3IG0A

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 2.1 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
185
Chain Sequence
TDPRKSELYVVEGMFQAILPLRGIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords DNA gyrase subunit B
total genus 60
structure length 185
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ig0A02
3M4IA 3IG0A 2ZJTA
chains in the Genus database with same CATH superfamily
5CA0F 3QZ7A 4JYAH 4LF4H 1EZ1A 4YQWA 3RBDA 2R8JA 1WCMA 3K3PA 2FK1A 5C5JA 4FBTA 3PN1A 1TA8A 5KT6A 4I4TF 1CE8A 5KG0A 2R7MA 4ECSA 1IOVA 4A3GG 5KKNB 2JA6G 4C5BA 2W9BB 1Y1WG 4UCRA 5KFDA 3QZ8A 3H40A 2ASJA 2YS6A 1N56A 3KHHA 4Q8FA 2AGOA 3FDSA 1MZBA 4ECYA 5KFHA 3TQ1A 2DPIA 3SI8A 4RAZA 3MWDA 3ORRA 4MV4A 5FD5A 2W9BA 3RF2A 4JV1A 3Q8SB 4DV7H 1M0TA 1S68A 1TAEA 1PX2A 2SCUB 3I4MG 4DR6H 3LWBA 4ME6A 5EWGA 4BBRG 1KC7A 2JEJA 4IRKA 4K0KH 4HR7A 1KJ8A 3RGXA 2DWCA 1EHIA 4C2MA 5BR8H 4QW9A 3GIKA 4DR1H 4GC6A 2UUCH 3HBLA 1Y1VG 2GLTA 4ZQIA 4DR2H 2W7PA 3GTOA 2BR0A 4MV6A 5FPOA 3MJFA 5HV6A 1A9XA 2ZDHA 3IG0A 5BMVF 4R8UB 1GLVA 3BQ1A 2DPJA 4YHHH 4O2BF 2VOBA 2E2IA 1XMQH 3TIIA 2ZJTA 4YBZB 5KFXA 5A2QW 2UVWA 4JV5H 4X62H 2W6PA 4FS1A 2IBKA 4EEQA 4ED8A 2VPSA 1E4EA 2R85A 2FK3A 1SCUB 2UXDH 5BPHA 4RU9A 1E4GT 2W6OA 5EZYF 2R84A 2W6MA 4AYBA 3H3VH 2V4RA 4AYBE 4RB0A 4TQRA 1ZETA 4LF6H 4EGQA 5DLFA 3GIQA 3RFCA 1N32H 2R6FA 5LA6F 3EPIA 5IP9G 4RB2C 5FLMG 2W9CB 2XCAA 2AGPA 1E4FT 3PW2A 4DL7A 3H0GA 4QW8A 3GV7B 2W57A 3MWEA 4MV8A 2WTFA 1RYRA 3WO0A 5KT2A 3RGZA 4CC6A 2YZGA 3HKZA 4PDBA 4A3FG 1K1SA 1B04A 4GKJH 2W6ZA 4DR3H 2XIGA 4BBSG 5LMUH 4ECWA 4IWYA 5KFIA 1JIHA 1UC8A 1KBLA 3Q8RB 2B63A 1JLLB 2XGQA 2Q2TA 4A3DG 3GIIA 4FBUA 3GTKA 2HVQA 3BJYA 1M0WA 3BQ0A 1BNCA 4I55F 2NUAB 4F4YA 2FLLA 2UVVA 2UXBH 2E2HA 2W7OA 2YS7A 4A3LG 4RAYA 3JAMW 1HR0H 4U7CA 4A3JG 5EWFA 3N40P 4A3IG 1S0NA 4XYMB 4EBCA 1TWFA 4F4WA 4ECTA 3UQ8A 5EWEA 4RB1A 4JV2A 3V4SA 4LF8H 1P8LA 4JI4H 1SEIA 2BQ3A 5D1OB 4EYIB 4YR0A 5KG4A 5C44G 3HOYG 2NVYA 4YR3A 2Y0SA 3PW7A 4DR5H 3MR3A 3R5FA 4XX0B 5DG8A 4NXNH 2JEIA 3F8NA 5IYZF 3V4ZA 5KT5A 1DV1A 4O2AF 4O3OA 4YY3H 1IBLH 3Q2OA 1EYZA 1RJPA 4QIWA 4O3SA 1B33N 1DIKA 5T14A 2R8GA 4LF5H 4J9OA 5KFRA 5KFKA 4FU0A 1B6RA 3QFFA 2YYAA 2R7NA 4G3IA 4QWEA 3KHRA 4HNVA 4J0MA 2BQRA 4UCOA 2PMZA 2QK4A 1S0OA 2FPPB 2R7KA 3C0FB 5KG5A 1VBHA 2XCLA 5KFWA 2FP4B 1UC9A 2CQYA 5D1PA 2XC9A 2R8KA 2HVRA 5C4XG 4RNOA 1I6UA 1V9PA 4A3MG 1TWGA 1S10A 4QWCA 2UVRA 1JKJB 2GPSA 3GV8B 3PO3G 5LOVF 1TWCA 3BA9A 2JA7A 2I87A 3ETHA 4ZI7F 1AN7A 3SE7A 4RNMA 1N33H 3RTXA 2AGQA 5C1OA 3MWMA 2AU0A 3N42B 1C30A 3G6YA 4Q44A 4J9KA 3I12A 4LSAA 3GTQA 2VUMA 5LXTF 4X65H 1SFOA 3GQCA 4MV7A 1R9TA 1OWTA 4BXXG 4BWSC 3J80W 4OX9H 4ECRA 2UXCH 2JA8G 3AYHB 3PW4A 1JXLA 2WAQA 1AUVA 3CQZA 3K5HA 5JQWA 5L1IA 2R7ZG 4MAMA 1S97A 3VMMA 2WAQE 3Q8PB 2JA5A 1K1QA 1ZHQA 3MR5A 1HNXH 4JUZA 2R86A 5GONF 3RB0A 1UNNC 3RV3A 2FPGB 4LFAH 5K2MA 4A93G 2OWOA 4DV6H 4F4XA 3BG5A 4B3MH 4QJFA 2W6QA 2YW2A 4Q45A 2ASDA 2YZNA 4RUAA 1WCMG 4DV2H 1XNRH 4Q43A 4ECQA 3ETJA 5DQHA 4L1KA 5IYCG 5DGAA 3WO1A 2RF4A 3U9SA 2JEGA 4I7HA 3GIDA 3VPDA 3HOWG 4TQSA 2JA6A 4ED6A 4UCVA 5EOYA 4EG0A 4LFBH 3G6VA 3Q8QB 5EDWA 1FKAH 4DUZH 2YU9A 2XCPA 3U9TA 5D8DA 2W71A 5L9XA 4ED2A 5DG7A 4NLGA 4DR4H 1V4YA 1Z2OX 4I50F 5KFYA 1RYSA 3GIMA 3OUZA 2R82A 4ECVA 1WH2A 4ED3A 2FMAA 2R92G 5KFBA 4JI2H 3M9MB 3V6HA 4DL4A 3FMAA 1XNQH 1RK5A 5DG9A 2UUAH 1M7JA 2V9WA 3JZIA 1EUDB 2FE3A 5KT7A 4DV1H 3KALA 1N34H 5IYDG 4ZHQF 3PO2G 4YAKB 3MFIA 4DV4H 4J9NA 4LH6A 2R93G 2VQDA 3JSLA 2VPQA 1I50A 5KX5F 2R87A 4UCSA 2WB1E 4FM9A 1Y1VA 4O4IF 3OTOH 5KG6A 3GV5B 2KSWA 4X66H 3PR5B 2P0AA 3PVXA 2OH2A 5CAEB 1ULZA 4YJ2F 4GC7A 3GIPA 4E4TA 4QWBA 2HGSA 2UVUA 4DR7H 1DV2A 5KFVA 2HJWA 1BXRA 4XYLB 3T5JA 4ECXA 1GSOA 1JDEA 2PBZA 4TV8F 5IYBG 3OHAA 4DL6A 3HOXG 3H20A 1IBMH 2W9AA 2FJZA 4YAJB 4J9LA 1FVIA 2YRXA 5CA1F 2JEFA 2YZMA 2X0SA 3R5HA 2AQ4A 4R7RA 3MFHA 5KFQA 4A3BG 1CS0A 4IAJA 5FLXW 4EBDA 1I94H 3K5IA 4CC5A 4R8UA 3FKIG 2J9GA 5JH7F 4J9SA 1EUCB 1W93A 1VKZA 4MA0A 4ECUA 3HB9A 4IHJF 4QWDA 3IN5A 4YJ3F 2C28A 1VBGA 1KJ9A 1N36H 5JVDF 3RAXA 2UUBH 3HOVG 3HKZE 5KFAA 4ED1A 2IP4A 3G6XA 2HVSA 1HNZH 4JI1H 1Z2PX 2C00A 3GLKA 4EEYA 2VR1A 4O4HF 1X9NA 2Q2UA 4RZRA 4C5AA 4DLKA 1KEEA 4RB3C 4A3EG 2ALZA 3KXYT 5DGBA 4GKKH 4JI5H 2IA6A 3LMLA 1TWAA 4ECZA 3N44B 3GILA 4UFZA 2VQFH 5C8YF 4KHPH 5DQGA 2CKZB 4U6PA 5FJ8G 4B3TH 2XD4A 3JRXA 1O75A 2B63G 2VUGA 2O03A 3EYYA 2QYZA 1Y1WA 2DLNA 4YB8B 1I7LA 5KG1A 3V6KA 4EBEA 3G8CA 5LYJF 2ZM6H 4O3RA 4XZ3B 1V51A 4JI3H 1TWHA 5FD6A 3PW0A 4BY1G 4MV3A 4YR2A 2C2DA 2R7LA 2WE6A 3PR4A 2RGRA 2V5AA 2NVXA 5IT9W 5KFJA 3BABA 4A2AA 3OHBA 1GSHA 4YP3A 2WYOA 3T5HA 2M05A 4QIWE 5LMNH 1CQIB 4B3RH 4Y8VB 1GSAA 3GTLA 2CW7A 4ED7A 5BPFA 2E5LH 3R23A 5L1JA 1RJRA 1CQJB 4EFEA 3JSNA 2J6SA 5KG7A 4JI7H 2VA2A 2PVPA 5C3EG 4PWQA 2BQUA 1I7NA 3JRWA 3WNZA 4O3PA 5KG3A 1J5EH 3N43B 3EPGA 3N41B 3CVZA 2IMWP 4DL2A 2V4QA 1JDBB 2W6NA 5KFOA 1B6SA 3RB4A 2J6UA 4GLXA 2YCHA 4F50A 4UCTA 5KFMA 3T1HH 1SYXB 2C2EA 2F4VH 3MR2A 4JI8H 5KFUA 1S9FA 4NXMH 3UFXB 2YL2A 4LH7A 4LFCH 5KG2A 4LMYA 5DQIA 1VAJA 4HYKA 3PW5A 4WD3A 3VPBA 3KHGA 4LF9H 2GPWA 3N6XA 4MA5A 3M4IA 2V58A 4J9QA 1L2ZA 5KFTA 3L2PA 4IR1A 4AQYH 5KFSA 3T1YH 4A3CG 4DV0H 5FPRA 1KJJA 2I8CA 3KHLA 4J9RA 1T94A 2CW8A 4ED0A 3HOZG 4M7EA 2RDIA 3BAAA 5JVLA 4EFBA 3TIGA 1KJIA 3OSNA 5H80A 3RB6A 3H0GG 2R8IA 3KAJA 2MCTA 3BA8A 1ZQ7A 2PN1A 1RK6A 3T5LA 4Q0YA 5KFFA 2NU7B 3RJ0A 1T3NA 2FLNA 3I4NG 5CB4F 2ZDQA 2C35B 4IRCA 1WR2A 2R7ZA 5KFZA 5IP7G 3GTMA 2JA5G 5KFEA 3M9NB 4IR9A 4APMA 3V6JA 2RGVA 2FB9A 3HXLA 1XDNA 2W8LA 4UCUA 1Z2NX 4A2BA 3KAKA 5F9LA 3MR6A 2ATLA 2CZGA 3HOUG 3GTPA 5KFGA 1T36A 2NU6B 4HNTA 5LL6b 4RNNA 2I80A 5C1PA 5KFCA 4FS2A 3RBEA 4Q8EA 1RJQA 4IWXA 4IZOA 3N8DA 4C5CA 3GIJA 1ZHSA 2FK2A 3M9OB 2UU9H 4F4ZA 5IWAH 1M6VA 3K3VA 5JUMA 4HNUA 5L1LA 4MTEA 4BY7G 4J9MA 3NGDA 2J6TA 5DLGA 4DV3H 1W96A 4JI0H 2ZDGA 3R5XA 1BJTA 2R92A 1WSCA 4B3SH 1IBKH 2WB1A 5D1OA 3T5KA 2W9CA 3H4DA 4IRDA 2R8HA 2XGPA 2Y0SE 2VQEH 4DL3A 3E5NA 2YRWA 1IOWA 4O3NA 2NU8B 1S0MA 5L1KA 1AUXA 4WBNF 3J7AK 2R93A 1DGSA 1C3OA 4MV9A 3RIZA 1FJGH 3L4JA 2W70A 3RV4A 1JX4A 3ORQA 5J2TF 3VPCA 2NU9B 2ASLA 4MV1A 5KT3A 3L4KA 3H4BA 4DUYH 4M9UA 2V59A 2DZDA 4EYHB 3RB3A 3OSPA 1XMOH 4ZOLF 2PMZE 4RUCA 5KFLA 4J9PA 1A0IA 5F9NA 5KFNA 2OLSA 3RAQA 2HHHH 1BGWA 1KJQA 4TV9F 3GTJA 2JA7G 2C22A 2FKLA 2W8KA 2VA3A 3KTMA 3FKIA 1GYFA 2RDJA 1E4EB 3RUPA 5LP6F 3OUUA 4RZQA 2VUMG 5KFPA 4O4LF 3TQTA 1I3QA 5KT4A 1Y14B 4O3QA 2C2RA 2DIKA 1S03G 1K83A 4A3KG 4X64H 1VS0A 4QWAA 1N48A 4DV5H 3Q1KA 1HNWH 1GGOA 2WDTA 4LF7H 4JV0A 4LSXA 1PK8A 5HBRB 2FLPA 1GO3E 4TUYF 3TINA 3J81W 3GTGA 4MTDA 4ETSA 3LP8A 2FPIB 4EGJA 3PZPA 4DL5A 5J2UF 4JI6H 3DF7A 4HQ6A 3BQ2A 5I47A
chains in the Genus database with same CATH topology
2CW8A 4LF4H 4JYAH 4M7EA 3BAAA 4DR5H 4EFBA 1IBMH 3H20A 1TA8A 3PN1A 4NXNH 3F8NA 3KAJA 2MCTA 3BA8A 4YY3H 1IBLH 1FVIA 4Q0YA 3RJ0A 4UCRA 4R7RA 4LF5H 4IAJA 5FLXW 1I94H 1MZBA 4CC5A 1N33H 4RAZA 5FD5A 4J0MA 4APMA 4UCOA 3RF2A 2RGVA 3HXLA 1XDNA 4DV7H 1M0TA 3C0FB 1S68A 1Z2NX 1TAEA 4UCUA 1N36H 4A2BA 3KAKA 4DR6H 5D1PA 2UUBH 2HVRA 4K0KH 2HVSA 1I6UA 3RGXA 1HNZH 1Z2PX 1V9PA 5BR8H 5LL6b 4DR1H 2UUCH 4JI1H 1X9NA 2Q2UA 1ZHSA 3BA9A 4DR2H 2UU9H 5FPOA 5IWAH 4RB3C 3IG0A 1AN7A 3K3VA 3KXYT 4MTEA 3RTXA 4JI5H 3LMLA 4GKKH 3MWMA 4YHHH 2VOBA 4DV3H 1XMQH 3N42B 3N44B 4UFZA 4JI0H 2VQFH 1BJTA 2ZJTA 4KHPH 4LSAA 1L2ZA 4B3TH 5A2QW 4X65H 4JV5H 4X62H 4MV7A 1O75A 2VUGA 2O03A 3EYYA 4BWSC 3J80W 1IBKH 4EEQA 4B3SH 2VPSA 5D1OA 4OX9H 2UXCH 2ZM6H 2UXDH 2VQEH 4JI3H 5FD6A 1E4GT 3J7AK 1ZHQA 1HNXH 1DGSA 4MV9A 3RIZA 1FJGH 4LFAH 3L4JA 4RB0A 2WE6A 2RGRA 4LF6H 5IT9W 3BABA 4A2AA 2OWOA 4DV6H 4B3MH 2WYOA 3L4KA 5LMNH 1N32H 4DUYH 4B3RH 4DV2H 4RB2C 1XNRH 2CW7A 1XMOH 1E4FT 2E5LH 4DR7H 2W57A 1HNWH 4I7HA 1A0IA 2HHHH 4UCVA 5EOYA 4EFEA 1BGWA 3JSNA 4LFBH 3RGZA 4CC6A 4DUZH 1FKAH 4JI7H 4PDBA 4DR4H 1Z2OX 1GYFA 1J5EH 1B04A 3N43B 4GKJH 4RZQA 1WH2A 3CVZA 2XIGA 3N41B 5LMUH 4DR3H 4JI2H 3FMAA 1XNQH 2UUAH 2Q2TA 4GLXA 2YCHA 1S03G 2FE3A 4UCTA 2HVQA 4DV1H 1M0WA 1SYXB 3KALA 3T1HH 1N34H 4NXMH 2F4VH 2UXBH 4X64H 4JI8H 1VS0A 4RAYA 4DV4H 3JAMW 4LH6A 4LH7A 2WDTA 4DV5H 1HR0H 4LF7H 4LMYA 3JSLA 3N40P 4LSXA 4LF9H 4LFCH 3J81W 4UCSA 4MTDA 3N6XA 4ETSA 3UQ8A 4RB1A 4FM9A 3OTOH 3M4IA 4LF8H 2KSWA 1P8LA 4X66H 1SEIA 3L2PA 4JI4H 4AQYH 5D1OB 3T1YH 3DF7A 4DV0H 4JI6H 5FPRA 2HGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4I A;  3IG0 A;  2ZJT A; 
#chains in the Genus database with same CATH topology
 5CA0 F;  3QZ7 A;  4JYA H;  4LF4 H;  1EZ1 A;  4YQW A;  3RBD A;  2R8J A;  1WCM A;  3K3P A;  2FK1 A;  5C5J A;  4FBT A;  3PN1 A;  1TA8 A;  5KT6 A;  4I4T F;  1CE8 A;  5KG0 A;  2R7M A;  4ECS A;  1IOV A;  4A3G G;  5KKN B;  2JA6 G;  4C5B A;  2W9B B;  1Y1W G;  4UCR A;  5KFD A;  3QZ8 A;  3H40 A;  2ASJ A;  2YS6 A;  1N56 A;  3KHH A;  4Q8F A;  2AGO A;  3FDS A;  1MZB A;  4ECY A;  5KFH A;  3TQ1 A;  2DPI A;  3SI8 A;  4RAZ A;  3MWD A;  3ORR A;  4MV4 A;  5FD5 A;  2W9B A;  3RF2 A;  4JV1 A;  3Q8S B;  4DV7 H;  1M0T A;  1S68 A;  1TAE A;  1PX2 A;  2SCU B;  3I4M G;  4DR6 H;  3LWB A;  4ME6 A;  5EWG A;  4BBR G;  1KC7 A;  2JEJ A;  4IRK A;  4K0K H;  4HR7 A;  1KJ8 A;  3RGX A;  2DWC A;  1EHI A;  4C2M A;  5BR8 H;  4QW9 A;  3GIK A;  4DR1 H;  4GC6 A;  2UUC H;  3HBL A;  1Y1V G;  2GLT A;  4ZQI A;  4DR2 H;  2W7P A;  3GTO A;  2BR0 A;  4MV6 A;  5FPO A;  3MJF A;  5HV6 A;  1A9X A;  2ZDH A;  3IG0 A;  5BMV F;  4R8U B;  1GLV A;  3BQ1 A;  2DPJ A;  4YHH H;  4O2B F;  2VOB A;  2E2I A;  1XMQ H;  3TII A;  2ZJT A;  4YBZ B;  5KFX A;  5A2Q W;  2UVW A;  4JV5 H;  4X62 H;  2W6P A;  4FS1 A;  2IBK A;  4EEQ A;  4ED8 A;  2VPS A;  1E4E A;  2R85 A;  2FK3 A;  1SCU B;  2UXD H;  5BPH A;  4RU9 A;  1E4G T;  2W6O A;  5EZY F;  2R84 A;  2W6M A;  4AYB A;  3H3V H;  2V4R A;  4AYB E;  4RB0 A;  4TQR A;  1ZET A;  4LF6 H;  4EGQ A;  5DLF A;  3GIQ A;  3RFC A;  1N32 H;  2R6F A;  5LA6 F;  3EPI A;  5IP9 G;  4RB2 C;  5FLM G;  2W9C B;  2XCA A;  2AGP A;  1E4F T;  3PW2 A;  4DL7 A;  3H0G A;  4QW8 A;  3GV7 B;  2W57 A;  3MWE A;  4MV8 A;  2WTF A;  1RYR A;  3WO0 A;  5KT2 A;  3RGZ A;  4CC6 A;  2YZG A;  3HKZ A;  4PDB A;  4A3F G;  1K1S A;  1B04 A;  4GKJ H;  2W6Z A;  4DR3 H;  2XIG A;  4BBS G;  5LMU H;  4ECW A;  4IWY A;  5KFI A;  1JIH A;  1UC8 A;  1KBL A;  3Q8R B;  2B63 A;  1JLL B;  2XGQ A;  2Q2T A;  4A3D G;  3GII A;  4FBU A;  3GTK A;  2HVQ A;  3BJY A;  1M0W A;  3BQ0 A;  1BNC A;  4I55 F;  2NUA B;  4F4Y A;  2FLL A;  2UVV A;  2UXB H;  2E2H A;  2W7O A;  2YS7 A;  4A3L G;  4RAY A;  3JAM W;  1HR0 H;  4U7C A;  4A3J G;  5EWF A;  3N40 P;  4A3I G;  1S0N A;  4XYM B;  4EBC A;  1TWF A;  4F4W A;  4ECT A;  3UQ8 A;  5EWE A;  4RB1 A;  4JV2 A;  3V4S A;  4LF8 H;  1P8L A;  4JI4 H;  1SEI A;  2BQ3 A;  5D1O B;  4EYI B;  4YR0 A;  5KG4 A;  5C44 G;  3HOY G;  2NVY A;  4YR3 A;  2Y0S A;  3PW7 A;  4DR5 H;  3MR3 A;  3R5F A;  4XX0 B;  5DG8 A;  4NXN H;  2JEI A;  3F8N A;  5IYZ F;  3V4Z A;  5KT5 A;  1DV1 A;  4O2A F;  4O3O A;  4YY3 H;  1IBL H;  3Q2O A;  1EYZ A;  1RJP A;  4QIW A;  4O3S A;  1B33 N;  1DIK A;  5T14 A;  2R8G A;  4LF5 H;  4J9O A;  5KFR A;  5KFK A;  4FU0 A;  1B6R A;  3QFF A;  2YYA A;  2R7N A;  4G3I A;  4QWE A;  3KHR A;  4HNV A;  4J0M A;  2BQR A;  4UCO A;  2PMZ A;  2QK4 A;  1S0O A;  2FPP B;  2R7K A;  3C0F B;  5KG5 A;  1VBH A;  2XCL A;  5KFW A;  2FP4 B;  1UC9 A;  2CQY A;  5D1P A;  2XC9 A;  2R8K A;  2HVR A;  5C4X G;  4RNO A;  1I6U A;  1V9P A;  4A3M G;  1TWG A;  1S10 A;  4QWC A;  2UVR A;  1JKJ B;  2GPS A;  3GV8 B;  3PO3 G;  5LOV F;  1TWC A;  3BA9 A;  2JA7 A;  2I87 A;  3ETH A;  4ZI7 F;  1AN7 A;  3SE7 A;  4RNM A;  1N33 H;  3RTX A;  2AGQ A;  5C1O A;  3MWM A;  2AU0 A;  3N42 B;  1C30 A;  3G6Y A;  4Q44 A;  4J9K A;  3I12 A;  4LSA A;  3GTQ A;  2VUM A;  5LXT F;  4X65 H;  1SFO A;  3GQC A;  4MV7 A;  1R9T A;  1OWT A;  4BXX G;  4BWS C;  3J80 W;  4OX9 H;  4ECR A;  2UXC H;  2JA8 G;  3AYH B;  3PW4 A;  1JXL A;  2WAQ A;  1AUV A;  3CQZ A;  3K5H A;  5JQW A;  5L1I A;  2R7Z G;  4MAM A;  1S97 A;  3VMM A;  2WAQ E;  3Q8P B;  2JA5 A;  1K1Q A;  1ZHQ A;  3MR5 A;  1HNX H;  4JUZ A;  2R86 A;  5GON F;  3RB0 A;  1UNN C;  3RV3 A;  2FPG B;  4LFA H;  5K2M A;  4A93 G;  2OWO A;  4DV6 H;  4F4X A;  3BG5 A;  4B3M H;  4QJF A;  2W6Q A;  2YW2 A;  4Q45 A;  2ASD A;  2YZN A;  4RUA A;  1WCM G;  4DV2 H;  1XNR H;  4Q43 A;  4ECQ A;  3ETJ A;  5DQH A;  4L1K A;  5IYC G;  5DGA A;  3WO1 A;  2RF4 A;  3U9S A;  2JEG A;  4I7H A;  3GID A;  3VPD A;  3HOW G;  4TQS A;  2JA6 A;  4ED6 A;  4UCV A;  5EOY A;  4EG0 A;  4LFB H;  3G6V A;  3Q8Q B;  5EDW A;  1FKA H;  4DUZ H;  2YU9 A;  2XCP A;  3U9T A;  5D8D A;  2W71 A;  5L9X A;  4ED2 A;  5DG7 A;  4NLG A;  4DR4 H;  1V4Y A;  1Z2O X;  4I50 F;  5KFY A;  1RYS A;  3GIM A;  3OUZ A;  2R82 A;  4ECV A;  1WH2 A;  4ED3 A;  2FMA A;  2R92 G;  5KFB A;  4JI2 H;  3M9M B;  3V6H A;  4DL4 A;  3FMA A;  1XNQ H;  1RK5 A;  5DG9 A;  2UUA H;  1M7J A;  2V9W A;  3JZI A;  1EUD B;  2FE3 A;  5KT7 A;  4DV1 H;  3KAL A;  1N34 H;  5IYD G;  4ZHQ F;  3PO2 G;  4YAK B;  3MFI A;  4DV4 H;  4J9N A;  4LH6 A;  2R93 G;  2VQD A;  3JSL A;  2VPQ A;  1I50 A;  5KX5 F;  2R87 A;  4UCS A;  2WB1 E;  4FM9 A;  1Y1V A;  4O4I F;  3OTO H;  5KG6 A;  3GV5 B;  2KSW A;  4X66 H;  3PR5 B;  2P0A A;  3PVX A;  2OH2 A;  5CAE B;  1ULZ A;  4YJ2 F;  4GC7 A;  3GIP A;  4E4T A;  4QWB A;  2HGS A;  2UVU A;  4DR7 H;  1DV2 A;  5KFV A;  2HJW A;  1BXR A;  4XYL B;  3T5J A;  4ECX A;  1GSO A;  1JDE A;  2PBZ A;  4TV8 F;  5IYB G;  3OHA A;  4DL6 A;  3HOX G;  3H20 A;  1IBM H;  2W9A A;  2FJZ A;  4YAJ B;  4J9L A;  1FVI A;  2YRX A;  5CA1 F;  2JEF A;  2YZM A;  2X0S A;  3R5H A;  2AQ4 A;  4R7R A;  3MFH A;  5KFQ A;  4A3B G;  1CS0 A;  4IAJ A;  5FLX W;  4EBD A;  1I94 H;  3K5I A;  4CC5 A;  4R8U A;  3FKI G;  2J9G A;  5JH7 F;  4J9S A;  1EUC B;  1W93 A;  1VKZ A;  4MA0 A;  4ECU A;  3HB9 A;  4IHJ F;  4QWD A;  3IN5 A;  4YJ3 F;  2C28 A;  1VBG A;  1KJ9 A;  1N36 H;  5JVD F;  3RAX A;  2UUB H;  3HOV G;  3HKZ E;  5KFA A;  4ED1 A;  2IP4 A;  3G6X A;  2HVS A;  1HNZ H;  4JI1 H;  1Z2P X;  2C00 A;  3GLK A;  4EEY A;  2VR1 A;  4O4H F;  1X9N A;  2Q2U A;  4RZR A;  4C5A A;  4DLK A;  1KEE A;  4RB3 C;  4A3E G;  2ALZ A;  3KXY T;  5DGB A;  4GKK H;  4JI5 H;  2IA6 A;  3LML A;  1TWA A;  4ECZ A;  3N44 B;  3GIL A;  4UFZ A;  2VQF H;  5C8Y F;  4KHP H;  5DQG A;  2CKZ B;  4U6P A;  5FJ8 G;  4B3T H;  2XD4 A;  3JRX A;  1O75 A;  2B63 G;  2VUG A;  2O03 A;  3EYY A;  2QYZ A;  1Y1W A;  2DLN A;  4YB8 B;  1I7L A;  5KG1 A;  3V6K A;  4EBE A;  3G8C A;  5LYJ F;  2ZM6 H;  4O3R A;  4XZ3 B;  1V51 A;  4JI3 H;  1TWH A;  5FD6 A;  3PW0 A;  4BY1 G;  4MV3 A;  4YR2 A;  2C2D A;  2R7L A;  2WE6 A;  3PR4 A;  2RGR A;  2V5A A;  2NVX A;  5IT9 W;  5KFJ A;  3BAB A;  4A2A A;  3OHB A;  1GSH A;  4YP3 A;  2WYO A;  3T5H A;  2M05 A;  4QIW E;  5LMN H;  1CQI B;  4B3R H;  4Y8V B;  1GSA A;  3GTL A;  2CW7 A;  4ED7 A;  5BPF A;  2E5L H;  3R23 A;  5L1J A;  1RJR A;  1CQJ B;  4EFE A;  3JSN A;  2J6S A;  5KG7 A;  4JI7 H;  2VA2 A;  2PVP A;  5C3E G;  4PWQ A;  2BQU A;  1I7N A;  3JRW A;  3WNZ A;  4O3P A;  5KG3 A;  1J5E H;  3N43 B;  3EPG A;  3N41 B;  3CVZ A;  2IMW P;  4DL2 A;  2V4Q A;  1JDB B;  2W6N A;  5KFO A;  1B6S A;  3RB4 A;  2J6U A;  4GLX A;  2YCH A;  4F50 A;  4UCT A;  5KFM A;  3T1H H;  1SYX B;  2C2E A;  2F4V H;  3MR2 A;  4JI8 H;  5KFU A;  1S9F A;  4NXM H;  3UFX B;  2YL2 A;  4LH7 A;  4LFC H;  5KG2 A;  4LMY A;  5DQI A;  1VAJ A;  4HYK A;  3PW5 A;  4WD3 A;  3VPB A;  3KHG A;  4LF9 H;  2GPW A;  3N6X A;  4MA5 A;  3M4I A;  2V58 A;  4J9Q A;  1L2Z A;  5KFT A;  3L2P A;  4IR1 A;  4AQY H;  5KFS A;  3T1Y H;  4A3C G;  4DV0 H;  5FPR A;  1KJJ A;  2I8C A;  3KHL A;  4J9R A;  1T94 A;  2CW8 A;  4ED0 A;  3HOZ G;  4M7E A;  2RDI A;  3BAA A;  5JVL A;  4EFB A;  3TIG A;  1KJI A;  3OSN A;  5H80 A;  3RB6 A;  3H0G G;  2R8I A;  3KAJ A;  2MCT A;  3BA8 A;  1ZQ7 A;  2PN1 A;  1RK6 A;  3T5L A;  4Q0Y A;  5KFF A;  2NU7 B;  3RJ0 A;  1T3N A;  2FLN A;  3I4N G;  5CB4 F;  2ZDQ A;  2C35 B;  4IRC A;  1WR2 A;  2R7Z A;  5KFZ A;  5IP7 G;  3GTM A;  2JA5 G;  5KFE A;  3M9N B;  4IR9 A;  4APM A;  3V6J A;  2RGV A;  2FB9 A;  3HXL A;  1XDN A;  2W8L A;  4UCU A;  1Z2N X;  4A2B A;  3KAK A;  5F9L A;  3MR6 A;  2ATL A;  2CZG A;  3HOU G;  3GTP A;  5KFG A;  1T36 A;  2NU6 B;  4HNT A;  5LL6 b;  4RNN A;  2I80 A;  5C1P A;  5KFC A;  4FS2 A;  3RBE A;  4Q8E A;  1RJQ A;  4IWX A;  4IZO A;  3N8D A;  4C5C A;  3GIJ A;  1ZHS A;  2FK2 A;  3M9O B;  2UU9 H;  4F4Z A;  5IWA H;  1M6V A;  3K3V A;  5JUM A;  4HNU A;  5L1L A;  4MTE A;  4BY7 G;  4J9M A;  3NGD A;  2J6T A;  5DLG A;  4DV3 H;  1W96 A;  4JI0 H;  2ZDG A;  3R5X A;  1BJT A;  2R92 A;  1WSC A;  4B3S H;  1IBK H;  2WB1 A;  5D1O A;  3T5K A;  2W9C A;  3H4D A;  4IRD A;  2R8H A;  2XGP A;  2Y0S E;  2VQE H;  4DL3 A;  3E5N A;  2YRW A;  1IOW A;  4O3N A;  2NU8 B;  1S0M A;  5L1K A;  1AUX A;  4WBN F;  3J7A K;  2R93 A;  1DGS A;  1C3O A;  4MV9 A;  3RIZ A;  1FJG H;  3L4J A;  2W70 A;  3RV4 A;  1JX4 A;  3ORQ A;  5J2T F;  3VPC A;  2NU9 B;  2ASL A;  4MV1 A;  5KT3 A;  3L4K A;  3H4B A;  4DUY H;  4M9U A;  2V59 A;  2DZD A;  4EYH B;  3RB3 A;  3OSP A;  1XMO H;  4ZOL F;  2PMZ E;  4RUC A;  5KFL A;  4J9P A;  1A0I A;  5F9N A;  5KFN A;  2OLS A;  3RAQ A;  2HHH H;  1BGW A;  1KJQ A;  4TV9 F;  3GTJ A;  2JA7 G;  2C22 A;  2FKL A;  2W8K A;  2VA3 A;  3KTM A;  3FKI A;  1GYF A;  2RDJ A;  1E4E B;  3RUP A;  5LP6 F;  3OUU A;  4RZQ A;  2VUM G;  5KFP A;  4O4L F;  3TQT A;  1I3Q A;  5KT4 A;  1Y14 B;  4O3Q A;  2C2R A;  2DIK A;  1S03 G;  1K83 A;  4A3K G;  4X64 H;  1VS0 A;  4QWA A;  1N48 A;  4DV5 H;  3Q1K A;  1HNW H;  1GGO A;  2WDT A;  4LF7 H;  4JV0 A;  4LSX A;  1PK8 A;  5HBR B;  2FLP A;  1GO3 E;  4TUY F;  3TIN A;  3J81 W;  3GTG A;  4MTD A;  4ETS A;  3LP8 A;  2FPI B;  4EGJ A;  3PZP A;  4DL5 A;  5J2U F;  4JI6 H;  3DF7 A;  4HQ6 A;  3BQ2 A;  5I47 A; 
#chains in the Genus database with same CATH homology
 2CW8 A;  4LF4 H;  4JYA H;  4M7E A;  3BAA A;  4DR5 H;  4EFB A;  1IBM H;  3H20 A;  1TA8 A;  3PN1 A;  4NXN H;  3F8N A;  3KAJ A;  2MCT A;  3BA8 A;  4YY3 H;  1IBL H;  1FVI A;  4Q0Y A;  3RJ0 A;  4UCR A;  4R7R A;  4LF5 H;  4IAJ A;  5FLX W;  1I94 H;  1MZB A;  4CC5 A;  1N33 H;  4RAZ A;  5FD5 A;  4J0M A;  4APM A;  4UCO A;  3RF2 A;  2RGV A;  3HXL A;  1XDN A;  4DV7 H;  1M0T A;  3C0F B;  1S68 A;  1Z2N X;  1TAE A;  4UCU A;  1N36 H;  4A2B A;  3KAK A;  4DR6 H;  5D1P A;  2UUB H;  2HVR A;  4K0K H;  2HVS A;  1I6U A;  3RGX A;  1HNZ H;  1Z2P X;  1V9P A;  5BR8 H;  5LL6 b;  4DR1 H;  2UUC H;  4JI1 H;  1X9N A;  2Q2U A;  1ZHS A;  3BA9 A;  4DR2 H;  2UU9 H;  5FPO A;  5IWA H;  4RB3 C;  3IG0 A;  1AN7 A;  3K3V A;  3KXY T;  4MTE A;  3RTX A;  4JI5 H;  3LML A;  4GKK H;  3MWM A;  4YHH H;  2VOB A;  4DV3 H;  1XMQ H;  3N42 B;  3N44 B;  4UFZ A;  4JI0 H;  2VQF H;  1BJT A;  2ZJT A;  4KHP H;  4LSA A;  1L2Z A;  4B3T H;  5A2Q W;  4X65 H;  4JV5 H;  4X62 H;  4MV7 A;  1O75 A;  2VUG A;  2O03 A;  3EYY A;  4BWS C;  3J80 W;  1IBK H;  4EEQ A;  4B3S H;  2VPS A;  5D1O A;  4OX9 H;  2UXC H;  2ZM6 H;  2UXD H;  2VQE H;  4JI3 H;  5FD6 A;  1E4G T;  3J7A K;  1ZHQ A;  1HNX H;  1DGS A;  4MV9 A;  3RIZ A;  1FJG H;  4LFA H;  3L4J A;  4RB0 A;  2WE6 A;  2RGR A;  4LF6 H;  5IT9 W;  3BAB A;  4A2A A;  2OWO A;  4DV6 H;  4B3M H;  2WYO A;  3L4K A;  5LMN H;  1N32 H;  4DUY H;  4B3R H;  4DV2 H;  4RB2 C;  1XNR H;  2CW7 A;  1XMO H;  1E4F T;  2E5L H;  4DR7 H;  2W57 A;  1HNW H;  4I7H A;  1A0I A;  2HHH H;  4UCV A;  5EOY A;  4EFE A;  1BGW A;  3JSN A;  4LFB H;  3RGZ A;  4CC6 A;  4DUZ H;  1FKA H;  4JI7 H;  4PDB A;  4DR4 H;  1Z2O X;  1GYF A;  1J5E H;  1B04 A;  3N43 B;  4GKJ H;  4RZQ A;  1WH2 A;  3CVZ A;  2XIG A;  3N41 B;  5LMU H;  4DR3 H;  4JI2 H;  3FMA A;  1XNQ H;  2UUA H;  2Q2T A;  4GLX A;  2YCH A;  1S03 G;  2FE3 A;  4UCT A;  2HVQ A;  4DV1 H;  1M0W A;  1SYX B;  3KAL A;  3T1H H;  1N34 H;  4NXM H;  2F4V H;  2UXB H;  4X64 H;  4JI8 H;  1VS0 A;  4RAY A;  4DV4 H;  3JAM W;  4LH6 A;  4LH7 A;  2WDT A;  4DV5 H;  1HR0 H;  4LF7 H;  4LMY A;  3JSL A;  3N40 P;  4LSX A;  4LF9 H;  4LFC H;  3J81 W;  4UCS A;  4MTD A;  3N6X A;  4ETS A;  3UQ8 A;  4RB1 A;  4FM9 A;  3OTO H;  3M4I A;  4LF8 H;  2KSW A;  1P8L A;  4X66 H;  1SEI A;  3L2P A;  4JI4 H;  4AQY H;  5D1O B;  3T1Y H;  3DF7 A;  4DV0 H;  4JI6 H;  5FPR A;  2HGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...