3AYHB

Crystal structure of the c17/25 subcomplex from s. pombe rna polymerase iii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
203
structure length
183
Chain Sequence
MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWKIEGEDGSEGTELYFDIDEEIRFQIESEDFVDVSPYTLIASCSRDGLGIPAWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C17/25 subcomplex from Schizosaccharomyces pombe RNA polymerase III
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase III subunit rpc9
total genus 40
structure length 183
sequence length 203
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
B PF08292 RNA_pol_Rbc25 RNA polymerase III subunit Rpc25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ayhB02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3ayhB01
5LMUL 1N36L 3D0FA 1B8AA 3I2ZA 3Q8DA 3JAMc 3I56A 1CKNA 3CCSA 5IYDG 1YI2A 1XMQL 1VQ6A 4R4OA 4B3SL 1HNWL 4QGUA 1PH1A 2AWNA 4A3JH 4OONA 4GNXA 3HOZH 4H02A 1L1OC 4XIGS 1KD1C 1E1OA 2YTVA 1HZBA 4KHPL 1K8AC 1IBLQ 3S15H 4AYBG 3PV0A 2K75A 3H0GG 3S14H 2K14A 1O7IA 1Q1BA 2AWOA 5BR8L 4KHZA 1YZ6A 3KFUA 2D0PA 2BH8A 1BBWA 2PQAB 1YIJA 1LUZA 4OO1I 5C4XG 2JK8A 2OTLA 1E1TA 3F1ZA 1EIFA 2R7ZG 4A3LH 1M1KC 4UPAA 1N34Q 2LXKA 4HJ9A 1IBLL 2K5VA 3J80c 4OWTB 1Q86C 5JJLA 1B70B 3HKSA 3K0XA 5E7NA 1YHQA 2PNHA 3I4OA 1X9NA 4JG2A 2VY3A 1RIPA 2JQOA 4LF5Q 3S16H 4P73A 4A3MH 3TRZA 3U4VA 4JOIC 4A3MG 3U58A 2IHEA 1E3PA 4DAYB 2A8VA 1FL0A 4DUZL 4X66Q 3F2CA 1EIYB 1XJVA 4BBSG 2ZTEA 1KL9A 2IHFA 3GTMH 4GN4B 3ULLA 2UXDQ 1QZHA 3A74A 3M85A 1LM0A 5IP9H 3J81j 2VZAA 3U4ZA 4PG3A 3DM3A 4UY8C 2R7FA 1SN8A 3T1YQ 3ER0A 5GAEC 3F2DA 3TQYA 3OTOL 3I4MH 3KDFB 3RR5A 3FKIG 1UEBA 4B3ML 4A3EG 1U5KA 4KHPQ 1YHAA 1XTDA 4IFDI 3G4SA 2QEXA 3S1NH 1I50H 2AMCB 1V43A 3GTLH 4IJHA 3HKZG 2UUCQ 3ULPA 4A3CH 2UU9Q 4LF4L 3KLWA 2VUMG 3K8AA 3OTOQ 3EIVA 1S3OA 2Q2TA 5FJ8G 3PO3H 4HJAA 1QZGA 4DV6L 1G291 1J5EL 5IWAQ 4GN5A 3BU2A 4EX5A 3AYHB 3CXCA 4LUZA 4DV0L 1Z47A 3HOVH 4LFBL 3EN2A 1VS0A 1Q8KA 1FGUA 2FXQA 1I5FA 1WCMG 3MXNB 3HOYH 1HNXL 4APVA 4JI7Q 4IPCA 4DUYQ 1N9WA 2K50A 4BBRH 2JA7H 4O2DA 3CC7A 4IOCA 4IPGA 3G6EA 5JEAJ 2VUMH 5JEAG 5C44H 2F4VL 5FLMG 4WJ3M 4IJLA 5EAYA 3PF4A 4UP7A 3I4NG 2Y0SG 1Q46A 3H0GH 3GTJH 3UE0A 4FDBA 4DR4Q 5IYBG 2EXDA 2KENA 3IRBA 5IE8A 2N78A 4GOPC 3F2BA 2CWPA 4DAMA 1MJCA 1SMXA 3ERSX 1S40A 5HY6A 1PH8A 1DGSA 2QGQA 3CF5A 4YWMA 1SE8A 1NE3A 4YY3L 2JA8G 2JA9A 4YWLA 5C4JH 2YTXA 3PF5A 1R9TH 1JMCA 1LYLA 4EQ5A 2UXDL 2F3IA 4NXML 1SR3A 4A93H 4OX9Q 4JBMA 4L5SA 4QJFA 1N33L 5LMNW 4AIMA 5M5WH 3JC66 1EQRA 3B6YA 2IX1A 1Q81C 1TWGH 4UP9A 4TQUS 4LNQA 4DV2Q 1SROA 2GVBA 2Z6KA 4BXXH 3HOVG 1AH9A 2VL6A 1UE6A 2GVAA 2ZM6L 2N8NA 2HQLA 1BBUA 2UUBQ 1VQKA 1PH9A 4OO1G 2JE6I 1N33Q 1N32Q 2D0OA 1X3FA 5M3MG 1I6HH 4JI1L 2ATWA 2AKWB 1Y1WH 4QY7A 2LXJA 4DV3Q 4A3LG 5GQOA 3TS2A 2XTIA 4Y52H 4DV1L 1VQFA 1HJPA 3CCLA 4A3KH 4IFDJ 3D31A 1X65A 2OTJA 4LF9L 1J5EQ 2NVQH 3BZKA 3RLFA 2C35B 2H5XA 4B3TL 3KJOA 2MO0A 1TWAH 5IT9c 2RF4A 3M9BA 1IBKQ 4BA2I 3L0OA 4YCUA 3HOUG 4MNOA 2UUAQ 4JV5L 1NMGA 4MTNA 1Y1WG 1C7YA 4BBRG 1OXVA 1VQ5A 2JA7G 2R92G 1SRUA 4YWKA 2NVYH 3M7NA 4JBKA 2B3GA 4LFAQ 1OXXK 5GAGC 1WCMH 3HOYG 5FLXc 1X3GA 2BA1A 4JI8L 1IXRA 4PZ8A 4YHHL 3K7UC 1NTGA 4A3GG 1K0RA 4YCWA 1FJGQ 4K0KQ 2VQFQ 2UXBL 2AHOB 4DV6Q 2CCZA 3HOUH 4YY3Q 3ICEA 1EWIA 4LF8Q 2F52A 1IL2A 1HR0Q 1PFSA 3KF6B 1PHJA 2UXCQ 4DK6C 4HJ5A 4JOIA 1OXUA 3TREA 4DR1L 4LF9Q 3AEVA 2V1CC 3KDFA 1PVOA 1JB7A 4DR6L 2DGYA 1YJWA 1HZ9A 4DV1Q 1GKHA 4DV7L 1OTCA 4OWWB 3BJUA 1IBMQ 3J7ZC 3HOXH 2K52A 1Y1VH 1OXTA 2Q2HA 3KYHC 5LMNL 4DR2L 3W1GA 5IP9G 4LWCA 2YTYA 3CCUA 1A62A 5GAHC 4GNXC 5JJKA 2Z0SA 4X65L 4MZ9A 3WWVA 4JI1Q 2JA6H 3STBC 2R93H 3UDGA 2ID0A 1MJEA 1N32L 1YBYA 3SGIA 1LTLA 2L15A 4BA1I 1GVPA 1A8VA 3PIOA 4P75A 1VQPA 4JI0L 2YU9H 4DR7Q 3S2HH 1XNQQ 1VQ4A 5DLQE 4JI4Q 1OXSC 2R93G 2I5MX 2Q2IA 3KOJA 1XPUA 5M3FG 2OQ0A 3OW2A 3J7A5 3GTGH 1IZ6A 3RZDH 3KJPA 1WFQA 4L5QA 2VW9A 3DLLA 1JJGA 3CC2A 4LF6L 2NZOA 5C3EG 1ASZA 3UDFA 4B3MQ 5H1SE 3E0EA 1TWHH 2N49A 4HIDA 1JJ2A 2NVTH 3K81C 3CC4A 1HH2P 5IYBH 4DV4Q 1SLJA 4DR4L 3PUWA 4A3EH 1VCIA 4HIMA 4A3IH 2IY5B 3NBHB 5BR8Q 2JEBI 3KF6A 4JI6Q 1VQHA 3PUVA 4JYAL 2MO1A 2WAQE 3HOWH 1EUJA 1YVCA 3CQZH 4PZ6A 2CWAA 3PUZA 4DR3L 2E5LQ 4X6AH 1B7YB 3J81i 3FP9A 1PH5A 4A3BH 2UXBQ 2MQHA 3E9IA 1VQMA 4GN3B 4DR5Q 3MEFA 5ELNA 4YHHQ 1KAWA 3PUYA 1CKOA 5IYDH 2JEAI 3L7ZC 4IPDA 1XMOQ 1HZCA 4BBSH 2KBNA 1KHIA 2VNUD 1K9MC 1QUQB 4LW1A 1A0IA 3STBD 4GOPB 1I94L 4ME3A 1VQNA 3S2DH 1PH3A 1VQIA 1Q12A 1EOVA 1Z9FA 1AE2A 3TEHB 2WP8J 5C0XJ 4OX9L 3S17H 4QIWE 4A3IG 3CPFA 4C3JH 3H15A 4HIOA 2PI2A 2WB1E 4LF4Q 1VQLA 1KIXA 4YCVA 4JI2Q 2CQOA 4LFCL 4NPSA 3CAMA 2PMZE 1YNXA 3E9HA 1I3QH 1YHBA 4GS3A 1N34L 3CMEA 3PSIA 4X62L 2UUCL 2HIVA 1WI5A 2XGTA 2WB1G 3FKIH 1VQOA 4RG1A 1N8RC 1XNRL 4B3RL 3S1QH 2KCTA 3K7AH 4P72A 3RNUA 4DR6Q 4JCVE 1NJIC 4A4IA 4A3GH 3L2PA 3PIPA 2HHHQ 2OQKA 4B3RQ 3GTPH 2VS1A 4HJ8A 1EQQA 1V1QA 3A0JA 1P8LA 3M3YH 2KHIA 3PCOB 4GKJQ 1SFOH 3RN5A 5AJ3L 5C44G 4OWXB 4LF8L 1TWFH 4L5RC 3T1YL 1FVIA 1GM5A 5IYCH 1HZAA 2ZTDA 3G48A 4JI5Q 2A1AA 2EIFA 1X55A 2HIXA 3M4PA 1CUKA 2VQFL 1HNZL 2ALYB 2MNAA 1XNQL 3H3VI 3JAMi 4AYBE 1L1OA 1PA6A 4WJ4A 2ASBA 4JC0A 2OWOA 4A3DH 4JI3Q 1N36Q 5C0XI 2KHJA 2B63H 4QQBX 2K5HA 5M3FH 1CKMA 1WJJA 4QL5A 2MFIA 3AFQA 3HOWG 1XMOL 2RHSB 2YV5A 2Q2UA 4O0AA 5IP7H 2K4KA 3W1BA 1V9PA 3RN2A 1G51A 4KI0A 4X65Q 4HIKA 4JYAQ 2QA4A 2UU9L 3UE1A 4LF5L 3UDXA 1PH6A 3A5UA 2E8GA 4POGA 1IBKL 1RL2A 1UE1A 1K73C 4PZ7A 1XNRQ 4IOAA 3CP0A 3J80i 3ZJYC 3CCVA 1JT8A 4BY1H 3GDEA 5GROA 2HHHL 4DV4L 3CPWA 2ZTCA 1PH7A 1PV4A 1E24A 2R6GA 4LFCQ 2E2IH 2UXCL 3HOZG 4DK3C 5C0XG 1UE5A 5FLMH 2F4VQ 1HNWQ 3CCRA 4LF6Q 1TWCH 3GTKH 4BY1G 1VQCA 3GD7A 4JBWA 1X54A 1G6PA 3PO2H 1IYJB 2R92H 3GO5A 1HNXQ 4X66L 1QVFA 4ALPA 2WAQG 4Y7NH 3I7FA 4P74A 4KLKA 1JE5A 2Y0SE 4R4CA 4R1JA 4DPGA 3PO2G 4GLAC 3HOXG 1HNZQ 4DV5L 1L2FA 1Q82C 1HR0W 4DR2Q 1QVCA 4JI5L 1PYSB 2E5LL 4LUOA 3ULJA 4NXMQ 1VQDA 4JBJA 4DR5L 1D8LA 4A3FH 1E7ZA 5AJ3Q 1XPRA 4JI6L 2VQEQ 1ASYA 3H3VH 5JJIA 4B3TQ 1YEZA 1NMFA 2E2JH 3I4NH 3RZOH 2JA6G 2JA8H 5LMNQ 5C3EH 2GN5A 5C4XH 3NENA 2RCNA 4AH6A 4X64Q 1VQ7A 2JA5G 4LF7Q 5M3MH 4LUVA 1EFWA 1UWVA 2EQSA 5M5YH 4DV3L 2JA5H 2OCEA 5IY0A 1WYDA 4LF7L 2BH2A 2IT1A 2PI2E 4L5TA 1GD7A 4IFDG 2PQAA 1XPOA 1Q1EA 3CCEA 3VDYA 2Z6KC 1NBWA 4DV5Q 4BY7G 4AQYL 5FJ8H 3LGJA 1E22A 3PO3G 4DR7L 4JI7L 1T9HA 2UUBL 4A76A 2B63G 3G71A 1KXLA 3CMAA 4IO9A 4JI3L 4JI8Q 2CFMA 1YJNA 1VQAA 1KC8C 5HGQA 1L1OB 1YITA 3S1MH 2A19A 2KCMA 3PGZA 4NB3A 4TVAB 3S24A 4XTCS 1X56A 3CCQA 4AQYQ 1QVGA 1P16A 4BY7H 4R4IA 5IYCG 4PMWA 3CCMA 3CW2C 1BVSA 1EYGA 3M4OH 1AE3A 4DNIA 5GADC 3T1HQ 1WOCA 1UE7A 1PYBA 1X6OA 4JV5Q 4A3CG 2R7ZH 2K5NA 1MKHA 2YYZA 4P71A 4DKAC 1VQ9A 2ES2A 2NVXH 4C2MH 1Y14B 3NEMA 4RMFA 5J3BA 1HR0L 1KRSA 4X64L 1PH4A 1M90C 3T1HL 3I4MG 4DR1Q 4C3HH 1Q7YC 1C9OA 4JI2L 3TS0A 4GNXB 4K0KL 4A3JG 3RLNA 1VQGA 2DUDA 1VQBA 2HT1A 5K36G 1X3EA 3AFPA 3CD6A 3FHWA 4GKKQ 2B29A 3KF8B 1CKNB 5IP7G 4JI4L 1MIUA 5LMUQ 4DV2L 1J6QA 3EBEA 4A93G 5M5XH 1I94Q 4JI0Q 1TXYA 2IX0A 3J81c 2ZM6Q 1K8GA 5IWAL 1PH2A 4A3DG 1VQEA 4J15A 3RLOA 2CKZB 4IPHA 4DV0Q 3W5OA 4GKKL 4LFBQ 3BZCA 3K80C 4R4TA 5ELOA 4HJ7A 1K3RA 3A5ZB 3HFZB 1L0WA 3U50C 2E2HH 2UUAL 3GTOH 4A3BG 1U0LA 4OXPA 3HKZE 4DR3Q 2NN6G 4A75A 1CSQA 1W3SA 1KQSA 4NXNQ 3I55A 1IBML 4GKJL 1JJCB 2BA0A 2D62A 3M4QA 4DV7Q 2RHQB 3OYYA 2NZHA 2JJQA 1K83H 1CSPA 2WFWA 4R4QA 3CCJA 1YJ9A 2ZJRA 3AQQA 1BKBA 4BXXG 4X62Q 2ZJPA 2I0QA 3PUXA 4NXNL 1Y1VG 4GLXA 4A3FG 1QUQA 2I5LX 1W2BA 1C0AA 2R7DA 4DUYL 4UP8A 1GO3E 2VQEL 4GOPA 1FJGL 4B3SQ 4A3KG 3UDIA 2ZJQA 1D7QA 4DUZQ 2LSSA 1VQJA 4C3IH 1XMQQ 1A63A 1H95A 3F8TA 4GLVB 4POFA 3NELA 1KRTA 2NN6I 1VQ8A 1NY4A 2I5HA 3GTQH 4LFAL 1S72A 2N3SA 3S1RH
chains in the Genus database with same CATH superfamily
5LMUL 3JAMc 4BXXH 3N43B 2W9BA 5CMDA 3ND9A 4ZCKA 4CKCA 5TSSA 4ZLTF 3GTLA 4B3SL 3QWNA 4QGUA 2AWNA 3EQLC 4A3JH 4TV9F 1L1OC 2MHVA 4K2LA 3KTMA 2ASJA 4IN3A 1ENAA 5ELFA 1HZBA 1K8AC 4C1NI 3H0GG 4C5BA 3T5KA 1O7IA 3KFUA 1YZ6A 4DK1A 2D0PA 3T1HH 2FHTA 2JK8A 1EIFA 1EY5A 5CBEE 3NTIA 4F4ZA 4F8MA 4HJ9A 1JICA 3H4DA 3OHBA 5JJLA 1B70B 3HKSA 4LMQD 1YHQA 1X9NA 2B63A 3FDTA 2V59A 2VY3A 1RIPA 3VYRA 3S16H 4P73A 4G7ZC 4PMBA 4C3HB 1JCKB 2UVWA 5L1LA 2C2RA 3VPCA 1FL0A 2EYJA 1A6XA 1B44D 4CDDC 2DPJA 1KL9A 3FMAA 1BBXC 2BR0A 2SDFA 3GTJA 4GN4B 3KLRA 3ULLA 4A3KB 2UXDQ 1QZHA 5KT6A 4FS2A 4LFAH 4X3KA 3V6KA 5EZYF 4JVZA 3DM3A 3WNZA 2F0GA 3KALA 3T1YQ 4IQZA 1DV1A 1SYEA 4RHRA 3RR5A 5GONF 2YRXA 4IUTA 1TWFA 1E4GT 1NR4A 3JRXA 2NVXA 2JSOA 4PNYA 2EE1A 1V1PB 3TP7A 4EYIB 4A3CH 2SOBA 3KLWA 1H9SA 2VUMG 4DL4A 1K83B 5KFOA 3EIVA 2B2YC 2L11A 1BCPC 2SCUB 4DV0L 3HOVH 1Z47A 3EN2A 1VS0A 4DL5A 2IP4A 1FGUA 2B2TA 4KY7A 5I2YA 3MXNB 1HNXL 2EY2A 1TU2B 4UCOA 3Q8SB 2R6FA 5C1OA 4NKLA 1N9WA 2K50A 1X3QA 4MV9A 4IOCA 3CC7A 4IPGA 4FF2A 4JUZA 5C44H 5FLXW 4WJ3M 2HVQA 1OO9B 5D3DA 2B2VC 2NYZD 3UE0A 5K36H 3Q8QB 1RCVD 2JA7A 5IYBG 2EXDA 5L37A 1EY9A 2C2DA 3R93A 2RQXA 1ZHQA 2N78A 1B3AA 1TWHA 3F2BA 1MJCA 3BDOA 3DWAA 3MZ5A 1S40A 3RGZA 1TS5A 1PH8A 1AUXA 1STAA 4YWMA 1SE8A 4YY3L 2JA8G 1UUPA 2VQDA 4TUYF 2Z4IA 4WJWA 5T1GA 2BQ3A 2F3IA 3S2HB 1M8AA 1ESFA 1WTQA 3PMFA 4QJFA 3I12A 3K5OA 1XDNA 4DXGA 2IX1A 1EQRA 2W8KA 4DV2Q 3EPGA 2GVBA 2Z6KA 3F2UA 3HOVG 1L0YB 2ZM6L 2RBMA 2HQLA 4IUNA 4FF1A 2JE6I 3A8KE 2JN4A 3D3RA 2X6LA 4I4TF 4JV2A 1Y1WH 2CW0C 3J80E 2CQYA 2LKVA 3DMUA 3R2TA 4QWEA 2KEDA 1W93A 4A3KH 5C3XA 1R4QB 4IFDJ 2EOTA 2NVQH 4IFDH 4QCLA 1CQJB 1PDQA 4CHTB 3KJOA 2KOLA 2RF4A 5FD5A 1SFOA 3NUCA 3RD4A 4MTNA 1XYIA 1C7YA 1Q90A 4BBRG 2JA7G 4DR3H 3MHBA 1CHPD 2EYMA 4S3SA 1NR2A 2J7ZA 2NVYH 4HCSA 5IGFA 3HOYG 5GAGC 1WCMH 3M4YA 1K3BC 4EEYA 2ASLA 1IXRA 3PIO3 5IYZF 3C1EA 5F2DA 4A3GG 4KHVA 4YCWA 4K0KQ 3HOVB 2UXBL 2F4VH 5NUCA 2AHOB 3W2DA 3VR5A 5J2UF 1JE4A 2F0SA 5KFZA 4LF5H 2FK3A 1PFSA 5ISRA 4ME6A 3M3YB 2UXCQ 4HJ5A 5DLGA 1SYCA 4KY5A 3N44B 3AEVA 4DR1L 2F0NA 4LF9Q 1XNRH 2ZXRA 4I65A 1JB7A 4CDFC 1PTOC 1HZ9A 2A69C 4DAVA 4DV1Q 4R8UA 4EG0A 4OWWB 3SEBA 2HCCA 1Y1VH 3KYHC 2Q2HA 4KJNA 2XCLA 5EDWA 1HXYD 3CCUA 1A62A 1KNAA 2KA7A 2Z0SA 4K8IA 4DNRB 5M3FB 2E2DC 1LLRD 2R93H 2W9BB 3CU7A 3UDGA 3MFIA 4FF3A 1YBYA 2F0MA 5BMVF 2L15A 2BE5D 2EXZA 4JI0L 4ZQIA 3FEWX 3S2HH 4LSAA 1VQ4A 5IOCA 1GSHA 4V190 2WKCA 3K5NA 4CJ2C 2R93G 2I5MX 2F0PA 2Q2IA 1HCZA 2NU7B 3OW2A 2QW7A 1JB3A 1TWGB 4XT1B 5M3MB 2W6MA 4ECUA 5FPRA 1EUCB 1I4PA 2L12A 1C4QA 5I2XA 3HOYB 3UDFA 4IR9A 1TWHH 5I9OA 2VUMB 1HH2P 1TS3A 3TP6A 3PUWA 4A3EH 1VCIA 3GTKB 1GUWA 2FB9A 4KV6A 1GYFA 3NBHB 4FU0A 4RB2C 2MO1A 2WAQE 1E2ZA 3CQZH 3PW7A 5G3LF 1H9JA 1PRTF 4K5XA 3FP9A 3M9MB 2UXBQ 2R3ZA 1VQMA 4GN3B 4DR5Q 3MEFA 1ZYRC 4TQRA 2R8JA 3NK9A 3G6VA 1HZCA 1S5CD 3V6JA 1E2WA 4A3FB 3P20A 1A0IA 1QOHA 1I94L 3OSNA 4ZHQF 1TA8A 3S17H 3JSLA 3TEHB 5C0XJ 2NVYB 1TY2A 2CVRA 2WP8J 2UVVA 1HHVA 3EA6A 2E5LH 3H15A 5M5WB 2PI2A 3PW5A 1BJTA 4YCVA 4JI2Q 5BPHA 3NGDA 4LFCL 1RJQA 3DUZA 4XQJA 1N56A 3GILA 1SMYD 2DIKA 1WTWA 5I4DA 1T3NA 3CMEA 2K5DA 2UUCL 2HIVA 2XGTA 2EDGA 2Q8TA 1N8RC 1XNRL 4DR1H 4DL3A 3K7AH 3RNUA 4ECQA 4DR6Q 1S0NA 4JCVE 1CQVA 3L2PA 3HRZC 4B3RQ 3GTPH 3A0JA 3E5SA 2RDFA 1N33H 4LF8L 4MV3A 1FVIA 1A9XA 1HZAA 3G48A 3N42B 4JV5H 1X55A 3M4PA 2MNAA 3K59A 3CRKC 4DR7H 1BXRA 1PA6A 4WJ4A 1EYDA 1N36Q 5C0XI 4QQBX 1UC8A 5CV8A 5IGDA 1CFMA 5M3FH 1CTMA 3AFQA 2JA6B 3HOWG 2AQ3B 3RBDA 3EYYA 1C8CA 3GTPA 2RGVA 1EZ1A 1G51A 2K03A 4FM9A 1B04A 4LF5L 5J2TF 1IBKL 1RL2A 5DQIA 1J9OA 3DWPA 1K73C 3UFXB 3H91A 5AFWA 2IL8A 2W6OA 5KX5F 1SNPA 2E2HA 3GDEA 2HHHL 3G8CA 2QDBA 3H20A 1PV4A 4A2BA 2CHBD 4LF6Q 1E2VA 4ZOLF 5JVH3 5HBRB 5IGCA 4BY1G 4FXDA 1PX2A 3CKIB 2R93A 1IW7C 4LF4H 3PO2H 3HOXB 5C3WA 3GO5A 2L1BA 2HGSA 1HNXQ 1LTSD 2R8KA 1QVFA 3PN1A 5CGKA 4Y8VB 5C8YF 1BCPF 4IRDA 2KCNA 1QJOA 2HVSA 3GTQA 4P74A 4KLKA 1ZQ7A 3BVZA 2NUAB 2B2UC 5EPKA 4DPGA 4MV1A 3HOXG 4Q44A 1ML0D 1QVCA 1PYSB 3MR3A 4ZYSA 4HNVA 1VQDA 5M9OA 3QG1A 4DR5L 1HNXH 1D8LA 4A3FH 3LWEA 1B53A 1EUDB 2OF1A 3MWYW 2E2JH 1M7JA 1CHQD 3QB3A 2I80A 1EYAA 2EYFA 1VQ7A 5A35A 4KKSA 4LUVA 2ZXPA 1EFWA 5M5YH 3N6XA 3S16B 2OCEA 4U68A 2X6GA 4ED2A 1DV2A 1HTPA 4RZRA 3ITPA 4BWSC 1B50A 2W6PA 2F3VA 5LA6F 3MXPA 3S1QB 3Q8PB 2EY6A 3VDYA 1A3UA 1GHJA 2W7PA 1RYSA 3GTPB 4RNOA 1NBWA 1SFOB 3LWBA 3D6CA 5JQWA 3OMGA 4JI3L 3HOZB 2F0DA 1YJNA 1G2SA 5HGQA 1YITA 3S1MH 5CBAE 4UHVA 2DY7A 1H9RA 3S15B 5JOBA 2YS6A 1N36H 5IYCG 4PMWA 4FVMA 1SNQA 2IW3A 3TP5A 3M4OH 3QOLA 1HPCA 4EBEA 5C0XH 1PYBA 4JV5Q 1EIHA 5EBCA 5ELBA 1MZBA 2LFNA 4DXFA 4XYQA 4MA5A 4DKAC 3MFHA 4RWSC 2ES2A 2NVXH 4C2MH 4RMFA 1T94A 4IZOA 5J3BA 4B3RH 1KRSA 1M90C 1LT5D 4ECRA 1S5DD 1EWCA 4DR1Q 3NXWA 1C9OA 2K01A 4BY1B 1I7NA 1S0OA 4A3JG 3RLNA 1LT4D 4C3JG 2HT1A 3UQ8A 4A3GB 3FHWA 2B29A 1LTTD 1CKNB 4IUQA 4JI4L 2Y0SA 3EFXD 2VQFH 1TR5A 5LMUQ 3EBEA 4QWBA 3BAAA 1NUCA 5IT9E 1QCBD 3GIJA 4EQOA 2H4OA 2CKZB 4DV0Q 4GKKL 3IG0A 3BZCA 4R4TA 5ELOA 5KNBA 1K3RA 3HFZB 3U50C 2K5WA 3ORQA 2WB1B 2R7LA 4ETSA 4DR5H 1RYRA 3W3AA 4OIKA 3K5LA 5L1KA 2YL2A 1IBML 1JJCB 2BA0A 3M4QA 3GTGA 2RHQB 4L8JA 4DNTB 4J9SA 2XCAA 2PW7A 3HG9A 2WFWA 1EHIA 1E0BA 2ZJRA 3Q23A 1BKBA 2E2JB 5LL6S 3G6JB 3OHXC 4GLXA 3E5NA 3VPBA 3L4KA 3RIZA 3P75A 1QUQA 4YIJA 1R9TA 2HD3A 4LFBH 3WO0A 2VQEL 1EEID 1RTNA 3R8BA 4RCNA 4DUZQ 2CZGA 2LSSA 5JUMA 4C3IH 4X66H 4ZRZA 1S5BD 3BDLA 2XNAC 4POFA 4TRDA 3T5LA 1VQ8A 4ZKBB 5KFVA 1MSHA 1S72A 2Q8RE 4CJ1B 1JORA 3LX0A 5ELDA 2X0SA 5FKAC 1B8AA 4KK7A 1CKNA 5IYDG 1W6KA 2MJ8A 3MA2B 1PH1A 4HEDA 4GNXA 4R8IA 2WIIB 2PNRC 4H02A 1KD1C 3FVQA 1TWAB 1H9MA 1U9RA 3S15H 1C30A 2GLTA 3I90A 3D8GA 5CA1F 2FK1A 2K14A 2KHSA 4PQXA 2PQAB 2F0WA 4JW0A 1E1TA 2R7ZG 1WSCA 5DG9A 3TZUA 2K5VA 1EIGA 2AQ2B 3J80c 3K0XA 1SEBD 2KEEA 2JQOA 4LF5Q 4A3MH 2QK4A 4JOIC 1PTOF 3U58A 4WBNF 5DG7A 3A54A 2IHEA 5KFTA 1Y8PB 2W71A 2A8VA 4JI7H 4X66Q 3LMLA 1M0WA 5FK9C 3PW0A 2ZTEA 4NDXA 2IHFA 1JWSD 4OHJA 2HDMA 4ECYA 5IWAH 1LM0A 1ILPA 3U4ZA 3DXJC 1SN8A 3HKZB 3BA8A 2VUGA 2VA3A 4LF7H 2K1BA 3TQYA 3I4MH 2MPMA 3MVVA 4F88A 1U5KA 4RFBA 1XTDA 4IFDI 4KHPH 1I6UA 4DFAA 4ILWA 2AMCB 1KJIA 2RCFA 4NXMH 4M7EA 5KFJA 1XX8A 1AUVA 5JPNC 3K8AA 4LAAA 3NQTA 2ZDGA 1S3OA 2MUYA 4HJAA 4CC5A 4DV6L 4APMA 3Q2OA 2R87A 4EX5A 3TP8A 5KG3A 3KXYT 2Z8LA 4DAPA 3LP8A 5LMUH 2FXQA 1QNKA 1SDFA 2M9VA 5HV6A 1F2ZA 5KYIA 4DUYQ 4HYKA 3PQIA 4HSPA 4O2DA 3JAML 2VUMH 3KK7A 4JV1A 4G4KA 1LTID 2RSOA 4CKBA 2C9OA 1G2TA 3JRWA 3IN5A 1Q46A 1LT3D 1S68A 4QMGA 4FDBA 4DR4Q 3I91A 4GOPC 5KRUA 2PYKA 2CWPA 4DAMA 2F0FA 3MXUA 4X65H 2QGQA 3CF5A 5IT9W 1ZHSA 4KN7C 2FLPA 1GUOA 1EWHA 4YWLA 3SI8A 1IBLH 4O3NA 1JMCA 2UXDL 4EQ5A 4NXML 2XN9C 3FMCA 2AQ4A 4XX0B 2J6TA 5M5WH 2L0CA 4U6PA 4ZI7F 4FP5D 3GTGB 4LNQA 3A55A 4XDXA 4YR0A 1AH9A 4RGMA 2OEOA 1F9PA 1UE6A 2GVAA 1O7ZA 2N8NA 1I3QB 3OPOA 4OO1G 4LH7A 4JK1C 4O3QA 1DCZA 5ELEA 1X3FA 5M3MG 4JI1L 2ATWA 4RCOA 3QIAA 4IUPA 2JXMB 4QY7A 4DV3Q 4F50A 1ULZA 1JIHA 1UNNC 1VQFA 1HJPA 5KFEA 3AB9A 1PMRA 1STGA 1X65A 2XIGA 2B2WA 4X62H 3RLFA 3A8IE 3KF8A 2C35B 3PW2A 2V9WA 4EQPA 1RHPA 5LHY1 4BA2I 3M9BA 4ED1A 1A3TA 3C1FA 4R7RA 1SYDA 4A2AA 3M9OB 1PFNA 1NMGA 4L63B 3T1YH 1VQ5A 1CS0A 2PCFB 1PFMA 2D9UA 2KJXA 3RV3A 2DPIA 3P7JA 4JBKA 4LFAQ 2V58A 1OXXK 3PZPA 2UXDH 1R4PB 2XVSA 2BA1A 5CORA 1IYUA 3BZDB 3TBIB 4PZ8A 2VOBA 4YHHL 3K7UC 1NTGA 2PZTA 1I94H 1K0RA 4LF6H 3RBEA 4YY3Q 5JVDF 5BR8H 1FD7D 1IL2A 1RJRA 1DXMA 4KN4C 3KF6B 4OEMB 1PHJA 4XXEA 4DK6C 4DL2A 4JOIA 2TMPA 5KFBA 3OWFA 3TREA 1TS4A 3GTKA 2V1CC 5KFLA 5J22A 3T4AC 2DGYA 4DR6L 4MIUA 5CC4A 4DV7L 2B2UA 2DY8A 3J7ZC 3R5FA 2ENBA 3MEHA 2G9HD 5DGBA 1WH2A 5LMNL 1ET9A 3CQZA 3J7AV 4XQNA 3W1GA 2AGPA 5IP9G 3R3OA 1TY0A 1KLGD 3GTLB 4H44C 4IR1A 2XRQD 3KLSX 1BCPD 1SYFA 3NTKA 4XYLB 3SGIA 5C4ZA 3V4SA 2IPKD 4BA1I 1VQPA 4DR7Q 2DNCA 1XNQQ 3PO3B 1EY7A 5DLQE 3HGBA 1XPUA 3KOJA 2W9CB 5M3FG 4UCTA 2FLLA 2OQ0A 5C4XB 2N88A 3GTGH 2W7OA 3RZDH 3R5XA 1WFQA 4IRCA 2CW8A 2VW9A 2L5TA 1UC9A 3CC2A 3J81E 1BQQT 3GV3A 3E0EA 2N49A 2NVTH 4F4XA 4MV6A 3CC4A 4WORA 4DR4L 3IL8A 4A3IH 4DV6H 3KF6A 4O1NA 1I4GA 1VQHA 1WTRA 4JYAL 2XCPA 1ZYRD 1CI3M 5EKLA 1EUJA 4EGJA 4PZ6A 3PUZA 4DR3L 1SSOA 2E5LQ 4X6AH 5DLFA 3BG3A 1PH5A 1EFID 4C5AA 1HTLD 4I7HA 3GIKA 3T5JA 2E75C 4QWDA 2WDTA 2JEAI 3ORRA 2NB0A 3MFYA 5LYJF 3M4OB 1Q3LA 3S2DH 5DGAA 1VQNA 2V4RA 2UXBH 3N6RA 3I4NB 1AE2A 5D1OB 5KFPA 3BJYA 3KLSA 4HIOA 2F0VA 4CC6A 3A7AB 1ZETA 2CQOA 1NAPA 3CAMA 4H7BA 2GA4B 1YHBA 2JYOA 4GS3A 4J0MA 3BQ0A 1CQIB 1N34L 4IRKA 3KHRA 2WB1G 4RG1A 1D6EC 1FGBD 4P72A 3SR1A 4A4IA 4A3GH 3PIPA 1WTPA 1V1QA 1GSAA 1P8LA 2PMZA 5EPJA 1KDAA 5C44G 1TWFH 2UUBH 3LNNA 3T1YL 2NVQB 1V51A 1GM5A 2ZTDA 4K5VA 5K5PA 2EIFA 2B8GA 2HIXA 4ME5A 1CUKA 2VQFL 1HNZL 2ALYB 2NU8B 3PW4A 5IIFA 1L1OA 2R8HA 2W70A 2OWOA 4A3DH 4JI3Q 2KHJA 2B63H 2K5HA 3C0FB 2EYHA 4RU9A 3HS0C 1XMOL 3OIQA 3W1BA 1V9PA 3RN2A 4WRDA 4KI0A 5IGBA 3BABA 4JYAQ 4EQNA 2ZT9C 2QA4A 4EBDA 3UDXA 1PH6A 4POGA 1DM0B 5I6WA 1MBYA 3R5HA 4PZ7A 1XNRQ 2FINB 4TSSA 1D1IA 3CP0A 3ZJYC 3CCVA 1JT8A 1QG7A 1O75A 5KG4A 5C6AA 2ZTCA 2R6GA 1IW7D 1Z2NX 2F3WA 1SE4A 2F4VQ 3JSNA 5CV5A 4K0KH 2K33A 1B1ZA 1VQCA 3S1RB 3GD7A 4ED7A 1X54A 1IYJB 1SBBB 3EPIA 4MN3A 4J6HA 1PYWD 1U4LA 4QIWA 2OH2A 4Y7NH 4UDUC 2IMWP 4OGQC 4DAYA 1HR0W 4DV5L 1L2FA 2R93B 1TWGA 2R61A 4DR2Q 4BBSB 2TSSA 3RMHA 2C2EA 2AU0A 1E7ZA 5IGEA 1XPRA 4J9KA 3H3VH 5JJIA 3RZOH 4E4TA 2FMMA 4C3JB 4ECXA 3WOFA 2EYPA 3MR2A 1AZPA 3ONAB 1RD9D 2PI2E 1GD7A 4IFDG 4ED6A 4DGZA 5I9PA 3MR6A 4MTDA 4DV5Q 4LSXA 3SVMA 2WKDA 2NWGA 3J7AF 2GPSA 1VQAA 1KC8C 3TQTA 1L1OB 2R7KA 1EEFD 2KCMA 4NB3A 3I4MB 3S24A 1BOSA 4J1MA 2JP1A 2B63B 1Y1WA 3J80L 3I4LA 1AE3A 5GADC 1WOCA 1CA5A 3K6OA 2ICIA 1WTHA 4P71A 4TQSA 1FR3A 1PTOB 1FKAH 1BCPB 1JXLA 5FO8B 2PZUA 3VYTA 4X64L 4FF4A 2IBKA 3OIPA 1A15A 5KEEA 4RAUC 4GNXB 3J81W 5JPMC 3E0JA 4K0KL 1J5EH 2DUDA 1VQBA 5K36G 2F0UA 3AFPA 3CD6A 5EQ0A 3K58A 4X3SA 1S10A 1HFNA 2R84A 5LOVF 4A93G 2DN8A 1MI2A 4ECSA 1I94Q 5KG6A 5CV7A 4DL7A 2ZM6Q 1K8GA 4B3SH 4N9PA 5IWAL 2BQRA 4A3DG 2YYAA 5T14A 2XC9A 3RLOA 1JX4A 3H0GB 3W5OA 4RNNA 3K80C 2YRWA 1PRTB 3IFTA 4A3BG 3A5ZB 2UUAL 2ASDA 2C22A 1S97A 3GTOH 4EFBA 4ZUIA 4OXPA 3HKZE 4YHHH 2DNEA 4Y7NB 4KD3A 1F9RA 4A75A 1W3SA 4YAKB 4ED8A 3K3VA 3I55A 4DV7Q 4HNUA 3OYYA 2NZHA 5C4JB 3MAQA 2JJQA 1K83H 1CSPA 4JI6H 4R4QA 3NE5B 1PTOD 4DF7A 3CCJA 1YJ9A 1B33N 2IA6A 4BXXG 4X62Q 2I0QA 2FMCA 2JA8B 5EPLA 1SYBA 2Z4HA 1KAAA 5C3EB 4A3FG 1PK8A 5KFHA 1RKNA 2I5LX 1T5XD 2R7DA 4RA8A 4G7HC 1BDOA 1NCVA 1SNDA 1BF4A 1I6VC 3BDCA 2A68D 1BUVT 2ZJQA 4B3SQ 3BYYB 1A63A 2EY5A 2Z9HA 4GLVB 3NELA 1CK1A 5KT5A 4RNMA 1ICFB 3MC0B 1C48A 3TINA 1KJ9A 3V4ZA 1J5EQ 2KCCA 1N36L 2DJFC 4K14A 1SJHD 3D0FA 3I2ZA 3Q8DA 1YI2A 1VQ6A 3CCSA 3V05A 3PF4A 1XMQL 3NBIA 1Z2PX 1JDBB 4O4IF 4R4OA 3I70A 1LABA 4OONA 2PN1A 1PRTD 4XIGS 1QNUA 4UFZA 1E1OA 1EQVA 1IBLQ 3K0YA 4GC6A 2K75A 4ULLA 2AWOA 3D4RA 4RB0A 4KHZA 2WINB 5EGTA 2BH8A 1BBWA 3G7LA 5KFFA 2KECA 1LUZA 1JOKA 1RJPA 2V5AA 4WD3A 4UPAA 5LXTF 2LXKA 5KFXA 4ZAIA 1VDZA 3D4DA 4OWTB 1Q86C 2W9CA 4EYHB 2PNHA 4JG2A 2FPPB 2J9GA 3NTHA 2F0LA 3TRZA 3U4VA 2W9AA 2D2CC 4HNTA 2VB2X 4ZQ3A 3QZ7A 4DV5H 3OHAA 3BYTB 5FO9B 1GUGA 1EIYB 1IHZA 3F2CA 1XJVA 2QYZA 3VR4A 3X3NA 3SHLA 4K8JA 1C3OA 3GTMH 4OO1H 2A6EC 2QCPX 3A74A 3RAQA 5FO7B 3T51B 5IP9H 3J81j 3E6ZX 2C5CA 5K2MA 1GXDC 4QW8A 1E4FT 3F2DA 5GAEC 1DIKA 3KDFB 2A6ED 2EYOA 2FK2A 3GTOB 1STEA 4B3ML 4A3EG 2WE6A 2CQAA 4KHPQ 3I3CA 3G4SA 4IAJA 3MXGA 4NP5A 1I50H 3GTLH 1V43A 3HKZG 4Q45A 4DR2H 4N9TA 1JKJB 2UU9Q 4LF4L 4RB1A 3M9NB 1WCMB 3QJYA 3OTOQ 2I07B 2YU9B 5FJ8G 3PO3H 1SE3A 1QZGA 1TIID 3X3MA 2J6SA 5IWAQ 5HURA 4GN5A 5DM63 3BU2A 5KFIA 3SK4A 5BPFA 4YBZB 4LFBL 3RZDB 2OLSA 1Q8KA 4C56C 5KFRA 3L9AX 2A5HA 4APVA 2RDHA 4JI7Q 4Q0YA 4IPCA 2JA6A 1EY0A 3T5HA 2NVTB 4ECWA 3GQBA 5JEAJ 5JEAG 2Z6BA 5FLMG 4A3IB 1IYVA 2G5DA 4IJLA 5EAYA 4ECTA 3I4NG 3DEPA 2FE3A 3QFFA 4ED0A 2E2HB 5IE8A 1GLVA 4Z9CB 2QEJC 5T1IA 2FLNA 1SMXA 2KQ3A 3QR8A 3QO2A 4JYAH 5HY6A 4IWXA 3K5MA 1I3QA 5KT7A 3T16A 3GIPA 4AQYH 3PF5A 1R9TH 1LYLA 2R7NA 4A93H 1DD2A 4OX9Q 4JBMA 4J9LA 1ZKOA 4JI3H 1N33L 4AIMA 2B8FA 1HRJA 4YR3A 4CDCC 3TSSA 5EKIA 1TWGH 2FJZA 5E4WC 1SROA 4HSVA 1W96A 2VL6A 1IKMA 4IURA 2UUBQ 4RAYA 1VQKA 2DLNA 1N32Q 4OIJA 2WAQB 1F2LA 5IGGA 2D0OA 1TWHB 1GJXA 3PR4A 3DEOA 1K83A 1F77A 4ZK9B 4A3LG 4HR7B 2XTIA 4AYBB 4DV1L 1S5ED 3CCLA 2PBZA 1BGWA 1TWFB 4IALA 4GZYC 2OTJA 4LF9L 3KBXA 5KT3A 3U9TA 4IUVA 2H5XA 4B3TL 2QKIC 2MO0A 1TWAH 3GV5B 2I87A 1B6SA 3JAMW 4U7CA 3NBHA 1RJTA 4YCUA 4YAJB 3JZIA 4C2MA 2UUAQ 1W6JA 1HNZH 1Y1WG 2PVPA 2F4IA 1WTOA 1I50B 2R92G 1G91A 1SRUA 3GP7A 4YWKA 3S17B 3TDQA 3M7NA 5KFSA 2XGQA 2OXPA 3K5IA 1X3GA 3BVMA 5F9LA 1BNCA 1I4HA 4KY6A 2K04A 4B9WA 4A3MB 4NLGA 3KBGA 1NNXA 2VQFQ 1O7YA 2F0JA 4DV6Q 1A2UA 1WTXA 1UNSA 1K1SA 3ICEA 4EEQA 4LFCH 1EWIA 1HR0Q 3VYSA 1KDBA 3J7YW 2E2IB 2RKSA 2VXWA 3HEJA 4U673 4EBCA 3KDFA 2M00A 3OMCA 3C3LA 2VUMA 1N34H 1UEAB 5C44B 1YJWA 3FDSA 5FD6A 1F2YA 1IBMQ 2MP1A 1X32A 1ET6A 1O7LA 1OXTA 2K28A 3NWTA 5I6YA 1ENCA 4ID6A 3JAME 5KFAA 4LWCA 3DM1A 3TMEA 5L1JA 1XNQH 5GAHC 2L9HA 4X65L 3WWVA 1VKZA 4JI1Q 2JA6H 3EROA 3GV6A 1MJEA 1K1QA 1LTLA 1GVPA 2RSNA 3GV8B 1D5ZC 4JI4Q 1OXSC 2EZVA 4LJZC 1EY8A 2F03A 2YZNA 5E3FA 1JR0D 1K8MA 3DLLA 3RF2A 2NZOA 3KAKA 1TQOA 4HIDA 1JJ2A 1KC7A 4F4YA 4YR2A 3GQCA 3K81C 2BE5C 3FPPA 1SLJA 4FXGC 4KD4A 5IYBH 4N8FA 4HIMA 2O5IC 2IY5B 5KFYA 5BR8Q 4O42A 4YY3H 2JEBI 1YNJC 2R8GA 3RB6A 3PUVA 1YVCA 3VA5A 2NU6B 3RV4A 2CWAA 4J9QA 1MGSA 4HMJA 1B7YB 5DAUA 4Q5VA 4A3BH 4NXNH 2MQHA 3VR2A 1IOWA 2HQEA 3SE0A 3H3VC 4FS1A 5ELNA 5IYDH 2EYLA 3PUYA 1CKOA 4BY7B 3N8DA 2WV6D 2WAQA 1XMOQ 4HTHA 2FPIB 1KHIA 4LW1A 4GOPB 1MHWC 4ME3A 3I73A 1PH3A 1WTVA 1VQIA 1Q12A 4L6TB 1AW7A 1KBLA 4IUUA 1F2MA 5KNCA 4JI0H 4LF4Q 2W57A 1KIXA 3FKIA 3MWDA 5CV9A 4GKKH 4N8X1 5JVLA 4JPBW 5KNDA 3E9HA 4DV4H 1I3QH 2B2TC 1D5MC 2O4XA 1VQOA 2MCTA 3S1QH 2A6HC 2KCTA 4DV3H 2E74C 2HHHQ 1LV9A 4HJ8A 1EY4A 3M3YH 2CH4W 2KHIA 3PCOB 1SFOH 2HUGA 4OWXB 4I7AA 4JI5Q 3NWSA 1XNQL 1Y1VB 3H3VI 1E4EB 3JAMi 2ZJTA 4M1UB 1I4XA 1B4OA 3GTMA 1SNMA 1QWYA 3VYUA 5JAVA 2Q8IB 2KUMA 1CKMA 5E4XA 1WJJA 2MFIA 1U4PA 1XXGA 3U9OA 5KFDA 2RHSB 4JI8H 4O0AA 5D65A 4X65Q 2PQEA 1EYZA 4HIKA 1FNUA 1DZ1A 4QUCA 4KKUA 3A5UA 2E8GA 4DK0A 1UE1A 3NPPA 4DR4H 4IOAA 2WTFA 3J80i 1VAJA 4H13C 2HJWA 3HOUB 4BY1H 4ODGA 3DHQA 5GROA 4DV4L 1RDPD 4DR6H 4WFN3 3CPWA 2KSWA 1E24A 3T13A 2UXCL 4DUYH 3KUPA 5C0XG 5FLMH 1FJGH 2K32A 2CW7A 3KHHA 4CJ0B 1TWCH 4A3EB 3GTKH 5EBDA 3HKZA 1S0MA 1KLUD 4JBWA 4JI2H 2F0HA 1G6PA 1K0SA 2R92H 5CAEB 3CQZB 4X66L 4O4LF 1GOZA 2XSCA 4ALPA 4DU9A 4A3BB 3SK5A 4RAZA 1RODA 2EJGC 3ZYYX 1BNZA 3I7FA 2Y0SE 1EZ6A 3IKJA 4GLAC 3TQ1A 1JDEA 5J39A 4JI5L 4MTKA 3A56A 2E5LL 4NXMQ 4LUOA 3ULJA 1M0TA 4UCUA 3RAXA 1RK6A 1DONA 4JI6L 2VQEQ 1ASYA 2EJMA 5KT2A 5EJWA 1NMFA 5L1IA 2ZXOA 2JA6G 5KFNA 4FYDA 5LMNQ 4RUAA 2O2LD 2GN5A 2IWHA 5C4XH 2RCNA 4AH6A 4C1NK 5BN5A 1ICWA 2X69A 4X64Q 4LF7Q 1GHKA 2I8CA 4UCSA 3RB0A 4FBTA 1UWVA 2EQSA 1JC7A 4DV3L 4LF7L 4K2KA 1WYDA 5IY0A 5A2QL 3N41B 4MTEA 1Y8OB 1F9QA 1ZEQX 2NN6H 5JVG3 2PQAA 5LL6b 3K7AB 3F8NA 1HA6A 2Z6KC 3GTQB 4R8UB 3D6WA 4BY7G 5KG7A 4K6DA 4AQYL 3LGJA 4CKEA 2DZDA 4DR7L 4PDBA 5BN4A 3Q24A 2UUBL 2B63G 1KXLA 4IO9A 1S5FD 3PVXA 4JI8Q 2CFMA 3PGZA 5KFCA 2XGPA 1S9FA 4J9MA 4XTCS 1X56A 3CCQA 3S14B 3RB4A 1P16A 3V6HA 1SNCA 2I46A 1TAEA 2K7VA 3CCMA 3CW2C 1BVSA 1EYGA 2IJ0A 3NHHA 4CGYB 4QUFA 4JV0A 4DNIA 5FLXE 2F0IA 2VPQA 3RJ0A 2RDGA 2EVBA 1KABA 2W6QA 2P5ZX 2YYZA 2V4DA 3ERQA 3K57A 1VQ9A 2F0KA 1I50A 3BQ2A 1Y14B 3NEMA 4DV1H 2JEGA 2HHHH 2A6HD 4MA0A 4QW9A 3T1HL 3VPDA 3I4MG 2PO4A 1DJRD 1FYCA 3N40P 4RGTA 1ZXTA 2UXCH 4QB4A 2WYOA 2H1EA 3FKIB 4NMZA 3TS0A 4ECZA 4K5WA 4H0LC 1X3EA 2EY1A 4GKKQ 1E4EA 3DWQA 3NP8A 4DV2L 1J6QA 3D4WA 5M5XH 4UAIA 1QB5D 5D3IB 1TXYA 1PZKD 2IX0A 4JI0Q 4DUZH 1PH2A 1VQEA 2RDJA 4IPHA 4LFBQ 3PO2B 2R92B 4O2BF 4LMYA 1AN8A 2ALZA 1Q8IA 2E2HH 4F7XA 2UUCH 2ICEC 4DR3Q 2A73B 5CR3A 1CSQA 1KQSA 5EWGA 3S1NB 4NXNQ 2D62A 1BXTA 4KTAA 2ATLA 5KYLA 4HN7A 2HDLA 3GV7B 3TN2A 3Q0AA 4DN4M 3AQQA 4F87A 1PLFA 4XZ3B 1XWEA 1Y1VG 2AGQA 3RUZA 3ETHA 4DV0H 5KGUA 5EKKA 1C0AA 4DA2A 4HQ6A 5IT9L 4YQWA 3UDIA 1GUSA 2AQ1B 3AU7A 1VQJA 4HCEA 3F8TA 5DM73 4OELB 4BBRB 2JA7B 2NN6I 1Y1WB 2F0OA 3CCRA 3GTQH 2L55A 1STBA 2N3SA 3ND8A 3S1RH 2XWBB 2E76C 3I56A 1STHA 4K6LA 4HAEA 1FNVA 2CW0D 5G3LD 2IX3A 1HNWL 4KJOA 3HOZH 4MAMA 3QOJA 3HZXA 4LK1C 1LTAD 2YTVA 3T56B 2MGSA 4KHPL 3S14H 4AYBG 3PV0A 2G9DA 5BR8L 1Q1BA 4F4WA 1D5XC 1YIJA 4OO1I 5C4XG 1IBMH 2OTLA 3F1ZA 1DOLA 2QILA 3URYA 4A3LH 1CQFA 1X3PA 2AUKA 1M1KC 3R2IA 1N34Q 1WCMA 1IBLL 2NUCA 1ENFA 1O80A 5E7NA 4CDEC 4YJ3F 3I4OA 2NVXB 1S03G 1PFBA 3BQ1A 1WR2A 5KFQA 3DF7A 4A3MG 1II3A 1DOKA 1KEEA 1E3PA 4V0BA 4DAYB 4O2AF 4DUZL 1SNOA 3A7LA 4BBSG 4ED3A 2VA2A 1AEXA 1LO5D 5M5XB 4EGQA 3P1HA 3M85A 2VZAA 1JLLB 1SCUB 4PG3A 4UY8C 2R7FA 2O03A 2OT2A 3ER0A 5DQHA 3OTOL 2UUAH 3J7AK 3FKIG 1UEBA 4IHJF 1YHAA 4RKBA 2QEXA 3S1NH 4IJHA 2F0TA 1RF2D 2UUCQ 3ULPA 2FKLA 5JEAH 1B9NA 1Z2OX 2FPGB 2Q2TA 1O78A 1Z6HA 3CRLC 3J81L 3GIQA 1G291 1J5EL 1IOVA 1J8IA 2NU9B 3AYHB 3CXCA 1PZJD 3R23A 4LUZA 2R86A 4NW2A 5F9NA 1I5FA 3H6MA 1WCMG 3HOYH 5L9XA 1D1KA 4O3RA 4FNFA 4C3IB 1WD1A 1CA6A 4IWYA 2BQUA 2NZ1D 2K05A 3IFDA 2DWCA 2VPSA 4BBRH 2JA7H 3RUPA 2C28A 4Q0FA 3G6EA 2RVLA 3TZDA 2F4VL 3O13A 4OX9H 3FPUB 4DLKA 4UP7A 1TWCA 3GIMA 2Y0SG 4EFEA 1Y1VA 1SXTA 3H0GH 3GTJH 4HR7A 5DQGA 2L4NA 3OSPA 2KENA 3IRBA 4Q8FA 1B3QA 4O3SA 1U4MA 3ERSX 1PXUA 1PZID 3MTSA 3WO1A 1DGSA 1HQMC 1NE3A 3NQIA 5I47A 2JA9A 3HXLA 3K3PA 4KKTA 5C4JH 2YTXA 1M4VA 4YJ2F 1LACA 1QE6A 1SR3A 4L5SA 3KHLA 4E6IA 1DOMA 5LMNW 3JC66 3B6YA 1Q81C 1VMPA 4UP9A 3T53B 4TQUS 1B6RA 4Q8EA 4FXKC 3Q6SA 4PV1C 1EQTA 3VR3A 5KG2A 1BBUA 2YS7A 1PH9A 1N33Q 1IKLA 2F1MA 3C2PA 1XMQH 1I6HH 1JQYD 1NSNS 2AKWB 4O4HF 1EZ8A 3G6YA 5CV6A 2LXJA 1LTRD 3OUZA 1VMCA 3Q1KA 5GQOA 1FNWA 5J1ZA 1JOOA 1H9KA 3TS2A 4Y52H 4XT3B 1V4YA 1K28A 3G6XA 3OTOH 4R9WA 3D31A 3HOWB 4X64H 4PWQA 3TIIA 1OWTA 2R85A 5KG1A 4A3JB 3BZKA 4M9UA 5LMNH 3N52A 2BDOA 2VQEH 5IT9c 3IAYA 1IBKQ 3L0OA 1F9SA 5KIXA 3E3XA 3LWUA 3HOUG 4MNOA 4JV5L 1KJQA 1EOTA 1OXVA 3S2DB 5EWEA 2RGRA 2B3GA 5FLXc 1UAPA 5LL6X 1U4RA 4FO2A 1VF5C 4JI8L 5C1PA 1GUNA 2PZWA 1K8OA 4C3HG 4XYOA 2R7MA 3SK8A 4DL6A 4UCVA 1FJGQ 1IL8A 2EJFC 4MV4A 5C5JA 3I72A 2CCZA 3HOUH 4EVOA 1GUTA 1Y69U 1VBGA 1TVXA 4LF8Q 1HQRD 1WD0A 2BDNA 2F52A 4B08A 1QILA 3GTOA 5H80A 3C46A 1OXUA 4G7OC 1PVOA 2J0TD 2W6ZA 1STNA 3BS1A 3Q22A 4IZ8A 1GKHA 3SK6A 3OOCA 3HBLA 1OTCA 3BJUA 4KMUC 3HOXH 3GTJB 2K52A 5A2QW 2ZDHA 4Q43A 2E2IA 4DR2L 4A3DB 1YNNC 2YTYA 4J8QA 1A3VA 3FRPB 1AP0A 4GNXC 4B9XA 5JJKA 5KFKA 4MZ9A 3STBC 2W6NA 1I4RA 4ZUJA 2F0EA 2ID0A 2B2WC 1N32L 2EPBA 5JH7F 1A8VA 3PIOA 4P75A 2YU9H 3H09A 1AFPA 4C3IG 3BVGA 4JI5H 2VB3X 1CT1D 3HP3A 3GLKA 1JWMD 4ECVA 1SYGA 3J7A5 4UCRA 1IZ6A 3KJPA 1BO0A 1JWUD 4L5QA 5M5YB 1JJGA 1L2ZA 1SMYC 2RA4A 4LF6L 5C3EG 1VF7A 4LF9H 2N55A 1ASZA 4B3MQ 4QIWB 5H1SE 2LY7A 4LH6A 1I6HB 2FJ2A 2YZGA 2R82A 3MWMA 4RKLA 3K5HA 4DV4Q 4P2CB 2YZMA 2J6UA 3J80W 3EJIA 4GC7A 1N48A 4JI6Q 5DEHA 3VMMA 3HOWH 4OL7A 1I7LA 2W8LA 1GSOA 4DV7H 4B3TH 3J81i 3V96A 3E9IA 1WVLA 3S1MB 2A74C 2BCOA 2PW5A 3H0GA 4YHHQ 1KAWA 4L1KA 1BR9A 1GGOA 3L7ZC 4IPDA 1XMOH 5C5LA 2J4XA 4BBSH 5FLXL 4X3TA 1RK5A 2KBNA 1K9MC 1QUQB 3STBD 1R9TB 1L0XB 4A93B 4O3OA 1EOVA 1Z9FA 4OX9L 3RZOB 5FPOA 4YP3A 2FMAA 2ZM6H 4QIWE 4A3IG 4J9RA 1TKWB 3CPFA 4C3JH 2WB1E 3GIIA 2B39A 1CZGA 1VQLA 4C2MB 5ELCA 4PMCA 2JEIA 1SE2A 2JA5B 4NPSA 2ZDQA 1YNJD 1A2TA 2PMZE 1YNXA 1HNWH 2K5QA 1MSGA 3PSIA 4X62L 1WI5A 3FKIH 4HMIA 4B3RL 2WB1A 1KJJA 1NJIC 2OQKA 1LTGD 4RGOS 2VS1A 1EQQA 4AYBA 2R92A 4GKJQ 2BOSA 3RN5A 5AJ3L 1HFGA 4EGVA 4XYMB 4L5RC 5KG0A 2JEJA 2F0QA 5IYCH 2VNUD 5EOYA 3M4IA 4JI4H 2A1AA 2JEFA 4DV2H 4AYBE 2K6AA 2ASBA 4JC0A 1CE8A 2QF7A 4RH6A 5CYUA 4I55F 5E1FA 3V2TA 4JI1H 2JA5A 3MXNA 4QL5A 2SEBD 2YV5A 2Q2UA 1EY6A 1KDCA 5IP7H 3KHGA 2K4KA 2R7ZB 3KAJA 1PTOH 2NVYA 4XQQA 3MR5A 2UU9L 1Y8NB 3UE1A 1SEIA 4BS9A 4RZQA 5CB4F 5KFGA 4RUCA 4GKJH 1V1PA 2KVMA 1G8ZD 2AUJD 3OWEB 1KJ8A 4QWAA 1H9SB 2B2YA 1G6ZA 1HR0H 4TKOB 3QZ8A 2NTTA 1PH7A 3SE7A 4QWCA 4ZKCB 4LFCQ 2E2IH 3BA9A 3HOZG 1LT6D 2DJGC 4DK3C 1UE5A 4RGNA 4J9NA 1HNWQ 4MHEA 3TIGA 2V4QA 4J9OA 3EVQA 5FOBB 1B2TA 5KFMA 2C00A 1TT2A 1ESRA 1ILQA 5C5MA 4MV7A 2WAQG 4R4CA 1JE5A 4R1JA 3SXHA 3PO2G 4ABNA 1HNZQ 3ETJA 2B2VA 1Q82C 5D1PA 2XWJB 5HGTA 4JBJA 3OSOA 1AN7A 1CZWA 5AJ3Q 4B3TQ 1YEZA 1B9MA 1SAPA 1DYQA 3I4NH 2JA8H 1M6VA 5KKNB 5C3EH 3NENA 2JA5G 1ONLA 3Q8RB 1D2BA 5M3MH 2JA5H 2BH2A 3L3OC 2IT1A 5KFWA 2SNSA 1KNEA 1EU3A 2XD4A 5D8DA 4L5TA 1CM9A 4B3MH 1MD2D 2WACA 2UVRA 1AZQA 1XPOA 1N32H 1Q1EA 5JJZA 3CCEA 1TWAA 2D5DA 3RFCA 5DG8A 1KTKA 2XRSD 4R8NA 2R7ZA 5IODA 1T5EA 2A69D 2M2LA 1VBHA 5FJ8H 1XTCD 1E22A 3PO3G 1EL0A 4JI7L 1T9HA 1SJED 1TS2A 4A76A 2XIWA 3G71A 3CMAA 3VR6A 1S4ZA 1EYCA 2A19A 4I7ZC 4TVAB 3UI2A 3S9WA 1HUNA 4BY7H 4AQYQ 1QVGA 2GPWA 4R4IA 2CH4A 2YW2A 1V1OA 1JOQA 3I8ZA 3GIDA 3MFGA 3T1HQ 4MV8A 2R8IA 1UE7A 1X6OA 2PMZB 1PRTC 4A3CG 2Z1CA 2R7ZH 5EWFA 3OW7A 2K5NA 1MKHA 5DNFA 3OUUA 4J9PA 1STYA 1EU4A 1LTBD 4TV8F 5COYA 2YCHA 1HR0L 1PH4A 3AMUA 4C3HH 5KG5A 1Q7YC 3MJFA 4JI2L 5LP6F 2QDLA 3RB3A 5CA0F 1VQGA 4LF8H 2A68C 2O5JC 3H40A 4RHSA 3KF8B 5D1OA 1Z7TA 5IP7G 4FBUA 4I50F 2M05A 1MIUA 3GTMB 1SYXB 3PR5B 3J81c 3H94A 4CBVA 4RB3C 3A8JE 3WOEA 2LS01 2RDIA 4J15A 2FP4B 3SDZA 4QF4A 1HA5A 1I4QA 3BG5A 3MWEA 4HJ7A 4X3UA 5KT4A 1L0WA 2UU9H 1U0LA 3RGXA 5CV4A 2NN6G 2UVUA 2FFKB 3NSWA 3RTXA 3PIP3 2Y0SB 1V8QA 4GKJL 5BN3A 1RTOA 2PPBC 2LMCB 5A2QE 1IBKH 3H4BA 3VA7A 2NTSA 1T36A 5KFUA 4M8AA 2ZJPA 3PUXA 4NXNL 3CHBD 2SNMA 3M7GA 3U9SA 3WDNA 2HCIA 3HB9A 2HVRA 1W2BA 2NBFA 4G3IA 4DUYL 4C5CA 4UP8A 1GO3E 4GOPA 1FJGL 4A3KG 1D7QA 2YU9A 5D14A 1XMQQ 1H95A 5C4HA 4BWGB 2VR1A 4O3PA 1HUMA 3L4JA 1KRTA 2AGOA 1YNND 4G57A 2P0AA 4YB8B 1NY4A 2I5HA 4LFAL 1TWCB 3CVZA
chains in the Genus database with same CATH topology
5LMUL 1N36L 3D0FA 1B8AA 3I2ZA 3Q8DA 3JAMc 3I56A 1CKNA 3CCSA 5IYDG 1YI2A 1XMQL 1VQ6A 4R4OA 4B3SL 1HNWL 4QGUA 1PH1A 2AWNA 4A3JH 4OONA 4GNXA 3HOZH 4H02A 1L1OC 4XIGS 1KD1C 1E1OA 2YTVA 1HZBA 4KHPL 1K8AC 1IBLQ 3S15H 4AYBG 3PV0A 2K75A 3H0GG 3S14H 2K14A 1O7IA 1Q1BA 2AWOA 5BR8L 4KHZA 1YZ6A 3KFUA 2D0PA 2BH8A 1BBWA 2PQAB 1YIJA 1LUZA 4OO1I 5C4XG 2JK8A 2OTLA 1E1TA 3F1ZA 1EIFA 2R7ZG 4A3LH 1M1KC 4UPAA 1N34Q 2LXKA 4HJ9A 1IBLL 2K5VA 3J80c 4OWTB 1Q86C 5JJLA 1B70B 3HKSA 3K0XA 5E7NA 1YHQA 2PNHA 3I4OA 1X9NA 4JG2A 2VY3A 1RIPA 2JQOA 4LF5Q 3S16H 4P73A 4A3MH 3TRZA 3U4VA 4JOIC 4A3MG 3U58A 2IHEA 1E3PA 4DAYB 2A8VA 1FL0A 4DUZL 4X66Q 3F2CA 1EIYB 1XJVA 4BBSG 2ZTEA 1KL9A 2IHFA 3GTMH 4GN4B 3ULLA 2UXDQ 1QZHA 3A74A 3M85A 1LM0A 5IP9H 3J81j 2VZAA 3U4ZA 4PG3A 3DM3A 4UY8C 2R7FA 1SN8A 3T1YQ 3ER0A 5GAEC 3F2DA 3TQYA 3OTOL 3I4MH 3KDFB 3RR5A 3FKIG 1UEBA 4B3ML 4A3EG 1U5KA 4KHPQ 1YHAA 1XTDA 4IFDI 3G4SA 2QEXA 3S1NH 1I50H 2AMCB 1V43A 3GTLH 4IJHA 3HKZG 2UUCQ 3ULPA 4A3CH 2UU9Q 4LF4L 3KLWA 2VUMG 3K8AA 3OTOQ 3EIVA 1S3OA 2Q2TA 5FJ8G 3PO3H 4HJAA 1QZGA 4DV6L 1G291 1J5EL 5IWAQ 4GN5A 3BU2A 4EX5A 3AYHB 3CXCA 4LUZA 4DV0L 1Z47A 3HOVH 4LFBL 3EN2A 1VS0A 1Q8KA 1FGUA 2FXQA 1I5FA 1WCMG 3MXNB 3HOYH 1HNXL 4APVA 4JI7Q 4IPCA 4DUYQ 1N9WA 2K50A 4BBRH 2JA7H 4O2DA 3CC7A 4IOCA 4IPGA 3G6EA 5JEAJ 2VUMH 5JEAG 5C44H 2F4VL 5FLMG 4WJ3M 4IJLA 5EAYA 3PF4A 4UP7A 3I4NG 2Y0SG 1Q46A 3H0GH 3GTJH 3UE0A 4FDBA 4DR4Q 5IYBG 2EXDA 2KENA 3IRBA 5IE8A 2N78A 4GOPC 3F2BA 2CWPA 4DAMA 1MJCA 1SMXA 3ERSX 1S40A 5HY6A 1PH8A 1DGSA 2QGQA 3CF5A 4YWMA 1SE8A 1NE3A 4YY3L 2JA8G 2JA9A 4YWLA 5C4JH 2YTXA 3PF5A 1R9TH 1JMCA 1LYLA 4EQ5A 2UXDL 2F3IA 4NXML 1SR3A 4A93H 4OX9Q 4JBMA 4L5SA 4QJFA 1N33L 5LMNW 4AIMA 5M5WH 3JC66 1EQRA 3B6YA 2IX1A 1Q81C 1TWGH 4UP9A 4TQUS 4LNQA 4DV2Q 1SROA 2GVBA 2Z6KA 4BXXH 3HOVG 1AH9A 2VL6A 1UE6A 2GVAA 2ZM6L 2N8NA 2HQLA 1BBUA 2UUBQ 1VQKA 1PH9A 4OO1G 2JE6I 1N33Q 1N32Q 2D0OA 1X3FA 5M3MG 1I6HH 4JI1L 2ATWA 2AKWB 1Y1WH 4QY7A 2LXJA 4DV3Q 4A3LG 5GQOA 3TS2A 2XTIA 4Y52H 4DV1L 1VQFA 1HJPA 3CCLA 4A3KH 4IFDJ 3D31A 1X65A 2OTJA 4LF9L 1J5EQ 2NVQH 3BZKA 3RLFA 2C35B 2H5XA 4B3TL 3KJOA 2MO0A 1TWAH 5IT9c 2RF4A 3M9BA 1IBKQ 4BA2I 3L0OA 4YCUA 3HOUG 4MNOA 2UUAQ 4JV5L 1NMGA 4MTNA 1Y1WG 1C7YA 4BBRG 1OXVA 1VQ5A 2JA7G 2R92G 1SRUA 4YWKA 2NVYH 3M7NA 4JBKA 2B3GA 4LFAQ 1OXXK 5GAGC 1WCMH 3HOYG 5FLXc 1X3GA 2BA1A 4JI8L 1IXRA 4PZ8A 4YHHL 3K7UC 1NTGA 4A3GG 1K0RA 4YCWA 1FJGQ 4K0KQ 2VQFQ 2UXBL 2AHOB 4DV6Q 2CCZA 3HOUH 4YY3Q 3ICEA 1EWIA 4LF8Q 2F52A 1IL2A 1HR0Q 1PFSA 3KF6B 1PHJA 2UXCQ 4DK6C 4HJ5A 4JOIA 1OXUA 3TREA 4DR1L 4LF9Q 3AEVA 2V1CC 3KDFA 1PVOA 1JB7A 4DR6L 2DGYA 1YJWA 1HZ9A 4DV1Q 1GKHA 4DV7L 1OTCA 4OWWB 3BJUA 1IBMQ 3J7ZC 3HOXH 2K52A 1Y1VH 1OXTA 2Q2HA 3KYHC 5LMNL 4DR2L 3W1GA 5IP9G 4LWCA 2YTYA 3CCUA 1A62A 5GAHC 4GNXC 5JJKA 2Z0SA 4X65L 4MZ9A 3WWVA 4JI1Q 2JA6H 3STBC 2R93H 3UDGA 2ID0A 1MJEA 1N32L 1YBYA 3SGIA 1LTLA 2L15A 4BA1I 1GVPA 1A8VA 3PIOA 4P75A 1VQPA 4JI0L 2YU9H 4DR7Q 3S2HH 1XNQQ 1VQ4A 5DLQE 4JI4Q 1OXSC 2R93G 2I5MX 2Q2IA 3KOJA 1XPUA 5M3FG 2OQ0A 3OW2A 3J7A5 3GTGH 1IZ6A 3RZDH 3KJPA 1WFQA 4L5QA 2VW9A 3DLLA 1JJGA 3CC2A 4LF6L 2NZOA 5C3EG 1ASZA 3UDFA 4B3MQ 5H1SE 3E0EA 1TWHH 2N49A 4HIDA 1JJ2A 2NVTH 3K81C 3CC4A 1HH2P 5IYBH 4DV4Q 1SLJA 4DR4L 3PUWA 4A3EH 1VCIA 4HIMA 4A3IH 2IY5B 3NBHB 5BR8Q 2JEBI 3KF6A 4JI6Q 1VQHA 3PUVA 4JYAL 2MO1A 2WAQE 3HOWH 1EUJA 1YVCA 3CQZH 4PZ6A 2CWAA 3PUZA 4DR3L 2E5LQ 4X6AH 1B7YB 3J81i 3FP9A 1PH5A 4A3BH 2UXBQ 2MQHA 3E9IA 1VQMA 4GN3B 4DR5Q 3MEFA 5ELNA 4YHHQ 1KAWA 3PUYA 1CKOA 5IYDH 2JEAI 3L7ZC 4IPDA 1XMOQ 1HZCA 4BBSH 2KBNA 1KHIA 2VNUD 1K9MC 1QUQB 4LW1A 1A0IA 3STBD 4GOPB 1I94L 4ME3A 1VQNA 3S2DH 1PH3A 1VQIA 1Q12A 1EOVA 1Z9FA 1AE2A 3TEHB 2WP8J 5C0XJ 4OX9L 3S17H 4QIWE 4A3IG 3CPFA 4C3JH 3H15A 4HIOA 2PI2A 2WB1E 4LF4Q 1VQLA 1KIXA 4YCVA 4JI2Q 2CQOA 4LFCL 4NPSA 3CAMA 2PMZE 1YNXA 3E9HA 1I3QH 1YHBA 4GS3A 1N34L 3CMEA 3PSIA 4X62L 2UUCL 2HIVA 1WI5A 2XGTA 2WB1G 3FKIH 1VQOA 4RG1A 1N8RC 1XNRL 4B3RL 3S1QH 2KCTA 3K7AH 4P72A 3RNUA 4DR6Q 4JCVE 1NJIC 4A4IA 4A3GH 3L2PA 3PIPA 2HHHQ 2OQKA 4B3RQ 3GTPH 2VS1A 4HJ8A 1EQQA 1V1QA 3A0JA 1P8LA 3M3YH 2KHIA 3PCOB 4GKJQ 1SFOH 3RN5A 5AJ3L 5C44G 4OWXB 4LF8L 1TWFH 4L5RC 3T1YL 1FVIA 1GM5A 5IYCH 1HZAA 2ZTDA 3G48A 4JI5Q 2A1AA 2EIFA 1X55A 2HIXA 3M4PA 1CUKA 2VQFL 1HNZL 2ALYB 2MNAA 1XNQL 3H3VI 3JAMi 4AYBE 1L1OA 1PA6A 4WJ4A 2ASBA 4JC0A 2OWOA 4A3DH 4JI3Q 1N36Q 5C0XI 2KHJA 2B63H 4QQBX 2K5HA 5M3FH 1CKMA 1WJJA 4QL5A 2MFIA 3AFQA 3HOWG 1XMOL 2RHSB 2YV5A 2Q2UA 4O0AA 5IP7H 2K4KA 3W1BA 1V9PA 3RN2A 1G51A 4KI0A 4X65Q 4HIKA 4JYAQ 2QA4A 2UU9L 3UE1A 4LF5L 3UDXA 1PH6A 3A5UA 2E8GA 4POGA 1IBKL 1RL2A 1UE1A 1K73C 4PZ7A 1XNRQ 4IOAA 3CP0A 3J80i 3ZJYC 3CCVA 1JT8A 4BY1H 3GDEA 5GROA 2HHHL 4DV4L 3CPWA 2ZTCA 1PH7A 1PV4A 1E24A 2R6GA 4LFCQ 2E2IH 2UXCL 3HOZG 4DK3C 5C0XG 1UE5A 5FLMH 2F4VQ 1HNWQ 3CCRA 4LF6Q 1TWCH 3GTKH 4BY1G 1VQCA 3GD7A 4JBWA 1X54A 1G6PA 3PO2H 1IYJB 2R92H 3GO5A 1HNXQ 4X66L 1QVFA 4ALPA 2WAQG 4Y7NH 3I7FA 4P74A 4KLKA 1JE5A 2Y0SE 4R4CA 4R1JA 4DPGA 3PO2G 4GLAC 3HOXG 1HNZQ 4DV5L 1L2FA 1Q82C 1HR0W 4DR2Q 1QVCA 4JI5L 1PYSB 2E5LL 4LUOA 3ULJA 4NXMQ 1VQDA 4JBJA 4DR5L 1D8LA 4A3FH 1E7ZA 5AJ3Q 1XPRA 4JI6L 2VQEQ 1ASYA 3H3VH 5JJIA 4B3TQ 1YEZA 1NMFA 2E2JH 3I4NH 3RZOH 2JA6G 2JA8H 5LMNQ 5C3EH 2GN5A 5C4XH 3NENA 2RCNA 4AH6A 4X64Q 1VQ7A 2JA5G 4LF7Q 5M3MH 4LUVA 1EFWA 1UWVA 2EQSA 5M5YH 4DV3L 2JA5H 2OCEA 5IY0A 1WYDA 4LF7L 2BH2A 2IT1A 2PI2E 4L5TA 1GD7A 4IFDG 2PQAA 1XPOA 1Q1EA 3CCEA 3VDYA 2Z6KC 1NBWA 4DV5Q 4BY7G 4AQYL 5FJ8H 3LGJA 1E22A 3PO3G 4DR7L 4JI7L 1T9HA 2UUBL 4A76A 2B63G 3G71A 1KXLA 3CMAA 4IO9A 4JI3L 4JI8Q 2CFMA 1YJNA 1VQAA 1KC8C 5HGQA 1L1OB 1YITA 3S1MH 2A19A 2KCMA 3PGZA 4NB3A 4TVAB 3S24A 4XTCS 1X56A 3CCQA 4AQYQ 1QVGA 1P16A 4BY7H 4R4IA 5IYCG 4PMWA 3CCMA 3CW2C 1BVSA 1EYGA 3M4OH 1AE3A 4DNIA 5GADC 3T1HQ 1WOCA 1UE7A 1PYBA 1X6OA 4JV5Q 4A3CG 2R7ZH 2K5NA 1MKHA 2YYZA 4P71A 4DKAC 1VQ9A 2ES2A 2NVXH 4C2MH 1Y14B 3NEMA 4RMFA 5J3BA 1HR0L 1KRSA 4X64L 1PH4A 1M90C 3T1HL 3I4MG 4DR1Q 4C3HH 1Q7YC 1C9OA 4JI2L 3TS0A 4GNXB 4K0KL 4A3JG 3RLNA 1VQGA 2DUDA 1VQBA 2HT1A 5K36G 1X3EA 3AFPA 3CD6A 3FHWA 4GKKQ 2B29A 3KF8B 1CKNB 5IP7G 4JI4L 1MIUA 5LMUQ 4DV2L 1J6QA 3EBEA 4A93G 5M5XH 1I94Q 4JI0Q 1TXYA 2IX0A 3J81c 2ZM6Q 1K8GA 5IWAL 1PH2A 4A3DG 1VQEA 4J15A 3RLOA 2CKZB 4IPHA 4DV0Q 3W5OA 4GKKL 4LFBQ 3BZCA 3K80C 4R4TA 5ELOA 4HJ7A 1K3RA 3A5ZB 3HFZB 1L0WA 3U50C 2E2HH 2UUAL 3GTOH 4A3BG 1U0LA 4OXPA 3HKZE 4DR3Q 2NN6G 4A75A 1CSQA 1W3SA 1KQSA 4NXNQ 3I55A 1IBML 4GKJL 1JJCB 2BA0A 2D62A 3M4QA 4DV7Q 2RHQB 3OYYA 2NZHA 2JJQA 1K83H 1CSPA 2WFWA 4R4QA 3CCJA 1YJ9A 2ZJRA 3AQQA 1BKBA 4BXXG 4X62Q 2ZJPA 2I0QA 3PUXA 4NXNL 1Y1VG 4GLXA 4A3FG 1QUQA 2I5LX 1W2BA 1C0AA 2R7DA 4DUYL 4UP8A 1GO3E 2VQEL 4GOPA 1FJGL 4B3SQ 4A3KG 3UDIA 2ZJQA 1D7QA 4DUZQ 2LSSA 1VQJA 4C3IH 1XMQQ 1A63A 1H95A 3F8TA 4GLVB 4POFA 3NELA 1KRTA 2NN6I 1VQ8A 1NY4A 2I5HA 3GTQH 4LFAL 1S72A 2N3SA 3S1RH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU L;  1N36 L;  3D0F A;  1B8A A;  3I2Z A;  3Q8D A;  3JAM c;  3I56 A;  1CKN A;  3CCS A;  5IYD G;  1YI2 A;  1XMQ L;  1VQ6 A;  4R4O A;  4B3S L;  1HNW L;  4QGU A;  1PH1 A;  2AWN A;  4A3J H;  4OON A;  4GNX A;  3HOZ H;  4H02 A;  1L1O C;  4XIG S;  1KD1 C;  1E1O A;  2YTV A;  1HZB A;  4KHP L;  1K8A C;  1IBL Q;  3S15 H;  4AYB G;  3PV0 A;  2K75 A;  3H0G G;  3S14 H;  2K14 A;  1O7I A;  1Q1B A;  2AWO A;  5BR8 L;  4KHZ A;  1YZ6 A;  3KFU A;  2D0P A;  2BH8 A;  1BBW A;  2PQA B;  1YIJ A;  1LUZ A;  4OO1 I;  5C4X G;  2JK8 A;  2OTL A;  1E1T A;  3F1Z A;  1EIF A;  2R7Z G;  4A3L H;  1M1K C;  4UPA A;  1N34 Q;  2LXK A;  4HJ9 A;  1IBL L;  2K5V A;  3J80 c;  4OWT B;  1Q86 C;  5JJL A;  1B70 B;  3HKS A;  3K0X A;  5E7N A;  1YHQ A;  2PNH A;  3I4O A;  1X9N A;  4JG2 A;  2VY3 A;  1RIP A;  2JQO A;  4LF5 Q;  3S16 H;  4P73 A;  4A3M H;  3TRZ A;  3U4V A;  4JOI C;  4A3M G;  3U58 A;  2IHE A;  1E3P A;  4DAY B;  2A8V A;  1FL0 A;  4DUZ L;  4X66 Q;  3F2C A;  1EIY B;  1XJV A;  4BBS G;  2ZTE A;  1KL9 A;  2IHF A;  3GTM H;  4GN4 B;  3ULL A;  2UXD Q;  1QZH A;  3A74 A;  3M85 A;  1LM0 A;  5IP9 H;  3J81 j;  2VZA A;  3U4Z A;  4PG3 A;  3DM3 A;  4UY8 C;  2R7F A;  1SN8 A;  3T1Y Q;  3ER0 A;  5GAE C;  3F2D A;  3TQY A;  3OTO L;  3I4M H;  3KDF B;  3RR5 A;  3FKI G;  1UEB A;  4B3M L;  4A3E G;  1U5K A;  4KHP Q;  1YHA A;  1XTD A;  4IFD I;  3G4S A;  2QEX A;  3S1N H;  1I50 H;  2AMC B;  1V43 A;  3GTL H;  4IJH A;  3HKZ G;  2UUC Q;  3ULP A;  4A3C H;  2UU9 Q;  4LF4 L;  3KLW A;  2VUM G;  3K8A A;  3OTO Q;  3EIV A;  1S3O A;  2Q2T A;  5FJ8 G;  3PO3 H;  4HJA A;  1QZG A;  4DV6 L;  1G29 1;  1J5E L;  5IWA Q;  4GN5 A;  3BU2 A;  4EX5 A;  3AYH B;  3CXC A;  4LUZ A;  4DV0 L;  1Z47 A;  3HOV H;  4LFB L;  3EN2 A;  1VS0 A;  1Q8K A;  1FGU A;  2FXQ A;  1I5F A;  1WCM G;  3MXN B;  3HOY H;  1HNX L;  4APV A;  4JI7 Q;  4IPC A;  4DUY Q;  1N9W A;  2K50 A;  4BBR H;  2JA7 H;  4O2D A;  3CC7 A;  4IOC A;  4IPG A;  3G6E A;  5JEA J;  2VUM H;  5JEA G;  5C44 H;  2F4V L;  5FLM G;  4WJ3 M;  4IJL A;  5EAY A;  3PF4 A;  4UP7 A;  3I4N G;  2Y0S G;  1Q46 A;  3H0G H;  3GTJ H;  3UE0 A;  4FDB A;  4DR4 Q;  5IYB G;  2EXD A;  2KEN A;  3IRB A;  5IE8 A;  2N78 A;  4GOP C;  3F2B A;  2CWP A;  4DAM A;  1MJC A;  1SMX A;  3ERS X;  1S40 A;  5HY6 A;  1PH8 A;  1DGS A;  2QGQ A;  3CF5 A;  4YWM A;  1SE8 A;  1NE3 A;  4YY3 L;  2JA8 G;  2JA9 A;  4YWL A;  5C4J H;  2YTX A;  3PF5 A;  1R9T H;  1JMC A;  1LYL A;  4EQ5 A;  2UXD L;  2F3I A;  4NXM L;  1SR3 A;  4A93 H;  4OX9 Q;  4JBM A;  4L5S A;  4QJF A;  1N33 L;  5LMN W;  4AIM A;  5M5W H;  3JC6 6;  1EQR A;  3B6Y A;  2IX1 A;  1Q81 C;  1TWG H;  4UP9 A;  4TQU S;  4LNQ A;  4DV2 Q;  1SRO A;  2GVB A;  2Z6K A;  4BXX H;  3HOV G;  1AH9 A;  2VL6 A;  1UE6 A;  2GVA A;  2ZM6 L;  2N8N A;  2HQL A;  1BBU A;  2UUB Q;  1VQK A;  1PH9 A;  4OO1 G;  2JE6 I;  1N33 Q;  1N32 Q;  2D0O A;  1X3F A;  5M3M G;  1I6H H;  4JI1 L;  2ATW A;  2AKW B;  1Y1W H;  4QY7 A;  2LXJ A;  4DV3 Q;  4A3L G;  5GQO A;  3TS2 A;  2XTI A;  4Y52 H;  4DV1 L;  1VQF A;  1HJP A;  3CCL A;  4A3K H;  4IFD J;  3D31 A;  1X65 A;  2OTJ A;  4LF9 L;  1J5E Q;  2NVQ H;  3BZK A;  3RLF A;  2C35 B;  2H5X A;  4B3T L;  3KJO A;  2MO0 A;  1TWA H;  5IT9 c;  2RF4 A;  3M9B A;  1IBK Q;  4BA2 I;  3L0O A;  4YCU A;  3HOU G;  4MNO A;  2UUA Q;  4JV5 L;  1NMG A;  4MTN A;  1Y1W G;  1C7Y A;  4BBR G;  1OXV A;  1VQ5 A;  2JA7 G;  2R92 G;  1SRU A;  4YWK A;  2NVY H;  3M7N A;  4JBK A;  2B3G A;  4LFA Q;  1OXX K;  5GAG C;  1WCM H;  3HOY G;  5FLX c;  1X3G A;  2BA1 A;  4JI8 L;  1IXR A;  4PZ8 A;  4YHH L;  3K7U C;  1NTG A;  4A3G G;  1K0R A;  4YCW A;  1FJG Q;  4K0K Q;  2VQF Q;  2UXB L;  2AHO B;  4DV6 Q;  2CCZ A;  3HOU H;  4YY3 Q;  3ICE A;  1EWI A;  4LF8 Q;  2F52 A;  1IL2 A;  1HR0 Q;  1PFS A;  3KF6 B;  1PHJ A;  2UXC Q;  4DK6 C;  4HJ5 A;  4JOI A;  1OXU A;  3TRE A;  4DR1 L;  4LF9 Q;  3AEV A;  2V1C C;  3KDF A;  1PVO A;  1JB7 A;  4DR6 L;  2DGY A;  1YJW A;  1HZ9 A;  4DV1 Q;  1GKH A;  4DV7 L;  1OTC A;  4OWW B;  3BJU A;  1IBM Q;  3J7Z C;  3HOX H;  2K52 A;  1Y1V H;  1OXT A;  2Q2H A;  3KYH C;  5LMN L;  4DR2 L;  3W1G A;  5IP9 G;  4LWC A;  2YTY A;  3CCU A;  1A62 A;  5GAH C;  4GNX C;  5JJK A;  2Z0S A;  4X65 L;  4MZ9 A;  3WWV A;  4JI1 Q;  2JA6 H;  3STB C;  2R93 H;  3UDG A;  2ID0 A;  1MJE A;  1N32 L;  1YBY A;  3SGI A;  1LTL A;  2L15 A;  4BA1 I;  1GVP A;  1A8V A;  3PIO A;  4P75 A;  1VQP A;  4JI0 L;  2YU9 H;  4DR7 Q;  3S2H H;  1XNQ Q;  1VQ4 A;  5DLQ E;  4JI4 Q;  1OXS C;  2R93 G;  2I5M X;  2Q2I A;  3KOJ A;  1XPU A;  5M3F G;  2OQ0 A;  3OW2 A;  3J7A 5;  3GTG H;  1IZ6 A;  3RZD H;  3KJP A;  1WFQ A;  4L5Q A;  2VW9 A;  3DLL A;  1JJG A;  3CC2 A;  4LF6 L;  2NZO A;  5C3E G;  1ASZ A;  3UDF A;  4B3M Q;  5H1S E;  3E0E A;  1TWH H;  2N49 A;  4HID A;  1JJ2 A;  2NVT H;  3K81 C;  3CC4 A;  1HH2 P;  5IYB H;  4DV4 Q;  1SLJ A;  4DR4 L;  3PUW A;  4A3E H;  1VCI A;  4HIM A;  4A3I H;  2IY5 B;  3NBH B;  5BR8 Q;  2JEB I;  3KF6 A;  4JI6 Q;  1VQH A;  3PUV A;  4JYA L;  2MO1 A;  2WAQ E;  3HOW H;  1EUJ A;  1YVC A;  3CQZ H;  4PZ6 A;  2CWA A;  3PUZ A;  4DR3 L;  2E5L Q;  4X6A H;  1B7Y B;  3J81 i;  3FP9 A;  1PH5 A;  4A3B H;  2UXB Q;  2MQH A;  3E9I A;  1VQM A;  4GN3 B;  4DR5 Q;  3MEF A;  5ELN A;  4YHH Q;  1KAW A;  3PUY A;  1CKO A;  5IYD H;  2JEA I;  3L7Z C;  4IPD A;  1XMO Q;  1HZC A;  4BBS H;  2KBN A;  1KHI A;  2VNU D;  1K9M C;  1QUQ B;  4LW1 A;  1A0I A;  3STB D;  4GOP B;  1I94 L;  4ME3 A;  1VQN A;  3S2D H;  1PH3 A;  1VQI A;  1Q12 A;  1EOV A;  1Z9F A;  1AE2 A;  3TEH B;  2WP8 J;  5C0X J;  4OX9 L;  3S17 H;  4QIW E;  4A3I G;  3CPF A;  4C3J H;  3H15 A;  4HIO A;  2PI2 A;  2WB1 E;  4LF4 Q;  1VQL A;  1KIX A;  4YCV A;  4JI2 Q;  2CQO A;  4LFC L;  4NPS A;  3CAM A;  2PMZ E;  1YNX A;  3E9H A;  1I3Q H;  1YHB A;  4GS3 A;  1N34 L;  3CME A;  3PSI A;  4X62 L;  2UUC L;  2HIV A;  1WI5 A;  2XGT A;  2WB1 G;  3FKI H;  1VQO A;  4RG1 A;  1N8R C;  1XNR L;  4B3R L;  3S1Q H;  2KCT A;  3K7A H;  4P72 A;  3RNU A;  4DR6 Q;  4JCV E;  1NJI C;  4A4I A;  4A3G H;  3L2P A;  3PIP A;  2HHH Q;  2OQK A;  4B3R Q;  3GTP H;  2VS1 A;  4HJ8 A;  1EQQ A;  1V1Q A;  3A0J A;  1P8L A;  3M3Y H;  2KHI A;  3PCO B;  4GKJ Q;  1SFO H;  3RN5 A;  5AJ3 L;  5C44 G;  4OWX B;  4LF8 L;  1TWF H;  4L5R C;  3T1Y L;  1FVI A;  1GM5 A;  5IYC H;  1HZA A;  2ZTD A;  3G48 A;  4JI5 Q;  2A1A A;  2EIF A;  1X55 A;  2HIX A;  3M4P A;  1CUK A;  2VQF L;  1HNZ L;  2ALY B;  2MNA A;  1XNQ L;  3H3V I;  3JAM i;  4AYB E;  1L1O A;  1PA6 A;  4WJ4 A;  2ASB A;  4JC0 A;  2OWO A;  4A3D H;  4JI3 Q;  1N36 Q;  5C0X I;  2KHJ A;  2B63 H;  4QQB X;  2K5H A;  5M3F H;  1CKM A;  1WJJ A;  4QL5 A;  2MFI A;  3AFQ A;  3HOW G;  1XMO L;  2RHS B;  2YV5 A;  2Q2U A;  4O0A A;  5IP7 H;  2K4K A;  3W1B A;  1V9P A;  3RN2 A;  1G51 A;  4KI0 A;  4X65 Q;  4HIK A;  4JYA Q;  2QA4 A;  2UU9 L;  3UE1 A;  4LF5 L;  3UDX A;  1PH6 A;  3A5U A;  2E8G A;  4POG A;  1IBK L;  1RL2 A;  1UE1 A;  1K73 C;  4PZ7 A;  1XNR Q;  4IOA A;  3CP0 A;  3J80 i;  3ZJY C;  3CCV A;  1JT8 A;  4BY1 H;  3GDE A;  5GRO A;  2HHH L;  4DV4 L;  3CPW A;  2ZTC A;  1PH7 A;  1PV4 A;  1E24 A;  2R6G A;  4LFC Q;  2E2I H;  2UXC L;  3HOZ G;  4DK3 C;  5C0X G;  1UE5 A;  5FLM H;  2F4V Q;  1HNW Q;  3CCR A;  4LF6 Q;  1TWC H;  3GTK H;  4BY1 G;  1VQC A;  3GD7 A;  4JBW A;  1X54 A;  1G6P A;  3PO2 H;  1IYJ B;  2R92 H;  3GO5 A;  1HNX Q;  4X66 L;  1QVF A;  4ALP A;  2WAQ G;  4Y7N H;  3I7F A;  4P74 A;  4KLK A;  1JE5 A;  2Y0S E;  4R4C A;  4R1J A;  4DPG A;  3PO2 G;  4GLA C;  3HOX G;  1HNZ Q;  4DV5 L;  1L2F A;  1Q82 C;  1HR0 W;  4DR2 Q;  1QVC A;  4JI5 L;  1PYS B;  2E5L L;  4LUO A;  3ULJ A;  4NXM Q;  1VQD A;  4JBJ A;  4DR5 L;  1D8L A;  4A3F H;  1E7Z A;  5AJ3 Q;  1XPR A;  4JI6 L;  2VQE Q;  1ASY A;  3H3V H;  5JJI A;  4B3T Q;  1YEZ A;  1NMF A;  2E2J H;  3I4N H;  3RZO H;  2JA6 G;  2JA8 H;  5LMN Q;  5C3E H;  2GN5 A;  5C4X H;  3NEN A;  2RCN A;  4AH6 A;  4X64 Q;  1VQ7 A;  2JA5 G;  4LF7 Q;  5M3M H;  4LUV A;  1EFW A;  1UWV A;  2EQS A;  5M5Y H;  4DV3 L;  2JA5 H;  2OCE A;  5IY0 A;  1WYD A;  4LF7 L;  2BH2 A;  2IT1 A;  2PI2 E;  4L5T A;  1GD7 A;  4IFD G;  2PQA A;  1XPO A;  1Q1E A;  3CCE A;  3VDY A;  2Z6K C;  1NBW A;  4DV5 Q;  4BY7 G;  4AQY L;  5FJ8 H;  3LGJ A;  1E22 A;  3PO3 G;  4DR7 L;  4JI7 L;  1T9H A;  2UUB L;  4A76 A;  2B63 G;  3G71 A;  1KXL A;  3CMA A;  4IO9 A;  4JI3 L;  4JI8 Q;  2CFM A;  1YJN A;  1VQA A;  1KC8 C;  5HGQ A;  1L1O B;  1YIT A;  3S1M H;  2A19 A;  2KCM A;  3PGZ A;  4NB3 A;  4TVA B;  3S24 A;  4XTC S;  1X56 A;  3CCQ A;  4AQY Q;  1QVG A;  1P16 A;  4BY7 H;  4R4I A;  5IYC G;  4PMW A;  3CCM A;  3CW2 C;  1BVS A;  1EYG A;  3M4O H;  1AE3 A;  4DNI A;  5GAD C;  3T1H Q;  1WOC A;  1UE7 A;  1PYB A;  1X6O A;  4JV5 Q;  4A3C G;  2R7Z H;  2K5N A;  1MKH A;  2YYZ A;  4P71 A;  4DKA C;  1VQ9 A;  2ES2 A;  2NVX H;  4C2M H;  1Y14 B;  3NEM A;  4RMF A;  5J3B A;  1HR0 L;  1KRS A;  4X64 L;  1PH4 A;  1M90 C;  3T1H L;  3I4M G;  4DR1 Q;  4C3H H;  1Q7Y C;  1C9O A;  4JI2 L;  3TS0 A;  4GNX B;  4K0K L;  4A3J G;  3RLN A;  1VQG A;  2DUD A;  1VQB A;  2HT1 A;  5K36 G;  1X3E A;  3AFP A;  3CD6 A;  3FHW A;  4GKK Q;  2B29 A;  3KF8 B;  1CKN B;  5IP7 G;  4JI4 L;  1MIU A;  5LMU Q;  4DV2 L;  1J6Q A;  3EBE A;  4A93 G;  5M5X H;  1I94 Q;  4JI0 Q;  1TXY A;  2IX0 A;  3J81 c;  2ZM6 Q;  1K8G A;  5IWA L;  1PH2 A;  4A3D G;  1VQE A;  4J15 A;  3RLO A;  2CKZ B;  4IPH A;  4DV0 Q;  3W5O A;  4GKK L;  4LFB Q;  3BZC A;  3K80 C;  4R4T A;  5ELO A;  4HJ7 A;  1K3R A;  3A5Z B;  3HFZ B;  1L0W A;  3U50 C;  2E2H H;  2UUA L;  3GTO H;  4A3B G;  1U0L A;  4OXP A;  3HKZ E;  4DR3 Q;  2NN6 G;  4A75 A;  1CSQ A;  1W3S A;  1KQS A;  4NXN Q;  3I55 A;  1IBM L;  4GKJ L;  1JJC B;  2BA0 A;  2D62 A;  3M4Q A;  4DV7 Q;  2RHQ B;  3OYY A;  2NZH A;  2JJQ A;  1K83 H;  1CSP A;  2WFW A;  4R4Q A;  3CCJ A;  1YJ9 A;  2ZJR A;  3AQQ A;  1BKB A;  4BXX G;  4X62 Q;  2ZJP A;  2I0Q A;  3PUX A;  4NXN L;  1Y1V G;  4GLX A;  4A3F G;  1QUQ A;  2I5L X;  1W2B A;  1C0A A;  2R7D A;  4DUY L;  4UP8 A;  1GO3 E;  2VQE L;  4GOP A;  1FJG L;  4B3S Q;  4A3K G;  3UDI A;  2ZJQ A;  1D7Q A;  4DUZ Q;  2LSS A;  1VQJ A;  4C3I H;  1XMQ Q;  1A63 A;  1H95 A;  3F8T A;  4GLV B;  4POF A;  3NEL A;  1KRT A;  2NN6 I;  1VQ8 A;  1NY4 A;  2I5H A;  3GTQ H;  4LFA L;  1S72 A;  2N3S A;  3S1R H; 
#chains in the Genus database with same CATH topology
 5LMU L;  3JAM c;  4BXX H;  3N43 B;  2W9B A;  5CMD A;  3ND9 A;  4ZCK A;  4CKC A;  5TSS A;  4ZLT F;  3GTL A;  4B3S L;  3QWN A;  4QGU A;  2AWN A;  3EQL C;  4A3J H;  4TV9 F;  1L1O C;  2MHV A;  4K2L A;  3KTM A;  2ASJ A;  4IN3 A;  1ENA A;  5ELF A;  1HZB A;  1K8A C;  4C1N I;  3H0G G;  4C5B A;  3T5K A;  1O7I A;  3KFU A;  1YZ6 A;  4DK1 A;  2D0P A;  3T1H H;  2FHT A;  2JK8 A;  1EIF A;  1EY5 A;  5CBE E;  3NTI A;  4F4Z A;  4F8M A;  4HJ9 A;  1JIC A;  3H4D A;  3OHB A;  5JJL A;  1B70 B;  3HKS A;  4LMQ D;  1YHQ A;  1X9N A;  2B63 A;  3FDT A;  2V59 A;  2VY3 A;  1RIP A;  3VYR A;  3S16 H;  4P73 A;  4G7Z C;  4PMB A;  4C3H B;  1JCK B;  2UVW A;  5L1L A;  2C2R A;  3VPC A;  1FL0 A;  2EYJ A;  1A6X A;  1B44 D;  4CDD C;  2DPJ A;  1KL9 A;  3FMA A;  1BBX C;  2BR0 A;  2SDF A;  3GTJ A;  4GN4 B;  3KLR A;  3ULL A;  4A3K B;  2UXD Q;  1QZH A;  5KT6 A;  4FS2 A;  4LFA H;  4X3K A;  3V6K A;  5EZY F;  4JVZ A;  3DM3 A;  3WNZ A;  2F0G A;  3KAL A;  3T1Y Q;  4IQZ A;  1DV1 A;  1SYE A;  4RHR A;  3RR5 A;  5GON F;  2YRX A;  4IUT A;  1TWF A;  1E4G T;  1NR4 A;  3JRX A;  2NVX A;  2JSO A;  4PNY A;  2EE1 A;  1V1P B;  3TP7 A;  4EYI B;  4A3C H;  2SOB A;  3KLW A;  1H9S A;  2VUM G;  4DL4 A;  1K83 B;  5KFO A;  3EIV A;  2B2Y C;  2L11 A;  1BCP C;  2SCU B;  4DV0 L;  3HOV H;  1Z47 A;  3EN2 A;  1VS0 A;  4DL5 A;  2IP4 A;  1FGU A;  2B2T A;  4KY7 A;  5I2Y A;  3MXN B;  1HNX L;  2EY2 A;  1TU2 B;  4UCO A;  3Q8S B;  2R6F A;  5C1O A;  4NKL A;  1N9W A;  2K50 A;  1X3Q A;  4MV9 A;  4IOC A;  3CC7 A;  4IPG A;  4FF2 A;  4JUZ A;  5C44 H;  5FLX W;  4WJ3 M;  2HVQ A;  1OO9 B;  5D3D A;  2B2V C;  2NYZ D;  3UE0 A;  5K36 H;  3Q8Q B;  1RCV D;  2JA7 A;  5IYB G;  2EXD A;  5L37 A;  1EY9 A;  2C2D A;  3R93 A;  2RQX A;  1ZHQ A;  2N78 A;  1B3A A;  1TWH A;  3F2B A;  1MJC A;  3BDO A;  3DWA A;  3MZ5 A;  1S40 A;  3RGZ A;  1TS5 A;  1PH8 A;  1AUX A;  1STA A;  4YWM A;  1SE8 A;  4YY3 L;  2JA8 G;  1UUP A;  2VQD A;  4TUY F;  2Z4I A;  4WJW A;  5T1G A;  2BQ3 A;  2F3I A;  3S2H B;  1M8A A;  1ESF A;  1WTQ A;  3PMF A;  4QJF A;  3I12 A;  3K5O A;  1XDN A;  4DXG A;  2IX1 A;  1EQR A;  2W8K A;  4DV2 Q;  3EPG A;  2GVB A;  2Z6K A;  3F2U A;  3HOV G;  1L0Y B;  2ZM6 L;  2RBM A;  2HQL A;  4IUN A;  4FF1 A;  2JE6 I;  3A8K E;  2JN4 A;  3D3R A;  2X6L A;  4I4T F;  4JV2 A;  1Y1W H;  2CW0 C;  3J80 E;  2CQY A;  2LKV A;  3DMU A;  3R2T A;  4QWE A;  2KED A;  1W93 A;  4A3K H;  5C3X A;  1R4Q B;  4IFD J;  2EOT A;  2NVQ H;  4IFD H;  4QCL A;  1CQJ B;  1PDQ A;  4CHT B;  3KJO A;  2KOL A;  2RF4 A;  5FD5 A;  1SFO A;  3NUC A;  3RD4 A;  4MTN A;  1XYI A;  1C7Y A;  1Q90 A;  4BBR G;  2JA7 G;  4DR3 H;  3MHB A;  1CHP D;  2EYM A;  4S3S A;  1NR2 A;  2J7Z A;  2NVY H;  4HCS A;  5IGF A;  3HOY G;  5GAG C;  1WCM H;  3M4Y A;  1K3B C;  4EEY A;  2ASL A;  1IXR A;  3PIO 3;  5IYZ F;  3C1E A;  5F2D A;  4A3G G;  4KHV A;  4YCW A;  4K0K Q;  3HOV B;  2UXB L;  2F4V H;  5NUC A;  2AHO B;  3W2D A;  3VR5 A;  5J2U F;  1JE4 A;  2F0S A;  5KFZ A;  4LF5 H;  2FK3 A;  1PFS A;  5ISR A;  4ME6 A;  3M3Y B;  2UXC Q;  4HJ5 A;  5DLG A;  1SYC A;  4KY5 A;  3N44 B;  3AEV A;  4DR1 L;  2F0N A;  4LF9 Q;  1XNR H;  2ZXR A;  4I65 A;  1JB7 A;  4CDF C;  1PTO C;  1HZ9 A;  2A69 C;  4DAV A;  4DV1 Q;  4R8U A;  4EG0 A;  4OWW B;  3SEB A;  2HCC A;  1Y1V H;  3KYH C;  2Q2H A;  4KJN A;  2XCL A;  5EDW A;  1HXY D;  3CCU A;  1A62 A;  1KNA A;  2KA7 A;  2Z0S A;  4K8I A;  4DNR B;  5M3F B;  2E2D C;  1LLR D;  2R93 H;  2W9B B;  3CU7 A;  3UDG A;  3MFI A;  4FF3 A;  1YBY A;  2F0M A;  5BMV F;  2L15 A;  2BE5 D;  2EXZ A;  4JI0 L;  4ZQI A;  3FEW X;  3S2H H;  4LSA A;  1VQ4 A;  5IOC A;  1GSH A;  4V19 0;  2WKC A;  3K5N A;  4CJ2 C;  2R93 G;  2I5M X;  2F0P A;  2Q2I A;  1HCZ A;  2NU7 B;  3OW2 A;  2QW7 A;  1JB3 A;  1TWG B;  4XT1 B;  5M3M B;  2W6M A;  4ECU A;  5FPR A;  1EUC B;  1I4P A;  2L12 A;  1C4Q A;  5I2X A;  3HOY B;  3UDF A;  4IR9 A;  1TWH H;  5I9O A;  2VUM B;  1HH2 P;  1TS3 A;  3TP6 A;  3PUW A;  4A3E H;  1VCI A;  3GTK B;  1GUW A;  2FB9 A;  4KV6 A;  1GYF A;  3NBH B;  4FU0 A;  4RB2 C;  2MO1 A;  2WAQ E;  1E2Z A;  3CQZ H;  3PW7 A;  5G3L F;  1H9J A;  1PRT F;  4K5X A;  3FP9 A;  3M9M B;  2UXB Q;  2R3Z A;  1VQM A;  4GN3 B;  4DR5 Q;  3MEF A;  1ZYR C;  4TQR A;  2R8J A;  3NK9 A;  3G6V A;  1HZC A;  1S5C D;  3V6J A;  1E2W A;  4A3F B;  3P20 A;  1A0I A;  1QOH A;  1I94 L;  3OSN A;  4ZHQ F;  1TA8 A;  3S17 H;  3JSL A;  3TEH B;  5C0X J;  2NVY B;  1TY2 A;  2CVR A;  2WP8 J;  2UVV A;  1HHV A;  3EA6 A;  2E5L H;  3H15 A;  5M5W B;  2PI2 A;  3PW5 A;  1BJT A;  4YCV A;  4JI2 Q;  5BPH A;  3NGD A;  4LFC L;  1RJQ A;  3DUZ A;  4XQJ A;  1N56 A;  3GIL A;  1SMY D;  2DIK A;  1WTW A;  5I4D A;  1T3N A;  3CME A;  2K5D A;  2UUC L;  2HIV A;  2XGT A;  2EDG A;  2Q8T A;  1N8R C;  1XNR L;  4DR1 H;  4DL3 A;  3K7A H;  3RNU A;  4ECQ A;  4DR6 Q;  1S0N A;  4JCV E;  1CQV A;  3L2P A;  3HRZ C;  4B3R Q;  3GTP H;  3A0J A;  3E5S A;  2RDF A;  1N33 H;  4LF8 L;  4MV3 A;  1FVI A;  1A9X A;  1HZA A;  3G48 A;  3N42 B;  4JV5 H;  1X55 A;  3M4P A;  2MNA A;  3K59 A;  3CRK C;  4DR7 H;  1BXR A;  1PA6 A;  4WJ4 A;  1EYD A;  1N36 Q;  5C0X I;  4QQB X;  1UC8 A;  5CV8 A;  5IGD A;  1CFM A;  5M3F H;  1CTM A;  3AFQ A;  2JA6 B;  3HOW G;  2AQ3 B;  3RBD A;  3EYY A;  1C8C A;  3GTP A;  2RGV A;  1EZ1 A;  1G51 A;  2K03 A;  4FM9 A;  1B04 A;  4LF5 L;  5J2T F;  1IBK L;  1RL2 A;  5DQI A;  1J9O A;  3DWP A;  1K73 C;  3UFX B;  3H91 A;  5AFW A;  2IL8 A;  2W6O A;  5KX5 F;  1SNP A;  2E2H A;  3GDE A;  2HHH L;  3G8C A;  2QDB A;  3H20 A;  1PV4 A;  4A2B A;  2CHB D;  4LF6 Q;  1E2V A;  4ZOL F;  5JVH 3;  5HBR B;  5IGC A;  4BY1 G;  4FXD A;  1PX2 A;  3CKI B;  2R93 A;  1IW7 C;  4LF4 H;  3PO2 H;  3HOX B;  5C3W A;  3GO5 A;  2L1B A;  2HGS A;  1HNX Q;  1LTS D;  2R8K A;  1QVF A;  3PN1 A;  5CGK A;  4Y8V B;  5C8Y F;  1BCP F;  4IRD A;  2KCN A;  1QJO A;  2HVS A;  3GTQ A;  4P74 A;  4KLK A;  1ZQ7 A;  3BVZ A;  2NUA B;  2B2U C;  5EPK A;  4DPG A;  4MV1 A;  3HOX G;  4Q44 A;  1ML0 D;  1QVC A;  1PYS B;  3MR3 A;  4ZYS A;  4HNV A;  1VQD A;  5M9O A;  3QG1 A;  4DR5 L;  1HNX H;  1D8L A;  4A3F H;  3LWE A;  1B53 A;  1EUD B;  2OF1 A;  3MWY W;  2E2J H;  1M7J A;  1CHQ D;  3QB3 A;  2I80 A;  1EYA A;  2EYF A;  1VQ7 A;  5A35 A;  4KKS A;  4LUV A;  2ZXP A;  1EFW A;  5M5Y H;  3N6X A;  3S16 B;  2OCE A;  4U68 A;  2X6G A;  4ED2 A;  1DV2 A;  1HTP A;  4RZR A;  3ITP A;  4BWS C;  1B50 A;  2W6P A;  2F3V A;  5LA6 F;  3MXP A;  3S1Q B;  3Q8P B;  2EY6 A;  3VDY A;  1A3U A;  1GHJ A;  2W7P A;  1RYS A;  3GTP B;  4RNO A;  1NBW A;  1SFO B;  3LWB A;  3D6C A;  5JQW A;  3OMG A;  4JI3 L;  3HOZ B;  2F0D A;  1YJN A;  1G2S A;  5HGQ A;  1YIT A;  3S1M H;  5CBA E;  4UHV A;  2DY7 A;  1H9R A;  3S15 B;  5JOB A;  2YS6 A;  1N36 H;  5IYC G;  4PMW A;  4FVM A;  1SNQ A;  2IW3 A;  3TP5 A;  3M4O H;  3QOL A;  1HPC A;  4EBE A;  5C0X H;  1PYB A;  4JV5 Q;  1EIH A;  5EBC A;  5ELB A;  1MZB A;  2LFN A;  4DXF A;  4XYQ A;  4MA5 A;  4DKA C;  3MFH A;  4RWS C;  2ES2 A;  2NVX H;  4C2M H;  4RMF A;  1T94 A;  4IZO A;  5J3B A;  4B3R H;  1KRS A;  1M90 C;  1LT5 D;  4ECR A;  1S5D D;  1EWC A;  4DR1 Q;  3NXW A;  1C9O A;  2K01 A;  4BY1 B;  1I7N A;  1S0O A;  4A3J G;  3RLN A;  1LT4 D;  4C3J G;  2HT1 A;  3UQ8 A;  4A3G B;  3FHW A;  2B29 A;  1LTT D;  1CKN B;  4IUQ A;  4JI4 L;  2Y0S A;  3EFX D;  2VQF H;  1TR5 A;  5LMU Q;  3EBE A;  4QWB A;  3BAA A;  1NUC A;  5IT9 E;  1QCB D;  3GIJ A;  4EQO A;  2H4O A;  2CKZ B;  4DV0 Q;  4GKK L;  3IG0 A;  3BZC A;  4R4T A;  5ELO A;  5KNB A;  1K3R A;  3HFZ B;  3U50 C;  2K5W A;  3ORQ A;  2WB1 B;  2R7L A;  4ETS A;  4DR5 H;  1RYR A;  3W3A A;  4OIK A;  3K5L A;  5L1K A;  2YL2 A;  1IBM L;  1JJC B;  2BA0 A;  3M4Q A;  3GTG A;  2RHQ B;  4L8J A;  4DNT B;  4J9S A;  2XCA A;  2PW7 A;  3HG9 A;  2WFW A;  1EHI A;  1E0B A;  2ZJR A;  3Q23 A;  1BKB A;  2E2J B;  5LL6 S;  3G6J B;  3OHX C;  4GLX A;  3E5N A;  3VPB A;  3L4K A;  3RIZ A;  3P75 A;  1QUQ A;  4YIJ A;  1R9T A;  2HD3 A;  4LFB H;  3WO0 A;  2VQE L;  1EEI D;  1RTN A;  3R8B A;  4RCN A;  4DUZ Q;  2CZG A;  2LSS A;  5JUM A;  4C3I H;  4X66 H;  4ZRZ A;  1S5B D;  3BDL A;  2XNA C;  4POF A;  4TRD A;  3T5L A;  1VQ8 A;  4ZKB B;  5KFV A;  1MSH A;  1S72 A;  2Q8R E;  4CJ1 B;  1JOR A;  3LX0 A;  5ELD A;  2X0S A;  5FKA C;  1B8A A;  4KK7 A;  1CKN A;  5IYD G;  1W6K A;  2MJ8 A;  3MA2 B;  1PH1 A;  4HED A;  4GNX A;  4R8I A;  2WII B;  2PNR C;  4H02 A;  1KD1 C;  3FVQ A;  1TWA B;  1H9M A;  1U9R A;  3S15 H;  1C30 A;  2GLT A;  3I90 A;  3D8G A;  5CA1 F;  2FK1 A;  2K14 A;  2KHS A;  4PQX A;  2PQA B;  2F0W A;  4JW0 A;  1E1T A;  2R7Z G;  1WSC A;  5DG9 A;  3TZU A;  2K5V A;  1EIG A;  2AQ2 B;  3J80 c;  3K0X A;  1SEB D;  2KEE A;  2JQO A;  4LF5 Q;  4A3M H;  2QK4 A;  4JOI C;  1PTO F;  3U58 A;  4WBN F;  5DG7 A;  3A54 A;  2IHE A;  5KFT A;  1Y8P B;  2W71 A;  2A8V A;  4JI7 H;  4X66 Q;  3LML A;  1M0W A;  5FK9 C;  3PW0 A;  2ZTE A;  4NDX A;  2IHF A;  1JWS D;  4OHJ A;  2HDM A;  4ECY A;  5IWA H;  1LM0 A;  1ILP A;  3U4Z A;  3DXJ C;  1SN8 A;  3HKZ B;  3BA8 A;  2VUG A;  2VA3 A;  4LF7 H;  2K1B A;  3TQY A;  3I4M H;  2MPM A;  3MVV A;  4F88 A;  1U5K A;  4RFB A;  1XTD A;  4IFD I;  4KHP H;  1I6U A;  4DFA A;  4ILW A;  2AMC B;  1KJI A;  2RCF A;  4NXM H;  4M7E A;  5KFJ A;  1XX8 A;  1AUV A;  5JPN C;  3K8A A;  4LAA A;  3NQT A;  2ZDG A;  1S3O A;  2MUY A;  4HJA A;  4CC5 A;  4DV6 L;  4APM A;  3Q2O A;  2R87 A;  4EX5 A;  3TP8 A;  5KG3 A;  3KXY T;  2Z8L A;  4DAP A;  3LP8 A;  5LMU H;  2FXQ A;  1QNK A;  1SDF A;  2M9V A;  5HV6 A;  1F2Z A;  5KYI A;  4DUY Q;  4HYK A;  3PQI A;  4HSP A;  4O2D A;  3JAM L;  2VUM H;  3KK7 A;  4JV1 A;  4G4K A;  1LTI D;  2RSO A;  4CKB A;  2C9O A;  1G2T A;  3JRW A;  3IN5 A;  1Q46 A;  1LT3 D;  1S68 A;  4QMG A;  4FDB A;  4DR4 Q;  3I91 A;  4GOP C;  5KRU A;  2PYK A;  2CWP A;  4DAM A;  2F0F A;  3MXU A;  4X65 H;  2QGQ A;  3CF5 A;  5IT9 W;  1ZHS A;  4KN7 C;  2FLP A;  1GUO A;  1EWH A;  4YWL A;  3SI8 A;  1IBL H;  4O3N A;  1JMC A;  2UXD L;  4EQ5 A;  4NXM L;  2XN9 C;  3FMC A;  2AQ4 A;  4XX0 B;  2J6T A;  5M5W H;  2L0C A;  4U6P A;  4ZI7 F;  4FP5 D;  3GTG B;  4LNQ A;  3A55 A;  4XDX A;  4YR0 A;  1AH9 A;  4RGM A;  2OEO A;  1F9P A;  1UE6 A;  2GVA A;  1O7Z A;  2N8N A;  1I3Q B;  3OPO A;  4OO1 G;  4LH7 A;  4JK1 C;  4O3Q A;  1DCZ A;  5ELE A;  1X3F A;  5M3M G;  4JI1 L;  2ATW A;  4RCO A;  3QIA A;  4IUP A;  2JXM B;  4QY7 A;  4DV3 Q;  4F50 A;  1ULZ A;  1JIH A;  1UNN C;  1VQF A;  1HJP A;  5KFE A;  3AB9 A;  1PMR A;  1STG A;  1X65 A;  2XIG A;  2B2W A;  4X62 H;  3RLF A;  3A8I E;  3KF8 A;  2C35 B;  3PW2 A;  2V9W A;  4EQP A;  1RHP A;  5LHY 1;  4BA2 I;  3M9B A;  4ED1 A;  1A3T A;  3C1F A;  4R7R A;  1SYD A;  4A2A A;  3M9O B;  1PFN A;  1NMG A;  4L63 B;  3T1Y H;  1VQ5 A;  1CS0 A;  2PCF B;  1PFM A;  2D9U A;  2KJX A;  3RV3 A;  2DPI A;  3P7J A;  4JBK A;  4LFA Q;  2V58 A;  1OXX K;  3PZP A;  2UXD H;  1R4P B;  2XVS A;  2BA1 A;  5COR A;  1IYU A;  3BZD B;  3TBI B;  4PZ8 A;  2VOB A;  4YHH L;  3K7U C;  1NTG A;  2PZT A;  1I94 H;  1K0R A;  4LF6 H;  3RBE A;  4YY3 Q;  5JVD F;  5BR8 H;  1FD7 D;  1IL2 A;  1RJR A;  1DXM A;  4KN4 C;  3KF6 B;  4OEM B;  1PHJ A;  4XXE A;  4DK6 C;  4DL2 A;  4JOI A;  2TMP A;  5KFB A;  3OWF A;  3TRE A;  1TS4 A;  3GTK A;  2V1C C;  5KFL A;  5J22 A;  3T4A C;  2DGY A;  4DR6 L;  4MIU A;  5CC4 A;  4DV7 L;  2B2U A;  2DY8 A;  3J7Z C;  3R5F A;  2ENB A;  3MEH A;  2G9H D;  5DGB A;  1WH2 A;  5LMN L;  1ET9 A;  3CQZ A;  3J7A V;  4XQN A;  3W1G A;  2AGP A;  5IP9 G;  3R3O A;  1TY0 A;  1KLG D;  3GTL B;  4H44 C;  4IR1 A;  2XRQ D;  3KLS X;  1BCP D;  1SYF A;  3NTK A;  4XYL B;  3SGI A;  5C4Z A;  3V4S A;  2IPK D;  4BA1 I;  1VQP A;  4DR7 Q;  2DNC A;  1XNQ Q;  3PO3 B;  1EY7 A;  5DLQ E;  3HGB A;  1XPU A;  3KOJ A;  2W9C B;  5M3F G;  4UCT A;  2FLL A;  2OQ0 A;  5C4X B;  2N88 A;  3GTG H;  2W7O A;  3RZD H;  3R5X A;  1WFQ A;  4IRC A;  2CW8 A;  2VW9 A;  2L5T A;  1UC9 A;  3CC2 A;  3J81 E;  1BQQ T;  3GV3 A;  3E0E A;  2N49 A;  2NVT H;  4F4X A;  4MV6 A;  3CC4 A;  4WOR A;  4DR4 L;  3IL8 A;  4A3I H;  4DV6 H;  3KF6 A;  4O1N A;  1I4G A;  1VQH A;  1WTR A;  4JYA L;  2XCP A;  1ZYR D;  1CI3 M;  5EKL A;  1EUJ A;  4EGJ A;  4PZ6 A;  3PUZ A;  4DR3 L;  1SSO A;  2E5L Q;  4X6A H;  5DLF A;  3BG3 A;  1PH5 A;  1EFI D;  4C5A A;  1HTL D;  4I7H A;  3GIK A;  3T5J A;  2E75 C;  4QWD A;  2WDT A;  2JEA I;  3ORR A;  2NB0 A;  3MFY A;  5LYJ F;  3M4O B;  1Q3L A;  3S2D H;  5DGA A;  1VQN A;  2V4R A;  2UXB H;  3N6R A;  3I4N B;  1AE2 A;  5D1O B;  5KFP A;  3BJY A;  3KLS A;  4HIO A;  2F0V A;  4CC6 A;  3A7A B;  1ZET A;  2CQO A;  1NAP A;  3CAM A;  4H7B A;  2GA4 B;  1YHB A;  2JYO A;  4GS3 A;  4J0M A;  3BQ0 A;  1CQI B;  1N34 L;  4IRK A;  3KHR A;  2WB1 G;  4RG1 A;  1D6E C;  1FGB D;  4P72 A;  3SR1 A;  4A4I A;  4A3G H;  3PIP A;  1WTP A;  1V1Q A;  1GSA A;  1P8L A;  2PMZ A;  5EPJ A;  1KDA A;  5C44 G;  1TWF H;  2UUB H;  3LNN A;  3T1Y L;  2NVQ B;  1V51 A;  1GM5 A;  2ZTD A;  4K5V A;  5K5P A;  2EIF A;  2B8G A;  2HIX A;  4ME5 A;  1CUK A;  2VQF L;  1HNZ L;  2ALY B;  2NU8 B;  3PW4 A;  5IIF A;  1L1O A;  2R8H A;  2W70 A;  2OWO A;  4A3D H;  4JI3 Q;  2KHJ A;  2B63 H;  2K5H A;  3C0F B;  2EYH A;  4RU9 A;  3HS0 C;  1XMO L;  3OIQ A;  3W1B A;  1V9P A;  3RN2 A;  4WRD A;  4KI0 A;  5IGB A;  3BAB A;  4JYA Q;  4EQN A;  2ZT9 C;  2QA4 A;  4EBD A;  3UDX A;  1PH6 A;  4POG A;  1DM0 B;  5I6W A;  1MBY A;  3R5H A;  4PZ7 A;  1XNR Q;  2FIN B;  4TSS A;  1D1I A;  3CP0 A;  3ZJY C;  3CCV A;  1JT8 A;  1QG7 A;  1O75 A;  5KG4 A;  5C6A A;  2ZTC A;  2R6G A;  1IW7 D;  1Z2N X;  2F3W A;  1SE4 A;  2F4V Q;  3JSN A;  5CV5 A;  4K0K H;  2K33 A;  1B1Z A;  1VQC A;  3S1R B;  3GD7 A;  4ED7 A;  1X54 A;  1IYJ B;  1SBB B;  3EPI A;  4MN3 A;  4J6H A;  1PYW D;  1U4L A;  4QIW A;  2OH2 A;  4Y7N H;  4UDU C;  2IMW P;  4OGQ C;  4DAY A;  1HR0 W;  4DV5 L;  1L2F A;  2R93 B;  1TWG A;  2R61 A;  4DR2 Q;  4BBS B;  2TSS A;  3RMH A;  2C2E A;  2AU0 A;  1E7Z A;  5IGE A;  1XPR A;  4J9K A;  3H3V H;  5JJI A;  3RZO H;  4E4T A;  2FMM A;  4C3J B;  4ECX A;  3WOF A;  2EYP A;  3MR2 A;  1AZP A;  3ONA B;  1RD9 D;  2PI2 E;  1GD7 A;  4IFD G;  4ED6 A;  4DGZ A;  5I9P A;  3MR6 A;  4MTD A;  4DV5 Q;  4LSX A;  3SVM A;  2WKD A;  2NWG A;  3J7A F;  2GPS A;  1VQA A;  1KC8 C;  3TQT A;  1L1O B;  2R7K A;  1EEF D;  2KCM A;  4NB3 A;  3I4M B;  3S24 A;  1BOS A;  4J1M A;  2JP1 A;  2B63 B;  1Y1W A;  3J80 L;  3I4L A;  1AE3 A;  5GAD C;  1WOC A;  1CA5 A;  3K6O A;  2ICI A;  1WTH A;  4P71 A;  4TQS A;  1FR3 A;  1PTO B;  1FKA H;  1BCP B;  1JXL A;  5FO8 B;  2PZU A;  3VYT A;  4X64 L;  4FF4 A;  2IBK A;  3OIP A;  1A15 A;  5KEE A;  4RAU C;  4GNX B;  3J81 W;  5JPM C;  3E0J A;  4K0K L;  1J5E H;  2DUD A;  1VQB A;  5K36 G;  2F0U A;  3AFP A;  3CD6 A;  5EQ0 A;  3K58 A;  4X3S A;  1S10 A;  1HFN A;  2R84 A;  5LOV F;  4A93 G;  2DN8 A;  1MI2 A;  4ECS A;  1I94 Q;  5KG6 A;  5CV7 A;  4DL7 A;  2ZM6 Q;  1K8G A;  4B3S H;  4N9P A;  5IWA L;  2BQR A;  4A3D G;  2YYA A;  5T14 A;  2XC9 A;  3RLO A;  1JX4 A;  3H0G B;  3W5O A;  4RNN A;  3K80 C;  2YRW A;  1PRT B;  3IFT A;  4A3B G;  3A5Z B;  2UUA L;  2ASD A;  2C22 A;  1S97 A;  3GTO H;  4EFB A;  4ZUI A;  4OXP A;  3HKZ E;  4YHH H;  2DNE A;  4Y7N B;  4KD3 A;  1F9R A;  4A75 A;  1W3S A;  4YAK B;  4ED8 A;  3K3V A;  3I55 A;  4DV7 Q;  4HNU A;  3OYY A;  2NZH A;  5C4J B;  3MAQ A;  2JJQ A;  1K83 H;  1CSP A;  4JI6 H;  4R4Q A;  3NE5 B;  1PTO D;  4DF7 A;  3CCJ A;  1YJ9 A;  1B33 N;  2IA6 A;  4BXX G;  4X62 Q;  2I0Q A;  2FMC A;  2JA8 B;  5EPL A;  1SYB A;  2Z4H A;  1KAA A;  5C3E B;  4A3F G;  1PK8 A;  5KFH A;  1RKN A;  2I5L X;  1T5X D;  2R7D A;  4RA8 A;  4G7H C;  1BDO A;  1NCV A;  1SND A;  1BF4 A;  1I6V C;  3BDC A;  2A68 D;  1BUV T;  2ZJQ A;  4B3S Q;  3BYY B;  1A63 A;  2EY5 A;  2Z9H A;  4GLV B;  3NEL A;  1CK1 A;  5KT5 A;  4RNM A;  1ICF B;  3MC0 B;  1C48 A;  3TIN A;  1KJ9 A;  3V4Z A;  1J5E Q;  2KCC A;  1N36 L;  2DJF C;  4K14 A;  1SJH D;  3D0F A;  3I2Z A;  3Q8D A;  1YI2 A;  1VQ6 A;  3CCS A;  3V05 A;  3PF4 A;  1XMQ L;  3NBI A;  1Z2P X;  1JDB B;  4O4I F;  4R4O A;  3I70 A;  1LAB A;  4OON A;  2PN1 A;  1PRT D;  4XIG S;  1QNU A;  4UFZ A;  1E1O A;  1EQV A;  1IBL Q;  3K0Y A;  4GC6 A;  2K75 A;  4ULL A;  2AWO A;  3D4R A;  4RB0 A;  4KHZ A;  2WIN B;  5EGT A;  2BH8 A;  1BBW A;  3G7L A;  5KFF A;  2KEC A;  1LUZ A;  1JOK A;  1RJP A;  2V5A A;  4WD3 A;  4UPA A;  5LXT F;  2LXK A;  5KFX A;  4ZAI A;  1VDZ A;  3D4D A;  4OWT B;  1Q86 C;  2W9C A;  4EYH B;  2PNH A;  4JG2 A;  2FPP B;  2J9G A;  3NTH A;  2F0L A;  3TRZ A;  3U4V A;  2W9A A;  2D2C C;  4HNT A;  2VB2 X;  4ZQ3 A;  3QZ7 A;  4DV5 H;  3OHA A;  3BYT B;  5FO9 B;  1GUG A;  1EIY B;  1IHZ A;  3F2C A;  1XJV A;  2QYZ A;  3VR4 A;  3X3N A;  3SHL A;  4K8J A;  1C3O A;  3GTM H;  4OO1 H;  2A6E C;  2QCP X;  3A74 A;  3RAQ A;  5FO7 B;  3T51 B;  5IP9 H;  3J81 j;  3E6Z X;  2C5C A;  5K2M A;  1GXD C;  4QW8 A;  1E4F T;  3F2D A;  5GAE C;  1DIK A;  3KDF B;  2A6E D;  2EYO A;  2FK2 A;  3GTO B;  1STE A;  4B3M L;  4A3E G;  2WE6 A;  2CQA A;  4KHP Q;  3I3C A;  3G4S A;  4IAJ A;  3MXG A;  4NP5 A;  1I50 H;  3GTL H;  1V43 A;  3HKZ G;  4Q45 A;  4DR2 H;  4N9T A;  1JKJ B;  2UU9 Q;  4LF4 L;  4RB1 A;  3M9N B;  1WCM B;  3QJY A;  3OTO Q;  2I07 B;  2YU9 B;  5FJ8 G;  3PO3 H;  1SE3 A;  1QZG A;  1TII D;  3X3M A;  2J6S A;  5IWA Q;  5HUR A;  4GN5 A;  5DM6 3;  3BU2 A;  5KFI A;  3SK4 A;  5BPF A;  4YBZ B;  4LFB L;  3RZD B;  2OLS A;  1Q8K A;  4C56 C;  5KFR A;  3L9A X;  2A5H A;  4APV A;  2RDH A;  4JI7 Q;  4Q0Y A;  4IPC A;  2JA6 A;  1EY0 A;  3T5H A;  2NVT B;  4ECW A;  3GQB A;  5JEA J;  5JEA G;  2Z6B A;  5FLM G;  4A3I B;  1IYV A;  2G5D A;  4IJL A;  5EAY A;  4ECT A;  3I4N G;  3DEP A;  2FE3 A;  3QFF A;  4ED0 A;  2E2H B;  5IE8 A;  1GLV A;  4Z9C B;  2QEJ C;  5T1I A;  2FLN A;  1SMX A;  2KQ3 A;  3QR8 A;  3QO2 A;  4JYA H;  5HY6 A;  4IWX A;  3K5M A;  1I3Q A;  5KT7 A;  3T16 A;  3GIP A;  4AQY H;  3PF5 A;  1R9T H;  1LYL A;  2R7N A;  4A93 H;  1DD2 A;  4OX9 Q;  4JBM A;  4J9L A;  1ZKO A;  4JI3 H;  1N33 L;  4AIM A;  2B8F A;  1HRJ A;  4YR3 A;  4CDC C;  3TSS A;  5EKI A;  1TWG H;  2FJZ A;  5E4W C;  1SRO A;  4HSV A;  1W96 A;  2VL6 A;  1IKM A;  4IUR A;  2UUB Q;  4RAY A;  1VQK A;  2DLN A;  1N32 Q;  4OIJ A;  2WAQ B;  1F2L A;  5IGG A;  2D0O A;  1TWH B;  1GJX A;  3PR4 A;  3DEO A;  1K83 A;  1F77 A;  4ZK9 B;  4A3L G;  4HR7 B;  2XTI A;  4AYB B;  4DV1 L;  1S5E D;  3CCL A;  2PBZ A;  1BGW A;  1TWF B;  4IAL A;  4GZY C;  2OTJ A;  4LF9 L;  3KBX A;  5KT3 A;  3U9T A;  4IUV A;  2H5X A;  4B3T L;  2QKI C;  2MO0 A;  1TWA H;  3GV5 B;  2I87 A;  1B6S A;  3JAM W;  4U7C A;  3NBH A;  1RJT A;  4YCU A;  4YAJ B;  3JZI A;  4C2M A;  2UUA Q;  1W6J A;  1HNZ H;  1Y1W G;  2PVP A;  2F4I A;  1WTO A;  1I50 B;  2R92 G;  1G91 A;  1SRU A;  3GP7 A;  4YWK A;  3S17 B;  3TDQ A;  3M7N A;  5KFS A;  2XGQ A;  2OXP A;  3K5I A;  1X3G A;  3BVM A;  5F9L A;  1BNC A;  1I4H A;  4KY6 A;  2K04 A;  4B9W A;  4A3M B;  4NLG A;  3KBG A;  1NNX A;  2VQF Q;  1O7Y A;  2F0J A;  4DV6 Q;  1A2U A;  1WTX A;  1UNS A;  1K1S A;  3ICE A;  4EEQ A;  4LFC H;  1EWI A;  1HR0 Q;  3VYS A;  1KDB A;  3J7Y W;  2E2I B;  2RKS A;  2VXW A;  3HEJ A;  4U67 3;  4EBC A;  3KDF A;  2M00 A;  3OMC A;  3C3L A;  2VUM A;  1N34 H;  1UEA B;  5C44 B;  1YJW A;  3FDS A;  5FD6 A;  1F2Y A;  1IBM Q;  2MP1 A;  1X32 A;  1ET6 A;  1O7L A;  1OXT A;  2K28 A;  3NWT A;  5I6Y A;  1ENC A;  4ID6 A;  3JAM E;  5KFA A;  4LWC A;  3DM1 A;  3TME A;  5L1J A;  1XNQ H;  5GAH C;  2L9H A;  4X65 L;  3WWV A;  1VKZ A;  4JI1 Q;  2JA6 H;  3ERO A;  3GV6 A;  1MJE A;  1K1Q A;  1LTL A;  1GVP A;  2RSN A;  3GV8 B;  1D5Z C;  4JI4 Q;  1OXS C;  2EZV A;  4LJZ C;  1EY8 A;  2F03 A;  2YZN A;  5E3F A;  1JR0 D;  1K8M A;  3DLL A;  3RF2 A;  2NZO A;  3KAK A;  1TQO A;  4HID A;  1JJ2 A;  1KC7 A;  4F4Y A;  4YR2 A;  3GQC A;  3K81 C;  2BE5 C;  3FPP A;  1SLJ A;  4FXG C;  4KD4 A;  5IYB H;  4N8F A;  4HIM A;  2O5I C;  2IY5 B;  5KFY A;  5BR8 Q;  4O42 A;  4YY3 H;  2JEB I;  1YNJ C;  2R8G A;  3RB6 A;  3PUV A;  1YVC A;  3VA5 A;  2NU6 B;  3RV4 A;  2CWA A;  4J9Q A;  1MGS A;  4HMJ A;  1B7Y B;  5DAU A;  4Q5V A;  4A3B H;  4NXN H;  2MQH A;  3VR2 A;  1IOW A;  2HQE A;  3SE0 A;  3H3V C;  4FS1 A;  5ELN A;  5IYD H;  2EYL A;  3PUY A;  1CKO A;  4BY7 B;  3N8D A;  2WV6 D;  2WAQ A;  1XMO Q;  4HTH A;  2FPI B;  1KHI A;  4LW1 A;  4GOP B;  1MHW C;  4ME3 A;  3I73 A;  1PH3 A;  1WTV A;  1VQI A;  1Q12 A;  4L6T B;  1AW7 A;  1KBL A;  4IUU A;  1F2M A;  5KNC A;  4JI0 H;  4LF4 Q;  2W57 A;  1KIX A;  3FKI A;  3MWD A;  5CV9 A;  4GKK H;  4N8X 1;  5JVL A;  4JPB W;  5KND A;  3E9H A;  4DV4 H;  1I3Q H;  2B2T C;  1D5M C;  2O4X A;  1VQO A;  2MCT A;  3S1Q H;  2A6H C;  2KCT A;  4DV3 H;  2E74 C;  2HHH Q;  1LV9 A;  4HJ8 A;  1EY4 A;  3M3Y H;  2CH4 W;  2KHI A;  3PCO B;  1SFO H;  2HUG A;  4OWX B;  4I7A A;  4JI5 Q;  3NWS A;  1XNQ L;  1Y1V B;  3H3V I;  1E4E B;  3JAM i;  2ZJT A;  4M1U B;  1I4X A;  1B4O A;  3GTM A;  1SNM A;  1QWY A;  3VYU A;  5JAV A;  2Q8I B;  2KUM A;  1CKM A;  5E4X A;  1WJJ A;  2MFI A;  1U4P A;  1XXG A;  3U9O A;  5KFD A;  2RHS B;  4JI8 H;  4O0A A;  5D65 A;  4X65 Q;  2PQE A;  1EYZ A;  4HIK A;  1FNU A;  1DZ1 A;  4QUC A;  4KKU A;  3A5U A;  2E8G A;  4DK0 A;  1UE1 A;  3NPP A;  4DR4 H;  4IOA A;  2WTF A;  3J80 i;  1VAJ A;  4H13 C;  2HJW A;  3HOU B;  4BY1 H;  4ODG A;  3DHQ A;  5GRO A;  4DV4 L;  1RDP D;  4DR6 H;  4WFN 3;  3CPW A;  2KSW A;  1E24 A;  3T13 A;  2UXC L;  4DUY H;  3KUP A;  5C0X G;  5FLM H;  1FJG H;  2K32 A;  2CW7 A;  3KHH A;  4CJ0 B;  1TWC H;  4A3E B;  3GTK H;  5EBD A;  3HKZ A;  1S0M A;  1KLU D;  4JBW A;  4JI2 H;  2F0H A;  1G6P A;  1K0S A;  2R92 H;  5CAE B;  3CQZ B;  4X66 L;  4O4L F;  1GOZ A;  2XSC A;  4ALP A;  4DU9 A;  4A3B B;  3SK5 A;  4RAZ A;  1ROD A;  2EJG C;  3ZYY X;  1BNZ A;  3I7F A;  2Y0S E;  1EZ6 A;  3IKJ A;  4GLA C;  3TQ1 A;  1JDE A;  5J39 A;  4JI5 L;  4MTK A;  3A56 A;  2E5L L;  4NXM Q;  4LUO A;  3ULJ A;  1M0T A;  4UCU A;  3RAX A;  1RK6 A;  1DON A;  4JI6 L;  2VQE Q;  1ASY A;  2EJM A;  5KT2 A;  5EJW A;  1NMF A;  5L1I A;  2ZXO A;  2JA6 G;  5KFN A;  4FYD A;  5LMN Q;  4RUA A;  2O2L D;  2GN5 A;  2IWH A;  5C4X H;  2RCN A;  4AH6 A;  4C1N K;  5BN5 A;  1ICW A;  2X69 A;  4X64 Q;  4LF7 Q;  1GHK A;  2I8C A;  4UCS A;  3RB0 A;  4FBT A;  1UWV A;  2EQS A;  1JC7 A;  4DV3 L;  4LF7 L;  4K2K A;  1WYD A;  5IY0 A;  5A2Q L;  3N41 B;  4MTE A;  1Y8O B;  1F9Q A;  1ZEQ X;  2NN6 H;  5JVG 3;  2PQA A;  5LL6 b;  3K7A B;  3F8N A;  1HA6 A;  2Z6K C;  3GTQ B;  4R8U B;  3D6W A;  4BY7 G;  5KG7 A;  4K6D A;  4AQY L;  3LGJ A;  4CKE A;  2DZD A;  4DR7 L;  4PDB A;  5BN4 A;  3Q24 A;  2UUB L;  2B63 G;  1KXL A;  4IO9 A;  1S5F D;  3PVX A;  4JI8 Q;  2CFM A;  3PGZ A;  5KFC A;  2XGP A;  1S9F A;  4J9M A;  4XTC S;  1X56 A;  3CCQ A;  3S14 B;  3RB4 A;  1P16 A;  3V6H A;  1SNC A;  2I46 A;  1TAE A;  2K7V A;  3CCM A;  3CW2 C;  1BVS A;  1EYG A;  2IJ0 A;  3NHH A;  4CGY B;  4QUF A;  4JV0 A;  4DNI A;  5FLX E;  2F0I A;  2VPQ A;  3RJ0 A;  2RDG A;  2EVB A;  1KAB A;  2W6Q A;  2P5Z X;  2YYZ A;  2V4D A;  3ERQ A;  3K57 A;  1VQ9 A;  2F0K A;  1I50 A;  3BQ2 A;  1Y14 B;  3NEM A;  4DV1 H;  2JEG A;  2HHH H;  2A6H D;  4MA0 A;  4QW9 A;  3T1H L;  3VPD A;  3I4M G;  2PO4 A;  1DJR D;  1FYC A;  3N40 P;  4RGT A;  1ZXT A;  2UXC H;  4QB4 A;  2WYO A;  2H1E A;  3FKI B;  4NMZ A;  3TS0 A;  4ECZ A;  4K5W A;  4H0L C;  1X3E A;  2EY1 A;  4GKK Q;  1E4E A;  3DWQ A;  3NP8 A;  4DV2 L;  1J6Q A;  3D4W A;  5M5X H;  4UAI A;  1QB5 D;  5D3I B;  1TXY A;  1PZK D;  2IX0 A;  4JI0 Q;  4DUZ H;  1PH2 A;  1VQE A;  2RDJ A;  4IPH A;  4LFB Q;  3PO2 B;  2R92 B;  4O2B F;  4LMY A;  1AN8 A;  2ALZ A;  1Q8I A;  2E2H H;  4F7X A;  2UUC H;  2ICE C;  4DR3 Q;  2A73 B;  5CR3 A;  1CSQ A;  1KQS A;  5EWG A;  3S1N B;  4NXN Q;  2D62 A;  1BXT A;  4KTA A;  2ATL A;  5KYL A;  4HN7 A;  2HDL A;  3GV7 B;  3TN2 A;  3Q0A A;  4DN4 M;  3AQQ A;  4F87 A;  1PLF A;  4XZ3 B;  1XWE A;  1Y1V G;  2AGQ A;  3RUZ A;  3ETH A;  4DV0 H;  5KGU A;  5EKK A;  1C0A A;  4DA2 A;  4HQ6 A;  5IT9 L;  4YQW A;  3UDI A;  1GUS A;  2AQ1 B;  3AU7 A;  1VQJ A;  4HCE A;  3F8T A;  5DM7 3;  4OEL B;  4BBR B;  2JA7 B;  2NN6 I;  1Y1W B;  2F0O A;  3CCR A;  3GTQ H;  2L55 A;  1STB A;  2N3S A;  3ND8 A;  3S1R H;  2XWB B;  2E76 C;  3I56 A;  1STH A;  4K6L A;  4HAE A;  1FNV A;  2CW0 D;  5G3L D;  2IX3 A;  1HNW L;  4KJO A;  3HOZ H;  4MAM A;  3QOJ A;  3HZX A;  4LK1 C;  1LTA D;  2YTV A;  3T56 B;  2MGS A;  4KHP L;  3S14 H;  4AYB G;  3PV0 A;  2G9D A;  5BR8 L;  1Q1B A;  4F4W A;  1D5X C;  1YIJ A;  4OO1 I;  5C4X G;  1IBM H;  2OTL A;  3F1Z A;  1DOL A;  2QIL A;  3URY A;  4A3L H;  1CQF A;  1X3P A;  2AUK A;  1M1K C;  3R2I A;  1N34 Q;  1WCM A;  1IBL L;  2NUC A;  1ENF A;  1O80 A;  5E7N A;  4CDE C;  4YJ3 F;  3I4O A;  2NVX B;  1S03 G;  1PFB A;  3BQ1 A;  1WR2 A;  5KFQ A;  3DF7 A;  4A3M G;  1II3 A;  1DOK A;  1KEE A;  1E3P A;  4V0B A;  4DAY B;  4O2A F;  4DUZ L;  1SNO A;  3A7L A;  4BBS G;  4ED3 A;  2VA2 A;  1AEX A;  1LO5 D;  5M5X B;  4EGQ A;  3P1H A;  3M85 A;  2VZA A;  1JLL B;  1SCU B;  4PG3 A;  4UY8 C;  2R7F A;  2O03 A;  2OT2 A;  3ER0 A;  5DQH A;  3OTO L;  2UUA H;  3J7A K;  3FKI G;  1UEB A;  4IHJ F;  1YHA A;  4RKB A;  2QEX A;  3S1N H;  4IJH A;  2F0T A;  1RF2 D;  2UUC Q;  3ULP A;  2FKL A;  5JEA H;  1B9N A;  1Z2O X;  2FPG B;  2Q2T A;  1O78 A;  1Z6H A;  3CRL C;  3J81 L;  3GIQ A;  1G29 1;  1J5E L;  1IOV A;  1J8I A;  2NU9 B;  3AYH B;  3CXC A;  1PZJ D;  3R23 A;  4LUZ A;  2R86 A;  4NW2 A;  5F9N A;  1I5F A;  3H6M A;  1WCM G;  3HOY H;  5L9X A;  1D1K A;  4O3R A;  4FNF A;  4C3I B;  1WD1 A;  1CA6 A;  4IWY A;  2BQU A;  2NZ1 D;  2K05 A;  3IFD A;  2DWC A;  2VPS A;  4BBR H;  2JA7 H;  3RUP A;  2C28 A;  4Q0F A;  3G6E A;  2RVL A;  3TZD A;  2F4V L;  3O13 A;  4OX9 H;  3FPU B;  4DLK A;  4UP7 A;  1TWC A;  3GIM A;  2Y0S G;  4EFE A;  1Y1V A;  1SXT A;  3H0G H;  3GTJ H;  4HR7 A;  5DQG A;  2L4N A;  3OSP A;  2KEN A;  3IRB A;  4Q8F A;  1B3Q A;  4O3S A;  1U4M A;  3ERS X;  1PXU A;  1PZI D;  3MTS A;  3WO1 A;  1DGS A;  1HQM C;  1NE3 A;  3NQI A;  5I47 A;  2JA9 A;  3HXL A;  3K3P A;  4KKT A;  5C4J H;  2YTX A;  1M4V A;  4YJ2 F;  1LAC A;  1QE6 A;  1SR3 A;  4L5S A;  3KHL A;  4E6I A;  1DOM A;  5LMN W;  3JC6 6;  3B6Y A;  1Q81 C;  1VMP A;  4UP9 A;  3T53 B;  4TQU S;  1B6R A;  4Q8E A;  4FXK C;  3Q6S A;  4PV1 C;  1EQT A;  3VR3 A;  5KG2 A;  1BBU A;  2YS7 A;  1PH9 A;  1N33 Q;  1IKL A;  2F1M A;  3C2P A;  1XMQ H;  1I6H H;  1JQY D;  1NSN S;  2AKW B;  4O4H F;  1EZ8 A;  3G6Y A;  5CV6 A;  2LXJ A;  1LTR D;  3OUZ A;  1VMC A;  3Q1K A;  5GQO A;  1FNW A;  5J1Z A;  1JOO A;  1H9K A;  3TS2 A;  4Y52 H;  4XT3 B;  1V4Y A;  1K28 A;  3G6X A;  3OTO H;  4R9W A;  3D31 A;  3HOW B;  4X64 H;  4PWQ A;  3TII A;  1OWT A;  2R85 A;  5KG1 A;  4A3J B;  3BZK A;  4M9U A;  5LMN H;  3N52 A;  2BDO A;  2VQE H;  5IT9 c;  3IAY A;  1IBK Q;  3L0O A;  1F9S A;  5KIX A;  3E3X A;  3LWU A;  3HOU G;  4MNO A;  4JV5 L;  1KJQ A;  1EOT A;  1OXV A;  3S2D B;  5EWE A;  2RGR A;  2B3G A;  5FLX c;  1UAP A;  5LL6 X;  1U4R A;  4FO2 A;  1VF5 C;  4JI8 L;  5C1P A;  1GUN A;  2PZW A;  1K8O A;  4C3H G;  4XYO A;  2R7M A;  3SK8 A;  4DL6 A;  4UCV A;  1FJG Q;  1IL8 A;  2EJF C;  4MV4 A;  5C5J A;  3I72 A;  2CCZ A;  3HOU H;  4EVO A;  1GUT A;  1Y69 U;  1VBG A;  1TVX A;  4LF8 Q;  1HQR D;  1WD0 A;  2BDN A;  2F52 A;  4B08 A;  1QIL A;  3GTO A;  5H80 A;  3C46 A;  1OXU A;  4G7O C;  1PVO A;  2J0T D;  2W6Z A;  1STN A;  3BS1 A;  3Q22 A;  4IZ8 A;  1GKH A;  3SK6 A;  3OOC A;  3HBL A;  1OTC A;  3BJU A;  4KMU C;  3HOX H;  3GTJ B;  2K52 A;  5A2Q W;  2ZDH A;  4Q43 A;  2E2I A;  4DR2 L;  4A3D B;  1YNN C;  2YTY A;  4J8Q A;  1A3V A;  3FRP B;  1AP0 A;  4GNX C;  4B9X A;  5JJK A;  5KFK A;  4MZ9 A;  3STB C;  2W6N A;  1I4R A;  4ZUJ A;  2F0E A;  2ID0 A;  2B2W C;  1N32 L;  2EPB A;  5JH7 F;  1A8V A;  3PIO A;  4P75 A;  2YU9 H;  3H09 A;  1AFP A;  4C3I G;  3BVG A;  4JI5 H;  2VB3 X;  1CT1 D;  3HP3 A;  3GLK A;  1JWM D;  4ECV A;  1SYG A;  3J7A 5;  4UCR A;  1IZ6 A;  3KJP A;  1BO0 A;  1JWU D;  4L5Q A;  5M5Y B;  1JJG A;  1L2Z A;  1SMY C;  2RA4 A;  4LF6 L;  5C3E G;  1VF7 A;  4LF9 H;  2N55 A;  1ASZ A;  4B3M Q;  4QIW B;  5H1S E;  2LY7 A;  4LH6 A;  1I6H B;  2FJ2 A;  2YZG A;  2R82 A;  3MWM A;  4RKL A;  3K5H A;  4DV4 Q;  4P2C B;  2YZM A;  2J6U A;  3J80 W;  3EJI A;  4GC7 A;  1N48 A;  4JI6 Q;  5DEH A;  3VMM A;  3HOW H;  4OL7 A;  1I7L A;  2W8L A;  1GSO A;  4DV7 H;  4B3T H;  3J81 i;  3V96 A;  3E9I A;  1WVL A;  3S1M B;  2A74 C;  2BCO A;  2PW5 A;  3H0G A;  4YHH Q;  1KAW A;  4L1K A;  1BR9 A;  1GGO A;  3L7Z C;  4IPD A;  1XMO H;  5C5L A;  2J4X A;  4BBS H;  5FLX L;  4X3T A;  1RK5 A;  2KBN A;  1K9M C;  1QUQ B;  3STB D;  1R9T B;  1L0X B;  4A93 B;  4O3O A;  1EOV A;  1Z9F A;  4OX9 L;  3RZO B;  5FPO A;  4YP3 A;  2FMA A;  2ZM6 H;  4QIW E;  4A3I G;  4J9R A;  1TKW B;  3CPF A;  4C3J H;  2WB1 E;  3GII A;  2B39 A;  1CZG A;  1VQL A;  4C2M B;  5ELC A;  4PMC A;  2JEI A;  1SE2 A;  2JA5 B;  4NPS A;  2ZDQ A;  1YNJ D;  1A2T A;  2PMZ E;  1YNX A;  1HNW H;  2K5Q A;  1MSG A;  3PSI A;  4X62 L;  1WI5 A;  3FKI H;  4HMI A;  4B3R L;  2WB1 A;  1KJJ A;  1NJI C;  2OQK A;  1LTG D;  4RGO S;  2VS1 A;  1EQQ A;  4AYB A;  2R92 A;  4GKJ Q;  2BOS A;  3RN5 A;  5AJ3 L;  1HFG A;  4EGV A;  4XYM B;  4L5R C;  5KG0 A;  2JEJ A;  2F0Q A;  5IYC H;  2VNU D;  5EOY A;  3M4I A;  4JI4 H;  2A1A A;  2JEF A;  4DV2 H;  4AYB E;  2K6A A;  2ASB A;  4JC0 A;  1CE8 A;  2QF7 A;  4RH6 A;  5CYU A;  4I55 F;  5E1F A;  3V2T A;  4JI1 H;  2JA5 A;  3MXN A;  4QL5 A;  2SEB D;  2YV5 A;  2Q2U A;  1EY6 A;  1KDC A;  5IP7 H;  3KHG A;  2K4K A;  2R7Z B;  3KAJ A;  1PTO H;  2NVY A;  4XQQ A;  3MR5 A;  2UU9 L;  1Y8N B;  3UE1 A;  1SEI A;  4BS9 A;  4RZQ A;  5CB4 F;  5KFG A;  4RUC A;  4GKJ H;  1V1P A;  2KVM A;  1G8Z D;  2AUJ D;  3OWE B;  1KJ8 A;  4QWA A;  1H9S B;  2B2Y A;  1G6Z A;  1HR0 H;  4TKO B;  3QZ8 A;  2NTT A;  1PH7 A;  3SE7 A;  4QWC A;  4ZKC B;  4LFC Q;  2E2I H;  3BA9 A;  3HOZ G;  1LT6 D;  2DJG C;  4DK3 C;  1UE5 A;  4RGN A;  4J9N A;  1HNW Q;  4MHE A;  3TIG A;  2V4Q A;  4J9O A;  3EVQ A;  5FOB B;  1B2T A;  5KFM A;  2C00 A;  1TT2 A;  1ESR A;  1ILQ A;  5C5M A;  4MV7 A;  2WAQ G;  4R4C A;  1JE5 A;  4R1J A;  3SXH A;  3PO2 G;  4ABN A;  1HNZ Q;  3ETJ A;  2B2V A;  1Q82 C;  5D1P A;  2XWJ B;  5HGT A;  4JBJ A;  3OSO A;  1AN7 A;  1CZW A;  5AJ3 Q;  4B3T Q;  1YEZ A;  1B9M A;  1SAP A;  1DYQ A;  3I4N H;  2JA8 H;  1M6V A;  5KKN B;  5C3E H;  3NEN A;  2JA5 G;  1ONL A;  3Q8R B;  1D2B A;  5M3M H;  2JA5 H;  2BH2 A;  3L3O C;  2IT1 A;  5KFW A;  2SNS A;  1KNE A;  1EU3 A;  2XD4 A;  5D8D A;  4L5T A;  1CM9 A;  4B3M H;  1MD2 D;  2WAC A;  2UVR A;  1AZQ A;  1XPO A;  1N32 H;  1Q1E A;  5JJZ A;  3CCE A;  1TWA A;  2D5D A;  3RFC A;  5DG8 A;  1KTK A;  2XRS D;  4R8N A;  2R7Z A;  5IOD A;  1T5E A;  2A69 D;  2M2L A;  1VBH A;  5FJ8 H;  1XTC D;  1E22 A;  3PO3 G;  1EL0 A;  4JI7 L;  1T9H A;  1SJE D;  1TS2 A;  4A76 A;  2XIW A;  3G71 A;  3CMA A;  3VR6 A;  1S4Z A;  1EYC A;  2A19 A;  4I7Z C;  4TVA B;  3UI2 A;  3S9W A;  1HUN A;  4BY7 H;  4AQY Q;  1QVG A;  2GPW A;  4R4I A;  2CH4 A;  2YW2 A;  1V1O A;  1JOQ A;  3I8Z A;  3GID A;  3MFG A;  3T1H Q;  4MV8 A;  2R8I A;  1UE7 A;  1X6O A;  2PMZ B;  1PRT C;  4A3C G;  2Z1C A;  2R7Z H;  5EWF A;  3OW7 A;  2K5N A;  1MKH A;  5DNF A;  3OUU A;  4J9P A;  1STY A;  1EU4 A;  1LTB D;  4TV8 F;  5COY A;  2YCH A;  1HR0 L;  1PH4 A;  3AMU A;  4C3H H;  5KG5 A;  1Q7Y C;  3MJF A;  4JI2 L;  5LP6 F;  2QDL A;  3RB3 A;  5CA0 F;  1VQG A;  4LF8 H;  2A68 C;  2O5J C;  3H40 A;  4RHS A;  3KF8 B;  5D1O A;  1Z7T A;  5IP7 G;  4FBU A;  4I50 F;  2M05 A;  1MIU A;  3GTM B;  1SYX B;  3PR5 B;  3J81 c;  3H94 A;  4CBV A;  4RB3 C;  3A8J E;  3WOE A;  2LS0 1;  2RDI A;  4J15 A;  2FP4 B;  3SDZ A;  4QF4 A;  1HA5 A;  1I4Q A;  3BG5 A;  3MWE A;  4HJ7 A;  4X3U A;  5KT4 A;  1L0W A;  2UU9 H;  1U0L A;  3RGX A;  5CV4 A;  2NN6 G;  2UVU A;  2FFK B;  3NSW A;  3RTX A;  3PIP 3;  2Y0S B;  1V8Q A;  4GKJ L;  5BN3 A;  1RTO A;  2PPB C;  2LMC B;  5A2Q E;  1IBK H;  3H4B A;  3VA7 A;  2NTS A;  1T36 A;  5KFU A;  4M8A A;  2ZJP A;  3PUX A;  4NXN L;  3CHB D;  2SNM A;  3M7G A;  3U9S A;  3WDN A;  2HCI A;  3HB9 A;  2HVR A;  1W2B A;  2NBF A;  4G3I A;  4DUY L;  4C5C A;  4UP8 A;  1GO3 E;  4GOP A;  1FJG L;  4A3K G;  1D7Q A;  2YU9 A;  5D14 A;  1XMQ Q;  1H95 A;  5C4H A;  4BWG B;  2VR1 A;  4O3P A;  1HUM A;  3L4J A;  1KRT A;  2AGO A;  1YNN D;  4G57 A;  2P0A A;  4YB8 B;  1NY4 A;  2I5H A;  4LFA L;  1TWC B;  3CVZ A; 
#chains in the Genus database with same CATH homology
 5LMU L;  1N36 L;  3D0F A;  1B8A A;  3I2Z A;  3Q8D A;  3JAM c;  3I56 A;  1CKN A;  3CCS A;  5IYD G;  1YI2 A;  1XMQ L;  1VQ6 A;  4R4O A;  4B3S L;  1HNW L;  4QGU A;  1PH1 A;  2AWN A;  4A3J H;  4OON A;  4GNX A;  3HOZ H;  4H02 A;  1L1O C;  4XIG S;  1KD1 C;  1E1O A;  2YTV A;  1HZB A;  4KHP L;  1K8A C;  1IBL Q;  3S15 H;  4AYB G;  3PV0 A;  2K75 A;  3H0G G;  3S14 H;  2K14 A;  1O7I A;  1Q1B A;  2AWO A;  5BR8 L;  4KHZ A;  1YZ6 A;  3KFU A;  2D0P A;  2BH8 A;  1BBW A;  2PQA B;  1YIJ A;  1LUZ A;  4OO1 I;  5C4X G;  2JK8 A;  2OTL A;  1E1T A;  3F1Z A;  1EIF A;  2R7Z G;  4A3L H;  1M1K C;  4UPA A;  1N34 Q;  2LXK A;  4HJ9 A;  1IBL L;  2K5V A;  3J80 c;  4OWT B;  1Q86 C;  5JJL A;  1B70 B;  3HKS A;  3K0X A;  5E7N A;  1YHQ A;  2PNH A;  3I4O A;  1X9N A;  4JG2 A;  2VY3 A;  1RIP A;  2JQO A;  4LF5 Q;  3S16 H;  4P73 A;  4A3M H;  3TRZ A;  3U4V A;  4JOI C;  4A3M G;  3U58 A;  2IHE A;  1E3P A;  4DAY B;  2A8V A;  1FL0 A;  4DUZ L;  4X66 Q;  3F2C A;  1EIY B;  1XJV A;  4BBS G;  2ZTE A;  1KL9 A;  2IHF A;  3GTM H;  4GN4 B;  3ULL A;  2UXD Q;  1QZH A;  3A74 A;  3M85 A;  1LM0 A;  5IP9 H;  3J81 j;  2VZA A;  3U4Z A;  4PG3 A;  3DM3 A;  4UY8 C;  2R7F A;  1SN8 A;  3T1Y Q;  3ER0 A;  5GAE C;  3F2D A;  3TQY A;  3OTO L;  3I4M H;  3KDF B;  3RR5 A;  3FKI G;  1UEB A;  4B3M L;  4A3E G;  1U5K A;  4KHP Q;  1YHA A;  1XTD A;  4IFD I;  3G4S A;  2QEX A;  3S1N H;  1I50 H;  2AMC B;  1V43 A;  3GTL H;  4IJH A;  3HKZ G;  2UUC Q;  3ULP A;  4A3C H;  2UU9 Q;  4LF4 L;  3KLW A;  2VUM G;  3K8A A;  3OTO Q;  3EIV A;  1S3O A;  2Q2T A;  5FJ8 G;  3PO3 H;  4HJA A;  1QZG A;  4DV6 L;  1G29 1;  1J5E L;  5IWA Q;  4GN5 A;  3BU2 A;  4EX5 A;  3AYH B;  3CXC A;  4LUZ A;  4DV0 L;  1Z47 A;  3HOV H;  4LFB L;  3EN2 A;  1VS0 A;  1Q8K A;  1FGU A;  2FXQ A;  1I5F A;  1WCM G;  3MXN B;  3HOY H;  1HNX L;  4APV A;  4JI7 Q;  4IPC A;  4DUY Q;  1N9W A;  2K50 A;  4BBR H;  2JA7 H;  4O2D A;  3CC7 A;  4IOC A;  4IPG A;  3G6E A;  5JEA J;  2VUM H;  5JEA G;  5C44 H;  2F4V L;  5FLM G;  4WJ3 M;  4IJL A;  5EAY A;  3PF4 A;  4UP7 A;  3I4N G;  2Y0S G;  1Q46 A;  3H0G H;  3GTJ H;  3UE0 A;  4FDB A;  4DR4 Q;  5IYB G;  2EXD A;  2KEN A;  3IRB A;  5IE8 A;  2N78 A;  4GOP C;  3F2B A;  2CWP A;  4DAM A;  1MJC A;  1SMX A;  3ERS X;  1S40 A;  5HY6 A;  1PH8 A;  1DGS A;  2QGQ A;  3CF5 A;  4YWM A;  1SE8 A;  1NE3 A;  4YY3 L;  2JA8 G;  2JA9 A;  4YWL A;  5C4J H;  2YTX A;  3PF5 A;  1R9T H;  1JMC A;  1LYL A;  4EQ5 A;  2UXD L;  2F3I A;  4NXM L;  1SR3 A;  4A93 H;  4OX9 Q;  4JBM A;  4L5S A;  4QJF A;  1N33 L;  5LMN W;  4AIM A;  5M5W H;  3JC6 6;  1EQR A;  3B6Y A;  2IX1 A;  1Q81 C;  1TWG H;  4UP9 A;  4TQU S;  4LNQ A;  4DV2 Q;  1SRO A;  2GVB A;  2Z6K A;  4BXX H;  3HOV G;  1AH9 A;  2VL6 A;  1UE6 A;  2GVA A;  2ZM6 L;  2N8N A;  2HQL A;  1BBU A;  2UUB Q;  1VQK A;  1PH9 A;  4OO1 G;  2JE6 I;  1N33 Q;  1N32 Q;  2D0O A;  1X3F A;  5M3M G;  1I6H H;  4JI1 L;  2ATW A;  2AKW B;  1Y1W H;  4QY7 A;  2LXJ A;  4DV3 Q;  4A3L G;  5GQO A;  3TS2 A;  2XTI A;  4Y52 H;  4DV1 L;  1VQF A;  1HJP A;  3CCL A;  4A3K H;  4IFD J;  3D31 A;  1X65 A;  2OTJ A;  4LF9 L;  1J5E Q;  2NVQ H;  3BZK A;  3RLF A;  2C35 B;  2H5X A;  4B3T L;  3KJO A;  2MO0 A;  1TWA H;  5IT9 c;  2RF4 A;  3M9B A;  1IBK Q;  4BA2 I;  3L0O A;  4YCU A;  3HOU G;  4MNO A;  2UUA Q;  4JV5 L;  1NMG A;  4MTN A;  1Y1W G;  1C7Y A;  4BBR G;  1OXV A;  1VQ5 A;  2JA7 G;  2R92 G;  1SRU A;  4YWK A;  2NVY H;  3M7N A;  4JBK A;  2B3G A;  4LFA Q;  1OXX K;  5GAG C;  1WCM H;  3HOY G;  5FLX c;  1X3G A;  2BA1 A;  4JI8 L;  1IXR A;  4PZ8 A;  4YHH L;  3K7U C;  1NTG A;  4A3G G;  1K0R A;  4YCW A;  1FJG Q;  4K0K Q;  2VQF Q;  2UXB L;  2AHO B;  4DV6 Q;  2CCZ A;  3HOU H;  4YY3 Q;  3ICE A;  1EWI A;  4LF8 Q;  2F52 A;  1IL2 A;  1HR0 Q;  1PFS A;  3KF6 B;  1PHJ A;  2UXC Q;  4DK6 C;  4HJ5 A;  4JOI A;  1OXU A;  3TRE A;  4DR1 L;  4LF9 Q;  3AEV A;  2V1C C;  3KDF A;  1PVO A;  1JB7 A;  4DR6 L;  2DGY A;  1YJW A;  1HZ9 A;  4DV1 Q;  1GKH A;  4DV7 L;  1OTC A;  4OWW B;  3BJU A;  1IBM Q;  3J7Z C;  3HOX H;  2K52 A;  1Y1V H;  1OXT A;  2Q2H A;  3KYH C;  5LMN L;  4DR2 L;  3W1G A;  5IP9 G;  4LWC A;  2YTY A;  3CCU A;  1A62 A;  5GAH C;  4GNX C;  5JJK A;  2Z0S A;  4X65 L;  4MZ9 A;  3WWV A;  4JI1 Q;  2JA6 H;  3STB C;  2R93 H;  3UDG A;  2ID0 A;  1MJE A;  1N32 L;  1YBY A;  3SGI A;  1LTL A;  2L15 A;  4BA1 I;  1GVP A;  1A8V A;  3PIO A;  4P75 A;  1VQP A;  4JI0 L;  2YU9 H;  4DR7 Q;  3S2H H;  1XNQ Q;  1VQ4 A;  5DLQ E;  4JI4 Q;  1OXS C;  2R93 G;  2I5M X;  2Q2I A;  3KOJ A;  1XPU A;  5M3F G;  2OQ0 A;  3OW2 A;  3J7A 5;  3GTG H;  1IZ6 A;  3RZD H;  3KJP A;  1WFQ A;  4L5Q A;  2VW9 A;  3DLL A;  1JJG A;  3CC2 A;  4LF6 L;  2NZO A;  5C3E G;  1ASZ A;  3UDF A;  4B3M Q;  5H1S E;  3E0E A;  1TWH H;  2N49 A;  4HID A;  1JJ2 A;  2NVT H;  3K81 C;  3CC4 A;  1HH2 P;  5IYB H;  4DV4 Q;  1SLJ A;  4DR4 L;  3PUW A;  4A3E H;  1VCI A;  4HIM A;  4A3I H;  2IY5 B;  3NBH B;  5BR8 Q;  2JEB I;  3KF6 A;  4JI6 Q;  1VQH A;  3PUV A;  4JYA L;  2MO1 A;  2WAQ E;  3HOW H;  1EUJ A;  1YVC A;  3CQZ H;  4PZ6 A;  2CWA A;  3PUZ A;  4DR3 L;  2E5L Q;  4X6A H;  1B7Y B;  3J81 i;  3FP9 A;  1PH5 A;  4A3B H;  2UXB Q;  2MQH A;  3E9I A;  1VQM A;  4GN3 B;  4DR5 Q;  3MEF A;  5ELN A;  4YHH Q;  1KAW A;  3PUY A;  1CKO A;  5IYD H;  2JEA I;  3L7Z C;  4IPD A;  1XMO Q;  1HZC A;  4BBS H;  2KBN A;  1KHI A;  2VNU D;  1K9M C;  1QUQ B;  4LW1 A;  1A0I A;  3STB D;  4GOP B;  1I94 L;  4ME3 A;  1VQN A;  3S2D H;  1PH3 A;  1VQI A;  1Q12 A;  1EOV A;  1Z9F A;  1AE2 A;  3TEH B;  2WP8 J;  5C0X J;  4OX9 L;  3S17 H;  4QIW E;  4A3I G;  3CPF A;  4C3J H;  3H15 A;  4HIO A;  2PI2 A;  2WB1 E;  4LF4 Q;  1VQL A;  1KIX A;  4YCV A;  4JI2 Q;  2CQO A;  4LFC L;  4NPS A;  3CAM A;  2PMZ E;  1YNX A;  3E9H A;  1I3Q H;  1YHB A;  4GS3 A;  1N34 L;  3CME A;  3PSI A;  4X62 L;  2UUC L;  2HIV A;  1WI5 A;  2XGT A;  2WB1 G;  3FKI H;  1VQO A;  4RG1 A;  1N8R C;  1XNR L;  4B3R L;  3S1Q H;  2KCT A;  3K7A H;  4P72 A;  3RNU A;  4DR6 Q;  4JCV E;  1NJI C;  4A4I A;  4A3G H;  3L2P A;  3PIP A;  2HHH Q;  2OQK A;  4B3R Q;  3GTP H;  2VS1 A;  4HJ8 A;  1EQQ A;  1V1Q A;  3A0J A;  1P8L A;  3M3Y H;  2KHI A;  3PCO B;  4GKJ Q;  1SFO H;  3RN5 A;  5AJ3 L;  5C44 G;  4OWX B;  4LF8 L;  1TWF H;  4L5R C;  3T1Y L;  1FVI A;  1GM5 A;  5IYC H;  1HZA A;  2ZTD A;  3G48 A;  4JI5 Q;  2A1A A;  2EIF A;  1X55 A;  2HIX A;  3M4P A;  1CUK A;  2VQF L;  1HNZ L;  2ALY B;  2MNA A;  1XNQ L;  3H3V I;  3JAM i;  4AYB E;  1L1O A;  1PA6 A;  4WJ4 A;  2ASB A;  4JC0 A;  2OWO A;  4A3D H;  4JI3 Q;  1N36 Q;  5C0X I;  2KHJ A;  2B63 H;  4QQB X;  2K5H A;  5M3F H;  1CKM A;  1WJJ A;  4QL5 A;  2MFI A;  3AFQ A;  3HOW G;  1XMO L;  2RHS B;  2YV5 A;  2Q2U A;  4O0A A;  5IP7 H;  2K4K A;  3W1B A;  1V9P A;  3RN2 A;  1G51 A;  4KI0 A;  4X65 Q;  4HIK A;  4JYA Q;  2QA4 A;  2UU9 L;  3UE1 A;  4LF5 L;  3UDX A;  1PH6 A;  3A5U A;  2E8G A;  4POG A;  1IBK L;  1RL2 A;  1UE1 A;  1K73 C;  4PZ7 A;  1XNR Q;  4IOA A;  3CP0 A;  3J80 i;  3ZJY C;  3CCV A;  1JT8 A;  4BY1 H;  3GDE A;  5GRO A;  2HHH L;  4DV4 L;  3CPW A;  2ZTC A;  1PH7 A;  1PV4 A;  1E24 A;  2R6G A;  4LFC Q;  2E2I H;  2UXC L;  3HOZ G;  4DK3 C;  5C0X G;  1UE5 A;  5FLM H;  2F4V Q;  1HNW Q;  3CCR A;  4LF6 Q;  1TWC H;  3GTK H;  4BY1 G;  1VQC A;  3GD7 A;  4JBW A;  1X54 A;  1G6P A;  3PO2 H;  1IYJ B;  2R92 H;  3GO5 A;  1HNX Q;  4X66 L;  1QVF A;  4ALP A;  2WAQ G;  4Y7N H;  3I7F A;  4P74 A;  4KLK A;  1JE5 A;  2Y0S E;  4R4C A;  4R1J A;  4DPG A;  3PO2 G;  4GLA C;  3HOX G;  1HNZ Q;  4DV5 L;  1L2F A;  1Q82 C;  1HR0 W;  4DR2 Q;  1QVC A;  4JI5 L;  1PYS B;  2E5L L;  4LUO A;  3ULJ A;  4NXM Q;  1VQD A;  4JBJ A;  4DR5 L;  1D8L A;  4A3F H;  1E7Z A;  5AJ3 Q;  1XPR A;  4JI6 L;  2VQE Q;  1ASY A;  3H3V H;  5JJI A;  4B3T Q;  1YEZ A;  1NMF A;  2E2J H;  3I4N H;  3RZO H;  2JA6 G;  2JA8 H;  5LMN Q;  5C3E H;  2GN5 A;  5C4X H;  3NEN A;  2RCN A;  4AH6 A;  4X64 Q;  1VQ7 A;  2JA5 G;  4LF7 Q;  5M3M H;  4LUV A;  1EFW A;  1UWV A;  2EQS A;  5M5Y H;  4DV3 L;  2JA5 H;  2OCE A;  5IY0 A;  1WYD A;  4LF7 L;  2BH2 A;  2IT1 A;  2PI2 E;  4L5T A;  1GD7 A;  4IFD G;  2PQA A;  1XPO A;  1Q1E A;  3CCE A;  3VDY A;  2Z6K C;  1NBW A;  4DV5 Q;  4BY7 G;  4AQY L;  5FJ8 H;  3LGJ A;  1E22 A;  3PO3 G;  4DR7 L;  4JI7 L;  1T9H A;  2UUB L;  4A76 A;  2B63 G;  3G71 A;  1KXL A;  3CMA A;  4IO9 A;  4JI3 L;  4JI8 Q;  2CFM A;  1YJN A;  1VQA A;  1KC8 C;  5HGQ A;  1L1O B;  1YIT A;  3S1M H;  2A19 A;  2KCM A;  3PGZ A;  4NB3 A;  4TVA B;  3S24 A;  4XTC S;  1X56 A;  3CCQ A;  4AQY Q;  1QVG A;  1P16 A;  4BY7 H;  4R4I A;  5IYC G;  4PMW A;  3CCM A;  3CW2 C;  1BVS A;  1EYG A;  3M4O H;  1AE3 A;  4DNI A;  5GAD C;  3T1H Q;  1WOC A;  1UE7 A;  1PYB A;  1X6O A;  4JV5 Q;  4A3C G;  2R7Z H;  2K5N A;  1MKH A;  2YYZ A;  4P71 A;  4DKA C;  1VQ9 A;  2ES2 A;  2NVX H;  4C2M H;  1Y14 B;  3NEM A;  4RMF A;  5J3B A;  1HR0 L;  1KRS A;  4X64 L;  1PH4 A;  1M90 C;  3T1H L;  3I4M G;  4DR1 Q;  4C3H H;  1Q7Y C;  1C9O A;  4JI2 L;  3TS0 A;  4GNX B;  4K0K L;  4A3J G;  3RLN A;  1VQG A;  2DUD A;  1VQB A;  2HT1 A;  5K36 G;  1X3E A;  3AFP A;  3CD6 A;  3FHW A;  4GKK Q;  2B29 A;  3KF8 B;  1CKN B;  5IP7 G;  4JI4 L;  1MIU A;  5LMU Q;  4DV2 L;  1J6Q A;  3EBE A;  4A93 G;  5M5X H;  1I94 Q;  4JI0 Q;  1TXY A;  2IX0 A;  3J81 c;  2ZM6 Q;  1K8G A;  5IWA L;  1PH2 A;  4A3D G;  1VQE A;  4J15 A;  3RLO A;  2CKZ B;  4IPH A;  4DV0 Q;  3W5O A;  4GKK L;  4LFB Q;  3BZC A;  3K80 C;  4R4T A;  5ELO A;  4HJ7 A;  1K3R A;  3A5Z B;  3HFZ B;  1L0W A;  3U50 C;  2E2H H;  2UUA L;  3GTO H;  4A3B G;  1U0L A;  4OXP A;  3HKZ E;  4DR3 Q;  2NN6 G;  4A75 A;  1CSQ A;  1W3S A;  1KQS A;  4NXN Q;  3I55 A;  1IBM L;  4GKJ L;  1JJC B;  2BA0 A;  2D62 A;  3M4Q A;  4DV7 Q;  2RHQ B;  3OYY A;  2NZH A;  2JJQ A;  1K83 H;  1CSP A;  2WFW A;  4R4Q A;  3CCJ A;  1YJ9 A;  2ZJR A;  3AQQ A;  1BKB A;  4BXX G;  4X62 Q;  2ZJP A;  2I0Q A;  3PUX A;  4NXN L;  1Y1V G;  4GLX A;  4A3F G;  1QUQ A;  2I5L X;  1W2B A;  1C0A A;  2R7D A;  4DUY L;  4UP8 A;  1GO3 E;  2VQE L;  4GOP A;  1FJG L;  4B3S Q;  4A3K G;  3UDI A;  2ZJQ A;  1D7Q A;  4DUZ Q;  2LSS A;  1VQJ A;  4C3I H;  1XMQ Q;  1A63 A;  1H95 A;  3F8T A;  4GLV B;  4POF A;  3NEL A;  1KRT A;  2NN6 I;  1VQ8 A;  1NY4 A;  2I5H A;  3GTQ H;  4LFA L;  1S72 A;  2N3S A;  3S1R H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...