4BY7G

Elongating rna polymerase ii-bye1 tld complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by7G01
4EQ5A 3E0EA 1VQIA 2A8VA 1HR0W 4DR5Q 1S3OA 1M1KC 1X55A 2KENA 4DV0L 2HT1A 3J81i 4LFAQ 3ERSX 5IYBG 1XNRL 3STBC 4WJ3M 2KCTA 4DR1L 3KF8B 4JOIA 5IP9H 3HKSA 4DR5L 4A76A 1K3RA 2OCEA 1EQQA 4DV7L 3PUVA 5GAHC 2I5LX 1LUZA 2UXDL 4A3FH 3KYHC 1JJCB 2NZHA 1VQEA 4P75A 4A3FG 3J80i 1Y1WH 4O0AA 2JA6G 3PO3H 1IBMQ 1L1OB 3I4OA 2K5VA 5C4JH 2UXDQ 4A3CG 3G71A 1U0LA 2CKZB 2E5LQ 3I55A 3NENA 1B8AA 4A3IH 4GN4B 4JBJA 4ALPA 1QZGA 4LF8Q 4NB3A 4A93G 1X56A 1UE6A 3KDFA 2QA4A 2D0OA 2KHJA 2WAQG 1WOCA 2ZJQA 3HOXH 2R92G 3HOWG 3J7ZC 4YCWA 2Y0SE 1OXTA 1PH3A 4PZ7A 1MJCA 4LFBL 1O7IA 4BXXH 2RCNA 4POFA 5C3EH 1Q86C 3HKZE 2AMCB 4JI1L 3CCVA 1JE5A 3G6EA 3IRBA 4IPGA 1W2BA 1BBUA 2PI2E 1GVPA 3CAMA 3RN5A 4DAMA 2LXJA 4IOCA 3I2ZA 1QUQB 3CPWA 2Q2IA 3BZCA 4DUZQ 1S40A 1NJIC 1PH5A 4LFBQ 2VL6A 2ALYB 5J3BA 1M90C 1PH4A 4KI0A 1XMQQ 4XTCS 1E24A 1KC8C 1VQCA 4FDBA 1J5EL 1CSQA 3DLLA 3CC2A 4GKKQ 4OO1I 1TXYA 3UDIA 2AWOA 1HZBA 1Q8KA 1X54A 2QGQA 2WB1G 4DKAC 4HJAA 3T1YQ 4X62Q 4BY1H 4NXML 1J5EQ 5AJ3Q 4L5QA 1IBML 2E2HH 4K0KL 5K36G 4GOPC 4JI7Q 1J6QA 4X66Q 1XMQL 1C9OA 2UXBQ 3CPFA 2KCMA 2F52A 4HJ9A 4QGUA 2NN6G 1PYSB 4HJ8A 3AEVA 4BXXG 3F2DA 1PFSA 3M9BA 4OWTB 1UE5A 3GTJH 1EQRA 2Q2TA 2JA8G 3D31A 1CKMA 1YI2A 2ES2A 4X65Q 4X66L 1G51A 5DLQE 3JC66 2N8NA 2OQ0A 4A3IG 2VNUD 1K73C 1VQLA 1TWGH 3NBHB 3NELA 1KAWA 4GKJQ 3SGIA 1JJGA 1P16A 3U4ZA 2VQEQ 1JJ2A 2JK8A 1FJGL 4BBRH 3L0OA 2YV5A 4LF8L 5BR8Q 1V9PA 4UP8A 4JI3L 4Y7NH 4DK6C 3GTOH 4LUVA 1N33Q 1E1TA 1LM0A 4AIMA 4DNIA 4DR7L 3G4SA 4JI6L 2R7ZG 1EOVA 3I4NG 2D0PA 3OW2A 4B3MQ 1A0IA 1VQDA 2YTYA 4DV2L 3TS2A 2B3GA 2GN5A 4OX9Q 3K81C 4DAYB 4DR7Q 4GNXA 5E7NA 1X3FA 5BR8L 1I5FA 4DR2Q 5AJ3L 3E9HA 4R4CA 1W3SA 4JG2A 2BA0A 3K8AA 1E7ZA 2FXQA 4JOIC 3S1MH 4LNQA 3CCUA 1VQKA 4DUZL 2F4VL 3I4NH 3ICEA 5C0XG 3HOUH 2R93H 2GVBA 2WP8J 5EAYA 5M3MG 5IWAL 2B63G 4BY7H 4A3JH 2ZM6Q 4HIOA 2AHOB 4A3BG 1JB7A 5LMNQ 3TRZA 2WB1E 1VQOA 3T1YL 4NXMQ 2F4VQ 3OTOQ 3MXNB 3FP9A 2YU9H 3G48A 4IPCA 3KF6B 4A3DG 2UXBL 3CQZH 4GN3B 4JI4L 5ELNA 1PHJA 4A75A 2A1AA 3PIOA 2F3IA 3M3YH 2Z0SA 4IJHA 1JMCA 2LXKA 2YTXA 1X6OA 2CFMA 4QQBX 2ZJPA 3PCOB 3ER0A 3CCMA 4LUZA 3M7NA 1EIFA 1PYBA 5HY6A 2GVAA 3PO2G 2ZTCA 1U5KA 4YHHQ 1PV4A 4IO9A 2R92H 3HOWH 4A3LG 3M4QA 4APVA 2OQKA 1KD1C 1A8VA 2N3SA 1K0RA 1PH2A 4IOAA 4OO1G 1UE1A 1DGSA 4A3LH 4X64Q 3KJPA 1IBLL 3U58A 3S14H 2PQAA 4L5TA 1YVCA 1K83H 1GD7A 2WAQE 5JEAG 3CMEA 1XJVA 1VQJA 3S2HH 2XGTA 1VQ6A 3S16H 3KLWA 4OXPA 3HOXG 1IBKQ 4LF9L 2B63H 2IX0A 3K7AH 1KRTA 1UWVA 1OTCA 4DK3C 3W5OA 2OWOA 3F2CA 3CD6A 2DGYA 1CKNA 2NZOA 3PUXA 1IBKL 4A3JG 1NMFA 4LF9Q 2LSSA 4DV1Q 1G291 4PZ6A 3KFUA 5IP9G 4IFDG 1AH9A 1HJPA 1Y14B 4A4IA 4NXNQ 1H95A 4KHPQ 3TQYA 5M3MH 2VQFL 1XNQL 3S1QH 4YCUA 3PUZA 1IZ6A 1VQBA 2ZJRA 3F1ZA 5GQOA 4KHPL 1CKOA 4JCVE 2ZTDA 1XNRQ 1SROA 2L15A 5LMUL 4JV5Q 1KL9A 4B3SL 4BBRG 4LF7Q 2NVQH 4IJLA 4QL5A 1L1OC 3PO3G 1I3QH 1HZAA 1N32L 1VQNA 2UUCQ 5IE8A 1TWHH 1NBWA 1Q1EA 2VUMG 4DV4L 3I4MG 4PZ8A 1NY4A 1IBLQ 2Y0SG 3A0JA 4LUOA 4P73A 1ASYA 3T1HL 1D8LA 2C35B 1EIYB 2ASBA 3I4MH 4L5RC 1HNZQ 2UXCL 4JI1Q 3KDFB 4JI2Q 1OXUA 1XPOA 3J81c 3M85A 1VS0A 4YWLA 4LF6Q 1S72A 2HHHL 1SLJA 2N78A 2UUAQ 3HOUG 3GD7A 4OWWB 2E8GA 1Q46A 2R7ZH 3GO5A 4PMWA 3RLFA 4KHZA 1IL2A 3GTMH 3I7FA 5IT9c 5ELOA 2V1CC 1YZ6A 3CCSA 4DV3Q 1B70B 1EWIA 4OONA 1Z9FA 4B3TQ 3UDFA 2YTVA 3PUYA 5JEAJ 3ULLA 4QY7A 1P8LA 1C7YA 2K52A 1SR3A 1VCIA 1VQMA 3L7ZC 4LF6L 3PO2H 4DV5L 1QZHA 3K0XA 3UDXA 5FJ8G 2KHIA 2Z6KC 4YCVA 1SRUA 4LW1A 4DV6L 4GOPA 1N36L 1LYLA 1X3EA 2PNHA 3CCEA 3U4VA 4GN5A 4DV5Q 4HJ7A 4JYAQ 4LF5L 1AE3A 2JA8H 1IYJB 1FGUA 3RLNA 2JA7G 3PF4A 4IFDJ 4DV6Q 3D0FA 2KBNA 2NVYH 3F8TA 4JI5L 3RLOA 4GOPB 4MTNA 1R9TH 1N36Q 4A3DH 1N32Q 4Y52H 1YHBA 1WI5A 3S1RH 3PSIA 4UPAA 2R6GA 4JBWA 4AH6A 2R7DA 2UU9L 4IPHA 1WYDA 3CMAA 2IHFA 3HOZG 4HIKA 4DPGA 4LFAL 4GKKL 1YITA 4JYAL 2AWNA 3HOYH 1LTLA 4YWKA 1PVOA 3W1BA 2E2IH 4AQYL 2VW9A 4GLXA 3S2DH 1UEBA 2K4KA 3KJOA 1BKBA 2E2JH 4JI7L 3AQQA 1HR0Q 1SE8A 4HJ5A 2HHHQ 3RN2A 3JAMi 4DR4L 1VQAA 1Y1VH 2JQOA 2MQHA 4AQYQ 4BY7G 2MNAA 2OTJA 4JI0Q 1JT8A 2UUBL 1HZCA 4RMFA 1YNXA 3CC4A 4DR4Q 1VQ9A 1A62A 1G6PA 4GS3A 3S17H 1L0WA 3HFZB 1K8AC 5IY0A 1HZ9A 3I56A 4JI8Q 2BA1A 3H0GH 3E9IA 4R4TA 4JI2L 1A63A 1K8GA 1HNWL 1UE7A 2UUBQ 4P74A 2VS1A 2YYZA 4GNXC 4JI8L 1SN8A 2RF4A 3J81j 1OXSC 1T9HA 5H1SE 1YJ9A 3B6YA 2QEXA 3CCRA 1WJJA 1N33L 3CP0A 3H3VI 3K80C 4B3TL 2EIFA 2JJQA 4A3EG 1GKHA 5M5XH 4MNOA 2VZAA 1NE3A 1XTDA 4NPSA 1NMGA 3UE1A 3A74A 3FKIG 1IXRA 1VQFA 3ZJYC 4XIGS 2MO0A 1PH9A 1XPRA 2H5XA 2Z6KA 2CCZA 3Q8DA 3S1NH 5C4XG 4HIMA 3PIPA 1MKHA 1FL0A 1Q81C 4B3RL 4DR1Q 3AFPA 4A3GG 1KIXA 5M3FH 1FVIA 4R1JA 1QVGA 1V1QA 4GLAC 4JI0L 1TWCH 3CCLA 4JC0A 3ULJA 1C0AA 5FLXc 1I6HH 4B3RQ 3EIVA 1SMXA 3TEHB 4GKJL 3AFQA 4BY1G 2UU9Q 1Q1BA 4UP7A 3CXCA 2HQLA 4JI3Q 3GDEA 2K50A 4R4QA 1PH7A 1FJGQ 5C44H 4A3KH 4POGA 2K14A 2K5NA 4X65L 1HNWQ 2WFWA 1MJEA 1I94L 3GTKH 1N34Q 3CW2C 1TWAH 4OX9L 2R7FA 2AKWB 5IP7H 1HR0L 4P71A 5C0XJ 1X9NA 1EFWA 2JA9A 3HKZG 5FLMG 1KQSA 3HOVH 3NEMA 4DR2L 2I0QA 3TREA 5IYDH 1ASZA 1WFQA 2JA5H 4JBMA 5IYDG 1CKNB 4BA2I 1I94Q 4IPDA 1SFOH 1N34L 4UP9A 4LF4Q 2MFIA 3GTLH 3JAMc 3BJUA 4WJ4A 3RNUA 3L2PA 4JI6Q 2BH2A 3K7UC 1YJWA 1VQ8A 2A19A 2B29A 4LWCA 4X64L 4K0KQ 3CF5A 2ZTEA 3KOJA 3PV0A 4LFCL 5C44G 2CQOA 2HIXA 5GROA 5FJ8H 4A93H 1NTGA 4UY8C 3PUWA 3OTOL 1D7QA 2JEBI 1HH2P 4A3CH 4YY3Q 2HIVA 4DR3L 3CC7A 5LMNL 5JJIA 4GLVB 3UDGA 1YEZA 2JA6H 3GTGH 1PH6A 3STBD 1VQGA 4MZ9A 4JBKA 1Q7YC 4IFDI 2JE6I 1Y1WG 2EXDA 4LFCQ 4DUYL 4BBSH 2IT1A 5LMUQ 1X3GA 2JA5G 4DR3Q 4AYBG 1Z47A 4X62L 1EYGA 4A3BH 1KHIA 1KRSA 1WCMH 4YY3L 4DR6Q 5C3EG 1HNXQ 1EUJA 1RL2A 4YHHL 4EX5A 4H02A 3F2BA 3EBEA 1WCMG 1X65A 4TQUS 1V43A 3UE0A 3FKIH 5IYCG 2ZM6L 4C3JH 4DUYQ 2K5HA 3H3VH 2N49A 2IY5B 4A3EH 2OTLA 1I50H 1GM5A 2ID0A 3J7A5 5JJKA 1B7YB 3WWVA 3RZOH 1RIPA 2RHSB 3A5UA 1E22A 4B3ML 4DV2Q 1VQPA 1HNXL 4LF4L 2XTIA 2EQSA 5IYBH 1Q12A 1CSPA 1OXXK 1TWFH 1BVSA 5C0XI 2PQAB 1QUQA 4DV4Q 4A3GH 3RZDH 2VQEL 1GO3E 3H0GG 4RG1A 1YHQA 1N8RC 3S15H 2NN6I 5GAEC 1PA6A 4OWXB 5C4XH 4BA1I 4KLKA 3GTPH 4A3MH 2NVTH 5IYCH 4AYBE 4DV0Q 5IWAQ 5GAGC 3BZKA 4A3MG 1XMOL 2UUAL 3U50C 2IX1A 3M4PA 5LMNW 4LF5Q 4R4OA 2VY3A 4R4IA 1L2FA 1K9MC 4L5SA 2Q2HA 4PG3A 2D62A 1XNQQ 2JEAI 1CUKA 4DR6L 4P72A 3CCJA 3KF6A 1XPUA 5M5WH 1VQ4A 3H15A 4JV5L 2I5MX 3OYYA 1XMOQ 3DM3A 3AYHB 2UUCL 3PGZA 1E3PA 4O2DA 1YBYA 4NXNL 1AE2A 4LF7L 1Y1VG 4DV1L 4BBSG 2RHQB 2VQFQ 4C3HH 2MO1A 2CWAA 3PF5A 3T1HQ 4JI5Q 3W1GA 4DV7Q 1VQ7A 3GTQH 1L1OA 1YIJA 4HIDA 3CCQA 4ME3A 5JJLA 4QIWE 1BBWA 3LGJA 3MEFA 2PMZE 4JI4Q 4B3SQ 2DUDA 1MIUA 2IHEA 3FHWA 1N9WA 4DV3L 1YJNA 1E1OA 5IP7G 1KXLA 5HGQA 2ATWA 3S24A 3HOYG 5FLMH 1PH1A 3HOVG 1PH8A 1VQHA 4A3KG 3HOZH 4TVAB 4J15A 2CWPA 2E5LL 3A5ZB 2VUMH 4QJFA 5M5YH 1VQ5A 3M4OH 2PI2A 4C2MH 1OXVA 4X6AH 4C3IH 3BU2A 5GADC 3TS0A 1Q82C 1HNZL 2Q2UA 2K75A 3ULPA 2UXCQ 3EN2A 4GNXB 2JA7H 4YWMA 2BH8A 2R93G 3J80c 3VDYA 1QVCA 1YHAA 5M3FG 1QVFA 3RR5A 2I5HA 2NVXH
chains in the Genus database with same CATH superfamily
2F0DA 1SFOA 3E0EA 1VQIA 4KY7A 1O80A 1Q8IA 1X55A 2KENA 2QF7A 1DIKA 4MV4A 2B2WC 5KFCA 2F0QA 3I8ZA 5D3DA 1KLUD 1SCUB 2EYPA 5IP9H 1Y69U 1G91A 4A76A 2OCEA 4LSXA 3EVQA 5KYIA 1BCPF 3KLRA 4ED6A 1YNNC 5CV5A 4KY5A 2R8GA 2F0PA 4WJWA 4P75A 1CQJB 5I2YA 1TT2A 3D8GA 4J9MA 4IUTA 5ELEA 1Y1WH 4O0AA 1K1SA 2XRQD 3PO3H 1IBMQ 1O7LA 5C4JH 1PFMA 4MV3A 4IZOA 4KJNA 5C4XB 2JEIA 5KGUA 2E5LQ 2B2UC 1QZGA 4RZRA 4IAJA 2EYMA 4NB3A 3L9AX 4A3FB 1X56A 2NZ1D 5IGBA 4ECYA 2QA4A 1E2WA 5C4HA 3GTOB 3HOWG 1QJOA 2R92G 3HOXH 4IUNA 5FPRA 3R3OA 2GPWA 1O7IA 2YS7A 4LMYA 3G6EA 2A6HC 2F0GA 4F4WA 3LX0A 4RGTA 5T14A 1BBUA 4APMA 4IOCA 2BQRA 2OXPA 1EU3A 4DUZQ 3BAAA 1M90C 4HYKA 5KIXA 5C5LA 5LMNH 3MR6A 4FDBA 4TRDA 1AN7A 1CSQA 1GUGA 2VQDA 2R92B 3CC2A 4OO1I 2AWOA 2WB1G 5L1IA 3EYYA 2YS6A 4ZCKA 4X62Q 2AGPA 4KHVA 1J5EQ 3RBEA 4GOPC 3G6YA 3M9MB 2UXBQ 4A3KB 3VA5A 5FOBB 3CPFA 4UCTA 4QGUA 2ZT9C 1PYSB 4HJ8A 2F4IA 1BBXC 3BYTB 2FHTA 2Q8RE 2K6AA 3F2DA 1WD1A 1EUCB 1PFSA 2W71A 2XC9A 4YHHH 2AQ4A 1SAPA 1I6UA 1EQRA 1NSNS 2C2EA 3H4DA 5DLQE 2V4DA 3DEOA 1EIGA 1RD9D 2VNUD 1K73C 1EU4A 1PRTD 1RKNA 1VQLA 4OIKA 3NBHB 2R3ZA 4GKJQ 4ILWA 2GA4B 2E76C 5DGAA 5C8YF 3U4ZA 3I4NB 3N41B 4Y8VB 1JJ2A 1HFGA 2JYOA 3RZOB 2F3VA 1FJGL 1K0SA 4HTHA 1V9PA 1EHIA 4JI3L 2P0AA 2L5TA 1E1TA 1LM0A 4AIMA 3G4SA 4JI6L 3DWPA 3HP3A 2KHSA 4ZLTF 1XNQH 5HBRB 4B3MQ 1AUXA 3TS2A 3T5KA 1KNEA 2L12A 2B3GA 4DAYB 3A56A 4DR7Q 1PLFA 5IODA 3PR5B 4KHPH 1X3FA 1EY5A 3ND8A 1H9JA 1W3SA 1UAPA 1AW7A 2BA0A 4JG2A 5KG7A 2FXQA 4JI8H 3GILA 3Q8RB 4ECVA 1KJ9A 3GV7B 3ICEA 1IHZA 1JB3A 2K33A 3M9OB 1D1KA 2FB9A 4LFBH 5IWAL 3MR3A 5KFSA 2ZM6Q 4RWSC 3V4SA 2EJMA 1ZXTA 1TKWB 2IWHA 3S2DB 4WRDA 2ASJA 3OTOQ 3MXNB 5C1PA 2B2WA 3D4DA 3Q6SA 2ZDQA 4RGNA 3F2UA 2ZDGA 3S14B 1NNXA 4YR2A 3K7AB 1Z2PX 2YCHA 4KD4A 4R7RA 2ZJPA 3ER0A 1I7LA 4OO1H 1EIFA 5HY6A 3TP6A 3J81E 3E5SA 4QW9A 4OO1G 2EXZA 1S03G 2R8KA 5K5PA 2RDIA 5JEAH 5DGBA 3U58A 3S14H 4FF1A 2WAQB 1EY9A 5T1GA 3CMEA 2FKLA 4IUPA 5CV8A 1VQJA 3L4JA 4CGYB 1VQ6A 1IKMA 4JPBW 3SR1A 2B63H 5IGEA 3K7AH 3GV6A 2JA5A 2R87A 4ECSA 3W5OA 2KECA 3VPCA 4ZAIA 2Z6BA 1CKNA 2XRSD 3PUXA 4QUFA 4JV5Q 1TY2A 2W70A 1HFNA 1KDAA 4IFDG 4YQWA 1HJPA 1TWFB 4A4IA 4KKSA 1VBHA 3TQYA 3V4ZA 3DM1A 1CZGA 4I7ZC 4RB3C 1XDNA 2M05A 2UXDH 2Z9HA 1NUCA 3H4BA 2X6GA 4JVZA 2ZTDA 2A74C 1XNRQ 3NUCA 5LMUL 3VYSA 4LF7Q 5DQGA 4IJLA 1N32L 2YZNA 2PMZA 2FE3A 5IE8A 1SNCA 2VUMG 5LMUH 3I4MG 1HHVA 1IBLQ 3MFHA 3L4KA 1D8LA 2C35B 4TSSA 3SI8A 3QIAA 5KG3A 4JI1Q 3KDFB 3DMUA 2CHBD 1VS0A 5HGTA 5IIFA 5LL6S 1PTOB 2YZMA 1SE4A 2UUAQ 3HOUG 4Q0FA 4ED3A 1Q46A 4ZK9B 5JPNC 3GO5A 3HS0C 1X3PA 4KHZA 3GTMH 3I7FA 3RFCA 1STEA 5ELOA 1WTXA 4B9XA 3IFDA 4OONA 1SE2A 2F0IA 2YTVA 3PUYA 3UDFA 4QMGA 3ULLA 3MFGA 4G57A 4QY7A 1C7YA 3M4OB 2VUMB 4A2AA 1SR3A 1VQMA 2W7OA 1SFOB 1K3BC 1BF4A 1R4QB 2A6HD 4DV5L 1QZHA 1WH2A 4I65A 2KHIA 1SRUA 1B4OA 4O4IF 1LYLA 1X3EA 1QE6A 4A3DB 1F2YA 3I3CA 3RLNA 3TP8A 2B8FA 2MGSA 4X65H 5E4XA 2NVYH 4JI5L 5IWAH 1GUNA 3RLOA 4Y52H 2ATLA 1WI5A 3S1RH 1M4VA 4AH6A 2NU6B 4LF9H 3CMAA 4S3SA 1ULZA 4GKKL 4HIKA 1S4ZA 4DPGA 2ZDHA 3MXNA 2AWNA 2CVRA 2CW8A 5CC4A 2E2IH 2A5HA 3GTMB 2VW9A 3N6XA 1UEBA 1STAA 2E2JH 1BKBA 3KBGA 2YU9B 1SE8A 4QWAA 1V1PB 3BDOA 3CQZB 2AQ1B 5D1OB 5BN5A 2FPPB 4JI0Q 1ICWA 1YNXA 3CC4A 4O3NA 3G7LA 2N55A 2EOTA 1A62A 4JI6H 4O3RA 1L0WA 3PIO3 3BG5A 3SHLA 2L11A 3KBXA 2EYLA 2DY7A 4PQXA 4E6IA 1DZ1A 2AGQA 3BS1A 1GXDC 5EOYA 4P74A 2VS1A 4GNXC 4JI8L 4U6PA 3J81j 3S1MB 1OXSC 5H1SE 2QEXA 1PRTB 1C8CA 5I9PA 5M3FB 3P1HA 4B3TL 5BN3A 1RJQA 4O3PA 3CU7A 1JOKA 3KUPA 4MV9A 3UE1A 1NE3A 2K03A 3RZDB 3FDSA 1UNSA 5KX5F 1IXRA 4ABNA 3I90A 3S15B 1VQFA 2V58A 1TWFA 5KFGA 1BXRA 1PH9A 4UDUC 3OUUA 5CA1F 2H5XA 3Q8DA 3S1NH 4ZQIA 1WTQA 5KFNA 3OHAA 2X6LA 2ALZA 4B3RL 2HUGA 1KIXA 5M3FH 1FVIA 4EYHB 4GLAC 1TWCH 4JC0A 3TP5A 4UFZA 4GKJL 4BY1G 3NHHA 1Q1BA 4MTEA 2HQLA 4N9PA 3DWAA 4ZUIA 1PH7A 2JA7B 2ENBA 2K14A 3OMCA 5FK9C 2F0HA 5KFAA 3AU7A 1TY0A 1HR0L 2AKWB 3GQCA 4P71A 2E2DC 1EFWA 5FLMG 3HOVH 4PV1C 1L0YB 4HMJA 3Q24A 5IT9L 1ASZA 1WFQA 1SYXB 1EY6A 1BCPC 2JA5H 1C48A 5IYDG 1DOKA 4IPDA 3GTLH 1FGBD 1RHPA 3BJUA 3LWEA 4DR4H 3L2PA 3EPGA 1VQ8A 2A19A 2B29A 4IUQA 3MWEA 4EYIB 3CF5A 5D8DA 3KOJA 3PV0A 2B2VC 5KFBA 2HIXA 4DAYA 2HGSA 4MV8A 3GIIA 3URYA 2R8IA 2A6ED 2E74C 1HH2P 1M0TA 1YEZA 2OF1A 2PZWA 1LTTD 4ZUJA 1Q7YC 1Y1WG 1CM9A 4BBSH 4L8JA 4MHEA 4DR6Q 4YY3L 4GKKH 1HNXQ 1RL2A 1GGOA 4YHHL 4EX5A 2UVRA 2KUMA 5BN4A 3HEJA 3EBEA 4H0LC 4DK0A 1X65A 4IZ8A 4TQUS 4EGJA 2EY2A 1V43A 3FKIH 3SEBA 1U4PA 4C3JH 2ZM6L 2K5HA 2C00A 2IY5B 3SK8A 1I50H 4QF4A 4DR1H 4RUCA 2HQEA 1JOOA 3RZOH 1E22A 1CQFA 2UXCH 5F9NA 3D3RA 1WTRA 4Q43A 5IYBH 1OXXK 2O2LD 1VF7A 1WTPA 4N9TA 1HA6A 5C0XI 4G3IA 2HVQA 1K28A 5I47A 4DR5H 4AYBA 4HNVA 1PA6A 5C4XH 3VA7A 2Z4IA 4DV5H 1UC9A 4RB2C 5CV7A 1RK5A 2FMMA 3BYYB 3BZKA 1XMOL 4F4XA 1DV2A 5LMNW 5KFDA 1I4HA 1R4PB 4R4IA 1L2FA 4OEMB 4O42A 4HAEA 1YNJC 4ED7A 1HPCA 3MFYA 1XPUA 3K5HA 1VQ4A 5HURA 1XMOQ 1S0OA 1TQOA 4XT3B 2RDGA 3CRLC 1QOHA 1Y1VG 1XYIA 4BBSG 1PFBA 2B2TC 2GPSA 2I80A 4Q45A 2V9WA 4OL7A 5D1OA 1ET6A 4HN7A 4JI5Q 2RSOA 3GTQH 4CJ1B 1MZBA 1L1OA 3H0GA 4LFCH 3MZ5A 3WOEA 4CJ0B 3JRXA 4NMZA 4C2MA 4J9KA 4B3SQ 2BE5D 3HOXB 3OTOH 1TIID 1U4LA 5JVH3 1E1OA 1EQVA 1EYAA 3JZIA 5AFWA 2KCNA 1KXLA 2D2CC 1PTOF 5C44B 3HOUB 1GUOA 2EY1A 4TVAB 2E5LL 2XNAC 1PFNA 4ECZA 3A5ZB 5M5YH 1PDQA 2PI2A 2C9OA 1STYA 1OXVA 4C2MH 1Q82C 3ULPA 5F2DA 5LYJF 4QB4A 4RKLA 1UC8A 2XCPA 2BH8A 4X62H 3I12A 1S0MA 1YHAA 2CW0D 4DL5A 1ENCA 2NVXH 2YZGA 1KEEA 2A6EC 4TUYF 1HR0W 1KJIA 1S3OA 5DQHA 1TWGA 1SXTA 3QG1A 4LFAQ 4C1NK 2O03A 2JSOA 4HSPA 4JOIA 4B3RH 1S5DD 5EWFA 5EGTA 4FNFA 4F50A 2UXDL 2W8LA 1JJCB 2C2DA 3K59A 4K8JA 3NQIA 2JEGA 1VQEA 5KFFA 3J80W 4A3FG 4GKJH 2IX3A 5KT5A 2R8JA 4IURA 1L1OB 3H0GB 1LTAD 2VB2X 3FPUB 1U0LA 1GSHA 1BNCA 1B8AA 4DA2A 4GN4B 3NXWA 4YJ3F 1AN8A 3E5NA 4I4TF 1I4PA 3KDFA 5FD5A 2WB1A 2D0OA 4FM9A 4UHVA 2WAQG 4JW0A 2W6QA 4F88A 1OXTA 2L55A 1MJCA 4B9WA 3RMHA 1IKLA 1ZYRD 1Q86C 1IOVA 3K5MA 3S1QB 3HKZE 3C3LA 1E4FT 3N44B 1ZETA 4EEYA 1HCZA 1F9PA 1H9KA 3RN5A 3Q8SB 1G2SA 2NYZD 3NTHA 1I4RA 3I2ZA 3E0JA 3CPWA 4DL6A 4I7AA 1IYUA 2N88A 3GTLB 5JVG3 3A7AB 1PH4A 5EPLA 1XMQQ 5E1FA 4CC6A 1VQCA 1J5EL 1LO5D 2JA8B 3D6CA 4OGQC 4BY7B 1GUWA 1M6VA 3MXGA 3ORRA 2QGQA 4BY1H 2JEJA 4Q8FA 4CKEA 5AJ3Q 1IBML 2E2HH 4K0KL 5K36G 4JI7Q 4X66Q 2I87A 2KCMA 2NN6G 3JAMW 1JOQA 1W96A 3GTJH 4K5VA 2AGOA 2PBZA 1YI2A 4X65Q 2R7ZB 2AQ2B 2BQ3A 1NR4A 4M9UA 1JC7A 4DV4H 2NVXA 1DYQA 2R8HA 3TSSA 1SYFA 3GTKA 1JX4A 3NELA 1TWGH 2EE1A 2PW5A 1JCKB 1A3VA 4KN4C 4V190 2J4XA 4KMUC 5DEHA 4R8IA 2JK8A 3R93A 2QYZA 3QOJA 4BBRH 3L0OA 4DV0H 5KFOA 5BR8Q 3GTPA 4UP8A 3IAYA 3GTOH 1C30A 1N33Q 4DR7L 2EJFC 4LH6A 2OT2A 4XQNA 2WACA 1AUVA 5KEEA 2YTYA 4DV2L 1DJRD 5KFQA 2WINB 1GHJA 4GNXA 3GIQA 3BVGA 3E9HA 4R4CA 3J7AV 2XGQA 1E7ZA 1TWHA 1E2VA 1KJQA 2I8CA 4TV9F 1RCVD 4XYMB 2JA6B 2W9BB 3P20A 2SNSA 2F0OA 5JPMC 2FJZA 1SDFA 3HOUH 2R93H 2B39A 2VB3X 5EAYA 2UUCH 2HJWA 4YR3A 2H1EA 2BCOA 1JB7A 1CA5A 3H20A 3TRZA 1VQOA 4IHJF 3DEPA 1GLVA 1FD7D 2IJ0A 3RB3A 2YU9H 3R8BA 3GTQB 4IPCA 3KF6B 1CI3M 2UXBL 4RAUC 1A9XA 3M4IA 5EKLA 3NSWA 2F0MA 2Z0SA 3KAKA 2UUAH 3K0YA 2UXBH 2CFMA 3PCOB 1HQMC 3CCMA 4I50F 3M7NA 3T16A 1PZJD 1PYBA 3PO2G 1PV4A 3HOWH 3BQ2A 1KD1C 4A2BA 2N3SA 1PH2A 4HNUA 3GTKB 1MI2A 1EQTA 3KJPA 1KDCA 1IBLL 1SBBB 2PQAA 5H80A 1EY4A 5KT7A 1I6VC 3TQ1A 1DD2A 3MXUA 2K5WA 2XGTA 2K01A 3KLWA 5EWGA 3WNZA 2XCLA 3KXYT 4KKTA 1EZ6A 4QWDA 5T1IA 3WO1A 2W9AA 3KFUA 4B3MH 1EEFD 4I7HA 2DZDA 1Y1VA 4YIJA 3TIGA 1AH9A 5CB4F 4HQ6A 1R9TB 2XCAA 1CQIB 3R5XA 2KQ3A 4KHPQ 4DNTB 5M3MH 3S1QH 2FK3A 2VPSA 1IW7D 4K0KH 3PUZA 3T53B 1IZ6A 1BOSA 1EL0A 2Z1CA 3LWBA 4LF8H 2F0WA 4JCVE 3V6KA 5JUMA 3M4YA 1SNDA 1TAEA 2F0VA 4BBRG 2NVQH 4QL5A 3PO3G 1I3QH 4RH6A 4ED2A 1VQNA 1LACA 2HDMA 3EQLC 1TWHH 3GTPB 5LXTF 1Q1EA 2ZM6H 4DV4L 4TQSA 3PW5A 4PZ8A 2MUYA 1ASYA 4LUOA 4P73A 3K6OA 3OW7A 2R7KA 4ZHQF 4FO2A 5L37A 4DK1A 1LTBD 3SK4A 1HNZQ 3T5JA 4XYOA 2UXCL 4JI2Q 3CVZA 1OXUA 2EY5A 3RIZA 3Q22A 1EYDA 3EA6A 4C5BA 4IUVA 4LF6Q 3N6RA 4OIJA 1S72A 3GD7A 1V51A 2VUGA 2CZGA 3TIIA 4PMWA 3RLFA 1IL2A 4WBNF 1BCPD 4EBCA 1B70B 1EWIA 4RGOS 1Z9FA 4B3TQ 4EEQA 1W93A 3T1YH 1P8LA 1J5EH 1CE8A 3L7ZC 1H9RA 1GHKA 3D4WA 5FJ8G 5KFJA 1VF5C 1QILA 4RU9A 3U4VA 2R92A 4ID6A 4HJ7A 4JYAQ 1IYJB 1X32A 1XTCD 3PF4A 4IFDJ 2KBNA 3F8TA 1N36Q 1N32Q 2FK1A 4MTNA 5EWEA 1K8MA 4QIWB 3PSIA 3ONAB 2R6GA 2AU0A 2UU9L 1WYDA 2EY6A 3HOZG 2A68D 3T4AC 1J9OA 1YITA 2M00A 3HOYH 4JYAL 1V4YA 4NXNH 1PVOA 3QJYA 2KCCA 4AQYL 5CA0F 4GLXA 2FFKB 5IGGA 3AQQA 1HR0Q 1FKAH 4F4ZA 4KY6A 1Y1VH 2JQOA 4CKBA 3VR5A 2WB1B 2VQFH 3GV3A 1JT8A 2DJFC 3GTGA 1KAAA 4DR4Q 1VQ9A 4GS3A 4GC7A 5IY0A 1TWAB 5G3LF 3I56A 4JI8Q 1CHPD 2FJ2A 2QCPX 2F0NA 3E9IA 1SE3A 2R7NA 2YRXA 1A63A 1H9MA 1HNWL 2W6ZA 4UCRA 4B3SH 2RA4A 1GSAA 4IWXA 3QZ8A 3HG9A 1K8OA 5CORA 1H9SB 4K5XA 5DLGA 1FNVA 5J2UF 4YP3A 2RGRA 4ZRZA 5NUCA 3CP0A 3V96A 2CH4W 3H94A 4XX0B 1JWMD 1GKHA 5M5XH 1G6ZA 2VZAA 3S9WA 4CBVA 4XQQA 1WTHA 1I4GA 3MFIA 3ZJYC 4XIGS 2MO0A 4Z9CB 1Z7TA 4K14A 2K1BA 1Q81C 4K2KA 4K2LA 4R1JA 4DNRB 1V1QA 2XVSA 3HB9A 3ULJA 3JAME 1I50B 3TEHB 3TDQA 3AFQA 3MR2A 4C3IG 3CXCA 4MA0A 4JV0A 5KG4A 4JI3Q 3PIP3 2K50A 1W6KA 3UQ8A 4FBTA 3ETJA 4A3KH 4POGA 2C28A 1I94L 5KT6A 1N34Q 3CW2C 5IP7H 3OSPA 4F8MA 1X9NA 2JA9A 4X3SA 1KQSA 2DIKA 2QW7A 4K6LA 1V8QA 4ED8A 3TREA 2AUJD 4JK1C 4BY1B 1RYRA 4JV5H 3TINA 1CKNB 1I94Q 1SFOH 4LF4Q 2MFIA 4ECTA 1M8AA 3HGBA 3JAMc 4IRDA 2BH2A 2JA5B 1YJWA 1MSHA 2RVLA 2ZTEA 1A2UA 1DM0B 5GROA 1SJHD 2PMZB 4ECRA 3MC0B 2JEBI 1XNRH 4A3CH 4DR3L 3CC7A 5JJIA 4GLVB 3UDGA 1CS0A 1ML0D 4RAZA 1VQGA 2Y0SB 4MZ9A 1STGA 4G7OC 4DV7H 3OHBA 1ESFA 3J7AF 4LFCQ 5LMUQ 1ICFB 3M7GA 2CW0C 5M5WB 3GIDA 2YRWA 3FPPA 2PNRC 3U9OA 1JXLA 1EYGA 4A3BH 1KRSA 2RBMA 5DAUA 3Q23A 4RHSA 1EUJA 2YW2A 1G2TA 3BDLA 4RNMA 4ECXA 4PMBA 2YYAA 5KFHA 3UE0A 5IYCG 4L63B 4QIWA 2L0CA 4HR7A 2XSCA 4QCLA 4H13C 1GM5A 2TMPA 3J7A5 4Q5VA 1KTKA 1YNND 2F0EA 5COYA 1VQPA 2NUCA 4LH7A 3P75A 5JH7F 4YR0A 1S5ED 2EQSA 3MWMA 4FYDA 1TWFH 3JRWA 1JLLB 5CMDA 4XT1B 5ISRA 3NBHA 2QDLA 2PQAB 1QUQA 3KLSX 3DWQA 5I9OA 4A3GH 3T51B 2VQEL 4RG1A 1N8RC 4HNTA 2WV6D 3S15H 4YAJB 5GAEC 1HNWH 1F77A 4RFBA 2LKVA 1T5EA 2VQEH 2NVTH 3BA9A 4C2MB 5I6YA 5IYCH 4DV0Q 5C6AA 5BPFA 3M4PA 1SNOA 4R4OA 4RCOA 2PVPA 4J1MA 2Q2HA 2D62A 2X0SA 3EFXD 4ETSA 4DR6L 5LP6F 3RUPA 2EZVA 3KF6A 1LT5D 3A7LA 1GUSA 3OYYA 3X3MA 3MJFA 2UUCL 3PGZA 4ZYSA 2HHHH 4NXNL 1S5FD 1AE2A 4YBZB 3QO2A 2RHQB 3FRPB 3FMCA 1QCBD 4C3HH 3GV5B 2CWAA 5E4WC 1AZQA 3W1GA 1LT3D 1UUPA 3CCQA 1A15A 4HIDA 3GIJA 4JI4Q 2YL2A 2DUDA 2JN4A 2IHEA 5KFKA 2CW7A 2IPKD 1YJNA 4E4TA 2E2HB 1D2BA 1B1ZA 3S24A 3G8CA 5K2MA 3CQZA 3I70A 3MXPA 1PH8A 1VQHA 3HOZH 2BDNA 3V6HA 3BVZA 3A54A 4J15A 1XMQH 5KFVA 4FF4A 3UI2A 3RUZA 4QJFA 1VQ5A 2VUMH 3M4OH 3H40A 5KT3A 3TS0A 3WDNA 1HNZL 2MP1A 1OO9B 3EN2A 1PK8A 4HR7B 3J80c 3VDYA 1QVCA 4KTAA 2WTFA 3RR5A 2D5DA 4JI7H 5LA6F 4X66H 4EQ5A 5CGKA 5KKNB 2A8VA 4QUCA 3DUZA 4DR5Q 1DOMA 5DM63 2RDFA 2HT1A 2L9HA 3ERSX 1EZ8A 3IL8A 5IYBG 1Z6HA 1XNRL 4WJ3M 2FPIB 3Q8QB 2OLSA 1IBKH 3KF8B 1EQQA 3HKSA 4IUUA 3H6MA 4DV7L 2Y0SA 1PMRA 3PUVA 5I2XA 3KYHC 1FJGH 4C3JG 2NZHA 3A8JE 2GLTA 2MCTA 3U9TA 3J80i 4KKUA 3GTQA 4K8IA 1PTOD 4LJZC 4FF3A 4RCNA 2JA6G 3I4OA 5CV6A 1LTSD 2R61A 4A3MB 3R23A 1XMOH 4Q8EA 3G71A 2CKZB 4DAPA 2HD3A 3NENA 5IOCA 4A3IH 4JBJA 4ALPA 4LF8Q 3S17B 5IT9E 2W6PA 4A93G 5KFLA 4IRCA 1WD0A 4OX9H 3MWYW 4Y7NB 2ZJQA 4TV8F 2K05A 3T1HH 4F7XA 1B3QA 1B6SA 1PH3A 4PZ7A 4FS1A 4JI5H 1RODA 4BXXH 2RCNA 5C3EH 2B63A 1E0BA 3GV8B 3RD4A 3IRBA 4ODGA 3MEHA 5JQWA 2PI2E 1KJJA 3NP8A 4RA8A 4DAMA 2LXJA 2W7PA 4MTKA 2B2YC 3ERQA 1S40A 2VL6A 3PMFA 1KC7A 2J9GA 5KG2A 3IN5A 4QWCA 4XTCS 3HZXA 4J9RA 1KC8C 1PRTF 3OOCA 2NU9B 4NXMH 1BNZA 1RJTA 3FDTA 1T36A 1B04A 1HQRD 4GKKQ 4Q0YA 1TXYA 3UDIA 3T1YQ 4NXML 4FU0A 1NCVA 4L5QA 3J80L 2FMCA 1J6QA 4MV6A 4EBEA 1C9OA 2RSNA 4N8FA 2WKDA 2L4NA 3AEVA 1I3QA 3U9SA 1QG7A 3M9BA 3W3AA 4OWTB 4JYAH 2R85A 1JWSD 1UE5A 2JA8G 3MWDA 4MV1A 3D31A 1CKMA 4O1NA 1WTVA 1EY7A 2ES2A 3CRKC 1TWCA 2I07B 1Z2OX 2OQ0A 3VYTA 3GP7A 3SGIA 2Z8LA 1MGSA 3A8IE 1P16A 1SMYC 1BJTA 2FINB 2YV5A 3T56B 3TQTA 4ED0A 4LUVA 3HKZB 4DNIA 2O5IC 5EPKA 3MVVA 4J0MA 5A2QW 1EOVA 3H09A 3GTLA 3OW2A 1JICA 2DNCA 2WDTA 2A69C 3K81C 3I72A 1LT4D 4A3IB 3JSNA 4DR2Q 2V59A 2KEDA 5AJ3L 1O75A 1PRTC 3ETHA 5KFXA 3K8AA 3LNNA 3S1MH 2J6UA 4LNQA 3GTGB 2F4VL 1SEBD 3I4NH 3RBDA 1SYGA 3DXJC 5ELDA 2XGPA 2W6MA 2WP8J 3D6WA 5M3MG 2B63G 3SE0A 1CTMA 1LTRD 4A3JH 3PR4A 1GSOA 3PW4A 2UVVA 2E2IB 2F4VQ 2IBKA 2D9UA 3G48A 5FD6A 4KD3A 4A3DG 2UVWA 3CQZH 4A75A 1XWEA 2A1AA 4EQOA 4LF6H 3QOLA 3VPBA 4IJHA 1JMCA 2YTXA 2NVYB 5EKKA 3FKIA 4QQBX 4JV2A 1Z2NX 4LUZA 2Q8TA 1Y8OB 4DV3H 2EJGC 1B44D 4IO9A 2R92H 4A3LG 5KG6A 2F1MA 3M4QA 4APVA 2PPBC 1K0RA 4QWEA 1DGSA 2LMCB 5CV9A 4X64Q 4A3LH 2BQUA 1SEIA 2R86A 2NN6H 3V2TA 1DOLA 3W2DA 1TS4A 2WAQE 5FO7B 5JEAG 4YB8B 4LFAH 4CC5A 1RK6A 3HOXG 4LF9L 5HV6A 1KRTA 4RB0A 1UWVA 4DK3C 3F2CA 5EPJA 1IBKL 4WJ4A 4C3HB 2LSSA 4DV1Q 4XYQA 5IP9G 1K83A 1Y14B 4NXNQ 1H95A 4C56C 3OSOA 1XNQL 1B2TA 1F2LA 4IN3A 4FP5D 2EYOA 5GQOA 4FXDA 4KHPL 1CKOA 5KFMA 1A3UA 3ITPA 1Q90A 4LK1C 4XDXA 1KL9A 2F03A 2EYHA 1HZAA 2ICIA 4LMQD 2UUCQ 2Q8IB 1B3AA 1CK1A 3BG3A 1IOWA 2SCUB 1NY4A 2Y0SG 3A0JA 2NVTB 1PZID 4G7ZC 3T1HL 2CQYA 5EJWA 2ASBA 1A6XA 2RQXA 3TN2A 3I4MH 4L5RC 2DJGC 3AB9A 3VR2A 3FVQA 4C1NI 2ZJTA 3ORQA 2AQ3B 2JXMB 3I73A 3GIPA 4A3GB 2R93A 3N43B 2PW7A 4R9WA 3RAXA 1NAPA 1SLJA 5C0XH 2E8GA 3MHBA 2DWCA 2NBFA 2V1CC 1YZ6A 2XWJB 4U673 5FLXE 2I46A 3NE5B 3F8NA 2LS01 3ND9A 4JV1A 1QNKA 2JA7A 2NU8B 3R5HA 2FLNA 1B9NA 3K0XA 4YCVA 4LW1A 4DV6L 4GOPA 1N36L 1II3A 2PNHA 2PN1A 4K6DA 3SK5A 3RGZA 3V6JA 1D5ZC 1AE3A 1BUVT 2B2VA 3D0FA 5C4ZA 4GOPB 3GTJA 1YHBA 3LP8A 2NU7B 2HDLA 2R7DA 4IPHA 4NKLA 1HRJA 2DPJA 3NTIA 2IHFA 4ED1A 3M3YB 1WTWA 1N34H 1PXUA 4YWKA 2OEOA 3W1BA 3S2DH 4O3SA 1Y8PB 4IR9A 5C5JA 1LABA 2K4KA 4BWSC 2HHHQ 4HJ5A 4DR4L 3RN2A 3JAMi 1VAJA 1TS2A 2MQHA 4KN7C 4AQYQ 3OWFA 2MNAA 3S1RB 4LF4H 1FNWA 2JA6A 3OHXC 5C5MA 3S17H 3HFZB 5LL6X 4JI2L 1C3OA 1IYVA 1CA6A 4EFEA 4FXGC 1HNZH 1TA8A 1H9SA 4JI2H 2RF4A 5A2QE 5LL6b 4O3QA 1YJ9A 2WYOA 5DG9A 2RDJA 3B6YA 4A3BB 1AEXA 1WJJA 4DAVA 3H3VI 4EG0A 3K5NA 1SJED 2JJQA 2CQAA 4MNOA 1KDBA 1NMGA 3OUZA 3FKIG 3Q0AA 4J9PA 2VXWA 1XX8A 4KK7A 5JAVA 4A3JB 2G9DA 5J2TF 2R6FA 4MV7A 2FK2A 2CCZA 2DN8A 2F0FA 2PQEA 4XZ3B 4HIMA 1KNAA 2HCCA 1MKHA 3IKJA 1RTOA 3NGDA 4A3GG 2BR0A 4DLKA 1QVGA 2J6TA 4C3JB 3CCLA 1AFPA 3FKIB 4CDEC 1C0AA 1I6HH 3EIVA 1SMXA 2UU9Q 2F3WA 3J81L 2XWBB 3RB6A 2VPQA 2F0LA 3GDEA 4ME5A 4I55F 1FJGQ 5DLFA 2IP4A 5KFPA 2BDOA 5EQ0A 3IG0A 2K5NA 1HNWQ 4X65L 4GC6A 4BBSB 1B53A 3GTKH 4OX9L 2R7FA 5C0XJ 3PW0A 3HKZG 1IBMH 2EYFA 3NEMA 2I0QA 1CFMA 1F9SA 1VDZA 5IYDH 5KFRA 3T5HA 3N52A 1SYBA 4RNNA 3I91A 3OMGA 4JBMA 4X3TA 4UP9A 3KAJA 2O5JC 3OIQA 3HKZA 4A93B 4C3HG 3G6XA 2B2TA 4LWCA 1L2ZA 4L6TB 4X64L 4K0KQ 1U4MA 4U7CA 4WFN3 1V1OA 1EWCA 4IQZA 1MBYA 1ZHQA 5FJ8H 4DFAA 2OH2A 1EZ1A 3HOYB 2CH4A 4U68A 1D5XC 3PUWA 4YY3Q 2HIVA 5FKAC 5EKIA 1VKZA 4BWGB 3GTGH 5L1KA 1PH6A 1ZHSA 3STBD 2LY7A 2SOBA 4JBKA 4ECUA 4IFDI 2JE6I 4C5AA 1UEAB 2JA5G 4DR3Q 4AYBG 5IGFA 3PO3B 5EDWA 4X62L 2LFNA 4DN4M 1E4EA 2PO4A 1WVLA 1CT1D 3QFFA 5TSSA 2K04A 1TWCB 4A3EH 1DXMA 2OTLA 5JJKA 3L3OC 2VOBA 3WWVA 2W57A 1LLRD 3OSNA 4DV2Q 1HNXL 5C3EB 1C4QA 4LF4L 2SDFA 4KJOA 4UAIA 4RZQA 5BMVF 4B3TH 4AYBB 1CSPA 1ONLA 1SNPA 1BVSA 4EVOA 1PTOC 2F0SA 1F9RA 1T5XD 5CV4A 1S9FA 3RZDH 3H0GG 1YHQA 4PDBA 1ZKOA 5D3IB 4OWXB 4BA1I 5I4DA 1RYSA 2EYJA 3PW7A 4A3MH 4HCEA 5DQIA 4DV6H 3C1FA 1N36H 3ZYYX 1N32H 4DU9A 5GAGC 4A3MG 2UUAL 3LMLA 5CBEE 4LF5Q 1K9MC 2JEAI 2E2HA 4TKOB 1ZYRC 1XNQQ 2J6SA 3DF7A 4HMIA 1I94H 2ICEC 2BE5C 2NTTA 1X3QA 4PWQA 3NQTA 4R8UA 5M5WH 1JKJB 3FEWX 4IWYA 3Q8PB 3H15A 2I5MX 3DM3A 4NW2A 3AYHB 5IGDA 1HR0H 1TS5A 4LF7L 5EBDA 3KLSA 2VA3A 1VMPA 4DV1L 2VQFQ 5G3LD 1U4RA 4M8AA 3N42B 4J6HA 2E2JB 2KOLA 3BQ0A 1BO0A 3T1HQ 2MJ8A 1LT6D 3BVMA 4DV7Q 5JJLA 2B2UA 4XQJA 5DG8A 4QIWE 2A68C 4NDXA 5FO8B 2C2RA 1TS3A 3R2TA 5LHY1 3FHWA 2UUBH 4DV3L 1STNA 5IP7G 5HGQA 3HOYG 2P5ZX 1QNUA 5IGCA 4ZQ3A 4A3KG 1EUDB 2O4XA 3NTKA 2CWPA 3KF8A 4PMCA 5L9XA 1SNQA 4UCVA 4C3IH 1A3TA 1O7ZA 2Q2UA 3KHGA 4MAMA 2KA7A 4GNXB 2R93G 1QVFA 2EVBA 1KJ8A 4X64H 2G9HD 1M1KC 4J9QA 4DV0L 1IL8A 3J81i 4EQPA 3Q2OA 3STBC 2PZUA 4GZYC 2KCTA 4DR1L 5M5XB 3C1EA 3VR4A 2A69D 1PYWD 2MHVA 4MN3A 1K3RA 4DR5L 4RNOA 3RV4A 5GAHC 2I5LX 1LUZA 5D65A 4A3FH 4JI3H 2R93B 1XXGA 1RJRA 1B9MA 3KHHA 4CKCA 2VA2A 2DNEA 1BXTA 4IR1A 2K5VA 4HEDA 3D4RA 2K32A 4A3CG 2UXDQ 2B2YA 3A55A 3I55A 4J9OA 4EFBA 4V0BA 4XYLB 2DY8A 5KFEA 1UE6A 2KHJA 2L1BA 1WOCA 2QKIC 3J7ZC 4YCWA 5KYLA 2Y0SE 1WTOA 4LFBL 4DR2H 1STHA 2W6OA 4POFA 1S10A 4R8UB 4BBRB 2AMCB 4JI1L 1BCPB 1SYCA 1JE5A 4CDCC 3CCVA 4EQNA 1W2BA 5FLXW 4F4YA 1GVPA 3CAMA 4NP5A 1CQVA 1Y1VB 2IL8A 1ENAA 1B6RA 4JI1H 1QUQB 1ILPA 2Q2IA 3BZCA 1NJIC 1PH5A 1V1PA 4LFBQ 3NBIA 4X3KA 4UCUA 2ALYB 5J3BA 4YJ2F 3T13A 3EPIA 4KI0A 1Q3LA 4FS2A 1E24A 1JE4A 4EGVA 1HTPA 1VBGA 2DPIA 3DLLA 2C22A 1T94A 1K83B 1HZBA 1Q8KA 1X54A 4DKAC 4HJAA 1EIHA 1JDBB 4O2AF 2HVRA 1RJPA 4DUYH 1D1IA 1GUTA 3RF2A 1XMQL 4Q44A 4QW8A 2F52A 4HJ9A 2WKCA 1S0NA 4BXXG 4DXGA 3C46A 4UCSA 2Q2TA 3EROA 4X66L 1G51A 3G6VA 3JC66 2KVMA 2N8NA 1ENFA 2V4QA 4A3IG 2W8KA 1JJGA 1KAWA 3R5FA 3MR5A 4IALA 2PYKA 3QR8A 4R8NA 4FBUA 1D5MC 3K5OA 2VQEQ 5D1PA 1S68A 4J9NA 1KBLA 3T5LA 4LF8L 1JR0D 2RKSA 4Y7NH 2K28A 4DK6C 2SNMA 2UVUA 2R7ZG 3I4NG 2D0PA 3BA8A 3VR6A 1A0IA 1VQDA 5ELBA 2GN5A 4OX9Q 1SSOA 1N56A 5E7NA 5BR8L 1I5FA 4DL2A 4C3IB 2ZXOA 2XIWA 4JOIC 3I4LA 3K3VA 3CCUA 2JP1A 1SMYD 3HRZC 4FXKC 5EBCA 4DUZL 1VQKA 5KG0A 1RF2D 4ME6A 2NB0A 2TSSA 5C0XG 2K5QA 2GVBA 4LF7H 4DUZH 3C2PA 3PQIA 1KLGD 1EFID 4P2CB 4BY7H 3HXLA 4RAYA 3O13A 4HIOA 2AHOB 4A3BG 5KFZA 4IFDH 3GTMA 1CHQD 5LMNQ 1F2MA 2WB1E 4QWBA 4CJ2C 3T1YL 4NXMQ 4JI4H 3LWUA 3FP9A 2J7ZA 1EYZA 4GN3B 4JI4L 3VR3A 2RCFA 4G4KA 5ELNA 1PHJA 5KRUA 3PIOA 2F3IA 3G6JB 3M3YH 2WIIB 3PN1A 4JUZA 3OPOA 4G7HC 4WORA 1WCMB 2LXKA 1EY8A 2PCFB 1Y8NB 1E4EB 2QK4A 1X6OA 3NK9A 4J9SA 1LV9A 1JWUD 2GVAA 2ZTCA 1U5KA 4YHHQ 5A35A 2OQKA 4ECWA 1A8VA 4IOAA 1F9QA 2UU9H 1SYDA 4ZKCB 1UE1A 1E2ZA 1DV1A 5ELFA 4L5TA 1YVCA 3HOWB 5C3WA 1K83H 1GD7A 5JVLA 1XJVA 5K36H 2W6NA 2W9CA 2K7VA 3S2HH 3S16H 1JQYD 2FMAA 2E2IA 4OXPA 1IBKQ 1EWHA 4YAKB 2IX0A 1TWAA 1OTCA 4MTDA 2OWOA 2C5CA 2DGYA 5J39A 3M9NB 1AP0A 2NZOA 4LF9Q 3N8DA 4A3JG 1NMFA 2FLLA 1FYCA 1G291 4PZ6A 4WD3A 3S1NB 4RUAA 5C1OA 1SYEA 4DR7H 3TBIB 3QWNA 1UNNC 2IW3A 3CKIB 2H4OA 2DLNA 4EBDA 2VQFL 4YCUA 3NWSA 4DL4A 2HCIA 1WSCA 2E5LH 1VQBA 4H7BA 3RAQA 2ZJRA 2HVSA 3F1ZA 3P7JA 3J81W 3WOFA 4JI0H 1SROA 3AMUA 5A2QL 5KG1A 4EGQA 2L15A 4B3SL 1L1OC 5DG7A 1Y1WB 2EDGA 1BGWA 1NBWA 1JDEA 2AUKA 2R7LA 3K5LA 2F4VH 2F0JA 1EIYB 1BDOA 4DR6H 2MPMA 1HNXH 3BABA 1XPOA 3J81c 1IW7C 3M85A 4YWLA 3BDCA 5CYUA 4DF7A 2VUMA 2HHHL 2RDHA 2N78A 1PX2A 4X3UA 4OWWB 2R7ZH 1MHWC 4RB1A 1NR2A 5IT9c 3CCSA 4HSVA 3FMAA 3DHQA 1I4QA 3MA2B 4DV3Q 1S97A 2KEEA 1TWGB 3KK7A 1I3QB 5JEAJ 1L0XB 3UFXB 3MAQA 2K52A 1VCIA 1YNJD 4LF6L 1I4XA 4UCOA 2PZTA 2JEFA 4OHJA 2KSWA 2ZXRA 3PO2H 5IYZF 2IMWP 1LTGD 3UDXA 4O4LF 3GTJB 2Z6KC 3KHRA 1ET9A 4M7EA 1HXYD 5KNDA 3CCEA 4J8QA 5EZYF 1EY0A 4N8X1 4GN5A 5L1JA 4DV5Q 5IT9W 4LF5L 2JA8H 1BQQT 1FGUA 4O2BF 2JA7G 3J7YW 4F87A 4DV6Q 3KALA 4A3DH 1R9TH 1RTNA 1O78A 5KFYA 4LF5H 1FNUA 4UPAA 4JBWA 2SEBD 1S5BD 3OIPA 3KTMA 1BR9A 4DV1H 4LFAL 4KV6A 1LTLA 2K5DA 3GIMA 3GIKA 1HUNA 5ELCA 3KJOA 4JI7L 3QZ7A 2ASDA 1B33N 2V4RA 1R9TA 1ILQA 1QB5D 3Q1KA 1VQAA 3MTSA 4M1UB 2OTJA 5KG5A 4BY7G 2UUBL 5KT2A 1HZCA 4RMFA 2WE6A 2Z4HA 3GQBA 1G6PA 1DCZA 2V5AA 1K8AC 1HZ9A 1EOTA 2EPBA 2M2LA 2NTSA 2BA1A 3H0GH 4R4TA 2NVQB 1QWYA 1K8GA 1UE7A 3BZDB 2UUBQ 4YY3H 4J9LA 5KFUA 2YYZA 1RDPD 3EJIA 1SN8A 2M9VA 1PZKD 1D6EC 4L1KA 1T9HA 5JJZA 1U9RA 4B08A 3CCRA 1N33L 3K3PA 2IA6A 3K80C 3SDZA 1MD2D 2EIFA 5M3MB 4ZKBB 4A3EG 4LSAA 4BS9A 4NPSA 4ULLA 1XTDA 3RB4A 3J7AK 3A74A 3K58A 3RTXA 3RB0A 3OWEB 4MIUA 3IFTA 1XPRA 5JVDF 2Z6KA 1AZPA 3JSLA 5C4XG 2B8GA 1EEID 1A2TA 5E3FA 2QEJC 3PIPA 1FL0A 3PZPA 4DR1Q 3AFPA 2R7MA 5M9OA 4DV2H 1LTID 2X69A 1STBA 4JI0L 2FP4B 3HBLA 1KABA 5FLXc 3SVMA 4B3RQ 4A3EB 4UP7A 1CZWA 3SE7A 4CHTB 4C5CA 3PW2A 4R4QA 4DL7A 3K5IA 5C44H 1K1QA 2WFWA 1MJEA 2RGVA 1HTLD 1TWAH 5M5YB 2QILA 3JAML 5FO9B 1Y1WA 1SNMA 2ZXPA 4DR2L 3CHBD 1DONA 3E3XA 1ZEQX 1GYFA 5C3XA 4AQYH 4BA2I 1E4GT 3N40P 2A73B 1N34L 2W9BA 2E75C 3VYUA 3RNUA 4JI6Q 3K7UC 2KJXA 3S16B 3PVXA 5I6WA 3S2HB 3TMEA 4LFCL 5C44G 2CQOA 2FPGB 1I7NA 4A93H 3BQ1A 1NTGA 3SK6A 1M7JA 4UY8C 5KFWA 3OTOL 1D7QA 2XN9C 2VR1A 3V05A 1G8ZD 4LAAA 5LMNL 2ASLA 5FPOA 2JA6H 1TR5A 4H44C 2J0TD 1N48A 1T3NA 3I4MB 2EXDA 2F0UA 4DUYL 2IT1A 1X3GA 2NUAB 3GLKA 3WO0A 3BJYA 1IBLH 3A8KE 5KT4A 1Z47A 1I6HB 5CBAE 3NWTA 4FF2A 1F2ZA 1KHIA 1WCMH 2NVYA 5F9LA 5C3EG 3J80E 4H02A 5KNCA 4ZI7F 3F2BA 1WCMG 1M0WA 4O3OA 4DUYQ 2R7ZA 5CAEB 3H3VH 2N49A 2BOSA 5CR3A 2ID0A 2XD4A 4FVMA 4HCSA 5DM73 4MA5A 1B7YB 1RIPA 2RHSB 3A5UA 4B3ML 4RHRA 2XTIA 3TP7A 2W9CB 1WCMA 4ECQA 1Q12A 4XXEA 5KFTA 5FLXL 3QB3A 3RGXA 4DL3A 4DV4Q 4DXFA 1GO3E 4IRKA 2NN6I 1B50A 1I50A 1TU2B 1FR3A 3E6ZX 3R2IA 1TVXA 1S5CD 1TWHB 4KLKA 3GTPH 3H3VC 1JIHA 5L1LA 5D14A 4O4HF 4AYBE 5BR8H 5IWAQ 2IX1A 1N33H 3U50C 2R82A 3TZUA 2VY3A 3GTOA 1HUMA 1HA5A 3NPPA 4L5SA 4PG3A 3RJ0A 5JOBA 1CUKA 4CDDC 5KNBA 3HOZB 1ESRA 4P72A 4RGMA 3CCJA 3KHLA 5KFIA 3C0FB 4JV5L 3VMMA 4K5WA 4ZOLF 1E3PA 5DNFA 4O2DA 1YBYA 4TQRA 3RV3A 4CDFC 4OELB 2NVXB 5LOVF 2MO1A 3X3NA 1GOZA 3PF5A 5J1ZA 1MSGA 1VQ7A 4DGZA 2G5DA 1YIJA 3K57A 4ME3A 1GJXA 2XIGA 2YU9A 2NWGA 4DR3H 3SXHA 1BBWA 3LGJA 3MEFA 2B63B 2PMZE 3HOVB 1MIUA 1PTOH 1N9WA 3VPDA 2R84A 5GONF 1ZQ7A 5J22A 2ATWA 2F0TA 1W6JA 5FLMH 1PH1A 3HOVG 1JORA 5BPHA 4PNYA 4NLGA 3VYRA 2F0KA 1VMCA 1OWTA 1O7YA 1EYCA 3TZDA 1J8IA 4X6AH 1WR2A 3BU2A 5GADC 5C4JB 2UXCQ 2K75A 4RKBA 3PO2B 2FLPA 2JA7H 4YWMA 3H91A 2QDBA 2WAQA 4IPGA 5M3FG 2I5HA 3CD6A
chains in the Genus database with same CATH topology
4EQ5A 3E0EA 1VQIA 2A8VA 1HR0W 4DR5Q 1S3OA 1M1KC 1X55A 2KENA 4DV0L 2HT1A 3J81i 4LFAQ 3ERSX 5IYBG 1XNRL 3STBC 4WJ3M 2KCTA 4DR1L 3KF8B 4JOIA 5IP9H 3HKSA 4DR5L 4A76A 1K3RA 2OCEA 1EQQA 4DV7L 3PUVA 5GAHC 2I5LX 1LUZA 2UXDL 4A3FH 3KYHC 1JJCB 2NZHA 1VQEA 4P75A 4A3FG 3J80i 1Y1WH 4O0AA 2JA6G 3PO3H 1IBMQ 1L1OB 3I4OA 2K5VA 5C4JH 2UXDQ 4A3CG 3G71A 1U0LA 2CKZB 2E5LQ 3I55A 3NENA 1B8AA 4A3IH 4GN4B 4JBJA 4ALPA 1QZGA 4LF8Q 4NB3A 4A93G 1X56A 1UE6A 3KDFA 2QA4A 2D0OA 2KHJA 2WAQG 1WOCA 2ZJQA 3HOXH 2R92G 3HOWG 3J7ZC 4YCWA 2Y0SE 1OXTA 1PH3A 4PZ7A 1MJCA 4LFBL 1O7IA 4BXXH 2RCNA 4POFA 5C3EH 1Q86C 3HKZE 2AMCB 4JI1L 3CCVA 1JE5A 3G6EA 3IRBA 4IPGA 1W2BA 1BBUA 2PI2E 1GVPA 3CAMA 3RN5A 4DAMA 2LXJA 4IOCA 3I2ZA 1QUQB 3CPWA 2Q2IA 3BZCA 4DUZQ 1S40A 1NJIC 1PH5A 4LFBQ 2VL6A 2ALYB 5J3BA 1M90C 1PH4A 4KI0A 1XMQQ 4XTCS 1E24A 1KC8C 1VQCA 4FDBA 1J5EL 1CSQA 3DLLA 3CC2A 4GKKQ 4OO1I 1TXYA 3UDIA 2AWOA 1HZBA 1Q8KA 1X54A 2QGQA 2WB1G 4DKAC 4HJAA 3T1YQ 4X62Q 4BY1H 4NXML 1J5EQ 5AJ3Q 4L5QA 1IBML 2E2HH 4K0KL 5K36G 4GOPC 4JI7Q 1J6QA 4X66Q 1XMQL 1C9OA 2UXBQ 3CPFA 2KCMA 2F52A 4HJ9A 4QGUA 2NN6G 1PYSB 4HJ8A 3AEVA 4BXXG 3F2DA 1PFSA 3M9BA 4OWTB 1UE5A 3GTJH 1EQRA 2Q2TA 2JA8G 3D31A 1CKMA 1YI2A 2ES2A 4X65Q 4X66L 1G51A 5DLQE 3JC66 2N8NA 2OQ0A 4A3IG 2VNUD 1K73C 1VQLA 1TWGH 3NBHB 3NELA 1KAWA 4GKJQ 3SGIA 1JJGA 1P16A 3U4ZA 2VQEQ 1JJ2A 2JK8A 1FJGL 4BBRH 3L0OA 2YV5A 4LF8L 5BR8Q 1V9PA 4UP8A 4JI3L 4Y7NH 4DK6C 3GTOH 4LUVA 1N33Q 1E1TA 1LM0A 4AIMA 4DNIA 4DR7L 3G4SA 4JI6L 2R7ZG 1EOVA 3I4NG 2D0PA 3OW2A 4B3MQ 1A0IA 1VQDA 2YTYA 4DV2L 3TS2A 2B3GA 2GN5A 4OX9Q 3K81C 4DAYB 4DR7Q 4GNXA 5E7NA 1X3FA 5BR8L 1I5FA 4DR2Q 5AJ3L 3E9HA 4R4CA 1W3SA 4JG2A 2BA0A 3K8AA 1E7ZA 2FXQA 4JOIC 3S1MH 4LNQA 3CCUA 1VQKA 4DUZL 2F4VL 3I4NH 3ICEA 5C0XG 3HOUH 2R93H 2GVBA 2WP8J 5EAYA 5M3MG 5IWAL 2B63G 4BY7H 4A3JH 2ZM6Q 4HIOA 2AHOB 4A3BG 1JB7A 5LMNQ 3TRZA 2WB1E 1VQOA 3T1YL 4NXMQ 2F4VQ 3OTOQ 3MXNB 3FP9A 2YU9H 3G48A 4IPCA 3KF6B 4A3DG 2UXBL 3CQZH 4GN3B 4JI4L 5ELNA 1PHJA 4A75A 2A1AA 3PIOA 2F3IA 3M3YH 2Z0SA 4IJHA 1JMCA 2LXKA 2YTXA 1X6OA 2CFMA 4QQBX 2ZJPA 3PCOB 3ER0A 3CCMA 4LUZA 3M7NA 1EIFA 1PYBA 5HY6A 2GVAA 3PO2G 2ZTCA 1U5KA 4YHHQ 1PV4A 4IO9A 2R92H 3HOWH 4A3LG 3M4QA 4APVA 2OQKA 1KD1C 1A8VA 2N3SA 1K0RA 1PH2A 4IOAA 4OO1G 1UE1A 1DGSA 4A3LH 4X64Q 3KJPA 1IBLL 3U58A 3S14H 2PQAA 4L5TA 1YVCA 1K83H 1GD7A 2WAQE 5JEAG 3CMEA 1XJVA 1VQJA 3S2HH 2XGTA 1VQ6A 3S16H 3KLWA 4OXPA 3HOXG 1IBKQ 4LF9L 2B63H 2IX0A 3K7AH 1KRTA 1UWVA 1OTCA 4DK3C 3W5OA 2OWOA 3F2CA 3CD6A 2DGYA 1CKNA 2NZOA 3PUXA 1IBKL 4A3JG 1NMFA 4LF9Q 2LSSA 4DV1Q 1G291 4PZ6A 3KFUA 5IP9G 4IFDG 1AH9A 1HJPA 1Y14B 4A4IA 4NXNQ 1H95A 4KHPQ 3TQYA 5M3MH 2VQFL 1XNQL 3S1QH 4YCUA 3PUZA 1IZ6A 1VQBA 2ZJRA 3F1ZA 5GQOA 4KHPL 1CKOA 4JCVE 2ZTDA 1XNRQ 1SROA 2L15A 5LMUL 4JV5Q 1KL9A 4B3SL 4BBRG 4LF7Q 2NVQH 4IJLA 4QL5A 1L1OC 3PO3G 1I3QH 1HZAA 1N32L 1VQNA 2UUCQ 5IE8A 1TWHH 1NBWA 1Q1EA 2VUMG 4DV4L 3I4MG 4PZ8A 1NY4A 1IBLQ 2Y0SG 3A0JA 4LUOA 4P73A 1ASYA 3T1HL 1D8LA 2C35B 1EIYB 2ASBA 3I4MH 4L5RC 1HNZQ 2UXCL 4JI1Q 3KDFB 4JI2Q 1OXUA 1XPOA 3J81c 3M85A 1VS0A 4YWLA 4LF6Q 1S72A 2HHHL 1SLJA 2N78A 2UUAQ 3HOUG 3GD7A 4OWWB 2E8GA 1Q46A 2R7ZH 3GO5A 4PMWA 3RLFA 4KHZA 1IL2A 3GTMH 3I7FA 5IT9c 5ELOA 2V1CC 1YZ6A 3CCSA 4DV3Q 1B70B 1EWIA 4OONA 1Z9FA 4B3TQ 3UDFA 2YTVA 3PUYA 5JEAJ 3ULLA 4QY7A 1P8LA 1C7YA 2K52A 1SR3A 1VCIA 1VQMA 3L7ZC 4LF6L 3PO2H 4DV5L 1QZHA 3K0XA 3UDXA 5FJ8G 2KHIA 2Z6KC 4YCVA 1SRUA 4LW1A 4DV6L 4GOPA 1N36L 1LYLA 1X3EA 2PNHA 3CCEA 3U4VA 4GN5A 4DV5Q 4HJ7A 4JYAQ 4LF5L 1AE3A 2JA8H 1IYJB 1FGUA 3RLNA 2JA7G 3PF4A 4IFDJ 4DV6Q 3D0FA 2KBNA 2NVYH 3F8TA 4JI5L 3RLOA 4GOPB 4MTNA 1R9TH 1N36Q 4A3DH 1N32Q 4Y52H 1YHBA 1WI5A 3S1RH 3PSIA 4UPAA 2R6GA 4JBWA 4AH6A 2R7DA 2UU9L 4IPHA 1WYDA 3CMAA 2IHFA 3HOZG 4HIKA 4DPGA 4LFAL 4GKKL 1YITA 4JYAL 2AWNA 3HOYH 1LTLA 4YWKA 1PVOA 3W1BA 2E2IH 4AQYL 2VW9A 4GLXA 3S2DH 1UEBA 2K4KA 3KJOA 1BKBA 2E2JH 4JI7L 3AQQA 1HR0Q 1SE8A 4HJ5A 2HHHQ 3RN2A 3JAMi 4DR4L 1VQAA 1Y1VH 2JQOA 2MQHA 4AQYQ 4BY7G 2MNAA 2OTJA 4JI0Q 1JT8A 2UUBL 1HZCA 4RMFA 1YNXA 3CC4A 4DR4Q 1VQ9A 1A62A 1G6PA 4GS3A 3S17H 1L0WA 3HFZB 1K8AC 5IY0A 1HZ9A 3I56A 4JI8Q 2BA1A 3H0GH 3E9IA 4R4TA 4JI2L 1A63A 1K8GA 1HNWL 1UE7A 2UUBQ 4P74A 2VS1A 2YYZA 4GNXC 4JI8L 1SN8A 2RF4A 3J81j 1OXSC 1T9HA 5H1SE 1YJ9A 3B6YA 2QEXA 3CCRA 1WJJA 1N33L 3CP0A 3H3VI 3K80C 4B3TL 2EIFA 2JJQA 4A3EG 1GKHA 5M5XH 4MNOA 2VZAA 1NE3A 1XTDA 4NPSA 1NMGA 3UE1A 3A74A 3FKIG 1IXRA 1VQFA 3ZJYC 4XIGS 2MO0A 1PH9A 1XPRA 2H5XA 2Z6KA 2CCZA 3Q8DA 3S1NH 5C4XG 4HIMA 3PIPA 1MKHA 1FL0A 1Q81C 4B3RL 4DR1Q 3AFPA 4A3GG 1KIXA 5M3FH 1FVIA 4R1JA 1QVGA 1V1QA 4GLAC 4JI0L 1TWCH 3CCLA 4JC0A 3ULJA 1C0AA 5FLXc 1I6HH 4B3RQ 3EIVA 1SMXA 3TEHB 4GKJL 3AFQA 4BY1G 2UU9Q 1Q1BA 4UP7A 3CXCA 2HQLA 4JI3Q 3GDEA 2K50A 4R4QA 1PH7A 1FJGQ 5C44H 4A3KH 4POGA 2K14A 2K5NA 4X65L 1HNWQ 2WFWA 1MJEA 1I94L 3GTKH 1N34Q 3CW2C 1TWAH 4OX9L 2R7FA 2AKWB 5IP7H 1HR0L 4P71A 5C0XJ 1X9NA 1EFWA 2JA9A 3HKZG 5FLMG 1KQSA 3HOVH 3NEMA 4DR2L 2I0QA 3TREA 5IYDH 1ASZA 1WFQA 2JA5H 4JBMA 5IYDG 1CKNB 4BA2I 1I94Q 4IPDA 1SFOH 1N34L 4UP9A 4LF4Q 2MFIA 3GTLH 3JAMc 3BJUA 4WJ4A 3RNUA 3L2PA 4JI6Q 2BH2A 3K7UC 1YJWA 1VQ8A 2A19A 2B29A 4LWCA 4X64L 4K0KQ 3CF5A 2ZTEA 3KOJA 3PV0A 4LFCL 5C44G 2CQOA 2HIXA 5GROA 5FJ8H 4A93H 1NTGA 4UY8C 3PUWA 3OTOL 1D7QA 2JEBI 1HH2P 4A3CH 4YY3Q 2HIVA 4DR3L 3CC7A 5LMNL 5JJIA 4GLVB 3UDGA 1YEZA 2JA6H 3GTGH 1PH6A 3STBD 1VQGA 4MZ9A 4JBKA 1Q7YC 4IFDI 2JE6I 1Y1WG 2EXDA 4LFCQ 4DUYL 4BBSH 2IT1A 5LMUQ 1X3GA 2JA5G 4DR3Q 4AYBG 1Z47A 4X62L 1EYGA 4A3BH 1KHIA 1KRSA 1WCMH 4YY3L 4DR6Q 5C3EG 1HNXQ 1EUJA 1RL2A 4YHHL 4EX5A 4H02A 3F2BA 3EBEA 1WCMG 1X65A 4TQUS 1V43A 3UE0A 3FKIH 5IYCG 2ZM6L 4C3JH 4DUYQ 2K5HA 3H3VH 2N49A 2IY5B 4A3EH 2OTLA 1I50H 1GM5A 2ID0A 3J7A5 5JJKA 1B7YB 3WWVA 3RZOH 1RIPA 2RHSB 3A5UA 1E22A 4B3ML 4DV2Q 1VQPA 1HNXL 4LF4L 2XTIA 2EQSA 5IYBH 1Q12A 1CSPA 1OXXK 1TWFH 1BVSA 5C0XI 2PQAB 1QUQA 4DV4Q 4A3GH 3RZDH 2VQEL 1GO3E 3H0GG 4RG1A 1YHQA 1N8RC 3S15H 2NN6I 5GAEC 1PA6A 4OWXB 5C4XH 4BA1I 4KLKA 3GTPH 4A3MH 2NVTH 5IYCH 4AYBE 4DV0Q 5IWAQ 5GAGC 3BZKA 4A3MG 1XMOL 2UUAL 3U50C 2IX1A 3M4PA 5LMNW 4LF5Q 4R4OA 2VY3A 4R4IA 1L2FA 1K9MC 4L5SA 2Q2HA 4PG3A 2D62A 1XNQQ 2JEAI 1CUKA 4DR6L 4P72A 3CCJA 3KF6A 1XPUA 5M5WH 1VQ4A 3H15A 4JV5L 2I5MX 3OYYA 1XMOQ 3DM3A 3AYHB 2UUCL 3PGZA 1E3PA 4O2DA 1YBYA 4NXNL 1AE2A 4LF7L 1Y1VG 4DV1L 4BBSG 2RHQB 2VQFQ 4C3HH 2MO1A 2CWAA 3PF5A 3T1HQ 4JI5Q 3W1GA 4DV7Q 1VQ7A 3GTQH 1L1OA 1YIJA 4HIDA 3CCQA 4ME3A 5JJLA 4QIWE 1BBWA 3LGJA 3MEFA 2PMZE 4JI4Q 4B3SQ 2DUDA 1MIUA 2IHEA 3FHWA 1N9WA 4DV3L 1YJNA 1E1OA 5IP7G 1KXLA 5HGQA 2ATWA 3S24A 3HOYG 5FLMH 1PH1A 3HOVG 1PH8A 1VQHA 4A3KG 3HOZH 4TVAB 4J15A 2CWPA 2E5LL 3A5ZB 2VUMH 4QJFA 5M5YH 1VQ5A 3M4OH 2PI2A 4C2MH 1OXVA 4X6AH 4C3IH 3BU2A 5GADC 3TS0A 1Q82C 1HNZL 2Q2UA 2K75A 3ULPA 2UXCQ 3EN2A 4GNXB 2JA7H 4YWMA 2BH8A 2R93G 3J80c 3VDYA 1QVCA 1YHAA 5M3FG 1QVFA 3RR5A 2I5HA 2NVXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ5 A;  3E0E A;  1VQI A;  2A8V A;  1HR0 W;  4DR5 Q;  1S3O A;  1M1K C;  1X55 A;  2KEN A;  4DV0 L;  2HT1 A;  3J81 i;  4LFA Q;  3ERS X;  5IYB G;  1XNR L;  3STB C;  4WJ3 M;  2KCT A;  4DR1 L;  3KF8 B;  4JOI A;  5IP9 H;  3HKS A;  4DR5 L;  4A76 A;  1K3R A;  2OCE A;  1EQQ A;  4DV7 L;  3PUV A;  5GAH C;  2I5L X;  1LUZ A;  2UXD L;  4A3F H;  3KYH C;  1JJC B;  2NZH A;  1VQE A;  4P75 A;  4A3F G;  3J80 i;  1Y1W H;  4O0A A;  2JA6 G;  3PO3 H;  1IBM Q;  1L1O B;  3I4O A;  2K5V A;  5C4J H;  2UXD Q;  4A3C G;  3G71 A;  1U0L A;  2CKZ B;  2E5L Q;  3I55 A;  3NEN A;  1B8A A;  4A3I H;  4GN4 B;  4JBJ A;  4ALP A;  1QZG A;  4LF8 Q;  4NB3 A;  4A93 G;  1X56 A;  1UE6 A;  3KDF A;  2QA4 A;  2D0O A;  2KHJ A;  2WAQ G;  1WOC A;  2ZJQ A;  3HOX H;  2R92 G;  3HOW G;  3J7Z C;  4YCW A;  2Y0S E;  1OXT A;  1PH3 A;  4PZ7 A;  1MJC A;  4LFB L;  1O7I A;  4BXX H;  2RCN A;  4POF A;  5C3E H;  1Q86 C;  3HKZ E;  2AMC B;  4JI1 L;  3CCV A;  1JE5 A;  3G6E A;  3IRB A;  4IPG A;  1W2B A;  1BBU A;  2PI2 E;  1GVP A;  3CAM A;  3RN5 A;  4DAM A;  2LXJ A;  4IOC A;  3I2Z A;  1QUQ B;  3CPW A;  2Q2I A;  3BZC A;  4DUZ Q;  1S40 A;  1NJI C;  1PH5 A;  4LFB Q;  2VL6 A;  2ALY B;  5J3B A;  1M90 C;  1PH4 A;  4KI0 A;  1XMQ Q;  4XTC S;  1E24 A;  1KC8 C;  1VQC A;  4FDB A;  1J5E L;  1CSQ A;  3DLL A;  3CC2 A;  4GKK Q;  4OO1 I;  1TXY A;  3UDI A;  2AWO A;  1HZB A;  1Q8K A;  1X54 A;  2QGQ A;  2WB1 G;  4DKA C;  4HJA A;  3T1Y Q;  4X62 Q;  4BY1 H;  4NXM L;  1J5E Q;  5AJ3 Q;  4L5Q A;  1IBM L;  2E2H H;  4K0K L;  5K36 G;  4GOP C;  4JI7 Q;  1J6Q A;  4X66 Q;  1XMQ L;  1C9O A;  2UXB Q;  3CPF A;  2KCM A;  2F52 A;  4HJ9 A;  4QGU A;  2NN6 G;  1PYS B;  4HJ8 A;  3AEV A;  4BXX G;  3F2D A;  1PFS A;  3M9B A;  4OWT B;  1UE5 A;  3GTJ H;  1EQR A;  2Q2T A;  2JA8 G;  3D31 A;  1CKM A;  1YI2 A;  2ES2 A;  4X65 Q;  4X66 L;  1G51 A;  5DLQ E;  3JC6 6;  2N8N A;  2OQ0 A;  4A3I G;  2VNU D;  1K73 C;  1VQL A;  1TWG H;  3NBH B;  3NEL A;  1KAW A;  4GKJ Q;  3SGI A;  1JJG A;  1P16 A;  3U4Z A;  2VQE Q;  1JJ2 A;  2JK8 A;  1FJG L;  4BBR H;  3L0O A;  2YV5 A;  4LF8 L;  5BR8 Q;  1V9P A;  4UP8 A;  4JI3 L;  4Y7N H;  4DK6 C;  3GTO H;  4LUV A;  1N33 Q;  1E1T A;  1LM0 A;  4AIM A;  4DNI A;  4DR7 L;  3G4S A;  4JI6 L;  2R7Z G;  1EOV A;  3I4N G;  2D0P A;  3OW2 A;  4B3M Q;  1A0I A;  1VQD A;  2YTY A;  4DV2 L;  3TS2 A;  2B3G A;  2GN5 A;  4OX9 Q;  3K81 C;  4DAY B;  4DR7 Q;  4GNX A;  5E7N A;  1X3F A;  5BR8 L;  1I5F A;  4DR2 Q;  5AJ3 L;  3E9H A;  4R4C A;  1W3S A;  4JG2 A;  2BA0 A;  3K8A A;  1E7Z A;  2FXQ A;  4JOI C;  3S1M H;  4LNQ A;  3CCU A;  1VQK A;  4DUZ L;  2F4V L;  3I4N H;  3ICE A;  5C0X G;  3HOU H;  2R93 H;  2GVB A;  2WP8 J;  5EAY A;  5M3M G;  5IWA L;  2B63 G;  4BY7 H;  4A3J H;  2ZM6 Q;  4HIO A;  2AHO B;  4A3B G;  1JB7 A;  5LMN Q;  3TRZ A;  2WB1 E;  1VQO A;  3T1Y L;  4NXM Q;  2F4V Q;  3OTO Q;  3MXN B;  3FP9 A;  2YU9 H;  3G48 A;  4IPC A;  3KF6 B;  4A3D G;  2UXB L;  3CQZ H;  4GN3 B;  4JI4 L;  5ELN A;  1PHJ A;  4A75 A;  2A1A A;  3PIO A;  2F3I A;  3M3Y H;  2Z0S A;  4IJH A;  1JMC A;  2LXK A;  2YTX A;  1X6O A;  2CFM A;  4QQB X;  2ZJP A;  3PCO B;  3ER0 A;  3CCM A;  4LUZ A;  3M7N A;  1EIF A;  1PYB A;  5HY6 A;  2GVA A;  3PO2 G;  2ZTC A;  1U5K A;  4YHH Q;  1PV4 A;  4IO9 A;  2R92 H;  3HOW H;  4A3L G;  3M4Q A;  4APV A;  2OQK A;  1KD1 C;  1A8V A;  2N3S A;  1K0R A;  1PH2 A;  4IOA A;  4OO1 G;  1UE1 A;  1DGS A;  4A3L H;  4X64 Q;  3KJP A;  1IBL L;  3U58 A;  3S14 H;  2PQA A;  4L5T A;  1YVC A;  1K83 H;  1GD7 A;  2WAQ E;  5JEA G;  3CME A;  1XJV A;  1VQJ A;  3S2H H;  2XGT A;  1VQ6 A;  3S16 H;  3KLW A;  4OXP A;  3HOX G;  1IBK Q;  4LF9 L;  2B63 H;  2IX0 A;  3K7A H;  1KRT A;  1UWV A;  1OTC A;  4DK3 C;  3W5O A;  2OWO A;  3F2C A;  3CD6 A;  2DGY A;  1CKN A;  2NZO A;  3PUX A;  1IBK L;  4A3J G;  1NMF A;  4LF9 Q;  2LSS A;  4DV1 Q;  1G29 1;  4PZ6 A;  3KFU A;  5IP9 G;  4IFD G;  1AH9 A;  1HJP A;  1Y14 B;  4A4I A;  4NXN Q;  1H95 A;  4KHP Q;  3TQY A;  5M3M H;  2VQF L;  1XNQ L;  3S1Q H;  4YCU A;  3PUZ A;  1IZ6 A;  1VQB A;  2ZJR A;  3F1Z A;  5GQO A;  4KHP L;  1CKO A;  4JCV E;  2ZTD A;  1XNR Q;  1SRO A;  2L15 A;  5LMU L;  4JV5 Q;  1KL9 A;  4B3S L;  4BBR G;  4LF7 Q;  2NVQ H;  4IJL A;  4QL5 A;  1L1O C;  3PO3 G;  1I3Q H;  1HZA A;  1N32 L;  1VQN A;  2UUC Q;  5IE8 A;  1TWH H;  1NBW A;  1Q1E A;  2VUM G;  4DV4 L;  3I4M G;  4PZ8 A;  1NY4 A;  1IBL Q;  2Y0S G;  3A0J A;  4LUO A;  4P73 A;  1ASY A;  3T1H L;  1D8L A;  2C35 B;  1EIY B;  2ASB A;  3I4M H;  4L5R C;  1HNZ Q;  2UXC L;  4JI1 Q;  3KDF B;  4JI2 Q;  1OXU A;  1XPO A;  3J81 c;  3M85 A;  1VS0 A;  4YWL A;  4LF6 Q;  1S72 A;  2HHH L;  1SLJ A;  2N78 A;  2UUA Q;  3HOU G;  3GD7 A;  4OWW B;  2E8G A;  1Q46 A;  2R7Z H;  3GO5 A;  4PMW A;  3RLF A;  4KHZ A;  1IL2 A;  3GTM H;  3I7F A;  5IT9 c;  5ELO A;  2V1C C;  1YZ6 A;  3CCS A;  4DV3 Q;  1B70 B;  1EWI A;  4OON A;  1Z9F A;  4B3T Q;  3UDF A;  2YTV A;  3PUY A;  5JEA J;  3ULL A;  4QY7 A;  1P8L A;  1C7Y A;  2K52 A;  1SR3 A;  1VCI A;  1VQM A;  3L7Z C;  4LF6 L;  3PO2 H;  4DV5 L;  1QZH A;  3K0X A;  3UDX A;  5FJ8 G;  2KHI A;  2Z6K C;  4YCV A;  1SRU A;  4LW1 A;  4DV6 L;  4GOP A;  1N36 L;  1LYL A;  1X3E A;  2PNH A;  3CCE A;  3U4V A;  4GN5 A;  4DV5 Q;  4HJ7 A;  4JYA Q;  4LF5 L;  1AE3 A;  2JA8 H;  1IYJ B;  1FGU A;  3RLN A;  2JA7 G;  3PF4 A;  4IFD J;  4DV6 Q;  3D0F A;  2KBN A;  2NVY H;  3F8T A;  4JI5 L;  3RLO A;  4GOP B;  4MTN A;  1R9T H;  1N36 Q;  4A3D H;  1N32 Q;  4Y52 H;  1YHB A;  1WI5 A;  3S1R H;  3PSI A;  4UPA A;  2R6G A;  4JBW A;  4AH6 A;  2R7D A;  2UU9 L;  4IPH A;  1WYD A;  3CMA A;  2IHF A;  3HOZ G;  4HIK A;  4DPG A;  4LFA L;  4GKK L;  1YIT A;  4JYA L;  2AWN A;  3HOY H;  1LTL A;  4YWK A;  1PVO A;  3W1B A;  2E2I H;  4AQY L;  2VW9 A;  4GLX A;  3S2D H;  1UEB A;  2K4K A;  3KJO A;  1BKB A;  2E2J H;  4JI7 L;  3AQQ A;  1HR0 Q;  1SE8 A;  4HJ5 A;  2HHH Q;  3RN2 A;  3JAM i;  4DR4 L;  1VQA A;  1Y1V H;  2JQO A;  2MQH A;  4AQY Q;  4BY7 G;  2MNA A;  2OTJ A;  4JI0 Q;  1JT8 A;  2UUB L;  1HZC A;  4RMF A;  1YNX A;  3CC4 A;  4DR4 Q;  1VQ9 A;  1A62 A;  1G6P A;  4GS3 A;  3S17 H;  1L0W A;  3HFZ B;  1K8A C;  5IY0 A;  1HZ9 A;  3I56 A;  4JI8 Q;  2BA1 A;  3H0G H;  3E9I A;  4R4T A;  4JI2 L;  1A63 A;  1K8G A;  1HNW L;  1UE7 A;  2UUB Q;  4P74 A;  2VS1 A;  2YYZ A;  4GNX C;  4JI8 L;  1SN8 A;  2RF4 A;  3J81 j;  1OXS C;  1T9H A;  5H1S E;  1YJ9 A;  3B6Y A;  2QEX A;  3CCR A;  1WJJ A;  1N33 L;  3CP0 A;  3H3V I;  3K80 C;  4B3T L;  2EIF A;  2JJQ A;  4A3E G;  1GKH A;  5M5X H;  4MNO A;  2VZA A;  1NE3 A;  1XTD A;  4NPS A;  1NMG A;  3UE1 A;  3A74 A;  3FKI G;  1IXR A;  1VQF A;  3ZJY C;  4XIG S;  2MO0 A;  1PH9 A;  1XPR A;  2H5X A;  2Z6K A;  2CCZ A;  3Q8D A;  3S1N H;  5C4X G;  4HIM A;  3PIP A;  1MKH A;  1FL0 A;  1Q81 C;  4B3R L;  4DR1 Q;  3AFP A;  4A3G G;  1KIX A;  5M3F H;  1FVI A;  4R1J A;  1QVG A;  1V1Q A;  4GLA C;  4JI0 L;  1TWC H;  3CCL A;  4JC0 A;  3ULJ A;  1C0A A;  5FLX c;  1I6H H;  4B3R Q;  3EIV A;  1SMX A;  3TEH B;  4GKJ L;  3AFQ A;  4BY1 G;  2UU9 Q;  1Q1B A;  4UP7 A;  3CXC A;  2HQL A;  4JI3 Q;  3GDE A;  2K50 A;  4R4Q A;  1PH7 A;  1FJG Q;  5C44 H;  4A3K H;  4POG A;  2K14 A;  2K5N A;  4X65 L;  1HNW Q;  2WFW A;  1MJE A;  1I94 L;  3GTK H;  1N34 Q;  3CW2 C;  1TWA H;  4OX9 L;  2R7F A;  2AKW B;  5IP7 H;  1HR0 L;  4P71 A;  5C0X J;  1X9N A;  1EFW A;  2JA9 A;  3HKZ G;  5FLM G;  1KQS A;  3HOV H;  3NEM A;  4DR2 L;  2I0Q A;  3TRE A;  5IYD H;  1ASZ A;  1WFQ A;  2JA5 H;  4JBM A;  5IYD G;  1CKN B;  4BA2 I;  1I94 Q;  4IPD A;  1SFO H;  1N34 L;  4UP9 A;  4LF4 Q;  2MFI A;  3GTL H;  3JAM c;  3BJU A;  4WJ4 A;  3RNU A;  3L2P A;  4JI6 Q;  2BH2 A;  3K7U C;  1YJW A;  1VQ8 A;  2A19 A;  2B29 A;  4LWC A;  4X64 L;  4K0K Q;  3CF5 A;  2ZTE A;  3KOJ A;  3PV0 A;  4LFC L;  5C44 G;  2CQO A;  2HIX A;  5GRO A;  5FJ8 H;  4A93 H;  1NTG A;  4UY8 C;  3PUW A;  3OTO L;  1D7Q A;  2JEB I;  1HH2 P;  4A3C H;  4YY3 Q;  2HIV A;  4DR3 L;  3CC7 A;  5LMN L;  5JJI A;  4GLV B;  3UDG A;  1YEZ A;  2JA6 H;  3GTG H;  1PH6 A;  3STB D;  1VQG A;  4MZ9 A;  4JBK A;  1Q7Y C;  4IFD I;  2JE6 I;  1Y1W G;  2EXD A;  4LFC Q;  4DUY L;  4BBS H;  2IT1 A;  5LMU Q;  1X3G A;  2JA5 G;  4DR3 Q;  4AYB G;  1Z47 A;  4X62 L;  1EYG A;  4A3B H;  1KHI A;  1KRS A;  1WCM H;  4YY3 L;  4DR6 Q;  5C3E G;  1HNX Q;  1EUJ A;  1RL2 A;  4YHH L;  4EX5 A;  4H02 A;  3F2B A;  3EBE A;  1WCM G;  1X65 A;  4TQU S;  1V43 A;  3UE0 A;  3FKI H;  5IYC G;  2ZM6 L;  4C3J H;  4DUY Q;  2K5H A;  3H3V H;  2N49 A;  2IY5 B;  4A3E H;  2OTL A;  1I50 H;  1GM5 A;  2ID0 A;  3J7A 5;  5JJK A;  1B7Y B;  3WWV A;  3RZO H;  1RIP A;  2RHS B;  3A5U A;  1E22 A;  4B3M L;  4DV2 Q;  1VQP A;  1HNX L;  4LF4 L;  2XTI A;  2EQS A;  5IYB H;  1Q12 A;  1CSP A;  1OXX K;  1TWF H;  1BVS A;  5C0X I;  2PQA B;  1QUQ A;  4DV4 Q;  4A3G H;  3RZD H;  2VQE L;  1GO3 E;  3H0G G;  4RG1 A;  1YHQ A;  1N8R C;  3S15 H;  2NN6 I;  5GAE C;  1PA6 A;  4OWX B;  5C4X H;  4BA1 I;  4KLK A;  3GTP H;  4A3M H;  2NVT H;  5IYC H;  4AYB E;  4DV0 Q;  5IWA Q;  5GAG C;  3BZK A;  4A3M G;  1XMO L;  2UUA L;  3U50 C;  2IX1 A;  3M4P A;  5LMN W;  4LF5 Q;  4R4O A;  2VY3 A;  4R4I A;  1L2F A;  1K9M C;  4L5S A;  2Q2H A;  4PG3 A;  2D62 A;  1XNQ Q;  2JEA I;  1CUK A;  4DR6 L;  4P72 A;  3CCJ A;  3KF6 A;  1XPU A;  5M5W H;  1VQ4 A;  3H15 A;  4JV5 L;  2I5M X;  3OYY A;  1XMO Q;  3DM3 A;  3AYH B;  2UUC L;  3PGZ A;  1E3P A;  4O2D A;  1YBY A;  4NXN L;  1AE2 A;  4LF7 L;  1Y1V G;  4DV1 L;  4BBS G;  2RHQ B;  2VQF Q;  4C3H H;  2MO1 A;  2CWA A;  3PF5 A;  3T1H Q;  4JI5 Q;  3W1G A;  4DV7 Q;  1VQ7 A;  3GTQ H;  1L1O A;  1YIJ A;  4HID A;  3CCQ A;  4ME3 A;  5JJL A;  4QIW E;  1BBW A;  3LGJ A;  3MEF A;  2PMZ E;  4JI4 Q;  4B3S Q;  2DUD A;  1MIU A;  2IHE A;  3FHW A;  1N9W A;  4DV3 L;  1YJN A;  1E1O A;  5IP7 G;  1KXL A;  5HGQ A;  2ATW A;  3S24 A;  3HOY G;  5FLM H;  1PH1 A;  3HOV G;  1PH8 A;  1VQH A;  4A3K G;  3HOZ H;  4TVA B;  4J15 A;  2CWP A;  2E5L L;  3A5Z B;  2VUM H;  4QJF A;  5M5Y H;  1VQ5 A;  3M4O H;  2PI2 A;  4C2M H;  1OXV A;  4X6A H;  4C3I H;  3BU2 A;  5GAD C;  3TS0 A;  1Q82 C;  1HNZ L;  2Q2U A;  2K75 A;  3ULP A;  2UXC Q;  3EN2 A;  4GNX B;  2JA7 H;  4YWM A;  2BH8 A;  2R93 G;  3J80 c;  3VDY A;  1QVC A;  1YHA A;  5M3F G;  1QVF A;  3RR5 A;  2I5H A;  2NVX H; 
#chains in the Genus database with same CATH topology
 2F0D A;  1SFO A;  3E0E A;  1VQI A;  4KY7 A;  1O80 A;  1Q8I A;  1X55 A;  2KEN A;  2QF7 A;  1DIK A;  4MV4 A;  2B2W C;  5KFC A;  2F0Q A;  3I8Z A;  5D3D A;  1KLU D;  1SCU B;  2EYP A;  5IP9 H;  1Y69 U;  1G91 A;  4A76 A;  2OCE A;  4LSX A;  3EVQ A;  5KYI A;  1BCP F;  3KLR A;  4ED6 A;  1YNN C;  5CV5 A;  4KY5 A;  2R8G A;  2F0P A;  4WJW A;  4P75 A;  1CQJ B;  5I2Y A;  1TT2 A;  3D8G A;  4J9M A;  4IUT A;  5ELE A;  1Y1W H;  4O0A A;  1K1S A;  2XRQ D;  3PO3 H;  1IBM Q;  1O7L A;  5C4J H;  1PFM A;  4MV3 A;  4IZO A;  4KJN A;  5C4X B;  2JEI A;  5KGU A;  2E5L Q;  2B2U C;  1QZG A;  4RZR A;  4IAJ A;  2EYM A;  4NB3 A;  3L9A X;  4A3F B;  1X56 A;  2NZ1 D;  5IGB A;  4ECY A;  2QA4 A;  1E2W A;  5C4H A;  3GTO B;  3HOW G;  1QJO A;  2R92 G;  3HOX H;  4IUN A;  5FPR A;  3R3O A;  2GPW A;  1O7I A;  2YS7 A;  4LMY A;  3G6E A;  2A6H C;  2F0G A;  4F4W A;  3LX0 A;  4RGT A;  5T14 A;  1BBU A;  4APM A;  4IOC A;  2BQR A;  2OXP A;  1EU3 A;  4DUZ Q;  3BAA A;  1M90 C;  4HYK A;  5KIX A;  5C5L A;  5LMN H;  3MR6 A;  4FDB A;  4TRD A;  1AN7 A;  1CSQ A;  1GUG A;  2VQD A;  2R92 B;  3CC2 A;  4OO1 I;  2AWO A;  2WB1 G;  5L1I A;  3EYY A;  2YS6 A;  4ZCK A;  4X62 Q;  2AGP A;  4KHV A;  1J5E Q;  3RBE A;  4GOP C;  3G6Y A;  3M9M B;  2UXB Q;  4A3K B;  3VA5 A;  5FOB B;  3CPF A;  4UCT A;  4QGU A;  2ZT9 C;  1PYS B;  4HJ8 A;  2F4I A;  1BBX C;  3BYT B;  2FHT A;  2Q8R E;  2K6A A;  3F2D A;  1WD1 A;  1EUC B;  1PFS A;  2W71 A;  2XC9 A;  4YHH H;  2AQ4 A;  1SAP A;  1I6U A;  1EQR A;  1NSN S;  2C2E A;  3H4D A;  5DLQ E;  2V4D A;  3DEO A;  1EIG A;  1RD9 D;  2VNU D;  1K73 C;  1EU4 A;  1PRT D;  1RKN A;  1VQL A;  4OIK A;  3NBH B;  2R3Z A;  4GKJ Q;  4ILW A;  2GA4 B;  2E76 C;  5DGA A;  5C8Y F;  3U4Z A;  3I4N B;  3N41 B;  4Y8V B;  1JJ2 A;  1HFG A;  2JYO A;  3RZO B;  2F3V A;  1FJG L;  1K0S A;  4HTH A;  1V9P A;  1EHI A;  4JI3 L;  2P0A A;  2L5T A;  1E1T A;  1LM0 A;  4AIM A;  3G4S A;  4JI6 L;  3DWP A;  3HP3 A;  2KHS A;  4ZLT F;  1XNQ H;  5HBR B;  4B3M Q;  1AUX A;  3TS2 A;  3T5K A;  1KNE A;  2L12 A;  2B3G A;  4DAY B;  3A56 A;  4DR7 Q;  1PLF A;  5IOD A;  3PR5 B;  4KHP H;  1X3F A;  1EY5 A;  3ND8 A;  1H9J A;  1W3S A;  1UAP A;  1AW7 A;  2BA0 A;  4JG2 A;  5KG7 A;  2FXQ A;  4JI8 H;  3GIL A;  3Q8R B;  4ECV A;  1KJ9 A;  3GV7 B;  3ICE A;  1IHZ A;  1JB3 A;  2K33 A;  3M9O B;  1D1K A;  2FB9 A;  4LFB H;  5IWA L;  3MR3 A;  5KFS A;  2ZM6 Q;  4RWS C;  3V4S A;  2EJM A;  1ZXT A;  1TKW B;  2IWH A;  3S2D B;  4WRD A;  2ASJ A;  3OTO Q;  3MXN B;  5C1P A;  2B2W A;  3D4D A;  3Q6S A;  2ZDQ A;  4RGN A;  3F2U A;  2ZDG A;  3S14 B;  1NNX A;  4YR2 A;  3K7A B;  1Z2P X;  2YCH A;  4KD4 A;  4R7R A;  2ZJP A;  3ER0 A;  1I7L A;  4OO1 H;  1EIF A;  5HY6 A;  3TP6 A;  3J81 E;  3E5S A;  4QW9 A;  4OO1 G;  2EXZ A;  1S03 G;  2R8K A;  5K5P A;  2RDI A;  5JEA H;  5DGB A;  3U58 A;  3S14 H;  4FF1 A;  2WAQ B;  1EY9 A;  5T1G A;  3CME A;  2FKL A;  4IUP A;  5CV8 A;  1VQJ A;  3L4J A;  4CGY B;  1VQ6 A;  1IKM A;  4JPB W;  3SR1 A;  2B63 H;  5IGE A;  3K7A H;  3GV6 A;  2JA5 A;  2R87 A;  4ECS A;  3W5O A;  2KEC A;  3VPC A;  4ZAI A;  2Z6B A;  1CKN A;  2XRS D;  3PUX A;  4QUF A;  4JV5 Q;  1TY2 A;  2W70 A;  1HFN A;  1KDA A;  4IFD G;  4YQW A;  1HJP A;  1TWF B;  4A4I A;  4KKS A;  1VBH A;  3TQY A;  3V4Z A;  3DM1 A;  1CZG A;  4I7Z C;  4RB3 C;  1XDN A;  2M05 A;  2UXD H;  2Z9H A;  1NUC A;  3H4B A;  2X6G A;  4JVZ A;  2ZTD A;  2A74 C;  1XNR Q;  3NUC A;  5LMU L;  3VYS A;  4LF7 Q;  5DQG A;  4IJL A;  1N32 L;  2YZN A;  2PMZ A;  2FE3 A;  5IE8 A;  1SNC A;  2VUM G;  5LMU H;  3I4M G;  1HHV A;  1IBL Q;  3MFH A;  3L4K A;  1D8L A;  2C35 B;  4TSS A;  3SI8 A;  3QIA A;  5KG3 A;  4JI1 Q;  3KDF B;  3DMU A;  2CHB D;  1VS0 A;  5HGT A;  5IIF A;  5LL6 S;  1PTO B;  2YZM A;  1SE4 A;  2UUA Q;  3HOU G;  4Q0F A;  4ED3 A;  1Q46 A;  4ZK9 B;  5JPN C;  3GO5 A;  3HS0 C;  1X3P A;  4KHZ A;  3GTM H;  3I7F A;  3RFC A;  1STE A;  5ELO A;  1WTX A;  4B9X A;  3IFD A;  4OON A;  1SE2 A;  2F0I A;  2YTV A;  3PUY A;  3UDF A;  4QMG A;  3ULL A;  3MFG A;  4G57 A;  4QY7 A;  1C7Y A;  3M4O B;  2VUM B;  4A2A A;  1SR3 A;  1VQM A;  2W7O A;  1SFO B;  1K3B C;  1BF4 A;  1R4Q B;  2A6H D;  4DV5 L;  1QZH A;  1WH2 A;  4I65 A;  2KHI A;  1SRU A;  1B4O A;  4O4I F;  1LYL A;  1X3E A;  1QE6 A;  4A3D B;  1F2Y A;  3I3C A;  3RLN A;  3TP8 A;  2B8F A;  2MGS A;  4X65 H;  5E4X A;  2NVY H;  4JI5 L;  5IWA H;  1GUN A;  3RLO A;  4Y52 H;  2ATL A;  1WI5 A;  3S1R H;  1M4V A;  4AH6 A;  2NU6 B;  4LF9 H;  3CMA A;  4S3S A;  1ULZ A;  4GKK L;  4HIK A;  1S4Z A;  4DPG A;  2ZDH A;  3MXN A;  2AWN A;  2CVR A;  2CW8 A;  5CC4 A;  2E2I H;  2A5H A;  3GTM B;  2VW9 A;  3N6X A;  1UEB A;  1STA A;  2E2J H;  1BKB A;  3KBG A;  2YU9 B;  1SE8 A;  4QWA A;  1V1P B;  3BDO A;  3CQZ B;  2AQ1 B;  5D1O B;  5BN5 A;  2FPP B;  4JI0 Q;  1ICW A;  1YNX A;  3CC4 A;  4O3N A;  3G7L A;  2N55 A;  2EOT A;  1A62 A;  4JI6 H;  4O3R A;  1L0W A;  3PIO 3;  3BG5 A;  3SHL A;  2L11 A;  3KBX A;  2EYL A;  2DY7 A;  4PQX A;  4E6I A;  1DZ1 A;  2AGQ A;  3BS1 A;  1GXD C;  5EOY A;  4P74 A;  2VS1 A;  4GNX C;  4JI8 L;  4U6P A;  3J81 j;  3S1M B;  1OXS C;  5H1S E;  2QEX A;  1PRT B;  1C8C A;  5I9P A;  5M3F B;  3P1H A;  4B3T L;  5BN3 A;  1RJQ A;  4O3P A;  3CU7 A;  1JOK A;  3KUP A;  4MV9 A;  3UE1 A;  1NE3 A;  2K03 A;  3RZD B;  3FDS A;  1UNS A;  5KX5 F;  1IXR A;  4ABN A;  3I90 A;  3S15 B;  1VQF A;  2V58 A;  1TWF A;  5KFG A;  1BXR A;  1PH9 A;  4UDU C;  3OUU A;  5CA1 F;  2H5X A;  3Q8D A;  3S1N H;  4ZQI A;  1WTQ A;  5KFN A;  3OHA A;  2X6L A;  2ALZ A;  4B3R L;  2HUG A;  1KIX A;  5M3F H;  1FVI A;  4EYH B;  4GLA C;  1TWC H;  4JC0 A;  3TP5 A;  4UFZ A;  4GKJ L;  4BY1 G;  3NHH A;  1Q1B A;  4MTE A;  2HQL A;  4N9P A;  3DWA A;  4ZUI A;  1PH7 A;  2JA7 B;  2ENB A;  2K14 A;  3OMC A;  5FK9 C;  2F0H A;  5KFA A;  3AU7 A;  1TY0 A;  1HR0 L;  2AKW B;  3GQC A;  4P71 A;  2E2D C;  1EFW A;  5FLM G;  3HOV H;  4PV1 C;  1L0Y B;  4HMJ A;  3Q24 A;  5IT9 L;  1ASZ A;  1WFQ A;  1SYX B;  1EY6 A;  1BCP C;  2JA5 H;  1C48 A;  5IYD G;  1DOK A;  4IPD A;  3GTL H;  1FGB D;  1RHP A;  3BJU A;  3LWE A;  4DR4 H;  3L2P A;  3EPG A;  1VQ8 A;  2A19 A;  2B29 A;  4IUQ A;  3MWE A;  4EYI B;  3CF5 A;  5D8D A;  3KOJ A;  3PV0 A;  2B2V C;  5KFB A;  2HIX A;  4DAY A;  2HGS A;  4MV8 A;  3GII A;  3URY A;  2R8I A;  2A6E D;  2E74 C;  1HH2 P;  1M0T A;  1YEZ A;  2OF1 A;  2PZW A;  1LTT D;  4ZUJ A;  1Q7Y C;  1Y1W G;  1CM9 A;  4BBS H;  4L8J A;  4MHE A;  4DR6 Q;  4YY3 L;  4GKK H;  1HNX Q;  1RL2 A;  1GGO A;  4YHH L;  4EX5 A;  2UVR A;  2KUM A;  5BN4 A;  3HEJ A;  3EBE A;  4H0L C;  4DK0 A;  1X65 A;  4IZ8 A;  4TQU S;  4EGJ A;  2EY2 A;  1V43 A;  3FKI H;  3SEB A;  1U4P A;  4C3J H;  2ZM6 L;  2K5H A;  2C00 A;  2IY5 B;  3SK8 A;  1I50 H;  4QF4 A;  4DR1 H;  4RUC A;  2HQE A;  1JOO A;  3RZO H;  1E22 A;  1CQF A;  2UXC H;  5F9N A;  3D3R A;  1WTR A;  4Q43 A;  5IYB H;  1OXX K;  2O2L D;  1VF7 A;  1WTP A;  4N9T A;  1HA6 A;  5C0X I;  4G3I A;  2HVQ A;  1K28 A;  5I47 A;  4DR5 H;  4AYB A;  4HNV A;  1PA6 A;  5C4X H;  3VA7 A;  2Z4I A;  4DV5 H;  1UC9 A;  4RB2 C;  5CV7 A;  1RK5 A;  2FMM A;  3BYY B;  3BZK A;  1XMO L;  4F4X A;  1DV2 A;  5LMN W;  5KFD A;  1I4H A;  1R4P B;  4R4I A;  1L2F A;  4OEM B;  4O42 A;  4HAE A;  1YNJ C;  4ED7 A;  1HPC A;  3MFY A;  1XPU A;  3K5H A;  1VQ4 A;  5HUR A;  1XMO Q;  1S0O A;  1TQO A;  4XT3 B;  2RDG A;  3CRL C;  1QOH A;  1Y1V G;  1XYI A;  4BBS G;  1PFB A;  2B2T C;  2GPS A;  2I80 A;  4Q45 A;  2V9W A;  4OL7 A;  5D1O A;  1ET6 A;  4HN7 A;  4JI5 Q;  2RSO A;  3GTQ H;  4CJ1 B;  1MZB A;  1L1O A;  3H0G A;  4LFC H;  3MZ5 A;  3WOE A;  4CJ0 B;  3JRX A;  4NMZ A;  4C2M A;  4J9K A;  4B3S Q;  2BE5 D;  3HOX B;  3OTO H;  1TII D;  1U4L A;  5JVH 3;  1E1O A;  1EQV A;  1EYA A;  3JZI A;  5AFW A;  2KCN A;  1KXL A;  2D2C C;  1PTO F;  5C44 B;  3HOU B;  1GUO A;  2EY1 A;  4TVA B;  2E5L L;  2XNA C;  1PFN A;  4ECZ A;  3A5Z B;  5M5Y H;  1PDQ A;  2PI2 A;  2C9O A;  1STY A;  1OXV A;  4C2M H;  1Q82 C;  3ULP A;  5F2D A;  5LYJ F;  4QB4 A;  4RKL A;  1UC8 A;  2XCP A;  2BH8 A;  4X62 H;  3I12 A;  1S0M A;  1YHA A;  2CW0 D;  4DL5 A;  1ENC A;  2NVX H;  2YZG A;  1KEE A;  2A6E C;  4TUY F;  1HR0 W;  1KJI A;  1S3O A;  5DQH A;  1TWG A;  1SXT A;  3QG1 A;  4LFA Q;  4C1N K;  2O03 A;  2JSO A;  4HSP A;  4JOI A;  4B3R H;  1S5D D;  5EWF A;  5EGT A;  4FNF A;  4F50 A;  2UXD L;  2W8L A;  1JJC B;  2C2D A;  3K59 A;  4K8J A;  3NQI A;  2JEG A;  1VQE A;  5KFF A;  3J80 W;  4A3F G;  4GKJ H;  2IX3 A;  5KT5 A;  2R8J A;  4IUR A;  1L1O B;  3H0G B;  1LTA D;  2VB2 X;  3FPU B;  1U0L A;  1GSH A;  1BNC A;  1B8A A;  4DA2 A;  4GN4 B;  3NXW A;  4YJ3 F;  1AN8 A;  3E5N A;  4I4T F;  1I4P A;  3KDF A;  5FD5 A;  2WB1 A;  2D0O A;  4FM9 A;  4UHV A;  2WAQ G;  4JW0 A;  2W6Q A;  4F88 A;  1OXT A;  2L55 A;  1MJC A;  4B9W A;  3RMH A;  1IKL A;  1ZYR D;  1Q86 C;  1IOV A;  3K5M A;  3S1Q B;  3HKZ E;  3C3L A;  1E4F T;  3N44 B;  1ZET A;  4EEY A;  1HCZ A;  1F9P A;  1H9K A;  3RN5 A;  3Q8S B;  1G2S A;  2NYZ D;  3NTH A;  1I4R A;  3I2Z A;  3E0J A;  3CPW A;  4DL6 A;  4I7A A;  1IYU A;  2N88 A;  3GTL B;  5JVG 3;  3A7A B;  1PH4 A;  5EPL A;  1XMQ Q;  5E1F A;  4CC6 A;  1VQC A;  1J5E L;  1LO5 D;  2JA8 B;  3D6C A;  4OGQ C;  4BY7 B;  1GUW A;  1M6V A;  3MXG A;  3ORR A;  2QGQ A;  4BY1 H;  2JEJ A;  4Q8F A;  4CKE A;  5AJ3 Q;  1IBM L;  2E2H H;  4K0K L;  5K36 G;  4JI7 Q;  4X66 Q;  2I87 A;  2KCM A;  2NN6 G;  3JAM W;  1JOQ A;  1W96 A;  3GTJ H;  4K5V A;  2AGO A;  2PBZ A;  1YI2 A;  4X65 Q;  2R7Z B;  2AQ2 B;  2BQ3 A;  1NR4 A;  4M9U A;  1JC7 A;  4DV4 H;  2NVX A;  1DYQ A;  2R8H A;  3TSS A;  1SYF A;  3GTK A;  1JX4 A;  3NEL A;  1TWG H;  2EE1 A;  2PW5 A;  1JCK B;  1A3V A;  4KN4 C;  4V19 0;  2J4X A;  4KMU C;  5DEH A;  4R8I A;  2JK8 A;  3R93 A;  2QYZ A;  3QOJ A;  4BBR H;  3L0O A;  4DV0 H;  5KFO A;  5BR8 Q;  3GTP A;  4UP8 A;  3IAY A;  3GTO H;  1C30 A;  1N33 Q;  4DR7 L;  2EJF C;  4LH6 A;  2OT2 A;  4XQN A;  2WAC A;  1AUV A;  5KEE A;  2YTY A;  4DV2 L;  1DJR D;  5KFQ A;  2WIN B;  1GHJ A;  4GNX A;  3GIQ A;  3BVG A;  3E9H A;  4R4C A;  3J7A V;  2XGQ A;  1E7Z A;  1TWH A;  1E2V A;  1KJQ A;  2I8C A;  4TV9 F;  1RCV D;  4XYM B;  2JA6 B;  2W9B B;  3P20 A;  2SNS A;  2F0O A;  5JPM C;  2FJZ A;  1SDF A;  3HOU H;  2R93 H;  2B39 A;  2VB3 X;  5EAY A;  2UUC H;  2HJW A;  4YR3 A;  2H1E A;  2BCO A;  1JB7 A;  1CA5 A;  3H20 A;  3TRZ A;  1VQO A;  4IHJ F;  3DEP A;  1GLV A;  1FD7 D;  2IJ0 A;  3RB3 A;  2YU9 H;  3R8B A;  3GTQ B;  4IPC A;  3KF6 B;  1CI3 M;  2UXB L;  4RAU C;  1A9X A;  3M4I A;  5EKL A;  3NSW A;  2F0M A;  2Z0S A;  3KAK A;  2UUA H;  3K0Y A;  2UXB H;  2CFM A;  3PCO B;  1HQM C;  3CCM A;  4I50 F;  3M7N A;  3T16 A;  1PZJ D;  1PYB A;  3PO2 G;  1PV4 A;  3HOW H;  3BQ2 A;  1KD1 C;  4A2B A;  2N3S A;  1PH2 A;  4HNU A;  3GTK B;  1MI2 A;  1EQT A;  3KJP A;  1KDC A;  1IBL L;  1SBB B;  2PQA A;  5H80 A;  1EY4 A;  5KT7 A;  1I6V C;  3TQ1 A;  1DD2 A;  3MXU A;  2K5W A;  2XGT A;  2K01 A;  3KLW A;  5EWG A;  3WNZ A;  2XCL A;  3KXY T;  4KKT A;  1EZ6 A;  4QWD A;  5T1I A;  3WO1 A;  2W9A A;  3KFU A;  4B3M H;  1EEF D;  4I7H A;  2DZD A;  1Y1V A;  4YIJ A;  3TIG A;  1AH9 A;  5CB4 F;  4HQ6 A;  1R9T B;  2XCA A;  1CQI B;  3R5X A;  2KQ3 A;  4KHP Q;  4DNT B;  5M3M H;  3S1Q H;  2FK3 A;  2VPS A;  1IW7 D;  4K0K H;  3PUZ A;  3T53 B;  1IZ6 A;  1BOS A;  1EL0 A;  2Z1C A;  3LWB A;  4LF8 H;  2F0W A;  4JCV E;  3V6K A;  5JUM A;  3M4Y A;  1SND A;  1TAE A;  2F0V A;  4BBR G;  2NVQ H;  4QL5 A;  3PO3 G;  1I3Q H;  4RH6 A;  4ED2 A;  1VQN A;  1LAC A;  2HDM A;  3EQL C;  1TWH H;  3GTP B;  5LXT F;  1Q1E A;  2ZM6 H;  4DV4 L;  4TQS A;  3PW5 A;  4PZ8 A;  2MUY A;  1ASY A;  4LUO A;  4P73 A;  3K6O A;  3OW7 A;  2R7K A;  4ZHQ F;  4FO2 A;  5L37 A;  4DK1 A;  1LTB D;  3SK4 A;  1HNZ Q;  3T5J A;  4XYO A;  2UXC L;  4JI2 Q;  3CVZ A;  1OXU A;  2EY5 A;  3RIZ A;  3Q22 A;  1EYD A;  3EA6 A;  4C5B A;  4IUV A;  4LF6 Q;  3N6R A;  4OIJ A;  1S72 A;  3GD7 A;  1V51 A;  2VUG A;  2CZG A;  3TII A;  4PMW A;  3RLF A;  1IL2 A;  4WBN F;  1BCP D;  4EBC A;  1B70 B;  1EWI A;  4RGO S;  1Z9F A;  4B3T Q;  4EEQ A;  1W93 A;  3T1Y H;  1P8L A;  1J5E H;  1CE8 A;  3L7Z C;  1H9R A;  1GHK A;  3D4W A;  5FJ8 G;  5KFJ A;  1VF5 C;  1QIL A;  4RU9 A;  3U4V A;  2R92 A;  4ID6 A;  4HJ7 A;  4JYA Q;  1IYJ B;  1X32 A;  1XTC D;  3PF4 A;  4IFD J;  2KBN A;  3F8T A;  1N36 Q;  1N32 Q;  2FK1 A;  4MTN A;  5EWE A;  1K8M A;  4QIW B;  3PSI A;  3ONA B;  2R6G A;  2AU0 A;  2UU9 L;  1WYD A;  2EY6 A;  3HOZ G;  2A68 D;  3T4A C;  1J9O A;  1YIT A;  2M00 A;  3HOY H;  4JYA L;  1V4Y A;  4NXN H;  1PVO A;  3QJY A;  2KCC A;  4AQY L;  5CA0 F;  4GLX A;  2FFK B;  5IGG A;  3AQQ A;  1HR0 Q;  1FKA H;  4F4Z A;  4KY6 A;  1Y1V H;  2JQO A;  4CKB A;  3VR5 A;  2WB1 B;  2VQF H;  3GV3 A;  1JT8 A;  2DJF C;  3GTG A;  1KAA A;  4DR4 Q;  1VQ9 A;  4GS3 A;  4GC7 A;  5IY0 A;  1TWA B;  5G3L F;  3I56 A;  4JI8 Q;  1CHP D;  2FJ2 A;  2QCP X;  2F0N A;  3E9I A;  1SE3 A;  2R7N A;  2YRX A;  1A63 A;  1H9M A;  1HNW L;  2W6Z A;  4UCR A;  4B3S H;  2RA4 A;  1GSA A;  4IWX A;  3QZ8 A;  3HG9 A;  1K8O A;  5COR A;  1H9S B;  4K5X A;  5DLG A;  1FNV A;  5J2U F;  4YP3 A;  2RGR A;  4ZRZ A;  5NUC A;  3CP0 A;  3V96 A;  2CH4 W;  3H94 A;  4XX0 B;  1JWM D;  1GKH A;  5M5X H;  1G6Z A;  2VZA A;  3S9W A;  4CBV A;  4XQQ A;  1WTH A;  1I4G A;  3MFI A;  3ZJY C;  4XIG S;  2MO0 A;  4Z9C B;  1Z7T A;  4K14 A;  2K1B A;  1Q81 C;  4K2K A;  4K2L A;  4R1J A;  4DNR B;  1V1Q A;  2XVS A;  3HB9 A;  3ULJ A;  3JAM E;  1I50 B;  3TEH B;  3TDQ A;  3AFQ A;  3MR2 A;  4C3I G;  3CXC A;  4MA0 A;  4JV0 A;  5KG4 A;  4JI3 Q;  3PIP 3;  2K50 A;  1W6K A;  3UQ8 A;  4FBT A;  3ETJ A;  4A3K H;  4POG A;  2C28 A;  1I94 L;  5KT6 A;  1N34 Q;  3CW2 C;  5IP7 H;  3OSP A;  4F8M A;  1X9N A;  2JA9 A;  4X3S A;  1KQS A;  2DIK A;  2QW7 A;  4K6L A;  1V8Q A;  4ED8 A;  3TRE A;  2AUJ D;  4JK1 C;  4BY1 B;  1RYR A;  4JV5 H;  3TIN A;  1CKN B;  1I94 Q;  1SFO H;  4LF4 Q;  2MFI A;  4ECT A;  1M8A A;  3HGB A;  3JAM c;  4IRD A;  2BH2 A;  2JA5 B;  1YJW A;  1MSH A;  2RVL A;  2ZTE A;  1A2U A;  1DM0 B;  5GRO A;  1SJH D;  2PMZ B;  4ECR A;  3MC0 B;  2JEB I;  1XNR H;  4A3C H;  4DR3 L;  3CC7 A;  5JJI A;  4GLV B;  3UDG A;  1CS0 A;  1ML0 D;  4RAZ A;  1VQG A;  2Y0S B;  4MZ9 A;  1STG A;  4G7O C;  4DV7 H;  3OHB A;  1ESF A;  3J7A F;  4LFC Q;  5LMU Q;  1ICF B;  3M7G A;  2CW0 C;  5M5W B;  3GID A;  2YRW A;  3FPP A;  2PNR C;  3U9O A;  1JXL A;  1EYG A;  4A3B H;  1KRS A;  2RBM A;  5DAU A;  3Q23 A;  4RHS A;  1EUJ A;  2YW2 A;  1G2T A;  3BDL A;  4RNM A;  4ECX A;  4PMB A;  2YYA A;  5KFH A;  3UE0 A;  5IYC G;  4L63 B;  4QIW A;  2L0C A;  4HR7 A;  2XSC A;  4QCL A;  4H13 C;  1GM5 A;  2TMP A;  3J7A 5;  4Q5V A;  1KTK A;  1YNN D;  2F0E A;  5COY A;  1VQP A;  2NUC A;  4LH7 A;  3P75 A;  5JH7 F;  4YR0 A;  1S5E D;  2EQS A;  3MWM A;  4FYD A;  1TWF H;  3JRW A;  1JLL B;  5CMD A;  4XT1 B;  5ISR A;  3NBH A;  2QDL A;  2PQA B;  1QUQ A;  3KLS X;  3DWQ A;  5I9O A;  4A3G H;  3T51 B;  2VQE L;  4RG1 A;  1N8R C;  4HNT A;  2WV6 D;  3S15 H;  4YAJ B;  5GAE C;  1HNW H;  1F77 A;  4RFB A;  2LKV A;  1T5E A;  2VQE H;  2NVT H;  3BA9 A;  4C2M B;  5I6Y A;  5IYC H;  4DV0 Q;  5C6A A;  5BPF A;  3M4P A;  1SNO A;  4R4O A;  4RCO A;  2PVP A;  4J1M A;  2Q2H A;  2D62 A;  2X0S A;  3EFX D;  4ETS A;  4DR6 L;  5LP6 F;  3RUP A;  2EZV A;  3KF6 A;  1LT5 D;  3A7L A;  1GUS A;  3OYY A;  3X3M A;  3MJF A;  2UUC L;  3PGZ A;  4ZYS A;  2HHH H;  4NXN L;  1S5F D;  1AE2 A;  4YBZ B;  3QO2 A;  2RHQ B;  3FRP B;  3FMC A;  1QCB D;  4C3H H;  3GV5 B;  2CWA A;  5E4W C;  1AZQ A;  3W1G A;  1LT3 D;  1UUP A;  3CCQ A;  1A15 A;  4HID A;  3GIJ A;  4JI4 Q;  2YL2 A;  2DUD A;  2JN4 A;  2IHE A;  5KFK A;  2CW7 A;  2IPK D;  1YJN A;  4E4T A;  2E2H B;  1D2B A;  1B1Z A;  3S24 A;  3G8C A;  5K2M A;  3CQZ A;  3I70 A;  3MXP A;  1PH8 A;  1VQH A;  3HOZ H;  2BDN A;  3V6H A;  3BVZ A;  3A54 A;  4J15 A;  1XMQ H;  5KFV A;  4FF4 A;  3UI2 A;  3RUZ A;  4QJF A;  1VQ5 A;  2VUM H;  3M4O H;  3H40 A;  5KT3 A;  3TS0 A;  3WDN A;  1HNZ L;  2MP1 A;  1OO9 B;  3EN2 A;  1PK8 A;  4HR7 B;  3J80 c;  3VDY A;  1QVC A;  4KTA A;  2WTF A;  3RR5 A;  2D5D A;  4JI7 H;  5LA6 F;  4X66 H;  4EQ5 A;  5CGK A;  5KKN B;  2A8V A;  4QUC A;  3DUZ A;  4DR5 Q;  1DOM A;  5DM6 3;  2RDF A;  2HT1 A;  2L9H A;  3ERS X;  1EZ8 A;  3IL8 A;  5IYB G;  1Z6H A;  1XNR L;  4WJ3 M;  2FPI B;  3Q8Q B;  2OLS A;  1IBK H;  3KF8 B;  1EQQ A;  3HKS A;  4IUU A;  3H6M A;  4DV7 L;  2Y0S A;  1PMR A;  3PUV A;  5I2X A;  3KYH C;  1FJG H;  4C3J G;  2NZH A;  3A8J E;  2GLT A;  2MCT A;  3U9T A;  3J80 i;  4KKU A;  3GTQ A;  4K8I A;  1PTO D;  4LJZ C;  4FF3 A;  4RCN A;  2JA6 G;  3I4O A;  5CV6 A;  1LTS D;  2R61 A;  4A3M B;  3R23 A;  1XMO H;  4Q8E A;  3G71 A;  2CKZ B;  4DAP A;  2HD3 A;  3NEN A;  5IOC A;  4A3I H;  4JBJ A;  4ALP A;  4LF8 Q;  3S17 B;  5IT9 E;  2W6P A;  4A93 G;  5KFL A;  4IRC A;  1WD0 A;  4OX9 H;  3MWY W;  4Y7N B;  2ZJQ A;  4TV8 F;  2K05 A;  3T1H H;  4F7X A;  1B3Q A;  1B6S A;  1PH3 A;  4PZ7 A;  4FS1 A;  4JI5 H;  1ROD A;  4BXX H;  2RCN A;  5C3E H;  2B63 A;  1E0B A;  3GV8 B;  3RD4 A;  3IRB A;  4ODG A;  3MEH A;  5JQW A;  2PI2 E;  1KJJ A;  3NP8 A;  4RA8 A;  4DAM A;  2LXJ A;  2W7P A;  4MTK A;  2B2Y C;  3ERQ A;  1S40 A;  2VL6 A;  3PMF A;  1KC7 A;  2J9G A;  5KG2 A;  3IN5 A;  4QWC A;  4XTC S;  3HZX A;  4J9R A;  1KC8 C;  1PRT F;  3OOC A;  2NU9 B;  4NXM H;  1BNZ A;  1RJT A;  3FDT A;  1T36 A;  1B04 A;  1HQR D;  4GKK Q;  4Q0Y A;  1TXY A;  3UDI A;  3T1Y Q;  4NXM L;  4FU0 A;  1NCV A;  4L5Q A;  3J80 L;  2FMC A;  1J6Q A;  4MV6 A;  4EBE A;  1C9O A;  2RSN A;  4N8F A;  2WKD A;  2L4N A;  3AEV A;  1I3Q A;  3U9S A;  1QG7 A;  3M9B A;  3W3A A;  4OWT B;  4JYA H;  2R85 A;  1JWS D;  1UE5 A;  2JA8 G;  3MWD A;  4MV1 A;  3D31 A;  1CKM A;  4O1N A;  1WTV A;  1EY7 A;  2ES2 A;  3CRK C;  1TWC A;  2I07 B;  1Z2O X;  2OQ0 A;  3VYT A;  3GP7 A;  3SGI A;  2Z8L A;  1MGS A;  3A8I E;  1P16 A;  1SMY C;  1BJT A;  2FIN B;  2YV5 A;  3T56 B;  3TQT A;  4ED0 A;  4LUV A;  3HKZ B;  4DNI A;  2O5I C;  5EPK A;  3MVV A;  4J0M A;  5A2Q W;  1EOV A;  3H09 A;  3GTL A;  3OW2 A;  1JIC A;  2DNC A;  2WDT A;  2A69 C;  3K81 C;  3I72 A;  1LT4 D;  4A3I B;  3JSN A;  4DR2 Q;  2V59 A;  2KED A;  5AJ3 L;  1O75 A;  1PRT C;  3ETH A;  5KFX A;  3K8A A;  3LNN A;  3S1M H;  2J6U A;  4LNQ A;  3GTG B;  2F4V L;  1SEB D;  3I4N H;  3RBD A;  1SYG A;  3DXJ C;  5ELD A;  2XGP A;  2W6M A;  2WP8 J;  3D6W A;  5M3M G;  2B63 G;  3SE0 A;  1CTM A;  1LTR D;  4A3J H;  3PR4 A;  1GSO A;  3PW4 A;  2UVV A;  2E2I B;  2F4V Q;  2IBK A;  2D9U A;  3G48 A;  5FD6 A;  4KD3 A;  4A3D G;  2UVW A;  3CQZ H;  4A75 A;  1XWE A;  2A1A A;  4EQO A;  4LF6 H;  3QOL A;  3VPB A;  4IJH A;  1JMC A;  2YTX A;  2NVY B;  5EKK A;  3FKI A;  4QQB X;  4JV2 A;  1Z2N X;  4LUZ A;  2Q8T A;  1Y8O B;  4DV3 H;  2EJG C;  1B44 D;  4IO9 A;  2R92 H;  4A3L G;  5KG6 A;  2F1M A;  3M4Q A;  4APV A;  2PPB C;  1K0R A;  4QWE A;  1DGS A;  2LMC B;  5CV9 A;  4X64 Q;  4A3L H;  2BQU A;  1SEI A;  2R86 A;  2NN6 H;  3V2T A;  1DOL A;  3W2D A;  1TS4 A;  2WAQ E;  5FO7 B;  5JEA G;  4YB8 B;  4LFA H;  4CC5 A;  1RK6 A;  3HOX G;  4LF9 L;  5HV6 A;  1KRT A;  4RB0 A;  1UWV A;  4DK3 C;  3F2C A;  5EPJ A;  1IBK L;  4WJ4 A;  4C3H B;  2LSS A;  4DV1 Q;  4XYQ A;  5IP9 G;  1K83 A;  1Y14 B;  4NXN Q;  1H95 A;  4C56 C;  3OSO A;  1XNQ L;  1B2T A;  1F2L A;  4IN3 A;  4FP5 D;  2EYO A;  5GQO A;  4FXD A;  4KHP L;  1CKO A;  5KFM A;  1A3U A;  3ITP A;  1Q90 A;  4LK1 C;  4XDX A;  1KL9 A;  2F03 A;  2EYH A;  1HZA A;  2ICI A;  4LMQ D;  2UUC Q;  2Q8I B;  1B3A A;  1CK1 A;  3BG3 A;  1IOW A;  2SCU B;  1NY4 A;  2Y0S G;  3A0J A;  2NVT B;  1PZI D;  4G7Z C;  3T1H L;  2CQY A;  5EJW A;  2ASB A;  1A6X A;  2RQX A;  3TN2 A;  3I4M H;  4L5R C;  2DJG C;  3AB9 A;  3VR2 A;  3FVQ A;  4C1N I;  2ZJT A;  3ORQ A;  2AQ3 B;  2JXM B;  3I73 A;  3GIP A;  4A3G B;  2R93 A;  3N43 B;  2PW7 A;  4R9W A;  3RAX A;  1NAP A;  1SLJ A;  5C0X H;  2E8G A;  3MHB A;  2DWC A;  2NBF A;  2V1C C;  1YZ6 A;  2XWJ B;  4U67 3;  5FLX E;  2I46 A;  3NE5 B;  3F8N A;  2LS0 1;  3ND9 A;  4JV1 A;  1QNK A;  2JA7 A;  2NU8 B;  3R5H A;  2FLN A;  1B9N A;  3K0X A;  4YCV A;  4LW1 A;  4DV6 L;  4GOP A;  1N36 L;  1II3 A;  2PNH A;  2PN1 A;  4K6D A;  3SK5 A;  3RGZ A;  3V6J A;  1D5Z C;  1AE3 A;  1BUV T;  2B2V A;  3D0F A;  5C4Z A;  4GOP B;  3GTJ A;  1YHB A;  3LP8 A;  2NU7 B;  2HDL A;  2R7D A;  4IPH A;  4NKL A;  1HRJ A;  2DPJ A;  3NTI A;  2IHF A;  4ED1 A;  3M3Y B;  1WTW A;  1N34 H;  1PXU A;  4YWK A;  2OEO A;  3W1B A;  3S2D H;  4O3S A;  1Y8P B;  4IR9 A;  5C5J A;  1LAB A;  2K4K A;  4BWS C;  2HHH Q;  4HJ5 A;  4DR4 L;  3RN2 A;  3JAM i;  1VAJ A;  1TS2 A;  2MQH A;  4KN7 C;  4AQY Q;  3OWF A;  2MNA A;  3S1R B;  4LF4 H;  1FNW A;  2JA6 A;  3OHX C;  5C5M A;  3S17 H;  3HFZ B;  5LL6 X;  4JI2 L;  1C3O A;  1IYV A;  1CA6 A;  4EFE A;  4FXG C;  1HNZ H;  1TA8 A;  1H9S A;  4JI2 H;  2RF4 A;  5A2Q E;  5LL6 b;  4O3Q A;  1YJ9 A;  2WYO A;  5DG9 A;  2RDJ A;  3B6Y A;  4A3B B;  1AEX A;  1WJJ A;  4DAV A;  3H3V I;  4EG0 A;  3K5N A;  1SJE D;  2JJQ A;  2CQA A;  4MNO A;  1KDB A;  1NMG A;  3OUZ A;  3FKI G;  3Q0A A;  4J9P A;  2VXW A;  1XX8 A;  4KK7 A;  5JAV A;  4A3J B;  2G9D A;  5J2T F;  2R6F A;  4MV7 A;  2FK2 A;  2CCZ A;  2DN8 A;  2F0F A;  2PQE A;  4XZ3 B;  4HIM A;  1KNA A;  2HCC A;  1MKH A;  3IKJ A;  1RTO A;  3NGD A;  4A3G G;  2BR0 A;  4DLK A;  1QVG A;  2J6T A;  4C3J B;  3CCL A;  1AFP A;  3FKI B;  4CDE C;  1C0A A;  1I6H H;  3EIV A;  1SMX A;  2UU9 Q;  2F3W A;  3J81 L;  2XWB B;  3RB6 A;  2VPQ A;  2F0L A;  3GDE A;  4ME5 A;  4I55 F;  1FJG Q;  5DLF A;  2IP4 A;  5KFP A;  2BDO A;  5EQ0 A;  3IG0 A;  2K5N A;  1HNW Q;  4X65 L;  4GC6 A;  4BBS B;  1B53 A;  3GTK H;  4OX9 L;  2R7F A;  5C0X J;  3PW0 A;  3HKZ G;  1IBM H;  2EYF A;  3NEM A;  2I0Q A;  1CFM A;  1F9S A;  1VDZ A;  5IYD H;  5KFR A;  3T5H A;  3N52 A;  1SYB A;  4RNN A;  3I91 A;  3OMG A;  4JBM A;  4X3T A;  4UP9 A;  3KAJ A;  2O5J C;  3OIQ A;  3HKZ A;  4A93 B;  4C3H G;  3G6X A;  2B2T A;  4LWC A;  1L2Z A;  4L6T B;  4X64 L;  4K0K Q;  1U4M A;  4U7C A;  4WFN 3;  1V1O A;  1EWC A;  4IQZ A;  1MBY A;  1ZHQ A;  5FJ8 H;  4DFA A;  2OH2 A;  1EZ1 A;  3HOY B;  2CH4 A;  4U68 A;  1D5X C;  3PUW A;  4YY3 Q;  2HIV A;  5FKA C;  5EKI A;  1VKZ A;  4BWG B;  3GTG H;  5L1K A;  1PH6 A;  1ZHS A;  3STB D;  2LY7 A;  2SOB A;  4JBK A;  4ECU A;  4IFD I;  2JE6 I;  4C5A A;  1UEA B;  2JA5 G;  4DR3 Q;  4AYB G;  5IGF A;  3PO3 B;  5EDW A;  4X62 L;  2LFN A;  4DN4 M;  1E4E A;  2PO4 A;  1WVL A;  1CT1 D;  3QFF A;  5TSS A;  2K04 A;  1TWC B;  4A3E H;  1DXM A;  2OTL A;  5JJK A;  3L3O C;  2VOB A;  3WWV A;  2W57 A;  1LLR D;  3OSN A;  4DV2 Q;  1HNX L;  5C3E B;  1C4Q A;  4LF4 L;  2SDF A;  4KJO A;  4UAI A;  4RZQ A;  5BMV F;  4B3T H;  4AYB B;  1CSP A;  1ONL A;  1SNP A;  1BVS A;  4EVO A;  1PTO C;  2F0S A;  1F9R A;  1T5X D;  5CV4 A;  1S9F A;  3RZD H;  3H0G G;  1YHQ A;  4PDB A;  1ZKO A;  5D3I B;  4OWX B;  4BA1 I;  5I4D A;  1RYS A;  2EYJ A;  3PW7 A;  4A3M H;  4HCE A;  5DQI A;  4DV6 H;  3C1F A;  1N36 H;  3ZYY X;  1N32 H;  4DU9 A;  5GAG C;  4A3M G;  2UUA L;  3LML A;  5CBE E;  4LF5 Q;  1K9M C;  2JEA I;  2E2H A;  4TKO B;  1ZYR C;  1XNQ Q;  2J6S A;  3DF7 A;  4HMI A;  1I94 H;  2ICE C;  2BE5 C;  2NTT A;  1X3Q A;  4PWQ A;  3NQT A;  4R8U A;  5M5W H;  1JKJ B;  3FEW X;  4IWY A;  3Q8P B;  3H15 A;  2I5M X;  3DM3 A;  4NW2 A;  3AYH B;  5IGD A;  1HR0 H;  1TS5 A;  4LF7 L;  5EBD A;  3KLS A;  2VA3 A;  1VMP A;  4DV1 L;  2VQF Q;  5G3L D;  1U4R A;  4M8A A;  3N42 B;  4J6H A;  2E2J B;  2KOL A;  3BQ0 A;  1BO0 A;  3T1H Q;  2MJ8 A;  1LT6 D;  3BVM A;  4DV7 Q;  5JJL A;  2B2U A;  4XQJ A;  5DG8 A;  4QIW E;  2A68 C;  4NDX A;  5FO8 B;  2C2R A;  1TS3 A;  3R2T A;  5LHY 1;  3FHW A;  2UUB H;  4DV3 L;  1STN A;  5IP7 G;  5HGQ A;  3HOY G;  2P5Z X;  1QNU A;  5IGC A;  4ZQ3 A;  4A3K G;  1EUD B;  2O4X A;  3NTK A;  2CWP A;  3KF8 A;  4PMC A;  5L9X A;  1SNQ A;  4UCV A;  4C3I H;  1A3T A;  1O7Z A;  2Q2U A;  3KHG A;  4MAM A;  2KA7 A;  4GNX B;  2R93 G;  1QVF A;  2EVB A;  1KJ8 A;  4X64 H;  2G9H D;  1M1K C;  4J9Q A;  4DV0 L;  1IL8 A;  3J81 i;  4EQP A;  3Q2O A;  3STB C;  2PZU A;  4GZY C;  2KCT A;  4DR1 L;  5M5X B;  3C1E A;  3VR4 A;  2A69 D;  1PYW D;  2MHV A;  4MN3 A;  1K3R A;  4DR5 L;  4RNO A;  3RV4 A;  5GAH C;  2I5L X;  1LUZ A;  5D65 A;  4A3F H;  4JI3 H;  2R93 B;  1XXG A;  1RJR A;  1B9M A;  3KHH A;  4CKC A;  2VA2 A;  2DNE A;  1BXT A;  4IR1 A;  2K5V A;  4HED A;  3D4R A;  2K32 A;  4A3C G;  2UXD Q;  2B2Y A;  3A55 A;  3I55 A;  4J9O A;  4EFB A;  4V0B A;  4XYL B;  2DY8 A;  5KFE A;  1UE6 A;  2KHJ A;  2L1B A;  1WOC A;  2QKI C;  3J7Z C;  4YCW A;  5KYL A;  2Y0S E;  1WTO A;  4LFB L;  4DR2 H;  1STH A;  2W6O A;  4POF A;  1S10 A;  4R8U B;  4BBR B;  2AMC B;  4JI1 L;  1BCP B;  1SYC A;  1JE5 A;  4CDC C;  3CCV A;  4EQN A;  1W2B A;  5FLX W;  4F4Y A;  1GVP A;  3CAM A;  4NP5 A;  1CQV A;  1Y1V B;  2IL8 A;  1ENA A;  1B6R A;  4JI1 H;  1QUQ B;  1ILP A;  2Q2I A;  3BZC A;  1NJI C;  1PH5 A;  1V1P A;  4LFB Q;  3NBI A;  4X3K A;  4UCU A;  2ALY B;  5J3B A;  4YJ2 F;  3T13 A;  3EPI A;  4KI0 A;  1Q3L A;  4FS2 A;  1E24 A;  1JE4 A;  4EGV A;  1HTP A;  1VBG A;  2DPI A;  3DLL A;  2C22 A;  1T94 A;  1K83 B;  1HZB A;  1Q8K A;  1X54 A;  4DKA C;  4HJA A;  1EIH A;  1JDB B;  4O2A F;  2HVR A;  1RJP A;  4DUY H;  1D1I A;  1GUT A;  3RF2 A;  1XMQ L;  4Q44 A;  4QW8 A;  2F52 A;  4HJ9 A;  2WKC A;  1S0N A;  4BXX G;  4DXG A;  3C46 A;  4UCS A;  2Q2T A;  3ERO A;  4X66 L;  1G51 A;  3G6V A;  3JC6 6;  2KVM A;  2N8N A;  1ENF A;  2V4Q A;  4A3I G;  2W8K A;  1JJG A;  1KAW A;  3R5F A;  3MR5 A;  4IAL A;  2PYK A;  3QR8 A;  4R8N A;  4FBU A;  1D5M C;  3K5O A;  2VQE Q;  5D1P A;  1S68 A;  4J9N A;  1KBL A;  3T5L A;  4LF8 L;  1JR0 D;  2RKS A;  4Y7N H;  2K28 A;  4DK6 C;  2SNM A;  2UVU A;  2R7Z G;  3I4N G;  2D0P A;  3BA8 A;  3VR6 A;  1A0I A;  1VQD A;  5ELB A;  2GN5 A;  4OX9 Q;  1SSO A;  1N56 A;  5E7N A;  5BR8 L;  1I5F A;  4DL2 A;  4C3I B;  2ZXO A;  2XIW A;  4JOI C;  3I4L A;  3K3V A;  3CCU A;  2JP1 A;  1SMY D;  3HRZ C;  4FXK C;  5EBC A;  4DUZ L;  1VQK A;  5KG0 A;  1RF2 D;  4ME6 A;  2NB0 A;  2TSS A;  5C0X G;  2K5Q A;  2GVB A;  4LF7 H;  4DUZ H;  3C2P A;  3PQI A;  1KLG D;  1EFI D;  4P2C B;  4BY7 H;  3HXL A;  4RAY A;  3O13 A;  4HIO A;  2AHO B;  4A3B G;  5KFZ A;  4IFD H;  3GTM A;  1CHQ D;  5LMN Q;  1F2M A;  2WB1 E;  4QWB A;  4CJ2 C;  3T1Y L;  4NXM Q;  4JI4 H;  3LWU A;  3FP9 A;  2J7Z A;  1EYZ A;  4GN3 B;  4JI4 L;  3VR3 A;  2RCF A;  4G4K A;  5ELN A;  1PHJ A;  5KRU A;  3PIO A;  2F3I A;  3G6J B;  3M3Y H;  2WII B;  3PN1 A;  4JUZ A;  3OPO A;  4G7H C;  4WOR A;  1WCM B;  2LXK A;  1EY8 A;  2PCF B;  1Y8N B;  1E4E B;  2QK4 A;  1X6O A;  3NK9 A;  4J9S A;  1LV9 A;  1JWU D;  2GVA A;  2ZTC A;  1U5K A;  4YHH Q;  5A35 A;  2OQK A;  4ECW A;  1A8V A;  4IOA A;  1F9Q A;  2UU9 H;  1SYD A;  4ZKC B;  1UE1 A;  1E2Z A;  1DV1 A;  5ELF A;  4L5T A;  1YVC A;  3HOW B;  5C3W A;  1K83 H;  1GD7 A;  5JVL A;  1XJV A;  5K36 H;  2W6N A;  2W9C A;  2K7V A;  3S2H H;  3S16 H;  1JQY D;  2FMA A;  2E2I A;  4OXP A;  1IBK Q;  1EWH A;  4YAK B;  2IX0 A;  1TWA A;  1OTC A;  4MTD A;  2OWO A;  2C5C A;  2DGY A;  5J39 A;  3M9N B;  1AP0 A;  2NZO A;  4LF9 Q;  3N8D A;  4A3J G;  1NMF A;  2FLL A;  1FYC A;  1G29 1;  4PZ6 A;  4WD3 A;  3S1N B;  4RUA A;  5C1O A;  1SYE A;  4DR7 H;  3TBI B;  3QWN A;  1UNN C;  2IW3 A;  3CKI B;  2H4O A;  2DLN A;  4EBD A;  2VQF L;  4YCU A;  3NWS A;  4DL4 A;  2HCI A;  1WSC A;  2E5L H;  1VQB A;  4H7B A;  3RAQ A;  2ZJR A;  2HVS A;  3F1Z A;  3P7J A;  3J81 W;  3WOF A;  4JI0 H;  1SRO A;  3AMU A;  5A2Q L;  5KG1 A;  4EGQ A;  2L15 A;  4B3S L;  1L1O C;  5DG7 A;  1Y1W B;  2EDG A;  1BGW A;  1NBW A;  1JDE A;  2AUK A;  2R7L A;  3K5L A;  2F4V H;  2F0J A;  1EIY B;  1BDO A;  4DR6 H;  2MPM A;  1HNX H;  3BAB A;  1XPO A;  3J81 c;  1IW7 C;  3M85 A;  4YWL A;  3BDC A;  5CYU A;  4DF7 A;  2VUM A;  2HHH L;  2RDH A;  2N78 A;  1PX2 A;  4X3U A;  4OWW B;  2R7Z H;  1MHW C;  4RB1 A;  1NR2 A;  5IT9 c;  3CCS A;  4HSV A;  3FMA A;  3DHQ A;  1I4Q A;  3MA2 B;  4DV3 Q;  1S97 A;  2KEE A;  1TWG B;  3KK7 A;  1I3Q B;  5JEA J;  1L0X B;  3UFX B;  3MAQ A;  2K52 A;  1VCI A;  1YNJ D;  4LF6 L;  1I4X A;  4UCO A;  2PZT A;  2JEF A;  4OHJ A;  2KSW A;  2ZXR A;  3PO2 H;  5IYZ F;  2IMW P;  1LTG D;  3UDX A;  4O4L F;  3GTJ B;  2Z6K C;  3KHR A;  1ET9 A;  4M7E A;  1HXY D;  5KND A;  3CCE A;  4J8Q A;  5EZY F;  1EY0 A;  4N8X 1;  4GN5 A;  5L1J A;  4DV5 Q;  5IT9 W;  4LF5 L;  2JA8 H;  1BQQ T;  1FGU A;  4O2B F;  2JA7 G;  3J7Y W;  4F87 A;  4DV6 Q;  3KAL A;  4A3D H;  1R9T H;  1RTN A;  1O78 A;  5KFY A;  4LF5 H;  1FNU A;  4UPA A;  4JBW A;  2SEB D;  1S5B D;  3OIP A;  3KTM A;  1BR9 A;  4DV1 H;  4LFA L;  4KV6 A;  1LTL A;  2K5D A;  3GIM A;  3GIK A;  1HUN A;  5ELC A;  3KJO A;  4JI7 L;  3QZ7 A;  2ASD A;  1B33 N;  2V4R A;  1R9T A;  1ILQ A;  1QB5 D;  3Q1K A;  1VQA A;  3MTS A;  4M1U B;  2OTJ A;  5KG5 A;  4BY7 G;  2UUB L;  5KT2 A;  1HZC A;  4RMF A;  2WE6 A;  2Z4H A;  3GQB A;  1G6P A;  1DCZ A;  2V5A A;  1K8A C;  1HZ9 A;  1EOT A;  2EPB A;  2M2L A;  2NTS A;  2BA1 A;  3H0G H;  4R4T A;  2NVQ B;  1QWY A;  1K8G A;  1UE7 A;  3BZD B;  2UUB Q;  4YY3 H;  4J9L A;  5KFU A;  2YYZ A;  1RDP D;  3EJI A;  1SN8 A;  2M9V A;  1PZK D;  1D6E C;  4L1K A;  1T9H A;  5JJZ A;  1U9R A;  4B08 A;  3CCR A;  1N33 L;  3K3P A;  2IA6 A;  3K80 C;  3SDZ A;  1MD2 D;  2EIF A;  5M3M B;  4ZKB B;  4A3E G;  4LSA A;  4BS9 A;  4NPS A;  4ULL A;  1XTD A;  3RB4 A;  3J7A K;  3A74 A;  3K58 A;  3RTX A;  3RB0 A;  3OWE B;  4MIU A;  3IFT A;  1XPR A;  5JVD F;  2Z6K A;  1AZP A;  3JSL A;  5C4X G;  2B8G A;  1EEI D;  1A2T A;  5E3F A;  2QEJ C;  3PIP A;  1FL0 A;  3PZP A;  4DR1 Q;  3AFP A;  2R7M A;  5M9O A;  4DV2 H;  1LTI D;  2X69 A;  1STB A;  4JI0 L;  2FP4 B;  3HBL A;  1KAB A;  5FLX c;  3SVM A;  4B3R Q;  4A3E B;  4UP7 A;  1CZW A;  3SE7 A;  4CHT B;  4C5C A;  3PW2 A;  4R4Q A;  4DL7 A;  3K5I A;  5C44 H;  1K1Q A;  2WFW A;  1MJE A;  2RGV A;  1HTL D;  1TWA H;  5M5Y B;  2QIL A;  3JAM L;  5FO9 B;  1Y1W A;  1SNM A;  2ZXP A;  4DR2 L;  3CHB D;  1DON A;  3E3X A;  1ZEQ X;  1GYF A;  5C3X A;  4AQY H;  4BA2 I;  1E4G T;  3N40 P;  2A73 B;  1N34 L;  2W9B A;  2E75 C;  3VYU A;  3RNU A;  4JI6 Q;  3K7U C;  2KJX A;  3S16 B;  3PVX A;  5I6W A;  3S2H B;  3TME A;  4LFC L;  5C44 G;  2CQO A;  2FPG B;  1I7N A;  4A93 H;  3BQ1 A;  1NTG A;  3SK6 A;  1M7J A;  4UY8 C;  5KFW A;  3OTO L;  1D7Q A;  2XN9 C;  2VR1 A;  3V05 A;  1G8Z D;  4LAA A;  5LMN L;  2ASL A;  5FPO A;  2JA6 H;  1TR5 A;  4H44 C;  2J0T D;  1N48 A;  1T3N A;  3I4M B;  2EXD A;  2F0U A;  4DUY L;  2IT1 A;  1X3G A;  2NUA B;  3GLK A;  3WO0 A;  3BJY A;  1IBL H;  3A8K E;  5KT4 A;  1Z47 A;  1I6H B;  5CBA E;  3NWT A;  4FF2 A;  1F2Z A;  1KHI A;  1WCM H;  2NVY A;  5F9L A;  5C3E G;  3J80 E;  4H02 A;  5KNC A;  4ZI7 F;  3F2B A;  1WCM G;  1M0W A;  4O3O A;  4DUY Q;  2R7Z A;  5CAE B;  3H3V H;  2N49 A;  2BOS A;  5CR3 A;  2ID0 A;  2XD4 A;  4FVM A;  4HCS A;  5DM7 3;  4MA5 A;  1B7Y B;  1RIP A;  2RHS B;  3A5U A;  4B3M L;  4RHR A;  2XTI A;  3TP7 A;  2W9C B;  1WCM A;  4ECQ A;  1Q12 A;  4XXE A;  5KFT A;  5FLX L;  3QB3 A;  3RGX A;  4DL3 A;  4DV4 Q;  4DXF A;  1GO3 E;  4IRK A;  2NN6 I;  1B50 A;  1I50 A;  1TU2 B;  1FR3 A;  3E6Z X;  3R2I A;  1TVX A;  1S5C D;  1TWH B;  4KLK A;  3GTP H;  3H3V C;  1JIH A;  5L1L A;  5D14 A;  4O4H F;  4AYB E;  5BR8 H;  5IWA Q;  2IX1 A;  1N33 H;  3U50 C;  2R82 A;  3TZU A;  2VY3 A;  3GTO A;  1HUM A;  1HA5 A;  3NPP A;  4L5S A;  4PG3 A;  3RJ0 A;  5JOB A;  1CUK A;  4CDD C;  5KNB A;  3HOZ B;  1ESR A;  4P72 A;  4RGM A;  3CCJ A;  3KHL A;  5KFI A;  3C0F B;  4JV5 L;  3VMM A;  4K5W A;  4ZOL F;  1E3P A;  5DNF A;  4O2D A;  1YBY A;  4TQR A;  3RV3 A;  4CDF C;  4OEL B;  2NVX B;  5LOV F;  2MO1 A;  3X3N A;  1GOZ A;  3PF5 A;  5J1Z A;  1MSG A;  1VQ7 A;  4DGZ A;  2G5D A;  1YIJ A;  3K57 A;  4ME3 A;  1GJX A;  2XIG A;  2YU9 A;  2NWG A;  4DR3 H;  3SXH A;  1BBW A;  3LGJ A;  3MEF A;  2B63 B;  2PMZ E;  3HOV B;  1MIU A;  1PTO H;  1N9W A;  3VPD A;  2R84 A;  5GON F;  1ZQ7 A;  5J22 A;  2ATW A;  2F0T A;  1W6J A;  5FLM H;  1PH1 A;  3HOV G;  1JOR A;  5BPH A;  4PNY A;  4NLG A;  3VYR A;  2F0K A;  1VMC A;  1OWT A;  1O7Y A;  1EYC A;  3TZD A;  1J8I A;  4X6A H;  1WR2 A;  3BU2 A;  5GAD C;  5C4J B;  2UXC Q;  2K75 A;  4RKB A;  3PO2 B;  2FLP A;  2JA7 H;  4YWM A;  3H91 A;  2QDB A;  2WAQ A;  4IPG A;  5M3F G;  2I5H A;  3CD6 A; 
#chains in the Genus database with same CATH homology
 4EQ5 A;  3E0E A;  1VQI A;  2A8V A;  1HR0 W;  4DR5 Q;  1S3O A;  1M1K C;  1X55 A;  2KEN A;  4DV0 L;  2HT1 A;  3J81 i;  4LFA Q;  3ERS X;  5IYB G;  1XNR L;  3STB C;  4WJ3 M;  2KCT A;  4DR1 L;  3KF8 B;  4JOI A;  5IP9 H;  3HKS A;  4DR5 L;  4A76 A;  1K3R A;  2OCE A;  1EQQ A;  4DV7 L;  3PUV A;  5GAH C;  2I5L X;  1LUZ A;  2UXD L;  4A3F H;  3KYH C;  1JJC B;  2NZH A;  1VQE A;  4P75 A;  4A3F G;  3J80 i;  1Y1W H;  4O0A A;  2JA6 G;  3PO3 H;  1IBM Q;  1L1O B;  3I4O A;  2K5V A;  5C4J H;  2UXD Q;  4A3C G;  3G71 A;  1U0L A;  2CKZ B;  2E5L Q;  3I55 A;  3NEN A;  1B8A A;  4A3I H;  4GN4 B;  4JBJ A;  4ALP A;  1QZG A;  4LF8 Q;  4NB3 A;  4A93 G;  1X56 A;  1UE6 A;  3KDF A;  2QA4 A;  2D0O A;  2KHJ A;  2WAQ G;  1WOC A;  2ZJQ A;  3HOX H;  2R92 G;  3HOW G;  3J7Z C;  4YCW A;  2Y0S E;  1OXT A;  1PH3 A;  4PZ7 A;  1MJC A;  4LFB L;  1O7I A;  4BXX H;  2RCN A;  4POF A;  5C3E H;  1Q86 C;  3HKZ E;  2AMC B;  4JI1 L;  3CCV A;  1JE5 A;  3G6E A;  3IRB A;  4IPG A;  1W2B A;  1BBU A;  2PI2 E;  1GVP A;  3CAM A;  3RN5 A;  4DAM A;  2LXJ A;  4IOC A;  3I2Z A;  1QUQ B;  3CPW A;  2Q2I A;  3BZC A;  4DUZ Q;  1S40 A;  1NJI C;  1PH5 A;  4LFB Q;  2VL6 A;  2ALY B;  5J3B A;  1M90 C;  1PH4 A;  4KI0 A;  1XMQ Q;  4XTC S;  1E24 A;  1KC8 C;  1VQC A;  4FDB A;  1J5E L;  1CSQ A;  3DLL A;  3CC2 A;  4GKK Q;  4OO1 I;  1TXY A;  3UDI A;  2AWO A;  1HZB A;  1Q8K A;  1X54 A;  2QGQ A;  2WB1 G;  4DKA C;  4HJA A;  3T1Y Q;  4X62 Q;  4BY1 H;  4NXM L;  1J5E Q;  5AJ3 Q;  4L5Q A;  1IBM L;  2E2H H;  4K0K L;  5K36 G;  4GOP C;  4JI7 Q;  1J6Q A;  4X66 Q;  1XMQ L;  1C9O A;  2UXB Q;  3CPF A;  2KCM A;  2F52 A;  4HJ9 A;  4QGU A;  2NN6 G;  1PYS B;  4HJ8 A;  3AEV A;  4BXX G;  3F2D A;  1PFS A;  3M9B A;  4OWT B;  1UE5 A;  3GTJ H;  1EQR A;  2Q2T A;  2JA8 G;  3D31 A;  1CKM A;  1YI2 A;  2ES2 A;  4X65 Q;  4X66 L;  1G51 A;  5DLQ E;  3JC6 6;  2N8N A;  2OQ0 A;  4A3I G;  2VNU D;  1K73 C;  1VQL A;  1TWG H;  3NBH B;  3NEL A;  1KAW A;  4GKJ Q;  3SGI A;  1JJG A;  1P16 A;  3U4Z A;  2VQE Q;  1JJ2 A;  2JK8 A;  1FJG L;  4BBR H;  3L0O A;  2YV5 A;  4LF8 L;  5BR8 Q;  1V9P A;  4UP8 A;  4JI3 L;  4Y7N H;  4DK6 C;  3GTO H;  4LUV A;  1N33 Q;  1E1T A;  1LM0 A;  4AIM A;  4DNI A;  4DR7 L;  3G4S A;  4JI6 L;  2R7Z G;  1EOV A;  3I4N G;  2D0P A;  3OW2 A;  4B3M Q;  1A0I A;  1VQD A;  2YTY A;  4DV2 L;  3TS2 A;  2B3G A;  2GN5 A;  4OX9 Q;  3K81 C;  4DAY B;  4DR7 Q;  4GNX A;  5E7N A;  1X3F A;  5BR8 L;  1I5F A;  4DR2 Q;  5AJ3 L;  3E9H A;  4R4C A;  1W3S A;  4JG2 A;  2BA0 A;  3K8A A;  1E7Z A;  2FXQ A;  4JOI C;  3S1M H;  4LNQ A;  3CCU A;  1VQK A;  4DUZ L;  2F4V L;  3I4N H;  3ICE A;  5C0X G;  3HOU H;  2R93 H;  2GVB A;  2WP8 J;  5EAY A;  5M3M G;  5IWA L;  2B63 G;  4BY7 H;  4A3J H;  2ZM6 Q;  4HIO A;  2AHO B;  4A3B G;  1JB7 A;  5LMN Q;  3TRZ A;  2WB1 E;  1VQO A;  3T1Y L;  4NXM Q;  2F4V Q;  3OTO Q;  3MXN B;  3FP9 A;  2YU9 H;  3G48 A;  4IPC A;  3KF6 B;  4A3D G;  2UXB L;  3CQZ H;  4GN3 B;  4JI4 L;  5ELN A;  1PHJ A;  4A75 A;  2A1A A;  3PIO A;  2F3I A;  3M3Y H;  2Z0S A;  4IJH A;  1JMC A;  2LXK A;  2YTX A;  1X6O A;  2CFM A;  4QQB X;  2ZJP A;  3PCO B;  3ER0 A;  3CCM A;  4LUZ A;  3M7N A;  1EIF A;  1PYB A;  5HY6 A;  2GVA A;  3PO2 G;  2ZTC A;  1U5K A;  4YHH Q;  1PV4 A;  4IO9 A;  2R92 H;  3HOW H;  4A3L G;  3M4Q A;  4APV A;  2OQK A;  1KD1 C;  1A8V A;  2N3S A;  1K0R A;  1PH2 A;  4IOA A;  4OO1 G;  1UE1 A;  1DGS A;  4A3L H;  4X64 Q;  3KJP A;  1IBL L;  3U58 A;  3S14 H;  2PQA A;  4L5T A;  1YVC A;  1K83 H;  1GD7 A;  2WAQ E;  5JEA G;  3CME A;  1XJV A;  1VQJ A;  3S2H H;  2XGT A;  1VQ6 A;  3S16 H;  3KLW A;  4OXP A;  3HOX G;  1IBK Q;  4LF9 L;  2B63 H;  2IX0 A;  3K7A H;  1KRT A;  1UWV A;  1OTC A;  4DK3 C;  3W5O A;  2OWO A;  3F2C A;  3CD6 A;  2DGY A;  1CKN A;  2NZO A;  3PUX A;  1IBK L;  4A3J G;  1NMF A;  4LF9 Q;  2LSS A;  4DV1 Q;  1G29 1;  4PZ6 A;  3KFU A;  5IP9 G;  4IFD G;  1AH9 A;  1HJP A;  1Y14 B;  4A4I A;  4NXN Q;  1H95 A;  4KHP Q;  3TQY A;  5M3M H;  2VQF L;  1XNQ L;  3S1Q H;  4YCU A;  3PUZ A;  1IZ6 A;  1VQB A;  2ZJR A;  3F1Z A;  5GQO A;  4KHP L;  1CKO A;  4JCV E;  2ZTD A;  1XNR Q;  1SRO A;  2L15 A;  5LMU L;  4JV5 Q;  1KL9 A;  4B3S L;  4BBR G;  4LF7 Q;  2NVQ H;  4IJL A;  4QL5 A;  1L1O C;  3PO3 G;  1I3Q H;  1HZA A;  1N32 L;  1VQN A;  2UUC Q;  5IE8 A;  1TWH H;  1NBW A;  1Q1E A;  2VUM G;  4DV4 L;  3I4M G;  4PZ8 A;  1NY4 A;  1IBL Q;  2Y0S G;  3A0J A;  4LUO A;  4P73 A;  1ASY A;  3T1H L;  1D8L A;  2C35 B;  1EIY B;  2ASB A;  3I4M H;  4L5R C;  1HNZ Q;  2UXC L;  4JI1 Q;  3KDF B;  4JI2 Q;  1OXU A;  1XPO A;  3J81 c;  3M85 A;  1VS0 A;  4YWL A;  4LF6 Q;  1S72 A;  2HHH L;  1SLJ A;  2N78 A;  2UUA Q;  3HOU G;  3GD7 A;  4OWW B;  2E8G A;  1Q46 A;  2R7Z H;  3GO5 A;  4PMW A;  3RLF A;  4KHZ A;  1IL2 A;  3GTM H;  3I7F A;  5IT9 c;  5ELO A;  2V1C C;  1YZ6 A;  3CCS A;  4DV3 Q;  1B70 B;  1EWI A;  4OON A;  1Z9F A;  4B3T Q;  3UDF A;  2YTV A;  3PUY A;  5JEA J;  3ULL A;  4QY7 A;  1P8L A;  1C7Y A;  2K52 A;  1SR3 A;  1VCI A;  1VQM A;  3L7Z C;  4LF6 L;  3PO2 H;  4DV5 L;  1QZH A;  3K0X A;  3UDX A;  5FJ8 G;  2KHI A;  2Z6K C;  4YCV A;  1SRU A;  4LW1 A;  4DV6 L;  4GOP A;  1N36 L;  1LYL A;  1X3E A;  2PNH A;  3CCE A;  3U4V A;  4GN5 A;  4DV5 Q;  4HJ7 A;  4JYA Q;  4LF5 L;  1AE3 A;  2JA8 H;  1IYJ B;  1FGU A;  3RLN A;  2JA7 G;  3PF4 A;  4IFD J;  4DV6 Q;  3D0F A;  2KBN A;  2NVY H;  3F8T A;  4JI5 L;  3RLO A;  4GOP B;  4MTN A;  1R9T H;  1N36 Q;  4A3D H;  1N32 Q;  4Y52 H;  1YHB A;  1WI5 A;  3S1R H;  3PSI A;  4UPA A;  2R6G A;  4JBW A;  4AH6 A;  2R7D A;  2UU9 L;  4IPH A;  1WYD A;  3CMA A;  2IHF A;  3HOZ G;  4HIK A;  4DPG A;  4LFA L;  4GKK L;  1YIT A;  4JYA L;  2AWN A;  3HOY H;  1LTL A;  4YWK A;  1PVO A;  3W1B A;  2E2I H;  4AQY L;  2VW9 A;  4GLX A;  3S2D H;  1UEB A;  2K4K A;  3KJO A;  1BKB A;  2E2J H;  4JI7 L;  3AQQ A;  1HR0 Q;  1SE8 A;  4HJ5 A;  2HHH Q;  3RN2 A;  3JAM i;  4DR4 L;  1VQA A;  1Y1V H;  2JQO A;  2MQH A;  4AQY Q;  4BY7 G;  2MNA A;  2OTJ A;  4JI0 Q;  1JT8 A;  2UUB L;  1HZC A;  4RMF A;  1YNX A;  3CC4 A;  4DR4 Q;  1VQ9 A;  1A62 A;  1G6P A;  4GS3 A;  3S17 H;  1L0W A;  3HFZ B;  1K8A C;  5IY0 A;  1HZ9 A;  3I56 A;  4JI8 Q;  2BA1 A;  3H0G H;  3E9I A;  4R4T A;  4JI2 L;  1A63 A;  1K8G A;  1HNW L;  1UE7 A;  2UUB Q;  4P74 A;  2VS1 A;  2YYZ A;  4GNX C;  4JI8 L;  1SN8 A;  2RF4 A;  3J81 j;  1OXS C;  1T9H A;  5H1S E;  1YJ9 A;  3B6Y A;  2QEX A;  3CCR A;  1WJJ A;  1N33 L;  3CP0 A;  3H3V I;  3K80 C;  4B3T L;  2EIF A;  2JJQ A;  4A3E G;  1GKH A;  5M5X H;  4MNO A;  2VZA A;  1NE3 A;  1XTD A;  4NPS A;  1NMG A;  3UE1 A;  3A74 A;  3FKI G;  1IXR A;  1VQF A;  3ZJY C;  4XIG S;  2MO0 A;  1PH9 A;  1XPR A;  2H5X A;  2Z6K A;  2CCZ A;  3Q8D A;  3S1N H;  5C4X G;  4HIM A;  3PIP A;  1MKH A;  1FL0 A;  1Q81 C;  4B3R L;  4DR1 Q;  3AFP A;  4A3G G;  1KIX A;  5M3F H;  1FVI A;  4R1J A;  1QVG A;  1V1Q A;  4GLA C;  4JI0 L;  1TWC H;  3CCL A;  4JC0 A;  3ULJ A;  1C0A A;  5FLX c;  1I6H H;  4B3R Q;  3EIV A;  1SMX A;  3TEH B;  4GKJ L;  3AFQ A;  4BY1 G;  2UU9 Q;  1Q1B A;  4UP7 A;  3CXC A;  2HQL A;  4JI3 Q;  3GDE A;  2K50 A;  4R4Q A;  1PH7 A;  1FJG Q;  5C44 H;  4A3K H;  4POG A;  2K14 A;  2K5N A;  4X65 L;  1HNW Q;  2WFW A;  1MJE A;  1I94 L;  3GTK H;  1N34 Q;  3CW2 C;  1TWA H;  4OX9 L;  2R7F A;  2AKW B;  5IP7 H;  1HR0 L;  4P71 A;  5C0X J;  1X9N A;  1EFW A;  2JA9 A;  3HKZ G;  5FLM G;  1KQS A;  3HOV H;  3NEM A;  4DR2 L;  2I0Q A;  3TRE A;  5IYD H;  1ASZ A;  1WFQ A;  2JA5 H;  4JBM A;  5IYD G;  1CKN B;  4BA2 I;  1I94 Q;  4IPD A;  1SFO H;  1N34 L;  4UP9 A;  4LF4 Q;  2MFI A;  3GTL H;  3JAM c;  3BJU A;  4WJ4 A;  3RNU A;  3L2P A;  4JI6 Q;  2BH2 A;  3K7U C;  1YJW A;  1VQ8 A;  2A19 A;  2B29 A;  4LWC A;  4X64 L;  4K0K Q;  3CF5 A;  2ZTE A;  3KOJ A;  3PV0 A;  4LFC L;  5C44 G;  2CQO A;  2HIX A;  5GRO A;  5FJ8 H;  4A93 H;  1NTG A;  4UY8 C;  3PUW A;  3OTO L;  1D7Q A;  2JEB I;  1HH2 P;  4A3C H;  4YY3 Q;  2HIV A;  4DR3 L;  3CC7 A;  5LMN L;  5JJI A;  4GLV B;  3UDG A;  1YEZ A;  2JA6 H;  3GTG H;  1PH6 A;  3STB D;  1VQG A;  4MZ9 A;  4JBK A;  1Q7Y C;  4IFD I;  2JE6 I;  1Y1W G;  2EXD A;  4LFC Q;  4DUY L;  4BBS H;  2IT1 A;  5LMU Q;  1X3G A;  2JA5 G;  4DR3 Q;  4AYB G;  1Z47 A;  4X62 L;  1EYG A;  4A3B H;  1KHI A;  1KRS A;  1WCM H;  4YY3 L;  4DR6 Q;  5C3E G;  1HNX Q;  1EUJ A;  1RL2 A;  4YHH L;  4EX5 A;  4H02 A;  3F2B A;  3EBE A;  1WCM G;  1X65 A;  4TQU S;  1V43 A;  3UE0 A;  3FKI H;  5IYC G;  2ZM6 L;  4C3J H;  4DUY Q;  2K5H A;  3H3V H;  2N49 A;  2IY5 B;  4A3E H;  2OTL A;  1I50 H;  1GM5 A;  2ID0 A;  3J7A 5;  5JJK A;  1B7Y B;  3WWV A;  3RZO H;  1RIP A;  2RHS B;  3A5U A;  1E22 A;  4B3M L;  4DV2 Q;  1VQP A;  1HNX L;  4LF4 L;  2XTI A;  2EQS A;  5IYB H;  1Q12 A;  1CSP A;  1OXX K;  1TWF H;  1BVS A;  5C0X I;  2PQA B;  1QUQ A;  4DV4 Q;  4A3G H;  3RZD H;  2VQE L;  1GO3 E;  3H0G G;  4RG1 A;  1YHQ A;  1N8R C;  3S15 H;  2NN6 I;  5GAE C;  1PA6 A;  4OWX B;  5C4X H;  4BA1 I;  4KLK A;  3GTP H;  4A3M H;  2NVT H;  5IYC H;  4AYB E;  4DV0 Q;  5IWA Q;  5GAG C;  3BZK A;  4A3M G;  1XMO L;  2UUA L;  3U50 C;  2IX1 A;  3M4P A;  5LMN W;  4LF5 Q;  4R4O A;  2VY3 A;  4R4I A;  1L2F A;  1K9M C;  4L5S A;  2Q2H A;  4PG3 A;  2D62 A;  1XNQ Q;  2JEA I;  1CUK A;  4DR6 L;  4P72 A;  3CCJ A;  3KF6 A;  1XPU A;  5M5W H;  1VQ4 A;  3H15 A;  4JV5 L;  2I5M X;  3OYY A;  1XMO Q;  3DM3 A;  3AYH B;  2UUC L;  3PGZ A;  1E3P A;  4O2D A;  1YBY A;  4NXN L;  1AE2 A;  4LF7 L;  1Y1V G;  4DV1 L;  4BBS G;  2RHQ B;  2VQF Q;  4C3H H;  2MO1 A;  2CWA A;  3PF5 A;  3T1H Q;  4JI5 Q;  3W1G A;  4DV7 Q;  1VQ7 A;  3GTQ H;  1L1O A;  1YIJ A;  4HID A;  3CCQ A;  4ME3 A;  5JJL A;  4QIW E;  1BBW A;  3LGJ A;  3MEF A;  2PMZ E;  4JI4 Q;  4B3S Q;  2DUD A;  1MIU A;  2IHE A;  3FHW A;  1N9W A;  4DV3 L;  1YJN A;  1E1O A;  5IP7 G;  1KXL A;  5HGQ A;  2ATW A;  3S24 A;  3HOY G;  5FLM H;  1PH1 A;  3HOV G;  1PH8 A;  1VQH A;  4A3K G;  3HOZ H;  4TVA B;  4J15 A;  2CWP A;  2E5L L;  3A5Z B;  2VUM H;  4QJF A;  5M5Y H;  1VQ5 A;  3M4O H;  2PI2 A;  4C2M H;  1OXV A;  4X6A H;  4C3I H;  3BU2 A;  5GAD C;  3TS0 A;  1Q82 C;  1HNZ L;  2Q2U A;  2K75 A;  3ULP A;  2UXC Q;  3EN2 A;  4GNX B;  2JA7 H;  4YWM A;  2BH8 A;  2R93 G;  3J80 c;  3VDY A;  1QVC A;  1YHA A;  5M3F G;  1QVF A;  3RR5 A;  2I5H A;  2NVX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...