4BY7G

Elongating rna polymerase ii-bye1 tld complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by7G01
4JI3Q 1GO3E 2R7FA 4DR1Q 1OXUA 3KF8B 4JBWA 4DPGA 5C44H 4K0KL 1P16A 2B29A 4GKJL 1YHAA 1AE3A 2ALYB 4DR3Q 5LMUL 2WAQE 5JJKA 2I5MX 1L1OA 4PZ7A 3J81i 2UUCL 3M4OH 2UXBL 2R93G 1LM0A 1SLJA 2YTXA 3RR5A 4GNXC 2WB1E 1IBKQ 1N32L 4LUVA 4YCVA 4GS3A 2MNAA 5C4XH 4LF8Q 4HJ5A 4PZ6A 4JI5Q 4X66L 4GLAC 2VQFL 4A3MG 4LNQA 4DV7L 3M4PA 4LF4L 1HNXQ 2UXCQ 2ZTCA 1SROA 5BR8L 1D8LA 4J15A 3K80C 2LSSA 3MXNB 1S40A 4BBSH 2MFIA 4DV2Q 4C3HH 4UP9A 2KCMA 2VY3A 4A3GH 4R4OA 3HOZH 4AH6A 1IBLL 4JI2L 2GVBA 1EQRA 1E1TA 1PH9A 5ELOA 4K0KQ 1X65A 4LWCA 2E2IH 4XIGS 1YIJA 1VQBA 4LFCL 2EQSA 3S1NH 4GKJQ 4DR4L 1N36L 5LMUQ 3S15H 2KBNA 3CCJA 3CPFA 5JJIA 2UUCQ 2UXBQ 1M90C 5IE8A 3RLFA 4BXXH 1N32Q 1NY4A 1IBML 3RN5A 3TRZA 4UY8C 1E22A 4YWKA 2NVQH 4LUOA 2KHIA 4OWTB 4X66Q 1HJPA 2VQFQ 4LW1A 4B3RL 4DV7Q 1IYJB 4LF4Q 2Q2IA 2OCEA 2VUMG 1KRTA 4NXNL 3STBD 3G4SA 3AQQA 4DV0L 4GOPB 1SR3A 1PH8A 1J5EL 1KHIA 5BR8Q 4DR5L 4WJ4A 2Y0SG 4L5QA 2UUBL 4GN4B 4O2DA 2ZM6Q 3CCUA 5IYCG 1PFSA 4OWWB 1VQEA 4IFDI 2CWAA 4A93G 4JI2Q 1X3GA 3HFZB 1DGSA 3K7AH 2QGQA 4DV1L 4GNXB 3PUXA 4A3DH 4QGUA 4OO1G 3BZKA 3RNUA 4LFCQ 1EIYB 2JE6I 3KYHC 4DR4Q 1UE7A 2D62A 1N36Q 1X54A 4APVA 2B3GA 4BA1I 4GOPA 4FDBA 5GAEC 5GQOA 5IWAL 2R7ZG 5IP7H 5HGQA 1IBMQ 1SE8A 3NENA 1H95A 1OTCA 1FJGL 1XNRL 3CP0A 2IHFA 4B3RQ 1Z47A 2B63H 2PI2A 2OTLA 1J5EQ 4HJ9A 4NXNQ 3KDFB 4DV0Q 3U4ZA 1PH2A 2WAQG 1AE2A 1VQHA 4DR5Q 4RG1A 1HNZL 4KHPL 1Q1EA 2UUBQ 3ULLA 1D7QA 1FGUA 2WB1G 2QA4A 3G48A 2NZHA 1NMFA 4Y7NH 2K5NA 3GTQH 3G71A 1WJJA 1WCMH 4IO9A 1V43A 4IPGA 3DLLA 1GM5A 2V1CC 3CW2C 2N3SA 1NBWA 2BA0A 5LMNL 1YHQA 5LMNW 3CC2A 2DUDA 4HIMA 1Z9FA 2MQHA 3H3VI 4GKKL 1A63A 1JT8A 4YY3L 3KDFA 1T9HA 4P75A 1EQQA 5IWAQ 3J80c 3F8TA 1GVPA 1ASYA 3W1BA 1KD1C 3J7A5 4AYBG 1QUQB 1XNRQ 5IP9G 1WI5A 2D0OA 3W5OA 1N8RC 3M85A 1VS0A 5C0XJ 2Z6KA 1SFOH 4DR7L 2R93H 4UP7A 1NJIC 1PHJA 1VQ9A 1CSPA 4KHPQ 2NVYH 1JJCB 3JAMc 1HNZQ 4JV5L 2ZTEA 4UPAA 1MIUA 3KLWA 3CCEA 1VQCA 2JEBI 3CC4A 1VQOA 5J3BA 4GN3B 1PA6A 2E5LL 1L1OB 2HT1A 1YITA 3ZJYC 4HJAA 4TVAB 4A3MH 3PF4A 1PH4A 4B3TL 4C3JH 5LMNQ 1MJEA 2A8VA 2ZJRA 1VQIA 1CKOA 3H3VH 4Y52H 4KI0A 1Y1WG 4GOPC 3GTPH 4GKKQ 3RZOH 3M9BA 4YY3Q 2OWOA 2VNUD 5M5YH 2CCZA 3H0GG 2CFMA 4JC0A 4JYAL 3RLNA 4DV4L 4LF7L 2HIXA 3UE1A 3F2DA 2JEAI 4OO1I 4MNOA 5IYBG 1XPOA 2KENA 3BZCA 3SGIA 4XTCS 2ATWA 1K9MC 1E7ZA 2CQOA 4POGA 4A3FG 2KCTA 4DR7Q 1YI2A 2ZJQA 4JV5Q 3D0FA 3T1YL 1C0AA 1W3SA 4B3SQ 1L2FA 1Q82C 1B70B 2F52A 4OWXB 5H1SE 4IJHA 2E5LQ 3HOXG 2K5VA 4A3JG 1ASZA 5EAYA 4X62L 3U58A 1JJ2A 4A3EG 5K36G 2RHQB 1W2BA 2VUMH 5ELNA 3I7FA 1VQLA 4DUZL 3F1ZA 4NPSA 4JI7L 1RIPA 3TEHB 2ZM6L 1VQ8A 4B3TQ 2C35B 5FLXc 5C3EH 3KJOA 3I2ZA 4DNIA 1Q12A 2ID0A 1PVOA 3S1RH 4BY7G 5IYCH 4AYBE 2PI2E 4JI1L 1G6PA 1VQAA 3L7ZC 1Y1VG 1LUZA 4A93H 4JYAQ 4L5RC 1Q1BA 4DV4Q 4LF7Q 1QVCA 3RN2A 3F2BA 1VQNA 3RLOA 2D0PA 1YJ9A 3I4NH 5M3MG 4A3BG 5C4JH 3PGZA 3FP9A 4P74A 4R4IA 4JI4L 3NELA 1TWFH 4IOCA 3T1YQ 3J81j 4JI8L 4JBMA 1K83H 1YEZA 2R7ZH 1XPRA 2JA9A 1OXXK 2XGTA 1TWHH 4YHHL 1JE5A 1GKHA 3I4OA 3I4MG 5C0XG 2R92G 4X62Q 2QEXA 3HOVG 2UU9Q 3CPWA 2AMCB 1IZ6A 3CCVA 2JA5G 4DUZQ 1M1KC 4JI7Q 2Q2HA 4OX9L 1BVSA 1VQMA 1SMXA 2YTYA 3K7UC 1JJGA 1NE3A 4X6AH 4JI1Q 4P71A 3CQZH 3G6EA 3VDYA 2OQKA 5GADC 1CKMA 4HJ7A 2IY5B 1U5KA 4IPDA 1L1OC 3A5ZB 3IRBA 3CCMA 2CWPA 3FHWA 2HIVA 3HOYG 4QQBX 4DUYQ 3E0EA 4P73A 4A3IG 3LGJA 3AEVA 2NZOA 1E3PA 2A19A 2RHSB 3Q8DA 4JI4Q 4BBSG 1I3QH 2E2HH 2VS1A 4JI8Q 1A0IA 2GN5A 1VQ4A 4QJFA 3L2PA 1X9NA 4A3KG 4YHHQ 4EQ5A 2RCNA 5IP9H 2I5HA 1K8AC 3FKIG 4IOAA 2K52A 2DGYA 2PMZE 2JA7G 4NB3A 4HJ8A 4JI0L 4OX9Q 2K4KA 3PO2G 3L0OA 1OXSC 3E9HA 2UUAL 4ALPA 1B7YB 5M5XH 3GD7A 5FJ8G 4JI6L 1HZ9A 4BXXG 1UE1A 3PUWA 2A1AA 3STBC 1YJWA 1KQSA 1N33L 1I94L 2E2JH 3ULPA 1PH7A 3NEMA 1OXVA 3HOUG 5IYDH 4BBRG 3PUVA 4MZ9A 4OXPA 3F2CA 3RZDH 1XJVA 1Q81C 2OTJA 5M3FG 2Q2UA 2K14A 1CKNA 1V9PA 5HY6A 3U4VA 5GROA 3PCOB 1QVGA 1Y1WH 1HNWL 3KF6A 4DAMA 4YWMA 3GTLH 2HQLA 2WP8J 3H0GH 4HIDA 1XMOL 2JQOA 4LFBL 3PO3G 1A8VA 2I5LX 4JBJA 1I6HH 3ICEA 2WFWA 5IYBH 4ME3A 1K0RA 1E24A 4P72A 1L0WA 1CUKA 3HOWG 1V1QA 4A3FH 4JI0Q 4B3SL 2XTIA 1YHBA 2AWOA 1K73C 1XMQL 2UUAQ 2BA1A 3JC66 4R4CA 4A4IA 2NN6G 3M4QA 1Q46A 5JEAG 3A0JA 1J6QA 4IJLA 2OQ0A 3AFPA 4JI6Q 3S2HH 3NBHB 4QIWE 3HOXH 1QZHA 1N33Q 5IY0A 3GTMH 2JK8A 4A3JH 1I94Q 1O7IA 5C0XI 4A3LG 4KHZA 2BH2A 3TS0A 5E7NA 4A3DG 4H02A 2B63G 3OYYA 1QZGA 4IPHA 2ASBA 2YTVA 2YU9H 1WFQA 4OONA 4DV6L 1X3FA 3K81C 4BY7H 1HNWQ 2K75A 4KLKA 3GTKH 4YCUA 1Y1VH 1Q8KA 1XMOQ 1VCIA 4LFBQ 2LXJA 2JA8G 4PZ8A 1TWCH 1YBYA 1KAWA 3A74A 4DK6C 1WCMG 1HH2P 1YVCA 3DM3A 3MEFA 1PV4A 2ZTDA 1GD7A 3M7NA 4DV2L 2JA6G 5AJ3L 2MO0A 3B6YA 2IHEA 2VL6A 5M3MH 1PH3A 1MKHA 1SRUA 3CCSA 1JMCA 4A3BH 1PYBA 3OTOL 3PV0A 5DLQE 1PH1A 1QVFA 3E9IA 4PMWA 3CCRA 1XMQQ 2ES2A 1X6OA 1CSQA 4DR6L 2L15A 3M3YH 5FLMG 2AKWB 2VQEL 2UU9L 2IT1A 3I4MH 4DV3L 1EYGA 2JJQA 2R92H 4WJ3M 1AH9A 1Q7YC 3HOVH 1XNQL 3PIPA 4AQYL 3KJPA 2JA5H 4L5SA 1VQFA 2PNHA 4DR2L 3S1MH 2PQAA 1NTGA 3CXCA 4LUZA 3CMAA 1IL2A 3S14H 5JJLA 4YWLA 1BKBA 1VQJA 5GAHC 2H5XA 5M5WH 4DV6Q 1Q86C 3GTGH 4A75A 4JOIA 2F3IA 3EN2A 4BY1G 1I50H 3GTJH 2Z6KC 4DUYL 1JB7A 2MO1A 3UE0A 4GLVB 4A3CG 1X3EA 1SN8A 3J80i 3HOYH 1TXYA 4B3ML 3S2DH 4X65L 3ERSX 2N8NA 3EIVA 5AJ3Q 1YJNA 2R7DA 4GN5A 4A3IH 4LF9Q 4DK3C 2ZJPA 1I5FA 2Q2TA 1FVIA 3UDXA 2GVAA 4POFA 3OTOQ 1HR0L 1A62A 3CC7A 1HR0W 3CCLA 5JEAJ 4DV5L 4LFAL 5C44G 4DR6Q 2IX0A 3JAMi 4IPCA 2VQEQ 4A3KH 4X64L 4DV3Q 2Z0SA 1G291 4HIKA 1EUJA 2N49A 4MTNA 3FKIH 3I56A 1K8GA 3HKZE 1EFWA 1XNQQ 2JA7H 5GAGC 4GLXA 1S3OA 4AQYQ 4DKAC 4DR2Q 3PO2H 2CKZB 1FL0A 4A76A 3ULJA 1G51A 3PIOA 4R4QA 2NN6I 5C4XG 2YYZA 5FJ8H 3PF5A 4JCVE 2FXQA 3EBEA 4BA2I 4IFDJ 2N78A 3CD6A 4LF5L 1EIFA 1TWGH 1TWAH 3A5UA 1S72A 3HOUH 1PH5A 4BBRH 3U50C 5M3FH 1R9TH 4B3MQ 2AHOB 4X65Q 1KIXA 3TS2A 1UEBA 1IXRA 5C3EG 3TREA 1RL2A 4A3GG 3HOZG 1HR0Q 2NVXH 2IX1A 2HHHL 1PYSB 2AWNA 4LFAQ 3WWVA 4DV5Q 3T1HL 3PO3H 1CKNB 1VQGA 1E1OA 1Y14B 2VZAA 3S24A 4C3IH 1IBLQ 3PSIA 4UP8A 4X64Q 1KXLA 2YV5A 3KF6B 4O0AA 4RMFA 2VW9A 3PUZA 3HOWH 2R6GA 3I4NG 4EX5A 1N9WA 1YZ6A 1UWVA 2I0QA 3K8AA 4NXML 1C7YA 2UXDL 2E8GA 2K5HA 3J81c 4JOIC 4TQUS 3S1QH 1LYLA 1OXTA 3UDIA 1NMGA 3GTOH 3S17H 4A3LH 4LF5Q 1N34L 1MJCA 1VQDA 1B8AA 1BBWA 4GNXA 3CMEA 1VQKA 1XTDA 4L5TA 3GDEA 4HIOA 1VQ7A 2RF4A 1VQ5A 4PG3A 1YNXA 2HHHQ 3BJUA 3T1HQ 2JA8H 1WOCA 4QL5A 2BH8A 1HZBA 3W1GA 3J7ZC 3OW2A 4LF6L 2F4VL 3KOJA 2NVTH 3KFUA 2EIFA 4DV1Q 3BU2A 4R1JA 2KHJA 3I55A 1HZAA 2LXKA 2JA6H 2K50A 3CAMA 1K3RA 3AFQA 3K0XA 3UDFA 4JI3L 1U0LA 3UDGA 4DR1L 4NXMQ 5IP7G 4DAYB 2UXDQ 1P8LA 3TQYA 1PH6A 1XPUA 5FLMH 4A3EH 1C9OA 4DR3L 4C2MH 1N34Q 1FJGQ 1EWIA 1WYDA 5IT9c 3CCQA 2Y0SE 3D31A 3HKZG 1KC8C 3PUYA 3HKSA 3GO5A 1IBKL 3ER0A 1X56A 3H15A 4LF8L 1LTLA 4IFDG 1UE6A 4JI5L 1X55A 4R4TA 2PQAB 4BY1H 1HZCA 1HNXL 4LF6Q 3S16H 1KL9A 2F4VQ 2UXCL 3CF5A 1UE5A 1VQPA 4A3CH 4JG2A 4LF9L 1EOVA 1VQ6A 1KRSA 2EXDA 5IYDG 4JBKA 1QUQA 4YCWA 4AIMA 4QY7A 3AYHB 1BBUA
chains in the Genus database with same CATH superfamily
1GO3E 1WTQA 4DR4H 4DR1Q 3LP8A 1A3VA 4ULLA 1KDCA 3J80W 5C8YF 1X3PA 5KFKA 1F2YA 1YHAA 3MEHA 4GKJL 4FF2A 5BN4A 2R86A 3K58A 3L9AX 1H9SA 1EU3A 3QR8A 5C3EB 2I5MX 4C3HB 3RAQA 2R93G 2UUCL 3M4OH 3NGDA 1TWCA 3S1RB 1SLJA 3RR5A 2K05A 4G7ZC 1DM0B 4LUVA 2XWJB 2MPMA 4GS3A 2MNAA 4F4ZA 3A54A 4LF8Q 4HAEA 4DV0H 4PZ6A 1GHKA 3PN1A 1CT1D 1PRTF 5M9OA 2VQFL 1UUPA 4IUNA 1SROA 1DOMA 4J15A 2RQXA 1S40A 4QWCA 3Q8SB 2HQEA 3D6CA 2KCMA 2Y0SA 4AH6A 4KD3A 4K0KQ 4KY7A 2E2IH 1IYVA 1PFBA 4DR4L 5CBAE 4JVZA 5LMUQ 2WAQB 1LLRD 4FVMA 3CPFA 3HBLA 1BNZA 3D8GA 4A3DB 3RN5A 1I7LA 4UY8C 4LUOA 2KHIA 3BABA 1IYJB 4KHVA 2SDFA 4DV0L 1F9PA 1IHZA 1Y8OB 1Z7TA 4KJNA 5BR8Q 3V4ZA 5FO9B 4GN4B 3BG3A 3IFDA 3H3VC 1PFSA 5LMNH 1EY8A 3Q22A 3HRZC 1X3GA 1ET9A 4I65A 4FBTA 4GKKH 2YCHA 4OO1G 1EEFD 2FMAA 4DR1H 1AZPA 3BZKA 2JE6I 3KYHC 4F8MA 2Q8TA 2BQUA 1CS0A 4HMIA 2O5JC 2FPIB 2EZVA 1X54A 1G8ZD 1BNCA 1O75A 1EIHA 2B2TA 2L55A 2R7ZG 5HGQA 3M9OB 3NENA 1RTNA 2E2JB 1OTCA 1S68A 3RZDB 4XQQA 2B63H 4AYBA 5HBRB 5E3FA 1BBXC 4NXNQ 4ZUJA 3U4ZA 2WAQG 1F9QA 4DR5Q 2N55A 2D5DA 2K28A 1FGUA 3R2TA 4IFDH 4EQOA 2E2DC 3OSPA 2BOSA 3GTQH 3W3AA 2L5TA 1VBHA 2EY5A 5EGTA 4IO9A 1AZQA 4RU9A 4IPGA 4ECUA 3DLLA 3CW2C 2NVYB 4I7ZC 1M7JA 4K0KH 5LMNL 3ND9A 2I87A 1K1QA 4HIMA 3H3VI 1HA5A 4GKKL 3K59A 2L12A 1ZQ7A 1T9HA 4Q45A 4A3MB 1AUXA 1SNOA 5ELBA 4CDFC 4C3JB 3T1YH 3MXPA 1WI5A 1Q8IA 1QILA 2D0OA 5JAVA 2NU6B 5KT2A 1V4YA 5C0XJ 3NQTA 4FXDA 1SFOH 2YZNA 1SYCA 4KHPQ 4JV5L 1JJCB 4X62H 1MIUA 3G7LA 1EFID 3CCEA 2RDFA 1QE6A 4O4LF 1PA6A 5J3BA 4GN3B 3LMLA 1PLFA 3GV7B 1YITA 4QMGA 3J81L 1EUDB 2NU8B 1CA6A 4TVAB 2AGOA 3GTMA 4A3BB 4QCLA 4XYQA 3MTSA 3QG1A 3N8DA 1VQIA 1LTSD 4A2AA 3RAXA 3CKIB 3RZOH 3OHAA 4ECQA 2YU9A 5M5YH 3H0GG 5CYUA 3M3YB 3RGXA 4OHJA 1OWTA 1RF2D 4Q0YA 3F2DA 1VF7A 1JIHA 4MNOA 5IYBG 5KFVA 3HGBA 4J9RA 1CA5A 2JA5B 2NB0A 3HP3A 5JOBA 2KCTA 4YHHH 1KTKA 4H13C 2ZJQA 3T1YL 4A93B 4OELB 3I72A 3NBIA 1Q82C 1B70B 5H1SE 4OX9H 1EY6A 1JJ2A 4X62L 3G6JB 5LOVF 3ITPA 5ELNA 1TWFB 4NPSA 1HFGA 4DU9A 4B3TQ 4FU0A 2XCLA 2YYAA 1CTMA 1C30A 3KBGA 4UCOA 1G6PA 4JI1L 1VQAA 1LUZA 4JYAQ 1C3OA 4DV4Q 4EGVA 1I4HA 5I9PA 3E5SA 1M0WA 1NR4A 3NQIA 4PV1C 1I50A 3GTJA 1A9XA 3I4NH 2W7OA 5M3MG 2EYHA 4A3BG 2B8GA 2WB1B 4C5AA 5EJWA 3NELA 1UNSA 4KN7C 3FMAA 4ED7A 1D6EC 1F9RA 1YEZA 3VR5A 3A56A 4F50A 1OXXK 4DL3A 2CVRA 3VYUA 4YHHL 2UUAH 3RUZA 5JPNC 2EVBA 3RFCA 3GV8B 1B53A 2QEXA 2UU9Q 2XSCA 1R9TB 5L1LA 4JI6H 1IZ6A 2JA5G 4WD3A 1M1KC 4OX9L 1BVSA 1I3QB 1TAEA 1EY5A 1VQMA 2DY8A 3JSLA 5KFEA 2YTYA 3VPCA 2IL8A 3K7UC 1CHPD 3OWEB 3X3NA 4L1KA 3PO3B 1RJRA 3WOFA 2KEEA 3VDYA 3G6EA 1PTOH 2OQKA 3N41B 1U5KA 1D5ZC 1L1OC 2E76C 2F0UA 4OEMB 2CWPA 4QQBX 1XTCD 3BDOA 4HNTA 1FGBD 2ZXPA 5LL6S 1GYFA 3LGJA 4XQNA 2ZXRA 5EKIA 3U9SA 2A19A 2VS1A 5EQ0A 1KJ8A 1L2ZA 1DV2A 3JAME 2IX3A 4QJFA 1X9NA 3SK6A 3S17B 5CORA 4A3KG 3TP6A 4DA2A 5IP9H 4ECWA 4O4IF 1Y1WB 2PMZE 1DD2A 1RCVD 5ELDA 2IA6A 2UUAL 4MV6A 3KHRA 5M5XH 3GD7A 5FJ8G 4JI6L 1HZ9A 1KJJA 4RHSA 1QOHA 3PUWA 2NUCA 2NVTB 3ULPA 3MFIA 4A3FB 4BBRG 1Q81C 2OTJA 2Q2UA 1NCVA 3DWQA 1V9PA 4ILWA 5HY6A 2P0AA 4FM9A 3MZ5A 3KF6A 4A3JB 4I7AA 2HD3A 1BO0A 3LX0A 2OT2A 3A7AB 3PO3G 5KFAA 3H4BA 1I6HH 1EEID 5KRUA 4ME3A 2W9BA 4FXKC 2HGSA 1GXDC 1KAAA 1EL0A 1E24A 1WCMA 2VQEH 4ED0A 2UU9H 1Y1VB 1YHBA 1K73C 4FS1A 2JA6A 1F2LA 4Q44A 1RYSA 2SNMA 1RTOA 3A0JA 1LTID 5KFCA 4AQYH 1GSHA 3GTMH 1B04A 2I07B 1I94Q 1O7IA 2NTSA 5C0XI 4A3LG 5K36H 1UNNC 3TS0A 3DF7A 3DEPA 4RB3C 3P75A 4IPHA 5A2QE 2YU9H 3OHBA 4IWYA 1JWMD 4HYKA 4R9WA 1DJRD 4BY7H 1X3FA 1S10A 1HNWQ 3NXWA 3BA8A 1Q8KA 1XMOQ 4X65H 2F3VA 2JXMB 3A7LA 3R23A 3QOJA 3AMUA 3BZDB 1HH2P 1YVCA 3DM3A 3MEFA 1HR0H 2ZTDA 4K6DA 3M4OB 1IOVA 2ENBA 4R8UB 1MKHA 3CCSA 2QDBA 3PW5A 1FD7D 4PMWA 4J9OA 1WTHA 1X6OA 1JC7A 5DM63 4K2KA 1ZETA 2VQEL 2Z8LA 4QF4A 2UU9L 4DNRB 2IT1A 1BF4A 3I4MH 1TU2B 2JJQA 1JKJB 4BWGB 2NBFA 5JVG3 1Q7YC 4A3IB 3HOVH 3PIPA 1SAPA 4MTKA 4AQYL 1NNXA 4KY5A 4L5SA 2PNHA 1VKZA 3C0FB 4YJ3F 1DXMA 2PQAA 1NTGA 2A6ED 2Q8RE 3CXCA 3CMAA 4LF5H 4YWLA 5KFOA 1PZJD 5I47A 3GTGH 5DEHA 3EN2A 4LMQD 1I50H 2JA7B 1VF5C 3GTJH 1JB7A 2MO1A 3PO2B 4LSXA 3J80i 3HOYH 4FF3A 2MGSA 4X65L 3S2DH 1YJNA 3T1HH 2R7DA 4LF9Q 4DK3C 2ZJPA 1I5FA 5KIXA 1HA6A 4POFA 2GVAA 1HR0L 5KYIA 5CGKA 5KFSA 3HOUB 2FJ2A 2GPSA 3QZ7A 1ESRA 1G291 2Z1CA 2UXDH 1CFMA 3E6ZX 3HKZE 1K8GA 4GLXA 2FMMA 2NVXB 1FL0A 4A76A 1JICA 2NN6I 2EXZA 1DYQA 1J8IA 3ONAB 3MXNA 2O03A 1I6VC 1HNWH 4LF5L 1EIFA 5I2XA 1WVLA 3HOWB 1EYAA 3U50C 1ESFA 2F0GA 1HQRD 2FK3A 3MWYW 2NUAB 1KIXA 1UEBA 1KJ9A 3PW7A 1WD0A 3TREA 3EFXD 3GTOB 2EJGC 3TZDA 3WWVA 3T1HL 4ZCKA 2FPGB 1CKNB 5D3DA 1E1OA 4C3IH 2WDTA 5DAUA 2B63B 3EROA 1LV9A 4MV3A 3PSIA 4HN7A 4UP8A 4X64Q 1KXLA 4RMFA 2VW9A 2SCUB 5BPHA 3Q0AA 4F88A 3MFGA 2R6GA 4WRDA 3O13A 4K6LA 5L9XA 4EX5A 2F0IA 3GIJA 1A2UA 2UXDL 1I4GA 1LYLA 1OXTA 3NSWA 4KD4A 1NMGA 1MBYA 1IBKH 4RAZA 2L1BA 4WBNF 1MSHA 2AU0A 3SI8A 3MAQA 1A15A 2FK1A 1JXLA 2JEGA 4JI5H 2WINB 2R8GA 1STHA 3CMEA 2UXCH 3HKZA 1VQKA 2EDGA 3RTXA 3RV4A 4CDDC 4LF9H 1VQ7A 4C2MB 2W6MA 1AUVA 4WORA 4ODGA 3KTMA 3BJUA 2C2EA 2DIKA 4LMYA 4B9XA 3MFHA 2HVSA 2Z6BA 5C5LA 1SFOB 3ETHA 3PVXA 1SJHD 2JA6H 1ENAA 3MHBA 1QWYA 3AFQA 2K5QA 4BY1B 4NXMQ 3TQYA 2B2UA 4HNUA 1JOKA 5DG8A 3N42B 4DN4M 5FLMH 1JWSD 4V190 4RWSC 1G2SA 1N32H 1T36A 4CHTB 4CJ2C 2ICIA 2R8JA 4I7HA 1YNJD 3OW7A 4G57A 3PUYA 2FKLA 2G9DA 3N52A 1IBKL 3RZOB 4DV7H 4LF4H 2R7LA 3H15A 2F0EA 1GUTA 1R4PB 2B2YA 4IFDG 3MWDA 3FDTA 4JI5L 3NTIA 1H9SB 4JV0A 4UDUC 1HZCA 1AW7A 2UXCL 5KEEA 4A3CH 4JG2A 4LF9L 1KRSA 2EXDA 4JI2H 1SCUB 1STAA 4KN4C 2DJFC 4C5CA 3BQ1A 1BBUA 2W70A 1M4VA 4KKSA 3L4KA 4LFCH 3E5NA 5KFLA 2R7FA 3KF8B 4UAIA 2RCFA 5C44H 1WTVA 3PMFA 3HEJA 1AE3A 3GTKA 1IBMH 2QEJC 3T5HA 5KFHA 5TSSA 1L1OA 2Y0SB 3HOZB 2MCTA 1LM0A 4WJWA 3VA7A 3JAML 4GNXC 3UFXB 1ZKOA 1N32L 3QZ8A 3BJYA 4YCVA 4TV8F 4OIJA 2FLLA 5C4XH 3MA2B 2Q8IB 3JSNA 1I4QA 3TP5A 2VUGA 2UUBH 1B1ZA 4LNQA 4DV7L 2IP4A 2D2CC 2EY1A 3M4PA 4LF4L 3I4NB 5LP6F 1STEA 1ENCA 2VUMA 5I6WA 2MFIA 5KFMA 4A3GH 4R4OA 2AGQA 4K2LA 4HSVA 4JI2L 2GVBA 5EZYF 1E1TA 1E4EA 1IKLA 4GKJQ 1VQBA 4LFCL 1JE4A 1O7LA 5LL6X 4XZ3B 3S15H 3CCJA 3KAKA 3VR6A 4ETSA 2UUCQ 1XNRH 2FK2A 3RLFA 5EOYA 4G4KA 1NY4A 3K7AB 1IBML 1Z2PX 2A68C 5D1OA 3TRZA 2C9OA 1E22A 2DWCA 4JW0A 3WDNA 5FPOA 1HNZH 2O4XA 1HHVA 2VQFQ 2VA3A 5EWFA 1TWHA 2A6EC 1XX8A 1SR3A 3BYTB 5FLXW 2EPBA 2Y0SG 4L5QA 2UUBL 4O2DA 3CCUA 4ZQ3A 4OWWB 4FF4A 2KCCA 2CWAA 4ED2A 1LT4D 4GNXB 5A2QL 4QGUA 5CV5A 1GGOA 3C1FA 4DR4Q 1UE7A 2IJ0A 3GV6A 4APVA 2ICEC 5M5XB 5K2MA 2CQYA 4BA1I 4GOPA 2JP1A 3C2PA 3DHQA 5GQOA 5IP7H 5C5JA 1H9KA 2KUMA 1H95A 4LJZC 1XNRL 2FFKB 2IHFA 2XCPA 5NUCA 4TUYF 1JDBB 3N44B 1IOWA 2E5LH 3K5NA 3K5LA 4DV0Q 1PH2A 1VQHA 1HNZL 3FPUB 4RG1A 3G6VA 1D7QA 3ULLA 3CHBD 5KX5F 2QA4A 3G48A 3RB4A 3M7GA 4MV8A 1O7YA 5CV7A 3ORQA 2R93B 2YRWA 4KKUA 2BA0A 1STGA 3CC2A 4LF7H 2RGRA 3QWNA 1A63A 1JT8A 4RFBA 1X3QA 1EQQA 4JV1A 1ASYA 5L1IA 1EOTA 3GTLA 4AYBG 1GJXA 5KFIA 5IP9G 2GLTA 2ALZA 2WIIB 2PVPA 2RVLA 3OMGA 1N8RC 2QK4A 4O3RA 3DUZA 2L0CA 1TVXA 4DR7L 1BUVT 4UP7A 4K8JA 1CSPA 3JAMc 2FJZA 3KLWA 3RIZA 4DUZH 5KG3A 2E5LL 4ED1A 5LL6b 2EE1A 1MD2D 4ZOLF 1V1PA 2DNEA 1EUCB 3H20A 5LMNQ 5GONF 2A8VA 4Y52H 4KI0A 4GKKQ 3N43B 5DG7A 3M9BA 2KECA 2RA4A 5EBCA 2CCZA 2CFMA 4JC0A 4LF7L 3I4MB 4Y8VB 2JEAI 4DXFA 4OO1I 5IGGA 1I4XA 1CHQD 4XTCS 2SOBA 2RKSA 2CQOA 1E2ZA 1K28A 2M2LA 1TS3A 4QWDA 1YI2A 4CJ0B 2BQ3A 4JV5Q 3D0FA 3D4DA 1C0AA 3GTGB 4B3SQ 1L2FA 4KY6A 3IL8A 4OWXB 1LTAD 1I50B 1NUCA 4IJHA 5KFQA 2W8LA 4DAPA 2L9HA 5EPLA 1YNJC 5EAYA 5K36G 2XD4A 2XGPA 5BN3A 4A3EG 3TDQA 1ML0D 3HOYB 2VUMH 1VQLA 3I7FA 3S2DB 4DUZL 4EG0A 2C35B 1K83B 2R7ZB 1SEIA 2EOTA 2EYFA 4BY7G 5IYCH 4AYBE 4YAJB 4CDCC 2QDLA 4F87A 1Q1BA 1FR3A 1QVCA 1IL8A 5E1FA 2IMWP 1S97A 1VQNA 1B4OA 5F9NA 1YJ9A 1QNUA 1EY4A 5C4JH 5KFDA 4P74A 2NWGA 3P20A 4ZQIA 4IOCA 4FNFA 3T1YQ 3J81j 4JBMA 5KFTA 1DCZA 1SJED 3CQZB 3Q8RB 1XPRA 1HTPA 1XDNA 4JI0H 2XGTA 1TWHH 4PWQA 4APMA 3I4OA 3KLSX 3I4MG 4X62Q 1S03G 3HOVG 3CPWA 1I4PA 4ED3A 4JPBW 1CQIB 3CCVA 2Q2HA 2QF7A 1N33H 2E2HB 3FKIA 5KG7A 1EYZA 2IW3A 1JJGA 1U4PA 4X6AH 4JI1Q 4K14A 3K5MA 4C3IB 5CMDA 1PX2A 5GADC 5KFYA 4RGTA 3NP8A 3J80E 1LTRD 2X6LA 3IRBA 3U9OA 3HOYG 3FHWA 4QWAA 4LFBH 1CK1A 3E0EA 3GV5B 4P73A 3TP8A 4PDBA 1TY0A 4N9TA 3AEVA 3K5HA 2RHSB 1BR9A 4IQZA 4MTEA 4WFN3 4JV5H 3L2PA 1W93A 4B3SH 4YHHQ 2RCNA 1XMQH 2QILA 2O2LD 4IOAA 2K52A 4KTAA 1CQFA 4HJ8A 4JI0L 1EZ6A 4XQJA 4OX9Q 4Q43A 4TV9F 3H0GB 3L0OA 1OXSC 2A69D 2AQ2B 3EYYA 2CW0C 4BXXG 1H9JA 2HVQA 4IUVA 2A1AA 2OF1A 3I73A 1YJWA 1KQSA 1N33L 2DN8A 3F8NA 4O3OA 3T5LA 1PH7A 2PZUA 4DV6H 2JA6B 3K5IA 2K14A 1B50A 3U4VA 1QVGA 3MR5A 4RKLA 1F2ZA 3R2IA 3AB9A 3DM1A 4DAMA 2WP8J 3GTLH 1T3NA 3GIDA 4LFBL 4Q8EA 3BDLA 3HG9A 1PMRA 2I5LX 3RF2A 4C3IG 3ICEA 3OTOH 4H0LC 1AN8A 5C4HA 2H1EA 1D2BA 2F0WA 2PMZB 2W6NA 5HV6A 1CUKA 3I8ZA 2ZJTA 2W57A 4B3SL 1Y8NB 3VYTA 4DV3H 2UUAQ 1XMQL 3NTHA 2PCFB 3T53B 1XNQH 1Q46A 3S2HH 2F1MA 1J6QA 1JOQA 5KFZA 4JI6Q 4MN3A 3NBHB 3HOXH 2JK8A 4JI1H 2V5AA 4IZOA 4KHZA 5M3MB 2W6OA 4E4TA 2VOBA 2YTVA 2HCIA 4J8QA 3H94A 1RK6A 4DV6L 4KLKA 3Q23A 1VCIA 4YR3A 2K03A 4PZ8A 1TWCH 1WCMG 2G5DA 1KJQA 2JA6G 5AJ3L 4EBEA 3B6YA 1PH3A 1JMCA 4NP5A 1PYBA 3OTOL 1CI3M 5KFJA 1HRJA 5JH7F 4UCTA 3CCRA 2ES2A 4ECTA 2BR0A 1CSQA 2P5ZX 4O2AF 1D1KA 3A8IE 5DLGA 5FLMG 3MVVA 4DV3L 4WJ3M 1XNQL 5IT9W 4FS2A 4X3UA 5LHY1 3GQBA 3H09A 4A3GB 2QKIC 1VQJA 5GAHC 3EJIA 1LT6D 4A3KB 3IN5A 2LY7A 3NHHA 2YRXA 4JOIA 4J0MA 1B9NA 2RGVA 5KG1A 3UE0A 4GZYC 3CU7A 3S15B 4A3CG 3JRXA 3V6HA 5I2YA 1TXYA 2JN4A 2HHHH 5ISRA 2N8NA 4IUQA 3D4RA 4ZLTF 1FVIA 3UDXA 5DQGA 3CCLA 2AUJD 4IZ8A 1TWGB 1TWAB 5JEAJ 5C44G 4BBRB 2VQEQ 5FOBB 2F0PA 2Z9HA 3RV3A 2F0HA 1EUJA 3FKIH 2WYOA 5GAGC 2G9HD 1S3OA 4RGMA 4AQYQ 5FO7B 5C5MA 1S5DD 2W8KA 3ULJA 1N34H 2C2RA 5C4XG 2C5CA 5KFPA 2B2WC 4JCVE 1STNA 2W6ZA 1BCPB 4IFDJ 2N78A 4J9SA 3CD6A 2F0JA 2Z4HA 2LMCB 4ECRA 4M1UB 3MR2A 3G6XA 5IYZF 1WTOA 2EYOA 2RSOA 5KFRA 5M3FH 1QB5D 4OGQC 5DQHA 4RH6A 4X65Q 3RBDA 1RDPD 1IXRA 2F4VH 2O5IC 5KFFA 1PYWD 1RL2A 4A3GG 2MUYA 4FP5D 1HR0Q 5EDWA 2ASLA 4QUFA 3I12A 2HHHL 1PYSB 5AFWA 2AWNA 2J4XA 3SR1A 1VQGA 1JDEA 4EYIB 2YZMA 4J9KA 4JI3H 3GIMA 3HZXA 3JZIA 1L0YB 1RD9D 2SNSA 1K1SA 2FB9A 4DR3H 5JQWA 2KHSA 1FNWA 4YBZB 2E8GA 3J81c 5CA0F 3S1QH 5J2TF 3FMCA 1U4MA 3V4SA 3VMMA 3UDIA 3RJ0A 3G6YA 4ZKCB 1V1OA 1N34L 4LF5Q 2IPKD 4JK1C 4A2BA 1B8AA 1QJOA 1MZBA 1HNXH 4RAUC 4G7HC 1VMCA 2IWHA 4L5TA 3CVZA 3GDEA 5CV8A 3K3VA 3T1HQ 3T56B 4DV2H 2BH8A 2F4VL 4O3NA 4K5XA 1U4LA 3KOJA 4RKBA 1KDBA 4DV1Q 3BU2A 2KHJA 2PZTA 3EPGA 1T5XD 1JR0D 3CAMA 1H9RA 4I55F 4UCVA 3UDFA 4JI3L 3T51B 3BG5A 5LYJF 3UDGA 3U9TA 1SNPA 5IP7G 5EPJA 2W9AA 2F0MA 1B9MA 1P8LA 1PH6A 3S16B 2UXDQ 4IAJA 1O78A 2UXBH 4QW8A 4A3EH 4DR3L 2A69C 3F2UA 1FJGQ 2DLNA 4NKLA 4N8X1 3RBEA 4DL4A 1KABA 3CCQA 3HKZG 1KC8C 2R85A 4X66H 3HKSA 4YIJA 2NVYA 3QB3A 5FPRA 2DJGC 4EYHB 2WACA 4H7BA 3WNZA 3SEBA 4DAYA 1HNXL 3OSNA 5KGUA 4R7RA 1UE5A 1ONLA 1EOVA 1DZ1A 2DPIA 3HB9A 4DV2L 4NLGA 3J7YW 3MXUA 1EZ1A 3P1HA 1N36H 1OXUA 3J80L 2V4DA 2NTTA 1D5MC 4C5BA 2XGQA 1P16A 2A68D 5KT7A 5H80A 2WKCA 2A73B 1SE4A 4PZ7A 2FE3A 2UXBL 1U4RA 5T1IA 2WB1E 1IBKQ 4B3RH 1I6UA 1QG7A 3R5HA 1S0OA 2CHBD 1E4EB 1J5EH 1JWUD 4EQNA 2E2IB 4HJ5A 4JI5Q 1GOZA 4X66L 3V05A 4ZI7F 2K5DA 4IR9A 2UXCQ 2E75C 2ZTCA 4F4WA 5D1OB 4DV1H 3D3RA 3C3LA 4C3HH 5KNBA 2K5WA 3NK9A 4DK1A 5FD5A 4YB8B 1TWHB 4NMZA 1EQRA 4C1NK 2PW7A 1PH9A 1X65A 3S1NH 4XIGS 3N6XA 5IWAH 1N36L 3BQ2A 1TS2A 2EYJA 2KBNA 3PQIA 3IKJA 5JJIA 1FJGH 1LACA 1STBA 1M90C 1TA8A 2V59A 1SEBD 5IE8A 3PZPA 4BXXH 1N32Q 2A6HD 5F2DA 1KLGD 4IUUA 1TWFA 4GC7A 4YAKB 4HR7B 1HJPA 4B3RL 1HTLD 4DV7Q 2BQRA 4LF4Q 3LWBA 2Q2IA 2OCEA 2VUMG 1KRTA 3G4SA 4LAAA 4GOPB 1QNKA 2B2VC 1J5EL 5T14A 2Z4IA 1PFMA 5IYCG 2N88A 2RDHA 4IFDI 1VQEA 3V96A 2VQDA 5D14A 1LABA 5C6AA 2WB1A 4O42A 4JI2Q 4F4XA 4C1NI 1DGSA 3VA5A 2QGQA 4MIUA 4TKOB 4DV1L 3GILA 1PRTB 3PUXA 4A3DH 4YY3H 2ZDHA 4LFCQ 1EIYB 4B9WA 2D62A 3IFTA 1B3AA 4YR2A 2A5HA 1UC9A 1T5EA 3Q6SA 2CH4W 4FDBA 3GTQB 4Q5VA 5IWAL 1IBMQ 1KC7A 2F0SA 1HFNA 1SXTA 1I3QA 3BA9A 1FJGL 4IRCA 1SSOA 1EWHA 2PI2A 5CV4A 5JVH3 3T5KA 4HJ9A 1S0NA 5K5PA 1AE2A 1ILPA 1Q1EA 2UUBQ 3R5FA 2HUGA 5KG2A 3NUCA 2W9CB 2RBMA 1MSGA 4R8NA 1AP0A 2NZHA 2K5NA 4MTDA 3G71A 1WJJA 1WCMH 3OHXC 1N56A 1V43A 1S5FD 2XIWA 2V1CC 5E4WC 2N3SA 5LMNW 2DUDA 1B3QA 2F0NA 2MQHA 4YY3L 3S2HB 3KDFA 4P75A 1YNND 2PN1A 1Y1WA 3J80c 3F8TA 1GVPA 4RGNA 1TIID 2TSSA 4KJOA 1KD1C 1ZYRC 1QUQB 1KNAA 2F0FA 4CKCA 4G3IA 1XNRQ 1Y69U 2VB2X 1NJIC 2KA7A 1PHJA 1VQ9A 5M5YB 2NVYH 1HNZQ 2JYOA 2ZTEA 4UPAA 1VQOA 4JI7H 2HT1A 1VMPA 3VPDA 1UEAB 1TWCB 1LT3D 4K8IA 3J81W 4A3MH 4HJAA 4EBDA 3SK5A 5DGAA 4O3PA 2UVRA 1PTOC 4C3JH 2F0LA 1MJEA 1TS4A 3WO0A 3L4JA 2ZJRA 2B8FA 3H3VH 3TBIB 5KFNA 2EYMA 1E4GT 3DEOA 1HPCA 4J9LA 2HIXA 1BGWA 1Y1VA 2KSWA 2UVWA 4JI4H 4JI8H 3BZCA 3SGIA 1WH2A 4DR7Q 2RDIA 5BN5A 1CQJB 4RUAA 4RZRA 4XYOA 2HDMA 1WSCA 2F52A 4YP3A 2JEFA 2E5LQ 3HOXG 2K5VA 3QOLA 5KT4A 3U58A 4NDXA 3D6WA 5JVDF 2R92A 4JI7L 3TEHB 1VQ8A 3KALA 1BQQT 2A74C 3I2ZA 4DNIA 3KJOA 1WTXA 2M9VA 2C00A 1K3BC 4MV9A 1FNVA 1OO9B 5C1OA 3GV3A 4A93H 4L5RC 4R8UA 4LF7Q 4O4HF 1V51A 1BXRA 5A35A 4LH6A 4J9QA 3RN2A 4E6IA 2EYLA 3FKIB 3F2BA 2D0PA 5FD6A 2LS01 3GIPA 4FBUA 3K57A 3PGZA 2X69A 3FP9A 4JI4L 1TWFH 1PXUA 4ECXA 1SBBB 4JI8L 3X3MA 5L1KA 3PW4A 1PTOB 2JA9A 2X6GA 2CW0D 1ULZA 3KAJA 1JE5A 1GKHA 2OEOA 4LH7A 1O80A 4HCEA 2R87A 3BVZA 4DL6A 4IWXA 4DUZQ 4ME5A 2C2DA 5BMVF 2JA7A 4CDEC 1SNQA 1O7ZA 2CW8A 1X32A 1NE3A 2WV6D 4AYBB 3NPPA 3C46A 3PR4A 3Q24A 5LA6F 5KNCA 5KG0A 1HUMA 1D5XC 3BVGA 3H91A 3QO2A 3VR2A 2IY5B 2KVMA 3A5ZB 2VPSA 3LNNA 4DUYQ 3TZUA 5JJZA 3J7AF 3Q8PB 1H9MA 2NZOA 4BBSG 1I3QH 4DR7H 3S1QB 2GN5A 1CZWA 1VQ4A 5C1PA 2MP1A 4HNVA 2NVXA 1FYCA 2I5HA 3T5JA 3EPIA 3FKIG 3SK8A 2A6HC 2DGYA 4IUTA 2AQ4A 1TQOA 1C8CA 3E9HA 1CM9A 4ALPA 2PYKA 1I6HB 3IAYA 2F0KA 1UE1A 4RCOA 5FK9C 5C3XA 5CV6A 1DOKA 3OWFA 2DZDA 1UC8A 4M7EA 4MZ9A 3GTOA 4OXPA 2M00A 2UVUA 1AEXA 5M3FG 1CKNA 4UHVA 5GROA 3PCOB 2B63A 1Y1WH 1BCPD 5IGCA 2JEJA 3GTMB 3Q8QB 2HQLA 3MWMA 3AU7A 3BVMA 1IKMA 4A3EB 2DY7A 1A8VA 1UAPA 4JBJA 3A55A 5KFGA 2YU9B 4DR6H 1L0WA 4BY7B 1EY9A 2K01A 1SE3A 4S3SA 4A3FH 4JI0Q 1S0MA 2AWOA 2BA1A 4R4CA 4A4IA 3KK7A 4CBVA 4DL2A 3OUZA 4ECYA 5FLXE 3AFPA 1SNCA 4QIWE 5IOCA 4DR2H 1QZHA 1N33Q 4A3JH 4ZRZA 4RZQA 1RJTA 1HQMC 1EZ8A 3CRLC 3EVQA 5E7NA 4C2MA 4MV4A 3OYYA 4U68A 4J9MA 3FRPB 5IGDA 4OONA 4DUYH 5DG9A 2K75A 2PZWA 3GTKH 4YCUA 2WE6A 1Y1VH 1JCKB 4CC5A 4LFBQ 4N9PA 5ELFA 3HOVB 2LXJA 1YBYA 2PW5A 3A74A 5ELCA 4DK6C 2H4OA 1GD7A 4LFAH 1YNNC 4DV5H 2MO0A 4EBCA 2VL6A 2B2VA 2GPWA 1G91A 1L0XB 1T94A 1M6VA 1EHIA 3PV0A 5DLQE 1QVFA 3E9IA 1XMQQ 3HXLA 3GTJB 4DR6L 3T4AC 2AKWB 4G7OC 5C0XH 3GIKA 2R92H 1AH9A 2ZDQA 3KJPA 1VQFA 4DR2L 3QJYA 3S1MH 1RHPA 4IUPA 1GUWA 4JV2A 3S14H 2R8HA 5JJLA 5EWEA 1BKBA 1EY7A 3VR4A 5M5WH 4DV6Q 4EQPA 1Q86C 4A75A 2R6FA 2FLPA 3S1NB 3PR5B 3VYRA 2J6TA 4K5WA 3FVQA 1JB3A 2YZGA 2Z6KC 4DUYL 3K0YA 4QIWA 1X3EA 2K7VA 3KF8A 1Q90A 4B3ML 3EIVA 5AJ3Q 2E74C 5LXTF 4A3IH 1KNEA 5DLFA 2R7NA 3OTOQ 1HR0W 2OXPA 2DNCA 4LFAL 4DV5L 2IX0A 4IPCA 1FKAH 3Q2OA 4DV3Q 2Z0SA 1GSOA 1ILQA 4MTNA 2N49A 5CV9A 1B44D 3I56A 1XNQQ 2JA7H 1DONA 3EA6A 1RJQA 2I80A 3PO2H 2XRQD 2CKZB 1Z2NX 1G51A 1TT2A 4LK1C 2LFNA 3PIOA 1EWCA 4R4QA 2YYZA 4N8FA 3PF5A 2FXQA 5KFWA 5FKAC 2CQAA 1W96A 3A5UA 3IG0A 1S72A 3HOUH 2JEIA 4EVOA 3BYYB 3PW0A 1JOOA 1ENFA 2AHOB 3TS2A 1F9SA 4LF6H 5C3EG 4C3HG 1LTTD 2PBZA 4IRKA 2R8IA 2NVXH 2EY2A 5L37A 4IURA 4IHJF 1Y14B 1IBLQ 3DXJC 2YV5A 3KF6B 2BDOA 1Z2OX 3T13A 3PUZA 1DV1A 3R5XA 4X3SA 3HOWH 2R84A 1I7NA 1Z6HA 2I0QA 2F0VA 3M4IA 1VDZA 3K8AA 5D3IB 2NN6H 1C7YA 2XIGA 4RAYA 5JEAH 2W9BB 2IBKA 3UQ8A 4TQUS 2L4NA 2OLSA 1WCMB 2DPJA 4MAMA 3DWPA 3GTOH 1B2TA 4RNMA 4YR0A 3KHHA 4LF8H 1VQDA 5KFUA 2XWBB 2I8CA 3M9NB 4IR1A 4GNXA 1JLLB 4F4YA 1A3UA 4QW9A 4I50F 3V6KA 3PIP3 4HIOA 2R7KA 1NSNS 3MR6A 3H40A 2HHHQ 4QUCA 2JA8H 1S5BD 2VPQA 4LF6L 3WO1A 3W1GA 4A3DG 3OW2A 3KFUA 2XNAC 3BS1A 1GUOA 2EIFA 4EEYA 2KCNA 1SMYD 3RD4A 3SE0A 1KEEA 2F3WA 2K50A 1K3RA 1SYDA 5FO8B 2W7PA 4J9NA 3NTKA 4PMBA 2W6PA 1EQVA 5HGTA 4DR1L 5LMUH 1PRTD 4DAYB 2QW7A 1SDFA 4RNOA 1XPUA 1WTWA 1C9OA 2VR1A 3TIGA 4C2MH 4TRDA 1N34Q 5D1PA 1WYDA 1VBGA 4RHRA 3GO5A 3MFYA 3ER0A 1JQYD 4UCUA 5C44B 1X56A 2K33A 4LF8L 2R93A 1LTLA 2MHVA 4HMJA 1UE6A 5BR8H 1X55A 4R4TA 2PQAB 4BY1H 3GIIA 1BDOA 5DNFA 1GLVA 2F4VQ 2FHTA 1BCPC 3TP7A 4XT3B 4DXGA 1VQ6A 5IYDG 1IBLH 4JBKA 4YCWA 4AIMA 5C4XB 2R61A 3AYHB 3G8CA 2IX1A 4ED6A 1TKWB 4JI3Q 1K8MA 5IGFA 1GUNA 1PTOF 1A6XA 3GTPA 1S5CD 3OIQA 4JBWA 4DPGA 4K0KL 3Q1KA 3TQTA 2B29A 4M9UA 2ALYB 3LWUA 4DR3Q 5LMUL 5KKNB 2WAQE 5JJKA 1EY0A 5C4ZA 5KFBA 2AGPA 3J81i 4ECZA 4HQ6A 2YTXA 3H6MA 3RUPA 1IW7D 3JAMW 4B08A 2KEDA 3I4LA 2KJXA 4NXNH 2J6UA 4DR5H 2M05A 4GLAC 4A3MG 3VPBA 4EGJA 1G6ZA 1HNXQ 2K6AA 4C3JG 5BR8L 1D8LA 3BDCA 3M4YA 5IIFA 3K80C 2LSSA 3MXNB 4BBSH 2RDJA 2NYZD 4DV2Q 4UP9A 2D9UA 3H4DA 2F0DA 2VY3A 3HOZH 1NR2A 2B2UC 1IBLL 2ATLA 5ELOA 4LWCA 5J1ZA 1YIJA 2UVVA 4ME6A 2EQSA 3GTGA 3ORRA 2L11A 1QCBD 4LSAA 2UXBQ 4XYLB 1ZXTA 1K0SA 3K6OA 5EBDA 2B2YC 3QIAA 5KT5A 4KHPH 4YWKA 2NVQH 2X0SA 1K83A 2R7ZA 4X66Q 4OWTB 2YS7A 1GHJA 4ECSA 4LW1A 1RK5A 5KT3A 3J7AV 4NXNL 3STBD 3AQQA 1PH8A 1LT5D 5IODA 3OUUA 1KHIA 4DR5L 4WJ4A 1C4QA 3GP7A 5FLXL 3RB6A 4XDXA 4KV6A 3J7AK 2ZM6Q 1A2TA 5L1JA 1C48A 2WAQA 4RB2C 2K1BA 4A93G 4ID6A 1HUNA 4J1MA 3HFZB 3K7AH 3UI2A 1K8OA 5A2QW 5CAEB 1ZYRD 3HKZB 3RNUA 3CQZA 2PQEA 4RA8A 1N36Q 5IGBA 4ZAIA 4V0BA 2B3GA 5GAEC 5IT9E 4ECVA 3S9WA 4GC6A 1SE8A 2ZT9C 2VA2A 3DWAA 2E2HA 2F0OA 3CP0A 1SYGA 4XX0B 5EKLA 2VXWA 3SXHA 4DFAA 1Z47A 4B3RQ 1EQTA 3JRWA 2OTLA 1ZHQA 3N6RA 1J5EQ 3KDFB 3I3CA 4KHPL 1PTOD 3OSOA 1HXYD 4CGYB 1V8QA 2WB1G 1SYEA 4Z9CB 4O1NA 4B3TH 3K5OA 1NMFA 4Y7NH 3FEWX 3E0JA 3NWSA 4FXGC 1W6JA 5JPMC 2BE5D 3PW2A 1LO5D 1JX4A 4ZYSA 1GM5A 2NU9B 2ZXOA 1BOSA 4HSPA 1NBWA 1YHQA 5F9LA 3TIIA 4JYAH 4PMCA 4DV4H 3T16A 1Z9FA 3L3OC 5IWAQ 1W6KA 4UCSA 3W1BA 5J39A 3H0GA 5KNDA 2B39A 5DM73 3W5OA 1ZEQX 3M85A 1TS5A 1VS0A 4QWBA 2Z6KA 3D4WA 2R93H 5E4XA 1GUSA 4BWSC 1ICFB 3GTKB 4RNNA 1VQCA 2JEBI 3ND8A 2K32A 3CC4A 3P7JA 2ZM6H 1L1OB 1WTPA 1XXGA 1AN7A 3RB3A 1S5ED 2XVSA 3ZJYC 5CR3A 3PF4A 1PH4A 2XCAA 1I4RA 4B3TL 4RB0A 4MV1A 1CKOA 4X3TA 1Y1WG 4L63B 4GOPC 3GTPH 2J9GA 4EGQA 4YY3Q 2OWOA 2VNUD 4OIKA 3RLNA 4DNTB 4JYAL 2PMZA 4DV4L 2EJFC 1SMYC 2F0TA 2VUMB 2R92B 3UE1A 1E2WA 4CKBA 4J9PA 3BQ0A 3FDSA 1XPOA 2KENA 2ATWA 4TSSA 1A3TA 3S1MB 1K9MC 3OOCA 3NBHA 1E7ZA 1PRTC 4A3FG 2RDGA 3KLSA 4POGA 3S14B 1M0TA 1U9RA 5KG5A 5M5WB 1W3SA 4KK7A 3EQLC 4DLKA 3E3XA 4ZUIA 4L8JA 5T1GA 2BCOA 3TQ1A 4A3JG 1ICWA 1ASZA 1M8AA 4HEDA 3CRKC 5CBEE 4TQRA 5C4JB 2RHQB 1W2BA 2EYPA 3F1ZA 4PQXA 1RIPA 2ZM6L 2PPBC 2AQ1B 5FLXc 5C3EH 1Q3LA 3URYA 1Q12A 2ID0A 2FP4B 1PVOA 3S1RH 5KT6A 2CZGA 2JA5A 2HVRA 2PI2E 3L7ZC 4EFBA 1Y1VG 1VAJA 2FLNA 5C3WA 2NZ1D 2AQ3B 2KOLA 4RGOS 4OO1H 1DIKA 3LWEA 3MR3A 3RLOA 1CQVA 3QFFA 5JVLA 4DL5A 4R4IA 4KKTA 4MA0A 5I4DA 3RGZA 1K83H 5IGEA 2R7ZH 3DMUA 1R4QB 5C0XG 4PNYA 2R3ZA 2R92G 4NW2A 2W6QA 1IW7C 4DL7A 2AMCB 4JI7Q 5ELEA 1I94H 1EYCA 1SMXA 1JORA 5EWGA 2K04A 3KXYT 4HTHA 4P71A 1MGSA 4O3QA 3CQZH 1CKMA 4HJ7A 4IPDA 4UFZA 4EEQA 4J6HA 3CCMA 2HIVA 4CJ1B 1IYUA 1TWGA 1TWAA 2CW7A 1XMOH 4U7CA 4A3IG 1R9TA 1E3PA 3Q8DA 4JI4Q 2MJ8A 1B6SA 4RUCA 1II3A 2E2HH 4JI8Q 4YJ2F 1N48A 1A0IA 5CC4A 5G3LF 4EQ5A 2AUKA 1G2TA 2V4RA 1K8AC 1WTRA 3GLKA 2JA7G 2HJWA 3HS0C 4NB3A 1KLUD 2I46A 2K4KA 3I90A 3GTLB 3PO2G 1B7YB 5EPKA 1RODA 4Q0FA 2JA8B 4K5VA 3STBC 4O3SA 1EIGA 1I94L 2E2JH 2PO4A 2LKVA 2C28A 3NEMA 1OXVA 3HOUG 2V9WA 3SVMA 3RZDH 3KBXA 3PUVA 3F2CA 4FYDA 1XJVA 5IYDH 2R82A 4U6PA 1SYBA 3MXGA 1LTBD 2FPPB 1HNWL 3HOXB 4H44C 1E2VA 4YWMA 3VR3A 3H0GH 4HIDA 1V1PB 2JQOA 2JSOA 1PZID 3I91A 1PDQA 3NE5B 4DK0A 1XMOL 2YL2A 4RCNA 1GUGA 1KDAA 2WFWA 5IYBH 3TN2A 1Y8PB 4IRDA 1K0RA 4XXEA 4P72A 3HOWG 1V1QA 3MJFA 2V4QA 2F0QA 1F77A 2XTIA 1SYFA 3J7A5 3JC66 2NN6G 3M4QA 4IN3A 5JEAG 4IJLA 2OQ0A 1TY2A 4HCSA 5IY0A 1TR5A 2ASDA 2BH2A 1PZKD 4RB1A 4H02A 2B63G 1QZGA 2ASJA 2ASBA 3KLRA 5J2UF 1WFQA 2B2TC 2OH2A 3ERQA 1EYDA 4MA5A 1STYA 2BE5C 3K81C 5I9OA 3SE7A 1HCZA 4I4TF 3TSSA 2B2WA 5I6YA 3K3PA 1S4ZA 3WOEA 2JA8G 3TINA 4XYMB 1KAWA 3OIPA 2J0TD 1PV4A 1B33N 3M7NA 3PIO3 1WR2A 3W2DA 2XC9A 5M3MH 1BJTA 2IHEA 3VYSA 4A3BH 1LTGD 1SRUA 1J9OA 1PH1A 4X64H 4QB4A 1RYRA 4O2BF 1BCPF 2L15A 2WTFA 4QIWB 3M3YH 1EU4A 2KQ3A 1EYGA 2NU7B 1SNDA 3FPPA 5IT9L 2JA5H 4BBSB 3M9MB 4FF1A 1S9FA 4L6TB 4DAVA 4LUZA 1IL2A 3V6JA 5G3LD 2H5XA 2EJMA 2F3IA 5D65A 4BY1G 4TQSA 5CB4F 4EFEA 1AFPA 4XT1B 4GLVB 5JUMA 2ZDGA 1SN8A 5CA1F 1E0BA 1ZHSA 5J22A 3ERSX 3GIQA 4GN5A 2QCPX 2Q2TA 3MWEA 5KFXA 1A62A 3CC7A 3MC0B 3OMCA 1SYXB 5COYA 3OPOA 2NVQB 3BAAA 1KJIA 3SHLA 4DR6Q 3JAMi 3GQCA 1MHWC 4A3KH 4U673 4X64L 5M3FB 4NXMH 4HIKA 2CH4A 1B6RA 2R8KA 2PNRC 1EFWA 3J81E 2E2IA 4ZKBB 2RSNA 4DKAC 2BDNA 4DR2Q 2R7MA 2W71A 2YS6A 5FJ8H 3N40P 3EBEA 4BA2I 1TWGH 1TWAH 3A8KE 1PH5A 4BBRH 1FNUA 3RMHA 2TMPA 1R9TH 4B3MQ 1NAPA 4DGZA 1D1IA 3TMEA 3HOZG 3C1EA 3R93A 4LFAQ 4DV5Q 3PO3H 3S24A 2WKDA 2VZAA 2QYZA 1KBLA 1ET6A 2HCCA 4KMUC 4O0AA 1XWEA 1RJPA 4X3KA 1PK8A 3I4NG 4HR7A 4ZHQF 1N9WA 1YZ6A 1UWVA 4NXML 2FMCA 5BPFA 4MHEA 4BS9A 2K5HA 4Y7NB 4JOIC 1XYIA 2VB3X 2XRSD 1DOLA 3V2TA 2EY6A 3S17H 4A3LH 3R8BA 2C22A 1PFNA 1MJCA 4QWEA 3KHLA 1BBWA 1SE2A 4Q8FA 4MV7A 1XTDA 3NWTA 3I70A 1BXTA 2FINB 2RF4A 1VQ5A 4PG3A 1YNXA 2XN9C 4FO2A 4F7XA 5HURA 2J7ZA 1WOCA 4QL5A 3SDZA 1HZBA 3SK4A 5KYLA 3J7ZC 2F03A 3GTQA 2NVTH 1GSAA 4CKEA 4R1JA 2SEBD 1HZAA 2LXKA 3I55A 3ZYYX 1CE8A 3ETJA 5DGBA 4IALA 3K0XA 4GKJH 1MI2A 1CZGA 1U0LA 3RB0A 5DQIA 3KHGA 2HDLA 4CC6A 2YW2A 2UUCH 1E4FT 1WD1A 2J6SA 3KUPA 4C56C 4P2CB 2GA4B 3R3OA 2W9CA 1F2MA 4UCRA 1EWIA 4ABNA 4R8IA 5IT9c 5D8DA 2Y0SE 3D31A 3GTPB 4ZK9B 2F4IA 2VQFH 5KG4A 1SFOA 4B3MH 3A8JE 4M8AA 1RKNA 4LF6Q 3S16H 1KL9A 5KG6A 3CF5A 4YQWA 1VQPA 4ED8A 4JUZA 5EKKA 4OL7A 1SNMA 2V58A 1QUQA 4DF7A 4QY7A
chains in the Genus database with same CATH topology
4JI3Q 1GO3E 2R7FA 4DR1Q 1OXUA 3KF8B 4JBWA 4DPGA 5C44H 4K0KL 1P16A 2B29A 4GKJL 1YHAA 1AE3A 2ALYB 4DR3Q 5LMUL 2WAQE 5JJKA 2I5MX 1L1OA 4PZ7A 3J81i 2UUCL 3M4OH 2UXBL 2R93G 1LM0A 1SLJA 2YTXA 3RR5A 4GNXC 2WB1E 1IBKQ 1N32L 4LUVA 4YCVA 4GS3A 2MNAA 5C4XH 4LF8Q 4HJ5A 4PZ6A 4JI5Q 4X66L 4GLAC 2VQFL 4A3MG 4LNQA 4DV7L 3M4PA 4LF4L 1HNXQ 2UXCQ 2ZTCA 1SROA 5BR8L 1D8LA 4J15A 3K80C 2LSSA 3MXNB 1S40A 4BBSH 2MFIA 4DV2Q 4C3HH 4UP9A 2KCMA 2VY3A 4A3GH 4R4OA 3HOZH 4AH6A 1IBLL 4JI2L 2GVBA 1EQRA 1E1TA 1PH9A 5ELOA 4K0KQ 1X65A 4LWCA 2E2IH 4XIGS 1YIJA 1VQBA 4LFCL 2EQSA 3S1NH 4GKJQ 4DR4L 1N36L 5LMUQ 3S15H 2KBNA 3CCJA 3CPFA 5JJIA 2UUCQ 2UXBQ 1M90C 5IE8A 3RLFA 4BXXH 1N32Q 1NY4A 1IBML 3RN5A 3TRZA 4UY8C 1E22A 4YWKA 2NVQH 4LUOA 2KHIA 4OWTB 4X66Q 1HJPA 2VQFQ 4LW1A 4B3RL 4DV7Q 1IYJB 4LF4Q 2Q2IA 2OCEA 2VUMG 1KRTA 4NXNL 3STBD 3G4SA 3AQQA 4DV0L 4GOPB 1SR3A 1PH8A 1J5EL 1KHIA 5BR8Q 4DR5L 4WJ4A 2Y0SG 4L5QA 2UUBL 4GN4B 4O2DA 2ZM6Q 3CCUA 5IYCG 1PFSA 4OWWB 1VQEA 4IFDI 2CWAA 4A93G 4JI2Q 1X3GA 3HFZB 1DGSA 3K7AH 2QGQA 4DV1L 4GNXB 3PUXA 4A3DH 4QGUA 4OO1G 3BZKA 3RNUA 4LFCQ 1EIYB 2JE6I 3KYHC 4DR4Q 1UE7A 2D62A 1N36Q 1X54A 4APVA 2B3GA 4BA1I 4GOPA 4FDBA 5GAEC 5GQOA 5IWAL 2R7ZG 5IP7H 5HGQA 1IBMQ 1SE8A 3NENA 1H95A 1OTCA 1FJGL 1XNRL 3CP0A 2IHFA 4B3RQ 1Z47A 2B63H 2PI2A 2OTLA 1J5EQ 4HJ9A 4NXNQ 3KDFB 4DV0Q 3U4ZA 1PH2A 2WAQG 1AE2A 1VQHA 4DR5Q 4RG1A 1HNZL 4KHPL 1Q1EA 2UUBQ 3ULLA 1D7QA 1FGUA 2WB1G 2QA4A 3G48A 2NZHA 1NMFA 4Y7NH 2K5NA 3GTQH 3G71A 1WJJA 1WCMH 4IO9A 1V43A 4IPGA 3DLLA 1GM5A 2V1CC 3CW2C 2N3SA 1NBWA 2BA0A 5LMNL 1YHQA 5LMNW 3CC2A 2DUDA 4HIMA 1Z9FA 2MQHA 3H3VI 4GKKL 1A63A 1JT8A 4YY3L 3KDFA 1T9HA 4P75A 1EQQA 5IWAQ 3J80c 3F8TA 1GVPA 1ASYA 3W1BA 1KD1C 3J7A5 4AYBG 1QUQB 1XNRQ 5IP9G 1WI5A 2D0OA 3W5OA 1N8RC 3M85A 1VS0A 5C0XJ 2Z6KA 1SFOH 4DR7L 2R93H 4UP7A 1NJIC 1PHJA 1VQ9A 1CSPA 4KHPQ 2NVYH 1JJCB 3JAMc 1HNZQ 4JV5L 2ZTEA 4UPAA 1MIUA 3KLWA 3CCEA 1VQCA 2JEBI 3CC4A 1VQOA 5J3BA 4GN3B 1PA6A 2E5LL 1L1OB 2HT1A 1YITA 3ZJYC 4HJAA 4TVAB 4A3MH 3PF4A 1PH4A 4B3TL 4C3JH 5LMNQ 1MJEA 2A8VA 2ZJRA 1VQIA 1CKOA 3H3VH 4Y52H 4KI0A 1Y1WG 4GOPC 3GTPH 4GKKQ 3RZOH 3M9BA 4YY3Q 2OWOA 2VNUD 5M5YH 2CCZA 3H0GG 2CFMA 4JC0A 4JYAL 3RLNA 4DV4L 4LF7L 2HIXA 3UE1A 3F2DA 2JEAI 4OO1I 4MNOA 5IYBG 1XPOA 2KENA 3BZCA 3SGIA 4XTCS 2ATWA 1K9MC 1E7ZA 2CQOA 4POGA 4A3FG 2KCTA 4DR7Q 1YI2A 2ZJQA 4JV5Q 3D0FA 3T1YL 1C0AA 1W3SA 4B3SQ 1L2FA 1Q82C 1B70B 2F52A 4OWXB 5H1SE 4IJHA 2E5LQ 3HOXG 2K5VA 4A3JG 1ASZA 5EAYA 4X62L 3U58A 1JJ2A 4A3EG 5K36G 2RHQB 1W2BA 2VUMH 5ELNA 3I7FA 1VQLA 4DUZL 3F1ZA 4NPSA 4JI7L 1RIPA 3TEHB 2ZM6L 1VQ8A 4B3TQ 2C35B 5FLXc 5C3EH 3KJOA 3I2ZA 4DNIA 1Q12A 2ID0A 1PVOA 3S1RH 4BY7G 5IYCH 4AYBE 2PI2E 4JI1L 1G6PA 1VQAA 3L7ZC 1Y1VG 1LUZA 4A93H 4JYAQ 4L5RC 1Q1BA 4DV4Q 4LF7Q 1QVCA 3RN2A 3F2BA 1VQNA 3RLOA 2D0PA 1YJ9A 3I4NH 5M3MG 4A3BG 5C4JH 3PGZA 3FP9A 4P74A 4R4IA 4JI4L 3NELA 1TWFH 4IOCA 3T1YQ 3J81j 4JI8L 4JBMA 1K83H 1YEZA 2R7ZH 1XPRA 2JA9A 1OXXK 2XGTA 1TWHH 4YHHL 1JE5A 1GKHA 3I4OA 3I4MG 5C0XG 2R92G 4X62Q 2QEXA 3HOVG 2UU9Q 3CPWA 2AMCB 1IZ6A 3CCVA 2JA5G 4DUZQ 1M1KC 4JI7Q 2Q2HA 4OX9L 1BVSA 1VQMA 1SMXA 2YTYA 3K7UC 1JJGA 1NE3A 4X6AH 4JI1Q 4P71A 3CQZH 3G6EA 3VDYA 2OQKA 5GADC 1CKMA 4HJ7A 2IY5B 1U5KA 4IPDA 1L1OC 3A5ZB 3IRBA 3CCMA 2CWPA 3FHWA 2HIVA 3HOYG 4QQBX 4DUYQ 3E0EA 4P73A 4A3IG 3LGJA 3AEVA 2NZOA 1E3PA 2A19A 2RHSB 3Q8DA 4JI4Q 4BBSG 1I3QH 2E2HH 2VS1A 4JI8Q 1A0IA 2GN5A 1VQ4A 4QJFA 3L2PA 1X9NA 4A3KG 4YHHQ 4EQ5A 2RCNA 5IP9H 2I5HA 1K8AC 3FKIG 4IOAA 2K52A 2DGYA 2PMZE 2JA7G 4NB3A 4HJ8A 4JI0L 4OX9Q 2K4KA 3PO2G 3L0OA 1OXSC 3E9HA 2UUAL 4ALPA 1B7YB 5M5XH 3GD7A 5FJ8G 4JI6L 1HZ9A 4BXXG 1UE1A 3PUWA 2A1AA 3STBC 1YJWA 1KQSA 1N33L 1I94L 2E2JH 3ULPA 1PH7A 3NEMA 1OXVA 3HOUG 5IYDH 4BBRG 3PUVA 4MZ9A 4OXPA 3F2CA 3RZDH 1XJVA 1Q81C 2OTJA 5M3FG 2Q2UA 2K14A 1CKNA 1V9PA 5HY6A 3U4VA 5GROA 3PCOB 1QVGA 1Y1WH 1HNWL 3KF6A 4DAMA 4YWMA 3GTLH 2HQLA 2WP8J 3H0GH 4HIDA 1XMOL 2JQOA 4LFBL 3PO3G 1A8VA 2I5LX 4JBJA 1I6HH 3ICEA 2WFWA 5IYBH 4ME3A 1K0RA 1E24A 4P72A 1L0WA 1CUKA 3HOWG 1V1QA 4A3FH 4JI0Q 4B3SL 2XTIA 1YHBA 2AWOA 1K73C 1XMQL 2UUAQ 2BA1A 3JC66 4R4CA 4A4IA 2NN6G 3M4QA 1Q46A 5JEAG 3A0JA 1J6QA 4IJLA 2OQ0A 3AFPA 4JI6Q 3S2HH 3NBHB 4QIWE 3HOXH 1QZHA 1N33Q 5IY0A 3GTMH 2JK8A 4A3JH 1I94Q 1O7IA 5C0XI 4A3LG 4KHZA 2BH2A 3TS0A 5E7NA 4A3DG 4H02A 2B63G 3OYYA 1QZGA 4IPHA 2ASBA 2YTVA 2YU9H 1WFQA 4OONA 4DV6L 1X3FA 3K81C 4BY7H 1HNWQ 2K75A 4KLKA 3GTKH 4YCUA 1Y1VH 1Q8KA 1XMOQ 1VCIA 4LFBQ 2LXJA 2JA8G 4PZ8A 1TWCH 1YBYA 1KAWA 3A74A 4DK6C 1WCMG 1HH2P 1YVCA 3DM3A 3MEFA 1PV4A 2ZTDA 1GD7A 3M7NA 4DV2L 2JA6G 5AJ3L 2MO0A 3B6YA 2IHEA 2VL6A 5M3MH 1PH3A 1MKHA 1SRUA 3CCSA 1JMCA 4A3BH 1PYBA 3OTOL 3PV0A 5DLQE 1PH1A 1QVFA 3E9IA 4PMWA 3CCRA 1XMQQ 2ES2A 1X6OA 1CSQA 4DR6L 2L15A 3M3YH 5FLMG 2AKWB 2VQEL 2UU9L 2IT1A 3I4MH 4DV3L 1EYGA 2JJQA 2R92H 4WJ3M 1AH9A 1Q7YC 3HOVH 1XNQL 3PIPA 4AQYL 3KJPA 2JA5H 4L5SA 1VQFA 2PNHA 4DR2L 3S1MH 2PQAA 1NTGA 3CXCA 4LUZA 3CMAA 1IL2A 3S14H 5JJLA 4YWLA 1BKBA 1VQJA 5GAHC 2H5XA 5M5WH 4DV6Q 1Q86C 3GTGH 4A75A 4JOIA 2F3IA 3EN2A 4BY1G 1I50H 3GTJH 2Z6KC 4DUYL 1JB7A 2MO1A 3UE0A 4GLVB 4A3CG 1X3EA 1SN8A 3J80i 3HOYH 1TXYA 4B3ML 3S2DH 4X65L 3ERSX 2N8NA 3EIVA 5AJ3Q 1YJNA 2R7DA 4GN5A 4A3IH 4LF9Q 4DK3C 2ZJPA 1I5FA 2Q2TA 1FVIA 3UDXA 2GVAA 4POFA 3OTOQ 1HR0L 1A62A 3CC7A 1HR0W 3CCLA 5JEAJ 4DV5L 4LFAL 5C44G 4DR6Q 2IX0A 3JAMi 4IPCA 2VQEQ 4A3KH 4X64L 4DV3Q 2Z0SA 1G291 4HIKA 1EUJA 2N49A 4MTNA 3FKIH 3I56A 1K8GA 3HKZE 1EFWA 1XNQQ 2JA7H 5GAGC 4GLXA 1S3OA 4AQYQ 4DKAC 4DR2Q 3PO2H 2CKZB 1FL0A 4A76A 3ULJA 1G51A 3PIOA 4R4QA 2NN6I 5C4XG 2YYZA 5FJ8H 3PF5A 4JCVE 2FXQA 3EBEA 4BA2I 4IFDJ 2N78A 3CD6A 4LF5L 1EIFA 1TWGH 1TWAH 3A5UA 1S72A 3HOUH 1PH5A 4BBRH 3U50C 5M3FH 1R9TH 4B3MQ 2AHOB 4X65Q 1KIXA 3TS2A 1UEBA 1IXRA 5C3EG 3TREA 1RL2A 4A3GG 3HOZG 1HR0Q 2NVXH 2IX1A 2HHHL 1PYSB 2AWNA 4LFAQ 3WWVA 4DV5Q 3T1HL 3PO3H 1CKNB 1VQGA 1E1OA 1Y14B 2VZAA 3S24A 4C3IH 1IBLQ 3PSIA 4UP8A 4X64Q 1KXLA 2YV5A 3KF6B 4O0AA 4RMFA 2VW9A 3PUZA 3HOWH 2R6GA 3I4NG 4EX5A 1N9WA 1YZ6A 1UWVA 2I0QA 3K8AA 4NXML 1C7YA 2UXDL 2E8GA 2K5HA 3J81c 4JOIC 4TQUS 3S1QH 1LYLA 1OXTA 3UDIA 1NMGA 3GTOH 3S17H 4A3LH 4LF5Q 1N34L 1MJCA 1VQDA 1B8AA 1BBWA 4GNXA 3CMEA 1VQKA 1XTDA 4L5TA 3GDEA 4HIOA 1VQ7A 2RF4A 1VQ5A 4PG3A 1YNXA 2HHHQ 3BJUA 3T1HQ 2JA8H 1WOCA 4QL5A 2BH8A 1HZBA 3W1GA 3J7ZC 3OW2A 4LF6L 2F4VL 3KOJA 2NVTH 3KFUA 2EIFA 4DV1Q 3BU2A 4R1JA 2KHJA 3I55A 1HZAA 2LXKA 2JA6H 2K50A 3CAMA 1K3RA 3AFQA 3K0XA 3UDFA 4JI3L 1U0LA 3UDGA 4DR1L 4NXMQ 5IP7G 4DAYB 2UXDQ 1P8LA 3TQYA 1PH6A 1XPUA 5FLMH 4A3EH 1C9OA 4DR3L 4C2MH 1N34Q 1FJGQ 1EWIA 1WYDA 5IT9c 3CCQA 2Y0SE 3D31A 3HKZG 1KC8C 3PUYA 3HKSA 3GO5A 1IBKL 3ER0A 1X56A 3H15A 4LF8L 1LTLA 4IFDG 1UE6A 4JI5L 1X55A 4R4TA 2PQAB 4BY1H 1HZCA 1HNXL 4LF6Q 3S16H 1KL9A 2F4VQ 2UXCL 3CF5A 1UE5A 1VQPA 4A3CH 4JG2A 4LF9L 1EOVA 1VQ6A 1KRSA 2EXDA 5IYDG 4JBKA 1QUQA 4YCWA 4AIMA 4QY7A 3AYHB 1BBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 Q;  1GO3 E;  2R7F A;  4DR1 Q;  1OXU A;  3KF8 B;  4JBW A;  4DPG A;  5C44 H;  4K0K L;  1P16 A;  2B29 A;  4GKJ L;  1YHA A;  1AE3 A;  2ALY B;  4DR3 Q;  5LMU L;  2WAQ E;  5JJK A;  2I5M X;  1L1O A;  4PZ7 A;  3J81 i;  2UUC L;  3M4O H;  2UXB L;  2R93 G;  1LM0 A;  1SLJ A;  2YTX A;  3RR5 A;  4GNX C;  2WB1 E;  1IBK Q;  1N32 L;  4LUV A;  4YCV A;  4GS3 A;  2MNA A;  5C4X H;  4LF8 Q;  4HJ5 A;  4PZ6 A;  4JI5 Q;  4X66 L;  4GLA C;  2VQF L;  4A3M G;  4LNQ A;  4DV7 L;  3M4P A;  4LF4 L;  1HNX Q;  2UXC Q;  2ZTC A;  1SRO A;  5BR8 L;  1D8L A;  4J15 A;  3K80 C;  2LSS A;  3MXN B;  1S40 A;  4BBS H;  2MFI A;  4DV2 Q;  4C3H H;  4UP9 A;  2KCM A;  2VY3 A;  4A3G H;  4R4O A;  3HOZ H;  4AH6 A;  1IBL L;  4JI2 L;  2GVB A;  1EQR A;  1E1T A;  1PH9 A;  5ELO A;  4K0K Q;  1X65 A;  4LWC A;  2E2I H;  4XIG S;  1YIJ A;  1VQB A;  4LFC L;  2EQS A;  3S1N H;  4GKJ Q;  4DR4 L;  1N36 L;  5LMU Q;  3S15 H;  2KBN A;  3CCJ A;  3CPF A;  5JJI A;  2UUC Q;  2UXB Q;  1M90 C;  5IE8 A;  3RLF A;  4BXX H;  1N32 Q;  1NY4 A;  1IBM L;  3RN5 A;  3TRZ A;  4UY8 C;  1E22 A;  4YWK A;  2NVQ H;  4LUO A;  2KHI A;  4OWT B;  4X66 Q;  1HJP A;  2VQF Q;  4LW1 A;  4B3R L;  4DV7 Q;  1IYJ B;  4LF4 Q;  2Q2I A;  2OCE A;  2VUM G;  1KRT A;  4NXN L;  3STB D;  3G4S A;  3AQQ A;  4DV0 L;  4GOP B;  1SR3 A;  1PH8 A;  1J5E L;  1KHI A;  5BR8 Q;  4DR5 L;  4WJ4 A;  2Y0S G;  4L5Q A;  2UUB L;  4GN4 B;  4O2D A;  2ZM6 Q;  3CCU A;  5IYC G;  1PFS A;  4OWW B;  1VQE A;  4IFD I;  2CWA A;  4A93 G;  4JI2 Q;  1X3G A;  3HFZ B;  1DGS A;  3K7A H;  2QGQ A;  4DV1 L;  4GNX B;  3PUX A;  4A3D H;  4QGU A;  4OO1 G;  3BZK A;  3RNU A;  4LFC Q;  1EIY B;  2JE6 I;  3KYH C;  4DR4 Q;  1UE7 A;  2D62 A;  1N36 Q;  1X54 A;  4APV A;  2B3G A;  4BA1 I;  4GOP A;  4FDB A;  5GAE C;  5GQO A;  5IWA L;  2R7Z G;  5IP7 H;  5HGQ A;  1IBM Q;  1SE8 A;  3NEN A;  1H95 A;  1OTC A;  1FJG L;  1XNR L;  3CP0 A;  2IHF A;  4B3R Q;  1Z47 A;  2B63 H;  2PI2 A;  2OTL A;  1J5E Q;  4HJ9 A;  4NXN Q;  3KDF B;  4DV0 Q;  3U4Z A;  1PH2 A;  2WAQ G;  1AE2 A;  1VQH A;  4DR5 Q;  4RG1 A;  1HNZ L;  4KHP L;  1Q1E A;  2UUB Q;  3ULL A;  1D7Q A;  1FGU A;  2WB1 G;  2QA4 A;  3G48 A;  2NZH A;  1NMF A;  4Y7N H;  2K5N A;  3GTQ H;  3G71 A;  1WJJ A;  1WCM H;  4IO9 A;  1V43 A;  4IPG A;  3DLL A;  1GM5 A;  2V1C C;  3CW2 C;  2N3S A;  1NBW A;  2BA0 A;  5LMN L;  1YHQ A;  5LMN W;  3CC2 A;  2DUD A;  4HIM A;  1Z9F A;  2MQH A;  3H3V I;  4GKK L;  1A63 A;  1JT8 A;  4YY3 L;  3KDF A;  1T9H A;  4P75 A;  1EQQ A;  5IWA Q;  3J80 c;  3F8T A;  1GVP A;  1ASY A;  3W1B A;  1KD1 C;  3J7A 5;  4AYB G;  1QUQ B;  1XNR Q;  5IP9 G;  1WI5 A;  2D0O A;  3W5O A;  1N8R C;  3M85 A;  1VS0 A;  5C0X J;  2Z6K A;  1SFO H;  4DR7 L;  2R93 H;  4UP7 A;  1NJI C;  1PHJ A;  1VQ9 A;  1CSP A;  4KHP Q;  2NVY H;  1JJC B;  3JAM c;  1HNZ Q;  4JV5 L;  2ZTE A;  4UPA A;  1MIU A;  3KLW A;  3CCE A;  1VQC A;  2JEB I;  3CC4 A;  1VQO A;  5J3B A;  4GN3 B;  1PA6 A;  2E5L L;  1L1O B;  2HT1 A;  1YIT A;  3ZJY C;  4HJA A;  4TVA B;  4A3M H;  3PF4 A;  1PH4 A;  4B3T L;  4C3J H;  5LMN Q;  1MJE A;  2A8V A;  2ZJR A;  1VQI A;  1CKO A;  3H3V H;  4Y52 H;  4KI0 A;  1Y1W G;  4GOP C;  3GTP H;  4GKK Q;  3RZO H;  3M9B A;  4YY3 Q;  2OWO A;  2VNU D;  5M5Y H;  2CCZ A;  3H0G G;  2CFM A;  4JC0 A;  4JYA L;  3RLN A;  4DV4 L;  4LF7 L;  2HIX A;  3UE1 A;  3F2D A;  2JEA I;  4OO1 I;  4MNO A;  5IYB G;  1XPO A;  2KEN A;  3BZC A;  3SGI A;  4XTC S;  2ATW A;  1K9M C;  1E7Z A;  2CQO A;  4POG A;  4A3F G;  2KCT A;  4DR7 Q;  1YI2 A;  2ZJQ A;  4JV5 Q;  3D0F A;  3T1Y L;  1C0A A;  1W3S A;  4B3S Q;  1L2F A;  1Q82 C;  1B70 B;  2F52 A;  4OWX B;  5H1S E;  4IJH A;  2E5L Q;  3HOX G;  2K5V A;  4A3J G;  1ASZ A;  5EAY A;  4X62 L;  3U58 A;  1JJ2 A;  4A3E G;  5K36 G;  2RHQ B;  1W2B A;  2VUM H;  5ELN A;  3I7F A;  1VQL A;  4DUZ L;  3F1Z A;  4NPS A;  4JI7 L;  1RIP A;  3TEH B;  2ZM6 L;  1VQ8 A;  4B3T Q;  2C35 B;  5FLX c;  5C3E H;  3KJO A;  3I2Z A;  4DNI A;  1Q12 A;  2ID0 A;  1PVO A;  3S1R H;  4BY7 G;  5IYC H;  4AYB E;  2PI2 E;  4JI1 L;  1G6P A;  1VQA A;  3L7Z C;  1Y1V G;  1LUZ A;  4A93 H;  4JYA Q;  4L5R C;  1Q1B A;  4DV4 Q;  4LF7 Q;  1QVC A;  3RN2 A;  3F2B A;  1VQN A;  3RLO A;  2D0P A;  1YJ9 A;  3I4N H;  5M3M G;  4A3B G;  5C4J H;  3PGZ A;  3FP9 A;  4P74 A;  4R4I A;  4JI4 L;  3NEL A;  1TWF H;  4IOC A;  3T1Y Q;  3J81 j;  4JI8 L;  4JBM A;  1K83 H;  1YEZ A;  2R7Z H;  1XPR A;  2JA9 A;  1OXX K;  2XGT A;  1TWH H;  4YHH L;  1JE5 A;  1GKH A;  3I4O A;  3I4M G;  5C0X G;  2R92 G;  4X62 Q;  2QEX A;  3HOV G;  2UU9 Q;  3CPW A;  2AMC B;  1IZ6 A;  3CCV A;  2JA5 G;  4DUZ Q;  1M1K C;  4JI7 Q;  2Q2H A;  4OX9 L;  1BVS A;  1VQM A;  1SMX A;  2YTY A;  3K7U C;  1JJG A;  1NE3 A;  4X6A H;  4JI1 Q;  4P71 A;  3CQZ H;  3G6E A;  3VDY A;  2OQK A;  5GAD C;  1CKM A;  4HJ7 A;  2IY5 B;  1U5K A;  4IPD A;  1L1O C;  3A5Z B;  3IRB A;  3CCM A;  2CWP A;  3FHW A;  2HIV A;  3HOY G;  4QQB X;  4DUY Q;  3E0E A;  4P73 A;  4A3I G;  3LGJ A;  3AEV A;  2NZO A;  1E3P A;  2A19 A;  2RHS B;  3Q8D A;  4JI4 Q;  4BBS G;  1I3Q H;  2E2H H;  2VS1 A;  4JI8 Q;  1A0I A;  2GN5 A;  1VQ4 A;  4QJF A;  3L2P A;  1X9N A;  4A3K G;  4YHH Q;  4EQ5 A;  2RCN A;  5IP9 H;  2I5H A;  1K8A C;  3FKI G;  4IOA A;  2K52 A;  2DGY A;  2PMZ E;  2JA7 G;  4NB3 A;  4HJ8 A;  4JI0 L;  4OX9 Q;  2K4K A;  3PO2 G;  3L0O A;  1OXS C;  3E9H A;  2UUA L;  4ALP A;  1B7Y B;  5M5X H;  3GD7 A;  5FJ8 G;  4JI6 L;  1HZ9 A;  4BXX G;  1UE1 A;  3PUW A;  2A1A A;  3STB C;  1YJW A;  1KQS A;  1N33 L;  1I94 L;  2E2J H;  3ULP A;  1PH7 A;  3NEM A;  1OXV A;  3HOU G;  5IYD H;  4BBR G;  3PUV A;  4MZ9 A;  4OXP A;  3F2C A;  3RZD H;  1XJV A;  1Q81 C;  2OTJ A;  5M3F G;  2Q2U A;  2K14 A;  1CKN A;  1V9P A;  5HY6 A;  3U4V A;  5GRO A;  3PCO B;  1QVG A;  1Y1W H;  1HNW L;  3KF6 A;  4DAM A;  4YWM A;  3GTL H;  2HQL A;  2WP8 J;  3H0G H;  4HID A;  1XMO L;  2JQO A;  4LFB L;  3PO3 G;  1A8V A;  2I5L X;  4JBJ A;  1I6H H;  3ICE A;  2WFW A;  5IYB H;  4ME3 A;  1K0R A;  1E24 A;  4P72 A;  1L0W A;  1CUK A;  3HOW G;  1V1Q A;  4A3F H;  4JI0 Q;  4B3S L;  2XTI A;  1YHB A;  2AWO A;  1K73 C;  1XMQ L;  2UUA Q;  2BA1 A;  3JC6 6;  4R4C A;  4A4I A;  2NN6 G;  3M4Q A;  1Q46 A;  5JEA G;  3A0J A;  1J6Q A;  4IJL A;  2OQ0 A;  3AFP A;  4JI6 Q;  3S2H H;  3NBH B;  4QIW E;  3HOX H;  1QZH A;  1N33 Q;  5IY0 A;  3GTM H;  2JK8 A;  4A3J H;  1I94 Q;  1O7I A;  5C0X I;  4A3L G;  4KHZ A;  2BH2 A;  3TS0 A;  5E7N A;  4A3D G;  4H02 A;  2B63 G;  3OYY A;  1QZG A;  4IPH A;  2ASB A;  2YTV A;  2YU9 H;  1WFQ A;  4OON A;  4DV6 L;  1X3F A;  3K81 C;  4BY7 H;  1HNW Q;  2K75 A;  4KLK A;  3GTK H;  4YCU A;  1Y1V H;  1Q8K A;  1XMO Q;  1VCI A;  4LFB Q;  2LXJ A;  2JA8 G;  4PZ8 A;  1TWC H;  1YBY A;  1KAW A;  3A74 A;  4DK6 C;  1WCM G;  1HH2 P;  1YVC A;  3DM3 A;  3MEF A;  1PV4 A;  2ZTD A;  1GD7 A;  3M7N A;  4DV2 L;  2JA6 G;  5AJ3 L;  2MO0 A;  3B6Y A;  2IHE A;  2VL6 A;  5M3M H;  1PH3 A;  1MKH A;  1SRU A;  3CCS A;  1JMC A;  4A3B H;  1PYB A;  3OTO L;  3PV0 A;  5DLQ E;  1PH1 A;  1QVF A;  3E9I A;  4PMW A;  3CCR A;  1XMQ Q;  2ES2 A;  1X6O A;  1CSQ A;  4DR6 L;  2L15 A;  3M3Y H;  5FLM G;  2AKW B;  2VQE L;  2UU9 L;  2IT1 A;  3I4M H;  4DV3 L;  1EYG A;  2JJQ A;  2R92 H;  4WJ3 M;  1AH9 A;  1Q7Y C;  3HOV H;  1XNQ L;  3PIP A;  4AQY L;  3KJP A;  2JA5 H;  4L5S A;  1VQF A;  2PNH A;  4DR2 L;  3S1M H;  2PQA A;  1NTG A;  3CXC A;  4LUZ A;  3CMA A;  1IL2 A;  3S14 H;  5JJL A;  4YWL A;  1BKB A;  1VQJ A;  5GAH C;  2H5X A;  5M5W H;  4DV6 Q;  1Q86 C;  3GTG H;  4A75 A;  4JOI A;  2F3I A;  3EN2 A;  4BY1 G;  1I50 H;  3GTJ H;  2Z6K C;  4DUY L;  1JB7 A;  2MO1 A;  3UE0 A;  4GLV B;  4A3C G;  1X3E A;  1SN8 A;  3J80 i;  3HOY H;  1TXY A;  4B3M L;  3S2D H;  4X65 L;  3ERS X;  2N8N A;  3EIV A;  5AJ3 Q;  1YJN A;  2R7D A;  4GN5 A;  4A3I H;  4LF9 Q;  4DK3 C;  2ZJP A;  1I5F A;  2Q2T A;  1FVI A;  3UDX A;  2GVA A;  4POF A;  3OTO Q;  1HR0 L;  1A62 A;  3CC7 A;  1HR0 W;  3CCL A;  5JEA J;  4DV5 L;  4LFA L;  5C44 G;  4DR6 Q;  2IX0 A;  3JAM i;  4IPC A;  2VQE Q;  4A3K H;  4X64 L;  4DV3 Q;  2Z0S A;  1G29 1;  4HIK A;  1EUJ A;  2N49 A;  4MTN A;  3FKI H;  3I56 A;  1K8G A;  3HKZ E;  1EFW A;  1XNQ Q;  2JA7 H;  5GAG C;  4GLX A;  1S3O A;  4AQY Q;  4DKA C;  4DR2 Q;  3PO2 H;  2CKZ B;  1FL0 A;  4A76 A;  3ULJ A;  1G51 A;  3PIO A;  4R4Q A;  2NN6 I;  5C4X G;  2YYZ A;  5FJ8 H;  3PF5 A;  4JCV E;  2FXQ A;  3EBE A;  4BA2 I;  4IFD J;  2N78 A;  3CD6 A;  4LF5 L;  1EIF A;  1TWG H;  1TWA H;  3A5U A;  1S72 A;  3HOU H;  1PH5 A;  4BBR H;  3U50 C;  5M3F H;  1R9T H;  4B3M Q;  2AHO B;  4X65 Q;  1KIX A;  3TS2 A;  1UEB A;  1IXR A;  5C3E G;  3TRE A;  1RL2 A;  4A3G G;  3HOZ G;  1HR0 Q;  2NVX H;  2IX1 A;  2HHH L;  1PYS B;  2AWN A;  4LFA Q;  3WWV A;  4DV5 Q;  3T1H L;  3PO3 H;  1CKN B;  1VQG A;  1E1O A;  1Y14 B;  2VZA A;  3S24 A;  4C3I H;  1IBL Q;  3PSI A;  4UP8 A;  4X64 Q;  1KXL A;  2YV5 A;  3KF6 B;  4O0A A;  4RMF A;  2VW9 A;  3PUZ A;  3HOW H;  2R6G A;  3I4N G;  4EX5 A;  1N9W A;  1YZ6 A;  1UWV A;  2I0Q A;  3K8A A;  4NXM L;  1C7Y A;  2UXD L;  2E8G A;  2K5H A;  3J81 c;  4JOI C;  4TQU S;  3S1Q H;  1LYL A;  1OXT A;  3UDI A;  1NMG A;  3GTO H;  3S17 H;  4A3L H;  4LF5 Q;  1N34 L;  1MJC A;  1VQD A;  1B8A A;  1BBW A;  4GNX A;  3CME A;  1VQK A;  1XTD A;  4L5T A;  3GDE A;  4HIO A;  1VQ7 A;  2RF4 A;  1VQ5 A;  4PG3 A;  1YNX A;  2HHH Q;  3BJU A;  3T1H Q;  2JA8 H;  1WOC A;  4QL5 A;  2BH8 A;  1HZB A;  3W1G A;  3J7Z C;  3OW2 A;  4LF6 L;  2F4V L;  3KOJ A;  2NVT H;  3KFU A;  2EIF A;  4DV1 Q;  3BU2 A;  4R1J A;  2KHJ A;  3I55 A;  1HZA A;  2LXK A;  2JA6 H;  2K50 A;  3CAM A;  1K3R A;  3AFQ A;  3K0X A;  3UDF A;  4JI3 L;  1U0L A;  3UDG A;  4DR1 L;  4NXM Q;  5IP7 G;  4DAY B;  2UXD Q;  1P8L A;  3TQY A;  1PH6 A;  1XPU A;  5FLM H;  4A3E H;  1C9O A;  4DR3 L;  4C2M H;  1N34 Q;  1FJG Q;  1EWI A;  1WYD A;  5IT9 c;  3CCQ A;  2Y0S E;  3D31 A;  3HKZ G;  1KC8 C;  3PUY A;  3HKS A;  3GO5 A;  1IBK L;  3ER0 A;  1X56 A;  3H15 A;  4LF8 L;  1LTL A;  4IFD G;  1UE6 A;  4JI5 L;  1X55 A;  4R4T A;  2PQA B;  4BY1 H;  1HZC A;  1HNX L;  4LF6 Q;  3S16 H;  1KL9 A;  2F4V Q;  2UXC L;  3CF5 A;  1UE5 A;  1VQP A;  4A3C H;  4JG2 A;  4LF9 L;  1EOV A;  1VQ6 A;  1KRS A;  2EXD A;  5IYD G;  4JBK A;  1QUQ A;  4YCW A;  4AIM A;  4QY7 A;  3AYH B;  1BBU A; 
#chains in the Genus database with same CATH topology
 1GO3 E;  1WTQ A;  4DR4 H;  4DR1 Q;  3LP8 A;  1A3V A;  4ULL A;  1KDC A;  3J80 W;  5C8Y F;  1X3P A;  5KFK A;  1F2Y A;  1YHA A;  3MEH A;  4GKJ L;  4FF2 A;  5BN4 A;  2R86 A;  3K58 A;  3L9A X;  1H9S A;  1EU3 A;  3QR8 A;  5C3E B;  2I5M X;  4C3H B;  3RAQ A;  2R93 G;  2UUC L;  3M4O H;  3NGD A;  1TWC A;  3S1R B;  1SLJ A;  3RR5 A;  2K05 A;  4G7Z C;  1DM0 B;  4LUV A;  2XWJ B;  2MPM A;  4GS3 A;  2MNA A;  4F4Z A;  3A54 A;  4LF8 Q;  4HAE A;  4DV0 H;  4PZ6 A;  1GHK A;  3PN1 A;  1CT1 D;  1PRT F;  5M9O A;  2VQF L;  1UUP A;  4IUN A;  1SRO A;  1DOM A;  4J15 A;  2RQX A;  1S40 A;  4QWC A;  3Q8S B;  2HQE A;  3D6C A;  2KCM A;  2Y0S A;  4AH6 A;  4KD3 A;  4K0K Q;  4KY7 A;  2E2I H;  1IYV A;  1PFB A;  4DR4 L;  5CBA E;  4JVZ A;  5LMU Q;  2WAQ B;  1LLR D;  4FVM A;  3CPF A;  3HBL A;  1BNZ A;  3D8G A;  4A3D B;  3RN5 A;  1I7L A;  4UY8 C;  4LUO A;  2KHI A;  3BAB A;  1IYJ B;  4KHV A;  2SDF A;  4DV0 L;  1F9P A;  1IHZ A;  1Y8O B;  1Z7T A;  4KJN A;  5BR8 Q;  3V4Z A;  5FO9 B;  4GN4 B;  3BG3 A;  3IFD A;  3H3V C;  1PFS A;  5LMN H;  1EY8 A;  3Q22 A;  3HRZ C;  1X3G A;  1ET9 A;  4I65 A;  4FBT A;  4GKK H;  2YCH A;  4OO1 G;  1EEF D;  2FMA A;  4DR1 H;  1AZP A;  3BZK A;  2JE6 I;  3KYH C;  4F8M A;  2Q8T A;  2BQU A;  1CS0 A;  4HMI A;  2O5J C;  2FPI B;  2EZV A;  1X54 A;  1G8Z D;  1BNC A;  1O75 A;  1EIH A;  2B2T A;  2L55 A;  2R7Z G;  5HGQ A;  3M9O B;  3NEN A;  1RTN A;  2E2J B;  1OTC A;  1S68 A;  3RZD B;  4XQQ A;  2B63 H;  4AYB A;  5HBR B;  5E3F A;  1BBX C;  4NXN Q;  4ZUJ A;  3U4Z A;  2WAQ G;  1F9Q A;  4DR5 Q;  2N55 A;  2D5D A;  2K28 A;  1FGU A;  3R2T A;  4IFD H;  4EQO A;  2E2D C;  3OSP A;  2BOS A;  3GTQ H;  3W3A A;  2L5T A;  1VBH A;  2EY5 A;  5EGT A;  4IO9 A;  1AZQ A;  4RU9 A;  4IPG A;  4ECU A;  3DLL A;  3CW2 C;  2NVY B;  4I7Z C;  1M7J A;  4K0K H;  5LMN L;  3ND9 A;  2I87 A;  1K1Q A;  4HIM A;  3H3V I;  1HA5 A;  4GKK L;  3K59 A;  2L12 A;  1ZQ7 A;  1T9H A;  4Q45 A;  4A3M B;  1AUX A;  1SNO A;  5ELB A;  4CDF C;  4C3J B;  3T1Y H;  3MXP A;  1WI5 A;  1Q8I A;  1QIL A;  2D0O A;  5JAV A;  2NU6 B;  5KT2 A;  1V4Y A;  5C0X J;  3NQT A;  4FXD A;  1SFO H;  2YZN A;  1SYC A;  4KHP Q;  4JV5 L;  1JJC B;  4X62 H;  1MIU A;  3G7L A;  1EFI D;  3CCE A;  2RDF A;  1QE6 A;  4O4L F;  1PA6 A;  5J3B A;  4GN3 B;  3LML A;  1PLF A;  3GV7 B;  1YIT A;  4QMG A;  3J81 L;  1EUD B;  2NU8 B;  1CA6 A;  4TVA B;  2AGO A;  3GTM A;  4A3B B;  4QCL A;  4XYQ A;  3MTS A;  3QG1 A;  3N8D A;  1VQI A;  1LTS D;  4A2A A;  3RAX A;  3CKI B;  3RZO H;  3OHA A;  4ECQ A;  2YU9 A;  5M5Y H;  3H0G G;  5CYU A;  3M3Y B;  3RGX A;  4OHJ A;  1OWT A;  1RF2 D;  4Q0Y A;  3F2D A;  1VF7 A;  1JIH A;  4MNO A;  5IYB G;  5KFV A;  3HGB A;  4J9R A;  1CA5 A;  2JA5 B;  2NB0 A;  3HP3 A;  5JOB A;  2KCT A;  4YHH H;  1KTK A;  4H13 C;  2ZJQ A;  3T1Y L;  4A93 B;  4OEL B;  3I72 A;  3NBI A;  1Q82 C;  1B70 B;  5H1S E;  4OX9 H;  1EY6 A;  1JJ2 A;  4X62 L;  3G6J B;  5LOV F;  3ITP A;  5ELN A;  1TWF B;  4NPS A;  1HFG A;  4DU9 A;  4B3T Q;  4FU0 A;  2XCL A;  2YYA A;  1CTM A;  1C30 A;  3KBG A;  4UCO A;  1G6P A;  4JI1 L;  1VQA A;  1LUZ A;  4JYA Q;  1C3O A;  4DV4 Q;  4EGV A;  1I4H A;  5I9P A;  3E5S A;  1M0W A;  1NR4 A;  3NQI A;  4PV1 C;  1I50 A;  3GTJ A;  1A9X A;  3I4N H;  2W7O A;  5M3M G;  2EYH A;  4A3B G;  2B8G A;  2WB1 B;  4C5A A;  5EJW A;  3NEL A;  1UNS A;  4KN7 C;  3FMA A;  4ED7 A;  1D6E C;  1F9R A;  1YEZ A;  3VR5 A;  3A56 A;  4F50 A;  1OXX K;  4DL3 A;  2CVR A;  3VYU A;  4YHH L;  2UUA H;  3RUZ A;  5JPN C;  2EVB A;  3RFC A;  3GV8 B;  1B53 A;  2QEX A;  2UU9 Q;  2XSC A;  1R9T B;  5L1L A;  4JI6 H;  1IZ6 A;  2JA5 G;  4WD3 A;  1M1K C;  4OX9 L;  1BVS A;  1I3Q B;  1TAE A;  1EY5 A;  1VQM A;  2DY8 A;  3JSL A;  5KFE A;  2YTY A;  3VPC A;  2IL8 A;  3K7U C;  1CHP D;  3OWE B;  3X3N A;  4L1K A;  3PO3 B;  1RJR A;  3WOF A;  2KEE A;  3VDY A;  3G6E A;  1PTO H;  2OQK A;  3N41 B;  1U5K A;  1D5Z C;  1L1O C;  2E76 C;  2F0U A;  4OEM B;  2CWP A;  4QQB X;  1XTC D;  3BDO A;  4HNT A;  1FGB D;  2ZXP A;  5LL6 S;  1GYF A;  3LGJ A;  4XQN A;  2ZXR A;  5EKI A;  3U9S A;  2A19 A;  2VS1 A;  5EQ0 A;  1KJ8 A;  1L2Z A;  1DV2 A;  3JAM E;  2IX3 A;  4QJF A;  1X9N A;  3SK6 A;  3S17 B;  5COR A;  4A3K G;  3TP6 A;  4DA2 A;  5IP9 H;  4ECW A;  4O4I F;  1Y1W B;  2PMZ E;  1DD2 A;  1RCV D;  5ELD A;  2IA6 A;  2UUA L;  4MV6 A;  3KHR A;  5M5X H;  3GD7 A;  5FJ8 G;  4JI6 L;  1HZ9 A;  1KJJ A;  4RHS A;  1QOH A;  3PUW A;  2NUC A;  2NVT B;  3ULP A;  3MFI A;  4A3F B;  4BBR G;  1Q81 C;  2OTJ A;  2Q2U A;  1NCV A;  3DWQ A;  1V9P A;  4ILW A;  5HY6 A;  2P0A A;  4FM9 A;  3MZ5 A;  3KF6 A;  4A3J B;  4I7A A;  2HD3 A;  1BO0 A;  3LX0 A;  2OT2 A;  3A7A B;  3PO3 G;  5KFA A;  3H4B A;  1I6H H;  1EEI D;  5KRU A;  4ME3 A;  2W9B A;  4FXK C;  2HGS A;  1GXD C;  1KAA A;  1EL0 A;  1E24 A;  1WCM A;  2VQE H;  4ED0 A;  2UU9 H;  1Y1V B;  1YHB A;  1K73 C;  4FS1 A;  2JA6 A;  1F2L A;  4Q44 A;  1RYS A;  2SNM A;  1RTO A;  3A0J A;  1LTI D;  5KFC A;  4AQY H;  1GSH A;  3GTM H;  1B04 A;  2I07 B;  1I94 Q;  1O7I A;  2NTS A;  5C0X I;  4A3L G;  5K36 H;  1UNN C;  3TS0 A;  3DF7 A;  3DEP A;  4RB3 C;  3P75 A;  4IPH A;  5A2Q E;  2YU9 H;  3OHB A;  4IWY A;  1JWM D;  4HYK A;  4R9W A;  1DJR D;  4BY7 H;  1X3F A;  1S10 A;  1HNW Q;  3NXW A;  3BA8 A;  1Q8K A;  1XMO Q;  4X65 H;  2F3V A;  2JXM B;  3A7L A;  3R23 A;  3QOJ A;  3AMU A;  3BZD B;  1HH2 P;  1YVC A;  3DM3 A;  3MEF A;  1HR0 H;  2ZTD A;  4K6D A;  3M4O B;  1IOV A;  2ENB A;  4R8U B;  1MKH A;  3CCS A;  2QDB A;  3PW5 A;  1FD7 D;  4PMW A;  4J9O A;  1WTH A;  1X6O A;  1JC7 A;  5DM6 3;  4K2K A;  1ZET A;  2VQE L;  2Z8L A;  4QF4 A;  2UU9 L;  4DNR B;  2IT1 A;  1BF4 A;  3I4M H;  1TU2 B;  2JJQ A;  1JKJ B;  4BWG B;  2NBF A;  5JVG 3;  1Q7Y C;  4A3I B;  3HOV H;  3PIP A;  1SAP A;  4MTK A;  4AQY L;  1NNX A;  4KY5 A;  4L5S A;  2PNH A;  1VKZ A;  3C0F B;  4YJ3 F;  1DXM A;  2PQA A;  1NTG A;  2A6E D;  2Q8R E;  3CXC A;  3CMA A;  4LF5 H;  4YWL A;  5KFO A;  1PZJ D;  5I47 A;  3GTG H;  5DEH A;  3EN2 A;  4LMQ D;  1I50 H;  2JA7 B;  1VF5 C;  3GTJ H;  1JB7 A;  2MO1 A;  3PO2 B;  4LSX A;  3J80 i;  3HOY H;  4FF3 A;  2MGS A;  4X65 L;  3S2D H;  1YJN A;  3T1H H;  2R7D A;  4LF9 Q;  4DK3 C;  2ZJP A;  1I5F A;  5KIX A;  1HA6 A;  4POF A;  2GVA A;  1HR0 L;  5KYI A;  5CGK A;  5KFS A;  3HOU B;  2FJ2 A;  2GPS A;  3QZ7 A;  1ESR A;  1G29 1;  2Z1C A;  2UXD H;  1CFM A;  3E6Z X;  3HKZ E;  1K8G A;  4GLX A;  2FMM A;  2NVX B;  1FL0 A;  4A76 A;  1JIC A;  2NN6 I;  2EXZ A;  1DYQ A;  1J8I A;  3ONA B;  3MXN A;  2O03 A;  1I6V C;  1HNW H;  4LF5 L;  1EIF A;  5I2X A;  1WVL A;  3HOW B;  1EYA A;  3U50 C;  1ESF A;  2F0G A;  1HQR D;  2FK3 A;  3MWY W;  2NUA B;  1KIX A;  1UEB A;  1KJ9 A;  3PW7 A;  1WD0 A;  3TRE A;  3EFX D;  3GTO B;  2EJG C;  3TZD A;  3WWV A;  3T1H L;  4ZCK A;  2FPG B;  1CKN B;  5D3D A;  1E1O A;  4C3I H;  2WDT A;  5DAU A;  2B63 B;  3ERO A;  1LV9 A;  4MV3 A;  3PSI A;  4HN7 A;  4UP8 A;  4X64 Q;  1KXL A;  4RMF A;  2VW9 A;  2SCU B;  5BPH A;  3Q0A A;  4F88 A;  3MFG A;  2R6G A;  4WRD A;  3O13 A;  4K6L A;  5L9X A;  4EX5 A;  2F0I A;  3GIJ A;  1A2U A;  2UXD L;  1I4G A;  1LYL A;  1OXT A;  3NSW A;  4KD4 A;  1NMG A;  1MBY A;  1IBK H;  4RAZ A;  2L1B A;  4WBN F;  1MSH A;  2AU0 A;  3SI8 A;  3MAQ A;  1A15 A;  2FK1 A;  1JXL A;  2JEG A;  4JI5 H;  2WIN B;  2R8G A;  1STH A;  3CME A;  2UXC H;  3HKZ A;  1VQK A;  2EDG A;  3RTX A;  3RV4 A;  4CDD C;  4LF9 H;  1VQ7 A;  4C2M B;  2W6M A;  1AUV A;  4WOR A;  4ODG A;  3KTM A;  3BJU A;  2C2E A;  2DIK A;  4LMY A;  4B9X A;  3MFH A;  2HVS A;  2Z6B A;  5C5L A;  1SFO B;  3ETH A;  3PVX A;  1SJH D;  2JA6 H;  1ENA A;  3MHB A;  1QWY A;  3AFQ A;  2K5Q A;  4BY1 B;  4NXM Q;  3TQY A;  2B2U A;  4HNU A;  1JOK A;  5DG8 A;  3N42 B;  4DN4 M;  5FLM H;  1JWS D;  4V19 0;  4RWS C;  1G2S A;  1N32 H;  1T36 A;  4CHT B;  4CJ2 C;  2ICI A;  2R8J A;  4I7H A;  1YNJ D;  3OW7 A;  4G57 A;  3PUY A;  2FKL A;  2G9D A;  3N52 A;  1IBK L;  3RZO B;  4DV7 H;  4LF4 H;  2R7L A;  3H15 A;  2F0E A;  1GUT A;  1R4P B;  2B2Y A;  4IFD G;  3MWD A;  3FDT A;  4JI5 L;  3NTI A;  1H9S B;  4JV0 A;  4UDU C;  1HZC A;  1AW7 A;  2UXC L;  5KEE A;  4A3C H;  4JG2 A;  4LF9 L;  1KRS A;  2EXD A;  4JI2 H;  1SCU B;  1STA A;  4KN4 C;  2DJF C;  4C5C A;  3BQ1 A;  1BBU A;  2W70 A;  1M4V A;  4KKS A;  3L4K A;  4LFC H;  3E5N A;  5KFL A;  2R7F A;  3KF8 B;  4UAI A;  2RCF A;  5C44 H;  1WTV A;  3PMF A;  3HEJ A;  1AE3 A;  3GTK A;  1IBM H;  2QEJ C;  3T5H A;  5KFH A;  5TSS A;  1L1O A;  2Y0S B;  3HOZ B;  2MCT A;  1LM0 A;  4WJW A;  3VA7 A;  3JAM L;  4GNX C;  3UFX B;  1ZKO A;  1N32 L;  3QZ8 A;  3BJY A;  4YCV A;  4TV8 F;  4OIJ A;  2FLL A;  5C4X H;  3MA2 B;  2Q8I B;  3JSN A;  1I4Q A;  3TP5 A;  2VUG A;  2UUB H;  1B1Z A;  4LNQ A;  4DV7 L;  2IP4 A;  2D2C C;  2EY1 A;  3M4P A;  4LF4 L;  3I4N B;  5LP6 F;  1STE A;  1ENC A;  2VUM A;  5I6W A;  2MFI A;  5KFM A;  4A3G H;  4R4O A;  2AGQ A;  4K2L A;  4HSV A;  4JI2 L;  2GVB A;  5EZY F;  1E1T A;  1E4E A;  1IKL A;  4GKJ Q;  1VQB A;  4LFC L;  1JE4 A;  1O7L A;  5LL6 X;  4XZ3 B;  3S15 H;  3CCJ A;  3KAK A;  3VR6 A;  4ETS A;  2UUC Q;  1XNR H;  2FK2 A;  3RLF A;  5EOY A;  4G4K A;  1NY4 A;  3K7A B;  1IBM L;  1Z2P X;  2A68 C;  5D1O A;  3TRZ A;  2C9O A;  1E22 A;  2DWC A;  4JW0 A;  3WDN A;  5FPO A;  1HNZ H;  2O4X A;  1HHV A;  2VQF Q;  2VA3 A;  5EWF A;  1TWH A;  2A6E C;  1XX8 A;  1SR3 A;  3BYT B;  5FLX W;  2EPB A;  2Y0S G;  4L5Q A;  2UUB L;  4O2D A;  3CCU A;  4ZQ3 A;  4OWW B;  4FF4 A;  2KCC A;  2CWA A;  4ED2 A;  1LT4 D;  4GNX B;  5A2Q L;  4QGU A;  5CV5 A;  1GGO A;  3C1F A;  4DR4 Q;  1UE7 A;  2IJ0 A;  3GV6 A;  4APV A;  2ICE C;  5M5X B;  5K2M A;  2CQY A;  4BA1 I;  4GOP A;  2JP1 A;  3C2P A;  3DHQ A;  5GQO A;  5IP7 H;  5C5J A;  1H9K A;  2KUM A;  1H95 A;  4LJZ C;  1XNR L;  2FFK B;  2IHF A;  2XCP A;  5NUC A;  4TUY F;  1JDB B;  3N44 B;  1IOW A;  2E5L H;  3K5N A;  3K5L A;  4DV0 Q;  1PH2 A;  1VQH A;  1HNZ L;  3FPU B;  4RG1 A;  3G6V A;  1D7Q A;  3ULL A;  3CHB D;  5KX5 F;  2QA4 A;  3G48 A;  3RB4 A;  3M7G A;  4MV8 A;  1O7Y A;  5CV7 A;  3ORQ A;  2R93 B;  2YRW A;  4KKU A;  2BA0 A;  1STG A;  3CC2 A;  4LF7 H;  2RGR A;  3QWN A;  1A63 A;  1JT8 A;  4RFB A;  1X3Q A;  1EQQ A;  4JV1 A;  1ASY A;  5L1I A;  1EOT A;  3GTL A;  4AYB G;  1GJX A;  5KFI A;  5IP9 G;  2GLT A;  2ALZ A;  2WII B;  2PVP A;  2RVL A;  3OMG A;  1N8R C;  2QK4 A;  4O3R A;  3DUZ A;  2L0C A;  1TVX A;  4DR7 L;  1BUV T;  4UP7 A;  4K8J A;  1CSP A;  3JAM c;  2FJZ A;  3KLW A;  3RIZ A;  4DUZ H;  5KG3 A;  2E5L L;  4ED1 A;  5LL6 b;  2EE1 A;  1MD2 D;  4ZOL F;  1V1P A;  2DNE A;  1EUC B;  3H20 A;  5LMN Q;  5GON F;  2A8V A;  4Y52 H;  4KI0 A;  4GKK Q;  3N43 B;  5DG7 A;  3M9B A;  2KEC A;  2RA4 A;  5EBC A;  2CCZ A;  2CFM A;  4JC0 A;  4LF7 L;  3I4M B;  4Y8V B;  2JEA I;  4DXF A;  4OO1 I;  5IGG A;  1I4X A;  1CHQ D;  4XTC S;  2SOB A;  2RKS A;  2CQO A;  1E2Z A;  1K28 A;  2M2L A;  1TS3 A;  4QWD A;  1YI2 A;  4CJ0 B;  2BQ3 A;  4JV5 Q;  3D0F A;  3D4D A;  1C0A A;  3GTG B;  4B3S Q;  1L2F A;  4KY6 A;  3IL8 A;  4OWX B;  1LTA D;  1I50 B;  1NUC A;  4IJH A;  5KFQ A;  2W8L A;  4DAP A;  2L9H A;  5EPL A;  1YNJ C;  5EAY A;  5K36 G;  2XD4 A;  2XGP A;  5BN3 A;  4A3E G;  3TDQ A;  1ML0 D;  3HOY B;  2VUM H;  1VQL A;  3I7F A;  3S2D B;  4DUZ L;  4EG0 A;  2C35 B;  1K83 B;  2R7Z B;  1SEI A;  2EOT A;  2EYF A;  4BY7 G;  5IYC H;  4AYB E;  4YAJ B;  4CDC C;  2QDL A;  4F87 A;  1Q1B A;  1FR3 A;  1QVC A;  1IL8 A;  5E1F A;  2IMW P;  1S97 A;  1VQN A;  1B4O A;  5F9N A;  1YJ9 A;  1QNU A;  1EY4 A;  5C4J H;  5KFD A;  4P74 A;  2NWG A;  3P20 A;  4ZQI A;  4IOC A;  4FNF A;  3T1Y Q;  3J81 j;  4JBM A;  5KFT A;  1DCZ A;  1SJE D;  3CQZ B;  3Q8R B;  1XPR A;  1HTP A;  1XDN A;  4JI0 H;  2XGT A;  1TWH H;  4PWQ A;  4APM A;  3I4O A;  3KLS X;  3I4M G;  4X62 Q;  1S03 G;  3HOV G;  3CPW A;  1I4P A;  4ED3 A;  4JPB W;  1CQI B;  3CCV A;  2Q2H A;  2QF7 A;  1N33 H;  2E2H B;  3FKI A;  5KG7 A;  1EYZ A;  2IW3 A;  1JJG A;  1U4P A;  4X6A H;  4JI1 Q;  4K14 A;  3K5M A;  4C3I B;  5CMD A;  1PX2 A;  5GAD C;  5KFY A;  4RGT A;  3NP8 A;  3J80 E;  1LTR D;  2X6L A;  3IRB A;  3U9O A;  3HOY G;  3FHW A;  4QWA A;  4LFB H;  1CK1 A;  3E0E A;  3GV5 B;  4P73 A;  3TP8 A;  4PDB A;  1TY0 A;  4N9T A;  3AEV A;  3K5H A;  2RHS B;  1BR9 A;  4IQZ A;  4MTE A;  4WFN 3;  4JV5 H;  3L2P A;  1W93 A;  4B3S H;  4YHH Q;  2RCN A;  1XMQ H;  2QIL A;  2O2L D;  4IOA A;  2K52 A;  4KTA A;  1CQF A;  4HJ8 A;  4JI0 L;  1EZ6 A;  4XQJ A;  4OX9 Q;  4Q43 A;  4TV9 F;  3H0G B;  3L0O A;  1OXS C;  2A69 D;  2AQ2 B;  3EYY A;  2CW0 C;  4BXX G;  1H9J A;  2HVQ A;  4IUV A;  2A1A A;  2OF1 A;  3I73 A;  1YJW A;  1KQS A;  1N33 L;  2DN8 A;  3F8N A;  4O3O A;  3T5L A;  1PH7 A;  2PZU A;  4DV6 H;  2JA6 B;  3K5I A;  2K14 A;  1B50 A;  3U4V A;  1QVG A;  3MR5 A;  4RKL A;  1F2Z A;  3R2I A;  3AB9 A;  3DM1 A;  4DAM A;  2WP8 J;  3GTL H;  1T3N A;  3GID A;  4LFB L;  4Q8E A;  3BDL A;  3HG9 A;  1PMR A;  2I5L X;  3RF2 A;  4C3I G;  3ICE A;  3OTO H;  4H0L C;  1AN8 A;  5C4H A;  2H1E A;  1D2B A;  2F0W A;  2PMZ B;  2W6N A;  5HV6 A;  1CUK A;  3I8Z A;  2ZJT A;  2W57 A;  4B3S L;  1Y8N B;  3VYT A;  4DV3 H;  2UUA Q;  1XMQ L;  3NTH A;  2PCF B;  3T53 B;  1XNQ H;  1Q46 A;  3S2H H;  2F1M A;  1J6Q A;  1JOQ A;  5KFZ A;  4JI6 Q;  4MN3 A;  3NBH B;  3HOX H;  2JK8 A;  4JI1 H;  2V5A A;  4IZO A;  4KHZ A;  5M3M B;  2W6O A;  4E4T A;  2VOB A;  2YTV A;  2HCI A;  4J8Q A;  3H94 A;  1RK6 A;  4DV6 L;  4KLK A;  3Q23 A;  1VCI A;  4YR3 A;  2K03 A;  4PZ8 A;  1TWC H;  1WCM G;  2G5D A;  1KJQ A;  2JA6 G;  5AJ3 L;  4EBE A;  3B6Y A;  1PH3 A;  1JMC A;  4NP5 A;  1PYB A;  3OTO L;  1CI3 M;  5KFJ A;  1HRJ A;  5JH7 F;  4UCT A;  3CCR A;  2ES2 A;  4ECT A;  2BR0 A;  1CSQ A;  2P5Z X;  4O2A F;  1D1K A;  3A8I E;  5DLG A;  5FLM G;  3MVV A;  4DV3 L;  4WJ3 M;  1XNQ L;  5IT9 W;  4FS2 A;  4X3U A;  5LHY 1;  3GQB A;  3H09 A;  4A3G B;  2QKI C;  1VQJ A;  5GAH C;  3EJI A;  1LT6 D;  4A3K B;  3IN5 A;  2LY7 A;  3NHH A;  2YRX A;  4JOI A;  4J0M A;  1B9N A;  2RGV A;  5KG1 A;  3UE0 A;  4GZY C;  3CU7 A;  3S15 B;  4A3C G;  3JRX A;  3V6H A;  5I2Y A;  1TXY A;  2JN4 A;  2HHH H;  5ISR A;  2N8N A;  4IUQ A;  3D4R A;  4ZLT F;  1FVI A;  3UDX A;  5DQG A;  3CCL A;  2AUJ D;  4IZ8 A;  1TWG B;  1TWA B;  5JEA J;  5C44 G;  4BBR B;  2VQE Q;  5FOB B;  2F0P A;  2Z9H A;  3RV3 A;  2F0H A;  1EUJ A;  3FKI H;  2WYO A;  5GAG C;  2G9H D;  1S3O A;  4RGM A;  4AQY Q;  5FO7 B;  5C5M A;  1S5D D;  2W8K A;  3ULJ A;  1N34 H;  2C2R A;  5C4X G;  2C5C A;  5KFP A;  2B2W C;  4JCV E;  1STN A;  2W6Z A;  1BCP B;  4IFD J;  2N78 A;  4J9S A;  3CD6 A;  2F0J A;  2Z4H A;  2LMC B;  4ECR A;  4M1U B;  3MR2 A;  3G6X A;  5IYZ F;  1WTO A;  2EYO A;  2RSO A;  5KFR A;  5M3F H;  1QB5 D;  4OGQ C;  5DQH A;  4RH6 A;  4X65 Q;  3RBD A;  1RDP D;  1IXR A;  2F4V H;  2O5I C;  5KFF A;  1PYW D;  1RL2 A;  4A3G G;  2MUY A;  4FP5 D;  1HR0 Q;  5EDW A;  2ASL A;  4QUF A;  3I12 A;  2HHH L;  1PYS B;  5AFW A;  2AWN A;  2J4X A;  3SR1 A;  1VQG A;  1JDE A;  4EYI B;  2YZM A;  4J9K A;  4JI3 H;  3GIM A;  3HZX A;  3JZI A;  1L0Y B;  1RD9 D;  2SNS A;  1K1S A;  2FB9 A;  4DR3 H;  5JQW A;  2KHS A;  1FNW A;  4YBZ B;  2E8G A;  3J81 c;  5CA0 F;  3S1Q H;  5J2T F;  3FMC A;  1U4M A;  3V4S A;  3VMM A;  3UDI A;  3RJ0 A;  3G6Y A;  4ZKC B;  1V1O A;  1N34 L;  4LF5 Q;  2IPK D;  4JK1 C;  4A2B A;  1B8A A;  1QJO A;  1MZB A;  1HNX H;  4RAU C;  4G7H C;  1VMC A;  2IWH A;  4L5T A;  3CVZ A;  3GDE A;  5CV8 A;  3K3V A;  3T1H Q;  3T56 B;  4DV2 H;  2BH8 A;  2F4V L;  4O3N A;  4K5X A;  1U4L A;  3KOJ A;  4RKB A;  1KDB A;  4DV1 Q;  3BU2 A;  2KHJ A;  2PZT A;  3EPG A;  1T5X D;  1JR0 D;  3CAM A;  1H9R A;  4I55 F;  4UCV A;  3UDF A;  4JI3 L;  3T51 B;  3BG5 A;  5LYJ F;  3UDG A;  3U9T A;  1SNP A;  5IP7 G;  5EPJ A;  2W9A A;  2F0M A;  1B9M A;  1P8L A;  1PH6 A;  3S16 B;  2UXD Q;  4IAJ A;  1O78 A;  2UXB H;  4QW8 A;  4A3E H;  4DR3 L;  2A69 C;  3F2U A;  1FJG Q;  2DLN A;  4NKL A;  4N8X 1;  3RBE A;  4DL4 A;  1KAB A;  3CCQ A;  3HKZ G;  1KC8 C;  2R85 A;  4X66 H;  3HKS A;  4YIJ A;  2NVY A;  3QB3 A;  5FPR A;  2DJG C;  4EYH B;  2WAC A;  4H7B A;  3WNZ A;  3SEB A;  4DAY A;  1HNX L;  3OSN A;  5KGU A;  4R7R A;  1UE5 A;  1ONL A;  1EOV A;  1DZ1 A;  2DPI A;  3HB9 A;  4DV2 L;  4NLG A;  3J7Y W;  3MXU A;  1EZ1 A;  3P1H A;  1N36 H;  1OXU A;  3J80 L;  2V4D A;  2NTT A;  1D5M C;  4C5B A;  2XGQ A;  1P16 A;  2A68 D;  5KT7 A;  5H80 A;  2WKC A;  2A73 B;  1SE4 A;  4PZ7 A;  2FE3 A;  2UXB L;  1U4R A;  5T1I A;  2WB1 E;  1IBK Q;  4B3R H;  1I6U A;  1QG7 A;  3R5H A;  1S0O A;  2CHB D;  1E4E B;  1J5E H;  1JWU D;  4EQN A;  2E2I B;  4HJ5 A;  4JI5 Q;  1GOZ A;  4X66 L;  3V05 A;  4ZI7 F;  2K5D A;  4IR9 A;  2UXC Q;  2E75 C;  2ZTC A;  4F4W A;  5D1O B;  4DV1 H;  3D3R A;  3C3L A;  4C3H H;  5KNB A;  2K5W A;  3NK9 A;  4DK1 A;  5FD5 A;  4YB8 B;  1TWH B;  4NMZ A;  1EQR A;  4C1N K;  2PW7 A;  1PH9 A;  1X65 A;  3S1N H;  4XIG S;  3N6X A;  5IWA H;  1N36 L;  3BQ2 A;  1TS2 A;  2EYJ A;  2KBN A;  3PQI A;  3IKJ A;  5JJI A;  1FJG H;  1LAC A;  1STB A;  1M90 C;  1TA8 A;  2V59 A;  1SEB D;  5IE8 A;  3PZP A;  4BXX H;  1N32 Q;  2A6H D;  5F2D A;  1KLG D;  4IUU A;  1TWF A;  4GC7 A;  4YAK B;  4HR7 B;  1HJP A;  4B3R L;  1HTL D;  4DV7 Q;  2BQR A;  4LF4 Q;  3LWB A;  2Q2I A;  2OCE A;  2VUM G;  1KRT A;  3G4S A;  4LAA A;  4GOP B;  1QNK A;  2B2V C;  1J5E L;  5T14 A;  2Z4I A;  1PFM A;  5IYC G;  2N88 A;  2RDH A;  4IFD I;  1VQE A;  3V96 A;  2VQD A;  5D14 A;  1LAB A;  5C6A A;  2WB1 A;  4O42 A;  4JI2 Q;  4F4X A;  4C1N I;  1DGS A;  3VA5 A;  2QGQ A;  4MIU A;  4TKO B;  4DV1 L;  3GIL A;  1PRT B;  3PUX A;  4A3D H;  4YY3 H;  2ZDH A;  4LFC Q;  1EIY B;  4B9W A;  2D62 A;  3IFT A;  1B3A A;  4YR2 A;  2A5H A;  1UC9 A;  1T5E A;  3Q6S A;  2CH4 W;  4FDB A;  3GTQ B;  4Q5V A;  5IWA L;  1IBM Q;  1KC7 A;  2F0S A;  1HFN A;  1SXT A;  1I3Q A;  3BA9 A;  1FJG L;  4IRC A;  1SSO A;  1EWH A;  2PI2 A;  5CV4 A;  5JVH 3;  3T5K A;  4HJ9 A;  1S0N A;  5K5P A;  1AE2 A;  1ILP A;  1Q1E A;  2UUB Q;  3R5F A;  2HUG A;  5KG2 A;  3NUC A;  2W9C B;  2RBM A;  1MSG A;  4R8N A;  1AP0 A;  2NZH A;  2K5N A;  4MTD A;  3G71 A;  1WJJ A;  1WCM H;  3OHX C;  1N56 A;  1V43 A;  1S5F D;  2XIW A;  2V1C C;  5E4W C;  2N3S A;  5LMN W;  2DUD A;  1B3Q A;  2F0N A;  2MQH A;  4YY3 L;  3S2H B;  3KDF A;  4P75 A;  1YNN D;  2PN1 A;  1Y1W A;  3J80 c;  3F8T A;  1GVP A;  4RGN A;  1TII D;  2TSS A;  4KJO A;  1KD1 C;  1ZYR C;  1QUQ B;  1KNA A;  2F0F A;  4CKC A;  4G3I A;  1XNR Q;  1Y69 U;  2VB2 X;  1NJI C;  2KA7 A;  1PHJ A;  1VQ9 A;  5M5Y B;  2NVY H;  1HNZ Q;  2JYO A;  2ZTE A;  4UPA A;  1VQO A;  4JI7 H;  2HT1 A;  1VMP A;  3VPD A;  1UEA B;  1TWC B;  1LT3 D;  4K8I A;  3J81 W;  4A3M H;  4HJA A;  4EBD A;  3SK5 A;  5DGA A;  4O3P A;  2UVR A;  1PTO C;  4C3J H;  2F0L A;  1MJE A;  1TS4 A;  3WO0 A;  3L4J A;  2ZJR A;  2B8F A;  3H3V H;  3TBI B;  5KFN A;  2EYM A;  1E4G T;  3DEO A;  1HPC A;  4J9L A;  2HIX A;  1BGW A;  1Y1V A;  2KSW A;  2UVW A;  4JI4 H;  4JI8 H;  3BZC A;  3SGI A;  1WH2 A;  4DR7 Q;  2RDI A;  5BN5 A;  1CQJ B;  4RUA A;  4RZR A;  4XYO A;  2HDM A;  1WSC A;  2F52 A;  4YP3 A;  2JEF A;  2E5L Q;  3HOX G;  2K5V A;  3QOL A;  5KT4 A;  3U58 A;  4NDX A;  3D6W A;  5JVD F;  2R92 A;  4JI7 L;  3TEH B;  1VQ8 A;  3KAL A;  1BQQ T;  2A74 C;  3I2Z A;  4DNI A;  3KJO A;  1WTX A;  2M9V A;  2C00 A;  1K3B C;  4MV9 A;  1FNV A;  1OO9 B;  5C1O A;  3GV3 A;  4A93 H;  4L5R C;  4R8U A;  4LF7 Q;  4O4H F;  1V51 A;  1BXR A;  5A35 A;  4LH6 A;  4J9Q A;  3RN2 A;  4E6I A;  2EYL A;  3FKI B;  3F2B A;  2D0P A;  5FD6 A;  2LS0 1;  3GIP A;  4FBU A;  3K57 A;  3PGZ A;  2X69 A;  3FP9 A;  4JI4 L;  1TWF H;  1PXU A;  4ECX A;  1SBB B;  4JI8 L;  3X3M A;  5L1K A;  3PW4 A;  1PTO B;  2JA9 A;  2X6G A;  2CW0 D;  1ULZ A;  3KAJ A;  1JE5 A;  1GKH A;  2OEO A;  4LH7 A;  1O80 A;  4HCE A;  2R87 A;  3BVZ A;  4DL6 A;  4IWX A;  4DUZ Q;  4ME5 A;  2C2D A;  5BMV F;  2JA7 A;  4CDE C;  1SNQ A;  1O7Z A;  2CW8 A;  1X32 A;  1NE3 A;  2WV6 D;  4AYB B;  3NPP A;  3C46 A;  3PR4 A;  3Q24 A;  5LA6 F;  5KNC A;  5KG0 A;  1HUM A;  1D5X C;  3BVG A;  3H91 A;  3QO2 A;  3VR2 A;  2IY5 B;  2KVM A;  3A5Z B;  2VPS A;  3LNN A;  4DUY Q;  3TZU A;  5JJZ A;  3J7A F;  3Q8P B;  1H9M A;  2NZO A;  4BBS G;  1I3Q H;  4DR7 H;  3S1Q B;  2GN5 A;  1CZW A;  1VQ4 A;  5C1P A;  2MP1 A;  4HNV A;  2NVX A;  1FYC A;  2I5H A;  3T5J A;  3EPI A;  3FKI G;  3SK8 A;  2A6H C;  2DGY A;  4IUT A;  2AQ4 A;  1TQO A;  1C8C A;  3E9H A;  1CM9 A;  4ALP A;  2PYK A;  1I6H B;  3IAY A;  2F0K A;  1UE1 A;  4RCO A;  5FK9 C;  5C3X A;  5CV6 A;  1DOK A;  3OWF A;  2DZD A;  1UC8 A;  4M7E A;  4MZ9 A;  3GTO A;  4OXP A;  2M00 A;  2UVU A;  1AEX A;  5M3F G;  1CKN A;  4UHV A;  5GRO A;  3PCO B;  2B63 A;  1Y1W H;  1BCP D;  5IGC A;  2JEJ A;  3GTM B;  3Q8Q B;  2HQL A;  3MWM A;  3AU7 A;  3BVM A;  1IKM A;  4A3E B;  2DY7 A;  1A8V A;  1UAP A;  4JBJ A;  3A55 A;  5KFG A;  2YU9 B;  4DR6 H;  1L0W A;  4BY7 B;  1EY9 A;  2K01 A;  1SE3 A;  4S3S A;  4A3F H;  4JI0 Q;  1S0M A;  2AWO A;  2BA1 A;  4R4C A;  4A4I A;  3KK7 A;  4CBV A;  4DL2 A;  3OUZ A;  4ECY A;  5FLX E;  3AFP A;  1SNC A;  4QIW E;  5IOC A;  4DR2 H;  1QZH A;  1N33 Q;  4A3J H;  4ZRZ A;  4RZQ A;  1RJT A;  1HQM C;  1EZ8 A;  3CRL C;  3EVQ A;  5E7N A;  4C2M A;  4MV4 A;  3OYY A;  4U68 A;  4J9M A;  3FRP B;  5IGD A;  4OON A;  4DUY H;  5DG9 A;  2K75 A;  2PZW A;  3GTK H;  4YCU A;  2WE6 A;  1Y1V H;  1JCK B;  4CC5 A;  4LFB Q;  4N9P A;  5ELF A;  3HOV B;  2LXJ A;  1YBY A;  2PW5 A;  3A74 A;  5ELC A;  4DK6 C;  2H4O A;  1GD7 A;  4LFA H;  1YNN C;  4DV5 H;  2MO0 A;  4EBC A;  2VL6 A;  2B2V A;  2GPW A;  1G91 A;  1L0X B;  1T94 A;  1M6V A;  1EHI A;  3PV0 A;  5DLQ E;  1QVF A;  3E9I A;  1XMQ Q;  3HXL A;  3GTJ B;  4DR6 L;  3T4A C;  2AKW B;  4G7O C;  5C0X H;  3GIK A;  2R92 H;  1AH9 A;  2ZDQ A;  3KJP A;  1VQF A;  4DR2 L;  3QJY A;  3S1M H;  1RHP A;  4IUP A;  1GUW A;  4JV2 A;  3S14 H;  2R8H A;  5JJL A;  5EWE A;  1BKB A;  1EY7 A;  3VR4 A;  5M5W H;  4DV6 Q;  4EQP A;  1Q86 C;  4A75 A;  2R6F A;  2FLP A;  3S1N B;  3PR5 B;  3VYR A;  2J6T A;  4K5W A;  3FVQ A;  1JB3 A;  2YZG A;  2Z6K C;  4DUY L;  3K0Y A;  4QIW A;  1X3E A;  2K7V A;  3KF8 A;  1Q90 A;  4B3M L;  3EIV A;  5AJ3 Q;  2E74 C;  5LXT F;  4A3I H;  1KNE A;  5DLF A;  2R7N A;  3OTO Q;  1HR0 W;  2OXP A;  2DNC A;  4LFA L;  4DV5 L;  2IX0 A;  4IPC A;  1FKA H;  3Q2O A;  4DV3 Q;  2Z0S A;  1GSO A;  1ILQ A;  4MTN A;  2N49 A;  5CV9 A;  1B44 D;  3I56 A;  1XNQ Q;  2JA7 H;  1DON A;  3EA6 A;  1RJQ A;  2I80 A;  3PO2 H;  2XRQ D;  2CKZ B;  1Z2N X;  1G51 A;  1TT2 A;  4LK1 C;  2LFN A;  3PIO A;  1EWC A;  4R4Q A;  2YYZ A;  4N8F A;  3PF5 A;  2FXQ A;  5KFW A;  5FKA C;  2CQA A;  1W96 A;  3A5U A;  3IG0 A;  1S72 A;  3HOU H;  2JEI A;  4EVO A;  3BYY B;  3PW0 A;  1JOO A;  1ENF A;  2AHO B;  3TS2 A;  1F9S A;  4LF6 H;  5C3E G;  4C3H G;  1LTT D;  2PBZ A;  4IRK A;  2R8I A;  2NVX H;  2EY2 A;  5L37 A;  4IUR A;  4IHJ F;  1Y14 B;  1IBL Q;  3DXJ C;  2YV5 A;  3KF6 B;  2BDO A;  1Z2O X;  3T13 A;  3PUZ A;  1DV1 A;  3R5X A;  4X3S A;  3HOW H;  2R84 A;  1I7N A;  1Z6H A;  2I0Q A;  2F0V A;  3M4I A;  1VDZ A;  3K8A A;  5D3I B;  2NN6 H;  1C7Y A;  2XIG A;  4RAY A;  5JEA H;  2W9B B;  2IBK A;  3UQ8 A;  4TQU S;  2L4N A;  2OLS A;  1WCM B;  2DPJ A;  4MAM A;  3DWP A;  3GTO H;  1B2T A;  4RNM A;  4YR0 A;  3KHH A;  4LF8 H;  1VQD A;  5KFU A;  2XWB B;  2I8C A;  3M9N B;  4IR1 A;  4GNX A;  1JLL B;  4F4Y A;  1A3U A;  4QW9 A;  4I50 F;  3V6K A;  3PIP 3;  4HIO A;  2R7K A;  1NSN S;  3MR6 A;  3H40 A;  2HHH Q;  4QUC A;  2JA8 H;  1S5B D;  2VPQ A;  4LF6 L;  3WO1 A;  3W1G A;  4A3D G;  3OW2 A;  3KFU A;  2XNA C;  3BS1 A;  1GUO A;  2EIF A;  4EEY A;  2KCN A;  1SMY D;  3RD4 A;  3SE0 A;  1KEE A;  2F3W A;  2K50 A;  1K3R A;  1SYD A;  5FO8 B;  2W7P A;  4J9N A;  3NTK A;  4PMB A;  2W6P A;  1EQV A;  5HGT A;  4DR1 L;  5LMU H;  1PRT D;  4DAY B;  2QW7 A;  1SDF A;  4RNO A;  1XPU A;  1WTW A;  1C9O A;  2VR1 A;  3TIG A;  4C2M H;  4TRD A;  1N34 Q;  5D1P A;  1WYD A;  1VBG A;  4RHR A;  3GO5 A;  3MFY A;  3ER0 A;  1JQY D;  4UCU A;  5C44 B;  1X56 A;  2K33 A;  4LF8 L;  2R93 A;  1LTL A;  2MHV A;  4HMJ A;  1UE6 A;  5BR8 H;  1X55 A;  4R4T A;  2PQA B;  4BY1 H;  3GII A;  1BDO A;  5DNF A;  1GLV A;  2F4V Q;  2FHT A;  1BCP C;  3TP7 A;  4XT3 B;  4DXG A;  1VQ6 A;  5IYD G;  1IBL H;  4JBK A;  4YCW A;  4AIM A;  5C4X B;  2R61 A;  3AYH B;  3G8C A;  2IX1 A;  4ED6 A;  1TKW B;  4JI3 Q;  1K8M A;  5IGF A;  1GUN A;  1PTO F;  1A6X A;  3GTP A;  1S5C D;  3OIQ A;  4JBW A;  4DPG A;  4K0K L;  3Q1K A;  3TQT A;  2B29 A;  4M9U A;  2ALY B;  3LWU A;  4DR3 Q;  5LMU L;  5KKN B;  2WAQ E;  5JJK A;  1EY0 A;  5C4Z A;  5KFB A;  2AGP A;  3J81 i;  4ECZ A;  4HQ6 A;  2YTX A;  3H6M A;  3RUP A;  1IW7 D;  3JAM W;  4B08 A;  2KED A;  3I4L A;  2KJX A;  4NXN H;  2J6U A;  4DR5 H;  2M05 A;  4GLA C;  4A3M G;  3VPB A;  4EGJ A;  1G6Z A;  1HNX Q;  2K6A A;  4C3J G;  5BR8 L;  1D8L A;  3BDC A;  3M4Y A;  5IIF A;  3K80 C;  2LSS A;  3MXN B;  4BBS H;  2RDJ A;  2NYZ D;  4DV2 Q;  4UP9 A;  2D9U A;  3H4D A;  2F0D A;  2VY3 A;  3HOZ H;  1NR2 A;  2B2U C;  1IBL L;  2ATL A;  5ELO A;  4LWC A;  5J1Z A;  1YIJ A;  2UVV A;  4ME6 A;  2EQS A;  3GTG A;  3ORR A;  2L11 A;  1QCB D;  4LSA A;  2UXB Q;  4XYL B;  1ZXT A;  1K0S A;  3K6O A;  5EBD A;  2B2Y C;  3QIA A;  5KT5 A;  4KHP H;  4YWK A;  2NVQ H;  2X0S A;  1K83 A;  2R7Z A;  4X66 Q;  4OWT B;  2YS7 A;  1GHJ A;  4ECS A;  4LW1 A;  1RK5 A;  5KT3 A;  3J7A V;  4NXN L;  3STB D;  3AQQ A;  1PH8 A;  1LT5 D;  5IOD A;  3OUU A;  1KHI A;  4DR5 L;  4WJ4 A;  1C4Q A;  3GP7 A;  5FLX L;  3RB6 A;  4XDX A;  4KV6 A;  3J7A K;  2ZM6 Q;  1A2T A;  5L1J A;  1C48 A;  2WAQ A;  4RB2 C;  2K1B A;  4A93 G;  4ID6 A;  1HUN A;  4J1M A;  3HFZ B;  3K7A H;  3UI2 A;  1K8O A;  5A2Q W;  5CAE B;  1ZYR D;  3HKZ B;  3RNU A;  3CQZ A;  2PQE A;  4RA8 A;  1N36 Q;  5IGB A;  4ZAI A;  4V0B A;  2B3G A;  5GAE C;  5IT9 E;  4ECV A;  3S9W A;  4GC6 A;  1SE8 A;  2ZT9 C;  2VA2 A;  3DWA A;  2E2H A;  2F0O A;  3CP0 A;  1SYG A;  4XX0 B;  5EKL A;  2VXW A;  3SXH A;  4DFA A;  1Z47 A;  4B3R Q;  1EQT A;  3JRW A;  2OTL A;  1ZHQ A;  3N6R A;  1J5E Q;  3KDF B;  3I3C A;  4KHP L;  1PTO D;  3OSO A;  1HXY D;  4CGY B;  1V8Q A;  2WB1 G;  1SYE A;  4Z9C B;  4O1N A;  4B3T H;  3K5O A;  1NMF A;  4Y7N H;  3FEW X;  3E0J A;  3NWS A;  4FXG C;  1W6J A;  5JPM C;  2BE5 D;  3PW2 A;  1LO5 D;  1JX4 A;  4ZYS A;  1GM5 A;  2NU9 B;  2ZXO A;  1BOS A;  4HSP A;  1NBW A;  1YHQ A;  5F9L A;  3TII A;  4JYA H;  4PMC A;  4DV4 H;  3T16 A;  1Z9F A;  3L3O C;  5IWA Q;  1W6K A;  4UCS A;  3W1B A;  5J39 A;  3H0G A;  5KND A;  2B39 A;  5DM7 3;  3W5O A;  1ZEQ X;  3M85 A;  1TS5 A;  1VS0 A;  4QWB A;  2Z6K A;  3D4W A;  2R93 H;  5E4X A;  1GUS A;  4BWS C;  1ICF B;  3GTK B;  4RNN A;  1VQC A;  2JEB I;  3ND8 A;  2K32 A;  3CC4 A;  3P7J A;  2ZM6 H;  1L1O B;  1WTP A;  1XXG A;  1AN7 A;  3RB3 A;  1S5E D;  2XVS A;  3ZJY C;  5CR3 A;  3PF4 A;  1PH4 A;  2XCA A;  1I4R A;  4B3T L;  4RB0 A;  4MV1 A;  1CKO A;  4X3T A;  1Y1W G;  4L63 B;  4GOP C;  3GTP H;  2J9G A;  4EGQ A;  4YY3 Q;  2OWO A;  2VNU D;  4OIK A;  3RLN A;  4DNT B;  4JYA L;  2PMZ A;  4DV4 L;  2EJF C;  1SMY C;  2F0T A;  2VUM B;  2R92 B;  3UE1 A;  1E2W A;  4CKB A;  4J9P A;  3BQ0 A;  3FDS A;  1XPO A;  2KEN A;  2ATW A;  4TSS A;  1A3T A;  3S1M B;  1K9M C;  3OOC A;  3NBH A;  1E7Z A;  1PRT C;  4A3F G;  2RDG A;  3KLS A;  4POG A;  3S14 B;  1M0T A;  1U9R A;  5KG5 A;  5M5W B;  1W3S A;  4KK7 A;  3EQL C;  4DLK A;  3E3X A;  4ZUI A;  4L8J A;  5T1G A;  2BCO A;  3TQ1 A;  4A3J G;  1ICW A;  1ASZ A;  1M8A A;  4HED A;  3CRK C;  5CBE E;  4TQR A;  5C4J B;  2RHQ B;  1W2B A;  2EYP A;  3F1Z A;  4PQX A;  1RIP A;  2ZM6 L;  2PPB C;  2AQ1 B;  5FLX c;  5C3E H;  1Q3L A;  3URY A;  1Q12 A;  2ID0 A;  2FP4 B;  1PVO A;  3S1R H;  5KT6 A;  2CZG A;  2JA5 A;  2HVR A;  2PI2 E;  3L7Z C;  4EFB A;  1Y1V G;  1VAJ A;  2FLN A;  5C3W A;  2NZ1 D;  2AQ3 B;  2KOL A;  4RGO S;  4OO1 H;  1DIK A;  3LWE A;  3MR3 A;  3RLO A;  1CQV A;  3QFF A;  5JVL A;  4DL5 A;  4R4I A;  4KKT A;  4MA0 A;  5I4D A;  3RGZ A;  1K83 H;  5IGE A;  2R7Z H;  3DMU A;  1R4Q B;  5C0X G;  4PNY A;  2R3Z A;  2R92 G;  4NW2 A;  2W6Q A;  1IW7 C;  4DL7 A;  2AMC B;  4JI7 Q;  5ELE A;  1I94 H;  1EYC A;  1SMX A;  1JOR A;  5EWG A;  2K04 A;  3KXY T;  4HTH A;  4P71 A;  1MGS A;  4O3Q A;  3CQZ H;  1CKM A;  4HJ7 A;  4IPD A;  4UFZ A;  4EEQ A;  4J6H A;  3CCM A;  2HIV A;  4CJ1 B;  1IYU A;  1TWG A;  1TWA A;  2CW7 A;  1XMO H;  4U7C A;  4A3I G;  1R9T A;  1E3P A;  3Q8D A;  4JI4 Q;  2MJ8 A;  1B6S A;  4RUC A;  1II3 A;  2E2H H;  4JI8 Q;  4YJ2 F;  1N48 A;  1A0I A;  5CC4 A;  5G3L F;  4EQ5 A;  2AUK A;  1G2T A;  2V4R A;  1K8A C;  1WTR A;  3GLK A;  2JA7 G;  2HJW A;  3HS0 C;  4NB3 A;  1KLU D;  2I46 A;  2K4K A;  3I90 A;  3GTL B;  3PO2 G;  1B7Y B;  5EPK A;  1ROD A;  4Q0F A;  2JA8 B;  4K5V A;  3STB C;  4O3S A;  1EIG A;  1I94 L;  2E2J H;  2PO4 A;  2LKV A;  2C28 A;  3NEM A;  1OXV A;  3HOU G;  2V9W A;  3SVM A;  3RZD H;  3KBX A;  3PUV A;  3F2C A;  4FYD A;  1XJV A;  5IYD H;  2R82 A;  4U6P A;  1SYB A;  3MXG A;  1LTB D;  2FPP B;  1HNW L;  3HOX B;  4H44 C;  1E2V A;  4YWM A;  3VR3 A;  3H0G H;  4HID A;  1V1P B;  2JQO A;  2JSO A;  1PZI D;  3I91 A;  1PDQ A;  3NE5 B;  4DK0 A;  1XMO L;  2YL2 A;  4RCN A;  1GUG A;  1KDA A;  2WFW A;  5IYB H;  3TN2 A;  1Y8P B;  4IRD A;  1K0R A;  4XXE A;  4P72 A;  3HOW G;  1V1Q A;  3MJF A;  2V4Q A;  2F0Q A;  1F77 A;  2XTI A;  1SYF A;  3J7A 5;  3JC6 6;  2NN6 G;  3M4Q A;  4IN3 A;  5JEA G;  4IJL A;  2OQ0 A;  1TY2 A;  4HCS A;  5IY0 A;  1TR5 A;  2ASD A;  2BH2 A;  1PZK D;  4RB1 A;  4H02 A;  2B63 G;  1QZG A;  2ASJ A;  2ASB A;  3KLR A;  5J2U F;  1WFQ A;  2B2T C;  2OH2 A;  3ERQ A;  1EYD A;  4MA5 A;  1STY A;  2BE5 C;  3K81 C;  5I9O A;  3SE7 A;  1HCZ A;  4I4T F;  3TSS A;  2B2W A;  5I6Y A;  3K3P A;  1S4Z A;  3WOE A;  2JA8 G;  3TIN A;  4XYM B;  1KAW A;  3OIP A;  2J0T D;  1PV4 A;  1B33 N;  3M7N A;  3PIO 3;  1WR2 A;  3W2D A;  2XC9 A;  5M3M H;  1BJT A;  2IHE A;  3VYS A;  4A3B H;  1LTG D;  1SRU A;  1J9O A;  1PH1 A;  4X64 H;  4QB4 A;  1RYR A;  4O2B F;  1BCP F;  2L15 A;  2WTF A;  4QIW B;  3M3Y H;  1EU4 A;  2KQ3 A;  1EYG A;  2NU7 B;  1SND A;  3FPP A;  5IT9 L;  2JA5 H;  4BBS B;  3M9M B;  4FF1 A;  1S9F A;  4L6T B;  4DAV A;  4LUZ A;  1IL2 A;  3V6J A;  5G3L D;  2H5X A;  2EJM A;  2F3I A;  5D65 A;  4BY1 G;  4TQS A;  5CB4 F;  4EFE A;  1AFP A;  4XT1 B;  4GLV B;  5JUM A;  2ZDG A;  1SN8 A;  5CA1 F;  1E0B A;  1ZHS A;  5J22 A;  3ERS X;  3GIQ A;  4GN5 A;  2QCP X;  2Q2T A;  3MWE A;  5KFX A;  1A62 A;  3CC7 A;  3MC0 B;  3OMC A;  1SYX B;  5COY A;  3OPO A;  2NVQ B;  3BAA A;  1KJI A;  3SHL A;  4DR6 Q;  3JAM i;  3GQC A;  1MHW C;  4A3K H;  4U67 3;  4X64 L;  5M3F B;  4NXM H;  4HIK A;  2CH4 A;  1B6R A;  2R8K A;  2PNR C;  1EFW A;  3J81 E;  2E2I A;  4ZKB B;  2RSN A;  4DKA C;  2BDN A;  4DR2 Q;  2R7M A;  2W71 A;  2YS6 A;  5FJ8 H;  3N40 P;  3EBE A;  4BA2 I;  1TWG H;  1TWA H;  3A8K E;  1PH5 A;  4BBR H;  1FNU A;  3RMH A;  2TMP A;  1R9T H;  4B3M Q;  1NAP A;  4DGZ A;  1D1I A;  3TME A;  3HOZ G;  3C1E A;  3R93 A;  4LFA Q;  4DV5 Q;  3PO3 H;  3S24 A;  2WKD A;  2VZA A;  2QYZ A;  1KBL A;  1ET6 A;  2HCC A;  4KMU C;  4O0A A;  1XWE A;  1RJP A;  4X3K A;  1PK8 A;  3I4N G;  4HR7 A;  4ZHQ F;  1N9W A;  1YZ6 A;  1UWV A;  4NXM L;  2FMC A;  5BPF A;  4MHE A;  4BS9 A;  2K5H A;  4Y7N B;  4JOI C;  1XYI A;  2VB3 X;  2XRS D;  1DOL A;  3V2T A;  2EY6 A;  3S17 H;  4A3L H;  3R8B A;  2C22 A;  1PFN A;  1MJC A;  4QWE A;  3KHL A;  1BBW A;  1SE2 A;  4Q8F A;  4MV7 A;  1XTD A;  3NWT A;  3I70 A;  1BXT A;  2FIN B;  2RF4 A;  1VQ5 A;  4PG3 A;  1YNX A;  2XN9 C;  4FO2 A;  4F7X A;  5HUR A;  2J7Z A;  1WOC A;  4QL5 A;  3SDZ A;  1HZB A;  3SK4 A;  5KYL A;  3J7Z C;  2F03 A;  3GTQ A;  2NVT H;  1GSA A;  4CKE A;  4R1J A;  2SEB D;  1HZA A;  2LXK A;  3I55 A;  3ZYY X;  1CE8 A;  3ETJ A;  5DGB A;  4IAL A;  3K0X A;  4GKJ H;  1MI2 A;  1CZG A;  1U0L A;  3RB0 A;  5DQI A;  3KHG A;  2HDL A;  4CC6 A;  2YW2 A;  2UUC H;  1E4F T;  1WD1 A;  2J6S A;  3KUP A;  4C56 C;  4P2C B;  2GA4 B;  3R3O A;  2W9C A;  1F2M A;  4UCR A;  1EWI A;  4ABN A;  4R8I A;  5IT9 c;  5D8D A;  2Y0S E;  3D31 A;  3GTP B;  4ZK9 B;  2F4I A;  2VQF H;  5KG4 A;  1SFO A;  4B3M H;  3A8J E;  4M8A A;  1RKN A;  4LF6 Q;  3S16 H;  1KL9 A;  5KG6 A;  3CF5 A;  4YQW A;  1VQP A;  4ED8 A;  4JUZ A;  5EKK A;  4OL7 A;  1SNM A;  2V58 A;  1QUQ A;  4DF7 A;  4QY7 A; 
#chains in the Genus database with same CATH homology
 4JI3 Q;  1GO3 E;  2R7F A;  4DR1 Q;  1OXU A;  3KF8 B;  4JBW A;  4DPG A;  5C44 H;  4K0K L;  1P16 A;  2B29 A;  4GKJ L;  1YHA A;  1AE3 A;  2ALY B;  4DR3 Q;  5LMU L;  2WAQ E;  5JJK A;  2I5M X;  1L1O A;  4PZ7 A;  3J81 i;  2UUC L;  3M4O H;  2UXB L;  2R93 G;  1LM0 A;  1SLJ A;  2YTX A;  3RR5 A;  4GNX C;  2WB1 E;  1IBK Q;  1N32 L;  4LUV A;  4YCV A;  4GS3 A;  2MNA A;  5C4X H;  4LF8 Q;  4HJ5 A;  4PZ6 A;  4JI5 Q;  4X66 L;  4GLA C;  2VQF L;  4A3M G;  4LNQ A;  4DV7 L;  3M4P A;  4LF4 L;  1HNX Q;  2UXC Q;  2ZTC A;  1SRO A;  5BR8 L;  1D8L A;  4J15 A;  3K80 C;  2LSS A;  3MXN B;  1S40 A;  4BBS H;  2MFI A;  4DV2 Q;  4C3H H;  4UP9 A;  2KCM A;  2VY3 A;  4A3G H;  4R4O A;  3HOZ H;  4AH6 A;  1IBL L;  4JI2 L;  2GVB A;  1EQR A;  1E1T A;  1PH9 A;  5ELO A;  4K0K Q;  1X65 A;  4LWC A;  2E2I H;  4XIG S;  1YIJ A;  1VQB A;  4LFC L;  2EQS A;  3S1N H;  4GKJ Q;  4DR4 L;  1N36 L;  5LMU Q;  3S15 H;  2KBN A;  3CCJ A;  3CPF A;  5JJI A;  2UUC Q;  2UXB Q;  1M90 C;  5IE8 A;  3RLF A;  4BXX H;  1N32 Q;  1NY4 A;  1IBM L;  3RN5 A;  3TRZ A;  4UY8 C;  1E22 A;  4YWK A;  2NVQ H;  4LUO A;  2KHI A;  4OWT B;  4X66 Q;  1HJP A;  2VQF Q;  4LW1 A;  4B3R L;  4DV7 Q;  1IYJ B;  4LF4 Q;  2Q2I A;  2OCE A;  2VUM G;  1KRT A;  4NXN L;  3STB D;  3G4S A;  3AQQ A;  4DV0 L;  4GOP B;  1SR3 A;  1PH8 A;  1J5E L;  1KHI A;  5BR8 Q;  4DR5 L;  4WJ4 A;  2Y0S G;  4L5Q A;  2UUB L;  4GN4 B;  4O2D A;  2ZM6 Q;  3CCU A;  5IYC G;  1PFS A;  4OWW B;  1VQE A;  4IFD I;  2CWA A;  4A93 G;  4JI2 Q;  1X3G A;  3HFZ B;  1DGS A;  3K7A H;  2QGQ A;  4DV1 L;  4GNX B;  3PUX A;  4A3D H;  4QGU A;  4OO1 G;  3BZK A;  3RNU A;  4LFC Q;  1EIY B;  2JE6 I;  3KYH C;  4DR4 Q;  1UE7 A;  2D62 A;  1N36 Q;  1X54 A;  4APV A;  2B3G A;  4BA1 I;  4GOP A;  4FDB A;  5GAE C;  5GQO A;  5IWA L;  2R7Z G;  5IP7 H;  5HGQ A;  1IBM Q;  1SE8 A;  3NEN A;  1H95 A;  1OTC A;  1FJG L;  1XNR L;  3CP0 A;  2IHF A;  4B3R Q;  1Z47 A;  2B63 H;  2PI2 A;  2OTL A;  1J5E Q;  4HJ9 A;  4NXN Q;  3KDF B;  4DV0 Q;  3U4Z A;  1PH2 A;  2WAQ G;  1AE2 A;  1VQH A;  4DR5 Q;  4RG1 A;  1HNZ L;  4KHP L;  1Q1E A;  2UUB Q;  3ULL A;  1D7Q A;  1FGU A;  2WB1 G;  2QA4 A;  3G48 A;  2NZH A;  1NMF A;  4Y7N H;  2K5N A;  3GTQ H;  3G71 A;  1WJJ A;  1WCM H;  4IO9 A;  1V43 A;  4IPG A;  3DLL A;  1GM5 A;  2V1C C;  3CW2 C;  2N3S A;  1NBW A;  2BA0 A;  5LMN L;  1YHQ A;  5LMN W;  3CC2 A;  2DUD A;  4HIM A;  1Z9F A;  2MQH A;  3H3V I;  4GKK L;  1A63 A;  1JT8 A;  4YY3 L;  3KDF A;  1T9H A;  4P75 A;  1EQQ A;  5IWA Q;  3J80 c;  3F8T A;  1GVP A;  1ASY A;  3W1B A;  1KD1 C;  3J7A 5;  4AYB G;  1QUQ B;  1XNR Q;  5IP9 G;  1WI5 A;  2D0O A;  3W5O A;  1N8R C;  3M85 A;  1VS0 A;  5C0X J;  2Z6K A;  1SFO H;  4DR7 L;  2R93 H;  4UP7 A;  1NJI C;  1PHJ A;  1VQ9 A;  1CSP A;  4KHP Q;  2NVY H;  1JJC B;  3JAM c;  1HNZ Q;  4JV5 L;  2ZTE A;  4UPA A;  1MIU A;  3KLW A;  3CCE A;  1VQC A;  2JEB I;  3CC4 A;  1VQO A;  5J3B A;  4GN3 B;  1PA6 A;  2E5L L;  1L1O B;  2HT1 A;  1YIT A;  3ZJY C;  4HJA A;  4TVA B;  4A3M H;  3PF4 A;  1PH4 A;  4B3T L;  4C3J H;  5LMN Q;  1MJE A;  2A8V A;  2ZJR A;  1VQI A;  1CKO A;  3H3V H;  4Y52 H;  4KI0 A;  1Y1W G;  4GOP C;  3GTP H;  4GKK Q;  3RZO H;  3M9B A;  4YY3 Q;  2OWO A;  2VNU D;  5M5Y H;  2CCZ A;  3H0G G;  2CFM A;  4JC0 A;  4JYA L;  3RLN A;  4DV4 L;  4LF7 L;  2HIX A;  3UE1 A;  3F2D A;  2JEA I;  4OO1 I;  4MNO A;  5IYB G;  1XPO A;  2KEN A;  3BZC A;  3SGI A;  4XTC S;  2ATW A;  1K9M C;  1E7Z A;  2CQO A;  4POG A;  4A3F G;  2KCT A;  4DR7 Q;  1YI2 A;  2ZJQ A;  4JV5 Q;  3D0F A;  3T1Y L;  1C0A A;  1W3S A;  4B3S Q;  1L2F A;  1Q82 C;  1B70 B;  2F52 A;  4OWX B;  5H1S E;  4IJH A;  2E5L Q;  3HOX G;  2K5V A;  4A3J G;  1ASZ A;  5EAY A;  4X62 L;  3U58 A;  1JJ2 A;  4A3E G;  5K36 G;  2RHQ B;  1W2B A;  2VUM H;  5ELN A;  3I7F A;  1VQL A;  4DUZ L;  3F1Z A;  4NPS A;  4JI7 L;  1RIP A;  3TEH B;  2ZM6 L;  1VQ8 A;  4B3T Q;  2C35 B;  5FLX c;  5C3E H;  3KJO A;  3I2Z A;  4DNI A;  1Q12 A;  2ID0 A;  1PVO A;  3S1R H;  4BY7 G;  5IYC H;  4AYB E;  2PI2 E;  4JI1 L;  1G6P A;  1VQA A;  3L7Z C;  1Y1V G;  1LUZ A;  4A93 H;  4JYA Q;  4L5R C;  1Q1B A;  4DV4 Q;  4LF7 Q;  1QVC A;  3RN2 A;  3F2B A;  1VQN A;  3RLO A;  2D0P A;  1YJ9 A;  3I4N H;  5M3M G;  4A3B G;  5C4J H;  3PGZ A;  3FP9 A;  4P74 A;  4R4I A;  4JI4 L;  3NEL A;  1TWF H;  4IOC A;  3T1Y Q;  3J81 j;  4JI8 L;  4JBM A;  1K83 H;  1YEZ A;  2R7Z H;  1XPR A;  2JA9 A;  1OXX K;  2XGT A;  1TWH H;  4YHH L;  1JE5 A;  1GKH A;  3I4O A;  3I4M G;  5C0X G;  2R92 G;  4X62 Q;  2QEX A;  3HOV G;  2UU9 Q;  3CPW A;  2AMC B;  1IZ6 A;  3CCV A;  2JA5 G;  4DUZ Q;  1M1K C;  4JI7 Q;  2Q2H A;  4OX9 L;  1BVS A;  1VQM A;  1SMX A;  2YTY A;  3K7U C;  1JJG A;  1NE3 A;  4X6A H;  4JI1 Q;  4P71 A;  3CQZ H;  3G6E A;  3VDY A;  2OQK A;  5GAD C;  1CKM A;  4HJ7 A;  2IY5 B;  1U5K A;  4IPD A;  1L1O C;  3A5Z B;  3IRB A;  3CCM A;  2CWP A;  3FHW A;  2HIV A;  3HOY G;  4QQB X;  4DUY Q;  3E0E A;  4P73 A;  4A3I G;  3LGJ A;  3AEV A;  2NZO A;  1E3P A;  2A19 A;  2RHS B;  3Q8D A;  4JI4 Q;  4BBS G;  1I3Q H;  2E2H H;  2VS1 A;  4JI8 Q;  1A0I A;  2GN5 A;  1VQ4 A;  4QJF A;  3L2P A;  1X9N A;  4A3K G;  4YHH Q;  4EQ5 A;  2RCN A;  5IP9 H;  2I5H A;  1K8A C;  3FKI G;  4IOA A;  2K52 A;  2DGY A;  2PMZ E;  2JA7 G;  4NB3 A;  4HJ8 A;  4JI0 L;  4OX9 Q;  2K4K A;  3PO2 G;  3L0O A;  1OXS C;  3E9H A;  2UUA L;  4ALP A;  1B7Y B;  5M5X H;  3GD7 A;  5FJ8 G;  4JI6 L;  1HZ9 A;  4BXX G;  1UE1 A;  3PUW A;  2A1A A;  3STB C;  1YJW A;  1KQS A;  1N33 L;  1I94 L;  2E2J H;  3ULP A;  1PH7 A;  3NEM A;  1OXV A;  3HOU G;  5IYD H;  4BBR G;  3PUV A;  4MZ9 A;  4OXP A;  3F2C A;  3RZD H;  1XJV A;  1Q81 C;  2OTJ A;  5M3F G;  2Q2U A;  2K14 A;  1CKN A;  1V9P A;  5HY6 A;  3U4V A;  5GRO A;  3PCO B;  1QVG A;  1Y1W H;  1HNW L;  3KF6 A;  4DAM A;  4YWM A;  3GTL H;  2HQL A;  2WP8 J;  3H0G H;  4HID A;  1XMO L;  2JQO A;  4LFB L;  3PO3 G;  1A8V A;  2I5L X;  4JBJ A;  1I6H H;  3ICE A;  2WFW A;  5IYB H;  4ME3 A;  1K0R A;  1E24 A;  4P72 A;  1L0W A;  1CUK A;  3HOW G;  1V1Q A;  4A3F H;  4JI0 Q;  4B3S L;  2XTI A;  1YHB A;  2AWO A;  1K73 C;  1XMQ L;  2UUA Q;  2BA1 A;  3JC6 6;  4R4C A;  4A4I A;  2NN6 G;  3M4Q A;  1Q46 A;  5JEA G;  3A0J A;  1J6Q A;  4IJL A;  2OQ0 A;  3AFP A;  4JI6 Q;  3S2H H;  3NBH B;  4QIW E;  3HOX H;  1QZH A;  1N33 Q;  5IY0 A;  3GTM H;  2JK8 A;  4A3J H;  1I94 Q;  1O7I A;  5C0X I;  4A3L G;  4KHZ A;  2BH2 A;  3TS0 A;  5E7N A;  4A3D G;  4H02 A;  2B63 G;  3OYY A;  1QZG A;  4IPH A;  2ASB A;  2YTV A;  2YU9 H;  1WFQ A;  4OON A;  4DV6 L;  1X3F A;  3K81 C;  4BY7 H;  1HNW Q;  2K75 A;  4KLK A;  3GTK H;  4YCU A;  1Y1V H;  1Q8K A;  1XMO Q;  1VCI A;  4LFB Q;  2LXJ A;  2JA8 G;  4PZ8 A;  1TWC H;  1YBY A;  1KAW A;  3A74 A;  4DK6 C;  1WCM G;  1HH2 P;  1YVC A;  3DM3 A;  3MEF A;  1PV4 A;  2ZTD A;  1GD7 A;  3M7N A;  4DV2 L;  2JA6 G;  5AJ3 L;  2MO0 A;  3B6Y A;  2IHE A;  2VL6 A;  5M3M H;  1PH3 A;  1MKH A;  1SRU A;  3CCS A;  1JMC A;  4A3B H;  1PYB A;  3OTO L;  3PV0 A;  5DLQ E;  1PH1 A;  1QVF A;  3E9I A;  4PMW A;  3CCR A;  1XMQ Q;  2ES2 A;  1X6O A;  1CSQ A;  4DR6 L;  2L15 A;  3M3Y H;  5FLM G;  2AKW B;  2VQE L;  2UU9 L;  2IT1 A;  3I4M H;  4DV3 L;  1EYG A;  2JJQ A;  2R92 H;  4WJ3 M;  1AH9 A;  1Q7Y C;  3HOV H;  1XNQ L;  3PIP A;  4AQY L;  3KJP A;  2JA5 H;  4L5S A;  1VQF A;  2PNH A;  4DR2 L;  3S1M H;  2PQA A;  1NTG A;  3CXC A;  4LUZ A;  3CMA A;  1IL2 A;  3S14 H;  5JJL A;  4YWL A;  1BKB A;  1VQJ A;  5GAH C;  2H5X A;  5M5W H;  4DV6 Q;  1Q86 C;  3GTG H;  4A75 A;  4JOI A;  2F3I A;  3EN2 A;  4BY1 G;  1I50 H;  3GTJ H;  2Z6K C;  4DUY L;  1JB7 A;  2MO1 A;  3UE0 A;  4GLV B;  4A3C G;  1X3E A;  1SN8 A;  3J80 i;  3HOY H;  1TXY A;  4B3M L;  3S2D H;  4X65 L;  3ERS X;  2N8N A;  3EIV A;  5AJ3 Q;  1YJN A;  2R7D A;  4GN5 A;  4A3I H;  4LF9 Q;  4DK3 C;  2ZJP A;  1I5F A;  2Q2T A;  1FVI A;  3UDX A;  2GVA A;  4POF A;  3OTO Q;  1HR0 L;  1A62 A;  3CC7 A;  1HR0 W;  3CCL A;  5JEA J;  4DV5 L;  4LFA L;  5C44 G;  4DR6 Q;  2IX0 A;  3JAM i;  4IPC A;  2VQE Q;  4A3K H;  4X64 L;  4DV3 Q;  2Z0S A;  1G29 1;  4HIK A;  1EUJ A;  2N49 A;  4MTN A;  3FKI H;  3I56 A;  1K8G A;  3HKZ E;  1EFW A;  1XNQ Q;  2JA7 H;  5GAG C;  4GLX A;  1S3O A;  4AQY Q;  4DKA C;  4DR2 Q;  3PO2 H;  2CKZ B;  1FL0 A;  4A76 A;  3ULJ A;  1G51 A;  3PIO A;  4R4Q A;  2NN6 I;  5C4X G;  2YYZ A;  5FJ8 H;  3PF5 A;  4JCV E;  2FXQ A;  3EBE A;  4BA2 I;  4IFD J;  2N78 A;  3CD6 A;  4LF5 L;  1EIF A;  1TWG H;  1TWA H;  3A5U A;  1S72 A;  3HOU H;  1PH5 A;  4BBR H;  3U50 C;  5M3F H;  1R9T H;  4B3M Q;  2AHO B;  4X65 Q;  1KIX A;  3TS2 A;  1UEB A;  1IXR A;  5C3E G;  3TRE A;  1RL2 A;  4A3G G;  3HOZ G;  1HR0 Q;  2NVX H;  2IX1 A;  2HHH L;  1PYS B;  2AWN A;  4LFA Q;  3WWV A;  4DV5 Q;  3T1H L;  3PO3 H;  1CKN B;  1VQG A;  1E1O A;  1Y14 B;  2VZA A;  3S24 A;  4C3I H;  1IBL Q;  3PSI A;  4UP8 A;  4X64 Q;  1KXL A;  2YV5 A;  3KF6 B;  4O0A A;  4RMF A;  2VW9 A;  3PUZ A;  3HOW H;  2R6G A;  3I4N G;  4EX5 A;  1N9W A;  1YZ6 A;  1UWV A;  2I0Q A;  3K8A A;  4NXM L;  1C7Y A;  2UXD L;  2E8G A;  2K5H A;  3J81 c;  4JOI C;  4TQU S;  3S1Q H;  1LYL A;  1OXT A;  3UDI A;  1NMG A;  3GTO H;  3S17 H;  4A3L H;  4LF5 Q;  1N34 L;  1MJC A;  1VQD A;  1B8A A;  1BBW A;  4GNX A;  3CME A;  1VQK A;  1XTD A;  4L5T A;  3GDE A;  4HIO A;  1VQ7 A;  2RF4 A;  1VQ5 A;  4PG3 A;  1YNX A;  2HHH Q;  3BJU A;  3T1H Q;  2JA8 H;  1WOC A;  4QL5 A;  2BH8 A;  1HZB A;  3W1G A;  3J7Z C;  3OW2 A;  4LF6 L;  2F4V L;  3KOJ A;  2NVT H;  3KFU A;  2EIF A;  4DV1 Q;  3BU2 A;  4R1J A;  2KHJ A;  3I55 A;  1HZA A;  2LXK A;  2JA6 H;  2K50 A;  3CAM A;  1K3R A;  3AFQ A;  3K0X A;  3UDF A;  4JI3 L;  1U0L A;  3UDG A;  4DR1 L;  4NXM Q;  5IP7 G;  4DAY B;  2UXD Q;  1P8L A;  3TQY A;  1PH6 A;  1XPU A;  5FLM H;  4A3E H;  1C9O A;  4DR3 L;  4C2M H;  1N34 Q;  1FJG Q;  1EWI A;  1WYD A;  5IT9 c;  3CCQ A;  2Y0S E;  3D31 A;  3HKZ G;  1KC8 C;  3PUY A;  3HKS A;  3GO5 A;  1IBK L;  3ER0 A;  1X56 A;  3H15 A;  4LF8 L;  1LTL A;  4IFD G;  1UE6 A;  4JI5 L;  1X55 A;  4R4T A;  2PQA B;  4BY1 H;  1HZC A;  1HNX L;  4LF6 Q;  3S16 H;  1KL9 A;  2F4V Q;  2UXC L;  3CF5 A;  1UE5 A;  1VQP A;  4A3C H;  4JG2 A;  4LF9 L;  1EOV A;  1VQ6 A;  1KRS A;  2EXD A;  5IYD G;  4JBK A;  1QUQ A;  4YCW A;  4AIM A;  4QY7 A;  3AYH B;  1BBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...