA 1SMYF 4P9FA 3QU3A 1T98A 2K02A 4DQ2A 1J75A 4L0YB 1U5TA 3C7JA 2XAJA 5L3EA 1ZHFA 3SZTA 4KIFA 2H94A 1P4AA 1R36A 2IRFG 1ZG3A 2HKXA 4CO8A 5AONA 2MH2A 1AOYA 3WTZA 2IA1A 1SD7A 2FF4A 4BHCA 2XGXA 1LEBA 2LDUA 2P7CB 3MCZA 4MNUA 2AXLA 2ACJA 3F3XA 2IVMA 1K79A 2EB7A 4LB6B 2PQ8A 2XRNA 3QOPA 2NS0A 2R3SA 2W24A 2BGCA 2QQAA 2H6BA 2NAZA 4U7BA 5BPDA 2PEXA 4PGGA 2GQQA 4XRFA 1K7AA 4YFNF 3WTSC 1ZGAA 1B4AA 5JR3A 1IUYA 5FFZA 2HGCA 4LMYA 1P4XA 3G3ZA 2XHKA 3KZZA 1IN8A 1IF1A 3RTRA 5ED4A 1TNSA 3C18A 3KP4A 1D8JA 3K9TA 3ZP5A 1KGSA 3KP2A 5D5WB 2YU3A 4EM2A 2DW4A 4YFKF 4ESFA 2B0LA 1OKRA 3IWZA 5ICGA 4FX4A 4KYWA 5K1YA 3DPLC 5JHUA 2QZ8A 3T0YA 2ZNYA 3R6SA 1BI3A 1O7FA 4ZYGA 3HRSA 2JPCA 1MDMB 3ZMUA 2VN2A 1UFMA 1D3YA 1USTA 1HW5A 1BOAA 2D1HA 4IHTA 5L3BA 3W6JB 4ENNA 1U3EM 3GF2A 3RYRA
chains in the Genus database with same CATH superfamily
4CCJA 2YS7A 3PO3J 3KYCB 5LHHA 3GTOJ 4GO1A 5H80A 1A04A 3NEUA 3BR1A 4HX7A 2IP4A 3ABLH 4NDLA 2K85A 2R92A 3F22A 3WU1B 5KG2A 1SAXA 2H8WA 4OOIA 3HOXG 3QZ7A 1VQ8I 2PJRB 1K4SA 1R49A 2KISA 2ZMEC 3DF8A 1HXDA 3GEZA 3VYUB 3D5LA 4MQVA 4BXUA 1PP8F 1BR4A 2ZMEB 1CQTA 1CQIB 5IT9W 2B63A 3MR5A 1ZETA 2E1NA 3H92A 4KN4X 5KFYA 3CTAA 1B1BA 2HS5A 1D0ZA 2QUFA 3BJ6A 2CRGA 3CF2A 3F23A 3ML6A 4D5FA 4FS2A 1P2FA 4AVPA 3HKZN 2JZYA 3FZVA 4J19A 4GXOA 3EDPA 2COMA 3HKZA 2JMWA 3QYBA 1F5TA 1QPIA 2E1CA 1FSHA 3KYDB 2A6EF 2OZUA 1G3SA 4LF4H 1B04A 2ADUA 1E3PA 5H2FC 3BR0A 1JUMA 1LB2A 1ZGJA 3BQZA 3EUKL 4ED0A 3ELKA 5LD2C 4UUSA 2DTZA 1T38A 5FD5A 3OSPA 3VODA 1KYWA 2XAHA 2F48A 4HOBA 4UCTA 5KG1A 1ZRCA 3JSPA 1GLNA 1VQMI 3ZQGA 5K5OA 1KQ9A 2DOEA 2E2JJ 2UXBH 2CV1A 3CMAI 2H09A 3SZGA 2DIKA 1OWTA 5EEAA 3KP5A 3HIFA 1TLHB 5J40A 3HM5A 3H1CA 3M9NB 2R7WA 1IXSB 4Q48A 2OZ6A 4FBUA 1T8IA 2MC4A 1IJWC 2F4OB 2BY3A 4G94A 3CQZJ 2H27A 2TDXA 5BPHA 4QWDA 2Z2SB 3V4GA 1SFXA 1USSA 1ZRFA 5IT9Z 3I56I 4IR1A 2QVOA 2FE3A 1MBHA 2X6WA 5D8DA 1JKOC 4CC6A 2KL4A 4BY7J 2HYGD 3MKWB 2JA8J 2FKLA 1XMQH 4GKKH 4UB8C 3LA3A 1ONVA 1HNZH 3IH4A 2YZMA 4ZYAA 1HKTA 4LG3A 4RDUA 5KFWA 5D8KB 2K5CA 5CQEA 2ASLA 2NS7A 1Y0UA 3LA7A 4IVNA 4JV0A 3BZCA 1DP3A 3KXYT 1W5SA 2ESHA 1HC8A 3K4JA 3K4MA 1U8RA 2V4QA 1GHCA 1EKEA 1YIJI 2JA5G 3U1DA 2XKPA 5J47A 3MFKA 1O3QA 2PMHA 2QF7A 2ZJ2A 3ROUA 5B1AH 3I55I 2V1UA 1RRJA 3MWEA 1FMVA 1Y8RB 2XIGA 3DPTA 4LFAH 2MD0A 2HOAA 2RV8A 3OY9A 1E2XA 1XNRH 4L9VA 3M9AA 4RZRA 5FLMJ 4JI0H 2H1KA 3PJRA 3NAUA 4LOCA 4J01A 1Q1HA 1WR2A 2EINH 4Y52J 3W2VA 1A35A 4A3LG 2CU7A 5CQGA 5KK1A 4F91B 4CXFA 2M34A 2DFHA 1MDMA 3GBGA 2HDCA 2NUAB 4OMYA 2XAUA 4RLFA 3T5HA 4A3IG 1MNMC 3PZPA 1TAEA 1MKMA 4C9YA 5IP9J 5BMVF 3FXLA 3J80Z 4B4CA 1AUVA 1ZHQA 1ZR4A 3GTQA 1K6YA 3E5UA 3SE7A 1P8LA 2MLKA 3OYBA 1HOMA 1L3LA 3OYCA 2WC2A 5D5UB 3BZ6A 5HV6A 1V9PA 5F04A 2HU9A 3RKXA 2JEIA 5E20A 5FJ8J 1IRGA 3CDHA 4FASD 5KFLA 3OYKA 4O4IF 2DDAA 2ASDA 2YL2A 3A0BC 4Y7NJ 4MHGA 2NVYJ 1Y1WG 3KZYA 2CYYA 1AN7A 4RS8A 5LEJA 1ETQA 4QWEA 3GIMA 1EZ1A 1HW1A 4DNCA 4ZYHA 4OAZA 4IRIA 1KQ0A 1O57A 5DV5A 3RIRA 1MH3A 1Z6RA 2UXNA 2VUMJ 4V2FA 4A93J 1RPWA 2EFNA 1RR8C 3ZQQA 2E5LH 4A3JJ 2ZMEA 2ZM6H 2W1OA 2W4SA 3CJNA 2GXBA 2L5QA 2FB9A 2LRDA 1BI1A 4RA2A 1RC9A 2YU9J 3PW0A 2GA1A 2LYCA 1ZG5A 5FROA 2VQDA 1GUUA 4M71A 3OIQA 3BPXA 1ETXA 4BBSJ 1GLVA 1HQCA 3RJ0A 4O5VA 2QENA 2IS6A 1MMSA 2MD5A 3FK7A 3ZMVA 3V6HA 2L4MA 2OBPA 3PIOF 2UXXA 2YW2A 4E70A 1LDKB 3BLYA 3K3PA 3L2CA 1X3WB 3MAJA 4XSXF 1SFOJ 4C5CA 2MA3A 1APLC 1AKHB 1AUXA 3D5RC 4IRKA 4FHTA 5M3FJ 3ETHA 1I7NA 2R5YA 3BJOA 2D45A 5EDWA 3I0TA 3KHHA 4UY8I 4G6QA 2RKHA 4QIWN 5GAGJ 1FKAH 3RUPA 2BQUA 1R6RA 1V5FA 4ZZLA 3LFKA 3I54A 5D4SA 4LLNA 3ABUA 5J6XA 4DR6H 4R79A 4ECSA 3KAJA 2C6YA 2FMLA 4J9RA 2DT6A 3H4DA 1YS7A 1HSJA 4B8XA 3OS0A 2J5OA 4CZZA 2VE9A 2EZHA 4HX8A 2MBFA 2CQNA 3CCUI 5HDGA 1RIOH 4ED1A 3JRIA 3H5AA 2ID6A 5K7ZA 2NNYA 4L0ZB 1IDZA 3RQ4A 1W0TA 3K4CA 2BBYA 1FNNA 3P5JA 2W70A 2Q2UA 1TL8A 2SCUB 4DYQA 4ED8A 1TWFA 3GTMA 2X6XA 2XAQA 1ODDA 1LFBA 5KX5F 5LRRA 4UFZA 4IRHA 2M9HA 4HF1A 2DLNA 4HQMA 3QU6A 4QPQA 2DJIA 4P55A 2ECBA 4V2GA 2NNNA 4QWCA 2WWYA 4A3CJ 1TWHA 4DR7H 3ZXSA 2VOPA 4H4KC 2ELJA 1XC5A 5KT4A 2YX7A 2H8RA 1GSOA 3OSGA 1JT6A 3BCBA 4FETA 3WGGA 3WE3A 2FK3A 1XD7A 2Y0MA 3I4NJ 2I87A 1E4EA 1X58A 2JPBA 2EFQA 3E5NA 2JA7J 3PO2J 5F0FA 3COAC 3I12A 3QPTA 5HLIA 1TA8A 3SEQA 3GTPA 2Q2EB 4XRSA 1SEUA 5KFJA 2HOTA 3ZMZA 5KFGA 2EBIA 2XPVA 1IN5A 2R7LA 4MO7A 2FMYA 2UV1A 4XL9A 2VLAA 4B3MH 1FJGH 5GPAA 3OYHA 2NU7B 1S0NA 4DUZH 2A3SA 4FISA 2O03A 1PUEE 3N8DA 1JIHA 1HW2A 1VQ4I 1DU0A 3BA8A 3H9QA 3BTLA 4C2MJ 2HQRA 3B02A 4O3MA 3VEPA 4YQWA 4DV4H 3L9FA 4AYBA 1P92A 2H6CA 4BNCA 4UVAA 4EJUA 1UG0A 2RNJA 3UR3C 2DPJA 1FOKA 3RFCA 2OCEA 5GP9A 4IL6C 3H0DA 1FBUA 2FOKA 3TW7A 5FKOA 4O3PA 1X1BA 3BTCA 4PJJA 2ELHA 2F5VA 5DS9A 4QTRA 2V9PA 3TO7A 4R8UB 2V1XA 4KFCA 5EWFA 3PFIA 3L2PA 4DYCA 3KP6A 4XONA 1WH7A 1FBQA 2X85A 3ASOH 1KONA 2GXGA 1O4XA 4AIKA 3S3NA 1VQOI 5DUKA 3CCJI 4KMUX 4J9SA 1YTYA 2VUGA 2C00A 2EIJH 3I9V2 3VB2A 4I2OA 3HL2A 2CUFA 3BR6A 4XORA 4WD3A 5L3FA 2MC3A 4HSTA 3CDLA 2DK5A 2F5FA 4A0ZA 5CVIA 4I50F 1DDNA 3D0SA 5FKMA 1QA6A 4DR2H 4A3EG 3PW2A 4MFDA 2KRFA 1DV1A 3A03A 3IHUA 1RYSA 1YX5A 4A3MG 1RJQA 4O2BF 1BJTA 2ME6A 2W8KA 4RZQA 4F4YA 3JRGA 3BY6A 1XSDA 1QGPA 3BTIA 2BY0A 3ZRGA 1TWGJ 1G6NA 2WTEA 4FE7A 1JGSA 4L5EA 2HTSA 1KQ8A 4LFCH 2I8DA 1MIJA 2Q0OA 3LSGA 1EUCB 4AYBE 1I50J 3ERMA 4F50A 5LGUA 3BDDA 4KIBA 3U9TA 4LG0B 4IEJA 1I6UA 4A6EA 2X1CA 4EG0A 3SFIA 3T5JA 1Z7UA 4EGQA 5KG0A 1LKXA 5ICCA 5JLXA 1AKHA 2VXDA 1YX3A 2R84A 3OWTA 1EJ9A 1VAJA 2RQPA 1JGGA 4OIPF 4DIQA 5IYDG 4IQ4A 2OWOA 3ZCOA 1PP7U 1TQPA 3U21A 4A5MA 3WGHA 2DYRH 1MMNA 1JHFA 1IRFA 2Y0SN 4I09A 5KAIC 3HHHA 3F8NA 3EETA 4MV7A 1I3QJ 2Y0SA 5F0HA 1CF7B 4EEYA 4II3A 1WJCA 4O4LF 1GV5A 1WSCA 4OX9H 1N34H 1X2NA 4ZYDA 1OCCH 2O6GE 3F8FA 2C22A 4I4TF 1EH6A 3TP0A 5KFXA 5J1YA 5LMUH 4XICA 2ZCWA 2XC9A 3RBEA 3I4MG 2K7LA 4KHPH 4IHWA 5IYBG 4HA8A 1M0WA 1F9NA 4GC6A 3M3YJ 3FXJA 3GLXA 4M3DA 3HJEA 1AU7A 2HVQA 1S3JA 4CCOA 5HLGA 3AAFA 5DM6F 2YX4A 4XSZF 1MD0A 2W85A 4U87A 2XVCA 4I02A 1JKPC 1MNEA 2OLSA 2NS8A 4XYLB 2B9SA 1K61A 1WHUA 1X3ZB 4I76A 1B9NA 4O4HF 2EFWA 3FXUA 4BJ5C 4J00A 4Y4RA 1VKZA 2CS3A 1TWAJ 5C44J 5JQWA 3IL2A 4H0EA 4E7IA 1IW7F 4A3KJ 4XN3A 4MTEA 1YYVA 1HCRA 3S16J 3JRWA 2NU8B 5D6EA 2W7PA 2HPIA 5A2QZ 1HA8A 1DGWY 2FBIA 2ZKZA 3MWMA 4XRSG 3UKGA 2EZLA 3GIDA 5LXTF 3EYYA 3HHGA 4IRGA 4S0HB 4C2UA 5T14A 1VQ7I 4RNNA 2F5CA 1GSAA 1BM9A 5FKNA 4ZDLA 2BYVE 4GDFA 3H20A 2XPUA 3GQCA 4ECXA 3IV5A 1OISA 2A69F 1G3WA 3TQTA 3GFMA 1RUNA 2A6TA 2UXDH 4IHXA 5CA1F 2D5VA 1I6XA 2ZSIB 4ZI7F 2ETHA 5LGTA 4UHTA 1BR1A 2LF7A 2YRWA 2W9AA 1WCMA 4DR4H 2IGOA 4DL2A 5JVTA 3X2QH 4KA4A 3EPZA 2WV1A 2VB6A 4I7HA 2KDZA 1QQIA 5B1BH 1BNCA 3MQ0A 2R7TA 2PBZA 4W97A 3G8CA 1YRNA 3H4BA 1X2MA 1HSTA 3O8GA 3G4SI 3PSFA 1QHGA 3RI4A 3LP8A 1BXRA 3WU2C 3EPIA 2FBHA 3IP4B 5FB2A 1WI3A 3ZPLA 4LH7A 3T1HH 1WH5A 3LSKA 2X0SA 2CW8A 2VQHA 4ZDPA 2ZDGA 4YIRX 1KA8A 2FP4B 3PSIA 2EV5A 3L2UA 1V54H 3J80K 1ZN2A 3MKZA 2XF7A 3N44B 3PIPF 3KLOA 4MA5A 4IOCF 1YFHA 3GIQA 3IRQA 4CH7A 2NXNB 4BXFA 2RF4A 1S0OA 3CLQA 1E3OC 1SC7A 2O8KA 2IGMA 4IHSA 1V4RA 4A0YA 2GOMA 1X9NA 1R1VA 3H9JA 3IAS2 1MW7A 5KAFC 2VT2A 5EGOA 2VA2A 2H1LA 2ZBKA 1XSVA 2E1MB 1JTXA 3HTUA 1P6RA 5KT3A 2K4BA 2W9CB 2VQLA 2CG4A 3Q9SA 2KPMA 2HDDA 3K1MA 4LLGF 2BV6A 4RGRA 1LUJB 3BOQA 1UELB 4LG0A 1IN6A 4BKXA 4ZTJA 1HF0A 3QFFA 2DFFA 2P0WA 3RYPA 2XCPA 2DA1A 1BA5A 2YSRA 1Q1VA 1YQAA 4LF8H 4ENMA 2L54A 4DV7H 2HXIA 4AC0A 3TEDA 1KJJA 2R87A 3RCOA 5H6QA 1V5EA 2KRHA 2CQYA 3A01B 1CE8A 2OUMA 4Q43A 1YHQI 1T33A 3H40A 2C28A 2YRXA 4M72A 5KG7A 1Z2PX 4GLXA 3HC7A 3MR6A 4G7HF 3RSNA 1CF7A 2PG4A 1QRYA 5LHGA 1BW6A 4C3JJ 3J81K 3VPBA 5AIQA 4U88A 3RAQA 1QNTA 2QKMB 4LFBH 3R0JA 1Z0XA 1ZQ3P 3NWSA 4OINF 4RB1A 3V8LA 1U2WA 1IBMH 4ED3A 1WI9A 2XGPA 4KNYA 1DPRA 1RI7A 4CSWA 1S10A 2L01A 1D5VA 5DDGA 2Y31A 3L2RA 1RJRA 4WXHA 1DIKA 1ZRDA 2ZXHA 2VQCA 2YCHA 3DV8A 4R7RA 4WX9A 3PNYA 4Y3OA 1LE8B 2V7FA 4TV9F 1F4KA 4NNJA 3W2WA 5B5EC 1WH2A 3J7AK 3FXKA 2X0LA 1ZGWA 2KZVA 1M0TA 3OUZA 2R7ZG 4M6XA 1YG2A 3CP2A 3KETA 1FOXA 4A0XA 4BBRJ 4UCRA 4LSAA 3W3CA 2X51A 3O8HA 1H8AC 2JA5A 5CVRA 3NWTA 5KFUA 3FBIB 3OSFA 4NXNH 5CVVA 2K4JA 5L9XA 2UU9H 5F1RA 2X4HA 1IXCA 3GV7B 4F93B 3GZ6A 1J9IA 3DQVC 1XDNA 1I1SA 1J0RA 1WWXA 5DM7F 2AGOA 2GLOA 4MV8A 4DV2H 2G7HA 3LMLA 1JXSA 1A9XA 3ESWB 2A05A 1KU3A 2HGSA 4GYGA 1XGOA 1ERDA 3QPLA 2VONA 1KU7A 3DWLE 1FEXA 3ETJA 3E7LA 2K9SA 1IN4A 1W7PA 3CJRB 1ULYA 3E6MA 3LSJA 3ASNH 5EF6A 3BA9A 4BY1G 3C3WA 4XLEA 2NRAC 2R7KA 2DCEA 1FC3A 3OYNA 3JTGA 2ZB9A 1MNDA 4HSRA 3V7SA 4YIIA 4YELA 3VDXA 5KG6A 2MYSA 2DN0A 2FPIB 2M87A 1OCOH 2RGVA 2JA6J 1WCMG 4BACA 4F4WA 5DD4A 4BL0B 5CAEB 4IHYA 2XSJC 5E1XA 2MW8A 3R5HA 3OYIA 1TP4A 2F4MB 2FD5A 4BE0A 5CPRB 3KPHA 2MLGA 3I71A 2BVLA 2E2IA 3TO6A 3G6YA 1T2KA 2WB1E 3GIIA 3N97A 2K3PA 1UAAA 2F4VH 1P4WA 2M1BA 2FPGB 3PR4A 4ITVA 3JR9A 1RK6A 5FKKA 4ZZDA 4E4TA 2VKHA 2DA3A 3BR2A 2XF6A 3GUDA 1M6VA 5F6FA 1XCBA 5D8LB 4L5IA 2V1DA 3CO7C 4B47A 4N0BA 5HOOA 4QSHA 3HOXJ 2XD4A 4LB5A 2FEZA 5J8FA 3ZQHA 2C2DA 4EJTA 1QPMA 1DU6A 4BWSC 2R0QC 3OV8A 1RYRA 3U1KA 5LLQA 4JV2A 5M5YJ 4HPQA 5J1RA 2OPTA 3BG7A 4BGDA 3TOAA 4XRMA 2XROA 1X4OA 5TJJA 3PO3G 1FT9A 5F08A 1QZYA 2MG4A 2K9NA 5ICFA 2XB5A 1IBLH 1OCTC 4RGXA 4YAJB 3S1NJ 1TW2A 2E5ZA 2VJ4A 1ZAOA 1Z67A 4PSWA 1VQPI 2R93A 2W9CA 4WCGA 3QRFF 2YU9A 1OPCA 1OQYA 1ACIA 1T39A 1D5YA 4YIFA 2JEFA 2AXTC 4JYKA 2K9QA 1OFCX 3DCFA 2M0CA 2O0YA 4XN0A 2LF8A 2DFIA 5DYMA 1JKRC 4CC5A 1QVTA 5L1JA 4C30A 2CSOA 1LDDA 4S05A 1HDPA 2Y2ZA 4B3SH 2KP6A 5KKNB 3Q8PB 2HR3A 1W7PD 3DBLB 1MJAA 4DYRA 2ISZA 3MR2A 3GMEA 1SFOA 3I64A 3RKWA 5BNGA 4K0KH 3DF7A 4E7SA 1K6OA 2F6CA 2I5UA 2DT7B 2P81A 3A01A 1IRZA 2OH2A 2Z1DA 3HBLA 2R7UA 3OL3A 2L7KA 3GTLJ 1IXRC 3C2BA 2COBA 3DBHB 4UB6C 3BTJA 2HNHA 1F1ZA 2D1VA 3SQNA 5TRDA 2J9GA 3HXLA 3I58A 3BT9A 5LFAA 2E35A 5KFPA 2CQXA 3J80W 5AIPA 3EPGA 5L1IA 2KKOA 1QZEA 2DA5A 2GIVA 3K2AA 4B3AA 3JRXA 4ECYA 4X1EA 4RM2A 1DV2A 2DOAA 4XK4A 5C1PA 4G7OF 1UG2A 1SVOA 3BQ0A 3P9CA 2G0EA 3Q8RB 2XAGA 4HF0A 4PFOA 1PYVA 2PVPA 1TWCA 4LF9H 4D9JA 3OYLA 2XSDC 3OHBA 5E3NA 1JKJB 4XX0B 2R7RA 3B73A 1DP7P 3H0GA 3JREA 4K2EA 2LG4A 2DU9A 4U0YA 2ELKA 4TQSA 3V6JA 1LE8A 4QW9A 3BPVA 4M3FA 2PJPA 3RV4A 2UVWA 1BI2A 3S93A 1I94H 3TBIA 1JX4A 4LSXA 2WBMA 1B6RA 2GA2A 3KHRA 1R00A 1XGNA 3V7CA 4ZHQF 1LDJA 5E3MA 1X3UA 3F6OA 5C4XJ 4EYIB 2CH0A 4XYMB 4A3FJ 2VPRA 1IOWA 3IH3A 2BOLA 3ERED 3N40P 4GKJH 3V6KA 2JA8G 1JE8A 4BY7G 4KT5C 2Z3YA 6PAXA 1YW8A 9ANTA 3BQ2A 3PUFA 3M9OB 3I4PA 3CCRI 3U9GA 5IT3A 3LSTA 3QYEA 3A1YA 1KEEA 3OR2C 4D1QA 5KG5A 1XS9A 3GTGJ 2NVXJ 2L3DA 1WKMA 1HR0H 5JVDF 4FU0A 3K4LA 5EG0B 4PFPA 1K4TA 4EJVA 1MMDA 4JBAA 1Y1VA 1SFKA 2PN6A 5A2QK 1BL0A 4FS1A 3PFYA 4A3LJ 5CB4F 1FYMA 5D4RA 3E6CC 4LIVA 2K86A 2EH3A 4MV9A 4C2MA 2VL8A 4UV8A 5KFDA 5HDKA 1BR2A 1NH3A 1G8XA 3KEYA 3T1BA 5D5VB 5J3LA 2NU6B 1MH4A 2UUCH 1SEIA 4CHUA 3BQ1A 4Y15A 5KG4A 5FLMG 4A3DG 4NUBA 2AGQA 1VS0A 3PVXA 2XGEA 3GYHX 5EZHA 3ORRA 2BXZA 4OIRF 1RKTA 5CJ9A 4HRIA 1FIPA 4KICA 4LGWA 4FCYA 2MABA 2P4WA 2KMUA 5DTDA 4MV4A 2CFOA 3GTJJ 2QLZA 1XCVA 4A2UA 1IC8A 1ZTRA 2VXZA 3RPUA 1KJ9A 2ECCA 1JLLB 4B3RH 5F9NA 1BI0A 4HG2A 1XNQH 2PJRA 2KQRA 2LC2A 2R92J 4JUZA 3HSRA 4EVIA 3AL0B 3TINA 5FJ8G 5HS7A 5CVJA 5EDNA 4PWQA 1T56A 1SFUA 2RDPA 5KT6A 3FMQA 1JJ8C 1FTTA 3QP6A 4BYYA 3FXQA 4UUVA 1YI2I 2B63J 5H20A 2UVRA 4M6YA 1J09A 3KLNA 3FK6A 1X1CA 1JXLA 3TDZC 2P5KA 3CCQI 2OTJI 1D1AA 1L0OC 2FK2A 1N32H 4I0BA 3ZMSA 1J7KA 1LFPA 4A93G 2A5YB 1BBYA 5KFOA 2W57A 5F27A 2FQ3A 3T5XA 4B43A 4A3JG 2LD5A 2N8GA 3V4ZA 3WTTC 4PGHA 3MJFA 1PVEA 2Z16A 5CLSA 5J4VA 1TWGA 2R93G 3DU5A 5KG3A 2BHYA 4PZJA 4XIDA 1DUXC 3J81Z 1TW3A 3UNGC 3VFZA 5BMZA 3A2KA 4LH6A 2ASJA 4E7HA 5KVRA 2FK1A 5HLHA 3HOUJ 1K1QA 5F64A 4EV0A 2UWMA 3KP3A 4BE2A 3PN1A 3F72A 4AUXA 4MLOA 4EGZA 3L09A 2VQFH 4A3GG 3U2RA 1ENHA 2M5WA 2C2EA 1W0UA 1VZ0A 5KFRA 2DMUA 1KC7A 1EV7A 2OU2A 2FPPB 4EEQA 1Z1DA 4FE4A 3Q3SA 4DL5A 5FGMA 4GFBA 4DW6A 2QYOA 2KZGA 4JI2H 1SCUB 3F9KA 2JVHA 3K70C 2DMNA 4A2BA 1YLFA 5TISC 4EYHB 1NHAA 2G9WA 3KE2A 3B6AA 3ABMH 4M9XA 1XTAA 3DXJF 4EM0B 2OA4A 4RGSA 2M4GA 1I3QA 4DL3A 2M3AA 4N4OB 4FT8A 3BP8A 5BS6A 2IT0A 1L2ZA 4DZJA 4BE1A 3LSMA 3VYSB 1DQUA 5IYZF 4NBQA 5E18F 4ZH4F 4L9NA 4XLFA 3C2GA 1YJWI 1P9QC 2OJED 3GXOA 3RPUD 5M3MJ 1EA3A 1LQ1A 1IV6A 1ZLKA 4DV3H 4ED2A 2FRHA 4D5CA 2RGRA 3PR5B 4HYKA 3H0GG 1ZH5A 5FO5A 4P96A 4XLHA 3D5SC 3IKVA 4F7ZA 2QQ9A 1Y14B 4J0MA 4LD5A 3ECHA 3ECOA 4G7ZF 3FXRA 3ZMTA 3JRAA 3KYLA 3IG0A 2LLKA 3IWFA 4LIUA 3HTSB 5ICEA 2RREA 3KZIC 4RAYA 2J6TA 3CCYA 5ERIA 2QSFX 4BH9A 1OYWA 2W6QA 5GTHC 3WTYC 3GILA 1BJAA 5LHIA 1JDEA 3J7ZI 2QGUA 3S32A 3SHFA 4CCNA 3I4NG 1D0XA 3JRBA 1U9NA 4TV7A 3ZMDA 2P5LC 3BROA 1X1PA 4AYBN 3MZHA 2FOWA 2W7OA 2JA7G 3PO2G 1WPKA 1WJFA 4O3NA 4OWRB 2DFEA 3EQLF 4G6DA 4U0VA 4HNVA 4J9OA 3HOWG 1T36A 2VQGA 4DL4A 5EG0A 3M07A 4L18B 2M2EA 3T8RA 1VQ6I 5EZGA 4PJNA 5DLGA 3I3LA 2YS6A 4BXXG 3HDDA 5HODA 4RB0A 2JUGA 1Y1VG 3P7NA 1AWCA 3ZQFA 4DV0H 3PM1A 4ASNA 3GCMA 1R1UA 5BR8H 4XM3A 4LK1F 2ZDHA 2L9NA 1DGSA 3HGGA 4IZOA 2DOFA 4TV8F 1N48A 2VOOA 2E34A 1IRXA 2LVSA 1KZHA 4J9QA 1R1TA 2JSCA 2FU4A 3RB4A 2L9VA 4P1WA 2PX9A 3Q0VA 2CW7A 1BW5A 4MQ9F 3SDBA 2CKZB 2F5DA 3LSRA 2HOEA 3ZR8X 1LFUP 4E7LA 2ID3A 2OF7A 4A6DA 3MKLA 2CFXA 3GV8B 4IR9A 5KFMA 3ZQ7A 4Q4ZF 1R9TA 3OYJA 2JJ7A 4WXDA 3BG5A 4AIJA 5EZYF 2E71A 3H3ZA 2P6SA 2FX0A 5TGTA 5DQHA 1QU3A 2QM3A 2VBWA 2LREA 3HOYJ 3S3MA 4CICA 2KFDA 3U9SA 4KN7X 1GSHA 3HOVG 4M73A 2UXCH 4IWYA 4BQNA 1B6SA 3JZIA 5KFNA 2LBFB 3Q5FA 2QK4A 3TKYA 2AQ4A 2L9SA 1IZ1A 2JRTA 4DBRA 1M1EB 4C2TA 5L3GA 3M8FA 2FLPA 3GO5A 3LSIA 4M3BA 2XRLA 3S3OA 1IBKH 3FM3A 4QWQA 1JUSA 3V8JA 3E5XA 4IHVA 3VMMA 5A2QW 3MVPA 3G6VA 3ONQA 4JI3H 3SI8A 2E7XA 3JCUC 4YRVA 2R5ZB 1FIAA 1S7AA 1DGRM 3MWDA 3K1PA 5L1KA 3BG3A 5EEHA 2IA0A 5KT7A 2JSPA 1TQMA 5E17F 3CC7I 2IPQX 2Z99A 1WSUA 1O3SA 5HNHA 3JSLA 3ZGKA 3GTKJ 2NOJB 4M9SA 4A3BJ 2FA5A 5DCFA 1D1BA 4EJWA 5DQIA 2IXSA 3KIOA 1VTNC 2CGPA 4X65H 1RR7A 4WF2A 4ENKA 5GPCA 2XAFA 5LRSA 1RESA 1R23A 4LK0F 5D1PA 1OCZH 4MEXF 1HKQA 3GFJA 1XMAA 1UB9A 3S8PA 3DEEA 1RJPA 4Q8FA 3CVZA 2M4KA 2EZIA 3A0HC 1S7OA 4KDPA 4DGWB 3GTMJ 4BDYA 2Q1ZB 3GLLA 1GO3E 1M7JA 2VOBA 3FIWA 4XKVA 2QWWA 1YW7A 5IYBJ 3PNTA 2W8LA 2NVQJ 4RUAA 1FJLA 3VWBA 3FHZA 3VPDA 4JK1X 2EA4A 4HF2A 3CCVI 2HZTA 3N41B 2RDJA 1TWHJ 3PW4A 2CW0F 1FBSA 4BHBA 1V51A 4NQWB 3E6DA 1HBXG 2LMDA 3V42A 3G73A 2CMPA 2V59A 1PK8A 3ZOBA 1BGWA 3F6VA 2KLOA 5KFFA 3L2VA 2O5RA 2VKEA 3DTEA 1UCRA 1UZCA 3L4KA 1VQNI 1ON2A 2B7EA 3K0LA 2Z33A 2DBBA 2LH9A 3VYTB 4CZCA 2Q2EA 5KFKA 2WAFA 3REOA 1ETYA 5F1JA 2CJJA 4B48A 3K5IA 4I99C 1MJ9A 3JSNA 3RZOJ 2P6TA 3GTPJ 2ZDQA 2AQFA 5J4YA 2FNAA 2KJCA 5F9LA 1EF4A 1J59A 3DKXA 3QWLA 2KHMA 4GGGA 3ABTA 5JFRA 3WTXC 4JI5H 2WYOA 5C5JA 1G4DA 5L1LA 1H9TA 3KFWX 4L1KA 3CC4I 4EBDA 4RNOA 1S6LA 1KBLA 4A3KG 1HNXH 2ME0A 2P7VB 2GXAA 5HVQC 4IXAA 1D0YA 3Q8QB 1S7EA 2VIXA 3GZ5A 3CMEI 3J7AO 2LTPA 2ZC2A 3H5NA 1EH7A 5EOYA 4DR3H 3RDIA 2OV7A 2R7NA 2ESNA 3FHNA 3M7GA 2W71A 5LMNH 2BQRA 3HOZG 2M45A 4I01A 4LF6H 3IC7A 3UFXB 2R7ZJ 1SVLA 1U6GA 2HI3A 4R8UA 1R5HA 2YYAA 2QKLB 3TL4X 1F36A 3RJPA 4DV5H 3WU0A 2WV0A 3I53A 2W82A 3J7AY 2E7WA 1ETVA 1IN7A 1TBXA 3QAHA 4OAYA 2V26A 2R4GA 4MIMA 3K70D 3DEUA 3M1CA 2JUCA 2HDWA 1NG6A 2D2WA 3GIPA 3FKIA 3K5HA 2VR1A 3WHCA 2EQRA 2JQ7A 2DTRA 5FPRA 2OTLI 4BDZA 4U6PA 2BEOA 4ABZA 5IYCG 3GTOA 2KRCA 2WADA 3OYFA 4ECRA 3WE2A 5C4JJ 5IOYA 2Z9OA 5E8IA 3BJYA 1KYZA 4MV6A 4OU0A 1ZELA 2RC4A 2X6OA 2ZFUA 3E6BA 4JP0A 2E1MC 2AS5F 5LOVF 3DLLF 3DLAA 3QQAA 3CCLI 2QBYB 3TOBA 2LBFA 2M0MA 4MA0A 2MSYA 2L4AA 2PMZA 3I59B 1SD5A 1BC8C 4DL6A 2L02A 2HXOA 4C5AA 3LNQA 3V7RA 3O3KA 1H9GA 2A07F 3DFGA 5IP7G 3LWBA 2DT5A 3RB3A 2VBYA 2X6YA 2R7VA 2I10A 1W96A 3C0FB 3LQQA 1NK3P 5GONF 2V6EA 3CUQC 4ZDOA 4LFUA 1GXPA 3RKQA 2R5ZA 2ZXJA 3CUQB 2MCTA 3OMYA 2Q2TA 3PNVA 5H6RA 4F4ZA 4IAJA 4Q0YA 4J9MA 5J8CA 5IY5H 1F43A 3C1DA 2ZJRF 2L7ZA 3GW2A 5K7HA 1FYLA 2AGPA 3SZPA 4A12A 4J9PA 4LF5H 5D5XB 5HNFA 4HQEA 5EWGA 1YJ9I 2P0AA 3Q8SB 2L2OA 4O3QA 2X1DA 4CYCB 1A0IA 1GV2A 4I0AA 2VPLA 1B59A 2K3FA 1NTCA 2KIFA 2YS9A 4II2A 3HOSA 4TQRA 4ECTA 4HV6A 2DPDA 1OR7C 1B9MA 1J2XA 4EGYA 4GYIA 2HTJA 4BJ6C 4HEA2 5E3LA 2I8CA 1W4MA 2HHHH 4DV6H 3NRVA 4KIGA 4ZYEA 1A31A 2W6OA 1YS6A 3G1OA 2BY2A 2WB1N 4AQYH 3CJQB 1UHMA 1I6HJ 1W5TA 4O3OA 2CZGA 3WO1A 2WB1A 1HLVA 2OC6A 2DJNA 3LFUA 1RUOA 4TUYF 3FMSA 4EMSA 2IA2A 3CQZA 1WQ2A 2PMZE 2HFHA 3LAPA 2C35B 3CMYA 2WY8Q 4QPOA 3TIGA 4P9UA 5K5RA 4Y8VB 4NQWA 1C3OA 3L2QA 1FZPB 2R82A 2W6NA 1W1WE 1VQLI 1FSEA 2BE5F 4HAMA 3M8EA 4M3GA 4MEYF 1S29A 1EYZA 1BIBA 3IRRA 2WAQA 2M7AA 5GAHJ 3F8MA 4JI7H 2LK2A 3S15J 2EWNA 4B3XA 1BJZA 4ZC3A 3L7WA 1YOVB 4D7MA 5L3CA 1Z2OX 1SD6A 1G3TA 4CA0A 3RV3A 5KFVA 4MV1A 1B72B 1Z05A 3Q0WA 4R1HA 4CYDA 2HWVA 2IP2A 4HW0A 5C3EJ 5KFAA 2W9BB 4IZZA 2M8EA 2G7UA 2PBIA 3LA2A 5KFZA 1S72I 4PSXA 4XKWA 2KSWA 1UMQA 4GCVA 1FLIA 3HB9A 1XGMA 2YZGA 3BAAA 2V9VA 3DKWA 3FMAA 3HOTA 4U7DA 4ANJA 1K83J 3A4CA 4FM9A 3CJTB 3FF5A 4XMYA 2OQRA 4WWCA 2K9MA 2ZNZA 3WNZA 4CCLA 1EHIA 3N42B 2ZXIA 2W7NA 3T1YH 3O2PE 3QP5A 3MFIA 2XPWA 3ABKH 3MZYA 4KITB 5F0CA 4EBCA 2XC7A 3OL4A 1GVJA 2DA6A 2PI0A 3Q2OA 3OOPA 4HV5A 2WA0A 3CP8A 2VBZA 5IOZA 5FRMA 5FPOA 1WVRA 2AHQA 4XKCA 4ECZA 2NVUB 3RB6A 4O3SA 4Q44A 2XKOA 3RB0A 3GX4X 3BWGA 2JA6G 2DA2A 2LKSA 2FSWA 3F8BA 1Z91A 4DBQA 4ECVA 4JI6H 2V9WA 2FNPA 4J9LA 3E5QA 5E1ZB 3GWZA 4MTDA 4Z6YA 2OAZA 2HVRA 4IPAA 1V5GA 2QCOA 2Y9YA 4CUGA 4GRIA 1W93A 2WAQE 1T0FC 1H89C 3S2HJ 4M9ZA 3R60A 4QLCU 1ZQ7A 3FKIG 1XMKA 3CF5F 2DLLA 4ETSA 3QPSA 5ILVA 4HX4A 4IKFA 2VBXA 1UC8A 1HDDC 2NVYA 2VASA 2HQ5A 4KJZA 4UCSA 2EV6A 3KP7A 1ZK8A 2V1NA 2BY1A 3IUOA 2VUMA 2HKOA 5CYVA 4M3EA 5HDNA 1W36C 3F21A 2QBYA 2STWA 1PJRA 1E4GT 4DUYH 3SYTA 1MMAA 2F2EA 5JLWA 3I59A 1STZA 1MJBA 3MZ8A 4RM3A 4ECQA 2R7SA 1OYYA 1VFCA 3FX3A 3L2WA 2A68F 1R71A 3KTMA 5KCMA 1D1CA 4IJAA 5HBRB 4WBNF 3BC8A 3CO6C 4Q47A 2E2HJ 1REPC 2O9LA 5IWAH 2GAUA 1S68A 1OCPA 3CUQA 1N56A 4L9TA 3R4KA 1MGTA 1N77A 4APMA 3AG3H 2HJWA 1OYIA 1YW9A 2TRTA 4BHPA 5K5QA 2BHZA 4JX5A 1SMTA 2K27A 5LGNA 5K7FA 2DMQA 4DV1H 2LSOA 3IN5A 4XKBA 2R5YB 1P7JA 5B66C 2DZDA 2OD5A 3R5FA 1VNDA 3PQKA 5BPIA 4CYCA 1FYKA 1WJBA 2STTA 3I5UA 1Z21A 4P5OA 1R5ID 3HUGB 1D8KA 1PDNC 3FKJA 1I27A 1FOYA 1ZG1A 3N6XA 2IA6A 3TMOA 1OR7A 1KU2A 5FLXZ 1HNWH 3AKZA 2HYFA 4XR6A 2IBDA 4ECWA 2QEXI 1UHSA 3BR3A 1OJLA 5KFBA 4YR2A 1LVKA 4UXNA 2V79A 2KJBA 3WG9A 4AVZA 1ORKA 1YIOA 5LP6F 1IGNA 2F5EA 3S1RJ 5LA6F 1P7IA 1HKSA 1G59A 4IOAF 2FJZA 2XCLA 3K2ZA 4S04A 3QYFA 2R8IA 1TC3C 3W6KB 4QWBA 1J5YA 3H5RA 3RKYA 4UCOA 5FRNA 1I3AA 3S2WA 3S2DJ 1R4MB 4JI1H 4O2AF 4HLYA 4UCUA 1XSXA 2RDIA 2VC0A 1WFXA 2UUZA 2ZFWA 2IMWP 4RNMA 3LAJA 2FBKA 3OIOA 2JEJA 2ISYA 1JHHA 3WTVC 1I1GA 2LR8A 4G3IA 2JA5J 3HSEA 1O3RA 2R86A 1Z3YA 1ZARA 5BQTA 2ZJPF 2JA7A 2TCTA 1E4EB 3WTWC 5D1OB 1JT0A 4M9UA 1B72A 2X9DA 3S17J 1IAWA 4ZJZA 2R8JA 1XDUA 1TTYA 4PCQA 3HKZE 2AQEA 4ME6A 1G2HA 5KFCA 4OIOF 4UNOA 2W9BA 4E7JA 3CD6I 3LMMA 1U8BA 4B1RA 4YBZB 3CMMA 3DPUA 4DJAA 1R58A 1Z77A 5DEQA 5HLTA 3JSOA 4IO9F 5C4XG 5J2UF 3K4KA 4A3FG 1X1DA 4V19K 3H3VK 3J81W 1WRJA 1I5ZA 2LOOA 3RQIA 4KUMA 3T5LA 4A3IJ 3TP3A 3RAXA 3CLOA 2QQBA 3G1LA 4MGRA 3SDGA 2VA3A 2GOXB 3HPGA 3GZNB 3TO9A 1LEAA 3Q9VA 2EA2A 3VSKA 1K1SA 3KX2A 3VSLA 2BQ3A 3GV5B 4X0GA 4M7EA 4XLPF 4A3DJ 4HBLA 2EIKH 3KEQA 4EGJA 3RGXA 2DWCA 1XPXA 2QSGX 3HEFA 2CUZA 4F92B 2L0KA 2O3FA 4CGZA 2FJ1A 1QO0D 2KDOA 3OR1C 1TNTA 2Y9ZA 1ZLJA 3LQRA 2E2IJ 2UZKA 3VOEA 2R7FA 5IP9G 4O3RA 2DODA 2CQ7A 5ILSA 2DA4A 2JRMA 2JWTA 2KIMA 3OS2A 1Y1WJ 4ENJA 3S14J 5DCMB 1O7LA 3V4SA 4Z2YA 1U78A 2MGQA 3A02A 3B6CA 3AL0C 3K1NA 2QQ8A 3L1PA 4ECUA 1ZYRF 3OOUA 1GYFA 4DR1H 1T0FA 3JAMK 1B33N 3CC2I 1R7JA 1S8NA 3T5KA 3E97A 3GIJA 1NG7A 2RN7A 4LITA 4M74A 2L7MP 3AG1H 3PW5A 1YO5C 2CV2A 3HZJA 2XUBA 3HRTA 4RU9A 2ZSHB 2BZTA 3H3VH 2VI6A 2VUMG 2HQNA 1JI8A 2LY2A 1VQKI 1IOVA 4E7ZA 2V4RA 2R92G 4XBFA 2ALZA 4YB8B 5LBQA 1W5CC 1XN7A 2DMTA 4JI8H 5DUIA 3ZQCA 1GDTA 1OMIA 4UVBA 3DU6A 3SEZA 2R93J 2V6CA 2DAOA 4YR0A 4FX0A 2B63G 1I50A 4XNFA 3R5XA 1FPQA 4BBSG 3EUAA 2O61A 4DOZA 1WZ2A 4X62H 4CCKA 1G3YA 2LNBA 2XV4S 3ISPA 1LPQA 2V9KA 2EJRA 4NHJA 4FTHA 2DI3A 2PFBA 3GFIA 5FD6A 4G6TB 2UVUA 3T8TA 2KIUA 5JUMA 4X6AJ 4A3GJ 2EZKA 2O7OA 1UHWA 1Y0NA 5DG9A 4AIDA 2J6SA 4YFXF 3RGZA 1N78A 1T6SA 3ZQLA 5LEKA 1SD4A 3RIZA 2FLNA 4YAKB 2R7QA 3BQYA 4HZFA 3EUHC 3WGIA 4Q5SF 2M05A 3GTKA 3HOUG 3IH2A 3TDUC 4JX4A 4DZPA 4I98B 4QIWA 3RBDA 2JK3A 3HUGA 2FLLA 4NB5A 4U0WA 5DG8A 3G6XA 1S9HA 2VJJA 4RAZA 3LSPA 3ZN0A 1ON1A 3K4NA 4IF4A 4A69C 3P9IA 3D1NI 3SFZA 4LLLA 2YPRA 3H9GA 4RGUA 5HS8A 3HSFA 2F4IA 1JTYA 2EFOA 2LKPA 1Z6TA 3HYIA 1TWCJ 4WK8F 1VI0A 5ILUA 3KCCA 1EH8A 4ON0A 4F4XA 4YHHH 4F3QA 3H0GJ 1MMGA 3GVAA 1MSFC 1LNWA 1QHHD 3PQJA 2VE8A 2AU0A 2IJLA 2WY7Q 5GAEJ 4IWXA 5LL6b 4A3CG 3V8KA 2GZWA 3R0AA 1V55H 1Z7LA 2ICWG 2RVCA 5CA0F 2V58A 4RUCA 4XLNF 2IS2A 4ESJA 1GVDA 4NC7A 1KJ8A 5J2TF 2EV0A 1N75A 2XASA 1FOWA 4O6JA 3M1EA 4B3TH 2MFZA 3L4JA 2CO5A 1TWAA 1N25A 2E5NA 4A5NA 3RPQA 2PLYA 1W36D 3NGDA 3MEXA 5L3DA 4QJFA 5D1OA 4HYEA 1AA7A 3K6GA 1K78B 3JRDA 2DPUA 2HEOA 4EFBA 3S1MJ 1LJ9A 5KFEA 1TT5B 1H0MA 3WODF 3HG9A 1FX7A 4XOPA 4CCMA 2M8GX 3G71I 1LVAA 4WXCA 2DA7A 3HOWJ 2IW5A 2C2RA 3MFHA 3UQ8A 3FMRA 4XLAA 4EM1A 4ZOLF 4CDGA 4QIWE 3WO0A 4BXXJ 1FP2A 1Y1VJ 2EPFA 2M7BA 1ZHSA 3QZ8A 3CZ6A 3M4OJ 2CQKA 1OLTA 2VT3A 1H88C 2XGDA 5JH7F 4B09A 5BPFA 1VQ5I 5C8YF 5HS9A 3IAM2 1BIAA 4AD9A 4Y13A 5GTIC 1E4FT 1XMOH 4MFEA 3HRMA 1S97A 3GTQJ 1FTZA 4UV9A 2WDTA 1RKWA 1BOBA 4M6VA 1XB4A 2YR2A 2DQRA 3FWEA 4E4HA 3TGNA 4AWXB 4KT6A 4I55F 5DGBA 5EWEA 4RAGA 1U5TC 1J5EH 2R7ZA 1TZLA 2I80A 2GWRA 1U5TB 1JJ6C 2UUAH 4PUSA 1S03G 2R7MA 4B44A 3Q1KA 4X64H 1ZKGA 4JX6A 4RBOA 5E1WA 5DCMA 3DP7A 4C3HJ 2R7OA 1MZBA 1Z3XA 2PMUA 4RB3C 4L9JA 1YRNB 4G9YA 1CS0A 2QYZA 3QOEA 2VPQA 2VPSA 1RETA 2WE6A 3W2AA 4YJ2F 2A61A 3FM5A 5B3SH 4A3EJ 1E17A 2Y30A 3KEOA 1JDBB 1YE9A 4RAFA 5EJCA 4YJ3F 3QPHA 5KT5A 4A3MJ 1ZREA 1MBGA 3HOVJ 2HQAA 2V4JC 4ESBA 5FFXA 4QW8A 2WTFA 3Q0UA 1FMWA 1T08B 1WJDA 2R8KA 3LWFA 5GADJ 2FXAA 1ZR2A 4ED6A 1V3FA 1QVUA 3OYAA 3IKTA 4R8HA 4C3IJ 1XGSA 3HRUA 4JV1A 3BG9A 5JI6A 3HOYG 2XF5A 4BUPA 4UVCA 1OCRH 3GIKA 4UCVA 3WTUC 2GBYA 4IRCA 4L5JA 2JVGA 2Y69H 3KALA 2OCCH 3JRHA 3FISA 3VPRA 5I47A 5EGOB 3N4MA 4E6KG 4N4NB 1SFEA 2W48A 4EATA 1QZZA 3MR3A 1FP1D 2JTVA 5IYDJ 4ZQIA 1WJAA 2R85A 1O3TA 1KU9A 1MBKA 1GT0C 4U7CA 5BOXA 1A36A 3P9KA 3L00A 1GGOA 4BQAA 3NQOA 3DKYA 4HLXA 5JVGF 2R7DA 2M30A 2JEGA 4EJOA 4F55A 2DXIA 3GLKA 5IP6A 1RZ4A 3E1SA 2R6FA 4YEJA 5D6FA 1X4PA 3DTIA 1XMXA 2Y48A 3K4BA 4RMNA 5M5WJ 2JT1A 3NARA 1SYXB 2P8TA 2GIZA 4JI4H 3GFLA 4BJTA 3EUHA 2YUSA 3M8JA 3OYEA 1Y6IA 2EFPA 3KHGA 2DO7A 1TWFJ 5M5XJ 4A3BG 3OYMA 2LKXA 3RZDJ 1R22A 1KJQA 3R23A 1Y8QB 4N9IA 4BEHB 3PW7A 3JAMW 3AFHA 3BR5A 4PDKA 1Z9CA 3I4MJ 2DMPA 1BN5A 3SJMA 4BU2A 1XDSA 2J5PA 1B8IB 2KIQA 3S1QJ 4XOTA 2CV0A 4JOMA 4PJ0C 4EFEA 1C0WA 4JQFA 2NYXA 2Q8KA 3H35A 2W84A 3J7YJ 4DL7A 4OIQF 2BW3B 1FWZA 2DK8A 2K40A 2O8XA 2RQQA 4Y33A 1WJEA 4D0PA 2ATLA 4F52A 3E3VA 1UNNC 1A6QA 4HQ6A 1QBJA 3TW6A 2Z5UA 1JKQC 4PJMA 5EYRA 5FLXK 1MBEA 3H3UA 3JTHA 2V5AA 2VODA 4EQQA 1Y39A 5KFIA 3SXYA 4HDUA 3F8CA 2A6HF 4E7KA 3OYGA 4N9HA 3JW4A 2ZJQF 3N05A 1UJ8A 4Y17A 1TQIA 5CKTA 3BJAA 1S0MA 1R5GA 2L7FP 2XCAA 2W25A 1RNLA 4G8XA 1PUFB 5KFQA 3TQNA 4AIHA 3CUOA 4HDVA 4RLQA 2ZO4A 3EYIA 2R7XA 1B6AA 2OQGA 4W1UA 3FDSA 1DPUA 4YG2F 5IPAA 5C44G 4NXMH 1IO2A 5CVUA 5E8GA 1K78A 4OMZA 4KMFA 1BC7C 1GXQA 5EEGA 4RB2C 5DLFA 3TQ1A 3AYHB 2P5VA 1CGPA 5IT9K 2EK5A 5DQGA 1CQJB 3ULQB 4YY3H 3OSNA 2CUEA 3K69A 4G12A 3LOCA 2DQLA 4NLGA 3R61A 1MBFA 2Y75A 3MKYB 3AG2H 3OIPA 5K2MA 1FY7A 4LJZF 2FUG2 3O6BB 2K9LA 2NOGA 3QODA 5KNLA 4AM3A 3HOZJ 5KHDA 3ZN1A 2NU9B 1W7PB 2VC1A 2MH9A 2BR0A 1U0JA 5DD8A 3CCMI 2Y0SE 2A5WA 2E1OA 4BAYA 3K3VA 3JAMZ 1K83A 4HNTA 4XLCA 4PK4A 1IUFA 2JA6A 3ZQIA 2CWEA 1SMYF 4P9FA 2UVVA 2R8HA 1A6IA 3K10A 3QU3A 1T98A 4PJLA 3C2HA 2K02A 4DQ2A 2FMAA 1J75A 4EBEA 3RF2A 5DGAA 4L0YB 3C7JA 1U5TA 2JN6A 3ORQA 1ETKA 2LFBA 2IAIA 2XAJA 2BXYA 2NVTJ 1V4YA 5L3EA 1ZHFA 3SZTA 1SANA 1YJNI 4KIFA 1R9TJ 1S5LC 1X19A 1P4AA 2H94A 3WHBA 2XGQA 1E0EA 2AO9A 1RK5A 1R36A 2IRFG 1KJIA 2VQEH 1ZG3A 5IYCJ 1T3NA 2HKXA 2X48A 4HR7A 2PN1A 3AG4H 4CO8A 5AONA 2MH2A 3OS1A 1AOYA 1UC9A 1MSEC 3WTZA 2PMZN 2VJ5A 2HOSA 2FQ4A 1U9OA 3CCSI 3G6EI 1FVIA 5LYJF 5E79C 4IHJF 4J9KA 2WAEA 2IA1A 2J6UA 1SD7A 2DYSH 2FF4A 2IGNA 4HNUA 4Q8EA 1XG1A 4BHCA 2HYJA 2XGXA 1LEBA 3OUUA 2LDUA 2JA2A 2XB0X 1VQ9I 2P7CB 1MBJA 2XGCA 4MV3A 3MCZA 5IP7J 4MNUA 1IG7A 1WGXA 4IX7A 2AXLA 2RNGA 2ACJA 1NK2P 2QSHX 2EIMH 2LY9A 3F3XA 2IVMA 1AHDP 3LSHA 1K79A 2VKDA 1N33H 2RAEA 2EB7A 3G2BA 2EILH 1XX5A 3PUBA 4EEFG 2BVMA 1I39A 2PQ8A 4LB6B 2XRNA 1SVMA 2NS0A 3QOPA 5DG7A 2R3SA 4NC6A 2W24A 4PDBA 3K7AJ 2HPMA 2BGCA 3FBNB 2IGKA 2E2HA 2QQAA 2H6BA 2NAZA 1I7LA 2LP0A 1ULZA 3DEWA 4U7BA 1X1AA 2VJIA 4UUSB 3KAKA 2L9RA 1EUDB 2CQQA 2XDVA 5BPDA 1PX2A 2PEXA 1VF9A 4PGGA 3RTXA 2HVSA 3DTKA 5JHFA 3GTLA 2IEKA 5KFSA 4X66H 1ITYA 3OYDA 2GQQA 4XRFA 1K7AA 1T94A 4YFNF 1C30A 3FXMA 3F0CA 2HZDA 2E19A 2W6PA 4BEHA 2YZNA 1ETWA 3WTSC 4XQFA 1ZGAA 5J1UA 1VBHA 4I6ZA 1B4AA 2IS1A 5JR3A 3MD2A 1IUYA 2DDBA 1B8IA 3BABA 1N36H 5FFZA 2HGCA 4LMYA 1P4XA 3G3ZA 3CESA 2XHKA 2BW3A 3KZZA 1IN8A 3VYRB 2WAQN 4XZ3B 1IF1A 5KFTA 3BCAA 2CUJA 3OHAA 3RTRA 3G1MA 1VBGA 5ED4A 3W6VA 2IS4A 2QA4I 2LY1A 2GPSA 4D7NA 3OTOH 1TNSA 1Y56A 3C18A 3KP4A 4QWAA 1D8JA 3K9TA 4AU7A 3ZP5A 2UUBH 4MAMA 2ZJTA 4YP3A 1ETOA 1KGSA 3KP2A 1PUFA 5D5WB 5FLVA 3FDYA 1IV8A 2YU3A 3BG6A 4EM2A 4BBRG 3LL7A 3HGYA 2DW4A 4YFKF 3M4IA 4ESFA 2B0LA 4JV5H 1OKRA 3H36A 3IWZA 3WG7H 5ICGA 4FX4A 1S9FA 4YR3A 4Q45A 4KYWA 5K1YA 2GM4A 3KHLA 3DPLC 1E3HA 5JHUA 1T95A 3M9MB 4BY1J 3JRCA 2QZ8A 3T0YA 2ZNYA 1YITI 4DR5H 3R6SA 4FBTA 4NC8A 1BI3A 4ZTFA 3N43B 2W00A 1TT0A 3GTGA 2NVXA 4IQJA 1O7FA 3E0JB 5C3EG 4ZYGA 4UUTA 2IBKA 2E36A 1WCMJ 1IDYA 1Z2NX 1R4NB 2KT0A 5C1OA 1WJ5A 4GC7A 5KT2A 3HPHA 2E60A 3FXOA 3HRSA 5FKLA 4FQGA 2JPCA 2X1EA 4KISA 3MMYB 3BZKA 1MDMB 3ZMUA 1A5JA 2R8GA 3JRFA 2VN2A 4LF7H 4A2AA 1UFMA 3MN2A 2W6ZA 1D3YA 4IRDA 4J9NA 2ZXWH 1USTA 1HW5A 1BOAA 3CDIA 2D1HA 4IHTA 3TIIA 4BS9A 5FLXW 1SAUA 5L3BA 3W6JB 1O75A 4C5BA 1JUPA 4BQQA 2GLTA 3VPCA 4ENNA 3CCEI 1POGA 2VKVA 3PL8A 1U3EM 4ED7A 2GPWA 4DLKA 3FKIJ 3GF2A 5E3OA 5KFHA 3RYRA 3GTJA 4JYAH 3DBRB 5JVLA 1Y1WA 2DPIA 4BQOA 2W6MA
chains in the Genus database with same CATH topology
5LHHA 4GO1A 1A04A 3NEUA 4HX7A 3F22A 3WU1B 1SAXA 4OOIA 3DF8A 1PP8F 3GEZA 1HXDA 4BXUA 3D5LA 4MQVA 2ZMEB 5IT9W 2E1NA 3H92A 4KN4X 3CTAA 1B1BA 2HS5A 2QUFA 3BJ6A 3F23A 3ML6A 1P2FA 4AVPA 2JZYA 3FZVA 4GXOA 3EDPA 2COMA 2E1CA 1F5TA 1FSHA 2A6EF 2OZUA 1G3SA 4LF4H 1B04A 2ADUA 1LB2A 1ZGJA 3ELKA 1T38A 5FD5A 3VODA 1KYWA 2XAHA 4HOBA 4UCTA 1ZRCA 3JSPA 5K5OA 1KQ9A 2UXBH 2H09A 3KP5A 3HIFA 1TLHB 1IXSB 4Q48A 2OZ6A 4G94A 2H27A 2TDXA 3V4GA 1SFXA 1USSA 1ZRFA 5IT9Z 2QVOA 2FE3A 4CC6A 2HYGD 1XMQH 4GKKH 3LA3A 1ONVA 1HNZH 1HKTA 5D8KB 3LA7A 1Y0UA 4IVNA 3KXYT 1W5SA 2ESHA 1U8RA 1GHCA 3U1DA 2XKPA 3MFKA 1O3QA 2PMHA 2ZJ2A 3ROUA 2V1UA 2XIGA 3DPTA 4LFAH 2RV8A 1E2XA 1XNRH 4L9VA 3M9AA 4JI0H 1Q1HA 5KK1A 4CXFA 2HDCA 1MDMA 4OMYA 1TAEA 1MKMA 3J80Z 1ZHQA 3E5UA 1P8LA 2MLKA 1L3LA 2WC2A 5D5UB 3BZ6A 1V9PA 3RKXA 5E20A 1IRGA 3CDHA 4MHGA 3KZYA 2CYYA 1AN7A 4RS8A 5LEJA 1HW1A 4ZYHA 4DNCA 4IRIA 1KQ0A 1O57A 5DV5A 3RIRA 1Z6RA 2UXNA 2EFNA 2E5LH 2ZMEA 2ZM6H 3CJNA 2GXBA 3UQ8A 1BI1A 2GA1A 1ZG5A 4M71A 3BPXA 1HQCA 3RJ0A 4O5VA 2QENA 2MD5A 3ZMVA 2L4MA 2OBPA 2UXXA 4E70A 1LDKB 3L2CA 3MAJA 4XSXF 2MA3A 4FHTA 3BJOA 2D45A 3I0TA 4G6QA 2RKHA 1FKAH 4ZZLA 3LFKA 3I54A 5D4SA 4LLNA 3ABUA 5J6XA 4DR6H 4R79A 3KAJA 2C6YA 2FMLA 1YS7A 1HSJA 4B8XA 2J5OA 4CZZA 2VE9A 4HX8A 2MBFA 1RIOH 5HDGA 2NNYA 4L0ZB 2BBYA 1FNNA 2Q2UA 2XAQA 1ODDA 5LRRA 4UFZA 4IRHA 4HF1A 4HQMA 3QU6A 4P55A 2NNNA 2WWYA 4DR7H 2VOPA 2YX7A 3WGGA 3WE3A 1XD7A 2Y0MA 2JPBA 2EFQA 3COAC 3QPTA 5HLIA 1TA8A 3ZMZA 1IN5A 2FMYA 4B3MH 1FJGH 4DUZH 2A3SA 2O03A 1PUEE 1HW2A 3BA8A 2HQRA 3B02A 4O3MA 3VEPA 4DV4H 3L9FA 1P92A 2H6CA 4BNCA 4UVAA 4EJUA 2RNJA 1FOKA 1FBUA 2FOKA 2ELHA 3TO7A 2V1XA 4KFCA 3PFIA 3L2PA 3KP6A 1FBQA 2GXGA 4AIKA 5DUKA 4KMUX 1YTYA 2VUGA 3VB2A 4I2OA 5L3FA 2MC3A 2DK5A 2F5FA 4A0ZA 5CVIA 1DDNA 3D0SA 4DR2H 2KRFA 3IHUA 1BJTA 4RZQA 3BY6A 1XSDA 1QGPA 1G6NA 2WTEA 1JGSA 2HTSA 1KQ8A 4LFCH 2Q0OA 5LGUA 3BDDA 4KIBA 4LG0B 1I6UA 4A6EA 1Z7UA 5ICCA 2RQPA 4OIPF 2OWOA 1PP7U 1TQPA 4A5MA 3WGHA 1JHFA 1IRFA 4I09A 3HHHA 3F8NA 3EETA 4MV7A 1CF7B 4OX9H 1N34H 4ZYDA 2O6GE 3F8FA 1EH6A 5LMUH 2ZCWA 4KHPH 2K7LA 4HA8A 1M0WA 1F9NA 3GLXA 2HVQA 1S3JA 5HLGA 3AAFA 4XSZF 2YX4A 1MD0A 2W85A 2XVCA 4I02A 1B9NA 2EFWA 3FXUA 3IL2A 4H0EA 1IW7F 4MTEA 1YYVA 5D6EA 5A2QZ 2FBIA 2ZKZA 3MWMA 3EYYA 3HHGA 4IRGA 2F5CA 1BM9A 2BYVE 3H20A 2A69F 1G3WA 3GFMA 1RUNA 2UXDH 1I6XA 2ETHA 5LGTA 4UHTA 2LF7A 4DR4H 5JVTA 4KA4A 4I7HA 1QQIA 3MQ0A 1HSTA 3RI4A 2FBHA 3T1HH 5FB2A 3ZPLA 4LH7A 2CW8A 1KA8A 2EV5A 3J80K 1ZN2A 3N44B 3KLOA 1YFHA 3IRQA 4IHSA 1V4RA 4A0YA 1X9NA 1R1VA 2VT2A 2ZBKA 1XSVA 3HTUA 1P6RA 2K4BA 2CG4A 3Q9SA 3K1MA 4LLGF 2BV6A 4RGRA 4LG0A 3BOQA 1IN6A 3RYPA 2YSRA 1YQAA 4LF8H 4ENMA 2L54A 4DV7H 5H6QA 4M72A 1Z2PX 4GLXA 4G7HF 1CF7A 2PG4A 5LHGA 3J81K 5AIQA 4U88A 1QNTA 4LFBH 3R0JA 4OINF 4RB1A 3V8LA 1U2WA 1IBMH 1WI9A 4KNYA 1DPRA 1RI7A 2L01A 1D5VA 5DDGA 4WXHA 1ZRDA 2YCHA 4R7RA 3DV8A 4WX9A 1F4KA 1WH2A 3J7AK 2X0LA 1M0TA 4M6XA 1YG2A 3KETA 4A0XA 4UCRA 4LSAA 5CVRA 4NXNH 5CVVA 2K4JA 2UU9H 5F1RA 2X4HA 1IXCA 3GZ6A 1J9IA 3DQVC 1XDNA 1I1SA 1J0RA 1WWXA 4DV2H 2G7HA 3LMLA 1JXSA 1KU3A 2HGSA 4GYGA 1XGOA 2VONA 1KU7A 1IN4A 1W7PA 1ULYA 3E6MA 3BA9A 3C3WA 2NRAC 1FC3A 3JTGA 3V7SA 4YIIA 2M87A 2RGVA 5DD4A 5E1XA 2MLGA 3I71A 3TO6A 1T2KA 3N97A 2F4VH 1P4WA 2M1BA 4ZZDA 3GUDA 5F6FA 1XCBA 5D8LB 4L5IA 2V1DA 3CO7C 4N0BA 5HOOA 4LB5A 2FEZA 5J8FA 4EJTA 1QPMA 4BWSC 3OV8A 5LLQA 3TOAA 2XROA 5TJJA 1FT9A 1QZYA 5ICFA 1IBLH 4RGXA 1TW2A 1ZAOA 4WCGA 3QRFF 1OPCA 1T39A 4YIFA 2O0YA 2LF8A 2DFIA 5DYMA 4CC5A 4S05A 2CSOA 1LDDA 4B3SH 2HR3A 1W7PD 1MJAA 2ISZA 3I64A 3RKWA 4K0KH 3DF7A 1K6OA 1IXRC 1F1ZA 2D1VA 3SQNA 5TRDA 3HXLA 3I58A 3J80W 5AIPA 2KKOA 2GIVA 4G7OF 3P9CA 2XAGA 4HF0A 4LF9H 1DP7P 3B73A 4K2EA 2DU9A 4U0YA 3BPVA 2PJPA 1BI2A 1I94H 4LSXA 2GA2A 1R00A 1XGNA 3V7CA 1LDJA 1X3UA 3F6OA 3ERED 3N40P 4GKJH 1JE8A 4KT5C 2Z3YA 6PAXA 1YW8A 3I4PA 3U9GA 5IT3A 3LSTA 2L3DA 1WKMA 1HR0H 4EJVA 4JBAA 2PN6A 5A2QK 1FYMA 5D4RA 3E6CC 2K86A 4MV9A 4UV8A 5HDKA 3T1BA 5D5VB 2UUCH 1SEIA 4CHUA 4Y15A 1VS0A 3GYHX 4OIRF 5CJ9A 4KICA 4LGWA 2P4WA 2QLZA 1XCVA 4A2UA 2VXZA 3RPUA 4B3RH 1BI0A 1XNQH 3HSRA 4EVIA 5HS7A 5CVJA 1SFUA 2RDPA 3FMQA 3QP6A 4BYYA 3FXQA 4UUVA 5H20A 4M6YA 3KLNA 3TDZC 2P5KA 1L0OC 1N32H 4I0BA 3ZMSA 1J7KA 2A5YB 1BBYA 2W57A 2FQ3A 3T5XA 3WTTC 4PGHA 5CLSA 4PZJA 1DUXC 3J81Z 1TW3A 4LH6A 3VFZA 5BMZA 5KVRA 5HLHA 5F64A 4EV0A 2UWMA 3KP3A 3PN1A 3F72A 4EGZA 2VQFH 3L09A 3U2RA 2M5WA 1EV7A 2OU2A 4EEQA 1Z1DA 5FGMA 2QYOA 4JI2H 4A2BA 1YLFA 1NHAA 2G9WA 3KE2A 4M9XA 4EM0B 3DXJF 2OA4A 4RGSA 4FT8A 3BP8A 5BS6A 2IT0A 1L2ZA 5E18F 4ZH4F 4L9NA 3GXOA 4DV3H 1LQ1A 1ZLKA 2FRHA 2RGRA 1ZH5A 5FO5A 4P96A 4F7ZA 3IKVA 2QQ9A 4J0MA 4LD5A 3ECHA 3ECOA 4G7ZF 3FXRA 3ZMTA 3IG0A 3HTSB 3IWFA 5ICEA 4RAYA 5ERIA 4BH9A 1OYWA 3WTYC 1BJAA 5LHIA 3SHFA 4TV7A 3ZMDA 2P5LC 3MZHA 3BROA 3EQLF 4G6DA 4U0VA 4L18B 3T8RA 4RB0A 3P7NA 1AWCA 4DV0H 4ASNA 1R1UA 5BR8H 4LK1F 1DGSA 2VOOA 1R1TA 2JSCA 2FU4A 2CW7A 4MQ9F 2F5DA 2HOEA 4A6DA 2CFXA 3ZQ7A 4Q4ZF 4WXDA 4AIJA 3H3ZA 2P6SA 2QM3A 2VBWA 4CICA 4KN7X 2UXCH 4M73A 3Q5FA 3TKYA 1IZ1A 2JRTA 5L3GA 3M8FA 3GO5A 1IBKH 3FM3A 4QWQA 3V8JA 3E5XA 5A2QW 4JI3H 2E7XA 1S7AA 3K1PA 5EEHA 2IA0A 5E17F 1TQMA 2IPQX 2Z99A 1WSUA 1O3SA 3JSLA 4M9SA 2FA5A 5DCFA 4EJWA 4X65H 2CGPA 1VTNC 4WF2A 4ENKA 2XAFA 5LRSA 1R23A 4LK0F 5D1PA 4MEXF 1HKQA 3GFJA 1XMAA 1UB9A 3CVZA 1S7OA 4KDPA 2VOBA 2QWWA 1YW7A 3FHZA 4JK1X 2EA4A 4HF2A 2HZTA 3N41B 2CW0F 1FBSA 4BHBA 3E6DA 1HBXG 3G73A 1BGWA 3F6VA 1UCRA 3L4KA 1ON2A 2Z33A 3K0LA 2DBBA 2Q2EA 3REOA 1MJ9A 3JSNA 2P6TA 2FNAA 2KJCA 1J59A 4GGGA 5JFRA 3ABTA 3WTXC 4JI5H 2WYOA 1G4DA 1H9TA 3KFWX 1S6LA 1HNXH 2P7VB 5HVQC 4IXAA 3GZ5A 3J7AO 1EH7A 5EOYA 4DR3H 3RDIA 2ESNA 3M7GA 5LMNH 2M45A 4I01A 4LF6H 3IC7A 1U6GA 1R5HA 3RJPA 4DV5H 3WU0A 2WV0A 3I53A 2E7WA 1IN7A 1TBXA 3QAHA 3DEUA 2D2WA 2DTRA 5FPRA 2BEOA 3WE2A 2Z9OA 5E8IA 1KYZA 4OU0A 2RC4A 3E6BA 2AS5F 2QBYB 3TOBA 2L4AA 3I59B 1SD5A 1BC8C 2L02A 3V7RA 3O3KA 1H9GA 2A07F 3DFGA 2DT5A 2VBYA 3C0FB 3LQQA 3CUQC 4LFUA 1GXPA 2ZXJA 3CUQB 2MCTA 2Q2TA 5H6RA 4IAJA 4Q0YA 5J8CA 3C1DA 3GW2A 1FYLA 3SZPA 4A12A 4LF5H 5D5XB 4HQEA 1A0IA 4I0AA 1B59A 2KIFA 3HOSA 4HV6A 2DPDA 1B9MA 1J2XA 4EGYA 4GYIA 2HTJA 1W4MA 2HHHH 4DV6H