4BY1G

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by1G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by1G01
5K36G 2JEAI 2JA9A 1IBMQ 1HNWQ 4LF7L 3UDFA 1TXYA 3CXCA 4BBSH 2CFMA 3GTLH 2NN6G 4P73A 3J7ZC 3F2BA 5IY0A 1HNZQ 2R7ZG 3M7NA 3NEMA 1U0LA 4JI6L 2KHIA 5C4XG 4IPDA 1WYDA 4JI2Q 1U5KA 2D62A 4X64L 4XIGS 1NJIC 5M3FG 2RCNA 2WFWA 1YHBA 5IT9c 2I0QA 4YCUA 4GNXC 3PUWA 4IFDJ 1FJGL 2E5LL 4JYAQ 4DR7L 3CMEA 5JEAJ 1CKMA 3HKZE 2B63G 4YWLA 1T9HA 5GAGC 1OXSC 3GTGH 3S16H 1XMOL 4QIWE 4UP8A 2JA8H 4DNIA 3KDFA 1JJCB 3LGJA 3KJOA 1N34Q 2F4VL 4GOPB 1TWFH 4O0AA 1QVGA 2JA5G 3F2CA 3ICEA 3ULLA 4HIOA 1B8AA 4A3LG 2R92G 4YWMA 1PH2A 3AFQA 4IPHA 1NE3A 4P72A 2NZOA 3HOVH 2JJQA 1L1OC 2B29A 3I55A 1IBKL 1A62A 2GVAA 2KBNA 3RN5A 4JOIC 4JBWA 5IYBH 1WJJA 2UUAL 1KD1C 1QUQB 5LMNL 1I94L 4X62L 3KF6A 2VS1A 2KHJA 4YHHL 2NVQH 4X65L 4A75A 2JQOA 2VL6A 4KHZA 4A4IA 2Y0SE 4DV4Q 4OWWB 3KLWA 3CCQA 4NXNL 1R9TH 2UXDL 3S1RH 4OWTB 3S2DH 2L15A 3UDXA 3F1ZA 3K0XA 2HIXA 4PZ8A 1Z47A 3IRBA 4DV1L 1PH8A 1GM5A 4BA2I 4GKJQ 1E3PA 5IYCG 3AYHB 2JK8A 4QGUA 3H3VI 2XTIA 3PUYA 2JA7H 4KHPQ 1X9NA 1UE6A 2D0PA 1X3GA 4B3SL 4K0KL 4JI7L 1RIPA 4DR2L 4LFCQ 5M3MH 2UUCL 1QVCA 2BH2A 3PIPA 1VQJA 3E0EA 4GOPA 2I5HA 2ASBA 3K7AH 2YTVA 2NZHA 5HY6A 2VY3A 4AH6A 1W3SA 3EN2A 1P16A 5M5WH 2KENA 4DV0L 1VQKA 4LF6Q 3M3YH 1PH4A 3W1BA 1VQCA 2MNAA 4HIDA 1V1QA 1PFSA 5AJ3L 4BY1H 3K8AA 4BA1I 1H95A 1X55A 4HIKA 1KHIA 2PI2E 3PO3H 4IFDI 4DV7Q 1QUQA 1YHQA 3PF4A 3ER0A 1VQHA 4GLAC 4AIMA 3OYYA 4GN5A 1TWHH 1IYJB 5IP9H 3H0GH 1VQNA 4J15A 1YJ9A 4DPGA 4DR1Q 1VQ7A 1WFQA 1VQMA 1E22A 2R6GA 2JA7G 4X6AH 3DLLA 1N9WA 1BKBA 4DV2Q 3U4ZA 1XMQL 2UU9L 3H15A 3CCUA 1VQGA 4A3BH 2HHHQ 4A3CH 4B3TQ 3OTOQ 3JAMi 2OQ0A 4LFAL 4LFBQ 5M3MG 3TRZA 1I3QH 2A1AA 1L0WA 3D31A 3F2DA 1JMCA 1SFOH 5BR8Q 1EQRA 3FHWA 2K14A 4AYBE 1XNQL 2VUMG 3HOWH 3HOYH 2UXCQ 1VQBA 1L2FA 4DUZQ 3KYHC 3W1GA 4DV5Q 4HJ7A 1HNWL 1W2BA 2ES2A 4C3IH 3D0FA 1KRTA 3GTMH 1G6PA 1Q12A 1YEZA 3CF5A 5M5XH 4BY1G 1EIYB 4IJLA 1VQLA 4DV6L 2BA1A 3PO3G 3JAMc 3K81C 2HIVA 2C35B 3HFZB 4A3MH 3FKIH 2VQEL 2ZJRA 5C44H 3H0GG 2VQFQ 1MJEA 2IY5B 3ERSX 1JE5A 1V43A 1VQEA 3UDIA 3VDYA 1IXRA 1PHJA 1K9MC 3RZOH 3T1HQ 4JV5Q 3M4PA 3RZDH 1CSPA 1X3EA 4NPSA 1OXVA 4MZ9A 1EFWA 4A3CG 4B3RL 3J81c 1Y1VH 4A3BG 1G291 1YJWA 4JBKA 1N36Q 5GADC 4L5SA 2Q2IA 4DR5L 3BJUA 4GN3B 2ZM6L 1A63A 2NN6I 4NB3A 4LF5Q 2N3SA 4A93G 1OXTA 1I50H 3SGIA 4JI5Q 4R1JA 4JI3L 5EAYA 2PQAB 2ZTDA 5E7NA 3HOYG 3HOZH 3G48A 4DR4L 1PA6A 2YTXA 3I4NH 3TEHB 4P75A 2HQLA 1NMGA 2Q2HA 1GO3E 4B3ML 1C7YA 2R7FA 3JC66 2ZTEA 4AQYQ 1FL0A 3AFPA 4JC0A 4OXPA 3L7ZC 3CCEA 1G51A 1NMFA 1Z9FA 2VW9A 1UEBA 3TQYA 1J5EQ 3GTKH 4Y52H 3U58A 1VQDA 4X66Q 4LUZA 2UUBL 4NXML 1JT8A 3PUVA 3M4QA 5FLMH 4UY8C 1HNXQ 3FKIG 2NVTH 4A3GG 1E1TA 4GKKL 1HR0Q 3GTJH 1Q1EA 1MKHA 4JCVE 4DR6Q 5IYDH 1OXUA 2R93G 5LMUQ 4DR3L 3CCJA 3RNUA 4JI1Q 5C0XG 5GAEC 4LF8Q 1N33Q 1KRSA 3CCLA 1YZ6A 2XGTA 4LF9Q 1ASZA 4L5RC 1VS0A 1HJPA 2V1CC 3ULJA 1Q82C 3S1MH 1YNXA 4JBMA 2AKWB 3GTOH 3BU2A 1XPOA 4OX9L 3HOUH 3HOZG 2OTJA 1AH9A 4BBSG 3UE1A 4PZ7A 1E24A 3NELA 2GN5A 3HKZG 4YCVA 4GNXB 4DUYL 1K8AC 4POGA 3I4NG 3A5UA 3K80C 3GTPH 2NVYH 3G6EA 4HJAA 4GLVB 1QZHA 3NBHB 2ZTCA 5ELOA 2AWOA 2PQAA 2GVBA 1N32Q 1EIFA 4DV3L 2D0OA 2DGYA 3I56A 4A3EH 2IX0A 3A74A 1MJCA 5JJLA 1MIUA 4PMWA 3CCVA 1M1KC 4LF7Q 1AE3A 2JA8G 1FVIA 3MEFA 4A3KH 4JI6Q 2JA6H 5IWAL 1JB7A 1L1OB 3I4MH 4X64Q 3GO5A 2WAQG 2WB1E 4EX5A 1SMXA 1K0RA 2Z6KA 1S72A 4LWCA 2E8GA 1YJNA 1XNRL 3ZJYC 1VQ4A 2E5LQ 3HOVG 4DR7Q 3UE0A 4JI8L 3E9HA 1YITA 1CKNB 2CQOA 1ASYA 4B3TL 4C3JH 5IYBG 3AQQA 2K75A 1FGUA 2Z0SA 5FJ8H 4R4IA 1X65A 2I5MX 1PH5A 1K83H 3G71A 1GD7A 2K5NA 4R4QA 2R7DA 5IP7H 5DLQE 3STBC 2A19A 1X6OA 1BVSA 4DK3C 5IE8A 4YY3L 5HGQA 4LF4L 3PSIA 4JI4L 4GN4B 1PH3A 4GNXA 5GQOA 3PV0A 1VQPA 3CCRA 1IZ6A 5C0XJ 5ELNA 2UXBL 3ULPA 4BXXH 2MO1A 2UUAQ 4IOAA 1NTGA 1LM0A 3PF5A 3J81j 5LMNQ 1VQ6A 1Y1WH 3TREA 4X62Q 2PMZE 1Q81C 4Y7NH 4YHHQ 2OQKA 5FLXc 1KIXA 2VQFL 1AE2A 2H5XA 4X65Q 3S1QH 3KFUA 4ALPA 1IBLL 1LTLA 4DKAC 4NXNQ 1NBWA 1SN8A 2MQHA 3U4VA 3J7A5 1UWVA 1SRUA 2UXDQ 3AEVA 1L1OA 4H02A 1XJVA 4C3HH 4TVAB 5C3EH 4JOIA 2IHFA 5C4JH 4LF5L 1QVFA 3RR5A 1VQOA 2WP8J 3S1NH 2K52A 3DM3A 5IP7G 2YU9H 4WJ4A 1IBML 1I6HH 4KI0A 4IO9A 4GS3A 1GKHA 3J81i 1HNZL 5JEAG 1HZAA 2N78A 1CKNA 1LYLA 2CKZB 4LW1A 4B3SQ 4K0KQ 4DR2Q 4XTCS 2IHEA 4JI2L 1HZBA 3EIVA 2UUCQ 1C9OA 3L0OA 3CMAA 4HJ9A 4MTNA 4WJ3M 2ATWA 5IP9G 4BXXG 4UPAA 1J5EL 4BBRH 2YYZA 1NY4A 4JG2A 4AYBG 1BBUA 4JYAL 4JBJA 1Y1WG 4DV0Q 4YCWA 1LUZA 1E1OA 3CCSA 2K50A 4DR6L 2I5LX 1K3RA 2QA4A 3PO2H 5AJ3Q 2IT1A 5LMUL 2LSSA 1J6QA 1N34L 4RG1A 1DGSA 3RLNA 5J3BA 3M85A 1VQ8A 1PH9A 2YTYA 4HJ5A 4R4CA 3MXNB 1OXXK 1YVCA 4QY7A 4PG3A 1XPRA 3HOWG 1KXLA 1OTCA 3BZCA 1VQIA 1VQFA 2AWNA 2B63H 2BH8A 3M9BA 2K5HA 2UU9Q 1VQ5A 3T1YQ 3CP0A 1KC8C 2F3IA 4LFAQ 4FDBA 1K8GA 4HJ8A 3B6YA 4A3MG 3TS2A 1HH2P 2KCTA 5GROA 1B7YB 1D8LA 3OW2A 5C0XI 2JA5H 5M5YH 5C44G 1X56A 3W5OA 4BBRG 4DV4L 3TS0A 2R92H 4A3LH 2A8VA 4IPCA 3S17H 2MFIA 5JJKA 2CWAA 4GOPC 2ID0A 3G4SA 1E7ZA 4IJHA 3PO2G 1A8VA 1Y1VG 4C2MH 3I7FA 3CC2A 4GKJL 1PV4A 4L5QA 2OTLA 3M4OH 1TWCH 4DV6Q 3CCMA 4KHPL 4A3DH 2K4KA 2VZAA 2BA0A 3U50C 1P8LA 2AMCB 4TQUS 2VQEQ 4RMFA 2IX1A 4UP9A 1PH6A 1Q8KA 4LFCL 2MO0A 4IPGA 3Q8DA 4JI0Q 2EIFA 1IL2A 4B3RQ 1V9PA 4OONA 2K5VA 2E2JH 4HIMA 5IYCH 4DR5Q 2ALYB 4LF6L 4APVA 2RHQB 1HR0W 2ZM6Q 3S14H 1UE7A 5FLMG 1KQSA 4R4OA 3KJPA 4JI3Q 4DAYB 1PH7A 3CAMA 3RN2A 1YBYA 2EXDA 4UP7A 5IYDG 3H3VH 1CSQA 4DR4Q 3S15H 4DV7L 4B3MQ 4LUOA 4QQBX 4A3IH 1Q7YC 2RF4A 1X3FA 1TWAH 1PVOA 4A3FH 1O7IA 1WOCA 4DR1L 2DUDA 1EOVA 2WAQE 1CKOA 4LUVA 2UUBQ 4A3DG 2PNHA 1FJGQ 4NXMQ 2Y0SG 3GTQH 1HZ9A 1S3OA 1SE8A 4DV2L 1M90C 3HOUG 2HHHL 5H1SE 1JJ2A 4GKKQ 1EWIA 3OTOL 1XMOQ 4LFBL 3CQZH 2QEXA 4DR3Q 1HZCA 3WWVA 1WCMH 5BR8L 2ZJQA 2F4VQ 4POFA 1WI5A 4R4TA 2UXCL 2CCZA 4DUZL 3J80i 1A0IA 1XTDA 2EQSA 4DV5L 2WB1G 3K7UC 1PYSB 3CPWA 2LXJA 3BZKA 4A3EG 1CUKA 1VCIA 2RHSB 3PGZA 4BY7H 4OX9Q 2HT1A 1KL9A 1RL2A 1IBKQ 4DUYQ 3L2PA 4EQ5A 4A3KG 1N8RC 3S2HH 2PI2A 1Q46A 3RLFA 1I94Q 2JA6G 2YV5A 4OWXB 3F8TA 4A3IG 4A3JH 3UDGA 3I4MG 5JJIA 1XPUA 4A3FG 2VUMH 1SR3A 1BBWA 1KAWA 4DAMA 2KCMA 4JV5L 3J80c 3T1HL 4DV3Q 3CC4A 1YIJA 2FXQA 1S40A 2JE6I 3NENA 2E2IH 4LNQA 1N36L 5FJ8G 4DV1Q 3CW2C 4A76A 1WCMG 1SLJA 3KOJA 4JI5L 2AHOB 1TWGH 5IWAQ 1X54A 3CPFA 1EUJA 4IFDG 1JJGA 1D7QA 4QL5A 1GVPA 1Y14B 1XNRQ 4JI7Q 3PIOA 4AQYL 3HKSA 1UE5A 4BY7G 4JI8Q 5LMNW 4L5TA 3T1YL 1B70B 1SROA 2Q2UA 4KLKA 4QJFA 3GD7A 4X66L 3HOXH 1YHAA 4PZ6A 4A3JG 4A93H 1HNXL 2OCEA 4O2DA 4DK6C 1HR0L 3EBEA 3PCOB 4YY3Q 2NVXH 3STBD 4LF4Q 2R7ZH 2VNUD 2JEBI 4JI1L 1PYBA 3PUXA 2CWPA 1Q1BA 4IOCA 5C4XH 1YI2A 4JI4Q 4LF8L 1N33L 1K73C 3I4OA 4LF9L 1UE1A 4P74A 2F52A 4OO1I 2OWOA 2UXBQ 3E9IA 5M3FH 3KDFB 5C3EG 1PH1A 1I5FA 2Q2TA 3A0JA 2LXKA 1VQAA 4ME3A 4OO1G 3KF8B 3PUZA 4A3GH 2E2HH 4YWKA 1Q86C 3CD6A 1QZGA 3RLOA 3S24A 1XMQQ 2ZJPA 2R93H 1VQ9A 1IBLQ 4MNOA 3FP9A 4JI0L 1EQQA 2QGQA 5GAHC 3A5ZB 1EYGA 2Z6KC 3GDEA 1C0AA 3I2ZA 3CC7A 1XNQQ 1N32L 2N8NA 3KF6B 4P71A 3HOXG 2N49A 2B3GA 4GLXA
chains in the Genus database with same CATH superfamily
4NXNH 2QK4A 4LFBH 1FGBD 1IYVA 2R84A 2R7ZG 1AUVA 1QNUA 4I55F 5A35A 2KEDA 1YNJC 2KHIA 4JI2Q 1Q3LA 1Y8OB 3NE5B 4X64L 1NJIC 2JEIA 5DM63 3EA6A 1C3OA 3I4MB 4IFDJ 1ZQ7A 4PQXA 3D3RA 3GTJA 1E4GT 5GAGC 3GTGH 3S16H 4DNIA 3T5JA 1N34Q 2F4VL 4HQ6A 3CQZB 1DD2A 3ICEA 4TRDA 1SE3A 1B8AA 1WCMB 1HQRD 4A3LG 1TWCA 4G4KA 2YZGA 4YWMA 4IPHA 1KJQA 2DY8A 3BYYB 4IUNA 1L1OC 4HR7B 2KBNA 2EXZA 4JOIC 3T5LA 4JBWA 1H9JA 2UUAL 5KT6A 4X62L 1WTHA 3N6RA 3PIO3 1D2BA 4XZ3B 4QUCA 2W71A 2VL6A 4KHZA 2AUKA 2JN4A 4WRDA 4C1NI 2QF7A 2Y0SE 4Y7NB 1GUOA 4JK1C 2XN9C 3UDXA 4A2AA 2ASDA 3K5NA 4PZ8A 2HIXA 1S03G 4DV1L 4BA2I 4LH7A 5IYCG 3R23A 5JAVA 2JK8A 1TWAA 4C3HB 2Z8LA 3V6KA 1BCPF 4HN7A 2N88A 4I7AA 1TWGB 4B3SL 4K0KL 1SYXB 3I70A 4DR2L 2R7NA 3LWUA 3SXHA 4UCTA 3E0EA 4R8UB 3T5HA 2F0LA 2KSWA 4UHVA 4B08A 2WACA 2VQEH 2NZHA 1K83A 5KG4A 4AH6A 3EN2A 5M5WH 3BVGA 4LF6Q 3NQTA 3MC0B 1VQCA 4KD3A 1CQFA 4JI0H 1PFSA 2K5QA 1DCZA 3K8AA 4B3RH 1H95A 2R8JA 4HIKA 2PI2E 3CHBD 2R7ZB 1H9SB 4GLAC 3V05A 4AIMA 1B2TA 3FRPB 5IP9H 1IYJB 3H0GH 1OWTA 5FD5A 4JI3H 2M9VA 2F3VA 1VQ7A 5I9PA 4DR1Q 2C9OA 1VQMA 1F2YA 1N9WA 3EYYA 2SNSA 2RDFA 4DV2Q 3RAXA 2UU9L 3H15A 3CCUA 3FMAA 4A3BH 4RGMA 4QW8A 4LFBQ 2OQ0A 3C1FA 1TY0A 2A1AA 3N41B 1L0WA 3D31A 2R93B 4AYBE 1KJIA 2VUMG 3OHBA 2W8KA 1VQBA 3KLSX 2NTTA 3KYHC 2RCFA 3W1GA 4HJ7A 1LTRD 1HNWL 3OUUA 4IAJA 4LK1C 1E4EB 2K5WA 1KRTA 3GTMH 1Y8NB 1Q12A 1G6PA 2F4VH 2W70A 4IJLA 4MIUA 2KCNA 4FXGC 1VQLA 2PNRC 5DGAA 4RAZA 1IOWA 2ZJRA 2O4XA 3H0GG 3NWSA 4JV5Q 3HRZC 5FO7B 1PHJA 2L1BA 3RZOH 3DM1A 3WOFA 4Q8EA 1X32A 3RZDH 1X3EA 3SHLA 4RNOA 2NVXA 1EFWA 1QNKA 2GA4B 4A3BG 1M6VA 2OXPA 4K5XA 1N36Q 2AGQA 3BJUA 3NBIA 3TSSA 4NB3A 1KDCA 1A3TA 1STBA 4JI5Q 5E7NA 1ZXTA 4CC5A 5IGCA 1JR0D 3G6JB 4RAUC 3JC66 4MV1A 4DV1H 3T5KA 3CCEA 1NMFA 3W2DA 3TQYA 1GLVA 1VDZA 4HAEA 3U58A 4X66Q 4LH6A 4NXML 5FLMH 3N40P 3BDCA 2NVTH 1MZBA 2ZDGA 4YIJA 4JCVE 4DR6Q 2VPQA 4DR3L 4JI1Q 5LHY1 5C0XG 3GTLA 5EOYA 1YZ6A 1Z2OX 1F2LA 4KJNA 1HJPA 5FLXW 4G3IA 3TIGA 3MFHA 1WTOA 2IW3A 2CVRA 3BDOA 3KBGA 2SCUB 3R5HA 3BU2A 1XPOA 4OX9L 1AH9A 2OTJA 2F3WA 4YCVA 1K8AC 1XWEA 4DUYL 4EQPA 3K80C 1SBBB 3GTPH 4XYMB 4RB3C 3A7AB 2W9CA 1K8MA 1Z2NX 4RUCA 2UU9H 2X6GA 3A54A 2VUMB 2IX0A 1EWHA 1NSNS 2LFNA 5M5WB 1ILQA 3MTSA 1M1KC 5JOBA 2JA8G 4J9OA 2R86A 4QCLA 2EY5A 2JA6H 1CS0A 2YW2A 4EG0A 5EDWA 4X64Q 2WB1E 1IBMH 1HNWH 1HPCA 4JPBW 1S9FA 1EIGA 5EKLA 3NTKA 1XNRL 4L1KA 1HNZH 3GTQA 3H0GB 1DZ1A 5EWEA 1JIHA 3UE0A 2A6HC 3RJ0A 2R8IA 5M9OA 1M4VA 3GQBA 1ASYA 1R9TA 4B3TL 4C3JH 5KX5F 3GQCA 5FOBB 4Q0FA 4O2AF 1PH5A 4K5VA 1CE8A 4A3BB 2R7DA 5IP7H 3STBC 2MCTA 1GUNA 1TU2B 2A19A 1BVSA 1X6OA 5G3LD 5IE8A 2ZDHA 5HGQA 3URYA 4QWBA 5JEAH 4J9NA 1PH3A 2PZUA 4GNXA 4WORA 5GQOA 1JKJB 5C0XJ 2UXBL 2BE5D 3DWPA 1S5CD 2UUAQ 4IOAA 5KYIA 3RMHA 3GTMB 5KRUA 1Y1WH 3K5MA 4KV6A 4X62Q 2OQKA 5FLXc 5J22A 1AE2A 3S1QH 3KFUA 1KC7A 2R61A 1B04A 5A2QE 1LTLA 2EY6A 1NBWA 1SRUA 4DU9A 1TAEA 3RZDB 3VPCA 4NXMH 1JICA 1LT4D 5C4JH 1RYSA 1QVFA 4Y52H 2WP8J 5IP7G 4LJZC 4KI0A 4I50F 4J9PA 3J81i 2A73B 5JEAG 2NYZD 2CKZB 4B3SQ 3LMLA 4K0KQ 4DL3A 5BN4A 2FMMA 4DR2Q 3GLKA 2IHEA 1WVLA 3EIVA 3A7LA 3RIZA 3CMAA 3VA7A 4KHPH 4WJ3M 2XRSD 5DLFA 4BBRH 2YYZA 4JG2A 4OX9H 1BBUA 1Y1WG 5K36H 5KG3A 2A6EC 2K03A 2NN6H 2FPGB 2LSSA 2NVTB 4YR3A 1DGSA 2VQDA 3LX0A 1BCPB 2YTYA 4HJ5A 2JA8B 3MXNB 3H09A 4QY7A 1F9SA 2KECA 1IKLA 1SEBD 3HOWG 4EVOA 5ELEA 1TWFB 3DWAA 1RF2D 2V9WA 4H7BA 3FKIA 4RWSC 3GIJA 3BZCA 4DV7H 4EYHB 4OGQC 3DMUA 2HCCA 1LABA 2UU9Q 3CP0A 2NU9B 4K14A 2SNMA 1Y1VA 2ENBA 2R7KA 5GROA 4EGVA 3HB9A 2B2UC 1JJGA 1IW7D 3W5OA 4BBRG 4DV4L 1CA5A 1HXYD 2R92H 2A8VA 1CHQD 5ISRA 3S17H 1I50A 2O03A 3BG5A 5JJKA 2W57A 3R5XA 4B3TH 4GOPC 4ZAIA 2H4OA 3HKZA 1E7ZA 3RB4A 5CV6A 4GKJL 4ZRZA 5LL6S 4QIWA 4C5BA 3M4OH 3QO2A 1HA6A 1TWCH 3DF7A 4U7CA 4ODGA 4FF4A 2Z4IA 3J80W 2VZAA 4RKBA 1NCVA 2EYPA 4TQUS 1TS3A 2UXBH 5KFUA 4Q44A 1GUGA 1Q8KA 3QOLA 2MO0A 4O1NA 4LFCL 4IPGA 4M8AA 2EIFA 5KNBA 3GTGA 3QJYA 5L1LA 1W93A 1V9PA 4OONA 3C3LA 3A55A 2E2JH 4HIMA 5KFOA 1D5XC 3OSOA 4APVA 4C3JB 2W9BA 3KALA 1B44D 2NUAB 1YBYA 5IYDG 4FF2A 1CSQA 2VXWA 3GTOA 1V1PB 3AB9A 4EGJA 4QQBX 4A3IH 1X3QA 1RJRA 1TWAH 1PVOA 2F0JA 4A3FH 5KFXA 1GOZA 1WOCA 1EOVA 1AN8A 1CKOA 4ECUA 4RH6A 4NXMQ 1HZ9A 1S3OA 4J9RA 2RSOA 1LTBD 1Y1WB 5FKAC 4AQYH 2HHHL 1JJ2A 1AZQA 2I80A 3S1QB 4DR3Q 2QEXA 2V59A 1RJQA 1DOKA 2B2VA 1EU4A 3VR4A 1WI5A 4RHRA 4Q0YA 5KGUA 2UXCL 5LL6b 1HNXH 5L1JA 1A0IA 1I3QB 2EQSA 4DV5L 1HR0H 1PYSB 1SFOB 2XIGA 1WTVA 4IWYA 4CJ1B 3BZKA 5ELCA 2PO4A 3HOWB 4HSPA 4Z9CB 1VF7A 1C4QA 2RHSB 3PGZA 4NKLA 1N33H 4OX9Q 2HT1A 1IBKQ 5KFWA 4IUVA 4DUYQ 4A3KG 4EQ5A 4J9SA 4HYKA 3M9NB 3L3OC 2IA6A 4A3IG 4A3JH 1ZHQA 5JJIA 1KBLA 4A3FG 3VA5A 1SR3A 1BBWA 2XCLA 3J80c 3KAJA 4K8IA 4BBRB 1SAPA 2IMWP 1ICWA 1YIJA 3IKJA 2F0SA 3NP8A 2RDIA 4A76A 4DV4H 1STAA 3P1HA 3OW7A 3C1EA 4FS2A 5FLXL 3CPFA 1HTPA 3TINA 4LF7H 2FPIB 4QL5A 1GVPA 1PLFA 1XNRQ 4GKJH 3F2UA 3HKSA 1UNSA 3T1YL 1B70B 2J4XA 4WD3A 4ZQ3A 2Q2UA 2NU8B 4QJFA 2KEEA 4ULLA 2JSOA 4QWEA 1YHAA 1RJTA 1YNND 4A3JG 4A93H 1NR4A 4LMQD 4MA5A 2B8GA 2CW0D 1KTKA 2NVXH 1B33N 3HGBA 5KYLA 5DAUA 1PYBA 4IOCA 5C4XH 1BCPC 1QB5D 3MAQA 2R85A 3GTJB 4RNMA 3T4AC 3S17B 4P74A 4OO1I 4ED1A 2UXBQ 1J8IA 5C3EG 5COYA 1PH1A 2MHVA 4IZ8A 3U9SA 2LXKA 4HTHA 4A3GH 3R2TA 3M4OB 4CJ2C 1TWCB 1H9KA 1PRTD 4S3SA 4R7RA 4MTEA 3H94A 3S24A 3CRLC 1SDFA 2ZJPA 1VQ9A 5KNCA 1Z2PX 4RA8A 2WYOA 3MR6A 4I65A 2F0FA 5GAHC 2Z6KC 4G57A 3GDEA 3HEJA 1WD0A 1N32L 2NVYB 3RGXA 4X65H 2DPJA 1EYDA 2N49A 2HHHH 2WKCA 2E2JB 1T5XD 3CXCA 4HMIA 1ET9A 3GTLH 1SYBA 4BBSH 4P73A 2W6MA 5KFCA 3M7NA 1QWYA 5C4XG 1LTAD 3EJIA 2D62A 1G6ZA 4XIGS 4J1MA 3BABA 2RCNA 1I4PA 5IT9c 4A3IB 1EEFD 1FJGL 1CA6A 3FDTA 4A3FB 4DR7L 2JA5A 3V6HA 2RDGA 1AEXA 3MA2B 2ZT9C 2B63G 2UUCH 1TKWB 2EPBA 4UP8A 1VAJA 1JJCB 2A68D 3KJOA 1VBHA 4XYOA 2SDFA 4CJ0B 5E3FA 1QVGA 5J2TF 2RGRA 1MBYA 2I87A 3ULLA 1U4RA 1K83B 1II3A 3G6XA 1NE3A 2L9HA 2NZOA 5BPFA 3RN5A 2XIWA 5IYBH 2LY7A 5KNDA 2JEGA 2A69C 5LMNL 1I94L 1BF4A 1RJPA 2F4IA 3SE7A 2NVQH 4DGZA 4A3JB 1C8CA 4DV4Q 1R9TH 4NXNL 2K7VA 3T1YH 2DWCA 4OWTB 3MXPA 4WBNF 1F9RA 4PV1C 4O3NA 1ZYRD 2EYFA 1Z47A 4GKJQ 3A8JE 2JA6A 2F0HA 4KY6A 5C3EB 1Q8IA 4LFCQ 5M3MH 1EQTA 1M0TA 1QVCA 3SK4A 5CORA 3Q23A 4UCUA 4APMA 1ZETA 3T16A 1S4ZA 3KBXA 3K57A 1GYFA 2I5HA 3E0JA 3VPBA 3K7AH 2YTVA 1A2TA 1LACA 3KK7A 5HY6A 1CHPD 1P16A 3M3YH 5EPKA 4U6PA 1KABA 2SOBA 3NHHA 1STYA 2QKIC 1KLUD 5E1FA 5AJ3L 3IN5A 1AFPA 1GSAA 4IUQA 1X55A 1KHIA 2NVXB 3PO3H 4JV2A 1M0WA 2ZM6H 2I8CA 5C4XB 2HD3A 1EY8A 3R2IA 1YJ9A 1WFQA 5EPLA 1K0SA 2R6GA 4O4IF 3DLLA 1SE2A 3U4ZA 1XMQL 4A3CH 2HHHQ 3GIIA 2K05A 3JRWA 1XYIA 4ZOLF 5M3MG 3F2DA 2B2WC 1DV1A 1FJGH 4J0MA 1EQRA 3FHWA 2UXCQ 2FE3A 4DV5Q 2QW7A 2XRQD 1W6JA 3R8BA 4CGYB 2VR1A 2VOBA 5C3WA 3D0FA 5G3LF 1K28A 1YEZA 1V51A 4DV6L 2BA1A 4BBSB 3GTLB 3PO3G 3IFDA 3ETHA 1QILA 4HMJA 5EGTA 3SDZA 3FKIH 2AQ2B 2VQEL 5C44H 1MJEA 1VQEA 1O75A 2HDLA 1CSPA 3N43B 1PTOC 5I2XA 2F0NA 4MV8A 1I94H 2LS01 4A3CG 4B3RL 5J2UF 1Y1VH 1PFBA 2W6ZA 2V58A 4L5SA 2NBFA 3VPDA 4GC7A 3WNZA 3JAML 1A63A 2NN6I 4PWQA 4X3UA 4DV3H 3Q1KA 2W9CB 1I50H 2AUJD 3GIKA 4JI3L 5EAYA 3RTXA 4A2BA 4DR4L 1EYAA 2YTXA 3I4NH 1GO3E 4H13C 1C7YA 2ASLA 2R8GA 2E2HA 4R9WA 3AFPA 4ILWA 4JC0A 1Z9FA 2DN8A 2VW9A 1UEBA 4LUZA 1S0OA 4UY8C 1PX2A 3FKIG 3Q8QB 2Z6BA 2R92A 5C5MA 3GTQB 2NVQB 1OXUA 2RSNA 3A8KE 3P7JA 2R93G 4KY5A 1UUPA 5GAEC 1KRSA 3CCLA 2XGTA 4L5RC 3V6JA 2R82A 5IT9L 3I73A 4IR1A 1Q82C 3S1MH 2P0AA 2B2TC 4JBMA 2YZNA 5HV6A 3QZ7A 3GTOH 2YZMA 5C1PA 1JLLB 1PZJD 4RAYA 3N52A 4MV6A 3NELA 3HKZG 3I4NG 4GNXB 4ECXA 1U4PA 1UC9A 3G6EA 2ZTCA 1CZGA 3S2HB 5M3MB 4YJ2F 5ELOA 2PQAA 1N32Q 3Q8RB 2DGYA 1XMQH 1KEEA 3I56A 4A3EH 3A74A 3K7AB 4EFEA 1MIUA 4PMWA 2EY2A 2QCPX 5CMDA 3K59A 2TSSA 3GO5A 3PO3B 1A3UA 3TQ1A 3X3NA 4FNFA 1K0RA 2FMAA 1YJNA 4DR7Q 1EUCB 3P75A 4XXEA 4K2LA 4DV6H 3E9HA 1YITA 1FNVA 1KNEA 4DFAA 4ED2A 4J9QA 1GJXA 1FGUA 4N8X1 1CFMA 3Q0AA 2I5MX 4O4HF 3K6OA 3G71A 2K5NA 4R4QA 4JYAH 5FLXE 4YY3L 1Y8PB 5KFHA 2JA7A 3BVMA 4CDEC 1E0BA 1EZ6A 3QWNA 1B3AA 5CC4A 1FYCA 1R4PB 2XCAA 4QUFA 5KFAA 4C56C 2P5ZX 1GHJA 3NBHA 5D1OB 1DM0B 3KAKA 3PF5A 4O3QA 5LMNQ 1SYDA 4DR4H 3BG3A 3TREA 1Q81C 1F2ZA 3MEHA 2VQFL 2I46A 1BJTA 4DAYA 2WTFA 3FKIB 3GIPA 4DKAC 4NXNQ 3U4VA 1HFNA 3C0FB 1L1OA 4H02A 3DEPA 4JOIA 2VPSA 4DAVA 4LF5L 2W8LA 4OO1H 5DG7A 1IBML 1I6HH 5F9LA 2VB2X 1GKHA 1HNZL 1D5ZC 1I50B 1CKNA 3E6ZX 1EY7A 3BA8A 4KD4A 4XTCS 3NQIA 1HZBA 1AP0A 5KFMA 3HKZB 3I4NB 1C9OA 3L0OA 3TZDA 4HJ9A 5IGDA 4QIWB 5IP9G 2A6HD 1J5EL 3I72A 3KHGA 3J7AF 3ORRA 4JBJA 3PW4A 5CV4A 3A8IE 4KHVA 1LUZA 1E1OA 2D9UA 4J8QA 2K50A 3PO2H 5AJ3Q 5LMUL 4DN4M 4UCSA 3QB3A 3M4YA 5LXTF 4RGNA 3RLNA 1FD7D 5J3BA 3M85A 3GTGB 1VQ8A 3S16B 1PH9A 3NGDA 4R4CA 3H20A 1OXXK 1YVCA 4IURA 5JPNC 2NZ1D 4F4YA 1BO0A 4QWDA 2W9BB 2EYLA 2R3ZA 5JQWA 2W7PA 3H3VC 3NSWA 2YYAA 1B1ZA 2AWNA 3S1MB 2BH8A 2K5HA 1SNPA 4F88A 2C2DA 1S0NA 4HNTA 2RGVA 3GTOB 3NTHA 4EBDA 4RHSA 1LTID 2F3IA 3R3OA 4HJ8A 4E4TA 4YP3A 3TS2A 2KCTA 2JA5H 2M05A 5M5YH 3G6YA 4IPCA 5EPJA 2KUMA 2MFIA 4FS1A 4YJ3F 1H9MA 1BXTA 1X3PA 1I6UA 2ID0A 4X3SA 5T1GA 1GSHA 3PO2G 4ECWA 3JRXA 1PV4A 4L5QA 3IG0A 4YY3H 4DV6Q 3G8CA 5DEHA 4JUZA 4DUZH 3PW0A 4KHPL 2C5CA 2Z9HA 4A3DH 4QWAA 3RV4A 4PDBA 4JW0A 3PZPA 2VQEQ 2ICEC 2IX1A 1TA8A 4ZI7F 3GIDA 5C3XA 4FF1A 1FKAH 4H44C 5T14A 1SJHD 4JI0Q 1PRTF 3PN1A 5L37A 4B3RQ 2E76C 2B2YC 2NTSA 3RB3A 2K5VA 2VQFH 4KMUC 2RHQB 2R6FA 3T1HH 3SVMA 2PW7A 3S14H 2XD4A 5FLMG 5ELDA 4GC6A 1SYEA 4HNUA 4JI3Q 5D3IB 3RB6A 4DR4Q 2Y0SA 1TS4A 4DV7L 5CBAE 2BDNA 2D5DA 4ID6A 1LT6D 3I90A 4LF5H 2Z1CA 5KFYA 2V4RA 4RKLA 2DUDA 3CU7A 1HA5A 1WTXA 3VYSA 1EY6A 4A3DG 2PNHA 1K1QA 1B53A 1D5MC 2QDLA 1EWIA 1K3BC 4FBUA 3MVVA 5FO8B 1J5EH 3ITPA 2K04A 5BR8L 2ZJQA 2F4VQ 4R4TA 3GV8B 3J80i 3J80E 2DIKA 2VA3A 3K7UC 3MHBA 3J7AK 2LXJA 5LMUH 1LT3D 1CUKA 1TIID 1VCIA 1EZ1A 4XX0B 2IJ0A 1XX8A 2F0PA 4FO2A 3C2PA 4BY7H 4LF8H 1I6HB 1Z7TA 1SXTA 4XQJA 3MFGA 2PI2A 1Q46A 5NUCA 1WD1A 2JA6G 4IHJF 2YV5A 4OWXB 4HCSA 5FPOA 3UDGA 1BOSA 2OEOA 4RB1A 3UFXB 1KAWA 2PW5A 1Q90A 5KFQA 4MV7A 5ELFA 1KAAA 5KFKA 1JE4A 3VR2A 3RZOB 2JE6I 3NENA 4M1UB 4OEMB 4C3JG 3HXLA 4E6IA 4DV1Q 3CW2C 3PO2B 3U9OA 1RCVD 1G91A 2QYZA 4AYBA 5KT7A 1OO9B 5T1IA 2C22A 3MWEA 4AQYL 4OL7A 4JI6H 4BY7G 1AN7A 5C1OA 5LMNW 4L5TA 5KFBA 1SROA 2R7LA 4O3SA 4KLKA 3GD7A 2ZDQA 1JDEA 2K28A 5JVH3 2R87A 1ET6A 3FVQA 1HNXL 2E5LH 5LA6F 1NUCA 4DK6C 1HR0L 1JOQA 1ZHSA 4YY3Q 1EQVA 2VNUD 2JEBI 3PUXA 4MV4A 2CWPA 4M9UA 1GUTA 2M2LA 1N33L 1K73C 3I4OA 2KCCA 1UE1A 1AUXA 2F52A 1UNNC 2OWOA 4R8UA 3E9IA 3G6VA 1TVXA 1PFMA 2Q2TA 5LYJF 4ME3A 3N44B 2E2HH 3CD6A 3O13A 1QZGA 4QWCA 4A3DB 4ECYA 4ZK9B 3IAYA 4Q5VA 2AQ4A 4MNOA 4UAIA 1EQQA 4O42A 4V0BA 2QGQA 1RD9D 1E4FT 5D14A 1H9SA 3ORQA 4ED3A 4FBTA 3GTPB 5IT9E 4NP5A 3I2ZA 3CC7A 4NLGA 4P71A 4ZUIA 5JH7F 4GLXA 5KFJA 5K36G 4DL7A 2JEAI 1IBMQ 1HNWQ 2J6UA 4LF7L 4WFN3 2CFMA 2B39A 2NN6G 1QE6A 3F2BA 5IY0A 1HNZQ 5BR8H 1A9XA 1U0LA 4MV9A 1WYDA 1U5KA 3QZ8A 2JA6B 2WFWA 2I0QA 3HS0C 3PUWA 5JEAJ 1B4OA 3Q8PB 4C1NK 5IGGA 5LOVF 4YWLA 3RUPA 1T9HA 1OXSC 1XMOL 3BVZA 2F1MA 2BDOA 5KFLA 1JORA 2XSCA 2F0EA 3PR4A 1EY9A 1R4QB 4O0AA 1SYGA 4TSSA 3F2CA 4HIOA 1JQYD 1PXUA 2R92G 1PH2A 2BE5C 3HOVH 1CTMA 2JJQA 1SMYD 2CQAA 4L6TB 1A62A 2XGPA 1WJJA 2BCOA 1CT1D 4BY7B 4ZYSA 1I4GA 3TN2A 1WSCA 2KHJA 2L4NA 5C6AA 4X65L 4A75A 2JQOA 5JVDF 2WB1A 1HTLD 2XC9A 1C48A 3KLWA 4F4XA 3CCQA 4ED7A 1EEID 2L15A 3S2DH 3F1ZA 4LFAH 4YAKB 3JAMW 3MXGA 4U68A 2RA4A 1W96A 1GM5A 5EQ0A 1K8OA 1E3PA 3I12A 4QGUA 3RB0A 1KLGD 2XTIA 4KKTA 3PUYA 2JA7H 4KHPQ 4IRKA 1ICFB 5KFNA 1B3QA 5C4JB 1KJ9A 1UE6A 3FMCA 5KFDA 1X3GA 2B2UA 1JXLA 4RCNA 4JI7L 3OPOA 1EIHA 3J81W 2UUCL 2OLSA 5IGEA 4J9MA 4IWXA 4K6LA 4GOPA 1E2WA 5DQGA 2ASBA 1AZPA 1LLRD 2KHSA 1RYRA 2DZDA 2KENA 2HDMA 5C5LA 2CQYA 4HIDA 2A5HA 2RKSA 1NAPA 3LWBA 5JPMC 4DV7Q 1QUQA 1YHQA 4DR5H 2HVRA 5IT9W 1VQHA 4CKEA 4GN5A 1IYUA 3RBDA 1VQNA 3F8NA 4DPGA 2IP4A 2F0WA 2FMCA 5KFEA 4HCEA 1E22A 1PRTB 2HGSA 2JA7G 3M4IA 4ETSA 2VUMA 4B3MH 1BKBA 2HQEA 3GV5B 2IWHA 4M7EA 2BR0A 2DNCA 3QIAA 4B3TQ 2CW7A 1IW7C 4N9PA 1SNCA 3TRZA 2R7MA 1EL0A 1JMCA 2E2IA 5BR8Q 4KKSA 1XNQL 4ED8A 3HOYH 2W6QA 1L2FA 3OOCA 4RFBA 4QB4A 1WH2A 4CDDC 1GXDC 1XMOH 1W2BA 2R92B 2UVWA 5M5XH 5KEEA 3VYTA 3LWEA 3JAMc 3SE0A 2HJWA 2C35B 4A3MH 3CVZA 2IY5B 3UDIA 5ELBA 1NNXA 3M4PA 2WDTA 3MXUA 4NPSA 1OXVA 2A74C 1LTTD 1WTRA 3J81c 5KFPA 1G291 2Q2IA 5LP6F 2IL8A 2ZM6L 1S5BD 2N3SA 4A93G 1BBXC 4TV9F 4R1JA 2PQAB 2ZTDA 3HOYG 4RB0A 2C00A 1PA6A 4CHTB 3KHRA 2Q2HA 3SEBA 5KT2A 1HUNA 4IN3A 2NWGA 4AQYQ 3OUZA 4OXPA 3L7ZC 3KUPA 5DNFA 2O5JC 1DYQA 2K32A 1TWAB 2Q8TA 4ZQIA 2KOLA 3PUVA 3M4QA 4JI7H 2BOSA 1HNXQ 3VR3A 4A3GG 3EPIA 2DJFC 2LMCB 2MP1A 1STHA 4L63B 3KHLA 1HR0Q 1Q1EA 1MKHA 3RNUA 3CCJA 5EWFA 5CAEB 3U9TA 2C2EA 1N33Q 3P20A 1O7YA 3S2DB 1VS0A 3ULJA 1LTGD 5BPHA 2ZJTA 1YNXA 3VYUA 4DXGA 1HRJA 4Q45A 2AKWB 3BZDB 4R8IA 3HOUH 5JVLA 4BBSG 4PZ7A 1E24A 2JA7B 2GN5A 3RV3A 3ND9A 4POGA 1EY4A 3A5UA 3MFIA 4HJAA 1JC7A 3BDLA 1BQQT 3NBHB 2XCPA 2AWOA 2CH4W 4DXFA 1KJJA 1RDPD 2GVBA 4DV3L 2HVQA 3MR3A 1IBLH 3IL8A 1MJCA 5JJLA 3K5OA 5BMVF 3VMMA 4LF7Q 5KG2A 4PMBA 1PK8A 1FVIA 3MEFA 1SCUB 1N48A 1XNQH 3GP7A 2CW8A 1L1OB 2I07B 3I4MH 4IZOA 1YNJD 1DOMA 3DWQA 2Z6KA 1S72A 4LWCA 4FXDA 1TT2A 2E8GA 3D4RA 4CKBA 1DIKA 3ZJYC 1VQ4A 4JI8L 1IKMA 5IOCA 1CKNB 2CQOA 3H6MA 1YNNC 1H9RA 5IYBG 1LT5D 2K75A 5FJ8H 4F4WA 1DJRD 1X65A 4K6DA 1GD7A 2CW0C 1HHVA 3MWDA 5J1ZA 2PMZA 3RD4A 1CK1A 3G7LA 3T51B 1DV2A 2X0SA 4IFDH 5FPRA 1ML0D 3PSIA 4A93B 3MJFA 4JI4L 4GN4B 3HOYB 5IGBA 4KN7C 5I6YA 5KFRA 4J9LA 4C5CA 5CV5A 1EHIA 1WTWA 3J81j 1PRTC 5C4ZA 1ENAA 5HURA 4ABNA 4ECVA 5I4DA 4Y7NH 4Q43A 1QJOA 4EEYA 3EFXD 2H5XA 4X65Q 3GIQA 2OH2A 3J7YW 4ALPA 3DUZA 4A3GB 2ALZA 2VB3X 4ED6A 1O78A 1SN8A 2MQHA 2F0GA 3J7A5 1UWVA 2X6LA 3LP8A 2F0TA 3RAQA 3SK5A 3E3XA 1JCKB 4C3HH 4EFBA 4IUPA 2R8HA 3S1NH 4WJ4A 4DNTB 3DM3A 5CA1F 1TWHA 5DQIA 4IO9A 1SEIA 3T53B 1O7LA 1HZAA 3RF2A 5EWGA 2UUCQ 2UVUA 4RZRA 2F0KA 4MTNA 2AGPA 2H1EA 2ATWA 2SEBD 4UPAA 4ZCKA 2FKLA 1NY4A 4AYBG 4JYAL 5CBEE 1QG7A 1SFOA 3K3PA 3CCSA 4DR6L 2FK1A 2A68C 2QA4A 1CQVA 4IQZA 3H4BA 3RFCA 1SNQA 3CKIB 4RG1A 5DQHA 4G7HC 4LF6H 3C46A 2K33A 4UDUC 3PMFA 5D3DA 1A6XA 2OF1A 2MJ8A 2WV6D 1HQMC 4JVZA 4DA2A 1OTCA 4LSAA 1V8QA 5CA0F 1VQFA 4MHEA 4B9XA 2YS7A 3M9BA 3J81L 1VQ5A 1D6EC 3T1YQ 3MR5A 2YL2A 5KT5A 2HCIA 2ZXPA 2FB9A 4DR1H 4FDBA 4UCVA 1S5FD 4ZKCB 4CBVA 1HH2P 1B7YB 1D8LA 1IHZA 2F0MA 3OW2A 5C44G 1X56A 1ENCA 4A3LH 4DV2H 4JI8H 2EYOA 5D8DA 4YBZB 1ZYRC 1HUMA 1L0YB 1R9TB 1A8VA 1Y1VG 3CC2A 3BAAA 1TQOA 1LV9A 2OTLA 4ECSA 4G7ZC 4LAAA 3CCMA 4JI4H 2ZXRA 2LKVA 1M7JA 1LO5D 1P8LA 4LSXA 4XYLB 2B2WA 3GTKA 2EE1A 4UP9A 2PZWA 5TSSA 5L9XA 1U9RA 1UEAB 3Q8DA 1RTOA 1SNMA 1IL2A 2DNEA 2WE6A 5IYCH 5EBDA 2ALYB 4JV5H 4F87A 1HR0W 2ZM6Q 2WAQA 4ECTA 4R4OA 4XDXA 1PH7A 3CAMA 3M3YB 3RN2A 3V4ZA 1TY2A 1NR2A 2KQ3A 5L1KA 4ECRA 3S15H 1N36H 2XWJB 4UFZA 1V1OA 4LUOA 2ICIA 4JI5H 1S0MA 3WDNA 3SK8A 4EQNA 2NVYA 4MA0A 2DY7A 5I6WA 1FJGQ 1SE8A 4AYBB 5IYZF 1M90C 3FDSA 5H1SE 3OTOL 2L12A 4IALA 4P2CB 2ATLA 2PBZA 2UVRA 2VA2A 1G2SA 1B50A 3WWVA 4X66H 4RZQA 4POFA 4O3RA 2EZVA 4MTDA 4TKOB 2CCZA 4DUZL 1XTDA 1FR3A 2WB1G 1JB3A 4DR6H 3Q22A 1D1KA 2YCHA 4A3EG 3BS1A 4JI1H 3W3AA 3S1NB 1KL9A 1AW7A 3L2PA 2W7OA 1KNAA 3RLFA 1I94Q 4EGQA 2RBMA 3F8TA 2VUMH 2PCFB 1PDQA 4DAMA 3PVXA 3T1HL 1S5ED 1STNA 3IFTA 1CQJB 4DV3Q 5C44B 5BN5A 1TS2A 3GV3A 2B2TA 1S40A 4LNQA 2E2IH 5EJWA 4BS9A 3L4KA 1SNOA 3E5SA 1I4QA 5C8YF 4Q8FA 1DXMA 1EU3A 3K0YA 5JUMA 1ZEQX 2EOTA 1Y1VB 4G7OC 3KOJA 5KFIA 2AHOB 5JJZA 1CQIB 3K3VA 1EUJA 4N8FA 4NW2A 1SE4A 1Y14B 2E75C 4KY7A 1J9OA 2R8KA 2MGSA 1UE5A 2KA7A 4JI8Q 3WOEA 3BJYA 1EFID 4X64H 3KTMA 2C28A 3OMCA 4OIJA 3HOXH 4PZ6A 3TIIA 2NB0A 3QOJA 4JV0A 4O2DA 2AQ3B 4HSVA 1EY0A 3EBEA 3STBD 3PR5B 4CDFC 2YU9A 4JI4Q 3KHHA 1SJED 1YI2A 4LF8L 1XXGA 1HFGA 1BNZA 4LF9L 1N56A 5M3FH 1GHKA 5IIFA 2C2RA 4FVMA 5CV7A 1I5FA 3A0JA 1VQAA 4OO1G 3WO1A 1Q86C 3VYRA 5C5JA 3Q8SB 3RLOA 2WIIB 2PPBC 1XMQQ 2L11A 3UQ8A 3ERQA 4YB8B 3V4SA 5C0XH 3H4DA 2AU0A 3UI2A 2UUAH 4FM9A 1I4XA 1STGA 3TZUA 2B8FA 3PW2A 4X62H 1EWCA 4GZYC 1EYGA 1C0AA 3T13A 2BQUA 1RTNA 2N8NA 4J6HA 3HOXG 2B3GA 3D4WA 3OTOH 3WO0A 4KTAA 2JA9A 2WB1B 5CV8A 1TXYA 3UDFA 3NK9A 5K2MA 5CV9A 3J7ZC 4A3EB 1Z6HA 3NEMA 2WINB 3BQ2A 4JI6L 4IPDA 2B63A 3KLRA 2DPIA 3S15B 1MSHA 1DONA 5M3FG 3HBLA 1ENFA 1G8ZD 1YHBA 3TDQA 2FLLA 5L1IA 1SNDA 4YCUA 4GNXC 1C30A 3E5NA 2E5LL 4JYAQ 4B3SH 3CMEA 4K0KH 1CKMA 2AGOA 3PQIA 1PFNA 1MI2A 3L9AX 2NU7B 1T5EA 4DR2H 1XTCD 3HKZE 3TP5A 4QIWE 2FJ2A 2JA8H 2A6ED 3FEWX 3KDFA 5CB4F 2W6PA 3EPGA 3LGJA 4GOPB 1TWFH 1E2VA 3GV6A 4C2MA 4ED0A 3KF8A 2JA5G 3MZ5A 1UAPA 2RDHA 1JWMD 3AFQA 4DL5A 4P72A 4RU9A 1ESRA 2B29A 3I55A 5GONF 1IBKL 2GVAA 3Q2OA 2V5AA 4OHJA 2ZXOA 1VBGA 1KD1C 1QUQB 3KF6A 2DLNA 2VS1A 4YHHL 4X3TA 5E4WC 4EYIB 5DLGA 3EVQA 5EKKA 4DK0A 2GPWA 4A4IA 4OWWB 3QR8A 3J7AV 2UXDL 1FNUA 3S1RH 2J0TD 1WTQA 2UVVA 3PW5A 4I7ZC 1VKZA 3K0XA 5KG5A 2N55A 3IRBA 4NMZA 1PH8A 2FLPA 4DL6A 3AYHB 2E2IB 3H3VI 3NTIA 4MAMA 1X9NA 3HZXA 2D0PA 5KFVA 1ONLA 1L0XB 4LF9H 1RIPA 4XYQA 4OELB 3H40A 2BH2A 5AFWA 3VR5A 3PIPA 1VQJA 1O80A 3AU7A 1GGOA 1EOTA 3FPUB 2RVLA 3CQZA 4X3KA 1WCMA 2VY3A 4DV0L 1W3SA 5DG9A 1VQKA 1BDOA 1PH4A 3W1BA 2MNAA 5F2DA 1V1QA 1PTOF 2QEJC 3HOXB 4HR7A 1FNWA 2L0CA 2Q8RE 4BY1H 4BA1I 1UC8A 5KG0A 4PMCA 4U673 1W6KA 3DHQA 4IFDI 3PF4A 3ER0A 2J9GA 5C4HA 5KG7A 3OYYA 1TWHH 4K5WA 4DL4A 3T56B 4J15A 2B2YA 1I4RA 5M3FB 1B6SA 4X6AH 1A3VA 4QW9A 3CRKC 5KT4A 1VQGA 1S10A 1RKNA 3OTOQ 2AQ1B 1S97A 3JAME 3JAMi 4LFAL 3BQ1A 1I3QH 2CZGA 1STEA 2JEFA 1SFOH 2WKDA 3I4LA 2K14A 5KFSA 3HOWH 4KJOA 4DUZQ 1CM9A 4I4TF 2JA5B 2PQEA 1TWGA 4ECZA 2F03A 5M5YB 4DR3H 2Q8IB 2ES2A 4C3IH 3L4JA 1EZ8A 3RBEA 3J81E 3D4DA 3CF5A 4BY1G 1EIYB 4EQOA 3OSNA 2JEJA 4O2BF 2EJGC 2HIVA 2XNAC 3K81C 4CDCC 3HFZB 4XT1B 1O7ZA 3QG1A 2XGQA 4RGOS 2VQFQ 3ERSX 1JE5A 1V43A 3VDYA 1K9MC 1IXRA 1IBKH 4TUYF 3T1HQ 1M8AA 2J6TA 1PZID 4B9WA 4DUYH 2EYHA 4MZ9A 1V4YA 2R7ZA 1I7LA 4OIKA 4YHHH 1YJWA 4JBKA 5D1OA 5GADC 4DR5L 2FK3A 4GN3B 3K58A 3JSNA 5EZYF 4LF5Q 1OXTA 2F0QA 3SGIA 2UXDH 2XWBB 3HOZH 3G48A 4KN4C 3S14B 3RGZA 3TEHB 1JWUD 2HQLA 1NMGA 1PZKD 4P75A 4KKUA 4B3ML 2B2VC 2R7FA 5D1PA 2ZTEA 5H80A 2O2LD 1SYFA 1FL0A 1SSOA 3TP8A 4C3IG 4DF7A 2R93A 3KXYT 1MSGA 1G51A 3JZIA 1KJ8A 3K5HA 1J5EQ 3GTKH 1VQDA 2UUBL 1EYZA 2MPMA 2F0UA 1JT8A 2BQRA 1XNRH 3GILA 3PIP3 1E1TA 1B9MA 4GKKL 1E4EA 3GTJH 4R8NA 5IYDH 3FPPA 5LMUQ 5KG1A 1LTSD 4LF8Q 4DV0H 5I2YA 1ASZA 5CR3A 3S1RB 4LF9Q 3OWFA 1BCPD 1ULZA 2V1CC 4ME5A 1F9QA 1PYWD 2IPKD 2VUGA 2YRWA 2PMZB 5KFFA 1I7NA 2V4DA 3S9WA 1L2ZA 3HOZG 2E74C 4K8JA 2EY1A 3UE1A 1PTOH 3EROA 4CKCA 3N42B 5KFGA 1IOVA 5KIXA 2NVYH 3MWMA 4GLVB 5FO9B 1QZHA 4FXKC 2IBKA 2TMPA 1T3NA 5JVG3 1EIFA 2D0OA 2PVPA 3ZYYX 4N9TA 1CZWA 1BGWA 5KFTA 5A2QW 3CCVA 1AE3A 4RNNA 2W6OA 3HP3A 4A3KH 4JI6Q 5IWAL 1JB7A 2PN1A 4BY1B 3DXJC 2NUCA 2WAQG 4EX5A 1SMXA 2BQ3A 3NXWA 5CYUA 5KKNB 1TWHB 2E5LQ 3HOVG 2DJGC 3MR2A 4EBCA 5HGTA 2YRXA 4FYDA 4HNVA 3AQQA 2O5IC 2Z0SA 2EJFC 1U4MA 4R4IA 4TQSA 2PZTA 3V2TA 1K83H 2V4QA 1RHPA 1A15A 1WR2A 5DLQE 4XQQA 4YAJB 2EJMA 3OHXC 4DK3C 4LF4L 3I3CA 1RODA 1TR5A 1WTPA 2L55A 2KJXA 2JYOA 1MGSA 4F7XA 5BN3A 3PV0A 4IUUA 1VQPA 1G2TA 3CCRA 3N8DA 4UCRA 5DGBA 1IZ6A 5DG8A 2X69A 5ELNA 3BQ0A 3AMUA 1BR9A 3ULPA 2FP4B 2G9DA 4FF3A 4BXXH 2MO1A 4DNRB 3OSPA 1NTGA 3OWEB 1LM0A 4C3IB 5I47A 2HUGA 5J39A 1VQ6A 1T36A 4MTKA 1PMRA 2PMZE 4ZLTF 1VMCA 1KIXA 4YHHQ 1GUSA 2A69D 4QF4A 1SYCA 1JDBB 1BUVT 1IBLL 2E2HB 4O3PA 2UXDQ 3A56A 3MFYA 5DM73 4PNYA 2EYMA 3GIMA 1U4LA 2F0VA 3AEVA 4RUAA 4O3OA 2UUBH 1XJVA 1I6VC 4XT3B 4TVAB 5C3EH 5EKIA 2IHFA 5F9NA 4ME6A 1JX4A 4C5AA 2K5DA 4DK1A 4GKKH 3EQLC 3RR5A 1VQOA 3TQTA 2K52A 3OMGA 2YU9H 3I91A 3H0GA 3M9OB 4GS3A 2N78A 1VF5C 1LYLA 3H91A 4LW1A 1EUDB 1HCZA 3HOZB 4JI2L 4BWGB 3ETJA 1RK5A 1I4HA 4BXXG 4IRDA 5FK9C 1JWSD 2FJZA 4DV0Q 4YCWA 2W9AA 4J9KA 4LFCH 3GTKB 2D2CC 5D65A 2I5LX 4K2KA 1K3RA 3ND8A 2IT1A 1JOKA 1J6QA 2XVSA 1N34L 2K01A 3I8ZA 1K1SA 2NU6B 1BNCA 3GTMA 3Q6SA 4PG3A 1XPRA 1SMYC 2J7ZA 1KXLA 2Z4HA 2FLNA 2WAQB 3R5FA 1BXRA 1T94A 4FU0A 1GSOA 1VQIA 3NWTA 2B63H 5IWAH 4BWSC 3HOVB 4CC6A 1KC8C 1PTOB 4LFAQ 1K8GA 3B6YA 4MN3A 1F9PA 4A3MG 5C0XI 4XQNA 5E4XA 3TS0A 2GLTA 5KT3A 1A2UA 2K1BA 4H0LC 2CWAA 1MD2D 4KK7A 5KG6A 3G4SA 3VR6A 4IJHA 4C2MH 3D6CA 1KDBA 2JXMB 3I7FA 5EBCA 2UXCH 4ZHQF 4LF4H 5K5PA 4DV5H 4ZKBB 2K4KA 2HVSA 2BA0A 4F4ZA 3U50C 4A3KB 2FPPB 2AMCB 4RMFA 1KDAA 2FK2A 4EBEA 1PH6A 4O4LF 2F0IA 1ILPA 4IRCA 4ECQA 1F77A 3MXNA 1PTOD 1EYCA 4DR5Q 4EEQA 4LF6L 3TP6A 1TWFA 4L8JA 4IR9A 1UE7A 3X3MA 1KQSA 1B9NA 3SK6A 3KJPA 2RDJA 2F0OA 4DAYB 4UP7A 2EXDA 3TBIB 3H3VH 3SI8A 5KFZA 4IUTA 2EVBA 4B3MQ 1Q7YC 2RF4A 1X3FA 3M7GA 1O7IA 3GTPA 4DR1L 1S68A 2KVMA 3HG9A 2WAQE 4LUVA 2UUBQ 3GTQH 2Y0SG 3D6WA 2OT2A 4DV2L 4I7HA 4JI2H 1VMPA 3HOUG 4GKKQ 1MHWC 2RQXA 1XMOQ 4LFBL 3CQZH 5I9OA 1HZCA 5HBRB 3PW7A 3OIQA 1WCMH 4HEDA 5IGFA 3BA9A 4YR2A 3MWYW 4YQWA 3RUZA 2G9HD 4TQRA 4YR0A 4RCOA 3CPWA 4F50A 1N34H 2YS6A 3TP7A 1ZKOA 1CI3M 2YU9B 1RL2A 2JP1A 2L5TA 4F8MA 5IODA 3S2HH 1N8RC 4DLKA 3KLSA 5M5XB 3I4MG 1XPUA 1F2MA 3K5LA 2KCMA 4JV5L 2GPSA 4A3MB 2F0DA 1IL8A 2CH4A 3CC4A 1V1PA 2W6NA 1GUWA 3QFFA 4TV8F 4Y8VB 3GV7B 2FXQA 2M00A 2EYJA 3NPPA 4DAPA 3SR1A 1N36L 2PYKA 1D1IA 3D8GA 5FJ8G 3JSLA 1S5DD 5FD6A 1N32H 1WCMG 1SLJA 4JI5L 5IWAQ 1TWGH 4RGTA 1X54A 3LNNA 4FP5D 4IFDG 3J80L 1D7QA 3OHAA 2FHTA 1Y1WA 2MUYA 3DEOA 2E2DC 4JI7Q 3PIOA 3Q24A 1QCBD 2QILA 4QMGA 1TS5A 2J6SA 1Y69U 3V96A 1EY5A 1JOOA 2B63B 2EDGA 4X66L 1I3QA 1DOLA 3NUCA 2FINB 4DR7H 2OCEA 3K5IA 2K6AA 2CHBD 3PCOB 4ZUJA 2R7ZH 4LF4Q 1ESFA 5CGKA 4JV1A 4JI1L 5A2QL 1Q1BA 1QOHA 3R93A 1RK6A 4C3HG 3KDFB 1B6RA 3BYTB 4MV3A 4UCOA 4C2MB 2QDBA 2ASJA 3KF8B 3PUZA 3TMEA 4YWKA 4DL2A 1E2ZA 2Y0SB 2R93H 1IBLQ 3FP9A 4JI0L 3HOUB 4V190 3N6XA 4RB2C 5LMNH 2G5DA 4WJWA 5LL6X 4NDXA 1XDNA 3A5ZB 3M9MB 2FFKB 3ONAB 3OIPA 1XNQQ 3KF6B 4LMYA 2IX3A
chains in the Genus database with same CATH topology
5K36G 2JEAI 2JA9A 1IBMQ 1HNWQ 4LF7L 3UDFA 1TXYA 3CXCA 4BBSH 2CFMA 3GTLH 2NN6G 4P73A 3J7ZC 3F2BA 5IY0A 1HNZQ 2R7ZG 3M7NA 3NEMA 1U0LA 4JI6L 2KHIA 5C4XG 4IPDA 1WYDA 4JI2Q 1U5KA 2D62A 4X64L 4XIGS 1NJIC 5M3FG 2RCNA 2WFWA 1YHBA 5IT9c 2I0QA 4YCUA 4GNXC 3PUWA 4IFDJ 1FJGL 2E5LL 4JYAQ 4DR7L 3CMEA 5JEAJ 1CKMA 3HKZE 2B63G 4YWLA 1T9HA 5GAGC 1OXSC 3GTGH 3S16H 1XMOL 4QIWE 4UP8A 2JA8H 4DNIA 3KDFA 1JJCB 3LGJA 3KJOA 1N34Q 2F4VL 4GOPB 1TWFH 4O0AA 1QVGA 2JA5G 3F2CA 3ICEA 3ULLA 4HIOA 1B8AA 4A3LG 2R92G 4YWMA 1PH2A 3AFQA 4IPHA 1NE3A 4P72A 2NZOA 3HOVH 2JJQA 1L1OC 2B29A 3I55A 1IBKL 1A62A 2GVAA 2KBNA 3RN5A 4JOIC 4JBWA 5IYBH 1WJJA 2UUAL 1KD1C 1QUQB 5LMNL 1I94L 4X62L 3KF6A 2VS1A 2KHJA 4YHHL 2NVQH 4X65L 4A75A 2JQOA 2VL6A 4KHZA 4A4IA 2Y0SE 4DV4Q 4OWWB 3KLWA 3CCQA 4NXNL 1R9TH 2UXDL 3S1RH 4OWTB 3S2DH 2L15A 3UDXA 3F1ZA 3K0XA 2HIXA 4PZ8A 1Z47A 3IRBA 4DV1L 1PH8A 1GM5A 4BA2I 4GKJQ 1E3PA 5IYCG 3AYHB 2JK8A 4QGUA 3H3VI 2XTIA 3PUYA 2JA7H 4KHPQ 1X9NA 1UE6A 2D0PA 1X3GA 4B3SL 4K0KL 4JI7L 1RIPA 4DR2L 4LFCQ 5M3MH 2UUCL 1QVCA 2BH2A 3PIPA 1VQJA 3E0EA 4GOPA 2I5HA 2ASBA 3K7AH 2YTVA 2NZHA 5HY6A 2VY3A 4AH6A 1W3SA 3EN2A 1P16A 5M5WH 2KENA 4DV0L 1VQKA 4LF6Q 3M3YH 1PH4A 3W1BA 1VQCA 2MNAA 4HIDA 1V1QA 1PFSA 5AJ3L 4BY1H 3K8AA 4BA1I 1H95A 1X55A 4HIKA 1KHIA 2PI2E 3PO3H 4IFDI 4DV7Q 1QUQA 1YHQA 3PF4A 3ER0A 1VQHA 4GLAC 4AIMA 3OYYA 4GN5A 1TWHH 1IYJB 5IP9H 3H0GH 1VQNA 4J15A 1YJ9A 4DPGA 4DR1Q 1VQ7A 1WFQA 1VQMA 1E22A 2R6GA 2JA7G 4X6AH 3DLLA 1N9WA 1BKBA 4DV2Q 3U4ZA 1XMQL 2UU9L 3H15A 3CCUA 1VQGA 4A3BH 2HHHQ 4A3CH 4B3TQ 3OTOQ 3JAMi 2OQ0A 4LFAL 4LFBQ 5M3MG 3TRZA 1I3QH 2A1AA 1L0WA 3D31A 3F2DA 1JMCA 1SFOH 5BR8Q 1EQRA 3FHWA 2K14A 4AYBE 1XNQL 2VUMG 3HOWH 3HOYH 2UXCQ 1VQBA 1L2FA 4DUZQ 3KYHC 3W1GA 4DV5Q 4HJ7A 1HNWL 1W2BA 2ES2A 4C3IH 3D0FA 1KRTA 3GTMH 1G6PA 1Q12A 1YEZA 3CF5A 5M5XH 4BY1G 1EIYB 4IJLA 1VQLA 4DV6L 2BA1A 3PO3G 3JAMc 3K81C 2HIVA 2C35B 3HFZB 4A3MH 3FKIH 2VQEL 2ZJRA 5C44H 3H0GG 2VQFQ 1MJEA 2IY5B 3ERSX 1JE5A 1V43A 1VQEA 3UDIA 3VDYA 1IXRA 1PHJA 1K9MC 3RZOH 3T1HQ 4JV5Q 3M4PA 3RZDH 1CSPA 1X3EA 4NPSA 1OXVA 4MZ9A 1EFWA 4A3CG 4B3RL 3J81c 1Y1VH 4A3BG 1G291 1YJWA 4JBKA 1N36Q 5GADC 4L5SA 2Q2IA 4DR5L 3BJUA 4GN3B 2ZM6L 1A63A 2NN6I 4NB3A 4LF5Q 2N3SA 4A93G 1OXTA 1I50H 3SGIA 4JI5Q 4R1JA 4JI3L 5EAYA 2PQAB 2ZTDA 5E7NA 3HOYG 3HOZH 3G48A 4DR4L 1PA6A 2YTXA 3I4NH 3TEHB 4P75A 2HQLA 1NMGA 2Q2HA 1GO3E 4B3ML 1C7YA 2R7FA 3JC66 2ZTEA 4AQYQ 1FL0A 3AFPA 4JC0A 4OXPA 3L7ZC 3CCEA 1G51A 1NMFA 1Z9FA 2VW9A 1UEBA 3TQYA 1J5EQ 3GTKH 4Y52H 3U58A 1VQDA 4X66Q 4LUZA 2UUBL 4NXML 1JT8A 3PUVA 3M4QA 5FLMH 4UY8C 1HNXQ 3FKIG 2NVTH 4A3GG 1E1TA 4GKKL 1HR0Q 3GTJH 1Q1EA 1MKHA 4JCVE 4DR6Q 5IYDH 1OXUA 2R93G 5LMUQ 4DR3L 3CCJA 3RNUA 4JI1Q 5C0XG 5GAEC 4LF8Q 1N33Q 1KRSA 3CCLA 1YZ6A 2XGTA 4LF9Q 1ASZA 4L5RC 1VS0A 1HJPA 2V1CC 3ULJA 1Q82C 3S1MH 1YNXA 4JBMA 2AKWB 3GTOH 3BU2A 1XPOA 4OX9L 3HOUH 3HOZG 2OTJA 1AH9A 4BBSG 3UE1A 4PZ7A 1E24A 3NELA 2GN5A 3HKZG 4YCVA 4GNXB 4DUYL 1K8AC 4POGA 3I4NG 3A5UA 3K80C 3GTPH 2NVYH 3G6EA 4HJAA 4GLVB 1QZHA 3NBHB 2ZTCA 5ELOA 2AWOA 2PQAA 2GVBA 1N32Q 1EIFA 4DV3L 2D0OA 2DGYA 3I56A 4A3EH 2IX0A 3A74A 1MJCA 5JJLA 1MIUA 4PMWA 3CCVA 1M1KC 4LF7Q 1AE3A 2JA8G 1FVIA 3MEFA 4A3KH 4JI6Q 2JA6H 5IWAL 1JB7A 1L1OB 3I4MH 4X64Q 3GO5A 2WAQG 2WB1E 4EX5A 1SMXA 1K0RA 2Z6KA 1S72A 4LWCA 2E8GA 1YJNA 1XNRL 3ZJYC 1VQ4A 2E5LQ 3HOVG 4DR7Q 3UE0A 4JI8L 3E9HA 1YITA 1CKNB 2CQOA 1ASYA 4B3TL 4C3JH 5IYBG 3AQQA 2K75A 1FGUA 2Z0SA 5FJ8H 4R4IA 1X65A 2I5MX 1PH5A 1K83H 3G71A 1GD7A 2K5NA 4R4QA 2R7DA 5IP7H 5DLQE 3STBC 2A19A 1X6OA 1BVSA 4DK3C 5IE8A 4YY3L 5HGQA 4LF4L 3PSIA 4JI4L 4GN4B 1PH3A 4GNXA 5GQOA 3PV0A 1VQPA 3CCRA 1IZ6A 5C0XJ 5ELNA 2UXBL 3ULPA 4BXXH 2MO1A 2UUAQ 4IOAA 1NTGA 1LM0A 3PF5A 3J81j 5LMNQ 1VQ6A 1Y1WH 3TREA 4X62Q 2PMZE 1Q81C 4Y7NH 4YHHQ 2OQKA 5FLXc 1KIXA 2VQFL 1AE2A 2H5XA 4X65Q 3S1QH 3KFUA 4ALPA 1IBLL 1LTLA 4DKAC 4NXNQ 1NBWA 1SN8A 2MQHA 3U4VA 3J7A5 1UWVA 1SRUA 2UXDQ 3AEVA 1L1OA 4H02A 1XJVA 4C3HH 4TVAB 5C3EH 4JOIA 2IHFA 5C4JH 4LF5L 1QVFA 3RR5A 1VQOA 2WP8J 3S1NH 2K52A 3DM3A 5IP7G 2YU9H 4WJ4A 1IBML 1I6HH 4KI0A 4IO9A 4GS3A 1GKHA 3J81i 1HNZL 5JEAG 1HZAA 2N78A 1CKNA 1LYLA 2CKZB 4LW1A 4B3SQ 4K0KQ 4DR2Q 4XTCS 2IHEA 4JI2L 1HZBA 3EIVA 2UUCQ 1C9OA 3L0OA 3CMAA 4HJ9A 4MTNA 4WJ3M 2ATWA 5IP9G 4BXXG 4UPAA 1J5EL 4BBRH 2YYZA 1NY4A 4JG2A 4AYBG 1BBUA 4JYAL 4JBJA 1Y1WG 4DV0Q 4YCWA 1LUZA 1E1OA 3CCSA 2K50A 4DR6L 2I5LX 1K3RA 2QA4A 3PO2H 5AJ3Q 2IT1A 5LMUL 2LSSA 1J6QA 1N34L 4RG1A 1DGSA 3RLNA 5J3BA 3M85A 1VQ8A 1PH9A 2YTYA 4HJ5A 4R4CA 3MXNB 1OXXK 1YVCA 4QY7A 4PG3A 1XPRA 3HOWG 1KXLA 1OTCA 3BZCA 1VQIA 1VQFA 2AWNA 2B63H 2BH8A 3M9BA 2K5HA 2UU9Q 1VQ5A 3T1YQ 3CP0A 1KC8C 2F3IA 4LFAQ 4FDBA 1K8GA 4HJ8A 3B6YA 4A3MG 3TS2A 1HH2P 2KCTA 5GROA 1B7YB 1D8LA 3OW2A 5C0XI 2JA5H 5M5YH 5C44G 1X56A 3W5OA 4BBRG 4DV4L 3TS0A 2R92H 4A3LH 2A8VA 4IPCA 3S17H 2MFIA 5JJKA 2CWAA 4GOPC 2ID0A 3G4SA 1E7ZA 4IJHA 3PO2G 1A8VA 1Y1VG 4C2MH 3I7FA 3CC2A 4GKJL 1PV4A 4L5QA 2OTLA 3M4OH 1TWCH 4DV6Q 3CCMA 4KHPL 4A3DH 2K4KA 2VZAA 2BA0A 3U50C 1P8LA 2AMCB 4TQUS 2VQEQ 4RMFA 2IX1A 4UP9A 1PH6A 1Q8KA 4LFCL 2MO0A 4IPGA 3Q8DA 4JI0Q 2EIFA 1IL2A 4B3RQ 1V9PA 4OONA 2K5VA 2E2JH 4HIMA 5IYCH 4DR5Q 2ALYB 4LF6L 4APVA 2RHQB 1HR0W 2ZM6Q 3S14H 1UE7A 5FLMG 1KQSA 4R4OA 3KJPA 4JI3Q 4DAYB 1PH7A 3CAMA 3RN2A 1YBYA 2EXDA 4UP7A 5IYDG 3H3VH 1CSQA 4DR4Q 3S15H 4DV7L 4B3MQ 4LUOA 4QQBX 4A3IH 1Q7YC 2RF4A 1X3FA 1TWAH 1PVOA 4A3FH 1O7IA 1WOCA 4DR1L 2DUDA 1EOVA 2WAQE 1CKOA 4LUVA 2UUBQ 4A3DG 2PNHA 1FJGQ 4NXMQ 2Y0SG 3GTQH 1HZ9A 1S3OA 1SE8A 4DV2L 1M90C 3HOUG 2HHHL 5H1SE 1JJ2A 4GKKQ 1EWIA 3OTOL 1XMOQ 4LFBL 3CQZH 2QEXA 4DR3Q 1HZCA 3WWVA 1WCMH 5BR8L 2ZJQA 2F4VQ 4POFA 1WI5A 4R4TA 2UXCL 2CCZA 4DUZL 3J80i 1A0IA 1XTDA 2EQSA 4DV5L 2WB1G 3K7UC 1PYSB 3CPWA 2LXJA 3BZKA 4A3EG 1CUKA 1VCIA 2RHSB 3PGZA 4BY7H 4OX9Q 2HT1A 1KL9A 1RL2A 1IBKQ 4DUYQ 3L2PA 4EQ5A 4A3KG 1N8RC 3S2HH 2PI2A 1Q46A 3RLFA 1I94Q 2JA6G 2YV5A 4OWXB 3F8TA 4A3IG 4A3JH 3UDGA 3I4MG 5JJIA 1XPUA 4A3FG 2VUMH 1SR3A 1BBWA 1KAWA 4DAMA 2KCMA 4JV5L 3J80c 3T1HL 4DV3Q 3CC4A 1YIJA 2FXQA 1S40A 2JE6I 3NENA 2E2IH 4LNQA 1N36L 5FJ8G 4DV1Q 3CW2C 4A76A 1WCMG 1SLJA 3KOJA 4JI5L 2AHOB 1TWGH 5IWAQ 1X54A 3CPFA 1EUJA 4IFDG 1JJGA 1D7QA 4QL5A 1GVPA 1Y14B 1XNRQ 4JI7Q 3PIOA 4AQYL 3HKSA 1UE5A 4BY7G 4JI8Q 5LMNW 4L5TA 3T1YL 1B70B 1SROA 2Q2UA 4KLKA 4QJFA 3GD7A 4X66L 3HOXH 1YHAA 4PZ6A 4A3JG 4A93H 1HNXL 2OCEA 4O2DA 4DK6C 1HR0L 3EBEA 3PCOB 4YY3Q 2NVXH 3STBD 4LF4Q 2R7ZH 2VNUD 2JEBI 4JI1L 1PYBA 3PUXA 2CWPA 1Q1BA 4IOCA 5C4XH 1YI2A 4JI4Q 4LF8L 1N33L 1K73C 3I4OA 4LF9L 1UE1A 4P74A 2F52A 4OO1I 2OWOA 2UXBQ 3E9IA 5M3FH 3KDFB 5C3EG 1PH1A 1I5FA 2Q2TA 3A0JA 2LXKA 1VQAA 4ME3A 4OO1G 3KF8B 3PUZA 4A3GH 2E2HH 4YWKA 1Q86C 3CD6A 1QZGA 3RLOA 3S24A 1XMQQ 2ZJPA 2R93H 1VQ9A 1IBLQ 4MNOA 3FP9A 4JI0L 1EQQA 2QGQA 5GAHC 3A5ZB 1EYGA 2Z6KC 3GDEA 1C0AA 3I2ZA 3CC7A 1XNQQ 1N32L 2N8NA 3KF6B 4P71A 3HOXG 2N49A 2B3GA 4GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  2JEA I;  2JA9 A;  1IBM Q;  1HNW Q;  4LF7 L;  3UDF A;  1TXY A;  3CXC A;  4BBS H;  2CFM A;  3GTL H;  2NN6 G;  4P73 A;  3J7Z C;  3F2B A;  5IY0 A;  1HNZ Q;  2R7Z G;  3M7N A;  3NEM A;  1U0L A;  4JI6 L;  2KHI A;  5C4X G;  4IPD A;  1WYD A;  4JI2 Q;  1U5K A;  2D62 A;  4X64 L;  4XIG S;  1NJI C;  5M3F G;  2RCN A;  2WFW A;  1YHB A;  5IT9 c;  2I0Q A;  4YCU A;  4GNX C;  3PUW A;  4IFD J;  1FJG L;  2E5L L;  4JYA Q;  4DR7 L;  3CME A;  5JEA J;  1CKM A;  3HKZ E;  2B63 G;  4YWL A;  1T9H A;  5GAG C;  1OXS C;  3GTG H;  3S16 H;  1XMO L;  4QIW E;  4UP8 A;  2JA8 H;  4DNI A;  3KDF A;  1JJC B;  3LGJ A;  3KJO A;  1N34 Q;  2F4V L;  4GOP B;  1TWF H;  4O0A A;  1QVG A;  2JA5 G;  3F2C A;  3ICE A;  3ULL A;  4HIO A;  1B8A A;  4A3L G;  2R92 G;  4YWM A;  1PH2 A;  3AFQ A;  4IPH A;  1NE3 A;  4P72 A;  2NZO A;  3HOV H;  2JJQ A;  1L1O C;  2B29 A;  3I55 A;  1IBK L;  1A62 A;  2GVA A;  2KBN A;  3RN5 A;  4JOI C;  4JBW A;  5IYB H;  1WJJ A;  2UUA L;  1KD1 C;  1QUQ B;  5LMN L;  1I94 L;  4X62 L;  3KF6 A;  2VS1 A;  2KHJ A;  4YHH L;  2NVQ H;  4X65 L;  4A75 A;  2JQO A;  2VL6 A;  4KHZ A;  4A4I A;  2Y0S E;  4DV4 Q;  4OWW B;  3KLW A;  3CCQ A;  4NXN L;  1R9T H;  2UXD L;  3S1R H;  4OWT B;  3S2D H;  2L15 A;  3UDX A;  3F1Z A;  3K0X A;  2HIX A;  4PZ8 A;  1Z47 A;  3IRB A;  4DV1 L;  1PH8 A;  1GM5 A;  4BA2 I;  4GKJ Q;  1E3P A;  5IYC G;  3AYH B;  2JK8 A;  4QGU A;  3H3V I;  2XTI A;  3PUY A;  2JA7 H;  4KHP Q;  1X9N A;  1UE6 A;  2D0P A;  1X3G A;  4B3S L;  4K0K L;  4JI7 L;  1RIP A;  4DR2 L;  4LFC Q;  5M3M H;  2UUC L;  1QVC A;  2BH2 A;  3PIP A;  1VQJ A;  3E0E A;  4GOP A;  2I5H A;  2ASB A;  3K7A H;  2YTV A;  2NZH A;  5HY6 A;  2VY3 A;  4AH6 A;  1W3S A;  3EN2 A;  1P16 A;  5M5W H;  2KEN A;  4DV0 L;  1VQK A;  4LF6 Q;  3M3Y H;  1PH4 A;  3W1B A;  1VQC A;  2MNA A;  4HID A;  1V1Q A;  1PFS A;  5AJ3 L;  4BY1 H;  3K8A A;  4BA1 I;  1H95 A;  1X55 A;  4HIK A;  1KHI A;  2PI2 E;  3PO3 H;  4IFD I;  4DV7 Q;  1QUQ A;  1YHQ A;  3PF4 A;  3ER0 A;  1VQH A;  4GLA C;  4AIM A;  3OYY A;  4GN5 A;  1TWH H;  1IYJ B;  5IP9 H;  3H0G H;  1VQN A;  4J15 A;  1YJ9 A;  4DPG A;  4DR1 Q;  1VQ7 A;  1WFQ A;  1VQM A;  1E22 A;  2R6G A;  2JA7 G;  4X6A H;  3DLL A;  1N9W A;  1BKB A;  4DV2 Q;  3U4Z A;  1XMQ L;  2UU9 L;  3H15 A;  3CCU A;  1VQG A;  4A3B H;  2HHH Q;  4A3C H;  4B3T Q;  3OTO Q;  3JAM i;  2OQ0 A;  4LFA L;  4LFB Q;  5M3M G;  3TRZ A;  1I3Q H;  2A1A A;  1L0W A;  3D31 A;  3F2D A;  1JMC A;  1SFO H;  5BR8 Q;  1EQR A;  3FHW A;  2K14 A;  4AYB E;  1XNQ L;  2VUM G;  3HOW H;  3HOY H;  2UXC Q;  1VQB A;  1L2F A;  4DUZ Q;  3KYH C;  3W1G A;  4DV5 Q;  4HJ7 A;  1HNW L;  1W2B A;  2ES2 A;  4C3I H;  3D0F A;  1KRT A;  3GTM H;  1G6P A;  1Q12 A;  1YEZ A;  3CF5 A;  5M5X H;  4BY1 G;  1EIY B;  4IJL A;  1VQL A;  4DV6 L;  2BA1 A;  3PO3 G;  3JAM c;  3K81 C;  2HIV A;  2C35 B;  3HFZ B;  4A3M H;  3FKI H;  2VQE L;  2ZJR A;  5C44 H;  3H0G G;  2VQF Q;  1MJE A;  2IY5 B;  3ERS X;  1JE5 A;  1V43 A;  1VQE A;  3UDI A;  3VDY A;  1IXR A;  1PHJ A;  1K9M C;  3RZO H;  3T1H Q;  4JV5 Q;  3M4P A;  3RZD H;  1CSP A;  1X3E A;  4NPS A;  1OXV A;  4MZ9 A;  1EFW A;  4A3C G;  4B3R L;  3J81 c;  1Y1V H;  4A3B G;  1G29 1;  1YJW A;  4JBK A;  1N36 Q;  5GAD C;  4L5S A;  2Q2I A;  4DR5 L;  3BJU A;  4GN3 B;  2ZM6 L;  1A63 A;  2NN6 I;  4NB3 A;  4LF5 Q;  2N3S A;  4A93 G;  1OXT A;  1I50 H;  3SGI A;  4JI5 Q;  4R1J A;  4JI3 L;  5EAY A;  2PQA B;  2ZTD A;  5E7N A;  3HOY G;  3HOZ H;  3G48 A;  4DR4 L;  1PA6 A;  2YTX A;  3I4N H;  3TEH B;  4P75 A;  2HQL A;  1NMG A;  2Q2H A;  1GO3 E;  4B3M L;  1C7Y A;  2R7F A;  3JC6 6;  2ZTE A;  4AQY Q;  1FL0 A;  3AFP A;  4JC0 A;  4OXP A;  3L7Z C;  3CCE A;  1G51 A;  1NMF A;  1Z9F A;  2VW9 A;  1UEB A;  3TQY A;  1J5E Q;  3GTK H;  4Y52 H;  3U58 A;  1VQD A;  4X66 Q;  4LUZ A;  2UUB L;  4NXM L;  1JT8 A;  3PUV A;  3M4Q A;  5FLM H;  4UY8 C;  1HNX Q;  3FKI G;  2NVT H;  4A3G G;  1E1T A;  4GKK L;  1HR0 Q;  3GTJ H;  1Q1E A;  1MKH A;  4JCV E;  4DR6 Q;  5IYD H;  1OXU A;  2R93 G;  5LMU Q;  4DR3 L;  3CCJ A;  3RNU A;  4JI1 Q;  5C0X G;  5GAE C;  4LF8 Q;  1N33 Q;  1KRS A;  3CCL A;  1YZ6 A;  2XGT A;  4LF9 Q;  1ASZ A;  4L5R C;  1VS0 A;  1HJP A;  2V1C C;  3ULJ A;  1Q82 C;  3S1M H;  1YNX A;  4JBM A;  2AKW B;  3GTO H;  3BU2 A;  1XPO A;  4OX9 L;  3HOU H;  3HOZ G;  2OTJ A;  1AH9 A;  4BBS G;  3UE1 A;  4PZ7 A;  1E24 A;  3NEL A;  2GN5 A;  3HKZ G;  4YCV A;  4GNX B;  4DUY L;  1K8A C;  4POG A;  3I4N G;  3A5U A;  3K80 C;  3GTP H;  2NVY H;  3G6E A;  4HJA A;  4GLV B;  1QZH A;  3NBH B;  2ZTC A;  5ELO A;  2AWO A;  2PQA A;  2GVB A;  1N32 Q;  1EIF A;  4DV3 L;  2D0O A;  2DGY A;  3I56 A;  4A3E H;  2IX0 A;  3A74 A;  1MJC A;  5JJL A;  1MIU A;  4PMW A;  3CCV A;  1M1K C;  4LF7 Q;  1AE3 A;  2JA8 G;  1FVI A;  3MEF A;  4A3K H;  4JI6 Q;  2JA6 H;  5IWA L;  1JB7 A;  1L1O B;  3I4M H;  4X64 Q;  3GO5 A;  2WAQ G;  2WB1 E;  4EX5 A;  1SMX A;  1K0R A;  2Z6K A;  1S72 A;  4LWC A;  2E8G A;  1YJN A;  1XNR L;  3ZJY C;  1VQ4 A;  2E5L Q;  3HOV G;  4DR7 Q;  3UE0 A;  4JI8 L;  3E9H A;  1YIT A;  1CKN B;  2CQO A;  1ASY A;  4B3T L;  4C3J H;  5IYB G;  3AQQ A;  2K75 A;  1FGU A;  2Z0S A;  5FJ8 H;  4R4I A;  1X65 A;  2I5M X;  1PH5 A;  1K83 H;  3G71 A;  1GD7 A;  2K5N A;  4R4Q A;  2R7D A;  5IP7 H;  5DLQ E;  3STB C;  2A19 A;  1X6O A;  1BVS A;  4DK3 C;  5IE8 A;  4YY3 L;  5HGQ A;  4LF4 L;  3PSI A;  4JI4 L;  4GN4 B;  1PH3 A;  4GNX A;  5GQO A;  3PV0 A;  1VQP A;  3CCR A;  1IZ6 A;  5C0X J;  5ELN A;  2UXB L;  3ULP A;  4BXX H;  2MO1 A;  2UUA Q;  4IOA A;  1NTG A;  1LM0 A;  3PF5 A;  3J81 j;  5LMN Q;  1VQ6 A;  1Y1W H;  3TRE A;  4X62 Q;  2PMZ E;  1Q81 C;  4Y7N H;  4YHH Q;  2OQK A;  5FLX c;  1KIX A;  2VQF L;  1AE2 A;  2H5X A;  4X65 Q;  3S1Q H;  3KFU A;  4ALP A;  1IBL L;  1LTL A;  4DKA C;  4NXN Q;  1NBW A;  1SN8 A;  2MQH A;  3U4V A;  3J7A 5;  1UWV A;  1SRU A;  2UXD Q;  3AEV A;  1L1O A;  4H02 A;  1XJV A;  4C3H H;  4TVA B;  5C3E H;  4JOI A;  2IHF A;  5C4J H;  4LF5 L;  1QVF A;  3RR5 A;  1VQO A;  2WP8 J;  3S1N H;  2K52 A;  3DM3 A;  5IP7 G;  2YU9 H;  4WJ4 A;  1IBM L;  1I6H H;  4KI0 A;  4IO9 A;  4GS3 A;  1GKH A;  3J81 i;  1HNZ L;  5JEA G;  1HZA A;  2N78 A;  1CKN A;  1LYL A;  2CKZ B;  4LW1 A;  4B3S Q;  4K0K Q;  4DR2 Q;  4XTC S;  2IHE A;  4JI2 L;  1HZB A;  3EIV A;  2UUC Q;  1C9O A;  3L0O A;  3CMA A;  4HJ9 A;  4MTN A;  4WJ3 M;  2ATW A;  5IP9 G;  4BXX G;  4UPA A;  1J5E L;  4BBR H;  2YYZ A;  1NY4 A;  4JG2 A;  4AYB G;  1BBU A;  4JYA L;  4JBJ A;  1Y1W G;  4DV0 Q;  4YCW A;  1LUZ A;  1E1O A;  3CCS A;  2K50 A;  4DR6 L;  2I5L X;  1K3R A;  2QA4 A;  3PO2 H;  5AJ3 Q;  2IT1 A;  5LMU L;  2LSS A;  1J6Q A;  1N34 L;  4RG1 A;  1DGS A;  3RLN A;  5J3B A;  3M85 A;  1VQ8 A;  1PH9 A;  2YTY A;  4HJ5 A;  4R4C A;  3MXN B;  1OXX K;  1YVC A;  4QY7 A;  4PG3 A;  1XPR A;  3HOW G;  1KXL A;  1OTC A;  3BZC A;  1VQI A;  1VQF A;  2AWN A;  2B63 H;  2BH8 A;  3M9B A;  2K5H A;  2UU9 Q;  1VQ5 A;  3T1Y Q;  3CP0 A;  1KC8 C;  2F3I A;  4LFA Q;  4FDB A;  1K8G A;  4HJ8 A;  3B6Y A;  4A3M G;  3TS2 A;  1HH2 P;  2KCT A;  5GRO A;  1B7Y B;  1D8L A;  3OW2 A;  5C0X I;  2JA5 H;  5M5Y H;  5C44 G;  1X56 A;  3W5O A;  4BBR G;  4DV4 L;  3TS0 A;  2R92 H;  4A3L H;  2A8V A;  4IPC A;  3S17 H;  2MFI A;  5JJK A;  2CWA A;  4GOP C;  2ID0 A;  3G4S A;  1E7Z A;  4IJH A;  3PO2 G;  1A8V A;  1Y1V G;  4C2M H;  3I7F A;  3CC2 A;  4GKJ L;  1PV4 A;  4L5Q A;  2OTL A;  3M4O H;  1TWC H;  4DV6 Q;  3CCM A;  4KHP L;  4A3D H;  2K4K A;  2VZA A;  2BA0 A;  3U50 C;  1P8L A;  2AMC B;  4TQU S;  2VQE Q;  4RMF A;  2IX1 A;  4UP9 A;  1PH6 A;  1Q8K A;  4LFC L;  2MO0 A;  4IPG A;  3Q8D A;  4JI0 Q;  2EIF A;  1IL2 A;  4B3R Q;  1V9P A;  4OON A;  2K5V A;  2E2J H;  4HIM A;  5IYC H;  4DR5 Q;  2ALY B;  4LF6 L;  4APV A;  2RHQ B;  1HR0 W;  2ZM6 Q;  3S14 H;  1UE7 A;  5FLM G;  1KQS A;  4R4O A;  3KJP A;  4JI3 Q;  4DAY B;  1PH7 A;  3CAM A;  3RN2 A;  1YBY A;  2EXD A;  4UP7 A;  5IYD G;  3H3V H;  1CSQ A;  4DR4 Q;  3S15 H;  4DV7 L;  4B3M Q;  4LUO A;  4QQB X;  4A3I H;  1Q7Y C;  2RF4 A;  1X3F A;  1TWA H;  1PVO A;  4A3F H;  1O7I A;  1WOC A;  4DR1 L;  2DUD A;  1EOV A;  2WAQ E;  1CKO A;  4LUV A;  2UUB Q;  4A3D G;  2PNH A;  1FJG Q;  4NXM Q;  2Y0S G;  3GTQ H;  1HZ9 A;  1S3O A;  1SE8 A;  4DV2 L;  1M90 C;  3HOU G;  2HHH L;  5H1S E;  1JJ2 A;  4GKK Q;  1EWI A;  3OTO L;  1XMO Q;  4LFB L;  3CQZ H;  2QEX A;  4DR3 Q;  1HZC A;  3WWV A;  1WCM H;  5BR8 L;  2ZJQ A;  2F4V Q;  4POF A;  1WI5 A;  4R4T A;  2UXC L;  2CCZ A;  4DUZ L;  3J80 i;  1A0I A;  1XTD A;  2EQS A;  4DV5 L;  2WB1 G;  3K7U C;  1PYS B;  3CPW A;  2LXJ A;  3BZK A;  4A3E G;  1CUK A;  1VCI A;  2RHS B;  3PGZ A;  4BY7 H;  4OX9 Q;  2HT1 A;  1KL9 A;  1RL2 A;  1IBK Q;  4DUY Q;  3L2P A;  4EQ5 A;  4A3K G;  1N8R C;  3S2H H;  2PI2 A;  1Q46 A;  3RLF A;  1I94 Q;  2JA6 G;  2YV5 A;  4OWX B;  3F8T A;  4A3I G;  4A3J H;  3UDG A;  3I4M G;  5JJI A;  1XPU A;  4A3F G;  2VUM H;  1SR3 A;  1BBW A;  1KAW A;  4DAM A;  2KCM A;  4JV5 L;  3J80 c;  3T1H L;  4DV3 Q;  3CC4 A;  1YIJ A;  2FXQ A;  1S40 A;  2JE6 I;  3NEN A;  2E2I H;  4LNQ A;  1N36 L;  5FJ8 G;  4DV1 Q;  3CW2 C;  4A76 A;  1WCM G;  1SLJ A;  3KOJ A;  4JI5 L;  2AHO B;  1TWG H;  5IWA Q;  1X54 A;  3CPF A;  1EUJ A;  4IFD G;  1JJG A;  1D7Q A;  4QL5 A;  1GVP A;  1Y14 B;  1XNR Q;  4JI7 Q;  3PIO A;  4AQY L;  3HKS A;  1UE5 A;  4BY7 G;  4JI8 Q;  5LMN W;  4L5T A;  3T1Y L;  1B70 B;  1SRO A;  2Q2U A;  4KLK A;  4QJF A;  3GD7 A;  4X66 L;  3HOX H;  1YHA A;  4PZ6 A;  4A3J G;  4A93 H;  1HNX L;  2OCE A;  4O2D A;  4DK6 C;  1HR0 L;  3EBE A;  3PCO B;  4YY3 Q;  2NVX H;  3STB D;  4LF4 Q;  2R7Z H;  2VNU D;  2JEB I;  4JI1 L;  1PYB A;  3PUX A;  2CWP A;  1Q1B A;  4IOC A;  5C4X H;  1YI2 A;  4JI4 Q;  4LF8 L;  1N33 L;  1K73 C;  3I4O A;  4LF9 L;  1UE1 A;  4P74 A;  2F52 A;  4OO1 I;  2OWO A;  2UXB Q;  3E9I A;  5M3F H;  3KDF B;  5C3E G;  1PH1 A;  1I5F A;  2Q2T A;  3A0J A;  2LXK A;  1VQA A;  4ME3 A;  4OO1 G;  3KF8 B;  3PUZ A;  4A3G H;  2E2H H;  4YWK A;  1Q86 C;  3CD6 A;  1QZG A;  3RLO A;  3S24 A;  1XMQ Q;  2ZJP A;  2R93 H;  1VQ9 A;  1IBL Q;  4MNO A;  3FP9 A;  4JI0 L;  1EQQ A;  2QGQ A;  5GAH C;  3A5Z B;  1EYG A;  2Z6K C;  3GDE A;  1C0A A;  3I2Z A;  3CC7 A;  1XNQ Q;  1N32 L;  2N8N A;  3KF6 B;  4P71 A;  3HOX G;  2N49 A;  2B3G A;  4GLX A; 
#chains in the Genus database with same CATH topology
 4NXN H;  2QK4 A;  4LFB H;  1FGB D;  1IYV A;  2R84 A;  2R7Z G;  1AUV A;  1QNU A;  4I55 F;  5A35 A;  2KED A;  1YNJ C;  2KHI A;  4JI2 Q;  1Q3L A;  1Y8O B;  3NE5 B;  4X64 L;  1NJI C;  2JEI A;  5DM6 3;  3EA6 A;  1C3O A;  3I4M B;  4IFD J;  1ZQ7 A;  4PQX A;  3D3R A;  3GTJ A;  1E4G T;  5GAG C;  3GTG H;  3S16 H;  4DNI A;  3T5J A;  1N34 Q;  2F4V L;  4HQ6 A;  3CQZ B;  1DD2 A;  3ICE A;  4TRD A;  1SE3 A;  1B8A A;  1WCM B;  1HQR D;  4A3L G;  1TWC A;  4G4K A;  2YZG A;  4YWM A;  4IPH A;  1KJQ A;  2DY8 A;  3BYY B;  4IUN A;  1L1O C;  4HR7 B;  2KBN A;  2EXZ A;  4JOI C;  3T5L A;  4JBW A;  1H9J A;  2UUA L;  5KT6 A;  4X62 L;  1WTH A;  3N6R A;  3PIO 3;  1D2B A;  4XZ3 B;  4QUC A;  2W71 A;  2VL6 A;  4KHZ A;  2AUK A;  2JN4 A;  4WRD A;  4C1N I;  2QF7 A;  2Y0S E;  4Y7N B;  1GUO A;  4JK1 C;  2XN9 C;  3UDX A;  4A2A A;  2ASD A;  3K5N A;  4PZ8 A;  2HIX A;  1S03 G;  4DV1 L;  4BA2 I;  4LH7 A;  5IYC G;  3R23 A;  5JAV A;  2JK8 A;  1TWA A;  4C3H B;  2Z8L A;  3V6K A;  1BCP F;  4HN7 A;  2N88 A;  4I7A A;  1TWG B;  4B3S L;  4K0K L;  1SYX B;  3I70 A;  4DR2 L;  2R7N A;  3LWU A;  3SXH A;  4UCT A;  3E0E A;  4R8U B;  3T5H A;  2F0L A;  2KSW A;  4UHV A;  4B08 A;  2WAC A;  2VQE H;  2NZH A;  1K83 A;  5KG4 A;  4AH6 A;  3EN2 A;  5M5W H;  3BVG A;  4LF6 Q;  3NQT A;  3MC0 B;  1VQC A;  4KD3 A;  1CQF A;  4JI0 H;  1PFS A;  2K5Q A;  1DCZ A;  3K8A A;  4B3R H;  1H95 A;  2R8J A;  4HIK A;  2PI2 E;  3CHB D;  2R7Z B;  1H9S B;  4GLA C;  3V05 A;  4AIM A;  1B2T A;  3FRP B;  5IP9 H;  1IYJ B;  3H0G H;  1OWT A;  5FD5 A;  4JI3 H;  2M9V A;  2F3V A;  1VQ7 A;  5I9P A;  4DR1 Q;  2C9O A;  1VQM A;  1F2Y A;  1N9W A;  3EYY A;  2SNS A;  2RDF A;  4DV2 Q;  3RAX A;  2UU9 L;  3H15 A;  3CCU A;  3FMA A;  4A3B H;  4RGM A;  4QW8 A;  4LFB Q;  2OQ0 A;  3C1F A;  1TY0 A;  2A1A A;  3N41 B;  1L0W A;  3D31 A;  2R93 B;  4AYB E;  1KJI A;  2VUM G;  3OHB A;  2W8K A;  1VQB A;  3KLS X;  2NTT A;  3KYH C;  2RCF A;  3W1G A;  4HJ7 A;  1LTR D;  1HNW L;  3OUU A;  4IAJ A;  4LK1 C;  1E4E B;  2K5W A;  1KRT A;  3GTM H;  1Y8N B;  1Q12 A;  1G6P A;  2F4V H;  2W70 A;  4IJL A;  4MIU A;  2KCN A;  4FXG C;  1VQL A;  2PNR C;  5DGA A;  4RAZ A;  1IOW A;  2ZJR A;  2O4X A;  3H0G G;  3NWS A;  4JV5 Q;  3HRZ C;  5FO7 B;  1PHJ A;  2L1B A;  3RZO H;  3DM1 A;  3WOF A;  4Q8E A;  1X32 A;  3RZD H;  1X3E A;  3SHL A;  4RNO A;  2NVX A;  1EFW A;  1QNK A;  2GA4 B;  4A3B G;  1M6V A;  2OXP A;  4K5X A;  1N36 Q;  2AGQ A;  3BJU A;  3NBI A;  3TSS A;  4NB3 A;  1KDC A;  1A3T A;  1STB A;  4JI5 Q;  5E7N A;  1ZXT A;  4CC5 A;  5IGC A;  1JR0 D;  3G6J B;  4RAU C;  3JC6 6;  4MV1 A;  4DV1 H;  3T5K A;  3CCE A;  1NMF A;  3W2D A;  3TQY A;  1GLV A;  1VDZ A;  4HAE A;  3U58 A;  4X66 Q;  4LH6 A;  4NXM L;  5FLM H;  3N40 P;  3BDC A;  2NVT H;  1MZB A;  2ZDG A;  4YIJ A;  4JCV E;  4DR6 Q;  2VPQ A;  4DR3 L;  4JI1 Q;  5LHY 1;  5C0X G;  3GTL A;  5EOY A;  1YZ6 A;  1Z2O X;  1F2L A;  4KJN A;  1HJP A;  5FLX W;  4G3I A;  3TIG A;  3MFH A;  1WTO A;  2IW3 A;  2CVR A;  3BDO A;  3KBG A;  2SCU B;  3R5H A;  3BU2 A;  1XPO A;  4OX9 L;  1AH9 A;  2OTJ A;  2F3W A;  4YCV A;  1K8A C;  1XWE A;  4DUY L;  4EQP A;  3K80 C;  1SBB B;  3GTP H;  4XYM B;  4RB3 C;  3A7A B;  2W9C A;  1K8M A;  1Z2N X;  4RUC A;  2UU9 H;  2X6G A;  3A54 A;  2VUM B;  2IX0 A;  1EWH A;  1NSN S;  2LFN A;  5M5W B;  1ILQ A;  3MTS A;  1M1K C;  5JOB A;  2JA8 G;  4J9O A;  2R86 A;  4QCL A;  2EY5 A;  2JA6 H;  1CS0 A;  2YW2 A;  4EG0 A;  5EDW A;  4X64 Q;  2WB1 E;  1IBM H;  1HNW H;  1HPC A;  4JPB W;  1S9F A;  1EIG A;  5EKL A;  3NTK A;  1XNR L;  4L1K A;  1HNZ H;  3GTQ A;  3H0G B;  1DZ1 A;  5EWE A;  1JIH A;  3UE0 A;  2A6H C;  3RJ0 A;  2R8I A;  5M9O A;  1M4V A;  3GQB A;  1ASY A;  1R9T A;  4B3T L;  4C3J H;  5KX5 F;  3GQC A;  5FOB B;  4Q0F A;  4O2A F;  1PH5 A;  4K5V A;  1CE8 A;  4A3B B;  2R7D A;  5IP7 H;  3STB C;  2MCT A;  1GUN A;  1TU2 B;  2A19 A;  1BVS A;  1X6O A;  5G3L D;  5IE8 A;  2ZDH A;  5HGQ A;  3URY A;  4QWB A;  5JEA H;  4J9N A;  1PH3 A;  2PZU A;  4GNX A;  4WOR A;  5GQO A;  1JKJ B;  5C0X J;  2UXB L;  2BE5 D;  3DWP A;  1S5C D;  2UUA Q;  4IOA A;  5KYI A;  3RMH A;  3GTM B;  5KRU A;  1Y1W H;  3K5M A;  4KV6 A;  4X62 Q;  2OQK A;  5FLX c;  5J22 A;  1AE2 A;  3S1Q H;  3KFU A;  1KC7 A;  2R61 A;  1B04 A;  5A2Q E;  1LTL A;  2EY6 A;  1NBW A;  1SRU A;  4DU9 A;  1TAE A;  3RZD B;  3VPC A;  4NXM H;  1JIC A;  1LT4 D;  5C4J H;  1RYS A;  1QVF A;  4Y52 H;  2WP8 J;  5IP7 G;  4LJZ C;  4KI0 A;  4I50 F;  4J9P A;  3J81 i;  2A73 B;  5JEA G;  2NYZ D;  2CKZ B;  4B3S Q;  3LML A;  4K0K Q;  4DL3 A;  5BN4 A;  2FMM A;  4DR2 Q;  3GLK A;  2IHE A;  1WVL A;  3EIV A;  3A7L A;  3RIZ A;  3CMA A;  3VA7 A;  4KHP H;  4WJ3 M;  2XRS D;  5DLF A;  4BBR H;  2YYZ A;  4JG2 A;  4OX9 H;  1BBU A;  1Y1W G;  5K36 H;  5KG3 A;  2A6E C;  2K03 A;  2NN6 H;  2FPG B;  2LSS A;  2NVT B;  4YR3 A;  1DGS A;  2VQD A;  3LX0 A;  1BCP B;  2YTY A;  4HJ5 A;  2JA8 B;  3MXN B;  3H09 A;  4QY7 A;  1F9S A;  2KEC A;  1IKL A;  1SEB D;  3HOW G;  4EVO A;  5ELE A;  1TWF B;  3DWA A;  1RF2 D;  2V9W A;  4H7B A;  3FKI A;  4RWS C;  3GIJ A;  3BZC A;  4DV7 H;  4EYH B;  4OGQ C;  3DMU A;  2HCC A;  1LAB A;  2UU9 Q;  3CP0 A;  2NU9 B;  4K14 A;  2SNM A;  1Y1V A;  2ENB A;  2R7K A;  5GRO A;  4EGV A;  3HB9 A;  2B2U C;  1JJG A;  1IW7 D;  3W5O A;  4BBR G;  4DV4 L;  1CA5 A;  1HXY D;  2R92 H;  2A8V A;  1CHQ D;  5ISR A;  3S17 H;  1I50 A;  2O03 A;  3BG5 A;  5JJK A;  2W57 A;  3R5X A;  4B3T H;  4GOP C;  4ZAI A;  2H4O A;  3HKZ A;  1E7Z A;  3RB4 A;  5CV6 A;  4GKJ L;  4ZRZ A;  5LL6 S;  4QIW A;  4C5B A;  3M4O H;  3QO2 A;  1HA6 A;  1TWC H;  3DF7 A;  4U7C A;  4ODG A;  4FF4 A;  2Z4I A;  3J80 W;  2VZA A;  4RKB A;  1NCV A;  2EYP A;  4TQU S;  1TS3 A;  2UXB H;  5KFU A;  4Q44 A;  1GUG A;  1Q8K A;  3QOL A;  2MO0 A;  4O1N A;  4LFC L;  4IPG A;  4M8A A;  2EIF A;  5KNB A;  3GTG A;  3QJY A;  5L1L A;  1W93 A;  1V9P A;  4OON A;  3C3L A;  3A55 A;  2E2J H;  4HIM A;  5KFO A;  1D5X C;  3OSO A;  4APV A;  4C3J B;  2W9B A;  3KAL A;  1B44 D;  2NUA B;  1YBY A;  5IYD G;  4FF2 A;  1CSQ A;  2VXW A;  3GTO A;  1V1P B;  3AB9 A;  4EGJ A;  4QQB X;  4A3I H;  1X3Q A;  1RJR A;  1TWA H;  1PVO A;  2F0J A;  4A3F H;  5KFX A;  1GOZ A;  1WOC A;  1EOV A;  1AN8 A;  1CKO A;  4ECU A;  4RH6 A;  4NXM Q;  1HZ9 A;  1S3O A;  4J9R A;  2RSO A;  1LTB D;  1Y1W B;  5FKA C;  4AQY H;  2HHH L;  1JJ2 A;  1AZQ A;  2I80 A;  3S1Q B;  4DR3 Q;  2QEX A;  2V59 A;  1RJQ A;  1DOK A;  2B2V A;  1EU4 A;  3VR4 A;  1WI5 A;  4RHR A;  4Q0Y A;  5KGU A;  2UXC L;  5LL6 b;  1HNX H;  5L1J A;  1A0I A;  1I3Q B;  2EQS A;  4DV5 L;  1HR0 H;  1PYS B;  1SFO B;  2XIG A;  1WTV A;  4IWY A;  4CJ1 B;  3BZK A;  5ELC A;  2PO4 A;  3HOW B;  4HSP A;  4Z9C B;  1VF7 A;  1C4Q A;  2RHS B;  3PGZ A;  4NKL A;  1N33 H;  4OX9 Q;  2HT1 A;  1IBK Q;  5KFW A;  4IUV A;  4DUY Q;  4A3K G;  4EQ5 A;  4J9S A;  4HYK A;  3M9N B;  3L3O C;  2IA6 A;  4A3I G;  4A3J H;  1ZHQ A;  5JJI A;  1KBL A;  4A3F G;  3VA5 A;  1SR3 A;  1BBW A;  2XCL A;  3J80 c;  3KAJ A;  4K8I A;  4BBR B;  1SAP A;  2IMW P;  1ICW A;  1YIJ A;  3IKJ A;  2F0S A;  3NP8 A;  2RDI A;  4A76 A;  4DV4 H;  1STA A;  3P1H A;  3OW7 A;  3C1E A;  4FS2 A;  5FLX L;  3CPF A;  1HTP A;  3TIN A;  4LF7 H;  2FPI B;  4QL5 A;  1GVP A;  1PLF A;  1XNR Q;  4GKJ H;  3F2U A;  3HKS A;  1UNS A;  3T1Y L;  1B70 B;  2J4X A;  4WD3 A;  4ZQ3 A;  2Q2U A;  2NU8 B;  4QJF A;  2KEE A;  4ULL A;  2JSO A;  4QWE A;  1YHA A;  1RJT A;  1YNN D;  4A3J G;  4A93 H;  1NR4 A;  4LMQ D;  4MA5 A;  2B8G A;  2CW0 D;  1KTK A;  2NVX H;  1B33 N;  3HGB A;  5KYL A;  5DAU A;  1PYB A;  4IOC A;  5C4X H;  1BCP C;  1QB5 D;  3MAQ A;  2R85 A;  3GTJ B;  4RNM A;  3T4A C;  3S17 B;  4P74 A;  4OO1 I;  4ED1 A;  2UXB Q;  1J8I A;  5C3E G;  5COY A;  1PH1 A;  2MHV A;  4IZ8 A;  3U9S A;  2LXK A;  4HTH A;  4A3G H;  3R2T A;  3M4O B;  4CJ2 C;  1TWC B;  1H9K A;  1PRT D;  4S3S A;  4R7R A;  4MTE A;  3H94 A;  3S24 A;  3CRL C;  1SDF A;  2ZJP A;  1VQ9 A;  5KNC A;  1Z2P X;  4RA8 A;  2WYO A;  3MR6 A;  4I65 A;  2F0F A;  5GAH C;  2Z6K C;  4G57 A;  3GDE A;  3HEJ A;  1WD0 A;  1N32 L;  2NVY B;  3RGX A;  4X65 H;  2DPJ A;  1EYD A;  2N49 A;  2HHH H;  2WKC A;  2E2J B;  1T5X D;  3CXC A;  4HMI A;  1ET9 A;  3GTL H;  1SYB A;  4BBS H;  4P73 A;  2W6M A;  5KFC A;  3M7N A;  1QWY A;  5C4X G;  1LTA D;  3EJI A;  2D62 A;  1G6Z A;  4XIG S;  4J1M A;  3BAB A;  2RCN A;  1I4P A;  5IT9 c;  4A3I B;  1EEF D;  1FJG L;  1CA6 A;  3FDT A;  4A3F B;  4DR7 L;  2JA5 A;  3V6H A;  2RDG A;  1AEX A;  3MA2 B;  2ZT9 C;  2B63 G;  2UUC H;  1TKW B;  2EPB A;  4UP8 A;  1VAJ A;  1JJC B;  2A68 D;  3KJO A;  1VBH A;  4XYO A;  2SDF A;  4CJ0 B;  5E3F A;  1QVG A;  5J2T F;  2RGR A;  1MBY A;  2I87 A;  3ULL A;  1U4R A;  1K83 B;  1II3 A;  3G6X A;  1NE3 A;  2L9H A;  2NZO A;  5BPF A;  3RN5 A;  2XIW A;  5IYB H;  2LY7 A;  5KND A;  2JEG A;  2A69 C;  5LMN L;  1I94 L;  1BF4 A;  1RJP A;  2F4I A;  3SE7 A;  2NVQ H;  4DGZ A;  4A3J B;  1C8C A;  4DV4 Q;  1R9T H;  4NXN L;  2K7V A;  3T1Y H;  2DWC A;  4OWT B;  3MXP A;  4WBN F;  1F9R A;  4PV1 C;  4O3N A;  1ZYR D;  2EYF A;  1Z47 A;  4GKJ Q;  3A8J E;  2JA6 A;  2F0H A;  4KY6 A;  5C3E B;  1Q8I A;  4LFC Q;  5M3M H;  1EQT A;  1M0T A;  1QVC A;  3SK4 A;  5COR A;  3Q23 A;  4UCU A;  4APM A;  1ZET A;  3T16 A;  1S4Z A;  3KBX A;  3K57 A;  1GYF A;  2I5H A;  3E0J A;  3VPB A;  3K7A H;  2YTV A;  1A2T A;  1LAC A;  3KK7 A;  5HY6 A;  1CHP D;  1P16 A;  3M3Y H;  5EPK A;  4U6P A;  1KAB A;  2SOB A;  3NHH A;  1STY A;  2QKI C;  1KLU D;  5E1F A;  5AJ3 L;  3IN5 A;  1AFP A;  1GSA A;  4IUQ A;  1X55 A;  1KHI A;  2NVX B;  3PO3 H;  4JV2 A;  1M0W A;  2ZM6 H;  2I8C A;  5C4X B;  2HD3 A;  1EY8 A;  3R2I A;  1YJ9 A;  1WFQ A;  5EPL A;  1K0S A;  2R6G A;  4O4I F;  3DLL A;  1SE2 A;  3U4Z A;  1XMQ L;  4A3C H;  2HHH Q;  3GII A;  2K05 A;  3JRW A;  1XYI A;  4ZOL F;  5M3M G;  3F2D A;  2B2W C;  1DV1 A;  1FJG H;  4J0M A;  1EQR A;  3FHW A;  2UXC Q;  2FE3 A;  4DV5 Q;  2QW7 A;  2XRQ D;  1W6J A;  3R8B A;  4CGY B;  2VR1 A;  2VOB A;  5C3W A;  3D0F A;  5G3L F;  1K28 A;  1YEZ A;  1V51 A;  4DV6 L;  2BA1 A;  4BBS B;  3GTL B;  3PO3 G;  3IFD A;  3ETH A;  1QIL A;  4HMJ A;  5EGT A;  3SDZ A;  3FKI H;  2AQ2 B;  2VQE L;  5C44 H;  1MJE A;  1VQE A;  1O75 A;  2HDL A;  1CSP A;  3N43 B;  1PTO C;  5I2X A;  2F0N A;  4MV8 A;  1I94 H;  2LS0 1;  4A3C G;  4B3R L;  5J2U F;  1Y1V H;  1PFB A;  2W6Z A;  2V58 A;  4L5S A;  2NBF A;  3VPD A;  4GC7 A;  3WNZ A;  3JAM L;  1A63 A;  2NN6 I;  4PWQ A;  4X3U A;  4DV3 H;  3Q1K A;  2W9C B;  1I50 H;  2AUJ D;  3GIK A;  4JI3 L;  5EAY A;  3RTX A;  4A2B A;  4DR4 L;  1EYA A;  2YTX A;  3I4N H;  1GO3 E;  4H13 C;  1C7Y A;  2ASL A;  2R8G A;  2E2H A;  4R9W A;  3AFP A;  4ILW A;  4JC0 A;  1Z9F A;  2DN8 A;  2VW9 A;  1UEB A;  4LUZ A;  1S0O A;  4UY8 C;  1PX2 A;  3FKI G;  3Q8Q B;  2Z6B A;  2R92 A;  5C5M A;  3GTQ B;  2NVQ B;  1OXU A;  2RSN A;  3A8K E;  3P7J A;  2R93 G;  4KY5 A;  1UUP A;  5GAE C;  1KRS A;  3CCL A;  2XGT A;  4L5R C;  3V6J A;  2R82 A;  5IT9 L;  3I73 A;  4IR1 A;  1Q82 C;  3S1M H;  2P0A A;  2B2T C;  4JBM A;  2YZN A;  5HV6 A;  3QZ7 A;  3GTO H;  2YZM A;  5C1P A;  1JLL B;  1PZJ D;  4RAY A;  3N52 A;  4MV6 A;  3NEL A;  3HKZ G;  3I4N G;  4GNX B;  4ECX A;  1U4P A;  1UC9 A;  3G6E A;  2ZTC A;  1CZG A;  3S2H B;  5M3M B;  4YJ2 F;  5ELO A;  2PQA A;  1N32 Q;  3Q8R B;  2DGY A;  1XMQ H;  1KEE A;  3I56 A;  4A3E H;  3A74 A;  3K7A B;  4EFE A;  1MIU A;  4PMW A;  2EY2 A;  2QCP X;  5CMD A;  3K59 A;  2TSS A;  3GO5 A;  3PO3 B;  1A3U A;  3TQ1 A;  3X3N A;  4FNF A;  1K0R A;  2FMA A;  1YJN A;  4DR7 Q;  1EUC B;  3P75 A;  4XXE A;  4K2L A;  4DV6 H;  3E9H A;  1YIT A;  1FNV A;  1KNE A;  4DFA A;  4ED2 A;  4J9Q A;  1GJX A;  1FGU A;  4N8X 1;  1CFM A;  3Q0A A;  2I5M X;  4O4H F;  3K6O A;  3G71 A;  2K5N A;  4R4Q A;  4JYA H;  5FLX E;  4YY3 L;  1Y8P B;  5KFH A;  2JA7 A;  3BVM A;  4CDE C;  1E0B A;  1EZ6 A;  3QWN A;  1B3A A;  5CC4 A;  1FYC A;  1R4P B;  2XCA A;  4QUF A;  5KFA A;  4C56 C;  2P5Z X;  1GHJ A;  3NBH A;  5D1O B;  1DM0 B;  3KAK A;  3PF5 A;  4O3Q A;  5LMN Q;  1SYD A;  4DR4 H;  3BG3 A;  3TRE A;  1Q81 C;  1F2Z A;  3MEH A;  2VQF L;  2I46 A;  1BJT A;  4DAY A;  2WTF A;  3FKI B;  3GIP A;  4DKA C;  4NXN Q;  3U4V A;  1HFN A;  3C0F B;  1L1O A;  4H02 A;  3DEP A;  4JOI A;  2VPS A;  4DAV A;  4LF5 L;  2W8L A;  4OO1 H;  5DG7 A;  1IBM L;  1I6H H;  5F9L A;  2VB2 X;  1GKH A;  1HNZ L;  1D5Z C;  1I50 B;  1CKN A;  3E6Z X;  1EY7 A;  3BA8 A;  4KD4 A;  4XTC S;  3NQI A;  1HZB A;  1AP0 A;  5KFM A;  3HKZ B;  3I4N B;  1C9O A;  3L0O A;  3TZD A;  4HJ9 A;  5IGD A;  4QIW B;  5IP9 G;  2A6H D;  1J5E L;  3I72 A;  3KHG A;  3J7A F;  3ORR A;  4JBJ A;  3PW4 A;  5CV4 A;  3A8I E;  4KHV A;  1LUZ A;  1E1O A;  2D9U A;  4J8Q A;  2K50 A;  3PO2 H;  5AJ3 Q;  5LMU L;  4DN4 M;  4UCS A;  3QB3 A;  3M4Y A;  5LXT F;  4RGN A;  3RLN A;  1FD7 D;  5J3B A;  3M85 A;  3GTG B;  1VQ8 A;  3S16 B;  1PH9 A;  3NGD A;  4R4C A;  3H20 A;  1OXX K;  1YVC A;  4IUR A;  5JPN C;  2NZ1 D;  4F4Y A;  1BO0 A;  4QWD A;  2W9B B;  2EYL A;  2R3Z A;  5JQW A;  2W7P A;  3H3V C;  3NSW A;  2YYA A;  1B1Z A;  2AWN A;  3S1M B;  2BH8 A;  2K5H A;  1SNP A;  4F88 A;  2C2D A;  1S0N A;  4HNT A;  2RGV A;  3GTO B;  3NTH A;  4EBD A;  4RHS A;  1LTI D;  2F3I A;  3R3O A;  4HJ8 A;  4E4T A;  4YP3 A;  3TS2 A;  2KCT A;  2JA5 H;  2M05 A;  5M5Y H;  3G6Y A;  4IPC A;  5EPJ A;  2KUM A;  2MFI A;  4FS1 A;  4YJ3 F;  1H9M A;  1BXT A;  1X3P A;  1I6U A;  2ID0 A;  4X3S A;  5T1G A;  1GSH A;  3PO2 G;  4ECW A;  3JRX A;  1PV4 A;  4L5Q A;  3IG0 A;  4YY3 H;  4DV6 Q;  3G8C A;  5DEH A;  4JUZ A;  4DUZ H;  3PW0 A;  4KHP L;  2C5C A;  2Z9H A;  4A3D H;  4QWA A;  3RV4 A;  4PDB A;  4JW0 A;  3PZP A;  2VQE Q;  2ICE C;  2IX1 A;  1TA8 A;  4ZI7 F;  3GID A;  5C3X A;  4FF1 A;  1FKA H;  4H44 C;  5T14 A;  1SJH D;  4JI0 Q;  1PRT F;  3PN1 A;  5L37 A;  4B3R Q;  2E76 C;  2B2Y C;  2NTS A;  3RB3 A;  2K5V A;  2VQF H;  4KMU C;  2RHQ B;  2R6F A;  3T1H H;  3SVM A;  2PW7 A;  3S14 H;  2XD4 A;  5FLM G;  5ELD A;  4GC6 A;  1SYE A;  4HNU A;  4JI3 Q;  5D3I B;  3RB6 A;  4DR4 Q;  2Y0S A;  1TS4 A;  4DV7 L;  5CBA E;  2BDN A;  2D5D A;  4ID6 A;  1LT6 D;  3I90 A;  4LF5 H;  2Z1C A;  5KFY A;  2V4R A;  4RKL A;  2DUD A;  3CU7 A;  1HA5 A;  1WTX A;  3VYS A;  1EY6 A;  4A3D G;  2PNH A;  1K1Q A;  1B53 A;  1D5M C;  2QDL A;  1EWI A;  1K3B C;  4FBU A;  3MVV A;  5FO8 B;  1J5E H;  3ITP A;  2K04 A;  5BR8 L;  2ZJQ A;  2F4V Q;  4R4T A;  3GV8 B;  3J80 i;  3J80 E;  2DIK A;  2VA3 A;  3K7U C;  3MHB A;  3J7A K;  2LXJ A;  5LMU H;  1LT3 D;  1CUK A;  1TII D;  1VCI A;  1EZ1 A;  4XX0 B;  2IJ0 A;  1XX8 A;  2F0P A;  4FO2 A;  3C2P A;  4BY7 H;  4LF8 H;  1I6H B;  1Z7T A;  1SXT A;  4XQJ A;  3MFG A;  2PI2 A;  1Q46 A;  5NUC A;  1WD1 A;  2JA6 G;  4IHJ F;  2YV5 A;  4OWX B;  4HCS A;  5FPO A;  3UDG A;  1BOS A;  2OEO A;  4RB1 A;  3UFX B;  1KAW A;  2PW5 A;  1Q90 A;  5KFQ A;  4MV7 A;  5ELF A;  1KAA A;  5KFK A;  1JE4 A;  3VR2 A;  3RZO B;  2JE6 I;  3NEN A;  4M1U B;  4OEM B;  4C3J G;  3HXL A;  4E6I A;  4DV1 Q;  3CW2 C;  3PO2 B;  3U9O A;  1RCV D;  1G91 A;  2QYZ A;  4AYB A;  5KT7 A;  1OO9 B;  5T1I A;  2C22 A;  3MWE A;  4AQY L;  4OL7 A;  4JI6 H;  4BY7 G;  1AN7 A;  5C1O A;  5LMN W;  4L5T A;  5KFB A;  1SRO A;  2R7L A;  4O3S A;  4KLK A;  3GD7 A;  2ZDQ A;  1JDE A;  2K28 A;  5JVH 3;  2R87 A;  1ET6 A;  3FVQ A;  1HNX L;  2E5L H;  5LA6 F;  1NUC A;  4DK6 C;  1HR0 L;  1JOQ A;  1ZHS A;  4YY3 Q;  1EQV A;  2VNU D;  2JEB I;  3PUX A;  4MV4 A;  2CWP A;  4M9U A;  1GUT A;  2M2L A;  1N33 L;  1K73 C;  3I4O A;  2KCC A;  1UE1 A;  1AUX A;  2F52 A;  1UNN C;  2OWO A;  4R8U A;  3E9I A;  3G6V A;  1TVX A;  1PFM A;  2Q2T A;  5LYJ F;  4ME3 A;  3N44 B;  2E2H H;  3CD6 A;  3O13 A;  1QZG A;  4QWC A;  4A3D B;  4ECY A;  4ZK9 B;  3IAY A;  4Q5V A;  2AQ4 A;  4MNO A;  4UAI A;  1EQQ A;  4O42 A;  4V0B A;  2QGQ A;  1RD9 D;  1E4F T;  5D14 A;  1H9S A;  3ORQ A;  4ED3 A;  4FBT A;  3GTP B;  5IT9 E;  4NP5 A;  3I2Z A;  3CC7 A;  4NLG A;  4P71 A;  4ZUI A;  5JH7 F;  4GLX A;  5KFJ A;  5K36 G;  4DL7 A;  2JEA I;  1IBM Q;  1HNW Q;  2J6U A;  4LF7 L;  4WFN 3;  2CFM A;  2B39 A;  2NN6 G;  1QE6 A;  3F2B A;  5IY0 A;  1HNZ Q;  5BR8 H;  1A9X A;  1U0L A;  4MV9 A;  1WYD A;  1U5K A;  3QZ8 A;  2JA6 B;  2WFW A;  2I0Q A;  3HS0 C;  3PUW A;  5JEA J;  1B4O A;  3Q8P B;  4C1N K;  5IGG A;  5LOV F;  4YWL A;  3RUP A;  1T9H A;  1OXS C;  1XMO L;  3BVZ A;  2F1M A;  2BDO A;  5KFL A;  1JOR A;  2XSC A;  2F0E A;  3PR4 A;  1EY9 A;  1R4Q B;  4O0A A;  1SYG A;  4TSS A;  3F2C A;  4HIO A;  1JQY D;  1PXU A;  2R92 G;  1PH2 A;  2BE5 C;  3HOV H;  1CTM A;  2JJQ A;  1SMY D;  2CQA A;  4L6T B;  1A62 A;  2XGP A;  1WJJ A;  2BCO A;  1CT1 D;  4BY7 B;  4ZYS A;  1I4G A;  3TN2 A;  1WSC A;  2KHJ A;  2L4N A;  5C6A A;  4X65 L;  4A75 A;  2JQO A;  5JVD F;  2WB1 A;  1HTL D;  2XC9 A;  1C48 A;  3KLW A;  4F4X A;  3CCQ A;  4ED7 A;  1EEI D;  2L15 A;  3S2D H;  3F1Z A;  4LFA H;  4YAK B;  3JAM W;  3MXG A;  4U68 A;  2RA4 A;  1W96 A;  1GM5 A;  5EQ0 A;  1K8O A;  1E3P A;  3I12 A;  4QGU A;  3RB0 A;  1KLG D;  2XTI A;  4KKT A;  3PUY A;  2JA7 H;  4KHP Q;  4IRK A;  1ICF B;  5KFN A;  1B3Q A;  5C4J B;  1KJ9 A;  1UE6 A;  3FMC A;  5KFD A;  1X3G A;  2B2U A;  1JXL A;  4RCN A;  4JI7 L;  3OPO A;  1EIH A;  3J81 W;  2UUC L;  2OLS A;  5IGE A;  4J9M A;  4IWX A;  4K6L A;  4GOP A;  1E2W A;  5DQG A;  2ASB A;  1AZP A;  1LLR D;  2KHS A;  1RYR A;  2DZD A;  2KEN A;  2HDM A;  5C5L A;  2CQY A;  4HID A;  2A5H A;  2RKS A;  1NAP A;  3LWB A;  5JPM C;  4DV7 Q;  1QUQ A;  1YHQ A;  4DR5 H;  2HVR A;  5IT9 W;  1VQH A;  4CKE A;  4GN5 A;  1IYU A;  3RBD A;  1VQN A;  3F8N A;  4DPG A;  2IP4 A;  2F0W A;  2FMC A;  5KFE A;  4HCE A;  1E22 A;  1PRT B;  2HGS A;  2JA7 G;  3M4I A;  4ETS A;  2VUM A;  4B3M H;  1BKB A;  2HQE A;  3GV5 B;  2IWH A;  4M7E A;  2BR0 A;  2DNC A;  3QIA A;  4B3T Q;  2CW7 A;  1IW7 C;  4N9P A;  1SNC A;  3TRZ A;  2R7M A;  1EL0 A;  1JMC A;  2E2I A;  5BR8 Q;  4KKS A;  1XNQ L;  4ED8 A;  3HOY H;  2W6Q A;  1L2F A;  3OOC A;  4RFB A;  4QB4 A;  1WH2 A;  4CDD C;  1GXD C;  1XMO H;  1W2B A;  2R92 B;  2UVW A;  5M5X H;  5KEE A;  3VYT A;  3LWE A;  3JAM c;  3SE0 A;  2HJW A;  2C35 B;  4A3M H;  3CVZ A;  2IY5 B;  3UDI A;  5ELB A;  1NNX A;  3M4P A;  2WDT A;  3MXU A;  4NPS A;  1OXV A;  2A74 C;  1LTT D;  1WTR A;  3J81 c;  5KFP A;  1G29 1;  2Q2I A;  5LP6 F;  2IL8 A;  2ZM6 L;  1S5B D;  2N3S A;  4A93 G;  1BBX C;  4TV9 F;  4R1J A;  2PQA B;  2ZTD A;  3HOY G;  4RB0 A;  2C00 A;  1PA6 A;  4CHT B;  3KHR A;  2Q2H A;  3SEB A;  5KT2 A;  1HUN A;  4IN3 A;  2NWG A;  4AQY Q;  3OUZ A;  4OXP A;  3L7Z C;  3KUP A;  5DNF A;  2O5J C;  1DYQ A;  2K32 A;  1TWA B;  2Q8T A;  4ZQI A;  2KOL A;  3PUV A;  3M4Q A;  4JI7 H;  2BOS A;  1HNX Q;  3VR3 A;  4A3G G;  3EPI A;  2DJF C;  2LMC B;  2MP1 A;  1STH A;  4L63 B;  3KHL A;  1HR0 Q;  1Q1E A;  1MKH A;  3RNU A;  3CCJ A;  5EWF A;  5CAE B;  3U9T A;  2C2E A;  1N33 Q;  3P20 A;  1O7Y A;  3S2D B;  1VS0 A;  3ULJ A;  1LTG D;  5BPH A;  2ZJT A;  1YNX A;  3VYU A;  4DXG A;  1HRJ A;  4Q45 A;  2AKW B;  3BZD B;  4R8I A;  3HOU H;  5JVL A;  4BBS G;  4PZ7 A;  1E24 A;  2JA7 B;  2GN5 A;  3RV3 A;  3ND9 A;  4POG A;  1EY4 A;  3A5U A;  3MFI A;  4HJA A;  1JC7 A;  3BDL A;  1BQQ T;  3NBH B;  2XCP A;  2AWO A;  2CH4 W;  4DXF A;  1KJJ A;  1RDP D;  2GVB A;  4DV3 L;  2HVQ A;  3MR3 A;  1IBL H;  3IL8 A;  1MJC A;  5JJL A;  3K5O A;  5BMV F;  3VMM A;  4LF7 Q;  5KG2 A;  4PMB A;  1PK8 A;  1FVI A;  3MEF A;  1SCU B;  1N48 A;  1XNQ H;  3GP7 A;  2CW8 A;  1L1O B;  2I07 B;  3I4M H;  4IZO A;  1YNJ D;  1DOM A;  3DWQ A;  2Z6K A;  1S72 A;  4LWC A;  4FXD A;  1TT2 A;  2E8G A;  3D4R A;  4CKB A;  1DIK A;  3ZJY C;  1VQ4 A;  4JI8 L;  1IKM A;  5IOC A;  1CKN B;  2CQO A;  3H6M A;  1YNN C;  1H9R A;  5IYB G;  1LT5 D;  2K75 A;  5FJ8 H;  4F4W A;  1DJR D;  1X65 A;  4K6D A;  1GD7 A;  2CW0 C;  1HHV A;  3MWD A;  5J1Z A;  2PMZ A;  3RD4 A;  1CK1 A;  3G7L A;  3T51 B;  1DV2 A;  2X0S A;  4IFD H;  5FPR A;  1ML0 D;  3PSI A;  4A93 B;  3MJF A;  4JI4 L;  4GN4 B;  3HOY B;  5IGB A;  4KN7 C;  5I6Y A;  5KFR A;  4J9L A;  4C5C A;  5CV5 A;  1EHI A;  1WTW A;  3J81 j;  1PRT C;  5C4Z A;  1ENA A;  5HUR A;  4ABN A;  4ECV A;  5I4D A;  4Y7N H;  4Q43 A;  1QJO A;  4EEY A;  3EFX D;  2H5X A;  4X65 Q;  3GIQ A;  2OH2 A;  3J7Y W;  4ALP A;  3DUZ A;  4A3G B;  2ALZ A;  2VB3 X;  4ED6 A;  1O78 A;  1SN8 A;  2MQH A;  2F0G A;  3J7A 5;  1UWV A;  2X6L A;  3LP8 A;  2F0T A;  3RAQ A;  3SK5 A;  3E3X A;  1JCK B;  4C3H H;  4EFB A;  4IUP A;  2R8H A;  3S1N H;  4WJ4 A;  4DNT B;  3DM3 A;  5CA1 F;  1TWH A;  5DQI A;  4IO9 A;  1SEI A;  3T53 B;  1O7L A;  1HZA A;  3RF2 A;  5EWG A;  2UUC Q;  2UVU A;  4RZR A;  2F0K A;  4MTN A;  2AGP A;  2H1E A;  2ATW A;  2SEB D;  4UPA A;  4ZCK A;  2FKL A;  1NY4 A;  4AYB G;  4JYA L;  5CBE E;  1QG7 A;  1SFO A;  3K3P A;  3CCS A;  4DR6 L;  2FK1 A;  2A68 C;  2QA4 A;  1CQV A;  4IQZ A;  3H4B A;  3RFC A;  1SNQ A;  3CKI B;  4RG1 A;  5DQH A;  4G7H C;  4LF6 H;  3C46 A;  2K33 A;  4UDU C;  3PMF A;  5D3D A;  1A6X A;  2OF1 A;  2MJ8 A;  2WV6 D;  1HQM C;  4JVZ A;  4DA2 A;  1OTC A;  4LSA A;  1V8Q A;  5CA0 F;  1VQF A;  4MHE A;  4B9X A;  2YS7 A;  3M9B A;  3J81 L;  1VQ5 A;  1D6E C;  3T1Y Q;  3MR5 A;  2YL2 A;  5KT5 A;  2HCI A;  2ZXP A;  2FB9 A;  4DR1 H;  4FDB A;  4UCV A;  1S5F D;  4ZKC B;  4CBV A;  1HH2 P;  1B7Y B;  1D8L A;  1IHZ A;  2F0M A;  3OW2 A;  5C44 G;  1X56 A;  1ENC A;  4A3L H;  4DV2 H;  4JI8 H;  2EYO A;  5D8D A;  4YBZ B;  1ZYR C;  1HUM A;  1L0Y B;  1R9T B;  1A8V A;  1Y1V G;  3CC2 A;  3BAA A;  1TQO A;  1LV9 A;  2OTL A;  4ECS A;  4G7Z C;  4LAA A;  3CCM A;  4JI4 H;  2ZXR A;  2LKV A;  1M7J A;  1LO5 D;  1P8L A;  4LSX A;  4XYL B;  2B2W A;  3GTK A;  2EE1 A;  4UP9 A;  2PZW A;  5TSS A;  5L9X A;  1U9R A;  1UEA B;  3Q8D A;  1RTO A;  1SNM A;  1IL2 A;  2DNE A;  2WE6 A;  5IYC H;  5EBD A;  2ALY B;  4JV5 H;  4F87 A;  1HR0 W;  2ZM6 Q;  2WAQ A;  4ECT A;  4R4O A;  4XDX A;  1PH7 A;  3CAM A;  3M3Y B;  3RN2 A;  3V4Z A;  1TY2 A;  1NR2 A;  2KQ3 A;  5L1K A;  4ECR A;  3S15 H;  1N36 H;  2XWJ B;  4UFZ A;  1V1O A;  4LUO A;  2ICI A;  4JI5 H;  1S0M A;  3WDN A;  3SK8 A;  4EQN A;  2NVY A;  4MA0 A;  2DY7 A;  5I6W A;  1FJG Q;  1SE8 A;  4AYB B;  5IYZ F;  1M90 C;  3FDS A;  5H1S E;  3OTO L;  2L12 A;  4IAL A;  4P2C B;  2ATL A;  2PBZ A;  2UVR A;  2VA2 A;  1G2S A;  1B50 A;  3WWV A;  4X66 H;  4RZQ A;  4POF A;  4O3R A;  2EZV A;  4MTD A;  4TKO B;  2CCZ A;  4DUZ L;  1XTD A;  1FR3 A;  2WB1 G;  1JB3 A;  4DR6 H;  3Q22 A;  1D1K A;  2YCH A;  4A3E G;  3BS1 A;  4JI1 H;  3W3A A;  3S1N B;  1KL9 A;  1AW7 A;  3L2P A;  2W7O A;  1KNA A;  3RLF A;  1I94 Q;  4EGQ A;  2RBM A;  3F8T A;  2VUM H;  2PCF B;  1PDQ A;  4DAM A;  3PVX A;  3T1H L;  1S5E D;  1STN A;  3IFT A;  1CQJ B;  4DV3 Q;  5C44 B;  5BN5 A;  1TS2 A;  3GV3 A;  2B2T A;  1S40 A;  4LNQ A;  2E2I H;  5EJW A;  4BS9 A;  3L4K A;  1SNO A;  3E5S A;  1I4Q A;  5C8Y F;  4Q8F A;  1DXM A;  1EU3 A;  3K0Y A;  5JUM A;  1ZEQ X;  2EOT A;  1Y1V B;  4G7O C;  3KOJ A;  5KFI A;  2AHO B;  5JJZ A;  1CQI B;  3K3V A;  1EUJ A;  4N8F A;  4NW2 A;  1SE4 A;  1Y14 B;  2E75 C;  4KY7 A;  1J9O A;  2R8K A;  2MGS A;  1UE5 A;  2KA7 A;  4JI8 Q;  3WOE A;  3BJY A;  1EFI D;  4X64 H;  3KTM A;  2C28 A;  3OMC A;  4OIJ A;  3HOX H;  4PZ6 A;  3TII A;  2NB0 A;  3QOJ A;  4JV0 A;  4O2D A;  2AQ3 B;  4HSV A;  1EY0 A;  3EBE A;  3STB D;  3PR5 B;  4CDF C;  2YU9 A;  4JI4 Q;  3KHH A;  1SJE D;  1YI2 A;  4LF8 L;  1XXG A;  1HFG A;  1BNZ A;  4LF9 L;  1N56 A;  5M3F H;  1GHK A;  5IIF A;  2C2R A;  4FVM A;  5CV7 A;  1I5F A;  3A0J A;  1VQA A;  4OO1 G;  3WO1 A;  1Q86 C;  3VYR A;  5C5J A;  3Q8S B;  3RLO A;  2WII B;  2PPB C;  1XMQ Q;  2L11 A;  3UQ8 A;  3ERQ A;  4YB8 B;  3V4S A;  5C0X H;  3H4D A;  2AU0 A;  3UI2 A;  2UUA H;  4FM9 A;  1I4X A;  1STG A;  3TZU A;  2B8F A;  3PW2 A;  4X62 H;  1EWC A;  4GZY C;  1EYG A;  1C0A A;  3T13 A;  2BQU A;  1RTN A;  2N8N A;  4J6H A;  3HOX G;  2B3G A;  3D4W A;  3OTO H;  3WO0 A;  4KTA A;  2JA9 A;  2WB1 B;  5CV8 A;  1TXY A;  3UDF A;  3NK9 A;  5K2M A;  5CV9 A;  3J7Z C;  4A3E B;  1Z6H A;  3NEM A;  2WIN B;  3BQ2 A;  4JI6 L;  4IPD A;  2B63 A;  3KLR A;  2DPI A;  3S15 B;  1MSH A;  1DON A;  5M3F G;  3HBL A;  1ENF A;  1G8Z D;  1YHB A;  3TDQ A;  2FLL A;  5L1I A;  1SND A;  4YCU A;  4GNX C;  1C30 A;  3E5N A;  2E5L L;  4JYA Q;  4B3S H;  3CME A;  4K0K H;  1CKM A;  2AGO A;  3PQI A;  1PFN A;  1MI2 A;  3L9A X;  2NU7 B;  1T5E A;  4DR2 H;  1XTC D;  3HKZ E;  3TP5 A;  4QIW E;  2FJ2 A;  2JA8 H;  2A6E D;  3FEW X;  3KDF A;  5CB4 F;  2W6P A;  3EPG A;  3LGJ A;  4GOP B;  1TWF H;  1E2V A;  3GV6 A;  4C2M A;  4ED0 A;  3KF8 A;  2JA5 G;  3MZ5 A;  1UAP A;  2RDH A;  1JWM D;  3AFQ A;  4DL5 A;  4P72 A;  4RU9 A;  1ESR A;  2B29 A;  3I55 A;  5GON F;  1IBK L;  2GVA A;  3Q2O A;  2V5A A;  4OHJ A;  2ZXO A;  1VBG A;  1KD1 C;  1QUQ B;  3KF6 A;  2DLN A;  2VS1 A;  4YHH L;  4X3T A;  5E4W C;  4EYI B;  5DLG A;  3EVQ A;  5EKK A;  4DK0 A;  2GPW A;  4A4I A;  4OWW B;  3QR8 A;  3J7A V;  2UXD L;  1FNU A;  3S1R H;  2J0T D;  1WTQ A;  2UVV A;  3PW5 A;  4I7Z C;  1VKZ A;  3K0X A;  5KG5 A;  2N55 A;  3IRB A;  4NMZ A;  1PH8 A;  2FLP A;  4DL6 A;  3AYH B;  2E2I B;  3H3V I;  3NTI A;  4MAM A;  1X9N A;  3HZX A;  2D0P A;  5KFV A;  1ONL A;  1L0X B;  4LF9 H;  1RIP A;  4XYQ A;  4OEL B;  3H40 A;  2BH2 A;  5AFW A;  3VR5 A;  3PIP A;  1VQJ A;  1O80 A;  3AU7 A;  1GGO A;  1EOT A;  3FPU B;  2RVL A;  3CQZ A;  4X3K A;  1WCM A;  2VY3 A;  4DV0 L;  1W3S A;  5DG9 A;  1VQK A;  1BDO A;  1PH4 A;  3W1B A;  2MNA A;  5F2D A;  1V1Q A;  1PTO F;  2QEJ C;  3HOX B;  4HR7 A;  1FNW A;  2L0C A;  2Q8R E;  4BY1 H;  4BA1 I;  1UC8 A;  5KG0 A;  4PMC A;  4U67 3;  1W6K A;  3DHQ A;  4IFD I;  3PF4 A;  3ER0 A;  2J9G A;  5C4H A;  5KG7 A;  3OYY A;  1TWH H;  4K5W A;  4DL4 A;  3T56 B;  4J15 A;  2B2Y A;  1I4R A;  5M3F B;  1B6S A;  4X6A H;  1A3V A;  4QW9 A;  3CRK C;  5KT4 A;  1VQG A;  1S10 A;  1RKN A;  3OTO Q;  2AQ1 B;  1S97 A;  3JAM E;  3JAM i;  4LFA L;  3BQ1 A;  1I3Q H;  2CZG A;  1STE A;  2JEF A;  1SFO H;  2WKD A;  3I4L A;  2K14 A;  5KFS A;  3HOW H;  4KJO A;  4DUZ Q;  1CM9 A;  4I4T F;  2JA5 B;  2PQE A;  1TWG A;  4ECZ A;  2F03 A;  5M5Y B;  4DR3 H;  2Q8I B;  2ES2 A;  4C3I H;  3L4J A;  1EZ8 A;  3RBE A;  3J81 E;  3D4D A;  3CF5 A;  4BY1 G;  1EIY B;  4EQO A;  3OSN A;  2JEJ A;  4O2B F;  2EJG C;  2HIV A;  2XNA C;  3K81 C;  4CDC C;  3HFZ B;  4XT1 B;  1O7Z A;  3QG1 A;  2XGQ A;  4RGO S;  2VQF Q;  3ERS X;  1JE5 A;  1V43 A;  3VDY A;  1K9M C;  1IXR A;  1IBK H;  4TUY F;  3T1H Q;  1M8A A;  2J6T A;  1PZI D;  4B9W A;  4DUY H;  2EYH A;  4MZ9 A;  1V4Y A;  2R7Z A;  1I7L A;  4OIK A;  4YHH H;  1YJW A;  4JBK A;  5D1O A;  5GAD C;  4DR5 L;  2FK3 A;  4GN3 B;  3K58 A;  3JSN A;  5EZY F;  4LF5 Q;  1OXT A;  2F0Q A;  3SGI A;  2UXD H;  2XWB B;  3HOZ H;  3G48 A;  4KN4 C;  3S14 B;  3RGZ A;  3TEH B;  1JWU D;  2HQL A;  1NMG A;  1PZK D;  4P75 A;  4KKU A;  4B3M L;  2B2V C;  2R7F A;  5D1P A;  2ZTE A;  5H80 A;  2O2L D;  1SYF A;  1FL0 A;  1SSO A;  3TP8 A;  4C3I G;  4DF7 A;  2R93 A;  3KXY T;  1MSG A;  1G51 A;  3JZI A;  1KJ8 A;  3K5H A;  1J5E Q;  3GTK H;  1VQD A;  2UUB L;  1EYZ A;  2MPM A;  2F0U A;  1JT8 A;  2BQR A;  1XNR H;  3GIL A;  3PIP 3;  1E1T A;  1B9M A;  4GKK L;  1E4E A;  3GTJ H;  4R8N A;  5IYD H;  3FPP A;  5LMU Q;  5KG1 A;  1LTS D;  4LF8 Q;  4DV0 H;  5I2Y A;  1ASZ A;  5CR3 A;  3S1R B;  4LF9 Q;  3OWF A;  1BCP D;  1ULZ A;  2V1C C;  4ME5 A;  1F9Q A;  1PYW D;  2IPK D;  2VUG A;  2YRW A;  2PMZ B;  5KFF A;  1I7N A;  2V4D A;  3S9W A;  1L2Z A;  3HOZ G;  2E74 C;  4K8J A;  2EY1 A;  3UE1 A;  1PTO H;  3ERO A;  4CKC A;  3N42 B;  5KFG A;  1IOV A;  5KIX A;  2NVY H;  3MWM A;  4GLV B;  5FO9 B;  1QZH A;  4FXK C;  2IBK A;  2TMP A;  1T3N A;  5JVG 3;  1EIF A;  2D0O A;  2PVP A;  3ZYY X;  4N9T A;  1CZW A;  1BGW A;  5KFT A;  5A2Q W;  3CCV A;  1AE3 A;  4RNN A;  2W6O A;  3HP3 A;  4A3K H;  4JI6 Q;  5IWA L;  1JB7 A;  2PN1 A;  4BY1 B;  3DXJ C;  2NUC A;  2WAQ G;  4EX5 A;  1SMX A;  2BQ3 A;  3NXW A;  5CYU A;  5KKN B;  1TWH B;  2E5L Q;  3HOV G;  2DJG C;  3MR2 A;  4EBC A;  5HGT A;  2YRX A;  4FYD A;  4HNV A;  3AQQ A;  2O5I C;  2Z0S A;  2EJF C;  1U4M A;  4R4I A;  4TQS A;  2PZT A;  3V2T A;  1K83 H;  2V4Q A;  1RHP A;  1A15 A;  1WR2 A;  5DLQ E;  4XQQ A;  4YAJ B;  2EJM A;  3OHX C;  4DK3 C;  4LF4 L;  3I3C A;  1ROD A;  1TR5 A;  1WTP A;  2L55 A;  2KJX A;  2JYO A;  1MGS A;  4F7X A;  5BN3 A;  3PV0 A;  4IUU A;  1VQP A;  1G2T A;  3CCR A;  3N8D A;  4UCR A;  5DGB A;  1IZ6 A;  5DG8 A;  2X69 A;  5ELN A;  3BQ0 A;  3AMU A;  1BR9 A;  3ULP A;  2FP4 B;  2G9D A;  4FF3 A;  4BXX H;  2MO1 A;  4DNR B;  3OSP A;  1NTG A;  3OWE B;  1LM0 A;  4C3I B;  5I47 A;  2HUG A;  5J39 A;  1VQ6 A;  1T36 A;  4MTK A;  1PMR A;  2PMZ E;  4ZLT F;  1VMC A;  1KIX A;  4YHH Q;  1GUS A;  2A69 D;  4QF4 A;  1SYC A;  1JDB B;  1BUV T;  1IBL L;  2E2H B;  4O3P A;  2UXD Q;  3A56 A;  3MFY A;  5DM7 3;  4PNY A;  2EYM A;  3GIM A;  1U4L A;  2F0V A;  3AEV A;  4RUA A;  4O3O A;  2UUB H;  1XJV A;  1I6V C;  4XT3 B;  4TVA B;  5C3E H;  5EKI A;  2IHF A;  5F9N A;  4ME6 A;  1JX4 A;  4C5A A;  2K5D A;  4DK1 A;  4GKK H;  3EQL C;  3RR5 A;  1VQO A;  3TQT A;  2K52 A;  3OMG A;  2YU9 H;  3I91 A;  3H0G A;  3M9O B;  4GS3 A;  2N78 A;  1VF5 C;  1LYL A;  3H91 A;  4LW1 A;  1EUD B;  1HCZ A;  3HOZ B;  4JI2 L;  4BWG B;  3ETJ A;  1RK5 A;  1I4H A;  4BXX G;  4IRD A;  5FK9 C;  1JWS D;  2FJZ A;  4DV0 Q;  4YCW A;  2W9A A;  4J9K A;  4LFC H;  3GTK B;  2D2C C;  5D65 A;  2I5L X;  4K2K A;  1K3R A;  3ND8 A;  2IT1 A;  1JOK A;  1J6Q A;  2XVS A;  1N34 L;  2K01 A;  3I8Z A;  1K1S A;  2NU6 B;  1BNC A;  3GTM A;  3Q6S A;  4PG3 A;  1XPR A;  1SMY C;  2J7Z A;  1KXL A;  2Z4H A;  2FLN A;  2WAQ B;  3R5F A;  1BXR A;  1T94 A;  4FU0 A;  1GSO A;  1VQI A;  3NWT A;  2B63 H;  5IWA H;  4BWS C;  3HOV B;  4CC6 A;  1KC8 C;  1PTO B;  4LFA Q;  1K8G A;  3B6Y A;  4MN3 A;  1F9P A;  4A3M G;  5C0X I;  4XQN A;  5E4X A;  3TS0 A;  2GLT A;  5KT3 A;  1A2U A;  2K1B A;  4H0L C;  2CWA A;  1MD2 D;  4KK7 A;  5KG6 A;  3G4S A;  3VR6 A;  4IJH A;  4C2M H;  3D6C A;  1KDB A;  2JXM B;  3I7F A;  5EBC A;  2UXC H;  4ZHQ F;  4LF4 H;  5K5P A;  4DV5 H;  4ZKB B;  2K4K A;  2HVS A;  2BA0 A;  4F4Z A;  3U50 C;  4A3K B;  2FPP B;  2AMC B;  4RMF A;  1KDA A;  2FK2 A;  4EBE A;  1PH6 A;  4O4L F;  2F0I A;  1ILP A;  4IRC A;  4ECQ A;  1F77 A;  3MXN A;  1PTO D;  1EYC A;  4DR5 Q;  4EEQ A;  4LF6 L;  3TP6 A;  1TWF A;  4L8J A;  4IR9 A;  1UE7 A;  3X3M A;  1KQS A;  1B9N A;  3SK6 A;  3KJP A;  2RDJ A;  2F0O A;  4DAY B;  4UP7 A;  2EXD A;  3TBI B;  3H3V H;  3SI8 A;  5KFZ A;  4IUT A;  2EVB A;  4B3M Q;  1Q7Y C;  2RF4 A;  1X3F A;  3M7G A;  1O7I A;  3GTP A;  4DR1 L;  1S68 A;  2KVM A;  3HG9 A;  2WAQ E;  4LUV A;  2UUB Q;  3GTQ H;  2Y0S G;  3D6W A;  2OT2 A;  4DV2 L;  4I7H A;  4JI2 H;  1VMP A;  3HOU G;  4GKK Q;  1MHW C;  2RQX A;  1XMO Q;  4LFB L;  3CQZ H;  5I9O A;  1HZC A;  5HBR B;  3PW7 A;  3OIQ A;  1WCM H;  4HED A;  5IGF A;  3BA9 A;  4YR2 A;  3MWY W;  4YQW A;  3RUZ A;  2G9H D;  4TQR A;  4YR0 A;  4RCO A;  3CPW A;  4F50 A;  1N34 H;  2YS6 A;  3TP7 A;  1ZKO A;  1CI3 M;  2YU9 B;  1RL2 A;  2JP1 A;  2L5T A;  4F8M A;  5IOD A;  3S2H H;  1N8R C;  4DLK A;  3KLS A;  5M5X B;  3I4M G;  1XPU A;  1F2M A;  3K5L A;  2KCM A;  4JV5 L;  2GPS A;  4A3M B;  2F0D A;  1IL8 A;  2CH4 A;  3CC4 A;  1V1P A;  2W6N A;  1GUW A;  3QFF A;  4TV8 F;  4Y8V B;  3GV7 B;  2FXQ A;  2M00 A;  2EYJ A;  3NPP A;  4DAP A;  3SR1 A;  1N36 L;  2PYK A;  1D1I A;  3D8G A;  5FJ8 G;  3JSL A;  1S5D D;  5FD6 A;  1N32 H;  1WCM G;  1SLJ A;  4JI5 L;  5IWA Q;  1TWG H;  4RGT A;  1X54 A;  3LNN A;  4FP5 D;  4IFD G;  3J80 L;  1D7Q A;  3OHA A;  2FHT A;  1Y1W A;  2MUY A;  3DEO A;  2E2D C;  4JI7 Q;  3PIO A;  3Q24 A;  1QCB D;  2QIL A;  4QMG A;  1TS5 A;  2J6S A;  1Y69 U;  3V96 A;  1EY5 A;  1JOO A;  2B63 B;  2EDG A;  4X66 L;  1I3Q A;  1DOL A;  3NUC A;  2FIN B;  4DR7 H;  2OCE A;  3K5I A;  2K6A A;  2CHB D;  3PCO B;  4ZUJ A;  2R7Z H;  4LF4 Q;  1ESF A;  5CGK A;  4JV1 A;  4JI1 L;  5A2Q L;  1Q1B A;  1QOH A;  3R93 A;  1RK6 A;  4C3H G;  3KDF B;  1B6R A;  3BYT B;  4MV3 A;  4UCO A;  4C2M B;  2QDB A;  2ASJ A;  3KF8 B;  3PUZ A;  3TME A;  4YWK A;  4DL2 A;  1E2Z A;  2Y0S B;  2R93 H;  1IBL Q;  3FP9 A;  4JI0 L;  3HOU B;  4V19 0;  3N6X A;  4RB2 C;  5LMN H;  2G5D A;  4WJW A;  5LL6 X;  4NDX A;  1XDN A;  3A5Z B;  3M9M B;  2FFK B;  3ONA B;  3OIP A;  1XNQ Q;  3KF6 B;  4LMY A;  2IX3 A; 
#chains in the Genus database with same CATH homology
 5K36 G;  2JEA I;  2JA9 A;  1IBM Q;  1HNW Q;  4LF7 L;  3UDF A;  1TXY A;  3CXC A;  4BBS H;  2CFM A;  3GTL H;  2NN6 G;  4P73 A;  3J7Z C;  3F2B A;  5IY0 A;  1HNZ Q;  2R7Z G;  3M7N A;  3NEM A;  1U0L A;  4JI6 L;  2KHI A;  5C4X G;  4IPD A;  1WYD A;  4JI2 Q;  1U5K A;  2D62 A;  4X64 L;  4XIG S;  1NJI C;  5M3F G;  2RCN A;  2WFW A;  1YHB A;  5IT9 c;  2I0Q A;  4YCU A;  4GNX C;  3PUW A;  4IFD J;  1FJG L;  2E5L L;  4JYA Q;  4DR7 L;  3CME A;  5JEA J;  1CKM A;  3HKZ E;  2B63 G;  4YWL A;  1T9H A;  5GAG C;  1OXS C;  3GTG H;  3S16 H;  1XMO L;  4QIW E;  4UP8 A;  2JA8 H;  4DNI A;  3KDF A;  1JJC B;  3LGJ A;  3KJO A;  1N34 Q;  2F4V L;  4GOP B;  1TWF H;  4O0A A;  1QVG A;  2JA5 G;  3F2C A;  3ICE A;  3ULL A;  4HIO A;  1B8A A;  4A3L G;  2R92 G;  4YWM A;  1PH2 A;  3AFQ A;  4IPH A;  1NE3 A;  4P72 A;  2NZO A;  3HOV H;  2JJQ A;  1L1O C;  2B29 A;  3I55 A;  1IBK L;  1A62 A;  2GVA A;  2KBN A;  3RN5 A;  4JOI C;  4JBW A;  5IYB H;  1WJJ A;  2UUA L;  1KD1 C;  1QUQ B;  5LMN L;  1I94 L;  4X62 L;  3KF6 A;  2VS1 A;  2KHJ A;  4YHH L;  2NVQ H;  4X65 L;  4A75 A;  2JQO A;  2VL6 A;  4KHZ A;  4A4I A;  2Y0S E;  4DV4 Q;  4OWW B;  3KLW A;  3CCQ A;  4NXN L;  1R9T H;  2UXD L;  3S1R H;  4OWT B;  3S2D H;  2L15 A;  3UDX A;  3F1Z A;  3K0X A;  2HIX A;  4PZ8 A;  1Z47 A;  3IRB A;  4DV1 L;  1PH8 A;  1GM5 A;  4BA2 I;  4GKJ Q;  1E3P A;  5IYC G;  3AYH B;  2JK8 A;  4QGU A;  3H3V I;  2XTI A;  3PUY A;  2JA7 H;  4KHP Q;  1X9N A;  1UE6 A;  2D0P A;  1X3G A;  4B3S L;  4K0K L;  4JI7 L;  1RIP A;  4DR2 L;  4LFC Q;  5M3M H;  2UUC L;  1QVC A;  2BH2 A;  3PIP A;  1VQJ A;  3E0E A;  4GOP A;  2I5H A;  2ASB A;  3K7A H;  2YTV A;  2NZH A;  5HY6 A;  2VY3 A;  4AH6 A;  1W3S A;  3EN2 A;  1P16 A;  5M5W H;  2KEN A;  4DV0 L;  1VQK A;  4LF6 Q;  3M3Y H;  1PH4 A;  3W1B A;  1VQC A;  2MNA A;  4HID A;  1V1Q A;  1PFS A;  5AJ3 L;  4BY1 H;  3K8A A;  4BA1 I;  1H95 A;  1X55 A;  4HIK A;  1KHI A;  2PI2 E;  3PO3 H;  4IFD I;  4DV7 Q;  1QUQ A;  1YHQ A;  3PF4 A;  3ER0 A;  1VQH A;  4GLA C;  4AIM A;  3OYY A;  4GN5 A;  1TWH H;  1IYJ B;  5IP9 H;  3H0G H;  1VQN A;  4J15 A;  1YJ9 A;  4DPG A;  4DR1 Q;  1VQ7 A;  1WFQ A;  1VQM A;  1E22 A;  2R6G A;  2JA7 G;  4X6A H;  3DLL A;  1N9W A;  1BKB A;  4DV2 Q;  3U4Z A;  1XMQ L;  2UU9 L;  3H15 A;  3CCU A;  1VQG A;  4A3B H;  2HHH Q;  4A3C H;  4B3T Q;  3OTO Q;  3JAM i;  2OQ0 A;  4LFA L;  4LFB Q;  5M3M G;  3TRZ A;  1I3Q H;  2A1A A;  1L0W A;  3D31 A;  3F2D A;  1JMC A;  1SFO H;  5BR8 Q;  1EQR A;  3FHW A;  2K14 A;  4AYB E;  1XNQ L;  2VUM G;  3HOW H;  3HOY H;  2UXC Q;  1VQB A;  1L2F A;  4DUZ Q;  3KYH C;  3W1G A;  4DV5 Q;  4HJ7 A;  1HNW L;  1W2B A;  2ES2 A;  4C3I H;  3D0F A;  1KRT A;  3GTM H;  1G6P A;  1Q12 A;  1YEZ A;  3CF5 A;  5M5X H;  4BY1 G;  1EIY B;  4IJL A;  1VQL A;  4DV6 L;  2BA1 A;  3PO3 G;  3JAM c;  3K81 C;  2HIV A;  2C35 B;  3HFZ B;  4A3M H;  3FKI H;  2VQE L;  2ZJR A;  5C44 H;  3H0G G;  2VQF Q;  1MJE A;  2IY5 B;  3ERS X;  1JE5 A;  1V43 A;  1VQE A;  3UDI A;  3VDY A;  1IXR A;  1PHJ A;  1K9M C;  3RZO H;  3T1H Q;  4JV5 Q;  3M4P A;  3RZD H;  1CSP A;  1X3E A;  4NPS A;  1OXV A;  4MZ9 A;  1EFW A;  4A3C G;  4B3R L;  3J81 c;  1Y1V H;  4A3B G;  1G29 1;  1YJW A;  4JBK A;  1N36 Q;  5GAD C;  4L5S A;  2Q2I A;  4DR5 L;  3BJU A;  4GN3 B;  2ZM6 L;  1A63 A;  2NN6 I;  4NB3 A;  4LF5 Q;  2N3S A;  4A93 G;  1OXT A;  1I50 H;  3SGI A;  4JI5 Q;  4R1J A;  4JI3 L;  5EAY A;  2PQA B;  2ZTD A;  5E7N A;  3HOY G;  3HOZ H;  3G48 A;  4DR4 L;  1PA6 A;  2YTX A;  3I4N H;  3TEH B;  4P75 A;  2HQL A;  1NMG A;  2Q2H A;  1GO3 E;  4B3M L;  1C7Y A;  2R7F A;  3JC6 6;  2ZTE A;  4AQY Q;  1FL0 A;  3AFP A;  4JC0 A;  4OXP A;  3L7Z C;  3CCE A;  1G51 A;  1NMF A;  1Z9F A;  2VW9 A;  1UEB A;  3TQY A;  1J5E Q;  3GTK H;  4Y52 H;  3U58 A;  1VQD A;  4X66 Q;  4LUZ A;  2UUB L;  4NXM L;  1JT8 A;  3PUV A;  3M4Q A;  5FLM H;  4UY8 C;  1HNX Q;  3FKI G;  2NVT H;  4A3G G;  1E1T A;  4GKK L;  1HR0 Q;  3GTJ H;  1Q1E A;  1MKH A;  4JCV E;  4DR6 Q;  5IYD H;  1OXU A;  2R93 G;  5LMU Q;  4DR3 L;  3CCJ A;  3RNU A;  4JI1 Q;  5C0X G;  5GAE C;  4LF8 Q;  1N33 Q;  1KRS A;  3CCL A;  1YZ6 A;  2XGT A;  4LF9 Q;  1ASZ A;  4L5R C;  1VS0 A;  1HJP A;  2V1C C;  3ULJ A;  1Q82 C;  3S1M H;  1YNX A;  4JBM A;  2AKW B;  3GTO H;  3BU2 A;  1XPO A;  4OX9 L;  3HOU H;  3HOZ G;  2OTJ A;  1AH9 A;  4BBS G;  3UE1 A;  4PZ7 A;  1E24 A;  3NEL A;  2GN5 A;  3HKZ G;  4YCV A;  4GNX B;  4DUY L;  1K8A C;  4POG A;  3I4N G;  3A5U A;  3K80 C;  3GTP H;  2NVY H;  3G6E A;  4HJA A;  4GLV B;  1QZH A;  3NBH B;  2ZTC A;  5ELO A;  2AWO A;  2PQA A;  2GVB A;  1N32 Q;  1EIF A;  4DV3 L;  2D0O A;  2DGY A;  3I56 A;  4A3E H;  2IX0 A;  3A74 A;  1MJC A;  5JJL A;  1MIU A;  4PMW A;  3CCV A;  1M1K C;  4LF7 Q;  1AE3 A;  2JA8 G;  1FVI A;  3MEF A;  4A3K H;  4JI6 Q;  2JA6 H;  5IWA L;  1JB7 A;  1L1O B;  3I4M H;  4X64 Q;  3GO5 A;  2WAQ G;  2WB1 E;  4EX5 A;  1SMX A;  1K0R A;  2Z6K A;  1S72 A;  4LWC A;  2E8G A;  1YJN A;  1XNR L;  3ZJY C;  1VQ4 A;  2E5L Q;  3HOV G;  4DR7 Q;  3UE0 A;  4JI8 L;  3E9H A;  1YIT A;  1CKN B;  2CQO A;  1ASY A;  4B3T L;  4C3J H;  5IYB G;  3AQQ A;  2K75 A;  1FGU A;  2Z0S A;  5FJ8 H;  4R4I A;  1X65 A;  2I5M X;  1PH5 A;  1K83 H;  3G71 A;  1GD7 A;  2K5N A;  4R4Q A;  2R7D A;  5IP7 H;  5DLQ E;  3STB C;  2A19 A;  1X6O A;  1BVS A;  4DK3 C;  5IE8 A;  4YY3 L;  5HGQ A;  4LF4 L;  3PSI A;  4JI4 L;  4GN4 B;  1PH3 A;  4GNX A;  5GQO A;  3PV0 A;  1VQP A;  3CCR A;  1IZ6 A;  5C0X J;  5ELN A;  2UXB L;  3ULP A;  4BXX H;  2MO1 A;  2UUA Q;  4IOA A;  1NTG A;  1LM0 A;  3PF5 A;  3J81 j;  5LMN Q;  1VQ6 A;  1Y1W H;  3TRE A;  4X62 Q;  2PMZ E;  1Q81 C;  4Y7N H;  4YHH Q;  2OQK A;  5FLX c;  1KIX A;  2VQF L;  1AE2 A;  2H5X A;  4X65 Q;  3S1Q H;  3KFU A;  4ALP A;  1IBL L;  1LTL A;  4DKA C;  4NXN Q;  1NBW A;  1SN8 A;  2MQH A;  3U4V A;  3J7A 5;  1UWV A;  1SRU A;  2UXD Q;  3AEV A;  1L1O A;  4H02 A;  1XJV A;  4C3H H;  4TVA B;  5C3E H;  4JOI A;  2IHF A;  5C4J H;  4LF5 L;  1QVF A;  3RR5 A;  1VQO A;  2WP8 J;  3S1N H;  2K52 A;  3DM3 A;  5IP7 G;  2YU9 H;  4WJ4 A;  1IBM L;  1I6H H;  4KI0 A;  4IO9 A;  4GS3 A;  1GKH A;  3J81 i;  1HNZ L;  5JEA G;  1HZA A;  2N78 A;  1CKN A;  1LYL A;  2CKZ B;  4LW1 A;  4B3S Q;  4K0K Q;  4DR2 Q;  4XTC S;  2IHE A;  4JI2 L;  1HZB A;  3EIV A;  2UUC Q;  1C9O A;  3L0O A;  3CMA A;  4HJ9 A;  4MTN A;  4WJ3 M;  2ATW A;  5IP9 G;  4BXX G;  4UPA A;  1J5E L;  4BBR H;  2YYZ A;  1NY4 A;  4JG2 A;  4AYB G;  1BBU A;  4JYA L;  4JBJ A;  1Y1W G;  4DV0 Q;  4YCW A;  1LUZ A;  1E1O A;  3CCS A;  2K50 A;  4DR6 L;  2I5L X;  1K3R A;  2QA4 A;  3PO2 H;  5AJ3 Q;  2IT1 A;  5LMU L;  2LSS A;  1J6Q A;  1N34 L;  4RG1 A;  1DGS A;  3RLN A;  5J3B A;  3M85 A;  1VQ8 A;  1PH9 A;  2YTY A;  4HJ5 A;  4R4C A;  3MXN B;  1OXX K;  1YVC A;  4QY7 A;  4PG3 A;  1XPR A;  3HOW G;  1KXL A;  1OTC A;  3BZC A;  1VQI A;  1VQF A;  2AWN A;  2B63 H;  2BH8 A;  3M9B A;  2K5H A;  2UU9 Q;  1VQ5 A;  3T1Y Q;  3CP0 A;  1KC8 C;  2F3I A;  4LFA Q;  4FDB A;  1K8G A;  4HJ8 A;  3B6Y A;  4A3M G;  3TS2 A;  1HH2 P;  2KCT A;  5GRO A;  1B7Y B;  1D8L A;  3OW2 A;  5C0X I;  2JA5 H;  5M5Y H;  5C44 G;  1X56 A;  3W5O A;  4BBR G;  4DV4 L;  3TS0 A;  2R92 H;  4A3L H;  2A8V A;  4IPC A;  3S17 H;  2MFI A;  5JJK A;  2CWA A;  4GOP C;  2ID0 A;  3G4S A;  1E7Z A;  4IJH A;  3PO2 G;  1A8V A;  1Y1V G;  4C2M H;  3I7F A;  3CC2 A;  4GKJ L;  1PV4 A;  4L5Q A;  2OTL A;  3M4O H;  1TWC H;  4DV6 Q;  3CCM A;  4KHP L;  4A3D H;  2K4K A;  2VZA A;  2BA0 A;  3U50 C;  1P8L A;  2AMC B;  4TQU S;  2VQE Q;  4RMF A;  2IX1 A;  4UP9 A;  1PH6 A;  1Q8K A;  4LFC L;  2MO0 A;  4IPG A;  3Q8D A;  4JI0 Q;  2EIF A;  1IL2 A;  4B3R Q;  1V9P A;  4OON A;  2K5V A;  2E2J H;  4HIM A;  5IYC H;  4DR5 Q;  2ALY B;  4LF6 L;  4APV A;  2RHQ B;  1HR0 W;  2ZM6 Q;  3S14 H;  1UE7 A;  5FLM G;  1KQS A;  4R4O A;  3KJP A;  4JI3 Q;  4DAY B;  1PH7 A;  3CAM A;  3RN2 A;  1YBY A;  2EXD A;  4UP7 A;  5IYD G;  3H3V H;  1CSQ A;  4DR4 Q;  3S15 H;  4DV7 L;  4B3M Q;  4LUO A;  4QQB X;  4A3I H;  1Q7Y C;  2RF4 A;  1X3F A;  1TWA H;  1PVO A;  4A3F H;  1O7I A;  1WOC A;  4DR1 L;  2DUD A;  1EOV A;  2WAQ E;  1CKO A;  4LUV A;  2UUB Q;  4A3D G;  2PNH A;  1FJG Q;  4NXM Q;  2Y0S G;  3GTQ H;  1HZ9 A;  1S3O A;  1SE8 A;  4DV2 L;  1M90 C;  3HOU G;  2HHH L;  5H1S E;  1JJ2 A;  4GKK Q;  1EWI A;  3OTO L;  1XMO Q;  4LFB L;  3CQZ H;  2QEX A;  4DR3 Q;  1HZC A;  3WWV A;  1WCM H;  5BR8 L;  2ZJQ A;  2F4V Q;  4POF A;  1WI5 A;  4R4T A;  2UXC L;  2CCZ A;  4DUZ L;  3J80 i;  1A0I A;  1XTD A;  2EQS A;  4DV5 L;  2WB1 G;  3K7U C;  1PYS B;  3CPW A;  2LXJ A;  3BZK A;  4A3E G;  1CUK A;  1VCI A;  2RHS B;  3PGZ A;  4BY7 H;  4OX9 Q;  2HT1 A;  1KL9 A;  1RL2 A;  1IBK Q;  4DUY Q;  3L2P A;  4EQ5 A;  4A3K G;  1N8R C;  3S2H H;  2PI2 A;  1Q46 A;  3RLF A;  1I94 Q;  2JA6 G;  2YV5 A;  4OWX B;  3F8T A;  4A3I G;  4A3J H;  3UDG A;  3I4M G;  5JJI A;  1XPU A;  4A3F G;  2VUM H;  1SR3 A;  1BBW A;  1KAW A;  4DAM A;  2KCM A;  4JV5 L;  3J80 c;  3T1H L;  4DV3 Q;  3CC4 A;  1YIJ A;  2FXQ A;  1S40 A;  2JE6 I;  3NEN A;  2E2I H;  4LNQ A;  1N36 L;  5FJ8 G;  4DV1 Q;  3CW2 C;  4A76 A;  1WCM G;  1SLJ A;  3KOJ A;  4JI5 L;  2AHO B;  1TWG H;  5IWA Q;  1X54 A;  3CPF A;  1EUJ A;  4IFD G;  1JJG A;  1D7Q A;  4QL5 A;  1GVP A;  1Y14 B;  1XNR Q;  4JI7 Q;  3PIO A;  4AQY L;  3HKS A;  1UE5 A;  4BY7 G;  4JI8 Q;  5LMN W;  4L5T A;  3T1Y L;  1B70 B;  1SRO A;  2Q2U A;  4KLK A;  4QJF A;  3GD7 A;  4X66 L;  3HOX H;  1YHA A;  4PZ6 A;  4A3J G;  4A93 H;  1HNX L;  2OCE A;  4O2D A;  4DK6 C;  1HR0 L;  3EBE A;  3PCO B;  4YY3 Q;  2NVX H;  3STB D;  4LF4 Q;  2R7Z H;  2VNU D;  2JEB I;  4JI1 L;  1PYB A;  3PUX A;  2CWP A;  1Q1B A;  4IOC A;  5C4X H;  1YI2 A;  4JI4 Q;  4LF8 L;  1N33 L;  1K73 C;  3I4O A;  4LF9 L;  1UE1 A;  4P74 A;  2F52 A;  4OO1 I;  2OWO A;  2UXB Q;  3E9I A;  5M3F H;  3KDF B;  5C3E G;  1PH1 A;  1I5F A;  2Q2T A;  3A0J A;  2LXK A;  1VQA A;  4ME3 A;  4OO1 G;  3KF8 B;  3PUZ A;  4A3G H;  2E2H H;  4YWK A;  1Q86 C;  3CD6 A;  1QZG A;  3RLO A;  3S24 A;  1XMQ Q;  2ZJP A;  2R93 H;  1VQ9 A;  1IBL Q;  4MNO A;  3FP9 A;  4JI0 L;  1EQQ A;  2QGQ A;  5GAH C;  3A5Z B;  1EYG A;  2Z6K C;  3GDE A;  1C0A A;  3I2Z A;  3CC7 A;  1XNQ Q;  1N32 L;  2N8N A;  3KF6 B;  4P71 A;  3HOX G;  2N49 A;  2B3G A;  4GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...