3AYHB

Crystal structure of the c17/25 subcomplex from s. pombe rna polymerase iii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
203
structure length
183
Chain Sequence
b'MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWKIEGEDGSEGTELYFDIDEEIRFQIESEDFVDVSPYTLIASCSRDGLGIPAWWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase III subunit rpc9
molecule tags Transcription
source organism Schizosaccharomyces pombe
publication title Crystal structure of the C17/25 subcomplex from Schizosaccharomyces pombe RNA polymerase III
pubmed doi rcsb
total genus 40
structure length 183
sequence length 203
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
B PF08292 RNA_pol_Rbc25 RNA polymerase III subunit Rpc25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ayhB02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3ayhB01
1SROA 2QA4A 2OCEA 1QZHA 4RMFA 4R4OA 4LF9Q 1PH4A 1Q8KA 3CD6A 4YWMA 3J81j 4QGUA 1XNQQ 3J7ZC 1Q86C 4P72A 2EQSA 5DLQE 4B3MQ 2HT1A 2Q2HA 4IPHA 3GTLH 4A3LG 1L0WA 1NMFA 3GD7A 4IFDI 4O2DA 3RLFA 2N49A 4GNXA 2E2IH 2JA5H 1HNZL 2A8VA 1PA6A 4GNXC 5C0XI 3KF8B 2R7DA 1FVIA 1XTDA 3GTMH 2OQ0A 3S17H 4AIMA 4IJLA 1J5EQ 3S1MH 3GO5A 1PVOA 4P75A 3CP0A 4A3JG 1Y1WH 3HOYH 4X62L 3PF5A 2QGQA 4X65L 3FKIH 3M4QA 2IX1A 1JJGA 1M1KC 3PO2H 1KRSA 1N8RC 1VQBA 3CCEA 4JC0A 5LMNQ 4O0AA 5IP9H 4DR3L 3U4ZA 4JBWA 1NMGA 5IWAQ 3M3YH 3L7ZC 2JA8G 4C3IH 1XMQL 1K73C 2R7ZG 2Z0SA 3OTOL 3H3VH 1D8LA 4A3MH 2OQKA 3S16H 2NZOA 3UDGA 1FJGL 2V1CC 2I5MX 3IRBA 4A3BH 3CF5A 1WCMG 4JI8L 3W5OA 2UUBQ 4BY1G 1IXRA 1Q12A 2KCMA 3J7A5 5E7NA 4GKJQ 5AJ3Q 4BBSG 3PCOB 4PZ7A 3J81c 5EAYA 4DV6L 4DR2L 2OTLA 4GOPA 2JE6I 3PUWA 2K52A 2YU9H 1I94L 1PFSA 4NXML 1K83H 2ZJQA 2PI2E 2B63H 2YYZA 1TWFH 4K0KL 2I0QA 1SE8A 2UUAQ 3TEHB 1YNXA 3K7AH 2ID0A 5M5WH 1JMCA 3KLWA 3T1YL 1X6OA 5M5YH 2VQFL 1VQMA 2VQEL 2N78A 3PF4A 2F3IA 5IT9c 2YTYA 1IL2A 2F52A 2KHIA 3M4OH 1KL9A 1Y1VG 4JI3L 1VQHA 4PZ8A 4C3HH 3HOXH 4C2MH 1KIXA 2R92G 3S14H 3PUYA 4XIGS 4C3JH 1E3PA 4OX9L 3KFUA 2UXCL 4KLKA 1EIYB 1VQAA 4LFAQ 4OWXB 5LMUL 4JYAL 2R93H 4JI6L 1WFQA 4X66Q 4UY8C 4TQUS 1VS0A 1N34L 4IJHA 2ATWA 2MFIA 1CSPA 4FDBA 2N8NA 4DR4L 1NY4A 4JI0Q 1VQ7A 1CKNB 4A3DG 4HJ8A 1I6HH 3CPWA 1VQPA 5BR8Q 4P74A 2H5XA 2C35B 1C7YA 1UE7A 4L5RC 1VQFA 3HOVG 4LUZA 3H3VI 2BH2A 3BU2A 2VW9A 3I7FA 3K80C 3RNUA 3I4OA 4DV2Q 4DR1L 3PGZA 1I94Q 3TREA 1XNRL 3KOJA 2KENA 3M9BA 1K8AC 1XMOQ 4OWWB 3W1GA 3CCVA 1OXUA 4HIDA 5JJKA 3L0OA 4GLVB 2NN6G 5AJ3L 2ZTDA 3UE1A 5FJ8G 3I55A 3KJPA 1NJIC 4X66L 2JA6H 2LXKA 4GN3B 2E2HH 3I4NG 5LMUQ 3J81i 1VQDA 1FJGQ 1VQLA 1H95A 3AYHB 1VCIA 4UPAA 1JJ2A 2BA0A 1G51A 3J80i 1PYBA 5IYCH 5HY6A 4AQYL 4NXNQ 3VDYA 3SGIA 1MIUA 1VQIA 2MO0A 1WOCA 3EN2A 4JI2L 4IFDG 3TS2A 4A76A 4QY7A 1PH3A 3U58A 4DR7L 3E9HA 2IY5B 3HOWG 2JQOA 3PUXA 5ELNA 3A5UA 1KC8C 4DR7Q 1R9TH 1W2BA 1A63A 4HIOA 4JI6Q 1E7ZA 2KHJA 5M3FG 2HHHL 4A3DH 4GOPB 3KF6A 4GKKL 4A3JH 2MO1A 2ZTEA 1Y1WG 3S2DH 4LWCA 2UXCQ 2LXJA 1D7QA 4JBJA 5M3FH 3RR5A 5M3MH 4L5SA 1Q1EA 1TWAH 3RN2A 1PH8A 4WJ4A 2BA1A 3I2ZA 1BBWA 1OXTA 2ZJRA 2JA5G 1YZ6A 1L1OB 3CCSA 4OO1I 2IX0A 3E0EA 3GTOH 3G48A 4BXXG 2PI2A 4AH6A 1N36Q 1JT8A 1X3FA 3DM3A 4IPCA 1G291 3CCJA 3PV0A 5H1SE 2AMCB 3OTOQ 1U5KA 1VQOA 2E5LL 1K3RA 4LW1A 4LFCL 4NXNL 4DV2L 4DR1Q 4A93H 3GTJH 1QVCA 3OYYA 4ALPA 4LF5L 5J3BA 5LMNL 3STBC 3CQZH 4UP8A 4B3SQ 1E24A 1RIPA 4DV5Q 3CC7A 4YWLA 4K0KQ 4JI5Q 3G71A 5IYDH 1LTLA 3HFZB 4GLAC 3CAMA 1CUKA 4JI1L 4DK3C 4JI0L 1NBWA 1V43A 4DUZQ 2K50A 1N33Q 3PUVA 1AH9A 2K4KA 4LF7Q 1UE1A 4A3CH 2A19A 2NVYH 4LF7L 2RF4A 3RZOH 5FLMG 1GM5A 1YJ9A 4HIKA 3CW2C 3E9IA 5IYCG 4IOAA 1A62A 3EBEA 4OX9Q 5C4JH 4B3TL 3UE0A 1LM0A 2K5NA 4JG2A 4POGA 3KDFA 4BXXH 1WCMH 1CSQA 2K75A 2R7FA 4GN4B 4YCWA 4X64Q 4A3BG 2OTJA 4YY3L 4A3IG 1HR0L 4DNIA 1E22A 2WB1E 2GVBA 1IBML 1CKMA 1W3SA 4JI4L 4LFBL 2UU9Q 1VQNA 1WI5A 1KD1C 3UDFA 1V1QA 4AYBG 1CKNA 4A3IH 4A3FH 2JA8H 3TRZA 5JJLA 1KQSA 1O7IA 2VQEQ 5GAEC 4DR6L 2R93G 4ME3A 3I4MH 5LMNW 3F2CA 1NE3A 3PO2G 1KHIA 2F4VQ 1EOVA 1DGSA 1N36L 1HNXL 2NN6I 3ULLA 4HJ9A 4LF5Q 2R92H 1EQRA 1OXSC 4YCVA 4X64L 3BZKA 1UE6A 2JA7H 3KDFB 3CCMA 1XPRA 1GO3E 2BH8A 3T1HQ 2CWAA 4YWKA 4GKKQ 3NENA 4BY7H 3GTGH 2FXQA 4HIMA 5JEAJ 4A3LH 4GKJL 5ELOA 4BBRG 4LNQA 1BKBA 3ICEA 2LSSA 2GN5A 4DUZL 2KBNA 1PH5A 1PH7A 1K0RA 2E8GA 4JI1Q 4RG1A 1KRTA 1QZGA 5GADC 3DLLA 2HQLA 1XMQQ 2UU9L 5FJ8H 2JA6G 4JI5L 2UXDL 3H0GH 4JI2Q 1YHAA 1SN8A 1VQGA 3UDIA 2R6GA 3PIOA 4DR3Q 3JC66 4A75A 1I3QH 1YITA 5IE8A 4JV5L 3PSIA 3F8TA 3FHWA 2ZTCA 3ER0A 1T9HA 1L1OA 3S1NH 3JAMi 1E1OA 2VNUD 1SRUA 5K36G 4POFA 4A3MG 1OXVA 1Y1VH 3F1ZA 3LGJA 2JA7G 4GNXB 3Q8DA 2K5HA 2Q2UA 1EUJA 2D0PA 4R4QA 1N33L 3PO3H 1S72A 1SFOH 1VQEA 3HKZE 1EYGA 1V9PA 2WP8J 3PO3G 3M85A 1RL2A 5C0XG 1M90C 4JBKA 4BY1H 1N32L 1I5FA 1XJVA 3K8AA 1C9OA 2Z6KA 2UUCQ 4JOIC 1U0LA 3CMEA 5C44G 2D0OA 3CPFA 3GTKH 3I4MG 1Q81C 3J80c 2AKWB 1YEZA 1VQ6A 2IHFA 2L15A 2R7ZH 2ZJPA 2NVQH 2K5VA 4UP7A 4PMWA 1AE2A 4LF8L 4IOCA 4HJ5A 2VS1A 2YTVA 2HIVA 3NELA 4JI4Q 4LFBQ 5C0XJ 1X9NA 3HOZG 2Q2IA 2PMZE 4JYAQ 5JJIA 3PIPA 4LUVA 5FLXc 2A1AA 4DV4Q 2GVAA 5C3EG 1IBKL 4B3RL 4L5TA 4B3TQ 5M5XH 1HR0W 4A3KG 4BBRH 1PH1A 4P73A 4H02A 2JEBI 4UP9A 1YIJA 3HOUG 3K7UC 3I56A 1UE5A 4GOPC 1X54A 1VQ4A 3KF6B 4P71A 2AWOA 3HOXG 2WAQE 2B29A 4DUYQ 4DK6C 1QUQB 3KJOA 1IZ6A 4R1JA 3JAMc 3EIVA 4DV5L 1YJWA 2UUAL 3CC2A 1HH2P 2JK8A 4LUOA 4EX5A 4IO9A 1EFWA 1MJEA 3AEVA 5GAHC 4MNOA 3OW2A 5IP9G 3ULPA 4DV6Q 5GROA 1BVSA 2XTIA 4AYBE 1A0IA 1CKOA 4BA1I 4DV1Q 4A3GG 3FKIG 2N3SA 1IBLL 2I5LX 1SR3A 3GDEA 3A5ZB 1PYSB 3HOYG 3L2PA 3AQQA 2YTXA 4XTCS 4LF4Q 1JE5A 2RHSB 1Z9FA 2WAQG 3CCUA 1K8GA 1VQ5A 5IY0A 3A0JA 3KYHC 1A8VA 1XNRQ 3HOWH 2NVTH 3PUZA 3HOUH 3F2BA 4PG3A 2HHHQ 1FGUA 1HNWL 5GQOA 4A3EH 2DGYA 4DV0Q 4OO1G 1UWVA 4X6AH 4JBMA 4DV7Q 1E1TA 1N9WA 1BBUA 2I5HA 1YHBA 3MXNB 4DV7L 4OONA 1N34Q 1QUQA 2CCZA 5IP7G 4DV0L 3GTPH 1Z47A 3WWVA 3S1QH 3F2DA 1N32Q 2EXDA 3I4NH 2UXBL 4Y7NH 1XPOA 4LFAL 2K14A 4A4IA 3CXCA 4B3ML 3M7NA 4A3FG 1XNQL 4R4IA 4BY7G 3D0FA 4MZ9A 4YCUA 1LYLA 4DUYL 4AQYQ 1S3OA 1SMXA 2IHEA 3FP9A 3S1RH 3RLNA 4DAYB 1WYDA 4QQBX 1X3EA 4R4TA 1QVGA 4LF4L 1I50H 4IPDA 4JI3Q 2JEAI 2YV5A 1VQCA 3S24A 3ZJYC 4QL5A 2UUBL 2VY3A 2DUDA 1IBLQ 2D62A 5IYDG 2OWOA 2XGTA 3BZCA 4DV1L 1EQQA 1P8LA 5IP7H 3H0GG 2VQFQ 1PH2A 1XMOL 2ES2A 3T1YQ 2ZM6L 1Q1BA 4JOIA 1WJJA 4QJFA 2KCTA 3HKSA 5GAGC 1YI2A 1IBKQ 3S15H 1G6PA 1KAWA 2MQHA 2IT1A 1L2FA 4DAMA 1B70B 3A74A 1Q82C 1PH6A 4JI7L 4IFDJ 2UXBQ 2CFMA 2UXDQ 4GS3A 4X65Q 1X56A 1YBYA 5BR8L 4LF8Q 3CCRA 3CCQA 4KI0A 4TVAB 1Q7YC 2VUMH 1HZAA 3NBHB 2CKZB 4DR4Q 4J15A 1X65A 1FL0A 3BJUA 1HNZQ 3HKZG 4EQ5A 1HNWQ 3UDXA 4A3CG 2PNHA 1VQ9A 3GTQH 3M4PA 3T1HL 4Y52H 1AE3A 1J6QA 2B3GA 2RCNA 3RLOA 4A3GH 2EIFA 1YHQA 4LF9L 4B3RQ 4NB3A 4OWTB 2WFWA 4DV4L 1HZBA 1VQJA 1YVCA 3AFPA 4PZ6A 4HJ7A 5C4XH 1JB7A 4YHHQ 2CWPA 4DR5L 1HNXQ 1X55A 4DKAC 1S40A 2F4VL 4APVA 1EWIA 2MNAA 1QVFA 3NEMA 5C3EH 1YJNA 4LF6L 1Y14B 1VQ8A 4DR6Q 4MTNA 2NVXH 2PQAB 4LF6Q 3RZDH 3AFQA 1X3GA 2JJQA 1MKHA 4KHZA 1B8AA 1GKHA 1EIFA 5IYBH 2UUCL 4JV5Q 1OXXK 4YY3Q 4GN5A 3W1BA 5FLMH 1PV4A 2VZAA 1B7YB 1SLJA 4NXMQ 3D31A 4A3KH 1ASYA 3G4SA 4BA2I 3CMAA 1HZ9A 1UEBA 3S2HH 1PHJA 5M3MG 1TWCH 3U50C 4DR2Q 4KHPQ 3K0XA 4DV3Q 1TWHH 2B63G 2AWNA 3TS0A 4L5QA 2AHOB 2Z6KC 1HJPA 4JI8Q 1Q46A 2JA9A 1GD7A 4KHPL 1LUZA 1TWGH 2QEXA 3H15A 1PH9A 3TQYA 3HOVH 1IYJB 2CQOA 2RHQB 5IYBG 3MEFA 1OTCA 2Q2TA 4BBSH 1C0AA 4JCVE 4WJ3M 2HIXA 1K9MC 2E2JH 2Y0SG 5IWAL 2VL6A 1XPUA 4R4CA 4JI7Q 4A3EG 4GLXA 5C44H 1TXYA 3CC4A 3U4VA 4B3SL 1KXLA 3RN5A 1P16A 4NPSA 3G6EA 4DPGA 2VUMG 4LFCQ 1HZCA 2NZHA 1MJCA 2WB1G 4IPGA 2ZM6Q 3K81C 4X62Q 1VQKA 5C4XG 2E5LQ 2ASBA 2PQAA 4OXPA 1ASZA 1J5EL 1L1OC 3ERSX 3STBD 2ALYB 3HOZH 5HGQA 4HJAA 1JJCB 3CCLA 1IBMQ 3ULJA 4QIWE 5JEAG 4YHHL 4DR5Q 3B6YA 1HR0Q 4A93G 1NTGA 2Y0SE 4DV3L 1GVPA
chains in the Genus database with same CATH superfamily
2QA4A 1QZHA 4RMFA 4LH6A 5EWFA 1Q8KA 2EYLA 4YWMA 3J81j 4QCLA 1HA5A 4B3MQ 5DLQE 4K5WA 2JSOA 1L0WA 4F50A 3GD7A 4Y8VB 1JR0D 2N49A 3CRLC 4GNXA 3E5SA 2E2IH 4DR5H 3KBXA 1FVIA 3NBHA 2OQ0A 1J5EQ 4O3NA 1GUWA 5KRUA 4J9QA 3MR5A 2J6SA 1Y1WH 4CBVA 3HOYH 4HCSA 5EDWA 1I7LA 2IX1A 3KHHA 2L4NA 2RGVA 2FFKB 1I3QB 2KVMA 1K73C 2R7ZG 1SE4A 4ZRZA 2YS7A 3GTQB 3S16H 2FMAA 3MFIA 4UCVA 4A3BH 1ICWA 3PMFA 1WCMG 5C5MA 5I9OA 3CF5A 1GHKA 1B04A 5LOVF 2UUBQ 4BY1G 4DL6A 3PW2A 2KCMA 5IIFA 1EZ8A 4BBSG 2J6TA 1SEBD 4DR2L 1KJJA 5EAYA 4DV6L 1EY6A 4GOPA 2QDLA 3PUWA 5NUCA 1WTVA 1PK8A 1TWCA 1I94H 1V1PB 2YU9H 5E3FA 4NXML 4EVOA 4NXMH 2ZJQA 2B63H 3K5NA 1KJIA 3EFXD 2UUAQ 4Q0FA 2VR1A 5ELFA 5M5WH 2SNMA 4KD4A 1JMCA 2L55A 5TSSA 3KLWA 5C3WA 2N78A 4C5AA 5IT9c 4A3BB 4OIKA 2KHIA 1XTCD 3BG5A 3IFTA 3L4JA 1Y1VG 5KFQA 3HOXH 4C2MH 3S14H 3ND9A 4J9NA 3PUYA 4C3JH 1E3PA 2UXCL 4OX9H 4KLKA 1NUCA 4LFAQ 4RHRA 4FU0A 5KFTA 3WO1A 4UY8C 1TS5A 4TQUS 1XWEA 2R7ZB 3E3XA 2HQEA 1CSPA 2DNCA 1KABA 5BPHA 4A3DG 3CPWA 1VQPA 2M2LA 2I87A 5D1OB 1C7YA 1JKJB 4EBDA 1VQFA 3URYA 3BS1A 3H3VI 4MV9A 2BH2A 4LF5Q 2VW9A 3K5IA 3I4OA 5CV5A 4DV2Q 3PR4A 3TDQA 5IGDA 1HRJA 3S14B 2JP1A 3M9BA 3CCVA 4IQZA 3KK7A 2C2DA 4GLVB 3I55A 4GKJH 3KJPA 5LXTF 3TP7A 4X66L 5EWEA 2LXKA 5LMUQ 4JI3H 5C3EB 1VCIA 3D3RA 2BA0A 3GTGB 1PYBA 3SXHA 3EA6A 4AQYL 2YZGA 4RA8A 3SGIA 2IJ0A 4MAMA 3HEJA 3RB4A 3EN2A 1B1ZA 1NNXA 1S5ED 4JI6H 4G57A 5L1JA 2IMWP 2IY5B 1UAPA 2NB0A 5IT9E 2R6FA 1KC8C 4MHEA 4U6PA 1ZKOA 1JORA 4HIOA 3SR1A 4JI6Q 1A6XA 5EPJA 1EY5A 1K3BC 3HP3A 4FXKC 5D65A 5FO7B 3GIPA 2MO1A 2LY7A 4L1KA 2E75C 1D7QA 2LXJA 1M7JA 3KXYT 4IR9A 3RR5A 4L5SA 2M00A 4LMYA 4MA0A 3RN2A 1PH8A 5LHY1 2BA1A 4RB3C 5CGKA 3WDNA 5JPMC 3PQIA 3HOVB 1HR0H 4DA2A 1FJGH 1STGA 3E0EA 3G48A 4N9TA 5EBDA 4O3RA 1JT8A 1DV1A 1E4FT 4FM9A 1X3FA 1Z7TA 3T5JA 4R8IA 3GV6A 4QWEA 4FS2A 1PTOB 1JLLB 4LW1A 1WTXA 1AZPA 1EWHA 1QCBD 1SNMA 4DR1Q 3H91A 3GTJH 4ZUIA 3N42B 2R8JA 5LMNL 4BY1B 1E24A 3S1RB 4DV5Q 1KDAA 4HEDA 3CC7A 3N40P 4U673 3PIO3 2OLSA 4GLAC 1CUKA 1E2WA 4CKCA 1VBHA 1V43A 4DUZQ 2SOBA 5D1PA 1AH9A 3N44B 1UE1A 5BMVF 3RZOH 1MSHA 3JAME 3QZ7A 1CQFA 4IOAA 1A62A 4OIJA 1WH2A 1O75A 5C4JH 4ZOLF 3WO0A 5L1LA 4JG2A 4BXXH 1HQRD 4A3GB 4C3JB 4EQPA 2V9WA 5D3DA 4YCWA 4I55F 4GN4B 1S0OA 1GSHA 5JQWA 1HTLD 4Z9CB 4YY3L 1I4RA 1E22A 4HTHA 2H4OA 3A56A 3CRKC 4XQNA 4JYAH 1S5DD 4JI4L 4LFBL 1WI5A 3HOZB 3UDFA 3NGDA 3T13A 2JA8H 5KYIA 1E4EB 5GAEC 3S1MB 5LMNW 5CC4A 3HXLA 1NE3A 3PO2G 2W6QA 2EE1A 1PTOF 2HGSA 4CDEC 5KG7A 3J7AV 2NN6I 2XIWA 3MTSA 2B2UC 2JA7H 4O2BF 2BE5D 2PO4A 2R7MA 4TV9F 5JOBA 2BOSA 1K8MA 5IGCA 4FBTA 3VYTA 4C5BA 3T1HQ 4F8MA 3E5NA 4BY7H 2GLTA 4ECZA 4ZYSA 2AUJD 3K59A 3I90A 4RB0A 4BBRG 3H40A 1BKBA 2GN5A 1SYFA 1NCVA 2PVPA 4CKEA 1ZYRD 2B2YA 3C2PA 3HG9A 4ZKBB 2FKLA 4X3TA 4O4IF 3M9MB 1LT4D 2R7KA 2HQLA 2UXDL 3NSWA 3L3OC 4JI5L 4JI2Q 3U9TA 3KHRA 1SN8A 5DLFA 2R6GA 1TWFB 4A75A 1U4PA 3MR2A 4QIWB 5FLXW 3H4BA 1LV9A 4RCNA 3FHWA 2JA7B 4QWBA 4I4TF 5KT7A 1E2ZA 1T9HA 5JVDF 2VNUD 2A68C 3K3VA 1LABA 4POFA 1WVLA 4O2AF 1EY8A 5FLXL 4A3MG 3LGJA 3UQ8A 2PZTA 1QOHA 1EUJA 4MTDA 4HMJA 4QMGA 4S3SA 5KT5A 3PO3H 1S72A 1SFOH 2R93B 4DXGA 2WP8J 1BR9A 1PRTB 5M3MB 1EY0A 4TV8F 2I8CA 4ED6A 2R82A 5C0XG 2MHVA 4YBZB 1N32H 4JBKA 3VA7A 2LFNA 3K8AA 4J1MA 4JOIC 3DWAA 1JXLA 3GTKH 3V4ZA 2IHFA 4DV7H 3QOLA 4PMWA 4APMA 1AE2A 3FMCA 3SK5A 1ICFB 3J81W 4JI4Q 4LFBQ 2UU9H 4NXNH 3OHAA 4PWQA 4HR7A 4LFAH 2K04A 5K5PA 3WOEA 1E4GT 3OSPA 5CA1F 3A54A 1QNKA 2CW0C 2LMCB 4CGYB 4KK7A 1KEEA 3FPPA 4LJZC 4B3TQ 4YR3A 3L4KA 4GC7A 4TKOB 2LS01 4I7HA 4DAYA 4H02A 2C5CA 4NLGA 3MXPA 3I56A 4TQRA 3G6JB 2AQ3B 4P71A 1CQIB 1RTOA 4BY7B 4OEMB 1TY2A 1B6SA 4WFN3 3I73A 2UUAL 4ECTA 2B63B 1HH2P 1MI2A 1ET9A 3GQCA 2R8IA 3MC0B 4JV5H 5C0XH 4L63B 4MNOA 3VR2A 1ONLA 4C2MA 4DV1Q 1TIID 2PW7A 4J9PA 2I5LX 2UUBH 3OSNA 1PYSB 3L2PA 2OH2A 2BE5C 3NBIA 4RB2C 3O13A 1IL8A 5IOCA 1A8VA 1QB5D 1XNRQ 4DK1A 2NVTH 3N41B 3HOUH 3Q22A 2E76C 1STAA 3D4RA 1TWGB 1Z2PX 1HNWL 4A3EH 2SCUB 4BBSB 4OO1G 3T16A 4X6AH 1EL0A 1PYWD 4HNVA 1N48A 2L12A 1YHBA 3MXNB 4OONA 1N34Q 3FDTA 2CCZA 2MCTA 5IP7G 4EEYA 4LF8H 3GTPH 1Z47A 1ZHSA 2FMCA 1V8QA 1N32Q 1F9SA 2FLNA 2UXBL 1PFBA 4B3MH 4B3ML 2RQXA 3HOXB 1XNQH 3CQZB 4MV1A 5KFBA 2DWCA 1H9SB 4BY7G 4RZQA 1LYLA 4LF9H 1SMXA 3FP9A 2L9HA 1K28A 3S1RH 2F1MA 3BQ2A 1SFOA 4QQBX 4QUFA 1X3EA 4R4TA 2DJFC 5KFEA 3GILA 2QEJC 1PTOH 2YV5A 3S24A 3BA9A 1KNAA 4DN4M 4IUQA 4CJ2C 1TS2A 1VF5C 2OWOA 2XGTA 4DV1L 3H0GG 2VQFQ 1PH2A 3T1YQ 1WJJA 4QJFA 5GAGC 3HKSA 1I4PA 1TWAA 3J80L 2MQHA 1X3PA 1WCMB 4DAMA 1B70B 3A74A 2DY7A 5EQ0A 4JI7L 4IFDJ 1ZETA 2UVVA 2CFMA 4XYOA 4X65Q 1BJTA 1X56A 2EZVA 5COYA 3NHHA 3ONAB 4LF8Q 4LAAA 4KI0A 4RUAA 3GTKA 1A2TA 1HZAA 4DR4Q 1U9RA 4F4YA 1SNPA 3NTHA 5KG0A 4CJ0B 2R8HA 2YCHA 1EY9A 3M4PA 2B3GA 2WB1B 2ZDQA 1PZID 2ENBA 1MGSA 1JB7A 4YHHQ 4DR5L 1TA8A 4J6HA 3GIQA 2F4VL 4APVA 2MNAA 4RGOS 2HCCA 5KG5A 2VQEH 5C3XA 3RZDH 4ZHQF 1X3GA 3AFQA 3F2UA 2HUGA 1M0TA 1GKHA 5IYBH 2UUCL 4JV5Q 1OXXK 4UCTA 4YQWA 2W7OA 1B50A 4TSSA 2G9HD 2KHSA 1WCMA 4HYKA 1B7YB 4G7OC 4A3KH 3G4SA 1UEAB 3Q8QB 2B39A 3U50C 4DR2Q 4KHPQ 1D5MC 4G3IA 2RSOA 3VR5A 4TUYF 2B63G 1DYQA 2SNSA 2R93A 2IW3A 3TQYA 1IYJB 2EVBA 5E4WC 5IYBG 4BBSH 4EQNA 5BN5A 4JCVE 4O3QA 1F9PA 4M1UB 5C1OA 2CW8A 2VL6A 1SDFA 2F0TA 4R4CA 3CC4A 1DCZA 3U4VA 3G6EA 4DPGA 5EJWA 4NXNQ 4IPGA 2ZM6Q 2PYKA 4X62Q 5KFOA 2L11A 2W6MA 3P20A 4EBEA 1BOSA 3NTIA 1S5CD 1W96A 4O3PA 4HJAA 1FGBD 3CCLA 1DONA 3ULJA 1HTPA 1LT5D 1RJPA 4YB8B 1V51A 5JVH3 5IGEA 1BCPD 4QGUA 3R93A 4P72A 4A3LG 1VMPA 5CORA 1H9KA 1NMFA 4X3UA 2JA5H 1I6HB 5C4ZA 1PA6A 4HNTA 5C0XI 2R7DA 1XTDA 3OSOA 4IJLA 3BYYB 2V4RA 3CP0A 1STEA 5FD6A 3PF5A 4ED2A 2QGQA 4X65L 3M4QA 4FF2A 4XYLB 1A3UA 1JJGA 2XC9A 2JA7A 3S16B 1N8RC 2CW7A 3CCEA 4JC0A 1GJXA 1BQQT 4QW9A 4CC6A 3U4ZA 1NMGA 1C3OA 2R85A 4V0BA 3H0GB 4IRKA 1AN7A 3OTOL 3H3VH 4FXGC 1BGWA 2NZOA 3UDGA 1FJGL 2V1CC 4A3DB 1R9TB 3KLRA 3GTMA 3L9AX 3W5OA 4MV7A 4JI8H 2JA6A 1Q12A 2ICIA 4GKJQ 5E7NA 1I4GA 1EU4A 1STBA 1UC9A 3OIPA 3PCOB 4IAJA 2JE6I 3EJIA 2MUYA 4DV2H 2W9CA 1II3A 2NZ1D 1K83H 3BVGA 4KY7A 4K0KL 2NU8B 2R84A 1B3QA 2EYJA 1EYCA 1GOZA 1S5FD 2PZWA 1EIGA 4L8JA 4P2CB 4LF6H 1PMRA 1E4EA 5DEHA 1GYFA 1E0BA 2YTYA 1S97A 2F0MA 2F52A 3M4OH 3R5HA 1KL9A 3DEPA 4RGMA 4JI3L 3MZ5A 3WNZA 4KKUA 4PZ8A 3Q23A 3S2HB 4C3HH 1ENAA 4J9LA 3TINA 2A68D 4RAYA 5KT2A 2KEDA 4OWXB 2K5WA 1SFOB 2R93H 4TQSA 4CJ1B 2ASLA 4LMQD 1MD2D 2A5HA 3GTOA 1O78A 1I4XA 1N34L 4PV1C 2ATWA 4FDBA 3SDZA 4NW2A 4JI0Q 1VQ7A 1CKNB 4NP5A 4HJ8A 5EWGA 2K33A 5LL6S 4WJWA 5BR8Q 4P74A 1MSGA 2H5XA 3GQBA 4N8FA 4L5RC 1DD2A 5EZYF 3HOVG 4LUZA 2B63A 3BU2A 3TP8A 3K3PA 3K80C 2BQUA 4C1NI 4DR1H 2NU7B 3KOJA 4OWWB 4J8QA 1XMOQ 4Q44A 1JWMD 5AJ3L 2ZTDA 1RJTA 3UE1A 2JA6H 3T5KA 1RK6A 3Q1KA 1LTAD 4GN3B 5M9OA 3SK4A 2I07B 1B9NA 1VQDA 1X32A 1FJGQ 1H95A 4XQJA 1KC7A 5C4XB 5DQGA 1JJ2A 1TY0A 1TAEA 3JZIA 5KFIA 4K2LA 1CE8A 4AQYH 2F0KA 5KFJA 4KN7C 1RTNA 1MIUA 1A3VA 3C3LA 1SXTA 4MA5A 3LX0A 2ZJTA 3QR8A 1PH3A 1BUVT 1QE6A 2HDMA 3E9HA 1YNJC 5LP6F 3PUXA 2L1BA 5ELNA 1ULZA 5KFHA 1W2BA 2EY5A 1TWHB 2FHTA 1A63A 2RDHA 2KHJA 2HHHH 1KBLA 3U9OA 4GKKL 3BZDB 4A3JH 2W6PA 3I12A 1WSCA 4JK1C 1TS4A 4JBJA 2WTFA 4A3JB 2NYZD 3J81L 3HS0C 2ZJRA 4JW0A 3CCSA 4OO1I 4DL3A 3GTOH 4C56C 2PI2A 1N36Q 2NTSA 3R2TA 4IPCA 2EDGA 5EOYA 3CCJA 4FYDA 3PV0A 2F0GA 4DV6H 2G9DA 4IURA 3ZYYX 5DG8A 2C22A 5ELDA 4A93H 4I7AA 2X6LA 3FRPB 4LF5H 1ILQA 3STBC 2PZUA 3CQZH 1FR3A 1HUNA 1T3NA 4A93B 1ML0D 4E6IA 4JI5Q 5IYDH 1RKNA 2VB2X 4RHSA 2W8KA 1LTLA 3DWPA 1DOLA 2CVRA 1B6RA 1Y8PB 2KCCA 5A2QL 3GTPB 2XIGA 4O4LF 4O3SA 5HBRB 4JI0L 3KAJA 1NBWA 1SMYD 3PUVA 2Q8RE 4LF7H 3GTOB 4LF7L 2WB1A 3J7YW 4EYHB 3K6OA 1N33H 3AU7A 1GM5A 4QWCA 1YJ9A 4HIKA 3E9IA 3K5HA 1IOWA 3R2IA 4OX9Q 2EOTA 2H1EA 1HHVA 2VPSA 5KFMA 3UE0A 5IODA 2A6EC 4POGA 5D14A 4X64Q 2K75A 1JQYD 2KUMA 4R8NA 1KNEA 1HUMA 4RH6A 3PN1A 4YY3H 3PW0A 1HR0L 2F0SA 2WB1E 1XXGA 1CKMA 5JJLA 4M8AA 2XVSA 4AYBG 1CKNA 4UCOA 4R8UB 1T5EA 2R7NA 1EFID 1O7IA 2VQEQ 4J0MA 2R93G 4CC5A 4ECQA 2JA5B 1O7LA 4FP5D 1OWTA 2F4VQ 1EOVA 4DXFA 1DGSA 1W93A 4MV6A 3X3MA 5KFGA 1JICA 4HJ9A 5KFNA 5FKAC 4YCVA 3IG0A 1Q90A 1HFNA 3ORQA 5I9PA 4AYBA 1SMYC 1KDBA 3OMGA 2EXZA 2CWAA 4YWKA 3CVZA 3N6RA 2EY2A 4GKKQ 1JCKB 2B2YC 4YAKB 2YL2A 1EOTA 2NVXB 5ELOA 2JA6B 3CU7A 4LNQA 2QCPX 1AUVA 5BN4A 3GTMB 2VOBA 4YR0A 1BCPC 2LSSA 3DHQA 4A2AA 1IKLA 4FXDA 1PH5A 1PH7A 4IRDA 4UAIA 1K0RA 4JI1Q 4RNMA 5GADC 3DLLA 3NQIA 4I7ZC 1XMQQ 2UU9L 1LTGD 3WOFA 2JA6G 3W3AA 3JAML 1VQGA 1MHWC 2ZXRA 2WKCA 2B2UA 1YITA 1PTOD 2A69D 3GTJB 4DL7A 3HKZA 4C3HB 2FE3A 3DWQA 3ER0A 3NXWA 4CKBA 1BCPB 3U9SA 1L1OA 3S1NH 1E1OA 5A2QE 4F7XA 5K36G 1IBLH 2R7ZA 4ECUA 1OXVA 1SE3A 2JA7G 3KHGA 4FNFA 5EKKA 5JEAH 4LH7A 2ICEC 1EYGA 4RU9A 1V9PA 1CA6A 1AFPA 5KFYA 5KFUA 5KX5F 2TMPA 1GSOA 3M85A 2W6NA 4MTEA 4KTAA 2XNAC 4BY1H 3CKIB 5C4JB 1XJVA 1N32L 5DG7A 1U4LA 1TWHA 5C44G 2D0OA 3CPFA 4IZOA 1VQ6A 2Z9HA 3BVZA 2R7ZH 2ZJPA 2NVQH 3NELA 1Q8IA 4LFCH 4X3KA 5C0XJ 3EPIA 2PMZE 5EGTA 3VYRA 1E2VA 2HDLA 4DV4Q 4QW8A 3W2DA 1U4RA 3FVQA 1SYGA 1IBKL 5CMDA 4B3RL 3NPPA 5IT9L 3ETJA 1G2SA 2DZDA 1JC7A 2PMZB 5I6YA 3KTMA 2G5DA 5M5XH 4FF3A 3VMMA 2JEBI 1CZGA 3I70A 1YIJA 3J80E 2ASDA 1SAPA 2B2TA 1UE5A 4K6LA 1X54A 1W6JA 5CV8A 4ID6A 3HOXG 3GIIA 2WAQE 4RKBA 2YS6A 1STNA 4DUYQ 2IBKA 1QUQB 3KJOA 2E74C 2I46A 3S9WA 3CC2A 4JI5H 4LUOA 4EX5A 1EFWA 2KOLA 5G3LD 3SE0A 5GAHC 3GV7B 2JEGA 2XWBB 1JDBB 5I2YA 3ULPA 3J80W 1BVSA 4ME5A 1IBLL 2N3SA 1KJ8A 4JV0A 3GDEA 2Z8LA 4N9PA 1RJQA 3MFGA 3VA5A 3Q0AA 4ED3A 1HNXH 3K58A 4CDCC 4LF4Q 3BDCA 4XT1B 2FP4B 2W8LA 2XCLA 1WR2A 4ECXA 4C2MB 3MXUA 4Q5VA 2I80A 1HNWH 4DV0Q 5KFXA 1H9SA 4DV7Q 5DAUA 1N9WA 1BBUA 2I5HA 2F0QA 5DLGA 1RCVD 4DV7L 1W6KA 5CR3A 1QUQA 2F0UA 4DV0L 2Z6BA 4RWSC 2JYOA 3WWVA 1K0SA 2ZDHA 2UXDH 3H4DA 2EXDA 4IUTA 4LFAL 2K14A 4A3FG 3JRXA 1XNQL 4R4IA 1O7ZA 3K5MA 1CI3M 1MZBA 1FYCA 4DAYB 1WYDA 4IPDA 3RTXA 3ZJYC 2RSNA 2KA7A 2VY3A 2C9OA 1F2MA 2VPQA 3BZCA 4IZ8A 4K8JA 1XMOL 2ES2A 1XMOH 1Q1BA 1IBKQ 1G6PA 2K05A 5KFDA 1CZWA 1O7YA 4OL7A 3TIIA 4ED1A 3DF7A 4DR3H 2UXBQ 3KF8A 5CV4A 5KFCA 3VPDA 1YBYA 3OWFA 3CCRA 1Z6HA 3TZDA 4IRCA 4KJNA 4TVAB 1Q7YC 2C2RA 2CKZB 2XN9C 1D1IA 1X65A 1FL0A 3BJUA 3AB9A 1HNZQ 2NVQB 3DM1A 4A3CG 1EU3A 1NSNS 3GTQH 3G8CA 3M3YB 4G4KA 3Q8PB 3T1HH 3T1HL 3TQTA 1J6QA 4IN3A 2EIFA 3R8BA 1YHQA 2PPBC 4B3RQ 4OWTB 3MJFA 1SNQA 1PLFA 1HZBA 1VQJA 1YVCA 4HJ7A 5KG1A 1IYUA 3RIZA 1S68A 2CWPA 2FB9A 1LTSD 3A7AB 1QVFA 4X3SA 2NBFA 1YJNA 5JPNC 1Y14B 1VQ8A 1TKWB 4LF6L 2CW0D 4IFDH 1V4YA 2NVXH 1XX8A 4HR7B 3Q24A 1N56A 1MKHA 4KHZA 1FNWA 3MWMA 4IWYA 4M9UA 5FLMH 4DLKA 2D5DA 1B3AA 4YAJB 4EEQA 1Y8OB 5CV6A 1SYXB 3CMAA 1HZ9A 1PHJA 3PO3B 4DV3Q 1JIHA 2MP1A 3OUUA 2EJGC 2IL8A 4L5QA 2AHOB 2F3WA 2EYHA 1PZKD 2Y0SB 5DNFA 3MFHA 4JI8Q 2DIKA 2JA9A 4A3EB 3G6XA 4JV1A 1LUZA 2QEXA 4OHJA 3H15A 5KFWA 2CQOA 1OTCA 2FINB 2Q2TA 1C0AA 2YRXA 2N88A 2RDIA 2RA4A 5FK9C 4DK0A 1K9MC 4JI7Q 2F3VA 3A7LA 2PQEA 4B3SL 5C44H 4QIWA 4ULLA 5GONF 1KXLA 4J9MA 1HZCA 1S5BD 5C8YF 3R3OA 3K81C 5C4XG 4CHTB 2E5LQ 2PQAA 4OXPA 1Y69U 4EFEA 3NUCA 1L1OC 1SNCA 3ERSX 1MBYA 2ALYB 5L1IA 1JJCB 4LK1C 4IUVA 1IBMQ 4BWGB 5JEAG 4ZQIA 3B6YA 1HR0Q 4A93G 2KQ3A 4V190 2Y0SE 3DMUA 4DV3L 1GVPA 1SROA 3QG1A 3I3CA 4DNRB 5KYLA 4R4OA 1B33N 3JSLA 3GTLA 1PH4A 5KG4A 3CD6A 5CV7A 3NP8A 3J7ZC 1Q86C 2EQSA 2HT1A 5BPFA 2JEFA 4O2DA 5DM63 5EKIA 1QILA 4FVMA 1HNZL 4ED7A 4U68A 1LTID 4UCRA 3KF8B 3MXNA 3GTMH 3S17H 2VB3X 4G7HC 2X0SA 4Q45A 2W9BB 1PVOA 4P75A 4A3JG 1L2ZA 4X62L 4X62H 1O80A 1S03G 3TP6A 1VQBA 1QWYA 3KAKA 4O0AA 4IHJF 3VPCA 4JBWA 5IWAQ 2RCFA 3LWBA 4KD3A 2Z4IA 3DXJC 4RGNA 4XYQA 2Z0SA 5KFLA 4A3MH 2OQKA 1EIHA 3PO2B 5LMUH 2I5MX 3IRBA 1DOMA 3BDOA 1SNDA 2ZXPA 2GPWA 2AGQA 5C4HA 3M9NB 1M6VA 3J81c 4DV3H 2QW7A 1IW7D 4KV6A 3LWUA 1PDQA 3ERQA 2K52A 1I94L 1PFSA 3RBEA 3KLSA 1BBXC 5KKNB 2D2CC 2PI2E 3TSSA 2WACA 2NVTB 2I0QA 1TWFA 1SE8A 4O4HF 2RVLA 2B2WA 1YNXA 3BAAA 2ID0A 1B53A 1JX4A 1NR2A 1SJED 1VKZA 5M5YH 2EYOA 2Q8IB 5KIXA 1RODA 3PF4A 4X66H 5M5YB 2F3IA 2VUGA 2ATLA 2JN4A 4DL4A 1TWCB 1CM9A 3GIDA 1VQHA 5D8DA 1I50A 1D5ZC 5IYZF 2TSSA 1RJRA 3RF2A 1J9OA 2R87A 5KT6A 1EUCB 1S10A 3DUZA 4JYAL 3GTQA 5DQHA 1DZ1A 2CHBD 1VS0A 2MGSA 4F4WA 1HNZH 2FLPA 2MFIA 5T14A 4DR4L 1T36A 4DGZA 1I6HH 1EWCA 1B44D 2C35B 2V4QA 3KUPA 4DU9A 4EGVA 5C44B 1AZQA 1ESRA 4JPBW 3RNUA 1I94Q 4DR1L 3PGZA 3NWTA 2KENA 3EVQA 5FOBB 2R86A 3W1GA 4DFAA 2DNEA 4HIDA 2NN6G 1NJIC 1EZ6A 1GSAA 2SEBD 2R8KA 3H6MA 3AMUA 2K28A 3J81i 4KKSA 4GZYC 1VQLA 1DV2A 2ALZA 3AYHB 2A6HC 2YYAA 1KTKA 5IYCH 3VDYA 1FD7D 3HOWB 3SVMA 4M7EA 4JI2L 4IFDG 3TS2A 1JWUD 5I2XA 1UC8A 3U58A 2JXMB 3C1FA 4DR7L 4DR7H 3HOWG 2JQOA 3V6JA 3S17B 1B9MA 2W70A 4DR7Q 1R9TH 2QYZA 2GPSA 2WIIB 1TR5A 1F2YA 3RV4A 1E7ZA 2HHHL 2V59A 5J2UF 1HPCA 2IPKD 3TBIB 3S2DH 2ZTEA 4LWCA 1B2TA 1JE4A 5M3MH 1CT1D 4AYBB 4WJ4A 3RMHA 3V05A 1BBWA 4Y7NB 1K83B 4H44C 2JA5G 1YZ6A 1L1OB 2IX0A 4BXXG 1RK5A 5FPOA 3K5OA 3H0GA 4YJ3F 5H1SE 3OTOQ 2O03A 2E5LL 1VQOA 5LL6X 2MPMA 3CHBD 4E4TA 4LFCL 4DV2L 4XYMB 1JOOA 3OYYA 4ALPA 4LF5L 4ZUJA 2WINB 5J3BA 2NU9B 4B3SQ 4IWXA 1CHPD 4QWDA 2Z1CA 1RIPA 3TP5A 5CBAE 2K6AA 4YWLA 4K0KQ 3KALA 3G71A 3QFFA 3I4LA 4XQQA 3K5LA 5FLXE 3OHBA 2W9CB 4GC6A 4EFBA 2L0CA 4JI1L 2K50A 3EYYA 4XXEA 3NWSA 2BR0A 1G2TA 2A19A 3RUPA 3SK6A 3MR3A 2QKIC 3OHXC 4ZK9B 5FLMG 3CW2C 2RDGA 3GIMA 1YNND 3A55A 2XD4A 4B3TL 3ITPA 5E1FA 1JOKA 2K5NA 2HVQA 1BXRA 1X3QA 4H0LC 4Q8EA 2R7FA 4A3IG 4DNIA 2KSWA 1RD9D 2DY8A 2GVBA 2KCNA 4Q8FA 2UU9Q 1VQNA 1B4OA 1KD1C 1V1QA 2K03A 1Y8NB 3F2CA 1N36H 1HNXL 3ULLA 3N43B 1A15A 5KNDA 1EQRA 2AQ1B 4F88A 4UCUA 4X64L 3FKIA 1UE6A 4MV4A 1LTRD 5KFRA 3V4SA 3CCMA 4HNUA 3I91A 1XPRA 1GO3E 2BH8A 3MHBA 4FF1A 5F2DA 3GTGH 2FXQA 3MAQA 4A3LH 3GTPA 3JRWA 3GTJA 3ICEA 4NMZA 3LNNA 4RG1A 1KRTA 1T94A 1LO5D 3GV3A 4FF4A 5HV6A 4K2KA 4QUCA 3PIOA 4HSPA 3JC66 3RB3A 5LMNH 4JV5L 2YU9B 1IKMA 3M4IA 1S0MA 4MTKA 5KGUA 3M4OB 1DIKA 1PRTC 2NVXA 2AUKA 2XGPA 4IUPA 2OF1A 4JI1H 1S4ZA 3RV3A 5LYJF 4GNXB 3Q8DA 2K5HA 2O2LD 2V58A 1N33L 1R9TA 5IT9W 2Q8TA 3HKZE 3GV8B 1SJHD 4GKKH 2EYMA 5J39A 1EUDB 3QZ8A 2W57A 1IHZA 2XGQA 1RL2A 3V6HA 1M90C 3TZUA 5DGBA 3BABA 4EG0A 2KJXA 2Z6KA 2UUCQ 4R8UA 1WTQA 3GLKA 1U0LA 5JAVA 3CMEA 5BR8H 5K36H 5DG9A 1SEIA 2C28A 3I4MG 1Q81C 3J80c 2AKWB 2A6ED 4C3IG 1JB3A 1TQOA 4UP7A 4LF8L 4WBNF 4IOCA 4F4XA 2E5LH 4HJ5A 2VS1A 1A9XA 2YTVA 5LL6b 5G3LF 2ZXOA 5M5XB 2Q2IA 2V4DA 4JYAQ 5JJIA 5L9XA 1SYCA 4LUVA 1BXTA 2YW2A 2GVAA 4KJOA 3VYUA 1JWSD 1WTOA 2V5AA 1RYSA 2RDJA 4JVZA 4DNTB 3M9OB 1HR0W 4A3KG 4KMUC 1PH1A 3R23A 3HOUG 1OO9B 2B2VA 3K7UC 2W6OA 1PXUA 3SI8A 1ENCA 4ZAIA 4GOPC 2E2HB 4KHVA 1VQ4A 3KF6B 2YZMA 4A3FB 2AWOA 2WE6A 5K2MA 2B29A 3VR4A 5C1PA 4DK6C 3HOUB 4FBUA 4EBCA 1SYBA 2XRSD 2X69A 4DV5L 1YJWA 1M0WA 4DV5H 2DPJA 3PZPA 2JK8A 3NTKA 1VAJA 4IO9A 2RGRA 3AEVA 1PZJD 3S2DB 5ELEA 3HOYB 4PDBA 3F8NA 3TMEA 2QDBA 1PTOC 2A69C 4DV6Q 4BA1I 2XTIA 1A0IA 3I8ZA 4IUNA 3A5ZB 2NUCA 3EPGA 3HOYG 5CAEB 3AQQA 3FEWX 1VF7A 1L0XB 2XRQD 2YTXA 1GUNA 3CCUA 4TRDA 1CQJB 4C3IB 3RB0A 3A0JA 3KYHC 3C0FB 2PW5A 4B3RH 5IWAH 4RB1A 5KNCA 3PUZA 1I3QA 2F0NA 1YNJD 2R7LA 3F2BA 2BDNA 3G7LA 3RFCA 2A73B 2HHHQ 1FGUA 3K57A 3RGXA 5GQOA 1GUTA 1Q3LA 4ODGA 3Q2OA 1EQTA 4R7RA 3VYSA 2YU9A 1E1TA 3N8DA 4BWSC 3J81E 1AN8A 1K1QA 3RUZA 2K32A 2UUCH 1G8ZD 1STHA 3S1QH 3I4NH 4Y7NH 4H13C 1XPOA 3T5HA 4ECSA 3UFXB 3D0FA 4MZ9A 4YCUA 4AQYQ 1T5XD 3R5XA 5L1KA 3IN5A 1ZQ7A 1I7NA 3A8KE 1I50H 2W6ZA 4JI3Q 4LSXA 3GIJA 1VQCA 2B8FA 2Y0SA 2YRWA 1SSOA 3JSNA 5IYDG 4J9RA 1EQQA 2JA8B 4KKTA 5IP7H 4WORA 1Z2OX 2FK3A 3QOJA 4KY6A 4JOIA 1VDZA 1KAWA 2UVUA 2NN6H 2O5IC 4JI7H 5T1IA 1Q82C 1PH6A 3MVVA 5KG6A 3MXGA 4GS3A 2CH4A 1ZHQA 3P1HA 4RFBA 4XT3B 2F03A 5KNBA 4B9WA 3CCQA 5EPKA 2VUMH 3NBHB 1LT3D 4EYIB 5JH7F 2GA4B 4ME6A 4O42A 2O4XA 3V6KA 3PW5A 4R9WA 3IFDA 3J7AK 4KHPH 3UDXA 2PNHA 5KFVA 3VPBA 3I4MB 3N6XA 1FNUA 4ILWA 1AE3A 4Y52H 3RLOA 4LF9L 3PIP3 5J1ZA 2F0EA 2WFWA 4PQXA 5KEEA 4PZ6A 1EYAA 4DAPA 2IA6A 1H9JA 4UHVA 4K8IA 1EWIA 2R61A 2ZDGA 1STYA 2FLLA 2J0TD 1GXDC 4J9OA 4DR6Q 1F77A 2EPBA 4MTNA 2AU0A 1G91A 4LF6Q 4YJ2F 5J22A 3HBLA 4ZLTF 2CH4W 4ZKCB 1EIFA 3S1NB 4PMBA 4I50F 5JUMA 3G6VA 2JA5A 1QNUA 4GN5A 5T1GA 1PV4A 3MR6A 2PBZA 2AGPA 2BQ3A 4NXMQ 4BA2I 3VR3A 5M3MG 3HZXA 2CZGA 1TWHH 3TS0A 2Z6KC 1HJPA 4KY5A 2XCPA 2AQ4A 1GD7A 4KHPL 1YNNC 1TWGH 3I72A 3HOVH 4IUUA 4K14A 3MEFA 3RB6A 4X65H 2HIXA 2E2JH 4K0KH 5KG3A 2Y0SG 4FS1A 5IWAL 3NQTA 3BYTB 1XPUA 4OO1H 3ETHA 4A3EG 2K5QA 2OEOA 4O1NA 1VBGA 5KFKA 4HSVA 1P16A 2B2TC 5HGTA 3RN5A 5KT4A 4NPSA 4IALA 2VUMG 3GV5B 5DGAA 1RYRA 2NZHA 1MJCA 3T1YH 2PNRC 3OTOH 1A3TA 4DL2A 1ASZA 1M8AA 2QF7A 4ED8A 1J5EL 2E2HA 2DN8A 2JEJA 5HGQA 3RZOB 2N55A 3BJYA 3D6CA 4QIWE 4YHHL 4DR5Q 1NTGA 4XDXA 1BF4A 5F9LA 2OCEA 3KBGA 5AFWA 1C8CA 2VUMA 1BO0A 5E4XA 4LF9Q 2ZT9C 4ECRA 4RKLA 1UNSA 4B08A 2UXCH 1C4QA 1XNQQ 3GTLH 2IWHA 3VR6A 2E2JB 2Q2HA 4IPHA 4IFDI 3RLFA 4RAZA 2A8VA 4DF7A 1N34H 1CQVA 4GNXC 2PN1A 3QIAA 1TT2A 1HQMC 4AIMA 3S1MH 2A74C 1WTRA 4RNOA 3GO5A 1KLGD 3FKIH 5D3IB 2M05A 1M1KC 3Q8SB 3PO2H 1KRSA 3RAQA 2XCAA 4RNNA 2IX3A 5FD5A 5LMNQ 5IP9H 5CB4F 4DR3L 1KJ9A 3OWEB 3M3YH 1XNRH 3L7ZC 3SHLA 2JA8G 4C3IH 1XMQL 1XMQH 5C5JA 1D8LA 1RHPA 1Y1WA 3HB9A 1V1OA 2HD3A 4JI8L 2W9AA 1IXRA 3J7A5 5AJ3Q 2ASJA 4OELB 5C5LA 4PZ7A 2WV6D 2OTLA 4A2BA 2A6HD 2J6UA 4RCOA 1SCUB 2YYZA 1TWFH 3FMAA 3G6YA 3MWYW 3TEHB 3K7AH 3T1YL 2F0FA 1Y1VB 5KFAA 1X6OA 3TN2A 2VQFL 3RJ0A 1S0NA 5I4DA 1PFMA 1VQMA 2VQEL 1PFNA 1IL2A 4J9KA 2UVWA 3GIKA 2J9GA 1G6ZA 1KIXA 2R92G 4XIGS 1PRTF 4OX9L 3KFUA 1PRTD 3PW4A 1GHJA 1EIYB 1VQAA 5LMUL 5FPRA 1GUOA 2F0OA 4JI4H 3MFYA 5CBEE 4LSAA 3TQ1A 3H09A 4JV2A 4JI6L 1WFQA 4LFBH 5EKLA 4X66Q 5KG2A 1GLVA 5KT3A 2NUAB 4IJHA 1I50B 2N8NA 4NDXA 1QJOA 1NY4A 2KEEA 1R4PB 1CHQD 2X6GA 5EPLA 5KFSA 4IR1A 1UE7A 2W9BA 3D8GA 4ZCKA 4OGQC 4K5XA 4B3SH 1UUPA 1RF2D 3I7FA 3S2HH 1XNRL 3I4MH 3TREA 1K8AC 1RDPD 3RAXA 2VQFH 1OXUA 2VA2A 5JJKA 3L0OA 2L5TA 5FJ8G 2K1BA 1LT6D 3M4YA 5HURA 2DJGC 2E2HH 3I4NG 2VUMB 1D6EC 2E2IB 5ISRA 5H80A 1IW7C 2VXWA 4UPAA 1XYIA 4UCSA 1G51A 2C2EA 3J80i 5HY6A 5JJZA 4Q43A 4KN4C 1VQIA 2MO0A 4QB4A 1WOCA 2NTTA 4A76A 4QY7A 2R92B 4B9XA 1J8IA 1U4MA 1KLUD 4L6TB 4O3OA 4ECVA 2DLNA 3A5UA 1NR4A 2DPIA 3OIQA 1BDOA 2JEIA 5M3FG 4A3DH 4GOPB 3KF6A 4WD3A 1K83A 1Y1WG 1ZXTA 2QK4A 2UXCQ 5M3FH 1KDCA 1Q1EA 1TWAH 3I2ZA 3PW7A 1OXTA 4N8X1 3OOCA 5FO9B 5M3FB 4C5CA 2AGOA 1IBMH 3IAYA 4AH6A 5L37A 3RZDB 2B2VC 3DM3A 2RDFA 3QJYA 2FK2A 1EEID 1G291 5CA0F 1ESFA 3LMLA 3C1EA 4I65A 3BQ0A 2AMCB 5FO8B 1U5KA 1K3RA 3PR5B 4NXNL 1EZ1A 2W7PA 4RGTA 1QVCA 4A3KB 2WDTA 4XX0B 1GGOA 1ZEQX 4UP8A 4EQOA 4X64H 4UFZA 2FPPB 5IGFA 2R3ZA 3HFZB 3IKJA 1V1PA 3V96A 3RD4A 3CAMA 4DK3C 1TWGA 3A8IE 2KECA 2Z4HA 4JI0H 1N33Q 2FK1A 2WKDA 1D1KA 1GUGA 1D5XC 2K4KA 2PMZA 4LF7Q 3LP8A 4A3CH 2NVYH 2M9VA 2RF4A 4FO2A 4CDDC 3TIGA 3EROA 5IYCG 5BN3A 3EBEA 4U7CA 3JAMW 4B3TH 1LM0A 1C48A 1UNNC 3KDFA 1FNVA 1WCMH 1CSQA 3FKIB 4A3BG 1DXMA 2OTJA 4MIUA 3UI2A 1Y1WB 1A2UA 1IBML 1W3SA 3V2TA 4HAEA 4ETSA 5C6AA 4A3IH 4A3FH 2WAQA 3TRZA 1KQSA 3Q8RB 4DR6H 2C00A 4DR6L 1K1SA 4ME3A 1Z2NX 4HCEA 3P7JA 1L0YB 4A3IB 1KHIA 2B8GA 1NAPA 1N36L 4RZRA 3E6ZX 2R92H 3MWDA 1OXSC 1R4QB 3BZKA 3KDFB 1I4QA 1XDNA 2OXPA 2HCIA 2K01A 2F0PA 3NENA 2EJMA 4HIMA 3OPOA 3ND8A 5JEAJ 4HQ6A 1EYZA 2E2IA 4GKJL 2F0HA 2CQYA 2FJZA 5J2TF 2CQAA 4ZI7F 4DUZL 2KBNA 1ILPA 2E8GA 3LWEA 1QZGA 5M5WB 2EYPA 2W71A 5FJ8H 2QILA 3H0GH 2AQ2B 1YHAA 3MEHA 3UDIA 4DR3Q 1ZYRC 2UXBH 1I3QH 3SEBA 5IE8A 3PSIA 3F8TA 3IL8A 4K6DA 1IBKH 2FMMA 4JI2H 2ZTCA 2F0WA 4C3JG 3JAMi 1SRUA 5CV9A 1BNZA 2UVRA 1Y1VH 3F1ZA 4QF4A 2Q2UA 1LTBD 2D0PA 4R4QA 5I47A 1VQEA 1WTPA 2J7ZA 3PO3G 4PMCA 1HCZA 1CFMA 1ET6A 1C30A 1EY7A 4ECWA 1I5FA 3T5LA 1C9OA 3KLSX 2J4XA 1AW7A 1DM0B 4C1NK 2F4IA 1YEZA 2L15A 4ABNA 3M7GA 2K5VA 3R5FA 2F0VA 4WRDA 3OMCA 4DV0H 1H9RA 2HIVA 4PNYA 1X9NA 3BG3A 3PIPA 5FLXc 2A1AA 5C3EG 3GTLB 4L5TA 3FPUB 4BBRH 1F2ZA 3K0YA 4P73A 3D6WA 4UP9A 1F9RA 1EHIA 4EGQA 1TU2B 2BCOA 2NVYA 1IYVA 3T51B 2MJ8A 4DUZH 4F4ZA 3A8JE 1TS3A 2HJWA 4MV8A 2UUAH 4RUCA 1IZ6A 4R1JA 3JAMc 3EIVA 2P5ZX 1I4HA 5JVG3 4ECYA 2EJFC 1SE2A 4DAVA 1MJEA 2BQRA 2F0DA 2R92A 4RAUC 3OW2A 5A2QW 3T53B 4DUYH 4F87A 5IP9G 3QO2A 5GROA 4AYBE 4A3GG 1CKOA 2D9UA 1D2BA 3BA8A 3FKIG 1SR3A 5A35A 4ED0A 4H7BA 1KAAA 3T4AC 1EYDA 2FJ2A 4XTCS 4HN7A 3HOZG 1JE5A 2RHSB 1Z9FA 2WAQG 3NE5B 1LLRD 1K8GA 5IY0A 1VQ5A 3MA2B 4QWAA 1EQVA 3HOWH 1SYDA 3BDLA 1AUXA 4PG3A 1DOKA 1I6VC 2DGYA 3HKZB 4J9SA 1UWVA 4JBMA 2NU6B 3MWEA 3BQ1A 1K8OA 2RKSA 4NKLA 3K7AB 1LACA 2OT2A 1I6UA 3F2DA 3QB3A 1F2LA 5KFFA 5JVLA 4A4IA 3CXCA 3M7NA 2EYFA 2K7VA 5ELBA 3T56B 3X3NA 4DUYL 4G7ZC 1KJQA 1S3OA 4BS9A 2IHEA 3SE7A 4DL5A 1H9MA 3RLNA 1QVGA 4LF4L 3E0JA 2JEAI 2IP4A 2EY1A 4QL5A 2UUBL 3RBDA 3H3VC 1CTMA 2DUDA 1IBLQ 2D62A 1CA5A 1P8LA 5DM73 3DEOA 3J7AF 3GTKB 2ZM6H 1ENFA 2ZM6L 2RBMA 5D1OA 2KCTA 1YI2A 3S15H 3KHLA 3SK8A 1WD0A 2IT1A 1L2FA 2FPIB 3BVMA 4ZQ3A 3S15B 2UXDQ 3D4WA 2E2DC 4MN3A 3ORRA 5BR8L 1HA6A 3D4DA 2VA3A 4K5VA 4UDUC 4J15A 4YR2A 1SYEA 1VMCA 3HKZG 1GUSA 3NK9A 4EQ5A 1HNWQ 2B2WC 4DR2H 1FKAH 3GTGA 4BBRB 1VQ9A 1M4VA 5KFPA 5I6WA 3QWNA 2HVSA 2YZNA 4Q0YA 2RCNA 2FPGB 4A3GH 1SNOA 2NWGA 4NB3A 5KFZA 1S9FA 3CQZA 3HGBA 4DV4L 5DQIA 3AFPA 4LF4H 5C4XH 3H94A 1QG7A 1HNXQ 1X55A 4DKAC 1S40A 2F4VH 1JDEA 3NEMA 5C3EH 5EBCA 1HXYD 4C3HG 4DV1H 2PQAB 1EEFD 2JJQA 5ELCA 1B8AA 4A3MB 4YHHH 4EGJA 4YY3Q 1PX2A 1LTTD 3W1BA 1AEXA 2VZAA 1TWAB 1IOVA 3HRZC 5IGBA 2K5DA 1SLJA 3FDSA 3D31A 1ASYA 2HVRA 3OUZA 3Q6SA 1BCPF 4HMIA 3C46A 1UEBA 1TWCH 1SBBB 3K0XA 2P0AA 2R8GA 1CK1A 2XWJB 2AWNA 5IGGA 3EQLC 3RGZA 1WD1A 2SDFA 2EY6A 2WYOA 4JUZA 1Q46A 5F9NA 4DR4H 2F0JA 2PCFB 1PH9A 2BDOA 2VQDA 2RHQB 4WJ3M 2F0LA 3P75A 5CYUA 4MV3A 1F9QA 1WTWA 1TVXA 3S1QB 4DV4H 4GLXA 1TXYA 1Y1VA 3I4NB 2WAQB 4LFCQ 1BNCA 1HFGA 2WB1G 5LA6F 3GP7A 4YIJA 1VQKA 3OW7A 4YP3A 4CDFC 1CS0A 2ASBA 2LKVA 2XSCA 1WTHA 2O5JC 1J5EH 3PVXA 1AP0A 1EY4A 2F0IA 3STBD 3HOZH 2NVYB 1JOQA 3H20A 1DJRD 3N52A 4XZ3B
chains in the Genus database with same CATH topology
1SROA 2QA4A 2OCEA 1QZHA 4RMFA 4R4OA 4LF9Q 1PH4A 1Q8KA 3CD6A 4YWMA 3J81j 4QGUA 1XNQQ 3J7ZC 1Q86C 4P72A 2EQSA 5DLQE 4B3MQ 2HT1A 2Q2HA 4IPHA 3GTLH 4A3LG 1L0WA 1NMFA 3GD7A 4IFDI 4O2DA 3RLFA 2N49A 4GNXA 2E2IH 2JA5H 1HNZL 2A8VA 1PA6A 4GNXC 5C0XI 3KF8B 2R7DA 1FVIA 1XTDA 3GTMH 2OQ0A 3S17H 4AIMA 4IJLA 1J5EQ 3S1MH 3GO5A 1PVOA 4P75A 3CP0A 4A3JG 1Y1WH 3HOYH 4X62L 3PF5A 2QGQA 4X65L 3FKIH 3M4QA 2IX1A 1JJGA 1M1KC 3PO2H 1KRSA 1N8RC 1VQBA 3CCEA 4JC0A 5LMNQ 4O0AA 5IP9H 4DR3L 3U4ZA 4JBWA 1NMGA 5IWAQ 3M3YH 3L7ZC 2JA8G 4C3IH 1XMQL 1K73C 2R7ZG 2Z0SA 3OTOL 3H3VH 1D8LA 4A3MH 2OQKA 3S16H 2NZOA 3UDGA 1FJGL 2V1CC 2I5MX 3IRBA 4A3BH 3CF5A 1WCMG 4JI8L 3W5OA 2UUBQ 4BY1G 1IXRA 1Q12A 2KCMA 3J7A5 5E7NA 4GKJQ 5AJ3Q 4BBSG 3PCOB 4PZ7A 3J81c 5EAYA 4DV6L 4DR2L 2OTLA 4GOPA 2JE6I 3PUWA 2K52A 2YU9H 1I94L 1PFSA 4NXML 1K83H 2ZJQA 2PI2E 2B63H 2YYZA 1TWFH 4K0KL 2I0QA 1SE8A 2UUAQ 3TEHB 1YNXA 3K7AH 2ID0A 5M5WH 1JMCA 3KLWA 3T1YL 1X6OA 5M5YH 2VQFL 1VQMA 2VQEL 2N78A 3PF4A 2F3IA 5IT9c 2YTYA 1IL2A 2F52A 2KHIA 3M4OH 1KL9A 1Y1VG 4JI3L 1VQHA 4PZ8A 4C3HH 3HOXH 4C2MH 1KIXA 2R92G 3S14H 3PUYA 4XIGS 4C3JH 1E3PA 4OX9L 3KFUA 2UXCL 4KLKA 1EIYB 1VQAA 4LFAQ 4OWXB 5LMUL 4JYAL 2R93H 4JI6L 1WFQA 4X66Q 4UY8C 4TQUS 1VS0A 1N34L 4IJHA 2ATWA 2MFIA 1CSPA 4FDBA 2N8NA 4DR4L 1NY4A 4JI0Q 1VQ7A 1CKNB 4A3DG 4HJ8A 1I6HH 3CPWA 1VQPA 5BR8Q 4P74A 2H5XA 2C35B 1C7YA 1UE7A 4L5RC 1VQFA 3HOVG 4LUZA 3H3VI 2BH2A 3BU2A 2VW9A 3I7FA 3K80C 3RNUA 3I4OA 4DV2Q 4DR1L 3PGZA 1I94Q 3TREA 1XNRL 3KOJA 2KENA 3M9BA 1K8AC 1XMOQ 4OWWB 3W1GA 3CCVA 1OXUA 4HIDA 5JJKA 3L0OA 4GLVB 2NN6G 5AJ3L 2ZTDA 3UE1A 5FJ8G 3I55A 3KJPA 1NJIC 4X66L 2JA6H 2LXKA 4GN3B 2E2HH 3I4NG 5LMUQ 3J81i 1VQDA 1FJGQ 1VQLA 1H95A 3AYHB 1VCIA 4UPAA 1JJ2A 2BA0A 1G51A 3J80i 1PYBA 5IYCH 5HY6A 4AQYL 4NXNQ 3VDYA 3SGIA 1MIUA 1VQIA 2MO0A 1WOCA 3EN2A 4JI2L 4IFDG 3TS2A 4A76A 4QY7A 1PH3A 3U58A 4DR7L 3E9HA 2IY5B 3HOWG 2JQOA 3PUXA 5ELNA 3A5UA 1KC8C 4DR7Q 1R9TH 1W2BA 1A63A 4HIOA 4JI6Q 1E7ZA 2KHJA 5M3FG 2HHHL 4A3DH 4GOPB 3KF6A 4GKKL 4A3JH 2MO1A 2ZTEA 1Y1WG 3S2DH 4LWCA 2UXCQ 2LXJA 1D7QA 4JBJA 5M3FH 3RR5A 5M3MH 4L5SA 1Q1EA 1TWAH 3RN2A 1PH8A 4WJ4A 2BA1A 3I2ZA 1BBWA 1OXTA 2ZJRA 2JA5G 1YZ6A 1L1OB 3CCSA 4OO1I 2IX0A 3E0EA 3GTOH 3G48A 4BXXG 2PI2A 4AH6A 1N36Q 1JT8A 1X3FA 3DM3A 4IPCA 1G291 3CCJA 3PV0A 5H1SE 2AMCB 3OTOQ 1U5KA 1VQOA 2E5LL 1K3RA 4LW1A 4LFCL 4NXNL 4DV2L 4DR1Q 4A93H 3GTJH 1QVCA 3OYYA 4ALPA 4LF5L 5J3BA 5LMNL 3STBC 3CQZH 4UP8A 4B3SQ 1E24A 1RIPA 4DV5Q 3CC7A 4YWLA 4K0KQ 4JI5Q 3G71A 5IYDH 1LTLA 3HFZB 4GLAC 3CAMA 1CUKA 4JI1L 4DK3C 4JI0L 1NBWA 1V43A 4DUZQ 2K50A 1N33Q 3PUVA 1AH9A 2K4KA 4LF7Q 1UE1A 4A3CH 2A19A 2NVYH 4LF7L 2RF4A 3RZOH 5FLMG 1GM5A 1YJ9A 4HIKA 3CW2C 3E9IA 5IYCG 4IOAA 1A62A 3EBEA 4OX9Q 5C4JH 4B3TL 3UE0A 1LM0A 2K5NA 4JG2A 4POGA 3KDFA 4BXXH 1WCMH 1CSQA 2K75A 2R7FA 4GN4B 4YCWA 4X64Q 4A3BG 2OTJA 4YY3L 4A3IG 1HR0L 4DNIA 1E22A 2WB1E 2GVBA 1IBML 1CKMA 1W3SA 4JI4L 4LFBL 2UU9Q 1VQNA 1WI5A 1KD1C 3UDFA 1V1QA 4AYBG 1CKNA 4A3IH 4A3FH 2JA8H 3TRZA 5JJLA 1KQSA 1O7IA 2VQEQ 5GAEC 4DR6L 2R93G 4ME3A 3I4MH 5LMNW 3F2CA 1NE3A 3PO2G 1KHIA 2F4VQ 1EOVA 1DGSA 1N36L 1HNXL 2NN6I 3ULLA 4HJ9A 4LF5Q 2R92H 1EQRA 1OXSC 4YCVA 4X64L 3BZKA 1UE6A 2JA7H 3KDFB 3CCMA 1XPRA 1GO3E 2BH8A 3T1HQ 2CWAA 4YWKA 4GKKQ 3NENA 4BY7H 3GTGH 2FXQA 4HIMA 5JEAJ 4A3LH 4GKJL 5ELOA 4BBRG 4LNQA 1BKBA 3ICEA 2LSSA 2GN5A 4DUZL 2KBNA 1PH5A 1PH7A 1K0RA 2E8GA 4JI1Q 4RG1A 1KRTA 1QZGA 5GADC 3DLLA 2HQLA 1XMQQ 2UU9L 5FJ8H 2JA6G 4JI5L 2UXDL 3H0GH 4JI2Q 1YHAA 1SN8A 1VQGA 3UDIA 2R6GA 3PIOA 4DR3Q 3JC66 4A75A 1I3QH 1YITA 5IE8A 4JV5L 3PSIA 3F8TA 3FHWA 2ZTCA 3ER0A 1T9HA 1L1OA 3S1NH 3JAMi 1E1OA 2VNUD 1SRUA 5K36G 4POFA 4A3MG 1OXVA 1Y1VH 3F1ZA 3LGJA 2JA7G 4GNXB 3Q8DA 2K5HA 2Q2UA 1EUJA 2D0PA 4R4QA 1N33L 3PO3H 1S72A 1SFOH 1VQEA 3HKZE 1EYGA 1V9PA 2WP8J 3PO3G 3M85A 1RL2A 5C0XG 1M90C 4JBKA 4BY1H 1N32L 1I5FA 1XJVA 3K8AA 1C9OA 2Z6KA 2UUCQ 4JOIC 1U0LA 3CMEA 5C44G 2D0OA 3CPFA 3GTKH 3I4MG 1Q81C 3J80c 2AKWB 1YEZA 1VQ6A 2IHFA 2L15A 2R7ZH 2ZJPA 2NVQH 2K5VA 4UP7A 4PMWA 1AE2A 4LF8L 4IOCA 4HJ5A 2VS1A 2YTVA 2HIVA 3NELA 4JI4Q 4LFBQ 5C0XJ 1X9NA 3HOZG 2Q2IA 2PMZE 4JYAQ 5JJIA 3PIPA 4LUVA 5FLXc 2A1AA 4DV4Q 2GVAA 5C3EG 1IBKL 4B3RL 4L5TA 4B3TQ 5M5XH 1HR0W 4A3KG 4BBRH 1PH1A 4P73A 4H02A 2JEBI 4UP9A 1YIJA 3HOUG 3K7UC 3I56A 1UE5A 4GOPC 1X54A 1VQ4A 3KF6B 4P71A 2AWOA 3HOXG 2WAQE 2B29A 4DUYQ 4DK6C 1QUQB 3KJOA 1IZ6A 4R1JA 3JAMc 3EIVA 4DV5L 1YJWA 2UUAL 3CC2A 1HH2P 2JK8A 4LUOA 4EX5A 4IO9A 1EFWA 1MJEA 3AEVA 5GAHC 4MNOA 3OW2A 5IP9G 3ULPA 4DV6Q 5GROA 1BVSA 2XTIA 4AYBE 1A0IA 1CKOA 4BA1I 4DV1Q 4A3GG 3FKIG 2N3SA 1IBLL 2I5LX 1SR3A 3GDEA 3A5ZB 1PYSB 3HOYG 3L2PA 3AQQA 2YTXA 4XTCS 4LF4Q 1JE5A 2RHSB 1Z9FA 2WAQG 3CCUA 1K8GA 1VQ5A 5IY0A 3A0JA 3KYHC 1A8VA 1XNRQ 3HOWH 2NVTH 3PUZA 3HOUH 3F2BA 4PG3A 2HHHQ 1FGUA 1HNWL 5GQOA 4A3EH 2DGYA 4DV0Q 4OO1G 1UWVA 4X6AH 4JBMA 4DV7Q 1E1TA 1N9WA 1BBUA 2I5HA 1YHBA 3MXNB 4DV7L 4OONA 1N34Q 1QUQA 2CCZA 5IP7G 4DV0L 3GTPH 1Z47A 3WWVA 3S1QH 3F2DA 1N32Q 2EXDA 3I4NH 2UXBL 4Y7NH 1XPOA 4LFAL 2K14A 4A4IA 3CXCA 4B3ML 3M7NA 4A3FG 1XNQL 4R4IA 4BY7G 3D0FA 4MZ9A 4YCUA 1LYLA 4DUYL 4AQYQ 1S3OA 1SMXA 2IHEA 3FP9A 3S1RH 3RLNA 4DAYB 1WYDA 4QQBX 1X3EA 4R4TA 1QVGA 4LF4L 1I50H 4IPDA 4JI3Q 2JEAI 2YV5A 1VQCA 3S24A 3ZJYC 4QL5A 2UUBL 2VY3A 2DUDA 1IBLQ 2D62A 5IYDG 2OWOA 2XGTA 3BZCA 4DV1L 1EQQA 1P8LA 5IP7H 3H0GG 2VQFQ 1PH2A 1XMOL 2ES2A 3T1YQ 2ZM6L 1Q1BA 4JOIA 1WJJA 4QJFA 2KCTA 3HKSA 5GAGC 1YI2A 1IBKQ 3S15H 1G6PA 1KAWA 2MQHA 2IT1A 1L2FA 4DAMA 1B70B 3A74A 1Q82C 1PH6A 4JI7L 4IFDJ 2UXBQ 2CFMA 2UXDQ 4GS3A 4X65Q 1X56A 1YBYA 5BR8L 4LF8Q 3CCRA 3CCQA 4KI0A 4TVAB 1Q7YC 2VUMH 1HZAA 3NBHB 2CKZB 4DR4Q 4J15A 1X65A 1FL0A 3BJUA 1HNZQ 3HKZG 4EQ5A 1HNWQ 3UDXA 4A3CG 2PNHA 1VQ9A 3GTQH 3M4PA 3T1HL 4Y52H 1AE3A 1J6QA 2B3GA 2RCNA 3RLOA 4A3GH 2EIFA 1YHQA 4LF9L 4B3RQ 4NB3A 4OWTB 2WFWA 4DV4L 1HZBA 1VQJA 1YVCA 3AFPA 4PZ6A 4HJ7A 5C4XH 1JB7A 4YHHQ 2CWPA 4DR5L 1HNXQ 1X55A 4DKAC 1S40A 2F4VL 4APVA 1EWIA 2MNAA 1QVFA 3NEMA 5C3EH 1YJNA 4LF6L 1Y14B 1VQ8A 4DR6Q 4MTNA 2NVXH 2PQAB 4LF6Q 3RZDH 3AFQA 1X3GA 2JJQA 1MKHA 4KHZA 1B8AA 1GKHA 1EIFA 5IYBH 2UUCL 4JV5Q 1OXXK 4YY3Q 4GN5A 3W1BA 5FLMH 1PV4A 2VZAA 1B7YB 1SLJA 4NXMQ 3D31A 4A3KH 1ASYA 3G4SA 4BA2I 3CMAA 1HZ9A 1UEBA 3S2HH 1PHJA 5M3MG 1TWCH 3U50C 4DR2Q 4KHPQ 3K0XA 4DV3Q 1TWHH 2B63G 2AWNA 3TS0A 4L5QA 2AHOB 2Z6KC 1HJPA 4JI8Q 1Q46A 2JA9A 1GD7A 4KHPL 1LUZA 1TWGH 2QEXA 3H15A 1PH9A 3TQYA 3HOVH 1IYJB 2CQOA 2RHQB 5IYBG 3MEFA 1OTCA 2Q2TA 4BBSH 1C0AA 4JCVE 4WJ3M 2HIXA 1K9MC 2E2JH 2Y0SG 5IWAL 2VL6A 1XPUA 4R4CA 4JI7Q 4A3EG 4GLXA 5C44H 1TXYA 3CC4A 3U4VA 4B3SL 1KXLA 3RN5A 1P16A 4NPSA 3G6EA 4DPGA 2VUMG 4LFCQ 1HZCA 2NZHA 1MJCA 2WB1G 4IPGA 2ZM6Q 3K81C 4X62Q 1VQKA 5C4XG 2E5LQ 2ASBA 2PQAA 4OXPA 1ASZA 1J5EL 1L1OC 3ERSX 3STBD 2ALYB 3HOZH 5HGQA 4HJAA 1JJCB 3CCLA 1IBMQ 3ULJA 4QIWE 5JEAG 4YHHL 4DR5Q 3B6YA 1HR0Q 4A93G 1NTGA 2Y0SE 4DV3L 1GVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRO A;  2QA4 A;  2OCE A;  1QZH A;  4RMF A;  4R4O A;  4LF9 Q;  1PH4 A;  1Q8K A;  3CD6 A;  4YWM A;  3J81 j;  4QGU A;  1XNQ Q;  3J7Z C;  1Q86 C;  4P72 A;  2EQS A;  5DLQ E;  4B3M Q;  2HT1 A;  2Q2H A;  4IPH A;  3GTL H;  4A3L G;  1L0W A;  1NMF A;  3GD7 A;  4IFD I;  4O2D A;  3RLF A;  2N49 A;  4GNX A;  2E2I H;  2JA5 H;  1HNZ L;  2A8V A;  1PA6 A;  4GNX C;  5C0X I;  3KF8 B;  2R7D A;  1FVI A;  1XTD A;  3GTM H;  2OQ0 A;  3S17 H;  4AIM A;  4IJL A;  1J5E Q;  3S1M H;  3GO5 A;  1PVO A;  4P75 A;  3CP0 A;  4A3J G;  1Y1W H;  3HOY H;  4X62 L;  3PF5 A;  2QGQ A;  4X65 L;  3FKI H;  3M4Q A;  2IX1 A;  1JJG A;  1M1K C;  3PO2 H;  1KRS A;  1N8R C;  1VQB A;  3CCE A;  4JC0 A;  5LMN Q;  4O0A A;  5IP9 H;  4DR3 L;  3U4Z A;  4JBW A;  1NMG A;  5IWA Q;  3M3Y H;  3L7Z C;  2JA8 G;  4C3I H;  1XMQ L;  1K73 C;  2R7Z G;  2Z0S A;  3OTO L;  3H3V H;  1D8L A;  4A3M H;  2OQK A;  3S16 H;  2NZO A;  3UDG A;  1FJG L;  2V1C C;  2I5M X;  3IRB A;  4A3B H;  3CF5 A;  1WCM G;  4JI8 L;  3W5O A;  2UUB Q;  4BY1 G;  1IXR A;  1Q12 A;  2KCM A;  3J7A 5;  5E7N A;  4GKJ Q;  5AJ3 Q;  4BBS G;  3PCO B;  4PZ7 A;  3J81 c;  5EAY A;  4DV6 L;  4DR2 L;  2OTL A;  4GOP A;  2JE6 I;  3PUW A;  2K52 A;  2YU9 H;  1I94 L;  1PFS A;  4NXM L;  1K83 H;  2ZJQ A;  2PI2 E;  2B63 H;  2YYZ A;  1TWF H;  4K0K L;  2I0Q A;  1SE8 A;  2UUA Q;  3TEH B;  1YNX A;  3K7A H;  2ID0 A;  5M5W H;  1JMC A;  3KLW A;  3T1Y L;  1X6O A;  5M5Y H;  2VQF L;  1VQM A;  2VQE L;  2N78 A;  3PF4 A;  2F3I A;  5IT9 c;  2YTY A;  1IL2 A;  2F52 A;  2KHI A;  3M4O H;  1KL9 A;  1Y1V G;  4JI3 L;  1VQH A;  4PZ8 A;  4C3H H;  3HOX H;  4C2M H;  1KIX A;  2R92 G;  3S14 H;  3PUY A;  4XIG S;  4C3J H;  1E3P A;  4OX9 L;  3KFU A;  2UXC L;  4KLK A;  1EIY B;  1VQA A;  4LFA Q;  4OWX B;  5LMU L;  4JYA L;  2R93 H;  4JI6 L;  1WFQ A;  4X66 Q;  4UY8 C;  4TQU S;  1VS0 A;  1N34 L;  4IJH A;  2ATW A;  2MFI A;  1CSP A;  4FDB A;  2N8N A;  4DR4 L;  1NY4 A;  4JI0 Q;  1VQ7 A;  1CKN B;  4A3D G;  4HJ8 A;  1I6H H;  3CPW A;  1VQP A;  5BR8 Q;  4P74 A;  2H5X A;  2C35 B;  1C7Y A;  1UE7 A;  4L5R C;  1VQF A;  3HOV G;  4LUZ A;  3H3V I;  2BH2 A;  3BU2 A;  2VW9 A;  3I7F A;  3K80 C;  3RNU A;  3I4O A;  4DV2 Q;  4DR1 L;  3PGZ A;  1I94 Q;  3TRE A;  1XNR L;  3KOJ A;  2KEN A;  3M9B A;  1K8A C;  1XMO Q;  4OWW B;  3W1G A;  3CCV A;  1OXU A;  4HID A;  5JJK A;  3L0O A;  4GLV B;  2NN6 G;  5AJ3 L;  2ZTD A;  3UE1 A;  5FJ8 G;  3I55 A;  3KJP A;  1NJI C;  4X66 L;  2JA6 H;  2LXK A;  4GN3 B;  2E2H H;  3I4N G;  5LMU Q;  3J81 i;  1VQD A;  1FJG Q;  1VQL A;  1H95 A;  3AYH B;  1VCI A;  4UPA A;  1JJ2 A;  2BA0 A;  1G51 A;  3J80 i;  1PYB A;  5IYC H;  5HY6 A;  4AQY L;  4NXN Q;  3VDY A;  3SGI A;  1MIU A;  1VQI A;  2MO0 A;  1WOC A;  3EN2 A;  4JI2 L;  4IFD G;  3TS2 A;  4A76 A;  4QY7 A;  1PH3 A;  3U58 A;  4DR7 L;  3E9H A;  2IY5 B;  3HOW G;  2JQO A;  3PUX A;  5ELN A;  3A5U A;  1KC8 C;  4DR7 Q;  1R9T H;  1W2B A;  1A63 A;  4HIO A;  4JI6 Q;  1E7Z A;  2KHJ A;  5M3F G;  2HHH L;  4A3D H;  4GOP B;  3KF6 A;  4GKK L;  4A3J H;  2MO1 A;  2ZTE A;  1Y1W G;  3S2D H;  4LWC A;  2UXC Q;  2LXJ A;  1D7Q A;  4JBJ A;  5M3F H;  3RR5 A;  5M3M H;  4L5S A;  1Q1E A;  1TWA H;  3RN2 A;  1PH8 A;  4WJ4 A;  2BA1 A;  3I2Z A;  1BBW A;  1OXT A;  2ZJR A;  2JA5 G;  1YZ6 A;  1L1O B;  3CCS A;  4OO1 I;  2IX0 A;  3E0E A;  3GTO H;  3G48 A;  4BXX G;  2PI2 A;  4AH6 A;  1N36 Q;  1JT8 A;  1X3F A;  3DM3 A;  4IPC A;  1G29 1;  3CCJ A;  3PV0 A;  5H1S E;  2AMC B;  3OTO Q;  1U5K A;  1VQO A;  2E5L L;  1K3R A;  4LW1 A;  4LFC L;  4NXN L;  4DV2 L;  4DR1 Q;  4A93 H;  3GTJ H;  1QVC A;  3OYY A;  4ALP A;  4LF5 L;  5J3B A;  5LMN L;  3STB C;  3CQZ H;  4UP8 A;  4B3S Q;  1E24 A;  1RIP A;  4DV5 Q;  3CC7 A;  4YWL A;  4K0K Q;  4JI5 Q;  3G71 A;  5IYD H;  1LTL A;  3HFZ B;  4GLA C;  3CAM A;  1CUK A;  4JI1 L;  4DK3 C;  4JI0 L;  1NBW A;  1V43 A;  4DUZ Q;  2K50 A;  1N33 Q;  3PUV A;  1AH9 A;  2K4K A;  4LF7 Q;  1UE1 A;  4A3C H;  2A19 A;  2NVY H;  4LF7 L;  2RF4 A;  3RZO H;  5FLM G;  1GM5 A;  1YJ9 A;  4HIK A;  3CW2 C;  3E9I A;  5IYC G;  4IOA A;  1A62 A;  3EBE A;  4OX9 Q;  5C4J H;  4B3T L;  3UE0 A;  1LM0 A;  2K5N A;  4JG2 A;  4POG A;  3KDF A;  4BXX H;  1WCM H;  1CSQ A;  2K75 A;  2R7F A;  4GN4 B;  4YCW A;  4X64 Q;  4A3B G;  2OTJ A;  4YY3 L;  4A3I G;  1HR0 L;  4DNI A;  1E22 A;  2WB1 E;  2GVB A;  1IBM L;  1CKM A;  1W3S A;  4JI4 L;  4LFB L;  2UU9 Q;  1VQN A;  1WI5 A;  1KD1 C;  3UDF A;  1V1Q A;  4AYB G;  1CKN A;  4A3I H;  4A3F H;  2JA8 H;  3TRZ A;  5JJL A;  1KQS A;  1O7I A;  2VQE Q;  5GAE C;  4DR6 L;  2R93 G;  4ME3 A;  3I4M H;  5LMN W;  3F2C A;  1NE3 A;  3PO2 G;  1KHI A;  2F4V Q;  1EOV A;  1DGS A;  1N36 L;  1HNX L;  2NN6 I;  3ULL A;  4HJ9 A;  4LF5 Q;  2R92 H;  1EQR A;  1OXS C;  4YCV A;  4X64 L;  3BZK A;  1UE6 A;  2JA7 H;  3KDF B;  3CCM A;  1XPR A;  1GO3 E;  2BH8 A;  3T1H Q;  2CWA A;  4YWK A;  4GKK Q;  3NEN A;  4BY7 H;  3GTG H;  2FXQ A;  4HIM A;  5JEA J;  4A3L H;  4GKJ L;  5ELO A;  4BBR G;  4LNQ A;  1BKB A;  3ICE A;  2LSS A;  2GN5 A;  4DUZ L;  2KBN A;  1PH5 A;  1PH7 A;  1K0R A;  2E8G A;  4JI1 Q;  4RG1 A;  1KRT A;  1QZG A;  5GAD C;  3DLL A;  2HQL A;  1XMQ Q;  2UU9 L;  5FJ8 H;  2JA6 G;  4JI5 L;  2UXD L;  3H0G H;  4JI2 Q;  1YHA A;  1SN8 A;  1VQG A;  3UDI A;  2R6G A;  3PIO A;  4DR3 Q;  3JC6 6;  4A75 A;  1I3Q H;  1YIT A;  5IE8 A;  4JV5 L;  3PSI A;  3F8T A;  3FHW A;  2ZTC A;  3ER0 A;  1T9H A;  1L1O A;  3S1N H;  3JAM i;  1E1O A;  2VNU D;  1SRU A;  5K36 G;  4POF A;  4A3M G;  1OXV A;  1Y1V H;  3F1Z A;  3LGJ A;  2JA7 G;  4GNX B;  3Q8D A;  2K5H A;  2Q2U A;  1EUJ A;  2D0P A;  4R4Q A;  1N33 L;  3PO3 H;  1S72 A;  1SFO H;  1VQE A;  3HKZ E;  1EYG A;  1V9P A;  2WP8 J;  3PO3 G;  3M85 A;  1RL2 A;  5C0X G;  1M90 C;  4JBK A;  4BY1 H;  1N32 L;  1I5F A;  1XJV A;  3K8A A;  1C9O A;  2Z6K A;  2UUC Q;  4JOI C;  1U0L A;  3CME A;  5C44 G;  2D0O A;  3CPF A;  3GTK H;  3I4M G;  1Q81 C;  3J80 c;  2AKW B;  1YEZ A;  1VQ6 A;  2IHF A;  2L15 A;  2R7Z H;  2ZJP A;  2NVQ H;  2K5V A;  4UP7 A;  4PMW A;  1AE2 A;  4LF8 L;  4IOC A;  4HJ5 A;  2VS1 A;  2YTV A;  2HIV A;  3NEL A;  4JI4 Q;  4LFB Q;  5C0X J;  1X9N A;  3HOZ G;  2Q2I A;  2PMZ E;  4JYA Q;  5JJI A;  3PIP A;  4LUV A;  5FLX c;  2A1A A;  4DV4 Q;  2GVA A;  5C3E G;  1IBK L;  4B3R L;  4L5T A;  4B3T Q;  5M5X H;  1HR0 W;  4A3K G;  4BBR H;  1PH1 A;  4P73 A;  4H02 A;  2JEB I;  4UP9 A;  1YIJ A;  3HOU G;  3K7U C;  3I56 A;  1UE5 A;  4GOP C;  1X54 A;  1VQ4 A;  3KF6 B;  4P71 A;  2AWO A;  3HOX G;  2WAQ E;  2B29 A;  4DUY Q;  4DK6 C;  1QUQ B;  3KJO A;  1IZ6 A;  4R1J A;  3JAM c;  3EIV A;  4DV5 L;  1YJW A;  2UUA L;  3CC2 A;  1HH2 P;  2JK8 A;  4LUO A;  4EX5 A;  4IO9 A;  1EFW A;  1MJE A;  3AEV A;  5GAH C;  4MNO A;  3OW2 A;  5IP9 G;  3ULP A;  4DV6 Q;  5GRO A;  1BVS A;  2XTI A;  4AYB E;  1A0I A;  1CKO A;  4BA1 I;  4DV1 Q;  4A3G G;  3FKI G;  2N3S A;  1IBL L;  2I5L X;  1SR3 A;  3GDE A;  3A5Z B;  1PYS B;  3HOY G;  3L2P A;  3AQQ A;  2YTX A;  4XTC S;  4LF4 Q;  1JE5 A;  2RHS B;  1Z9F A;  2WAQ G;  3CCU A;  1K8G A;  1VQ5 A;  5IY0 A;  3A0J A;  3KYH C;  1A8V A;  1XNR Q;  3HOW H;  2NVT H;  3PUZ A;  3HOU H;  3F2B A;  4PG3 A;  2HHH Q;  1FGU A;  1HNW L;  5GQO A;  4A3E H;  2DGY A;  4DV0 Q;  4OO1 G;  1UWV A;  4X6A H;  4JBM A;  4DV7 Q;  1E1T A;  1N9W A;  1BBU A;  2I5H A;  1YHB A;  3MXN B;  4DV7 L;  4OON A;  1N34 Q;  1QUQ A;  2CCZ A;  5IP7 G;  4DV0 L;  3GTP H;  1Z47 A;  3WWV A;  3S1Q H;  3F2D A;  1N32 Q;  2EXD A;  3I4N H;  2UXB L;  4Y7N H;  1XPO A;  4LFA L;  2K14 A;  4A4I A;  3CXC A;  4B3M L;  3M7N A;  4A3F G;  1XNQ L;  4R4I A;  4BY7 G;  3D0F A;  4MZ9 A;  4YCU A;  1LYL A;  4DUY L;  4AQY Q;  1S3O A;  1SMX A;  2IHE A;  3FP9 A;  3S1R H;  3RLN A;  4DAY B;  1WYD A;  4QQB X;  1X3E A;  4R4T A;  1QVG A;  4LF4 L;  1I50 H;  4IPD A;  4JI3 Q;  2JEA I;  2YV5 A;  1VQC A;  3S24 A;  3ZJY C;  4QL5 A;  2UUB L;  2VY3 A;  2DUD A;  1IBL Q;  2D62 A;  5IYD G;  2OWO A;  2XGT A;  3BZC A;  4DV1 L;  1EQQ A;  1P8L A;  5IP7 H;  3H0G G;  2VQF Q;  1PH2 A;  1XMO L;  2ES2 A;  3T1Y Q;  2ZM6 L;  1Q1B A;  4JOI A;  1WJJ A;  4QJF A;  2KCT A;  3HKS A;  5GAG C;  1YI2 A;  1IBK Q;  3S15 H;  1G6P A;  1KAW A;  2MQH A;  2IT1 A;  1L2F A;  4DAM A;  1B70 B;  3A74 A;  1Q82 C;  1PH6 A;  4JI7 L;  4IFD J;  2UXB Q;  2CFM A;  2UXD Q;  4GS3 A;  4X65 Q;  1X56 A;  1YBY A;  5BR8 L;  4LF8 Q;  3CCR A;  3CCQ A;  4KI0 A;  4TVA B;  1Q7Y C;  2VUM H;  1HZA A;  3NBH B;  2CKZ B;  4DR4 Q;  4J15 A;  1X65 A;  1FL0 A;  3BJU A;  1HNZ Q;  3HKZ G;  4EQ5 A;  1HNW Q;  3UDX A;  4A3C G;  2PNH A;  1VQ9 A;  3GTQ H;  3M4P A;  3T1H L;  4Y52 H;  1AE3 A;  1J6Q A;  2B3G A;  2RCN A;  3RLO A;  4A3G H;  2EIF A;  1YHQ A;  4LF9 L;  4B3R Q;  4NB3 A;  4OWT B;  2WFW A;  4DV4 L;  1HZB A;  1VQJ A;  1YVC A;  3AFP A;  4PZ6 A;  4HJ7 A;  5C4X H;  1JB7 A;  4YHH Q;  2CWP A;  4DR5 L;  1HNX Q;  1X55 A;  4DKA C;  1S40 A;  2F4V L;  4APV A;  1EWI A;  2MNA A;  1QVF A;  3NEM A;  5C3E H;  1YJN A;  4LF6 L;  1Y14 B;  1VQ8 A;  4DR6 Q;  4MTN A;  2NVX H;  2PQA B;  4LF6 Q;  3RZD H;  3AFQ A;  1X3G A;  2JJQ A;  1MKH A;  4KHZ A;  1B8A A;  1GKH A;  1EIF A;  5IYB H;  2UUC L;  4JV5 Q;  1OXX K;  4YY3 Q;  4GN5 A;  3W1B A;  5FLM H;  1PV4 A;  2VZA A;  1B7Y B;  1SLJ A;  4NXM Q;  3D31 A;  4A3K H;  1ASY A;  3G4S A;  4BA2 I;  3CMA A;  1HZ9 A;  1UEB A;  3S2H H;  1PHJ A;  5M3M G;  1TWC H;  3U50 C;  4DR2 Q;  4KHP Q;  3K0X A;  4DV3 Q;  1TWH H;  2B63 G;  2AWN A;  3TS0 A;  4L5Q A;  2AHO B;  2Z6K C;  1HJP A;  4JI8 Q;  1Q46 A;  2JA9 A;  1GD7 A;  4KHP L;  1LUZ A;  1TWG H;  2QEX A;  3H15 A;  1PH9 A;  3TQY A;  3HOV H;  1IYJ B;  2CQO A;  2RHQ B;  5IYB G;  3MEF A;  1OTC A;  2Q2T A;  4BBS H;  1C0A A;  4JCV E;  4WJ3 M;  2HIX A;  1K9M C;  2E2J H;  2Y0S G;  5IWA L;  2VL6 A;  1XPU A;  4R4C A;  4JI7 Q;  4A3E G;  4GLX A;  5C44 H;  1TXY A;  3CC4 A;  3U4V A;  4B3S L;  1KXL A;  3RN5 A;  1P16 A;  4NPS A;  3G6E A;  4DPG A;  2VUM G;  4LFC Q;  1HZC A;  2NZH A;  1MJC A;  2WB1 G;  4IPG A;  2ZM6 Q;  3K81 C;  4X62 Q;  1VQK A;  5C4X G;  2E5L Q;  2ASB A;  2PQA A;  4OXP A;  1ASZ A;  1J5E L;  1L1O C;  3ERS X;  3STB D;  2ALY B;  3HOZ H;  5HGQ A;  4HJA A;  1JJC B;  3CCL A;  1IBM Q;  3ULJ A;  4QIW E;  5JEA G;  4YHH L;  4DR5 Q;  3B6Y A;  1HR0 Q;  4A93 G;  1NTG A;  2Y0S E;  4DV3 L;  1GVP A; 
#chains in the Genus database with same CATH topology
 2QA4 A;  1QZH A;  4RMF A;  4LH6 A;  5EWF A;  1Q8K A;  2EYL A;  4YWM A;  3J81 j;  4QCL A;  1HA5 A;  4B3M Q;  5DLQ E;  4K5W A;  2JSO A;  1L0W A;  4F50 A;  3GD7 A;  4Y8V B;  1JR0 D;  2N49 A;  3CRL C;  4GNX A;  3E5S A;  2E2I H;  4DR5 H;  3KBX A;  1FVI A;  3NBH A;  2OQ0 A;  1J5E Q;  4O3N A;  1GUW A;  5KRU A;  4J9Q A;  3MR5 A;  2J6S A;  1Y1W H;  4CBV A;  3HOY H;  4HCS A;  5EDW A;  1I7L A;  2IX1 A;  3KHH A;  2L4N A;  2RGV A;  2FFK B;  1I3Q B;  2KVM A;  1K73 C;  2R7Z G;  1SE4 A;  4ZRZ A;  2YS7 A;  3GTQ B;  3S16 H;  2FMA A;  3MFI A;  4UCV A;  4A3B H;  1ICW A;  3PMF A;  1WCM G;  5C5M A;  5I9O A;  3CF5 A;  1GHK A;  1B04 A;  5LOV F;  2UUB Q;  4BY1 G;  4DL6 A;  3PW2 A;  2KCM A;  5IIF A;  1EZ8 A;  4BBS G;  2J6T A;  1SEB D;  4DR2 L;  1KJJ A;  5EAY A;  4DV6 L;  1EY6 A;  4GOP A;  2QDL A;  3PUW A;  5NUC A;  1WTV A;  1PK8 A;  1TWC A;  1I94 H;  1V1P B;  2YU9 H;  5E3F A;  4NXM L;  4EVO A;  4NXM H;  2ZJQ A;  2B63 H;  3K5N A;  1KJI A;  3EFX D;  2UUA Q;  4Q0F A;  2VR1 A;  5ELF A;  5M5W H;  2SNM A;  4KD4 A;  1JMC A;  2L55 A;  5TSS A;  3KLW A;  5C3W A;  2N78 A;  4C5A A;  5IT9 c;  4A3B B;  4OIK A;  2KHI A;  1XTC D;  3BG5 A;  3IFT A;  3L4J A;  1Y1V G;  5KFQ A;  3HOX H;  4C2M H;  3S14 H;  3ND9 A;  4J9N A;  3PUY A;  4C3J H;  1E3P A;  2UXC L;  4OX9 H;  4KLK A;  1NUC A;  4LFA Q;  4RHR A;  4FU0 A;  5KFT A;  3WO1 A;  4UY8 C;  1TS5 A;  4TQU S;  1XWE A;  2R7Z B;  3E3X A;  2HQE A;  1CSP A;  2DNC A;  1KAB A;  5BPH A;  4A3D G;  3CPW A;  1VQP A;  2M2L A;  2I87 A;  5D1O B;  1C7Y A;  1JKJ B;  4EBD A;  1VQF A;  3URY A;  3BS1 A;  3H3V I;  4MV9 A;  2BH2 A;  4LF5 Q;  2VW9 A;  3K5I A;  3I4O A;  5CV5 A;  4DV2 Q;  3PR4 A;  3TDQ A;  5IGD A;  1HRJ A;  3S14 B;  2JP1 A;  3M9B A;  3CCV A;  4IQZ A;  3KK7 A;  2C2D A;  4GLV B;  3I55 A;  4GKJ H;  3KJP A;  5LXT F;  3TP7 A;  4X66 L;  5EWE A;  2LXK A;  5LMU Q;  4JI3 H;  5C3E B;  1VCI A;  3D3R A;  2BA0 A;  3GTG B;  1PYB A;  3SXH A;  3EA6 A;  4AQY L;  2YZG A;  4RA8 A;  3SGI A;  2IJ0 A;  4MAM A;  3HEJ A;  3RB4 A;  3EN2 A;  1B1Z A;  1NNX A;  1S5E D;  4JI6 H;  4G57 A;  5L1J A;  2IMW P;  2IY5 B;  1UAP A;  2NB0 A;  5IT9 E;  2R6F A;  1KC8 C;  4MHE A;  4U6P A;  1ZKO A;  1JOR A;  4HIO A;  3SR1 A;  4JI6 Q;  1A6X A;  5EPJ A;  1EY5 A;  1K3B C;  3HP3 A;  4FXK C;  5D65 A;  5FO7 B;  3GIP A;  2MO1 A;  2LY7 A;  4L1K A;  2E75 C;  1D7Q A;  2LXJ A;  1M7J A;  3KXY T;  4IR9 A;  3RR5 A;  4L5S A;  2M00 A;  4LMY A;  4MA0 A;  3RN2 A;  1PH8 A;  5LHY 1;  2BA1 A;  4RB3 C;  5CGK A;  3WDN A;  5JPM C;  3PQI A;  3HOV B;  1HR0 H;  4DA2 A;  1FJG H;  1STG A;  3E0E A;  3G48 A;  4N9T A;  5EBD A;  4O3R A;  1JT8 A;  1DV1 A;  1E4F T;  4FM9 A;  1X3F A;  1Z7T A;  3T5J A;  4R8I A;  3GV6 A;  4QWE A;  4FS2 A;  1PTO B;  1JLL B;  4LW1 A;  1WTX A;  1AZP A;  1EWH A;  1QCB D;  1SNM A;  4DR1 Q;  3H91 A;  3GTJ H;  4ZUI A;  3N42 B;  2R8J A;  5LMN L;  4BY1 B;  1E24 A;  3S1R B;  4DV5 Q;  1KDA A;  4HED A;  3CC7 A;  3N40 P;  4U67 3;  3PIO 3;  2OLS A;  4GLA C;  1CUK A;  1E2W A;  4CKC A;  1VBH A;  1V43 A;  4DUZ Q;  2SOB A;  5D1P A;  1AH9 A;  3N44 B;  1UE1 A;  5BMV F;  3RZO H;  1MSH A;  3JAM E;  3QZ7 A;  1CQF A;  4IOA A;  1A62 A;  4OIJ A;  1WH2 A;  1O75 A;  5C4J H;  4ZOL F;  3WO0 A;  5L1L A;  4JG2 A;  4BXX H;  1HQR D;  4A3G B;  4C3J B;  4EQP A;  2V9W A;  5D3D A;  4YCW A;  4I55 F;  4GN4 B;  1S0O A;  1GSH A;  5JQW A;  1HTL D;  4Z9C B;  4YY3 L;  1I4R A;  1E22 A;  4HTH A;  2H4O A;  3A56 A;  3CRK C;  4XQN A;  4JYA H;  1S5D D;  4JI4 L;  4LFB L;  1WI5 A;  3HOZ B;  3UDF A;  3NGD A;  3T13 A;  2JA8 H;  5KYI A;  1E4E B;  5GAE C;  3S1M B;  5LMN W;  5CC4 A;  3HXL A;  1NE3 A;  3PO2 G;  2W6Q A;  2EE1 A;  1PTO F;  2HGS A;  4CDE C;  5KG7 A;  3J7A V;  2NN6 I;  2XIW A;  3MTS A;  2B2U C;  2JA7 H;  4O2B F;  2BE5 D;  2PO4 A;  2R7M A;  4TV9 F;  5JOB A;  2BOS A;  1K8M A;  5IGC A;  4FBT A;  3VYT A;  4C5B A;  3T1H Q;  4F8M A;  3E5N A;  4BY7 H;  2GLT A;  4ECZ A;  4ZYS A;  2AUJ D;  3K59 A;  3I90 A;  4RB0 A;  4BBR G;  3H40 A;  1BKB A;  2GN5 A;  1SYF A;  1NCV A;  2PVP A;  4CKE A;  1ZYR D;  2B2Y A;  3C2P A;  3HG9 A;  4ZKB B;  2FKL A;  4X3T A;  4O4I F;  3M9M B;  1LT4 D;  2R7K A;  2HQL A;  2UXD L;  3NSW A;  3L3O C;  4JI5 L;  4JI2 Q;  3U9T A;  3KHR A;  1SN8 A;  5DLF A;  2R6G A;  1TWF B;  4A75 A;  1U4P A;  3MR2 A;  4QIW B;  5FLX W;  3H4B A;  1LV9 A;  4RCN A;  3FHW A;  2JA7 B;  4QWB A;  4I4T F;  5KT7 A;  1E2Z A;  1T9H A;  5JVD F;  2VNU D;  2A68 C;  3K3V A;  1LAB A;  4POF A;  1WVL A;  4O2A F;  1EY8 A;  5FLX L;  4A3M G;  3LGJ A;  3UQ8 A;  2PZT A;  1QOH A;  1EUJ A;  4MTD A;  4HMJ A;  4QMG A;  4S3S A;  5KT5 A;  3PO3 H;  1S72 A;  1SFO H;  2R93 B;  4DXG A;  2WP8 J;  1BR9 A;  1PRT B;  5M3M B;  1EY0 A;  4TV8 F;  2I8C A;  4ED6 A;  2R82 A;  5C0X G;  2MHV A;  4YBZ B;  1N32 H;  4JBK A;  3VA7 A;  2LFN A;  3K8A A;  4J1M A;  4JOI C;  3DWA A;  1JXL A;  3GTK H;  3V4Z A;  2IHF A;  4DV7 H;  3QOL A;  4PMW A;  4APM A;  1AE2 A;  3FMC A;  3SK5 A;  1ICF B;  3J81 W;  4JI4 Q;  4LFB Q;  2UU9 H;  4NXN H;  3OHA A;  4PWQ A;  4HR7 A;  4LFA H;  2K04 A;  5K5P A;  3WOE A;  1E4G T;  3OSP A;  5CA1 F;  3A54 A;  1QNK A;  2CW0 C;  2LMC B;  4CGY B;  4KK7 A;  1KEE A;  3FPP A;  4LJZ C;  4B3T Q;  4YR3 A;  3L4K A;  4GC7 A;  4TKO B;  2LS0 1;  4I7H A;  4DAY A;  4H02 A;  2C5C A;  4NLG A;  3MXP A;  3I56 A;  4TQR A;  3G6J B;  2AQ3 B;  4P71 A;  1CQI B;  1RTO A;  4BY7 B;  4OEM B;  1TY2 A;  1B6S A;  4WFN 3;  3I73 A;  2UUA L;  4ECT A;  2B63 B;  1HH2 P;  1MI2 A;  1ET9 A;  3GQC A;  2R8I A;  3MC0 B;  4JV5 H;  5C0X H;  4L63 B;  4MNO A;  3VR2 A;  1ONL A;  4C2M A;  4DV1 Q;  1TII D;  2PW7 A;  4J9P A;  2I5L X;  2UUB H;  3OSN A;  1PYS B;  3L2P A;  2OH2 A;  2BE5 C;  3NBI A;  4RB2 C;  3O13 A;  1IL8 A;  5IOC A;  1A8V A;  1QB5 D;  1XNR Q;  4DK1 A;  2NVT H;  3N41 B;  3HOU H;  3Q22 A;  2E76 C;  1STA A;  3D4R A;  1TWG B;  1Z2P X;  1HNW L;  4A3E H;  2SCU B;  4BBS B;  4OO1 G;  3T16 A;  4X6A H;  1EL0 A;  1PYW D;  4HNV A;  1N48 A;  2L12 A;  1YHB A;  3MXN B;  4OON A;  1N34 Q;  3FDT A;  2CCZ A;  2MCT A;  5IP7 G;  4EEY A;  4LF8 H;  3GTP H;  1Z47 A;  1ZHS A;  2FMC A;  1V8Q A;  1N32 Q;  1F9S A;  2FLN A;  2UXB L;  1PFB A;  4B3M H;  4B3M L;  2RQX A;  3HOX B;  1XNQ H;  3CQZ B;  4MV1 A;  5KFB A;  2DWC A;  1H9S B;  4BY7 G;  4RZQ A;  1LYL A;  4LF9 H;  1SMX A;  3FP9 A;  2L9H A;  1K28 A;  3S1R H;  2F1M A;  3BQ2 A;  1SFO A;  4QQB X;  4QUF A;  1X3E A;  4R4T A;  2DJF C;  5KFE A;  3GIL A;  2QEJ C;  1PTO H;  2YV5 A;  3S24 A;  3BA9 A;  1KNA A;  4DN4 M;  4IUQ A;  4CJ2 C;  1TS2 A;  1VF5 C;  2OWO A;  2XGT A;  4DV1 L;  3H0G G;  2VQF Q;  1PH2 A;  3T1Y Q;  1WJJ A;  4QJF A;  5GAG C;  3HKS A;  1I4P A;  1TWA A;  3J80 L;  2MQH A;  1X3P A;  1WCM B;  4DAM A;  1B70 B;  3A74 A;  2DY7 A;  5EQ0 A;  4JI7 L;  4IFD J;  1ZET A;  2UVV A;  2CFM A;  4XYO A;  4X65 Q;  1BJT A;  1X56 A;  2EZV A;  5COY A;  3NHH A;  3ONA B;  4LF8 Q;  4LAA A;  4KI0 A;  4RUA A;  3GTK A;  1A2T A;  1HZA A;  4DR4 Q;  1U9R A;  4F4Y A;  1SNP A;  3NTH A;  5KG0 A;  4CJ0 B;  2R8H A;  2YCH A;  1EY9 A;  3M4P A;  2B3G A;  2WB1 B;  2ZDQ A;  1PZI D;  2ENB A;  1MGS A;  1JB7 A;  4YHH Q;  4DR5 L;  1TA8 A;  4J6H A;  3GIQ A;  2F4V L;  4APV A;  2MNA A;  4RGO S;  2HCC A;  5KG5 A;  2VQE H;  5C3X A;  3RZD H;  4ZHQ F;  1X3G A;  3AFQ A;  3F2U A;  2HUG A;  1M0T A;  1GKH A;  5IYB H;  2UUC L;  4JV5 Q;  1OXX K;  4UCT A;  4YQW A;  2W7O A;  1B50 A;  4TSS A;  2G9H D;  2KHS A;  1WCM A;  4HYK A;  1B7Y B;  4G7O C;  4A3K H;  3G4S A;  1UEA B;  3Q8Q B;  2B39 A;  3U50 C;  4DR2 Q;  4KHP Q;  1D5M C;  4G3I A;  2RSO A;  3VR5 A;  4TUY F;  2B63 G;  1DYQ A;  2SNS A;  2R93 A;  2IW3 A;  3TQY A;  1IYJ B;  2EVB A;  5E4W C;  5IYB G;  4BBS H;  4EQN A;  5BN5 A;  4JCV E;  4O3Q A;  1F9P A;  4M1U B;  5C1O A;  2CW8 A;  2VL6 A;  1SDF A;  2F0T A;  4R4C A;  3CC4 A;  1DCZ A;  3U4V A;  3G6E A;  4DPG A;  5EJW A;  4NXN Q;  4IPG A;  2ZM6 Q;  2PYK A;  4X62 Q;  5KFO A;  2L11 A;  2W6M A;  3P20 A;  4EBE A;  1BOS A;  3NTI A;  1S5C D;  1W96 A;  4O3P A;  4HJA A;  1FGB D;  3CCL A;  1DON A;  3ULJ A;  1HTP A;  1LT5 D;  1RJP A;  4YB8 B;  1V51 A;  5JVH 3;  5IGE A;  1BCP D;  4QGU A;  3R93 A;  4P72 A;  4A3L G;  1VMP A;  5COR A;  1H9K A;  1NMF A;  4X3U A;  2JA5 H;  1I6H B;  5C4Z A;  1PA6 A;  4HNT A;  5C0X I;  2R7D A;  1XTD A;  3OSO A;  4IJL A;  3BYY B;  2V4R A;  3CP0 A;  1STE A;  5FD6 A;  3PF5 A;  4ED2 A;  2QGQ A;  4X65 L;  3M4Q A;  4FF2 A;  4XYL B;  1A3U A;  1JJG A;  2XC9 A;  2JA7 A;  3S16 B;  1N8R C;  2CW7 A;  3CCE A;  4JC0 A;  1GJX A;  1BQQ T;  4QW9 A;  4CC6 A;  3U4Z A;  1NMG A;  1C3O A;  2R85 A;  4V0B A;  3H0G B;  4IRK A;  1AN7 A;  3OTO L;  3H3V H;  4FXG C;  1BGW A;  2NZO A;  3UDG A;  1FJG L;  2V1C C;  4A3D B;  1R9T B;  3KLR A;  3GTM A;  3L9A X;  3W5O A;  4MV7 A;  4JI8 H;  2JA6 A;  1Q12 A;  2ICI A;  4GKJ Q;  5E7N A;  1I4G A;  1EU4 A;  1STB A;  1UC9 A;  3OIP A;  3PCO B;  4IAJ A;  2JE6 I;  3EJI A;  2MUY A;  4DV2 H;  2W9C A;  1II3 A;  2NZ1 D;  1K83 H;  3BVG A;  4KY7 A;  4K0K L;  2NU8 B;  2R84 A;  1B3Q A;  2EYJ A;  1EYC A;  1GOZ A;  1S5F D;  2PZW A;  1EIG A;  4L8J A;  4P2C B;  4LF6 H;  1PMR A;  1E4E A;  5DEH A;  1GYF A;  1E0B A;  2YTY A;  1S97 A;  2F0M A;  2F52 A;  3M4O H;  3R5H A;  1KL9 A;  3DEP A;  4RGM A;  4JI3 L;  3MZ5 A;  3WNZ A;  4KKU A;  4PZ8 A;  3Q23 A;  3S2H B;  4C3H H;  1ENA A;  4J9L A;  3TIN A;  2A68 D;  4RAY A;  5KT2 A;  2KED A;  4OWX B;  2K5W A;  1SFO B;  2R93 H;  4TQS A;  4CJ1 B;  2ASL A;  4LMQ D;  1MD2 D;  2A5H A;  3GTO A;  1O78 A;  1I4X A;  1N34 L;  4PV1 C;  2ATW A;  4FDB A;  3SDZ A;  4NW2 A;  4JI0 Q;  1VQ7 A;  1CKN B;  4NP5 A;  4HJ8 A;  5EWG A;  2K33 A;  5LL6 S;  4WJW A;  5BR8 Q;  4P74 A;  1MSG A;  2H5X A;  3GQB A;  4N8F A;  4L5R C;  1DD2 A;  5EZY F;  3HOV G;  4LUZ A;  2B63 A;  3BU2 A;  3TP8 A;  3K3P A;  3K80 C;  2BQU A;  4C1N I;  4DR1 H;  2NU7 B;  3KOJ A;  4OWW B;  4J8Q A;  1XMO Q;  4Q44 A;  1JWM D;  5AJ3 L;  2ZTD A;  1RJT A;  3UE1 A;  2JA6 H;  3T5K A;  1RK6 A;  3Q1K A;  1LTA D;  4GN3 B;  5M9O A;  3SK4 A;  2I07 B;  1B9N A;  1VQD A;  1X32 A;  1FJG Q;  1H95 A;  4XQJ A;  1KC7 A;  5C4X B;  5DQG A;  1JJ2 A;  1TY0 A;  1TAE A;  3JZI A;  5KFI A;  4K2L A;  1CE8 A;  4AQY H;  2F0K A;  5KFJ A;  4KN7 C;  1RTN A;  1MIU A;  1A3V A;  3C3L A;  1SXT A;  4MA5 A;  3LX0 A;  2ZJT A;  3QR8 A;  1PH3 A;  1BUV T;  1QE6 A;  2HDM A;  3E9H A;  1YNJ C;  5LP6 F;  3PUX A;  2L1B A;  5ELN A;  1ULZ A;  5KFH A;  1W2B A;  2EY5 A;  1TWH B;  2FHT A;  1A63 A;  2RDH A;  2KHJ A;  2HHH H;  1KBL A;  3U9O A;  4GKK L;  3BZD B;  4A3J H;  2W6P A;  3I12 A;  1WSC A;  4JK1 C;  1TS4 A;  4JBJ A;  2WTF A;  4A3J B;  2NYZ D;  3J81 L;  3HS0 C;  2ZJR A;  4JW0 A;  3CCS A;  4OO1 I;  4DL3 A;  3GTO H;  4C56 C;  2PI2 A;  1N36 Q;  2NTS A;  3R2T A;  4IPC A;  2EDG A;  5EOY A;  3CCJ A;  4FYD A;  3PV0 A;  2F0G A;  4DV6 H;  2G9D A;  4IUR A;  3ZYY X;  5DG8 A;  2C22 A;  5ELD A;  4A93 H;  4I7A A;  2X6L A;  3FRP B;  4LF5 H;  1ILQ A;  3STB C;  2PZU A;  3CQZ H;  1FR3 A;  1HUN A;  1T3N A;  4A93 B;  1ML0 D;  4E6I A;  4JI5 Q;  5IYD H;  1RKN A;  2VB2 X;  4RHS A;  2W8K A;  1LTL A;  3DWP A;  1DOL A;  2CVR A;  1B6R A;  1Y8P B;  2KCC A;  5A2Q L;  3GTP B;  2XIG A;  4O4L F;  4O3S A;  5HBR B;  4JI0 L;  3KAJ A;  1NBW A;  1SMY D;  3PUV A;  2Q8R E;  4LF7 H;  3GTO B;  4LF7 L;  2WB1 A;  3J7Y W;  4EYH B;  3K6O A;  1N33 H;  3AU7 A;  1GM5 A;  4QWC A;  1YJ9 A;  4HIK A;  3E9I A;  3K5H A;  1IOW A;  3R2I A;  4OX9 Q;  2EOT A;  2H1E A;  1HHV A;  2VPS A;  5KFM A;  3UE0 A;  5IOD A;  2A6E C;  4POG A;  5D14 A;  4X64 Q;  2K75 A;  1JQY D;  2KUM A;  4R8N A;  1KNE A;  1HUM A;  4RH6 A;  3PN1 A;  4YY3 H;  3PW0 A;  1HR0 L;  2F0S A;  2WB1 E;  1XXG A;  1CKM A;  5JJL A;  4M8A A;  2XVS A;  4AYB G;  1CKN A;  4UCO A;  4R8U B;  1T5E A;  2R7N A;  1EFI D;  1O7I A;  2VQE Q;  4J0M A;  2R93 G;  4CC5 A;  4ECQ A;  2JA5 B;  1O7L A;  4FP5 D;  1OWT A;  2F4V Q;  1EOV A;  4DXF A;  1DGS A;  1W93 A;  4MV6 A;  3X3M A;  5KFG A;  1JIC A;  4HJ9 A;  5KFN A;  5FKA C;  4YCV A;  3IG0 A;  1Q90 A;  1HFN A;  3ORQ A;  5I9P A;  4AYB A;  1SMY C;  1KDB A;  3OMG A;  2EXZ A;  2CWA A;  4YWK A;  3CVZ A;  3N6R A;  2EY2 A;  4GKK Q;  1JCK B;  2B2Y C;  4YAK B;  2YL2 A;  1EOT A;  2NVX B;  5ELO A;  2JA6 B;  3CU7 A;  4LNQ A;  2QCP X;  1AUV A;  5BN4 A;  3GTM B;  2VOB A;  4YR0 A;  1BCP C;  2LSS A;  3DHQ A;  4A2A A;  1IKL A;  4FXD A;  1PH5 A;  1PH7 A;  4IRD A;  4UAI A;  1K0R A;  4JI1 Q;  4RNM A;  5GAD C;  3DLL A;  3NQI A;  4I7Z C;  1XMQ Q;  2UU9 L;  1LTG D;  3WOF A;  2JA6 G;  3W3A A;  3JAM L;  1VQG A;  1MHW C;  2ZXR A;  2WKC A;  2B2U A;  1YIT A;  1PTO D;  2A69 D;  3GTJ B;  4DL7 A;  3HKZ A;  4C3H B;  2FE3 A;  3DWQ A;  3ER0 A;  3NXW A;  4CKB A;  1BCP B;  3U9S A;  1L1O A;  3S1N H;  1E1O A;  5A2Q E;  4F7X A;  5K36 G;  1IBL H;  2R7Z A;  4ECU A;  1OXV A;  1SE3 A;  2JA7 G;  3KHG A;  4FNF A;  5EKK A;  5JEA H;  4LH7 A;  2ICE C;  1EYG A;  4RU9 A;  1V9P A;  1CA6 A;  1AFP A;  5KFY A;  5KFU A;  5KX5 F;  2TMP A;  1GSO A;  3M85 A;  2W6N A;  4MTE A;  4KTA A;  2XNA C;  4BY1 H;  3CKI B;  5C4J B;  1XJV A;  1N32 L;  5DG7 A;  1U4L A;  1TWH A;  5C44 G;  2D0O A;  3CPF A;  4IZO A;  1VQ6 A;  2Z9H A;  3BVZ A;  2R7Z H;  2ZJP A;  2NVQ H;  3NEL A;  1Q8I A;  4LFC H;  4X3K A;  5C0X J;  3EPI A;  2PMZ E;  5EGT A;  3VYR A;  1E2V A;  2HDL A;  4DV4 Q;  4QW8 A;  3W2D A;  1U4R A;  3FVQ A;  1SYG A;  1IBK L;  5CMD A;  4B3R L;  3NPP A;  5IT9 L;  3ETJ A;  1G2S A;  2DZD A;  1JC7 A;  2PMZ B;  5I6Y A;  3KTM A;  2G5D A;  5M5X H;  4FF3 A;  3VMM A;  2JEB I;  1CZG A;  3I70 A;  1YIJ A;  3J80 E;  2ASD A;  1SAP A;  2B2T A;  1UE5 A;  4K6L A;  1X54 A;  1W6J A;  5CV8 A;  4ID6 A;  3HOX G;  3GII A;  2WAQ E;  4RKB A;  2YS6 A;  1STN A;  4DUY Q;  2IBK A;  1QUQ B;  3KJO A;  2E74 C;  2I46 A;  3S9W A;  3CC2 A;  4JI5 H;  4LUO A;  4EX5 A;  1EFW A;  2KOL A;  5G3L D;  3SE0 A;  5GAH C;  3GV7 B;  2JEG A;  2XWB B;  1JDB B;  5I2Y A;  3ULP A;  3J80 W;  1BVS A;  4ME5 A;  1IBL L;  2N3S A;  1KJ8 A;  4JV0 A;  3GDE A;  2Z8L A;  4N9P A;  1RJQ A;  3MFG A;  3VA5 A;  3Q0A A;  4ED3 A;  1HNX H;  3K58 A;  4CDC C;  4LF4 Q;  3BDC A;  4XT1 B;  2FP4 B;  2W8L A;  2XCL A;  1WR2 A;  4ECX A;  4C2M B;  3MXU A;  4Q5V A;  2I80 A;  1HNW H;  4DV0 Q;  5KFX A;  1H9S A;  4DV7 Q;  5DAU A;  1N9W A;  1BBU A;  2I5H A;  2F0Q A;  5DLG A;  1RCV D;  4DV7 L;  1W6K A;  5CR3 A;  1QUQ A;  2F0U A;  4DV0 L;  2Z6B A;  4RWS C;  2JYO A;  3WWV A;  1K0S A;  2ZDH A;  2UXD H;  3H4D A;  2EXD A;  4IUT A;  4LFA L;  2K14 A;  4A3F G;  3JRX A;  1XNQ L;  4R4I A;  1O7Z A;  3K5M A;  1CI3 M;  1MZB A;  1FYC A;  4DAY B;  1WYD A;  4IPD A;  3RTX A;  3ZJY C;  2RSN A;  2KA7 A;  2VY3 A;  2C9O A;  1F2M A;  2VPQ A;  3BZC A;  4IZ8 A;  4K8J A;  1XMO L;  2ES2 A;  1XMO H;  1Q1B A;  1IBK Q;  1G6P A;  2K05 A;  5KFD A;  1CZW A;  1O7Y A;  4OL7 A;  3TII A;  4ED1 A;  3DF7 A;  4DR3 H;  2UXB Q;  3KF8 A;  5CV4 A;  5KFC A;  3VPD A;  1YBY A;  3OWF A;  3CCR A;  1Z6H A;  3TZD A;  4IRC A;  4KJN A;  4TVA B;  1Q7Y C;  2C2R A;  2CKZ B;  2XN9 C;  1D1I A;  1X65 A;  1FL0 A;  3BJU A;  3AB9 A;  1HNZ Q;  2NVQ B;  3DM1 A;  4A3C G;  1EU3 A;  1NSN S;  3GTQ H;  3G8C A;  3M3Y B;  4G4K A;  3Q8P B;  3T1H H;  3T1H L;  3TQT A;  1J6Q A;  4IN3 A;  2EIF A;  3R8B A;  1YHQ A;  2PPB C;  4B3R Q;  4OWT B;  3MJF A;  1SNQ A;  1PLF A;  1HZB A;  1VQJ A;  1YVC A;  4HJ7 A;  5KG1 A;  1IYU A;  3RIZ A;  1S68 A;  2CWP A;  2FB9 A;  1LTS D;  3A7A B;  1QVF A;  4X3S A;  2NBF A;  1YJN A;  5JPN C;  1Y14 B;  1VQ8 A;  1TKW B;  4LF6 L;  2CW0 D;  4IFD H;  1V4Y A;  2NVX H;  1XX8 A;  4HR7 B;  3Q24 A;  1N56 A;  1MKH A;  4KHZ A;  1FNW A;  3MWM A;  4IWY A;  4M9U A;  5FLM H;  4DLK A;  2D5D A;  1B3A A;  4YAJ B;  4EEQ A;  1Y8O B;  5CV6 A;  1SYX B;  3CMA A;  1HZ9 A;  1PHJ A;  3PO3 B;  4DV3 Q;  1JIH A;  2MP1 A;  3OUU A;  2EJG C;  2IL8 A;  4L5Q A;  2AHO B;  2F3W A;  2EYH A;  1PZK D;  2Y0S B;  5DNF A;  3MFH A;  4JI8 Q;  2DIK A;  2JA9 A;  4A3E B;  3G6X A;  4JV1 A;  1LUZ A;  2QEX A;  4OHJ A;  3H15 A;  5KFW A;  2CQO A;  1OTC A;  2FIN B;  2Q2T A;  1C0A A;  2YRX A;  2N88 A;  2RDI A;  2RA4 A;  5FK9 C;  4DK0 A;  1K9M C;  4JI7 Q;  2F3V A;  3A7L A;  2PQE A;  4B3S L;  5C44 H;  4QIW A;  4ULL A;  5GON F;  1KXL A;  4J9M A;  1HZC A;  1S5B D;  5C8Y F;  3R3O A;  3K81 C;  5C4X G;  4CHT B;  2E5L Q;  2PQA A;  4OXP A;  1Y69 U;  4EFE A;  3NUC A;  1L1O C;  1SNC A;  3ERS X;  1MBY A;  2ALY B;  5L1I A;  1JJC B;  4LK1 C;  4IUV A;  1IBM Q;  4BWG B;  5JEA G;  4ZQI A;  3B6Y A;  1HR0 Q;  4A93 G;  2KQ3 A;  4V19 0;  2Y0S E;  3DMU A;  4DV3 L;  1GVP A;  1SRO A;  3QG1 A;  3I3C A;  4DNR B;  5KYL A;  4R4O A;  1B33 N;  3JSL A;  3GTL A;  1PH4 A;  5KG4 A;  3CD6 A;  5CV7 A;  3NP8 A;  3J7Z C;  1Q86 C;  2EQS A;  2HT1 A;  5BPF A;  2JEF A;  4O2D A;  5DM6 3;  5EKI A;  1QIL A;  4FVM A;  1HNZ L;  4ED7 A;  4U68 A;  1LTI D;  4UCR A;  3KF8 B;  3MXN A;  3GTM H;  3S17 H;  2VB3 X;  4G7H C;  2X0S A;  4Q45 A;  2W9B B;  1PVO A;  4P75 A;  4A3J G;  1L2Z A;  4X62 L;  4X62 H;  1O80 A;  1S03 G;  3TP6 A;  1VQB A;  1QWY A;  3KAK A;  4O0A A;  4IHJ F;  3VPC A;  4JBW A;  5IWA Q;  2RCF A;  3LWB A;  4KD3 A;  2Z4I A;  3DXJ C;  4RGN A;  4XYQ A;  2Z0S A;  5KFL A;  4A3M H;  2OQK A;  1EIH A;  3PO2 B;  5LMU H;  2I5M X;  3IRB A;  1DOM A;  3BDO A;  1SND A;  2ZXP A;  2GPW A;  2AGQ A;  5C4H A;  3M9N B;  1M6V A;  3J81 c;  4DV3 H;  2QW7 A;  1IW7 D;  4KV6 A;  3LWU A;  1PDQ A;  3ERQ A;  2K52 A;  1I94 L;  1PFS A;  3RBE A;  3KLS A;  1BBX C;  5KKN B;  2D2C C;  2PI2 E;  3TSS A;  2WAC A;  2NVT B;  2I0Q A;  1TWF A;  1SE8 A;  4O4H F;  2RVL A;  2B2W A;  1YNX A;  3BAA A;  2ID0 A;  1B53 A;  1JX4 A;  1NR2 A;  1SJE D;  1VKZ A;  5M5Y H;  2EYO A;  2Q8I B;  5KIX A;  1ROD A;  3PF4 A;  4X66 H;  5M5Y B;  2F3I A;  2VUG A;  2ATL A;  2JN4 A;  4DL4 A;  1TWC B;  1CM9 A;  3GID A;  1VQH A;  5D8D A;  1I50 A;  1D5Z C;  5IYZ F;  2TSS A;  1RJR A;  3RF2 A;  1J9O A;  2R87 A;  5KT6 A;  1EUC B;  1S10 A;  3DUZ A;  4JYA L;  3GTQ A;  5DQH A;  1DZ1 A;  2CHB D;  1VS0 A;  2MGS A;  4F4W A;  1HNZ H;  2FLP A;  2MFI A;  5T14 A;  4DR4 L;  1T36 A;  4DGZ A;  1I6H H;  1EWC A;  1B44 D;  2C35 B;  2V4Q A;  3KUP A;  4DU9 A;  4EGV A;  5C44 B;  1AZQ A;  1ESR A;  4JPB W;  3RNU A;  1I94 Q;  4DR1 L;  3PGZ A;  3NWT A;  2KEN A;  3EVQ A;  5FOB B;  2R86 A;  3W1G A;  4DFA A;  2DNE A;  4HID A;  2NN6 G;  1NJI C;  1EZ6 A;  1GSA A;  2SEB D;  2R8K A;  3H6M A;  3AMU A;  2K28 A;  3J81 i;  4KKS A;  4GZY C;  1VQL A;  1DV2 A;  2ALZ A;  3AYH B;  2A6H C;  2YYA A;  1KTK A;  5IYC H;  3VDY A;  1FD7 D;  3HOW B;  3SVM A;  4M7E A;  4JI2 L;  4IFD G;  3TS2 A;  1JWU D;  5I2X A;  1UC8 A;  3U58 A;  2JXM B;  3C1F A;  4DR7 L;  4DR7 H;  3HOW G;  2JQO A;  3V6J A;  3S17 B;  1B9M A;  2W70 A;  4DR7 Q;  1R9T H;  2QYZ A;  2GPS A;  2WII B;  1TR5 A;  1F2Y A;  3RV4 A;  1E7Z A;  2HHH L;  2V59 A;  5J2U F;  1HPC A;  2IPK D;  3TBI B;  3S2D H;  2ZTE A;  4LWC A;  1B2T A;  1JE4 A;  5M3M H;  1CT1 D;  4AYB B;  4WJ4 A;  3RMH A;  3V05 A;  1BBW A;  4Y7N B;  1K83 B;  4H44 C;  2JA5 G;  1YZ6 A;  1L1O B;  2IX0 A;  4BXX G;  1RK5 A;  5FPO A;  3K5O A;  3H0G A;  4YJ3 F;  5H1S E;  3OTO Q;  2O03 A;  2E5L L;  1VQO A;  5LL6 X;  2MPM A;  3CHB D;  4E4T A;  4LFC L;  4DV2 L;  4XYM B;  1JOO A;  3OYY A;  4ALP A;  4LF5 L;  4ZUJ A;  2WIN B;  5J3B A;  2NU9 B;  4B3S Q;  4IWX A;  1CHP D;  4QWD A;  2Z1C A;  1RIP A;  3TP5 A;  5CBA E;  2K6A A;  4YWL A;  4K0K Q;  3KAL A;  3G71 A;  3QFF A;  3I4L A;  4XQQ A;  3K5L A;  5FLX E;  3OHB A;  2W9C B;  4GC6 A;  4EFB A;  2L0C A;  4JI1 L;  2K50 A;  3EYY A;  4XXE A;  3NWS A;  2BR0 A;  1G2T A;  2A19 A;  3RUP A;  3SK6 A;  3MR3 A;  2QKI C;  3OHX C;  4ZK9 B;  5FLM G;  3CW2 C;  2RDG A;  3GIM A;  1YNN D;  3A55 A;  2XD4 A;  4B3T L;  3ITP A;  5E1F A;  1JOK A;  2K5N A;  2HVQ A;  1BXR A;  1X3Q A;  4H0L C;  4Q8E A;  2R7F A;  4A3I G;  4DNI A;  2KSW A;  1RD9 D;  2DY8 A;  2GVB A;  2KCN A;  4Q8F A;  2UU9 Q;  1VQN A;  1B4O A;  1KD1 C;  1V1Q A;  2K03 A;  1Y8N B;  3F2C A;  1N36 H;  1HNX L;  3ULL A;  3N43 B;  1A15 A;  5KND A;  1EQR A;  2AQ1 B;  4F88 A;  4UCU A;  4X64 L;  3FKI A;  1UE6 A;  4MV4 A;  1LTR D;  5KFR A;  3V4S A;  3CCM A;  4HNU A;  3I91 A;  1XPR A;  1GO3 E;  2BH8 A;  3MHB A;  4FF1 A;  5F2D A;  3GTG H;  2FXQ A;  3MAQ A;  4A3L H;  3GTP A;  3JRW A;  3GTJ A;  3ICE A;  4NMZ A;  3LNN A;  4RG1 A;  1KRT A;  1T94 A;  1LO5 D;  3GV3 A;  4FF4 A;  5HV6 A;  4K2K A;  4QUC A;  3PIO A;  4HSP A;  3JC6 6;  3RB3 A;  5LMN H;  4JV5 L;  2YU9 B;  1IKM A;  3M4I A;  1S0M A;  4MTK A;  5KGU A;  3M4O B;  1DIK A;  1PRT C;  2NVX A;  2AUK A;  2XGP A;  4IUP A;  2OF1 A;  4JI1 H;  1S4Z A;  3RV3 A;  5LYJ F;  4GNX B;  3Q8D A;  2K5H A;  2O2L D;  2V58 A;  1N33 L;  1R9T A;  5IT9 W;  2Q8T A;  3HKZ E;  3GV8 B;  1SJH D;  4GKK H;  2EYM A;  5J39 A;  1EUD B;  3QZ8 A;  2W57 A;  1IHZ A;  2XGQ A;  1RL2 A;  3V6H A;  1M90 C;  3TZU A;  5DGB A;  3BAB A;  4EG0 A;  2KJX A;  2Z6K A;  2UUC Q;  4R8U A;  1WTQ A;  3GLK A;  1U0L A;  5JAV A;  3CME A;  5BR8 H;  5K36 H;  5DG9 A;  1SEI A;  2C28 A;  3I4M G;  1Q81 C;  3J80 c;  2AKW B;  2A6E D;  4C3I G;  1JB3 A;  1TQO A;  4UP7 A;  4LF8 L;  4WBN F;  4IOC A;  4F4X A;  2E5L H;  4HJ5 A;  2VS1 A;  1A9X A;  2YTV A;  5LL6 b;  5G3L F;  2ZXO A;  5M5X B;  2Q2I A;  2V4D A;  4JYA Q;  5JJI A;  5L9X A;  1SYC A;  4LUV A;  1BXT A;  2YW2 A;  2GVA A;  4KJO A;  3VYU A;  1JWS D;  1WTO A;  2V5A A;  1RYS A;  2RDJ A;  4JVZ A;  4DNT B;  3M9O B;  1HR0 W;  4A3K G;  4KMU C;  1PH1 A;  3R23 A;  3HOU G;  1OO9 B;  2B2V A;  3K7U C;  2W6O A;  1PXU A;  3SI8 A;  1ENC A;  4ZAI A;  4GOP C;  2E2H B;  4KHV A;  1VQ4 A;  3KF6 B;  2YZM A;  4A3F B;  2AWO A;  2WE6 A;  5K2M A;  2B29 A;  3VR4 A;  5C1P A;  4DK6 C;  3HOU B;  4FBU A;  4EBC A;  1SYB A;  2XRS D;  2X69 A;  4DV5 L;  1YJW A;  1M0W A;  4DV5 H;  2DPJ A;  3PZP A;  2JK8 A;  3NTK A;  1VAJ A;  4IO9 A;  2RGR A;  3AEV A;  1PZJ D;  3S2D B;  5ELE A;  3HOY B;  4PDB A;  3F8N A;  3TME A;  2QDB A;  1PTO C;  2A69 C;  4DV6 Q;  4BA1 I;  2XTI A;  1A0I A;  3I8Z A;  4IUN A;  3A5Z B;  2NUC A;  3EPG A;  3HOY G;  5CAE B;  3AQQ A;  3FEW X;  1VF7 A;  1L0X B;  2XRQ D;  2YTX A;  1GUN A;  3CCU A;  4TRD A;  1CQJ B;  4C3I B;  3RB0 A;  3A0J A;  3KYH C;  3C0F B;  2PW5 A;  4B3R H;  5IWA H;  4RB1 A;  5KNC A;  3PUZ A;  1I3Q A;  2F0N A;  1YNJ D;  2R7L A;  3F2B A;  2BDN A;  3G7L A;  3RFC A;  2A73 B;  2HHH Q;  1FGU A;  3K57 A;  3RGX A;  5GQO A;  1GUT A;  1Q3L A;  4ODG A;  3Q2O A;  1EQT A;  4R7R A;  3VYS A;  2YU9 A;  1E1T A;  3N8D A;  4BWS C;  3J81 E;  1AN8 A;  1K1Q A;  3RUZ A;  2K32 A;  2UUC H;  1G8Z D;  1STH A;  3S1Q H;  3I4N H;  4Y7N H;  4H13 C;  1XPO A;  3T5H A;  4ECS A;  3UFX B;  3D0F A;  4MZ9 A;  4YCU A;  4AQY Q;  1T5X D;  3R5X A;  5L1K A;  3IN5 A;  1ZQ7 A;  1I7N A;  3A8K E;  1I50 H;  2W6Z A;  4JI3 Q;  4LSX A;  3GIJ A;  1VQC A;  2B8F A;  2Y0S A;  2YRW A;  1SSO A;  3JSN A;  5IYD G;  4J9R A;  1EQQ A;  2JA8 B;  4KKT A;  5IP7 H;  4WOR A;  1Z2O X;  2FK3 A;  3QOJ A;  4KY6 A;  4JOI A;  1VDZ A;  1KAW A;  2UVU A;  2NN6 H;  2O5I C;  4JI7 H;  5T1I A;  1Q82 C;  1PH6 A;  3MVV A;  5KG6 A;  3MXG A;  4GS3 A;  2CH4 A;  1ZHQ A;  3P1H A;  4RFB A;  4XT3 B;  2F03 A;  5KNB A;  4B9W A;  3CCQ A;  5EPK A;  2VUM H;  3NBH B;  1LT3 D;  4EYI B;  5JH7 F;  2GA4 B;  4ME6 A;  4O42 A;  2O4X A;  3V6K A;  3PW5 A;  4R9W A;  3IFD A;  3J7A K;  4KHP H;  3UDX A;  2PNH A;  5KFV A;  3VPB A;  3I4M B;  3N6X A;  1FNU A;  4ILW A;  1AE3 A;  4Y52 H;  3RLO A;  4LF9 L;  3PIP 3;  5J1Z A;  2F0E A;  2WFW A;  4PQX A;  5KEE A;  4PZ6 A;  1EYA A;  4DAP A;  2IA6 A;  1H9J A;  4UHV A;  4K8I A;  1EWI A;  2R61 A;  2ZDG A;  1STY A;  2FLL A;  2J0T D;  1GXD C;  4J9O A;  4DR6 Q;  1F77 A;  2EPB A;  4MTN A;  2AU0 A;  1G91 A;  4LF6 Q;  4YJ2 F;  5J22 A;  3HBL A;  4ZLT F;  2CH4 W;  4ZKC B;  1EIF A;  3S1N B;  4PMB A;  4I50 F;  5JUM A;  3G6V A;  2JA5 A;  1QNU A;  4GN5 A;  5T1G A;  1PV4 A;  3MR6 A;  2PBZ A;  2AGP A;  2BQ3 A;  4NXM Q;  4BA2 I;  3VR3 A;  5M3M G;  3HZX A;  2CZG A;  1TWH H;  3TS0 A;  2Z6K C;  1HJP A;  4KY5 A;  2XCP A;  2AQ4 A;  1GD7 A;  4KHP L;  1YNN C;  1TWG H;  3I72 A;  3HOV H;  4IUU A;  4K14 A;  3MEF A;  3RB6 A;  4X65 H;  2HIX A;  2E2J H;  4K0K H;  5KG3 A;  2Y0S G;  4FS1 A;  5IWA L;  3NQT A;  3BYT B;  1XPU A;  4OO1 H;  3ETH A;  4A3E G;  2K5Q A;  2OEO A;  4O1N A;  1VBG A;  5KFK A;  4HSV A;  1P16 A;  2B2T C;  5HGT A;  3RN5 A;  5KT4 A;  4NPS A;  4IAL A;  2VUM G;  3GV5 B;  5DGA A;  1RYR A;  2NZH A;  1MJC A;  3T1Y H;  2PNR C;  3OTO H;  1A3T A;  4DL2 A;  1ASZ A;  1M8A A;  2QF7 A;  4ED8 A;  1J5E L;  2E2H A;  2DN8 A;  2JEJ A;  5HGQ A;  3RZO B;  2N55 A;  3BJY A;  3D6C A;  4QIW E;  4YHH L;  4DR5 Q;  1NTG A;  4XDX A;  1BF4 A;  5F9L A;  2OCE A;  3KBG A;  5AFW A;  1C8C A;  2VUM A;  1BO0 A;  5E4X A;  4LF9 Q;  2ZT9 C;  4ECR A;  4RKL A;  1UNS A;  4B08 A;  2UXC H;  1C4Q A;  1XNQ Q;  3GTL H;  2IWH A;  3VR6 A;  2E2J B;  2Q2H A;  4IPH A;  4IFD I;  3RLF A;  4RAZ A;  2A8V A;  4DF7 A;  1N34 H;  1CQV A;  4GNX C;  2PN1 A;  3QIA A;  1TT2 A;  1HQM C;  4AIM A;  3S1M H;  2A74 C;  1WTR A;  4RNO A;  3GO5 A;  1KLG D;  3FKI H;  5D3I B;  2M05 A;  1M1K C;  3Q8S B;  3PO2 H;  1KRS A;  3RAQ A;  2XCA A;  4RNN A;  2IX3 A;  5FD5 A;  5LMN Q;  5IP9 H;  5CB4 F;  4DR3 L;  1KJ9 A;  3OWE B;  3M3Y H;  1XNR H;  3L7Z C;  3SHL A;  2JA8 G;  4C3I H;  1XMQ L;  1XMQ H;  5C5J A;  1D8L A;  1RHP A;  1Y1W A;  3HB9 A;  1V1O A;  2HD3 A;  4JI8 L;  2W9A A;  1IXR A;  3J7A 5;  5AJ3 Q;  2ASJ A;  4OEL B;  5C5L A;  4PZ7 A;  2WV6 D;  2OTL A;  4A2B A;  2A6H D;  2J6U A;  4RCO A;  1SCU B;  2YYZ A;  1TWF H;  3FMA A;  3G6Y A;  3MWY W;  3TEH B;  3K7A H;  3T1Y L;  2F0F A;  1Y1V B;  5KFA A;  1X6O A;  3TN2 A;  2VQF L;  3RJ0 A;  1S0N A;  5I4D A;  1PFM A;  1VQM A;  2VQE L;  1PFN A;  1IL2 A;  4J9K A;  2UVW A;  3GIK A;  2J9G A;  1G6Z A;  1KIX A;  2R92 G;  4XIG S;  1PRT F;  4OX9 L;  3KFU A;  1PRT D;  3PW4 A;  1GHJ A;  1EIY B;  1VQA A;  5LMU L;  5FPR A;  1GUO A;  2F0O A;  4JI4 H;  3MFY A;  5CBE E;  4LSA A;  3TQ1 A;  3H09 A;  4JV2 A;  4JI6 L;  1WFQ A;  4LFB H;  5EKL A;  4X66 Q;  5KG2 A;  1GLV A;  5KT3 A;  2NUA B;  4IJH A;  1I50 B;  2N8N A;  4NDX A;  1QJO A;  1NY4 A;  2KEE A;  1R4P B;  1CHQ D;  2X6G A;  5EPL A;  5KFS A;  4IR1 A;  1UE7 A;  2W9B A;  3D8G A;  4ZCK A;  4OGQ C;  4K5X A;  4B3S H;  1UUP A;  1RF2 D;  3I7F A;  3S2H H;  1XNR L;  3I4M H;  3TRE A;  1K8A C;  1RDP D;  3RAX A;  2VQF H;  1OXU A;  2VA2 A;  5JJK A;  3L0O A;  2L5T A;  5FJ8 G;  2K1B A;  1LT6 D;  3M4Y A;  5HUR A;  2DJG C;  2E2H H;  3I4N G;  2VUM B;  1D6E C;  2E2I B;  5ISR A;  5H80 A;  1IW7 C;  2VXW A;  4UPA A;  1XYI A;  4UCS A;  1G51 A;  2C2E A;  3J80 i;  5HY6 A;  5JJZ A;  4Q43 A;  4KN4 C;  1VQI A;  2MO0 A;  4QB4 A;  1WOC A;  2NTT A;  4A76 A;  4QY7 A;  2R92 B;  4B9X A;  1J8I A;  1U4M A;  1KLU D;  4L6T B;  4O3O A;  4ECV A;  2DLN A;  3A5U A;  1NR4 A;  2DPI A;  3OIQ A;  1BDO A;  2JEI A;  5M3F G;  4A3D H;  4GOP B;  3KF6 A;  4WD3 A;  1K83 A;  1Y1W G;  1ZXT A;  2QK4 A;  2UXC Q;  5M3F H;  1KDC A;  1Q1E A;  1TWA H;  3I2Z A;  3PW7 A;  1OXT A;  4N8X 1;  3OOC A;  5FO9 B;  5M3F B;  4C5C A;  2AGO A;  1IBM H;  3IAY A;  4AH6 A;  5L37 A;  3RZD B;  2B2V C;  3DM3 A;  2RDF A;  3QJY A;  2FK2 A;  1EEI D;  1G29 1;  5CA0 F;  1ESF A;  3LML A;  3C1E A;  4I65 A;  3BQ0 A;  2AMC B;  5FO8 B;  1U5K A;  1K3R A;  3PR5 B;  4NXN L;  1EZ1 A;  2W7P A;  4RGT A;  1QVC A;  4A3K B;  2WDT A;  4XX0 B;  1GGO A;  1ZEQ X;  4UP8 A;  4EQO A;  4X64 H;  4UFZ A;  2FPP B;  5IGF A;  2R3Z A;  3HFZ B;  3IKJ A;  1V1P A;  3V96 A;  3RD4 A;  3CAM A;  4DK3 C;  1TWG A;  3A8I E;  2KEC A;  2Z4H A;  4JI0 H;  1N33 Q;  2FK1 A;  2WKD A;  1D1K A;  1GUG A;  1D5X C;  2K4K A;  2PMZ A;  4LF7 Q;  3LP8 A;  4A3C H;  2NVY H;  2M9V A;  2RF4 A;  4FO2 A;  4CDD C;  3TIG A;  3ERO A;  5IYC G;  5BN3 A;  3EBE A;  4U7C A;  3JAM W;  4B3T H;  1LM0 A;  1C48 A;  1UNN C;  3KDF A;  1FNV A;  1WCM H;  1CSQ A;  3FKI B;  4A3B G;  1DXM A;  2OTJ A;  4MIU A;  3UI2 A;  1Y1W B;  1A2U A;  1IBM L;  1W3S A;  3V2T A;  4HAE A;  4ETS A;  5C6A A;  4A3I H;  4A3F H;  2WAQ A;  3TRZ A;  1KQS A;  3Q8R B;  4DR6 H;  2C00 A;  4DR6 L;  1K1S A;  4ME3 A;  1Z2N X;  4HCE A;  3P7J A;  1L0Y B;  4A3I B;  1KHI A;  2B8G A;  1NAP A;  1N36 L;  4RZR A;  3E6Z X;  2R92 H;  3MWD A;  1OXS C;  1R4Q B;  3BZK A;  3KDF B;  1I4Q A;  1XDN A;  2OXP A;  2HCI A;  2K01 A;  2F0P A;  3NEN A;  2EJM A;  4HIM A;  3OPO A;  3ND8 A;  5JEA J;  4HQ6 A;  1EYZ A;  2E2I A;  4GKJ L;  2F0H A;  2CQY A;  2FJZ A;  5J2T F;  2CQA A;  4ZI7 F;  4DUZ L;  2KBN A;  1ILP A;  2E8G A;  3LWE A;  1QZG A;  5M5W B;  2EYP A;  2W71 A;  5FJ8 H;  2QIL A;  3H0G H;  2AQ2 B;  1YHA A;  3MEH A;  3UDI A;  4DR3 Q;  1ZYR C;  2UXB H;  1I3Q H;  3SEB A;  5IE8 A;  3PSI A;  3F8T A;  3IL8 A;  4K6D A;  1IBK H;  2FMM A;  4JI2 H;  2ZTC A;  2F0W A;  4C3J G;  3JAM i;  1SRU A;  5CV9 A;  1BNZ A;  2UVR A;  1Y1V H;  3F1Z A;  4QF4 A;  2Q2U A;  1LTB D;  2D0P A;  4R4Q A;  5I47 A;  1VQE A;  1WTP A;  2J7Z A;  3PO3 G;  4PMC A;  1HCZ A;  1CFM A;  1ET6 A;  1C30 A;  1EY7 A;  4ECW A;  1I5F A;  3T5L A;  1C9O A;  3KLS X;  2J4X A;  1AW7 A;  1DM0 B;  4C1N K;  2F4I A;  1YEZ A;  2L15 A;  4ABN A;  3M7G A;  2K5V A;  3R5F A;  2F0V A;  4WRD A;  3OMC A;  4DV0 H;  1H9R A;  2HIV A;  4PNY A;  1X9N A;  3BG3 A;  3PIP A;  5FLX c;  2A1A A;  5C3E G;  3GTL B;  4L5T A;  3FPU B;  4BBR H;  1F2Z A;  3K0Y A;  4P73 A;  3D6W A;  4UP9 A;  1F9R A;  1EHI A;  4EGQ A;  1TU2 B;  2BCO A;  2NVY A;  1IYV A;  3T51 B;  2MJ8 A;  4DUZ H;  4F4Z A;  3A8J E;  1TS3 A;  2HJW A;  4MV8 A;  2UUA H;  4RUC A;  1IZ6 A;  4R1J A;  3JAM c;  3EIV A;  2P5Z X;  1I4H A;  5JVG 3;  4ECY A;  2EJF C;  1SE2 A;  4DAV A;  1MJE A;  2BQR A;  2F0D A;  2R92 A;  4RAU C;  3OW2 A;  5A2Q W;  3T53 B;  4DUY H;  4F87 A;  5IP9 G;  3QO2 A;  5GRO A;  4AYB E;  4A3G G;  1CKO A;  2D9U A;  1D2B A;  3BA8 A;  3FKI G;  1SR3 A;  5A35 A;  4ED0 A;  4H7B A;  1KAA A;  3T4A C;  1EYD A;  2FJ2 A;  4XTC S;  4HN7 A;  3HOZ G;  1JE5 A;  2RHS B;  1Z9F A;  2WAQ G;  3NE5 B;  1LLR D;  1K8G A;  5IY0 A;  1VQ5 A;  3MA2 B;  4QWA A;  1EQV A;  3HOW H;  1SYD A;  3BDL A;  1AUX A;  4PG3 A;  1DOK A;  1I6V C;  2DGY A;  3HKZ B;  4J9S A;  1UWV A;  4JBM A;  2NU6 B;  3MWE A;  3BQ1 A;  1K8O A;  2RKS A;  4NKL A;  3K7A B;  1LAC A;  2OT2 A;  1I6U A;  3F2D A;  3QB3 A;  1F2L A;  5KFF A;  5JVL A;  4A4I A;  3CXC A;  3M7N A;  2EYF A;  2K7V A;  5ELB A;  3T56 B;  3X3N A;  4DUY L;  4G7Z C;  1KJQ A;  1S3O A;  4BS9 A;  2IHE A;  3SE7 A;  4DL5 A;  1H9M A;  3RLN A;  1QVG A;  4LF4 L;  3E0J A;  2JEA I;  2IP4 A;  2EY1 A;  4QL5 A;  2UUB L;  3RBD A;  3H3V C;  1CTM A;  2DUD A;  1IBL Q;  2D62 A;  1CA5 A;  1P8L A;  5DM7 3;  3DEO A;  3J7A F;  3GTK B;  2ZM6 H;  1ENF A;  2ZM6 L;  2RBM A;  5D1O A;  2KCT A;  1YI2 A;  3S15 H;  3KHL A;  3SK8 A;  1WD0 A;  2IT1 A;  1L2F A;  2FPI B;  3BVM A;  4ZQ3 A;  3S15 B;  2UXD Q;  3D4W A;  2E2D C;  4MN3 A;  3ORR A;  5BR8 L;  1HA6 A;  3D4D A;  2VA3 A;  4K5V A;  4UDU C;  4J15 A;  4YR2 A;  1SYE A;  1VMC A;  3HKZ G;  1GUS A;  3NK9 A;  4EQ5 A;  1HNW Q;  2B2W C;  4DR2 H;  1FKA H;  3GTG A;  4BBR B;  1VQ9 A;  1M4V A;  5KFP A;  5I6W A;  3QWN A;  2HVS A;  2YZN A;  4Q0Y A;  2RCN A;  2FPG B;  4A3G H;  1SNO A;  2NWG A;  4NB3 A;  5KFZ A;  1S9F A;  3CQZ A;  3HGB A;  4DV4 L;  5DQI A;  3AFP A;  4LF4 H;  5C4X H;  3H94 A;  1QG7 A;  1HNX Q;  1X55 A;  4DKA C;  1S40 A;  2F4V H;  1JDE A;  3NEM A;  5C3E H;  5EBC A;  1HXY D;  4C3H G;  4DV1 H;  2PQA B;  1EEF D;  2JJQ A;  5ELC A;  1B8A A;  4A3M B;  4YHH H;  4EGJ A;  4YY3 Q;  1PX2 A;  1LTT D;  3W1B A;  1AEX A;  2VZA A;  1TWA B;  1IOV A;  3HRZ C;  5IGB A;  2K5D A;  1SLJ A;  3FDS A;  3D31 A;  1ASY A;  2HVR A;  3OUZ A;  3Q6S A;  1BCP F;  4HMI A;  3C46 A;  1UEB A;  1TWC H;  1SBB B;  3K0X A;  2P0A A;  2R8G A;  1CK1 A;  2XWJ B;  2AWN A;  5IGG A;  3EQL C;  3RGZ A;  1WD1 A;  2SDF A;  2EY6 A;  2WYO A;  4JUZ A;  1Q46 A;  5F9N A;  4DR4 H;  2F0J A;  2PCF B;  1PH9 A;  2BDO A;  2VQD A;  2RHQ B;  4WJ3 M;  2F0L A;  3P75 A;  5CYU A;  4MV3 A;  1F9Q A;  1WTW A;  1TVX A;  3S1Q B;  4DV4 H;  4GLX A;  1TXY A;  1Y1V A;  3I4N B;  2WAQ B;  4LFC Q;  1BNC A;  1HFG A;  2WB1 G;  5LA6 F;  3GP7 A;  4YIJ A;  1VQK A;  3OW7 A;  4YP3 A;  4CDF C;  1CS0 A;  2ASB A;  2LKV A;  2XSC A;  1WTH A;  2O5J C;  1J5E H;  3PVX A;  1AP0 A;  1EY4 A;  2F0I A;  3STB D;  3HOZ H;  2NVY B;  1JOQ A;  3H20 A;  1DJR D;  3N52 A;  4XZ3 B; 
#chains in the Genus database with same CATH homology
 1SRO A;  2QA4 A;  2OCE A;  1QZH A;  4RMF A;  4R4O A;  4LF9 Q;  1PH4 A;  1Q8K A;  3CD6 A;  4YWM A;  3J81 j;  4QGU A;  1XNQ Q;  3J7Z C;  1Q86 C;  4P72 A;  2EQS A;  5DLQ E;  4B3M Q;  2HT1 A;  2Q2H A;  4IPH A;  3GTL H;  4A3L G;  1L0W A;  1NMF A;  3GD7 A;  4IFD I;  4O2D A;  3RLF A;  2N49 A;  4GNX A;  2E2I H;  2JA5 H;  1HNZ L;  2A8V A;  1PA6 A;  4GNX C;  5C0X I;  3KF8 B;  2R7D A;  1FVI A;  1XTD A;  3GTM H;  2OQ0 A;  3S17 H;  4AIM A;  4IJL A;  1J5E Q;  3S1M H;  3GO5 A;  1PVO A;  4P75 A;  3CP0 A;  4A3J G;  1Y1W H;  3HOY H;  4X62 L;  3PF5 A;  2QGQ A;  4X65 L;  3FKI H;  3M4Q A;  2IX1 A;  1JJG A;  1M1K C;  3PO2 H;  1KRS A;  1N8R C;  1VQB A;  3CCE A;  4JC0 A;  5LMN Q;  4O0A A;  5IP9 H;  4DR3 L;  3U4Z A;  4JBW A;  1NMG A;  5IWA Q;  3M3Y H;  3L7Z C;  2JA8 G;  4C3I H;  1XMQ L;  1K73 C;  2R7Z G;  2Z0S A;  3OTO L;  3H3V H;  1D8L A;  4A3M H;  2OQK A;  3S16 H;  2NZO A;  3UDG A;  1FJG L;  2V1C C;  2I5M X;  3IRB A;  4A3B H;  3CF5 A;  1WCM G;  4JI8 L;  3W5O A;  2UUB Q;  4BY1 G;  1IXR A;  1Q12 A;  2KCM A;  3J7A 5;  5E7N A;  4GKJ Q;  5AJ3 Q;  4BBS G;  3PCO B;  4PZ7 A;  3J81 c;  5EAY A;  4DV6 L;  4DR2 L;  2OTL A;  4GOP A;  2JE6 I;  3PUW A;  2K52 A;  2YU9 H;  1I94 L;  1PFS A;  4NXM L;  1K83 H;  2ZJQ A;  2PI2 E;  2B63 H;  2YYZ A;  1TWF H;  4K0K L;  2I0Q A;  1SE8 A;  2UUA Q;  3TEH B;  1YNX A;  3K7A H;  2ID0 A;  5M5W H;  1JMC A;  3KLW A;  3T1Y L;  1X6O A;  5M5Y H;  2VQF L;  1VQM A;  2VQE L;  2N78 A;  3PF4 A;  2F3I A;  5IT9 c;  2YTY A;  1IL2 A;  2F52 A;  2KHI A;  3M4O H;  1KL9 A;  1Y1V G;  4JI3 L;  1VQH A;  4PZ8 A;  4C3H H;  3HOX H;  4C2M H;  1KIX A;  2R92 G;  3S14 H;  3PUY A;  4XIG S;  4C3J H;  1E3P A;  4OX9 L;  3KFU A;  2UXC L;  4KLK A;  1EIY B;  1VQA A;  4LFA Q;  4OWX B;  5LMU L;  4JYA L;  2R93 H;  4JI6 L;  1WFQ A;  4X66 Q;  4UY8 C;  4TQU S;  1VS0 A;  1N34 L;  4IJH A;  2ATW A;  2MFI A;  1CSP A;  4FDB A;  2N8N A;  4DR4 L;  1NY4 A;  4JI0 Q;  1VQ7 A;  1CKN B;  4A3D G;  4HJ8 A;  1I6H H;  3CPW A;  1VQP A;  5BR8 Q;  4P74 A;  2H5X A;  2C35 B;  1C7Y A;  1UE7 A;  4L5R C;  1VQF A;  3HOV G;  4LUZ A;  3H3V I;  2BH2 A;  3BU2 A;  2VW9 A;  3I7F A;  3K80 C;  3RNU A;  3I4O A;  4DV2 Q;  4DR1 L;  3PGZ A;  1I94 Q;  3TRE A;  1XNR L;  3KOJ A;  2KEN A;  3M9B A;  1K8A C;  1XMO Q;  4OWW B;  3W1G A;  3CCV A;  1OXU A;  4HID A;  5JJK A;  3L0O A;  4GLV B;  2NN6 G;  5AJ3 L;  2ZTD A;  3UE1 A;  5FJ8 G;  3I55 A;  3KJP A;  1NJI C;  4X66 L;  2JA6 H;  2LXK A;  4GN3 B;  2E2H H;  3I4N G;  5LMU Q;  3J81 i;  1VQD A;  1FJG Q;  1VQL A;  1H95 A;  3AYH B;  1VCI A;  4UPA A;  1JJ2 A;  2BA0 A;  1G51 A;  3J80 i;  1PYB A;  5IYC H;  5HY6 A;  4AQY L;  4NXN Q;  3VDY A;  3SGI A;  1MIU A;  1VQI A;  2MO0 A;  1WOC A;  3EN2 A;  4JI2 L;  4IFD G;  3TS2 A;  4A76 A;  4QY7 A;  1PH3 A;  3U58 A;  4DR7 L;  3E9H A;  2IY5 B;  3HOW G;  2JQO A;  3PUX A;  5ELN A;  3A5U A;  1KC8 C;  4DR7 Q;  1R9T H;  1W2B A;  1A63 A;  4HIO A;  4JI6 Q;  1E7Z A;  2KHJ A;  5M3F G;  2HHH L;  4A3D H;  4GOP B;  3KF6 A;  4GKK L;  4A3J H;  2MO1 A;  2ZTE A;  1Y1W G;  3S2D H;  4LWC A;  2UXC Q;  2LXJ A;  1D7Q A;  4JBJ A;  5M3F H;  3RR5 A;  5M3M H;  4L5S A;  1Q1E A;  1TWA H;  3RN2 A;  1PH8 A;  4WJ4 A;  2BA1 A;  3I2Z A;  1BBW A;  1OXT A;  2ZJR A;  2JA5 G;  1YZ6 A;  1L1O B;  3CCS A;  4OO1 I;  2IX0 A;  3E0E A;  3GTO H;  3G48 A;  4BXX G;  2PI2 A;  4AH6 A;  1N36 Q;  1JT8 A;  1X3F A;  3DM3 A;  4IPC A;  1G29 1;  3CCJ A;  3PV0 A;  5H1S E;  2AMC B;  3OTO Q;  1U5K A;  1VQO A;  2E5L L;  1K3R A;  4LW1 A;  4LFC L;  4NXN L;  4DV2 L;  4DR1 Q;  4A93 H;  3GTJ H;  1QVC A;  3OYY A;  4ALP A;  4LF5 L;  5J3B A;  5LMN L;  3STB C;  3CQZ H;  4UP8 A;  4B3S Q;  1E24 A;  1RIP A;  4DV5 Q;  3CC7 A;  4YWL A;  4K0K Q;  4JI5 Q;  3G71 A;  5IYD H;  1LTL A;  3HFZ B;  4GLA C;  3CAM A;  1CUK A;  4JI1 L;  4DK3 C;  4JI0 L;  1NBW A;  1V43 A;  4DUZ Q;  2K50 A;  1N33 Q;  3PUV A;  1AH9 A;  2K4K A;  4LF7 Q;  1UE1 A;  4A3C H;  2A19 A;  2NVY H;  4LF7 L;  2RF4 A;  3RZO H;  5FLM G;  1GM5 A;  1YJ9 A;  4HIK A;  3CW2 C;  3E9I A;  5IYC G;  4IOA A;  1A62 A;  3EBE A;  4OX9 Q;  5C4J H;  4B3T L;  3UE0 A;  1LM0 A;  2K5N A;  4JG2 A;  4POG A;  3KDF A;  4BXX H;  1WCM H;  1CSQ A;  2K75 A;  2R7F A;  4GN4 B;  4YCW A;  4X64 Q;  4A3B G;  2OTJ A;  4YY3 L;  4A3I G;  1HR0 L;  4DNI A;  1E22 A;  2WB1 E;  2GVB A;  1IBM L;  1CKM A;  1W3S A;  4JI4 L;  4LFB L;  2UU9 Q;  1VQN A;  1WI5 A;  1KD1 C;  3UDF A;  1V1Q A;  4AYB G;  1CKN A;  4A3I H;  4A3F H;  2JA8 H;  3TRZ A;  5JJL A;  1KQS A;  1O7I A;  2VQE Q;  5GAE C;  4DR6 L;  2R93 G;  4ME3 A;  3I4M H;  5LMN W;  3F2C A;  1NE3 A;  3PO2 G;  1KHI A;  2F4V Q;  1EOV A;  1DGS A;  1N36 L;  1HNX L;  2NN6 I;  3ULL A;  4HJ9 A;  4LF5 Q;  2R92 H;  1EQR A;  1OXS C;  4YCV A;  4X64 L;  3BZK A;  1UE6 A;  2JA7 H;  3KDF B;  3CCM A;  1XPR A;  1GO3 E;  2BH8 A;  3T1H Q;  2CWA A;  4YWK A;  4GKK Q;  3NEN A;  4BY7 H;  3GTG H;  2FXQ A;  4HIM A;  5JEA J;  4A3L H;  4GKJ L;  5ELO A;  4BBR G;  4LNQ A;  1BKB A;  3ICE A;  2LSS A;  2GN5 A;  4DUZ L;  2KBN A;  1PH5 A;  1PH7 A;  1K0R A;  2E8G A;  4JI1 Q;  4RG1 A;  1KRT A;  1QZG A;  5GAD C;  3DLL A;  2HQL A;  1XMQ Q;  2UU9 L;  5FJ8 H;  2JA6 G;  4JI5 L;  2UXD L;  3H0G H;  4JI2 Q;  1YHA A;  1SN8 A;  1VQG A;  3UDI A;  2R6G A;  3PIO A;  4DR3 Q;  3JC6 6;  4A75 A;  1I3Q H;  1YIT A;  5IE8 A;  4JV5 L;  3PSI A;  3F8T A;  3FHW A;  2ZTC A;  3ER0 A;  1T9H A;  1L1O A;  3S1N H;  3JAM i;  1E1O A;  2VNU D;  1SRU A;  5K36 G;  4POF A;  4A3M G;  1OXV A;  1Y1V H;  3F1Z A;  3LGJ A;  2JA7 G;  4GNX B;  3Q8D A;  2K5H A;  2Q2U A;  1EUJ A;  2D0P A;  4R4Q A;  1N33 L;  3PO3 H;  1S72 A;  1SFO H;  1VQE A;  3HKZ E;  1EYG A;  1V9P A;  2WP8 J;  3PO3 G;  3M85 A;  1RL2 A;  5C0X G;  1M90 C;  4JBK A;  4BY1 H;  1N32 L;  1I5F A;  1XJV A;  3K8A A;  1C9O A;  2Z6K A;  2UUC Q;  4JOI C;  1U0L A;  3CME A;  5C44 G;  2D0O A;  3CPF A;  3GTK H;  3I4M G;  1Q81 C;  3J80 c;  2AKW B;  1YEZ A;  1VQ6 A;  2IHF A;  2L15 A;  2R7Z H;  2ZJP A;  2NVQ H;  2K5V A;  4UP7 A;  4PMW A;  1AE2 A;  4LF8 L;  4IOC A;  4HJ5 A;  2VS1 A;  2YTV A;  2HIV A;  3NEL A;  4JI4 Q;  4LFB Q;  5C0X J;  1X9N A;  3HOZ G;  2Q2I A;  2PMZ E;  4JYA Q;  5JJI A;  3PIP A;  4LUV A;  5FLX c;  2A1A A;  4DV4 Q;  2GVA A;  5C3E G;  1IBK L;  4B3R L;  4L5T A;  4B3T Q;  5M5X H;  1HR0 W;  4A3K G;  4BBR H;  1PH1 A;  4P73 A;  4H02 A;  2JEB I;  4UP9 A;  1YIJ A;  3HOU G;  3K7U C;  3I56 A;  1UE5 A;  4GOP C;  1X54 A;  1VQ4 A;  3KF6 B;  4P71 A;  2AWO A;  3HOX G;  2WAQ E;  2B29 A;  4DUY Q;  4DK6 C;  1QUQ B;  3KJO A;  1IZ6 A;  4R1J A;  3JAM c;  3EIV A;  4DV5 L;  1YJW A;  2UUA L;  3CC2 A;  1HH2 P;  2JK8 A;  4LUO A;  4EX5 A;  4IO9 A;  1EFW A;  1MJE A;  3AEV A;  5GAH C;  4MNO A;  3OW2 A;  5IP9 G;  3ULP A;  4DV6 Q;  5GRO A;  1BVS A;  2XTI A;  4AYB E;  1A0I A;  1CKO A;  4BA1 I;  4DV1 Q;  4A3G G;  3FKI G;  2N3S A;  1IBL L;  2I5L X;  1SR3 A;  3GDE A;  3A5Z B;  1PYS B;  3HOY G;  3L2P A;  3AQQ A;  2YTX A;  4XTC S;  4LF4 Q;  1JE5 A;  2RHS B;  1Z9F A;  2WAQ G;  3CCU A;  1K8G A;  1VQ5 A;  5IY0 A;  3A0J A;  3KYH C;  1A8V A;  1XNR Q;  3HOW H;  2NVT H;  3PUZ A;  3HOU H;  3F2B A;  4PG3 A;  2HHH Q;  1FGU A;  1HNW L;  5GQO A;  4A3E H;  2DGY A;  4DV0 Q;  4OO1 G;  1UWV A;  4X6A H;  4JBM A;  4DV7 Q;  1E1T A;  1N9W A;  1BBU A;  2I5H A;  1YHB A;  3MXN B;  4DV7 L;  4OON A;  1N34 Q;  1QUQ A;  2CCZ A;  5IP7 G;  4DV0 L;  3GTP H;  1Z47 A;  3WWV A;  3S1Q H;  3F2D A;  1N32 Q;  2EXD A;  3I4N H;  2UXB L;  4Y7N H;  1XPO A;  4LFA L;  2K14 A;  4A4I A;  3CXC A;  4B3M L;  3M7N A;  4A3F G;  1XNQ L;  4R4I A;  4BY7 G;  3D0F A;  4MZ9 A;  4YCU A;  1LYL A;  4DUY L;  4AQY Q;  1S3O A;  1SMX A;  2IHE A;  3FP9 A;  3S1R H;  3RLN A;  4DAY B;  1WYD A;  4QQB X;  1X3E A;  4R4T A;  1QVG A;  4LF4 L;  1I50 H;  4IPD A;  4JI3 Q;  2JEA I;  2YV5 A;  1VQC A;  3S24 A;  3ZJY C;  4QL5 A;  2UUB L;  2VY3 A;  2DUD A;  1IBL Q;  2D62 A;  5IYD G;  2OWO A;  2XGT A;  3BZC A;  4DV1 L;  1EQQ A;  1P8L A;  5IP7 H;  3H0G G;  2VQF Q;  1PH2 A;  1XMO L;  2ES2 A;  3T1Y Q;  2ZM6 L;  1Q1B A;  4JOI A;  1WJJ A;  4QJF A;  2KCT A;  3HKS A;  5GAG C;  1YI2 A;  1IBK Q;  3S15 H;  1G6P A;  1KAW A;  2MQH A;  2IT1 A;  1L2F A;  4DAM A;  1B70 B;  3A74 A;  1Q82 C;  1PH6 A;  4JI7 L;  4IFD J;  2UXB Q;  2CFM A;  2UXD Q;  4GS3 A;  4X65 Q;  1X56 A;  1YBY A;  5BR8 L;  4LF8 Q;  3CCR A;  3CCQ A;  4KI0 A;  4TVA B;  1Q7Y C;  2VUM H;  1HZA A;  3NBH B;  2CKZ B;  4DR4 Q;  4J15 A;  1X65 A;  1FL0 A;  3BJU A;  1HNZ Q;  3HKZ G;  4EQ5 A;  1HNW Q;  3UDX A;  4A3C G;  2PNH A;  1VQ9 A;  3GTQ H;  3M4P A;  3T1H L;  4Y52 H;  1AE3 A;  1J6Q A;  2B3G A;  2RCN A;  3RLO A;  4A3G H;  2EIF A;  1YHQ A;  4LF9 L;  4B3R Q;  4NB3 A;  4OWT B;  2WFW A;  4DV4 L;  1HZB A;  1VQJ A;  1YVC A;  3AFP A;  4PZ6 A;  4HJ7 A;  5C4X H;  1JB7 A;  4YHH Q;  2CWP A;  4DR5 L;  1HNX Q;  1X55 A;  4DKA C;  1S40 A;  2F4V L;  4APV A;  1EWI A;  2MNA A;  1QVF A;  3NEM A;  5C3E H;  1YJN A;  4LF6 L;  1Y14 B;  1VQ8 A;  4DR6 Q;  4MTN A;  2NVX H;  2PQA B;  4LF6 Q;  3RZD H;  3AFQ A;  1X3G A;  2JJQ A;  1MKH A;  4KHZ A;  1B8A A;  1GKH A;  1EIF A;  5IYB H;  2UUC L;  4JV5 Q;  1OXX K;  4YY3 Q;  4GN5 A;  3W1B A;  5FLM H;  1PV4 A;  2VZA A;  1B7Y B;  1SLJ A;  4NXM Q;  3D31 A;  4A3K H;  1ASY A;  3G4S A;  4BA2 I;  3CMA A;  1HZ9 A;  1UEB A;  3S2H H;  1PHJ A;  5M3M G;  1TWC H;  3U50 C;  4DR2 Q;  4KHP Q;  3K0X A;  4DV3 Q;  1TWH H;  2B63 G;  2AWN A;  3TS0 A;  4L5Q A;  2AHO B;  2Z6K C;  1HJP A;  4JI8 Q;  1Q46 A;  2JA9 A;  1GD7 A;  4KHP L;  1LUZ A;  1TWG H;  2QEX A;  3H15 A;  1PH9 A;  3TQY A;  3HOV H;  1IYJ B;  2CQO A;  2RHQ B;  5IYB G;  3MEF A;  1OTC A;  2Q2T A;  4BBS H;  1C0A A;  4JCV E;  4WJ3 M;  2HIX A;  1K9M C;  2E2J H;  2Y0S G;  5IWA L;  2VL6 A;  1XPU A;  4R4C A;  4JI7 Q;  4A3E G;  4GLX A;  5C44 H;  1TXY A;  3CC4 A;  3U4V A;  4B3S L;  1KXL A;  3RN5 A;  1P16 A;  4NPS A;  3G6E A;  4DPG A;  2VUM G;  4LFC Q;  1HZC A;  2NZH A;  1MJC A;  2WB1 G;  4IPG A;  2ZM6 Q;  3K81 C;  4X62 Q;  1VQK A;  5C4X G;  2E5L Q;  2ASB A;  2PQA A;  4OXP A;  1ASZ A;  1J5E L;  1L1O C;  3ERS X;  3STB D;  2ALY B;  3HOZ H;  5HGQ A;  4HJA A;  1JJC B;  3CCL A;  1IBM Q;  3ULJ A;  4QIW E;  5JEA G;  4YHH L;  4DR5 Q;  3B6Y A;  1HR0 Q;  4A93 G;  1NTG A;  2Y0S E;  4DV3 L;  1GVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...