3IG0A

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 2.1 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
185
Chain Sequence
b'TDPRKSELYVVEGMFQAILPLRGIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 60
structure length 185
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ig0A02
3M4IA 2ZJTA 3IG0A
chains in the Genus database with same CATH superfamily
1PX2A 4HNTA 5F9LA 2VOBA 4JI2H 4R8UA 4HYKA 3BJYA 3WO1A 3HOYG 1XDNA 3OTOH 4FS2A 2OLSA 3OHBA 2W57A 4O4IF 4J9LA 4QWBA 2ASJA 5KG1A 2CW8A 3RV3A 4ECQA 4JV0A 1WSCA 2FJZA 5IP9G 4JV1A 3N44B 1VKZA 4YR3A 1IBMH 3TINA 2R84A 5DGBA 5D1OB 3TQ1A 5CAEB 4ETSA 1S10A 3CVZA 4A3LG 4LH6A 3U9TA 1V4YA 4TV8F 4UCVA 1VAJA 1E4EA 1BXRA 2QK4A 5KG3A 4RU9A 4XYLB 4M7EA 2RDIA 1A0IA 4YY3H 2JEJA 4AQYH 4TUYF 5IYDG 5LP6F 2IA6A 2SCUB 2FB9A 2HVSA 1ULZA 2R86A 5C4XG 2X0SA 2XIGA 2C2DA 3MR6A 4LF7H 4F4WA 4ED3A 4ED2A 2BQRA 1B04A 2Y0SA 5IP7G 4IRCA 4BY7G 4LFAH 3PZPA 3V6JA 4A3KG 4ECWA 3PW0A 4DV5H 5LXTF 5IT9W 3KHRA 1RJRA 2I80A 5I47A 5KFXA 4IR9A 2R7NA 1VBHA 2FP4B 2V4RA 5LMNH 1V9PA 3KHHA 4IZOA 1AUVA 3K3PA 4JI4H 3JSLA 3GTMA 2YS7A 2R8JA 4IRDA 1K83A 2UVWA 2ZJTA 2C28A 2UVRA 3KAJA 2JEFA 1OWTA 5JUMA 3BAAA 2FK1A 3Q8RB 3JZIA 1I3QA 4EEYA 3RB3A 3GTOA 2YL2A 4U6PA 3C0FB 4LF5H 1E4GT 1GGOA 3ORQA 1JXLA 2Q2TA 2ATLA 1FKAH 3GTQA 1TA8A 3L2PA 4ZQIA 4IHJF 5GONF 5EWFA 4I7HA 3OSPA 4B3TH 3R5XA 5D1PA 2R8KA 1C30A 4TV9F 2PMZA 1KJJA 3DF7A 3MR2A 1I94H 2PN1A 2DPIA 4ME6A 3MFHA 4JI8H 5KFCA 2UUBH 4A3JG 1XMOH 2MCTA 3PN1A 3OUZA 4M9UA 5EOYA 2W9BA 1N34H 3EPGA 3RTXA 2YRXA 4F4YA 2DPJA 4LSAA 4ECZA 3SE7A 4C5CA 3RV4A 3WNZA 5KFMA 4FBUA 2R7ZG 4KHPH 1M0WA 2YU9A 4G3IA 4A3IG 5HBRB 4J9OA 4A3GG 3T5KA 3RB6A 2FK2A 3MWMA 2VUGA 4ED6A 2VPQA 3OUUA 1IOWA 3RBDA 4RZQA 2O03A 2AU0A 5H80A 5CA0F 4A93G 4JI3H 1CS0A 2ZM6H 4UCRA 4HNUA 5LL6b 3T1HH 1GYFA 5FLXW 4YAJB 2HHHH 4DL6A 1RK6A 4J9RA 4XX0B 2JA6A 4QIWA 4RNOA 2UVVA 5C3EG 4DV4H 4C5AA 5EZYF 4ECUA 1T36A 5J2TF 1N48A 2VA2A 4LSXA 3V6KA 3BQ2A 3RUPA 4Q45A 1AUXA 2PBZA 4O3RA 2JA5G 3GIMA 1Z2PX 4L1KA 2W7PA 1A9XA 2AGQA 4JI1H 4OX9H 3GTLA 3JRWA 5KFPA 4MV7A 4UCUA 4ED7A 5HV6A 2FLLA 4IRKA 1JDBB 1EYZA 4E4TA 3RF2A 4RB2C 2R7MA 3T5JA 4ZI7F 3EPIA 5C8YF 4QIWE 5JQWA 1RJQA 5KFFA 1I6UA 2ZDQA 3VPDA 4QWEA 4MV4A 3GV7B 2NVXA 3FKIG 3G6XA 4IWXA 3BG5A 4PDBA 1W96A 4Q8EA 2DZDA 3HOWG 5KT7A 3IG0A 3RIZA 4DUZH 2NVYA 2NUAB 4QJFA 5KFUA 5J2UF 3M9OB 3HOVG 2FLNA 1BGWA 2PVPA 4RZRA 1DV1A 1WCMG 4AYBE 4UCTA 3RGXA 1VBGA 2R7ZA 2IP4A 5KT6A 4EBEA 1DGSA 5KT4A 1IOVA 2OWOA 3H3VH 4B3SH 5KFGA 1KJ9A 5KKNB 2R92G 4A3MG 2JEIA 3GIDA 3AYHB 4IWYA 4JI0H 1BJTA 1B6RA 2AQ4A 2KSWA 5DG8A 2YZMA 2DWCA 2RF4A 3L4KA 5EDWA 5KFJA 2R7KA 1UC8A 4I55F 2YYAA 4O2AF 5F9NA 3G6YA 2R82A 2I87A 4MV3A 5KX5F 4X64H 5C1PA 5KFAA 4BXXG 2W71A 2C2EA 5L1LA 2CW7A 4MA0A 3RBEA 2Q2UA 1N56A 1SEIA 3UQ8A 1JX4A 3QZ7A 2HVRA 1DIKA 3N43B 2I8CA 2ZDGA 4A3FG 3SI8A 1B33N 4FS1A 2VR1A 4RB1A 1TWAA 5DQIA 1S0MA 4C2MA 4K0KH 4YBZB 5KFWA 2JA5A 4YR0A 2W7OA 3V4ZA 4DV3H 4J9QA 1TWFA 5KFZA 5KFLA 5KFYA 1KBLA 1N36H 1Z2OX 2FLPA 2JA6G 1N33H 4GLXA 2XCPA 4JI7H 4EBDA 4LF8H 3H40A 4EYIB 2P0AA 4A3EG 2CZGA 4R8UB 2W6NA 1J5EH 4X62H 1R9TA 5EWGA 4DR7H 3QZ8A 3RAQA 3PW7A 1KEEA 2W9CA 5DQGA 3GTPA 2YW2A 5FPRA 2GPWA 2AGPA 3FKIA 3T1YH 3GIKA 2R85A 2VA3A 4UCOA 5KT5A 4DL2A 5D8DA 5L1KA 4CC5A 5JH7F 3RB0A 1T94A 3EYYA 5KT3A 4DV6H 2BQUA 5BR8H 2XGQA 4A2BA 3JRXA 5KFIA 1WH2A 1TWGA 5IYCG 1WCMA 2UUCH 3HOZG 1PK8A 4YR2A 3I12A 3N41B 4DV1H 5KG0A 4HNVA 3GIPA 1K1QA 2BQ3A 1E4EB 1W93A 5JVLA 4IAJA 3H4DA 4J9SA 3KHGA 3H4BA 3MJFA 2R92A 3T5HA 3KTMA 2OH2A 4HR7A 4EBCA 4J9MA 4MV6A 2E2IA 2V59A 3VPCA 1RK5A 5FD6A 4A3CG 4FU0A 5FLMG 4LF6H 3LWBA 3J81W 3HB9A 4JUZA 4FM9A 1N32H 2B63G 1UNNC 4RNNA 3M9MB 3HKZE 2C22A 2V58A 3N6XA 3GTKA 4ECRA 2YZNA 2V9WA 4Q43A 2JA8G 3I4NG 4DUYH 4ED1A 4ECTA 3WO0A 2FPIB 4QWAA 4TQSA 2E5LH 3RAXA 4BWSC 2ASLA 1KC7A 4C5BA 2W6QA 4PWQA 1JKJB 5KFSA 4LF9H 2UXCH 1M6VA 2W8KA 3KAKA 2VQDA 4MV8A 2J9GA 3GILA 2IBKA 3PR4A 4DLKA 3BA8A 4A2AA 2UXDH 3V4SA 2YCHA 4Q8FA 4IR1A 1B6SA 1FVIA 3V6HA 4NXMH 1AN7A 4O3OA 1RYRA 2XCLA 4JV5H 1EZ1A 5C1OA 1HNWH 4A3DG 3PVXA 3GIQA 1Y1WG 3L4JA 3GTGA 2XGPA 5KFTA 1JIHA 4BBRG 3JSNA 1JDEA 4AYBA 2R93G 1Y14B 4O3PA 3Q2OA 4RB3C 5C44G 3T5LA 4RUCA 1TWHA 1SFOA 4YB8B 4O2BF 3J7AK 2W9AA 2RGVA 1KJIA 4LH7A 4WD3A 2W9BB 4YHHH 2UU9H 4MV1A 3MR5A 5DQHA 5C5JA 1TWCA 2W6ZA 4QWDA 1S0OA 2UUAH 4DR6H 4ECXA 2ZDHA 5DGAA 3TIGA 4F4XA 5T14A 2W8LA 2FE3A 3Q8SB 1SCUB 3MWDA 5CB4F 3VPBA 3N42B 2DLNA 2VQFH 1IBLH 2YS6A 5KFRA 3BQ1A 3ORRA 4B3RH 2WAQA 1WR2A 2NU6B 4J0MA 2B63A 4UFZA 1S9FA 3RJ0A 3PW5A 3GTJA 2J6SA 3VMMA 5KFNA 5L9XA 4R7RA 1ZETA 4F50A 5DLFA 3F8NA 4F4ZA 3U9SA 2C2RA 2QYZA 4LF4H 3K5HA 3JAMW 5IYBG 3H0GG 2ASDA 1ZHSA 5JVDF 5KFHA 4X66H 3I4MG 4U7CA 4YQWA 4JI6H 5KG7A 5K2MA 1EUCB 4DR2H 2R7LA 3FDSA 5BPHA 1GSAA 5DLGA 4EYHB 3BQ0A 3CQZA 2WAQE 1ZHQA 5KG2A 4RNMA 2WTFA 4YJ3F 3M9NB 4J9NA 1XMQH 4GKJH 2XC9A 3KALA 4MAMA 1K1SA 4QW8A 3NGDA 3OHAA 2FK3A 1Y1WA 2R8HA 4FBTA 5LA6F 2NU9B 2W6PA 2C00A 4LFBH 3N8DA 2R93A 4EG0A 1KJQA 3HXLA 1L2ZA 1ZQ7A 5DG7A 2FKLA 3PR5B 1M7JA 4ECSA 5KG6A 3GIIA 2HJWA 3BA9A 4DR5H 5LMUH 2UXBH 4O3NA 1TAEA 1CE8A 1I7LA 1BNCA 1C3OA 2NU7B 3RB4A 4WBNF 2E2HA 1GSHA 2M05A 4MA5A 4X65H 4DV2H 4NLGA 5KG5A 5LOVF 2VUMG 4EGQA 3RFCA 3HKZA 4EGJA 3HOXG 2RDJA 4DL3A 2AGOA 3HBLA 2XCAA 1Z2NX 4J9KA 1Y1VG 1MZBA 2FPPB 3GV5B 2JA7G 1CQIB 2WB1A 2FPGB 1P8LA 2W6MA 2WE6A 3LMLA 3LP8A 5IWAH 4I4TF 2R8IA 4GC6A 4ED0A 1XNRH 3MWEA 4ZHQF 4RUAA 3TIIA 2Y0SE 4I50F 4QW9A 1X9NA 2ALZA 2J6TA 4QWCA 3Q8PB 3H0GA 3K3VA 2R87A 4O4HF 4MTEA 1HNZH 3PO2G 3ETHA 1RJPA 5L1JA 2CKZB 1SYXB 3E5NA 5CA1F 1XNQH 4A3BG 4DL7A 1S68A 1S0NA 4RAYA 2VQEH 1VS0A 4LMYA 5KFQA 3MFIA 1FJGH 1DV2A 2HGSA 4O3SA 3H20A 5FD5A 3BABA 2DIKA 1EUDB 1V51A 5KFKA 5LYJF 4JV2A 4XYMB 4MTDA 5FPOA 2WB1E 4ZOLF 3G6VA 4ED8A 4MV9A 4UCSA 5EWEA 4DL5A 1IBKH 3KHLA 3MR3A 3Q8QB 2VPSA 4Y8VB 2BR0A 5KFEA 2NU8B 3IN5A 2YRWA 3K5IA 4Q0YA 4ECVA 3PW2A 2J6UA 1T3NA 2WDTA 1EHIA 1M0TA 5A2QW 5KFOA 4RAZA 4TQRA 2F4VH 2W9CB 4O4LF 4YJ2F 4APMA 4DR4H 2PMZE 5KFDA 2GLTA 4B3MH 4YAKB 2CQYA 2XD4A 5KG4A 5KT2A 3TQTA 3PO3G 2RGRA 4EEQA 2R8GA 5D1OA 3M4IA 2HVQA 5IYZF 3UFXB 4Q44A 2C35B 3R23A 5KFBA 2WYOA 4ECYA 4GKKH 2VUMA 1I50A 1I7NA 5BMVF 1GSOA 3ETJA 3FMAA 1HNXH 1HR0H 2JEGA 3RGZA 3GQCA 2UVUA 1Y1VA 5KFVA 4DV7H 3R5HA 3N40P 1CQJB 4HQ6A 4NXNH 3QFFA 3GV8B 2JA7A 1S97A 1RYSA 4RB0A 5DG9A 4BBSG 4O3QA 4J9PA 2W6OA 4XZ3B 5BPFA 3GIJA 4JI5H 2GPSA 1GLVA 4EFBA 3PW4A 2YZGA 3Q1KA 5L1IA 4DL4A 4DR1H 2R6FA 1O75A 2V5AA 3GLKA 1UC9A 2IMWP 1GO3E 3G8CA 2FMAA 4YP3A 3OSNA 4DV0H 4BY1G 3HOUG 1JLLB 2W70A 4CC6A 3J80W 5FJ8G 1E4FT 2V4QA 4DR3H 1KJ8A 4EFEA 1S03G 4LFCH 3KXYT 4GC7A 3R5FA 4JYAH
chains in the Genus database with same CATH topology
3HXLA 1L2ZA 2VOBA 4JI2H 1XDNA 3OTOH 5FD6A 2W57A 4DV4H 3BA9A 4DR5H 4LF6H 3J81W 5LMUH 2UXBH 1TAEA 2CW8A 4FM9A 1N32H 4LSXA 3N6XA 3N44B 1Z2PX 4DV2H 4X65H 1IBMH 4JI1H 4DUYH 4OX9H 5D1OB 4ETSA 4MV7A 4UCUA 3CVZA 2E5LH 4BWSC 4LH6A 4LF9H 2UXCH 3RF2A 4JYAH 3KAKA 1FKAH 1Z2NX 4UCVA 4RB2C 4M7EA 1MZBA 1A0IA 4YY3H 4AQYH 1I6UA 5IWAH 3LMLA 1P8LA 2WE6A 3BA8A 4A2AA 2UXDH 2HVSA 1XNRH 2YCHA 4PDBA 1FVIA 1X9NA 2XIGA 4NXMH 4DUZH 3IG0A 3RIZA 4LF7H 1AN7A 3K3VA 4MTEA 1B04A 1HNZH 1BGWA 1XNQH 4JV5H 1SYXB 4LFAH 1HNWH 4UCTA 1S68A 3RGXA 4RAYA 3L4JA 2VQEH 1DGSA 1VS0A 4LMYA 4DV5H 1FJGH 2HGSA 2OWOA 3H20A 3JSNA 5IT9W 5FD5A 4B3SH 3BABA 4RB3C 5LMNH 1V9PA 4MTDA 5FPOA 4JI0H 3J7AK 1BJTA 4MV9A 3JSLA 4UCSA 4JI4H 1IBKH 2KSWA 2RGVA 4LH7A 4YHHH 2VPSA 2UU9H 2ZJTA 3KAJA 3L4KA 3BAAA 4Q0YA 2UUAH 4DR6H 2WDTA 1M0TA 5A2QW 2F4VH 3C0FB 4RAZA 4X64H 4LF5H 1E4GT 4DR4H 4APMA 2Q2TA 2CW7A 2FE3A 2Q2UA 4B3MH 1TA8A 3L2PA 1SEIA 4B3TH 3UQ8A 4I7HA 5D1PA 2HVRA 3N43B 3N42B 3DF7A 2VQFH 1IBLH 4EEQA 2RGRA 4B3RH 4RB1A 4J0MA 5D1OA 1I94H 4K0KH 4UFZA 3M4IA 2HVQA 3RJ0A 4JI8H 2UUBH 4DV3H 4R7RA 2WYOA 4GKKH 1N36H 1XMOH 2MCTA 1N33H 1Z2OX 3PN1A 4GLXA 3F8NA 5EOYA 4JI7H 4LF8H 4LF4H 3FMAA 1N34H 1HNXH 1HR0H 3RTXA 3JAMW 1ZHSA 3RGZA 4X66H 1J5EH 4X62H 4DR7H 4LSAA 4JI6H 4DV7H 4DR2H 3N40P 4NXNH 4KHPH 1M0WA 4RB0A 5FPRA 3T1YH 4JI5H 1ZHQA 4EFBA 4UCOA 3MWMA 2VUGA 4DR1H 1O75A 4CC5A 1XMQH 3EYYA 4RZQA 4DV6H 4GKJH 2O03A 3KALA 5BR8H 4A2BA 1WH2A 4DV0H 2UUCH 4JI3H 4CC6A 3J80W 1E4FT 2ZM6H 3N41B 4DV1H 4UCRA 4EFEA 4DR3H 1S03G 3T1HH 5LL6b 4LFCH 3KXYT 1GYFA 5FLXW 4LFBH 4IAJA 2HHHH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4I A;  2ZJT A;  3IG0 A; 
#chains in the Genus database with same CATH topology
 1PX2 A;  4HNT A;  5F9L A;  2VOB A;  4JI2 H;  4R8U A;  4HYK A;  3BJY A;  3WO1 A;  3HOY G;  1XDN A;  3OTO H;  4FS2 A;  2OLS A;  3OHB A;  2W57 A;  4O4I F;  4J9L A;  4QWB A;  2ASJ A;  5KG1 A;  2CW8 A;  3RV3 A;  4ECQ A;  4JV0 A;  1WSC A;  2FJZ A;  5IP9 G;  4JV1 A;  3N44 B;  1VKZ A;  4YR3 A;  1IBM H;  3TIN A;  2R84 A;  5DGB A;  5D1O B;  3TQ1 A;  5CAE B;  4ETS A;  1S10 A;  3CVZ A;  4A3L G;  4LH6 A;  3U9T A;  1V4Y A;  4TV8 F;  4UCV A;  1VAJ A;  1E4E A;  1BXR A;  2QK4 A;  5KG3 A;  4RU9 A;  4XYL B;  4M7E A;  2RDI A;  1A0I A;  4YY3 H;  2JEJ A;  4AQY H;  4TUY F;  5IYD G;  5LP6 F;  2IA6 A;  2SCU B;  2FB9 A;  2HVS A;  1ULZ A;  2R86 A;  5C4X G;  2X0S A;  2XIG A;  2C2D A;  3MR6 A;  4LF7 H;  4F4W A;  4ED3 A;  4ED2 A;  2BQR A;  1B04 A;  2Y0S A;  5IP7 G;  4IRC A;  4BY7 G;  4LFA H;  3PZP A;  3V6J A;  4A3K G;  4ECW A;  3PW0 A;  4DV5 H;  5LXT F;  5IT9 W;  3KHR A;  1RJR A;  2I80 A;  5I47 A;  5KFX A;  4IR9 A;  2R7N A;  1VBH A;  2FP4 B;  2V4R A;  5LMN H;  1V9P A;  3KHH A;  4IZO A;  1AUV A;  3K3P A;  4JI4 H;  3JSL A;  3GTM A;  2YS7 A;  2R8J A;  4IRD A;  1K83 A;  2UVW A;  2ZJT A;  2C28 A;  2UVR A;  3KAJ A;  2JEF A;  1OWT A;  5JUM A;  3BAA A;  2FK1 A;  3Q8R B;  3JZI A;  1I3Q A;  4EEY A;  3RB3 A;  3GTO A;  2YL2 A;  4U6P A;  3C0F B;  4LF5 H;  1E4G T;  1GGO A;  3ORQ A;  1JXL A;  2Q2T A;  2ATL A;  1FKA H;  3GTQ A;  1TA8 A;  3L2P A;  4ZQI A;  4IHJ F;  5GON F;  5EWF A;  4I7H A;  3OSP A;  4B3T H;  3R5X A;  5D1P A;  2R8K A;  1C30 A;  4TV9 F;  2PMZ A;  1KJJ A;  3DF7 A;  3MR2 A;  1I94 H;  2PN1 A;  2DPI A;  4ME6 A;  3MFH A;  4JI8 H;  5KFC A;  2UUB H;  4A3J G;  1XMO H;  2MCT A;  3PN1 A;  3OUZ A;  4M9U A;  5EOY A;  2W9B A;  1N34 H;  3EPG A;  3RTX A;  2YRX A;  4F4Y A;  2DPJ A;  4LSA A;  4ECZ A;  3SE7 A;  4C5C A;  3RV4 A;  3WNZ A;  5KFM A;  4FBU A;  2R7Z G;  4KHP H;  1M0W A;  2YU9 A;  4G3I A;  4A3I G;  5HBR B;  4J9O A;  4A3G G;  3T5K A;  3RB6 A;  2FK2 A;  3MWM A;  2VUG A;  4ED6 A;  2VPQ A;  3OUU A;  1IOW A;  3RBD A;  4RZQ A;  2O03 A;  2AU0 A;  5H80 A;  5CA0 F;  4A93 G;  4JI3 H;  1CS0 A;  2ZM6 H;  4UCR A;  4HNU A;  5LL6 b;  3T1H H;  1GYF A;  5FLX W;  4YAJ B;  2HHH H;  4DL6 A;  1RK6 A;  4J9R A;  4XX0 B;  2JA6 A;  4QIW A;  4RNO A;  2UVV A;  5C3E G;  4DV4 H;  4C5A A;  5EZY F;  4ECU A;  1T36 A;  5J2T F;  1N48 A;  2VA2 A;  4LSX A;  3V6K A;  3BQ2 A;  3RUP A;  4Q45 A;  1AUX A;  2PBZ A;  4O3R A;  2JA5 G;  3GIM A;  1Z2P X;  4L1K A;  2W7P A;  1A9X A;  2AGQ A;  4JI1 H;  4OX9 H;  3GTL A;  3JRW A;  5KFP A;  4MV7 A;  4UCU A;  4ED7 A;  5HV6 A;  2FLL A;  4IRK A;  1JDB B;  1EYZ A;  4E4T A;  3RF2 A;  4RB2 C;  2R7M A;  3T5J A;  4ZI7 F;  3EPI A;  5C8Y F;  4QIW E;  5JQW A;  1RJQ A;  5KFF A;  1I6U A;  2ZDQ A;  3VPD A;  4QWE A;  4MV4 A;  3GV7 B;  2NVX A;  3FKI G;  3G6X A;  4IWX A;  3BG5 A;  4PDB A;  1W96 A;  4Q8E A;  2DZD A;  3HOW G;  5KT7 A;  3IG0 A;  3RIZ A;  4DUZ H;  2NVY A;  2NUA B;  4QJF A;  5KFU A;  5J2U F;  3M9O B;  3HOV G;  2FLN A;  1BGW A;  2PVP A;  4RZR A;  1DV1 A;  1WCM G;  4AYB E;  4UCT A;  3RGX A;  1VBG A;  2R7Z A;  2IP4 A;  5KT6 A;  4EBE A;  1DGS A;  5KT4 A;  1IOV A;  2OWO A;  3H3V H;  4B3S H;  5KFG A;  1KJ9 A;  5KKN B;  2R92 G;  4A3M G;  2JEI A;  3GID A;  3AYH B;  4IWY A;  4JI0 H;  1BJT A;  1B6R A;  2AQ4 A;  2KSW A;  5DG8 A;  2YZM A;  2DWC A;  2RF4 A;  3L4K A;  5EDW A;  5KFJ A;  2R7K A;  1UC8 A;  4I55 F;  2YYA A;  4O2A F;  5F9N A;  3G6Y A;  2R82 A;  2I87 A;  4MV3 A;  5KX5 F;  4X64 H;  5C1P A;  5KFA A;  4BXX G;  2W71 A;  2C2E A;  5L1L A;  2CW7 A;  4MA0 A;  3RBE A;  2Q2U A;  1N56 A;  1SEI A;  3UQ8 A;  1JX4 A;  3QZ7 A;  2HVR A;  1DIK A;  3N43 B;  2I8C A;  2ZDG A;  4A3F G;  3SI8 A;  1B33 N;  4FS1 A;  2VR1 A;  4RB1 A;  1TWA A;  5DQI A;  1S0M A;  4C2M A;  4K0K H;  4YBZ B;  5KFW A;  2JA5 A;  4YR0 A;  2W7O A;  3V4Z A;  4DV3 H;  4J9Q A;  1TWF A;  5KFZ A;  5KFL A;  5KFY A;  1KBL A;  1N36 H;  1Z2O X;  2FLP A;  2JA6 G;  1N33 H;  4GLX A;  2XCP A;  4JI7 H;  4EBD A;  4LF8 H;  3H40 A;  4EYI B;  2P0A A;  4A3E G;  2CZG A;  4R8U B;  2W6N A;  1J5E H;  4X62 H;  1R9T A;  5EWG A;  4DR7 H;  3QZ8 A;  3RAQ A;  3PW7 A;  1KEE A;  2W9C A;  5DQG A;  3GTP A;  2YW2 A;  5FPR A;  2GPW A;  2AGP A;  3FKI A;  3T1Y H;  3GIK A;  2R85 A;  2VA3 A;  4UCO A;  5KT5 A;  4DL2 A;  5D8D A;  5L1K A;  4CC5 A;  5JH7 F;  3RB0 A;  1T94 A;  3EYY A;  5KT3 A;  4DV6 H;  2BQU A;  5BR8 H;  2XGQ A;  4A2B A;  3JRX A;  5KFI A;  1WH2 A;  1TWG A;  5IYC G;  1WCM A;  2UUC H;  3HOZ G;  1PK8 A;  4YR2 A;  3I12 A;  3N41 B;  4DV1 H;  5KG0 A;  4HNV A;  3GIP A;  1K1Q A;  2BQ3 A;  1E4E B;  1W93 A;  5JVL A;  4IAJ A;  3H4D A;  4J9S A;  3KHG A;  3H4B A;  3MJF A;  2R92 A;  3T5H A;  3KTM A;  2OH2 A;  4HR7 A;  4EBC A;  4J9M A;  4MV6 A;  2E2I A;  2V59 A;  3VPC A;  1RK5 A;  5FD6 A;  4A3C G;  4FU0 A;  5FLM G;  4LF6 H;  3LWB A;  3J81 W;  3HB9 A;  4JUZ A;  4FM9 A;  1N32 H;  2B63 G;  1UNN C;  4RNN A;  3M9M B;  3HKZ E;  2C22 A;  2V58 A;  3N6X A;  3GTK A;  4ECR A;  2YZN A;  2V9W A;  4Q43 A;  2JA8 G;  3I4N G;  4DUY H;  4ED1 A;  4ECT A;  3WO0 A;  2FPI B;  4QWA A;  4TQS A;  2E5L H;  3RAX A;  4BWS C;  2ASL A;  1KC7 A;  4C5B A;  2W6Q A;  4PWQ A;  1JKJ B;  5KFS A;  4LF9 H;  2UXC H;  1M6V A;  2W8K A;  3KAK A;  2VQD A;  4MV8 A;  2J9G A;  3GIL A;  2IBK A;  3PR4 A;  4DLK A;  3BA8 A;  4A2A A;  2UXD H;  3V4S A;  2YCH A;  4Q8F A;  4IR1 A;  1B6S A;  1FVI A;  3V6H A;  4NXM H;  1AN7 A;  4O3O A;  1RYR A;  2XCL A;  4JV5 H;  1EZ1 A;  5C1O A;  1HNW H;  4A3D G;  3PVX A;  3GIQ A;  1Y1W G;  3L4J A;  3GTG A;  2XGP A;  5KFT A;  1JIH A;  4BBR G;  3JSN A;  1JDE A;  4AYB A;  2R93 G;  1Y14 B;  4O3P A;  3Q2O A;  4RB3 C;  5C44 G;  3T5L A;  4RUC A;  1TWH A;  1SFO A;  4YB8 B;  4O2B F;  3J7A K;  2W9A A;  2RGV A;  1KJI A;  4LH7 A;  4WD3 A;  2W9B B;  4YHH H;  2UU9 H;  4MV1 A;  3MR5 A;  5DQH A;  5C5J A;  1TWC A;  2W6Z A;  4QWD A;  1S0O A;  2UUA H;  4DR6 H;  4ECX A;  2ZDH A;  5DGA A;  3TIG A;  4F4X A;  5T14 A;  2W8L A;  2FE3 A;  3Q8S B;  1SCU B;  3MWD A;  5CB4 F;  3VPB A;  3N42 B;  2DLN A;  2VQF H;  1IBL H;  2YS6 A;  5KFR A;  3BQ1 A;  3ORR A;  4B3R H;  2WAQ A;  1WR2 A;  2NU6 B;  4J0M A;  2B63 A;  4UFZ A;  1S9F A;  3RJ0 A;  3PW5 A;  3GTJ A;  2J6S A;  3VMM A;  5KFN A;  5L9X A;  4R7R A;  1ZET A;  4F50 A;  5DLF A;  3F8N A;  4F4Z A;  3U9S A;  2C2R A;  2QYZ A;  4LF4 H;  3K5H A;  3JAM W;  5IYB G;  3H0G G;  2ASD A;  1ZHS A;  5JVD F;  5KFH A;  4X66 H;  3I4M G;  4U7C A;  4YQW A;  4JI6 H;  5KG7 A;  5K2M A;  1EUC B;  4DR2 H;  2R7L A;  3FDS A;  5BPH A;  1GSA A;  5DLG A;  4EYH B;  3BQ0 A;  3CQZ A;  2WAQ E;  1ZHQ A;  5KG2 A;  4RNM A;  2WTF A;  4YJ3 F;  3M9N B;  4J9N A;  1XMQ H;  4GKJ H;  2XC9 A;  3KAL A;  4MAM A;  1K1S A;  4QW8 A;  3NGD A;  3OHA A;  2FK3 A;  1Y1W A;  2R8H A;  4FBT A;  5LA6 F;  2NU9 B;  2W6P A;  2C00 A;  4LFB H;  3N8D A;  2R93 A;  4EG0 A;  1KJQ A;  3HXL A;  1L2Z A;  1ZQ7 A;  5DG7 A;  2FKL A;  3PR5 B;  1M7J A;  4ECS A;  5KG6 A;  3GII A;  2HJW A;  3BA9 A;  4DR5 H;  5LMU H;  2UXB H;  4O3N A;  1TAE A;  1CE8 A;  1I7L A;  1BNC A;  1C3O A;  2NU7 B;  3RB4 A;  4WBN F;  2E2H A;  1GSH A;  2M05 A;  4MA5 A;  4X65 H;  4DV2 H;  4NLG A;  5KG5 A;  5LOV F;  2VUM G;  4EGQ A;  3RFC A;  3HKZ A;  4EGJ A;  3HOX G;  2RDJ A;  4DL3 A;  2AGO A;  3HBL A;  2XCA A;  1Z2N X;  4J9K A;  1Y1V G;  1MZB A;  2FPP B;  3GV5 B;  2JA7 G;  1CQI B;  2WB1 A;  2FPG B;  1P8L A;  2W6M A;  2WE6 A;  3LML A;  3LP8 A;  5IWA H;  4I4T F;  2R8I A;  4GC6 A;  4ED0 A;  1XNR H;  3MWE A;  4ZHQ F;  4RUA A;  3TII A;  2Y0S E;  4I50 F;  4QW9 A;  1X9N A;  2ALZ A;  2J6T A;  4QWC A;  3Q8P B;  3H0G A;  3K3V A;  2R87 A;  4O4H F;  4MTE A;  1HNZ H;  3PO2 G;  3ETH A;  1RJP A;  5L1J A;  2CKZ B;  1SYX B;  3E5N A;  5CA1 F;  1XNQ H;  4A3B G;  4DL7 A;  1S68 A;  1S0N A;  4RAY A;  2VQE H;  1VS0 A;  4LMY A;  5KFQ A;  3MFI A;  1FJG H;  1DV2 A;  2HGS A;  4O3S A;  3H20 A;  5FD5 A;  3BAB A;  2DIK A;  1EUD B;  1V51 A;  5KFK A;  5LYJ F;  4JV2 A;  4XYM B;  4MTD A;  5FPO A;  2WB1 E;  4ZOL F;  3G6V A;  4ED8 A;  4MV9 A;  4UCS A;  5EWE A;  4DL5 A;  1IBK H;  3KHL A;  3MR3 A;  3Q8Q B;  2VPS A;  4Y8V B;  2BR0 A;  5KFE A;  2NU8 B;  3IN5 A;  2YRW A;  3K5I A;  4Q0Y A;  4ECV A;  3PW2 A;  2J6U A;  1T3N A;  2WDT A;  1EHI A;  1M0T A;  5A2Q W;  5KFO A;  4RAZ A;  4TQR A;  2F4V H;  2W9C B;  4O4L F;  4YJ2 F;  4APM A;  4DR4 H;  2PMZ E;  5KFD A;  2GLT A;  4B3M H;  4YAK B;  2CQY A;  2XD4 A;  5KG4 A;  5KT2 A;  3TQT A;  3PO3 G;  2RGR A;  4EEQ A;  2R8G A;  5D1O A;  3M4I A;  2HVQ A;  5IYZ F;  3UFX B;  4Q44 A;  2C35 B;  3R23 A;  5KFB A;  2WYO A;  4ECY A;  4GKK H;  2VUM A;  1I50 A;  1I7N A;  5BMV F;  1GSO A;  3ETJ A;  3FMA A;  1HNX H;  1HR0 H;  2JEG A;  3RGZ A;  3GQC A;  2UVU A;  1Y1V A;  5KFV A;  4DV7 H;  3R5H A;  3N40 P;  1CQJ B;  4HQ6 A;  4NXN H;  3QFF A;  3GV8 B;  2JA7 A;  1S97 A;  1RYS A;  4RB0 A;  5DG9 A;  4BBS G;  4O3Q A;  4J9P A;  2W6O A;  4XZ3 B;  5BPF A;  3GIJ A;  4JI5 H;  2GPS A;  1GLV A;  4EFB A;  3PW4 A;  2YZG A;  3Q1K A;  5L1I A;  4DL4 A;  4DR1 H;  2R6F A;  1O75 A;  2V5A A;  3GLK A;  1UC9 A;  2IMW P;  1GO3 E;  3G8C A;  2FMA A;  4YP3 A;  3OSN A;  4DV0 H;  4BY1 G;  3HOU G;  1JLL B;  2W70 A;  4CC6 A;  3J80 W;  5FJ8 G;  1E4F T;  2V4Q A;  4DR3 H;  1KJ8 A;  4EFE A;  1S03 G;  4LFC H;  3KXY T;  4GC7 A;  3R5F A;  4JYA H; 
#chains in the Genus database with same CATH homology
 3HXL A;  1L2Z A;  2VOB A;  4JI2 H;  1XDN A;  3OTO H;  5FD6 A;  2W57 A;  4DV4 H;  3BA9 A;  4DR5 H;  4LF6 H;  3J81 W;  5LMU H;  2UXB H;  1TAE A;  2CW8 A;  4FM9 A;  1N32 H;  4LSX A;  3N6X A;  3N44 B;  1Z2P X;  4DV2 H;  4X65 H;  1IBM H;  4JI1 H;  4DUY H;  4OX9 H;  5D1O B;  4ETS A;  4MV7 A;  4UCU A;  3CVZ A;  2E5L H;  4BWS C;  4LH6 A;  4LF9 H;  2UXC H;  3RF2 A;  4JYA H;  3KAK A;  1FKA H;  1Z2N X;  4UCV A;  4RB2 C;  4M7E A;  1MZB A;  1A0I A;  4YY3 H;  4AQY H;  1I6U A;  5IWA H;  3LML A;  1P8L A;  2WE6 A;  3BA8 A;  4A2A A;  2UXD H;  2HVS A;  1XNR H;  2YCH A;  4PDB A;  1FVI A;  1X9N A;  2XIG A;  4NXM H;  4DUZ H;  3IG0 A;  3RIZ A;  4LF7 H;  1AN7 A;  3K3V A;  4MTE A;  1B04 A;  1HNZ H;  1BGW A;  1XNQ H;  4JV5 H;  1SYX B;  4LFA H;  1HNW H;  4UCT A;  1S68 A;  3RGX A;  4RAY A;  3L4J A;  2VQE H;  1DGS A;  1VS0 A;  4LMY A;  4DV5 H;  1FJG H;  2HGS A;  2OWO A;  3H20 A;  3JSN A;  5IT9 W;  5FD5 A;  4B3S H;  3BAB A;  4RB3 C;  5LMN H;  1V9P A;  4MTD A;  5FPO A;  4JI0 H;  3J7A K;  1BJT A;  4MV9 A;  3JSL A;  4UCS A;  4JI4 H;  1IBK H;  2KSW A;  2RGV A;  4LH7 A;  4YHH H;  2VPS A;  2UU9 H;  2ZJT A;  3KAJ A;  3L4K A;  3BAA A;  4Q0Y A;  2UUA H;  4DR6 H;  2WDT A;  1M0T A;  5A2Q W;  2F4V H;  3C0F B;  4RAZ A;  4X64 H;  4LF5 H;  1E4G T;  4DR4 H;  4APM A;  2Q2T A;  2CW7 A;  2FE3 A;  2Q2U A;  4B3M H;  1TA8 A;  3L2P A;  1SEI A;  4B3T H;  3UQ8 A;  4I7H A;  5D1P A;  2HVR A;  3N43 B;  3N42 B;  3DF7 A;  2VQF H;  1IBL H;  4EEQ A;  2RGR A;  4B3R H;  4RB1 A;  4J0M A;  5D1O A;  1I94 H;  4K0K H;  4UFZ A;  3M4I A;  2HVQ A;  3RJ0 A;  4JI8 H;  2UUB H;  4DV3 H;  4R7R A;  2WYO A;  4GKK H;  1N36 H;  1XMO H;  2MCT A;  1N33 H;  1Z2O X;  3PN1 A;  4GLX A;  3F8N A;  5EOY A;  4JI7 H;  4LF8 H;  4LF4 H;  3FMA A;  1N34 H;  1HNX H;  1HR0 H;  3RTX A;  3JAM W;  1ZHS A;  3RGZ A;  4X66 H;  1J5E H;  4X62 H;  4DR7 H;  4LSA A;  4JI6 H;  4DV7 H;  4DR2 H;  3N40 P;  4NXN H;  4KHP H;  1M0W A;  4RB0 A;  5FPR A;  3T1Y H;  4JI5 H;  1ZHQ A;  4EFB A;  4UCO A;  3MWM A;  2VUG A;  4DR1 H;  1O75 A;  4CC5 A;  1XMQ H;  3EYY A;  4RZQ A;  4DV6 H;  4GKJ H;  2O03 A;  3KAL A;  5BR8 H;  4A2B A;  1WH2 A;  4DV0 H;  2UUC H;  4JI3 H;  4CC6 A;  3J80 W;  1E4F T;  2ZM6 H;  3N41 B;  4DV1 H;  4UCR A;  4EFE A;  4DR3 H;  1S03 G;  3T1H H;  5LL6 b;  4LFC H;  3KXY T;  1GYF A;  5FLX W;  4LFB H;  4IAJ A;  2HHH H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...