4BY7G

Elongating rna polymerase ii-bye1 tld complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by7G01
1QZHA 4A3LH 2WB1E 4JI7L 2Y0SE 4MNOA 3J80i 3J7ZC 4LF5Q 1Q1EA 1IBKL 2Z6KC 2VQEQ 1Q7YC 3I2ZA 4DV6L 4DUYQ 3M7NA 4Y52H 1CKOA 2ZTEA 3OYYA 4JI7Q 3GTMH 1JJCB 1IBKQ 5C4XH 4LW1A 4QGUA 2ATWA 4ME3A 2I5MX 4LWCA 5M3FH 1HR0Q 4PG3A 3MXNB 4DKAC 3AQQA 5C0XI 3A5ZB 1FVIA 4A76A 1OTCA 3GTGH 3TRZA 4A3CH 3SGIA 4A3KG 1HH2P 4OO1I 1SLJA 1G51A 5DLQE 4BY1G 2ZTDA 1UWVA 1VQGA 2JK8A 1X3FA 4DNIA 3CC7A 1WI5A 3D31A 4A93H 1SMXA 3K80C 4X62L 2RHQB 4AIMA 3J81i 1E22A 1Q82C 4OWXB 5J3BA 2DUDA 3PSIA 1QVFA 1BBUA 2LXKA 2UXCL 3E9IA 3ERSX 3KYHC 4YY3L 1K73C 3I4MH 1X3GA 4POFA 5AJ3L 3KF6A 3KFUA 4B3TL 4X62Q 1K3RA 2YU9H 1CKMA 1SRUA 2BA1A 2MO0A 2R92H 2CFMA 4KI0A 5GROA 1SE8A 5M5WH 2UXCQ 5ELOA 3B6YA 3FHWA 3GTLH 4HJ8A 4YY3Q 2JA5G 1TXYA 5AJ3Q 1L2FA 3NBHB 2K50A 1E24A 1FGUA 4B3TQ 4QIWE 3I4NG 4DR7L 3ULJA 1VQKA 4LF7L 5FJ8G 3KLWA 3HOWG 2ALYB 1PH2A 4A4IA 3OTOL 4GN4B 2VUMG 3HOZH 4OX9L 3M9BA 3JAMi 1VQJA 3I4OA 3H0GH 1VQEA 5LMNW 3NENA 4AQYQ 1EIFA 4JI6L 5JJIA 3BJUA 3NELA 3G71A 3J81j 1I5FA 1U0LA 2KHJA 3BU2A 4A75A 4DR4L 4GN5A 3CCEA 3RR5A 5C44G 4NPSA 1J6QA 3TREA 4JI6Q 4HIOA 3PCOB 3RLOA 2B3GA 1XMOL 2DGYA 3GTJH 4JI2L 1K8GA 3K7UC 4GNXB 4A3GG 3A74A 4X6AH 2GVAA 1VQFA 3CP0A 2CCZA 3CMAA 1SN8A 1GO3E 2EQSA 2KCMA 3E0EA 4P72A 1JJ2A 1XMOQ 1C7YA 4JI2Q 2JQOA 1YI2A 2OQ0A 3CCJA 4DV2L 3RN2A 2HT1A 1KD1C 3L7ZC 4IPDA 4TQUS 2NVTH 3K7AH 2AKWB 2A1AA 1CUKA 1O7IA 1L1OB 2IHEA 4BY1H 4GKKL 1JJGA 1P16A 1Z9FA 4DV2Q 1KIXA 4IJLA 4TVAB 5FLXc 4KHZA 2UXBL 3AYHB 2KHIA 4DR2Q 4DR3L 4LNQA 4GKKQ 3TEHB 5EAYA 3CMEA 1FL0A 4AYBE 4R4IA 1PH9A 5C4XG 4BA2I 3TQYA 1G6PA 4KLKA 2QEXA 5M3FG 3PUVA 2Z0SA 2OWOA 3S17H 3G48A 3HKZG 1L1OA 2WAQE 3UE0A 4HIDA 4DR3Q 2JA5H 1BKBA 1VCIA 3I55A 4A3CG 1Z47A 4NXML 3U4VA 3GTQH 3W1BA 1HNXL 1X55A 4POGA 1WCMG 1XPRA 1W3SA 1WYDA 1XPUA 5FJ8H 3HOWH 3F1ZA 1HJPA 4IPHA 3PIPA 4UPAA 4PZ6A 1VQ7A 4NXMQ 3S15H 4DK6C 4A3IG 1R9TH 1IBML 3TS0A 1FJGL 4OXPA 4DAYB 3I4MG 4R4CA 2AWNA 5IP9H 3F2CA 1VQMA 1VQ9A 1VQOA 1NMGA 5C44H 1YZ6A 4OWTB 4LF4L 1FJGQ 3J7A5 3UDGA 1Q46A 1HNZL 1E3PA 1HZBA 1NE3A 5HY6A 5IYDH 2EIFA 3W1GA 1K9MC 2NN6G 4A3GH 4P73A 2Q2IA 1ASYA 4JYAL 1K83H 2FXQA 3ICEA 3PGZA 1UE6A 1HNZQ 3HOZG 3HOYH 1Q8KA 3HOVH 4GNXC 4GS3A 2B63G 1XNQL 4JYAQ 3M4OH 3Q8DA 3H15A 5JEAG 4X65L 2JA9A 4DV7Q 2ASBA 3PO2G 1NBWA 1U5KA 4PMWA 3CF5A 4ALPA 1PH3A 4RMFA 3VDYA 1VQLA 2RHSB 1YHAA 3BZKA 2UXDL 2V1CC 2XGTA 5IE8A 2LSSA 1HR0L 1XNQQ 3S24A 1I3QH 2JE6I 1MJEA 3S2DH 1OXVA 3UE1A 2PMZE 2VS1A 1L1OC 4X65Q 3A5UA 2R6GA 1E1TA 1A8VA 3E9HA 1C0AA 1CKNA 3ULPA 2UXDQ 5M5YH 2ZTCA 3M85A 2CQOA 3STBD 3GD7A 1S40A 4GLVB 4IOAA 2WFWA 1AE2A 1OXTA 1WCMH 3KF6B 1H95A 1AE3A 3W5OA 2JA8H 4RG1A 4UP8A 2HIVA 1RIPA 1I6HH 1WOCA 1VQIA 1Q86C 1MIUA 2QGQA 1LTLA 4A3IH 2OCEA 4A3JH 3HOXH 3IRBA 1A62A 2IHFA 3UDFA 3CPWA 2R7FA 4L5TA 3CXCA 1VQ5A 3T1HL 4JOIA 1N9WA 5IP7H 2KBNA 2ZJQA 5H1SE 2D0PA 1TWAH 3ULLA 2JEAI 1X3EA 3K81C 3JAMc 1VQPA 2K14A 2YYZA 4BXXH 1N32L 1HZCA 1CSQA 3EBEA 1VQAA 3T1HQ 1EFWA 4B3RL 2RCNA 4JBJA 1ASZA 2KENA 2A8VA 1EOVA 1N32Q 4AQYL 4JI3L 2CWPA 3PUYA 4B3RQ 1LM0A 3JC66 4IO9A 1YJWA 1W2BA 4B3ML 2B63H 2E2JH 1NMFA 1PH5A 3I7FA 1HNWL 1K8AC 2E5LQ 4JI3Q 3PO2H 5C0XJ 4DV0Q 5IP9G 1Q1BA 3CCMA 1IXRA 1P8LA 1QVCA 2Y0SG 4QL5A 2YTXA 1V1QA 3HFZB 3HKZE 4J15A 4DPGA 4A3FG 1S72A 1N34Q 2Q2UA 4B3MQ 2NVQH 3EN2A 1HNWQ 4LFAQ 4XIGS 4P71A 2JA7G 4A3BG 5IYDG 2D62A 1V43A 2CWAA 2H5XA 2PI2E 1EUJA 4DR5L 2R7ZG 1XNRL 4HJ7A 3HOYG 5ELNA 4K0KL 3CD6A 3RNUA 3HOVG 2OTJA 2NN6I 1GD7A 1UE1A 5LMNL 2MQHA 4DR5Q 1X9NA 4DR2L 3NEMA 1XNRQ 4NXNL 4WJ3M 2UU9Q 1A63A 4L5QA 3PIOA 4K0KQ 1QUQB 1KRTA 4JOIC 4DV3L 2F3IA 3AFQA 2UUBL 1PH7A 1NTGA 4QQBX 3PO3H 1Y14B 3F8TA 4YHHL 3GO5A 4JCVE 5LMNQ 5IY0A 3CCLA 1OXSC 1N36L 3RLFA 5GAHC 4C3HH 4NXNQ 4YWLA 5M3MH 4DV3Q 1NJIC 4IFDJ 5K36G 1XMQQ 2UUBQ 1Y1VG 1WJJA 4R4QA 4L5SA 4YHHQ 2JA6G 3M4QA 4DV1L 2YTYA 2YTVA 1N36Q 1QUQA 4LUZA 2N8NA 4QY7A 4AH6A 2IX1A 4YWKA 2HQLA 4JI8L 1NY4A 1YBYA 1BVSA 2K5NA 1YVCA 4YCWA 5GAGC 1MJCA 4C2MH 4LF8Q 3D0FA 4MZ9A 2JA8G 4DV1Q 1PV4A 1XJVA 2PI2A 4JI8Q 3RZOH 3T1YL 1Y1WH 1KL9A 4A3JG 3HOXG 1M90C 1YJ9A 4L5RC 4LFCL 4JI1L 4IPCA 4OWWB 1X65A 1IL2A 3S1NH 5IP7G 5IYCH 3T1YQ 3M4PA 1PH6A 4JI0L 4DV4L 2ZM6L 4UY8C 3CCRA 4A3FH 1PHJA 4LFCQ 2A19A 4BXXG 3PV0A 4JI1Q 1JB7A 3BZCA 4IFDG 2JA7H 4A3BH 4MTNA 4JI0Q 3J80c 2ID0A 4DV4Q 2ZM6Q 4HJAA 3HOUH 4KHPQ 4Y7NH 1X54A 1SR3A 2R7ZH 2C35B 3AFPA 4B3SQ 4DV7L 2K4KA 4DUZQ 1IYJB 2GVBA 5GQOA 3PUZA 1CKNB 1VQBA 2VZAA 2I0QA 2Q2HA 4O0AA 3RN5A 4JI5Q 1LYLA 2R7DA 1PH8A 1JT8A 1TWGH 2WP8J 1GVPA 1YITA 1HR0W 4YCVA 3LGJA 1DGSA 3STBC 1SFOH 3KF8B 1UEBA 3S1QH 2AWOA 1QVGA 3WWVA 2NZOA 3CAMA 4UP9A 1PH4A 4AYBG 4IJHA 1JMCA 4LFBL 1E7ZA 1TWHH 1WFQA 1Y1VH 2ZJRA 2JA6H 3J81c 4HIMA 3KOJA 3KDFB 4IPGA 4GLAC 4YCUA 2WAQG 5GAEC 5LMUL 2MNAA 1QZGA 1VQDA 3F2BA 1VQNA 4LFBQ 4X66Q 4HJ5A 2VY3A 5C3EH 5LMUQ 2F4VL 3MEFA 3HKSA 1VQCA 2K5VA 1JE5A 2NVYH 3U50C 1X56A 1A0IA 2GN5A 3CCUA 4GN3B 1EYGA 3PO3G 4HJ9A 3A0JA 2OQKA 3KDFA 4BY7G 1RL2A 2EXDA 2ZJPA 2F4VQ 5M3MG 3FKIG 4DV6Q 1T9HA 2OTLA 1YIJA 1C9OA 4JI4L 4BBRH 3ER0A 4A3MH 2BA0A 2HHHL 3DM3A 3GTKH 4BBSH 2E8GA 1XPOA 1TWCH 2AMCB 5FLMG 1N8RC 4C3IH 2E2IH 4JI4Q 4DR1L 1KAWA 1KRSA 2XTIA 2E5LL 1GM5A 4XTCS 4DV0L 1UE5A 4LF6L 1EQRA 2HHHQ 4A3DG 1KQSA 3F2DA 1Y1WG 4EQ5A 1N34L 2N78A 4BA1I 2I5HA 5HGQA 4DR1Q 1MKHA 3G6EA 4LFAL 4A3EG 4LF6Q 1B8AA 1LUZA 1UE7A 2WB1G 5M5XH 2B29A 1VS0A 3UDIA 4APVA 2PQAB 4DAMA 3CQZH 1VQ8A 1D8LA 3EIVA 4EX5A 3S14H 2I5LX 5C4JH 5JJKA 3K8AA 2D0OA 3PUWA 1YEZA 5E7NA 2L15A 4P74A 3HOUG 1EIYB 3TS2A 2K5HA 1IZ6A 4PZ8A 2UUAL 5JJLA 3CPFA 3U58A 3CC4A 4X64L 2NVXH 2UU9L 4IFDI 4LF9L 2PQAA 4PZ7A 2N49A 3H3VH 1HZAA 4DV5L 2N3SA 1B70B 4LF7Q 4DR7Q 2UUAQ 4IOCA 3S1MH 3OTOQ 4GKJL 4X64Q 2VQFL 4GLXA 4LF9Q 3PF5A 4OX9Q 1IBLL 2JEBI 4DV5Q 1VQ4A 1K0RA 4GOPB 1XMQL 2AHOB 3CW2C 3L2PA 5C0XG 3U4ZA 1J5EL 3L0OA 4GKJQ 3UDXA 1CSPA 2VQFQ 2PNHA 1HZ9A 4C3JH 4BY7H 1AH9A 4DR4Q 3K0XA 3FKIH 1I50H 1IBLQ 4QJFA 4OONA 5BR8L 2NZHA 3GTPH 4OO1G 3S1RH 1PYSB 2KCTA 4LF8L 1J5EQ 1PFSA 3KJPA 1I94L 5IYBG 4A3KH 3PF4A 3FP9A 5BR8Q 4GOPA 2Q2TA 3M3YH 4DR6L 2R93G 4JBMA 5IYCG 1YHBA 5FLMH 5IWAL 1Q81C 4JBKA 3CC2A 4A3LG 1GKHA 4JC0A 5C3EG 1OXUA 1V9PA 1XTDA 4JG2A 1I94Q 3GTOH 4GNXA 3H3VI 3ZJYC 4H02A 3AEVA 4A3DH 4DR6Q 1TWFH 1PA6A 4LUVA 5IWAQ 3DLLA 4UP7A 2QA4A 5GADC 2F52A 2IT1A 1VQHA 2LXJA 2YV5A 1Q12A 2Z6KA 3CCQA 3OW2A 2MO1A 4A3EH 4JV5L 1PVOA 2UXBQ 1B7YB 2K75A 1EQQA 4KHPL 1VQ6A 1BBWA 1KXLA 1M1KC 1X6OA 2HIXA 3CCSA 2UUCL 4B3SL 1G291 4DUZL 4JV5Q 4BBRG 5IT9c 4A3MG 2BH2A 4NB3A 3I4NH 2E2HH 4BBSG 4YWMA 2VL6A 4JI5L 2CKZB 3RZDH 2VUMH 2BH8A 1L0WA 5JEAJ 2UUCQ 2IX0A 2K52A 1HNXQ 3S16H 4A93G 1D7QA 4FDBA 3GDEA 2MFIA 1N33L 1YNXA 3I56A 2RF4A 2IY5B 1IBMQ 2R92G 1SROA 3CCVA 2JJQA 1OXXK 1E1OA 1N33Q 1YJNA 1PH1A 4LUOA 2VNUD 1PYBA 3G4SA 3PUXA 4R4OA 4GOPC 4O2DA 4R1JA 4P75A 4LF4Q 1KHIA 3S2HH 4WJ4A 4X66L 2ES2A 4LF5L 1EWIA 4DK3C 4R4TA 5IYBH 1KC8C 2VQEL 4JBWA 4HIKA 4DUYL 2R93H 3H0GG 2VW9A 1YHQA 3KJOA 1S3OA 3RLNA
chains in the Genus database with same CATH superfamily
4A3LH 2WB1E 3HB9A 3Q8QB 1ENCA 2L9HA 1CZWA 4Q44A 1Q7YC 4Y52H 1K3BC 4O1NA 2ZTEA 2MP1A 2RBMA 5DG7A 4C3JG 3NTIA 1ILQA 1M8AA 2ATWA 4ME3A 1HR0Q 4LWCA 1SYCA 3F8NA 3EROA 3RZOB 1PRTC 5C0XI 1Y1WB 3A5ZB 3KBXA 4KKTA 1VAJA 1BNZA 4R8IA 3BDCA 1FR3A 3BG3A 3S1NB 4OO1I 1G51A 1WTWA 4KV6A 5DLQE 2ZTDA 1UWVA 2D9UA 1VQGA 2IPKD 4DNIA 1U4LA 1WI5A 4A93H 1SYDA 1SMXA 3LWBA 2NZ1D 2F1MA 1Q82C 5LYJF 2JA7B 4J9OA 5I6YA 2W8LA 4JI3H 4J9SA 1Y1WA 1TU2B 2EDGA 4O42A 3I4MH 1A3TA 4KD3A 4HEDA 1K73C 2R7ZB 4YAKB 3D6WA 2IBKA 2YU9H 4KI0A 1SE8A 3B6YA 3FHWA 3RD4A 3MWEA 4YY3Q 1F9RA 2AGPA 3RV4A 1TXYA 4P2CB 2ASDA 5AJ3Q 1A2UA 2K50A 4B3TQ 3I4NG 3I8ZA 4DR7L 1AN7A 1S4ZA 3BVGA 2CW0C 2ALYB 2Z4HA 2R7ZA 4O4HF 3S1QB 3K5LA 1C48A 4OX9L 3M9BA 2RQXA 4EYHB 1VQEA 3NENA 5JEAH 1PXUA 5JJIA 4CKCA 2DWCA 4A75A 3BU2A 1L0XB 2JA6B 4DR4L 5LMNH 1KDAA 3KLSX 3RR5A 2M00A 1STAA 3QOLA 2N88A 2DPJA 2JSOA 3TREA 4JI6Q 2R8HA 4CJ1B 2F0NA 2W9CA 2PNRC 2I46A 5J39A 2FLPA 3K7UC 5FOBB 1I6HB 4A3GG 5JVG3 1WSCA 2GVAA 2Z4IA 3CP0A 2CCZA 3CMAA 5LA6F 1C7YA 3NQTA 2JA6A 4JI2Q 3VA7A 3AU7A 2A69C 2NTSA 3GV7B 5E3FA 4F8MA 2A1AA 1QE6A 4I55F 4UAIA 1CUKA 4B9WA 2IHEA 5KGUA 1Z9FA 4FS2A 3RGZA 3AYHB 3U9OA 4U68A 5KFAA 4GKKQ 2FE3A 5EAYA 4AYBE 5IGGA 4C3IB 5C4XG 3R5XA 4J9KA 4F4WA 1AZQA 4LFCH 5M3FG 4G7OC 3J80E 3Q8RB 2OWOA 4HIDA 3UE0A 4DR3Q 4FXDA 1GHJA 1BKBA 1VCIA 4QUFA 3W1BA 3F2UA 1HNXL 1AN8A 1XPRA 5M5XB 1SNQA 4MV4A 1BQQT 2LMCB 3N43B 2R6FA 2BE5C 4JI5H 3TQ1A 1WTHA 2F4IA 5J1ZA 5BPFA 3RF2A 3GIKA 3X3MA 1VQ9A 4DGZA 1VQOA 1C3OA 4OGQC 5CAEB 4K2KA 4OWTB 1FJGQ 4FBUA 2F0MA 1IOVA 2Q8TA 4EGQA 4E4TA 4DL3A 5IYDH 3PR4A 3W1GA 2KVMA 2NN6G 2YS7A 4A3GH 4JYAL 1ASYA 3UQ8A 1K83H 2J6SA 1MSHA 1S0OA 1HNZQ 2KEEA 4TV8F 3KHRA 3HOVH 2W57A 2B63G 2EJMA 4Q0FA 1XNQL 3Q8DA 4X65L 2JA9A 3PO2G 1B9NA 4JV2A 3CF5A 1PH3A 3KK7A 3TN2A 2UVUA 2UXDL 2V1CC 4ID6A 5IE8A 1KTKA 3S2DH 5KNDA 1B3AA 5A2QE 5C1PA 4F50A 1E1TA 4FO2A 1A8VA 2C00A 3WO0A 2D5DA 3GTOB 2ZTCA 4ODGA 2FPPB 1TWFB 3EA6A 2W6PA 3TDQA 3WOEA 3BQ0A 2UVVA 5T1IA 2I07B 5E4XA 3BAAA 4IOAA 3D4RA 4FXKC 1OXTA 3FRPB 2MPMA 2F0PA 1BGWA 4UP8A 3R5HA 3NWSA 4YBZB 1VQIA 1WD0A 3K5NA 3GLKA 1LTLA 2BR0A 4KKSA 4K2LA 5JVDF 3UDFA 2IHFA 1TWFA 5KFGA 4O2AF 3FMCA 1KJ8A 1KNAA 2PVPA 1B9MA 3T1HL 3EYYA 1U9RA 2YRWA 4XX0B 1TWAH 5KT2A 3RBEA 2YYZA 4FP5D 4HQ6A 4HMIA 2W70A 1J8IA 1CSQA 4MV6A 4UCOA 2HD3A 1ASZA 2KENA 2NN6H 5KFIA 5DLGA 1PLFA 5NUCA 4TQSA 3RIZA 3SR1A 4DR7H 2XIWA 5A35A 3JC66 4WORA 2B63H 2J6UA 2DJGC 3RUZA 1NMFA 1PH5A 2XCPA 4OX9H 2G9HD 2A5HA 4JI3Q 3PO2H 3IN5A 1LTGD 5C0XJ 5D1OB 1E2VA 3TZUA 1P8LA 1L0YB 4J15A 2J4XA 4DPGA 2B2UA 4ED8A 3BDOA 4GKJH 3EN2A 4DR4H 1LT3D 1IBLH 2R93B 4A3BG 2A6ED 2EOTA 3C1EA 2HDLA 3Q1KA 1EUJA 4DR5L 2EZVA 1TIID 2AQ2B 2WINB 5ELNA 1S5BD 4EBCA 3T56B 3IAYA 3J7YW 5KYIA 2JEIA 1UE1A 3DHQA 5CV8A 2M05A 1I94H 1ILPA 2JEGA 2MQHA 2R93A 4EFEA 3NEMA 4EYIB 3LX0A 3NXWA 3H91A 3SE7A 2UUBL 1KEEA 4UHVA 5EPJA 1Y14B 1ICFB 5LMNQ 3J7AV 3CCLA 3FDTA 1QJOA 4RAYA 5K36G 3CHBD 4L5SA 4R4QA 5KFEA 1SMYD 3VYSA 4A93B 1EUDB 4JV5H 2WKCA 4QY7A 4A2BA 1UEAB 2HQLA 3I4MB 2ZDGA 1YVCA 3RMHA 3QFFA 5KT6A 1VMCA 2JA8G 1IW7C 2YU9B 1HNXH 4MV1A 1SE3A 3VYRA 2PI2A 4JI8Q 4J0MA 4A3JG 1FKAH 2B2UC 3HOXG 1M90C 4HSVA 4IPCA 1GJXA 2O2LD 3M9MB 2EE1A 5IP7G 4MTDA 3M4PA 2KEDA 3MFHA 4LFCQ 2WKDA 1SSOA 3PV0A 4BXXG 4JI1Q 4IURA 3BZCA 4JPBW 4A3BH 5H80A 4JI0Q 5EWFA 2D2CC 4HJAA 2WV6D 2PW5A 2UVWA 1SR3A 4PV1C 5CC4A 1RKNA 3DEOA 3AFPA 4FYDA 4NP5A 4IRCA 3NSWA 3PUZA 2V4DA 4C3JB 1CKNB 1VQBA 2C2RA 3R5FA 4LF5H 1KJJA 4JI5Q 1PH8A 1JT8A 4ECTA 4ZK9B 1HR0W 1SFOH 3GV6A 1UEBA 5C0XH 2UXDH 5ELFA 1GUGA 1JC7A 3PIP3 5C3XA 4MAMA 5K2MA 5EKLA 4UP9A 4AYBG 5K36H 4LFBL 1STEA 3MXUA 5T14A 1H9SB 3CU7A 5EDWA 4HMJA 2Q8RE 5JVH3 3ZYYX 1SYEA 3K5MA 3OWEB 4HJ5A 2EVBA 5IOCA 5LMUQ 2KOLA 1VQCA 3U50C 5IGDA 4Q0YA 3TZDA 4GN3B 2F0HA 2IX3A 1EYGA 1I4RA 3CRLC 4HJ9A 3PO3G 3I4NB 1VDZA 5KFMA 1H9SA 5I2YA 2EPBA 2H1EA 1B6RA 1T9HA 2EYPA 3A56A 2BQ3A 2W9AA 2HCCA 1BO0A 4FF3A 3L4KA 4JI4L 2R86A 4CBVA 4BBRH 3V96A 4ZCKA 4A3MH 3DM3A 4RH6A 2E8GA 4HTHA 2AMCB 4IWXA 2PCFB 4DR1L 1KAWA 1KRSA 2XTIA 4DV0L 1UE5A 1Y1WG 3LP8A 4UFZA 4O4LF 2N78A 2IMWP 4MA0A 2I5HA 1F77A 1S5ED 4A3GB 2OT2A 1WH2A 1RJRA 1LUZA 2F3WA 2QW7A 2FPGB 2PQAB 3BVZA 3CQZH 1JWUD 2Y0SA 1FNWA 3EIVA 1U4RA 5C6AA 1VKZA 5C4JH 5JJKA 3K8AA 2D0OA 1BBXC 1LLRD 4P74A 2LFNA 1EEID 2K5HA 1XMOH 5KRUA 4QW9A 3SVMA 3TIGA 2F0EA 1K83A 5IODA 3S2DB 2HQEA 5KYLA 3KHLA 2LKVA 1SE4A 1O7LA 2PQAA 3GP7A 2N49A 4HR7B 5KG3A 4DV5L 4DR7Q 2N3SA 2K01A 5FLXE 4QWAA 4KN4C 3NP8A 2A68C 2VQFL 2JXMB 1VBHA 4OX9Q 5IYZF 4OELB 1F9QA 4GOPB 2X6GA 3IG0A 3CW2C 4IR9A 3N8DA 3U4ZA 1J5EL 4GKJQ 2UUBH 1HZ9A 4ZHQF 4HR7A 4DR4Q 1DONA 2QCPX 1I50H 4DAVA 1IBLQ 4QJFA 5BR8L 1PDQA 4YQWA 3GIPA 2KCTA 4ETSA 3J81W 2F0VA 2HVSA 3OMCA 4ED7A 4FXGC 3PF4A 1JOKA 3FP9A 4GOPA 2R8IA 3M3YH 4JBMA 1QILA 4NXMH 4JBKA 3CC2A 1TWAB 3SK6A 1OXUA 1I94Q 4HYKA 3OWFA 4GNXA 3H3VI 2E2DC 3MR2A 1PA6A 4A2AA 3QWNA 1LTBD 3DLLA 1XWEA 2LXJA 2Q2TA 1Q12A 2Z6KA 4Q8EA 4N8FA 2Z1CA 1QB5D 4KHPL 1TWAA 1BBWA 2B63B 2V4QA 1MI2A 3PIO3 1G291 4JV5Q 3PO2B 4ZKCB 3MWMA 1B50A 4RNMA 4C3IG 3RZDH 2VUMH 2BH8A 1L0WA 2L11A 1D7QA 1HNXQ 2V4RA 3VR4A 4S3SA 4HNTA 1PMRA 5G3LF 2B63A 1K8MA 1YNXA 3I56A 2IY5B 2KQ3A 1AEXA 4HNUA 4CDDC 3ND8A 1EL0A 2V9WA 3CCVA 3KAJA 5ELDA 2FB9A 4FF1A 3W3AA 4CDEC 4IRKA 5IGCA 3PW2A 1EYAA 4GOPC 3S2HH 2QYZA 2DNCA 3OHBA 2VQEL 5KFSA 2NUCA 2F0TA 2K5QA 3KJOA 3K5IA 5EBCA 5HV6A 3DF7A 1QZHA 5DLFA 2Y0SE 4LF5Q 2EYFA 1IBKL 3RB6A 2Z6KC 1PRTF 4DUYQ 1CKOA 1SYBA 5BPHA 4NW2A 2RSOA 3T4AC 2SDFA 4JI7Q 2EXZA 1JJCB 2F0KA 2XWJB 3HZXA 4LW1A 5LOVF 1JORA 4CC6A 1Y69U 2H4OA 3GQCA 4J8QA 3KLRA 1C30A 1DCZA 1FVIA 4A76A 4ZKBB 1OTCA 1JIHA 3P75A 4PQXA 4A3CH 1EWHA 1DOKA 3H09A 3SGIA 2V5AA 1X3QA 2WB1B 1I7LA 5JAVA 4BY1G 1V1OA 1I4GA 3K80C 1PYWD 2RHQB 4AIMA 4X62L 3J81i 4A3BB 4DV0H 4OWXB 5J3BA 2ZJTA 3PSIA 1QVFA 2UXCL 3E9IA 3KYHC 2K5DA 3KF6A 1B44D 3V6JA 2WB1A 2MO0A 3C46A 5GROA 1Y8OB 4PMCA 3SK8A 3GTLH 2W6OA 1WR2A 2CH4A 4DF7A 4YIJA 5KT5A 2CVRA 3NGDA 3NBHB 5IT9W 4QIWE 3ULJA 4LH7A 4A4IA 4O3QA 4GN4B 5BN5A 1SFOB 1A3UA 1VQJA 3I4OA 4XYOA 2XD4A 3M7GA 5LMNW 1EIFA 4DV5H 2F0GA 4BWGB 3NELA 3EPGA 1PZJD 2GA4B 1U0LA 3J81j 5CA0F 3PZPA 1SFOA 3MR6A 3PCOB 1ENFA 3GTJH 2NBFA 2F3VA 3LWUA 5KNBA 1J5EH 1QWYA 1N36H 1IKLA 5EQ0A 5JPNC 1BNCA 1SYXB 3Q24A 4RFBA 1GO3E 2EQSA 3E0EA 1JJ2A 1XMOQ 4LK1C 3HOXB 2QK4A 3CKIB 3IFTA 2OQ0A 4DV2L 1YI2A 1WD1A 1T36A 3RGXA 5ELEA 5EKKA 5I6WA 1KD1C 1W93A 4IPDA 1JB3A 1RYRA 4RWSC 1GSAA 5DQIA 4CC5A 1L1OB 4BY1H 1JJGA 1P16A 1KIXA 4TVAB 2UXBL 3QZ7A 4BBRB 4A3MB 2RGRA 1PTOC 1B33N 2MCTA 4J9RA 3C3LA 3TEHB 1FL0A 3GTMA 3BS1A 1PX2A 3Q8PB 1G6PA 3ONAB 2Z0SA 5D3DA 3G48A 4F87A 1L1OA 2F0SA 2PW7A 2QILA 4IUUA 1TAEA 3R3OA 1G2TA 4KHPH 4O3OA 4QF4A 1SDFA 4IZ8A 3VA5A 2EYMA 1DV2A 1WCMG 3H4BA 4TSSA 1EOTA 3JRWA 1GUTA 3CQZB 2R82A 2DNEA 1HJPA 1RHPA 3PIPA 3NPPA 4NXMQ 2FK2A 5CV4A 5EWGA 2R8JA 3MFYA 5C4JB 4A3IG 1R9TH 1IBML 3TS0A 1BR9A 4YJ3F 2C28A 4OEMB 3V2TA 1FYCA 2JEJA 3OHXC 4OXPA 4AYBB 3I4MG 4R4CA 1BDOA 5C5LA 5LP6F 1NMGA 4KY5A 5KFDA 1DV1A 2R92A 4KN7C 3H40A 1CZGA 1Q46A 1E3PA 4IUNA 1NE3A 3V4SA 2EIFA 1UC8A 1K9MC 3RB4A 4KMUC 2W9BB 3MAQA 3TQTA 2FXQA 4DNRB 2A6HD 5KFXA 1Q8KA 5FD5A 2KUMA 5L9XA 3E5SA 4CGYB 1JR0D 1K1QA 4Q8FA 1I50B 3A8IE 2R84A 5JEAG 4ULLA 1EFID 1HXYD 4IUTA 4ALPA 4RMFA 3VDYA 1VQLA 1YHAA 1YNJC 2W9BA 2LSSA 5C5JA 1OXVA 3M3YB 2VS1A 1L1OC 1SNOA 3I73A 2ZXRA 3HS0C 3ULPA 1DXMA 2QDBA 5M5YH 4O3SA 3IL8A 1I50A 4K5WA 5JPMC 4K8JA 5D3IB 1I4XA 1HCZA 1K28A 3STBD 4F7XA 3ORQA 2WFWA 1AE2A 3KF8A 1WCMH 2Z6BA 5FPOA 2AQ4A 1II3A 3SK4A 3GV5B 2FK1A 1R4QB 1RIPA 1WOCA 1EIGA 1TS2A 4PDBA 4LMQD 4A3IH 4QW8A 2OCEA 2SNSA 3PQIA 1Q90A 4X62H 1RJPA 3CXCA 4WBNF 2UXCH 1F2YA 3RB3A 3RZDB 1GSHA 2D0PA 3K81C 2XNAC 3JAMc 1TQOA 1N32L 2F0UA 4RUCA 1VQAA 4B3RL 5KFOA 3WOFA 4RZQA 5J2UF 4KJNA 3GQBA 3ORRA 1A15A 1EY8A 2VUMA 2KA7A 4RU9A 2W9CB 2EYOA 1CHPD 3A7AB 2IA6A 4B3ML 4X64H 2A6EC 4ZUIA 1ONLA 1HNWL 4EQOA 3S2HB 2DLNA 5FPRA 4DV0Q 4EBDA 3MC0B 2Y0SG 4QL5A 1S72A 1ET6A 3HKZE 2X6LA 4X3UA 2RSNA 4RCOA 1SEBD 4A3FG 2VPQA 5KFYA 2BOSA 4U7CA 3N6RA 4XIGS 2FP4B 4P71A 5IYDG 2D62A 1W6KA 1M7JA 3OSOA 5CYUA 2RDJA 3Q22A 2JN4A 2ASJA 1XNRL 2B2YA 3CD6A 3RNUA 3HOVG 1D2BA 1F2MA 4YR3A 1A63A 4NXNL 1EHIA 4DR6H 1SMYC 2NYZD 5IGBA 3PIOA 4K0KQ 1IKMA 3KXYT 4DV3L 5IWAH 1PH7A 1TA8A 4Q43A 4QQBX 4XYMB 4U6PA 4YHHL 5IY0A 5EWEA 2UXBH 1F9SA 3MVVA 4YWLA 3FEWX 3K0YA 4MV7A 4IFDJ 4F88A 5JQWA 1WJJA 2QF7A 5FO9B 4ED3A 3M4QA 4DV1L 1N36Q 2YTVA 2N8NA 4AH6A 4YWKA 1ENAA 1WTPA 4C2MH 1BUVT 1ZYRD 2J0TD 1PV4A 4DK0A 2ICIA 1WTOA 1XJVA 3GTLB 1DD2A 1G2SA 3T1YL 2XRSD 2R85A 3OSNA 3HBLA 4FNFA 1IBMH 1KJQA 2W71A 2WDTA 1N33H 4DV4L 4A3FH 4DL7A 3HRZC 5T1GA 1CQJB 4IFDG 1E4FT 2AGQA 2B2YC 3GTLA 3BYYB 2RDIA 3HOUH 4TUYF 2ZM6Q 3C1FA 4KHPQ 1RODA 4Y7NH 2O4XA 1X54A 1GUWA 3ND9A 3TP7A 3A8KE 1IYJB 5GQOA 2NU9B 3KHGA 3GTJB 3M9NB 2VZAA 4I65A 2I0QA 4O0AA 1FNUA 2TMPA 3DMUA 3PW7A 3R93A 3T13A 2WP8J 5L1JA 3TINA 1CA6A 3BA9A 4UCRA 5JOBA 1EY7A 2K33A 2AWOA 1QVGA 2VXWA 4BY1B 3QJYA 4IJHA 3GTJA 2ZJRA 1TWHH 2Z9HA 1F2LA 2IP4A 3J81c 3GV3A 2FMCA 4HIMA 4YCUA 3F2BA 1LT4D 3ITPA 5G3LD 1RD9D 5C3EH 3RBDA 2F4VL 2A74C 1DM0B 1HTLD 2B2VA 1X56A 2GN5A 3M4IA 2G5DA 2OQKA 4BY7G 4G57A 1ZHSA 4RB1A 2B2TA 1SBBB 2ZJPA 2BDOA 4O4IF 2OTLA 1LTID 4LH6A 3QO2A 1R9TB 1YIJA 1HA5A 4IFDH 3VPCA 4CJ2C 1G8ZD 2HHHL 2BA0A 1BXTA 2B8GA 4DA2A 1CI3M 5DM63 3O13A 3GTKH 4BBSH 1N56A 2LS01 4B3RH 1TWCH 1N8RC 1CQFA 3D6CA 2E5LL 4LF6L 1GM5A 1RYSA 1HHVA 1EQRA 5LXTF 1STHA 1PRTD 4FS1A 4PMBA 1KQSA 1S10A 4WRDA 1FNVA 4DL6A 1R9TA 4BA1I 5HGQA 2XGQA 4B3MH 4LFAL 5BN3A 4A3EG 1UE7A 2WB1G 2GPSA 1HNWH 5BMVF 4DAMA 3GIJA 4QWDA 5KG6A 1JX4A 4DL4A 1E2WA 3PUWA 3J80W 5FO7B 1CQVA 3K57A 3TS2A 2UUAL 4FF2A 1IYVA 4C5AA 1SEIA 2UU9L 4LF9L 5J2TF 1XNRH 4OIKA 1HZAA 2B2VC 1B70B 1EZ8A 3VR2A 1G91A 3N44B 4V0BA 3S1MH 1XDNA 1QOHA 3U9SA 5M5YB 1STGA 4X64Q 2EJFC 1H9JA 2B2TC 1I4HA 2DY8A 4MTKA 1K0RA 1XMQL 1LO5D 3L2PA 1SNPA 4KJOA 5C0XG 3BZDB 3L0OA 3GIMA 1CSPA 1WCMB 2PNHA 1RDPD 4BY7H 1AH9A 4ABNA 4IZOA 3K0XA 2NB0A 1LV9A 1JDEA 3C2PA 2NZHA 4OO1G 1UC9A 3HG9A 2CW8A 4A3IB 2RDHA 1S0NA 3KJPA 3I12A 1CHQD 5IYBG 1IL8A 3T5JA 4A3KH 4FVMA 2K7VA 4LAAA 1GOZA 4RKBA 5CV6A 5L37A 5EOYA 1WCMA 1GKHA 4K6LA 2A73B 3FPPA 5COYA 1KNEA 2VA3A 3CRKC 3AEVA 1BCPF 2AUKA 3QB3A 5DM73 1LT6D 4DR6Q 2NVYA 4ME6A 5KFRA 4LUVA 5CGKA 5IWAQ 3T1YH 2L5TA 5D14A 2QA4A 5GADC 2IT1A 2YV5A 1RK6A 4A3EH 3CCQA 1O78A 3OW2A 2C5CA 4ED0A 1MBYA 2MO1A 2UXBQ 1B7YB 3N52A 2K75A 3JAMW 1M1KC 5A2QW 3CCSA 1B2TA 2UUCL 4B3SL 4BBRG 5IT9c 4A3MG 4NB3A 4ZQ3A 1L2ZA 2E2HH 3QR8A 4YWMA 2VL6A 4J9LA 2HCIA 4JYAH 5KFLA 2C2EA 3GDEA 4J9PA 4C5CA 2VB2X 3TP6A 1XNQH 2KSWA 3RAQA 1Z2PX 1IBMQ 5I9PA 2R92G 4X65H 3K59A 1EZ1A 1N33Q 2VNUD 4LUOA 3H6MA 3K6OA 2W6QA 4R4OA 4R1JA 4OO1H 3PVXA 1ZKOA 4X66L 4EEYA 1CQIB 1H9KA 1KC8C 5IYBH 3HXLA 2NVXA 4JBWA 3OMGA 4EVOA 5EGTA 2GLTA 2CW7A 1S3OA 3J80i 3J7ZC 3LWEA 2RKSA 2CHBD 1LTAD 2R8GA 3H4DA 2YZNA 4N9TA 1T94A 3S9WA 3GTMH 1EEFD 4QGUA 2ZDHA 2I5MX 4HCSA 3FKIA 4PG3A 3MXNB 4DKAC 3T1HH 3P7JA 1EUCB 3NWTA 1HA6A 1EWCA 3GTGH 1X32A 4Y8VB 4RAZA 1Q3LA 1HH2P 1J9OA 5KFQA 3MJFA 3UFXB 2Y0SB 5C3WA 5KG0A 1STNA 4C2MA 4A3FB 3CC7A 3D31A 3JZIA 2E5LH 3MXNA 3GIDA 2DUDA 3K3VA 4M9UA 3HOUB 2LXKA 4EGJA 2C22A 2J7ZA 4EG0A 4YY3L 4Y7NB 3PMFA 2P5ZX 1K83B 4FF4A 5AJ3L 2XCAA 3KFUA 2ALZA 4B3TL 4I4TF 4LFAH 2R92H 5E4WC 1CKMA 1SRUA 2BA1A 2XGPA 3T5KA 4LJZC 3HOVB 2EY5A 3J7AF 1LTTD 1L2FA 2F0JA 1E24A 1FGUA 1EY9A 3ETHA 3WDNA 4LF7L 2K28A 3KLWA 3HOWG 4YR0A 1PH2A 2VUMG 3HOZH 3AMUA 2UUAH 1RK5A 4DR5H 2FMAA 1HQMC 2EYJA 3JAMi 1GSOA 4FBTA 2UU9H 2I87A 4JI6L 2W6ZA 1IOWA 4RB3C 1SCUB 2KHJA 2HUGA 4GN5A 3CCEA 4NPSA 3P1HA 1EY0A 1J6QA 4I7AA 3R2IA 1XMQH 2UVRA 3RLOA 2B3GA 4QIWB 2DGYA 4JI2L 1K8GA 2R7MA 5C3EB 3MWYW 4GNXB 3A74A 3DXJC 1LACA 1VQFA 1AUXA 3D3RA 3BG5A 1TWHA 1SN8A 2SOBA 1Z6HA 1W6JA 2PZUA 1C4QA 2JQOA 3CCJA 1PTOF 4RUAA 1RTOA 2F0OA 3L7ZC 4TQUS 3K7AH 2AKWB 3KBGA 1V51A 1WTQA 1O7IA 2JP1A 4GKKL 4QIWA 3MEHA 3PW0A 3D4DA 3MWDA 4ECUA 3NQIA 2BDNA 1LABA 4HAEA 4KHZA 2KHIA 4DR3L 3GTKB 2YZGA 2B2WA 1TWCB 3L3OC 1PH9A 4R4IA 1DIKA 4IWYA 4OHJA 1GUNA 5IT9E 3DWQA 2QEXA 4DFAA 1XYIA 2F0DA 1SE2A 3J81L 2GPWA 2WAQE 4A3CG 4TKOB 2BQUA 1Z47A 1H9RA 4C56C 1K1SA 1X55A 4POGA 4XYLB 2UUCH 4B3SH 4RCNA 5HGTA 1WYDA 1XPUA 3GTKA 1D1KA 2PPBC 3F1ZA 2DJFC 3P20A 3HOWH 1TWCA 4HN7A 4K8IA 1VQ7A 3A55A 4L63B 3SE0A 2RGVA 5KFJA 1FJGL 2ZT9C 4MTEA 2KCNA 1Z2NX 2VA2A 2AWNA 3LMLA 1XX8A 4GC6A 5IP9H 3F2CA 1VQMA 1SXTA 2A6HC 4K5XA 1NAPA 4QCLA 2JYOA 5JVLA 1YZ6A 5CMDA 1HNZL 1HZBA 5HY6A 3S1MB 4EGVA 3Q6SA 1EU3A 1UAPA 2W6MA 2MHVA 1HRJA 3V4ZA 1SJHD 4P73A 4HNVA 1QCBD 4XDXA 3ICEA 2B39A 4G4KA 1KABA 1AZPA 2XVSA 5LL6X 3HOYH 2WTFA 2BQRA 4LFBH 5CA1F 4X66H 4GNXC 4GS3A 4BY7B 3LNNA 2HGSA 3AB9A 2HJWA 4JYAQ 3QG1A 5DG8A 2ATLA 1NBWA 1U5KA 1HUNA 4XT1B 4QWEA 2XGTA 1XNQQ 5ELCA 2JE6I 4A3KB 1MJEA 1XTCD 3UE1A 2PMZE 4X65Q 4F4ZA 2F0IA 2K6AA 4ZI7F 3BVMA 3E3XA 1C0AA 5D8DA 2UXDQ 4TRDA 1UNSA 2M2LA 1NR2A 4RKLA 1EQTA 3M85A 1U4MA 1MHWC 4F4YA 5L1LA 5K5PA 4GLVB 4JI4H 4DLKA 3KF6B 4A3EB 1H95A 3OUUA 4DXFA 3TMEA 3R23A 1I6HH 1JOQA 4J9MA 1TY2A 3SK5A 1Q86C 1MIUA 2MGSA 4EFBA 4LSAA 5FLXW 4DR1H 3HEJA 1D5ZC 3CPWA 2K1BA 2E2HB 4C3HG 5DQGA 4L5TA 1B04A 4JOIA 1S0MA 5H1SE 4YY3H 1H9MA 3ULLA 1GGOA 1HTPA 1X3EA 4XZ3B 2VB3X 4ECWA 2VUGA 1HZCA 3T1HQ 1EFWA 1EOVA 4XQJA 2NU7B 4LSXA 2E2HA 4AQYL 2Z8LA 2CWPA 5D65A 4JI3L 4LF7H 1LM0A 4ECXA 4DU9A 1W2BA 4JVZA 2O5IC 1ET9A 4L6TB 1BOSA 4M7EA 1CTMA 2E5LQ 2R8KA 3CCMA 1Q1BA 4JI6H 1QVCA 4QUCA 4ZUJA 2XIGA 2VQFH 2Q2UA 1AP0A 4L1KA 4LFAQ 4XQNA 3K3PA 5E1FA 5EZYF 5IT9L 1KDBA 3KALA 1V43A 5IGFA 2K05A 2CWAA 4CKBA 5KFKA 3NE5B 5BR8H 4IN3A 3MR5A 3GTMB 2NN6I 1GD7A 4ECYA 3CVZA 5KT3A 5CV9A 5LMNL 4DR5Q 1HUMA 3MZ5A 4DR2L 1ZQ7A 2UU9Q 2CQYA 4L5QA 2YZMA 3HKZB 5C1OA 4JOIC 2V59A 2X0SA 2F3IA 3AFQA 1JKJB 4GKKH 1NTGA 4RGTA 1E4EA 1I3QA 3RLFA 5GAHC 4C3HH 5KT4A 1ZYRC 5M3MH 2CZGA 1CM9A 3OOCA 2HVRA 4IR1A 1XMQQ 2UUBQ 1Y1VG 3MTSA 5KFVA 1JWMD 2R61A 3HKZA 4C1NI 4CKEA 3GTGA 5KIXA 5EBDA 4JI8L 1NY4A 1YBYA 1BVSA 4YCWA 4TV9F 3VMMA 2EY2A 4M1UB 1MJCA 5GAGC 2R92B 4J9NA 1G6ZA 5KG1A 4O3NA 2R7LA 4L5RC 1CS0A 2DZDA 1VF5C 1PRTB 4LFCL 4JI1L 1X65A 1FJGH 3FPUB 5EPLA 3HOZB 4JI0L 5ELBA 1EIHA 3CCRA 3JSLA 3PR5B 2A19A 1S03G 4NDXA 4B9XA 4K14A 2PN1A 1Y8PB 1V1PB 3GIQA 3J80c 3QIAA 1RTNA 1I4PA 1EYDA 1CK1A 1WTRA 2C35B 4B3SQ 4DV7L 2K4KA 1QG7A 3G6JB 2GVBA 1BCPD 2EJGC 1PFBA 4IUQA 3G7LA 3BQ1A 2Q2HA 2VQEH 2R7DA 2L4NA 1TWGH 1YITA 1GVPA 1V1PA 3T51B 2M9VA 1IBKH 3KF8B 3MFGA 3K7AB 5EKIA 2NZOA 5DEHA 3CAMA 1PH4A 4YR2A 2OEOA 1E7ZA 1ESFA 1UUPA 1WFQA 1Y1VH 3J7AK 3KOJA 2OXPA 3KDFB 4IPGA 4ED6A 5LMUL 2WAQG 4RB2C 5FKAC 5J22A 2MNAA 1LT5D 1VQDA 1QZGA 4LFBQ 2PO4A 1X3PA 4X66Q 2C2DA 2VY3A 3FDSA 3I4LA 3HKSA 2PQEA 3MEFA 2NVYH 3CCUA 1M4VA 2YL2A 2FK3A 1A0IA 4H0LC 4IALA 2K5WA 2KCCA 4YP3A 1TKWB 3KDFA 4RB0A 1Y8NB 4DL5A 3FKIG 1D6EC 3HOWB 2XN9C 2VUMB 4XT3B 2O03A 4H13C 2RCFA 4KKUA 5IGEA 3Q8SB 3RAXA 1C9OA 2WYOA 2PZWA 1Z2OX 4DNTB 3ER0A 4MHEA 3N6XA 5FLMG 4KK7A 3D8GA 2E2IH 4JI4Q 5IIFA 1T5EA 2YS6A 2AQ1B 4A3DG 4AQYH 5L1KA 3F2DA 1ICWA 1N34L 1RF2D 4JK1C 3BABA 3OIPA 5I47A 1PZID 1MKHA 4DR1Q 2AGOA 3Q23A 2NU8B 2B29A 1NR4A 3FVQA 3UDIA 3HOYB 1D8LA 2ICEC 4ZQIA 4ECZA 4OL7A 1MD2D 4EX5A 1STBA 3S14H 2I5LX 5LL6S 2SEBD 1SNDA 1YEZA 2JA7A 5E7NA 2L15A 2WACA 2HDMA 3HOUG 4RGMA 3X3NA 1IZ6A 4PZ8A 5JJLA 2ASLA 3CPFA 3CC4A 2NVXH 3G6XA 4PNYA 1GXDC 4PZ7A 3H3VH 2AU0A 1BJTA 4YB8B 4UCUA 1KLUD 4LF7Q 2L1BA 3BQ2A 2IJ0A 4IOCA 3PW5A 4DV2H 4GKJL 3U9TA 4GLXA 4YJ2F 5I2XA 3SHLA 4CJ0B 3PF5A 2JEBI 1IBLL 4DV5Q 4C5BA 4DR2H 2AHOB 2IW3A 1A2TA 3UDXA 2VQFQ 1GHKA 4TQRA 4C3JH 3RB0A 3FKIH 1I7NA 5CORA 1S68A 3OSPA 3GTPH 1FD7D 1MZBA 4J6HA 4RGNA 3S1RH 4BS9A 4LF8L 1CE8A 1J5EQ 3ETJA 1I94L 1PFMA 1TY0A 2KJXA 5BR8Q 1WTVA 1PZKD 1YHBA 5FLMH 1Q81C 4JI8H 4JC0A 5C3EG 1M6VA 2FMMA 4KY7A 4MV9A 4JUZA 1PFNA 3I90A 4A3DH 2CQAA 1KAAA 1SAPA 1SNCA 4JV5L 1PVOA 2CH4W 4JI1H 4RHSA 1EQQA 1VQ6A 2QKIC 4JI0H 3PW4A 4DUZL 2BH2A 1PTOD 2E75C 4EBEA 3I4NH 4BBSG 5KEEA 1OWTA 4X3TA 5ISRA 1UNNC 5KFNA 1EY6A 3S16H 4U673 4DV7H 1B3QA 5KNCA 5TSSA 2MFIA 1JOOA 4ILWA 4IQZA 1NCVA 3OHAA 2RF4A 1SNMA 3E5NA 2VQDA 2FKLA 3SDZA 1AFPA 1SROA 3K58A 1TS3A 4L8JA 1QNUA 1YJNA 1PH1A 4RNOA 1PYBA 4GC7A 1YNND 3PUXA 4KTAA 1EYZA 4O2DA 4ED2A 5HURA 3D4WA 5EJWA 4WD3A 1E2ZA 2SCUB 2W6NA 2ES2A 4LF5L 4ZYSA 4H7BA 3MXGA 1O7ZA 2DN8A 4C3HB 4DUYL 5M3MB 3H0GG 5LMUH 2VW9A 4IRDA 3RLNA 2E74C 4MNOA 4JI7L 1Q1EA 2VQEQ 2VPSA 3SXHA 3I2ZA 4DV6L 3M7NA 3W2DA 3VYTA 3DUZA 1JE4A 4MA5A 3G6VA 5KFBA 3OYYA 3JAME 4RNNA 1A3VA 3G6YA 1WTXA 4PWQA 1IBKQ 4UCSA 5C4XH 2IL8A 2C9OA 5M3FH 1AUVA 3AQQA 1YNJD 5KG4A 3RTXA 3TRZA 4A3KG 1N32H 1JICA 1SLJA 3MA2B 3T16A 3QOJA 1TS4A 1VF7A 2JK8A 1X3FA 1WVLA 5KFZA 2L12A 2RDFA 3GTOA 1E22A 4KHVA 4ECVA 1BBUA 5I4DA 3GILA 3ERSX 2RVLA 3T5LA 1N34H 3TBIB 1X3GA 4POFA 3EQLC 5CBAE 2FJZA 4X62Q 1K3RA 4FM9A 3A7LA 1CA5A 2CFMA 5M5WH 2UXCQ 5ELOA 4HJ8A 2JA5G 4LMYA 2KHSA 3A8JE 1N48A 5CV7A 1TWGB 4I7ZC 1VQKA 4EQPA 2NTTA 5FJ8G 1VMPA 3OTOL 1EYCA 1RJTA 1GYFA 5C5MA 1JWSD 1Z7TA 2RA4A 4MV3A 2R87A 1FGBD 2NWGA 3BDLA 3H0GH 3H94A 2OLSA 4AQYQ 4RHRA 1Y1VB 3BJUA 4ZAIA 3G71A 1I5FA 2CW0D 1ZEQX 4ZLTF 1TWGA 5C44G 2XRQD 4NXNH 3Q2OA 1JQYD 1QNKA 4DV3H 4HIOA 1I4QA 2FFKB 1M0TA 1SYFA 1XMOL 5DAUA 2B8FA 3VR5A 1EY5A 4YHHH 3J80L 4R8NA 1ESRA 4X6AH 3BJYA 3RUPA 2NVYB 1Y1VA 3EVQA 4P72A 2KCMA 1I6VC 5D1OA 3JSNA 4LF8H 2FINB 3RN2A 2HT1A 4DV1H 1D5MC 2KECA 2NVTH 2R7KA 3E0JA 1V4YA 5F9NA 2W7PA 4DV2Q 4IJLA 5FLXc 1RJQA 5KX5F 4XYQA 4DR2Q 4LNQA 4ZOLF 2A69D 4RA8A 4N9PA 3CMEA 1S9FA 3MR3A 3OW7A 4BA2I 3TQYA 2E2IB 3SEBA 2HVQA 3HP3A 4KLKA 1NUCA 3PUVA 2L55A 3S17H 3HKZG 2W7OA 2JA5H 4DV4H 3I55A 1KLGD 4NXML 3U4VA 5C4ZA 3GTQH 1DOMA 1D1IA 4DUZH 1F9PA 1W3SA 2F0FA 5FJ8H 4IPHA 1D5XC 4UPAA 4PZ6A 2E2IA 3S15H 3S14B 5KG2A 4DK6C 2J9GA 4DAYB 4K6DA 2MJ8A 3L9AX 1S5DD 1PTOH 2NVXB 5C44H 5LL6b 2WAQB 4LF4L 2YU9A 3JAML 5CB4F 3OPOA 5F2DA 3UDGA 5A2QL 2BE5D 3J7A5 3J81E 4QMGA 2EYLA 4NLGA 1TT2A 2FLLA 2Q2IA 3Q0AA 4DAYA 3UI2A 3PGZA 1UE6A 4R9WA 3MXPA 2Q8IB 3HOZG 5KFUA 3V6HA 5DGBA 2WAQA 1A9XA 1SYGA 4WJWA 2IWHA 3M4OH 3FKIB 2L0CA 3H15A 3GTPB 3HGBA 4DV7Q 2ASBA 4DUYH 1CFMA 4PMWA 3S1RB 1Q8IA 4DAPA 2RHSB 3BZKA 4JI7H 1HR0L 4X3SA 1I3QH 3S24A 3K5HA 4QWBA 2DY7A 5DG9A 4ECSA 2F4VH 5C4HA 4DV6H 3A5UA 1KJIA 1B1ZA 2R6GA 4C2MB 3E9HA 4ECRA 1CKNA 2EYHA 4ZRZA 3M4YA 3GTPA 4A3DB 5M9OA 1LTSD 2CQOA 2AUJD 1V8QA 3GD7A 4M8AA 1S40A 2YW2A 3NBIA 3KUPA 5KT7A 3W5OA 2JEFA 2JA8H 4RG1A 2HHHH 2HIVA 2R3ZA 5DQHA 2DPIA 3I70A 3PN1A 5EPKA 2QGQA 4JW0A 4A3JH 1IHZA 2PMZB 1BXRA 4LF6H 3RFCA 3HOXH 3IRBA 1A62A 5BN4A 5GONF 4R7RA 4XQQA 2R7FA 5I9OA 1VQ5A 1N9WA 2F0WA 2KBNA 5IP7H 2ZJQA 3R8BA 2K04A 1HFNA 3L4JA 2JEAI 3V05A 4F4XA 4NKLA 1VQPA 3S16B 2K14A 4BXXH 4ECQA 3EBEA 4MIUA 4MN3A 2RCNA 4JBJA 1SJED 2A8VA 2PMZA 3H3VC 1N32Q 3PUYA 1XXGA 2OF1A 4X3KA 1KC7A 5JUMA 4B3RQ 4IO9A 1T5XD 1YJWA 3OTOH 2E2JH 1ZHQA 3N42B 4Q5VA 3I7FA 5JJZA 4LF9H 1BCPB 4RGOS 1K8AC 5FD6A 2ZDQA 1TWHB 5IP9G 3VPDA 1IXRA 5IYCG 3N40P 3MFIA 2YTXA 1V1QA 3HFZB 1N34Q 4B3MQ 1B6SA 1K0SA 2NVQH 1OO9B 3T53B 1HNWQ 2W8KA 2MUYA 2JA7G 4J1MA 5CBEE 4E6IA 5KFCA 4N8X1 1C8CA 1KDCA 3E6ZX 2H5XA 2PI2E 2FHTA 2R7ZG 4B08A 2VOBA 3KTMA 2K32A 3TP8A 4HJ7A 3HOYG 4K0KL 2PBZA 4YAJB 1S5FD 4UDUC 2OTJA 4Z9CB 5C4XB 3RV3A 1X9NA 4WJ3M 1XNRQ 1MGSA 5M3FB 1QUQB 1KRTA 5LHY1 2QDLA 3KHHA 2YCHA 3PO3H 3F8TA 2EY1A 3GO5A 4JCVE 1OXSC 1N36L 4NXNQ 4BBSB 4GZYC 1GUSA 4MV8A 3NTKA 4DV3Q 1NJIC 1JLLB 1GUOA 1VBGA 4YHHQ 2JA6G 5CV5A 3OUZA 2YTYA 1QUQA 4LUZA 2IX1A 4WFN3 1PK8A 2K5NA 1IYUA 4LF8Q 3D0FA 4MZ9A 3K5OA 4DV1Q 4QWCA 5M5WB 4EQNA 3NTHA 3RZOH 1Y1WH 4G7ZC 1KL9A 4KY6A 5KFTA 4V190 2AQ3B 4OWWB 5DGAA 3I91A 3NHHA 1IL2A 1BF4A 3S1NH 2FPIB 1EQVA 5IYCH 3T1YQ 1JDBB 3EFXD 1IW7D 3TP5A 2ZM6L 1PH6A 4UY8C 2VR1A 5KFFA 1TS5A 1M0WA 1PHJA 1ZETA 1I6UA 1BCPC 2TSSA 1JB7A 1O80A 3H0GB 4LF4H 2JA7H 4MTNA 1DJRD 3T5HA 2ID0A 4DV4Q 1DOLA 1E0BA 4J9QA 3KLSA 2R7ZH 2XC9A 4DUZQ 4RZRA 5HBRB 2LY7A 1B4OA 2EY6A 4ME5A 3DM1A 3RN5A 1LYLA 2XCLA 4Q45A 2WE6A 3H0GA 5CR3A 3MHBA 2B2WC 3FMAA 4YCVA 3LGJA 1DGSA 3STBC 5C8YF 4O2BF 3S1QH 4FU0A 2R7NA 4UCVA 1HR0H 2NVTB 3WNZA 3WWVA 2NUAB 3TSSA 2NU6B 1KBLA 3WO1A 3H20A 1JMCA 1O75A 5KKNB 2JA6H 3TIIA 4XXEA 2I8CA 4GLAC 5GAEC 3R2TA 3BYTB 5KFPA 1VQNA 3A54A 3VR3A 2F0QA 5D1PA 4KD4A 2FJ2A 3S17B 4CDFC 2K5VA 1JE5A 1ZXTA 2JA5B 1JXLA 4IUPA 4UCTA 1KJ9A 4NMZA 3GTQB 3A0JA 4O3PA 1RL2A 2EXDA 2WIIB 2F4VQ 5JH7F 3V6KA 5M3MG 3N41B 1U4PA 2F0LA 4DV6Q 3DWAA 3C0FB 4I50F 1S97A 2YRXA 3S15B 1JCKB 4B3TH 2I80A 1F2ZA 2O5JC 3URYA 2JA5A 1W96A 1ULZA 2FLNA 1EU4A 1DZ1A 2ENBA 3GTQA 1XPOA 3I3CA 3GV8B 1AW7A 1PTOB 3IKJA 4C3IH 5C44B 2J6TA 4G3IA 5KG5A 4XTCS 2HHHQ 2OH2A 5FLXL 4EQ5A 1CT1D 3G6EA 4LF6Q 1GLVA 1B8AA 5M5XH 1YJ9A 1VS0A 4APVA 3GIIA 1VQ8A 1NSNS 1T3NA 4CDCC 4IUVA 5KFHA 5L1IA 1R4PB 3M4OB 1E4GT 1EY4A 3VPBA 1EIYB 3JRXA 4JI2H 3NUCA 3VYUA 1E4EB 3U58A 4IFDI 1I3QB 4X64L 4JV0A 2XSCA 2K03A 2V58A 2ZXOA 4BWSC 4K0KH 2UUAQ 1NNXA 3OTOQ 2N55A 2E76C 1RCVD 4IAJA 3NBHA 4G7HC 4LF9Q 4HCEA 3GTGB 1VQ4A 4O3RA 4CHTB 3DWPA 4HSPA 2JA8B 4DR3H 4OONA 3BA8A 2A68D 3EJIA 1PYSB 1PFSA 5KFWA 4A3JB 1HQRD 3M9OB 1ML0D 4K5VA 3RJ0A 2P0AA 1S5CD 4R8UB 2XWBB 4DR6L 2R93G 4DL2A 1EZ6A 1MSGA 5FK9C 5IWAL 4A3LG 1A6XA 1V9PA 1XTDA 2QEJC 4JG2A 3GTOH 3G8CA 3ZJYC 4H02A 1TR5A 1O7YA 1TWFH 3QZ8A 4H44C 5F9LA 4UP7A 4APMA 2F52A 1VQHA 2PZTA 2X69A 1HFGA 4R8UA 1STYA 4OIJA 2SNMA 3IFDA 1KXLA 4DXGA 1X6OA 2ZM6H 2E2JB 2HIXA 2YYAA 2PYKA 3SI8A 5DNFA 1HNZH 2DIKA 4JI5L 2CKZB 1TVXA 3DEPA 3KAKA 2UUCQ 2NVQB 5JEAJ 4IHJF 2IX0A 2K52A 4A93G 4FDBA 4ED1A 1YNNC 1K8OA 4C1NK 1N33L 1HPCA 5KG7A 3EPIA 1B53A 3I72A 2BCOA 4QB4A 2F03A 2JJQA 1OXXK 1E1OA 3CQZA 5FO8B 3NK9A 3ERQA 3G4SA 4DN4M 4DK1A 4P75A 4LF4Q 1KHIA 4WJ4A 4RAUC 4AYBA 2RDGA 3PO3B 3VR6A 1EWIA 4DK3C 4R4TA 1DYQA 5AFWA 4JV1A 2ZXPA 4HIKA 2R93H 4EEQA 4I7HA 1LTRD 1YHQA 2G9DA 3OIQA 1AE3A
chains in the Genus database with same CATH topology
1QZHA 4A3LH 2WB1E 4JI7L 2Y0SE 4MNOA 3J80i 3J7ZC 4LF5Q 1Q1EA 1IBKL 2Z6KC 2VQEQ 1Q7YC 3I2ZA 4DV6L 4DUYQ 3M7NA 4Y52H 1CKOA 2ZTEA 3OYYA 4JI7Q 3GTMH 1JJCB 1IBKQ 5C4XH 4LW1A 4QGUA 2ATWA 4ME3A 2I5MX 4LWCA 5M3FH 1HR0Q 4PG3A 3MXNB 4DKAC 3AQQA 5C0XI 3A5ZB 1FVIA 4A76A 1OTCA 3GTGH 3TRZA 4A3CH 3SGIA 4A3KG 1HH2P 4OO1I 1SLJA 1G51A 5DLQE 4BY1G 2ZTDA 1UWVA 1VQGA 2JK8A 1X3FA 4DNIA 3CC7A 1WI5A 3D31A 4A93H 1SMXA 3K80C 4X62L 2RHQB 4AIMA 3J81i 1E22A 1Q82C 4OWXB 5J3BA 2DUDA 3PSIA 1QVFA 1BBUA 2LXKA 2UXCL 3E9IA 3ERSX 3KYHC 4YY3L 1K73C 3I4MH 1X3GA 4POFA 5AJ3L 3KF6A 3KFUA 4B3TL 4X62Q 1K3RA 2YU9H 1CKMA 1SRUA 2BA1A 2MO0A 2R92H 2CFMA 4KI0A 5GROA 1SE8A 5M5WH 2UXCQ 5ELOA 3B6YA 3FHWA 3GTLH 4HJ8A 4YY3Q 2JA5G 1TXYA 5AJ3Q 1L2FA 3NBHB 2K50A 1E24A 1FGUA 4B3TQ 4QIWE 3I4NG 4DR7L 3ULJA 1VQKA 4LF7L 5FJ8G 3KLWA 3HOWG 2ALYB 1PH2A 4A4IA 3OTOL 4GN4B 2VUMG 3HOZH 4OX9L 3M9BA 3JAMi 1VQJA 3I4OA 3H0GH 1VQEA 5LMNW 3NENA 4AQYQ 1EIFA 4JI6L 5JJIA 3BJUA 3NELA 3G71A 3J81j 1I5FA 1U0LA 2KHJA 3BU2A 4A75A 4DR4L 4GN5A 3CCEA 3RR5A 5C44G 4NPSA 1J6QA 3TREA 4JI6Q 4HIOA 3PCOB 3RLOA 2B3GA 1XMOL 2DGYA 3GTJH 4JI2L 1K8GA 3K7UC 4GNXB 4A3GG 3A74A 4X6AH 2GVAA 1VQFA 3CP0A 2CCZA 3CMAA 1SN8A 1GO3E 2EQSA 2KCMA 3E0EA 4P72A 1JJ2A 1XMOQ 1C7YA 4JI2Q 2JQOA 1YI2A 2OQ0A 3CCJA 4DV2L 3RN2A 2HT1A 1KD1C 3L7ZC 4IPDA 4TQUS 2NVTH 3K7AH 2AKWB 2A1AA 1CUKA 1O7IA 1L1OB 2IHEA 4BY1H 4GKKL 1JJGA 1P16A 1Z9FA 4DV2Q 1KIXA 4IJLA 4TVAB 5FLXc 4KHZA 2UXBL 3AYHB 2KHIA 4DR2Q 4DR3L 4LNQA 4GKKQ 3TEHB 5EAYA 3CMEA 1FL0A 4AYBE 4R4IA 1PH9A 5C4XG 4BA2I 3TQYA 1G6PA 4KLKA 2QEXA 5M3FG 3PUVA 2Z0SA 2OWOA 3S17H 3G48A 3HKZG 1L1OA 2WAQE 3UE0A 4HIDA 4DR3Q 2JA5H 1BKBA 1VCIA 3I55A 4A3CG 1Z47A 4NXML 3U4VA 3GTQH 3W1BA 1HNXL 1X55A 4POGA 1WCMG 1XPRA 1W3SA 1WYDA 1XPUA 5FJ8H 3HOWH 3F1ZA 1HJPA 4IPHA 3PIPA 4UPAA 4PZ6A 1VQ7A 4NXMQ 3S15H 4DK6C 4A3IG 1R9TH 1IBML 3TS0A 1FJGL 4OXPA 4DAYB 3I4MG 4R4CA 2AWNA 5IP9H 3F2CA 1VQMA 1VQ9A 1VQOA 1NMGA 5C44H 1YZ6A 4OWTB 4LF4L 1FJGQ 3J7A5 3UDGA 1Q46A 1HNZL 1E3PA 1HZBA 1NE3A 5HY6A 5IYDH 2EIFA 3W1GA 1K9MC 2NN6G 4A3GH 4P73A 2Q2IA 1ASYA 4JYAL 1K83H 2FXQA 3ICEA 3PGZA 1UE6A 1HNZQ 3HOZG 3HOYH 1Q8KA 3HOVH 4GNXC 4GS3A 2B63G 1XNQL 4JYAQ 3M4OH 3Q8DA 3H15A 5JEAG 4X65L 2JA9A 4DV7Q 2ASBA 3PO2G 1NBWA 1U5KA 4PMWA 3CF5A 4ALPA 1PH3A 4RMFA 3VDYA 1VQLA 2RHSB 1YHAA 3BZKA 2UXDL 2V1CC 2XGTA 5IE8A 2LSSA 1HR0L 1XNQQ 3S24A 1I3QH 2JE6I 1MJEA 3S2DH 1OXVA 3UE1A 2PMZE 2VS1A 1L1OC 4X65Q 3A5UA 2R6GA 1E1TA 1A8VA 3E9HA 1C0AA 1CKNA 3ULPA 2UXDQ 5M5YH 2ZTCA 3M85A 2CQOA 3STBD 3GD7A 1S40A 4GLVB 4IOAA 2WFWA 1AE2A 1OXTA 1WCMH 3KF6B 1H95A 1AE3A 3W5OA 2JA8H 4RG1A 4UP8A 2HIVA 1RIPA 1I6HH 1WOCA 1VQIA 1Q86C 1MIUA 2QGQA 1LTLA 4A3IH 2OCEA 4A3JH 3HOXH 3IRBA 1A62A 2IHFA 3UDFA 3CPWA 2R7FA 4L5TA 3CXCA 1VQ5A 3T1HL 4JOIA 1N9WA 5IP7H 2KBNA 2ZJQA 5H1SE 2D0PA 1TWAH 3ULLA 2JEAI 1X3EA 3K81C 3JAMc 1VQPA 2K14A 2YYZA 4BXXH 1N32L 1HZCA 1CSQA 3EBEA 1VQAA 3T1HQ 1EFWA 4B3RL 2RCNA 4JBJA 1ASZA 2KENA 2A8VA 1EOVA 1N32Q 4AQYL 4JI3L 2CWPA 3PUYA 4B3RQ 1LM0A 3JC66 4IO9A 1YJWA 1W2BA 4B3ML 2B63H 2E2JH 1NMFA 1PH5A 3I7FA 1HNWL 1K8AC 2E5LQ 4JI3Q 3PO2H 5C0XJ 4DV0Q 5IP9G 1Q1BA 3CCMA 1IXRA 1P8LA 1QVCA 2Y0SG 4QL5A 2YTXA 1V1QA 3HFZB 3HKZE 4J15A 4DPGA 4A3FG 1S72A 1N34Q 2Q2UA 4B3MQ 2NVQH 3EN2A 1HNWQ 4LFAQ 4XIGS 4P71A 2JA7G 4A3BG 5IYDG 2D62A 1V43A 2CWAA 2H5XA 2PI2E 1EUJA 4DR5L 2R7ZG 1XNRL 4HJ7A 3HOYG 5ELNA 4K0KL 3CD6A 3RNUA 3HOVG 2OTJA 2NN6I 1GD7A 1UE1A 5LMNL 2MQHA 4DR5Q 1X9NA 4DR2L 3NEMA 1XNRQ 4NXNL 4WJ3M 2UU9Q 1A63A 4L5QA 3PIOA 4K0KQ 1QUQB 1KRTA 4JOIC 4DV3L 2F3IA 3AFQA 2UUBL 1PH7A 1NTGA 4QQBX 3PO3H 1Y14B 3F8TA 4YHHL 3GO5A 4JCVE 5LMNQ 5IY0A 3CCLA 1OXSC 1N36L 3RLFA 5GAHC 4C3HH 4NXNQ 4YWLA 5M3MH 4DV3Q 1NJIC 4IFDJ 5K36G 1XMQQ 2UUBQ 1Y1VG 1WJJA 4R4QA 4L5SA 4YHHQ 2JA6G 3M4QA 4DV1L 2YTYA 2YTVA 1N36Q 1QUQA 4LUZA 2N8NA 4QY7A 4AH6A 2IX1A 4YWKA 2HQLA 4JI8L 1NY4A 1YBYA 1BVSA 2K5NA 1YVCA 4YCWA 5GAGC 1MJCA 4C2MH 4LF8Q 3D0FA 4MZ9A 2JA8G 4DV1Q 1PV4A 1XJVA 2PI2A 4JI8Q 3RZOH 3T1YL 1Y1WH 1KL9A 4A3JG 3HOXG 1M90C 1YJ9A 4L5RC 4LFCL 4JI1L 4IPCA 4OWWB 1X65A 1IL2A 3S1NH 5IP7G 5IYCH 3T1YQ 3M4PA 1PH6A 4JI0L 4DV4L 2ZM6L 4UY8C 3CCRA 4A3FH 1PHJA 4LFCQ 2A19A 4BXXG 3PV0A 4JI1Q 1JB7A 3BZCA 4IFDG 2JA7H 4A3BH 4MTNA 4JI0Q 3J80c 2ID0A 4DV4Q 2ZM6Q 4HJAA 3HOUH 4KHPQ 4Y7NH 1X54A 1SR3A 2R7ZH 2C35B 3AFPA 4B3SQ 4DV7L 2K4KA 4DUZQ 1IYJB 2GVBA 5GQOA 3PUZA 1CKNB 1VQBA 2VZAA 2I0QA 2Q2HA 4O0AA 3RN5A 4JI5Q 1LYLA 2R7DA 1PH8A 1JT8A 1TWGH 2WP8J 1GVPA 1YITA 1HR0W 4YCVA 3LGJA 1DGSA 3STBC 1SFOH 3KF8B 1UEBA 3S1QH 2AWOA 1QVGA 3WWVA 2NZOA 3CAMA 4UP9A 1PH4A 4AYBG 4IJHA 1JMCA 4LFBL 1E7ZA 1TWHH 1WFQA 1Y1VH 2ZJRA 2JA6H 3J81c 4HIMA 3KOJA 3KDFB 4IPGA 4GLAC 4YCUA 2WAQG 5GAEC 5LMUL 2MNAA 1QZGA 1VQDA 3F2BA 1VQNA 4LFBQ 4X66Q 4HJ5A 2VY3A 5C3EH 5LMUQ 2F4VL 3MEFA 3HKSA 1VQCA 2K5VA 1JE5A 2NVYH 3U50C 1X56A 1A0IA 2GN5A 3CCUA 4GN3B 1EYGA 3PO3G 4HJ9A 3A0JA 2OQKA 3KDFA 4BY7G 1RL2A 2EXDA 2ZJPA 2F4VQ 5M3MG 3FKIG 4DV6Q 1T9HA 2OTLA 1YIJA 1C9OA 4JI4L 4BBRH 3ER0A 4A3MH 2BA0A 2HHHL 3DM3A 3GTKH 4BBSH 2E8GA 1XPOA 1TWCH 2AMCB 5FLMG 1N8RC 4C3IH 2E2IH 4JI4Q 4DR1L 1KAWA 1KRSA 2XTIA 2E5LL 1GM5A 4XTCS 4DV0L 1UE5A 4LF6L 1EQRA 2HHHQ 4A3DG 1KQSA 3F2DA 1Y1WG 4EQ5A 1N34L 2N78A 4BA1I 2I5HA 5HGQA 4DR1Q 1MKHA 3G6EA 4LFAL 4A3EG 4LF6Q 1B8AA 1LUZA 1UE7A 2WB1G 5M5XH 2B29A 1VS0A 3UDIA 4APVA 2PQAB 4DAMA 3CQZH 1VQ8A 1D8LA 3EIVA 4EX5A 3S14H 2I5LX 5C4JH 5JJKA 3K8AA 2D0OA 3PUWA 1YEZA 5E7NA 2L15A 4P74A 3HOUG 1EIYB 3TS2A 2K5HA 1IZ6A 4PZ8A 2UUAL 5JJLA 3CPFA 3U58A 3CC4A 4X64L 2NVXH 2UU9L 4IFDI 4LF9L 2PQAA 4PZ7A 2N49A 3H3VH 1HZAA 4DV5L 2N3SA 1B70B 4LF7Q 4DR7Q 2UUAQ 4IOCA 3S1MH 3OTOQ 4GKJL 4X64Q 2VQFL 4GLXA 4LF9Q 3PF5A 4OX9Q 1IBLL 2JEBI 4DV5Q 1VQ4A 1K0RA 4GOPB 1XMQL 2AHOB 3CW2C 3L2PA 5C0XG 3U4ZA 1J5EL 3L0OA 4GKJQ 3UDXA 1CSPA 2VQFQ 2PNHA 1HZ9A 4C3JH 4BY7H 1AH9A 4DR4Q 3K0XA 3FKIH 1I50H 1IBLQ 4QJFA 4OONA 5BR8L 2NZHA 3GTPH 4OO1G 3S1RH 1PYSB 2KCTA 4LF8L 1J5EQ 1PFSA 3KJPA 1I94L 5IYBG 4A3KH 3PF4A 3FP9A 5BR8Q 4GOPA 2Q2TA 3M3YH 4DR6L 2R93G 4JBMA 5IYCG 1YHBA 5FLMH 5IWAL 1Q81C 4JBKA 3CC2A 4A3LG 1GKHA 4JC0A 5C3EG 1OXUA 1V9PA 1XTDA 4JG2A 1I94Q 3GTOH 4GNXA 3H3VI 3ZJYC 4H02A 3AEVA 4A3DH 4DR6Q 1TWFH 1PA6A 4LUVA 5IWAQ 3DLLA 4UP7A 2QA4A 5GADC 2F52A 2IT1A 1VQHA 2LXJA 2YV5A 1Q12A 2Z6KA 3CCQA 3OW2A 2MO1A 4A3EH 4JV5L 1PVOA 2UXBQ 1B7YB 2K75A 1EQQA 4KHPL 1VQ6A 1BBWA 1KXLA 1M1KC 1X6OA 2HIXA 3CCSA 2UUCL 4B3SL 1G291 4DUZL 4JV5Q 4BBRG 5IT9c 4A3MG 2BH2A 4NB3A 3I4NH 2E2HH 4BBSG 4YWMA 2VL6A 4JI5L 2CKZB 3RZDH 2VUMH 2BH8A 1L0WA 5JEAJ 2UUCQ 2IX0A 2K52A 1HNXQ 3S16H 4A93G 1D7QA 4FDBA 3GDEA 2MFIA 1N33L 1YNXA 3I56A 2RF4A 2IY5B 1IBMQ 2R92G 1SROA 3CCVA 2JJQA 1OXXK 1E1OA 1N33Q 1YJNA 1PH1A 4LUOA 2VNUD 1PYBA 3G4SA 3PUXA 4R4OA 4GOPC 4O2DA 4R1JA 4P75A 4LF4Q 1KHIA 3S2HH 4WJ4A 4X66L 2ES2A 4LF5L 1EWIA 4DK3C 4R4TA 5IYBH 1KC8C 2VQEL 4JBWA 4HIKA 4DUYL 2R93H 3H0GG 2VW9A 1YHQA 3KJOA 1S3OA 3RLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZH A;  4A3L H;  2WB1 E;  4JI7 L;  2Y0S E;  4MNO A;  3J80 i;  3J7Z C;  4LF5 Q;  1Q1E A;  1IBK L;  2Z6K C;  2VQE Q;  1Q7Y C;  3I2Z A;  4DV6 L;  4DUY Q;  3M7N A;  4Y52 H;  1CKO A;  2ZTE A;  3OYY A;  4JI7 Q;  3GTM H;  1JJC B;  1IBK Q;  5C4X H;  4LW1 A;  4QGU A;  2ATW A;  4ME3 A;  2I5M X;  4LWC A;  5M3F H;  1HR0 Q;  4PG3 A;  3MXN B;  4DKA C;  3AQQ A;  5C0X I;  3A5Z B;  1FVI A;  4A76 A;  1OTC A;  3GTG H;  3TRZ A;  4A3C H;  3SGI A;  4A3K G;  1HH2 P;  4OO1 I;  1SLJ A;  1G51 A;  5DLQ E;  4BY1 G;  2ZTD A;  1UWV A;  1VQG A;  2JK8 A;  1X3F A;  4DNI A;  3CC7 A;  1WI5 A;  3D31 A;  4A93 H;  1SMX A;  3K80 C;  4X62 L;  2RHQ B;  4AIM A;  3J81 i;  1E22 A;  1Q82 C;  4OWX B;  5J3B A;  2DUD A;  3PSI A;  1QVF A;  1BBU A;  2LXK A;  2UXC L;  3E9I A;  3ERS X;  3KYH C;  4YY3 L;  1K73 C;  3I4M H;  1X3G A;  4POF A;  5AJ3 L;  3KF6 A;  3KFU A;  4B3T L;  4X62 Q;  1K3R A;  2YU9 H;  1CKM A;  1SRU A;  2BA1 A;  2MO0 A;  2R92 H;  2CFM A;  4KI0 A;  5GRO A;  1SE8 A;  5M5W H;  2UXC Q;  5ELO A;  3B6Y A;  3FHW A;  3GTL H;  4HJ8 A;  4YY3 Q;  2JA5 G;  1TXY A;  5AJ3 Q;  1L2F A;  3NBH B;  2K50 A;  1E24 A;  1FGU A;  4B3T Q;  4QIW E;  3I4N G;  4DR7 L;  3ULJ A;  1VQK A;  4LF7 L;  5FJ8 G;  3KLW A;  3HOW G;  2ALY B;  1PH2 A;  4A4I A;  3OTO L;  4GN4 B;  2VUM G;  3HOZ H;  4OX9 L;  3M9B A;  3JAM i;  1VQJ A;  3I4O A;  3H0G H;  1VQE A;  5LMN W;  3NEN A;  4AQY Q;  1EIF A;  4JI6 L;  5JJI A;  3BJU A;  3NEL A;  3G71 A;  3J81 j;  1I5F A;  1U0L A;  2KHJ A;  3BU2 A;  4A75 A;  4DR4 L;  4GN5 A;  3CCE A;  3RR5 A;  5C44 G;  4NPS A;  1J6Q A;  3TRE A;  4JI6 Q;  4HIO A;  3PCO B;  3RLO A;  2B3G A;  1XMO L;  2DGY A;  3GTJ H;  4JI2 L;  1K8G A;  3K7U C;  4GNX B;  4A3G G;  3A74 A;  4X6A H;  2GVA A;  1VQF A;  3CP0 A;  2CCZ A;  3CMA A;  1SN8 A;  1GO3 E;  2EQS A;  2KCM A;  3E0E A;  4P72 A;  1JJ2 A;  1XMO Q;  1C7Y A;  4JI2 Q;  2JQO A;  1YI2 A;  2OQ0 A;  3CCJ A;  4DV2 L;  3RN2 A;  2HT1 A;  1KD1 C;  3L7Z C;  4IPD A;  4TQU S;  2NVT H;  3K7A H;  2AKW B;  2A1A A;  1CUK A;  1O7I A;  1L1O B;  2IHE A;  4BY1 H;  4GKK L;  1JJG A;  1P16 A;  1Z9F A;  4DV2 Q;  1KIX A;  4IJL A;  4TVA B;  5FLX c;  4KHZ A;  2UXB L;  3AYH B;  2KHI A;  4DR2 Q;  4DR3 L;  4LNQ A;  4GKK Q;  3TEH B;  5EAY A;  3CME A;  1FL0 A;  4AYB E;  4R4I A;  1PH9 A;  5C4X G;  4BA2 I;  3TQY A;  1G6P A;  4KLK A;  2QEX A;  5M3F G;  3PUV A;  2Z0S A;  2OWO A;  3S17 H;  3G48 A;  3HKZ G;  1L1O A;  2WAQ E;  3UE0 A;  4HID A;  4DR3 Q;  2JA5 H;  1BKB A;  1VCI A;  3I55 A;  4A3C G;  1Z47 A;  4NXM L;  3U4V A;  3GTQ H;  3W1B A;  1HNX L;  1X55 A;  4POG A;  1WCM G;  1XPR A;  1W3S A;  1WYD A;  1XPU A;  5FJ8 H;  3HOW H;  3F1Z A;  1HJP A;  4IPH A;  3PIP A;  4UPA A;  4PZ6 A;  1VQ7 A;  4NXM Q;  3S15 H;  4DK6 C;  4A3I G;  1R9T H;  1IBM L;  3TS0 A;  1FJG L;  4OXP A;  4DAY B;  3I4M G;  4R4C A;  2AWN A;  5IP9 H;  3F2C A;  1VQM A;  1VQ9 A;  1VQO A;  1NMG A;  5C44 H;  1YZ6 A;  4OWT B;  4LF4 L;  1FJG Q;  3J7A 5;  3UDG A;  1Q46 A;  1HNZ L;  1E3P A;  1HZB A;  1NE3 A;  5HY6 A;  5IYD H;  2EIF A;  3W1G A;  1K9M C;  2NN6 G;  4A3G H;  4P73 A;  2Q2I A;  1ASY A;  4JYA L;  1K83 H;  2FXQ A;  3ICE A;  3PGZ A;  1UE6 A;  1HNZ Q;  3HOZ G;  3HOY H;  1Q8K A;  3HOV H;  4GNX C;  4GS3 A;  2B63 G;  1XNQ L;  4JYA Q;  3M4O H;  3Q8D A;  3H15 A;  5JEA G;  4X65 L;  2JA9 A;  4DV7 Q;  2ASB A;  3PO2 G;  1NBW A;  1U5K A;  4PMW A;  3CF5 A;  4ALP A;  1PH3 A;  4RMF A;  3VDY A;  1VQL A;  2RHS B;  1YHA A;  3BZK A;  2UXD L;  2V1C C;  2XGT A;  5IE8 A;  2LSS A;  1HR0 L;  1XNQ Q;  3S24 A;  1I3Q H;  2JE6 I;  1MJE A;  3S2D H;  1OXV A;  3UE1 A;  2PMZ E;  2VS1 A;  1L1O C;  4X65 Q;  3A5U A;  2R6G A;  1E1T A;  1A8V A;  3E9H A;  1C0A A;  1CKN A;  3ULP A;  2UXD Q;  5M5Y H;  2ZTC A;  3M85 A;  2CQO A;  3STB D;  3GD7 A;  1S40 A;  4GLV B;  4IOA A;  2WFW A;  1AE2 A;  1OXT A;  1WCM H;  3KF6 B;  1H95 A;  1AE3 A;  3W5O A;  2JA8 H;  4RG1 A;  4UP8 A;  2HIV A;  1RIP A;  1I6H H;  1WOC A;  1VQI A;  1Q86 C;  1MIU A;  2QGQ A;  1LTL A;  4A3I H;  2OCE A;  4A3J H;  3HOX H;  3IRB A;  1A62 A;  2IHF A;  3UDF A;  3CPW A;  2R7F A;  4L5T A;  3CXC A;  1VQ5 A;  3T1H L;  4JOI A;  1N9W A;  5IP7 H;  2KBN A;  2ZJQ A;  5H1S E;  2D0P A;  1TWA H;  3ULL A;  2JEA I;  1X3E A;  3K81 C;  3JAM c;  1VQP A;  2K14 A;  2YYZ A;  4BXX H;  1N32 L;  1HZC A;  1CSQ A;  3EBE A;  1VQA A;  3T1H Q;  1EFW A;  4B3R L;  2RCN A;  4JBJ A;  1ASZ A;  2KEN A;  2A8V A;  1EOV A;  1N32 Q;  4AQY L;  4JI3 L;  2CWP A;  3PUY A;  4B3R Q;  1LM0 A;  3JC6 6;  4IO9 A;  1YJW A;  1W2B A;  4B3M L;  2B63 H;  2E2J H;  1NMF A;  1PH5 A;  3I7F A;  1HNW L;  1K8A C;  2E5L Q;  4JI3 Q;  3PO2 H;  5C0X J;  4DV0 Q;  5IP9 G;  1Q1B A;  3CCM A;  1IXR A;  1P8L A;  1QVC A;  2Y0S G;  4QL5 A;  2YTX A;  1V1Q A;  3HFZ B;  3HKZ E;  4J15 A;  4DPG A;  4A3F G;  1S72 A;  1N34 Q;  2Q2U A;  4B3M Q;  2NVQ H;  3EN2 A;  1HNW Q;  4LFA Q;  4XIG S;  4P71 A;  2JA7 G;  4A3B G;  5IYD G;  2D62 A;  1V43 A;  2CWA A;  2H5X A;  2PI2 E;  1EUJ A;  4DR5 L;  2R7Z G;  1XNR L;  4HJ7 A;  3HOY G;  5ELN A;  4K0K L;  3CD6 A;  3RNU A;  3HOV G;  2OTJ A;  2NN6 I;  1GD7 A;  1UE1 A;  5LMN L;  2MQH A;  4DR5 Q;  1X9N A;  4DR2 L;  3NEM A;  1XNR Q;  4NXN L;  4WJ3 M;  2UU9 Q;  1A63 A;  4L5Q A;  3PIO A;  4K0K Q;  1QUQ B;  1KRT A;  4JOI C;  4DV3 L;  2F3I A;  3AFQ A;  2UUB L;  1PH7 A;  1NTG A;  4QQB X;  3PO3 H;  1Y14 B;  3F8T A;  4YHH L;  3GO5 A;  4JCV E;  5LMN Q;  5IY0 A;  3CCL A;  1OXS C;  1N36 L;  3RLF A;  5GAH C;  4C3H H;  4NXN Q;  4YWL A;  5M3M H;  4DV3 Q;  1NJI C;  4IFD J;  5K36 G;  1XMQ Q;  2UUB Q;  1Y1V G;  1WJJ A;  4R4Q A;  4L5S A;  4YHH Q;  2JA6 G;  3M4Q A;  4DV1 L;  2YTY A;  2YTV A;  1N36 Q;  1QUQ A;  4LUZ A;  2N8N A;  4QY7 A;  4AH6 A;  2IX1 A;  4YWK A;  2HQL A;  4JI8 L;  1NY4 A;  1YBY A;  1BVS A;  2K5N A;  1YVC A;  4YCW A;  5GAG C;  1MJC A;  4C2M H;  4LF8 Q;  3D0F A;  4MZ9 A;  2JA8 G;  4DV1 Q;  1PV4 A;  1XJV A;  2PI2 A;  4JI8 Q;  3RZO H;  3T1Y L;  1Y1W H;  1KL9 A;  4A3J G;  3HOX G;  1M90 C;  1YJ9 A;  4L5R C;  4LFC L;  4JI1 L;  4IPC A;  4OWW B;  1X65 A;  1IL2 A;  3S1N H;  5IP7 G;  5IYC H;  3T1Y Q;  3M4P A;  1PH6 A;  4JI0 L;  4DV4 L;  2ZM6 L;  4UY8 C;  3CCR A;  4A3F H;  1PHJ A;  4LFC Q;  2A19 A;  4BXX G;  3PV0 A;  4JI1 Q;  1JB7 A;  3BZC A;  4IFD G;  2JA7 H;  4A3B H;  4MTN A;  4JI0 Q;  3J80 c;  2ID0 A;  4DV4 Q;  2ZM6 Q;  4HJA A;  3HOU H;  4KHP Q;  4Y7N H;  1X54 A;  1SR3 A;  2R7Z H;  2C35 B;  3AFP A;  4B3S Q;  4DV7 L;  2K4K A;  4DUZ Q;  1IYJ B;  2GVB A;  5GQO A;  3PUZ A;  1CKN B;  1VQB A;  2VZA A;  2I0Q A;  2Q2H A;  4O0A A;  3RN5 A;  4JI5 Q;  1LYL A;  2R7D A;  1PH8 A;  1JT8 A;  1TWG H;  2WP8 J;  1GVP A;  1YIT A;  1HR0 W;  4YCV A;  3LGJ A;  1DGS A;  3STB C;  1SFO H;  3KF8 B;  1UEB A;  3S1Q H;  2AWO A;  1QVG A;  3WWV A;  2NZO A;  3CAM A;  4UP9 A;  1PH4 A;  4AYB G;  4IJH A;  1JMC A;  4LFB L;  1E7Z A;  1TWH H;  1WFQ A;  1Y1V H;  2ZJR A;  2JA6 H;  3J81 c;  4HIM A;  3KOJ A;  3KDF B;  4IPG A;  4GLA C;  4YCU A;  2WAQ G;  5GAE C;  5LMU L;  2MNA A;  1QZG A;  1VQD A;  3F2B A;  1VQN A;  4LFB Q;  4X66 Q;  4HJ5 A;  2VY3 A;  5C3E H;  5LMU Q;  2F4V L;  3MEF A;  3HKS A;  1VQC A;  2K5V A;  1JE5 A;  2NVY H;  3U50 C;  1X56 A;  1A0I A;  2GN5 A;  3CCU A;  4GN3 B;  1EYG A;  3PO3 G;  4HJ9 A;  3A0J A;  2OQK A;  3KDF A;  4BY7 G;  1RL2 A;  2EXD A;  2ZJP A;  2F4V Q;  5M3M G;  3FKI G;  4DV6 Q;  1T9H A;  2OTL A;  1YIJ A;  1C9O A;  4JI4 L;  4BBR H;  3ER0 A;  4A3M H;  2BA0 A;  2HHH L;  3DM3 A;  3GTK H;  4BBS H;  2E8G A;  1XPO A;  1TWC H;  2AMC B;  5FLM G;  1N8R C;  4C3I H;  2E2I H;  4JI4 Q;  4DR1 L;  1KAW A;  1KRS A;  2XTI A;  2E5L L;  1GM5 A;  4XTC S;  4DV0 L;  1UE5 A;  4LF6 L;  1EQR A;  2HHH Q;  4A3D G;  1KQS A;  3F2D A;  1Y1W G;  4EQ5 A;  1N34 L;  2N78 A;  4BA1 I;  2I5H A;  5HGQ A;  4DR1 Q;  1MKH A;  3G6E A;  4LFA L;  4A3E G;  4LF6 Q;  1B8A A;  1LUZ A;  1UE7 A;  2WB1 G;  5M5X H;  2B29 A;  1VS0 A;  3UDI A;  4APV A;  2PQA B;  4DAM A;  3CQZ H;  1VQ8 A;  1D8L A;  3EIV A;  4EX5 A;  3S14 H;  2I5L X;  5C4J H;  5JJK A;  3K8A A;  2D0O A;  3PUW A;  1YEZ A;  5E7N A;  2L15 A;  4P74 A;  3HOU G;  1EIY B;  3TS2 A;  2K5H A;  1IZ6 A;  4PZ8 A;  2UUA L;  5JJL A;  3CPF A;  3U58 A;  3CC4 A;  4X64 L;  2NVX H;  2UU9 L;  4IFD I;  4LF9 L;  2PQA A;  4PZ7 A;  2N49 A;  3H3V H;  1HZA A;  4DV5 L;  2N3S A;  1B70 B;  4LF7 Q;  4DR7 Q;  2UUA Q;  4IOC A;  3S1M H;  3OTO Q;  4GKJ L;  4X64 Q;  2VQF L;  4GLX A;  4LF9 Q;  3PF5 A;  4OX9 Q;  1IBL L;  2JEB I;  4DV5 Q;  1VQ4 A;  1K0R A;  4GOP B;  1XMQ L;  2AHO B;  3CW2 C;  3L2P A;  5C0X G;  3U4Z A;  1J5E L;  3L0O A;  4GKJ Q;  3UDX A;  1CSP A;  2VQF Q;  2PNH A;  1HZ9 A;  4C3J H;  4BY7 H;  1AH9 A;  4DR4 Q;  3K0X A;  3FKI H;  1I50 H;  1IBL Q;  4QJF A;  4OON A;  5BR8 L;  2NZH A;  3GTP H;  4OO1 G;  3S1R H;  1PYS B;  2KCT A;  4LF8 L;  1J5E Q;  1PFS A;  3KJP A;  1I94 L;  5IYB G;  4A3K H;  3PF4 A;  3FP9 A;  5BR8 Q;  4GOP A;  2Q2T A;  3M3Y H;  4DR6 L;  2R93 G;  4JBM A;  5IYC G;  1YHB A;  5FLM H;  5IWA L;  1Q81 C;  4JBK A;  3CC2 A;  4A3L G;  1GKH A;  4JC0 A;  5C3E G;  1OXU A;  1V9P A;  1XTD A;  4JG2 A;  1I94 Q;  3GTO H;  4GNX A;  3H3V I;  3ZJY C;  4H02 A;  3AEV A;  4A3D H;  4DR6 Q;  1TWF H;  1PA6 A;  4LUV A;  5IWA Q;  3DLL A;  4UP7 A;  2QA4 A;  5GAD C;  2F52 A;  2IT1 A;  1VQH A;  2LXJ A;  2YV5 A;  1Q12 A;  2Z6K A;  3CCQ A;  3OW2 A;  2MO1 A;  4A3E H;  4JV5 L;  1PVO A;  2UXB Q;  1B7Y B;  2K75 A;  1EQQ A;  4KHP L;  1VQ6 A;  1BBW A;  1KXL A;  1M1K C;  1X6O A;  2HIX A;  3CCS A;  2UUC L;  4B3S L;  1G29 1;  4DUZ L;  4JV5 Q;  4BBR G;  5IT9 c;  4A3M G;  2BH2 A;  4NB3 A;  3I4N H;  2E2H H;  4BBS G;  4YWM A;  2VL6 A;  4JI5 L;  2CKZ B;  3RZD H;  2VUM H;  2BH8 A;  1L0W A;  5JEA J;  2UUC Q;  2IX0 A;  2K52 A;  1HNX Q;  3S16 H;  4A93 G;  1D7Q A;  4FDB A;  3GDE A;  2MFI A;  1N33 L;  1YNX A;  3I56 A;  2RF4 A;  2IY5 B;  1IBM Q;  2R92 G;  1SRO A;  3CCV A;  2JJQ A;  1OXX K;  1E1O A;  1N33 Q;  1YJN A;  1PH1 A;  4LUO A;  2VNU D;  1PYB A;  3G4S A;  3PUX A;  4R4O A;  4GOP C;  4O2D A;  4R1J A;  4P75 A;  4LF4 Q;  1KHI A;  3S2H H;  4WJ4 A;  4X66 L;  2ES2 A;  4LF5 L;  1EWI A;  4DK3 C;  4R4T A;  5IYB H;  1KC8 C;  2VQE L;  4JBW A;  4HIK A;  4DUY L;  2R93 H;  3H0G G;  2VW9 A;  1YHQ A;  3KJO A;  1S3O A;  3RLN A; 
#chains in the Genus database with same CATH topology
 4A3L H;  2WB1 E;  3HB9 A;  3Q8Q B;  1ENC A;  2L9H A;  1CZW A;  4Q44 A;  1Q7Y C;  4Y52 H;  1K3B C;  4O1N A;  2ZTE A;  2MP1 A;  2RBM A;  5DG7 A;  4C3J G;  3NTI A;  1ILQ A;  1M8A A;  2ATW A;  4ME3 A;  1HR0 Q;  4LWC A;  1SYC A;  3F8N A;  3ERO A;  3RZO B;  1PRT C;  5C0X I;  1Y1W B;  3A5Z B;  3KBX A;  4KKT A;  1VAJ A;  1BNZ A;  4R8I A;  3BDC A;  1FR3 A;  3BG3 A;  3S1N B;  4OO1 I;  1G51 A;  1WTW A;  4KV6 A;  5DLQ E;  2ZTD A;  1UWV A;  2D9U A;  1VQG A;  2IPK D;  4DNI A;  1U4L A;  1WI5 A;  4A93 H;  1SYD A;  1SMX A;  3LWB A;  2NZ1 D;  2F1M A;  1Q82 C;  5LYJ F;  2JA7 B;  4J9O A;  5I6Y A;  2W8L A;  4JI3 H;  4J9S A;  1Y1W A;  1TU2 B;  2EDG A;  4O42 A;  3I4M H;  1A3T A;  4KD3 A;  4HED A;  1K73 C;  2R7Z B;  4YAK B;  3D6W A;  2IBK A;  2YU9 H;  4KI0 A;  1SE8 A;  3B6Y A;  3FHW A;  3RD4 A;  3MWE A;  4YY3 Q;  1F9R A;  2AGP A;  3RV4 A;  1TXY A;  4P2C B;  2ASD A;  5AJ3 Q;  1A2U A;  2K50 A;  4B3T Q;  3I4N G;  3I8Z A;  4DR7 L;  1AN7 A;  1S4Z A;  3BVG A;  2CW0 C;  2ALY B;  2Z4H A;  2R7Z A;  4O4H F;  3S1Q B;  3K5L A;  1C48 A;  4OX9 L;  3M9B A;  2RQX A;  4EYH B;  1VQE A;  3NEN A;  5JEA H;  1PXU A;  5JJI A;  4CKC A;  2DWC A;  4A75 A;  3BU2 A;  1L0X B;  2JA6 B;  4DR4 L;  5LMN H;  1KDA A;  3KLS X;  3RR5 A;  2M00 A;  1STA A;  3QOL A;  2N88 A;  2DPJ A;  2JSO A;  3TRE A;  4JI6 Q;  2R8H A;  4CJ1 B;  2F0N A;  2W9C A;  2PNR C;  2I46 A;  5J39 A;  2FLP A;  3K7U C;  5FOB B;  1I6H B;  4A3G G;  5JVG 3;  1WSC A;  2GVA A;  2Z4I A;  3CP0 A;  2CCZ A;  3CMA A;  5LA6 F;  1C7Y A;  3NQT A;  2JA6 A;  4JI2 Q;  3VA7 A;  3AU7 A;  2A69 C;  2NTS A;  3GV7 B;  5E3F A;  4F8M A;  2A1A A;  1QE6 A;  4I55 F;  4UAI A;  1CUK A;  4B9W A;  2IHE A;  5KGU A;  1Z9F A;  4FS2 A;  3RGZ A;  3AYH B;  3U9O A;  4U68 A;  5KFA A;  4GKK Q;  2FE3 A;  5EAY A;  4AYB E;  5IGG A;  4C3I B;  5C4X G;  3R5X A;  4J9K A;  4F4W A;  1AZQ A;  4LFC H;  5M3F G;  4G7O C;  3J80 E;  3Q8R B;  2OWO A;  4HID A;  3UE0 A;  4DR3 Q;  4FXD A;  1GHJ A;  1BKB A;  1VCI A;  4QUF A;  3W1B A;  3F2U A;  1HNX L;  1AN8 A;  1XPR A;  5M5X B;  1SNQ A;  4MV4 A;  1BQQ T;  2LMC B;  3N43 B;  2R6F A;  2BE5 C;  4JI5 H;  3TQ1 A;  1WTH A;  2F4I A;  5J1Z A;  5BPF A;  3RF2 A;  3GIK A;  3X3M A;  1VQ9 A;  4DGZ A;  1VQO A;  1C3O A;  4OGQ C;  5CAE B;  4K2K A;  4OWT B;  1FJG Q;  4FBU A;  2F0M A;  1IOV A;  2Q8T A;  4EGQ A;  4E4T A;  4DL3 A;  5IYD H;  3PR4 A;  3W1G A;  2KVM A;  2NN6 G;  2YS7 A;  4A3G H;  4JYA L;  1ASY A;  3UQ8 A;  1K83 H;  2J6S A;  1MSH A;  1S0O A;  1HNZ Q;  2KEE A;  4TV8 F;  3KHR A;  3HOV H;  2W57 A;  2B63 G;  2EJM A;  4Q0F A;  1XNQ L;  3Q8D A;  4X65 L;  2JA9 A;  3PO2 G;  1B9N A;  4JV2 A;  3CF5 A;  1PH3 A;  3KK7 A;  3TN2 A;  2UVU A;  2UXD L;  2V1C C;  4ID6 A;  5IE8 A;  1KTK A;  3S2D H;  5KND A;  1B3A A;  5A2Q E;  5C1P A;  4F50 A;  1E1T A;  4FO2 A;  1A8V A;  2C00 A;  3WO0 A;  2D5D A;  3GTO B;  2ZTC A;  4ODG A;  2FPP B;  1TWF B;  3EA6 A;  2W6P A;  3TDQ A;  3WOE A;  3BQ0 A;  2UVV A;  5T1I A;  2I07 B;  5E4X A;  3BAA A;  4IOA A;  3D4R A;  4FXK C;  1OXT A;  3FRP B;  2MPM A;  2F0P A;  1BGW A;  4UP8 A;  3R5H A;  3NWS A;  4YBZ B;  1VQI A;  1WD0 A;  3K5N A;  3GLK A;  1LTL A;  2BR0 A;  4KKS A;  4K2L A;  5JVD F;  3UDF A;  2IHF A;  1TWF A;  5KFG A;  4O2A F;  3FMC A;  1KJ8 A;  1KNA A;  2PVP A;  1B9M A;  3T1H L;  3EYY A;  1U9R A;  2YRW A;  4XX0 B;  1TWA H;  5KT2 A;  3RBE A;  2YYZ A;  4FP5 D;  4HQ6 A;  4HMI A;  2W70 A;  1J8I A;  1CSQ A;  4MV6 A;  4UCO A;  2HD3 A;  1ASZ A;  2KEN A;  2NN6 H;  5KFI A;  5DLG A;  1PLF A;  5NUC A;  4TQS A;  3RIZ A;  3SR1 A;  4DR7 H;  2XIW A;  5A35 A;  3JC6 6;  4WOR A;  2B63 H;  2J6U A;  2DJG C;  3RUZ A;  1NMF A;  1PH5 A;  2XCP A;  4OX9 H;  2G9H D;  2A5H A;  4JI3 Q;  3PO2 H;  3IN5 A;  1LTG D;  5C0X J;  5D1O B;  1E2V A;  3TZU A;  1P8L A;  1L0Y B;  4J15 A;  2J4X A;  4DPG A;  2B2U A;  4ED8 A;  3BDO A;  4GKJ H;  3EN2 A;  4DR4 H;  1LT3 D;  1IBL H;  2R93 B;  4A3B G;  2A6E D;  2EOT A;  3C1E A;  2HDL A;  3Q1K A;  1EUJ A;  4DR5 L;  2EZV A;  1TII D;  2AQ2 B;  2WIN B;  5ELN A;  1S5B D;  4EBC A;  3T56 B;  3IAY A;  3J7Y W;  5KYI A;  2JEI A;  1UE1 A;  3DHQ A;  5CV8 A;  2M05 A;  1I94 H;  1ILP A;  2JEG A;  2MQH A;  2R93 A;  4EFE A;  3NEM A;  4EYI B;  3LX0 A;  3NXW A;  3H91 A;  3SE7 A;  2UUB L;  1KEE A;  4UHV A;  5EPJ A;  1Y14 B;  1ICF B;  5LMN Q;  3J7A V;  3CCL A;  3FDT A;  1QJO A;  4RAY A;  5K36 G;  3CHB D;  4L5S A;  4R4Q A;  5KFE A;  1SMY D;  3VYS A;  4A93 B;  1EUD B;  4JV5 H;  2WKC A;  4QY7 A;  4A2B A;  1UEA B;  2HQL A;  3I4M B;  2ZDG A;  1YVC A;  3RMH A;  3QFF A;  5KT6 A;  1VMC A;  2JA8 G;  1IW7 C;  2YU9 B;  1HNX H;  4MV1 A;  1SE3 A;  3VYR A;  2PI2 A;  4JI8 Q;  4J0M A;  4A3J G;  1FKA H;  2B2U C;  3HOX G;  1M90 C;  4HSV A;  4IPC A;  1GJX A;  2O2L D;  3M9M B;  2EE1 A;  5IP7 G;  4MTD A;  3M4P A;  2KED A;  3MFH A;  4LFC Q;  2WKD A;  1SSO A;  3PV0 A;  4BXX G;  4JI1 Q;  4IUR A;  3BZC A;  4JPB W;  4A3B H;  5H80 A;  4JI0 Q;  5EWF A;  2D2C C;  4HJA A;  2WV6 D;  2PW5 A;  2UVW A;  1SR3 A;  4PV1 C;  5CC4 A;  1RKN A;  3DEO A;  3AFP A;  4FYD A;  4NP5 A;  4IRC A;  3NSW A;  3PUZ A;  2V4D A;  4C3J B;  1CKN B;  1VQB A;  2C2R A;  3R5F A;  4LF5 H;  1KJJ A;  4JI5 Q;  1PH8 A;  1JT8 A;  4ECT A;  4ZK9 B;  1HR0 W;  1SFO H;  3GV6 A;  1UEB A;  5C0X H;  2UXD H;  5ELF A;  1GUG A;  1JC7 A;  3PIP 3;  5C3X A;  4MAM A;  5K2M A;  5EKL A;  4UP9 A;  4AYB G;  5K36 H;  4LFB L;  1STE A;  3MXU A;  5T14 A;  1H9S B;  3CU7 A;  5EDW A;  4HMJ A;  2Q8R E;  5JVH 3;  3ZYY X;  1SYE A;  3K5M A;  3OWE B;  4HJ5 A;  2EVB A;  5IOC A;  5LMU Q;  2KOL A;  1VQC A;  3U50 C;  5IGD A;  4Q0Y A;  3TZD A;  4GN3 B;  2F0H A;  2IX3 A;  1EYG A;  1I4R A;  3CRL C;  4HJ9 A;  3PO3 G;  3I4N B;  1VDZ A;  5KFM A;  1H9S A;  5I2Y A;  2EPB A;  2H1E A;  1B6R A;  1T9H A;  2EYP A;  3A56 A;  2BQ3 A;  2W9A A;  2HCC A;  1BO0 A;  4FF3 A;  3L4K A;  4JI4 L;  2R86 A;  4CBV A;  4BBR H;  3V96 A;  4ZCK A;  4A3M H;  3DM3 A;  4RH6 A;  2E8G A;  4HTH A;  2AMC B;  4IWX A;  2PCF B;  4DR1 L;  1KAW A;  1KRS A;  2XTI A;  4DV0 L;  1UE5 A;  1Y1W G;  3LP8 A;  4UFZ A;  4O4L F;  2N78 A;  2IMW P;  4MA0 A;  2I5H A;  1F77 A;  1S5E D;  4A3G B;  2OT2 A;  1WH2 A;  1RJR A;  1LUZ A;  2F3W A;  2QW7 A;  2FPG B;  2PQA B;  3BVZ A;  3CQZ H;  1JWU D;  2Y0S A;  1FNW A;  3EIV A;  1U4R A;  5C6A A;  1VKZ A;  5C4J H;  5JJK A;  3K8A A;  2D0O A;  1BBX C;  1LLR D;  4P74 A;  2LFN A;  1EEI D;  2K5H A;  1XMO H;  5KRU A;  4QW9 A;  3SVM A;  3TIG A;  2F0E A;  1K83 A;  5IOD A;  3S2D B;  2HQE A;  5KYL A;  3KHL A;  2LKV A;  1SE4 A;  1O7L A;  2PQA A;  3GP7 A;  2N49 A;  4HR7 B;  5KG3 A;  4DV5 L;  4DR7 Q;  2N3S A;  2K01 A;  5FLX E;  4QWA A;  4KN4 C;  3NP8 A;  2A68 C;  2VQF L;  2JXM B;  1VBH A;  4OX9 Q;  5IYZ F;  4OEL B;  1F9Q A;  4GOP B;  2X6G A;  3IG0 A;  3CW2 C;  4IR9 A;  3N8D A;  3U4Z A;  1J5E L;  4GKJ Q;  2UUB H;  1HZ9 A;  4ZHQ F;  4HR7 A;  4DR4 Q;  1DON A;  2QCP X;  1I50 H;  4DAV A;  1IBL Q;  4QJF A;  5BR8 L;  1PDQ A;  4YQW A;  3GIP A;  2KCT A;  4ETS A;  3J81 W;  2F0V A;  2HVS A;  3OMC A;  4ED7 A;  4FXG C;  3PF4 A;  1JOK A;  3FP9 A;  4GOP A;  2R8I A;  3M3Y H;  4JBM A;  1QIL A;  4NXM H;  4JBK A;  3CC2 A;  1TWA B;  3SK6 A;  1OXU A;  1I94 Q;  4HYK A;  3OWF A;  4GNX A;  3H3V I;  2E2D C;  3MR2 A;  1PA6 A;  4A2A A;  3QWN A;  1LTB D;  3DLL A;  1XWE A;  2LXJ A;  2Q2T A;  1Q12 A;  2Z6K A;  4Q8E A;  4N8F A;  2Z1C A;  1QB5 D;  4KHP L;  1TWA A;  1BBW A;  2B63 B;  2V4Q A;  1MI2 A;  3PIO 3;  1G29 1;  4JV5 Q;  3PO2 B;  4ZKC B;  3MWM A;  1B50 A;  4RNM A;  4C3I G;  3RZD H;  2VUM H;  2BH8 A;  1L0W A;  2L11 A;  1D7Q A;  1HNX Q;  2V4R A;  3VR4 A;  4S3S A;  4HNT A;  1PMR A;  5G3L F;  2B63 A;  1K8M A;  1YNX A;  3I56 A;  2IY5 B;  2KQ3 A;  1AEX A;  4HNU A;  4CDD C;  3ND8 A;  1EL0 A;  2V9W A;  3CCV A;  3KAJ A;  5ELD A;  2FB9 A;  4FF1 A;  3W3A A;  4CDE C;  4IRK A;  5IGC A;  3PW2 A;  1EYA A;  4GOP C;  3S2H H;  2QYZ A;  2DNC A;  3OHB A;  2VQE L;  5KFS A;  2NUC A;  2F0T A;  2K5Q A;  3KJO A;  3K5I A;  5EBC A;  5HV6 A;  3DF7 A;  1QZH A;  5DLF A;  2Y0S E;  4LF5 Q;  2EYF A;  1IBK L;  3RB6 A;  2Z6K C;  1PRT F;  4DUY Q;  1CKO A;  1SYB A;  5BPH A;  4NW2 A;  2RSO A;  3T4A C;  2SDF A;  4JI7 Q;  2EXZ A;  1JJC B;  2F0K A;  2XWJ B;  3HZX A;  4LW1 A;  5LOV F;  1JOR A;  4CC6 A;  1Y69 U;  2H4O A;  3GQC A;  4J8Q A;  3KLR A;  1C30 A;  1DCZ A;  1FVI A;  4A76 A;  4ZKB B;  1OTC A;  1JIH A;  3P75 A;  4PQX A;  4A3C H;  1EWH A;  1DOK A;  3H09 A;  3SGI A;  2V5A A;  1X3Q A;  2WB1 B;  1I7L A;  5JAV A;  4BY1 G;  1V1O A;  1I4G A;  3K80 C;  1PYW D;  2RHQ B;  4AIM A;  4X62 L;  3J81 i;  4A3B B;  4DV0 H;  4OWX B;  5J3B A;  2ZJT A;  3PSI A;  1QVF A;  2UXC L;  3E9I A;  3KYH C;  2K5D A;  3KF6 A;  1B44 D;  3V6J A;  2WB1 A;  2MO0 A;  3C46 A;  5GRO A;  1Y8O B;  4PMC A;  3SK8 A;  3GTL H;  2W6O A;  1WR2 A;  2CH4 A;  4DF7 A;  4YIJ A;  5KT5 A;  2CVR A;  3NGD A;  3NBH B;  5IT9 W;  4QIW E;  3ULJ A;  4LH7 A;  4A4I A;  4O3Q A;  4GN4 B;  5BN5 A;  1SFO B;  1A3U A;  1VQJ A;  3I4O A;  4XYO A;  2XD4 A;  3M7G A;  5LMN W;  1EIF A;  4DV5 H;  2F0G A;  4BWG B;  3NEL A;  3EPG A;  1PZJ D;  2GA4 B;  1U0L A;  3J81 j;  5CA0 F;  3PZP A;  1SFO A;  3MR6 A;  3PCO B;  1ENF A;  3GTJ H;  2NBF A;  2F3V A;  3LWU A;  5KNB A;  1J5E H;  1QWY A;  1N36 H;  1IKL A;  5EQ0 A;  5JPN C;  1BNC A;  1SYX B;  3Q24 A;  4RFB A;  1GO3 E;  2EQS A;  3E0E A;  1JJ2 A;  1XMO Q;  4LK1 C;  3HOX B;  2QK4 A;  3CKI B;  3IFT A;  2OQ0 A;  4DV2 L;  1YI2 A;  1WD1 A;  1T36 A;  3RGX A;  5ELE A;  5EKK A;  5I6W A;  1KD1 C;  1W93 A;  4IPD A;  1JB3 A;  1RYR A;  4RWS C;  1GSA A;  5DQI A;  4CC5 A;  1L1O B;  4BY1 H;  1JJG A;  1P16 A;  1KIX A;  4TVA B;  2UXB L;  3QZ7 A;  4BBR B;  4A3M B;  2RGR A;  1PTO C;  1B33 N;  2MCT A;  4J9R A;  3C3L A;  3TEH B;  1FL0 A;  3GTM A;  3BS1 A;  1PX2 A;  3Q8P B;  1G6P A;  3ONA B;  2Z0S A;  5D3D A;  3G48 A;  4F87 A;  1L1O A;  2F0S A;  2PW7 A;  2QIL A;  4IUU A;  1TAE A;  3R3O A;  1G2T A;  4KHP H;  4O3O A;  4QF4 A;  1SDF A;  4IZ8 A;  3VA5 A;  2EYM A;  1DV2 A;  1WCM G;  3H4B A;  4TSS A;  1EOT A;  3JRW A;  1GUT A;  3CQZ B;  2R82 A;  2DNE A;  1HJP A;  1RHP A;  3PIP A;  3NPP A;  4NXM Q;  2FK2 A;  5CV4 A;  5EWG A;  2R8J A;  3MFY A;  5C4J B;  4A3I G;  1R9T H;  1IBM L;  3TS0 A;  1BR9 A;  4YJ3 F;  2C28 A;  4OEM B;  3V2T A;  1FYC A;  2JEJ A;  3OHX C;  4OXP A;  4AYB B;  3I4M G;  4R4C A;  1BDO A;  5C5L A;  5LP6 F;  1NMG A;  4KY5 A;  5KFD A;  1DV1 A;  2R92 A;  4KN7 C;  3H40 A;  1CZG A;  1Q46 A;  1E3P A;  4IUN A;  1NE3 A;  3V4S A;  2EIF A;  1UC8 A;  1K9M C;  3RB4 A;  4KMU C;  2W9B B;  3MAQ A;  3TQT A;  2FXQ A;  4DNR B;  2A6H D;  5KFX A;  1Q8K A;  5FD5 A;  2KUM A;  5L9X A;  3E5S A;  4CGY B;  1JR0 D;  1K1Q A;  4Q8F A;  1I50 B;  3A8I E;  2R84 A;  5JEA G;  4ULL A;  1EFI D;  1HXY D;  4IUT A;  4ALP A;  4RMF A;  3VDY A;  1VQL A;  1YHA A;  1YNJ C;  2W9B A;  2LSS A;  5C5J A;  1OXV A;  3M3Y B;  2VS1 A;  1L1O C;  1SNO A;  3I73 A;  2ZXR A;  3HS0 C;  3ULP A;  1DXM A;  2QDB A;  5M5Y H;  4O3S A;  3IL8 A;  1I50 A;  4K5W A;  5JPM C;  4K8J A;  5D3I B;  1I4X A;  1HCZ A;  1K28 A;  3STB D;  4F7X A;  3ORQ A;  2WFW A;  1AE2 A;  3KF8 A;  1WCM H;  2Z6B A;  5FPO A;  2AQ4 A;  1II3 A;  3SK4 A;  3GV5 B;  2FK1 A;  1R4Q B;  1RIP A;  1WOC A;  1EIG A;  1TS2 A;  4PDB A;  4LMQ D;  4A3I H;  4QW8 A;  2OCE A;  2SNS A;  3PQI A;  1Q90 A;  4X62 H;  1RJP A;  3CXC A;  4WBN F;  2UXC H;  1F2Y A;  3RB3 A;  3RZD B;  1GSH A;  2D0P A;  3K81 C;  2XNA C;  3JAM c;  1TQO A;  1N32 L;  2F0U A;  4RUC A;  1VQA A;  4B3R L;  5KFO A;  3WOF A;  4RZQ A;  5J2U F;  4KJN A;  3GQB A;  3ORR A;  1A15 A;  1EY8 A;  2VUM A;  2KA7 A;  4RU9 A;  2W9C B;  2EYO A;  1CHP D;  3A7A B;  2IA6 A;  4B3M L;  4X64 H;  2A6E C;  4ZUI A;  1ONL A;  1HNW L;  4EQO A;  3S2H B;  2DLN A;  5FPR A;  4DV0 Q;  4EBD A;  3MC0 B;  2Y0S G;  4QL5 A;  1S72 A;  1ET6 A;  3HKZ E;  2X6L A;  4X3U A;  2RSN A;  4RCO A;  1SEB D;  4A3F G;  2VPQ A;  5KFY A;  2BOS A;  4U7C A;  3N6R A;  4XIG S;  2FP4 B;  4P71 A;  5IYD G;  2D62 A;  1W6K A;  1M7J A;  3OSO A;  5CYU A;  2RDJ A;  3Q22 A;  2JN4 A;  2ASJ A;  1XNR L;  2B2Y A;  3CD6 A;  3RNU A;  3HOV G;  1D2B A;  1F2M A;  4YR3 A;  1A63 A;  4NXN L;  1EHI A;  4DR6 H;  1SMY C;  2NYZ D;  5IGB A;  3PIO A;  4K0K Q;  1IKM A;  3KXY T;  4DV3 L;  5IWA H;  1PH7 A;  1TA8 A;  4Q43 A;  4QQB X;  4XYM B;  4U6P A;  4YHH L;  5IY0 A;  5EWE A;  2UXB H;  1F9S A;  3MVV A;  4YWL A;  3FEW X;  3K0Y A;  4MV7 A;  4IFD J;  4F88 A;  5JQW A;  1WJJ A;  2QF7 A;  5FO9 B;  4ED3 A;  3M4Q A;  4DV1 L;  1N36 Q;  2YTV A;  2N8N A;  4AH6 A;  4YWK A;  1ENA A;  1WTP A;  4C2M H;  1BUV T;  1ZYR D;  2J0T D;  1PV4 A;  4DK0 A;  2ICI A;  1WTO A;  1XJV A;  3GTL B;  1DD2 A;  1G2S A;  3T1Y L;  2XRS D;  2R85 A;  3OSN A;  3HBL A;  4FNF A;  1IBM H;  1KJQ A;  2W71 A;  2WDT A;  1N33 H;  4DV4 L;  4A3F H;  4DL7 A;  3HRZ C;  5T1G A;  1CQJ B;  4IFD G;  1E4F T;  2AGQ A;  2B2Y C;  3GTL A;  3BYY B;  2RDI A;  3HOU H;  4TUY F;  2ZM6 Q;  3C1F A;  4KHP Q;  1ROD A;  4Y7N H;  2O4X A;  1X54 A;  1GUW A;  3ND9 A;  3TP7 A;  3A8K E;  1IYJ B;  5GQO A;  2NU9 B;  3KHG A;  3GTJ B;  3M9N B;  2VZA A;  4I65 A;  2I0Q A;  4O0A A;  1FNU A;  2TMP A;  3DMU A;  3PW7 A;  3R93 A;  3T13 A;  2WP8 J;  5L1J A;  3TIN A;  1CA6 A;  3BA9 A;  4UCR A;  5JOB A;  1EY7 A;  2K33 A;  2AWO A;  1QVG A;  2VXW A;  4BY1 B;  3QJY A;  4IJH A;  3GTJ A;  2ZJR A;  1TWH H;  2Z9H A;  1F2L A;  2IP4 A;  3J81 c;  3GV3 A;  2FMC A;  4HIM A;  4YCU A;  3F2B A;  1LT4 D;  3ITP A;  5G3L D;  1RD9 D;  5C3E H;  3RBD A;  2F4V L;  2A74 C;  1DM0 B;  1HTL D;  2B2V A;  1X56 A;  2GN5 A;  3M4I A;  2G5D A;  2OQK A;  4BY7 G;  4G57 A;  1ZHS A;  4RB1 A;  2B2T A;  1SBB B;  2ZJP A;  2BDO A;  4O4I F;  2OTL A;  1LTI D;  4LH6 A;  3QO2 A;  1R9T B;  1YIJ A;  1HA5 A;  4IFD H;  3VPC A;  4CJ2 C;  1G8Z D;  2HHH L;  2BA0 A;  1BXT A;  2B8G A;  4DA2 A;  1CI3 M;  5DM6 3;  3O13 A;  3GTK H;  4BBS H;  1N56 A;  2LS0 1;  4B3R H;  1TWC H;  1N8R C;  1CQF A;  3D6C A;  2E5L L;  4LF6 L;  1GM5 A;  1RYS A;  1HHV A;  1EQR A;  5LXT F;  1STH A;  1PRT D;  4FS1 A;  4PMB A;  1KQS A;  1S10 A;  4WRD A;  1FNV A;  4DL6 A;  1R9T A;  4BA1 I;  5HGQ A;  2XGQ A;  4B3M H;  4LFA L;  5BN3 A;  4A3E G;  1UE7 A;  2WB1 G;  2GPS A;  1HNW H;  5BMV F;  4DAM A;  3GIJ A;  4QWD A;  5KG6 A;  1JX4 A;  4DL4 A;  1E2W A;  3PUW A;  3J80 W;  5FO7 B;  1CQV A;  3K57 A;  3TS2 A;  2UUA L;  4FF2 A;  1IYV A;  4C5A A;  1SEI A;  2UU9 L;  4LF9 L;  5J2T F;  1XNR H;  4OIK A;  1HZA A;  2B2V C;  1B70 B;  1EZ8 A;  3VR2 A;  1G91 A;  3N44 B;  4V0B A;  3S1M H;  1XDN A;  1QOH A;  3U9S A;  5M5Y B;  1STG A;  4X64 Q;  2EJF C;  1H9J A;  2B2T C;  1I4H A;  2DY8 A;  4MTK A;  1K0R A;  1XMQ L;  1LO5 D;  3L2P A;  1SNP A;  4KJO A;  5C0X G;  3BZD B;  3L0O A;  3GIM A;  1CSP A;  1WCM B;  2PNH A;  1RDP D;  4BY7 H;  1AH9 A;  4ABN A;  4IZO A;  3K0X A;  2NB0 A;  1LV9 A;  1JDE A;  3C2P A;  2NZH A;  4OO1 G;  1UC9 A;  3HG9 A;  2CW8 A;  4A3I B;  2RDH A;  1S0N A;  3KJP A;  3I12 A;  1CHQ D;  5IYB G;  1IL8 A;  3T5J A;  4A3K H;  4FVM A;  2K7V A;  4LAA A;  1GOZ A;  4RKB A;  5CV6 A;  5L37 A;  5EOY A;  1WCM A;  1GKH A;  4K6L A;  2A73 B;  3FPP A;  5COY A;  1KNE A;  2VA3 A;  3CRK C;  3AEV A;  1BCP F;  2AUK A;  3QB3 A;  5DM7 3;  1LT6 D;  4DR6 Q;  2NVY A;  4ME6 A;  5KFR A;  4LUV A;  5CGK A;  5IWA Q;  3T1Y H;  2L5T A;  5D14 A;  2QA4 A;  5GAD C;  2IT1 A;  2YV5 A;  1RK6 A;  4A3E H;  3CCQ A;  1O78 A;  3OW2 A;  2C5C A;  4ED0 A;  1MBY A;  2MO1 A;  2UXB Q;  1B7Y B;  3N52 A;  2K75 A;  3JAM W;  1M1K C;  5A2Q W;  3CCS A;  1B2T A;  2UUC L;  4B3S L;  4BBR G;  5IT9 c;  4A3M G;  4NB3 A;  4ZQ3 A;  1L2Z A;  2E2H H;  3QR8 A;  4YWM A;  2VL6 A;  4J9L A;  2HCI A;  4JYA H;  5KFL A;  2C2E A;  3GDE A;  4J9P A;  4C5C A;  2VB2 X;  3TP6 A;  1XNQ H;  2KSW A;  3RAQ A;  1Z2P X;  1IBM Q;  5I9P A;  2R92 G;  4X65 H;  3K59 A;  1EZ1 A;  1N33 Q;  2VNU D;  4LUO A;  3H6M A;  3K6O A;  2W6Q A;  4R4O A;  4R1J A;  4OO1 H;  3PVX A;  1ZKO A;  4X66 L;  4EEY A;  1CQI B;  1H9K A;  1KC8 C;  5IYB H;  3HXL A;  2NVX A;  4JBW A;  3OMG A;  4EVO A;  5EGT A;  2GLT A;  2CW7 A;  1S3O A;  3J80 i;  3J7Z C;  3LWE A;  2RKS A;  2CHB D;  1LTA D;  2R8G A;  3H4D A;  2YZN A;  4N9T A;  1T94 A;  3S9W A;  3GTM H;  1EEF D;  4QGU A;  2ZDH A;  2I5M X;  4HCS A;  3FKI A;  4PG3 A;  3MXN B;  4DKA C;  3T1H H;  3P7J A;  1EUC B;  3NWT A;  1HA6 A;  1EWC A;  3GTG H;  1X32 A;  4Y8V B;  4RAZ A;  1Q3L A;  1HH2 P;  1J9O A;  5KFQ A;  3MJF A;  3UFX B;  2Y0S B;  5C3W A;  5KG0 A;  1STN A;  4C2M A;  4A3F B;  3CC7 A;  3D31 A;  3JZI A;  2E5L H;  3MXN A;  3GID A;  2DUD A;  3K3V A;  4M9U A;  3HOU B;  2LXK A;  4EGJ A;  2C22 A;  2J7Z A;  4EG0 A;  4YY3 L;  4Y7N B;  3PMF A;  2P5Z X;  1K83 B;  4FF4 A;  5AJ3 L;  2XCA A;  3KFU A;  2ALZ A;  4B3T L;  4I4T F;  4LFA H;  2R92 H;  5E4W C;  1CKM A;  1SRU A;  2BA1 A;  2XGP A;  3T5K A;  4LJZ C;  3HOV B;  2EY5 A;  3J7A F;  1LTT D;  1L2F A;  2F0J A;  1E24 A;  1FGU A;  1EY9 A;  3ETH A;  3WDN A;  4LF7 L;  2K28 A;  3KLW A;  3HOW G;  4YR0 A;  1PH2 A;  2VUM G;  3HOZ H;  3AMU A;  2UUA H;  1RK5 A;  4DR5 H;  2FMA A;  1HQM C;  2EYJ A;  3JAM i;  1GSO A;  4FBT A;  2UU9 H;  2I87 A;  4JI6 L;  2W6Z A;  1IOW A;  4RB3 C;  1SCU B;  2KHJ A;  2HUG A;  4GN5 A;  3CCE A;  4NPS A;  3P1H A;  1EY0 A;  1J6Q A;  4I7A A;  3R2I A;  1XMQ H;  2UVR A;  3RLO A;  2B3G A;  4QIW B;  2DGY A;  4JI2 L;  1K8G A;  2R7M A;  5C3E B;  3MWY W;  4GNX B;  3A74 A;  3DXJ C;  1LAC A;  1VQF A;  1AUX A;  3D3R A;  3BG5 A;  1TWH A;  1SN8 A;  2SOB A;  1Z6H A;  1W6J A;  2PZU A;  1C4Q A;  2JQO A;  3CCJ A;  1PTO F;  4RUA A;  1RTO A;  2F0O A;  3L7Z C;  4TQU S;  3K7A H;  2AKW B;  3KBG A;  1V51 A;  1WTQ A;  1O7I A;  2JP1 A;  4GKK L;  4QIW A;  3MEH A;  3PW0 A;  3D4D A;  3MWD A;  4ECU A;  3NQI A;  2BDN A;  1LAB A;  4HAE A;  4KHZ A;  2KHI A;  4DR3 L;  3GTK B;  2YZG A;  2B2W A;  1TWC B;  3L3O C;  1PH9 A;  4R4I A;  1DIK A;  4IWY A;  4OHJ A;  1GUN A;  5IT9 E;  3DWQ A;  2QEX A;  4DFA A;  1XYI A;  2F0D A;  1SE2 A;  3J81 L;  2GPW A;  2WAQ E;  4A3C G;  4TKO B;  2BQU A;  1Z47 A;  1H9R A;  4C56 C;  1K1S A;  1X55 A;  4POG A;  4XYL B;  2UUC H;  4B3S H;  4RCN A;  5HGT A;  1WYD A;  1XPU A;  3GTK A;  1D1K A;  2PPB C;  3F1Z A;  2DJF C;  3P20 A;  3HOW H;  1TWC A;  4HN7 A;  4K8I A;  1VQ7 A;  3A55 A;  4L63 B;  3SE0 A;  2RGV A;  5KFJ A;  1FJG L;  2ZT9 C;  4MTE A;  2KCN A;  1Z2N X;  2VA2 A;  2AWN A;  3LML A;  1XX8 A;  4GC6 A;  5IP9 H;  3F2C A;  1VQM A;  1SXT A;  2A6H C;  4K5X A;  1NAP A;  4QCL A;  2JYO A;  5JVL A;  1YZ6 A;  5CMD A;  1HNZ L;  1HZB A;  5HY6 A;  3S1M B;  4EGV A;  3Q6S A;  1EU3 A;  1UAP A;  2W6M A;  2MHV A;  1HRJ A;  3V4Z A;  1SJH D;  4P73 A;  4HNV A;  1QCB D;  4XDX A;  3ICE A;  2B39 A;  4G4K A;  1KAB A;  1AZP A;  2XVS A;  5LL6 X;  3HOY H;  2WTF A;  2BQR A;  4LFB H;  5CA1 F;  4X66 H;  4GNX C;  4GS3 A;  4BY7 B;  3LNN A;  2HGS A;  3AB9 A;  2HJW A;  4JYA Q;  3QG1 A;  5DG8 A;  2ATL A;  1NBW A;  1U5K A;  1HUN A;  4XT1 B;  4QWE A;  2XGT A;  1XNQ Q;  5ELC A;  2JE6 I;  4A3K B;  1MJE A;  1XTC D;  3UE1 A;  2PMZ E;  4X65 Q;  4F4Z A;  2F0I A;  2K6A A;  4ZI7 F;  3BVM A;  3E3X A;  1C0A A;  5D8D A;  2UXD Q;  4TRD A;  1UNS A;  2M2L A;  1NR2 A;  4RKL A;  1EQT A;  3M85 A;  1U4M A;  1MHW C;  4F4Y A;  5L1L A;  5K5P A;  4GLV B;  4JI4 H;  4DLK A;  3KF6 B;  4A3E B;  1H95 A;  3OUU A;  4DXF A;  3TME A;  3R23 A;  1I6H H;  1JOQ A;  4J9M A;  1TY2 A;  3SK5 A;  1Q86 C;  1MIU A;  2MGS A;  4EFB A;  4LSA A;  5FLX W;  4DR1 H;  3HEJ A;  1D5Z C;  3CPW A;  2K1B A;  2E2H B;  4C3H G;  5DQG A;  4L5T A;  1B04 A;  4JOI A;  1S0M A;  5H1S E;  4YY3 H;  1H9M A;  3ULL A;  1GGO A;  1HTP A;  1X3E A;  4XZ3 B;  2VB3 X;  4ECW A;  2VUG A;  1HZC A;  3T1H Q;  1EFW A;  1EOV A;  4XQJ A;  2NU7 B;  4LSX A;  2E2H A;  4AQY L;  2Z8L A;  2CWP A;  5D65 A;  4JI3 L;  4LF7 H;  1LM0 A;  4ECX A;  4DU9 A;  1W2B A;  4JVZ A;  2O5I C;  1ET9 A;  4L6T B;  1BOS A;  4M7E A;  1CTM A;  2E5L Q;  2R8K A;  3CCM A;  1Q1B A;  4JI6 H;  1QVC A;  4QUC A;  4ZUJ A;  2XIG A;  2VQF H;  2Q2U A;  1AP0 A;  4L1K A;  4LFA Q;  4XQN A;  3K3P A;  5E1F A;  5EZY F;  5IT9 L;  1KDB A;  3KAL A;  1V43 A;  5IGF A;  2K05 A;  2CWA A;  4CKB A;  5KFK A;  3NE5 B;  5BR8 H;  4IN3 A;  3MR5 A;  3GTM B;  2NN6 I;  1GD7 A;  4ECY A;  3CVZ A;  5KT3 A;  5CV9 A;  5LMN L;  4DR5 Q;  1HUM A;  3MZ5 A;  4DR2 L;  1ZQ7 A;  2UU9 Q;  2CQY A;  4L5Q A;  2YZM A;  3HKZ B;  5C1O A;  4JOI C;  2V59 A;  2X0S A;  2F3I A;  3AFQ A;  1JKJ B;  4GKK H;  1NTG A;  4RGT A;  1E4E A;  1I3Q A;  3RLF A;  5GAH C;  4C3H H;  5KT4 A;  1ZYR C;  5M3M H;  2CZG A;  1CM9 A;  3OOC A;  2HVR A;  4IR1 A;  1XMQ Q;  2UUB Q;  1Y1V G;  3MTS A;  5KFV A;  1JWM D;  2R61 A;  3HKZ A;  4C1N I;  4CKE A;  3GTG A;  5KIX A;  5EBD A;  4JI8 L;  1NY4 A;  1YBY A;  1BVS A;  4YCW A;  4TV9 F;  3VMM A;  2EY2 A;  4M1U B;  1MJC A;  5GAG C;  2R92 B;  4J9N A;  1G6Z A;  5KG1 A;  4O3N A;  2R7L A;  4L5R C;  1CS0 A;  2DZD A;  1VF5 C;  1PRT B;  4LFC L;  4JI1 L;  1X65 A;  1FJG H;  3FPU B;  5EPL A;  3HOZ B;  4JI0 L;  5ELB A;  1EIH A;  3CCR A;  3JSL A;  3PR5 B;  2A19 A;  1S03 G;  4NDX A;  4B9X A;  4K14 A;  2PN1 A;  1Y8P B;  1V1P B;  3GIQ A;  3J80 c;  3QIA A;  1RTN A;  1I4P A;  1EYD A;  1CK1 A;  1WTR A;  2C35 B;  4B3S Q;  4DV7 L;  2K4K A;  1QG7 A;  3G6J B;  2GVB A;  1BCP D;  2EJG C;  1PFB A;  4IUQ A;  3G7L A;  3BQ1 A;  2Q2H A;  2VQE H;  2R7D A;  2L4N A;  1TWG H;  1YIT A;  1GVP A;  1V1P A;  3T51 B;  2M9V A;  1IBK H;  3KF8 B;  3MFG A;  3K7A B;  5EKI A;  2NZO A;  5DEH A;  3CAM A;  1PH4 A;  4YR2 A;  2OEO A;  1E7Z A;  1ESF A;  1UUP A;  1WFQ A;  1Y1V H;  3J7A K;  3KOJ A;  2OXP A;  3KDF B;  4IPG A;  4ED6 A;  5LMU L;  2WAQ G;  4RB2 C;  5FKA C;  5J22 A;  2MNA A;  1LT5 D;  1VQD A;  1QZG A;  4LFB Q;  2PO4 A;  1X3P A;  4X66 Q;  2C2D A;  2VY3 A;  3FDS A;  3I4L A;  3HKS A;  2PQE A;  3MEF A;  2NVY H;  3CCU A;  1M4V A;  2YL2 A;  2FK3 A;  1A0I A;  4H0L C;  4IAL A;  2K5W A;  2KCC A;  4YP3 A;  1TKW B;  3KDF A;  4RB0 A;  1Y8N B;  4DL5 A;  3FKI G;  1D6E C;  3HOW B;  2XN9 C;  2VUM B;  4XT3 B;  2O03 A;  4H13 C;  2RCF A;  4KKU A;  5IGE A;  3Q8S B;  3RAX A;  1C9O A;  2WYO A;  2PZW A;  1Z2O X;  4DNT B;  3ER0 A;  4MHE A;  3N6X A;  5FLM G;  4KK7 A;  3D8G A;  2E2I H;  4JI4 Q;  5IIF A;  1T5E A;  2YS6 A;  2AQ1 B;  4A3D G;  4AQY H;  5L1K A;  3F2D A;  1ICW A;  1N34 L;  1RF2 D;  4JK1 C;  3BAB A;  3OIP A;  5I47 A;  1PZI D;  1MKH A;  4DR1 Q;  2AGO A;  3Q23 A;  2NU8 B;  2B29 A;  1NR4 A;  3FVQ A;  3UDI A;  3HOY B;  1D8L A;  2ICE C;  4ZQI A;  4ECZ A;  4OL7 A;  1MD2 D;  4EX5 A;  1STB A;  3S14 H;  2I5L X;  5LL6 S;  2SEB D;  1SND A;  1YEZ A;  2JA7 A;  5E7N A;  2L15 A;  2WAC A;  2HDM A;  3HOU G;  4RGM A;  3X3N A;  1IZ6 A;  4PZ8 A;  5JJL A;  2ASL A;  3CPF A;  3CC4 A;  2NVX H;  3G6X A;  4PNY A;  1GXD C;  4PZ7 A;  3H3V H;  2AU0 A;  1BJT A;  4YB8 B;  4UCU A;  1KLU D;  4LF7 Q;  2L1B A;  3BQ2 A;  2IJ0 A;  4IOC A;  3PW5 A;  4DV2 H;  4GKJ L;  3U9T A;  4GLX A;  4YJ2 F;  5I2X A;  3SHL A;  4CJ0 B;  3PF5 A;  2JEB I;  1IBL L;  4DV5 Q;  4C5B A;  4DR2 H;  2AHO B;  2IW3 A;  1A2T A;  3UDX A;  2VQF Q;  1GHK A;  4TQR A;  4C3J H;  3RB0 A;  3FKI H;  1I7N A;  5COR A;  1S68 A;  3OSP A;  3GTP H;  1FD7 D;  1MZB A;  4J6H A;  4RGN A;  3S1R H;  4BS9 A;  4LF8 L;  1CE8 A;  1J5E Q;  3ETJ A;  1I94 L;  1PFM A;  1TY0 A;  2KJX A;  5BR8 Q;  1WTV A;  1PZK D;  1YHB A;  5FLM H;  1Q81 C;  4JI8 H;  4JC0 A;  5C3E G;  1M6V A;  2FMM A;  4KY7 A;  4MV9 A;  4JUZ A;  1PFN A;  3I90 A;  4A3D H;  2CQA A;  1KAA A;  1SAP A;  1SNC A;  4JV5 L;  1PVO A;  2CH4 W;  4JI1 H;  4RHS A;  1EQQ A;  1VQ6 A;  2QKI C;  4JI0 H;  3PW4 A;  4DUZ L;  2BH2 A;  1PTO D;  2E75 C;  4EBE A;  3I4N H;  4BBS G;  5KEE A;  1OWT A;  4X3T A;  5ISR A;  1UNN C;  5KFN A;  1EY6 A;  3S16 H;  4U67 3;  4DV7 H;  1B3Q A;  5KNC A;  5TSS A;  2MFI A;  1JOO A;  4ILW A;  4IQZ A;  1NCV A;  3OHA A;  2RF4 A;  1SNM A;  3E5N A;  2VQD A;  2FKL A;  3SDZ A;  1AFP A;  1SRO A;  3K58 A;  1TS3 A;  4L8J A;  1QNU A;  1YJN A;  1PH1 A;  4RNO A;  1PYB A;  4GC7 A;  1YNN D;  3PUX A;  4KTA A;  1EYZ A;  4O2D A;  4ED2 A;  5HUR A;  3D4W A;  5EJW A;  4WD3 A;  1E2Z A;  2SCU B;  2W6N A;  2ES2 A;  4LF5 L;  4ZYS A;  4H7B A;  3MXG A;  1O7Z A;  2DN8 A;  4C3H B;  4DUY L;  5M3M B;  3H0G G;  5LMU H;  2VW9 A;  4IRD A;  3RLN A;  2E74 C;  4MNO A;  4JI7 L;  1Q1E A;  2VQE Q;  2VPS A;  3SXH A;  3I2Z A;  4DV6 L;  3M7N A;  3W2D A;  3VYT A;  3DUZ A;  1JE4 A;  4MA5 A;  3G6V A;  5KFB A;  3OYY A;  3JAM E;  4RNN A;  1A3V A;  3G6Y A;  1WTX A;  4PWQ A;  1IBK Q;  4UCS A;  5C4X H;  2IL8 A;  2C9O A;  5M3F H;  1AUV A;  3AQQ A;  1YNJ D;  5KG4 A;  3RTX A;  3TRZ A;  4A3K G;  1N32 H;  1JIC A;  1SLJ A;  3MA2 B;  3T16 A;  3QOJ A;  1TS4 A;  1VF7 A;  2JK8 A;  1X3F A;  1WVL A;  5KFZ A;  2L12 A;  2RDF A;  3GTO A;  1E22 A;  4KHV A;  4ECV A;  1BBU A;  5I4D A;  3GIL A;  3ERS X;  2RVL A;  3T5L A;  1N34 H;  3TBI B;  1X3G A;  4POF A;  3EQL C;  5CBA E;  2FJZ A;  4X62 Q;  1K3R A;  4FM9 A;  3A7L A;  1CA5 A;  2CFM A;  5M5W H;  2UXC Q;  5ELO A;  4HJ8 A;  2JA5 G;  4LMY A;  2KHS A;  3A8J E;  1N48 A;  5CV7 A;  1TWG B;  4I7Z C;  1VQK A;  4EQP A;  2NTT A;  5FJ8 G;  1VMP A;  3OTO L;  1EYC A;  1RJT A;  1GYF A;  5C5M A;  1JWS D;  1Z7T A;  2RA4 A;  4MV3 A;  2R87 A;  1FGB D;  2NWG A;  3BDL A;  3H0G H;  3H94 A;  2OLS A;  4AQY Q;  4RHR A;  1Y1V B;  3BJU A;  4ZAI A;  3G71 A;  1I5F A;  2CW0 D;  1ZEQ X;  4ZLT F;  1TWG A;  5C44 G;  2XRQ D;  4NXN H;  3Q2O A;  1JQY D;  1QNK A;  4DV3 H;  4HIO A;  1I4Q A;  2FFK B;  1M0T A;  1SYF A;  1XMO L;  5DAU A;  2B8F A;  3VR5 A;  1EY5 A;  4YHH H;  3J80 L;  4R8N A;  1ESR A;  4X6A H;  3BJY A;  3RUP A;  2NVY B;  1Y1V A;  3EVQ A;  4P72 A;  2KCM A;  1I6V C;  5D1O A;  3JSN A;  4LF8 H;  2FIN B;  3RN2 A;  2HT1 A;  4DV1 H;  1D5M C;  2KEC A;  2NVT H;  2R7K A;  3E0J A;  1V4Y A;  5F9N A;  2W7P A;  4DV2 Q;  4IJL A;  5FLX c;  1RJQ A;  5KX5 F;  4XYQ A;  4DR2 Q;  4LNQ A;  4ZOL F;  2A69 D;  4RA8 A;  4N9P A;  3CME A;  1S9F A;  3MR3 A;  3OW7 A;  4BA2 I;  3TQY A;  2E2I B;  3SEB A;  2HVQ A;  3HP3 A;  4KLK A;  1NUC A;  3PUV A;  2L55 A;  3S17 H;  3HKZ G;  2W7O A;  2JA5 H;  4DV4 H;  3I55 A;  1KLG D;  4NXM L;  3U4V A;  5C4Z A;  3GTQ H;  1DOM A;  1D1I A;  4DUZ H;  1F9P A;  1W3S A;  2F0F A;  5FJ8 H;  4IPH A;  1D5X C;  4UPA A;  4PZ6 A;  2E2I A;  3S15 H;  3S14 B;  5KG2 A;  4DK6 C;  2J9G A;  4DAY B;  4K6D A;  2MJ8 A;  3L9A X;  1S5D D;  1PTO H;  2NVX B;  5C44 H;  5LL6 b;  2WAQ B;  4LF4 L;  2YU9 A;  3JAM L;  5CB4 F;  3OPO A;  5F2D A;  3UDG A;  5A2Q L;  2BE5 D;  3J7A 5;  3J81 E;  4QMG A;  2EYL A;  4NLG A;  1TT2 A;  2FLL A;  2Q2I A;  3Q0A A;  4DAY A;  3UI2 A;  3PGZ A;  1UE6 A;  4R9W A;  3MXP A;  2Q8I B;  3HOZ G;  5KFU A;  3V6H A;  5DGB A;  2WAQ A;  1A9X A;  1SYG A;  4WJW A;  2IWH A;  3M4O H;  3FKI B;  2L0C A;  3H15 A;  3GTP B;  3HGB A;  4DV7 Q;  2ASB A;  4DUY H;  1CFM A;  4PMW A;  3S1R B;  1Q8I A;  4DAP A;  2RHS B;  3BZK A;  4JI7 H;  1HR0 L;  4X3S A;  1I3Q H;  3S24 A;  3K5H A;  4QWB A;  2DY7 A;  5DG9 A;  4ECS A;  2F4V H;  5C4H A;  4DV6 H;  3A5U A;  1KJI A;  1B1Z A;  2R6G A;  4C2M B;  3E9H A;  4ECR A;  1CKN A;  2EYH A;  4ZRZ A;  3M4Y A;  3GTP A;  4A3D B;  5M9O A;  1LTS D;  2CQO A;  2AUJ D;  1V8Q A;  3GD7 A;  4M8A A;  1S40 A;  2YW2 A;  3NBI A;  3KUP A;  5KT7 A;  3W5O A;  2JEF A;  2JA8 H;  4RG1 A;  2HHH H;  2HIV A;  2R3Z A;  5DQH A;  2DPI A;  3I70 A;  3PN1 A;  5EPK A;  2QGQ A;  4JW0 A;  4A3J H;  1IHZ A;  2PMZ B;  1BXR A;  4LF6 H;  3RFC A;  3HOX H;  3IRB A;  1A62 A;  5BN4 A;  5GON F;  4R7R A;  4XQQ A;  2R7F A;  5I9O A;  1VQ5 A;  1N9W A;  2F0W A;  2KBN A;  5IP7 H;  2ZJQ A;  3R8B A;  2K04 A;  1HFN A;  3L4J A;  2JEA I;  3V05 A;  4F4X A;  4NKL A;  1VQP A;  3S16 B;  2K14 A;  4BXX H;  4ECQ A;  3EBE A;  4MIU A;  4MN3 A;  2RCN A;  4JBJ A;  1SJE D;  2A8V A;  2PMZ A;  3H3V C;  1N32 Q;  3PUY A;  1XXG A;  2OF1 A;  4X3K A;  1KC7 A;  5JUM A;  4B3R Q;  4IO9 A;  1T5X D;  1YJW A;  3OTO H;  2E2J H;  1ZHQ A;  3N42 B;  4Q5V A;  3I7F A;  5JJZ A;  4LF9 H;  1BCP B;  4RGO S;  1K8A C;  5FD6 A;  2ZDQ A;  1TWH B;  5IP9 G;  3VPD A;  1IXR A;  5IYC G;  3N40 P;  3MFI A;  2YTX A;  1V1Q A;  3HFZ B;  1N34 Q;  4B3M Q;  1B6S A;  1K0S A;  2NVQ H;  1OO9 B;  3T53 B;  1HNW Q;  2W8K A;  2MUY A;  2JA7 G;  4J1M A;  5CBE E;  4E6I A;  5KFC A;  4N8X 1;  1C8C A;  1KDC A;  3E6Z X;  2H5X A;  2PI2 E;  2FHT A;  2R7Z G;  4B08 A;  2VOB A;  3KTM A;  2K32 A;  3TP8 A;  4HJ7 A;  3HOY G;  4K0K L;  2PBZ A;  4YAJ B;  1S5F D;  4UDU C;  2OTJ A;  4Z9C B;  5C4X B;  3RV3 A;  1X9N A;  4WJ3 M;  1XNR Q;  1MGS A;  5M3F B;  1QUQ B;  1KRT A;  5LHY 1;  2QDL A;  3KHH A;  2YCH A;  3PO3 H;  3F8T A;  2EY1 A;  3GO5 A;  4JCV E;  1OXS C;  1N36 L;  4NXN Q;  4BBS B;  4GZY C;  1GUS A;  4MV8 A;  3NTK A;  4DV3 Q;  1NJI C;  1JLL B;  1GUO A;  1VBG A;  4YHH Q;  2JA6 G;  5CV5 A;  3OUZ A;  2YTY A;  1QUQ A;  4LUZ A;  2IX1 A;  4WFN 3;  1PK8 A;  2K5N A;  1IYU A;  4LF8 Q;  3D0F A;  4MZ9 A;  3K5O A;  4DV1 Q;  4QWC A;  5M5W B;  4EQN A;  3NTH A;  3RZO H;  1Y1W H;  4G7Z C;  1KL9 A;  4KY6 A;  5KFT A;  4V19 0;  2AQ3 B;  4OWW B;  5DGA A;  3I91 A;  3NHH A;  1IL2 A;  1BF4 A;  3S1N H;  2FPI B;  1EQV A;  5IYC H;  3T1Y Q;  1JDB B;  3EFX D;  1IW7 D;  3TP5 A;  2ZM6 L;  1PH6 A;  4UY8 C;  2VR1 A;  5KFF A;  1TS5 A;  1M0W A;  1PHJ A;  1ZET A;  1I6U A;  1BCP C;  2TSS A;  1JB7 A;  1O80 A;  3H0G B;  4LF4 H;  2JA7 H;  4MTN A;  1DJR D;  3T5H A;  2ID0 A;  4DV4 Q;  1DOL A;  1E0B A;  4J9Q A;  3KLS A;  2R7Z H;  2XC9 A;  4DUZ Q;  4RZR A;  5HBR B;  2LY7 A;  1B4O A;  2EY6 A;  4ME5 A;  3DM1 A;  3RN5 A;  1LYL A;  2XCL A;  4Q45 A;  2WE6 A;  3H0G A;  5CR3 A;  3MHB A;  2B2W C;  3FMA A;  4YCV A;  3LGJ A;  1DGS A;  3STB C;  5C8Y F;  4O2B F;  3S1Q H;  4FU0 A;  2R7N A;  4UCV A;  1HR0 H;  2NVT B;  3WNZ A;  3WWV A;  2NUA B;  3TSS A;  2NU6 B;  1KBL A;  3WO1 A;  3H20 A;  1JMC A;  1O75 A;  5KKN B;  2JA6 H;  3TII A;  4XXE A;  2I8C A;  4GLA C;  5GAE C;  3R2T A;  3BYT B;  5KFP A;  1VQN A;  3A54 A;  3VR3 A;  2F0Q A;  5D1P A;  4KD4 A;  2FJ2 A;  3S17 B;  4CDF C;  2K5V A;  1JE5 A;  1ZXT A;  2JA5 B;  1JXL A;  4IUP A;  4UCT A;  1KJ9 A;  4NMZ A;  3GTQ B;  3A0J A;  4O3P A;  1RL2 A;  2EXD A;  2WII B;  2F4V Q;  5JH7 F;  3V6K A;  5M3M G;  3N41 B;  1U4P A;  2F0L A;  4DV6 Q;  3DWA A;  3C0F B;  4I50 F;  1S97 A;  2YRX A;  3S15 B;  1JCK B;  4B3T H;  2I80 A;  1F2Z A;  2O5J C;  3URY A;  2JA5 A;  1W96 A;  1ULZ A;  2FLN A;  1EU4 A;  1DZ1 A;  2ENB A;  3GTQ A;  1XPO A;  3I3C A;  3GV8 B;  1AW7 A;  1PTO B;  3IKJ A;  4C3I H;  5C44 B;  2J6T A;  4G3I A;  5KG5 A;  4XTC S;  2HHH Q;  2OH2 A;  5FLX L;  4EQ5 A;  1CT1 D;  3G6E A;  4LF6 Q;  1GLV A;  1B8A A;  5M5X H;  1YJ9 A;  1VS0 A;  4APV A;  3GII A;  1VQ8 A;  1NSN S;  1T3N A;  4CDC C;  4IUV A;  5KFH A;  5L1I A;  1R4P B;  3M4O B;  1E4G T;  1EY4 A;  3VPB A;  1EIY B;  3JRX A;  4JI2 H;  3NUC A;  3VYU A;  1E4E B;  3U58 A;  4IFD I;  1I3Q B;  4X64 L;  4JV0 A;  2XSC A;  2K03 A;  2V58 A;  2ZXO A;  4BWS C;  4K0K H;  2UUA Q;  1NNX A;  3OTO Q;  2N55 A;  2E76 C;  1RCV D;  4IAJ A;  3NBH A;  4G7H C;  4LF9 Q;  4HCE A;  3GTG B;  1VQ4 A;  4O3R A;  4CHT B;  3DWP A;  4HSP A;  2JA8 B;  4DR3 H;  4OON A;  3BA8 A;  2A68 D;  3EJI A;  1PYS B;  1PFS A;  5KFW A;  4A3J B;  1HQR D;  3M9O B;  1ML0 D;  4K5V A;  3RJ0 A;  2P0A A;  1S5C D;  4R8U B;  2XWB B;  4DR6 L;  2R93 G;  4DL2 A;  1EZ6 A;  1MSG A;  5FK9 C;  5IWA L;  4A3L G;  1A6X A;  1V9P A;  1XTD A;  2QEJ C;  4JG2 A;  3GTO H;  3G8C A;  3ZJY C;  4H02 A;  1TR5 A;  1O7Y A;  1TWF H;  3QZ8 A;  4H44 C;  5F9L A;  4UP7 A;  4APM A;  2F52 A;  1VQH A;  2PZT A;  2X69 A;  1HFG A;  4R8U A;  1STY A;  4OIJ A;  2SNM A;  3IFD A;  1KXL A;  4DXG A;  1X6O A;  2ZM6 H;  2E2J B;  2HIX A;  2YYA A;  2PYK A;  3SI8 A;  5DNF A;  1HNZ H;  2DIK A;  4JI5 L;  2CKZ B;  1TVX A;  3DEP A;  3KAK A;  2UUC Q;  2NVQ B;  5JEA J;  4IHJ F;  2IX0 A;  2K52 A;  4A93 G;  4FDB A;  4ED1 A;  1YNN C;  1K8O A;  4C1N K;  1N33 L;  1HPC A;  5KG7 A;  3EPI A;  1B53 A;  3I72 A;  2BCO A;  4QB4 A;  2F03 A;  2JJQ A;  1OXX K;  1E1O A;  3CQZ A;  5FO8 B;  3NK9 A;  3ERQ A;  3G4S A;  4DN4 M;  4DK1 A;  4P75 A;  4LF4 Q;  1KHI A;  4WJ4 A;  4RAU C;  4AYB A;  2RDG A;  3PO3 B;  3VR6 A;  1EWI A;  4DK3 C;  4R4T A;  1DYQ A;  5AFW A;  4JV1 A;  2ZXP A;  4HIK A;  2R93 H;  4EEQ A;  4I7H A;  1LTR D;  1YHQ A;  2G9D A;  3OIQ A;  1AE3 A; 
#chains in the Genus database with same CATH homology
 1QZH A;  4A3L H;  2WB1 E;  4JI7 L;  2Y0S E;  4MNO A;  3J80 i;  3J7Z C;  4LF5 Q;  1Q1E A;  1IBK L;  2Z6K C;  2VQE Q;  1Q7Y C;  3I2Z A;  4DV6 L;  4DUY Q;  3M7N A;  4Y52 H;  1CKO A;  2ZTE A;  3OYY A;  4JI7 Q;  3GTM H;  1JJC B;  1IBK Q;  5C4X H;  4LW1 A;  4QGU A;  2ATW A;  4ME3 A;  2I5M X;  4LWC A;  5M3F H;  1HR0 Q;  4PG3 A;  3MXN B;  4DKA C;  3AQQ A;  5C0X I;  3A5Z B;  1FVI A;  4A76 A;  1OTC A;  3GTG H;  3TRZ A;  4A3C H;  3SGI A;  4A3K G;  1HH2 P;  4OO1 I;  1SLJ A;  1G51 A;  5DLQ E;  4BY1 G;  2ZTD A;  1UWV A;  1VQG A;  2JK8 A;  1X3F A;  4DNI A;  3CC7 A;  1WI5 A;  3D31 A;  4A93 H;  1SMX A;  3K80 C;  4X62 L;  2RHQ B;  4AIM A;  3J81 i;  1E22 A;  1Q82 C;  4OWX B;  5J3B A;  2DUD A;  3PSI A;  1QVF A;  1BBU A;  2LXK A;  2UXC L;  3E9I A;  3ERS X;  3KYH C;  4YY3 L;  1K73 C;  3I4M H;  1X3G A;  4POF A;  5AJ3 L;  3KF6 A;  3KFU A;  4B3T L;  4X62 Q;  1K3R A;  2YU9 H;  1CKM A;  1SRU A;  2BA1 A;  2MO0 A;  2R92 H;  2CFM A;  4KI0 A;  5GRO A;  1SE8 A;  5M5W H;  2UXC Q;  5ELO A;  3B6Y A;  3FHW A;  3GTL H;  4HJ8 A;  4YY3 Q;  2JA5 G;  1TXY A;  5AJ3 Q;  1L2F A;  3NBH B;  2K50 A;  1E24 A;  1FGU A;  4B3T Q;  4QIW E;  3I4N G;  4DR7 L;  3ULJ A;  1VQK A;  4LF7 L;  5FJ8 G;  3KLW A;  3HOW G;  2ALY B;  1PH2 A;  4A4I A;  3OTO L;  4GN4 B;  2VUM G;  3HOZ H;  4OX9 L;  3M9B A;  3JAM i;  1VQJ A;  3I4O A;  3H0G H;  1VQE A;  5LMN W;  3NEN A;  4AQY Q;  1EIF A;  4JI6 L;  5JJI A;  3BJU A;  3NEL A;  3G71 A;  3J81 j;  1I5F A;  1U0L A;  2KHJ A;  3BU2 A;  4A75 A;  4DR4 L;  4GN5 A;  3CCE A;  3RR5 A;  5C44 G;  4NPS A;  1J6Q A;  3TRE A;  4JI6 Q;  4HIO A;  3PCO B;  3RLO A;  2B3G A;  1XMO L;  2DGY A;  3GTJ H;  4JI2 L;  1K8G A;  3K7U C;  4GNX B;  4A3G G;  3A74 A;  4X6A H;  2GVA A;  1VQF A;  3CP0 A;  2CCZ A;  3CMA A;  1SN8 A;  1GO3 E;  2EQS A;  2KCM A;  3E0E A;  4P72 A;  1JJ2 A;  1XMO Q;  1C7Y A;  4JI2 Q;  2JQO A;  1YI2 A;  2OQ0 A;  3CCJ A;  4DV2 L;  3RN2 A;  2HT1 A;  1KD1 C;  3L7Z C;  4IPD A;  4TQU S;  2NVT H;  3K7A H;  2AKW B;  2A1A A;  1CUK A;  1O7I A;  1L1O B;  2IHE A;  4BY1 H;  4GKK L;  1JJG A;  1P16 A;  1Z9F A;  4DV2 Q;  1KIX A;  4IJL A;  4TVA B;  5FLX c;  4KHZ A;  2UXB L;  3AYH B;  2KHI A;  4DR2 Q;  4DR3 L;  4LNQ A;  4GKK Q;  3TEH B;  5EAY A;  3CME A;  1FL0 A;  4AYB E;  4R4I A;  1PH9 A;  5C4X G;  4BA2 I;  3TQY A;  1G6P A;  4KLK A;  2QEX A;  5M3F G;  3PUV A;  2Z0S A;  2OWO A;  3S17 H;  3G48 A;  3HKZ G;  1L1O A;  2WAQ E;  3UE0 A;  4HID A;  4DR3 Q;  2JA5 H;  1BKB A;  1VCI A;  3I55 A;  4A3C G;  1Z47 A;  4NXM L;  3U4V A;  3GTQ H;  3W1B A;  1HNX L;  1X55 A;  4POG A;  1WCM G;  1XPR A;  1W3S A;  1WYD A;  1XPU A;  5FJ8 H;  3HOW H;  3F1Z A;  1HJP A;  4IPH A;  3PIP A;  4UPA A;  4PZ6 A;  1VQ7 A;  4NXM Q;  3S15 H;  4DK6 C;  4A3I G;  1R9T H;  1IBM L;  3TS0 A;  1FJG L;  4OXP A;  4DAY B;  3I4M G;  4R4C A;  2AWN A;  5IP9 H;  3F2C A;  1VQM A;  1VQ9 A;  1VQO A;  1NMG A;  5C44 H;  1YZ6 A;  4OWT B;  4LF4 L;  1FJG Q;  3J7A 5;  3UDG A;  1Q46 A;  1HNZ L;  1E3P A;  1HZB A;  1NE3 A;  5HY6 A;  5IYD H;  2EIF A;  3W1G A;  1K9M C;  2NN6 G;  4A3G H;  4P73 A;  2Q2I A;  1ASY A;  4JYA L;  1K83 H;  2FXQ A;  3ICE A;  3PGZ A;  1UE6 A;  1HNZ Q;  3HOZ G;  3HOY H;  1Q8K A;  3HOV H;  4GNX C;  4GS3 A;  2B63 G;  1XNQ L;  4JYA Q;  3M4O H;  3Q8D A;  3H15 A;  5JEA G;  4X65 L;  2JA9 A;  4DV7 Q;  2ASB A;  3PO2 G;  1NBW A;  1U5K A;  4PMW A;  3CF5 A;  4ALP A;  1PH3 A;  4RMF A;  3VDY A;  1VQL A;  2RHS B;  1YHA A;  3BZK A;  2UXD L;  2V1C C;  2XGT A;  5IE8 A;  2LSS A;  1HR0 L;  1XNQ Q;  3S24 A;  1I3Q H;  2JE6 I;  1MJE A;  3S2D H;  1OXV A;  3UE1 A;  2PMZ E;  2VS1 A;  1L1O C;  4X65 Q;  3A5U A;  2R6G A;  1E1T A;  1A8V A;  3E9H A;  1C0A A;  1CKN A;  3ULP A;  2UXD Q;  5M5Y H;  2ZTC A;  3M85 A;  2CQO A;  3STB D;  3GD7 A;  1S40 A;  4GLV B;  4IOA A;  2WFW A;  1AE2 A;  1OXT A;  1WCM H;  3KF6 B;  1H95 A;  1AE3 A;  3W5O A;  2JA8 H;  4RG1 A;  4UP8 A;  2HIV A;  1RIP A;  1I6H H;  1WOC A;  1VQI A;  1Q86 C;  1MIU A;  2QGQ A;  1LTL A;  4A3I H;  2OCE A;  4A3J H;  3HOX H;  3IRB A;  1A62 A;  2IHF A;  3UDF A;  3CPW A;  2R7F A;  4L5T A;  3CXC A;  1VQ5 A;  3T1H L;  4JOI A;  1N9W A;  5IP7 H;  2KBN A;  2ZJQ A;  5H1S E;  2D0P A;  1TWA H;  3ULL A;  2JEA I;  1X3E A;  3K81 C;  3JAM c;  1VQP A;  2K14 A;  2YYZ A;  4BXX H;  1N32 L;  1HZC A;  1CSQ A;  3EBE A;  1VQA A;  3T1H Q;  1EFW A;  4B3R L;  2RCN A;  4JBJ A;  1ASZ A;  2KEN A;  2A8V A;  1EOV A;  1N32 Q;  4AQY L;  4JI3 L;  2CWP A;  3PUY A;  4B3R Q;  1LM0 A;  3JC6 6;  4IO9 A;  1YJW A;  1W2B A;  4B3M L;  2B63 H;  2E2J H;  1NMF A;  1PH5 A;  3I7F A;  1HNW L;  1K8A C;  2E5L Q;  4JI3 Q;  3PO2 H;  5C0X J;  4DV0 Q;  5IP9 G;  1Q1B A;  3CCM A;  1IXR A;  1P8L A;  1QVC A;  2Y0S G;  4QL5 A;  2YTX A;  1V1Q A;  3HFZ B;  3HKZ E;  4J15 A;  4DPG A;  4A3F G;  1S72 A;  1N34 Q;  2Q2U A;  4B3M Q;  2NVQ H;  3EN2 A;  1HNW Q;  4LFA Q;  4XIG S;  4P71 A;  2JA7 G;  4A3B G;  5IYD G;  2D62 A;  1V43 A;  2CWA A;  2H5X A;  2PI2 E;  1EUJ A;  4DR5 L;  2R7Z G;  1XNR L;  4HJ7 A;  3HOY G;  5ELN A;  4K0K L;  3CD6 A;  3RNU A;  3HOV G;  2OTJ A;  2NN6 I;  1GD7 A;  1UE1 A;  5LMN L;  2MQH A;  4DR5 Q;  1X9N A;  4DR2 L;  3NEM A;  1XNR Q;  4NXN L;  4WJ3 M;  2UU9 Q;  1A63 A;  4L5Q A;  3PIO A;  4K0K Q;  1QUQ B;  1KRT A;  4JOI C;  4DV3 L;  2F3I A;  3AFQ A;  2UUB L;  1PH7 A;  1NTG A;  4QQB X;  3PO3 H;  1Y14 B;  3F8T A;  4YHH L;  3GO5 A;  4JCV E;  5LMN Q;  5IY0 A;  3CCL A;  1OXS C;  1N36 L;  3RLF A;  5GAH C;  4C3H H;  4NXN Q;  4YWL A;  5M3M H;  4DV3 Q;  1NJI C;  4IFD J;  5K36 G;  1XMQ Q;  2UUB Q;  1Y1V G;  1WJJ A;  4R4Q A;  4L5S A;  4YHH Q;  2JA6 G;  3M4Q A;  4DV1 L;  2YTY A;  2YTV A;  1N36 Q;  1QUQ A;  4LUZ A;  2N8N A;  4QY7 A;  4AH6 A;  2IX1 A;  4YWK A;  2HQL A;  4JI8 L;  1NY4 A;  1YBY A;  1BVS A;  2K5N A;  1YVC A;  4YCW A;  5GAG C;  1MJC A;  4C2M H;  4LF8 Q;  3D0F A;  4MZ9 A;  2JA8 G;  4DV1 Q;  1PV4 A;  1XJV A;  2PI2 A;  4JI8 Q;  3RZO H;  3T1Y L;  1Y1W H;  1KL9 A;  4A3J G;  3HOX G;  1M90 C;  1YJ9 A;  4L5R C;  4LFC L;  4JI1 L;  4IPC A;  4OWW B;  1X65 A;  1IL2 A;  3S1N H;  5IP7 G;  5IYC H;  3T1Y Q;  3M4P A;  1PH6 A;  4JI0 L;  4DV4 L;  2ZM6 L;  4UY8 C;  3CCR A;  4A3F H;  1PHJ A;  4LFC Q;  2A19 A;  4BXX G;  3PV0 A;  4JI1 Q;  1JB7 A;  3BZC A;  4IFD G;  2JA7 H;  4A3B H;  4MTN A;  4JI0 Q;  3J80 c;  2ID0 A;  4DV4 Q;  2ZM6 Q;  4HJA A;  3HOU H;  4KHP Q;  4Y7N H;  1X54 A;  1SR3 A;  2R7Z H;  2C35 B;  3AFP A;  4B3S Q;  4DV7 L;  2K4K A;  4DUZ Q;  1IYJ B;  2GVB A;  5GQO A;  3PUZ A;  1CKN B;  1VQB A;  2VZA A;  2I0Q A;  2Q2H A;  4O0A A;  3RN5 A;  4JI5 Q;  1LYL A;  2R7D A;  1PH8 A;  1JT8 A;  1TWG H;  2WP8 J;  1GVP A;  1YIT A;  1HR0 W;  4YCV A;  3LGJ A;  1DGS A;  3STB C;  1SFO H;  3KF8 B;  1UEB A;  3S1Q H;  2AWO A;  1QVG A;  3WWV A;  2NZO A;  3CAM A;  4UP9 A;  1PH4 A;  4AYB G;  4IJH A;  1JMC A;  4LFB L;  1E7Z A;  1TWH H;  1WFQ A;  1Y1V H;  2ZJR A;  2JA6 H;  3J81 c;  4HIM A;  3KOJ A;  3KDF B;  4IPG A;  4GLA C;  4YCU A;  2WAQ G;  5GAE C;  5LMU L;  2MNA A;  1QZG A;  1VQD A;  3F2B A;  1VQN A;  4LFB Q;  4X66 Q;  4HJ5 A;  2VY3 A;  5C3E H;  5LMU Q;  2F4V L;  3MEF A;  3HKS A;  1VQC A;  2K5V A;  1JE5 A;  2NVY H;  3U50 C;  1X56 A;  1A0I A;  2GN5 A;  3CCU A;  4GN3 B;  1EYG A;  3PO3 G;  4HJ9 A;  3A0J A;  2OQK A;  3KDF A;  4BY7 G;  1RL2 A;  2EXD A;  2ZJP A;  2F4V Q;  5M3M G;  3FKI G;  4DV6 Q;  1T9H A;  2OTL A;  1YIJ A;  1C9O A;  4JI4 L;  4BBR H;  3ER0 A;  4A3M H;  2BA0 A;  2HHH L;  3DM3 A;  3GTK H;  4BBS H;  2E8G A;  1XPO A;  1TWC H;  2AMC B;  5FLM G;  1N8R C;  4C3I H;  2E2I H;  4JI4 Q;  4DR1 L;  1KAW A;  1KRS A;  2XTI A;  2E5L L;  1GM5 A;  4XTC S;  4DV0 L;  1UE5 A;  4LF6 L;  1EQR A;  2HHH Q;  4A3D G;  1KQS A;  3F2D A;  1Y1W G;  4EQ5 A;  1N34 L;  2N78 A;  4BA1 I;  2I5H A;  5HGQ A;  4DR1 Q;  1MKH A;  3G6E A;  4LFA L;  4A3E G;  4LF6 Q;  1B8A A;  1LUZ A;  1UE7 A;  2WB1 G;  5M5X H;  2B29 A;  1VS0 A;  3UDI A;  4APV A;  2PQA B;  4DAM A;  3CQZ H;  1VQ8 A;  1D8L A;  3EIV A;  4EX5 A;  3S14 H;  2I5L X;  5C4J H;  5JJK A;  3K8A A;  2D0O A;  3PUW A;  1YEZ A;  5E7N A;  2L15 A;  4P74 A;  3HOU G;  1EIY B;  3TS2 A;  2K5H A;  1IZ6 A;  4PZ8 A;  2UUA L;  5JJL A;  3CPF A;  3U58 A;  3CC4 A;  4X64 L;  2NVX H;  2UU9 L;  4IFD I;  4LF9 L;  2PQA A;  4PZ7 A;  2N49 A;  3H3V H;  1HZA A;  4DV5 L;  2N3S A;  1B70 B;  4LF7 Q;  4DR7 Q;  2UUA Q;  4IOC A;  3S1M H;  3OTO Q;  4GKJ L;  4X64 Q;  2VQF L;  4GLX A;  4LF9 Q;  3PF5 A;  4OX9 Q;  1IBL L;  2JEB I;  4DV5 Q;  1VQ4 A;  1K0R A;  4GOP B;  1XMQ L;  2AHO B;  3CW2 C;  3L2P A;  5C0X G;  3U4Z A;  1J5E L;  3L0O A;  4GKJ Q;  3UDX A;  1CSP A;  2VQF Q;  2PNH A;  1HZ9 A;  4C3J H;  4BY7 H;  1AH9 A;  4DR4 Q;  3K0X A;  3FKI H;  1I50 H;  1IBL Q;  4QJF A;  4OON A;  5BR8 L;  2NZH A;  3GTP H;  4OO1 G;  3S1R H;  1PYS B;  2KCT A;  4LF8 L;  1J5E Q;  1PFS A;  3KJP A;  1I94 L;  5IYB G;  4A3K H;  3PF4 A;  3FP9 A;  5BR8 Q;  4GOP A;  2Q2T A;  3M3Y H;  4DR6 L;  2R93 G;  4JBM A;  5IYC G;  1YHB A;  5FLM H;  5IWA L;  1Q81 C;  4JBK A;  3CC2 A;  4A3L G;  1GKH A;  4JC0 A;  5C3E G;  1OXU A;  1V9P A;  1XTD A;  4JG2 A;  1I94 Q;  3GTO H;  4GNX A;  3H3V I;  3ZJY C;  4H02 A;  3AEV A;  4A3D H;  4DR6 Q;  1TWF H;  1PA6 A;  4LUV A;  5IWA Q;  3DLL A;  4UP7 A;  2QA4 A;  5GAD C;  2F52 A;  2IT1 A;  1VQH A;  2LXJ A;  2YV5 A;  1Q12 A;  2Z6K A;  3CCQ A;  3OW2 A;  2MO1 A;  4A3E H;  4JV5 L;  1PVO A;  2UXB Q;  1B7Y B;  2K75 A;  1EQQ A;  4KHP L;  1VQ6 A;  1BBW A;  1KXL A;  1M1K C;  1X6O A;  2HIX A;  3CCS A;  2UUC L;  4B3S L;  1G29 1;  4DUZ L;  4JV5 Q;  4BBR G;  5IT9 c;  4A3M G;  2BH2 A;  4NB3 A;  3I4N H;  2E2H H;  4BBS G;  4YWM A;  2VL6 A;  4JI5 L;  2CKZ B;  3RZD H;  2VUM H;  2BH8 A;  1L0W A;  5JEA J;  2UUC Q;  2IX0 A;  2K52 A;  1HNX Q;  3S16 H;  4A93 G;  1D7Q A;  4FDB A;  3GDE A;  2MFI A;  1N33 L;  1YNX A;  3I56 A;  2RF4 A;  2IY5 B;  1IBM Q;  2R92 G;  1SRO A;  3CCV A;  2JJQ A;  1OXX K;  1E1O A;  1N33 Q;  1YJN A;  1PH1 A;  4LUO A;  2VNU D;  1PYB A;  3G4S A;  3PUX A;  4R4O A;  4GOP C;  4O2D A;  4R1J A;  4P75 A;  4LF4 Q;  1KHI A;  3S2H H;  4WJ4 A;  4X66 L;  2ES2 A;  4LF5 L;  1EWI A;  4DK3 C;  4R4T A;  5IYB H;  1KC8 C;  2VQE L;  4JBW A;  4HIK A;  4DUY L;  2R93 H;  3H0G G;  2VW9 A;  1YHQ A;  3KJO A;  1S3O A;  3RLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...