3IG0A

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 2.1 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
185
Chain Sequence
TDPRKSELYVVEGMFQAILPLRGIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 60
structure length 185
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ig0A02
3IG0A 3M4IA 2ZJTA
chains in the Genus database with same CATH superfamily
3OHAA 4IRCA 5KG2A 5KT6A 1V51A 3SE7A 2YW2A 2PBZA 4ECSA 2FPIB 2R87A 4IAJA 3ORQA 5FD5A 1GO3E 3GTGA 4ZQIA 4YY3H 1MZBA 5C4XG 2R8IA 3HOZG 2CQYA 1RJRA 2ZJTA 4YJ2F 3WNZA 3MFIA 2AGPA 5KFSA 1AUVA 1IBKH 2J9GA 5CB4F 2YS6A 4B3MH 1S9FA 4Q43A 1PX2A 2BQUA 3F8NA 3TQTA 5KFVA 2WYOA 3RV4A 4DR2H 2IMWP 3RUPA 3HOVG 3KHGA 3H4BA 3FMAA 3HKZA 5GONF 5JVDF 2UVVA 1HNWH 3RB3A 1S0NA 2VA3A 1V4YA 4ZHQF 2ASJA 1HNXH 3H3VH 5BMVF 3KXYT 3V4ZA 1X9NA 4ECRA 3J80W 5KT2A 1FVIA 5KG6A 2W7PA 1EHIA 2DWCA 3OUUA 2IP4A 4CC6A 2WAQA 3RV3A 4C5BA 5BPFA 3ETJA 2DLNA 2YCHA 4IRDA 1EUDB 3HKZE 1IBLH 3K5IA 3OSPA 3N41B 2GPSA 3QFFA 5LXTF 1KC7A 2HGSA 4Q44A 3VMMA 3OUZA 4DV7H 4B3TH 4GKKH 4DL6A 4KHPH 3GV8B 5KFUA 3GIPA 4A3KG 4AQYH 4J9OA 2VPQA 4RB2C 1IOVA 4EFBA 3PR4A 2WB1E 2UXBH 2XIGA 2YYAA 4A3EG 4HQ6A 5DQGA 2PVPA 3K3VA 2YRWA 1C30A 5K2MA 4YR3A 1P8LA 2FPPB 1M0TA 3LWBA 4LMYA 1DGSA 3PR5B 5IYDG 1XMOH 5DGBA 1TWHA 2J6TA 3I4MG 2F4VH 2W71A 2UUCH 2HVRA 4R7RA 3H0GA 3GTLA 5HBRB 1JX4A 3MWMA 1M7JA 5KFYA 5D8DA 5FD6A 5KFCA 2XGPA 3GILA 5IP7G 2VQFH 2VOBA 4RB1A 4MTEA 2NU6B 5DLFA 2J6SA 3GTJA 5F9NA 1CQIB 3GTOA 3PO3G 1GSAA 4XYMB 1B04A 3WO0A 5KFHA 1C3OA 4U7CA 4YQWA 3Q8SB 3H40A 4A3FG 4U6PA 1Y1WA 2VUMA 4ETSA 4F50A 1N48A 2YZNA 3RFCA 3H0GG 4JI0H 5EDWA 4EEYA 4ECXA 2ASDA 4CC5A 3MR6A 3DF7A 1I3QA 4EBDA 4ECTA 4ED0A 3V6HA 4R8UA 3H20A 4LF9H 2FLNA 2I87A 4QWBA 3GTKA 3RB4A 1HR0H 2FMAA 1B6RA 3HOWG 2J6UA 2VA2A 1Y1WG 2R8JA 3H4DA 5L1JA 1J5EH 1I6UA 4J9RA 4DV0H 2R7KA 2FLPA 1M6VA 4XZ3B 3KAKA 5KFJA 5D1OB 4O4LF 3L4JA 3SI8A 4EBEA 5IYCG 1VBHA 1E4EB 1CE8A 4UCTA 5KFPA 1I7LA 4GLXA 4RZQA 1KJIA 2R8HA 1N36H 2R92G 1TWGA 4Y8VB 3U9SA 5BR8H 1K1QA 4DR5H 4ECQA 1N33H 1KJQA 4JI8H 3N40P 4A2BA 3G6XA 4EYIB 3HXLA 4UCSA 1S0OA 3GLKA 4HNVA 3J7AK 2CW7A 2I80A 3GIQA 3BJYA 4C5AA 5JH7F 3E5NA 2XGQA 4IWXA 3VPBA 2DZDA 4AYBE 3QZ8A 1EUCB 2V4RA 2V4QA 4MV4A 2WTFA 4FM9A 3GIKA 1N56A 5KFXA 2W6MA 1RJPA 4MV3A 4B3RH 1WH2A 2C2DA 2C2EA 1GLVA 3JZIA 1KEEA 5KX5F 4DLKA 3T1HH 1T3NA 5KFZA 3J81W 4JI5H 2ATLA 5A2QW 3M9NB 4DL4A 2E2IA 4MV8A 4A3MG 2XCAA 3I4NG 4IR9A 2SCUB 1WR2A 2ZDHA 2IBKA 3MWDA 2WDTA 4LSAA 3Q8RB 4A93G 1KJ8A 2BR0A 3OSNA 1JXLA 3N8DA 4I50F 4Q0YA 1VAJA 5KFDA 3TQ1A 3BQ2A 4ME6A 2ZDGA 1JDBB 4A3BG 4J9SA 2NUAB 5L1IA 2W9CA 3M9MB 4X62H 4UFZA 5IWAH 4J0MA 1V9PA 5LL6b 1AUXA 1SYXB 2VUGA 2ALZA 1KBLA 1I94H 5KFEA 2KSWA 1OWTA 2XD4A 1BGWA 5KFIA 2W6NA 5IYZF 2W9BB 3MR3A 4LF5H 4A3JG 1KJ9A 4RNOA 2FP4B 4DL2A 1K83A 4O3QA 1VKZA 5H80A 1JDEA 3HB9A 5KFFA 2XCPA 5IP9G 2R8GA 3N42B 3N44B 5LMUH 3OHBA 4NXMH 2W6PA 3RF2A 2RGVA 4RUAA 4G3IA 1GSOA 4Q45A 4UCRA 4J9MA 4F4ZA 4NXNH 4RAYA 2M05A 2WB1A 4WBNF 3BQ1A 2AGOA 2X0SA 5KFWA 5KG4A 1CQJB 5KFRA 3L4KA 4JI1H 4JI4H 2AU0A 3VPCA 2HJWA 4QIWE 2AQ4A 2V9WA 4JV1A 5KT3A 1Z2NX 4FU0A 5C1OA 4EEQA 5DG9A 3Q2OA 4DR4H 2W6ZA 2RDJA 2XCLA 1UC9A 2I8CA 4X65H 4FBTA 3M9OB 3JSNA 2R84A 4MV9A 4JI7H 4MV1A 5EWGA 1RK6A 1Y1VA 4APMA 5JVLA 4DUYH 4FS1A 3T5KA 3PW2A 2RDIA 2C00A 3EYYA 4JYAH 5EWFA 4A3GG 4EGJA 4RB3C 4O2AF 2R7NA 5KT7A 5L1LA 2C28A 4PDBA 1N32H 5LA6F 1DV1A 4C2MA 2R8KA 2V59A 5KT5A 4JI2H 4YR0A 4F4YA 3K5HA 1EYZA 3TIIA 4DR1H 2W8LA 4GC6A 4O3SA 4I7HA 1M0WA 3ETHA 4RUCA 4ECWA 4IWYA 2UUAH 1E4FT 3LP8A 3V4SA 4ED1A 3PW7A 2V58A 2C35B 4O4HF 5LP6F 5C5JA 3IN5A 5IT9W 1R9TA 4TQSA 4ECVA 5KG5A 5IYBG 5KG0A 3CQZA 2JEJA 2FK1A 2ASLA 4BXXG 1ZETA 4YR2A 2JA8G 3N6XA 1RYRA 3GTMA 2OLSA 4ED2A 3Q1KA 3U9TA 3EPIA 1S10A 3C0FB 3MFHA 3TINA 2R7LA 4QWEA 2UXCH 1ZQ7A 1S68A 4XX0B 2FLLA 4IZOA 2JA7A 3BABA 1EZ1A 3PN1A 4ECUA 2VUMG 1TWFA 2UXDH 5LYJF 3FKIA 4UCUA 1XNRH 4A3DG 4XYLB 3FDSA 4AYBA 5JUMA 4ED3A 5DQHA 1WCMA 2V5AA 4QJFA 5KFKA 4QW9A 3G6YA 2B63A 1A9XA 5KFGA 3I12A 2C22A 3RB0A 2W57A 4J9NA 4JV0A 4DR6H 4YP3A 2PMZE 2MCTA 3TIGA 4HR7A 4HYKA 1Z2OX 1B6SA 3PW5A 3FKIG 3RIZA 3HBLA 5KFOA 4DV5H 2Q2UA 5KFQA 1N34H 3NGDA 4YBZB 5DLGA 3G8CA 5CAEB 2B63G 1WCMG 3PW0A 4YAKB 5EWEA 3KHHA 4OX9H 5F9LA 2NU7B 4FBUA 1BJTA 4LH6A 3T5JA 4R8UB 2VQEH 2C2RA 3R5FA 3M4IA 5KFMA 4O3RA 2R7MA 5FJ8G 4MA5A 4A3LG 2RF4A 5I47A 3N43B 5KFNA 4LFBH 2R6FA 3RGXA 1RK5A 4L1KA 1BXRA 4J9PA 5FPRA 4B3SH 5KG7A 1B33N 1JLLB 4X66H 3RAQA 3R5HA 3V6JA 1FJGH 1CS0A 2DIKA 1GGOA 4RB0A 4ED7A 2JA5A 3K3PA 4ECZA 4BY7G 4JV5H 4JV2A 4K0KH 2NU9B 2PN1A 2FE3A 3MR5A 2VPSA 2NVYA 1PK8A 2BQRA 4ZOLF 3L2PA 3BQ0A 5T14A 1W96A 5L9XA 5KFTA 4YB8B 1HNZH 2UUBH 1ZHQA 4LH7A 2W6QA 2UVUA 2YS7A 4JI6H 4LFAH 2HVSA 4M9UA 4BY1G 2R7ZA 4QIWA 5C1PA 1TAEA 3HOUG 1SEIA 4HNTA 4TUYF 1JKJB 4TQRA 3RB6A 2VR1A 5KFBA 5L1KA 3BA8A 3GV5B 2W8KA 3PZPA 1IBMH 2P0AA 3KHRA 5FLMG 2WE6A 2R7ZG 3GV7B 4J9QA 4DUZH 1TWAA 4EBCA 1IOWA 2DPIA 4I55F 1Y14B 3Q8QB 5FPOA 3GIMA 3R5XA 1BNCA 1FKAH 3GIDA 4BBSG 3GTQA 5C44G 3RBDA 3BG5A 3MWEA 4EG0A 4IHJF 4EGQA 4DR3H 2W9CB 3PW4A 2JA6A 1TWCA 4M7EA 4ED6A 4A2AA 2IA6A 1ULZA 5D1PA 2FPGB 4QWDA 3RJ0A 2NU8B 4DV3H 2FK2A 4LF7H 2Q2TA 4LF6H 4LF8H 3RTXA 4QWCA 3HOYG 5BPHA 3R23A 4MAMA 2JA6G 4E4TA 1Y1VG 2DPJA 1DV2A 4UCVA 4LF4H 3KTMA 1SFOA 1RYSA 4QWAA 3JRXA 3OTOH 4EYHB 2R85A 5DQIA 4Q8EA 5DG8A 1UNNC 2YZMA 4YJ3F 5KKNB 3G6VA 4O3PA 3RAXA 2RGRA 3GIIA 2FB9A 2HHHH 2OH2A 4DR7H 4IR1A 2WAQE 4Q8FA 3UQ8A 4NLGA 2XC9A 4O3OA 2W70A 3MR2A 2UVWA 4RU9A 2CKZB 2HVQA 5D1OA 2JEFA 1XMQH 2E2HA 1E4EA 4TV8F 1W93A 4BBRG 5JQWA 3BAAA 3MJFA 2PMZA 4RZRA 3QZ7A 3V6KA 2JEIA 2R93A 5KFLA 2FKLA 1RJQA 4RNMA 2UU9H 4JUZA 3RGZA 4A3IG 1A0IA 2VQDA 1I7NA 5J2UF 5KG1A 4YHHH 4ED8A 5DGAA 2UVRA 2O03A 5EOYA 5J2TF 4UCOA 5KG3A 2QYZA 1DIKA 4MTDA 2JEGA 4O3NA 5KFAA 5C3EG 4O2BF 2JA7G 2R93G 4J9KA 4MV7A 4PWQA 5LOVF 4RAZA 1T94A 4I4TF 3KHLA 3HOXG 1XDNA 4EFEA 5CA1F 4X64H 2E5LH 4DL3A 1O75A 3JRWA 4GKJH 2R92A 3BA9A 1UC8A 1VBGA 3JAMW 5CA0F 1AN7A 1I50A 3RBEA 2CW8A 1T36A 1ZHSA 3AYHB 3Q8PB 3T5HA 2YRXA 4F4WA 4LFCH 4MA0A 1WSCA 2YL2A 3LMLA 4DV1H 1Z2PX 2Y0SA 1S97A 3CVZA 1TA8A 3PO2G 4TV9F 3KAJA 4MV6A 5DG7A 5KT4A 3GTPA 2ZDQA 1KJJA 2OWOA 3WO1A 4DV6H 1JIHA 3ORRA 4O4IF 4J9LA 2W9AA 3KALA 2BQ3A 1GYFA 4C5CA 4A3CG 2ZM6H 3T1YH 1L2ZA 4DV4H 4DL5A 2FK3A 4HNUA 5LMNH 1VS0A 1SCUB 2AGQA 3T5LA 2Y0SE 5FLXW 4WD3A 3PVXA 1S0MA 4FS2A 1S03G 1E4GT 2FJZA 2R86A 2W9BA 2CZGA 2QK4A 4LSXA 3GQCA 2W7OA 2R82A 4GC7A 1XNQH 2NVXA 2YU9A 2YZGA 1GSHA 4BWSC 3JSLA 1K1SA 3VPDA 5HV6A 4ZI7F 4RNNA 4ECYA 2JA5G 4JI3H 3IG0A 4IRKA 5EZYF 3EPGA 4QW8A 4YAJB 4F4XA 4DL7A 4DV2H 2GPWA 2GLTA 3GIJA 2W6OA 5C8YF 3UFXB
chains in the Genus database with same CATH topology
4UCSA 4A2AA 3C0FB 3J7AK 2CW7A 5D1PA 4IAJA 2UXCH 3RJ0A 1S68A 5FD5A 4DV3H 4LF7H 4YY3H 1MZBA 2Q2TA 4LF6H 3RTXA 4LF8H 3BABA 2ZJTA 3PN1A 4FM9A 1IBKH 2UXDH 4B3MH 4UCVA 4LF4H 4UCUA 4B3RH 1WH2A 3OTOH 1XNRH 3F8NA 2WYOA 4DR2H 3T1HH 3J81W 3FMAA 4JI5H 2W57A 5A2QW 1HNWH 2RGRA 4DR6H 2HHHH 4DR7H 2MCTA 4JV5H 1Z2OX 2WDTA 1HNXH 3UQ8A 4LSAA 3RIZA 4DV5H 2Q2UA 1N34H 3KXYT 1X9NA 2HVQA 5D1OA 1XMQH 3J80W 4Q0YA 1FVIA 4OX9H 3BAAA 4CC6A 2YCHA 1BJTA 2UU9H 4LH6A 2VQEH 3RGZA 1IBLH 3M4IA 4X62H 3N41B 4UFZA 5IWAH 4J0MA 4DV7H 1A0IA 2HGSA 1V9PA 5LL6b 4YHHH 4B3TH 1SYXB 2VUGA 1I94H 3N43B 4GKKH 4KHPH 2O03A 5EOYA 2KSWA 4LFBH 4UCOA 1BGWA 4MTDA 3RGXA 4LF5H 4AQYH 4RB2C 4MV7A 4EFBA 5FPRA 4B3SH 4RAZA 2XIGA 3N42B 4X66H 2UXBH 3N44B 5LMUH 3K3VA 1FJGH 1XDNA 4NXMH 4RB0A 1P8LA 3RF2A 4EFEA 2RGVA 4X64H 1M0TA 1O75A 2E5LH 4GKJH 4UCRA 3BA9A 1DGSA 4LMYA 1XMOH 4NXNH 4K0KH 3JAMW 4RAYA 1AN7A 2FE3A 2VPSA 2F4VH 4JI1H 2CW8A 3L2PA 1ZHSA 4R7RA 3L4KA 2HVRA 2UUCH 4JI4H 3MWMA 4LFCH 5FD6A 3LMLA 4DV1H 1HNZH 2VQFH 2VOBA 1ZHQA 1Z2NX 4LH7A 4RB1A 2UUBH 4MTEA 1Z2PX 4EEQA 4DR4H 4JI6H 4X65H 4LFAH 4M7EA 3CVZA 1TA8A 3JSNA 1B04A 2HVSA 3KAJA 4MV9A 4JI7H 4DUYH 2OWOA 1TAEA 4APMA 4ETSA 1SEIA 4JI0H 4DV6H 3EYYA 4JYAH 1GYFA 3KALA 4CC5A 1L2ZA 2ZM6H 3T1YH 3DF7A 4DV4H 5LMNH 4LF9H 4RB3C 1VS0A 3H20A 1HR0H 3BA8A 4PDBA 1N32H 1IBMH 2WE6A 5FLXW 4DUZH 4JI2H 1S03G 1E4GT 4DR1H 1J5EH 1I6UA 4LSXA 4I7HA 1M0WA 5FPOA 4DV0H 3L4JA 3KAKA 5D1OB 2UUAH 1FKAH 1E4FT 1XNQH 4UCTA 4BWSC 3JSLA 4GLXA 5IT9W 4RZQA 4JI3H 3IG0A 1N36H 4DR5H 5BR8H 4DV2H 4DR3H 1N33H 4JI8H 3N6XA 3N40P 4A2BA 3HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG0 A;  3M4I A;  2ZJT A; 
#chains in the Genus database with same CATH topology
 3OHA A;  4IRC A;  5KG2 A;  5KT6 A;  1V51 A;  3SE7 A;  2YW2 A;  2PBZ A;  4ECS A;  2FPI B;  2R87 A;  4IAJ A;  3ORQ A;  5FD5 A;  1GO3 E;  3GTG A;  4ZQI A;  4YY3 H;  1MZB A;  5C4X G;  2R8I A;  3HOZ G;  2CQY A;  1RJR A;  2ZJT A;  4YJ2 F;  3WNZ A;  3MFI A;  2AGP A;  5KFS A;  1AUV A;  1IBK H;  2J9G A;  5CB4 F;  2YS6 A;  4B3M H;  1S9F A;  4Q43 A;  1PX2 A;  2BQU A;  3F8N A;  3TQT A;  5KFV A;  2WYO A;  3RV4 A;  4DR2 H;  2IMW P;  3RUP A;  3HOV G;  3KHG A;  3H4B A;  3FMA A;  3HKZ A;  5GON F;  5JVD F;  2UVV A;  1HNW H;  3RB3 A;  1S0N A;  2VA3 A;  1V4Y A;  4ZHQ F;  2ASJ A;  1HNX H;  3H3V H;  5BMV F;  3KXY T;  3V4Z A;  1X9N A;  4ECR A;  3J80 W;  5KT2 A;  1FVI A;  5KG6 A;  2W7P A;  1EHI A;  2DWC A;  3OUU A;  2IP4 A;  4CC6 A;  2WAQ A;  3RV3 A;  4C5B A;  5BPF A;  3ETJ A;  2DLN A;  2YCH A;  4IRD A;  1EUD B;  3HKZ E;  1IBL H;  3K5I A;  3OSP A;  3N41 B;  2GPS A;  3QFF A;  5LXT F;  1KC7 A;  2HGS A;  4Q44 A;  3VMM A;  3OUZ A;  4DV7 H;  4B3T H;  4GKK H;  4DL6 A;  4KHP H;  3GV8 B;  5KFU A;  3GIP A;  4A3K G;  4AQY H;  4J9O A;  2VPQ A;  4RB2 C;  1IOV A;  4EFB A;  3PR4 A;  2WB1 E;  2UXB H;  2XIG A;  2YYA A;  4A3E G;  4HQ6 A;  5DQG A;  2PVP A;  3K3V A;  2YRW A;  1C30 A;  5K2M A;  4YR3 A;  1P8L A;  2FPP B;  1M0T A;  3LWB A;  4LMY A;  1DGS A;  3PR5 B;  5IYD G;  1XMO H;  5DGB A;  1TWH A;  2J6T A;  3I4M G;  2F4V H;  2W71 A;  2UUC H;  2HVR A;  4R7R A;  3H0G A;  3GTL A;  5HBR B;  1JX4 A;  3MWM A;  1M7J A;  5KFY A;  5D8D A;  5FD6 A;  5KFC A;  2XGP A;  3GIL A;  5IP7 G;  2VQF H;  2VOB A;  4RB1 A;  4MTE A;  2NU6 B;  5DLF A;  2J6S A;  3GTJ A;  5F9N A;  1CQI B;  3GTO A;  3PO3 G;  1GSA A;  4XYM B;  1B04 A;  3WO0 A;  5KFH A;  1C3O A;  4U7C A;  4YQW A;  3Q8S B;  3H40 A;  4A3F G;  4U6P A;  1Y1W A;  2VUM A;  4ETS A;  4F50 A;  1N48 A;  2YZN A;  3RFC A;  3H0G G;  4JI0 H;  5EDW A;  4EEY A;  4ECX A;  2ASD A;  4CC5 A;  3MR6 A;  3DF7 A;  1I3Q A;  4EBD A;  4ECT A;  4ED0 A;  3V6H A;  4R8U A;  3H20 A;  4LF9 H;  2FLN A;  2I87 A;  4QWB A;  3GTK A;  3RB4 A;  1HR0 H;  2FMA A;  1B6R A;  3HOW G;  2J6U A;  2VA2 A;  1Y1W G;  2R8J A;  3H4D A;  5L1J A;  1J5E H;  1I6U A;  4J9R A;  4DV0 H;  2R7K A;  2FLP A;  1M6V A;  4XZ3 B;  3KAK A;  5KFJ A;  5D1O B;  4O4L F;  3L4J A;  3SI8 A;  4EBE A;  5IYC G;  1VBH A;  1E4E B;  1CE8 A;  4UCT A;  5KFP A;  1I7L A;  4GLX A;  4RZQ A;  1KJI A;  2R8H A;  1N36 H;  2R92 G;  1TWG A;  4Y8V B;  3U9S A;  5BR8 H;  1K1Q A;  4DR5 H;  4ECQ A;  1N33 H;  1KJQ A;  4JI8 H;  3N40 P;  4A2B A;  3G6X A;  4EYI B;  3HXL A;  4UCS A;  1S0O A;  3GLK A;  4HNV A;  3J7A K;  2CW7 A;  2I80 A;  3GIQ A;  3BJY A;  4C5A A;  5JH7 F;  3E5N A;  2XGQ A;  4IWX A;  3VPB A;  2DZD A;  4AYB E;  3QZ8 A;  1EUC B;  2V4R A;  2V4Q A;  4MV4 A;  2WTF A;  4FM9 A;  3GIK A;  1N56 A;  5KFX A;  2W6M A;  1RJP A;  4MV3 A;  4B3R H;  1WH2 A;  2C2D A;  2C2E A;  1GLV A;  3JZI A;  1KEE A;  5KX5 F;  4DLK A;  3T1H H;  1T3N A;  5KFZ A;  3J81 W;  4JI5 H;  2ATL A;  5A2Q W;  3M9N B;  4DL4 A;  2E2I A;  4MV8 A;  4A3M G;  2XCA A;  3I4N G;  4IR9 A;  2SCU B;  1WR2 A;  2ZDH A;  2IBK A;  3MWD A;  2WDT A;  4LSA A;  3Q8R B;  4A93 G;  1KJ8 A;  2BR0 A;  3OSN A;  1JXL A;  3N8D A;  4I50 F;  4Q0Y A;  1VAJ A;  5KFD A;  3TQ1 A;  3BQ2 A;  4ME6 A;  2ZDG A;  1JDB B;  4A3B G;  4J9S A;  2NUA B;  5L1I A;  2W9C A;  3M9M B;  4X62 H;  4UFZ A;  5IWA H;  4J0M A;  1V9P A;  5LL6 b;  1AUX A;  1SYX B;  2VUG A;  2ALZ A;  1KBL A;  1I94 H;  5KFE A;  2KSW A;  1OWT A;  2XD4 A;  1BGW A;  5KFI A;  2W6N A;  5IYZ F;  2W9B B;  3MR3 A;  4LF5 H;  4A3J G;  1KJ9 A;  4RNO A;  2FP4 B;  4DL2 A;  1K83 A;  4O3Q A;  1VKZ A;  5H80 A;  1JDE A;  3HB9 A;  5KFF A;  2XCP A;  5IP9 G;  2R8G A;  3N42 B;  3N44 B;  5LMU H;  3OHB A;  4NXM H;  2W6P A;  3RF2 A;  2RGV A;  4RUA A;  4G3I A;  1GSO A;  4Q45 A;  4UCR A;  4J9M A;  4F4Z A;  4NXN H;  4RAY A;  2M05 A;  2WB1 A;  4WBN F;  3BQ1 A;  2AGO A;  2X0S A;  5KFW A;  5KG4 A;  1CQJ B;  5KFR A;  3L4K A;  4JI1 H;  4JI4 H;  2AU0 A;  3VPC A;  2HJW A;  4QIW E;  2AQ4 A;  2V9W A;  4JV1 A;  5KT3 A;  1Z2N X;  4FU0 A;  5C1O A;  4EEQ A;  5DG9 A;  3Q2O A;  4DR4 H;  2W6Z A;  2RDJ A;  2XCL A;  1UC9 A;  2I8C A;  4X65 H;  4FBT A;  3M9O B;  3JSN A;  2R84 A;  4MV9 A;  4JI7 H;  4MV1 A;  5EWG A;  1RK6 A;  1Y1V A;  4APM A;  5JVL A;  4DUY H;  4FS1 A;  3T5K A;  3PW2 A;  2RDI A;  2C00 A;  3EYY A;  4JYA H;  5EWF A;  4A3G G;  4EGJ A;  4RB3 C;  4O2A F;  2R7N A;  5KT7 A;  5L1L A;  2C28 A;  4PDB A;  1N32 H;  5LA6 F;  1DV1 A;  4C2M A;  2R8K A;  2V59 A;  5KT5 A;  4JI2 H;  4YR0 A;  4F4Y A;  3K5H A;  1EYZ A;  3TII A;  4DR1 H;  2W8L A;  4GC6 A;  4O3S A;  4I7H A;  1M0W A;  3ETH A;  4RUC A;  4ECW A;  4IWY A;  2UUA H;  1E4F T;  3LP8 A;  3V4S A;  4ED1 A;  3PW7 A;  2V58 A;  2C35 B;  4O4H F;  5LP6 F;  5C5J A;  3IN5 A;  5IT9 W;  1R9T A;  4TQS A;  4ECV A;  5KG5 A;  5IYB G;  5KG0 A;  3CQZ A;  2JEJ A;  2FK1 A;  2ASL A;  4BXX G;  1ZET A;  4YR2 A;  2JA8 G;  3N6X A;  1RYR A;  3GTM A;  2OLS A;  4ED2 A;  3Q1K A;  3U9T A;  3EPI A;  1S10 A;  3C0F B;  3MFH A;  3TIN A;  2R7L A;  4QWE A;  2UXC H;  1ZQ7 A;  1S68 A;  4XX0 B;  2FLL A;  4IZO A;  2JA7 A;  3BAB A;  1EZ1 A;  3PN1 A;  4ECU A;  2VUM G;  1TWF A;  2UXD H;  5LYJ F;  3FKI A;  4UCU A;  1XNR H;  4A3D G;  4XYL B;  3FDS A;  4AYB A;  5JUM A;  4ED3 A;  5DQH A;  1WCM A;  2V5A A;  4QJF A;  5KFK A;  4QW9 A;  3G6Y A;  2B63 A;  1A9X A;  5KFG A;  3I12 A;  2C22 A;  3RB0 A;  2W57 A;  4J9N A;  4JV0 A;  4DR6 H;  4YP3 A;  2PMZ E;  2MCT A;  3TIG A;  4HR7 A;  4HYK A;  1Z2O X;  1B6S A;  3PW5 A;  3FKI G;  3RIZ A;  3HBL A;  5KFO A;  4DV5 H;  2Q2U A;  5KFQ A;  1N34 H;  3NGD A;  4YBZ B;  5DLG A;  3G8C A;  5CAE B;  2B63 G;  1WCM G;  3PW0 A;  4YAK B;  5EWE A;  3KHH A;  4OX9 H;  5F9L A;  2NU7 B;  4FBU A;  1BJT A;  4LH6 A;  3T5J A;  4R8U B;  2VQE H;  2C2R A;  3R5F A;  3M4I A;  5KFM A;  4O3R A;  2R7M A;  5FJ8 G;  4MA5 A;  4A3L G;  2RF4 A;  5I47 A;  3N43 B;  5KFN A;  4LFB H;  2R6F A;  3RGX A;  1RK5 A;  4L1K A;  1BXR A;  4J9P A;  5FPR A;  4B3S H;  5KG7 A;  1B33 N;  1JLL B;  4X66 H;  3RAQ A;  3R5H A;  3V6J A;  1FJG H;  1CS0 A;  2DIK A;  1GGO A;  4RB0 A;  4ED7 A;  2JA5 A;  3K3P A;  4ECZ A;  4BY7 G;  4JV5 H;  4JV2 A;  4K0K H;  2NU9 B;  2PN1 A;  2FE3 A;  3MR5 A;  2VPS A;  2NVY A;  1PK8 A;  2BQR A;  4ZOL F;  3L2P A;  3BQ0 A;  5T14 A;  1W96 A;  5L9X A;  5KFT A;  4YB8 B;  1HNZ H;  2UUB H;  1ZHQ A;  4LH7 A;  2W6Q A;  2UVU A;  2YS7 A;  4JI6 H;  4LFA H;  2HVS A;  4M9U A;  4BY1 G;  2R7Z A;  4QIW A;  5C1P A;  1TAE A;  3HOU G;  1SEI A;  4HNT A;  4TUY F;  1JKJ B;  4TQR A;  3RB6 A;  2VR1 A;  5KFB A;  5L1K A;  3BA8 A;  3GV5 B;  2W8K A;  3PZP A;  1IBM H;  2P0A A;  3KHR A;  5FLM G;  2WE6 A;  2R7Z G;  3GV7 B;  4J9Q A;  4DUZ H;  1TWA A;  4EBC A;  1IOW A;  2DPI A;  4I55 F;  1Y14 B;  3Q8Q B;  5FPO A;  3GIM A;  3R5X A;  1BNC A;  1FKA H;  3GID A;  4BBS G;  3GTQ A;  5C44 G;  3RBD A;  3BG5 A;  3MWE A;  4EG0 A;  4IHJ F;  4EGQ A;  4DR3 H;  2W9C B;  3PW4 A;  2JA6 A;  1TWC A;  4M7E A;  4ED6 A;  4A2A A;  2IA6 A;  1ULZ A;  5D1P A;  2FPG B;  4QWD A;  3RJ0 A;  2NU8 B;  4DV3 H;  2FK2 A;  4LF7 H;  2Q2T A;  4LF6 H;  4LF8 H;  3RTX A;  4QWC A;  3HOY G;  5BPH A;  3R23 A;  4MAM A;  2JA6 G;  4E4T A;  1Y1V G;  2DPJ A;  1DV2 A;  4UCV A;  4LF4 H;  3KTM A;  1SFO A;  1RYS A;  4QWA A;  3JRX A;  3OTO H;  4EYH B;  2R85 A;  5DQI A;  4Q8E A;  5DG8 A;  1UNN C;  2YZM A;  4YJ3 F;  5KKN B;  3G6V A;  4O3P A;  3RAX A;  2RGR A;  3GII A;  2FB9 A;  2HHH H;  2OH2 A;  4DR7 H;  4IR1 A;  2WAQ E;  4Q8F A;  3UQ8 A;  4NLG A;  2XC9 A;  4O3O A;  2W70 A;  3MR2 A;  2UVW A;  4RU9 A;  2CKZ B;  2HVQ A;  5D1O A;  2JEF A;  1XMQ H;  2E2H A;  1E4E A;  4TV8 F;  1W93 A;  4BBR G;  5JQW A;  3BAA A;  3MJF A;  2PMZ A;  4RZR A;  3QZ7 A;  3V6K A;  2JEI A;  2R93 A;  5KFL A;  2FKL A;  1RJQ A;  4RNM A;  2UU9 H;  4JUZ A;  3RGZ A;  4A3I G;  1A0I A;  2VQD A;  1I7N A;  5J2U F;  5KG1 A;  4YHH H;  4ED8 A;  5DGA A;  2UVR A;  2O03 A;  5EOY A;  5J2T F;  4UCO A;  5KG3 A;  2QYZ A;  1DIK A;  4MTD A;  2JEG A;  4O3N A;  5KFA A;  5C3E G;  4O2B F;  2JA7 G;  2R93 G;  4J9K A;  4MV7 A;  4PWQ A;  5LOV F;  4RAZ A;  1T94 A;  4I4T F;  3KHL A;  3HOX G;  1XDN A;  4EFE A;  5CA1 F;  4X64 H;  2E5L H;  4DL3 A;  1O75 A;  3JRW A;  4GKJ H;  2R92 A;  3BA9 A;  1UC8 A;  1VBG A;  3JAM W;  5CA0 F;  1AN7 A;  1I50 A;  3RBE A;  2CW8 A;  1T36 A;  1ZHS A;  3AYH B;  3Q8P B;  3T5H A;  2YRX A;  4F4W A;  4LFC H;  4MA0 A;  1WSC A;  2YL2 A;  3LML A;  4DV1 H;  1Z2P X;  2Y0S A;  1S97 A;  3CVZ A;  1TA8 A;  3PO2 G;  4TV9 F;  3KAJ A;  4MV6 A;  5DG7 A;  5KT4 A;  3GTP A;  2ZDQ A;  1KJJ A;  2OWO A;  3WO1 A;  4DV6 H;  1JIH A;  3ORR A;  4O4I F;  4J9L A;  2W9A A;  3KAL A;  2BQ3 A;  1GYF A;  4C5C A;  4A3C G;  2ZM6 H;  3T1Y H;  1L2Z A;  4DV4 H;  4DL5 A;  2FK3 A;  4HNU A;  5LMN H;  1VS0 A;  1SCU B;  2AGQ A;  3T5L A;  2Y0S E;  5FLX W;  4WD3 A;  3PVX A;  1S0M A;  4FS2 A;  1S03 G;  1E4G T;  2FJZ A;  2R86 A;  2W9B A;  2CZG A;  2QK4 A;  4LSX A;  3GQC A;  2W7O A;  2R82 A;  4GC7 A;  1XNQ H;  2NVX A;  2YU9 A;  2YZG A;  1GSH A;  4BWS C;  3JSL A;  1K1S A;  3VPD A;  5HV6 A;  4ZI7 F;  4RNN A;  4ECY A;  2JA5 G;  4JI3 H;  3IG0 A;  4IRK A;  5EZY F;  3EPG A;  4QW8 A;  4YAJ B;  4F4X A;  4DL7 A;  4DV2 H;  2GPW A;  2GLT A;  3GIJ A;  2W6O A;  5C8Y F;  3UFX B; 
#chains in the Genus database with same CATH homology
 4UCS A;  4A2A A;  3C0F B;  3J7A K;  2CW7 A;  5D1P A;  4IAJ A;  2UXC H;  3RJ0 A;  1S68 A;  5FD5 A;  4DV3 H;  4LF7 H;  4YY3 H;  1MZB A;  2Q2T A;  4LF6 H;  3RTX A;  4LF8 H;  3BAB A;  2ZJT A;  3PN1 A;  4FM9 A;  1IBK H;  2UXD H;  4B3M H;  4UCV A;  4LF4 H;  4UCU A;  4B3R H;  1WH2 A;  3OTO H;  1XNR H;  3F8N A;  2WYO A;  4DR2 H;  3T1H H;  3J81 W;  3FMA A;  4JI5 H;  2W57 A;  5A2Q W;  1HNW H;  2RGR A;  4DR6 H;  2HHH H;  4DR7 H;  2MCT A;  4JV5 H;  1Z2O X;  2WDT A;  1HNX H;  3UQ8 A;  4LSA A;  3RIZ A;  4DV5 H;  2Q2U A;  1N34 H;  3KXY T;  1X9N A;  2HVQ A;  5D1O A;  1XMQ H;  3J80 W;  4Q0Y A;  1FVI A;  4OX9 H;  3BAA A;  4CC6 A;  2YCH A;  1BJT A;  2UU9 H;  4LH6 A;  2VQE H;  3RGZ A;  1IBL H;  3M4I A;  4X62 H;  3N41 B;  4UFZ A;  5IWA H;  4J0M A;  4DV7 H;  1A0I A;  2HGS A;  1V9P A;  5LL6 b;  4YHH H;  4B3T H;  1SYX B;  2VUG A;  1I94 H;  3N43 B;  4GKK H;  4KHP H;  2O03 A;  5EOY A;  2KSW A;  4LFB H;  4UCO A;  1BGW A;  4MTD A;  3RGX A;  4LF5 H;  4AQY H;  4RB2 C;  4MV7 A;  4EFB A;  5FPR A;  4B3S H;  4RAZ A;  2XIG A;  3N42 B;  4X66 H;  2UXB H;  3N44 B;  5LMU H;  3K3V A;  1FJG H;  1XDN A;  4NXM H;  4RB0 A;  1P8L A;  3RF2 A;  4EFE A;  2RGV A;  4X64 H;  1M0T A;  1O75 A;  2E5L H;  4GKJ H;  4UCR A;  3BA9 A;  1DGS A;  4LMY A;  1XMO H;  4NXN H;  4K0K H;  3JAM W;  4RAY A;  1AN7 A;  2FE3 A;  2VPS A;  2F4V H;  4JI1 H;  2CW8 A;  3L2P A;  1ZHS A;  4R7R A;  3L4K A;  2HVR A;  2UUC H;  4JI4 H;  3MWM A;  4LFC H;  5FD6 A;  3LML A;  4DV1 H;  1HNZ H;  2VQF H;  2VOB A;  1ZHQ A;  1Z2N X;  4LH7 A;  4RB1 A;  2UUB H;  4MTE A;  1Z2P X;  4EEQ A;  4DR4 H;  4JI6 H;  4X65 H;  4LFA H;  4M7E A;  3CVZ A;  1TA8 A;  3JSN A;  1B04 A;  2HVS A;  3KAJ A;  4MV9 A;  4JI7 H;  4DUY H;  2OWO A;  1TAE A;  4APM A;  4ETS A;  1SEI A;  4JI0 H;  4DV6 H;  3EYY A;  4JYA H;  1GYF A;  3KAL A;  4CC5 A;  1L2Z A;  2ZM6 H;  3T1Y H;  3DF7 A;  4DV4 H;  5LMN H;  4LF9 H;  4RB3 C;  1VS0 A;  3H20 A;  1HR0 H;  3BA8 A;  4PDB A;  1N32 H;  1IBM H;  2WE6 A;  5FLX W;  4DUZ H;  4JI2 H;  1S03 G;  1E4G T;  4DR1 H;  1J5E H;  1I6U A;  4LSX A;  4I7H A;  1M0W A;  5FPO A;  4DV0 H;  3L4J A;  3KAK A;  5D1O B;  2UUA H;  1FKA H;  1E4F T;  1XNQ H;  4UCT A;  4BWS C;  3JSL A;  4GLX A;  5IT9 W;  4RZQ A;  4JI3 H;  3IG0 A;  1N36 H;  4DR5 H;  5BR8 H;  4DV2 H;  4DR3 H;  1N33 H;  4JI8 H;  3N6X A;  3N40 P;  4A2B A;  3HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...