4BY7G

Elongating rna polymerase ii-bye1 tld complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by7G01
4JI3L 1E1TA 4AH6A 4OO1I 2ZTEA 4A4IA 2V1CC 1YITA 3M4OH 4BBSG 3CAMA 2QA4A 1OXTA 4A3DH 3M9BA 3CCRA 5C3EG 2D0OA 1LUZA 4UPAA 3E9IA 4LF9L 2K5VA 1OTCA 1NTGA 4O2DA 5C4XH 3K8AA 1PH7A 4DR3Q 1HNXL 2FXQA 2NN6I 3UDXA 3KDFB 4DUYQ 4DR1Q 3S2HH 1EWIA 4JC0A 1HJPA 2F3IA 4DUZL 4JI4Q 4JV5L 4YCUA 5FJ8G 3T1YL 5AJ3Q 4DR4Q 3GTQH 2B29A 1HNZQ 1KQSA 4BA2I 2WB1G 2GVBA 2EQSA 1C9OA 1NJIC 1K3RA 4LFAQ 1KRTA 1BKBA 1H95A 1EQRA 2JK8A 4JI1L 3CCVA 4GNXA 4DV2Q 1L0WA 3KOJA 1SR3A 1VQHA 4DV7Q 4JYAL 4DAMA 1AE3A 2Z6KC 1QUQB 3G48A 2VQEQ 3GTGH 4LFBQ 4HIMA 4HJ8A 4LF7Q 4GLAC 4JI0L 3FKIG 3I4NH 1HNWQ 5IE8A 4PZ7A 2K5NA 5M5XH 3CMAA 2UUCL 4NXML 2LXJA 3PO3H 1XNRQ 1G51A 2MFIA 1VQOA 3ER0A 4DR7L 1QVFA 5C0XI 1VQ4A 1WOCA 2MQHA 5IP7G 4DV6Q 2E2IH 3G6EA 4L5RC 5JEAJ 2ZJPA 4A3LH 4WJ4A 4A3KG 3S24A 2Q2HA 4KLKA 4HJ7A 5ELOA 2K14A 2UU9Q 2MNAA 2XTIA 4C3IH 3HFZB 4OWXB 4DR5Q 3E0EA 3BZCA 4FDBA 4POFA 1BVSA 2Q2TA 2R7ZH 2CWPA 1J6QA 4C3JH 1VQEA 3B6YA 3RLFA 1K8GA 4B3TL 4JG2A 3W1BA 2RF4A 4UP8A 1E1OA 4YWKA 4YY3L 4A3BG 4DV3L 4GOPA 1XMQL 1Q7YC 2F4VL 5H1SE 1Z9FA 2RHQB 3HOVG 1PFSA 3D0FA 1I3QH 1IZ6A 4DV4L 1PH8A 1Q46A 3MEFA 4YHHQ 1KXLA 1YNXA 1MIUA 1X56A 4UP9A 2JEAI 3M3YH 1Q8KA 1PA6A 4POGA 2E5LQ 2GVAA 5M3MH 4LF6Q 3TQYA 5IYBG 3UDIA 4IFDG 4QQBX 1VCIA 1PH6A 4JI2Q 3UE1A 3U4VA 3S1MH 2AWOA 2ZTCA 3NELA 1EQQA 5IP9H 4JI5Q 4JI3Q 2UUBL 2ATWA 1CKNB 3KF6A 3RZOH 1V1QA 3CMEA 4NPSA 3DM3A 2DUDA 1WJJA 2OQKA 2XGTA 4X62L 1VQ8A 2JA8G 4GKKL 5IYDH 3CXCA 1B7YB 3KF8B 2BA0A 4RG1A 5E7NA 4LF9Q 1HNWL 2PMZE 1YHBA 4HJAA 4PZ8A 2HIVA 1HNXQ 2N78A 3I56A 4A3DG 1PH5A 2UUAL 4B3SL 1S3OA 2K75A 4IOAA 4JV5Q 2N8NA 3T1YQ 4A3EH 1XPUA 1Y1WH 1K0RA 1XPRA 5C4XG 3HKZG 3BZKA 3KJPA 1D8LA 3UDFA 3PF4A 1TWFH 2IHEA 4A3CH 3TS0A 2NVXH 3ZJYC 3I2ZA 4KI0A 3AQQA 1VQDA 3CPWA 1XMOL 1W2BA 2YTVA 1WFQA 2VL6A 4PZ6A 5IYCH 1JMCA 4JI1Q 2IX0A 1VQCA 4BY7H 1LYLA 1I94L 4JYAQ 1X55A 3F8TA 2ZM6L 4YCWA 4X66L 3MXNB 3HOUH 1L1OA 4O0AA 5GROA 2A1AA 1UWVA 1CUKA 1WI5A 4JI0Q 4DR6L 4DK3C 4K0KQ 5HY6A 1HZBA 2JEBI 2UUCQ 4A76A 1VQKA 4DV0L 2BA1A 5J3BA 4DR7Q 4LWCA 1K8AC 4WJ3M 3S17H 3I7FA 4P75A 3ICEA 2ALYB 2CFMA 4C3HH 3HOXH 4GN4B 1K73C 3PUZA 1VQGA 1VQ9A 1S72A 1SE8A 1T9HA 5GAHC 1PH4A 3I4NG 1VQBA 2KCMA 2WP8J 2Z6KA 2MO1A 3M4PA 3H3VI 4R1JA 3PO3G 1PVOA 1V43A 5DLQE 4IOCA 1J5EL 1EFWA 1IBML 4A3LG 4GS3A 3HOWH 3KYHC 1N32L 2KENA 4B3TQ 4AYBG 4YY3Q 4IPGA 3J81j 5LMUL 4DV1L 4DV3Q 1XMQQ 2R93H 2F4VQ 5HGQA 1XTDA 4L5QA 2CKZB 3S16H 4JOIC 3A74A 4DV4Q 2YTXA 4DV5L 4BY1G 3PIPA 1HH2P 1G6PA 1UE1A 3E9HA 4YWLA 1M1KC 2YU9H 4LNQA 4A93H 2BH2A 2JJQA 1EIFA 3CQZH 2YTYA 4R4IA 2JA6H 3L0OA 3KDFA 4YWMA 3U50C 4QJFA 4PG3A 2UUBQ 3KJOA 2UXCL 4BBRH 2UXDL 3OYYA 4HJ5A 1V9PA 1YJ9A 4X62Q 4GKKQ 1FGUA 1C7YA 1N34L 1NBWA 3S1QH 4KHPL 1PV4A 3ERSX 3CCSA 2ASBA 5ELNA 3PUVA 4K0KL 2UXBL 4LW1A 5IP9G 3S1RH 1CKMA 1YEZA 4P73A 2KBNA 3KLWA 1M90C 2AHOB 2R6GA 1HZAA 4P72A 4B3ML 3PSIA 3PUYA 4X6AH 5IYDG 1SMXA 1TWAH 1E3PA 4LUVA 3STBC 2UUAQ 3K7AH 1QUQA 4A3IH 4B3SQ 2K52A 1OXUA 3HOYH 1LTLA 2AMCB 3M7NA 4IPHA 5LMNL 3M85A 2PQAB 1S40A 1VQIA 2VZAA 3JAMi 1EIYB 1WCMH 2JE6I 4BY1H 5JJLA 1VQ7A 2KHIA 3PCOB 2KHJA 2N3SA 1U0LA 3EN2A 1VS0A 3CD6A 5IT9c 3K81C 1KRSA 3EIVA 1XMOQ 2VUMH 4A3EG 3I4MG 2E8GA 1Q1BA 3FHWA 1Y1WG 4HIDA 3IRBA 1I94Q 3GTPH 4OX9L 1JE5A 3AFPA 3RLOA 3F2BA 4A3CG 2ZM6Q 2L15A 3CCJA 4X66Q 1AE2A 1PH1A 2HHHL 4LF4L 4BY7G 5IYCG 3H0GG 4DR6Q 2EIFA 1P8LA 3HKZE 1YIJA 3OTOL 1GO3E 3OW2A 5M3FH 2JQOA 5FLXc 4DV0Q 4DR2Q 1SROA 1A62A 4NXNL 2QGQA 3L7ZC 4L5SA 2R7DA 1UE7A 1G291 1I50H 3HOUG 1TWGH 2IX1A 3CCUA 4JBWA 1XJVA 2JA7G 2NZOA 2OTJA 3CCMA 1Z47A 4HIKA 1KL9A 1UE5A 1KC8C 2JA9A 4A3MH 1J5EQ 4OXPA 4LUZA 1TWHH 1IBMQ 4XTCS 1K83H 1N32Q 1OXSC 3HOXG 3NEMA 5LMUQ 4DV1Q 1HR0L 1CKNA 2VW9A 2I5LX 1YZ6A 4IJHA 1KIXA 2I5HA 3NENA 1GD7A 1YI2A 4LFCL 4DV5Q 3TS2A 3HOWG 2A8VA 1NMGA 4MZ9A 1E7ZA 1YHQA 2R93G 4LF8L 1PH2A 1VQLA 1GKHA 2D0PA 2VY3A 1CKOA 2NVQH 4GKJL 2WFWA 1MJCA 4AYBE 3D31A 3ULLA 4A75A 4JBKA 3U4ZA 3GD7A 5M5YH 2AKWB 2UXCQ 2UXDQ 5JJKA 2K50A 3M4QA 4JOIA 3SGIA 3GDEA 4YCVA 4GOPC 1YJNA 4A3GH 4A93G 1JJGA 3HKSA 1N34Q 1IBLL 4X64L 2JA6G 2RHSB 4KHPQ 1I6HH 4JI8L 1N8RC 4DNIA 4A3BH 4UY8C 2UXBQ 5C44H 2NVYH 4BBRG 4B3MQ 3I55A 4AIMA 4DR2L 4IFDI 1EUJA 4IFDJ 2A19A 2OTLA 3K7UC 1GM5A 2N49A 4ME3A 4JI7L 1VQ6A 3UE0A 5C0XJ 4DK6C 5LMNQ 3RLNA 3J80i 1IBKL 3GTOH 1IYJB 1RL2A 4KHZA 3RR5A 4JI6L 4QL5A 3T1HL 1VQJA 1SFOH 1C0AA 2QEXA 1Y14B 2HQLA 5IWAL 1N36L 5M5WH 3H3VH 1HZCA 3L2PA 4A3IG 3J80c 3PO2H 1TXYA 3HOYG 3A0JA 1K9MC 4MNOA 2I0QA 2JA5H 5C0XG 1GVPA 3CC4A 1KD1C 3A5UA 4OX9Q 3GO5A 3G71A 3EBEA 1WCMG 4IO9A 3U58A 3HOZH 1WYDA 4BXXH 1VQAA 1JT8A 4A3JH 1RIPA 3KFUA 4QGUA 2R7ZG 2HHHQ 4ALPA 4OWWB 3S14H 4LF4Q 3DLLA 3CP0A 1Q81C 2LSSA 3OTOQ 4UP7A 2Q2UA 4Y52H 1N33Q 3GTMH 2R7FA 1B70B 1VQMA 2B63H 1D7QA 1TWCH 2MO0A 4NXNQ 4TVAB 5GAEC 1EYGA 4R4CA 3J81i 4JCVE 1JJ2A 4IPCA 4APVA 2HIXA 5JJIA 4QY7A 3CCEA 3PUXA 1JJCB 5M3MG 2D62A 1PH9A 1W3SA 1YJWA 1PHJA 2I5MX 5M3FG 1PYSB 3J81c 3VDYA 5GQOA 3AYHB 4GN5A 4X65L 4GNXB 2IY5B 1FJGL 1QZHA 4JBJA 1L1OC 1IXRA 3PGZA 4B3RL 1MKHA 1X3GA 1QZGA 1VQ5A 4AQYL 1HR0Q 2K5HA 2ZJRA 2Y0SG 3RN2A 1SN8A 3I4OA 1MJEA 2OCEA 4LF5L 5BR8L 2VUMG 1E22A 1P16A 2ID0A 4A3MG 1X3FA 1Y1VH 4LFCQ 3S2DH 3F2DA 1X6OA 1AH9A 5C4JH 2R92H 4A3FH 3PV0A 5EAYA 4LF8Q 2YYZA 1YHAA 3W5OA 4OONA 1XNQL 3JC66 1NMFA 2VQFL 3K0XA 3CCQA 1BBWA 1HZ9A 5FLMH 2ZJQA 4GKJQ 2YV5A 4EQ5A 4R4TA 4P71A 3JAMc 1QVCA 4GLVB 1DGSA 2LXKA 1OXXK 2VS1A 4R4OA 4C2MH 4BBSH 4TQUS 3GTKH 3CC7A 1YVCA 4NB3A 2PQAA 2PI2E 4EX5A 5C3EH 4HJ9A 1IBLQ 4X64Q 2HT1A 5GAGC 4HIOA 1ASZA 4JI8Q 4DPGA 3J7ZC 4GOPB 1I5FA 3CF5A 2AWNA 3FP9A 1X54A 1JB7A 3CCLA 1N33L 3UDGA 3Q8DA 2E2HH 2IT1A 1PYBA 5IY0A 3F1ZA 4A3GG 3STBD 5FJ8H 4IPDA 1OXVA 4JI7Q 3BU2A 3NBHB 5JEAG 3A5ZB 3PF5A 4DR3L 5C44G 1X3EA 4GNXC 1ASYA 3CW2C 1IBKQ 4DUYL 4JI6Q 4DR1L 1YBYA 1X9NA 3T1HQ 4JI4L 5GADC 3KF6B 4PMWA 2WAQE 3TREA 3ULJA 5IWAQ 5AJ3L 1VQPA 1N36Q 4JBMA 4DR4L 2C35B 3AFQA 1HNZL 4DAYB 2OWOA 1FL0A 1CSQA 1KAWA 2VNUD 2IHFA 3TEHB 4RMFA 1FVIA 3RN5A 4LFAL 1VQNA 4R4QA 2NZHA 1LM0A 3CC2A 4OO1G 3FKIH 2GN5A 1X65A 2BH8A 1E24A 2OQ0A 1Q86C 1A0IA 3PUWA 4DV2L 3PO2G 1A8VA 2F52A 4DV7L 2JA5G 5LMNW 5IP7H 2VQEL 4LFBL 1XPOA 1NY4A 1VQFA 2CCZA 3HOZG 4A3KH 1UE6A 3H15A 3RZDH 1R9TH 1QVGA 1O7IA 4A3JG 4LF7L 4BXXG 1A63A 2EXDA 1KHIA 2NN6G 2PNHA 1BBUA 4J15A 1Q82C 1XNRL 2Q2IA 4BA1I 3LGJA 4DV6L 3K80C 4GN3B 4LUOA 1PH3A 2B63G 4DUZQ 2CWAA 1NE3A 4GLXA 1UEBA 4XIGS 4X65Q 3PIOA 2WAQG 4OWTB 1U5KA 1FJGQ 2KCTA 3I4MH 4B3RQ 2UU9L 2PI2A 2E2JH 3W1GA 4DKAC 3AEVA 3RNUA 4AQYQ 2ZTDA 4Y7NH 3ULPA 3HOVH 4P74A 1L1OB 4DR5L 4LF5Q 5BR8Q 3F2CA 2ES2A 3GTLH 3TRZA 3H0GH 2B3GA 3S15H 3S1NH 2DGYA 4IJLA 4MTNA 5IYBH 3GTJH 1IL2A 3J7A5 1XNQQ 1Q1EA 5K36G 1SRUA 2VQFQ 2H5XA 2RCNA 4YHHL 3CPFA 1Y1VG 1Q12A 2K4KA 1EOVA 2CQOA 3BJUA 2NVTH 1CSPA 2E5LL 1N9WA 3WWVA 2WB1E 3G4SA 4L5TA 4LF6L 1SLJA 4NXMQ 2JA7H 2Y0SE 4H02A 2JA8H 2R92G 4QIWE 1B8AA 4A3FG 4JI2L 1HR0W 2Z0SA 1L2FA 4JI5L 5FLMG
chains in the Genus database with same CATH superfamily
1E1TA 3DUZA 2B2YC 4AH6A 4OO1I 2ZTEA 2C2RA 1YITA 2V1CC 3M4OH 3MJFA 1A2TA 3RJ0A 2DPIA 1DOMA 5C3EG 3GTGB 2UUBH 1OTCA 1QNKA 2M05A 4ZLTF 3RD4A 3K8AA 3EYYA 2X0SA 4GKKH 3UDXA 3EROA 1DZ1A 4F4XA 2HCIA 5KYLA 2F3IA 3GTKB 2XIWA 2AUJD 2PMZA 2UVVA 1BJTA 5FJ8G 5KIXA 3T1YL 4I7AA 4OELB 1HNZQ 1A15A 3IL8A 2PPBC 1SJHD 5KFAA 1S9FA 4RAYA 4LFAQ 4C3IB 1I6UA 3GTPA 2JK8A 4DV2Q 1LTTD 4LF8H 3GILA 5C3XA 3G48A 4LFBQ 4KY6A 1TS4A 4RB0A 1TIID 4JI0L 5C8YF 3I4NH 3SI8A 1HNWQ 4J9PA 4TRDA 2UUCL 3PO3H 3M3YB 1XNRQ 5JVH3 2I46A 2KOLA 1QVFA 4HNTA 2M2LA 4L5RC 1WOCA 2MQHA 1S5DD 4DV6Q 4A3LH 1XXGA 2K03A 3OIPA 4A3KG 3S24A 2WB1A 4J9NA 4JI8H 4HJ7A 2UVUA 3A7LA 4QIWA 3N41B 3S1MB 4NMZA 2UU9Q 2JP1A 1Y8PB 3E0EA 4RWSC 4ZK9B 3E3XA 4JI7H 2R7ZH 2CWPA 1J6QA 3GQBA 3RLFA 4B3TL 4UP8A 4YWKA 5NUCA 4YY3L 1HCZA 3VYTA 1XMQL 4IFDJ 2WDTA 4J9MA 2V9WA 3H09A 1CFMA 4JI6H 3KK7A 3HOVG 1PFSA 3D0FA 4DA2A 2JEGA 1TKWB 5IWAH 3MEFA 5DM63 2W7PA 3IFDA 4UP9A 4H44C 1DV1A 1ENAA 5KYIA 4DV1H 3NBHA 3VPDA 4DNTB 2JN4A 5JVG3 1VCIA 4JI2Q 3UE1A 3U4VA 1LTRD 3Q24A 1EQQA 4JI5Q 1KAAA 4JI3Q 1CKNB 2CHBD 2KHSA 5KG4A 4NPSA 1WJJA 2OQKA 3H0GB 3MFHA 3S1NB 2PZUA 3BA9A 1RJQA 3MTSA 4I55F 4RG1A 4U673 2ZXOA 2XC9A 1YHBA 2WKCA 4HJAA 1N48A 2HIVA 2W57A 3JAMW 4C1NI 4ED6A 2VPSA 3GTLA 2JA7B 4KHPH 1BCPC 1PH5A 1LT3D 1T36A 2F0FA 1ICFB 2B2YA 3S17B 5D3IB 1EYAA 3D4RA 4MIUA 3MWYW 4RNOA 4B3MH 5C4XG 3R5FA 2QKIC 3HKZG 2OT2A 3S9WA 3KJPA 1ESFA 1TWFH 3KXYT 3V4ZA 1B53A 4RZRA 4A3DB 1TS3A 1VQDA 3AQQA 3JSLA 2ZXPA 1XMOL 1W2BA 1WFQA 2VL6A 4PZ6A 3MR2A 3G6YA 4JI1Q 2IX0A 4F88A 4G7ZC 4FYDA 3P7JA 1EOTA 4JYAQ 2VUGA 2R93B 4XXEA 4IRKA 5GROA 2A1AA 2ICIA 1KBLA 1WI5A 2JEFA 1SEBD 1STBA 4O3NA 2QYZA 2RGRA 1VQKA 5J3BA 4JUZA 4JVZA 4BS9A 3ICEA 5JVDF 3Q8QB 4C3HH 2CFMA 1VQ9A 2R7MA 1S72A 4U68A 5IGFA 1VQBA 2MO1A 3M4PA 3OWFA 4HCSA 1DCZA 2X6LA 4IOCA 4OO1H 1JC7A 5E4WC 1SNPA 2KENA 3S1QB 5FO9B 2IMWP 4DR3H 2F4VQ 4IWYA 2GA4B 3S16H 4JI4H 2FINB 5COYA 4DV4Q 2YTXA 4DR4H 1RF2D 1TWAB 2K5WA 4BY1G 3M9OB 1HH2P 4A3IB 4QMGA 1NNXA 1M1KC 2FMAA 4A93H 2BH2A 4XQNA 2JA6H 1WTRA 2KCNA 4DL2A 1WCMB 2ZDGA 4Z9CB 2PZTA 3HRZC 2UUBQ 5J22A 2UXCL 2W6ZA 4HJ5A 5KFLA 1MI2A 4GKKQ 4XT3B 4DNRB 1EFID 5LOVF 2F0WA 1C7YA 4AYBA 3GIMA 2VQEH 1TU2B 1E4EB 1CZWA 2E2DC 3KUPA 2QK4A 2F0NA 1I3QB 4C5AA 3MEHA 3PUVA 5ELNA 4LW1A 4RHRA 1PRTD 3FEWX 1PX2A 2WYOA 2AHOB 5M3MB 3K58A 1E3PA 5CV4A 3STBC 1QUQA 3NWTA 4YR3A 4KKSA 1SAPA 1SYBA 2M00A 2K5DA 1E2WA 3L9AX 2VZAA 3JAMi 4RKBA 1DIKA 1DYQA 3FMCA 5EKIA 2V5AA 4J0MA 5JJLA 3RGXA 4DR5H 2KHIA 1XWEA 3E6ZX 1U0LA 2EDGA 1Y8OB 2VUMB 1KRSA 3EIVA 4A3MB 2A6EC 3NGDA 3T4AC 2E8GA 1HFNA 1IBKH 3IRBA 1JE5A 1BXTA 4C5BA 2XWBB 4TSSA 5G3LD 5M9OA 3BA8A 3TDQA 4TUYF 4F7XA 5LL6X 1PTOB 2NBFA 2IPKD 4BY7G 5JOBA 1RTNA 2EIFA 4DLKA 4CBVA 1SROA 3JZIA 5KFCA 3L7ZC 4L5SA 1G291 1I50H 1TWGH 5ELDA 2A6HC 2EYLA 2A73B 2NZOA 5FO7B 1Z47A 1KC8C 2A69C 1J5EQ 2JYOA 1LTID 3GP7A 4WFN3 1BCPF 1I6HB 1TWFA 4ZAIA 4DV1Q 5KG3A 2VW9A 2I5LX 2NVYB 1KIXA 4DUZH 3K5OA 2L1BA 5K5PA 2D2CC 5CA0F 3HOWG 5FPOA 1NMGA 1KDAA 2W9AA 4AQYH 1GKHA 1B04A 3GIDA 3LX0A 1CKOA 1C4QA 2QCPX 4UAIA 4FF1A 4GKJL 3VPBA 4B08A 1FD7D 4JBKA 4ED7A 3GD7A 5M5WB 1Q3LA 3M4QA 4RHSA 2PN1A 3GDEA 4YCVA 1YJNA 1EY5A 3RV3A 4EYHB 4UCVA 3L3OC 1N34Q 4KHPQ 1IW7D 1N8RC 4NXMH 2WE6A 1V1PA 4B3MQ 1FNWA 2F0LA 4AIMA 4RGNA 2R8GA 3K5LA 4IFDI 2R8KA 3O13A 3N8DA 3HKZA 2FMMA 1VQ6A 2B63B 3MXNA 1HTPA 2BCOA 1HFGA 2WAQB 1CM9A 3GTOH 1IYJB 1YNJC 4KHZA 3RR5A 5KT3A 1ZXTA 3PW4A 1SFOH 2KSWA 4RCOA 5JUMA 3GTQA 3L2PA 1L0YB 4Q43A 3PO2H 1AZQA 2JA6A 2I0QA 2G9HD 5C6AA 5C0XG 4HR7A 4OHJA 1KD1C 3CC4A 4OX9Q 4R8IA 3G71A 1JT8A 3ETHA 1TS5A 1ENCA 3WOEA 1RIPA 5EPJA 3N6XA 1E2ZA 2SCUB 2DY8A 3S2DB 3RAQA 3OTOQ 2ALZA 2Q2UA 2L55A 4Y52H 3GTMH 4X3UA 2W9BA 1O7YA 1VQMA 5C4JB 1TWCH 1MSHA 4NXNQ 4QCLA 1CT1D 1XX8A 3MR6A 4IPCA 1RK6A 4APVA 3CCEA 1S0NA 5CBEE 4GC7A 5KFIA 1F9RA 1YJWA 3BQ0A 2I5MX 1H9SB 1STHA 4WD3A 4C2MB 3VDYA 5GQOA 4GN5A 3OSOA 5ISRA 3J7AV 5C3EB 2EYMA 1MGSA 4B3RL 1IXRA 4JW0A 4DXFA 1QZGA 3MFIA 3QZ8A 1M7JA 2K5HA 2CZGA 1SN8A 1RHPA 2OCEA 2D9UA 5BR8L 2UUAH 2ID0A 4CKBA 2KQ3A 4LFCQ 1STAA 5KT7A 3A8JE 4ECSA 1QCBD 4DK0A 3F2DA 2B2VA 4F8MA 5E3FA 1AH9A 4R8UB 2R92H 5EAYA 4IURA 2YYZA 4PDBA 5KG2A 1PZKD 2YL2A 2RQXA 3JC66 5D1OB 2PW5A 4IUNA 3RB0A 2R6FA 4EQ5A 3A7AB 4R4TA 5DG8A 3JAMc 1ZQ7A 1QVCA 4BBSH 1KTKA 3GTKH 5KNBA 4NB3A 5I2XA 3RB6A 3BDCA 1I50A 4RB2C 1TWGA 4FS2A 1IBLQ 4X64Q 1WTXA 1GSHA 3QOJA 4HIOA 2HUGA 1SNCA 2Y0SA 4DR6H 1JB7A 3LP8A 1N33L 4TKOB 2O2LD 4ZRZA 4DV0H 1S03G 5IY0A 4A3GG 4IPDA 4FXGC 3KHLA 3TQ1A 3BU2A 2R86A 4A3KB 2LS01 3RZDB 4Q44A 5C44G 1X3EA 4GNXC 1BF4A 1IBKQ 4RH6A 5D1PA 3JRXA 3KALA 1STNA 1SCUB 4TQRA 1N32H 3OW7A 1VQPA 2AGOA 2C35B 4RKLA 4LAAA 1HNZL 2O5JC 5EJWA 4WORA 3IKJA 1CSQA 2OLSA 3TEHB 5ELEA 2RDGA 4RMFA 4LFAL 1VF5C 4Y7NB 3HOVB 1AN7A 2F0VA 5LXTF 2FLPA 3FKIH 4ULLA 3QO2A 1O75A 1YNND 2OQ0A 1X65A 1HUMA 4NP5A 5I2YA 1Q86C 4DV2L 2ASDA 2F52A 1HPCA 3QIAA 2JA5G 2VPQA 2NTSA 5J2UF 1IKLA 1CI3M 2F0SA 1VQFA 1XPOA 4LFBL 5DG7A 5KFOA 1R9TH 1QVGA 2WACA 1LT6D 4A3JG 4FBTA 5DAUA 4RU9A 4CHTB 1KHIA 4WJWA 3GIPA 4HN7A 4KD3A 2GPSA 2AGQA 1XNRL 4FU0A 3BYYB 3LGJA 2MCTA 4DV6L 4LUOA 4DUZQ 2CWAA 3URYA 3HOZB 3KAJA 1EY0A 1EQVA 3PIOA 3GTOA 4OWTB 1U5KA 3WNZA 4K0KH 4KMUC 2UXBH 2UU9L 2L5TA 5KFVA 1SFOA 4ZCKA 2RDJA 4DKAC 3QOLA 4DR7H 4AQYQ 4M7EA 3J80E 4O3PA 1TAEA 2OF1A 2ES2A 2XCLA 3DHQA 3A8KE 3H0GH 5KGUA 2HVQA 4UCOA 4OL7A 5LMNH 3S1NH 4ED3A 4ZHQF 3I90A 4IFDH 2DJGC 4J1MA 5C4XB 1XNQQ 1Q1EA 2D5DA 5K36G 5KT6A 3J80L 4MV4A 3ZYYX 1OO9B 3BG3A 1Q12A 4ZUJA 3TP8A 3GTMA 2UVWA 3WWVA 2WB1E 4TV9F 1TWCA 1SLJA 4NXMQ 2JA7H 4QIWE 4K2KA 2BQUA 4JI2L 3U9OA 3T56B 4JI5L 5FLMG 4JI3L 3AMUA 1KEEA 5EGTA 3X3NA 1RYSA 3PIP3 1E0BA 3J81E 2VB2X 2AQ1B 4A3DH 3M9BA 3BVGA 5FD6A 3RAXA 2ASLA 3E9IA 4I7HA 1A3VA 4CDEC 4KJOA 5KX5F 5DLFA 4X62H 2R8HA 2KJXA 2NN6I 4DR1Q 3VYUA 5M5XB 4JC0A 4N8FA 2JEJA 2RDHA 4UCUA 2R92A 5AJ3Q 3DEPA 2BQRA 3NTKA 2EOTA 3SE0A 5BMVF 2WB1G 2GVBA 2EQSA 1NJIC 4HMIA 5DQHA 2E76C 1KRTA 1BKBA 2ZJTA 1EQRA 3GTKA 4JI1L 4GNXA 2HJWA 5CR3A 5KFDA 4BY1B 2MUYA 4JYAL 1SR3A 1AE3A 1ICWA 2Z6KC 1ZHQA 3AU7A 1RJRA 4GLAC 2F03A 1J8IA 3TBIB 3CMAA 1I94H 4FXKC 2RCFA 5KFJA 2G5DA 3ER0A 2EY6A 4RFBA 1EUCB 2XCAA 2ZM6H 5C5MA 2E2IH 2ZJPA 3OHBA 1R4QB 3ONAB 4ETSA 4C1NK 5ELOA 3I3CA 2K14A 3IN5A 1JXLA 2MNAA 3HFZB 3ORRA 1Y8NB 4UFZA 4E4TA 2Q2TA 4C3JH 3B6YA 4O2BF 3K3VA 4JG2A 3W1BA 2RF4A 4ED0A 4GOPA 1Q7YC 2F4VL 2NWGA 5H1SE 3WO0A 5EDWA 2RHQB 3FKIA 5KNCA 1I3QH 2NUAB 1IZ6A 2K33A 4DV4L 4J9SA 3KBGA 3TP6A 2FPGB 1Q46A 1DV2A 1MIUA 1B50A 2FKLA 2XVSA 5JAVA 3TQTA 3V2TA 2R87A 1KDBA 5M3MH 1WSCA 3EVQA 3KAKA 4Q0YA 3TQYA 1W93A 1R9TA 3BAAA 3RBEA 4RNNA 4C56C 1WVLA 4YR2A 4DV5H 2NVXB 5IP9H 2FK2A 3R93A 2UUBL 4XYMB 5EPLA 2XGTA 4DAYA 2JA8G 4GKKL 5IYDH 3CXCA 1EUDB 1B7YB 4ECVA 2F0JA 3KF8B 2YZMA 4O4HF 2YYAA 1EY6A 4LF9Q 5I47A 2R8IA 1EL0A 1KC7A 2W9CA 4QF4A 4O3RA 2UXDH 1I6VC 4ABNA 1F2ZA 1HNXQ 2RSNA 3VMMA 2W70A 4X65H 4JV5Q 4A3EH 1Y1WH 3NTHA 1AFPA 1D8LA 3PF4A 3WOFA 4ECQA 4LF5H 3I73A 3TS0A 4MV9A 5C4ZA 4JV0A 3SXHA 2FHTA 3CPWA 1A9XA 3L4KA 1JDBB 1EYZA 2K32A 3HOWB 2IX3A 4LK1C 2KCCA 4NDXA 1X55A 1PTOC 3A54A 2Z4IA 3F8TA 3NXWA 4FNFA 4V0BA 2FPIB 1Q90A 3HOUH 1L1OA 3QB3A 4O0AA 3S2HB 5CMDA 2VOBA 4K0KQ 4XZ3B 4CDDC 1HZBA 3IG0A 4Q45A 4A76A 5ELFA 4DR7Q 4XT1B 4WJ3M 3RUPA 2WKDA 4P75A 4K5XA 1CA6A 3HOXH 1K73C 3CQZB 3PUZA 1PFMA 4UCRA 4IRDA 1SE8A 1T9HA 5GAHC 1PH4A 3I4NG 3EPIA 2Z6KA 3PO3G 4OEMB 1V43A 1J5EL 1QWYA 1EFWA 4QW9A 2PZWA 1RCVD 4A3LG 5IGEA 4LSAA 4R8NA 4AYBG 3J81j 5LP6F 2V4DA 4DV1L 4DV3Q 5FD5A 5KFEA 4DUYH 3S1RB 1EHIA 4JOIC 3A74A 3TSSA 2EPBA 1VMPA 3RBDA 2NN6H 5IGCA 1G6PA 2YU9H 1EZ1A 2YS6A 1BO0A 5LHY1 3DMUA 5HBRB 4IWXA 4LH6A 3KDFA 2DLNA 5KFZA 2FK3A 4QJFA 1M0TA 3QG1A 4BBRH 3PVXA 2E2IA 1B6SA 1V9PA 4X62Q 2GLTA 3TIGA 3Q2OA 1FGUA 1I4HA 2KECA 2WINB 4ZUIA 1EY8A 1LABA 1N34L 4KHPL 3ERSX 3ITPA 4K6DA 2ASBA 3MFYA 2PCFB 4P73A 2KBNA 4B3ML 4KD4A 4FVMA 1HZAA 2PO4A 4P72A 1Q8IA 4I50F 2XCPA 2FLLA 4ME6A 1MBYA 1CHPD 4ZQIA 4B3SQ 3K7AH 3H4BA 1OXUA 3HOYH 1LTLA 2AMCB 1D2BA 4ECUA 4HEDA 2PQAB 4PV1C 1VQIA 4JPBW 3TZUA 1S40A 3RZOB 4J9OA 2BDNA 1U4PA 2KHJA 3EN2A 1WTQA 3KHGA 4ZYSA 2QW7A 5IT9c 3CD6A 3I4MG 5A2QE 1Q1BA 3FHWA 3ETJA 1I94Q 4OX9L 1HTLD 3RLOA 2LMCB 5DG9A 1X3QA 2P5ZX 2Q8RE 2ZM6Q 2C22A 3CCJA 1TT2A 4X66Q 1N36H 4YHHH 2CH4W 1FNUA 1SNMA 4CKEA 5E4XA 4RNMA 1IYUA 3M4YA 1YIJA 3HKZE 5A2QL 4LF6H 3OTOL 3MZ5A 2CQYA 3SEBA 3V6HA 1GO3E 2JQOA 5FLXc 4MA0A 4EGJA 4NXNL 1S0OA 2QGQA 3NQIA 1D1IA 2NVQB 2XIGA 1QG7A 3D8GA 4JBWA 2EJMA 3OUZA 1TQOA 3CCMA 4NW2A 1EY7A 5JPMC 4DGZA 2IW3A 3OOCA 4HIKA 5M5YB 1UC9A 4WBNF 1TY0A 1IBMQ 3M4IA 1Y1WA 4XTCS 4C3HG 1B1ZA 2B2TA 5LMUQ 4L63B 3D3RA 5C44B 4IJHA 4RUCA 2PNRC 3NENA 1GD7A 2BR0A 4LFCL 1HUNA 3IFTA 4I4TF 3T1YH 4DV5Q 1KJIA 5F2DA 1E7ZA 1SYFA 1ET9A 1VQLA 4R7RA 5KG6A 2VY3A 1B2TA 3GV6A 1RKNA 4IZ8A 1GGOA 1PTOF 2BQ3A 3BQ1A 3ULLA 2AKWB 4WRDA 5IYZF 2UXDQ 3C46A 4JOIA 3SGIA 4FO2A 5IGDA 2W6OA 4A93G 2JEIA 1SXTA 2JA5B 2VQFH 3HKSA 1IBLL 2JA6G 4X64L 2I87A 4JI0H 1KLUD 4UY8C 2UUCH 4A2BA 3S14B 4DR2L 1BCPD 2QF7A 1EUJA 2F0PA 4I65A 3D4DA 3K7UC 1GM5A 3NTIA 4B9WA 2K1BA 2B2WC 2ZDHA 2IWHA 1IBKL 1UEAB 2SNMA 2F4IA 3MHBA 2QEXA 3Q0AA 2YU9A 1HZCA 4B3TH 4G7OC 4YY3H 3UI2A 2HDLA 1T5XD 1V1OA 1GVPA 3K5HA 3HOZH 1B33N 3U58A 4DL7A 4E6IA 4BXXH 1VBGA 2R8JA 1VQAA 1ILQA 4CC5A 2HHHQ 4KV6A 1VBHA 2DZDA 3CP0A 3GIQA 3RB4A 3BYTB 5BN5A 3J7AK 5EZYF 2PMZB 3MFGA 4QB4A 5DQGA 1EYGA 2Z4HA 2HIXA 5JJIA 2AGPA 4LSXA 3PUXA 3P75A 1PHJA 1RK5A 4R9WA 1PYSB 3GTPB 4K8IA 1S5BD 4JBJA 3H4DA 1X3GA 2FP4B 1JOQA 4AQYL 1SYXB 3I12A 2R7ZA 1CQVA 2C9OA 2Y0SG 3RN2A 4YBZB 5M3FB 3JAME 1X3FA 1Y1VH 3MWDA 2HVRA 4BWSC 4YQWA 4A3FH 4LF8Q 4HMJA 1XNQL 2WB1B 1I4PA 1L2ZA 1BBWA 3MXUA 4QIWB 3JAML 2YV5A 2HQEA 4P71A 4DAPA 4GLVB 1K83B 1DGSA 4R4OA 3RTXA 2W6QA 4R8UA 1YVCA 1A6XA 4EFEA 3T5JA 3U9TA 1CQFA 3SVMA 5GAGC 5KT5A 4MTDA 4JI8Q 4DPGA 3J7ZC 1RODA 5EOYA 2AWNA 3BVMA 3CCLA 3WO1A 1D6EC 3RF2A 2E2HH 1BQQT 1PYBA 1I7LA 3E5NA 4MTEA 3STBD 4JI7Q 3N40P 3NBHB 1STYA 3R5XA 3PF5A 1ASYA 3CW2C 4JI6Q 4DR1L 3HXLA 1YBYA 1X9NA 4ID6A 3ULJA 5IWAQ 1N36Q 5AJ3L 1GUSA 2A6ED 3OMGA 1T3NA 1PMRA 3BDLA 1KAWA 2VNUD 4DL3A 2NB0A 1VQNA 4R4QA 2NZHA 3HEJA 3VR2A 3CC2A 2NU8B 5C1PA 2B2WA 4XDXA 2BH8A 3PO2G 1A0IA 4KHVA 5CV7A 1Z6HA 1A8VA 1JLLB 3MR5A 5EBCA 2Z8LA 4KN4C 5LMNW 1EY4A 5IP7H 1X3PA 1NY4A 2W71A 1A63A 1O7IA 2IJ0A 3SK6A 2PNHA 2UXCH 1AUXA 2A6HD 4KKTA 1BBXC 5KT4A 2Q2IA 1JWMD 4BA1I 1LTSD 2A69D 4GN3B 4KN7C 2JA8B 5H80A 1NE3A 2E75C 1UEBA 4XIGS 4EG0A 3GV3A 5BPHA 2QEJC 5IIFA 1WTPA 3LWBA 4ECTA 2E2JH 1B4OA 2R84A 3M4OB 2A74C 1K0SA 4CJ1B 3TRZA 2FJ2A 4MV7A 2EYFA 1EY9A 3ND9A 5KFSA 5IYBH 3GTJH 2DWCA 3KHHA 3J7A5 3VR3A 2YZGA 4QW8A 2VQFQ 2DN8A 4CDFC 3CPFA 1H9KA 4CGYB 1CSPA 4EQOA 1C8CA 1C30A 2B2UC 2DIKA 5T14A 2L11A 2R92G 5CV9A 2EZVA 1HR0W 1Z2OX 3A5UA 3EBEA 4IO9A 4N8X1 4J8QA 1WD1A 1RJTA 4A4IA 4RGOS 4BBSG 3CAMA 4ME5A 2QA4A 4RGTA 4HSVA 2D0OA 1LUZA 4UPAA 4LF9L 4GZYC 3CKIB 1PH7A 1SYCA 4DR3Q 1YNJD 1HNXL 2FXQA 3I4NB 3JRWA 3RV4A 4APMA 1Y1VA 3S2HH 3EQLC 1EWIA 1HJPA 4XYOA 4JI4Q 4RB3C 3E0JA 4JV5L 5KFKA 1ZHSA 4YAJB 5K2MA 4DR4Q 1A3TA 2B29A 4BA2I 4DXGA 2HVSA 4UCSA 5KG1A 1I4XA 1U4RA 1K3RA 5DNFA 1EIGA 2I8CA 2R85A 3CCVA 1SNDA 5JVLA 1EEFD 1VKZA 2K7VA 2EE1A 2XSCA 1VQHA 1X32A 3KOJA 3TZDA 4DF7A 3JSNA 3R23A 1QUQB 3A55A 2VQEQ 4FF4A 3GTGH 4HQ6A 3W2DA 2SEBD 3LMLA 2EJFC 3FKIG 2AUKA 4G4KA 5IE8A 3G6VA 3J80W 4PZ7A 1K3BC 2K5NA 3NK9A 4OGQC 1T5EA 2LXJA 2E2HA 1G51A 1VQOA 4DR7L 2MGSA 3NUCA 1VQ4A 1DJRD 1ZEQX 1PK8A 4KJNA 1C48A 4EQNA 1RDPD 1GHJA 2RDFA 3OMCA 5DEHA 5IGGA 5L9XA 5DQIA 4C3IH 4HNUA 4OWXB 5KG5A 4DR5Q 1I7NA 3FMAA 2W6NA 5KFUA 1BVSA 1VQEA 5BN3A 1K8GA 1I4QA 2CH4A 3F2UA 4A3BG 1E1OA 3Q6SA 4DV3L 1XDNA 4KTAA 2NTTA 4YIJA 1KNAA 4Q8FA 3J81W 1KXLA 4MAMA 1YNXA 3M3YH 4EBCA 3MWMA 4H0LC 1PA6A 4POGA 4ZI7F 2DY7A 5CGKA 1BOSA 4HTHA 3I4MB 4IFDG 1PH6A 3S1MH 1TWFB 3NE5B 2V4QA 2ZTCA 3OIQA 3RZOH 3KF6A 2H4OA 3UFXB 3CMEA 5EWEA 3DM3A 2RKSA 1S5FD 4X62L 2CW0C 1G6ZA 2QDLA 5FK9C 5E7NA 4EQPA 1HNWL 2PMZE 5IT9W 2B2UA 2C5CA 2NVTB 2YZNA 2EY1A 4F4WA 3BVZA 1EU4A 2DNCA 5CV6A 3I56A 3I4LA 4A3DG 1PRTB 4B3SL 1L0XB 2K75A 2LY7A 4X3KA 3T16A 5KKNB 2N8NA 1XPUA 3GTJA 1B3QA 3ND8A 3SE7A 4B3RH 3R8BA 1K0RA 4C3HB 1CZGA 1XPRA 5D3DA 5DGBA 2MHVA 5C1OA 3UDFA 4A3CH 3ZJYC 5FLXW 5BR8H 4MN3A 1H9MA 1S5CD 5D8DA 4N9PA 3RB3A 2ASJA 2YTVA 1PFBA 2RVLA 5IYCH 2K28A 1V1PB 1VQCA 4ED8A 2RGVA 1I94L 3HKZB 2ZM6L 4X66L 2MPMA 3KLSX 3MXNB 2PVPA 4O2AF 3S16B 2WTFA 2UVRA 4DK3C 1SSOA 5HY6A 2MP1A 4IUUA 2FE3A 2NYZD 1BUVT 3GTQB 4F4ZA 2BA1A 4LWCA 5F9LA 4XYQA 5FOBB 3I7FA 3S17H 4A93B 4CC6A 4PNYA 2ALYB 1M6VA 4LF4H 2CQAA 2JA6B 1KDCA 3PW5A 4HR7B 3N42B 3H3VI 4IZOA 1B9MA 1JE4A 1N33H 4KKUA 5IOCA 1IBML 2EYOA 5CBAE 2KVMA 4GS3A 3KYHC 3NSWA 3NWSA 2NUCA 4RAUC 1D1KA 4ECXA 2J6TA 1QILA 2EYHA 5LMUL 2R93H 3HS0C 2W9BB 5HGQA 3K5MA 1XTDA 4L5QA 2CKZB 3BZDB 3RMHA 4DV5L 4C3JG 4HCEA 3PIPA 1HNZH 3GTGA 3E9HA 1C3OA 2KEDA 2NU7B 1HR0H 1TA8A 4LNQA 2JJQA 4O3QA 1EIFA 2YTYA 4LFAH 3L0OA 2XD4A 5J39A 3U50C 1O7ZA 5HURA 1G91A 4PG3A 4YJ2F 2VA2A 2UXDL 3D4WA 3OYYA 1YJ9A 4M1UB 2NU9B 1PDQA 4LFBH 3S1QH 4ILWA 1PV4A 4PQXA 2B39A 3OPOA 5IP9G 3Q23A 2I07B 1CKMA 1YEZA 1ZYRC 3RUZA 1XNRH 1S68A 3KLWA 4N9TA 4X6AH 1QB5D 1GUOA 5IYDG 3OSNA 1TWAH 3C2PA 4LUVA 5L1JA 4MV3A 2UUAQ 1LT4D 3VA7A 4A3IH 2GPWA 4EYIB 2K52A 3T13A 3P1HA 1SYGA 5LA6F 2ZDQA 2E74C 5J1ZA 2UU9H 5KFNA 1I50B 4V190 4IALA 1TWGB 1EIYB 4YAKB 1WCMH 2JE6I 1JKJB 5KFBA 1VQ7A 3PCOB 2Y0SB 1NR4A 1VS0A 3K81C 5CA1F 4A3EG 4EGQA 1Y1WG 2BE5C 4HIDA 1VAJA 1MHWC 3GTPH 4DL6A 3AFPA 3T1HH 2L15A 1SMYC 1B9NA 2VB3X 2HHHL 3QWNA 2VA3A 4DR6Q 1ZYRD 4X3TA 4O42A 3IAYA 1STEA 2XRQD 5M3FH 4LH7A 4DV0Q 3A8IE 4JI2H 3SR1A 4H7BA 1GYFA 4B9XA 3HOUG 1A3UA 2R7DA 5KFPA 4JI3H 2IX1A 3EPGA 3CCUA 3DWAA 2HD3A 4BY7B 1EEID 3VR5A 1BNZA 2QILA 3VA5A 1KL9A 2VUMH 4A3MH 4OXPA 2Z6BA 4LUZA 1ILPA 1K83H 1N32Q 1OXSC 4ZQ3A 3HOXG 4DL5A 1GUWA 3NEMA 2FJZA 1LT5D 5LYJF 1CKNA 2ZT9C 1YZ6A 1CS0A 3H0GA 3V6JA 1PTOH 2FMCA 3GLKA 5HV6A 5KRUA 1FJGH 3K5IA 3TS2A 3OHXC 1U4LA 1AP0A 2A8VA 4MZ9A 2FB9A 2Q8IB 1YHQA 2QDBA 4LF8L 4Q0FA 2D0PA 1S0MA 3GTOB 2WFWA 5L37A 2JA7A 4AYBE 3D31A 1SFOB 3OUUA 4ECRA 4JI1H 4A75A 1CK1A 3U4ZA 1ML0D 3T5HA 1GUTA 5JJKA 2K50A 3PO2B 4JYAH 5TSSA 1K1SA 2V59A 1I6HH 4UDUC 1F2MA 4JI8L 3SK8A 4EFBA 4DNIA 5JEAH 2UXBQ 2NVYH 4BBRG 1JB3A 4L1KA 4RGMA 3QFFA 2R93A 3GTMB 2OTLA 4JI7L 5KG7A 4ME3A 3WDNA 1TWCB 3DWQA 5C0XJ 2F0TA 4DK6C 5LMNQ 3RLNA 4JK1C 2BDOA 4JI6L 5IWAL 1N36L 5M5WH 1WD0A 3H3VH 1NCVA 3J80c 3HOYG 4IUVA 3A0JA 3VR6A 1VMCA 2F4VH 3TINA 1PTOD 3G7LA 4K14A 1WTVA 2L0CA 1QNUA 1Z2PX 3NPPA 3TP7A 2R7ZG 4OWWB 4ALPA 4LF4Q 3DLLA 1Q81C 3FDSA 1EZ6A 1JOKA 3BG5A 1N33Q 2R7FA 2B63H 2R92B 1F9PA 1D7QA 2MO0A 3H3VC 4O1NA 4TVAB 5GAEC 4R4CA 1I4RA 4JCVE 4JV2A 3VYRA 3DXJC 3A56A 4XQJA 5FKAC 4QY7A 3GIKA 5CB4F 1TWAA 1JJCB 1PH9A 3QZ7A 1DM0B 4DV7H 4BBSB 4MV1A 4LF7H 3J81c 5EQ0A 4C5CA 4GNXB 1QZHA 1WCMA 3PGZA 3LNNA 1GUGA 1VQ5A 1HR0Q 2N88A 1E2VA 1K8MA 1F2LA 1ULZA 1E22A 3F8NA 3MR3A 5BN4A 1G2TA 3S2DH 1E4EA 4ECZA 2WIIB 2SOBA 5KFQA 1X6OA 1I3QA 3TP5A 5C4JH 4QUCA 3W5OA 1HQRD 4OONA 4RA8A 4IN3A 5JQWA 4EGVA 2VQFL 3K0XA 3CCQA 5JH7F 1HZ9A 2ZJQA 2YRWA 3H6MA 1TR5A 2IP4A 1TWHB 1M4VA 2VS1A 1M0WA 1S4ZA 4C2MH 1O78A 3CC7A 1GSAA 1GXDC 4EX5A 5C3EH 2R61A 1XTCD 1TVXA 4K5VA 4LMQD 3VR4A 3AB9A 2XGQA 3N52A 4GOPB 3MVVA 3CF5A 3FP9A 5FO8B 2E5LH 3D6WA 2VUMA 3FKIB 4YR0A 1SJED 2YS7A 3HP3A 3DF7A 1GJXA 2CW8A 1K83A 1R4PB 3F1ZA 1CQIB 3ERQA 5FJ8H 1QJOA 5KFWA 3DEOA 3T53B 1JR0D 5A35A 1R9TB 1LACA 1JDEA 2ZXRA 4DR3L 3CRLC 2EY5A 2KUMA 3J7AF 3T1HQ 4JI4L 1J5EH 5I9PA 1KABA 5EWFA 4A3GB 1QOHA 2F0UA 4PMWA 3TREA 4JBMA 4DR4L 1PXUA 2L9HA 4QWEA 4DAYB 1EYCA 5E1FA 1FL0A 2OWOA 4A3BB 3TMEA 4JV1A 1W96A 1V4YA 2W9CB 3SK4A 4KY7A 1LM0A 4OO1G 3FPUB 2GN5A 4LMYA 1UNNC 1FGBD 3PUWA 1SE4A 2F0OA 3NBIA 2VQEL 2YCHA 2CCZA 3HOZG 3X3MA 4A3KH 4BXXG 3RZDH 2RDIA 2NVYA 1DOLA 3PW7A 2EXDA 3UQ8A 1Q82C 1BBUA 4J15A 2C2EA 3FRPB 4J9KA 3NQTA 2F0IA 4P2CB 3TIIA 1N34H 4HSPA 5CV8A 2I80A 4ZOLF 2K5QA 4GLXA 4X65Q 1VF7A 1FJGQ 4A3JB 3I4MH 1GHKA 1K1QA 3V4SA 2PI2A 3W1GA 3AEVA 3KHRA 3K6OA 3ULPA 2ZTDA 4Y7NH 3HOVH 1HXYD 3R2IA 3HB9A 3K0YA 1L1OB 4P74A 4DR5L 3I91A 4LF5Q 2YW2A 1SBBB 3F2CA 2R7NA 1B44D 2V58A 4FS1A 3I8ZA 5L1LA 2B3GA 1BR9A 1F2YA 2FPPB 1CQJB 2F3VA 3I70A 1UAPA 1SRUA 2F0EA 2H5XA 5C5LA 2J4XA 2RCNA 5DLGA 2KEEA 1Y1VG 3BJUA 5BPFA 1EOVA 3SHLA 2NVTH 1JX4A 1XMQH 1STGA 2B63A 4RUAA 2Y0SE 4OX9H 3OWEB 3D6CA 4A3FG 3PR4A 2WAQA 2PQEA 2MJ8A 4ECWA 1FNVA 1XYIA 4QWCA 2X6GA 3NP8A 2Z0SA 1L2FA 4CDCC 2PW7A 5CYUA 2F1MA 5J2TF 5KEEA 1HRJA 2KA7A 3OTOH 1OXTA 3G8CA 1G8ZD 3CCRA 3L4JA 1KJJA 4NXNH 4H13C 1ZKOA 2K04A 1Z7TA 2K5VA 3QR8A 4CKCA 2Z1CA 1NTGA 4O2DA 4ZKBB 5C4XH 1PRTC 2FK1A 1F77A 1AUVA 3T5KA 3KDFB 4DUYQ 1EIHA 4DUZL 4YB8B 4YCUA 1KJQA 1TY2A 2E2IB 1CTMA 2L12A 3GTQH 1KLGD 1KQSA 2W6PA 3V05A 1C9OA 3N43B 3CU7A 3M9MB 1K28A 1MZBA 3RIZA 5CAEB 4LFCH 1H95A 1JWSD 1H9SA 1O80A 4DL4A 4C2MA 1M8AA 1LTBD 1EYDA 4F4YA 1BDOA 4XQQA 4C3JB 1L0WA 5LL6b 1SE2A 1D5XC 4DV7Q 4DAMA 3H91A 4K8JA 3GIIA 4IUPA 4HIMA 3CVZA 4HJ8A 4LF7Q 3G6JB 1XMOH 2C28A 5M5XH 3CRKC 4NXML 3H20A 2MFIA 4EVOA 3K3PA 3GIJA 4RZQA 5C0XI 5IP7G 1IBLH 4X64H 3G6EA 5JEAJ 4MV8A 4WJ4A 2F0GA 3HBLA 3U9SA 2Q2HA 4KLKA 3GQCA 5D1OA 5KFXA 1IHZA 4DAVA 2OXPA 4K5WA 3Q8RB 2XTIA 1F9QA 1PZID 4DR2H 3KTMA 1JWUD 3BZCA 4FDBA 4POFA 3BJYA 1B6RA 3ORQA 4BY1H 2O5IC 3PW0A 1U9RA 2R7LA 1A2UA 1Z9FA 1ONLA 2BOSA 4U6PA 2J0TD 2A5HA 1PH8A 4YHHQ 1X56A 2JEAI 4YP3A 1Q8KA 1PLFA 2E5LQ 2GVAA 3K57A 4A3EB 4LF6Q 5IYBG 3UDIA 3BDOA 1Y1WB 4QQBX 3G6XA 2B8FA 1W6KA 4QUFA 2VR1A 4IAJA 2AWOA 2DPJA 1IKMA 3NELA 2EXZA 2ATWA 4FBUA 5EBDA 1V1QA 3GTLB 1IL8A 2DUDA 2EVBA 2B2VC 5I9OA 1VQ8A 3S15B 5ELBA 3PZPA 3BQ2A 5DM73 2BA0A 1T94A 1IW7C 4DN4M 4EEYA 1SNOA 3HOUB 4PZ8A 4L8JA 1LLRD 1AW7A 3FPPA 4F87A 1HHVA 2N78A 4K6LA 5CORA 2HGSA 2XRSD 4FP5D 2UUAL 1S3OA 4IOAA 1AN8A 1PYWD 3T1YQ 3MWEA 2O4XA 2C00A 2W7OA 3HOXB 1S97A 3FVQA 3BZKA 3C0FB 3KBXA 2IHEA 1WTOA 1H9RA 2NVXH 3H40A 1NUCA 2NU6B 4EEQA 2AU0A 3I2ZA 4KI0A 1S5ED 3C1EA 1JIHA 1JMCA 4BY7H 1I4GA 1LYLA 3R3OA 1K8OA 2FLNA 3C1FA 2LKVA 1XNQH 1BXRA 2IBKA 1RD9D 4YCWA 3MAQA 1JORA 2LFNA 1UWVA 1CUKA 3H94A 4XYLB 4JI0Q 4DR6L 1GSOA 1F9SA 1D5MC 4I7ZC 3PMFA 2UUCQ 2JEBI 5KFTA 4DV0L 4KK7A 1K8AC 2YU9B 4G57A 3E5SA 5L1KA 1WTHA 4G7HC 2F0MA 4GN4B 1VQGA 3Q1KA 1DOKA 1AZPA 2EJGC 2KCMA 2WP8J 4R1JA 1PVOA 2F0DA 5DLQE 1PRTF 4BBRB 4HYKA 4FM9A 4DU9A 2F0KA 4DFAA 5KFFA 3HOWH 1N32L 2PBZA 4J9LA 1WTWA 4B3TQ 4YY3Q 4IPGA 3GV5B 1XMQQ 4DR1H 3FDTA 5CC4A 4C3IG 3PO3B 3MA2B 1UC8A 4UCTA 2CW7A 1H9JA 3K7AB 3PQIA 2VQDA 1UE1A 4AYBB 1CHQD 4YWLA 2R3ZA 3HOYB 1GLVA 4IR1A 1IOWA 1E4FT 4R4IA 3CQZH 4HNVA 1AEXA 4IRCA 4FXDA 2Z9HA 1N56A 1V51A 3M7GA 4YWMA 2VXWA 1SEIA 4RB1A 5GONF 5G3LF 3OHAA 2R7ZB 3KJOA 1SE3A 2K01A 5KFRA 1NBWA 1J9OA 5KFGA 2J7ZA 4GKJH 3HZXA 1JQYD 4PWQA 3CCSA 3LWUA 4K0KL 2UXBL 2IL8A 3S1RH 4J6HA 1M90C 2R6GA 3PSIA 3PUYA 3RFCA 2OEOA 1SMXA 2RBMA 1G2SA 3Q22A 2OH2A 4O3SA 3T51B 4IPHA 3M7NA 4CJ2C 1EQTA 5LMNL 1BCPB 4PMCA 3M85A 5C0XH 3N44B 4J9RA 2AQ3B 2TMPA 2AQ2B 4RAZA 2J6UA 2N3SA 3VPCA 4LJZC 5I6WA 2JXMB 1XMOQ 5JPNC 4O4LF 4NLGA 4KY5A 1E4GT 1LV9A 2FFKB 3P20A 1FR3A 1CE8A 1KNEA 5D14A 3F2BA 4A3CG 1LTGD 3QJYA 1AE2A 1LTAD 1PH1A 1JICA 4LF4L 2G9DA 1YNNC 5IYCG 3H0GG 1GOZA 1P8LA 1VDZA 4XX0B 2EY2A 4NKLA 4Y8VB 3DWPA 3OW2A 5D65A 4DR2Q 5C4HA 1A62A 2DJFC 3RGZA 3V6KA 4ODGA 4ZKCB 1UE7A 4MTKA 1IOVA 2XGPA 5KFHA 4J9QA 1XJVA 3PR5B 2NZ1D 3SK5A 2JA7G 5KFYA 5EWGA 2F3WA 2OTJA 1UE5A 1LO5D 4PMBA 2JA9A 4TV8F 4ECYA 1TWHH 3PW2A 4LF9H 3HGBA 3NHHA 1ENFA 2Q8TA 1RJPA 2NVXA 3MXPA 4TQSA 2A68C 1HNXH 4YJ3F 1HR0L 2N55A 1V8QA 1W6JA 2I5HA 3T5LA 1SDFA 1YI2A 3GV8B 4JV5H 2J9GA 3KF8A 1B3AA 4OIKA 3PIO3 3GV7B 2R93G 1WR2A 1RTOA 1PH2A 4F50A 2K05A 2J6SA 1ESRA 2NVQH 2R82A 1MJCA 2O03A 4IUTA 5M5YH 2UXCQ 5EKLA 1Z2NX 2CW0D 4IUQA 4GOPC 4A3GH 5JJZA 1JJGA 1HQMC 1GUNA 2RHSB 5EPKA 4A3BH 5C44H 3EFXD 2K6AA 2A68D 3I55A 5IGBA 1BNCA 1BGWA 3BS1A 4FF2A 2A19A 2N49A 1TS2A 3UE0A 4GC6A 2M9VA 1PFNA 4UHVA 5CV5A 3J80i 3C3LA 1RL2A 2V4RA 3MC0B 3SDZA 4QL5A 3T1HL 1VQJA 1C0AA 1Y14B 2HQLA 5L1IA 2YRXA 4A3IG 1TXYA 4DV3H 1K9MC 2JA5H 4MNOA 3CQZA 3GO5A 1WCMG 5KNDA 1WYDA 4S3SA 1HA6A 2ATLA 2XNAC 4A3JH 3K5NA 3KFUA 4QGUA 5KFMA 3S14H 5HGTA 4RCNA 2CVRA 1Y1VB 2LSSA 4UP7A 4L6TB 1B70B 4A3FB 5FPRA 1NSNS 1KJ9A 3J81i 3KLRA 1JJ2A 1S10A 3R2TA 4DV2H 4K2LA 2ICEC 2RA4A 5M3MG 2D62A 2EYPA 1W3SA 2W8KA 3J81L 1PZJD 1HA5A 5M3FG 4X3SA 3AYHB 4Q5VA 4X65L 1UUPA 2IY5B 2WV6D 1FJGL 1HNWH 1L1OC 2W8LA 1MKHA 1NAPA 4OIJA 1ZETA 1RYRA 4G3IA 1EZ8A 2ZJRA 5K36H 5IT9E 1MJEA 3I4OA 4LF5L 4O4IF 1Y69U 3TN2A 2VUMG 4DV6H 4B3SH 1P16A 4A3MG 2E2HB 3OSPA 4A2AA 4FF3A 2F0QA 5F9NA 4DK1A 1ET6A 4IHJF 4MV6A 3PV0A 1WH2A 2DNEA 1YHAA 5KG0A 4M8AA 1NMFA 4ED1A 1U4MA 5IT9L 3LWEA 5FLMH 4GKJQ 2HDMA 2C2DA 5T1IA 5FLXE 2LXKA 1KJ8A 1OXXK 4TQUS 4ED2A 1II3A 2PQAA 2PI2E 4HJ9A 1JOOA 1CA5A 4X66H 2HT1A 5KT2A 1EWCA 1ASZA 4HAEA 1I5FA 1DXMA 4QWAA 5ELCA 3Q8PB 2XN9C 4EBEA 1X54A 5FLXL 2X69A 1FKAH 3UDGA 1TWHA 5AFWA 3Q8DA 2W6MA 2IT1A 4QWBA 2B8GA 3DM1A 1NR2A 5DGAA 1OXVA 4JI5H 1SYEA 5EKKA 5C3WA 1JCKB 5JEAG 4M9UA 3A5ZB 4DUYL 1EU3A 1O7LA 4IQZA 3K59A 5T1GA 5GADC 1EWHA 1IBMH 2L4NA 3KF6B 2WAQE 1IYVA 4QWDA 3AFQA 3J7YW 5LMUH 5I4DA 2BE5D 2R7KA 3PN1A 2IHFA 1D5ZC 3EJIA 4MHEA 4Q8EA 2PYKA 3MXGA 2E2JB 3RN5A 1FVIA 1SMYD 3I72A 2HCCA 2F0HA 5IODA 2SDFA 2JSOA 2P0AA 1E24A 1MSGA 2H1EA 4DV7L 4IR9A 1SYDA 3GTJB 1UE6A 3H15A 4LF7L 4CJ0B 3VYSA 2NN6G 3HG9A 2IA6A 3KLSA 2TSSA 4O3OA 1FYCA 3EA6A 3K80C 1PH3A 2B63G 4U7CA 2WAQG 3V96A 2KCTA 4B3RQ 3Q8SB 1OWTA 3RNUA 5A2QW 3CHBD 5BR8Q 3BABA 2JA5A 3GTLH 4MA5A 1UNSA 2AQ4A 3S15H 2DGYA 4IJLA 4MTNA 1IL2A 2ENBA 1DONA 4BWGB 3W3AA 2XWJB 2SNSA 4YHHL 5C5JA 1MD2D 2K4KA 2CQOA 4EBDA 2E5LL 1N9WA 2RSOA 3G4SA 4L5TA 4LF6L 2JA8H 1SNQA 3M9NB 4H02A 2B2TC 1DD2A 2EYJA 1B8AA 1QE6A 5I6YA 3N6RA 4DV4H 3R5HA 5LL6S 2HHHH
chains in the Genus database with same CATH topology
4JI3L 1E1TA 4AH6A 4OO1I 2ZTEA 4A4IA 2V1CC 1YITA 3M4OH 4BBSG 3CAMA 2QA4A 1OXTA 4A3DH 3M9BA 3CCRA 5C3EG 2D0OA 1LUZA 4UPAA 3E9IA 4LF9L 2K5VA 1OTCA 1NTGA 4O2DA 5C4XH 3K8AA 1PH7A 4DR3Q 1HNXL 2FXQA 2NN6I 3UDXA 3KDFB 4DUYQ 4DR1Q 3S2HH 1EWIA 4JC0A 1HJPA 2F3IA 4DUZL 4JI4Q 4JV5L 4YCUA 5FJ8G 3T1YL 5AJ3Q 4DR4Q 3GTQH 2B29A 1HNZQ 1KQSA 4BA2I 2WB1G 2GVBA 2EQSA 1C9OA 1NJIC 1K3RA 4LFAQ 1KRTA 1BKBA 1H95A 1EQRA 2JK8A 4JI1L 3CCVA 4GNXA 4DV2Q 1L0WA 3KOJA 1SR3A 1VQHA 4DV7Q 4JYAL 4DAMA 1AE3A 2Z6KC 1QUQB 3G48A 2VQEQ 3GTGH 4LFBQ 4HIMA 4HJ8A 4LF7Q 4GLAC 4JI0L 3FKIG 3I4NH 1HNWQ 5IE8A 4PZ7A 2K5NA 5M5XH 3CMAA 2UUCL 4NXML 2LXJA 3PO3H 1XNRQ 1G51A 2MFIA 1VQOA 3ER0A 4DR7L 1QVFA 5C0XI 1VQ4A 1WOCA 2MQHA 5IP7G 4DV6Q 2E2IH 3G6EA 4L5RC 5JEAJ 2ZJPA 4A3LH 4WJ4A 4A3KG 3S24A 2Q2HA 4KLKA 4HJ7A 5ELOA 2K14A 2UU9Q 2MNAA 2XTIA 4C3IH 3HFZB 4OWXB 4DR5Q 3E0EA 3BZCA 4FDBA 4POFA 1BVSA 2Q2TA 2R7ZH 2CWPA 1J6QA 4C3JH 1VQEA 3B6YA 3RLFA 1K8GA 4B3TL 4JG2A 3W1BA 2RF4A 4UP8A 1E1OA 4YWKA 4YY3L 4A3BG 4DV3L 4GOPA 1XMQL 1Q7YC 2F4VL 5H1SE 1Z9FA 2RHQB 3HOVG 1PFSA 3D0FA 1I3QH 1IZ6A 4DV4L 1PH8A 1Q46A 3MEFA 4YHHQ 1KXLA 1YNXA 1MIUA 1X56A 4UP9A 2JEAI 3M3YH 1Q8KA 1PA6A 4POGA 2E5LQ 2GVAA 5M3MH 4LF6Q 3TQYA 5IYBG 3UDIA 4IFDG 4QQBX 1VCIA 1PH6A 4JI2Q 3UE1A 3U4VA 3S1MH 2AWOA 2ZTCA 3NELA 1EQQA 5IP9H 4JI5Q 4JI3Q 2UUBL 2ATWA 1CKNB 3KF6A 3RZOH 1V1QA 3CMEA 4NPSA 3DM3A 2DUDA 1WJJA 2OQKA 2XGTA 4X62L 1VQ8A 2JA8G 4GKKL 5IYDH 3CXCA 1B7YB 3KF8B 2BA0A 4RG1A 5E7NA 4LF9Q 1HNWL 2PMZE 1YHBA 4HJAA 4PZ8A 2HIVA 1HNXQ 2N78A 3I56A 4A3DG 1PH5A 2UUAL 4B3SL 1S3OA 2K75A 4IOAA 4JV5Q 2N8NA 3T1YQ 4A3EH 1XPUA 1Y1WH 1K0RA 1XPRA 5C4XG 3HKZG 3BZKA 3KJPA 1D8LA 3UDFA 3PF4A 1TWFH 2IHEA 4A3CH 3TS0A 2NVXH 3ZJYC 3I2ZA 4KI0A 3AQQA 1VQDA 3CPWA 1XMOL 1W2BA 2YTVA 1WFQA 2VL6A 4PZ6A 5IYCH 1JMCA 4JI1Q 2IX0A 1VQCA 4BY7H 1LYLA 1I94L 4JYAQ 1X55A 3F8TA 2ZM6L 4YCWA 4X66L 3MXNB 3HOUH 1L1OA 4O0AA 5GROA 2A1AA 1UWVA 1CUKA 1WI5A 4JI0Q 4DR6L 4DK3C 4K0KQ 5HY6A 1HZBA 2JEBI 2UUCQ 4A76A 1VQKA 4DV0L 2BA1A 5J3BA 4DR7Q 4LWCA 1K8AC 4WJ3M 3S17H 3I7FA 4P75A 3ICEA 2ALYB 2CFMA 4C3HH 3HOXH 4GN4B 1K73C 3PUZA 1VQGA 1VQ9A 1S72A 1SE8A 1T9HA 5GAHC 1PH4A 3I4NG 1VQBA 2KCMA 2WP8J 2Z6KA 2MO1A 3M4PA 3H3VI 4R1JA 3PO3G 1PVOA 1V43A 5DLQE 4IOCA 1J5EL 1EFWA 1IBML 4A3LG 4GS3A 3HOWH 3KYHC 1N32L 2KENA 4B3TQ 4AYBG 4YY3Q 4IPGA 3J81j 5LMUL 4DV1L 4DV3Q 1XMQQ 2R93H 2F4VQ 5HGQA 1XTDA 4L5QA 2CKZB 3S16H 4JOIC 3A74A 4DV4Q 2YTXA 4DV5L 4BY1G 3PIPA 1HH2P 1G6PA 1UE1A 3E9HA 4YWLA 1M1KC 2YU9H 4LNQA 4A93H 2BH2A 2JJQA 1EIFA 3CQZH 2YTYA 4R4IA 2JA6H 3L0OA 3KDFA 4YWMA 3U50C 4QJFA 4PG3A 2UUBQ 3KJOA 2UXCL 4BBRH 2UXDL 3OYYA 4HJ5A 1V9PA 1YJ9A 4X62Q 4GKKQ 1FGUA 1C7YA 1N34L 1NBWA 3S1QH 4KHPL 1PV4A 3ERSX 3CCSA 2ASBA 5ELNA 3PUVA 4K0KL 2UXBL 4LW1A 5IP9G 3S1RH 1CKMA 1YEZA 4P73A 2KBNA 3KLWA 1M90C 2AHOB 2R6GA 1HZAA 4P72A 4B3ML 3PSIA 3PUYA 4X6AH 5IYDG 1SMXA 1TWAH 1E3PA 4LUVA 3STBC 2UUAQ 3K7AH 1QUQA 4A3IH 4B3SQ 2K52A 1OXUA 3HOYH 1LTLA 2AMCB 3M7NA 4IPHA 5LMNL 3M85A 2PQAB 1S40A 1VQIA 2VZAA 3JAMi 1EIYB 1WCMH 2JE6I 4BY1H 5JJLA 1VQ7A 2KHIA 3PCOB 2KHJA 2N3SA 1U0LA 3EN2A 1VS0A 3CD6A 5IT9c 3K81C 1KRSA 3EIVA 1XMOQ 2VUMH 4A3EG 3I4MG 2E8GA 1Q1BA 3FHWA 1Y1WG 4HIDA 3IRBA 1I94Q 3GTPH 4OX9L 1JE5A 3AFPA 3RLOA 3F2BA 4A3CG 2ZM6Q 2L15A 3CCJA 4X66Q 1AE2A 1PH1A 2HHHL 4LF4L 4BY7G 5IYCG 3H0GG 4DR6Q 2EIFA 1P8LA 3HKZE 1YIJA 3OTOL 1GO3E 3OW2A 5M3FH 2JQOA 5FLXc 4DV0Q 4DR2Q 1SROA 1A62A 4NXNL 2QGQA 3L7ZC 4L5SA 2R7DA 1UE7A 1G291 1I50H 3HOUG 1TWGH 2IX1A 3CCUA 4JBWA 1XJVA 2JA7G 2NZOA 2OTJA 3CCMA 1Z47A 4HIKA 1KL9A 1UE5A 1KC8C 2JA9A 4A3MH 1J5EQ 4OXPA 4LUZA 1TWHH 1IBMQ 4XTCS 1K83H 1N32Q 1OXSC 3HOXG 3NEMA 5LMUQ 4DV1Q 1HR0L 1CKNA 2VW9A 2I5LX 1YZ6A 4IJHA 1KIXA 2I5HA 3NENA 1GD7A 1YI2A 4LFCL 4DV5Q 3TS2A 3HOWG 2A8VA 1NMGA 4MZ9A 1E7ZA 1YHQA 2R93G 4LF8L 1PH2A 1VQLA 1GKHA 2D0PA 2VY3A 1CKOA 2NVQH 4GKJL 2WFWA 1MJCA 4AYBE 3D31A 3ULLA 4A75A 4JBKA 3U4ZA 3GD7A 5M5YH 2AKWB 2UXCQ 2UXDQ 5JJKA 2K50A 3M4QA 4JOIA 3SGIA 3GDEA 4YCVA 4GOPC 1YJNA 4A3GH 4A93G 1JJGA 3HKSA 1N34Q 1IBLL 4X64L 2JA6G 2RHSB 4KHPQ 1I6HH 4JI8L 1N8RC 4DNIA 4A3BH 4UY8C 2UXBQ 5C44H 2NVYH 4BBRG 4B3MQ 3I55A 4AIMA 4DR2L 4IFDI 1EUJA 4IFDJ 2A19A 2OTLA 3K7UC 1GM5A 2N49A 4ME3A 4JI7L 1VQ6A 3UE0A 5C0XJ 4DK6C 5LMNQ 3RLNA 3J80i 1IBKL 3GTOH 1IYJB 1RL2A 4KHZA 3RR5A 4JI6L 4QL5A 3T1HL 1VQJA 1SFOH 1C0AA 2QEXA 1Y14B 2HQLA 5IWAL 1N36L 5M5WH 3H3VH 1HZCA 3L2PA 4A3IG 3J80c 3PO2H 1TXYA 3HOYG 3A0JA 1K9MC 4MNOA 2I0QA 2JA5H 5C0XG 1GVPA 3CC4A 1KD1C 3A5UA 4OX9Q 3GO5A 3G71A 3EBEA 1WCMG 4IO9A 3U58A 3HOZH 1WYDA 4BXXH 1VQAA 1JT8A 4A3JH 1RIPA 3KFUA 4QGUA 2R7ZG 2HHHQ 4ALPA 4OWWB 3S14H 4LF4Q 3DLLA 3CP0A 1Q81C 2LSSA 3OTOQ 4UP7A 2Q2UA 4Y52H 1N33Q 3GTMH 2R7FA 1B70B 1VQMA 2B63H 1D7QA 1TWCH 2MO0A 4NXNQ 4TVAB 5GAEC 1EYGA 4R4CA 3J81i 4JCVE 1JJ2A 4IPCA 4APVA 2HIXA 5JJIA 4QY7A 3CCEA 3PUXA 1JJCB 5M3MG 2D62A 1PH9A 1W3SA 1YJWA 1PHJA 2I5MX 5M3FG 1PYSB 3J81c 3VDYA 5GQOA 3AYHB 4GN5A 4X65L 4GNXB 2IY5B 1FJGL 1QZHA 4JBJA 1L1OC 1IXRA 3PGZA 4B3RL 1MKHA 1X3GA 1QZGA 1VQ5A 4AQYL 1HR0Q 2K5HA 2ZJRA 2Y0SG 3RN2A 1SN8A 3I4OA 1MJEA 2OCEA 4LF5L 5BR8L 2VUMG 1E22A 1P16A 2ID0A 4A3MG 1X3FA 1Y1VH 4LFCQ 3S2DH 3F2DA 1X6OA 1AH9A 5C4JH 2R92H 4A3FH 3PV0A 5EAYA 4LF8Q 2YYZA 1YHAA 3W5OA 4OONA 1XNQL 3JC66 1NMFA 2VQFL 3K0XA 3CCQA 1BBWA 1HZ9A 5FLMH 2ZJQA 4GKJQ 2YV5A 4EQ5A 4R4TA 4P71A 3JAMc 1QVCA 4GLVB 1DGSA 2LXKA 1OXXK 2VS1A 4R4OA 4C2MH 4BBSH 4TQUS 3GTKH 3CC7A 1YVCA 4NB3A 2PQAA 2PI2E 4EX5A 5C3EH 4HJ9A 1IBLQ 4X64Q 2HT1A 5GAGC 4HIOA 1ASZA 4JI8Q 4DPGA 3J7ZC 4GOPB 1I5FA 3CF5A 2AWNA 3FP9A 1X54A 1JB7A 3CCLA 1N33L 3UDGA 3Q8DA 2E2HH 2IT1A 1PYBA 5IY0A 3F1ZA 4A3GG 3STBD 5FJ8H 4IPDA 1OXVA 4JI7Q 3BU2A 3NBHB 5JEAG 3A5ZB 3PF5A 4DR3L 5C44G 1X3EA 4GNXC 1ASYA 3CW2C 1IBKQ 4DUYL 4JI6Q 4DR1L 1YBYA 1X9NA 3T1HQ 4JI4L 5GADC 3KF6B 4PMWA 2WAQE 3TREA 3ULJA 5IWAQ 5AJ3L 1VQPA 1N36Q 4JBMA 4DR4L 2C35B 3AFQA 1HNZL 4DAYB 2OWOA 1FL0A 1CSQA 1KAWA 2VNUD 2IHFA 3TEHB 4RMFA 1FVIA 3RN5A 4LFAL 1VQNA 4R4QA 2NZHA 1LM0A 3CC2A 4OO1G 3FKIH 2GN5A 1X65A 2BH8A 1E24A 2OQ0A 1Q86C 1A0IA 3PUWA 4DV2L 3PO2G 1A8VA 2F52A 4DV7L 2JA5G 5LMNW 5IP7H 2VQEL 4LFBL 1XPOA 1NY4A 1VQFA 2CCZA 3HOZG 4A3KH 1UE6A 3H15A 3RZDH 1R9TH 1QVGA 1O7IA 4A3JG 4LF7L 4BXXG 1A63A 2EXDA 1KHIA 2NN6G 2PNHA 1BBUA 4J15A 1Q82C 1XNRL 2Q2IA 4BA1I 3LGJA 4DV6L 3K80C 4GN3B 4LUOA 1PH3A 2B63G 4DUZQ 2CWAA 1NE3A 4GLXA 1UEBA 4XIGS 4X65Q 3PIOA 2WAQG 4OWTB 1U5KA 1FJGQ 2KCTA 3I4MH 4B3RQ 2UU9L 2PI2A 2E2JH 3W1GA 4DKAC 3AEVA 3RNUA 4AQYQ 2ZTDA 4Y7NH 3ULPA 3HOVH 4P74A 1L1OB 4DR5L 4LF5Q 5BR8Q 3F2CA 2ES2A 3GTLH 3TRZA 3H0GH 2B3GA 3S15H 3S1NH 2DGYA 4IJLA 4MTNA 5IYBH 3GTJH 1IL2A 3J7A5 1XNQQ 1Q1EA 5K36G 1SRUA 2VQFQ 2H5XA 2RCNA 4YHHL 3CPFA 1Y1VG 1Q12A 2K4KA 1EOVA 2CQOA 3BJUA 2NVTH 1CSPA 2E5LL 1N9WA 3WWVA 2WB1E 3G4SA 4L5TA 4LF6L 1SLJA 4NXMQ 2JA7H 2Y0SE 4H02A 2JA8H 2R92G 4QIWE 1B8AA 4A3FG 4JI2L 1HR0W 2Z0SA 1L2FA 4JI5L 5FLMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 L;  1E1T A;  4AH6 A;  4OO1 I;  2ZTE A;  4A4I A;  2V1C C;  1YIT A;  3M4O H;  4BBS G;  3CAM A;  2QA4 A;  1OXT A;  4A3D H;  3M9B A;  3CCR A;  5C3E G;  2D0O A;  1LUZ A;  4UPA A;  3E9I A;  4LF9 L;  2K5V A;  1OTC A;  1NTG A;  4O2D A;  5C4X H;  3K8A A;  1PH7 A;  4DR3 Q;  1HNX L;  2FXQ A;  2NN6 I;  3UDX A;  3KDF B;  4DUY Q;  4DR1 Q;  3S2H H;  1EWI A;  4JC0 A;  1HJP A;  2F3I A;  4DUZ L;  4JI4 Q;  4JV5 L;  4YCU A;  5FJ8 G;  3T1Y L;  5AJ3 Q;  4DR4 Q;  3GTQ H;  2B29 A;  1HNZ Q;  1KQS A;  4BA2 I;  2WB1 G;  2GVB A;  2EQS A;  1C9O A;  1NJI C;  1K3R A;  4LFA Q;  1KRT A;  1BKB A;  1H95 A;  1EQR A;  2JK8 A;  4JI1 L;  3CCV A;  4GNX A;  4DV2 Q;  1L0W A;  3KOJ A;  1SR3 A;  1VQH A;  4DV7 Q;  4JYA L;  4DAM A;  1AE3 A;  2Z6K C;  1QUQ B;  3G48 A;  2VQE Q;  3GTG H;  4LFB Q;  4HIM A;  4HJ8 A;  4LF7 Q;  4GLA C;  4JI0 L;  3FKI G;  3I4N H;  1HNW Q;  5IE8 A;  4PZ7 A;  2K5N A;  5M5X H;  3CMA A;  2UUC L;  4NXM L;  2LXJ A;  3PO3 H;  1XNR Q;  1G51 A;  2MFI A;  1VQO A;  3ER0 A;  4DR7 L;  1QVF A;  5C0X I;  1VQ4 A;  1WOC A;  2MQH A;  5IP7 G;  4DV6 Q;  2E2I H;  3G6E A;  4L5R C;  5JEA J;  2ZJP A;  4A3L H;  4WJ4 A;  4A3K G;  3S24 A;  2Q2H A;  4KLK A;  4HJ7 A;  5ELO A;  2K14 A;  2UU9 Q;  2MNA A;  2XTI A;  4C3I H;  3HFZ B;  4OWX B;  4DR5 Q;  3E0E A;  3BZC A;  4FDB A;  4POF A;  1BVS A;  2Q2T A;  2R7Z H;  2CWP A;  1J6Q A;  4C3J H;  1VQE A;  3B6Y A;  3RLF A;  1K8G A;  4B3T L;  4JG2 A;  3W1B A;  2RF4 A;  4UP8 A;  1E1O A;  4YWK A;  4YY3 L;  4A3B G;  4DV3 L;  4GOP A;  1XMQ L;  1Q7Y C;  2F4V L;  5H1S E;  1Z9F A;  2RHQ B;  3HOV G;  1PFS A;  3D0F A;  1I3Q H;  1IZ6 A;  4DV4 L;  1PH8 A;  1Q46 A;  3MEF A;  4YHH Q;  1KXL A;  1YNX A;  1MIU A;  1X56 A;  4UP9 A;  2JEA I;  3M3Y H;  1Q8K A;  1PA6 A;  4POG A;  2E5L Q;  2GVA A;  5M3M H;  4LF6 Q;  3TQY A;  5IYB G;  3UDI A;  4IFD G;  4QQB X;  1VCI A;  1PH6 A;  4JI2 Q;  3UE1 A;  3U4V A;  3S1M H;  2AWO A;  2ZTC A;  3NEL A;  1EQQ A;  5IP9 H;  4JI5 Q;  4JI3 Q;  2UUB L;  2ATW A;  1CKN B;  3KF6 A;  3RZO H;  1V1Q A;  3CME A;  4NPS A;  3DM3 A;  2DUD A;  1WJJ A;  2OQK A;  2XGT A;  4X62 L;  1VQ8 A;  2JA8 G;  4GKK L;  5IYD H;  3CXC A;  1B7Y B;  3KF8 B;  2BA0 A;  4RG1 A;  5E7N A;  4LF9 Q;  1HNW L;  2PMZ E;  1YHB A;  4HJA A;  4PZ8 A;  2HIV A;  1HNX Q;  2N78 A;  3I56 A;  4A3D G;  1PH5 A;  2UUA L;  4B3S L;  1S3O A;  2K75 A;  4IOA A;  4JV5 Q;  2N8N A;  3T1Y Q;  4A3E H;  1XPU A;  1Y1W H;  1K0R A;  1XPR A;  5C4X G;  3HKZ G;  3BZK A;  3KJP A;  1D8L A;  3UDF A;  3PF4 A;  1TWF H;  2IHE A;  4A3C H;  3TS0 A;  2NVX H;  3ZJY C;  3I2Z A;  4KI0 A;  3AQQ A;  1VQD A;  3CPW A;  1XMO L;  1W2B A;  2YTV A;  1WFQ A;  2VL6 A;  4PZ6 A;  5IYC H;  1JMC A;  4JI1 Q;  2IX0 A;  1VQC A;  4BY7 H;  1LYL A;  1I94 L;  4JYA Q;  1X55 A;  3F8T A;  2ZM6 L;  4YCW A;  4X66 L;  3MXN B;  3HOU H;  1L1O A;  4O0A A;  5GRO A;  2A1A A;  1UWV A;  1CUK A;  1WI5 A;  4JI0 Q;  4DR6 L;  4DK3 C;  4K0K Q;  5HY6 A;  1HZB A;  2JEB I;  2UUC Q;  4A76 A;  1VQK A;  4DV0 L;  2BA1 A;  5J3B A;  4DR7 Q;  4LWC A;  1K8A C;  4WJ3 M;  3S17 H;  3I7F A;  4P75 A;  3ICE A;  2ALY B;  2CFM A;  4C3H H;  3HOX H;  4GN4 B;  1K73 C;  3PUZ A;  1VQG A;  1VQ9 A;  1S72 A;  1SE8 A;  1T9H A;  5GAH C;  1PH4 A;  3I4N G;  1VQB A;  2KCM A;  2WP8 J;  2Z6K A;  2MO1 A;  3M4P A;  3H3V I;  4R1J A;  3PO3 G;  1PVO A;  1V43 A;  5DLQ E;  4IOC A;  1J5E L;  1EFW A;  1IBM L;  4A3L G;  4GS3 A;  3HOW H;  3KYH C;  1N32 L;  2KEN A;  4B3T Q;  4AYB G;  4YY3 Q;  4IPG A;  3J81 j;  5LMU L;  4DV1 L;  4DV3 Q;  1XMQ Q;  2R93 H;  2F4V Q;  5HGQ A;  1XTD A;  4L5Q A;  2CKZ B;  3S16 H;  4JOI C;  3A74 A;  4DV4 Q;  2YTX A;  4DV5 L;  4BY1 G;  3PIP A;  1HH2 P;  1G6P A;  1UE1 A;  3E9H A;  4YWL A;  1M1K C;  2YU9 H;  4LNQ A;  4A93 H;  2BH2 A;  2JJQ A;  1EIF A;  3CQZ H;  2YTY A;  4R4I A;  2JA6 H;  3L0O A;  3KDF A;  4YWM A;  3U50 C;  4QJF A;  4PG3 A;  2UUB Q;  3KJO A;  2UXC L;  4BBR H;  2UXD L;  3OYY A;  4HJ5 A;  1V9P A;  1YJ9 A;  4X62 Q;  4GKK Q;  1FGU A;  1C7Y A;  1N34 L;  1NBW A;  3S1Q H;  4KHP L;  1PV4 A;  3ERS X;  3CCS A;  2ASB A;  5ELN A;  3PUV A;  4K0K L;  2UXB L;  4LW1 A;  5IP9 G;  3S1R H;  1CKM A;  1YEZ A;  4P73 A;  2KBN A;  3KLW A;  1M90 C;  2AHO B;  2R6G A;  1HZA A;  4P72 A;  4B3M L;  3PSI A;  3PUY A;  4X6A H;  5IYD G;  1SMX A;  1TWA H;  1E3P A;  4LUV A;  3STB C;  2UUA Q;  3K7A H;  1QUQ A;  4A3I H;  4B3S Q;  2K52 A;  1OXU A;  3HOY H;  1LTL A;  2AMC B;  3M7N A;  4IPH A;  5LMN L;  3M85 A;  2PQA B;  1S40 A;  1VQI A;  2VZA A;  3JAM i;  1EIY B;  1WCM H;  2JE6 I;  4BY1 H;  5JJL A;  1VQ7 A;  2KHI A;  3PCO B;  2KHJ A;  2N3S A;  1U0L A;  3EN2 A;  1VS0 A;  3CD6 A;  5IT9 c;  3K81 C;  1KRS A;  3EIV A;  1XMO Q;  2VUM H;  4A3E G;  3I4M G;  2E8G A;  1Q1B A;  3FHW A;  1Y1W G;  4HID A;  3IRB A;  1I94 Q;  3GTP H;  4OX9 L;  1JE5 A;  3AFP A;  3RLO A;  3F2B A;  4A3C G;  2ZM6 Q;  2L15 A;  3CCJ A;  4X66 Q;  1AE2 A;  1PH1 A;  2HHH L;  4LF4 L;  4BY7 G;  5IYC G;  3H0G G;  4DR6 Q;  2EIF A;  1P8L A;  3HKZ E;  1YIJ A;  3OTO L;  1GO3 E;  3OW2 A;  5M3F H;  2JQO A;  5FLX c;  4DV0 Q;  4DR2 Q;  1SRO A;  1A62 A;  4NXN L;  2QGQ A;  3L7Z C;  4L5S A;  2R7D A;  1UE7 A;  1G29 1;  1I50 H;  3HOU G;  1TWG H;  2IX1 A;  3CCU A;  4JBW A;  1XJV A;  2JA7 G;  2NZO A;  2OTJ A;  3CCM A;  1Z47 A;  4HIK A;  1KL9 A;  1UE5 A;  1KC8 C;  2JA9 A;  4A3M H;  1J5E Q;  4OXP A;  4LUZ A;  1TWH H;  1IBM Q;  4XTC S;  1K83 H;  1N32 Q;  1OXS C;  3HOX G;  3NEM A;  5LMU Q;  4DV1 Q;  1HR0 L;  1CKN A;  2VW9 A;  2I5L X;  1YZ6 A;  4IJH A;  1KIX A;  2I5H A;  3NEN A;  1GD7 A;  1YI2 A;  4LFC L;  4DV5 Q;  3TS2 A;  3HOW G;  2A8V A;  1NMG A;  4MZ9 A;  1E7Z A;  1YHQ A;  2R93 G;  4LF8 L;  1PH2 A;  1VQL A;  1GKH A;  2D0P A;  2VY3 A;  1CKO A;  2NVQ H;  4GKJ L;  2WFW A;  1MJC A;  4AYB E;  3D31 A;  3ULL A;  4A75 A;  4JBK A;  3U4Z A;  3GD7 A;  5M5Y H;  2AKW B;  2UXC Q;  2UXD Q;  5JJK A;  2K50 A;  3M4Q A;  4JOI A;  3SGI A;  3GDE A;  4YCV A;  4GOP C;  1YJN A;  4A3G H;  4A93 G;  1JJG A;  3HKS A;  1N34 Q;  1IBL L;  4X64 L;  2JA6 G;  2RHS B;  4KHP Q;  1I6H H;  4JI8 L;  1N8R C;  4DNI A;  4A3B H;  4UY8 C;  2UXB Q;  5C44 H;  2NVY H;  4BBR G;  4B3M Q;  3I55 A;  4AIM A;  4DR2 L;  4IFD I;  1EUJ A;  4IFD J;  2A19 A;  2OTL A;  3K7U C;  1GM5 A;  2N49 A;  4ME3 A;  4JI7 L;  1VQ6 A;  3UE0 A;  5C0X J;  4DK6 C;  5LMN Q;  3RLN A;  3J80 i;  1IBK L;  3GTO H;  1IYJ B;  1RL2 A;  4KHZ A;  3RR5 A;  4JI6 L;  4QL5 A;  3T1H L;  1VQJ A;  1SFO H;  1C0A A;  2QEX A;  1Y14 B;  2HQL A;  5IWA L;  1N36 L;  5M5W H;  3H3V H;  1HZC A;  3L2P A;  4A3I G;  3J80 c;  3PO2 H;  1TXY A;  3HOY G;  3A0J A;  1K9M C;  4MNO A;  2I0Q A;  2JA5 H;  5C0X G;  1GVP A;  3CC4 A;  1KD1 C;  3A5U A;  4OX9 Q;  3GO5 A;  3G71 A;  3EBE A;  1WCM G;  4IO9 A;  3U58 A;  3HOZ H;  1WYD A;  4BXX H;  1VQA A;  1JT8 A;  4A3J H;  1RIP A;  3KFU A;  4QGU A;  2R7Z G;  2HHH Q;  4ALP A;  4OWW B;  3S14 H;  4LF4 Q;  3DLL A;  3CP0 A;  1Q81 C;  2LSS A;  3OTO Q;  4UP7 A;  2Q2U A;  4Y52 H;  1N33 Q;  3GTM H;  2R7F A;  1B70 B;  1VQM A;  2B63 H;  1D7Q A;  1TWC H;  2MO0 A;  4NXN Q;  4TVA B;  5GAE C;  1EYG A;  4R4C A;  3J81 i;  4JCV E;  1JJ2 A;  4IPC A;  4APV A;  2HIX A;  5JJI A;  4QY7 A;  3CCE A;  3PUX A;  1JJC B;  5M3M G;  2D62 A;  1PH9 A;  1W3S A;  1YJW A;  1PHJ A;  2I5M X;  5M3F G;  1PYS B;  3J81 c;  3VDY A;  5GQO A;  3AYH B;  4GN5 A;  4X65 L;  4GNX B;  2IY5 B;  1FJG L;  1QZH A;  4JBJ A;  1L1O C;  1IXR A;  3PGZ A;  4B3R L;  1MKH A;  1X3G A;  1QZG A;  1VQ5 A;  4AQY L;  1HR0 Q;  2K5H A;  2ZJR A;  2Y0S G;  3RN2 A;  1SN8 A;  3I4O A;  1MJE A;  2OCE A;  4LF5 L;  5BR8 L;  2VUM G;  1E22 A;  1P16 A;  2ID0 A;  4A3M G;  1X3F A;  1Y1V H;  4LFC Q;  3S2D H;  3F2D A;  1X6O A;  1AH9 A;  5C4J H;  2R92 H;  4A3F H;  3PV0 A;  5EAY A;  4LF8 Q;  2YYZ A;  1YHA A;  3W5O A;  4OON A;  1XNQ L;  3JC6 6;  1NMF A;  2VQF L;  3K0X A;  3CCQ A;  1BBW A;  1HZ9 A;  5FLM H;  2ZJQ A;  4GKJ Q;  2YV5 A;  4EQ5 A;  4R4T A;  4P71 A;  3JAM c;  1QVC A;  4GLV B;  1DGS A;  2LXK A;  1OXX K;  2VS1 A;  4R4O A;  4C2M H;  4BBS H;  4TQU S;  3GTK H;  3CC7 A;  1YVC A;  4NB3 A;  2PQA A;  2PI2 E;  4EX5 A;  5C3E H;  4HJ9 A;  1IBL Q;  4X64 Q;  2HT1 A;  5GAG C;  4HIO A;  1ASZ A;  4JI8 Q;  4DPG A;  3J7Z C;  4GOP B;  1I5F A;  3CF5 A;  2AWN A;  3FP9 A;  1X54 A;  1JB7 A;  3CCL A;  1N33 L;  3UDG A;  3Q8D A;  2E2H H;  2IT1 A;  1PYB A;  5IY0 A;  3F1Z A;  4A3G G;  3STB D;  5FJ8 H;  4IPD A;  1OXV A;  4JI7 Q;  3BU2 A;  3NBH B;  5JEA G;  3A5Z B;  3PF5 A;  4DR3 L;  5C44 G;  1X3E A;  4GNX C;  1ASY A;  3CW2 C;  1IBK Q;  4DUY L;  4JI6 Q;  4DR1 L;  1YBY A;  1X9N A;  3T1H Q;  4JI4 L;  5GAD C;  3KF6 B;  4PMW A;  2WAQ E;  3TRE A;  3ULJ A;  5IWA Q;  5AJ3 L;  1VQP A;  1N36 Q;  4JBM A;  4DR4 L;  2C35 B;  3AFQ A;  1HNZ L;  4DAY B;  2OWO A;  1FL0 A;  1CSQ A;  1KAW A;  2VNU D;  2IHF A;  3TEH B;  4RMF A;  1FVI A;  3RN5 A;  4LFA L;  1VQN A;  4R4Q A;  2NZH A;  1LM0 A;  3CC2 A;  4OO1 G;  3FKI H;  2GN5 A;  1X65 A;  2BH8 A;  1E24 A;  2OQ0 A;  1Q86 C;  1A0I A;  3PUW A;  4DV2 L;  3PO2 G;  1A8V A;  2F52 A;  4DV7 L;  2JA5 G;  5LMN W;  5IP7 H;  2VQE L;  4LFB L;  1XPO A;  1NY4 A;  1VQF A;  2CCZ A;  3HOZ G;  4A3K H;  1UE6 A;  3H15 A;  3RZD H;  1R9T H;  1QVG A;  1O7I A;  4A3J G;  4LF7 L;  4BXX G;  1A63 A;  2EXD A;  1KHI A;  2NN6 G;  2PNH A;  1BBU A;  4J15 A;  1Q82 C;  1XNR L;  2Q2I A;  4BA1 I;  3LGJ A;  4DV6 L;  3K80 C;  4GN3 B;  4LUO A;  1PH3 A;  2B63 G;  4DUZ Q;  2CWA A;  1NE3 A;  4GLX A;  1UEB A;  4XIG S;  4X65 Q;  3PIO A;  2WAQ G;  4OWT B;  1U5K A;  1FJG Q;  2KCT A;  3I4M H;  4B3R Q;  2UU9 L;  2PI2 A;  2E2J H;  3W1G A;  4DKA C;  3AEV A;  3RNU A;  4AQY Q;  2ZTD A;  4Y7N H;  3ULP A;  3HOV H;  4P74 A;  1L1O B;  4DR5 L;  4LF5 Q;  5BR8 Q;  3F2C A;  2ES2 A;  3GTL H;  3TRZ A;  3H0G H;  2B3G A;  3S15 H;  3S1N H;  2DGY A;  4IJL A;  4MTN A;  5IYB H;  3GTJ H;  1IL2 A;  3J7A 5;  1XNQ Q;  1Q1E A;  5K36 G;  1SRU A;  2VQF Q;  2H5X A;  2RCN A;  4YHH L;  3CPF A;  1Y1V G;  1Q12 A;  2K4K A;  1EOV A;  2CQO A;  3BJU A;  2NVT H;  1CSP A;  2E5L L;  1N9W A;  3WWV A;  2WB1 E;  3G4S A;  4L5T A;  4LF6 L;  1SLJ A;  4NXM Q;  2JA7 H;  2Y0S E;  4H02 A;  2JA8 H;  2R92 G;  4QIW E;  1B8A A;  4A3F G;  4JI2 L;  1HR0 W;  2Z0S A;  1L2F A;  4JI5 L;  5FLM G; 
#chains in the Genus database with same CATH topology
 1E1T A;  3DUZ A;  2B2Y C;  4AH6 A;  4OO1 I;  2ZTE A;  2C2R A;  1YIT A;  2V1C C;  3M4O H;  3MJF A;  1A2T A;  3RJ0 A;  2DPI A;  1DOM A;  5C3E G;  3GTG B;  2UUB H;  1OTC A;  1QNK A;  2M05 A;  4ZLT F;  3RD4 A;  3K8A A;  3EYY A;  2X0S A;  4GKK H;  3UDX A;  3ERO A;  1DZ1 A;  4F4X A;  2HCI A;  5KYL A;  2F3I A;  3GTK B;  2XIW A;  2AUJ D;  2PMZ A;  2UVV A;  1BJT A;  5FJ8 G;  5KIX A;  3T1Y L;  4I7A A;  4OEL B;  1HNZ Q;  1A15 A;  3IL8 A;  2PPB C;  1SJH D;  5KFA A;  1S9F A;  4RAY A;  4LFA Q;  4C3I B;  1I6U A;  3GTP A;  2JK8 A;  4DV2 Q;  1LTT D;  4LF8 H;  3GIL A;  5C3X A;  3G48 A;  4LFB Q;  4KY6 A;  1TS4 A;  4RB0 A;  1TII D;  4JI0 L;  5C8Y F;  3I4N H;  3SI8 A;  1HNW Q;  4J9P A;  4TRD A;  2UUC L;  3PO3 H;  3M3Y B;  1XNR Q;  5JVH 3;  2I46 A;  2KOL A;  1QVF A;  4HNT A;  2M2L A;  4L5R C;  1WOC A;  2MQH A;  1S5D D;  4DV6 Q;  4A3L H;  1XXG A;  2K03 A;  3OIP A;  4A3K G;  3S24 A;  2WB1 A;  4J9N A;  4JI8 H;  4HJ7 A;  2UVU A;  3A7L A;  4QIW A;  3N41 B;  3S1M B;  4NMZ A;  2UU9 Q;  2JP1 A;  1Y8P B;  3E0E A;  4RWS C;  4ZK9 B;  3E3X A;  4JI7 H;  2R7Z H;  2CWP A;  1J6Q A;  3GQB A;  3RLF A;  4B3T L;  4UP8 A;  4YWK A;  5NUC A;  4YY3 L;  1HCZ A;  3VYT A;  1XMQ L;  4IFD J;  2WDT A;  4J9M A;  2V9W A;  3H09 A;  1CFM A;  4JI6 H;  3KK7 A;  3HOV G;  1PFS A;  3D0F A;  4DA2 A;  2JEG A;  1TKW B;  5IWA H;  3MEF A;  5DM6 3;  2W7P A;  3IFD A;  4UP9 A;  4H44 C;  1DV1 A;  1ENA A;  5KYI A;  4DV1 H;  3NBH A;  3VPD A;  4DNT B;  2JN4 A;  5JVG 3;  1VCI A;  4JI2 Q;  3UE1 A;  3U4V A;  1LTR D;  3Q24 A;  1EQQ A;  4JI5 Q;  1KAA A;  4JI3 Q;  1CKN B;  2CHB D;  2KHS A;  5KG4 A;  4NPS A;  1WJJ A;  2OQK A;  3H0G B;  3MFH A;  3S1N B;  2PZU A;  3BA9 A;  1RJQ A;  3MTS A;  4I55 F;  4RG1 A;  4U67 3;  2ZXO A;  2XC9 A;  1YHB A;  2WKC A;  4HJA A;  1N48 A;  2HIV A;  2W57 A;  3JAM W;  4C1N I;  4ED6 A;  2VPS A;  3GTL A;  2JA7 B;  4KHP H;  1BCP C;  1PH5 A;  1LT3 D;  1T36 A;  2F0F A;  1ICF B;  2B2Y A;  3S17 B;  5D3I B;  1EYA A;  3D4R A;  4MIU A;  3MWY W;  4RNO A;  4B3M H;  5C4X G;  3R5F A;  2QKI C;  3HKZ G;  2OT2 A;  3S9W A;  3KJP A;  1ESF A;  1TWF H;  3KXY T;  3V4Z A;  1B53 A;  4RZR A;  4A3D B;  1TS3 A;  1VQD A;  3AQQ A;  3JSL A;  2ZXP A;  1XMO L;  1W2B A;  1WFQ A;  2VL6 A;  4PZ6 A;  3MR2 A;  3G6Y A;  4JI1 Q;  2IX0 A;  4F88 A;  4G7Z C;  4FYD A;  3P7J A;  1EOT A;  4JYA Q;  2VUG A;  2R93 B;  4XXE A;  4IRK A;  5GRO A;  2A1A A;  2ICI A;  1KBL A;  1WI5 A;  2JEF A;  1SEB D;  1STB A;  4O3N A;  2QYZ A;  2RGR A;  1VQK A;  5J3B A;  4JUZ A;  4JVZ A;  4BS9 A;  3ICE A;  5JVD F;  3Q8Q B;  4C3H H;  2CFM A;  1VQ9 A;  2R7M A;  1S72 A;  4U68 A;  5IGF A;  1VQB A;  2MO1 A;  3M4P A;  3OWF A;  4HCS A;  1DCZ A;  2X6L A;  4IOC A;  4OO1 H;  1JC7 A;  5E4W C;  1SNP A;  2KEN A;  3S1Q B;  5FO9 B;  2IMW P;  4DR3 H;  2F4V Q;  4IWY A;  2GA4 B;  3S16 H;  4JI4 H;  2FIN B;  5COY A;  4DV4 Q;  2YTX A;  4DR4 H;  1RF2 D;  1TWA B;  2K5W A;  4BY1 G;  3M9O B;  1HH2 P;  4A3I B;  4QMG A;  1NNX A;  1M1K C;  2FMA A;  4A93 H;  2BH2 A;  4XQN A;  2JA6 H;  1WTR A;  2KCN A;  4DL2 A;  1WCM B;  2ZDG A;  4Z9C B;  2PZT A;  3HRZ C;  2UUB Q;  5J22 A;  2UXC L;  2W6Z A;  4HJ5 A;  5KFL A;  1MI2 A;  4GKK Q;  4XT3 B;  4DNR B;  1EFI D;  5LOV F;  2F0W A;  1C7Y A;  4AYB A;  3GIM A;  2VQE H;  1TU2 B;  1E4E B;  1CZW A;  2E2D C;  3KUP A;  2QK4 A;  2F0N A;  1I3Q B;  4C5A A;  3MEH A;  3PUV A;  5ELN A;  4LW1 A;  4RHR A;  1PRT D;  3FEW X;  1PX2 A;  2WYO A;  2AHO B;  5M3M B;  3K58 A;  1E3P A;  5CV4 A;  3STB C;  1QUQ A;  3NWT A;  4YR3 A;  4KKS A;  1SAP A;  1SYB A;  2M00 A;  2K5D A;  1E2W A;  3L9A X;  2VZA A;  3JAM i;  4RKB A;  1DIK A;  1DYQ A;  3FMC A;  5EKI A;  2V5A A;  4J0M A;  5JJL A;  3RGX A;  4DR5 H;  2KHI A;  1XWE A;  3E6Z X;  1U0L A;  2EDG A;  1Y8O B;  2VUM B;  1KRS A;  3EIV A;  4A3M B;  2A6E C;  3NGD A;  3T4A C;  2E8G A;  1HFN A;  1IBK H;  3IRB A;  1JE5 A;  1BXT A;  4C5B A;  2XWB B;  4TSS A;  5G3L D;  5M9O A;  3BA8 A;  3TDQ A;  4TUY F;  4F7X A;  5LL6 X;  1PTO B;  2NBF A;  2IPK D;  4BY7 G;  5JOB A;  1RTN A;  2EIF A;  4DLK A;  4CBV A;  1SRO A;  3JZI A;  5KFC A;  3L7Z C;  4L5S A;  1G29 1;  1I50 H;  1TWG H;  5ELD A;  2A6H C;  2EYL A;  2A73 B;  2NZO A;  5FO7 B;  1Z47 A;  1KC8 C;  2A69 C;  1J5E Q;  2JYO A;  1LTI D;  3GP7 A;  4WFN 3;  1BCP F;  1I6H B;  1TWF A;  4ZAI A;  4DV1 Q;  5KG3 A;  2VW9 A;  2I5L X;  2NVY B;  1KIX A;  4DUZ H;  3K5O A;  2L1B A;  5K5P A;  2D2C C;  5CA0 F;  3HOW G;  5FPO A;  1NMG A;  1KDA A;  2W9A A;  4AQY H;  1GKH A;  1B04 A;  3GID A;  3LX0 A;  1CKO A;  1C4Q A;  2QCP X;  4UAI A;  4FF1 A;  4GKJ L;  3VPB A;  4B08 A;  1FD7 D;  4JBK A;  4ED7 A;  3GD7 A;  5M5W B;  1Q3L A;  3M4Q A;  4RHS A;  2PN1 A;  3GDE A;  4YCV A;  1YJN A;  1EY5 A;  3RV3 A;  4EYH B;  4UCV A;  3L3O C;  1N34 Q;  4KHP Q;  1IW7 D;  1N8R C;  4NXM H;  2WE6 A;  1V1P A;  4B3M Q;  1FNW A;  2F0L A;  4AIM A;  4RGN A;  2R8G A;  3K5L A;  4IFD I;  2R8K A;  3O13 A;  3N8D A;  3HKZ A;  2FMM A;  1VQ6 A;  2B63 B;  3MXN A;  1HTP A;  2BCO A;  1HFG A;  2WAQ B;  1CM9 A;  3GTO H;  1IYJ B;  1YNJ C;  4KHZ A;  3RR5 A;  5KT3 A;  1ZXT A;  3PW4 A;  1SFO H;  2KSW A;  4RCO A;  5JUM A;  3GTQ A;  3L2P A;  1L0Y B;  4Q43 A;  3PO2 H;  1AZQ A;  2JA6 A;  2I0Q A;  2G9H D;  5C6A A;  5C0X G;  4HR7 A;  4OHJ A;  1KD1 C;  3CC4 A;  4OX9 Q;  4R8I A;  3G71 A;  1JT8 A;  3ETH A;  1TS5 A;  1ENC A;  3WOE A;  1RIP A;  5EPJ A;  3N6X A;  1E2Z A;  2SCU B;  2DY8 A;  3S2D B;  3RAQ A;  3OTO Q;  2ALZ A;  2Q2U A;  2L55 A;  4Y52 H;  3GTM H;  4X3U A;  2W9B A;  1O7Y A;  1VQM A;  5C4J B;  1TWC H;  1MSH A;  4NXN Q;  4QCL A;  1CT1 D;  1XX8 A;  3MR6 A;  4IPC A;  1RK6 A;  4APV A;  3CCE A;  1S0N A;  5CBE E;  4GC7 A;  5KFI A;  1F9R A;  1YJW A;  3BQ0 A;  2I5M X;  1H9S B;  1STH A;  4WD3 A;  4C2M B;  3VDY A;  5GQO A;  4GN5 A;  3OSO A;  5ISR A;  3J7A V;  5C3E B;  2EYM A;  1MGS A;  4B3R L;  1IXR A;  4JW0 A;  4DXF A;  1QZG A;  3MFI A;  3QZ8 A;  1M7J A;  2K5H A;  2CZG A;  1SN8 A;  1RHP A;  2OCE A;  2D9U A;  5BR8 L;  2UUA H;  2ID0 A;  4CKB A;  2KQ3 A;  4LFC Q;  1STA A;  5KT7 A;  3A8J E;  4ECS A;  1QCB D;  4DK0 A;  3F2D A;  2B2V A;  4F8M A;  5E3F A;  1AH9 A;  4R8U B;  2R92 H;  5EAY A;  4IUR A;  2YYZ A;  4PDB A;  5KG2 A;  1PZK D;  2YL2 A;  2RQX A;  3JC6 6;  5D1O B;  2PW5 A;  4IUN A;  3RB0 A;  2R6F A;  4EQ5 A;  3A7A B;  4R4T A;  5DG8 A;  3JAM c;  1ZQ7 A;  1QVC A;  4BBS H;  1KTK A;  3GTK H;  5KNB A;  4NB3 A;  5I2X A;  3RB6 A;  3BDC A;  1I50 A;  4RB2 C;  1TWG A;  4FS2 A;  1IBL Q;  4X64 Q;  1WTX A;  1GSH A;  3QOJ A;  4HIO A;  2HUG A;  1SNC A;  2Y0S A;  4DR6 H;  1JB7 A;  3LP8 A;  1N33 L;  4TKO B;  2O2L D;  4ZRZ A;  4DV0 H;  1S03 G;  5IY0 A;  4A3G G;  4IPD A;  4FXG C;  3KHL A;  3TQ1 A;  3BU2 A;  2R86 A;  4A3K B;  2LS0 1;  3RZD B;  4Q44 A;  5C44 G;  1X3E A;  4GNX C;  1BF4 A;  1IBK Q;  4RH6 A;  5D1P A;  3JRX A;  3KAL A;  1STN A;  1SCU B;  4TQR A;  1N32 H;  3OW7 A;  1VQP A;  2AGO A;  2C35 B;  4RKL A;  4LAA A;  1HNZ L;  2O5J C;  5EJW A;  4WOR A;  3IKJ A;  1CSQ A;  2OLS A;  3TEH B;  5ELE A;  2RDG A;  4RMF A;  4LFA L;  1VF5 C;  4Y7N B;  3HOV B;  1AN7 A;  2F0V A;  5LXT F;  2FLP A;  3FKI H;  4ULL A;  3QO2 A;  1O75 A;  1YNN D;  2OQ0 A;  1X65 A;  1HUM A;  4NP5 A;  5I2Y A;  1Q86 C;  4DV2 L;  2ASD A;  2F52 A;  1HPC A;  3QIA A;  2JA5 G;  2VPQ A;  2NTS A;  5J2U F;  1IKL A;  1CI3 M;  2F0S A;  1VQF A;  1XPO A;  4LFB L;  5DG7 A;  5KFO A;  1R9T H;  1QVG A;  2WAC A;  1LT6 D;  4A3J G;  4FBT A;  5DAU A;  4RU9 A;  4CHT B;  1KHI A;  4WJW A;  3GIP A;  4HN7 A;  4KD3 A;  2GPS A;  2AGQ A;  1XNR L;  4FU0 A;  3BYY B;  3LGJ A;  2MCT A;  4DV6 L;  4LUO A;  4DUZ Q;  2CWA A;  3URY A;  3HOZ B;  3KAJ A;  1EY0 A;  1EQV A;  3PIO A;  3GTO A;  4OWT B;  1U5K A;  3WNZ A;  4K0K H;  4KMU C;  2UXB H;  2UU9 L;  2L5T A;  5KFV A;  1SFO A;  4ZCK A;  2RDJ A;  4DKA C;  3QOL A;  4DR7 H;  4AQY Q;  4M7E A;  3J80 E;  4O3P A;  1TAE A;  2OF1 A;  2ES2 A;  2XCL A;  3DHQ A;  3A8K E;  3H0G H;  5KGU A;  2HVQ A;  4UCO A;  4OL7 A;  5LMN H;  3S1N H;  4ED3 A;  4ZHQ F;  3I90 A;  4IFD H;  2DJG C;  4J1M A;  5C4X B;  1XNQ Q;  1Q1E A;  2D5D A;  5K36 G;  5KT6 A;  3J80 L;  4MV4 A;  3ZYY X;  1OO9 B;  3BG3 A;  1Q12 A;  4ZUJ A;  3TP8 A;  3GTM A;  2UVW A;  3WWV A;  2WB1 E;  4TV9 F;  1TWC A;  1SLJ A;  4NXM Q;  2JA7 H;  4QIW E;  4K2K A;  2BQU A;  4JI2 L;  3U9O A;  3T56 B;  4JI5 L;  5FLM G;  4JI3 L;  3AMU A;  1KEE A;  5EGT A;  3X3N A;  1RYS A;  3PIP 3;  1E0B A;  3J81 E;  2VB2 X;  2AQ1 B;  4A3D H;  3M9B A;  3BVG A;  5FD6 A;  3RAX A;  2ASL A;  3E9I A;  4I7H A;  1A3V A;  4CDE C;  4KJO A;  5KX5 F;  5DLF A;  4X62 H;  2R8H A;  2KJX A;  2NN6 I;  4DR1 Q;  3VYU A;  5M5X B;  4JC0 A;  4N8F A;  2JEJ A;  2RDH A;  4UCU A;  2R92 A;  5AJ3 Q;  3DEP A;  2BQR A;  3NTK A;  2EOT A;  3SE0 A;  5BMV F;  2WB1 G;  2GVB A;  2EQS A;  1NJI C;  4HMI A;  5DQH A;  2E76 C;  1KRT A;  1BKB A;  2ZJT A;  1EQR A;  3GTK A;  4JI1 L;  4GNX A;  2HJW A;  5CR3 A;  5KFD A;  4BY1 B;  2MUY A;  4JYA L;  1SR3 A;  1AE3 A;  1ICW A;  2Z6K C;  1ZHQ A;  3AU7 A;  1RJR A;  4GLA C;  2F03 A;  1J8I A;  3TBI B;  3CMA A;  1I94 H;  4FXK C;  2RCF A;  5KFJ A;  2G5D A;  3ER0 A;  2EY6 A;  4RFB A;  1EUC B;  2XCA A;  2ZM6 H;  5C5M A;  2E2I H;  2ZJP A;  3OHB A;  1R4Q B;  3ONA B;  4ETS A;  4C1N K;  5ELO A;  3I3C A;  2K14 A;  3IN5 A;  1JXL A;  2MNA A;  3HFZ B;  3ORR A;  1Y8N B;  4UFZ A;  4E4T A;  2Q2T A;  4C3J H;  3B6Y A;  4O2B F;  3K3V A;  4JG2 A;  3W1B A;  2RF4 A;  4ED0 A;  4GOP A;  1Q7Y C;  2F4V L;  2NWG A;  5H1S E;  3WO0 A;  5EDW A;  2RHQ B;  3FKI A;  5KNC A;  1I3Q H;  2NUA B;  1IZ6 A;  2K33 A;  4DV4 L;  4J9S A;  3KBG A;  3TP6 A;  2FPG B;  1Q46 A;  1DV2 A;  1MIU A;  1B50 A;  2FKL A;  2XVS A;  5JAV A;  3TQT A;  3V2T A;  2R87 A;  1KDB A;  5M3M H;  1WSC A;  3EVQ A;  3KAK A;  4Q0Y A;  3TQY A;  1W93 A;  1R9T A;  3BAA A;  3RBE A;  4RNN A;  4C56 C;  1WVL A;  4YR2 A;  4DV5 H;  2NVX B;  5IP9 H;  2FK2 A;  3R93 A;  2UUB L;  4XYM B;  5EPL A;  2XGT A;  4DAY A;  2JA8 G;  4GKK L;  5IYD H;  3CXC A;  1EUD B;  1B7Y B;  4ECV A;  2F0J A;  3KF8 B;  2YZM A;  4O4H F;  2YYA A;  1EY6 A;  4LF9 Q;  5I47 A;  2R8I A;  1EL0 A;  1KC7 A;  2W9C A;  4QF4 A;  4O3R A;  2UXD H;  1I6V C;  4ABN A;  1F2Z A;  1HNX Q;  2RSN A;  3VMM A;  2W70 A;  4X65 H;  4JV5 Q;  4A3E H;  1Y1W H;  3NTH A;  1AFP A;  1D8L A;  3PF4 A;  3WOF A;  4ECQ A;  4LF5 H;  3I73 A;  3TS0 A;  4MV9 A;  5C4Z A;  4JV0 A;  3SXH A;  2FHT A;  3CPW A;  1A9X A;  3L4K A;  1JDB B;  1EYZ A;  2K32 A;  3HOW B;  2IX3 A;  4LK1 C;  2KCC A;  4NDX A;  1X55 A;  1PTO C;  3A54 A;  2Z4I A;  3F8T A;  3NXW A;  4FNF A;  4V0B A;  2FPI B;  1Q90 A;  3HOU H;  1L1O A;  3QB3 A;  4O0A A;  3S2H B;  5CMD A;  2VOB A;  4K0K Q;  4XZ3 B;  4CDD C;  1HZB A;  3IG0 A;  4Q45 A;  4A76 A;  5ELF A;  4DR7 Q;  4XT1 B;  4WJ3 M;  3RUP A;  2WKD A;  4P75 A;  4K5X A;  1CA6 A;  3HOX H;  1K73 C;  3CQZ B;  3PUZ A;  1PFM A;  4UCR A;  4IRD A;  1SE8 A;  1T9H A;  5GAH C;  1PH4 A;  3I4N G;  3EPI A;  2Z6K A;  3PO3 G;  4OEM B;  1V43 A;  1J5E L;  1QWY A;  1EFW A;  4QW9 A;  2PZW A;  1RCV D;  4A3L G;  5IGE A;  4LSA A;  4R8N A;  4AYB G;  3J81 j;  5LP6 F;  2V4D A;  4DV1 L;  4DV3 Q;  5FD5 A;  5KFE A;  4DUY H;  3S1R B;  1EHI A;  4JOI C;  3A74 A;  3TSS A;  2EPB A;  1VMP A;  3RBD A;  2NN6 H;  5IGC A;  1G6P A;  2YU9 H;  1EZ1 A;  2YS6 A;  1BO0 A;  5LHY 1;  3DMU A;  5HBR B;  4IWX A;  4LH6 A;  3KDF A;  2DLN A;  5KFZ A;  2FK3 A;  4QJF A;  1M0T A;  3QG1 A;  4BBR H;  3PVX A;  2E2I A;  1B6S A;  1V9P A;  4X62 Q;  2GLT A;  3TIG A;  3Q2O A;  1FGU A;  1I4H A;  2KEC A;  2WIN B;  4ZUI A;  1EY8 A;  1LAB A;  1N34 L;  4KHP L;  3ERS X;  3ITP A;  4K6D A;  2ASB A;  3MFY A;  2PCF B;  4P73 A;  2KBN A;  4B3M L;  4KD4 A;  4FVM A;  1HZA A;  2PO4 A;  4P72 A;  1Q8I A;  4I50 F;  2XCP A;  2FLL A;  4ME6 A;  1MBY A;  1CHP D;  4ZQI A;  4B3S Q;  3K7A H;  3H4B A;  1OXU A;  3HOY H;  1LTL A;  2AMC B;  1D2B A;  4ECU A;  4HED A;  2PQA B;  4PV1 C;  1VQI A;  4JPB W;  3TZU A;  1S40 A;  3RZO B;  4J9O A;  2BDN A;  1U4P A;  2KHJ A;  3EN2 A;  1WTQ A;  3KHG A;  4ZYS A;  2QW7 A;  5IT9 c;  3CD6 A;  3I4M G;  5A2Q E;  1Q1B A;  3FHW A;  3ETJ A;  1I94 Q;  4OX9 L;  1HTL D;  3RLO A;  2LMC B;  5DG9 A;  1X3Q A;  2P5Z X;  2Q8R E;  2ZM6 Q;  2C22 A;  3CCJ A;  1TT2 A;  4X66 Q;  1N36 H;  4YHH H;  2CH4 W;  1FNU A;  1SNM A;  4CKE A;  5E4X A;  4RNM A;  1IYU A;  3M4Y A;  1YIJ A;  3HKZ E;  5A2Q L;  4LF6 H;  3OTO L;  3MZ5 A;  2CQY A;  3SEB A;  3V6H A;  1GO3 E;  2JQO A;  5FLX c;  4MA0 A;  4EGJ A;  4NXN L;  1S0O A;  2QGQ A;  3NQI A;  1D1I A;  2NVQ B;  2XIG A;  1QG7 A;  3D8G A;  4JBW A;  2EJM A;  3OUZ A;  1TQO A;  3CCM A;  4NW2 A;  1EY7 A;  5JPM C;  4DGZ A;  2IW3 A;  3OOC A;  4HIK A;  5M5Y B;  1UC9 A;  4WBN F;  1TY0 A;  1IBM Q;  3M4I A;  1Y1W A;  4XTC S;  4C3H G;  1B1Z A;  2B2T A;  5LMU Q;  4L63 B;  3D3R A;  5C44 B;  4IJH A;  4RUC A;  2PNR C;  3NEN A;  1GD7 A;  2BR0 A;  4LFC L;  1HUN A;  3IFT A;  4I4T F;  3T1Y H;  4DV5 Q;  1KJI A;  5F2D A;  1E7Z A;  1SYF A;  1ET9 A;  1VQL A;  4R7R A;  5KG6 A;  2VY3 A;  1B2T A;  3GV6 A;  1RKN A;  4IZ8 A;  1GGO A;  1PTO F;  2BQ3 A;  3BQ1 A;  3ULL A;  2AKW B;  4WRD A;  5IYZ F;  2UXD Q;  3C46 A;  4JOI A;  3SGI A;  4FO2 A;  5IGD A;  2W6O A;  4A93 G;  2JEI A;  1SXT A;  2JA5 B;  2VQF H;  3HKS A;  1IBL L;  2JA6 G;  4X64 L;  2I87 A;  4JI0 H;  1KLU D;  4UY8 C;  2UUC H;  4A2B A;  3S14 B;  4DR2 L;  1BCP D;  2QF7 A;  1EUJ A;  2F0P A;  4I65 A;  3D4D A;  3K7U C;  1GM5 A;  3NTI A;  4B9W A;  2K1B A;  2B2W C;  2ZDH A;  2IWH A;  1IBK L;  1UEA B;  2SNM A;  2F4I A;  3MHB A;  2QEX A;  3Q0A A;  2YU9 A;  1HZC A;  4B3T H;  4G7O C;  4YY3 H;  3UI2 A;  2HDL A;  1T5X D;  1V1O A;  1GVP A;  3K5H A;  3HOZ H;  1B33 N;  3U58 A;  4DL7 A;  4E6I A;  4BXX H;  1VBG A;  2R8J A;  1VQA A;  1ILQ A;  4CC5 A;  2HHH Q;  4KV6 A;  1VBH A;  2DZD A;  3CP0 A;  3GIQ A;  3RB4 A;  3BYT B;  5BN5 A;  3J7A K;  5EZY F;  2PMZ B;  3MFG A;  4QB4 A;  5DQG A;  1EYG A;  2Z4H A;  2HIX A;  5JJI A;  2AGP A;  4LSX A;  3PUX A;  3P75 A;  1PHJ A;  1RK5 A;  4R9W A;  1PYS B;  3GTP B;  4K8I A;  1S5B D;  4JBJ A;  3H4D A;  1X3G A;  2FP4 B;  1JOQ A;  4AQY L;  1SYX B;  3I12 A;  2R7Z A;  1CQV A;  2C9O A;  2Y0S G;  3RN2 A;  4YBZ B;  5M3F B;  3JAM E;  1X3F A;  1Y1V H;  3MWD A;  2HVR A;  4BWS C;  4YQW A;  4A3F H;  4LF8 Q;  4HMJ A;  1XNQ L;  2WB1 B;  1I4P A;  1L2Z A;  1BBW A;  3MXU A;  4QIW B;  3JAM L;  2YV5 A;  2HQE A;  4P71 A;  4DAP A;  4GLV B;  1K83 B;  1DGS A;  4R4O A;  3RTX A;  2W6Q A;  4R8U A;  1YVC A;  1A6X A;  4EFE A;  3T5J A;  3U9T A;  1CQF A;  3SVM A;  5GAG C;  5KT5 A;  4MTD A;  4JI8 Q;  4DPG A;  3J7Z C;  1ROD A;  5EOY A;  2AWN A;  3BVM A;  3CCL A;  3WO1 A;  1D6E C;  3RF2 A;  2E2H H;  1BQQ T;  1PYB A;  1I7L A;  3E5N A;  4MTE A;  3STB D;  4JI7 Q;  3N40 P;  3NBH B;  1STY A;  3R5X A;  3PF5 A;  1ASY A;  3CW2 C;  4JI6 Q;  4DR1 L;  3HXL A;  1YBY A;  1X9N A;  4ID6 A;  3ULJ A;  5IWA Q;  1N36 Q;  5AJ3 L;  1GUS A;  2A6E D;  3OMG A;  1T3N A;  1PMR A;  3BDL A;  1KAW A;  2VNU D;  4DL3 A;  2NB0 A;  1VQN A;  4R4Q A;  2NZH A;  3HEJ A;  3VR2 A;  3CC2 A;  2NU8 B;  5C1P A;  2B2W A;  4XDX A;  2BH8 A;  3PO2 G;  1A0I A;  4KHV A;  5CV7 A;  1Z6H A;  1A8V A;  1JLL B;  3MR5 A;  5EBC A;  2Z8L A;  4KN4 C;  5LMN W;  1EY4 A;  5IP7 H;  1X3P A;  1NY4 A;  2W71 A;  1A63 A;  1O7I A;  2IJ0 A;  3SK6 A;  2PNH A;  2UXC H;  1AUX A;  2A6H D;  4KKT A;  1BBX C;  5KT4 A;  2Q2I A;  1JWM D;  4BA1 I;  1LTS D;  2A69 D;  4GN3 B;  4KN7 C;  2JA8 B;  5H80 A;  1NE3 A;  2E75 C;  1UEB A;  4XIG S;  4EG0 A;  3GV3 A;  5BPH A;  2QEJ C;  5IIF A;  1WTP A;  3LWB A;  4ECT A;  2E2J H;  1B4O A;  2R84 A;  3M4O B;  2A74 C;  1K0S A;  4CJ1 B;  3TRZ A;  2FJ2 A;  4MV7 A;  2EYF A;  1EY9 A;  3ND9 A;  5KFS A;  5IYB H;  3GTJ H;  2DWC A;  3KHH A;  3J7A 5;  3VR3 A;  2YZG A;  4QW8 A;  2VQF Q;  2DN8 A;  4CDF C;  3CPF A;  1H9K A;  4CGY B;  1CSP A;  4EQO A;  1C8C A;  1C30 A;  2B2U C;  2DIK A;  5T14 A;  2L11 A;  2R92 G;  5CV9 A;  2EZV A;  1HR0 W;  1Z2O X;  3A5U A;  3EBE A;  4IO9 A;  4N8X 1;  4J8Q A;  1WD1 A;  1RJT A;  4A4I A;  4RGO S;  4BBS G;  3CAM A;  4ME5 A;  2QA4 A;  4RGT A;  4HSV A;  2D0O A;  1LUZ A;  4UPA A;  4LF9 L;  4GZY C;  3CKI B;  1PH7 A;  1SYC A;  4DR3 Q;  1YNJ D;  1HNX L;  2FXQ A;  3I4N B;  3JRW A;  3RV4 A;  4APM A;  1Y1V A;  3S2H H;  3EQL C;  1EWI A;  1HJP A;  4XYO A;  4JI4 Q;  4RB3 C;  3E0J A;  4JV5 L;  5KFK A;  1ZHS A;  4YAJ B;  5K2M A;  4DR4 Q;  1A3T A;  2B29 A;  4BA2 I;  4DXG A;  2HVS A;  4UCS A;  5KG1 A;  1I4X A;  1U4R A;  1K3R A;  5DNF A;  1EIG A;  2I8C A;  2R85 A;  3CCV A;  1SND A;  5JVL A;  1EEF D;  1VKZ A;  2K7V A;  2EE1 A;  2XSC A;  1VQH A;  1X32 A;  3KOJ A;  3TZD A;  4DF7 A;  3JSN A;  3R23 A;  1QUQ B;  3A55 A;  2VQE Q;  4FF4 A;  3GTG H;  4HQ6 A;  3W2D A;  2SEB D;  3LML A;  2EJF C;  3FKI G;  2AUK A;  4G4K A;  5IE8 A;  3G6V A;  3J80 W;  4PZ7 A;  1K3B C;  2K5N A;  3NK9 A;  4OGQ C;  1T5E A;  2LXJ A;  2E2H A;  1G51 A;  1VQO A;  4DR7 L;  2MGS A;  3NUC A;  1VQ4 A;  1DJR D;  1ZEQ X;  1PK8 A;  4KJN A;  1C48 A;  4EQN A;  1RDP D;  1GHJ A;  2RDF A;  3OMC A;  5DEH A;  5IGG A;  5L9X A;  5DQI A;  4C3I H;  4HNU A;  4OWX B;  5KG5 A;  4DR5 Q;  1I7N A;  3FMA A;  2W6N A;  5KFU A;  1BVS A;  1VQE A;  5BN3 A;  1K8G A;  1I4Q A;  2CH4 A;  3F2U A;  4A3B G;  1E1O A;  3Q6S A;  4DV3 L;  1XDN A;  4KTA A;  2NTT A;  4YIJ A;  1KNA A;  4Q8F A;  3J81 W;  1KXL A;  4MAM A;  1YNX A;  3M3Y H;  4EBC A;  3MWM A;  4H0L C;  1PA6 A;  4POG A;  4ZI7 F;  2DY7 A;  5CGK A;  1BOS A;  4HTH A;  3I4M B;  4IFD G;  1PH6 A;  3S1M H;  1TWF B;  3NE5 B;  2V4Q A;  2ZTC A;  3OIQ A;  3RZO H;  3KF6 A;  2H4O A;  3UFX B;  3CME A;  5EWE A;  3DM3 A;  2RKS A;  1S5F D;  4X62 L;  2CW0 C;  1G6Z A;  2QDL A;  5FK9 C;  5E7N A;  4EQP A;  1HNW L;  2PMZ E;  5IT9 W;  2B2U A;  2C5C A;  2NVT B;  2YZN A;  2EY1 A;  4F4W A;  3BVZ A;  1EU4 A;  2DNC A;  5CV6 A;  3I56 A;  3I4L A;  4A3D G;  1PRT B;  4B3S L;  1L0X B;  2K75 A;  2LY7 A;  4X3K A;  3T16 A;  5KKN B;  2N8N A;  1XPU A;  3GTJ A;  1B3Q A;  3ND8 A;  3SE7 A;  4B3R H;  3R8B A;  1K0R A;  4C3H B;  1CZG A;  1XPR A;  5D3D A;  5DGB A;  2MHV A;  5C1O A;  3UDF A;  4A3C H;  3ZJY C;  5FLX W;  5BR8 H;  4MN3 A;  1H9M A;  1S5C D;  5D8D A;  4N9P A;  3RB3 A;  2ASJ A;  2YTV A;  1PFB A;  2RVL A;  5IYC H;  2K28 A;  1V1P B;  1VQC A;  4ED8 A;  2RGV A;  1I94 L;  3HKZ B;  2ZM6 L;  4X66 L;  2MPM A;  3KLS X;  3MXN B;  2PVP A;  4O2A F;  3S16 B;  2WTF A;  2UVR A;  4DK3 C;  1SSO A;  5HY6 A;  2MP1 A;  4IUU A;  2FE3 A;  2NYZ D;  1BUV T;  3GTQ B;  4F4Z A;  2BA1 A;  4LWC A;  5F9L A;  4XYQ A;  5FOB B;  3I7F A;  3S17 H;  4A93 B;  4CC6 A;  4PNY A;  2ALY B;  1M6V A;  4LF4 H;  2CQA A;  2JA6 B;  1KDC A;  3PW5 A;  4HR7 B;  3N42 B;  3H3V I;  4IZO A;  1B9M A;  1JE4 A;  1N33 H;  4KKU A;  5IOC A;  1IBM L;  2EYO A;  5CBA E;  2KVM A;  4GS3 A;  3KYH C;  3NSW A;  3NWS A;  2NUC A;  4RAU C;  1D1K A;  4ECX A;  2J6T A;  1QIL A;  2EYH A;  5LMU L;  2R93 H;  3HS0 C;  2W9B B;  5HGQ A;  3K5M A;  1XTD A;  4L5Q A;  2CKZ B;  3BZD B;  3RMH A;  4DV5 L;  4C3J G;  4HCE A;  3PIP A;  1HNZ H;  3GTG A;  3E9H A;  1C3O A;  2KED A;  2NU7 B;  1HR0 H;  1TA8 A;  4LNQ A;  2JJQ A;  4O3Q A;  1EIF A;  2YTY A;  4LFA H;  3L0O A;  2XD4 A;  5J39 A;  3U50 C;  1O7Z A;  5HUR A;  1G91 A;  4PG3 A;  4YJ2 F;  2VA2 A;  2UXD L;  3D4W A;  3OYY A;  1YJ9 A;  4M1U B;  2NU9 B;  1PDQ A;  4LFB H;  3S1Q H;  4ILW A;  1PV4 A;  4PQX A;  2B39 A;  3OPO A;  5IP9 G;  3Q23 A;  2I07 B;  1CKM A;  1YEZ A;  1ZYR C;  3RUZ A;  1XNR H;  1S68 A;  3KLW A;  4N9T A;  4X6A H;  1QB5 D;  1GUO A;  5IYD G;  3OSN A;  1TWA H;  3C2P A;  4LUV A;  5L1J A;  4MV3 A;  2UUA Q;  1LT4 D;  3VA7 A;  4A3I H;  2GPW A;  4EYI B;  2K52 A;  3T13 A;  3P1H A;  1SYG A;  5LA6 F;  2ZDQ A;  2E74 C;  5J1Z A;  2UU9 H;  5KFN A;  1I50 B;  4V19 0;  4IAL A;  1TWG B;  1EIY B;  4YAK B;  1WCM H;  2JE6 I;  1JKJ B;  5KFB A;  1VQ7 A;  3PCO B;  2Y0S B;  1NR4 A;  1VS0 A;  3K81 C;  5CA1 F;  4A3E G;  4EGQ A;  1Y1W G;  2BE5 C;  4HID A;  1VAJ A;  1MHW C;  3GTP H;  4DL6 A;  3AFP A;  3T1H H;  2L15 A;  1SMY C;  1B9N A;  2VB3 X;  2HHH L;  3QWN A;  2VA3 A;  4DR6 Q;  1ZYR D;  4X3T A;  4O42 A;  3IAY A;  1STE A;  2XRQ D;  5M3F H;  4LH7 A;  4DV0 Q;  3A8I E;  4JI2 H;  3SR1 A;  4H7B A;  1GYF A;  4B9X A;  3HOU G;  1A3U A;  2R7D A;  5KFP A;  4JI3 H;  2IX1 A;  3EPG A;  3CCU A;  3DWA A;  2HD3 A;  4BY7 B;  1EEI D;  3VR5 A;  1BNZ A;  2QIL A;  3VA5 A;  1KL9 A;  2VUM H;  4A3M H;  4OXP A;  2Z6B A;  4LUZ A;  1ILP A;  1K83 H;  1N32 Q;  1OXS C;  4ZQ3 A;  3HOX G;  4DL5 A;  1GUW A;  3NEM A;  2FJZ A;  1LT5 D;  5LYJ F;  1CKN A;  2ZT9 C;  1YZ6 A;  1CS0 A;  3H0G A;  3V6J A;  1PTO H;  2FMC A;  3GLK A;  5HV6 A;  5KRU A;  1FJG H;  3K5I A;  3TS2 A;  3OHX C;  1U4L A;  1AP0 A;  2A8V A;  4MZ9 A;  2FB9 A;  2Q8I B;  1YHQ A;  2QDB A;  4LF8 L;  4Q0F A;  2D0P A;  1S0M A;  3GTO B;  2WFW A;  5L37 A;  2JA7 A;  4AYB E;  3D31 A;  1SFO B;  3OUU A;  4ECR A;  4JI1 H;  4A75 A;  1CK1 A;  3U4Z A;  1ML0 D;  3T5H A;  1GUT A;  5JJK A;  2K50 A;  3PO2 B;  4JYA H;  5TSS A;  1K1S A;  2V59 A;  1I6H H;  4UDU C;  1F2M A;  4JI8 L;  3SK8 A;  4EFB A;  4DNI A;  5JEA H;  2UXB Q;  2NVY H;  4BBR G;  1JB3 A;  4L1K A;  4RGM A;  3QFF A;  2R93 A;  3GTM B;  2OTL A;  4JI7 L;  5KG7 A;  4ME3 A;  3WDN A;  1TWC B;  3DWQ A;  5C0X J;  2F0T A;  4DK6 C;  5LMN Q;  3RLN A;  4JK1 C;  2BDO A;  4JI6 L;  5IWA L;  1N36 L;  5M5W H;  1WD0 A;  3H3V H;  1NCV A;  3J80 c;  3HOY G;  4IUV A;  3A0J A;  3VR6 A;  1VMC A;  2F4V H;  3TIN A;  1PTO D;  3G7L A;  4K14 A;  1WTV A;  2L0C A;  1QNU A;  1Z2P X;  3NPP A;  3TP7 A;  2R7Z G;  4OWW B;  4ALP A;  4LF4 Q;  3DLL A;  1Q81 C;  3FDS A;  1EZ6 A;  1JOK A;  3BG5 A;  1N33 Q;  2R7F A;  2B63 H;  2R92 B;  1F9P A;  1D7Q A;  2MO0 A;  3H3V C;  4O1N A;  4TVA B;  5GAE C;  4R4C A;  1I4R A;  4JCV E;  4JV2 A;  3VYR A;  3DXJ C;  3A56 A;  4XQJ A;  5FKA C;  4QY7 A;  3GIK A;  5CB4 F;  1TWA A;  1JJC B;  1PH9 A;  3QZ7 A;  1DM0 B;  4DV7 H;  4BBS B;  4MV1 A;  4LF7 H;  3J81 c;  5EQ0 A;  4C5C A;  4GNX B;  1QZH A;  1WCM A;  3PGZ A;  3LNN A;  1GUG A;  1VQ5 A;  1HR0 Q;  2N88 A;  1E2V A;  1K8M A;  1F2L A;  1ULZ A;  1E22 A;  3F8N A;  3MR3 A;  5BN4 A;  1G2T A;  3S2D H;  1E4E A;  4ECZ A;  2WII B;  2SOB A;  5KFQ A;  1X6O A;  1I3Q A;  3TP5 A;  5C4J H;  4QUC A;  3W5O A;  1HQR D;  4OON A;  4RA8 A;  4IN3 A;  5JQW A;  4EGV A;  2VQF L;  3K0X A;  3CCQ A;  5JH7 F;  1HZ9 A;  2ZJQ A;  2YRW A;  3H6M A;  1TR5 A;  2IP4 A;  1TWH B;  1M4V A;  2VS1 A;  1M0W A;  1S4Z A;  4C2M H;  1O78 A;  3CC7 A;  1GSA A;  1GXD C;  4EX5 A;  5C3E H;  2R61 A;  1XTC D;  1TVX A;  4K5V A;  4LMQ D;  3VR4 A;  3AB9 A;  2XGQ A;  3N52 A;  4GOP B;  3MVV A;  3CF5 A;  3FP9 A;  5FO8 B;  2E5L H;  3D6W A;  2VUM A;  3FKI B;  4YR0 A;  1SJE D;  2YS7 A;  3HP3 A;  3DF7 A;  1GJX A;  2CW8 A;  1K83 A;  1R4P B;  3F1Z A;  1CQI B;  3ERQ A;  5FJ8 H;  1QJO A;  5KFW A;  3DEO A;  3T53 B;  1JR0 D;  5A35 A;  1R9T B;  1LAC A;  1JDE A;  2ZXR A;  4DR3 L;  3CRL C;  2EY5 A;  2KUM A;  3J7A F;  3T1H Q;  4JI4 L;  1J5E H;  5I9P A;  1KAB A;  5EWF A;  4A3G B;  1QOH A;  2F0U A;  4PMW A;  3TRE A;  4JBM A;  4DR4 L;  1PXU A;  2L9H A;  4QWE A;  4DAY B;  1EYC A;  5E1F A;  1FL0 A;  2OWO A;  4A3B B;  3TME A;  4JV1 A;  1W96 A;  1V4Y A;  2W9C B;  3SK4 A;  4KY7 A;  1LM0 A;  4OO1 G;  3FPU B;  2GN5 A;  4LMY A;  1UNN C;  1FGB D;  3PUW A;  1SE4 A;  2F0O A;  3NBI A;  2VQE L;  2YCH A;  2CCZ A;  3HOZ G;  3X3M A;  4A3K H;  4BXX G;  3RZD H;  2RDI A;  2NVY A;  1DOL A;  3PW7 A;  2EXD A;  3UQ8 A;  1Q82 C;  1BBU A;  4J15 A;  2C2E A;  3FRP B;  4J9K A;  3NQT A;  2F0I A;  4P2C B;  3TII A;  1N34 H;  4HSP A;  5CV8 A;  2I80 A;  4ZOL F;  2K5Q A;  4GLX A;  4X65 Q;  1VF7 A;  1FJG Q;  4A3J B;  3I4M H;  1GHK A;  1K1Q A;  3V4S A;  2PI2 A;  3W1G A;  3AEV A;  3KHR A;  3K6O A;  3ULP A;  2ZTD A;  4Y7N H;  3HOV H;  1HXY D;  3R2I A;  3HB9 A;  3K0Y A;  1L1O B;  4P74 A;  4DR5 L;  3I91 A;  4LF5 Q;  2YW2 A;  1SBB B;  3F2C A;  2R7N A;  1B44 D;  2V58 A;  4FS1 A;  3I8Z A;  5L1L A;  2B3G A;  1BR9 A;  1F2Y A;  2FPP B;  1CQJ B;  2F3V A;  3I70 A;  1UAP A;  1SRU A;  2F0E A;  2H5X A;  5C5L A;  2J4X A;  2RCN A;  5DLG A;  2KEE A;  1Y1V G;  3BJU A;  5BPF A;  1EOV A;  3SHL A;  2NVT H;  1JX4 A;  1XMQ H;  1STG A;  2B63 A;  4RUA A;  2Y0S E;  4OX9 H;  3OWE B;  3D6C A;  4A3F G;  3PR4 A;  2WAQ A;  2PQE A;  2MJ8 A;  4ECW A;  1FNV A;  1XYI A;  4QWC A;  2X6G A;  3NP8 A;  2Z0S A;  1L2F A;  4CDC C;  2PW7 A;  5CYU A;  2F1M A;  5J2T F;  5KEE A;  1HRJ A;  2KA7 A;  3OTO H;  1OXT A;  3G8C A;  1G8Z D;  3CCR A;  3L4J A;  1KJJ A;  4NXN H;  4H13 C;  1ZKO A;  2K04 A;  1Z7T A;  2K5V A;  3QR8 A;  4CKC A;  2Z1C A;  1NTG A;  4O2D A;  4ZKB B;  5C4X H;  1PRT C;  2FK1 A;  1F77 A;  1AUV A;  3T5K A;  3KDF B;  4DUY Q;  1EIH A;  4DUZ L;  4YB8 B;  4YCU A;  1KJQ A;  1TY2 A;  2E2I B;  1CTM A;  2L12 A;  3GTQ H;  1KLG D;  1KQS A;  2W6P A;  3V05 A;  1C9O A;  3N43 B;  3CU7 A;  3M9M B;  1K28 A;  1MZB A;  3RIZ A;  5CAE B;  4LFC H;  1H95 A;  1JWS D;  1H9S A;  1O80 A;  4DL4 A;  4C2M A;  1M8A A;  1LTB D;  1EYD A;  4F4Y A;  1BDO A;  4XQQ A;  4C3J B;  1L0W A;  5LL6 b;  1SE2 A;  1D5X C;  4DV7 Q;  4DAM A;  3H91 A;  4K8J A;  3GII A;  4IUP A;  4HIM A;  3CVZ A;  4HJ8 A;  4LF7 Q;  3G6J B;  1XMO H;  2C28 A;  5M5X H;  3CRK C;  4NXM L;  3H20 A;  2MFI A;  4EVO A;  3K3P A;  3GIJ A;  4RZQ A;  5C0X I;  5IP7 G;  1IBL H;  4X64 H;  3G6E A;  5JEA J;  4MV8 A;  4WJ4 A;  2F0G A;  3HBL A;  3U9S A;  2Q2H A;  4KLK A;  3GQC A;  5D1O A;  5KFX A;  1IHZ A;  4DAV A;  2OXP A;  4K5W A;  3Q8R B;  2XTI A;  1F9Q A;  1PZI D;  4DR2 H;  3KTM A;  1JWU D;  3BZC A;  4FDB A;  4POF A;  3BJY A;  1B6R A;  3ORQ A;  4BY1 H;  2O5I C;  3PW0 A;  1U9R A;  2R7L A;  1A2U A;  1Z9F A;  1ONL A;  2BOS A;  4U6P A;  2J0T D;  2A5H A;  1PH8 A;  4YHH Q;  1X56 A;  2JEA I;  4YP3 A;  1Q8K A;  1PLF A;  2E5L Q;  2GVA A;  3K57 A;  4A3E B;  4LF6 Q;  5IYB G;  3UDI A;  3BDO A;  1Y1W B;  4QQB X;  3G6X A;  2B8F A;  1W6K A;  4QUF A;  2VR1 A;  4IAJ A;  2AWO A;  2DPJ A;  1IKM A;  3NEL A;  2EXZ A;  2ATW A;  4FBU A;  5EBD A;  1V1Q A;  3GTL B;  1IL8 A;  2DUD A;  2EVB A;  2B2V C;  5I9O A;  1VQ8 A;  3S15 B;  5ELB A;  3PZP A;  3BQ2 A;  5DM7 3;  2BA0 A;  1T94 A;  1IW7 C;  4DN4 M;  4EEY A;  1SNO A;  3HOU B;  4PZ8 A;  4L8J A;  1LLR D;  1AW7 A;  3FPP A;  4F87 A;  1HHV A;  2N78 A;  4K6L A;  5COR A;  2HGS A;  2XRS D;  4FP5 D;  2UUA L;  1S3O A;  4IOA A;  1AN8 A;  1PYW D;  3T1Y Q;  3MWE A;  2O4X A;  2C00 A;  2W7O A;  3HOX B;  1S97 A;  3FVQ A;  3BZK A;  3C0F B;  3KBX A;  2IHE A;  1WTO A;  1H9R A;  2NVX H;  3H40 A;  1NUC A;  2NU6 B;  4EEQ A;  2AU0 A;  3I2Z A;  4KI0 A;  1S5E D;  3C1E A;  1JIH A;  1JMC A;  4BY7 H;  1I4G A;  1LYL A;  3R3O A;  1K8O A;  2FLN A;  3C1F A;  2LKV A;  1XNQ H;  1BXR A;  2IBK A;  1RD9 D;  4YCW A;  3MAQ A;  1JOR A;  2LFN A;  1UWV A;  1CUK A;  3H94 A;  4XYL B;  4JI0 Q;  4DR6 L;  1GSO A;  1F9S A;  1D5M C;  4I7Z C;  3PMF A;  2UUC Q;  2JEB I;  5KFT A;  4DV0 L;  4KK7 A;  1K8A C;  2YU9 B;  4G57 A;  3E5S A;  5L1K A;  1WTH A;  4G7H C;  2F0M A;  4GN4 B;  1VQG A;  3Q1K A;  1DOK A;  1AZP A;  2EJG C;  2KCM A;  2WP8 J;  4R1J A;  1PVO A;  2F0D A;  5DLQ E;  1PRT F;  4BBR B;  4HYK A;  4FM9 A;  4DU9 A;  2F0K A;  4DFA A;  5KFF A;  3HOW H;  1N32 L;  2PBZ A;  4J9L A;  1WTW A;  4B3T Q;  4YY3 Q;  4IPG A;  3GV5 B;  1XMQ Q;  4DR1 H;  3FDT A;  5CC4 A;  4C3I G;  3PO3 B;  3MA2 B;  1UC8 A;  4UCT A;  2CW7 A;  1H9J A;  3K7A B;  3PQI A;  2VQD A;  1UE1 A;  4AYB B;  1CHQ D;  4YWL A;  2R3Z A;  3HOY B;  1GLV A;  4IR1 A;  1IOW A;  1E4F T;  4R4I A;  3CQZ H;  4HNV A;  1AEX A;  4IRC A;  4FXD A;  2Z9H A;  1N56 A;  1V51 A;  3M7G A;  4YWM A;  2VXW A;  1SEI A;  4RB1 A;  5GON F;  5G3L F;  3OHA A;  2R7Z B;  3KJO A;  1SE3 A;  2K01 A;  5KFR A;  1NBW A;  1J9O A;  5KFG A;  2J7Z A;  4GKJ H;  3HZX A;  1JQY D;  4PWQ A;  3CCS A;  3LWU A;  4K0K L;  2UXB L;  2IL8 A;  3S1R H;  4J6H A;  1M90 C;  2R6G A;  3PSI A;  3PUY A;  3RFC A;  2OEO A;  1SMX A;  2RBM A;  1G2S A;  3Q22 A;  2OH2 A;  4O3S A;  3T51 B;  4IPH A;  3M7N A;  4CJ2 C;  1EQT A;  5LMN L;  1BCP B;  4PMC A;  3M85 A;  5C0X H;  3N44 B;  4J9R A;  2AQ3 B;  2TMP A;  2AQ2 B;  4RAZ A;  2J6U A;  2N3S A;  3VPC A;  4LJZ C;  5I6W A;  2JXM B;  1XMO Q;  5JPN C;  4O4L F;  4NLG A;  4KY5 A;  1E4G T;  1LV9 A;  2FFK B;  3P20 A;  1FR3 A;  1CE8 A;  1KNE A;  5D14 A;  3F2B A;  4A3C G;  1LTG D;  3QJY A;  1AE2 A;  1LTA D;  1PH1 A;  1JIC A;  4LF4 L;  2G9D A;  1YNN C;  5IYC G;  3H0G G;  1GOZ A;  1P8L A;  1VDZ A;  4XX0 B;  2EY2 A;  4NKL A;  4Y8V B;  3DWP A;  3OW2 A;  5D65 A;  4DR2 Q;  5C4H A;  1A62 A;  2DJF C;  3RGZ A;  3V6K A;  4ODG A;  4ZKC B;  1UE7 A;  4MTK A;  1IOV A;  2XGP A;  5KFH A;  4J9Q A;  1XJV A;  3PR5 B;  2NZ1 D;  3SK5 A;  2JA7 G;  5KFY A;  5EWG A;  2F3W A;  2OTJ A;  1UE5 A;  1LO5 D;  4PMB A;  2JA9 A;  4TV8 F;  4ECY A;  1TWH H;  3PW2 A;  4LF9 H;  3HGB A;  3NHH A;  1ENF A;  2Q8T A;  1RJP A;  2NVX A;  3MXP A;  4TQS A;  2A68 C;  1HNX H;  4YJ3 F;  1HR0 L;  2N55 A;  1V8Q A;  1W6J A;  2I5H A;  3T5L A;  1SDF A;  1YI2 A;  3GV8 B;  4JV5 H;  2J9G A;  3KF8 A;  1B3A A;  4OIK A;  3PIO 3;  3GV7 B;  2R93 G;  1WR2 A;  1RTO A;  1PH2 A;  4F50 A;  2K05 A;  2J6S A;  1ESR A;  2NVQ H;  2R82 A;  1MJC A;  2O03 A;  4IUT A;  5M5Y H;  2UXC Q;  5EKL A;  1Z2N X;  2CW0 D;  4IUQ A;  4GOP C;  4A3G H;  5JJZ A;  1JJG A;  1HQM C;  1GUN A;  2RHS B;  5EPK A;  4A3B H;  5C44 H;  3EFX D;  2K6A A;  2A68 D;  3I55 A;  5IGB A;  1BNC A;  1BGW A;  3BS1 A;  4FF2 A;  2A19 A;  2N49 A;  1TS2 A;  3UE0 A;  4GC6 A;  2M9V A;  1PFN A;  4UHV A;  5CV5 A;  3J80 i;  3C3L A;  1RL2 A;  2V4R A;  3MC0 B;  3SDZ A;  4QL5 A;  3T1H L;  1VQJ A;  1C0A A;  1Y14 B;  2HQL A;  5L1I A;  2YRX A;  4A3I G;  1TXY A;  4DV3 H;  1K9M C;  2JA5 H;  4MNO A;  3CQZ A;  3GO5 A;  1WCM G;  5KND A;  1WYD A;  4S3S A;  1HA6 A;  2ATL A;  2XNA C;  4A3J H;  3K5N A;  3KFU A;  4QGU A;  5KFM A;  3S14 H;  5HGT A;  4RCN A;  2CVR A;  1Y1V B;  2LSS A;  4UP7 A;  4L6T B;  1B70 B;  4A3F B;  5FPR A;  1NSN S;  1KJ9 A;  3J81 i;  3KLR A;  1JJ2 A;  1S10 A;  3R2T A;  4DV2 H;  4K2L A;  2ICE C;  2RA4 A;  5M3M G;  2D62 A;  2EYP A;  1W3S A;  2W8K A;  3J81 L;  1PZJ D;  1HA5 A;  5M3F G;  4X3S A;  3AYH B;  4Q5V A;  4X65 L;  1UUP A;  2IY5 B;  2WV6 D;  1FJG L;  1HNW H;  1L1O C;  2W8L A;  1MKH A;  1NAP A;  4OIJ A;  1ZET A;  1RYR A;  4G3I A;  1EZ8 A;  2ZJR A;  5K36 H;  5IT9 E;  1MJE A;  3I4O A;  4LF5 L;  4O4I F;  1Y69 U;  3TN2 A;  2VUM G;  4DV6 H;  4B3S H;  1P16 A;  4A3M G;  2E2H B;  3OSP A;  4A2A A;  4FF3 A;  2F0Q A;  5F9N A;  4DK1 A;  1ET6 A;  4IHJ F;  4MV6 A;  3PV0 A;  1WH2 A;  2DNE A;  1YHA A;  5KG0 A;  4M8A A;  1NMF A;  4ED1 A;  1U4M A;  5IT9 L;  3LWE A;  5FLM H;  4GKJ Q;  2HDM A;  2C2D A;  5T1I A;  5FLX E;  2LXK A;  1KJ8 A;  1OXX K;  4TQU S;  4ED2 A;  1II3 A;  2PQA A;  2PI2 E;  4HJ9 A;  1JOO A;  1CA5 A;  4X66 H;  2HT1 A;  5KT2 A;  1EWC A;  1ASZ A;  4HAE A;  1I5F A;  1DXM A;  4QWA A;  5ELC A;  3Q8P B;  2XN9 C;  4EBE A;  1X54 A;  5FLX L;  2X69 A;  1FKA H;  3UDG A;  1TWH A;  5AFW A;  3Q8D A;  2W6M A;  2IT1 A;  4QWB A;  2B8G A;  3DM1 A;  1NR2 A;  5DGA A;  1OXV A;  4JI5 H;  1SYE A;  5EKK A;  5C3W A;  1JCK B;  5JEA G;  4M9U A;  3A5Z B;  4DUY L;  1EU3 A;  1O7L A;  4IQZ A;  3K59 A;  5T1G A;  5GAD C;  1EWH A;  1IBM H;  2L4N A;  3KF6 B;  2WAQ E;  1IYV A;  4QWD A;  3AFQ A;  3J7Y W;  5LMU H;  5I4D A;  2BE5 D;  2R7K A;  3PN1 A;  2IHF A;  1D5Z C;  3EJI A;  4MHE A;  4Q8E A;  2PYK A;  3MXG A;  2E2J B;  3RN5 A;  1FVI A;  1SMY D;  3I72 A;  2HCC A;  2F0H A;  5IOD A;  2SDF A;  2JSO A;  2P0A A;  1E24 A;  1MSG A;  2H1E A;  4DV7 L;  4IR9 A;  1SYD A;  3GTJ B;  1UE6 A;  3H15 A;  4LF7 L;  4CJ0 B;  3VYS A;  2NN6 G;  3HG9 A;  2IA6 A;  3KLS A;  2TSS A;  4O3O A;  1FYC A;  3EA6 A;  3K80 C;  1PH3 A;  2B63 G;  4U7C A;  2WAQ G;  3V96 A;  2KCT A;  4B3R Q;  3Q8S B;  1OWT A;  3RNU A;  5A2Q W;  3CHB D;  5BR8 Q;  3BAB A;  2JA5 A;  3GTL H;  4MA5 A;  1UNS A;  2AQ4 A;  3S15 H;  2DGY A;  4IJL A;  4MTN A;  1IL2 A;  2ENB A;  1DON A;  4BWG B;  3W3A A;  2XWJ B;  2SNS A;  4YHH L;  5C5J A;  1MD2 D;  2K4K A;  2CQO A;  4EBD A;  2E5L L;  1N9W A;  2RSO A;  3G4S A;  4L5T A;  4LF6 L;  2JA8 H;  1SNQ A;  3M9N B;  4H02 A;  2B2T C;  1DD2 A;  2EYJ A;  1B8A A;  1QE6 A;  5I6Y A;  3N6R A;  4DV4 H;  3R5H A;  5LL6 S;  2HHH H; 
#chains in the Genus database with same CATH homology
 4JI3 L;  1E1T A;  4AH6 A;  4OO1 I;  2ZTE A;  4A4I A;  2V1C C;  1YIT A;  3M4O H;  4BBS G;  3CAM A;  2QA4 A;  1OXT A;  4A3D H;  3M9B A;  3CCR A;  5C3E G;  2D0O A;  1LUZ A;  4UPA A;  3E9I A;  4LF9 L;  2K5V A;  1OTC A;  1NTG A;  4O2D A;  5C4X H;  3K8A A;  1PH7 A;  4DR3 Q;  1HNX L;  2FXQ A;  2NN6 I;  3UDX A;  3KDF B;  4DUY Q;  4DR1 Q;  3S2H H;  1EWI A;  4JC0 A;  1HJP A;  2F3I A;  4DUZ L;  4JI4 Q;  4JV5 L;  4YCU A;  5FJ8 G;  3T1Y L;  5AJ3 Q;  4DR4 Q;  3GTQ H;  2B29 A;  1HNZ Q;  1KQS A;  4BA2 I;  2WB1 G;  2GVB A;  2EQS A;  1C9O A;  1NJI C;  1K3R A;  4LFA Q;  1KRT A;  1BKB A;  1H95 A;  1EQR A;  2JK8 A;  4JI1 L;  3CCV A;  4GNX A;  4DV2 Q;  1L0W A;  3KOJ A;  1SR3 A;  1VQH A;  4DV7 Q;  4JYA L;  4DAM A;  1AE3 A;  2Z6K C;  1QUQ B;  3G48 A;  2VQE Q;  3GTG H;  4LFB Q;  4HIM A;  4HJ8 A;  4LF7 Q;  4GLA C;  4JI0 L;  3FKI G;  3I4N H;  1HNW Q;  5IE8 A;  4PZ7 A;  2K5N A;  5M5X H;  3CMA A;  2UUC L;  4NXM L;  2LXJ A;  3PO3 H;  1XNR Q;  1G51 A;  2MFI A;  1VQO A;  3ER0 A;  4DR7 L;  1QVF A;  5C0X I;  1VQ4 A;  1WOC A;  2MQH A;  5IP7 G;  4DV6 Q;  2E2I H;  3G6E A;  4L5R C;  5JEA J;  2ZJP A;  4A3L H;  4WJ4 A;  4A3K G;  3S24 A;  2Q2H A;  4KLK A;  4HJ7 A;  5ELO A;  2K14 A;  2UU9 Q;  2MNA A;  2XTI A;  4C3I H;  3HFZ B;  4OWX B;  4DR5 Q;  3E0E A;  3BZC A;  4FDB A;  4POF A;  1BVS A;  2Q2T A;  2R7Z H;  2CWP A;  1J6Q A;  4C3J H;  1VQE A;  3B6Y A;  3RLF A;  1K8G A;  4B3T L;  4JG2 A;  3W1B A;  2RF4 A;  4UP8 A;  1E1O A;  4YWK A;  4YY3 L;  4A3B G;  4DV3 L;  4GOP A;  1XMQ L;  1Q7Y C;  2F4V L;  5H1S E;  1Z9F A;  2RHQ B;  3HOV G;  1PFS A;  3D0F A;  1I3Q H;  1IZ6 A;  4DV4 L;  1PH8 A;  1Q46 A;  3MEF A;  4YHH Q;  1KXL A;  1YNX A;  1MIU A;  1X56 A;  4UP9 A;  2JEA I;  3M3Y H;  1Q8K A;  1PA6 A;  4POG A;  2E5L Q;  2GVA A;  5M3M H;  4LF6 Q;  3TQY A;  5IYB G;  3UDI A;  4IFD G;  4QQB X;  1VCI A;  1PH6 A;  4JI2 Q;  3UE1 A;  3U4V A;  3S1M H;  2AWO A;  2ZTC A;  3NEL A;  1EQQ A;  5IP9 H;  4JI5 Q;  4JI3 Q;  2UUB L;  2ATW A;  1CKN B;  3KF6 A;  3RZO H;  1V1Q A;  3CME A;  4NPS A;  3DM3 A;  2DUD A;  1WJJ A;  2OQK A;  2XGT A;  4X62 L;  1VQ8 A;  2JA8 G;  4GKK L;  5IYD H;  3CXC A;  1B7Y B;  3KF8 B;  2BA0 A;  4RG1 A;  5E7N A;  4LF9 Q;  1HNW L;  2PMZ E;  1YHB A;  4HJA A;  4PZ8 A;  2HIV A;  1HNX Q;  2N78 A;  3I56 A;  4A3D G;  1PH5 A;  2UUA L;  4B3S L;  1S3O A;  2K75 A;  4IOA A;  4JV5 Q;  2N8N A;  3T1Y Q;  4A3E H;  1XPU A;  1Y1W H;  1K0R A;  1XPR A;  5C4X G;  3HKZ G;  3BZK A;  3KJP A;  1D8L A;  3UDF A;  3PF4 A;  1TWF H;  2IHE A;  4A3C H;  3TS0 A;  2NVX H;  3ZJY C;  3I2Z A;  4KI0 A;  3AQQ A;  1VQD A;  3CPW A;  1XMO L;  1W2B A;  2YTV A;  1WFQ A;  2VL6 A;  4PZ6 A;  5IYC H;  1JMC A;  4JI1 Q;  2IX0 A;  1VQC A;  4BY7 H;  1LYL A;  1I94 L;  4JYA Q;  1X55 A;  3F8T A;  2ZM6 L;  4YCW A;  4X66 L;  3MXN B;  3HOU H;  1L1O A;  4O0A A;  5GRO A;  2A1A A;  1UWV A;  1CUK A;  1WI5 A;  4JI0 Q;  4DR6 L;  4DK3 C;  4K0K Q;  5HY6 A;  1HZB A;  2JEB I;  2UUC Q;  4A76 A;  1VQK A;  4DV0 L;  2BA1 A;  5J3B A;  4DR7 Q;  4LWC A;  1K8A C;  4WJ3 M;  3S17 H;  3I7F A;  4P75 A;  3ICE A;  2ALY B;  2CFM A;  4C3H H;  3HOX H;  4GN4 B;  1K73 C;  3PUZ A;  1VQG A;  1VQ9 A;  1S72 A;  1SE8 A;  1T9H A;  5GAH C;  1PH4 A;  3I4N G;  1VQB A;  2KCM A;  2WP8 J;  2Z6K A;  2MO1 A;  3M4P A;  3H3V I;  4R1J A;  3PO3 G;  1PVO A;  1V43 A;  5DLQ E;  4IOC A;  1J5E L;  1EFW A;  1IBM L;  4A3L G;  4GS3 A;  3HOW H;  3KYH C;  1N32 L;  2KEN A;  4B3T Q;  4AYB G;  4YY3 Q;  4IPG A;  3J81 j;  5LMU L;  4DV1 L;  4DV3 Q;  1XMQ Q;  2R93 H;  2F4V Q;  5HGQ A;  1XTD A;  4L5Q A;  2CKZ B;  3S16 H;  4JOI C;  3A74 A;  4DV4 Q;  2YTX A;  4DV5 L;  4BY1 G;  3PIP A;  1HH2 P;  1G6P A;  1UE1 A;  3E9H A;  4YWL A;  1M1K C;  2YU9 H;  4LNQ A;  4A93 H;  2BH2 A;  2JJQ A;  1EIF A;  3CQZ H;  2YTY A;  4R4I A;  2JA6 H;  3L0O A;  3KDF A;  4YWM A;  3U50 C;  4QJF A;  4PG3 A;  2UUB Q;  3KJO A;  2UXC L;  4BBR H;  2UXD L;  3OYY A;  4HJ5 A;  1V9P A;  1YJ9 A;  4X62 Q;  4GKK Q;  1FGU A;  1C7Y A;  1N34 L;  1NBW A;  3S1Q H;  4KHP L;  1PV4 A;  3ERS X;  3CCS A;  2ASB A;  5ELN A;  3PUV A;  4K0K L;  2UXB L;  4LW1 A;  5IP9 G;  3S1R H;  1CKM A;  1YEZ A;  4P73 A;  2KBN A;  3KLW A;  1M90 C;  2AHO B;  2R6G A;  1HZA A;  4P72 A;  4B3M L;  3PSI A;  3PUY A;  4X6A H;  5IYD G;  1SMX A;  1TWA H;  1E3P A;  4LUV A;  3STB C;  2UUA Q;  3K7A H;  1QUQ A;  4A3I H;  4B3S Q;  2K52 A;  1OXU A;  3HOY H;  1LTL A;  2AMC B;  3M7N A;  4IPH A;  5LMN L;  3M85 A;  2PQA B;  1S40 A;  1VQI A;  2VZA A;  3JAM i;  1EIY B;  1WCM H;  2JE6 I;  4BY1 H;  5JJL A;  1VQ7 A;  2KHI A;  3PCO B;  2KHJ A;  2N3S A;  1U0L A;  3EN2 A;  1VS0 A;  3CD6 A;  5IT9 c;  3K81 C;  1KRS A;  3EIV A;  1XMO Q;  2VUM H;  4A3E G;  3I4M G;  2E8G A;  1Q1B A;  3FHW A;  1Y1W G;  4HID A;  3IRB A;  1I94 Q;  3GTP H;  4OX9 L;  1JE5 A;  3AFP A;  3RLO A;  3F2B A;  4A3C G;  2ZM6 Q;  2L15 A;  3CCJ A;  4X66 Q;  1AE2 A;  1PH1 A;  2HHH L;  4LF4 L;  4BY7 G;  5IYC G;  3H0G G;  4DR6 Q;  2EIF A;  1P8L A;  3HKZ E;  1YIJ A;  3OTO L;  1GO3 E;  3OW2 A;  5M3F H;  2JQO A;  5FLX c;  4DV0 Q;  4DR2 Q;  1SRO A;  1A62 A;  4NXN L;  2QGQ A;  3L7Z C;  4L5S A;  2R7D A;  1UE7 A;  1G29 1;  1I50 H;  3HOU G;  1TWG H;  2IX1 A;  3CCU A;  4JBW A;  1XJV A;  2JA7 G;  2NZO A;  2OTJ A;  3CCM A;  1Z47 A;  4HIK A;  1KL9 A;  1UE5 A;  1KC8 C;  2JA9 A;  4A3M H;  1J5E Q;  4OXP A;  4LUZ A;  1TWH H;  1IBM Q;  4XTC S;  1K83 H;  1N32 Q;  1OXS C;  3HOX G;  3NEM A;  5LMU Q;  4DV1 Q;  1HR0 L;  1CKN A;  2VW9 A;  2I5L X;  1YZ6 A;  4IJH A;  1KIX A;  2I5H A;  3NEN A;  1GD7 A;  1YI2 A;  4LFC L;  4DV5 Q;  3TS2 A;  3HOW G;  2A8V A;  1NMG A;  4MZ9 A;  1E7Z A;  1YHQ A;  2R93 G;  4LF8 L;  1PH2 A;  1VQL A;  1GKH A;  2D0P A;  2VY3 A;  1CKO A;  2NVQ H;  4GKJ L;  2WFW A;  1MJC A;  4AYB E;  3D31 A;  3ULL A;  4A75 A;  4JBK A;  3U4Z A;  3GD7 A;  5M5Y H;  2AKW B;  2UXC Q;  2UXD Q;  5JJK A;  2K50 A;  3M4Q A;  4JOI A;  3SGI A;  3GDE A;  4YCV A;  4GOP C;  1YJN A;  4A3G H;  4A93 G;  1JJG A;  3HKS A;  1N34 Q;  1IBL L;  4X64 L;  2JA6 G;  2RHS B;  4KHP Q;  1I6H H;  4JI8 L;  1N8R C;  4DNI A;  4A3B H;  4UY8 C;  2UXB Q;  5C44 H;  2NVY H;  4BBR G;  4B3M Q;  3I55 A;  4AIM A;  4DR2 L;  4IFD I;  1EUJ A;  4IFD J;  2A19 A;  2OTL A;  3K7U C;  1GM5 A;  2N49 A;  4ME3 A;  4JI7 L;  1VQ6 A;  3UE0 A;  5C0X J;  4DK6 C;  5LMN Q;  3RLN A;  3J80 i;  1IBK L;  3GTO H;  1IYJ B;  1RL2 A;  4KHZ A;  3RR5 A;  4JI6 L;  4QL5 A;  3T1H L;  1VQJ A;  1SFO H;  1C0A A;  2QEX A;  1Y14 B;  2HQL A;  5IWA L;  1N36 L;  5M5W H;  3H3V H;  1HZC A;  3L2P A;  4A3I G;  3J80 c;  3PO2 H;  1TXY A;  3HOY G;  3A0J A;  1K9M C;  4MNO A;  2I0Q A;  2JA5 H;  5C0X G;  1GVP A;  3CC4 A;  1KD1 C;  3A5U A;  4OX9 Q;  3GO5 A;  3G71 A;  3EBE A;  1WCM G;  4IO9 A;  3U58 A;  3HOZ H;  1WYD A;  4BXX H;  1VQA A;  1JT8 A;  4A3J H;  1RIP A;  3KFU A;  4QGU A;  2R7Z G;  2HHH Q;  4ALP A;  4OWW B;  3S14 H;  4LF4 Q;  3DLL A;  3CP0 A;  1Q81 C;  2LSS A;  3OTO Q;  4UP7 A;  2Q2U A;  4Y52 H;  1N33 Q;  3GTM H;  2R7F A;  1B70 B;  1VQM A;  2B63 H;  1D7Q A;  1TWC H;  2MO0 A;  4NXN Q;  4TVA B;  5GAE C;  1EYG A;  4R4C A;  3J81 i;  4JCV E;  1JJ2 A;  4IPC A;  4APV A;  2HIX A;  5JJI A;  4QY7 A;  3CCE A;  3PUX A;  1JJC B;  5M3M G;  2D62 A;  1PH9 A;  1W3S A;  1YJW A;  1PHJ A;  2I5M X;  5M3F G;  1PYS B;  3J81 c;  3VDY A;  5GQO A;  3AYH B;  4GN5 A;  4X65 L;  4GNX B;  2IY5 B;  1FJG L;  1QZH A;  4JBJ A;  1L1O C;  1IXR A;  3PGZ A;  4B3R L;  1MKH A;  1X3G A;  1QZG A;  1VQ5 A;  4AQY L;  1HR0 Q;  2K5H A;  2ZJR A;  2Y0S G;  3RN2 A;  1SN8 A;  3I4O A;  1MJE A;  2OCE A;  4LF5 L;  5BR8 L;  2VUM G;  1E22 A;  1P16 A;  2ID0 A;  4A3M G;  1X3F A;  1Y1V H;  4LFC Q;  3S2D H;  3F2D A;  1X6O A;  1AH9 A;  5C4J H;  2R92 H;  4A3F H;  3PV0 A;  5EAY A;  4LF8 Q;  2YYZ A;  1YHA A;  3W5O A;  4OON A;  1XNQ L;  3JC6 6;  1NMF A;  2VQF L;  3K0X A;  3CCQ A;  1BBW A;  1HZ9 A;  5FLM H;  2ZJQ A;  4GKJ Q;  2YV5 A;  4EQ5 A;  4R4T A;  4P71 A;  3JAM c;  1QVC A;  4GLV B;  1DGS A;  2LXK A;  1OXX K;  2VS1 A;  4R4O A;  4C2M H;  4BBS H;  4TQU S;  3GTK H;  3CC7 A;  1YVC A;  4NB3 A;  2PQA A;  2PI2 E;  4EX5 A;  5C3E H;  4HJ9 A;  1IBL Q;  4X64 Q;  2HT1 A;  5GAG C;  4HIO A;  1ASZ A;  4JI8 Q;  4DPG A;  3J7Z C;  4GOP B;  1I5F A;  3CF5 A;  2AWN A;  3FP9 A;  1X54 A;  1JB7 A;  3CCL A;  1N33 L;  3UDG A;  3Q8D A;  2E2H H;  2IT1 A;  1PYB A;  5IY0 A;  3F1Z A;  4A3G G;  3STB D;  5FJ8 H;  4IPD A;  1OXV A;  4JI7 Q;  3BU2 A;  3NBH B;  5JEA G;  3A5Z B;  3PF5 A;  4DR3 L;  5C44 G;  1X3E A;  4GNX C;  1ASY A;  3CW2 C;  1IBK Q;  4DUY L;  4JI6 Q;  4DR1 L;  1YBY A;  1X9N A;  3T1H Q;  4JI4 L;  5GAD C;  3KF6 B;  4PMW A;  2WAQ E;  3TRE A;  3ULJ A;  5IWA Q;  5AJ3 L;  1VQP A;  1N36 Q;  4JBM A;  4DR4 L;  2C35 B;  3AFQ A;  1HNZ L;  4DAY B;  2OWO A;  1FL0 A;  1CSQ A;  1KAW A;  2VNU D;  2IHF A;  3TEH B;  4RMF A;  1FVI A;  3RN5 A;  4LFA L;  1VQN A;  4R4Q A;  2NZH A;  1LM0 A;  3CC2 A;  4OO1 G;  3FKI H;  2GN5 A;  1X65 A;  2BH8 A;  1E24 A;  2OQ0 A;  1Q86 C;  1A0I A;  3PUW A;  4DV2 L;  3PO2 G;  1A8V A;  2F52 A;  4DV7 L;  2JA5 G;  5LMN W;  5IP7 H;  2VQE L;  4LFB L;  1XPO A;  1NY4 A;  1VQF A;  2CCZ A;  3HOZ G;  4A3K H;  1UE6 A;  3H15 A;  3RZD H;  1R9T H;  1QVG A;  1O7I A;  4A3J G;  4LF7 L;  4BXX G;  1A63 A;  2EXD A;  1KHI A;  2NN6 G;  2PNH A;  1BBU A;  4J15 A;  1Q82 C;  1XNR L;  2Q2I A;  4BA1 I;  3LGJ A;  4DV6 L;  3K80 C;  4GN3 B;  4LUO A;  1PH3 A;  2B63 G;  4DUZ Q;  2CWA A;  1NE3 A;  4GLX A;  1UEB A;  4XIG S;  4X65 Q;  3PIO A;  2WAQ G;  4OWT B;  1U5K A;  1FJG Q;  2KCT A;  3I4M H;  4B3R Q;  2UU9 L;  2PI2 A;  2E2J H;  3W1G A;  4DKA C;  3AEV A;  3RNU A;  4AQY Q;  2ZTD A;  4Y7N H;  3ULP A;  3HOV H;  4P74 A;  1L1O B;  4DR5 L;  4LF5 Q;  5BR8 Q;  3F2C A;  2ES2 A;  3GTL H;  3TRZ A;  3H0G H;  2B3G A;  3S15 H;  3S1N H;  2DGY A;  4IJL A;  4MTN A;  5IYB H;  3GTJ H;  1IL2 A;  3J7A 5;  1XNQ Q;  1Q1E A;  5K36 G;  1SRU A;  2VQF Q;  2H5X A;  2RCN A;  4YHH L;  3CPF A;  1Y1V G;  1Q12 A;  2K4K A;  1EOV A;  2CQO A;  3BJU A;  2NVT H;  1CSP A;  2E5L L;  1N9W A;  3WWV A;  2WB1 E;  3G4S A;  4L5T A;  4LF6 L;  1SLJ A;  4NXM Q;  2JA7 H;  2Y0S E;  4H02 A;  2JA8 H;  2R92 G;  4QIW E;  1B8A A;  4A3F G;  4JI2 L;  1HR0 W;  2Z0S A;  1L2F A;  4JI5 L;  5FLM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...