4BY1G

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by1G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by1G01
3PCOB 1NMFA 2FXQA 5IP7G 3DLLA 3FKIH 1QUQB 1SN8A 2AMCB 4B3TL 4JI6Q 1Y1VG 1Z9FA 2CFMA 4KLKA 2BA0A 1SROA 3GTLH 5LMNQ 2ZM6L 2VQEL 2MO0A 2MO1A 3CC4A 3MEFA 3ULJA 1GVPA 4GN3B 2CKZB 3AYHB 2Q2TA 4A3CG 4R1JA 2K52A 4YWMA 1VQOA 1K9MC 2OTJA 4MTNA 1SR3A 1EIFA 2A1AA 2GVAA 4LFAQ 3ULLA 2I5HA 3G6EA 4P73A 4X62L 5C4JH 4DV7L 3EIVA 1B70B 2EQSA 1Q46A 1JE5A 4LF4L 4GOPA 4QIWE 4JI2L 3F2DA 4DV6L 3RLFA 3CCLA 1X3EA 1XNQQ 3CCMA 4A76A 1GD7A 2VUMG 1VQIA 1EUJA 3L0OA 1WOCA 5IYCG 1NJIC 1MKHA 1GM5A 2OTLA 2MQHA 1D7QA 1VQLA 4DR6Q 3KDFA 3OTOL 1M1KC 2CCZA 4B3TQ 1KIXA 1ASZA 1YEZA 2WAQE 1PH3A 3K7AH 2ZM6Q 2VY3A 2VQEQ 4A3KG 3JC66 4A3EG 4BY7H 1JT8A 4GS3A 1VQGA 3M4QA 3CMEA 2OWOA 4L5SA 3KF6B 2PQAB 3HOYH 1BKBA 1IBKL 1NBWA 4X62Q 1HH2P 3W1BA 4DV7Q 2Q2UA 1M90C 3F2CA 4GNXA 5LMUL 4LF4Q 3CQZH 4DAYB 3T1YL 4JI2Q 1YITA 4YWKA 1SMXA 4Y52H 4RG1A 1IZ6A 4DV6Q 5JJLA 4APVA 3J81j 1Q81C 3HOZH 2RHQB 3PIOA 3HOVG 2I5LX 2BH2A 1U5KA 1HR0W 2R92G 4LWCA 4JBKA 4NXML 4R4QA 3OTOQ 3E9HA 2CQOA 4B3SQ 1VCIA 1OXTA 3HOXG 3I4MH 5C44H 1TWCH 1Q7YC 4NPSA 3K7UC 1VQ4A 4A3FH 1YI2A 4LF5L 2QEXA 5M3MH 4BXXH 3ER0A 4WJ4A 3J81c 2VW9A 5M3FH 1B8AA 4NB3A 1I94L 1CKNA 3CPWA 4IO9A 4JBMA 1KL9A 2KHIA 1VQ9A 2K5HA 1YHBA 4DV4L 1EWIA 3PF5A 5GAGC 1IBKQ 4OX9Q 4O0AA 1V9PA 4O2DA 4JI1Q 5LMUQ 4BY1G 3H0GH 1PH8A 1LTLA 1XNRL 1QVFA 3S17H 5E7NA 3UDIA 2VS1A 5IWAL 2ZJPA 1IBLL 3HOWH 4A3DH 2H5XA 4HIKA 2YV5A 1XPUA 3A5UA 2ALYB 2N78A 3CMAA 3UE1A 4DR5Q 4DV3L 1QVGA 3KJOA 3S1MH 2JA7G 5C0XG 4NXMQ 2L15A 4JBWA 4YCWA 3CCQA 5IYDH 1D8LA 2NN6G 3CAMA 3S24A 3TREA 2B63H 1CSQA 1RIPA 2K5VA 4LF5Q 4C3IH 3BZCA 4XIGS 4TQUS 4YWLA 1HNXL 1DGSA 3A0JA 1I94Q 1S72A 4QJFA 2XGTA 2I5MX 4A3BG 3CP0A 3PUYA 4OWTB 4DV4Q 4LF9L 1HNWQ 2YU9H 2A19A 3I4OA 1QZGA 5M5XH 2KBNA 1WJJA 1TWAH 2GVBA 2WB1G 1K8GA 4FDBA 1Y14B 3BZKA 3RN5A 1YVCA 3HKSA 3NEMA 2HQLA 1XNRQ 3PO3H 4K0KL 5M5WH 1PYBA 2NVQH 3NENA 5JEAG 3GO5A 1C7YA 5IWAQ 1X9NA 1PH2A 1IBLQ 1BVSA 3S2DH 3J80c 1K8AC 2JA6G 1L1OA 1EFWA 4DV3Q 1PH7A 2BH8A 4ME3A 4QY7A 3LGJA 2JA8G 3HOUG 1Q8KA 1VQKA 3CCRA 2ZTCA 4OO1I 2ES2A 2JA9A 3RNUA 1HNXQ 4MZ9A 4DR3L 4BBSG 2UXCL 1E1OA 2AKWB 2VZAA 1VQ6A 3TRZA 3GD7A 4P74A 5GADC 2IT1A 3RZOH 3T1HQ 4LF9Q 1P8LA 2MFIA 1I6HH 4DUZL 4A3MH 1BBUA 3AFPA 1L0WA 3G4SA 1N34L 1RL2A 1HNZQ 3U4ZA 1KXLA 1OXUA 3M3YH 3HFZB 4IPHA 2JQOA 3A74A 4JI8L 4K0KQ 1MIUA 2B29A 1KRTA 4OWXB 5M3FG 1VQPA 4BA1I 3H15A 4Y7NH 2Z6KC 2R7FA 1WFQA 5H1SE 4AQYL 3RZDH 4BBRG 4OO1G 3JAMc 3VDYA 1EOVA 4UP8A 2ZJQA 4IPDA 2CWAA 2NZOA 3PGZA 3H3VI 5HGQA 2LXKA 2WB1E 1VQBA 5C4XH 3J81i 3S1RH 1N33L 3PV0A 3I4NH 1IL2A 3CCUA 4DV2L 2R7ZH 3G71A 4PMWA 2A8VA 4R4OA 3PO2G 3NBHB 2JA5H 2UXCQ 1G51A 4OONA 4XTCS 5HY6A 1UEBA 4DR3Q 2R93G 2ZTEA 4X65L 5IP9G 1MJEA 3L7ZC 2F4VL 4B3ML 1XPRA 4A3LH 4JOIC 1Q86C 4DUZQ 1N34Q 5IYBH 4GLXA 4A3JH 5FJ8G 4HIDA 4LFCL 2IHFA 5C0XJ 4KHPL 4JI8Q 3IRBA 4C3HH 2ID0A 4X6AH 1S40A 2V1CC 4AQYQ 1VQMA 1C9OA 1PA6A 1J6QA 4DKAC 2F52A 3OYYA 1VQEA 4DV0L 4JI4L 3GTQH 4A93G 1EQQA 3S1NH 2QGQA 4YHHL 1YJWA 3K81C 4JCVE 4HJ9A 1N36L 1G291 1N33Q 4A3GG 4WJ3M 4DV2Q 3M7NA 1WCMH 2PNHA 3K80C 3MXNB 3D0FA 1AE2A 2K14A 2WP8J 5LMNW 2LSSA 3DM3A 1E7ZA 5GAHC 4LUVA 2UUAL 1A8VA 4X65Q 5C3EH 4R4TA 1W3SA 2E5LL 4B3MQ 5JEAJ 4QGUA 1AH9A 4AH6A 1TWGH 4DAMA 3GTMH 1TWFH 1A62A 3HKZG 3K0XA 4KI0A 3UDXA 3KJPA 4IFDJ 1CSPA 2EIFA 3J80i 3STBC 3U58A 4IOCA 1HJPA 5BR8L 1XJVA 4LFCQ 5JJIA 4AIMA 2D62A 4QL5A 4OXPA 1PHJA 4BA2I 2EXDA 1IXRA 4IJHA 4LF7L 2F3IA 4QQBX 1G6PA 3ERSX 2N49A 3PUVA 1VS0A 1QUQA 1SE8A 2DGYA 2E8GA 2JK8A 3FKIG 4P75A 4NXNL 4YY3L 3K8AA 4DV0Q 1YHAA 4GOPC 4A3MG 4JI4Q 3FP9A 3CCEA 1VQJA 4YHHQ 3T1YQ 1Y1WH 1N36Q 3CXCA 3PUZA 5IP7H 1LYLA 3F1ZA 4UP7A 4GKKL 4PZ8A 1Y1VH 5GROA 3E9IA 1K0RA 3PUXA 1FJGL 4RMFA 4R4CA 1E24A 1PFSA 2NVYH 2UUAQ 5GQOA 5JJKA 2ZJRA 4DR2L 2E5LQ 1TXYA 3AQQA 4DK3C 5J3BA 1JB7A 1IYJB 3D31A 2K4KA 3RR5A 1PV4A 2B3GA 3RN2A 2OQ0A 4YCVA 3F2BA 2IY5B 3JAMi 5BR8Q 1VQNA 4L5TA 2OCEA 2LXJA 2VQFL 3PF4A 4GOPB 4IJLA 4JYAL 2UUCL 4AYBG 4LF7Q 1N9WA 4H02A 1WYDA 4GLAC 4GNXC 4NXNQ 4YY3Q 1AE3A 4LW1A 2YYZA 3CF5A 1J5EL 4PZ7A 1Z47A 4R4IA 4IOAA 3HKZE 3M4PA 3GTKH 5IYCH 2IHEA 3CCVA 1NTGA 4DK6C 4BY7G 1NY4A 4JI5L 1X55A 1OXSC 3KDFB 4GKKQ 5FLMH 1Q82C 1UE1A 3KF6A 2PQAA 1YHQA 3HOYG 1FJGQ 2QA4A 4A3EH 2N3SA 1LM0A 1UE7A 1E1TA 2AWOA 2I0QA 1EYGA 1VQ8A 1H95A 3SGIA 5IT9c 4DR1L 2E2JH 4B3RL 3E0EA 4DV1L 1VQAA 2JEBI 4OWWB 3TEHB 1S3OA 2UU9L 2RCNA 3AFQA 1I3QH 4JV5L 4GN5A 4GNXB 3HOZG 2VQFQ 4JYAQ 3PIPA 2UUCQ 1V1QA 3WWVA 1HR0L 3CC7A 4HJ7A 3UE0A 4IPCA 3UDGA 1J5EQ 1YNXA 3BU2A 4JBJA 4MNOA 3U4VA 3I4MG 1PH5A 5C44G 2YTXA 1PVOA 2VNUD 2R92H 4A3FG 5M3MG 1FL0A 1PH6A 4BXXG 3TS2A 4JI5Q 3CCSA 3ZJYC 2KCTA 1A63A 3HOXH 2NZHA 1SRUA 1VQCA 2KCMA 4AYBE 1C0AA 1KHIA 2AWNA 4A3IH 4GKJQ 1CKNB 1KD1C 4DR1Q 1GKHA 5ELNA 4B3RQ 3H0GG 3GTGH 4P71A 4JI0L 3I2ZA 1QVCA 4DR6L 2KENA 1YZ6A 4HIOA 1YIJA 2UU9Q 1FGUA 3HOWG 3CCJA 1O7IA 3G48A 4A3DG 1KQSA 4JV5Q 1NE3A 4BY1H 1X56A 5GAEC 1B7YB 1HZCA 2IX1A 1HR0Q 4JC0A 1IBML 1A0IA 5IYDG 3ICEA 3B6YA 1VQHA 2B63G 5IY0A 2JA7H 4LF8L 4HIMA 1WI5A 2OQKA 1X54A 3KYHC 1L1OC 1BBWA 5EAYA 4C3JH 2WFWA 2ATWA 1UWVA 2PI2E 3GTOH 4DUYL 3S14H 2RF4A 4LFBL 3NELA 4L5QA 2XTIA 5IE8A 5AJ3L 3S15H 3Q8DA 2RHSB 3M85A 5DLQE 4A3BH 3W1GA 3I55A 1VQDA 3J7A5 3PO3G 4JI0Q 3U50C 3BJUA 1X3FA 4DNIA 2VL6A 2E2HH 3GDEA 1L2FA 1PH1A 4B3SL 5FLMG 2CWPA 4A93H 4IPGA 1OTCA 1K3RA 2F4VQ 2C35B 4DR7L 1X65A 4PG3A 1PH9A 2N8NA 1QZHA 1IBMQ 2JA6H 3KOJA 1L1OB 2KHJA 5FLXc 1Q1BA 4OX9L 1I5FA 4LF8Q 4KHPQ 3GTPH 2K50A 2UXBL 1XMQL 4JI1L 2R7DA 3F8TA 1SFOH 2JA8H 3HOUH 3M4OH 4HJAA 2ZTDA 2K5NA 1V43A 1UE5A 4DUYQ 2JE6I 4LFBQ 1P16A 5AJ3Q 4BBSH 4LUOA 3FHWA 2R6GA 4P72A 4JI3L 3W5OA 1X3GA 2BA1A 4DV5L 4DR5L 2HHHL 1GO3E 3KFUA 5M5YH 1N32L 1CKOA 4JI7L 1K83H 3I56A 2D0PA 3EBEA 3GTJH 3OW2A 1VQ5A 2PI2A 1SLJA 3M9BA 1XPOA 1PYSB 4UY8C 1E22A 1YJ9A 4DR7Q 1N8RC 1KRSA 1UE6A 5C0XI 4A3IG 4J15A 5C4XG 4A3CH 1XMOL 4LF6L 2E2IH 3I4NG 4GN4B 4BBRH 4X64L 3AEVA 1HNWL 2R7ZG 2NN6I 1E3PA 2HIVA 3KF8B 1K73C 1W2BA 5K36G 1YBYA 3S2HH 4POFA 1EIYB 2JA5G 2UXBQ 1XMQQ 2Y0SG 2ASBA 1NMGA 1OXVA 1HZAA 2JEAI 1I50H 2AHOB 4LNQA 1KAWA 3PO2H 4LUZA 1HZBA 2D0OA 1ASYA 4A3LG 1TWHH 1OXXK 2YTVA 3CD6A 2R93H 4HJ8A 4JI3Q 2VUMH 2GN5A 5IYBG 5IP9H 4DV5Q 1U0LA 2Q2IA 2Z6KA 4A3JG 4A4IA 4DPGA 1MJCA 2PMZE 3I7FA 4GLVB 1PH4A 4JI7Q 3ULPA 2HT1A 1N32Q 2NVXH 4DR4L 4UPAA 3EN2A 2UXDL 3KLWA 5FJ8H 3S1QH 4A3KH 2UUBL 3H3VH 4IFDI 1X6OA 1T9HA 4DR2Q 2K75A 1FVIA 4X66L 1JMCA 2NVTH 1CUKA 1XMOQ 4LF6Q 3TS0A 3T1HL 4X64Q 4L5RC 4GKJL 1CKMA 1JJCB 1WCMG 2YTYA 3CC2A 4JI6L 2IX0A 1Q1EA 3PSIA 1EQRA 3A5ZB 4POGA 2JJQA 4JOIA 5LMNL 1HNZL 4A3GH 2HHHQ 5ELOA 4HJ5A 3TQYA 5C3EG 2MNAA 4KHZA 1JJGA 1XTDA 3CW2C 4PZ6A 1HZ9A 2HIXA 4TVAB 4EQ5A 1LUZA 4IFDG 3HOVH 3RLOA 4A75A 2DUDA 4LFAL 4JG2A 3RLNA 3STBD 4C2MH 4EX5A 3CPFA 4YCUA 2Q2HA 4DR4Q 1JJ2A 3S16H 2Y0SE 1KC8C 2UXDQ 2WAQG 1Q12A 3L2PA 4UP9A 3UDFA 1R9TH 1VQ7A 2UUBQ 2Z0SA 4ALPA 1YJNA 1XNQL 4X66Q 3J7ZC 3PUWA 1Y1WG 4DV1Q 1VQFA
chains in the Genus database with same CATH superfamily
2FXQA 4FS1A 4A93H 1QUQB 1E0BA 2CFMA 2HD3A 1PZJD 1SFOB 2JA8B 3IFTA 3CC4A 4EQOA 1VF7A 5CYUA 4EEYA 4NW2A 2OEOA 4KJNA 4Q8FA 2K52A 4LK1C 4YWMA 1VQOA 1K9MC 2W9BA 5KFGA 1SR3A 2GVAA 5F2DA 3ULLA 3G6EA 4F4XA 1ESFA 3MTSA 4GOPA 2UVUA 2KVMA 4JI2L 2K01A 3FDSA 3N8DA 3VYRA 4DV6L 5C5MA 1H9MA 1X3EA 3RLFA 2WV6D 5KIXA 3CCMA 1GD7A 4ZUIA 4J9NA 4EG0A 1ET9A 1EUJA 1QNKA 5CV4A 5C5JA 2E2IB 2R7ZA 5DNFA 1LT6D 4B3TQ 2BE5C 2YL2A 1ASZA 2MPMA 2Y0SA 2WAQE 2W9AA 5KFWA 2VQEQ 1O78A 4RB3C 1JT8A 4QWDA 4DV5H 4GS3A 1M4VA 2OF1A 1F2MA 1XDNA 1KDAA 1TWHB 3KF6B 2R93B 2W6MA 2VUMB 2XRSD 1IBKL 1BNCA 1CHQD 2Q2UA 1GLVA 2QCPX 4GNXA 4HR7B 3CQZH 4DAYB 5I9OA 3MFIA 4K6LA 4RG1A 4LF6H 4X64H 2F4IA 4J9SA 3SHLA 3J81j 4KY6A 3MWEA 1Q81C 3HOZH 1M8AA 2NVTB 2I5LX 2FMAA 1HR0W 2R92G 2XCAA 2FFKB 3QB3A 2O03A 1DOKA 1WCMA 2M9VA 3HEJA 3E9HA 4B3SQ 2M2LA 2Z9HA 1TWCH 4LF5L 2R7MA 4IR9A 2QEXA 4BXXH 4A3GB 1TAEA 4NB3A 1VQ9A 1KJQA 1TWFA 1QJOA 5GAGC 2UUBH 5LMUQ 4ECTA 2B8FA 1FNVA 3R93A 1XXGA 3S17H 4CC5A 1HXYD 2VS1A 1WH2A 5IWAL 1R9TB 1IBLL 4A3DH 4HIKA 1EEFD 3A5UA 1VAJA 2ALYB 4FNFA 5LP6F 4UDUC 1SCUB 3RZOB 5LMNH 4G7ZC 4QWAA 1ML0D 4WRDA 4Z9CB 4C3JG 4A93B 2B63H 2NN6G 2C22A 3JRWA 3TREA 4A3MB 1CSQA 5KFTA 5JJZA 4XIGS 3SI8A 1I94Q 4JVZA 1X3PA 4FP5D 4S3SA 3GIMA 4OWTB 3PUYA 2WE6A 2CQYA 3I4OA 1H9SB 2CH4W 5JPMC 1QZGA 1ZHSA 1D1KA 1TWAH 4XQNA 2EY6A 3GIJA 4IUTA 2RSNA 1Y14B 3RN5A 3NEMA 5ELEA 1BNZA 2HQLA 3N52A 5M5WH 1WTWA 2NVQH 3GO5A 2FLPA 1A2TA 1ENAA 2ENBA 2KEDA 4O2AF 2VUMA 1L1OA 1PH7A 3IN5A 2XWBB 2K5DA 1Y69U 2HGSA 3KHLA 2F0GA 2PO4A 4ED2A 1O7YA 2ES2A 4WD3A 2JA9A 4BBSG 3TRZA 5FLXW 5EOYA 4DV7H 2E75C 3W3AA 4LF4H 2G9DA 1EY7A 3HZXA 4CDFC 1AFPA 4EBDA 1I3QA 4FBUA 1OXUA 3CQZB 3HFZB 2JQOA 4K0KQ 4OWXB 5M3FG 5T14A 1QOHA 1VQPA 4Y7NH 3EVQA 1I4HA 3OTOH 3HOZB 4QIWB 3EFXD 3E3XA 3OHBA 1NCVA 5HGQA 2WB1E 3T4AC 5TSSA 5E4WC 3BYYB 3ETHA 1IL2A 3J81W 5IODA 1TWCB 1JB3A 2MUYA 4GZYC 4QUFA 1EL0A 1G6ZA 1G51A 5HY6A 4DR3Q 4RAYA 5C1PA 1SYBA 2ZTEA 4TQRA 1XX8A 4X65L 5IP9G 3L7ZC 3S9WA 3GTGA 2F4VL 4B3ML 4GC7A 4MV8A 4JOIC 1AN7A 2P5ZX 1RTOA 1ENCA 4LFCL 4DL2A 3IFDA 5LL6S 4ME6A 4KHPL 1YNND 4JI8Q 3S17B 2XGQA 2J6TA 1OO9B 3TQ1A 1S40A 4A3DB 4NXMH 2BQ3A 1J6QA 4DKAC 4KV6A 1VQEA 2A74C 5CV7A 3GTQH 5KT7A 3MFHA 3RBEA 1EQQA 2QGQA 1CQFA 2B63B 2NB0A 4WJ3M 3N42B 4DV2Q 1T3NA 2PNHA 4JW0A 2YS7A 4DV4H 1SNCA 4FM9A 3MHBA 1GUOA 2WP8J 2LSSA 3Q22A 1DV2A 2UUAL 3MVVA 1IW7C 2X6LA 2VUGA 5DQIA 4QGUA 1AH9A 2E2HA 2VOBA 1A62A 1TWAB 1SJED 5E4XA 3J80i 3MWYW 3STBC 4ME5A 3PIO3 4PMBA 4LMYA 2B2VA 5JJIA 1EU4A 5M5WB 1C30A 4DV3H 2D62A 2NVQB 1ZHQA 4OXPA 3V6KA 3CRKC 1IXRA 2F3IA 2JA6A 4LH7A 5C6AA 1CA6A 1SE3A 3PUVA 3K0YA 5DLFA 2DGYA 3FKIG 2JK8A 4GOPC 1PRTB 4JI4Q 3K8AA 2R8KA 2ZJTA 3FP9A 2EJMA 2A5HA 1Y1WH 1VF5C 4UP7A 4LF9H 5HGTA 2UVRA 4C5AA 3E9IA 1FJGL 4IUVA 2NVYH 4RA8A 2PQEA 3ZYYX 2Q8TA 4KD4A 4YB8B 2ZJRA 4DR2L 3A8KE 1CQVA 5J3BA 3TQTA 1QE6A 1VBGA 4YCVA 2C2RA 2IY5B 3JAMi 5BR8Q 3QR8A 4TV8F 4L5TA 2XIGA 1DCZA 2OCEA 2VQFL 5EZYF 4LF7Q 4Y7NB 4H02A 4GLAC 3KBXA 4GNXC 4YY3Q 4LW1A 1J5EL 4EFBA 3HKZE 3M4PA 3GTKH 4NP5A 4ZI7F 2IHEA 3BDCA 2QILA 3K5NA 1NTGA 4ZQ3A 4DK6C 4BY7G 1OXSC 4GKKQ 3BAAA 2PQAA 4ODGA 3RB0A 1YNJC 3ITPA 4DUZH 2QA4A 3QWNA 4ECQA 1N34H 4YP3A 2W6QA 2PW7A 2I0QA 3VMMA 5DAUA 4DR1L 3C2PA 3RV3A 1EY5A 1UEAB 2FK1A 3KTMA 4G3IA 1WTVA 1CQJB 4AQYH 1S0MA 4DNRB 4J0MA 1B3QA 4JV5L 2JEFA 1B44D 4XX0B 2J0TD 3PIPA 4Y8VB 4TUYF 3GILA 1N33H 5KFCA 2Z8LA 4OGQC 3GTQB 1S97A 4IHJF 1PH5A 4G57A 2A68D 4A3FG 1FL0A 4CHTB 5L37A 4RH6A 3R3OA 4HAEA 5E1FA 1N48A 2KCTA 4IURA 5KFKA 2NZHA 3GIIA 2VA3A 3K6OA 1IBMH 1D2BA 3DUZA 3LWBA 2TMPA 5C4HA 4J9RA 3RB3A 4C2MA 3T5JA 1CI3M 2W71A 4DK1A 2WIIB 4RNOA 2BR0A 1EYZA 1L0XB 1ILPA 3RBDA 2KENA 1YZ6A 2PW5A 2UU9Q 3HOWG 3G48A 2KCCA 4H7BA 3VA5A 1KQSA 1W6JA 5GAEC 4R8IA 1RJRA 4UCSA 4DV0H 2WAQB 3L3OC 4YHHH 3K5LA 1A0IA 2W9CB 4H13C 1RF2D 2JA7H 1UAPA 2EYPA 1Y1WB 4LF8L 1WTXA 3OMGA 2VQDA 3GIKA 1X54A 5EAYA 1L1OC 3GTOH 3M9OB 2E5LH 1UWVA 3C46A 4DXGA 2NVYB 4HMJA 3Q8DA 1B53A 1ENFA 4L63B 1MBYA 4HCSA 2RQXA 1D5MC 5DLQE 1DIKA 2W6OA 4KY5A 4A3BH 3V6HA 1KLGD 1ULZA 3VPCA 4RGMA 3BDOA 3U9OA 4JI0Q 1O7ZA 4RFBA 2VL6A 2F0SA 2I8CA 1L2FA 3ND9A 2C9OA 2FLNA 4NXNH 1LT3D 2JXMB 1B9MA 4IPGA 4IZOA 4AYBA 5CB4F 1IYUA 2F4VQ 4DR7L 1X65A 1EY6A 3PW0A 1LT4D 2W70A 4FXDA 5KFPA 4EBCA 1SNQA 3GTKB 4OX9L 5JVLA 1DD2A 4KHPQ 3GTPH 2K50A 2UXBL 5F9NA 5IGBA 4WORA 1RKNA 3M4OH 2NYZD 2K5NA 3RUZA 4G7HC 4XQJA 1PZKD 1ET6A 4I55F 3BVZA 4EQPA 1C48A 5KNCA 1SEIA 1LTBD 4RHSA 4DLKA 5FO7B 4JI3L 3T56B 4DR5L 4UHVA 2HHHL 1EZ6A 1GO3E 3AMUA 5H80A 1N32L 3RFCA 3MFGA 4LMQD 1K83H 2AGQA 3EBEA 2X69A 3TBIB 3M9BA 1PFMA 1K8MA 1E22A 4DF7A 2E76C 1YJ9A 1KRSA 1UE6A 2CW0D 4J15A 4A3IG 5C4XG 5JVDF 3I4NG 4OO1H 3NE5B 4RCOA 4RKBA 4BBRH 3AEVA 1HNWL 5BPFA 2R7ZG 1HHVA 2NN6I 5FPOA 2HIVA 3KF8B 5CA0F 1S9FA 3NBHA 2Y0SG 5FO8B 5KFUA 2JEAI 2VXWA 2JEJA 4LNQA 1CS0A 3EYYA 1KAWA 2EY5A 3PO2H 1II3A 4LUZA 5KG3A 4Q43A 5KT4A 4DV1H 3SK5A 4PWQA 3HXLA 4OIKA 2GN5A 5IYBG 4DV5Q 5KG0A 2B2WA 2F0LA 4XDXA 1KJ8A 4A4IA 5KFDA 1PH4A 5BN3A 4C3HG 4EQNA 2NVXH 5JPNC 1B6RA 4KD3A 4EYHB 1KDBA 2FK2A 4R9WA 4A3KH 4C56C 3H3VH 3J7AV 2F0QA 2WYOA 4DR2Q 1JMCA 4QUCA 4LF6Q 3R5XA 3TS0A 3T1HL 1EIGA 4X64Q 2B2VC 1WCMG 3E5SA 2JA7B 2AQ2B 2IX0A 4RGTA 4POGA 1HNZL 4F87A 3GTOB 5ELOA 3FRPB 5C3EG 2EJGC 5C8YF 3CW2C 2C00A 4QF4A 5KKNB 2IPKD 1CFMA 4EQ5A 2LFNA 3HOVH 1PK8A 2PCFB 2A73B 4A3BB 1E2ZA 3TP6A 3R2TA 1LTRD 2K04A 3CPFA 5J2TF 2WB1B 3OSNA 2B2YA 3R5HA 4UCOA 2UUBQ 1A3VA 1EOTA 4ALPA 5KFVA 5KX5F 3A55A 3KLSA 3PUWA 2ZT9C 3Q6SA 2JSOA 4GKJQ 3PCOB 1LTAD 1K28A 2AMCB 4B3TL 5KFZA 3Q24A 3GTPB 5EPLA 5LMNQ 2KSWA 1ZKOA 2VQEL 2ZXRA 3M4OB 2MJ8A 2F0FA 2EY1A 3A56A 3QG1A 4C1NI 3ULJA 3RB6A 3G6XA 2Q8IB 2CKZB 2Q2TA 2R7KA 4MTNA 4UCTA 5LXTF 1J8IA 5C4JH 3NQIA 4M1UB 1STBA 2EQSA 2R6FA 4LSAA 1K83B 4QIWE 2BQUA 2C2DA 4ZKCB 3NUCA 4ZYSA 4A76A 3I90A 3ORRA 2VUMG 3MR2A 3RV4A 5IYCG 4ZAIA 1NJIC 1GM5A 3RB4A 1CT1D 1XMQH 4BBRB 1MD2D 4JI1H 2FPPB 1GJXA 2KCNA 5CV5A 2CCZA 3EROA 5COYA 3T51B 1KIXA 4ZCKA 1KEEA 5KFFA 3BQ0A 4ECWA 2AGOA 2VY3A 3SE7A 1DONA 1ONLA 3PO2B 3M4QA 2OWOA 3HP3A 1SYCA 4I50F 4EGVA 4KKSA 1A2UA 4LSXA 4RUCA 4TQSA 3BVGA 4DV7Q 4LF5H 3E5NA 1M90C 2CQAA 2NVXB 5LMUL 3PZPA 4LF4Q 4ZQIA 3N43B 1JCKB 4YWKA 1IZ6A 1XMOH 4A3KB 2FLLA 1EIHA 4ECRA 3E6ZX 3HRZC 2RHQB 3PIOA 1J9OA 1U5KA 4A2BA 4LWCA 2B8GA 3OTOQ 1NUCA 1VCIA 2ZXOA 3I4MH 2J6SA 4CKBA 5LYJF 5C44H 1JWUD 1Q7YC 4NPSA 4KHVA 1YI2A 1W93A 3SVMA 4XYLB 3J80E 5M3MH 3ER0A 4NDXA 4X3UA 3J81c 1I94L 2EYOA 1CKNA 3CPWA 2M05A 1TWGA 4DR4H 3HOVB 3PF5A 4OX9Q 2FK3A 2UXDH 1V9PA 3GTPA 2YRXA 4CDEC 3H0GH 3HKZB 3G6JB 4IN3A 4K5WA 4MIUA 5A2QE 1QVFA 5E7NA 2K32A 3UDIA 2WACA 1STAA 3Q8PB 2YV5A 1F2LA 2RDHA 3NWTA 4JI6H 4DR5Q 5C0XG 4APMA 3KHGA 4F4ZA 4NXMQ 4JBWA 3Q0AA 3CCQA 5IYDH 1GUGA 3RAXA 1Y1VA 3S24A 1EWHA 2A6HC 4DL4A 1IKMA 1CA5A 4R7RA 2K5VA 3BABA 3ONAB 4C3IH 5CAEB 1DGSA 3A0JA 1TS5A 3JAME 3H6MA 2FPGB 1H9KA 2XGTA 1EWCA 2J9GA 2I5MX 1DXMA 4FF3A 4DV4Q 1HNWQ 2YU9H 4J9KA 1PRTD 1ICWA 2K5WA 3CVZA 2NUCA 2GVBA 2J4XA 5C4JB 3OW7A 3BZKA 3PO3H 4K0KL 2F3WA 1PYBA 3R2IA 5NUCA 5KG6A 4O42A 1TS3A 2X0SA 1BCPC 1RDPD 1X9NA 1HRJA 2FP4B 5J22A 1BVSA 1G2SA 1JKJB 2JA6G 3OWEB 4K8JA 4DV3Q 3EA6A 5F9LA 3NWSA 4QY7A 2ZM6H 2ICIA 2BOSA 3U9TA 3HOUG 5KT6A 3T5HA 2W6NA 2ZTCA 1GOZA 2F0WA 1ZXTA 4OO1I 2OT2A 1A9XA 5EDWA 3RNUA 2YZMA 4DR3L 1E1OA 3DMUA 4IUUA 1X32A 4Q5VA 3GD7A 5ISRA 1B1ZA 5GADC 1HTLD 2IT1A 3T1HQ 4LF9Q 3RZOH 4OL7A 2IA6A 2F0OA 4ECUA 4A3MH 1BBUA 1HNZQ 3MA2B 2XC9A 1PTOH 3A74A 4NMZA 4JI8L 2VPQA 4YQWA 5IGDA 3H15A 2B2WC 3RZDH 2R7FA 5H1SE 4UP8A 4ECZA 4HNTA 2CWAA 2NZOA 4J9LA 3VR5A 3H3VI 1D7QA 1VQBA 1PRTF 4RAZA 2ZDGA 4H44C 4O3OA 1E2VA 3Q23A 3CCUA 4DV2L 3I4MB 1SE4A 1S4ZA 2Z1CA 4IQZA 1BO0A 2A6ED 4QMGA 4PMWA 5C44B 5K36H 2HCCA 1LTSD 4N8X1 5M3MB 2JA5H 5KFRA 4F4WA 4OONA 2IW3A 5J39A 4RCNA 4A3LH 3T1YH 1ZQ7A 3KAJA 5D14A 2NUAB 2SNMA 5EJWA 4DUZQ 4YIJA 1N34Q 4A3JH 5FJ8G 3FMAA 3H0GB 5C0XJ 1XTCD 3D4WA 4J6HA 1XYIA 4HSPA 4AQYQ 3FMCA 1PA6A 2W7PA 3TSSA 3E0JA 2Z4HA 1B2TA 4JI4L 1SMYD 4Q45A 1N33Q 2B2YC 3K81C 3AB9A 1TIID 3HG9A 2FE3A 3NXWA 3TIIA 5D8DA 4C3IB 1SYGA 2KHSA 2W57A 3R23A 4FF1A 2R7LA 2J7ZA 5EBDA 4DFAA 1A8VA 3EJIA 4R4TA 4H0LC 5KFOA 3OIPA 2YU9B 4AH6A 2NU6B 3C1EA 1XNRH 1SSOA 3FDTA 3GTMH 4U7CA 3UDXA 3K0XA 4NLGA 3VYTA 4IFDJ 3U58A 2PNRC 5BR8L 4MAMA 4JUZA 3KBGA 4O4IF 4I7ZC 3PO3B 4QL5A 3ETJA 4BA2I 1SYDA 4LF7L 4IJHA 4QQBX 2C2EA 3ERSX 2B39A 5DM73 3GTLH 1QUQA 4YY3L 4DV0Q 3PW2A 1GUTA 1SFOA 1HNXH 4YHHQ 4L6TB 1LYLA 2XRQD 4ILWA 5JVG3 4GKKL 3SDZA 4QW8A 1VBHA 1HCZA 4R4CA 3T13A 4K5XA 5C3WA 3K3VA 2E5LQ 5EWGA 3DHQA 5KYLA 4EGQA 3H94A 1PV4A 2F0UA 2NZ1D 3F2BA 1BUVT 1PTOB 1VQNA 4JV0A 2JP1A 4ECVA 5L9XA 1VKZA 5KYIA 4B08A 2LXJA 5BN4A 3PF4A 4IJLA 2E2IA 4AYBG 3RZDB 4DK0A 3EPGA 1S03G 2IL8A 2RDIA 4NXNQ 1I6UA 5FD5A 4IOAA 4R4IA 1MSGA 4N9TA 4ECYA 1EUCB 2UXCH 1GYFA 5ELCA 4FXGC 5KFXA 1X55A 3TINA 3BYTB 3KDFB 5FLMH 1Q82C 3KF6A 1TWHA 2R93A 2JA5B 2MHVA 4R8NA 5KFLA 3VR3A 3HOYG 5EWEA 1UE7A 5JOBA 2AWOA 1EYGA 4HR7A 1EQTA 1TR5A 3SGIA 4DAYA 5IT9c 3GLKA 4U6PA 4FVMA 4KKUA 4A3JB 4OWWB 2UU9L 2R82A 5IT9L 4GN5A 2EPBA 2UUCQ 1ILQA 1TS4A 2YU9A 3V4SA 3HB9A 1SNOA 4CBVA 5IGCA 2PZWA 1YNXA 5KFSA 4ED0A 4MV3A 1F2YA 1IOVA 2R92H 3V4ZA 4YR3A 2Z4IA 3TS2A 3CCSA 4XT1B 3ZJYC 1GHKA 2B2TA 3R5FA 5BMVF 2RBMA 5FLXE 1JOQA 1JICA 3GTMB 2R8JA 4JI0L 4DR6L 2NU8B 3ERQA 1R9TA 2DY8A 1YIJA 3WOFA 1O7IA 3CCJA 2R7NA 3GIDA 1NE3A 3I4LA 2G9HD 1TA8A 1B7YB 1EU3A 1HZCA 1NSNS 1N36H 4JC0A 3GTLB 2G5DA 5DGBA 1LTID 2QEJC 4DL3A 5I2YA 3OPOA 3KAKA 4C3JH 2ATWA 3GIQA 2NN6H 3S14H 2PI2E 3OUUA 4ID6A 1H9SA 5IE8A 4DAVA 3S15H 1XWEA 2MP1A 1EFID 3Q2OA 2RHSB 3M85A 4UCRA 4OELB 2AUJD 3W1GA 3H20A 1T5XD 3U50C 1WR2A 4RZQA 3QZ8A 1PH1A 5KRUA 1SNMA 3F8NA 2BCOA 1OTCA 4C5CA 1JDBB 4UFZA 4IALA 3M4YA 4O1NA 5KG1A 3JSLA 5GONF 2DPJA 3KUPA 1LTTD 4ZK9B 1E2WA 4MV7A 1STYA 3F8TA 4HJAA 1UE5A 4N8FA 3J7AF 3LWEA 4R8UB 1P16A 4BBSH 4LUOA 5I2XA 1VMPA 4P72A 3W5OA 2BA1A 4DV5L 3KFUA 5M5YH 3CQZA 4JYAH 1C4QA 1B9NA 3I56A 1BQQT 3OMCA 5EBCA 1VQ5A 2R86A 4QIWA 1XPOA 1N8RC 5DLGA 5C0XI 4ED7A 4A3CH 4F88A 4LF6L 4X64L 4JI5H 4RNMA 3L4JA 1TWCA 1W2BA 2R92B 4HNUA 3S2HH 5JVH3 1JORA 1XMQQ 2ASBA 1NMGA 1W96A 3RD4A 1TY0A 2IWHA 1I50H 3HBLA 1KNEA 1CQIB 2HQEA 3C0FB 2F0KA 4MN3A 1RJPA 1QWYA 1VDZA 4B3RH 1HZBA 1ASYA 2YTVA 5FOBB 4HJ8A 5IP9H 4EVOA 1U0LA 2O4XA 2Z6KA 1Q8IA 2DN8A 1JWMD 3EN2A 3UQ8A 1HR0H 2NU9B 1Z2NX 3KLWA 3S1QH 2UUBL 4IFDI 3PR5B 1X6OA 1T9HA 1FVIA 1BJTA 1CUKA 4EFEA 3BG3A 1XMOQ 4OIJA 1MZBA 2B63A 4GKJL 4RGOS 5T1IA 3CC2A 2KQ3A 3NGDA 2JJQA 5LMNL 2I87A 4C3JB 2HJWA 3OWFA 3JZIA 3TQYA 1D6EC 3S14B 2PZUA 4KHZA 1JJGA 1XTDA 4IR1A 1IW7D 1HZ9A 1H9JA 3S15B 1TWAA 3RJ0A 1CE8A 2BQRA 3IG0A 1PFNA 4QB4A 3RLNA 3QOJA 3STBD 3P7JA 4KHPH 4EX5A 5JH7F 4EBEA 4DR4Q 2Y0SE 1PYWD 2UXDQ 3RIZA 1LO5D 1Q12A 3L2PA 3UDFA 3MC0B 4LAAA 2W8LA 3PW5A 4Q0YA 3X3NA 2F0EA 5BN5A 1HUNA 2OH2A 1MI2A 3I8ZA 4DN4M 1KJIA 2K33A 5IP7G 3FKIH 1SN8A 5CMDA 1H9RA 4JI6Q 1Y1VG 5BPHA 2DIKA 5JUMA 4DUYH 4LFBH 3JSNA 2IP4A 4CJ0B 2MO1A 1STEA 2FHTA 2W6PA 1I6VC 3AYHB 4BBSB 4M8AA 3EPIA 2F0DA 4KKTA 3D3RA 3VYSA 2A1AA 1EIFA 3V96A 4B3SH 2I5HA 2WINB 1RHPA 4DV7L 5M5YB 4CKCA 1JE5A 4LF4L 1HPCA 2R8IA 2EY2A 3GQCA 3F2DA 5M9OA 3CCLA 2ZDHA 2O5JC 4WFN3 3AU7A 1VQIA 3L0OA 1WOCA 2OTLA 1MKHA 2W8KA 3P1HA 2QKIC 3QJYA 5CORA 4DR6Q 3OTOL 5HV6A 4YR2A 3K5MA 2WTFA 3S2HB 1TY2A 3K7AH 2ZM6Q 4A3KG 4A3EG 1I50B 4BY7H 5LL6b 3QIAA 1VQGA 4IZ8A 4JI7H 4L5SA 1BKBA 1K3BC 3PN1A 1NBWA 2QK4A 4PDBA 2B2TC 4X62Q 4KN7C 3W1BA 1S5DD 1YITA 3M4IA 4Y52H 4XZ3B 3S1QB 5IT9W 1TT2A 4TV9F 4DA2A 1V4YA 3GTQA 5FKAC 3HOVG 1WTHA 2BH2A 2AUKA 4NXML 3DWPA 1S0OA 2CQOA 3HOXG 3K59A 1VQ4A 1FD7D 3CU7A 4A3FH 2HVQA 1Y8PB 1I4XA 1B8AA 1FNWA 2C5CA 2E74C 1BXRA 4RHRA 2K5HA 4DV4L 3N41B 1EWIA 1AP0A 4X3SA 3MJFA 4O0AA 4B9WA 4MV9A 5HURA 3UFXB 4Q44A 4BY1G 1PH8A 1LTLA 2WAQA 4X66H 2A69C 2RCFA 1F9PA 2PMZB 3HOWH 1DM0B 2W9CA 4ECXA 4DL7A 2N78A 3RGXA 3UE1A 4DV3L 3S1MH 3KJOA 1Y1WA 5IIFA 2F0MA 4O3QA 2L15A 4YCWA 3FKIB 1UNSA 1D8LA 5LL6X 2L11A 4HMIA 2KJXA 2K1BA 3BZCA 2NVYA 4YWLA 3QFFA 4LFAH 4ZOLF 3X3MA 1LT5D 4DU9A 4LF9L 4CDDC 2A19A 1U4PA 1WJJA 2AGPA 1STHA 3G6YA 1T94A 4FDBA 5KFQA 2HVSA 1XNQH 1YVCA 3HKSA 5KFBA 2AU0A 4HSVA 1XNRQ 5K2MA 3NENA 1NNXA 5JEAG 1C7YA 1PH2A 3BA9A 4JV2A 4EGJA 4IUPA 2Q8RE 1SE2A 3GTKA 1EFWA 2BH8A 3BS1A 1EYDA 1AUXA 3LGJA 1T36A 2JA8G 1Q8KA 3CCRA 1PTOD 3D6WA 5KT5A 3K7AB 2JEGA 1HNXQ 1S5BD 4MZ9A 2KUMA 1HUMA 4BY7B 4J9QA 1FGBD 1VQ6A 4V190 1CTMA 3OHXC 1JC7A 4HCEA 4YBZB 3NSWA 4JI2H 2MFIA 2QDLA 4DUZL 1N34L 3AFPA 3G4SA 3SEBA 4DV6H 1RL2A 1Z7TA 3M3YH 4DAPA 2L5TA 5DEHA 3RMHA 2B29A 1B50A 2FINB 2L12A 4BA1I 4AQYL 2Z6KC 2L9HA 1WFQA 3K5IA 1EOVA 3KF8A 1L2ZA 3PGZA 3CKIB 2LXKA 5C4XH 3J81i 2HDLA 3PQIA 1N33L 3I4NH 4QCLA 2R7ZH 3G71A 2LS01 4R4OA 3BDLA 5A35A 4A3FB 1O75A 2UXCQ 2R93G 1IBKH 1RK5A 4FO2A 5D1OB 5E3FA 1XPRA 4A2AA 4PNYA 2FJZA 3DWAA 5IYBH 1B3AA 4HIDA 5CV9A 2IHFA 4C3HH 2ID0A 1PTOF 1V1PB 1RCVD 2D2CC 2K5QA 2V1CC 3HOWB 2R61A 1JE4A 4FYDA 1C9OA 4XQQA 2DWCA 3S1MB 2JA7A 2F52A 3OYYA 4DV0L 4QWEA 3S1NH 4LJZC 4YHHL 3GTOA 4JCVE 4A3GG 4JPBW 1M6VA 1PRTC 3MXGA 3M7NA 4O2BF 1WCMH 3MXNB 3MZ5A 3D0FA 1I4QA 1NR2A 2K14A 5LMNW 1AZQA 2V4RA 3DM3A 1E7ZA 4RGNA 4LUVA 3TP5A 2PYKA 3H91A 5DQHA 5C3EH 1R4QB 1GUWA 1D5ZC 2E5LL 5JEAJ 5DQGA 1VMCA 4DAMA 4G4KA 2RGVA 3M7GA 1TWFH 2WB1A 2VB2X 1TU2B 5IWAH 1CSPA 1IBLH 1XJVA 1FKAH 4IOCA 1OWTA 2DPIA 1ZYRC 4AIMA 1DZ1A 3O13A 2FPIB 3GV7B 2N49A 1VS0A 4NXNL 4A93G 2E8GA 2EE1A 5KNDA 4A3MG 1M7JA 1FR3A 3TDQA 1IKLA 2IJ0A 2GPWA 1EHIA 1WTOA 1I7LA 1N36Q 1HA5A 5L1IA 2RDGA 1U4RA 3F1ZA 5EWFA 3OSPA 2GPSA 1EEID 5GROA 1E24A 5GQOA 2I07B 2DZDA 1TXYA 4DK3C 3WO0A 1JB7A 1IYJB 3D31A 2K4KA 3RR5A 2DLNA 1K83A 2QW7A 1JIHA 3RN2A 3UI2A 2W9BB 3Q1KA 3M3YB 5JQWA 5CBEE 4DNTB 4IRDA 2FKLA 4GOPB 2UUCL 2A6EC 3RAQA 2OXPA 2HDMA 1KLUD 1V1OA 2YYZA 3CF5A 4PZ7A 2XD4A 5K5PA 5IYCH 5C4XB 1QILA 5KFJA 4JV1A 3BG5A 3I4NB 3NBIA 2R7ZB 4YR0A 1I4PA 1PZID 1WD1A 3WNZA 2ASDA 1UE1A 2PVPA 4ETSA 3GV6A 2Y0SB 1ESRA 1E1TA 2NVXA 2F1MA 4YJ3F 3MR6A 2E2JH 4DV1L 4UCUA 4O4HF 1UC8A 1VQAA 2YZNA 3RGZA 3OIQA 2RCNA 2CHBD 4C3HB 1I3QH 4GNXB 3HOZG 4RB2C 3J7YW 4JYAQ 1EYCA 3WWVA 3CC7A 4HJ7A 3HS0C 1JWSD 5KG7A 2L0CA 3A54A 4IPCA 1MHWC 3UDGA 1A63A 4MNOA 2VNUD 3S1NB 4IAJA 2XGPA 2YTXA 4BXXG 3TN2A 1PH6A 3QO2A 4JI5Q 4X65H 4FBTA 3PW4A 1WCMB 2F4VH 1KDCA 4B3MH 1SRUA 3C3LA 2KCMA 2WKCA 4AYBE 1STNA 5ELFA 1SYXB 1C0AA 1KHIA 2LKVA 5C3EB 2LMCB 2AWNA 1LTGD 5JAVA 2IMWP 4LFCH 1U9RA 5D3DA 1KAAA 3SR1A 4B3RQ 1GKHA 5ELNA 3VR6A 3HKZA 1TWFB 3GTGH 5FPRA 2H1EA 3NTHA 4P71A 3I2ZA 1Q90A 1QVCA 5D1PA 1RYSA 1CK1A 4A3DG 4XYQA 1F9QA 1X56A 4N9PA 3T53B 2IX1A 1STGA 1HR0Q 3B6YA 5CR3A 1VQHA 5KEEA 3T5LA 2B63G 3NP8A 1LLRD 3BQ2A 2A6HD 5IY0A 4MA5A 5C0XH 5J2UF 2FMMA 1WI5A 2RVLA 2OQKA 4B9XA 3QZ7A 2UUAH 3KYHC 1BBWA 2WFWA 2R8GA 1CHPD 1NR4A 2RF4A 1GHJA 3NELA 1E4GT 2ALZA 1KJJA 5EPJA 5EKLA 4C5BA 2X6GA 5IOCA 2XCLA 2MGSA 3W2DA 2E2HH 1X3FA 3PW7A 1RYRA 3T5KA 5FLMG 1BCPD 2EZVA 5IGGA 4UCVA 5FD6A 1SEBD 1QNUA 3G8CA 1V51A 4WBNF 3NPPA 2NTSA 2C35B 1KABA 2I46A 1PH9A 5KT2A 2NTTA 1QZHA 1IBMQ 3OHAA 2JA6H 4IFDH 3VPBA 4XYMB 1L1OB 1Q1BA 1R4PB 1I5FA 4FF4A 5KG4A 2C28A 1EUDB 1FJGH 1XMQL 4JI1L 2R7DA 3KLSX 2KECA 3HOUH 4PV1C 1B4OA 1TKWB 2RSOA 4DR2H 2ZTDA 3BQ1A 3KHHA 4DUYQ 2JE6I 4LFBQ 1KBLA 1PX2A 5AJ3Q 4O4LF 1SNDA 2EYJA 1RODA 1X3GA 4YJ2F 1JOOA 2E2JB 1CKOA 4I7AA 1A15A 2VQFH 2V9WA 1EZ8A 3OSOA 2D0PA 2SCUB 3GTJH 3OW2A 1QB5D 1I3QB 1Z2OX 3I73A 1SLJA 1GXDC 3PMFA 4IUQA 1J5EH 4X3TA 5CGKA 1A3TA 1XMOL 2K05A 1E3PA 4HQ6A 3MAQA 1HQMC 4POFA 1EIYB 4M9UA 2IX3A 3A7LA 1B6SA 1HZAA 2AHOB 1D5XC 1BCPF 3PVXA 4E6IA 4DR1H 2RDJA 5EPKA 4GKJH 1OXXK 3CD6A 3DWQA 2BE5D 4Q8EA 4WJWA 2Q2IA 1IYVA 2FMCA 2ATLA 3H0GA 1FNUA 1MJCA 2PMZE 3I7FA 4JI7Q 3GTGB 1T5EA 3ULPA 4RU9A 4JV5H 1ZEQX 4DR4L 4UPAA 3TZUA 3VR4A 2UXDL 4RNNA 1SYEA 3D8GA 3MXPA 1S10A 1CM9A 5FJ8H 1K8OA 1YNNC 2PN1A 3RTXA 1BXTA 2K75A 3CHBD 5EQ0A 4IRCA 2SOBA 1V8QA 2YTYA 2F0PA 4JI6L 3PSIA 2EVBA 3A5ZB 5IYZF 1ZETA 4XT3B 2DY7A 4HJ5A 3EQLC 2CZGA 1HTPA 2MNAA 2N88A 1GSHA 2NWGA 4PZ6A 4MV1A 3A8IE 4TVAB 1AZPA 1LUZA 2JYOA 2RKSA 2JN4A 3RLOA 4A75A 1N56A 4C2MH 4I65A 2E2HB 5KFIA 3S16H 3Q8SB 2WAQG 1JLLB 3I3CA 3TMEA 3V2TA 1VQ7A 1K1QA 4ZUJA 1YJNA 1DOLA 3SK4A 4GC6A 2V4DA 5T1GA 4X66Q 4LF8H 4KJOA 3VR2A 2CVRA 1BDOA 1Y1WG 4DV1Q 2JA6B 1B33N 5KFYA 1NMFA 3DLLA 1RTNA 3MXUA 1Z9FA 4KLKA 5CV8A 2VPSA 2BA0A 1SROA 1IL8A 3VPDA 2ZM6L 2D5DA 2MO0A 3HOUB 2DJFC 3MEFA 3LWUA 4DXFA 2XCPA 3RUPA 1GVPA 1PFBA 4GN3B 4A3CG 2UVWA 4R1JA 2OTJA 3SK6A 3LMLA 5C3XA 4LFAQ 1HQRD 4P73A 4X62L 1DV1A 4J9OA 3EIVA 1S5CD 1B70B 1Q46A 1X3QA 3WOEA 3J81E 4DR7H 3TP7A 3GTJB 1K1SA 5KG5A 4K14A 4ZKBB 3NK9A 1XNQQ 2W6ZA 4OX9H 5D65A 3H3VC 2MQHA 2UXBH 3NTKA 1VQLA 3KDFA 1M1KC 3DXJC 2I80A 2V5AA 2OLSA 1Q3LA 1Y8NB 2JA5A 1YEZA 1PH3A 1JR0D 2CW7A 4JI3H 3JC66 1HFNA 2R84A 2YZGA 2YW2A 4DR5H 2HHHH 1N32H 1PDQA 3CMEA 2PQAB 4UAIA 3HOYH 4ZHQF 3JRXA 5DG9A 1HH2P 4F7XA 4KMUC 5D3IB 3F2CA 4CC6A 3T16A 3T1YL 4JI2Q 1SMXA 5JJLA 2NU7B 4DV6Q 3URYA 4XXEA 4APVA 1HNWH 1U4LA 1A3UA 3BVMA 4G7OC 4F8MA 1GUNA 5C5LA 4JBKA 4O3NA 1JX4A 4R4QA 4O3PA 1OXTA 1C8CA 2A68C 2K6AA 3L9AX 3K7UC 1UUPA 4RAUC 3P20A 4WJ4A 1LV9A 2VW9A 4FU0A 2SDFA 5M3FH 4IO9A 4JBMA 1RK6A 1KL9A 1I4RA 2KHIA 3GTMA 1YHBA 2GA4B 1IBKQ 4C2MB 1AUVA 4O2DA 5CV6A 4JI1Q 1JXLA 1PXUA 3S16B 1XNRL 1GSAA 4CJ1B 5DM63 2ZJPA 1RJQA 3T1HH 2R8HA 2H5XA 3GTLA 1XPUA 3CMAA 1WTRA 1JDEA 1BOSA 2JA7G 4HTHA 3BA8A 1HNZH 2F0HA 1BBXC 1WSCA 4I7HA 3H4DA 1LACA 2FJ2A 3CAMA 1BF4A 4ED6A 3GTJA 3A8JE 1KTKA 1RIPA 4LF5Q 2FB9A 2K03A 3OUZA 4TQUS 5ELDA 3VA7A 1HNXL 1S72A 4QJFA 3SXHA 4A3BG 4J9PA 1BR9A 3CP0A 5J1ZA 4RKLA 5M5XH 2KBNA 3I72A 1K8GA 2WB1G 3F2UA 5KG2A 3GV5B 3K3PA 1IHZA 3KLRA 3DF7A 1AEXA 5IWAQ 1IBLQ 4HNVA 3S2DH 3J80c 1K8AC 2WDTA 1PLFA 4P2CB 4YAKB 3L4KA 4B3TH 4AYBB 4ME3A 2VQEH 2LY7A 1TVXA 3J80L 4E4TA 1L0YB 1IOWA 1VQKA 4PQXA 3G6VA 4R8UA 4J9MA 2VR1A 2UXCL 2AKWB 2VZAA 4P74A 3QOLA 4ULLA 3V05A 5EKIA 2TSSA 1P8LA 3HOYB 5HBRB 1S5FD 5A2QL 1I6HH 4ED1A 3KK7A 1L0WA 2O2LD 1BCPB 3U4ZA 1KXLA 2WKDA 3C1FA 4IPHA 3D4DA 4CDCC 1MIUA 1KRTA 1QCBD 4OHJA 4DGZA 5IGEA 2K7VA 1K0SA 5L1JA 3ND8A 1KNAA 5I6WA 4OO1G 4BBRG 3JAMc 3VDYA 2ZJQA 4IPDA 2MCTA 2R92A 2RDFA 2CW0C 3TIGA 3S1RH 3PV0A 3JAML 1S68A 3KXYT 1EY0A 2H4OA 2A8VA 1E4EB 2L4NA 3PO2G 3NBHB 3FVQA 5KFAA 4XTCS 1UEBA 5M3FB 1EQVA 1MJEA 3Q8RB 4DL6A 5LMUH 4KN4C 2RA4A 5I6YA 4EEQA 3M9MB 3BJYA 1Q86C 1EYAA 1JOKA 4HYKA 4GLXA 1WTQA 1DJRD 2ASJA 3H4BA 1YNJD 3IRBA 4X6AH 3TZDA 1RJTA 1VQMA 2YYAA 3Q8QB 2ZDQA 4MTKA 2KOLA 3NQTA 1ICFB 2GLTA 3P75A 5KNBA 1YJWA 4HJ9A 1N36L 1G291 1I94H 3K80C 3RF2A 4KY7A 1AE2A 1O80A 2XSCA 4IUNA 3VYUA 5GAHC 3KALA 4RZRA 2PZTA 4X65Q 4LH6A 5G3LD 5LOVF 1W3SA 2DJGC 4B3MQ 1M0TA 5C4ZA 4J8QA 1TWGH 2F0TA 1AN8A 1QG7A 3D4RA 5M5XB 4KI0A 3HKZG 3KJPA 3GV3A 1WD0A 4OEMB 2EIFA 4TSSA 1UNNC 4LFCQ 1HJPA 4QWBA 5ELBA 5CBAE 4K6DA 1AW7A 1CZWA 5KGUA 2W7OA 1PHJA 1SJHD 3N44B 3N40P 2EXDA 1HA6A 3LNNA 4K2LA 3I91A 1PTOC 1SYFA 3H09A 3S2DB 2ZXPA 1G6PA 5IT9E 2ASLA 1SE8A 2R3ZA 1FYCA 4P75A 4U68A 5CC4A 1QVGA 1E4FT 2BDNA 1YHAA 3R8BA 3CCEA 1VQJA 3T1YQ 4IWXA 4U673 3CXCA 3PUZA 5IP7H 3MWMA 2UUCH 2AQ4A 4PZ8A 1Y1VH 3NTIA 1K0RA 3PUXA 4K2KA 4KTAA 4RMFA 1PFSA 2UUAQ 5JJKA 5EKKA 2L55A 2B2UA 2EYLA 2EOTA 3AQQA 2ICEC 4F4YA 3V6JA 5DGAA 4K0KH 1I6HB 2B3GA 2OQ0A 4BS9A 5C1OA 1E4EA 2QDBA 5AFWA 4I4TF 4O3SA 3CRLC 1A6XA 2RGRA 2EYFA 1Y8OB 5LHY1 4JYAL 4CJ2C 1N9WA 2XNAC 2XVSA 1WYDA 2EJFC 3DEPA 1BGWA 2KEEA 1AE3A 5G3LF 1I7NA 1Z47A 3M9NB 1I4GA 3CCVA 3S1RB 3MFYA 4DR3H 1I50A 2AQ1B 4J1MA 1NY4A 4JI5L 2UVVA 1F9RA 1YHQA 2SEBD 2PPBC 5DG8A 1FJGQ 5FK9C 1DYQA 4A3EH 2N3SA 1LM0A 4DL5A 4QW9A 2F0VA 3G7LA 1F9SA 1VQ8A 4K5VA 4B3RL 1H95A 4JI8H 5LA6F 3E0EA 4ED8A 2JEBI 3TEHB 1S3OA 3GV8B 3AFQA 3I12A 4L8JA 2VQFQ 1V1QA 5I9PA 4FF2A 1HR0L 1S5ED 3UE0A 2DNCA 4DV2H 3PR4A 1J5EQ 4JBJA 3BU2A 3U4VA 3I4MG 1PVOA 4Q0FA 1SBBB 5C44G 1PMRA 5M3MG 1MGSA 2P0AA 3HOXH 2XN9C 1VQCA 1U4MA 2NBFA 5KFHA 2F0IA 1SNPA 4A3IH 1CKNB 1KD1C 1TWGB 4DR1Q 3HGBA 5KFMA 1O7LA 3H0GG 4MTEA 1Z2PX 3LX0A 2A69D 2PMZA 2R85A 4HIOA 1RD9D 1FGUA 1G2TA 1SXTA 4C1NK 4JV5Q 3H40A 4BY1H 4JI4H 4NKLA 3KHRA 1B04A 1EZ1A 3MR5A 1IBML 5IYDG 3ICEA 3FKIA 4IRKA 1G8ZD 4C3IG 2CH4A 1WVLA 4HIMA 3A7AB 1NAPA 1C3OA 3GQBA 4JK1C 1Y1VB 3SK8A 4DUYL 2V59A 2KA7A 4LFBL 3ORQA 4QWCA 5DG7A 4L5QA 2XTIA 5AJ3L 1F77A 1GUSA 5IGFA 5KFNA 5L1KA 4ZRZA 5BR8H 3J7A5 3I55A 1VQDA 2HCIA 2QF7A 3PO3G 4M7EA 3BJUA 4BWGB 3NHHA 4DNIA 5KFEA 4MHEA 4LF7H 3GDEA 4B3SL 1CZGA 2CWPA 4YY3H 1EY4A 3U9SA 3N6XA 3MWDA 4FXKC 1K3RA 3BZDB 5JEAH 4ED3A 4PG3A 2N8NA 2AQ3B 2V58A 1KJ9A 2YRWA 3KOJA 3N6RA 4GKKH 1TQOA 2KHJA 5FLXc 4TKOB 1GSOA 4TRDA 4LF8Q 1LABA 1KC7A 1EY8A 4BWSC 3J80W 1SFOH 2JA8H 4ECSA 3OOCA 5FLXL 1V43A 1W6KA 2L1BA 2Z6BA 1SDFA 2XWJB 4K8IA 4CGYB 4F50A 4V0BA 4A3EB 3FHWA 4PMCA 2R6GA 3K57A 4MTDA 4JI7L 2DNEA 1SAPA 2HVRA 5A2QW 1HFGA 5KT3A 2V4QA 3D6CA 4CKEA 3FEWX 2PI2A 4RWSC 4IWYA 3K5HA 3WDNA 2PBZA 1PYSB 4UY8C 3SE0A 3TP8A 4DR7Q 3K58A 1Z6HA 3J7AK 3MR3A 2E2IH 2JEIA 4GN4B 2QYZA 1MSHA 4FS2A 5EGTA 1K73C 3J81L 2SNSA 5K36G 1YBYA 1S0NA 2YS6A 5I47A 2JA5G 2UXBQ 3JAMW 5D1OA 1OXVA 2F0JA 2YCHA 3HOXB 3MEHA 2D0OA 2E2DC 2VB3X 4X3KA 1TWHH 4A3LG 2R93H 2HUGA 2N55A 4JI3Q 2VUMH 4A3IB 4MV6A 2EYMA 2M00A 4XYOA 4A3JG 2HHHQ 2UU9H 4DPGA 2HT1A 4GLVB 3DEOA 1N32Q 3IAYA 1V1PA 2EXZA 2D9UA 5FO9B 4BY1B 2CW8A 4RB0A 4L1KA 4X66L 2NVTH 2F03A 4O3RA 4RUAA 1JQYD 4MA0A 1G91A 4L5RC 2O5IC 2J6UA 3MXNA 2VA2A 1CKMA 1JJCB 1M0WA 1DOMA 4EYIB 1SMYC 1Q1EA 3I70A 1EQRA 4ABNA 2F3VA 1GGOA 3GP7A 1UC9A 2R87A 4JOIA 1F2ZA 4A3GH 4YAJB 3LP8A 4MV4A 5L1LA 1WTPA 2HIXA 2EYHA 3FPPA 3GIPA 4ZLTF 4JI0H 4DR6H 4IFDG 1TS2A 2DUDA 4KK7A 4LFAL 4JG2A 3IKJA 3DM1A 1D1IA 2BDOA 1EY9A 2XIWA 4HN7A 4YCUA 2EDGA 3PIP3 1ZYRD 2Q2HA 4RB1A 4HEDA 2F0NA 1JJ2A 3WO1A 1KC8C 4UP9A 2B2UC 3FPUB 2K28A 5I4DA 1R9TH 2Z0SA 1XNQL 2IBKA 3J7ZC 3K5OA 4X62H 5CA1F 3IL8A 1VQFA
chains in the Genus database with same CATH topology
3PCOB 1NMFA 2FXQA 5IP7G 3DLLA 3FKIH 1QUQB 1SN8A 2AMCB 4B3TL 4JI6Q 1Y1VG 1Z9FA 2CFMA 4KLKA 2BA0A 1SROA 3GTLH 5LMNQ 2ZM6L 2VQEL 2MO0A 2MO1A 3CC4A 3MEFA 3ULJA 1GVPA 4GN3B 2CKZB 3AYHB 2Q2TA 4A3CG 4R1JA 2K52A 4YWMA 1VQOA 1K9MC 2OTJA 4MTNA 1SR3A 1EIFA 2A1AA 2GVAA 4LFAQ 3ULLA 2I5HA 3G6EA 4P73A 4X62L 5C4JH 4DV7L 3EIVA 1B70B 2EQSA 1Q46A 1JE5A 4LF4L 4GOPA 4QIWE 4JI2L 3F2DA 4DV6L 3RLFA 3CCLA 1X3EA 1XNQQ 3CCMA 4A76A 1GD7A 2VUMG 1VQIA 1EUJA 3L0OA 1WOCA 5IYCG 1NJIC 1MKHA 1GM5A 2OTLA 2MQHA 1D7QA 1VQLA 4DR6Q 3KDFA 3OTOL 1M1KC 2CCZA 4B3TQ 1KIXA 1ASZA 1YEZA 2WAQE 1PH3A 3K7AH 2ZM6Q 2VY3A 2VQEQ 4A3KG 3JC66 4A3EG 4BY7H 1JT8A 4GS3A 1VQGA 3M4QA 3CMEA 2OWOA 4L5SA 3KF6B 2PQAB 3HOYH 1BKBA 1IBKL 1NBWA 4X62Q 1HH2P 3W1BA 4DV7Q 2Q2UA 1M90C 3F2CA 4GNXA 5LMUL 4LF4Q 3CQZH 4DAYB 3T1YL 4JI2Q 1YITA 4YWKA 1SMXA 4Y52H 4RG1A 1IZ6A 4DV6Q 5JJLA 4APVA 3J81j 1Q81C 3HOZH 2RHQB 3PIOA 3HOVG 2I5LX 2BH2A 1U5KA 1HR0W 2R92G 4LWCA 4JBKA 4NXML 4R4QA 3OTOQ 3E9HA 2CQOA 4B3SQ 1VCIA 1OXTA 3HOXG 3I4MH 5C44H 1TWCH 1Q7YC 4NPSA 3K7UC 1VQ4A 4A3FH 1YI2A 4LF5L 2QEXA 5M3MH 4BXXH 3ER0A 4WJ4A 3J81c 2VW9A 5M3FH 1B8AA 4NB3A 1I94L 1CKNA 3CPWA 4IO9A 4JBMA 1KL9A 2KHIA 1VQ9A 2K5HA 1YHBA 4DV4L 1EWIA 3PF5A 5GAGC 1IBKQ 4OX9Q 4O0AA 1V9PA 4O2DA 4JI1Q 5LMUQ 4BY1G 3H0GH 1PH8A 1LTLA 1XNRL 1QVFA 3S17H 5E7NA 3UDIA 2VS1A 5IWAL 2ZJPA 1IBLL 3HOWH 4A3DH 2H5XA 4HIKA 2YV5A 1XPUA 3A5UA 2ALYB 2N78A 3CMAA 3UE1A 4DR5Q 4DV3L 1QVGA 3KJOA 3S1MH 2JA7G 5C0XG 4NXMQ 2L15A 4JBWA 4YCWA 3CCQA 5IYDH 1D8LA 2NN6G 3CAMA 3S24A 3TREA 2B63H 1CSQA 1RIPA 2K5VA 4LF5Q 4C3IH 3BZCA 4XIGS 4TQUS 4YWLA 1HNXL 1DGSA 3A0JA 1I94Q 1S72A 4QJFA 2XGTA 2I5MX 4A3BG 3CP0A 3PUYA 4OWTB 4DV4Q 4LF9L 1HNWQ 2YU9H 2A19A 3I4OA 1QZGA 5M5XH 2KBNA 1WJJA 1TWAH 2GVBA 2WB1G 1K8GA 4FDBA 1Y14B 3BZKA 3RN5A 1YVCA 3HKSA 3NEMA 2HQLA 1XNRQ 3PO3H 4K0KL 5M5WH 1PYBA 2NVQH 3NENA 5JEAG 3GO5A 1C7YA 5IWAQ 1X9NA 1PH2A 1IBLQ 1BVSA 3S2DH 3J80c 1K8AC 2JA6G 1L1OA 1EFWA 4DV3Q 1PH7A 2BH8A 4ME3A 4QY7A 3LGJA 2JA8G 3HOUG 1Q8KA 1VQKA 3CCRA 2ZTCA 4OO1I 2ES2A 2JA9A 3RNUA 1HNXQ 4MZ9A 4DR3L 4BBSG 2UXCL 1E1OA 2AKWB 2VZAA 1VQ6A 3TRZA 3GD7A 4P74A 5GADC 2IT1A 3RZOH 3T1HQ 4LF9Q 1P8LA 2MFIA 1I6HH 4DUZL 4A3MH 1BBUA 3AFPA 1L0WA 3G4SA 1N34L 1RL2A 1HNZQ 3U4ZA 1KXLA 1OXUA 3M3YH 3HFZB 4IPHA 2JQOA 3A74A 4JI8L 4K0KQ 1MIUA 2B29A 1KRTA 4OWXB 5M3FG 1VQPA 4BA1I 3H15A 4Y7NH 2Z6KC 2R7FA 1WFQA 5H1SE 4AQYL 3RZDH 4BBRG 4OO1G 3JAMc 3VDYA 1EOVA 4UP8A 2ZJQA 4IPDA 2CWAA 2NZOA 3PGZA 3H3VI 5HGQA 2LXKA 2WB1E 1VQBA 5C4XH 3J81i 3S1RH 1N33L 3PV0A 3I4NH 1IL2A 3CCUA 4DV2L 2R7ZH 3G71A 4PMWA 2A8VA 4R4OA 3PO2G 3NBHB 2JA5H 2UXCQ 1G51A 4OONA 4XTCS 5HY6A 1UEBA 4DR3Q 2R93G 2ZTEA 4X65L 5IP9G 1MJEA 3L7ZC 2F4VL 4B3ML 1XPRA 4A3LH 4JOIC 1Q86C 4DUZQ 1N34Q 5IYBH 4GLXA 4A3JH 5FJ8G 4HIDA 4LFCL 2IHFA 5C0XJ 4KHPL 4JI8Q 3IRBA 4C3HH 2ID0A 4X6AH 1S40A 2V1CC 4AQYQ 1VQMA 1C9OA 1PA6A 1J6QA 4DKAC 2F52A 3OYYA 1VQEA 4DV0L 4JI4L 3GTQH 4A93G 1EQQA 3S1NH 2QGQA 4YHHL 1YJWA 3K81C 4JCVE 4HJ9A 1N36L 1G291 1N33Q 4A3GG 4WJ3M 4DV2Q 3M7NA 1WCMH 2PNHA 3K80C 3MXNB 3D0FA 1AE2A 2K14A 2WP8J 5LMNW 2LSSA 3DM3A 1E7ZA 5GAHC 4LUVA 2UUAL 1A8VA 4X65Q 5C3EH 4R4TA 1W3SA 2E5LL 4B3MQ 5JEAJ 4QGUA 1AH9A 4AH6A 1TWGH 4DAMA 3GTMH 1TWFH 1A62A 3HKZG 3K0XA 4KI0A 3UDXA 3KJPA 4IFDJ 1CSPA 2EIFA 3J80i 3STBC 3U58A 4IOCA 1HJPA 5BR8L 1XJVA 4LFCQ 5JJIA 4AIMA 2D62A 4QL5A 4OXPA 1PHJA 4BA2I 2EXDA 1IXRA 4IJHA 4LF7L 2F3IA 4QQBX 1G6PA 3ERSX 2N49A 3PUVA 1VS0A 1QUQA 1SE8A 2DGYA 2E8GA 2JK8A 3FKIG 4P75A 4NXNL 4YY3L 3K8AA 4DV0Q 1YHAA 4GOPC 4A3MG 4JI4Q 3FP9A 3CCEA 1VQJA 4YHHQ 3T1YQ 1Y1WH 1N36Q 3CXCA 3PUZA 5IP7H 1LYLA 3F1ZA 4UP7A 4GKKL 4PZ8A 1Y1VH 5GROA 3E9IA 1K0RA 3PUXA 1FJGL 4RMFA 4R4CA 1E24A 1PFSA 2NVYH 2UUAQ 5GQOA 5JJKA 2ZJRA 4DR2L 2E5LQ 1TXYA 3AQQA 4DK3C 5J3BA 1JB7A 1IYJB 3D31A 2K4KA 3RR5A 1PV4A 2B3GA 3RN2A 2OQ0A 4YCVA 3F2BA 2IY5B 3JAMi 5BR8Q 1VQNA 4L5TA 2OCEA 2LXJA 2VQFL 3PF4A 4GOPB 4IJLA 4JYAL 2UUCL 4AYBG 4LF7Q 1N9WA 4H02A 1WYDA 4GLAC 4GNXC 4NXNQ 4YY3Q 1AE3A 4LW1A 2YYZA 3CF5A 1J5EL 4PZ7A 1Z47A 4R4IA 4IOAA 3HKZE 3M4PA 3GTKH 5IYCH 2IHEA 3CCVA 1NTGA 4DK6C 4BY7G 1NY4A 4JI5L 1X55A 1OXSC 3KDFB 4GKKQ 5FLMH 1Q82C 1UE1A 3KF6A 2PQAA 1YHQA 3HOYG 1FJGQ 2QA4A 4A3EH 2N3SA 1LM0A 1UE7A 1E1TA 2AWOA 2I0QA 1EYGA 1VQ8A 1H95A 3SGIA 5IT9c 4DR1L 2E2JH 4B3RL 3E0EA 4DV1L 1VQAA 2JEBI 4OWWB 3TEHB 1S3OA 2UU9L 2RCNA 3AFQA 1I3QH 4JV5L 4GN5A 4GNXB 3HOZG 2VQFQ 4JYAQ 3PIPA 2UUCQ 1V1QA 3WWVA 1HR0L 3CC7A 4HJ7A 3UE0A 4IPCA 3UDGA 1J5EQ 1YNXA 3BU2A 4JBJA 4MNOA 3U4VA 3I4MG 1PH5A 5C44G 2YTXA 1PVOA 2VNUD 2R92H 4A3FG 5M3MG 1FL0A 1PH6A 4BXXG 3TS2A 4JI5Q 3CCSA 3ZJYC 2KCTA 1A63A 3HOXH 2NZHA 1SRUA 1VQCA 2KCMA 4AYBE 1C0AA 1KHIA 2AWNA 4A3IH 4GKJQ 1CKNB 1KD1C 4DR1Q 1GKHA 5ELNA 4B3RQ 3H0GG 3GTGH 4P71A 4JI0L 3I2ZA 1QVCA 4DR6L 2KENA 1YZ6A 4HIOA 1YIJA 2UU9Q 1FGUA 3HOWG 3CCJA 1O7IA 3G48A 4A3DG 1KQSA 4JV5Q 1NE3A 4BY1H 1X56A 5GAEC 1B7YB 1HZCA 2IX1A 1HR0Q 4JC0A 1IBML 1A0IA 5IYDG 3ICEA 3B6YA 1VQHA 2B63G 5IY0A 2JA7H 4LF8L 4HIMA 1WI5A 2OQKA 1X54A 3KYHC 1L1OC 1BBWA 5EAYA 4C3JH 2WFWA 2ATWA 1UWVA 2PI2E 3GTOH 4DUYL 3S14H 2RF4A 4LFBL 3NELA 4L5QA 2XTIA 5IE8A 5AJ3L 3S15H 3Q8DA 2RHSB 3M85A 5DLQE 4A3BH 3W1GA 3I55A 1VQDA 3J7A5 3PO3G 4JI0Q 3U50C 3BJUA 1X3FA 4DNIA 2VL6A 2E2HH 3GDEA 1L2FA 1PH1A 4B3SL 5FLMG 2CWPA 4A93H 4IPGA 1OTCA 1K3RA 2F4VQ 2C35B 4DR7L 1X65A 4PG3A 1PH9A 2N8NA 1QZHA 1IBMQ 2JA6H 3KOJA 1L1OB 2KHJA 5FLXc 1Q1BA 4OX9L 1I5FA 4LF8Q 4KHPQ 3GTPH 2K50A 2UXBL 1XMQL 4JI1L 2R7DA 3F8TA 1SFOH 2JA8H 3HOUH 3M4OH 4HJAA 2ZTDA 2K5NA 1V43A 1UE5A 4DUYQ 2JE6I 4LFBQ 1P16A 5AJ3Q 4BBSH 4LUOA 3FHWA 2R6GA 4P72A 4JI3L 3W5OA 1X3GA 2BA1A 4DV5L 4DR5L 2HHHL 1GO3E 3KFUA 5M5YH 1N32L 1CKOA 4JI7L 1K83H 3I56A 2D0PA 3EBEA 3GTJH 3OW2A 1VQ5A 2PI2A 1SLJA 3M9BA 1XPOA 1PYSB 4UY8C 1E22A 1YJ9A 4DR7Q 1N8RC 1KRSA 1UE6A 5C0XI 4A3IG 4J15A 5C4XG 4A3CH 1XMOL 4LF6L 2E2IH 3I4NG 4GN4B 4BBRH 4X64L 3AEVA 1HNWL 2R7ZG 2NN6I 1E3PA 2HIVA 3KF8B 1K73C 1W2BA 5K36G 1YBYA 3S2HH 4POFA 1EIYB 2JA5G 2UXBQ 1XMQQ 2Y0SG 2ASBA 1NMGA 1OXVA 1HZAA 2JEAI 1I50H 2AHOB 4LNQA 1KAWA 3PO2H 4LUZA 1HZBA 2D0OA 1ASYA 4A3LG 1TWHH 1OXXK 2YTVA 3CD6A 2R93H 4HJ8A 4JI3Q 2VUMH 2GN5A 5IYBG 5IP9H 4DV5Q 1U0LA 2Q2IA 2Z6KA 4A3JG 4A4IA 4DPGA 1MJCA 2PMZE 3I7FA 4GLVB 1PH4A 4JI7Q 3ULPA 2HT1A 1N32Q 2NVXH 4DR4L 4UPAA 3EN2A 2UXDL 3KLWA 5FJ8H 3S1QH 4A3KH 2UUBL 3H3VH 4IFDI 1X6OA 1T9HA 4DR2Q 2K75A 1FVIA 4X66L 1JMCA 2NVTH 1CUKA 1XMOQ 4LF6Q 3TS0A 3T1HL 4X64Q 4L5RC 4GKJL 1CKMA 1JJCB 1WCMG 2YTYA 3CC2A 4JI6L 2IX0A 1Q1EA 3PSIA 1EQRA 3A5ZB 4POGA 2JJQA 4JOIA 5LMNL 1HNZL 4A3GH 2HHHQ 5ELOA 4HJ5A 3TQYA 5C3EG 2MNAA 4KHZA 1JJGA 1XTDA 3CW2C 4PZ6A 1HZ9A 2HIXA 4TVAB 4EQ5A 1LUZA 4IFDG 3HOVH 3RLOA 4A75A 2DUDA 4LFAL 4JG2A 3RLNA 3STBD 4C2MH 4EX5A 3CPFA 4YCUA 2Q2HA 4DR4Q 1JJ2A 3S16H 2Y0SE 1KC8C 2UXDQ 2WAQG 1Q12A 3L2PA 4UP9A 3UDFA 1R9TH 1VQ7A 2UUBQ 2Z0SA 4ALPA 1YJNA 1XNQL 4X66Q 3J7ZC 3PUWA 1Y1WG 4DV1Q 1VQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCO B;  1NMF A;  2FXQ A;  5IP7 G;  3DLL A;  3FKI H;  1QUQ B;  1SN8 A;  2AMC B;  4B3T L;  4JI6 Q;  1Y1V G;  1Z9F A;  2CFM A;  4KLK A;  2BA0 A;  1SRO A;  3GTL H;  5LMN Q;  2ZM6 L;  2VQE L;  2MO0 A;  2MO1 A;  3CC4 A;  3MEF A;  3ULJ A;  1GVP A;  4GN3 B;  2CKZ B;  3AYH B;  2Q2T A;  4A3C G;  4R1J A;  2K52 A;  4YWM A;  1VQO A;  1K9M C;  2OTJ A;  4MTN A;  1SR3 A;  1EIF A;  2A1A A;  2GVA A;  4LFA Q;  3ULL A;  2I5H A;  3G6E A;  4P73 A;  4X62 L;  5C4J H;  4DV7 L;  3EIV A;  1B70 B;  2EQS A;  1Q46 A;  1JE5 A;  4LF4 L;  4GOP A;  4QIW E;  4JI2 L;  3F2D A;  4DV6 L;  3RLF A;  3CCL A;  1X3E A;  1XNQ Q;  3CCM A;  4A76 A;  1GD7 A;  2VUM G;  1VQI A;  1EUJ A;  3L0O A;  1WOC A;  5IYC G;  1NJI C;  1MKH A;  1GM5 A;  2OTL A;  2MQH A;  1D7Q A;  1VQL A;  4DR6 Q;  3KDF A;  3OTO L;  1M1K C;  2CCZ A;  4B3T Q;  1KIX A;  1ASZ A;  1YEZ A;  2WAQ E;  1PH3 A;  3K7A H;  2ZM6 Q;  2VY3 A;  2VQE Q;  4A3K G;  3JC6 6;  4A3E G;  4BY7 H;  1JT8 A;  4GS3 A;  1VQG A;  3M4Q A;  3CME A;  2OWO A;  4L5S A;  3KF6 B;  2PQA B;  3HOY H;  1BKB A;  1IBK L;  1NBW A;  4X62 Q;  1HH2 P;  3W1B A;  4DV7 Q;  2Q2U A;  1M90 C;  3F2C A;  4GNX A;  5LMU L;  4LF4 Q;  3CQZ H;  4DAY B;  3T1Y L;  4JI2 Q;  1YIT A;  4YWK A;  1SMX A;  4Y52 H;  4RG1 A;  1IZ6 A;  4DV6 Q;  5JJL A;  4APV A;  3J81 j;  1Q81 C;  3HOZ H;  2RHQ B;  3PIO A;  3HOV G;  2I5L X;  2BH2 A;  1U5K A;  1HR0 W;  2R92 G;  4LWC A;  4JBK A;  4NXM L;  4R4Q A;  3OTO Q;  3E9H A;  2CQO A;  4B3S Q;  1VCI A;  1OXT A;  3HOX G;  3I4M H;  5C44 H;  1TWC H;  1Q7Y C;  4NPS A;  3K7U C;  1VQ4 A;  4A3F H;  1YI2 A;  4LF5 L;  2QEX A;  5M3M H;  4BXX H;  3ER0 A;  4WJ4 A;  3J81 c;  2VW9 A;  5M3F H;  1B8A A;  4NB3 A;  1I94 L;  1CKN A;  3CPW A;  4IO9 A;  4JBM A;  1KL9 A;  2KHI A;  1VQ9 A;  2K5H A;  1YHB A;  4DV4 L;  1EWI A;  3PF5 A;  5GAG C;  1IBK Q;  4OX9 Q;  4O0A A;  1V9P A;  4O2D A;  4JI1 Q;  5LMU Q;  4BY1 G;  3H0G H;  1PH8 A;  1LTL A;  1XNR L;  1QVF A;  3S17 H;  5E7N A;  3UDI A;  2VS1 A;  5IWA L;  2ZJP A;  1IBL L;  3HOW H;  4A3D H;  2H5X A;  4HIK A;  2YV5 A;  1XPU A;  3A5U A;  2ALY B;  2N78 A;  3CMA A;  3UE1 A;  4DR5 Q;  4DV3 L;  1QVG A;  3KJO A;  3S1M H;  2JA7 G;  5C0X G;  4NXM Q;  2L15 A;  4JBW A;  4YCW A;  3CCQ A;  5IYD H;  1D8L A;  2NN6 G;  3CAM A;  3S24 A;  3TRE A;  2B63 H;  1CSQ A;  1RIP A;  2K5V A;  4LF5 Q;  4C3I H;  3BZC A;  4XIG S;  4TQU S;  4YWL A;  1HNX L;  1DGS A;  3A0J A;  1I94 Q;  1S72 A;  4QJF A;  2XGT A;  2I5M X;  4A3B G;  3CP0 A;  3PUY A;  4OWT B;  4DV4 Q;  4LF9 L;  1HNW Q;  2YU9 H;  2A19 A;  3I4O A;  1QZG A;  5M5X H;  2KBN A;  1WJJ A;  1TWA H;  2GVB A;  2WB1 G;  1K8G A;  4FDB A;  1Y14 B;  3BZK A;  3RN5 A;  1YVC A;  3HKS A;  3NEM A;  2HQL A;  1XNR Q;  3PO3 H;  4K0K L;  5M5W H;  1PYB A;  2NVQ H;  3NEN A;  5JEA G;  3GO5 A;  1C7Y A;  5IWA Q;  1X9N A;  1PH2 A;  1IBL Q;  1BVS A;  3S2D H;  3J80 c;  1K8A C;  2JA6 G;  1L1O A;  1EFW A;  4DV3 Q;  1PH7 A;  2BH8 A;  4ME3 A;  4QY7 A;  3LGJ A;  2JA8 G;  3HOU G;  1Q8K A;  1VQK A;  3CCR A;  2ZTC A;  4OO1 I;  2ES2 A;  2JA9 A;  3RNU A;  1HNX Q;  4MZ9 A;  4DR3 L;  4BBS G;  2UXC L;  1E1O A;  2AKW B;  2VZA A;  1VQ6 A;  3TRZ A;  3GD7 A;  4P74 A;  5GAD C;  2IT1 A;  3RZO H;  3T1H Q;  4LF9 Q;  1P8L A;  2MFI A;  1I6H H;  4DUZ L;  4A3M H;  1BBU A;  3AFP A;  1L0W A;  3G4S A;  1N34 L;  1RL2 A;  1HNZ Q;  3U4Z A;  1KXL A;  1OXU A;  3M3Y H;  3HFZ B;  4IPH A;  2JQO A;  3A74 A;  4JI8 L;  4K0K Q;  1MIU A;  2B29 A;  1KRT A;  4OWX B;  5M3F G;  1VQP A;  4BA1 I;  3H15 A;  4Y7N H;  2Z6K C;  2R7F A;  1WFQ A;  5H1S E;  4AQY L;  3RZD H;  4BBR G;  4OO1 G;  3JAM c;  3VDY A;  1EOV A;  4UP8 A;  2ZJQ A;  4IPD A;  2CWA A;  2NZO A;  3PGZ A;  3H3V I;  5HGQ A;  2LXK A;  2WB1 E;  1VQB A;  5C4X H;  3J81 i;  3S1R H;  1N33 L;  3PV0 A;  3I4N H;  1IL2 A;  3CCU A;  4DV2 L;  2R7Z H;  3G71 A;  4PMW A;  2A8V A;  4R4O A;  3PO2 G;  3NBH B;  2JA5 H;  2UXC Q;  1G51 A;  4OON A;  4XTC S;  5HY6 A;  1UEB A;  4DR3 Q;  2R93 G;  2ZTE A;  4X65 L;  5IP9 G;  1MJE A;  3L7Z C;  2F4V L;  4B3M L;  1XPR A;  4A3L H;  4JOI C;  1Q86 C;  4DUZ Q;  1N34 Q;  5IYB H;  4GLX A;  4A3J H;  5FJ8 G;  4HID A;  4LFC L;  2IHF A;  5C0X J;  4KHP L;  4JI8 Q;  3IRB A;  4C3H H;  2ID0 A;  4X6A H;  1S40 A;  2V1C C;  4AQY Q;  1VQM A;  1C9O A;  1PA6 A;  1J6Q A;  4DKA C;  2F52 A;  3OYY A;  1VQE A;  4DV0 L;  4JI4 L;  3GTQ H;  4A93 G;  1EQQ A;  3S1N H;  2QGQ A;  4YHH L;  1YJW A;  3K81 C;  4JCV E;  4HJ9 A;  1N36 L;  1G29 1;  1N33 Q;  4A3G G;  4WJ3 M;  4DV2 Q;  3M7N A;  1WCM H;  2PNH A;  3K80 C;  3MXN B;  3D0F A;  1AE2 A;  2K14 A;  2WP8 J;  5LMN W;  2LSS A;  3DM3 A;  1E7Z A;  5GAH C;  4LUV A;  2UUA L;  1A8V A;  4X65 Q;  5C3E H;  4R4T A;  1W3S A;  2E5L L;  4B3M Q;  5JEA J;  4QGU A;  1AH9 A;  4AH6 A;  1TWG H;  4DAM A;  3GTM H;  1TWF H;  1A62 A;  3HKZ G;  3K0X A;  4KI0 A;  3UDX A;  3KJP A;  4IFD J;  1CSP A;  2EIF A;  3J80 i;  3STB C;  3U58 A;  4IOC A;  1HJP A;  5BR8 L;  1XJV A;  4LFC Q;  5JJI A;  4AIM A;  2D62 A;  4QL5 A;  4OXP A;  1PHJ A;  4BA2 I;  2EXD A;  1IXR A;  4IJH A;  4LF7 L;  2F3I A;  4QQB X;  1G6P A;  3ERS X;  2N49 A;  3PUV A;  1VS0 A;  1QUQ A;  1SE8 A;  2DGY A;  2E8G A;  2JK8 A;  3FKI G;  4P75 A;  4NXN L;  4YY3 L;  3K8A A;  4DV0 Q;  1YHA A;  4GOP C;  4A3M G;  4JI4 Q;  3FP9 A;  3CCE A;  1VQJ A;  4YHH Q;  3T1Y Q;  1Y1W H;  1N36 Q;  3CXC A;  3PUZ A;  5IP7 H;  1LYL A;  3F1Z A;  4UP7 A;  4GKK L;  4PZ8 A;  1Y1V H;  5GRO A;  3E9I A;  1K0R A;  3PUX A;  1FJG L;  4RMF A;  4R4C A;  1E24 A;  1PFS A;  2NVY H;  2UUA Q;  5GQO A;  5JJK A;  2ZJR A;  4DR2 L;  2E5L Q;  1TXY A;  3AQQ A;  4DK3 C;  5J3B A;  1JB7 A;  1IYJ B;  3D31 A;  2K4K A;  3RR5 A;  1PV4 A;  2B3G A;  3RN2 A;  2OQ0 A;  4YCV A;  3F2B A;  2IY5 B;  3JAM i;  5BR8 Q;  1VQN A;  4L5T A;  2OCE A;  2LXJ A;  2VQF L;  3PF4 A;  4GOP B;  4IJL A;  4JYA L;  2UUC L;  4AYB G;  4LF7 Q;  1N9W A;  4H02 A;  1WYD A;  4GLA C;  4GNX C;  4NXN Q;  4YY3 Q;  1AE3 A;  4LW1 A;  2YYZ A;  3CF5 A;  1J5E L;  4PZ7 A;  1Z47 A;  4R4I A;  4IOA A;  3HKZ E;  3M4P A;  3GTK H;  5IYC H;  2IHE A;  3CCV A;  1NTG A;  4DK6 C;  4BY7 G;  1NY4 A;  4JI5 L;  1X55 A;  1OXS C;  3KDF B;  4GKK Q;  5FLM H;  1Q82 C;  1UE1 A;  3KF6 A;  2PQA A;  1YHQ A;  3HOY G;  1FJG Q;  2QA4 A;  4A3E H;  2N3S A;  1LM0 A;  1UE7 A;  1E1T A;  2AWO A;  2I0Q A;  1EYG A;  1VQ8 A;  1H95 A;  3SGI A;  5IT9 c;  4DR1 L;  2E2J H;  4B3R L;  3E0E A;  4DV1 L;  1VQA A;  2JEB I;  4OWW B;  3TEH B;  1S3O A;  2UU9 L;  2RCN A;  3AFQ A;  1I3Q H;  4JV5 L;  4GN5 A;  4GNX B;  3HOZ G;  2VQF Q;  4JYA Q;  3PIP A;  2UUC Q;  1V1Q A;  3WWV A;  1HR0 L;  3CC7 A;  4HJ7 A;  3UE0 A;  4IPC A;  3UDG A;  1J5E Q;  1YNX A;  3BU2 A;  4JBJ A;  4MNO A;  3U4V A;  3I4M G;  1PH5 A;  5C44 G;  2YTX A;  1PVO A;  2VNU D;  2R92 H;  4A3F G;  5M3M G;  1FL0 A;  1PH6 A;  4BXX G;  3TS2 A;  4JI5 Q;  3CCS A;  3ZJY C;  2KCT A;  1A63 A;  3HOX H;  2NZH A;  1SRU A;  1VQC A;  2KCM A;  4AYB E;  1C0A A;  1KHI A;  2AWN A;  4A3I H;  4GKJ Q;  1CKN B;  1KD1 C;  4DR1 Q;  1GKH A;  5ELN A;  4B3R Q;  3H0G G;  3GTG H;  4P71 A;  4JI0 L;  3I2Z A;  1QVC A;  4DR6 L;  2KEN A;  1YZ6 A;  4HIO A;  1YIJ A;  2UU9 Q;  1FGU A;  3HOW G;  3CCJ A;  1O7I A;  3G48 A;  4A3D G;  1KQS A;  4JV5 Q;  1NE3 A;  4BY1 H;  1X56 A;  5GAE C;  1B7Y B;  1HZC A;  2IX1 A;  1HR0 Q;  4JC0 A;  1IBM L;  1A0I A;  5IYD G;  3ICE A;  3B6Y A;  1VQH A;  2B63 G;  5IY0 A;  2JA7 H;  4LF8 L;  4HIM A;  1WI5 A;  2OQK A;  1X54 A;  3KYH C;  1L1O C;  1BBW A;  5EAY A;  4C3J H;  2WFW A;  2ATW A;  1UWV A;  2PI2 E;  3GTO H;  4DUY L;  3S14 H;  2RF4 A;  4LFB L;  3NEL A;  4L5Q A;  2XTI A;  5IE8 A;  5AJ3 L;  3S15 H;  3Q8D A;  2RHS B;  3M85 A;  5DLQ E;  4A3B H;  3W1G A;  3I55 A;  1VQD A;  3J7A 5;  3PO3 G;  4JI0 Q;  3U50 C;  3BJU A;  1X3F A;  4DNI A;  2VL6 A;  2E2H H;  3GDE A;  1L2F A;  1PH1 A;  4B3S L;  5FLM G;  2CWP A;  4A93 H;  4IPG A;  1OTC A;  1K3R A;  2F4V Q;  2C35 B;  4DR7 L;  1X65 A;  4PG3 A;  1PH9 A;  2N8N A;  1QZH A;  1IBM Q;  2JA6 H;  3KOJ A;  1L1O B;  2KHJ A;  5FLX c;  1Q1B A;  4OX9 L;  1I5F A;  4LF8 Q;  4KHP Q;  3GTP H;  2K50 A;  2UXB L;  1XMQ L;  4JI1 L;  2R7D A;  3F8T A;  1SFO H;  2JA8 H;  3HOU H;  3M4O H;  4HJA A;  2ZTD A;  2K5N A;  1V43 A;  1UE5 A;  4DUY Q;  2JE6 I;  4LFB Q;  1P16 A;  5AJ3 Q;  4BBS H;  4LUO A;  3FHW A;  2R6G A;  4P72 A;  4JI3 L;  3W5O A;  1X3G A;  2BA1 A;  4DV5 L;  4DR5 L;  2HHH L;  1GO3 E;  3KFU A;  5M5Y H;  1N32 L;  1CKO A;  4JI7 L;  1K83 H;  3I56 A;  2D0P A;  3EBE A;  3GTJ H;  3OW2 A;  1VQ5 A;  2PI2 A;  1SLJ A;  3M9B A;  1XPO A;  1PYS B;  4UY8 C;  1E22 A;  1YJ9 A;  4DR7 Q;  1N8R C;  1KRS A;  1UE6 A;  5C0X I;  4A3I G;  4J15 A;  5C4X G;  4A3C H;  1XMO L;  4LF6 L;  2E2I H;  3I4N G;  4GN4 B;  4BBR H;  4X64 L;  3AEV A;  1HNW L;  2R7Z G;  2NN6 I;  1E3P A;  2HIV A;  3KF8 B;  1K73 C;  1W2B A;  5K36 G;  1YBY A;  3S2H H;  4POF A;  1EIY B;  2JA5 G;  2UXB Q;  1XMQ Q;  2Y0S G;  2ASB A;  1NMG A;  1OXV A;  1HZA A;  2JEA I;  1I50 H;  2AHO B;  4LNQ A;  1KAW A;  3PO2 H;  4LUZ A;  1HZB A;  2D0O A;  1ASY A;  4A3L G;  1TWH H;  1OXX K;  2YTV A;  3CD6 A;  2R93 H;  4HJ8 A;  4JI3 Q;  2VUM H;  2GN5 A;  5IYB G;  5IP9 H;  4DV5 Q;  1U0L A;  2Q2I A;  2Z6K A;  4A3J G;  4A4I A;  4DPG A;  1MJC A;  2PMZ E;  3I7F A;  4GLV B;  1PH4 A;  4JI7 Q;  3ULP A;  2HT1 A;  1N32 Q;  2NVX H;  4DR4 L;  4UPA A;  3EN2 A;  2UXD L;  3KLW A;  5FJ8 H;  3S1Q H;  4A3K H;  2UUB L;  3H3V H;  4IFD I;  1X6O A;  1T9H A;  4DR2 Q;  2K75 A;  1FVI A;  4X66 L;  1JMC A;  2NVT H;  1CUK A;  1XMO Q;  4LF6 Q;  3TS0 A;  3T1H L;  4X64 Q;  4L5R C;  4GKJ L;  1CKM A;  1JJC B;  1WCM G;  2YTY A;  3CC2 A;  4JI6 L;  2IX0 A;  1Q1E A;  3PSI A;  1EQR A;  3A5Z B;  4POG A;  2JJQ A;  4JOI A;  5LMN L;  1HNZ L;  4A3G H;  2HHH Q;  5ELO A;  4HJ5 A;  3TQY A;  5C3E G;  2MNA A;  4KHZ A;  1JJG A;  1XTD A;  3CW2 C;  4PZ6 A;  1HZ9 A;  2HIX A;  4TVA B;  4EQ5 A;  1LUZ A;  4IFD G;  3HOV H;  3RLO A;  4A75 A;  2DUD A;  4LFA L;  4JG2 A;  3RLN A;  3STB D;  4C2M H;  4EX5 A;  3CPF A;  4YCU A;  2Q2H A;  4DR4 Q;  1JJ2 A;  3S16 H;  2Y0S E;  1KC8 C;  2UXD Q;  2WAQ G;  1Q12 A;  3L2P A;  4UP9 A;  3UDF A;  1R9T H;  1VQ7 A;  2UUB Q;  2Z0S A;  4ALP A;  1YJN A;  1XNQ L;  4X66 Q;  3J7Z C;  3PUW A;  1Y1W G;  4DV1 Q;  1VQF A; 
#chains in the Genus database with same CATH topology
 2FXQ A;  4FS1 A;  4A93 H;  1QUQ B;  1E0B A;  2CFM A;  2HD3 A;  1PZJ D;  1SFO B;  2JA8 B;  3IFT A;  3CC4 A;  4EQO A;  1VF7 A;  5CYU A;  4EEY A;  4NW2 A;  2OEO A;  4KJN A;  4Q8F A;  2K52 A;  4LK1 C;  4YWM A;  1VQO A;  1K9M C;  2W9B A;  5KFG A;  1SR3 A;  2GVA A;  5F2D A;  3ULL A;  3G6E A;  4F4X A;  1ESF A;  3MTS A;  4GOP A;  2UVU A;  2KVM A;  4JI2 L;  2K01 A;  3FDS A;  3N8D A;  3VYR A;  4DV6 L;  5C5M A;  1H9M A;  1X3E A;  3RLF A;  2WV6 D;  5KIX A;  3CCM A;  1GD7 A;  4ZUI A;  4J9N A;  4EG0 A;  1ET9 A;  1EUJ A;  1QNK A;  5CV4 A;  5C5J A;  2E2I B;  2R7Z A;  5DNF A;  1LT6 D;  4B3T Q;  2BE5 C;  2YL2 A;  1ASZ A;  2MPM A;  2Y0S A;  2WAQ E;  2W9A A;  5KFW A;  2VQE Q;  1O78 A;  4RB3 C;  1JT8 A;  4QWD A;  4DV5 H;  4GS3 A;  1M4V A;  2OF1 A;  1F2M A;  1XDN A;  1KDA A;  1TWH B;  3KF6 B;  2R93 B;  2W6M A;  2VUM B;  2XRS D;  1IBK L;  1BNC A;  1CHQ D;  2Q2U A;  1GLV A;  2QCP X;  4GNX A;  4HR7 B;  3CQZ H;  4DAY B;  5I9O A;  3MFI A;  4K6L A;  4RG1 A;  4LF6 H;  4X64 H;  2F4I A;  4J9S A;  3SHL A;  3J81 j;  4KY6 A;  3MWE A;  1Q81 C;  3HOZ H;  1M8A A;  2NVT B;  2I5L X;  2FMA A;  1HR0 W;  2R92 G;  2XCA A;  2FFK B;  3QB3 A;  2O03 A;  1DOK A;  1WCM A;  2M9V A;  3HEJ A;  3E9H A;  4B3S Q;  2M2L A;  2Z9H A;  1TWC H;  4LF5 L;  2R7M A;  4IR9 A;  2QEX A;  4BXX H;  4A3G B;  1TAE A;  4NB3 A;  1VQ9 A;  1KJQ A;  1TWF A;  1QJO A;  5GAG C;  2UUB H;  5LMU Q;  4ECT A;  2B8F A;  1FNV A;  3R93 A;  1XXG A;  3S17 H;  4CC5 A;  1HXY D;  2VS1 A;  1WH2 A;  5IWA L;  1R9T B;  1IBL L;  4A3D H;  4HIK A;  1EEF D;  3A5U A;  1VAJ A;  2ALY B;  4FNF A;  5LP6 F;  4UDU C;  1SCU B;  3RZO B;  5LMN H;  4G7Z C;  4QWA A;  1ML0 D;  4WRD A;  4Z9C B;  4C3J G;  4A93 B;  2B63 H;  2NN6 G;  2C22 A;  3JRW A;  3TRE A;  4A3M B;  1CSQ A;  5KFT A;  5JJZ A;  4XIG S;  3SI8 A;  1I94 Q;  4JVZ A;  1X3P A;  4FP5 D;  4S3S A;  3GIM A;  4OWT B;  3PUY A;  2WE6 A;  2CQY A;  3I4O A;  1H9S B;  2CH4 W;  5JPM C;  1QZG A;  1ZHS A;  1D1K A;  1TWA H;  4XQN A;  2EY6 A;  3GIJ A;  4IUT A;  2RSN A;  1Y14 B;  3RN5 A;  3NEM A;  5ELE A;  1BNZ A;  2HQL A;  3N52 A;  5M5W H;  1WTW A;  2NVQ H;  3GO5 A;  2FLP A;  1A2T A;  1ENA A;  2ENB A;  2KED A;  4O2A F;  2VUM A;  1L1O A;  1PH7 A;  3IN5 A;  2XWB B;  2K5D A;  1Y69 U;  2HGS A;  3KHL A;  2F0G A;  2PO4 A;  4ED2 A;  1O7Y A;  2ES2 A;  4WD3 A;  2JA9 A;  4BBS G;  3TRZ A;  5FLX W;  5EOY A;  4DV7 H;  2E75 C;  3W3A A;  4LF4 H;  2G9D A;  1EY7 A;  3HZX A;  4CDF C;  1AFP A;  4EBD A;  1I3Q A;  4FBU A;  1OXU A;  3CQZ B;  3HFZ B;  2JQO A;  4K0K Q;  4OWX B;  5M3F G;  5T14 A;  1QOH A;  1VQP A;  4Y7N H;  3EVQ A;  1I4H A;  3OTO H;  3HOZ B;  4QIW B;  3EFX D;  3E3X A;  3OHB A;  1NCV A;  5HGQ A;  2WB1 E;  3T4A C;  5TSS A;  5E4W C;  3BYY B;  3ETH A;  1IL2 A;  3J81 W;  5IOD A;  1TWC B;  1JB3 A;  2MUY A;  4GZY C;  4QUF A;  1EL0 A;  1G6Z A;  1G51 A;  5HY6 A;  4DR3 Q;  4RAY A;  5C1P A;  1SYB A;  2ZTE A;  4TQR A;  1XX8 A;  4X65 L;  5IP9 G;  3L7Z C;  3S9W A;  3GTG A;  2F4V L;  4B3M L;  4GC7 A;  4MV8 A;  4JOI C;  1AN7 A;  2P5Z X;  1RTO A;  1ENC A;  4LFC L;  4DL2 A;  3IFD A;  5LL6 S;  4ME6 A;  4KHP L;  1YNN D;  4JI8 Q;  3S17 B;  2XGQ A;  2J6T A;  1OO9 B;  3TQ1 A;  1S40 A;  4A3D B;  4NXM H;  2BQ3 A;  1J6Q A;  4DKA C;  4KV6 A;  1VQE A;  2A74 C;  5CV7 A;  3GTQ H;  5KT7 A;  3MFH A;  3RBE A;  1EQQ A;  2QGQ A;  1CQF A;  2B63 B;  2NB0 A;  4WJ3 M;  3N42 B;  4DV2 Q;  1T3N A;  2PNH A;  4JW0 A;  2YS7 A;  4DV4 H;  1SNC A;  4FM9 A;  3MHB A;  1GUO A;  2WP8 J;  2LSS A;  3Q22 A;  1DV2 A;  2UUA L;  3MVV A;  1IW7 C;  2X6L A;  2VUG A;  5DQI A;  4QGU A;  1AH9 A;  2E2H A;  2VOB A;  1A62 A;  1TWA B;  1SJE D;  5E4X A;  3J80 i;  3MWY W;  3STB C;  4ME5 A;  3PIO 3;  4PMB A;  4LMY A;  2B2V A;  5JJI A;  1EU4 A;  5M5W B;  1C30 A;  4DV3 H;  2D62 A;  2NVQ B;  1ZHQ A;  4OXP A;  3V6K A;  3CRK C;  1IXR A;  2F3I A;  2JA6 A;  4LH7 A;  5C6A A;  1CA6 A;  1SE3 A;  3PUV A;  3K0Y A;  5DLF A;  2DGY A;  3FKI G;  2JK8 A;  4GOP C;  1PRT B;  4JI4 Q;  3K8A A;  2R8K A;  2ZJT A;  3FP9 A;  2EJM A;  2A5H A;  1Y1W H;  1VF5 C;  4UP7 A;  4LF9 H;  5HGT A;  2UVR A;  4C5A A;  3E9I A;  1FJG L;  4IUV A;  2NVY H;  4RA8 A;  2PQE A;  3ZYY X;  2Q8T A;  4KD4 A;  4YB8 B;  2ZJR A;  4DR2 L;  3A8K E;  1CQV A;  5J3B A;  3TQT A;  1QE6 A;  1VBG A;  4YCV A;  2C2R A;  2IY5 B;  3JAM i;  5BR8 Q;  3QR8 A;  4TV8 F;  4L5T A;  2XIG A;  1DCZ A;  2OCE A;  2VQF L;  5EZY F;  4LF7 Q;  4Y7N B;  4H02 A;  4GLA C;  3KBX A;  4GNX C;  4YY3 Q;  4LW1 A;  1J5E L;  4EFB A;  3HKZ E;  3M4P A;  3GTK H;  4NP5 A;  4ZI7 F;  2IHE A;  3BDC A;  2QIL A;  3K5N A;  1NTG A;  4ZQ3 A;  4DK6 C;  4BY7 G;  1OXS C;  4GKK Q;  3BAA A;  2PQA A;  4ODG A;  3RB0 A;  1YNJ C;  3ITP A;  4DUZ H;  2QA4 A;  3QWN A;  4ECQ A;  1N34 H;  4YP3 A;  2W6Q A;  2PW7 A;  2I0Q A;  3VMM A;  5DAU A;  4DR1 L;  3C2P A;  3RV3 A;  1EY5 A;  1UEA B;  2FK1 A;  3KTM A;  4G3I A;  1WTV A;  1CQJ B;  4AQY H;  1S0M A;  4DNR B;  4J0M A;  1B3Q A;  4JV5 L;  2JEF A;  1B44 D;  4XX0 B;  2J0T D;  3PIP A;  4Y8V B;  4TUY F;  3GIL A;  1N33 H;  5KFC A;  2Z8L A;  4OGQ C;  3GTQ B;  1S97 A;  4IHJ F;  1PH5 A;  4G57 A;  2A68 D;  4A3F G;  1FL0 A;  4CHT B;  5L37 A;  4RH6 A;  3R3O A;  4HAE A;  5E1F A;  1N48 A;  2KCT A;  4IUR A;  5KFK A;  2NZH A;  3GII A;  2VA3 A;  3K6O A;  1IBM H;  1D2B A;  3DUZ A;  3LWB A;  2TMP A;  5C4H A;  4J9R A;  3RB3 A;  4C2M A;  3T5J A;  1CI3 M;  2W71 A;  4DK1 A;  2WII B;  4RNO A;  2BR0 A;  1EYZ A;  1L0X B;  1ILP A;  3RBD A;  2KEN A;  1YZ6 A;  2PW5 A;  2UU9 Q;  3HOW G;  3G48 A;  2KCC A;  4H7B A;  3VA5 A;  1KQS A;  1W6J A;  5GAE C;  4R8I A;  1RJR A;  4UCS A;  4DV0 H;  2WAQ B;  3L3O C;  4YHH H;  3K5L A;  1A0I A;  2W9C B;  4H13 C;  1RF2 D;  2JA7 H;  1UAP A;  2EYP A;  1Y1W B;  4LF8 L;  1WTX A;  3OMG A;  2VQD A;  3GIK A;  1X54 A;  5EAY A;  1L1O C;  3GTO H;  3M9O B;  2E5L H;  1UWV A;  3C46 A;  4DXG A;  2NVY B;  4HMJ A;  3Q8D A;  1B53 A;  1ENF A;  4L63 B;  1MBY A;  4HCS A;  2RQX A;  1D5M C;  5DLQ E;  1DIK A;  2W6O A;  4KY5 A;  4A3B H;  3V6H A;  1KLG D;  1ULZ A;  3VPC A;  4RGM A;  3BDO A;  3U9O A;  4JI0 Q;  1O7Z A;  4RFB A;  2VL6 A;  2F0S A;  2I8C A;  1L2F A;  3ND9 A;  2C9O A;  2FLN A;  4NXN H;  1LT3 D;  2JXM B;  1B9M A;  4IPG A;  4IZO A;  4AYB A;  5CB4 F;  1IYU A;  2F4V Q;  4DR7 L;  1X65 A;  1EY6 A;  3PW0 A;  1LT4 D;  2W70 A;  4FXD A;  5KFP A;  4EBC A;  1SNQ A;  3GTK B;  4OX9 L;  5JVL A;  1DD2 A;  4KHP Q;  3GTP H;  2K50 A;  2UXB L;  5F9N A;  5IGB A;  4WOR A;  1RKN A;  3M4O H;  2NYZ D;  2K5N A;  3RUZ A;  4G7H C;  4XQJ A;  1PZK D;  1ET6 A;  4I55 F;  3BVZ A;  4EQP A;  1C48 A;  5KNC A;  1SEI A;  1LTB D;  4RHS A;  4DLK A;  5FO7 B;  4JI3 L;  3T56 B;  4DR5 L;  4UHV A;  2HHH L;  1EZ6 A;  1GO3 E;  3AMU A;  5H80 A;  1N32 L;  3RFC A;  3MFG A;  4LMQ D;  1K83 H;  2AGQ A;  3EBE A;  2X69 A;  3TBI B;  3M9B A;  1PFM A;  1K8M A;  1E22 A;  4DF7 A;  2E76 C;  1YJ9 A;  1KRS A;  1UE6 A;  2CW0 D;  4J15 A;  4A3I G;  5C4X G;  5JVD F;  3I4N G;  4OO1 H;  3NE5 B;  4RCO A;  4RKB A;  4BBR H;  3AEV A;  1HNW L;  5BPF A;  2R7Z G;  1HHV A;  2NN6 I;  5FPO A;  2HIV A;  3KF8 B;  5CA0 F;  1S9F A;  3NBH A;  2Y0S G;  5FO8 B;  5KFU A;  2JEA I;  2VXW A;  2JEJ A;  4LNQ A;  1CS0 A;  3EYY A;  1KAW A;  2EY5 A;  3PO2 H;  1II3 A;  4LUZ A;  5KG3 A;  4Q43 A;  5KT4 A;  4DV1 H;  3SK5 A;  4PWQ A;  3HXL A;  4OIK A;  2GN5 A;  5IYB G;  4DV5 Q;  5KG0 A;  2B2W A;  2F0L A;  4XDX A;  1KJ8 A;  4A4I A;  5KFD A;  1PH4 A;  5BN3 A;  4C3H G;  4EQN A;  2NVX H;  5JPN C;  1B6R A;  4KD3 A;  4EYH B;  1KDB A;  2FK2 A;  4R9W A;  4A3K H;  4C56 C;  3H3V H;  3J7A V;  2F0Q A;  2WYO A;  4DR2 Q;  1JMC A;  4QUC A;  4LF6 Q;  3R5X A;  3TS0 A;  3T1H L;  1EIG A;  4X64 Q;  2B2V C;  1WCM G;  3E5S A;  2JA7 B;  2AQ2 B;  2IX0 A;  4RGT A;  4POG A;  1HNZ L;  4F87 A;  3GTO B;  5ELO A;  3FRP B;  5C3E G;  2EJG C;  5C8Y F;  3CW2 C;  2C00 A;  4QF4 A;  5KKN B;  2IPK D;  1CFM A;  4EQ5 A;  2LFN A;  3HOV H;  1PK8 A;  2PCF B;  2A73 B;  4A3B B;  1E2Z A;  3TP6 A;  3R2T A;  1LTR D;  2K04 A;  3CPF A;  5J2T F;  2WB1 B;  3OSN A;  2B2Y A;  3R5H A;  4UCO A;  2UUB Q;  1A3V A;  1EOT A;  4ALP A;  5KFV A;  5KX5 F;  3A55 A;  3KLS A;  3PUW A;  2ZT9 C;  3Q6S A;  2JSO A;  4GKJ Q;  3PCO B;  1LTA D;  1K28 A;  2AMC B;  4B3T L;  5KFZ A;  3Q24 A;  3GTP B;  5EPL A;  5LMN Q;  2KSW A;  1ZKO A;  2VQE L;  2ZXR A;  3M4O B;  2MJ8 A;  2F0F A;  2EY1 A;  3A56 A;  3QG1 A;  4C1N I;  3ULJ A;  3RB6 A;  3G6X A;  2Q8I B;  2CKZ B;  2Q2T A;  2R7K A;  4MTN A;  4UCT A;  5LXT F;  1J8I A;  5C4J H;  3NQI A;  4M1U B;  1STB A;  2EQS A;  2R6F A;  4LSA A;  1K83 B;  4QIW E;  2BQU A;  2C2D A;  4ZKC B;  3NUC A;  4ZYS A;  4A76 A;  3I90 A;  3ORR A;  2VUM G;  3MR2 A;  3RV4 A;  5IYC G;  4ZAI A;  1NJI C;  1GM5 A;  3RB4 A;  1CT1 D;  1XMQ H;  4BBR B;  1MD2 D;  4JI1 H;  2FPP B;  1GJX A;  2KCN A;  5CV5 A;  2CCZ A;  3ERO A;  5COY A;  3T51 B;  1KIX A;  4ZCK A;  1KEE A;  5KFF A;  3BQ0 A;  4ECW A;  2AGO A;  2VY3 A;  3SE7 A;  1DON A;  1ONL A;  3PO2 B;  3M4Q A;  2OWO A;  3HP3 A;  1SYC A;  4I50 F;  4EGV A;  4KKS A;  1A2U A;  4LSX A;  4RUC A;  4TQS A;  3BVG A;  4DV7 Q;  4LF5 H;  3E5N A;  1M90 C;  2CQA A;  2NVX B;  5LMU L;  3PZP A;  4LF4 Q;  4ZQI A;  3N43 B;  1JCK B;  4YWK A;  1IZ6 A;  1XMO H;  4A3K B;  2FLL A;  1EIH A;  4ECR A;  3E6Z X;  3HRZ C;  2RHQ B;  3PIO A;  1J9O A;  1U5K A;  4A2B A;  4LWC A;  2B8G A;  3OTO Q;  1NUC A;  1VCI A;  2ZXO A;  3I4M H;  2J6S A;  4CKB A;  5LYJ F;  5C44 H;  1JWU D;  1Q7Y C;  4NPS A;  4KHV A;  1YI2 A;  1W93 A;  3SVM A;  4XYL B;  3J80 E;  5M3M H;  3ER0 A;  4NDX A;  4X3U A;  3J81 c;  1I94 L;  2EYO A;  1CKN A;  3CPW A;  2M05 A;  1TWG A;  4DR4 H;  3HOV B;  3PF5 A;  4OX9 Q;  2FK3 A;  2UXD H;  1V9P A;  3GTP A;  2YRX A;  4CDE C;  3H0G H;  3HKZ B;  3G6J B;  4IN3 A;  4K5W A;  4MIU A;  5A2Q E;  1QVF A;  5E7N A;  2K32 A;  3UDI A;  2WAC A;  1STA A;  3Q8P B;  2YV5 A;  1F2L A;  2RDH A;  3NWT A;  4JI6 H;  4DR5 Q;  5C0X G;  4APM A;  3KHG A;  4F4Z A;  4NXM Q;  4JBW A;  3Q0A A;  3CCQ A;  5IYD H;  1GUG A;  3RAX A;  1Y1V A;  3S24 A;  1EWH A;  2A6H C;  4DL4 A;  1IKM A;  1CA5 A;  4R7R A;  2K5V A;  3BAB A;  3ONA B;  4C3I H;  5CAE B;  1DGS A;  3A0J A;  1TS5 A;  3JAM E;  3H6M A;  2FPG B;  1H9K A;  2XGT A;  1EWC A;  2J9G A;  2I5M X;  1DXM A;  4FF3 A;  4DV4 Q;  1HNW Q;  2YU9 H;  4J9K A;  1PRT D;  1ICW A;  2K5W A;  3CVZ A;  2NUC A;  2GVB A;  2J4X A;  5C4J B;  3OW7 A;  3BZK A;  3PO3 H;  4K0K L;  2F3W A;  1PYB A;  3R2I A;  5NUC A;  5KG6 A;  4O42 A;  1TS3 A;  2X0S A;  1BCP C;  1RDP D;  1X9N A;  1HRJ A;  2FP4 B;  5J22 A;  1BVS A;  1G2S A;  1JKJ B;  2JA6 G;  3OWE B;  4K8J A;  4DV3 Q;  3EA6 A;  5F9L A;  3NWS A;  4QY7 A;  2ZM6 H;  2ICI A;  2BOS A;  3U9T A;  3HOU G;  5KT6 A;  3T5H A;  2W6N A;  2ZTC A;  1GOZ A;  2F0W A;  1ZXT A;  4OO1 I;  2OT2 A;  1A9X A;  5EDW A;  3RNU A;  2YZM A;  4DR3 L;  1E1O A;  3DMU A;  4IUU A;  1X32 A;  4Q5V A;  3GD7 A;  5ISR A;  1B1Z A;  5GAD C;  1HTL D;  2IT1 A;  3T1H Q;  4LF9 Q;  3RZO H;  4OL7 A;  2IA6 A;  2F0O A;  4ECU A;  4A3M H;  1BBU A;  1HNZ Q;  3MA2 B;  2XC9 A;  1PTO H;  3A74 A;  4NMZ A;  4JI8 L;  2VPQ A;  4YQW A;  5IGD A;  3H15 A;  2B2W C;  3RZD H;  2R7F A;  5H1S E;  4UP8 A;  4ECZ A;  4HNT A;  2CWA A;  2NZO A;  4J9L A;  3VR5 A;  3H3V I;  1D7Q A;  1VQB A;  1PRT F;  4RAZ A;  2ZDG A;  4H44 C;  4O3O A;  1E2V A;  3Q23 A;  3CCU A;  4DV2 L;  3I4M B;  1SE4 A;  1S4Z A;  2Z1C A;  4IQZ A;  1BO0 A;  2A6E D;  4QMG A;  4PMW A;  5C44 B;  5K36 H;  2HCC A;  1LTS D;  4N8X 1;  5M3M B;  2JA5 H;  5KFR A;  4F4W A;  4OON A;  2IW3 A;  5J39 A;  4RCN A;  4A3L H;  3T1Y H;  1ZQ7 A;  3KAJ A;  5D14 A;  2NUA B;  2SNM A;  5EJW A;  4DUZ Q;  4YIJ A;  1N34 Q;  4A3J H;  5FJ8 G;  3FMA A;  3H0G B;  5C0X J;  1XTC D;  3D4W A;  4J6H A;  1XYI A;  4HSP A;  4AQY Q;  3FMC A;  1PA6 A;  2W7P A;  3TSS A;  3E0J A;  2Z4H A;  1B2T A;  4JI4 L;  1SMY D;  4Q45 A;  1N33 Q;  2B2Y C;  3K81 C;  3AB9 A;  1TII D;  3HG9 A;  2FE3 A;  3NXW A;  3TII A;  5D8D A;  4C3I B;  1SYG A;  2KHS A;  2W57 A;  3R23 A;  4FF1 A;  2R7L A;  2J7Z A;  5EBD A;  4DFA A;  1A8V A;  3EJI A;  4R4T A;  4H0L C;  5KFO A;  3OIP A;  2YU9 B;  4AH6 A;  2NU6 B;  3C1E A;  1XNR H;  1SSO A;  3FDT A;  3GTM H;  4U7C A;  3UDX A;  3K0X A;  4NLG A;  3VYT A;  4IFD J;  3U58 A;  2PNR C;  5BR8 L;  4MAM A;  4JUZ A;  3KBG A;  4O4I F;  4I7Z C;  3PO3 B;  4QL5 A;  3ETJ A;  4BA2 I;  1SYD A;  4LF7 L;  4IJH A;  4QQB X;  2C2E A;  3ERS X;  2B39 A;  5DM7 3;  3GTL H;  1QUQ A;  4YY3 L;  4DV0 Q;  3PW2 A;  1GUT A;  1SFO A;  1HNX H;  4YHH Q;  4L6T B;  1LYL A;  2XRQ D;  4ILW A;  5JVG 3;  4GKK L;  3SDZ A;  4QW8 A;  1VBH A;  1HCZ A;  4R4C A;  3T13 A;  4K5X A;  5C3W A;  3K3V A;  2E5L Q;  5EWG A;  3DHQ A;  5KYL A;  4EGQ A;  3H94 A;  1PV4 A;  2F0U A;  2NZ1 D;  3F2B A;  1BUV T;  1PTO B;  1VQN A;  4JV0 A;  2JP1 A;  4ECV A;  5L9X A;  1VKZ A;  5KYI A;  4B08 A;  2LXJ A;  5BN4 A;  3PF4 A;  4IJL A;  2E2I A;  4AYB G;  3RZD B;  4DK0 A;  3EPG A;  1S03 G;  2IL8 A;  2RDI A;  4NXN Q;  1I6U A;  5FD5 A;  4IOA A;  4R4I A;  1MSG A;  4N9T A;  4ECY A;  1EUC B;  2UXC H;  1GYF A;  5ELC A;  4FXG C;  5KFX A;  1X55 A;  3TIN A;  3BYT B;  3KDF B;  5FLM H;  1Q82 C;  3KF6 A;  1TWH A;  2R93 A;  2JA5 B;  2MHV A;  4R8N A;  5KFL A;  3VR3 A;  3HOY G;  5EWE A;  1UE7 A;  5JOB A;  2AWO A;  1EYG A;  4HR7 A;  1EQT A;  1TR5 A;  3SGI A;  4DAY A;  5IT9 c;  3GLK A;  4U6P A;  4FVM A;  4KKU A;  4A3J B;  4OWW B;  2UU9 L;  2R82 A;  5IT9 L;  4GN5 A;  2EPB A;  2UUC Q;  1ILQ A;  1TS4 A;  2YU9 A;  3V4S A;  3HB9 A;  1SNO A;  4CBV A;  5IGC A;  2PZW A;  1YNX A;  5KFS A;  4ED0 A;  4MV3 A;  1F2Y A;  1IOV A;  2R92 H;  3V4Z A;  4YR3 A;  2Z4I A;  3TS2 A;  3CCS A;  4XT1 B;  3ZJY C;  1GHK A;  2B2T A;  3R5F A;  5BMV F;  2RBM A;  5FLX E;  1JOQ A;  1JIC A;  3GTM B;  2R8J A;  4JI0 L;  4DR6 L;  2NU8 B;  3ERQ A;  1R9T A;  2DY8 A;  1YIJ A;  3WOF A;  1O7I A;  3CCJ A;  2R7N A;  3GID A;  1NE3 A;  3I4L A;  2G9H D;  1TA8 A;  1B7Y B;  1EU3 A;  1HZC A;  1NSN S;  1N36 H;  4JC0 A;  3GTL B;  2G5D A;  5DGB A;  1LTI D;  2QEJ C;  4DL3 A;  5I2Y A;  3OPO A;  3KAK A;  4C3J H;  2ATW A;  3GIQ A;  2NN6 H;  3S14 H;  2PI2 E;  3OUU A;  4ID6 A;  1H9S A;  5IE8 A;  4DAV A;  3S15 H;  1XWE A;  2MP1 A;  1EFI D;  3Q2O A;  2RHS B;  3M85 A;  4UCR A;  4OEL B;  2AUJ D;  3W1G A;  3H20 A;  1T5X D;  3U50 C;  1WR2 A;  4RZQ A;  3QZ8 A;  1PH1 A;  5KRU A;  1SNM A;  3F8N A;  2BCO A;  1OTC A;  4C5C A;  1JDB B;  4UFZ A;  4IAL A;  3M4Y A;  4O1N A;  5KG1 A;  3JSL A;  5GON F;  2DPJ A;  3KUP A;  1LTT D;  4ZK9 B;  1E2W A;  4MV7 A;  1STY A;  3F8T A;  4HJA A;  1UE5 A;  4N8F A;  3J7A F;  3LWE A;  4R8U B;  1P16 A;  4BBS H;  4LUO A;  5I2X A;  1VMP A;  4P72 A;  3W5O A;  2BA1 A;  4DV5 L;  3KFU A;  5M5Y H;  3CQZ A;  4JYA H;  1C4Q A;  1B9N A;  3I56 A;  1BQQ T;  3OMC A;  5EBC A;  1VQ5 A;  2R86 A;  4QIW A;  1XPO A;  1N8R C;  5DLG A;  5C0X I;  4ED7 A;  4A3C H;  4F88 A;  4LF6 L;  4X64 L;  4JI5 H;  4RNM A;  3L4J A;  1TWC A;  1W2B A;  2R92 B;  4HNU A;  3S2H H;  5JVH 3;  1JOR A;  1XMQ Q;  2ASB A;  1NMG A;  1W96 A;  3RD4 A;  1TY0 A;  2IWH A;  1I50 H;  3HBL A;  1KNE A;  1CQI B;  2HQE A;  3C0F B;  2F0K A;  4MN3 A;  1RJP A;  1QWY A;  1VDZ A;  4B3R H;  1HZB A;  1ASY A;  2YTV A;  5FOB B;  4HJ8 A;  5IP9 H;  4EVO A;  1U0L A;  2O4X A;  2Z6K A;  1Q8I A;  2DN8 A;  1JWM D;  3EN2 A;  3UQ8 A;  1HR0 H;  2NU9 B;  1Z2N X;  3KLW A;  3S1Q H;  2UUB L;  4IFD I;  3PR5 B;  1X6O A;  1T9H A;  1FVI A;  1BJT A;  1CUK A;  4EFE A;  3BG3 A;  1XMO Q;  4OIJ A;  1MZB A;  2B63 A;  4GKJ L;  4RGO S;  5T1I A;  3CC2 A;  2KQ3 A;  3NGD A;  2JJQ A;  5LMN L;  2I87 A;  4C3J B;  2HJW A;  3OWF A;  3JZI A;  3TQY A;  1D6E C;  3S14 B;  2PZU A;  4KHZ A;  1JJG A;  1XTD A;  4IR1 A;  1IW7 D;  1HZ9 A;  1H9J A;  3S15 B;  1TWA A;  3RJ0 A;  1CE8 A;  2BQR A;  3IG0 A;  1PFN A;  4QB4 A;  3RLN A;  3QOJ A;  3STB D;  3P7J A;  4KHP H;  4EX5 A;  5JH7 F;  4EBE A;  4DR4 Q;  2Y0S E;  1PYW D;  2UXD Q;  3RIZ A;  1LO5 D;  1Q12 A;  3L2P A;  3UDF A;  3MC0 B;  4LAA A;  2W8L A;  3PW5 A;  4Q0Y A;  3X3N A;  2F0E A;  5BN5 A;  1HUN A;  2OH2 A;  1MI2 A;  3I8Z A;  4DN4 M;  1KJI A;  2K33 A;  5IP7 G;  3FKI H;  1SN8 A;  5CMD A;  1H9R A;  4JI6 Q;  1Y1V G;  5BPH A;  2DIK A;  5JUM A;  4DUY H;  4LFB H;  3JSN A;  2IP4 A;  4CJ0 B;  2MO1 A;  1STE A;  2FHT A;  2W6P A;  1I6V C;  3AYH B;  4BBS B;  4M8A A;  3EPI A;  2F0D A;  4KKT A;  3D3R A;  3VYS A;  2A1A A;  1EIF A;  3V96 A;  4B3S H;  2I5H A;  2WIN B;  1RHP A;  4DV7 L;  5M5Y B;  4CKC A;  1JE5 A;  4LF4 L;  1HPC A;  2R8I A;  2EY2 A;  3GQC A;  3F2D A;  5M9O A;  3CCL A;  2ZDH A;  2O5J C;  4WFN 3;  3AU7 A;  1VQI A;  3L0O A;  1WOC A;  2OTL A;  1MKH A;  2W8K A;  3P1H A;  2QKI C;  3QJY A;  5COR A;  4DR6 Q;  3OTO L;  5HV6 A;  4YR2 A;  3K5M A;  2WTF A;  3S2H B;  1TY2 A;  3K7A H;  2ZM6 Q;  4A3K G;  4A3E G;  1I50 B;  4BY7 H;  5LL6 b;  3QIA A;  1VQG A;  4IZ8 A;  4JI7 H;  4L5S A;  1BKB A;  1K3B C;  3PN1 A;  1NBW A;  2QK4 A;  4PDB A;  2B2T C;  4X62 Q;  4KN7 C;  3W1B A;  1S5D D;  1YIT A;  3M4I A;  4Y52 H;  4XZ3 B;  3S1Q B;  5IT9 W;  1TT2 A;  4TV9 F;  4DA2 A;  1V4Y A;  3GTQ A;  5FKA C;  3HOV G;  1WTH A;  2BH2 A;  2AUK A;  4NXM L;  3DWP A;  1S0O A;  2CQO A;  3HOX G;  3K59 A;  1VQ4 A;  1FD7 D;  3CU7 A;  4A3F H;  2HVQ A;  1Y8P B;  1I4X A;  1B8A A;  1FNW A;  2C5C A;  2E74 C;  1BXR A;  4RHR A;  2K5H A;  4DV4 L;  3N41 B;  1EWI A;  1AP0 A;  4X3S A;  3MJF A;  4O0A A;  4B9W A;  4MV9 A;  5HUR A;  3UFX B;  4Q44 A;  4BY1 G;  1PH8 A;  1LTL A;  2WAQ A;  4X66 H;  2A69 C;  2RCF A;  1F9P A;  2PMZ B;  3HOW H;  1DM0 B;  2W9C A;  4ECX A;  4DL7 A;  2N78 A;  3RGX A;  3UE1 A;  4DV3 L;  3S1M H;  3KJO A;  1Y1W A;  5IIF A;  2F0M A;  4O3Q A;  2L15 A;  4YCW A;  3FKI B;  1UNS A;  1D8L A;  5LL6 X;  2L11 A;  4HMI A;  2KJX A;  2K1B A;  3BZC A;  2NVY A;  4YWL A;  3QFF A;  4LFA H;  4ZOL F;  3X3M A;  1LT5 D;  4DU9 A;  4LF9 L;  4CDD C;  2A19 A;  1U4P A;  1WJJ A;  2AGP A;  1STH A;  3G6Y A;  1T94 A;  4FDB A;  5KFQ A;  2HVS A;  1XNQ H;  1YVC A;  3HKS A;  5KFB A;  2AU0 A;  4HSV A;  1XNR Q;  5K2M A;  3NEN A;  1NNX A;  5JEA G;  1C7Y A;  1PH2 A;  3BA9 A;  4JV2 A;  4EGJ A;  4IUP A;  2Q8R E;  1SE2 A;  3GTK A;  1EFW A;  2BH8 A;  3BS1 A;  1EYD A;  1AUX A;  3LGJ A;  1T36 A;  2JA8 G;  1Q8K A;  3CCR A;  1PTO D;  3D6W A;  5KT5 A;  3K7A B;  2JEG A;  1HNX Q;  1S5B D;  4MZ9 A;  2KUM A;  1HUM A;  4BY7 B;  4J9Q A;  1FGB D;  1VQ6 A;  4V19 0;  1CTM A;  3OHX C;  1JC7 A;  4HCE A;  4YBZ B;  3NSW A;  4JI2 H;  2MFI A;  2QDL A;  4DUZ L;  1N34 L;  3AFP A;  3G4S A;  3SEB A;  4DV6 H;  1RL2 A;  1Z7T A;  3M3Y H;  4DAP A;  2L5T A;  5DEH A;  3RMH A;  2B29 A;  1B50 A;  2FIN B;  2L12 A;  4BA1 I;  4AQY L;  2Z6K C;  2L9H A;  1WFQ A;  3K5I A;  1EOV A;  3KF8 A;  1L2Z A;  3PGZ A;  3CKI B;  2LXK A;  5C4X H;  3J81 i;  2HDL A;  3PQI A;  1N33 L;  3I4N H;  4QCL A;  2R7Z H;  3G71 A;  2LS0 1;  4R4O A;  3BDL A;  5A35 A;  4A3F B;  1O75 A;  2UXC Q;  2R93 G;  1IBK H;  1RK5 A;  4FO2 A;  5D1O B;  5E3F A;  1XPR A;  4A2A A;  4PNY A;  2FJZ A;  3DWA A;  5IYB H;  1B3A A;  4HID A;  5CV9 A;  2IHF A;  4C3H H;  2ID0 A;  1PTO F;  1V1P B;  1RCV D;  2D2C C;  2K5Q A;  2V1C C;  3HOW B;  2R61 A;  1JE4 A;  4FYD A;  1C9O A;  4XQQ A;  2DWC A;  3S1M B;  2JA7 A;  2F52 A;  3OYY A;  4DV0 L;  4QWE A;  3S1N H;  4LJZ C;  4YHH L;  3GTO A;  4JCV E;  4A3G G;  4JPB W;  1M6V A;  1PRT C;  3MXG A;  3M7N A;  4O2B F;  1WCM H;  3MXN B;  3MZ5 A;  3D0F A;  1I4Q A;  1NR2 A;  2K14 A;  5LMN W;  1AZQ A;  2V4R A;  3DM3 A;  1E7Z A;  4RGN A;  4LUV A;  3TP5 A;  2PYK A;  3H91 A;  5DQH A;  5C3E H;  1R4Q B;  1GUW A;  1D5Z C;  2E5L L;  5JEA J;  5DQG A;  1VMC A;  4DAM A;  4G4K A;  2RGV A;  3M7G A;  1TWF H;  2WB1 A;  2VB2 X;  1TU2 B;  5IWA H;  1CSP A;  1IBL H;  1XJV A;  1FKA H;  4IOC A;  1OWT A;  2DPI A;  1ZYR C;  4AIM A;  1DZ1 A;  3O13 A;  2FPI B;  3GV7 B;  2N49 A;  1VS0 A;  4NXN L;  4A93 G;  2E8G A;  2EE1 A;  5KND A;  4A3M G;  1M7J A;  1FR3 A;  3TDQ A;  1IKL A;  2IJ0 A;  2GPW A;  1EHI A;  1WTO A;  1I7L A;  1N36 Q;  1HA5 A;  5L1I A;  2RDG A;  1U4R A;  3F1Z A;  5EWF A;  3OSP A;  2GPS A;  1EEI D;  5GRO A;  1E24 A;  5GQO A;  2I07 B;  2DZD A;  1TXY A;  4DK3 C;  3WO0 A;  1JB7 A;  1IYJ B;  3D31 A;  2K4K A;  3RR5 A;  2DLN A;  1K83 A;  2QW7 A;  1JIH A;  3RN2 A;  3UI2 A;  2W9B B;  3Q1K A;  3M3Y B;  5JQW A;  5CBE E;  4DNT B;  4IRD A;  2FKL A;  4GOP B;  2UUC L;  2A6E C;  3RAQ A;  2OXP A;  2HDM A;  1KLU D;  1V1O A;  2YYZ A;  3CF5 A;  4PZ7 A;  2XD4 A;  5K5P A;  5IYC H;  5C4X B;  1QIL A;  5KFJ A;  4JV1 A;  3BG5 A;  3I4N B;  3NBI A;  2R7Z B;  4YR0 A;  1I4P A;  1PZI D;  1WD1 A;  3WNZ A;  2ASD A;  1UE1 A;  2PVP A;  4ETS A;  3GV6 A;  2Y0S B;  1ESR A;  1E1T A;  2NVX A;  2F1M A;  4YJ3 F;  3MR6 A;  2E2J H;  4DV1 L;  4UCU A;  4O4H F;  1UC8 A;  1VQA A;  2YZN A;  3RGZ A;  3OIQ A;  2RCN A;  2CHB D;  4C3H B;  1I3Q H;  4GNX B;  3HOZ G;  4RB2 C;  3J7Y W;  4JYA Q;  1EYC A;  3WWV A;  3CC7 A;  4HJ7 A;  3HS0 C;  1JWS D;  5KG7 A;  2L0C A;  3A54 A;  4IPC A;  1MHW C;  3UDG A;  1A63 A;  4MNO A;  2VNU D;  3S1N B;  4IAJ A;  2XGP A;  2YTX A;  4BXX G;  3TN2 A;  1PH6 A;  3QO2 A;  4JI5 Q;  4X65 H;  4FBT A;  3PW4 A;  1WCM B;  2F4V H;  1KDC A;  4B3M H;  1SRU A;  3C3L A;  2KCM A;  2WKC A;  4AYB E;  1STN A;  5ELF A;  1SYX B;  1C0A A;  1KHI A;  2LKV A;  5C3E B;  2LMC B;  2AWN A;  1LTG D;  5JAV A;  2IMW P;  4LFC H;  1U9R A;  5D3D A;  1KAA A;  3SR1 A;  4B3R Q;  1GKH A;  5ELN A;  3VR6 A;  3HKZ A;  1TWF B;  3GTG H;  5FPR A;  2H1E A;  3NTH A;  4P71 A;  3I2Z A;  1Q90 A;  1QVC A;  5D1P A;  1RYS A;  1CK1 A;  4A3D G;  4XYQ A;  1F9Q A;  1X56 A;  4N9P A;  3T53 B;  2IX1 A;  1STG A;  1HR0 Q;  3B6Y A;  5CR3 A;  1VQH A;  5KEE A;  3T5L A;  2B63 G;  3NP8 A;  1LLR D;  3BQ2 A;  2A6H D;  5IY0 A;  4MA5 A;  5C0X H;  5J2U F;  2FMM A;  1WI5 A;  2RVL A;  2OQK A;  4B9X A;  3QZ7 A;  2UUA H;  3KYH C;  1BBW A;  2WFW A;  2R8G A;  1CHP D;  1NR4 A;  2RF4 A;  1GHJ A;  3NEL A;  1E4G T;  2ALZ A;  1KJJ A;  5EPJ A;  5EKL A;  4C5B A;  2X6G A;  5IOC A;  2XCL A;  2MGS A;  3W2D A;  2E2H H;  1X3F A;  3PW7 A;  1RYR A;  3T5K A;  5FLM G;  1BCP D;  2EZV A;  5IGG A;  4UCV A;  5FD6 A;  1SEB D;  1QNU A;  3G8C A;  1V51 A;  4WBN F;  3NPP A;  2NTS A;  2C35 B;  1KAB A;  2I46 A;  1PH9 A;  5KT2 A;  2NTT A;  1QZH A;  1IBM Q;  3OHA A;  2JA6 H;  4IFD H;  3VPB A;  4XYM B;  1L1O B;  1Q1B A;  1R4P B;  1I5F A;  4FF4 A;  5KG4 A;  2C28 A;  1EUD B;  1FJG H;  1XMQ L;  4JI1 L;  2R7D A;  3KLS X;  2KEC A;  3HOU H;  4PV1 C;  1B4O A;  1TKW B;  2RSO A;  4DR2 H;  2ZTD A;  3BQ1 A;  3KHH A;  4DUY Q;  2JE6 I;  4LFB Q;  1KBL A;  1PX2 A;  5AJ3 Q;  4O4L F;  1SND A;  2EYJ A;  1ROD A;  1X3G A;  4YJ2 F;  1JOO A;  2E2J B;  1CKO A;  4I7A A;  1A15 A;  2VQF H;  2V9W A;  1EZ8 A;  3OSO A;  2D0P A;  2SCU B;  3GTJ H;  3OW2 A;  1QB5 D;  1I3Q B;  1Z2O X;  3I73 A;  1SLJ A;  1GXD C;  3PMF A;  4IUQ A;  1J5E H;  4X3T A;  5CGK A;  1A3T A;  1XMO L;  2K05 A;  1E3P A;  4HQ6 A;  3MAQ A;  1HQM C;  4POF A;  1EIY B;  4M9U A;  2IX3 A;  3A7L A;  1B6S A;  1HZA A;  2AHO B;  1D5X C;  1BCP F;  3PVX A;  4E6I A;  4DR1 H;  2RDJ A;  5EPK A;  4GKJ H;  1OXX K;  3CD6 A;  3DWQ A;  2BE5 D;  4Q8E A;  4WJW A;  2Q2I A;  1IYV A;  2FMC A;  2ATL A;  3H0G A;  1FNU A;  1MJC A;  2PMZ E;  3I7F A;  4JI7 Q;  3GTG B;  1T5E A;  3ULP A;  4RU9 A;  4JV5 H;  1ZEQ X;  4DR4 L;  4UPA A;  3TZU A;  3VR4 A;  2UXD L;  4RNN A;  1SYE A;  3D8G A;  3MXP A;  1S10 A;  1CM9 A;  5FJ8 H;  1K8O A;  1YNN C;  2PN1 A;  3RTX A;  1BXT A;  2K75 A;  3CHB D;  5EQ0 A;  4IRC A;  2SOB A;  1V8Q A;  2YTY A;  2F0P A;  4JI6 L;  3PSI A;  2EVB A;  3A5Z B;  5IYZ F;  1ZET A;  4XT3 B;  2DY7 A;  4HJ5 A;  3EQL C;  2CZG A;  1HTP A;  2MNA A;  2N88 A;  1GSH A;  2NWG A;  4PZ6 A;  4MV1 A;  3A8I E;  4TVA B;  1AZP A;  1LUZ A;  2JYO A;  2RKS A;  2JN4 A;  3RLO A;  4A75 A;  1N56 A;  4C2M H;  4I65 A;  2E2H B;  5KFI A;  3S16 H;  3Q8S B;  2WAQ G;  1JLL B;  3I3C A;  3TME A;  3V2T A;  1VQ7 A;  1K1Q A;  4ZUJ A;  1YJN A;  1DOL A;  3SK4 A;  4GC6 A;  2V4D A;  5T1G A;  4X66 Q;  4LF8 H;  4KJO A;  3VR2 A;  2CVR A;  1BDO A;  1Y1W G;  4DV1 Q;  2JA6 B;  1B33 N;  5KFY A;  1NMF A;  3DLL A;  1RTN A;  3MXU A;  1Z9F A;  4KLK A;  5CV8 A;  2VPS A;  2BA0 A;  1SRO A;  1IL8 A;  3VPD A;  2ZM6 L;  2D5D A;  2MO0 A;  3HOU B;  2DJF C;  3MEF A;  3LWU A;  4DXF A;  2XCP A;  3RUP A;  1GVP A;  1PFB A;  4GN3 B;  4A3C G;  2UVW A;  4R1J A;  2OTJ A;  3SK6 A;  3LML A;  5C3X A;  4LFA Q;  1HQR D;  4P73 A;  4X62 L;  1DV1 A;  4J9O A;  3EIV A;  1S5C D;  1B70 B;  1Q46 A;  1X3Q A;  3WOE A;  3J81 E;  4DR7 H;  3TP7 A;  3GTJ B;  1K1S A;  5KG5 A;  4K14 A;  4ZKB B;  3NK9 A;  1XNQ Q;  2W6Z A;  4OX9 H;  5D65 A;  3H3V C;  2MQH A;  2UXB H;  3NTK A;  1VQL A;  3KDF A;  1M1K C;  3DXJ C;  2I80 A;  2V5A A;  2OLS A;  1Q3L A;  1Y8N B;  2JA5 A;  1YEZ A;  1PH3 A;  1JR0 D;  2CW7 A;  4JI3 H;  3JC6 6;  1HFN A;  2R84 A;  2YZG A;  2YW2 A;  4DR5 H;  2HHH H;  1N32 H;  1PDQ A;  3CME A;  2PQA B;  4UAI A;  3HOY H;  4ZHQ F;  3JRX A;  5DG9 A;  1HH2 P;  4F7X A;  4KMU C;  5D3I B;  3F2C A;  4CC6 A;  3T16 A;  3T1Y L;  4JI2 Q;  1SMX A;  5JJL A;  2NU7 B;  4DV6 Q;  3URY A;  4XXE A;  4APV A;  1HNW H;  1U4L A;  1A3U A;  3BVM A;  4G7O C;  4F8M A;  1GUN A;  5C5L A;  4JBK A;  4O3N A;  1JX4 A;  4R4Q A;  4O3P A;  1OXT A;  1C8C A;  2A68 C;  2K6A A;  3L9A X;  3K7U C;  1UUP A;  4RAU C;  3P20 A;  4WJ4 A;  1LV9 A;  2VW9 A;  4FU0 A;  2SDF A;  5M3F H;  4IO9 A;  4JBM A;  1RK6 A;  1KL9 A;  1I4R A;  2KHI A;  3GTM A;  1YHB A;  2GA4 B;  1IBK Q;  4C2M B;  1AUV A;  4O2D A;  5CV6 A;  4JI1 Q;  1JXL A;  1PXU A;  3S16 B;  1XNR L;  1GSA A;  4CJ1 B;  5DM6 3;  2ZJP A;  1RJQ A;  3T1H H;  2R8H A;  2H5X A;  3GTL A;  1XPU A;  3CMA A;  1WTR A;  1JDE A;  1BOS A;  2JA7 G;  4HTH A;  3BA8 A;  1HNZ H;  2F0H A;  1BBX C;  1WSC A;  4I7H A;  3H4D A;  1LAC A;  2FJ2 A;  3CAM A;  1BF4 A;  4ED6 A;  3GTJ A;  3A8J E;  1KTK A;  1RIP A;  4LF5 Q;  2FB9 A;  2K03 A;  3OUZ A;  4TQU S;  5ELD A;  3VA7 A;  1HNX L;  1S72 A;  4QJF A;  3SXH A;  4A3B G;  4J9P A;  1BR9 A;  3CP0 A;  5J1Z A;  4RKL A;  5M5X H;  2KBN A;  3I72 A;  1K8G A;  2WB1 G;  3F2U A;  5KG2 A;  3GV5 B;  3K3P A;  1IHZ A;  3KLR A;  3DF7 A;  1AEX A;  5IWA Q;  1IBL Q;  4HNV A;  3S2D H;  3J80 c;  1K8A C;  2WDT A;  1PLF A;  4P2C B;  4YAK B;  3L4K A;  4B3T H;  4AYB B;  4ME3 A;  2VQE H;  2LY7 A;  1TVX A;  3J80 L;  4E4T A;  1L0Y B;  1IOW A;  1VQK A;  4PQX A;  3G6V A;  4R8U A;  4J9M A;  2VR1 A;  2UXC L;  2AKW B;  2VZA A;  4P74 A;  3QOL A;  4ULL A;  3V05 A;  5EKI A;  2TSS A;  1P8L A;  3HOY B;  5HBR B;  1S5F D;  5A2Q L;  1I6H H;  4ED1 A;  3KK7 A;  1L0W A;  2O2L D;  1BCP B;  3U4Z A;  1KXL A;  2WKD A;  3C1F A;  4IPH A;  3D4D A;  4CDC C;  1MIU A;  1KRT A;  1QCB D;  4OHJ A;  4DGZ A;  5IGE A;  2K7V A;  1K0S A;  5L1J A;  3ND8 A;  1KNA A;  5I6W A;  4OO1 G;  4BBR G;  3JAM c;  3VDY A;  2ZJQ A;  4IPD A;  2MCT A;  2R92 A;  2RDF A;  2CW0 C;  3TIG A;  3S1R H;  3PV0 A;  3JAM L;  1S68 A;  3KXY T;  1EY0 A;  2H4O A;  2A8V A;  1E4E B;  2L4N A;  3PO2 G;  3NBH B;  3FVQ A;  5KFA A;  4XTC S;  1UEB A;  5M3F B;  1EQV A;  1MJE A;  3Q8R B;  4DL6 A;  5LMU H;  4KN4 C;  2RA4 A;  5I6Y A;  4EEQ A;  3M9M B;  3BJY A;  1Q86 C;  1EYA A;  1JOK A;  4HYK A;  4GLX A;  1WTQ A;  1DJR D;  2ASJ A;  3H4B A;  1YNJ D;  3IRB A;  4X6A H;  3TZD A;  1RJT A;  1VQM A;  2YYA A;  3Q8Q B;  2ZDQ A;  4MTK A;  2KOL A;  3NQT A;  1ICF B;  2GLT A;  3P75 A;  5KNB A;  1YJW A;  4HJ9 A;  1N36 L;  1G29 1;  1I94 H;  3K80 C;  3RF2 A;  4KY7 A;  1AE2 A;  1O80 A;  2XSC A;  4IUN A;  3VYU A;  5GAH C;  3KAL A;  4RZR A;  2PZT A;  4X65 Q;  4LH6 A;  5G3L D;  5LOV F;  1W3S A;  2DJG C;  4B3M Q;  1M0T A;  5C4Z A;  4J8Q A;  1TWG H;  2F0T A;  1AN8 A;  1QG7 A;  3D4R A;  5M5X B;  4KI0 A;  3HKZ G;  3KJP A;  3GV3 A;  1WD0 A;  4OEM B;  2EIF A;  4TSS A;  1UNN C;  4LFC Q;  1HJP A;  4QWB A;  5ELB A;  5CBA E;  4K6D A;  1AW7 A;  1CZW A;  5KGU A;  2W7O A;  1PHJ A;  1SJH D;  3N44 B;  3N40 P;  2EXD A;  1HA6 A;  3LNN A;  4K2L A;  3I91 A;  1PTO C;  1SYF A;  3H09 A;  3S2D B;  2ZXP A;  1G6P A;  5IT9 E;  2ASL A;  1SE8 A;  2R3Z A;  1FYC A;  4P75 A;  4U68 A;  5CC4 A;  1QVG A;  1E4F T;  2BDN A;  1YHA A;  3R8B A;  3CCE A;  1VQJ A;  3T1Y Q;  4IWX A;  4U67 3;  3CXC A;  3PUZ A;  5IP7 H;  3MWM A;  2UUC H;  2AQ4 A;  4PZ8 A;  1Y1V H;  3NTI A;  1K0R A;  3PUX A;  4K2K A;  4KTA A;  4RMF A;  1PFS A;  2UUA Q;  5JJK A;  5EKK A;  2L55 A;  2B2U A;  2EYL A;  2EOT A;  3AQQ A;  2ICE C;  4F4Y A;  3V6J A;  5DGA A;  4K0K H;  1I6H B;  2B3G A;  2OQ0 A;  4BS9 A;  5C1O A;  1E4E A;  2QDB A;  5AFW A;  4I4T F;  4O3S A;  3CRL C;  1A6X A;  2RGR A;  2EYF A;  1Y8O B;  5LHY 1;  4JYA L;  4CJ2 C;  1N9W A;  2XNA C;  2XVS A;  1WYD A;  2EJF C;  3DEP A;  1BGW A;  2KEE A;  1AE3 A;  5G3L F;  1I7N A;  1Z47 A;  3M9N B;  1I4G A;  3CCV A;  3S1R B;  3MFY A;  4DR3 H;  1I50 A;  2AQ1 B;  4J1M A;  1NY4 A;  4JI5 L;  2UVV A;  1F9R A;  1YHQ A;  2SEB D;  2PPB C;  5DG8 A;  1FJG Q;  5FK9 C;  1DYQ A;  4A3E H;  2N3S A;  1LM0 A;  4DL5 A;  4QW9 A;  2F0V A;  3G7L A;  1F9S A;  1VQ8 A;  4K5V A;  4B3R L;  1H95 A;  4JI8 H;  5LA6 F;  3E0E A;  4ED8 A;  2JEB I;  3TEH B;  1S3O A;  3GV8 B;  3AFQ A;  3I12 A;  4L8J A;  2VQF Q;  1V1Q A;  5I9P A;  4FF2 A;  1HR0 L;  1S5E D;  3UE0 A;  2DNC A;  4DV2 H;  3PR4 A;  1J5E Q;  4JBJ A;  3BU2 A;  3U4V A;  3I4M G;  1PVO A;  4Q0F A;  1SBB B;  5C44 G;  1PMR A;  5M3M G;  1MGS A;  2P0A A;  3HOX H;  2XN9 C;  1VQC A;  1U4M A;  2NBF A;  5KFH A;  2F0I A;  1SNP A;  4A3I H;  1CKN B;  1KD1 C;  1TWG B;  4DR1 Q;  3HGB A;  5KFM A;  1O7L A;  3H0G G;  4MTE A;  1Z2P X;  3LX0 A;  2A69 D;  2PMZ A;  2R85 A;  4HIO A;  1RD9 D;  1FGU A;  1G2T A;  1SXT A;  4C1N K;  4JV5 Q;  3H40 A;  4BY1 H;  4JI4 H;  4NKL A;  3KHR A;  1B04 A;  1EZ1 A;  3MR5 A;  1IBM L;  5IYD G;  3ICE A;  3FKI A;  4IRK A;  1G8Z D;  4C3I G;  2CH4 A;  1WVL A;  4HIM A;  3A7A B;  1NAP A;  1C3O A;  3GQB A;  4JK1 C;  1Y1V B;  3SK8 A;  4DUY L;  2V59 A;  2KA7 A;  4LFB L;  3ORQ A;  4QWC A;  5DG7 A;  4L5Q A;  2XTI A;  5AJ3 L;  1F77 A;  1GUS A;  5IGF A;  5KFN A;  5L1K A;  4ZRZ A;  5BR8 H;  3J7A 5;  3I55 A;  1VQD A;  2HCI A;  2QF7 A;  3PO3 G;  4M7E A;  3BJU A;  4BWG B;  3NHH A;  4DNI A;  5KFE A;  4MHE A;  4LF7 H;  3GDE A;  4B3S L;  1CZG A;  2CWP A;  4YY3 H;  1EY4 A;  3U9S A;  3N6X A;  3MWD A;  4FXK C;  1K3R A;  3BZD B;  5JEA H;  4ED3 A;  4PG3 A;  2N8N A;  2AQ3 B;  2V58 A;  1KJ9 A;  2YRW A;  3KOJ A;  3N6R A;  4GKK H;  1TQO A;  2KHJ A;  5FLX c;  4TKO B;  1GSO A;  4TRD A;  4LF8 Q;  1LAB A;  1KC7 A;  1EY8 A;  4BWS C;  3J80 W;  1SFO H;  2JA8 H;  4ECS A;  3OOC A;  5FLX L;  1V43 A;  1W6K A;  2L1B A;  2Z6B A;  1SDF A;  2XWJ B;  4K8I A;  4CGY B;  4F50 A;  4V0B A;  4A3E B;  3FHW A;  4PMC A;  2R6G A;  3K57 A;  4MTD A;  4JI7 L;  2DNE A;  1SAP A;  2HVR A;  5A2Q W;  1HFG A;  5KT3 A;  2V4Q A;  3D6C A;  4CKE A;  3FEW X;  2PI2 A;  4RWS C;  4IWY A;  3K5H A;  3WDN A;  2PBZ A;  1PYS B;  4UY8 C;  3SE0 A;  3TP8 A;  4DR7 Q;  3K58 A;  1Z6H A;  3J7A K;  3MR3 A;  2E2I H;  2JEI A;  4GN4 B;  2QYZ A;  1MSH A;  4FS2 A;  5EGT A;  1K73 C;  3J81 L;  2SNS A;  5K36 G;  1YBY A;  1S0N A;  2YS6 A;  5I47 A;  2JA5 G;  2UXB Q;  3JAM W;  5D1O A;  1OXV A;  2F0J A;  2YCH A;  3HOX B;  3MEH A;  2D0O A;  2E2D C;  2VB3 X;  4X3K A;  1TWH H;  4A3L G;  2R93 H;  2HUG A;  2N55 A;  4JI3 Q;  2VUM H;  4A3I B;  4MV6 A;  2EYM A;  2M00 A;  4XYO A;  4A3J G;  2HHH Q;  2UU9 H;  4DPG A;  2HT1 A;  4GLV B;  3DEO A;  1N32 Q;  3IAY A;  1V1P A;  2EXZ A;  2D9U A;  5FO9 B;  4BY1 B;  2CW8 A;  4RB0 A;  4L1K A;  4X66 L;  2NVT H;  2F03 A;  4O3R A;  4RUA A;  1JQY D;  4MA0 A;  1G91 A;  4L5R C;  2O5I C;  2J6U A;  3MXN A;  2VA2 A;  1CKM A;  1JJC B;  1M0W A;  1DOM A;  4EYI B;  1SMY C;  1Q1E A;  3I70 A;  1EQR A;  4ABN A;  2F3V A;  1GGO A;  3GP7 A;  1UC9 A;  2R87 A;  4JOI A;  1F2Z A;  4A3G H;  4YAJ B;  3LP8 A;  4MV4 A;  5L1L A;  1WTP A;  2HIX A;  2EYH A;  3FPP A;  3GIP A;  4ZLT F;  4JI0 H;  4DR6 H;  4IFD G;  1TS2 A;  2DUD A;  4KK7 A;  4LFA L;  4JG2 A;  3IKJ A;  3DM1 A;  1D1I A;  2BDO A;  1EY9 A;  2XIW A;  4HN7 A;  4YCU A;  2EDG A;  3PIP 3;  1ZYR D;  2Q2H A;  4RB1 A;  4HED A;  2F0N A;  1JJ2 A;  3WO1 A;  1KC8 C;  4UP9 A;  2B2U C;  3FPU B;  2K28 A;  5I4D A;  1R9T H;  2Z0S A;  1XNQ L;  2IBK A;  3J7Z C;  3K5O A;  4X62 H;  5CA1 F;  3IL8 A;  1VQF A; 
#chains in the Genus database with same CATH homology
 3PCO B;  1NMF A;  2FXQ A;  5IP7 G;  3DLL A;  3FKI H;  1QUQ B;  1SN8 A;  2AMC B;  4B3T L;  4JI6 Q;  1Y1V G;  1Z9F A;  2CFM A;  4KLK A;  2BA0 A;  1SRO A;  3GTL H;  5LMN Q;  2ZM6 L;  2VQE L;  2MO0 A;  2MO1 A;  3CC4 A;  3MEF A;  3ULJ A;  1GVP A;  4GN3 B;  2CKZ B;  3AYH B;  2Q2T A;  4A3C G;  4R1J A;  2K52 A;  4YWM A;  1VQO A;  1K9M C;  2OTJ A;  4MTN A;  1SR3 A;  1EIF A;  2A1A A;  2GVA A;  4LFA Q;  3ULL A;  2I5H A;  3G6E A;  4P73 A;  4X62 L;  5C4J H;  4DV7 L;  3EIV A;  1B70 B;  2EQS A;  1Q46 A;  1JE5 A;  4LF4 L;  4GOP A;  4QIW E;  4JI2 L;  3F2D A;  4DV6 L;  3RLF A;  3CCL A;  1X3E A;  1XNQ Q;  3CCM A;  4A76 A;  1GD7 A;  2VUM G;  1VQI A;  1EUJ A;  3L0O A;  1WOC A;  5IYC G;  1NJI C;  1MKH A;  1GM5 A;  2OTL A;  2MQH A;  1D7Q A;  1VQL A;  4DR6 Q;  3KDF A;  3OTO L;  1M1K C;  2CCZ A;  4B3T Q;  1KIX A;  1ASZ A;  1YEZ A;  2WAQ E;  1PH3 A;  3K7A H;  2ZM6 Q;  2VY3 A;  2VQE Q;  4A3K G;  3JC6 6;  4A3E G;  4BY7 H;  1JT8 A;  4GS3 A;  1VQG A;  3M4Q A;  3CME A;  2OWO A;  4L5S A;  3KF6 B;  2PQA B;  3HOY H;  1BKB A;  1IBK L;  1NBW A;  4X62 Q;  1HH2 P;  3W1B A;  4DV7 Q;  2Q2U A;  1M90 C;  3F2C A;  4GNX A;  5LMU L;  4LF4 Q;  3CQZ H;  4DAY B;  3T1Y L;  4JI2 Q;  1YIT A;  4YWK A;  1SMX A;  4Y52 H;  4RG1 A;  1IZ6 A;  4DV6 Q;  5JJL A;  4APV A;  3J81 j;  1Q81 C;  3HOZ H;  2RHQ B;  3PIO A;  3HOV G;  2I5L X;  2BH2 A;  1U5K A;  1HR0 W;  2R92 G;  4LWC A;  4JBK A;  4NXM L;  4R4Q A;  3OTO Q;  3E9H A;  2CQO A;  4B3S Q;  1VCI A;  1OXT A;  3HOX G;  3I4M H;  5C44 H;  1TWC H;  1Q7Y C;  4NPS A;  3K7U C;  1VQ4 A;  4A3F H;  1YI2 A;  4LF5 L;  2QEX A;  5M3M H;  4BXX H;  3ER0 A;  4WJ4 A;  3J81 c;  2VW9 A;  5M3F H;  1B8A A;  4NB3 A;  1I94 L;  1CKN A;  3CPW A;  4IO9 A;  4JBM A;  1KL9 A;  2KHI A;  1VQ9 A;  2K5H A;  1YHB A;  4DV4 L;  1EWI A;  3PF5 A;  5GAG C;  1IBK Q;  4OX9 Q;  4O0A A;  1V9P A;  4O2D A;  4JI1 Q;  5LMU Q;  4BY1 G;  3H0G H;  1PH8 A;  1LTL A;  1XNR L;  1QVF A;  3S17 H;  5E7N A;  3UDI A;  2VS1 A;  5IWA L;  2ZJP A;  1IBL L;  3HOW H;  4A3D H;  2H5X A;  4HIK A;  2YV5 A;  1XPU A;  3A5U A;  2ALY B;  2N78 A;  3CMA A;  3UE1 A;  4DR5 Q;  4DV3 L;  1QVG A;  3KJO A;  3S1M H;  2JA7 G;  5C0X G;  4NXM Q;  2L15 A;  4JBW A;  4YCW A;  3CCQ A;  5IYD H;  1D8L A;  2NN6 G;  3CAM A;  3S24 A;  3TRE A;  2B63 H;  1CSQ A;  1RIP A;  2K5V A;  4LF5 Q;  4C3I H;  3BZC A;  4XIG S;  4TQU S;  4YWL A;  1HNX L;  1DGS A;  3A0J A;  1I94 Q;  1S72 A;  4QJF A;  2XGT A;  2I5M X;  4A3B G;  3CP0 A;  3PUY A;  4OWT B;  4DV4 Q;  4LF9 L;  1HNW Q;  2YU9 H;  2A19 A;  3I4O A;  1QZG A;  5M5X H;  2KBN A;  1WJJ A;  1TWA H;  2GVB A;  2WB1 G;  1K8G A;  4FDB A;  1Y14 B;  3BZK A;  3RN5 A;  1YVC A;  3HKS A;  3NEM A;  2HQL A;  1XNR Q;  3PO3 H;  4K0K L;  5M5W H;  1PYB A;  2NVQ H;  3NEN A;  5JEA G;  3GO5 A;  1C7Y A;  5IWA Q;  1X9N A;  1PH2 A;  1IBL Q;  1BVS A;  3S2D H;  3J80 c;  1K8A C;  2JA6 G;  1L1O A;  1EFW A;  4DV3 Q;  1PH7 A;  2BH8 A;  4ME3 A;  4QY7 A;  3LGJ A;  2JA8 G;  3HOU G;  1Q8K A;  1VQK A;  3CCR A;  2ZTC A;  4OO1 I;  2ES2 A;  2JA9 A;  3RNU A;  1HNX Q;  4MZ9 A;  4DR3 L;  4BBS G;  2UXC L;  1E1O A;  2AKW B;  2VZA A;  1VQ6 A;  3TRZ A;  3GD7 A;  4P74 A;  5GAD C;  2IT1 A;  3RZO H;  3T1H Q;  4LF9 Q;  1P8L A;  2MFI A;  1I6H H;  4DUZ L;  4A3M H;  1BBU A;  3AFP A;  1L0W A;  3G4S A;  1N34 L;  1RL2 A;  1HNZ Q;  3U4Z A;  1KXL A;  1OXU A;  3M3Y H;  3HFZ B;  4IPH A;  2JQO A;  3A74 A;  4JI8 L;  4K0K Q;  1MIU A;  2B29 A;  1KRT A;  4OWX B;  5M3F G;  1VQP A;  4BA1 I;  3H15 A;  4Y7N H;  2Z6K C;  2R7F A;  1WFQ A;  5H1S E;  4AQY L;  3RZD H;  4BBR G;  4OO1 G;  3JAM c;  3VDY A;  1EOV A;  4UP8 A;  2ZJQ A;  4IPD A;  2CWA A;  2NZO A;  3PGZ A;  3H3V I;  5HGQ A;  2LXK A;  2WB1 E;  1VQB A;  5C4X H;  3J81 i;  3S1R H;  1N33 L;  3PV0 A;  3I4N H;  1IL2 A;  3CCU A;  4DV2 L;  2R7Z H;  3G71 A;  4PMW A;  2A8V A;  4R4O A;  3PO2 G;  3NBH B;  2JA5 H;  2UXC Q;  1G51 A;  4OON A;  4XTC S;  5HY6 A;  1UEB A;  4DR3 Q;  2R93 G;  2ZTE A;  4X65 L;  5IP9 G;  1MJE A;  3L7Z C;  2F4V L;  4B3M L;  1XPR A;  4A3L H;  4JOI C;  1Q86 C;  4DUZ Q;  1N34 Q;  5IYB H;  4GLX A;  4A3J H;  5FJ8 G;  4HID A;  4LFC L;  2IHF A;  5C0X J;  4KHP L;  4JI8 Q;  3IRB A;  4C3H H;  2ID0 A;  4X6A H;  1S40 A;  2V1C C;  4AQY Q;  1VQM A;  1C9O A;  1PA6 A;  1J6Q A;  4DKA C;  2F52 A;  3OYY A;  1VQE A;  4DV0 L;  4JI4 L;  3GTQ H;  4A93 G;  1EQQ A;  3S1N H;  2QGQ A;  4YHH L;  1YJW A;  3K81 C;  4JCV E;  4HJ9 A;  1N36 L;  1G29 1;  1N33 Q;  4A3G G;  4WJ3 M;  4DV2 Q;  3M7N A;  1WCM H;  2PNH A;  3K80 C;  3MXN B;  3D0F A;  1AE2 A;  2K14 A;  2WP8 J;  5LMN W;  2LSS A;  3DM3 A;  1E7Z A;  5GAH C;  4LUV A;  2UUA L;  1A8V A;  4X65 Q;  5C3E H;  4R4T A;  1W3S A;  2E5L L;  4B3M Q;  5JEA J;  4QGU A;  1AH9 A;  4AH6 A;  1TWG H;  4DAM A;  3GTM H;  1TWF H;  1A62 A;  3HKZ G;  3K0X A;  4KI0 A;  3UDX A;  3KJP A;  4IFD J;  1CSP A;  2EIF A;  3J80 i;  3STB C;  3U58 A;  4IOC A;  1HJP A;  5BR8 L;  1XJV A;  4LFC Q;  5JJI A;  4AIM A;  2D62 A;  4QL5 A;  4OXP A;  1PHJ A;  4BA2 I;  2EXD A;  1IXR A;  4IJH A;  4LF7 L;  2F3I A;  4QQB X;  1G6P A;  3ERS X;  2N49 A;  3PUV A;  1VS0 A;  1QUQ A;  1SE8 A;  2DGY A;  2E8G A;  2JK8 A;  3FKI G;  4P75 A;  4NXN L;  4YY3 L;  3K8A A;  4DV0 Q;  1YHA A;  4GOP C;  4A3M G;  4JI4 Q;  3FP9 A;  3CCE A;  1VQJ A;  4YHH Q;  3T1Y Q;  1Y1W H;  1N36 Q;  3CXC A;  3PUZ A;  5IP7 H;  1LYL A;  3F1Z A;  4UP7 A;  4GKK L;  4PZ8 A;  1Y1V H;  5GRO A;  3E9I A;  1K0R A;  3PUX A;  1FJG L;  4RMF A;  4R4C A;  1E24 A;  1PFS A;  2NVY H;  2UUA Q;  5GQO A;  5JJK A;  2ZJR A;  4DR2 L;  2E5L Q;  1TXY A;  3AQQ A;  4DK3 C;  5J3B A;  1JB7 A;  1IYJ B;  3D31 A;  2K4K A;  3RR5 A;  1PV4 A;  2B3G A;  3RN2 A;  2OQ0 A;  4YCV A;  3F2B A;  2IY5 B;  3JAM i;  5BR8 Q;  1VQN A;  4L5T A;  2OCE A;  2LXJ A;  2VQF L;  3PF4 A;  4GOP B;  4IJL A;  4JYA L;  2UUC L;  4AYB G;  4LF7 Q;  1N9W A;  4H02 A;  1WYD A;  4GLA C;  4GNX C;  4NXN Q;  4YY3 Q;  1AE3 A;  4LW1 A;  2YYZ A;  3CF5 A;  1J5E L;  4PZ7 A;  1Z47 A;  4R4I A;  4IOA A;  3HKZ E;  3M4P A;  3GTK H;  5IYC H;  2IHE A;  3CCV A;  1NTG A;  4DK6 C;  4BY7 G;  1NY4 A;  4JI5 L;  1X55 A;  1OXS C;  3KDF B;  4GKK Q;  5FLM H;  1Q82 C;  1UE1 A;  3KF6 A;  2PQA A;  1YHQ A;  3HOY G;  1FJG Q;  2QA4 A;  4A3E H;  2N3S A;  1LM0 A;  1UE7 A;  1E1T A;  2AWO A;  2I0Q A;  1EYG A;  1VQ8 A;  1H95 A;  3SGI A;  5IT9 c;  4DR1 L;  2E2J H;  4B3R L;  3E0E A;  4DV1 L;  1VQA A;  2JEB I;  4OWW B;  3TEH B;  1S3O A;  2UU9 L;  2RCN A;  3AFQ A;  1I3Q H;  4JV5 L;  4GN5 A;  4GNX B;  3HOZ G;  2VQF Q;  4JYA Q;  3PIP A;  2UUC Q;  1V1Q A;  3WWV A;  1HR0 L;  3CC7 A;  4HJ7 A;  3UE0 A;  4IPC A;  3UDG A;  1J5E Q;  1YNX A;  3BU2 A;  4JBJ A;  4MNO A;  3U4V A;  3I4M G;  1PH5 A;  5C44 G;  2YTX A;  1PVO A;  2VNU D;  2R92 H;  4A3F G;  5M3M G;  1FL0 A;  1PH6 A;  4BXX G;  3TS2 A;  4JI5 Q;  3CCS A;  3ZJY C;  2KCT A;  1A63 A;  3HOX H;  2NZH A;  1SRU A;  1VQC A;  2KCM A;  4AYB E;  1C0A A;  1KHI A;  2AWN A;  4A3I H;  4GKJ Q;  1CKN B;  1KD1 C;  4DR1 Q;  1GKH A;  5ELN A;  4B3R Q;  3H0G G;  3GTG H;  4P71 A;  4JI0 L;  3I2Z A;  1QVC A;  4DR6 L;  2KEN A;  1YZ6 A;  4HIO A;  1YIJ A;  2UU9 Q;  1FGU A;  3HOW G;  3CCJ A;  1O7I A;  3G48 A;  4A3D G;  1KQS A;  4JV5 Q;  1NE3 A;  4BY1 H;  1X56 A;  5GAE C;  1B7Y B;  1HZC A;  2IX1 A;  1HR0 Q;  4JC0 A;  1IBM L;  1A0I A;  5IYD G;  3ICE A;  3B6Y A;  1VQH A;  2B63 G;  5IY0 A;  2JA7 H;  4LF8 L;  4HIM A;  1WI5 A;  2OQK A;  1X54 A;  3KYH C;  1L1O C;  1BBW A;  5EAY A;  4C3J H;  2WFW A;  2ATW A;  1UWV A;  2PI2 E;  3GTO H;  4DUY L;  3S14 H;  2RF4 A;  4LFB L;  3NEL A;  4L5Q A;  2XTI A;  5IE8 A;  5AJ3 L;  3S15 H;  3Q8D A;  2RHS B;  3M85 A;  5DLQ E;  4A3B H;  3W1G A;  3I55 A;  1VQD A;  3J7A 5;  3PO3 G;  4JI0 Q;  3U50 C;  3BJU A;  1X3F A;  4DNI A;  2VL6 A;  2E2H H;  3GDE A;  1L2F A;  1PH1 A;  4B3S L;  5FLM G;  2CWP A;  4A93 H;  4IPG A;  1OTC A;  1K3R A;  2F4V Q;  2C35 B;  4DR7 L;  1X65 A;  4PG3 A;  1PH9 A;  2N8N A;  1QZH A;  1IBM Q;  2JA6 H;  3KOJ A;  1L1O B;  2KHJ A;  5FLX c;  1Q1B A;  4OX9 L;  1I5F A;  4LF8 Q;  4KHP Q;  3GTP H;  2K50 A;  2UXB L;  1XMQ L;  4JI1 L;  2R7D A;  3F8T A;  1SFO H;  2JA8 H;  3HOU H;  3M4O H;  4HJA A;  2ZTD A;  2K5N A;  1V43 A;  1UE5 A;  4DUY Q;  2JE6 I;  4LFB Q;  1P16 A;  5AJ3 Q;  4BBS H;  4LUO A;  3FHW A;  2R6G A;  4P72 A;  4JI3 L;  3W5O A;  1X3G A;  2BA1 A;  4DV5 L;  4DR5 L;  2HHH L;  1GO3 E;  3KFU A;  5M5Y H;  1N32 L;  1CKO A;  4JI7 L;  1K83 H;  3I56 A;  2D0P A;  3EBE A;  3GTJ H;  3OW2 A;  1VQ5 A;  2PI2 A;  1SLJ A;  3M9B A;  1XPO A;  1PYS B;  4UY8 C;  1E22 A;  1YJ9 A;  4DR7 Q;  1N8R C;  1KRS A;  1UE6 A;  5C0X I;  4A3I G;  4J15 A;  5C4X G;  4A3C H;  1XMO L;  4LF6 L;  2E2I H;  3I4N G;  4GN4 B;  4BBR H;  4X64 L;  3AEV A;  1HNW L;  2R7Z G;  2NN6 I;  1E3P A;  2HIV A;  3KF8 B;  1K73 C;  1W2B A;  5K36 G;  1YBY A;  3S2H H;  4POF A;  1EIY B;  2JA5 G;  2UXB Q;  1XMQ Q;  2Y0S G;  2ASB A;  1NMG A;  1OXV A;  1HZA A;  2JEA I;  1I50 H;  2AHO B;  4LNQ A;  1KAW A;  3PO2 H;  4LUZ A;  1HZB A;  2D0O A;  1ASY A;  4A3L G;  1TWH H;  1OXX K;  2YTV A;  3CD6 A;  2R93 H;  4HJ8 A;  4JI3 Q;  2VUM H;  2GN5 A;  5IYB G;  5IP9 H;  4DV5 Q;  1U0L A;  2Q2I A;  2Z6K A;  4A3J G;  4A4I A;  4DPG A;  1MJC A;  2PMZ E;  3I7F A;  4GLV B;  1PH4 A;  4JI7 Q;  3ULP A;  2HT1 A;  1N32 Q;  2NVX H;  4DR4 L;  4UPA A;  3EN2 A;  2UXD L;  3KLW A;  5FJ8 H;  3S1Q H;  4A3K H;  2UUB L;  3H3V H;  4IFD I;  1X6O A;  1T9H A;  4DR2 Q;  2K75 A;  1FVI A;  4X66 L;  1JMC A;  2NVT H;  1CUK A;  1XMO Q;  4LF6 Q;  3TS0 A;  3T1H L;  4X64 Q;  4L5R C;  4GKJ L;  1CKM A;  1JJC B;  1WCM G;  2YTY A;  3CC2 A;  4JI6 L;  2IX0 A;  1Q1E A;  3PSI A;  1EQR A;  3A5Z B;  4POG A;  2JJQ A;  4JOI A;  5LMN L;  1HNZ L;  4A3G H;  2HHH Q;  5ELO A;  4HJ5 A;  3TQY A;  5C3E G;  2MNA A;  4KHZ A;  1JJG A;  1XTD A;  3CW2 C;  4PZ6 A;  1HZ9 A;  2HIX A;  4TVA B;  4EQ5 A;  1LUZ A;  4IFD G;  3HOV H;  3RLO A;  4A75 A;  2DUD A;  4LFA L;  4JG2 A;  3RLN A;  3STB D;  4C2M H;  4EX5 A;  3CPF A;  4YCU A;  2Q2H A;  4DR4 Q;  1JJ2 A;  3S16 H;  2Y0S E;  1KC8 C;  2UXD Q;  2WAQ G;  1Q12 A;  3L2P A;  4UP9 A;  3UDF A;  1R9T H;  1VQ7 A;  2UUB Q;  2Z0S A;  4ALP A;  1YJN A;  1XNQ L;  4X66 Q;  3J7Z C;  3PUW A;  1Y1W G;  4DV1 Q;  1VQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...