3N44B

Crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; osmium soak) of chikungunya virus.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
338
structure length
337
Chain Sequence
DNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 65
structure length 337
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n44B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n44B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n44B02
3N42B 3N41B 3MUUA 3N44B 3N43B 3N40P
chains in the Genus database with same CATH superfamily
3OR7A 1U4FA 2O6PA 1Z3GH 1LWHA 3TURA 2QBWA 4DCQB 4J4PC 2MWCA 4CUCA 5I9QC 5IF0A 4ZOLF 3O6FA 1WSCA 4OJYA 3WHE1 4LF5H 2BIOA 1EO8L 2CE6A 1R34A 2ICWA 3PWLA 4ZPTA 3BQ1A 4O02L 2DW5A 5JPNB 1A7OH 2LLGA 5CGTA 1AP2A 5J6GA 1V3JA 4JCLA 4L4VA 4UCTA 5F3BB 5EPMA 4B60A 4TYUA 1JGVL 1A6AB 2BP0A 3CFBA 2AK1L 5C0JB 5LGYA 4XZ4A 1T80A 3BW9B 3KPNA 1HHJA 3LN5A 3VD3A 1D5BB 1MHPL 3WEMA 4PRPA 5FF6A 4CBZA 3ETSA 1RZFH 1JHLL 4M00A 5ISZB 3IGLA 2EH7H 2JI2A 4DFIA 3WKNA 4IJ3B 2VQFH 3TH3T 1SBSL 4ZS6C 2ZJTA 5BXFA 3O4LE 2GQHA 3FUNA 2ICWI 2EE0A 3GXMA 5DJ8B 4WO0A 2PTVA 2IADA 3CN3A 4ZFZA 3D6GA 4OLUH 3S9DB 1B9KA 2X89A 1A0IA 2OMTB 4LPXA 4DV5H 3CC5B 3LXBA 4YHKH 2EYRA 2AAVA 4OZFA 3IAQA 4M9OA 4NO0B 3D3VD 3IF1B 3VGHA 4JI3H 3ZE1F 4OLXH 3UYPA 3FFDB 2IANA 4IBLT 3I9IA 4LRIC 1U8KA 3NGDA 4AK2A 3HS0C 4JKPH 4NHCL 1NOAA 4AVIA 4RSYA 4ZW3A 1S0OA 3FUIA 1NJ9A 4HX1B 2XY1A 5EU7E 3VXUB 3U4KA 5E9NA 1YMHA 1YG9A 3PPSA 3QXVA 1BD2A 3R1GH 4AXWB 1IEBA 3S37X 4PJGA 5IJKA 4NN6B 1RPUA 1M9SA 4AQ1B 3L81A 3WTVA 3QS2A 3RJ0A 4L4TA 1CIUA 2O5ZL 2CBTA 5LBGA 2Z65C 2BOCB 3N55A 4N90E 5FCSH 4K8RC 3RRQA 2GJJA 5HI4D 2Q2EB 2WPGA 4R2GB 1GSAA 3BKJH 3CX5K 2P8PB 3FQUB 5DEZA 2WZPA 1VKZA 3MJ8A 2DBJA 4X8JA 1ZHLB 5DMIH 1Z5HA 4LGPB 1TETH 5EZJB 3BRGC 3PZPA 1IGCL 1WIOA 3VXOA 4JO2H 3SGDH 3VYOA 3FO0L 2BFVL 5KN5B 2IXQB 4ORGB 3VGGA 4AI7A 1IVTA 3OAZK 1AGEB 5KKNB 3LQZA 4A6YL 1HTYA 4MNQD 1AKPA 1Y6NR 3RIKA 1INEH 1YEKL 1NEPA 2XTJC 2DWEB 5JQWA 2JLPA 4XNUL 4P46C 3EH5B 2WKLA 1UOLA 1G1KA 3CZSA 2AMGA 1RSFA 4CC0A 3QVAA 1UA6L 1B0GB 3BKML 4LSUL 3CH8A 2HX9A 3NJIA 3MGOB 4MCZB 4Q7DA 32C2A 1RZKC 4JY6A 3B5GA 4MV7A 4CC6A 1A8ZA 4U6TA 4AUYA 5IEKB 2VXTL 4IIZA 1K5NA 4M8VA 3WEXA 2HKAA 2J8UF 4F4ZA 4KMTH 3GIPA 5AW8B 4FI6A 2VDPB 4Y0GA 4WWKD 3V7AG 2Q3ZA 1NFKA 4Y4FA 2VW6A 4KZCA 2F19L 3DF7A 5I1HL 2M2DA 3BDBA 3KW8A 4GY4A 1MCLA 1FFOB 5GQBA 2QZQA 4LP5A 3QJZA 2AGJL 4RGOH 4MMZA 1HJBC 1F6AA 3GKWH 2WTPA 1FL6B 3AQXA 5JOPD 1M7JA 5EIIG 4NJAL 3S5LG 3E38A 3CLEL 3QA3B 5C2BL 2ATKA 2YPVA 3G04A 3UC0L 3VXMD 4PLKC 3KLKA 4G6JH 2A6JA 3TPKA 1W0VA 1MRFL 2QV2A 4JI6H 4DEUA 4YSDA 3SPVB 2ORBH 3DHMA 1BVKB 5T14A 2KBGA 6CGTA 4PYGA 2Q9OA 4I3GA 4EOWL 4FQQB 4O2EB 3TNNA 3BEVA 1HJCA 3WNNA 1KJIA 2CRYA 1OSZA 5A2QW 1NC2B 1E9OB 3DTXA 2BOBA 1FZKB 1AE6L 5IB2B 3EGSB 4XN5A 2VQUA 1G9NC 2BVOB 3IJSB 5C0DA 5LGJB 5GRJH 4M29A 5IFAL 2WLHA 4F15B 4W6YB 2OK0L 4TVPE 3B7SA 4AOFA 4QRQB 5LYJF 2DLFL 4UTBA 3FB6B 2N01B 1G9MH 2NSXA 2APXA 3RGHA 1BFVL 4E9YA 2YGOA 1KB5B 5C0AE 1S7XA 3BXNB 5LXGL 2FRGP 3NZ8A 1Y18B 3KD4A 4LU5L 1RP8A 4QAWA 3VD0A 3FTYA 4G9FB 4YNYA 2ETWA 4J23A 1O7DC 4UUJA 5BPHA 1GY1A 5FO8A 2OJZH 3G6JB 2Y1VA 3AMKA 2XZAH 3BUBA 2QGEA 4N0UA 3MLPA 3HBLA 1BFTA 5EB9A 3CQPA 1M6OA 5DHVB 2P26A 2EDRA 2FPIB 1ANUA 3FQNA 4LHJB 1LO5A 4XBGB 2F68X 1QSEB 3WIFB 4KI5F 4AYSA 3PGFH 3RWFB 2DKUA 4YDMA 1QAWA 1QRNB 3ESMA 1S97A 1EXGA 2CBPA 4EI6B 3CSFA 3L08A 3PN1A 5D2LB 4NQQA 5E8PA 4EN3D 4N2IA 4OVUA 1VGKB 5F71A 3O8XD 3DWTA 3MNZA 5E1AB 3ZHNA 4XPGL 2Y2WA 1G7QA 2UXCH 1SMAA 5C09D 3WFBL 4BK8A 3DIFA 2R8KA 1J87A 1KYOK 1HILB 5KG9B 4XXDB 4R7RA 1TJGL 2Y6SD 4ODBD 1E4XI 1CICC 1ICTA 4N2OA 4JI4H 1RIHL 2G3MA 3ROOA 3GMRA 5KTEL 3VPCA 3DJZA 1AO7A 4HUMB 4G59C 4OGYL 3HKFA 1SOKA 3OC8A 4J9MA 4XXWC 2FK2A 1UD5A 5DVKA 3VTAA 2J20A 2FX7L 1OV8A 2XG4A 2WLMA 1PSKL 2X53A 4NUMA 4KKRA 4RUCA 1EHNA 1CGWA 3VGFA 3HC0B 3DSFL 1A0QH 3QQNA 4MJIE 4PRID 5LG1A 3N8DA 3KPRD 4DUXA 1SLXA 4JPKH 3T8XA 3FT0A 1WZ1L 1XR8B 1MQ8A 2ICCA 4GG6B 1QYGL 4NZJA 5KFXA 1K6QH 1FNSH 1MI5E 1XGQB 2HT3D 4BH7B 2Z93B 4CU7A 3IJ9A 5TPWH 2ZAGA 2UX6A 1H5BC 3ILQD 1LO0L 5AG8A 2XXFA 5KVGL 2Z35B 1GCFA 2H0JA 3FS9A 3WN5B 3QDJA 1NEZG 2BVPB 2RH0A 1ZLVH 3UBHA 5TK4A 1B6RA 1QSZA 2WZ5A 4F7PB 4BXXG 3BVDB 3NEEA 4JHAL 3IXAA 4N8VB 2JIXA 4FFTA 4FQHA 3CQZA 3G5ZA 1ZGLA 4XCYB 1KXHA 3FN0H 3NP4A 3ARGA 1LM8V 5CEZH 3AS2A 5A2AA 1OT2A 3QORB 1ADQL 4JG1L 4RISL 1DO5A 4JHUA 4WHTA 5IBLD 1KELL 3OQ3B 3ZDYE 2EDDA 5C6PB 1R3JA 3BDXA 5I1AB 1EFXD 3X14B 2AGQA 1RHHA 1LE9B 2J44A 1X5YA 4IGBD 5AOZA 4N5UA 4CW1B 1URLA 4JY4A 3CSYB 4OD1H 1MHHB 2CRMA 1TZHA 4KHTL 3EFFA 3VX1A 1JG9A 2EDKA 2DKMA 4JG0L 3I02A 2C4XA 1TJHH 2QHLA 4LPCA 4QMEA 1TQBB 1DUZB 3SDDB 2MCAA 1ZY9A 2ASLA 5FHAH 4NNXA 1UJ3A 3JTSB 1WFIA 4LLVB 3WJMA 4AENA 1IBBA 1JWUB 1RL1A 1TSRA 2DLTA 1N3NB 2AJUL 3H6AA 5DC2A 3GEWB 1R5WB 3V9EA 5E8OA 5CEXB 5KFHA 3H2QA 2EIZA 3EADA 3GLZA 5EUOF 3T0DA 3AC0A 1TZAA 1H15B 4YHPB 4N68A 4OM0L 3ZUNC 1K4CB 2YW2A 4EZJA 4XNXH 3ZZSA 4K73A 2O26U 4ZMVA 4WFHD 2Y07H 2V9UA 4JKLA 4YR6B 1QVOB 2AJSL 1YRKA 3S3DB 2P3YA 4YWGL 1VPOH 4NQED 4Q2ZA 2PMZE 3HE6A 5FKAA 2R9HD 2HFEA 1U8CA 3H4FA 2UUDH 5HHVH 3ATDA 2DD8H 4BK5A 1G6RB 2A0LC 1T0OA 5D70H 5BOZG 2EIJB 5A6LA 3MUHL 1A3ZA 1PW3A 3RVTC 5CGYC 2EJ1A 4LFCH 1WH0A 3ZT5A 1F4XL 3IMUA 1DQVA 5BMVF 3W39B 2VZVA 3SB3A 4GO8A 2PPDA 4L5FH 3IETA 4ZI7F 1B0RB 3CC1A 5FK9A 1BZQK 1F1GA 3TT1H 1A3LH 5DD3L 5DJ6B 3DRTA 3EO1B 1XH2A 5T8IA 3TYGH 4LNVA 5IM7A 1GLVA 5D1OB 3HB3B 4QJ3B 4HMDA 5E2VH 5IWLA 1K4DB 2Z0BA 1PLGL 5E9DE 3ILEA 5HYQB 3DIVA 3H6JA 4A7GF 4J3WA 2EZ0C 2HG5B 3HPLA 4AYFB 4A3MG 5AWNH 1PGRB 4I77L 4PJBE 3W57A 4AEHH 4P48A 4YFDB 3D0VB 1MSPA 2A83B 4NKDB 3IFPB 2Y5EA 1KTJA 2ZKHL 3C5ZD 3GBMH 4W9FC 4PRAB 4H8QA 1FVEA 3IGAB 2DZDA 3T77B 3NESA 1S7TA 3GHEL 1EQWA 4G7VH 3BQUD 4A3JG 3O6KH 4Y1AA 5D71L 1BZDA 1DV2A 2YQ2A 4DGYH 2J4WH 4H26B 3QWOB 1IAOA 4XXCC 1UWXH 4R5TA 1KENL 2ZONA 5C0ND 3FH8A 4WWID 3DARA 3E6HA 2FLPA 2GSMB 4LCUB 2K6YA 4NRYA 4QR7A 3CXHJ 1CVRA 2KZKA 2V5SA 3PWUA 1HX0A 1RK7A 1EERB 1XGYH 4MA3B 4PSPA 3R7RA 1PKQA 4WY7L 2ZNWA 5TFSH 4Q8FA 5EN2B 4H4NA 5H35B 2X9YA 1A7QH 4RDQG 3UZEA 4APQA 1TWHA 2HAZA 3GUFA 5KFVA 3LZNA 4LLMA 1BEYH 3PRZA 4MAYB 4MZ2A 4ZQKB 1Y1UA 4HG4J 2GJ6B 3V7AE 4XHQA 2K9UA 4CADB 1GYUA 4JANA 4XMPH 1ZLWH 5JW4N 3W5MA 4HUVB 2XC9A 2R0LH 3HG1A 1E6OH 2QGCA 2FJUB 5CXPA 4E0RB 5FWRA 5IP4A 1CDYA 4W9KC 2OWOA 3BJ91 2IFFL 4UIMA 4ALAC 5CF3A 3AGWA 1BX2B 2JKJA 3HBZA 1NAMB 1KC5H 3KCPA 5CSBA 1UCBL 5D1QB 4A39A 4ERSH 2W57A 4J9SA 2BQRA 2X6CA 5ICXA 4JFPA 2V3EA 3V4VH 1JZDC 4JV5H 1SJHB 1AGFA 2ZPKH 3O6LH 1T6WA 4K23L 4CVXB 1FLTX 1JVOA 2BX5A 1K8IA 2E6JA 3HPJA 4QEGA 4R97B 4R7DB 4XBMA 5DZLA 3QUXB 4YXKH 3V0EA 2QELA 2UYLA 2FWSA 2OPCA 4JZNB 4L29A 4G80B 1XMOH 4M4RA 3QS3A 4UFZA 6TAAA 2I07A 4XMXA 1JZ5A 1BA9A 4J9OA 3SOBL 3VH8G 2WSDA 3BCDA 2QL1A 2FSEA 1NANH 1A25A 4JRYD 4MHHG 3K2UH 2DZEA 1DJIA 1TNMA 2D03L 3RYMA 1KZYA 2I7SA 4DR4H 2W70A 3IG0A 2DQFB 4XYMB 2Y7QA 3ELQA 4KVCH 1FHNA 4ELMA 1RULL 1U95A 3WHXB 2YBRA 4QIRA 3P0GB 8FABB 1S9WA 4KO6A 4YR3A 2RR3A 4HWBH 1I9RH 3BN3B 3I84A 4OQTA 4YPJA 1AZZC 4QY8B 5AZ2L 3ZJAA 2VLRD 4L4JA 5KG6A 4DKEL 1T1YB 1Z66A 2E3VA 1SN5A 1QPXA 1PX3A 2UY6A 2OMWB 2V9WA 1TCRB 3U4AA 3QJTB 2GVYA 2PCFB 3B3BA 2FPGB 4Z7VE 3TCLA 3FCGA 4J3OG 4ZMQA 5C6TL 3STZB 1SNRA 1AFVL 1RZJL 2P5WA 4ED3A 4EUPG 5CEZE 3MJ9H 4WNQB 4D3CH 5KBLA 2OZ4H 1CF1A 1G87A 3C5SB 3QHTC 4NERA 4IIQA 2OKMA 3QIUB 4I4TF 4U6YB 1VSCA 2W60B 3HA0A 1AMXA 5E2WH 4TMPA 3SDCA 1KBGH 2BMKA 4JO8A 4LVOC 4MASA 4OLEA 3K2MC 5CHNA 5A16B 4ONGL 3VTTA 3VVVA 1HYSD 1DJWA 1BF8A 3WMSA 2DAVA 4RETB 2X42A 4AM0A 1AIFA 2KERA 2X10A 3REVB 2ZG3A 4UTAH 4JNXA 4MMXC 4YC2C 4XAKE 4X65H 4JCWA 4QIWA 4DP5X 1IBFA 3MLYL 2ED8A 3V4UL 1FGVH 5EWFA 3RDTA 4PRNA 3TA3D 4G11A 2YPLE 4WU5B 4M5YH 3MRIA 1MXGA 3UJJH 3L9RB 4K2UL 4PB9H 4M7EA 1CU4L 1EXUA 3BEWA 1SM3H 5CINH 1RJLB 4ZFOB 2V6HA 1JGEB 1NMAH 2DEYX 2G9HA 3LKPB 2ADYA 5IQOA 1BECA 4NUJA 5F7YC 1P7HL 1NIEA 2BVQB 2JK5B 6FABH 5KVMC 3H4BA 1NL0L 3HN5A 3OKEB 3P69A 2LFGA 3TO4D 4J3OH 1ND0A 3VFTB 4BH8A 1S6NA 2BIQA 4EMZA 4UYPA 2PR4H 3RF2A 2I5YL 1MWAB 2A74C 4OF7A 2ZSVA 3RGVB 4EUPH 4HC1H 3GMQB 4PW3A 4X6DE 1SDDA 4XBEH 3PXLA 4YR2A 1U8MA 1U3ZA 5CZVL 3TIIA 3UTSE 2WGXA 4L5FE 2NZ9D 3IJEB 3ZL4H 4B9GA 5KVEH 2DWXA 1TITA 3X13A 1JF6A 4PG9A 4XPHH 4YSSA 2IOIA 1TF4A 4LHUG 4IRJA 2ALAA 1I1AB 5I2IA 1I7RA 4GKJH 4V1DD 5K59F 1DQTA 4JFOA 4GLRI 4RFOH 1WQVT 3CUPA 1Z0NA 4K3DL 5DFAA 3C08H 3U0TA 2FK3A 3MXVL 4ZPVA 4HFWB 3JYBA 2JB6A 3G3LA 2X4NA 2NW3A 1G43A 3MI6A 1QOKA 3IB4A 2K45A 3D39A 3KVDD 3JTTB 4AZUA 3HHSA 3MOAL 2MPAL 4M5SA 5DQDH 4A3DG 4P23A 2OXHB 3FF7A 3T8VA 3PR5B 2BVEA 1S9YB 1R17A 2NU9B 1OP3K 5EU3A 4MNGB 1ET5A 4H1LG 4QOKE 4U4BA 2BIMA 3MV8B 1GGYA 3ZRSA 5HI4C 5IJVA 3V4SA 1KCUL 4L3CA 4EVNA 3H3BC 4LP8A 3QRGH 2BSED 3OZ9L 3BAIA 2HLAA 3IDYB 2CUIA 4TUKH 5IFHL 2CUMA 1G4RA 5LCVA 3WSQH 5LNDA 3VFUA 4H5SB 2B9BA 4HEME 1OARL 3P30H 4U1IA 4XNZB 4OFQA 2XJKA 1ZK5A 5IVXE 3F58L 2P24A 2CIKA 3BZDA 5DEFA 2XOTA 5IQ7H 2R0WH 3QO1B 5LUMA 2RB8A 4Y2DD 4ABVA 4R4FL 3US9A 3QZBA 2WXMA 1J8SA 1YMMD 4FHBD 3FTSA 4IEFA 4Q97A 5DRXB 1G9NH 3ULUD 4IU2A 4OI7A 2Y4SA 5CLXA 4QI3A 3MLXL 3IJ7A 1Y1DA 3M1BA 3L4YA 4L8BA 3PNRB 5EZLB 5I8KL 5EH1A 1U3NA 1NPNA 2Y36H 3K1KC 4ICXA 1MJ8H 4JN1L 4FFZH 4WWKC 4JBSA 3UFIA 2QSVA 4TVSa 4PV1C 2VOBA 3ARDB 3PYCA 3VO0A 5HY9A 3BN9C 2GY7B 3WYRA 9PCYA 4X6EB 3DX7A 5KVDE 4KO7A 3EFOA 4N3UA 3TVMB 3HI5L 4PB0H 3G6XA 5E08L 1E2VA 3NZHH 3PUCA 4WW2A 3RIAK 3IMVA 1L5GB 2L7JA 2WQUA 3LRSA 2WXOA 4HIIB 3ZZQA 4H1LH 5JPNC 5L1LA 2RF4A 1BQLL 1O6SA 5I1JL 1C08B 2BJML 1IVLA 4UAHA 4YHYB 2YSSA 1XWVA 1FO0H 1PL3A 1ACXA 2ZP9A 4GT0A 5GHWL 2AXFA 2KL6A 4JFDA 4HOZA 4HKBA 1FBIL 3OJDA 4KOCA 1AGBA 4LCCB 4ONHB 3U9PL 3EW3B 3K80A 2P28B 4XE0A 5D7JA 3TN0D 4ZOEA 1WLHA 1C30A 5GS0C 4IRSB 2EILB 1Q9WB 4AQAB 4ECUA 1W0YT 3BPCB 4IJ3C 4M4PA 3BAXA 3IE9A 4HU8A 2G3XA 2NLJA 5FAAA 4YAQA 1A9BB 2Y72A 3DOSB 2BHUA 2OJEB 3LV3A 5D9SB 3O2VL 2BS9A 4P59H 2H3NB 4NCC2 5FHBH 5SWZE 4EBEA 4HWNA 2ADFH 4TLUA 1N34H 5JOEA 2NXYD 1XGTB 4TV9F 2Y5TB 3TXAA 3DI2B 3PHQA 2UVUA 5FDWB 3VFVA 4M62L 4BSVA 4X9YA 2P5EE 5DD6A 4M61B 1AZUA 1MVFA 2W0FA 2IH8A 4QCIA 2QHRH 3DXAA 5DJDB 4P5KA 3EYOA 1DDTA 5TGBA 3ARFA 4WCYH 1JNHA 3KPSB 2BWDA 3KYKL 5EEUA 3GV7B 3ETTA 2B8OT 1F58L 4OD3H 3OLGA 4EN3C 4IBQA 3BKCH 1OGAB 2ZCLH 3O8XC 4NN6C 2GK0A 2CWRA 2MCTA 4HNUA 5FM8A 4P2QE 1D6EA 4B7LA 2P1YA 4CSTA 2HRHA 5BMFH 5I1EL 3GQFA 3V6OC 5EU5B 4JGNA 2DQEH 2YZ1A 4HQQL 2VZ3A 2DQHH 1MCHA 1E8YA 3MNVB 5DURB 4F27A 3AVEA 3UBGA 5BO0D 3TESA 5J89A 3CMOH 2B2XH 4FS0A 3NT0A 2H45A 3P9MB 4YAKB 1A65A 1T6BX 1HHKA 1N9PA 4JM2A 4WI4A 3AITA 1T5KA 1DSFH 3SYAA 3MJGX 3HR5A 2J8UB 3CSBA 1AANA 2H9GA 3CVIH 4G3IA 2B77A 2UWEF 3KJ6L 3CX2A 3A67L 5TQ0H 1FNEB 4ZMXA 5B8CA 4ZUSA 4MA7H 3ARXA 2DTSA 2AXJA 1MG3C 3ILQC 1N67A 4M1CD 2RA1A 5CO1A 4LT7A 2E7LA 1DBBL 2YA2A 3QUML 3KYOA 4QHNB 5KBMA 2ED7A 4F8PA 3VWJB 3C60B 2W91A 3HKZE 2J8OA 3LS5L 4OCSL 1N2RB 5HYSG 2IH9A 2VW7A 5DQJA 3GO1H 4P2OB 3CZFB 4QRRE 3WO3B 5C1OA 3V6FA 3P0VH 2C5DC 3I6GB 4KTDH 3MLRH 4ZMZA 4YE0A 1VEMA 1OAZL 1HCYA 4I3SH 5KVEE 1I4FB 1UENA 5IBLC 1CD1B 1OAKL 4UAOB 5KSUA 4KITB 1WCBA 2OR9L 2XTJE 4RGMB 3UTZB 1X5GA 4IGBC 3V5KA 4XYLB 3WOVA 1KLGB 1SDYA 1AQDA 2MH4A 2UY7A 4I2XB 4EIUA 1IC5H 2OS7A 3QISA 4WV1B 5CGBA 2G2RB 2PCPA 4Q6IC 5JHBA 1AS6A 5T5FL 3WNIA 3SKMB 3GIMA 4OZHF 3DX8A 3QUYB 3UZVB 2ASJA 4CVWA 4F9PC 1PVHA 1KACB 1QI3A 1U0QA 4F4XA 5CP3H 1LTXA 3EYUH 2FCBA 3OHBA 2PPFA 2ALZA 1P4LB 1MCIA 2E2HA 1O7SA 4FQXD 3QSKB 1Q38A 4FMFA 1CL7I 3S3CB 1HEZB 3HXLA 3EBGA 1WTLA 3GRGA 5KS9A 3B9KD 4OZIA 1OAYL 4K9EL 5F96L 4NCDA 1KZQA 3KXFD 2IDUA 1HH6B 2H41A 2Q8AL 3BZEA 4EEYA 1PCXA 4H8VA 5IB3A 5ACZB 3L7FB 1XGPA 3O6FD 4PJ9A 5DUMH 5DWPA 1CXIA 4YMPA 4ZUUB 5IYZF 1AD0A 5GONF 1J18A 4XPBL 1Q0EA 1ROWA 1I1YA 3ARRA 3U6XA 3VXRA 3RU8L 3RIAF 4L4VD 1NFDF 4FD0A 5G55A 2HVRA 1CTNA 1TQWA 1XH1A 2R9HC 2Z4QA 1MDTA 3RWEB 2Q6WA 2PPCA 3BP7B 1Q1JH 3K5IA 3ELAT 4YSTA 5HHMD 5DT1H 4RZCB 1VACB 4HDIB 4B9KC 2R27A 2W81C 3D5OF 1UFUA 4W9GC 2JB5L 2R7EA 3MMEA 3SCMA 1RZIB 3OSVA 3FSWA 5J1SC 4FQJL 3GS7A 4MX7A 4PJ7B 3FQ1A 2NRDA 4O3QA 1X7QA 4LSXA 3SBWA 1OM3L 1GGBH 1OAUH 1R3HB 4JQIL 4MD0A 5F7EL 3S48A 4M8UA 3SPCA 4PTUA 1EEZB 3LIUA 3FUJA 5LLIC 3W2DH 4X6CA 2R2EA 2AJZB 4PBWD 4YH6A 1O7DE 2X89D 5IY5B 2DMGA 5E1QA 4LH6A 1OP9A 5AUMA 4HIHB 3FONA 5D6CB 1OAJA 4NO3B 3CBRA 3BD5A 1EO8H 2VDOB 3FU0A 3SGEI 4O02H 1F11A 3QYCA 5GS2D 1IKNC 1JZEA 4NNYB 4AYGA 1JGVH 5E2UL 1LK3L 1PEWA 2V2TB 4I4WA 3G9AB 2AK1H 4K5LA 1Y0LA 4GP8B 4JFEE 2W94A 2D9CA 2UZYB 4ALAH 5CEYA 4ABQA 3FRPG 3VXQB 3FULA 1NDMA 2VABB 1CXLA 5DO8A 3HZMA 3WN5C 4B9IA 4LEEA 1J9CT 4ABUA 2EE9A 2XYBA 3FDWA 3KAAA 4XN1A 1SBSH 3C60D 1E4EB 3LN9A 1KEGL 5EF0A 3GB7A 3CPUA 3S36X 3VX0A 2N3JA 4X0KA 2WZPD 1JZ4A 2F18A 5FA4A 3F7VB 4BSWA 4PRHB 5DG8A 2L7EA 1LK2B 1S8DA 4MVBD 1ULZA 3ZN6A 1DL7L 3RB7A 3SZKC 1TTFA 4K71B 3HBQA 2BWQA 2HJKB 3D18B 4GUPB 4HH9A 2WQWA 3U48A 5GS3A 5F7UA 2W9CB 1QFPA 3P02A 3QJSB 3QW9A 2GIYA 2BQUA 3I6LD 3T5JA 4EXPX 1J8HB 3HZYA 4XVJL 4YBHA 3LZPA 4GAYB 2VUKA 4K7FA 1AHWC 4H2AA 2R8GA 2FECI 3UC2A 2AJ3A 5HVHB 4L2YA 3K8MA 2IEPA 2NY2D 3PCYA 1QSFD 3UAEA 1B2WH 3FXIC 1TPXB 3S3BB 1C8QA 4Y4KB 3KDPB 3G5WA 1N33H 5KSBA 4YY3H 4ZO8A 5T1MA 3U4EB 3UTTB 1UZ6E 4Y5VB 5EU6E 3DOHA 4Y19A 5EUOB 2ZYHA 4E41E 3V0IA 1KTKE 1EO7A 2V7HA 4C4BA 3PABA 4Y4FD 4FFVC 2BNQE 2WZAA 3DPBB 3R23A 2OLSA 3HFML 3V4PB 3EYSH 1ZRUA 3VW3H 3L4XA 2OSWA 1LNUA 5DHYA 4B41A 3FO0H 2BFVH 3BSZA 4ANWA 4OAWA 5KFKA 5JA8B 1OT1A 4MS6A 2NY4D 3N41B 3EJYD 1E9QA 1I1CA 1D9KA 3MREB 4A6YH 4Z7WA 4M3JA 1H6EA 4N9GB 4RDBA 5AKRA 3FQ2A 1T4WA 5AYQA 2YK1L 4UM8A 3U36A 2XZQH 1OGTB 2B1AL 2ITEA 4F4WA 3M7OA 2G5BB 4ECRA 5DLGA 4LSUH 3BKMH 5I66A 4EAEA 1A6VH 2FLNA 2GI0A 4Z7NF 4IKKA 3L1GA 4P3DA 4Q8EA 3PWNB 3T6WA 3QIWB 4LCWA 2VXTH 1HXKA 4U6HB 4IKNA 2X44D 3BAWA 3PGCA 1JGLL 1RJZB 4I0PB 3REWB 4LBEA 5IMMB 3U2SB 3S5YA 3P9WB 4U6VH 3QFJD 3UBXB 3WO1A 2F19H 4GRMB 5FR3A 3CN1A 1R3KA 1HQRB 1S9VA 2VKXA 2Z7YA 2DIAA 3CFKA 3KVQA 3HB3C 3MRCA 4LASL 5F93C 4LL9A 1ECZA 3ECVA 3DHPA 3DX6B 4NJAH 3DBSA 3RTQB 2W5PA 1QHQA 3BO8A 3UC0H 3UAAA 1XGRB 1IRAY 3LB6D 2OMVB 2VQ1A 4LARL 4OGAD 5DLML 3US1A 3FN3A 4JHVA 3MJFA 3K1DA 2C9XA 2BIHA 5E51A 4BQBA 4EOWH 4HLEA 5HYEA 3QPKA 1JHKL 3ARED 1UQSB 2XIGA 3BAAA 1CDHA 3UAJA 4K3GA 1FZJB 4OLYL 4L8CB 2NY6D 4PTTA 4FJ6A 5D93B 5HHQB 3JWDC 9CGTA 3AWGA 3V6BR 2Y0SE 5AOMA 1TTAA 5C9JB 1HYSC 2E86A 5IFAH 4MJ2A 2MOQA 3ORQA 3ZT7A 5JHDB 3IDGB 2C3WA 2XKNB 5T1DH 4LSVL 3CVHB 3H8NA 3ZR6A 1FORH 1GMEA 3L3OA 3O4LA 4X98B 5L6YL 1JRHL 4ZZFA 4QW8A 3WENA 4R83A 5KYYB 1KJ9A 1U4EA 3CHSA 5DI8A 5BZWB 4FQCL 4F7CB 4O2FB 2CKNA 1KXTB 3B83A 1AO7D 3NABH 3CE1A 3HN3A 1CE1H 3WNMA 2R92A 2PABA 2J1YA 3OC5A 3VD7A 5BOPA 5KFGA 3CIAA 2DYSB 2Z91B 3HMWL 3IFLH 4W93A 1ZJBA 2CHDA 4KGLA 5DJ2B 2I80A 1G7LA 4GQ9L 2ZUYA 4YHOL 4XMKL 4LCYB 3IMTA 2Q76B 1QBML 3ESUF 2XVKA 3ZY7A 2FWUA 2JMRA 4TVUA 2IALB 3BVTA 4LOVA 3ULVL 4GBXB 7FABH 3MHZA 1KN4L 5DD1L 4RU9A 4Q89A 2X9ZA 3NCJL 3WEOA 5MEND 2BFGA 1FZMA 4HD5A 4YSEA 2VSCA 3O3DB 1BYNA 1OOWA 2YN5A 3WLBA 4R7NA 4MV8A 4EGQA 3KJ4B 3KLQA 5F3HA 4QRSB 5GRUL 1TG8A 3AS0A 4G1MB 1BXUA 2J3SA 4DLKA 3TP4A 4Z0BH 2DQGL 3NP3A 4RQQB 1UADC 2M1KA 3RFZC 3WE1A 3GQCA 3WFBH 1T22B 1NMBH 3ESPA 2YPVL 1N6QH 1J0YA 1TJGH 2MOGA 2NZ9C 3X1FA 4NUGH 2JIXD 2FEDD 2Q2TA 2Q3XA 3KBHE 4IBWA 3NH7L 3ZHDA 1RIHH 4I55F 4R97C 3AUWB 1Q9KB 5KX5F 3D07A 1TVBA 3ABMB 3QUXC 1B2YA 2NT0A 1WEJL 3ARGD 3NJFA 4G8EB 1LDPL 1UACL 3FQXA 1A8JH 3BZ5A 3ISYA 1CLOH 1PSKH 5CJXA 4P3WA 5E6YA 1CE8A 1OXYA 1N64L 1EXHA 3SQBB 1RPKA 2HRLA 1UZ8A 3DSFH 3VWKB 1VAHA 2NR6D 5BRQA 2DQDH 1HHIB 3NK4A 5DQ9A 4DR3H 5ID0A 2G3ZA 5JW5A 3QHFL 1MQKL 1XB8A 1ZTXH 1F2XK 1WZ1H 4PJEE 4ODSL 3MO1B 3MRRB 4UTBL 1QYGH 2WSPA 5T1KA 1D5MA 1ZSDA 3G5YA 4KNSA 4PGBB 5I5IA 1JDDA 1OSYA 4DIXA 3QYMA 3Q6FA 2A6DB 4QXGL 4GEJA 5KVGH 1VFOA 3SYCA 4TUJA 1N0LB 1MAJA 1E5CA 1OO2A 2WNKA 5BJTB 2W6NA 1MCDA 1KPRA 1QLFB 1RY7B 5KG2A 5HYJB 4JHAH 4P2RD 5DS8A 2UZPA 2B1HH 3BT0A 4PJ5B 5A3ID 1S7SB 1M7XA 4EF3A 3OSNA 1E4XL 2H32A 2FT7A 5EUKA 2VJ0A 5I1DB 5ANMA 2X1OA 3LXUX 2VN6A 3G08B 2R7LA 5JUEL 1Q9OA 2LTQB 2VC2H 3BX7C 3LS4H 3MGTB 4RISH 2BNRB 4ZFQA 1HNFA 1U8NB 3J7AK 2GI7A 1ZHNA 3AABA 3ULUC 4JN2A 2A5UA 4U0RC 3LP8A 3RIZA 4IHBA 4MB1A 3Q5YA 3QIUC 3U7WL 3UCRA 5DMJB 3JWOL 3HE6D 3RBSA 5D4HA 5GS0H 5DHEA 3FO9A 3A47A 4KHTH 4P57A 3HZ3A 5D7IE 5GIRA 4QRAA 1DQQA 5D7LD 2R2HA 1NBQA 3L3DB 4JG0H 1MDAA 4ODXB 3VRJB 2CUAA 2DQJH 4WENB 2NNAB 4Q9QL 2KZWA 2VLJE 1YPZE 3WKQA 4G2AA 1CDJA 4HYKA 5I6XB 3LH2L 5CILL 4Y4HB 1KCWA 3IPFA 1DUYA 4HK3J 1KCSL 4IRZA 2V4RA 5DJAA 1EMTH 1CFMA 1VRSA 1ZEAL 3ZTCC 4DWHA 3BC9A 5D6DC 5F0LB 5IB4A 1JAEA 1BIHA 5F72S 1AZCA 4YQWA 3ILDA 2W6PA 3A0OA 4BEIA 2GBUA 1ODUA 1PYWA 1W72A 2WQRA 1S7RB 4HU2A 1C5DB 4HPOL 2SEBB 2FVNA 4OM0H 1J05B 1DQDL 1QTSA 2XI9A 4PRDA 4TQRA 3W9DA 4GFTB 5A6MA 3MLWL 1QFWI 2TSBA 1QD0A 5I16A 5DVOA 4YWGH 4E9SA 2IDFA 1I85C 4O58L 1R24A 3GJEA 2GTZB 2W0KA 2MNWA 1G7IB 3OWRA 1J12A 3L2NA 1A1NB 1TTGA 4OU3A 4U33A 1L0XA 4AVHA 2E27L 1WVZA 4Y1AD 3O4OC 5CWSA 4H0GA 4OT1H 1E5YA 1JXDA 4E36A 1NIBA 1G4MA 4R5VA 1KTBA 3L5IA 2DH2A 4MDIA 1YEDA 2QVMA 3QRBA 2UZIL 1KTCA 3UZQB 1M1XB 4IS6B 1QLEB 1BXRA 2NXYC 1Z5LB 3GXUB 1O7VA 1ZLDA 1YZZA 5F1OB 4ELDA 3VD9A 3RWGB 2J43A 3GJFA 3TBYB 1B3JA 3ARBA 3QUKA 4FTVB 1BZ9A 5DS2A 3B2PA 4K9EC 2XXCB 3WIIH 3TZVB 2XSKA 4APQD 2P7TB 4U2YA 3FT4B 4OIFA 3LPGA 1PLGH 2YC1B 1BBJA 3PDGA 5KOVC 4M7LT 1KBKA 2X4RB 3Q06A 1I31A 4E4TA 4UM9B 1U21A 4MJIA 5B39A 3RGXA 4I77H 4LSAA 1WD9A 4R8UA 3VMNA 1G0XA 2GT9A 3SOTA 4BFNA 3SDXE 3UQ8A 3WN6A 3BZFB 4PY7A 3RB5A 1FFNA 3HG1D 4YLCA 1I9EA 1MI5A 1BF5A 2W95A 2D2OA 1T89C 4U1MA 1E42A 1WT5A 3O9WB 3IJHA 5D71H 2VDQB 1U8PA 5ABZA 4QYAA 3BFQG 2JA7G 4JHBA 4EG0A 2E8YA 2CQVA 3B1TA 1UB5B 4P9HC 1AGDA 2QLVB 4GS7C 4ZO7A 3U0WL 4A3LG 1X5KA 4OF8A 4GPVA 4DP0X 4OV5B 5EC2B 1E27A 1JTOA 2R51A 4WTQA 3BE1H 4R8WL 4GRLA 3D3VE 1AMYA 3PQYE 4FQLH 1QLRA 1NFAA 4IBZA 4IYKA 4X5WA 4ISVA 4MQXC 3ZDXE 4F80A 1DBJH 2BSDA 2IPUK 1DQLH 1IOVA 3H20A 3OG6B 1YNKL 4O3NA 2QV4A 5AL8A 4C83B 1BLNA 5HV6A 2ZF9A 3T4AA 2Q5BA 4NXMH 5ABAA 4AMXA 5F88A 1BZEA 4JUZA 4I7HA 3DROB 5C8JA 43C9B 2PW1A 3GMMB 4XP6L 3C5JA 2K70A 2ZOLB 3AY2A 3PHSA 5AVSB 3F6JA 5FPRA 1A1MA 2O5NA 3TONA 2W9AA 4UQ3A 3TV3L 4HOMA 1O9VA 3H4DA 2HVBA 2JA6A 1SMDA 3NFSH 2Q86B 4EYIB 1EEYA 1UCBH 2A73A 2H3XC 4KDVA 5DHVH 3UPRB 4P4KA 5KFUA 5AW5B 4K23H 1DQJA 3GZQA 1F3RB 1IIKA 5AZUA 2D31A 3QG6A 1F4AA 3WTYA 3KWWB 3MTRA 5KJRH 1FVCB 4B27A 5HHPA 4MNQE 4M7KL 3RFRA 2VZ1A 1I7ZA 4N8VG 4NJ9L 1HXMA 1N0XL 4L9LC 4NO5B 5ADPL 2P5WD 5BZDA 4F1SA 4NZTH 5C3TA 3SOBH 2OTUB 3HN8A 1VKXB 1LEKA 1FVDA 3DYOA 4LCCC 43CAA 3GIIA 5IIEA 2PMZA 4X99B 2Z7UA 4BCXA 1IIIA 3Q3GB 3KS0H 4PJGF 5GJSH 3TIDB 4CRPA 3FCTA 4IRSC 2EDMA 3SDCD 1ZTXE 2H1XA 3P73A 1A7RH 1RULH 1OP3H 3ATFA 3VI4E 5HHNB 4BUGA 4FQXC 3T1FA 2HVKB 3KLSA 1GIGL 1AG6A 2OTPA 4HIEB 3GI9L 3NCWA 5JNYB 1Y07A 3B9KC 4HFUH 3ARQA 4MWFB 3CXDH 2BHFA 5KVGE 3OLEA 3SGDI 4DKEH 2Z31B 4KXBA 3ZYOA 2IDTA 3U9WA 4N86A 2QSTA 3KPLA 3VXME 3L5WB 5IR1B 4N6QA 4P49A 2DS4A 4A3IG 1F3JB 3U83A 4ZW7A 5CUSH 4XC3L 1T3NA 3QC5X 3RDTD 1A9EB 1AFVH 3L16A 2ID5A 4B9CA 5E9DA 1ET7A 1DJSA 1DFBL 4LPYA 1O5PA 1V5JA 2FE3A 1IC7L 3PV6B 2E4FA 4DN3H 1X7SA 4PJBA 4X7TB 3O41A 3ZQWA 3ULVF 1XSKA 3S8FB 2VDML 4EI5A 3G6AA 3TF4A 4ZG1A 4UB0L 3EYVA 1DEDA 3K4AA 2DKSA 2JI1A 3DO7B 1SEQL 4JFWA 1BQHG 5HGDB 3WL9B 3GZKA 1IM9B 3O9WD 4ONGH 4QW9A 1WWWX 3CZKA 1ZDQA 1PAZA 3FU5A 5IV2A 3MBEB 1ROCA 4OI8A 1GS7A 1BJ1H 1LEGA 4YSRA 1FV1A 3BP6A 1J9QA 1U8QB 4JJ5B 1JNLL 4TUOB 5C0GA 2V8LA 4YO0A 3W82A 3UIZA 1E4HA 3H9SD 2UWEB 2Y3AA 1C8PA 1HAWA 3MV7B 4A2EA 4IRJD 3Q2VA 2Z92A 3OX8A 4P06A 4KKNA 5DHXB 1LGVA 3V4UH 5HD8D 1KIRA 1VJSA 1Z9SB 1T1ZB 5C08B 3TFBA 1JPGA 4ECWA 4JPQA 5C0BD 3Q8RB 3CDCA 1JP5A 4NWTH 4DKDC 4ODTL 2BO0A 4J3BA 4JW3A 1DANT 3V6ZA 3D39D 4K5MA 4JFZL 3EGXA 3ME0A 3OAYK 1XCTA 4OQTL 3CVBA 3KEDA 5F9OH 2A38A 2O6FA 4JFXB 4P23D 5D2NB 4ETQB 5MHSD 5H2BA 1NL0H 4BFIB 3K71B 2GJZB 4X7CC 4Y2NA 1IGML 1BMGA 3LQAC 3LNEA 4OF6A 3S5LA 3C60C 3WFDL 5EIIA 3F04A 1NH6A 1MH5A 4YX2H 3AADB 2FIRT 3H4HA 3V5HA 2BHYA 3L3GA 3GLDA 4PBXA 4WKXA 3QZPA 5CZVH 3VFMB 3WTXA 4ED0A 2WIIB 4P2OC 3BT2L 4Z7UB 1J8KA 1A6TB 5JHAA 3L9YA 2VH5L 2H6PA 4R3SB 1K2DB 4XMLL 2WO4A 2ROYA 3P0YH 4J6RL 4QO1B 2DLEA 4L3AA 1ZGLM 1UYWL 4UAOC 5CJOH 4ZDHA 3DVGA 4OZHB 3JTBA 3DX3A 3WKML 4OLWL 2WP3O 3R06B 2W6OA 4RGMC 5HGAB 2QPSA 4HJ1A 3OPZL 1NSNH 1G6RH 1VEPA 1OTUD 3ES6A 1KJMA 3LEXA 5KT2A 5J12C 1A1OA 5ESQB 1E4KC 4M5TA 1BIIB 3QZ7A 2ODHA 2NY2C 2O5XL 3MBWB 3TO2B 1NC4B 1QBLL 1SLVA 3QUYC 5DGQA 2EKSB 3MOAH 2MPAH 3H0TB 4OGXH 3UTQA 4ZSOE 3ZZ1A 5I1KL 2NU8B 2YYAA 2PWHA 1U8LA 2C28A 4I85A 2V3DA 3T3PF 2CDGA 5F6IB 2AF2A 2CO7B 5CP7A 5FWQA 2RGRA 2VR1A 3A4EA 1AZRA 4KNUA 4LVHB 2EDWA 5FB8B 1GS8A 1UKTA 3MLVL 1XH3B 4YHLH 4ZMWA 3M4IA 3ZTJG 4XN4A 1LDSA 2COVD 5AW4B 4Q14A 3FT2A 1HQ4A 4S1QL 3E80A 1MFCL 1NFDB 2KDGA 3BWZA 3EOAA 4IBYA 3N44F 3ZKND 3BZ4A 1E65A 2E4TA 4HV8A 4Z7VA 4I9WD 2P46B 2CCWA 3VUAA 3EJYC 3QIBB 5I6KA 1SVCP 4B3MH 3F58H 4M3KB 3PE9A 2D4DA 3KE0A 1A02N 5KWYC 1JWSA 3E2HB 2DI9A 1KEMH 5FJ8G 1PMYA 1A6ZA 1T6VN 2XJLA 3LH9A 3JWDH 3TFKD 2X4PB 3OF6D 5I8OL 5DC4B 4C56B 4JFDD 4NPYB 3WS3B 1AHMA 4XN7A 1PCSA 3MLXH 4MXWL 2CO2A 5T3XD 5D1ZA 2DMKA 5DZJA 2AEPH 4W1TA 2WBJB 2IP4A 5D7JD 5KZCB 5I8KH 2NY5L 5LL6b 2PYFB 3TV8A 3KBEA 4GC7A 3MV9D 5GS1B 2P52A 3IMRA 4JN1H 4PV8A 1ORQA 5IJCC 5I8EA 2H6OA 3ZQ9A 2JLLA 4BE5A 4A66A 1BJTA 5AOLA 2HVJB 3B5HA 3WTWA 1QKZH 1CYWA 2WP3T 4M43H 4UT9H 5FA3B 3MUGB 5GSVA 1IBKH 2X28A 2I60L 3MA7B 2O61A 3QR0A 1WWAX 3LHPL 3JXAA 2FL5A 1RCYA 2DWTA 4Z77A 1V7NH 3LYRA 3AAZA 1RK5A 4OGAC 4F7EB 1RH8A 3H42L 1LILA 4LHQB 2CBOA 2WM0A 5K1VA 5I1JH 4N0RA 4NKOA 1GOGA 5T33L 4FNQA 3AREC 3ARFD 1AGCB 2P5PA 2WTRB 4HGWB 1QRNE 4YJ3F 2LHAA 5M95B 3WTSA 5I74C 2NY6C 3ZTJH 4FLSA 1WBZB 5GHWH 1PU0A 2XG5A 3FQWA 4RX4D 1NEZA 2Q20A 3BPNC 3U9PH 5ANHA 7PAZA 1BHGA 4AH2B 1WV7T 15C8L 5G5DB 3RDJA 5B1AB 4B3VA 3VGEA 5LCVL 3KPTA 4GAAA 1NCCL 4PJ8B 2AQQA 4AQOA 4MMYB 4X6DA 2MJWA 3TPUB 3O2VH 2V2WB 2VXSL 3QZNA 1N8ZB 3IMSA 4FFYA 1R9FA 4O2AF 3UTSA 2WB7A 5F70A 2VSKB 4U6PA 5FM5M 5ITBL 2R2BA 1HSAA 4TM9A 4Y16B 1JK8A 5KFLA 3H2WA 4M62H 1P1VA 3QDAA 1JMZA 2O5YH 5E6RB 3VMPA 4XMUA 3S4SB 3MR5A 4PWQA 3F5WA 3TIEB 2BSSB 1B9ZA 1U3JA 2XWXA 1DVZA 2Q7YA 2GC4C 1B04A 3KYKH 4GG6E 5HVHC 1OAQL 3FBKA 3MLTB 5LO7A 3STLA 1UKSA 5ALBL 4ANVA 1F58H 1RUPL 2VDLL 2NQ3A 4LSTL 3T71A 2D3VA 4UZUA 5JVDF 1TPXC 1BG1A 1NFIA 1HEJC 2ARWA 1XDTT 2X2HA 3DETC 3KYAA 1RHFA 5D7EA 3WHE0 1KGCE 4Y5VC 4GW4B 4XWGL 1H0DA 4DQAA 5J6HB 3CZLA 1KDJA 4FQIL 1FZOB 2VRQA 4QOKA 5F9JA 3DX2A 4KKLD 4YDJA 3SPJA 2J2ZA 5IJDC 1EDQA 2FEDC 3UBFA 3RZCA 1G7MA 3DSNB 4PWJA 1A7NL 1E8XA 4WDIA 2IAMD 2AANA 3ARGC 1ONQA 4GRWF 2OSLB 2VR7A 2WJ5A 4ME6A 1TZGL 2EH8L 2J1WA 4HEMA 3ULUH 3M9MB 4Q6YA 3BUYA 3OR6B 2W92A 4Z7NB 3K72B 3WIHH 2FHFA 1IT9H 3PDDA 2ADGA 4GG8B 5T3XL 5IVXA 4PGEB 1EUDB 5DSCB 2C4FU 2NR6C 4CGTA 2HTKD 1TTBA 2ZKXA 1R3IH 1SFOA 3LDBC 3GLEA 4WW1B 3KJ6H 3L4KA 2VN5A 4ZX4A 4RAHA 2C1OB 2FJHB 4XPTL 1MIMH 3FL7A 3B2UC 3FZUD 3QIWC 3K5SA 3IDUA 1KC7A 1DBBH 1ZT1B 2YFOA 3QUMH 1U93A 2DM2A 4JVUA 2EIBA 3U4BH 1FC2D 2YO3A 1UTDA 3LVTA 1GVIA 3V0JA 2PXYB 3HB9A 3EFDL 3EKCA 2F0CA 3I75A 4U1NB 1GYWA 4FULA 2WC7A 5K9OA 3RTQC 2CGZA 4E42B 5DEGB 4PJ9D 4WEBL 2AEQL 4K94C 3ZUCA 5EEZA 3C6LB 2CMRL 2KZ1B 3V4VA 5DZOA 4GKZB 5DRZA 3VXRD 3SKOA 3RILA 5AYTA 2OM5A 1CFNB 1BAGA 5SX4H 1YEFL 3DUSB 3HE6C 1JX4A 3TBSB 2J6EH 4H44C 5FXCH 2J88L 3NIDF 4QD2E 5JIPA 3MOQA 4XCFL 1YUHA 2W9DL 5L88L 1HHGA 4H20L 4LSPL 4R4BA 3SCMD 3BGMA 4IRKA 2CIIB 4KROD 3FB5A 3A5VA 4JDEB 4NENB 5F97E 4MAMA 2VR4A 2MNJB 1MCQA 3OSKA 1JCKA 2VLRE 5IOPB 4R90H 1NMCB 3FQYA 5ICYA 5DU7A 1TMQA 4XH2B 5EOTB 4AEFA 4K9EH 3P3UA 4F33A 4Y5XB 5JORA 4BY7G 3QI9D 1LQBC 2EO1A 2QADD 4HWBA 3VI3B 1WC7B 2JJTC 4O4LF 1RZGA 2Q8AH 3MRBB 1A4JB 3V6OE 2IC2A 2YGNA 1FCCA 4J4PA 3HG0A 2DN7A 4N8UA 1UNNC 2R29H 3GIJA 3MRFA 2P5EA 2DMCA 2ATPA 3DJTA 2ICEB 4U1GC 4W6XB 2QKIC 2HRGA 4XPBH 2R86A 4GBXC 3CWGA 3RU8H 3H85A 3EG9B 3CVZA 1OZUA 1VCBC 3QH3A 4HJGA 3MVSA 4J9PA 4J3UA 1YAZA 1EAPB 4ELMF 3TH2T 4NSKA 1X6NA 4MV6A 3FCSB 3BISA 3QULB 4P9HH 4AQZA 4UANA 3WFZA 1Y1WG 4P2QA 1YY9C 3BIKB 2GAZA 1KFAH 2AJXL 3LY6A 3PWVB 2EDXA 1D5XB 2O6DA 3KPMA 1OM3H 4DQOL 1A3QA 3P9LB 5F7EH 4HSAC 5L8KB 1BJ8A 1T1WA 3RB3A 4KFMA 3QJVB 2YLHA 2WLKA 3VH8A 5D1XD 5BS0B 5CLTA 4Z3JA 3MLUH 1UXWA 5F9DC 2IOOA 4UTAA 4PP2B 3D2UD 1M71B 3OMNB 1TZIB 3RAQA 4LPTA 5HGHA 3HBGA 2F58L 1XGUA 2B5IB 3P3SA 3C09B 4NNPL 4LRIA 4RGNB 3CNKA 2IMMA 5K93A 2FJFA 1HWWA 3DURB 4ODHH 5E7FA 3HS0A 3GUTB 1KJQA 4JV2A 1G7PA 2WVVB 1LK3H 3GXPA 3K6OA 5E2UH 1JF5A 5EO9B 2AV1B 1FIGL 3PPEA 2AU0A 1PG7W 1SJMA 5CZXD 4D9QD 1CJYA 2LQRA 1RUQL 2NY3B 4NQXA 5K39A 5HSFA 1U91B 3DBXB 1G94A 1DBAH 5HDOA 3HNVL 4Y19D 1OF2B 2F53B 1YLBB 2K4WA 5DFWH 1HKLL 3DV6A 5ADOL 3ALXA 3I6SA 1A6WL 3FU6A 2DWDB 3HKZA 2VDRB 3T65B 5HPMA 1VF5C 2VL5A 3MBXL 3UCQA 4HC1A 4R5XA 2XN0A 5DRNA 2WBWB 4QRRA 1ORSA 3W38A 2DWYA 1KTLB 4V1DE 1DL7H 3B6SB 4L0PB 1XMWA 2LTQC 5FOBA 1ZDSA 2ZXAA 1X6LA 3AU1B 1EZLA 2EC9U 2A4CA 2YEZB 1CC3A 3OVUB 3CMGA 4IBSA 4PW9A 1ZT7B 3K7UA 4P46A 2OMZB 5CNHA 2LT9A 5HVFB 3BVWA 4YDZA 3HEIB 1OGPA 1QR1B 4A3BG 3MCYA 2F1EA 1GGIL 2F7OA 4YEFA 2OQJA 5JMOC 1GGOA 4U7SA 3RQ3A 4PP1D 4HW6A 4Q8BA 4CSZA 5GZOC 2Z8SA 5MEQA 1TJXA 3QNZA 4Y9GA 4RESB 4Y4HC 3TL5A 3CFQA 4JFHE 1IQWL 1E9PB 4RUAA 5J1AA 4PDBA 4UU9A 3PO3G 5KFMA 3BKYL 3HFMH 4ZOCA 5KFPA 4L2LA 4CSPA 2B15A 3PLYA 3RVXD 1PFOA 3DGGB 4RVBA 4OJDH 3T2NL 1T21A 2Y7OA 3QP3A 4H8WL 5BPPA 2DYRB 2FGWL 4W9JC 5DMGD 4AT6B 3KYNA 4M6NL 3ULUE 5E6IB 4PU2A 1KIUA 3QXAB 2CDEA 4WI0A 3JZ7A 2WLIB 5K69A 4IKLA 2B39A 1JGDA 1CT8B 2PTTB 3NRQA 5IROD 4GH7B 1MREH 3QQ9C 4KC3B 3EOTH 2EDBA 2IG2L 2QEJA 2Q7AA 3U9UA 3G5XA 2WCGA 3HNTH 4JAMA 4L8DA 4LE8A 1IM3D 3H55A 3H7LA 4LHUA 2DDQL 2HTLC 1U3HB 2LLNA 3O4LD 3RY4A 2AI0L 1YSOA 3EDJA 3FW6A 4YIQA 4FFZA 1QACA 4XO3A 3L4ZA 4PV9B 2C8NA 1DE4B 2VR6A 3GYRA 5D96B 5GS2H 4LASH 3OXRB 3TZVC 1YQ2A 4M7ZB 3RDTC 1L9TA 1NGWB 4MCNA 4Z7AA 1L9SA 3GRWH 2PWEA 3T4YA 4LARH 5DLMH 4GAGH 1CPUA 1PNCA 5LA6F 3HR6A 1HE7A 5CZRA 2HFFB 1UD4A 2DQTH 5KVFL 1GY2A 4FXKB 2VDNH 4H1LA 2MQCA 3QDGB 4JFFB 4LLYA 1DJZA 2A9AA 3V4ZA 2HKFL 3OR7B 4JFEA 5JA9A 1MEXL 1FO0A 4LPWA 5IF0B 1A4KA 1YN6A 3O9WC 4BHUA 3RVUD 4FXGB 1D5ZA 2ZJSH 3RUGE 1EVUA 3UEZA 4L1HA 1A2YA 4L9DA 2ICWB 4ZPTB 2E74C 1P6AB 4YSPA 4LSVH 1YO4A 4ADIA 1MRDL 1YNTA 2B20A 4KV5E 3RAJH 2OLDA 3SJVD 5L6YH 5EPMB 4E9TA 2BP0B 3R18A 3CFBB 2H1PL 1CICA 1N70A 3GWJA 1ZJAA 4FQCH 1BBDL 2DTMH 4WW2F 4BK4A 2GTWB 1HKFA 3L2LA 2FR4B 3IN5A 4XXWA 1M7DB 4X9BA 1T0PB 4YVNA 1BGXL 3HMWH 4YK4C 4QXWA 2V2XB 5FF6B 4FLOA 2W07B 3W11D 3BAKA 3VQ1C 4ETSA 4YJ2F 1JYXA 3IU3A 1QBMH 2ZUSA 5AYUL 4WO4D 1PK8A 2O30A 5BXFB 1KN4H 5DD1H 2KLRA 3NCMA 4ZZKA 2GITB 1XD0A 3EJSA 3NJMA 3G5VA 5DO2D 2CCLA 1TJIL 1NAKL 1S3RA 4ZFZB 5AW0B 2A3TA 3PDOB 1J0KA 2X0VA 3AFLA 1P9MC 4IK7A 4UIKL 1H5BA 1I8IA 1S7QA 1T3FB 4OZFB 1DVXA 3KLHC 5JLZA 3UYPB 3ARZA 5EU6A 1WFUA 1IGFL 4LLWA 4X8CA 2IANB 2X6VA 4RMBA 1U8KB 4E41A 3OKLB 3QPXL 2HJLB 1IE4A 1Z9LA 1RJRA 4DJMA 2V17H 1YEJL 2VDKL 4C8XA 2Q8BL 4AQEA 4ZTOL 5MEPA 2XACC 1BD2B 2F8OA 3SDYL 4APXB 3WO4B 1A14H 2Z9TA 2FLLA 4ED8A 4FNPA 4PJGB 4XWOD 3MJ7A 3GRBA 1KWKA 1A4CA 1JWMA 2AJVL 3LIZA 1XF2B 5DG7A 1J1XL 2OXGA 4L4TB 4P3CH 1N64H 3COOA 4PS8A 3VSTA 5KT5A 3CK0L 3GGWA 5MERA 5JVLA 5HXMA 3QHFH 5FECA 4LOFA 4N2FA 1OLLA 5FYLD 4ODSH 4X8JB 1NGPH 1BLIA 2GIXA 1MAML 3DO4A 1E5ZA 2CK2A 3C8KA 4ENZA 4TUUA 2R4RL 1KY6A 2W1NA 4QXGH 4RAVA 4A7QA 4S1DD 1QSVA 4V2CB 3LQZB 1IL1B 3V0DA 4QHUA 4D7PA 1CE6B 1MCSA 3LNFA 4R7LA 4P2AA 4YN3A 5TDPA 2C7UB 5C5JA 1ZQ7A 2GPWA 1OK0A 1FPTL 5LAXB 3PGDA 4UINL 1J0HA 2D7PA 2VDOH 3IDMB 2X5PA 1E6JH 3ZKXB 5B38G 5EBMA 2BXZA 5EBLA 3WNPA 2XN9B 5FLUA 2EDOA 2ESVB 1JCVA 2BSTA 4JM2F 5EWEA 5IB1A 4ZXBD 3BH9A 1CD9B 1YQVL 5JUEH 1QP1A 2GUOB 3IAGC 3WEXB 4YBLB 1WH2A 5EZPA 3TFKC 2FK1A 1IBZA 3BWAA 2BNUA 3CHOA 1VFAA 5DJYB 4AIZA 3U46A 1UT9A 3FAWA 3LVEA 3RL1A 4UBDD 1KCVH 5CBAB 3JWOH 3FH5A 4ZMOA 5CU9A 2A4ZA 4GSDL 3P77B 4MMZB 5IQ9B 1F00I 2ATKB 3G04B 4XVOA 2Y0SA 4PR5A 5ERWA 5C0FA 3MBEC 1W0VB 1UD2A 2YD0A 5J13C 1X5FA 3IGFA 3N6YA 4JEGB 1SCUB 1C16A 2QTVA 3LH2H 2YQBA 1R5VB 1BYPA 1AZNA 3OKNA 2I32A 3KXFE 1LD9A 3D4ZA 4PREB 3TBBA 1B90A 2YOCA 1TSHA 4PS7A 4X9FA 2R7NA 3X1GA 1JPTL 3D2TA 3N04A 3GINA 4ETYA 2BOBB 1J86A 1X9RA 1ZVSA 2KDYA 3ZGHA 3UBXG 5C0DB 2IQAA 2RMNA 2V8MA 2YGQA 4XE5B 4YDIH 4KQ4H 4S1RH 1DQDH 1L6PA 5IVZB 4F37F 1CI5A 1W8OA 5AW2B 3SO3C 2ZQKA 4P99A 3NCYS 3K4DA 3KXYT 3MLWH 5HHME 2ZOOA 1HNZH 1XZWA 2IH1A 3CFMA 1S7XB 4O58H 4UDTA 5D2NC 4A7UA 4J3XA 1GHFL 4ODUA 3M07A 4OGZA 5HYSA 5BVJB 1V27A 4DFHA 2E27H 4XHJD 3PREA 3GSRB 4G7QB 4N0UB 3GMLB 4DZ8B 5I5RA 3O6ML 3V4PH 3P4LA 2XN2A 1NCAL 4XXCA 5KS9F 4OZIF 3FQNB 4EQ3A 1LO5B 4JO5A 5GGSB 2ZAIA 2Y6TE 2ZCKL 3IDIA 3QAZB 2UZXA 2F74A 3VG0L 1H3VA 3VMOA 1JPFB 5E8PB 3L5JA 1WG3A 3QEUA 3TA4D 2ARJA 1INDL 1FNFA 2VISB 2BVYA 3AU0A 2VERN 3HCVA 3T5WA 4EFEA 1KNOA 3BSHA 2NDFA 1I94H 2IGLA 1LP9B 3T3PB 5B8CC 1EVTC 3D69B 3J81W 3U82B 4UCFA 4QRPB 1EJ6A 3EYFA 4LEBA 4PJEA 4TLKA 3B3IA 5KG1A 1QWHA 4Z8FH 1MCCA 5CD3A 3A6CL 2BCMA 4R9HA 1K83A 4IRZL 1QQDA 1YDPB 2XIDA 4HPYL 4KKLC 4LIQL 1WCMG 2YRXA 3F62A 1FGNH 1DZ0A 2CR3A 2L0DA 3F7KA 3VXSD 3X3GH 3B2XA 1CFSB 3ZE2F 5E1GA 3U0WH 2FKLA 1W72L 4X6CF 4JR9L 1DN0A 2IAMC 1KTDA 4K94H 4GAFB 4O9HL 2FIKB 4P4KD 1QUNB 2FO1A 4XGZA 4E5XG 2TRHA 4NRZA 4WWPA 1XCQA 5EO0A 2X3BA 2EUVA 3I6LE 2WAQE 4U2ZA 3D4GA 3E2HC 5DD5H 3GV8B 3BH4A 2B4CC 4LSSL 4DK6A 3EHBD 1HWHB 4I2XE 1YNKH 3QDJB 2H6UA 4GAJL 4KXZH 4A38A 3MWMA 1N10A 1XF5A 3LSOB 1QSFE 3HC3L 1L3WA 2WBJC 4FQHB 3UJIH 3FZUC 3ZBMA 2WMPB 3OAYH 1QR4A 3P11L 1G7JB 4HS8H 1P84K 4Y2OB 3VFNA 3VE0A 3S8WA 5GS1C 2DMBA 2ZM6H 1JZJA 5I1CH 4HZ1A 5D7IA 1JYNA 4KZEL 3F12A 2NY7H 5D4JA 2VUYA 3GTKA 2R0ZL 3TV3H 1JI1A 2H8PA 3EJQA 2JI3A 3ZE0F 2VLJA 3RY6C 4OZGA 3QZWB 4M8QB 1RHHB 1V4YA 4XO4A 3PO2G 5IEHA 3JAMW 4IDJH 2E9BA 1Z3GL 3FOLB 5I0VA 3B2DC 2W65B 3MA9H 1XB6A 1SVBA 1PX4A 4GI8A 5K33A 4AY0A 4KQ3H 3EFFB 4U1JB 2D73A 1A7OL 3DK2A 5DHMC 4NJ9H 5ADPH 1N0XH 4PUBL 4NPKA 5KT3A 2QVKA 4WI2A 3FRPA 4YAJB 1OP5H 4XCNB 1TLMA 4JGUA 5GJTH 5E2JA 5GGVL 4FLRA 4NNXB 4KTEL 2F7QA 4G1EA 2N7AA 4AENB 5I18H 1TNNA 4P2YA 2WCPA 4EI5D 1N26A 1E5AA 2VITB 2Z7WA 3BI9X 4A3EG 1ZA3A 3HJ0A 3SCMC 2Y9RT 4Z7OF 5KSBF 5DGBA 2JA5A 4N6RB 1MOEA 3FQ4A 4PJ7E 4MQ7A 2XWBA 4PJ8C 2VMJA 3I3BA 2UV3A 4X6BB 3ZIMA 3FFCA 4N5ED 1GIGH 3QFJE 3GI9H 3AYHB 3MCKB 2YGPA 4WK0B 2ZWZA 2ZX6A 5B1CA 1U42A 3QI9C 1EUCB 5KFBA 1T0NA 5DVPA 4OLUL 1NGQL 4D8PB 4Q2ZB 4YHKL 2IQ9L 2Z4TA 1U8CB 2EEXA 1JERA 2XKSA 5CR1A 4JREB 1S0NA 5CU5A 4XC3H 3WNZA 4Z7WF 1S3KL 3IKCA 2AQ2A 5IHUL 5FO7B 3CLWA 4UOZA 4UCOA 4KDTC 5PCYA 4DW2L 1DFBH 3L5XL 1A3RL 3LKRB 4IOSD 3KPOA 2AITA 3IETB 4PGDB 2VE6A 1VFBA 3MRJA 3R1GL 5FK9B 1X9LA 2QQNH 3SDXA 1SYXB 1IMHC 2BC4A 2WWMD 2CD0A 3RWIA 3MZTA 5IM7B 4Q0YA 3L3JA 3Q8PB 2FSDA 1TTUA 1TTCA 3CIQA 4OIIH 2A74A 2WOYA 2H2SD 2NTSP 5GXBB 5IBTL 3BKJL 3ZSTA 1JNLH 4NYLB 3MRNA 5DMIL 4EZKA 3BPLB 4PRHE 3VSUA 5D1XC 4KFZC 1UC9A 4GKSA 3PL6B 2F7RA 1LEIA 5HDBB 2WXGA 3D3VA 3P4NB 1FVEB 3PQYA 1IAMA 1S7TB 1JL8A 2CM5A 3FHEA 4DOHB 1DVQA 1J8HE 1WICA 2B7DT 4TNGA 3TTSA 4OIBA 4PRBA 2BS8A 3DA0A 4P9MH 1EHKB 3VFGL 2Q3AA 5FDYA 5JIDA 5MENE 3TM6A 4ZQIA 5HGBA 2F54B 2HN7B 2XY2A 3PG2A 4QHKI 4WFFE 3SBPA 1IAIL 4NRYB 4CMMA 4GSUA 4JFZH 4MJ6B 4OQTH 4KAQH 1PY0A 3IDJB 3OKMB 1YY8A 1ZWIA 2DYPA 4ZO6A 4KMTL 3RNKA 2WAHA 1TEGA 3GJFK 4LVEA 4JFQA 4P5MA 2YR3A 4HHAA 4F7MB 2PXYC 2UXTA 4FG6D 4LLMB 4RGOL 3GKWL 2GCYA 2X2YA 1TU2B 4XMLH 3EO9L 3HVNA 2XPZA 4FHKA 2RCSL 1U8HB 3I50H 4J6RH 4JANB 3RWCA 1BAFL 3HE7D 4G6JL 4PJCB 1UYWH 3NIDB 2GSIA 2BSRA 4HGMA 2SODB 2ORBL 3HS8A 4MNQA 4OLWH 4PWHA 1IBMH 2OULB 2NXZD 3IVKB 4UDUB 3CFEB 5CEZD 4YFLF 2XV6B 4L3EB 2J6SA 2X4TA 2AXGB 2JTDA 2NW2B 2PP7A 1BMWA 1SXBA 1BG9A 3FUFA 4JFPB 1QHOA 4N24A 5D1ZD 4YBQC 3JUZA 2WXKA 1HOCB 5I1KH 3HPJB 2BP5M 2FQDA 2VN7A 1B88A 5I17A 2P44B 1F0LA 4Z3EA 2UYLB 4DL7A 1G9ML 1SY6L 3VI4A 4WWKA 3TEUA 2I07B 1L9MA 4JRXB 4P2RE 3L4UA 4OKVB 4Y5XC 4UI2A 3RVXC 3MLVH 1MUJA 2FSEB 2X6BA 3ZU8A 4DCQA 4XP9H 1MFCH 1U8OB 1JPEA 4E2OA 2OJZL 2DLNA 1HESA 4W9ZA 5DG9A 5AVQB 4IDLA 4DK5A 5DMGC 2Y7QB 2ICEC 4F9LC 3ECQA 1Z2OX 4DO6A 1TA8A 1NIDA 3SKJL 4YFEA 1U95B 5JPNA 1FFRA 5DZPA 5LP6F 1S9WB 5MP6H 5DFVD 5F3BA 2HHHH 3PGFL 1A6AA 1IFHL 3L4VA 4Z7QB 1TT6A 4DEPB 3PFQA 4UNIA 5C0JA 1VDGA 5IROC 4TSAH 1DSYA 1D5BA 3N2JA 2ZYIA 5D7LE 2YAPA 4ZBJA 5ISZA 1RAMA 2F9BT 5A2FA 3TCLB 2YZ8A 1GRWA 4FFWC 5KFWA 3V8OA 3OXSB 1FN4B 5I19L 5DJ8A 3TJEH 2I60H 2VM3A 4RFNC 1L9QA 4XN8A 1CFVL 4X6FA 2OMTA 3NSCA 4PJIB 4QUOA 1X7TA 2CGRH 5GGUB 2GBAA 5BO1L 4YXLH 3R5XA 1BW8A 1SPDA 2NUPB 5JZ7C 3IF1A 5IK3B 4HUCA 4Y9BA 3LX9A 2BMKB 3H42H 1GZPB 2B5IC 3FFDA 4JL1A 3BD3A 4FJYA 3C09C 4PGZA 4ZAKD 3ZZLA 4RGNC 4KHPH 1A0QL 1FVIA 5CD5D 1BEXA 5T33H 1J5IA 1MLBA 2P4AB 2F54D 2XNAA 2QYZA 4XX1G 2YXMA 4BBRG 5C86A 1K6QL 4FNUA 4F58L 1FNSL 4AXWA 1BDYA 2X6UA 4YHMH 4FLQA 1A4BA 5TPWL 12E8H 1YJDC 3O8XA 3RVUC 3O81A 15C8H 3L13A 4WU7B 1ETZB 4C4KO 5A2JH 4K15A 4AQ1A 4I1PA 3UJTH 3QXUA 5FS5A 5LCVH 3ZKQD 1VCAA 3VGAB 4HZAA 1CD0A 2XA3A 4LNRB 4I1NB 4QOKD 2WE6A 2LABA 1NCWH 1WUZA 2FZ3B 5IJBC 3OMZA 1LHZA 3FQUA 3T8MA 1ZHLA 5EZJA 2NTFA 3IU4H 3RGBA 3RZCD 1OSPH 4F24A 2G9HB 2FB4H 4KPHH 3FN0L 1X5HA 5ITBH 5KN5A 4DV6H 4B9PA 5CEZL 2IXQA 4KNTA 1U6AH 3P54A 1OIOA 1AGEA 1FYTB 2VLLA 3W11C 5LQBL 4WO4C 1QWUA 2DWEA 2ZSVB 2IV9A 1UWEH 1WO2A 5KEZA 2C9SA 5HHXH 1GGCH 4OH2A 1WS7A 1PY9A 1MCFA 5DEJA 3WMPA 1R6VA 4DPAX 4FYRA 1HR0H 1B0GA 1RUPH 3JWNC 5F7HA 3EYQC 4YOKA 3X13B 4NQCB 4F50A 2J6TA 4ZSOA 1EHXA 3QQDB 5D55A 1TJHL 1UASA 3IN0A 1FLRH 1TJMA 4XWGH 3WCYA 1I7RB 2FJSA 1MFAH 1QATA 1NCBH 3CUPB 5FHAL 2E46A 3MRDB 3JV0A 2AK4D 5GGRA 5HDRA 2XCAA 2VA3A 1FFOA 1GYCA 3AS3A 1XNRH 3MAWA 4UNUA 3RKPA 3QA3A 1MFVA 4QJ5B 1D5RA 2W9LA 1SDAB 4XWOC 4OCYH 5KJ7E 3I4MG 2OCJA 2EH8H 4TQ8A 3N43B 3DVNB 5DGRA 2B14A 5EU3B 3SPVA 2DIKA 1BVKA 3C6EA 5T3XH 1HZHL 1EFXA 2Y07L 4WNSA 3SDAB 3SPHA 1T5XB 1MPAH 4BKSC 4C4KT 4FQQA 4IGBA 4O2EA 5E94B 3P2TA 4EEEA 1JZGA 2KYIA 2VR9A 4ODWB 4CU8A 2N1TE 4EVNB 5ICZB 4F8TA 1NC2A 4B7IA 5HHVL 1E9OA 4FE9A 4HETA 5KAQF 3ORRA 4Q6IA 1FZKA 2IPTL 5IB2A 3E6FB 2V58A 2JELH 2BVOA 4XPTH 1TWAA 3IJSA 1DQKA 5LGJA 4F9PA 3BA8A 3FK3A 4FFYL 4PGCB 1CLCA 4QRQA 2WO2B 4L5FL 3ZIYA 2NMSA 2P24B 2CIKB 1IAIM 1SYSB 4JDTH 5IMOA 1KB5A 2BY1A 4F20A 4CVZA 3M1CA 1GZHC 3TT1L 1A3LL 4PJDB 4BFBD 5D96C 3TYGL 1AOZA 1YEHL 3TQ1A 3NEXA 1JZFA 3SYPA 4J4PD 4ZXBC 4YSUA 2VZUA 4M93B 2P5ED 2P5WE 5DHVA 5EDSA 3ZDYF 3GFUA 2ITDB 1EFQA 4EXKA 4NLHA 1WBYA 2BLFA 3ARYA 2DWCA 5AWNL 1J0JA 4AEHL 1ZCRA 1IO4C 4WJ5B 1MFDL 4UBDC 1YEFH 2UUBH 2J73A 1QRNA 5CBEB 1MHCB 3MUUA 5HY9B 2NNRA 1HEHC 1IFGA 5D2LA 1M0TA 2J88H 2E9IA 4KJYB 3ATBA 1VGKA 4P8QA 3O6KL 4FXGC 4XCFH 5E1AA 2K8MA 5L88H 1JIHA 4AQYH 3T3MB 4DGYL 4TRPL 2J4WL 2Q2LA 2JQZA 1TQCB 1PLCA 1VERA 4RMWA 5KSAB 1DHKA 1DVUA 3FTGA 1MW0A 3BPOB 4L23A 3THMH 2HG0A 5JDSB 5EIVA 1HILA 4NDMB 5KG9A 4XXDA 4LMQI 1C1EH 4C5AA 1XGYL 4OCMC 2ZICA 4C5CA 4G6FD 2EDNA 3HMXA 4FTVE 4LGSB 4G5AA 3TU6A 2GHZA 1ZK9A 4C47A 1INQB 1AGBB 1ZHKB 1A7QL 3MROB 3FCUB 1SGKA 1FF5A 5DJXB 2FE0A 1ZGLP 3GDCA 3T1HH 1IKNA 1BEYL 3GPEA 3LV3B 4U3HA 3QBTB 5AW9B 1XR8A 3RWDB 5IVNA 4GW1B 4GG6A 1EANA 4F2FA 3BWUF 2R0LL 5C07D 3JYCA 4LP4A 4ZO9A 4NM8L 4DP8X 2I25N 2E7BA 4NN7B 5DD6B 2W0FB 3WN5A 3FUDA 5KVDL 3DXAB 5LXTF 3TT3L 4ECYA 3HAEB 4F7PA 2VLKD 1KC5L 4IOIB 2C3HA 4K8RD 5TGBB 4E9XA 4ERSL 4N8VA 4C2MA 3Q2CA 4DQOH 1JNHB 1KYAA 4UTCA 1NCOA 3H9SE 3U6XS 1G7HB 3D25B 1NCUA 2L7QA 3BHBB 4M1DH 4XCYA 4BFGA 4QRRD 4YXKL 4QWEA 2BP3A 4QRUA 3L2PA 1QFUL 3QQ4B 1H19A 3QORA 2CKBH 2K3HA 3V0WH 3TJHD 2IH3B 5C0BE 4B5ZA 4N8PA 2F58H 5J4MA 3MC0A 3AXIA 5F0JB 3LTVA 4NNPH 1LE9A 3QYNA 2XTJD 4PJBF 4RBPK 4BKLB 4CW1A 3KG5A 3K2UL 4P46D 4DEWA 3CSYA 2VXUH 1AHWA 2UUDK 1ETJA 1K3ZA 3BGFC 4HCIA 4B6ZA 4MV1A 3D08A 1FIGH 1H6TA 5MHSE 3L4JA 2GW5A 4EBDA 1E2WA 4Y8AA 3RP1A 4KVCL 4KUCD 1RUQH 1R5IB 3WNOA 2QR0B 1WJ3A 3KMDA 1NGZA 3DGCR 4EO5A 1HZKA 3GTGA 4G8IB 3IXTB 4HWBL 1T4KA 1I7NA 4LF6H 4MXQD 1TYEB 2QFPA 1NWPA 3MUZ1 4JM2B 1ID2A 3S3JA 3GSXA 5DGAA 5ADOH 1CTOA 4QXTB 1A6WH 1U2HA 4LLVA 4Q58C 4JM4H 2BDNH 3EJZD 4LKCB 3MZGB 4G8AC 2CLRB 5EO1A 5C0CB 1R5WA 4ABWA 5SV3A 1L4IA 4IHOB 3BUTA 4LDCA 2WXIA 2H4EA 1H15A 4WI7A 4YHPA 1DLHB 3HOUG 3GSUB 1TZ8A 3EHBC 5I6LA 2JV6A 4D3CL 3N06B 4YR6A 4G9DB 1R46A 2AXHA 1A7PH 3QUHA 2QVIA 3EXJA 4NQVA 1DR9A 1T83C 4L1LA 2CA4A 3FT3B 1G6RA 5IW6B 1DBMH 5E2WL 1KBGL 3B2VH 4M8RA 5H37G 5KFYA 1FH2A 2NY1B 3QJUB 2PWGA 1UJTA 3Q1EA 4EDXB 4KXDA 4OY9A 3SO5A 3ASOB 1WCBB 1IQWH 3KR3H 2VLRA 4UTAL 1GC1L 2ADIA 4KVNH 1HNXH 3EO1A 1H8LA 5IP9G 4ONFL 2C35B 3QT2A 5D1OA 1VHPA 2JKNA 5KYWB 1FGVL 4OJCA 3V6OA 4NT6B 3EH1A 1K4DA 1I82A 5HYQA 3MRHA 4M5YL 1ES0B 1MIEH 2PTUA 4FI8A 1KEEA 4PB9L 1HHHA 4AYFA 1AUXA 4Z76B 5CINL 3MFFB 2HFGL 5KOMC 1Y7VA 1NMAL 1IC4H 2JKSA 3D0VA 4NC0B 4OFDA 2A83A 4HIXH 4NKDA 1ZLWK 2B1OA 3U79A 4ENEC 5T3XE 4OZIB 3LRMA 1SUHA 6FABL 1WA1X 2XIBA 1X5IA 4JFED 3T77A 4WEUD 1XEDA 4KZDH 3MV9E 4K8RL 2BIIA 1H9DA 2IG2H 2PR4L 4MRCA 4H26A 1ERNA 3QWOA 4HMEA 4HC1L 4N5EC 2YARA 2CJSA 1WA0X 4XBEL 3DX9A 3T5KA 1FAIL 3QPQC 3Q7JA 4LCUA 4PCKA 4O4YH 4F2MB 5HHOB 3WS3A 1ZE3C 4MA3A 5BRPA 3ZL4L 4D0CB 5KVEL 3B9AA 2BW4A 1PLAA 2Z4QB 4LRNL 2AABL 2VT0A 2Q6WB 1CGUA 1JZ6A 4GJTB 5EN2A 3KNBB 4UF7C 2WYZA 4Z7VF 3P3RA 4IRDA 4UT9A 5H37H 5CIPH 3WNKA 5AD0A 3QG7L 2WLJA 3FU8A 1D2OA 1RZKL 4UQCA 1XL6A 1QPPA 1IAKB 3DMMB 5KVFH 1ID5I 1TENA 3APMA 1DVFB 2FYYA 4DGVH 5DMYA 5DQDL 2W0PA 4HUVA 2YAOA 1ACZA 5D2NE 5TQ2L 3K8LA 4L0ZA 1G0YR 1RU9H 2WWMC 1UB6A 3J80W 2MNUA 2HKFH 4X6CB 1MEXH 4WKZB 3EPIA 3BJYA 2XCPA 3FONB 4FZ8L 1UUNA 2H2SC 5L8LB 4FL4B 4FJZA 3RFZA 3BH8B 1SHSA 1BX2A 2FWOA 3QRGL 4Z7UE 1F11B 4E41D 2F4VH 5JHLH 1MRDH 4KWUA 3WSQL 2Z34A 1SJHA 4CVXA 4GI9A 5C0CD 4I4WB 2YSTA 1Q0XH 3CSGA 4GQRA 1FNAA 3T0VA 1BBDH 4R7DA 4FN0A 3QUXA 3M8OL 1G5AA 2X87A 4V1DA 2ICWJ 1NBVH 4JZNA 1PG7H 5CEYB 3RWHA 5IQ7L 1BGXH 1MJUL 4QLWA 1REIA 4WNJA 5AVYB 5AYUH 1N4XL 4HUXB 3D9AH 1O9ZA 4X0KB 3ZE0B 3RV3A 4GXFA 4OUUA 2DQFA 1TJIH 2X38A 1NAKH 4BSWB 1S8DB 2E7MA 1JTTA 2J5LB 1MJ8L 3EUDA 3L3IA 2WW8A 4TXVB 4FFZL 1NINA 4UIKH 4HH9B 5BV7B 8FABA 4YP3A 4HZLB 4FGMA 3RVWD 4X6DF 2AEOA 4QY8A 3W0WB 2BK8A 4GO6B 2BINA 1T1YA 3IKKA 1IKFH 2OMWA 2ZUQB 4JKKA 4U1HA 4JZOA 1OTSC 1TCRA 2EXSA 2FATH 2WXLA 2AJ3B 2JKRM 5KT4A 2PCFA 3HE7C 2P8MA 4ZTOH 3UTOA 3SDYH 2ZOTA 1LO2H 5GGQH 4J39A 3NTCH 3STZA 3DTUB 1HI6A 2AJVH 2WXNA 4Z7OB 4HVBA 3NSXA 5F1NA 1T03H 1FO0L 3Q5OA 4DETA 2A77L 3KM1A 1MXDA 4KK6C 4Y9FA 1YN7B 3CK0H 3GMOA 3PABB 4CSSA 3WIHA 1G1OA 3QIUA 3L1OH 5D1ZC 3BRFA 4U6YA 2W60A 1J88A 1GCYA 3L9EA 1OQOA 5E4EB 2A0LD 2ED6A 5A16A 5I8CB 3RVTD 3UG3A 2FX9L 4YDLB 3CDFA 3GNMH 4PJAB 1HIML 2HRPH 4TN9A 5DJZA 4ECVA 5FLXW 4RZQA 1WP6A 1WYJA 1CN4A 1AR2A 1D9KB 1E9QB 3FBQA 3FPYA 4P59L 3JWNG 4XO5A 3GI8H 2ADFL 4C55A 4WQOA 5AW6B 3W9EB 4G72B 4GB9A 3NGBB 4UINH 4QRTB 4HEPG 2DJ4A 1RQ5A 3ARUA 5D6DA 5I66B 1ZS2A 3RKDC 2WXFA 3NIGE 4RB1A 2CHXA 4CMHC 4WI9A 1PZSA 5IVXF 2QHRL 3QC6X 3VXRE 1NPJA 4B50A 1YQVH 4LCWB 4WU5A 5DFVC 3PGCB 4XPAH 1P6FA 4WCYL 1KGXA 4LBEB 3RBDA 2EZ0D 2R7KA 1RJLA 4Z3HA 1JGEA 1YJDH 3LKPA 4XP4H 2L3BA 4GT7A 4OD3L 1CYXA 4NFBA 3WY1A 3L3HB 3BKCL 1I85A 2ZCLL 2BVQA 1X4XA 3RLSA 2JK5A 3KVPA 1KJVA 4I18C 4GSDH 4LQ1A 3OKEA 4XVTL 3T1WA 2BERA 3QARA 3BQVA 1PY4A 4GIAA 1S2EA 2J6EA 3Q1SH 3ZDZB 4DP4X 1IC1A 1HNYA 2G75A 2VQ1B 2VDKB 4FKHA 1IGYA 1Q9LB 3RUGA 2D3NA 1F4WL 3D30A 2ZXGA 5IG7A 3BPLC 3P40A 5I0ZA 3MNWB 3LIZL 25C8L 4G8FB 3PL6C 5DK0B 4NQDD 3GSOB 1BM7A 1JPTH 1WFOA 3CMOL 1BVOA 4QXUL 1BVNP 1GOFA 2B2XL 2VIRB 4GEIA 4UT6A 2YCHA 3B4NA 3I9PA 4DP7X 4ZAKC 3BAJA 1F42A 2CLVB 4KJQD 5FOJA 3V9CA 2OJ1A 3CXHK 5CD5C 1DSFL 2A1WL 1J7VR 2MTPA 3JWNH 4HFWA 3CVIL 2R29A 1FJ1A 1MCOL 5TQ0L 1P1ZB 1SOSA 2X88A 3L3OB 3JTTA 4W9HC 5F8QC 3VAEA 4HKXB 2IBKA 4QT5B 2NUAB 2ISDA 2LU7A 4R0LB 2OXHA 4M6ML 1GHFH 3D4CA 2V33A 1NCNA 1S9YA 5L0QB 3X1EA 1E28A 3QE5A 1T89A 4RDQF 4HG4K 3NMEA 2BIPA 4DUVA 4LLQB 3HW7A 1F3DH 2H32H 1N59B 1QEWB 2CBMA 2ZG1A 4RAUB 5JMRA 3RZCC 3AROA 3WFCL 5CCHE 2X7LA 5D1XE 3JSNA 3RB0A 4BD4A 2ZCKH 1X44A 4KKBD 4BY1G 4KTDL 4FOMA 3T6ZA 1DCLA 3MLRL 2DPJA 3VG0H 1AR1D 1CWVA 2FP4B 4I1RA 5EG6C 2RDIA 1UC6A 1P2CA 5F3HB 3FU7B 2ENYA 1QNZH 2Y24A 5DD0L 1INDH 2JFCA 1XXFC 3QO1A 5FYLH 2G2NA 3PF2A 1XIWB 1T1XB 2CUHA 2DH3A 2FH8A 5DRXA 1LL1A 1XTLA 4AC4A 4S10A 4N2DA 5I6MA 4HA1A 2DOCA 3JV4B 5KVFE 1DZBA 1PZBA 4H8PA 5EZLA 3F7YB 2ZXWB 2CH8A 3EYUL 5B39G 5EA0H 3FQXB 3VXTB 1UA3A 1KBBA 4GXUN 1A64A 4BYHA 4HNTA 4HPYH 4LIQH 5JIHA 2BY0A 3PWPB 1JDCA 5KAQG 1EEQA 3R4DA 4X5XA 2VLJD 2Q7NA 4LEXL 3AM8C 2R0KL 5AVVB 4QLRA 4JR9H 2Y23A 4HXBH 5C71A 3T5HA 2ZYSA 4KZ0A 2OL3H 3TVMA 1XF1A 3RJQB 5DUML 3GSVB 1KG0A 2WINA 5T1KB 1D5MB 1ZSDB 4U31A 1L5GA 4AVJA 4HIIA 1GJUA 4AMKH 1MZBA 1T94A 1S9XA 4PI0A 1NPUA 5EULV 4Z3TA 4L9LA 4HHWA 2BZCA 4XBPA 3J27A 4LSSH 4W70A 3T0EB 1GPOL 3RB4A 2KKQA 4OCWH 4DEPC 1JHTA 1AQHA 5KFTA 5I71C 1Y1WA 4C54A 1PZUB 1KPRB 5DT1L 3VQ2C 4LCCA 3HC3H 1I8LC 3K6NA 5FO2A 3EH3B 2ZDHA 4IRSA 4AQAA 3VQMA 2X12A 5F6HI 4JK0D 2VUGA 1TFHA 4X7EC 4K0OA 4FQXA 2C9RA 3SHSA 1MJ7H 1FNGB 3FFCD 5LVEA 5D9SA 1XEUA 2Y06H 1GGBL 1OAUL 1ESOA