4BY7G

Elongating rna polymerase ii-bye1 tld complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by7G01
4JI3L 4DR4Q 4A3DG 2MO0A 5FJ8H 2R92H 1W2BA 1XJVA 2GVBA 1WI5A 4UP7A 4JI8Q 2ASBA 4LW1A 4A3BH 2IX0A 1NBWA 4LFCQ 1JJCB 2LXKA 2VNUD 4Y52H 4JI5Q 4JG2A 3L2PA 4JI0Q 2ES2A 4O2DA 5C44H 2IX1A 5GAGC 1CKNB 3CC7A 1Q46A 4LUVA 2YTVA 1Y14B 4A3MG 5GQOA 1XMQQ 4KHPQ 5IYBG 1N9WA 1G6PA 1X65A 5IE8A 2PI2A 1VQJA 1X9NA 3ERSX 4R1JA 4IO9A 2UUAQ 3HKZE 4MNOA 1HZBA 2K14A 1RL2A 4JC0A 4DV1L 4GNXC 2CCZA 3I4MH 4LF8Q 1YIJA 4J15A 2UXDQ 4JI2Q 4IPCA 3J7ZC 2R93G 1PH3A 4A3IG 2UU9L 3CXCA 1SROA 3EIVA 2N8NA 3E0EA 4DV2L 4HJAA 3T1YQ 4WJ3M 2WFWA 2BA0A 3I7FA 2EIFA 4GOPA 4IJHA 4DR7L 1EYGA 2KENA 1OXVA 2Q2UA 4L5RC 1PVOA 4DV6Q 2MNAA 1I50H 4A3FH 1VQPA 1K9MC 3A0JA 3W1GA 4BY1G 2UUCL 4A3GG 4IFDI 1HZAA 1LYLA 1X56A 3GTMH 2WB1E 4IFDG 2FXQA 2VUMG 4JI6Q 1Q1EA 2PNHA 3KYHC 1OXTA 1JB7A 3H3VH 2E2JH 1N33L 2GVAA 1WFQA 1MJCA 3GTLH 1PA6A 4JV5L 2KHJA 4UP9A 4BA1I 1Q8KA 2R7ZG 3PUVA 1KQSA 1D8LA 4PZ6A 1D7QA 4DR3L 1LTLA 1HNZL 4JI3Q 4JBWA 1E1OA 2AHOB 3KOJA 4YCWA 2WAQG 5GADC 1DGSA 4A3EG 2JA6H 4LUZA 1BBUA 1EWIA 4P74A 3PUXA 3GO5A 5GROA 1N8RC 4BBSG 4A3LH 2YTYA 1I3QH 2L15A 4JI7L 1EQRA 1N34L 1PYSB 3J81i 1AH9A 1EOVA 3CCQA 1QZGA 4GOPC 1Q86C 2MO1A 3HKSA 3TS2A 1PV4A 3S2HH 2VW9A 4KI0A 1XPRA 1NE3A 2B63H 4DPGA 2JE6I 1Q82C 1JT8A 1Z47A 3PO3H 2R7FA 1HR0L 1AE3A 2KCTA 5FLXc 4LUOA 4OO1I 3KJOA 4A93H 2D62A 2I5HA 2E2HH 3HOYH 4OO1G 2ALYB 3HOXG 4BBRG 1MIUA 4DR4L 2CFMA 5ELNA 5LMUQ 4DV2Q 5H1SE 2NVTH 1PHJA 1GM5A 4JI8L 3HOWG 4IPDA 2E8GA 1VQOA 2HIVA 3ICEA 4BY7G 3S1QH 5JJKA 1Z9FA 5IT9c 3G4SA 1K8AC 2UUCQ 3S17H 4QIWE 3JAMi 1WOCA 2Y0SE 1FVIA 4DR6L 4HIDA 5IYDH 5M3MG 3F2CA 2K50A 4PG3A 1U0LA 4C3JH 1N33Q 2F52A 3S1NH 3NENA 1PYBA 4A3KG 4JV5Q 3A74A 4LFBQ 2JEBI 4OWTB 3M9BA 4DR3Q 3I4NH 2DUDA 1LUZA 1HNZQ 2D0PA 2NZHA 4P75A 5IP9G 3CCEA 4HJ8A 3CQZH 4NXNQ 3NEMA 3T1YL 1JMCA 1X3EA 1HJPA 3J80i 1Y1WG 1QVGA 2PQAB 3CC2A 5IYCH 4B3ML 3ZJYC 3RLNA 4KHZA 5IWAL 4JYAL 4LF4Q 1FGUA 3M4QA 3KJPA 1N34Q 1ASZA 2K52A 1GVPA 3K8AA 3UDXA 1W3SA 5M3FH 1H95A 4OWWB 1NJIC 2I0QA 4JI6L 5JJLA 4GNXB 5JJIA 1YNXA 2N78A 2ZTDA 1Q1BA 1B7YB 1SE8A 2HIXA 2N3SA 2N49A 2BH2A 2WP8J 1S72A 5FJ8G 1YJ9A 1HR0Q 2BA1A 4QY7A 5JEAJ 1KRSA 2R6GA 3UDIA 1O7IA 4UP8A 1MJEA 4A3BG 1I6HH 5IP7H 3S1RH 1QVCA 1YHQA 2I5MX 2KHIA 1VQ6A 3ULPA 4QQBX 4QGUA 1T9HA 2JA7H 2E2IH 2PI2E 5C44G 1PH6A 1IBKL 3SGIA 3L7ZC 1VQFA 4UY8C 1A0IA 4AYBE 5M5WH 3PO2H 1E24A 2HQLA 2AWOA 4X62L 1VQKA 3RNUA 2UXCQ 2KBNA 4ALPA 2JA8H 3I4MG 3E9HA 3FP9A 3J81j 4DR6Q 2YU9H 1QVFA 1KIXA 1HH2P 2Z6KC 1J6QA 4R4CA 3TS0A 1SN8A 1FJGQ 1E3PA 4POGA 4H02A 3CMAA 3KFUA 3U4ZA 2F3IA 1SFOH 2RF4A 4YHHL 5AJ3L 3FKIG 3CAMA 4OONA 2JA5H 4WJ4A 4UPAA 1CKOA 2OQKA 3NELA 1VQHA 3RN2A 4LF9L 4A3FG 5DLQE 5LMUL 1XPUA 4P71A 3PUWA 4HJ5A 3PIOA 4B3MQ 3BZCA 3TEHB 3HOUH 4GN4B 5IWAQ 3ER0A 3H3VI 4LNQA 3KDFA 4C3HH 4GOPB 1PH1A 3M85A 4DR5L 4MTNA 3RLOA 3CCUA 4DUYL 1NY4A 2MFIA 1KHIA 1X3GA 5IY0A 1BKBA 4A3CH 5EAYA 4OWXB 3AQQA 1VQ5A 3FHWA 1XNQL 3GTKH 1TWGH 3UE1A 2OWOA 1EIYB 2K5HA 3GTOH 1KXLA 4X6AH 2QEXA 1E7ZA 3EN2A 1N32L 4LFBL 4L5QA 4DV3L 1XNRL 3K0XA 1VQEA 4NXNL 5J3BA 4B3RQ 1K0RA 2RHQB 1KAWA 1TWHH 3HKZG 3PUZA 1WCMH 1IBKQ 4GKJL 1SR3A 4LF4L 4TQUS 3TREA 4B3TL 4X62Q 2B63G 4X66L 3PO3G 1TXYA 1SRUA 1X6OA 1Q81C 1Q12A 1YHBA 4A3GH 5C3EH 4A93G 1HNWQ 1L2FA 1UWVA 3HOYG 3CD6A 2UXBL 4LFAL 3STBC 3OW2A 1KC8C 5FLMH 4LF5Q 3HOVH 1WJJA 1WYDA 2ATWA 2OTJA 4DAYB 4R4IA 4YHHQ 3M4PA 5AJ3Q 2VS1A 4OX9L 1EIFA 4DR2Q 2WB1G 4GLXA 3J80c 1IBMQ 4LF9Q 2QGQA 1Y1VH 3RZDH 3AFQA 2IHEA 3M7NA 1QZHA 5IYDG 5LMNL 1A62A 2GN5A 1EUJA 4DR5Q 3LGJA 1J5EL 2NVXH 4DUYQ 2UXCL 3W1BA 5JEAG 2ZM6L 1C9OA 4JBMA 4BBSH 1QUQA 1YHAA 3CPFA 1L1OA 4A4IA 3PSIA 3I2ZA 2HT1A 3MEFA 1FJGL 1N36Q 1PH2A 3I4NG 3K7AH 3MXNB 1R9TH 2ZJPA 4NXML 1K8GA 4JCVE 4AH6A 4JYAQ 1XNQQ 3D0FA 2A1AA 1TWFH 4X65Q 3CCRA 4HIMA 5ELOA 5IYCG 3U50C 3DLLA 2NVYH 1PH4A 4LF7Q 1N32Q 1P8LA 1V1QA 3G48A 4DV3Q 4A3JH 1XNRQ 4K0KQ 1VQMA 2NVQH 4B3SL 4O0AA 1VS0A 4EQ5A 4GKJQ 3CCMA 5LMNW 2XTIA 3HOZH 2IT1A 3RR5A 4B3TQ 3J7A5 4X66Q 4HIOA 2YTXA 4DNIA 4OXPA 1VQGA 1VQ7A 4YCUA 5IP7G 3A5UA 2UXBQ 4LFAQ 2YV5A 3G6EA 2R92G 5M3MH 4BY7H 4KHPL 2JA7G 1L1OC 4POFA 4OX9Q 1KD1C 2Y0SG 5C4XH 1A63A 2UUBL 3Q8DA 3PO2G 1TWAH 1CUKA 2KCMA 1OXXK 4B3RL 1UE7A 3GTPH 1B70B 1KRTA 1YJNA 2JA8G 3GTQH 5LMNQ 1VQ8A 3K7UC 1PH8A 2LXJA 1P16A 1VQAA 4GKKL 5C0XI 3L0OA 3KF6A 1J5EQ 3S2DH 2R7DA 2EQSA 3GTJH 2A19A 2ZM6Q 2Q2IA 4GLVB 1ASYA 3CF5A 3GD7A 4BXXH 1HNWL 4RG1A 5HGQA 2JA5G 2F4VL 1S40A 4YY3L 1X3FA 3M4OH 2AMCB 1C0AA 4NXMQ 4LF5L 4QL5A 4R4QA 3RZOH 3GDEA 4L5TA 1XPOA 4XTCS 4DR2L 1IXRA 4GLAC 3CCSA 3HOUG 1IBML 4PZ8A 4X64L 4MZ9A 3AEVA 4IPGA 3RLFA 4LF6L 3OTOQ 3H0GH 4DV0Q 3OYYA 4B3SQ 3ULJA 3CCJA 4TVAB 1YZ6A 4L5SA 1B8AA 2DGYA 3J81c 4HIKA 3PF4A 3K81C 1EFWA 4A3DH 3A5ZB 1IL2A 4A3CG 3DM3A 1CKNA 4FDBA 1IZ6A 3HFZB 3KDFB 4DK3C 2VQEL 2E5LL 3CMEA 4NPSA 3AYHB 4DV7Q 4C2MH 1KL9A 2ZTEA 3F1ZA 1XTDA 1V43A 2K5VA 3S1MH 2WAQE 4P73A 2Q2TA 3T1HQ 5E7NA 1N36L 1CSPA 4AYBG 2OCEA 1I5FA 3TQYA 2A8VA 4JBJA 4A3MH 1E22A 2OQ0A 1NMFA 5IYBH 2JA6G 4YWMA 4X65L 5C0XJ 3CCLA 1PFSA 4LF7L 4GS3A 1WCMG 3PCOB 1IBLL 4JI1L 1LM0A 2UUBQ 1UE1A 4A3LG 2K75A 3U58A 4DV5L 4K0KL 2MQHA 2BH8A 3FKIH 2ZJRA 5BR8L 4A75A 2IY5B 1IYJB 2R93H 4YCVA 2VY3A 4DR1L 3E9IA 4EX5A 4A3IH 1UE5A 3JAMc 4IPHA 3S15H 1VQDA 1FL0A 5C3EG 3F2DA 1YITA 2K5NA 4JI4Q 4GKKQ 1JJGA 2VQFL 3BU2A 5FLMG 4IOCA 3HOVG 4DKAC 1GKHA 2VL6A 2K4KA 3RN5A 4BY1H 3PV0A 1XMOL 4DV4Q 2F4VQ 3STBD 4YY3Q 2VUMH 3KLWA 2Q2HA 1VQCA 2CKZB 4C3IH 1K73C 1Q7YC 1Y1VG 1OXUA 2HHHL 2OTLA 4BA2I 3CW2C 1A8VA 2IHFA 4X64Q 2R7ZH 1U5KA 3BZKA 4LWCA 4P72A 1YI2A 2PMZE 1X55A 4GN5A 4YWLA 2ZTCA 4LF6Q 1OXSC 4DAMA 1M90C 2CWAA 2NN6I 4A3EH 2V1CC 4R4OA 3ULLA 2NN6G 4AIMA 1JJ2A 3TRZA 2H5XA 1E1TA 2VQEQ 2E5LQ 2Z0SA 3JC66 4IOAA 3NBHB 1G291 2B29A 2RHSB 1I94L 2JJQA 4HJ7A 3U4VA 3GTGH 2CQOA 1V9PA 1QUQB 2RCNA 5M5XH 1L1OB 1VQIA 4DUZL 4JOIA 1S3OA 4R4TA 4DV1Q 4AQYL 1BBWA 4A3JG 3PGZA 1PH5A 3F8TA 3W5OA 1HNXL 5K36G 4IFDJ 5C4JH 1OTCA 4IJLA 2UU9Q 3K80C 2JA9A 4JI1Q 1IBLQ 3IRBA 3PUYA 4XIGS 5GAEC 3HOZG 4DV5Q 3M3YH 4HJ9A 4DR7Q 3OTOL 5BR8Q 4DV0L 2QA4A 1PH7A 3HOXH 2NZOA 3CP0A 5HY6A 2VZAA 4LFCL 4BBRH 5M3FG 4DR1Q 1EQQA 3H15A 1K3RA 4JI5L 3PF5A 4JI0L 1HZ9A 3HOWH 2VQFQ 2LSSA 3BJUA 2I5LX 2B3GA 1TWCH 1HZCA 3EBEA 4DV7L 1BVSA 4Y7NH 4RMFA 1XMQL 4JBKA 1UE6A 4DK6C 3UDGA 2ZJQA 3I56A 1NMGA 2JQOA 3D31A 1XMOQ 3T1HL 2AWNA 5C4XG 2UUAL 2XGTA 1PH9A 1K83H 2YYZA 3PIPA 2AKWB 1HR0W 4LF8L 2UXDL 3UDFA 4JI2L 4A76A 1AE2A 2HHHQ 1X54A 4PMWA 4QJFA 1MKHA 3F2BA 4ME3A 1M1KC 2EXDA 3B6YA 1L0WA 1YEZA 2C35B 1VQ9A 1GO3E 2PQAA 4A3KH 4JOIC 1VQNA 3WWVA 4NB3A 1GD7A 2Z6KA 3S16H 4PZ7A 4KLKA 1NTGA 5M5YH 3CCVA 1JE5A 5IP9H 4DV6L 4JI7Q 3UE0A 1CKMA 1UEBA 3G71A 1YJWA 1Y1WH 4JI4L 1VQLA 3AFPA 5GAHC 4BXXG 4GNXA 1G51A 1SMXA 3S24A 4APVA 1CSQA 2ID0A 3KF6B 5C0XG 4GN3B 3VDYA 1I94Q 1C7YA 3I55A 1RIPA 1VQ4A 2JEAI 3CC4A 3S14H 4DV4L 4DUZQ 3KF8B 1YVCA 4AQYQ 1HNXQ 2D0OA 1YBYA 2CWPA 2JK8A 1VCIA 4YWKA 1VQBA 3H0GG 3CPWA 1SLJA 3I4OA
chains in the Genus database with same CATH superfamily
3DF7A 4WORA 4A3DG 5IGFA 2MO0A 4NDXA 1XJVA 1E2ZA 3NTHA 5KT4A 1GUOA 4LW1A 1PYWD 4A3FB 2MHVA 3KLSX 4Y52H 2DWCA 4IUNA 1DV1A 5GAGC 4LSXA 1XMQQ 4LUVA 1A2TA 4A3MG 1Y14B 1CHPD 4X3SA 5GQOA 3Q6SA 5KFKA 4IO9A 1I4PA 3I4MH 2CW8A 4AYBA 4DV1L 2CCZA 3CRKC 4EYIB 4LF8Q 2UXDQ 2KVMA 5EKKA 5I2XA 3BG3A 4B08A 1BO0A 4A3IG 1PH3A 2UU9L 2JA6B 1BCPB 1SROA 2C5CA 2FK2A 5DG9A 4IRKA 2WFWA 2BA0A 3O13A 1EOTA 5DLGA 2EIFA 5LHY1 1J8IA 4LH6A 5C3WA 2KENA 5BPFA 4DV6Q 3QZ7A 1VQPA 3RBEA 2UUCL 1LYLA 2DY8A 2SOBA 5C3EB 4X65H 2WB1E 4LF7H 3PW0A 4JI6Q 1Q1EA 2PNHA 4C3IG 2P5ZX 2K5WA 1IL8A 3OSOA 4JUZA 4EFEA 3GILA 1XTCD 2EDGA 2BOSA 2WYOA 2W9BB 2R7ZA 2KHJA 4UP9A 3JAML 2ENBA 3SR1A 5D1PA 1S68A 3G7LA 2AHOB 5KFOA 1SYBA 1S03G 4ULLA 1WTOA 3S1QB 3DWPA 1RK6A 2NVXA 1T36A 3C46A 5CMDA 1O7LA 5GROA 4YAJB 5KT6A 5C1OA 2B2VA 2FKLA 1S4ZA 1N34L 5KFQA 5F2DA 1AH9A 3CCQA 1R9TA 1JWUD 3T5KA 4C3JB 5EGTA 1PV4A 3TIIA 4YJ2F 2B63H 3BAAA 1WTHA 4NW2A 2R8GA 4OO1I 1TS5A 4Q43A 1H9SB 5KFLA 5T1IA 2ALYB 3HOXG 1C3OA 4DL2A 2CFMA 5ELNA 1PHJA 1GM5A 1PFNA 3N40P 4BS9A 1XNQH 1VQOA 5KFDA 3KK7A 4BY7G 1STNA 1Z9FA 5DQHA 5IT9c 2EYOA 2UUCQ 4E6IA 3S17H 1JDEA 2K33A 4I4TF 2HUGA 3BVZA 5M3MG 5J39A 2K50A 4PG3A 3SDZA 4H0LC 1WTPA 5EZYF 4JV1A 4B9XA 1Z2OX 4DV0H 3NENA 3MR3A 5C4XB 3IAYA 1I6HB 3MR5A 3DEPA 4C5CA 3T5HA 4JI5H 5KIXA 1E4GT 3GTQH 4P75A 2A68D 3CCEA 4HJ8A 4HR7A 4RZQA 4DV7H 5ELFA 4KHPH 4QWBA 3RMHA 5IWAL 4LF4Q 2J9GA 1X3PA 3R2TA 4UCRA 2D9UA 3DUZA 3SXHA 4G4KA 3BZDB 4RUAA 3H91A 3KJPA 3RF2A 1N34Q 4FS1A 1LV9A 2YU9B 2KJXA 2I0QA 1BJTA 5JJLA 3M4OB 2ZTDA 2RGRA 1J9OA 2WP8J 5FJ8G 3X3MA 2KHSA 2BQUA 2BA1A 4KY6A 4QY7A 1KRSA 3NPPA 3SK4A 3UDIA 1O7IA 4A3BG 2V58A 5IP7H 3S1RH 3MFYA 4HEDA 2KHIA 2HQEA 5EBCA 4QGUA 1T9HA 2SCUB 3U9TA 2PI2E 1IBKL 1CZGA 3MFHA 3E0JA 4L6TB 1SNMA 1CFMA 4FNFA 2HQLA 2AWOA 1VQKA 1JICA 2G5DA 1DONA 1D6EC 2KBNA 5C6AA 2OH2A 3FP9A 2R87A 1ZQ7A 1KIXA 1HH2P 4HAEA 3K3PA 1WTQA 1E3PA 1F9QA 2VR1A 2R8KA 3VYTA 1B50A 4ZUJA 4AYBB 3J81L 3Q23A 4KN7C 4KY7A 2X0SA 3NELA 2B2TA 3N52A 5F9NA 3KALA 3QG1A 1QE6A 3HOUH 5IWAQ 5DM73 4LNQA 5KFAA 4C3HH 5KT5A 1B6SA 4MTNA 2W6QA 2B8FA 1F2ZA 4DUYL 3OPOA 4A3GB 3AB9A 2MFIA 4A3CH 1LT3D 2OXPA 4DR7H 1XNQL 5BR8H 1TWGH 3DXJC 1STBA 1EIYB 2OWOA 1KXLA 4ECXA 2IMWP 2K04A 2R7ZB 1SBBB 4L5QA 1EQVA 2YZMA 2CVRA 1BCPF 2ZDQA 1Z6HA 1D5MC 2DY7A 4NXNL 4KJOA 5IODA 1SSOA 5KFNA 3MFGA 4EEYA 5EKLA 2H4OA 1TWHH 3TQTA 1IBKQ 2ZXPA 2EYFA 1XDNA 2K28A 4O3NA 5CV9A 3TREA 4B3TL 4DK1A 3HZXA 5C5JA 2RQXA 1SRUA 4HTHA 1ILPA 1YHBA 4A93G 1R9TB 2IL8A 2XGQA 3HOYG 4J9LA 3A55A 3OW2A 3HOVH 4Z9CB 1U4RA 3ONAB 1KEEA 4IZ8A 4MV8A 2VS1A 4IZOA 3J80c 4J9KA 4FF3A 1JLLB 1TAEA 3HOZB 5LMNL 1A62A 3HOWB 1TWCA 1HR0H 1KDCA 4AQYH 2FK3A 3NBHA 1J5EL 2F0VA 4MHEA 4Y7NB 4DUYQ 4XX0B 1GSAA 4FYDA 1QUQA 2J4XA 1L0XB 1LTAD 1FJGL 5FD5A 4XZ3B 1PH2A 3TP5A 2ZJTA 3VR3A 4JCVE 1K8GA 3TP7A 2K5QA 1XNQQ 3PMFA 5CB4F 4IRCA 4JPBW 5KGUA 4X65Q 4A3KB 4LF7Q 5IYCG 4RCNA 1PH4A 3OWEB 1V1QA 3G48A 2R85A 1ICWA 4A3JH 3LWUA 1S9FA 4L8JA 2VA2A 4EVOA 4HR7B 4O0AA 1VS0A 2DZDA 4O2AF 2UUAH 2W9AA 1IOVA 1GHJA 4ZHQF 1QWYA 2F0MA 4B3TQ 4RKLA 1NR4A 4JI2H 4FU0A 4WFN3 4RWSC 1VQ7A 1CZWA 1RHPA 3P75A 2QDLA 2QYZA 3A5UA 4B3MH 2YV5A 2R92A 1GUTA 5M3MH 2B2YC 2BCOA 2JA7G 1L1OC 5KFHA 4POFA 3LX0A 2A68C 3DHQA 3PO2G 1ZYRD 1CUKA 2YRXA 4A3DB 3NTKA 3CHBD 2OLSA 5LMNQ 3AU7A 2LXJA 1EY4A 1J5EQ 4TV9F 4C2MB 3J7AK 2R8JA 2A19A 4GLVB 5A2QW 3PIO3 3PVXA 3CF5A 3GD7A 3FPUB 1HNWL 1W6KA 3URYA 1S40A 2F4VL 1ZETA 4MV7A 1F2MA 1X3FA 2I07B 1C0AA 4RB2C 2KUMA 4R4QA 3RZOH 4IUTA 4MN3A 4X62H 4DR2L 1FR3A 5KFZA 3C3LA 2DIKA 3CVZA 1K1QA 1HA6A 1B9NA 4QW9A 1HRJA 2QCPX 3AEVA 3GIJA 3RLFA 1H9KA 1STEA 1HTLD 4DV0Q 3ULJA 4TVAB 2DGYA 3A5ZB 5FD6A 1FNVA 1CKNA 3QZ8A 3G6XA 2E5LL 4NPSA 4DV7Q 2F0LA 3EROA 4B9WA 4M9UA 2ZTEA 3S1MH 2F0IA 4C3IB 1N36L 2YS6A 1CSPA 4KKUA 4YR0A 2W8KA 2OCEA 5I2YA 3IFDA 1E22A 4DR5H 2B2UA 2JA6G 4ZYSA 5C0XJ 1PFSA 1WCMA 2RBMA 4JI1L 3G6JB 1LM0A 3RIZA 2E75C 3HEJA 4K0KL 5KFVA 1I3QA 1GHKA 1HFNA 1SNOA 3E6ZX 2MQHA 2BH8A 2ZJRA 5BN5A 5BR8L 4EX5A 1UE5A 5C3EG 2EJGC 3A8JE 1TT2A 1JXLA 3S2HB 1KDBA 1E4FT 5I47A 4LFBH 1PRTB 3N43B 1XNRH 3RN5A 4BY1H 2R8IA 1PMRA 3H3VC 3FPPA 2F4VQ 3STBD 4GKJH 2Q2HA 1Y1VA 1SNQA 2R84A 4BA2I 4X66H 1PZKD 4K6LA 3BZKA 4LWCA 1JE4A 2VUGA 2WTFA 4OHJA 4TQSA 3MXGA 5DNFA 2PMZE 4GN5A 3HOXB 2ZTCA 3I3CA 3SVMA 1M90C 2F03A 4R4OA 1KDAA 3OSNA 1TWCB 4C3JG 1EY9A 2H5XA 2E5LQ 1GUGA 5FLXL 3M4IA 3NBHB 4OL7A 3R5XA 2RHSB 1I94L 1EUCB 2CQOA 3V05A 1QUQB 5M5XH 1BXRA 2NVYA 5D65A 4R4TA 4AQYL 1BBWA 1HNXL 3PGZA 5K36G 3W5OA 4IJLA 3BDLA 2DLNA 1DOLA 4JI1Q 5CBAE 2VPQA 3IRBA 4HCEA 1HCZA 3M3YH 1B1ZA 5M5YB 3ORRA 3HRZC 4DR7Q 4LSAA 3A56A 5BR8Q 3GV3A 1EYAA 3SK5A 2VZAA 1EQQA 1JIHA 2Z4HA 1BDOA 3I12A 5D1OA 3EBEA 3ICEA 1BVSA 4RMFA 1S5DD 4UAIA 3WDNA 4IUQA 4DK6C 3I56A 1XX8A 1V8QA 5C4XG 2UUAL 1DJRD 1SCUB 1A15A 1TWAA 1K83H 3PIPA 4C5AA 5JVDF 2FK1A 4RGTA 3UDFA 4JI2L 2JA7A 1RJTA 1SNPA 2F0NA 2R92B 1VQ9A 2PQAA 4JOIC 4O4HF 1KNAA 4NB3A 4ZQ3A 3SHLA 4A3BB 2EVBA 1DYQA 2Z6KA 3MXPA 3S16H 4U68A 3H6MA 4KLKA 2Q8TA 3K5LA 1VBGA 2MCTA 2FLNA 5IP9H 3MTSA 5KFXA 2G9DA 5EPJA 3SE0A 4BXXG 4JI4L 4A2BA 3BABA 4G3IA 2PVPA 1CSQA 1I94Q 2JEAI 3P7JA 4RU9A 2EJFC 2R3ZA 2YCHA 5LA6F 1SYGA 1IOWA 5IIFA 4F8MA 4AQYQ 1HNXQ 3LNNA 5KFGA 2CWPA 3VR6A 1IYJB 3H0GG 1TVXA 1ZYRC 2KECA 1W2BA 4LAAA 2GVBA 5CA0F 5FO8B 2IBKA 2W8LA 5CV8A 4ZKCB 2LXKA 5I6WA 4LF5H 1CA5A 4ME5A 2RGVA 4JG2A 4YHHH 3L2PA 2ES2A 3QB3A 1WR2A 4JV2A 1RCVD 1IBMH 1CKNB 2X6LA 1Q46A 3CC7A 2E2JB 1G6PA 3GTKA 3GTOA 4LF9H 2W6MA 4Q0FA 2UUAQ 2K14A 4GNXC 5CBEE 1SNDA 2XWJB 4J15A 4RGNA 4JI2Q 3J7ZC 2R93G 4H7BA 3CXCA 4WJ3M 2N8NA 4HJAA 1WCMB 2GPWA 3I7FA 4IJHA 1EYGA 1I3QB 1OXVA 4L5RC 2UVVA 4A3FH 3A0JA 3W1GA 4A3GG 4YAKB 3BQ2A 2NBFA 3P1HA 4IFDG 4L1KA 1SDFA 3M4YA 1N32H 5KT2A 3FDTA 1IBLH 3KYHC 1OXTA 3KHGA 2B8GA 2N55A 3DEOA 1WSCA 2GVAA 3MFIA 4WJWA 5IT9E 2R7ZG 4BA1I 3PUVA 5G3LF 3S9WA 1I4GA 2VPSA 4DR3L 1PTOB 1LTLA 1Y1VB 1HNZL 3T51B 3IKJA 3KOJA 2WAQG 1DGSA 1SEBD 2JA6H 5FO9B 5DGBA 1BBUA 1EWIA 1LT4D 5L9XA 2NVXB 5IGEA 3GTGA 3PUXA 1N8RC 3HGBA 1MSGA 4JI7L 5A2QE 2VA3A 2HHHH 2V59A 1PRTF 1Q86C 3HKSA 5DEHA 3IFTA 4KI0A 1XPRA 5JVH3 5CA1F 4DPGA 1JT8A 3I90A 3PO3H 2ASLA 2NVYB 3BJYA 3KJOA 5J2TF 1X32A 3SK6A 5KFCA 3ITPA 3JRXA 1I7LA 5FOBB 3VR2A 3HOWG 1ENAA 1R4PB 3MHBA 2HIVA 4DUZH 3S1QH 4ID6A 5DAUA 1ULZA 1FGBD 1K8AC 5KT7A 4MV6A 3TDQA 3Q2OA 4DR6L 5KNDA 5IYDH 4HIDA 3MXNA 5D1OB 1ZKOA 3F2CA 1JWSD 4C3JH 1U0LA 5JEAH 1XYIA 2F52A 4A3KG 1T3NA 3A74A 4LFCH 4YB8B 5HV6A 1TWAB 1I4QA 1C4QA 3DMUA 3OOCA 3I4NH 4DR3Q 4LFBQ 3OUUA 4JI0H 1HNZQ 5K36H 2D0PA 4MTKA 4RHSA 1OO9B 2JA7B 2NU8B 5KFIA 1MGSA 4K5WA 3NK9A 1X3EA 1HJPA 1EFID 5IGDA 1Y1WG 1QVGA 1L2ZA 2PQAB 3PO2B 3T1HH 3L4KA 1DCZA 1WD1A 2K52A 5JJZA 3SEBA 3UDXA 1W3SA 2R6FA 1NJIC 1IHZA 4JI6L 1CT1D 5JJIA 1YNXA 1BGWA 1Q1BA 2N3SA 2N49A 2BH2A 1S0MA 2QILA 1R4QB 2F4IA 1B3QA 5JEAJ 3MWDA 3U9OA 3PR5B 1F2LA 4ILWA 1I6HH 1VAJA 3H0GA 4EBCA 2RKSA 2EPBA 1QVCA 1YHQA 2PPBC 2I5MX 1VQ6A 5CAEB 4QQBX 1AN8A 5FO7B 2IP4A 3WO0A 2QF7A 3ND8A 2MP1A 2E2IH 5C44G 3SGIA 1VQFA 3M9OB 1A0IA 4AYBE 5M5WH 4DV4H 5EDWA 1E24A 4DNTB 1HTPA 3RNUA 1U9RA 1LTTD 4JI3H 3J81j 4DR6Q 2YU9H 2EYMA 2Z6KC 4R4CA 5E4XA 2YZGA 4X64H 3GTKB 4H02A 3GTOB 3KFUA 4UCSA 2W70A 4YHHL 5ELDA 4M1UB 4ME6A 3M9MB 4WJ4A 3CAMA 1EYZA 2R93A 4UPAA 3MWMA 2VQEH 4LF9L 1RTOA 2EY1A 4Q44A 3FVQA 3A8IE 3QWNA 5KG6A 2NWGA 4HJ5A 4R8UA 3RGZA 4HYKA 2R7NA 3CCUA 5COYA 3GQBA 2NYZD 3J80E 1NY4A 3C0FB 2QEJC 4F50A 1X3GA 2MJ8A 4TRDA 4YR2A 5EAYA 2SEBD 3D6CA 5E1FA 1VQ5A 1EZ8A 4PDBA 5KFWA 2IPKD 4O3SA 1N32L 3E5SA 4DV3L 2WAQA 1UEAB 5IOCA 2W7OA 2NU7B 4O4IF 1ZHSA 4YQWA 2RHQB 1KAWA 3HKZG 4LMYA 1N33H 2NU9B 1MSHA 4LF4L 4JV5H 3C2PA 4QWDA 3GTGB 4BBSB 2B63A 5J22A 2B2WA 1TXYA 2R7MA 5D8DA 4DL7A 2C2RA 1X6OA 4A3GH 3Q1KA 1UWVA 5KFUA 4PMBA 4IFDH 4LF5Q 1EYDA 2OTJA 4YHHQ 3M4PA 4OX9L 2WB1A 1EIFA 1PTOF 2O2LD 4F88A 4RNNA 3H4BA 3RB3A 1IBMQ 2F0OA 1A3TA 2RA4A 2SNSA 2NVQB 4LF9Q 3I8ZA 3M7NA 3V6KA 1QZHA 4ECTA 3FDSA 1I4HA 3MVVA 4DA2A 3C1EA 2ZM6L 1C9OA 2E2DC 1YHAA 2B2YA 4N8FA 3FMAA 1L1OA 4DR4H 1RD9D 1BR9A 3I2ZA 1JOOA 3MR6A 1EQTA 3MEFA 2NN6H 1KTKA 4XYLB 4JI8H 3MXNB 1R9TH 1VF5C 2WV6D 2L12A 4AH6A 3V2TA 2A1AA 3TBIB 5I4DA 1CS0A 1RJPA 5ELOA 3U50C 4FXDA 1N32Q 1P8LA 2OEOA 1GUSA 1B6RA 4DV3Q 5KRUA 3JRWA 4J9OA 2J6TA 1CQIB 5K2MA 2V4QA 1EEID 2FLPA 2C28A 1Y1WA 1PZJD 3W2DA 4DFAA 5AFWA 4IN3A 2N88A 4CDFC 4CJ0B 4GC6A 3N41B 3S2DB 1M8AA 3HOZH 4OELB 3RR5A 1KJQA 1D5ZC 2DPIA 4I7AA 4HIOA 1RYRA 2HJWA 4XDXA 4OXPA 3T1YH 3RGXA 2XIWA 1B4OA 5JAVA 2Z9HA 2R92G 1SE4A 4IAJA 1BF4A 4OX9Q 2Y0SG 4UDUC 5KG3A 4O42A 3Q8DA 3H0GB 3TMEA 4G7HC 2J7ZA 1U4PA 2V4RA 2JA8G 3BS1A 1O7ZA 2HDMA 4GKKL 3L0OA 1Z2NX 2EQSA 2F3VA 2ZM6Q 5M9OA 2LKVA 4C1NK 5KFTA 3I4MB 4O4LF 2IW3A 3KF8A 2AQ1B 3I72A 2V9WA 4RG1A 2JA5G 3IG0A 4U673 1II3A 4ODGA 4DAPA 3Q8QB 4OIKA 4FO2A 1O7YA 5LL6S 3T53B 1QJOA 2AUJD 5KFJA 5D3DA 3HB9A 4GLAC 4CHTB 1HQMC 4HMIA 3V4SA 3PW4A 1FNWA 4X64L 1I50A 2XCLA 2R93B 4IPGA 2XC9A 4MV3A 1S5CD 3S15B 1PDQA 4IHJF 1YZ6A 1B8AA 1SYFA 4RH6A 3J81c 4A3DH 3RAXA 1IL2A 2K32A 3EVQA 3DM3A 4R8UB 3HFZB 2AUKA 3M7GA 2VQEL 2W6NA 3AYHB 5GONF 4C2MH 3F1ZA 1I6VC 1XTDA 2VQDA 2K5VA 4A2AA 4P73A 1B9MA 2Q2TA 5LMUH 4DV2H 2BDOA 5E7NA 3T1HQ 4FM9A 4IURA 4Y8VB 2XNAC 5DLFA 3TQYA 2E76C 4JBJA 4A3MH 2OQ0A 2XGPA 1JX4A 4X65L 2I80A 4LF7L 3SK8A 1WCMG 2CH4W 2Z6BA 2K75A 2AQ4A 1TS3A 1LTSD 2FJZA 4KK7A 2YYAA 2WAQB 3HKZA 4YCVA 4A3IH 1FL0A 3BDCA 2K5NA 1ONLA 4GKKQ 1JJGA 5L1LA 5JPNC 5FLMG 2F0TA 4ED7A 2B63B 3ERQA 4DKAC 3FMCA 4QUCA 1B04A 2K4KA 2E2HA 4O3QA 4DV4Q 2CKZB 4C3IH 4GC7A 1Y1VG 1OXUA 3NBIA 4JVZA 3Q8PB 1S0NA 3CW2C 5JPMC 3MWYW 2WB1B 4RAZA 4X64Q 2K5DA 4XYOA 4I7HA 3PW5A 2EYJA 1SEIA 1YI2A 3V6JA 4J9MA 3I70A 2UXBH 1QOHA 3MC0B 4LFAH 3S17B 5C4ZA 4DAMA 1SYDA 2NN6I 4HN7A 5KNCA 2D2CC 4BWSC 5J1ZA 2VQEQ 1E1TA 3HXLA 2RCNA 4G7OC 3PR4A 2YW2A 1L1OB 3G6YA 4JOIA 1S3OA 1CA6A 2HDLA 2M05A 1PH5A 3F8TA 2IX3A 3CQZA 2B2WC 1VKZA 2K6AA 2HCIA 3K80C 2UXCH 2JA9A 4XIGS 3TSSA 1E2VA 1EU4A 4HJ9A 2VB3X 2D5DA 4DV0L 4FF4A 3HOXH 2NZOA 1Y1WB 3J7AV 4NXMH 4JI5L 1PLFA 1Z2PX 4J9NA 1BOSA 4DV7L 4BY7H 1TWCH 1HZCA 4KHPL 4CC5A 4WRDA 2ZJQA 3OMGA 2AWNA 4B3SH 1RK5A 5KFSA 4HQ6A 1ZXTA 1PH9A 1W96A 4JYAH 1AE2A 4QIWA 1X54A 4PMWA 1M1KC 3IL8A 4U7CA 5JUMA 2JP1A 3B6YA 2Y0SA 4ED6A 5IT9W 3WWVA 4ZQIA 1A3UA 5DG8A 1GD7A 2FB9A 2W71A 2KCNA 2PZUA 5M5YH 3CCVA 2BQ3A 4YJ3F 4NLGA 3UE0A 3R5FA 1CKMA 3G71A 5C44B 4GNXA 3KLRA 1SMXA 3S24A 4CBVA 1Q3LA 1CM9A 1C7YA 2K01A 1RIPA 2EJMA 1VQ4A 2FMCA 3TIGA 4ECSA 5JVG3 4B3RH 2KEEA 5ELCA 2JA5A 4F4XA 3KF8B 3X3NA 5CV4A 1HFGA 1YBYA 2JK8A 1HA5A 4YWKA 5DGAA 4DR4Q 4Q8FA 5FJ8H 2R92H 4EQOA 2L0CA 4O3PA 3NP8A 5IGCA 4UP7A 1WI5A 4RAUC 4JI8Q 3ZYYX 1BNZA 1B44D 2XRQD 3QIAA 1I50B 4A3BH 1NBWA 1JR0D 4JI5Q 1CQVA 4EGVA 4O2DA 2IX1A 2QKIC 1AUVA 4KHPQ 1I4RA 2YTVA 3K0YA 3QFFA 4PWQA 1TY0A 3VMMA 5IYBG 1N9WA 4KHVA 4FF1A 5LYJF 1X65A 1RJRA 4TUYF 3VPDA 1VQJA 1X9NA 3ERSX 4R1JA 3GV5B 2K7VA 4QW8A 1DM0B 4MA5A 4JC0A 2JN4A 1DIKA 4QWAA 1YIJA 1AN7A 4MTEA 1JOKA 2PYKA 2GLTA 1EY6A 3BYTB 3EIVA 2MGSA 3E0EA 4DV2L 3T1YQ 1NUCA 4DR7L 2RDHA 2Q2UA 1PVOA 2MNAA 5KG4A 4S3SA 5F9LA 3HKZB 1X56A 3IN5A 3GTMH 4XYMB 2FXQA 2VUMG 3MJFA 4J1MA 1EU3A 2M00A 4WBNF 1JB7A 2J0TD 3HOVB 4DV5H 4QF4A 2E2JH 2RCFA 1WFQA 1TS4A 3GTLH 1PA6A 4HSVA 4IR1A 4PQXA 2E2HB 2J6SA 1Q8KA 1KQSA 4FP5D 3J81W 1D7QA 3RAQA 2BDNA 3HBLA 2VQFH 3MZ5A 1GXDC 5ISRA 1JDBB 1PFMA 3A54A 1E1OA 3EA6A 4A3EG 5H80A 4O3RA 4LUZA 1TY2A 1XMOH 3GO5A 4BBSG 3KUPA 1GSHA 2YTYA 1I3QH 2XN9C 3J81i 2RDFA 3E3XA 1EOVA 4ZUIA 3K5NA 1CE8A 2R7LA 2ICIA 4GOPC 1QZGA 2W6ZA 1GUWA 5KG7A 5D14A 4TKOB 4Q45A 3KAKA 1TWFA 3S1NB 2FLLA 1Q82C 1Z47A 1B2TA 4MAMA 3R23A 2R7FA 1HR0L 2XIGA 5FLXc 1SNCA 4A93H 2L55A 2I5HA 1T5EA 4A3JB 3WNZA 1UAPA 3CQZB 3HOYH 4IALA 4OO1G 4YIJA 4BBRG 1MIUA 1PTOH 4DV2Q 2BR0A 5LMUQ 5H1SE 2NVTH 3VR4A 5I6YA 1PK8A 2E8GA 4R8NA 3D8GA 1I4XA 2JXMB 5JJKA 1E4EA 3TINA 3VYSA 3G4SA 2C2DA 5M3FB 3NGDA 2GA4B 1D1KA 4DGZA 4ED0A 2F0WA 2HGSA 1WOCA 5CORA 2PZWA 5IGGA 5FK9C 2PMZA 3J80W 1XWEA 2Q8RE 4ETSA 2CW0D 3OTOH 3GIMA 1DD2A 4DL3A 1PYBA 4K5VA 4CKEA 5KFBA 1KC7A 5KG1A 1UUPA 3GTPA 2JEBI 2R8HA 2DUDA 3R2IA 1IW7D 1EZ6A 2NZHA 5JOBA 5JVLA 4QIWB 1XMQH 3KBXA 4MV1A 2XSCA 2Y0SB 3J80i 3I91A 4IWYA 4P2CB 3CC2A 5IYCH 3BDOA 2F1MA 4B3ML 3RLNA 2A6HD 3EFXD 4X3UA 3RUZA 4JYAL 3GTJA 1WTRA 2PW5A 1ML0D 3M4QA 4LF8H 2UXDH 2JA8B 5JH7F 3K8AA 4QUFA 4OWWB 3QR8A 4GNXB 2IA6A 1MI2A 2OF1A 1AEXA 2N78A 4HNTA 2HIXA 1N56A 1S72A 1YJ9A 4MTDA 2EE1A 1HR0Q 4DV6H 1S0OA 2JA5B 2R82A 1IKMA 4UP8A 1MJEA 3T4AC 3SE7A 3K6OA 4NKLA 2JA7H 2RDGA 2LS01 3L7ZC 4UY8C 4TQRA 3PO2H 2RSOA 5EJWA 1QNUA 3F2UA 4X62L 4DAVA 2UXCQ 3S1MB 3MXUA 4ALPA 3I4MG 1RJQA 1J6QA 4DF7A 1SN8A 2DN8A 1NSNS 1ET9A 1SXTA 4LF6H 3W3AA 2F3IA 3D4RA 1SFOH 2RF4A 2Z1CA 1D5XC 3FKIA 4RFBA 2F0GA 2OQKA 3MWEA 3RN2A 1VQHA 5DLQE 5JQWA 2JEIA 3PUWA 3VPCA 2NB0A 4B3MQ 3TEHB 4GN4B 4JYAQ 5LXTF 1RDPD 2F0SA 4MIUA 3M85A 4DR5L 5KYIA 1STYA 3PQIA 4HNVA 5EWGA 4DV1H 3MA2B 4DK0A 4BY1B 3CU7A 5EOYA 2UU9H 1KHIA 3GLKA 4H44C 2VUMA 3D4DA 2JYOA 3T56B 4OWXB 3AQQA 4G57A 4MV4A 3GTKH 2W9CA 3UE1A 1YNJD 2K5HA 3GTOH 4DR1H 1E0BA 1E7ZA 2FE3A 4LFBL 3H09A 3KLSA 1XNRL 3D3RA 3GIDA 3RZDB 5J3BA 3GV7B 4B3RQ 1K0RA 1V4YA 3PUZA 4M8AA 4GKJL 4RGOS 2AQ3B 2OT2A 2ZDGA 5KT3A 1BCPD 4TQUS 3GQCA 5KFPA 3F8NA 2R61A 4X62Q 2B63G 2UVUA 4X66L 3MR2A 4ED1A 5I9PA 2YS7A 5M5XB 1SE2A 5KKNB 1CTMA 1Q12A 4I50F 2G9HD 3GV6A 2VOBA 3K7AB 5C3EH 2ATLA 1L2FA 5IGBA 3NWSA 2Q8IB 3PZPA 1QB5D 3K5HA 3STBC 4RB3C 1TWFB 1WJJA 2EZVA 2LFNA 2ATWA 1GYFA 4R4IA 2XWBB 2C00A 2WB1G 4XXEA 4GLXA 4ZOLF 1EUDB 1Y8NB 3L9AX 3Q8SB 2CQYA 1Q8IA 1Y8PB 1S5FD 1EZ1A 4LH7A 1NR2A 1YNND 2GN5A 1EUJA 4DR5Q 1K0SA 1JB3A 4UCTA 1GOZA 3LGJA 4DXGA 4O1NA 3K59A 1E4EB 1VDZA 2B39A 4JBMA 4BBSH 1A9XA 2QW7A 3CPFA 2FPGB 2QK4A 3PSIA 3VYUA 2HT1A 1LTBD 1TR5A 4J8QA 3NQIA 2BE5D 2PMZB 4OEMB 1HQRD 3NQTA 5DG7A 2DPJA 4OGQC 4ZK9B 3CCRA 4HIMA 4O3OA 3DLLA 3NUCA 1S5BD 1XNRQ 3S16B 3GTPB 2O5JC 1ICFB 5CV5A 2F0PA 2NVQH 4N9PA 3RUPA 1KAAA 2WDTA 4EQ5A 4ZRZA 5K5PA 4ZI7F 4GKJQ 3CCMA 4DL4A 5C5MA 3GTJB 4CC6A 3J7A5 4X66Q 3FRPB 5EPKA 4DNIA 5KFFA 1RKNA 2FPIB 2CW0C 5CV7A 4YCUA 5IP7G 3RB6A 3J81E 5DQIA 1O75A 5A35A 5DM63 1JKJB 5IWAH 2EY5A 1UNSA 2E2IA 1KD1C 5C4XH 1A63A 2L5TA 4IUUA 4Q5VA 3SI8A 2A6HC 1YJNA 2PO4A 5HURA 1DZ1A 3GIKA 5CYUA 2I8CA 1VQAA 4FF2A 2A6ED 3S2DH 1VMCA 4PV1C 2R7DA 2UVWA 2IWHA 1ASYA 2EY6A 3V96A 3CRLC 4BXXH 3EPIA 4HMJA 1K8OA 3D4WA 1JWMD 2XD4A 2KSWA 3M4OH 2AMCB 1IBKH 4LF5L 1V51A 2HVQA 4QL5A 4XTCS 4JV0A 1VF7A 2ZXOA 3HOUG 3CCSA 1IBML 1AZPA 4C3HG 3FKIB 4DXFA 4MZ9A 5C3XA 4LF6L 1F77A 3H0GH 3H94A 3OTOQ 5L1IA 3OYYA 3Q0AA 4L5SA 3PF4A 1A3VA 1W93A 4RUCA 3K81C 3GIQA 5KYLA 4A3CG 4LJZC 3ETHA 1D1IA 4DK3C 3NXWA 1BXTA 1KL9A 2EXZA 4DU9A 2WAQE 5E4WC 4DNRB 2VUMB 3TZUA 1CQJB 1TU2B 3H40A 2FINB 4N8X1 2W9CB 4DUYH 3V4ZA 3PCOB 1IBLL 1RYSA 1STAA 1UE1A 3L3OC 4A3LG 2PN1A 2XVSA 4ZAIA 3BQ1A 1N48A 4K8JA 2IY5B 4A75A 3LMLA 4A3EB 2R93H 4KTAA 2BQRA 4DR1L 3E9IA 1JOQA 3JAMc 3S15H 1EIHA 1ILQA 1VQDA 2O03A 3E5NA 3F2DA 3LWEA 4Q0YA 1K3BC 3BQ0A 2FPPB 2W57A 3BU2A 3WOEA 3HOVG 3PO3B 1WD0A 2VL6A 4L63B 4NXNH 4H13C 3R3OA 3PV0A 1MD2D 3R8BA 4ABNA 4CDCC 1YNJC 1KJJA 1Q7YC 5C4JB 3U9SA 2A73B 1LLRD 1IYUA 2HHHL 4QCLA 2TMPA 4B3TH 4RB0A 2JSOA 3PW7A 2ICEC 2IHFA 2R7ZH 1KJ8A 1KNEA 2TSSA 3QOJA 4P72A 4EQPA 4YWLA 4LF6Q 4EGJA 4BBRB 1BCPC 4EEQA 2NTTA 4ECVA 2V1CC 2W7PA 2IJ0A 4AIMA 3MAQA 5KFYA 3TRZA 2Z0SA 3JC66 2RDIA 1LO5D 3U4VA 2DNCA 1JCKB 4DUZL 3GTQA 4DV1Q 4A3JG 1PXUA 3I4NB 2RDJA 5LMNH 4UCOA 3N6RA 4IFDJ 3RV3A 2AGOA 1OTCA 1J5EH 2UU9Q 2JEJA 5IT9L 1TKWB 1IBLQ 4IR9A 1B53A 3NSWA 5EBDA 2Z8LA 1YNNC 3EQLC 4HSPA 3TN2A 1FJGH 1G6ZA 1SJHD 2A74C 1NCVA 2QA4A 5M3FG 3CP0A 4LFCL 4DR1Q 5LL6b 3OUZA 1K3RA 3PF5A 4JI0L 1HZ9A 3HOWH 2LSSA 2I5LX 2B3GA 4JBKA 5A2QL 3S14B 4Y7NH 2I87A 1UE6A 3UDGA 4RB1A 2BE5C 2PW7A 3T1HL 5KG2A 4R8IA 3RJ0A 4ECYA 4A76A 4J0MA 2HHHQ 4DN4M 3JZIA 1JC7A 4QJFA 4ME3A 2EXDA 4N9TA 1L0WA 1YEZA 2AGPA 2C35B 2E2IB 1GO3E 1H9MA 2F0EA 5FKAC 4A3KH 2WINB 1VQNA 3KHHA 5M5WB 4EQNA 3HG9A 3EJIA 1F9SA 4RNMA 2F0UA 1UC8A 2PQEA 1Y1WH 3AFPA 5GAHC 4V190 4YP3A 1G51A 3BA8A 4EYHB 5C0XG 2ID0A 5KG5A 4EGQA 1SE3A 4QB4A 2YZNA 2KEDA 1V1PA 2MPMA 4DUZQ 4DV4L 1YVCA 1F2YA 1VCIA 2ASBA 5C8YF 4CKBA 3CPWA 1UC9A 1VQLA 4JI3L 1LTID 3EYYA 3R5HA 3J7YW 3M9NB 2QDBA 1KJIA 4I65A 3K58A 1HNWH 1EEFD 2IX0A 2F4VH 4C2MA 2LMCB 3TP8A 4LFCQ 1JJCB 2A6EC 3QO2A 2VNUD 3H20A 4LMQD 4JI0Q 4ECRA 4ZLTF 5C44H 4DR2H 2HCCA 1SYXB 4KKTA 1TWGA 1W6JA 5IE8A 4CKCA 2PI2A 4KV6A 3HKZE 4MNOA 1HZBA 1AUXA 1RL2A 2R7KA 5LP6F 4WD3A 1KLGD 4KJNA 4IPCA 4CJ2C 1TWHA 2E5LH 3QOLA 1HXYD 1C48A 2FHTA 5ELBA 4GOPA 4PNYA 5EWEA 2PNRC 1N36H 2MUYA 5FLXE 1I50H 2R86A 1K9MC 1LACA 2KOLA 1B3AA 4BY1G 4IFDI 1HZAA 4KN4C 4DL5A 4JI1H 2K03A 3KAJA 3H3VH 4K0KH 1S5ED 3T5JA 1N33L 1EY0A 3T16A 1MJCA 2KA7A 2NUCA 4QWEA 2F0DA 4JV5L 4EBDA 1U4LA 1D8LA 5E3FA 4PZ6A 1XXGA 2JEGA 3R93A 4JI3Q 1A2UA 4JBWA 2O4XA 1PX2A 2KQ3A 4YCWA 3TZDA 5GADC 4FXGC 1EY8A 5G3LD 4P74A 2FMAA 1V1OA 4RAYA 4A3LH 4YBZB 2X6GA 2L15A 3OMCA 1DOKA 1EQRA 2L1BA 1PYSB 1O80A 3Q22A 2MO1A 4V0BA 1ENCA 3TS2A 3S2HH 3J80L 2VW9A 1ZEQX 3OSPA 4HNUA 3TQ1A 1NE3A 3KXYT 2JE6I 4DAYA 3MEHA 1PRTD 1AE3A 2KCTA 4RNOA 4LUOA 3DM1A 3GTQB 2D62A 5DQGA 4OIJA 2E2HH 3JAMW 5L1JA 2FP4B 3JSLA 1HHVA 4DR4L 3C1FA 3OIQA 3N8DA 1I94H 4JI8L 4IPDA 1VMPA 3BYYB 1RODA 1MHWC 3PN1A 1HNXH 1TQOA 3I4LA 2F3WA 1M0TA 1ET6A 4QIWE 3JAMi 2W6PA 5T14A 1QILA 4IWXA 2UVRA 1CI3M 2Y0SE 1FVIA 2F0FA 1WH2A 1IKLA 2WKCA 4KD3A 1M0WA 5LL6X 4FBUA 1LT6D 5FPRA 2B2VC 4C1NI 1N33Q 1QNKA 3RB0A 2PCFB 3RB4A 1Y8OB 1K28A 3S1NH 4JV5Q 3S1RB 2H1EA 4QMGA 3N6XA 4OWTB 3M9BA 1LUZA 5C4HA 3OHAA 5IP9G 4U6PA 4NXNQ 3CQZH 3N44B 2EYPA 3NEMA 3T1YL 1JMCA 3KHRA 5EPLA 2ZT9C 4PMCA 3ZJYC 1C30A 4KHZA 2Z4IA 1FGUA 1QG7A 2CQAA 3K57A 1H9JA 1ASZA 2ZXRA 1GVPA 4IUPA 1HPCA 5M3FH 1H95A 3Q24A 3VA7A 3OW7A 3A8KE 2UUBH 2RSNA 4BWGB 1B7YB 1SE8A 1EWCA 1V1PB 1LABA 2O5IC 2ASJA 2R6GA 4JI4H 4APMA 2WIIB 1G91A 5TSSA 3ULPA 5KX5F 3RBDA 3HOUB 2FMMA 4ED2A 4C3HB 1PH6A 4DLKA 4YY3H 3N42B 4YR3A 1TS2A 4ED3A 2JA8H 2CW7A 3E9HA 1QVFA 1STGA 2WKDA 3VA5A 3TS0A 4I55F 1FJGQ 1LT5D 1NAPA 2CZGA 4R9WA 1GUNA 4A3MB 4POGA 1AW7A 1TWGB 3CMAA 1AFPA 3K3VA 3L4JA 5C0XH 3U4ZA 4J9PA 2J6UA 3TP6A 5L37A 2XRSD 4IQZA 5AJ3L 2PBZA 3FKIG 4OONA 4RCOA 2JA5H 2K1BA 4UFZA 1DXMA 1CKOA 2DJGC 4A3FG 1KLUD 1TWHB 2X69A 5LMUL 4A3IB 1XPUA 3GIIA 1UNNC 4P71A 3GTMA 2W6OA 3PIOA 2HD3A 3BZCA 3FEWX 4GZYC 4HCSA 3H3VI 3OWFA 3ER0A 4F4YA 2AGQA 3KDFA 4GOPB 1PH1A 1C8CA 4X3KA 3RLOA 1AP0A 4Q8EA 5LOVF 3GTLA 4JK1C 2ALZA 1HUMA 5IY0A 4F87A 1BKBA 5KNBA 1I7NA 1SYCA 1PFBA 3FHWA 2C22A 4IUVA 4X6AH 2QEXA 3EN2A 4DL6A 1WTWA 4TV8F 1CHQD 1X3QA 3K0XA 1VQEA 4O2BF 1ZHQA 5KFRA 1JORA 1F9RA 4CDEC 1D2BA 1MZBA 3DWAA 4M7EA 1WCMH 1SR3A 3GIPA 4FBTA 3A7LA 2XCAA 4XQQA 2F0HA 2B2TC 3NHHA 4K5XA 4DR3H 3PO3G 1HNZH 1Q81C 1HNWQ 5KFEA 4F4WA 3CD6A 2UXBL 2F0KA 4LFAL 1KC8C 5FLMH 1A6XA 3UQ8A 1WYDA 2EYHA 1WVLA 3G6VA 3RTXA 1FD7D 4DAYB 5AJ3Q 4JI7H 3AMUA 4DR2Q 1T5XD 3GV8B 4XYQA 4CJ1B 1AZQA 1DV2A 2QGQA 1Y1VH 2WE6A 4FVMA 3RZDH 3AFQA 1DOMA 2IHEA 3PIP3 1PTOD 3WO1A 5C5LA 2E74C 1G2SA 5IYDG 5KG0A 3BG5A 5IYZF 4BY7B 2NVXH 5BN3A 4RGMA 5CV6A 3H4DA 2UXCL 3W1BA 5JEAG 3A7AB 5EQ0A 1K83A 1BQQT 4A4IA 4X3TA 1BNCA 3NTIA 3JSNA 1N36Q 3I4NG 1PRTC 3G8CA 3K7AH 5EKIA 5M3MB 3T5LA 2ZJPA 4NXML 3NE5B 5HGTA 1IYVA 5J2UF 1K8MA 2DJFC 3D0FA 4RA8A 5D3IB 1TWFH 1MBYA 2NVYH 4R7RA 4FXKC 3DWQA 3NWTA 4K0KQ 1KBLA 4DR6H 1VQMA 1STHA 3P20A 4B3SL 1SMYD 5LMNW 4K14A 2VB2X 2XTIA 1Y69U 1RF2D 2L11A 4UCVA 2IT1A 4EBEA 1E2WA 1VBHA 2C9OA 4XQJA 1BBXC 4FS2A 2YTXA 1G8ZD 3EPGA 4C5BA 1VQGA 2ZDHA 2UXBQ 3K5MA 4LFAQ 3RZOB 4QWCA 2A69D 5I9OA 3G6EA 2L4NA 2NUAB 2EYLA 5T1GA 4CGYB 1KJ9A 1EIGA 3VPBA 5L1KA 1CK1A 4MV9A 2UUBL 1TWAH 4RKBA 4JI6H 2KCMA 4G7ZC 1OXXK 4NP5A 3UI2A 4B3RL 1UE7A 3GTPH 2F0JA 3BVGA 1B70B 1KRTA 3K5IA 3LWBA 2CH4A 4ZCKA 4JW0A 3K7UC 1VQ8A 4C56C 1PH8A 4ECUA 4RHRA 1P16A 5C0XI 1SJED 3KF6A 3GTJH 2M9VA 3RFCA 2Q2IA 2ASDA 1SFOA 1ESFA 2GPSA 5HGQA 1SAPA 4YY3L 3JAME 4NXMQ 1T94A 1Z7TA 4EFBA 4UHVA 1TIID 3VYRA 3GDEA 4L5TA 2V4DA 4K8IA 1XPOA 4ECQA 2JEFA 1LTRD 4ED8A 1IXRA 1HUNA 4CDDC 4PZ8A 3BA9A 2NZ1D 3KTMA 4ZKBB 4B3SQ 4MA0A 3CCJA 4HIKA 2P0AA 1EFWA 3GTMB 3KBGA 2HVSA 1U4MA 1M7JA 4FDBA 1IZ6A 3KDFB 1GJXA 3CMEA 3ND9A 1B33N 1FYCA 4F4ZA 1H9RA 3GTLB 1V43A 1OWTA 4KY5A 3GP7A 4AYBG 4KMUC 1M4VA 1I5FA 2A8VA 2NU6B 2C2EA 2JA6A 5BPHA 1NMFA 5IYBH 4YWMA 3CCLA 4XQNA 4GS3A 2UUCH 1O78A 1JQYD 2UUBQ 3U58A 4DV5L 1Q90A 1LTGD 3FKIH 2V5AA 5FPOA 1GGOA 2VY3A 1NNXA 4IPHA 3D6WA 3BVMA 3KHLA 1YITA 4JI4Q 1BUVT 5C1PA 1EHIA 2VQFL 5CGKA 4LK1C 2L9HA 3WOFA 4IOCA 2SNMA 4DV3H 1GKHA 4ECZA 3UFXB 2W9BA 1XMOL 1I6UA 3ORQA 1PZID 1M6VA 5EWFA 4A93B 4TSSA 2CHBD 4YY3Q 2LY7A 1WTXA 2VUMH 3KLWA 2NTSA 3HOYB 1VQCA 1K73C 4LF4H 5HBRB 1G2TA 2OTLA 2I46A 1K1SA 2NVTB 3HP3A 2HVRA 1N34H 1A8VA 3M3YB 1U5KA 4K6DA 1X55A 4IRDA 5NUCA 2B2UC 1OXSC 3V6HA 2CWAA 4A3EH 4F7XA 4EG0A 1KABA 3ULLA 2NN6G 1JJ2A 4ECWA 4OX9H 1EY7A 4K2KA 4IOAA 1G291 2B29A 3GTGH 2JJQA 4HJ7A 4UCUA 3OHBA 2PZTA 1V9PA 4E4TA 1VQIA 1K83B 1L0YB 4J6HA 3ETJA 3LP8A 1H9SA 5CR3A 3K5OA 1S10A 3VR5A 1ENFA 4XT1B 5BMVF 3PW2A 1EL0A 5C4JH 1FKAH 5ELEA 2VXWA 2ZM6H 2EOTA 4NMZA 3PUYA 5GAEC 3HOZG 4DV5Q 1EY5A 1PTOC 3OTOL 5KFMA 4OO1H 4I7ZC 4K2LA 1PH7A 5HY6A 4BBRH 3CKIB 3H15A 2VQFQ 1EYCA 2SDFA 2A5HA 3BJUA 3HS0C 3QJYA 1RTNA 1XMQL 5FLXW 1S97A 1NMGA 1SYEA 2F0QA 2JQOA 3D31A 1XMOQ 1GSOA 2DNEA 3J7AF 5KEEA 3OHXC 2XGTA 1HR0W 2YL2A 2YYZA 3RD4A 2AKWB 4XT3B 1WTVA 4LF8L 5BN4A 2UXDL 4J9RA 4KKSA 3F2BA 1MKHA 1ESRA 3I73A 1IW7C 4J9QA 1TA8A 2FFKB 3RV4A 3OIPA 2YRWA 4KD4A 2AQ2B 1CQFA 1SMYC 4PZ7A 1NTGA 2K05A 1JE5A 2XCPA 2FJ2A 4DV6L 4JI7Q 2YU9A 1FNUA 1UEBA 4RZRA 1YJWA 3Q8RB 2KCCA 2EY2A 2WACA 2AU0A 4APVA 3KF6B 2RVLA 4J9SA 4GN3B 3VDYA 1GLVA 3I55A 1F9PA 1SFOB 3CC4A 3T13A 1EWHA 3S14H 2A69C 5CC4A 1QCBD 2D0OA 2M2LA 1VQBA 4GKKH 1SLJA 3I4OA
chains in the Genus database with same CATH topology
4JI3L 4DR4Q 4A3DG 2MO0A 5FJ8H 2R92H 1W2BA 1XJVA 2GVBA 1WI5A 4UP7A 4JI8Q 2ASBA 4LW1A 4A3BH 2IX0A 1NBWA 4LFCQ 1JJCB 2LXKA 2VNUD 4Y52H 4JI5Q 4JG2A 3L2PA 4JI0Q 2ES2A 4O2DA 5C44H 2IX1A 5GAGC 1CKNB 3CC7A 1Q46A 4LUVA 2YTVA 1Y14B 4A3MG 5GQOA 1XMQQ 4KHPQ 5IYBG 1N9WA 1G6PA 1X65A 5IE8A 2PI2A 1VQJA 1X9NA 3ERSX 4R1JA 4IO9A 2UUAQ 3HKZE 4MNOA 1HZBA 2K14A 1RL2A 4JC0A 4DV1L 4GNXC 2CCZA 3I4MH 4LF8Q 1YIJA 4J15A 2UXDQ 4JI2Q 4IPCA 3J7ZC 2R93G 1PH3A 4A3IG 2UU9L 3CXCA 1SROA 3EIVA 2N8NA 3E0EA 4DV2L 4HJAA 3T1YQ 4WJ3M 2WFWA 2BA0A 3I7FA 2EIFA 4GOPA 4IJHA 4DR7L 1EYGA 2KENA 1OXVA 2Q2UA 4L5RC 1PVOA 4DV6Q 2MNAA 1I50H 4A3FH 1VQPA 1K9MC 3A0JA 3W1GA 4BY1G 2UUCL 4A3GG 4IFDI 1HZAA 1LYLA 1X56A 3GTMH 2WB1E 4IFDG 2FXQA 2VUMG 4JI6Q 1Q1EA 2PNHA 3KYHC 1OXTA 1JB7A 3H3VH 2E2JH 1N33L 2GVAA 1WFQA 1MJCA 3GTLH 1PA6A 4JV5L 2KHJA 4UP9A 4BA1I 1Q8KA 2R7ZG 3PUVA 1KQSA 1D8LA 4PZ6A 1D7QA 4DR3L 1LTLA 1HNZL 4JI3Q 4JBWA 1E1OA 2AHOB 3KOJA 4YCWA 2WAQG 5GADC 1DGSA 4A3EG 2JA6H 4LUZA 1BBUA 1EWIA 4P74A 3PUXA 3GO5A 5GROA 1N8RC 4BBSG 4A3LH 2YTYA 1I3QH 2L15A 4JI7L 1EQRA 1N34L 1PYSB 3J81i 1AH9A 1EOVA 3CCQA 1QZGA 4GOPC 1Q86C 2MO1A 3HKSA 3TS2A 1PV4A 3S2HH 2VW9A 4KI0A 1XPRA 1NE3A 2B63H 4DPGA 2JE6I 1Q82C 1JT8A 1Z47A 3PO3H 2R7FA 1HR0L 1AE3A 2KCTA 5FLXc 4LUOA 4OO1I 3KJOA 4A93H 2D62A 2I5HA 2E2HH 3HOYH 4OO1G 2ALYB 3HOXG 4BBRG 1MIUA 4DR4L 2CFMA 5ELNA 5LMUQ 4DV2Q 5H1SE 2NVTH 1PHJA 1GM5A 4JI8L 3HOWG 4IPDA 2E8GA 1VQOA 2HIVA 3ICEA 4BY7G 3S1QH 5JJKA 1Z9FA 5IT9c 3G4SA 1K8AC 2UUCQ 3S17H 4QIWE 3JAMi 1WOCA 2Y0SE 1FVIA 4DR6L 4HIDA 5IYDH 5M3MG 3F2CA 2K50A 4PG3A 1U0LA 4C3JH 1N33Q 2F52A 3S1NH 3NENA 1PYBA 4A3KG 4JV5Q 3A74A 4LFBQ 2JEBI 4OWTB 3M9BA 4DR3Q 3I4NH 2DUDA 1LUZA 1HNZQ 2D0PA 2NZHA 4P75A 5IP9G 3CCEA 4HJ8A 3CQZH 4NXNQ 3NEMA 3T1YL 1JMCA 1X3EA 1HJPA 3J80i 1Y1WG 1QVGA 2PQAB 3CC2A 5IYCH 4B3ML 3ZJYC 3RLNA 4KHZA 5IWAL 4JYAL 4LF4Q 1FGUA 3M4QA 3KJPA 1N34Q 1ASZA 2K52A 1GVPA 3K8AA 3UDXA 1W3SA 5M3FH 1H95A 4OWWB 1NJIC 2I0QA 4JI6L 5JJLA 4GNXB 5JJIA 1YNXA 2N78A 2ZTDA 1Q1BA 1B7YB 1SE8A 2HIXA 2N3SA 2N49A 2BH2A 2WP8J 1S72A 5FJ8G 1YJ9A 1HR0Q 2BA1A 4QY7A 5JEAJ 1KRSA 2R6GA 3UDIA 1O7IA 4UP8A 1MJEA 4A3BG 1I6HH 5IP7H 3S1RH 1QVCA 1YHQA 2I5MX 2KHIA 1VQ6A 3ULPA 4QQBX 4QGUA 1T9HA 2JA7H 2E2IH 2PI2E 5C44G 1PH6A 1IBKL 3SGIA 3L7ZC 1VQFA 4UY8C 1A0IA 4AYBE 5M5WH 3PO2H 1E24A 2HQLA 2AWOA 4X62L 1VQKA 3RNUA 2UXCQ 2KBNA 4ALPA 2JA8H 3I4MG 3E9HA 3FP9A 3J81j 4DR6Q 2YU9H 1QVFA 1KIXA 1HH2P 2Z6KC 1J6QA 4R4CA 3TS0A 1SN8A 1FJGQ 1E3PA 4POGA 4H02A 3CMAA 3KFUA 3U4ZA 2F3IA 1SFOH 2RF4A 4YHHL 5AJ3L 3FKIG 3CAMA 4OONA 2JA5H 4WJ4A 4UPAA 1CKOA 2OQKA 3NELA 1VQHA 3RN2A 4LF9L 4A3FG 5DLQE 5LMUL 1XPUA 4P71A 3PUWA 4HJ5A 3PIOA 4B3MQ 3BZCA 3TEHB 3HOUH 4GN4B 5IWAQ 3ER0A 3H3VI 4LNQA 3KDFA 4C3HH 4GOPB 1PH1A 3M85A 4DR5L 4MTNA 3RLOA 3CCUA 4DUYL 1NY4A 2MFIA 1KHIA 1X3GA 5IY0A 1BKBA 4A3CH 5EAYA 4OWXB 3AQQA 1VQ5A 3FHWA 1XNQL 3GTKH 1TWGH 3UE1A 2OWOA 1EIYB 2K5HA 3GTOH 1KXLA 4X6AH 2QEXA 1E7ZA 3EN2A 1N32L 4LFBL 4L5QA 4DV3L 1XNRL 3K0XA 1VQEA 4NXNL 5J3BA 4B3RQ 1K0RA 2RHQB 1KAWA 1TWHH 3HKZG 3PUZA 1WCMH 1IBKQ 4GKJL 1SR3A 4LF4L 4TQUS 3TREA 4B3TL 4X62Q 2B63G 4X66L 3PO3G 1TXYA 1SRUA 1X6OA 1Q81C 1Q12A 1YHBA 4A3GH 5C3EH 4A93G 1HNWQ 1L2FA 1UWVA 3HOYG 3CD6A 2UXBL 4LFAL 3STBC 3OW2A 1KC8C 5FLMH 4LF5Q 3HOVH 1WJJA 1WYDA 2ATWA 2OTJA 4DAYB 4R4IA 4YHHQ 3M4PA 5AJ3Q 2VS1A 4OX9L 1EIFA 4DR2Q 2WB1G 4GLXA 3J80c 1IBMQ 4LF9Q 2QGQA 1Y1VH 3RZDH 3AFQA 2IHEA 3M7NA 1QZHA 5IYDG 5LMNL 1A62A 2GN5A 1EUJA 4DR5Q 3LGJA 1J5EL 2NVXH 4DUYQ 2UXCL 3W1BA 5JEAG 2ZM6L 1C9OA 4JBMA 4BBSH 1QUQA 1YHAA 3CPFA 1L1OA 4A4IA 3PSIA 3I2ZA 2HT1A 3MEFA 1FJGL 1N36Q 1PH2A 3I4NG 3K7AH 3MXNB 1R9TH 2ZJPA 4NXML 1K8GA 4JCVE 4AH6A 4JYAQ 1XNQQ 3D0FA 2A1AA 1TWFH 4X65Q 3CCRA 4HIMA 5ELOA 5IYCG 3U50C 3DLLA 2NVYH 1PH4A 4LF7Q 1N32Q 1P8LA 1V1QA 3G48A 4DV3Q 4A3JH 1XNRQ 4K0KQ 1VQMA 2NVQH 4B3SL 4O0AA 1VS0A 4EQ5A 4GKJQ 3CCMA 5LMNW 2XTIA 3HOZH 2IT1A 3RR5A 4B3TQ 3J7A5 4X66Q 4HIOA 2YTXA 4DNIA 4OXPA 1VQGA 1VQ7A 4YCUA 5IP7G 3A5UA 2UXBQ 4LFAQ 2YV5A 3G6EA 2R92G 5M3MH 4BY7H 4KHPL 2JA7G 1L1OC 4POFA 4OX9Q 1KD1C 2Y0SG 5C4XH 1A63A 2UUBL 3Q8DA 3PO2G 1TWAH 1CUKA 2KCMA 1OXXK 4B3RL 1UE7A 3GTPH 1B70B 1KRTA 1YJNA 2JA8G 3GTQH 5LMNQ 1VQ8A 3K7UC 1PH8A 2LXJA 1P16A 1VQAA 4GKKL 5C0XI 3L0OA 3KF6A 1J5EQ 3S2DH 2R7DA 2EQSA 3GTJH 2A19A 2ZM6Q 2Q2IA 4GLVB 1ASYA 3CF5A 3GD7A 4BXXH 1HNWL 4RG1A 5HGQA 2JA5G 2F4VL 1S40A 4YY3L 1X3FA 3M4OH 2AMCB 1C0AA 4NXMQ 4LF5L 4QL5A 4R4QA 3RZOH 3GDEA 4L5TA 1XPOA 4XTCS 4DR2L 1IXRA 4GLAC 3CCSA 3HOUG 1IBML 4PZ8A 4X64L 4MZ9A 3AEVA 4IPGA 3RLFA 4LF6L 3OTOQ 3H0GH 4DV0Q 3OYYA 4B3SQ 3ULJA 3CCJA 4TVAB 1YZ6A 4L5SA 1B8AA 2DGYA 3J81c 4HIKA 3PF4A 3K81C 1EFWA 4A3DH 3A5ZB 1IL2A 4A3CG 3DM3A 1CKNA 4FDBA 1IZ6A 3HFZB 3KDFB 4DK3C 2VQEL 2E5LL 3CMEA 4NPSA 3AYHB 4DV7Q 4C2MH 1KL9A 2ZTEA 3F1ZA 1XTDA 1V43A 2K5VA 3S1MH 2WAQE 4P73A 2Q2TA 3T1HQ 5E7NA 1N36L 1CSPA 4AYBG 2OCEA 1I5FA 3TQYA 2A8VA 4JBJA 4A3MH 1E22A 2OQ0A 1NMFA 5IYBH 2JA6G 4YWMA 4X65L 5C0XJ 3CCLA 1PFSA 4LF7L 4GS3A 1WCMG 3PCOB 1IBLL 4JI1L 1LM0A 2UUBQ 1UE1A 4A3LG 2K75A 3U58A 4DV5L 4K0KL 2MQHA 2BH8A 3FKIH 2ZJRA 5BR8L 4A75A 2IY5B 1IYJB 2R93H 4YCVA 2VY3A 4DR1L 3E9IA 4EX5A 4A3IH 1UE5A 3JAMc 4IPHA 3S15H 1VQDA 1FL0A 5C3EG 3F2DA 1YITA 2K5NA 4JI4Q 4GKKQ 1JJGA 2VQFL 3BU2A 5FLMG 4IOCA 3HOVG 4DKAC 1GKHA 2VL6A 2K4KA 3RN5A 4BY1H 3PV0A 1XMOL 4DV4Q 2F4VQ 3STBD 4YY3Q 2VUMH 3KLWA 2Q2HA 1VQCA 2CKZB 4C3IH 1K73C 1Q7YC 1Y1VG 1OXUA 2HHHL 2OTLA 4BA2I 3CW2C 1A8VA 2IHFA 4X64Q 2R7ZH 1U5KA 3BZKA 4LWCA 4P72A 1YI2A 2PMZE 1X55A 4GN5A 4YWLA 2ZTCA 4LF6Q 1OXSC 4DAMA 1M90C 2CWAA 2NN6I 4A3EH 2V1CC 4R4OA 3ULLA 2NN6G 4AIMA 1JJ2A 3TRZA 2H5XA 1E1TA 2VQEQ 2E5LQ 2Z0SA 3JC66 4IOAA 3NBHB 1G291 2B29A 2RHSB 1I94L 2JJQA 4HJ7A 3U4VA 3GTGH 2CQOA 1V9PA 1QUQB 2RCNA 5M5XH 1L1OB 1VQIA 4DUZL 4JOIA 1S3OA 4R4TA 4DV1Q 4AQYL 1BBWA 4A3JG 3PGZA 1PH5A 3F8TA 3W5OA 1HNXL 5K36G 4IFDJ 5C4JH 1OTCA 4IJLA 2UU9Q 3K80C 2JA9A 4JI1Q 1IBLQ 3IRBA 3PUYA 4XIGS 5GAEC 3HOZG 4DV5Q 3M3YH 4HJ9A 4DR7Q 3OTOL 5BR8Q 4DV0L 2QA4A 1PH7A 3HOXH 2NZOA 3CP0A 5HY6A 2VZAA 4LFCL 4BBRH 5M3FG 4DR1Q 1EQQA 3H15A 1K3RA 4JI5L 3PF5A 4JI0L 1HZ9A 3HOWH 2VQFQ 2LSSA 3BJUA 2I5LX 2B3GA 1TWCH 1HZCA 3EBEA 4DV7L 1BVSA 4Y7NH 4RMFA 1XMQL 4JBKA 1UE6A 4DK6C 3UDGA 2ZJQA 3I56A 1NMGA 2JQOA 3D31A 1XMOQ 3T1HL 2AWNA 5C4XG 2UUAL 2XGTA 1PH9A 1K83H 2YYZA 3PIPA 2AKWB 1HR0W 4LF8L 2UXDL 3UDFA 4JI2L 4A76A 1AE2A 2HHHQ 1X54A 4PMWA 4QJFA 1MKHA 3F2BA 4ME3A 1M1KC 2EXDA 3B6YA 1L0WA 1YEZA 2C35B 1VQ9A 1GO3E 2PQAA 4A3KH 4JOIC 1VQNA 3WWVA 4NB3A 1GD7A 2Z6KA 3S16H 4PZ7A 4KLKA 1NTGA 5M5YH 3CCVA 1JE5A 5IP9H 4DV6L 4JI7Q 3UE0A 1CKMA 1UEBA 3G71A 1YJWA 1Y1WH 4JI4L 1VQLA 3AFPA 5GAHC 4BXXG 4GNXA 1G51A 1SMXA 3S24A 4APVA 1CSQA 2ID0A 3KF6B 5C0XG 4GN3B 3VDYA 1I94Q 1C7YA 3I55A 1RIPA 1VQ4A 2JEAI 3CC4A 3S14H 4DV4L 4DUZQ 3KF8B 1YVCA 4AQYQ 1HNXQ 2D0OA 1YBYA 2CWPA 2JK8A 1VCIA 4YWKA 1VQBA 3H0GG 3CPWA 1SLJA 3I4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 L;  4DR4 Q;  4A3D G;  2MO0 A;  5FJ8 H;  2R92 H;  1W2B A;  1XJV A;  2GVB A;  1WI5 A;  4UP7 A;  4JI8 Q;  2ASB A;  4LW1 A;  4A3B H;  2IX0 A;  1NBW A;  4LFC Q;  1JJC B;  2LXK A;  2VNU D;  4Y52 H;  4JI5 Q;  4JG2 A;  3L2P A;  4JI0 Q;  2ES2 A;  4O2D A;  5C44 H;  2IX1 A;  5GAG C;  1CKN B;  3CC7 A;  1Q46 A;  4LUV A;  2YTV A;  1Y14 B;  4A3M G;  5GQO A;  1XMQ Q;  4KHP Q;  5IYB G;  1N9W A;  1G6P A;  1X65 A;  5IE8 A;  2PI2 A;  1VQJ A;  1X9N A;  3ERS X;  4R1J A;  4IO9 A;  2UUA Q;  3HKZ E;  4MNO A;  1HZB A;  2K14 A;  1RL2 A;  4JC0 A;  4DV1 L;  4GNX C;  2CCZ A;  3I4M H;  4LF8 Q;  1YIJ A;  4J15 A;  2UXD Q;  4JI2 Q;  4IPC A;  3J7Z C;  2R93 G;  1PH3 A;  4A3I G;  2UU9 L;  3CXC A;  1SRO A;  3EIV A;  2N8N A;  3E0E A;  4DV2 L;  4HJA A;  3T1Y Q;  4WJ3 M;  2WFW A;  2BA0 A;  3I7F A;  2EIF A;  4GOP A;  4IJH A;  4DR7 L;  1EYG A;  2KEN A;  1OXV A;  2Q2U A;  4L5R C;  1PVO A;  4DV6 Q;  2MNA A;  1I50 H;  4A3F H;  1VQP A;  1K9M C;  3A0J A;  3W1G A;  4BY1 G;  2UUC L;  4A3G G;  4IFD I;  1HZA A;  1LYL A;  1X56 A;  3GTM H;  2WB1 E;  4IFD G;  2FXQ A;  2VUM G;  4JI6 Q;  1Q1E A;  2PNH A;  3KYH C;  1OXT A;  1JB7 A;  3H3V H;  2E2J H;  1N33 L;  2GVA A;  1WFQ A;  1MJC A;  3GTL H;  1PA6 A;  4JV5 L;  2KHJ A;  4UP9 A;  4BA1 I;  1Q8K A;  2R7Z G;  3PUV A;  1KQS A;  1D8L A;  4PZ6 A;  1D7Q A;  4DR3 L;  1LTL A;  1HNZ L;  4JI3 Q;  4JBW A;  1E1O A;  2AHO B;  3KOJ A;  4YCW A;  2WAQ G;  5GAD C;  1DGS A;  4A3E G;  2JA6 H;  4LUZ A;  1BBU A;  1EWI A;  4P74 A;  3PUX A;  3GO5 A;  5GRO A;  1N8R C;  4BBS G;  4A3L H;  2YTY A;  1I3Q H;  2L15 A;  4JI7 L;  1EQR A;  1N34 L;  1PYS B;  3J81 i;  1AH9 A;  1EOV A;  3CCQ A;  1QZG A;  4GOP C;  1Q86 C;  2MO1 A;  3HKS A;  3TS2 A;  1PV4 A;  3S2H H;  2VW9 A;  4KI0 A;  1XPR A;  1NE3 A;  2B63 H;  4DPG A;  2JE6 I;  1Q82 C;  1JT8 A;  1Z47 A;  3PO3 H;  2R7F A;  1HR0 L;  1AE3 A;  2KCT A;  5FLX c;  4LUO A;  4OO1 I;  3KJO A;  4A93 H;  2D62 A;  2I5H A;  2E2H H;  3HOY H;  4OO1 G;  2ALY B;  3HOX G;  4BBR G;  1MIU A;  4DR4 L;  2CFM A;  5ELN A;  5LMU Q;  4DV2 Q;  5H1S E;  2NVT H;  1PHJ A;  1GM5 A;  4JI8 L;  3HOW G;  4IPD A;  2E8G A;  1VQO A;  2HIV A;  3ICE A;  4BY7 G;  3S1Q H;  5JJK A;  1Z9F A;  5IT9 c;  3G4S A;  1K8A C;  2UUC Q;  3S17 H;  4QIW E;  3JAM i;  1WOC A;  2Y0S E;  1FVI A;  4DR6 L;  4HID A;  5IYD H;  5M3M G;  3F2C A;  2K50 A;  4PG3 A;  1U0L A;  4C3J H;  1N33 Q;  2F52 A;  3S1N H;  3NEN A;  1PYB A;  4A3K G;  4JV5 Q;  3A74 A;  4LFB Q;  2JEB I;  4OWT B;  3M9B A;  4DR3 Q;  3I4N H;  2DUD A;  1LUZ A;  1HNZ Q;  2D0P A;  2NZH A;  4P75 A;  5IP9 G;  3CCE A;  4HJ8 A;  3CQZ H;  4NXN Q;  3NEM A;  3T1Y L;  1JMC A;  1X3E A;  1HJP A;  3J80 i;  1Y1W G;  1QVG A;  2PQA B;  3CC2 A;  5IYC H;  4B3M L;  3ZJY C;  3RLN A;  4KHZ A;  5IWA L;  4JYA L;  4LF4 Q;  1FGU A;  3M4Q A;  3KJP A;  1N34 Q;  1ASZ A;  2K52 A;  1GVP A;  3K8A A;  3UDX A;  1W3S A;  5M3F H;  1H95 A;  4OWW B;  1NJI C;  2I0Q A;  4JI6 L;  5JJL A;  4GNX B;  5JJI A;  1YNX A;  2N78 A;  2ZTD A;  1Q1B A;  1B7Y B;  1SE8 A;  2HIX A;  2N3S A;  2N49 A;  2BH2 A;  2WP8 J;  1S72 A;  5FJ8 G;  1YJ9 A;  1HR0 Q;  2BA1 A;  4QY7 A;  5JEA J;  1KRS A;  2R6G A;  3UDI A;  1O7I A;  4UP8 A;  1MJE A;  4A3B G;  1I6H H;  5IP7 H;  3S1R H;  1QVC A;  1YHQ A;  2I5M X;  2KHI A;  1VQ6 A;  3ULP A;  4QQB X;  4QGU A;  1T9H A;  2JA7 H;  2E2I H;  2PI2 E;  5C44 G;  1PH6 A;  1IBK L;  3SGI A;  3L7Z C;  1VQF A;  4UY8 C;  1A0I A;  4AYB E;  5M5W H;  3PO2 H;  1E24 A;  2HQL A;  2AWO A;  4X62 L;  1VQK A;  3RNU A;  2UXC Q;  2KBN A;  4ALP A;  2JA8 H;  3I4M G;  3E9H A;  3FP9 A;  3J81 j;  4DR6 Q;  2YU9 H;  1QVF A;  1KIX A;  1HH2 P;  2Z6K C;  1J6Q A;  4R4C A;  3TS0 A;  1SN8 A;  1FJG Q;  1E3P A;  4POG A;  4H02 A;  3CMA A;  3KFU A;  3U4Z A;  2F3I A;  1SFO H;  2RF4 A;  4YHH L;  5AJ3 L;  3FKI G;  3CAM A;  4OON A;  2JA5 H;  4WJ4 A;  4UPA A;  1CKO A;  2OQK A;  3NEL A;  1VQH A;  3RN2 A;  4LF9 L;  4A3F G;  5DLQ E;  5LMU L;  1XPU A;  4P71 A;  3PUW A;  4HJ5 A;  3PIO A;  4B3M Q;  3BZC A;  3TEH B;  3HOU H;  4GN4 B;  5IWA Q;  3ER0 A;  3H3V I;  4LNQ A;  3KDF A;  4C3H H;  4GOP B;  1PH1 A;  3M85 A;  4DR5 L;  4MTN A;  3RLO A;  3CCU A;  4DUY L;  1NY4 A;  2MFI A;  1KHI A;  1X3G A;  5IY0 A;  1BKB A;  4A3C H;  5EAY A;  4OWX B;  3AQQ A;  1VQ5 A;  3FHW A;  1XNQ L;  3GTK H;  1TWG H;  3UE1 A;  2OWO A;  1EIY B;  2K5H A;  3GTO H;  1KXL A;  4X6A H;  2QEX A;  1E7Z A;  3EN2 A;  1N32 L;  4LFB L;  4L5Q A;  4DV3 L;  1XNR L;  3K0X A;  1VQE A;  4NXN L;  5J3B A;  4B3R Q;  1K0R A;  2RHQ B;  1KAW A;  1TWH H;  3HKZ G;  3PUZ A;  1WCM H;  1IBK Q;  4GKJ L;  1SR3 A;  4LF4 L;  4TQU S;  3TRE A;  4B3T L;  4X62 Q;  2B63 G;  4X66 L;  3PO3 G;  1TXY A;  1SRU A;  1X6O A;  1Q81 C;  1Q12 A;  1YHB A;  4A3G H;  5C3E H;  4A93 G;  1HNW Q;  1L2F A;  1UWV A;  3HOY G;  3CD6 A;  2UXB L;  4LFA L;  3STB C;  3OW2 A;  1KC8 C;  5FLM H;  4LF5 Q;  3HOV H;  1WJJ A;  1WYD A;  2ATW A;  2OTJ A;  4DAY B;  4R4I A;  4YHH Q;  3M4P A;  5AJ3 Q;  2VS1 A;  4OX9 L;  1EIF A;  4DR2 Q;  2WB1 G;  4GLX A;  3J80 c;  1IBM Q;  4LF9 Q;  2QGQ A;  1Y1V H;  3RZD H;  3AFQ A;  2IHE A;  3M7N A;  1QZH A;  5IYD G;  5LMN L;  1A62 A;  2GN5 A;  1EUJ A;  4DR5 Q;  3LGJ A;  1J5E L;  2NVX H;  4DUY Q;  2UXC L;  3W1B A;  5JEA G;  2ZM6 L;  1C9O A;  4JBM A;  4BBS H;  1QUQ A;  1YHA A;  3CPF A;  1L1O A;  4A4I A;  3PSI A;  3I2Z A;  2HT1 A;  3MEF A;  1FJG L;  1N36 Q;  1PH2 A;  3I4N G;  3K7A H;  3MXN B;  1R9T H;  2ZJP A;  4NXM L;  1K8G A;  4JCV E;  4AH6 A;  4JYA Q;  1XNQ Q;  3D0F A;  2A1A A;  1TWF H;  4X65 Q;  3CCR A;  4HIM A;  5ELO A;  5IYC G;  3U50 C;  3DLL A;  2NVY H;  1PH4 A;  4LF7 Q;  1N32 Q;  1P8L A;  1V1Q A;  3G48 A;  4DV3 Q;  4A3J H;  1XNR Q;  4K0K Q;  1VQM A;  2NVQ H;  4B3S L;  4O0A A;  1VS0 A;  4EQ5 A;  4GKJ Q;  3CCM A;  5LMN W;  2XTI A;  3HOZ H;  2IT1 A;  3RR5 A;  4B3T Q;  3J7A 5;  4X66 Q;  4HIO A;  2YTX A;  4DNI A;  4OXP A;  1VQG A;  1VQ7 A;  4YCU A;  5IP7 G;  3A5U A;  2UXB Q;  4LFA Q;  2YV5 A;  3G6E A;  2R92 G;  5M3M H;  4BY7 H;  4KHP L;  2JA7 G;  1L1O C;  4POF A;  4OX9 Q;  1KD1 C;  2Y0S G;  5C4X H;  1A63 A;  2UUB L;  3Q8D A;  3PO2 G;  1TWA H;  1CUK A;  2KCM A;  1OXX K;  4B3R L;  1UE7 A;  3GTP H;  1B70 B;  1KRT A;  1YJN A;  2JA8 G;  3GTQ H;  5LMN Q;  1VQ8 A;  3K7U C;  1PH8 A;  2LXJ A;  1P16 A;  1VQA A;  4GKK L;  5C0X I;  3L0O A;  3KF6 A;  1J5E Q;  3S2D H;  2R7D A;  2EQS A;  3GTJ H;  2A19 A;  2ZM6 Q;  2Q2I A;  4GLV B;  1ASY A;  3CF5 A;  3GD7 A;  4BXX H;  1HNW L;  4RG1 A;  5HGQ A;  2JA5 G;  2F4V L;  1S40 A;  4YY3 L;  1X3F A;  3M4O H;  2AMC B;  1C0A A;  4NXM Q;  4LF5 L;  4QL5 A;  4R4Q A;  3RZO H;  3GDE A;  4L5T A;  1XPO A;  4XTC S;  4DR2 L;  1IXR A;  4GLA C;  3CCS A;  3HOU G;  1IBM L;  4PZ8 A;  4X64 L;  4MZ9 A;  3AEV A;  4IPG A;  3RLF A;  4LF6 L;  3OTO Q;  3H0G H;  4DV0 Q;  3OYY A;  4B3S Q;  3ULJ A;  3CCJ A;  4TVA B;  1YZ6 A;  4L5S A;  1B8A A;  2DGY A;  3J81 c;  4HIK A;  3PF4 A;  3K81 C;  1EFW A;  4A3D H;  3A5Z B;  1IL2 A;  4A3C G;  3DM3 A;  1CKN A;  4FDB A;  1IZ6 A;  3HFZ B;  3KDF B;  4DK3 C;  2VQE L;  2E5L L;  3CME A;  4NPS A;  3AYH B;  4DV7 Q;  4C2M H;  1KL9 A;  2ZTE A;  3F1Z A;  1XTD A;  1V43 A;  2K5V A;  3S1M H;  2WAQ E;  4P73 A;  2Q2T A;  3T1H Q;  5E7N A;  1N36 L;  1CSP A;  4AYB G;  2OCE A;  1I5F A;  3TQY A;  2A8V A;  4JBJ A;  4A3M H;  1E22 A;  2OQ0 A;  1NMF A;  5IYB H;  2JA6 G;  4YWM A;  4X65 L;  5C0X J;  3CCL A;  1PFS A;  4LF7 L;  4GS3 A;  1WCM G;  3PCO B;  1IBL L;  4JI1 L;  1LM0 A;  2UUB Q;  1UE1 A;  4A3L G;  2K75 A;  3U58 A;  4DV5 L;  4K0K L;  2MQH A;  2BH8 A;  3FKI H;  2ZJR A;  5BR8 L;  4A75 A;  2IY5 B;  1IYJ B;  2R93 H;  4YCV A;  2VY3 A;  4DR1 L;  3E9I A;  4EX5 A;  4A3I H;  1UE5 A;  3JAM c;  4IPH A;  3S15 H;  1VQD A;  1FL0 A;  5C3E G;  3F2D A;  1YIT A;  2K5N A;  4JI4 Q;  4GKK Q;  1JJG A;  2VQF L;  3BU2 A;  5FLM G;  4IOC A;  3HOV G;  4DKA C;  1GKH A;  2VL6 A;  2K4K A;  3RN5 A;  4BY1 H;  3PV0 A;  1XMO L;  4DV4 Q;  2F4V Q;  3STB D;  4YY3 Q;  2VUM H;  3KLW A;  2Q2H A;  1VQC A;  2CKZ B;  4C3I H;  1K73 C;  1Q7Y C;  1Y1V G;  1OXU A;  2HHH L;  2OTL A;  4BA2 I;  3CW2 C;  1A8V A;  2IHF A;  4X64 Q;  2R7Z H;  1U5K A;  3BZK A;  4LWC A;  4P72 A;  1YI2 A;  2PMZ E;  1X55 A;  4GN5 A;  4YWL A;  2ZTC A;  4LF6 Q;  1OXS C;  4DAM A;  1M90 C;  2CWA A;  2NN6 I;  4A3E H;  2V1C C;  4R4O A;  3ULL A;  2NN6 G;  4AIM A;  1JJ2 A;  3TRZ A;  2H5X A;  1E1T A;  2VQE Q;  2E5L Q;  2Z0S A;  3JC6 6;  4IOA A;  3NBH B;  1G29 1;  2B29 A;  2RHS B;  1I94 L;  2JJQ A;  4HJ7 A;  3U4V A;  3GTG H;  2CQO A;  1V9P A;  1QUQ B;  2RCN A;  5M5X H;  1L1O B;  1VQI A;  4DUZ L;  4JOI A;  1S3O A;  4R4T A;  4DV1 Q;  4AQY L;  1BBW A;  4A3J G;  3PGZ A;  1PH5 A;  3F8T A;  3W5O A;  1HNX L;  5K36 G;  4IFD J;  5C4J H;  1OTC A;  4IJL A;  2UU9 Q;  3K80 C;  2JA9 A;  4JI1 Q;  1IBL Q;  3IRB A;  3PUY A;  4XIG S;  5GAE C;  3HOZ G;  4DV5 Q;  3M3Y H;  4HJ9 A;  4DR7 Q;  3OTO L;  5BR8 Q;  4DV0 L;  2QA4 A;  1PH7 A;  3HOX H;  2NZO A;  3CP0 A;  5HY6 A;  2VZA A;  4LFC L;  4BBR H;  5M3F G;  4DR1 Q;  1EQQ A;  3H15 A;  1K3R A;  4JI5 L;  3PF5 A;  4JI0 L;  1HZ9 A;  3HOW H;  2VQF Q;  2LSS A;  3BJU A;  2I5L X;  2B3G A;  1TWC H;  1HZC A;  3EBE A;  4DV7 L;  1BVS A;  4Y7N H;  4RMF A;  1XMQ L;  4JBK A;  1UE6 A;  4DK6 C;  3UDG A;  2ZJQ A;  3I56 A;  1NMG A;  2JQO A;  3D31 A;  1XMO Q;  3T1H L;  2AWN A;  5C4X G;  2UUA L;  2XGT A;  1PH9 A;  1K83 H;  2YYZ A;  3PIP A;  2AKW B;  1HR0 W;  4LF8 L;  2UXD L;  3UDF A;  4JI2 L;  4A76 A;  1AE2 A;  2HHH Q;  1X54 A;  4PMW A;  4QJF A;  1MKH A;  3F2B A;  4ME3 A;  1M1K C;  2EXD A;  3B6Y A;  1L0W A;  1YEZ A;  2C35 B;  1VQ9 A;  1GO3 E;  2PQA A;  4A3K H;  4JOI C;  1VQN A;  3WWV A;  4NB3 A;  1GD7 A;  2Z6K A;  3S16 H;  4PZ7 A;  4KLK A;  1NTG A;  5M5Y H;  3CCV A;  1JE5 A;  5IP9 H;  4DV6 L;  4JI7 Q;  3UE0 A;  1CKM A;  1UEB A;  3G71 A;  1YJW A;  1Y1W H;  4JI4 L;  1VQL A;  3AFP A;  5GAH C;  4BXX G;  4GNX A;  1G51 A;  1SMX A;  3S24 A;  4APV A;  1CSQ A;  2ID0 A;  3KF6 B;  5C0X G;  4GN3 B;  3VDY A;  1I94 Q;  1C7Y A;  3I55 A;  1RIP A;  1VQ4 A;  2JEA I;  3CC4 A;  3S14 H;  4DV4 L;  4DUZ Q;  3KF8 B;  1YVC A;  4AQY Q;  1HNX Q;  2D0O A;  1YBY A;  2CWP A;  2JK8 A;  1VCI A;  4YWK A;  1VQB A;  3H0G G;  3CPW A;  1SLJ A;  3I4O A; 
#chains in the Genus database with same CATH topology
 3DF7 A;  4WOR A;  4A3D G;  5IGF A;  2MO0 A;  4NDX A;  1XJV A;  1E2Z A;  3NTH A;  5KT4 A;  1GUO A;  4LW1 A;  1PYW D;  4A3F B;  2MHV A;  3KLS X;  4Y52 H;  2DWC A;  4IUN A;  1DV1 A;  5GAG C;  4LSX A;  1XMQ Q;  4LUV A;  1A2T A;  4A3M G;  1Y14 B;  1CHP D;  4X3S A;  5GQO A;  3Q6S A;  5KFK A;  4IO9 A;  1I4P A;  3I4M H;  2CW8 A;  4AYB A;  4DV1 L;  2CCZ A;  3CRK C;  4EYI B;  4LF8 Q;  2UXD Q;  2KVM A;  5EKK A;  5I2X A;  3BG3 A;  4B08 A;  1BO0 A;  4A3I G;  1PH3 A;  2UU9 L;  2JA6 B;  1BCP B;  1SRO A;  2C5C A;  2FK2 A;  5DG9 A;  4IRK A;  2WFW A;  2BA0 A;  3O13 A;  1EOT A;  5DLG A;  2EIF A;  5LHY 1;  1J8I A;  4LH6 A;  5C3W A;  2KEN A;  5BPF A;  4DV6 Q;  3QZ7 A;  1VQP A;  3RBE A;  2UUC L;  1LYL A;  2DY8 A;  2SOB A;  5C3E B;  4X65 H;  2WB1 E;  4LF7 H;  3PW0 A;  4JI6 Q;  1Q1E A;  2PNH A;  4C3I G;  2P5Z X;  2K5W A;  1IL8 A;  3OSO A;  4JUZ A;  4EFE A;  3GIL A;  1XTC D;  2EDG A;  2BOS A;  2WYO A;  2W9B B;  2R7Z A;  2KHJ A;  4UP9 A;  3JAM L;  2ENB A;  3SR1 A;  5D1P A;  1S68 A;  3G7L A;  2AHO B;  5KFO A;  1SYB A;  1S03 G;  4ULL A;  1WTO A;  3S1Q B;  3DWP A;  1RK6 A;  2NVX A;  1T36 A;  3C46 A;  5CMD A;  1O7L A;  5GRO A;  4YAJ B;  5KT6 A;  5C1O A;  2B2V A;  2FKL A;  1S4Z A;  1N34 L;  5KFQ A;  5F2D A;  1AH9 A;  3CCQ A;  1R9T A;  1JWU D;  3T5K A;  4C3J B;  5EGT A;  1PV4 A;  3TII A;  4YJ2 F;  2B63 H;  3BAA A;  1WTH A;  4NW2 A;  2R8G A;  4OO1 I;  1TS5 A;  4Q43 A;  1H9S B;  5KFL A;  5T1I A;  2ALY B;  3HOX G;  1C3O A;  4DL2 A;  2CFM A;  5ELN A;  1PHJ A;  1GM5 A;  1PFN A;  3N40 P;  4BS9 A;  1XNQ H;  1VQO A;  5KFD A;  3KK7 A;  4BY7 G;  1STN A;  1Z9F A;  5DQH A;  5IT9 c;  2EYO A;  2UUC Q;  4E6I A;  3S17 H;  1JDE A;  2K33 A;  4I4T F;  2HUG A;  3BVZ A;  5M3M G;  5J39 A;  2K50 A;  4PG3 A;  3SDZ A;  4H0L C;  1WTP A;  5EZY F;  4JV1 A;  4B9X A;  1Z2O X;  4DV0 H;  3NEN A;  3MR3 A;  5C4X B;  3IAY A;  1I6H B;  3MR5 A;  3DEP A;  4C5C A;  3T5H A;  4JI5 H;  5KIX A;  1E4G T;  3GTQ H;  4P75 A;  2A68 D;  3CCE A;  4HJ8 A;  4HR7 A;  4RZQ A;  4DV7 H;  5ELF A;  4KHP H;  4QWB A;  3RMH A;  5IWA L;  4LF4 Q;  2J9G A;  1X3P A;  3R2T A;  4UCR A;  2D9U A;  3DUZ A;  3SXH A;  4G4K A;  3BZD B;  4RUA A;  3H91 A;  3KJP A;  3RF2 A;  1N34 Q;  4FS1 A;  1LV9 A;  2YU9 B;  2KJX A;  2I0Q A;  1BJT A;  5JJL A;  3M4O B;  2ZTD A;  2RGR A;  1J9O A;  2WP8 J;  5FJ8 G;  3X3M A;  2KHS A;  2BQU A;  2BA1 A;  4KY6 A;  4QY7 A;  1KRS A;  3NPP A;  3SK4 A;  3UDI A;  1O7I A;  4A3B G;  2V58 A;  5IP7 H;  3S1R H;  3MFY A;  4HED A;  2KHI A;  2HQE A;  5EBC A;  4QGU A;  1T9H A;  2SCU B;  3U9T A;  2PI2 E;  1IBK L;  1CZG A;  3MFH A;  3E0J A;  4L6T B;  1SNM A;  1CFM A;  4FNF A;  2HQL A;  2AWO A;  1VQK A;  1JIC A;  2G5D A;  1DON A;  1D6E C;  2KBN A;  5C6A A;  2OH2 A;  3FP9 A;  2R87 A;  1ZQ7 A;  1KIX A;  1HH2 P;  4HAE A;  3K3P A;  1WTQ A;  1E3P A;  1F9Q A;  2VR1 A;  2R8K A;  3VYT A;  1B50 A;  4ZUJ A;  4AYB B;  3J81 L;  3Q23 A;  4KN7 C;  4KY7 A;  2X0S A;  3NEL A;  2B2T A;  3N52 A;  5F9N A;  3KAL A;  3QG1 A;  1QE6 A;  3HOU H;  5IWA Q;  5DM7 3;  4LNQ A;  5KFA A;  4C3H H;  5KT5 A;  1B6S A;  4MTN A;  2W6Q A;  2B8F A;  1F2Z A;  4DUY L;  3OPO A;  4A3G B;  3AB9 A;  2MFI A;  4A3C H;  1LT3 D;  2OXP A;  4DR7 H;  1XNQ L;  5BR8 H;  1TWG H;  3DXJ C;  1STB A;  1EIY B;  2OWO A;  1KXL A;  4ECX A;  2IMW P;  2K04 A;  2R7Z B;  1SBB B;  4L5Q A;  1EQV A;  2YZM A;  2CVR A;  1BCP F;  2ZDQ A;  1Z6H A;  1D5M C;  2DY7 A;  4NXN L;  4KJO A;  5IOD A;  1SSO A;  5KFN A;  3MFG A;  4EEY A;  5EKL A;  2H4O A;  1TWH H;  3TQT A;  1IBK Q;  2ZXP A;  2EYF A;  1XDN A;  2K28 A;  4O3N A;  5CV9 A;  3TRE A;  4B3T L;  4DK1 A;  3HZX A;  5C5J A;  2RQX A;  1SRU A;  4HTH A;  1ILP A;  1YHB A;  4A93 G;  1R9T B;  2IL8 A;  2XGQ A;  3HOY G;  4J9L A;  3A55 A;  3OW2 A;  3HOV H;  4Z9C B;  1U4R A;  3ONA B;  1KEE A;  4IZ8 A;  4MV8 A;  2VS1 A;  4IZO A;  3J80 c;  4J9K A;  4FF3 A;  1JLL B;  1TAE A;  3HOZ B;  5LMN L;  1A62 A;  3HOW B;  1TWC A;  1HR0 H;  1KDC A;  4AQY H;  2FK3 A;  3NBH A;  1J5E L;  2F0V A;  4MHE A;  4Y7N B;  4DUY Q;  4XX0 B;  1GSA A;  4FYD A;  1QUQ A;  2J4X A;  1L0X B;  1LTA D;  1FJG L;  5FD5 A;  4XZ3 B;  1PH2 A;  3TP5 A;  2ZJT A;  3VR3 A;  4JCV E;  1K8G A;  3TP7 A;  2K5Q A;  1XNQ Q;  3PMF A;  5CB4 F;  4IRC A;  4JPB W;  5KGU A;  4X65 Q;  4A3K B;  4LF7 Q;  5IYC G;  4RCN A;  1PH4 A;  3OWE B;  1V1Q A;  3G48 A;  2R85 A;  1ICW A;  4A3J H;  3LWU A;  1S9F A;  4L8J A;  2VA2 A;  4EVO A;  4HR7 B;  4O0A A;  1VS0 A;  2DZD A;  4O2A F;  2UUA H;  2W9A A;  1IOV A;  1GHJ A;  4ZHQ F;  1QWY A;  2F0M A;  4B3T Q;  4RKL A;  1NR4 A;  4JI2 H;  4FU0 A;  4WFN 3;  4RWS C;  1VQ7 A;  1CZW A;  1RHP A;  3P75 A;  2QDL A;  2QYZ A;  3A5U A;  4B3M H;  2YV5 A;  2R92 A;  1GUT A;  5M3M H;  2B2Y C;  2BCO A;  2JA7 G;  1L1O C;  5KFH A;  4POF A;  3LX0 A;  2A68 C;  3DHQ A;  3PO2 G;  1ZYR D;  1CUK A;  2YRX A;  4A3D B;  3NTK A;  3CHB D;  2OLS A;  5LMN Q;  3AU7 A;  2LXJ A;  1EY4 A;  1J5E Q;  4TV9 F;  4C2M B;  3J7A K;  2R8J A;  2A19 A;  4GLV B;  5A2Q W;  3PIO 3;  3PVX A;  3CF5 A;  3GD7 A;  3FPU B;  1HNW L;  1W6K A;  3URY A;  1S40 A;  2F4V L;  1ZET A;  4MV7 A;  1F2M A;  1X3F A;  2I07 B;  1C0A A;  4RB2 C;  2KUM A;  4R4Q A;  3RZO H;  4IUT A;  4MN3 A;  4X62 H;  4DR2 L;  1FR3 A;  5KFZ A;  3C3L A;  2DIK A;  3CVZ A;  1K1Q A;  1HA6 A;  1B9N A;  4QW9 A;  1HRJ A;  2QCP X;  3AEV A;  3GIJ A;  3RLF A;  1H9K A;  1STE A;  1HTL D;  4DV0 Q;  3ULJ A;  4TVA B;  2DGY A;  3A5Z B;  5FD6 A;  1FNV A;  1CKN A;  3QZ8 A;  3G6X A;  2E5L L;  4NPS A;  4DV7 Q;  2F0L A;  3ERO A;  4B9W A;  4M9U A;  2ZTE A;  3S1M H;  2F0I A;  4C3I B;  1N36 L;  2YS6 A;  1CSP A;  4KKU A;  4YR0 A;  2W8K A;  2OCE A;  5I2Y A;  3IFD A;  1E22 A;  4DR5 H;  2B2U A;  2JA6 G;  4ZYS A;  5C0X J;  1PFS A;  1WCM A;  2RBM A;  4JI1 L;  3G6J B;  1LM0 A;  3RIZ A;  2E75 C;  3HEJ A;  4K0K L;  5KFV A;  1I3Q A;  1GHK A;  1HFN A;  1SNO A;  3E6Z X;  2MQH A;  2BH8 A;  2ZJR A;  5BN5 A;  5BR8 L;  4EX5 A;  1UE5 A;  5C3E G;  2EJG C;  3A8J E;  1TT2 A;  1JXL A;  3S2H B;  1KDB A;  1E4F T;  5I47 A;  4LFB H;  1PRT B;  3N43 B;  1XNR H;  3RN5 A;  4BY1 H;  2R8I A;  1PMR A;  3H3V C;  3FPP A;  2F4V Q;  3STB D;  4GKJ H;  2Q2H A;  1Y1V A;  1SNQ A;  2R84 A;  4BA2 I;  4X66 H;  1PZK D;  4K6L A;  3BZK A;  4LWC A;  1JE4 A;  2VUG A;  2WTF A;  4OHJ A;  4TQS A;  3MXG A;  5DNF A;  2PMZ E;  4GN5 A;  3HOX B;  2ZTC A;  3I3C A;  3SVM A;  1M90 C;  2F03 A;  4R4O A;  1KDA A;  3OSN A;  1TWC B;  4C3J G;  1EY9 A;  2H5X A;  2E5L Q;  1GUG A;  5FLX L;  3M4I A;  3NBH B;  4OL7 A;  3R5X A;  2RHS B;  1I94 L;  1EUC B;  2CQO A;  3V05 A;  1QUQ B;  5M5X H;  1BXR A;  2NVY A;  5D65 A;  4R4T A;  4AQY L;  1BBW A;  1HNX L;  3PGZ A;  5K36 G;  3W5O A;  4IJL A;  3BDL A;  2DLN A;  1DOL A;  4JI1 Q;  5CBA E;  2VPQ A;  3IRB A;  4HCE A;  1HCZ A;  3M3Y H;  1B1Z A;  5M5Y B;  3ORR A;  3HRZ C;  4DR7 Q;  4LSA A;  3A56 A;  5BR8 Q;  3GV3 A;  1EYA A;  3SK5 A;  2VZA A;  1EQQ A;  1JIH A;  2Z4H A;  1BDO A;  3I12 A;  5D1O A;  3EBE A;  3ICE A;  1BVS A;  4RMF A;  1S5D D;  4UAI A;  3WDN A;  4IUQ A;  4DK6 C;  3I56 A;  1XX8 A;  1V8Q A;  5C4X G;  2UUA L;  1DJR D;  1SCU B;  1A15 A;  1TWA A;  1K83 H;  3PIP A;  4C5A A;  5JVD F;  2FK1 A;  4RGT A;  3UDF A;  4JI2 L;  2JA7 A;  1RJT A;  1SNP A;  2F0N A;  2R92 B;  1VQ9 A;  2PQA A;  4JOI C;  4O4H F;  1KNA A;  4NB3 A;  4ZQ3 A;  3SHL A;  4A3B B;  2EVB A;  1DYQ A;  2Z6K A;  3MXP A;  3S16 H;  4U68 A;  3H6M A;  4KLK A;  2Q8T A;  3K5L A;  1VBG A;  2MCT A;  2FLN A;  5IP9 H;  3MTS A;  5KFX A;  2G9D A;  5EPJ A;  3SE0 A;  4BXX G;  4JI4 L;  4A2B A;  3BAB A;  4G3I A;  2PVP A;  1CSQ A;  1I94 Q;  2JEA I;  3P7J A;  4RU9 A;  2EJF C;  2R3Z A;  2YCH A;  5LA6 F;  1SYG A;  1IOW A;  5IIF A;  4F8M A;  4AQY Q;  1HNX Q;  3LNN A;  5KFG A;  2CWP A;  3VR6 A;  1IYJ B;  3H0G G;  1TVX A;  1ZYR C;  2KEC A;  1W2B A;  4LAA A;  2GVB A;  5CA0 F;  5FO8 B;  2IBK A;  2W8L A;  5CV8 A;  4ZKC B;  2LXK A;  5I6W A;  4LF5 H;  1CA5 A;  4ME5 A;  2RGV A;  4JG2 A;  4YHH H;  3L2P A;  2ES2 A;  3QB3 A;  1WR2 A;  4JV2 A;  1RCV D;  1IBM H;  1CKN B;  2X6L A;  1Q46 A;  3CC7 A;  2E2J B;  1G6P A;  3GTK A;  3GTO A;  4LF9 H;  2W6M A;  4Q0F A;  2UUA Q;  2K14 A;  4GNX C;  5CBE E;  1SND A;  2XWJ B;  4J15 A;  4RGN A;  4JI2 Q;  3J7Z C;  2R93 G;  4H7B A;  3CXC A;  4WJ3 M;  2N8N A;  4HJA A;  1WCM B;  2GPW A;  3I7F A;  4IJH A;  1EYG A;  1I3Q B;  1OXV A;  4L5R C;  2UVV A;  4A3F H;  3A0J A;  3W1G A;  4A3G G;  4YAK B;  3BQ2 A;  2NBF A;  3P1H A;  4IFD G;  4L1K A;  1SDF A;  3M4Y A;  1N32 H;  5KT2 A;  3FDT A;  1IBL H;  3KYH C;  1OXT A;  3KHG A;  2B8G A;  2N55 A;  3DEO A;  1WSC A;  2GVA A;  3MFI A;  4WJW A;  5IT9 E;  2R7Z G;  4BA1 I;  3PUV A;  5G3L F;  3S9W A;  1I4G A;  2VPS A;  4DR3 L;  1PTO B;  1LTL A;  1Y1V B;  1HNZ L;  3T51 B;  3IKJ A;  3KOJ A;  2WAQ G;  1DGS A;  1SEB D;  2JA6 H;  5FO9 B;  5DGB A;  1BBU A;  1EWI A;  1LT4 D;  5L9X A;  2NVX B;  5IGE A;  3GTG A;  3PUX A;  1N8R C;  3HGB A;  1MSG A;  4JI7 L;  5A2Q E;  2VA3 A;  2HHH H;  2V59 A;  1PRT F;  1Q86 C;  3HKS A;  5DEH A;  3IFT A;  4KI0 A;  1XPR A;  5JVH 3;  5CA1 F;  4DPG A;  1JT8 A;  3I90 A;  3PO3 H;  2ASL A;  2NVY B;  3BJY A;  3KJO A;  5J2T F;  1X32 A;  3SK6 A;  5KFC A;  3ITP A;  3JRX A;  1I7L A;  5FOB B;  3VR2 A;  3HOW G;  1ENA A;  1R4P B;  3MHB A;  2HIV A;  4DUZ H;  3S1Q H;  4ID6 A;  5DAU A;  1ULZ A;  1FGB D;  1K8A C;  5KT7 A;  4MV6 A;  3TDQ A;  3Q2O A;  4DR6 L;  5KND A;  5IYD H;  4HID A;  3MXN A;  5D1O B;  1ZKO A;  3F2C A;  1JWS D;  4C3J H;  1U0L A;  5JEA H;  1XYI A;  2F52 A;  4A3K G;  1T3N A;  3A74 A;  4LFC H;  4YB8 B;  5HV6 A;  1TWA B;  1I4Q A;  1C4Q A;  3DMU A;  3OOC A;  3I4N H;  4DR3 Q;  4LFB Q;  3OUU A;  4JI0 H;  1HNZ Q;  5K36 H;  2D0P A;  4MTK A;  4RHS A;  1OO9 B;  2JA7 B;  2NU8 B;  5KFI A;  1MGS A;  4K5W A;  3NK9 A;  1X3E A;  1HJP A;  1EFI D;  5IGD A;  1Y1W G;  1QVG A;  1L2Z A;  2PQA B;  3PO2 B;  3T1H H;  3L4K A;  1DCZ A;  1WD1 A;  2K52 A;  5JJZ A;  3SEB A;  3UDX A;  1W3S A;  2R6F A;  1NJI C;  1IHZ A;  4JI6 L;  1CT1 D;  5JJI A;  1YNX A;  1BGW A;  1Q1B A;  2N3S A;  2N49 A;  2BH2 A;  1S0M A;  2QIL A;  1R4Q B;  2F4I A;  1B3Q A;  5JEA J;  3MWD A;  3U9O A;  3PR5 B;  1F2L A;  4ILW A;  1I6H H;  1VAJ A;  3H0G A;  4EBC A;  2RKS A;  2EPB A;  1QVC A;  1YHQ A;  2PPB C;  2I5M X;  1VQ6 A;  5CAE B;  4QQB X;  1AN8 A;  5FO7 B;  2IP4 A;  3WO0 A;  2QF7 A;  3ND8 A;  2MP1 A;  2E2I H;  5C44 G;  3SGI A;  1VQF A;  3M9O B;  1A0I A;  4AYB E;  5M5W H;  4DV4 H;  5EDW A;  1E24 A;  4DNT B;  1HTP A;  3RNU A;  1U9R A;  1LTT D;  4JI3 H;  3J81 j;  4DR6 Q;  2YU9 H;  2EYM A;  2Z6K C;  4R4C A;  5E4X A;  2YZG A;  4X64 H;  3GTK B;  4H02 A;  3GTO B;  3KFU A;  4UCS A;  2W70 A;  4YHH L;  5ELD A;  4M1U B;  4ME6 A;  3M9M B;  4WJ4 A;  3CAM A;  1EYZ A;  2R93 A;  4UPA A;  3MWM A;  2VQE H;  4LF9 L;  1RTO A;  2EY1 A;  4Q44 A;  3FVQ A;  3A8I E;  3QWN A;  5KG6 A;  2NWG A;  4HJ5 A;  4R8U A;  3RGZ A;  4HYK A;  2R7N A;  3CCU A;  5COY A;  3GQB A;  2NYZ D;  3J80 E;  1NY4 A;  3C0F B;  2QEJ C;  4F50 A;  1X3G A;  2MJ8 A;  4TRD A;  4YR2 A;  5EAY A;  2SEB D;  3D6C A;  5E1F A;  1VQ5 A;  1EZ8 A;  4PDB A;  5KFW A;  2IPK D;  4O3S A;  1N32 L;  3E5S A;  4DV3 L;  2WAQ A;  1UEA B;  5IOC A;  2W7O A;  2NU7 B;  4O4I F;  1ZHS A;  4YQW A;  2RHQ B;  1KAW A;  3HKZ G;  4LMY A;  1N33 H;  2NU9 B;  1MSH A;  4LF4 L;  4JV5 H;  3C2P A;  4QWD A;  3GTG B;  4BBS B;  2B63 A;  5J22 A;  2B2W A;  1TXY A;  2R7M A;  5D8D A;  4DL7 A;  2C2R A;  1X6O A;  4A3G H;  3Q1K A;  1UWV A;  5KFU A;  4PMB A;  4IFD H;  4LF5 Q;  1EYD A;  2OTJ A;  4YHH Q;  3M4P A;  4OX9 L;  2WB1 A;  1EIF A;  1PTO F;  2O2L D;  4F88 A;  4RNN A;  3H4B A;  3RB3 A;  1IBM Q;  2F0O A;  1A3T A;  2RA4 A;  2SNS A;  2NVQ B;  4LF9 Q;  3I8Z A;  3M7N A;  3V6K A;  1QZH A;  4ECT A;  3FDS A;  1I4H A;  3MVV A;  4DA2 A;  3C1E A;  2ZM6 L;  1C9O A;  2E2D C;  1YHA A;  2B2Y A;  4N8F A;  3FMA A;  1L1O A;  4DR4 H;  1RD9 D;  1BR9 A;  3I2Z A;  1JOO A;  3MR6 A;  1EQT A;  3MEF A;  2NN6 H;  1KTK A;  4XYL B;  4JI8 H;  3MXN B;  1R9T H;  1VF5 C;  2WV6 D;  2L12 A;  4AH6 A;  3V2T A;  2A1A A;  3TBI B;  5I4D A;  1CS0 A;  1RJP A;  5ELO A;  3U50 C;  4FXD A;  1N32 Q;  1P8L A;  2OEO A;  1GUS A;  1B6R A;  4DV3 Q;  5KRU A;  3JRW A;  4J9O A;  2J6T A;  1CQI B;  5K2M A;  2V4Q A;  1EEI D;  2FLP A;  2C28 A;  1Y1W A;  1PZJ D;  3W2D A;  4DFA A;  5AFW A;  4IN3 A;  2N88 A;  4CDF C;  4CJ0 B;  4GC6 A;  3N41 B;  3S2D B;  1M8A A;  3HOZ H;  4OEL B;  3RR5 A;  1KJQ A;  1D5Z C;  2DPI A;  4I7A A;  4HIO A;  1RYR A;  2HJW A;  4XDX A;  4OXP A;  3T1Y H;  3RGX A;  2XIW A;  1B4O A;  5JAV A;  2Z9H A;  2R92 G;  1SE4 A;  4IAJ A;  1BF4 A;  4OX9 Q;  2Y0S G;  4UDU C;  5KG3 A;  4O42 A;  3Q8D A;  3H0G B;  3TME A;  4G7H C;  2J7Z A;  1U4P A;  2V4R A;  2JA8 G;  3BS1 A;  1O7Z A;  2HDM A;  4GKK L;  3L0O A;  1Z2N X;  2EQS A;  2F3V A;  2ZM6 Q;  5M9O A;  2LKV A;  4C1N K;  5KFT A;  3I4M B;  4O4L F;  2IW3 A;  3KF8 A;  2AQ1 B;  3I72 A;  2V9W A;  4RG1 A;  2JA5 G;  3IG0 A;  4U67 3;  1II3 A;  4ODG A;  4DAP A;  3Q8Q B;  4OIK A;  4FO2 A;  1O7Y A;  5LL6 S;  3T53 B;  1QJO A;  2AUJ D;  5KFJ A;  5D3D A;  3HB9 A;  4GLA C;  4CHT B;  1HQM C;  4HMI A;  3V4S A;  3PW4 A;  1FNW A;  4X64 L;  1I50 A;  2XCL A;  2R93 B;  4IPG A;  2XC9 A;  4MV3 A;  1S5C D;  3S15 B;  1PDQ A;  4IHJ F;  1YZ6 A;  1B8A A;  1SYF A;  4RH6 A;  3J81 c;  4A3D H;  3RAX A;  1IL2 A;  2K32 A;  3EVQ A;  3DM3 A;  4R8U B;  3HFZ B;  2AUK A;  3M7G A;  2VQE L;  2W6N A;  3AYH B;  5GON F;  4C2M H;  3F1Z A;  1I6V C;  1XTD A;  2VQD A;  2K5V A;  4A2A A;  4P73 A;  1B9M A;  2Q2T A;  5LMU H;  4DV2 H;  2BDO A;  5E7N A;  3T1H Q;  4FM9 A;  4IUR A;  4Y8V B;  2XNA C;  5DLF A;  3TQY A;  2E76 C;  4JBJ A;  4A3M H;  2OQ0 A;  2XGP A;  1JX4 A;  4X65 L;  2I80 A;  4LF7 L;  3SK8 A;  1WCM G;  2CH4 W;  2Z6B A;  2K75 A;  2AQ4 A;  1TS3 A;  1LTS D;  2FJZ A;  4KK7 A;  2YYA A;  2WAQ B;  3HKZ A;  4YCV A;  4A3I H;  1FL0 A;  3BDC A;  2K5N A;  1ONL A;  4GKK Q;  1JJG A;  5L1L A;  5JPN C;  5FLM G;  2F0T A;  4ED7 A;  2B63 B;  3ERQ A;  4DKA C;  3FMC A;  4QUC A;  1B04 A;  2K4K A;  2E2H A;  4O3Q A;  4DV4 Q;  2CKZ B;  4C3I H;  4GC7 A;  1Y1V G;  1OXU A;  3NBI A;  4JVZ A;  3Q8P B;  1S0N A;  3CW2 C;  5JPM C;  3MWY W;  2WB1 B;  4RAZ A;  4X64 Q;  2K5D A;  4XYO A;  4I7H A;  3PW5 A;  2EYJ A;  1SEI A;  1YI2 A;  3V6J A;  4J9M A;  3I70 A;  2UXB H;  1QOH A;  3MC0 B;  4LFA H;  3S17 B;  5C4Z A;  4DAM A;  1SYD A;  2NN6 I;  4HN7 A;  5KNC A;  2D2C C;  4BWS C;  5J1Z A;  2VQE Q;  1E1T A;  3HXL A;  2RCN A;  4G7O C;  3PR4 A;  2YW2 A;  1L1O B;  3G6Y A;  4JOI A;  1S3O A;  1CA6 A;  2HDL A;  2M05 A;  1PH5 A;  3F8T A;  2IX3 A;  3CQZ A;  2B2W C;  1VKZ A;  2K6A A;  2HCI A;  3K80 C;  2UXC H;  2JA9 A;  4XIG S;  3TSS A;  1E2V A;  1EU4 A;  4HJ9 A;  2VB3 X;  2D5D A;  4DV0 L;  4FF4 A;  3HOX H;  2NZO A;  1Y1W B;  3J7A V;  4NXM H;  4JI5 L;  1PLF A;  1Z2P X;  4J9N A;  1BOS A;  4DV7 L;  4BY7 H;  1TWC H;  1HZC A;  4KHP L;  4CC5 A;  4WRD A;  2ZJQ A;  3OMG A;  2AWN A;  4B3S H;  1RK5 A;  5KFS A;  4HQ6 A;  1ZXT A;  1PH9 A;  1W96 A;  4JYA H;  1AE2 A;  4QIW A;  1X54 A;  4PMW A;  1M1K C;  3IL8 A;  4U7C A;  5JUM A;  2JP1 A;  3B6Y A;  2Y0S A;  4ED6 A;  5IT9 W;  3WWV A;  4ZQI A;  1A3U A;  5DG8 A;  1GD7 A;  2FB9 A;  2W71 A;  2KCN A;  2PZU A;  5M5Y H;  3CCV A;  2BQ3 A;  4YJ3 F;  4NLG A;  3UE0 A;  3R5F A;  1CKM A;  3G71 A;  5C44 B;  4GNX A;  3KLR A;  1SMX A;  3S24 A;  4CBV A;  1Q3L A;  1CM9 A;  1C7Y A;  2K01 A;  1RIP A;  2EJM A;  1VQ4 A;  2FMC A;  3TIG A;  4ECS A;  5JVG 3;  4B3R H;  2KEE A;  5ELC A;  2JA5 A;  4F4X A;  3KF8 B;  3X3N A;  5CV4 A;  1HFG A;  1YBY A;  2JK8 A;  1HA5 A;  4YWK A;  5DGA A;  4DR4 Q;  4Q8F A;  5FJ8 H;  2R92 H;  4EQO A;  2L0C A;  4O3P A;  3NP8 A;  5IGC A;  4UP7 A;  1WI5 A;  4RAU C;  4JI8 Q;  3ZYY X;  1BNZ A;  1B44 D;  2XRQ D;  3QIA A;  1I50 B;  4A3B H;  1NBW A;  1JR0 D;  4JI5 Q;  1CQV A;  4EGV A;  4O2D A;  2IX1 A;  2QKI C;  1AUV A;  4KHP Q;  1I4R A;  2YTV A;  3K0Y A;  3QFF A;  4PWQ A;  1TY0 A;  3VMM A;  5IYB G;  1N9W A;  4KHV A;  4FF1 A;  5LYJ F;  1X65 A;  1RJR A;  4TUY F;  3VPD A;  1VQJ A;  1X9N A;  3ERS X;  4R1J A;  3GV5 B;  2K7V A;  4QW8 A;  1DM0 B;  4MA5 A;  4JC0 A;  2JN4 A;  1DIK A;  4QWA A;  1YIJ A;  1AN7 A;  4MTE A;  1JOK A;  2PYK A;  2GLT A;  1EY6 A;  3BYT B;  3EIV A;  2MGS A;  3E0E A;  4DV2 L;  3T1Y Q;  1NUC A;  4DR7 L;  2RDH A;  2Q2U A;  1PVO A;  2MNA A;  5KG4 A;  4S3S A;  5F9L A;  3HKZ B;  1X56 A;  3IN5 A;  3GTM H;  4XYM B;  2FXQ A;  2VUM G;  3MJF A;  4J1M A;  1EU3 A;  2M00 A;  4WBN F;  1JB7 A;  2J0T D;  3HOV B;  4DV5 H;  4QF4 A;  2E2J H;  2RCF A;  1WFQ A;  1TS4 A;  3GTL H;  1PA6 A;  4HSV A;  4IR1 A;  4PQX A;  2E2H B;  2J6S A;  1Q8K A;  1KQS A;  4FP5 D;  3J81 W;  1D7Q A;  3RAQ A;  2BDN A;  3HBL A;  2VQF H;  3MZ5 A;  1GXD C;  5ISR A;  1JDB B;  1PFM A;  3A54 A;  1E1O A;  3EA6 A;  4A3E G;  5H80 A;  4O3R A;  4LUZ A;  1TY2 A;  1XMO H;  3GO5 A;  4BBS G;  3KUP A;  1GSH A;  2YTY A;  1I3Q H;  2XN9 C;  3J81 i;  2RDF A;  3E3X A;  1EOV A;  4ZUI A;  3K5N A;  1CE8 A;  2R7L A;  2ICI A;  4GOP C;  1QZG A;  2W6Z A;  1GUW A;  5KG7 A;  5D14 A;  4TKO B;  4Q45 A;  3KAK A;  1TWF A;  3S1N B;  2FLL A;  1Q82 C;  1Z47 A;  1B2T A;  4MAM A;  3R23 A;  2R7F A;  1HR0 L;  2XIG A;  5FLX c;  1SNC A;  4A93 H;  2L55 A;  2I5H A;  1T5E A;  4A3J B;  3WNZ A;  1UAP A;  3CQZ B;  3HOY H;  4IAL A;  4OO1 G;  4YIJ A;  4BBR G;  1MIU A;  1PTO H;  4DV2 Q;  2BR0 A;  5LMU Q;  5H1S E;  2NVT H;  3VR4 A;  5I6Y A;  1PK8 A;  2E8G A;  4R8N A;  3D8G A;  1I4X A;  2JXM B;  5JJK A;  1E4E A;  3TIN A;  3VYS A;  3G4S A;  2C2D A;  5M3F B;  3NGD A;  2GA4 B;  1D1K A;  4DGZ A;  4ED0 A;  2F0W A;  2HGS A;  1WOC A;  5COR A;  2PZW A;  5IGG A;  5FK9 C;  2PMZ A;  3J80 W;  1XWE A;  2Q8R E;  4ETS A;  2CW0 D;  3OTO H;  3GIM A;  1DD2 A;  4DL3 A;  1PYB A;  4K5V A;  4CKE A;  5KFB A;  1KC7 A;  5KG1 A;  1UUP A;  3GTP A;  2JEB I;  2R8H A;  2DUD A;  3R2I A;  1IW7 D;  1EZ6 A;  2NZH A;  5JOB A;  5JVL A;  4QIW B;  1XMQ H;  3KBX A;  4MV1 A;  2XSC A;  2Y0S B;  3J80 i;  3I91 A;  4IWY A;  4P2C B;  3CC2 A;  5IYC H;  3BDO A;  2F1M A;  4B3M L;  3RLN A;  2A6H D;  3EFX D;  4X3U A;  3RUZ A;  4JYA L;  3GTJ A;  1WTR A;  2PW5 A;  1ML0 D;  3M4Q A;  4LF8 H;  2UXD H;  2JA8 B;  5JH7 F;  3K8A A;  4QUF A;  4OWW B;  3QR8 A;  4GNX B;  2IA6 A;  1MI2 A;  2OF1 A;  1AEX A;  2N78 A;  4HNT A;  2HIX A;  1N56 A;  1S72 A;  1YJ9 A;  4MTD A;  2EE1 A;  1HR0 Q;  4DV6 H;  1S0O A;  2JA5 B;  2R82 A;  1IKM A;  4UP8 A;  1MJE A;  3T4A C;  3SE7 A;  3K6O A;  4NKL A;  2JA7 H;  2RDG A;  2LS0 1;  3L7Z C;  4UY8 C;  4TQR A;  3PO2 H;  2RSO A;  5EJW A;  1QNU A;  3F2U A;  4X62 L;  4DAV A;  2UXC Q;  3S1M B;  3MXU A;  4ALP A;  3I4M G;  1RJQ A;  1J6Q A;  4DF7 A;  1SN8 A;  2DN8 A;  1NSN S;  1ET9 A;  1SXT A;  4LF6 H;  3W3A A;  2F3I A;  3D4R A;  1SFO H;  2RF4 A;  2Z1C A;  1D5X C;  3FKI A;  4RFB A;  2F0G A;  2OQK A;  3MWE A;  3RN2 A;  1VQH A;  5DLQ E;  5JQW A;  2JEI A;  3PUW A;  3VPC A;  2NB0 A;  4B3M Q;  3TEH B;  4GN4 B;  4JYA Q;  5LXT F;  1RDP D;  2F0S A;  4MIU A;  3M85 A;  4DR5 L;  5KYI A;  1STY A;  3PQI A;  4HNV A;  5EWG A;  4DV1 H;  3MA2 B;  4DK0 A;  4BY1 B;  3CU7 A;  5EOY A;  2UU9 H;  1KHI A;  3GLK A;  4H44 C;  2VUM A;  3D4D A;  2JYO A;  3T56 B;  4OWX B;  3AQQ A;  4G57 A;  4MV4 A;  3GTK H;  2W9C A;  3UE1 A;  1YNJ D;  2K5H A;  3GTO H;  4DR1 H;  1E0B A;  1E7Z A;  2FE3 A;  4LFB L;  3H09 A;  3KLS A;  1XNR L;  3D3R A;  3GID A;  3RZD B;  5J3B A;  3GV7 B;  4B3R Q;  1K0R A;  1V4Y A;  3PUZ A;  4M8A A;  4GKJ L;  4RGO S;  2AQ3 B;  2OT2 A;  2ZDG A;  5KT3 A;  1BCP D;  4TQU S;  3GQC A;  5KFP A;  3F8N A;  2R61 A;  4X62 Q;  2B63 G;  2UVU A;  4X66 L;  3MR2 A;  4ED1 A;  5I9P A;  2YS7 A;  5M5X B;  1SE2 A;  5KKN B;  1CTM A;  1Q12 A;  4I50 F;  2G9H D;  3GV6 A;  2VOB A;  3K7A B;  5C3E H;  2ATL A;  1L2F A;  5IGB A;  3NWS A;  2Q8I B;  3PZP A;  1QB5 D;  3K5H A;  3STB C;  4RB3 C;  1TWF B;  1WJJ A;  2EZV A;  2LFN A;  2ATW A;  1GYF A;  4R4I A;  2XWB B;  2C00 A;  2WB1 G;  4XXE A;  4GLX A;  4ZOL F;  1EUD B;  1Y8N B;  3L9A X;  3Q8S B;  2CQY A;  1Q8I A;  1Y8P B;  1S5F D;  1EZ1 A;  4LH7 A;  1NR2 A;  1YNN D;  2GN5 A;  1EUJ A;  4DR5 Q;  1K0S A;  1JB3 A;  4UCT A;  1GOZ A;  3LGJ A;  4DXG A;  4O1N A;  3K59 A;  1E4E B;  1VDZ A;  2B39 A;  4JBM A;  4BBS H;  1A9X A;  2QW7 A;  3CPF A;  2FPG B;  2QK4 A;  3PSI A;  3VYU A;  2HT1 A;  1LTB D;  1TR5 A;  4J8Q A;  3NQI A;  2BE5 D;  2PMZ B;  4OEM B;  1HQR D;  3NQT A;  5DG7 A;  2DPJ A;  4OGQ C;  4ZK9 B;  3CCR A;  4HIM A;  4O3O A;  3DLL A;  3NUC A;  1S5B D;  1XNR Q;  3S16 B;  3GTP B;  2O5J C;  1ICF B;  5CV5 A;  2F0P A;  2NVQ H;  4N9P A;  3RUP A;  1KAA A;  2WDT A;  4EQ5 A;  4ZRZ A;  5K5P A;  4ZI7 F;  4GKJ Q;  3CCM A;  4DL4 A;  5C5M A;  3GTJ B;  4CC6 A;  3J7A 5;  4X66 Q;  3FRP B;  5EPK A;  4DNI A;  5KFF A;  1RKN A;  2FPI B;  2CW0 C;  5CV7 A;  4YCU A;  5IP7 G;  3RB6 A;  3J81 E;  5DQI A;  1O75 A;  5A35 A;  5DM6 3;  1JKJ B;  5IWA H;  2EY5 A;  1UNS A;  2E2I A;  1KD1 C;  5C4X H;  1A63 A;  2L5T A;  4IUU A;  4Q5V A;  3SI8 A;  2A6H C;  1YJN A;  2PO4 A;  5HUR A;  1DZ1 A;  3GIK A;  5CYU A;  2I8C A;  1VQA A;  4FF2 A;  2A6E D;  3S2D H;  1VMC A;  4PV1 C;  2R7D A;  2UVW A;  2IWH A;  1ASY A;  2EY6 A;  3V96 A;  3CRL C;  4BXX H;  3EPI A;  4HMJ A;  1K8O A;  3D4W A;  1JWM D;  2XD4 A;  2KSW A;  3M4O H;  2AMC B;  1IBK H;  4LF5 L;  1V51 A;  2HVQ A;  4QL5 A;  4XTC S;  4JV0 A;  1VF7 A;  2ZXO A;  3HOU G;  3CCS A;  1IBM L;  1AZP A;  4C3H G;  3FKI B;  4DXF A;  4MZ9 A;  5C3X A;  4LF6 L;  1F77 A;  3H0G H;  3H94 A;  3OTO Q;  5L1I A;  3OYY A;  3Q0A A;  4L5S A;  3PF4 A;  1A3V A;  1W93 A;  4RUC A;  3K81 C;  3GIQ A;  5KYL A;  4A3C G;  4LJZ C;  3ETH A;  1D1I A;  4DK3 C;  3NXW A;  1BXT A;  1KL9 A;  2EXZ A;  4DU9 A;  2WAQ E;  5E4W C;  4DNR B;  2VUM B;  3TZU A;  1CQJ B;  1TU2 B;  3H40 A;  2FIN B;  4N8X 1;  2W9C B;  4DUY H;  3V4Z A;  3PCO B;  1IBL L;  1RYS A;  1STA A;  1UE1 A;  3L3O C;  4A3L G;  2PN1 A;  2XVS A;  4ZAI A;  3BQ1 A;  1N48 A;  4K8J A;  2IY5 B;  4A75 A;  3LML A;  4A3E B;  2R93 H;  4KTA A;  2BQR A;  4DR1 L;  3E9I A;  1JOQ A;  3JAM c;  3S15 H;  1EIH A;  1ILQ A;  1VQD A;  2O03 A;  3E5N A;  3F2D A;  3LWE A;  4Q0Y A;  1K3B C;  3BQ0 A;  2FPP B;  2W57 A;  3BU2 A;  3WOE A;  3HOV G;  3PO3 B;  1WD0 A;  2VL6 A;  4L63 B;  4NXN H;  4H13 C;  3R3O A;  3PV0 A;  1MD2 D;  3R8B A;  4ABN A;  4CDC C;  1YNJ C;  1KJJ A;  1Q7Y C;  5C4J B;  3U9S A;  2A73 B;  1LLR D;  1IYU A;  2HHH L;  4QCL A;  2TMP A;  4B3T H;  4RB0 A;  2JSO A;  3PW7 A;  2ICE C;  2IHF A;  2R7Z H;  1KJ8 A;  1KNE A;  2TSS A;  3QOJ A;  4P72 A;  4EQP A;  4YWL A;  4LF6 Q;  4EGJ A;  4BBR B;  1BCP C;  4EEQ A;  2NTT A;  4ECV A;  2V1C C;  2W7P A;  2IJ0 A;  4AIM A;  3MAQ A;  5KFY A;  3TRZ A;  2Z0S A;  3JC6 6;  2RDI A;  1LO5 D;  3U4V A;  2DNC A;  1JCK B;  4DUZ L;  3GTQ A;  4DV1 Q;  4A3J G;  1PXU A;  3I4N B;  2RDJ A;  5LMN H;  4UCO A;  3N6R A;  4IFD J;  3RV3 A;  2AGO A;  1OTC A;  1J5E H;  2UU9 Q;  2JEJ A;  5IT9 L;  1TKW B;  1IBL Q;  4IR9 A;  1B53 A;  3NSW A;  5EBD A;  2Z8L A;  1YNN C;  3EQL C;  4HSP A;  3TN2 A;  1FJG H;  1G6Z A;  1SJH D;  2A74 C;  1NCV A;  2QA4 A;  5M3F G;  3CP0 A;  4LFC L;  4DR1 Q;  5LL6 b;  3OUZ A;  1K3R A;  3PF5 A;  4JI0 L;  1HZ9 A;  3HOW H;  2LSS A;  2I5L X;  2B3G A;  4JBK A;  5A2Q L;  3S14 B;  4Y7N H;  2I87 A;  1UE6 A;  3UDG A;  4RB1 A;  2BE5 C;  2PW7 A;  3T1H L;  5KG2 A;  4R8I A;  3RJ0 A;  4ECY A;  4A76 A;  4J0M A;  2HHH Q;  4DN4 M;  3JZI A;  1JC7 A;  4QJF A;  4ME3 A;  2EXD A;  4N9T A;  1L0W A;  1YEZ A;  2AGP A;  2C35 B;  2E2I B;  1GO3 E;  1H9M A;  2F0E A;  5FKA C;  4A3K H;  2WIN B;  1VQN A;  3KHH A;  5M5W B;  4EQN A;  3HG9 A;  3EJI A;  1F9S A;  4RNM A;  2F0U A;  1UC8 A;  2PQE A;  1Y1W H;  3AFP A;  5GAH C;  4V19 0;  4YP3 A;  1G51 A;  3BA8 A;  4EYH B;  5C0X G;  2ID0 A;  5KG5 A;  4EGQ A;  1SE3 A;  4QB4 A;  2YZN A;  2KED A;  1V1P A;  2MPM A;  4DUZ Q;  4DV4 L;  1YVC A;  1F2Y A;  1VCI A;  2ASB A;  5C8Y F;  4CKB A;  3CPW A;  1UC9 A;  1VQL A;  4JI3 L;  1LTI D;  3EYY A;  3R5H A;  3J7Y W;  3M9N B;  2QDB A;  1KJI A;  4I65 A;  3K58 A;  1HNW H;  1EEF D;  2IX0 A;  2F4V H;  4C2M A;  2LMC B;  3TP8 A;  4LFC Q;  1JJC B;  2A6E C;  3QO2 A;  2VNU D;  3H20 A;  4LMQ D;  4JI0 Q;  4ECR A;  4ZLT F;  5C44 H;  4DR2 H;  2HCC A;  1SYX B;  4KKT A;  1TWG A;  1W6J A;  5IE8 A;  4CKC A;  2PI2 A;  4KV6 A;  3HKZ E;  4MNO A;  1HZB A;  1AUX A;  1RL2 A;  2R7K A;  5LP6 F;  4WD3 A;  1KLG D;  4KJN A;  4IPC A;  4CJ2 C;  1TWH A;  2E5L H;  3QOL A;  1HXY D;  1C48 A;  2FHT A;  5ELB A;  4GOP A;  4PNY A;  5EWE A;  2PNR C;  1N36 H;  2MUY A;  5FLX E;  1I50 H;  2R86 A;  1K9M C;  1LAC A;  2KOL A;  1B3A A;  4BY1 G;  4IFD I;  1HZA A;  4KN4 C;  4DL5 A;  4JI1 H;  2K03 A;  3KAJ A;  3H3V H;  4K0K H;  1S5E D;  3T5J A;  1N33 L;  1EY0 A;  3T16 A;  1MJC A;  2KA7 A;  2NUC A;  4QWE A;  2F0D A;  4JV5 L;  4EBD A;  1U4L A;  1D8L A;  5E3F A;  4PZ6 A;  1XXG A;  2JEG A;  3R93 A;  4JI3 Q;  1A2U A;  4JBW A;  2O4X A;  1PX2 A;  2KQ3 A;  4YCW A;  3TZD A;  5GAD C;  4FXG C;  1EY8 A;  5G3L D;  4P74 A;  2FMA A;  1V1O A;  4RAY A;  4A3L H;  4YBZ B;  2X6G A;  2L15 A;  3OMC A;  1DOK A;  1EQR A;  2L1B A;  1PYS B;  1O80 A;  3Q22 A;  2MO1 A;  4V0B A;  1ENC A;  3TS2 A;  3S2H H;  3J80 L;  2VW9 A;  1ZEQ X;  3OSP A;  4HNU A;  3TQ1 A;  1NE3 A;  3KXY T;  2JE6 I;  4DAY A;  3MEH A;  1PRT D;  1AE3 A;  2KCT A;  4RNO A;  4LUO A;  3DM1 A;  3GTQ B;  2D62 A;  5DQG A;  4OIJ A;  2E2H H;  3JAM W;  5L1J A;  2FP4 B;  3JSL A;  1HHV A;  4DR4 L;  3C1F A;  3OIQ A;  3N8D A;  1I94 H;  4JI8 L;  4IPD A;  1VMP A;  3BYY B;  1ROD A;  1MHW C;  3PN1 A;  1HNX H;  1TQO A;  3I4L A;  2F3W A;  1M0T A;  1ET6 A;  4QIW E;  3JAM i;  2W6P A;  5T14 A;  1QIL A;  4IWX A;  2UVR A;  1CI3 M;  2Y0S E;  1FVI A;  2F0F A;  1WH2 A;  1IKL A;  2WKC A;  4KD3 A;  1M0W A;  5LL6 X;  4FBU A;  1LT6 D;  5FPR A;  2B2V C;  4C1N I;  1N33 Q;  1QNK A;  3RB0 A;  2PCF B;  3RB4 A;  1Y8O B;  1K28 A;  3S1N H;  4JV5 Q;  3S1R B;  2H1E A;  4QMG A;  3N6X A;  4OWT B;  3M9B A;  1LUZ A;  5C4H A;  3OHA A;  5IP9 G;  4U6P A;  4NXN Q;  3CQZ H;  3N44 B;  2EYP A;  3NEM A;  3T1Y L;  1JMC A;  3KHR A;  5EPL A;  2ZT9 C;  4PMC A;  3ZJY C;  1C30 A;  4KHZ A;  2Z4I A;  1FGU A;  1QG7 A;  2CQA A;  3K57 A;  1H9J A;  1ASZ A;  2ZXR A;  1GVP A;  4IUP A;  1HPC A;  5M3F H;  1H95 A;  3Q24 A;  3VA7 A;  3OW7 A;  3A8K E;  2UUB H;  2RSN A;  4BWG B;  1B7Y B;  1SE8 A;  1EWC A;  1V1P B;  1LAB A;  2O5I C;  2ASJ A;  2R6G A;  4JI4 H;  4APM A;  2WII B;  1G91 A;  5TSS A;  3ULP A;  5KX5 F;  3RBD A;  3HOU B;  2FMM A;  4ED2 A;  4C3H B;  1PH6 A;  4DLK A;  4YY3 H;  3N42 B;  4YR3 A;  1TS2 A;  4ED3 A;  2JA8 H;  2CW7 A;  3E9H A;  1QVF A;  1STG A;  2WKD A;  3VA5 A;  3TS0 A;  4I55 F;  1FJG Q;  1LT5 D;  1NAP A;  2CZG A;  4R9W A;  1GUN A;  4A3M B;  4POG A;  1AW7 A;  1TWG B;  3CMA A;  1AFP A;  3K3V A;  3L4J A;  5C0X H;  3U4Z A;  4J9P A;  2J6U A;  3TP6 A;  5L37 A;  2XRS D;  4IQZ A;  5AJ3 L;  2PBZ A;  3FKI G;  4OON A;  4RCO A;  2JA5 H;  2K1B A;  4UFZ A;  1DXM A;  1CKO A;  2DJG C;  4A3F G;  1KLU D;  1TWH B;  2X69 A;  5LMU L;  4A3I B;  1XPU A;  3GII A;  1UNN C;  4P71 A;  3GTM A;  2W6O A;  3PIO A;  2HD3 A;  3BZC A;  3FEW X;  4GZY C;  4HCS A;  3H3V I;  3OWF A;  3ER0 A;  4F4Y A;  2AGQ A;  3KDF A;  4GOP B;  1PH1 A;  1C8C A;  4X3K A;  3RLO A;  1AP0 A;  4Q8E A;  5LOV F;  3GTL A;  4JK1 C;  2ALZ A;  1HUM A;  5IY0 A;  4F87 A;  1BKB A;  5KNB A;  1I7N A;  1SYC A;  1PFB A;  3FHW A;  2C22 A;  4IUV A;  4X6A H;  2QEX A;  3EN2 A;  4DL6 A;  1WTW A;  4TV8 F;  1CHQ D;  1X3Q A;  3K0X A;  1VQE A;  4O2B F;  1ZHQ A;  5KFR A;  1JOR A;  1F9R A;  4CDE C;  1D2B A;  1MZB A;  3DWA A;  4M7E A;  1WCM H;  1SR3 A;  3GIP A;  4FBT A;  3A7L A;  2XCA A;  4XQQ A;  2F0H A;  2B2T C;  3NHH A;  4K5X A;  4DR3 H;  3PO3 G;  1HNZ H;  1Q81 C;  1HNW Q;  5KFE A;  4F4W A;  3CD6 A;  2UXB L;  2F0K A;  4LFA L;  1KC8 C;  5FLM H;  1A6X A;  3UQ8 A;  1WYD A;  2EYH A;  1WVL A;  3G6V A;  3RTX A;  1FD7 D;  4DAY B;  5AJ3 Q;  4JI7 H;  3AMU A;  4DR2 Q;  1T5X D;  3GV8 B;  4XYQ A;  4CJ1 B;  1AZQ A;  1DV2 A;  2QGQ A;  1Y1V H;  2WE6 A;  4FVM A;  3RZD H;  3AFQ A;  1DOM A;  2IHE A;  3PIP 3;  1PTO D;  3WO1 A;  5C5L A;  2E74 C;  1G2S A;  5IYD G;  5KG0 A;  3BG5 A;  5IYZ F;  4BY7 B;  2NVX H;  5BN3 A;  4RGM A;  5CV6 A;  3H4D A;  2UXC L;  3W1B A;  5JEA G;  3A7A B;  5EQ0 A;  1K83 A;  1BQQ T;  4A4I A;  4X3T A;  1BNC A;  3NTI A;  3JSN A;  1N36 Q;  3I4N G;  1PRT C;  3G8C A;  3K7A H;  5EKI A;  5M3M B;  3T5L A;  2ZJP A;  4NXM L;  3NE5 B;  5HGT A;  1IYV A;  5J2U F;  1K8M A;  2DJF C;  3D0F A;  4RA8 A;  5D3I B;  1TWF H;  1MBY A;  2NVY H;  4R7R A;  4FXK C;  3DWQ A;  3NWT A;  4K0K Q;  1KBL A;  4DR6 H;  1VQM A;  1STH A;  3P20 A;  4B3S L;  1SMY D;  5LMN W;  4K14 A;  2VB2 X;  2XTI A;  1Y69 U;  1RF2 D;  2L11 A;  4UCV A;  2IT1 A;  4EBE A;  1E2W A;  1VBH A;  2C9O A;  4XQJ A;  1BBX C;  4FS2 A;  2YTX A;  1G8Z D;  3EPG A;  4C5B A;  1VQG A;  2ZDH A;  2UXB Q;  3K5M A;  4LFA Q;  3RZO B;  4QWC A;  2A69 D;  5I9O A;  3G6E A;  2L4N A;  2NUA B;  2EYL A;  5T1G A;  4CGY B;  1KJ9 A;  1EIG A;  3VPB A;  5L1K A;  1CK1 A;  4MV9 A;  2UUB L;  1TWA H;  4RKB A;  4JI6 H;  2KCM A;  4G7Z C;  1OXX K;  4NP5 A;  3UI2 A;  4B3R L;  1UE7 A;  3GTP H;  2F0J A;  3BVG A;  1B70 B;  1KRT A;  3K5I A;  3LWB A;  2CH4 A;  4ZCK A;  4JW0 A;  3K7U C;  1VQ8 A;  4C56 C;  1PH8 A;  4ECU A;  4RHR A;  1P16 A;  5C0X I;  1SJE D;  3KF6 A;  3GTJ H;  2M9V A;  3RFC A;  2Q2I A;  2ASD A;  1SFO A;  1ESF A;  2GPS A;  5HGQ A;  1SAP A;  4YY3 L;  3JAM E;  4NXM Q;  1T94 A;  1Z7T A;  4EFB A;  4UHV A;  1TII D;  3VYR A;  3GDE A;  4L5T A;  2V4D A;  4K8I A;  1XPO A;  4ECQ A;  2JEF A;  1LTR D;  4ED8 A;  1IXR A;  1HUN A;  4CDD C;  4PZ8 A;  3BA9 A;  2NZ1 D;  3KTM A;  4ZKB B;  4B3S Q;  4MA0 A;  3CCJ A;  4HIK A;  2P0A A;  1EFW A;  3GTM B;  3KBG A;  2HVS A;  1U4M A;  1M7J A;  4FDB A;  1IZ6 A;  3KDF B;  1GJX A;  3CME A;  3ND9 A;  1B33 N;  1FYC A;  4F4Z A;  1H9R A;  3GTL B;  1V43 A;  1OWT A;  4KY5 A;  3GP7 A;  4AYB G;  4KMU C;  1M4V A;  1I5F A;  2A8V A;  2NU6 B;  2C2E A;  2JA6 A;  5BPH A;  1NMF A;  5IYB H;  4YWM A;  3CCL A;  4XQN A;  4GS3 A;  2UUC H;  1O78 A;  1JQY D;  2UUB Q;  3U58 A;  4DV5 L;  1Q90 A;  1LTG D;  3FKI H;  2V5A A;  5FPO A;  1GGO A;  2VY3 A;  1NNX A;  4IPH A;  3D6W A;  3BVM A;  3KHL A;  1YIT A;  4JI4 Q;  1BUV T;  5C1P A;  1EHI A;  2VQF L;  5CGK A;  4LK1 C;  2L9H A;  3WOF A;  4IOC A;  2SNM A;  4DV3 H;  1GKH A;  4ECZ A;  3UFX B;  2W9B A;  1XMO L;  1I6U A;  3ORQ A;  1PZI D;  1M6V A;  5EWF A;  4A93 B;  4TSS A;  2CHB D;  4YY3 Q;  2LY7 A;  1WTX A;  2VUM H;  3KLW A;  2NTS A;  3HOY B;  1VQC A;  1K73 C;  4LF4 H;  5HBR B;  1G2T A;  2OTL A;  2I46 A;  1K1S A;  2NVT B;  3HP3 A;  2HVR A;  1N34 H;  1A8V A;  3M3Y B;  1U5K A;  4K6D A;  1X55 A;  4IRD A;  5NUC A;  2B2U C;  1OXS C;  3V6H A;  2CWA A;  4A3E H;  4F7X A;  4EG0 A;  1KAB A;  3ULL A;  2NN6 G;  1JJ2 A;  4ECW A;  4OX9 H;  1EY7 A;  4K2K A;  4IOA A;  1G29 1;  2B29 A;  3GTG H;  2JJQ A;  4HJ7 A;  4UCU A;  3OHB A;  2PZT A;  1V9P A;  4E4T A;  1VQI A;  1K83 B;  1L0Y B;  4J6H A;  3ETJ A;  3LP8 A;  1H9S A;  5CR3 A;  3K5O A;  1S10 A;  3VR5 A;  1ENF A;  4XT1 B;  5BMV F;  3PW2 A;  1EL0 A;  5C4J H;  1FKA H;  5ELE A;  2VXW A;  2ZM6 H;  2EOT A;  4NMZ A;  3PUY A;  5GAE C;  3HOZ G;  4DV5 Q;  1EY5 A;  1PTO C;  3OTO L;  5KFM A;  4OO1 H;  4I7Z C;  4K2L A;  1PH7 A;  5HY6 A;  4BBR H;  3CKI B;  3H15 A;  2VQF Q;  1EYC A;  2SDF A;  2A5H A;  3BJU A;  3HS0 C;  3QJY A;  1RTN A;  1XMQ L;  5FLX W;  1S97 A;  1NMG A;  1SYE A;  2F0Q A;  2JQO A;  3D31 A;  1XMO Q;  1GSO A;  2DNE A;  3J7A F;  5KEE A;  3OHX C;  2XGT A;  1HR0 W;  2YL2 A;  2YYZ A;  3RD4 A;  2AKW B;  4XT3 B;  1WTV A;  4LF8 L;  5BN4 A;  2UXD L;  4J9R A;  4KKS A;  3F2B A;  1MKH A;  1ESR A;  3I73 A;  1IW7 C;  4J9Q A;  1TA8 A;  2FFK B;  3RV4 A;  3OIP A;  2YRW A;  4KD4 A;  2AQ2 B;  1CQF A;  1SMY C;  4PZ7 A;  1NTG A;  2K05 A;  1JE5 A;  2XCP A;  2FJ2 A;  4DV6 L;  4JI7 Q;  2YU9 A;  1FNU A;  1UEB A;  4RZR A;  1YJW A;  3Q8R B;  2KCC A;  2EY2 A;  2WAC A;  2AU0 A;  4APV A;  3KF6 B;  2RVL A;  4J9S A;  4GN3 B;  3VDY A;  1GLV A;  3I55 A;  1F9P A;  1SFO B;  3CC4 A;  3T13 A;  1EWH A;  3S14 H;  2A69 C;  5CC4 A;  1QCB D;  2D0O A;  2M2L A;  1VQB A;  4GKK H;  1SLJ A;  3I4O A; 
#chains in the Genus database with same CATH homology
 4JI3 L;  4DR4 Q;  4A3D G;  2MO0 A;  5FJ8 H;  2R92 H;  1W2B A;  1XJV A;  2GVB A;  1WI5 A;  4UP7 A;  4JI8 Q;  2ASB A;  4LW1 A;  4A3B H;  2IX0 A;  1NBW A;  4LFC Q;  1JJC B;  2LXK A;  2VNU D;  4Y52 H;  4JI5 Q;  4JG2 A;  3L2P A;  4JI0 Q;  2ES2 A;  4O2D A;  5C44 H;  2IX1 A;  5GAG C;  1CKN B;  3CC7 A;  1Q46 A;  4LUV A;  2YTV A;  1Y14 B;  4A3M G;  5GQO A;  1XMQ Q;  4KHP Q;  5IYB G;  1N9W A;  1G6P A;  1X65 A;  5IE8 A;  2PI2 A;  1VQJ A;  1X9N A;  3ERS X;  4R1J A;  4IO9 A;  2UUA Q;  3HKZ E;  4MNO A;  1HZB A;  2K14 A;  1RL2 A;  4JC0 A;  4DV1 L;  4GNX C;  2CCZ A;  3I4M H;  4LF8 Q;  1YIJ A;  4J15 A;  2UXD Q;  4JI2 Q;  4IPC A;  3J7Z C;  2R93 G;  1PH3 A;  4A3I G;  2UU9 L;  3CXC A;  1SRO A;  3EIV A;  2N8N A;  3E0E A;  4DV2 L;  4HJA A;  3T1Y Q;  4WJ3 M;  2WFW A;  2BA0 A;  3I7F A;  2EIF A;  4GOP A;  4IJH A;  4DR7 L;  1EYG A;  2KEN A;  1OXV A;  2Q2U A;  4L5R C;  1PVO A;  4DV6 Q;  2MNA A;  1I50 H;  4A3F H;  1VQP A;  1K9M C;  3A0J A;  3W1G A;  4BY1 G;  2UUC L;  4A3G G;  4IFD I;  1HZA A;  1LYL A;  1X56 A;  3GTM H;  2WB1 E;  4IFD G;  2FXQ A;  2VUM G;  4JI6 Q;  1Q1E A;  2PNH A;  3KYH C;  1OXT A;  1JB7 A;  3H3V H;  2E2J H;  1N33 L;  2GVA A;  1WFQ A;  1MJC A;  3GTL H;  1PA6 A;  4JV5 L;  2KHJ A;  4UP9 A;  4BA1 I;  1Q8K A;  2R7Z G;  3PUV A;  1KQS A;  1D8L A;  4PZ6 A;  1D7Q A;  4DR3 L;  1LTL A;  1HNZ L;  4JI3 Q;  4JBW A;  1E1O A;  2AHO B;  3KOJ A;  4YCW A;  2WAQ G;  5GAD C;  1DGS A;  4A3E G;  2JA6 H;  4LUZ A;  1BBU A;  1EWI A;  4P74 A;  3PUX A;  3GO5 A;  5GRO A;  1N8R C;  4BBS G;  4A3L H;  2YTY A;  1I3Q H;  2L15 A;  4JI7 L;  1EQR A;  1N34 L;  1PYS B;  3J81 i;  1AH9 A;  1EOV A;  3CCQ A;  1QZG A;  4GOP C;  1Q86 C;  2MO1 A;  3HKS A;  3TS2 A;  1PV4 A;  3S2H H;  2VW9 A;  4KI0 A;  1XPR A;  1NE3 A;  2B63 H;  4DPG A;  2JE6 I;  1Q82 C;  1JT8 A;  1Z47 A;  3PO3 H;  2R7F A;  1HR0 L;  1AE3 A;  2KCT A;  5FLX c;  4LUO A;  4OO1 I;  3KJO A;  4A93 H;  2D62 A;  2I5H A;  2E2H H;  3HOY H;  4OO1 G;  2ALY B;  3HOX G;  4BBR G;  1MIU A;  4DR4 L;  2CFM A;  5ELN A;  5LMU Q;  4DV2 Q;  5H1S E;  2NVT H;  1PHJ A;  1GM5 A;  4JI8 L;  3HOW G;  4IPD A;  2E8G A;  1VQO A;  2HIV A;  3ICE A;  4BY7 G;  3S1Q H;  5JJK A;  1Z9F A;  5IT9 c;  3G4S A;  1K8A C;  2UUC Q;  3S17 H;  4QIW E;  3JAM i;  1WOC A;  2Y0S E;  1FVI A;  4DR6 L;  4HID A;  5IYD H;  5M3M G;  3F2C A;  2K50 A;  4PG3 A;  1U0L A;  4C3J H;  1N33 Q;  2F52 A;  3S1N H;  3NEN A;  1PYB A;  4A3K G;  4JV5 Q;  3A74 A;  4LFB Q;  2JEB I;  4OWT B;  3M9B A;  4DR3 Q;  3I4N H;  2DUD A;  1LUZ A;  1HNZ Q;  2D0P A;  2NZH A;  4P75 A;  5IP9 G;  3CCE A;  4HJ8 A;  3CQZ H;  4NXN Q;  3NEM A;  3T1Y L;  1JMC A;  1X3E A;  1HJP A;  3J80 i;  1Y1W G;  1QVG A;  2PQA B;  3CC2 A;  5IYC H;  4B3M L;  3ZJY C;  3RLN A;  4KHZ A;  5IWA L;  4JYA L;  4LF4 Q;  1FGU A;  3M4Q A;  3KJP A;  1N34 Q;  1ASZ A;  2K52 A;  1GVP A;  3K8A A;  3UDX A;  1W3S A;  5M3F H;  1H95 A;  4OWW B;  1NJI C;  2I0Q A;  4JI6 L;  5JJL A;  4GNX B;  5JJI A;  1YNX A;  2N78 A;  2ZTD A;  1Q1B A;  1B7Y B;  1SE8 A;  2HIX A;  2N3S A;  2N49 A;  2BH2 A;  2WP8 J;  1S72 A;  5FJ8 G;  1YJ9 A;  1HR0 Q;  2BA1 A;  4QY7 A;  5JEA J;  1KRS A;  2R6G A;  3UDI A;  1O7I A;  4UP8 A;  1MJE A;  4A3B G;  1I6H H;  5IP7 H;  3S1R H;  1QVC A;  1YHQ A;  2I5M X;  2KHI A;  1VQ6 A;  3ULP A;  4QQB X;  4QGU A;  1T9H A;  2JA7 H;  2E2I H;  2PI2 E;  5C44 G;  1PH6 A;  1IBK L;  3SGI A;  3L7Z C;  1VQF A;  4UY8 C;  1A0I A;  4AYB E;  5M5W H;  3PO2 H;  1E24 A;  2HQL A;  2AWO A;  4X62 L;  1VQK A;  3RNU A;  2UXC Q;  2KBN A;  4ALP A;  2JA8 H;  3I4M G;  3E9H A;  3FP9 A;  3J81 j;  4DR6 Q;  2YU9 H;  1QVF A;  1KIX A;  1HH2 P;  2Z6K C;  1J6Q A;  4R4C A;  3TS0 A;  1SN8 A;  1FJG Q;  1E3P A;  4POG A;  4H02 A;  3CMA A;  3KFU A;  3U4Z A;  2F3I A;  1SFO H;  2RF4 A;  4YHH L;  5AJ3 L;  3FKI G;  3CAM A;  4OON A;  2JA5 H;  4WJ4 A;  4UPA A;  1CKO A;  2OQK A;  3NEL A;  1VQH A;  3RN2 A;  4LF9 L;  4A3F G;  5DLQ E;  5LMU L;  1XPU A;  4P71 A;  3PUW A;  4HJ5 A;  3PIO A;  4B3M Q;  3BZC A;  3TEH B;  3HOU H;  4GN4 B;  5IWA Q;  3ER0 A;  3H3V I;  4LNQ A;  3KDF A;  4C3H H;  4GOP B;  1PH1 A;  3M85 A;  4DR5 L;  4MTN A;  3RLO A;  3CCU A;  4DUY L;  1NY4 A;  2MFI A;  1KHI A;  1X3G A;  5IY0 A;  1BKB A;  4A3C H;  5EAY A;  4OWX B;  3AQQ A;  1VQ5 A;  3FHW A;  1XNQ L;  3GTK H;  1TWG H;  3UE1 A;  2OWO A;  1EIY B;  2K5H A;  3GTO H;  1KXL A;  4X6A H;  2QEX A;  1E7Z A;  3EN2 A;  1N32 L;  4LFB L;  4L5Q A;  4DV3 L;  1XNR L;  3K0X A;  1VQE A;  4NXN L;  5J3B A;  4B3R Q;  1K0R A;  2RHQ B;  1KAW A;  1TWH H;  3HKZ G;  3PUZ A;  1WCM H;  1IBK Q;  4GKJ L;  1SR3 A;  4LF4 L;  4TQU S;  3TRE A;  4B3T L;  4X62 Q;  2B63 G;  4X66 L;  3PO3 G;  1TXY A;  1SRU A;  1X6O A;  1Q81 C;  1Q12 A;  1YHB A;  4A3G H;  5C3E H;  4A93 G;  1HNW Q;  1L2F A;  1UWV A;  3HOY G;  3CD6 A;  2UXB L;  4LFA L;  3STB C;  3OW2 A;  1KC8 C;  5FLM H;  4LF5 Q;  3HOV H;  1WJJ A;  1WYD A;  2ATW A;  2OTJ A;  4DAY B;  4R4I A;  4YHH Q;  3M4P A;  5AJ3 Q;  2VS1 A;  4OX9 L;  1EIF A;  4DR2 Q;  2WB1 G;  4GLX A;  3J80 c;  1IBM Q;  4LF9 Q;  2QGQ A;  1Y1V H;  3RZD H;  3AFQ A;  2IHE A;  3M7N A;  1QZH A;  5IYD G;  5LMN L;  1A62 A;  2GN5 A;  1EUJ A;  4DR5 Q;  3LGJ A;  1J5E L;  2NVX H;  4DUY Q;  2UXC L;  3W1B A;  5JEA G;  2ZM6 L;  1C9O A;  4JBM A;  4BBS H;  1QUQ A;  1YHA A;  3CPF A;  1L1O A;  4A4I A;  3PSI A;  3I2Z A;  2HT1 A;  3MEF A;  1FJG L;  1N36 Q;  1PH2 A;  3I4N G;  3K7A H;  3MXN B;  1R9T H;  2ZJP A;  4NXM L;  1K8G A;  4JCV E;  4AH6 A;  4JYA Q;  1XNQ Q;  3D0F A;  2A1A A;  1TWF H;  4X65 Q;  3CCR A;  4HIM A;  5ELO A;  5IYC G;  3U50 C;  3DLL A;  2NVY H;  1PH4 A;  4LF7 Q;  1N32 Q;  1P8L A;  1V1Q A;  3G48 A;  4DV3 Q;  4A3J H;  1XNR Q;  4K0K Q;  1VQM A;  2NVQ H;  4B3S L;  4O0A A;  1VS0 A;  4EQ5 A;  4GKJ Q;  3CCM A;  5LMN W;  2XTI A;  3HOZ H;  2IT1 A;  3RR5 A;  4B3T Q;  3J7A 5;  4X66 Q;  4HIO A;  2YTX A;  4DNI A;  4OXP A;  1VQG A;  1VQ7 A;  4YCU A;  5IP7 G;  3A5U A;  2UXB Q;  4LFA Q;  2YV5 A;  3G6E A;  2R92 G;  5M3M H;  4BY7 H;  4KHP L;  2JA7 G;  1L1O C;  4POF A;  4OX9 Q;  1KD1 C;  2Y0S G;  5C4X H;  1A63 A;  2UUB L;  3Q8D A;  3PO2 G;  1TWA H;  1CUK A;  2KCM A;  1OXX K;  4B3R L;  1UE7 A;  3GTP H;  1B70 B;  1KRT A;  1YJN A;  2JA8 G;  3GTQ H;  5LMN Q;  1VQ8 A;  3K7U C;  1PH8 A;  2LXJ A;  1P16 A;  1VQA A;  4GKK L;  5C0X I;  3L0O A;  3KF6 A;  1J5E Q;  3S2D H;  2R7D A;  2EQS A;  3GTJ H;  2A19 A;  2ZM6 Q;  2Q2I A;  4GLV B;  1ASY A;  3CF5 A;  3GD7 A;  4BXX H;  1HNW L;  4RG1 A;  5HGQ A;  2JA5 G;  2F4V L;  1S40 A;  4YY3 L;  1X3F A;  3M4O H;  2AMC B;  1C0A A;  4NXM Q;  4LF5 L;  4QL5 A;  4R4Q A;  3RZO H;  3GDE A;  4L5T A;  1XPO A;  4XTC S;  4DR2 L;  1IXR A;  4GLA C;  3CCS A;  3HOU G;  1IBM L;  4PZ8 A;  4X64 L;  4MZ9 A;  3AEV A;  4IPG A;  3RLF A;  4LF6 L;  3OTO Q;  3H0G H;  4DV0 Q;  3OYY A;  4B3S Q;  3ULJ A;  3CCJ A;  4TVA B;  1YZ6 A;  4L5S A;  1B8A A;  2DGY A;  3J81 c;  4HIK A;  3PF4 A;  3K81 C;  1EFW A;  4A3D H;  3A5Z B;  1IL2 A;  4A3C G;  3DM3 A;  1CKN A;  4FDB A;  1IZ6 A;  3HFZ B;  3KDF B;  4DK3 C;  2VQE L;  2E5L L;  3CME A;  4NPS A;  3AYH B;  4DV7 Q;  4C2M H;  1KL9 A;  2ZTE A;  3F1Z A;  1XTD A;  1V43 A;  2K5V A;  3S1M H;  2WAQ E;  4P73 A;  2Q2T A;  3T1H Q;  5E7N A;  1N36 L;  1CSP A;  4AYB G;  2OCE A;  1I5F A;  3TQY A;  2A8V A;  4JBJ A;  4A3M H;  1E22 A;  2OQ0 A;  1NMF A;  5IYB H;  2JA6 G;  4YWM A;  4X65 L;  5C0X J;  3CCL A;  1PFS A;  4LF7 L;  4GS3 A;  1WCM G;  3PCO B;  1IBL L;  4JI1 L;  1LM0 A;  2UUB Q;  1UE1 A;  4A3L G;  2K75 A;  3U58 A;  4DV5 L;  4K0K L;  2MQH A;  2BH8 A;  3FKI H;  2ZJR A;  5BR8 L;  4A75 A;  2IY5 B;  1IYJ B;  2R93 H;  4YCV A;  2VY3 A;  4DR1 L;  3E9I A;  4EX5 A;  4A3I H;  1UE5 A;  3JAM c;  4IPH A;  3S15 H;  1VQD A;  1FL0 A;  5C3E G;  3F2D A;  1YIT A;  2K5N A;  4JI4 Q;  4GKK Q;  1JJG A;  2VQF L;  3BU2 A;  5FLM G;  4IOC A;  3HOV G;  4DKA C;  1GKH A;  2VL6 A;  2K4K A;  3RN5 A;  4BY1 H;  3PV0 A;  1XMO L;  4DV4 Q;  2F4V Q;  3STB D;  4YY3 Q;  2VUM H;  3KLW A;  2Q2H A;  1VQC A;  2CKZ B;  4C3I H;  1K73 C;  1Q7Y C;  1Y1V G;  1OXU A;  2HHH L;  2OTL A;  4BA2 I;  3CW2 C;  1A8V A;  2IHF A;  4X64 Q;  2R7Z H;  1U5K A;  3BZK A;  4LWC A;  4P72 A;  1YI2 A;  2PMZ E;  1X55 A;  4GN5 A;  4YWL A;  2ZTC A;  4LF6 Q;  1OXS C;  4DAM A;  1M90 C;  2CWA A;  2NN6 I;  4A3E H;  2V1C C;  4R4O A;  3ULL A;  2NN6 G;  4AIM A;  1JJ2 A;  3TRZ A;  2H5X A;  1E1T A;  2VQE Q;  2E5L Q;  2Z0S A;  3JC6 6;  4IOA A;  3NBH B;  1G29 1;  2B29 A;  2RHS B;  1I94 L;  2JJQ A;  4HJ7 A;  3U4V A;  3GTG H;  2CQO A;  1V9P A;  1QUQ B;  2RCN A;  5M5X H;  1L1O B;  1VQI A;  4DUZ L;  4JOI A;  1S3O A;  4R4T A;  4DV1 Q;  4AQY L;  1BBW A;  4A3J G;  3PGZ A;  1PH5 A;  3F8T A;  3W5O A;  1HNX L;  5K36 G;  4IFD J;  5C4J H;  1OTC A;  4IJL A;  2UU9 Q;  3K80 C;  2JA9 A;  4JI1 Q;  1IBL Q;  3IRB A;  3PUY A;  4XIG S;  5GAE C;  3HOZ G;  4DV5 Q;  3M3Y H;  4HJ9 A;  4DR7 Q;  3OTO L;  5BR8 Q;  4DV0 L;  2QA4 A;  1PH7 A;  3HOX H;  2NZO A;  3CP0 A;  5HY6 A;  2VZA A;  4LFC L;  4BBR H;  5M3F G;  4DR1 Q;  1EQQ A;  3H15 A;  1K3R A;  4JI5 L;  3PF5 A;  4JI0 L;  1HZ9 A;  3HOW H;  2VQF Q;  2LSS A;  3BJU A;  2I5L X;  2B3G A;  1TWC H;  1HZC A;  3EBE A;  4DV7 L;  1BVS A;  4Y7N H;  4RMF A;  1XMQ L;  4JBK A;  1UE6 A;  4DK6 C;  3UDG A;  2ZJQ A;  3I56 A;  1NMG A;  2JQO A;  3D31 A;  1XMO Q;  3T1H L;  2AWN A;  5C4X G;  2UUA L;  2XGT A;  1PH9 A;  1K83 H;  2YYZ A;  3PIP A;  2AKW B;  1HR0 W;  4LF8 L;  2UXD L;  3UDF A;  4JI2 L;  4A76 A;  1AE2 A;  2HHH Q;  1X54 A;  4PMW A;  4QJF A;  1MKH A;  3F2B A;  4ME3 A;  1M1K C;  2EXD A;  3B6Y A;  1L0W A;  1YEZ A;  2C35 B;  1VQ9 A;  1GO3 E;  2PQA A;  4A3K H;  4JOI C;  1VQN A;  3WWV A;  4NB3 A;  1GD7 A;  2Z6K A;  3S16 H;  4PZ7 A;  4KLK A;  1NTG A;  5M5Y H;  3CCV A;  1JE5 A;  5IP9 H;  4DV6 L;  4JI7 Q;  3UE0 A;  1CKM A;  1UEB A;  3G71 A;  1YJW A;  1Y1W H;  4JI4 L;  1VQL A;  3AFP A;  5GAH C;  4BXX G;  4GNX A;  1G51 A;  1SMX A;  3S24 A;  4APV A;  1CSQ A;  2ID0 A;  3KF6 B;  5C0X G;  4GN3 B;  3VDY A;  1I94 Q;  1C7Y A;  3I55 A;  1RIP A;  1VQ4 A;  2JEA I;  3CC4 A;  3S14 H;  4DV4 L;  4DUZ Q;  3KF8 B;  1YVC A;  4AQY Q;  1HNX Q;  2D0O A;  1YBY A;  2CWP A;  2JK8 A;  1VCI A;  4YWK A;  1VQB A;  3H0G G;  3CPW A;  1SLJ A;  3I4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...