3AYHB

Crystal structure of the c17/25 subcomplex from s. pombe rna polymerase iii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
203
structure length
183
Chain Sequence
b'MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWKIEGEDGSEGTELYFDIDEEIRFQIESEDFVDVSPYTLIASCSRDGLGIPAWWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase III subunit rpc9
publication title Crystal structure of the C17/25 subcomplex from Schizosaccharomyces pombe RNA polymerase III
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 40
structure length 183
sequence length 203
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
B PF08292 RNA_pol_Rbc25 RNA polymerase III subunit Rpc25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ayhB02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3ayhB01
1JJCB 1EFWA 1SE8A 2PQAA 4JI2Q 1BBWA 3PSIA 2R7DA 3ULJA 1VQJA 2CCZA 4JI8L 3OYYA 5M5XH 4P73A 1Q82C 1Q46A 3D0FA 3KJOA 3KF6B 4IO9A 2A1AA 1UE7A 3HKSA 1JJGA 2ZM6L 4KHPL 1YHQA 3S15H 4JBWA 4WJ3M 1R9TH 1PH8A 2JA8H 3RZDH 2HIXA 2L15A 5IYDG 1NJIC 1WFQA 2CQOA 1A0IA 2H5XA 5C3EG 2A8VA 1MKHA 1WOCA 2N8NA 5IT9c 3TQYA 4A3JH 2E5LQ 3UE0A 1SRUA 3GTKH 3I4NG 1O7IA 3K7AH 5M3FG 1S40A 1K0RA 1XMOL 1PYSB 2JA9A 5IE8A 5C44H 3G6EA 2E2JH 1N36Q 1PH1A 3CCRA 2K75A 2ZJQA 4YHHL 2R92H 2N78A 3B6YA 4JBKA 2ATWA 1NMFA 1VQFA 3DLLA 1GKHA 2KENA 2JA7H 5IYCH 5IP9H 4AYBE 1CKNA 4DR6L 1TWGH 1AE3A 3CC7A 1VQAA 1YJ9A 5C4XH 2VW9A 2NVXH 4DKAC 2CWAA 1HNZL 5C0XI 1BVSA 3W1BA 4JI6L 3CPFA 4DAMA 4IOCA 1H95A 4IPCA 1X54A 2VZAA 3Q8DA 1KD1C 3CC4A 2DGYA 4DV2L 3CP0A 2K4KA 1G291 3AFPA 4DR2Q 2VS1A 3ER0A 3F2BA 4X64L 4DR4Q 1LTLA 2A19A 2VQEL 4XTCS 3PUYA 1E24A 2JEAI 1HZAA 1XPOA 1FL0A 2ZJPA 3UDXA 3CMEA 1Y1WH 1IBKQ 3A74A 3CXCA 3FP9A 3KF6A 3PUWA 1OXTA 4JBMA 3AFQA 3FKIH 1VQ7A 4EX5A 4DR5L 2F3IA 4R4CA 1HR0L 4OO1G 4QQBX 4IFDG 1JE5A 2ZTDA 3U50C 4HJ7A 1G51A 1P16A 4GKJQ 4B3MQ 1QVGA 4K0KQ 3TRZA 5J3BA 1NY4A 3RN5A 2NN6I 1WI5A 2YTXA 1C9OA 2UUCL 3TS2A 3U58A 4X65L 3BU2A 4MTNA 3KOJA 1XNRL 3CCQA 4X66Q 3ZJYC 3GD7A 3CCSA 2OTJA 1IBLQ 3PGZA 5ELNA 4C3HH 4YCUA 1K73C 3PV0A 1M1KC 2AMCB 1Z47A 2BA0A 1UE6A 4GLAC 1XNQQ 2OCEA 5LMUL 1HZBA 4JV5L 1KHIA 1PH7A 5GQOA 1J5EQ 4NXML 1OXUA 3CF5A 5HGQA 1BKBA 1SROA 4DV4Q 3UDGA 1XPRA 1JB7A 4A3DG 1LM0A 2JA8G 4J15A 3PUXA 4HJ9A 4PG3A 3PO3H 1VS0A 4DR3Q 4HIMA 4DV1L 4L5SA 3H3VI 3S1MH 2IHEA 1XMQL 2GVBA 3UDFA 4A3JG 5JJLA 2UUAQ 2K5HA 2XGTA 3AQQA 2AWOA 4LUZA 4R4TA 1IZ6A 2YTYA 1Q1BA 3CCMA 2E2HH 3T1HL 2R92G 4A3KG 4HIKA 4A3MH 3S24A 4NXNL 4GN3B 2V1CC 3WWVA 1VQOA 1VQLA 2JA7G 1D7QA 5IY0A 3A5ZB 4FDBA 2VQFL 2B63H 3F8TA 3HOXH 5AJ3Q 4Y52H 1K83H 3M4OH 1IBMQ 5IYBH 5JJKA 3KFUA 1N9WA 1VQDA 1YITA 3JAMc 2JE6I 4ALPA 4A3EG 4B3RL 2HT1A 3I4MG 4BA2I 2FXQA 2ZTEA 1JT8A 2LXKA 4JI1Q 1N33L 4BA1I 1CKOA 4TQUS 1UE1A 2B3GA 3I2ZA 1V1QA 1I94L 1HZ9A 2WAQG 4MZ9A 3ERSX 3F2DA 1A8VA 2EXDA 4YWLA 4DV6Q 3CC2A 4OWXB 1PH9A 1Y1VG 1Y1WG 4LNQA 5FLMH 1QUQB 5LMNL 3HOZG 2Z6KA 4DR1Q 3T1YL 2Q2UA 4B3TQ 2JQOA 3I55A 1K9MC 1XPUA 3PUZA 3I56A 1E1TA 3EBEA 1PFSA 1WCMH 4DV3L 2WB1G 1VQ4A 4LFBQ 4LF8Q 2AHOB 2HIVA 4YY3L 4L5TA 3SGIA 4LF5Q 4JI3L 3UDIA 2I5MX 2UU9L 1EQQA 1W3SA 1VCIA 3ULPA 3CW2C 2EQSA 2WAQE 4JI5Q 1JJ2A 3GTGH 1C0AA 3D31A 4A3DH 1EYGA 1AE2A 3K8AA 4R1JA 3BZCA 1X3FA 3S17H 2LSSA 1OXVA 2R6GA 1E22A 4DUZQ 3M9BA 2I0QA 4LF4L 2UXDQ 3E0EA 1DGSA 1HNWL 4C3IH 2KCMA 3J81c 3CPWA 4YWMA 3J80c 3KYHC 4H02A 4RG1A 4A3KH 2WB1E 1A63A 2CFMA 3PO3G 5C0XG 3OTOL 1A62A 2RHSB 4OX9Q 2F4VQ 2NZOA 1Q81C 2HQLA 4LF9Q 2UUBQ 4JOIC 4DPGA 1PHJA 3PIPA 3HKZG 4ME3A 1QUQA 4GOPC 4PZ7A 4JI7Q 3OW2A 1L1OC 3EIVA 4A75A 2AWNA 4A3EH 4A3MG 1FJGQ 1FGUA 3NENA 4YCWA 2R7ZG 4GKJL 4P74A 3I4MH 1K3RA 3GO5A 1CSQA 4WJ4A 3S14H 2DUDA 4P71A 2B63G 3IRBA 3HFZB 4OWTB 3HOXG 1HNXL 4JI4Q 1N32Q 1ASZA 2MNAA 3AYHB 1WYDA 2OWOA 4B3SQ 5H1SE 3CCVA 5IYBG 3CCLA 2Q2HA 4GN4B 2WFWA 4JI8Q 1Y1VH 4GLXA 3K80C 3I7FA 1JMCA 4POFA 1YEZA 1XNQL 4A4IA 4LF6L 5JEAG 1B8AA 2I5HA 1V9PA 3RLOA 3NEMA 2NVQH 4LFAQ 3PF4A 3A0JA 3HOYG 3J81j 3RN2A 4R4IA 3CCEA 1Z9FA 4DV4L 5DLQE 5FLMG 3CD6A 1KRTA 1I5FA 1KC8C 4APVA 4DR3L 2KHJA 4DUYL 1KL9A 1XMOQ 1IYJB 1YZ6A 4OXPA 4X62L 2QA4A 3HOVG 1PYBA 3E9IA 1Q7YC 4LUVA 4YHHQ 3CCUA 1CUKA 1PH5A 4GNXC 2LXJA 1N34Q 2IX1A 1PA6A 3M4QA 4DAYB 1TWAH 1WCMG 4HJAA 2KCTA 3RLFA 1GM5A 4GN5A 5FJ8G 1EIYB 4POGA 2BH2A 2UXBL 2VNUD 2BH8A 1NMGA 4A3BH 4A93H 2MO1A 4GKKL 1CSPA 3PIOA 4JOIA 3U4ZA 4JI6Q 1U0LA 5AJ3L 4IJHA 4DR7Q 4GOPA 4JCVE 1U5KA 4DV0L 5GROA 3L2PA 1L1OA 4KHPQ 4YWKA 4DV2Q 4LWCA 1VQKA 3EN2A 3ICEA 5M3MG 4UP8A 5BR8L 1VQ9A 3K0XA 3F1ZA 3TEHB 1UWVA 2VQEQ 3KLWA 3AEVA 3H15A 1S3OA 3RLNA 4JI1L 4JI0Q 1SMXA 1VQNA 4C2MH 2K5VA 4IOAA 4A76A 4O2DA 1BBUA 2R7ZH 3L7ZC 1NBWA 4DV6L 4C3JH 3GTMH 4JYAQ 2IY5B 1HR0Q 1TWFH 4DR1L 1VQPA 1W2BA 4MNOA 1Q86C 4B3TL 1KQSA 4LF7Q 1IXRA 1HH2P 1NTGA 4AQYL 2ALYB 4UP9A 2VL6A 3UE1A 2HHHL 2K14A 5IWAQ 4L5RC 2D62A 2IT1A 2VY3A 1D8LA 4X65Q 1N8RC 4JI2L 1XNRQ 1LYLA 2KHIA 3GTOH 2AKWB 4LF5L 1T9HA 1V43A 3F2CA 4JG2A 2ZJRA 1AH9A 2PI2E 3HOYH 4BXXG 2R7FA 1VQBA 4JI5L 4A3LH 4PZ6A 3GDEA 3NBHB 4PMWA 4AH6A 5LMUQ 4IPHA 2JJQA 4R4OA 3S1RH 4JV5Q 4NXMQ 2N3SA 2Q2IA 1TWCH 4BY7G 1OXXK 3PO2G 2E5LL 3HOVH 1XJVA 2OTLA 4DV7Q 1OTCA 1YHBA 4AIMA 4IFDJ 3G71A 1N36L 3M3YH 1XMQQ 5FJ8H 3ULLA 4GLVB 1G6PA 4HIDA 4A3FG 4OX9L 3W5OA 4QY7A 2PMZE 4DV5Q 4LF9L 1K8AC 1E3PA 4KLKA 1VQ5A 3H3VH 3LGJA 2GVAA 4BBRG 1VQMA 1HR0W 2CWPA 1EWIA 3BJUA 4JI7L 1PVOA 1QZHA 2PNHA 2N49A 2KBNA 5M3MH 4A3BG 4HJ8A 4A93G 1K8GA 3E9HA 4OWWB 1SR3A 2E2IH 2D0PA 2XTIA 2Y0SG 4P72A 3G48A 4DR2L 2JA6G 2B29A 2MO0A 2Q2TA 1N32L 4DR4L 4B3RQ 4B3SL 1KAWA 1C7YA 1KRSA 4O0AA 1OXSC 3HOUG 4HJ5A 5K36G 1N33Q 2ASBA 3TREA 4DNIA 1GVPA 4AYBG 1IBKL 1FVIA 4KHZA 2VUMH 1I94Q 4A3CG 2R93G 5M5WH 2UXCQ 3H0GG 1GO3E 1QVCA 1Y14B 1SN8A 5FLXc 4LFAL 5LMNQ 1YBYA 2MFIA 4YCVA 3T1YQ 3STBC 1EUJA 4P75A 1TXYA 1I50H 4JBJA 4JC0A 4NB3A 5M5YH 4GOPB 4UP7A 4B3ML 4K0KL 4A3IG 1L1OB 2MQHA 4LFCQ 3MXNB 2Y0SE 3CMAA 1YJNA 2JA5H 2F52A 2K52A 1QZGA 3KDFB 3KJPA 4UY8C 1MJEA 1CKMA 1Q1EA 1PV4A 1PH3A 1VQEA 4X66L 4DV3Q 5JJIA 1L0WA 4BXXH 4RMFA 1SLJA 4QL5A 4YY3Q 1N34L 1IBLL 3CCJA 4JI3Q 2GN5A 2UU9Q 1E7ZA 4IPDA 3CQZH 3S1QH 1RIPA 3W1GA 3S2HH 1VQHA 2RF4A 2NN6G 3U4VA 2ZM6Q 1SFOH 4BY7H 1VQGA 1YI2A 3PO2H 1EOVA 3HKZE 3FHWA 3RNUA 1J5EL 5ELOA 4A3LG 4DR7L 4A3GH 4OONA 4BBSG 4QJFA 1X65A 4Y7NH 3GTLH 3GTPH 2IHFA 4LF4Q 1X3EA 1X55A 1X3GA 3L0OA 4A3FH 1HNWQ 4IPGA 1IL2A 1X6OA 1UE5A 1YVCA 4HIOA 4R4QA 1ASYA 2UUAL 4JI0L 3PCOB 4BBRH 1PH2A 2YU9H 3OTOQ 5IP7G 1KXLA 5GADC 1KIXA 1MIUA 2NZHA 4GNXB 2QGQA 2D0OA 4DR6Q 4NPSA 2YTVA 4JYAL 1YNXA 5LMNW 1HNZQ 4BY1G 3GTJH 2JA6H 4LF7L 1IBML 2PI2A 2YYZA 3MEFA 2JEBI 1UEBA 1RL2A 4PZ8A 5E7NA 5IWAL 3HOUH 3HOWG 3S1NH 4IFDI 2K50A 3KDFA 3TS0A 1HNXQ 3JAMi 1Q8KA 5HY6A 3A5UA 4X64Q 4TVAB 3S2DH 1VQCA 2R93H 3VDYA 1PH6A 2NVYH 4A3CH 3J7A5 2CKZB 3H0GH 3STBD 3M85A 3J7ZC 4LUOA 2ZTCA 1J6QA 3DM3A 2Z6KC 3HOZH 5IYDH 4GS3A 4L5QA 2K5NA 1VQ8A 5C3EH 4DR5Q 4LF6Q 4A3IH 3JC66 2VUMG 1YIJA 3I4NH 3PF5A 5C0XJ 4DK6C 5M3FH 2WP8J 4XIGS 2BA1A 1S72A 1GD7A 2UUCQ 1LUZA 4DV7L 2JK8A 1X9NA 1TWHH 4DUYQ 2PQAB 1HJPA 3KF8B 4IJLA 4QGUA 4X62Q 4LF8L 3GTQH 4LFBL 1B70B 1EIFA 2JA5G 4UPAA 2YV5A 2ID0A 3BZKA 4DV5L 1L2FA 4DK3C 5C44G 2C35B 1PH4A 1P8LA 1Q12A 1QVFA 1YHAA 4GNXA 2UXBQ 3K81C 4GKKQ 2OQ0A 2ES2A 1VQ6A 1EQRA 4BBSH 5IYCG 5IP9G 3G4SA 4QIWE 4OO1I 2RCNA 4EQ5A 2RHQB 5C4XG 1HZCA 3PUVA 4KI0A 4DV0Q 5EAYA 1I3QH 4DUZL 5C4JH 3M4PA 4LW1A 2UXDL 5BR8Q 2QEXA 5JEAJ 3RR5A 5IP7H 4DV1Q 4A3GG 5GAGC 3J81i 3J80i 2EIFA 1VQIA 1XTDA 2I5LX 2F4VL 4JI4L 2NVTH 2OQKA 4BY1H 3S16H 1YJWA 3T1HQ 2UUBL 2UXCL 1CKNB 3I4OA 5GAEC 4NXNQ 3CAMA 1WJJA 3RZOH 3HOWH 1E1OA 3K7UC 5GAHC 3M7NA 1MJCA 2Z0SA 2VQFQ 1FJGL 3NELA 3FKIG 1I6HH 2IX0A 4LFCL 4AQYQ 2HHHQ 1M90C 2E8GA 1B7YB 1NE3A 1X56A 4X6AH
chains in the Genus database with same CATH superfamily
5IODA 2MGSA 3HKZA 4JI2Q 3PSIA 1VQJA 4JI8L 3OYYA 1Q82C 2E5LH 5I2XA 1Q46A 1G8ZD 3KF6B 4BS9A 4MTKA 2ZXPA 4IO9A 1VBGA 1STNA 1UE7A 1AFPA 1SJHD 4YR2A 4OX9H 5E4XA 1PH8A 4DL6A 1O78A 1XYIA 3M9MB 4LF9H 1PYWD 1JOKA 1M6VA 5EWFA 2CQOA 2H5XA 3TQYA 4A3JH 3ETHA 1KJ9A 4JI7H 1S40A 2F1MA 4J9MA 1K0RA 5KG5A 3MFYA 5M5WB 4JBKA 2ATWA 1VQFA 3MR3A 2JA7H 4DR4H 5IP9H 4RUCA 1TWGH 3CC7A 3ORQA 4KY7A 5EGTA 1A6XA 1BVSA 1TWCA 4WRDA 5C1PA 2F3VA 4DAMA 4MTDA 4O42A 1W6KA 1X54A 1FKAH 1DYQA 2DGYA 2EJFC 3CHBD 4DV2L 3CP0A 2K4KA 4Q43A 2RGRA 5DG7A 3MFGA 2YRWA 3F2BA 2F0FA 4I65A 2B2WC 4R8IA 4MV1A 4B3MH 3N8DA 3J7AK 2Z6BA 3S2HB 3RUPA 2AQ4A 1IBKQ 5DQIA 1JR0D 1VF7A 3MC0B 3FKIH 4YHHH 1FR3A 1HR0L 1N34H 1CE8A 1JE5A 2ZTDA 3QOJA 4GKJQ 2EDGA 4K0KQ 3TRZA 1WH2A 3U9TA 2NN6I 4ZKCB 1WI5A 2YTXA 2PPBC 1G91A 1PK8A 5D1OB 3K58A 1QWYA 1DV2A 2LMCB 4K6DA 4DR7H 4J9OA 2L12A 3ND9A 2EY2A 1AEXA 2VUMA 1EY4A 5I47A 2W6NA 3MXPA 4KHVA 3CCSA 3QFFA 2OTJA 1IBLQ 5ELNA 1ILPA 1K73C 3PV0A 4L8JA 4DAVA 2EYMA 3LWBA 2JA6B 2JEJA 1EU4A 5CV7A 1MHWC 3GTKA 3N6RA 2JA5A 2JP1A 1F9RA 4JYAH 3SK8A 4AYBB 1Z2PX 3TIGA 3SEBA 3JAMW 2NVYB 4PG3A 3PO3H 1VS0A 1KJQA 3H3VI 3H0GB 4L5SA 3TP5A 1EYCA 4ZHQF 3CQZA 1A3TA 1O7ZA 2YTYA 2IW3A 2N55A 4A3KG 4HIKA 4NXNL 2F0JA 2YZMA 2V1CC 1VQOA 1VQLA 3OHXC 3A5ZB 4FDBA 2FB9A 1L0XB 3PW5A 3GTLA 5AJ3Q 2I46A 1HFGA 2AUJD 3OWFA 3C2PA 1IBMQ 3M4OH 1G6ZA 3MR2A 1F2LA 5LMUH 3CU7A 4HSPA 4A3EG 2K5DA 4B3RL 2HT1A 5DQHA 1KABA 3X3NA 1YNNC 3DWQA 3J7AV 3GILA 4IZ8A 5BN4A 1JT8A 2LXKA 3GV5B 1CKOA 2PN1A 5JEAH 2DLNA 1Y8OB 2B3GA 3I2ZA 1PRTF 3A56A 1KDCA 1C3OA 5KT2A 3BVZA 2L1BA 1Y1VG 3SVMA 3EFXD 4DR1Q 1I3QB 3T1YL 2Q2UA 4B3TQ 4DV5H 2JQOA 1E4EB 1S5ED 3VR2A 4ULLA 2R93A 2PW5A 1DZ1A 5DM63 3OIPA 2O2LD 3U9OA 1PFSA 3KK7A 4BY1B 4DUZH 3NHHA 4CKBA 3SGIA 4LF5Q 3IKJA 4JI3L 2RBMA 2B2TC 3RZOB 3QZ8A 2K7VA 2EQSA 4JI5Q 4Q0FA 1JJ2A 4M7EA 3D31A 3PQIA 4HNVA 5C5JA 1I94H 1X3FA 2UXCH 1A2TA 1DCZA 2LSSA 4C1NK 1BOSA 3W2DA 3GTQA 4NW2A 3E0EA 1DGSA 1HNWL 4C3IH 1FJGH 3J80c 1JOQA 1PZID 4QIWB 4CKCA 2CFMA 5F9NA 4OX9Q 4LF9Q 1ML0D 3RZDB 3ETJA 3GV3A 1QUQA 4PZ7A 4JI7Q 4A3MG 1FGUA 3NENA 4XZ3B 4B9XA 2F0PA 2HDMA 1AUVA 3GO5A 1CSQA 3J80E 4ECTA 2YZNA 2DUDA 5C44B 4P71A 4O2BF 1HNXL 1ZYRD 3HOXG 1U4PA 2A69C 2MP1A 4FF1A 3R5FA 4C5BA 2RGVA 2VB3X 3BVGA 2XCLA 4O4LF 5F9LA 1S0OA 4IRDA 4GLXA 1R4QB 1FNUA 3DHQA 4MN3A 1JMCA 4EQPA 1YEZA 5D1PA 5DLGA 4RFBA 4A4IA 4LF6L 3WDNA 1B8AA 4KHPQ 1PTOB 3NEMA 4A3GB 3OTOH 5A2QL 2TMPA 3J81j 2AQ2B 4R4IA 4Y7NB 1RYRA 3CCEA 3D4DA 2K01A 1I5FA 1KC8C 4APVA 4DR3L 3RBEA 1XMOQ 1IYJB 1YZ6A 3CRLC 4OXPA 2MPMA 3E9IA 2JEGA 3CCUA 4YHHQ 4DV2H 4GNXC 1N34Q 2F0QA 3M4QA 1TWAH 3G6JB 2VNUD 2UXBL 3Q22A 2BH8A 4A93H 3EQLC 4GKKL 4ZUJA 3FEWX 1MGSA 3U4ZA 4MAMA 1BNZA 4DR7Q 3T56B 4GOPA 2RCFA 1L1OA 3L3OC 4PMCA 4N8X1 3MZ5A 1VQKA 4UP8A 3ICEA 2XGPA 3TEHB 2VPQA 4HCSA 1UWVA 3H15A 1EY8A 5FO7B 1C4QA 4JI1L 3RLNA 4RUAA 4ECQA 4UDUC 4C2MH 4KV6A 3RBDA 2R6FA 4I7AA 1UEAB 2RA4A 1JWMD 3L7ZC 4C3JH 3GTMH 4JYAQ 2QEJC 3K6OA 1QILA 1TWFH 2OEOA 1VQPA 1Q86C 4MNOA 2K32A 5IYZF 3JSNA 2KCNA 1KQSA 4JV1A 3PMFA 1J8IA 4AQYL 5COYA 5EQ0A 3UE1A 2VL6A 2HHHL 5ELEA 1TU2B 5J1ZA 1GGOA 2J6TA 3I70A 2EY5A 1N8RC 4JI2L 1K8MA 5J22A 1LYLA 3NUCA 2Q8TA 1EQVA 4DU9A 1M7JA 3GTOH 1I6VC 2ZJRA 3TSSA 5KFBA 5BN3A 2XCPA 1VQBA 4ED1A 3K3PA 1DOLA 4NLGA 2IL8A 3MTSA 1S4ZA 4DA2A 5EJWA 2HGSA 5LMUQ 4AH6A 2WB1A 4R4OA 1EYDA 1X3PA 4JV5Q 1RK5A 1A3UA 5LHY1 1AN7A 5C4ZA 4NXNH 4KKSA 4Q5VA 2EYHA 3C0FB 2QKIC 3HOVH 2CZGA 5KFOA 1Y8PB 1B04A 4CJ2C 1SNOA 4HMJA 4KD4A 3J81W 4U7CA 1YHBA 4IFDJ 2HDLA 5ELCA 1S10A 3ULLA 2IP4A 1G6PA 1MBYA 4Q45A 4A3FG 4C5CA 5KFPA 4QY7A 2PMZE 4DV5Q 4CJ1B 1VQ5A 4KLKA 2DNEA 4HCEA 5DAUA 3MXUA 4BBRG 3GP7A 4RAUC 2CWPA 1EWIA 3BJUA 4ZAIA 1PVOA 4I7HA 4A3BG 4HJ8A 4LH7A 3OMGA 4CHTB 2XTIA 1ENFA 2Y0SG 2KCCA 5DM73 4P72A 3MR5A 3OSPA 3TP7A 5J39A 2B29A 2MO0A 1N32L 2R7NA 4EFBA 3T1YH 1WVLA 1FGBD 1KAWA 4B3SL 5JH7F 2F0NA 2RDFA 4LAAA 5KFJA 3LNNA 3NBIA 4HJ5A 4HSVA 3MWYW 2ASBA 3PR4A 3TREA 4DNIA 5HGTA 1IBKL 3GTGB 1I94Q 5M5WH 4A3DB 2UXCQ 2B63A 1QVCA 3GQBA 1SE2A 4O4IF 4LFAL 1WSCA 4QMGA 4V0BA 5KFCA 4UCRA 4DAPA 4A3JB 1SYDA 1U4RA 2V9WA 4K0KL 2EYOA 2MQHA 1B44D 1YJNA 2A6HC 5GONF 3KDFB 1S9FA 1MJEA 1CKMA 2A68D 1VQEA 1LTGD 4F7XA 2JA7B 1I4PA 4EGJA 1SLJA 4ED8A 1IBLL 4DR2H 5KFRA 1XWEA 5CA1F 1RIPA 3S2HH 1STYA 1VQHA 2A73B 2NN6G 2RDJA 2EPBA 1UAPA 2IBKA 5EPKA 4RAZA 5K5PA 2E76C 2C00A 2KSWA 3VYRA 1KNEA 1DONA 1EY9A 1WCMA 3KAJA 4FVMA 2IHFA 1X3EA 5DGAA 1I7NA 4IPGA 4R4QA 1ASYA 1MD2D 1STGA 3OTOQ 1HNXH 1CK1A 2Z8LA 3NWTA 5GADC 2NVQB 1MIUA 1D5MC 1E0BA 2EY6A 4WJWA 1SNQA 2KQ3A 4HAEA 2JA6H 4HR7A 5IGCA 1IBML 2YYZA 5LA6F 5E7NA 1ILQA 2F0WA 1O80A 3JAMi 1Q8KA 1CA5A 1JKJB 4FF3A 2J4XA 2PNRC 5CB4F 5KFEA 4P2CB 2B2VC 2NVYH 5D65A 3J7A5 2C22A 5JVH3 1A15A 3NTIA 1B7YB 3H0GH 4QCLA 3VR5A 4DR3H 3M85A 3J7ZC 1S5BD 4LUOA 2Z6KC 3Q24A 1BF4A 4ED0A 2VUMG 1SYGA 1ESRA 2VQDA 4EG0A 5C0XJ 5KG7A 1UUPA 2F0MA 2WP8J 5C4HA 2UXBH 4R8NA 4X3SA 4GKKH 4XT1B 1EFID 3DEPA 4ME6A 2WKCA 2JK8A 2K5WA 1EZ6A 4DXFA 1Y1VA 4C5AA 3WOEA 3HKZB 2FP4B 1HTLD 1ZXTA 1B70B 1EIFA 2JA5G 3RF2A 3SE7A 2UVWA 4CKEA 2FPIB 3BZKA 2B2UA 1Q12A 1EL0A 5FOBB 2R7KA 3K81C 4JI1H 1VQ6A 4UCOA 4RA8A 3KHRA 2F03A 1QCBD 3FRPB 3KUPA 5C4XG 2L55A 2WACA 4KI0A 1I3QH 4QW8A 1PRTD 1S5DD 2NUCA 3M4PA 1JX4A 4RB2C 1JICA 1MSHA 1Z7TA 3UQ8A 4AQYH 3HOYB 2EIFA 2GPSA 1VQIA 1JIHA 3PIP3 3CKIB 4BY1H 3S16H 2F4IA 2RDHA 5KFDA 4JI2H 4NXNQ 1EEID 1WJJA 3RZOH 5LXTF 3EA6A 1TWCB 5EKIA 5GAHC 3M7NA 3NELA 1II3A 2OLSA 4PMBA 2XWBB 1M90C 2K28A 3M3YB 3K5OA 1X56A 1LTRD 1EFWA 5IGFA 4RGMA 2RSOA 5DNFA 2NB0A 2DY7A 1CM9A 5JPMC 2CCZA 5M5XH 1S0MA 4O3NA 2W9CB 4G7HC 1SYBA 3H40A 3KLRA 2FMCA 5M3MB 1AZQA 4KHPL 4WJ3M 2L0CA 5L1KA 5LYJF 3RZDH 2L15A 3Q8SB 5IYDG 2EJGC 1WFQA 1LLRD 3I72A 1MKHA 1WOCA 1A9XA 4X3KA 3I4NG 1SRUA 2HQEA 5M3FG 1OO9B 3OUZA 1NR4A 1XMOL 1PYSB 2JA9A 3G6EA 5C44H 4FYDA 2L11A 1WTOA 4YHHL 1B4OA 3NE5B 3B6YA 3TQ1A 2C28A 1N32H 4B3SH 5C5MA 4AYBE 2EY1A 1VQAA 4MV3A 2NU7B 1C8CA 2CWAA 1HNZL 3DF7A 1LTID 1IBKH 4CBVA 2OF1A 3CPFA 1H95A 1GUOA 2JA5B 1CZGA 2VZAA 1LABA 1M4VA 1PTOH 3IN5A 1GSHA 2I87A 4N9TA 4NKLA 1G291 2Z1CA 4DR2Q 4LFAH 2FHTA 1B3AA 2DPJA 3TIIA 4X64L 4ECXA 5EBDA 2A19A 4K5XA 2SEBD 4B3ML 1HZAA 3J80L 1FL0A 4ETSA 4WORA 3CMEA 1EIGA 3A74A 3Q23A 4BY7B 3X3MA 1PTOC 4JBMA 2L5TA 2F3IA 4R8UA 1DD2A 2E2IA 4YAJB 1TY0A 1BBXC 4HJ7A 4PWQA 1P16A 3GTLB 2CW0D 1QVGA 5FD5A 4K2KA 5J3BA 1Y69U 3GIIA 3TZDA 2E74C 1C9OA 1V1PA 3PR5B 2R8HA 4MTNA 1ICWA 2HD3A 5JJZA 3GD7A 2H1EA 3E3XA 3PGZA 4A93B 1H9RA 5FK9C 3ORRA 2EZVA 1M1KC 2AMCB 2PZTA 1Z47A 1UE6A 2W57A 5LMUL 1D5ZC 2A6EC 2W9BB 4JV5L 5IGEA 1SDFA 3HOUB 1PH7A 2X0SA 4K8JA 3S2DB 4TV9F 2R93B 4J15A 4IAJA 4DR3Q 4J9SA 4LSAA 5DEHA 3S1MH 1IOVA 3V6KA 2R8KA 1IBMH 1EZ1A 4N8FA 2B2WA 2XGTA 5C3WA 3CCMA 1Q1BA 3R2IA 4G4KA 4MA0A 4X65H 1TWFB 4A3MH 1QE6A 4GN3B 3C1EA 3I4NB 1SYEA 4RCNA 3K5HA 2C2RA 4UCSA 3R5XA 1EWHA 2VQFL 2XC9A 4G3IA 3GTPA 1LTTD 3HOXH 1SNMA 1VDZA 3KFUA 4EBEA 1VQDA 5CBEE 1YITA 3GTQB 4RZRA 3GV8B 3I4MG 5KFZA 3T5JA 1E4FT 2R7MA 2FXQA 4JI1Q 1H9JA 2NTSA 3K59A 4TQUS 1UE1A 4RNNA 1I94L 2W8KA 1HZ9A 2WAQG 3G6VA 3GTJA 1A8VA 2EXDA 4DGZA 4IR9A 1SMYC 1QUQB 4RGOS 5IGBA 4EBDA 4ILWA 2J0TD 4IALA 1JWUD 1CT1D 3BVMA 1EY0A 2B8FA 3DMUA 3J80W 2WB1G 1EUCB 5DG8A 2M00A 4DL3A 4J9LA 2HIVA 3ONAB 5KG0A 4LMYA 3UDIA 5ELDA 1W3SA 1VCIA 1EQQA 3TP6A 3CW2C 5KFTA 1IL8A 3GTGH 4K2LA 3QOLA 5EWGA 4A3DH 1EYGA 1ZQ7A 3RB6A 3BABA 3K8AA 4R1JA 1HFNA 5KFIA 5KFXA 2I0QA 4J9NA 2KEDA 4U68A 5F2DA 4ECSA 1KDBA 4Z9CB 4ECVA 4YWMA 4H02A 4RG1A 1A63A 3RIZA 3OTOL 1A62A 2RHSB 2I80A 2NZOA 5CORA 2SNSA 2HQLA 3S15B 5HV6A 2HVRA 4ZLTF 4IUVA 4R9WA 5KGUA 3PIPA 3V4ZA 4IQZA 5IGGA 2AWNA 4KN7C 2R7ZG 5BPFA 3WOFA 4P74A 2R87A 1K3RA 3S14H 4KHPH 1GSAA 2E2JB 2B63G 4OHJA 3HFZB 1N32Q 2NU9B 2XRSD 2P5ZX 4B3SQ 5H1SE 3I4LA 5IYBG 3CCLA 4J6HA 3R3OA 4OIJA 5TSSA 1BR9A 2Q8RE 4RGNA 3Q8RB 1XMOH 2LS01 4U6PA 1IW7C 3DEOA 4IUUA 1XNQL 2V4QA 2NVQH 4ZYSA 1V9PA 3V6HA 4LFAQ 5KFQA 2J6UA 2I8CA 1SNDA 1O7LA 1UNSA 3AU7A 1F2YA 4DV4L 4XX0B 3GQCA 5E3FA 4ZKBB 3CD6A 3VYSA 1HNZH 2QILA 5IT9L 2YS6A 1JQYD 2KHJA 4OGQC 1KL9A 3F2UA 2QA4A 1LO5D 4LUVA 5EPJA 5ELFA 1V4YA 2LXJA 2IX1A 1EY7A 4F8MA 1PA6A 1X32A 1WCMG 1EIYB 1GM5A 4X64H 2BH2A 5FJ8G 4NP5A 1R9TA 1LACA 3W3AA 4A3BH 5I2YA 2MO1A 3V6JA 5BMVF 4TQSA 3KLSX 1YNJC 4O3SA 4FS1A 4CDFC 5GROA 3A54A 1AW7A 4YWKA 1I4XA 5KFAA 2R92A 4LWCA 3EN2A 2NU6B 4UCUA 1CTMA 3K5MA 1VQNA 2NVXA 3VPCA 5DG9A 3E6ZX 1AN8A 4O2DA 2R8GA 3UFXB 3SDZA 1I4GA 1SAPA 4DV6L 4X62H 5K2MA 1ZEQX 2A69D 3TZUA 3HZXA 3IFTA 5T14A 5FO8B 1QB5D 2ALYB 2AQ1B 1U4LA 3T4AC 2K14A 2NUAB 2IT1A 2JEIA 1VF5C 4JV5H 2CW8A 4X65Q 1Y1WA 2XIGA 2R8JA 1K0SA 2NN6H 5BR8H 4JG2A 4PNYA 2OH2A 5KT6A 1RD9D 4JV0A 2PI2E 3BDOA 3HOYH 1PTOF 1KEEA 2G9DA 4J9QA 4PZ6A 3RB4A 3F8NA 4IPHA 4EEQA 4CJ0B 5KT3A 5CR3A 2D5DA 4NXMQ 4CDDC 4Y8VB 1TWCH 1GLVA 1OXXK 3PO2G 3PN1A 1JCKB 1FNVA 1T5EA 1SYFA 1UC8A 2BR0A 1OTCA 2VQFH 4M8AA 2ZXRA 4JUZA 3G71A 3M3YH 5KG4A 3L9AX 3M4IA 3S16B 1ET6A 1CQJB 4APMA 1QNKA 3W5OA 4RCOA 1EEFD 1BNCA 2KUMA 1GHJA 3H3VH 1MSGA 1BXTA 1HR0W 5KFKA 2AUKA 4ID6A 5D3DA 2YZGA 2CVRA 5M3MH 2KBNA 5I9PA 1EQTA 3MFIA 4OWWB 1AZPA 1PZJD 4DR2L 3RB0A 2Q2TA 5M5XB 3H3VC 1E4GT 4Q0YA 1KRSA 2E2HA 2WE6A 1OXSC 5K36G 2PVPA 4H44C 4DNTB 2EJMA 1WTVA 2VUMH 5KT4A 1GUGA 2FINB 5JOBA 1E2ZA 4PQXA 3OWEB 3GIQA 3T5KA 3V96A 3NBHA 3N6XA 1K83A 5LMNQ 2MFIA 2RVLA 3HOZG 1TXYA 4DF7A 4HR7B 3WO0A 4UP7A 2WIIB 4A3IG 1V1OA 3OPOA 2SDFA 2Y0SE 2A74C 2JA5H 4A3KB 3GTOA 1D1KA 3BQ0A 1L0WA 4BXXH 1G2SA 2QW7A 2LKVA 3GIDA 4QL5A 4YY3Q 2C9OA 4EGQA 2GN5A 4F87A 2UU9Q 1E7ZA 4KY5A 3CQZH 4G7OC 3W1GA 2C2EA 3HBLA 3RGZA 2F0IA 1I7LA 1JOOA 2RDIA 2BQ3A 4A3EB 1JC7A 5C5LA 5FO9B 3BS1A 4BY7H 3MWMA 1YI2A 2LFNA 3HKZE 1KLUD 2ICIA 4CDCC 4XT3B 2XRQD 4A3LG 5JUMA 5L1LA 2K33A 4BBSG 1X65A 3GTLH 1JXLA 3L0OA 1X3GA 1IL2A 1X6OA 1YVCA 1Y1VB 1D6EC 1H9SB 1L0YB 4EYHB 2NZHA 1WTXA 5M9OA 1HNZQ 3RV4A 3A8IE 2F0KA 5KG1A 2JEBI 2O5IC 1RL2A 4PZ8A 5IWAL 3HOUH 2WV6D 3HOWG 3S1NH 1XNQH 4EBCA 5HY6A 2NZ1D 4X64Q 4TVAB 3S2DH 1VQCA 1CQIB 1JE4A 3VDYA 2R93H 4A3CH 3M9NB 4DV4H 2CKZB 2FJZA 3N41B 1WTHA 1HA5A 4F88A 3GLKA 3R23A 1GUNA 2C5CA 1BXRA 2FJ2A 3S9WA 4BWSC 2ZTCA 4XYMB 5JQWA 5IYDH 2F0DA 2A6HD 4GS3A 2K5NA 1YIJA 3I4NH 3PF5A 3L4KA 5M3FH 4XIGS 3BG5A 1GUWA 3BG3A 1IYVA 1GD7A 3S1MB 4ED2A 2WAQA 1LUZA 1GHKA 1GSOA 4DUYQ 3FDTA 3GTQH 4X62Q 3AMUA 4TRDA 4A3MB 4O3OA 1K1SA 4DK3C 1QVFA 1BO0A 2D9UA 4RB1A 3HOXB 1KC7A 3G7LA 1BJTA 4J1MA 1KTKA 5IP9G 1B2TA 2IJ0A 2RCNA 2W6MA 1X3QA 3LX0A 4DV0Q 4DV6H 1LT6D 4MV6A 2FLNA 4F4YA 5BR8Q 5JEAJ 5KYLA 5IP7H 3BQ1A 1PMRA 2R85A 1JDEA 4YQWA 3J80i 1IYUA 1XTDA 4OIKA 3WO1A 2W70A 1YJWA 1HHVA 3I4OA 5GAEC 1EYZA 5JVDF 5DLFA 5A2QW 3K7UC 4YP3A 2VQFQ 3JRXA 3BJYA 3JAME 3FKIG 1SE4A 4QWCA 5C6AA 4LFCL 3CVZA 4EQ5A 5KNBA 4X6AH 1I4HA 1JJCB 4IWXA 4QWBA 4Q44A 1SE8A 3T53B 1DIKA 2PCFB 4RKLA 2R7DA 2ZXOA 3VR6A 3ULJA 1NUCA 2R7ZA 4P73A 3GIJA 3D0FA 4KY6A 3KJOA 4QWAA 3EPGA 2AU0A 5FPOA 1S03G 2R3ZA 1CZWA 1PXUA 2ZM6L 3S15H 1PLFA 4R8UB 1LV9A 1KDAA 5D14A 5CV8A 2W9AA 2HVQA 2F0OA 2UUBH 4CC6A 5C3EG 2A8VA 3SK5A 5IT9c 1V1PB 1O7IA 4B9WA 3C3LA 3T16A 2E2JH 1N36Q 1PH1A 3E0JA 5CYUA 2BE5C 2N78A 2KENA 5IYCH 3QJYA 1CKNA 4JPBW 4DR6L 4FS2A 4MHEA 2VW9A 1LT5D 4DKAC 3W1BA 5IT9E 3Q6SA 3S14B 2E75C 4IPCA 4MIUA 1KD1C 1DOMA 1ZKOA 3CC4A 4LMQD 4JK1C 3LP8A 1NAPA 2B2YC 2VS1A 2FMAA 3ER0A 1O7YA 4RH6A 1LTLA 2JEAI 4XTCS 3PUYA 1E24A 3IG0A 1B9MA 3BZDB 3MVVA 1K1QA 3MFHA 3RTXA 1RTNA 3CXCA 4DK1A 1SFOB 3PUWA 1OXTA 3AFQA 4WD3A 4EX5A 4M1UB 3TN2A 4R4CA 4DR5L 4QQBX 1SE3A 4IFDG 3H20A 2ICEC 4L1KA 3U50C 1G51A 5FLXL 3GTPB 4C1NI 2XIWA 3RAXA 1LTSD 4A3FB 1SNPA 1NY4A 3OOCA 3RN5A 3RMHA 2YCHA 4KD3A 3HRZC 4H13C 3FMAA 4MV7A 4X65L 3BU2A 4BBRB 5D3IB 3RB3A 2ASJA 3M9OB 2M2LA 2GLTA 3CCQA 4X66Q 3ZJYC 2V4DA 4QWEA 4A3BB 2R61A 3MEHA 3FVQA 1RTOA 2W71A 2Y0SB 3GTJB 2BA0A 1XNQQ 1I50A 1BCPB 2FFKB 2OCEA 1HZBA 1J5EQ 5GQOA 4NXML 5KT5A 5HGQA 4DV4Q 1JB7A 1B3QA 1EYAA 4FF2A 2JA8G 3T5HA 5CV5A 3R2TA 4HIMA 5KFFA 1S0NA 2QCPX 2GVBA 5KRUA 4L63B 5JJLA 1C48A 2K5HA 5ISRA 2P0AA 4LUZA 5IWAH 4C3IG 1IZ6A 1I4RA 2R92G 3PZPA 3TBIB 1XNRH 2V58A 3WWVA 3MAQA 2X69A 4F50A 2B63H 3PVXA 5LOVF 1R4PB 1LT4D 3JRWA 2X6GA 3T13A 5IYBH 1JWSD 1V51A 2W6ZA 2F0LA 4ALPA 3VMMA 1PTOD 1RKNA 3MWDA 2YU9A 4QWDA 2RDGA 3KHGA 2NBFA 1BGWA 3D6WA 4ECRA 3O13A 2H4OA 4BA1I 5HURA 2AGQA 1N56A 1V1QA 3GV6A 1WTWA 4MZ9A 3ERSX 3F2DA 4MA5A 4YWLA 4EGVA 4DV6Q 2OT2A 5LL6b 1Z6HA 1TY2A 4N9PA 1Y1WG 3I91A 4LNQA 5LMNL 5KNDA 4O3PA 1EUDB 4E6IA 5C4JB 2BQRA 2K5QA 5BPHA 1B6RA 1IHZA 3I55A 2MUYA 2XD4A 3EPIA 1K9MC 1XPUA 2N88A 1E1TA 1HXYD 3EBEA 3R93A 1WCMH 1SBBB 2NYZD 4LFBQ 2EYFA 4LF8Q 2AHOB 3SR1A 2A6ED 4YY3L 4L5TA 1DJRD 1SSOA 4RNMA 2MJ8A 2XSCA 4J0MA 1VBHA 2I5MX 2UU9L 1KBLA 3ULPA 1QG7A 2WAQE 2IA6A 1CHQD 1N33H 4C3HG 5I6YA 2PO4A 2F0SA 2FK1A 4B08A 4ZUIA 2K03A 1OXVA 2R6GA 1TWHA 1E22A 3OMCA 1D5XC 2IX3A 3M9BA 3PW7A 3J7YW 5LP6F 4ECUA 1HTPA 2HCCA 2A5HA 3J81c 3CPWA 2O5JC 3MR6A 3M7GA 1IKLA 2TSSA 4KK7A 4A3KH 3KBGA 3QZ7A 2VUMB 2WB1E 4LFCH 5C0XG 2F4VQ 2ATLA 1A3VA 4ZQ3A 1Q81C 2O03A 1S5FD 2UUBQ 1R9TB 4X3UA 4DV3H 1F9QA 3BA9A 4JOIC 4EQNA 3E5SA 5T1IA 5JVG3 3KLSA 4ME3A 1M0TA 3V4SA 1ULZA 3OW2A 3EIVA 3GTKB 4A3EH 2JYOA 4I55F 3J81E 1NNXA 2ZM6H 5IIFA 3IRBA 1O75A 4OWTB 4JI4Q 1ASZA 2MNAA 3AYHB 4CC5A 4KTAA 2OWOA 2W6QA 5I6WA 3CCVA 4GN4B 1SMYD 3QR8A 3CQZB 4KN4C 2WFWA 3R5HA 2NVXB 1Y1VH 3KAKA 1RJPA 5C4XB 4IHJF 4LF4H 3BA8A 3K80C 1EY6A 3I3CA 1CS0A 1UC9A 3T5LA 4TQRA 2I5HA 3RLOA 2DN8A 1ENAA 4HMIA 1Z9FA 4DR6H 1D1IA 4TSSA 4EYIB 5FLMG 2QDLA 1B1ZA 3IAYA 2DWCA 4DUYL 3NP8A 4X62L 1Y1WB 2B2UC 3HOVG 1PH5A 3VA5A 1E2WA 1VAJA 1SJED 2KCTA 4ODGA 3RLFA 2FK2A 1PFNA 1NMGA 3OSOA 2SNMA 2WINB 1PZKD 1FYCA 1SEBD 2IWHA 2R86A 4JI6Q 3S1NB 1SYXB 4K5VA 2OXPA 3MXGA 4DV0L 3L2PA 2F3WA 4DR5H 3DM1A 2UVUA 1XXGA 5BR8L 5K36H 1ZHQA 2CH4W 1LTAD 3K0XA 2VQEQ 4XQJA 3I12A 2JA7A 1S3OA 2FKLA 1TIID 4F4ZA 1TWGA 2JXMB 4XDXA 4A76A 1TAEA 1WTRA 2R7LA 3ITPA 5LL6S 2PQEA 3SXHA 2IY5B 1W6JA 5M3FB 2IMWP 1F77A 3BAAA 1W2BA 2AGPA 1IXRA 1HH2P 1NTGA 5I9OA 4L5RC 5IWAQ 2ASLA 2D62A 2F0UA 1IW7D 1D8LA 1XNRQ 4NXMH 5CV4A 2ZDGA 4HQ6A 4MV9A 4DAYA 1V43A 3F2CA 1AUXA 3FKIA 4UCVA 1KJ8A 1F9SA 5CV6A 3KHLA 2HVSA 3D4WA 4A3LH 3GDEA 4J9RA 3NBHB 4ZI7F 1STBA 2F0GA 1K83B 2V5AA 2JJQA 3MWEA 3S1RH 1ONLA 1RJQA 1PDQA 2Q2IA 3SK6A 3VYTA 4OELB 3NTKA 2OTLA 5G3LF 1VKZA 1N36L 1XMQQ 3NPPA 1YNJD 4ZRZA 3H4DA 2VUGA 1SXTA 5ELBA 1K8AC 3N44B 3D8GA 3FMCA 1VQMA 4EQOA 3C1FA 2ENBA 3NQIA 4YR0A 1K8GA 3E9HA 4ECYA 1SR3A 2E2IH 4EEYA 2ALZA 1UNNC 3GIKA 4DL2A 2JA6G 5LMNH 3GIPA 3JAML 3Q8PB 1STAA 4O0AA 2YW2A 3OSNA 2LY7A 3RGXA 2CW0C 1H9MA 1N33Q 2EVBA 4AYBG 5DQGA 1FVIA 2FMMA 3H0GG 3FPUB 5FD6A 4H0LC 3S17B 1Y14B 4YY3H 5FLXc 4RAYA 3IL8A 1YBYA 1YNND 4YCVA 2M9VA 1F2MA 3STBC 4A2AA 2UU9H 1EUJA 4P75A 3TMEA 1AP0A 3FPPA 4GOPB 1XTCD 2Z4HA 3C46A 1L1OB 4LFCQ 2DZDA 3CMAA 4I50F 4UY8C 1QZGA 4GZYC 4DV3Q 4X66L 1EIHA 4DFAA 4LSXA 3SK4A 1JORA 3CCJA 5KX5F 3EROA 4JW0A 3S1QH 2XNAC 5FLXE 2WTFA 2ASDA 2B2TA 4K6LA 3NGDA 3U4VA 2ZM6Q 1SFOH 4DL7A 1WD0A 4IUQA 3I4MB 4GC7A 2AQ3B 3FHWA 4L6TB 1J5EL 5ELOA 2HUGA 4QJFA 4KMUC 3GTPH 2WKDA 2SOBA 2WAQB 4LF4Q 4A3FH 3FDSA 1B33N 1UE5A 4HIOA 1C30A 4JI0L 4BBRH 1PH2A 2W9CA 1HUNA 2QGQA 4DR6Q 2YTVA 1YNXA 2KOLA 2VR1A 4BY1G 3GTJH 2WB1B 3WNZA 4ED7A 2G9HD 4LF7L 5FKAC 2CHBD 1S97A 2XN9C 3MEFA 5JAVA 5KT7A 3NXWA 5EPLA 2Z4IA 1KJIA 4IFDI 1TVXA 4ZK9B 3A5UA 2KA7A 1H9KA 5DGBA 1PH6A 5KKNB 5JPNC 1BCPC 4DUYH 1TS3A 1J6QA 3DM3A 2ZDHA 1EU3A 2KEEA 2UUAH 2FK3A 5C3EH 4DR5Q 2FLPA 4QUCA 5KIXA 1K8OA 4NMZA 3Q0AA 1GOZA 4FF4A 2PMZA 5AFWA 1S72A 2PW7A 4DV7L 4BWGB 2KVMA 3I73A 3K57A 2ZDQA 1ESFA 3JZIA 4IJLA 4LFBL 4LF8L 4DV0H 2ZT9C 4UPAA 3DXJC 2R7ZB 2ID0A 4HEDA 4RZQA 3NWSA 1L2FA 1PH4A 1DXMA 5C44G 1P8LA 1YHAA 1CHPD 2DJFC 2Z9HA 5CV9A 3RUZA 4GNXA 2O4XA 2B63B 2RQXA 2ES2A 3TP8A 3BDLA 3G4SA 2JSOA 2RHQB 1HZCA 5EAYA 4I4TF 3OUUA 5C4JH 2F0TA 2KJXA 2QEXA 3RR5A 4K14A 4A3GG 1BDOA 1TWAA 2D2CC 4ABNA 2F4VL 1NR2A 2OQKA 4IFDH 4F4WA 2UUBL 5CA0F 5IOCA 1CKNB 2I07B 3IFDA 1PFBA 1KJJA 5KFGA 1E1OA 1QOHA 2W9BA 1MJCA 5KYIA 3SI8A 2VA2A 5KFVA 4HNUA 4HNTA 3HGBA 5IT9W 1WCMB 1NE3A 4J9PA 4IRCA 4JI4L 4RGTA 3KBXA 3MA2B 4ZOLF 4C2MA 2PQAA 3KF8A 5KFSA 1BBWA 4FXKC 5CBAE 3GTMA 2UXDH 4IR1A 1VMCA 3LWUA 1RHPA 1TWFA 4E4TA 3PW2A 1N36H 2A1AA 3HKSA 1IKMA 1JJGA 2FE3A 2AGOA 1YHQA 4JBWA 1T3NA 1R9TH 2JA8H 5KFMA 2XVSA 2HIXA 3A8KE 4HTHA 1NJIC 1XDNA 3GIMA 4ED6A 2UVRA 4RNOA 1A0IA 5L9XA 2N8NA 3GTKH 4DK0A 2E5LQ 3UE0A 2SCUB 3K7AH 3ZYYX 3RD4A 4LK1C 3Q2OA 2EYJA 5NUCA 5IE8A 2ZJQA 2R92H 3G6XA 3DWAA 2K75A 3CCRA 1Q90A 5EZYF 1NMFA 3DLLA 1GKHA 5CGKA 2R82A 4XQNA 3PIO3 3KTMA 1FNWA 1YJ9A 1AE3A 2NVXH 3OW7A 5C4XH 1I50B 4JI8H 3D4RA 5C0XI 5M5YB 3TINA 4JI6L 4YAKB 4QB4A 1B50A 3QB3A 4IOCA 3Q8DA 2GPWA 2W8LA 2RSNA 5EDWA 2IPKD 3MXNA 3AFPA 2J7ZA 1N48A 1TS4A 4DR4Q 2VQEL 2DPIA 4ME5A 3J81L 4FO2A 3P20A 4HN7A 1XPOA 2ZJPA 3UDXA 1GJXA 1Y1WH 5EKLA 3FP9A 2K04A 3KF6A 3PO2B 2HJWA 4X66H 4J9KA 1PRTB 1VQ7A 4OO1G 1KNAA 3K5NA 2E2DC 5E1FA 3JSLA 4B3MQ 1PFMA 2F0EA 2CQYA 2UUCL 3TS2A 5EWEA 3U58A 3P75A 3QG1A 1QNUA 3KOJA 1XNRL 3A7LA 2YU9B 5J2UF 1J5EH 3M4YA 3BYTB 4C56C 5KG6A 4C3HH 4YCUA 3VR4A 4JI0H 4GLAC 1RODA 1KHIA 3RJ0A 3N52A 1OXUA 2BE5D 2HCIA 1BKBA 1SROA 3CF5A 3UDGA 1XPRA 4A3DG 1LM0A 5KFUA 1HR0H 3PUXA 4HJ9A 5C0XH 1TR5A 4DV1L 4LF7H 2IHEA 1XMQL 3UDFA 2B2YA 4A3JG 2UUAQ 4R4TA 3AQQA 2AWOA 1U4MA 3G8CA 2BDNA 2JEFA 3HOZB 2E2HH 4WFN3 4IWYA 4XYOA 3T1HL 3VPDA 1V8QA 4A3IB 1SYCA 3S24A 3VPBA 4IRKA 2W6OA 1NCVA 1D7QA 2JA7G 5HBRB 1RJTA 5IY0A 3ND8A 3P1HA 3F8TA 5E4WC 1F9PA 4Y52H 1G2TA 1K83H 1TWHB 5JJKA 5D8DA 4F4XA 1N9WA 3JAMc 2JE6I 5D1OA 4BA2I 3H4BA 2ZTEA 3D3RA 1N33L 4KKUA 4FXGC 2VXWA 4KJNA 2B2VA 4S3SA 4G57A 4DV7H 2DJGC 1W96A 3HB9A 1ZYRC 2J6SA 4BBSB 5C1OA 2XGQA 3CC2A 4LFBH 2NTTA 4LF8H 3S1RB 2JA6A 4OWXB 1PH9A 2FLLA 4IUPA 5G3LD 5FLMH 2Z6KA 1SNCA 4FM9A 4DXGA 2R84A 1TS5A 3G6YA 4O3QA 1STEA 4AYBA 2NVYA 2QF7A 3PUZA 3H0GA 3I56A 4O3RA 2F0VA 4DV3L 1JB3A 1VQ4A 2NVTB 1ET9A 2JN4A 2EXZA 1WTQA 3Q8QB 1CI3M 5L37A 4B3RH 4MTEA 1BCPF 3HOWB 1C0AA 3HP3A 1RF2D 1I6HB 2KHSA 2E2IB 4JV2A 3LMLA 2F4VH 1AE2A 3BZCA 3S17H 1CA6A 4QUFA 1SEIA 3HXLA 3K5IA 2BQUA 1EY5A 1F2ZA 1S68A 2W7PA 4DUZQ 3QO2A 1CQFA 1EWCA 2L9HA 4H7BA 4LF4L 2UXDQ 4MV4A 2KCMA 1FD7D 1MZBA 3KYHC 1GUTA 3PO3G 4JI4H 2YL2A 1HRJA 1B6SA 3TQTA 4QF4A 4DPGA 1ZETA 1PHJA 3HKZG 4GOPC 4DN4M 1I3QA 4JI3H 1L1OC 4A75A 4GKJL 2UVVA 1FJGQ 4YCWA 4IN3A 1E4EA 3I4MH 4WJ4A 2VB2X 2B8GA 5EBCA 1GUSA 1TKWB 2C2DA 1WYDA 4NDXA 5JVLA 2QDBA 4G7ZC 2Q2HA 3A8JE 3S1QB 4JI8Q 1TWGB 4IUNA 4YB8B 1HNWH 3I7FA 4POFA 3N42B 4XQQA 3BQ2A 3LWEA 3QWNA 5JEAG 3PF4A 1E2VA 1TA8A 4TV8F 1Z2OX 3A0JA 3HOYG 4FXDA 3RN2A 1K28A 2M05A 3OHAA 1HQMC 5DLQE 4RHRA 4O1NA 4XYLB 3I90A 1KRTA 3D6CA 2GA4B 4JI6H 3N43B 1T5XD 4QIWA 1PYBA 1Q7YC 1CUKA 3FKIB 4DAYB 2FPGB 3KXYT 4HJAA 4WBNF 4GN5A 4POGA 2VQEH 1CSPA 2FPPB 4OEMB 3TDQA 1WTPA 3N40P 3HS0C 3PIOA 2K1BA 3CRKC 5C3XA 4JOIA 4XXEA 3HG9A 1U0LA 5AJ3L 4IJHA 4JCVE 1U5KA 4KKTA 3OIQA 3DWPA 4DV2Q 4LF6H 2EYPA 5M3MG 1CQVA 1RJRA 5I4DA 1VQ9A 2V59A 3F1ZA 4TUYF 3KLWA 3AEVA 5CAEB 4JI0Q 1SMXA 3E5NA 3SHLA 2K5VA 4IOAA 2UUCH 1BBUA 5C3EB 3V2TA 4DL4A 3K3VA 2R7ZH 1NBWA 3A55A 2X6LA 5J2TF 3HEJA 3DUZA 1HR0Q 4DR1L 4B3TL 1SCUB 4LF7Q 5KG2A 3Q1KA 3PO3B 5EOYA 4UP9A 1WD1A 1VMPA 1ZHSA 1JLLB 3PW0A 2VY3A 1LT3D 3GV7B 3URYA 4FP5D 2DIKA 3R8BA 3EJIA 4U673 1PX2A 5C8YF 2KHIA 1H9SA 5KNCA 4ZCKA 2AKWB 3H6MA 4K8IA 4LF5L 1T9HA 4ED3A 1AH9A 2PZWA 4DV1H 2Q8IB 4BXXG 2R7FA 4GC6A 2A68C 4JI5L 2L4NA 1XMQH 4HYKA 1RK6A 1GXDC 4JVZA 1TS2A 5L1IA 1Z2NX 4FBUA 4PMWA 1DOKA 3M4OB 3T1HH 2N3SA 4BY7G 4ECZA 2E5LL 2KECA 1B53A 1Q3LA 1M0WA 5KFWA 1XJVA 4DV7Q 2QYZA 4AIMA 4ECWA 5FJ8H 4GLVB 2HHHH 4HIDA 4OX9L 3RAQA 2DY8A 3RFCA 4LF9L 1E3PA 1XX8A 3OHBA 4MV8A 3LGJA 2GVAA 4LH6A 1W93A 1HUMA 3I8ZA 2EOTA 2MHVA 5FLXW 4JI7L 2QK4A 2K6AA 3BYYB 1QZHA 2PNHA 2N49A 4J8QA 4TKOB 1I4QA 4A93G 2W6PA 2R8IA 2D0PA 3KHHA 2EE1A 3G48A 4DLKA 5IGDA 4DR4L 4Q8FA 4OL7A 3K0YA 4B3RQ 1C7YA 3NQTA 1RDPD 3BDCA 3HOUG 4RHSA 1T36A 4XYQA 2PYKA 1GVPA 2BOSA 4KHZA 2R93G 4A3CG 3ERQA 2BDOA 2JA8B 2YS7A 1GO3E 2W7OA 3A7AB 1SN8A 3EVQA 4FNFA 3T1YQ 1MI2A 4C3JG 4YJ3F 4JC0A 1HPCA 1I50H 4JBJA 4NB3A 4CGYB 3K7AB 4C3IB 4RWSC 4EVOA 5M5YH 3AB9A 3SE0A 5KFNA 1IOWA 2R92B 4YJ2F 2F52A 2K52A 3KJPA 4R7RA 4YBZB 1Q1EA 1PV4A 1PH3A 5JJIA 2VA3A 4PV1C 4RMFA 3KALA 2WYOA 1N34L 1A2UA 4IZOA 4JI3Q 1ENCA 1L2ZA 2V4RA 4IPDA 5A2QE 1HCZA 5CC4A 5BN5A 2RF4A 4EFEA 4LJZC 5EKKA 1VQGA 3PO2H 3VA7A 1EOVA 2WDTA 1Y8NB 3RNUA 2G5DA 1RYSA 4DR7L 1DV1A 5L1JA 2PMZB 3V05A 4A3GH 4OONA 1EZ8A 3MJFA 4ZQIA 4DNRB 4Y7NH 2NWGA 3H91A 1X55A 4X3TA 1HNWQ 3VR3A 4GKJH 1J9OA 3NTHA 2J9GA 1KLGD 5KG3A 4M9UA 4K0KH 1K3BC 2ZJTA 2UUAL 2CW7A 3PCOB 4UCTA 2YU9H 3GTGA 5IP7G 1PRTC 1KXLA 1KIXA 2YRXA 1DM0B 1CFMA 1T94A 4GNXB 2D0OA 4JYAL 4NPSA 5LMNW 5CMDA 4YR3A 1IBLH 4RKBA 5KEEA 4QW9A 3H09A 2DNCA 4UHVA 5T1GA 1JDBB 3UI2A 2PI2A 1EHIA 1UEBA 4OO1I 3T51B 2VPSA 2F0HA 2K50A 3KDFA 3TS0A 1HNXQ 1EOTA 3QIAA 4KJOA 4O4HF 3NK9A 5A35A 4A2BA 1TWAB 3J7AF 4C3HB 3K5LA 2CH4A 3STBD 4PDBA 1ICFB 1M8AA 4UAIA 2XWJB 2VOBA 1Q8IA 1HQRD 3HOZH 5FPRA 1NSNS 4L5QA 1VQ8A 4LF6Q 4A3IH 3JC66 1KAAA 4Q8EA 2RKSA 4K5WA 4DK6C 4RU9A 3P7JA 3PW4A 4FBTA 2BA1A 2PBZA 2B39A 2UUCQ 1X9NA 1GYFA 1TWHH 4C2MB 4V190 2PQAB 1OWTA 1HJPA 3KF8B 4QGUA 2E2HB 3U9SA 4IURA 1BQQT 2YV5A 1HA6A 4C3JB 3GTMB 4DV5L 1SFOA 4YIJA 2K05A 5KFLA 2C35B 2UXBQ 4I7ZC 3VYUA 4GKKQ 2OQ0A 1B9NA 3H94A 1EQRA 4BBSH 5IYCG 2BCOA 4RB0A 4QIWE 4O2AF 1TT2A 1TQOA 2PZUA 3PUVA 3EYYA 4DUZL 4FU0A 5H80A 2CQAA 4LW1A 2UXDL 4DR1H 4B3TH 1STHA 4DV1Q 3GTOB 5GAGC 3J81i 2MCTA 3L4JA 1RCVD 3MHBA 3RV3A 4CDEC 2I5LX 2NU8B 4OO1H 1WR2A 2NVTH 2Y0SA 2YYAA 3T1HQ 2UXCL 1LTBD 4DL5A 2XCAA 3CAMA 5LL6X 4RB3C 2EYLA 3HOWH 1D2BA 4LF5H 5KFYA 2Z0SA 3HOVB 1S5CD 1FJGL 1BUVT 1U9RA 1I6UA 1I6HH 5KFHA 4JI5H 2IX0A 4AQYQ 1QJOA 4IUTA 2E8GA 2HHHQ 3NSWA 3MXNB 1BCPD 4UFZA
chains in the Genus database with same CATH topology
1JJCB 1EFWA 1SE8A 2PQAA 4JI2Q 1BBWA 3PSIA 2R7DA 3ULJA 1VQJA 2CCZA 4JI8L 3OYYA 5M5XH 4P73A 1Q82C 1Q46A 3D0FA 3KJOA 3KF6B 4IO9A 2A1AA 1UE7A 3HKSA 1JJGA 2ZM6L 4KHPL 1YHQA 3S15H 4JBWA 4WJ3M 1R9TH 1PH8A 2JA8H 3RZDH 2HIXA 2L15A 5IYDG 1NJIC 1WFQA 2CQOA 1A0IA 2H5XA 5C3EG 2A8VA 1MKHA 1WOCA 2N8NA 5IT9c 3TQYA 4A3JH 2E5LQ 3UE0A 1SRUA 3GTKH 3I4NG 1O7IA 3K7AH 5M3FG 1S40A 1K0RA 1XMOL 1PYSB 2JA9A 5IE8A 5C44H 3G6EA 2E2JH 1N36Q 1PH1A 3CCRA 2K75A 2ZJQA 4YHHL 2R92H 2N78A 3B6YA 4JBKA 2ATWA 1NMFA 1VQFA 3DLLA 1GKHA 2KENA 2JA7H 5IYCH 5IP9H 4AYBE 1CKNA 4DR6L 1TWGH 1AE3A 3CC7A 1VQAA 1YJ9A 5C4XH 2VW9A 2NVXH 4DKAC 2CWAA 1HNZL 5C0XI 1BVSA 3W1BA 4JI6L 3CPFA 4DAMA 4IOCA 1H95A 4IPCA 1X54A 2VZAA 3Q8DA 1KD1C 3CC4A 2DGYA 4DV2L 3CP0A 2K4KA 1G291 3AFPA 4DR2Q 2VS1A 3ER0A 3F2BA 4X64L 4DR4Q 1LTLA 2A19A 2VQEL 4XTCS 3PUYA 1E24A 2JEAI 1HZAA 1XPOA 1FL0A 2ZJPA 3UDXA 3CMEA 1Y1WH 1IBKQ 3A74A 3CXCA 3FP9A 3KF6A 3PUWA 1OXTA 4JBMA 3AFQA 3FKIH 1VQ7A 4EX5A 4DR5L 2F3IA 4R4CA 1HR0L 4OO1G 4QQBX 4IFDG 1JE5A 2ZTDA 3U50C 4HJ7A 1G51A 1P16A 4GKJQ 4B3MQ 1QVGA 4K0KQ 3TRZA 5J3BA 1NY4A 3RN5A 2NN6I 1WI5A 2YTXA 1C9OA 2UUCL 3TS2A 3U58A 4X65L 3BU2A 4MTNA 3KOJA 1XNRL 3CCQA 4X66Q 3ZJYC 3GD7A 3CCSA 2OTJA 1IBLQ 3PGZA 5ELNA 4C3HH 4YCUA 1K73C 3PV0A 1M1KC 2AMCB 1Z47A 2BA0A 1UE6A 4GLAC 1XNQQ 2OCEA 5LMUL 1HZBA 4JV5L 1KHIA 1PH7A 5GQOA 1J5EQ 4NXML 1OXUA 3CF5A 5HGQA 1BKBA 1SROA 4DV4Q 3UDGA 1XPRA 1JB7A 4A3DG 1LM0A 2JA8G 4J15A 3PUXA 4HJ9A 4PG3A 3PO3H 1VS0A 4DR3Q 4HIMA 4DV1L 4L5SA 3H3VI 3S1MH 2IHEA 1XMQL 2GVBA 3UDFA 4A3JG 5JJLA 2UUAQ 2K5HA 2XGTA 3AQQA 2AWOA 4LUZA 4R4TA 1IZ6A 2YTYA 1Q1BA 3CCMA 2E2HH 3T1HL 2R92G 4A3KG 4HIKA 4A3MH 3S24A 4NXNL 4GN3B 2V1CC 3WWVA 1VQOA 1VQLA 2JA7G 1D7QA 5IY0A 3A5ZB 4FDBA 2VQFL 2B63H 3F8TA 3HOXH 5AJ3Q 4Y52H 1K83H 3M4OH 1IBMQ 5IYBH 5JJKA 3KFUA 1N9WA 1VQDA 1YITA 3JAMc 2JE6I 4ALPA 4A3EG 4B3RL 2HT1A 3I4MG 4BA2I 2FXQA 2ZTEA 1JT8A 2LXKA 4JI1Q 1N33L 4BA1I 1CKOA 4TQUS 1UE1A 2B3GA 3I2ZA 1V1QA 1I94L 1HZ9A 2WAQG 4MZ9A 3ERSX 3F2DA 1A8VA 2EXDA 4YWLA 4DV6Q 3CC2A 4OWXB 1PH9A 1Y1VG 1Y1WG 4LNQA 5FLMH 1QUQB 5LMNL 3HOZG 2Z6KA 4DR1Q 3T1YL 2Q2UA 4B3TQ 2JQOA 3I55A 1K9MC 1XPUA 3PUZA 3I56A 1E1TA 3EBEA 1PFSA 1WCMH 4DV3L 2WB1G 1VQ4A 4LFBQ 4LF8Q 2AHOB 2HIVA 4YY3L 4L5TA 3SGIA 4LF5Q 4JI3L 3UDIA 2I5MX 2UU9L 1EQQA 1W3SA 1VCIA 3ULPA 3CW2C 2EQSA 2WAQE 4JI5Q 1JJ2A 3GTGH 1C0AA 3D31A 4A3DH 1EYGA 1AE2A 3K8AA 4R1JA 3BZCA 1X3FA 3S17H 2LSSA 1OXVA 2R6GA 1E22A 4DUZQ 3M9BA 2I0QA 4LF4L 2UXDQ 3E0EA 1DGSA 1HNWL 4C3IH 2KCMA 3J81c 3CPWA 4YWMA 3J80c 3KYHC 4H02A 4RG1A 4A3KH 2WB1E 1A63A 2CFMA 3PO3G 5C0XG 3OTOL 1A62A 2RHSB 4OX9Q 2F4VQ 2NZOA 1Q81C 2HQLA 4LF9Q 2UUBQ 4JOIC 4DPGA 1PHJA 3PIPA 3HKZG 4ME3A 1QUQA 4GOPC 4PZ7A 4JI7Q 3OW2A 1L1OC 3EIVA 4A75A 2AWNA 4A3EH 4A3MG 1FJGQ 1FGUA 3NENA 4YCWA 2R7ZG 4GKJL 4P74A 3I4MH 1K3RA 3GO5A 1CSQA 4WJ4A 3S14H 2DUDA 4P71A 2B63G 3IRBA 3HFZB 4OWTB 3HOXG 1HNXL 4JI4Q 1N32Q 1ASZA 2MNAA 3AYHB 1WYDA 2OWOA 4B3SQ 5H1SE 3CCVA 5IYBG 3CCLA 2Q2HA 4GN4B 2WFWA 4JI8Q 1Y1VH 4GLXA 3K80C 3I7FA 1JMCA 4POFA 1YEZA 1XNQL 4A4IA 4LF6L 5JEAG 1B8AA 2I5HA 1V9PA 3RLOA 3NEMA 2NVQH 4LFAQ 3PF4A 3A0JA 3HOYG 3J81j 3RN2A 4R4IA 3CCEA 1Z9FA 4DV4L 5DLQE 5FLMG 3CD6A 1KRTA 1I5FA 1KC8C 4APVA 4DR3L 2KHJA 4DUYL 1KL9A 1XMOQ 1IYJB 1YZ6A 4OXPA 4X62L 2QA4A 3HOVG 1PYBA 3E9IA 1Q7YC 4LUVA 4YHHQ 3CCUA 1CUKA 1PH5A 4GNXC 2LXJA 1N34Q 2IX1A 1PA6A 3M4QA 4DAYB 1TWAH 1WCMG 4HJAA 2KCTA 3RLFA 1GM5A 4GN5A 5FJ8G 1EIYB 4POGA 2BH2A 2UXBL 2VNUD 2BH8A 1NMGA 4A3BH 4A93H 2MO1A 4GKKL 1CSPA 3PIOA 4JOIA 3U4ZA 4JI6Q 1U0LA 5AJ3L 4IJHA 4DR7Q 4GOPA 4JCVE 1U5KA 4DV0L 5GROA 3L2PA 1L1OA 4KHPQ 4YWKA 4DV2Q 4LWCA 1VQKA 3EN2A 3ICEA 5M3MG 4UP8A 5BR8L 1VQ9A 3K0XA 3F1ZA 3TEHB 1UWVA 2VQEQ 3KLWA 3AEVA 3H15A 1S3OA 3RLNA 4JI1L 4JI0Q 1SMXA 1VQNA 4C2MH 2K5VA 4IOAA 4A76A 4O2DA 1BBUA 2R7ZH 3L7ZC 1NBWA 4DV6L 4C3JH 3GTMH 4JYAQ 2IY5B 1HR0Q 1TWFH 4DR1L 1VQPA 1W2BA 4MNOA 1Q86C 4B3TL 1KQSA 4LF7Q 1IXRA 1HH2P 1NTGA 4AQYL 2ALYB 4UP9A 2VL6A 3UE1A 2HHHL 2K14A 5IWAQ 4L5RC 2D62A 2IT1A 2VY3A 1D8LA 4X65Q 1N8RC 4JI2L 1XNRQ 1LYLA 2KHIA 3GTOH 2AKWB 4LF5L 1T9HA 1V43A 3F2CA 4JG2A 2ZJRA 1AH9A 2PI2E 3HOYH 4BXXG 2R7FA 1VQBA 4JI5L 4A3LH 4PZ6A 3GDEA 3NBHB 4PMWA 4AH6A 5LMUQ 4IPHA 2JJQA 4R4OA 3S1RH 4JV5Q 4NXMQ 2N3SA 2Q2IA 1TWCH 4BY7G 1OXXK 3PO2G 2E5LL 3HOVH 1XJVA 2OTLA 4DV7Q 1OTCA 1YHBA 4AIMA 4IFDJ 3G71A 1N36L 3M3YH 1XMQQ 5FJ8H 3ULLA 4GLVB 1G6PA 4HIDA 4A3FG 4OX9L 3W5OA 4QY7A 2PMZE 4DV5Q 4LF9L 1K8AC 1E3PA 4KLKA 1VQ5A 3H3VH 3LGJA 2GVAA 4BBRG 1VQMA 1HR0W 2CWPA 1EWIA 3BJUA 4JI7L 1PVOA 1QZHA 2PNHA 2N49A 2KBNA 5M3MH 4A3BG 4HJ8A 4A93G 1K8GA 3E9HA 4OWWB 1SR3A 2E2IH 2D0PA 2XTIA 2Y0SG 4P72A 3G48A 4DR2L 2JA6G 2B29A 2MO0A 2Q2TA 1N32L 4DR4L 4B3RQ 4B3SL 1KAWA 1C7YA 1KRSA 4O0AA 1OXSC 3HOUG 4HJ5A 5K36G 1N33Q 2ASBA 3TREA 4DNIA 1GVPA 4AYBG 1IBKL 1FVIA 4KHZA 2VUMH 1I94Q 4A3CG 2R93G 5M5WH 2UXCQ 3H0GG 1GO3E 1QVCA 1Y14B 1SN8A 5FLXc 4LFAL 5LMNQ 1YBYA 2MFIA 4YCVA 3T1YQ 3STBC 1EUJA 4P75A 1TXYA 1I50H 4JBJA 4JC0A 4NB3A 5M5YH 4GOPB 4UP7A 4B3ML 4K0KL 4A3IG 1L1OB 2MQHA 4LFCQ 3MXNB 2Y0SE 3CMAA 1YJNA 2JA5H 2F52A 2K52A 1QZGA 3KDFB 3KJPA 4UY8C 1MJEA 1CKMA 1Q1EA 1PV4A 1PH3A 1VQEA 4X66L 4DV3Q 5JJIA 1L0WA 4BXXH 4RMFA 1SLJA 4QL5A 4YY3Q 1N34L 1IBLL 3CCJA 4JI3Q 2GN5A 2UU9Q 1E7ZA 4IPDA 3CQZH 3S1QH 1RIPA 3W1GA 3S2HH 1VQHA 2RF4A 2NN6G 3U4VA 2ZM6Q 1SFOH 4BY7H 1VQGA 1YI2A 3PO2H 1EOVA 3HKZE 3FHWA 3RNUA 1J5EL 5ELOA 4A3LG 4DR7L 4A3GH 4OONA 4BBSG 4QJFA 1X65A 4Y7NH 3GTLH 3GTPH 2IHFA 4LF4Q 1X3EA 1X55A 1X3GA 3L0OA 4A3FH 1HNWQ 4IPGA 1IL2A 1X6OA 1UE5A 1YVCA 4HIOA 4R4QA 1ASYA 2UUAL 4JI0L 3PCOB 4BBRH 1PH2A 2YU9H 3OTOQ 5IP7G 1KXLA 5GADC 1KIXA 1MIUA 2NZHA 4GNXB 2QGQA 2D0OA 4DR6Q 4NPSA 2YTVA 4JYAL 1YNXA 5LMNW 1HNZQ 4BY1G 3GTJH 2JA6H 4LF7L 1IBML 2PI2A 2YYZA 3MEFA 2JEBI 1UEBA 1RL2A 4PZ8A 5E7NA 5IWAL 3HOUH 3HOWG 3S1NH 4IFDI 2K50A 3KDFA 3TS0A 1HNXQ 3JAMi 1Q8KA 5HY6A 3A5UA 4X64Q 4TVAB 3S2DH 1VQCA 2R93H 3VDYA 1PH6A 2NVYH 4A3CH 3J7A5 2CKZB 3H0GH 3STBD 3M85A 3J7ZC 4LUOA 2ZTCA 1J6QA 3DM3A 2Z6KC 3HOZH 5IYDH 4GS3A 4L5QA 2K5NA 1VQ8A 5C3EH 4DR5Q 4LF6Q 4A3IH 3JC66 2VUMG 1YIJA 3I4NH 3PF5A 5C0XJ 4DK6C 5M3FH 2WP8J 4XIGS 2BA1A 1S72A 1GD7A 2UUCQ 1LUZA 4DV7L 2JK8A 1X9NA 1TWHH 4DUYQ 2PQAB 1HJPA 3KF8B 4IJLA 4QGUA 4X62Q 4LF8L 3GTQH 4LFBL 1B70B 1EIFA 2JA5G 4UPAA 2YV5A 2ID0A 3BZKA 4DV5L 1L2FA 4DK3C 5C44G 2C35B 1PH4A 1P8LA 1Q12A 1QVFA 1YHAA 4GNXA 2UXBQ 3K81C 4GKKQ 2OQ0A 2ES2A 1VQ6A 1EQRA 4BBSH 5IYCG 5IP9G 3G4SA 4QIWE 4OO1I 2RCNA 4EQ5A 2RHQB 5C4XG 1HZCA 3PUVA 4KI0A 4DV0Q 5EAYA 1I3QH 4DUZL 5C4JH 3M4PA 4LW1A 2UXDL 5BR8Q 2QEXA 5JEAJ 3RR5A 5IP7H 4DV1Q 4A3GG 5GAGC 3J81i 3J80i 2EIFA 1VQIA 1XTDA 2I5LX 2F4VL 4JI4L 2NVTH 2OQKA 4BY1H 3S16H 1YJWA 3T1HQ 2UUBL 2UXCL 1CKNB 3I4OA 5GAEC 4NXNQ 3CAMA 1WJJA 3RZOH 3HOWH 1E1OA 3K7UC 5GAHC 3M7NA 1MJCA 2Z0SA 2VQFQ 1FJGL 3NELA 3FKIG 1I6HH 2IX0A 4LFCL 4AQYQ 2HHHQ 1M90C 2E8GA 1B7YB 1NE3A 1X56A 4X6AH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJC B;  1EFW A;  1SE8 A;  2PQA A;  4JI2 Q;  1BBW A;  3PSI A;  2R7D A;  3ULJ A;  1VQJ A;  2CCZ A;  4JI8 L;  3OYY A;  5M5X H;  4P73 A;  1Q82 C;  1Q46 A;  3D0F A;  3KJO A;  3KF6 B;  4IO9 A;  2A1A A;  1UE7 A;  3HKS A;  1JJG A;  2ZM6 L;  4KHP L;  1YHQ A;  3S15 H;  4JBW A;  4WJ3 M;  1R9T H;  1PH8 A;  2JA8 H;  3RZD H;  2HIX A;  2L15 A;  5IYD G;  1NJI C;  1WFQ A;  2CQO A;  1A0I A;  2H5X A;  5C3E G;  2A8V A;  1MKH A;  1WOC A;  2N8N A;  5IT9 c;  3TQY A;  4A3J H;  2E5L Q;  3UE0 A;  1SRU A;  3GTK H;  3I4N G;  1O7I A;  3K7A H;  5M3F G;  1S40 A;  1K0R A;  1XMO L;  1PYS B;  2JA9 A;  5IE8 A;  5C44 H;  3G6E A;  2E2J H;  1N36 Q;  1PH1 A;  3CCR A;  2K75 A;  2ZJQ A;  4YHH L;  2R92 H;  2N78 A;  3B6Y A;  4JBK A;  2ATW A;  1NMF A;  1VQF A;  3DLL A;  1GKH A;  2KEN A;  2JA7 H;  5IYC H;  5IP9 H;  4AYB E;  1CKN A;  4DR6 L;  1TWG H;  1AE3 A;  3CC7 A;  1VQA A;  1YJ9 A;  5C4X H;  2VW9 A;  2NVX H;  4DKA C;  2CWA A;  1HNZ L;  5C0X I;  1BVS A;  3W1B A;  4JI6 L;  3CPF A;  4DAM A;  4IOC A;  1H95 A;  4IPC A;  1X54 A;  2VZA A;  3Q8D A;  1KD1 C;  3CC4 A;  2DGY A;  4DV2 L;  3CP0 A;  2K4K A;  1G29 1;  3AFP A;  4DR2 Q;  2VS1 A;  3ER0 A;  3F2B A;  4X64 L;  4DR4 Q;  1LTL A;  2A19 A;  2VQE L;  4XTC S;  3PUY A;  1E24 A;  2JEA I;  1HZA A;  1XPO A;  1FL0 A;  2ZJP A;  3UDX A;  3CME A;  1Y1W H;  1IBK Q;  3A74 A;  3CXC A;  3FP9 A;  3KF6 A;  3PUW A;  1OXT A;  4JBM A;  3AFQ A;  3FKI H;  1VQ7 A;  4EX5 A;  4DR5 L;  2F3I A;  4R4C A;  1HR0 L;  4OO1 G;  4QQB X;  4IFD G;  1JE5 A;  2ZTD A;  3U50 C;  4HJ7 A;  1G51 A;  1P16 A;  4GKJ Q;  4B3M Q;  1QVG A;  4K0K Q;  3TRZ A;  5J3B A;  1NY4 A;  3RN5 A;  2NN6 I;  1WI5 A;  2YTX A;  1C9O A;  2UUC L;  3TS2 A;  3U58 A;  4X65 L;  3BU2 A;  4MTN A;  3KOJ A;  1XNR L;  3CCQ A;  4X66 Q;  3ZJY C;  3GD7 A;  3CCS A;  2OTJ A;  1IBL Q;  3PGZ A;  5ELN A;  4C3H H;  4YCU A;  1K73 C;  3PV0 A;  1M1K C;  2AMC B;  1Z47 A;  2BA0 A;  1UE6 A;  4GLA C;  1XNQ Q;  2OCE A;  5LMU L;  1HZB A;  4JV5 L;  1KHI A;  1PH7 A;  5GQO A;  1J5E Q;  4NXM L;  1OXU A;  3CF5 A;  5HGQ A;  1BKB A;  1SRO A;  4DV4 Q;  3UDG A;  1XPR A;  1JB7 A;  4A3D G;  1LM0 A;  2JA8 G;  4J15 A;  3PUX A;  4HJ9 A;  4PG3 A;  3PO3 H;  1VS0 A;  4DR3 Q;  4HIM A;  4DV1 L;  4L5S A;  3H3V I;  3S1M H;  2IHE A;  1XMQ L;  2GVB A;  3UDF A;  4A3J G;  5JJL A;  2UUA Q;  2K5H A;  2XGT A;  3AQQ A;  2AWO A;  4LUZ A;  4R4T A;  1IZ6 A;  2YTY A;  1Q1B A;  3CCM A;  2E2H H;  3T1H L;  2R92 G;  4A3K G;  4HIK A;  4A3M H;  3S24 A;  4NXN L;  4GN3 B;  2V1C C;  3WWV A;  1VQO A;  1VQL A;  2JA7 G;  1D7Q A;  5IY0 A;  3A5Z B;  4FDB A;  2VQF L;  2B63 H;  3F8T A;  3HOX H;  5AJ3 Q;  4Y52 H;  1K83 H;  3M4O H;  1IBM Q;  5IYB H;  5JJK A;  3KFU A;  1N9W A;  1VQD A;  1YIT A;  3JAM c;  2JE6 I;  4ALP A;  4A3E G;  4B3R L;  2HT1 A;  3I4M G;  4BA2 I;  2FXQ A;  2ZTE A;  1JT8 A;  2LXK A;  4JI1 Q;  1N33 L;  4BA1 I;  1CKO A;  4TQU S;  1UE1 A;  2B3G A;  3I2Z A;  1V1Q A;  1I94 L;  1HZ9 A;  2WAQ G;  4MZ9 A;  3ERS X;  3F2D A;  1A8V A;  2EXD A;  4YWL A;  4DV6 Q;  3CC2 A;  4OWX B;  1PH9 A;  1Y1V G;  1Y1W G;  4LNQ A;  5FLM H;  1QUQ B;  5LMN L;  3HOZ G;  2Z6K A;  4DR1 Q;  3T1Y L;  2Q2U A;  4B3T Q;  2JQO A;  3I55 A;  1K9M C;  1XPU A;  3PUZ A;  3I56 A;  1E1T A;  3EBE A;  1PFS A;  1WCM H;  4DV3 L;  2WB1 G;  1VQ4 A;  4LFB Q;  4LF8 Q;  2AHO B;  2HIV A;  4YY3 L;  4L5T A;  3SGI A;  4LF5 Q;  4JI3 L;  3UDI A;  2I5M X;  2UU9 L;  1EQQ A;  1W3S A;  1VCI A;  3ULP A;  3CW2 C;  2EQS A;  2WAQ E;  4JI5 Q;  1JJ2 A;  3GTG H;  1C0A A;  3D31 A;  4A3D H;  1EYG A;  1AE2 A;  3K8A A;  4R1J A;  3BZC A;  1X3F A;  3S17 H;  2LSS A;  1OXV A;  2R6G A;  1E22 A;  4DUZ Q;  3M9B A;  2I0Q A;  4LF4 L;  2UXD Q;  3E0E A;  1DGS A;  1HNW L;  4C3I H;  2KCM A;  3J81 c;  3CPW A;  4YWM A;  3J80 c;  3KYH C;  4H02 A;  4RG1 A;  4A3K H;  2WB1 E;  1A63 A;  2CFM A;  3PO3 G;  5C0X G;  3OTO L;  1A62 A;  2RHS B;  4OX9 Q;  2F4V Q;  2NZO A;  1Q81 C;  2HQL A;  4LF9 Q;  2UUB Q;  4JOI C;  4DPG A;  1PHJ A;  3PIP A;  3HKZ G;  4ME3 A;  1QUQ A;  4GOP C;  4PZ7 A;  4JI7 Q;  3OW2 A;  1L1O C;  3EIV A;  4A75 A;  2AWN A;  4A3E H;  4A3M G;  1FJG Q;  1FGU A;  3NEN A;  4YCW A;  2R7Z G;  4GKJ L;  4P74 A;  3I4M H;  1K3R A;  3GO5 A;  1CSQ A;  4WJ4 A;  3S14 H;  2DUD A;  4P71 A;  2B63 G;  3IRB A;  3HFZ B;  4OWT B;  3HOX G;  1HNX L;  4JI4 Q;  1N32 Q;  1ASZ A;  2MNA A;  3AYH B;  1WYD A;  2OWO A;  4B3S Q;  5H1S E;  3CCV A;  5IYB G;  3CCL A;  2Q2H A;  4GN4 B;  2WFW A;  4JI8 Q;  1Y1V H;  4GLX A;  3K80 C;  3I7F A;  1JMC A;  4POF A;  1YEZ A;  1XNQ L;  4A4I A;  4LF6 L;  5JEA G;  1B8A A;  2I5H A;  1V9P A;  3RLO A;  3NEM A;  2NVQ H;  4LFA Q;  3PF4 A;  3A0J A;  3HOY G;  3J81 j;  3RN2 A;  4R4I A;  3CCE A;  1Z9F A;  4DV4 L;  5DLQ E;  5FLM G;  3CD6 A;  1KRT A;  1I5F A;  1KC8 C;  4APV A;  4DR3 L;  2KHJ A;  4DUY L;  1KL9 A;  1XMO Q;  1IYJ B;  1YZ6 A;  4OXP A;  4X62 L;  2QA4 A;  3HOV G;  1PYB A;  3E9I A;  1Q7Y C;  4LUV A;  4YHH Q;  3CCU A;  1CUK A;  1PH5 A;  4GNX C;  2LXJ A;  1N34 Q;  2IX1 A;  1PA6 A;  3M4Q A;  4DAY B;  1TWA H;  1WCM G;  4HJA A;  2KCT A;  3RLF A;  1GM5 A;  4GN5 A;  5FJ8 G;  1EIY B;  4POG A;  2BH2 A;  2UXB L;  2VNU D;  2BH8 A;  1NMG A;  4A3B H;  4A93 H;  2MO1 A;  4GKK L;  1CSP A;  3PIO A;  4JOI A;  3U4Z A;  4JI6 Q;  1U0L A;  5AJ3 L;  4IJH A;  4DR7 Q;  4GOP A;  4JCV E;  1U5K A;  4DV0 L;  5GRO A;  3L2P A;  1L1O A;  4KHP Q;  4YWK A;  4DV2 Q;  4LWC A;  1VQK A;  3EN2 A;  3ICE A;  5M3M G;  4UP8 A;  5BR8 L;  1VQ9 A;  3K0X A;  3F1Z A;  3TEH B;  1UWV A;  2VQE Q;  3KLW A;  3AEV A;  3H15 A;  1S3O A;  3RLN A;  4JI1 L;  4JI0 Q;  1SMX A;  1VQN A;  4C2M H;  2K5V A;  4IOA A;  4A76 A;  4O2D A;  1BBU A;  2R7Z H;  3L7Z C;  1NBW A;  4DV6 L;  4C3J H;  3GTM H;  4JYA Q;  2IY5 B;  1HR0 Q;  1TWF H;  4DR1 L;  1VQP A;  1W2B A;  4MNO A;  1Q86 C;  4B3T L;  1KQS A;  4LF7 Q;  1IXR A;  1HH2 P;  1NTG A;  4AQY L;  2ALY B;  4UP9 A;  2VL6 A;  3UE1 A;  2HHH L;  2K14 A;  5IWA Q;  4L5R C;  2D62 A;  2IT1 A;  2VY3 A;  1D8L A;  4X65 Q;  1N8R C;  4JI2 L;  1XNR Q;  1LYL A;  2KHI A;  3GTO H;  2AKW B;  4LF5 L;  1T9H A;  1V43 A;  3F2C A;  4JG2 A;  2ZJR A;  1AH9 A;  2PI2 E;  3HOY H;  4BXX G;  2R7F A;  1VQB A;  4JI5 L;  4A3L H;  4PZ6 A;  3GDE A;  3NBH B;  4PMW A;  4AH6 A;  5LMU Q;  4IPH A;  2JJQ A;  4R4O A;  3S1R H;  4JV5 Q;  4NXM Q;  2N3S A;  2Q2I A;  1TWC H;  4BY7 G;  1OXX K;  3PO2 G;  2E5L L;  3HOV H;  1XJV A;  2OTL A;  4DV7 Q;  1OTC A;  1YHB A;  4AIM A;  4IFD J;  3G71 A;  1N36 L;  3M3Y H;  1XMQ Q;  5FJ8 H;  3ULL A;  4GLV B;  1G6P A;  4HID A;  4A3F G;  4OX9 L;  3W5O A;  4QY7 A;  2PMZ E;  4DV5 Q;  4LF9 L;  1K8A C;  1E3P A;  4KLK A;  1VQ5 A;  3H3V H;  3LGJ A;  2GVA A;  4BBR G;  1VQM A;  1HR0 W;  2CWP A;  1EWI A;  3BJU A;  4JI7 L;  1PVO A;  1QZH A;  2PNH A;  2N49 A;  2KBN A;  5M3M H;  4A3B G;  4HJ8 A;  4A93 G;  1K8G A;  3E9H A;  4OWW B;  1SR3 A;  2E2I H;  2D0P A;  2XTI A;  2Y0S G;  4P72 A;  3G48 A;  4DR2 L;  2JA6 G;  2B29 A;  2MO0 A;  2Q2T A;  1N32 L;  4DR4 L;  4B3R Q;  4B3S L;  1KAW A;  1C7Y A;  1KRS A;  4O0A A;  1OXS C;  3HOU G;  4HJ5 A;  5K36 G;  1N33 Q;  2ASB A;  3TRE A;  4DNI A;  1GVP A;  4AYB G;  1IBK L;  1FVI A;  4KHZ A;  2VUM H;  1I94 Q;  4A3C G;  2R93 G;  5M5W H;  2UXC Q;  3H0G G;  1GO3 E;  1QVC A;  1Y14 B;  1SN8 A;  5FLX c;  4LFA L;  5LMN Q;  1YBY A;  2MFI A;  4YCV A;  3T1Y Q;  3STB C;  1EUJ A;  4P75 A;  1TXY A;  1I50 H;  4JBJ A;  4JC0 A;  4NB3 A;  5M5Y H;  4GOP B;  4UP7 A;  4B3M L;  4K0K L;  4A3I G;  1L1O B;  2MQH A;  4LFC Q;  3MXN B;  2Y0S E;  3CMA A;  1YJN A;  2JA5 H;  2F52 A;  2K52 A;  1QZG A;  3KDF B;  3KJP A;  4UY8 C;  1MJE A;  1CKM A;  1Q1E A;  1PV4 A;  1PH3 A;  1VQE A;  4X66 L;  4DV3 Q;  5JJI A;  1L0W A;  4BXX H;  4RMF A;  1SLJ A;  4QL5 A;  4YY3 Q;  1N34 L;  1IBL L;  3CCJ A;  4JI3 Q;  2GN5 A;  2UU9 Q;  1E7Z A;  4IPD A;  3CQZ H;  3S1Q H;  1RIP A;  3W1G A;  3S2H H;  1VQH A;  2RF4 A;  2NN6 G;  3U4V A;  2ZM6 Q;  1SFO H;  4BY7 H;  1VQG A;  1YI2 A;  3PO2 H;  1EOV A;  3HKZ E;  3FHW A;  3RNU A;  1J5E L;  5ELO A;  4A3L G;  4DR7 L;  4A3G H;  4OON A;  4BBS G;  4QJF A;  1X65 A;  4Y7N H;  3GTL H;  3GTP H;  2IHF A;  4LF4 Q;  1X3E A;  1X55 A;  1X3G A;  3L0O A;  4A3F H;  1HNW Q;  4IPG A;  1IL2 A;  1X6O A;  1UE5 A;  1YVC A;  4HIO A;  4R4Q A;  1ASY A;  2UUA L;  4JI0 L;  3PCO B;  4BBR H;  1PH2 A;  2YU9 H;  3OTO Q;  5IP7 G;  1KXL A;  5GAD C;  1KIX A;  1MIU A;  2NZH A;  4GNX B;  2QGQ A;  2D0O A;  4DR6 Q;  4NPS A;  2YTV A;  4JYA L;  1YNX A;  5LMN W;  1HNZ Q;  4BY1 G;  3GTJ H;  2JA6 H;  4LF7 L;  1IBM L;  2PI2 A;  2YYZ A;  3MEF A;  2JEB I;  1UEB A;  1RL2 A;  4PZ8 A;  5E7N A;  5IWA L;  3HOU H;  3HOW G;  3S1N H;  4IFD I;  2K50 A;  3KDF A;  3TS0 A;  1HNX Q;  3JAM i;  1Q8K A;  5HY6 A;  3A5U A;  4X64 Q;  4TVA B;  3S2D H;  1VQC A;  2R93 H;  3VDY A;  1PH6 A;  2NVY H;  4A3C H;  3J7A 5;  2CKZ B;  3H0G H;  3STB D;  3M85 A;  3J7Z C;  4LUO A;  2ZTC A;  1J6Q A;  3DM3 A;  2Z6K C;  3HOZ H;  5IYD H;  4GS3 A;  4L5Q A;  2K5N A;  1VQ8 A;  5C3E H;  4DR5 Q;  4LF6 Q;  4A3I H;  3JC6 6;  2VUM G;  1YIJ A;  3I4N H;  3PF5 A;  5C0X J;  4DK6 C;  5M3F H;  2WP8 J;  4XIG S;  2BA1 A;  1S72 A;  1GD7 A;  2UUC Q;  1LUZ A;  4DV7 L;  2JK8 A;  1X9N A;  1TWH H;  4DUY Q;  2PQA B;  1HJP A;  3KF8 B;  4IJL A;  4QGU A;  4X62 Q;  4LF8 L;  3GTQ H;  4LFB L;  1B70 B;  1EIF A;  2JA5 G;  4UPA A;  2YV5 A;  2ID0 A;  3BZK A;  4DV5 L;  1L2F A;  4DK3 C;  5C44 G;  2C35 B;  1PH4 A;  1P8L A;  1Q12 A;  1QVF A;  1YHA A;  4GNX A;  2UXB Q;  3K81 C;  4GKK Q;  2OQ0 A;  2ES2 A;  1VQ6 A;  1EQR A;  4BBS H;  5IYC G;  5IP9 G;  3G4S A;  4QIW E;  4OO1 I;  2RCN A;  4EQ5 A;  2RHQ B;  5C4X G;  1HZC A;  3PUV A;  4KI0 A;  4DV0 Q;  5EAY A;  1I3Q H;  4DUZ L;  5C4J H;  3M4P A;  4LW1 A;  2UXD L;  5BR8 Q;  2QEX A;  5JEA J;  3RR5 A;  5IP7 H;  4DV1 Q;  4A3G G;  5GAG C;  3J81 i;  3J80 i;  2EIF A;  1VQI A;  1XTD A;  2I5L X;  2F4V L;  4JI4 L;  2NVT H;  2OQK A;  4BY1 H;  3S16 H;  1YJW A;  3T1H Q;  2UUB L;  2UXC L;  1CKN B;  3I4O A;  5GAE C;  4NXN Q;  3CAM A;  1WJJ A;  3RZO H;  3HOW H;  1E1O A;  3K7U C;  5GAH C;  3M7N A;  1MJC A;  2Z0S A;  2VQF Q;  1FJG L;  3NEL A;  3FKI G;  1I6H H;  2IX0 A;  4LFC L;  4AQY Q;  2HHH Q;  1M90 C;  2E8G A;  1B7Y B;  1NE3 A;  1X56 A;  4X6A H; 
#chains in the Genus database with same CATH topology
 5IOD A;  2MGS A;  3HKZ A;  4JI2 Q;  3PSI A;  1VQJ A;  4JI8 L;  3OYY A;  1Q82 C;  2E5L H;  5I2X A;  1Q46 A;  1G8Z D;  3KF6 B;  4BS9 A;  4MTK A;  2ZXP A;  4IO9 A;  1VBG A;  1STN A;  1UE7 A;  1AFP A;  1SJH D;  4YR2 A;  4OX9 H;  5E4X A;  1PH8 A;  4DL6 A;  1O78 A;  1XYI A;  3M9M B;  4LF9 H;  1PYW D;  1JOK A;  1M6V A;  5EWF A;  2CQO A;  2H5X A;  3TQY A;  4A3J H;  3ETH A;  1KJ9 A;  4JI7 H;  1S40 A;  2F1M A;  4J9M A;  1K0R A;  5KG5 A;  3MFY A;  5M5W B;  4JBK A;  2ATW A;  1VQF A;  3MR3 A;  2JA7 H;  4DR4 H;  5IP9 H;  4RUC A;  1TWG H;  3CC7 A;  3ORQ A;  4KY7 A;  5EGT A;  1A6X A;  1BVS A;  1TWC A;  4WRD A;  5C1P A;  2F3V A;  4DAM A;  4MTD A;  4O42 A;  1W6K A;  1X54 A;  1FKA H;  1DYQ A;  2DGY A;  2EJF C;  3CHB D;  4DV2 L;  3CP0 A;  2K4K A;  4Q43 A;  2RGR A;  5DG7 A;  3MFG A;  2YRW A;  3F2B A;  2F0F A;  4I65 A;  2B2W C;  4R8I A;  4MV1 A;  4B3M H;  3N8D A;  3J7A K;  2Z6B A;  3S2H B;  3RUP A;  2AQ4 A;  1IBK Q;  5DQI A;  1JR0 D;  1VF7 A;  3MC0 B;  3FKI H;  4YHH H;  1FR3 A;  1HR0 L;  1N34 H;  1CE8 A;  1JE5 A;  2ZTD A;  3QOJ A;  4GKJ Q;  2EDG A;  4K0K Q;  3TRZ A;  1WH2 A;  3U9T A;  2NN6 I;  4ZKC B;  1WI5 A;  2YTX A;  2PPB C;  1G91 A;  1PK8 A;  5D1O B;  3K58 A;  1QWY A;  1DV2 A;  2LMC B;  4K6D A;  4DR7 H;  4J9O A;  2L12 A;  3ND9 A;  2EY2 A;  1AEX A;  2VUM A;  1EY4 A;  5I47 A;  2W6N A;  3MXP A;  4KHV A;  3CCS A;  3QFF A;  2OTJ A;  1IBL Q;  5ELN A;  1ILP A;  1K73 C;  3PV0 A;  4L8J A;  4DAV A;  2EYM A;  3LWB A;  2JA6 B;  2JEJ A;  1EU4 A;  5CV7 A;  1MHW C;  3GTK A;  3N6R A;  2JA5 A;  2JP1 A;  1F9R A;  4JYA H;  3SK8 A;  4AYB B;  1Z2P X;  3TIG A;  3SEB A;  3JAM W;  2NVY B;  4PG3 A;  3PO3 H;  1VS0 A;  1KJQ A;  3H3V I;  3H0G B;  4L5S A;  3TP5 A;  1EYC A;  4ZHQ F;  3CQZ A;  1A3T A;  1O7Z A;  2YTY A;  2IW3 A;  2N55 A;  4A3K G;  4HIK A;  4NXN L;  2F0J A;  2YZM A;  2V1C C;  1VQO A;  1VQL A;  3OHX C;  3A5Z B;  4FDB A;  2FB9 A;  1L0X B;  3PW5 A;  3GTL A;  5AJ3 Q;  2I46 A;  1HFG A;  2AUJ D;  3OWF A;  3C2P A;  1IBM Q;  3M4O H;  1G6Z A;  3MR2 A;  1F2L A;  5LMU H;  3CU7 A;  4HSP A;  4A3E G;  2K5D A;  4B3R L;  2HT1 A;  5DQH A;  1KAB A;  3X3N A;  1YNN C;  3DWQ A;  3J7A V;  3GIL A;  4IZ8 A;  5BN4 A;  1JT8 A;  2LXK A;  3GV5 B;  1CKO A;  2PN1 A;  5JEA H;  2DLN A;  1Y8O B;  2B3G A;  3I2Z A;  1PRT F;  3A56 A;  1KDC A;  1C3O A;  5KT2 A;  3BVZ A;  2L1B A;  1Y1V G;  3SVM A;  3EFX D;  4DR1 Q;  1I3Q B;  3T1Y L;  2Q2U A;  4B3T Q;  4DV5 H;  2JQO A;  1E4E B;  1S5E D;  3VR2 A;  4ULL A;  2R93 A;  2PW5 A;  1DZ1 A;  5DM6 3;  3OIP A;  2O2L D;  3U9O A;  1PFS A;  3KK7 A;  4BY1 B;  4DUZ H;  3NHH A;  4CKB A;  3SGI A;  4LF5 Q;  3IKJ A;  4JI3 L;  2RBM A;  2B2T C;  3RZO B;  3QZ8 A;  2K7V A;  2EQS A;  4JI5 Q;  4Q0F A;  1JJ2 A;  4M7E A;  3D31 A;  3PQI A;  4HNV A;  5C5J A;  1I94 H;  1X3F A;  2UXC H;  1A2T A;  1DCZ A;  2LSS A;  4C1N K;  1BOS A;  3W2D A;  3GTQ A;  4NW2 A;  3E0E A;  1DGS A;  1HNW L;  4C3I H;  1FJG H;  3J80 c;  1JOQ A;  1PZI D;  4QIW B;  4CKC A;  2CFM A;  5F9N A;  4OX9 Q;  4LF9 Q;  1ML0 D;  3RZD B;  3ETJ A;  3GV3 A;  1QUQ A;  4PZ7 A;  4JI7 Q;  4A3M G;  1FGU A;  3NEN A;  4XZ3 B;  4B9X A;  2F0P A;  2HDM A;  1AUV A;  3GO5 A;  1CSQ A;  3J80 E;  4ECT A;  2YZN A;  2DUD A;  5C44 B;  4P71 A;  4O2B F;  1HNX L;  1ZYR D;  3HOX G;  1U4P A;  2A69 C;  2MP1 A;  4FF1 A;  3R5F A;  4C5B A;  2RGV A;  2VB3 X;  3BVG A;  2XCL A;  4O4L F;  5F9L A;  1S0O A;  4IRD A;  4GLX A;  1R4Q B;  1FNU A;  3DHQ A;  4MN3 A;  1JMC A;  4EQP A;  1YEZ A;  5D1P A;  5DLG A;  4RFB A;  4A4I A;  4LF6 L;  3WDN A;  1B8A A;  4KHP Q;  1PTO B;  3NEM A;  4A3G B;  3OTO H;  5A2Q L;  2TMP A;  3J81 j;  2AQ2 B;  4R4I A;  4Y7N B;  1RYR A;  3CCE A;  3D4D A;  2K01 A;  1I5F A;  1KC8 C;  4APV A;  4DR3 L;  3RBE A;  1XMO Q;  1IYJ B;  1YZ6 A;  3CRL C;  4OXP A;  2MPM A;  3E9I A;  2JEG A;  3CCU A;  4YHH Q;  4DV2 H;  4GNX C;  1N34 Q;  2F0Q A;  3M4Q A;  1TWA H;  3G6J B;  2VNU D;  2UXB L;  3Q22 A;  2BH8 A;  4A93 H;  3EQL C;  4GKK L;  4ZUJ A;  3FEW X;  1MGS A;  3U4Z A;  4MAM A;  1BNZ A;  4DR7 Q;  3T56 B;  4GOP A;  2RCF A;  1L1O A;  3L3O C;  4PMC A;  4N8X 1;  3MZ5 A;  1VQK A;  4UP8 A;  3ICE A;  2XGP A;  3TEH B;  2VPQ A;  4HCS A;  1UWV A;  3H15 A;  1EY8 A;  5FO7 B;  1C4Q A;  4JI1 L;  3RLN A;  4RUA A;  4ECQ A;  4UDU C;  4C2M H;  4KV6 A;  3RBD A;  2R6F A;  4I7A A;  1UEA B;  2RA4 A;  1JWM D;  3L7Z C;  4C3J H;  3GTM H;  4JYA Q;  2QEJ C;  3K6O A;  1QIL A;  1TWF H;  2OEO A;  1VQP A;  1Q86 C;  4MNO A;  2K32 A;  5IYZ F;  3JSN A;  2KCN A;  1KQS A;  4JV1 A;  3PMF A;  1J8I A;  4AQY L;  5COY A;  5EQ0 A;  3UE1 A;  2VL6 A;  2HHH L;  5ELE A;  1TU2 B;  5J1Z A;  1GGO A;  2J6T A;  3I70 A;  2EY5 A;  1N8R C;  4JI2 L;  1K8M A;  5J22 A;  1LYL A;  3NUC A;  2Q8T A;  1EQV A;  4DU9 A;  1M7J A;  3GTO H;  1I6V C;  2ZJR A;  3TSS A;  5KFB A;  5BN3 A;  2XCP A;  1VQB A;  4ED1 A;  3K3P A;  1DOL A;  4NLG A;  2IL8 A;  3MTS A;  1S4Z A;  4DA2 A;  5EJW A;  2HGS A;  5LMU Q;  4AH6 A;  2WB1 A;  4R4O A;  1EYD A;  1X3P A;  4JV5 Q;  1RK5 A;  1A3U A;  5LHY 1;  1AN7 A;  5C4Z A;  4NXN H;  4KKS A;  4Q5V A;  2EYH A;  3C0F B;  2QKI C;  3HOV H;  2CZG A;  5KFO A;  1Y8P B;  1B04 A;  4CJ2 C;  1SNO A;  4HMJ A;  4KD4 A;  3J81 W;  4U7C A;  1YHB A;  4IFD J;  2HDL A;  5ELC A;  1S10 A;  3ULL A;  2IP4 A;  1G6P A;  1MBY A;  4Q45 A;  4A3F G;  4C5C A;  5KFP A;  4QY7 A;  2PMZ E;  4DV5 Q;  4CJ1 B;  1VQ5 A;  4KLK A;  2DNE A;  4HCE A;  5DAU A;  3MXU A;  4BBR G;  3GP7 A;  4RAU C;  2CWP A;  1EWI A;  3BJU A;  4ZAI A;  1PVO A;  4I7H A;  4A3B G;  4HJ8 A;  4LH7 A;  3OMG A;  4CHT B;  2XTI A;  1ENF A;  2Y0S G;  2KCC A;  5DM7 3;  4P72 A;  3MR5 A;  3OSP A;  3TP7 A;  5J39 A;  2B29 A;  2MO0 A;  1N32 L;  2R7N A;  4EFB A;  3T1Y H;  1WVL A;  1FGB D;  1KAW A;  4B3S L;  5JH7 F;  2F0N A;  2RDF A;  4LAA A;  5KFJ A;  3LNN A;  3NBI A;  4HJ5 A;  4HSV A;  3MWY W;  2ASB A;  3PR4 A;  3TRE A;  4DNI A;  5HGT A;  1IBK L;  3GTG B;  1I94 Q;  5M5W H;  4A3D B;  2UXC Q;  2B63 A;  1QVC A;  3GQB A;  1SE2 A;  4O4I F;  4LFA L;  1WSC A;  4QMG A;  4V0B A;  5KFC A;  4UCR A;  4DAP A;  4A3J B;  1SYD A;  1U4R A;  2V9W A;  4K0K L;  2EYO A;  2MQH A;  1B44 D;  1YJN A;  2A6H C;  5GON F;  3KDF B;  1S9F A;  1MJE A;  1CKM A;  2A68 D;  1VQE A;  1LTG D;  4F7X A;  2JA7 B;  1I4P A;  4EGJ A;  1SLJ A;  4ED8 A;  1IBL L;  4DR2 H;  5KFR A;  1XWE A;  5CA1 F;  1RIP A;  3S2H H;  1STY A;  1VQH A;  2A73 B;  2NN6 G;  2RDJ A;  2EPB A;  1UAP A;  2IBK A;  5EPK A;  4RAZ A;  5K5P A;  2E76 C;  2C00 A;  2KSW A;  3VYR A;  1KNE A;  1DON A;  1EY9 A;  1WCM A;  3KAJ A;  4FVM A;  2IHF A;  1X3E A;  5DGA A;  1I7N A;  4IPG A;  4R4Q A;  1ASY A;  1MD2 D;  1STG A;  3OTO Q;  1HNX H;  1CK1 A;  2Z8L A;  3NWT A;  5GAD C;  2NVQ B;  1MIU A;  1D5M C;  1E0B A;  2EY6 A;  4WJW A;  1SNQ A;  2KQ3 A;  4HAE A;  2JA6 H;  4HR7 A;  5IGC A;  1IBM L;  2YYZ A;  5LA6 F;  5E7N A;  1ILQ A;  2F0W A;  1O80 A;  3JAM i;  1Q8K A;  1CA5 A;  1JKJ B;  4FF3 A;  2J4X A;  2PNR C;  5CB4 F;  5KFE A;  4P2C B;  2B2V C;  2NVY H;  5D65 A;  3J7A 5;  2C22 A;  5JVH 3;  1A15 A;  3NTI A;  1B7Y B;  3H0G H;  4QCL A;  3VR5 A;  4DR3 H;  3M85 A;  3J7Z C;  1S5B D;  4LUO A;  2Z6K C;  3Q24 A;  1BF4 A;  4ED0 A;  2VUM G;  1SYG A;  1ESR A;  2VQD A;  4EG0 A;  5C0X J;  5KG7 A;  1UUP A;  2F0M A;  2WP8 J;  5C4H A;  2UXB H;  4R8N A;  4X3S A;  4GKK H;  4XT1 B;  1EFI D;  3DEP A;  4ME6 A;  2WKC A;  2JK8 A;  2K5W A;  1EZ6 A;  4DXF A;  1Y1V A;  4C5A A;  3WOE A;  3HKZ B;  2FP4 B;  1HTL D;  1ZXT A;  1B70 B;  1EIF A;  2JA5 G;  3RF2 A;  3SE7 A;  2UVW A;  4CKE A;  2FPI B;  3BZK A;  2B2U A;  1Q12 A;  1EL0 A;  5FOB B;  2R7K A;  3K81 C;  4JI1 H;  1VQ6 A;  4UCO A;  4RA8 A;  3KHR A;  2F03 A;  1QCB D;  3FRP B;  3KUP A;  5C4X G;  2L55 A;  2WAC A;  4KI0 A;  1I3Q H;  4QW8 A;  1PRT D;  1S5D D;  2NUC A;  3M4P A;  1JX4 A;  4RB2 C;  1JIC A;  1MSH A;  1Z7T A;  3UQ8 A;  4AQY H;  3HOY B;  2EIF A;  2GPS A;  1VQI A;  1JIH A;  3PIP 3;  3CKI B;  4BY1 H;  3S16 H;  2F4I A;  2RDH A;  5KFD A;  4JI2 H;  4NXN Q;  1EEI D;  1WJJ A;  3RZO H;  5LXT F;  3EA6 A;  1TWC B;  5EKI A;  5GAH C;  3M7N A;  3NEL A;  1II3 A;  2OLS A;  4PMB A;  2XWB B;  1M90 C;  2K28 A;  3M3Y B;  3K5O A;  1X56 A;  1LTR D;  1EFW A;  5IGF A;  4RGM A;  2RSO A;  5DNF A;  2NB0 A;  2DY7 A;  1CM9 A;  5JPM C;  2CCZ A;  5M5X H;  1S0M A;  4O3N A;  2W9C B;  4G7H C;  1SYB A;  3H40 A;  3KLR A;  2FMC A;  5M3M B;  1AZQ A;  4KHP L;  4WJ3 M;  2L0C A;  5L1K A;  5LYJ F;  3RZD H;  2L15 A;  3Q8S B;  5IYD G;  2EJG C;  1WFQ A;  1LLR D;  3I72 A;  1MKH A;  1WOC A;  1A9X A;  4X3K A;  3I4N G;  1SRU A;  2HQE A;  5M3F G;  1OO9 B;  3OUZ A;  1NR4 A;  1XMO L;  1PYS B;  2JA9 A;  3G6E A;  5C44 H;  4FYD A;  2L11 A;  1WTO A;  4YHH L;  1B4O A;  3NE5 B;  3B6Y A;  3TQ1 A;  2C28 A;  1N32 H;  4B3S H;  5C5M A;  4AYB E;  2EY1 A;  1VQA A;  4MV3 A;  2NU7 B;  1C8C A;  2CWA A;  1HNZ L;  3DF7 A;  1LTI D;  1IBK H;  4CBV A;  2OF1 A;  3CPF A;  1H95 A;  1GUO A;  2JA5 B;  1CZG A;  2VZA A;  1LAB A;  1M4V A;  1PTO H;  3IN5 A;  1GSH A;  2I87 A;  4N9T A;  4NKL A;  1G29 1;  2Z1C A;  4DR2 Q;  4LFA H;  2FHT A;  1B3A A;  2DPJ A;  3TII A;  4X64 L;  4ECX A;  5EBD A;  2A19 A;  4K5X A;  2SEB D;  4B3M L;  1HZA A;  3J80 L;  1FL0 A;  4ETS A;  4WOR A;  3CME A;  1EIG A;  3A74 A;  3Q23 A;  4BY7 B;  3X3M A;  1PTO C;  4JBM A;  2L5T A;  2F3I A;  4R8U A;  1DD2 A;  2E2I A;  4YAJ B;  1TY0 A;  1BBX C;  4HJ7 A;  4PWQ A;  1P16 A;  3GTL B;  2CW0 D;  1QVG A;  5FD5 A;  4K2K A;  5J3B A;  1Y69 U;  3GII A;  3TZD A;  2E74 C;  1C9O A;  1V1P A;  3PR5 B;  2R8H A;  4MTN A;  1ICW A;  2HD3 A;  5JJZ A;  3GD7 A;  2H1E A;  3E3X A;  3PGZ A;  4A93 B;  1H9R A;  5FK9 C;  3ORR A;  2EZV A;  1M1K C;  2AMC B;  2PZT A;  1Z47 A;  1UE6 A;  2W57 A;  5LMU L;  1D5Z C;  2A6E C;  2W9B B;  4JV5 L;  5IGE A;  1SDF A;  3HOU B;  1PH7 A;  2X0S A;  4K8J A;  3S2D B;  4TV9 F;  2R93 B;  4J15 A;  4IAJ A;  4DR3 Q;  4J9S A;  4LSA A;  5DEH A;  3S1M H;  1IOV A;  3V6K A;  2R8K A;  1IBM H;  1EZ1 A;  4N8F A;  2B2W A;  2XGT A;  5C3W A;  3CCM A;  1Q1B A;  3R2I A;  4G4K A;  4MA0 A;  4X65 H;  1TWF B;  4A3M H;  1QE6 A;  4GN3 B;  3C1E A;  3I4N B;  1SYE A;  4RCN A;  3K5H A;  2C2R A;  4UCS A;  3R5X A;  1EWH A;  2VQF L;  2XC9 A;  4G3I A;  3GTP A;  1LTT D;  3HOX H;  1SNM A;  1VDZ A;  3KFU A;  4EBE A;  1VQD A;  5CBE E;  1YIT A;  3GTQ B;  4RZR A;  3GV8 B;  3I4M G;  5KFZ A;  3T5J A;  1E4F T;  2R7M A;  2FXQ A;  4JI1 Q;  1H9J A;  2NTS A;  3K59 A;  4TQU S;  1UE1 A;  4RNN A;  1I94 L;  2W8K A;  1HZ9 A;  2WAQ G;  3G6V A;  3GTJ A;  1A8V A;  2EXD A;  4DGZ A;  4IR9 A;  1SMY C;  1QUQ B;  4RGO S;  5IGB A;  4EBD A;  4ILW A;  2J0T D;  4IAL A;  1JWU D;  1CT1 D;  3BVM A;  1EY0 A;  2B8F A;  3DMU A;  3J80 W;  2WB1 G;  1EUC B;  5DG8 A;  2M00 A;  4DL3 A;  4J9L A;  2HIV A;  3ONA B;  5KG0 A;  4LMY A;  3UDI A;  5ELD A;  1W3S A;  1VCI A;  1EQQ A;  3TP6 A;  3CW2 C;  5KFT A;  1IL8 A;  3GTG H;  4K2L A;  3QOL A;  5EWG A;  4A3D H;  1EYG A;  1ZQ7 A;  3RB6 A;  3BAB A;  3K8A A;  4R1J A;  1HFN A;  5KFI A;  5KFX A;  2I0Q A;  4J9N A;  2KED A;  4U68 A;  5F2D A;  4ECS A;  1KDB A;  4Z9C B;  4ECV A;  4YWM A;  4H02 A;  4RG1 A;  1A63 A;  3RIZ A;  3OTO L;  1A62 A;  2RHS B;  2I80 A;  2NZO A;  5COR A;  2SNS A;  2HQL A;  3S15 B;  5HV6 A;  2HVR A;  4ZLT F;  4IUV A;  4R9W A;  5KGU A;  3PIP A;  3V4Z A;  4IQZ A;  5IGG A;  2AWN A;  4KN7 C;  2R7Z G;  5BPF A;  3WOF A;  4P74 A;  2R87 A;  1K3R A;  3S14 H;  4KHP H;  1GSA A;  2E2J B;  2B63 G;  4OHJ A;  3HFZ B;  1N32 Q;  2NU9 B;  2XRS D;  2P5Z X;  4B3S Q;  5H1S E;  3I4L A;  5IYB G;  3CCL A;  4J6H A;  3R3O A;  4OIJ A;  5TSS A;  1BR9 A;  2Q8R E;  4RGN A;  3Q8R B;  1XMO H;  2LS0 1;  4U6P A;  1IW7 C;  3DEO A;  4IUU A;  1XNQ L;  2V4Q A;  2NVQ H;  4ZYS A;  1V9P A;  3V6H A;  4LFA Q;  5KFQ A;  2J6U A;  2I8C A;  1SND A;  1O7L A;  1UNS A;  3AU7 A;  1F2Y A;  4DV4 L;  4XX0 B;  3GQC A;  5E3F A;  4ZKB B;  3CD6 A;  3VYS A;  1HNZ H;  2QIL A;  5IT9 L;  2YS6 A;  1JQY D;  2KHJ A;  4OGQ C;  1KL9 A;  3F2U A;  2QA4 A;  1LO5 D;  4LUV A;  5EPJ A;  5ELF A;  1V4Y A;  2LXJ A;  2IX1 A;  1EY7 A;  4F8M A;  1PA6 A;  1X32 A;  1WCM G;  1EIY B;  1GM5 A;  4X64 H;  2BH2 A;  5FJ8 G;  4NP5 A;  1R9T A;  1LAC A;  3W3A A;  4A3B H;  5I2Y A;  2MO1 A;  3V6J A;  5BMV F;  4TQS A;  3KLS X;  1YNJ C;  4O3S A;  4FS1 A;  4CDF C;  5GRO A;  3A54 A;  1AW7 A;  4YWK A;  1I4X A;  5KFA A;  2R92 A;  4LWC A;  3EN2 A;  2NU6 B;  4UCU A;  1CTM A;  3K5M A;  1VQN A;  2NVX A;  3VPC A;  5DG9 A;  3E6Z X;  1AN8 A;  4O2D A;  2R8G A;  3UFX B;  3SDZ A;  1I4G A;  1SAP A;  4DV6 L;  4X62 H;  5K2M A;  1ZEQ X;  2A69 D;  3TZU A;  3HZX A;  3IFT A;  5T14 A;  5FO8 B;  1QB5 D;  2ALY B;  2AQ1 B;  1U4L A;  3T4A C;  2K14 A;  2NUA B;  2IT1 A;  2JEI A;  1VF5 C;  4JV5 H;  2CW8 A;  4X65 Q;  1Y1W A;  2XIG A;  2R8J A;  1K0S A;  2NN6 H;  5BR8 H;  4JG2 A;  4PNY A;  2OH2 A;  5KT6 A;  1RD9 D;  4JV0 A;  2PI2 E;  3BDO A;  3HOY H;  1PTO F;  1KEE A;  2G9D A;  4J9Q A;  4PZ6 A;  3RB4 A;  3F8N A;  4IPH A;  4EEQ A;  4CJ0 B;  5KT3 A;  5CR3 A;  2D5D A;  4NXM Q;  4CDD C;  4Y8V B;  1TWC H;  1GLV A;  1OXX K;  3PO2 G;  3PN1 A;  1JCK B;  1FNV A;  1T5E A;  1SYF A;  1UC8 A;  2BR0 A;  1OTC A;  2VQF H;  4M8A A;  2ZXR A;  4JUZ A;  3G71 A;  3M3Y H;  5KG4 A;  3L9A X;  3M4I A;  3S16 B;  1ET6 A;  1CQJ B;  4APM A;  1QNK A;  3W5O A;  4RCO A;  1EEF D;  1BNC A;  2KUM A;  1GHJ A;  3H3V H;  1MSG A;  1BXT A;  1HR0 W;  5KFK A;  2AUK A;  4ID6 A;  5D3D A;  2YZG A;  2CVR A;  5M3M H;  2KBN A;  5I9P A;  1EQT A;  3MFI A;  4OWW B;  1AZP A;  1PZJ D;  4DR2 L;  3RB0 A;  2Q2T A;  5M5X B;  3H3V C;  1E4G T;  4Q0Y A;  1KRS A;  2E2H A;  2WE6 A;  1OXS C;  5K36 G;  2PVP A;  4H44 C;  4DNT B;  2EJM A;  1WTV A;  2VUM H;  5KT4 A;  1GUG A;  2FIN B;  5JOB A;  1E2Z A;  4PQX A;  3OWE B;  3GIQ A;  3T5K A;  3V96 A;  3NBH A;  3N6X A;  1K83 A;  5LMN Q;  2MFI A;  2RVL A;  3HOZ G;  1TXY A;  4DF7 A;  4HR7 B;  3WO0 A;  4UP7 A;  2WII B;  4A3I G;  1V1O A;  3OPO A;  2SDF A;  2Y0S E;  2A74 C;  2JA5 H;  4A3K B;  3GTO A;  1D1K A;  3BQ0 A;  1L0W A;  4BXX H;  1G2S A;  2QW7 A;  2LKV A;  3GID A;  4QL5 A;  4YY3 Q;  2C9O A;  4EGQ A;  2GN5 A;  4F87 A;  2UU9 Q;  1E7Z A;  4KY5 A;  3CQZ H;  4G7O C;  3W1G A;  2C2E A;  3HBL A;  3RGZ A;  2F0I A;  1I7L A;  1JOO A;  2RDI A;  2BQ3 A;  4A3E B;  1JC7 A;  5C5L A;  5FO9 B;  3BS1 A;  4BY7 H;  3MWM A;  1YI2 A;  2LFN A;  3HKZ E;  1KLU D;  2ICI A;  4CDC C;  4XT3 B;  2XRQ D;  4A3L G;  5JUM A;  5L1L A;  2K33 A;  4BBS G;  1X65 A;  3GTL H;  1JXL A;  3L0O A;  1X3G A;  1IL2 A;  1X6O A;  1YVC A;  1Y1V B;  1D6E C;  1H9S B;  1L0Y B;  4EYH B;  2NZH A;  1WTX A;  5M9O A;  1HNZ Q;  3RV4 A;  3A8I E;  2F0K A;  5KG1 A;  2JEB I;  2O5I C;  1RL2 A;  4PZ8 A;  5IWA L;  3HOU H;  2WV6 D;  3HOW G;  3S1N H;  1XNQ H;  4EBC A;  5HY6 A;  2NZ1 D;  4X64 Q;  4TVA B;  3S2D H;  1VQC A;  1CQI B;  1JE4 A;  3VDY A;  2R93 H;  4A3C H;  3M9N B;  4DV4 H;  2CKZ B;  2FJZ A;  3N41 B;  1WTH A;  1HA5 A;  4F88 A;  3GLK A;  3R23 A;  1GUN A;  2C5C A;  1BXR A;  2FJ2 A;  3S9W A;  4BWS C;  2ZTC A;  4XYM B;  5JQW A;  5IYD H;  2F0D A;  2A6H D;  4GS3 A;  2K5N A;  1YIJ A;  3I4N H;  3PF5 A;  3L4K A;  5M3F H;  4XIG S;  3BG5 A;  1GUW A;  3BG3 A;  1IYV A;  1GD7 A;  3S1M B;  4ED2 A;  2WAQ A;  1LUZ A;  1GHK A;  1GSO A;  4DUY Q;  3FDT A;  3GTQ H;  4X62 Q;  3AMU A;  4TRD A;  4A3M B;  4O3O A;  1K1S A;  4DK3 C;  1QVF A;  1BO0 A;  2D9U A;  4RB1 A;  3HOX B;  1KC7 A;  3G7L A;  1BJT A;  4J1M A;  1KTK A;  5IP9 G;  1B2T A;  2IJ0 A;  2RCN A;  2W6M A;  1X3Q A;  3LX0 A;  4DV0 Q;  4DV6 H;  1LT6 D;  4MV6 A;  2FLN A;  4F4Y A;  5BR8 Q;  5JEA J;  5KYL A;  5IP7 H;  3BQ1 A;  1PMR A;  2R85 A;  1JDE A;  4YQW A;  3J80 i;  1IYU A;  1XTD A;  4OIK A;  3WO1 A;  2W70 A;  1YJW A;  1HHV A;  3I4O A;  5GAE C;  1EYZ A;  5JVD F;  5DLF A;  5A2Q W;  3K7U C;  4YP3 A;  2VQF Q;  3JRX A;  3BJY A;  3JAM E;  3FKI G;  1SE4 A;  4QWC A;  5C6A A;  4LFC L;  3CVZ A;  4EQ5 A;  5KNB A;  4X6A H;  1I4H A;  1JJC B;  4IWX A;  4QWB A;  4Q44 A;  1SE8 A;  3T53 B;  1DIK A;  2PCF B;  4RKL A;  2R7D A;  2ZXO A;  3VR6 A;  3ULJ A;  1NUC A;  2R7Z A;  4P73 A;  3GIJ A;  3D0F A;  4KY6 A;  3KJO A;  4QWA A;  3EPG A;  2AU0 A;  5FPO A;  1S03 G;  2R3Z A;  1CZW A;  1PXU A;  2ZM6 L;  3S15 H;  1PLF A;  4R8U B;  1LV9 A;  1KDA A;  5D14 A;  5CV8 A;  2W9A A;  2HVQ A;  2F0O A;  2UUB H;  4CC6 A;  5C3E G;  2A8V A;  3SK5 A;  5IT9 c;  1V1P B;  1O7I A;  4B9W A;  3C3L A;  3T16 A;  2E2J H;  1N36 Q;  1PH1 A;  3E0J A;  5CYU A;  2BE5 C;  2N78 A;  2KEN A;  5IYC H;  3QJY A;  1CKN A;  4JPB W;  4DR6 L;  4FS2 A;  4MHE A;  2VW9 A;  1LT5 D;  4DKA C;  3W1B A;  5IT9 E;  3Q6S A;  3S14 B;  2E75 C;  4IPC A;  4MIU A;  1KD1 C;  1DOM A;  1ZKO A;  3CC4 A;  4LMQ D;  4JK1 C;  3LP8 A;  1NAP A;  2B2Y C;  2VS1 A;  2FMA A;  3ER0 A;  1O7Y A;  4RH6 A;  1LTL A;  2JEA I;  4XTC S;  3PUY A;  1E24 A;  3IG0 A;  1B9M A;  3BZD B;  3MVV A;  1K1Q A;  3MFH A;  3RTX A;  1RTN A;  3CXC A;  4DK1 A;  1SFO B;  3PUW A;  1OXT A;  3AFQ A;  4WD3 A;  4EX5 A;  4M1U B;  3TN2 A;  4R4C A;  4DR5 L;  4QQB X;  1SE3 A;  4IFD G;  3H20 A;  2ICE C;  4L1K A;  3U50 C;  1G51 A;  5FLX L;  3GTP B;  4C1N I;  2XIW A;  3RAX A;  1LTS D;  4A3F B;  1SNP A;  1NY4 A;  3OOC A;  3RN5 A;  3RMH A;  2YCH A;  4KD3 A;  3HRZ C;  4H13 C;  3FMA A;  4MV7 A;  4X65 L;  3BU2 A;  4BBR B;  5D3I B;  3RB3 A;  2ASJ A;  3M9O B;  2M2L A;  2GLT A;  3CCQ A;  4X66 Q;  3ZJY C;  2V4D A;  4QWE A;  4A3B B;  2R61 A;  3MEH A;  3FVQ A;  1RTO A;  2W71 A;  2Y0S B;  3GTJ B;  2BA0 A;  1XNQ Q;  1I50 A;  1BCP B;  2FFK B;  2OCE A;  1HZB A;  1J5E Q;  5GQO A;  4NXM L;  5KT5 A;  5HGQ A;  4DV4 Q;  1JB7 A;  1B3Q A;  1EYA A;  4FF2 A;  2JA8 G;  3T5H A;  5CV5 A;  3R2T A;  4HIM A;  5KFF A;  1S0N A;  2QCP X;  2GVB A;  5KRU A;  4L63 B;  5JJL A;  1C48 A;  2K5H A;  5ISR A;  2P0A A;  4LUZ A;  5IWA H;  4C3I G;  1IZ6 A;  1I4R A;  2R92 G;  3PZP A;  3TBI B;  1XNR H;  2V58 A;  3WWV A;  3MAQ A;  2X69 A;  4F50 A;  2B63 H;  3PVX A;  5LOV F;  1R4P B;  1LT4 D;  3JRW A;  2X6G A;  3T13 A;  5IYB H;  1JWS D;  1V51 A;  2W6Z A;  2F0L A;  4ALP A;  3VMM A;  1PTO D;  1RKN A;  3MWD A;  2YU9 A;  4QWD A;  2RDG A;  3KHG A;  2NBF A;  1BGW A;  3D6W A;  4ECR A;  3O13 A;  2H4O A;  4BA1 I;  5HUR A;  2AGQ A;  1N56 A;  1V1Q A;  3GV6 A;  1WTW A;  4MZ9 A;  3ERS X;  3F2D A;  4MA5 A;  4YWL A;  4EGV A;  4DV6 Q;  2OT2 A;  5LL6 b;  1Z6H A;  1TY2 A;  4N9P A;  1Y1W G;  3I91 A;  4LNQ A;  5LMN L;  5KND A;  4O3P A;  1EUD B;  4E6I A;  5C4J B;  2BQR A;  2K5Q A;  5BPH A;  1B6R A;  1IHZ A;  3I55 A;  2MUY A;  2XD4 A;  3EPI A;  1K9M C;  1XPU A;  2N88 A;  1E1T A;  1HXY D;  3EBE A;  3R93 A;  1WCM H;  1SBB B;  2NYZ D;  4LFB Q;  2EYF A;  4LF8 Q;  2AHO B;  3SR1 A;  2A6E D;  4YY3 L;  4L5T A;  1DJR D;  1SSO A;  4RNM A;  2MJ8 A;  2XSC A;  4J0M A;  1VBH A;  2I5M X;  2UU9 L;  1KBL A;  3ULP A;  1QG7 A;  2WAQ E;  2IA6 A;  1CHQ D;  1N33 H;  4C3H G;  5I6Y A;  2PO4 A;  2F0S A;  2FK1 A;  4B08 A;  4ZUI A;  2K03 A;  1OXV A;  2R6G A;  1TWH A;  1E22 A;  3OMC A;  1D5X C;  2IX3 A;  3M9B A;  3PW7 A;  3J7Y W;  5LP6 F;  4ECU A;  1HTP A;  2HCC A;  2A5H A;  3J81 c;  3CPW A;  2O5J C;  3MR6 A;  3M7G A;  1IKL A;  2TSS A;  4KK7 A;  4A3K H;  3KBG A;  3QZ7 A;  2VUM B;  2WB1 E;  4LFC H;  5C0X G;  2F4V Q;  2ATL A;  1A3V A;  4ZQ3 A;  1Q81 C;  2O03 A;  1S5F D;  2UUB Q;  1R9T B;  4X3U A;  4DV3 H;  1F9Q A;  3BA9 A;  4JOI C;  4EQN A;  3E5S A;  5T1I A;  5JVG 3;  3KLS A;  4ME3 A;  1M0T A;  3V4S A;  1ULZ A;  3OW2 A;  3EIV A;  3GTK B;  4A3E H;  2JYO A;  4I55 F;  3J81 E;  1NNX A;  2ZM6 H;  5IIF A;  3IRB A;  1O75 A;  4OWT B;  4JI4 Q;  1ASZ A;  2MNA A;  3AYH B;  4CC5 A;  4KTA A;  2OWO A;  2W6Q A;  5I6W A;  3CCV A;  4GN4 B;  1SMY D;  3QR8 A;  3CQZ B;  4KN4 C;  2WFW A;  3R5H A;  2NVX B;  1Y1V H;  3KAK A;  1RJP A;  5C4X B;  4IHJ F;  4LF4 H;  3BA8 A;  3K80 C;  1EY6 A;  3I3C A;  1CS0 A;  1UC9 A;  3T5L A;  4TQR A;  2I5H A;  3RLO A;  2DN8 A;  1ENA A;  4HMI A;  1Z9F A;  4DR6 H;  1D1I A;  4TSS A;  4EYI B;  5FLM G;  2QDL A;  1B1Z A;  3IAY A;  2DWC A;  4DUY L;  3NP8 A;  4X62 L;  1Y1W B;  2B2U C;  3HOV G;  1PH5 A;  3VA5 A;  1E2W A;  1VAJ A;  1SJE D;  2KCT A;  4ODG A;  3RLF A;  2FK2 A;  1PFN A;  1NMG A;  3OSO A;  2SNM A;  2WIN B;  1PZK D;  1FYC A;  1SEB D;  2IWH A;  2R86 A;  4JI6 Q;  3S1N B;  1SYX B;  4K5V A;  2OXP A;  3MXG A;  4DV0 L;  3L2P A;  2F3W A;  4DR5 H;  3DM1 A;  2UVU A;  1XXG A;  5BR8 L;  5K36 H;  1ZHQ A;  2CH4 W;  1LTA D;  3K0X A;  2VQE Q;  4XQJ A;  3I12 A;  2JA7 A;  1S3O A;  2FKL A;  1TII D;  4F4Z A;  1TWG A;  2JXM B;  4XDX A;  4A76 A;  1TAE A;  1WTR A;  2R7L A;  3ITP A;  5LL6 S;  2PQE A;  3SXH A;  2IY5 B;  1W6J A;  5M3F B;  2IMW P;  1F77 A;  3BAA A;  1W2B A;  2AGP A;  1IXR A;  1HH2 P;  1NTG A;  5I9O A;  4L5R C;  5IWA Q;  2ASL A;  2D62 A;  2F0U A;  1IW7 D;  1D8L A;  1XNR Q;  4NXM H;  5CV4 A;  2ZDG A;  4HQ6 A;  4MV9 A;  4DAY A;  1V43 A;  3F2C A;  1AUX A;  3FKI A;  4UCV A;  1KJ8 A;  1F9S A;  5CV6 A;  3KHL A;  2HVS A;  3D4W A;  4A3L H;  3GDE A;  4J9R A;  3NBH B;  4ZI7 F;  1STB A;  2F0G A;  1K83 B;  2V5A A;  2JJQ A;  3MWE A;  3S1R H;  1ONL A;  1RJQ A;  1PDQ A;  2Q2I A;  3SK6 A;  3VYT A;  4OEL B;  3NTK A;  2OTL A;  5G3L F;  1VKZ A;  1N36 L;  1XMQ Q;  3NPP A;  1YNJ D;  4ZRZ A;  3H4D A;  2VUG A;  1SXT A;  5ELB A;  1K8A C;  3N44 B;  3D8G A;  3FMC A;  1VQM A;  4EQO A;  3C1F A;  2ENB A;  3NQI A;  4YR0 A;  1K8G A;  3E9H A;  4ECY A;  1SR3 A;  2E2I H;  4EEY A;  2ALZ A;  1UNN C;  3GIK A;  4DL2 A;  2JA6 G;  5LMN H;  3GIP A;  3JAM L;  3Q8P B;  1STA A;  4O0A A;  2YW2 A;  3OSN A;  2LY7 A;  3RGX A;  2CW0 C;  1H9M A;  1N33 Q;  2EVB A;  4AYB G;  5DQG A;  1FVI A;  2FMM A;  3H0G G;  3FPU B;  5FD6 A;  4H0L C;  3S17 B;  1Y14 B;  4YY3 H;  5FLX c;  4RAY A;  3IL8 A;  1YBY A;  1YNN D;  4YCV A;  2M9V A;  1F2M A;  3STB C;  4A2A A;  2UU9 H;  1EUJ A;  4P75 A;  3TME A;  1AP0 A;  3FPP A;  4GOP B;  1XTC D;  2Z4H A;  3C46 A;  1L1O B;  4LFC Q;  2DZD A;  3CMA A;  4I50 F;  4UY8 C;  1QZG A;  4GZY C;  4DV3 Q;  4X66 L;  1EIH A;  4DFA A;  4LSX A;  3SK4 A;  1JOR A;  3CCJ A;  5KX5 F;  3ERO A;  4JW0 A;  3S1Q H;  2XNA C;  5FLX E;  2WTF A;  2ASD A;  2B2T A;  4K6L A;  3NGD A;  3U4V A;  2ZM6 Q;  1SFO H;  4DL7 A;  1WD0 A;  4IUQ A;  3I4M B;  4GC7 A;  2AQ3 B;  3FHW A;  4L6T B;  1J5E L;  5ELO A;  2HUG A;  4QJF A;  4KMU C;  3GTP H;  2WKD A;  2SOB A;  2WAQ B;  4LF4 Q;  4A3F H;  3FDS A;  1B33 N;  1UE5 A;  4HIO A;  1C30 A;  4JI0 L;  4BBR H;  1PH2 A;  2W9C A;  1HUN A;  2QGQ A;  4DR6 Q;  2YTV A;  1YNX A;  2KOL A;  2VR1 A;  4BY1 G;  3GTJ H;  2WB1 B;  3WNZ A;  4ED7 A;  2G9H D;  4LF7 L;  5FKA C;  2CHB D;  1S97 A;  2XN9 C;  3MEF A;  5JAV A;  5KT7 A;  3NXW A;  5EPL A;  2Z4I A;  1KJI A;  4IFD I;  1TVX A;  4ZK9 B;  3A5U A;  2KA7 A;  1H9K A;  5DGB A;  1PH6 A;  5KKN B;  5JPN C;  1BCP C;  4DUY H;  1TS3 A;  1J6Q A;  3DM3 A;  2ZDH A;  1EU3 A;  2KEE A;  2UUA H;  2FK3 A;  5C3E H;  4DR5 Q;  2FLP A;  4QUC A;  5KIX A;  1K8O A;  4NMZ A;  3Q0A A;  1GOZ A;  4FF4 A;  2PMZ A;  5AFW A;  1S72 A;  2PW7 A;  4DV7 L;  4BWG B;  2KVM A;  3I73 A;  3K57 A;  2ZDQ A;  1ESF A;  3JZI A;  4IJL A;  4LFB L;  4LF8 L;  4DV0 H;  2ZT9 C;  4UPA A;  3DXJ C;  2R7Z B;  2ID0 A;  4HED A;  4RZQ A;  3NWS A;  1L2F A;  1PH4 A;  1DXM A;  5C44 G;  1P8L A;  1YHA A;  1CHP D;  2DJF C;  2Z9H A;  5CV9 A;  3RUZ A;  4GNX A;  2O4X A;  2B63 B;  2RQX A;  2ES2 A;  3TP8 A;  3BDL A;  3G4S A;  2JSO A;  2RHQ B;  1HZC A;  5EAY A;  4I4T F;  3OUU A;  5C4J H;  2F0T A;  2KJX A;  2QEX A;  3RR5 A;  4K14 A;  4A3G G;  1BDO A;  1TWA A;  2D2C C;  4ABN A;  2F4V L;  1NR2 A;  2OQK A;  4IFD H;  4F4W A;  2UUB L;  5CA0 F;  5IOC A;  1CKN B;  2I07 B;  3IFD A;  1PFB A;  1KJJ A;  5KFG A;  1E1O A;  1QOH A;  2W9B A;  1MJC A;  5KYI A;  3SI8 A;  2VA2 A;  5KFV A;  4HNU A;  4HNT A;  3HGB A;  5IT9 W;  1WCM B;  1NE3 A;  4J9P A;  4IRC A;  4JI4 L;  4RGT A;  3KBX A;  3MA2 B;  4ZOL F;  4C2M A;  2PQA A;  3KF8 A;  5KFS A;  1BBW A;  4FXK C;  5CBA E;  3GTM A;  2UXD H;  4IR1 A;  1VMC A;  3LWU A;  1RHP A;  1TWF A;  4E4T A;  3PW2 A;  1N36 H;  2A1A A;  3HKS A;  1IKM A;  1JJG A;  2FE3 A;  2AGO A;  1YHQ A;  4JBW A;  1T3N A;  1R9T H;  2JA8 H;  5KFM A;  2XVS A;  2HIX A;  3A8K E;  4HTH A;  1NJI C;  1XDN A;  3GIM A;  4ED6 A;  2UVR A;  4RNO A;  1A0I A;  5L9X A;  2N8N A;  3GTK H;  4DK0 A;  2E5L Q;  3UE0 A;  2SCU B;  3K7A H;  3ZYY X;  3RD4 A;  4LK1 C;  3Q2O A;  2EYJ A;  5NUC A;  5IE8 A;  2ZJQ A;  2R92 H;  3G6X A;  3DWA A;  2K75 A;  3CCR A;  1Q90 A;  5EZY F;  1NMF A;  3DLL A;  1GKH A;  5CGK A;  2R82 A;  4XQN A;  3PIO 3;  3KTM A;  1FNW A;  1YJ9 A;  1AE3 A;  2NVX H;  3OW7 A;  5C4X H;  1I50 B;  4JI8 H;  3D4R A;  5C0X I;  5M5Y B;  3TIN A;  4JI6 L;  4YAK B;  4QB4 A;  1B50 A;  3QB3 A;  4IOC A;  3Q8D A;  2GPW A;  2W8L A;  2RSN A;  5EDW A;  2IPK D;  3MXN A;  3AFP A;  2J7Z A;  1N48 A;  1TS4 A;  4DR4 Q;  2VQE L;  2DPI A;  4ME5 A;  3J81 L;  4FO2 A;  3P20 A;  4HN7 A;  1XPO A;  2ZJP A;  3UDX A;  1GJX A;  1Y1W H;  5EKL A;  3FP9 A;  2K04 A;  3KF6 A;  3PO2 B;  2HJW A;  4X66 H;  4J9K A;  1PRT B;  1VQ7 A;  4OO1 G;  1KNA A;  3K5N A;  2E2D C;  5E1F A;  3JSL A;  4B3M Q;  1PFM A;  2F0E A;  2CQY A;  2UUC L;  3TS2 A;  5EWE A;  3U58 A;  3P75 A;  3QG1 A;  1QNU A;  3KOJ A;  1XNR L;  3A7L A;  2YU9 B;  5J2U F;  1J5E H;  3M4Y A;  3BYT B;  4C56 C;  5KG6 A;  4C3H H;  4YCU A;  3VR4 A;  4JI0 H;  4GLA C;  1ROD A;  1KHI A;  3RJ0 A;  3N52 A;  1OXU A;  2BE5 D;  2HCI A;  1BKB A;  1SRO A;  3CF5 A;  3UDG A;  1XPR A;  4A3D G;  1LM0 A;  5KFU A;  1HR0 H;  3PUX A;  4HJ9 A;  5C0X H;  1TR5 A;  4DV1 L;  4LF7 H;  2IHE A;  1XMQ L;  3UDF A;  2B2Y A;  4A3J G;  2UUA Q;  4R4T A;  3AQQ A;  2AWO A;  1U4M A;  3G8C A;  2BDN A;  2JEF A;  3HOZ B;  2E2H H;  4WFN 3;  4IWY A;  4XYO A;  3T1H L;  3VPD A;  1V8Q A;  4A3I B;  1SYC A;  3S24 A;  3VPB A;  4IRK A;  2W6O A;  1NCV A;  1D7Q A;  2JA7 G;  5HBR B;  1RJT A;  5IY0 A;  3ND8 A;  3P1H A;  3F8T A;  5E4W C;  1F9P A;  4Y52 H;  1G2T A;  1K83 H;  1TWH B;  5JJK A;  5D8D A;  4F4X A;  1N9W A;  3JAM c;  2JE6 I;  5D1O A;  4BA2 I;  3H4B A;  2ZTE A;  3D3R A;  1N33 L;  4KKU A;  4FXG C;  2VXW A;  4KJN A;  2B2V A;  4S3S A;  4G57 A;  4DV7 H;  2DJG C;  1W96 A;  3HB9 A;  1ZYR C;  2J6S A;  4BBS B;  5C1O A;  2XGQ A;  3CC2 A;  4LFB H;  2NTT A;  4LF8 H;  3S1R B;  2JA6 A;  4OWX B;  1PH9 A;  2FLL A;  4IUP A;  5G3L D;  5FLM H;  2Z6K A;  1SNC A;  4FM9 A;  4DXG A;  2R84 A;  1TS5 A;  3G6Y A;  4O3Q A;  1STE A;  4AYB A;  2NVY A;  2QF7 A;  3PUZ A;  3H0G A;  3I56 A;  4O3R A;  2F0V A;  4DV3 L;  1JB3 A;  1VQ4 A;  2NVT B;  1ET9 A;  2JN4 A;  2EXZ A;  1WTQ A;  3Q8Q B;  1CI3 M;  5L37 A;  4B3R H;  4MTE A;  1BCP F;  3HOW B;  1C0A A;  3HP3 A;  1RF2 D;  1I6H B;  2KHS A;  2E2I B;  4JV2 A;  3LML A;  2F4V H;  1AE2 A;  3BZC A;  3S17 H;  1CA6 A;  4QUF A;  1SEI A;  3HXL A;  3K5I A;  2BQU A;  1EY5 A;  1F2Z A;  1S68 A;  2W7P A;  4DUZ Q;  3QO2 A;  1CQF A;  1EWC A;  2L9H A;  4H7B A;  4LF4 L;  2UXD Q;  4MV4 A;  2KCM A;  1FD7 D;  1MZB A;  3KYH C;  1GUT A;  3PO3 G;  4JI4 H;  2YL2 A;  1HRJ A;  1B6S A;  3TQT A;  4QF4 A;  4DPG A;  1ZET A;  1PHJ A;  3HKZ G;  4GOP C;  4DN4 M;  1I3Q A;  4JI3 H;  1L1O C;  4A75 A;  4GKJ L;  2UVV A;  1FJG Q;  4YCW A;  4IN3 A;  1E4E A;  3I4M H;  4WJ4 A;  2VB2 X;  2B8G A;  5EBC A;  1GUS A;  1TKW B;  2C2D A;  1WYD A;  4NDX A;  5JVL A;  2QDB A;  4G7Z C;  2Q2H A;  3A8J E;  3S1Q B;  4JI8 Q;  1TWG B;  4IUN A;  4YB8 B;  1HNW H;  3I7F A;  4POF A;  3N42 B;  4XQQ A;  3BQ2 A;  3LWE A;  3QWN A;  5JEA G;  3PF4 A;  1E2V A;  1TA8 A;  4TV8 F;  1Z2O X;  3A0J A;  3HOY G;  4FXD A;  3RN2 A;  1K28 A;  2M05 A;  3OHA A;  1HQM C;  5DLQ E;  4RHR A;  4O1N A;  4XYL B;  3I90 A;  1KRT A;  3D6C A;  2GA4 B;  4JI6 H;  3N43 B;  1T5X D;  4QIW A;  1PYB A;  1Q7Y C;  1CUK A;  3FKI B;  4DAY B;  2FPG B;  3KXY T;  4HJA A;  4WBN F;  4GN5 A;  4POG A;  2VQE H;  1CSP A;  2FPP B;  4OEM B;  3TDQ A;  1WTP A;  3N40 P;  3HS0 C;  3PIO A;  2K1B A;  3CRK C;  5C3X A;  4JOI A;  4XXE A;  3HG9 A;  1U0L A;  5AJ3 L;  4IJH A;  4JCV E;  1U5K A;  4KKT A;  3OIQ A;  3DWP A;  4DV2 Q;  4LF6 H;  2EYP A;  5M3M G;  1CQV A;  1RJR A;  5I4D A;  1VQ9 A;  2V59 A;  3F1Z A;  4TUY F;  3KLW A;  3AEV A;  5CAE B;  4JI0 Q;  1SMX A;  3E5N A;  3SHL A;  2K5V A;  4IOA A;  2UUC H;  1BBU A;  5C3E B;  3V2T A;  4DL4 A;  3K3V A;  2R7Z H;  1NBW A;  3A55 A;  2X6L A;  5J2T F;  3HEJ A;  3DUZ A;  1HR0 Q;  4DR1 L;  4B3T L;  1SCU B;  4LF7 Q;  5KG2 A;  3Q1K A;  3PO3 B;  5EOY A;  4UP9 A;  1WD1 A;  1VMP A;  1ZHS A;  1JLL B;  3PW0 A;  2VY3 A;  1LT3 D;  3GV7 B;  3URY A;  4FP5 D;  2DIK A;  3R8B A;  3EJI A;  4U67 3;  1PX2 A;  5C8Y F;  2KHI A;  1H9S A;  5KNC A;  4ZCK A;  2AKW B;  3H6M A;  4K8I A;  4LF5 L;  1T9H A;  4ED3 A;  1AH9 A;  2PZW A;  4DV1 H;  2Q8I B;  4BXX G;  2R7F A;  4GC6 A;  2A68 C;  4JI5 L;  2L4N A;  1XMQ H;  4HYK A;  1RK6 A;  1GXD C;  4JVZ A;  1TS2 A;  5L1I A;  1Z2N X;  4FBU A;  4PMW A;  1DOK A;  3M4O B;  3T1H H;  2N3S A;  4BY7 G;  4ECZ A;  2E5L L;  2KEC A;  1B53 A;  1Q3L A;  1M0W A;  5KFW A;  1XJV A;  4DV7 Q;  2QYZ A;  4AIM A;  4ECW A;  5FJ8 H;  4GLV B;  2HHH H;  4HID A;  4OX9 L;  3RAQ A;  2DY8 A;  3RFC A;  4LF9 L;  1E3P A;  1XX8 A;  3OHB A;  4MV8 A;  3LGJ A;  2GVA A;  4LH6 A;  1W93 A;  1HUM A;  3I8Z A;  2EOT A;  2MHV A;  5FLX W;  4JI7 L;  2QK4 A;  2K6A A;  3BYY B;  1QZH A;  2PNH A;  2N49 A;  4J8Q A;  4TKO B;  1I4Q A;  4A93 G;  2W6P A;  2R8I A;  2D0P A;  3KHH A;  2EE1 A;  3G48 A;  4DLK A;  5IGD A;  4DR4 L;  4Q8F A;  4OL7 A;  3K0Y A;  4B3R Q;  1C7Y A;  3NQT A;  1RDP D;  3BDC A;  3HOU G;  4RHS A;  1T36 A;  4XYQ A;  2PYK A;  1GVP A;  2BOS A;  4KHZ A;  2R93 G;  4A3C G;  3ERQ A;  2BDO A;  2JA8 B;  2YS7 A;  1GO3 E;  2W7O A;  3A7A B;  1SN8 A;  3EVQ A;  4FNF A;  3T1Y Q;  1MI2 A;  4C3J G;  4YJ3 F;  4JC0 A;  1HPC A;  1I50 H;  4JBJ A;  4NB3 A;  4CGY B;  3K7A B;  4C3I B;  4RWS C;  4EVO A;  5M5Y H;  3AB9 A;  3SE0 A;  5KFN A;  1IOW A;  2R92 B;  4YJ2 F;  2F52 A;  2K52 A;  3KJP A;  4R7R A;  4YBZ B;  1Q1E A;  1PV4 A;  1PH3 A;  5JJI A;  2VA3 A;  4PV1 C;  4RMF A;  3KAL A;  2WYO A;  1N34 L;  1A2U A;  4IZO A;  4JI3 Q;  1ENC A;  1L2Z A;  2V4R A;  4IPD A;  5A2Q E;  1HCZ A;  5CC4 A;  5BN5 A;  2RF4 A;  4EFE A;  4LJZ C;  5EKK A;  1VQG A;  3PO2 H;  3VA7 A;  1EOV A;  2WDT A;  1Y8N B;  3RNU A;  2G5D A;  1RYS A;  4DR7 L;  1DV1 A;  5L1J A;  2PMZ B;  3V05 A;  4A3G H;  4OON A;  1EZ8 A;  3MJF A;  4ZQI A;  4DNR B;  4Y7N H;  2NWG A;  3H91 A;  1X55 A;  4X3T A;  1HNW Q;  3VR3 A;  4GKJ H;  1J9O A;  3NTH A;  2J9G A;  1KLG D;  5KG3 A;  4M9U A;  4K0K H;  1K3B C;  2ZJT A;  2UUA L;  2CW7 A;  3PCO B;  4UCT A;  2YU9 H;  3GTG A;  5IP7 G;  1PRT C;  1KXL A;  1KIX A;  2YRX A;  1DM0 B;  1CFM A;  1T94 A;  4GNX B;  2D0O A;  4JYA L;  4NPS A;  5LMN W;  5CMD A;  4YR3 A;  1IBL H;  4RKB A;  5KEE A;  4QW9 A;  3H09 A;  2DNC A;  4UHV A;  5T1G A;  1JDB B;  3UI2 A;  2PI2 A;  1EHI A;  1UEB A;  4OO1 I;  3T51 B;  2VPS A;  2F0H A;  2K50 A;  3KDF A;  3TS0 A;  1HNX Q;  1EOT A;  3QIA A;  4KJO A;  4O4H F;  3NK9 A;  5A35 A;  4A2B A;  1TWA B;  3J7A F;  4C3H B;  3K5L A;  2CH4 A;  3STB D;  4PDB A;  1ICF B;  1M8A A;  4UAI A;  2XWJ B;  2VOB A;  1Q8I A;  1HQR D;  3HOZ H;  5FPR A;  1NSN S;  4L5Q A;  1VQ8 A;  4LF6 Q;  4A3I H;  3JC6 6;  1KAA A;  4Q8E A;  2RKS A;  4K5W A;  4DK6 C;  4RU9 A;  3P7J A;  3PW4 A;  4FBT A;  2BA1 A;  2PBZ A;  2B39 A;  2UUC Q;  1X9N A;  1GYF A;  1TWH H;  4C2M B;  4V19 0;  2PQA B;  1OWT A;  1HJP A;  3KF8 B;  4QGU A;  2E2H B;  3U9S A;  4IUR A;  1BQQ T;  2YV5 A;  1HA6 A;  4C3J B;  3GTM B;  4DV5 L;  1SFO A;  4YIJ A;  2K05 A;  5KFL A;  2C35 B;  2UXB Q;  4I7Z C;  3VYU A;  4GKK Q;  2OQ0 A;  1B9N A;  3H94 A;  1EQR A;  4BBS H;  5IYC G;  2BCO A;  4RB0 A;  4QIW E;  4O2A F;  1TT2 A;  1TQO A;  2PZU A;  3PUV A;  3EYY A;  4DUZ L;  4FU0 A;  5H80 A;  2CQA A;  4LW1 A;  2UXD L;  4DR1 H;  4B3T H;  1STH A;  4DV1 Q;  3GTO B;  5GAG C;  3J81 i;  2MCT A;  3L4J A;  1RCV D;  3MHB A;  3RV3 A;  4CDE C;  2I5L X;  2NU8 B;  4OO1 H;  1WR2 A;  2NVT H;  2Y0S A;  2YYA A;  3T1H Q;  2UXC L;  1LTB D;  4DL5 A;  2XCA A;  3CAM A;  5LL6 X;  4RB3 C;  2EYL A;  3HOW H;  1D2B A;  4LF5 H;  5KFY A;  2Z0S A;  3HOV B;  1S5C D;  1FJG L;  1BUV T;  1U9R A;  1I6U A;  1I6H H;  5KFH A;  4JI5 H;  2IX0 A;  4AQY Q;  1QJO A;  4IUT A;  2E8G A;  2HHH Q;  3NSW A;  3MXN B;  1BCP D;  4UFZ A; 
#chains in the Genus database with same CATH homology
 1JJC B;  1EFW A;  1SE8 A;  2PQA A;  4JI2 Q;  1BBW A;  3PSI A;  2R7D A;  3ULJ A;  1VQJ A;  2CCZ A;  4JI8 L;  3OYY A;  5M5X H;  4P73 A;  1Q82 C;  1Q46 A;  3D0F A;  3KJO A;  3KF6 B;  4IO9 A;  2A1A A;  1UE7 A;  3HKS A;  1JJG A;  2ZM6 L;  4KHP L;  1YHQ A;  3S15 H;  4JBW A;  4WJ3 M;  1R9T H;  1PH8 A;  2JA8 H;  3RZD H;  2HIX A;  2L15 A;  5IYD G;  1NJI C;  1WFQ A;  2CQO A;  1A0I A;  2H5X A;  5C3E G;  2A8V A;  1MKH A;  1WOC A;  2N8N A;  5IT9 c;  3TQY A;  4A3J H;  2E5L Q;  3UE0 A;  1SRU A;  3GTK H;  3I4N G;  1O7I A;  3K7A H;  5M3F G;  1S40 A;  1K0R A;  1XMO L;  1PYS B;  2JA9 A;  5IE8 A;  5C44 H;  3G6E A;  2E2J H;  1N36 Q;  1PH1 A;  3CCR A;  2K75 A;  2ZJQ A;  4YHH L;  2R92 H;  2N78 A;  3B6Y A;  4JBK A;  2ATW A;  1NMF A;  1VQF A;  3DLL A;  1GKH A;  2KEN A;  2JA7 H;  5IYC H;  5IP9 H;  4AYB E;  1CKN A;  4DR6 L;  1TWG H;  1AE3 A;  3CC7 A;  1VQA A;  1YJ9 A;  5C4X H;  2VW9 A;  2NVX H;  4DKA C;  2CWA A;  1HNZ L;  5C0X I;  1BVS A;  3W1B A;  4JI6 L;  3CPF A;  4DAM A;  4IOC A;  1H95 A;  4IPC A;  1X54 A;  2VZA A;  3Q8D A;  1KD1 C;  3CC4 A;  2DGY A;  4DV2 L;  3CP0 A;  2K4K A;  1G29 1;  3AFP A;  4DR2 Q;  2VS1 A;  3ER0 A;  3F2B A;  4X64 L;  4DR4 Q;  1LTL A;  2A19 A;  2VQE L;  4XTC S;  3PUY A;  1E24 A;  2JEA I;  1HZA A;  1XPO A;  1FL0 A;  2ZJP A;  3UDX A;  3CME A;  1Y1W H;  1IBK Q;  3A74 A;  3CXC A;  3FP9 A;  3KF6 A;  3PUW A;  1OXT A;  4JBM A;  3AFQ A;  3FKI H;  1VQ7 A;  4EX5 A;  4DR5 L;  2F3I A;  4R4C A;  1HR0 L;  4OO1 G;  4QQB X;  4IFD G;  1JE5 A;  2ZTD A;  3U50 C;  4HJ7 A;  1G51 A;  1P16 A;  4GKJ Q;  4B3M Q;  1QVG A;  4K0K Q;  3TRZ A;  5J3B A;  1NY4 A;  3RN5 A;  2NN6 I;  1WI5 A;  2YTX A;  1C9O A;  2UUC L;  3TS2 A;  3U58 A;  4X65 L;  3BU2 A;  4MTN A;  3KOJ A;  1XNR L;  3CCQ A;  4X66 Q;  3ZJY C;  3GD7 A;  3CCS A;  2OTJ A;  1IBL Q;  3PGZ A;  5ELN A;  4C3H H;  4YCU A;  1K73 C;  3PV0 A;  1M1K C;  2AMC B;  1Z47 A;  2BA0 A;  1UE6 A;  4GLA C;  1XNQ Q;  2OCE A;  5LMU L;  1HZB A;  4JV5 L;  1KHI A;  1PH7 A;  5GQO A;  1J5E Q;  4NXM L;  1OXU A;  3CF5 A;  5HGQ A;  1BKB A;  1SRO A;  4DV4 Q;  3UDG A;  1XPR A;  1JB7 A;  4A3D G;  1LM0 A;  2JA8 G;  4J15 A;  3PUX A;  4HJ9 A;  4PG3 A;  3PO3 H;  1VS0 A;  4DR3 Q;  4HIM A;  4DV1 L;  4L5S A;  3H3V I;  3S1M H;  2IHE A;  1XMQ L;  2GVB A;  3UDF A;  4A3J G;  5JJL A;  2UUA Q;  2K5H A;  2XGT A;  3AQQ A;  2AWO A;  4LUZ A;  4R4T A;  1IZ6 A;  2YTY A;  1Q1B A;  3CCM A;  2E2H H;  3T1H L;  2R92 G;  4A3K G;  4HIK A;  4A3M H;  3S24 A;  4NXN L;  4GN3 B;  2V1C C;  3WWV A;  1VQO A;  1VQL A;  2JA7 G;  1D7Q A;  5IY0 A;  3A5Z B;  4FDB A;  2VQF L;  2B63 H;  3F8T A;  3HOX H;  5AJ3 Q;  4Y52 H;  1K83 H;  3M4O H;  1IBM Q;  5IYB H;  5JJK A;  3KFU A;  1N9W A;  1VQD A;  1YIT A;  3JAM c;  2JE6 I;  4ALP A;  4A3E G;  4B3R L;  2HT1 A;  3I4M G;  4BA2 I;  2FXQ A;  2ZTE A;  1JT8 A;  2LXK A;  4JI1 Q;  1N33 L;  4BA1 I;  1CKO A;  4TQU S;  1UE1 A;  2B3G A;  3I2Z A;  1V1Q A;  1I94 L;  1HZ9 A;  2WAQ G;  4MZ9 A;  3ERS X;  3F2D A;  1A8V A;  2EXD A;  4YWL A;  4DV6 Q;  3CC2 A;  4OWX B;  1PH9 A;  1Y1V G;  1Y1W G;  4LNQ A;  5FLM H;  1QUQ B;  5LMN L;  3HOZ G;  2Z6K A;  4DR1 Q;  3T1Y L;  2Q2U A;  4B3T Q;  2JQO A;  3I55 A;  1K9M C;  1XPU A;  3PUZ A;  3I56 A;  1E1T A;  3EBE A;  1PFS A;  1WCM H;  4DV3 L;  2WB1 G;  1VQ4 A;  4LFB Q;  4LF8 Q;  2AHO B;  2HIV A;  4YY3 L;  4L5T A;  3SGI A;  4LF5 Q;  4JI3 L;  3UDI A;  2I5M X;  2UU9 L;  1EQQ A;  1W3S A;  1VCI A;  3ULP A;  3CW2 C;  2EQS A;  2WAQ E;  4JI5 Q;  1JJ2 A;  3GTG H;  1C0A A;  3D31 A;  4A3D H;  1EYG A;  1AE2 A;  3K8A A;  4R1J A;  3BZC A;  1X3F A;  3S17 H;  2LSS A;  1OXV A;  2R6G A;  1E22 A;  4DUZ Q;  3M9B A;  2I0Q A;  4LF4 L;  2UXD Q;  3E0E A;  1DGS A;  1HNW L;  4C3I H;  2KCM A;  3J81 c;  3CPW A;  4YWM A;  3J80 c;  3KYH C;  4H02 A;  4RG1 A;  4A3K H;  2WB1 E;  1A63 A;  2CFM A;  3PO3 G;  5C0X G;  3OTO L;  1A62 A;  2RHS B;  4OX9 Q;  2F4V Q;  2NZO A;  1Q81 C;  2HQL A;  4LF9 Q;  2UUB Q;  4JOI C;  4DPG A;  1PHJ A;  3PIP A;  3HKZ G;  4ME3 A;  1QUQ A;  4GOP C;  4PZ7 A;  4JI7 Q;  3OW2 A;  1L1O C;  3EIV A;  4A75 A;  2AWN A;  4A3E H;  4A3M G;  1FJG Q;  1FGU A;  3NEN A;  4YCW A;  2R7Z G;  4GKJ L;  4P74 A;  3I4M H;  1K3R A;  3GO5 A;  1CSQ A;  4WJ4 A;  3S14 H;  2DUD A;  4P71 A;  2B63 G;  3IRB A;  3HFZ B;  4OWT B;  3HOX G;  1HNX L;  4JI4 Q;  1N32 Q;  1ASZ A;  2MNA A;  3AYH B;  1WYD A;  2OWO A;  4B3S Q;  5H1S E;  3CCV A;  5IYB G;  3CCL A;  2Q2H A;  4GN4 B;  2WFW A;  4JI8 Q;  1Y1V H;  4GLX A;  3K80 C;  3I7F A;  1JMC A;  4POF A;  1YEZ A;  1XNQ L;  4A4I A;  4LF6 L;  5JEA G;  1B8A A;  2I5H A;  1V9P A;  3RLO A;  3NEM A;  2NVQ H;  4LFA Q;  3PF4 A;  3A0J A;  3HOY G;  3J81 j;  3RN2 A;  4R4I A;  3CCE A;  1Z9F A;  4DV4 L;  5DLQ E;  5FLM G;  3CD6 A;  1KRT A;  1I5F A;  1KC8 C;  4APV A;  4DR3 L;  2KHJ A;  4DUY L;  1KL9 A;  1XMO Q;  1IYJ B;  1YZ6 A;  4OXP A;  4X62 L;  2QA4 A;  3HOV G;  1PYB A;  3E9I A;  1Q7Y C;  4LUV A;  4YHH Q;  3CCU A;  1CUK A;  1PH5 A;  4GNX C;  2LXJ A;  1N34 Q;  2IX1 A;  1PA6 A;  3M4Q A;  4DAY B;  1TWA H;  1WCM G;  4HJA A;  2KCT A;  3RLF A;  1GM5 A;  4GN5 A;  5FJ8 G;  1EIY B;  4POG A;  2BH2 A;  2UXB L;  2VNU D;  2BH8 A;  1NMG A;  4A3B H;  4A93 H;  2MO1 A;  4GKK L;  1CSP A;  3PIO A;  4JOI A;  3U4Z A;  4JI6 Q;  1U0L A;  5AJ3 L;  4IJH A;  4DR7 Q;  4GOP A;  4JCV E;  1U5K A;  4DV0 L;  5GRO A;  3L2P A;  1L1O A;  4KHP Q;  4YWK A;  4DV2 Q;  4LWC A;  1VQK A;  3EN2 A;  3ICE A;  5M3M G;  4UP8 A;  5BR8 L;  1VQ9 A;  3K0X A;  3F1Z A;  3TEH B;  1UWV A;  2VQE Q;  3KLW A;  3AEV A;  3H15 A;  1S3O A;  3RLN A;  4JI1 L;  4JI0 Q;  1SMX A;  1VQN A;  4C2M H;  2K5V A;  4IOA A;  4A76 A;  4O2D A;  1BBU A;  2R7Z H;  3L7Z C;  1NBW A;  4DV6 L;  4C3J H;  3GTM H;  4JYA Q;  2IY5 B;  1HR0 Q;  1TWF H;  4DR1 L;  1VQP A;  1W2B A;  4MNO A;  1Q86 C;  4B3T L;  1KQS A;  4LF7 Q;  1IXR A;  1HH2 P;  1NTG A;  4AQY L;  2ALY B;  4UP9 A;  2VL6 A;  3UE1 A;  2HHH L;  2K14 A;  5IWA Q;  4L5R C;  2D62 A;  2IT1 A;  2VY3 A;  1D8L A;  4X65 Q;  1N8R C;  4JI2 L;  1XNR Q;  1LYL A;  2KHI A;  3GTO H;  2AKW B;  4LF5 L;  1T9H A;  1V43 A;  3F2C A;  4JG2 A;  2ZJR A;  1AH9 A;  2PI2 E;  3HOY H;  4BXX G;  2R7F A;  1VQB A;  4JI5 L;  4A3L H;  4PZ6 A;  3GDE A;  3NBH B;  4PMW A;  4AH6 A;  5LMU Q;  4IPH A;  2JJQ A;  4R4O A;  3S1R H;  4JV5 Q;  4NXM Q;  2N3S A;  2Q2I A;  1TWC H;  4BY7 G;  1OXX K;  3PO2 G;  2E5L L;  3HOV H;  1XJV A;  2OTL A;  4DV7 Q;  1OTC A;  1YHB A;  4AIM A;  4IFD J;  3G71 A;  1N36 L;  3M3Y H;  1XMQ Q;  5FJ8 H;  3ULL A;  4GLV B;  1G6P A;  4HID A;  4A3F G;  4OX9 L;  3W5O A;  4QY7 A;  2PMZ E;  4DV5 Q;  4LF9 L;  1K8A C;  1E3P A;  4KLK A;  1VQ5 A;  3H3V H;  3LGJ A;  2GVA A;  4BBR G;  1VQM A;  1HR0 W;  2CWP A;  1EWI A;  3BJU A;  4JI7 L;  1PVO A;  1QZH A;  2PNH A;  2N49 A;  2KBN A;  5M3M H;  4A3B G;  4HJ8 A;  4A93 G;  1K8G A;  3E9H A;  4OWW B;  1SR3 A;  2E2I H;  2D0P A;  2XTI A;  2Y0S G;  4P72 A;  3G48 A;  4DR2 L;  2JA6 G;  2B29 A;  2MO0 A;  2Q2T A;  1N32 L;  4DR4 L;  4B3R Q;  4B3S L;  1KAW A;  1C7Y A;  1KRS A;  4O0A A;  1OXS C;  3HOU G;  4HJ5 A;  5K36 G;  1N33 Q;  2ASB A;  3TRE A;  4DNI A;  1GVP A;  4AYB G;  1IBK L;  1FVI A;  4KHZ A;  2VUM H;  1I94 Q;  4A3C G;  2R93 G;  5M5W H;  2UXC Q;  3H0G G;  1GO3 E;  1QVC A;  1Y14 B;  1SN8 A;  5FLX c;  4LFA L;  5LMN Q;  1YBY A;  2MFI A;  4YCV A;  3T1Y Q;  3STB C;  1EUJ A;  4P75 A;  1TXY A;  1I50 H;  4JBJ A;  4JC0 A;  4NB3 A;  5M5Y H;  4GOP B;  4UP7 A;  4B3M L;  4K0K L;  4A3I G;  1L1O B;  2MQH A;  4LFC Q;  3MXN B;  2Y0S E;  3CMA A;  1YJN A;  2JA5 H;  2F52 A;  2K52 A;  1QZG A;  3KDF B;  3KJP A;  4UY8 C;  1MJE A;  1CKM A;  1Q1E A;  1PV4 A;  1PH3 A;  1VQE A;  4X66 L;  4DV3 Q;  5JJI A;  1L0W A;  4BXX H;  4RMF A;  1SLJ A;  4QL5 A;  4YY3 Q;  1N34 L;  1IBL L;  3CCJ A;  4JI3 Q;  2GN5 A;  2UU9 Q;  1E7Z A;  4IPD A;  3CQZ H;  3S1Q H;  1RIP A;  3W1G A;  3S2H H;  1VQH A;  2RF4 A;  2NN6 G;  3U4V A;  2ZM6 Q;  1SFO H;  4BY7 H;  1VQG A;  1YI2 A;  3PO2 H;  1EOV A;  3HKZ E;  3FHW A;  3RNU A;  1J5E L;  5ELO A;  4A3L G;  4DR7 L;  4A3G H;  4OON A;  4BBS G;  4QJF A;  1X65 A;  4Y7N H;  3GTL H;  3GTP H;  2IHF A;  4LF4 Q;  1X3E A;  1X55 A;  1X3G A;  3L0O A;  4A3F H;  1HNW Q;  4IPG A;  1IL2 A;  1X6O A;  1UE5 A;  1YVC A;  4HIO A;  4R4Q A;  1ASY A;  2UUA L;  4JI0 L;  3PCO B;  4BBR H;  1PH2 A;  2YU9 H;  3OTO Q;  5IP7 G;  1KXL A;  5GAD C;  1KIX A;  1MIU A;  2NZH A;  4GNX B;  2QGQ A;  2D0O A;  4DR6 Q;  4NPS A;  2YTV A;  4JYA L;  1YNX A;  5LMN W;  1HNZ Q;  4BY1 G;  3GTJ H;  2JA6 H;  4LF7 L;  1IBM L;  2PI2 A;  2YYZ A;  3MEF A;  2JEB I;  1UEB A;  1RL2 A;  4PZ8 A;  5E7N A;  5IWA L;  3HOU H;  3HOW G;  3S1N H;  4IFD I;  2K50 A;  3KDF A;  3TS0 A;  1HNX Q;  3JAM i;  1Q8K A;  5HY6 A;  3A5U A;  4X64 Q;  4TVA B;  3S2D H;  1VQC A;  2R93 H;  3VDY A;  1PH6 A;  2NVY H;  4A3C H;  3J7A 5;  2CKZ B;  3H0G H;  3STB D;  3M85 A;  3J7Z C;  4LUO A;  2ZTC A;  1J6Q A;  3DM3 A;  2Z6K C;  3HOZ H;  5IYD H;  4GS3 A;  4L5Q A;  2K5N A;  1VQ8 A;  5C3E H;  4DR5 Q;  4LF6 Q;  4A3I H;  3JC6 6;  2VUM G;  1YIJ A;  3I4N H;  3PF5 A;  5C0X J;  4DK6 C;  5M3F H;  2WP8 J;  4XIG S;  2BA1 A;  1S72 A;  1GD7 A;  2UUC Q;  1LUZ A;  4DV7 L;  2JK8 A;  1X9N A;  1TWH H;  4DUY Q;  2PQA B;  1HJP A;  3KF8 B;  4IJL A;  4QGU A;  4X62 Q;  4LF8 L;  3GTQ H;  4LFB L;  1B70 B;  1EIF A;  2JA5 G;  4UPA A;  2YV5 A;  2ID0 A;  3BZK A;  4DV5 L;  1L2F A;  4DK3 C;  5C44 G;  2C35 B;  1PH4 A;  1P8L A;  1Q12 A;  1QVF A;  1YHA A;  4GNX A;  2UXB Q;  3K81 C;  4GKK Q;  2OQ0 A;  2ES2 A;  1VQ6 A;  1EQR A;  4BBS H;  5IYC G;  5IP9 G;  3G4S A;  4QIW E;  4OO1 I;  2RCN A;  4EQ5 A;  2RHQ B;  5C4X G;  1HZC A;  3PUV A;  4KI0 A;  4DV0 Q;  5EAY A;  1I3Q H;  4DUZ L;  5C4J H;  3M4P A;  4LW1 A;  2UXD L;  5BR8 Q;  2QEX A;  5JEA J;  3RR5 A;  5IP7 H;  4DV1 Q;  4A3G G;  5GAG C;  3J81 i;  3J80 i;  2EIF A;  1VQI A;  1XTD A;  2I5L X;  2F4V L;  4JI4 L;  2NVT H;  2OQK A;  4BY1 H;  3S16 H;  1YJW A;  3T1H Q;  2UUB L;  2UXC L;  1CKN B;  3I4O A;  5GAE C;  4NXN Q;  3CAM A;  1WJJ A;  3RZO H;  3HOW H;  1E1O A;  3K7U C;  5GAH C;  3M7N A;  1MJC A;  2Z0S A;  2VQF Q;  1FJG L;  3NEL A;  3FKI G;  1I6H H;  2IX0 A;  4LFC L;  4AQY Q;  2HHH Q;  1M90 C;  2E8G A;  1B7Y B;  1NE3 A;  1X56 A;  4X6A H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...