3AYHB

Crystal structure of the c17/25 subcomplex from s. pombe rna polymerase iii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
203
structure length
183
Chain Sequence
MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWKIEGEDGSEGTELYFDIDEEIRFQIESEDFVDVSPYTLIASCSRDGLGIPAWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase III subunit rpc9
publication title Crystal structure of the C17/25 subcomplex from Schizosaccharomyces pombe RNA polymerase III
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 40
structure length 183
sequence length 203
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
B PF08292 RNA_pol_Rbc25 RNA polymerase III subunit Rpc25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ayhB02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3ayhB01
2L15A 1N36L 2UUAQ 2CWPA 4GOPA 2K52A 3SGIA 4DK3C 1N33L 4A3DG 1AH9A 1HZAA 4NXNL 1N8RC 3KFUA 3UDFA 5LMNL 1VQGA 3CW2C 3UE1A 2ATWA 3HOYG 4MZ9A 4LUOA 1HR0Q 4A3FH 1XJVA 2ID0A 4X62L 2VW9A 5IWAQ 2JA9A 4IPGA 4DV0L 2WP8J 1SFOH 1PH9A 4DV1Q 4A3LG 3CPFA 3W1BA 4L5SA 3GTLH 3A74A 2CCZA 4JBWA 4HJ7A 1CKNB 4DV7Q 3CCQA 2KCTA 1XPUA 4LFCL 4JI8Q 5AJ3Q 5LMUL 3PO3H 2C35B 4OXPA 4BXXH 4APVA 3IRBA 4LF5Q 2IHFA 4DUZQ 1HR0L 1JB7A 3FHWA 1L1OA 2E2JH 2AWNA 1GVPA 3E9HA 5IWAL 2JA8H 1PH2A 1PVOA 4P75A 2JQOA 1WCMG 1JJCB 4DV1L 5C3EG 3E9IA 4LF9Q 1EUJA 4A3DH 3HFZB 1FVIA 5JEAG 5IP9G 3M9BA 3KJOA 4P74A 3I4MG 3PUXA 3G48A 4DR7Q 2PQAA 4DV7L 4AQYL 4BA1I 4A3IG 5K36G 4JI8L 1JJGA 5GROA 5AJ3L 1SR3A 1N9WA 2K5NA 1GO3E 1VQAA 3T1HQ 3PUYA 1BKBA 4A3LH 4DUZL 4HIMA 2R7ZG 1X3FA 2RF4A 3CCEA 4IJHA 1KRSA 4IFDJ 1CKOA 2OTLA 4JBKA 4R4CA 1X9NA 1VQ8A 1VQHA 1FL0A 2CQOA 1BBWA 1Q12A 3TS2A 5C0XG 1RL2A 4JV5Q 3DLLA 1R9TH 1E3PA 1A0IA 1V9PA 2CWAA 3CQZH 4IPCA 4BBSG 3OTOQ 4YWKA 1QUQB 4A76A 1PYSB 1WCMH 4LUZA 4GOPC 4OWTB 5C3EH 3J81i 3HKZG 3S2DH 3EBEA 1Y1VG 3I7FA 1Q1EA 5IP9H 2R93G 2RCNA 3I4MH 2Z0SA 4PG3A 1YZ6A 2ZJRA 4DK6C 3K0XA 4JI0Q 4GN4B 3PIPA 4A3IH 2UU9L 4IJLA 2Q2HA 2YTXA 3UDIA 3PIOA 1E1TA 4JI6Q 1QZGA 2JEBI 1A63A 5C44G 4A3JG 4MNOA 2F4VL 1LM0A 1HJPA 1QZHA 2Y0SE 2Y0SG 3CMAA 1TXYA 1MKHA 3D31A 1W3SA 1X56A 3OTOL 1SE8A 3U4VA 1A8VA 4A4IA 1U0LA 1FJGL 4TQUS 4PMWA 3U58A 2OQ0A 1PA6A 2OQKA 5BR8Q 4UY8C 4DR6Q 1YBYA 1L1OC 2LSSA 4JI0L 2JK8A 4PZ8A 4BY7G 1VQJA 1UE1A 5EAYA 4P72A 2NVTH 4BBSH 1CUKA 4JI6L 3PO2G 1YHQA 1KAWA 1K83H 4YCVA 2HIVA 4GKJQ 3WWVA 4QGUA 3BZCA 2R93H 2B63G 4JI4Q 4K0KQ 3I4OA 1XMOQ 3K80C 1LYLA 4GNXB 4L5TA 4NXMQ 3CC4A 3H3VH 3M4QA 3HOXG 4A3KG 2N3SA 1EQQA 2NVXH 1IYJB 2OWOA 4IOAA 2ALYB 4A3JH 1YJWA 1IBMQ 4J15A 4DR5Q 4A3GG 3AEVA 3U50C 4DV3Q 1M90C 3HOVG 2KENA 1VQNA 2RHQB 2RHSB 4JI7Q 4A3BG 1OXXK 3W1GA 1GM5A 4YHHQ 3F2BA 4GKJL 4DR3Q 3ICEA 4YY3Q 4Y52H 3K7AH 4HJ8A 1PH8A 2YTVA 1SROA 4B3RL 1N34Q 1XPRA 4KLKA 1UE7A 1VQBA 1TWCH 3PO2H 3NELA 5JJKA 3PUZA 1RIPA 4C3HH 1HH2P 1YIJA 4IFDG 3FKIG 3GTKH 4JI5Q 1IBLQ 4JI3Q 1VQOA 2B63H 4KHPQ 2VUMH 3HKSA 1QUQA 5GAEC 5E7NA 3H0GG 4JI7L 1HZCA 1J6QA 3CD6A 3NEMA 3S2HH 2NN6I 1K73C 5HY6A 3HOXH 4AIMA 4DR3L 1VQEA 3TS0A 1NMGA 3JAMc 1VQKA 3M7NA 2ZTEA 5H1SE 5M3FG 3RZDH 1MJEA 4B3ML 5JJLA 4A3GH 1UEBA 4FDBA 1DGSA 4O2DA 3HOVH 4DR4L 3HOZG 1AE2A 1I3QH 3S14H 3AFQA 3PCOB 2E8GA 1JJ2A 3S1QH 2PI2A 2GN5A 2VL6A 4JI3L 3T1YQ 2UXCQ 2QGQA 3L7ZC 1X65A 4A93G 1Q86C 3F8TA 1OXTA 3JAMi 5C4XG 2UUAL 2D62A 5IYBG 1VCIA 4RMFA 3PUWA 1G6PA 3KOJA 1YI2A 1EFWA 2B29A 4H02A 3NENA 3FKIH 3RLOA 1EWIA 2XGTA 2A1AA 4DKAC 1NMFA 1V1QA 2A8VA 2A19A 4HJAA 1H95A 4GLVB 4JYAQ 1YJNA 2AMCB 3I4NH 1YNXA 2E5LQ 3OYYA 1KD1C 2EXDA 5M3FH 3T1YL 1XTDA 5C0XI 3CF5A 2JA5G 3KF6B 2ASBA 4ALPA 3HOYH 3HOZH 4RG1A 5LMNW 4JI1Q 2KCMA 2Q2UA 1YHAA 2JE6I 3ZJYC 3AFPA 1G291 2Q2IA 2GVAA 2BH2A 1YVCA 2Z6KA 4LF5L 1IBKQ 1EIYB 1MIUA 4DV2Q 4B3TQ 3CC2A 3J81c 1GKHA 1K8GA 1VQIA 3S17H 1Y14B 1TWHH 4A93H 2K5HA 1IL2A 2IY5B 3H3VI 4YCUA 4DV6Q 4GS3A 1VQCA 4XIGS 2MO1A 3MEFA 4LF9L 1SRUA 1BBUA 1S40A 4DR7L 2VS1A 2E2IH 3FP9A 3GTQH 2JA6G 2JEAI 3S15H 1LTLA 4A75A 4PZ6A 2Q2TA 2IX0A 1HR0W 1TWAH 3T1HL 2ES2A 3ULLA 4B3TL 2F3IA 1E22A 1XNRQ 1X6OA 1HNWQ 4OWXB 2D0PA 1O7IA 3M4PA 3RR5A 1P16A 4LFAQ 5IE8A 1PH6A 4B3SQ 2MNAA 4MTNA 5HGQA 1UWVA 1J5EQ 2H5XA 1IXRA 4O0AA 4DV6L 2WFWA 2NZOA 4LW1A 1WJJA 1I94Q 3K7UC 4JV5L 1C0AA 4R4OA 3TREA 3U4ZA 1B8AA 2UUCQ 2R7ZH 4UP7A 4P71A 1E1OA 4DV5Q 5GAGC 4EX5A 1EOVA 4L5QA 1C9OA 3AYHB 4YWMA 2CFMA 1VQ9A 1KC8C 1IZ6A 4UP8A 1YHBA 2PMZE 3PSIA 3RLFA 1BVSA 1YJ9A 1TWFH 3A5UA 1CKNA 2JA6H 1J5EL 1I6HH 4JOIA 2UUBQ 2EIFA 4HIKA 2QA4A 1XMQQ 1JE5A 4OWWB 1VQDA 3HOUG 3G6EA 4R4TA 2UUCL 3M3YH 1Y1VH 1VQ7A 1GD7A 5ELNA 1WOCA 4DV5L 4GNXC 4XTCS 2E2HH 1U5KA 1OXSC 2K14A 5BR8L 4DR6L 4L5RC 4POGA 4DR2Q 3KDFB 2Z6KC 3PV0A 1X3EA 4NB3A 5C44H 4IFDI 4C2MH 4YWLA 3L0OA 5IYCG 2HT1A 2UUBL 4A3CG 1K8AC 4DV4Q 4BBRG 5GADC 1XMQL 4DNIA 4DAMA 4LWCA 2NVYH 4IO9A 1K3RA 4GN5A 2PI2E 5IT9c 3J7ZC 3CCMA 3S1NH 2EQSA 1VQPA 3PGZA 4X66Q 3PF4A 1NE3A 3A0JA 4AYBG 4AYBE 4DAYB 4JI4L 2N49A 1X54A 4K0KL 1XMOL 1KQSA 5M3MG 5M5WH 4NXML 3CXCA 3KYHC 1XNQQ 4BY7H 4DR1Q 1TWGH 3CCVA 4PZ7A 4A3MG 4R4QA 1WYDA 3TQYA 2JJQA 1Q8KA 1I5FA 3PF5A 2VQFQ 4DR5L 1IBML 3HOUH 2NZHA 4DV3L 3S1MH 2BA1A 4HIOA 1JT8A 4QY7A 4JBMA 1LUZA 1Q46A 3LGJA 4HJ5A 1KHIA 3ULJA 1X55A 2UXBQ 4YHHL 5M5XH 1Z47A 4A3FG 2VQEQ 1I50H 4X66L 4A3KH 2ZTCA 4YY3L 1NY4A 1OXUA 1L2FA 3RZOH 3CCRA 2B3GA 1Z9FA 3CCSA 2I5MX 2HHHQ 4LF6Q 5IYCH 4A3CH 1N36Q 1N34L 3RLNA 3G4SA 4DR1L 1N33Q 4C3IH 4NXNQ 1HNXQ 4A3BH 3AQQA 1EQRA 1A62A 1KRTA 1AE3A 2K4KA 1QVFA 3Q8DA 4LF8Q 5IYDG 4NPSA 2MFIA 4JI5L 1IBLL 3A5ZB 4KHPL 4BXXG 4JC0A 4OO1G 5M3MH 3MXNB 4JOIC 4DV0Q 2UXBL 5M5YH 3E0EA 3M4OH 4UPAA 4QQBX 2YV5A 3UE0A 4AH6A 4Y7NH 1VQMA 4IOCA 2HHHL 1Y1WG 1N32Q 1VQFA 1E7ZA 4LFCQ 5LMUQ 5IY0A 2AWOA 3RNUA 3I56A 4LFBQ 1HNXL 3H0GH 2AKWB 2OCEA 1Q7YC 1PH1A 2I5LX 3DM3A 3F2DA 4OX9Q 1MJCA 2KBNA 4LF8L 4A3EG 1B7YB 2VNUD 2PNHA 2R6GA 3GTOH 4UP9A 2UXCL 4IPHA 3BZKA 3ERSX 4GNXA 4WJ3M 1S3OA 1UE6A 5FJ8G 3KDFA 3L2PA 2XTIA 2VY3A 1N32L 4AQYQ 1M1KC 4P73A 2NN6G 1HNZQ 5IYDH 4KHZA 1PH3A 3HOWG 3D0FA 4LFBL 4QIWE 3OW2A 4X65Q 1CSQA 5FLXc 4JYAL 2CKZB 3VDYA 1VQLA 4OX9L 5C4XH 5DLQE 2E5LL 5IYBH 4JBJA 4GKKQ 2OTJA 4DUYQ 2YU9H 3GTGH 1Y1WH 4QL5A 2VUMG 2YTYA 1FGUA 2K50A 1EIFA 3B6YA 1PH4A 1X3GA 4JI1L 2K75A 3JC66 1PH7A 3KLWA 4BY1G 4LF7Q 1HNZL 5C4JH 1IBKL 1L0WA 2IHEA 4DV2L 4A3EH 4GN3B 3ER0A 3RN5A 1OXVA 4X65L 1P8LA 1YEZA 2JA5H 2R7DA 3STBD 5FJ8H 4X64Q 1K0RA 4GKKL 3ULPA 1PHJA 4DUYL 1OTCA 2DGYA 4GLXA 2IX1A 1CSPA 2I5HA 3CMEA 1UE5A 1PH5A 2UU9Q 1SMXA 2BH8A 5IP7G 3M85A 1W2BA 3HOWH 4OONA 3CCUA 4QJFA 3STBC 1YITA 1ASZA 2F4VQ 3S16H 1G51A 4LF7L 1KIXA 2AHOB 4BA2I 3J7A5 1XNRL 1HNWL 1HZBA 1NBWA 2DUDA 3BJUA 4B3SL 2WAQE 2WAQG 4GLAC 4LFAL 3HKZE 1FJGQ 1VQ6A 4X64L 1E24A 2KHJA 4JCVE 3UDXA 4GOPB 1ASYA 1KL9A 3S24A 1PFSA 3NBHB 1C7YA 4BY1H 2MO0A 1KXLA 1QVGA 1I94L 4LF4Q 3GDEA 2R92G 3BU2A 1EYGA 1D7QA 1HZ9A 4KI0A 4EQ5A 2V1CC 4ME3A 4LNQA 3F1ZA 2QEXA 3GD7A 4R1JA 4JG2A 2YYZA 3J81j 2GVBA 5GQOA 3TEHB 3EN2A 3KF6A 5IP7H 2FXQA 4LUVA 1Q82C 2VZAA 2ZTDA 3KJPA 2JA7G 2ZJQA 2HIXA 2KHIA 1WFQA 1Q81C 2BA0A 5JEAJ 1T9HA 5J3BA 3W5OA 4DPGA 4LF4L 1L1OB 1NTGA 3TRZA 2WB1G 2WB1E 3GTMH 3GTPH 2N8NA 1PV4A 2NVQH 3EIVA 3CPWA 2R7FA 3F2CA 4HJ9A 1PYBA 2ZM6Q 2LXJA 1VQ5A 3CCJA 4X6AH 1S72A 3G71A 4B3RQ 5FLMG 4DR2L 1K9MC 2PQAB 2I0QA 2R92H 4JI2Q 1VS0A 4DV4L 3H15A 4OO1I 1WI5A 4YCWA 1XPOA 3J80c 3KF8B 4WJ4A 3GO5A 1VQ4A 3I2ZA 3CCLA 5C0XJ 3GTJH 2UXDQ 4R4IA 1D8LA 3PUVA 3I55A 4IPDA 2ZM6L 1QVCA 2N78A 3RN2A 1XNQL 2JA7H 4B3MQ 4BBRH 1JMCA 3K81C 1NJIC 1SLJA 2D0OA 3CP0A 4TVAB 1Q1BA 2ZJPA 5LMNQ 4DR4Q 2F52A 2LXKA 2IT1A 2VQFL 3CC7A 5JJIA 1V43A 4JI2L 2MQHA 4X62Q 2HQLA 3S1RH 3PO3G 3CAMA 2K5VA 3J80i 1CKMA 3K8AA 1B70B 1SN8A 4POFA 5GAHC 2VQEL 4A3MH 2UXDL 4C3JH 5FLMH 3UDGA 2JA8G 4HIDA 4LF6L 5ELOA 3I4NG
chains in the Genus database with same CATH superfamily
4DAPA 4GOPA 4R8UA 2D5DA 4XYQA 1N8RC 4JI3H 3UE1A 1EWCA 3SK8A 3LP8A 2ID0A 2W6ZA 3Q23A 4MV8A 1TS4A 2V4RA 5IWAQ 4QWEA 3HOWB 1V4YA 4NMZA 2GPSA 2WKDA 1SE3A 4X3SA 1HUMA 4JBWA 2V59A 5DAUA 3CCQA 2KCTA 4RFBA 5KNDA 4S3SA 3Q8RB 3PO3H 3MWYW 2R8JA 4BXXH 3I4MB 1FNWA 1H9MA 3NBIA 2KVMA 2G5DA 2L9HA 3EPGA 2F0QA 2AWNA 1LABA 1EQTA 3JSLA 5C5LA 4XDXA 2NBFA 2P5ZX 1WCMG 3MVVA 1JJCB 4DV1L 2XCPA 5C3EG 4A3DH 4EG0A 2QF7A 5GONF 1BXTA 4DV7L 2LY7A 3GTOA 1A9XA 4GKJH 5GROA 2F0NA 3KHGA 2B2VC 1SNCA 4DUZL 1ZETA 2R7ZG 1RJPA 2NUAB 1D5ZC 4I7ZC 4IJHA 2A6ED 1CKOA 3NUCA 4K8IA 3J81E 4DL4A 2NN6H 3R3OA 4KD3A 1X9NA 3VR6A 2CQOA 1PZKD 4F4WA 4WD3A 1RL2A 3OHXC 4JV5Q 3PW4A 4CC5A 4DR3H 4LMQD 4YY3H 1II3A 4YWKA 1STGA 3NGDA 4A76A 1QB5D 2IWHA 3MR5A 5JEAH 2W57A 1Q1EA 5IP9H 1K0SA 2R82A 3RFCA 3I4MH 2Z0SA 2KEDA 4PG3A 2BDNA 4DK6C 1GYFA 3K0XA 3Q8SB 2WV6D 4GN4B 3BS1A 1RJTA 4JW0A 2D9UA 2Q2HA 1IBLH 3OWFA 1E1TA 1PDQA 3K7AB 5C44G 1LM0A 2OXPA 1HJPA 3CMAA 4LH7A 3D31A 4LMYA 4QMGA 2BR0A 4A4IA 3K5NA 4C3HB 2KOLA 2OQ0A 1RK5A 4ECVA 1L1OC 4JI0L 1F2YA 3MFYA 4P72A 5D3DA 1B50A 2YW2A 4C5AA 5LL6X 1TY2A 5KX5F 3WWVA 3BZCA 4HTHA 4K0KQ 3K80C 4L5TA 5KFNA 5J2UF 4QWAA 1EYZA 3URYA 1C48A 4A3KG 5D14A 1IYJB 2OWOA 2W7PA 2K05A 1YJWA 3NTIA 1B6RA 4J15A 4A3GG 3AEVA 5KT3A 4ZLTF 5A35A 4RHRA 4C3IG 1YNNC 3W1GA 3H09A 3NSWA 4YHHQ 1GM5A 3C2PA 5EWFA 3N8DA 2C2EA 4HNVA 1HQMC 1V1PB 3K7AH 3BQ1A 1PH8A 3GTMA 3GTPA 3GIPA 4B3RL 1MBYA 1IBKH 2R84A 4B3TH 1UE7A 3I4NB 5F9NA 2UVUA 1B6SA 2G9DA 3KBGA 3NWSA 4C3HH 1DD2A 4F88A 3TSSA 4RGTA 1TIID 4JI3Q 3MEHA 5GAEC 4JI7L 3V6JA 4JV1A 1ICWA 5L9XA 4DL6A 1HA6A 2A68C 3FDSA 4ABNA 3RZDH 1RKNA 2QCPX 5JJLA 5ISRA 2OLSA 4EGQA 5KFIA 3DWQA 4QF4A 1LT5D 3LNNA 1I3QH 4LFAH 3PCOB 2E8GA 1JJ2A 4QIWB 4HMIA 3VA5A 5EOYA 3NQIA 2WB1A 4DXFA 5BMVF 2QGQA 1I94H 3L7ZC 3RBEA 1WCMB 5IYBG 5C3EB 1GUTA 3EFXD 1ILPA 1EFWA 1G6PA 1PFNA 4DV5H 2FHTA 2B29A 4IFDH 2WINB 2A1AA 5BN4A 1V1QA 1HTPA 3FDTA 3I4NH 3VA7A 2KEEA 2EXDA 5DEHA 2R7ZB 2UUBH 4HCSA 2GA4B 3TZDA 3T1YL 1XMQH 5C1PA 2WTFA 3H4DA 2FMMA 3A7AB 3SDZA 2ASBA 1KC7A 1JC7A 2K7VA 2YS6A 2R8KA 4JI1Q 4FXKC 5EKKA 1YHAA 3ZJYC 1G291 2Q2IA 3KK7A 1YVCA 1B3AA 2VA2A 1TWFB 4LSAA 1EIYB 3ERQA 3CC2A 1GXDC 1K8GA 1VQIA 3S17H 4I50F 2J6UA 1A15A 2K5HA 2RGRA 1SAPA 4DV6Q 5CMDA 2RSOA 2XN9C 4I65A 1SRUA 1AZQA 3FP9A 3GTQH 1LTLA 1SYCA 1D1KA 3NQTA 2IX0A 4PZ6A 1TWAH 2SNSA 3QOJA 1TA8A 3ULLA 5C44B 1FNVA 1EEFD 4YJ2F 1E2VA 1O7IA 2K03A 5KFRA 4MTNA 3MHBA 1JDBB 5EPLA 5HGQA 2H5XA 2WFWA 5J2TF 2NUCA 3VR5A 3K6OA 4LW1A 4O4HF 4Q45A 3QZ7A 1XX8A 2UXBH 4OIJA 2ICEC 4JV5L 4R4OA 4LJZC 2R7ZH 4XXEA 2JP1A 3EQLC 2VQEH 1ZHSA 3H4BA 4Q0YA 5GAGC 1RHPA 1ESRA 4LF6H 1EOVA 2E2IA 4DXGA 4YWMA 3N42B 1IZ6A 1YJ9A 1YHBA 3PSIA 1XWEA 3NTHA 1TWFH 1VDZA 4HEDA 1KABA 2EJMA 4DNTB 1J5EL 4MV6A 4JOIA 4HIKA 2QA4A 1JE5A 1I50B 4A3KB 2F0FA 1VQDA 1MGSA 2R6FA 3GLKA 1STNA 3HOUG 4A3GB 3G6EA 2UUCL 1GD7A 3P75A 1WOCA 1ET6A 4C3IB 5KT6A 4XTCS 5K2MA 4PQXA 1U5KA 1OXSC 3S1QB 1EL0A 2W9BB 3OMGA 3U9SA 1EY0A 4DR2Q 1CZWA 4O3QA 5C44H 1H9RA 4J6HA 3L0OA 5IYCG 2HT1A 3ORRA 4OX9H 4DV4Q 4BBRG 4RKLA 4DNIA 3RMHA 3MAQA 4LWCA 4IO9A 1K3RA 5IT9c 1M4VA 3J7ZC 2EQSA 3PGZA 5G3LF 4X66Q 3PF4A 5KFEA 1NE3A 3A0JA 4AYBE 4K0KL 3TQ1A 1XNQQ 4C5CA 1GUSA 1WYDA 3MXPA 2JJQA 1GJXA 4X65H 1I5FA 1K8OA 3W3AA 3S1MH 5KIXA 4JBMA 4RAUC 4HJ5A 2EYJA 1X55A 5KFUA 4YHHL 5M5XH 1E0BA 5I6WA 1I50H 1EYCA 2Y0SA 4A3KH 4ZQ3A 4J0MA 2HHHQ 4QUFA 2KSWA 3G4SA 3N52A 2JEJA 1KJ8A 2H4OA 3DWAA 1EZ6A 4C3IH 1XNRH 4DL3A 2FK3A 4I7HA 3AQQA 3HGBA 2NB0A 1Y1WB 5L1KA 1KRTA 3UI2A 4X64H 4NPSA 4JC0A 4L8JA 1CQJB 2Z6BA 4NDXA 4UPAA 1JOQA 5C4JB 4AH6A 4A3EB 1N32Q 1H9SB 3RV4A 5EKLA 4XT3B 1K3BC 2AWOA 3RNUA 3SVMA 3SK5A 3E0JA 1OO9B 5KG1A 4IRDA 3SEBA 5ELDA 3VR3A 1WTWA 5L1JA 4F4ZA 2OT2A 4ECWA 5FO8B 2L0CA 5BPFA 1JKJB 1I3QA 1LT4D 4UP9A 3EPIA 1S3OA 3T51B 4LF4H 1B3QA 1K1SA 2CHBD 3L2PA 4IUQA 4IZ8A 2VUMB 1M1KC 4JV0A 1HNZQ 2HCIA 5IYDH 1ZHQA 3MTSA 4KHZA 4Y8VB 1B9NA 3D0FA 5ELEA 3OW2A 4LFBL 3V4ZA 1CSQA 5FLXc 1W96A 2CKZB 4FXDA 4RCNA 5IYBH 4GKKQ 4RB3C 4FBTA 3CRKC 3HS0C 1Y1WH 3H0GA 4DL2A 5E4XA 4ETSA 5DG9A 3K5HA 1CQIB 3RGXA 5DG7A 5IGDA 2QK4A 4JI1L 4KHVA 5CV5A 2E2HB 3NWTA 2Q8IB 4BY1G 2L11A 4E6IA 5JJZA 1JE4A 5KEEA 2ZM6H 5C4JH 4A3EH 2IHEA 4GN3B 3ER0A 3RN5A 1JORA 3RV3A 5D3IB 4B3RH 4HCEA 3T13A 1K0RA 2PZUA 3I73A 1OTCA 1PRTF 3VPDA 2PMZB 3KUPA 3X3MA 4PV1C 1W2BA 3M85A 3BDLA 1TWGB 2XIWA 4OONA 3STBC 3GTGA 3LWEA 4ZUIA 2AHOB 3AU7A 4HR7B 3GQCA 3J7A5 3GTQA 4F4YA 3RAXA 1HZBA 3BJUA 4ECZA 2VUMH 1TWAA 4GLAC 1VQ6A 1CHQD 2YZNA 5ELCA 1BXRA 4GOPB 5IT9L 4R8UB 4X62H 1KL9A 3GTJB 3S24A 4IRKA 1STYA 3TP8A 2JA5A 1DM0B 3GDEA 5DM63 1DXMA 2JA7B 4EGJA 4BBRB 1VKZA 4A2BA 3MR2A 4FF2A 4MHEA 3P7JA 4EQOA 3V6HA 1PZID 3S1RB 2FINB 2FXQA 3D3RA 2ZTDA 3T4AC 3KJPA 2ZJQA 3MR6A 3OIPA 5IWAH 4C3JB 2VR1A 1WFQA 5KNCA 2BA0A 1AH9A 1TWFA 5J3BA 3PW2A 1NAPA 2DPIA 2WB1G 4C5BA 2NVQH 2WE6A 3F2CA 3TMEA 1XDNA 1PYBA 2Q8TA 4ED8A 2LXJA 1BNZA 3CCJA 3PZPA 1RCVD 4X6AH 4RB1A 1S72A 1JWSD 4DR2L 1LLRD 4NLGA 1E4EA 3DWPA 1SFOB 1YNJC 1VS0A 3T16A 4DV4L 1WTXA 2CW7A 1WI5A 2HQEA 3X3NA 1GUWA 4WJ4A 4RWSC 3D4DA 3WDNA 3GTJH 2KCCA 3CCLA 3GIMA 4R4IA 5JAVA 1D8LA 3PUVA 3U9OA 4HSVA 4HNUA 2N78A 1ICFB 1XNQL 2JA7H 4BBRH 4EVOA 3K81C 2NTSA 5COYA 2D0OA 3GV8B 2AGPA 1WTRA 2JA8B 2QEJC 2IT1A 3HBLA 1AEXA 3CC7A 2MQHA 3SK4A 3BDCA 3S1RH 3PO3G 3CAMA 4K5VA 3J80i 4UCOA 2R61A 3K8AA 4M8AA 5KFHA 5GAHC 1W93A 4C3JH 5FLMH 4JV5H 2K52A 2F0GA 3A54A 4IUTA 4DK3C 4A3DG 1LTBD 1I50A 3UDFA 5LMNL 1VQGA 3CW2C 2ATWA 3BZDB 4MZ9A 3JAME 2RGVA 1XJVA 2BDOA 2VB3X 1KDCA 2XWJB 2N55A 4IPGA 2WP8J 1SFOH 4DV1Q 1R9TB 1SNOA 1JCKB 1ENCA 3GIDA 2R8IA 4HJ7A 1CKNB 3PVXA 4DV7Q 5L37A 1ULZA 2FFKB 3GIJA 3K57A 2CH4A 2IBKA 1LO5D 2HVSA 3IRBA 2EE1A 3T56B 4DUZQ 5KG6A 3BYTB 3OWEB 2XCLA 3E9HA 4C56C 1EY6A 2JA8H 3S9WA 3OHAA 2VA3A 3I91A 1PH2A 3E9IA 4ILWA 2A5HA 4I4TF 4DL5A 2EVBA 2F0SA 5JEAG 5IP9G 3M9BA 1STAA 4P74A 3I4MG 1QCBD 1XTCD 2HDMA 4BA1I 2XCAA 2K6AA 5AJ3L 1N9WA 1TT2A 1EEID 2F0OA 3EVQA 3T1HQ 4ID6A 1TAEA 3TIIA 2Q8RE 1BKBA 1TVXA 3KF8A 4K0KH 1UC9A 1A2TA 3GIQA 2V4DA 2NVTB 2M05A 1KRSA 4RUCA 4RAYA 1KJIA 3HG9A 3GTPB 5HV6A 5I2XA 3Q8PB 4CDDC 1T3NA 4R4CA 1BO0A 3HKZB 5DG8A 3PQIA 1VQ8A 1O7ZA 4UHVA 5J1ZA 3SHLA 3MWMA 2IL8A 4QW9A 1Q12A 3BA8A 2KCNA 1Y1WA 3KLSX 4YHHH 4MN3A 1R9TH 1E3PA 4YJ3F 1V9PA 1UUPA 2F0UA 3EYYA 3D4WA 3OIQA 3BVZA 4ZOLF 4GOPC 3A56A 3M9MB 3J81i 4HYKA 3I7FA 3ITPA 4J9PA 2RCNA 4N8X1 1HUNA 1D6EC 1YZ6A 2E74C 2ZJRA 1KJJA 4JI0Q 1H9SA 5K36H 3RB3A 1Z6HA 1G6ZA 2G9HD 1F2LA 2YTXA 3UDIA 1A63A 1DONA 1QZGA 4M7EA 1JB3A 2JYOA 3SE7A 5FK9C 4MNOA 5I9OA 3OHBA 2Y0SG 2RBMA 2CW0C 3OTOL 2WB1B 3PO2B 1A8VA 2EXZA 3CRLC 2CQYA 2OQKA 4UY8C 5C0XH 3GIKA 4KN4C 2LSSA 2VUMA 1SMYC 2NVTH 2C2RA 1SEBD 1J8IA 3T5HA 4JI6L 1HFNA 3OMCA 4C3HG 1KAWA 5IYZF 2HIVA 3OUZA 4XQJA 3S14B 5KFZA 1YNND 2TSSA 2QKIC 4UCVA 3H3VH 1O7YA 4P2CB 1EQQA 4IOAA 3KHHA 3ETHA 1ENFA 1IBMQ 2CQAA 4DR5Q 3M4YA 1M90C 2WYOA 2XD4A 1I4RA 1V1OA 1SNQA 2K5DA 1VQNA 4E4TA 2RHSB 2PW7A 4JI7Q 1AUVA 3PO3B 3F2BA 1W6JA 3ICEA 4C1NK 4Y52H 2C5CA 2C00A 4JI1H 1SROA 4WRDA 2VXWA 1N34Q 2WAQA 4L1KA 1XPRA 1IOWA 1VQBA 2A68D 2JEIA 3PO2H 5HGTA 2IP4A 1SJED 1YIJA 1HH2P 1GOZA 3RUZA 5KYLA 2J4XA 5JVG3 4IFDG 2YRXA 4XZ3B 3HOZB 2NU9B 4KHPQ 4HR7A 4DV6H 4F8MA 2NVXA 5C4HA 1QUQA 3C46A 1SJHD 3H0GG 1HZCA 2W7OA 1HPCA 1K73C 3HOXH 5DLFA 2EDGA 2ZTEA 5IIFA 1MJEA 3GTJA 3R5FA 4HQ6A 4IWXA 4FDBA 5JPMC 4ED1A 1AE2A 3S14H 2JA7A 1KNEA 3AFQA 1M0WA 5FD5A 2E2IB 1S68A 2DWCA 3T1YQ 3U9TA 5LYJF 2UXCQ 1X65A 5IGCA 2VQDA 1OXTA 5D1OB 2D62A 1VCIA 5IGGA 3PUWA 2ZXOA 3KOJA 1EY4A 1YI2A 1RTNA 2I46A 4K6DA 3L4JA 3FKIH 2O2LD 1EZ8A 1EWIA 3MWDA 2WDTA 1NMFA 1Y69U 4IAJA 2I07B 4DGZA 4HJAA 3BVGA 2W6OA 2R8GA 4JYAQ 1YJNA 2YCHA 4UDUC 2AMCB 4UAIA 3QB3A 3OYYA 4DFAA 5CC4A 3OSOA 3QZ8A 1BCPF 2JA5G 1HFGA 4ALPA 3HOZH 4RG1A 4O42A 1NNXA 3SXHA 3N6RA 3WO0A 1SFOA 2BE5D 2JE6I 2Q2UA 1SXTA 1GSHA 4DV2Q 4L63B 3J81c 2ALZA 1VMCA 3K5OA 4DR2H 1IL2A 2IY5B 4FYDA 2L12A 3M3YB 2MO1A 2R7NA 4DV4H 1I7NA 5HURA 2BCOA 1IOVA 3H3VC 4UCTA 2VS1A 2E2IH 4OL7A 3SE0A 5LA6F 1CZGA 4X66H 2KECA 1PMRA 3SR1A 3T1HL 1MD2D 4FXGC 4C2MB 1XNQH 1X6OA 2Y0SB 4R8IA 4ZKCB 1P16A 1PH6A 4B3SQ 5I6YA 1S0OA 1ZEQX 1UWVA 1J5EQ 2ENBA 1IXRA 1JXLA 2NZOA 4K8JA 3AMUA 4K6LA 2ASDA 5I2YA 2UUCQ 3G6VA 5CB4F 1PTOF 4XYMB 5EBDA 2HHHH 4CGYB 4ECUA 2ASJA 5CV9A 1R9TA 2CFMA 1VQ9A 1ZXTA 3J80L 1RF2D 2RVLA 2PMZE 3RLFA 1X3QA 1BF4A 2N88A 1EUCB 5DQHA 4J9LA 1CKNA 3SK6A 3GIIA 3BYYB 2KA7A 1EHIA 2FPGB 2YS7A 3RZDB 2RDIA 3M3YH 4R4TA 3E5SA 4RB0A 4IALA 4QUCA 1VQ7A 3QR8A 1PZJD 3M9NB 2X6GA 1I3QB 4YB8B 1N32H 3L4KA 1BDOA 4POGA 2CH4W 3O13A 4HMJA 1X3EA 1LTRD 4C2MH 3DXJC 1EQVA 3Q8QB 4OIKA 4DAMA 2F0EA 4GN5A 5BPHA 2K28A 2LFNA 2N49A 3H0GB 1RYSA 3CXCA 3HKZA 1HNZH 1ONLA 4A3MG 4R4QA 3QIAA 3TQYA 2W8LA 1IBML 1GHJA 1I4XA 4DR5L 5HBRB 3MFIA 2BA1A 3NXWA 4HIOA 1Q46A 3LGJA 3N44B 4GKKH 2JEFA 4XX0B 1HXYD 4A3FG 4ECSA 2B2YA 4ECQA 1I7LA 1NY4A 1OXUA 5IGEA 1GLVA 3CCRA 2NVYA 5EQ0A 2KHSA 1SNPA 3MZ5A 3S17B 4A3CH 1N36Q 1N34L 3RLNA 1C8CA 4EYIB 4DR1L 2RKSA 3IFTA 4BWSC 4NXNQ 2R7MA 2C22A 2QYZA 3QOLA 2YU9B 1EQRA 3GTGB 1QVFA 4ME6A 5IYDG 3GTQB 4KHPL 3A5ZB 4WBNF 3GP7A 4JOIC 1TWAB 3E0EA 2ZDHA 3V2TA 1VQMA 5C1OA 4Y7NH 4FM9A 3Q1KA 2BQRA 1Y1WG 3J81L 1AZPA 4JUZA 2JA5B 1Y8OB 5LMUQ 4KJOA 3RAQA 1QWYA 3I56A 4G7ZC 4LFBQ 1HNXL 3H0GH 1Q7YC 3F2DA 2E76C 4U7CA 1MJCA 2KBNA 4X3KA 4LF8L 4R9WA 4A3EG 2KJXA 3G7LA 1FNUA 5E3FA 4TQSA 4XQNA 2UXCL 3M7GA 5EDWA 2R7LA 1QG7A 2PYKA 1B1ZA 4RB2C 1E2WA 4AQYQ 4P73A 4NW2A 4X3UA 2FJZA 1PH3A 5KFQA 3NK9A 4F4XA 4OO1H 4FVMA 4I7AA 1F2MA 1HCZA 5NUCA 1VQLA 4JYAL 5KFTA 3FKIA 2BE5C 4JBJA 4DAYA 1F9SA 2A69D 2YU9H 3GTGH 4QL5A 2J7ZA 2VUMG 2YTYA 1EIFA 1PRTB 5EPJA 1NR4A 1PH4A 2C9OA 1E4EB 1X3GA 2V58A 2YRWA 1F77A 2XGPA 3E5NA 2PVPA 4EEYA 3KLWA 2HVQA 3N6XA 5LOVF 1L0WA 4DV2L 4JVZA 5KG2A 3QFFA 4IHJF 2JA5H 3STBD 5FJ8H 4FNFA 5T14A 5FKAC 4DUYL 1KLUD 2RSNA 4B08A 2IX1A 1CSPA 3LWUA 3CMEA 1UE5A 1SMXA 2BH8A 4KK7A 5CV6A 4IR1A 1YITA 3S16H 2F4VQ 1G51A 4LF7L 3BDOA 1KIXA 1G8ZD 3MXUA 2ZXRA 1JLLB 1K1QA 3RTXA 3MR3A 3S1MB 1LACA 5LL6S 4B3SL 2WAQG 2O5IC 4A2AA 3HKZE 3T53B 1E4FT 4JCVE 5D1OA 5M5XB 1N56A 1PFSA 3K5MA 2IX3A 1SCUB 3HRZC 2M00A 1EYGA 3N40P 3PMFA 4KI0A 4EQ5A 2V1CC 4KKSA 2QEXA 3FRPB 4JG2A 2YYZA 2B2UA 3J81j 1WR2A 3EN2A 1BNCA 3DF7A 5D65A 4LUVA 2JA7G 1S5BD 4A3MB 2BOSA 5FPRA 2QW7A 3P1HA 2HIXA 3BA9A 2KHIA 2IW3A 1T9HA 3W5OA 4DV1H 1CT1D 5KFXA 2WB1E 3H94A 1PV4A 4TV8F 3OOCA 1YNJD 3EIVA 2J6SA 4FS2A 1BBXC 3VMMA 3GV3A 3MC0B 1T5XD 4O1NA 5KFWA 5KKNB 3MJFA 3Q24A 4DV7H 2AQ1B 4A3FB 1LT3D 3H40A 1WTQA 1N48A 4C3JG 5FLMG 4KKUA 5LP6F 4DUZH 5I9PA 3K59A 1B9MA 1STEA 3GTLB 1VAJA 3QWNA 5IODA 3K5LA 5C3WA 3KF8B 3TQTA 2F0TA 3GO5A 2R7KA 4C2MA 4ED3A 3I2ZA 3MFGA 5M9OA 4N9TA 3JSNA 4TSSA 1QVCA 4UCRA 1JMCA 2E2JB 4R8NA 4YR0A 3V6KA 4TVAB 5EPKA 4DR4Q 2ZJPA 5LMNQ 3T1HH 2LXKA 4JI2L 5EKIA 2D2CC 1VMPA 4POFA 1M0TA 1B33N 4A3MH 2UXDL 4O3RA 3W2DA 2JA8G 1A6XA 1EWHA 4Q43A 1N36L 2UUAQ 4IUVA 2K5QA 2XGQA 1L0XB 3NBHA 4NXNL 1UNNC 3G6JB 2E2DC 1UAPA 1U4PA 4GZYC 4O4IF 2W9AA 4L6TB 4EBDA 4A3FH 5CYUA 2RDGA 3KXYT 2JA9A 4JI0H 3A8KE 4U673 3W1BA 3PW5A 4L5SA 3GTLH 3A74A 1GGOA 4O3SA 3TP5A 2CCZA 3CKIB 1ML0D 2F0KA 4MV9A 5AJ3Q 5LMUL 4MV4A 2C35B 3A7LA 2L55A 3VPBA 5CA1F 3PIP3 1BUVT 4APVA 4LF5Q 4O3OA 2IHFA 3I3CA 3BJYA 2K33A 1HR0L 3PIO3 4A3IB 2E2JH 1SYEA 1JR0D 1KBLA 1PRTC 5EWEA 2JQOA 3K3PA 1PXUA 2EYMA 1AN8A 4LF9Q 4IUNA 1AN7A 4O2AF 3HFZB 1FVIA 5C3XA 4F87A 1CHPD 2PQAA 3BAAA 4AQYL 5ELFA 5K36G 1QNKA 4JI8L 3I72A 2AQ4A 1SR3A 2A69C 1EOTA 1EFID 3PUYA 4DN4M 4A3LH 4UFZA 1CI3M 1JWMD 1SNDA 2RF4A 2AUKA 3CCEA 4BBSB 1RJRA 5KFMA 4JBKA 1IBMH 2NVQB 4DR5H 2WAQB 3K58A 2P0AA 4EFBA 4ODGA 2R93B 3Q22A 1FL0A 1BBWA 3TS2A 4JI7H 5C0XG 2YU9A 3DLLA 2R86A 4EYHB 1O75A 1A0IA 3F2UA 3OTOQ 2NVXB 2R87A 1QUQB 4LUZA 1LTTD 4OWTB 5IGFA 1N34H 3HKZG 2O03A 3A8IE 2SCUB 2CW0D 3LMLA 5I47A 4A3IH 3FPUB 3PIPA 2A6HC 4IJLA 1MHWC 3EJIA 1HRJA 4KHPH 1RDPD 3PIOA 1S03G 4JI6Q 3WO1A 5EBCA 1R4QB 2F4VL 2AUJD 2Y0SE 1QZHA 1VF7A 2ZDQA 5KFAA 1SMYD 3FEWX 1X56A 1D5MC 1SE8A 4OHJA 2X69A 4H0LC 3U4VA 2FMAA 4IZOA 4PWQA 1KAAA 3FPPA 1PA6A 5BR8Q 4DR6Q 1MSHA 4V190 4ZK9B 2E75C 1F9RA 5DGAA 1MSGA 2JK8A 4PZ8A 4M1UB 1VQJA 2DIKA 1RK6A 3OSNA 5L1LA 4BBSH 3T1YH 2VB2X 4RCOA 2Z4HA 4U68A 3PO2G 4QW8A 2UXCH 5KFSA 1KNAA 4QGUA 1LTAD 3IAYA 2R93H 1GSOA 1ENAA 4RGMA 4JI4Q 4M9UA 3I4OA 1XMOQ 2WIIB 1LYLA 4GNXB 2PQEA 4NXMQ 1OWTA 2R3ZA 2AGOA 5IT9W 3BABA 3HOXG 2NVXH 3RIZA 1ZKOA 4J9SA 4A3JH 3VYSA 3PW7A 2EY6A 4JYAH 3U50C 4DV3Q 2KENA 2EYOA 4N9PA 4A3BG 1OXXK 4J9RA 1QJOA 1JOOA 4GKJL 2MP1A 5A2QL 5DQIA 4R7RA 5CBEE 4HJ8A 2YTVA 4CKEA 4DU9A 3R2TA 2AQ3B 1K83A 1EYDA 3DEOA 4DV2H 2SDFA 5KFJA 5JJKA 3NELA 3NPPA 2W9CB 5BN5A 1RIPA 3FKIG 3GTKH 3NTKA 4JI5Q 2B63H 3C3LA 3HKSA 5E7NA 3KAJA 3CD6A 2NU8B 5KG3A 2NN6I 5HY6A 4DR3L 4AIMA 3TS0A 5FOBB 1VQKA 1NMGA 3JAMc 2NU6B 3M7NA 3I12A 2RCFA 5FLXL 5LHY1 1UEBA 2B8GA 3HOVH 4DR4L 4A93B 1T94A 5KG0A 3HOZG 2F0LA 3BG5A 3F8NA 1SDFA 5C6AA 1BGWA 4B3SH 4ZHQF 1RTOA 3A55A 5DNFA 4J9MA 3OSPA 1KLGD 1S5CD 4J9QA 2VL6A 4IN3A 1J5EH 5A2QW 1Z2NX 3R5XA 5CV4A 3K3VA 1BCPB 3I8ZA 1SYDA 5C4XG 2I87A 2UUAL 3KALA 2UUCH 3D4RA 4RMFA 1ILQA 4H02A 1EYAA 3NENA 3EROA 4MV1A 1EY9A 4IQZA 2VOBA 4KMUC 4DKAC 1SNMA 4BS9A 1TQOA 2A19A 1KDAA 1S9FA 2HVRA 1IYVA 4MTEA 3QG1A 4RNMA 2UVRA 2E5LQ 1KD1C 5M3FH 1UNSA 1XTDA 4WJWA 3CF5A 3KF6B 5FLXW 3DEPA 2DZDA 1A3TA 5LMNW 2CVRA 2KCMA 1RJQA 3RUPA 3AFPA 3KLRA 5KFPA 3GTLA 4Q8FA 2Z6KA 4LF5L 1I6HB 3RJ0A 4WFN3 1TWHH 4A93H 3CU7A 2HUGA 5CV7A 4O2BF 3J7AF 3J7AK 4YCUA 2XSCA 4GS3A 1VQCA 1CK1A 1ZYRC 3MEFA 4LF9L 2ASLA 3DUZA 2K1BA 1SSOA 2SNMA 1Y8NB 4Z9CB 2F0IA 3GV5B 2MGSA 3S15H 1MI2A 3EA6A 3IKJA 2DY7A 1PTOB 4B3TL 1E4GT 1I6UA 2F3IA 1E22A 1S4ZA 1XNRQ 1B44D 1HNWQ 2WACA 5D1PA 4J9KA 2D0PA 1IKMA 3WOFA 5IE8A 2NVYB 4KTAA 4FBUA 3MWEA 4KY5A 4O0AA 5FPOA 3SI8A 2JSOA 2VPQA 1WJJA 4CJ1B 5KT4A 1TR5A 3TREA 3U4ZA 1K8MA 1B8AA 3ONAB 1SYFA 4UP7A 4P71A 2W70A 3Q6SA 1E1OA 4CJ0B 2FLPA 4EX5A 3L3OC 4L5QA 5KT7A 3AYHB 3MA2B 2F0DA 1KC8C 4HN7A 2ZDGA 4NXNH 1BVSA 3OPOA 2JA6H 1I6HH 2FLLA 2EIFA 4EEQA 3HOXB 2EPBA 2JXMB 4B9XA 1TS5A 3PR4A 2AU0A 1E2ZA 1G2SA 4GNXC 4DV5L 4EBEA 4A3BB 2XWBB 4KN7C 5LMUH 4ECXA 5BR8L 4DR6L 2CW8A 2OEOA 1PFMA 3PV0A 4IFDI 4NB3A 4LFBH 1PTOH 1XXGA 4DL7A 5M3MB 4A3CG 5M5YB 1EIGA 1TKWB 1K8AC 2UUBL 3M4OB 3AB9A 1XMQL 5GADC 2ZXPA 2NVYH 1IW7C 3T5LA 4H13C 3CCMA 1JWUD 1VQPA 1PYWD 2EYLA 3FKIB 4DAYB 1DIKA 4JI4L 4RGOS 1X54A 2X0SA 3FMCA 1XMOL 3R5HA 2Z1CA 4NXML 4YP3A 3KYHC 1B04A 1DCZA 4MIUA 4DR1Q 3CCVA 2RDFA 1BJTA 1Y1VA 4AQYH 2R93A 4O3NA 2VQFQ 2NZHA 4DV3L 1KTKA 4LAAA 4NKLA 1WTVA 3UFXB 5DQGA 3T5KA 2FPPB 1LUZA 3VR4A 3IFDA 3V4SA 1Z47A 5IOCA 2PZTA 3TIGA 4KY6A 4RKBA 1L2FA 3CCSA 2B3GA 1Z9FA 2I5MX 2XVSA 3IN5A 4XYLB 2EYPA 1N33Q 4ZRZA 1EZ1A 5C4XB 2IJ0A 4ZI7F 1U4MA 1HNXQ 4A3BH 5FD6A 2J9GA 4YR3A 1AE3A 2K4KA 3Q8DA 4LF8Q 1BCPC 4JI5L 3T5JA 1O78A 1Q3LA 5M3MH 3H6MA 4DV0Q 4OO1G 5M5YH 2UXBL 3M4OH 3G6XA 4QQBX 2YV5A 3UE0A 3GTKA 2F0PA 2B63A 1WTHA 1CTMA 1CE8A 1SYBA 4ZCKA 2F4VH 1E7ZA 4LFCQ 5IY0A 2EYHA 1DZ1A 1EY8A 2AKWB 3Q2OA 1L0YB 4PMBA 1Y8PB 1WTOA 5F2DA 2EOTA 1T36A 4APMA 3HP3A 2VNUD 5C5MA 2R6GA 5CR3A 4MAMA 3BZKA 4GNXA 2ICIA 2W6QA 5FJ8G 3KDFA 2Z9HA 2RA4A 2FP4B 3KAKA 2VY3A 1F9PA 4RNNA 5KT2A 3KHLA 3VDYA 4OX9L 5C4XH 5DLQE 3C1EA 2PCFB 2E5LL 2OTJA 4DUYQ 1I4GA 4J8QA 3GQBA 1FGUA 4KKTA 1EU4A 5I4DA 2HCCA 4QWDA 4Q5VA 3TINA 3PW0A 2K75A 1JIHA 3JC66 1PTOC 2DJFC 1PH7A 5KFDA 2W9CA 2B2YC 4LF7Q 4X3TA 4JK1C 1OXVA 3HEJA 1P8LA 4X65L 2DN8A 2R7DA 4CDCC 2JN4A 3R93A 3ULPA 1PHJA 2DGYA 4TV9F 4GLXA 2B39A 1NSNS 4OEMB 5KG4A 3VPCA 5KG5A 1TWHA 2UU9Q 1PH5A 2AQ2B 4TUYF 3HOWH 2NWGA 3HXLA 4BWGB 3I70A 2B2WA 1ASZA 3I4LA 1NCVA 1M6VA 2KUMA 4BA2I 2PW5A 1XNRL 2R92B 1HNWL 1GUGA 3HB9A 5G3LD 1NBWA 3MXNA 2WAQE 4DR4H 1FJGQ 3M9OB 5LMNH 4X64L 3RGZA 1E24A 1B2TA 4ZQIA 3PN1A 3JZIA 3RF2A 4ED2A 3NBHB 1S0NA 1QVGA 2HGSA 4ECRA 3BU2A 2NTTA 2A73B 3HZXA 1D7QA 1HZ9A 1AW7A 4ME3A 4LNQA 4R1JA 2UUAH 3I90A 5GQOA 3KF6A 1C30A 4RUAA 5IP7H 1Q82C 5KFBA 2VZAA 4PNYA 4ECYA 4Y7NB 4IUPA 4LF4L 5JEAJ 3TRZA 5KFFA 2JA6A 5KRUA 3D6CA 1L2ZA 3CPWA 2F0MA 4HJ9A 3J80W 1VQ5A 3R23A 5EWGA 3BQ2A 3G71A 5KGUA 4J9NA 1K9MC 1CA5A 2MJ8A 2PQAB 2I0QA 3WNZA 4LF5H 2R92H 4JI2Q 3GV6A 2F0WA 5KFLA 3ORQA 1XPOA 5C4ZA 4LF9H 2IPKD 5TSSA 2UXDQ 1QE6A 4IPDA 1LTSD 2ZM6L 4RZRA 4LSXA 2B2VA 3RN2A 3ETJA 4B3MQ 3CVZA 4MA5A 2EY1A 1GUNA 2FJ2A 1ET9A 3MXGA 2F52A 4YAJB 2VQFL 4ED7A 5JJIA 4EBCA 2QDBA 2HQLA 1Z2PX 2O4XA 5DLGA 1CKMA 1B70B 2FE3A 4FF4A 4IURA 5E1FA 3TBIB 3OW7A 1DJRD 1EIHA 3TZUA 3E6ZX 1V51A 2AGQA 5ELOA 4I55F 3BVMA 2L15A 2CWPA 1WD1A 3SGIA 1N33L 1S97A 1HZAA 3OTOH 3KFUA 3KBXA 3RB4A 3HOYG 2B2UC 4LUOA 1HR0Q 1FD7D 1TS3A 4J9OA 1V8QA 2K01A 4X62L 2VW9A 5JOBA 2W8KA 5KFYA 3G6YA 4IRCA 4DV0L 4A3LG 1PH9A 3S16B 4O4LF 3CPFA 2DJGC 3CQZB 5IGBA 1GHKA 4AYBA 4MTDA 2YZGA 4JI6H 1PRTD 1XPUA 3S2DB 3Q0AA 4LFCL 4JI8Q 5CAEB 4OXPA 1DOLA 1JQYD 1GUOA 3FHWA 1L1OA 4CKBA 1JB7A 2H1EA 4FF3A 1GVPA 5BR8H 4DR6H 1LTID 5IWAL 2GPWA 1PVOA 2EJGC 2F0JA 2L5TA 4P75A 2R8HA 2W6NA 1EUJA 3J81W 3KJOA 4LK1C 3PUXA 3G48A 4DR7Q 5FO9B 4RU9A 3RD4A 2L1BA 1JJGA 4A3IG 1GSAA 1STBA 2K5NA 1GO3E 1VQAA 1IYUA 4JI4H 1CA6A 1HQRD 1XMOH 2F4IA 4NXMH 4HIMA 2W6MA 4MV7A 1X3FA 3D8GA 4IFDJ 2OTLA 2EY2A 2R85A 4DV3H 1K83B 1A2UA 1TY0A 1SYXB 3D6WA 2DPJA 1VQHA 5T1GA 2K04A 1B4OA 2XNAC 2A6EC 3LX0A 2CWAA 3CQZH 2A6HD 4IPCA 4BBSG 5F9LA 1CM9A 2J0TD 1PYSB 1WCMH 2B2TC 3M4IA 2RDJA 2NYZD 5C3EH 3S2DH 3EBEA 1Y1VG 4CDFC 2KQ3A 2R93G 5EJWA 3V05A 3VYRA 3IL8A 4CBVA 2UU9L 4JI5H 3C1FA 1KDBA 2JEBI 3TP6A 4A3JG 1STHA 5K5PA 2F0HA 1X32A 4ED0A 2ATLA 1TXYA 1T5EA 1MKHA 1W3SA 1TWCB 4G7OC 1KJ9A 5KNBA 1U0LA 5KT5A 1FJGL 4K5XA 4QB4A 5KFGA 4TQUS 4PMWA 3U58A 2UVVA 1G91A 4J1MA 1YBYA 3S2HB 4BY7G 3N41B 4C1NI 1UE1A 5EAYA 1CUKA 4FO2A 1CFMA 4F50A 5CORA 1YHQA 1M7JA 1IL8A 1K83H 4YCVA 4GKJQ 2DNCA 3KLSA 2B63G 5H80A 3TP7A 4DNRB 1F2ZA 1I4PA 3CC4A 1PFBA 3M4QA 3NE5B 1B53A 2N3SA 3FVQA 2FB9A 2ALYB 2LKVA 2IA6A 1Z7TA 3HOVG 2M2LA 2CZGA 2MHVA 4QWCA 2E5LH 1S5ED 2RHQB 3GV7B 1S0MA 5JQWA 4DR3Q 4YY3Q 5C5JA 5IT9E 1BR9A 1U4RA 5CA0F 5CV8A 2EY5A 5EGTA 3NHHA 2MCTA 4B9WA 4KLKA 2HD3A 4Q44A 1TWCH 2HDLA 1WTPA 3PUZA 1ESFA 5KFCA 3HOYB 3TN2A 2M9VA 1IBLQ 1VQOA 2R92A 4G3IA 2MPMA 2OH2A 3S2HH 1J6QA 4UCSA 3NEMA 4KY7A 2F03A 3JRWA 1VBGA 1VQEA 4QWBA 4YQWA 2B2TA 3BG3A 5H1SE 5M3FG 4B3ML 1G2TA 4A3GH 4DK1A 1DGSA 4O2DA 2YL2A 4O3PA 3RB0A 4LH6A 1HNWH 5DGBA 4EFEA 2DY8A 2I80A 1AP0A 3S1QH 2PI2A 2GN5A 4JI3L 4ZKBB 4A93G 3R2IA 1Q86C 2RDHA 3F8TA 3JAMi 2PBZA 5KG7A 4ED6A 1IHZA 4G7HC 3RLOA 5KFOA 2XGTA 2WKCA 1BOSA 3WOEA 2YYAA 2A8VA 1H95A 4GLVB 3VYTA 5A2QE 1YNXA 2EJFC 4H44C 5BN3A 1LV9A 2SOBA 5C0XI 2QDLA 5FO7B 3HOYH 5LL6b 2OF1A 5C8YF 1ZYRD 2GVAA 2BH2A 1S5FD 3GILA 1O7LA 1I6VC 2A74C 1IBKQ 4B3TQ 1MIUA 2F0VA 1HA5A 1GKHA 1HHVA 1Y14B 4ZAIA 3H3VI 4GC6A 1V1PA 4XIGS 4DA2A 1Y1VB 5FLXE 4EQNA 4XT1B 1BBUA 1S40A 4DR7L 2JA6G 4Q8EA 2JEAI 5CGKA 2L4NA 4A75A 2BQ3A 2Q2TA 1HR0W 2ES2A 5EZYF 5JPNC 1M8AA 4A3JB 1SEIA 4DR1H 4OWXB 4CDEC 1U9RA 3M4PA 3RR5A 1CS0A 2C2DA 2K32A 4LFAQ 2FK2A 4H7BA 2MNAA 4FS1A 1S10A 1TS2A 2VQFH 2IMWP 3S1NB 4DV6L 2XIGA 4MA0A 3H91A 2VPSA 4HNTA 1I94Q 4CC6A 3K7UC 1C0AA 5M5WB 3KHRA 4BY7B 1DOMA 1VBHA 4DV5Q 1FGBD 4OELB 4QIWA 3HOUB 1C9OA 2V4QA 1N33H 4TKOB 3GTKB 4UP8A 4KV6A 2B63B 3CQZA 1R4PB 1HNXH 5AFWA 1FYCA 2FMCA 1D5XC 3A5UA 3L9AX 1WCMA 2UUBQ 1XMQQ 4LF8H 2I8CA 4OWWB 5JVDF 3RZOB 2PN1A 3FMAA 4DV0H 2X6LA 3HOVB 1Y1VH 4YBZB 5ELNA 4TRDA 1IW7D 4ZUJA 3K5IA 1RD9D 2R7ZA 4LFCH 2E2HH 2K14A 3UQ8A 4GC7A 3J7YW 4L5RC 3KDFB 1FR3A 2Z6KC 4YWLA 1WVLA 2V5AA 3G8CA 1DV1A 4CJ2C 3IG0A 4ZYSA 1X3PA 5JVH3 1AFPA 2PI2E 5DM73 3S1NH 2W6PA 4IR9A 5JVLA 1AUXA 4FU0A 1U4LA 1I4QA 4AYBG 1DYQA 1KQSA 5M3MG 5M5WH 1WD0A 4BY7H 1NR2A 1PLFA 5KFVA 3PR5B 1TWGH 4YR2A 4PZ7A 4OGQC 1H9KA 1J9OA 2F3WA 3VR2A 5M3FB 1Q8KA 3PF5A 1A3VA 3HOUH 3GTOB 1ZQ7A 2ZJTA 1JT8A 4QY7A 1PK8A 1KHIA 4DUYH 2Z4IA 3ULJA 2UXBQ 4UCUA 1LT6D 2VQEQ 4X66L 2ZTCA 4PMCA 4YY3L 3N43B 3RZOH 2UVWA 1BCPD 4K14A 1W6KA 2RQXA 4LF6Q 5IYCH 4LF7H 1TWHB 1D2BA 3C0FB 2B8FA 1SYGA 1A62A 1QOHA 3CHBD 1HTLD 2MFIA 1IBLL 3S15B 5JH7F 4JPBW 4BXXG 1TWCA 2F3VA 4RNOA 3MXNB 4HAEA 2UU9H 2YZMA 1H9JA 2XC9A 5KFKA 1I4HA 1RYRA 4IOCA 2ZT9C 2HHHL 1EU3A 1VQFA 1KEEA 4RAZA 5JUMA 2DLNA 4DAVA 2OCEA 1QILA 1PH1A 2I5LX 3DM3A 4Q0FA 1FJGH 4F7XA 4OX9Q 1EY5A 1SE4A 4DLKA 4ME5A 1B7YB 2PNHA 3GTOH 4WORA 4IPHA 3ERSX 3RBDA 4FF1A 4WJ3M 1UE6A 2PPBC 2W9BA 1C4QA 4RH6A 2XRSD 2XTIA 4KJNA 3J7AV 2GLTA 1N32L 1UEAB 2NN6G 2SEBD 4G57A 4RHSA 1RODA 2FK1A 2JA6B 3HOWG 2NU7B 1C3OA 2C28A 4QIWE 2HJWA 4X65Q 1PTOD 4BY1B 4G4KA 4DF7A 1JICA 3KTMA 5ELBA 3OUUA 1QNUA 4N8FA 1O80A 2K50A 2F1MA 3B6YA 2QILA 5T1IA 4K5WA 2FPIB 3JRXA 1VF5C 4MV3A 1HNZL 1IBKL 3QJYA 1WSCA 3ND8A 1YEZA 2PNRC 4IWYA 4X64Q 4JI2H 1MZBA 4GKKL 3GTMB 2Z8LA 2JEGA 4KD4A 2O5JC 4YAKB 2I5HA 3A8JE 5IP7G 1JDEA 1EY7A 3P20A 4RA8A 1DV2A 3QO2A 3CCUA 1Q90A 3DM1A 4QJFA 2UXDH 1DOKA 1BQQT 2PO4A 5E4WC 4IUUA 5J22A 1F9QA 1KJQA 2MUYA 1N36H 4B3MH 3DHQA 2DUDA 3R8BA 3DMUA 4LFAL 5D8DA 4U6PA 2KHJA 4HSPA 3UDXA 2EZVA 1ASYA 3TDQA 3LWBA 1C7YA 4BY1H 3ND9A 2FLNA 2MO0A 1KXLA 1I94L 1CQFA 4K2LA 1SE2A 4LF4Q 3ZYYX 2R92G 2PZWA 2W71A 1Z2OX 4EGVA 2XRQD 4ECTA 3F1ZA 3GD7A 4RGNA 2LS01 2GVBA 3BQ0A 5KYIA 2FKLA 3TEHB 4AYBB 2V9WA 4XQQA 1HR0H 1Q8IA 1FKAH 4RZQA 2J6TA 1Q81C 3JAML 4DPGA 1L1OB 1NTGA 1S5DD 3GTMH 3H20A 3E3XA 2N8NA 3GTPH 5L1IA 4MTKA 4ULLA 2R7FA 2TMPA 4DK0A 1JOKA 2ZM6Q 3NP8A 1PX2A 4JI8H 4B3RQ 1EUDB 4NP5A 4K2KA 3MFHA 4YIJA 3V96A 2VUGA 1IKLA 4JV2A 4FP5D 3H15A 4OO1I 1UC8A 2E2HA 4XYOA 4YCWA 5LXTF 1TU2B 3J80c 1XYIA 3K0YA 4PDBA 1D1IA 1VQ4A 2NZ1D 5C0XJ 4CHTB 3J80E 1A3UA 3RB6A 3I55A 4QCLA 4DR7H 4EQPA 1K28A 4V0BA 2LMCB 3VYUA 4CKCA 1LTGD 2B2WC 1SLJA 2DNEA 2K5WA 3CP0A 5J39A 1NJIC 2PMZA 1Q1BA 1CQVA 4TQRA 1SBBB 1V43A 3JAMW 4X62Q 2EYFA 4A3DB 1TWGA 2K5VA 2BQUA 1JX4A 1SN8A 2VQEL 1WH2A 1NUCA 5CBAE 3UDGA 4HIDA 4LF6L 3I4NG
chains in the Genus database with same CATH topology
2L15A 1N36L 2UUAQ 2CWPA 4GOPA 2K52A 3SGIA 4DK3C 1N33L 4A3DG 1AH9A 1HZAA 4NXNL 1N8RC 3KFUA 3UDFA 5LMNL 1VQGA 3CW2C 3UE1A 2ATWA 3HOYG 4MZ9A 4LUOA 1HR0Q 4A3FH 1XJVA 2ID0A 4X62L 2VW9A 5IWAQ 2JA9A 4IPGA 4DV0L 2WP8J 1SFOH 1PH9A 4DV1Q 4A3LG 3CPFA 3W1BA 4L5SA 3GTLH 3A74A 2CCZA 4JBWA 4HJ7A 1CKNB 4DV7Q 3CCQA 2KCTA 1XPUA 4LFCL 4JI8Q 5AJ3Q 5LMUL 3PO3H 2C35B 4OXPA 4BXXH 4APVA 3IRBA 4LF5Q 2IHFA 4DUZQ 1HR0L 1JB7A 3FHWA 1L1OA 2E2JH 2AWNA 1GVPA 3E9HA 5IWAL 2JA8H 1PH2A 1PVOA 4P75A 2JQOA 1WCMG 1JJCB 4DV1L 5C3EG 3E9IA 4LF9Q 1EUJA 4A3DH 3HFZB 1FVIA 5JEAG 5IP9G 3M9BA 3KJOA 4P74A 3I4MG 3PUXA 3G48A 4DR7Q 2PQAA 4DV7L 4AQYL 4BA1I 4A3IG 5K36G 4JI8L 1JJGA 5GROA 5AJ3L 1SR3A 1N9WA 2K5NA 1GO3E 1VQAA 3T1HQ 3PUYA 1BKBA 4A3LH 4DUZL 4HIMA 2R7ZG 1X3FA 2RF4A 3CCEA 4IJHA 1KRSA 4IFDJ 1CKOA 2OTLA 4JBKA 4R4CA 1X9NA 1VQ8A 1VQHA 1FL0A 2CQOA 1BBWA 1Q12A 3TS2A 5C0XG 1RL2A 4JV5Q 3DLLA 1R9TH 1E3PA 1A0IA 1V9PA 2CWAA 3CQZH 4IPCA 4BBSG 3OTOQ 4YWKA 1QUQB 4A76A 1PYSB 1WCMH 4LUZA 4GOPC 4OWTB 5C3EH 3J81i 3HKZG 3S2DH 3EBEA 1Y1VG 3I7FA 1Q1EA 5IP9H 2R93G 2RCNA 3I4MH 2Z0SA 4PG3A 1YZ6A 2ZJRA 4DK6C 3K0XA 4JI0Q 4GN4B 3PIPA 4A3IH 2UU9L 4IJLA 2Q2HA 2YTXA 3UDIA 3PIOA 1E1TA 4JI6Q 1QZGA 2JEBI 1A63A 5C44G 4A3JG 4MNOA 2F4VL 1LM0A 1HJPA 1QZHA 2Y0SE 2Y0SG 3CMAA 1TXYA 1MKHA 3D31A 1W3SA 1X56A 3OTOL 1SE8A 3U4VA 1A8VA 4A4IA 1U0LA 1FJGL 4TQUS 4PMWA 3U58A 2OQ0A 1PA6A 2OQKA 5BR8Q 4UY8C 4DR6Q 1YBYA 1L1OC 2LSSA 4JI0L 2JK8A 4PZ8A 4BY7G 1VQJA 1UE1A 5EAYA 4P72A 2NVTH 4BBSH 1CUKA 4JI6L 3PO2G 1YHQA 1KAWA 1K83H 4YCVA 2HIVA 4GKJQ 3WWVA 4QGUA 3BZCA 2R93H 2B63G 4JI4Q 4K0KQ 3I4OA 1XMOQ 3K80C 1LYLA 4GNXB 4L5TA 4NXMQ 3CC4A 3H3VH 3M4QA 3HOXG 4A3KG 2N3SA 1EQQA 2NVXH 1IYJB 2OWOA 4IOAA 2ALYB 4A3JH 1YJWA 1IBMQ 4J15A 4DR5Q 4A3GG 3AEVA 3U50C 4DV3Q 1M90C 3HOVG 2KENA 1VQNA 2RHQB 2RHSB 4JI7Q 4A3BG 1OXXK 3W1GA 1GM5A 4YHHQ 3F2BA 4GKJL 4DR3Q 3ICEA 4YY3Q 4Y52H 3K7AH 4HJ8A 1PH8A 2YTVA 1SROA 4B3RL 1N34Q 1XPRA 4KLKA 1UE7A 1VQBA 1TWCH 3PO2H 3NELA 5JJKA 3PUZA 1RIPA 4C3HH 1HH2P 1YIJA 4IFDG 3FKIG 3GTKH 4JI5Q 1IBLQ 4JI3Q 1VQOA 2B63H 4KHPQ 2VUMH 3HKSA 1QUQA 5GAEC 5E7NA 3H0GG 4JI7L 1HZCA 1J6QA 3CD6A 3NEMA 3S2HH 2NN6I 1K73C 5HY6A 3HOXH 4AIMA 4DR3L 1VQEA 3TS0A 1NMGA 3JAMc 1VQKA 3M7NA 2ZTEA 5H1SE 5M3FG 3RZDH 1MJEA 4B3ML 5JJLA 4A3GH 1UEBA 4FDBA 1DGSA 4O2DA 3HOVH 4DR4L 3HOZG 1AE2A 1I3QH 3S14H 3AFQA 3PCOB 2E8GA 1JJ2A 3S1QH 2PI2A 2GN5A 2VL6A 4JI3L 3T1YQ 2UXCQ 2QGQA 3L7ZC 1X65A 4A93G 1Q86C 3F8TA 1OXTA 3JAMi 5C4XG 2UUAL 2D62A 5IYBG 1VCIA 4RMFA 3PUWA 1G6PA 3KOJA 1YI2A 1EFWA 2B29A 4H02A 3NENA 3FKIH 3RLOA 1EWIA 2XGTA 2A1AA 4DKAC 1NMFA 1V1QA 2A8VA 2A19A 4HJAA 1H95A 4GLVB 4JYAQ 1YJNA 2AMCB 3I4NH 1YNXA 2E5LQ 3OYYA 1KD1C 2EXDA 5M3FH 3T1YL 1XTDA 5C0XI 3CF5A 2JA5G 3KF6B 2ASBA 4ALPA 3HOYH 3HOZH 4RG1A 5LMNW 4JI1Q 2KCMA 2Q2UA 1YHAA 2JE6I 3ZJYC 3AFPA 1G291 2Q2IA 2GVAA 2BH2A 1YVCA 2Z6KA 4LF5L 1IBKQ 1EIYB 1MIUA 4DV2Q 4B3TQ 3CC2A 3J81c 1GKHA 1K8GA 1VQIA 3S17H 1Y14B 1TWHH 4A93H 2K5HA 1IL2A 2IY5B 3H3VI 4YCUA 4DV6Q 4GS3A 1VQCA 4XIGS 2MO1A 3MEFA 4LF9L 1SRUA 1BBUA 1S40A 4DR7L 2VS1A 2E2IH 3FP9A 3GTQH 2JA6G 2JEAI 3S15H 1LTLA 4A75A 4PZ6A 2Q2TA 2IX0A 1HR0W 1TWAH 3T1HL 2ES2A 3ULLA 4B3TL 2F3IA 1E22A 1XNRQ 1X6OA 1HNWQ 4OWXB 2D0PA 1O7IA 3M4PA 3RR5A 1P16A 4LFAQ 5IE8A 1PH6A 4B3SQ 2MNAA 4MTNA 5HGQA 1UWVA 1J5EQ 2H5XA 1IXRA 4O0AA 4DV6L 2WFWA 2NZOA 4LW1A 1WJJA 1I94Q 3K7UC 4JV5L 1C0AA 4R4OA 3TREA 3U4ZA 1B8AA 2UUCQ 2R7ZH 4UP7A 4P71A 1E1OA 4DV5Q 5GAGC 4EX5A 1EOVA 4L5QA 1C9OA 3AYHB 4YWMA 2CFMA 1VQ9A 1KC8C 1IZ6A 4UP8A 1YHBA 2PMZE 3PSIA 3RLFA 1BVSA 1YJ9A 1TWFH 3A5UA 1CKNA 2JA6H 1J5EL 1I6HH 4JOIA 2UUBQ 2EIFA 4HIKA 2QA4A 1XMQQ 1JE5A 4OWWB 1VQDA 3HOUG 3G6EA 4R4TA 2UUCL 3M3YH 1Y1VH 1VQ7A 1GD7A 5ELNA 1WOCA 4DV5L 4GNXC 4XTCS 2E2HH 1U5KA 1OXSC 2K14A 5BR8L 4DR6L 4L5RC 4POGA 4DR2Q 3KDFB 2Z6KC 3PV0A 1X3EA 4NB3A 5C44H 4IFDI 4C2MH 4YWLA 3L0OA 5IYCG 2HT1A 2UUBL 4A3CG 1K8AC 4DV4Q 4BBRG 5GADC 1XMQL 4DNIA 4DAMA 4LWCA 2NVYH 4IO9A 1K3RA 4GN5A 2PI2E 5IT9c 3J7ZC 3CCMA 3S1NH 2EQSA 1VQPA 3PGZA 4X66Q 3PF4A 1NE3A 3A0JA 4AYBG 4AYBE 4DAYB 4JI4L 2N49A 1X54A 4K0KL 1XMOL 1KQSA 5M3MG 5M5WH 4NXML 3CXCA 3KYHC 1XNQQ 4BY7H 4DR1Q 1TWGH 3CCVA 4PZ7A 4A3MG 4R4QA 1WYDA 3TQYA 2JJQA 1Q8KA 1I5FA 3PF5A 2VQFQ 4DR5L 1IBML 3HOUH 2NZHA 4DV3L 3S1MH 2BA1A 4HIOA 1JT8A 4QY7A 4JBMA 1LUZA 1Q46A 3LGJA 4HJ5A 1KHIA 3ULJA 1X55A 2UXBQ 4YHHL 5M5XH 1Z47A 4A3FG 2VQEQ 1I50H 4X66L 4A3KH 2ZTCA 4YY3L 1NY4A 1OXUA 1L2FA 3RZOH 3CCRA 2B3GA 1Z9FA 3CCSA 2I5MX 2HHHQ 4LF6Q 5IYCH 4A3CH 1N36Q 1N34L 3RLNA 3G4SA 4DR1L 1N33Q 4C3IH 4NXNQ 1HNXQ 4A3BH 3AQQA 1EQRA 1A62A 1KRTA 1AE3A 2K4KA 1QVFA 3Q8DA 4LF8Q 5IYDG 4NPSA 2MFIA 4JI5L 1IBLL 3A5ZB 4KHPL 4BXXG 4JC0A 4OO1G 5M3MH 3MXNB 4JOIC 4DV0Q 2UXBL 5M5YH 3E0EA 3M4OH 4UPAA 4QQBX 2YV5A 3UE0A 4AH6A 4Y7NH 1VQMA 4IOCA 2HHHL 1Y1WG 1N32Q 1VQFA 1E7ZA 4LFCQ 5LMUQ 5IY0A 2AWOA 3RNUA 3I56A 4LFBQ 1HNXL 3H0GH 2AKWB 2OCEA 1Q7YC 1PH1A 2I5LX 3DM3A 3F2DA 4OX9Q 1MJCA 2KBNA 4LF8L 4A3EG 1B7YB 2VNUD 2PNHA 2R6GA 3GTOH 4UP9A 2UXCL 4IPHA 3BZKA 3ERSX 4GNXA 4WJ3M 1S3OA 1UE6A 5FJ8G 3KDFA 3L2PA 2XTIA 2VY3A 1N32L 4AQYQ 1M1KC 4P73A 2NN6G 1HNZQ 5IYDH 4KHZA 1PH3A 3HOWG 3D0FA 4LFBL 4QIWE 3OW2A 4X65Q 1CSQA 5FLXc 4JYAL 2CKZB 3VDYA 1VQLA 4OX9L 5C4XH 5DLQE 2E5LL 5IYBH 4JBJA 4GKKQ 2OTJA 4DUYQ 2YU9H 3GTGH 1Y1WH 4QL5A 2VUMG 2YTYA 1FGUA 2K50A 1EIFA 3B6YA 1PH4A 1X3GA 4JI1L 2K75A 3JC66 1PH7A 3KLWA 4BY1G 4LF7Q 1HNZL 5C4JH 1IBKL 1L0WA 2IHEA 4DV2L 4A3EH 4GN3B 3ER0A 3RN5A 1OXVA 4X65L 1P8LA 1YEZA 2JA5H 2R7DA 3STBD 5FJ8H 4X64Q 1K0RA 4GKKL 3ULPA 1PHJA 4DUYL 1OTCA 2DGYA 4GLXA 2IX1A 1CSPA 2I5HA 3CMEA 1UE5A 1PH5A 2UU9Q 1SMXA 2BH8A 5IP7G 3M85A 1W2BA 3HOWH 4OONA 3CCUA 4QJFA 3STBC 1YITA 1ASZA 2F4VQ 3S16H 1G51A 4LF7L 1KIXA 2AHOB 4BA2I 3J7A5 1XNRL 1HNWL 1HZBA 1NBWA 2DUDA 3BJUA 4B3SL 2WAQE 2WAQG 4GLAC 4LFAL 3HKZE 1FJGQ 1VQ6A 4X64L 1E24A 2KHJA 4JCVE 3UDXA 4GOPB 1ASYA 1KL9A 3S24A 1PFSA 3NBHB 1C7YA 4BY1H 2MO0A 1KXLA 1QVGA 1I94L 4LF4Q 3GDEA 2R92G 3BU2A 1EYGA 1D7QA 1HZ9A 4KI0A 4EQ5A 2V1CC 4ME3A 4LNQA 3F1ZA 2QEXA 3GD7A 4R1JA 4JG2A 2YYZA 3J81j 2GVBA 5GQOA 3TEHB 3EN2A 3KF6A 5IP7H 2FXQA 4LUVA 1Q82C 2VZAA 2ZTDA 3KJPA 2JA7G 2ZJQA 2HIXA 2KHIA 1WFQA 1Q81C 2BA0A 5JEAJ 1T9HA 5J3BA 3W5OA 4DPGA 4LF4L 1L1OB 1NTGA 3TRZA 2WB1G 2WB1E 3GTMH 3GTPH 2N8NA 1PV4A 2NVQH 3EIVA 3CPWA 2R7FA 3F2CA 4HJ9A 1PYBA 2ZM6Q 2LXJA 1VQ5A 3CCJA 4X6AH 1S72A 3G71A 4B3RQ 5FLMG 4DR2L 1K9MC 2PQAB 2I0QA 2R92H 4JI2Q 1VS0A 4DV4L 3H15A 4OO1I 1WI5A 4YCWA 1XPOA 3J80c 3KF8B 4WJ4A 3GO5A 1VQ4A 3I2ZA 3CCLA 5C0XJ 3GTJH 2UXDQ 4R4IA 1D8LA 3PUVA 3I55A 4IPDA 2ZM6L 1QVCA 2N78A 3RN2A 1XNQL 2JA7H 4B3MQ 4BBRH 1JMCA 3K81C 1NJIC 1SLJA 2D0OA 3CP0A 4TVAB 1Q1BA 2ZJPA 5LMNQ 4DR4Q 2F52A 2LXKA 2IT1A 2VQFL 3CC7A 5JJIA 1V43A 4JI2L 2MQHA 4X62Q 2HQLA 3S1RH 3PO3G 3CAMA 2K5VA 3J80i 1CKMA 3K8AA 1B70B 1SN8A 4POFA 5GAHC 2VQEL 4A3MH 2UXDL 4C3JH 5FLMH 3UDGA 2JA8G 4HIDA 4LF6L 5ELOA 3I4NG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L15 A;  1N36 L;  2UUA Q;  2CWP A;  4GOP A;  2K52 A;  3SGI A;  4DK3 C;  1N33 L;  4A3D G;  1AH9 A;  1HZA A;  4NXN L;  1N8R C;  3KFU A;  3UDF A;  5LMN L;  1VQG A;  3CW2 C;  3UE1 A;  2ATW A;  3HOY G;  4MZ9 A;  4LUO A;  1HR0 Q;  4A3F H;  1XJV A;  2ID0 A;  4X62 L;  2VW9 A;  5IWA Q;  2JA9 A;  4IPG A;  4DV0 L;  2WP8 J;  1SFO H;  1PH9 A;  4DV1 Q;  4A3L G;  3CPF A;  3W1B A;  4L5S A;  3GTL H;  3A74 A;  2CCZ A;  4JBW A;  4HJ7 A;  1CKN B;  4DV7 Q;  3CCQ A;  2KCT A;  1XPU A;  4LFC L;  4JI8 Q;  5AJ3 Q;  5LMU L;  3PO3 H;  2C35 B;  4OXP A;  4BXX H;  4APV A;  3IRB A;  4LF5 Q;  2IHF A;  4DUZ Q;  1HR0 L;  1JB7 A;  3FHW A;  1L1O A;  2E2J H;  2AWN A;  1GVP A;  3E9H A;  5IWA L;  2JA8 H;  1PH2 A;  1PVO A;  4P75 A;  2JQO A;  1WCM G;  1JJC B;  4DV1 L;  5C3E G;  3E9I A;  4LF9 Q;  1EUJ A;  4A3D H;  3HFZ B;  1FVI A;  5JEA G;  5IP9 G;  3M9B A;  3KJO A;  4P74 A;  3I4M G;  3PUX A;  3G48 A;  4DR7 Q;  2PQA A;  4DV7 L;  4AQY L;  4BA1 I;  4A3I G;  5K36 G;  4JI8 L;  1JJG A;  5GRO A;  5AJ3 L;  1SR3 A;  1N9W A;  2K5N A;  1GO3 E;  1VQA A;  3T1H Q;  3PUY A;  1BKB A;  4A3L H;  4DUZ L;  4HIM A;  2R7Z G;  1X3F A;  2RF4 A;  3CCE A;  4IJH A;  1KRS A;  4IFD J;  1CKO A;  2OTL A;  4JBK A;  4R4C A;  1X9N A;  1VQ8 A;  1VQH A;  1FL0 A;  2CQO A;  1BBW A;  1Q12 A;  3TS2 A;  5C0X G;  1RL2 A;  4JV5 Q;  3DLL A;  1R9T H;  1E3P A;  1A0I A;  1V9P A;  2CWA A;  3CQZ H;  4IPC A;  4BBS G;  3OTO Q;  4YWK A;  1QUQ B;  4A76 A;  1PYS B;  1WCM H;  4LUZ A;  4GOP C;  4OWT B;  5C3E H;  3J81 i;  3HKZ G;  3S2D H;  3EBE A;  1Y1V G;  3I7F A;  1Q1E A;  5IP9 H;  2R93 G;  2RCN A;  3I4M H;  2Z0S A;  4PG3 A;  1YZ6 A;  2ZJR A;  4DK6 C;  3K0X A;  4JI0 Q;  4GN4 B;  3PIP A;  4A3I H;  2UU9 L;  4IJL A;  2Q2H A;  2YTX A;  3UDI A;  3PIO A;  1E1T A;  4JI6 Q;  1QZG A;  2JEB I;  1A63 A;  5C44 G;  4A3J G;  4MNO A;  2F4V L;  1LM0 A;  1HJP A;  1QZH A;  2Y0S E;  2Y0S G;  3CMA A;  1TXY A;  1MKH A;  3D31 A;  1W3S A;  1X56 A;  3OTO L;  1SE8 A;  3U4V A;  1A8V A;  4A4I A;  1U0L A;  1FJG L;  4TQU S;  4PMW A;  3U58 A;  2OQ0 A;  1PA6 A;  2OQK A;  5BR8 Q;  4UY8 C;  4DR6 Q;  1YBY A;  1L1O C;  2LSS A;  4JI0 L;  2JK8 A;  4PZ8 A;  4BY7 G;  1VQJ A;  1UE1 A;  5EAY A;  4P72 A;  2NVT H;  4BBS H;  1CUK A;  4JI6 L;  3PO2 G;  1YHQ A;  1KAW A;  1K83 H;  4YCV A;  2HIV A;  4GKJ Q;  3WWV A;  4QGU A;  3BZC A;  2R93 H;  2B63 G;  4JI4 Q;  4K0K Q;  3I4O A;  1XMO Q;  3K80 C;  1LYL A;  4GNX B;  4L5T A;  4NXM Q;  3CC4 A;  3H3V H;  3M4Q A;  3HOX G;  4A3K G;  2N3S A;  1EQQ A;  2NVX H;  1IYJ B;  2OWO A;  4IOA A;  2ALY B;  4A3J H;  1YJW A;  1IBM Q;  4J15 A;  4DR5 Q;  4A3G G;  3AEV A;  3U50 C;  4DV3 Q;  1M90 C;  3HOV G;  2KEN A;  1VQN A;  2RHQ B;  2RHS B;  4JI7 Q;  4A3B G;  1OXX K;  3W1G A;  1GM5 A;  4YHH Q;  3F2B A;  4GKJ L;  4DR3 Q;  3ICE A;  4YY3 Q;  4Y52 H;  3K7A H;  4HJ8 A;  1PH8 A;  2YTV A;  1SRO A;  4B3R L;  1N34 Q;  1XPR A;  4KLK A;  1UE7 A;  1VQB A;  1TWC H;  3PO2 H;  3NEL A;  5JJK A;  3PUZ A;  1RIP A;  4C3H H;  1HH2 P;  1YIJ A;  4IFD G;  3FKI G;  3GTK H;  4JI5 Q;  1IBL Q;  4JI3 Q;  1VQO A;  2B63 H;  4KHP Q;  2VUM H;  3HKS A;  1QUQ A;  5GAE C;  5E7N A;  3H0G G;  4JI7 L;  1HZC A;  1J6Q A;  3CD6 A;  3NEM A;  3S2H H;  2NN6 I;  1K73 C;  5HY6 A;  3HOX H;  4AIM A;  4DR3 L;  1VQE A;  3TS0 A;  1NMG A;  3JAM c;  1VQK A;  3M7N A;  2ZTE A;  5H1S E;  5M3F G;  3RZD H;  1MJE A;  4B3M L;  5JJL A;  4A3G H;  1UEB A;  4FDB A;  1DGS A;  4O2D A;  3HOV H;  4DR4 L;  3HOZ G;  1AE2 A;  1I3Q H;  3S14 H;  3AFQ A;  3PCO B;  2E8G A;  1JJ2 A;  3S1Q H;  2PI2 A;  2GN5 A;  2VL6 A;  4JI3 L;  3T1Y Q;  2UXC Q;  2QGQ A;  3L7Z C;  1X65 A;  4A93 G;  1Q86 C;  3F8T A;  1OXT A;  3JAM i;  5C4X G;  2UUA L;  2D62 A;  5IYB G;  1VCI A;  4RMF A;  3PUW A;  1G6P A;  3KOJ A;  1YI2 A;  1EFW A;  2B29 A;  4H02 A;  3NEN A;  3FKI H;  3RLO A;  1EWI A;  2XGT A;  2A1A A;  4DKA C;  1NMF A;  1V1Q A;  2A8V A;  2A19 A;  4HJA A;  1H95 A;  4GLV B;  4JYA Q;  1YJN A;  2AMC B;  3I4N H;  1YNX A;  2E5L Q;  3OYY A;  1KD1 C;  2EXD A;  5M3F H;  3T1Y L;  1XTD A;  5C0X I;  3CF5 A;  2JA5 G;  3KF6 B;  2ASB A;  4ALP A;  3HOY H;  3HOZ H;  4RG1 A;  5LMN W;  4JI1 Q;  2KCM A;  2Q2U A;  1YHA A;  2JE6 I;  3ZJY C;  3AFP A;  1G29 1;  2Q2I A;  2GVA A;  2BH2 A;  1YVC A;  2Z6K A;  4LF5 L;  1IBK Q;  1EIY B;  1MIU A;  4DV2 Q;  4B3T Q;  3CC2 A;  3J81 c;  1GKH A;  1K8G A;  1VQI A;  3S17 H;  1Y14 B;  1TWH H;  4A93 H;  2K5H A;  1IL2 A;  2IY5 B;  3H3V I;  4YCU A;  4DV6 Q;  4GS3 A;  1VQC A;  4XIG S;  2MO1 A;  3MEF A;  4LF9 L;  1SRU A;  1BBU A;  1S40 A;  4DR7 L;  2VS1 A;  2E2I H;  3FP9 A;  3GTQ H;  2JA6 G;  2JEA I;  3S15 H;  1LTL A;  4A75 A;  4PZ6 A;  2Q2T A;  2IX0 A;  1HR0 W;  1TWA H;  3T1H L;  2ES2 A;  3ULL A;  4B3T L;  2F3I A;  1E22 A;  1XNR Q;  1X6O A;  1HNW Q;  4OWX B;  2D0P A;  1O7I A;  3M4P A;  3RR5 A;  1P16 A;  4LFA Q;  5IE8 A;  1PH6 A;  4B3S Q;  2MNA A;  4MTN A;  5HGQ A;  1UWV A;  1J5E Q;  2H5X A;  1IXR A;  4O0A A;  4DV6 L;  2WFW A;  2NZO A;  4LW1 A;  1WJJ A;  1I94 Q;  3K7U C;  4JV5 L;  1C0A A;  4R4O A;  3TRE A;  3U4Z A;  1B8A A;  2UUC Q;  2R7Z H;  4UP7 A;  4P71 A;  1E1O A;  4DV5 Q;  5GAG C;  4EX5 A;  1EOV A;  4L5Q A;  1C9O A;  3AYH B;  4YWM A;  2CFM A;  1VQ9 A;  1KC8 C;  1IZ6 A;  4UP8 A;  1YHB A;  2PMZ E;  3PSI A;  3RLF A;  1BVS A;  1YJ9 A;  1TWF H;  3A5U A;  1CKN A;  2JA6 H;  1J5E L;  1I6H H;  4JOI A;  2UUB Q;  2EIF A;  4HIK A;  2QA4 A;  1XMQ Q;  1JE5 A;  4OWW B;  1VQD A;  3HOU G;  3G6E A;  4R4T A;  2UUC L;  3M3Y H;  1Y1V H;  1VQ7 A;  1GD7 A;  5ELN A;  1WOC A;  4DV5 L;  4GNX C;  4XTC S;  2E2H H;  1U5K A;  1OXS C;  2K14 A;  5BR8 L;  4DR6 L;  4L5R C;  4POG A;  4DR2 Q;  3KDF B;  2Z6K C;  3PV0 A;  1X3E A;  4NB3 A;  5C44 H;  4IFD I;  4C2M H;  4YWL A;  3L0O A;  5IYC G;  2HT1 A;  2UUB L;  4A3C G;  1K8A C;  4DV4 Q;  4BBR G;  5GAD C;  1XMQ L;  4DNI A;  4DAM A;  4LWC A;  2NVY H;  4IO9 A;  1K3R A;  4GN5 A;  2PI2 E;  5IT9 c;  3J7Z C;  3CCM A;  3S1N H;  2EQS A;  1VQP A;  3PGZ A;  4X66 Q;  3PF4 A;  1NE3 A;  3A0J A;  4AYB G;  4AYB E;  4DAY B;  4JI4 L;  2N49 A;  1X54 A;  4K0K L;  1XMO L;  1KQS A;  5M3M G;  5M5W H;  4NXM L;  3CXC A;  3KYH C;  1XNQ Q;  4BY7 H;  4DR1 Q;  1TWG H;  3CCV A;  4PZ7 A;  4A3M G;  4R4Q A;  1WYD A;  3TQY A;  2JJQ A;  1Q8K A;  1I5F A;  3PF5 A;  2VQF Q;  4DR5 L;  1IBM L;  3HOU H;  2NZH A;  4DV3 L;  3S1M H;  2BA1 A;  4HIO A;  1JT8 A;  4QY7 A;  4JBM A;  1LUZ A;  1Q46 A;  3LGJ A;  4HJ5 A;  1KHI A;  3ULJ A;  1X55 A;  2UXB Q;  4YHH L;  5M5X H;  1Z47 A;  4A3F G;  2VQE Q;  1I50 H;  4X66 L;  4A3K H;  2ZTC A;  4YY3 L;  1NY4 A;  1OXU A;  1L2F A;  3RZO H;  3CCR A;  2B3G A;  1Z9F A;  3CCS A;  2I5M X;  2HHH Q;  4LF6 Q;  5IYC H;  4A3C H;  1N36 Q;  1N34 L;  3RLN A;  3G4S A;  4DR1 L;  1N33 Q;  4C3I H;  4NXN Q;  1HNX Q;  4A3B H;  3AQQ A;  1EQR A;  1A62 A;  1KRT A;  1AE3 A;  2K4K A;  1QVF A;  3Q8D A;  4LF8 Q;  5IYD G;  4NPS A;  2MFI A;  4JI5 L;  1IBL L;  3A5Z B;  4KHP L;  4BXX G;  4JC0 A;  4OO1 G;  5M3M H;  3MXN B;  4JOI C;  4DV0 Q;  2UXB L;  5M5Y H;  3E0E A;  3M4O H;  4UPA A;  4QQB X;  2YV5 A;  3UE0 A;  4AH6 A;  4Y7N H;  1VQM A;  4IOC A;  2HHH L;  1Y1W G;  1N32 Q;  1VQF A;  1E7Z A;  4LFC Q;  5LMU Q;  5IY0 A;  2AWO A;  3RNU A;  3I56 A;  4LFB Q;  1HNX L;  3H0G H;  2AKW B;  2OCE A;  1Q7Y C;  1PH1 A;  2I5L X;  3DM3 A;  3F2D A;  4OX9 Q;  1MJC A;  2KBN A;  4LF8 L;  4A3E G;  1B7Y B;  2VNU D;  2PNH A;  2R6G A;  3GTO H;  4UP9 A;  2UXC L;  4IPH A;  3BZK A;  3ERS X;  4GNX A;  4WJ3 M;  1S3O A;  1UE6 A;  5FJ8 G;  3KDF A;  3L2P A;  2XTI A;  2VY3 A;  1N32 L;  4AQY Q;  1M1K C;  4P73 A;  2NN6 G;  1HNZ Q;  5IYD H;  4KHZ A;  1PH3 A;  3HOW G;  3D0F A;  4LFB L;  4QIW E;  3OW2 A;  4X65 Q;  1CSQ A;  5FLX c;  4JYA L;  2CKZ B;  3VDY A;  1VQL A;  4OX9 L;  5C4X H;  5DLQ E;  2E5L L;  5IYB H;  4JBJ A;  4GKK Q;  2OTJ A;  4DUY Q;  2YU9 H;  3GTG H;  1Y1W H;  4QL5 A;  2VUM G;  2YTY A;  1FGU A;  2K50 A;  1EIF A;  3B6Y A;  1PH4 A;  1X3G A;  4JI1 L;  2K75 A;  3JC6 6;  1PH7 A;  3KLW A;  4BY1 G;  4LF7 Q;  1HNZ L;  5C4J H;  1IBK L;  1L0W A;  2IHE A;  4DV2 L;  4A3E H;  4GN3 B;  3ER0 A;  3RN5 A;  1OXV A;  4X65 L;  1P8L A;  1YEZ A;  2JA5 H;  2R7D A;  3STB D;  5FJ8 H;  4X64 Q;  1K0R A;  4GKK L;  3ULP A;  1PHJ A;  4DUY L;  1OTC A;  2DGY A;  4GLX A;  2IX1 A;  1CSP A;  2I5H A;  3CME A;  1UE5 A;  1PH5 A;  2UU9 Q;  1SMX A;  2BH8 A;  5IP7 G;  3M85 A;  1W2B A;  3HOW H;  4OON A;  3CCU A;  4QJF A;  3STB C;  1YIT A;  1ASZ A;  2F4V Q;  3S16 H;  1G51 A;  4LF7 L;  1KIX A;  2AHO B;  4BA2 I;  3J7A 5;  1XNR L;  1HNW L;  1HZB A;  1NBW A;  2DUD A;  3BJU A;  4B3S L;  2WAQ E;  2WAQ G;  4GLA C;  4LFA L;  3HKZ E;  1FJG Q;  1VQ6 A;  4X64 L;  1E24 A;  2KHJ A;  4JCV E;  3UDX A;  4GOP B;  1ASY A;  1KL9 A;  3S24 A;  1PFS A;  3NBH B;  1C7Y A;  4BY1 H;  2MO0 A;  1KXL A;  1QVG A;  1I94 L;  4LF4 Q;  3GDE A;  2R92 G;  3BU2 A;  1EYG A;  1D7Q A;  1HZ9 A;  4KI0 A;  4EQ5 A;  2V1C C;  4ME3 A;  4LNQ A;  3F1Z A;  2QEX A;  3GD7 A;  4R1J A;  4JG2 A;  2YYZ A;  3J81 j;  2GVB A;  5GQO A;  3TEH B;  3EN2 A;  3KF6 A;  5IP7 H;  2FXQ A;  4LUV A;  1Q82 C;  2VZA A;  2ZTD A;  3KJP A;  2JA7 G;  2ZJQ A;  2HIX A;  2KHI A;  1WFQ A;  1Q81 C;  2BA0 A;  5JEA J;  1T9H A;  5J3B A;  3W5O A;  4DPG A;  4LF4 L;  1L1O B;  1NTG A;  3TRZ A;  2WB1 G;  2WB1 E;  3GTM H;  3GTP H;  2N8N A;  1PV4 A;  2NVQ H;  3EIV A;  3CPW A;  2R7F A;  3F2C A;  4HJ9 A;  1PYB A;  2ZM6 Q;  2LXJ A;  1VQ5 A;  3CCJ A;  4X6A H;  1S72 A;  3G71 A;  4B3R Q;  5FLM G;  4DR2 L;  1K9M C;  2PQA B;  2I0Q A;  2R92 H;  4JI2 Q;  1VS0 A;  4DV4 L;  3H15 A;  4OO1 I;  1WI5 A;  4YCW A;  1XPO A;  3J80 c;  3KF8 B;  4WJ4 A;  3GO5 A;  1VQ4 A;  3I2Z A;  3CCL A;  5C0X J;  3GTJ H;  2UXD Q;  4R4I A;  1D8L A;  3PUV A;  3I55 A;  4IPD A;  2ZM6 L;  1QVC A;  2N78 A;  3RN2 A;  1XNQ L;  2JA7 H;  4B3M Q;  4BBR H;  1JMC A;  3K81 C;  1NJI C;  1SLJ A;  2D0O A;  3CP0 A;  4TVA B;  1Q1B A;  2ZJP A;  5LMN Q;  4DR4 Q;  2F52 A;  2LXK A;  2IT1 A;  2VQF L;  3CC7 A;  5JJI A;  1V43 A;  4JI2 L;  2MQH A;  4X62 Q;  2HQL A;  3S1R H;  3PO3 G;  3CAM A;  2K5V A;  3J80 i;  1CKM A;  3K8A A;  1B70 B;  1SN8 A;  4POF A;  5GAH C;  2VQE L;  4A3M H;  2UXD L;  4C3J H;  5FLM H;  3UDG A;  2JA8 G;  4HID A;  4LF6 L;  5ELO A;  3I4N G; 
#chains in the Genus database with same CATH topology
 4DAP A;  4GOP A;  4R8U A;  2D5D A;  4XYQ A;  1N8R C;  4JI3 H;  3UE1 A;  1EWC A;  3SK8 A;  3LP8 A;  2ID0 A;  2W6Z A;  3Q23 A;  4MV8 A;  1TS4 A;  2V4R A;  5IWA Q;  4QWE A;  3HOW B;  1V4Y A;  4NMZ A;  2GPS A;  2WKD A;  1SE3 A;  4X3S A;  1HUM A;  4JBW A;  2V59 A;  5DAU A;  3CCQ A;  2KCT A;  4RFB A;  5KND A;  4S3S A;  3Q8R B;  3PO3 H;  3MWY W;  2R8J A;  4BXX H;  3I4M B;  1FNW A;  1H9M A;  3NBI A;  2KVM A;  2G5D A;  2L9H A;  3EPG A;  2F0Q A;  2AWN A;  1LAB A;  1EQT A;  3JSL A;  5C5L A;  4XDX A;  2NBF A;  2P5Z X;  1WCM G;  3MVV A;  1JJC B;  4DV1 L;  2XCP A;  5C3E G;  4A3D H;  4EG0 A;  2QF7 A;  5GON F;  1BXT A;  4DV7 L;  2LY7 A;  3GTO A;  1A9X A;  4GKJ H;  5GRO A;  2F0N A;  3KHG A;  2B2V C;  1SNC A;  4DUZ L;  1ZET A;  2R7Z G;  1RJP A;  2NUA B;  1D5Z C;  4I7Z C;  4IJH A;  2A6E D;  1CKO A;  3NUC A;  4K8I A;  3J81 E;  4DL4 A;  2NN6 H;  3R3O A;  4KD3 A;  1X9N A;  3VR6 A;  2CQO A;  1PZK D;  4F4W A;  4WD3 A;  1RL2 A;  3OHX C;  4JV5 Q;  3PW4 A;  4CC5 A;  4DR3 H;  4LMQ D;  4YY3 H;  1II3 A;  4YWK A;  1STG A;  3NGD A;  4A76 A;  1QB5 D;  2IWH A;  3MR5 A;  5JEA H;  2W57 A;  1Q1E A;  5IP9 H;  1K0S A;  2R82 A;  3RFC A;  3I4M H;  2Z0S A;  2KED A;  4PG3 A;  2BDN A;  4DK6 C;  1GYF A;  3K0X A;  3Q8S B;  2WV6 D;  4GN4 B;  3BS1 A;  1RJT A;  4JW0 A;  2D9U A;  2Q2H A;  1IBL H;  3OWF A;  1E1T A;  1PDQ A;  3K7A B;  5C44 G;  1LM0 A;  2OXP A;  1HJP A;  3CMA A;  4LH7 A;  3D31 A;  4LMY A;  4QMG A;  2BR0 A;  4A4I A;  3K5N A;  4C3H B;  2KOL A;  2OQ0 A;  1RK5 A;  4ECV A;  1L1O C;  4JI0 L;  1F2Y A;  3MFY A;  4P72 A;  5D3D A;  1B50 A;  2YW2 A;  4C5A A;  5LL6 X;  1TY2 A;  5KX5 F;  3WWV A;  3BZC A;  4HTH A;  4K0K Q;  3K80 C;  4L5T A;  5KFN A;  5J2U F;  4QWA A;  1EYZ A;  3URY A;  1C48 A;  4A3K G;  5D14 A;  1IYJ B;  2OWO A;  2W7P A;  2K05 A;  1YJW A;  3NTI A;  1B6R A;  4J15 A;  4A3G G;  3AEV A;  5KT3 A;  4ZLT F;  5A35 A;  4RHR A;  4C3I G;  1YNN C;  3W1G A;  3H09 A;  3NSW A;  4YHH Q;  1GM5 A;  3C2P A;  5EWF A;  3N8D A;  2C2E A;  4HNV A;  1HQM C;  1V1P B;  3K7A H;  3BQ1 A;  1PH8 A;  3GTM A;  3GTP A;  3GIP A;  4B3R L;  1MBY A;  1IBK H;  2R84 A;  4B3T H;  1UE7 A;  3I4N B;  5F9N A;  2UVU A;  1B6S A;  2G9D A;  3KBG A;  3NWS A;  4C3H H;  1DD2 A;  4F88 A;  3TSS A;  4RGT A;  1TII D;  4JI3 Q;  3MEH A;  5GAE C;  4JI7 L;  3V6J A;  4JV1 A;  1ICW A;  5L9X A;  4DL6 A;  1HA6 A;  2A68 C;  3FDS A;  4ABN A;  3RZD H;  1RKN A;  2QCP X;  5JJL A;  5ISR A;  2OLS A;  4EGQ A;  5KFI A;  3DWQ A;  4QF4 A;  1LT5 D;  3LNN A;  1I3Q H;  4LFA H;  3PCO B;  2E8G A;  1JJ2 A;  4QIW B;  4HMI A;  3VA5 A;  5EOY A;  3NQI A;  2WB1 A;  4DXF A;  5BMV F;  2QGQ A;  1I94 H;  3L7Z C;  3RBE A;  1WCM B;  5IYB G;  5C3E B;  1GUT A;  3EFX D;  1ILP A;  1EFW A;  1G6P A;  1PFN A;  4DV5 H;  2FHT A;  2B29 A;  4IFD H;  2WIN B;  2A1A A;  5BN4 A;  1V1Q A;  1HTP A;  3FDT A;  3I4N H;  3VA7 A;  2KEE A;  2EXD A;  5DEH A;  2R7Z B;  2UUB H;  4HCS A;  2GA4 B;  3TZD A;  3T1Y L;  1XMQ H;  5C1P A;  2WTF A;  3H4D A;  2FMM A;  3A7A B;  3SDZ A;  2ASB A;  1KC7 A;  1JC7 A;  2K7V A;  2YS6 A;  2R8K A;  4JI1 Q;  4FXK C;  5EKK A;  1YHA A;  3ZJY C;  1G29 1;  2Q2I A;  3KK7 A;  1YVC A;  1B3A A;  2VA2 A;  1TWF B;  4LSA A;  1EIY B;  3ERQ A;  3CC2 A;  1GXD C;  1K8G A;  1VQI A;  3S17 H;  4I50 F;  2J6U A;  1A15 A;  2K5H A;  2RGR A;  1SAP A;  4DV6 Q;  5CMD A;  2RSO A;  2XN9 C;  4I65 A;  1SRU A;  1AZQ A;  3FP9 A;  3GTQ H;  1LTL A;  1SYC A;  1D1K A;  3NQT A;  2IX0 A;  4PZ6 A;  1TWA H;  2SNS A;  3QOJ A;  1TA8 A;  3ULL A;  5C44 B;  1FNV A;  1EEF D;  4YJ2 F;  1E2V A;  1O7I A;  2K03 A;  5KFR A;  4MTN A;  3MHB A;  1JDB B;  5EPL A;  5HGQ A;  2H5X A;  2WFW A;  5J2T F;  2NUC A;  3VR5 A;  3K6O A;  4LW1 A;  4O4H F;  4Q45 A;  3QZ7 A;  1XX8 A;  2UXB H;  4OIJ A;  2ICE C;  4JV5 L;  4R4O A;  4LJZ C;  2R7Z H;  4XXE A;  2JP1 A;  3EQL C;  2VQE H;  1ZHS A;  3H4B A;  4Q0Y A;  5GAG C;  1RHP A;  1ESR A;  4LF6 H;  1EOV A;  2E2I A;  4DXG A;  4YWM A;  3N42 B;  1IZ6 A;  1YJ9 A;  1YHB A;  3PSI A;  1XWE A;  3NTH A;  1TWF H;  1VDZ A;  4HED A;  1KAB A;  2EJM A;  4DNT B;  1J5E L;  4MV6 A;  4JOI A;  4HIK A;  2QA4 A;  1JE5 A;  1I50 B;  4A3K B;  2F0F A;  1VQD A;  1MGS A;  2R6F A;  3GLK A;  1STN A;  3HOU G;  4A3G B;  3G6E A;  2UUC L;  1GD7 A;  3P75 A;  1WOC A;  1ET6 A;  4C3I B;  5KT6 A;  4XTC S;  5K2M A;  4PQX A;  1U5K A;  1OXS C;  3S1Q B;  1EL0 A;  2W9B B;  3OMG A;  3U9S A;  1EY0 A;  4DR2 Q;  1CZW A;  4O3Q A;  5C44 H;  1H9R A;  4J6H A;  3L0O A;  5IYC G;  2HT1 A;  3ORR A;  4OX9 H;  4DV4 Q;  4BBR G;  4RKL A;  4DNI A;  3RMH A;  3MAQ A;  4LWC A;  4IO9 A;  1K3R A;  5IT9 c;  1M4V A;  3J7Z C;  2EQS A;  3PGZ A;  5G3L F;  4X66 Q;  3PF4 A;  5KFE A;  1NE3 A;  3A0J A;  4AYB E;  4K0K L;  3TQ1 A;  1XNQ Q;  4C5C A;  1GUS A;  1WYD A;  3MXP A;  2JJQ A;  1GJX A;  4X65 H;  1I5F A;  1K8O A;  3W3A A;  3S1M H;  5KIX A;  4JBM A;  4RAU C;  4HJ5 A;  2EYJ A;  1X55 A;  5KFU A;  4YHH L;  5M5X H;  1E0B A;  5I6W A;  1I50 H;  1EYC A;  2Y0S A;  4A3K H;  4ZQ3 A;  4J0M A;  2HHH Q;  4QUF A;  2KSW A;  3G4S A;  3N52 A;  2JEJ A;  1KJ8 A;  2H4O A;  3DWA A;  1EZ6 A;  4C3I H;  1XNR H;  4DL3 A;  2FK3 A;  4I7H A;  3AQQ A;  3HGB A;  2NB0 A;  1Y1W B;  5L1K A;  1KRT A;  3UI2 A;  4X64 H;  4NPS A;  4JC0 A;  4L8J A;  1CQJ B;  2Z6B A;  4NDX A;  4UPA A;  1JOQ A;  5C4J B;  4AH6 A;  4A3E B;  1N32 Q;  1H9S B;  3RV4 A;  5EKL A;  4XT3 B;  1K3B C;  2AWO A;  3RNU A;  3SVM A;  3SK5 A;  3E0J A;  1OO9 B;  5KG1 A;  4IRD A;  3SEB A;  5ELD A;  3VR3 A;  1WTW A;  5L1J A;  4F4Z A;  2OT2 A;  4ECW A;  5FO8 B;  2L0C A;  5BPF A;  1JKJ B;  1I3Q A;  1LT4 D;  4UP9 A;  3EPI A;  1S3O A;  3T51 B;  4LF4 H;  1B3Q A;  1K1S A;  2CHB D;  3L2P A;  4IUQ A;  4IZ8 A;  2VUM B;  1M1K C;  4JV0 A;  1HNZ Q;  2HCI A;  5IYD H;  1ZHQ A;  3MTS A;  4KHZ A;  4Y8V B;  1B9N A;  3D0F A;  5ELE A;  3OW2 A;  4LFB L;  3V4Z A;  1CSQ A;  5FLX c;  1W96 A;  2CKZ B;  4FXD A;  4RCN A;  5IYB H;  4GKK Q;  4RB3 C;  4FBT A;  3CRK C;  3HS0 C;  1Y1W H;  3H0G A;  4DL2 A;  5E4X A;  4ETS A;  5DG9 A;  3K5H A;  1CQI B;  3RGX A;  5DG7 A;  5IGD A;  2QK4 A;  4JI1 L;  4KHV A;  5CV5 A;  2E2H B;  3NWT A;  2Q8I B;  4BY1 G;  2L11 A;  4E6I A;  5JJZ A;  1JE4 A;  5KEE A;  2ZM6 H;  5C4J H;  4A3E H;  2IHE A;  4GN3 B;  3ER0 A;  3RN5 A;  1JOR A;  3RV3 A;  5D3I B;  4B3R H;  4HCE A;  3T13 A;  1K0R A;  2PZU A;  3I73 A;  1OTC A;  1PRT F;  3VPD A;  2PMZ B;  3KUP A;  3X3M A;  4PV1 C;  1W2B A;  3M85 A;  3BDL A;  1TWG B;  2XIW A;  4OON A;  3STB C;  3GTG A;  3LWE A;  4ZUI A;  2AHO B;  3AU7 A;  4HR7 B;  3GQC A;  3J7A 5;  3GTQ A;  4F4Y A;  3RAX A;  1HZB A;  3BJU A;  4ECZ A;  2VUM H;  1TWA A;  4GLA C;  1VQ6 A;  1CHQ D;  2YZN A;  5ELC A;  1BXR A;  4GOP B;  5IT9 L;  4R8U B;  4X62 H;  1KL9 A;  3GTJ B;  3S24 A;  4IRK A;  1STY A;  3TP8 A;  2JA5 A;  1DM0 B;  3GDE A;  5DM6 3;  1DXM A;  2JA7 B;  4EGJ A;  4BBR B;  1VKZ A;  4A2B A;  3MR2 A;  4FF2 A;  4MHE A;  3P7J A;  4EQO A;  3V6H A;  1PZI D;  3S1R B;  2FIN B;  2FXQ A;  3D3R A;  2ZTD A;  3T4A C;  3KJP A;  2ZJQ A;  3MR6 A;  3OIP A;  5IWA H;  4C3J B;  2VR1 A;  1WFQ A;  5KNC A;  2BA0 A;  1AH9 A;  1TWF A;  5J3B A;  3PW2 A;  1NAP A;  2DPI A;  2WB1 G;  4C5B A;  2NVQ H;  2WE6 A;  3F2C A;  3TME A;  1XDN A;  1PYB A;  2Q8T A;  4ED8 A;  2LXJ A;  1BNZ A;  3CCJ A;  3PZP A;  1RCV D;  4X6A H;  4RB1 A;  1S72 A;  1JWS D;  4DR2 L;  1LLR D;  4NLG A;  1E4E A;  3DWP A;  1SFO B;  1YNJ C;  1VS0 A;  3T16 A;  4DV4 L;  1WTX A;  2CW7 A;  1WI5 A;  2HQE A;  3X3N A;  1GUW A;  4WJ4 A;  4RWS C;  3D4D A;  3WDN A;  3GTJ H;  2KCC A;  3CCL A;  3GIM A;  4R4I A;  5JAV A;  1D8L A;  3PUV A;  3U9O A;  4HSV A;  4HNU A;  2N78 A;  1ICF B;  1XNQ L;  2JA7 H;  4BBR H;  4EVO A;  3K81 C;  2NTS A;  5COY A;  2D0O A;  3GV8 B;  2AGP A;  1WTR A;  2JA8 B;  2QEJ C;  2IT1 A;  3HBL A;  1AEX A;  3CC7 A;  2MQH A;  3SK4 A;  3BDC A;  3S1R H;  3PO3 G;  3CAM A;  4K5V A;  3J80 i;  4UCO A;  2R61 A;  3K8A A;  4M8A A;  5KFH A;  5GAH C;  1W93 A;  4C3J H;  5FLM H;  4JV5 H;  2K52 A;  2F0G A;  3A54 A;  4IUT A;  4DK3 C;  4A3D G;  1LTB D;  1I50 A;  3UDF A;  5LMN L;  1VQG A;  3CW2 C;  2ATW A;  3BZD B;  4MZ9 A;  3JAM E;  2RGV A;  1XJV A;  2BDO A;  2VB3 X;  1KDC A;  2XWJ B;  2N55 A;  4IPG A;  2WP8 J;  1SFO H;  4DV1 Q;  1R9T B;  1SNO A;  1JCK B;  1ENC A;  3GID A;  2R8I A;  4HJ7 A;  1CKN B;  3PVX A;  4DV7 Q;  5L37 A;  1ULZ A;  2FFK B;  3GIJ A;  3K57 A;  2CH4 A;  2IBK A;  1LO5 D;  2HVS A;  3IRB A;  2EE1 A;  3T56 B;  4DUZ Q;  5KG6 A;  3BYT B;  3OWE B;  2XCL A;  3E9H A;  4C56 C;  1EY6 A;  2JA8 H;  3S9W A;  3OHA A;  2VA3 A;  3I91 A;  1PH2 A;  3E9I A;  4ILW A;  2A5H A;  4I4T F;  4DL5 A;  2EVB A;  2F0S A;  5JEA G;  5IP9 G;  3M9B A;  1STA A;  4P74 A;  3I4M G;  1QCB D;  1XTC D;  2HDM A;  4BA1 I;  2XCA A;  2K6A A;  5AJ3 L;  1N9W A;  1TT2 A;  1EEI D;  2F0O A;  3EVQ A;  3T1H Q;  4ID6 A;  1TAE A;  3TII A;  2Q8R E;  1BKB A;  1TVX A;  3KF8 A;  4K0K H;  1UC9 A;  1A2T A;  3GIQ A;  2V4D A;  2NVT B;  2M05 A;  1KRS A;  4RUC A;  4RAY A;  1KJI A;  3HG9 A;  3GTP B;  5HV6 A;  5I2X A;  3Q8P B;  4CDD C;  1T3N A;  4R4C A;  1BO0 A;  3HKZ B;  5DG8 A;  3PQI A;  1VQ8 A;  1O7Z A;  4UHV A;  5J1Z A;  3SHL A;  3MWM A;  2IL8 A;  4QW9 A;  1Q12 A;  3BA8 A;  2KCN A;  1Y1W A;  3KLS X;  4YHH H;  4MN3 A;  1R9T H;  1E3P A;  4YJ3 F;  1V9P A;  1UUP A;  2F0U A;  3EYY A;  3D4W A;  3OIQ A;  3BVZ A;  4ZOL F;  4GOP C;  3A56 A;  3M9M B;  3J81 i;  4HYK A;  3I7F A;  3ITP A;  4J9P A;  2RCN A;  4N8X 1;  1HUN A;  1D6E C;  1YZ6 A;  2E74 C;  2ZJR A;  1KJJ A;  4JI0 Q;  1H9S A;  5K36 H;  3RB3 A;  1Z6H A;  1G6Z A;  2G9H D;  1F2L A;  2YTX A;  3UDI A;  1A63 A;  1DON A;  1QZG A;  4M7E A;  1JB3 A;  2JYO A;  3SE7 A;  5FK9 C;  4MNO A;  5I9O A;  3OHB A;  2Y0S G;  2RBM A;  2CW0 C;  3OTO L;  2WB1 B;  3PO2 B;  1A8V A;  2EXZ A;  3CRL C;  2CQY A;  2OQK A;  4UY8 C;  5C0X H;  3GIK A;  4KN4 C;  2LSS A;  2VUM A;  1SMY C;  2NVT H;  2C2R A;  1SEB D;  1J8I A;  3T5H A;  4JI6 L;  1HFN A;  3OMC A;  4C3H G;  1KAW A;  5IYZ F;  2HIV A;  3OUZ A;  4XQJ A;  3S14 B;  5KFZ A;  1YNN D;  2TSS A;  2QKI C;  4UCV A;  3H3V H;  1O7Y A;  4P2C B;  1EQQ A;  4IOA A;  3KHH A;  3ETH A;  1ENF A;  1IBM Q;  2CQA A;  4DR5 Q;  3M4Y A;  1M90 C;  2WYO A;  2XD4 A;  1I4R A;  1V1O A;  1SNQ A;  2K5D A;  1VQN A;  4E4T A;  2RHS B;  2PW7 A;  4JI7 Q;  1AUV A;  3PO3 B;  3F2B A;  1W6J A;  3ICE A;  4C1N K;  4Y52 H;  2C5C A;  2C00 A;  4JI1 H;  1SRO A;  4WRD A;  2VXW A;  1N34 Q;  2WAQ A;  4L1K A;  1XPR A;  1IOW A;  1VQB A;  2A68 D;  2JEI A;  3PO2 H;  5HGT A;  2IP4 A;  1SJE D;  1YIJ A;  1HH2 P;  1GOZ A;  3RUZ A;  5KYL A;  2J4X A;  5JVG 3;  4IFD G;  2YRX A;  4XZ3 B;  3HOZ B;  2NU9 B;  4KHP Q;  4HR7 A;  4DV6 H;  4F8M A;  2NVX A;  5C4H A;  1QUQ A;  3C46 A;  1SJH D;  3H0G G;  1HZC A;  2W7O A;  1HPC A;  1K73 C;  3HOX H;  5DLF A;  2EDG A;  2ZTE A;  5IIF A;  1MJE A;  3GTJ A;  3R5F A;  4HQ6 A;  4IWX A;  4FDB A;  5JPM C;  4ED1 A;  1AE2 A;  3S14 H;  2JA7 A;  1KNE A;  3AFQ A;  1M0W A;  5FD5 A;  2E2I B;  1S68 A;  2DWC A;  3T1Y Q;  3U9T A;  5LYJ F;  2UXC Q;  1X65 A;  5IGC A;  2VQD A;  1OXT A;  5D1O B;  2D62 A;  1VCI A;  5IGG A;  3PUW A;  2ZXO A;  3KOJ A;  1EY4 A;  1YI2 A;  1RTN A;  2I46 A;  4K6D A;  3L4J A;  3FKI H;  2O2L D;  1EZ8 A;  1EWI A;  3MWD A;  2WDT A;  1NMF A;  1Y69 U;  4IAJ A;  2I07 B;  4DGZ A;  4HJA A;  3BVG A;  2W6O A;  2R8G A;  4JYA Q;  1YJN A;  2YCH A;  4UDU C;  2AMC B;  4UAI A;  3QB3 A;  3OYY A;  4DFA A;  5CC4 A;  3OSO A;  3QZ8 A;  1BCP F;  2JA5 G;  1HFG A;  4ALP A;  3HOZ H;  4RG1 A;  4O42 A;  1NNX A;  3SXH A;  3N6R A;  3WO0 A;  1SFO A;  2BE5 D;  2JE6 I;  2Q2U A;  1SXT A;  1GSH A;  4DV2 Q;  4L63 B;  3J81 c;  2ALZ A;  1VMC A;  3K5O A;  4DR2 H;  1IL2 A;  2IY5 B;  4FYD A;  2L12 A;  3M3Y B;  2MO1 A;  2R7N A;  4DV4 H;  1I7N A;  5HUR A;  2BCO A;  1IOV A;  3H3V C;  4UCT A;  2VS1 A;  2E2I H;  4OL7 A;  3SE0 A;  5LA6 F;  1CZG A;  4X66 H;  2KEC A;  1PMR A;  3SR1 A;  3T1H L;  1MD2 D;  4FXG C;  4C2M B;  1XNQ H;  1X6O A;  2Y0S B;  4R8I A;  4ZKC B;  1P16 A;  1PH6 A;  4B3S Q;  5I6Y A;  1S0O A;  1ZEQ X;  1UWV A;  1J5E Q;  2ENB A;  1IXR A;  1JXL A;  2NZO A;  4K8J A;  3AMU A;  4K6L A;  2ASD A;  5I2Y A;  2UUC Q;  3G6V A;  5CB4 F;  1PTO F;  4XYM B;  5EBD A;  2HHH H;  4CGY B;  4ECU A;  2ASJ A;  5CV9 A;  1R9T A;  2CFM A;  1VQ9 A;  1ZXT A;  3J80 L;  1RF2 D;  2RVL A;  2PMZ E;  3RLF A;  1X3Q A;  1BF4 A;  2N88 A;  1EUC B;  5DQH A;  4J9L A;  1CKN A;  3SK6 A;  3GII A;  3BYY B;  2KA7 A;  1EHI A;  2FPG B;  2YS7 A;  3RZD B;  2RDI A;  3M3Y H;  4R4T A;  3E5S A;  4RB0 A;  4IAL A;  4QUC A;  1VQ7 A;  3QR8 A;  1PZJ D;  3M9N B;  2X6G A;  1I3Q B;  4YB8 B;  1N32 H;  3L4K A;  1BDO A;  4POG A;  2CH4 W;  3O13 A;  4HMJ A;  1X3E A;  1LTR D;  4C2M H;  3DXJ C;  1EQV A;  3Q8Q B;  4OIK A;  4DAM A;  2F0E A;  4GN5 A;  5BPH A;  2K28 A;  2LFN A;  2N49 A;  3H0G B;  1RYS A;  3CXC A;  3HKZ A;  1HNZ H;  1ONL A;  4A3M G;  4R4Q A;  3QIA A;  3TQY A;  2W8L A;  1IBM L;  1GHJ A;  1I4X A;  4DR5 L;  5HBR B;  3MFI A;  2BA1 A;  3NXW A;  4HIO A;  1Q46 A;  3LGJ A;  3N44 B;  4GKK H;  2JEF A;  4XX0 B;  1HXY D;  4A3F G;  4ECS A;  2B2Y A;  4ECQ A;  1I7L A;  1NY4 A;  1OXU A;  5IGE A;  1GLV A;  3CCR A;  2NVY A;  5EQ0 A;  2KHS A;  1SNP A;  3MZ5 A;  3S17 B;  4A3C H;  1N36 Q;  1N34 L;  3RLN A;  1C8C A;  4EYI B;  4DR1 L;  2RKS A;  3IFT A;  4BWS C;  4NXN Q;  2R7M A;  2C22 A;  2QYZ A;  3QOL A;  2YU9 B;  1EQR A;  3GTG B;  1QVF A;  4ME6 A;  5IYD G;  3GTQ B;  4KHP L;  3A5Z B;  4WBN F;  3GP7 A;  4JOI C;  1TWA B;  3E0E A;  2ZDH A;  3V2T A;  1VQM A;  5C1O A;  4Y7N H;  4FM9 A;  3Q1K A;  2BQR A;  1Y1W G;  3J81 L;  1AZP A;  4JUZ A;  2JA5 B;  1Y8O B;  5LMU Q;  4KJO A;  3RAQ A;  1QWY A;  3I56 A;  4G7Z C;  4LFB Q;  1HNX L;  3H0G H;  1Q7Y C;  3F2D A;  2E76 C;  4U7C A;  1MJC A;  2KBN A;  4X3K A;  4LF8 L;  4R9W A;  4A3E G;  2KJX A;  3G7L A;  1FNU A;  5E3F A;  4TQS A;  4XQN A;  2UXC L;  3M7G A;  5EDW A;  2R7L A;  1QG7 A;  2PYK A;  1B1Z A;  4RB2 C;  1E2W A;  4AQY Q;  4P73 A;  4NW2 A;  4X3U A;  2FJZ A;  1PH3 A;  5KFQ A;  3NK9 A;  4F4X A;  4OO1 H;  4FVM A;  4I7A A;  1F2M A;  1HCZ A;  5NUC A;  1VQL A;  4JYA L;  5KFT A;  3FKI A;  2BE5 C;  4JBJ A;  4DAY A;  1F9S A;  2A69 D;  2YU9 H;  3GTG H;  4QL5 A;  2J7Z A;  2VUM G;  2YTY A;  1EIF A;  1PRT B;  5EPJ A;  1NR4 A;  1PH4 A;  2C9O A;  1E4E B;  1X3G A;  2V58 A;  2YRW A;  1F77 A;  2XGP A;  3E5N A;  2PVP A;  4EEY A;  3KLW A;  2HVQ A;  3N6X A;  5LOV F;  1L0W A;  4DV2 L;  4JVZ A;  5KG2 A;  3QFF A;  4IHJ F;  2JA5 H;  3STB D;  5FJ8 H;  4FNF A;  5T14 A;  5FKA C;  4DUY L;  1KLU D;  2RSN A;  4B08 A;  2IX1 A;  1CSP A;  3LWU A;  3CME A;  1UE5 A;  1SMX A;  2BH8 A;  4KK7 A;  5CV6 A;  4IR1 A;  1YIT A;  3S16 H;  2F4V Q;  1G51 A;  4LF7 L;  3BDO A;  1KIX A;  1G8Z D;  3MXU A;  2ZXR A;  1JLL B;  1K1Q A;  3RTX A;  3MR3 A;  3S1M B;  1LAC A;  5LL6 S;  4B3S L;  2WAQ G;  2O5I C;  4A2A A;  3HKZ E;  3T53 B;  1E4F T;  4JCV E;  5D1O A;  5M5X B;  1N56 A;  1PFS A;  3K5M A;  2IX3 A;  1SCU B;  3HRZ C;  2M00 A;  1EYG A;  3N40 P;  3PMF A;  4KI0 A;  4EQ5 A;  2V1C C;  4KKS A;  2QEX A;  3FRP B;  4JG2 A;  2YYZ A;  2B2U A;  3J81 j;  1WR2 A;  3EN2 A;  1BNC A;  3DF7 A;  5D65 A;  4LUV A;  2JA7 G;  1S5B D;  4A3M B;  2BOS A;  5FPR A;  2QW7 A;  3P1H A;  2HIX A;  3BA9 A;  2KHI A;  2IW3 A;  1T9H A;  3W5O A;  4DV1 H;  1CT1 D;  5KFX A;  2WB1 E;  3H94 A;  1PV4 A;  4TV8 F;  3OOC A;  1YNJ D;  3EIV A;  2J6S A;  4FS2 A;  1BBX C;  3VMM A;  3GV3 A;  3MC0 B;  1T5X D;  4O1N A;  5KFW A;  5KKN B;  3MJF A;  3Q24 A;  4DV7 H;  2AQ1 B;  4A3F B;  1LT3 D;  3H40 A;  1WTQ A;  1N48 A;  4C3J G;  5FLM G;  4KKU A;  5LP6 F;  4DUZ H;  5I9P A;  3K59 A;  1B9M A;  1STE A;  3GTL B;  1VAJ A;  3QWN A;  5IOD A;  3K5L A;  5C3W A;  3KF8 B;  3TQT A;  2F0T A;  3GO5 A;  2R7K A;  4C2M A;  4ED3 A;  3I2Z A;  3MFG A;  5M9O A;  4N9T A;  3JSN A;  4TSS A;  1QVC A;  4UCR A;  1JMC A;  2E2J B;  4R8N A;  4YR0 A;  3V6K A;  4TVA B;  5EPK A;  4DR4 Q;  2ZJP A;  5LMN Q;  3T1H H;  2LXK A;  4JI2 L;  5EKI A;  2D2C C;  1VMP A;  4POF A;  1M0T A;  1B33 N;  4A3M H;  2UXD L;  4O3R A;  3W2D A;  2JA8 G;  1A6X A;  1EWH A;  4Q43 A;  1N36 L;  2UUA Q;  4IUV A;  2K5Q A;  2XGQ A;  1L0X B;  3NBH A;  4NXN L;  1UNN C;  3G6J B;  2E2D C;  1UAP A;  1U4P A;  4GZY C;  4O4I F;  2W9A A;  4L6T B;  4EBD A;  4A3F H;  5CYU A;  2RDG A;  3KXY T;  2JA9 A;  4JI0 H;  3A8K E;  4U67 3;  3W1B A;  3PW5 A;  4L5S A;  3GTL H;  3A74 A;  1GGO A;  4O3S A;  3TP5 A;  2CCZ A;  3CKI B;  1ML0 D;  2F0K A;  4MV9 A;  5AJ3 Q;  5LMU L;  4MV4 A;  2C35 B;  3A7L A;  2L55 A;  3VPB A;  5CA1 F;  3PIP 3;  1BUV T;  4APV A;  4LF5 Q;  4O3O A;  2IHF A;  3I3C A;  3BJY A;  2K33 A;  1HR0 L;  3PIO 3;  4A3I B;  2E2J H;  1SYE A;  1JR0 D;  1KBL A;  1PRT C;  5EWE A;  2JQO A;  3K3P A;  1PXU A;  2EYM A;  1AN8 A;  4LF9 Q;  4IUN A;  1AN7 A;  4O2A F;  3HFZ B;  1FVI A;  5C3X A;  4F87 A;  1CHP D;  2PQA A;  3BAA A;  4AQY L;  5ELF A;  5K36 G;  1QNK A;  4JI8 L;  3I72 A;  2AQ4 A;  1SR3 A;  2A69 C;  1EOT A;  1EFI D;  3PUY A;  4DN4 M;  4A3L H;  4UFZ A;  1CI3 M;  1JWM D;  1SND A;  2RF4 A;  2AUK A;  3CCE A;  4BBS B;  1RJR A;  5KFM A;  4JBK A;  1IBM H;  2NVQ B;  4DR5 H;  2WAQ B;  3K58 A;  2P0A A;  4EFB A;  4ODG A;  2R93 B;  3Q22 A;  1FL0 A;  1BBW A;  3TS2 A;  4JI7 H;  5C0X G;  2YU9 A;  3DLL A;  2R86 A;  4EYH B;  1O75 A;  1A0I A;  3F2U A;  3OTO Q;  2NVX B;  2R87 A;  1QUQ B;  4LUZ A;  1LTT D;  4OWT B;  5IGF A;  1N34 H;  3HKZ G;  2O03 A;  3A8I E;  2SCU B;  2CW0 D;  3LML A;  5I47 A;  4A3I H;  3FPU B;  3PIP A;  2A6H C;  4IJL A;  1MHW C;  3EJI A;  1HRJ A;  4KHP H;  1RDP D;  3PIO A;  1S03 G;  4JI6 Q;  3WO1 A;  5EBC A;  1R4Q B;  2F4V L;  2AUJ D;  2Y0S E;  1QZH A;  1VF7 A;  2ZDQ A;  5KFA A;  1SMY D;  3FEW X;  1X56 A;  1D5M C;  1SE8 A;  4OHJ A;  2X69 A;  4H0L C;  3U4V A;  2FMA A;  4IZO A;  4PWQ A;  1KAA A;  3FPP A;  1PA6 A;  5BR8 Q;  4DR6 Q;  1MSH A;  4V19 0;  4ZK9 B;  2E75 C;  1F9R A;  5DGA A;  1MSG A;  2JK8 A;  4PZ8 A;  4M1U B;  1VQJ A;  2DIK A;  1RK6 A;  3OSN A;  5L1L A;  4BBS H;  3T1Y H;  2VB2 X;  4RCO A;  2Z4H A;  4U68 A;  3PO2 G;  4QW8 A;  2UXC H;  5KFS A;  1KNA A;  4QGU A;  1LTA D;  3IAY A;  2R93 H;  1GSO A;  1ENA A;  4RGM A;  4JI4 Q;  4M9U A;  3I4O A;  1XMO Q;  2WII B;  1LYL A;  4GNX B;  2PQE A;  4NXM Q;  1OWT A;  2R3Z A;  2AGO A;  5IT9 W;  3BAB A;  3HOX G;  2NVX H;  3RIZ A;  1ZKO A;  4J9S A;  4A3J H;  3VYS A;  3PW7 A;  2EY6 A;  4JYA H;  3U50 C;  4DV3 Q;  2KEN A;  2EYO A;  4N9P A;  4A3B G;  1OXX K;  4J9R A;  1QJO A;  1JOO A;  4GKJ L;  2MP1 A;  5A2Q L;  5DQI A;  4R7R A;  5CBE E;  4HJ8 A;  2YTV A;  4CKE A;  4DU9 A;  3R2T A;  2AQ3 B;  1K83 A;  1EYD A;  3DEO A;  4DV2 H;  2SDF A;  5KFJ A;  5JJK A;  3NEL A;  3NPP A;  2W9C B;  5BN5 A;  1RIP A;  3FKI G;  3GTK H;  3NTK A;  4JI5 Q;  2B63 H;  3C3L A;  3HKS A;  5E7N A;  3KAJ A;  3CD6 A;  2NU8 B;  5KG3 A;  2NN6 I;  5HY6 A;  4DR3 L;  4AIM A;  3TS0 A;  5FOB B;  1VQK A;  1NMG A;  3JAM c;  2NU6 B;  3M7N A;  3I12 A;  2RCF A;  5FLX L;  5LHY 1;  1UEB A;  2B8G A;  3HOV H;  4DR4 L;  4A93 B;  1T94 A;  5KG0 A;  3HOZ G;  2F0L A;  3BG5 A;  3F8N A;  1SDF A;  5C6A A;  1BGW A;  4B3S H;  4ZHQ F;  1RTO A;  3A55 A;  5DNF A;  4J9M A;  3OSP A;  1KLG D;  1S5C D;  4J9Q A;  2VL6 A;  4IN3 A;  1J5E H;  5A2Q W;  1Z2N X;  3R5X A;  5CV4 A;  3K3V A;  1BCP B;  3I8Z A;  1SYD A;  5C4X G;  2I87 A;  2UUA L;  3KAL A;  2UUC H;  3D4R A;  4RMF A;  1ILQ A;  4H02 A;  1EYA A;  3NEN A;  3ERO A;  4MV1 A;  1EY9 A;  4IQZ A;  2VOB A;  4KMU C;  4DKA C;  1SNM A;  4BS9 A;  1TQO A;  2A19 A;  1KDA A;  1S9F A;  2HVR A;  1IYV A;  4MTE A;  3QG1 A;  4RNM A;  2UVR A;  2E5L Q;  1KD1 C;  5M3F H;  1UNS A;  1XTD A;  4WJW A;  3CF5 A;  3KF6 B;  5FLX W;  3DEP A;  2DZD A;  1A3T A;  5LMN W;  2CVR A;  2KCM A;  1RJQ A;  3RUP A;  3AFP A;  3KLR A;  5KFP A;  3GTL A;  4Q8F A;  2Z6K A;  4LF5 L;  1I6H B;  3RJ0 A;  4WFN 3;  1TWH H;  4A93 H;  3CU7 A;  2HUG A;  5CV7 A;  4O2B F;  3J7A F;  3J7A K;  4YCU A;  2XSC A;  4GS3 A;  1VQC A;  1CK1 A;  1ZYR C;  3MEF A;  4LF9 L;  2ASL A;  3DUZ A;  2K1B A;  1SSO A;  2SNM A;  1Y8N B;  4Z9C B;  2F0I A;  3GV5 B;  2MGS A;  3S15 H;  1MI2 A;  3EA6 A;  3IKJ A;  2DY7 A;  1PTO B;  4B3T L;  1E4G T;  1I6U A;  2F3I A;  1E22 A;  1S4Z A;  1XNR Q;  1B44 D;  1HNW Q;  2WAC A;  5D1P A;  4J9K A;  2D0P A;  1IKM A;  3WOF A;  5IE8 A;  2NVY B;  4KTA A;  4FBU A;  3MWE A;  4KY5 A;  4O0A A;  5FPO A;  3SI8 A;  2JSO A;  2VPQ A;  1WJJ A;  4CJ1 B;  5KT4 A;  1TR5 A;  3TRE A;  3U4Z A;  1K8M A;  1B8A A;  3ONA B;  1SYF A;  4UP7 A;  4P71 A;  2W70 A;  3Q6S A;  1E1O A;  4CJ0 B;  2FLP A;  4EX5 A;  3L3O C;  4L5Q A;  5KT7 A;  3AYH B;  3MA2 B;  2F0D A;  1KC8 C;  4HN7 A;  2ZDG A;  4NXN H;  1BVS A;  3OPO A;  2JA6 H;  1I6H H;  2FLL A;  2EIF A;  4EEQ A;  3HOX B;  2EPB A;  2JXM B;  4B9X A;  1TS5 A;  3PR4 A;  2AU0 A;  1E2Z A;  1G2S A;  4GNX C;  4DV5 L;  4EBE A;  4A3B B;  2XWB B;  4KN7 C;  5LMU H;  4ECX A;  5BR8 L;  4DR6 L;  2CW8 A;  2OEO A;  1PFM A;  3PV0 A;  4IFD I;  4NB3 A;  4LFB H;  1PTO H;  1XXG A;  4DL7 A;  5M3M B;  4A3C G;  5M5Y B;  1EIG A;  1TKW B;  1K8A C;  2UUB L;  3M4O B;  3AB9 A;  1XMQ L;  5GAD C;  2ZXP A;  2NVY H;  1IW7 C;  3T5L A;  4H13 C;  3CCM A;  1JWU D;  1VQP A;  1PYW D;  2EYL A;  3FKI B;  4DAY B;  1DIK A;  4JI4 L;  4RGO S;  1X54 A;  2X0S A;  3FMC A;  1XMO L;  3R5H A;  2Z1C A;  4NXM L;  4YP3 A;  3KYH C;  1B04 A;  1DCZ A;  4MIU A;  4DR1 Q;  3CCV A;  2RDF A;  1BJT A;  1Y1V A;  4AQY H;  2R93 A;  4O3N A;  2VQF Q;  2NZH A;  4DV3 L;  1KTK A;  4LAA A;  4NKL A;  1WTV A;  3UFX B;  5DQG A;  3T5K A;  2FPP B;  1LUZ A;  3VR4 A;  3IFD A;  3V4S A;  1Z47 A;  5IOC A;  2PZT A;  3TIG A;  4KY6 A;  4RKB A;  1L2F A;  3CCS A;  2B3G A;  1Z9F A;  2I5M X;  2XVS A;  3IN5 A;  4XYL B;  2EYP A;  1N33 Q;  4ZRZ A;  1EZ1 A;  5C4X B;  2IJ0 A;  4ZI7 F;  1U4M A;  1HNX Q;  4A3B H;  5FD6 A;  2J9G A;  4YR3 A;  1AE3 A;  2K4K A;  3Q8D A;  4LF8 Q;  1BCP C;  4JI5 L;  3T5J A;  1O78 A;  1Q3L A;  5M3M H;  3H6M A;  4DV0 Q;  4OO1 G;  5M5Y H;  2UXB L;  3M4O H;  3G6X A;  4QQB X;  2YV5 A;  3UE0 A;  3GTK A;  2F0P A;  2B63 A;  1WTH A;  1CTM A;  1CE8 A;  1SYB A;  4ZCK A;  2F4V H;  1E7Z A;  4LFC Q;  5IY0 A;  2EYH A;  1DZ1 A;  1EY8 A;  2AKW B;  3Q2O A;  1L0Y B;  4PMB A;  1Y8P B;  1WTO A;  5F2D A;  2EOT A;  1T36 A;  4APM A;  3HP3 A;  2VNU D;  5C5M A;  2R6G A;  5CR3 A;  4MAM A;  3BZK A;  4GNX A;  2ICI A;  2W6Q A;  5FJ8 G;  3KDF A;  2Z9H A;  2RA4 A;  2FP4 B;  3KAK A;  2VY3 A;  1F9P A;  4RNN A;  5KT2 A;  3KHL A;  3VDY A;  4OX9 L;  5C4X H;  5DLQ E;  3C1E A;  2PCF B;  2E5L L;  2OTJ A;  4DUY Q;  1I4G A;  4J8Q A;  3GQB A;  1FGU A;  4KKT A;  1EU4 A;  5I4D A;  2HCC A;  4QWD A;  4Q5V A;  3TIN A;  3PW0 A;  2K75 A;  1JIH A;  3JC6 6;  1PTO C;  2DJF C;  1PH7 A;  5KFD A;  2W9C A;  2B2Y C;  4LF7 Q;  4X3T A;  4JK1 C;  1OXV A;  3HEJ A;  1P8L A;  4X65 L;  2DN8 A;  2R7D A;  4CDC C;  2JN4 A;  3R93 A;  3ULP A;  1PHJ A;  2DGY A;  4TV9 F;  4GLX A;  2B39 A;  1NSN S;  4OEM B;  5KG4 A;  3VPC A;  5KG5 A;  1TWH A;  2UU9 Q;  1PH5 A;  2AQ2 B;  4TUY F;  3HOW H;  2NWG A;  3HXL A;  4BWG B;  3I70 A;  2B2W A;  1ASZ A;  3I4L A;  1NCV A;  1M6V A;  2KUM A;  4BA2 I;  2PW5 A;  1XNR L;  2R92 B;  1HNW L;  1GUG A;  3HB9 A;  5G3L D;  1NBW A;  3MXN A;  2WAQ E;  4DR4 H;  1FJG Q;  3M9O B;  5LMN H;  4X64 L;  3RGZ A;  1E24 A;  1B2T A;  4ZQI A;  3PN1 A;  3JZI A;  3RF2 A;  4ED2 A;  3NBH B;  1S0N A;  1QVG A;  2HGS A;  4ECR A;  3BU2 A;  2NTT A;  2A73 B;  3HZX A;  1D7Q A;  1HZ9 A;  1AW7 A;  4ME3 A;  4LNQ A;  4R1J A;  2UUA H;  3I90 A;  5GQO A;  3KF6 A;  1C30 A;  4RUA A;  5IP7 H;  1Q82 C;  5KFB A;  2VZA A;  4PNY A;  4ECY A;  4Y7N B;  4IUP A;  4LF4 L;  5JEA J;  3TRZ A;  5KFF A;  2JA6 A;  5KRU A;  3D6C A;  1L2Z A;  3CPW A;  2F0M A;  4HJ9 A;  3J80 W;  1VQ5 A;  3R23 A;  5EWG A;  3BQ2 A;  3G71 A;  5KGU A;  4J9N A;  1K9M C;  1CA5 A;  2MJ8 A;  2PQA B;  2I0Q A;  3WNZ A;  4LF5 H;  2R92 H;  4JI2 Q;  3GV6 A;  2F0W A;  5KFL A;  3ORQ A;  1XPO A;  5C4Z A;  4LF9 H;  2IPK D;  5TSS A;  2UXD Q;  1QE6 A;  4IPD A;  1LTS D;  2ZM6 L;  4RZR A;  4LSX A;  2B2V A;  3RN2 A;  3ETJ A;  4B3M Q;  3CVZ A;  4MA5 A;  2EY1 A;  1GUN A;  2FJ2 A;  1ET9 A;  3MXG A;  2F52 A;  4YAJ B;  2VQF L;  4ED7 A;  5JJI A;  4EBC A;  2QDB A;  2HQL A;  1Z2P X;  2O4X A;  5DLG A;  1CKM A;  1B70 B;  2FE3 A;  4FF4 A;  4IUR A;  5E1F A;  3TBI B;  3OW7 A;  1DJR D;  1EIH A;  3TZU A;  3E6Z X;  1V51 A;  2AGQ A;  5ELO A;  4I55 F;  3BVM A;  2L15 A;  2CWP A;  1WD1 A;  3SGI A;  1N33 L;  1S97 A;  1HZA A;  3OTO H;  3KFU A;  3KBX A;  3RB4 A;  3HOY G;  2B2U C;  4LUO A;  1HR0 Q;  1FD7 D;  1TS3 A;  4J9O A;  1V8Q A;  2K01 A;  4X62 L;  2VW9 A;  5JOB A;  2W8K A;  5KFY A;  3G6Y A;  4IRC A;  4DV0 L;  4A3L G;  1PH9 A;  3S16 B;  4O4L F;  3CPF A;  2DJG C;  3CQZ B;  5IGB A;  1GHK A;  4AYB A;  4MTD A;  2YZG A;  4JI6 H;  1PRT D;  1XPU A;  3S2D B;  3Q0A A;  4LFC L;  4JI8 Q;  5CAE B;  4OXP A;  1DOL A;  1JQY D;  1GUO A;  3FHW A;  1L1O A;  4CKB A;  1JB7 A;  2H1E A;  4FF3 A;  1GVP A;  5BR8 H;  4DR6 H;  1LTI D;  5IWA L;  2GPW A;  1PVO A;  2EJG C;  2F0J A;  2L5T A;  4P75 A;  2R8H A;  2W6N A;  1EUJ A;  3J81 W;  3KJO A;  4LK1 C;  3PUX A;  3G48 A;  4DR7 Q;  5FO9 B;  4RU9 A;  3RD4 A;  2L1B A;  1JJG A;  4A3I G;  1GSA A;  1STB A;  2K5N A;  1GO3 E;  1VQA A;  1IYU A;  4JI4 H;  1CA6 A;  1HQR D;  1XMO H;  2F4I A;  4NXM H;  4HIM A;  2W6M A;  4MV7 A;  1X3F A;  3D8G A;  4IFD J;  2OTL A;  2EY2 A;  2R85 A;  4DV3 H;  1K83 B;  1A2U A;  1TY0 A;  1SYX B;  3D6W A;  2DPJ A;  1VQH A;  5T1G A;  2K04 A;  1B4O A;  2XNA C;  2A6E C;  3LX0 A;  2CWA A;  3CQZ H;  2A6H D;  4IPC A;  4BBS G;  5F9L A;  1CM9 A;  2J0T D;  1PYS B;  1WCM H;  2B2T C;  3M4I A;  2RDJ A;  2NYZ D;  5C3E H;  3S2D H;  3EBE A;  1Y1V G;  4CDF C;  2KQ3 A;  2R93 G;  5EJW A;  3V05 A;  3VYR A;  3IL8 A;  4CBV A;  2UU9 L;  4JI5 H;  3C1F A;  1KDB A;  2JEB I;  3TP6 A;  4A3J G;  1STH A;  5K5P A;  2F0H A;  1X32 A;  4ED0 A;  2ATL A;  1TXY A;  1T5E A;  1MKH A;  1W3S A;  1TWC B;  4G7O C;  1KJ9 A;  5KNB A;  1U0L A;  5KT5 A;  1FJG L;  4K5X A;  4QB4 A;  5KFG A;  4TQU S;  4PMW A;  3U58 A;  2UVV A;  1G91 A;  4J1M A;  1YBY A;  3S2H B;  4BY7 G;  3N41 B;  4C1N I;  1UE1 A;  5EAY A;  1CUK A;  4FO2 A;  1CFM A;  4F50 A;  5COR A;  1YHQ A;  1M7J A;  1IL8 A;  1K83 H;  4YCV A;  4GKJ Q;  2DNC A;  3KLS A;  2B63 G;  5H80 A;  3TP7 A;  4DNR B;  1F2Z A;  1I4P A;  3CC4 A;  1PFB A;  3M4Q A;  3NE5 B;  1B53 A;  2N3S A;  3FVQ A;  2FB9 A;  2ALY B;  2LKV A;  2IA6 A;  1Z7T A;  3HOV G;  2M2L A;  2CZG A;  2MHV A;  4QWC A;  2E5L H;  1S5E D;  2RHQ B;  3GV7 B;  1S0M A;  5JQW A;  4DR3 Q;  4YY3 Q;  5C5J A;  5IT9 E;  1BR9 A;  1U4R A;  5CA0 F;  5CV8 A;  2EY5 A;  5EGT A;  3NHH A;  2MCT A;  4B9W A;  4KLK A;  2HD3 A;  4Q44 A;  1TWC H;  2HDL A;  1WTP A;  3PUZ A;  1ESF A;  5KFC A;  3HOY B;  3TN2 A;  2M9V A;  1IBL Q;  1VQO A;  2R92 A;  4G3I A;  2MPM A;  2OH2 A;  3S2H H;  1J6Q A;  4UCS A;  3NEM A;  4KY7 A;  2F03 A;  3JRW A;  1VBG A;  1VQE A;  4QWB A;  4YQW A;  2B2T A;  3BG3 A;  5H1S E;  5M3F G;  4B3M L;  1G2T A;  4A3G H;  4DK1 A;  1DGS A;  4O2D A;  2YL2 A;  4O3P A;  3RB0 A;  4LH6 A;  1HNW H;  5DGB A;  4EFE A;  2DY8 A;  2I80 A;  1AP0 A;  3S1Q H;  2PI2 A;  2GN5 A;  4JI3 L;  4ZKB B;  4A93 G;  3R2I A;  1Q86 C;  2RDH A;  3F8T A;  3JAM i;  2PBZ A;  5KG7 A;  4ED6 A;  1IHZ A;  4G7H C;  3RLO A;  5KFO A;  2XGT A;  2WKC A;  1BOS A;  3WOE A;  2YYA A;  2A8V A;  1H95 A;  4GLV B;  3VYT A;  5A2Q E;  1YNX A;  2EJF C;  4H44 C;  5BN3 A;  1LV9 A;  2SOB A;  5C0X I;  2QDL A;  5FO7 B;  3HOY H;  5LL6 b;  2OF1 A;  5C8Y F;  1ZYR D;  2GVA A;  2BH2 A;  1S5F D;  3GIL A;  1O7L A;  1I6V C;  2A74 C;  1IBK Q;  4B3T Q;  1MIU A;  2F0V A;  1HA5 A;  1GKH A;  1HHV A;  1Y14 B;  4ZAI A;  3H3V I;  4GC6 A;  1V1P A;  4XIG S;  4DA2 A;  1Y1V B;  5FLX E;  4EQN A;  4XT1 B;  1BBU A;  1S40 A;  4DR7 L;  2JA6 G;  4Q8E A;  2JEA I;  5CGK A;  2L4N A;  4A75 A;  2BQ3 A;  2Q2T A;  1HR0 W;  2ES2 A;  5EZY F;  5JPN C;  1M8A A;  4A3J B;  1SEI A;  4DR1 H;  4OWX B;  4CDE C;  1U9R A;  3M4P A;  3RR5 A;  1CS0 A;  2C2D A;  2K32 A;  4LFA Q;  2FK2 A;  4H7B A;  2MNA A;  4FS1 A;  1S10 A;  1TS2 A;  2VQF H;  2IMW P;  3S1N B;  4DV6 L;  2XIG A;  4MA0 A;  3H91 A;  2VPS A;  4HNT A;  1I94 Q;  4CC6 A;  3K7U C;  1C0A A;  5M5W B;  3KHR A;  4BY7 B;  1DOM A;  1VBH A;  4DV5 Q;  1FGB D;  4OEL B;  4QIW A;  3HOU B;  1C9O A;  2V4Q A;  1N33 H;  4TKO B;  3GTK B;  4UP8 A;  4KV6 A;  2B63 B;  3CQZ A;  1R4P B;  1HNX H;  5AFW A;  1FYC A;  2FMC A;  1D5X C;  3A5U A;  3L9A X;  1WCM A;  2UUB Q;  1XMQ Q;  4LF8 H;  2I8C A;  4OWW B;  5JVD F;  3RZO B;  2PN1 A;  3FMA A;  4DV0 H;  2X6L A;  3HOV B;  1Y1V H;  4YBZ B;  5ELN A;  4TRD A;  1IW7 D;  4ZUJ A;  3K5I A;  1RD9 D;  2R7Z A;  4LFC H;  2E2H H;  2K14 A;  3UQ8 A;  4GC7 A;  3J7Y W;  4L5R C;  3KDF B;  1FR3 A;  2Z6K C;  4YWL A;  1WVL A;  2V5A A;  3G8C A;  1DV1 A;  4CJ2 C;  3IG0 A;  4ZYS A;  1X3P A;  5JVH 3;  1AFP A;  2PI2 E;  5DM7 3;  3S1N H;  2W6P A;  4IR9 A;  5JVL A;  1AUX A;  4FU0 A;  1U4L A;  1I4Q A;  4AYB G;  1DYQ A;  1KQS A;  5M3M G;  5M5W H;  1WD0 A;  4BY7 H;  1NR2 A;  1PLF A;  5KFV A;  3PR5 B;  1TWG H;  4YR2 A;  4PZ7 A;  4OGQ C;  1H9K A;  1J9O A;  2F3W A;  3VR2 A;  5M3F B;  1Q8K A;  3PF5 A;  1A3V A;  3HOU H;  3GTO B;  1ZQ7 A;  2ZJT A;  1JT8 A;  4QY7 A;  1PK8 A;  1KHI A;  4DUY H;  2Z4I A;  3ULJ A;  2UXB Q;  4UCU A;  1LT6 D;  2VQE Q;  4X66 L;  2ZTC A;  4PMC A;  4YY3 L;  3N43 B;  3RZO H;  2UVW A;  1BCP D;  4K14 A;  1W6K A;  2RQX A;  4LF6 Q;  5IYC H;  4LF7 H;  1TWH B;  1D2B A;  3C0F B;  2B8F A;  1SYG A;  1A62 A;  1QOH A;  3CHB D;  1HTL D;  2MFI A;  1IBL L;  3S15 B;  5JH7 F;  4JPB W;  4BXX G;  1TWC A;  2F3V A;  4RNO A;  3MXN B;  4HAE A;  2UU9 H;  2YZM A;  1H9J A;  2XC9 A;  5KFK A;  1I4H A;  1RYR A;  4IOC A;  2ZT9 C;  2HHH L;  1EU3 A;  1VQF A;  1KEE A;  4RAZ A;  5JUM A;  2DLN A;  4DAV A;  2OCE A;  1QIL A;  1PH1 A;  2I5L X;  3DM3 A;  4Q0F A;  1FJG H;  4F7X A;  4OX9 Q;  1EY5 A;  1SE4 A;  4DLK A;  4ME5 A;  1B7Y B;  2PNH A;  3GTO H;  4WOR A;  4IPH A;  3ERS X;  3RBD A;  4FF1 A;  4WJ3 M;  1UE6 A;  2PPB C;  2W9B A;  1C4Q A;  4RH6 A;  2XRS D;  2XTI A;  4KJN A;  3J7A V;  2GLT A;  1N32 L;  1UEA B;  2NN6 G;  2SEB D;  4G57 A;  4RHS A;  1ROD A;  2FK1 A;  2JA6 B;  3HOW G;  2NU7 B;  1C3O A;  2C28 A;  4QIW E;  2HJW A;  4X65 Q;  1PTO D;  4BY1 B;  4G4K A;  4DF7 A;  1JIC A;  3KTM A;  5ELB A;  3OUU A;  1QNU A;  4N8F A;  1O80 A;  2K50 A;  2F1M A;  3B6Y A;  2QIL A;  5T1I A;  4K5W A;  2FPI B;  3JRX A;  1VF5 C;  4MV3 A;  1HNZ L;  1IBK L;  3QJY A;  1WSC A;  3ND8 A;  1YEZ A;  2PNR C;  4IWY A;  4X64 Q;  4JI2 H;  1MZB A;  4GKK L;  3GTM B;  2Z8L A;  2JEG A;  4KD4 A;  2O5J C;  4YAK B;  2I5H A;  3A8J E;  5IP7 G;  1JDE A;  1EY7 A;  3P20 A;  4RA8 A;  1DV2 A;  3QO2 A;  3CCU A;  1Q90 A;  3DM1 A;  4QJF A;  2UXD H;  1DOK A;  1BQQ T;  2PO4 A;  5E4W C;  4IUU A;  5J22 A;  1F9Q A;  1KJQ A;  2MUY A;  1N36 H;  4B3M H;  3DHQ A;  2DUD A;  3R8B A;  3DMU A;  4LFA L;  5D8D A;  4U6P A;  2KHJ A;  4HSP A;  3UDX A;  2EZV A;  1ASY A;  3TDQ A;  3LWB A;  1C7Y A;  4BY1 H;  3ND9 A;  2FLN A;  2MO0 A;  1KXL A;  1I94 L;  1CQF A;  4K2L A;  1SE2 A;  4LF4 Q;  3ZYY X;  2R92 G;  2PZW A;  2W71 A;  1Z2O X;  4EGV A;  2XRQ D;  4ECT A;  3F1Z A;  3GD7 A;  4RGN A;  2LS0 1;  2GVB A;  3BQ0 A;  5KYI A;  2FKL A;  3TEH B;  4AYB B;  2V9W A;  4XQQ A;  1HR0 H;  1Q8I A;  1FKA H;  4RZQ A;  2J6T A;  1Q81 C;  3JAM L;  4DPG A;  1L1O B;  1NTG A;  1S5D D;  3GTM H;  3H20 A;  3E3X A;  2N8N A;  3GTP H;  5L1I A;  4MTK A;  4ULL A;  2R7F A;  2TMP A;  4DK0 A;  1JOK A;  2ZM6 Q;  3NP8 A;  1PX2 A;  4JI8 H;  4B3R Q;  1EUD B;  4NP5 A;  4K2K A;  3MFH A;  4YIJ A;  3V96 A;  2VUG A;  1IKL A;  4JV2 A;  4FP5 D;  3H15 A;  4OO1 I;  1UC8 A;  2E2H A;  4XYO A;  4YCW A;  5LXT F;  1TU2 B;  3J80 c;  1XYI A;  3K0Y A;  4PDB A;  1D1I A;  1VQ4 A;  2NZ1 D;  5C0X J;  4CHT B;  3J80 E;  1A3U A;  3RB6 A;  3I55 A;  4QCL A;  4DR7 H;  4EQP A;  1K28 A;  4V0B A;  2LMC B;  3VYU A;  4CKC A;  1LTG D;  2B2W C;  1SLJ A;  2DNE A;  2K5W A;  3CP0 A;  5J39 A;  1NJI C;  2PMZ A;  1Q1B A;  1CQV A;  4TQR A;  1SBB B;  1V43 A;  3JAM W;  4X62 Q;  2EYF A;  4A3D B;  1TWG A;  2K5V A;  2BQU A;  1JX4 A;  1SN8 A;  2VQE L;  1WH2 A;  1NUC A;  5CBA E;  3UDG A;  4HID A;  4LF6 L;  3I4N G; 
#chains in the Genus database with same CATH homology
 2L15 A;  1N36 L;  2UUA Q;  2CWP A;  4GOP A;  2K52 A;  3SGI A;  4DK3 C;  1N33 L;  4A3D G;  1AH9 A;  1HZA A;  4NXN L;  1N8R C;  3KFU A;  3UDF A;  5LMN L;  1VQG A;  3CW2 C;  3UE1 A;  2ATW A;  3HOY G;  4MZ9 A;  4LUO A;  1HR0 Q;  4A3F H;  1XJV A;  2ID0 A;  4X62 L;  2VW9 A;  5IWA Q;  2JA9 A;  4IPG A;  4DV0 L;  2WP8 J;  1SFO H;  1PH9 A;  4DV1 Q;  4A3L G;  3CPF A;  3W1B A;  4L5S A;  3GTL H;  3A74 A;  2CCZ A;  4JBW A;  4HJ7 A;  1CKN B;  4DV7 Q;  3CCQ A;  2KCT A;  1XPU A;  4LFC L;  4JI8 Q;  5AJ3 Q;  5LMU L;  3PO3 H;  2C35 B;  4OXP A;  4BXX H;  4APV A;  3IRB A;  4LF5 Q;  2IHF A;  4DUZ Q;  1HR0 L;  1JB7 A;  3FHW A;  1L1O A;  2E2J H;  2AWN A;  1GVP A;  3E9H A;  5IWA L;  2JA8 H;  1PH2 A;  1PVO A;  4P75 A;  2JQO A;  1WCM G;  1JJC B;  4DV1 L;  5C3E G;  3E9I A;  4LF9 Q;  1EUJ A;  4A3D H;  3HFZ B;  1FVI A;  5JEA G;  5IP9 G;  3M9B A;  3KJO A;  4P74 A;  3I4M G;  3PUX A;  3G48 A;  4DR7 Q;  2PQA A;  4DV7 L;  4AQY L;  4BA1 I;  4A3I G;  5K36 G;  4JI8 L;  1JJG A;  5GRO A;  5AJ3 L;  1SR3 A;  1N9W A;  2K5N A;  1GO3 E;  1VQA A;  3T1H Q;  3PUY A;  1BKB A;  4A3L H;  4DUZ L;  4HIM A;  2R7Z G;  1X3F A;  2RF4 A;  3CCE A;  4IJH A;  1KRS A;  4IFD J;  1CKO A;  2OTL A;  4JBK A;  4R4C A;  1X9N A;  1VQ8 A;  1VQH A;  1FL0 A;  2CQO A;  1BBW A;  1Q12 A;  3TS2 A;  5C0X G;  1RL2 A;  4JV5 Q;  3DLL A;  1R9T H;  1E3P A;  1A0I A;  1V9P A;  2CWA A;  3CQZ H;  4IPC A;  4BBS G;  3OTO Q;  4YWK A;  1QUQ B;  4A76 A;  1PYS B;  1WCM H;  4LUZ A;  4GOP C;  4OWT B;  5C3E H;  3J81 i;  3HKZ G;  3S2D H;  3EBE A;  1Y1V G;  3I7F A;  1Q1E A;  5IP9 H;  2R93 G;  2RCN A;  3I4M H;  2Z0S A;  4PG3 A;  1YZ6 A;  2ZJR A;  4DK6 C;  3K0X A;  4JI0 Q;  4GN4 B;  3PIP A;  4A3I H;  2UU9 L;  4IJL A;  2Q2H A;  2YTX A;  3UDI A;  3PIO A;  1E1T A;  4JI6 Q;  1QZG A;  2JEB I;  1A63 A;  5C44 G;  4A3J G;  4MNO A;  2F4V L;  1LM0 A;  1HJP A;  1QZH A;  2Y0S E;  2Y0S G;  3CMA A;  1TXY A;  1MKH A;  3D31 A;  1W3S A;  1X56 A;  3OTO L;  1SE8 A;  3U4V A;  1A8V A;  4A4I A;  1U0L A;  1FJG L;  4TQU S;  4PMW A;  3U58 A;  2OQ0 A;  1PA6 A;  2OQK A;  5BR8 Q;  4UY8 C;  4DR6 Q;  1YBY A;  1L1O C;  2LSS A;  4JI0 L;  2JK8 A;  4PZ8 A;  4BY7 G;  1VQJ A;  1UE1 A;  5EAY A;  4P72 A;  2NVT H;  4BBS H;  1CUK A;  4JI6 L;  3PO2 G;  1YHQ A;  1KAW A;  1K83 H;  4YCV A;  2HIV A;  4GKJ Q;  3WWV A;  4QGU A;  3BZC A;  2R93 H;  2B63 G;  4JI4 Q;  4K0K Q;  3I4O A;  1XMO Q;  3K80 C;  1LYL A;  4GNX B;  4L5T A;  4NXM Q;  3CC4 A;  3H3V H;  3M4Q A;  3HOX G;  4A3K G;  2N3S A;  1EQQ A;  2NVX H;  1IYJ B;  2OWO A;  4IOA A;  2ALY B;  4A3J H;  1YJW A;  1IBM Q;  4J15 A;  4DR5 Q;  4A3G G;  3AEV A;  3U50 C;  4DV3 Q;  1M90 C;  3HOV G;  2KEN A;  1VQN A;  2RHQ B;  2RHS B;  4JI7 Q;  4A3B G;  1OXX K;  3W1G A;  1GM5 A;  4YHH Q;  3F2B A;  4GKJ L;  4DR3 Q;  3ICE A;  4YY3 Q;  4Y52 H;  3K7A H;  4HJ8 A;  1PH8 A;  2YTV A;  1SRO A;  4B3R L;  1N34 Q;  1XPR A;  4KLK A;  1UE7 A;  1VQB A;  1TWC H;  3PO2 H;  3NEL A;  5JJK A;  3PUZ A;  1RIP A;  4C3H H;  1HH2 P;  1YIJ A;  4IFD G;  3FKI G;  3GTK H;  4JI5 Q;  1IBL Q;  4JI3 Q;  1VQO A;  2B63 H;  4KHP Q;  2VUM H;  3HKS A;  1QUQ A;  5GAE C;  5E7N A;  3H0G G;  4JI7 L;  1HZC A;  1J6Q A;  3CD6 A;  3NEM A;  3S2H H;  2NN6 I;  1K73 C;  5HY6 A;  3HOX H;  4AIM A;  4DR3 L;  1VQE A;  3TS0 A;  1NMG A;  3JAM c;  1VQK A;  3M7N A;  2ZTE A;  5H1S E;  5M3F G;  3RZD H;  1MJE A;  4B3M L;  5JJL A;  4A3G H;  1UEB A;  4FDB A;  1DGS A;  4O2D A;  3HOV H;  4DR4 L;  3HOZ G;  1AE2 A;  1I3Q H;  3S14 H;  3AFQ A;  3PCO B;  2E8G A;  1JJ2 A;  3S1Q H;  2PI2 A;  2GN5 A;  2VL6 A;  4JI3 L;  3T1Y Q;  2UXC Q;  2QGQ A;  3L7Z C;  1X65 A;  4A93 G;  1Q86 C;  3F8T A;  1OXT A;  3JAM i;  5C4X G;  2UUA L;  2D62 A;  5IYB G;  1VCI A;  4RMF A;  3PUW A;  1G6P A;  3KOJ A;  1YI2 A;  1EFW A;  2B29 A;  4H02 A;  3NEN A;  3FKI H;  3RLO A;  1EWI A;  2XGT A;  2A1A A;  4DKA C;  1NMF A;  1V1Q A;  2A8V A;  2A19 A;  4HJA A;  1H95 A;  4GLV B;  4JYA Q;  1YJN A;  2AMC B;  3I4N H;  1YNX A;  2E5L Q;  3OYY A;  1KD1 C;  2EXD A;  5M3F H;  3T1Y L;  1XTD A;  5C0X I;  3CF5 A;  2JA5 G;  3KF6 B;  2ASB A;  4ALP A;  3HOY H;  3HOZ H;  4RG1 A;  5LMN W;  4JI1 Q;  2KCM A;  2Q2U A;  1YHA A;  2JE6 I;  3ZJY C;  3AFP A;  1G29 1;  2Q2I A;  2GVA A;  2BH2 A;  1YVC A;  2Z6K A;  4LF5 L;  1IBK Q;  1EIY B;  1MIU A;  4DV2 Q;  4B3T Q;  3CC2 A;  3J81 c;  1GKH A;  1K8G A;  1VQI A;  3S17 H;  1Y14 B;  1TWH H;  4A93 H;  2K5H A;  1IL2 A;  2IY5 B;  3H3V I;  4YCU A;  4DV6 Q;  4GS3 A;  1VQC A;  4XIG S;  2MO1 A;  3MEF A;  4LF9 L;  1SRU A;  1BBU A;  1S40 A;  4DR7 L;  2VS1 A;  2E2I H;  3FP9 A;  3GTQ H;  2JA6 G;  2JEA I;  3S15 H;  1LTL A;  4A75 A;  4PZ6 A;  2Q2T A;  2IX0 A;  1HR0 W;  1TWA H;  3T1H L;  2ES2 A;  3ULL A;  4B3T L;  2F3I A;  1E22 A;  1XNR Q;  1X6O A;  1HNW Q;  4OWX B;  2D0P A;  1O7I A;  3M4P A;  3RR5 A;  1P16 A;  4LFA Q;  5IE8 A;  1PH6 A;  4B3S Q;  2MNA A;  4MTN A;  5HGQ A;  1UWV A;  1J5E Q;  2H5X A;  1IXR A;  4O0A A;  4DV6 L;  2WFW A;  2NZO A;  4LW1 A;  1WJJ A;  1I94 Q;  3K7U C;  4JV5 L;  1C0A A;  4R4O A;  3TRE A;  3U4Z A;  1B8A A;  2UUC Q;  2R7Z H;  4UP7 A;  4P71 A;  1E1O A;  4DV5 Q;  5GAG C;  4EX5 A;  1EOV A;  4L5Q A;  1C9O A;  3AYH B;  4YWM A;  2CFM A;  1VQ9 A;  1KC8 C;  1IZ6 A;  4UP8 A;  1YHB A;  2PMZ E;  3PSI A;  3RLF A;  1BVS A;  1YJ9 A;  1TWF H;  3A5U A;  1CKN A;  2JA6 H;  1J5E L;  1I6H H;  4JOI A;  2UUB Q;  2EIF A;  4HIK A;  2QA4 A;  1XMQ Q;  1JE5 A;  4OWW B;  1VQD A;  3HOU G;  3G6E A;  4R4T A;  2UUC L;  3M3Y H;  1Y1V H;  1VQ7 A;  1GD7 A;  5ELN A;  1WOC A;  4DV5 L;  4GNX C;  4XTC S;  2E2H H;  1U5K A;  1OXS C;  2K14 A;  5BR8 L;  4DR6 L;  4L5R C;  4POG A;  4DR2 Q;  3KDF B;  2Z6K C;  3PV0 A;  1X3E A;  4NB3 A;  5C44 H;  4IFD I;  4C2M H;  4YWL A;  3L0O A;  5IYC G;  2HT1 A;  2UUB L;  4A3C G;  1K8A C;  4DV4 Q;  4BBR G;  5GAD C;  1XMQ L;  4DNI A;  4DAM A;  4LWC A;  2NVY H;  4IO9 A;  1K3R A;  4GN5 A;  2PI2 E;  5IT9 c;  3J7Z C;  3CCM A;  3S1N H;  2EQS A;  1VQP A;  3PGZ A;  4X66 Q;  3PF4 A;  1NE3 A;  3A0J A;  4AYB G;  4AYB E;  4DAY B;  4JI4 L;  2N49 A;  1X54 A;  4K0K L;  1XMO L;  1KQS A;  5M3M G;  5M5W H;  4NXM L;  3CXC A;  3KYH C;  1XNQ Q;  4BY7 H;  4DR1 Q;  1TWG H;  3CCV A;  4PZ7 A;  4A3M G;  4R4Q A;  1WYD A;  3TQY A;  2JJQ A;  1Q8K A;  1I5F A;  3PF5 A;  2VQF Q;  4DR5 L;  1IBM L;  3HOU H;  2NZH A;  4DV3 L;  3S1M H;  2BA1 A;  4HIO A;  1JT8 A;  4QY7 A;  4JBM A;  1LUZ A;  1Q46 A;  3LGJ A;  4HJ5 A;  1KHI A;  3ULJ A;  1X55 A;  2UXB Q;  4YHH L;  5M5X H;  1Z47 A;  4A3F G;  2VQE Q;  1I50 H;  4X66 L;  4A3K H;  2ZTC A;  4YY3 L;  1NY4 A;  1OXU A;  1L2F A;  3RZO H;  3CCR A;  2B3G A;  1Z9F A;  3CCS A;  2I5M X;  2HHH Q;  4LF6 Q;  5IYC H;  4A3C H;  1N36 Q;  1N34 L;  3RLN A;  3G4S A;  4DR1 L;  1N33 Q;  4C3I H;  4NXN Q;  1HNX Q;  4A3B H;  3AQQ A;  1EQR A;  1A62 A;  1KRT A;  1AE3 A;  2K4K A;  1QVF A;  3Q8D A;  4LF8 Q;  5IYD G;  4NPS A;  2MFI A;  4JI5 L;  1IBL L;  3A5Z B;  4KHP L;  4BXX G;  4JC0 A;  4OO1 G;  5M3M H;  3MXN B;  4JOI C;  4DV0 Q;  2UXB L;  5M5Y H;  3E0E A;  3M4O H;  4UPA A;  4QQB X;  2YV5 A;  3UE0 A;  4AH6 A;  4Y7N H;  1VQM A;  4IOC A;  2HHH L;  1Y1W G;  1N32 Q;  1VQF A;  1E7Z A;  4LFC Q;  5LMU Q;  5IY0 A;  2AWO A;  3RNU A;  3I56 A;  4LFB Q;  1HNX L;  3H0G H;  2AKW B;  2OCE A;  1Q7Y C;  1PH1 A;  2I5L X;  3DM3 A;  3F2D A;  4OX9 Q;  1MJC A;  2KBN A;  4LF8 L;  4A3E G;  1B7Y B;  2VNU D;  2PNH A;  2R6G A;  3GTO H;  4UP9 A;  2UXC L;  4IPH A;  3BZK A;  3ERS X;  4GNX A;  4WJ3 M;  1S3O A;  1UE6 A;  5FJ8 G;  3KDF A;  3L2P A;  2XTI A;  2VY3 A;  1N32 L;  4AQY Q;  1M1K C;  4P73 A;  2NN6 G;  1HNZ Q;  5IYD H;  4KHZ A;  1PH3 A;  3HOW G;  3D0F A;  4LFB L;  4QIW E;  3OW2 A;  4X65 Q;  1CSQ A;  5FLX c;  4JYA L;  2CKZ B;  3VDY A;  1VQL A;  4OX9 L;  5C4X H;  5DLQ E;  2E5L L;  5IYB H;  4JBJ A;  4GKK Q;  2OTJ A;  4DUY Q;  2YU9 H;  3GTG H;  1Y1W H;  4QL5 A;  2VUM G;  2YTY A;  1FGU A;  2K50 A;  1EIF A;  3B6Y A;  1PH4 A;  1X3G A;  4JI1 L;  2K75 A;  3JC6 6;  1PH7 A;  3KLW A;  4BY1 G;  4LF7 Q;  1HNZ L;  5C4J H;  1IBK L;  1L0W A;  2IHE A;  4DV2 L;  4A3E H;  4GN3 B;  3ER0 A;  3RN5 A;  1OXV A;  4X65 L;  1P8L A;  1YEZ A;  2JA5 H;  2R7D A;  3STB D;  5FJ8 H;  4X64 Q;  1K0R A;  4GKK L;  3ULP A;  1PHJ A;  4DUY L;  1OTC A;  2DGY A;  4GLX A;  2IX1 A;  1CSP A;  2I5H A;  3CME A;  1UE5 A;  1PH5 A;  2UU9 Q;  1SMX A;  2BH8 A;  5IP7 G;  3M85 A;  1W2B A;  3HOW H;  4OON A;  3CCU A;  4QJF A;  3STB C;  1YIT A;  1ASZ A;  2F4V Q;  3S16 H;  1G51 A;  4LF7 L;  1KIX A;  2AHO B;  4BA2 I;  3J7A 5;  1XNR L;  1HNW L;  1HZB A;  1NBW A;  2DUD A;  3BJU A;  4B3S L;  2WAQ E;  2WAQ G;  4GLA C;  4LFA L;  3HKZ E;  1FJG Q;  1VQ6 A;  4X64 L;  1E24 A;  2KHJ A;  4JCV E;  3UDX A;  4GOP B;  1ASY A;  1KL9 A;  3S24 A;  1PFS A;  3NBH B;  1C7Y A;  4BY1 H;  2MO0 A;  1KXL A;  1QVG A;  1I94 L;  4LF4 Q;  3GDE A;  2R92 G;  3BU2 A;  1EYG A;  1D7Q A;  1HZ9 A;  4KI0 A;  4EQ5 A;  2V1C C;  4ME3 A;  4LNQ A;  3F1Z A;  2QEX A;  3GD7 A;  4R1J A;  4JG2 A;  2YYZ A;  3J81 j;  2GVB A;  5GQO A;  3TEH B;  3EN2 A;  3KF6 A;  5IP7 H;  2FXQ A;  4LUV A;  1Q82 C;  2VZA A;  2ZTD A;  3KJP A;  2JA7 G;  2ZJQ A;  2HIX A;  2KHI A;  1WFQ A;  1Q81 C;  2BA0 A;  5JEA J;  1T9H A;  5J3B A;  3W5O A;  4DPG A;  4LF4 L;  1L1O B;  1NTG A;  3TRZ A;  2WB1 G;  2WB1 E;  3GTM H;  3GTP H;  2N8N A;  1PV4 A;  2NVQ H;  3EIV A;  3CPW A;  2R7F A;  3F2C A;  4HJ9 A;  1PYB A;  2ZM6 Q;  2LXJ A;  1VQ5 A;  3CCJ A;  4X6A H;  1S72 A;  3G71 A;  4B3R Q;  5FLM G;  4DR2 L;  1K9M C;  2PQA B;  2I0Q A;  2R92 H;  4JI2 Q;  1VS0 A;  4DV4 L;  3H15 A;  4OO1 I;  1WI5 A;  4YCW A;  1XPO A;  3J80 c;  3KF8 B;  4WJ4 A;  3GO5 A;  1VQ4 A;  3I2Z A;  3CCL A;  5C0X J;  3GTJ H;  2UXD Q;  4R4I A;  1D8L A;  3PUV A;  3I55 A;  4IPD A;  2ZM6 L;  1QVC A;  2N78 A;  3RN2 A;  1XNQ L;  2JA7 H;  4B3M Q;  4BBR H;  1JMC A;  3K81 C;  1NJI C;  1SLJ A;  2D0O A;  3CP0 A;  4TVA B;  1Q1B A;  2ZJP A;  5LMN Q;  4DR4 Q;  2F52 A;  2LXK A;  2IT1 A;  2VQF L;  3CC7 A;  5JJI A;  1V43 A;  4JI2 L;  2MQH A;  4X62 Q;  2HQL A;  3S1R H;  3PO3 G;  3CAM A;  2K5V A;  3J80 i;  1CKM A;  3K8A A;  1B70 B;  1SN8 A;  4POF A;  5GAH C;  2VQE L;  4A3M H;  2UXD L;  4C3J H;  5FLM H;  3UDG A;  2JA8 G;  4HID A;  4LF6 L;  5ELO A;  3I4N G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...