3N44B

Crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; osmium soak) of chikungunya virus.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
338
structure length
337
Chain Sequence
b'DNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 65
structure length 337
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n44B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n44B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n44B02
3N43B 3MUUA 3N40P 3N44B 3N42B 3N41B
chains in the Genus database with same CATH superfamily
4KUCF 1ZDSA 1B6SA 2AXHA 1FIEA 2IANE 3CPLA 4U1KB 4Y1AE 4WI5A 3N1MC 2XZAH 3CHPA 4QOKB 3B9VA 4U3CA 5IVXA 3WO4B 3HS0C 1QFUL 1QR1B 4OQ1A 4UOJA 1CLYH 1ZSDA 2DB8A 1CGWA 1NUNB 3O11A 3Q6GH 3S35L 1XEUA 3FN9A 3DTDA 5J8OA 3BIKA 4OZIA 1S7TB 4AGQA 1IC5L 3GXPA 4M4RB 5EORH 1F1AA 4A6YL 2BSTB 5L88L 3OKMB 3V5KA 2AXJA 3TA4D 2R4SH 2FQFA 4ACPA 1KPUB 4LFHG 1TTBA 5IBUB 1ZPLA 2UZYB 5JZ7D 5KBDA 4JFVA 4PJBB 2F6AA 3ZYIA 1A6ZB 1RULH 2AGPA 5FA4A 3HB3C 4LSPL 2EYTA 3VVVA 1X7QA 1M2VB 1HINL 3MVSA 3I3BA 4FNLL 3NSXA 3T77A 1EJOL 3NIGE 1DV2A 1I7RA 5TQ0L 4O9HL 1KNOA 2JB6A 3BW9A 4X50A 5LBVA 2X4SB 2R39A 2NY7L 1KBVA 4NFCA 3VXTB 4FS0A 2OQJB 1GAFH 1XF3A 2GSIA 3L5XL 4L1TA 5B1KA 4R2GD 3GJFH 4Y4KA 1ADQL 5HHMD 4ZHQF 1DHKA 3JTTB 4KI5D 4U7SA 3UJTL 4FC3E 3SGKA 2YRLA 3BCDA 5CKGA 2YS7A 3ARRA 5HXMA 2VABA 4J2QA 4MVBC 4RFEB 4P9HH 4A2LA 1YAZA 4EFEA 5BW7A 2EE3A 4BZ1A 5LO7A 4GP5B 4MX7B 4HWEL 4O02L 3LP8A 5CU9A 5F3BA 3GTMA 1Z1WA 3BG5A 4ELMF 3QIUC 5C0CB 1AKJB 1KDJA 1YSOA 3LKSA 2Q86B 5J13C 3EJUA 4EVNA 2VOTA 3G6JF 1IJNA 3IU3B 4RH4A 4OJAA 5GIRA 4KNSA 4G59C 3WUWB 3BWAA 4PVMA 2NY3C 1A1NB 2YKLL 2VR7A 2G2RB 1E6JL 1BVOA 1HHIA 3EJZC 3RWHB 1CGUA 4EN3C 4M93B 2ATKB 4DUVA 4OAWA 2AQ4A 3SKOB 2O5NA 1FVCB 4BZYA 4YDKH 3GLDA 1AHWC 3ZTNL 3L95A 2WTOA 4KGJA 4MJ6A 5F6IB 4OI8A 1UM4H 2DKMA 5A3IC 1T36A 4YO0A 2VQUA 1G7QA 3HLKA 3OAWA 3W9EA 3JYBA 2F53A 5GJTL 3UTPE 4M7LT 3KEHA 3IJEB 1IC0A 4ZQKA 5A6IA 2XCAA 3Q0HA 4M1GL 2XACC 2JA7G 3GQCA 1UM6H 2Z8WC 5KS9B 3FSVA 4ZPTA 3PNRB 3ZKMC 2CPUA 2JTDA 5TE6L 1KTKE 4HFWB 1Z3GH 4JCMA 4RA3A 4ED7A 4I9WE 2V4QA 5KYUB 1BQ5A 2NNAB 1L7TL 3HZVB 1TR7A 4JY4A 4MD5A 3K6DA 2IGFH 4ME6A 3X13A 5E6IA 3FU8A 1LEKB 4Z7OB 3P9LB 1BZ9A 3PDDA 3VXPB 2B0SH 1B6RA 1TQWA 4QYOA 3R7QA 1MI5E 2FBJH 1XSIA 4KQ4L 4UIMB 3V0WH 4A7SA 4L18A 5IHBA 5HDBF 2V4LA 4XP9L 3UMNA 3PL6D 4TLUA 5DFAA 4WQOA 1TQUA 2R0LH 4BGDA 5EF3A 3I50L 1QYGH 2VW4A 3M86A 5JZ7C 4JFXB 4TUUA 4NQVA 1NBYB 2Z0BA 1PYWA 4WTZG 5F9WC 1G7LB 4AEIL 2DLIA 3LZPA 3SYAA 1C7TA 1QBLH 5KJRL 2PP9A 1OCWL 1I7TB 2D8KA 1SF5A 4MRCA 3DXAA 3LV3B 3PV6B 1XVSA 1I1AA 4HU2A 1A25A 4O3QA 5KFEA 4G8IA 2YZ1A 4ZBJA 1P4LA 5EWFA 3IDGB 2VE6B 4WTWA 1LWJA 5FF6A 1HH9A 4JG9A 4WTXA 3BC9A 5T3ZE 4I4WB 4R2GC 1YJDH 3W2DL 2MCAA 1JAEA 3BRDA 4KI5C 3QJZA 5DD1H 2GCYB 2UVWA 3FQRA 3KJ4C 4BQ6A 1XH3A 4HUVA 2DKSA 3BH4A 5KKNB 1T21B 2BM3A 2UY7B 1JHKL 5GGVL 4AENA 4QXUL 3DX6B 4WHYG 1TETH 3A24A 1HZHL 1DSYA 3OZLA 4P2OB 5EBGA 3C9NB 1UD6A 4X5XB 5T3XL 3WMPA 2DYPD 5I66A 1DN0B 5DFTA 3FO0H 1UWEL 5JORA 4OFPA 2B20A 2GW5A 3WAKA 4I0PB 4JDTH 2YMOA 3C5ZB 3PGFH 4ZFGL 3HI6H 1UT9A 4RB1A 1FAIL 2R4RH 2XPGB 4NUJA 4TQEL 4IR1A 3EH4B 3O4LA 4LOEA 3B7TA 4O4YL 4N68A 4N90D 4BHUA 5IB3B 4J9LA 1U95A 3L3IA 3CFEB 2DZDA 1RYSA 1BZOA 3T2NH 5JOFB 5D70L 1V5JA 3WGUB 1B4JH 4U7CA 2FH8A 1IAIH 4QEGA 3O2WH 4HH8A 3IKCB 4QRUA 4OD2A 5BMVF 1NAKH 2O61B 5C09B 3T5KA 3ARED 4XVOA 2HKAA 4F3FB 2AAVA 1IBFA 2F9BT 4BM7A 3HNSH 3B9EA 1IBYA 3FO1A 4ONGH 3T04D 5IFJA 3IDUA 3V6HA 2K6YA 4IDJL 2ICWA 4H0GA 3O0RL 4XMUA 3QG6A 1ZHNB 2ENSA 5DRXA 1JZ2A 3BT0A 3ASOB 4HGWA 5L1JA 1F58L 4LF6H 4RCAA 2JEFA 1VFOA 1HEZB 2DQGH 1LL1A 3HUJF 3PXLA 2LU3A 5C2BL 4H8HA 2FGZA 3FS9A 1NC2A 4N2FA 2BNUA 5CGMA 4Z7IA 1FSKB 1Z6JT 4P49A 5JPNB 2BERA 3ECUA 4AC2A 4AK1A 3UTTD 3NQIA 4OM1H 5JIKA 2BHYA 1R5WA 2R2BB 3PL6C 4I8DA 2IQ9L 3JZIA 4JZNA 2AV7B 1KTJA 1OB1A 3NIDF 3TYFA 5F1NA 3NIGB 2NU9B 4PAZA 5IQ9A 3CDZA 4N22A 5F9OL 5KANI 4RRPA 1MLBA 3CX5K 4JPKH 1MZYA 4U3SB 1OF0A 1NC4B 4R8WL 3R06B 3GLKA 4J9KA 5BOPA 1QOKA 3CN4A 1NLBH 3F84A 4LDOB 2FGWH 2WBXA 2VIRB 1EFXB 1DZBA 1VCAA 2D9CA 2VXUH 3U79A 1CDHA 3SQRA 2RD0A 2VR8A 3FB5A 4L8SC 1ZSHA 3D3VE 4UU9B 2H1PL 4DZBB 2KLSA 3QDJB 4JFHE 4F4XA 2XWCA 1JHTB 4FXGB 3U30C 1N8OE 1NOAA 1JRHI 4PJEF 5AOZA 1CBJA 5DS8B 1PJWA 3QK0A 3F12A 4KGLA 1ROWA 4OGAD 1GHFL 1LYQA 2APXA 3QZLA 3HBQA 1YYCA 1TCMA 1ZLDA 1A0QL 4KRMB 1LD9B 3VWKD 1IOVA 2X4OA 3CVBA 1HQRB 2HLEB 4RU9A 1OANA 4GJTB 5EU6D 1VKXA 2A6DB 2YXWA 4Q8EA 2DM3A 3N41B 2P8LB 4R4FL 3Q3GA 1H6EA 1KENH 4N25A 4XNAA 3RL1A 1MVYA 1SYSA 1YMMD 3NFNA 4K3DL 3T4YA 4YHYC 5I8CB 2X0WA 2ZXEB 1BD2D 3HPJB 1X9UA 3G9VA 2HKHH 3WOVA 1K8IA 3QJQB 3NCCB 4MLSA 4PJAE 4AEHH 1J48A 4P2YA 2WTRA 2YOCA 2FLMA 4E41A 2OBGA 3STZA 4A3KG 4LIQL 2A6IA 2XD4A 3AREC 1AJ7H 1KFAH 4JHUA 4EMZA 2PYED 3QS2A 1JD7A 4MAYC 4KTYA 4ENED 3WNNA 4LAQL 4IOSA 3E80A 3WFDH 4PGZA 1E3FA 1B2WH 1BQSA 4UANA 4C5AA 2AQ3A 2EIEA 5AAWC 4X5RA 5I0VA 4E0RB 3LRKA 1SJHA 4XB8A 4F8TA 4CL7A 2OW6A 2UZXA 1J5HA 3ZZLA 5LNDA 1XDTT 3DX3A 3KR3H 4MHHI 2IAND 2QLYA 1ZGLM 1XIWA 4Y1AD 1OGSA 4QI3A 5JDSA 4MSWA 1G5GA 3APMA 1D5BA 4GYBA 3BUQA 5C3EG 4HEME 3RB0A 2F7OA 3KNBB 3J7HA 3FH5A 5BVPH 3NZHL 1TTUA 4HSCX 3ZYZA 4LVHB 4FDWA 4W4NA 5E51A 3DIDA 2CHXA 1CDJA 2VXQH 3MRLA 5EZIH 5LXTF 5F97E 2ESVE 2NX5A 5B39A 4J9SA 1DVUA 5EOTA 1TWAA 3EJRA 5FK9B 1WAPA 4GO6B 5DHMC 1R3JA 5CEZL 2V9UA 3KYAA 3C87A 4R96A 3EYSH 3ARVA 4YSUA 3E38A 2ZDHA 4EI0A 1CCZA 3RTQD 5GGRA 4ZFOB 4MZ2A 4XMPL 2G3MA 4U1HA 5C7XH 1WWAX 3SDCA 5HHPA 4OY9A 5TE7L 3S96B 4U0RB 3H42L 2ZX7A 1XCWA 4O2AF 5HYJB 4GXVH 4ZFOL 5FECA 3OWEA 5DGBA 4UMSA 1D5ZA 3VSVA 1T1XB 2G3XA 4BA0A 4TUJB 2NW3B 2OYLA 5MEQA 1BIIA 4AYFB 1SYXB 4NN6B 3HB9A 2Q3XA 3QUKA 4YFDB 5D6DA 3ES6B 3VQMA 2C9UA 4IAJA 2GITA 3ENEA 3NSFA 4JM2F 5ITFA 4OGAC 2MNUA 1IGIH 2IPKA 1HHGB 2QSVA 3ULVF 1Q0EA 2HP4A 4XP6H 2YA1A 3GI8L 4BZ2A 1NM9A 5CINL 3VWKC 4PYHA 5JHMA 1L0QA 1ZXQA 3TIEB 1CG9B 2EDXA 4K0OA 4NOBA 1ZDQA 1KLGA 4S2SB 4A55A 2CJSA 1CXFA 1S2EA 1EK3A 1F2XK 4N20A 3SHSA 2X3BA 2YU9A 3UO1L 1FV1A 2D31A 3BQ0A 2PP7A 4GG6F 1JGEA 5FM4A 1LK3H 1CMOA 3ARFD 5HYSA 4BFBD 1JIBA 4R26H 2H0EA 4YXKL 1YN7B 3HAEG 2C2EA 4B7LA 3K3VA 2JA5G 2B3IA 5KYYA 4M1DL 4LU5L 1KGXA 1CGSH 4EIGB 1K8DA 1PJ9A 4FYTA 2PF6A 3QJOA 4XVUD 2ZOKB 1AMXA 5CWSB 3BGMA 1N8ZA 4HKZA 3BJYA 4MMXC 5KFRA 5DHDA 1CF1A 1I9JH 1LNUA 4ENEC 4ZSOE 4YXLL 1AANA 2V8LA 4WCYL 5EU7C 3VE0B 2CQYA 2V9QA 3CHQA 1DBBH 3FB8A 3UTPD 35C8H 2EQDA 4ED1A 1QTSA 1X5FA 3B2XA 1M9WA 3P2BA 2FECL 3CDFA 4ICXA 2C8NA 3OKYA 4I9WD 3T4AB 3AM8C 3HBLA 1X5AA 2BSBA 3WJLC 2XWEA 3SEPA 4HHWA 4KZ0A 5H80A 4OB5H 2NXZB 1J5OH 5IW1A 4MA5A 4WV1C 2NMSA 4DFIA 4WSJA 3PP3K 2EDLA 4EDXB 4ZNEE 4JKKA 2NVYA 1S03G 3Q8RB 1NM4A 1MI5D 4NN5B 2AEWA 2YSTA 5E9DE 4MJIE 1QHPA 3BD4A 5EZYF 1MCKA 1B0RB 1OAXH 4N8VG 4PUBL 2D4FA 1EUCB 3D3VB 4LKCA 4WHTB 1XF2B 5CU5A 2HX9A 2W7OA 3TBSB 3BRFA 1XBDA 3HNVL 2H41A 4YE4L 1L9MA 1A7RL 1ID2A 3EXLA 2JCWA 1YPZB 1KTCA 3RTQC 1Q0XL 4B3TH 1RSYA 1K1QA 1W8OA 4GB9A 3SPJA 1U3YA 2HMID 1B4RA 3SCMD 4HG4K 3MV7D 3WELA 1P2CA 4BE5A 1KCVH 2XWBA 5B1JC 1FFPA 3WO0A 4P5KB 5K9OB 3VFGL 3ZU8A 3CX5J 4S0SD 2ZXQA 5ADPL 1G7IA 5KAQF 2R1XA 3WEAA 2PN5A 1NCWH 3FO2A 5T3ZD 2VN6A 1CQIB 2AMGA 1XB8A 4TTDD 5FOBA 1AGDB 4L9LB 1ZPUA 3Q8AA 4U1GB 2WINA 3R4RA 1O6TA 2VXVH 4M62L 3WHXB 2E56A 1D5MB 3S8GB 2ITCA 3Q48A 3QNYB 4LVOC 2DWEB 2AEQH 2BWQA 4UQ2B 4M7KL 1CYWA 4PTUB 4QGTA 3N40F 1WC7A 2KLTA 5CHNA 2HGSA 4NO2B 5ANMA 4M6OL 2GY5A 3AS2A 3ARFC 1CXIA 3MR9A 1XH0A 2W0LA 3KPSB 3VXSE 4BH7A 1AQDA 3GK8H 2H3NA 1BEYL 2Y7QA 5H37H 1EHIA 4XVUC 5KFPA 1RSFA 3OKDB 1MCWM 4JRFA 1TYEB 5ESVB 3IB4A 2FO4B 3WJJA 4LLUA 5HJGA 2DW5A 4WBNF 3EDDA 4MA3B 3SGEH 1A6WL 1CE1H 3QXUA 3S3PA 3UYOD 3V6ZB 5E2UH 1DQLL 1MFVA 5D5MA 4XNUH 2KYIA 4PLJD 4H26B 4IM8A 1HSBB 4BCZA 1SOXA 2Z9TA 4S0HA 2O6FA 1ULZA 3GIKA 3EJTA 3AS1A 3ZDYB 2IOOA 1C12B 4Y2DA 4RX4A 4XZ4A 1CICD 4JKMA 4PH8A 1NOFA 3GHBH 1DSFL 4K7PH 2ZXGA 4F7EB 1TAEA 3BYYA 4Y8AA 2EEXA 2X09A 2YWZA 2VH5H 1XF1A 1GGBH 3A4DA 2VJ8A 4JV5H 2GABA 2YLHA 1RZ7H 1JZHA 5LKNA 4FOMA 1HNWH 2WUBH 1AMYA 1J9SA 1MFBH 2RQEA 4HH9B 4J6IA 4XCNB 4EEYA 3FH7A 3WUZA 1DVZA 3UXFA 4C4KT 5KW9L 5LNGA 4X7DC 4LCWB 4C55A 5IFHL 2F68X 1NEZB 2A77L 2NY5H 2V5YA 3MCG1 4HFUH 5J5EA 4UNTA 3ILEA 4MTDA 1WT5C 5GJSH 2R82A 2YPLA 1INDL 2XIGA 3VFWA 3CVHA 1AQKL 4UDUB 3P3SA 3JV0A 4AQZA 5ESAA 1GJWA 3RJOA 3LQAC 3P4MA 5DQJA 4JDEB 1S9KC 3HZKA 3MLYL 4LLWA 3ZR6A 2HMIC 3HFFA 3RUGE 3SCMC 3TNMA 2ADJA 3QDAA 5EU3A 4A2HA 3RPBA 2XSKA 4G6KL 1T04A 5HJ3A 4DR5H 2ZAGA 5EV7A 2VUMA 4I5BA 1I9RL 1YNTA 2DMBA 3GMNA 2X3CA 2WO4A 4NUGL 4UF7C 4FFVD 3QWOA 4KV5F 4JFHD 4N2EA 4OFKA 4FHBD 5JIIA 5KSBF 4YHMH 3D25A 4PSPA 4TTDC 3IMWA 2EDKA 4MA8L 4OKVA 4UQIM 4Y4FB 1FH5H 1U8PA 2X3AA 5LG6A 1Z2OX 4EG0A 1UCBH 2CR6A 3AY4A 3IFLL 5F2FA 2CJTA 4W9HC 4YPJA 3PQYA 4KX9A 4JGNA 4OCSL 4QXTB 3HG0A 4ATWA 5IYBG 4MMZB 4ZQIA 1B0GB 1N7ML 1UADC 4XXDA 4DHLA 3HE6B 5IVXE 1R34A 2B2XH 2JKTM 4DKEH 4PQXA 1QLFA 2YQ2A 3MV11 3OJDA 4MRBA 5FYLL 2VZUA 2FB4H 4UM9D 4YXHH 4FNRA 2OZ4H 3RWCA 2FIKA 1FIGH 3P4OB 5FUOL 2F7QA 1KLFB 4MHHG 1AAJA 2UUCH 1Q72L 4ECXA 1MWAA 3BKJL 1XCQA 1Q9WA 1A3ZA 2QVIA 4M48L 1RUAH 2FK2A 4PMEA 3RX5A 5DJCB 1MHPH 4ETQB 5C0RH 4RQQA 2CBOA 1EAPB 3V0DA 1HXMB 3IPFA 3NOIA 5JOPE 2DPKA 4A7VA 4L1BA 3F8NA 4P2QA 4BFIB 3ME0A 4PLJC 5F8QC 2WBWB 3QHZL 1EVTC 2J55A 1FNGA 3HVDA 2ZKMX 1T1WA 4LPUA 2KL6A 3MCKA 4K23H 3RZCD 4B3VA 4GS7C 1CICC 4QKTA 3C8KA 4IU3B 3JZ7A 2LABA 3IPEA 4I77H 4B0MB 1A9VA 3SE8L 5DLMH 2NQ3A 4YC2B 3KAKA 1HL8A 3X1EA 5PCYA 1LGVA 1NLDH 4HSQA 3RGVB 1P7KB 2ICWJ 3QQ4A 4XWGH 3X12A 2A5UA 3FTVA 3LPFA 4LBEB 1MXGA 2NR6A 4X7SL 3U36B 5ELIA 1WTLA 1UZ6F 5D9SA 4OI7A 3QJRB 4R9HA 1QNZL 4RB2C 5D6CB 2WWKT 2BDNL 1QW9A 3FMGL 2CXGA 1MHHA 1TZOA 1SFOA 5L7XL 3K3PA 1G7PA 3O4OC 1IGML 3UZEC 3GPEA 4H1LA 2ESVD 3GS7A 1RVFL 3MLVH 5K9QG 5EBMB 2ENPA 4Z8FH 5CD5D 4AYEC 5E8EB 3NZUA 1T7VA 3F7KA 4F37F 1FUNA 5HI5D 4AH2A 1HKLL 3ARDD 5D55A 3A3YB 1AGFB 4PRIA 1COBA 1MKFA 4KKAD 2HFGH 4L05A 1BXVA 2BIPA 4MWFB 5D7IF 4YHLH 3DX8B 4FFVC 3RV4A 1FJGH 5BUGA 1IQWH 2F58L 4ODVH 2AQ1A 4I3RL 1J1OH 1IEAB 2WNKA 2FX8H 4U2ZA 1VADB 2F53E 2IJ0C 2ARJQ 4UQCA 4YR6B 1TJHH 1BQLL 3LNHA 3QO1B 4PGCB 3VQ2C 4OBSA 5BO0D 2W95A 3LTVA 2CO7B 4IK7A 4HG4J 3TEUA 2QSQA 4ALAC 1HTYA 1MUJA 4QRRA 2E6JA 3D06A 4NQUA 3N1FC 3PNWB 2ZG3A 2CA3A 4KHXL 3HMWH 4PJBF 5CUSH 1TVDA 1AQ8A 3Q2OA 4DGWC 4TV8F 1CFSA 1VGKA 4M6NH 1B4TA 3LNEA 3AITA 2V17L 4F2EA 2FEDD 1GYAA 1ZHBB 4FI8A 4H5SB 3V4PL 2MTAA 1GGIL 2VLRA 4YFLF 4PRBB 2CNZA 4JRXB 4WTQA 1RMFL 2YEZA 5F0JB 3NYKA 2R69H 4GG8A 2UV3A 3RIZA 1S9VA 1UFUA 4UV7L 4OSUH 5EO9B 3WFHA 1DVTA 1IAMA 1MCBA 4OCXL 4X6DA 5H2BB 1JXLA 1HJCA 1MPAL 3AT0A 2ZAIA 3RHWF 2XWTB 4YHIB 1CXKA 1CT8B 3MOBL 3U1SH 4Z7UA 3NACH 5FGCE 3SZ6A 1F45A 2ZCKL 3S88L 3VYPA 3X3GH 3NN8B 2WJ5A 3DXAE 1XNQH 1I3RB 2VDRH 5IB1B 1QBML 2W65A 1VHPA 4GC6A 3RZCC 5KBNC 3HI1B 2WOBA 1KLUB 5AVSB 2AHIA 4FXLA 2ISDA 5E2TL 3UL4A 1XR8A 1Y14B 5AVWB 2W6ZA 1OLLA 2A9AA 4XNZB 4KKRA 1L7IH 1P7QB 4TVUA 4X42A 2XCMC 3C5XA 3VCLA 1FRGL 2X44D 1IM3D 2X6UA 4CU7A 2GJ6A 4F7MA 4I7HA 5TDPA 3MUGB 1D6EA 4QD2E 5ICXB 5TDOB 4FQXB 4GW5A 4UOW1 4G43A 4WJKB 5AG9A 1MQKH 2JE8A 3S3DB 4E9SA 1RAMA 2V2WB 2FHCA 2DQHH 1EAOA 2VLME 4LOFA 3VXOA 4DTGH 3MWDA 3RGZA 4Q8FA 3D0VA 3H9HB 4MAUL 1A7PL 2NZIA 2NY6D 4XVTH 3DJRA 5E9DD 1T7YA 3Q5OA 2YC1B 3GSNA 4GW4A 4MJID 5DJDB 1FORH 4RIRB 2XETA 4PJ7A 4NQTA 1E5YA 1AGEB 1XSKA 1ZTMA 2ZG2A 4FHKA 4HDIA 3HLAA 4UT7H 5CN1A 5TK2A 1EHNA 2EIZA 4I1NB 4LXFA 3APDA 4FFZA 4G42B 5CD5C 3VJ6A 1FFOB 1TFHA 3BT2L 1ADWA 5HI5C 2QFRA 3ARDC 4GQQA 1IT9L 1Y18B 4LASH 2JK5A 1L0PA 3L3JB 4KKAC 4HJGB 1HAUA 4UILL 5A2LH 4J3UA 3FUJA 3S37X 4LBAA 4P4RB 2ZPKH 2W88A 1BVNT 2F5AL 4IMLA 2JCCA 3MRNA 4X7FC 3GTTA 4UQ3A 1CR9L 1F6LL 1AG0A 3P1VA 4HT1L 3NA9L 4Z7WA 1JL8A 5ALBH 1CF8L 4YZFF 2VR4A 1SBSH 4Q9RL 1TJMA 4PR5A 3FUFA 4NQDB 5GRUH 2FNWA 3BIKB 4OZIB 3UTOA 2E2HA 1F3JA 3NRPA 3JV6A 3D4YA 4OQTA 4MA7L 3B2VL 4ES8A 5J1AA 1SF3A 3L7EB 5SWZA 1IARB 2HT4D 4PS8A 1SJVA 5EN3A 1KZQA 4LSPH 4KRLB 4MA1C 3VFVA 2J7LA 4ABWA 2QR0B 1HINH 2CLRA 5JDJA 3QUYA 5HHOA 5HVFB 2VDPL 1F41A 3ARXA 2DYRB 4XE5B 3KXFB 4KRNA 5FA4B 5JLZA 1XH1A 1K5WA 3MBEB 2V7NA 2FEDC 1M56B 4JDZA 4XVJL 3WO3B 4LMQE 4AYBA 5I6LA 5J6GA 3TV3H 1JTTA 1LDPL 3VXSD 4GSDL 3WTXA 2DMKA 2Y07H 2VSKB 3MRGA 2ILLA 4GUOA 1BX2A 4G8EB 1I7RB 4ESKA 2GB2A 4RNRA 4BY1G 4RBPH 1QLEL 2IPTL 5DUJA 4JO8A 3CFQA 5E8PB 2IXQA 2WGNB 3QAZB 2VCOA 1XF3B 2GSIB 4E9QA 3QCVL 4Y4KB 4P3WA 3T2OA 2CIKA 3PPSA 2M05A 4X8GA 2J6UA 2IDCA 4JRYA 3KMDA 1RUQH 2I85A 3ZHFA 4QHKI 4AEEA 5INDA 3RU8L 2KDYA 4JFDA 3J8F7 1HCVA 3SKJL 3OZKA 1OSPH 1LEIA 5IWAH 4J8RA 2RF4A 2PPDA 1JK9B 4JLRB 5C3TA 3BWUC 5KFKA 4KK6D 3Q1SL 4XX0B 4KMQA 3J81W 2H4EA 3GIMA 2YD8A 3IJSA 4FCHA 4UDTA 4NNXB 3QNZA 3TJEH 4EVNB 4ZOCA 5DLGA 4LF4H 2W8CA 3TEYA 1EJ6A 3D50A 1X5ZA 3BWAB 4M8QA 5DC0A 5BMFH 5DC2A 3GTNA 1HHIB 1KGJA 4JNXA 1CBVH 3BKMH 4JG1H 1J87A 3K72B 5FYJH 5GJTH 4OAWB 2WB1A 3RFZA 4DR3H 3L4TA 4NIYE 1NGQL 4G3YH 5F0MB 3PAUA 4YO0B 1G7QB 1TJGL 1O9ZA 1P8LA 3W9EB 2V5TA 3LS5L 3SPCA 2FZ3A 4JHAH 2B16A 4D3CL 4ZQKB 3K4DA 3QUHA 3UEZA 4ANWA 4DW2L 1NFDA 1SEQH 3VI4B 5DK2B 4J9MA 4A2FA 2WDTA 4DL3A 1UJ3C 3R1GH 4ZPTB 5ID1A 1GRWA 2ZE0A 1R9TA 3CZSA 3RA7L 4E41E 3WTTA 3O8XD 3ML8A 5IKCA 4JY4B 4HWUA 4KUZL 4RGOL 4U33A 4UT6A 1N3NA 2AV1A 1ZEAL 4U1NA 3TT3H 2X2JA 1VAHA 4GRWB 1Z9LA 1SVBA 4ZMXA 4Q52A 1DVFD 4JHVA 2C28A 1QI4A 1U8CA 1JGLH 2HT4C 1LO2H 1INQB 2DQFA 1VBGA 2RALA 3NIGF 1ZVYA 5E4EB 2UU9H 4K71C 4W9DC 1EZ1A 4M8UA 3ROOA 3MI6A 2NUTB 4TM9A 2WBJA 2XWRA 3VMNA 4JY5H 4W9KC 4OLXL 1UYWL 5EZOL 4RFNB 4YR2A 2WIIA 5DGAA 2OTPA 3I6LD 4IRZH 2D3JA 3RDTA 1RUPL 1I1FB 4FX5A 1HL4A 3EZ8A 3EKCA 2YFOA 1ZA6B 1JYVA 3ECWA 3SDDD 3TONA 1BQKA 1BZ8A 2NX5E 1V10A 2AQPA 1SHWA 2KKQA 4FQ2L 4DEPC 2J1KA 5FF6B 1HH9B 5FLVA 4DZ8A 1N6UA 2ALAA 4FA6A 5BZXA 4CMMB 2WE6A 4QXUH 3MBXH 4X5LA 5KVEL 3CMOL 3MRFB 1W9XA 3QNXA 1AHKA 3SE9L 1KN2L 1EEZA 1M6OA 2QMKA 3FQRB 4EOWL 3I75A 4HUVB 2AVFA 1Y0LA 3DMMA 3SN6N 4AENB 2CK0L 5T3XH 1EANA 1S7UA 2GUOB 2O1AA 1WZAA 4Q43A 4KK6C 4XXWC 1VFUA 1NL0H 1P7HL 1VACB 4MQTB 5BZWA 2OSYA 1IIIA 3RB4A 3VXME 2OI9C 2K78A 1NANI 2IWGA 3N41F 2EH7H 5BS0B 5I66B 2C35B 1JGUL 5JORB 4KTDH 3BQ1A 1D7FA 1JJUA 2AJUH 4N28A 3UC0H 4U1IA 1A2YA 3O4LB 1MELA 5AYUH 4GAJH 2HJFA 2WLLA 5E6UB 1U95B 4AIXA 4DP5X 4GY4A 1TLMA 3GXNA 4I50F 2J57A 2XQBL 4GXUN 3HI5L 2UVUA 3Q8QB 3DURB 2OJ1A 2F1BA 1AQMA 4F8LA 2XY1A 5I0ZA 3GRWH 3LZQA 4NOFA 5KVDH 1T6BX 3FO1B 9PCYA 4RDQF 4N87A 1GYCA 2X9XA 1IEBA 3A6CL 4QAMB 5I6OA 3QG6B 1U2CA 3O8XC 2ZCLH 3F5WB 4S1SH 5DRXB 5D1ZD 5MERA 3LMJH 4HGWB 5EWIL 1BGXH 3GNML 1P4UA 5GRWA 2V9RA 5I76A 5T5NF 4L8BA 3WNPA 1YEJL 4BKTC 5DQGA 1R3HA 5M94B 2F53D 1GPOL 5D2LA 3F7PC 2BNUB 4OZ4A 4Q89A 3MUHL 1D5XA 5AW4B 2CWRA 3IDMB 3UYRL 5C9JB 1HCZA 1DBJL 1NIAA 1DVFC 1XB3A 4PW9A 4YX2L 4UTBH 1R5WB 5AG8A 4R8WH 4N2MA 3UJJL 1M4KA 3GMPA 1H3GA 5F1NB 5F3HB 2V37A 4PJ8A 1BJ1H 2GI0A 2MOGA 4IEFB 1IGYA 1UACH 4P9MH 1N10A 3SKUD 1MLBB 5IOKA 2LAAA 2CDEA 2J3SA 5E6ID 2DL9A 4OM0H 4P5MA 5IHUL 1TSRA 3PS6A 3CXDH 1IAOA 1JS4A 4GLRH 4ODSH 2QVKA 3EG9B 1NDMA 3MCYA 1IKFH 1J7VR 1JPSL 1G7HB 2AP2A 3FQWA 1PCSA 4NLAA 1ZK9A 3NK3A 3SDDC 5HP5A 1A7OL 3VMMA 4NWTH 5GS3A 2J5LB 3G5WA 4M6ML 4X80H 1RIVL 5CSBA 3D07A 5ANHA 1YVLA 2L04A 3QAQA 5CEYB 3QZ7A 3QJXA 4YBZB 2CO2A 2YO3A 3TVMA 2Z31B 4YSQA 2VJ0A 1CGYA 5G4MA 1WR2A 1KACB 2EUXA 4A93G 4DUZH 1BJMA 1HR0H 4MTEA 5KUKA 3DXAD 2J6TA 5TD4A 1I1AD 1XDNA 2E0PA 4E4TA 1UFGA 1YY8A 2WSDA 4R4FH 3RIAK 2C3VA 1QUNA 1T22B 2CHDA 3B1TA 3DGCR 1GCYA 3EGDA 5IROA 3ZPDA 4DN4L 1WH0A 3MLUH 5KOMC 4BA8A 3NCJH 5GRXG 1JPFA 4XZ3B 2WZ6A 4DR2H 4Y4KC 4EQ3A 3MRKA 1IIKA 2F74A 2J2ZA 2W38A 3RL1B 4PJGB 2UUBH 4JQIL 3NFNB 3HPLA 5KVGL 2D0GA 4G11A 3ZKQD 2IMWP 1IZKA 1MCQA 5BW7C 5IYDG 1A4KA 3OG4B 1TDQA 4HMEA 4LIQH 1BFOB 1NKRA 1MJJB 2Z0UA 2VLMD 3OHXB 3WNLA 2DQTL 1F4WL 1SDDB 3IJ9A 2W9BA 2EADA 4KNUA 3BGAA 1SN5A 2FJHA 2WTRB 4LVEA 4YDIL 2JKSA 1QABA 2M8XA 4JR9H 5ANME 3STZB 2VWEC 3CX2A 1HS6A 2PPEA 4NO0A 2I60H 1WIPA 3HN3A 1OP4A 1MW3A 2N0MA 4XPHL 1S7QA 5AVXB 3O9WA 2K7PA 4XWOD 3RLSA 3N1GC 1PZ5A 1TITA 2QTEA 4A7UA 5D1ZC 1Q8MA 1SJHB 3T1WA 5M7QA 2UZXB 3FFCA 3FQXA 4ZOAA 5DA0B 4DOHB 4EBEA 5J11B 5CJQL 4TVPH 2OMZA 4JZOA 1NCCL 3TTYA 2PABA 1EJFA 2O5ZH 4GQ9L 1ES0B 4G7RB 1PY4A 4XAWL 4E5XA 4RLDA 1NBZB 5I1EH 4XCYA 4M43H 5DJAA 5F7DA 3H9SA 4L4JA 3NAAH 4LRIA 4O3SA 4D8OA 5IQNA 1H6TA 5IYCG 1RCYA 4BBSG 2J56A 5JHDE 4XBPA 4LLVB 3L1OH 1KELL 3MRLB 3G5XA 3OG6B 1KCWA 2NX5B 5B39B 5E6IC 3RWJB 4WKZA 4KZCA 3KM1A 4PJFA 3H42H 1NC2D 3MDJA 1IB5A 1CTMA 1R3JB 2W91A 3PWUA 4R96B 1YPZF 1ZVHA 4TOYH 4RMRA 5CM1A 2AJ3B 2X41A 4OFYD 3SDCB 1EHKB 2C9SA 5L6YL 5F72S 3PF2A 5FECB 1HKFA 2KMWA 2UVVA 1D5ZB 5MEQB 3GKZA 5DO2D 2VR1A 1TU2B 4GXFA 4JI0H 4JPVL 1IBDA 4MD0B 4CBPA 3SJVB 1U8NA 1MCOH 2ZX8A 4G9DA 4PWJA 3WHE1 1ZHSA 4JI6H 1HCFX 2NRDA 1B9KA 2Y23A 5ITFB 2ZDQA 3P54A 3P4NA 4YBQD 1BFSA 4EF3A 5DLLA 1I1AC 2IPKB 3QORD 5E4IA 3GMRA 4XNYH 4ZAKB 4YS4A 3ETBF 3U2SA 4ZI7F 3L17A 1C1EL 1C5DB 5HDOA 2EIMB 4TTGA 2YXFA 4ZUTA 5IJKA 5L2KB 4IS6A 1BAGA 1E6OH 3IFOA 1WE5A 3ARGD 3VFPA 1J1XL 2NY4B 2AQ2A 1FV1B 2D31B 1WCBA 4JKPH 1DANU 3C2SA 1JGEB 5HYSB 3KH4A 3NGBC 4OJCA 2GTWB 4KU1A 1NIEA 5CAEB 4N8VA 5KYYB 4PW4A 2VDLB 3JT0A 4DQOL 1PSKH 4BCYA 2FX9H 1G1CA 5JO5A 3VFSA 2K3HA 3V6KA 3BH9A 3F58H 4IWXA 3JWNG 3NJLA 1Z9PA 2ZNWA 4JPWL 4MNQA 4U6VH 2XN1A 4I2XE 3GTGA 1E9OA 3N2JA 4OFVA 1A1OA 1LNUB 3GLEA 1LDSA 3HTLX 4OGYL 4TNEA 2CZNA 3RL2B 2VPSA 3MNVA 3BN9D 2YZ8A 3FB8B 2MCPH 4XWOC 3VRJA 4KZEH 1JWUB 4A7GA 4E9YA 1ZA3B 3ULSB 5I1IL 1QFWL 4NQEA 1OAYL 4JB9L 3A6OA 3VFOA 3NJNA 3R0NA 5LG1A 2IMNA 2TSAA 5IJVA 3CBKB 1E5CA 4DIXA 3V8OA 2F8OA 3ELQA 1A7QL 3RE0A 4BUHA 2E59A 4P2QE 4IOSD 3LHPH 5BZDB 4OZGE 3B2PA 3WGVB 4ENZA 4F91B 3OL2A 5FWQA 2A6JA 1A7RH 4KH2A 4HPHA 1PS3A 3QQ3B 1YEWA 4LKCB 4QRQA 4AQ8A 2J9GA 1XIWD 4LEEA 5LGHH 1LK2A 4EIBA 4X4YA 1QG3A 2Q7AA 3FQ4A 3RRQA 4QXGL 1VBHA 1YEIH 1A1MB 3IF1A 1EERB 2W94A 4JV1A 2WKOF 1MIMH 2WWOA 3FKUS 4KTEL 4MZIA 3E2HB 1RURL 3C75A 5DHXB 3L45A 5DO2C 3E6FA 4XNQB 3N44B 4IBZA 4NZDA 5IVZA 5A2AA 1NCDL 3SB3A 1U8JB 5LBSA 5DD0L 1G7IB 3FTYA 3CFDA 4QGYA 4DQAA 3FO2B 1ZD6A 4K7FA 3TA3D 1G0DA 4YBQC 2DD8L 1NDGA 3QEUA 5JIHA 5JHLH 5FOBB 2PO6A 3QZWA 3QORC 1ZANH 3BAEH 2WINB 3GDCA 3EJJX 1DUZB 3CVZA 1KIQA 2IO5A 2J1WA 3WN5A 1KSRA 2YAOA 3DIFB 2YFNA 3H7BB 3KPQB 1FO0A 3QUZA 5D1QA 5DJ2A 3O0LA 1WSST 3D4GA 3LHAA 2CO6B 1L0YA 3NFSL 5CP3H 3UEQA 4DNLA 3ARGC 1WFJA 2AEIT 2IF7A 4XPFL 3FRPA 4K3HA 1WC7B 5CHNB 5JHAA 1T20A 1XGUA 3VXMD 1WHOA 4NHUA 1TLKA 3H40A 1HWWA 2BVUA 1IUZA 2ZWNA 4U1LA 1RZ8A 4Q0YA 1RZFL 4J9PA 3CZEA 1QO3B 1IVTA 3LXCA 3LZNA 2Y7QB 1FA4A 4HXAH 4RGND 1FJ1A 5K33A 4WKXA 3TQTA 5JIPA 4QRRE 2BNQD 3O6ML 1G7JB 4X4MA 5E2JA 3GTPA 2EDWA 1DQLH 3ATDA 3BWUF 3CLFH 1AXTH 1IL1B 4LLUB 4N2BA 1MIEL 1MCPL 3BN9C 3I6KA 4OD3L 4IOIB 2GTZB 5L1KA 3NDZE 5D5MB 4IU2B 1DSFH 2VLRE 4JHZA 2HRGA 5KVFL 4G80A 5DJXA 2LTQC 5KFTA 1A6UL 4FULA 4K5MA 4NQSA 2R0KL 5DUMH 2FK3A 5K5YA 4Z6AT 2FATL 3M45A 1L9TA 4TMPA 4Z7UE 3DI3B 4EFBA 3L3GB 3ECBB 3S9DB 2JJSA 1M57B 1T0PB 3TZVA 2DWXA 3ZMRA 3VI3A 4C56A 2P5EE 5L2JA 2C9XA 1ZVSB 3DNKA 5IJDC 5LAXA 1WV7T 2IDFA 4ABQA 5D93B 2PR9A 2R2CA 4CKQA 1V3JA 4MYPA 1XIWC 1PZCA 4CVZA 2BIIA 5AFAA 2OPCA 2YPLB 5IR1A 4QRSB 2GJ6E 3CHOA 2YWYA 1SDYA 3VFWB 5BOJA 3FFDA 5L0QC 5ESAB 3ZKND 1RJZA 5D2NA 3ZDZE 1T03H 4LLWB 1AIFA 1DJGA 2FDBP 3TNMB 3CSGA 1KGYE 4UIKH 5EU3B 4Z95H 4IHOB 4TKWA 1T04B 4EZLA 4IRKA 4G7VH 3ETJA 4I5BB 4PJ7E 2NUPB 4HS6A 4UAHA 4F15C 1KTLB 4UZSA 1HEHC 1LM8V 1OGPA 2FUQA 4LHUA 3DO3A 3GSUA 4FQCH 4Y89A 3S5LB 1EFQA 4B9IA 2IH8A 4WW2C 3PWPE 3TA3C 4XPAL 12E8L 1BLIA 3D25B 4BSVA 2VSCA 2W59A 1VZIA 2CLZA 3GHPA 2Y7MA 4OKVB 4TSAL 1CDCA 1SLUA 1FZOB 4GW1A 3DGGB 1WBZB 2YN5A 3PQYB 1FVEB 3JZYA 3CAFA 3VQLA 4CKVX 5L1LA 3GJFA 1RP9A 3MA9H 3QDGE 2JCCE 5D6DC 4XXDB 5EZJB 3MWMA 2MPVA 4Z7WE 1QLFB 4Z78B 5EO0A 1ZLEA 3OJDB 2YK1H 4JO2L 4ZJ9A 3DKHA 1X5KA 4DV0H 3MUY1 1VA9A 1RZJC 5EU5A 4J3TA 2R29A 1MG2C 3VNYA 4RGNC 3CDYA 5F9DC 3ARYA 1XCQB 5SWZE 1OCOB 3OXSB 4H8QA 3NPSC 2FH6A 3NP4A 1K3IA 4APXA 4FI7A 4WU7A 5B1BB 1A4CA 4XB7A 5TDNA 2Q8AL 3LEXB 1SY6L 5HDQH 3U7YH 1OP5H 1RJRA 4MD4A 4RMBA 2VLLA 2DEXX 3DHUA 1H9DA 4AYBE 3ME0B 1VFMA 2XYBA 1JYXA 1NIFA 4W93A 4Z18A 4NJAH 3J7AK 4Q0XL 1T1WB 3MCKB 3KPRD 1WZKA 1BAFL 1TTAA 2LE9A 1LXMA 2W0FB 5DDHA 3WKNA 4BFKA 2R92A 2EEAA 4R7NA 1E42A 4UTAA 4HNTA 1B4LA 3N6YA 4KNTA 4IW4C 5AUMB 3F64A 4HS3A 4QF1A 5FGBA 1AXSA 4P2AA 4P4KA 4F58H 5EF2A 1QSFA 3PAVA 3M8OH 1HHJB 2BDNH 4JRYE 3P11L 3QQ4B 3X12B 3FMGH 5AB1A 1T0NB 3DTXA 4ABVA 5D9SB 5DEZA 4AMKL 1IGMH 5LJYH 4M7ZB 1XHHA 5KN5B 4Y2DD 2IALA 3RUGF 4L1SA 1CS6A 4RX4D 2F8XC 3WLWD 5JHDD 2Q8BH 3AUWB 2P48B 1UOLA 1HYRC 2AS5M 4C57C 4H1LB 1JXJA 2BY0A 5KZCB 4ZTPL 3MRDB 5I1LB 3T5WA 3RWDB 5CAYB 3TYGH 1O7VA 3ZKNC 2VNCA 2CDFB 4LO9A 4L4TE 4NXKA 1OT2A 4KKBD 4YBLC 3O2DH 3S6CA 1A9BA 3PREA 4FEIA 4ANKA 4EI5A 3VD4A 4PRIB 5FHAL 2ZJSL 5CILL 1YHPA 1C5BH 2Q87A 4AY0A 2WB1E 2V33A 1BQLH 2CH8A 4R83A 2ZSVA 2Z92A 2ROYA 2VLJA 4QTFA 4A2MA 3HVNA 2QADB 4N0CD 4ANVA 3VDCA 4WW1B 1NFDE 3CZLA 3SY0B 3MV7B 3LQAL 4Y5VA 4B9PA 2ZOWA 4Q44A 4A3MG 1UOKA 2Y7NA 4OZIF 2VUYA 4L1DA 4QIWA 4KHXH 5C08E 1CURA 5LXVA 2ZIDA 2DI8A 5IIEB 3MR3A 1Q4NX 4QRRB 1HNFA 2DLEA 5FC9A 3LAFA 1PU0A 4NQQA 3US9A 3VDBA 1VKZA 1MJ8L 5T3ZL 2HG5A 4AL8H 1CFSB 1VGKB 4BQ9A 1KT2A 2G5RA 3U1PA 2GEQA 1AZNA 3S4SA 1R24A 2FECI 2WQ8A 2EVJA 3C6LA 3E8UH 1UC8A 3CMGA 3QIBB 1OQOA 3WXVL 5EUKA 1M42A 3JWDC 4HWBH 4XHJD 4L4VA 4B5ZA 3WFHB 4IOFD 1IBZA 4X6DB 3DUUB 2NLJB 2WLYA 3M1CA 3TQ1A 3DV6A 5ETUB 5I47A 3GI9L 5KTEH 3NCFB 2WZAA 1GS6X 3KLHD 3HZMA 2VAAA 4N0UA 4U6YA 1QACA 4OV5A 4PJHB 1S4IA 1P1ZB 4P46D 5DJYA 2DWDB 4IBTA 4ZS7H 1OAUH 1UURA 1BBDL 1QSEA 4RAYA 1GZQA 4N2IA 5BO1L 1HOEA 3V7MA 2YARA 3O6FA 3VCLB 5JUEL 2VGLM 4CMHB 1R3LA 1XTLA 1NGZA 4W70A 2GJ6B 1D6EB 2ERJB 4P2QD 3A0OA 2C1PA 3TN0D 1IMHC 1XGPB 4GW5B 4G43B 4HHAA 2IGLA 3BPNB 3MRBA 4UV4H 1FFTB 2W57A 4Y2DC 4GNKB 5CZKA 3K71A 3D0VB 4JPSA 3WLWC 2VDOB 4KRPB 3EDKA 3MMEB 4GW4B 4BKSC 4GAAA 3OSNA 1FGNH 4JPQA 4PJ7B 4GSQA 2VDOL 3JVFC 2EIZB 2W9LA 4FD0A 4F27A 3MXVH 1IAIM 3ALPA 1OZUA 1CFMA 2Q20A 1FLRH 3QXWA 3SOBL 1EMTH 1HHHA 4KKBC 3WKQA 2RFXA 1MDAA 3AUVA 4HGMA 3G6XA 2NVXA 3RWGA 2GPWA 4LSRL 4S10A 2J6SA 4NWUL 4J6RL 3F6JA 3RILA 4CGTA 2WUCH 1EEUA 4LESA 1CFTB 2DJSA 4PHZA 3U9UB 1LHZA 2LHAA 3OPZH 5IESL 5LDUA 3I2CL 1I82A 4AGNA 2E47A 3HEIB 2RR3A 1CD9B 3MJ9A 3NK4A 2QVFB 3FT2A 3P77A 2YPVH 1EZVY 3K81A 3MRNB 4N0CC 5EIIG 1WCMA 4JAMA 1MFAL 4HCRA 3SIKA 2PWEA 3HG3A 1QHOA 3T08A 2FVNA 3ESVF 3LN4A 4HAFA 4PR5B 2E76C 3KVDD 1S97A 2BINA 3L7FB 1SOKA 3GJFK 4PPTA 3THMH 4QTIL 3PP4L 5ACZB 1UT1A 1GC1C 2GY7B 2H0FA 5FWRA 1WHPA 3IMUA 4DKDC 3D48R 4PV9A 1RZPA 3L8QA 1RUMH 6FABH 2V0AA 2Y4SA 4E9TA 2P49B 5E8DL 5C8JA 3VFVB 1N5YH 1DLFL 5BR8H 1A3QA 4DFHA 4HNVA 4NKIH 5BV7C 5D2LE 5HHOB 1W96A 3FBQA 1I85A 5JLZB 4AKPA 3AY4C 4QNPE 2FP4B 4E42B 5J6GB 4TQ8A 3S37L 2FHFA 4J3OD 4EIZC 2NNFA 3MRGB 4JI1H 2XG4A 4XHJC 1BX2B 1QP1A 1MZZA 3QCVH 4G2AA 4IOFC 4ALAL 1BIHA 1R33A 2CGRL 4RNRB 5EPMB 2E7BA 2XRAL 3INUL 2IXQB 2R8KA 4JN2B 1LE9B 4AQOA 5IHWA 3VXUD 4P23B 3KLHC 3EGSA 2CIKB 5GZNA 1GTNA 1FZMB 4XP5L 2DJMA 4GFTB 4NCC2 3L4JA 1KJ3H 1G4RA 4M5YH 2HJWA 1MCHA 4HIXH 4JFDB 4P46C 1DVSA 3AQXA 2VLRD 3G9AB 3K2UL 1LEIB 1BMWA 3KGSA 4HBCL 2CJUL 4CW1B 5A2JH 1I8MB 3NTCL 4NRZA 2AJZA 5FDWA 2AJYL 1TUPA 2VZOA 2Z7YA 3IJSB 3C5SB 4UINH 3TN0C 2QBWA 5D4JA 5I74C 2P5ED 3CGTA 2AJXL 1E50A 1MF2H 4UUJB 3AQZA 3GS4A 4PCKA 3TO4A 1R5VB 3VX0A 4ILDA 1RZKH 3ABMB 4PWGA 5EZLA 1MN4A 3PFUA 2W60A 1A0IA 3N9GL 2J8UA 1OCRB 5IOPB 3IXTB 1ZV5A 2D2OA 1NMBL 4HLZG 3I84A 4OR1A 3WEXB 2YJLA 1U3HA 2OXGA 1G5AA 3I85A 1V7NH 2VXQA 2GBTA 4N0YH 2CRZA 1NFDB 3NZ8A 3ZHLA 1KPVA 2QV2A 4R0LC 5I2IB 2YS6A 1JE6A 4UCUA 3EADA 3FJTA 4IJ3C 4ORGA 5DT1L 4NC1C 2XN2A 4G6JL 5CCKL 5FR3A 1V9PA 2B59B 2NSQA 2ZXAA 2W9EL 4EUPG 3DROB 1LMIA 4QTHB 5IB2A 1PIFA 4EDWH 1RUKH 6PCYA 1AZRA 1BQHA 3VYNA 3PWPD 1P4IL 1JFQH 2AV1B 1IGTA 2ZOLA 3VGGA 4GRWH 3UZVA 3ESPA 3RJQB 1F11B 3PIQA 3C2AL 3OLEA 1P6FA 2XFXA 1U3ZA 4H88L 3FFCE 3N0AA 1FE8H 5JQ6H 1S7XA 2KC0A 1U8CB 4OJFH 4RZKA 2DQFB 4NN7C 2SODB 1H0DB 3QDGD 2Y3AA 4WO4B 5L8KB 2EDDA 3HG1E 5JXAH 2PXYB 2A9NH 2XBDA 2RDIA 1RUPH 5C5JA 2DS4A 1T66D 1PX3A 2GJRA 3H9SE 3WXWH 4Q6IC 2G30A 4N8CL 4J3OC 2UXFA 3IDIA 1WBYA 4HK3N 3U4KA 1HL9A 2R27A 2XIIA 4PS4L 3QC6X 3RDTB 3ZKXC 1OW0C 3EFDL 4NNYA 4NUMA 3SE3A 2WAQA 3J80W 1W6LA 3MLSH 1FG2A 5SWZD 3SE9H 3PWNB 3ARPA 1KYOK 5DG8A 3BE1L 1Q0YL 3TO2A 3C08L 4Y4HA 5IW6B 1DL7H 4PJFE 5E99H 1D7CA 1EO5A 3QUYD 4A3DG 3UTSE 3WIIH 2IH1A 2L4OA 2QV4A 5F89A 3EPIA 3QNXB 5C8YF 3HRZB 3PZPA 5I5JA 1EEZB 3H0GG 5FPRA 2J44A 5JVDF 2CXKA 5EIQA 1CE6A 4BUGA 2XN9A 3BQVA 4XC1H 2PCFA 4K2UH 4ONFH 3O6LL 1JGUH 3K2KA 2IADA 2V3FA 4ODXB 3GV5B 7CGTA 3T5JA 1XCTA 2HT3D 1UD8A 3AAZB 5BZWB 2KLRA 4ECQA 3OSPA 1JN6A 1HVXA 2MQ3A 5CLWA 5IP7G 4Y2OA 2IAMB 1SLXA 2A4CA 1I9EA 3KPPA 4V2CB 1ETB1 2CUAA 2EUVA 5KJ7E 4GMSL 2DJUA 3VB8A 2R87A 4JRYD 1Z9OA 4P0DA 1CO1A 1PL3A 5HI4D 4M3HA 4U1IB 1U42A 4WEBL 1A2YB 4ETSA 3K8MA 2CO1A 5K1JA 2HJFB 2WLLB 3CTTA 3II1A 2COVD 2ICEA 3RTLA 1CDGA 4YQWA 1NGXA 1Q9KA 1BOGA 3TBYB 3GSRA 4EBQH 4ZZFA 2P46B 5CO1A 4HUNB 2KUTA 4L4TD 4W1TA 3IT8D 2NY6B 3EW3B 15C8L 3DGDA 1TQCC 4KO9A 3BKYH 2EDEA 5T5FL 1KGIA 3IS0X 3R19A 3T0EB 1D6VL 3MV01 5MERB 2DIJA 4ZXBA 3D8MA 4UZGA 5CN3A 1N0XH 1GPOH 5A7EA 5EWGA 3PVXA 1M9SA 2QQNL 1G7MA 4MNQE 4XOEA 5DTFB 5GGQL 6CGTA 1T5WA 3RWEB 5I76B 4L8BB 2K6WA 4ZNCD 1E28B 4DGVL 1XEDA 1PLBA 3CVIL 1ITCA 1R3HB 2VXTH 5E56A 5GS1B 4U1JA 2QMJA 1PMYA 4AYID 1NWPA 2OMUA 3D39B 1X5HA 2G60H 3PP3H 4NQEE 5AOLA 5AW0B 1JZ4A 4QJ4B 2AJSH 3OLIA 4MXVE 1F3DH 1W91A 1C16B 5F7KC 5C08D 3QP3A 1UGNA 3GMPB 5GZOD 1JF1B 3ML9A 1J11A 1YECH 3MLTA 3RPKA 2RACA 3RX8A 4FZ8H 4UFZA 3RV3A 2VQ1A 3QXVA 3QC5X 1T66C 4I18A 5DC4B 3V4UH 1IAOB 2I9LB 5F8RC 1NDMB 1A7OH 1VJSA 1X7TA 1WP6A 4IBSA 4L1KA 4Y16A 3SDYL 3BAKA 2PR4L 3CZFA 4QRBA 1GTFA 1RIVH 3FQWB 4Q9CA 3W1ZA 2BOCA 2IH9A 3L9YA 4L0ZA 3U48A 4RWYL 1VEPA 3I9IA 5G2NA 3V4VB 5AW9B 1M05B 3REVA 3QUYC 1NCTA 1L6ZA 3OXRB 3PHSA 2WBJD 3ZE2E 3AU1B 4HKJB 2JVUA 1OGAB 3TVMB 5H37A 4GFXA 4F20A 5LWYL 1VB9A 4UOW0 2P52A 2RCSH 3MLZL 4HF5L 4AIEA 5K2MA 4C83A 5DK0A 1R0AL 2O6EA 2GK2A 4M3KB 5ALCL 5D7HA 1IBLH 4NXMH 3GMQA 1C08A 4BIKA 1MREL 2ASDA 2C3VB 1QUNB 2UXTA 1JGVH 2HT3C 3EGDB 4PGEA 5CR1A 5AOKA 4BFOA 3GMLA 2JKIS 1FI8C 5CJBA 5FM5M 1JPFB 3VFUB 3GTLA 1V3LA 3VRLF 4GAYA 2B4CH 3NABH 2UX6A 5EU4A 2F74B 1KB9K 4ODTL 2DQTH 3HPLB 1EQWA 4XNXH 5HI4C 1FN4A 5GGUA 4ECRA 4PRPB 5FGRA 4F2MA 3DMMD 1A4KB 5DEFA 4X7CC 5D1QE 4TQHA 1X5XA 3EBHA 5D1OA 1J8HA 2W9BB 5FYKE 4EXPX 1HILA 4LL4A 1TEGA 4GOSA 2AK1L 3WDHA 1MAJA 3N40P 4X0KA 3ZUNC 2FK9A 4XPHH 1ECZA 3WY2A 2NQCA 2LT9A 3MJ6A 2FSEA 4NO0B 3MJ8A 4M9PA 4OCWL 4GPVA 2BIHA 1BLNB 4C8XA 1QFHA 1QRNA 1DP0A 2IFFL 3DWTA 3L4UA 4HCIA 4LNVA 3EYQD 4Y5XC 5IT2L 4JK0D 3RBEA 3P30H 4OFIA 1S7QB 3O9WB 1NCCH 1PG7W 4GQ9H 5DJZA 2IA6A 1FNAA 4Q4IA 5B3JF 3WEOA 1IKOP 2WLMA 2DV6A 2L7QA 1MJ7L 4O58L 1REIA 3P69A 4X4ME 3RFZC 1CGTA 1ZK5A 4XE0A 1GOFA 3BVDB 1SFHA 3DJZA 3NCYP 4JZOB 4FM9A 1KJMA 4HA1A 2QVMA 3WBDA 3C5JA 1GOGA 4E5XB 1DLHA 3T8VA 1IFHH 4JKWA 2UY6A 4XCYB 1BVZA 5E08L 5DJAB 4KHPH 1TMCB 3H9SB 5DQIA 3GHEL 4F7PA 4B3RH 3O3BA 1P0SE 3QG7H 5GZOC 3L54A 2C22A 3ROLA 3JSSA 3KWVA 1NWOA 4YDJA 4Z76A 4WKZB 4BK4A 2R59A 4ZFFA 2R0ZH 3C09C 4OIBA 4PJFB 3ZZ1A 5CBAA 3QJTB 3B9KD 1GMIA 3VWJD 4C56E 3HAEB 4ODHL 3I02B 1BWWA 4GI9A 4EJ1C 1KIUA 5I1GL 4TUYF 3PJNA 1HNGA 4KQ3L 1KYUA 3BAJA 3RKPA 4JGUA 5I1KL 1CK0L 1MFEL 2CUIA 2P24A 3MV8D 3AYHB 3FRUA 4J1UA 4PJ8D 3N44F 2OZ4A 2CKBB 4GC7A 3G8CA 1U8NB 2WBJC 1PY9A 2EIJB 1HK6A 3F6IA 4RISL 1W72L 1A4BA 3HJEA 2FJGA 1KJ2B 5D2NE 1G6RB 4X6BA 3K6NA 2IGTA 2I8CA 4BZ2H 5D8JL 4NFDA 2Z34A 1OPGH 1JIHA 4XN4A 3O2VH 3U2SB 3D69A 2Q3AA 4MQ7A 5IEKA 3FYEB 5E1QA 1DJZA 3X1FA 3FO9A 1OGTB 4L2YA 2E7HA 1JZ3A 5C0IA 1WCBB 2WYOA 4DQOH 3DMMC 3DVIA 5HHQA 1NGWA 5C0AB 2JWYA 4GLXA 2VDLH 3K0YA 4JPWH 2H1XA 4N8VB 3V5HB 5E1GA 5HDWA 5JO5B 5JVLA 1JI2A 2K8MA 4Q6KA 2ZYIA 4Z5RA 2AXFB 5GRJH 3VFSB 5JNYB 2EDMA 4MNQB 3IEAA 1U2HA 1E9OB 5LYJF 1A1OB 4JFFE 3RVWC 3MLRL 1T1YA 3PWLA 2OCCB 3EYQC 4R4BB 1OAYH 4JB9H 2I9TB 4W68A 3Q01A 1KTRL 5D5MF 3BI9X 1GS8A 5IMMA 4GAGH 4DVRL 2JQMA 2A9MH 1JV5A 4HAGA 4YK4B 4BZ1L 3GEFA 4DL2A 1JKJB 4DV5H 3F62A 1A7QH 2ADFH 3LPGA 3K5HA 3KJ6L 3EFOA 5E23A 3L1FA 2GPZA 5IJVB 5F96L 2BCKA 5E7BA 3B8YA 2FBOJ 2W8LA 5FEBA 3KHRA 4J27A 1UENA 3N0PB 2UYLA 4K9JA 4OCRH 4BQCA 5ICZA 2V5AA 1I8UA 4LFCH 5JW3L 2VDQB 3MRMA 1JMXA 4DK6A 1CXLA 5T14A 4YDZA 3SDAD 1ETJA 3U9WA 4IGBB 5IREA 1MXDA 1U8MB 3MRQB 2A6JB 1OAQL 2DDQH 2QVTA 2QQLH 5DMYA 4YSRA 1WK0A 4M3JA 2G9KA 3B9AA 5AWNH 1Z3RA 5KT6A 1A47A 1HE8A 2OMVB 2J43A 4MASA 3HG1D 1LK2B 3S3JA 1QSFE 1DQJA 2EAEA 4JUTA 3B9KC 5GGTA 4XOAA 3PV7A 4X7EC 3U9PL 3LH2L 4O3RA 1W0VB 2YS4A 2W8KA 1QQDA 1TF4A 2GIXA 5HGDA 4AC4A 4AQAB 1AD9B 4Z23A 2DQIH 4HPOL 1P84J 4LGSB 4PJ8C 5FKPA 4HETA 1YNTF 4UNVA 2HJLA 3BQUA 1E4WL 1ONQA 2O6DA 2BIQA 2WXOA 4KJQD 5LQBL 4MV9A 3CFDB 2VISB 3KYOB 4YUEH 3EOTH 1NMCB 2OMYA 4CGUB 3UTSD 1TWFA 1NDGB 3QEUB 3QZWB 3SO3C 3NFSH 4QHLB 4X6CA 3QBTB 1KIQB 4L8DA 4QHMA 1BQRA 1FO0B 5D1QB 3ZE0E 5F71A 1A9EB 1CTOA 2ZX6A 4N6RA 3ABLB 5T1LA 3L4CA 1RZFH 1UWYA 2WAHA 5AAMA 3FRPB 5MENB 1T20B 2AGJH 1IQDA 5D7LB 4NHUB 7PCYA 1J5CA 3FOMB 3VTAA 3CWGA 3E3QE 4G6FB 3VG0L 1RZ8B 1RJYA 3BPLB 3MR2A 2P5WE 4F80A 3W5NA 2ZUVA 3DRTB 1F5WA 1DE4B 1K4CA 4QIWE 2P7TA 1RP8A 1FJ1B 2XQ0A 3L5WA 3Q43A 2ZUXA 2XJLA 4KQ0A 5TE4L 1XF5B 4R7LA 4XTRD 3D7PA 4OD3H 5DVOA 4HK0B 2WMPA 4N2GA 4XZUB 1E5AA 2A73A 3S35X 2RTTA 4KAQH 3GKWH 2YRZA 5DMKA 5CCJA 5FKAB 3UZQB 1KB9J 2DRUA 3I6KB 3OB0H 3OMZA 1C5CH 3DO7A 1PZ2A 1P5VA 4JJHA 1XX9C 5ILTL 4YHPA 4R5VA 4QWDA 1GO3E 5EOCL 3W37A 2VL5B 2AI0H 3VA2C 2FATH 1V55B 4NT6B 5DJXB 5CFAA 1EZVX 2VQDA 5JMRA 4PV1C 4QRTB 3L13A 4YN3A 4YH6A 3NJHA 4OZHA 2QPUA 4O2CB 5I1AA 1PFOA 4O2BF 3LVTA 2ZUQC 1BMZA 5IZ7A 2AK4A 4DL7A 5KYXA 2VJXA 3T2QA 4PY7B 3TZVB 4AGLA 2R7EA 4U1KA 1JVOA 3L6FA 4N0UE 3EOYG 3VI3B 4C56B 4QR7A 4RNNA 2W07A 4QOKA 1K2DB 5DHYB 5JR1L 3SDAC 1M1SA 1XF4B 4NQED 5F7WC 1QR1A 1DQIA 2VR3A 1QSEE 2IMMA 2X1WL 4UQEA 5KX5F 2EC9U 4HIHB 1S7TA 4CVZB 1A9XA 4M4RA 2XZQL 4LP5A 5IR1B 4ODBD 3U0WH 2BSTA 1ZV9A 5G5DA 3OKMA 3H3KA 4RSYA 1RK7A 3KLKA 4BD4A 2OTWA 3SQOH 4C4BA 3DYMA 5D2NB 5FV2A 3DDFA 1CI3M 1AIFB 4DERA 2XQYA 5KVMC 3DUSA 1HN1A 1FHNA 1X9QA 1DEEA 2PWFA 4XP1L 3V10A 4KJQC 4LHUB 1PBYA 3GSUB 3MXWL 4C5CA 3TL5A 1KC5L 1TZ8A 2CLZB 5ERWA 5E4OA 3K1KC 4GW1B 3L3DB 2G3NA 4HJUA 3BYTA 4FTVB 1J9CT 2B8OT 4H8WC 1DBKH 1I3GH 4J3OF 4MDIB 3JTTA 4RGMC 3GUTB 3TP4A 2YBGA 1S78D 4TSBH 4O02A 3WSQL 3QEQB 4RFEA 3EH2A 1F42A 4H40A 4UT9L 4DGUA 1SMOA 4NO3B 4UQ9A 5IYZF 1AKJA 2PO6D 5EU5B 3W38A 3ETHA 1NCGA 4XCFH 2FTAA 2Q86A 2WCGA 2X87A 5KYWA 1S46A 3VW3L 2JJTA 3QUZD 4JO3H 4D94A 3IU3A 4L3ED 3OR7B 3UIYA 1IE4A 5IJKC 2OCJA 4PVNA 1U4EA 5FYKD 2YMTA 4AW4A 1SHSA 3WUWA 3I9AA 3V0VB 2DPIA 4ADJA 1A1NA 3U7WH 4X6DF 2WO3B 2G2RA 4APXB 4WU7B 2XBTA 3RWHA 3MYZA 1HCYA 2E9JA 4G9FD 4LOUD 3FTUA 2ATKA 4LCIL 4Z7UF 3UGEA 3FAXA 2VLLB 3APNA 1FVCA 4JO4H 3Q8EA 4N8PA 5HGAB 2H32A 4NAJA 2VA3A 5F7HA 3CH1B 3S36H 2IPUK 4OBRA 3IJ8A 3CSPA 2DQUH 4KMTL 3EJCA 3PFQA 4LSUH 4DR4H 1R47A 4TNWK 5K1VA 5I17A 5KS9A 1GY2A 2ATAA 1D9KB 2O5XL 4HS3B 2W9CA 5DVPA 4LP4A 3RGHA 3GIPA 1QSFB 3DO4A 1DQDH 3DTXB 3U7AA 2ZT9C 5LXGH 3B6SB 4NZRH 3HJ0A 3T3MB 1LEKA 4EZJA 2BZCA 3P9LA 1NMAL 4Y1SA 4XP4H 3VXPA 1KV7A 2IALB 2X4UB 4PEEA 4NRXB 4G1EB 5HHXL 2IG2L 3L3OC 3HBPA 1KCSH 3LRMA 4H1LH 4UIMA 4PJ7F 3BJLA 3WHE0 2Y36L 4K15A 2EDFA 3M07A 3D30A 4NBXB 1YEHH 4XGZB 4CJ1A 4YNYA 4J39A 5EEWA 4JFXA 5I71C 4YWGL 1HFUA 4LSSH 1IFRA 1UGKA 4KH9A 2YBRA 3OAUH 4LQ1A 2HRPL 4FQ1L 3X3FH 4F9PA 1G9MH 4NENA 2BS9A 3WIAA 5I6XC 3NRFA 4KKQA 4AQ8C 1I7TA 4WI7A 4DP0X 3LV3A 3PV6A 1NCOA 2J8UE 2VLJB 2Z92B 3TT1H 3UP1A 2H6PB 5ID0B 4GRLB 2JCCF 3NIDE 3TEXA 4NPYB 1H3PH 2BJML 3US1A 3LPOA 25C8L 4Z7WF 2VE6A 5DSCB 5IFAH 4WDIA 1UM5H 4JZJC 2ZCZA 1DVQA 4I4WA 4WEUD 4Y5VB 3W39A 2C5DC 1A6VL 3PJSB 2GCYA 1S78C 5FO2A 3FTZA 2HKFH 4OIIL 1IILE 4GRMB 1T21A 4ZUUB 1DEDA 1ICTA 1PEWA 4EE2A 1TFPA 3H55A 4Y19A 4OF6A 4K8RH 4TUKL 1PX8A 5IP9G 1I53A 5FJ8G 4NFBA 2PO6C 3GQFA 3QXDA 1QFWI 2PVPA 4LF5H 3WN5C 1R24B 3QUZC 1M7UA 2Q5BA 2OTUA 4JFQA 1DN0A 1PLAA 2MJWA 3PABA 3RVXD 5EUKB 5I1CH 1DBAL 3C5ZA 1M6VA 4PG2C 1EHLH 4WNQA 1MAMH 5GS2H 4L4VB 5GRVK 4P2CG 5IB3A 1WYJA 2F8IA 3PHOA 3CFEA 4LOUC 2FR4A 5JOFA 3DV6B 4JFFD 2QHRH 2X5PA 3MRJB 5KAQG 1ZS8B 3HZMB 4W9JC 3BLKA 2O61A 1CGVA 2PW2B 1RZJL 5C09A 2VXSL 4ADIA 2WAQE 4G6AD 1XL6A 3L9RA 5L9XA 5DVLA 3PHAA 4XO3A 5DJYB 4F33B 4I85A 3HC4L 3L4YA 4LCCC 3JAMW 1GZQB 3FQ2A 1TZHB 1RIUH 3VNZA 3RIAF 4ED6A 3O6FB 1BM7A 3FN0L 4A3JG 3BUPA 1JDCA 2KQNA 1N59A 1R3LB 4X0NA 5EC1A 3CFBA 4BRVA 3T0DA 1BPVA 4DGIL 5J12B 2C1PB 3EO9H 3MCLL 3QHFL 1Q38A 1QVOA 3ZMEA 5DRZB 2XI9A 4RUAA 3MRBB 2R0WL 2VDOH 2XN9E 5I73C 3GJEB 3WMSA 1J9RA 1JPTH 2CNYA 1CZ8L 4LEXH 4RAHA 7FABL 4C4KO 2O5YL 4YLQT 3B3IB 4Y5YC 1N6QL 3Q9QA 3JUZA 5SV4A 2HPTA 4LSRH 4F57L 3DJ9A 3GXDA 4FFZH 3RVVD 3Q9PA 4NIKB 2R56H 4P4KD 4KUCD 3E5NA 2NY0B 1HHHB 4P57A 1RK5A 2RFXB 4Z7NE 3RWGB 1SMDA 4IMKA 4U3SA 5DMIL 2XQYK 3R06A 3OZ9H 1WD9A 1NFDF 2XYCA 3WKMH 5C1OA 1A22B 4JS7A 2EDTA 1IGJB 2BW5A 3D9AL 2V2XB 4TNGA 1TEYA 4JHWH 2Q2TA 2N1TE 3HA0A 4N1HB 3CUPB 2VIRA 1JWMB 5DRWA 3DVGA 2A0LC 4KY1H 3FHEA 3MV9E 4JAMB 4L37B 5AKVA 4RBPK 4OLYH 3RHWK 3QDJA 3G3LA 3S0PA 2B9BA 3LN4B 2HVJA 1WWCA 1JHTA 1XGQA 1S3RA 4EI5D 3RG1C 2X9ZA 1VGEH 5DS8A 1M7JA 1Y1DA 4FLOA 5D7IB 1Q94A 2G0LA 4ERSH 2G4EA 3T3PE 3GGWA 1E4HA 4XPGL 3GXMA 2DWTA 5C8JB 4L1HA 1W93A 2MHAB 1NSNL 2Y1ZA 4LCUB 1HQRA 2L7EA 4ATTA 1CPUA 2A6DA 1AR1B 5EBLA 2P5WD 5JOEA 4UCRA 5JXED 3RVXC 3VD5A 4UQDA 3INUH 1FFQA 1H9VA 1YNLL 2ZOOA 3FULA 3VFTA 2YGNA 3OF6D 2DLFH 3ZDXB 4B9FA 1OAZH 2NY1B 5AOMA 4HJIA 4P9HC 1OV8A 4JQVC 1CLOL 1XB6A 4IRJB 4LB8A 4LHJB 3MFFA 4Z7QE 4JI8H 3EGSB 1U2YA 3D2UD 3WS6A 3AMKA 4GUQA 4G6AC 2ORBL 5DURD 1ZTXL 5GISH 3C6LD 5LGYA 4FP8L 4G5AA 1ETA1 1JNNL 2XVBA 4LPWA 1BFTA 2ZUWA 4HQQH 3JWDL 3LRLA 3B56A 2J88L 3H56A 4HYKA 4E0RA 3LB6D 1TQBB 5B38A 4PJXB 3FU3A 2KSWA 2ZUSA 3SI8A 2I32A 1YEFL 2XZCL 1M7IA 2FIRT 2EEDA 4QMEA 3TJHD 3V9CA 4U6HB 3BSZL 5I6KA 2HFEA 3OKEA 1UTDA 4XO5A 2QKIB 4JE0A 1N2RA 1QLRA 3WEBA 4A2GA 1IAKA 1ZETA 4XYMB 2YUZA 3PG2A 5J0BA 5HGBB 1YCSA 3L81A 1NA8A 2UX7A 1P9MA 1QSED 2WWKO 3TASA 4BXVA 4NKOB 2CO3A 2X10A 4K7PY 5DD3L 5FGBC 1DVYA 3RVVC 2W60B 2GC4C 2X4RA 4P4KC 4JY6B 5IBTH 4AK2A 5KOVC 4WUKH 4JJOA 4JL1A 2X0SA 4WI0B 1U3HB 4M5ZL 4NM8H 1LO5A 2GQHA 4YP3A 1FFRA 1UWFA 3LDBC 4PB0H 2XY2A 2B5IB 1KPVB 1TENA 1J8HE 2DMHA 2EEBA 5DVKA 2FE3A 3FHQA 2Y7SA 3HHRB 3IMSA 4KXZI 3S5ZA 3PHQB 4ZFOA 1IBGH 4GMTL 5IB2B 2UVFA 2D7QA 4J4PA 5HYJA 1BQHB 3FHAA 5D71L 1KGWA 2B63A 1QRNE 2GTQA 3HG5A 3PDGA 4D9LL 5I75C 1IGTB 1T1XA 4I3SL 1TOXA 2ZOLB 1WEJL 3NSCA 3QR0A 2X53A 5D2LF 3M88A 4EI5C 4WHYH 2WZ0A 3LKOA 2VM3A 3LSOA 2XFXB 5B3NA 1UWGH 3RP1A 1HXKA 5I0XA 1SZNA 4M8VA 1UH4A 2BS71 5C07A 1HEJC 2IH3B 1QFPA 1A4AA 2ZNXA 3NZSA 4NZTL 3UPRB 2VC2B 5H4ZA 4FRWA 3EAKA 3VQ1C 1YEEH 1H3VA 3CVHL 5E2VL 2CCWA 1P5UC 3EFDH 4GKSB 3UCRA 2JELH 4ZYKA 3TIEA 3BDBA 3E3QC 2VC2L 2LW3A 1CG9A 3M7OA 4OJDH 2I87A 3QJHA 4DLKA 3OKNA 2MIZA 5JXEC 1QR4A 3L4XA 1L0XA 2EKSB 2OMXB 1E65A 1WBYB 1YJDC 1FYTB 3C08H 1QSVA 3KPOA 4ZX5A 3DRQB 1XMQH 5DVNA 4HAKA 2XWJA 1RYRA 1GC1L 2AQRA 1YN7A 2Y1YA 3TO2B 1WA1X 4JMNA 4Y4HB 1DTUA 4XH2B 4LVNC 4KBPA 4F1SA 5BV7L 1ZHKA 4BXSV 4YAQA 5CWSA 4K3JL 4O2EB 3UG5A 3C6LC 5FGSA 5AW2B 1AZZC 1CE6B 2XN9B 1IBKH 3S34L 2PCFB 3MUUA 2ZJTA 1EO8L 5EEUA 4BGLA 2PPFA 4P5TD 3LB6C 1XCTB 1EO7A 3D1MC 1QZNA 4HP5A 4HJJH 1TZAA 3HE7B 4Y2OB 4ZZKA 2VLKA 5E1IA 1ZKAA 3LMLA 4TQIA 5T1DH 3TJHC 1AI1H 2WXRA 5GZND 4C4UA 3S7GA 5FD5A 1WZMA 2XA8H 4ECZA 2DZEA 1EZLA 2R7ZA 3W57A 4GI8A 2PYFA 2DQCL 1IGCH 2JH2A 2H0JA 5IQ7L 5E03A 1VLXA 1AO7E 3W0WD 1NGXB 1Q9KB 1BOGB 1I6UA 2VKWA 2CLVB 2P5PA 3BEWB 3BKCL 5C0BE 3UH8A 4PV8B 3HHSA 3DJSA 4APQD 1XF2A 4ZW7A 1WGOA 1RU9L 2XV0A 3QCTL 5GGSY 3X17A 1D5IL 1KY7A 3QFJB 2PBZA 4XC3H 1YPZA 3BFWA 4KZDL 3TO4D 2ZXDA 3JV4B 2D3VA 4HIEA 4G3IA 1KCKA 2OJZH 5I18H 1VENA 3T3PB 2MOQA 3AC0A 1B3IA 3EH5B 3VD7A 2LQRA 2TRYA 4ECTA 4WUUE 4P5KA 3NJIA 3MTRA 4LQFL 1EIBA 4U1JB 4MJ5A 2QZQA 3N85L 1BZ7B 2OMUB 4H0IA 4I87A 4L9DA 2D7MA 8PAZA 4L9LA 4JFUA 5JHLA 3FSZA 4G8GB 4ED2A 4EO5A 3WHXA 5DWUL 1QATA 5IGXH 1D5MA 3LS4L 4AQ1C 2VQ1B 3QNYA 2DWEA 2CIIB 4NZUL 2IV8A 1BYOA 3WFBH 4Y9FA 4I18B 4PJFF 1X4XA 4MB5A 4KV5E 4PTUA 5KT2A 4Z7QB 4HIQA 4TV9F 4L3CA 3ABKB 2XOTA 2FCBA 3ZL1A 4FZEL 5DD5H 4LSTL 4PJ6A 1NKOA 3EJYD 2E86A 3ESOA 3KYNB 3KPSA 3V4VH 3QQ9D 2Q7YB 2RBLA 3MLZH 1T2XA 4WWKD 1YEDA 1FGVL 2X2IA 3REVB 4MZRA 1FFNA 3MREA 3GPSA 1V27A 1CL7L 3WTYA 1ZIBA 1PKQE 3OKDA 2OL3L 1RI8A 4R90H 3AG3B 5DK0B 2FO4A 3I9GL 3LCYA 4ECSA 3WLBA 3KLSA 1JZEA 1JCVA 3HZYB 3VX1A 3BZDA 1OT1A 4U1MA 4MXQD 2H2PD 4H8PA 1R1CA 3V6ZA 4U3XA 2JJWA 4P5TC 3QEGL 4PGEB 2NZ1A 2F19H 3FSOA 2WVSA 1VPOL 1KGCE 1HSBA 2P80D 2YAQA 3GMLB 4H26A 4JI3H 4I0CC 1L6PA 3BD5A 4GAYB 1GSAA 5GZNC 5EU4B 4OLVH 1LO4L 5E94A 4X6CE 3RBDA 1FN4B 3QULA 2AK1H 5GGUB 3RI5K 3ZDWA 2E46A 3ARBA 2WLNA 5DEFB 4F2MB 3V7AG 4PJCB 4KNQA 1JBJA 1J88A 4JREC 4PJ9D 1J8HB 4OCWH 2LU5A 4XCNA 2UWEA 2HLFD 1CD0A 4YSSA 3TH3T 4X0KB 1NBQA 4NQCB 4ZO8A 4NI3A 2BO0A 3COOA 3RIKA 4IYKA 3Q7JA 4LCWA 1DBML 2FSEB 1ETZA 1SJXA 3MJ8B 1BVKB 2HWZL 3OJ2C 4TLTA 4APQC 1WH2A 4OT1L 4XVSH 1OARL 5F9NA 1QRNB 1WWBX 3SKMB 3U46A 5DMGD 2FPIB 4C54A 5IM7B 4YVNA 2A74B 4QWCA 1CVSC 1TJIH 3OR6A 4A7GF 3FTXA 4UDUA 1E2VA 4GBXA 4DR6H 2DYSB 3WY1A 2C34A 3TO4C 3TURA 3ZT7A 1ACYL 3NMEA 4PU2A 1UZ6E 1EUUA 2VDNB 4MXVF 1OTSC 4JDEA 5CNHA 5FW8A 3Q8PB 3P40A 3QDMA 5I19L 1KJMB 3MTXA 4K5PA 4PJ5E 3JWOH 5K1NA 3N8DA 1N33H 4DETA 2E74C 1N36H 5GRZA 1DLHB 1U3HC 4LNRA 3MV9D 3P0YL 5I30L 2OK0H 4NZ8A 1S9WA 4A39A 2A83B 4QJ5B 1GYWA 4WF7A 4DPCX 5EULV 3GO1L 4B9YA 5D96C 1XL4A 4A2EA 4C59B 4QPEA 3WG7B 4F7PB 1SM3L 1JXKA 1GS7A 4NP9A 4ZXBD 1ZHLB 2NY2D 4Y4FA 4FJYA 1S9YB 4B9KC 1PF3A 1KV3A 4OZHE 1J0HA 2WLZA 4YDJB 5GS0H 2CRIA 2JA8G 4OLZH 1I8AA 2CMRH 1E27B 3DETD 3KG5A 4KQ3H 4JBSA 4QXTA 4ZFFB 3HAEH 5DJ8A 5CBAB 4MMZA 4RMUA 4UZUA 3ZE2F 1ASPA 1LEGB 1CK0H 1SUHA 4QOKE 1FVIA 4UAOC 1KIUB 1Z9SA 5JQWA 3R5HA 2ZICA 3EJYC 4FKKA 1AS7A 2YAEA 3ZK0A 3QQ9C 2HRHA 1P7BA 3MHZA 2CKBH 1B3JA 3EUUA 4WWKC 3FRUB 3MODL 2VZ3A 3O3EA 3QI9B 3GXTA 5LN8A 2CBTA 1KJ2H 4V1DB 1G6RH 2FJGB 2P26A 2HH0H 4X6BB 1XMEB 4URTB 4Y16D 1K9TA 3CDGA 1ASOA 3NCMA 3SE3C 5DZOA 1HXMA 1WIOA 4HS8L 4K73A 4P48A 4YDVB 5HHVL 2RH0A 4JG5A 2H2PC 4MXQC 1J5IA 4UB0H 4OQTL 5DYFA 1IVLA 3D69B 4BFIA 1RJLA 5JIQA 5IEKB 3BLBA 2R93A 7PAZA 4YGVA 2X6AA 2FBRA 2C00A 4WWID 3EHBB 4ZTEA 3OTTA 1QKZH 4GIAA 3X11A 3OMNB 3ZGHA 5C0IB 3W3BA 1E9PA 4AQYH 4LRNH 2J71A 1WITA 5C2UB 3NG5A 1NGWB 2WSPA 2SEBA 1E3XA 4NSKA 4F9LA 2W6QA 4PJ9C 4G1MB 4XCCL 4PWIA 4XNMB 4Z3EA 1PX2A 1P7KA 2HLFC 1BZEA 5DWPA 1PG7L 3T09A 4LBEA 4A3CG 1UQSB 4G70B 4Z5RB 4YEFA 4PN6A 1HI6B 2AABH 2X0UA 3G08B 1P4BL 4YL9A 1OHZA 1D3CA 1D7DA 3PWLB 4IKKA 4Y9CA 5DMGC 1S6NA 2OMNA 1JHLL 1U21A 2J1XA 2Y7OA 5IMMB 1XGTA 4AG4H 3LKQB 2ODIA 4DV7H 2O26U 1Q90A 2F5BL 1JV5B 3ILQD 1CLZH 5EBMA 5I9QB 1Z5YD 2ICEC 5E8EA 2PKDA 3PLYA 4PD4K 3UCQA 4LGRB 3EFOB 2ENJA 5FM5O 4CC1A 4NC0B 5DA4A 6PAZA 1IM9D 3VACA 5I82A 4B0MM 4N9OB 2N1KA 3BFOA 5B8CC 3U6XS 2UYLB 1BJ1J 4MNGA 4YPGA 1PD1A 1U8LA 5FYJE 5K9JL 3FMAA 2VDQH 4QRPB 1F8TL 2APWA 3VI3F 4X5PA 3C60B 1Q9OA 1YNKH 2WKLA 2JIXB 1VADA 2K4WA 4NO5B 4ZMLA 4ZMTA 1MFCL 4ZXBC 2NY2C 4CILA 1WD8A 1OWTA 5D7SH 2IFGA 3QO1A 4OF8A 3IGLA 4X4ZA 2CK2A 4ZPVB 5KS9E 4RFOL 1MJUH 2IDSA 3FB7B 3BPCA 3DETC 3NH7H 2HB0A 1KF9B 5CD3A 1DQJB 1NAMB 2YA0A 4ICWA 3BZ5A 4XODA 1CDBA 1X5JA 1C9SA 1MCJA 3VXRB 1QQDB 2BSEA 1Z0MA 4MCYA 1IKNC 2N7SA 3AWEA 4Z7OE 5HGDB 2YHGA 4EBCA 3I4NG 2VM4A 4RDQG 3V4PA 3Q6FA 5FKPB 4WU5A 1PKOA 2HTLD 4D0CA 3D85D 1ZHBA 2QSTA 3BQUB 3AB0B 3BGFB 4FKEA 4H5SA 3S2AA 3RTXA 3FUKA 32C2B 3BISA 3LNFA 5IVNA 4AIOA 2VDMB 2ZKHL 4JDVA 4XMKH 2PCPA 5T5NG 4KXCA 5G4OA 5AZ2L 4Y16C 2BNRB 3DHPA 5DUPL 5H2BA 4OJYA 4DEUA 2VDML 4HUCA 1FO0H 1WS8A 5TPWH 4L8DB 4G7YL 2DY2A 3FQTB 4QHMB 2B1HL 3GZOA 1MFDL 4F8OA 2XTLA 4IIQA 4M7LL 5FXCH 1I3RA 5IB1A 2E7LA 5T1LB 3K4AA 4KHTL 4FL4B 3CIQA 3KL0A 1X5YA 1N32H 1OTUD 3WD5H 1DFBL 3PAZA 1HIML 2VZ1A 3FQYA 2Y5TA 3CFUA 2CBMA 3KLQA 4G71B 4GT0A 2XBZA 2Y5QA 1W15A 3US0A 1PLGH 3BO8B 2P7TB 3RWFB 1TXKA 1MRDL 5CJOL 5IVOA 3X14A 5ICXA 3ZR5A 5TDOA 4FQXA 5IHZA 5I8KH 3FDSA 3BDXA 2VRQA 1SXSA 3CQFA 2I5YH 3K5IA 4Y19E 3Q8BA 2L8AA 2DTMH 5TFSL 2A73B 5HYIA 1AO7D 3H9HA 1YEGH 4GKNA 5EOCH 1RK0B 3GIZL 5T3XE 2FO1A 5DJDA 2YC1A 1HWHB 1WSCA 5C0BD 3Q1EA 3LN5B 1ASQA 2HCZX 3LIZL 3FT4B 1KCLA 2BP8A 3DO7B 1AGEA 4IRDA 1PZDA 3QR2A 3ILQC 3LEVL 1RLBA 4MJ2A 3ARQA 5EF1A 4FNTA 3GBML 3FKIG 3QNFA 4W9IC 1LLAA 4AEHL 1YYMH 4N2NA 1A3RH 5TQ2L 1BM3H 3M9MB 3L3JA 1GKEA 4HJGA 4OZHB 2FX7H 3QIWB 3GXFA 2Q7NA 1G9EA 2AK4B 4HX1B 5KYXB 1KN4H 3IPBA 1N5AA 4P4RA 2L0DA 1AE6L 2NY5C 4NRYB 4Z3JA 4LLDB 5KEZA 4YDLC 3GXUB 2R7EB 3MLXL 4WUUD 4GO9A 2E2IA 3L6FB 2XV2A 4A3FG 5C09E 1QPXA 1YYLL 3N42B 2W07B 2G9HA 2KDGA 2YPVA 5C6TL 1TVBB 1U91A 1WZ1L 4M02A 3ZIYA 5BRPA 2F0CA 3ZX1A 2NOYA 4A6YB 1DZ0A 5KVDE 4EIUA 4P3CL 3AXLA 4NQDA 4ECUA 4MXWH 4JGJA