3IG0A

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 2.1 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
185
Chain Sequence
TDPRKSELYVVEGMFQAILPLRGIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords DNA gyrase subunit B
publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 60
structure length 185
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ig0A02
2ZJTA 3M4IA 3IG0A
chains in the Genus database with same CATH superfamily
1GSAA 1JDBB 1M0WA 3BJYA 1S97A 2PN1A 1Z2OX 4YP3A 1XNRH 1VS0A 1HR0H 4BWSC 1I6UA 5KFCA 4EFEA 3RB3A 4RUCA 2R7LA 2DPIA 2GPSA 2VQFH 4BBSG 4RU9A 5KG5A 3M9NB 4LF8H 4DR4H 3GV8B 1IBLH 2Y0SA 4B3MH 4R8UA 3T5LA 4EYHB 4UCOA 1B6RA 5KG2A 3MR5A 4YB8B 2RF4A 4A3KG 5KFDA 2DLNA 4QWDA 4MV9A 2YW2A 1KC7A 4MV1A 5CA0F 5DQHA 5LL6b 4DV2H 4TQSA 4UFZA 2E2HA 5KT5A 4A3FG 5IYZF 2YZGA 2FMAA 3PZPA 2RDIA 3LMLA 4MAMA 4YAKB 2VQEH 3PVXA 3MFIA 4O4IF 4MV4A 1Y1WA 3KAJA 2FPGB 5DG9A 1I7LA 3ETHA 4JV1A 2NVYA 3IG0A 4DR1H 3KAKA 3OTOH 4DV1H 5KT2A 3R5HA 2R8KA 3GIKA 4ECWA 5KFRA 1JDEA 4A3MG 4JI5H 3BAAA 3MWDA 4ECSA 2BQUA 4NXNH 4DR2H 3G6VA 5FLMG 3KHHA 2W9CA 4O3QA 5CAEB 1Y1WG 1VAJA 1WR2A 4ETSA 4TQRA 4IZOA 3Q8PB 4PDBA 1N33H 5F9NA 2C22A 4A3DG 1JX4A 1RK5A 4MA5A 3T5JA 2W9BB 1UC9A 2YZMA 1B6SA 1GSHA 4GLXA 1OWTA 4DUYH 1N56A 4LSAA 2W8LA 3M9OB 1BGWA 5DQGA 1CS0A 4LFCH 1S10A 1B04A 3G6YA 4ECYA 2E2IA 4LFAH 4RB2C 2FB9A 5L9XA 4AQYH 3T5HA 2FPPB 4Q8EA 1BNCA 4HYKA 5KT6A 1JLLB 2VUGA 1VBHA 5FJ8G 4JUZA 2UVRA 3CVZA 2RDJA 2W71A 4TV9F 4G3IA 5EZYF 3M4IA 5KG4A 1K1SA 2V58A 5DG7A 5JVDF 4J9MA 2AGQA 3FKIA 2R8HA 5L1LA 4LMYA 4LF4H 1Y1VG 4O4HF 4ME6A 1GSOA 4QW8A 1C30A 1HNXH 5FPRA 3V6JA 4OX9H 1V9PA 2CZGA 5KFNA 4I7HA 4DR5H 3Q1KA 3ORQA 2XC9A 2W6OA 3N41B 2FJZA 4O3NA 1M7JA 2FK3A 4ECZA 3GTPA 4X65H 2UUBH 2VUMA 2X0SA 2AGPA 4BXXG 3FKIG 3K5HA 3H4DA 3HOWG 1SCUB 3GIQA 1KJJA 1DIKA 1KJQA 4UCSA 2PBZA 3Q8RB 1TA8A 5F9LA 3K5IA 3BA9A 4RB0A 4GKJH 4NLGA 2ZJTA 4C5AA 2YZNA 4C2MA 3PO2G 4EG0A 5KFOA 4ZOLF 2VUMG 2XD4A 3GIMA 5T14A 1JIHA 1GLVA 4FBTA 3GTGA 2UXCH 5FD5A 3MFHA 2VA3A 2R7NA 4EEQA 4HNTA 4Q43A 1KJ9A 4JI2H 4E4TA 1GYFA 4O2AF 2R86A 1I50A 2JEFA 3OUZA 1T3NA 4Q44A 4MV3A 4FBUA 4BY1G 2ZDHA 3R5FA 2ALZA 4DL2A 2PMZA 1SEIA 4O3PA 3BQ2A 4ED3A 3E5NA 1CQIB 5KFUA 3QFFA 5KFAA 5LYJF 2YU9A 2R84A 4HNVA 2UXDH 2ASLA 2HHHH 2C00A 3VPDA 4DR7H 2R8GA 2WAQE 3MJFA 4O4LF 5KT7A 4DR6H 4IRDA 4HQ6A 4QWBA 2VR1A 5A2QW 4DLKA 1XNQH 2RGVA 2KSWA 2J6SA 4JV2A 2JA7G 4M9UA 3U9TA 4LF9H 3T1HH 1GGOA 2R82A 2NUAB 1ZETA 3PR4A 1TWFA 4A3EG 2JA8G 1X9NA 2CW7A 3RV3A 4RNMA 1TAEA 5HV6A 2CKZB 2FK2A 4I50F 4DV5H 4ZHQF 5I47A 3NGDA 2VQDA 1RYRA 5FD6A 5D1OA 5KKNB 4DUZH 4F50A 2ZDQA 3JRXA 3R23A 3VMMA 4ED8A 2V5AA 4J9RA 2HVSA 4YR2A 3RAQA 5HBRB 2MCTA 3KXYT 2WE6A 3K3VA 3PW4A 2IMWP 2Y0SE 2YYAA 2BQ3A 1AUVA 4MV8A 1C3OA 4O3OA 3UQ8A 4DV3H 4B3TH 3RB4A 5KFMA 5KFWA 4FS2A 4DL4A 2UU9H 5GONF 4A3CG 4K0KH 5KFKA 3MWEA 3Q8QB 1IOVA 4DR3H 4A2BA 2W57A 2UUCH 2QYZA 3V6KA 1RJQA 2UUAH 1V4YA 4LF7H 4O3RA 4RUAA 2JEGA 2C35B 4AYBE 4EFBA 4EYIB 4AYBA 2M05A 5EOYA 4ECQA 1RJRA 1VKZA 4UCRA 3QZ7A 3OUUA 2P0AA 3KHRA 3VPBA 3RB0A 5C1PA 2R7KA 5L1KA 3SI8A 2R8JA 3PO3G 4TUYF 1TWHA 3QZ8A 4GC6A 5KX5F 3G6XA 4J9OA 2FLPA 3SE7A 1BXRA 2UXBH 4APMA 1RYSA 4MA0A 3GV5B 2JA5A 5KFFA 1ULZA 4WD3A 4IRCA 5IYDG 3PR5B 2BQRA 5C44G 3N44B 5KFVA 1T94A 4F4YA 5IYBG 3GTKA 3MWMA 3EYYA 4UCVA 1FKAH 4A3BG 3L4JA 5J2UF 3VPCA 1XMOH 4LH6A 3L2PA 4A3JG 1DGSA 1FVIA 4LH7A 1K83A 1E4EB 4JI0H 4U6PA 2JEIA 5KFXA 1KJIA 1S0OA 4M7EA 3N6XA 5KT4A 4RB1A 4A3IG 2Q2TA 2HJWA 4I55F 5IP9G 1XMQH 1CQJB 2W6MA 3RBDA 2V9WA 3GTMA 1JKJB 1WSCA 2FK1A 3GLKA 3GTQA 3RF2A 2DIKA 3V6HA 4IR1A 4X64H 5D8DA 5H80A 3H4BA 2UVUA 2C2EA 4RAZA 5C4XG 2B63A 4UCUA 2CQYA 4Y8VB 4X66H 2I87A 4UCTA 2NU8B 3TQ1A 1IBKH 1TWCA 2R6FA 4IR9A 4LSXA 4J9KA 3RB6A 2FLNA 3ETJA 2WYOA 4I4TF 2ASDA 4DV7H 1RJPA 2GPWA 3GIDA 3TINA 4WBNF 1T36A 5KFBA 3AYHB 5KFEA 1N36H 4J9SA 4DL6A 2HVRA 3C0FB 5KFTA 3WNZA 2WB1A 5EDWA 3L4KA 4DL5A 4QJFA 2HGSA 4JI6H 3HOZG 1E4GT 3KHLA 2YRWA 3TQTA 2R7ZA 1Y14B 3BQ1A 2RGRA 1EYZA 3ORRA 1Z2PX 2VPSA 3RUPA 4JI1H 2SCUB 4CC6A 3N40P 4JV0A 3TIIA 3RAXA 1S68A 2PMZE 4HNUA 1I7NA 4R8UB 2VOBA 3GTOA 3JAMW 2W9BA 2J6UA 4A93G 5JUMA 4L1KA 3J80W 3M9MB 1M0TA 2R7ZG 4IWXA 3IN5A 3I12A 2F4VH 3OSPA 4MTEA 4MTDA 3HKZA 4ED6A 4F4WA 1I3QA 3GV7B 4C5BA 2R93A 2UVWA 1V51A 4Q0YA 3Q2OA 4YAJB 2YL2A 1PX2A 4XYLB 5DG8A 5JQWA 3U9SA 5LMUH 4J9NA 2ASJA 2DPJA 5KFZA 4TV8F 2XCAA 2DZDA 4YBZB 2C2DA 3HOYG 4GKKH 3H0GA 2J9GA 4O3SA 5L1IA 1HNWH 5IYCG 1EZ1A 2W9CB 2ATLA 3WO1A 1ZHQA 1A9XA 1ZHSA 2O03A 2IBKA 1A0IA 1O75A 3OHAA 5LA6F 4ECTA 5BMVF 1EUDB 3HOVG 3LWBA 2ZM6H 4QWCA 1TWAA 4DL3A 1XDNA 2JA6A 2WTFA 3H0GG 1KEEA 4EGJA 3N42B 2BR0A 1TWGA 4J9LA 3G8CA 1B33N 1PK8A 3MR6A 3T1YH 1JXLA 1IBMH 3I4NG 5L1JA 1HNZH 4ZI7F 3RGXA 1RK6A 3BABA 5C3EG 2XIGA 2ZDGA 3RJ0A 3BQ0A 4ECXA 4A2AA 4DV6H 4GC7A 4JYAH 4LFBH 2V59A 4Q8FA 4KHPH 1N48A 2PVPA 1I94H 2UVVA 3GIPA 5DLGA 2J6TA 3GTLA 2CW8A 4QW9A 4RAYA 2OWOA 2FPIB 3GQCA 5EWEA 3H20A 5KT3A 4EBDA 1S0NA 2FKLA 3RGZA 1E4FT 4ECUA 2OH2A 4Q45A 4O2BF 2XCPA 2DWCA 2R92A 2W7PA 4YR3A 1AUXA 1KJ8A 5LMNH 4EBEA 1CE8A 4X62H 4ECRA 2IP4A 2XCLA 5BR8H 4IWYA 3PW2A 2AGOA 3JSNA 1MZBA 2NU9B 4JI4H 3EPIA 3GILA 4FM9A 1K1QA 2R92G 5IT9W 1GO3E 3CQZA 4YJ2F 4B3SH 3J7AK 1J5EH 3HB9A 3J81W 2C2RA 2GLTA 5KFPA 5C5JA 3OSNA 2NVXA 4RB3C 4A3GG 1EHIA 5BPHA 2JA5G 2W6PA 3GIIA 4J9QA 5D1PA 3V4SA 5KG0A 2I80A 2AQ4A 4CC5A 3OHBA 2R8IA 1Z2NX 5LXTF 4JI7H 5KFIA 5LP6F 5DGAA 2AU0A 5KG6A 5KFGA 4JI3H 1SFOA 4YY3H 3PW0A 3MR2A 1EUCB 4EGQA 5BPFA 3FMAA 4J9PA 4C5CA 4JI8H 2V4RA 1UC8A 4ED7A 4IRKA 5KFHA 2YS7A 2YS6A 3HOUG 3EPGA 3T5KA 2JEJA 1Y1VA 3PN1A 2R7MA 4J0MA 4DV4H 3N43B 5KFLA 4YHHH 1N34H 2R87A 1DV1A 3RTXA 4YR0A 4QWEA 3FDSA 3Q8SB 2W8KA 1SYXB 5IP7G 4F4ZA 3GTJA 2FLLA 5J2TF 2C28A 2B63G 2E5LH 2W70A 5C8YF 3I4MG 1P8LA 2XGQA 1S9FA 3MR3A 2WB1E 3F8NA 1AN7A 4R7RA 4YJ3F 5DQIA 1IOWA 5D1OB 4BY7G 3PW7A 3H3VH 1WH2A 4LF5H 2NU6B 4NXMH 5JVLA 1UNNC 4ED0A 4IHJF 2WDTA 2IA6A 3R5XA 5EWGA 2FP4B 1FJGH 4RNNA 4MV6A 3PW5A 1W93A 4LF6H 3LP8A 1WCMA 1R9TA 5CA1F 2YRXA 3HKZE 5KFJA 2QK4A 1S0MA 4YQWA 5KFSA 2I8CA 5KG1A 2OLSA 4BBRG 4U7CA 5LOVF 5JH7F 5EWFA 1E4EA 3BG5A 3N8DA 4XX0B 2VPQA 3KALA 4EEYA 4DL7A 1KBLA 3UFXB 4HR7A 4ECVA 4RZRA 3HBLA 4FU0A 4XYMB 5C1OA 5CB4F 4ED2A 1WCMG 1S03G 5IWAH 4RZQA 4F4XA 3KHGA 2FE3A 5FLXW 3BA8A 4PWQA 2R93G 2JA7A 5DGBA 1VBGA 1M6VA 5FPOA 2NU7B 2R85A 3JRWA 4RNOA 4DV0H 2XGPA 5K2MA 4XZ3B 3H40A 3KTMA 1BJTA 4QWAA 3RBEA 2WAQA 3RV4A 2W7OA 2W6ZA 4IAJA 4JV5H 4A3LG 4MV7A 3WO0A 2HVQA 2W6QA 3RFCA 5KG7A 2YCHA 3GIJA 2W9AA 4B3RH 4ZQIA 1N32H 1W96A 5KFQA 5KG3A 3HXLA 5KFYA 3TIGA 3K3PA 2Q2UA 2VA2A 4ED1A 1DV2A 3DF7A 4QIWE 3HOXG 4EBCA 4QIWA 1ZQ7A 3V4ZA 5DLFA 3JZIA 4FS1A 2V4QA 1L2ZA 3JSLA 2W6NA 2JA6G 3RIZA
chains in the Genus database with same CATH topology
5IT9W 1M0WA 4UCUA 4X66H 4B3SH 3J7AK 4UCTA 1J5EH 1Z2OX 1SEIA 3J81W 1IBKH 1VS0A 1XNRH 1HR0H 4BWSC 1I6UA 4LSXA 4EFEA 2WYOA 4DV7H 2UXDH 4RB3C 2HHHH 4DR7H 2VQFH 5D1PA 4LF8H 4DR4H 4DR6H 4CC5A 1IBLH 4B3MH 1N36H 5A2QW 1XNQH 1Z2NX 2RGVA 4JI7H 2KSWA 4UCOA 2HVRA 3C0FB 4MV9A 3L4KA 4DV2H 2HGSA 4JI6H 4JI3H 1E4GT 5LL6b 4UFZA 4YY3H 4LF9H 3T1HH 2RGRA 1Z2PX 2VPSA 3FMAA 3LMLA 2VQEH 4JI8H 4JI1H 4CC6A 1X9NA 2CW7A 3N40P 3KAJA 1TAEA 1S68A 3PN1A 3IG0A 4DR1H 2VOBA 4J0MA 4DV5H 3KAKA 3OTOH 4DV1H 3JAMW 4DV4H 5FD6A 3N43B 5D1OA 4YHHH 4DUZH 3J80W 3RTXA 1M0TA 1N34H 2HVSA 4JI5H 3BAAA 2F4VH 4NXNH 2MCTA 4MTEA 4MTDA 4DR2H 1SYXB 3KXYT 2WE6A 3K3VA 4ETSA 4Q0YA 1N33H 4PDBA 2E5LH 1P8LA 3F8NA 1AN7A 3UQ8A 4R7RA 4DV3H 4B3TH 2UU9H 5LMUH 4K0KH 5D1OB 4DR3H 4GLXA 4DUYH 4A2BA 4LSAA 2W57A 4GKKH 2UUCH 1WH2A 4LF5H 4NXMH 1BGWA 1HNWH 2UUAH 4LFCH 4LF7H 1B04A 1ZHQA 2WDTA 1ZHSA 2O03A 4LFAH 4EFBA 1A0IA 1O75A 4RB2C 5EOYA 4AQYH 1FJGH 4UCRA 4LF6H 2ZM6H 2VUGA 1XDNA 3CVZA 3N42B 3M4IA 4LMYA 3T1YH 4LF4H 1IBMH 2UXBH 3KALA 1HNXH 5FPRA 4APMA 3RGXA 1V9PA 3BABA 1HNZH 4OX9H 2XIGA 4I7HA 3RJ0A 4DR5H 4A2AA 4DV6H 4JYAH 1S03G 4LFBH 5IWAH 3N44B 4RZQA 3N41B 1I94H 4KHPH 3MWMA 2FE3A 5FLXW 4X65H 3BA8A 3EYYA 4UCVA 1FKAH 2UUBH 3L4JA 5FPOA 2CW8A 4DV0H 4UCSA 4RAYA 4LH6A 1XMOH 3L2PA 2OWOA 1DGSA 1FVIA 1TA8A 4LH7A 4JI0H 3BA9A 3H20A 1BJTA 4RB0A 4GKJH 3RGZA 1E4FT 2ZJTA 4IAJA 4JV5H 4M7EA 3N6XA 4MV7A 2HVQA 4B3RH 2YCHA 4RB1A 2Q2TA 1N32H 1XMQH 3HXLA 5LMNH 2UXCH 3RF2A 5FD5A 2Q2UA 4X62H 4EEQA 5BR8H 4X64H 4JI2H 3DF7A 3JSNA 1MZBA 1GYFA 4JI4H 4FM9A 4RAZA 1L2ZA 3JSLA 3RIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJT A;  3M4I A;  3IG0 A; 
#chains in the Genus database with same CATH topology
 1GSA A;  1JDB B;  1M0W A;  3BJY A;  1S97 A;  2PN1 A;  1Z2O X;  4YP3 A;  1XNR H;  1VS0 A;  1HR0 H;  4BWS C;  1I6U A;  5KFC A;  4EFE A;  3RB3 A;  4RUC A;  2R7L A;  2DPI A;  2GPS A;  2VQF H;  4BBS G;  4RU9 A;  5KG5 A;  3M9N B;  4LF8 H;  4DR4 H;  3GV8 B;  1IBL H;  2Y0S A;  4B3M H;  4R8U A;  3T5L A;  4EYH B;  4UCO A;  1B6R A;  5KG2 A;  3MR5 A;  4YB8 B;  2RF4 A;  4A3K G;  5KFD A;  2DLN A;  4QWD A;  4MV9 A;  2YW2 A;  1KC7 A;  4MV1 A;  5CA0 F;  5DQH A;  5LL6 b;  4DV2 H;  4TQS A;  4UFZ A;  2E2H A;  5KT5 A;  4A3F G;  5IYZ F;  2YZG A;  2FMA A;  3PZP A;  2RDI A;  3LML A;  4MAM A;  4YAK B;  2VQE H;  3PVX A;  3MFI A;  4O4I F;  4MV4 A;  1Y1W A;  3KAJ A;  2FPG B;  5DG9 A;  1I7L A;  3ETH A;  4JV1 A;  2NVY A;  3IG0 A;  4DR1 H;  3KAK A;  3OTO H;  4DV1 H;  5KT2 A;  3R5H A;  2R8K A;  3GIK A;  4ECW A;  5KFR A;  1JDE A;  4A3M G;  4JI5 H;  3BAA A;  3MWD A;  4ECS A;  2BQU A;  4NXN H;  4DR2 H;  3G6V A;  5FLM G;  3KHH A;  2W9C A;  4O3Q A;  5CAE B;  1Y1W G;  1VAJ A;  1WR2 A;  4ETS A;  4TQR A;  4IZO A;  3Q8P B;  4PDB A;  1N33 H;  5F9N A;  2C22 A;  4A3D G;  1JX4 A;  1RK5 A;  4MA5 A;  3T5J A;  2W9B B;  1UC9 A;  2YZM A;  1B6S A;  1GSH A;  4GLX A;  1OWT A;  4DUY H;  1N56 A;  4LSA A;  2W8L A;  3M9O B;  1BGW A;  5DQG A;  1CS0 A;  4LFC H;  1S10 A;  1B04 A;  3G6Y A;  4ECY A;  2E2I A;  4LFA H;  4RB2 C;  2FB9 A;  5L9X A;  4AQY H;  3T5H A;  2FPP B;  4Q8E A;  1BNC A;  4HYK A;  5KT6 A;  1JLL B;  2VUG A;  1VBH A;  5FJ8 G;  4JUZ A;  2UVR A;  3CVZ A;  2RDJ A;  2W71 A;  4TV9 F;  4G3I A;  5EZY F;  3M4I A;  5KG4 A;  1K1S A;  2V58 A;  5DG7 A;  5JVD F;  4J9M A;  2AGQ A;  3FKI A;  2R8H A;  5L1L A;  4LMY A;  4LF4 H;  1Y1V G;  4O4H F;  4ME6 A;  1GSO A;  4QW8 A;  1C30 A;  1HNX H;  5FPR A;  3V6J A;  4OX9 H;  1V9P A;  2CZG A;  5KFN A;  4I7H A;  4DR5 H;  3Q1K A;  3ORQ A;  2XC9 A;  2W6O A;  3N41 B;  2FJZ A;  4O3N A;  1M7J A;  2FK3 A;  4ECZ A;  3GTP A;  4X65 H;  2UUB H;  2VUM A;  2X0S A;  2AGP A;  4BXX G;  3FKI G;  3K5H A;  3H4D A;  3HOW G;  1SCU B;  3GIQ A;  1KJJ A;  1DIK A;  1KJQ A;  4UCS A;  2PBZ A;  3Q8R B;  1TA8 A;  5F9L A;  3K5I A;  3BA9 A;  4RB0 A;  4GKJ H;  4NLG A;  2ZJT A;  4C5A A;  2YZN A;  4C2M A;  3PO2 G;  4EG0 A;  5KFO A;  4ZOL F;  2VUM G;  2XD4 A;  3GIM A;  5T14 A;  1JIH A;  1GLV A;  4FBT A;  3GTG A;  2UXC H;  5FD5 A;  3MFH A;  2VA3 A;  2R7N A;  4EEQ A;  4HNT A;  4Q43 A;  1KJ9 A;  4JI2 H;  4E4T A;  1GYF A;  4O2A F;  2R86 A;  1I50 A;  2JEF A;  3OUZ A;  1T3N A;  4Q44 A;  4MV3 A;  4FBU A;  4BY1 G;  2ZDH A;  3R5F A;  2ALZ A;  4DL2 A;  2PMZ A;  1SEI A;  4O3P A;  3BQ2 A;  4ED3 A;  3E5N A;  1CQI B;  5KFU A;  3QFF A;  5KFA A;  5LYJ F;  2YU9 A;  2R84 A;  4HNV A;  2UXD H;  2ASL A;  2HHH H;  2C00 A;  3VPD A;  4DR7 H;  2R8G A;  2WAQ E;  3MJF A;  4O4L F;  5KT7 A;  4DR6 H;  4IRD A;  4HQ6 A;  4QWB A;  2VR1 A;  5A2Q W;  4DLK A;  1XNQ H;  2RGV A;  2KSW A;  2J6S A;  4JV2 A;  2JA7 G;  4M9U A;  3U9T A;  4LF9 H;  3T1H H;  1GGO A;  2R82 A;  2NUA B;  1ZET A;  3PR4 A;  1TWF A;  4A3E G;  2JA8 G;  1X9N A;  2CW7 A;  3RV3 A;  4RNM A;  1TAE A;  5HV6 A;  2CKZ B;  2FK2 A;  4I50 F;  4DV5 H;  4ZHQ F;  5I47 A;  3NGD A;  2VQD A;  1RYR A;  5FD6 A;  5D1O A;  5KKN B;  4DUZ H;  4F50 A;  2ZDQ A;  3JRX A;  3R23 A;  3VMM A;  4ED8 A;  2V5A A;  4J9R A;  2HVS A;  4YR2 A;  3RAQ A;  5HBR B;  2MCT A;  3KXY T;  2WE6 A;  3K3V A;  3PW4 A;  2IMW P;  2Y0S E;  2YYA A;  2BQ3 A;  1AUV A;  4MV8 A;  1C3O A;  4O3O A;  3UQ8 A;  4DV3 H;  4B3T H;  3RB4 A;  5KFM A;  5KFW A;  4FS2 A;  4DL4 A;  2UU9 H;  5GON F;  4A3C G;  4K0K H;  5KFK A;  3MWE A;  3Q8Q B;  1IOV A;  4DR3 H;  4A2B A;  2W57 A;  2UUC H;  2QYZ A;  3V6K A;  1RJQ A;  2UUA H;  1V4Y A;  4LF7 H;  4O3R A;  4RUA A;  2JEG A;  2C35 B;  4AYB E;  4EFB A;  4EYI B;  4AYB A;  2M05 A;  5EOY A;  4ECQ A;  1RJR A;  1VKZ A;  4UCR A;  3QZ7 A;  3OUU A;  2P0A A;  3KHR A;  3VPB A;  3RB0 A;  5C1P A;  2R7K A;  5L1K A;  3SI8 A;  2R8J A;  3PO3 G;  4TUY F;  1TWH A;  3QZ8 A;  4GC6 A;  5KX5 F;  3G6X A;  4J9O A;  2FLP A;  3SE7 A;  1BXR A;  2UXB H;  4APM A;  1RYS A;  4MA0 A;  3GV5 B;  2JA5 A;  5KFF A;  1ULZ A;  4WD3 A;  4IRC A;  5IYD G;  3PR5 B;  2BQR A;  5C44 G;  3N44 B;  5KFV A;  1T94 A;  4F4Y A;  5IYB G;  3GTK A;  3MWM A;  3EYY A;  4UCV A;  1FKA H;  4A3B G;  3L4J A;  5J2U F;  3VPC A;  1XMO H;  4LH6 A;  3L2P A;  4A3J G;  1DGS A;  1FVI A;  4LH7 A;  1K83 A;  1E4E B;  4JI0 H;  4U6P A;  2JEI A;  5KFX A;  1KJI A;  1S0O A;  4M7E A;  3N6X A;  5KT4 A;  4RB1 A;  4A3I G;  2Q2T A;  2HJW A;  4I55 F;  5IP9 G;  1XMQ H;  1CQJ B;  2W6M A;  3RBD A;  2V9W A;  3GTM A;  1JKJ B;  1WSC A;  2FK1 A;  3GLK A;  3GTQ A;  3RF2 A;  2DIK A;  3V6H A;  4IR1 A;  4X64 H;  5D8D A;  5H80 A;  3H4B A;  2UVU A;  2C2E A;  4RAZ A;  5C4X G;  2B63 A;  4UCU A;  2CQY A;  4Y8V B;  4X66 H;  2I87 A;  4UCT A;  2NU8 B;  3TQ1 A;  1IBK H;  1TWC A;  2R6F A;  4IR9 A;  4LSX A;  4J9K A;  3RB6 A;  2FLN A;  3ETJ A;  2WYO A;  4I4T F;  2ASD A;  4DV7 H;  1RJP A;  2GPW A;  3GID A;  3TIN A;  4WBN F;  1T36 A;  5KFB A;  3AYH B;  5KFE A;  1N36 H;  4J9S A;  4DL6 A;  2HVR A;  3C0F B;  5KFT A;  3WNZ A;  2WB1 A;  5EDW A;  3L4K A;  4DL5 A;  4QJF A;  2HGS A;  4JI6 H;  3HOZ G;  1E4G T;  3KHL A;  2YRW A;  3TQT A;  2R7Z A;  1Y14 B;  3BQ1 A;  2RGR A;  1EYZ A;  3ORR A;  1Z2P X;  2VPS A;  3RUP A;  4JI1 H;  2SCU B;  4CC6 A;  3N40 P;  4JV0 A;  3TII A;  3RAX A;  1S68 A;  2PMZ E;  4HNU A;  1I7N A;  4R8U B;  2VOB A;  3GTO A;  3JAM W;  2W9B A;  2J6U A;  4A93 G;  5JUM A;  4L1K A;  3J80 W;  3M9M B;  1M0T A;  2R7Z G;  4IWX A;  3IN5 A;  3I12 A;  2F4V H;  3OSP A;  4MTE A;  4MTD A;  3HKZ A;  4ED6 A;  4F4W A;  1I3Q A;  3GV7 B;  4C5B A;  2R93 A;  2UVW A;  1V51 A;  4Q0Y A;  3Q2O A;  4YAJ B;  2YL2 A;  1PX2 A;  4XYL B;  5DG8 A;  5JQW A;  3U9S A;  5LMU H;  4J9N A;  2ASJ A;  2DPJ A;  5KFZ A;  4TV8 F;  2XCA A;  2DZD A;  4YBZ B;  2C2D A;  3HOY G;  4GKK H;  3H0G A;  2J9G A;  4O3S A;  5L1I A;  1HNW H;  5IYC G;  1EZ1 A;  2W9C B;  2ATL A;  3WO1 A;  1ZHQ A;  1A9X A;  1ZHS A;  2O03 A;  2IBK A;  1A0I A;  1O75 A;  3OHA A;  5LA6 F;  4ECT A;  5BMV F;  1EUD B;  3HOV G;  3LWB A;  2ZM6 H;  4QWC A;  1TWA A;  4DL3 A;  1XDN A;  2JA6 A;  2WTF A;  3H0G G;  1KEE A;  4EGJ A;  3N42 B;  2BR0 A;  1TWG A;  4J9L A;  3G8C A;  1B33 N;  1PK8 A;  3MR6 A;  3T1Y H;  1JXL A;  1IBM H;  3I4N G;  5L1J A;  1HNZ H;  4ZI7 F;  3RGX A;  1RK6 A;  3BAB A;  5C3E G;  2XIG A;  2ZDG A;  3RJ0 A;  3BQ0 A;  4ECX A;  4A2A A;  4DV6 H;  4GC7 A;  4JYA H;  4LFB H;  2V59 A;  4Q8F A;  4KHP H;  1N48 A;  2PVP A;  1I94 H;  2UVV A;  3GIP A;  5DLG A;  2J6T A;  3GTL A;  2CW8 A;  4QW9 A;  4RAY A;  2OWO A;  2FPI B;  3GQC A;  5EWE A;  3H20 A;  5KT3 A;  4EBD A;  1S0N A;  2FKL A;  3RGZ A;  1E4F T;  4ECU A;  2OH2 A;  4Q45 A;  4O2B F;  2XCP A;  2DWC A;  2R92 A;  2W7P A;  4YR3 A;  1AUX A;  1KJ8 A;  5LMN H;  4EBE A;  1CE8 A;  4X62 H;  4ECR A;  2IP4 A;  2XCL A;  5BR8 H;  4IWY A;  3PW2 A;  2AGO A;  3JSN A;  1MZB A;  2NU9 B;  4JI4 H;  3EPI A;  3GIL A;  4FM9 A;  1K1Q A;  2R92 G;  5IT9 W;  1GO3 E;  3CQZ A;  4YJ2 F;  4B3S H;  3J7A K;  1J5E H;  3HB9 A;  3J81 W;  2C2R A;  2GLT A;  5KFP A;  5C5J A;  3OSN A;  2NVX A;  4RB3 C;  4A3G G;  1EHI A;  5BPH A;  2JA5 G;  2W6P A;  3GII A;  4J9Q A;  5D1P A;  3V4S A;  5KG0 A;  2I80 A;  2AQ4 A;  4CC5 A;  3OHB A;  2R8I A;  1Z2N X;  5LXT F;  4JI7 H;  5KFI A;  5LP6 F;  5DGA A;  2AU0 A;  5KG6 A;  5KFG A;  4JI3 H;  1SFO A;  4YY3 H;  3PW0 A;  3MR2 A;  1EUC B;  4EGQ A;  5BPF A;  3FMA A;  4J9P A;  4C5C A;  4JI8 H;  2V4R A;  1UC8 A;  4ED7 A;  4IRK A;  5KFH A;  2YS7 A;  2YS6 A;  3HOU G;  3EPG A;  3T5K A;  2JEJ A;  1Y1V A;  3PN1 A;  2R7M A;  4J0M A;  4DV4 H;  3N43 B;  5KFL A;  4YHH H;  1N34 H;  2R87 A;  1DV1 A;  3RTX A;  4YR0 A;  4QWE A;  3FDS A;  3Q8S B;  2W8K A;  1SYX B;  5IP7 G;  4F4Z A;  3GTJ A;  2FLL A;  5J2T F;  2C28 A;  2B63 G;  2E5L H;  2W70 A;  5C8Y F;  3I4M G;  1P8L A;  2XGQ A;  1S9F A;  3MR3 A;  2WB1 E;  3F8N A;  1AN7 A;  4R7R A;  4YJ3 F;  5DQI A;  1IOW A;  5D1O B;  4BY7 G;  3PW7 A;  3H3V H;  1WH2 A;  4LF5 H;  2NU6 B;  4NXM H;  5JVL A;  1UNN C;  4ED0 A;  4IHJ F;  2WDT A;  2IA6 A;  3R5X A;  5EWG A;  2FP4 B;  1FJG H;  4RNN A;  4MV6 A;  3PW5 A;  1W93 A;  4LF6 H;  3LP8 A;  1WCM A;  1R9T A;  5CA1 F;  2YRX A;  3HKZ E;  5KFJ A;  2QK4 A;  1S0M A;  4YQW A;  5KFS A;  2I8C A;  5KG1 A;  2OLS A;  4BBR G;  4U7C A;  5LOV F;  5JH7 F;  5EWF A;  1E4E A;  3BG5 A;  3N8D A;  4XX0 B;  2VPQ A;  3KAL A;  4EEY A;  4DL7 A;  1KBL A;  3UFX B;  4HR7 A;  4ECV A;  4RZR A;  3HBL A;  4FU0 A;  4XYM B;  5C1O A;  5CB4 F;  4ED2 A;  1WCM G;  1S03 G;  5IWA H;  4RZQ A;  4F4X A;  3KHG A;  2FE3 A;  5FLX W;  3BA8 A;  4PWQ A;  2R93 G;  2JA7 A;  5DGB A;  1VBG A;  1M6V A;  5FPO A;  2NU7 B;  2R85 A;  3JRW A;  4RNO A;  4DV0 H;  2XGP A;  5K2M A;  4XZ3 B;  3H40 A;  3KTM A;  1BJT A;  4QWA A;  3RBE A;  2WAQ A;  3RV4 A;  2W7O A;  2W6Z A;  4IAJ A;  4JV5 H;  4A3L G;  4MV7 A;  3WO0 A;  2HVQ A;  2W6Q A;  3RFC A;  5KG7 A;  2YCH A;  3GIJ A;  2W9A A;  4B3R H;  4ZQI A;  1N32 H;  1W96 A;  5KFQ A;  5KG3 A;  3HXL A;  5KFY A;  3TIG A;  3K3P A;  2Q2U A;  2VA2 A;  4ED1 A;  1DV2 A;  3DF7 A;  4QIW E;  3HOX G;  4EBC A;  4QIW A;  1ZQ7 A;  3V4Z A;  5DLF A;  3JZI A;  4FS1 A;  2V4Q A;  1L2Z A;  3JSL A;  2W6N A;  2JA6 G;  3RIZ A; 
#chains in the Genus database with same CATH homology
 5IT9 W;  1M0W A;  4UCU A;  4X66 H;  4B3S H;  3J7A K;  4UCT A;  1J5E H;  1Z2O X;  1SEI A;  3J81 W;  1IBK H;  1VS0 A;  1XNR H;  1HR0 H;  4BWS C;  1I6U A;  4LSX A;  4EFE A;  2WYO A;  4DV7 H;  2UXD H;  4RB3 C;  2HHH H;  4DR7 H;  2VQF H;  5D1P A;  4LF8 H;  4DR4 H;  4DR6 H;  4CC5 A;  1IBL H;  4B3M H;  1N36 H;  5A2Q W;  1XNQ H;  1Z2N X;  2RGV A;  4JI7 H;  2KSW A;  4UCO A;  2HVR A;  3C0F B;  4MV9 A;  3L4K A;  4DV2 H;  2HGS A;  4JI6 H;  4JI3 H;  1E4G T;  5LL6 b;  4UFZ A;  4YY3 H;  4LF9 H;  3T1H H;  2RGR A;  1Z2P X;  2VPS A;  3FMA A;  3LML A;  2VQE H;  4JI8 H;  4JI1 H;  4CC6 A;  1X9N A;  2CW7 A;  3N40 P;  3KAJ A;  1TAE A;  1S68 A;  3PN1 A;  3IG0 A;  4DR1 H;  2VOB A;  4J0M A;  4DV5 H;  3KAK A;  3OTO H;  4DV1 H;  3JAM W;  4DV4 H;  5FD6 A;  3N43 B;  5D1O A;  4YHH H;  4DUZ H;  3J80 W;  3RTX A;  1M0T A;  1N34 H;  2HVS A;  4JI5 H;  3BAA A;  2F4V H;  4NXN H;  2MCT A;  4MTE A;  4MTD A;  4DR2 H;  1SYX B;  3KXY T;  2WE6 A;  3K3V A;  4ETS A;  4Q0Y A;  1N33 H;  4PDB A;  2E5L H;  1P8L A;  3F8N A;  1AN7 A;  3UQ8 A;  4R7R A;  4DV3 H;  4B3T H;  2UU9 H;  5LMU H;  4K0K H;  5D1O B;  4DR3 H;  4GLX A;  4DUY H;  4A2B A;  4LSA A;  2W57 A;  4GKK H;  2UUC H;  1WH2 A;  4LF5 H;  4NXM H;  1BGW A;  1HNW H;  2UUA H;  4LFC H;  4LF7 H;  1B04 A;  1ZHQ A;  2WDT A;  1ZHS A;  2O03 A;  4LFA H;  4EFB A;  1A0I A;  1O75 A;  4RB2 C;  5EOY A;  4AQY H;  1FJG H;  4UCR A;  4LF6 H;  2ZM6 H;  2VUG A;  1XDN A;  3CVZ A;  3N42 B;  3M4I A;  4LMY A;  3T1Y H;  4LF4 H;  1IBM H;  2UXB H;  3KAL A;  1HNX H;  5FPR A;  4APM A;  3RGX A;  1V9P A;  3BAB A;  1HNZ H;  4OX9 H;  2XIG A;  4I7H A;  3RJ0 A;  4DR5 H;  4A2A A;  4DV6 H;  4JYA H;  1S03 G;  4LFB H;  5IWA H;  3N44 B;  4RZQ A;  3N41 B;  1I94 H;  4KHP H;  3MWM A;  2FE3 A;  5FLX W;  4X65 H;  3BA8 A;  3EYY A;  4UCV A;  1FKA H;  2UUB H;  3L4J A;  5FPO A;  2CW8 A;  4DV0 H;  4UCS A;  4RAY A;  4LH6 A;  1XMO H;  3L2P A;  2OWO A;  1DGS A;  1FVI A;  1TA8 A;  4LH7 A;  4JI0 H;  3BA9 A;  3H20 A;  1BJT A;  4RB0 A;  4GKJ H;  3RGZ A;  1E4F T;  2ZJT A;  4IAJ A;  4JV5 H;  4M7E A;  3N6X A;  4MV7 A;  2HVQ A;  4B3R H;  2YCH A;  4RB1 A;  2Q2T A;  1N32 H;  1XMQ H;  3HXL A;  5LMN H;  2UXC H;  3RF2 A;  5FD5 A;  2Q2U A;  4X62 H;  4EEQ A;  5BR8 H;  4X64 H;  4JI2 H;  3DF7 A;  3JSN A;  1MZB A;  1GYF A;  4JI4 H;  4FM9 A;  4RAZ A;  1L2Z A;  3JSL A;  3RIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...