4BY7G

Elongating rna polymerase ii-bye1 tld complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by7G01
1U5KA 4B3SQ 2WFWA 1VQFA 1WCMH 3FHWA 1VQ6A 1VQDA 2A1AA 1SRUA 3UDIA 1KIXA 1GM5A 4C3JH 4DR1L 4DR3Q 4A3EG 4DAYB 1R9TH 4UP8A 4LUZA 1N34L 4JI1Q 3CMAA 2IX1A 2UUCQ 4DV0L 1UE1A 4DV1L 1CUKA 4GNXB 4A3KH 2F4VL 3SGIA 4B3SL 3CCUA 4A3DG 1L2FA 1MJCA 1Z9FA 2I5MX 3ULPA 4JI6Q 4UY8C 2JA7G 3TRZA 3CQZH 2N78A 2UU9Q 5JJKA 1GVPA 4DV4L 1K73C 1PV4A 3KLWA 4A3KG 4DUZL 3CCMA 1VQOA 4L5QA 3S2HH 2MQHA 5JEAJ 4LF7Q 2R7ZH 4GNXC 2H5XA 3I7FA 1JJCB 4TQUS 1N34Q 3RR5A 2OWOA 4R4OA 3GTOH 5IWAQ 1YJ9A 4A3CG 4DV5Q 3IRBA 1PH2A 2UXBL 3KOJA 1XPOA 4YHHL 3J81i 3KJOA 4DR6L 2YTXA 1VQIA 4DR2L 3J80c 2UU9L 4JI7Q 4DV4Q 5C4XG 5ELOA 4JCVE 2WB1E 4JI6L 4LF8Q 2UUAL 1MJEA 5GROA 4JI8L 1KRSA 4NB3A 1NBWA 4QJFA 1VQLA 3D0FA 3NBHB 1K3RA 2KCTA 4A3FH 4JG2A 4JI7L 3ICEA 4DV2Q 3VDYA 2BH8A 4GN4B 3U58A 1ASYA 4A93G 4DV5L 1I5FA 4R4IA 1D8LA 3CAMA 1GO3E 1BKBA 1HZBA 2L15A 2AHOB 1AE2A 4BXXG 4A93H 4IFDI 3U50C 1C9OA 3W5OA 4DV6Q 4GN3B 1Y1WG 2R92H 2JA7H 3H3VI 1I94L 2VY3A 4C3HH 5C4XH 2K75A 4DK6C 5GQOA 3MXNB 4JI5L 3RLFA 2VQEQ 4JYAQ 4IPHA 1KQSA 2R93H 3UE0A 3S2DH 1WFQA 1AH9A 1HZAA 2I5LX 4JI4L 2Z6KA 3CCQA 1A63A 4OX9L 1FVIA 1QUQA 2BA0A 2Z0SA 4IOAA 2NVTH 1PVOA 1BBWA 1PH9A 2MNAA 4X66L 1NMFA 1T9HA 2N8NA 4B3MQ 3CMEA 1YJNA 2ASBA 1KXLA 1VQPA 3AFQA 1WOCA 2D62A 5GADC 3K80C 4IPGA 1JB7A 4BXXH 1VQMA 5FJ8H 2K5NA 4JOIC 5IP9H 5LMNW 4KHPQ 1B70B 1LUZA 2ZJRA 1VQKA 3H3VH 1QZGA 4DR4L 4JV5L 2WAQG 3I4OA 1WI5A 2GVBA 5JJLA 2KHJA 4UPAA 3ZJYC 1HJPA 3HFZB 4HJ8A 3PF5A 2ZM6L 4L5SA 2AWOA 2E5LL 1Q81C 3H15A 3HOWH 3K81C 1WCMG 3HOYH 4GKJQ 2XTIA 1OXUA 4LUOA 2HQLA 1P8LA 1FL0A 2PNHA 4R4CA 1CKNB 3OYYA 3B6YA 4C2MH 3CD6A 4OO1G 3E9HA 3ERSX 3PUWA 4HJAA 1HH2P 2I0QA 4GOPA 2R93G 3GTGH 1IZ6A 2E2IH 1KHIA 3G48A 3GTJH 2OTJA 4Y52H 4RG1A 3G71A 4A3LG 1K8GA 2NN6G 3H0GG 4EX5A 1WYDA 4H02A 2MO0A 1LM0A 4KLKA 1KD1C 3HOUH 3PV0A 1NE3A 4HIOA 1B7YB 2VNUD 1Q82C 2K5HA 4LW1A 3PUVA 5C44H 3GTLH 5C3EH 3PO2H 3FP9A 3T1HL 1VQ8A 1NTGA 3NEMA 1YITA 1SN8A 1S40A 2FXQA 1NMGA 1Y14B 5M5XH 3CC4A 1GKHA 1UE6A 1XTDA 3TQYA 2ID0A 1TXYA 1X54A 3F2DA 2YTVA 3F2BA 4A3BG 1VQ7A 4YCVA 1XNRL 3I4MH 2E8GA 2CFMA 4IPCA 3I4MG 1PYBA 1Z47A 1OXTA 2ZJPA 1PH1A 1ASZA 3S1QH 4A3GG 1HNWL 2AMCB 5K36G 3CPFA 1YHAA 2Z6KC 2VQEL 4JYAL 3U4VA 2OCEA 1SR3A 5IYCH 3RNUA 2B29A 4GLAC 1E7ZA 1P16A 1QUQB 1JE5A 4DPGA 4MZ9A 3S14H 3I56A 3CP0A 4R1JA 1TWFH 4JBMA 3PO2G 4YWMA 1HNWQ 1A62A 1QVCA 4X66Q 1L1OA 3T1YL 2KBNA 5JEAG 1C0AA 2KHIA 4QY7A 4O2DA 3A5ZB 4X65L 2JE6I 1HR0Q 2NVXH 3M85A 3PF4A 2Q2IA 4QGUA 3Q8DA 1PFSA 4DAMA 4GLXA 4QL5A 3CF5A 1PH8A 1AE3A 2Y0SG 2VZAA 4PMWA 4AYBE 1HNZL 3I4NH 2CQOA 4KHPL 2N3SA 4L5TA 4A3JH 4YY3L 1N36Q 5AJ3L 3KJPA 3HOZH 5IT9c 2NZHA 5LMUL 4OONA 2ZTCA 3D31A 4BBRG 1IXRA 1HR0L 1S72A 2IY5B 2ATWA 2CWAA 2Q2HA 2R7FA 3J80i 3JAMc 3M3YH 3CCEA 5IYBH 2EQSA 2ZM6Q 1N33L 2ZTDA 3BJUA 4OWWB 1FGUA 2CKZB 4P75A 3JAMi 2ZTEA 4L5RC 4X62L 2OQ0A 5AJ3Q 1HNZQ 2HT1A 2NVYH 4DR7L 5LMUQ 4Y7NH 1N32L 1CKNA 4DUYL 1SMXA 3F8TA 4UP7A 5M5YH 1VQBA 5M3MH 2E2JH 3L7ZC 4A3IH 3S1MH 3PSIA 1JJGA 2K5VA 1EQQA 1EIYB 4GOPB 1J5EL 3J7A5 4MTNA 2VUMG 1UWVA 1V43A 2BA1A 4X64Q 4A76A 2F4VQ 4UP9A 3E0EA 2Q2UA 3CCLA 3OTOL 4AH6A 4DV0Q 3G6EA 2PI2A 4GOPC 4A4IA 4GLVB 1PHJA 3RN2A 1B8AA 2YV5A 3PGZA 1FJGL 5J3BA 2K52A 5HGQA 5M5WH 4K0KL 2F3IA 3PO3H 1UE5A 4DUZQ 4X64L 1KC8C 1YHBA 2AKWB 3T1HQ 3NELA 1G51A 2B63G 1K8AC 3TS2A 2RF4A 1Q46A 4A3MG 1K83H 1G291 5M3FH 1OXXK 3L0OA 3UDXA 4A3JG 2XGTA 2AWNA 5GAGC 4BY1H 3HOZG 2R7DA 2LXKA 1W2BA 1UE7A 1VCIA 3A5UA 1M1KC 1PA6A 3M9BA 4A3FG 1K0RA 1VQJA 4LFAL 1RIPA 1KRTA 2VUMH 3CW2C 2A19A 3K7AH 3ER0A 4HJ7A 3RN5A 3W1GA 2KENA 1CKOA 4NXMQ 1V1QA 1S3OA 1X6OA 1IBKQ 1N9WA 1M90C 1XPUA 1MKHA 2PMZE 4DV7Q 1JJ2A 1A0IA 3G4SA 1N8RC 2UUBQ 1E1OA 1VQ9A 3CC2A 4LF9Q 5M3FG 4A3GH 4LF4L 4DV6L 1L1OB 1YIJA 2R6GA 1Q1BA 2UXDQ 3HOUG 2JQOA 1YBYA 1I50H 2MFIA 1Y1VH 4BBSH 1A8VA 1L1OC 5IYDG 1YI2A 4LF6Q 1NJIC 1XMOQ 4JBJA 4LF5L 3DLLA 1L0WA 3CCSA 1VS0A 4JI5Q 2D0OA 4LNQA 3AFPA 3CXCA 4GN5A 2PI2E 2MO1A 4J15A 1SFOH 4XTCS 5C0XJ 4R4TA 1IL2A 1PYSB 2UXCL 3J7ZC 3BU2A 1XMQL 1YVCA 4B3ML 3STBD 1HNXL 1N33Q 1KAWA 2YTYA 3UE1A 1O7IA 3K8AA 4DNIA 1K9MC 1LTLA 5FLMH 4OWTB 2ZJQA 2N49A 1XMOL 2LXJA 4DR7Q 5IYDH 1VQGA 2IT1A 1CKMA 1X55A 2RHQB 3M4PA 3FKIH 3HOXG 4IPDA 2K4KA 1PH4A 3I2ZA 4RMFA 2JJQA 4JC0A 5BR8L 4AQYQ 4HIDA 1QVGA 4LF7L 1J5EQ 2QGQA 3RZDH 4IOCA 1XMQQ 4QIWE 1IBLL 2IX0A 4GKJL 2HHHQ 4DR6Q 5GAEC 2E2HH 2C35B 5IWAL 4JI0L 3EIVA 2RHSB 4P71A 4YWLA 2B3GA 3TREA 4YHHQ 5BR8Q 4HIMA 4AQYL 1Q86C 3S16H 4DR2Q 1X65A 1RL2A 1XNQL 1VQEA 2F52A 2I5HA 2NZOA 3CCJA 1W3SA 4DV3Q 1EOVA 1Y1VG 4BBSG 3RLOA 4JI2L 1IYJB 1IBLQ 4BY1G 2JEBI 2VS1A 3PUZA 2GVAA 4PZ7A 5IP7H 1SROA 3CCVA 2BH2A 4IJHA 4BBRH 4QQBX 2Y0SE 4MNOA 4NPSA 4AYBG 1PH5A 2K50A 5FLXc 4NXNQ 4XIGS 1OXSC 1I3QH 3F2CA 3PO3G 2R92G 2VQFQ 2DGYA 3HKSA 1PH6A 3PUYA 4LFAQ 2YYZA 4YWKA 3J81c 2DUDA 1KL9A 3TEHB 1GD7A 4JI3L 2PQAB 3BZKA 1H95A 4DR5L 2UXBQ 3E9IA 4B3RQ 4DV7L 4HJ5A 3GTKH 3F1ZA 2CCZA 2VQFL 3J81j 4JOIA 3M4QA 4HIKA 4P74A 1Y1WH 2EXDA 1VQCA 5E7NA 5LMNL 3HOWG 2JEAI 1C7YA 3KYHC 1J6QA 3M4OH 1X56A 1VQAA 1XNRQ 4B3RL 2PQAA 4LF5Q 1G6PA 4ME3A 3AQQA 2NVQH 4LF6L 3A74A 2VL6A 1X3EA 4IJLA 4C3IH 1X9NA 4HJ9A 1PH3A 1VQNA 4A3IG 3AEVA 3S1NH 5H1SE 3KDFB 5LMNQ 2EIFA 3OW2A 1TWAH 2R7ZG 1JT8A 1JMCA 5FLMG 4TVAB 3GTPH 5IP7G 4WJ4A 4LFCQ 3ULLA 3S17H 2HIXA 1E24A 3HOVG 4A75A 1YHQA 1PH7A 4B3TL 4BY7H 2GN5A 4JBWA 4R4QA 5IP9G 2VW9A 4X65Q 3W1BA 3GD7A 4PZ8A 3EBEA 2E5LQ 3M7NA 4IFDG 2JA5H 3AYHB 1NY4A 3NENA 2QA4A 1VQ4A 4APVA 3PIPA 2D0PA 1FJGQ 4LFBL 4X6AH 4YCUA 5IYBG 1CSQA 4PG3A 1VQ5A 4DR1Q 4YY3Q 4DR3L 1N36L 2A8VA 1DGSA 3S1RH 1YNXA 5GAHC 3GO5A 3HOYG 4JI0Q 1HZCA 1EWIA 4LUVA 5IE8A 2WB1G 4KHZA 1SE8A 3FKIG 2V1CC 3U4ZA 3GDEA 4OXPA 1IBML 1X3GA 2IHFA 2HHHL 2UUCL 3STBC 5C44G 4DUYQ 3KF6A 4BY7G 4FDBA 3ULJA 3A0JA 2NN6I 3PCOB 1XNQQ 4X62Q 3HOVH 1E1TA 1TWHH 4KI0A 5IYCG 4JI2Q 3CPWA 2WP8J 1QZHA 4POGA 4DV3L 1I6HH 4IFDJ 1EQRA 2WAQE 4YCWA 1EYGA 4JV5Q 4A3LH 3OTOQ 1UEBA 4OWXB 1E22A 1XPRA 1Q12A 2JK8A 1EUJA 3UDFA 1IBMQ 1WJJA 4NXNL 5C3EG 3RZOH 4LF8L 2JA8H 3K7UC 3KF6B 2UUBL 2CWPA 3UDGA 4GS3A 4P73A 2OTLA 4JI8Q 5ELNA 4EQ5A 3GTMH 3PIOA 4A3CH 4K0KQ 3MEFA 5EAYA 2UUAQ 3HOXH 2JA5G 4JI3Q 1D7QA 1BBUA 2ALYB 1EFWA 1Q1EA 4DR5Q 2LSSA 4A3BH 3BZCA 4POFA 2K14A 1QVFA 3EN2A 3DM3A 4P72A 1EIFA 2JA9A 1TWGH 5IY0A 4GKKL 1XJVA 4DV2L 2ES2A 3PUXA 1U0LA 3LGJA 5C0XI 2QEXA 4A3DH 3CC7A 1CSPA 3T1YQ 4DR4Q 1VQHA 4A3MH 2UXCQ 1YEZA 2JA6H 4WJ3M 1X3FA 2RCNA 3HKZE 2B63H 4IO9A 1Q7YC 3H0GH 3CCRA 1HNXQ 4DKAC 2JA8G 3KFUA 5JJIA 2HIVA 4JBKA 4A3EH 1HR0W 1OTCA 1IBKL 4GKKQ 1I94Q 4PZ6A 3WWVA 1SLJA 2OQKA 3K0XA 5C0XG 4AIMA 1YJWA 4NXML 2JA6G 3KDFA 4ALPA 3TS0A 1OXVA 4OX9Q 1BVSA 5FJ8G 4LF4Q 4JI4Q 1LYLA 3S24A 3S15H 4LF9L 4BA2I 5DLQE 3HKZG 3I4NG 4O0AA 4LFCL 5C4JH 1MIUA 1V9PA 2Q2TA 2YU9H 3L2PA 2UXDL 4DV1Q 4B3TQ 4OO1I 2IHEA 1YZ6A 3JC66 5HY6A 3KF8B 4LWCA 1HZ9A 4JI1L 3RLNA 4BA1I 5M3MG 4GNXA 2KCMA 4LFBQ 1E3PA 1TWCH 3GTQH 3I55A 1N32Q 1Q8KA 4DK3C
chains in the Genus database with same CATH superfamily
2FMAA 1EY0A 2WFWA 1SRUA 1GM5A 1XDNA 2WKCA 3DWAA 4A3EG 1STEA 3F8NA 2WTFA 4UP8A 4F4ZA 1F9QA 1WCMB 5KYLA 4JI1H 1K28A 3CMAA 1GSAA 1SNPA 1UE1A 1CUKA 1Q90A 3WO0A 2F4VL 1LTTD 3SGIA 4A3DG 1L2FA 2I5MX 3N42B 2RSNA 3TRZA 2NU6B 4JI5H 2X6GA 2GLTA 4LH7A 2N78A 1U4PA 2UU9Q 3OSNA 2NUCA 5M3MB 2E2JB 4PV1C 1K73C 5JJKA 5KG5A 1X3QA 2GA4B 3CCMA 4QWAA 4LF7Q 4G7OC 5DLGA 4RNMA 3DUZA 3I7FA 4LAAA 3D3RA 2OWOA 4R4OA 5LA6F 5DG7A 2AGOA 3MXGA 3FVQA 3OWEB 5C4XG 3J80c 4J8QA 4ECVA 3R2TA 2WB1A 2JN4A 2FPIB 1ZYRD 4LF8Q 3J7AK 1EUDB 2UUAL 1BNZA 1MJEA 3R2IA 1TWCB 3GP7A 5GROA 3X3MA 4JI8L 3BVMA 1EEFD 1NBWA 1NR2A 1B1ZA 3D0FA 1KTKA 5ELEA 1XMOH 1K3RA 3Q6SA 4R8NA 5KFYA 1LT3D 4JI7L 4DV2Q 4X3KA 1D8LA 1AUXA 2F3VA 1GO3E 1GHJA 4CGYB 4CKEA 1CFMA 4CJ0B 2L15A 1AE2A 5FD6A 1M0WA 4DUYH 4ED3A 4GN3B 2QDLA 3KLSA 3JZIA 3H3VI 1I94L 2VY3A 3RB3A 2WINB 4CBVA 4JI2H 3RLFA 4JYAQ 1BDOA 1KQSA 1AH9A 4FVMA 4JI4L 2I5LX 4V0BA 1QUQA 2Z0SA 5IWAH 2C9OA 3D4DA 5T1IA 4C3IG 2NU8B 1NMFA 4B3MQ 1WD0A 5K2MA 3KHRA 2PZTA 2BCOA 1EUCB 3AFQA 4JI8H 5J39A 2QEJC 4M9UA 5I4DA 4I7AA 3KBGA 3E3XA 5FJ8H 1IOWA 4WFN3 5C44B 2ASDA 3Q1KA 2W9BA 1KJQA 4ZUJA 3RGXA 1LUZA 2ZJRA 1VQKA 2JA6A 3C1EA 4DR4L 1CQFA 2WAQG 5IT9L 3I4OA 4XYMB 1JX4A 3BQ1A 1HJPA 3HFZB 2XIWA 1VMCA 1PZKD 2YRWA 3HOYH 1ML0D 2CH4W 5JVDF 4A3JB 3HOZB 3OOCA 2OXPA 1EIHA 4R4CA 3OYYA 2L12A 3B6YA 1I7NA 3RUPA 2KEDA 4QWBA 2HVQA 2I0QA 1RJRA 2F0GA 3N8DA 2E2IH 3G48A 5G3LD 1G91A 2OTJA 1AUVA 1S0MA 4A3LG 4DLKA 1GSOA 3VR3A 4I4TF 2PN1A 2NN6G 3DEPA 3H0GG 4H02A 3R93A 4KLKA 5DM73 3ITPA 1E4FT 1TQOA 3PV0A 1NE3A 4Q5VA 4HIOA 4LMYA 3PIP3 3PUVA 3PO2H 3NBHA 1TR5A 3FP9A 1VQ8A 3NEMA 4A3KB 2FXQA 1NMGA 5M5XH 1JOQA 1GKHA 4UCRA 5C4HA 1QJOA 4CC6A 4O4IF 4O3PA 2XRQD 4CKBA 3RJ0A 3R3OA 1S68A 5J22A 3BVGA 4A3BG 5LYJF 4FXKC 1SNMA 1EY7A 2ZM6H 2VUGA 1HNWL 1E0BA 1C48A 3S1QH 4IUPA 3GIQA 1LT4D 5KFVA 3U4VA 2NB0A 5IYCH 3V2TA 3RNUA 4JI4H 3HP3A 1EYZA 1QUQB 1KAAA 1TWAA 1IBMH 3S14H 3M4IA 2NTSA 4YWMA 1L1OA 3BVZA 3SK6A 1S5BD 4EGVA 1JC7A 3LWEA 2KHIA 2XVSA 4QY7A 3DWQA 2N55A 3PF4A 2V4QA 4QGUA 5HURA 3BDLA 1GSHA 3Q8DA 1PFSA 4DAMA 3I4NH 3AU7A 3S17B 1AE3A 4EGJA 2VZAA 4RFBA 2PMZA 5C8YF 4ECSA 3S9WA 2A6EC 2C00A 2DZDA 4UCUA 4ECUA 1IXRA 3GILA 4UAIA 4CC5A 5I47A 2IY5B 1UAPA 1E2VA 5KFRA 3OHXC 3WNZA 3EVQA 1N33L 3DXJC 1PRTC 3BJUA 1B6RA 2CKZB 1C30A 2OQ0A 5AJ3Q 2B2TA 1C3OA 1VQBA 2A6HC 3S1MH 1EQQA 4J9SA 1J5EL 3BABA 1N33H 2NVXA 4DNTB 3BDOA 1I4XA 2VUMG 2B2VA 2SCUB 3WOFA 4AH6A 4DV0Q 2PI2A 2VQEH 1ZHSA 4DL7A 1O7ZA 4JI0H 4FS2A 3RBDA 1Y1VB 5JPMC 4BBSB 4O42A 5IGCA 2NVYA 3D6CA 5J1ZA 2AQ2B 2ALZA 4C2MB 1SCUB 4RGNA 4ZYSA 4DUZQ 1KC8C 3BG5A 1YHBA 2AKWB 3T1HQ 2C2RA 3GLKA 2R86A 1K8AC 2F0VA 2RF4A 1LTID 3KBXA 2G9HD 2XGTA 2AWNA 4X3SA 5GAGC 4ME6A 3MXUA 1VCIA 4B3SH 4JPBW 1VQJA 1RIPA 2F4IA 4KD4A 5ISRA 3ORQA 4O3QA 4B3MH 3M7GA 2JEFA 2A19A 3ER0A 5CA1F 2EDGA 1DOMA 4KY6A 4RH6A 4ME5A 4IUQA 1N32H 2EY2A 4DV7Q 5T1GA 1JJ2A 1HNWH 1SE3A 3CC2A 5M3FG 1KNAA 4YAKB 1AN8A 2BR0A 2YCHA 4K6LA 5C3XA 3GV8B 4LK1C 1PMRA 1YI2A 1EY9A 1S5CD 4LF6Q 1XMOQ 2FPGB 4PDBA 3HS0C 4LNQA 3SDZA 4GC6A 1RF2D 4H13C 2PI2E 2MO1A 1JDEA 4XTCS 3NTHA 5JOBA 2UXCL 2W71A 1ENCA 1EY5A 3NP8A 2K05A 3J7ZC 4ED0A 4HSVA 1QB5D 4IAJA 1KAWA 4NXNH 1C4QA 3TINA 5KNCA 2DPIA 3EQLC 5FLMH 1Z2PX 2N49A 3C1FA 1XMOL 2VPQA 4KKUA 4LF7H 1CKMA 2R8JA 3L4JA 1FNUA 3HOXG 4J9PA 1VKZA 3I2ZA 1QVGA 4JC0A 1Y1WA 2Z4HA 1WSCA 1G6ZA 1A2UA 2DIKA 3CKIB 5EQ0A 4IURA 1EHIA 2WDTA 2SOBA 5ELCA 2IL8A 1DZ1A 2FMCA 1SE2A 2IX0A 5JVG3 1S9FA 1XWEA 1K3BC 3S1MB 2QYZA 3VPCA 4AQYL 1QCBD 3MFYA 1RL2A 4QW9A 4F7XA 1ZETA 3CCJA 1R9TA 2F0OA 3RLOA 1IYJB 1IBLQ 2H1EA 4QB4A 4UDUC 2UVUA 1YNJC 2RA4A 4K5XA 3UI2A 1SROA 3GTGB 2EOTA 4BBRH 3OW7A 3Q2OA 1O80A 4QWDA 2K50A 2FK3A 2DLNA 4NXNQ 4KHPH 5FPOA 2DGYA 4DU9A 2YYZA 1HFGA 3NQTA 4CKCA 1KL9A 3K0YA 2DWCA 2PQAB 4YAJB 3RAXA 1LT5D 4DR5L 2UXBQ 3F1ZA 1F77A 3R5HA 2VQFL 1SSOA 2LMCB 3PW7A 5DM63 4JV5H 3RD4A 4P74A 4DR7H 4XZ3B 3HOWG 4TQSA 3NBIA 3KYHC 1UC9A 4RUCA 1X3PA 4J9QA 1XNRQ 2K33A 3VA5A 4IRKA 4B3RL 1IW7D 4LF5Q 3RIZA 3AQQA 4YR3A 4ZKBB 4C1NI 2L5TA 3S1NH 4BY1B 3CU7A 1YNJD 3E0JA 2W57A 5KT6A 4R8UA 5A2QW 1XXGA 3LWBA 5JJZA 1GYFA 1JMCA 1HPCA 4A3GB 1NNXA 2Z6BA 4LFCQ 3ULLA 3S17H 2HIXA 1PRTB 4A75A 5M9OA 4PQXA 2GN5A 4JBWA 4R4QA 3MVVA 4XX0B 4F88A 4FU0A 3GD7A 3OIQA 2E5LQ 4IFDG 4MA0A 1NY4A 1VQ4A 4APVA 3PIPA 1I6UA 4QMGA 2FKLA 4RZQA 1VQ5A 1N36L 1E4EB 2F0WA 3S1RH 4JI0Q 1HZCA 1RD9D 1SE8A 2DNCA 2V1CC 2Z8LA 3A8JE 4QCLA 4FDBA 1O75A 3A0JA 1XNQQ 4CDDC 4X62Q 5KT4A 3MFIA 4DR4Q 4JI2Q 3KAKA 2EY1A 4IFDJ 1LO5D 3GTGA 2IA6A 2UUCH 3K3PA 1XPRA 1VDZA 3K5NA 4A2AA 5FO8B 2DPJA 4JI6H 3IFDA 3M4YA 3M4OB 2R7KA 1EY8A 4BWGB 1EQVA 2CWPA 5EZYF 5C1OA 5BN5A 1GLVA 3PIOA 4A3CH 4RHRA 4YP3A 5A2QE 2JA5G 2ALYB 3NWTA 3BYYB 3TP5A 2O5IC 1EU4A 2K14A 1QVFA 2FLNA 1EIFA 3FEWX 4A3EB 2D5DA 1U0LA 1RODA 3E5NA 2QEXA 3CC7A 4NW2A 3KHGA 3V4ZA 1YNND 2G5DA 2UXCQ 3MZ5A 4WJ3M 3Q8SB 1PTOC 1RDPD 1X3FA 3HKZE 4KV6A 2E2HA 1TIID 2M2LA 3QO2A 4FM9A 4H44C 1TS4A 2HIVA 4JBKA 4X66H 1SLJA 1FKAH 1FYCA 4ALPA 3TS0A 2CZGA 1IW7C 5FLXL 5FJ8G 4K14A 1LYLA 1IKLA 5FD5A 1J5EH 2R8GA 1J9OA 1A2TA 2A73B 1MD2D 4JI7H 1V9PA 2UXDL 2R7MA 2IHEA 1YZ6A 3JC66 4GNXA 3KF8B 4LSXA 1RJPA 5DQIA 4ZKCB 5A35A 1TWCH 1H9RA 2ZJTA 4C1NK 2E74C 2K28A 2A1AA 2A6HD 4MV7A 4DAYB 2RDGA 3V4SA 2HCIA 2XN9C 1NUCA 4Q8FA 2UUCQ 4DV0L 2ZDGA 3G6XA 1D1KA 2I80A 1MJCA 5KFPA 5KGUA 4UY8C 2JA7G 4ECXA 2L55A 4DAPA 4F8MA 4DV4L 2A6ED 3KLWA 4DUZL 1ZYRC 4ED6A 1BCPD 2N88A 2FINB 3L3OC 2R7ZH 3EFXD 1SYEA 3RR5A 2UXBL 1YJ9A 2A74C 3KOJA 4YHHL 2EYLA 3KJOA 4DN4M 2YTXA 2UU9L 4DR6L 3K5LA 4DV4Q 4KK7A 5EOYA 4J1MA 1W96A 3DM1A 2KVMA 1OO9B 5I2XA 3PW5A 5KFGA 3HXLA 5G3LF 1E2WA 1KRSA 4NB3A 5KFTA 3HZXA 1EQTA 4EYIB 4A3FH 4OIJA 4A93G 2X6LA 1K1QA 1ASYA 2BH8A 2AGPA 1PZJD 5I6WA 1I5FA 4IUTA 3MR3A 2RVLA 1BKBA 2AHOB 2XSCA 4A93H 3FDTA 3U50C 3DMUA 3OSOA 1Y1WG 2Z1CA 2R92H 4DUZH 2K75A 5I2YA 4ED8A 2F0TA 1ET9A 5AFWA 2FPPB 3MXNB 2R3ZA 4ZOLF 4IPHA 2B2UC 3S2DH 1WFQA 1MBYA 5D65A 4RNOA 4NXMH 4OX9L 1PVOA 4ZLTF 1BBWA 2M00A 4O3SA 2MNAA 1BNCA 1JWUD 2BE5C 2I07B 1TT2A 1YJNA 3H09A 3GTQB 1DYQA 1WOCA 2D62A 4ID6A 4K2KA 5GADC 2W6MA 3K80C 1UNSA 3RF2A 4ZQIA 3J7YW 4EBEA 1O7LA 2ZXPA 4RA8A 1K8OA 2SNSA 1JORA 4A2BA 4KHPQ 1B70B 4IRDA 2CHBD 1QZGA 3EA6A 3GTOB 1A3TA 4DAYA 2RDHA 3MEHA 4K8JA 4ULLA 3PF5A 5EKIA 3LMLA 2QK4A 2E5LL 1WVLA 1Q81C 4LJZC 3K5MA 1K1SA 4CDFC 1OXUA 1BUVT 4AYBB 2F4VH 4B9WA 2W9AA 5CYUA 1FL0A 4WD3A 5ELFA 2XIGA 1N32Q 1CKNB 4OO1G 3I70A 5KNBA 2K1BA 1MSGA 2F0EA 3C3LA 2AU0A 4JI3H 4HJAA 1W93A 1ICFB 1TKWB 4GOPA 2R93G 1Y8PB 1KHIA 2HGSA 4S3SA 3GTJH 1WTPA 3I8ZA 4Y52H 5CAEB 2NBFA 4RG1A 3H91A 4YQWA 1K8GA 1WYDA 3PVXA 2YYAA 2CQAA 1KD1C 3GIPA 3T5KA 1TA8A 2JEGA 3T16A 3QIAA 2F1MA 4RAUC 1Q82C 2JA8B 2K5HA 4O4LF 2HDLA 4LF5H 5C3EH 2PBZA 1NTGA 3MXPA 4DR3H 1A3VA 2F0JA 4OL7A 2OEOA 1XTDA 2F0HA 1PX2A 4Q45A 5KFXA 3GTPB 1TXYA 5C1PA 1SFOA 3WO1A 2FK2A 4YCVA 1GHKA 3MR6A 1QWYA 5KG0A 3I4MG 4DR1H 1PYBA 4XYOA 1OXTA 1PH1A 4DGZA 5K36G 4HNTA 1B33N 5D3DA 3CPFA 3MXNA 2Z6KC 2VQEL 1T5EA 1SR3A 1D5ZC 2B2TC 2DY8A 5M5YB 4DPGA 4MZ9A 1EL0A 3TQ1A 1JICA 3PQIA 4R1JA 2MJ8A 1HNWQ 2FHTA 1A62A 1R4QB 3I3CA 4UCSA 3GTQA 1VF5C 2F3WA 1PFBA 2KBNA 4UFZA 2CW7A 3A5ZB 2NVXH 1I4RA 2PVPA 1X32A 3M85A 1QILA 2XC9A 4ECTA 2Q2IA 4QW8A 4HMIA 4BY7B 3I4MH 2B8GA 1BCPB 4G4KA 4HNUA 1LTSD 3RZDB 2F0MA 5CBEE 3KJPA 4Q43A 3D31A 5KRUA 1D5XC 3BS1A 1Y8OB 2R7FA 5E1FA 3J80i 3M3YH 1S5DD 2JA5A 3RAQA 2GPSA 4UCTA 2ZTDA 4OWWB 1FGUA 2FLLA 4B08A 2ZTEA 3HB9A 4L5RC 4X62L 4RCOA 4DR7L 2OT2A 4KY5A 1CKNA 1SMXA 4UP7A 5M5YH 5M3MH 2E2JH 1BGWA 4RNNA 4ECWA 3PSIA 2Y0SB 4ZK9B 3J7A5 4GKJH 2NUAB 1JCKB 4M8AA 2O03A 1V43A 4X64Q 2BA1A 1Z6HA 4A76A 3BA9A 3E0EA 2Q2UA 3OTOL 1Q8IA 4YIJA 3LP8A 4A4IA 4P2CB 1PHJA 1STAA 4HTHA 4YHHH 3P7JA 4HCEA 4K0KL 4LF6H 4ILWA 2F3IA 2XWBB 4NP5A 2RKSA 3PO3H 4X64L 2BQ3A 5KFUA 3BA8A 5CV7A 1B53A 2L11A 2E2DC 5KFDA 1OXXK 2J9GA 4BY1H 3J80L 5F2DA 1FR3A 4DAVA 3Q23A 3A54A 3M9BA 4X62H 2EYPA 1KRTA 2OH2A 4K5VA 2A69C 3FMAA 3K7AH 3VYRA 4HJ7A 2EYFA 3Q0AA 1IOVA 3AMUA 4A3FB 1V1QA 1U4MA 1S3OA 3ND9A 1X6OA 1I3QA 1IBKQ 5LP6F 4XYLB 2K03A 1XPUA 1RCVD 1SNDA 2PMZE 2B63B 3H4DA 4DV6H 3M9NB 3G4SA 1N8RC 2KOLA 2ENBA 4A3GH 2W8KA 1YIJA 4C5AA 3OUUA 3MFHA 2EY5A 2UUAH 1JOOA 2UXDQ 5J2UF 1F2LA 1LLRD 1YBYA 1TWHB 2MCTA 1I50H 3S1NB 2WYOA 1L1OC 3TBIB 5CV4A 3HEJA 1KJ9A 3G8CA 5L1LA 4JI5Q 1VS0A 4FO2A 2L9HA 1WTHA 5CC4A 2HJWA 4FBTA 1KJJA 4J15A 1SFOH 4IFDH 2FJZA 3PR5B 5C0XJ 1Y1WB 3CQZB 1PYSB 4RAYA 1FGBD 5JAVA 2R61A 1XMQL 3TIGA 2IP4A 1STYA 3STBD 1N33Q 2YTYA 4DV5H 3UE1A 4DNIA 2UUBH 2YW2A 2P0AA 4HN7A 1I50B 1GGOA 2LXJA 1D5MC 1LV9A 1VQGA 1Z2OX 2W6OA 1X55A 2K4KA 3BG3A 3I90A 1LTGD 4RMFA 1PH4A 1XNRH 4LF7L 1WTXA 2QGQA 2V59A 4MV1A 2ASJA 1XMQQ 3TQTA 1QNUA 2HHHQ 4DF7A 5CMDA 2F0KA 4IWYA 2C35B 2EXZA 5CV8A 4H7BA 5IWAL 1XJVA 3TREA 2B3GA 5E4XA 4YHHQ 3GV5B 4ECRA 4YJ3F 2QW7A 3VPDA 4C3IB 4U673 2SNMA 1VQEA 2I5HA 4U68A 2NZOA 3TP8A 1STHA 2SEBD 1T5XD 4BY1G 3PUZA 3CCVA 1KDBA 4DL6A 4J6HA 3H40A 4QQBX 1GOZA 2Y0SE 4NPSA 4AYBG 2ZDHA 2W7PA 2B39A 1HR0H 3PW0A 3BJYA 1II3A 1CQJB 4XIGS 3PO3G 5IYZF 5BPHA 3HKSA 1ESFA 1RK6A 4KD3A 1UEAB 1CZWA 4KHVA 5FO9B 5KFIA 4EEQA 3BZKA 5DG9A 1I3QB 1CHQD 2CH4A 4HJ5A 3PN1A 1HCZA 4EYHB 2C22A 3GTMB 1EOTA 4C3HG 5JVH3 2E2IA 1DIKA 2EXDA 1L0XB 5D1PA 1X56A 4OIKA 2VUMB 4ODGA 2NVQH 3QZ7A 4IJLA 2R93A 1V8QA 1B4OA 4HJ9A 4DV4H 4A3IG 3T5JA 3KDFB 3I91A 4R9WA 1SMYD 3RUZA 4G7ZC 1T3NA 1EU3A 3P75A 4XT1B 1WTWA 4MA5A 5FLMG 2WACA 5L1IA 2NN6H 1E24A 3T5HA 4A3DB 1YHQA 1PH7A 3BDCA 3JAML 1RTNA 2MHVA 4OHJA 4HR7A 5DQGA 4DL3A 4IRCA 2VW9A 3T53B 2DN8A 4X65Q 3R5FA 2VB2X 1I50A 4K8IA 2FMMA 4PMCA 2JA5H 3AYHB 2AGQA 3FRPB 3QWNA 4K6DA 2D0PA 1ZHQA 3HGBA 4X6AH 3C0FB 3ND8A 2NTTA 4YY3Q 2A8VA 4J9OA 1B3AA 4JV1A 1YNXA 3HOYG 3OHBA 1V1PA 3RZOB 2RDJA 1IBML 1I4GA 3GDEA 2HHHL 1IYVA 3KLRA 4ZQ3A 3JSLA 4EQNA 3VR2A 1F9PA 3MA2B 3JSNA 4J9NA 3T51B 4X64H 1E1TA 1TWHH 3CPWA 2K6AA 2WP8J 1I6HH 1STGA 2YZGA 3MAQA 3DEOA 4O1NA 3OTOQ 1UEBA 4OWXB 2XGQA 1IBMQ 4KJOA 1PDQA 5C3EG 2JA8H 4LF9H 1S0NA 3UDGA 2K5WA 4GS3A 4P73A 4K0KQ 2EE1A 5ELNA 5IGEA 3GTMH 1SEIA 1TWCA 2UUAQ 4I50F 4A93B 1LTRD 1S5FD 1BBUA 2CW8A 4WBNF 3K59A 4A3BH 4POFA 5LOVF 2VOBA 1PTOB 4TUYF 3PUXA 5C0XI 2A68C 1DCZA 3H0GB 5KG1A 1B3QA 4V190 2JA6H 4MV4A 2RCNA 2B63H 2J6UA 3N6XA 4IO9A 5JQWA 3H0GH 2EJGC 3KFUA 4DKAC 1S10A 3Q8QB 4L63B 1IBKL 1I94Q 3Q22A 3WWVA 2R7LA 2OQKA 2DJGC 3K0XA 5C0XG 4NXML 1OXVA 4OX9Q 4FYDA 1SYGA 4OELB 5NUCA 5HBRB 4C5BA 4KY7A 4LF9L 4BA2I 4HQ6A 2HVRA 2VA3A 3SXHA 3MR5A 4LFCL 1M0TA 1MIUA 3L2PA 4DV1Q 4N9TA 3LWUA 4JI1L 2PZWA 4BA1I 1M1KC 3IFTA 4YB8B 2R87A 2KCMA 3GIKA 3GTQH 3PR4A 2W9BB 1U5KA 4B3SQ 2KUMA 1VQFA 3RB6A 3FHWA 2HQEA 2CVRA 4ZAIA 3OPOA 3UDIA 1KIXA 3KHHA 2ASLA 4C3JH 4DR1L 4DR3Q 1L0YB 1CA5A 1AP0A 1N34L 4JI1Q 2JSOA 3F2UA 2IX1A 1IYUA 4DV1L 4GNXB 1SEBD 3LNNA 4A3KH 3IN5A 3HKZA 4ZRZA 3CCUA 3KTMA 4MV9A 3ULPA 1Z9FA 4B3RH 3H4BA 5I6YA 3VA7A 4TKOB 4MTDA 1JIHA 3J80W 4A3KG 3HOUB 1VQOA 4IHJF 2MQHA 5JEAJ 1ZEQX 3KALA 4FF4A 4GNXC 2H5XA 2Q8IB 1N34Q 1A9XA 5IWAQ 4A3CG 3IRBA 1PH2A 3M3YB 3KUPA 1TVXA 4DR2L 5FO7B 4GC7A 3EYYA 3D4WA 3N52A 4TSSA 2WB1E 4JI6L 4MV3A 4I55F 4EEYA 2J7ZA 3OWFA 5FOBB 1KBLA 2BQUA 2GPWA 4QJFA 1VQLA 2MPMA 4ABNA 3NBHB 1XMQH 2RQXA 3VR6A 2W9CB 1I94H 5IOCA 2DNEA 3VDYA 4GN4B 2WE6A 4LSAA 4DL4A 2C28A 5BN4A 1AW7A 4DV5L 3CAMA 3VYTA 1HZBA 4O4HF 2M05A 4BXXG 5C4XB 4AQYH 3HRZC 3K57A 3FPPA 2Z9HA 1B9MA 4RWSC 4R7RA 2JA7H 1U4LA 4C3HH 1MHWC 1XTCD 5C4XH 2KJXA 2EJFC 4DK6C 4JI5L 3A8KE 3GTLA 1KABA 1ONLA 3MWMA 5F9LA 4Q44A 4DR2H 3KXYT 1VAJA 4XQNA 2K32A 3GTOA 2N8NA 2SDFA 3MHBA 3CMEA 4M1UB 3E5SA 5KYIA 1IBLH 1T94A 2XCPA 4Q0YA 2UXDH 1JB7A 3VR4A 1VQMA 4F4XA 4C3JG 2K5NA 5IP9H 4AYBA 1DJRD 1G2SA 1UC8A 4NLGA 2FLPA 2PMZB 4N8FA 4X3UA 3H3VH 3KK7A 4JV5L 1RYSA 1SXTA 4RGTA 1U4RA 1CQVA 2KA7A 2GVBA 4HMJA 5JJLA 2KHJA 3ZJYC 4HJ8A 2OF1A 2B2WA 3J7AV 1WH2A 2ZM6L 4L5SA 2AWOA 3H15A 3HKZB 3HOWH 5FKAC 4L6TB 5A2QL 2XTIA 4LUOA 2XCLA 2HQLA 4RB2C 3VPBA 1EZ1A 2W6PA 2PNHA 4C2MH 3CD6A 2Z4IA 1Z2NX 1FNVA 3QOLA 3H3VC 3ERSX 4DL2A 3PUWA 2UVRA 1HH2P 4QF4A 4FXDA 3S1RB 1M7JA 4EBDA 4X65H 1K83A 2WB1B 5EPLA 4EX5A 5LMNH 1IL8A 1CZGA 2MO0A 1EZ6A 3HOUH 1B50A 1N48A 1BJTA 3A55A 4I7HA 2VNUD 1B7YB 5K36H 4MN3A 4LW1A 2R7NA 3GTLH 3J81L 3T1HL 2ICIA 2W9CA 1SN8A 1S40A 4QIWB 1V51A 2IX3A 3GTKB 2Q8TA 3TQYA 2ID0A 5KFZA 4ZI7F 1KLUD 3SK8A 1X54A 3F2DA 3F2BA 3HOVB 3TP7A 4LMQD 1XNRL 4KN7C 2E8GA 2CFMA 4IPCA 3Q24A 3TMEA 1Z47A 4A3GG 5F9NA 3EJIA 4CDCC 4Y8VB 3VYSA 4MTKA 4JYAL 1M6VA 4MTEA 2MP1A 2OCEA 1S97A 1KC7A 4N8X1 3JAMW 5BN3A 1GUTA 5K5PA 4GLAC 1P16A 1ILPA 4QWCA 3OUZA 2ZT9C 3D4RA 1SFOB 3V6KA 3K7AB 1BXRA 2ATLA 3NPPA 2F0IA 1QNKA 3PO2G 1AN7A 4X66Q 1QVCA 3T1YL 1IKMA 3OMGA 4IZ8A 3ONAB 3S16B 4X65L 1HR0Q 2UXCH 1Y69U 2VPSA 4EQOA 2HVSA 5JH7F 4RU9A 5C5MA 3DHQA 2JA6B 5KFOA 2CQOA 2N3SA 3A56A 4L5TA 1N36Q 3RBEA 3TZUA 5LMUL 2ZTCA 1SNQA 1I6HB 2J0TD 1HR0L 3QZ8A 2Q2HA 5C0XH 2XCAA 3BQ2A 2EQSA 2NYZD 1HQMC 5KFEA 1EWHA 5EWGA 2NVQB 4P75A 5HV6A 2HHHH 1MI2A 2CW0C 2HT1A 2F0NA 1H9MA 2NVYH 5L37A 4Y7NH 1N32L 2HD3A 4A3IH 1JJGA 1G2TA 2K5VA 3H20A 1B9NA 4HAEA 1SMYC 1LT6D 3TIIA 1UWVA 4FNFA 1V4YA 3HBLA 3A8IE 2EYHA 4UP9A 1RJQA 4ED1A 3G6EA 4GOPC 1E4GT 5KG2A 4LF4H 2YV5A 3PGZA 3K58A 2VXWA 5J3BA 4J9KA 3H6MA 3T4AC 1I4PA 1DOKA 5M5WH 1M4VA 1TS3A 1UE5A 3QFFA 1FD7D 3NELA 3MJFA 1G51A 4IUUA 4QWEA 4QIWA 3TS2A 1SDFA 3PO2B 5CR3A 4A3MG 1K83H 2F0PA 2F0FA 3UDXA 4A3JG 3HOZG 1JXLA 2LXKA 2RGRA 1PA6A 5DGAA 4A3FG 1K0RA 1JB3A 2JEIA 4HYKA 2VUMH 4FF1A 1GUSA 2AUJD 4LFAH 1MGSA 4IQZA 1PRTD 1CKOA 3W1GA 1KLGD 5EGTA 4I7ZC 2EY6A 1N9WA 4DK1A 5EKKA 1M90C 3RTXA 1IBKH 2KEEA 2KECA 1UNNC 5DNFA 1VQ9A 4A3MB 4RCNA 4LF4L 4DV6L 1L1OB 3U9OA 4JV2A 2F0SA 2B2YA 5M5WB 2R6GA 1Q1BA 3HOUG 2JQOA 1ZKOA 1WTRA 5JPNC 3L4KA 4CHTB 1Y1VH 4BBSH 1A8VA 2O5JC 5FK9C 1SYCA 2IPKD 2R7ZB 4JBJA 4LF5L 1L0WA 3CCSA 2MUYA 3AFPA 5IGGA 2C5CA 2EZVA 4RGOS 2NU7B 4R4TA 1IL2A 1TS5A 3H94A 2J6SA 1YVCA 3SEBA 4B3ML 3CVZA 2RSOA 1O7IA 3K8AA 3N6RA 4NDXA 4OWTB 2ZJQA 1TU2B 1BXTA 5IYDH 4M7EA 2IT1A 3W3AA 2RBMA 5LMUH 4IPDA 5JUMA 2JJQA 5BR8L 4HIDA 3CQZA 1J5EQ 1CT1D 4IOCA 2I87A 4EQPA 4I65A 3VR5A 3SE0A 2AUKA 4GKJL 2AQ1B 4DR6Q 1KJIA 5GAEC 2FE3A 3KHLA 1SYFA 4A3IB 1D6EC 4JI0L 2L1BA 3EIVA 1A3UA 2RHSB 4P71A 4WJWA 4HIMA 3DWPA 3RFCA 1CHPD 3S16H 5KFWA 4DR2Q 1X65A 4XYQA 3D6WA 1KEEA 1XNQL 2WKDA 2F52A 2VA2A 4DV3Q 4C2MA 1IHZA 4JI2L 4EVOA 3GTJB 5IGDA 2VS1A 2GVAA 5CORA 3ZYYX 2W6QA 5IT9E 4MNOA 3GIIA 1T36A 4TV8F 3QR8A 2YZNA 1B6SA 5FLXc 2W6NA 4ZCKA 3GTMA 2QKIC 3F2CA 4OEMB 1F2ZA 3C46A 1WTQA 2PW5A 1PH6A 1HUNA 4FBUA 4YWKA 2WAQB 5CBAE 2DUDA 3TEHB 2B2UA 1JE4A 1GD7A 4JI3L 5EKLA 3EROA 3E9IA 1EYAA 4DV7L 3GTKH 2CCZA 2HCCA 3J81j 3R23A 1SE4A 2IW3A 1B04A 4DV2H 4DR4H 4JOIA 3M4QA 4HIKA 4GZYC 1NSNS 1Y1WH 2F0QA 5E7NA 5KG6A 4LH6A 4J9RA 3UQ8A 1DV2A 4O3NA 1VQAA 4ECZA 2C2DA 4XDXA 5IT9W 3ETJA 1G6PA 4ME3A 4LF6L 3A74A 2VL6A 4HR7B 4TV9F 5CGKA 5H1SE 1EEID 2E2IB 2KQ3A 1F9SA 2EIFA 3IG0A 1JT8A 2I46A 1I4HA 1TWFA 4WJ4A 3UFXB 1J8IA 1DD2A 5KFCA 4B3TL 3I4MB 4F87A 1V1PB 5IP9G 2R6FA 4J9MA 3W1BA 1HNZH 4PZ8A 3EBEA 3KF8A 3M7NA 3SK5A 3N41B 3J81E 1FJGQ 4G7HC 4LFBL 2R8KA 3WDNA 1CS0A 4YCUA 5IYBG 4PG3A 1PRTF 1S0OA 3GIMA 2R8HA 4G57A 5EPJA 1H9JA 2EVBA 4DV1H 3GO5A 5IE8A 5D8DA 4KHZA 3M9OB 5HGTA 1X3GA 2IHFA 2EJMA 2UUCL 4LFBH 5JEAH 4DUYQ 3KF6A 4BY7G 4DFAA 1BCPC 2NN6I 3PCOB 5IGFA 3HOVH 1R9TB 1PK8A 4JV5Q 4KI0A 3GV3A 1QZHA 4POGA 3GTJA 2K01A 4DV3L 1GUOA 1EQRA 3NK9A 2WAQE 4O3RA 4A3LH 5IGBA 2Q8RE 1E22A 1KDAA 2JK8A 2UXBH 3NSWA 2ZDQA 1ICWA 1WJJA 5D1OB 3QOJA 3RZOH 2UUBL 1NAPA 5IODA 4RUAA 3RV4A 4EQ5A 3PMFA 4LF8H 3MEFA 5EAYA 2WAQA 2KHSA 1Q1EA 2ZXOA 1PXUA 5KFQA 1QOHA 1F2MA 2LSSA 4DR5Q 3SE7A 4DV7H 3BZDB 5LL6X 3EN2A 3DM3A 5C4ZA 2JA9A 4GKKL 1SBBB 1TWGH 2QDBA 2ES2A 4DV2L 3QJYA 2V4RA 4A3DH 1U9RA 2JEJA 4ED2A 4IN3A 5CV9A 4A3MH 3MFGA 3RB4A 4C56C 4ZUIA 4FXGC 1FJGH 5KT3A 1HNXQ 4R8IA 3JRWA 4BBRB 2JA8G 4HSPA 2E75C 5JJIA 4DV3H 2OLSA 4GKKH 3X3NA 1BCPF 4A3EH 1HR0W 1OTCA 4GKKQ 4PZ6A 2BDOA 1MZBA 2EYMA 1JQYD 4AIMA 4OO1H 3SI8A 2H4OA 2D2CC 4BS9A 1BVSA 4LF4Q 4WORA 4JI4Q 1PTOD 3S15H 3H0GA 4ETSA 1TAEA 1VF7A 1YNNC 1CM9A 2QILA 3MC0B 4YR2A 5DLQE 1HUMA 2AQ3B 2Q2TA 3A7AB 2YU9H 1WCMA 4JUZA 2BQRA 4B3TQ 5HY6A 3Q8RB 2PZUA 1E3PA 5KFSA 3I55A 1Q8KA 2FB9A 4DK3C 1GUWA 4HNVA 1DONA 1WCMH 4CDEC 1VQ6A 4DL5A 1VQDA 2W6ZA 4MIUA 5H80A 5EDWA 3WOEA 2RDFA 3N40P 5KFKA 1E4EA 1R9TH 5EWEA 5L9XA 4LUZA 4ECQA 2I8CA 1F9RA 3NE5B 1H9SA 4XQQA 4TRDA 4K5WA 5KIXA 4B3SL 5C5LA 4JI6Q 1WTOA 2K7VA 1H9KA 3CQZH 4L8JA 2YRXA 3OSPA 5EPKA 1GVPA 1PV4A 2BOSA 3V96A 2BE5D 4L5QA 1HQRD 4UHVA 3S2HH 4Q8EA 3T1YH 4FF2A 3GTOH 1JJCB 4TQUS 2W70A 2M9VA 5ELBA 4DV5Q 1PYWD 3TSSA 1XPOA 3J81i 2XNAC 3PW2A 5M3FB 1VQIA 3FMCA 4JI7Q 5ELOA 4JCVE 4CJ1B 4FF3A 2FFKB 4EFBA 1DV1A 4PWQA 1BF4A 2DY7A 5COYA 2JA7A 5C6AA 3G7LA 2FK1A 2KCTA 4RB3C 4JG2A 1I6VC 1XX8A 1W6KA 4Q0FA 1BO0A 3U58A 3ICEA 1PFMA 1WD1A 3SHLA 4R4IA 3GIDA 3GTPA 2PW7A 4OGQC 2E5LH 1EYDA 5CV5A 3JAME 5TSSA 4MHEA 3HOXB 4IFDI 1C9OA 2XGPA 3W5OA 4DV6Q 1CK1A 1HTLD 1TY0A 1JLLB 5GQOA 2VQEQ 1LABA 3A7LA 2R93H 3UE0A 1G8ZD 1HZAA 2TMPA 1A63A 2Z6KA 3CCQA 2AQ4A 1FVIA 1W6JA 3I73A 3GQCA 2BA0A 4IOAA 4YR0A 2NVTH 3MWDA 1PH9A 3R5XA 5KT7A 3TZDA 4X66L 1T9HA 2P5ZX 4RKLA 3HG9A 2ASBA 2DJFC 4KN4C 1KXLA 5CV6A 1VQPA 5DQHA 3J80E 5T14A 4IPGA 4L1KA 4MV6A 4BXXH 2IBKA 4OX9H 3I4LA 4JOIC 3GTLB 2UVVA 5EWFA 4JV0A 2NWGA 5LMNW 2YU9B 3N44B 3HOWB 3ETHA 2V5AA 2A68D 1WI5A 2QF7A 2RCFA 2EPBA 3KLSX 4UPAA 4IZOA 1S03G 2JA5B 1N34H 3K81C 1WCMG 4GKJQ 1EFID 1K83B 1P8LA 3Q8PB 2L0CA 3PO3B 3E9HA 1ET6A 3GTGH 1IZ6A 1VBHA 1CA6A 3C2PA 1A15A 1F2YA 2UU9H 3G71A 3GTKA 1PLFA 1HA5A 2UVWA 4B9XA 1RJTA 1I7LA 1LM0A 4ZHQF 5KFHA 4LFCH 4YJ2F 1RTOA 2JA7B 2F0UA 4RGMA 3G6JB 1DM0B 5C44H 3BAAA 5KFLA 2CW0D 2HDMA 5DAUA 5E3FA 1YITA 5J2TF 4ECYA 3IKJA 1Y14B 3CC4A 4EFEA 1UE6A 1GUNA 1Y8NB 4U7CA 2IWHA 3NQIA 2PPBC 5LL6b 1JWSD 1TWAB 2YTVA 3NTKA 2BDNA 3W2DA 1OWTA 5I9PA 1VQ7A 4J9LA 4UCOA 1CE8A 2ZJPA 2RDIA 1ASZA 5KFMA 2AMCB 4IUNA 2C2EA 1GXDC 1YHAA 4U6PA 4NKLA 1RYRA 2B29A 5KX5F 1TWGB 1E7ZA 1CI3M 3OMCA 1JE5A 2YS7A 4F4YA 2LKVA 1O78A 3I56A 1XNQH 3CP0A 3U9SA 3VMMA 1TWFH 4JBMA 5KNDA 3GQBA 1UUPA 5JEAG 1C0AA 2VR1A 4O2DA 3TN2A 1TWHA 2JE6I 3K5OA 3S14B 1E2ZA 2J4XA 4UCVA 3U9TA 5DGBA 3I72A 4KJNA 4GLXA 1PH8A 1HNZL 4QL5A 4E6IA 3CF5A 2Y0SG 4AYBE 4O3OA 4PMWA 4KHPL 5BPFA 3T5LA 4K0KH 4A3JH 4YY3L 3HOZH 5AJ3L 1M8AA 5IT9c 2NZHA 4OONA 3HOYB 4BBRG 1AFPA 5C5JA 1QG7A 1S72A 1HTPA 2W7OA 2ATWA 2CWAA 3FKIB 1D1IA 5LL6S 3JAMc 2NVXB 5EBCA 3CCEA 1JDBB 5IYBH 3RMHA 1GJXA 2ZM6Q 3JRXA 1SYBA 3JAMi 2B2WC 2B8FA 3S2DB 1Y1VA 1HNZQ 3NWSA 5C3EB 5LMUQ 1BBXC 4DUYL 3F8TA 4KKSA 4IALA 3L7ZC 3KAJA 5LXTF 1EIYB 3P20A 4XXEA 5IIFA 4Y7NB 4GOPB 3PZPA 2PYKA 4MTNA 1STBA 5KFJA 2F4VQ 3EPGA 3PIO3 1WR2A 3CCLA 2R92A 4JYAH 1JR0D 3CRLC 4EGQA 4GLVB 3URYA 3RN2A 3K6OA 4K2LA 4XT3B 1B8AA 4C3JB 1FJGL 1FNWA 2K52A 4Z9CB 3RV3A 1DOLA 5HGQA 3O13A 1XYIA 2B63G 4C3HB 1PTOF 3OHAA 2KCCA 1S5ED 1Q46A 4XQJA 3ERQA 1G291 2R85A 1EY4A 5M3FH 3L0OA 4KMUC 3D8GA 2R7DA 2NVYB 2W8LA 1W2BA 1UE7A 2K5QA 1JKJB 5EBDA 3A5UA 4DXFA 1ULZA 4LFAL 2PQEA 5FLXW 3CW2C 5DG8A 1EWCA 2R82A 1ENAA 2F03A 3MWEA 1NCVA 3RN5A 4J0MA 2KENA 5DEHA 2LY7A 1AEXA 4NXMQ 4X3TA 1GUGA 3SR1A 2R7ZA 3T13A 1TWGA 1MKHA 4IWXA 1A0IA 2B2VC 4LF9Q 3L9AX 1E1OA 2UUBQ 1RKNA 3I4NB 4MAMA 2F0DA 1SJED 2LS01 4QUCA 2A5HA 3TDQA 3V6JA 4E4TA 3OTOH 2NVTB 2MFIA 5E4WC 5IYDG 1NJIC 1HNXH 1AZPA 5KT5A 2R93B 3DLLA 4EG0A 4KKTA 1SAPA 1BR9A 2D0OA 3BQ0A 3T1HH 3CXCA 4GN5A 3S2HB 2QCPX 4DR6H 5JVLA 3P1HA 4PMBA 2EYJA 4NMZA 2JXMB 3MTSA 3SVMA 3BU2A 1EYCA 2E76C 1SYDA 3R8BA 5CA0F 3FKIA 1HNXL 4DR5H 2ICEC 4JK1C 3NGDA 5L1JA 1K9MC 1LTLA 2VQFH 2NU9B 2YU9A 4DV0H 1AZQA 4DR7Q 2X69A 5KFNA 5KFBA 4FP5D 5KFAA 1ILQA 2RHQB 2WIIB 2B2YC 3FKIH 3M4PA 4IR1A 3T56B 5D3IB 4AQYQ 2KCNA 1QE6A 2Y0SA 3G6YA 3RZDH 1EZ8A 4HCSA 4JVZA 5M5XB 1N56A 1ENFA 1RHPA 4QIWE 1KNEA 1STNA 2EYOA 3G6VA 4DA2A 3IL8A 1IBLL 4FS1A 1BOSA 2MGSA 4EBCA 1MSHA 4RB1A 2R92B 2VB3X 1B2TA 2E2HH 4YWLA 1DXMA 3FPUB 5BR8Q 1Q86C 4F4WA 1BQQT 2G9DA 1HHVA 3K3VA 3I12A 4APMA 1LACA 1JOKA 1W3SA 2NZ1D 4KTAA 1EOVA 1Y1VG 1R4PB 5ELDA 4BBSG 2JP1A 3S15B 5EJWA 2JEBI 2BH2A 5IP7H 4PZ7A 4IJHA 1I4QA 1PH5A 3CHBD 3BYTB 2J6TA 3RGZA 4ED7A 1OXSC 1I3QH 2R92G 1CQIB 2VQFQ 3DF7A 5GONF 3PUYA 2FP4B 4LFAQ 2RGVA 3RB0A 3J81c 1KJ8A 2XWJB 2IMWP 2PNRC 1SJHD 1H95A 4B3RQ 1V1OA 3QG1A 2B63A 1TY2A 1SYXB 1VQCA 1PFNA 3NHHA 5LMNL 3J81W 2JEAI 5KEEA 1C7YA 1J6QA 4WRDA 3M4OH 1HXYD 1EY6A 2PQAA 4TQRA 4C3IH 1X9NA 1X3EA 3GV6A 1VQNA 3AEVA 1PH3A 2CQYA 2YZMA 1L2ZA 1JWMD 5LMNQ 3VYUA 3OW2A 1TWAH 2R7ZG 2PCFB 2V9WA 5KKNB 2D9UA 3E6ZX 4TVAB 3GTPH 5IP7G 1ESRA 2WV6D 2JYOA 3HOVG 2IJ0A 4YY3H 5FLXE 4BY7H 4G3IA 1C8CA 5BMVF 3V6HA 3EPIA 5KT2A 4RZRA 3N43B 5LHY1 3J7AF 4F50A 2V58A 4H0LC 3NENA 2QA4A 4R8UB 4PNYA 4A3BB 3OIPA 1TWFB 1CSQA 3K5IA 2F0LA 4DR1Q 4DR3L 1DGSA 3NUCA 4CJ2C 2L4NA 5GAHC 1N36H 1EWIA 2K04A 4LUVA 2WB1G 5KFFA 3U4ZA 3FKIG 5CB4F 4OXPA 3CRKC 3MWYW 2YS6A 5D1OA 2VQDA 3K5HA 3STBC 5C44G 4MV8A 5KG7A 3ULJA 2K5DA 1PZID 1NR4A 4DK0A 1KDCA 1WTVA 5IYCG 3M9MB 3MR2A 4YCWA 1EYGA 1A6XA 3NTIA 4O2AF 1Q12A 4RHSA 1EUJA 3UDFA 1LTBD 1EIGA 4QUFA 4NXNL 4LF8L 3ORRA 3K7UC 3KF6B 4RAZA 5L1KA 4N9PA 3SK4A 4RKBA 5C4JB 2OTLA 2FJ2A 4JI8Q 1HFNA 2R8IA 4YBZB 3HOXH 4JI3Q 1D7QA 1EFWA 3FDSA 3V05A 3GIJA 2LFNA 1SNOA 4HEDA 5C3WA 3BZCA 1K0SA 1HA6A 1ZQ7A 5KG4A 5DLFA 1CTMA 2TSSA 4P72A 5IY0A 1VBGA 3GV7B 1S4ZA 2PO4A 3LGJA 1Q3LA 3TP6A 1CSPA 2A69D 3T1YQ 1VQHA 4RB0A 5BR8H 1YEZA 1SNCA 3NXWA 1D2BA 2KSWA 2XD4A 3S1QB 3PW4A 2VUMA 1LTAD 1Q7YC 3CCRA 4DNRB 4DXGA 1TS2A 4JW0A 5I9OA 1PTOH 4IR9A 5D14A 1RK5A 4O2BF 3LX0A 1YJWA 2JA6G 1K8MA 3AB9A 3KDFA 2YL2A 1O7YA 2XRSD 4BWSC 3S24A 2O2LD 1ZXTA 3IAYA 4IUVA 2X0SA 1Z7TA 2E2HB 2ZXRA 3HKZG 3I4NG 4O0AA 1VMPA 5C4JH 5KG3A 3QB3A 4OO1I 4B3TH 1HRJA 3RLNA 1H9SB 5M3MG 4LWCA 1HZ9A 5FPRA 2HUGA 2V4DA 4LFBQ 1B44D 2R84A 2O4XA 4C5CA
chains in the Genus database with same CATH topology
1U5KA 4B3SQ 2WFWA 1VQFA 1WCMH 3FHWA 1VQ6A 1VQDA 2A1AA 1SRUA 3UDIA 1KIXA 1GM5A 4C3JH 4DR1L 4DR3Q 4A3EG 4DAYB 1R9TH 4UP8A 4LUZA 1N34L 4JI1Q 3CMAA 2IX1A 2UUCQ 4DV0L 1UE1A 4DV1L 1CUKA 4GNXB 4A3KH 2F4VL 3SGIA 4B3SL 3CCUA 4A3DG 1L2FA 1MJCA 1Z9FA 2I5MX 3ULPA 4JI6Q 4UY8C 2JA7G 3TRZA 3CQZH 2N78A 2UU9Q 5JJKA 1GVPA 4DV4L 1K73C 1PV4A 3KLWA 4A3KG 4DUZL 3CCMA 1VQOA 4L5QA 3S2HH 2MQHA 5JEAJ 4LF7Q 2R7ZH 4GNXC 2H5XA 3I7FA 1JJCB 4TQUS 1N34Q 3RR5A 2OWOA 4R4OA 3GTOH 5IWAQ 1YJ9A 4A3CG 4DV5Q 3IRBA 1PH2A 2UXBL 3KOJA 1XPOA 4YHHL 3J81i 3KJOA 4DR6L 2YTXA 1VQIA 4DR2L 3J80c 2UU9L 4JI7Q 4DV4Q 5C4XG 5ELOA 4JCVE 2WB1E 4JI6L 4LF8Q 2UUAL 1MJEA 5GROA 4JI8L 1KRSA 4NB3A 1NBWA 4QJFA 1VQLA 3D0FA 3NBHB 1K3RA 2KCTA 4A3FH 4JG2A 4JI7L 3ICEA 4DV2Q 3VDYA 2BH8A 4GN4B 3U58A 1ASYA 4A93G 4DV5L 1I5FA 4R4IA 1D8LA 3CAMA 1GO3E 1BKBA 1HZBA 2L15A 2AHOB 1AE2A 4BXXG 4A93H 4IFDI 3U50C 1C9OA 3W5OA 4DV6Q 4GN3B 1Y1WG 2R92H 2JA7H 3H3VI 1I94L 2VY3A 4C3HH 5C4XH 2K75A 4DK6C 5GQOA 3MXNB 4JI5L 3RLFA 2VQEQ 4JYAQ 4IPHA 1KQSA 2R93H 3UE0A 3S2DH 1WFQA 1AH9A 1HZAA 2I5LX 4JI4L 2Z6KA 3CCQA 1A63A 4OX9L 1FVIA 1QUQA 2BA0A 2Z0SA 4IOAA 2NVTH 1PVOA 1BBWA 1PH9A 2MNAA 4X66L 1NMFA 1T9HA 2N8NA 4B3MQ 3CMEA 1YJNA 2ASBA 1KXLA 1VQPA 3AFQA 1WOCA 2D62A 5GADC 3K80C 4IPGA 1JB7A 4BXXH 1VQMA 5FJ8H 2K5NA 4JOIC 5IP9H 5LMNW 4KHPQ 1B70B 1LUZA 2ZJRA 1VQKA 3H3VH 1QZGA 4DR4L 4JV5L 2WAQG 3I4OA 1WI5A 2GVBA 5JJLA 2KHJA 4UPAA 3ZJYC 1HJPA 3HFZB 4HJ8A 3PF5A 2ZM6L 4L5SA 2AWOA 2E5LL 1Q81C 3H15A 3HOWH 3K81C 1WCMG 3HOYH 4GKJQ 2XTIA 1OXUA 4LUOA 2HQLA 1P8LA 1FL0A 2PNHA 4R4CA 1CKNB 3OYYA 3B6YA 4C2MH 3CD6A 4OO1G 3E9HA 3ERSX 3PUWA 4HJAA 1HH2P 2I0QA 4GOPA 2R93G 3GTGH 1IZ6A 2E2IH 1KHIA 3G48A 3GTJH 2OTJA 4Y52H 4RG1A 3G71A 4A3LG 1K8GA 2NN6G 3H0GG 4EX5A 1WYDA 4H02A 2MO0A 1LM0A 4KLKA 1KD1C 3HOUH 3PV0A 1NE3A 4HIOA 1B7YB 2VNUD 1Q82C 2K5HA 4LW1A 3PUVA 5C44H 3GTLH 5C3EH 3PO2H 3FP9A 3T1HL 1VQ8A 1NTGA 3NEMA 1YITA 1SN8A 1S40A 2FXQA 1NMGA 1Y14B 5M5XH 3CC4A 1GKHA 1UE6A 1XTDA 3TQYA 2ID0A 1TXYA 1X54A 3F2DA 2YTVA 3F2BA 4A3BG 1VQ7A 4YCVA 1XNRL 3I4MH 2E8GA 2CFMA 4IPCA 3I4MG 1PYBA 1Z47A 1OXTA 2ZJPA 1PH1A 1ASZA 3S1QH 4A3GG 1HNWL 2AMCB 5K36G 3CPFA 1YHAA 2Z6KC 2VQEL 4JYAL 3U4VA 2OCEA 1SR3A 5IYCH 3RNUA 2B29A 4GLAC 1E7ZA 1P16A 1QUQB 1JE5A 4DPGA 4MZ9A 3S14H 3I56A 3CP0A 4R1JA 1TWFH 4JBMA 3PO2G 4YWMA 1HNWQ 1A62A 1QVCA 4X66Q 1L1OA 3T1YL 2KBNA 5JEAG 1C0AA 2KHIA 4QY7A 4O2DA 3A5ZB 4X65L 2JE6I 1HR0Q 2NVXH 3M85A 3PF4A 2Q2IA 4QGUA 3Q8DA 1PFSA 4DAMA 4GLXA 4QL5A 3CF5A 1PH8A 1AE3A 2Y0SG 2VZAA 4PMWA 4AYBE 1HNZL 3I4NH 2CQOA 4KHPL 2N3SA 4L5TA 4A3JH 4YY3L 1N36Q 5AJ3L 3KJPA 3HOZH 5IT9c 2NZHA 5LMUL 4OONA 2ZTCA 3D31A 4BBRG 1IXRA 1HR0L 1S72A 2IY5B 2ATWA 2CWAA 2Q2HA 2R7FA 3J80i 3JAMc 3M3YH 3CCEA 5IYBH 2EQSA 2ZM6Q 1N33L 2ZTDA 3BJUA 4OWWB 1FGUA 2CKZB 4P75A 3JAMi 2ZTEA 4L5RC 4X62L 2OQ0A 5AJ3Q 1HNZQ 2HT1A 2NVYH 4DR7L 5LMUQ 4Y7NH 1N32L 1CKNA 4DUYL 1SMXA 3F8TA 4UP7A 5M5YH 1VQBA 5M3MH 2E2JH 3L7ZC 4A3IH 3S1MH 3PSIA 1JJGA 2K5VA 1EQQA 1EIYB 4GOPB 1J5EL 3J7A5 4MTNA 2VUMG 1UWVA 1V43A 2BA1A 4X64Q 4A76A 2F4VQ 4UP9A 3E0EA 2Q2UA 3CCLA 3OTOL 4AH6A 4DV0Q 3G6EA 2PI2A 4GOPC 4A4IA 4GLVB 1PHJA 3RN2A 1B8AA 2YV5A 3PGZA 1FJGL 5J3BA 2K52A 5HGQA 5M5WH 4K0KL 2F3IA 3PO3H 1UE5A 4DUZQ 4X64L 1KC8C 1YHBA 2AKWB 3T1HQ 3NELA 1G51A 2B63G 1K8AC 3TS2A 2RF4A 1Q46A 4A3MG 1K83H 1G291 5M3FH 1OXXK 3L0OA 3UDXA 4A3JG 2XGTA 2AWNA 5GAGC 4BY1H 3HOZG 2R7DA 2LXKA 1W2BA 1UE7A 1VCIA 3A5UA 1M1KC 1PA6A 3M9BA 4A3FG 1K0RA 1VQJA 4LFAL 1RIPA 1KRTA 2VUMH 3CW2C 2A19A 3K7AH 3ER0A 4HJ7A 3RN5A 3W1GA 2KENA 1CKOA 4NXMQ 1V1QA 1S3OA 1X6OA 1IBKQ 1N9WA 1M90C 1XPUA 1MKHA 2PMZE 4DV7Q 1JJ2A 1A0IA 3G4SA 1N8RC 2UUBQ 1E1OA 1VQ9A 3CC2A 4LF9Q 5M3FG 4A3GH 4LF4L 4DV6L 1L1OB 1YIJA 2R6GA 1Q1BA 2UXDQ 3HOUG 2JQOA 1YBYA 1I50H 2MFIA 1Y1VH 4BBSH 1A8VA 1L1OC 5IYDG 1YI2A 4LF6Q 1NJIC 1XMOQ 4JBJA 4LF5L 3DLLA 1L0WA 3CCSA 1VS0A 4JI5Q 2D0OA 4LNQA 3AFPA 3CXCA 4GN5A 2PI2E 2MO1A 4J15A 1SFOH 4XTCS 5C0XJ 4R4TA 1IL2A 1PYSB 2UXCL 3J7ZC 3BU2A 1XMQL 1YVCA 4B3ML 3STBD 1HNXL 1N33Q 1KAWA 2YTYA 3UE1A 1O7IA 3K8AA 4DNIA 1K9MC 1LTLA 5FLMH 4OWTB 2ZJQA 2N49A 1XMOL 2LXJA 4DR7Q 5IYDH 1VQGA 2IT1A 1CKMA 1X55A 2RHQB 3M4PA 3FKIH 3HOXG 4IPDA 2K4KA 1PH4A 3I2ZA 4RMFA 2JJQA 4JC0A 5BR8L 4AQYQ 4HIDA 1QVGA 4LF7L 1J5EQ 2QGQA 3RZDH 4IOCA 1XMQQ 4QIWE 1IBLL 2IX0A 4GKJL 2HHHQ 4DR6Q 5GAEC 2E2HH 2C35B 5IWAL 4JI0L 3EIVA 2RHSB 4P71A 4YWLA 2B3GA 3TREA 4YHHQ 5BR8Q 4HIMA 4AQYL 1Q86C 3S16H 4DR2Q 1X65A 1RL2A 1XNQL 1VQEA 2F52A 2I5HA 2NZOA 3CCJA 1W3SA 4DV3Q 1EOVA 1Y1VG 4BBSG 3RLOA 4JI2L 1IYJB 1IBLQ 4BY1G 2JEBI 2VS1A 3PUZA 2GVAA 4PZ7A 5IP7H 1SROA 3CCVA 2BH2A 4IJHA 4BBRH 4QQBX 2Y0SE 4MNOA 4NPSA 4AYBG 1PH5A 2K50A 5FLXc 4NXNQ 4XIGS 1OXSC 1I3QH 3F2CA 3PO3G 2R92G 2VQFQ 2DGYA 3HKSA 1PH6A 3PUYA 4LFAQ 2YYZA 4YWKA 3J81c 2DUDA 1KL9A 3TEHB 1GD7A 4JI3L 2PQAB 3BZKA 1H95A 4DR5L 2UXBQ 3E9IA 4B3RQ 4DV7L 4HJ5A 3GTKH 3F1ZA 2CCZA 2VQFL 3J81j 4JOIA 3M4QA 4HIKA 4P74A 1Y1WH 2EXDA 1VQCA 5E7NA 5LMNL 3HOWG 2JEAI 1C7YA 3KYHC 1J6QA 3M4OH 1X56A 1VQAA 1XNRQ 4B3RL 2PQAA 4LF5Q 1G6PA 4ME3A 3AQQA 2NVQH 4LF6L 3A74A 2VL6A 1X3EA 4IJLA 4C3IH 1X9NA 4HJ9A 1PH3A 1VQNA 4A3IG 3AEVA 3S1NH 5H1SE 3KDFB 5LMNQ 2EIFA 3OW2A 1TWAH 2R7ZG 1JT8A 1JMCA 5FLMG 4TVAB 3GTPH 5IP7G 4WJ4A 4LFCQ 3ULLA 3S17H 2HIXA 1E24A 3HOVG 4A75A 1YHQA 1PH7A 4B3TL 4BY7H 2GN5A 4JBWA 4R4QA 5IP9G 2VW9A 4X65Q 3W1BA 3GD7A 4PZ8A 3EBEA 2E5LQ 3M7NA 4IFDG 2JA5H 3AYHB 1NY4A 3NENA 2QA4A 1VQ4A 4APVA 3PIPA 2D0PA 1FJGQ 4LFBL 4X6AH 4YCUA 5IYBG 1CSQA 4PG3A 1VQ5A 4DR1Q 4YY3Q 4DR3L 1N36L 2A8VA 1DGSA 3S1RH 1YNXA 5GAHC 3GO5A 3HOYG 4JI0Q 1HZCA 1EWIA 4LUVA 5IE8A 2WB1G 4KHZA 1SE8A 3FKIG 2V1CC 3U4ZA 3GDEA 4OXPA 1IBML 1X3GA 2IHFA 2HHHL 2UUCL 3STBC 5C44G 4DUYQ 3KF6A 4BY7G 4FDBA 3ULJA 3A0JA 2NN6I 3PCOB 1XNQQ 4X62Q 3HOVH 1E1TA 1TWHH 4KI0A 5IYCG 4JI2Q 3CPWA 2WP8J 1QZHA 4POGA 4DV3L 1I6HH 4IFDJ 1EQRA 2WAQE 4YCWA 1EYGA 4JV5Q 4A3LH 3OTOQ 1UEBA 4OWXB 1E22A 1XPRA 1Q12A 2JK8A 1EUJA 3UDFA 1IBMQ 1WJJA 4NXNL 5C3EG 3RZOH 4LF8L 2JA8H 3K7UC 3KF6B 2UUBL 2CWPA 3UDGA 4GS3A 4P73A 2OTLA 4JI8Q 5ELNA 4EQ5A 3GTMH 3PIOA 4A3CH 4K0KQ 3MEFA 5EAYA 2UUAQ 3HOXH 2JA5G 4JI3Q 1D7QA 1BBUA 2ALYB 1EFWA 1Q1EA 4DR5Q 2LSSA 4A3BH 3BZCA 4POFA 2K14A 1QVFA 3EN2A 3DM3A 4P72A 1EIFA 2JA9A 1TWGH 5IY0A 4GKKL 1XJVA 4DV2L 2ES2A 3PUXA 1U0LA 3LGJA 5C0XI 2QEXA 4A3DH 3CC7A 1CSPA 3T1YQ 4DR4Q 1VQHA 4A3MH 2UXCQ 1YEZA 2JA6H 4WJ3M 1X3FA 2RCNA 3HKZE 2B63H 4IO9A 1Q7YC 3H0GH 3CCRA 1HNXQ 4DKAC 2JA8G 3KFUA 5JJIA 2HIVA 4JBKA 4A3EH 1HR0W 1OTCA 1IBKL 4GKKQ 1I94Q 4PZ6A 3WWVA 1SLJA 2OQKA 3K0XA 5C0XG 4AIMA 1YJWA 4NXML 2JA6G 3KDFA 4ALPA 3TS0A 1OXVA 4OX9Q 1BVSA 5FJ8G 4LF4Q 4JI4Q 1LYLA 3S24A 3S15H 4LF9L 4BA2I 5DLQE 3HKZG 3I4NG 4O0AA 4LFCL 5C4JH 1MIUA 1V9PA 2Q2TA 2YU9H 3L2PA 2UXDL 4DV1Q 4B3TQ 4OO1I 2IHEA 1YZ6A 3JC66 5HY6A 3KF8B 4LWCA 1HZ9A 4JI1L 3RLNA 4BA1I 5M3MG 4GNXA 2KCMA 4LFBQ 1E3PA 1TWCH 3GTQH 3I55A 1N32Q 1Q8KA 4DK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5K A;  4B3S Q;  2WFW A;  1VQF A;  1WCM H;  3FHW A;  1VQ6 A;  1VQD A;  2A1A A;  1SRU A;  3UDI A;  1KIX A;  1GM5 A;  4C3J H;  4DR1 L;  4DR3 Q;  4A3E G;  4DAY B;  1R9T H;  4UP8 A;  4LUZ A;  1N34 L;  4JI1 Q;  3CMA A;  2IX1 A;  2UUC Q;  4DV0 L;  1UE1 A;  4DV1 L;  1CUK A;  4GNX B;  4A3K H;  2F4V L;  3SGI A;  4B3S L;  3CCU A;  4A3D G;  1L2F A;  1MJC A;  1Z9F A;  2I5M X;  3ULP A;  4JI6 Q;  4UY8 C;  2JA7 G;  3TRZ A;  3CQZ H;  2N78 A;  2UU9 Q;  5JJK A;  1GVP A;  4DV4 L;  1K73 C;  1PV4 A;  3KLW A;  4A3K G;  4DUZ L;  3CCM A;  1VQO A;  4L5Q A;  3S2H H;  2MQH A;  5JEA J;  4LF7 Q;  2R7Z H;  4GNX C;  2H5X A;  3I7F A;  1JJC B;  4TQU S;  1N34 Q;  3RR5 A;  2OWO A;  4R4O A;  3GTO H;  5IWA Q;  1YJ9 A;  4A3C G;  4DV5 Q;  3IRB A;  1PH2 A;  2UXB L;  3KOJ A;  1XPO A;  4YHH L;  3J81 i;  3KJO A;  4DR6 L;  2YTX A;  1VQI A;  4DR2 L;  3J80 c;  2UU9 L;  4JI7 Q;  4DV4 Q;  5C4X G;  5ELO A;  4JCV E;  2WB1 E;  4JI6 L;  4LF8 Q;  2UUA L;  1MJE A;  5GRO A;  4JI8 L;  1KRS A;  4NB3 A;  1NBW A;  4QJF A;  1VQL A;  3D0F A;  3NBH B;  1K3R A;  2KCT A;  4A3F H;  4JG2 A;  4JI7 L;  3ICE A;  4DV2 Q;  3VDY A;  2BH8 A;  4GN4 B;  3U58 A;  1ASY A;  4A93 G;  4DV5 L;  1I5F A;  4R4I A;  1D8L A;  3CAM A;  1GO3 E;  1BKB A;  1HZB A;  2L15 A;  2AHO B;  1AE2 A;  4BXX G;  4A93 H;  4IFD I;  3U50 C;  1C9O A;  3W5O A;  4DV6 Q;  4GN3 B;  1Y1W G;  2R92 H;  2JA7 H;  3H3V I;  1I94 L;  2VY3 A;  4C3H H;  5C4X H;  2K75 A;  4DK6 C;  5GQO A;  3MXN B;  4JI5 L;  3RLF A;  2VQE Q;  4JYA Q;  4IPH A;  1KQS A;  2R93 H;  3UE0 A;  3S2D H;  1WFQ A;  1AH9 A;  1HZA A;  2I5L X;  4JI4 L;  2Z6K A;  3CCQ A;  1A63 A;  4OX9 L;  1FVI A;  1QUQ A;  2BA0 A;  2Z0S A;  4IOA A;  2NVT H;  1PVO A;  1BBW A;  1PH9 A;  2MNA A;  4X66 L;  1NMF A;  1T9H A;  2N8N A;  4B3M Q;  3CME A;  1YJN A;  2ASB A;  1KXL A;  1VQP A;  3AFQ A;  1WOC A;  2D62 A;  5GAD C;  3K80 C;  4IPG A;  1JB7 A;  4BXX H;  1VQM A;  5FJ8 H;  2K5N A;  4JOI C;  5IP9 H;  5LMN W;  4KHP Q;  1B70 B;  1LUZ A;  2ZJR A;  1VQK A;  3H3V H;  1QZG A;  4DR4 L;  4JV5 L;  2WAQ G;  3I4O A;  1WI5 A;  2GVB A;  5JJL A;  2KHJ A;  4UPA A;  3ZJY C;  1HJP A;  3HFZ B;  4HJ8 A;  3PF5 A;  2ZM6 L;  4L5S A;  2AWO A;  2E5L L;  1Q81 C;  3H15 A;  3HOW H;  3K81 C;  1WCM G;  3HOY H;  4GKJ Q;  2XTI A;  1OXU A;  4LUO A;  2HQL A;  1P8L A;  1FL0 A;  2PNH A;  4R4C A;  1CKN B;  3OYY A;  3B6Y A;  4C2M H;  3CD6 A;  4OO1 G;  3E9H A;  3ERS X;  3PUW A;  4HJA A;  1HH2 P;  2I0Q A;  4GOP A;  2R93 G;  3GTG H;  1IZ6 A;  2E2I H;  1KHI A;  3G48 A;  3GTJ H;  2OTJ A;  4Y52 H;  4RG1 A;  3G71 A;  4A3L G;  1K8G A;  2NN6 G;  3H0G G;  4EX5 A;  1WYD A;  4H02 A;  2MO0 A;  1LM0 A;  4KLK A;  1KD1 C;  3HOU H;  3PV0 A;  1NE3 A;  4HIO A;  1B7Y B;  2VNU D;  1Q82 C;  2K5H A;  4LW1 A;  3PUV A;  5C44 H;  3GTL H;  5C3E H;  3PO2 H;  3FP9 A;  3T1H L;  1VQ8 A;  1NTG A;  3NEM A;  1YIT A;  1SN8 A;  1S40 A;  2FXQ A;  1NMG A;  1Y14 B;  5M5X H;  3CC4 A;  1GKH A;  1UE6 A;  1XTD A;  3TQY A;  2ID0 A;  1TXY A;  1X54 A;  3F2D A;  2YTV A;  3F2B A;  4A3B G;  1VQ7 A;  4YCV A;  1XNR L;  3I4M H;  2E8G A;  2CFM A;  4IPC A;  3I4M G;  1PYB A;  1Z47 A;  1OXT A;  2ZJP A;  1PH1 A;  1ASZ A;  3S1Q H;  4A3G G;  1HNW L;  2AMC B;  5K36 G;  3CPF A;  1YHA A;  2Z6K C;  2VQE L;  4JYA L;  3U4V A;  2OCE A;  1SR3 A;  5IYC H;  3RNU A;  2B29 A;  4GLA C;  1E7Z A;  1P16 A;  1QUQ B;  1JE5 A;  4DPG A;  4MZ9 A;  3S14 H;  3I56 A;  3CP0 A;  4R1J A;  1TWF H;  4JBM A;  3PO2 G;  4YWM A;  1HNW Q;  1A62 A;  1QVC A;  4X66 Q;  1L1O A;  3T1Y L;  2KBN A;  5JEA G;  1C0A A;  2KHI A;  4QY7 A;  4O2D A;  3A5Z B;  4X65 L;  2JE6 I;  1HR0 Q;  2NVX H;  3M85 A;  3PF4 A;  2Q2I A;  4QGU A;  3Q8D A;  1PFS A;  4DAM A;  4GLX A;  4QL5 A;  3CF5 A;  1PH8 A;  1AE3 A;  2Y0S G;  2VZA A;  4PMW A;  4AYB E;  1HNZ L;  3I4N H;  2CQO A;  4KHP L;  2N3S A;  4L5T A;  4A3J H;  4YY3 L;  1N36 Q;  5AJ3 L;  3KJP A;  3HOZ H;  5IT9 c;  2NZH A;  5LMU L;  4OON A;  2ZTC A;  3D31 A;  4BBR G;  1IXR A;  1HR0 L;  1S72 A;  2IY5 B;  2ATW A;  2CWA A;  2Q2H A;  2R7F A;  3J80 i;  3JAM c;  3M3Y H;  3CCE A;  5IYB H;  2EQS A;  2ZM6 Q;  1N33 L;  2ZTD A;  3BJU A;  4OWW B;  1FGU A;  2CKZ B;  4P75 A;  3JAM i;  2ZTE A;  4L5R C;  4X62 L;  2OQ0 A;  5AJ3 Q;  1HNZ Q;  2HT1 A;  2NVY H;  4DR7 L;  5LMU Q;  4Y7N H;  1N32 L;  1CKN A;  4DUY L;  1SMX A;  3F8T A;  4UP7 A;  5M5Y H;  1VQB A;  5M3M H;  2E2J H;  3L7Z C;  4A3I H;  3S1M H;  3PSI A;  1JJG A;  2K5V A;  1EQQ A;  1EIY B;  4GOP B;  1J5E L;  3J7A 5;  4MTN A;  2VUM G;  1UWV A;  1V43 A;  2BA1 A;  4X64 Q;  4A76 A;  2F4V Q;  4UP9 A;  3E0E A;  2Q2U A;  3CCL A;  3OTO L;  4AH6 A;  4DV0 Q;  3G6E A;  2PI2 A;  4GOP C;  4A4I A;  4GLV B;  1PHJ A;  3RN2 A;  1B8A A;  2YV5 A;  3PGZ A;  1FJG L;  5J3B A;  2K52 A;  5HGQ A;  5M5W H;  4K0K L;  2F3I A;  3PO3 H;  1UE5 A;  4DUZ Q;  4X64 L;  1KC8 C;  1YHB A;  2AKW B;  3T1H Q;  3NEL A;  1G51 A;  2B63 G;  1K8A C;  3TS2 A;  2RF4 A;  1Q46 A;  4A3M G;  1K83 H;  1G29 1;  5M3F H;  1OXX K;  3L0O A;  3UDX A;  4A3J G;  2XGT A;  2AWN A;  5GAG C;  4BY1 H;  3HOZ G;  2R7D A;  2LXK A;  1W2B A;  1UE7 A;  1VCI A;  3A5U A;  1M1K C;  1PA6 A;  3M9B A;  4A3F G;  1K0R A;  1VQJ A;  4LFA L;  1RIP A;  1KRT A;  2VUM H;  3CW2 C;  2A19 A;  3K7A H;  3ER0 A;  4HJ7 A;  3RN5 A;  3W1G A;  2KEN A;  1CKO A;  4NXM Q;  1V1Q A;  1S3O A;  1X6O A;  1IBK Q;  1N9W A;  1M90 C;  1XPU A;  1MKH A;  2PMZ E;  4DV7 Q;  1JJ2 A;  1A0I A;  3G4S A;  1N8R C;  2UUB Q;  1E1O A;  1VQ9 A;  3CC2 A;  4LF9 Q;  5M3F G;  4A3G H;  4LF4 L;  4DV6 L;  1L1O B;  1YIJ A;  2R6G A;  1Q1B A;  2UXD Q;  3HOU G;  2JQO A;  1YBY A;  1I50 H;  2MFI A;  1Y1V H;  4BBS H;  1A8V A;  1L1O C;  5IYD G;  1YI2 A;  4LF6 Q;  1NJI C;  1XMO Q;  4JBJ A;  4LF5 L;  3DLL A;  1L0W A;  3CCS A;  1VS0 A;  4JI5 Q;  2D0O A;  4LNQ A;  3AFP A;  3CXC A;  4GN5 A;  2PI2 E;  2MO1 A;  4J15 A;  1SFO H;  4XTC S;  5C0X J;  4R4T A;  1IL2 A;  1PYS B;  2UXC L;  3J7Z C;  3BU2 A;  1XMQ L;  1YVC A;  4B3M L;  3STB D;  1HNX L;  1N33 Q;  1KAW A;  2YTY A;  3UE1 A;  1O7I A;  3K8A A;  4DNI A;  1K9M C;  1LTL A;  5FLM H;  4OWT B;  2ZJQ A;  2N49 A;  1XMO L;  2LXJ A;  4DR7 Q;  5IYD H;  1VQG A;  2IT1 A;  1CKM A;  1X55 A;  2RHQ B;  3M4P A;  3FKI H;  3HOX G;  4IPD A;  2K4K A;  1PH4 A;  3I2Z A;  4RMF A;  2JJQ A;  4JC0 A;  5BR8 L;  4AQY Q;  4HID A;  1QVG A;  4LF7 L;  1J5E Q;  2QGQ A;  3RZD H;  4IOC A;  1XMQ Q;  4QIW E;  1IBL L;  2IX0 A;  4GKJ L;  2HHH Q;  4DR6 Q;  5GAE C;  2E2H H;  2C35 B;  5IWA L;  4JI0 L;  3EIV A;  2RHS B;  4P71 A;  4YWL A;  2B3G A;  3TRE A;  4YHH Q;  5BR8 Q;  4HIM A;  4AQY L;  1Q86 C;  3S16 H;  4DR2 Q;  1X65 A;  1RL2 A;  1XNQ L;  1VQE A;  2F52 A;  2I5H A;  2NZO A;  3CCJ A;  1W3S A;  4DV3 Q;  1EOV A;  1Y1V G;  4BBS G;  3RLO A;  4JI2 L;  1IYJ B;  1IBL Q;  4BY1 G;  2JEB I;  2VS1 A;  3PUZ A;  2GVA A;  4PZ7 A;  5IP7 H;  1SRO A;  3CCV A;  2BH2 A;  4IJH A;  4BBR H;  4QQB X;  2Y0S E;  4MNO A;  4NPS A;  4AYB G;  1PH5 A;  2K50 A;  5FLX c;  4NXN Q;  4XIG S;  1OXS C;  1I3Q H;  3F2C A;  3PO3 G;  2R92 G;  2VQF Q;  2DGY A;  3HKS A;  1PH6 A;  3PUY A;  4LFA Q;  2YYZ A;  4YWK A;  3J81 c;  2DUD A;  1KL9 A;  3TEH B;  1GD7 A;  4JI3 L;  2PQA B;  3BZK A;  1H95 A;  4DR5 L;  2UXB Q;  3E9I A;  4B3R Q;  4DV7 L;  4HJ5 A;  3GTK H;  3F1Z A;  2CCZ A;  2VQF L;  3J81 j;  4JOI A;  3M4Q A;  4HIK A;  4P74 A;  1Y1W H;  2EXD A;  1VQC A;  5E7N A;  5LMN L;  3HOW G;  2JEA I;  1C7Y A;  3KYH C;  1J6Q A;  3M4O H;  1X56 A;  1VQA A;  1XNR Q;  4B3R L;  2PQA A;  4LF5 Q;  1G6P A;  4ME3 A;  3AQQ A;  2NVQ H;  4LF6 L;  3A74 A;  2VL6 A;  1X3E A;  4IJL A;  4C3I H;  1X9N A;  4HJ9 A;  1PH3 A;  1VQN A;  4A3I G;  3AEV A;  3S1N H;  5H1S E;  3KDF B;  5LMN Q;  2EIF A;  3OW2 A;  1TWA H;  2R7Z G;  1JT8 A;  1JMC A;  5FLM G;  4TVA B;  3GTP H;  5IP7 G;  4WJ4 A;  4LFC Q;  3ULL A;  3S17 H;  2HIX A;  1E24 A;  3HOV G;  4A75 A;  1YHQ A;  1PH7 A;  4B3T L;  4BY7 H;  2GN5 A;  4JBW A;  4R4Q A;  5IP9 G;  2VW9 A;  4X65 Q;  3W1B A;  3GD7 A;  4PZ8 A;  3EBE A;  2E5L Q;  3M7N A;  4IFD G;  2JA5 H;  3AYH B;  1NY4 A;  3NEN A;  2QA4 A;  1VQ4 A;  4APV A;  3PIP A;  2D0P A;  1FJG Q;  4LFB L;  4X6A H;  4YCU A;  5IYB G;  1CSQ A;  4PG3 A;  1VQ5 A;  4DR1 Q;  4YY3 Q;  4DR3 L;  1N36 L;  2A8V A;  1DGS A;  3S1R H;  1YNX A;  5GAH C;  3GO5 A;  3HOY G;  4JI0 Q;  1HZC A;  1EWI A;  4LUV A;  5IE8 A;  2WB1 G;  4KHZ A;  1SE8 A;  3FKI G;  2V1C C;  3U4Z A;  3GDE A;  4OXP A;  1IBM L;  1X3G A;  2IHF A;  2HHH L;  2UUC L;  3STB C;  5C44 G;  4DUY Q;  3KF6 A;  4BY7 G;  4FDB A;  3ULJ A;  3A0J A;  2NN6 I;  3PCO B;  1XNQ Q;  4X62 Q;  3HOV H;  1E1T A;  1TWH H;  4KI0 A;  5IYC G;  4JI2 Q;  3CPW A;  2WP8 J;  1QZH A;  4POG A;  4DV3 L;  1I6H H;  4IFD J;  1EQR A;  2WAQ E;  4YCW A;  1EYG A;  4JV5 Q;  4A3L H;  3OTO Q;  1UEB A;  4OWX B;  1E22 A;  1XPR A;  1Q12 A;  2JK8 A;  1EUJ A;  3UDF A;  1IBM Q;  1WJJ A;  4NXN L;  5C3E G;  3RZO H;  4LF8 L;  2JA8 H;  3K7U C;  3KF6 B;  2UUB L;  2CWP A;  3UDG A;  4GS3 A;  4P73 A;  2OTL A;  4JI8 Q;  5ELN A;  4EQ5 A;  3GTM H;  3PIO A;  4A3C H;  4K0K Q;  3MEF A;  5EAY A;  2UUA Q;  3HOX H;  2JA5 G;  4JI3 Q;  1D7Q A;  1BBU A;  2ALY B;  1EFW A;  1Q1E A;  4DR5 Q;  2LSS A;  4A3B H;  3BZC A;  4POF A;  2K14 A;  1QVF A;  3EN2 A;  3DM3 A;  4P72 A;  1EIF A;  2JA9 A;  1TWG H;  5IY0 A;  4GKK L;  1XJV A;  4DV2 L;  2ES2 A;  3PUX A;  1U0L A;  3LGJ A;  5C0X I;  2QEX A;  4A3D H;  3CC7 A;  1CSP A;  3T1Y Q;  4DR4 Q;  1VQH A;  4A3M H;  2UXC Q;  1YEZ A;  2JA6 H;  4WJ3 M;  1X3F A;  2RCN A;  3HKZ E;  2B63 H;  4IO9 A;  1Q7Y C;  3H0G H;  3CCR A;  1HNX Q;  4DKA C;  2JA8 G;  3KFU A;  5JJI A;  2HIV A;  4JBK A;  4A3E H;  1HR0 W;  1OTC A;  1IBK L;  4GKK Q;  1I94 Q;  4PZ6 A;  3WWV A;  1SLJ A;  2OQK A;  3K0X A;  5C0X G;  4AIM A;  1YJW A;  4NXM L;  2JA6 G;  3KDF A;  4ALP A;  3TS0 A;  1OXV A;  4OX9 Q;  1BVS A;  5FJ8 G;  4LF4 Q;  4JI4 Q;  1LYL A;  3S24 A;  3S15 H;  4LF9 L;  4BA2 I;  5DLQ E;  3HKZ G;  3I4N G;  4O0A A;  4LFC L;  5C4J H;  1MIU A;  1V9P A;  2Q2T A;  2YU9 H;  3L2P A;  2UXD L;  4DV1 Q;  4B3T Q;  4OO1 I;  2IHE A;  1YZ6 A;  3JC6 6;  5HY6 A;  3KF8 B;  4LWC A;  1HZ9 A;  4JI1 L;  3RLN A;  4BA1 I;  5M3M G;  4GNX A;  2KCM A;  4LFB Q;  1E3P A;  1TWC H;  3GTQ H;  3I55 A;  1N32 Q;  1Q8K A;  4DK3 C; 
#chains in the Genus database with same CATH topology
 2FMA A;  1EY0 A;  2WFW A;  1SRU A;  1GM5 A;  1XDN A;  2WKC A;  3DWA A;  4A3E G;  1STE A;  3F8N A;  2WTF A;  4UP8 A;  4F4Z A;  1F9Q A;  1WCM B;  5KYL A;  4JI1 H;  1K28 A;  3CMA A;  1GSA A;  1SNP A;  1UE1 A;  1CUK A;  1Q90 A;  3WO0 A;  2F4V L;  1LTT D;  3SGI A;  4A3D G;  1L2F A;  2I5M X;  3N42 B;  2RSN A;  3TRZ A;  2NU6 B;  4JI5 H;  2X6G A;  2GLT A;  4LH7 A;  2N78 A;  1U4P A;  2UU9 Q;  3OSN A;  2NUC A;  5M3M B;  2E2J B;  4PV1 C;  1K73 C;  5JJK A;  5KG5 A;  1X3Q A;  2GA4 B;  3CCM A;  4QWA A;  4LF7 Q;  4G7O C;  5DLG A;  4RNM A;  3DUZ A;  3I7F A;  4LAA A;  3D3R A;  2OWO A;  4R4O A;  5LA6 F;  5DG7 A;  2AGO A;  3MXG A;  3FVQ A;  3OWE B;  5C4X G;  3J80 c;  4J8Q A;  4ECV A;  3R2T A;  2WB1 A;  2JN4 A;  2FPI B;  1ZYR D;  4LF8 Q;  3J7A K;  1EUD B;  2UUA L;  1BNZ A;  1MJE A;  3R2I A;  1TWC B;  3GP7 A;  5GRO A;  3X3M A;  4JI8 L;  3BVM A;  1EEF D;  1NBW A;  1NR2 A;  1B1Z A;  3D0F A;  1KTK A;  5ELE A;  1XMO H;  1K3R A;  3Q6S A;  4R8N A;  5KFY A;  1LT3 D;  4JI7 L;  4DV2 Q;  4X3K A;  1D8L A;  1AUX A;  2F3V A;  1GO3 E;  1GHJ A;  4CGY B;  4CKE A;  1CFM A;  4CJ0 B;  2L15 A;  1AE2 A;  5FD6 A;  1M0W A;  4DUY H;  4ED3 A;  4GN3 B;  2QDL A;  3KLS A;  3JZI A;  3H3V I;  1I94 L;  2VY3 A;  3RB3 A;  2WIN B;  4CBV A;  4JI2 H;  3RLF A;  4JYA Q;  1BDO A;  1KQS A;  1AH9 A;  4FVM A;  4JI4 L;  2I5L X;  4V0B A;  1QUQ A;  2Z0S A;  5IWA H;  2C9O A;  3D4D A;  5T1I A;  4C3I G;  2NU8 B;  1NMF A;  4B3M Q;  1WD0 A;  5K2M A;  3KHR A;  2PZT A;  2BCO A;  1EUC B;  3AFQ A;  4JI8 H;  5J39 A;  2QEJ C;  4M9U A;  5I4D A;  4I7A A;  3KBG A;  3E3X A;  5FJ8 H;  1IOW A;  4WFN 3;  5C44 B;  2ASD A;  3Q1K A;  2W9B A;  1KJQ A;  4ZUJ A;  3RGX A;  1LUZ A;  2ZJR A;  1VQK A;  2JA6 A;  3C1E A;  4DR4 L;  1CQF A;  2WAQ G;  5IT9 L;  3I4O A;  4XYM B;  1JX4 A;  3BQ1 A;  1HJP A;  3HFZ B;  2XIW A;  1VMC A;  1PZK D;  2YRW A;  3HOY H;  1ML0 D;  2CH4 W;  5JVD F;  4A3J B;  3HOZ B;  3OOC A;  2OXP A;  1EIH A;  4R4C A;  3OYY A;  2L12 A;  3B6Y A;  1I7N A;  3RUP A;  2KED A;  4QWB A;  2HVQ A;  2I0Q A;  1RJR A;  2F0G A;  3N8D A;  2E2I H;  3G48 A;  5G3L D;  1G91 A;  2OTJ A;  1AUV A;  1S0M A;  4A3L G;  4DLK A;  1GSO A;  3VR3 A;  4I4T F;  2PN1 A;  2NN6 G;  3DEP A;  3H0G G;  4H02 A;  3R93 A;  4KLK A;  5DM7 3;  3ITP A;  1E4F T;  1TQO A;  3PV0 A;  1NE3 A;  4Q5V A;  4HIO A;  4LMY A;  3PIP 3;  3PUV A;  3PO2 H;  3NBH A;  1TR5 A;  3FP9 A;  1VQ8 A;  3NEM A;  4A3K B;  2FXQ A;  1NMG A;  5M5X H;  1JOQ A;  1GKH A;  4UCR A;  5C4H A;  1QJO A;  4CC6 A;  4O4I F;  4O3P A;  2XRQ D;  4CKB A;  3RJ0 A;  3R3O A;  1S68 A;  5J22 A;  3BVG A;  4A3B G;  5LYJ F;  4FXK C;  1SNM A;  1EY7 A;  2ZM6 H;  2VUG A;  1HNW L;  1E0B A;  1C48 A;  3S1Q H;  4IUP A;  3GIQ A;  1LT4 D;  5KFV A;  3U4V A;  2NB0 A;  5IYC H;  3V2T A;  3RNU A;  4JI4 H;  3HP3 A;  1EYZ A;  1QUQ B;  1KAA A;  1TWA A;  1IBM H;  3S14 H;  3M4I A;  2NTS A;  4YWM A;  1L1O A;  3BVZ A;  3SK6 A;  1S5B D;  4EGV A;  1JC7 A;  3LWE A;  2KHI A;  2XVS A;  4QY7 A;  3DWQ A;  2N55 A;  3PF4 A;  2V4Q A;  4QGU A;  5HUR A;  3BDL A;  1GSH A;  3Q8D A;  1PFS A;  4DAM A;  3I4N H;  3AU7 A;  3S17 B;  1AE3 A;  4EGJ A;  2VZA A;  4RFB A;  2PMZ A;  5C8Y F;  4ECS A;  3S9W A;  2A6E C;  2C00 A;  2DZD A;  4UCU A;  4ECU A;  1IXR A;  3GIL A;  4UAI A;  4CC5 A;  5I47 A;  2IY5 B;  1UAP A;  1E2V A;  5KFR A;  3OHX C;  3WNZ A;  3EVQ A;  1N33 L;  3DXJ C;  1PRT C;  3BJU A;  1B6R A;  2CKZ B;  1C30 A;  2OQ0 A;  5AJ3 Q;  2B2T A;  1C3O A;  1VQB A;  2A6H C;  3S1M H;  1EQQ A;  4J9S A;  1J5E L;  3BAB A;  1N33 H;  2NVX A;  4DNT B;  3BDO A;  1I4X A;  2VUM G;  2B2V A;  2SCU B;  3WOF A;  4AH6 A;  4DV0 Q;  2PI2 A;  2VQE H;  1ZHS A;  4DL7 A;  1O7Z A;  4JI0 H;  4FS2 A;  3RBD A;  1Y1V B;  5JPM C;  4BBS B;  4O42 A;  5IGC A;  2NVY A;  3D6C A;  5J1Z A;  2AQ2 B;  2ALZ A;  4C2M B;  1SCU B;  4RGN A;  4ZYS A;  4DUZ Q;  1KC8 C;  3BG5 A;  1YHB A;  2AKW B;  3T1H Q;  2C2R A;  3GLK A;  2R86 A;  1K8A C;  2F0V A;  2RF4 A;  1LTI D;  3KBX A;  2G9H D;  2XGT A;  2AWN A;  4X3S A;  5GAG C;  4ME6 A;  3MXU A;  1VCI A;  4B3S H;  4JPB W;  1VQJ A;  1RIP A;  2F4I A;  4KD4 A;  5ISR A;  3ORQ A;  4O3Q A;  4B3M H;  3M7G A;  2JEF A;  2A19 A;  3ER0 A;  5CA1 F;  2EDG A;  1DOM A;  4KY6 A;  4RH6 A;  4ME5 A;  4IUQ A;  1N32 H;  2EY2 A;  4DV7 Q;  5T1G A;  1JJ2 A;  1HNW H;  1SE3 A;  3CC2 A;  5M3F G;  1KNA A;  4YAK B;  1AN8 A;  2BR0 A;  2YCH A;  4K6L A;  5C3X A;  3GV8 B;  4LK1 C;  1PMR A;  1YI2 A;  1EY9 A;  1S5C D;  4LF6 Q;  1XMO Q;  2FPG B;  4PDB A;  3HS0 C;  4LNQ A;  3SDZ A;  4GC6 A;  1RF2 D;  4H13 C;  2PI2 E;  2MO1 A;  1JDE A;  4XTC S;  3NTH A;  5JOB A;  2UXC L;  2W71 A;  1ENC A;  1EY5 A;  3NP8 A;  2K05 A;  3J7Z C;  4ED0 A;  4HSV A;  1QB5 D;  4IAJ A;  1KAW A;  4NXN H;  1C4Q A;  3TIN A;  5KNC A;  2DPI A;  3EQL C;  5FLM H;  1Z2P X;  2N49 A;  3C1F A;  1XMO L;  2VPQ A;  4KKU A;  4LF7 H;  1CKM A;  2R8J A;  3L4J A;  1FNU A;  3HOX G;  4J9P A;  1VKZ A;  3I2Z A;  1QVG A;  4JC0 A;  1Y1W A;  2Z4H A;  1WSC A;  1G6Z A;  1A2U A;  2DIK A;  3CKI B;  5EQ0 A;  4IUR A;  1EHI A;  2WDT A;  2SOB A;  5ELC A;  2IL8 A;  1DZ1 A;  2FMC A;  1SE2 A;  2IX0 A;  5JVG 3;  1S9F A;  1XWE A;  1K3B C;  3S1M B;  2QYZ A;  3VPC A;  4AQY L;  1QCB D;  3MFY A;  1RL2 A;  4QW9 A;  4F7X A;  1ZET A;  3CCJ A;  1R9T A;  2F0O A;  3RLO A;  1IYJ B;  1IBL Q;  2H1E A;  4QB4 A;  4UDU C;  2UVU A;  1YNJ C;  2RA4 A;  4K5X A;  3UI2 A;  1SRO A;  3GTG B;  2EOT A;  4BBR H;  3OW7 A;  3Q2O A;  1O80 A;  4QWD A;  2K50 A;  2FK3 A;  2DLN A;  4NXN Q;  4KHP H;  5FPO A;  2DGY A;  4DU9 A;  2YYZ A;  1HFG A;  3NQT A;  4CKC A;  1KL9 A;  3K0Y A;  2DWC A;  2PQA B;  4YAJ B;  3RAX A;  1LT5 D;  4DR5 L;  2UXB Q;  3F1Z A;  1F77 A;  3R5H A;  2VQF L;  1SSO A;  2LMC B;  3PW7 A;  5DM6 3;  4JV5 H;  3RD4 A;  4P74 A;  4DR7 H;  4XZ3 B;  3HOW G;  4TQS A;  3NBI A;  3KYH C;  1UC9 A;  4RUC A;  1X3P A;  4J9Q A;  1XNR Q;  2K33 A;  3VA5 A;  4IRK A;  4B3R L;  1IW7 D;  4LF5 Q;  3RIZ A;  3AQQ A;  4YR3 A;  4ZKB B;  4C1N I;  2L5T A;  3S1N H;  4BY1 B;  3CU7 A;  1YNJ D;  3E0J A;  2W57 A;  5KT6 A;  4R8U A;  5A2Q W;  1XXG A;  3LWB A;  5JJZ A;  1GYF A;  1JMC A;  1HPC A;  4A3G B;  1NNX A;  2Z6B A;  4LFC Q;  3ULL A;  3S17 H;  2HIX A;  1PRT B;  4A75 A;  5M9O A;  4PQX A;  2GN5 A;  4JBW A;  4R4Q A;  3MVV A;  4XX0 B;  4F88 A;  4FU0 A;  3GD7 A;  3OIQ A;  2E5L Q;  4IFD G;  4MA0 A;  1NY4 A;  1VQ4 A;  4APV A;  3PIP A;  1I6U A;  4QMG A;  2FKL A;  4RZQ A;  1VQ5 A;  1N36 L;  1E4E B;  2F0W A;  3S1R H;  4JI0 Q;  1HZC A;  1RD9 D;  1SE8 A;  2DNC A;  2V1C C;  2Z8L A;  3A8J E;  4QCL A;  4FDB A;  1O75 A;  3A0J A;  1XNQ Q;  4CDD C;  4X62 Q;  5KT4 A;  3MFI A;  4DR4 Q;  4JI2 Q;  3KAK A;  2EY1 A;  4IFD J;  1LO5 D;  3GTG A;  2IA6 A;  2UUC H;  3K3P A;  1XPR A;  1VDZ A;  3K5N A;  4A2A A;  5FO8 B;  2DPJ A;  4JI6 H;  3IFD A;  3M4Y A;  3M4O B;  2R7K A;  1EY8 A;  4BWG B;  1EQV A;  2CWP A;  5EZY F;  5C1O A;  5BN5 A;  1GLV A;  3PIO A;  4A3C H;  4RHR A;  4YP3 A;  5A2Q E;  2JA5 G;  2ALY B;  3NWT A;  3BYY B;  3TP5 A;  2O5I C;  1EU4 A;  2K14 A;  1QVF A;  2FLN A;  1EIF A;  3FEW X;  4A3E B;  2D5D A;  1U0L A;  1ROD A;  3E5N A;  2QEX A;  3CC7 A;  4NW2 A;  3KHG A;  3V4Z A;  1YNN D;  2G5D A;  2UXC Q;  3MZ5 A;  4WJ3 M;  3Q8S B;  1PTO C;  1RDP D;  1X3F A;  3HKZ E;  4KV6 A;  2E2H A;  1TII D;  2M2L A;  3QO2 A;  4FM9 A;  4H44 C;  1TS4 A;  2HIV A;  4JBK A;  4X66 H;  1SLJ A;  1FKA H;  1FYC A;  4ALP A;  3TS0 A;  2CZG A;  1IW7 C;  5FLX L;  5FJ8 G;  4K14 A;  1LYL A;  1IKL A;  5FD5 A;  1J5E H;  2R8G A;  1J9O A;  1A2T A;  2A73 B;  1MD2 D;  4JI7 H;  1V9P A;  2UXD L;  2R7M A;  2IHE A;  1YZ6 A;  3JC6 6;  4GNX A;  3KF8 B;  4LSX A;  1RJP A;  5DQI A;  4ZKC B;  5A35 A;  1TWC H;  1H9R A;  2ZJT A;  4C1N K;  2E74 C;  2K28 A;  2A1A A;  2A6H D;  4MV7 A;  4DAY B;  2RDG A;  3V4S A;  2HCI A;  2XN9 C;  1NUC A;  4Q8F A;  2UUC Q;  4DV0 L;  2ZDG A;  3G6X A;  1D1K A;  2I80 A;  1MJC A;  5KFP A;  5KGU A;  4UY8 C;  2JA7 G;  4ECX A;  2L55 A;  4DAP A;  4F8M A;  4DV4 L;  2A6E D;  3KLW A;  4DUZ L;  1ZYR C;  4ED6 A;  1BCP D;  2N88 A;  2FIN B;  3L3O C;  2R7Z H;  3EFX D;  1SYE A;  3RR5 A;  2UXB L;  1YJ9 A;  2A74 C;  3KOJ A;  4YHH L;  2EYL A;  3KJO A;  4DN4 M;  2YTX A;  2UU9 L;  4DR6 L;  3K5L A;  4DV4 Q;  4KK7 A;  5EOY A;  4J1M A;  1W96 A;  3DM1 A;  2KVM A;  1OO9 B;  5I2X A;  3PW5 A;  5KFG A;  3HXL A;  5G3L F;  1E2W A;  1KRS A;  4NB3 A;  5KFT A;  3HZX A;  1EQT A;  4EYI B;  4A3F H;  4OIJ A;  4A93 G;  2X6L A;  1K1Q A;  1ASY A;  2BH8 A;  2AGP A;  1PZJ D;  5I6W A;  1I5F A;  4IUT A;  3MR3 A;  2RVL A;  1BKB A;  2AHO B;  2XSC A;  4A93 H;  3FDT A;  3U50 C;  3DMU A;  3OSO A;  1Y1W G;  2Z1C A;  2R92 H;  4DUZ H;  2K75 A;  5I2Y A;  4ED8 A;  2F0T A;  1ET9 A;  5AFW A;  2FPP B;  3MXN B;  2R3Z A;  4ZOL F;  4IPH A;  2B2U C;  3S2D H;  1WFQ A;  1MBY A;  5D65 A;  4RNO A;  4NXM H;  4OX9 L;  1PVO A;  4ZLT F;  1BBW A;  2M00 A;  4O3S A;  2MNA A;  1BNC A;  1JWU D;  2BE5 C;  2I07 B;  1TT2 A;  1YJN A;  3H09 A;  3GTQ B;  1DYQ A;  1WOC A;  2D62 A;  4ID6 A;  4K2K A;  5GAD C;  2W6M A;  3K80 C;  1UNS A;  3RF2 A;  4ZQI A;  3J7Y W;  4EBE A;  1O7L A;  2ZXP A;  4RA8 A;  1K8O A;  2SNS A;  1JOR A;  4A2B A;  4KHP Q;  1B70 B;  4IRD A;  2CHB D;  1QZG A;  3EA6 A;  3GTO B;  1A3T A;  4DAY A;  2RDH A;  3MEH A;  4K8J A;  4ULL A;  3PF5 A;  5EKI A;  3LML A;  2QK4 A;  2E5L L;  1WVL A;  1Q81 C;  4LJZ C;  3K5M A;  1K1S A;  4CDF C;  1OXU A;  1BUV T;  4AYB B;  2F4V H;  4B9W A;  2W9A A;  5CYU A;  1FL0 A;  4WD3 A;  5ELF A;  2XIG A;  1N32 Q;  1CKN B;  4OO1 G;  3I70 A;  5KNB A;  2K1B A;  1MSG A;  2F0E A;  3C3L A;  2AU0 A;  4JI3 H;  4HJA A;  1W93 A;  1ICF B;  1TKW B;  4GOP A;  2R93 G;  1Y8P B;  1KHI A;  2HGS A;  4S3S A;  3GTJ H;  1WTP A;  3I8Z A;  4Y52 H;  5CAE B;  2NBF A;  4RG1 A;  3H91 A;  4YQW A;  1K8G A;  1WYD A;  3PVX A;  2YYA A;  2CQA A;  1KD1 C;  3GIP A;  3T5K A;  1TA8 A;  2JEG A;  3T16 A;  3QIA A;  2F1M A;  4RAU C;  1Q82 C;  2JA8 B;  2K5H A;  4O4L F;  2HDL A;  4LF5 H;  5C3E H;  2PBZ A;  1NTG A;  3MXP A;  4DR3 H;  1A3V A;  2F0J A;  4OL7 A;  2OEO A;  1XTD A;  2F0H A;  1PX2 A;  4Q45 A;  5KFX A;  3GTP B;  1TXY A;  5C1P A;  1SFO A;  3WO1 A;  2FK2 A;  4YCV A;  1GHK A;  3MR6 A;  1QWY A;  5KG0 A;  3I4M G;  4DR1 H;  1PYB A;  4XYO A;  1OXT A;  1PH1 A;  4DGZ A;  5K36 G;  4HNT A;  1B33 N;  5D3D A;  3CPF A;  3MXN A;  2Z6K C;  2VQE L;  1T5E A;  1SR3 A;  1D5Z C;  2B2T C;  2DY8 A;  5M5Y B;  4DPG A;  4MZ9 A;  1EL0 A;  3TQ1 A;  1JIC A;  3PQI A;  4R1J A;  2MJ8 A;  1HNW Q;  2FHT A;  1A62 A;  1R4Q B;  3I3C A;  4UCS A;  3GTQ A;  1VF5 C;  2F3W A;  1PFB A;  2KBN A;  4UFZ A;  2CW7 A;  3A5Z B;  2NVX H;  1I4R A;  2PVP A;  1X32 A;  3M85 A;  1QIL A;  2XC9 A;  4ECT A;  2Q2I A;  4QW8 A;  4HMI A;  4BY7 B;  3I4M H;  2B8G A;  1BCP B;  4G4K A;  4HNU A;  1LTS D;  3RZD B;  2F0M A;  5CBE E;  3KJP A;  4Q43 A;  3D31 A;  5KRU A;  1D5X C;  3BS1 A;  1Y8O B;  2R7F A;  5E1F A;  3J80 i;  3M3Y H;  1S5D D;  2JA5 A;  3RAQ A;  2GPS A;  4UCT A;  2ZTD A;  4OWW B;  1FGU A;  2FLL A;  4B08 A;  2ZTE A;  3HB9 A;  4L5R C;  4X62 L;  4RCO A;  4DR7 L;  2OT2 A;  4KY5 A;  1CKN A;  1SMX A;  4UP7 A;  5M5Y H;  5M3M H;  2E2J H;  1BGW A;  4RNN A;  4ECW A;  3PSI A;  2Y0S B;  4ZK9 B;  3J7A 5;  4GKJ H;  2NUA B;  1JCK B;  4M8A A;  2O03 A;  1V43 A;  4X64 Q;  2BA1 A;  1Z6H A;  4A76 A;  3BA9 A;  3E0E A;  2Q2U A;  3OTO L;  1Q8I A;  4YIJ A;  3LP8 A;  4A4I A;  4P2C B;  1PHJ A;  1STA A;  4HTH A;  4YHH H;  3P7J A;  4HCE A;  4K0K L;  4LF6 H;  4ILW A;  2F3I A;  2XWB B;  4NP5 A;  2RKS A;  3PO3 H;  4X64 L;  2BQ3 A;  5KFU A;  3BA8 A;  5CV7 A;  1B53 A;  2L11 A;  2E2D C;  5KFD A;  1OXX K;  2J9G A;  4BY1 H;  3J80 L;  5F2D A;  1FR3 A;  4DAV A;  3Q23 A;  3A54 A;  3M9B A;  4X62 H;  2EYP A;  1KRT A;  2OH2 A;  4K5V A;  2A69 C;  3FMA A;  3K7A H;  3VYR A;  4HJ7 A;  2EYF A;  3Q0A A;  1IOV A;  3AMU A;  4A3F B;  1V1Q A;  1U4M A;  1S3O A;  3ND9 A;  1X6O A;  1I3Q A;  1IBK Q;  5LP6 F;  4XYL B;  2K03 A;  1XPU A;  1RCV D;  1SND A;  2PMZ E;  2B63 B;  3H4D A;  4DV6 H;  3M9N B;  3G4S A;  1N8R C;  2KOL A;  2ENB A;  4A3G H;  2W8K A;  1YIJ A;  4C5A A;  3OUU A;  3MFH A;  2EY5 A;  2UUA H;  1JOO A;  2UXD Q;  5J2U F;  1F2L A;  1LLR D;  1YBY A;  1TWH B;  2MCT A;  1I50 H;  3S1N B;  2WYO A;  1L1O C;  3TBI B;  5CV4 A;  3HEJ A;  1KJ9 A;  3G8C A;  5L1L A;  4JI5 Q;  1VS0 A;  4FO2 A;  2L9H A;  1WTH A;  5CC4 A;  2HJW A;  4FBT A;  1KJJ A;  4J15 A;  1SFO H;  4IFD H;  2FJZ A;  3PR5 B;  5C0X J;  1Y1W B;  3CQZ B;  1PYS B;  4RAY A;  1FGB D;  5JAV A;  2R61 A;  1XMQ L;  3TIG A;  2IP4 A;  1STY A;  3STB D;  1N33 Q;  2YTY A;  4DV5 H;  3UE1 A;  4DNI A;  2UUB H;  2YW2 A;  2P0A A;  4HN7 A;  1I50 B;  1GGO A;  2LXJ A;  1D5M C;  1LV9 A;  1VQG A;  1Z2O X;  2W6O A;  1X55 A;  2K4K A;  3BG3 A;  3I90 A;  1LTG D;  4RMF A;  1PH4 A;  1XNR H;  4LF7 L;  1WTX A;  2QGQ A;  2V59 A;  4MV1 A;  2ASJ A;  1XMQ Q;  3TQT A;  1QNU A;  2HHH Q;  4DF7 A;  5CMD A;  2F0K A;  4IWY A;  2C35 B;  2EXZ A;  5CV8 A;  4H7B A;  5IWA L;  1XJV A;  3TRE A;  2B3G A;  5E4X A;  4YHH Q;  3GV5 B;  4ECR A;  4YJ3 F;  2QW7 A;  3VPD A;  4C3I B;  4U67 3;  2SNM A;  1VQE A;  2I5H A;  4U68 A;  2NZO A;  3TP8 A;  1STH A;  2SEB D;  1T5X D;  4BY1 G;  3PUZ A;  3CCV A;  1KDB A;  4DL6 A;  4J6H A;  3H40 A;  4QQB X;  1GOZ A;  2Y0S E;  4NPS A;  4AYB G;  2ZDH A;  2W7P A;  2B39 A;  1HR0 H;  3PW0 A;  3BJY A;  1II3 A;  1CQJ B;  4XIG S;  3PO3 G;  5IYZ F;  5BPH A;  3HKS A;  1ESF A;  1RK6 A;  4KD3 A;  1UEA B;  1CZW A;  4KHV A;  5FO9 B;  5KFI A;  4EEQ A;  3BZK A;  5DG9 A;  1I3Q B;  1CHQ D;  2CH4 A;  4HJ5 A;  3PN1 A;  1HCZ A;  4EYH B;  2C22 A;  3GTM B;  1EOT A;  4C3H G;  5JVH 3;  2E2I A;  1DIK A;  2EXD A;  1L0X B;  5D1P A;  1X56 A;  4OIK A;  2VUM B;  4ODG A;  2NVQ H;  3QZ7 A;  4IJL A;  2R93 A;  1V8Q A;  1B4O A;  4HJ9 A;  4DV4 H;  4A3I G;  3T5J A;  3KDF B;  3I91 A;  4R9W A;  1SMY D;  3RUZ A;  4G7Z C;  1T3N A;  1EU3 A;  3P75 A;  4XT1 B;  1WTW A;  4MA5 A;  5FLM G;  2WAC A;  5L1I A;  2NN6 H;  1E24 A;  3T5H A;  4A3D B;  1YHQ A;  1PH7 A;  3BDC A;  3JAM L;  1RTN A;  2MHV A;  4OHJ A;  4HR7 A;  5DQG A;  4DL3 A;  4IRC A;  2VW9 A;  3T53 B;  2DN8 A;  4X65 Q;  3R5F A;  2VB2 X;  1I50 A;  4K8I A;  2FMM A;  4PMC A;  2JA5 H;  3AYH B;  2AGQ A;  3FRP B;  3QWN A;  4K6D A;  2D0P A;  1ZHQ A;  3HGB A;  4X6A H;  3C0F B;  3ND8 A;  2NTT A;  4YY3 Q;  2A8V A;  4J9O A;  1B3A A;  4JV1 A;  1YNX A;  3HOY G;  3OHB A;  1V1P A;  3RZO B;  2RDJ A;  1IBM L;  1I4G A;  3GDE A;  2HHH L;  1IYV A;  3KLR A;  4ZQ3 A;  3JSL A;  4EQN A;  3VR2 A;  1F9P A;  3MA2 B;  3JSN A;  4J9N A;  3T51 B;  4X64 H;  1E1T A;  1TWH H;  3CPW A;  2K6A A;  2WP8 J;  1I6H H;  1STG A;  2YZG A;  3MAQ A;  3DEO A;  4O1N A;  3OTO Q;  1UEB A;  4OWX B;  2XGQ A;  1IBM Q;  4KJO A;  1PDQ A;  5C3E G;  2JA8 H;  4LF9 H;  1S0N A;  3UDG A;  2K5W A;  4GS3 A;  4P73 A;  4K0K Q;  2EE1 A;  5ELN A;  5IGE A;  3GTM H;  1SEI A;  1TWC A;  2UUA Q;  4I50 F;  4A93 B;  1LTR D;  1S5F D;  1BBU A;  2CW8 A;  4WBN F;  3K59 A;  4A3B H;  4POF A;  5LOV F;  2VOB A;  1PTO B;  4TUY F;  3PUX A;  5C0X I;  2A68 C;  1DCZ A;  3H0G B;  5KG1 A;  1B3Q A;  4V19 0;  2JA6 H;  4MV4 A;  2RCN A;  2B63 H;  2J6U A;  3N6X A;  4IO9 A;  5JQW A;  3H0G H;  2EJG C;  3KFU A;  4DKA C;  1S10 A;  3Q8Q B;  4L63 B;  1IBK L;  1I94 Q;  3Q22 A;  3WWV A;  2R7L A;  2OQK A;  2DJG C;  3K0X A;  5C0X G;  4NXM L;  1OXV A;  4OX9 Q;  4FYD A;  1SYG A;  4OEL B;  5NUC A;  5HBR B;  4C5B A;  4KY7 A;  4LF9 L;  4BA2 I;  4HQ6 A;  2HVR A;  2VA3 A;  3SXH A;  3MR5 A;  4LFC L;  1M0T A;  1MIU A;  3L2P A;  4DV1 Q;  4N9T A;  3LWU A;  4JI1 L;  2PZW A;  4BA1 I;  1M1K C;  3IFT A;  4YB8 B;  2R87 A;  2KCM A;  3GIK A;  3GTQ H;  3PR4 A;  2W9B B;  1U5K A;  4B3S Q;  2KUM A;  1VQF A;  3RB6 A;  3FHW A;  2HQE A;  2CVR A;  4ZAI A;  3OPO A;  3UDI A;  1KIX A;  3KHH A;  2ASL A;  4C3J H;  4DR1 L;  4DR3 Q;  1L0Y B;  1CA5 A;  1AP0 A;  1N34 L;  4JI1 Q;  2JSO A;  3F2U A;  2IX1 A;  1IYU A;  4DV1 L;  4GNX B;  1SEB D;  3LNN A;  4A3K H;  3IN5 A;  3HKZ A;  4ZRZ A;  3CCU A;  3KTM A;  4MV9 A;  3ULP A;  1Z9F A;  4B3R H;  3H4B A;  5I6Y A;  3VA7 A;  4TKO B;  4MTD A;  1JIH A;  3J80 W;  4A3K G;  3HOU B;  1VQO A;  4IHJ F;  2MQH A;  5JEA J;  1ZEQ X;  3KAL A;  4FF4 A;  4GNX C;  2H5X A;  2Q8I B;  1N34 Q;  1A9X A;  5IWA Q;  4A3C G;  3IRB A;  1PH2 A;  3M3Y B;  3KUP A;  1TVX A;  4DR2 L;  5FO7 B;  4GC7 A;  3EYY A;  3D4W A;  3N52 A;  4TSS A;  2WB1 E;  4JI6 L;  4MV3 A;  4I55 F;  4EEY A;  2J7Z A;  3OWF A;  5FOB B;  1KBL A;  2BQU A;  2GPW A;  4QJF A;  1VQL A;  2MPM A;  4ABN A;  3NBH B;  1XMQ H;  2RQX A;  3VR6 A;  2W9C B;  1I94 H;  5IOC A;  2DNE A;  3VDY A;  4GN4 B;  2WE6 A;  4LSA A;  4DL4 A;  2C28 A;  5BN4 A;  1AW7 A;  4DV5 L;  3CAM A;  3VYT A;  1HZB A;  4O4H F;  2M05 A;  4BXX G;  5C4X B;  4AQY H;  3HRZ C;  3K57 A;  3FPP A;  2Z9H A;  1B9M A;  4RWS C;  4R7R A;  2JA7 H;  1U4L A;  4C3H H;  1MHW C;  1XTC D;  5C4X H;  2KJX A;  2EJF C;  4DK6 C;  4JI5 L;  3A8K E;  3GTL A;  1KAB A;  1ONL A;  3MWM A;  5F9L A;  4Q44 A;  4DR2 H;  3KXY T;  1VAJ A;  4XQN A;  2K32 A;  3GTO A;  2N8N A;  2SDF A;  3MHB A;  3CME A;  4M1U B;  3E5S A;  5KYI A;  1IBL H;  1T94 A;  2XCP A;  4Q0Y A;  2UXD H;  1JB7 A;  3VR4 A;  1VQM A;  4F4X A;  4C3J G;  2K5N A;  5IP9 H;  4AYB A;  1DJR D;  1G2S A;  1UC8 A;  4NLG A;  2FLP A;  2PMZ B;  4N8F A;  4X3U A;  3H3V H;  3KK7 A;  4JV5 L;  1RYS A;  1SXT A;  4RGT A;  1U4R A;  1CQV A;  2KA7 A;  2GVB A;  4HMJ A;  5JJL A;  2KHJ A;  3ZJY C;  4HJ8 A;  2OF1 A;  2B2W A;  3J7A V;  1WH2 A;  2ZM6 L;  4L5S A;  2AWO A;  3H15 A;  3HKZ B;  3HOW H;  5FKA C;  4L6T B;  5A2Q L;  2XTI A;  4LUO A;  2XCL A;  2HQL A;  4RB2 C;  3VPB A;  1EZ1 A;  2W6P A;  2PNH A;  4C2M H;  3CD6 A;  2Z4I A;  1Z2N X;  1FNV A;  3QOL A;  3H3V C;  3ERS X;  4DL2 A;  3PUW A;  2UVR A;  1HH2 P;  4QF4 A;  4FXD A;  3S1R B;  1M7J A;  4EBD A;  4X65 H;  1K83 A;  2WB1 B;  5EPL A;  4EX5 A;  5LMN H;  1IL8 A;  1CZG A;  2MO0 A;  1EZ6 A;  3HOU H;  1B50 A;  1N48 A;  1BJT A;  3A55 A;  4I7H A;  2VNU D;  1B7Y B;  5K36 H;  4MN3 A;  4LW1 A;  2R7N A;  3GTL H;  3J81 L;  3T1H L;  2ICI A;  2W9C A;  1SN8 A;  1S40 A;  4QIW B;  1V51 A;  2IX3 A;  3GTK B;  2Q8T A;  3TQY A;  2ID0 A;  5KFZ A;  4ZI7 F;  1KLU D;  3SK8 A;  1X54 A;  3F2D A;  3F2B A;  3HOV B;  3TP7 A;  4LMQ D;  1XNR L;  4KN7 C;  2E8G A;  2CFM A;  4IPC A;  3Q24 A;  3TME A;  1Z47 A;  4A3G G;  5F9N A;  3EJI A;  4CDC C;  4Y8V B;  3VYS A;  4MTK A;  4JYA L;  1M6V A;  4MTE A;  2MP1 A;  2OCE A;  1S97 A;  1KC7 A;  4N8X 1;  3JAM W;  5BN3 A;  1GUT A;  5K5P A;  4GLA C;  1P16 A;  1ILP A;  4QWC A;  3OUZ A;  2ZT9 C;  3D4R A;  1SFO B;  3V6K A;  3K7A B;  1BXR A;  2ATL A;  3NPP A;  2F0I A;  1QNK A;  3PO2 G;  1AN7 A;  4X66 Q;  1QVC A;  3T1Y L;  1IKM A;  3OMG A;  4IZ8 A;  3ONA B;  3S16 B;  4X65 L;  1HR0 Q;  2UXC H;  1Y69 U;  2VPS A;  4EQO A;  2HVS A;  5JH7 F;  4RU9 A;  5C5M A;  3DHQ A;  2JA6 B;  5KFO A;  2CQO A;  2N3S A;  3A56 A;  4L5T A;  1N36 Q;  3RBE A;  3TZU A;  5LMU L;  2ZTC A;  1SNQ A;  1I6H B;  2J0T D;  1HR0 L;  3QZ8 A;  2Q2H A;  5C0X H;  2XCA A;  3BQ2 A;  2EQS A;  2NYZ D;  1HQM C;  5KFE A;  1EWH A;  5EWG A;  2NVQ B;  4P75 A;  5HV6 A;  2HHH H;  1MI2 A;  2CW0 C;  2HT1 A;  2F0N A;  1H9M A;  2NVY H;  5L37 A;  4Y7N H;  1N32 L;  2HD3 A;  4A3I H;  1JJG A;  1G2T A;  2K5V A;  3H20 A;  1B9N A;  4HAE A;  1SMY C;  1LT6 D;  3TII A;  1UWV A;  4FNF A;  1V4Y A;  3HBL A;  3A8I E;  2EYH A;  4UP9 A;  1RJQ A;  4ED1 A;  3G6E A;  4GOP C;  1E4G T;  5KG2 A;  4LF4 H;  2YV5 A;  3PGZ A;  3K58 A;  2VXW A;  5J3B A;  4J9K A;  3H6M A;  3T4A C;  1I4P A;  1DOK A;  5M5W H;  1M4V A;  1TS3 A;  1UE5 A;  3QFF A;  1FD7 D;  3NEL A;  3MJF A;  1G51 A;  4IUU A;  4QWE A;  4QIW A;  3TS2 A;  1SDF A;  3PO2 B;  5CR3 A;  4A3M G;  1K83 H;  2F0P A;  2F0F A;  3UDX A;  4A3J G;  3HOZ G;  1JXL A;  2LXK A;  2RGR A;  1PA6 A;  5DGA A;  4A3F G;  1K0R A;  1JB3 A;  2JEI A;  4HYK A;  2VUM H;  4FF1 A;  1GUS A;  2AUJ D;  4LFA H;  1MGS A;  4IQZ A;  1PRT D;  1CKO A;  3W1G A;  1KLG D;  5EGT A;  4I7Z C;  2EY6 A;  1N9W A;  4DK1 A;  5EKK A;  1M90 C;  3RTX A;  1IBK H;  2KEE A;  2KEC A;  1UNN C;  5DNF A;  1VQ9 A;  4A3M B;  4RCN A;  4LF4 L;  4DV6 L;  1L1O B;  3U9O A;  4JV2 A;  2F0S A;  2B2Y A;  5M5W B;  2R6G A;  1Q1B A;  3HOU G;  2JQO A;  1ZKO A;  1WTR A;  5JPN C;  3L4K A;  4CHT B;  1Y1V H;  4BBS H;  1A8V A;  2O5J C;  5FK9 C;  1SYC A;  2IPK D;  2R7Z B;  4JBJ A;  4LF5 L;  1L0W A;  3CCS A;  2MUY A;  3AFP A;  5IGG A;  2C5C A;  2EZV A;  4RGO S;  2NU7 B;  4R4T A;  1IL2 A;  1TS5 A;  3H94 A;  2J6S A;  1YVC A;  3SEB A;  4B3M L;  3CVZ A;  2RSO A;  1O7I A;  3K8A A;  3N6R A;  4NDX A;  4OWT B;  2ZJQ A;  1TU2 B;  1BXT A;  5IYD H;  4M7E A;  2IT1 A;  3W3A A;  2RBM A;  5LMU H;  4IPD A;  5JUM A;  2JJQ A;  5BR8 L;  4HID A;  3CQZ A;  1J5E Q;  1CT1 D;  4IOC A;  2I87 A;  4EQP A;  4I65 A;  3VR5 A;  3SE0 A;  2AUK A;  4GKJ L;  2AQ1 B;  4DR6 Q;  1KJI A;  5GAE C;  2FE3 A;  3KHL A;  1SYF A;  4A3I B;  1D6E C;  4JI0 L;  2L1B A;  3EIV A;  1A3U A;  2RHS B;  4P71 A;  4WJW A;  4HIM A;  3DWP A;  3RFC A;  1CHP D;  3S16 H;  5KFW A;  4DR2 Q;  1X65 A;  4XYQ A;  3D6W A;  1KEE A;  1XNQ L;  2WKD A;  2F52 A;  2VA2 A;  4DV3 Q;  4C2M A;  1IHZ A;  4JI2 L;  4EVO A;  3GTJ B;  5IGD A;  2VS1 A;  2GVA A;  5COR A;  3ZYY X;  2W6Q A;  5IT9 E;  4MNO A;  3GII A;  1T36 A;  4TV8 F;  3QR8 A;  2YZN A;  1B6S A;  5FLX c;  2W6N A;  4ZCK A;  3GTM A;  2QKI C;  3F2C A;  4OEM B;  1F2Z A;  3C46 A;  1WTQ A;  2PW5 A;  1PH6 A;  1HUN A;  4FBU A;  4YWK A;  2WAQ B;  5CBA E;  2DUD A;  3TEH B;  2B2U A;  1JE4 A;  1GD7 A;  4JI3 L;  5EKL A;  3ERO A;  3E9I A;  1EYA A;  4DV7 L;  3GTK H;  2CCZ A;  2HCC A;  3J81 j;  3R23 A;  1SE4 A;  2IW3 A;  1B04 A;  4DV2 H;  4DR4 H;  4JOI A;  3M4Q A;  4HIK A;  4GZY C;  1NSN S;  1Y1W H;  2F0Q A;  5E7N A;  5KG6 A;  4LH6 A;  4J9R A;  3UQ8 A;  1DV2 A;  4O3N A;  1VQA A;  4ECZ A;  2C2D A;  4XDX A;  5IT9 W;  3ETJ A;  1G6P A;  4ME3 A;  4LF6 L;  3A74 A;  2VL6 A;  4HR7 B;  4TV9 F;  5CGK A;  5H1S E;  1EEI D;  2E2I B;  2KQ3 A;  1F9S A;  2EIF A;  3IG0 A;  1JT8 A;  2I46 A;  1I4H A;  1TWF A;  4WJ4 A;  3UFX B;  1J8I A;  1DD2 A;  5KFC A;  4B3T L;  3I4M B;  4F87 A;  1V1P B;  5IP9 G;  2R6F A;  4J9M A;  3W1B A;  1HNZ H;  4PZ8 A;  3EBE A;  3KF8 A;  3M7N A;  3SK5 A;  3N41 B;  3J81 E;  1FJG Q;  4G7H C;  4LFB L;  2R8K A;  3WDN A;  1CS0 A;  4YCU A;  5IYB G;  4PG3 A;  1PRT F;  1S0O A;  3GIM A;  2R8H A;  4G57 A;  5EPJ A;  1H9J A;  2EVB A;  4DV1 H;  3GO5 A;  5IE8 A;  5D8D A;  4KHZ A;  3M9O B;  5HGT A;  1X3G A;  2IHF A;  2EJM A;  2UUC L;  4LFB H;  5JEA H;  4DUY Q;  3KF6 A;  4BY7 G;  4DFA A;  1BCP C;  2NN6 I;  3PCO B;  5IGF A;  3HOV H;  1R9T B;  1PK8 A;  4JV5 Q;  4KI0 A;  3GV3 A;  1QZH A;  4POG A;  3GTJ A;  2K01 A;  4DV3 L;  1GUO A;  1EQR A;  3NK9 A;  2WAQ E;  4O3R A;  4A3L H;  5IGB A;  2Q8R E;  1E22 A;  1KDA A;  2JK8 A;  2UXB H;  3NSW A;  2ZDQ A;  1ICW A;  1WJJ A;  5D1O B;  3QOJ A;  3RZO H;  2UUB L;  1NAP A;  5IOD A;  4RUA A;  3RV4 A;  4EQ5 A;  3PMF A;  4LF8 H;  3MEF A;  5EAY A;  2WAQ A;  2KHS A;  1Q1E A;  2ZXO A;  1PXU A;  5KFQ A;  1QOH A;  1F2M A;  2LSS A;  4DR5 Q;  3SE7 A;  4DV7 H;  3BZD B;  5LL6 X;  3EN2 A;  3DM3 A;  5C4Z A;  2JA9 A;  4GKK L;  1SBB B;  1TWG H;  2QDB A;  2ES2 A;  4DV2 L;  3QJY A;  2V4R A;  4A3D H;  1U9R A;  2JEJ A;  4ED2 A;  4IN3 A;  5CV9 A;  4A3M H;  3MFG A;  3RB4 A;  4C56 C;  4ZUI A;  4FXG C;  1FJG H;  5KT3 A;  1HNX Q;  4R8I A;  3JRW A;  4BBR B;  2JA8 G;  4HSP A;  2E75 C;  5JJI A;  4DV3 H;  2OLS A;  4GKK H;  3X3N A;  1BCP F;  4A3E H;  1HR0 W;  1OTC A;  4GKK Q;  4PZ6 A;  2BDO A;  1MZB A;  2EYM A;  1JQY D;  4AIM A;  4OO1 H;  3SI8 A;  2H4O A;  2D2C C;  4BS9 A;  1BVS A;  4LF4 Q;  4WOR A;  4JI4 Q;  1PTO D;  3S15 H;  3H0G A;  4ETS A;  1TAE A;  1VF7 A;  1YNN C;  1CM9 A;  2QIL A;  3MC0 B;  4YR2 A;  5DLQ E;  1HUM A;  2AQ3 B;  2Q2T A;  3A7A B;  2YU9 H;  1WCM A;  4JUZ A;  2BQR A;  4B3T Q;  5HY6 A;  3Q8R B;  2PZU A;  1E3P A;  5KFS A;  3I55 A;  1Q8K A;  2FB9 A;  4DK3 C;  1GUW A;  4HNV A;  1DON A;  1WCM H;  4CDE C;  1VQ6 A;  4DL5 A;  1VQD A;  2W6Z A;  4MIU A;  5H80 A;  5EDW A;  3WOE A;  2RDF A;  3N40 P;  5KFK A;  1E4E A;  1R9T H;  5EWE A;  5L9X A;  4LUZ A;  4ECQ A;  2I8C A;  1F9R A;  3NE5 B;  1H9S A;  4XQQ A;  4TRD A;  4K5W A;  5KIX A;  4B3S L;  5C5L A;  4JI6 Q;  1WTO A;  2K7V A;  1H9K A;  3CQZ H;  4L8J A;  2YRX A;  3OSP A;  5EPK A;  1GVP A;  1PV4 A;  2BOS A;  3V96 A;  2BE5 D;  4L5Q A;  1HQR D;  4UHV A;  3S2H H;  4Q8E A;  3T1Y H;  4FF2 A;  3GTO H;  1JJC B;  4TQU S;  2W70 A;  2M9V A;  5ELB A;  4DV5 Q;  1PYW D;  3TSS A;  1XPO A;  3J81 i;  2XNA C;  3PW2 A;  5M3F B;  1VQI A;  3FMC A;  4JI7 Q;  5ELO A;  4JCV E;  4CJ1 B;  4FF3 A;  2FFK B;  4EFB A;  1DV1 A;  4PWQ A;  1BF4 A;  2DY7 A;  5COY A;  2JA7 A;  5C6A A;  3G7L A;  2FK1 A;  2KCT A;  4RB3 C;  4JG2 A;  1I6V C;  1XX8 A;  1W6K A;  4Q0F A;  1BO0 A;  3U58 A;  3ICE A;  1PFM A;  1WD1 A;  3SHL A;  4R4I A;  3GID A;  3GTP A;  2PW7 A;  4OGQ C;  2E5L H;  1EYD A;  5CV5 A;  3JAM E;  5TSS A;  4MHE A;  3HOX B;  4IFD I;  1C9O A;  2XGP A;  3W5O A;  4DV6 Q;  1CK1 A;  1HTL D;  1TY0 A;  1JLL B;  5GQO A;  2VQE Q;  1LAB A;  3A7L A;  2R93 H;  3UE0 A;  1G8Z D;  1HZA A;  2TMP A;  1A63 A;  2Z6K A;  3CCQ A;  2AQ4 A;  1FVI A;  1W6J A;  3I73 A;  3GQC A;  2BA0 A;  4IOA A;  4YR0 A;  2NVT H;  3MWD A;  1PH9 A;  3R5X A;  5KT7 A;  3TZD A;  4X66 L;  1T9H A;  2P5Z X;  4RKL A;  3HG9 A;  2ASB A;  2DJF C;  4KN4 C;  1KXL A;  5CV6 A;  1VQP A;  5DQH A;  3J80 E;  5T14 A;  4IPG A;  4L1K A;  4MV6 A;  4BXX H;  2IBK A;  4OX9 H;  3I4L A;  4JOI C;  3GTL B;  2UVV A;  5EWF A;  4JV0 A;  2NWG A;  5LMN W;  2YU9 B;  3N44 B;  3HOW B;  3ETH A;  2V5A A;  2A68 D;  1WI5 A;  2QF7 A;  2RCF A;  2EPB A;  3KLS X;  4UPA A;  4IZO A;  1S03 G;  2JA5 B;  1N34 H;  3K81 C;  1WCM G;  4GKJ Q;  1EFI D;  1K83 B;  1P8L A;  3Q8P B;  2L0C A;  3PO3 B;  3E9H A;  1ET6 A;  3GTG H;  1IZ6 A;  1VBH A;  1CA6 A;  3C2P A;  1A15 A;  1F2Y A;  2UU9 H;  3G71 A;  3GTK A;  1PLF A;  1HA5 A;  2UVW A;  4B9X A;  1RJT A;  1I7L A;  1LM0 A;  4ZHQ F;  5KFH A;  4LFC H;  4YJ2 F;  1RTO A;  2JA7 B;  2F0U A;  4RGM A;  3G6J B;  1DM0 B;  5C44 H;  3BAA A;  5KFL A;  2CW0 D;  2HDM A;  5DAU A;  5E3F A;  1YIT A;  5J2T F;  4ECY A;  3IKJ A;  1Y14 B;  3CC4 A;  4EFE A;  1UE6 A;  1GUN A;  1Y8N B;  4U7C A;  2IWH A;  3NQI A;  2PPB C;  5LL6 b;  1JWS D;  1TWA B;  2YTV A;  3NTK A;  2BDN A;  3W2D A;  1OWT A;  5I9P A;  1VQ7 A;  4J9L A;  4UCO A;  1CE8 A;  2ZJP A;  2RDI A;  1ASZ A;  5KFM A;  2AMC B;  4IUN A;  2C2E A;  1GXD C;  1YHA A;  4U6P A;  4NKL A;  1RYR A;  2B29 A;  5KX5 F;  1TWG B;  1E7Z A;  1CI3 M;  3OMC A;  1JE5 A;  2YS7 A;  4F4Y A;  2LKV A;  1O78 A;  3I56 A;  1XNQ H;  3CP0 A;  3U9S A;  3VMM A;  1TWF H;  4JBM A;  5KND A;  3GQB A;  1UUP A;  5JEA G;  1C0A A;  2VR1 A;  4O2D A;  3TN2 A;  1TWH A;  2JE6 I;  3K5O A;  3S14 B;  1E2Z A;  2J4X A;  4UCV A;  3U9T A;  5DGB A;  3I72 A;  4KJN A;  4GLX A;  1PH8 A;  1HNZ L;  4QL5 A;  4E6I A;  3CF5 A;  2Y0S G;  4AYB E;  4O3O A;  4PMW A;  4KHP L;  5BPF A;  3T5L A;  4K0K H;  4A3J H;  4YY3 L;  3HOZ H;  5AJ3 L;  1M8A A;  5IT9 c;  2NZH A;  4OON A;  3HOY B;  4BBR G;  1AFP A;  5C5J A;  1QG7 A;  1S72 A;  1HTP A;  2W7O A;  2ATW A;  2CWA A;  3FKI B;  1D1I A;  5LL6 S;  3JAM c;  2NVX B;  5EBC A;  3CCE A;  1JDB B;  5IYB H;  3RMH A;  1GJX A;  2ZM6 Q;  3JRX A;  1SYB A;  3JAM i;  2B2W C;  2B8F A;  3S2D B;  1Y1V A;  1HNZ Q;  3NWS A;  5C3E B;  5LMU Q;  1BBX C;  4DUY L;  3F8T A;  4KKS A;  4IAL A;  3L7Z C;  3KAJ A;  5LXT F;  1EIY B;  3P20 A;  4XXE A;  5IIF A;  4Y7N B;  4GOP B;  3PZP A;  2PYK A;  4MTN A;  1STB A;  5KFJ A;  2F4V Q;  3EPG A;  3PIO 3;  1WR2 A;  3CCL A;  2R92 A;  4JYA H;  1JR0 D;  3CRL C;  4EGQ A;  4GLV B;  3URY A;  3RN2 A;  3K6O A;  4K2L A;  4XT3 B;  1B8A A;  4C3J B;  1FJG L;  1FNW A;  2K52 A;  4Z9C B;  3RV3 A;  1DOL A;  5HGQ A;  3O13 A;  1XYI A;  2B63 G;  4C3H B;  1PTO F;  3OHA A;  2KCC A;  1S5E D;  1Q46 A;  4XQJ A;  3ERQ A;  1G29 1;  2R85 A;  1EY4 A;  5M3F H;  3L0O A;  4KMU C;  3D8G A;  2R7D A;  2NVY B;  2W8L A;  1W2B A;  1UE7 A;  2K5Q A;  1JKJ B;  5EBD A;  3A5U A;  4DXF A;  1ULZ A;  4LFA L;  2PQE A;  5FLX W;  3CW2 C;  5DG8 A;  1EWC A;  2R82 A;  1ENA A;  2F03 A;  3MWE A;  1NCV A;  3RN5 A;  4J0M A;  2KEN A;  5DEH A;  2LY7 A;  1AEX A;  4NXM Q;  4X3T A;  1GUG A;  3SR1 A;  2R7Z A;  3T13 A;  1TWG A;  1MKH A;  4IWX A;  1A0I A;  2B2V C;  4LF9 Q;  3L9A X;  1E1O A;  2UUB Q;  1RKN A;  3I4N B;  4MAM A;  2F0D A;  1SJE D;  2LS0 1;  4QUC A;  2A5H A;  3TDQ A;  3V6J A;  4E4T A;  3OTO H;  2NVT B;  2MFI A;  5E4W C;  5IYD G;  1NJI C;  1HNX H;  1AZP A;  5KT5 A;  2R93 B;  3DLL A;  4EG0 A;  4KKT A;  1SAP A;  1BR9 A;  2D0O A;  3BQ0 A;  3T1H H;  3CXC A;  4GN5 A;  3S2H B;  2QCP X;  4DR6 H;  5JVL A;  3P1H A;  4PMB A;  2EYJ A;  4NMZ A;  2JXM B;  3MTS A;  3SVM A;  3BU2 A;  1EYC A;  2E76 C;  1SYD A;  3R8B A;  5CA0 F;  3FKI A;  1HNX L;  4DR5 H;  2ICE C;  4JK1 C;  3NGD A;  5L1J A;  1K9M C;  1LTL A;  2VQF H;  2NU9 B;  2YU9 A;  4DV0 H;  1AZQ A;  4DR7 Q;  2X69 A;  5KFN A;  5KFB A;  4FP5 D;  5KFA A;  1ILQ A;  2RHQ B;  2WII B;  2B2Y C;  3FKI H;  3M4P A;  4IR1 A;  3T56 B;  5D3I B;  4AQY Q;  2KCN A;  1QE6 A;  2Y0S A;  3G6Y A;  3RZD H;  1EZ8 A;  4HCS A;  4JVZ A;  5M5X B;  1N56 A;  1ENF A;  1RHP A;  4QIW E;  1KNE A;  1STN A;  2EYO A;  3G6V A;  4DA2 A;  3IL8 A;  1IBL L;  4FS1 A;  1BOS A;  2MGS A;  4EBC A;  1MSH A;  4RB1 A;  2R92 B;  2VB3 X;  1B2T A;  2E2H H;  4YWL A;  1DXM A;  3FPU B;  5BR8 Q;  1Q86 C;  4F4W A;  1BQQ T;  2G9D A;  1HHV A;  3K3V A;  3I12 A;  4APM A;  1LAC A;  1JOK A;  1W3S A;  2NZ1 D;  4KTA A;  1EOV A;  1Y1V G;  1R4P B;  5ELD A;  4BBS G;  2JP1 A;  3S15 B;  5EJW A;  2JEB I;  2BH2 A;  5IP7 H;  4PZ7 A;  4IJH A;  1I4Q A;  1PH5 A;  3CHB D;  3BYT B;  2J6T A;  3RGZ A;  4ED7 A;  1OXS C;  1I3Q H;  2R92 G;  1CQI B;  2VQF Q;  3DF7 A;  5GON F;  3PUY A;  2FP4 B;  4LFA Q;  2RGV A;  3RB0 A;  3J81 c;  1KJ8 A;  2XWJ B;  2IMW P;  2PNR C;  1SJH D;  1H95 A;  4B3R Q;  1V1O A;  3QG1 A;  2B63 A;  1TY2 A;  1SYX B;  1VQC A;  1PFN A;  3NHH A;  5LMN L;  3J81 W;  2JEA I;  5KEE A;  1C7Y A;  1J6Q A;  4WRD A;  3M4O H;  1HXY D;  1EY6 A;  2PQA A;  4TQR A;  4C3I H;  1X9N A;  1X3E A;  3GV6 A;  1VQN A;  3AEV A;  1PH3 A;  2CQY A;  2YZM A;  1L2Z A;  1JWM D;  5LMN Q;  3VYU A;  3OW2 A;  1TWA H;  2R7Z G;  2PCF B;  2V9W A;  5KKN B;  2D9U A;  3E6Z X;  4TVA B;  3GTP H;  5IP7 G;  1ESR A;  2WV6 D;  2JYO A;  3HOV G;  2IJ0 A;  4YY3 H;  5FLX E;  4BY7 H;  4G3I A;  1C8C A;  5BMV F;  3V6H A;  3EPI A;  5KT2 A;  4RZR A;  3N43 B;  5LHY 1;  3J7A F;  4F50 A;  2V58 A;  4H0L C;  3NEN A;  2QA4 A;  4R8U B;  4PNY A;  4A3B B;  3OIP A;  1TWF B;  1CSQ A;  3K5I A;  2F0L A;  4DR1 Q;  4DR3 L;  1DGS A;  3NUC A;  4CJ2 C;  2L4N A;  5GAH C;  1N36 H;  1EWI A;  2K04 A;  4LUV A;  2WB1 G;  5KFF A;  3U4Z A;  3FKI G;  5CB4 F;  4OXP A;  3CRK C;  3MWY W;  2YS6 A;  5D1O A;  2VQD A;  3K5H A;  3STB C;  5C44 G;  4MV8 A;  5KG7 A;  3ULJ A;  2K5D A;  1PZI D;  1NR4 A;  4DK0 A;  1KDC A;  1WTV A;  5IYC G;  3M9M B;  3MR2 A;  4YCW A;  1EYG A;  1A6X A;  3NTI A;  4O2A F;  1Q12 A;  4RHS A;  1EUJ A;  3UDF A;  1LTB D;  1EIG A;  4QUF A;  4NXN L;  4LF8 L;  3ORR A;  3K7U C;  3KF6 B;  4RAZ A;  5L1K A;  4N9P A;  3SK4 A;  4RKB A;  5C4J B;  2OTL A;  2FJ2 A;  4JI8 Q;  1HFN A;  2R8I A;  4YBZ B;  3HOX H;  4JI3 Q;  1D7Q A;  1EFW A;  3FDS A;  3V05 A;  3GIJ A;  2LFN A;  1SNO A;  4HED A;  5C3W A;  3BZC A;  1K0S A;  1HA6 A;  1ZQ7 A;  5KG4 A;  5DLF A;  1CTM A;  2TSS A;  4P72 A;  5IY0 A;  1VBG A;  3GV7 B;  1S4Z A;  2PO4 A;  3LGJ A;  1Q3L A;  3TP6 A;  1CSP A;  2A69 D;  3T1Y Q;  1VQH A;  4RB0 A;  5BR8 H;  1YEZ A;  1SNC A;  3NXW A;  1D2B A;  2KSW A;  2XD4 A;  3S1Q B;  3PW4 A;  2VUM A;  1LTA D;  1Q7Y C;  3CCR A;  4DNR B;  4DXG A;  1TS2 A;  4JW0 A;  5I9O A;  1PTO H;  4IR9 A;  5D14 A;  1RK5 A;  4O2B F;  3LX0 A;  1YJW A;  2JA6 G;  1K8M A;  3AB9 A;  3KDF A;  2YL2 A;  1O7Y A;  2XRS D;  4BWS C;  3S24 A;  2O2L D;  1ZXT A;  3IAY A;  4IUV A;  2X0S A;  1Z7T A;  2E2H B;  2ZXR A;  3HKZ G;  3I4N G;  4O0A A;  1VMP A;  5C4J H;  5KG3 A;  3QB3 A;  4OO1 I;  4B3T H;  1HRJ A;  3RLN A;  1H9S B;  5M3M G;  4LWC A;  1HZ9 A;  5FPR A;  2HUG A;  2V4D A;  4LFB Q;  1B44 D;  2R84 A;  2O4X A;  4C5C A; 
#chains in the Genus database with same CATH homology
 1U5K A;  4B3S Q;  2WFW A;  1VQF A;  1WCM H;  3FHW A;  1VQ6 A;  1VQD A;  2A1A A;  1SRU A;  3UDI A;  1KIX A;  1GM5 A;  4C3J H;  4DR1 L;  4DR3 Q;  4A3E G;  4DAY B;  1R9T H;  4UP8 A;  4LUZ A;  1N34 L;  4JI1 Q;  3CMA A;  2IX1 A;  2UUC Q;  4DV0 L;  1UE1 A;  4DV1 L;  1CUK A;  4GNX B;  4A3K H;  2F4V L;  3SGI A;  4B3S L;  3CCU A;  4A3D G;  1L2F A;  1MJC A;  1Z9F A;  2I5M X;  3ULP A;  4JI6 Q;  4UY8 C;  2JA7 G;  3TRZ A;  3CQZ H;  2N78 A;  2UU9 Q;  5JJK A;  1GVP A;  4DV4 L;  1K73 C;  1PV4 A;  3KLW A;  4A3K G;  4DUZ L;  3CCM A;  1VQO A;  4L5Q A;  3S2H H;  2MQH A;  5JEA J;  4LF7 Q;  2R7Z H;  4GNX C;  2H5X A;  3I7F A;  1JJC B;  4TQU S;  1N34 Q;  3RR5 A;  2OWO A;  4R4O A;  3GTO H;  5IWA Q;  1YJ9 A;  4A3C G;  4DV5 Q;  3IRB A;  1PH2 A;  2UXB L;  3KOJ A;  1XPO A;  4YHH L;  3J81 i;  3KJO A;  4DR6 L;  2YTX A;  1VQI A;  4DR2 L;  3J80 c;  2UU9 L;  4JI7 Q;  4DV4 Q;  5C4X G;  5ELO A;  4JCV E;  2WB1 E;  4JI6 L;  4LF8 Q;  2UUA L;  1MJE A;  5GRO A;  4JI8 L;  1KRS A;  4NB3 A;  1NBW A;  4QJF A;  1VQL A;  3D0F A;  3NBH B;  1K3R A;  2KCT A;  4A3F H;  4JG2 A;  4JI7 L;  3ICE A;  4DV2 Q;  3VDY A;  2BH8 A;  4GN4 B;  3U58 A;  1ASY A;  4A93 G;  4DV5 L;  1I5F A;  4R4I A;  1D8L A;  3CAM A;  1GO3 E;  1BKB A;  1HZB A;  2L15 A;  2AHO B;  1AE2 A;  4BXX G;  4A93 H;  4IFD I;  3U50 C;  1C9O A;  3W5O A;  4DV6 Q;  4GN3 B;  1Y1W G;  2R92 H;  2JA7 H;  3H3V I;  1I94 L;  2VY3 A;  4C3H H;  5C4X H;  2K75 A;  4DK6 C;  5GQO A;  3MXN B;  4JI5 L;  3RLF A;  2VQE Q;  4JYA Q;  4IPH A;  1KQS A;  2R93 H;  3UE0 A;  3S2D H;  1WFQ A;  1AH9 A;  1HZA A;  2I5L X;  4JI4 L;  2Z6K A;  3CCQ A;  1A63 A;  4OX9 L;  1FVI A;  1QUQ A;  2BA0 A;  2Z0S A;  4IOA A;  2NVT H;  1PVO A;  1BBW A;  1PH9 A;  2MNA A;  4X66 L;  1NMF A;  1T9H A;  2N8N A;  4B3M Q;  3CME A;  1YJN A;  2ASB A;  1KXL A;  1VQP A;  3AFQ A;  1WOC A;  2D62 A;  5GAD C;  3K80 C;  4IPG A;  1JB7 A;  4BXX H;  1VQM A;  5FJ8 H;  2K5N A;  4JOI C;  5IP9 H;  5LMN W;  4KHP Q;  1B70 B;  1LUZ A;  2ZJR A;  1VQK A;  3H3V H;  1QZG A;  4DR4 L;  4JV5 L;  2WAQ G;  3I4O A;  1WI5 A;  2GVB A;  5JJL A;  2KHJ A;  4UPA A;  3ZJY C;  1HJP A;  3HFZ B;  4HJ8 A;  3PF5 A;  2ZM6 L;  4L5S A;  2AWO A;  2E5L L;  1Q81 C;  3H15 A;  3HOW H;  3K81 C;  1WCM G;  3HOY H;  4GKJ Q;  2XTI A;  1OXU A;  4LUO A;  2HQL A;  1P8L A;  1FL0 A;  2PNH A;  4R4C A;  1CKN B;  3OYY A;  3B6Y A;  4C2M H;  3CD6 A;  4OO1 G;  3E9H A;  3ERS X;  3PUW A;  4HJA A;  1HH2 P;  2I0Q A;  4GOP A;  2R93 G;  3GTG H;  1IZ6 A;  2E2I H;  1KHI A;  3G48 A;  3GTJ H;  2OTJ A;  4Y52 H;  4RG1 A;  3G71 A;  4A3L G;  1K8G A;  2NN6 G;  3H0G G;  4EX5 A;  1WYD A;  4H02 A;  2MO0 A;  1LM0 A;  4KLK A;  1KD1 C;  3HOU H;  3PV0 A;  1NE3 A;  4HIO A;  1B7Y B;  2VNU D;  1Q82 C;  2K5H A;  4LW1 A;  3PUV A;  5C44 H;  3GTL H;  5C3E H;  3PO2 H;  3FP9 A;  3T1H L;  1VQ8 A;  1NTG A;  3NEM A;  1YIT A;  1SN8 A;  1S40 A;  2FXQ A;  1NMG A;  1Y14 B;  5M5X H;  3CC4 A;  1GKH A;  1UE6 A;  1XTD A;  3TQY A;  2ID0 A;  1TXY A;  1X54 A;  3F2D A;  2YTV A;  3F2B A;  4A3B G;  1VQ7 A;  4YCV A;  1XNR L;  3I4M H;  2E8G A;  2CFM A;  4IPC A;  3I4M G;  1PYB A;  1Z47 A;  1OXT A;  2ZJP A;  1PH1 A;  1ASZ A;  3S1Q H;  4A3G G;  1HNW L;  2AMC B;  5K36 G;  3CPF A;  1YHA A;  2Z6K C;  2VQE L;  4JYA L;  3U4V A;  2OCE A;  1SR3 A;  5IYC H;  3RNU A;  2B29 A;  4GLA C;  1E7Z A;  1P16 A;  1QUQ B;  1JE5 A;  4DPG A;  4MZ9 A;  3S14 H;  3I56 A;  3CP0 A;  4R1J A;  1TWF H;  4JBM A;  3PO2 G;  4YWM A;  1HNW Q;  1A62 A;  1QVC A;  4X66 Q;  1L1O A;  3T1Y L;  2KBN A;  5JEA G;  1C0A A;  2KHI A;  4QY7 A;  4O2D A;  3A5Z B;  4X65 L;  2JE6 I;  1HR0 Q;  2NVX H;  3M85 A;  3PF4 A;  2Q2I A;  4QGU A;  3Q8D A;  1PFS A;  4DAM A;  4GLX A;  4QL5 A;  3CF5 A;  1PH8 A;  1AE3 A;  2Y0S G;  2VZA A;  4PMW A;  4AYB E;  1HNZ L;  3I4N H;  2CQO A;  4KHP L;  2N3S A;  4L5T A;  4A3J H;  4YY3 L;  1N36 Q;  5AJ3 L;  3KJP A;  3HOZ H;  5IT9 c;  2NZH A;  5LMU L;  4OON A;  2ZTC A;  3D31 A;  4BBR G;  1IXR A;  1HR0 L;  1S72 A;  2IY5 B;  2ATW A;  2CWA A;  2Q2H A;  2R7F A;  3J80 i;  3JAM c;  3M3Y H;  3CCE A;  5IYB H;  2EQS A;  2ZM6 Q;  1N33 L;  2ZTD A;  3BJU A;  4OWW B;  1FGU A;  2CKZ B;  4P75 A;  3JAM i;  2ZTE A;  4L5R C;  4X62 L;  2OQ0 A;  5AJ3 Q;  1HNZ Q;  2HT1 A;  2NVY H;  4DR7 L;  5LMU Q;  4Y7N H;  1N32 L;  1CKN A;  4DUY L;  1SMX A;  3F8T A;  4UP7 A;  5M5Y H;  1VQB A;  5M3M H;  2E2J H;  3L7Z C;  4A3I H;  3S1M H;  3PSI A;  1JJG A;  2K5V A;  1EQQ A;  1EIY B;  4GOP B;  1J5E L;  3J7A 5;  4MTN A;  2VUM G;  1UWV A;  1V43 A;  2BA1 A;  4X64 Q;  4A76 A;  2F4V Q;  4UP9 A;  3E0E A;  2Q2U A;  3CCL A;  3OTO L;  4AH6 A;  4DV0 Q;  3G6E A;  2PI2 A;  4GOP C;  4A4I A;  4GLV B;  1PHJ A;  3RN2 A;  1B8A A;  2YV5 A;  3PGZ A;  1FJG L;  5J3B A;  2K52 A;  5HGQ A;  5M5W H;  4K0K L;  2F3I A;  3PO3 H;  1UE5 A;  4DUZ Q;  4X64 L;  1KC8 C;  1YHB A;  2AKW B;  3T1H Q;  3NEL A;  1G51 A;  2B63 G;  1K8A C;  3TS2 A;  2RF4 A;  1Q46 A;  4A3M G;  1K83 H;  1G29 1;  5M3F H;  1OXX K;  3L0O A;  3UDX A;  4A3J G;  2XGT A;  2AWN A;  5GAG C;  4BY1 H;  3HOZ G;  2R7D A;  2LXK A;  1W2B A;  1UE7 A;  1VCI A;  3A5U A;  1M1K C;  1PA6 A;  3M9B A;  4A3F G;  1K0R A;  1VQJ A;  4LFA L;  1RIP A;  1KRT A;  2VUM H;  3CW2 C;  2A19 A;  3K7A H;  3ER0 A;  4HJ7 A;  3RN5 A;  3W1G A;  2KEN A;  1CKO A;  4NXM Q;  1V1Q A;  1S3O A;  1X6O A;  1IBK Q;  1N9W A;  1M90 C;  1XPU A;  1MKH A;  2PMZ E;  4DV7 Q;  1JJ2 A;  1A0I A;  3G4S A;  1N8R C;  2UUB Q;  1E1O A;  1VQ9 A;  3CC2 A;  4LF9 Q;  5M3F G;  4A3G H;  4LF4 L;  4DV6 L;  1L1O B;  1YIJ A;  2R6G A;  1Q1B A;  2UXD Q;  3HOU G;  2JQO A;  1YBY A;  1I50 H;  2MFI A;  1Y1V H;  4BBS H;  1A8V A;  1L1O C;  5IYD G;  1YI2 A;  4LF6 Q;  1NJI C;  1XMO Q;  4JBJ A;  4LF5 L;  3DLL A;  1L0W A;  3CCS A;  1VS0 A;  4JI5 Q;  2D0O A;  4LNQ A;  3AFP A;  3CXC A;  4GN5 A;  2PI2 E;  2MO1 A;  4J15 A;  1SFO H;  4XTC S;  5C0X J;  4R4T A;  1IL2 A;  1PYS B;  2UXC L;  3J7Z C;  3BU2 A;  1XMQ L;  1YVC A;  4B3M L;  3STB D;  1HNX L;  1N33 Q;  1KAW A;  2YTY A;  3UE1 A;  1O7I A;  3K8A A;  4DNI A;  1K9M C;  1LTL A;  5FLM H;  4OWT B;  2ZJQ A;  2N49 A;  1XMO L;  2LXJ A;  4DR7 Q;  5IYD H;  1VQG A;  2IT1 A;  1CKM A;  1X55 A;  2RHQ B;  3M4P A;  3FKI H;  3HOX G;  4IPD A;  2K4K A;  1PH4 A;  3I2Z A;  4RMF A;  2JJQ A;  4JC0 A;  5BR8 L;  4AQY Q;  4HID A;  1QVG A;  4LF7 L;  1J5E Q;  2QGQ A;  3RZD H;  4IOC A;  1XMQ Q;  4QIW E;  1IBL L;  2IX0 A;  4GKJ L;  2HHH Q;  4DR6 Q;  5GAE C;  2E2H H;  2C35 B;  5IWA L;  4JI0 L;  3EIV A;  2RHS B;  4P71 A;  4YWL A;  2B3G A;  3TRE A;  4YHH Q;  5BR8 Q;  4HIM A;  4AQY L;  1Q86 C;  3S16 H;  4DR2 Q;  1X65 A;  1RL2 A;  1XNQ L;  1VQE A;  2F52 A;  2I5H A;  2NZO A;  3CCJ A;  1W3S A;  4DV3 Q;  1EOV A;  1Y1V G;  4BBS G;  3RLO A;  4JI2 L;  1IYJ B;  1IBL Q;  4BY1 G;  2JEB I;  2VS1 A;  3PUZ A;  2GVA A;  4PZ7 A;  5IP7 H;  1SRO A;  3CCV A;  2BH2 A;  4IJH A;  4BBR H;  4QQB X;  2Y0S E;  4MNO A;  4NPS A;  4AYB G;  1PH5 A;  2K50 A;  5FLX c;  4NXN Q;  4XIG S;  1OXS C;  1I3Q H;  3F2C A;  3PO3 G;  2R92 G;  2VQF Q;  2DGY A;  3HKS A;  1PH6 A;  3PUY A;  4LFA Q;  2YYZ A;  4YWK A;  3J81 c;  2DUD A;  1KL9 A;  3TEH B;  1GD7 A;  4JI3 L;  2PQA B;  3BZK A;  1H95 A;  4DR5 L;  2UXB Q;  3E9I A;  4B3R Q;  4DV7 L;  4HJ5 A;  3GTK H;  3F1Z A;  2CCZ A;  2VQF L;  3J81 j;  4JOI A;  3M4Q A;  4HIK A;  4P74 A;  1Y1W H;  2EXD A;  1VQC A;  5E7N A;  5LMN L;  3HOW G;  2JEA I;  1C7Y A;  3KYH C;  1J6Q A;  3M4O H;  1X56 A;  1VQA A;  1XNR Q;  4B3R L;  2PQA A;  4LF5 Q;  1G6P A;  4ME3 A;  3AQQ A;  2NVQ H;  4LF6 L;  3A74 A;  2VL6 A;  1X3E A;  4IJL A;  4C3I H;  1X9N A;  4HJ9 A;  1PH3 A;  1VQN A;  4A3I G;  3AEV A;  3S1N H;  5H1S E;  3KDF B;  5LMN Q;  2EIF A;  3OW2 A;  1TWA H;  2R7Z G;  1JT8 A;  1JMC A;  5FLM G;  4TVA B;  3GTP H;  5IP7 G;  4WJ4 A;  4LFC Q;  3ULL A;  3S17 H;  2HIX A;  1E24 A;  3HOV G;  4A75 A;  1YHQ A;  1PH7 A;  4B3T L;  4BY7 H;  2GN5 A;  4JBW A;  4R4Q A;  5IP9 G;  2VW9 A;  4X65 Q;  3W1B A;  3GD7 A;  4PZ8 A;  3EBE A;  2E5L Q;  3M7N A;  4IFD G;  2JA5 H;  3AYH B;  1NY4 A;  3NEN A;  2QA4 A;  1VQ4 A;  4APV A;  3PIP A;  2D0P A;  1FJG Q;  4LFB L;  4X6A H;  4YCU A;  5IYB G;  1CSQ A;  4PG3 A;  1VQ5 A;  4DR1 Q;  4YY3 Q;  4DR3 L;  1N36 L;  2A8V A;  1DGS A;  3S1R H;  1YNX A;  5GAH C;  3GO5 A;  3HOY G;  4JI0 Q;  1HZC A;  1EWI A;  4LUV A;  5IE8 A;  2WB1 G;  4KHZ A;  1SE8 A;  3FKI G;  2V1C C;  3U4Z A;  3GDE A;  4OXP A;  1IBM L;  1X3G A;  2IHF A;  2HHH L;  2UUC L;  3STB C;  5C44 G;  4DUY Q;  3KF6 A;  4BY7 G;  4FDB A;  3ULJ A;  3A0J A;  2NN6 I;  3PCO B;  1XNQ Q;  4X62 Q;  3HOV H;  1E1T A;  1TWH H;  4KI0 A;  5IYC G;  4JI2 Q;  3CPW A;  2WP8 J;  1QZH A;  4POG A;  4DV3 L;  1I6H H;  4IFD J;  1EQR A;  2WAQ E;  4YCW A;  1EYG A;  4JV5 Q;  4A3L H;  3OTO Q;  1UEB A;  4OWX B;  1E22 A;  1XPR A;  1Q12 A;  2JK8 A;  1EUJ A;  3UDF A;  1IBM Q;  1WJJ A;  4NXN L;  5C3E G;  3RZO H;  4LF8 L;  2JA8 H;  3K7U C;  3KF6 B;  2UUB L;  2CWP A;  3UDG A;  4GS3 A;  4P73 A;  2OTL A;  4JI8 Q;  5ELN A;  4EQ5 A;  3GTM H;  3PIO A;  4A3C H;  4K0K Q;  3MEF A;  5EAY A;  2UUA Q;  3HOX H;  2JA5 G;  4JI3 Q;  1D7Q A;  1BBU A;  2ALY B;  1EFW A;  1Q1E A;  4DR5 Q;  2LSS A;  4A3B H;  3BZC A;  4POF A;  2K14 A;  1QVF A;  3EN2 A;  3DM3 A;  4P72 A;  1EIF A;  2JA9 A;  1TWG H;  5IY0 A;  4GKK L;  1XJV A;  4DV2 L;  2ES2 A;  3PUX A;  1U0L A;  3LGJ A;  5C0X I;  2QEX A;  4A3D H;  3CC7 A;  1CSP A;  3T1Y Q;  4DR4 Q;  1VQH A;  4A3M H;  2UXC Q;  1YEZ A;  2JA6 H;  4WJ3 M;  1X3F A;  2RCN A;  3HKZ E;  2B63 H;  4IO9 A;  1Q7Y C;  3H0G H;  3CCR A;  1HNX Q;  4DKA C;  2JA8 G;  3KFU A;  5JJI A;  2HIV A;  4JBK A;  4A3E H;  1HR0 W;  1OTC A;  1IBK L;  4GKK Q;  1I94 Q;  4PZ6 A;  3WWV A;  1SLJ A;  2OQK A;  3K0X A;  5C0X G;  4AIM A;  1YJW A;  4NXM L;  2JA6 G;  3KDF A;  4ALP A;  3TS0 A;  1OXV A;  4OX9 Q;  1BVS A;  5FJ8 G;  4LF4 Q;  4JI4 Q;  1LYL A;  3S24 A;  3S15 H;  4LF9 L;  4BA2 I;  5DLQ E;  3HKZ G;  3I4N G;  4O0A A;  4LFC L;  5C4J H;  1MIU A;  1V9P A;  2Q2T A;  2YU9 H;  3L2P A;  2UXD L;  4DV1 Q;  4B3T Q;  4OO1 I;  2IHE A;  1YZ6 A;  3JC6 6;  5HY6 A;  3KF8 B;  4LWC A;  1HZ9 A;  4JI1 L;  3RLN A;  4BA1 I;  5M3M G;  4GNX A;  2KCM A;  4LFB Q;  1E3P A;  1TWC H;  3GTQ H;  3I55 A;  1N32 Q;  1Q8K A;  4DK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...