3AYHB

Crystal structure of the c17/25 subcomplex from s. pombe rna polymerase iii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
203
structure length
183
Chain Sequence
MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWKIEGEDGSEGTELYFDIDEEIRFQIESEDFVDVSPYTLIASCSRDGLGIPAWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase III subunit rpc9
publication title Crystal structure of the C17/25 subcomplex from Schizosaccharomyces pombe RNA polymerase III
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 40
structure length 183
sequence length 203
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
B PF08292 RNA_pol_Rbc25 RNA polymerase III subunit Rpc25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ayhB02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3ayhB01
1L1OA 4GN3B 3CCMA 3K7AH 1YHQA 1JB7A 4X65Q 4O2DA 4LF8L 1SE8A 1PH5A 4JI2L 4LFAQ 2VL6A 3NEMA 4A3JG 1QVCA 4QIWE 4YHHQ 3OTOL 3OW2A 1UE1A 3CC7A 2R92G 4X64Q 3Q8DA 3GO5A 1QVFA 3I7FA 4PZ8A 3HKZG 3M4QA 1P16A 5IYBG 3J81c 4DUYQ 3PGZA 4DV4L 1K3RA 4EX5A 3CCJA 3T1YL 4QY7A 2JA7G 5C44G 2VUMH 3TRZA 2Z6KA 4X62L 5IT9c 5C3EH 1Y14B 2KHIA 5GAHC 4A3CG 1NMFA 4LF7Q 3DM3A 4AH6A 2PQAA 3M3YH 3S14H 1XJVA 2ZM6L 2VY3A 3K81C 5IYCG 4HIOA 3S1QH 1CKMA 1YHBA 1VQAA 1HNWQ 4A3FG 4QL5A 4BA1I 4DR5Q 1PH4A 1Y1VH 2OQ0A 2EIFA 3RN5A 1VQLA 3JC66 4JYAQ 1FJGQ 4GS3A 3GTPH 3S2DH 4DV2L 4A3IH 5LMUQ 3KLWA 2OTLA 3CD6A 2D0PA 4JI5L 1TWFH 1YZ6A 2HHHQ 1OTCA 4B3TQ 1Q1BA 1Q46A 5IYDG 1QZHA 1K8AC 1HNZL 1HR0Q 2CWPA 4A3LH 1UE5A 1X3FA 5LMNL 3CQZH 2UXCQ 5IWAL 1Y1WG 2Q2TA 4R1JA 1WYDA 2WP8J 3PUZA 4DV5L 4BY7H 4LFCQ 1B7YB 2UXBL 2H5XA 3T1HQ 2B63G 1HZBA 1X6OA 1L2FA 2AKWB 1EIYB 4DR6L 4OWTB 3PO3H 3UDFA 2JA8H 4A3MG 4JI2Q 2QA4A 1Q8KA 1XPUA 3OTOQ 5C4JH 2DUDA 1PHJA 1P8LA 2ES2A 2E5LL 4IPHA 1VQBA 2HIVA 5IP9H 5H1SE 1MJEA 1YNXA 2VZAA 1VQ5A 2UUBL 3GTLH 3HOZH 1LTLA 4KLKA 3S24A 4POFA 4DV4Q 4HIKA 2GN5A 3T1YQ 2IT1A 3F2CA 2R7ZG 4OWXB 4KHZA 4X62Q 4DKAC 1S40A 4LW1A 5FLMH 4JBKA 2JA9A 5BR8L 4NXML 2KCMA 4MTNA 1KAWA 3HOXG 1YBYA 2MO0A 4LF4L 3S15H 2JA5G 3GTKH 1I94L 3J7ZC 2ZM6Q 4JI4L 4DV1L 1N9WA 5M5XH 1CKNA 3MXNB 3GTJH 3UDXA 3U4VA 4DR2L 3AYHB 4A3EH 4YCUA 4DV2Q 4RG1A 1A63A 2HQLA 3KOJA 3DLLA 3M9BA 1I5FA 2F52A 4JOIA 2IX0A 1TWAH 2VQFL 4YWLA 3SGIA 1VQ9A 5M3MH 1D7QA 4DNIA 3RZDH 1GM5A 2NN6G 1S72A 4BBRG 4LF6L 4A75A 4JI7L 3WWVA 3G48A 5LMNQ 3A74A 1Q1EA 3CCVA 1E1TA 2YYZA 1MIUA 1YI2A 1N8RC 4JI3L 2F3IA 5IWAQ 4DR4L 4GNXA 4A93G 4DV5Q 2NVTH 2ATWA 2UXBQ 1Q82C 2E2JH 3MEFA 5M3FH 4P71A 2WFWA 4IJLA 4DR6Q 2XGTA 4B3ML 1O7IA 4OONA 1AH9A 1U0LA 2Q2IA 3RLOA 2E5LQ 5IYDH 4DV7L 4B3SL 1IBML 1E7ZA 2ZTCA 1VQHA 3CCUA 2UUBQ 1PH1A 1LM0A 4YCVA 3A5UA 4JG2A 5C4XG 3AFPA 3W1GA 3HOWH 5IP7G 1HZCA 2ASBA 1UE6A 5HY6A 3RR5A 5BR8Q 4NXMQ 3GDEA 4JI0L 4LF4Q 4BBSG 2ZJRA 4A3DH 2MO1A 1LYLA 3FKIG 1UEBA 4YWKA 1I94Q 1ASYA 3GTOH 2A8VA 2YTVA 4JI4Q 4DV1Q 3I55A 4LF9L 3F1ZA 3GTQH 3HOWG 1XPOA 1EYGA 2CFMA 3S1RH 2YTYA 4C3HH 4DV0L 4DR2Q 1BBWA 1RL2A 4ALPA 1TWGH 1V9PA 1VQOA 4P72A 1N34Q 4PG3A 3CW2C 1YHAA 2EXDA 2VQFQ 2JEAI 3S1NH 4KI0A 2R6GA 1PYBA 1X3EA 2Z0SA 3D0FA 3IRBA 2YTXA 3RLFA 4UP7A 2RHQB 2GVBA 4JI7Q 4MNOA 1WCMH 1YEZA 1VQ4A 1YIJA 5C3EG 2VUMG 4JI3Q 2UUAQ 3FHWA 4DR4Q 3I2ZA 4JBMA 3J81j 2Q2HA 2KCTA 2OQKA 2HT1A 1B70B 2PMZE 1NMGA 1JJ2A 5JJIA 5GAEC 4JI1L 4B3MQ 2K5HA 4HIMA 1QZGA 1VQMA 4B3RL 1Y1VG 3H15A 4XTCS 3PF5A 3J81i 1R9TH 4AIMA 1YVCA 3I4OA 5GAGC 4A3IG 1IBMQ 2V1CC 3ICEA 4DR3L 2MFIA 2PI2E 4JBJA 1Q81C 1PA6A 4R4OA 2GVAA 2UUCL 1E22A 1CSQA 4A3LG 1OXSC 4IPCA 4LFBQ 2B3GA 4UP9A 4JI0Q 3HOUH 4AQYL 4OX9L 4EQ5A 2IX1A 2R7FA 4BY7G 1U5KA 1G51A 1K9MC 2CQOA 2JQOA 5JEAG 2DGYA 2NZHA 4LF9Q 3K8AA 1EIFA 3PO3G 2JA8G 1SRUA 3PO2H 3J80c 1K8GA 4GN4B 5ELNA 2ZJPA 4DUZL 1V1QA 4DV0Q 1VQ7A 4A3BH 4C2MH 3G4SA 2IHFA 3BZCA 1E1OA 5JEAJ 4C3IH 3RZOH 5IP9G 1X9NA 3JAMc 1Q12A 3HOZG 4DV3L 4LF8Q 1NTGA 2D0OA 3AFQA 1Q86C 5HGQA 2PQAB 2I5LX 2KENA 2BH8A 2ZTDA 3F8TA 3RLNA 1IL2A 3CC4A 4P73A 2BH2A 3KFUA 3BZKA 5FLMG 2K50A 3I56A 3PCOB 1BVSA 1HH2P 2AHOB 4LUOA 1PVOA 3STBC 2NVQH 1PH6A 3HOVH 2KHJA 3CPFA 3H3VH 3PUYA 3CF5A 1Z47A 1KRTA 4HIDA 4IFDI 4JI1Q 1GO3E 4L5QA 5C0XI 5DLQE 4A3GH 4X6AH 2C35B 1TWCH 1QVGA 3KF8B 4GOPA 4B3RQ 2I5HA 2K5VA 1YJ9A 1N36L 1JT8A 4A3EG 2JA6H 1SLJA 4IO9A 4GN5A 1XPRA 4BXXG 5IE8A 4DR3Q 1AE3A 1HZAA 2K4KA 4TVAB 3FP9A 5M3MG 3S17H 4A76A 1KD1C 2R93H 2MNAA 1DGSA 2UUCQ 1VQIA 4BA2I 1E3PA 2JJQA 2K5NA 3U4ZA 3PUVA 1K0RA 1N33L 4BXXH 3H0GH 4AQYQ 3TS0A 4JI5Q 2LXKA 1NE3A 1X65A 1TXYA 1HNZQ 1E24A 5M3FG 1IBLL 3S2HH 3HFZB 4JI8L 5J3BA 2VQEL 1M1KC 1ASZA 2EQSA 2PI2A 3KDFA 3L7ZC 1K83H 3CAMA 1EQRA 3HKSA 1OXTA 3K80C 1VQFA 4NPSA 2N78A 2K14A 4PZ7A 3A0JA 4DV3Q 1QUQB 3ER0A 1V43A 4H02A 5GROA 4YCWA 2I5MX 4DPGA 1X55A 3AEVA 4PZ6A 3CCSA 1WFQA 4IOCA 3KF6A 4QQBX 1KXLA 4RMFA 3E0EA 1BBUA 4GKKL 3UE0A 4A3DG 2CCZA 1SN8A 3I4MH 3CP0A 3PUXA 4MZ9A 3UE1A 3W5OA 2UU9L 1NBWA 2AWOA 4LNQA 3ULPA 1FL0A 4AYBE 1PFSA 4GLXA 2CKZB 1Q7YC 1N36Q 2A1AA 4Y7NH 3HOYH 4A4IA 4DR1L 3CCRA 1H95A 1KHIA 4IJHA 1TWHH 3NBHB 2VW9A 1OXXK 1WI5A 2BA0A 4P75A 3EBEA 1XNQL 3G6EA 1M90C 1GVPA 1PH9A 1SR3A 4GKJL 2NZOA 4HJAA 4HJ5A 1WCMG 3CCQA 1VCIA 1G6PA 3B6YA 4JCVE 4A3KH 4LF6Q 4X66L 3U50C 3CXCA 5LMUL 4JI8Q 1D8LA 1KL9A 2VQEQ 3GD7A 4WJ4A 2E2HH 4FDBA 1J6QA 4L5SA 3LGJA 3OYYA 4DR7L 4LUZA 1HNXL 2YU9H 3A5ZB 2QGQA 3PUWA 1VQKA 1C7YA 3K0XA 4OWWB 1VQNA 5K36G 4OO1I 1PV4A 4DV6L 1IBKL 1HZ9A 2K52A 1W3SA 2ALYB 3KYHC 4DV7Q 4B3SQ 4GKKQ 2VNUD 3HOUG 2B29A 1IZ6A 2UU9Q 5FJ8H 2NVYH 1UWVA 1KRSA 4TQUS 1XNRL 4LUVA 2WAQE 1L1OB 1NJIC 3PO2G 2JE6I 2FXQA 4C3JH 4A3BG 2JEBI 4NXNL 3NENA 5JJKA 2JK8A 2N3SA 3L2PA 4A3JH 2XTIA 3J7A5 5E7NA 4OXPA 1A62A 5GQOA 4DR1Q 2R92H 3U58A 4R4QA 1PH3A 4KHPL 1XNQQ 1C9OA 2ZTEA 1X3GA 2CWAA 1NY4A 1AE2A 3VDYA 1XMQL 4GKJQ 5IYBH 3UDGA 1BKBA 2VS1A 4JBWA 3M7NA 4IPGA 4JV5L 2JA7H 3PIPA 2OWOA 4IFDG 5C44H 3NELA 4UP8A 5C0XG 3J80i 3HKZE 1KC8C 3HOVG 2IY5B 2IHEA 4HJ9A 4P74A 1YITA 3EIVA 4A3CH 2E8GA 4JC0A 4X66Q 4LF5L 2BA1A 4POGA 4JI6L 3I4NG 4A3GG 2YV5A 2KBNA 4IFDJ 2ID0A 2LXJA 3M4PA 5IYCH 1OXUA 3JAMi 5C0XJ 4DR7Q 1VQEA 4K0KL 1UE7A 4A3FH 3F2DA 2N49A 1EQQA 1A0IA 2JA6G 1L1OC 4Y52H 1HNXQ 1CUKA 1XMOL 1G291 3W1BA 5AJ3L 3UDIA 3PIOA 3I4NH 2UXDL 2Q2UA 4DAYB 2AMCB 2R93G 4DK3C 3ULLA 4DAMA 1PH2A 3H3VI 2R7DA 3M85A 4DV6Q 1IBKQ 2E2IH 2RHSB 3TS2A 3TQYA 4BY1G 4O0AA 1MKHA 3CMEA 1KQSA 1CKOA 1S3OA 1N32L 1A8VA 1WJJA 3H0GG 3BU2A 5GADC 1X54A 4ME3A 1Y1WH 4QGUA 1EOVA 5M5WH 2Z6KC 1XNRQ 1J5EL 1WOCA 1X56A 4APVA 4BY1H 2B63H 2RCNA 4R4CA 4LFCL 1PH8A 1FVIA 4NXNQ 4A3MH 4HJ8A 4OX9Q 2N8NA 3CCLA 4YY3L 3CC2A 3CPWA 1EFWA 4LWCA 4NB3A 2K75A 1XTDA 4KHPQ 1QUQA 4DUZQ 3AQQA 3GTGH 1XMQQ 1VQ8A 1SMXA 2L15A 3PSIA 1YJNA 4GLVB 4IPDA 3STBD 4JV5Q 5EAYA 3RNUA 2R7ZH 4GOPB 1OXVA 2OCEA 3E9HA 2PNHA 2Y0SG 4AYBG 1HR0W 3HOXH 3ERSX 1EWIA 5IY0A 3I4MG 2F4VL 4LF5Q 1N34L 2JA5H 4JI6Q 2RF4A 3S16H 3TREA 1CKNB 2A19A 4K0KQ 4X65L 1L0WA 4LFAL 3HOYG 3K7UC 1VQPA 4XIGS 4YHHL 3S1MH 4QJFA 3TEHB 1XMOQ 3E9IA 5AJ3Q 3D31A 2UXDQ 4DK6C 4X64L 1B8AA 2UUAL 2LSSA 1K73C 2Y0SE 2MQHA 1I6HH 1JE5A 5ELOA 4R4IA 1IYJB 1VS0A 3CCEA 2ZJQA 1VQ6A 4L5RC 2D62A 2QEXA 4GLAC 4DUYL 4BBRH 1GKHA 4IOAA 1N32Q 1HJPA 4R4TA 1YJWA 3KDFB 3BJUA 1VQDA 3PF4A 1EUJA 4GNXB 2NN6I 4UPAA 1SFOH 3RN2A 4A93H 1VQCA 4A3KG 1I3QH 4YWMA 4LF7L 1J5EQ 4PMWA 4GOPC 3KJOA 1Z9FA 1LUZA 3L0OA 1JMCA 1N33Q 1HNWL 2OTJA 1JJGA 1RIPA 1I50H 1IXRA 4DR5L 4J15A 1SROA 3KF6B 2WB1G 4YY3Q 3ULJA 3ZJYC 1IBLQ 4JYAL 4OO1G 1FJGL 1MJCA 2AWNA 2NVXH 4LFBL 1JJCB 3EN2A 1C0AA 1VQGA 1T9HA 1FGUA 1VQJA 3KJPA 2I0QA 1KIXA 3CMAA 2HHHL 4B3TL 4UY8C 4JOIC 5C4XH 3F2BA 1HR0L 5JJLA 3M4OH 5IP7H 1W2BA 3G71A 5FLXc 4HJ7A 1PH7A 2WAQG 5M5YH 2UXCL 1CSPA 4BBSH 5FJ8G 2WB1E 2HIXA 3PV0A 2F4VQ 3FKIH 5LMNW 3GTMH 1GD7A 3T1HL 4L5TA 4GNXC 1PYSB 4WJ3M
chains in the Genus database with same CATH superfamily
2FINB 1JB7A 3HOWH 4X65Q 5KT3A 1L0XB 1SE8A 2EY1A 2EYMA 1MSHA 4LFAQ 4A3JG 5KFGA 4J9OA 3RD4A 4LH7A 3URYA 1NAPA 2R92G 2I87A 2RSNA 3HXLA 1WTVA 4E4TA 2FLLA 5IYBG 4UCOA 3V96A 1BO0A 3CCJA 2OXPA 5JQWA 5IWAH 3TRZA 2FB9A 5IT9c 1EEFD 4OIKA 5GAHC 2UXBH 4A3CG 3D8GA 1NMFA 1LT4D 4AH6A 2YZNA 4ULLA 3K81C 1VQAA 4QL5A 2WTFA 1TY2A 1Y1VH 3H0GB 1GJXA 3RB6A 3NBIA 5LMUQ 2MCTA 2J6SA 2OTLA 4LSXA 1OTCA 4B3TQ 4K2LA 4RZQA 2FMAA 4FF3A 4NXMH 1WTOA 3K5HA 5LMNL 3CQZH 1SFOA 2HUGA 3MWEA 1X3QA 2IJ0A 5M3FB 4R1JA 1WYDA 2P0AA 4DV5L 5T14A 1ENAA 3T1HQ 2B63G 1HZBA 3SK4A 1ML0D 1MHWC 4FF1A 4OWTB 1XPUA 2NVXA 3DEOA 4JVZA 1DJRD 3OTOQ 1X32A 4MV8A 2HIVA 4IR9A 5KFKA 2UUBL 1CQFA 1LTLA 4H44C 3S24A 2NUCA 5ELDA 1PZJD 2GN5A 4A3DB 3T1YQ 1VAJA 2FK1A 4YIJA 4DKAC 1S40A 2JA9A 4J1MA 3HRZC 2MO0A 4QIWA 2BQ3A 5T1IA 5FD5A 2JA5G 2XGQA 3R23A 4B3MH 4O4LF 2ZM6Q 1N9WA 3OHAA 4RGTA 2W6PA 1CKNA 3MXNB 3GIPA 2FJ2A 2VUGA 2ZDHA 4DR2L 5M9OA 3CVZA 3S1NB 4JV0A 2F0KA 3AYHB 5KG3A 3QZ8A 3HZXA 5FO9B 4KHVA 4K8IA 2O03A 4YWLA 3SGIA 1VQ9A 3BJYA 2VB3X 3PMFA 2PMZB 1S72A 2DY7A 1H9RA 4HR7A 4JI0H 3SK6A 3FVQA 4ODGA 4Q45A 3M4YA 2YYZA 2XRSD 3HEJA 4JI3L 4DR4L 4EVOA 3HP3A 3RAXA 3MEFA 5M3FH 5EOYA 4DR6Q 4UDUC 1O7IA 2F0OA 5EKLA 2K6AA 3I91A 2EDGA 2Q2IA 3RLOA 4HNVA 4B3SL 2NVYB 3BZDB 4QUFA 3CCUA 2R7NA 1PH1A 1LM0A 4FXKC 4YCVA 1PTOF 4DU9A 3A5UA 1E4EA 4B08A 5C4XG 4CDEC 3HOUB 2R85A 3TP7A 3AB9A 5IP7G 1LV9A 1K8OA 5D1OA 5HY6A 5BR8Q 1IW7D 4LF4Q 4A3DH 2ZJRA 2R92B 3PQIA 1UEBA 1F2YA 4JI4Q 4DL7A 4MV4A 4OIJA 3MFHA 3T5JA 1XPOA 1EYGA 2CFMA 3FRPB 3J81L 4DV0L 1BBWA 1HPCA 3BQ2A 2J6UA 4P72A 4N9PA 3RF2A 4PG3A 2VQFQ 3MVVA 1BBXC 1M7JA 3S1NH 1CHQD 4RKLA 4JW0A 4CDCC 3PW7A 2BE5D 3RLFA 1JXLA 1VMCA 2RHQB 1TAEA 2GVBA 2NVQB 1WH2A 1VQ4A 1YEZA 1EY5A 3C46A 4ZKCB 3I2ZA 2Q2HA 2KCTA 1LTSD 2EYFA 1JJ2A 1NMGA 5JJIA 4DUZH 4JI1L 1RDPD 1UEAB 4MTDA 1K1QA 4KN4C 2BQRA 1VQMA 3JSLA 4XTCS 3TZDA 1GLVA 5EJWA 4A3IG 4DV3H 1IBMQ 1WD0A 2V1CC 4J9KA 4EYIB 4Z9CB 1SXTA 5F2DA 2PI2E 3UI2A 1Q81C 4BY1B 2B63B 5K36H 4R4OA 3JRWA 4HQ6A 1MGSA 3NQTA 4CKCA 1OXSC 2XIWA 2Z4IA 4LFBQ 3SVMA 2B3GA 3D3RA 3HOUH 2IA6A 3OW7A 5F9LA 1U5KA 3A54A 1K9MC 1K83B 4KY5A 2NYZD 2R82A 2ZT9C 4RH6A 1N36H 2EVBA 4YQWA 1PZID 3J80c 4Q0FA 5FOBB 2NTSA 3G4SA 5LXTF 4R9WA 1ILQA 5IGGA 3K5LA 5C1PA 2RGVA 1EYZA 1D5XC 2KENA 1STNA 2R8HA 2ZTDA 2BH2A 3KFUA 3SI8A 5K2MA 1H9KA 2K50A 4IFDH 2CH4W 1HFNA 2NVQH 1PH6A 1S0NA 2P5ZX 5FK9C 1TS2A 5KFJA 3GTQA 1Z47A 4IFDI 3U9TA 4XZ3B 2X69A 1QVGA 1SCUB 1RJTA 2K5VA 1W93A 2WACA 2EXZA 4A3EG 1SLJA 4O2AF 4GN5A 2W8LA 4BXXG 1AE3A 5KFBA 5EGTA 1M4VA 1B3AA 4CJ1B 3ORQA 4GKKH 1T94A 2JJQA 3JRXA 1CZWA 3OWFA 4JI5Q 2LXKA 5IT9W 1NE3A 2KOLA 2W9CB 4ZQIA 4JI8L 2V58A 1M1KC 2WB1B 2WIIB 4RNNA 1R9TA 1K83H 2B2VA 2OT2A 3HKSA 3GLKA 4KD4A 1MI2A 1B2TA 3G7LA 2EE1A 4ZKBB 2QDLA 4GKJH 1TA8A 4H02A 2ASLA 4YCWA 3QFFA 5ELEA 1X55A 3JSNA 1KXLA 1BJTA 3C0FB 3ITPA 3E0EA 4B9XA 5IGDA 2FE3A 1U4MA 1LO5D 2ICIA 1XTCD 4JK1C 4N9TA 1JB3A 3PUXA 3UE1A 4B9WA 5HURA 1A3UA 4J9SA 4YAJB 4C3HG 2XIGA 3A7LA 2M00A 1Y8OB 3T5LA 2ALZA 3EPGA 1GGOA 3HKZB 4P2CB 3S14B 1KHIA 1WVLA 1BNZA 2V5AA 4DV6H 2CW0C 1IBKH 2VW9A 1WI5A 4P75A 3EBEA 1EUDB 5C44B 1GVPA 1SJED 1PH9A 2W70A 2NZOA 3O13A 3GTPB 4CJ0B 5I4DA 5KFAA 1XNRH 1DV2A 4JCVE 2R6FA 4R8IA 3U50C 4Q8EA 5LMUL 2AQ1B 1D8LA 3VPCA 4QWEA 4DL3A 3J7AK 2BCOA 2K1BA 4ECUA 1EZ8A 3OSNA 1V4YA 2M9VA 5CV6A 1S10A 2NU7B 1C7YA 1I7NA 5KG4A 3GIKA 1PV4A 1KTKA 1HZ9A 2K32A 1W3SA 3H0GA 4OGQC 3KYHC 4DV7Q 2V4DA 2VNUD 3RFCA 5DNFA 2IPKD 1IZ6A 1VMPA 4JI6H 2K33A 2UU9Q 2CW0D 3N8DA 3JAML 1KRSA 4YAKB 1AUVA 2WAQE 3SK8A 3RGXA 1HCZA 5LL6b 4A3BG 2B2YC 1B33N 2N3SA 2XTIA 3KBXA 1A62A 3S15B 1JCKB 5J2UF 2AGOA 1PH3A 1XNQQ 1X3GA 3GTJB 1NY4A 3BQ0A 1LLRD 2WKDA 3VDYA 1JLLB 2N55A 4G7HC 2Y0SA 5C44H 2KUMA 4A3EB 4AYBA 4X3SA 1GSOA 3WO0A 3S16B 1KC8C 4C1NI 5I47A 4P74A 2X0SA 3KALA 4X66Q 3S9WA 3I4NG 3RBDA 1RYSA 1LT6D 4QWAA 4XYOA 2ID0A 2LXJA 4IFDJ 3GIDA 1OXUA 2R8IA 3WDNA 2JA6G 4LMYA 1WTXA 4Y52H 3M9MB 2FPIB 4CGYB 2UXDL 1Z2NX 2E2JB 1I94H 2R93G 2JEFA 1STGA 3MXNA 4DAMA 3H3VI 4HCEA 5IYDH 2E2IH 3TQYA 1V51A 1MKHA 1S3OA 5CV7A 1A8VA 1WJJA 5C4HA 3BU2A 1KJQA 3WNZA 1GYFA 3BDCA 1Y1WH 1EOVA 3I3CA 4F88A 3D4WA 1BDOA 4PV1C 4EG0A 1PH8A 1RK6A 4NXNQ 4YHHH 1LTGD 4HJ8A 2N8NA 4QWDA 3V4SA 4J9LA 5DEHA 2OLSA 1D1IA 3W3AA 1EFWA 4IR1A 3A8IE 4LWCA 2DNCA 4KHPQ 4DUYH 3VYUA 1ZYRC 4JUZA 4KK7A 4DK1A 4JV5Q 2FPPB 5EAYA 1TS5A 3CHBD 1I4RA 5GONF 2NVYA 1OXVA 2OCEA 3OHXC 1DOMA 4QIWB 5KG5A 3ERSX 4IZ8A 1AZPA 3I73A 2F0GA 3S16H 1HNWH 3QG1A 2L4NA 3PZPA 1CKNB 4RGNA 1JICA 1FYCA 4KY6A 1BCPF 4JYAH 2K28A 3N40P 2R92A 3RUPA 3J80W 3AU7A 3LWEA 4EBCA 2HHHH 5A2QE 3N42B 3CCEA 2VPQA 1STAA 4XYQA 5KFWA 4TQRA 3D6WA 2NN6H 4LAAA 5EKIA 4HR7B 1U4LA 5C3EB 2QEXA 4IOAA 4RNOA 2QDBA 4R4TA 2QYZA 2LMCB 3KDFB 1VQDA 1DOKA 3WOEA 2NN6I 1SFOH 2A6EC 1VQCA 4HSVA 4A3KG 4LF7L 3KJOA 4QF4A 1ZYRD 1XYIA 1LUZA 1N33Q 2R84A 1I6UA 5EWEA 3S2DB 1RIPA 2K7VA 1IXRA 4DR5L 2A68D 4YY3Q 4ECZA 2W7OA 3RB0A 2NVXH 4LFBL 3LWBA 1VQGA 2AU0A 1SSOA 1R4PB 3KLRA 2UVUA 2A6HD 3H91A 1SJHD 1B44D 1LTRD 4C2MB 2CQAA 4EGJA 3G71A 2JSOA 3QR8A 2EYLA 1PYWD 2B63A 3OIQA 5LMNW 4CBVA 2JA8B 5LHY1 1HFGA 3VR6A 1PYSB 1L1OA 1STHA 3K7AH 5JJZA 5KFXA 4O2DA 3KHHA 4KJOA 1PH5A 4JI2L 2VL6A 3NEMA 1WTQA 1QVCA 3OW2A 3HG9A 4OL7A 3HOZB 2A6ED 5CB4F 1UE1A 3CC7A 2J9GA 1CT1D 4X64Q 1A3TA 1C3OA 5G3LD 1GOZA 5LMNH 3PGZA 3E5NA 4DV4L 2HVRA 2MUYA 2NWGA 4X62L 1DV1A 5C3EH 4DV5H 4FXGC 2JA5A 5M5XB 1KJIA 1V8QA 2R93B 5KFTA 1XJVA 1HHVA 3S1QH 4HIOA 5IYCG 1BCPD 4M9UA 1CKMA 1YHBA 4A3FG 3TQ1A 2OQ0A 3KXYT 4ME6A 5JVDF 4BWSC 1SYBA 1FJGQ 5M3MB 3PIP3 3S2DH 4DV2L 1HA6A 1T3NA 2UUBH 1QNKA 4DXFA 5CAEB 3Q8QB 4JI5L 3VYSA 3I12A 1HR0Q 2BDOA 2CWPA 4A3LH 5KRUA 2NVTB 1X3FA 3IAYA 2UXCQ 2GPWA 2V4QA 3MHBA 2Q2TA 3PUZA 4BY7H 1M6VA 3ERQA 1B7YB 5JEAH 4LFCQ 4DR2H 1D1KA 3PO3H 1CZGA 3UDFA 2JA8H 4A3MG 2QA4A 1Q8KA 4F4YA 3RB4A 5C4JH 1DCZA 5JVLA 1K28A 2E5LL 3SXHA 1F77A 2W9CA 1VQBA 5H1SE 5IP9H 2Q8RE 1NR4A 1VQ5A 2V4RA 3HOZH 1JQYD 2EYPA 4DFAA 5DLGA 3A56A 4KLKA 4POFA 4HIKA 4JI3H 4Y7NB 2IT1A 3F2CA 2R7ZG 4DR4H 1NR2A 3I70A 4LW1A 3H6MA 2PQEA 5CV5A 5FLMH 5E4WC 4U68A 1B6SA 4C56C 1YBYA 2ZXPA 4PMCA 1Z2PX 3GTQB 3SK5A 1I94L 3QZ7A 3T13A 4DV1L 2K5DA 1D5ZC 5M5XH 3DF7A 2D5DA 4B3SH 1ZEQX 3RUZA 2EY5A 3MWMA 2HQLA 3KOJA 3J81W 3M9BA 3LX0A 2IX0A 4NKLA 1D7QA 5M3MH 1WCMB 1GM5A 2ASDA 1PFNA 1KABA 2C2EA 4JI7L 4TQSA 3G48A 1JOOA 3KHGA 1Q8IA 2YU9B 5IWAQ 4A93G 2NVTH 4NW2A 2YZGA 1JWSD 3G8CA 2K01A 3N6RA 4O3NA 4FS1A 2UXBQ 2YZMA 2WFWA 2X6GA 4DV0H 4DN4M 5CGKA 1R9TB 1E0BA 1DXMA 3GTPA 1SYXB 2LS01 2B2YA 4DV7L 1TWFA 3ONAB 1E7ZA 4O3SA 1VBGA 4RUCA 4K2KA 1GSHA 4C1NK 1BNCA 2IWHA 3K5NA 2B2WA 3TIGA 4JG2A 3NTIA 4J9RA 4I4TF 2OEOA 1PRTD 3RR5A 1EY6A 1OO9B 4NXMQ 4YR3A 2MO1A 4IWXA 1LYLA 4ECXA 1EQVA 4JI1H 4YWKA 2EJMA 1ASYA 1JR0D 3MFYA 5CBEE 4LF9L 3GTQH 3P20A 2HDLA 2V9WA 2KCNA 4C3IB 1WTRA 4GZYC 1RL2A 1STEA 3MR6A 1F9RA 2B2VC 5L1IA 4KI0A 3P7JA 1E4FT 2YTXA 1H9MA 4UP7A 2NZ1D 3H94A 4MNOA 1WCMH 2VUMG 4O4HF 5KFPA 3QB3A 4R8NA 1S5CD 1B4OA 2UUAQ 2HT1A 4A3GB 3R5XA 1B70B 1FNUA 3GTJA 5D65A 2PMZE 5EPLA 1SMYC 5GAEC 4RU9A 3R5FA 4B3MQ 2K5HA 3A7AB 1S5FD 3MAQA 4B3RL 3H15A 2O4XA 3PF5A 2JEIA 3J81i 3S17B 1R9TH 1EOTA 1EYCA 4QUCA 3ICEA 4M7EA 4DR3L 4ECQA 3CRKC 2MFIA 2CQYA 2EY6A 1B9MA 2UUCL 4XYMB 2QEJC 5IGEA 1EY0A 1A9XA 4XDXA 2F0IA 4CKEA 4UP9A 4JI0Q 3KHLA 4AQYL 1S5BD 4EQ5A 2IX1A 1A2UA 2R7FA 2NTTA 2CQOA 5DAUA 2JQOA 1NSNS 3UQ8A 1EIFA 2HD3A 1KJ8A 1SRUA 4O3PA 3MR2A 4UAIA 1CQJB 2J6TA 4GN4B 1V1QA 1VQ7A 2F0TA 4TSSA 1B04A 1E1OA 5JEAJ 2DLNA 2VOBA 4C3IH 3K5OA 1WTHA 1SMYD 4LF8Q 1ET6A 1NTGA 2D0OA 1DIKA 2K04A 2PQAB 4IUPA 1JX4A 1EYAA 1MD2D 2I5LX 4PMBA 4O3RA 2BH8A 2E76C 5CV4A 3CC4A 2Y0SB 3D6CA 4AYBB 3I4MB 3I56A 3PCOB 1BVSA 2V59A 5C0XH 1LACA 2AHOB 1Y69U 3STBC 3BS1A 2C5CA 4IUNA 3NXWA 4JI8H 5ELCA 1KRTA 4IN3A 3SR1A 5C0XI 5NUCA 5DLQE 4A3GH 1EIHA 2C35B 3I72A 3HOYB 5I6YA 1TWGA 4ECYA 5KFFA 4RAZA 1PFBA 2I5HA 3NWSA 1JT8A 2B8GA 5IE8A 4KKTA 3S17H 5KX5F 3FP9A 2BDNA 4H0LC 1DGSA 2RDIA 2F0VA 4BA2I 3G6VA 1BUVT 1I50B 3U4ZA 3NTHA 3BDLA 3EYYA 2VXWA 1N33L 4FXDA 4CDDC 3H0GH 4TV8F 3TS0A 3QOLA 2QW7A 2F0PA 4EFBA 3BAAA 1HNZQ 2B2UA 4ZLTF 3U9SA 3HFZB 3R8BA 2VQEL 2EQSA 3KDFA 3CAMA 5JOBA 5M5YB 1VQFA 4C5BA 2N78A 2HCIA 2K14A 1RKNA 4DV3Q 3L4KA 2YRWA 1SNOA 5JVG3 3T4AC 4RMFA 5FLXL 1FGBD 5D1PA 2XD4A 5IT9E 3H09A 1QOHA 1SN8A 3I4MH 2R87A 3MXPA 5LMUH 4MZ9A 1DONA 3W5OA 1K8MA 2X6LA 2ZJTA 5H80A 1NBWA 1MZBA 3QOJA 2HJWA 2KEDA 4A3JB 1O7YA 4C2MA 1FL0A 2F4IA 3JAMW 1N36Q 1GUOA 3HOYH 3M4IA 4A4IA 4DR1L 3CCRA 3PW2A 3M3YB 2BA0A 1ILPA 2VR1A 4ZI7F 2UVRA 1SR3A 2ICEC 4HJ5A 3KHRA 2XVSA 1VCIA 2SDFA 1G6PA 3B6YA 2CW8A 4LF6Q 3CXCA 4RGOS 1EWCA 3EJIA 1H9SB 1RK5A 4PWQA 4WJ4A 1PTOB 1KLGD 5CMDA 2JA6A 3LGJA 4UCUA 4FM9A 3OYYA 4DR7L 1DD2A 3OUUA 2KA7A 1RJQA 4XQQA 4OO1H 2JXMB 4LUZA 1HNXL 2R93A 2J0TD 2BOSA 2QGQA 3PUWA 1RHPA 1I6HB 4Q5VA 1VQKA 3K0XA 4RKBA 4OWWB 1IHZA 2MJ8A 4YR0A 4EGQA 2WE6A 4OO1I 3BABA 5CYUA 2K52A 5EPKA 3E5SA 5TSSA 1B3QA 2RDJA 3WO1A 4GKKQ 4ED8A 3Q23A 3FPPA 2FKLA 1Z2OX 5FJ8H 2NVYH 5I6WA 3GTLB 4EGVA 2FMCA 2CW7A 1GUNA 1L1OB 5EBCA 3PO2G 2FXQA 3NHHA 3PN1A 1F9QA 2JEBI 2RDHA 2F0UA 5JJKA 2IBKA 4RB0A 4A3JH 2UXDH 4A2AA 3FMCA 5E7NA 4OXPA 1PTOC 4YR2A 2R92H 2C22A 4LMQD 3DXJC 2ZTEA 1KAAA 1XMQL 1YNJC 2EYJA 3OMGA 5IYBH 4GKJQ 4ECWA 1XX8A 3PIPA 3BVGA 3H4BA 1HQRD 2JA5B 3FDSA 3HKZE 3HOVG 4TUYF 1AN7A 1WTWA 1YITA 3EIVA 4A3CH 3TINA 4JC0A 3V05A 4LF5L 4POGA 2AGQA 1S03G 4DNRB 4G3IA 3JAMi 2PO4A 5C0XJ 4K0KL 2IL8A 2QCPX 1UE7A 3KF8A 3IFTA 3CKIB 2N49A 5E4XA 2TMPA 1A0IA 3F2DA 1S68A 3FMAA 1L1OC 2W6NA 2PZWA 2PZTA 1XMOL 1G291 1SYEA 5AJ3L 4RAUC 1SYFA 3KLSX 3ULLA 5C1OA 4DV6Q 1IBKQ 1I6HH 5BPFA 3CMEA 1N32L 1KQSA 4QW9A 1CKOA 1KNEA 1N48A 4IZOA 4WRDA 3U9OA 4MTEA 5GADC 3GIQA 4ME3A 5BN3A 5KFMA 4WD3A 2VQFH 4FVMA 1WCMA 1XNRQ 1BR9A 1J5EL 5KT4A 4ID6A 3PR4A 4BY1H 2B63H 3N6XA 3GV7B 4KY7A 4OX9Q 1NNXA 1FKAH 2YU9A 3CCLA 1L0YB 3CC2A 4O2BF 4NB3A 5C4XB 3C1FA 5KFEA 1QUQA 2F3WA 3J7AV 4J9QA 1CE8A 4Q44A 1VQ8A 3PSIA 3S1RB 3RNUA 1ZHQA 3KAJA 3V4ZA 4GOPB 4LF7H 3E9HA 3ETJA 2RDFA 1EEID 1IOVA 2F4VL 4K14A 1GXDC 3PW0A 2HVSA 2JA5H 4JI6Q 2RF4A 5E1FA 5CV8A 2NU8B 4DR5H 4IURA 4IUVA 4APMA 4NLGA 5L9XA 4X65L 4FYDA 1NCVA 3VA5A 4LFAL 3OSPA 2F1MA 4LFBH 3K7UC 1VQPA 4QWCA 2DJGC 4QJFA 5IIFA 2KHSA 1B8AA 1EY7A 2UUAL 2LSSA 2MQHA 4ED0A 1HTLD 3NBHA 1B6RA 1IYJB 2ZJQA 3OIPA 2D62A 3V6JA 4GLAC 3ND9A 3BJUA 1EUJA 2A69C 4UPAA 3DUZA 2EZVA 2RVLA 4I7AA 4GOPC 3QJYA 1H9JA 4JI2H 3L0OA 5KFLA 3J80E 4A3IB 2F0HA 5KYLA 4N8X1 5DLFA 1SDFA 1IBLQ 1D2BA 1TWFB 2AWNA 3MXUA 3EN2A 2O5IC 1C0AA 1FGUA 1VQJA 3RGZA 4DV4H 3PO2B 3NPPA 4B3TL 4M1UB 5JJLA 5C4XH 1SE2A 3F2BA 3J7YW 4X62H 1CS0A 4ED1A 5IP7H 3R5HA 1SNQA 2QK4A 5FLXc 1PH7A 3DWPA 2WAQG 5KT6A 1WD1A 3R93A 4UCRA 1C48A 5KEEA 3DHQA 3NP8A 2BQUA 1GD7A 3T1HL 2YCHA 4RUAA 4UHVA 4C3JG 4XT3B 1YHQA 4LF8L 3FEWX 4K5VA 4M8AA 4DV2H 4QIWE 4YHHQ 3OTOL 3H40A 1X3PA 4I55F 1F2MA 4JI5H 3GTGA 1UNNC 3Q8DA 4FS2A 3GO5A 1TWCB 3M4QA 3J81c 4DUYQ 2W7PA 2R7ZA 2JA7G 3T1YL 1WR2A 5BMVF 2Z6KA 2B2WC 1Y14B 1ET9A 5DG8A 2XWBB 2OF1A 4FF2A 3DM3A 2PQAA 2ENBA 3S14H 3KUPA 3PVXA 2ZM6L 2VY3A 1RF2D 1HNWQ 3TDQA 2FMMA 4PNYA 1K3BC 3UFXB 2E5LH 2KCCA 2PCFB 4LJZC 1IYUA 1Q90A 1Z6HA 2JP1A 4L6TB 4WJWA 3RN5A 1VQLA 4JYAQ 4GS3A 3GTPH 3H20A 4R8UB 4A3IH 5KG2A 1PK8A 2PVPA 5KFYA 3CD6A 2D0PA 4DAYA 1G6ZA 1TWFH 1YZ6A 2HHHQ 4DL5A 1Q1BA 1Q46A 1BF4A 3TBIB 1HNZL 5EDWA 4ZCKA 3GIMA 2L0CA 2UVWA 3MZ5A 2L9HA 2N88A 2YL2A 1I3QA 4CDFC 3K5IA 2ZDGA 2WP8J 5DQIA 4DV1H 2UVVA 3PIO3 5IOCA 2PZUA 2H5XA 4I7ZC 1L2FA 4ZYSA 4DR6L 1F2ZA 3I8ZA 1I50A 2W71A 1CTMA 4HNUA 1V1PB 3K59A 1PHJA 2ES2A 1P8LA 2A74C 3NSWA 4KKUA 4IPHA 4DLKA 2YS7A 5BPHA 2FLNA 1YNXA 1S0MA 2VZAA 4X3KA 3EPIA 4JI7H 5KG0A 2RQXA 4KJNA 3E0JA 4EBDA 1EYDA 4KKSA 4JBKA 5BR8L 1GUTA 4DXGA 2KCMA 4MTNA 1KAWA 3HOXG 4LF4L 3S15H 1XDNA 4HAEA 3SEBA 2W8KA 5G3LF 3BA8A 4QW8A 1SYDA 4C3HB 4JI4L 4ZUJA 1TWGB 3GTJH 3UDXA 2KVMA 4PQXA 5EWFA 2DZDA 4DV7H 4KMUC 4XXEA 1M0WA 4A3EH 1A63A 4YCUA 3V6HA 4CHTB 2VQDA 3DLLA 1I4XA 2F52A 1STBA 2K05A 3VR4A 2VQFL 4EYHB 1PFMA 3TIIA 4DNIA 5ISRA 5C5JA 2VUMA 2XWJB 4BBRG 4LF6L 5KGUA 4A75A 5KNBA 1G91A 5LMNQ 1N8RC 1YI2A 4NP5A 1EU3A 1YNNC 4GNXA 3M9NB 4DV5Q 4S3SA 3MR5A 4LF9H 1Q82C 2E2JH 4UFZA 1QILA 4OONA 2EPBA 1AH9A 1U0LA 2WAQB 2Q8TA 2J7ZA 3J81E 1CA5A 4Q8FA 5C4ZA 4ECTA 1IBML 1W96A 2ZTCA 1E2ZA 4RAYA 3MWDA 1I6VC 1H9SA 2E75C 2UUBQ 2J4XA 2XCAA 4WORA 1EZ6A 5KFSA 3AFPA 2IX3A 3BA9A 1HZCA 3N44B 4MV3A 2A5HA 4HNTA 4BBSG 5FPOA 3GILA 2E74C 3D4DA 4L63B 3FKIG 3A55A 2YTVA 4V190 2A8VA 4A3BB 4XX0B 3IN5A 4B3RH 3F1ZA 4CKBA 3HOWG 2LKVA 4IALA 2B2UC 4DR2Q 1M8AA 4C3HH 2JA7B 1SAPA 3EVQA 4H13C 4TKOB 1EY9A 4RNMA 1TWGH 1V9PA 2WINB 1VQOA 4DR3H 1N34Q 2NU9B 3PW5A 2JEJA 3GTLA 2AGPA 1LTID 1YHAA 3CW2C 5T1GA 2UUCH 2R6GA 5KFCA 1PYBA 3LP8A 3GV8B 5L37A 2Z0SA 3D0FA 3IRBA 2D2CC 2G9DA 4AQYH 1JORA 1JOKA 1YIJA 4IHJF 2WKCA 4JI3Q 3FHWA 4DR4Q 4JBMA 3J81j 3I4NB 2NU6B 1II3A 4OHJA 1V1OA 1Y8PB 3T56B 5L1KA 5JVH3 1S9FA 3L9AX 2JA6B 5LOVF 2M05A 1Y1VG 5CBAE 3K3VA 4AIMA 1PX2A 1TWAA 3I4OA 5GAGC 1BQQT 2VB2X 5M5WB 5BN4A 4QB4A 1FD7D 4JBJA 1PA6A 3RTXA 4GC7A 2GVAA 1E4GT 3G6YA 1E22A 1CSQA 1QB5D 2F0FA 1KDAA 4IPCA 5KNDA 2E2DC 4OX9L 2KSWA 1C30A 5J1ZA 1PZKD 1G51A 1KDCA 4RZRA 4HMIA 1ESRA 3PW4A 1SBBB 3R2IA 1I4PA 1K8GA 4DV0Q 4A3BH 1PRTF 2DIKA 1RYRA 5IODA 4C2MH 2F3VA 2C28A 2YS6A 1X9NA 3JAMc 1Q12A 4DL4A 1N56A 2FK2A 5EZYF 3KLSA 1N33H 4UCVA 4EBEA 1IL2A 3RLNA 4FF4A 2PYKA 2QILA 2O2LD 1HH2P 3GIIA 5C3XA 1ENCA 3GTOA 1PVOA 2DPIA 5FLXW 4RA8A 3NUCA 2VQEH 3PUYA 5IYZF 4G57A 4HIDA 4JI1Q 1GO3E 4L5QA 3MTSA 3DWQA 3I90A 1DZ1A 4BBRB 1TVXA 3HB9A 3ND8A 3KF8B 4GOPA 2VA3A 2DWCA 2JA6H 4LH6A 4IO9A 1XPRA 5KFQA 4TVAB 1G2SA 3ZYYX 2R93H 1VQIA 1T5XD 4NDXA 1E3PA 2EYOA 2Z6BA 5J39A 3PUVA 1ICWA 1B9NA 4A3KB 3HGBA 5CV9A 1X65A 1RD9D 1IBLL 1E24A 5M3FG 2PI2A 2HGSA 3L7ZC 1EQRA 1KLUD 5CA1F 1R4QB 4RB2C 1OXTA 3K80C 2AUKA 5C5MA 4DR1H 2G9HD 5KFIA 5HBRB 5KG1A 1ONLA 3GV5B 4PZ7A 3A0JA 1QUQB 4LK1C 2FPGB 5GROA 4DPGA 2I5MX 1UNSA 3AEVA 4PZ6A 1BGWA 4IOCA 3QO2A 3E6ZX 2K5WA 4CC5A 3OWEB 2AQ4A 4A3DG 3F2UA 2CCZA 3MR3A 2UU9L 2DY8A 4LNQA 2SOBA 4DR7H 1QWYA 3EFXD 4AYBE 4GLXA 1PFSA 1KNAA 5DM73 3L4JA 3OOCA 3VR2A 1RCVD 2WYOA 2HQEA 4Y7NH 1HNXH 2RCFA 5IGBA 2F0JA 2EYHA 4CJ2C 3NBHB 3J7AF 1SEBD 1OXXK 4J8QA 1XNQL 4K6DA 1M90C 1ZXTA 4HJAA 4MV6A 2B39A 1TS3A 4ECRA 1JDEA 3VMMA 4A3KH 1TWCA 1SNPA 1I4QA 4X66L 5CA0F 3NE5B 4A3FB 4JI8Q 1TY0A 3JAME 4FDBA 1J6QA 4L5SA 1A15A 4O1NA 4TV9F 5LA6F 5KFZA 4JV2A 2HVQA 2YU9H 3FDTA 3GQBA 1M0TA 3A5ZB 2R8JA 1XMQH 3Q8SB 1VQNA 5K36G 3IG0A 3KK7A 2KJXA 5J22A 4ECVA 3BVZA 4R8UA 3DMUA 2O5JC 3HOUG 1GUWA 3QWNA 5KFDA 4LF5H 5KKNB 2L1BA 5C3WA 4J9MA 4MN3A 1UWVA 4TQUS 4A3MB 1NUCA 4K0KH 4RCNA 3C3LA 3EQLC 1JWUD 1MSGA 4NXNL 5KT5A 1HUMA 4ED6A 2WDTA 1XMOH 3L2PA 2PN1A 3BYYB 3J7A5 4ZOLF 5DM63 1QE6A 1HA5A 4RGMA 3GTGB 5HGTA 2F03A 4O3QA 4R4QA 4KHPL 2EJGC 1N32H 1XXGA 2XC9A 2R7ZB 1AE2A 1V1PA 4ZHQF 3M7NA 4JV5L 3VYRA 1PXUA 2RGRA 4IPGA 4HN7A 4IFDG 4U6PA 3NELA 4ZUIA 5DGAA 1FNVA 2IY5B 1J5EH 2IHEA 4HJ9A 2PBZA 4GC6A 4ED7A 3BVMA 5IYCH 3S1MB 2Z4HA 4XT1B 2KECA 4KTAA 4G4KA 4A3FH 1EQQA 1SNDA 1U4PA 4MV1A 2JYOA 1TWHA 3W1BA 5IGFA 3UDIA 1ESFA 3PIOA 2F0SA 2Q2UA 4MIUA 4DAYB 4HCSA 4DK3C 1PH2A 4ED3A 2EY2A 1UC9A 2ZXOA 3TS2A 3G6JB 4BY1G 4O0AA 4A93B 1UAPA 1I3QB 4BWGB 5FKAC 4H7BA 2F4VH 1A2TA 1VF5C 4TRDA 4F87A 1S97A 1CFMA 5D3DA 5L1LA 5D8DA 2Z6KC 2E2HA 5DG9A 2R8GA 4X65H 4APVA 4LFAH 2IW3A 4DAPA 4A3MH 4FBTA 2B2TA 4YY3L 2CVRA 3A8JE 2UUAH 3V2TA 1CQIB 2K75A 1FNWA 1XTDA 4DA2A 3M4OB 1KDBA 4DUZQ 3AQQA 3GTGH 5C5LA 2L15A 1YJNA 5FD6A 2W6MA 3STBD 3MA2B 2WAQA 1S0OA 1EHIA 2R7ZH 2XSCA 4ZK9B 1EWIA 5IY0A 1G8ZD 5LL6X 4DAVA 1N34L 3TSSA 1IW7C 1ZQ7A 3TREA 4EFEA 2W9BA 3T16A 4J0MA 1SNCA 1L0WA 3C1EA 3S1MH 3LWUA 5J2TF 2KQ3A 2UXDQ 3GP7A 4DK6C 5FO8B 4X64L 5DGBA 4A2BA 2F0DA 4B3TH 1K73C 4EQPA 1O80A 5ELOA 4R4IA 2Q8IB 1VQ6A 2VUMB 3N41B 1KJJA 4O3OA 2JA7A 1JDBB 1I4HA 2MPMA 1GKHA 3Q24A 1YJWA 1TKWB 3PF4A 5JAVA 2BE5C 4GNXB 1LTTD 3RN2A 4A93H 3T1HH 1I3QH 4YWMA 3FPUB 4ZQ3A 4PMWA 4ILWA 4LF8H 1Z9FA 1JMCA 1LT5D 2LY7A 1CM9A 2LFNA 3OTOH 2H1EA 2RA4A 2OTJA 1ZKOA 1I50H 1KJ9A 3GV3A 4J15A 1SROA 3KF6B 2WB1G 2L12A 1I7LA 5A2QL 3NQIA 1FJGL 5HV6A 4J9PA 1EU4A 1JJCB 2VA2A 4BS9A 4IUUA 3N43B 5I2XA 1T9HA 2GA4B 2I0QA 1KIXA 3CMAA 1EWHA 4HYKA 5FO7B 3T1YH 1WTPA 4K5WA 1HR0L 3VPDA 3M4OH 4E6IA 5M5YH 2UXCL 2AQ3B 4HSPA 2WB1E 2HIXA 3PV0A 2CZGA 2ZM6H 4DL2A 3RBEA 4LFCL 4L5TA 4GNXC 1K8AC 1F2LA 4GN3B 5EQ0A 3CCMA 5LYJF 2YW2A 1SYCA 2MGSA 2NBFA 2L11A 4J9NA 3TZUA 1JKJB 1F9SA 1U9RA 1EY4A 3I7FA 2K5QA 1QVFA 5DQHA 1SEIA 4PZ8A 1HNZH 3HKZG 3OHBA 1P16A 4FBUA 1JWMD 2RDGA 2W6ZA 1K3RA 4EX5A 3PR5B 4QY7A 5C44G 2VUMH 3H4DA 3GTKB 5AFWA 2KHIA 2GLTA 2SNSA 3LNNA 3Q22A 3K5MA 2CHBD 5DG7A 4LF7Q 4DR6H 5KFRA 3M3YH 4EQOA 1QCBD 4RHRA 3DWAA 2F0EA 4BA1I 4DR5Q 1PH4A 2EIFA 1TWAB 3JC66 1ZHSA 1JIHA 3Q8RB 4F4XA 3RZDB 5KFNA 2EJFC 3KLWA 2I8CA 1J8IA 1I4GA 5IYDG 4ETSA 3OPOA 1QZHA 1JOQA 3MXGA 1PTOH 5BR8H 1AEXA 3W2DA 4DNTB 5JPNC 4LF4H 1UE5A 5IWAL 4WFN3 1Y1WG 5L1JA 4JI4H 3HBLA 2UXBL 3K58A 1X6OA 1CI3M 2AKWB 1EIYB 4PDBA 1PTOD 4JI2Q 1KC7A 1AN8A 3SDZA 1AUXA 2DUDA 1SNMA 2PW7A 1VDZA 2C9OA 1YNJD 1MJEA 3GTLH 1HXYD 1TU2B 4LF6H 5ELBA 1UC8A 1B53A 3P1HA 4DV4Q 4OWXB 4KHZA 4X62Q 2XNAC 3GTOB 3FKIA 4NXML 3GTMA 3JZIA 3GTKH 3J7ZC 3T5KA 1W6JA 1IL8A 3U4VA 3MC0B 1IBMH 3A8KE 2F0NA 4DV2Q 4RG1A 1JC7A 3KBGA 1I5FA 4JOIA 1TWAH 1A3VA 3RZDH 1IYVA 2NN6G 3MFGA 3OUZA 2XN9C 5ELFA 3WWVA 4V0BA 3A74A 1Q1EA 3CCVA 1E1TA 2GPSA 1MIUA 1KBLA 2ASJA 2F3IA 4MAMA 3T5HA 1B50A 2ATWA 1Z7TA 3T53B 3TQTA 4K5XA 4P71A 4IJLA 2XGTA 1HUNA 1EUCB 1Y1VA 4B3ML 4I50F 3BG5A 1PMRA 3IL8A 4R7RA 4WJ3M 2E5LQ 1HQMC 1L2ZA 1VQHA 4UCTA 3D4RA 3CQZA 4ED2A 5D3IB 3W1GA 2KEEA 2ASBA 1UE6A 5KG6A 1C4QA 1LABA 3GDEA 4JI0L 4IQZA 2JN4A 2QF7A 1I94Q 2I80A 3GTOH 4DV1Q 4MV9A 4ECSA 3I55A 3E3XA 5JPMC 1VBHA 1EFID 3S1RH 2YTYA 3RZOB 1AFPA 2JEGA 4ALPA 2M2LA 2W57A 2JEAI 2EXDA 2H4OA 2WV6D 3X3NA 1LTBD 3VPBA 1X3EA 4K8JA 4N8FA 2A69D 4JI7Q 4I65A 3HOVB 4OX9H 4WBNF 5I9OA 3K6OA 5C3EG 3C2PA 2I46A 4F7XA 4C5AA 2OQKA 3RJ0A 2F0MA 2AUJD 1TIID 2E2IB 1QJOA 1AP0A 3VYTA 1RTOA 4HIMA 1QZGA 4YJ2F 4QWBA 2SNMA 4J6HA 4DL6A 4NMZA 4MA5A 1YVCA 1BXRA 1Y1WB 5D14A 5KNCA 5EPJA 5EWGA 1HTPA 1STYA 2C00A 3TP8A 4A3LG 5KT7A 1Y8NB 5E3FA 4IUQA 4DF7A 1OWTA 2ZXRA 3S2HB 4G7OC 3K57A 4BY7G 3BDOA 1S5DD 1E2VA 2A73B 5JEAG 3H3VC 2DGYA 2NZHA 2Z9HA 3F8NA 4LF9Q 1E2WA 3K8AA 3Q6SA 4O42A 2JA8G 3PO3G 3PO2H 2R7KA 4MTKA 5ELNA 2ZJPA 4DUZL 3RMHA 4YB8B 2ATLA 2IP4A 2IHFA 3BZCA 2PNRC 1K1SA 3RZOH 4F50A 5IP9G 3HOZG 4KV6A 4DV3L 3AFQA 1Q86C 5HGQA 2Z8LA 3F8TA 1CK1A 4P73A 1FR3A 3BZKA 5FLMG 4JV1A 5EKKA 1IBLH 1QG7A 4LUOA 3VR5A 1CA6A 2L5TA 2R3ZA 3HOVH 2KHJA 3CPFA 2D9UA 3NTKA 4UCSA 4RB1A 1T5EA 2DN8A 3H3VH 1QNUA 3CF5A 3Q2OA 4X6AH 1TWCH 2DJFC 4DK0A 4B3RQ 1YJ9A 1N36L 4F8MA 4ABNA 2FK3A 1MBYA 1TWHB 5A35A 1IKMA 5K5PA 1SFOB 2L55A 2XRQD 4DR3Q 1HZAA 2K4KA 4YP3A 5M3MG 4A76A 1KD1C 3CU7A 2MNAA 2UUCQ 2PMZA 1GHJA 2K5NA 1K0RA 1BOSA 4XQJA 5FLXE 2PPBC 4BXXH 4AQYQ 2NVXB 2RKSA 2UU9H 4OELB 3K0YA 5KIXA 4Y8VB 2E2HB 1TXYA 4F4WA 5I2YA 1D5MC 3S2HH 4FP5D 5J3BA 1ASZA 3G6XA 2IMWP 3LMLA 2FFKB 4NPSA 1XNQH 5C8YF 2A68C 1S4ZA 3ER0A 1V43A 4EEQA 3K7AB 3EROA 3CCSA 1WFQA 3KF6A 4QQBX 4IRDA 3SE7A 1K0SA 1BBUA 1G2TA 5KYIA 4GKKL 2A6HC 3UE0A 5JH7F 2SEBD 1KEEA 3IFDA 3MWYW 2XCLA 4X66H 2F0QA 2FHTA 3CP0A 1S5ED 4YJ3F 4C3JB 1D6EC 2AWOA 2W9BB 1BCPB 3ULPA 3V6KA 1EY8A 2CKZB 2PW5A 1O75A 1Q7YC 2A1AA 2W6QA 1TQOA 4HTHA 4L1KA 2OH2A 3Q0AA 3VA7A 4X3TA 2B2TC 3WOFA 1IOWA 3I4LA 4F4ZA 1H95A 1CQVA 2FLPA 4IRCA 4IJHA 1TWHH 3S1QB 4XQNA 4IUTA 3G6EA 1T36A 4IRKA 4GKJL 1YNND 3OSOA 5BN5A 1WCMG 5IT9L 3CCQA 4KN7C 3Q8PB 2XGPA 2W6OA 1PDQA 5KFVA 4HEDA 3NGDA 4HMJA 3RV4A 1Q3LA 1XWEA 3MEHA 4MV7A 2YYAA 2FP4B 2I07B 2AQ2B 3R3OA 4FO2A 3HS0C 2VQEQ 1KL9A 4NXNH 3GIJA 3GD7A 3MJFA 1F9PA 2E2HH 3GTKA 1E4EB 3RIZA 3TMEA 2G5DA 2R7MA 1BCPC 2CH4A 5D1OB 4DGZA 4BY7B 4KHPH 1WSCA 4XYLB 1O7LA 4JV5H 1J9OA 3SHLA 4I7HA 3PO3B 2MP1A 3EA6A 4DV6L 1IBKL 1A6XA 2ALYB 3TP5A 5C4JB 3SE0A 4B3SQ 1O78A 1GUGA 3BQ1A 2B29A 4RWSC 1DYQA 5KFOA 3VR3A 4Q43A 4ZRZA 1CHPD 1XNRL 1K83A 4LUVA 1NJIC 4Q0YA 2JE6I 4C3JH 2K03A 3DEPA 3NENA 2JK8A 1ULZA 3Q1KA 1TS4A 1TR5A 5JUMA 3AMUA 5GQOA 4C3IG 4DR1Q 2QKIC 4RFBA 3U58A 4OEMB 1C9OA 4O4IF 2CWAA 1EZ1A 3GQCA 2TSSA 2ZDQA 5KFUA 5KFHA 3UDGA 1BKBA 2VS1A 4JBWA 3HOXB 2JA7H 3TP6A 2OWOA 3QIAA 4UP8A 5C0XG 3RAQA 3J80i 5LL6S 1SE3A 4QMGA 4U673 1UUPA 1GSAA 2E8GA 2NB0A 2BA1A 2BR0A 4JI6L 2MHVA 4X3UA 4A3GG 1SYGA 2YV5A 2KBNA 4IWYA 3M4PA 2EOTA 4YY3H 2F0WA 4RCOA 1VQEA 4DR7Q 3BG3A 3M9OB 2R61A 3RV3A 3MFIA 1HNXQ 1CUKA 5I9PA 3I4NH 2AMCB 1SE4A 3M7GA 1ICFB 4RB3C 1AZQA 1IKLA 2R7DA 3M85A 3X3MA 2RHSB 1ENFA 3OMCA 1PRTB 3H0GG 1X54A 2VPSA 1N34H 2F0LA 4FU0A 4YBZB 1VF7A 5KG7A 4QGUA 1HRJA 5M5WH 2RSOA 4K6LA 1C8CA 1WOCA 5CR3A 3NK9A 1X56A 1U4RA 2C2DA 2RCNA 4R4CA 1GHKA 1FVIA 3NWTA 4FNFA 2WB1A 3L3OC 3N52A 2YRXA 3KAKA 4X64H 2HDMA 4ME5A 3CPWA 4IAJA 1O7ZA 1EQTA 5A2QW 3CRLC 1XMQQ 4RHSA 1SMXA 5CC4A 4CC6A 4GLVB 4IPDA 3RB3A 4LSAA 4BBSB 3BYTB 3FKIB 3GTMB 2PNHA 2Y0SG 4AYBG 1HR0W 3HOXH 3I4MG 4LF5Q 1PRTC 5EBDA 3HOWB 2SCUB 2A19A 4K0KQ 1FJGH 3P75A 5F9NA 3HOYG 1B1ZA 5FPRA 4XIGS 4YHHL 1W6KA 3TEHB 1XMOQ 3E9IA 1PLFA 3D31A 5AJ3Q 3HKZA 2RBMA 4KD3A 2Y0SE 3T51B 3ETHA 1RJPA 1JE5A 4U7CA 1HR0H 5KT2A 1VS0A 4L5RC 4DUYL 4BBRH 1N32Q 2W9AA 1HJPA 1RTNA 2UXCH 2Z1CA 3TN2A 3KTMA 2XCPA 1EIGA 4G7ZC 1LTAD 5C6AA 1DOLA 4L8JA 4LFCH 1ZETA 1J5EQ 3IKJA 1BXTA 2DPJA 3K3PA 1JE4A 1Y1VB 1VKZA 4MA0A 1HNWL 2B8FA 1JJGA 2NUAB 2FJZA 1TT2A 2R8KA 1AW7A 3GV6A 4MHEA 3ULJA 3ZJYC 4JYAL 4OO1G 5LP6F 1MJCA 1RJRA 3ORRA 2DNEA 5COYA 2E2IA 3KJPA 2R86A 3R2TA 2HHHL 1DM0B 4UY8C 4C5CA 3CQZB 5DQGA 4JOIC 4EQNA 4EEYA 3DM1A 1W2BA 4HJ7A 1LT3D 2R7LA 1Y1WA 2HCCA 1EL0A 4QCLA 5IGCA 1CSPA 4BBSH 5FJ8G 2C2RA 1GUSA 2F4VQ 3FKIH 5CORA 3GTMH 1RODA 3J80L 4JPBW 4ZAIA
chains in the Genus database with same CATH topology
1L1OA 4GN3B 3CCMA 3K7AH 1YHQA 1JB7A 4X65Q 4O2DA 4LF8L 1SE8A 1PH5A 4JI2L 4LFAQ 2VL6A 3NEMA 4A3JG 1QVCA 4QIWE 4YHHQ 3OTOL 3OW2A 1UE1A 3CC7A 2R92G 4X64Q 3Q8DA 3GO5A 1QVFA 3I7FA 4PZ8A 3HKZG 3M4QA 1P16A 5IYBG 3J81c 4DUYQ 3PGZA 4DV4L 1K3RA 4EX5A 3CCJA 3T1YL 4QY7A 2JA7G 5C44G 2VUMH 3TRZA 2Z6KA 4X62L 5IT9c 5C3EH 1Y14B 2KHIA 5GAHC 4A3CG 1NMFA 4LF7Q 3DM3A 4AH6A 2PQAA 3M3YH 3S14H 1XJVA 2ZM6L 2VY3A 3K81C 5IYCG 4HIOA 3S1QH 1CKMA 1YHBA 1VQAA 1HNWQ 4A3FG 4QL5A 4BA1I 4DR5Q 1PH4A 1Y1VH 2OQ0A 2EIFA 3RN5A 1VQLA 3JC66 4JYAQ 1FJGQ 4GS3A 3GTPH 3S2DH 4DV2L 4A3IH 5LMUQ 3KLWA 2OTLA 3CD6A 2D0PA 4JI5L 1TWFH 1YZ6A 2HHHQ 1OTCA 4B3TQ 1Q1BA 1Q46A 5IYDG 1QZHA 1K8AC 1HNZL 1HR0Q 2CWPA 4A3LH 1UE5A 1X3FA 5LMNL 3CQZH 2UXCQ 5IWAL 1Y1WG 2Q2TA 4R1JA 1WYDA 2WP8J 3PUZA 4DV5L 4BY7H 4LFCQ 1B7YB 2UXBL 2H5XA 3T1HQ 2B63G 1HZBA 1X6OA 1L2FA 2AKWB 1EIYB 4DR6L 4OWTB 3PO3H 3UDFA 2JA8H 4A3MG 4JI2Q 2QA4A 1Q8KA 1XPUA 3OTOQ 5C4JH 2DUDA 1PHJA 1P8LA 2ES2A 2E5LL 4IPHA 1VQBA 2HIVA 5IP9H 5H1SE 1MJEA 1YNXA 2VZAA 1VQ5A 2UUBL 3GTLH 3HOZH 1LTLA 4KLKA 3S24A 4POFA 4DV4Q 4HIKA 2GN5A 3T1YQ 2IT1A 3F2CA 2R7ZG 4OWXB 4KHZA 4X62Q 4DKAC 1S40A 4LW1A 5FLMH 4JBKA 2JA9A 5BR8L 4NXML 2KCMA 4MTNA 1KAWA 3HOXG 1YBYA 2MO0A 4LF4L 3S15H 2JA5G 3GTKH 1I94L 3J7ZC 2ZM6Q 4JI4L 4DV1L 1N9WA 5M5XH 1CKNA 3MXNB 3GTJH 3UDXA 3U4VA 4DR2L 3AYHB 4A3EH 4YCUA 4DV2Q 4RG1A 1A63A 2HQLA 3KOJA 3DLLA 3M9BA 1I5FA 2F52A 4JOIA 2IX0A 1TWAH 2VQFL 4YWLA 3SGIA 1VQ9A 5M3MH 1D7QA 4DNIA 3RZDH 1GM5A 2NN6G 1S72A 4BBRG 4LF6L 4A75A 4JI7L 3WWVA 3G48A 5LMNQ 3A74A 1Q1EA 3CCVA 1E1TA 2YYZA 1MIUA 1YI2A 1N8RC 4JI3L 2F3IA 5IWAQ 4DR4L 4GNXA 4A93G 4DV5Q 2NVTH 2ATWA 2UXBQ 1Q82C 2E2JH 3MEFA 5M3FH 4P71A 2WFWA 4IJLA 4DR6Q 2XGTA 4B3ML 1O7IA 4OONA 1AH9A 1U0LA 2Q2IA 3RLOA 2E5LQ 5IYDH 4DV7L 4B3SL 1IBML 1E7ZA 2ZTCA 1VQHA 3CCUA 2UUBQ 1PH1A 1LM0A 4YCVA 3A5UA 4JG2A 5C4XG 3AFPA 3W1GA 3HOWH 5IP7G 1HZCA 2ASBA 1UE6A 5HY6A 3RR5A 5BR8Q 4NXMQ 3GDEA 4JI0L 4LF4Q 4BBSG 2ZJRA 4A3DH 2MO1A 1LYLA 3FKIG 1UEBA 4YWKA 1I94Q 1ASYA 3GTOH 2A8VA 2YTVA 4JI4Q 4DV1Q 3I55A 4LF9L 3F1ZA 3GTQH 3HOWG 1XPOA 1EYGA 2CFMA 3S1RH 2YTYA 4C3HH 4DV0L 4DR2Q 1BBWA 1RL2A 4ALPA 1TWGH 1V9PA 1VQOA 4P72A 1N34Q 4PG3A 3CW2C 1YHAA 2EXDA 2VQFQ 2JEAI 3S1NH 4KI0A 2R6GA 1PYBA 1X3EA 2Z0SA 3D0FA 3IRBA 2YTXA 3RLFA 4UP7A 2RHQB 2GVBA 4JI7Q 4MNOA 1WCMH 1YEZA 1VQ4A 1YIJA 5C3EG 2VUMG 4JI3Q 2UUAQ 3FHWA 4DR4Q 3I2ZA 4JBMA 3J81j 2Q2HA 2KCTA 2OQKA 2HT1A 1B70B 2PMZE 1NMGA 1JJ2A 5JJIA 5GAEC 4JI1L 4B3MQ 2K5HA 4HIMA 1QZGA 1VQMA 4B3RL 1Y1VG 3H15A 4XTCS 3PF5A 3J81i 1R9TH 4AIMA 1YVCA 3I4OA 5GAGC 4A3IG 1IBMQ 2V1CC 3ICEA 4DR3L 2MFIA 2PI2E 4JBJA 1Q81C 1PA6A 4R4OA 2GVAA 2UUCL 1E22A 1CSQA 4A3LG 1OXSC 4IPCA 4LFBQ 2B3GA 4UP9A 4JI0Q 3HOUH 4AQYL 4OX9L 4EQ5A 2IX1A 2R7FA 4BY7G 1U5KA 1G51A 1K9MC 2CQOA 2JQOA 5JEAG 2DGYA 2NZHA 4LF9Q 3K8AA 1EIFA 3PO3G 2JA8G 1SRUA 3PO2H 3J80c 1K8GA 4GN4B 5ELNA 2ZJPA 4DUZL 1V1QA 4DV0Q 1VQ7A 4A3BH 4C2MH 3G4SA 2IHFA 3BZCA 1E1OA 5JEAJ 4C3IH 3RZOH 5IP9G 1X9NA 3JAMc 1Q12A 3HOZG 4DV3L 4LF8Q 1NTGA 2D0OA 3AFQA 1Q86C 5HGQA 2PQAB 2I5LX 2KENA 2BH8A 2ZTDA 3F8TA 3RLNA 1IL2A 3CC4A 4P73A 2BH2A 3KFUA 3BZKA 5FLMG 2K50A 3I56A 3PCOB 1BVSA 1HH2P 2AHOB 4LUOA 1PVOA 3STBC 2NVQH 1PH6A 3HOVH 2KHJA 3CPFA 3H3VH 3PUYA 3CF5A 1Z47A 1KRTA 4HIDA 4IFDI 4JI1Q 1GO3E 4L5QA 5C0XI 5DLQE 4A3GH 4X6AH 2C35B 1TWCH 1QVGA 3KF8B 4GOPA 4B3RQ 2I5HA 2K5VA 1YJ9A 1N36L 1JT8A 4A3EG 2JA6H 1SLJA 4IO9A 4GN5A 1XPRA 4BXXG 5IE8A 4DR3Q 1AE3A 1HZAA 2K4KA 4TVAB 3FP9A 5M3MG 3S17H 4A76A 1KD1C 2R93H 2MNAA 1DGSA 2UUCQ 1VQIA 4BA2I 1E3PA 2JJQA 2K5NA 3U4ZA 3PUVA 1K0RA 1N33L 4BXXH 3H0GH 4AQYQ 3TS0A 4JI5Q 2LXKA 1NE3A 1X65A 1TXYA 1HNZQ 1E24A 5M3FG 1IBLL 3S2HH 3HFZB 4JI8L 5J3BA 2VQEL 1M1KC 1ASZA 2EQSA 2PI2A 3KDFA 3L7ZC 1K83H 3CAMA 1EQRA 3HKSA 1OXTA 3K80C 1VQFA 4NPSA 2N78A 2K14A 4PZ7A 3A0JA 4DV3Q 1QUQB 3ER0A 1V43A 4H02A 5GROA 4YCWA 2I5MX 4DPGA 1X55A 3AEVA 4PZ6A 3CCSA 1WFQA 4IOCA 3KF6A 4QQBX 1KXLA 4RMFA 3E0EA 1BBUA 4GKKL 3UE0A 4A3DG 2CCZA 1SN8A 3I4MH 3CP0A 3PUXA 4MZ9A 3UE1A 3W5OA 2UU9L 1NBWA 2AWOA 4LNQA 3ULPA 1FL0A 4AYBE 1PFSA 4GLXA 2CKZB 1Q7YC 1N36Q 2A1AA 4Y7NH 3HOYH 4A4IA 4DR1L 3CCRA 1H95A 1KHIA 4IJHA 1TWHH 3NBHB 2VW9A 1OXXK 1WI5A 2BA0A 4P75A 3EBEA 1XNQL 3G6EA 1M90C 1GVPA 1PH9A 1SR3A 4GKJL 2NZOA 4HJAA 4HJ5A 1WCMG 3CCQA 1VCIA 1G6PA 3B6YA 4JCVE 4A3KH 4LF6Q 4X66L 3U50C 3CXCA 5LMUL 4JI8Q 1D8LA 1KL9A 2VQEQ 3GD7A 4WJ4A 2E2HH 4FDBA 1J6QA 4L5SA 3LGJA 3OYYA 4DR7L 4LUZA 1HNXL 2YU9H 3A5ZB 2QGQA 3PUWA 1VQKA 1C7YA 3K0XA 4OWWB 1VQNA 5K36G 4OO1I 1PV4A 4DV6L 1IBKL 1HZ9A 2K52A 1W3SA 2ALYB 3KYHC 4DV7Q 4B3SQ 4GKKQ 2VNUD 3HOUG 2B29A 1IZ6A 2UU9Q 5FJ8H 2NVYH 1UWVA 1KRSA 4TQUS 1XNRL 4LUVA 2WAQE 1L1OB 1NJIC 3PO2G 2JE6I 2FXQA 4C3JH 4A3BG 2JEBI 4NXNL 3NENA 5JJKA 2JK8A 2N3SA 3L2PA 4A3JH 2XTIA 3J7A5 5E7NA 4OXPA 1A62A 5GQOA 4DR1Q 2R92H 3U58A 4R4QA 1PH3A 4KHPL 1XNQQ 1C9OA 2ZTEA 1X3GA 2CWAA 1NY4A 1AE2A 3VDYA 1XMQL 4GKJQ 5IYBH 3UDGA 1BKBA 2VS1A 4JBWA 3M7NA 4IPGA 4JV5L 2JA7H 3PIPA 2OWOA 4IFDG 5C44H 3NELA 4UP8A 5C0XG 3J80i 3HKZE 1KC8C 3HOVG 2IY5B 2IHEA 4HJ9A 4P74A 1YITA 3EIVA 4A3CH 2E8GA 4JC0A 4X66Q 4LF5L 2BA1A 4POGA 4JI6L 3I4NG 4A3GG 2YV5A 2KBNA 4IFDJ 2ID0A 2LXJA 3M4PA 5IYCH 1OXUA 3JAMi 5C0XJ 4DR7Q 1VQEA 4K0KL 1UE7A 4A3FH 3F2DA 2N49A 1EQQA 1A0IA 2JA6G 1L1OC 4Y52H 1HNXQ 1CUKA 1XMOL 1G291 3W1BA 5AJ3L 3UDIA 3PIOA 3I4NH 2UXDL 2Q2UA 4DAYB 2AMCB 2R93G 4DK3C 3ULLA 4DAMA 1PH2A 3H3VI 2R7DA 3M85A 4DV6Q 1IBKQ 2E2IH 2RHSB 3TS2A 3TQYA 4BY1G 4O0AA 1MKHA 3CMEA 1KQSA 1CKOA 1S3OA 1N32L 1A8VA 1WJJA 3H0GG 3BU2A 5GADC 1X54A 4ME3A 1Y1WH 4QGUA 1EOVA 5M5WH 2Z6KC 1XNRQ 1J5EL 1WOCA 1X56A 4APVA 4BY1H 2B63H 2RCNA 4R4CA 4LFCL 1PH8A 1FVIA 4NXNQ 4A3MH 4HJ8A 4OX9Q 2N8NA 3CCLA 4YY3L 3CC2A 3CPWA 1EFWA 4LWCA 4NB3A 2K75A 1XTDA 4KHPQ 1QUQA 4DUZQ 3AQQA 3GTGH 1XMQQ 1VQ8A 1SMXA 2L15A 3PSIA 1YJNA 4GLVB 4IPDA 3STBD 4JV5Q 5EAYA 3RNUA 2R7ZH 4GOPB 1OXVA 2OCEA 3E9HA 2PNHA 2Y0SG 4AYBG 1HR0W 3HOXH 3ERSX 1EWIA 5IY0A 3I4MG 2F4VL 4LF5Q 1N34L 2JA5H 4JI6Q 2RF4A 3S16H 3TREA 1CKNB 2A19A 4K0KQ 4X65L 1L0WA 4LFAL 3HOYG 3K7UC 1VQPA 4XIGS 4YHHL 3S1MH 4QJFA 3TEHB 1XMOQ 3E9IA 5AJ3Q 3D31A 2UXDQ 4DK6C 4X64L 1B8AA 2UUAL 2LSSA 1K73C 2Y0SE 2MQHA 1I6HH 1JE5A 5ELOA 4R4IA 1IYJB 1VS0A 3CCEA 2ZJQA 1VQ6A 4L5RC 2D62A 2QEXA 4GLAC 4DUYL 4BBRH 1GKHA 4IOAA 1N32Q 1HJPA 4R4TA 1YJWA 3KDFB 3BJUA 1VQDA 3PF4A 1EUJA 4GNXB 2NN6I 4UPAA 1SFOH 3RN2A 4A93H 1VQCA 4A3KG 1I3QH 4YWMA 4LF7L 1J5EQ 4PMWA 4GOPC 3KJOA 1Z9FA 1LUZA 3L0OA 1JMCA 1N33Q 1HNWL 2OTJA 1JJGA 1RIPA 1I50H 1IXRA 4DR5L 4J15A 1SROA 3KF6B 2WB1G 4YY3Q 3ULJA 3ZJYC 1IBLQ 4JYAL 4OO1G 1FJGL 1MJCA 2AWNA 2NVXH 4LFBL 1JJCB 3EN2A 1C0AA 1VQGA 1T9HA 1FGUA 1VQJA 3KJPA 2I0QA 1KIXA 3CMAA 2HHHL 4B3TL 4UY8C 4JOIC 5C4XH 3F2BA 1HR0L 5JJLA 3M4OH 5IP7H 1W2BA 3G71A 5FLXc 4HJ7A 1PH7A 2WAQG 5M5YH 2UXCL 1CSPA 4BBSH 5FJ8G 2WB1E 2HIXA 3PV0A 2F4VQ 3FKIH 5LMNW 3GTMH 1GD7A 3T1HL 4L5TA 4GNXC 1PYSB 4WJ3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O A;  4GN3 B;  3CCM A;  3K7A H;  1YHQ A;  1JB7 A;  4X65 Q;  4O2D A;  4LF8 L;  1SE8 A;  1PH5 A;  4JI2 L;  4LFA Q;  2VL6 A;  3NEM A;  4A3J G;  1QVC A;  4QIW E;  4YHH Q;  3OTO L;  3OW2 A;  1UE1 A;  3CC7 A;  2R92 G;  4X64 Q;  3Q8D A;  3GO5 A;  1QVF A;  3I7F A;  4PZ8 A;  3HKZ G;  3M4Q A;  1P16 A;  5IYB G;  3J81 c;  4DUY Q;  3PGZ A;  4DV4 L;  1K3R A;  4EX5 A;  3CCJ A;  3T1Y L;  4QY7 A;  2JA7 G;  5C44 G;  2VUM H;  3TRZ A;  2Z6K A;  4X62 L;  5IT9 c;  5C3E H;  1Y14 B;  2KHI A;  5GAH C;  4A3C G;  1NMF A;  4LF7 Q;  3DM3 A;  4AH6 A;  2PQA A;  3M3Y H;  3S14 H;  1XJV A;  2ZM6 L;  2VY3 A;  3K81 C;  5IYC G;  4HIO A;  3S1Q H;  1CKM A;  1YHB A;  1VQA A;  1HNW Q;  4A3F G;  4QL5 A;  4BA1 I;  4DR5 Q;  1PH4 A;  1Y1V H;  2OQ0 A;  2EIF A;  3RN5 A;  1VQL A;  3JC6 6;  4JYA Q;  1FJG Q;  4GS3 A;  3GTP H;  3S2D H;  4DV2 L;  4A3I H;  5LMU Q;  3KLW A;  2OTL A;  3CD6 A;  2D0P A;  4JI5 L;  1TWF H;  1YZ6 A;  2HHH Q;  1OTC A;  4B3T Q;  1Q1B A;  1Q46 A;  5IYD G;  1QZH A;  1K8A C;  1HNZ L;  1HR0 Q;  2CWP A;  4A3L H;  1UE5 A;  1X3F A;  5LMN L;  3CQZ H;  2UXC Q;  5IWA L;  1Y1W G;  2Q2T A;  4R1J A;  1WYD A;  2WP8 J;  3PUZ A;  4DV5 L;  4BY7 H;  4LFC Q;  1B7Y B;  2UXB L;  2H5X A;  3T1H Q;  2B63 G;  1HZB A;  1X6O A;  1L2F A;  2AKW B;  1EIY B;  4DR6 L;  4OWT B;  3PO3 H;  3UDF A;  2JA8 H;  4A3M G;  4JI2 Q;  2QA4 A;  1Q8K A;  1XPU A;  3OTO Q;  5C4J H;  2DUD A;  1PHJ A;  1P8L A;  2ES2 A;  2E5L L;  4IPH A;  1VQB A;  2HIV A;  5IP9 H;  5H1S E;  1MJE A;  1YNX A;  2VZA A;  1VQ5 A;  2UUB L;  3GTL H;  3HOZ H;  1LTL A;  4KLK A;  3S24 A;  4POF A;  4DV4 Q;  4HIK A;  2GN5 A;  3T1Y Q;  2IT1 A;  3F2C A;  2R7Z G;  4OWX B;  4KHZ A;  4X62 Q;  4DKA C;  1S40 A;  4LW1 A;  5FLM H;  4JBK A;  2JA9 A;  5BR8 L;  4NXM L;  2KCM A;  4MTN A;  1KAW A;  3HOX G;  1YBY A;  2MO0 A;  4LF4 L;  3S15 H;  2JA5 G;  3GTK H;  1I94 L;  3J7Z C;  2ZM6 Q;  4JI4 L;  4DV1 L;  1N9W A;  5M5X H;  1CKN A;  3MXN B;  3GTJ H;  3UDX A;  3U4V A;  4DR2 L;  3AYH B;  4A3E H;  4YCU A;  4DV2 Q;  4RG1 A;  1A63 A;  2HQL A;  3KOJ A;  3DLL A;  3M9B A;  1I5F A;  2F52 A;  4JOI A;  2IX0 A;  1TWA H;  2VQF L;  4YWL A;  3SGI A;  1VQ9 A;  5M3M H;  1D7Q A;  4DNI A;  3RZD H;  1GM5 A;  2NN6 G;  1S72 A;  4BBR G;  4LF6 L;  4A75 A;  4JI7 L;  3WWV A;  3G48 A;  5LMN Q;  3A74 A;  1Q1E A;  3CCV A;  1E1T A;  2YYZ A;  1MIU A;  1YI2 A;  1N8R C;  4JI3 L;  2F3I A;  5IWA Q;  4DR4 L;  4GNX A;  4A93 G;  4DV5 Q;  2NVT H;  2ATW A;  2UXB Q;  1Q82 C;  2E2J H;  3MEF A;  5M3F H;  4P71 A;  2WFW A;  4IJL A;  4DR6 Q;  2XGT A;  4B3M L;  1O7I A;  4OON A;  1AH9 A;  1U0L A;  2Q2I A;  3RLO A;  2E5L Q;  5IYD H;  4DV7 L;  4B3S L;  1IBM L;  1E7Z A;  2ZTC A;  1VQH A;  3CCU A;  2UUB Q;  1PH1 A;  1LM0 A;  4YCV A;  3A5U A;  4JG2 A;  5C4X G;  3AFP A;  3W1G A;  3HOW H;  5IP7 G;  1HZC A;  2ASB A;  1UE6 A;  5HY6 A;  3RR5 A;  5BR8 Q;  4NXM Q;  3GDE A;  4JI0 L;  4LF4 Q;  4BBS G;  2ZJR A;  4A3D H;  2MO1 A;  1LYL A;  3FKI G;  1UEB A;  4YWK A;  1I94 Q;  1ASY A;  3GTO H;  2A8V A;  2YTV A;  4JI4 Q;  4DV1 Q;  3I55 A;  4LF9 L;  3F1Z A;  3GTQ H;  3HOW G;  1XPO A;  1EYG A;  2CFM A;  3S1R H;  2YTY A;  4C3H H;  4DV0 L;  4DR2 Q;  1BBW A;  1RL2 A;  4ALP A;  1TWG H;  1V9P A;  1VQO A;  4P72 A;  1N34 Q;  4PG3 A;  3CW2 C;  1YHA A;  2EXD A;  2VQF Q;  2JEA I;  3S1N H;  4KI0 A;  2R6G A;  1PYB A;  1X3E A;  2Z0S A;  3D0F A;  3IRB A;  2YTX A;  3RLF A;  4UP7 A;  2RHQ B;  2GVB A;  4JI7 Q;  4MNO A;  1WCM H;  1YEZ A;  1VQ4 A;  1YIJ A;  5C3E G;  2VUM G;  4JI3 Q;  2UUA Q;  3FHW A;  4DR4 Q;  3I2Z A;  4JBM A;  3J81 j;  2Q2H A;  2KCT A;  2OQK A;  2HT1 A;  1B70 B;  2PMZ E;  1NMG A;  1JJ2 A;  5JJI A;  5GAE C;  4JI1 L;  4B3M Q;  2K5H A;  4HIM A;  1QZG A;  1VQM A;  4B3R L;  1Y1V G;  3H15 A;  4XTC S;  3PF5 A;  3J81 i;  1R9T H;  4AIM A;  1YVC A;  3I4O A;  5GAG C;  4A3I G;  1IBM Q;  2V1C C;  3ICE A;  4DR3 L;  2MFI A;  2PI2 E;  4JBJ A;  1Q81 C;  1PA6 A;  4R4O A;  2GVA A;  2UUC L;  1E22 A;  1CSQ A;  4A3L G;  1OXS C;  4IPC A;  4LFB Q;  2B3G A;  4UP9 A;  4JI0 Q;  3HOU H;  4AQY L;  4OX9 L;  4EQ5 A;  2IX1 A;  2R7F A;  4BY7 G;  1U5K A;  1G51 A;  1K9M C;  2CQO A;  2JQO A;  5JEA G;  2DGY A;  2NZH A;  4LF9 Q;  3K8A A;  1EIF A;  3PO3 G;  2JA8 G;  1SRU A;  3PO2 H;  3J80 c;  1K8G A;  4GN4 B;  5ELN A;  2ZJP A;  4DUZ L;  1V1Q A;  4DV0 Q;  1VQ7 A;  4A3B H;  4C2M H;  3G4S A;  2IHF A;  3BZC A;  1E1O A;  5JEA J;  4C3I H;  3RZO H;  5IP9 G;  1X9N A;  3JAM c;  1Q12 A;  3HOZ G;  4DV3 L;  4LF8 Q;  1NTG A;  2D0O A;  3AFQ A;  1Q86 C;  5HGQ A;  2PQA B;  2I5L X;  2KEN A;  2BH8 A;  2ZTD A;  3F8T A;  3RLN A;  1IL2 A;  3CC4 A;  4P73 A;  2BH2 A;  3KFU A;  3BZK A;  5FLM G;  2K50 A;  3I56 A;  3PCO B;  1BVS A;  1HH2 P;  2AHO B;  4LUO A;  1PVO A;  3STB C;  2NVQ H;  1PH6 A;  3HOV H;  2KHJ A;  3CPF A;  3H3V H;  3PUY A;  3CF5 A;  1Z47 A;  1KRT A;  4HID A;  4IFD I;  4JI1 Q;  1GO3 E;  4L5Q A;  5C0X I;  5DLQ E;  4A3G H;  4X6A H;  2C35 B;  1TWC H;  1QVG A;  3KF8 B;  4GOP A;  4B3R Q;  2I5H A;  2K5V A;  1YJ9 A;  1N36 L;  1JT8 A;  4A3E G;  2JA6 H;  1SLJ A;  4IO9 A;  4GN5 A;  1XPR A;  4BXX G;  5IE8 A;  4DR3 Q;  1AE3 A;  1HZA A;  2K4K A;  4TVA B;  3FP9 A;  5M3M G;  3S17 H;  4A76 A;  1KD1 C;  2R93 H;  2MNA A;  1DGS A;  2UUC Q;  1VQI A;  4BA2 I;  1E3P A;  2JJQ A;  2K5N A;  3U4Z A;  3PUV A;  1K0R A;  1N33 L;  4BXX H;  3H0G H;  4AQY Q;  3TS0 A;  4JI5 Q;  2LXK A;  1NE3 A;  1X65 A;  1TXY A;  1HNZ Q;  1E24 A;  5M3F G;  1IBL L;  3S2H H;  3HFZ B;  4JI8 L;  5J3B A;  2VQE L;  1M1K C;  1ASZ A;  2EQS A;  2PI2 A;  3KDF A;  3L7Z C;  1K83 H;  3CAM A;  1EQR A;  3HKS A;  1OXT A;  3K80 C;  1VQF A;  4NPS A;  2N78 A;  2K14 A;  4PZ7 A;  3A0J A;  4DV3 Q;  1QUQ B;  3ER0 A;  1V43 A;  4H02 A;  5GRO A;  4YCW A;  2I5M X;  4DPG A;  1X55 A;  3AEV A;  4PZ6 A;  3CCS A;  1WFQ A;  4IOC A;  3KF6 A;  4QQB X;  1KXL A;  4RMF A;  3E0E A;  1BBU A;  4GKK L;  3UE0 A;  4A3D G;  2CCZ A;  1SN8 A;  3I4M H;  3CP0 A;  3PUX A;  4MZ9 A;  3UE1 A;  3W5O A;  2UU9 L;  1NBW A;  2AWO A;  4LNQ A;  3ULP A;  1FL0 A;  4AYB E;  1PFS A;  4GLX A;  2CKZ B;  1Q7Y C;  1N36 Q;  2A1A A;  4Y7N H;  3HOY H;  4A4I A;  4DR1 L;  3CCR A;  1H95 A;  1KHI A;  4IJH A;  1TWH H;  3NBH B;  2VW9 A;  1OXX K;  1WI5 A;  2BA0 A;  4P75 A;  3EBE A;  1XNQ L;  3G6E A;  1M90 C;  1GVP A;  1PH9 A;  1SR3 A;  4GKJ L;  2NZO A;  4HJA A;  4HJ5 A;  1WCM G;  3CCQ A;  1VCI A;  1G6P A;  3B6Y A;  4JCV E;  4A3K H;  4LF6 Q;  4X66 L;  3U50 C;  3CXC A;  5LMU L;  4JI8 Q;  1D8L A;  1KL9 A;  2VQE Q;  3GD7 A;  4WJ4 A;  2E2H H;  4FDB A;  1J6Q A;  4L5S A;  3LGJ A;  3OYY A;  4DR7 L;  4LUZ A;  1HNX L;  2YU9 H;  3A5Z B;  2QGQ A;  3PUW A;  1VQK A;  1C7Y A;  3K0X A;  4OWW B;  1VQN A;  5K36 G;  4OO1 I;  1PV4 A;  4DV6 L;  1IBK L;  1HZ9 A;  2K52 A;  1W3S A;  2ALY B;  3KYH C;  4DV7 Q;  4B3S Q;  4GKK Q;  2VNU D;  3HOU G;  2B29 A;  1IZ6 A;  2UU9 Q;  5FJ8 H;  2NVY H;  1UWV A;  1KRS A;  4TQU S;  1XNR L;  4LUV A;  2WAQ E;  1L1O B;  1NJI C;  3PO2 G;  2JE6 I;  2FXQ A;  4C3J H;  4A3B G;  2JEB I;  4NXN L;  3NEN A;  5JJK A;  2JK8 A;  2N3S A;  3L2P A;  4A3J H;  2XTI A;  3J7A 5;  5E7N A;  4OXP A;  1A62 A;  5GQO A;  4DR1 Q;  2R92 H;  3U58 A;  4R4Q A;  1PH3 A;  4KHP L;  1XNQ Q;  1C9O A;  2ZTE A;  1X3G A;  2CWA A;  1NY4 A;  1AE2 A;  3VDY A;  1XMQ L;  4GKJ Q;  5IYB H;  3UDG A;  1BKB A;  2VS1 A;  4JBW A;  3M7N A;  4IPG A;  4JV5 L;  2JA7 H;  3PIP A;  2OWO A;  4IFD G;  5C44 H;  3NEL A;  4UP8 A;  5C0X G;  3J80 i;  3HKZ E;  1KC8 C;  3HOV G;  2IY5 B;  2IHE A;  4HJ9 A;  4P74 A;  1YIT A;  3EIV A;  4A3C H;  2E8G A;  4JC0 A;  4X66 Q;  4LF5 L;  2BA1 A;  4POG A;  4JI6 L;  3I4N G;  4A3G G;  2YV5 A;  2KBN A;  4IFD J;  2ID0 A;  2LXJ A;  3M4P A;  5IYC H;  1OXU A;  3JAM i;  5C0X J;  4DR7 Q;  1VQE A;  4K0K L;  1UE7 A;  4A3F H;  3F2D A;  2N49 A;  1EQQ A;  1A0I A;  2JA6 G;  1L1O C;  4Y52 H;  1HNX Q;  1CUK A;  1XMO L;  1G29 1;  3W1B A;  5AJ3 L;  3UDI A;  3PIO A;  3I4N H;  2UXD L;  2Q2U A;  4DAY B;  2AMC B;  2R93 G;  4DK3 C;  3ULL A;  4DAM A;  1PH2 A;  3H3V I;  2R7D A;  3M85 A;  4DV6 Q;  1IBK Q;  2E2I H;  2RHS B;  3TS2 A;  3TQY A;  4BY1 G;  4O0A A;  1MKH A;  3CME A;  1KQS A;  1CKO A;  1S3O A;  1N32 L;  1A8V A;  1WJJ A;  3H0G G;  3BU2 A;  5GAD C;  1X54 A;  4ME3 A;  1Y1W H;  4QGU A;  1EOV A;  5M5W H;  2Z6K C;  1XNR Q;  1J5E L;  1WOC A;  1X56 A;  4APV A;  4BY1 H;  2B63 H;  2RCN A;  4R4C A;  4LFC L;  1PH8 A;  1FVI A;  4NXN Q;  4A3M H;  4HJ8 A;  4OX9 Q;  2N8N A;  3CCL A;  4YY3 L;  3CC2 A;  3CPW A;  1EFW A;  4LWC A;  4NB3 A;  2K75 A;  1XTD A;  4KHP Q;  1QUQ A;  4DUZ Q;  3AQQ A;  3GTG H;  1XMQ Q;  1VQ8 A;  1SMX A;  2L15 A;  3PSI A;  1YJN A;  4GLV B;  4IPD A;  3STB D;  4JV5 Q;  5EAY A;  3RNU A;  2R7Z H;  4GOP B;  1OXV A;  2OCE A;  3E9H A;  2PNH A;  2Y0S G;  4AYB G;  1HR0 W;  3HOX H;  3ERS X;  1EWI A;  5IY0 A;  3I4M G;  2F4V L;  4LF5 Q;  1N34 L;  2JA5 H;  4JI6 Q;  2RF4 A;  3S16 H;  3TRE A;  1CKN B;  2A19 A;  4K0K Q;  4X65 L;  1L0W A;  4LFA L;  3HOY G;  3K7U C;  1VQP A;  4XIG S;  4YHH L;  3S1M H;  4QJF A;  3TEH B;  1XMO Q;  3E9I A;  5AJ3 Q;  3D31 A;  2UXD Q;  4DK6 C;  4X64 L;  1B8A A;  2UUA L;  2LSS A;  1K73 C;  2Y0S E;  2MQH A;  1I6H H;  1JE5 A;  5ELO A;  4R4I A;  1IYJ B;  1VS0 A;  3CCE A;  2ZJQ A;  1VQ6 A;  4L5R C;  2D62 A;  2QEX A;  4GLA C;  4DUY L;  4BBR H;  1GKH A;  4IOA A;  1N32 Q;  1HJP A;  4R4T A;  1YJW A;  3KDF B;  3BJU A;  1VQD A;  3PF4 A;  1EUJ A;  4GNX B;  2NN6 I;  4UPA A;  1SFO H;  3RN2 A;  4A93 H;  1VQC A;  4A3K G;  1I3Q H;  4YWM A;  4LF7 L;  1J5E Q;  4PMW A;  4GOP C;  3KJO A;  1Z9F A;  1LUZ A;  3L0O A;  1JMC A;  1N33 Q;  1HNW L;  2OTJ A;  1JJG A;  1RIP A;  1I50 H;  1IXR A;  4DR5 L;  4J15 A;  1SRO A;  3KF6 B;  2WB1 G;  4YY3 Q;  3ULJ A;  3ZJY C;  1IBL Q;  4JYA L;  4OO1 G;  1FJG L;  1MJC A;  2AWN A;  2NVX H;  4LFB L;  1JJC B;  3EN2 A;  1C0A A;  1VQG A;  1T9H A;  1FGU A;  1VQJ A;  3KJP A;  2I0Q A;  1KIX A;  3CMA A;  2HHH L;  4B3T L;  4UY8 C;  4JOI C;  5C4X H;  3F2B A;  1HR0 L;  5JJL A;  3M4O H;  5IP7 H;  1W2B A;  3G71 A;  5FLX c;  4HJ7 A;  1PH7 A;  2WAQ G;  5M5Y H;  2UXC L;  1CSP A;  4BBS H;  5FJ8 G;  2WB1 E;  2HIX A;  3PV0 A;  2F4V Q;  3FKI H;  5LMN W;  3GTM H;  1GD7 A;  3T1H L;  4L5T A;  4GNX C;  1PYS B;  4WJ3 M; 
#chains in the Genus database with same CATH topology
 2FIN B;  1JB7 A;  3HOW H;  4X65 Q;  5KT3 A;  1L0X B;  1SE8 A;  2EY1 A;  2EYM A;  1MSH A;  4LFA Q;  4A3J G;  5KFG A;  4J9O A;  3RD4 A;  4LH7 A;  3URY A;  1NAP A;  2R92 G;  2I87 A;  2RSN A;  3HXL A;  1WTV A;  4E4T A;  2FLL A;  5IYB G;  4UCO A;  3V96 A;  1BO0 A;  3CCJ A;  2OXP A;  5JQW A;  5IWA H;  3TRZ A;  2FB9 A;  5IT9 c;  1EEF D;  4OIK A;  5GAH C;  2UXB H;  4A3C G;  3D8G A;  1NMF A;  1LT4 D;  4AH6 A;  2YZN A;  4ULL A;  3K81 C;  1VQA A;  4QL5 A;  2WTF A;  1TY2 A;  1Y1V H;  3H0G B;  1GJX A;  3RB6 A;  3NBI A;  5LMU Q;  2MCT A;  2J6S A;  2OTL A;  4LSX A;  1OTC A;  4B3T Q;  4K2L A;  4RZQ A;  2FMA A;  4FF3 A;  4NXM H;  1WTO A;  3K5H A;  5LMN L;  3CQZ H;  1SFO A;  2HUG A;  3MWE A;  1X3Q A;  2IJ0 A;  5M3F B;  4R1J A;  1WYD A;  2P0A A;  4DV5 L;  5T14 A;  1ENA A;  3T1H Q;  2B63 G;  1HZB A;  3SK4 A;  1ML0 D;  1MHW C;  4FF1 A;  4OWT B;  1XPU A;  2NVX A;  3DEO A;  4JVZ A;  1DJR D;  3OTO Q;  1X32 A;  4MV8 A;  2HIV A;  4IR9 A;  5KFK A;  2UUB L;  1CQF A;  1LTL A;  4H44 C;  3S24 A;  2NUC A;  5ELD A;  1PZJ D;  2GN5 A;  4A3D B;  3T1Y Q;  1VAJ A;  2FK1 A;  4YIJ A;  4DKA C;  1S40 A;  2JA9 A;  4J1M A;  3HRZ C;  2MO0 A;  4QIW A;  2BQ3 A;  5T1I A;  5FD5 A;  2JA5 G;  2XGQ A;  3R23 A;  4B3M H;  4O4L F;  2ZM6 Q;  1N9W A;  3OHA A;  4RGT A;  2W6P A;  1CKN A;  3MXN B;  3GIP A;  2FJ2 A;  2VUG A;  2ZDH A;  4DR2 L;  5M9O A;  3CVZ A;  3S1N B;  4JV0 A;  2F0K A;  3AYH B;  5KG3 A;  3QZ8 A;  3HZX A;  5FO9 B;  4KHV A;  4K8I A;  2O03 A;  4YWL A;  3SGI A;  1VQ9 A;  3BJY A;  2VB3 X;  3PMF A;  2PMZ B;  1S72 A;  2DY7 A;  1H9R A;  4HR7 A;  4JI0 H;  3SK6 A;  3FVQ A;  4ODG A;  4Q45 A;  3M4Y A;  2YYZ A;  2XRS D;  3HEJ A;  4JI3 L;  4DR4 L;  4EVO A;  3HP3 A;  3RAX A;  3MEF A;  5M3F H;  5EOY A;  4DR6 Q;  4UDU C;  1O7I A;  2F0O A;  5EKL A;  2K6A A;  3I91 A;  2EDG A;  2Q2I A;  3RLO A;  4HNV A;  4B3S L;  2NVY B;  3BZD B;  4QUF A;  3CCU A;  2R7N A;  1PH1 A;  1LM0 A;  4FXK C;  4YCV A;  1PTO F;  4DU9 A;  3A5U A;  1E4E A;  4B08 A;  5C4X G;  4CDE C;  3HOU B;  2R85 A;  3TP7 A;  3AB9 A;  5IP7 G;  1LV9 A;  1K8O A;  5D1O A;  5HY6 A;  5BR8 Q;  1IW7 D;  4LF4 Q;  4A3D H;  2ZJR A;  2R92 B;  3PQI A;  1UEB A;  1F2Y A;  4JI4 Q;  4DL7 A;  4MV4 A;  4OIJ A;  3MFH A;  3T5J A;  1XPO A;  1EYG A;  2CFM A;  3FRP B;  3J81 L;  4DV0 L;  1BBW A;  1HPC A;  3BQ2 A;  2J6U A;  4P72 A;  4N9P A;  3RF2 A;  4PG3 A;  2VQF Q;  3MVV A;  1BBX C;  1M7J A;  3S1N H;  1CHQ D;  4RKL A;  4JW0 A;  4CDC C;  3PW7 A;  2BE5 D;  3RLF A;  1JXL A;  1VMC A;  2RHQ B;  1TAE A;  2GVB A;  2NVQ B;  1WH2 A;  1VQ4 A;  1YEZ A;  1EY5 A;  3C46 A;  4ZKC B;  3I2Z A;  2Q2H A;  2KCT A;  1LTS D;  2EYF A;  1JJ2 A;  1NMG A;  5JJI A;  4DUZ H;  4JI1 L;  1RDP D;  1UEA B;  4MTD A;  1K1Q A;  4KN4 C;  2BQR A;  1VQM A;  3JSL A;  4XTC S;  3TZD A;  1GLV A;  5EJW A;  4A3I G;  4DV3 H;  1IBM Q;  1WD0 A;  2V1C C;  4J9K A;  4EYI B;  4Z9C B;  1SXT A;  5F2D A;  2PI2 E;  3UI2 A;  1Q81 C;  4BY1 B;  2B63 B;  5K36 H;  4R4O A;  3JRW A;  4HQ6 A;  1MGS A;  3NQT A;  4CKC A;  1OXS C;  2XIW A;  2Z4I A;  4LFB Q;  3SVM A;  2B3G A;  3D3R A;  3HOU H;  2IA6 A;  3OW7 A;  5F9L A;  1U5K A;  3A54 A;  1K9M C;  1K83 B;  4KY5 A;  2NYZ D;  2R82 A;  2ZT9 C;  4RH6 A;  1N36 H;  2EVB A;  4YQW A;  1PZI D;  3J80 c;  4Q0F A;  5FOB B;  2NTS A;  3G4S A;  5LXT F;  4R9W A;  1ILQ A;  5IGG A;  3K5L A;  5C1P A;  2RGV A;  1EYZ A;  1D5X C;  2KEN A;  1STN A;  2R8H A;  2ZTD A;  2BH2 A;  3KFU A;  3SI8 A;  5K2M A;  1H9K A;  2K50 A;  4IFD H;  2CH4 W;  1HFN A;  2NVQ H;  1PH6 A;  1S0N A;  2P5Z X;  5FK9 C;  1TS2 A;  5KFJ A;  3GTQ A;  1Z47 A;  4IFD I;  3U9T A;  4XZ3 B;  2X69 A;  1QVG A;  1SCU B;  1RJT A;  2K5V A;  1W93 A;  2WAC A;  2EXZ A;  4A3E G;  1SLJ A;  4O2A F;  4GN5 A;  2W8L A;  4BXX G;  1AE3 A;  5KFB A;  5EGT A;  1M4V A;  1B3A A;  4CJ1 B;  3ORQ A;  4GKK H;  1T94 A;  2JJQ A;  3JRX A;  1CZW A;  3OWF A;  4JI5 Q;  2LXK A;  5IT9 W;  1NE3 A;  2KOL A;  2W9C B;  4ZQI A;  4JI8 L;  2V58 A;  1M1K C;  2WB1 B;  2WII B;  4RNN A;  1R9T A;  1K83 H;  2B2V A;  2OT2 A;  3HKS A;  3GLK A;  4KD4 A;  1MI2 A;  1B2T A;  3G7L A;  2EE1 A;  4ZKB B;  2QDL A;  4GKJ H;  1TA8 A;  4H02 A;  2ASL A;  4YCW A;  3QFF A;  5ELE A;  1X55 A;  3JSN A;  1KXL A;  1BJT A;  3C0F B;  3ITP A;  3E0E A;  4B9X A;  5IGD A;  2FE3 A;  1U4M A;  1LO5 D;  2ICI A;  1XTC D;  4JK1 C;  4N9T A;  1JB3 A;  3PUX A;  3UE1 A;  4B9W A;  5HUR A;  1A3U A;  4J9S A;  4YAJ B;  4C3H G;  2XIG A;  3A7L A;  2M00 A;  1Y8O B;  3T5L A;  2ALZ A;  3EPG A;  1GGO A;  3HKZ B;  4P2C B;  3S14 B;  1KHI A;  1WVL A;  1BNZ A;  2V5A A;  4DV6 H;  2CW0 C;  1IBK H;  2VW9 A;  1WI5 A;  4P75 A;  3EBE A;  1EUD B;  5C44 B;  1GVP A;  1SJE D;  1PH9 A;  2W70 A;  2NZO A;  3O13 A;  3GTP B;  4CJ0 B;  5I4D A;  5KFA A;  1XNR H;  1DV2 A;  4JCV E;  2R6F A;  4R8I A;  3U50 C;  4Q8E A;  5LMU L;  2AQ1 B;  1D8L A;  3VPC A;  4QWE A;  4DL3 A;  3J7A K;  2BCO A;  2K1B A;  4ECU A;  1EZ8 A;  3OSN A;  1V4Y A;  2M9V A;  5CV6 A;  1S10 A;  2NU7 B;  1C7Y A;  1I7N A;  5KG4 A;  3GIK A;  1PV4 A;  1KTK A;  1HZ9 A;  2K32 A;  1W3S A;  3H0G A;  4OGQ C;  3KYH C;  4DV7 Q;  2V4D A;  2VNU D;  3RFC A;  5DNF A;  2IPK D;  1IZ6 A;  1VMP A;  4JI6 H;  2K33 A;  2UU9 Q;  2CW0 D;  3N8D A;  3JAM L;  1KRS A;  4YAK B;  1AUV A;  2WAQ E;  3SK8 A;  3RGX A;  1HCZ A;  5LL6 b;  4A3B G;  2B2Y C;  1B33 N;  2N3S A;  2XTI A;  3KBX A;  1A62 A;  3S15 B;  1JCK B;  5J2U F;  2AGO A;  1PH3 A;  1XNQ Q;  1X3G A;  3GTJ B;  1NY4 A;  3BQ0 A;  1LLR D;  2WKD A;  3VDY A;  1JLL B;  2N55 A;  4G7H C;  2Y0S A;  5C44 H;  2KUM A;  4A3E B;  4AYB A;  4X3S A;  1GSO A;  3WO0 A;  3S16 B;  1KC8 C;  4C1N I;  5I47 A;  4P74 A;  2X0S A;  3KAL A;  4X66 Q;  3S9W A;  3I4N G;  3RBD A;  1RYS A;  1LT6 D;  4QWA A;  4XYO A;  2ID0 A;  2LXJ A;  4IFD J;  3GID A;  1OXU A;  2R8I A;  3WDN A;  2JA6 G;  4LMY A;  1WTX A;  4Y52 H;  3M9M B;  2FPI B;  4CGY B;  2UXD L;  1Z2N X;  2E2J B;  1I94 H;  2R93 G;  2JEF A;  1STG A;  3MXN A;  4DAM A;  3H3V I;  4HCE A;  5IYD H;  2E2I H;  3TQY A;  1V51 A;  1MKH A;  1S3O A;  5CV7 A;  1A8V A;  1WJJ A;  5C4H A;  3BU2 A;  1KJQ A;  3WNZ A;  1GYF A;  3BDC A;  1Y1W H;  1EOV A;  3I3C A;  4F88 A;  3D4W A;  1BDO A;  4PV1 C;  4EG0 A;  1PH8 A;  1RK6 A;  4NXN Q;  4YHH H;  1LTG D;  4HJ8 A;  2N8N A;  4QWD A;  3V4S A;  4J9L A;  5DEH A;  2OLS A;  1D1I A;  3W3A A;  1EFW A;  4IR1 A;  3A8I E;  4LWC A;  2DNC A;  4KHP Q;  4DUY H;  3VYU A;  1ZYR C;  4JUZ A;  4KK7 A;  4DK1 A;  4JV5 Q;  2FPP B;  5EAY A;  1TS5 A;  3CHB D;  1I4R A;  5GON F;  2NVY A;  1OXV A;  2OCE A;  3OHX C;  1DOM A;  4QIW B;  5KG5 A;  3ERS X;  4IZ8 A;  1AZP A;  3I73 A;  2F0G A;  3S16 H;  1HNW H;  3QG1 A;  2L4N A;  3PZP A;  1CKN B;  4RGN A;  1JIC A;  1FYC A;  4KY6 A;  1BCP F;  4JYA H;  2K28 A;  3N40 P;  2R92 A;  3RUP A;  3J80 W;  3AU7 A;  3LWE A;  4EBC A;  2HHH H;  5A2Q E;  3N42 B;  3CCE A;  2VPQ A;  1STA A;  4XYQ A;  5KFW A;  4TQR A;  3D6W A;  2NN6 H;  4LAA A;  5EKI A;  4HR7 B;  1U4L A;  5C3E B;  2QEX A;  4IOA A;  4RNO A;  2QDB A;  4R4T A;  2QYZ A;  2LMC B;  3KDF B;  1VQD A;  1DOK A;  3WOE A;  2NN6 I;  1SFO H;  2A6E C;  1VQC A;  4HSV A;  4A3K G;  4LF7 L;  3KJO A;  4QF4 A;  1ZYR D;  1XYI A;  1LUZ A;  1N33 Q;  2R84 A;  1I6U A;  5EWE A;  3S2D B;  1RIP A;  2K7V A;  1IXR A;  4DR5 L;  2A68 D;  4YY3 Q;  4ECZ A;  2W7O A;  3RB0 A;  2NVX H;  4LFB L;  3LWB A;  1VQG A;  2AU0 A;  1SSO A;  1R4P B;  3KLR A;  2UVU A;  2A6H D;  3H91 A;  1SJH D;  1B44 D;  1LTR D;  4C2M B;  2CQA A;  4EGJ A;  3G71 A;  2JSO A;  3QR8 A;  2EYL A;  1PYW D;  2B63 A;  3OIQ A;  5LMN W;  4CBV A;  2JA8 B;  5LHY 1;  1HFG A;  3VR6 A;  1PYS B;  1L1O A;  1STH A;  3K7A H;  5JJZ A;  5KFX A;  4O2D A;  3KHH A;  4KJO A;  1PH5 A;  4JI2 L;  2VL6 A;  3NEM A;  1WTQ A;  1QVC A;  3OW2 A;  3HG9 A;  4OL7 A;  3HOZ B;  2A6E D;  5CB4 F;  1UE1 A;  3CC7 A;  2J9G A;  1CT1 D;  4X64 Q;  1A3T A;  1C3O A;  5G3L D;  1GOZ A;  5LMN H;  3PGZ A;  3E5N A;  4DV4 L;  2HVR A;  2MUY A;  2NWG A;  4X62 L;  1DV1 A;  5C3E H;  4DV5 H;  4FXG C;  2JA5 A;  5M5X B;  1KJI A;  1V8Q A;  2R93 B;  5KFT A;  1XJV A;  1HHV A;  3S1Q H;  4HIO A;  5IYC G;  1BCP D;  4M9U A;  1CKM A;  1YHB A;  4A3F G;  3TQ1 A;  2OQ0 A;  3KXY T;  4ME6 A;  5JVD F;  4BWS C;  1SYB A;  1FJG Q;  5M3M B;  3PIP 3;  3S2D H;  4DV2 L;  1HA6 A;  1T3N A;  2UUB H;  1QNK A;  4DXF A;  5CAE B;  3Q8Q B;  4JI5 L;  3VYS A;  3I12 A;  1HR0 Q;  2BDO A;  2CWP A;  4A3L H;  5KRU A;  2NVT B;  1X3F A;  3IAY A;  2UXC Q;  2GPW A;  2V4Q A;  3MHB A;  2Q2T A;  3PUZ A;  4BY7 H;  1M6V A;  3ERQ A;  1B7Y B;  5JEA H;  4LFC Q;  4DR2 H;  1D1K A;  3PO3 H;  1CZG A;  3UDF A;  2JA8 H;  4A3M G;  2QA4 A;  1Q8K A;  4F4Y A;  3RB4 A;  5C4J H;  1DCZ A;  5JVL A;  1K28 A;  2E5L L;  3SXH A;  1F77 A;  2W9C A;  1VQB A;  5H1S E;  5IP9 H;  2Q8R E;  1NR4 A;  1VQ5 A;  2V4R A;  3HOZ H;  1JQY D;  2EYP A;  4DFA A;  5DLG A;  3A56 A;  4KLK A;  4POF A;  4HIK A;  4JI3 H;  4Y7N B;  2IT1 A;  3F2C A;  2R7Z G;  4DR4 H;  1NR2 A;  3I70 A;  4LW1 A;  3H6M A;  2PQE A;  5CV5 A;  5FLM H;  5E4W C;  4U68 A;  1B6S A;  4C56 C;  1YBY A;  2ZXP A;  4PMC A;  1Z2P X;  3GTQ B;  3SK5 A;  1I94 L;  3QZ7 A;  3T13 A;  4DV1 L;  2K5D A;  1D5Z C;  5M5X H;  3DF7 A;  2D5D A;  4B3S H;  1ZEQ X;  3RUZ A;  2EY5 A;  3MWM A;  2HQL A;  3KOJ A;  3J81 W;  3M9B A;  3LX0 A;  2IX0 A;  4NKL A;  1D7Q A;  5M3M H;  1WCM B;  1GM5 A;  2ASD A;  1PFN A;  1KAB A;  2C2E A;  4JI7 L;  4TQS A;  3G48 A;  1JOO A;  3KHG A;  1Q8I A;  2YU9 B;  5IWA Q;  4A93 G;  2NVT H;  4NW2 A;  2YZG A;  1JWS D;  3G8C A;  2K01 A;  3N6R A;  4O3N A;  4FS1 A;  2UXB Q;  2YZM A;  2WFW A;  2X6G A;  4DV0 H;  4DN4 M;  5CGK A;  1R9T B;  1E0B A;  1DXM A;  3GTP A;  1SYX B;  2LS0 1;  2B2Y A;  4DV7 L;  1TWF A;  3ONA B;  1E7Z A;  4O3S A;  1VBG A;  4RUC A;  4K2K A;  1GSH A;  4C1N K;  1BNC A;  2IWH A;  3K5N A;  2B2W A;  3TIG A;  4JG2 A;  3NTI A;  4J9R A;  4I4T F;  2OEO A;  1PRT D;  3RR5 A;  1EY6 A;  1OO9 B;  4NXM Q;  4YR3 A;  2MO1 A;  4IWX A;  1LYL A;  4ECX A;  1EQV A;  4JI1 H;  4YWK A;  2EJM A;  1ASY A;  1JR0 D;  3MFY A;  5CBE E;  4LF9 L;  3GTQ H;  3P20 A;  2HDL A;  2V9W A;  2KCN A;  4C3I B;  1WTR A;  4GZY C;  1RL2 A;  1STE A;  3MR6 A;  1F9R A;  2B2V C;  5L1I A;  4KI0 A;  3P7J A;  1E4F T;  2YTX A;  1H9M A;  4UP7 A;  2NZ1 D;  3H94 A;  4MNO A;  1WCM H;  2VUM G;  4O4H F;  5KFP A;  3QB3 A;  4R8N A;  1S5C D;  1B4O A;  2UUA Q;  2HT1 A;  4A3G B;  3R5X A;  1B70 B;  1FNU A;  3GTJ A;  5D65 A;  2PMZ E;  5EPL A;  1SMY C;  5GAE C;  4RU9 A;  3R5F A;  4B3M Q;  2K5H A;  3A7A B;  1S5F D;  3MAQ A;  4B3R L;  3H15 A;  2O4X A;  3PF5 A;  2JEI A;  3J81 i;  3S17 B;  1R9T H;  1EOT A;  1EYC A;  4QUC A;  3ICE A;  4M7E A;  4DR3 L;  4ECQ A;  3CRK C;  2MFI A;  2CQY A;  2EY6 A;  1B9M A;  2UUC L;  4XYM B;  2QEJ C;  5IGE A;  1EY0 A;  1A9X A;  4XDX A;  2F0I A;  4CKE A;  4UP9 A;  4JI0 Q;  3KHL A;  4AQY L;  1S5B D;  4EQ5 A;  2IX1 A;  1A2U A;  2R7F A;  2NTT A;  2CQO A;  5DAU A;  2JQO A;  1NSN S;  3UQ8 A;  1EIF A;  2HD3 A;  1KJ8 A;  1SRU A;  4O3P A;  3MR2 A;  4UAI A;  1CQJ B;  2J6T A;  4GN4 B;  1V1Q A;  1VQ7 A;  2F0T A;  4TSS A;  1B04 A;  1E1O A;  5JEA J;  2DLN A;  2VOB A;  4C3I H;  3K5O A;  1WTH A;  1SMY D;  4LF8 Q;  1ET6 A;  1NTG A;  2D0O A;  1DIK A;  2K04 A;  2PQA B;  4IUP A;  1JX4 A;  1EYA A;  1MD2 D;  2I5L X;  4PMB A;  4O3R A;  2BH8 A;  2E76 C;  5CV4 A;  3CC4 A;  2Y0S B;  3D6C A;  4AYB B;  3I4M B;  3I56 A;  3PCO B;  1BVS A;  2V59 A;  5C0X H;  1LAC A;  2AHO B;  1Y69 U;  3STB C;  3BS1 A;  2C5C A;  4IUN A;  3NXW A;  4JI8 H;  5ELC A;  1KRT A;  4IN3 A;  3SR1 A;  5C0X I;  5NUC A;  5DLQ E;  4A3G H;  1EIH A;  2C35 B;  3I72 A;  3HOY B;  5I6Y A;  1TWG A;  4ECY A;  5KFF A;  4RAZ A;  1PFB A;  2I5H A;  3NWS A;  1JT8 A;  2B8G A;  5IE8 A;  4KKT A;  3S17 H;  5KX5 F;  3FP9 A;  2BDN A;  4H0L C;  1DGS A;  2RDI A;  2F0V A;  4BA2 I;  3G6V A;  1BUV T;  1I50 B;  3U4Z A;  3NTH A;  3BDL A;  3EYY A;  2VXW A;  1N33 L;  4FXD A;  4CDD C;  3H0G H;  4TV8 F;  3TS0 A;  3QOL A;  2QW7 A;  2F0P A;  4EFB A;  3BAA A;  1HNZ Q;  2B2U A;  4ZLT F;  3U9S A;  3HFZ B;  3R8B A;  2VQE L;  2EQS A;  3KDF A;  3CAM A;  5JOB A;  5M5Y B;  1VQF A;  4C5B A;  2N78 A;  2HCI A;  2K14 A;  1RKN A;  4DV3 Q;  3L4K A;  2YRW A;  1SNO A;  5JVG 3;  3T4A C;  4RMF A;  5FLX L;  1FGB D;  5D1P A;  2XD4 A;  5IT9 E;  3H09 A;  1QOH A;  1SN8 A;  3I4M H;  2R87 A;  3MXP A;  5LMU H;  4MZ9 A;  1DON A;  3W5O A;  1K8M A;  2X6L A;  2ZJT A;  5H80 A;  1NBW A;  1MZB A;  3QOJ A;  2HJW A;  2KED A;  4A3J B;  1O7Y A;  4C2M A;  1FL0 A;  2F4I A;  3JAM W;  1N36 Q;  1GUO A;  3HOY H;  3M4I A;  4A4I A;  4DR1 L;  3CCR A;  3PW2 A;  3M3Y B;  2BA0 A;  1ILP A;  2VR1 A;  4ZI7 F;  2UVR A;  1SR3 A;  2ICE C;  4HJ5 A;  3KHR A;  2XVS A;  1VCI A;  2SDF A;  1G6P A;  3B6Y A;  2CW8 A;  4LF6 Q;  3CXC A;  4RGO S;  1EWC A;  3EJI A;  1H9S B;  1RK5 A;  4PWQ A;  4WJ4 A;  1PTO B;  1KLG D;  5CMD A;  2JA6 A;  3LGJ A;  4UCU A;  4FM9 A;  3OYY A;  4DR7 L;  1DD2 A;  3OUU A;  2KA7 A;  1RJQ A;  4XQQ A;  4OO1 H;  2JXM B;  4LUZ A;  1HNX L;  2R93 A;  2J0T D;  2BOS A;  2QGQ A;  3PUW A;  1RHP A;  1I6H B;  4Q5V A;  1VQK A;  3K0X A;  4RKB A;  4OWW B;  1IHZ A;  2MJ8 A;  4YR0 A;  4EGQ A;  2WE6 A;  4OO1 I;  3BAB A;  5CYU A;  2K52 A;  5EPK A;  3E5S A;  5TSS A;  1B3Q A;  2RDJ A;  3WO1 A;  4GKK Q;  4ED8 A;  3Q23 A;  3FPP A;  2FKL A;  1Z2O X;  5FJ8 H;  2NVY H;  5I6W A;  3GTL B;  4EGV A;  2FMC A;  2CW7 A;  1GUN A;  1L1O B;  5EBC A;  3PO2 G;  2FXQ A;  3NHH A;  3PN1 A;  1F9Q A;  2JEB I;  2RDH A;  2F0U A;  5JJK A;  2IBK A;  4RB0 A;  4A3J H;  2UXD H;  4A2A A;  3FMC A;  5E7N A;  4OXP A;  1PTO C;  4YR2 A;  2R92 H;  2C22 A;  4LMQ D;  3DXJ C;  2ZTE A;  1KAA A;  1XMQ L;  1YNJ C;  2EYJ A;  3OMG A;  5IYB H;  4GKJ Q;  4ECW A;  1XX8 A;  3PIP A;  3BVG A;  3H4B A;  1HQR D;  2JA5 B;  3FDS A;  3HKZ E;  3HOV G;  4TUY F;  1AN7 A;  1WTW A;  1YIT A;  3EIV A;  4A3C H;  3TIN A;  4JC0 A;  3V05 A;  4LF5 L;  4POG A;  2AGQ A;  1S03 G;  4DNR B;  4G3I A;  3JAM i;  2PO4 A;  5C0X J;  4K0K L;  2IL8 A;  2QCP X;  1UE7 A;  3KF8 A;  3IFT A;  3CKI B;  2N49 A;  5E4X A;  2TMP A;  1A0I A;  3F2D A;  1S68 A;  3FMA A;  1L1O C;  2W6N A;  2PZW A;  2PZT A;  1XMO L;  1G29 1;  1SYE A;  5AJ3 L;  4RAU C;  1SYF A;  3KLS X;  3ULL A;  5C1O A;  4DV6 Q;  1IBK Q;  1I6H H;  5BPF A;  3CME A;  1N32 L;  1KQS A;  4QW9 A;  1CKO A;  1KNE A;  1N48 A;  4IZO A;  4WRD A;  3U9O A;  4MTE A;  5GAD C;  3GIQ A;  4ME3 A;  5BN3 A;  5KFM A;  4WD3 A;  2VQF H;  4FVM A;  1WCM A;  1XNR Q;  1BR9 A;  1J5E L;  5KT4 A;  4ID6 A;  3PR4 A;  4BY1 H;  2B63 H;  3N6X A;  3GV7 B;  4KY7 A;  4OX9 Q;  1NNX A;  1FKA H;  2YU9 A;  3CCL A;  1L0Y B;  3CC2 A;  4O2B F;  4NB3 A;  5C4X B;  3C1F A;  5KFE A;  1QUQ A;  2F3W A;  3J7A V;  4J9Q A;  1CE8 A;  4Q44 A;  1VQ8 A;  3PSI A;  3S1R B;  3RNU A;  1ZHQ A;  3KAJ A;  3V4Z A;  4GOP B;  4LF7 H;  3E9H A;  3ETJ A;  2RDF A;  1EEI D;  1IOV A;  2F4V L;  4K14 A;  1GXD C;  3PW0 A;  2HVS A;  2JA5 H;  4JI6 Q;  2RF4 A;  5E1F A;  5CV8 A;  2NU8 B;  4DR5 H;  4IUR A;  4IUV A;  4APM A;  4NLG A;  5L9X A;  4X65 L;  4FYD A;  1NCV A;  3VA5 A;  4LFA L;  3OSP A;  2F1M A;  4LFB H;  3K7U C;  1VQP A;  4QWC A;  2DJG C;  4QJF A;  5IIF A;  2KHS A;  1B8A A;  1EY7 A;  2UUA L;  2LSS A;  2MQH A;  4ED0 A;  1HTL D;  3NBH A;  1B6R A;  1IYJ B;  2ZJQ A;  3OIP A;  2D62 A;  3V6J A;  4GLA C;  3ND9 A;  3BJU A;  1EUJ A;  2A69 C;  4UPA A;  3DUZ A;  2EZV A;  2RVL A;  4I7A A;  4GOP C;  3QJY A;  1H9J A;  4JI2 H;  3L0O A;  5KFL A;  3J80 E;  4A3I B;  2F0H A;  5KYL A;  4N8X 1;  5DLF A;  1SDF A;  1IBL Q;  1D2B A;  1TWF B;  2AWN A;  3MXU A;  3EN2 A;  2O5I C;  1C0A A;  1FGU A;  1VQJ A;  3RGZ A;  4DV4 H;  3PO2 B;  3NPP A;  4B3T L;  4M1U B;  5JJL A;  5C4X H;  1SE2 A;  3F2B A;  3J7Y W;  4X62 H;  1CS0 A;  4ED1 A;  5IP7 H;  3R5H A;  1SNQ A;  2QK4 A;  5FLX c;  1PH7 A;  3DWP A;  2WAQ G;  5KT6 A;  1WD1 A;  3R93 A;  4UCR A;  1C48 A;  5KEE A;  3DHQ A;  3NP8 A;  2BQU A;  1GD7 A;  3T1H L;  2YCH A;  4RUA A;  4UHV A;  4C3J G;  4XT3 B;  1YHQ A;  4LF8 L;  3FEW X;  4K5V A;  4M8A A;  4DV2 H;  4QIW E;  4YHH Q;  3OTO L;  3H40 A;  1X3P A;  4I55 F;  1F2M A;  4JI5 H;  3GTG A;  1UNN C;  3Q8D A;  4FS2 A;  3GO5 A;  1TWC B;  3M4Q A;  3J81 c;  4DUY Q;  2W7P A;  2R7Z A;  2JA7 G;  3T1Y L;  1WR2 A;  5BMV F;  2Z6K A;  2B2W C;  1Y14 B;  1ET9 A;  5DG8 A;  2XWB B;  2OF1 A;  4FF2 A;  3DM3 A;  2PQA A;  2ENB A;  3S14 H;  3KUP A;  3PVX A;  2ZM6 L;  2VY3 A;  1RF2 D;  1HNW Q;  3TDQ A;  2FMM A;  4PNY A;  1K3B C;  3UFX B;  2E5L H;  2KCC A;  2PCF B;  4LJZ C;  1IYU A;  1Q90 A;  1Z6H A;  2JP1 A;  4L6T B;  4WJW A;  3RN5 A;  1VQL A;  4JYA Q;  4GS3 A;  3GTP H;  3H20 A;  4R8U B;  4A3I H;  5KG2 A;  1PK8 A;  2PVP A;  5KFY A;  3CD6 A;  2D0P A;  4DAY A;  1G6Z A;  1TWF H;  1YZ6 A;  2HHH Q;  4DL5 A;  1Q1B A;  1Q46 A;  1BF4 A;  3TBI B;  1HNZ L;  5EDW A;  4ZCK A;  3GIM A;  2L0C A;  2UVW A;  3MZ5 A;  2L9H A;  2N88 A;  2YL2 A;  1I3Q A;  4CDF C;  3K5I A;  2ZDG A;  2WP8 J;  5DQI A;  4DV1 H;  2UVV A;  3PIO 3;  5IOC A;  2PZU A;  2H5X A;  4I7Z C;  1L2F A;  4ZYS A;  4DR6 L;  1F2Z A;  3I8Z A;  1I50 A;  2W71 A;  1CTM A;  4HNU A;  1V1P B;  3K59 A;  1PHJ A;  2ES2 A;  1P8L A;  2A74 C;  3NSW A;  4KKU A;  4IPH A;  4DLK A;  2YS7 A;  5BPH A;  2FLN A;  1YNX A;  1S0M A;  2VZA A;  4X3K A;  3EPI A;  4JI7 H;  5KG0 A;  2RQX A;  4KJN A;  3E0J A;  4EBD A;  1EYD A;  4KKS A;  4JBK A;  5BR8 L;  1GUT A;  4DXG A;  2KCM A;  4MTN A;  1KAW A;  3HOX G;  4LF4 L;  3S15 H;  1XDN A;  4HAE A;  3SEB A;  2W8K A;  5G3L F;  3BA8 A;  4QW8 A;  1SYD A;  4C3H B;  4JI4 L;  4ZUJ A;  1TWG B;  3GTJ H;  3UDX A;  2KVM A;  4PQX A;  5EWF A;  2DZD A;  4DV7 H;  4KMU C;  4XXE A;  1M0W A;  4A3E H;  1A63 A;  4YCU A;  3V6H A;  4CHT B;  2VQD A;  3DLL A;  1I4X A;  2F52 A;  1STB A;  2K05 A;  3VR4 A;  2VQF L;  4EYH B;  1PFM A;  3TII A;  4DNI A;  5ISR A;  5C5J A;  2VUM A;  2XWJ B;  4BBR G;  4LF6 L;  5KGU A;  4A75 A;  5KNB A;  1G91 A;  5LMN Q;  1N8R C;  1YI2 A;  4NP5 A;  1EU3 A;  1YNN C;  4GNX A;  3M9N B;  4DV5 Q;  4S3S A;  3MR5 A;  4LF9 H;  1Q82 C;  2E2J H;  4UFZ A;  1QIL A;  4OON A;  2EPB A;  1AH9 A;  1U0L A;  2WAQ B;  2Q8T A;  2J7Z A;  3J81 E;  1CA5 A;  4Q8F A;  5C4Z A;  4ECT A;  1IBM L;  1W96 A;  2ZTC A;  1E2Z A;  4RAY A;  3MWD A;  1I6V C;  1H9S A;  2E75 C;  2UUB Q;  2J4X A;  2XCA A;  4WOR A;  1EZ6 A;  5KFS A;  3AFP A;  2IX3 A;  3BA9 A;  1HZC A;  3N44 B;  4MV3 A;  2A5H A;  4HNT A;  4BBS G;  5FPO A;  3GIL A;  2E74 C;  3D4D A;  4L63 B;  3FKI G;  3A55 A;  2YTV A;  4V19 0;  2A8V A;  4A3B B;  4XX0 B;  3IN5 A;  4B3R H;  3F1Z A;  4CKB A;  3HOW G;  2LKV A;  4IAL A;  2B2U C;  4DR2 Q;  1M8A A;  4C3H H;  2JA7 B;  1SAP A;  3EVQ A;  4H13 C;  4TKO B;  1EY9 A;  4RNM A;  1TWG H;  1V9P A;  2WIN B;  1VQO A;  4DR3 H;  1N34 Q;  2NU9 B;  3PW5 A;  2JEJ A;  3GTL A;  2AGP A;  1LTI D;  1YHA A;  3CW2 C;  5T1G A;  2UUC H;  2R6G A;  5KFC A;  1PYB A;  3LP8 A;  3GV8 B;  5L37 A;  2Z0S A;  3D0F A;  3IRB A;  2D2C C;  2G9D A;  4AQY H;  1JOR A;  1JOK A;  1YIJ A;  4IHJ F;  2WKC A;  4JI3 Q;  3FHW A;  4DR4 Q;  4JBM A;  3J81 j;  3I4N B;  2NU6 B;  1II3 A;  4OHJ A;  1V1O A;  1Y8P B;  3T56 B;  5L1K A;  5JVH 3;  1S9F A;  3L9A X;  2JA6 B;  5LOV F;  2M05 A;  1Y1V G;  5CBA E;  3K3V A;  4AIM A;  1PX2 A;  1TWA A;  3I4O A;  5GAG C;  1BQQ T;  2VB2 X;  5M5W B;  5BN4 A;  4QB4 A;  1FD7 D;  4JBJ A;  1PA6 A;  3RTX A;  4GC7 A;  2GVA A;  1E4G T;  3G6Y A;  1E22 A;  1CSQ A;  1QB5 D;  2F0F A;  1KDA A;  4IPC A;  5KND A;  2E2D C;  4OX9 L;  2KSW A;  1C30 A;  5J1Z A;  1PZK D;  1G51 A;  1KDC A;  4RZR A;  4HMI A;  1ESR A;  3PW4 A;  1SBB B;  3R2I A;  1I4P A;  1K8G A;  4DV0 Q;  4A3B H;  1PRT F;  2DIK A;  1RYR A;  5IOD A;  4C2M H;  2F3V A;  2C28 A;  2YS6 A;  1X9N A;  3JAM c;  1Q12 A;  4DL4 A;  1N56 A;  2FK2 A;  5EZY F;  3KLS A;  1N33 H;  4UCV A;  4EBE A;  1IL2 A;  3RLN A;  4FF4 A;  2PYK A;  2QIL A;  2O2L D;  1HH2 P;  3GII A;  5C3X A;  1ENC A;  3GTO A;  1PVO A;  2DPI A;  5FLX W;  4RA8 A;  3NUC A;  2VQE H;  3PUY A;  5IYZ F;  4G57 A;  4HID A;  4JI1 Q;  1GO3 E;  4L5Q A;  3MTS A;  3DWQ A;  3I90 A;  1DZ1 A;  4BBR B;  1TVX A;  3HB9 A;  3ND8 A;  3KF8 B;  4GOP A;  2VA3 A;  2DWC A;  2JA6 H;  4LH6 A;  4IO9 A;  1XPR A;  5KFQ A;  4TVA B;  1G2S A;  3ZYY X;  2R93 H;  1VQI A;  1T5X D;  4NDX A;  1E3P A;  2EYO A;  2Z6B A;  5J39 A;  3PUV A;  1ICW A;  1B9N A;  4A3K B;  3HGB A;  5CV9 A;  1X65 A;  1RD9 D;  1IBL L;  1E24 A;  5M3F G;  2PI2 A;  2HGS A;  3L7Z C;  1EQR A;  1KLU D;  5CA1 F;  1R4Q B;  4RB2 C;  1OXT A;  3K80 C;  2AUK A;  5C5M A;  4DR1 H;  2G9H D;  5KFI A;  5HBR B;  5KG1 A;  1ONL A;  3GV5 B;  4PZ7 A;  3A0J A;  1QUQ B;  4LK1 C;  2FPG B;  5GRO A;  4DPG A;  2I5M X;  1UNS A;  3AEV A;  4PZ6 A;  1BGW A;  4IOC A;  3QO2 A;  3E6Z X;  2K5W A;  4CC5 A;  3OWE B;  2AQ4 A;  4A3D G;  3F2U A;  2CCZ A;  3MR3 A;  2UU9 L;  2DY8 A;  4LNQ A;  2SOB A;  4DR7 H;  1QWY A;  3EFX D;  4AYB E;  4GLX A;  1PFS A;  1KNA A;  5DM7 3;  3L4J A;  3OOC A;  3VR2 A;  1RCV D;  2WYO A;  2HQE A;  4Y7N H;  1HNX H;  2RCF A;  5IGB A;  2F0J A;  2EYH A;  4CJ2 C;  3NBH B;  3J7A F;  1SEB D;  1OXX K;  4J8Q A;  1XNQ L;  4K6D A;  1M90 C;  1ZXT A;  4HJA A;  4MV6 A;  2B39 A;  1TS3 A;  4ECR A;  1JDE A;  3VMM A;  4A3K H;  1TWC A;  1SNP A;  1I4Q A;  4X66 L;  5CA0 F;  3NE5 B;  4A3F B;  4JI8 Q;  1TY0 A;  3JAM E;  4FDB A;  1J6Q A;  4L5S A;  1A15 A;  4O1N A;  4TV9 F;  5LA6 F;  5KFZ A;  4JV2 A;  2HVQ A;  2YU9 H;  3FDT A;  3GQB A;  1M0T A;  3A5Z B;  2R8J A;  1XMQ H;  3Q8S B;  1VQN A;  5K36 G;  3IG0 A;  3KK7 A;  2KJX A;  5J22 A;  4ECV A;  3BVZ A;  4R8U A;  3DMU A;  2O5J C;  3HOU G;  1GUW A;  3QWN A;  5KFD A;  4LF5 H;  5KKN B;  2L1B A;  5C3W A;  4J9M A;  4MN3 A;  1UWV A;  4TQU S;  4A3M B;  1NUC A;  4K0K H;  4RCN A;  3C3L A;  3EQL C;  1JWU D;  1MSG A;  4NXN L;  5KT5 A;  1HUM A;  4ED6 A;  2WDT A;  1XMO H;  3L2P A;  2PN1 A;  3BYY B;  3J7A 5;  4ZOL F;  5DM6 3;  1QE6 A;  1HA5 A;  4RGM A;  3GTG B;  5HGT A;  2F03 A;  4O3Q A;  4R4Q A;  4KHP L;  2EJG C;  1N32 H;  1XXG A;  2XC9 A;  2R7Z B;  1AE2 A;  1V1P A;  4ZHQ F;  3M7N A;  4JV5 L;  3VYR A;  1PXU A;  2RGR A;  4IPG A;  4HN7 A;  4IFD G;  4U6P A;  3NEL A;  4ZUI A;  5DGA A;  1FNV A;  2IY5 B;  1J5E H;  2IHE A;  4HJ9 A;  2PBZ A;  4GC6 A;  4ED7 A;  3BVM A;  5IYC H;  3S1M B;  2Z4H A;  4XT1 B;  2KEC A;  4KTA A;  4G4K A;  4A3F H;  1EQQ A;  1SND A;  1U4P A;  4MV1 A;  2JYO A;  1TWH A;  3W1B A;  5IGF A;  3UDI A;  1ESF A;  3PIO A;  2F0S A;  2Q2U A;  4MIU A;  4DAY B;  4HCS A;  4DK3 C;  1PH2 A;  4ED3 A;  2EY2 A;  1UC9 A;  2ZXO A;  3TS2 A;  3G6J B;  4BY1 G;  4O0A A;  4A93 B;  1UAP A;  1I3Q B;  4BWG B;  5FKA C;  4H7B A;  2F4V H;  1A2T A;  1VF5 C;  4TRD A;  4F87 A;  1S97 A;  1CFM A;  5D3D A;  5L1L A;  5D8D A;  2Z6K C;  2E2H A;  5DG9 A;  2R8G A;  4X65 H;  4APV A;  4LFA H;  2IW3 A;  4DAP A;  4A3M H;  4FBT A;  2B2T A;  4YY3 L;  2CVR A;  3A8J E;  2UUA H;  3V2T A;  1CQI B;  2K75 A;  1FNW A;  1XTD A;  4DA2 A;  3M4O B;  1KDB A;  4DUZ Q;  3AQQ A;  3GTG H;  5C5L A;  2L15 A;  1YJN A;  5FD6 A;  2W6M A;  3STB D;  3MA2 B;  2WAQ A;  1S0O A;  1EHI A;  2R7Z H;  2XSC A;  4ZK9 B;  1EWI A;  5IY0 A;  1G8Z D;  5LL6 X;  4DAV A;  1N34 L;  3TSS A;  1IW7 C;  1ZQ7 A;  3TRE A;  4EFE A;  2W9B A;  3T16 A;  4J0M A;  1SNC A;  1L0W A;  3C1E A;  3S1M H;  3LWU A;  5J2T F;  2KQ3 A;  2UXD Q;  3GP7 A;  4DK6 C;  5FO8 B;  4X64 L;  5DGB A;  4A2B A;  2F0D A;  4B3T H;  1K73 C;  4EQP A;  1O80 A;  5ELO A;  4R4I A;  2Q8I B;  1VQ6 A;  2VUM B;  3N41 B;  1KJJ A;  4O3O A;  2JA7 A;  1JDB B;  1I4H A;  2MPM A;  1GKH A;  3Q24 A;  1YJW A;  1TKW B;  3PF4 A;  5JAV A;  2BE5 C;  4GNX B;  1LTT D;  3RN2 A;  4A93 H;  3T1H H;  1I3Q H;  4YWM A;  3FPU B;  4ZQ3 A;  4PMW A;  4ILW A;  4LF8 H;  1Z9F A;  1JMC A;  1LT5 D;  2LY7 A;  1CM9 A;  2LFN A;  3OTO H;  2H1E A;  2RA4 A;  2OTJ A;  1ZKO A;  1I50 H;  1KJ9 A;  3GV3 A;  4J15 A;  1SRO A;  3KF6 B;  2WB1 G;  2L12 A;  1I7L A;  5A2Q L;  3NQI A;  1FJG L;  5HV6 A;  4J9P A;  1EU4 A;  1JJC B;  2VA2 A;  4BS9 A;  4IUU A;  3N43 B;  5I2X A;  1T9H A;  2GA4 B;  2I0Q A;  1KIX A;  3CMA A;  1EWH A;  4HYK A;  5FO7 B;  3T1Y H;  1WTP A;  4K5W A;  1HR0 L;  3VPD A;  3M4O H;  4E6I A;  5M5Y H;  2UXC L;  2AQ3 B;  4HSP A;  2WB1 E;  2HIX A;  3PV0 A;  2CZG A;  2ZM6 H;  4DL2 A;  3RBE A;  4LFC L;  4L5T A;  4GNX C;  1K8A C;  1F2L A;  4GN3 B;  5EQ0 A;  3CCM A;  5LYJ F;  2YW2 A;  1SYC A;  2MGS A;  2NBF A;  2L11 A;  4J9N A;  3TZU A;  1JKJ B;  1F9S A;  1U9R A;  1EY4 A;  3I7F A;  2K5Q A;  1QVF A;  5DQH A;  1SEI A;  4PZ8 A;  1HNZ H;  3HKZ G;  3OHB A;  1P16 A;  4FBU A;  1JWM D;  2RDG A;  2W6Z A;  1K3R A;  4EX5 A;  3PR5 B;  4QY7 A;  5C44 G;  2VUM H;  3H4D A;  3GTK B;  5AFW A;  2KHI A;  2GLT A;  2SNS A;  3LNN A;  3Q22 A;  3K5M A;  2CHB D;  5DG7 A;  4LF7 Q;  4DR6 H;  5KFR A;  3M3Y H;  4EQO A;  1QCB D;  4RHR A;  3DWA A;  2F0E A;  4BA1 I;  4DR5 Q;  1PH4 A;  2EIF A;  1TWA B;  3JC6 6;  1ZHS A;  1JIH A;  3Q8R B;  4F4X A;  3RZD B;  5KFN A;  2EJF C;  3KLW A;  2I8C A;  1J8I A;  1I4G A;  5IYD G;  4ETS A;  3OPO A;  1QZH A;  1JOQ A;  3MXG A;  1PTO H;  5BR8 H;  1AEX A;  3W2D A;  4DNT B;  5JPN C;  4LF4 H;  1UE5 A;  5IWA L;  4WFN 3;  1Y1W G;  5L1J A;  4JI4 H;  3HBL A;  2UXB L;  3K58 A;  1X6O A;  1CI3 M;  2AKW B;  1EIY B;  4PDB A;  1PTO D;  4JI2 Q;  1KC7 A;  1AN8 A;  3SDZ A;  1AUX A;  2DUD A;  1SNM A;  2PW7 A;  1VDZ A;  2C9O A;  1YNJ D;  1MJE A;  3GTL H;  1HXY D;  1TU2 B;  4LF6 H;  5ELB A;  1UC8 A;  1B53 A;  3P1H A;  4DV4 Q;  4OWX B;  4KHZ A;  4X62 Q;  2XNA C;  3GTO B;  3FKI A;  4NXM L;  3GTM A;  3JZI A;  3GTK H;  3J7Z C;  3T5K A;  1W6J A;  1IL8 A;  3U4V A;  3MC0 B;  1IBM H;  3A8K E;  2F0N A;  4DV2 Q;  4RG1 A;  1JC7 A;  3KBG A;  1I5F A;  4JOI A;  1TWA H;  1A3V A;  3RZD H;  1IYV A;  2NN6 G;  3MFG A;  3OUZ A;  2XN9 C;  5ELF A;  3WWV A;  4V0B A;  3A74 A;  1Q1E A;  3CCV A;  1E1T A;  2GPS A;  1MIU A;  1KBL A;  2ASJ A;  2F3I A;  4MAM A;  3T5H A;  1B50 A;  2ATW A;  1Z7T A;  3T53 B;  3TQT A;  4K5X A;  4P71 A;  4IJL A;  2XGT A;  1HUN A;  1EUC B;  1Y1V A;  4B3M L;  4I50 F;  3BG5 A;  1PMR A;  3IL8 A;  4R7R A;  4WJ3 M;  2E5L Q;  1HQM C;  1L2Z A;  1VQH A;  4UCT A;  3D4R A;  3CQZ A;  4ED2 A;  5D3I B;  3W1G A;  2KEE A;  2ASB A;  1UE6 A;  5KG6 A;  1C4Q A;  1LAB A;  3GDE A;  4JI0 L;  4IQZ A;  2JN4 A;  2QF7 A;  1I94 Q;  2I80 A;  3GTO H;  4DV1 Q;  4MV9 A;  4ECS A;  3I55 A;  3E3X A;  5JPM C;  1VBH A;  1EFI D;  3S1R H;  2YTY A;  3RZO B;  1AFP A;  2JEG A;  4ALP A;  2M2L A;  2W57 A;  2JEA I;  2EXD A;  2H4O A;  2WV6 D;  3X3N A;  1LTB D;  3VPB A;  1X3E A;  4K8J A;  4N8F A;  2A69 D;  4JI7 Q;  4I65 A;  3HOV B;  4OX9 H;  4WBN F;  5I9O A;  3K6O A;  5C3E G;  3C2P A;  2I46 A;  4F7X A;  4C5A A;  2OQK A;  3RJ0 A;  2F0M A;  2AUJ D;  1TII D;  2E2I B;  1QJO A;  1AP0 A;  3VYT A;  1RTO A;  4HIM A;  1QZG A;  4YJ2 F;  4QWB A;  2SNM A;  4J6H A;  4DL6 A;  4NMZ A;  4MA5 A;  1YVC A;  1BXR A;  1Y1W B;  5D14 A;  5KNC A;  5EPJ A;  5EWG A;  1HTP A;  1STY A;  2C00 A;  3TP8 A;  4A3L G;  5KT7 A;  1Y8N B;  5E3F A;  4IUQ A;  4DF7 A;  1OWT A;  2ZXR A;  3S2H B;  4G7O C;  3K57 A;  4BY7 G;  3BDO A;  1S5D D;  1E2V A;  2A73 B;  5JEA G;  3H3V C;  2DGY A;  2NZH A;  2Z9H A;  3F8N A;  4LF9 Q;  1E2W A;  3K8A A;  3Q6S A;  4O42 A;  2JA8 G;  3PO3 G;  3PO2 H;  2R7K A;  4MTK A;  5ELN A;  2ZJP A;  4DUZ L;  3RMH A;  4YB8 B;  2ATL A;  2IP4 A;  2IHF A;  3BZC A;  2PNR C;  1K1S A;  3RZO H;  4F50 A;  5IP9 G;  3HOZ G;  4KV6 A;  4DV3 L;  3AFQ A;  1Q86 C;  5HGQ A;  2Z8L A;  3F8T A;  1CK1 A;  4P73 A;  1FR3 A;  3BZK A;  5FLM G;  4JV1 A;  5EKK A;  1IBL H;  1QG7 A;  4LUO A;  3VR5 A;  1CA6 A;  2L5T A;  2R3Z A;  3HOV H;  2KHJ A;  3CPF A;  2D9U A;  3NTK A;  4UCS A;  4RB1 A;  1T5E A;  2DN8 A;  3H3V H;  1QNU A;  3CF5 A;  3Q2O A;  4X6A H;  1TWC H;  2DJF C;  4DK0 A;  4B3R Q;  1YJ9 A;  1N36 L;  4F8M A;  4ABN A;  2FK3 A;  1MBY A;  1TWH B;  5A35 A;  1IKM A;  5K5P A;  1SFO B;  2L55 A;  2XRQ D;  4DR3 Q;  1HZA A;  2K4K A;  4YP3 A;  5M3M G;  4A76 A;  1KD1 C;  3CU7 A;  2MNA A;  2UUC Q;  2PMZ A;  1GHJ A;  2K5N A;  1K0R A;  1BOS A;  4XQJ A;  5FLX E;  2PPB C;  4BXX H;  4AQY Q;  2NVX B;  2RKS A;  2UU9 H;  4OEL B;  3K0Y A;  5KIX A;  4Y8V B;  2E2H B;  1TXY A;  4F4W A;  5I2Y A;  1D5M C;  3S2H H;  4FP5 D;  5J3B A;  1ASZ A;  3G6X A;  2IMW P;  3LML A;  2FFK B;  4NPS A;  1XNQ H;  5C8Y F;  2A68 C;  1S4Z A;  3ER0 A;  1V43 A;  4EEQ A;  3K7A B;  3ERO A;  3CCS A;  1WFQ A;  3KF6 A;  4QQB X;  4IRD A;  3SE7 A;  1K0S A;  1BBU A;  1G2T A;  5KYI A;  4GKK L;  2A6H C;  3UE0 A;  5JH7 F;  2SEB D;  1KEE A;  3IFD A;  3MWY W;  2XCL A;  4X66 H;  2F0Q A;  2FHT A;  3CP0 A;  1S5E D;  4YJ3 F;  4C3J B;  1D6E C;  2AWO A;  2W9B B;  1BCP B;  3ULP A;  3V6K A;  1EY8 A;  2CKZ B;  2PW5 A;  1O75 A;  1Q7Y C;  2A1A A;  2W6Q A;  1TQO A;  4HTH A;  4L1K A;  2OH2 A;  3Q0A A;  3VA7 A;  4X3T A;  2B2T C;  3WOF A;  1IOW A;  3I4L A;  4F4Z A;  1H95 A;  1CQV A;  2FLP A;  4IRC A;  4IJH A;  1TWH H;  3S1Q B;  4XQN A;  4IUT A;  3G6E A;  1T36 A;  4IRK A;  4GKJ L;  1YNN D;  3OSO A;  5BN5 A;  1WCM G;  5IT9 L;  3CCQ A;  4KN7 C;  3Q8P B;  2XGP A;  2W6O A;  1PDQ A;  5KFV A;  4HED A;  3NGD A;  4HMJ A;  3RV4 A;  1Q3L A;  1XWE A;  3MEH A;  4MV7 A;  2YYA A;  2FP4 B;  2I07 B;  2AQ2 B;  3R3O A;  4FO2 A;  3HS0 C;  2VQE Q;  1KL9 A;  4NXN H;  3GIJ A;  3GD7 A;  3MJF A;  1F9P A;  2E2H H;  3GTK A;  1E4E B;  3RIZ A;  3TME A;  2G5D A;  2R7M A;  1BCP C;  2CH4 A;  5D1O B;  4DGZ A;  4BY7 B;  4KHP H;  1WSC A;  4XYL B;  1O7L A;  4JV5 H;  1J9O A;  3SHL A;  4I7H A;  3PO3 B;  2MP1 A;  3EA6 A;  4DV6 L;  1IBK L;  1A6X A;  2ALY B;  3TP5 A;  5C4J B;  3SE0 A;  4B3S Q;  1O78 A;  1GUG A;  3BQ1 A;  2B29 A;  4RWS C;  1DYQ A;  5KFO A;  3VR3 A;  4Q43 A;  4ZRZ A;  1CHP D;  1XNR L;  1K83 A;  4LUV A;  1NJI C;  4Q0Y A;  2JE6 I;  4C3J H;  2K03 A;  3DEP A;  3NEN A;  2JK8 A;  1ULZ A;  3Q1K A;  1TS4 A;  1TR5 A;  5JUM A;  3AMU A;  5GQO A;  4C3I G;  4DR1 Q;  2QKI C;  4RFB A;  3U58 A;  4OEM B;  1C9O A;  4O4I F;  2CWA A;  1EZ1 A;  3GQC A;  2TSS A;  2ZDQ A;  5KFU A;  5KFH A;  3UDG A;  1BKB A;  2VS1 A;  4JBW A;  3HOX B;  2JA7 H;  3TP6 A;  2OWO A;  3QIA A;  4UP8 A;  5C0X G;  3RAQ A;  3J80 i;  5LL6 S;  1SE3 A;  4QMG A;  4U67 3;  1UUP A;  1GSA A;  2E8G A;  2NB0 A;  2BA1 A;  2BR0 A;  4JI6 L;  2MHV A;  4X3U A;  4A3G G;  1SYG A;  2YV5 A;  2KBN A;  4IWY A;  3M4P A;  2EOT A;  4YY3 H;  2F0W A;  4RCO A;  1VQE A;  4DR7 Q;  3BG3 A;  3M9O B;  2R61 A;  3RV3 A;  3MFI A;  1HNX Q;  1CUK A;  5I9P A;  3I4N H;  2AMC B;  1SE4 A;  3M7G A;  1ICF B;  4RB3 C;  1AZQ A;  1IKL A;  2R7D A;  3M85 A;  3X3M A;  2RHS B;  1ENF A;  3OMC A;  1PRT B;  3H0G G;  1X54 A;  2VPS A;  1N34 H;  2F0L A;  4FU0 A;  4YBZ B;  1VF7 A;  5KG7 A;  4QGU A;  1HRJ A;  5M5W H;  2RSO A;  4K6L A;  1C8C A;  1WOC A;  5CR3 A;  3NK9 A;  1X56 A;  1U4R A;  2C2D A;  2RCN A;  4R4C A;  1GHK A;  1FVI A;  3NWT A;  4FNF A;  2WB1 A;  3L3O C;  3N52 A;  2YRX A;  3KAK A;  4X64 H;  2HDM A;  4ME5 A;  3CPW A;  4IAJ A;  1O7Z A;  1EQT A;  5A2Q W;  3CRL C;  1XMQ Q;  4RHS A;  1SMX A;  5CC4 A;  4CC6 A;  4GLV B;  4IPD A;  3RB3 A;  4LSA A;  4BBS B;  3BYT B;  3FKI B;  3GTM B;  2PNH A;  2Y0S G;  4AYB G;  1HR0 W;  3HOX H;  3I4M G;  4LF5 Q;  1PRT C;  5EBD A;  3HOW B;  2SCU B;  2A19 A;  4K0K Q;  1FJG H;  3P75 A;  5F9N A;  3HOY G;  1B1Z A;  5FPR A;  4XIG S;  4YHH L;  1W6K A;  3TEH B;  1XMO Q;  3E9I A;  1PLF A;  3D31 A;  5AJ3 Q;  3HKZ A;  2RBM A;  4KD3 A;  2Y0S E;  3T51 B;  3ETH A;  1RJP A;  1JE5 A;  4U7C A;  1HR0 H;  5KT2 A;  1VS0 A;  4L5R C;  4DUY L;  4BBR H;  1N32 Q;  2W9A A;  1HJP A;  1RTN A;  2UXC H;  2Z1C A;  3TN2 A;  3KTM A;  2XCP A;  1EIG A;  4G7Z C;  1LTA D;  5C6A A;  1DOL A;  4L8J A;  4LFC H;  1ZET A;  1J5E Q;  3IKJ A;  1BXT A;  2DPJ A;  3K3P A;  1JE4 A;  1Y1V B;  1VKZ A;  4MA0 A;  1HNW L;  2B8F A;  1JJG A;  2NUA B;  2FJZ A;  1TT2 A;  2R8K A;  1AW7 A;  3GV6 A;  4MHE A;  3ULJ A;  3ZJY C;  4JYA L;  4OO1 G;  5LP6 F;  1MJC A;  1RJR A;  3ORR A;  2DNE A;  5COY A;  2E2I A;  3KJP A;  2R86 A;  3R2T A;  2HHH L;  1DM0 B;  4UY8 C;  4C5C A;  3CQZ B;  5DQG A;  4JOI C;  4EQN A;  4EEY A;  3DM1 A;  1W2B A;  4HJ7 A;  1LT3 D;  2R7L A;  1Y1W A;  2HCC A;  1EL0 A;  4QCL A;  5IGC A;  1CSP A;  4BBS H;  5FJ8 G;  2C2R A;  1GUS A;  2F4V Q;  3FKI H;  5COR A;  3GTM H;  1ROD A;  3J80 L;  4JPB W;  4ZAI A; 
#chains in the Genus database with same CATH homology
 1L1O A;  4GN3 B;  3CCM A;  3K7A H;  1YHQ A;  1JB7 A;  4X65 Q;  4O2D A;  4LF8 L;  1SE8 A;  1PH5 A;  4JI2 L;  4LFA Q;  2VL6 A;  3NEM A;  4A3J G;  1QVC A;  4QIW E;  4YHH Q;  3OTO L;  3OW2 A;  1UE1 A;  3CC7 A;  2R92 G;  4X64 Q;  3Q8D A;  3GO5 A;  1QVF A;  3I7F A;  4PZ8 A;  3HKZ G;  3M4Q A;  1P16 A;  5IYB G;  3J81 c;  4DUY Q;  3PGZ A;  4DV4 L;  1K3R A;  4EX5 A;  3CCJ A;  3T1Y L;  4QY7 A;  2JA7 G;  5C44 G;  2VUM H;  3TRZ A;  2Z6K A;  4X62 L;  5IT9 c;  5C3E H;  1Y14 B;  2KHI A;  5GAH C;  4A3C G;  1NMF A;  4LF7 Q;  3DM3 A;  4AH6 A;  2PQA A;  3M3Y H;  3S14 H;  1XJV A;  2ZM6 L;  2VY3 A;  3K81 C;  5IYC G;  4HIO A;  3S1Q H;  1CKM A;  1YHB A;  1VQA A;  1HNW Q;  4A3F G;  4QL5 A;  4BA1 I;  4DR5 Q;  1PH4 A;  1Y1V H;  2OQ0 A;  2EIF A;  3RN5 A;  1VQL A;  3JC6 6;  4JYA Q;  1FJG Q;  4GS3 A;  3GTP H;  3S2D H;  4DV2 L;  4A3I H;  5LMU Q;  3KLW A;  2OTL A;  3CD6 A;  2D0P A;  4JI5 L;  1TWF H;  1YZ6 A;  2HHH Q;  1OTC A;  4B3T Q;  1Q1B A;  1Q46 A;  5IYD G;  1QZH A;  1K8A C;  1HNZ L;  1HR0 Q;  2CWP A;  4A3L H;  1UE5 A;  1X3F A;  5LMN L;  3CQZ H;  2UXC Q;  5IWA L;  1Y1W G;  2Q2T A;  4R1J A;  1WYD A;  2WP8 J;  3PUZ A;  4DV5 L;  4BY7 H;  4LFC Q;  1B7Y B;  2UXB L;  2H5X A;  3T1H Q;  2B63 G;  1HZB A;  1X6O A;  1L2F A;  2AKW B;  1EIY B;  4DR6 L;  4OWT B;  3PO3 H;  3UDF A;  2JA8 H;  4A3M G;  4JI2 Q;  2QA4 A;  1Q8K A;  1XPU A;  3OTO Q;  5C4J H;  2DUD A;  1PHJ A;  1P8L A;  2ES2 A;  2E5L L;  4IPH A;  1VQB A;  2HIV A;  5IP9 H;  5H1S E;  1MJE A;  1YNX A;  2VZA A;  1VQ5 A;  2UUB L;  3GTL H;  3HOZ H;  1LTL A;  4KLK A;  3S24 A;  4POF A;  4DV4 Q;  4HIK A;  2GN5 A;  3T1Y Q;  2IT1 A;  3F2C A;  2R7Z G;  4OWX B;  4KHZ A;  4X62 Q;  4DKA C;  1S40 A;  4LW1 A;  5FLM H;  4JBK A;  2JA9 A;  5BR8 L;  4NXM L;  2KCM A;  4MTN A;  1KAW A;  3HOX G;  1YBY A;  2MO0 A;  4LF4 L;  3S15 H;  2JA5 G;  3GTK H;  1I94 L;  3J7Z C;  2ZM6 Q;  4JI4 L;  4DV1 L;  1N9W A;  5M5X H;  1CKN A;  3MXN B;  3GTJ H;  3UDX A;  3U4V A;  4DR2 L;  3AYH B;  4A3E H;  4YCU A;  4DV2 Q;  4RG1 A;  1A63 A;  2HQL A;  3KOJ A;  3DLL A;  3M9B A;  1I5F A;  2F52 A;  4JOI A;  2IX0 A;  1TWA H;  2VQF L;  4YWL A;  3SGI A;  1VQ9 A;  5M3M H;  1D7Q A;  4DNI A;  3RZD H;  1GM5 A;  2NN6 G;  1S72 A;  4BBR G;  4LF6 L;  4A75 A;  4JI7 L;  3WWV A;  3G48 A;  5LMN Q;  3A74 A;  1Q1E A;  3CCV A;  1E1T A;  2YYZ A;  1MIU A;  1YI2 A;  1N8R C;  4JI3 L;  2F3I A;  5IWA Q;  4DR4 L;  4GNX A;  4A93 G;  4DV5 Q;  2NVT H;  2ATW A;  2UXB Q;  1Q82 C;  2E2J H;  3MEF A;  5M3F H;  4P71 A;  2WFW A;  4IJL A;  4DR6 Q;  2XGT A;  4B3M L;  1O7I A;  4OON A;  1AH9 A;  1U0L A;  2Q2I A;  3RLO A;  2E5L Q;  5IYD H;  4DV7 L;  4B3S L;  1IBM L;  1E7Z A;  2ZTC A;  1VQH A;  3CCU A;  2UUB Q;  1PH1 A;  1LM0 A;  4YCV A;  3A5U A;  4JG2 A;  5C4X G;  3AFP A;  3W1G A;  3HOW H;  5IP7 G;  1HZC A;  2ASB A;  1UE6 A;  5HY6 A;  3RR5 A;  5BR8 Q;  4NXM Q;  3GDE A;  4JI0 L;  4LF4 Q;  4BBS G;  2ZJR A;  4A3D H;  2MO1 A;  1LYL A;  3FKI G;  1UEB A;  4YWK A;  1I94 Q;  1ASY A;  3GTO H;  2A8V A;  2YTV A;  4JI4 Q;  4DV1 Q;  3I55 A;  4LF9 L;  3F1Z A;  3GTQ H;  3HOW G;  1XPO A;  1EYG A;  2CFM A;  3S1R H;  2YTY A;  4C3H H;  4DV0 L;  4DR2 Q;  1BBW A;  1RL2 A;  4ALP A;  1TWG H;  1V9P A;  1VQO A;  4P72 A;  1N34 Q;  4PG3 A;  3CW2 C;  1YHA A;  2EXD A;  2VQF Q;  2JEA I;  3S1N H;  4KI0 A;  2R6G A;  1PYB A;  1X3E A;  2Z0S A;  3D0F A;  3IRB A;  2YTX A;  3RLF A;  4UP7 A;  2RHQ B;  2GVB A;  4JI7 Q;  4MNO A;  1WCM H;  1YEZ A;  1VQ4 A;  1YIJ A;  5C3E G;  2VUM G;  4JI3 Q;  2UUA Q;  3FHW A;  4DR4 Q;  3I2Z A;  4JBM A;  3J81 j;  2Q2H A;  2KCT A;  2OQK A;  2HT1 A;  1B70 B;  2PMZ E;  1NMG A;  1JJ2 A;  5JJI A;  5GAE C;  4JI1 L;  4B3M Q;  2K5H A;  4HIM A;  1QZG A;  1VQM A;  4B3R L;  1Y1V G;  3H15 A;  4XTC S;  3PF5 A;  3J81 i;  1R9T H;  4AIM A;  1YVC A;  3I4O A;  5GAG C;  4A3I G;  1IBM Q;  2V1C C;  3ICE A;  4DR3 L;  2MFI A;  2PI2 E;  4JBJ A;  1Q81 C;  1PA6 A;  4R4O A;  2GVA A;  2UUC L;  1E22 A;  1CSQ A;  4A3L G;  1OXS C;  4IPC A;  4LFB Q;  2B3G A;  4UP9 A;  4JI0 Q;  3HOU H;  4AQY L;  4OX9 L;  4EQ5 A;  2IX1 A;  2R7F A;  4BY7 G;  1U5K A;  1G51 A;  1K9M C;  2CQO A;  2JQO A;  5JEA G;  2DGY A;  2NZH A;  4LF9 Q;  3K8A A;  1EIF A;  3PO3 G;  2JA8 G;  1SRU A;  3PO2 H;  3J80 c;  1K8G A;  4GN4 B;  5ELN A;  2ZJP A;  4DUZ L;  1V1Q A;  4DV0 Q;  1VQ7 A;  4A3B H;  4C2M H;  3G4S A;  2IHF A;  3BZC A;  1E1O A;  5JEA J;  4C3I H;  3RZO H;  5IP9 G;  1X9N A;  3JAM c;  1Q12 A;  3HOZ G;  4DV3 L;  4LF8 Q;  1NTG A;  2D0O A;  3AFQ A;  1Q86 C;  5HGQ A;  2PQA B;  2I5L X;  2KEN A;  2BH8 A;  2ZTD A;  3F8T A;  3RLN A;  1IL2 A;  3CC4 A;  4P73 A;  2BH2 A;  3KFU A;  3BZK A;  5FLM G;  2K50 A;  3I56 A;  3PCO B;  1BVS A;  1HH2 P;  2AHO B;  4LUO A;  1PVO A;  3STB C;  2NVQ H;  1PH6 A;  3HOV H;  2KHJ A;  3CPF A;  3H3V H;  3PUY A;  3CF5 A;  1Z47 A;  1KRT A;  4HID A;  4IFD I;  4JI1 Q;  1GO3 E;  4L5Q A;  5C0X I;  5DLQ E;  4A3G H;  4X6A H;  2C35 B;  1TWC H;  1QVG A;  3KF8 B;  4GOP A;  4B3R Q;  2I5H A;  2K5V A;  1YJ9 A;  1N36 L;  1JT8 A;  4A3E G;  2JA6 H;  1SLJ A;  4IO9 A;  4GN5 A;  1XPR A;  4BXX G;  5IE8 A;  4DR3 Q;  1AE3 A;  1HZA A;  2K4K A;  4TVA B;  3FP9 A;  5M3M G;  3S17 H;  4A76 A;  1KD1 C;  2R93 H;  2MNA A;  1DGS A;  2UUC Q;  1VQI A;  4BA2 I;  1E3P A;  2JJQ A;  2K5N A;  3U4Z A;  3PUV A;  1K0R A;  1N33 L;  4BXX H;  3H0G H;  4AQY Q;  3TS0 A;  4JI5 Q;  2LXK A;  1NE3 A;  1X65 A;  1TXY A;  1HNZ Q;  1E24 A;  5M3F G;  1IBL L;  3S2H H;  3HFZ B;  4JI8 L;  5J3B A;  2VQE L;  1M1K C;  1ASZ A;  2EQS A;  2PI2 A;  3KDF A;  3L7Z C;  1K83 H;  3CAM A;  1EQR A;  3HKS A;  1OXT A;  3K80 C;  1VQF A;  4NPS A;  2N78 A;  2K14 A;  4PZ7 A;  3A0J A;  4DV3 Q;  1QUQ B;  3ER0 A;  1V43 A;  4H02 A;  5GRO A;  4YCW A;  2I5M X;  4DPG A;  1X55 A;  3AEV A;  4PZ6 A;  3CCS A;  1WFQ A;  4IOC A;  3KF6 A;  4QQB X;  1KXL A;  4RMF A;  3E0E A;  1BBU A;  4GKK L;  3UE0 A;  4A3D G;  2CCZ A;  1SN8 A;  3I4M H;  3CP0 A;  3PUX A;  4MZ9 A;  3UE1 A;  3W5O A;  2UU9 L;  1NBW A;  2AWO A;  4LNQ A;  3ULP A;  1FL0 A;  4AYB E;  1PFS A;  4GLX A;  2CKZ B;  1Q7Y C;  1N36 Q;  2A1A A;  4Y7N H;  3HOY H;  4A4I A;  4DR1 L;  3CCR A;  1H95 A;  1KHI A;  4IJH A;  1TWH H;  3NBH B;  2VW9 A;  1OXX K;  1WI5 A;  2BA0 A;  4P75 A;  3EBE A;  1XNQ L;  3G6E A;  1M90 C;  1GVP A;  1PH9 A;  1SR3 A;  4GKJ L;  2NZO A;  4HJA A;  4HJ5 A;  1WCM G;  3CCQ A;  1VCI A;  1G6P A;  3B6Y A;  4JCV E;  4A3K H;  4LF6 Q;  4X66 L;  3U50 C;  3CXC A;  5LMU L;  4JI8 Q;  1D8L A;  1KL9 A;  2VQE Q;  3GD7 A;  4WJ4 A;  2E2H H;  4FDB A;  1J6Q A;  4L5S A;  3LGJ A;  3OYY A;  4DR7 L;  4LUZ A;  1HNX L;  2YU9 H;  3A5Z B;  2QGQ A;  3PUW A;  1VQK A;  1C7Y A;  3K0X A;  4OWW B;  1VQN A;  5K36 G;  4OO1 I;  1PV4 A;  4DV6 L;  1IBK L;  1HZ9 A;  2K52 A;  1W3S A;  2ALY B;  3KYH C;  4DV7 Q;  4B3S Q;  4GKK Q;  2VNU D;  3HOU G;  2B29 A;  1IZ6 A;  2UU9 Q;  5FJ8 H;  2NVY H;  1UWV A;  1KRS A;  4TQU S;  1XNR L;  4LUV A;  2WAQ E;  1L1O B;  1NJI C;  3PO2 G;  2JE6 I;  2FXQ A;  4C3J H;  4A3B G;  2JEB I;  4NXN L;  3NEN A;  5JJK A;  2JK8 A;  2N3S A;  3L2P A;  4A3J H;  2XTI A;  3J7A 5;  5E7N A;  4OXP A;  1A62 A;  5GQO A;  4DR1 Q;  2R92 H;  3U58 A;  4R4Q A;  1PH3 A;  4KHP L;  1XNQ Q;  1C9O A;  2ZTE A;  1X3G A;  2CWA A;  1NY4 A;  1AE2 A;  3VDY A;  1XMQ L;  4GKJ Q;  5IYB H;  3UDG A;  1BKB A;  2VS1 A;  4JBW A;  3M7N A;  4IPG A;  4JV5 L;  2JA7 H;  3PIP A;  2OWO A;  4IFD G;  5C44 H;  3NEL A;  4UP8 A;  5C0X G;  3J80 i;  3HKZ E;  1KC8 C;  3HOV G;  2IY5 B;  2IHE A;  4HJ9 A;  4P74 A;  1YIT A;  3EIV A;  4A3C H;  2E8G A;  4JC0 A;  4X66 Q;  4LF5 L;  2BA1 A;  4POG A;  4JI6 L;  3I4N G;  4A3G G;  2YV5 A;  2KBN A;  4IFD J;  2ID0 A;  2LXJ A;  3M4P A;  5IYC H;  1OXU A;  3JAM i;  5C0X J;  4DR7 Q;  1VQE A;  4K0K L;  1UE7 A;  4A3F H;  3F2D A;  2N49 A;  1EQQ A;  1A0I A;  2JA6 G;  1L1O C;  4Y52 H;  1HNX Q;  1CUK A;  1XMO L;  1G29 1;  3W1B A;  5AJ3 L;  3UDI A;  3PIO A;  3I4N H;  2UXD L;  2Q2U A;  4DAY B;  2AMC B;  2R93 G;  4DK3 C;  3ULL A;  4DAM A;  1PH2 A;  3H3V I;  2R7D A;  3M85 A;  4DV6 Q;  1IBK Q;  2E2I H;  2RHS B;  3TS2 A;  3TQY A;  4BY1 G;  4O0A A;  1MKH A;  3CME A;  1KQS A;  1CKO A;  1S3O A;  1N32 L;  1A8V A;  1WJJ A;  3H0G G;  3BU2 A;  5GAD C;  1X54 A;  4ME3 A;  1Y1W H;  4QGU A;  1EOV A;  5M5W H;  2Z6K C;  1XNR Q;  1J5E L;  1WOC A;  1X56 A;  4APV A;  4BY1 H;  2B63 H;  2RCN A;  4R4C A;  4LFC L;  1PH8 A;  1FVI A;  4NXN Q;  4A3M H;  4HJ8 A;  4OX9 Q;  2N8N A;  3CCL A;  4YY3 L;  3CC2 A;  3CPW A;  1EFW A;  4LWC A;  4NB3 A;  2K75 A;  1XTD A;  4KHP Q;  1QUQ A;  4DUZ Q;  3AQQ A;  3GTG H;  1XMQ Q;  1VQ8 A;  1SMX A;  2L15 A;  3PSI A;  1YJN A;  4GLV B;  4IPD A;  3STB D;  4JV5 Q;  5EAY A;  3RNU A;  2R7Z H;  4GOP B;  1OXV A;  2OCE A;  3E9H A;  2PNH A;  2Y0S G;  4AYB G;  1HR0 W;  3HOX H;  3ERS X;  1EWI A;  5IY0 A;  3I4M G;  2F4V L;  4LF5 Q;  1N34 L;  2JA5 H;  4JI6 Q;  2RF4 A;  3S16 H;  3TRE A;  1CKN B;  2A19 A;  4K0K Q;  4X65 L;  1L0W A;  4LFA L;  3HOY G;  3K7U C;  1VQP A;  4XIG S;  4YHH L;  3S1M H;  4QJF A;  3TEH B;  1XMO Q;  3E9I A;  5AJ3 Q;  3D31 A;  2UXD Q;  4DK6 C;  4X64 L;  1B8A A;  2UUA L;  2LSS A;  1K73 C;  2Y0S E;  2MQH A;  1I6H H;  1JE5 A;  5ELO A;  4R4I A;  1IYJ B;  1VS0 A;  3CCE A;  2ZJQ A;  1VQ6 A;  4L5R C;  2D62 A;  2QEX A;  4GLA C;  4DUY L;  4BBR H;  1GKH A;  4IOA A;  1N32 Q;  1HJP A;  4R4T A;  1YJW A;  3KDF B;  3BJU A;  1VQD A;  3PF4 A;  1EUJ A;  4GNX B;  2NN6 I;  4UPA A;  1SFO H;  3RN2 A;  4A93 H;  1VQC A;  4A3K G;  1I3Q H;  4YWM A;  4LF7 L;  1J5E Q;  4PMW A;  4GOP C;  3KJO A;  1Z9F A;  1LUZ A;  3L0O A;  1JMC A;  1N33 Q;  1HNW L;  2OTJ A;  1JJG A;  1RIP A;  1I50 H;  1IXR A;  4DR5 L;  4J15 A;  1SRO A;  3KF6 B;  2WB1 G;  4YY3 Q;  3ULJ A;  3ZJY C;  1IBL Q;  4JYA L;  4OO1 G;  1FJG L;  1MJC A;  2AWN A;  2NVX H;  4LFB L;  1JJC B;  3EN2 A;  1C0A A;  1VQG A;  1T9H A;  1FGU A;  1VQJ A;  3KJP A;  2I0Q A;  1KIX A;  3CMA A;  2HHH L;  4B3T L;  4UY8 C;  4JOI C;  5C4X H;  3F2B A;  1HR0 L;  5JJL A;  3M4O H;  5IP7 H;  1W2B A;  3G71 A;  5FLX c;  4HJ7 A;  1PH7 A;  2WAQ G;  5M5Y H;  2UXC L;  1CSP A;  4BBS H;  5FJ8 G;  2WB1 E;  2HIX A;  3PV0 A;  2F4V Q;  3FKI H;  5LMN W;  3GTM H;  1GD7 A;  3T1H L;  4L5T A;  4GNX C;  1PYS B;  4WJ3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...