3N44B

Crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; osmium soak) of chikungunya virus.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
338
structure length
337
Chain Sequence
DNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
total genus 65
structure length 337
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n44B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n44B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n44B02
3MUUA 3N40P 3N44B 3N41B 3N42B 3N43B
chains in the Genus database with same CATH superfamily
1XGZA 1MCQA 2PPCA 3OWEA 2V5AA 1DLHB 4GKSB 3SDYH 3INUL 4TVPH 4Y9BA 3P77A 5DYFA 1JGVH 1WFUA 2WB1E 4Y4FD 5B7MA 1X7TA 3FO2A 3HNTH 4GI6A 4QY8B 1IOVA 2A4CA 2KZKA 4NO2A 3V0GA 1A4AA 1RZFH 5CEZD 3CFEA 5KZCD 4GI8A 4HAGA 4FMKA 5KANG 1MH5A 2EH7H 3PW7A 5EO9B 2HT2C 1KCUH 2GFBB 1ZHLB 3KPTA 2EDRA 3L3DA 1PGRB 2VW7A 3PIQB 1BFOA 2BOLA 3ULUF 1NPUA 5CCJA 3QJUB 2OCJA 4P06A 3AUWB 4WW2C 3MRCB 4WSKA 1A4KB 2VRKA 2NYYD 4L4TE 2VQEH 1F2XK 3IDNA 2H2SD 2O5ZH 3P0YL 5DJCA 1U95A 3L95A 1B2WH 4BA0A 2EVHA 1VEOA 3VWKB 4OSUL 1YMHB 2WBJC 4PVNA 4YOKA 4ERSL 1BNCA 1KNOA 1CF8H 3B9DA 4KXCA 1VBHA 1XB3A 2R87A 4YBZB 2YFNA 4XAKE 1OSZA 5EU5B 4ETQA 2YS6A 4JREC 4TUOB 1DL7L 2NZ1A 1OSPL 2XWRA 4IYKA 4ZS7L 1HXKA 1U6AL 3EDKA 4H0LC 4ZTOH 4NZUL 5FHAL 3NTCH 3W2DL 3ULVE 4JI5H 1SJXA 4XNUL 4RIRB 1UH2A 4K7PL 5KBMA 4MYWB 4GO9A 1UKSA 4KPHH 1MREH 2AQPA 2ZSWB 5F72S 3SY0A 1UACL 1BM7A 1G7PB 5K9KA 4P4KC 4KTDH 4N6QA 2G3XA 1SHXA 2BX5A 3VQMA 1JV2A 2YRWA 1MUJA 4NAMA 5KS9F 3RWJB 4YPJA 2GJJA 2W0LA 4NM8L 5DT1H 1NCIA 2RACA 3HI1B 2FK1A 3ZKMD 1LDPL 4H88H 1I7UA 4KY2A 1DSFL 1HHIB 4RA3A 5AUMB 4BBWA 2XPYA 1J8HD 1Z9OA 3SE9L 3FB5B 3B2UD 3ZGIA 1EDHA 4ZTPL 1U9KA 2C7UB 4N6RB 3FB6A 2IAMA 2R15A 2AEQL 4E9SA 4F93B 3PWPE 1X9QA 3MFFB 1CFQB 4QRRD 1N56A 1IARB 1OTTC 2UX6A 2CHXA 5C0BD 2QSQA 2VQTA 4ZW3A 2LVCA 1XF3A 4A2FA 3T2OA 5K1JA 3GIVB 5SX4H 1E6JL 3JSNA 1CL7L 1EFXD 2X9XA 4LL9A 4S2SB 1ETZB 4D0DA 2UVEA 1V51A 3GGWB 4MV6A 3WEBA 2CHZA 4ZZFA 1T0NA 2CLRA 1QO3B 3AM8C 3IKKA 1ZK9A 2IBZY 1THCA 4ZPVB 3T8XB 3OHBA 3EF4A 2WXRA 4HAFA 3S4SA 1F00I 1F4HA 4XP4L 5IW1A 3GBEA 3W11D 3QK0A 1J0YA 1NDGB 2H3KA 2WB7A 2Y9RT 4PJDA 4V2BA 3UTSA 4ZFZB 1TMCB 2Y5EA 3AQXA 3GMOB 4OCYH 1MHEA 5E5LA 4JRYD 5C0AE 5IZ7A 3SDAA 4YC2B 4F7CB 4OLUL 3BSGA 3HS0A 2VUYA 3AMLA 2Z34A 3DHMA 1DQQA 3FTGA 4PJGA 4WY7L 5D7LD 4AUYA 5C0JB 5ERWB 2OJZH 3RHWF 3CBRA 3C2SA 3GS0A 3KPMB 1Q1JL 4F7EA 4ODTH 4KDTC 4U6XB 5I26A 3T4YB 1MZBA 2GQHA 3QUZB 4TNWK 1KJMB 2EIBA 2DI8A 4Z8FH 2NTSP 4JMXA 4OUUB 4NZ8A 2YU9A 4YSOA 3PABA 4YEFA 4P2CG 2R51A 4EZKA 4D7PA 4PTTB 3B5TA 1NIFA 2IFFL 3V5KA 5TF1H 4YHHH 3BIAX 2VZUA 4WWNA 1GLVA 2IQ9L 2X3AA 3D1MC 4RVBA 2XBZA 3MXWH 4CVWA 2N0MA 5EU4A 1XGTA 3O4LB 1FNGB 4HF5L 3VQLA 2VDPH 1HFUA 1U3HA 1FV1A 4XWGH 2WWKO 3H4DA 1L2ZA 4OY9A 4X5XA 4Z78A 3T1HH 1UA6H 5DZOA 4JI2H 3O6LL 3CZJA 2RDIA 4P5TB 4N0UA 5DLLA 4CNIA 2ENJA 5EEXA 3PAUA 5E24E 2VDMH 2H6PB 4G8GE 1A65A 1DN0A 2V7HA 2R39A 2XJLA 3UG4A 2XPGA 3FQWB 1JNLH 5H4YA 2ADIA 3RPIB 5GZOD 4LVHB 4J9LA 1E5AA 1ZETA 3KVPA 5I1KH 3OZLA 4KGLA 3HE7C 1BAFH 3HG0A 3OPZL 4ED2A 4NXSA 3CN3A 1B9ZA 3P4LA 1JYWA 4OQTH 2CCLA 4X9BA 5GISL 2BFVL 5IK3B 3S8GB 4TQIA 2JA8G 4WWOA 4FQCL 4IJ3B 4GMSH 1S7RB 4MXVE 4HOXA 3FAXA 4FYRA 4QXTB 2BSSB 3N2JA 4WGWB 5GRZA 3C6SA 1RPUA 2YSSA 4N2AA 2EDEA 1OVZA 2WUBH 4N8CL 1RERA 4X6CA 4DEPB 5KUKA 1KV7A 1SCUB 2NSXA 1YHPA 4F2ME 2J73A 1C12A 1FGVL 3GTTA 5FCUL 4G80A 1EMTH 4MTDA 5FYLH 5IFAH 4A6YB 3GM8A 3SCMD 4HWZB 3WO1A 5FPRA 2FLNA 2RF4A 4JMNA 4XRCA 4Y16B 1LEGB 3D09A 4N9GB 3QDJA 2GI0A 2IAND 2L7JA 4O3QA 3S9DB 3LKNB 3QNXB 4HIJB 4R96A 3SOTA 4NRYB 4A3EG 5EUKB 1O7DE 4PRIB 1GSOA 1MSPA 2FL5B 2DL9A 3WMPA 2A77H 2IJ0C 4Y19D 3PW5A 3B34A 1QATA 1MI5A 4PB0L 2G2RA 2H2PC 3UPRB 4Z7VB 2DLNA 2AANA 2C1PB 2XIIA 1A64A 2PXYA 4EXPX 2J21A 2VL5B 4EBDA 2HRPH 1ITBB 1JNNL 2B1AL 4EDWL 3JVGC 2YZNA 3RIZA 1OZTG 3LZQA 5CILL 2WIIB 3I6KB 2YRLA 4F7TA 3IE4A 4EXKA 2CO6A 1RJZB 3QP3A 2PABA 3O81A 4PJ9B 1UM5L 1PS3A 4TUKL 2X6CA 4HJSA 2NQDA 4JJ5A 3HUJB 3BJYA 4RETB 1UCBH 1NWPA 2EDYA 5BZXA 2JE8A 1VGEH 4NI3A 3MLSH 3BUTA 3P11L 2VABA 4XBGA 4C55A 4QXGH 3ES6A 4BWWA 2AXFB 3IDIA 3ILEA 4WJ5A 3UBXG 3EYVB 1JGDA 1XZWA 2HWZH 1YUHA 4LP4A 1KC7A 1J5OL 3RFCA 3CIAA 5FDYA 32C2B 1SY6A 3V0AC 2BNRB 4Q9CA 1I7NA 2NY0B 3RKDD 4AV0A 3S35L 2AAAA 4RAUA 3VXUD 1JDDA 2Q8AH 5D7LA 3WMQA 4UV4L 3WJLC 1TNNA 2Q3AA 4POZD 3PR4A 3CZSA 3GKWH 5CLYA 4PR5A 2YD0A 2DYPB 5F93C 1XGYL 3L3GB 4ZFGL 1M6UA 4IWYA 1SM3H 5TPWL 3T77B 3NZSA 3UPCA 4GQRA 4LEBA 4XNAA 1NSNH 3FPXA 2FH6A 1EEUA 3WFDH 1YRKA 3WFZA 4C83A 5BMFH 5ESAA 1JF5A 4ECQA 1CN4A 4XCFH 5FO9A 5DG7A 5IEHA 3NCJL 4ECUA 1E5BA 2QQKL 1NLDH 1ROCA 1P1VA 4YZFE 1A9BB 3I6GB 3IDYB 1MCDA 4QF1B 4G71B 5ENWB 2GSMB 5C8YF 4AW4A 1M53A 2O4EA 3GUTA 3NSXA 2IDSA 2Y3AA 1FYTE 3QCTH 1YZZA 1CFNA 2VXSH 4L8DA 3JAMW 3P4NB 3GPSA 4K55A 2EDMA 3FFCE 4KQ3L 4N2BA 3RNKB 4AYMC 2C2DA 3S36L 2OQJB 4GAAA 5A2JH 2Q7YA 3PV7A 4HDIB 2ZCLL 1F3JB 5GS0D 1UXWA 4AYGA 3M9OB 1WG3A 2OCFD 1CXEA 1H5BA 4X7SH 5FA4B 5KFPA 1OF2A 4F4YA 4XMLH 3HZ3A 3V0IA 5CGBA 3ECUA 3QWQB 1ZT1B 3KLHC 3QDME 1HQRB 2ZXBA 3PE9A 3QUZC 1AGDB 4F5CA 1BQRA 4ED1A 3ZIYA 4MD0A 4AQ1C 1FFRA 3ESOA 3WV0A 1P9MA 4YJ3F 5KG9B 4A2MA 2CLZB 2IA6A 2WXPA 4KI5C 4J3OC 3EJYC 5DEGA 4DQOH 8CGTA 1KY7A 4ZZKA 2D7NA 2DQMA 1RI8A 2NY2C 3B9KC 4JO2L 5BZDB 3SCMA 3HXLA 1Z5YD 3ZY7A 1P1ZA 3SDYL 4AQ8A 4R0LA 3IMWA 2VJXA 5D7IF 1LD9B 4ZMYA 3TT1H 5ITFA 5AKVA 1JGVL 4LSVH 1S03G 2DQ6A 3D18B 3HNTL 2BXYA 4HUXA 4JI3H 4ELDA 1IM9B 4MZ3A 2NCMA 3QUYD 3OG4B 3TEZA 1RZFL 4AY0A 2W57A 5T3XE 2R8SH 4FLRA 5FYLE 3ZYOA 4Y19A 3NUKA 2EH7L 1NIDA 3SHSA 1KC5H 5LQBH 4WNJA 3FSZA 1KFGA 2RHEA 2FJGA 3KVQA 5FUCC 3EBAA 3IFNH 1MJ7H 2ZJSH 5FGSA 2O5ZL 5J13B 3I4NG 3HE6C 1HKFA 5HYJA 2FNBA 2ZOLA 4G9FD 4F8OA 3E3QC 1SYSB 3RZCC 2LABA 3CLWA 1T7ZA 4ME6A 1FRGL 5JUEL 3WKMH 1FAIH 2MHAB 2AGPA 2IGTA 2HPOA 1RZKH 2V9QA 3BQ1A 4OX9H 2UZPA 3O3BA 3NH7H 6FABL 2NY1D 2X89D 3NTCL 4TN9A 3ZDZE 1HVXA 1PAZA 2EYSB 3FN0H 5C0FB 1A1NA 2BP3A 1K5NB 2OMVB 3QJRB 1ORSB 3GSXA 4LSRH 5CWSA 2MRYA 2NW3A 2WK2A 4XVUC 2QFRA 1MREL 3BFQG 4AG4L 4HV8B 4Y4KB 3UG5A 2APVA 4WEBH 2DV6A 4AGMA 5CZVH 4X6CF 4GLXA 2YMOA 4CN4A 4B60A 4U1KA 3V4VA 1CXFA 3REWA 3UZQB 2C2EA 1UZ8A 1OAQL 1I9EA 1RYSA 4FLSA 3LEYL 4O2CB 5DT1L 2KQMA 2NXYC 3DGCR 1L9NA 3AAZB 3QDHA 2YKLH 3C5SB 4G6AD 2BWDA 1QKZH 5D1ZA 4POYA 2YIHA 2BXZA 3RHWK 2XQBL 3D5OF 3SGKC 4OI8A 3B7YA 4PJ7B 3U2SA 5TE6H 2WWKT 2JTDA 1NFDE 1OO2A 1MFUA 3QQ3A 4U0RB 4ZS6D 1ZSDA 3UTPD 1OPGH 1T6VN 2VLRD 4FC3E 4IRSB 4NI6A 4XTRC 5D4QA 5LCVA 5H35A 4U6VL 1CFSA 5ESVB 4HPOH 4IBSA 5E4OA 2AKRB 2XV6B 4IQHA 2VDKH 2YPLD 3HC3H 4FQPA 2YRZA 1BFTA 4N0YH 1RLWA 3QZPA 5EC2B 3IT8D 3W9DB 2Z9TA 1FZKB 3GXFA 5A1AA 2AXJA 2J6EH 1NGZA 1DDTA 1JPFA 4GC6A 5JORB 1WISA 4Z7WF 1NC4D 3PWJB 3SGDI 1I3RB 1K8DA 2GBTA 3QIBD 2XZCH 2JA7A 3CZGA 3LQAC 4QHMA 5E4AA 1MCWW 2IDFA 3CXHK 3TZVC 5B1KA 3V4PH 4X99A 1T0PB 1LE9A 4OCYL 5DI8A 1JK9A 1EVUA 4QIWE 5FOBB 2Q86B 2WM0A 1H6TA 5IWAH 1GW0A 3ESPA 3O0LA 1E9OB 3MVSA 3ZLQC 2BOCB 4MQ7B 4Y5VA 3MREA 2JI1A 5E2WH 3V6JA 3VXSD 4PJAE 1Q1PA 4KUCD 4ODTL 5FUOH 1W8EA 2XV3A 4Z8FL 2A1WH 2CMRH 1YEDA 3EFDH 4HJGB 4JJHA 5D6DA 3NBNA 3VE0B 1LO5A 1ZIAA 4FFZA 3NVQA 3QO0B 3BLPX 3E2HC 5TF1L 3OUZA 1IJ9A 3G6VA 3BAXA 3FDSA 1HEZB 1A47A 2UXBH 4K3DL 1KCLA 2VDPL 3QUYA 4NPJA 4YDNA 4XWGL 5KG0A 1TTUA 1PY4A 3G6JB 4H0HB 3PDDA 4L0YA 3NSJA 2J8UB 4U6YB 4NWUH 4R97B 1YY8A 3VXMB 1B0RA 4BK4A 5L0QB 3R4RA 3SYQA 5D1OA 1UM4H 2VDML 2CO7B 4BQ8A 5J0BA 2VQDA 3QWRA 4JB9H 4QRTB 1JNLL 2H8PB 3IRZA 4KK9D 4PRPB 1BEXA 5DC0A 4YWGL 3M1CA 5I1KL 2FHFA 4M4RA 2YLKA 3D06A 1ND0A 3DJ9A 3UG3A 1QSZA 1T80A 4HKZB 4KNQA 3RJQB 2FR4A 3D2TA 2ASLA 5DZJA 3GIKA 4OQTL 2ERJB 5HGGS 3DTXB 2YUZA 5T1JA 5CBAB 2XN9E 5FYKH 1SJVA 4FG4A 3BGMB 4PJFB 1JD9A 4WO4B 5SWQB 1IC0A 5ICZB 1CXLA 4XGZB 3P4MA 1OAZH 4P2YA 2YAMA 1TQVA 2JKIS 3KPSD 4N2DA 4HFWA 2SEBA 2X89A 3AT9A 3MRKA 3B56A 5AAMA 2BNUA 2PWHA 2XIBA 4DK3A 4QWAA 1FE8H 1X4YA 5KYUB 5EU6A 1N5YH 5IJCC 1I8KA 1J86A 1OANA 2EDKA 3D34A 3GLDA 3OXSA 1KLFA 3VDBA 1J5HA 4C54A 1EMTL 2J3SA 5CSBA 5FYLL 2WZPA 4ZUVB 5IFAL 4XNQB 4LLYB 4CJ1A 4YBQC 4GIPD 5B38G 4NUQA 1DVSA 5ETUB 1FFNB 1GS6X 3OMZA 4J9KA 2HVKA 3GSNA 3BSZH 3GJFA 4G5ZL 1YEIH 3NRFA 1BX2B 1QTPA 3OBAA 4GKLA 3T9WA 3LDBC 2DDQH 3LKQA 1FJ1A 1E4EB 2A77L 2DW5A 3KPQA 4YIQB 4JV5H 1U2YA 1S0NA 4R2GC 2W59A 1USZA 4P5KA 1HZLA 2CZNA 5F7WC 4RSYA 4OZGE 1ZV5A 3WNIA 4AJYV 4JG0L 3E6FA 4MCMA 5K9QG 2HRPL 1OAYH 5GPRA 1NMAH 4OFIA 4ED6A 1BVLA 2YPLA 1AQKL 3KYAA 3MGOB 4GEIA 4U1LB 3BW9A 5C0GA 1JPEA 1DGSA 1MCPL 1B90A 2DWEA 4LXFA 3G3LA 1KIUA 3ZDXB 1NA8A 3BAKA 4OM1H 1EUTA 5DJXA 2B14A 2FEEL 4DV0H 1J1OL 4Y4KC 2OLDA 2MPAL 5HYQB 2X0SA 3L1FA 3P0GB 2WTRB 4BJLA 3QIBA 3PWUB 2ZP8A 3TVMB 5IG7A 2ICEB 1WK0A 4QXGL 5KSAC 5BRZA 4M8RA 4ANXA 4C57C 3PWVB 2DMBA 4X83A 2YAQA 4P2RD 4WFHE 4DL2A 4OIIH 3KW8A 4B3EA 3R06A 4PJ6A 1R5IB 1T83C 5ISZD 4P49A 5A16A 2WLKA 4IR9A 1Z2NX 3GFUA 5KVDE 5CP7B 1FNEB 3QHZH 3KHLA 2QDVA 5HHNA 4N87A 3FCSA 3OGOE 4EVNB 1BZ8A 3N04A 2XTJD 1WT5C 5FYKU 2Q8AL 5DJYA 5IW6A 5L88H 3WNJA 4HFUH 4Q8FA 3WKPA 4RQQB 5IVXB 4MV1A 5FM5M 4JFEE 4FNRA 1MCCA 3A6BH 4JY5H 5E9AA 1SM3L 5DO8A 3VXSA 1I7LA 4KHPH 4JY6B 3JTTA 1IT9H 4BBRG 4XC1H 3Q1EA 3UIZA 1JZHA 3WS6A 4HOMA 5KFVA 5DR5H 2X2HA 3L3JB 3CV5A 4UMGA 1SOQA 4L9DA 3T4AC 1W80A 4C56B 5AVYB 2P47B 1P4LA 4O5LH 2ZCKL 1KIPA 3UAEA 1NLDL 3FQ4A 1RVFH 1U8QA 2I07B 3E8UL 3H9HA 5D1ZI 5T1MB 3L08A 2FX8L 5LBVA 1E3FA 2GI7A 3CNKA 4WZ9A 5C2UB 2GUOA 4AVHA 3IDJA 3SDDD 3QCTL 1LMKA 3JWDC 4FQLH 4LGRB 4EI5A 4APQB 1A3ZA 2P8MA 4MZIA 3KVDD 4B96A 1IGIH 1R9TA 3DO7B 1JIBA 1X5MA 1CGYA 2ZUXA 5EIIB 4JRLA 3ZTJH 1GGBL 3U1SH 1N5AA 3HBGA 1AXSB 2H1XA 1LJMA 4OCWL 4MD5B 4X7SL 2ADJB 4R4ND 1YDPA 4XAWH 2DPJA 4KHTL 4EUPG 4MVBC 4XMLL 1WD9A 2D3LA 4N85A 4BDVB 1W0VB 5I2IA 3Q8QB 5D71H 2Q7NA 2V6HA 5F2FA 5A2BA 5EA0H 2HRHA 4EZJA 4BXSV 3L3KB 3TTYA 2XCMC 3CK0H 2OJEA 4IHOA 1RPQA 4GUCA 3RWCA 1YYMH 5C70A 4CC6A 5FYKE 4BRJA 5EEWA 5DC4B 5A2FA 4AV4A 3VG9B 4CSZA 3Q8EA 1CD1A 5JR1H 3ZN6A 1JVKA 5I66B 2QPFA 5ABAA 3QUMA 3RPBA 3UEQA 4DQOL 4J6RH 3ETTA 2OULB 2CRYA 4UQ2A 1Q0YH 4HSQA 4FG6C 3FMGH 3PUCA 2XXMB 4Y5XC 2B3IA 4LB8A 2SCUB 3MBEB 5L0QC 1MWAB 3II3A 4MDIB 4NQCD 2E9IA 3TT1L 2J5LC 3S98A 3F7YB 1XTMA 5FM4A 2FP4B 2CWRA 4WLCA 5DRWB 1M57B 1QUNB 3CSBA 4CC5A 3FOMA 5EWIL 2C3VB 1KC5L 5LQBL 3UPAA 2CDEA 3G5WA 3UAFA 15C8H 3F8UB 5TDPB 3TEUA 1O9VA 5LHDA 2V4RA 4Z7QF 5GXBB 2D0HA 2PETA 3BQUC 4R7RA 3P3YA 1NCCH 3L1OH 5D2NA 4M1CD 6PCYA 1GSAA 2P49B 2XCAA 4CVXA 3LB6D 2ZE0A 3HG1E 1DVYA 1FAIL 1IILE 2R8GA 5KFIA 3A4EA 1CFTA 1RZKL 3PVXA 3HBPA 5DA0B 3T3MF 2DQTL 3NH7L 1P5UA 1S9VB 2YARA 3MV8D 4XI5D 5LAXA 1V3KA 3FN0L 2AJYH 5I8KH 2JA6G 2Y6TE 5T5FA 1KJ3H 4RMVA 4LHJB 3AADB 3JTSA 4ECYA 3GK8H 1JF1B 4H25A 4EDXA 5CZVL 1G6RH 3PNRB 4TSAH 3NCMA 3HOGA 1IAOB 2BP0A 4JO8A 2GT9B 2PCPB 2VDPB 3H6JA 5CIPA 4B0MM 5A7BA 1MF2H 2RQ8A 3AABA 3EBIA 1UWYA 1QLRA 2XKUA 2YKLL 1F8TL 2YMXH 4G43A 1QKZL 4XVJH 3WL9B 5J57B 2C5DC 2VDMB 1HESA 2X4QB 3C9NB 1RK0B 2Z8WC 3VD3A 5FF6B 2AJSH 3HIZA 1OPGL 1S7VA 4ODXA 2DEXX 2GTWA 1T7YA 4BZ2A 4NP4H 2HRLA 3S97C 4ZSOA 4W1TA 4E9XA 1G9EA 4LHUB 3P9MA 1NBYB 2HFTA 3AB0C 1DBKL 4QRFA 1MJUH 2W95A 2YAFA 2VDKL 3BO8A 3HC3L 4UNIA 3KLAB 3TVMC 4RFNB 4G8IA 4OFQA 3WE6B 2BJMH 2V8MA 1Z9LA 2DWCA 1JZIA 1EZVX 4WCYH 1EUUA 1N4XL 2J6EL 1L9TA 2B77A 2HUHA 3LRGA 4HKXB 1NMCC 1MN4A 4QJFA 2WCPA 2AK1L 5CR8A 1KG0B 1JK8B 1G7HA 1SXZA 3T2PA 3RYMA 4JGMA 2XZCL 5K9OB 4NEHB 1OWTA 3HAEH 2R23A 4HH9A 3V4PL 2I87A 3OD3A 2X4PB 4Z3TA 1FVCB 4OF8A 3T0VA 4DZ8A 5JQHC 4XMUA 2WLLA 2Z8VC 2HVJA 3B2XA 1BD2D 1T1ZA 3GD1C 4AQAA 4NFDA 1RUKH 3W0WD 3GIMA 1S9WA 2YAOA 4YHOH 3QQ4B 5C0CB 1IZJA 3V7MA 3EO1A 5H2BB 3ARED 4PLJD 5EBGA 5C3TA 5FO8B 3ZKSD 1FORH 2ZUYA 4UZUA 4JHAH 2VSDA 1GCYA 1KWKA 3RFRA 2BIIA 5DS2A 4DFIA 1XF2B 3PJLA 4NUMA 5AOZA 2R7ZA 2A1WL 1A3RH 2CMRL 2XY1A 4Y5YA 1HYSC 2X1OA 3BQVA 3N0PB 3ZT6A 3VFWA 3UX9B 2BZDA 1OGAB 2VH5H 4NQCA 4H13C 1MAMH 4KUCF 4ELME 4XPBH 5DD6A 3TO2B 5SWSD 3VXRA 4APQC 2X4UA 2R85A 1D9KA 1KYOJ 4M1GH 4MCZB 1XIWD 4R83A 4KDWA 4M62H 1KYFA 4DL6A 1B4LA 2WHVA 3GRBA 4O2FA 5IYZF 1HHGA 1ORQB 2DQUL 1XBDA 5LGKA 2FK3A 2EXYD 3LQAH 4JB9L 1QFWI 4JHVA 3IGFA 1XH0A 4GG6E 1KN4H 1KGCD 1RZPA 3QZ7A 1CGSL 1QFPA 2WINA 35C8L 4J4PC 2ZX7A 2NY6C 3O2VH 1E7UA 1XO8A 1HCYA 1L9PA 2ATLA 4UM9D 3NA4A 3L6FB 2R27A 5FYKL 3V6OA 5INCB 5T33L 1UURA 3L48A 3VG9C 5EEUA 4KKCD 3MJ6A 4WHTB 1DQJA 5AVUB 4PJ5B 1JGLL 2YWZA 3JRXA 4YS4A 5I6KA 3UJJL 3ECBB 1EH9A 3D2UB 5F6IC 3ROOB 5IMKA 1O0VA 4AENA 5I9QC 3SBRA 1A3QA 1YO4A 3MRGB 3PQYB 3PWNB 2NZIA 2J7LA 1AFVH 4MAUH 4D8PA 1FE8L 5JIDA 4NKIH 4KI5E 1EV2E 2ZOKB 4EEQA 2L7UA 3TIEA 1CGXA 4PWJA 1PKQE 2L7EA 3D87B 5HHMD 5E5MB 1ONQB 2EE2A 3BUBA 1PJ9A 2W0PA 4P3DB 2IPTH 1EZVY 5E9DB 5L2KE 2NU7B 4L8SB 1SQMA 2O5XH 3O3AA 5GJTH 5KVGH 3WDIA 4HALA 3O0RH 5E8OB 2ZWSA 4L8BB 1JGEB 4F4XA 1FVIA 2OX5B 2WW8A 3TBYB 3MYZA 4W9ZA 2V2WA 1R46A 4YHIA 1KJ9A 3FBQA 4OGZA 1P4BH 2WXGA 4DJMA 4JRWA 1YN6B 5GGTH 1FWXA 2BC4A 4PJCE 3TXAA 1EZLA 3ARWA 3B5GA 1OAYL 3K81A 5FUCE 4D94A 5I16B 2FSDA 5CEYB 5AOJA 2ICCA 4OGAD 1ZOXA 4NO3B 1OCZB 1TJGL 2DLEA 4ZFOL 1MW0A 1JWMA 1E3ZA 1V3JA 3E3QE 5KT6A 1CLCA 4HZAA 3CU1A 4OM1L 2B1HH 1CTNA 3RX8A 3NSDA 5HHOD 1A02N 1HYSD 2GPWA 4JFOB 5M95B 4LCUB 2X05A 5L2JA 3H3VH 4L9LA 4RH4A 1JWUA 3NFNA 5FYJE 2AEPL 3GXDA 3O3EB 3ZO9A 4TS6A 1YC8A 4G3YL 4O4LF 4U7SA 4QW8A 1ZLUH 4EI0A 4LFAH 4OIIL 2ZKXA 3NIGB 5KANI 4OCSH 3HZKB 4UDTB 3SDAC 2Y7LA 4OAWA 1QQDB 3B7UX 1IE5A 4ZQTA 1MRDH 3W0WA 5DDHA 3UCQA 3RVTC 1RKRA 4FLHA 1WC7A 5L88L 2GJZB 3LPWA 2VB5A 5T14A 3H6AA 4HFUL 1DANT 2IOIA 4RWYH 4BSWB 3QFJE 4ZT1A 3P3UA 3EOBA 4JY5L 3A6BL 4NLAA 5TGBB 4EQ3A 3N41B 1IT9L 2E6PA 2IDQA 4XC1L 4U1NA 1PZAA 2GVYA 4HJJL 3QNZB 1QFOA 4XODA 3U4EA 4OIFA 5HPOA 5KKNB 5IOPA 5DR5L 1P6AB 3B2PA 4F9PC 4GP8B 5KN5B 3GIQA 1HH9B 3WO4C 1B4TA 3QISA 5AAPA 5F7MC 4RFNC 4O5LL 4ZI8A 1UFGA 4G1EB 3DRTA 1EX0A 4HJTA 3LEXA 3WD5L 4UILL 3OLGA 4L4JA 4HG4K 3E5NA 1TTRA 4JKKA 3D3VD 3RWIA 1Z7JA 3I9GH 3OC8A 5HDQH 4G6FB 1X5IA 1WUZA 5JPMA 3KHGA 1RZ8B 3FT4B 4FQLL 4N2MA 4FHJA 2XZQL 1JXJA 2R56H 3M7FB 1IGIL 1ZIBA 2HMID 1OCCB 4IDLA 1U58B 1WBZB 3ARTA 1IGJA 2G0LA 5CO1A 5DHYB 5EUOB 2PYED 3LAFA 3U1SL 2UZYB 2QQQA 4UM9A 1V5JA 1GYCA 2XWTB 4XAWL 4RGMB 3LRKA 4N0CD 2K4WA 4AE1A 1A0QH 1S10A 3MRBA 4KDVA 2LU7A 1D7BA 2WP3O 3OKNA 5D71L 3UZVB 3WEAA 2XVBA 3AQZA 5EA0L 5AG9A 4HXAH 3TO4D 4HWBA 4H26B 3CK0L 1I8LA 1SJHA 4OGQC 3VFUA 1YYML 2F61A 3ZDWA 1OALA 2DL2A 3OX8B 5I5IA 3L3OB 3SDXA 2F4VH 1NEZA 3ZUNC 5JR1L 3CVCA 4G6KH 4U3SB 3VJ6B 4J6RL 1HNZH 3U1PA 4Q8EA 5KYXB 5B1JA 4NBZB 1INEH 1HAUA 1Q0YL 1XCTB 3MNDA 2AK4E 5CSZB 5E6ID 4P8QA 3U30B 4ECNA 3ORJA 3D0VA 5L1KA 2PN5A 3TBVB 2V2TA 2XKNB 3NJKA 3BPLB 1DFBH 4ZTEA 4FMFA 3VI3F 3D39A 3U2IA 2DQJL 1NC2D 4G9DA 3DPBA 4A3FG 1T66C 2JVUA 4MQXD 5JXEA 4Y7MA 1BA9A 2Y1YA 5HD8C 2Y36H 1OTUC 2HH0H 3C2AL 3H9SB 6TAAA 5DQDH 1AR2A 2PXYC 2XWXA 1WZKA 4AUJA 3DVGA 3VI4A 3QORD 4UTAH 3GTQA 4N5EC 4CW1A 15C8L 4MA3A 3LQZA 4BCZA 5D70H 4XN1A 4DN3L 3TN0B 4AIOA 5C3EG 4PJEF 1KXTA 3GJFK 4ILDA 1NM4A 4NRZA 2A74C 2YD5A 3DJSA 1AHKA 3L1OL 4R90H 4J9QA 3Q2WA 3E6HA 1ZEAH 4V1DD 4YSUA 4RNRB 4RRPM 2NSQA 3ZZSA 5HVHB 3OSNA 4X0KA 4MJIA 5B1CA 1MQKH 5I17B 4QRUB 4XN7A 4JG5A 4B41A 1XHHA 1JIHA 4LSTH 3DROA 3OL2A 4OLZL 5GRVK 3DLQR 1EO5A 5KAQF 1HXMA 1UJ3B 2LU4A 5MENE 1MFDH 2AJYL 2Q2LA 3FRUA 2FQGA 2K9FB 2QPUA 3KR3H 2W1NA 3OKKB 2J71A 1H0DA 1QACA 2ATKA 5B7FA 1KJ3L 4AI7A 4BK8A 3ABLB 3TCLA 2IAAC 4ICXA 5LGJA 5TK2A 1G6RL 4TSAL 3IGLA 3OKLB 4I48B 2NY4D 3NCWA 1RUMH 3AGWA 5D4HA 1UWXK 2VDRH 1HH6B 5EO1A 4IS6A 4PJXE 1A9VA 4HUWA 4RAZA 1BVNT 4MS6A 4LARH 4DEWA 3ARDA 4YH6A 3EYQC 1P5VA 3FYEB 3ZIMA 3M17B 1CVSC 1R5WB 4PS4H 2ZX5A 1MLBB 5DGRA 4MAYD 5C08B 3PGCA 3KCWA 1G7MB 2Q3XA 4YGVB 3FONA 1PZCA 3KS0J 5DJ0A 4XMVA 5AW3B 1CDUA 3U9UB 3VM7A 4NQSB 5F21B 5ESQA 3MV7D 4K3JH 4G7QB 4KUZH 2R1WB 1DLFL 1ACZA 1AY1H 3D3VA 4OFKA 1MJUL 3L1EA 4H5SA 4GW4B 4K8RH 3RTQB 1M6OA 2CH8A 1R3IH 5FYJL 4BKLB 3VWJC 1TTAA 3CHXA 2IWFA 3CSTA 4OD2A 1AHWB 4OI9A 4Q9BA 3T3PB 4PJHA 4CMMB 4GP5B 2ZUSA 3F3HA 1XF4A 2CO2A 1D5ZA 4PPTA 3KPRD 1MNNA 3MV9B 2CKBA 4DZBB 4E41E 1BQHA 1AGFB 1M2VB 2X4OA 1IBGH 3FQXB 4X4ZA 4A2BA 3W3BA 3X3FH 3ILDA 1TZHB 4WI5A 1O6VA 4X6DA 2YGVA 3IG0A 4EN3A 2W0KA 4ENZA 4MHHG 4OVUA 1W6WA 3T6QC 3H3BC 3IDXL 3TT3H 5I0XA 5LN4A 1Q9OA 4ZX6A 4IEFB 5TFSL 4YHKH 3OHAA 1CDIA 3TO4A 1O75A 5EEVA 4RFEB 4PYHA 3PR5B 1KBVA 1SFDA 2FWLB 1P9MC 1ZJBA 4PJ7E 4YHOL 2IALA 3FQTB 3IF1B 2FRGP 1T1XB 1CK0H 1YPZA 2UX7A 2LHAA 4HUVA 4YN3A 1D5MB 1H3VA 3LRSA 3VG0H 1DZ0A 5DHXB 4HWEH 3B8YA 4JHAL 1KCRH 4OZIA 4K9EH 1C3OA 1S7UB 2BRQA 2UWEA 1YEWA 3S37H 5KFKA 2CXKA 3U83A 5I1GL 5D96C 1HX0A 1X7QB 2K8MA 4QHUA 5CJOH 1M05B 4DK6A 3QYNA 2VH5L 5JIHA 3Q3GB 1MAML 2DJMA 2W9EH 5AW2B 2UY7A 3D25A 4M1GL 1NC2A 5I5JA 4ZBJA 3WSQL 1DBJL 4E42A 3GBMH 3BKJH 3JT0A 3NEEA 4M62L 4S1SH 4WV1C 4DERA 4MNGA 2XGPA 4ODWB 4AMKH 3NA9H 1E27A 2OMWA 5AEAA 1XR9A 2E9WA 3LQAL 1CYXA 5CLZA 3CQQA 2C4FU 3F01A 3UTTE 1KN4L 4Q7DA 4D9RE 4WI4A 3VAEA 4DSYA 1IOWA 3HB3D 1Z32X 3BUYB 3O2VL 3A6CL 2B9AA 3KDMB 1X5LA 3H8NA 2WLIB 2JFCA 4V1DA 2JK5A 4PJBE 3L3OC 4JQXC 4OJCA 3I02A 3VCLA 3F12A 4MV3A 5DSCB 1IL1B 3NJNA 5HHQA 2VQ1A 1NM9A 1DVUA 1TQSA 5INDA 3D85D 4WFED 3L16A 3GMRB 5IHBA 1T7WA 1CXHA 4AX3A 2CR6A 4FXLA 1XBRA 2IBBA 2K3HA 4ODBD 1UTDA 5HI5D 1AFVL 1AS7A 3OR7A 4JM2B 2D7PA 4L4VB 4YXLH 2EEBA 1ES0B 3JV4B 4L3EE 5ICXA 3WG7B 4ZMOA 3HS9A 2PCFB 2AVFA 5FX3A 4GRLB 3Q8CA 5J6SA 1W96A 3GSRA 1S3KH 2KI6A 4UWQB 3ILPA 2R83A 3VXME 2E86A 2EDBA 4OIBA 1QSEA 4Z7NE 1DBML 1CTMA 4OGYH 2X2YA 5D1ZC 3BP6B 4JANA 5GJTL 5KVGL 3GTMA 2BVEA 4LU5L 4E2OA 5L6YL 2WWMC 1K4CA 4CN6A 4X4YA 2MNWA 3KBHE 3M6DA 3TN0C 3RNQA 3OHXA 1A1MA 3OPUA 1ADQL 1BHGA 1SDYA 2F54B 3MV7A 4JW3A 5FCSH 4AK1A 3EF7A 4PB9H 4XCNB 3MJ9A 3F6JA 4JJOA 2OSYA 3IJ7A 5GGTL 1Y0LA 1FH5L 2Y0SA 5MEPB 2BR0A 4HZLA 2IWKA 4QJ5B 1ET7A 2CRMA 3R5FA 3OSVA 3FZUD 1G9NC 1SJEB 1TFPA 2OSLB 4ZD3H 2LAAA 3ZE0B 2Z92B 1CICD 4JN2B 4ZOBA 3L4CA 2B1HL 5GGVL 4UCOA 1NMBH 1VSCA 5I8EA 2F7OA 4JPIB 3QEHA 4ZHQF 2ADGB 2WP3T 3MSPA 3I50H 1C9SA 1K85A 1DV2A 4FLQA 4U1JB 2P45B 3SPVB 1KCBA 4AZ8B 2UY6B 1L7TH 1ZGLM 3DX2A 4JFDB 1U8JA 2EC9U 3SBWC 3SKJH 5F0JB 4GO6B 4B5ZA 3RL2A 3F58H 4P2OD 4OCSL 4NQEE 4NFCA 2OP4L 1LO0L 2QZQA 3ARBB 4UUJB 1EJ8A 1ZLEA 5IB2A 4GAGL 4J23A 3RQ3A 5C07A 4UM8B 3D69A 4UV7H 4Y2DD 3TS8A 3CC1A 1UWFA 1U8NA 4IKJA 4MDJB 1R0AH 3MMEB 3DX0A 3C60B 1I1YA 2B5IB 1JFHA 2W9BA 3BIBX 3CFJB 3QA3A 1W72B 1LEKB 1Z5LA 1OV8A 4DP7X 3T09A 5GJSL 3EXJA 3A24A 5D7EA 2CGRL 3KL3A 3T2NL 4PV1C 4FI8A 4A63A 1C5BL 3QQ9D 4FQ1H 4MMXA 3PHOB 2ZDQA 3DETC 5AZ2H 4LCWE 2FSEB 4UCUA 1AS8A 4UINL 2EILB 4IW4C 3I9GL 1A21A 2QTVA 2ZXAA 1JI2A 1HXYA 1WFIA 3LPPA 1S7XB 1AD9A 2X87A 4FQQB 4PCSA 2P5WB 4IRZA 3RL1A 3WY4A 5KJRL 4I0PD 4GRWH 3OJ2C 2J8OA 2HJFA 4P57A 4KK8D 4S0TD 4PJIB 1E42A 5KAQG 5IV2A 1OKEA 5MP6H 4DLKA 1VFAB 2F74A 3MLWH 3GNMH 4NCC1 1U8KB 2VM3A 5FGBA 3M9NB 3Q5YA 3JQOB 5LDUA 1IEHA 4NOFA 4H20H 3MRRB 4HS3B 1JDCA 4R9HA 2WQSA 5D2LE 1FL5B 4J3UA 1A0QL 3AXLB 1CURA 3TOPA 1YNTF 3D85A 4HXAL 4LLWB 2A73A 4OD1L 3BZEA 5DMIH 4TVUA 1OM3L 4JFFB 2NNXA 2I26N 3EGXB 4JL1A 4R4FH 1V7NL 1TQUA 3V6FA 3PJNA 3H42H 3ZDYE 1CBVL 4G6KL 1FO0B 4KZDL 3U6XS 1A6ZB 1PCSA 1WJ3A 5CEZH 3GSUA 2HX7A 2Z4QB 1JPGA 1T04B 1INEL 2H41A 2XWDA 3DI2B 3OAUH 2OK0H 3TIIA 4UT7H 5DVNA 3CVIH 3OKDB 1E6OH 3JWDL 4O4IF 1DFBL 3MRPB 3BAWA 4Q56A 4WF7A 4Z76B 3N5AA 2BIMA 2X4RB 1CIDA 2Z31D 4FMVA 4C8XA 1RUAL 4MA7H 3NJMA 2HH0L 3WIIL 1JZ8A 3D4CA 1OQXA 5D5ME 2Q6WB 4UTAL 4BSJA 4YGAB 4NO5B 3EJTA 5IHUH 5CA0F 2JEGA 5G4OA 2JB5L 2WXLA 2XZZA 1JNHA 5D70L 2HP4A 4Z7AA 2K6YA 1UJTA 2AQNA 2UXVA 3FQNB 1N70A 2X09A 5J89A 5DJDA 3N85H 3FN3A 3JUZA 3U7WH 1GJWA 2VN5A 3EUDA 4BH7A 5ADOL 5TE4L 5DEFB 3V52H 1KT2A 1CICA 1PG7L 2VUKA 3OTTA 4ZNEA 1RIHH 4E9WA 4MV7A 4FFWC 1MQKL 4NQXA 3NIDE 3MRDA 4LSTL 2G9KA 2Q9OA 1XGRA 1JN6A 2VLMD 3DURA 4QO1A 4QR7A 1MCNA 1QAWA 1KWGA 4YPGB 2UVUA 5B3SB 1MFDL 3LCYA 3KR3L 3W9EB 1F42A 5CGTA 3X13A 1KCSH 1DTUA 1DQLH 5HGDA 2DWTA 2ZCZA 3GSQB 3D6GA 4AIZB 3SPIA 2A83B 2HTKD 3ZRSA 4DGWC 3BWUF 3QUGA 3WGUB 5HP5A 4P46A 2C9PA 4PEEA 2OMYA 4ETYA 2OMTB 2EKSB 1NFIB 4ECRA 3BRDA 4A2AA 2EIZA 4PVLA 2D3VA 4A3KG 3WS6C 2VMDA 1U0QA 3K91A 4D9QD 4JLRA 4PS4L 3IWUA 2E4TA 3KM2A 2ESVB 3VSUA 3G5YB 3SGDH 4MXQD 4XNYH 5E6ZA 2B1OA 4HOZA 1PJWA 3FQUA 4K3JL 4KMTH 1TQWA 5FFLA 2R7ZG 3VMNA 4YQXH 3WLBB 2IIJA 5D1XD 4HX1B 4J1UA 1LP9F 4JVUA 3VVVA 2XVKA 2VSMB 5E8PA 1JHTA 2ED9A 4LLQA 5ADPH 5DUML 2LT9A 4J3BA 2PO6D 4I0PA 1QLEL 3U7YL 1KFAL 3LNFA 1ADWA 4PCTA 3DTDA 5DF0A 4B9KC 4WDIA 5I19H 2FJZA 1SY6H 4Y7OC 5GRUH 1YMMA 4QWWC 1BZEA 1JOIA 1W0WB 1IBGL 3UROR 5C9JA 2CKZB 4QNPF 4JG9A 5DEJA 3X3FL 3VRJA 1GHFH 1WTGT 4PJDE 3ARGD 4LQFH 3RWGB 4IMLA 3I4MG 1TEYA 3K4DA 1F90H 1L9RA 3MGTA 1AQHA 4YHKL 1A5FH 3JWNC 3AG2B 1VENA 4PGCB 3CHOA 5LLIC 2GC7C 2XWBB 2NR6A 5KYYA 1DQMH 1K6QH 5KSBB 1ZVYA 5I6PA 3VG0L 3QJTB 1OGTB 4HWEL 1KCRL 3QPQC 4DP2X 2JIXD 2KZ1B 1XT5A 2ZJTA 1DVZA 3HLAB 4RUAA 3VXPB 2R8JA 5F70A 3EYFB 1SN5A 4J9SA 3O8XC 5SV4A 2PMZA 2PTVA 1VIWA 4YE0A 3QUKB 5CJOL 3RGVB 2VQFH 2VXTL 1PKOA 4L4TD 2VLKB 1U8CB 1UQSA 2W9EL 1IO4C 3PDOB 5DA4A 4U1MA 3RWFA 2A7BA 3EJUA 1U92A 2Z31A 4S1SL 3VFTB 3HPLB 3VDAA 1DUZB 1AQDB 4S10A 1B2YA 3KCPA 2VSKB 4AMKL 3NA9L 1UXLA 3DBXA 4XAKD 1EHLH 3GMLB 2JQZA 3MQIA 1JUFB 4FCAA 4HC1H 4GT7A 1T7XA 4M3KB 3AWEA 4MNQD 3SQBB 5H94A 4ZXBA 4P2QB 4LCVA 4WO0A 1FVEA 3W57A 1OD9A 3WTXA 2X9ZA 3DV6A 4X8GA 2NY7H 4TNVF 3DSFH 1KJ8A 3DX8A 3O45B 3WHXA 2CHNA 3BOVA 4KRPD 5D2NC 1KJ2B 3U0TB 1TT6A 5DMYA 3K71B 4Z0XB 1E9QB 4JNXA 3QUXB 3VH8A 4WFGE 4AJVA 5LDSA 2Y6SD 3TBTB 1KPVA 2BHFA 3HFFA 1IBFA 4HEPG 5AB9A 4P4RB 5IROC 4PP2A 1JRHI 3KGRA 4TOYH 1JHLH 3U6RB 2VJ8A 3QIUD 1CQJB 1P5UC 3M46A 5DHVH 4PG2A 5FR3A 1NBZA 4PAZA 4XPFH 2NNAB 1E9PB 4Y1AB 2OW7A 5AW7B 1Z1WA 3BXNA 1KBPA 4JZNA 2AVGA 3IK2A 3Q05A 3A3YB 1JCKA 4DWHA 5L9DH 4FFYA 4YXLL 2Q7AA 2OTUB 3OMNB 5KFHA 1AE6H 4KROB 3WFBL 3PWPD 5C09B 1R3KA 1AYRA 5G5DB 2FWUA 3OKOA 1I8MA 1CDCA 3SQRA 2HPTA 3BP5B 1KB9K 2RGSA 2EUZA 2VLJE 2W0FB 5DYOA 2YA0A 5EZIH 2F53A 1MHCB 2WLMA 3QDJE 5CZXD 1E0OB 4ZMWA 1DE4B 4XBEL 3FULA 5LB1A 4HUUB 4KO7A 5CAYB 2W7OA 1GVIA 1ET8A 5AOKA 2F18A 1MI5E 3D4GA 1AC0A 1KXVC 1OW0C 1MRCH 2XG5A 4PB9L 4JCLA 3B6SB 1T1YB 2IADB 3FUJA 5I30H 1KLGB 1IJNA 2DH2A 3UBXB 4IGBA 3QO1B 5C9KA 5EN2B 3BJLA 2V3EA 1J5EH 1AKPA 4MJ2A 5IT2H 1OT2A 2ZF8A 2PO6A 2VMJA 3CZEA 3MO1B 3EHBB 4KBPA 5C0AD 1O7VA 2A6JB 1J9TA 4GUQA 3ZPDA 1FSKB 5KT2A 2ODIA 1N36H 4WI0A 1OY3B 1O5DT 5K69A 3OR6A 5BXFA 3ME0B 5AZEH 1NCBL 1F4AA 1DV1A 1L7TL 2J1YA 4W6YB 3N6YA 2A3TA 5TD4A 3SKJL 1WSST 3NRQA 5E9DE 1IM3B 1AS6A 1ZS8B 3MRIB 2DLHA 2RIKA 3STLA 2QVMA 4GSXA 3EIFA 1UB6B 2WB1A 1QRNB 3D12B 4UV7L 2YN5A 3L2MA 5DK0A 4J9MA 4HUCA 1XCQB 2O6FA 3FTSA 1NGYA 5KYWB 1A9XA 4H8UA 2FWOA 5LCVH 4A2HA 2WGNB 3MA9H 1U8OA 4NSKB 4FADA 3EJJX 4D3CH 2F8XC 3D30A 2EJ1A 4L1DA 4G8GD 4Y5YC 4J27A 2K70A 3R8QA 4CGUB 3GILA 4YP3A 3U46B 4KK6C 4UNTA 3ZJAA 1E4FT 2EEAA 4I3SH 1G9NH 3MUGA 4ZUSB 4L4TA 1ZT4A 5FDWB 3QFDA 3NN8A 1D9KC 4CC1A 4MA1B 5GGUA 5AALA 1LL1A 4MNHA 3UTQA 1R1CA 4DL7A 4PRAA 3RGZA 4GY4A 5D7JB 1YEJH 5DD0L 4AT6B 1FNFA 2F68X 1BQLL 5GS0H 1OP3H 5KFAA 1MFAL 4LASL 4OUOA 1UFUA 4KC3B 5IBLC 3DSNB 3VYOA 5KS9B 1P4IH 3TCTA 1FF5A 1GTFA 1KB5L 1WGVA 4ENEC 4DP5X 2PW2A 3HZYB 5B39A 1TWGA 2COVD 4YDLB 3S88L 3T0EA 4DR3H 5DD1H 1NL0H 1ICTA 3CFCL 5MP6L 3MLWL 3FK3A 3GNML 4E5XG 2IQAA 2VR9A 1ODAA 4F92B 3V6OC 2XT1B 3BE1L 2WJ5A 4H20L 3RVUC 3X12A 5CS7A 4KKAD 4PP1C 4GXVH 3MLXH 2FYVA 3W37A 4ECTA 4E0RA 5FM5O 5KFTA 2UYLB 1KPUB 1FG2A 2VDRB 5JO5B 1EJFA 3AYHB 3K1KC 5E8DL 3K5RA 5DMIL 1FNSH 5LNDA 4YHPA 1EEZB 3V4UH 3BWSA 3VGAB 3WTVA 3MX0A 3V0DA 4OV6F 2W65A 3D4ZA 5JNYB 4R4FL 5J4MA 2A99A 1QSFB 4PWEA 3H42L 5DMKB 2X6MA 1UB5B 4ZAKA 1I1AB 1E4HA 1N6QH 4N8VG 3PV6B 3OAUL 5IEKB 3OQ3B 2VUMG 1WR2A 4XZ3B 4OW6A 1Z2KA 2EDQA 1R33A 5CU9A 3WIAA 3CU7A 4MQSB 1E6OL 1Q94B 3CSYA 1ROWA 4P9HC 2XC9A 3G08A 2ZKMX 4M7ZB 1SOKA 4CGTA 4NQDE 4G42A 3S96B 3IRPX 1RJQA 1AR1C 1J8KA 5IB5A 1GXEA 2FIKA 4MA7L 3UBGA 5D9SB 2I8CA 3QRLA 5JQ6H 2FO4B 4XB7A 3CDZA 2GK2A 2ZZUT 1H6FA 2HKFH 3V8OA 3L4WA 4I18A 5IHUL 5KG3A 1SDDB 2YBRB 2GCYB 3P2BA 2AABH 4JFPB 1W91A 5IWLA 5HYJE 5ICYB 1DVTA 1PZBA 1ESOA 2C9SA 5C0AA 3SYPA 1CQIB 1ZA6B 2XV0A 3HHMA 2Y2TA 4I5BB 4DK5A 4ES8A 4GKNA 5FD6A 1RIHL 3LNDA 4JPSA 3KXFB 5AOLA 3FAWA 4X9HA 2C28A 3GMMB 3P73B 2FEDD 3LIZA 3MPCA 2LVEA 3T08A 4O3SA 4LOVA 3QI9D 3F2LA 5DWPA 3BPCB 4DPCX 3HRZA 5EWEA 3P2DA 4M5YL 4NKDB 5HI3C 12E8H 5IB4B 5BOPA 4WTQA 1SYVA 1IC7H 4Z7UA 1KCSL 2G5RA 1A6TA 5I73B 4F9LA 2N1TE 1KJVA 2IH1A 3MLYL 4GUPA 2XA8H 3GJFH 5LXTF 3T6XA 2UXFA 1UXSA 4EFEA 3FYIB 1QOKA 4L1KA 1XZ0B 4ECXA 2R0KH 2PYFB 5BPHA 3DDFA 4UB0L 5HJGA 4L5FH 1EWHA 2YC1B 5J12B 1WSCA 3GXIA 4NYLA 4BFEA 4NERA 3X3GH 5CB4F 3IJHA 1TJMA 1UKQA 3FFCD 2FJHA 3DX1A 3UMTA 3L5XL 1MFMA 3Q2OA 2WXOA 2JJWA 2I7SA 3FU5A 2YGOA 4KMTL 5AB0A 4MQTB 3TJPA 4F7PB 1FSKC 1EK3A 4X98A 2QR0B 2DI7A 3VFPA 3LP8A 4IOSA 2H1PH 4G7YL 1BMZA 2HT4D 2CQVA 4APXB 3HVDA 3BZFA 2LR4A 3EO9H 4WUKL 5HBBA 3V5DA 5JPMC 3WAKA 1J9RA 1C5CH 2CALA 3B43A 5ADPL 3ULUC 4YBLB 4NN5B 3BEWA 3ARYA 5GZNA 2HKAA 3ML8A 4LAQL 4RGNC 1R24B 3CG8A 3QHTC 3U9SA 5I19L 1B04A 1SY6L 3LRLA 5GRUL 2VN6A 4JI7H 2BVYA 3RVVD 3WLWD 4LKXB 4G72B 4JFXB 3SSGA 1GHFL 3EZ8A 4AGLA 3NP4A 4XH2A 2M83A 3BWZA 2X53A 2IH3A 1AD0B 3PPSA 4LQFL 4OKVA 4GKZA 4CVZA 4CADA 1AIFA 1YAZA 3LKPB 3MUHL 1F90L 4UZSA 2NX5A 4KY1H 3VNZA 2V59A 3R0MA 1A5FL 2OYLA 1DQDH 4HKBA 2Z7YA 3BIKA 1S8DA 5EOTB 2ZXQA 3LKRA 1NUGA 2AU0A 3CQFA 1K6QL 1D5IH 4F1ZA 4YMPA 1AJ7H 2WSDA 5T3XD 4BIKA 3C6LB 4XP9L 4P5SA 5FYLD 5DJCB 1L7IH 1U95B 2E9BA 1QFWH 3TNNB 3RUPA 3DHJA 3RX5A 1XSIA 3GMPB 1SEBA 2PKDA 3A23A 1HU8A 5D7JC 5GSVB 1ZLVH 3ZTCC 4B3SH 1DDHA 3HR6A 3A4DA 3MFGB 4WUUA 5KFSA 5DCCA 1HAWA 4F3FA 3RBDA 1OSZB 3EGSB 1L0YA 1KIQA 1YNLH 1NGPH 4Y9FA 1GGCH 4R5TA 1E4WH 2ENQA 4FQJH 3VNYA 3H54A 2DB8A 1GYUA 2C9UA 2X3CA 3MV9E 4JBSA 4U7KA 1HSBB 3ARFC 1WIOA 5JXEC 4QCIB 1CXKA 1E5UI 4YSPA 3TCXA 5IJKC 2HG5A 1HHJA 5IYBG 2AZAA 4XX5A 2PR4H 2NQCA 3JWOH 5KT3A 1HC1A 5AENA 3N9GL 4JO3H 5ICUA 1JV2B 1W0YT 1MUJB 2D3JA 3PL6B 3WNLA 2NY7L 2Q1EA 3DSFL 4BFNA 5ALBH 7CGTA 4EGJA 2VW6A 1TPXB 5DURB 2A0LD 2A6IA 3ZE1E 2W6OA 1X7SA 3NJGA 4JRXD 3VA2C 4EZLA 1IBBA 5FKPB 4JPQA 3BN9D 4JDZA 3CCHB 4R7DA 3KBEA 4X4KA 4X5RA 5B38B 5E94A 4QOKB 2IAMB 4TOYL 4XWOC 2DIEA 3O6KH 1EZ1A 4MJ6A 1SLWA 4M48H 3QI9A 3MNVA 3QH3A 4NNPH 1JTTA 2EE6A 4RX4A 5I23A 3O6FD 3PGDA 4GXUM 5EU6E 5L9DL 2P46B 2X5PA 1KBBA 1J48A 4QDGA 1XF3B 4BV1A 4X8JA 4ZO9A 2X70A 1MCKA 2FPPB 3ULSA 4D0DB 2I9LB 2VZTA 3K6DA 2QQNL 4HZ1A 1PLGH 5BRQA 3GRWH 4KNTA 1T89A 7TAAA 5DD3L 1U2HA 4PJFF 4OQ1A 4BFOA 3ETBF 3OMAB 1T0NB 3NCYP 3QDGE 1JS4A 5IQ7L 4OZFA 1INDL 3ARDC 4DVRH 5LAPA 1I7TB 3GBDA 1DJGA 1EJOH 2XX0A 2GPSA 1FYTA 3S4SB 4FNPA 4F8TA 2V7NA 3PJSB 4LEOB 4GBXA 4DCQB 2B15A 4GRWB 1YYLH 5MHSE 3WJMB 1UH3A 5H37G 1P7HL 4M7LH 2LFGA 4MS8D 3I85A 2EINB 4NHUB 5IMOA 1MRCL 2Q10A 2OWOA 4G59C 3HS0B 2OTPA 5JVLA 1EIBA 4PJGB 3FTGB 1UH4A 4PV9A 2W9AA 1EZSA 1UM6H 2GLTA 1RJLB 4F8QA 4FL4B 2VMFA 2X88A 4JHBA 4F7EB 5D7IB 1JWSB 3HRPA 5IT2L 2AJVH 3QDMA 5D7HA 1JGUH 1U3YA 3RIAF 1Y18A 3H85A 2BVOA 2R59A 4RAHA 2NXZD 3MJ7B 5T5FH 1ULVA 3HR5A 3PABB 3RZWA 3VD2A 3CFKB 5B8CA 2HHHH 4ECZA 1ZVSA 5IR1B 5E2UH 4ZUWA 4Y4FB 5AZEL 4AL8C 5A3ID 5H4ZA 4EN3C 3V4VL 2VN3A 1XGTB 3EH2A 4A3IG 3LV3A 1I7RA 5CIPH 4HBCL 1WIPA 5D7SL 5IHZB 4L1TA 3MTRA 4Z78B 5KZCB 2MMXA 1CGTA 1U8MA 2CDGB 2DIBA 3KE0A 4ODSL 1WDAA 4PRBA 5T3ZH 1U3JA 3R0NA 4N3UA 3UO1L 4CNIB 1UATA 3Q6GH 9PCYA 2D0GA 2WQXA 1G7JB 2WY3B 4TYUA 1QR1B 2BQ3A 3CTTA 4NN6B 5LCVL 2HLFD 3C0FB 4BZ2H 3VW3H 2G9HA 3KAAA 3MA9L 4XNDA 2R84A 3IDMA 1WFNA 1DVQA 2G0KA 3GSOA 4JFQA 2ZNXA 4L05A 2RALA 4NUGH 5HJ3B 3C09B 4D3CL 2BIOA 4YO0B 5HHPA 5DHDA 3EG9B 1ZDQA 4WW1A 4EF3A 3BCFA 5EO0A 1LVEA 4FKEA 5FLVA 4I3SL 1G9NL 3CD4A 4YBLC 4NN5C 4X4ME 4BXVA 2R9HC 2NNRA 3BGAA 3L7FA 4FFVC 2IDUA 4HVBA 2YSSB 4AE0A 1Z3GH 4X6CB 2XN9D 1PIGA 2DKUA 4EUPB 1OSYA 4X7TA 3N43F 1OAJA 2GIMA 5IVXF 3VTTA 1P4IL 2R1XB 2DPIA 4JRFA 2R7EB 2EUXA 1CDYA 1D7FA 1HL4A 3VFSB 3UZEA 3HB9A 4FN0A 1MAJA 4U1SB 3Q5TA 3DOSA 3WGVB 3VFRB 1IEBB 2EYTA 2E2HA 4PS3A 2BHZA 5C0DA 4NXMH 5CGYC 4PTUB 2V2XA 2W6NA 3SJVA 4XRCB 4A7SA 4MXVF 4BZ1A 2DWYA 3EDDA 5IMMB 4LFCH 1MRFH 3MCKA 3DK0A 4JM4H 2GJPA 1J8HB 2DEWX 5EF0A 4GXVL 5K9JH 1GOGA 5KJ7E 5L8LB 1VPOL 5ANMB 2Q5BA 1N3NB 5LXVA 3EFOA 3V8CA 3O9WA 4O2BF 2F1EA 5JYMA 4ZW7A 4QRRB 4GXUN 1FNSL 1QZ1A 3GYRA 3V4UL 2YK1H 3SE7A 3K5HA 2VDOH 4FFZL 5C0BB 3O6FA 3AFLA 4I87A 1UOLA 1NFDA 4WAFA 1HOCA 3TBSB 1VFMA 3CBJB 3OKYA 4OR1A 1EFXB 4QRPA 4BHUA 1MQ8A 1U91A 5IMLB 1N6QL 2HT2D 3QDAA 5I1HH 5I75B 1S5HA 1DVFC 4D9LH 3FQRB 2D4FA 4IBZA 2OMXB 4JJ5B 4DQAA 5PCYA 4ZX3A 4GW1A 2CJ3A 5EZLA 2VABB 4XBGB 1ZKAA 4DHLA 4AYBA 4MHHI 2H32A 3PL6C 5FO2A 1QD0A 4GOSA 2NDGA 5EB9A 1MDTA 3FCUB 1T94A 4N2IA 4JRYB 1Q38A 2XPZA 1WVZA 4K9JA 4RAUB 4HAKA 4DTGL 2HKFL 5D7LB 1P84J 4PR5B 4WFHD 4HUKB 1NIEA 3QEQA 3W81A 3QEUA 1P7QA 1YEGL 1ZS2A 1JDEA 2G75A 5D2NE 3V95A 4QIWA 2OV0A 1JXLA 2R92G 4DL3A 1T0MB 2X4NA 1H3PH 4JFFE 4M8QA 3BUIA 4FFTA 4P4KD 2ZSVB 5FO9B 3CUPB 1ZHBA 5MEOB 3QJFA 1J5CA 2HYMA 2IWEA 2L4OA 4I2XB 2A9BA 4DPBX 2B3RA 1C5DA 4N0RA 1D3CA 4PJAA 3VTAA 3AW5A 3KPNB 4E9RA 4PFEA 3Q1SL 1BVKA 3KL5A 3DWTA 2A6DA 4P9HH 3GSNL 1KENL 1S6NA 1CFNB 2XA8L 3I2CL 2EO7A 2XJKA 4FA7B 5KVMC 4QGYA 2XQYG 1MELA 4JGNA 1A14H 4U7CA 2R0LL 2R0KL 3QJVB 1OTTD 2X6AA 1H3UA 2ENPA 5I71C 1NOAA 4LHQB 5JHDD 1A7PH 1MY7A 2DQGH 3TA3A 5T3ZE 5GRVL 5J6GA 5I1AB 3IBEA 1TYRA 3X3GL 4GXFA 3GXMA 2P8PA 1F3DJ 4YZFF 2WVTA 2VOBA 1Y1WA 1JP5A 5EFIA 1X44A 1YEHH 3T04D 1QA9A 5JIKA 1AP2B 1EHNA 2VDQH 1IKNA 4W9HC 4ZSOE 5JOFA 3WJJA 4RZCB 5GGQH 2R4RH 2YEQA 1M7IA 3AACA 1NUNB 4MD0B 3WUWA 1MKFA 2PPEA 1DJZA 5JDSB 2FPGB 2H1PL 1XMOH 4PREA 4ZMNA 1VADA 3VMMA 3V0VB 1FPTH 1H8SA 3EO9L 4Z95L 4PVBA 1RJPA 5HGAB 2DI9A 3C5JB 3G5ZA 4J6IA 3TU6A 1C5CL 2XQYK 5DEGB 2MPVA 4EOWH 3R5XA 5DQIA 3KLDA 2QVIA 4YK4B 1VF5C 1W8OA 1XD0A 5DHVB 1CYGA 2R2BB 1IUZA 4WWKA 5FFOA 3SCMB 2JELH 2PCXA 3DV4A 5FYKD 3RTQD 4L2LA 4CILA 1A6PA 4Y2OA 2MSPA 3TBWB 3N40F 3QE5A 1H6UA 2WD0A 4WSJA 1UVQA 2IANB 1VKXA 4N0FA 3QQNA 2AV7A 1T5WA 3ZBMA 1T4KB 1UWEH 5DMGC 5DVKA 5J5EA 1EEQA 2HX8A 3BAJA 5EN3A 3HJ0A 1D6EB 2D31B 4Y19B 4LOFA 3NFPA 3BDBA 4KY1L 3U4BL 1CDBA 2G5BA 2NU9B 1NBQA 2N59A 3DIFA 2I60H 1JZGA 2XYCA 4L1HA 4N2LA 5IVZA 2NLJB 4IKLA 4W4OA 43CAB 4R8WH 4LZKA 3C5ZC 2ESVE 1KOAA 1D5IL 3QWOA 1AO7A 1WS7A 3NP3A 1FZMB 2VT0A 4LSUH 1QFWL 4AOFA 2ZOLB 3EO0A 2YA1A 1I1RA 1NANH 2XCPA 4KXBA 5JQIB 3K5IA 2P24A 4X64H 4WU7A 5HYEA 1T2QH 2HFEA 4OZGA 4QHPA 4CSTA 3LZFL 1J0HA 3LD8C 4HIQA 2P80D 4NRXA 4H8VA 1YNLL 4DGIH 1W15A 1GGCL 3VXRE 1E4WL 3S5LA 1V05A 3O3BB 2K0RA 2X7LA 5GRXG 2R2HA 3MR9B 2HJLA 5EF3A 2WBJA 1FZJB 3FFDA 3SOBL 2ARJA 4O02B 5DO2C 1PY0A 3D50A 1WCMA 3FCTA 4WNSA 2PR4L 3PFQA 1M3IA 3MLUH 1RUQL 3PNWB 4XXCC 1CI3M 3VXUB 4AXWA 2H1LM 5J11C 4RFOL 4U1KB 1XTLA 2WQUA 1UZ8B 4QKTA 3B3BA 2KKQA 2P44B 5ALBL 4HJ1A 2NUPB 4U3CA 2AZUA 5FIEA 3RVXC 4JFZH 2CXGA 1IC4H 5HPMA 3V6OE 2FB9A 3ZDZF 3U2SB 1BOGB 2HJKA 4P4KA 4Y4HC 5KT4A 3QUML 4XNMB 5GSRA 5FB8A 4OZHE 1TZGL 4YHYC 4A3LG 3RIAK 1G0XA 3O6KL 4JFEA 2OR9H 2RTTA 5I75C 3FU3A 3C6EA 2HSIA 3JVFC 1ECZA 4B3TH 1S78C 3VB9A 1JZJA 3BAEH 4ZDHA 4FF9A 1BXAA 1U8HB 1FP5A 2VLKE 3FJTA 1E4JA 2FD6H 2JMRA 1BQUA 2YS7A 2CBMA 3K8LA 5F9JA 4P46C 4FTDA 3F83A 1OTSD 3BP7A 2CR3A 4ORZC 4PY7B 3ZSSA 4B7LA 1V7MH 1JPFB 1RIVH 3DYOA 1WEJH 2VIRA 1NFDF 4PJ8A 2E7DA 1HWGB 4DVRL 4EIGB 1Z2OX 4JM2D 4KJYB 4MX7B 3UP1A 1EJOL 4BHUI 3G6XA 2EIKB 4ZW8A 3I75B 4QHMB 4LBAA 1C8QA 1YYLL 3LVTA 2JQMA 2ZPKH 3NGBB 3ZRFC 3MACH 4YAJB 4M7LL 5J1SC 1CPUA 3AM8A 5EZJB 3RUGE 2AGJH 4BH8A 1CWVA 2EDJA 2AJ3B 3IB4A 1UM6L 5E1GA 5ITBH 2C9AA 4DR1H 4KJWC 4NT6B 4PG9B 1QEWB 4KK5C 1FVDB 4FZEH 4Y5VB 1AZZC 3Q2NA 3V5HB 3KGSA 5IFHL 5IKCA 5ACMA 4XPTH 4UI2A 1NGWA 2BO0A 3BT2H 1N59A 4Y1AE 4XBPB 3BAIA 4NKMA 1NCJA 5FJ8G 1JV5A 4KJPC 5SWZD 4NZRH 2PWEA 1LO5B 1JXFA 1ACCA 2CUAA 2VC2B 1MVYA 5HHXL 3DVNA 5KSUA 1MHHA 5DS8A 5AG8A 1LE5A 3CQPA 2QKIB 5F7UA 4A3JG 4KDTA 3QUYB 5KG7A 4B3MH 2B16A 4F80A 4P3WA 4Z7QB 5T3ZL 2XG4A 3Q8AA 5D1OB 3Q6GL 1OAKH 4XOEA 4PW3A 5DLFA 1VLXA 1RAMA 5KFBA 2WQVA 2GPZA 3DUUA 2H3NA 1WZLA 5J1AB 4QJ3B 5EIQA 4F15B 1TQCB 4K4KA 4BZ2L 1F97A 1WZMA 3VW3L 2GSIB 3H1ZA 4HGMA 2FR4B 3B1TA 4G9FB 5K39A 1I3GH 3T3MB 2WDTA 2ZG2A 3LN4A 2TSBA 1CLYH 2D03L 5IVOA 5TTRA 4OLEA 2AMUA 2VDLH 3TNMA 1CVRA 2F58L 3QZWA 3ZMRA 3P4MB 5LMUH 3NPSB 1T3FA 5LWYH 4LGSB 3HE7A 4NO0A 1YA5A 2MTPA 2UXTA 4QRQA 2CKBH 4YDVA 3SPGA 2NY1B 2SEBB 3SE8L 2EP6A 5IGXL 3MLPA 3VSQA 2FEJA 4LSAA 4HNUA 1OP4A 3HG1A 1KTKE 2NNFA 3POHA 3OXSB 3N41F 3L3HA 5JW5A 4J9PA 4F2FA 4FS0A 4CAGA 4ZXBC 3T0XA 1Q4NX 4ZJ9A 4RGNE 1WBYB 3LPOA 3BH8A 4YR6A 3QXVA 3DX7A 1HI6A 3FO9A 4FTVA 2E2IA 1DLHA 4BINA 2YS4A 1S9XA 2C3WA 4FXKB 2X0UA 4XVSH 2HVKB 2ITEA 1MRFL 4KI5D 4J3OD 3EJYD 3GJFB 3VB8A 5KFEA 4F57H 4Z77B 2R0ZH 1PD6A 2NY2D 3B9KD 4GAJL 1FJ1B 2UZIH 2MCPH 1CFVH 3KPQB 2VLRB 1Z0NA 4M5TA 4S1RH 1G7IB 1BGXH 3SYOA 5L2KD 1UUSA 2GFBA 1ZHLA 1NGQH 1HQ4A 4AJWA 2VDOL 2O03A 1MJ8H 5LP6F 3SDXE 5I18H 1AZBA 5F1NB 2ZXCA 1JDAA 2BWQA 1A4KA 2YPLB 3MRCA 2FE0A 2J1WA 5KVEH 3BW9B 3CQZA 2ED8A 3VWKA 1YMHA 2O5YH 5B1BB 5I1HL 4D9LL 5DJXB 4MBRA 1NC4B 4R7LA 4ZMLA 3PRZA 5EU5A 2ZD0A 3D39E 3QIBB 4TUOA 3HE6D 3MJGX 3GC3A 4FGMA 2E46A 5BRZB 1G4RA 3RZCD 3OF6A 4RIRA 3S37X 1RULH 3VGGA 3R06B 4I77H 4WW2F 2WN3A 1ZHKB 2ZSWA 3QCVL 2WNKA 4H8WC 1VZIA 5FYJD 1DO6A 4IGBC 1G7PA 3T5HA 4LHUG 3VXQA 4NJ9L 5DJYB 4OLVL 3V0JA 1JKJB 5GS2D 3LNHA 4LDOB 4X7DC 4LBEA 5I5MA 4PRNB 1MFBL 3VXSB 4ZQIA 4HIEB 3DMMD 2OI9B 3EOTH 3HI1A 5FUZH 2X1XR 5EPMB 4LCCB 4M6OH 5E2TL 1I8IA 2BNQE 2ZONA 5AUMA 3SGJC 4E4TA 1HILB 4MJIE 1PTZA 3MI6A 1P4LB 3V0HA 3WJLA 2H0FA 1KIPB 4N6RA 3QFJD 4YNYA 3IRCA 4LPTA 4N20A 3H9HB 3IPEA 3MFFA 1HYRC 4QWCA 1CFQA 2ZUWA 3BKCH 4IRJC 2NXYD 5IJVB 4QMEA 3DX6B 5EEZA 5MI0C 2ITDB 4P23C 3VD9A 3BA9A 2E75C 4F50A 1Y07A 4P9HL 5HDOA 4EIBA 4M4PA 1E40A 3O3DA 3JV5A 4M6NH 4S2SA 4LL4A 4XTRD 1NKOA 2BSED 4Y1SA 3ZTNH 4ZW5A 4Z7OE 3MYJB 2G3ZA 3BQ0A 4PGDA 2NY5C 4FNTA 3WUZA 3MJ9H 5I15H 1A7PL 2DQGL 4RZRA 2ILLA 2N7AA 4ZPVA 3VXNB 5I28A 3US1A 1IMHC 4JKPH 4JM0A 5F9WB 5JIPA 1YSOA 1WH0A 3CX2A 1NDGA 4JFHE 2C1OB 2L7QA 3GMOA 4FERA 3OHMB 4LCIH 1ZTXH 2VDQL 3RILA 3TASA 2WXNA 1BBJB 1OLZA 3KPSB 3PLYA 4P3CH 5F7KC 5GGQL 2R4RL 3PN1A 1SLXA 4PBWD 5L9XA 1I7ZB 2KL6A 1NTDA 5ERWA 3TZVD 2WZAA 1BF2A 4ZOEA 4KXAA 4Y2NA 3KPMA 4EOWL 2FCBA 4FQXC 3G9VA 4ANKA 4PJHE 1NUDA 4L1LA 3P40A 4U6XA 3T4YA 3T0EC 4PW4A 3QUZA 1KEGH 1KJMA 4JG1L 2FK2A 4LF3B 4OUUA 2JELL 3T5KA 4IAJA 3F7RA 4ZYKB 5KFXA 3JUYA 4HIHB 4WI3A 1D2OA 4X6DE 4LGPB 1N26A 1UWEL 1FNGA 3O4LA 1JSYA 4I4WB 1Y6NR 2JA5A 1WFMA 1PKQA 2QPSA 2H0JA 2A38A 2XU9A 3WFCH 1XB8A 4HUNB 3MJWA 1H3TA 1BYPA 5L2KA 4M1DH 5KFOA 2H6PA 1OARH 1GCFA 6CGTA 1CGVA 3FQWA 5LNGA 3VPBA 3RPIA 2OFQA 1YPZE 2B7DT 4KH9A 4OZIE 4LSUL 4ZAKC 3ILQC 3KYKH 2H0EA 2LTQB 2NY1C 4YUEH 2RCSH 4X5WA 1RK1B 2V0AA 3NMEA 2XX1A 1T2QL 4BKSC 1QI3A 4IRZH 5ID0B 1S0MA 1S7RA 1CFTB 1UC6A 1H15B 1TO5A 4N2KA 2V5RA 3APNA 1WWAX 5BV7C 4UQAA 3MBWB 5TDOB 4XBMA 4NCC2 1A7RL 1U30A 2ENSA 3UP6A 2R93G 1IFHL 1UD4A 4P2RB 4IZOA 5AVQB 4LVNC 4XPAH 1JRHH 1WCBB 5ISZB 4P59H 4UT6A 2E8YA 3JTSB 5F6HI 2O5NA 1G6VK 1YEFH 3C8HA 3QC6X 2XTJB 3GBNH 4EDXB 1HNFA 4ZS6C 4JEGB 5MEND 2BP0B 3T2QA 4XC3H 4HWZA 1MIML 1YUKB 3UH8A 4HWBL 2F5AH 2CHWA 1LEGA 4G43B 3HBLA 4DV6H 4I4TF 2CK0H 5DMJB 3LKNA 3QNXA 4HIJA 5EUKA 3R8BB 4HBQA 4PRIA 2FL5A 1S7VB 4ODXB 1XDNA 4ZMZA 1G5GA 1V10A 3FOLB 3H53A 2OR9L 2XKSA 2YD3A 3QHFH 4Z7VA 3UPRA 2C1PA 2V5YA 3P9MB 5CJQL 2VL5A 3IETA 4TULH 1L9MA 2B0SH 3SGKA 2FE3A 3BO8B 2ICWA 3BAEL 3FNKA 2BY3A 1KYAA 3SDDB 2RDJA 2EACA 4F2EA 1FC1A 1V54B 4ALAC 4D0BB 3I6KA 2BSEA 2JEIA 1QI5A 1SGKA 1GGUA 4R2GD 4PJ9A 4X50A 2APWA 4KVPA 1PZUB 5EWGA 1WEJL 4MLIA 1QSEE 1MFVA 4ATWA 3HUJA 3U0PB 3HW7A 3LN5B 2WV3A 3WDJA 4ZFFB 5IT9W 2GKIA 2KSWA 1JL8A 4D7BA 3JYCA 2AXFA 1QW8A 4Q6IC 4LLAA 3EYVA 3BI9X 3GIDA 5FOJA 4PY8I 2ZPKL 4JUTA 3TBBA 2KBGA 4JM2F 3SDCC 2QVTA 2QADC 4E41D 4NIYE 32C2A 4OTXL 2PNDA 2QELA 3IS1X 5DJZB 2VR1A 1S9WB 2DN7A 2ZQKA 2Y0SE 4B3RH 3THMH 5ITBL 5KSAD 3MCLH 3LHPH 4FZEL 2WVVB 2P5EE 2Z8RA 3L3GA 4XPTL 4UIMB 5CHNA 5GZNC 1ZTXE 3OJDB 3BT2L 1UT2A 1EO8H 4N68A 2YBGA 3S3JA 3HI6H 3J81W 1ZDSA 3IPFA 4W9KC 2VXUH 3ET9F 2E0PA 4NQCB 2P8LB 4TSBH 1U36A 5DD6B 3GV5B 3QJHB 4KK9C 5ECGA 2X4UB 1QFWM 1A9BA 3G8CA 2NZ9C 1A1OB 3I6GA 3NYKA 3BEVB 1A6WH 1RURL 2AK4A 2ZAGA 5ENWA 4RBPK 3BVNB 4JDEA 3F7LA 3JZ7A 3U9PL 4D0CA 2ZX9A 4PJEB 5C07E 4Y9GA 4DVBB 3P4NA 2BS8A 2ZWZA 3CDCA 3BFOA 4AKOA 3RNKA 2WAQA 2WINB 1IBKH 1F3JA 2KLRA 4HS6B 2OS7A 2OAAA 5DJAB 4ELMF 1I3GL 3KGUA 2YXMA 1XGQB 5FA4A 2X4TB 2AV1B 2VDLL 3H3KA 1X4XA 3UTTD 1DQJB 3W5NA 3SN6N 4D9RD 1ZT1A 4DOHB 1JMXA 3TFKD 1AGDA 1L9OA 3H0GA 2CKBL 3MV8B 4OSUH 1AHMA 5IMKB 2AJUH 4GIOA 2VRQA 4GG6F 3CSPA 3FKIG 4BWUA 2ID5A 8FABA 5KG9A 2CLZA 4PSPA 2OM5A 4MVBD 3K6NA 1X5HA 5F6HJ 1LLAA 3S3CB 1OSPH 1MEXL 4ZS7H 3K6SB 2ZOUA 3KGTA 2VISB 1BFSA 4OFYA 1JBJA 4XNUH 4JAMB 3US9A 4K7PH 2Q8BH 2JJTC 4GH7B 4JKMA 4UOW0 4DPAX 2YWYA 3LKOA 5E08L 1K2DB 2VPSA 1LD9A 1F11B 4L3ED 4XVSL 3N6XA 3D18A 2X1WL 8PAZA 1U93B 4F57L 4BCYA 4IRCA 5J2UF 3DUSB 2R0ZL 3FH7A 4KTYA 3QRGH 3PW2A 4ODVH 2UZIL 2MCPL 2LTQC 3RF2A 2BPBA 3B3IA 4K23L 5DUPL 4K94C 2VTFA 4PJXA 4S1RL 4YHIB 2Y1VA 4J3OF 3L1GA 1QZNA 1DSFH 1NGQL 3F00A 4ZQKA 4KAQH 4BZYA 1VGKB 2NY3D 1SVCP 4R3SB 3GLKA 1CZ8H 1JTPA 3I12A 5DZPA 4FBUA 2VDQB 2O5YL 5IFJB 2C22A 1SYSA 1BJMA 3X1EA 5JZ7C 1BYNA 1PQZB 3AXHA 4TPRH 3F64A 2MHAA 4L9LB 1TA8A 3D07A 3NFNB 4UAHA 1E6JH 3BQUD 4MTMA 4G8FB 4YHNA 2EYSA 4A68A 4PJCF 4PY8J 1RULL 1K5NA 1ORSA 4I77L 3VMPA 1EXUB 1YYCA 4HKJB 5HV6A 3BLKA 2JJSC 2W81C 4HV8A 1BD2B 4Y4KA 3W0WB 5DDHB 2VMEA 5CINH 1F45A 2J6WA 3UZQA 5C6PB 3AREB 3CDYA 5JW4R 3QVAA 2I25N 4O2CA 4NZTL 4NQED 5F9OL 5FO7B 2J55A 1T83A 3EOTL 5FUZL 5HDWA 4DP0X 1MIEH 5C97A 3AAZA 4M6OL 4OLUH 4W4NA 3TEWA 5C0BE 4WY7H 4FFYH 4KXZI 4PJ7A 2XUWA 4Z7WE 1WT5A 1MLCA 1GY1A 5FWQA 4A3CG 3GMNB 4IRSA 3C5XA 5SWSB 3DRTB 1MPAL 5L7XL 3BKCL 1XIWB 1H19A 1WWCA 5L8JB 5ESVA 4QHKI 1TWFA 3MLVH 3RWIB 5C0ND 2AKRA 5EBWB 2IFFH 1T03L 4JKWA 4LO9A 5AYUH 3UAAA 1DEEA 4KJQD 2EKJA 1RSFA 4M6NL 4R4NC 2IQ9H 3GJEA 5EC2A 5HDBE 4DETA 4XN9A 3W9DA 3KPLB 3ZTNL 4LCWD 5I0VA 1N68A 2JNZA 1MCIA 4MA8H 1LK3H 3RWEB 4HH8A 1ZLWK 5JPNB 4FQ2L 1AN7A 3V4SA 2G4GA 3PWJA 3MJ9L 2XN2A 2E74C 3O6LH 4FQHB 2HCZX 4JHZA 1U8LA 4UM9B 1ZY9A 4FNQA 1R3HA 3L9BA 4MV9A 3IFPA 2ALWA 1FNHA 2GYSA 2KLTA 1IU1A 3VD5A 1ZTXL 2PPFA 2QVFB 3UJTH 3CHSA 4NP9A 2HTLD 4P3CL 2Q86A 4LSPH 4DT2A 3VFUB 4JQIA 2X12A 5AKRA 3ORQA 4QHLB 2XDHA 1E9OA 2BOCA 1LO3L 2NT0A 4MQ7A 1PG7W 4J3XA 3N8DA 3KYOB 2FAUA 1EXGA 4XCYB 1GC1C 5AOIA 3L5WA 5E6UB 3H9ZA 1KEGL 4LF8H 2OYPA 5TH2B 2NT1A 3QZNA 1SUJA 5HHMB 2QHLA 4DP9X 4HJGA 3VRIA 4KU1A 3VE0A 3OKMB 2Z93A 2V2TB 2QSVA 1FGVH 3QO0A 1KBLA 4HPYH 3S2CA 3LKSA 4ACPA 3M86A 4L3EA 5FCUH 1HEZA 3DPBB 1CU4L 5J06A 5MEQB 1FN4A 2NY5H 3G6JA 2JCCE 3EKCA 1G7QB 2EVFA 2J8UA 2JXMA 2ITCB 3CH1A 4U6YA 1E50A 1ZE3H 3VXMA 2GTZB 5AW6B 1F4YH 2K7PA 3VI4B 4BA8A 5A40E 5HDRA 1BV8A 5CEXB 1YJDH 1N33H 2W80C 4MA3B 2XWCA 2XTLA 3AQYA 4LOUC 1NIAA 4HKZA 4YUEL 2VSCA 2RCSL 4NRZB 5DFVC 2QQLH 3BPOC 5DG8A 4ZK8A 5CBAA 2W6ZA 5AKSA 4BFFA 4EFBA 4ZOAA 3N50A 5SWQA 2HXAA 4WO4A 5I1IL 2GITB 5HHOB 2B1AH 4IRZL 2X9WA 2D7TL 2AQTA 4J4PD 5HVFB 3DROB 2DMKA 2FB4H 4LFHD 3UAJA 1TLMA 3ULVH 2F0CA 2CPUA 4LPYA 1QBMH 1RV6X 1UM5H 1M9SA 1CXIA 1TKWB 2QBWA 1JRHL 4TV3A 2CIKB 4XPAL 2WMPB 2PUQT 4P59L 5KYUA 2Q76B 5KW9H 1OSEA 4FG2A 2KQNA 2IANE 3TCLB 2GJ6E 1ZANH 3CZFB 3IXAB 3MRJB 1YEFL 1PFOA 3GBNL 2DEYX 3STBA 3Q06A 2WLYA 4MBOA 2YGPA 2COQA 4XNQA 3PPEA 4XC3L 1R4XA 5ETUA 1FFNA 2F5AL 3V0FA 1J5OH 3IMBA 1NKGA 3UTZB 5LG6A 1XXFC 1I6UA 2CK0L 5E23A 2ZCHH 4AVJA 4DFHA 2WKOF 4Q6KA 3PGCB 1CLOH 4NN7B 1BX2A 2BIPA 4LVOB 6PAZA 1G9MC 4XCCH 2J57A 4YIQA 3AJ7A 1B88A 1MVUB 3QHFL 4PIBA 1DEDA 5TPWH 1Q90A 1NEUA 1UA3A 5I6XC 2OL3A 3K4AA 3RX9A 1PDKB 5E0FA 4AGNA 4QHKJ 3D3VB 4TULL 4WFFE 2N01B 5G4NA 1ZVNA 4XMWA 2VDLB 3PHQA 3MGOA 1R3LA 4PJXF 1GYAA 5AVVB 2WYOA 1DJXA 4OD2B 1RHHA 2GSGB 1T1WB 2QQKH 2WXMA 5BV7H 5AZUA 5FS5A 4UANA 3IDGB 1D5ZB 3VFOB 3RY6C 1IB5A 2EVGA 3BVUA 4RSVA 1FG9C 3F6IA 3TA3C 2F53E 2PYEB 4UT9L 1QR4A 1A2YA 1YNTB 3H0TB 3KPOB 5HYQA 2WTRA 3PWUA 3TVMA 4K7FB 4I7ZC 1SXAA 1EAQA 4X4XB 4KQ3H 3AREC 3PWVA 5IIEA 3S36H 4Y2LA 3RTLA 1KGUA 2WGXA 1J0ZA 1IKNC 1I8AA 1Q9OB 1A3LL 2MEJB 4R8UB 1T5XB 5CP7A 3TO4B 1FNEA 4JHWL 1SBBA 3HHRB 1NAML 4YBHA 1A8JH 3WFEL 4EVNA 3W39B 2IALB 1BIIB 1G1KA 3UTSD 3VSTA 3FT2B 3LRSB 3P4OB 3E8VA 1BDYA 3OAZK 5FGRA 5CM1A 4LF9H 1YAIA 3HZVB 2QFPA 4JY6A 3QRBA 3SDAD 5JDJA 2UWEB 1EO8L 3HI6L 5E6IB 3LMJH 3LJ3A 5F7DB 3RVTD 3IJSB 3ZU8A 2EICA 2VXUL 4A7GF 4QHUB 4C56A 2CAKA 4F7MB 2AF2A 3U9WA 2FUQA 5GRYA 5EF1A 3WU1A 3OVUB 4TSBL 4ZO7A 1A7QH 1F0LA 2OTWA 2CJSA 2OXHB 3GLZA 3BG5A 4K3EH 4AKQA 3Q5OA 1NC2B 3MZGB 5I74C 3CVHL 5T1MA 3QXWA 3KBPA 5LGHL 5JH7F 1YNKH 1X5FA 4MNGB 3IWVA 1A6WL 2DTMH 4N2CA 4IJTA 4TMPA 1OXYA 4N25A 5DLMH 5AVSB 2OMWB 3FQYA 2R82A 5LA6F 1HE8A 1RK6A 5G4MA 3QORB 3K5SA 4OIAA 4W4OC 3CFMA 3NEXA 3Q1KA 4APQA 3ISWA 1BJ1J 4BE5A 1U3HD 3Q44A 2HX9A 3GPEA 5AYQA 2E7HA 1U2CA 2I27N 5EIIA 1B6SA