4BY1G

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by1G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by1G01
1V9PA 3ULPA 3ZJYC 3J81i 1WI5A 2F4VL 1QZGA 1KL9A 5JJIA 2CWAA 4GOPC 1KQSA 3HOVG 3MXNB 4JI3L 1Y1VG 4B3SL 1MIUA 3J80i 3GDEA 2ZM6L 2VQFL 3G71A 1QVFA 2E2IH 4OWWB 3K80C 4JG2A 4K0KQ 1HZ9A 2OWOA 1V1QA 3J80c 2JEAI 4GLVB 2Z6KA 3CC7A 4BA1I 4FDBA 1HNWL 3I56A 1J6QA 3S1RH 3EN2A 4DPGA 1Q81C 2V1CC 5IYCH 3CD6A 2VZAA 1UE6A 4HIKA 4OX9Q 2WFWA 4IJHA 2A19A 3UDGA 1K73C 2JA7H 4YWMA 1G51A 1AE3A 1OXTA 1VQCA 4GN3B 3RR5A 3CCEA 4B3TQ 5LMNQ 4JI7L 3F8TA 2F52A 1JB7A 3U50C 3E9IA 4TQUS 1CUKA 4DV2L 4IFDJ 1JT8A 2NZHA 4AH6A 4NXNQ 2B63G 2AHOB 1NTGA 1A63A 5C3EH 4NPSA 3I4NH 3UE1A 4DV0L 2E5LQ 5C4XH 5IYBH 3I4MG 4IFDG 1VQMA 3PUZA 1PVOA 1K83H 3AFQA 3JC66 4X66Q 1TWFH 3FKIG 1VS0A 4ME3A 1X3EA 2DGYA 2YTYA 4P71A 3KJPA 1SMXA 4GLAC 1AE2A 4A4IA 4IPDA 4BBRG 2HT1A 4NXMQ 5JJKA 5C0XG 4Y7NH 4GKKL 4JI5Q 3CCVA 3CAMA 3HKSA 3W5OA 4X62Q 3MEFA 1S72A 4BBSH 5HY6A 3TRZA 3NEMA 3PIOA 4DV5L 3S1QH 4A93G 2LSSA 5ELNA 4DUZL 5FJ8H 1LM0A 1Y1WG 4DR3Q 4OX9L 3HOWG 3HKZE 1HJPA 3G6EA 1V43A 4A3JG 4OO1G 2NVYH 2RF4A 3K7AH 4OWTB 4X64Q 2UU9Q 1GD7A 1QUQB 1VQ9A 5LMNL 4UP8A 3ER0A 5GAGC 2K14A 1UE7A 3GO5A 1Q1EA 4JI1Q 4HJ8A 1AH9A 4EQ5A 3DM3A 4QIWE 3GTJH 2EXDA 2QEXA 3A0JA 2ZJPA 1VQ6A 1GM5A 2R7ZG 1W3SA 5J3BA 1VCIA 2IX0A 2HIVA 3PGZA 2K75A 2UXCQ 2IY5B 1L1OB 3PUVA 5IWAQ 3S15H 4DR5L 1HNWQ 4X66L 3AYHB 3CXCA 1N36Q 3K81C 4O2DA 3S2DH 3WWVA 4L5SA 1VQ4A 2ZTEA 3S14H 3Q8DA 4GS3A 2Q2UA 4NXML 2K52A 2KENA 3TS2A 4JI5L 2E2JH 4X62L 4R4OA 3CC4A 3KOJA 5BR8Q 5IP9G 5C44H 3NBHB 1E24A 1I6HH 1KHIA 1S40A 4HIMA 2UXBQ 4JOIC 1QVGA 2JA6G 1Y14B 1WOCA 1YJ9A 4LF5Q 4A3BH 1I50H 2PI2A 4J15A 4DK6C 1NJIC 2R92H 4HIOA 3CMAA 2MO1A 1VQIA 2F3IA 2YTXA 1YHBA 4A76A 1XNQQ 2CCZA 2NZOA 2E2HH 3S16H 3RZDH 3ULJA 1NMGA 3A5ZB 2CKZB 3G4SA 1ASYA 4L5RC 2CFMA 1OXXK 4GNXB 1HNZQ 1D7QA 2NN6G 2UUCQ 5IP7H 1QVCA 1VQGA 4JBKA 4JI4L 4DV7Q 4YY3Q 1PFSA 4YCUA 5C3EG 2AMCB 1N33L 2UXCL 2N8NA 5GAEC 3S24A 5IWAL 1WYDA 4C3HH 5IT9c 1TWCH 5IYBG 4IOCA 1VQ7A 4B3MQ 3I2ZA 5JEAJ 1Y1WH 3HOWH 1N34Q 3JAMi 2A1AA 1XMOL 4DV4Q 3GTOH 4DR4Q 3UE0A 4A3JH 1HR0Q 4JBJA 3H15A 3E9HA 4JI8L 2ES2A 4ALPA 2KHIA 3E0EA 3JAMc 5BR8L 4GOPA 3KDFA 1YITA 1YNXA 1KRTA 3OW2A 2UXBL 1LTLA 3TEHB 4POGA 4LF5L 2N3SA 4BA2I 3RLFA 2JK8A 2R7ZH 3AFPA 1PH7A 1XPUA 1HZCA 1PV4A 1JE5A 4JC0A 4YWLA 1K8AC 1CSQA 2A8VA 4X6AH 4P73A 3L7ZC 1XNQL 3I4OA 5IY0A 3F2CA 4DR1Q 1I5FA 1HNZL 3U4VA 4BY7G 2PQAB 2UUCL 3M3YH 1W2BA 2KCTA 4R4IA 2YV5A 4DV7L 2N78A 2L15A 5E7NA 4DV3L 3K0XA 4L5QA 4A3EG 4DR6Q 2K4KA 3M4OH 4HIDA 5IP9H 2UXDQ 1EOVA 2ID0A 1HZBA 1CKOA 4B3ML 2VNUD 1TWAH 4AIMA 4A75A 3IRBA 3PUYA 4YWKA 3DLLA 1E3PA 5FLMG 3RNUA 2JA6H 4HJAA 1N34L 1CSPA 1K8GA 5EAYA 4DR4L 3M4QA 1K0RA 1UE5A 2CWPA 2Y0SE 2YTVA 4Y52H 2NVXH 4LF4Q 4RMFA 4JBMA 4POFA 1X65A 1N8RC 4NB3A 4H02A 1SRUA 4LW1A 3PCOB 1RL2A 2D0OA 4MTNA 5C44G 3TS0A 1PH3A 1YJWA 2ALYB 4PZ6A 3RN2A 2Y0SG 1X3GA 1L0WA 2VQEL 3STBC 4LF6Q 4LFCL 3BU2A 4A3BG 3U4ZA 1VQOA 3D0FA 4JV5Q 1CKMA 1L1OC 2R92G 4OWXB 1NY4A 3F2DA 4BY1G 3L2PA 1NMFA 2IT1A 4P74A 5AJ3Q 4JYAQ 1I94Q 1NE3A 3CCSA 4LFBQ 2LXKA 3CPWA 3GTQH 3ULLA 2XTIA 4P75A 3GTPH 2R7FA 4R4QA 3UDIA 3GTLH 3L0OA 1C9OA 1A62A 2B3GA 2QGQA 3NENA 4UP9A 5IP7G 2XGTA 4HJ7A 1ASZA 1KAWA 2UXDL 1JJCB 4TVAB 1EUJA 1T9HA 1E7ZA 1DGSA 1SE8A 2I5HA 2K5HA 1YHAA 1KRSA 3M4PA 1Z9FA 2Q2HA 4PMWA 4AQYQ 1IBKQ 2RHSB 4QGUA 4LFAQ 3CCUA 5GQOA 5JJLA 1WJJA 2JQOA 4QL5A 2I0QA 4LF4L 4LUVA 4GLXA 1IZ6A 2BH8A 1U5KA 5JEAG 3S1NH 4B3TL 4GNXC 1K3RA 1YIJA 4BY7H 1PHJA 1XJVA 1SLJA 3BJUA 3HKZG 3CCLA 4NXNL 1OXVA 5C0XI 1OTCA 1KD1C 4LF7Q 4A3EH 4JV5L 2EIFA 3KFUA 2E5LL 3M7NA 4LF8Q 5M5XH 3J7A5 1R9TH 1EIFA 4JOIA 3HFZB 2WAQE 5AJ3L 1I94L 5FLMH 1FJGQ 3EBEA 1XNRQ 2JA9A 4LFBL 2GVAA 4A3KG 1VQLA 4A3LG 3KYHC 1CKNA 1NBWA 2JEBI 2I5MX 1VQ5A 1E1TA 3UDXA 4JYAL 5IYDG 4OO1I 1M90C 4O0AA 4LNQA 3FP9A 2C35B 1SN8A 2PQAA 3CPFA 3CCMA 1WFQA 2WAQG 1S3OA 4YHHQ 2VL6A 1X54A 1HZAA 3PUWA 1PH1A 1IBKL 1UEBA 2YYZA 1I3QH 2D62A 2NVTH 1SR3A 1VQEA 4PZ7A 4DR3L 4GKJQ 1PH9A 4X64L 2UU9L 1Q7YC 4BY1H 4DV6Q 4LF9Q 1VQJA 1JJGA 3S1MH 4DAMA 2AWOA 3VDYA 4APVA 4P72A 1B7YB 1PH5A 2I5LX 1BBUA 4LF7L 4JI1L 4UY8C 2LXJA 2VS1A 3W1BA 3KF8B 4LUZA 1A8VA 3FHWA 1VQKA 2HHHQ 3H0GH 3I55A 1EQQA 1BVSA 1O7IA 1N36L 2H5XA 4YCWA 4KI0A 3T1HQ 1XPRA 4X65Q 1GKHA 2B29A 4IJLA 4JCVE 3RZOH 4JBWA 1PYBA 2ZJQA 4UP7A 3PO2G 1N9WA 3LGJA 4YHHL 2IHFA 3PSIA 1Q86C 1SFOH 1X55A 2NN6I 4XTCS 4R4CA 2MQHA 1P16A 3F1ZA 2JE6I 1MJCA 3CCRA 4KHPQ 4RG1A 2WP8J 2ZM6Q 4DUYQ 4IFDI 3ICEA 4DV6L 1Q46A 2CQOA 4LF9L 1D8LA 4OXPA 3PO2H 4PZ8A 4DR7Q 4A3DH 4C3JH 4B3RQ 5DLQE 2YU9H 2VUMG 2R7DA 1YJNA 4A3KH 1J5EQ 4A3LH 1VQPA 3M85A 2QA4A 1IBLQ 2UUBQ 1QUQA 5GADC 1VQ8A 1X6OA 5IYDH 3STBD 1K9MC 1YBYA 2BA1A 2PI2E 1VQAA 1EIYB 4WJ3M 3PUXA 4YY3L 3GD7A 3TQYA 2ZTCA 3A74A 4A3FH 2HHHL 1X3FA 3AQQA 1QZHA 3T1HL 4X65L 4QJFA 5GAHC 3GTKH 2JA8H 3RLOA 4DV4L 1FGUA 2IHEA 4A3IG 1L1OA 1SROA 3PV0A 1VQNA 5M3FG 3BZCA 1HR0L 4DV0Q 4IO9A 4C3IH 4A3MG 5LMNW 1WCMH 3UDFA 2JA5H 4HJ5A 1PYSB 3B6YA 1XMQQ 1EYGA 1EFWA 1GVPA 1U0LA 3HOZH 4WJ4A 1E22A 1HH2P 4KHPL 3HOXG 3HOUG 4IPGA 5M5YH 3J81c 3KF6B 4DUYL 4KHZA 2WB1E 3H3VH 2JJQA 4GKKQ 1YI2A 4B3RL 3U58A 4DR7L 2AKWB 1A0IA 3BZKA 3OTOQ 1J5EL 2VY3A 4DV5Q 4DR1L 1TWGH 1IBLL 1B70B 2UUAQ 2UUBL 4DUZQ 2OTJA 4IPCA 3KJOA 1KIXA 4BXXH 2WB1G 1UWVA 3CW2C 2Z0SA 3I7FA 3CCJA 1X9NA 2HQLA 1TWHH 3PO3H 5M3MH 4GNXA 4DR6L 1VQDA 2R93G 5HGQA 4A3GG 3K8AA 3SGIA 3G48A 1IXRA 2RHQB 4OONA 1Z47A 3H0GG 2Z6KC 3M9BA 3A5UA 1HNXQ 4R4TA 2OQKA 1OXSC 3S2HH 3EIVA 1XMQL 2RCNA 4GN4B 2VUMH 1IL2A 1Q8KA 4DR5Q 1YEZA 1MKHA 1FL0A 3HOYG 1KXLA 4R1JA 1G291 4GOPB 1C7YA 4DR2Q 1YZ6A 4LF6L 3KDFB 1P8LA 4A3CH 4K0KL 2KBNA 5IE8A 3S17H 4C2MH 1RIPA 1PH4A 1JMCA 3CQZH 3OTOL 1JJ2A 1FVIA 4A3DG 1XTDA 5LMUQ 2NVQH 3RN5A 4UPAA 2UUAL 3CC2A 4IPHA 4JI6Q 4JI0Q 2HIXA 3ERSX 1B8AA 4A3IH 1XPOA 4PG3A 1MJEA 5M3FH 4A3MH 2GVBA 3D31A 1EWIA 4HJ9A 4JI2Q 3CCQA 4DV1Q 2OCEA 2K5VA 1M1KC 4MNOA 2K5NA 4AQYL 2K50A 4A3FG 1PH8A 3HOVH 1H95A 1LUZA 5H1SE 3AEVA 3HOXH 1Y1VH 4LFAL 3HOUH 1HNXL 1VQHA 4KLKA 2JA8G 2EQSA 4JI4Q 1C0AA 2MFIA 5C4JH 1N33Q 1GO3E 2MO0A 1WCMG 2JA5G 4LWCA 4QQBX 1N32Q 3HOZG 1IBMQ 5K36G 1TXYA 2ZTDA 1VQFA 1LYLA 4DR2L 4YCVA 1XMOQ 3J7ZC 2ZJRA 3CP0A 2Q2TA 1PA6A 2N49A 2GN5A 4LF8L 2R93H 4A3GH 4JI8Q 4MZ9A 4EX5A 3T1YQ 1IYJB 1FJGL 1EQRA 1X56A 3KF6A 1XNRL 5LMUL 5M5WH 1Q82C 3W1GA 1E1OA 3CMEA 4JI6L 4JI0L 2B63H 2ATWA 1HR0W 2OQ0A 3PF5A 5IYCG 4IOAA 4BXXG 1PH2A 3PF4A 2Q2IA 3NELA 4DNIA 4DV1L 4JI2L 3I4MH 2JA7G 3PO3G 5M3MG 3HOYH 3FKIH 5C0XJ 2F4VQ 1PH6A 2IX1A 4L5TA 3RLNA 2PMZE 4JI3Q 3GTGH 4BBRH 5ELOA 4B3SQ 4GKJL 3H3VI 4DKAC 2PNHA 4QY7A 1Q1BA 4DV3Q 3I4NG 2VQFQ 4DAYB 3TREA 3PIPA 3KLWA 5C4XG 1N32L 1BKBA 1YVCA 1IBML 4A93H 1UE1A 4AYBE 1G6PA 2DUDA 3F2BA 2R6GA 5GROA 5FLXc 1OXUA 2ASBA 4LUOA 1L2FA 3T1YL 4A3CG 1KC8C 3J81j 4AYBG 2KHJA 1VQBA 4JI7Q 2D0PA 2KCMA 4XIGS 4BBSG 4GN5A 3CF5A 2VQEQ 4DV2Q 2OTLA 2FXQA 5FJ8G 2E8GA 3K7UC 4LFCQ 3OYYA 2MNAA 1Q12A 2BH2A 2BA0A 1BBWA 1CKNB 2AWNA 1YHQA 3GTMH 2VW9A 4DK3C
chains in the Genus database with same CATH superfamily
1V9PA 3PW0A 3J81i 5K36H 5JJIA 1KL9A 1SFOA 2CWAA 4GOPC 2FINB 1MZBA 4Y7NB 1Y1VG 1GSHA 3GDEA 1YNNC 2R7LA 5LL6b 2Z8LA 1T36A 5L1KA 3S1QB 4IUNA 4K0KQ 2NVQB 4O2AF 4JI1H 5L9XA 4FDBA 2YU9A 4DFAA 4DPGA 4L8JA 2V1CC 1GYFA 5AFWA 1N36H 3UDGA 2JEJA 1D1IA 2WV6D 4GN3B 4WFN3 3RR5A 3CCEA 3BQ1A 4I7ZC 5CYUA 4DV2L 2XNAC 5C3EH 1PTOB 4NPSA 2XSCA 3I4NH 5EBCA 3S15B 5KFUA 5C4XH 4B9XA 2DPJA 1PRTC 4CDEC 3A56A 1K83H 2KEEA 3JC66 3OSPA 2R8HA 1VS0A 1X3EA 2DGYA 4HEDA 2V59A 3T5LA 1B3QA 1Z6HA 2L4NA 1SSOA 4L1KA 4BBRG 1QE6A 2YCHA 4NXMQ 2J9GA 4BBSH 1H9KA 5HY6A 3NEMA 4DV5L 4NKLA 2QDLA 5ELNA 5JVG3 2WKDA 1RDPD 3HS0C 4DR3Q 1TQOA 4R9WA 1F2ZA 5EZYF 1WSCA 1V43A 3TMEA 3MWYW 4IR9A 4OWTB 4PNYA 1VQ9A 3DM1A 4J1MA 1RTNA 4NW2A 3JZIA 1I4PA 5K2MA 2F0OA 1PXUA 3H09A 4EVOA 2PW5A 3DHQA 5EPKA 4HJ8A 4Y8VB 3N44B 4I7HA 4CGYB 1WVLA 1TWCB 2SNMA 1JWUD 1STHA 3JRWA 2NTTA 1HNWQ 3AYHB 3CXCA 2OH2A 1VMPA 3K81C 2K01A 4O2DA 4ULLA 4DR7H 1DONA 3IG0A 1M8AA 3CRKC 3QR8A 2R87A 3TP7A 3JAML 4HN7A 4NXML 3TS2A 4EQPA 1IBLH 3MJFA 1SJHD 1D1KA 5IP9G 5BR8Q 5JPMC 5C44H 3NBHB 1I6HH 3Q8RB 2YYAA 2AGOA 1WTWA 1DOLA 4Q43A 4DR6H 4B9WA 2R7NA 4LF5Q 1I50H 4O3SA 4J15A 4LMYA 1NJIC 4MV9A 2QEJC 1A3VA 4HIOA 3CMAA 1U9RA 1KBLA 2F4IA 4NP5A 1IKLA 3ULJA 2KUMA 3A5ZB 1G91A 1FNWA 4XYMB 2NN6G 4DF7A 4J9NA 4K5XA 1Y1VA 3J80E 2VXWA 4JBKA 4DV7Q 3MFYA 1TWAB 4RGTA 5C3EG 1PFSA 4YCUA 2V5AA 2AMCB 1LTSD 2IX3A 1N33L 5KKNB 1B4OA 3S24A 4B3MQ 1VQ7A 3OWFA 4J0MA 4JV5H 3I2ZA 3TN2A 3HXLA 1Y1WH 2YW2A 3SHLA 3KLRA 1U4LA 2DZDA 2PVPA 2A1AA 1XMOL 4DV4Q 3GTOH 3GQCA 3UE0A 1K8MA 2A69C 4A3JH 4OO1H 2WB1A 1T5EA 1ESFA 1SNDA 1TT2A 3E0EA 4GOPA 5BR8L 3OSNA 1YITA 3OW2A 4CHTB 1W93A 1X3QA 4LF5L 2R7ZH 1PH7A 1MBYA 3KTMA 4ECRA 1HZCA 3RB6A 1K8AC 4MA0A 3L7ZC 3GTQB 1Q3LA 4I7AA 4K6DA 5BN4A 1I5FA 3T56B 2PQAB 3GIKA 2KECA 4ABNA 4U7CA 1ICFB 2N78A 4DV7L 3GTGA 1SNQA 5E7NA 3K0XA 2Q8IB 2K4KA 2B39A 1PRTD 4KKUA 4B3ML 2VNUD 4AIMA 1K8GA 3IRBA 4YWKA 4TRDA 2JA6H 2UVRA 2DNEA 4LF8H 2KCCA 1CSPA 2DY8A 5EDWA 3A54A 1FJGH 1UE5A 1FD7D 2YTVA 3S1NB 1XNRH 4X3KA 4Y52H 1JR0D 4BY7B 4JBMA 4GC7A 1RODA 1EWCA 3QWNA 1SRUA 5T1GA 3TQ1A 1RL2A 2H4OA 4MTNA 5C44G 3K58A 3TS0A 1PH3A 4A3EB 2NU7B 4MTDA 3H40A 4DV1H 2RBMA 1L0WA 4RGMA 4ECXA 1HFGA 3U4ZA 4ZYSA 1B9MA 1L1OC 3MAQA 4OWXB 4BY1G 5JH7F 1FYCA 3L2PA 2F0DA 4DAVA 4GKJH 2F0UA 3GTPH 2EJGC 3GTLH 2B3GA 1JQYD 3NENA 5C4HA 4HJ7A 2E2JB 3D4WA 2NVTB 2I5HA 3M4PA 1YHAA 2JXMB 1IBKQ 1Z9FA 2Q2HA 2HVSA 4JV2A 2W7PA 4O4IF 1V8QA 1OWTA 4JUZA 3S1MB 4DK1A 2C22A 1N32H 4B3TL 1IYVA 5C1PA 1RYSA 3VPCA 4N8X1 1XJVA 1SLJA 4NXNL 4RUAA 3FEWX 2ZXOA 2EYHA 3C1EA 3H6MA 4K8IA 2I8CA 5EQ0A 4C3JG 1ZHQA 3EBEA 5FLXE 2JA9A 1TKWB 2GVAA 3BS1A 3PR4A 1V1PA 1VQLA 2JEGA 1CKNA 1UUPA 2F0TA 2JEBI 2I5MX 3MFGA 1VQ5A 1RJQA 4OO1I 4PWQA 2BQ3A 3RUZA 1I6UA 2XCPA 5FO9B 2C35B 3CPFA 1WFQA 2WAQG 4YHHQ 1OO9B 1IBKL 2YYZA 4RAUC 4ETSA 1SR3A 4KKTA 5JOBA 1G2SA 3DMUA 4KD3A 1A2UA 1PH9A 2YU9B 5JVLA 4X64L 2UU9L 3OHXC 4C3IG 4LF9Q 5COYA 1DOKA 3NQTA 1JJGA 2PZTA 3MXUA 4QIWB 1Z2PX 4APVA 1PH5A 2F0FA 4TUYF 1Y8OB 3KBGA 2DNCA 5BMVF 4PV1C 2VS1A 4RCOA 3W1BA 5KEEA 1K1SA 2M05A 4HNTA 1EQQA 2H5XA 2IWHA 3T5HA 2B29A 3RZOH 1II3A 1PYBA 4DV5H 5JEAH 1D2BA 2UUAH 4YHHL 2EY2A 1QWYA 5HBRB 1JOQA 2EXZA 3R5XA 2AQ4A 1D5ZC 4PDBA 4XTCS 3GIJA 4R4CA 3J81L 1SNPA 2M9VA 1G8ZD 3F1ZA 2K7VA 2OXPA 4ED2A 3KALA 2EYOA 4RG1A 3VR2A 4DL2A 1ZYRD 1GJXA 1LLRD 1RCVD 1Q46A 4LF9L 2VPQA 5C8YF 4ED8A 2NYZD 4G7ZC 2R7DA 3M85A 1A2TA 1QUQA 1VQ8A 3G7LA 4LJZC 4G7OC 2Z9HA 1K9MC 1STEA 2FE3A 1VQAA 4WJ3M 3PUXA 2ZJTA 1S10A 1AP0A 2EYFA 3A74A 1V1OA 3AQQA 1Y8NB 3L4KA 3MC0B 3J7AK 3GV8B 1DXMA 1Y1WA 4ZKCB 1VQNA 1L1OA 5D1OA 3GTOA 4DV0Q 1HRJA 4A3MG 5KYIA 4WJ4A 5KX5F 3HOZH 2N88A 1AEXA 1BUVT 3NUCA 3RJ0A 1HUNA 1HH2P 3K5HA 3FDTA 3HOUG 1SBBB 2Q8RE 2WB1E 2R7ZA 3V6HA 3U58A 4OIKA 1A0IA 1NNXA 5M3FB 1TWGH 2HD3A 1KLGD 4HR7A 1N33H 1QILA 3KJOA 2F03A 1KIXA 1B1ZA 1GGOA 1TWHH 1LTTD 3PO3H 5M3MH 1VQDA 3SGIA 1XMOH 2RHQB 2BQRA 5CV6A 3T5JA 1EQTA 1O7LA 3OPOA 5KG0A 2Z6KC 2JA6A 5KG7A 1OXSC 2IJ0A 5LHY1 1BQQT 3EIVA 1B6SA 4DN4M 1C8CA 1VF7A 1W6JA 2VUMH 4LF5H 1IL2A 4DR5Q 1YEZA 2B2YC 2WB1B 4C1NI 3MFHA 4IAJA 4RNNA 4GOPB 3E5NA 1SYDA 1YZ6A 4LF6L 2O03A 3SR1A 1P8LA 2F4VH 4ECZA 3MR5A 4R7RA 3E5SA 2B8GA 3CQZH 1JJ2A 1ZQ7A 4G7HC 1I4QA 5LMUQ 4DV7H 1SNMA 1TS2A 1IW7D 3RN5A 4YQWA 2VQFH 2K05A 3N6XA 4JI0Q 2HIXA 4A3IH 2BQUA 5KFAA 4PG3A 4B3MH 2B2VC 2W9CA 3GTPA 1PFBA 3GTLA 4HJ9A 3CCQA 2K5VA 4MNOA 4AQYL 3HOVH 3GTGB 4BBRB 4F4ZA 3IN5A 5H1SE 5LP6F 3HOXH 4LFAL 4EG0A 1SMYD 4HQ6A 1EY0A 5JPNC 4RB3C 2FPGB 4JV1A 3X3NA 2PZWA 2C00A 4LSXA 4QQBX 3HOZG 1IBMQ 1PRTB 1TS4A 3PMFA 5IOCA 5ELFA 1VQFA 2AUJD 4KMUC 4YCVA 2PCFB 5CR3A 4JK1C 2Q2TA 2ENBA 3N6RA 2DJFC 2KEDA 4A3GH 3T1YQ 1TY0A 3H94A 4J9KA 5I9OA 5LMUL 5M5WH 1Q82C 1S0NA 4JI0L 2B63H 4IN3A 1O7ZA 2OQ0A 3KUPA 5IYCG 3PF5A 4IOAA 1PH2A 4CJ1B 2R86A 3NELA 2O2LD 4IZ8A 4DNIA 2NUCA 3I4MH 2JA7G 2RQXA 1H9MA 4L63B 5M3MG 3PO3G 3I3CA 1BNCA 4IRDA 3HOYH 4MV8A 4QWCA 4DL3A 3FKIH 1M7JA 4JI3Q 2Y0SA 1RK6A 5ELOA 4ZHQF 4B3TH 2FHTA 4DKAC 2LY7A 3D6CA 1WTRA 3PIPA 3KLWA 2EOTA 5CA1F 4NXNH 1IBML 4A93H 3SE7A 3NP8A 2PN1A 4WRDA 3WNZA 4CC6A 2J6UA 2ZT9C 1SE3A 4KJNA 1S5ED 5IIFA 2E2DC 3T1YL 1CZWA 2KHJA 1VQBA 2D0PA 3FMAA 2XVSA 4GN5A 3Q8PB 3I4NB 5C4XB 3K7UC 1VF5C 2CVRA 3DWAA 2MNAA 1Q12A 5KT7A 2ZXPA 1V1PB 1CHQD 1CKNB 1K83B 2AWNA 3QB3A 2K5WA 2LS01 1DZ1A 3S9WA 1TIID 4FBUA 5EWFA 1SNCA 3NWSA 1QZGA 1AN8A 3HOVG 4X64H 2UU9H 4JI3L 4WORA 1KNEA 1LT4D 2RDHA 4GC6A 2ATLA 1MIUA 3J80i 1KTKA 2M2LA 2ZM6L 4BBSB 5DLFA 1QVFA 2E2IH 3K80C 4EBCA 4F4YA 2VA2A 3J80c 1E2WA 2FMCA 5CGKA 2Z6KA 4QF4A 1LACA 5FK9C 4BS9A 3S1RH 3EN2A 1Q81C 2YS6A 3CD6A 3HRZC 1GSOA 2VZAA 5EJWA 2I87A 2D9UA 5D3DA 3QFFA 5K5PA 3BAAA 3V6KA 2UXCH 1K73C 4YJ2F 1G51A 2B2YA 1LO5D 5FPOA 1CFMA 1KJQA 4O1NA 2R8KA 3QOLA 4OL7A 1H9RA 4IFDJ 5BPHA 4YHHH 1CUKA 1JOOA 2B63G 3VPBA 2HQEA 1FNUA 2UXBH 2ASDA 1LABA 1S4ZA 2K04A 1CS0A 3I4MG 2I46A 5IGCA 1A15A 4X66Q 5DQHA 1TWFH 2B2VA 3FKIG 4P71A 1S5CD 2YTYA 1BO0A 1T5XD 4GLAC 3R8BA 4IPDA 2L0CA 4KY7A 1I6HB 5C0XG 2R6FA 3PZPA 1EYAA 3LWUA 4RHSA 4KHVA 5BN3A 4X62Q 2F0WA 3MEFA 1I50B 4C3HG 2AUKA 4A93G 2LSSA 1RHPA 5FJ8H 1LM0A 3Q0AA 1TWGA 5IGBA 4R8UA 3HOWG 4YR0A 4MV4A 4DXGA 1E4EA 2NVYH 1GD7A 1QUQB 1TWHA 2RGRA 1CHPD 1SNOA 3ER0A 5CA0F 1EY9A 2R7MA 3J81W 5KFIA 3GO5A 5EWGA 2AQ1B 4RHRA 1QCBD 5IT9L 1I7LA 3LMLA 3U9TA 1VCIA 3TZUA 3RBEA 2HIVA 1C48A 1Y1WB 2IY5B 1L1OB 3HP3A 5IWAQ 2VUMA 4X66L 3GTOB 5D1OB 1QB5D 3RB0A 1GXDC 3MZ5A 3DF7A 4A3JB 3S2DH 5C1OA 3BYTB 1VQ4A 4LMQD 2ZTEA 2YRWA 4YB8B 4FXDA 3S14H 1EY7A 4F88A 2O4XA 2A68C 1W96A 4QCLA 4PQXA 4X62L 4R4OA 3CC4A 4HAEA 1LTGD 3BZDB 3W3AA 5ISRA 2EZVA 1S40A 3CQZA 1Y69U 4JOIC 2R7ZB 2RA4A 4A3BH 2ALZA 3Q1KA 4V190 2R92H 1VBHA 3QOJA 4HR7B 2EY1A 3BG3A 2F3IA 1XNQQ 3S16H 1ET9A 2NZOA 3NWTA 3P7JA 1NMGA 2CFMA 4EEQA 4FVMA 2DJGC 2C2RA 3SVMA 1LTRD 1CQJB 3MXPA 1R4PB 4YY3Q 3T16A 1N48A 2JA6B 4YR3A 1ENCA 4M1UB 2F0MA 1PMRA 5IWAL 4LF6H 1B50A 3SI8A 1V4YA 5DGBA 3V6JA 4IUQA 1HR0Q 3Q24A 2ES2A 4ALPA 1RYRA 2DN8A 1CK1A 1LTLA 2AQ3B 5ELDA 5EPJA 2UVWA 2B63A 3AFPA 1XPUA 4AQYH 1N56A 2C9OA 4J9OA 1JE5A 1CSQA 4LFAH 5DG8A 1XNQL 3MWDA 3BQ2A 3K5LA 3F2CA 3GTPB 2W9CB 4DR1Q 3ETHA 3GTLB 3AMUA 1RK5A 3FKIA 3M4IA 2KCTA 4EGQA 4YIJA 1PTOF 1I4XA 1GOZA 1LT6D 4WBNF 1NR4A 3OSOA 3M4OH 4HIDA 2WIIB 5IP9H 2UXDQ 4HNVA 4ECUA 1CKOA 2RSOA 4A2BA 5FLMG 1AZQA 2NUAB 2AGQA 1RJTA 4HJAA 3NXWA 2JYOA 5KT5A 4ECYA 4IQZA 2Y0SE 5LMUH 4Z9CB 4IUTA 2NVXH 3IFDA 3PVXA 4JI0H 2OF1A 1N8RC 1UNNC 3N41B 4Q8FA 2P0AA 2K6AA 2EYMA 3E6ZX 1EFID 2NN6H 5I6WA 3GTJB 1HA6A 2VQEL 5KFRA 1EOTA 3STBC 4LFCL 5FO7B 4DNTB 4A3BG 1VQOA 3D0FA 3BA9A 2R92G 4EQNA 2XIWA 1S5FD 4JV0A 1I94Q 3CCSA 3ULLA 3DXJC 1SXTA 2XTIA 4K14A 4CDFC 4DV6H 2R3ZA 4LNQA 1A62A 1CT1D 2XRSD 3OIPA 1I4RA 1JORA 2PZUA 1KAWA 3RD4A 2UXDL 4BWSC 4K0KL 1E7ZA 2IX1A 2E2IA 2Y0SB 2K5HA 1A3UA 1DCZA 1UC8A 4PMWA 2V58A 4O3PA 4HCSA 3A7LA 1EUDB 1KABA 5GQOA 3CCUA 4UCTA 1WJJA 1MSHA 4QL5A 4GLXA 3R3OA 1EUCB 5D1PA 2A68D 3RZDB 4MTEA 1O80A 2F0GA 1SEBD 1B33N 3WDNA 1PHJA 1NUCA 1RF2D 3CU7A 3HKZG 4LF7Q 3CKIB 5G3LD 1KD1C 2EIFA 3KFUA 5M5XH 1KDBA 2L11A 3VYUA 3ORQA 3PO2G 1EIFA 4JOIA 3HFZB 5LL6S 4KHPH 1I94L 3RZOB 1YNJC 2ZM6H 5KFZA 4DUYH 4A3KG 3Q2OA 3KYHC 2J6SA 3JAME 4H13C 5EBDA 1TWFA 2K33A 5T1IA 1SN8A 3CCMA 3MXNA 3VYSA 2VL6A 1X54A 1HZAA 3L3OC 1PK8A 4AYBA 1I3QH 4TQRA 4HMJA 1PZJD 4LAAA 4DR3L 3OMCA 1Q7YC 4BY1H 1QNUA 3P75A 1B44D 2NVYA 4DAMA 5EKLA 1B7YB 3T13A 4NMZA 1RD9D 1XMQH 4LF7L 4YAJB 2A73B 2NU8B 4A2AA 3RUPA 4YP3A 3GQBA 3FPPA 5KG6A 1VQKA 4LUZA 2HHHQ 3FHWA 1HNWL 5DGAA 3H0GH 3I55A 1BVSA 2F0SA 3IKJA 1RJRA 3T1HQ 1ILQA 4X65Q 5DEHA 3JSNA 1JWSD 3I90A 4JBWA 2FP4B 3HOZB 3OTOH 3V4ZA 1CI3M 2E75C 3NTIA 2PPBC 4C5CA 3O13A 2NN6I 1STGA 2KSWA 2F3WA 2A6ED 3PW2A 3K59A 1MJCA 3RB4A 2YS7A 4MV3A 1V51A 5J2UF 4KJOA 1WTOA 2R92A 4R8UB 4PZ8A 4C3JH 1SYGA 1E4FT 1J5EQ 2W6QA 4XZ3B 4O3OA 1VMCA 4P2CB 2UUBQ 5DLGA 1ZXTA 4J9LA 1TWHB 3PO3B 1BXTA 1X6OA 1EY5A 3STBD 2W7OA 1YBYA 3NBIA 2BA1A 4J9SA 3NSWA 1EIYB 2V4RA 1STBA 4DXFA 4QUFA 4A3FH 3P20A 3R93A 1GUSA 1EYCA 2HHHL 1X32A 3T1HL 4X65L 4QJFA 5JAVA 3GTKH 1SDFA 3SK5A 1EZ1A 2JA8H 3RLOA 4DV4L 1A6XA 3C46A 3EJIA 3PV0A 2VUMB 3T5KA 1ZYRC 4IO9A 4C3IH 5KG3A 1SYBA 1PYSB 4HJ5A 1EYGA 3JRXA 4EYIB 5EKKA 5ELEA 1BCPB 4FF2A 4TSSA 4JI2H 4Q8EA 3HKZA 4BWGB 4J9QA 1F9RA 3KF6B 5IT9W 5CC4A 2K5DA 3CQZB 1R9TB 3H3VH 4GKKQ 2VPSA 2AKWB 1WD0A 3M9MB 4IUPA 4H44C 4A3IB 1J5EL 5FD6A 5DG9A 2UUBL 2G9HD 4DUZQ 3A7AB 4BXXH 2GPSA 3CW2C 1UWVA 3I7FA 3L9AX 1TA8A 4ZI7F 5KFWA 2HQLA 1F77A 1L0YB 3IAYA 5CV8A 3WOFA 2R93G 2OLSA 3G8CA 3M9OB 3HOXB 4C5BA 1YNJD 2RVLA 2F0NA 4FXGC 3H0GG 1ENFA 1HNXQ 2OQKA 3S2HH 3G6JB 5J2TF 3GLKA 2W8LA 3HZXA 4ODGA 2RCNA 5EPLA 1STNA 2NBFA 2NVXA 3SDZA 2W9AA 1HTLD 2HVQA 2MUYA 1MKHA 4QWAA 2RSNA 3GILA 2CW8A 1C7YA 4DR2Q 4A3GB 2I80A 1XNQH 2IP4A 4QWBA 4QW8A 4FO2A 4LK1C 5M5WB 2CQYA 2KBNA 5C4ZA 3S17H 4C2MH 2B63B 1HFNA 1FVIA 4ZCKA 2HDMA 5KFTA 2NVQH 3CHBD 3VR5A 4JI6Q 1IL8A 2R82A 2BE5D 2X69A 5E3FA 4A3MH 2XRQD 1SFOB 3D31A 3HOYB 3HEJA 4CDCC 3FKIB 2O5JC 4A3FG 2K50A 1LUZA 3H3VC 4FXKC 3AEVA 3HOUH 2KVMA 5KT6A 4J6HA 5A2QL 1HNXL 2JA8G 3DWPA 4JI4Q 4MV1A 1PTOH 2VQEH 4DV2H 4G57A 4UDUC 4CBVA 4LFCH 4XQNA 4RFBA 5DAUA 1MD2D 1HHVA 1IW7C 1S68A 5FLXL 2Z4IA 1QG7A 1LYLA 2XWJB 4FP5D 4DR2L 3GV7B 3RFCA 4OELB 2QKIC 4EGVA 3OHAA 4JI8Q 5C6AA 1HQRD 1IYJB 4KV6A 2RKSA 2EVBA 3BDCA 2W57A 2SCUB 2F0LA 3A55A 4JI6L 5IYZF 4YR2A 2K5QA 3OOCA 4K0KH 2ATWA 1HR0W 1SMYC 1F9PA 4BXXG 1GHKA 4EEYA 4KD4A 5KNDA 2RCFA 5KFMA 4M8AA 5LOVF 4J9RA 2Z1CA 2JSOA 1I3QA 3RLNA 4UCRA 4ZKBB 2E2IB 1F2YA 4RKLA 3H3VI 2PNHA 1KDAA 1Q1BA 2D5DA 4XXEA 4DV3Q 2CZGA 5I47A 3TREA 2K32A 1AFPA 3TP6A 3S1RB 2QYZA 3Q23A 3C0FB 5L1JA 4IUVA 4AYBE 2KQ3A 4MAMA 4ED7A 1Q8IA 3F2BA 3TZDA 3RAQA 4MA5A 2R6GA 1I94H 1D6EC 2BCOA 1IHZA 2VB3X 4K8JA 3U9OA 3J81j 1DJRD 2A6HD 4IUUA 2PQEA 4JI7Q 1JLLB 4EFBA 4FM9A 2CW0C 2F0PA 3H0GA 4NXMH 3PQIA 3SK4A 1PTOC 1XXGA 2XGQA 3DEPA 2E8GA 5DM63 1I7NA 3OYYA 3T51B 5CB4F 2BA0A 1BBWA 1HXYD 1YHQA 3GTMH 3K3VA 1JC7A 4DR3H 2YL2A 3ULPA 5EWEA 3MXNB 3NPPA 4QWEA 2I07B 4AYBB 4KTAA 3G71A 1KEEA 1HA5A 1FR3A 1HZ9A 3VR6A 1V1QA 2OWOA 1F9QA 1JWMD 2IW3A 3MR2A 2JEAI 3RBDA 2HUGA 1S0OA 2OT2A 5IYCH 2NVYB 1UE6A 4HIKA 4OX9Q 1HNWH 4FS2A 3NTHA 2JA7H 4YWMA 1AE3A 1OXTA 2WAQA 1JE4A 5LMNQ 4JI7L 1WR2A 1Y1VB 2DWCA 3F8TA 5E4WC 1JB7A 4KN7C 2FJ2A 2F0EA 3GTKA 4AH6A 5C4JB 5BR8H 1NTGA 1J9OA 4RCNA 1A63A 1IOWA 4DV0L 2E5LQ 1CM9A 4GZYC 3OWEB 3S2DB 1VQMA 1PVOA 3AFQA 1D5XC 3S14B 2KCNA 4TV8F 1EYDA 3D4DA 3KJPA 1SMXA 1GHJA 4A4IA 2NB0A 1O7YA 3VA5A 3H91A 5JJKA 1JOKA 2A74C 2VB2X 3KBXA 4L6TB 4JI5Q 4UCSA 3BG5A 5KNCA 5FPRA 4ZUIA 3TRZA 4A3BB 5BPFA 3PIOA 2R84A 1PRTF 1XTCD 2R92B 4EQOA 4H7BA 5KNBA 3EFXD 4OX9L 2VR1A 3HKZE 1HJPA 3S16B 4X65H 4F50A 3K7AH 5ELBA 5LMNL 3GIIA 4UP8A 5GAGC 4DV4H 3NHHA 4ECTA 2R8IA 4RB2C 1Q1EA 4JI1Q 4FNFA 4E6IA 1AH9A 4EQ5A 2QEXA 1VQ6A 2P5ZX 2ZJPA 1GM5A 3BA8A 5F9NA 2K75A 4U673 3PR5B 4DR5L 4ZK9B 1N36Q 1NCVA 2W6PA 2V9WA 1J5EH 3Q8DA 4GS3A 2Q2UA 2KENA 2UUBH 1B04A 4JI5L 4F8MA 2E2JH 3EA6A 5FD5A 3KOJA 3VMMA 1E24A 4C2MA 1KHIA 1S03G 4MIUA 4HIMA 1QOHA 3A8KE 1PZID 1QVGA 5KFLA 1YJ9A 3J7YW 2PI2A 4Q45A 4ZQIA 1I6VC 2MO1A 2V4DA 4JVZA 5CV7A 1VQIA 4A76A 3M9NB 2E2HH 3RAXA 2EE1A 1KDCA 3G4SA 2CKZB 4NLGA 2FKLA 1OXXK 2CW0D 1HNZQ 2LMCB 1ICWA 3TIGA 1PTOD 2UUCQ 1SE2A 3M4OB 4TKOB 5D65A 3PW7A 5NUCA 5C0XH 2F0KA 3FRPB 3IL8A 2N55A 1ILPA 5CV4A 1DM0B 3BVZA 4DGZA 5GAEC 4C3HH 1JB3A 2TSSA 4IOCA 5D8DA 2BDNA 1HQMC 5JEAJ 4J9MA 4ED3A 3HOWH 2NVXB 3JAMi 4EBDA 1F2MA 4CDDC 1VDZA 3H15A 3JAMc 3KDFA 2YRXA 3SK8A 1G2TA 2X6GA 5C3EB 1R4QB 2N3SA 2JK8A 4ECVA 1IBKH 2R8GA 3R23A 5JVH3 3OIQA 4YWLA 4X6AH 1U4MA 1PFNA 4P73A 2D2CC 5D14A 1C4QA 4R8NA 4IWXA 1AW7A 1HNZL 3U4VA 4BY7G 1EIHA 5C5JA 2UUCL 2J6TA 3OMGA 3EYYA 2FJZA 3M3YH 1W2BA 4R4IA 1EIGA 4DLKA 4CJ0B 2YV5A 2JEFA 1EY4A 4L5QA 4A3EG 1BNZA 4DR6Q 2R7KA 2PNRC 4M7EA 1EOVA 2MGSA 4DR2H 4A75A 3PUYA 5KFBA 1E3PA 4ZUJA 3RNUA 4RA8A 1PZKD 2MJ8A 2F0HA 3M4QA 4RNOA 4ZLTF 4HSPA 4LF4Q 3URYA 4POFA 3ERQA 2FFKB 5A2QW 4ZRZA 1F2LA 1X3GA 5M5XB 4ED0A 5J1ZA 3NBHA 5KFSA 4JV5Q 3GIDA 4FF3A 2QCPX 2ZDGA 1DIKA 3Q22A 1NY4A 1Z7TA 3F2DA 2DLNA 1NMFA 4YJ3F 4P74A 4K2LA 5AJ3Q 3MEHA 5FLXW 1NE3A 3GTMA 4LFBQ 2LXKA 3G6XA 4LF9H 4CKEA 2B2UC 3UDIA 4JYAQ 5JUMA 3L0OA 1C9OA 1ASZA 3JSLA 3BJYA 4UP9A 2PW7A 5C44B 1I3QB 1LT3D 3K5IA 3UE1A 1DGSA 1SE8A 1KRSA 3HBLA 2Z4HA 4DAYA 3KHHA 4UHVA 1DV1A 4BY1B 2I0QA 2EY6A 4LF4L 2BDOA 4LUVA 3EPIA 1GUOA 2BH8A 1U5KA 3RMHA 2JA7A 4GNXC 5JVDF 4FU0A 2RGVA 5A35A 3N8DA 4C56C 3CCLA 1XYIA 3PW4A 1OXVA 4N9TA 5C0XI 5IT9E 1OTCA 4JV5L 1A3TA 5CV9A 3M7NA 4LF8Q 3MWEA 2GLTA 1FJGQ 2JP1A 5AJ3L 2WAQE 1XNRQ 1Q90A 5FLMH 4LFBL 1B53A 4A3LG 3GIMA 5C5MA 2MP1A 3AU7A 5IYDG 4JYAL 3VR3A 4UCVA 5KFXA 2L12A 2PQAA 4IURA 2K28A 2W70A 2CQAA 1K3BC 1TS3A 4LH7A 3NTKA 4HSVA 2IMWP 1VQEA 1U4PA 5J39A 1LTAD 5M9OA 1RJPA 4GKJQ 4C3JB 1PFMA 1ML0D 1PX2A 2EJFC 1VQJA 1JDBB 3VPDA 3WO1A 1L2ZA 1TU2B 4DV0H 4KK7A 1HTPA 2WAQB 3R2IA 4MN3A 2AU0A 4DL4A 3ND8A 1CTMA 3ONAB 4K5WA 5KFVA 2NU9B 5CBEE 4UY8C 1M4VA 4JW0A 1O7IA 5ELCA 4YCWA 4KI0A 1XPRA 2WINB 1GKHA 3F8NA 1L0XB 4C3IB 1LTBD 4JCVE 1CA5A 2FLPA 1VAJA 2GPWA 1ET6A 3QO2A 4OGQC 1N9WA 3LGJA 3D3RA 2HCCA 3SE0A 5KGUA 1K28A 1X55A 2BOSA 3KLSX 3R2TA 3LWEA 1B9NA 3L4JA 2FB9A 5KIXA 2L9HA 3KK7A 2JE6I 4HCEA 5LMNH 2WP8J 1ZKOA 3ICEA 1UEAB 2R61A 3I73A 1D5MC 1D8LA 3PO2H 5I6YA 4B3RQ 5IGEA 4A3DH 3I72A 5DLQE 2C2DA 4O42A 5DQGA 1YJNA 4A3KH 2E2HA 1EWHA 2QA4A 1SYXB 2WTFA 2PI2E 3KAJA 2XC9A 4DR5H 4YY3L 4FF4A 2QDBA 2ZTCA 1DV2A 4IR1A 5CBAE 4FF1A 2UVVA 5GAHC 2A6EC 2IHEA 3OUUA 4EFEA 5M3FG 3BZCA 3SK6A 1HR0L 3KHGA 1S5DD 5LMNW 1WCMH 3KHRA 2JA5H 4Q0YA 3B6YA 1EFWA 1U0LA 4UAIA 4O2BF 3BDOA 1KJJA 2B2UA 3I4LA 3T53B 4IPGA 2HCIA 5M5YH 3J81c 4C2MB 3S17B 1AUXA 1E2VA 5KT3A 1EZ6A 2JN4A 3E3XA 4KHZA 5TSSA 4B3RL 1YI2A 1CQVA 4RGOS 2C28A 1TS5A 2QK4A 4N8FA 1WTPA 2VY3A 4DV5Q 4DR1L 1B70B 2UUAQ 4A3MB 3OUZA 4MV6A 5KG2A 5LL6X 2CW7A 1GUGA 1DD2A 1JKJB 4QIWA 2WB1G 3CCJA 2Z0SA 1JX4A 1IBMH 3HG9A 4GNXA 4TV9F 5I9PA 3HOUB 3N40P 1IXRA 1JXLA 3V05A 1KJ8A 1B6RA 4G4KA 3M9BA 3A5UA 3T1YH 4R4TA 2O5IC 4DL7A 4OHJA 3C2PA 3GV3A 4I55F 4I4TF 2CH4W 5KFYA 3C3LA 3ND9A 1FL0A 1KXLA 2HDLA 2RDIA 3KDFB 1J8IA 1SYEA 1HNZH 5IE8A 4K5VA 2RDJA 2UUCH 1EEFD 1RIPA 1RTOA 4Q5VA 3TP8A 2QW7A 1PH4A 1JMCA 3VYRA 4JI3H 1S5BD 4A3DG 1XTDA 4FYDA 1IOVA 4UPAA 2UUAL 5D3IB 3CC2A 4IPHA 4XYLB 3ERSX 1XPOA 1AUVA 3F2UA 2MCTA 2GA4B 2GVBA 1EWIA 2SOBA 4ZQ3A 2OCEA 5HGTA 1H95A 4X3SA 1PH8A 1Y8PB 3FDSA 4RUCA 3KXYT 3GP7A 4RB1A 3J7AV 2EQSA 2MFIA 4OIJA 2WYOA 1N33Q 1GO3E 2MO0A 1WCMG 2JA5G 2PBZA 4IRKA 3H4DA 5K36G 2W9BA 1TXYA 5FOBB 1XMOQ 2ZJRA 2BE5C 4F4WA 1PA6A 3RTXA 4HNUA 2XCAA 1VBGA 2R93H 5IGGA 1X56A 5FO8B 3CMEA 2NWGA 3NK9A 3GTMB 3CVZA 3R5HA 3G6YA 3PF4A 3U9SA 2Q2IA 5KFJA 3AB9A 1DOMA 1KAAA 2F4VQ 4LF4H 4RKBA 4L5TA 2KA7A 4R8IA 4DNRB 2F0QA 2XN9C 4B3SQ 2VUGA 3I4NG 2VQFQ 3J80L 4DAYB 1BR9A 5C4XG 2R85A 1TWGB 1BKBA 1UAPA 1UE1A 1O78A 3BVGA 1BCPF 1WTQA 1G6PA 1E4EB 2DUDA 4G3IA 2JA7B 1FNVA 5M3MB 2XGPA 2XCLA 4LFBH 3LWBA 2VQDA 1OXUA 1YNND 4HMIA 2ASBA 4X66H 4LUOA 1L2FA 1EEID 2WACA 4JYAH 4BBSG 2KCMA 3GV6A 4DL6A 3LX0A 4X62H 5DM73 1G6ZA 4ZAIA 4LH6A 1K83A 4IRCA 3K57A 1EL0A 4ED6A 5F2DA 3MR3A 2VA3A 3ZJYC 2F4VL 1WI5A 1KQSA 4XT3B 4OEMB 4XX0B 4O3NA 4B3SL 2VQFL 2LFNA 4OWWB 4JG2A 2A6HC 4GLVB 3CC7A 4BA1I 4ILWA 3H20A 3I56A 1J6QA 4LSAA 3K3PA 2EJMA 3K7AB 2KHSA 5IWAH 2WFWA 4KY6A 4IJHA 2A19A 2XIGA 4KY5A 3HOVB 1VQCA 5EGTA 4B3TQ 4CJ2C 2F0IA 2HJWA 5L1LA 3UI2A 2F52A 1IYUA 3SXHA 3E9IA 4TQUS 3U50C 1JT8A 4K2KA 2NZHA 3Q8SB 3KF8A 4NXNQ 2AHOB 3KLSA 2QF7A 2FPIB 5IYBH 2EY5A 1WCMA 2JA5A 5CAEB 2DPIA 1H9SA 3PUZA 4KKSA 5KYLA 2W6ZA 4ME3A 1STAA 4ECQA 2B2TC 1AE2A 3QIAA 2HT1A 2CH4A 4Y7NH 4GKKL 2FMMA 3CCVA 3CAMA 3HKSA 3W5OA 1S72A 2ZDHA 2NZ1D 1W6KA 4WJWA 3S1QH 1ZHSA 1S9FA 4IALA 2SNSA 4DUZL 4YY3H 4ECWA 1Y1WG 2L1BA 3I4MB 3G6EA 2E2HB 4A3JG 4OO1G 4HTHA 2RF4A 4X64Q 2UU9Q 4F87A 3NE5B 5T14A 2IA6A 1HR0H 5A2QE 3MVVA 2K14A 1UE7A 4F7XA 1AZPA 2L5TA 2BR0A 3E0JA 1M0WA 5KFDA 3GTJH 3DM3A 1GUNA 1LT5D 2EXDA 4QIWE 3A0JA 1HCZA 1MGSA 4C3HB 2R7ZG 1W3SA 4A93B 5J3BA 2W71A 2IX0A 2FK3A 3PGZA 2UXCQ 2EYPA 3PUVA 3HOWB 3S15H 3Q8QB 2FMAA 3WWVA 4B3RH 4L5SA 3A8IE 4UCUA 4IZOA 5HV6A 3Q6SA 1SYFA 2SDFA 4DR1H 2K52A 5I4DA 3DWQA 5KRUA 1UC9A 3FVQA 2UXBQ 1PLFA 4RGNA 1Y14B 2JA6G 2UXDH 1WOCA 1NAPA 4DK6C 4RU9A 2A69D 5KFFA 1QNKA 4QB4A 4DU9A 2DIKA 3TSSA 2YTXA 1YHBA 2CCZA 4U6PA 3J81E 3RZDH 1ASYA 3M3YB 3UFXB 2E76C 4GNXB 1CA6A 4L5RC 1D7QA 4V0BA 1BXRA 4K6LA 5IP7H 1QVCA 1VQGA 3RB3A 4JI4L 1C3OA 1KLUD 3MTSA 4X3UA 5G3LF 2FPPB 4XQQA 2UXCL 2N8NA 1BJTA 5IYBG 1WYDA 5IT9c 1TWCH 2E74C 2AQ2B 1S0MA 1N34Q 1M6VA 2Z6BA 4DR4Q 1HPCA 3RV3A 4JBJA 3W2DA 3E9HA 4JI8L 5J22A 4QWDA 2KHIA 2R93A 3FPUB 1YNXA 1KRTA 1WTHA 2UXBL 5KFEA 4XQJA 2B8FA 1XWEA 3TEHB 4POGA 4BA2I 3RLFA 3FMCA 1I50A 2RDGA 3GIPA 1PV4A 4JC0A 1JCKB 2K1BA 2A8VA 3I4OA 1TWFB 5IY0A 2LKVA 1ULZA 5EOYA 3EPGA 5KFKA 2MPMA 3ORRA 1QJOA 2L15A 4DV3L 4CKBA 1SEIA 2ID0A 1HZBA 2NTSA 4LF7H 1TWAH 2ASLA 2C5CA 3DLLA 1SYCA 2WKCA 1N34L 2W6MA 5EAYA 1WD1A 4DR4L 3RGXA 4QW9A 1K0RA 2CWPA 1WTXA 4B08A 4C5AA 2W9BB 4RMFA 1M0TA 1X65A 1AN7A 4ME6A 4NB3A 5I2YA 4H02A 1PYWD 4LW1A 3PCOB 4Q0FA 2B2TA 2D0OA 1YJWA 2PO4A 2ALYB 4PZ6A 3RN2A 1SCUB 2Y0SG 4IHJF 1B3AA 1BF4A 4LF6Q 3BU2A 1JICA 1RKNA 3RF2A 1CKMA 5CMDA 4U68A 4IFDH 2IT1A 3HB9A 3R5FA 4KN4C 2B2WC 1KJ9A 5KFCA 3CPWA 3GTQH 1EY6A 3TIIA 3JAMW 4P75A 1CZGA 2R7FA 1FGBD 4R4QA 5IP7G 2QGQA 2WE6A 5IGDA 2XGTA 5KG5A 1JJCB 5LXTF 1ONLA 1EUJA 1T9HA 4TVAB 4XIGS 3CF5A 4H0LC 4PMBA 4AQYQ 2R8JA 2RHSB 5H80A 4QGUA 2YZGA 3TBIB 4LFAQ 2EPBA 3PIO3 5JJLA 5KFNA 1STYA 5BN5A 2HHHH 2JQOA 1EYZA 5DNFA 3T1HH 1EQVA 1IZ6A 5FKAC 5JEAG 2J7ZA 3S1NH 3SEBA 5LA6F 1K3RA 3PN1A 3WO0A 4XT1B 1YIJA 3N52A 3M7GA 4BY7H 1SAPA 3OHBA 2ASJA 4TQSA 2IL8A 4RH6A 4QUCA 3PW5A 3BJUA 4C1NK 1LV9A 4A3EH 3J80W 1O75A 3K5MA 2E5LL 5JQWA 3BABA 3MXGA 3J7A5 3V96A 4ME5A 1R9TH 4B3SH 1E4GT 5C3WA 3P1HA 3K0YA 2J4XA 2PMZA 1K0SA 1NBWA 1E1TA 3UDXA 1M90C 4O0AA 3FP9A 3QJYA 3C1FA 5IGFA 3MFIA 5E4XA 5GONF 3V2TA 1S3OA 2ICEC 1PH1A 3HKZB 1TVXA 3PUWA 1UEBA 1MHWC 2D62A 3BYYB 2NVTH 4RAYA 5DG7A 4PZ7A 3KAKA 2QILA 4UFZA 3PO2B 5CORA 1Z2OX 4A3DB 4ID6A 4A3KB 3WOEA 3EVQA 4DV6Q 3ETJA 3S1MH 4MHEA 4ECSA 3K5OA 2AWOA 3VDYA 4P72A 3GV5B 4EYHB 2I5LX 1BBUA 5IODA 4CKCA 3N42B 1XDNA 2TMPA 3K5NA 4JI1L 2IBKA 2LXJA 3GTJA 3N43B 1I4GA 1I4HA 2X6LA 3KF8B 4IFDG 1A8VA 5CV5A 2FK2A 3MWMA 1N36L 4QMGA 3PIP3 1JIHA 4GKKH 5F9LA 4IJLA 1WCMB 2JA5B 1TR5A 1H9SB 2F0JA 3EROA 4UP7A 2ZJQA 3TQTA 3DUZA 3QZ7A 2AGPA 5C5LA 1ZEQX 2F1MA 4DUZH 1BCPC 2IHFA 3PSIA 1Q86C 1SFOH 5I2XA 3GIQA 5M5YB 3K6OA 2MQHA 1P16A 1S97A 4NDXA 3D4RA 1F9SA 3CCRA 4KHPQ 2FLLA 2ZM6Q 4DUYQ 4IFDI 2F0VA 3TINA 4DV6L 2CQOA 4OXPA 3I91A 3TP5A 2KJXA 4DR7Q 1C30A 3QG1A 2YU9H 2VUMG 1KJIA 3RV4A 3TDQA 3MHBA 2W8KA 1HNXH 4A3LH 1VQPA 1IBLQ 1TY2A 5GADC 5IYDH 5C3XA 4O3RA 3M4YA 4J8QA 1X3PA 3GD7A 3TQYA 4XDXA 1T3NA 1X3FA 3I70A 3VR4A 4I50F 2SEBD 4DL5A 1QZHA 2ZDQA 5KT2A 1A9XA 1TWCA 2EYLA 3X3MA 4RNMA 1B2TA 1FGUA 4A3IG 1SROA 1PDQA 1H9JA 5L1IA 3A8JE 1EHIA 3UDFA 4JI6H 1XMQQ 2B2WA 1GVPA 3HGBA 5KG1A 4RAZA 4X3TA 1XX8A 4ZOLF 1E22A 2F3VA 2IPKD 4KHPL 2X0SA 3HOXG 2XD4A 1ENAA 4DUYL 2JJQA 2G5DA 2H1EA 2MHVA 4DR7L 4WD3A 3BZKA 5KT4A 3OTOQ 1K1QA 1BDOA 5HURA 4JI4H 1IBLL 1EU4A 5KFQA 2OTJA 3EQLC 3G6VA 4IPCA 5KG4A 1X9NA 4IWYA 4FS1A 3BQ0A 4EBEA 4PMCA 4DR6L 1GLVA 1KC7A 5HGQA 4A3GG 3K8AA 3OW7A 3G48A 3UQ8A 2G9DA 3V4SA 4OONA 1Z47A 1TWAA 2EDGA 4JI8H 5EKIA 4XYQA 1WTVA 2JEIA 1E2ZA 1ESRA 3CRLC 2FLNA 1XMQL 4GN4B 4O3QA 2YZNA 1Q8KA 2Q8TA 2V4QA 3LP8A 3HOYG 1CE8A 4YAKB 2M00A 4R1JA 4O4HF 1G291 2R93B 3VYTA 4A3CH 2KOLA 3LNNA 3H0GB 2K03A 2W6OA 5KFGA 3OTOL 3I12A 1SE4A 1IKMA 4APMA 4DV3H 1MJEA 1B8AA 3GTQA 4RWSC 1LTID 3D6WA 5M3FH 5DQIA 1MSGA 1CQFA 3ITPA 5L37A 1DYQA 1N34H 4JI2Q 4DV1Q 1MI2A 4MTKA 4DK0A 3KHLA 4DR4H 4XYOA 1M1KC 1SJED 2K5NA 1BBXC 4F4XA 1WH2A 2A5HA 5KFOA 1Y1VH 1VQHA 4KLKA 5KFPA 4JI7H 1C0AA 4DAPA 5C4JH 1FKAH 1NSNS 2DY7A 4CC5A 2CHBD 1BCPD 3H4BA 4LWCA 1N32Q 2ZTDA 5E1FA 4N9PA 3RIZA 2VOBA 2ZXRA 3J7ZC 1EU3A 1ZETA 3CP0A 1TAEA 5KFHA 1NR2A 2N49A 2GN5A 4A3FB 3T4AC 4LF8L 5JJZA 1GUTA 4JPBW 4MZ9A 4EX5A 1T94A 1BGWA 2HVRA 1FJGL 1EQRA 2EYJA 3KF6A 1UNSA 1XNRL 3BDLA 3GTKB 4YBZB 3I8ZA 3W1GA 1E1OA 2JA8B 1K8OA 1R9TA 3BVMA 4RZRA 3QZ8A 1E0BA 1CQIB 1KNAA 5LYJF 4DV1L 4JI2L 3J7AF 2L55A 1GUWA 1JDEA 1U4RA 4OX9H 3RGZA 5C0XJ 2WDTA 4RB0A 1PH6A 4MV7A 2HGSA 4EGJA 2PMZE 3D8GA 3GTGH 4BBRH 2ICIA 4M9UA 4O4LF 4GKJL 4QY7A 4S3SA 4FBTA 3DEOA 1N32L 2W6NA 1YVCA 4HYKA 4I65A 2E5LH 3NGDA 3MR6A 2J0TD 5GROA 5FLXc 1HUMA 2FK1A 4RZQA 1Z2NX 3MA2B 4UCOA 4J9PA 2NU6B 1VKZA 4A3CG 1KC8C 2OEOA 4AYBG 3NQIA 3IFTA 2XWBB 3VA7A 1EY8A 3S2HB 4ED1A 2RDFA 2VQEQ 3ZYYX 4DV2Q 2OTLA 2FXQA 5FJ8G 2YZMA 4LFCQ 4JI5H 2PYKA 2BH2A 2C2EA 4DA2A 1BOSA 2PMZB 1GSAA 4E4TA 4Q44A 2UVUA 2VW9A 4DK3C 1EZ8A
chains in the Genus database with same CATH topology
1V9PA 3ULPA 3ZJYC 3J81i 1WI5A 2F4VL 1QZGA 1KL9A 5JJIA 2CWAA 4GOPC 1KQSA 3HOVG 3MXNB 4JI3L 1Y1VG 4B3SL 1MIUA 3J80i 3GDEA 2ZM6L 2VQFL 3G71A 1QVFA 2E2IH 4OWWB 3K80C 4JG2A 4K0KQ 1HZ9A 2OWOA 1V1QA 3J80c 2JEAI 4GLVB 2Z6KA 3CC7A 4BA1I 4FDBA 1HNWL 3I56A 1J6QA 3S1RH 3EN2A 4DPGA 1Q81C 2V1CC 5IYCH 3CD6A 2VZAA 1UE6A 4HIKA 4OX9Q 2WFWA 4IJHA 2A19A 3UDGA 1K73C 2JA7H 4YWMA 1G51A 1AE3A 1OXTA 1VQCA 4GN3B 3RR5A 3CCEA 4B3TQ 5LMNQ 4JI7L 3F8TA 2F52A 1JB7A 3U50C 3E9IA 4TQUS 1CUKA 4DV2L 4IFDJ 1JT8A 2NZHA 4AH6A 4NXNQ 2B63G 2AHOB 1NTGA 1A63A 5C3EH 4NPSA 3I4NH 3UE1A 4DV0L 2E5LQ 5C4XH 5IYBH 3I4MG 4IFDG 1VQMA 3PUZA 1PVOA 1K83H 3AFQA 3JC66 4X66Q 1TWFH 3FKIG 1VS0A 4ME3A 1X3EA 2DGYA 2YTYA 4P71A 3KJPA 1SMXA 4GLAC 1AE2A 4A4IA 4IPDA 4BBRG 2HT1A 4NXMQ 5JJKA 5C0XG 4Y7NH 4GKKL 4JI5Q 3CCVA 3CAMA 3HKSA 3W5OA 4X62Q 3MEFA 1S72A 4BBSH 5HY6A 3TRZA 3NEMA 3PIOA 4DV5L 3S1QH 4A93G 2LSSA 5ELNA 4DUZL 5FJ8H 1LM0A 1Y1WG 4DR3Q 4OX9L 3HOWG 3HKZE 1HJPA 3G6EA 1V43A 4A3JG 4OO1G 2NVYH 2RF4A 3K7AH 4OWTB 4X64Q 2UU9Q 1GD7A 1QUQB 1VQ9A 5LMNL 4UP8A 3ER0A 5GAGC 2K14A 1UE7A 3GO5A 1Q1EA 4JI1Q 4HJ8A 1AH9A 4EQ5A 3DM3A 4QIWE 3GTJH 2EXDA 2QEXA 3A0JA 2ZJPA 1VQ6A 1GM5A 2R7ZG 1W3SA 5J3BA 1VCIA 2IX0A 2HIVA 3PGZA 2K75A 2UXCQ 2IY5B 1L1OB 3PUVA 5IWAQ 3S15H 4DR5L 1HNWQ 4X66L 3AYHB 3CXCA 1N36Q 3K81C 4O2DA 3S2DH 3WWVA 4L5SA 1VQ4A 2ZTEA 3S14H 3Q8DA 4GS3A 2Q2UA 4NXML 2K52A 2KENA 3TS2A 4JI5L 2E2JH 4X62L 4R4OA 3CC4A 3KOJA 5BR8Q 5IP9G 5C44H 3NBHB 1E24A 1I6HH 1KHIA 1S40A 4HIMA 2UXBQ 4JOIC 1QVGA 2JA6G 1Y14B 1WOCA 1YJ9A 4LF5Q 4A3BH 1I50H 2PI2A 4J15A 4DK6C 1NJIC 2R92H 4HIOA 3CMAA 2MO1A 1VQIA 2F3IA 2YTXA 1YHBA 4A76A 1XNQQ 2CCZA 2NZOA 2E2HH 3S16H 3RZDH 3ULJA 1NMGA 3A5ZB 2CKZB 3G4SA 1ASYA 4L5RC 2CFMA 1OXXK 4GNXB 1HNZQ 1D7QA 2NN6G 2UUCQ 5IP7H 1QVCA 1VQGA 4JBKA 4JI4L 4DV7Q 4YY3Q 1PFSA 4YCUA 5C3EG 2AMCB 1N33L 2UXCL 2N8NA 5GAEC 3S24A 5IWAL 1WYDA 4C3HH 5IT9c 1TWCH 5IYBG 4IOCA 1VQ7A 4B3MQ 3I2ZA 5JEAJ 1Y1WH 3HOWH 1N34Q 3JAMi 2A1AA 1XMOL 4DV4Q 3GTOH 4DR4Q 3UE0A 4A3JH 1HR0Q 4JBJA 3H15A 3E9HA 4JI8L 2ES2A 4ALPA 2KHIA 3E0EA 3JAMc 5BR8L 4GOPA 3KDFA 1YITA 1YNXA 1KRTA 3OW2A 2UXBL 1LTLA 3TEHB 4POGA 4LF5L 2N3SA 4BA2I 3RLFA 2JK8A 2R7ZH 3AFPA 1PH7A 1XPUA 1HZCA 1PV4A 1JE5A 4JC0A 4YWLA 1K8AC 1CSQA 2A8VA 4X6AH 4P73A 3L7ZC 1XNQL 3I4OA 5IY0A 3F2CA 4DR1Q 1I5FA 1HNZL 3U4VA 4BY7G 2PQAB 2UUCL 3M3YH 1W2BA 2KCTA 4R4IA 2YV5A 4DV7L 2N78A 2L15A 5E7NA 4DV3L 3K0XA 4L5QA 4A3EG 4DR6Q 2K4KA 3M4OH 4HIDA 5IP9H 2UXDQ 1EOVA 2ID0A 1HZBA 1CKOA 4B3ML 2VNUD 1TWAH 4AIMA 4A75A 3IRBA 3PUYA 4YWKA 3DLLA 1E3PA 5FLMG 3RNUA 2JA6H 4HJAA 1N34L 1CSPA 1K8GA 5EAYA 4DR4L 3M4QA 1K0RA 1UE5A 2CWPA 2Y0SE 2YTVA 4Y52H 2NVXH 4LF4Q 4RMFA 4JBMA 4POFA 1X65A 1N8RC 4NB3A 4H02A 1SRUA 4LW1A 3PCOB 1RL2A 2D0OA 4MTNA 5C44G 3TS0A 1PH3A 1YJWA 2ALYB 4PZ6A 3RN2A 2Y0SG 1X3GA 1L0WA 2VQEL 3STBC 4LF6Q 4LFCL 3BU2A 4A3BG 3U4ZA 1VQOA 3D0FA 4JV5Q 1CKMA 1L1OC 2R92G 4OWXB 1NY4A 3F2DA 4BY1G 3L2PA 1NMFA 2IT1A 4P74A 5AJ3Q 4JYAQ 1I94Q 1NE3A 3CCSA 4LFBQ 2LXKA 3CPWA 3GTQH 3ULLA 2XTIA 4P75A 3GTPH 2R7FA 4R4QA 3UDIA 3GTLH 3L0OA 1C9OA 1A62A 2B3GA 2QGQA 3NENA 4UP9A 5IP7G 2XGTA 4HJ7A 1ASZA 1KAWA 2UXDL 1JJCB 4TVAB 1EUJA 1T9HA 1E7ZA 1DGSA 1SE8A 2I5HA 2K5HA 1YHAA 1KRSA 3M4PA 1Z9FA 2Q2HA 4PMWA 4AQYQ 1IBKQ 2RHSB 4QGUA 4LFAQ 3CCUA 5GQOA 5JJLA 1WJJA 2JQOA 4QL5A 2I0QA 4LF4L 4LUVA 4GLXA 1IZ6A 2BH8A 1U5KA 5JEAG 3S1NH 4B3TL 4GNXC 1K3RA 1YIJA 4BY7H 1PHJA 1XJVA 1SLJA 3BJUA 3HKZG 3CCLA 4NXNL 1OXVA 5C0XI 1OTCA 1KD1C 4LF7Q 4A3EH 4JV5L 2EIFA 3KFUA 2E5LL 3M7NA 4LF8Q 5M5XH 3J7A5 1R9TH 1EIFA 4JOIA 3HFZB 2WAQE 5AJ3L 1I94L 5FLMH 1FJGQ 3EBEA 1XNRQ 2JA9A 4LFBL 2GVAA 4A3KG 1VQLA 4A3LG 3KYHC 1CKNA 1NBWA 2JEBI 2I5MX 1VQ5A 1E1TA 3UDXA 4JYAL 5IYDG 4OO1I 1M90C 4O0AA 4LNQA 3FP9A 2C35B 1SN8A 2PQAA 3CPFA 3CCMA 1WFQA 2WAQG 1S3OA 4YHHQ 2VL6A 1X54A 1HZAA 3PUWA 1PH1A 1IBKL 1UEBA 2YYZA 1I3QH 2D62A 2NVTH 1SR3A 1VQEA 4PZ7A 4DR3L 4GKJQ 1PH9A 4X64L 2UU9L 1Q7YC 4BY1H 4DV6Q 4LF9Q 1VQJA 1JJGA 3S1MH 4DAMA 2AWOA 3VDYA 4APVA 4P72A 1B7YB 1PH5A 2I5LX 1BBUA 4LF7L 4JI1L 4UY8C 2LXJA 2VS1A 3W1BA 3KF8B 4LUZA 1A8VA 3FHWA 1VQKA 2HHHQ 3H0GH 3I55A 1EQQA 1BVSA 1O7IA 1N36L 2H5XA 4YCWA 4KI0A 3T1HQ 1XPRA 4X65Q 1GKHA 2B29A 4IJLA 4JCVE 3RZOH 4JBWA 1PYBA 2ZJQA 4UP7A 3PO2G 1N9WA 3LGJA 4YHHL 2IHFA 3PSIA 1Q86C 1SFOH 1X55A 2NN6I 4XTCS 4R4CA 2MQHA 1P16A 3F1ZA 2JE6I 1MJCA 3CCRA 4KHPQ 4RG1A 2WP8J 2ZM6Q 4DUYQ 4IFDI 3ICEA 4DV6L 1Q46A 2CQOA 4LF9L 1D8LA 4OXPA 3PO2H 4PZ8A 4DR7Q 4A3DH 4C3JH 4B3RQ 5DLQE 2YU9H 2VUMG 2R7DA 1YJNA 4A3KH 1J5EQ 4A3LH 1VQPA 3M85A 2QA4A 1IBLQ 2UUBQ 1QUQA 5GADC 1VQ8A 1X6OA 5IYDH 3STBD 1K9MC 1YBYA 2BA1A 2PI2E 1VQAA 1EIYB 4WJ3M 3PUXA 4YY3L 3GD7A 3TQYA 2ZTCA 3A74A 4A3FH 2HHHL 1X3FA 3AQQA 1QZHA 3T1HL 4X65L 4QJFA 5GAHC 3GTKH 2JA8H 3RLOA 4DV4L 1FGUA 2IHEA 4A3IG 1L1OA 1SROA 3PV0A 1VQNA 5M3FG 3BZCA 1HR0L 4DV0Q 4IO9A 4C3IH 4A3MG 5LMNW 1WCMH 3UDFA 2JA5H 4HJ5A 1PYSB 3B6YA 1XMQQ 1EYGA 1EFWA 1GVPA 1U0LA 3HOZH 4WJ4A 1E22A 1HH2P 4KHPL 3HOXG 3HOUG 4IPGA 5M5YH 3J81c 3KF6B 4DUYL 4KHZA 2WB1E 3H3VH 2JJQA 4GKKQ 1YI2A 4B3RL 3U58A 4DR7L 2AKWB 1A0IA 3BZKA 3OTOQ 1J5EL 2VY3A 4DV5Q 4DR1L 1TWGH 1IBLL 1B70B 2UUAQ 2UUBL 4DUZQ 2OTJA 4IPCA 3KJOA 1KIXA 4BXXH 2WB1G 1UWVA 3CW2C 2Z0SA 3I7FA 3CCJA 1X9NA 2HQLA 1TWHH 3PO3H 5M3MH 4GNXA 4DR6L 1VQDA 2R93G 5HGQA 4A3GG 3K8AA 3SGIA 3G48A 1IXRA 2RHQB 4OONA 1Z47A 3H0GG 2Z6KC 3M9BA 3A5UA 1HNXQ 4R4TA 2OQKA 1OXSC 3S2HH 3EIVA 1XMQL 2RCNA 4GN4B 2VUMH 1IL2A 1Q8KA 4DR5Q 1YEZA 1MKHA 1FL0A 3HOYG 1KXLA 4R1JA 1G291 4GOPB 1C7YA 4DR2Q 1YZ6A 4LF6L 3KDFB 1P8LA 4A3CH 4K0KL 2KBNA 5IE8A 3S17H 4C2MH 1RIPA 1PH4A 1JMCA 3CQZH 3OTOL 1JJ2A 1FVIA 4A3DG 1XTDA 5LMUQ 2NVQH 3RN5A 4UPAA 2UUAL 3CC2A 4IPHA 4JI6Q 4JI0Q 2HIXA 3ERSX 1B8AA 4A3IH 1XPOA 4PG3A 1MJEA 5M3FH 4A3MH 2GVBA 3D31A 1EWIA 4HJ9A 4JI2Q 3CCQA 4DV1Q 2OCEA 2K5VA 1M1KC 4MNOA 2K5NA 4AQYL 2K50A 4A3FG 1PH8A 3HOVH 1H95A 1LUZA 5H1SE 3AEVA 3HOXH 1Y1VH 4LFAL 3HOUH 1HNXL 1VQHA 4KLKA 2JA8G 2EQSA 4JI4Q 1C0AA 2MFIA 5C4JH 1N33Q 1GO3E 2MO0A 1WCMG 2JA5G 4LWCA 4QQBX 1N32Q 3HOZG 1IBMQ 5K36G 1TXYA 2ZTDA 1VQFA 1LYLA 4DR2L 4YCVA 1XMOQ 3J7ZC 2ZJRA 3CP0A 2Q2TA 1PA6A 2N49A 2GN5A 4LF8L 2R93H 4A3GH 4JI8Q 4MZ9A 4EX5A 3T1YQ 1IYJB 1FJGL 1EQRA 1X56A 3KF6A 1XNRL 5LMUL 5M5WH 1Q82C 3W1GA 1E1OA 3CMEA 4JI6L 4JI0L 2B63H 2ATWA 1HR0W 2OQ0A 3PF5A 5IYCG 4IOAA 4BXXG 1PH2A 3PF4A 2Q2IA 3NELA 4DNIA 4DV1L 4JI2L 3I4MH 2JA7G 3PO3G 5M3MG 3HOYH 3FKIH 5C0XJ 2F4VQ 1PH6A 2IX1A 4L5TA 3RLNA 2PMZE 4JI3Q 3GTGH 4BBRH 5ELOA 4B3SQ 4GKJL 3H3VI 4DKAC 2PNHA 4QY7A 1Q1BA 4DV3Q 3I4NG 2VQFQ 4DAYB 3TREA 3PIPA 3KLWA 5C4XG 1N32L 1BKBA 1YVCA 1IBML 4A93H 1UE1A 4AYBE 1G6PA 2DUDA 3F2BA 2R6GA 5GROA 5FLXc 1OXUA 2ASBA 4LUOA 1L2FA 3T1YL 4A3CG 1KC8C 3J81j 4AYBG 2KHJA 1VQBA 4JI7Q 2D0PA 2KCMA 4XIGS 4BBSG 4GN5A 3CF5A 2VQEQ 4DV2Q 2OTLA 2FXQA 5FJ8G 2E8GA 3K7UC 4LFCQ 3OYYA 2MNAA 1Q12A 2BH2A 2BA0A 1BBWA 1CKNB 2AWNA 1YHQA 3GTMH 2VW9A 4DK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9P A;  3ULP A;  3ZJY C;  3J81 i;  1WI5 A;  2F4V L;  1QZG A;  1KL9 A;  5JJI A;  2CWA A;  4GOP C;  1KQS A;  3HOV G;  3MXN B;  4JI3 L;  1Y1V G;  4B3S L;  1MIU A;  3J80 i;  3GDE A;  2ZM6 L;  2VQF L;  3G71 A;  1QVF A;  2E2I H;  4OWW B;  3K80 C;  4JG2 A;  4K0K Q;  1HZ9 A;  2OWO A;  1V1Q A;  3J80 c;  2JEA I;  4GLV B;  2Z6K A;  3CC7 A;  4BA1 I;  4FDB A;  1HNW L;  3I56 A;  1J6Q A;  3S1R H;  3EN2 A;  4DPG A;  1Q81 C;  2V1C C;  5IYC H;  3CD6 A;  2VZA A;  1UE6 A;  4HIK A;  4OX9 Q;  2WFW A;  4IJH A;  2A19 A;  3UDG A;  1K73 C;  2JA7 H;  4YWM A;  1G51 A;  1AE3 A;  1OXT A;  1VQC A;  4GN3 B;  3RR5 A;  3CCE A;  4B3T Q;  5LMN Q;  4JI7 L;  3F8T A;  2F52 A;  1JB7 A;  3U50 C;  3E9I A;  4TQU S;  1CUK A;  4DV2 L;  4IFD J;  1JT8 A;  2NZH A;  4AH6 A;  4NXN Q;  2B63 G;  2AHO B;  1NTG A;  1A63 A;  5C3E H;  4NPS A;  3I4N H;  3UE1 A;  4DV0 L;  2E5L Q;  5C4X H;  5IYB H;  3I4M G;  4IFD G;  1VQM A;  3PUZ A;  1PVO A;  1K83 H;  3AFQ A;  3JC6 6;  4X66 Q;  1TWF H;  3FKI G;  1VS0 A;  4ME3 A;  1X3E A;  2DGY A;  2YTY A;  4P71 A;  3KJP A;  1SMX A;  4GLA C;  1AE2 A;  4A4I A;  4IPD A;  4BBR G;  2HT1 A;  4NXM Q;  5JJK A;  5C0X G;  4Y7N H;  4GKK L;  4JI5 Q;  3CCV A;  3CAM A;  3HKS A;  3W5O A;  4X62 Q;  3MEF A;  1S72 A;  4BBS H;  5HY6 A;  3TRZ A;  3NEM A;  3PIO A;  4DV5 L;  3S1Q H;  4A93 G;  2LSS A;  5ELN A;  4DUZ L;  5FJ8 H;  1LM0 A;  1Y1W G;  4DR3 Q;  4OX9 L;  3HOW G;  3HKZ E;  1HJP A;  3G6E A;  1V43 A;  4A3J G;  4OO1 G;  2NVY H;  2RF4 A;  3K7A H;  4OWT B;  4X64 Q;  2UU9 Q;  1GD7 A;  1QUQ B;  1VQ9 A;  5LMN L;  4UP8 A;  3ER0 A;  5GAG C;  2K14 A;  1UE7 A;  3GO5 A;  1Q1E A;  4JI1 Q;  4HJ8 A;  1AH9 A;  4EQ5 A;  3DM3 A;  4QIW E;  3GTJ H;  2EXD A;  2QEX A;  3A0J A;  2ZJP A;  1VQ6 A;  1GM5 A;  2R7Z G;  1W3S A;  5J3B A;  1VCI A;  2IX0 A;  2HIV A;  3PGZ A;  2K75 A;  2UXC Q;  2IY5 B;  1L1O B;  3PUV A;  5IWA Q;  3S15 H;  4DR5 L;  1HNW Q;  4X66 L;  3AYH B;  3CXC A;  1N36 Q;  3K81 C;  4O2D A;  3S2D H;  3WWV A;  4L5S A;  1VQ4 A;  2ZTE A;  3S14 H;  3Q8D A;  4GS3 A;  2Q2U A;  4NXM L;  2K52 A;  2KEN A;  3TS2 A;  4JI5 L;  2E2J H;  4X62 L;  4R4O A;  3CC4 A;  3KOJ A;  5BR8 Q;  5IP9 G;  5C44 H;  3NBH B;  1E24 A;  1I6H H;  1KHI A;  1S40 A;  4HIM A;  2UXB Q;  4JOI C;  1QVG A;  2JA6 G;  1Y14 B;  1WOC A;  1YJ9 A;  4LF5 Q;  4A3B H;  1I50 H;  2PI2 A;  4J15 A;  4DK6 C;  1NJI C;  2R92 H;  4HIO A;  3CMA A;  2MO1 A;  1VQI A;  2F3I A;  2YTX A;  1YHB A;  4A76 A;  1XNQ Q;  2CCZ A;  2NZO A;  2E2H H;  3S16 H;  3RZD H;  3ULJ A;  1NMG A;  3A5Z B;  2CKZ B;  3G4S A;  1ASY A;  4L5R C;  2CFM A;  1OXX K;  4GNX B;  1HNZ Q;  1D7Q A;  2NN6 G;  2UUC Q;  5IP7 H;  1QVC A;  1VQG A;  4JBK A;  4JI4 L;  4DV7 Q;  4YY3 Q;  1PFS A;  4YCU A;  5C3E G;  2AMC B;  1N33 L;  2UXC L;  2N8N A;  5GAE C;  3S24 A;  5IWA L;  1WYD A;  4C3H H;  5IT9 c;  1TWC H;  5IYB G;  4IOC A;  1VQ7 A;  4B3M Q;  3I2Z A;  5JEA J;  1Y1W H;  3HOW H;  1N34 Q;  3JAM i;  2A1A A;  1XMO L;  4DV4 Q;  3GTO H;  4DR4 Q;  3UE0 A;  4A3J H;  1HR0 Q;  4JBJ A;  3H15 A;  3E9H A;  4JI8 L;  2ES2 A;  4ALP A;  2KHI A;  3E0E A;  3JAM c;  5BR8 L;  4GOP A;  3KDF A;  1YIT A;  1YNX A;  1KRT A;  3OW2 A;  2UXB L;  1LTL A;  3TEH B;  4POG A;  4LF5 L;  2N3S A;  4BA2 I;  3RLF A;  2JK8 A;  2R7Z H;  3AFP A;  1PH7 A;  1XPU A;  1HZC A;  1PV4 A;  1JE5 A;  4JC0 A;  4YWL A;  1K8A C;  1CSQ A;  2A8V A;  4X6A H;  4P73 A;  3L7Z C;  1XNQ L;  3I4O A;  5IY0 A;  3F2C A;  4DR1 Q;  1I5F A;  1HNZ L;  3U4V A;  4BY7 G;  2PQA B;  2UUC L;  3M3Y H;  1W2B A;  2KCT A;  4R4I A;  2YV5 A;  4DV7 L;  2N78 A;  2L15 A;  5E7N A;  4DV3 L;  3K0X A;  4L5Q A;  4A3E G;  4DR6 Q;  2K4K A;  3M4O H;  4HID A;  5IP9 H;  2UXD Q;  1EOV A;  2ID0 A;  1HZB A;  1CKO A;  4B3M L;  2VNU D;  1TWA H;  4AIM A;  4A75 A;  3IRB A;  3PUY A;  4YWK A;  3DLL A;  1E3P A;  5FLM G;  3RNU A;  2JA6 H;  4HJA A;  1N34 L;  1CSP A;  1K8G A;  5EAY A;  4DR4 L;  3M4Q A;  1K0R A;  1UE5 A;  2CWP A;  2Y0S E;  2YTV A;  4Y52 H;  2NVX H;  4LF4 Q;  4RMF A;  4JBM A;  4POF A;  1X65 A;  1N8R C;  4NB3 A;  4H02 A;  1SRU A;  4LW1 A;  3PCO B;  1RL2 A;  2D0O A;  4MTN A;  5C44 G;  3TS0 A;  1PH3 A;  1YJW A;  2ALY B;  4PZ6 A;  3RN2 A;  2Y0S G;  1X3G A;  1L0W A;  2VQE L;  3STB C;  4LF6 Q;  4LFC L;  3BU2 A;  4A3B G;  3U4Z A;  1VQO A;  3D0F A;  4JV5 Q;  1CKM A;  1L1O C;  2R92 G;  4OWX B;  1NY4 A;  3F2D A;  4BY1 G;  3L2P A;  1NMF A;  2IT1 A;  4P74 A;  5AJ3 Q;  4JYA Q;  1I94 Q;  1NE3 A;  3CCS A;  4LFB Q;  2LXK A;  3CPW A;  3GTQ H;  3ULL A;  2XTI A;  4P75 A;  3GTP H;  2R7F A;  4R4Q A;  3UDI A;  3GTL H;  3L0O A;  1C9O A;  1A62 A;  2B3G A;  2QGQ A;  3NEN A;  4UP9 A;  5IP7 G;  2XGT A;  4HJ7 A;  1ASZ A;  1KAW A;  2UXD L;  1JJC B;  4TVA B;  1EUJ A;  1T9H A;  1E7Z A;  1DGS A;  1SE8 A;  2I5H A;  2K5H A;  1YHA A;  1KRS A;  3M4P A;  1Z9F A;  2Q2H A;  4PMW A;  4AQY Q;  1IBK Q;  2RHS B;  4QGU A;  4LFA Q;  3CCU A;  5GQO A;  5JJL A;  1WJJ A;  2JQO A;  4QL5 A;  2I0Q A;  4LF4 L;  4LUV A;  4GLX A;  1IZ6 A;  2BH8 A;  1U5K A;  5JEA G;  3S1N H;  4B3T L;  4GNX C;  1K3R A;  1YIJ A;  4BY7 H;  1PHJ A;  1XJV A;  1SLJ A;  3BJU A;  3HKZ G;  3CCL A;  4NXN L;  1OXV A;  5C0X I;  1OTC A;  1KD1 C;  4LF7 Q;  4A3E H;  4JV5 L;  2EIF A;  3KFU A;  2E5L L;  3M7N A;  4LF8 Q;  5M5X H;  3J7A 5;  1R9T H;  1EIF A;  4JOI A;  3HFZ B;  2WAQ E;  5AJ3 L;  1I94 L;  5FLM H;  1FJG Q;  3EBE A;  1XNR Q;  2JA9 A;  4LFB L;  2GVA A;  4A3K G;  1VQL A;  4A3L G;  3KYH C;  1CKN A;  1NBW A;  2JEB I;  2I5M X;  1VQ5 A;  1E1T A;  3UDX A;  4JYA L;  5IYD G;  4OO1 I;  1M90 C;  4O0A A;  4LNQ A;  3FP9 A;  2C35 B;  1SN8 A;  2PQA A;  3CPF A;  3CCM A;  1WFQ A;  2WAQ G;  1S3O A;  4YHH Q;  2VL6 A;  1X54 A;  1HZA A;  3PUW A;  1PH1 A;  1IBK L;  1UEB A;  2YYZ A;  1I3Q H;  2D62 A;  2NVT H;  1SR3 A;  1VQE A;  4PZ7 A;  4DR3 L;  4GKJ Q;  1PH9 A;  4X64 L;  2UU9 L;  1Q7Y C;  4BY1 H;  4DV6 Q;  4LF9 Q;  1VQJ A;  1JJG A;  3S1M H;  4DAM A;  2AWO A;  3VDY A;  4APV A;  4P72 A;  1B7Y B;  1PH5 A;  2I5L X;  1BBU A;  4LF7 L;  4JI1 L;  4UY8 C;  2LXJ A;  2VS1 A;  3W1B A;  3KF8 B;  4LUZ A;  1A8V A;  3FHW A;  1VQK A;  2HHH Q;  3H0G H;  3I55 A;  1EQQ A;  1BVS A;  1O7I A;  1N36 L;  2H5X A;  4YCW A;  4KI0 A;  3T1H Q;  1XPR A;  4X65 Q;  1GKH A;  2B29 A;  4IJL A;  4JCV E;  3RZO H;  4JBW A;  1PYB A;  2ZJQ A;  4UP7 A;  3PO2 G;  1N9W A;  3LGJ A;  4YHH L;  2IHF A;  3PSI A;  1Q86 C;  1SFO H;  1X55 A;  2NN6 I;  4XTC S;  4R4C A;  2MQH A;  1P16 A;  3F1Z A;  2JE6 I;  1MJC A;  3CCR A;  4KHP Q;  4RG1 A;  2WP8 J;  2ZM6 Q;  4DUY Q;  4IFD I;  3ICE A;  4DV6 L;  1Q46 A;  2CQO A;  4LF9 L;  1D8L A;  4OXP A;  3PO2 H;  4PZ8 A;  4DR7 Q;  4A3D H;  4C3J H;  4B3R Q;  5DLQ E;  2YU9 H;  2VUM G;  2R7D A;  1YJN A;  4A3K H;  1J5E Q;  4A3L H;  1VQP A;  3M85 A;  2QA4 A;  1IBL Q;  2UUB Q;  1QUQ A;  5GAD C;  1VQ8 A;  1X6O A;  5IYD H;  3STB D;  1K9M C;  1YBY A;  2BA1 A;  2PI2 E;  1VQA A;  1EIY B;  4WJ3 M;  3PUX A;  4YY3 L;  3GD7 A;  3TQY A;  2ZTC A;  3A74 A;  4A3F H;  2HHH L;  1X3F A;  3AQQ A;  1QZH A;  3T1H L;  4X65 L;  4QJF A;  5GAH C;  3GTK H;  2JA8 H;  3RLO A;  4DV4 L;  1FGU A;  2IHE A;  4A3I G;  1L1O A;  1SRO A;  3PV0 A;  1VQN A;  5M3F G;  3BZC A;  1HR0 L;  4DV0 Q;  4IO9 A;  4C3I H;  4A3M G;  5LMN W;  1WCM H;  3UDF A;  2JA5 H;  4HJ5 A;  1PYS B;  3B6Y A;  1XMQ Q;  1EYG A;  1EFW A;  1GVP A;  1U0L A;  3HOZ H;  4WJ4 A;  1E22 A;  1HH2 P;  4KHP L;  3HOX G;  3HOU G;  4IPG A;  5M5Y H;  3J81 c;  3KF6 B;  4DUY L;  4KHZ A;  2WB1 E;  3H3V H;  2JJQ A;  4GKK Q;  1YI2 A;  4B3R L;  3U58 A;  4DR7 L;  2AKW B;  1A0I A;  3BZK A;  3OTO Q;  1J5E L;  2VY3 A;  4DV5 Q;  4DR1 L;  1TWG H;  1IBL L;  1B70 B;  2UUA Q;  2UUB L;  4DUZ Q;  2OTJ A;  4IPC A;  3KJO A;  1KIX A;  4BXX H;  2WB1 G;  1UWV A;  3CW2 C;  2Z0S A;  3I7F A;  3CCJ A;  1X9N A;  2HQL A;  1TWH H;  3PO3 H;  5M3M H;  4GNX A;  4DR6 L;  1VQD A;  2R93 G;  5HGQ A;  4A3G G;  3K8A A;  3SGI A;  3G48 A;  1IXR A;  2RHQ B;  4OON A;  1Z47 A;  3H0G G;  2Z6K C;  3M9B A;  3A5U A;  1HNX Q;  4R4T A;  2OQK A;  1OXS C;  3S2H H;  3EIV A;  1XMQ L;  2RCN A;  4GN4 B;  2VUM H;  1IL2 A;  1Q8K A;  4DR5 Q;  1YEZ A;  1MKH A;  1FL0 A;  3HOY G;  1KXL A;  4R1J A;  1G29 1;  4GOP B;  1C7Y A;  4DR2 Q;  1YZ6 A;  4LF6 L;  3KDF B;  1P8L A;  4A3C H;  4K0K L;  2KBN A;  5IE8 A;  3S17 H;  4C2M H;  1RIP A;  1PH4 A;  1JMC A;  3CQZ H;  3OTO L;  1JJ2 A;  1FVI A;  4A3D G;  1XTD A;  5LMU Q;  2NVQ H;  3RN5 A;  4UPA A;  2UUA L;  3CC2 A;  4IPH A;  4JI6 Q;  4JI0 Q;  2HIX A;  3ERS X;  1B8A A;  4A3I H;  1XPO A;  4PG3 A;  1MJE A;  5M3F H;  4A3M H;  2GVB A;  3D31 A;  1EWI A;  4HJ9 A;  4JI2 Q;  3CCQ A;  4DV1 Q;  2OCE A;  2K5V A;  1M1K C;  4MNO A;  2K5N A;  4AQY L;  2K50 A;  4A3F G;  1PH8 A;  3HOV H;  1H95 A;  1LUZ A;  5H1S E;  3AEV A;  3HOX H;  1Y1V H;  4LFA L;  3HOU H;  1HNX L;  1VQH A;  4KLK A;  2JA8 G;  2EQS A;  4JI4 Q;  1C0A A;  2MFI A;  5C4J H;  1N33 Q;  1GO3 E;  2MO0 A;  1WCM G;  2JA5 G;  4LWC A;  4QQB X;  1N32 Q;  3HOZ G;  1IBM Q;  5K36 G;  1TXY A;  2ZTD A;  1VQF A;  1LYL A;  4DR2 L;  4YCV A;  1XMO Q;  3J7Z C;  2ZJR A;  3CP0 A;  2Q2T A;  1PA6 A;  2N49 A;  2GN5 A;  4LF8 L;  2R93 H;  4A3G H;  4JI8 Q;  4MZ9 A;  4EX5 A;  3T1Y Q;  1IYJ B;  1FJG L;  1EQR A;  1X56 A;  3KF6 A;  1XNR L;  5LMU L;  5M5W H;  1Q82 C;  3W1G A;  1E1O A;  3CME A;  4JI6 L;  4JI0 L;  2B63 H;  2ATW A;  1HR0 W;  2OQ0 A;  3PF5 A;  5IYC G;  4IOA A;  4BXX G;  1PH2 A;  3PF4 A;  2Q2I A;  3NEL A;  4DNI A;  4DV1 L;  4JI2 L;  3I4M H;  2JA7 G;  3PO3 G;  5M3M G;  3HOY H;  3FKI H;  5C0X J;  2F4V Q;  1PH6 A;  2IX1 A;  4L5T A;  3RLN A;  2PMZ E;  4JI3 Q;  3GTG H;  4BBR H;  5ELO A;  4B3S Q;  4GKJ L;  3H3V I;  4DKA C;  2PNH A;  4QY7 A;  1Q1B A;  4DV3 Q;  3I4N G;  2VQF Q;  4DAY B;  3TRE A;  3PIP A;  3KLW A;  5C4X G;  1N32 L;  1BKB A;  1YVC A;  1IBM L;  4A93 H;  1UE1 A;  4AYB E;  1G6P A;  2DUD A;  3F2B A;  2R6G A;  5GRO A;  5FLX c;  1OXU A;  2ASB A;  4LUO A;  1L2F A;  3T1Y L;  4A3C G;  1KC8 C;  3J81 j;  4AYB G;  2KHJ A;  1VQB A;  4JI7 Q;  2D0P A;  2KCM A;  4XIG S;  4BBS G;  4GN5 A;  3CF5 A;  2VQE Q;  4DV2 Q;  2OTL A;  2FXQ A;  5FJ8 G;  2E8G A;  3K7U C;  4LFC Q;  3OYY A;  2MNA A;  1Q12 A;  2BH2 A;  2BA0 A;  1BBW A;  1CKN B;  2AWN A;  1YHQ A;  3GTM H;  2VW9 A;  4DK3 C; 
#chains in the Genus database with same CATH topology
 1V9P A;  3PW0 A;  3J81 i;  5K36 H;  5JJI A;  1KL9 A;  1SFO A;  2CWA A;  4GOP C;  2FIN B;  1MZB A;  4Y7N B;  1Y1V G;  1GSH A;  3GDE A;  1YNN C;  2R7L A;  5LL6 b;  2Z8L A;  1T36 A;  5L1K A;  3S1Q B;  4IUN A;  4K0K Q;  2NVQ B;  4O2A F;  4JI1 H;  5L9X A;  4FDB A;  2YU9 A;  4DFA A;  4DPG A;  4L8J A;  2V1C C;  1GYF A;  5AFW A;  1N36 H;  3UDG A;  2JEJ A;  1D1I A;  2WV6 D;  4GN3 B;  4WFN 3;  3RR5 A;  3CCE A;  3BQ1 A;  4I7Z C;  5CYU A;  4DV2 L;  2XNA C;  5C3E H;  1PTO B;  4NPS A;  2XSC A;  3I4N H;  5EBC A;  3S15 B;  5KFU A;  5C4X H;  4B9X A;  2DPJ A;  1PRT C;  4CDE C;  3A56 A;  1K83 H;  2KEE A;  3JC6 6;  3OSP A;  2R8H A;  1VS0 A;  1X3E A;  2DGY A;  4HED A;  2V59 A;  3T5L A;  1B3Q A;  1Z6H A;  2L4N A;  1SSO A;  4L1K A;  4BBR G;  1QE6 A;  2YCH A;  4NXM Q;  2J9G A;  4BBS H;  1H9K A;  5HY6 A;  3NEM A;  4DV5 L;  4NKL A;  2QDL A;  5ELN A;  5JVG 3;  2WKD A;  1RDP D;  3HS0 C;  4DR3 Q;  1TQO A;  4R9W A;  1F2Z A;  5EZY F;  1WSC A;  1V43 A;  3TME A;  3MWY W;  4IR9 A;  4OWT B;  4PNY A;  1VQ9 A;  3DM1 A;  4J1M A;  1RTN A;  4NW2 A;  3JZI A;  1I4P A;  5K2M A;  2F0O A;  1PXU A;  3H09 A;  4EVO A;  2PW5 A;  3DHQ A;  5EPK A;  4HJ8 A;  4Y8V B;  3N44 B;  4I7H A;  4CGY B;  1WVL A;  1TWC B;  2SNM A;  1JWU D;  1STH A;  3JRW A;  2NTT A;  1HNW Q;  3AYH B;  3CXC A;  2OH2 A;  1VMP A;  3K81 C;  2K01 A;  4O2D A;  4ULL A;  4DR7 H;  1DON A;  3IG0 A;  1M8A A;  3CRK C;  3QR8 A;  2R87 A;  3TP7 A;  3JAM L;  4HN7 A;  4NXM L;  3TS2 A;  4EQP A;  1IBL H;  3MJF A;  1SJH D;  1D1K A;  5IP9 G;  5BR8 Q;  5JPM C;  5C44 H;  3NBH B;  1I6H H;  3Q8R B;  2YYA A;  2AGO A;  1WTW A;  1DOL A;  4Q43 A;  4DR6 H;  4B9W A;  2R7N A;  4LF5 Q;  1I50 H;  4O3S A;  4J15 A;  4LMY A;  1NJI C;  4MV9 A;  2QEJ C;  1A3V A;  4HIO A;  3CMA A;  1U9R A;  1KBL A;  2F4I A;  4NP5 A;  1IKL A;  3ULJ A;  2KUM A;  3A5Z B;  1G91 A;  1FNW A;  4XYM B;  2NN6 G;  4DF7 A;  4J9N A;  4K5X A;  1Y1V A;  3J80 E;  2VXW A;  4JBK A;  4DV7 Q;  3MFY A;  1TWA B;  4RGT A;  5C3E G;  1PFS A;  4YCU A;  2V5A A;  2AMC B;  1LTS D;  2IX3 A;  1N33 L;  5KKN B;  1B4O A;  3S24 A;  4B3M Q;  1VQ7 A;  3OWF A;  4J0M A;  4JV5 H;  3I2Z A;  3TN2 A;  3HXL A;  1Y1W H;  2YW2 A;  3SHL A;  3KLR A;  1U4L A;  2DZD A;  2PVP A;  2A1A A;  1XMO L;  4DV4 Q;  3GTO H;  3GQC A;  3UE0 A;  1K8M A;  2A69 C;  4A3J H;  4OO1 H;  2WB1 A;  1T5E A;  1ESF A;  1SND A;  1TT2 A;  3E0E A;  4GOP A;  5BR8 L;  3OSN A;  1YIT A;  3OW2 A;  4CHT B;  1W93 A;  1X3Q A;  4LF5 L;  2R7Z H;  1PH7 A;  1MBY A;  3KTM A;  4ECR A;  1HZC A;  3RB6 A;  1K8A C;  4MA0 A;  3L7Z C;  3GTQ B;  1Q3L A;  4I7A A;  4K6D A;  5BN4 A;  1I5F A;  3T56 B;  2PQA B;  3GIK A;  2KEC A;  4ABN A;  4U7C A;  1ICF B;  2N78 A;  4DV7 L;  3GTG A;  1SNQ A;  5E7N A;  3K0X A;  2Q8I B;  2K4K A;  2B39 A;  1PRT D;  4KKU A;  4B3M L;  2VNU D;  4AIM A;  1K8G A;  3IRB A;  4YWK A;  4TRD A;  2JA6 H;  2UVR A;  2DNE A;  4LF8 H;  2KCC A;  1CSP A;  2DY8 A;  5EDW A;  3A54 A;  1FJG H;  1UE5 A;  1FD7 D;  2YTV A;  3S1N B;  1XNR H;  4X3K A;  4Y52 H;  1JR0 D;  4BY7 B;  4JBM A;  4GC7 A;  1ROD A;  1EWC A;  3QWN A;  1SRU A;  5T1G A;  3TQ1 A;  1RL2 A;  2H4O A;  4MTN A;  5C44 G;  3K58 A;  3TS0 A;  1PH3 A;  4A3E B;  2NU7 B;  4MTD A;  3H40 A;  4DV1 H;  2RBM A;  1L0W A;  4RGM A;  4ECX A;  1HFG A;  3U4Z A;  4ZYS A;  1B9M A;  1L1O C;  3MAQ A;  4OWX B;  4BY1 G;  5JH7 F;  1FYC A;  3L2P A;  2F0D A;  4DAV A;  4GKJ H;  2F0U A;  3GTP H;  2EJG C;  3GTL H;  2B3G A;  1JQY D;  3NEN A;  5C4H A;  4HJ7 A;  2E2J B;  3D4W A;  2NVT B;  2I5H A;  3M4P A;  1YHA A;  2JXM B;  1IBK Q;  1Z9F A;  2Q2H A;  2HVS A;  4JV2 A;  2W7P A;  4O4I F;  1V8Q A;  1OWT A;  4JUZ A;  3S1M B;  4DK1 A;  2C22 A;  1N32 H;  4B3T L;  1IYV A;  5C1P A;  1RYS A;  3VPC A;  4N8X 1;  1XJV A;  1SLJ A;  4NXN L;  4RUA A;  3FEW X;  2ZXO A;  2EYH A;  3C1E A;  3H6M A;  4K8I A;  2I8C A;  5EQ0 A;  4C3J G;  1ZHQ A;  3EBE A;  5FLX E;  2JA9 A;  1TKW B;  2GVA A;  3BS1 A;  3PR4 A;  1V1P A;  1VQL A;  2JEG A;  1CKN A;  1UUP A;  2F0T A;  2JEB I;  2I5M X;  3MFG A;  1VQ5 A;  1RJQ A;  4OO1 I;  4PWQ A;  2BQ3 A;  3RUZ A;  1I6U A;  2XCP A;  5FO9 B;  2C35 B;  3CPF A;  1WFQ A;  2WAQ G;  4YHH Q;  1OO9 B;  1IBK L;  2YYZ A;  4RAU C;  4ETS A;  1SR3 A;  4KKT A;  5JOB A;  1G2S A;  3DMU A;  4KD3 A;  1A2U A;  1PH9 A;  2YU9 B;  5JVL A;  4X64 L;  2UU9 L;  3OHX C;  4C3I G;  4LF9 Q;  5COY A;  1DOK A;  3NQT A;  1JJG A;  2PZT A;  3MXU A;  4QIW B;  1Z2P X;  4APV A;  1PH5 A;  2F0F A;  4TUY F;  1Y8O B;  3KBG A;  2DNC A;  5BMV F;  4PV1 C;  2VS1 A;  4RCO A;  3W1B A;  5KEE A;  1K1S A;  2M05 A;  4HNT A;  1EQQ A;  2H5X A;  2IWH A;  3T5H A;  2B29 A;  3RZO H;  1II3 A;  1PYB A;  4DV5 H;  5JEA H;  1D2B A;  2UUA H;  4YHH L;  2EY2 A;  1QWY A;  5HBR B;  1JOQ A;  2EXZ A;  3R5X A;  2AQ4 A;  1D5Z C;  4PDB A;  4XTC S;  3GIJ A;  4R4C A;  3J81 L;  1SNP A;  2M9V A;  1G8Z D;  3F1Z A;  2K7V A;  2OXP A;  4ED2 A;  3KAL A;  2EYO A;  4RG1 A;  3VR2 A;  4DL2 A;  1ZYR D;  1GJX A;  1LLR D;  1RCV D;  1Q46 A;  4LF9 L;  2VPQ A;  5C8Y F;  4ED8 A;  2NYZ D;  4G7Z C;  2R7D A;  3M85 A;  1A2T A;  1QUQ A;  1VQ8 A;  3G7L A;  4LJZ C;  4G7O C;  2Z9H A;  1K9M C;  1STE A;  2FE3 A;  1VQA A;  4WJ3 M;  3PUX A;  2ZJT A;  1S10 A;  1AP0 A;  2EYF A;  3A74 A;  1V1O A;  3AQQ A;  1Y8N B;  3L4K A;  3MC0 B;  3J7A K;  3GV8 B;  1DXM A;  1Y1W A;  4ZKC B;  1VQN A;  1L1O A;  5D1O A;  3GTO A;  4DV0 Q;  1HRJ A;  4A3M G;  5KYI A;  4WJ4 A;  5KX5 F;  3HOZ H;  2N88 A;  1AEX A;  1BUV T;  3NUC A;  3RJ0 A;  1HUN A;  1HH2 P;  3K5H A;  3FDT A;  3HOU G;  1SBB B;  2Q8R E;  2WB1 E;  2R7Z A;  3V6H A;  3U58 A;  4OIK A;  1A0I A;  1NNX A;  5M3F B;  1TWG H;  2HD3 A;  1KLG D;  4HR7 A;  1N33 H;  1QIL A;  3KJO A;  2F03 A;  1KIX A;  1B1Z A;  1GGO A;  1TWH H;  1LTT D;  3PO3 H;  5M3M H;  1VQD A;  3SGI A;  1XMO H;  2RHQ B;  2BQR A;  5CV6 A;  3T5J A;  1EQT A;  1O7L A;  3OPO A;  5KG0 A;  2Z6K C;  2JA6 A;  5KG7 A;  1OXS C;  2IJ0 A;  5LHY 1;  1BQQ T;  3EIV A;  1B6S A;  4DN4 M;  1C8C A;  1VF7 A;  1W6J A;  2VUM H;  4LF5 H;  1IL2 A;  4DR5 Q;  1YEZ A;  2B2Y C;  2WB1 B;  4C1N I;  3MFH A;  4IAJ A;  4RNN A;  4GOP B;  3E5N A;  1SYD A;  1YZ6 A;  4LF6 L;  2O03 A;  3SR1 A;  1P8L A;  2F4V H;  4ECZ A;  3MR5 A;  4R7R A;  3E5S A;  2B8G A;  3CQZ H;  1JJ2 A;  1ZQ7 A;  4G7H C;  1I4Q A;  5LMU Q;  4DV7 H;  1SNM A;  1TS2 A;  1IW7 D;  3RN5 A;  4YQW A;  2VQF H;  2K05 A;  3N6X A;  4JI0 Q;  2HIX A;  4A3I H;  2BQU A;  5KFA A;  4PG3 A;  4B3M H;  2B2V C;  2W9C A;  3GTP A;  1PFB A;  3GTL A;  4HJ9 A;  3CCQ A;  2K5V A;  4MNO A;  4AQY L;  3HOV H;  3GTG B;  4BBR B;  4F4Z A;  3IN5 A;  5H1S E;  5LP6 F;  3HOX H;  4LFA L;  4EG0 A;  1SMY D;  4HQ6 A;  1EY0 A;  5JPN C;  4RB3 C;  2FPG B;  4JV1 A;  3X3N A;  2PZW A;  2C00 A;  4LSX A;  4QQB X;  3HOZ G;  1IBM Q;  1PRT B;  1TS4 A;  3PMF A;  5IOC A;  5ELF A;  1VQF A;  2AUJ D;  4KMU C;  4YCV A;  2PCF B;  5CR3 A;  4JK1 C;  2Q2T A;  2ENB A;  3N6R A;  2DJF C;  2KED A;  4A3G H;  3T1Y Q;  1TY0 A;  3H94 A;  4J9K A;  5I9O A;  5LMU L;  5M5W H;  1Q82 C;  1S0N A;  4JI0 L;  2B63 H;  4IN3 A;  1O7Z A;  2OQ0 A;  3KUP A;  5IYC G;  3PF5 A;  4IOA A;  1PH2 A;  4CJ1 B;  2R86 A;  3NEL A;  2O2L D;  4IZ8 A;  4DNI A;  2NUC A;  3I4M H;  2JA7 G;  2RQX A;  1H9M A;  4L63 B;  5M3M G;  3PO3 G;  3I3C A;  1BNC A;  4IRD A;  3HOY H;  4MV8 A;  4QWC A;  4DL3 A;  3FKI H;  1M7J A;  4JI3 Q;  2Y0S A;  1RK6 A;  5ELO A;  4ZHQ F;  4B3T H;  2FHT A;  4DKA C;  2LY7 A;  3D6C A;  1WTR A;  3PIP A;  3KLW A;  2EOT A;  5CA1 F;  4NXN H;  1IBM L;  4A93 H;  3SE7 A;  3NP8 A;  2PN1 A;  4WRD A;  3WNZ A;  4CC6 A;  2J6U A;  2ZT9 C;  1SE3 A;  4KJN A;  1S5E D;  5IIF A;  2E2D C;  3T1Y L;  1CZW A;  2KHJ A;  1VQB A;  2D0P A;  3FMA A;  2XVS A;  4GN5 A;  3Q8P B;  3I4N B;  5C4X B;  3K7U C;  1VF5 C;  2CVR A;  3DWA A;  2MNA A;  1Q12 A;  5KT7 A;  2ZXP A;  1V1P B;  1CHQ D;  1CKN B;  1K83 B;  2AWN A;  3QB3 A;  2K5W A;  2LS0 1;  1DZ1 A;  3S9W A;  1TII D;  4FBU A;  5EWF A;  1SNC A;  3NWS A;  1QZG A;  1AN8 A;  3HOV G;  4X64 H;  2UU9 H;  4JI3 L;  4WOR A;  1KNE A;  1LT4 D;  2RDH A;  4GC6 A;  2ATL A;  1MIU A;  3J80 i;  1KTK A;  2M2L A;  2ZM6 L;  4BBS B;  5DLF A;  1QVF A;  2E2I H;  3K80 C;  4EBC A;  4F4Y A;  2VA2 A;  3J80 c;  1E2W A;  2FMC A;  5CGK A;  2Z6K A;  4QF4 A;  1LAC A;  5FK9 C;  4BS9 A;  3S1R H;  3EN2 A;  1Q81 C;  2YS6 A;  3CD6 A;  3HRZ C;  1GSO A;  2VZA A;  5EJW A;  2I87 A;  2D9U A;  5D3D A;  3QFF A;  5K5P A;  3BAA A;  3V6K A;  2UXC H;  1K73 C;  4YJ2 F;  1G51 A;  2B2Y A;  1LO5 D;  5FPO A;  1CFM A;  1KJQ A;  4O1N A;  2R8K A;  3QOL A;  4OL7 A;  1H9R A;  4IFD J;  5BPH A;  4YHH H;  1CUK A;  1JOO A;  2B63 G;  3VPB A;  2HQE A;  1FNU A;  2UXB H;  2ASD A;  1LAB A;  1S4Z A;  2K04 A;  1CS0 A;  3I4M G;  2I46 A;  5IGC A;  1A15 A;  4X66 Q;  5DQH A;  1TWF H;  2B2V A;  3FKI G;  4P71 A;  1S5C D;  2YTY A;  1BO0 A;  1T5X D;  4GLA C;  3R8B A;  4IPD A;  2L0C A;  4KY7 A;  1I6H B;  5C0X G;  2R6F A;  3PZP A;  1EYA A;  3LWU A;  4RHS A;  4KHV A;  5BN3 A;  4X62 Q;  2F0W A;  3MEF A;  1I50 B;  4C3H G;  2AUK A;  4A93 G;  2LSS A;  1RHP A;  5FJ8 H;  1LM0 A;  3Q0A A;  1TWG A;  5IGB A;  4R8U A;  3HOW G;  4YR0 A;  4MV4 A;  4DXG A;  1E4E A;  2NVY H;  1GD7 A;  1QUQ B;  1TWH A;  2RGR A;  1CHP D;  1SNO A;  3ER0 A;  5CA0 F;  1EY9 A;  2R7M A;  3J81 W;  5KFI A;  3GO5 A;  5EWG A;  2AQ1 B;  4RHR A;  1QCB D;  5IT9 L;  1I7L A;  3LML A;  3U9T A;  1VCI A;  3TZU A;  3RBE A;  2HIV A;  1C48 A;  1Y1W B;  2IY5 B;  1L1O B;  3HP3 A;  5IWA Q;  2VUM A;  4X66 L;  3GTO B;  5D1O B;  1QB5 D;  3RB0 A;  1GXD C;  3MZ5 A;  3DF7 A;  4A3J B;  3S2D H;  5C1O A;  3BYT B;  1VQ4 A;  4LMQ D;  2ZTE A;  2YRW A;  4YB8 B;  4FXD A;  3S14 H;  1EY7 A;  4F88 A;  2O4X A;  2A68 C;  1W96 A;  4QCL A;  4PQX A;  4X62 L;  4R4O A;  3CC4 A;  4HAE A;  1LTG D;  3BZD B;  3W3A A;  5ISR A;  2EZV A;  1S40 A;  3CQZ A;  1Y69 U;  4JOI C;  2R7Z B;  2RA4 A;  4A3B H;  2ALZ A;  3Q1K A;  4V19 0;  2R92 H;  1VBH A;  3QOJ A;  4HR7 B;  2EY1 A;  3BG3 A;  2F3I A;  1XNQ Q;  3S16 H;  1ET9 A;  2NZO A;  3NWT A;  3P7J A;  1NMG A;  2CFM A;  4EEQ A;  4FVM A;  2DJG C;  2C2R A;  3SVM A;  1LTR D;  1CQJ B;  3MXP A;  1R4P B;  4YY3 Q;  3T16 A;  1N48 A;  2JA6 B;  4YR3 A;  1ENC A;  4M1U B;  2F0M A;  1PMR A;  5IWA L;  4LF6 H;  1B50 A;  3SI8 A;  1V4Y A;  5DGB A;  3V6J A;  4IUQ A;  1HR0 Q;  3Q24 A;  2ES2 A;  4ALP A;  1RYR A;  2DN8 A;  1CK1 A;  1LTL A;  2AQ3 B;  5ELD A;  5EPJ A;  2UVW A;  2B63 A;  3AFP A;  1XPU A;  4AQY H;  1N56 A;  2C9O A;  4J9O A;  1JE5 A;  1CSQ A;  4LFA H;  5DG8 A;  1XNQ L;  3MWD A;  3BQ2 A;  3K5L A;  3F2C A;  3GTP B;  2W9C B;  4DR1 Q;  3ETH A;  3GTL B;  3AMU A;  1RK5 A;  3FKI A;  3M4I A;  2KCT A;  4EGQ A;  4YIJ A;  1PTO F;  1I4X A;  1GOZ A;  1LT6 D;  4WBN F;  1NR4 A;  3OSO A;  3M4O H;  4HID A;  2WII B;  5IP9 H;  2UXD Q;  4HNV A;  4ECU A;  1CKO A;  2RSO A;  4A2B A;  5FLM G;  1AZQ A;  2NUA B;  2AGQ A;  1RJT A;  4HJA A;  3NXW A;  2JYO A;  5KT5 A;  4ECY A;  4IQZ A;  2Y0S E;  5LMU H;  4Z9C B;  4IUT A;  2NVX H;  3IFD A;  3PVX A;  4JI0 H;  2OF1 A;  1N8R C;  1UNN C;  3N41 B;  4Q8F A;  2P0A A;  2K6A A;  2EYM A;  3E6Z X;  1EFI D;  2NN6 H;  5I6W A;  3GTJ B;  1HA6 A;  2VQE L;  5KFR A;  1EOT A;  3STB C;  4LFC L;  5FO7 B;  4DNT B;  4A3B G;  1VQO A;  3D0F A;  3BA9 A;  2R92 G;  4EQN A;  2XIW A;  1S5F D;  4JV0 A;  1I94 Q;  3CCS A;  3ULL A;  3DXJ C;  1SXT A;  2XTI A;  4K14 A;  4CDF C;  4DV6 H;  2R3Z A;  4LNQ A;  1A62 A;  1CT1 D;  2XRS D;  3OIP A;  1I4R A;  1JOR A;  2PZU A;  1KAW A;  3RD4 A;  2UXD L;  4BWS C;  4K0K L;  1E7Z A;  2IX1 A;  2E2I A;  2Y0S B;  2K5H A;  1A3U A;  1DCZ A;  1UC8 A;  4PMW A;  2V58 A;  4O3P A;  4HCS A;  3A7L A;  1EUD B;  1KAB A;  5GQO A;  3CCU A;  4UCT A;  1WJJ A;  1MSH A;  4QL5 A;  4GLX A;  3R3O A;  1EUC B;  5D1P A;  2A68 D;  3RZD B;  4MTE A;  1O80 A;  2F0G A;  1SEB D;  1B33 N;  3WDN A;  1PHJ A;  1NUC A;  1RF2 D;  3CU7 A;  3HKZ G;  4LF7 Q;  3CKI B;  5G3L D;  1KD1 C;  2EIF A;  3KFU A;  5M5X H;  1KDB A;  2L11 A;  3VYU A;  3ORQ A;  3PO2 G;  1EIF A;  4JOI A;  3HFZ B;  5LL6 S;  4KHP H;  1I94 L;  3RZO B;  1YNJ C;  2ZM6 H;  5KFZ A;  4DUY H;  4A3K G;  3Q2O A;  3KYH C;  2J6S A;  3JAM E;  4H13 C;  5EBD A;  1TWF A;  2K33 A;  5T1I A;  1SN8 A;  3CCM A;  3MXN A;  3VYS A;  2VL6 A;  1X54 A;  1HZA A;  3L3O C;  1PK8 A;  4AYB A;  1I3Q H;  4TQR A;  4HMJ A;  1PZJ D;  4LAA A;  4DR3 L;  3OMC A;  1Q7Y C;  4BY1 H;  1QNU A;  3P75 A;  1B44 D;  2NVY A;  4DAM A;  5EKL A;  1B7Y B;  3T13 A;  4NMZ A;  1RD9 D;  1XMQ H;  4LF7 L;  4YAJ B;  2A73 B;  2NU8 B;  4A2A A;  3RUP A;  4YP3 A;  3GQB A;  3FPP A;  5KG6 A;  1VQK A;  4LUZ A;  2HHH Q;  3FHW A;  1HNW L;  5DGA A;  3H0G H;  3I55 A;  1BVS A;  2F0S A;  3IKJ A;  1RJR A;  3T1H Q;  1ILQ A;  4X65 Q;  5DEH A;  3JSN A;  1JWS D;  3I90 A;  4JBW A;  2FP4 B;  3HOZ B;  3OTO H;  3V4Z A;  1CI3 M;  2E75 C;  3NTI A;  2PPB C;  4C5C A;  3O13 A;  2NN6 I;  1STG A;  2KSW A;  2F3W A;  2A6E D;  3PW2 A;  3K59 A;  1MJC A;  3RB4 A;  2YS7 A;  4MV3 A;  1V51 A;  5J2U F;  4KJO A;  1WTO A;  2R92 A;  4R8U B;  4PZ8 A;  4C3J H;  1SYG A;  1E4F T;  1J5E Q;  2W6Q A;  4XZ3 B;  4O3O A;  1VMC A;  4P2C B;  2UUB Q;  5DLG A;  1ZXT A;  4J9L A;  1TWH B;  3PO3 B;  1BXT A;  1X6O A;  1EY5 A;  3STB D;  2W7O A;  1YBY A;  3NBI A;  2BA1 A;  4J9S A;  3NSW A;  1EIY B;  2V4R A;  1STB A;  4DXF A;  4QUF A;  4A3F H;  3P20 A;  3R93 A;  1GUS A;  1EYC A;  2HHH L;  1X32 A;  3T1H L;  4X65 L;  4QJF A;  5JAV A;  3GTK H;  1SDF A;  3SK5 A;  1EZ1 A;  2JA8 H;  3RLO A;  4DV4 L;  1A6X A;  3C46 A;  3EJI A;  3PV0 A;  2VUM B;  3T5K A;  1ZYR C;  4IO9 A;  4C3I H;  5KG3 A;  1SYB A;  1PYS B;  4HJ5 A;  1EYG A;  3JRX A;  4EYI B;  5EKK A;  5ELE A;  1BCP B;  4FF2 A;  4TSS A;  4JI2 H;  4Q8E A;  3HKZ A;  4BWG B;  4J9Q A;  1F9R A;  3KF6 B;  5IT9 W;  5CC4 A;  2K5D A;  3CQZ B;  1R9T B;  3H3V H;  4GKK Q;  2VPS A;  2AKW B;  1WD0 A;  3M9M B;  4IUP A;  4H44 C;  4A3I B;  1J5E L;  5FD6 A;  5DG9 A;  2UUB L;  2G9H D;  4DUZ Q;  3A7A B;  4BXX H;  2GPS A;  3CW2 C;  1UWV A;  3I7F A;  3L9A X;  1TA8 A;  4ZI7 F;  5KFW A;  2HQL A;  1F77 A;  1L0Y B;  3IAY A;  5CV8 A;  3WOF A;  2R93 G;  2OLS A;  3G8C A;  3M9O B;  3HOX B;  4C5B A;  1YNJ D;  2RVL A;  2F0N A;  4FXG C;  3H0G G;  1ENF A;  1HNX Q;  2OQK A;  3S2H H;  3G6J B;  5J2T F;  3GLK A;  2W8L A;  3HZX A;  4ODG A;  2RCN A;  5EPL A;  1STN A;  2NBF A;  2NVX A;  3SDZ A;  2W9A A;  1HTL D;  2HVQ A;  2MUY A;  1MKH A;  4QWA A;  2RSN A;  3GIL A;  2CW8 A;  1C7Y A;  4DR2 Q;  4A3G B;  2I80 A;  1XNQ H;  2IP4 A;  4QWB A;  4QW8 A;  4FO2 A;  4LK1 C;  5M5W B;  2CQY A;  2KBN A;  5C4Z A;  3S17 H;  4C2M H;  2B63 B;  1HFN A;  1FVI A;  4ZCK A;  2HDM A;  5KFT A;  2NVQ H;  3CHB D;  3VR5 A;  4JI6 Q;  1IL8 A;  2R82 A;  2BE5 D;  2X69 A;  5E3F A;  4A3M H;  2XRQ D;  1SFO B;  3D31 A;  3HOY B;  3HEJ A;  4CDC C;  3FKI B;  2O5J C;  4A3F G;  2K50 A;  1LUZ A;  3H3V C;  4FXK C;  3AEV A;  3HOU H;  2KVM A;  5KT6 A;  4J6H A;  5A2Q L;  1HNX L;  2JA8 G;  3DWP A;  4JI4 Q;  4MV1 A;  1PTO H;  2VQE H;  4DV2 H;  4G57 A;  4UDU C;  4CBV A;  4LFC H;  4XQN A;  4RFB A;  5DAU A;  1MD2 D;  1HHV A;  1IW7 C;  1S68 A;  5FLX L;  2Z4I A;  1QG7 A;  1LYL A;  2XWJ B;  4FP5 D;  4DR2 L;  3GV7 B;  3RFC A;  4OEL B;  2QKI C;  4EGV A;  3OHA A;  4JI8 Q;  5C6A A;  1HQR D;  1IYJ B;  4KV6 A;  2RKS A;  2EVB A;  3BDC A;  2W57 A;  2SCU B;  2F0L A;  3A55 A;  4JI6 L;  5IYZ F;  4YR2 A;  2K5Q A;  3OOC A;  4K0K H;  2ATW A;  1HR0 W;  1SMY C;  1F9P A;  4BXX G;  1GHK A;  4EEY A;  4KD4 A;  5KND A;  2RCF A;  5KFM A;  4M8A A;  5LOV F;  4J9R A;  2Z1C A;  2JSO A;  1I3Q A;  3RLN A;  4UCR A;  4ZKB B;  2E2I B;  1F2Y A;  4RKL A;  3H3V I;  2PNH A;  1KDA A;  1Q1B A;  2D5D A;  4XXE A;  4DV3 Q;  2CZG A;  5I47 A;  3TRE A;  2K32 A;  1AFP A;  3TP6 A;  3S1R B;  2QYZ A;  3Q23 A;  3C0F B;  5L1J A;  4IUV A;  4AYB E;  2KQ3 A;  4MAM A;  4ED7 A;  1Q8I A;  3F2B A;  3TZD A;  3RAQ A;  4MA5 A;  2R6G A;  1I94 H;  1D6E C;  2BCO A;  1IHZ A;  2VB3 X;  4K8J A;  3U9O A;  3J81 j;  1DJR D;  2A6H D;  4IUU A;  2PQE A;  4JI7 Q;  1JLL B;  4EFB A;  4FM9 A;  2CW0 C;  2F0P A;  3H0G A;  4NXM H;  3PQI A;  3SK4 A;  1PTO C;  1XXG A;  2XGQ A;  3DEP A;  2E8G A;  5DM6 3;  1I7N A;  3OYY A;  3T51 B;  5CB4 F;  2BA0 A;  1BBW A;  1HXY D;  1YHQ A;  3GTM H;  3K3V A;  1JC7 A;  4DR3 H;  2YL2 A;  3ULP A;  5EWE A;  3MXN B;  3NPP A;  4QWE A;  2I07 B;  4AYB B;  4KTA A;  3G71 A;  1KEE A;  1HA5 A;  1FR3 A;  1HZ9 A;  3VR6 A;  1V1Q A;  2OWO A;  1F9Q A;  1JWM D;  2IW3 A;  3MR2 A;  2JEA I;  3RBD A;  2HUG A;  1S0O A;  2OT2 A;  5IYC H;  2NVY B;  1UE6 A;  4HIK A;  4OX9 Q;  1HNW H;  4FS2 A;  3NTH A;  2JA7 H;  4YWM A;  1AE3 A;  1OXT A;  2WAQ A;  1JE4 A;  5LMN Q;  4JI7 L;  1WR2 A;  1Y1V B;  2DWC A;  3F8T A;  5E4W C;  1JB7 A;  4KN7 C;  2FJ2 A;  2F0E A;  3GTK A;  4AH6 A;  5C4J B;  5BR8 H;  1NTG A;  1J9O A;  4RCN A;  1A63 A;  1IOW A;  4DV0 L;  2E5L Q;  1CM9 A;  4GZY C;  3OWE B;  3S2D B;  1VQM A;  1PVO A;  3AFQ A;  1D5X C;  3S14 B;  2KCN A;  4TV8 F;  1EYD A;  3D4D A;  3KJP A;  1SMX A;  1GHJ A;  4A4I A;  2NB0 A;  1O7Y A;  3VA5 A;  3H91 A;  5JJK A;  1JOK A;  2A74 C;  2VB2 X;  3KBX A;  4L6T B;  4JI5 Q;  4UCS A;  3BG5 A;  5KNC A;  5FPR A;  4ZUI A;  3TRZ A;  4A3B B;  5BPF A;  3PIO A;  2R84 A;  1PRT F;  1XTC D;  2R92 B;  4EQO A;  4H7B A;  5KNB A;  3EFX D;  4OX9 L;  2VR1 A;  3HKZ E;  1HJP A;  3S16 B;  4X65 H;  4F50 A;  3K7A H;  5ELB A;  5LMN L;  3GII A;  4UP8 A;  5GAG C;  4DV4 H;  3NHH A;  4ECT A;  2R8I A;  4RB2 C;  1Q1E A;  4JI1 Q;  4FNF A;  4E6I A;  1AH9 A;  4EQ5 A;  2QEX A;  1VQ6 A;  2P5Z X;  2ZJP A;  1GM5 A;  3BA8 A;  5F9N A;  2K75 A;  4U67 3;  3PR5 B;  4DR5 L;  4ZK9 B;  1N36 Q;  1NCV A;  2W6P A;  2V9W A;  1J5E H;  3Q8D A;  4GS3 A;  2Q2U A;  2KEN A;  2UUB H;  1B04 A;  4JI5 L;  4F8M A;  2E2J H;  3EA6 A;  5FD5 A;  3KOJ A;  3VMM A;  1E24 A;  4C2M A;  1KHI A;  1S03 G;  4MIU A;  4HIM A;  1QOH A;  3A8K E;  1PZI D;  1QVG A;  5KFL A;  1YJ9 A;  3J7Y W;  2PI2 A;  4Q45 A;  4ZQI A;  1I6V C;  2MO1 A;  2V4D A;  4JVZ A;  5CV7 A;  1VQI A;  4A76 A;  3M9N B;  2E2H H;  3RAX A;  2EE1 A;  1KDC A;  3G4S A;  2CKZ B;  4NLG A;  2FKL A;  1OXX K;  2CW0 D;  1HNZ Q;  2LMC B;  1ICW A;  3TIG A;  1PTO D;  2UUC Q;  1SE2 A;  3M4O B;  4TKO B;  5D65 A;  3PW7 A;  5NUC A;  5C0X H;  2F0K A;  3FRP B;  3IL8 A;  2N55 A;  1ILP A;  5CV4 A;  1DM0 B;  3BVZ A;  4DGZ A;  5GAE C;  4C3H H;  1JB3 A;  2TSS A;  4IOC A;  5D8D A;  2BDN A;  1HQM C;  5JEA J;  4J9M A;  4ED3 A;  3HOW H;  2NVX B;  3JAM i;  4EBD A;  1F2M A;  4CDD C;  1VDZ A;  3H15 A;  3JAM c;  3KDF A;  2YRX A;  3SK8 A;  1G2T A;  2X6G A;  5C3E B;  1R4Q B;  2N3S A;  2JK8 A;  4ECV A;  1IBK H;  2R8G A;  3R23 A;  5JVH 3;  3OIQ A;  4YWL A;  4X6A H;  1U4M A;  1PFN A;  4P73 A;  2D2C C;  5D14 A;  1C4Q A;  4R8N A;  4IWX A;  1AW7 A;  1HNZ L;  3U4V A;  4BY7 G;  1EIH A;  5C5J A;  2UUC L;  2J6T A;  3OMG A;  3EYY A;  2FJZ A;  3M3Y H;  1W2B A;  4R4I A;  1EIG A;  4DLK A;  4CJ0 B;  2YV5 A;  2JEF A;  1EY4 A;  4L5Q A;  4A3E G;  1BNZ A;  4DR6 Q;  2R7K A;  2PNR C;  4M7E A;  1EOV A;  2MGS A;  4DR2 H;  4A75 A;  3PUY A;  5KFB A;  1E3P A;  4ZUJ A;  3RNU A;  4RA8 A;  1PZK D;  2MJ8 A;  2F0H A;  3M4Q A;  4RNO A;  4ZLT F;  4HSP A;  4LF4 Q;  3URY A;  4POF A;  3ERQ A;  2FFK B;  5A2Q W;  4ZRZ A;  1F2L A;  1X3G A;  5M5X B;  4ED0 A;  5J1Z A;  3NBH A;  5KFS A;  4JV5 Q;  3GID A;  4FF3 A;  2QCP X;  2ZDG A;  1DIK A;  3Q22 A;  1NY4 A;  1Z7T A;  3F2D A;  2DLN A;  1NMF A;  4YJ3 F;  4P74 A;  4K2L A;  5AJ3 Q;  3MEH A;  5FLX W;  1NE3 A;  3GTM A;  4LFB Q;  2LXK A;  3G6X A;  4LF9 H;  4CKE A;  2B2U C;  3UDI A;  4JYA Q;  5JUM A;  3L0O A;  1C9O A;  1ASZ A;  3JSL A;  3BJY A;  4UP9 A;  2PW7 A;  5C44 B;  1I3Q B;  1LT3 D;  3K5I A;  3UE1 A;  1DGS A;  1SE8 A;  1KRS A;  3HBL A;  2Z4H A;  4DAY A;  3KHH A;  4UHV A;  1DV1 A;  4BY1 B;  2I0Q A;  2EY6 A;  4LF4 L;  2BDO A;  4LUV A;  3EPI A;  1GUO A;  2BH8 A;  1U5K A;  3RMH A;  2JA7 A;  4GNX C;  5JVD F;  4FU0 A;  2RGV A;  5A35 A;  3N8D A;  4C56 C;  3CCL A;  1XYI A;  3PW4 A;  1OXV A;  4N9T A;  5C0X I;  5IT9 E;  1OTC A;  4JV5 L;  1A3T A;  5CV9 A;  3M7N A;  4LF8 Q;  3MWE A;  2GLT A;  1FJG Q;  2JP1 A;  5AJ3 L;  2WAQ E;  1XNR Q;  1Q90 A;  5FLM H;  4LFB L;  1B53 A;  4A3L G;  3GIM A;  5C5M A;  2MP1 A;  3AU7 A;  5IYD G;  4JYA L;  3VR3 A;  4UCV A;  5KFX A;  2L12 A;  2PQA A;  4IUR A;  2K28 A;  2W70 A;  2CQA A;  1K3B C;  1TS3 A;  4LH7 A;  3NTK A;  4HSV A;  2IMW P;  1VQE A;  1U4P A;  5J39 A;  1LTA D;  5M9O A;  1RJP A;  4GKJ Q;  4C3J B;  1PFM A;  1ML0 D;  1PX2 A;  2EJF C;  1VQJ A;  1JDB B;  3VPD A;  3WO1 A;  1L2Z A;  1TU2 B;  4DV0 H;  4KK7 A;  1HTP A;  2WAQ B;  3R2I A;  4MN3 A;  2AU0 A;  4DL4 A;  3ND8 A;  1CTM A;  3ONA B;  4K5W A;  5KFV A;  2NU9 B;  5CBE E;  4UY8 C;  1M4V A;  4JW0 A;  1O7I A;  5ELC A;  4YCW A;  4KI0 A;  1XPR A;  2WIN B;  1GKH A;  3F8N A;  1L0X B;  4C3I B;  1LTB D;  4JCV E;  1CA5 A;  2FLP A;  1VAJ A;  2GPW A;  1ET6 A;  3QO2 A;  4OGQ C;  1N9W A;  3LGJ A;  3D3R A;  2HCC A;  3SE0 A;  5KGU A;  1K28 A;  1X55 A;  2BOS A;  3KLS X;  3R2T A;  3LWE A;  1B9N A;  3L4J A;  2FB9 A;  5KIX A;  2L9H A;  3KK7 A;  2JE6 I;  4HCE A;  5LMN H;  2WP8 J;  1ZKO A;  3ICE A;  1UEA B;  2R61 A;  3I73 A;  1D5M C;  1D8L A;  3PO2 H;  5I6Y A;  4B3R Q;  5IGE A;  4A3D H;  3I72 A;  5DLQ E;  2C2D A;  4O42 A;  5DQG A;  1YJN A;  4A3K H;  2E2H A;  1EWH A;  2QA4 A;  1SYX B;  2WTF A;  2PI2 E;  3KAJ A;  2XC9 A;  4DR5 H;  4YY3 L;  4FF4 A;  2QDB A;  2ZTC A;  1DV2 A;  4IR1 A;  5CBA E;  4FF1 A;  2UVV A;  5GAH C;  2A6E C;  2IHE A;  3OUU A;  4EFE A;  5M3F G;  3BZC A;  3SK6 A;  1HR0 L;  3KHG A;  1S5D D;  5LMN W;  1WCM H;  3KHR A;  2JA5 H;  4Q0Y A;  3B6Y A;  1EFW A;  1U0L A;  4UAI A;  4O2B F;  3BDO A;  1KJJ A;  2B2U A;  3I4L A;  3T53 B;  4IPG A;  2HCI A;  5M5Y H;  3J81 c;  4C2M B;  3S17 B;  1AUX A;  1E2V A;  5KT3 A;  1EZ6 A;  2JN4 A;  3E3X A;  4KHZ A;  5TSS A;  4B3R L;  1YI2 A;  1CQV A;  4RGO S;  2C28 A;  1TS5 A;  2QK4 A;  4N8F A;  1WTP A;  2VY3 A;  4DV5 Q;  4DR1 L;  1B70 B;  2UUA Q;  4A3M B;  3OUZ A;  4MV6 A;  5KG2 A;  5LL6 X;  2CW7 A;  1GUG A;  1DD2 A;  1JKJ B;  4QIW A;  2WB1 G;  3CCJ A;  2Z0S A;  1JX4 A;  1IBM H;  3HG9 A;  4GNX A;  4TV9 F;  5I9P A;  3HOU B;  3N40 P;  1IXR A;  1JXL A;  3V05 A;  1KJ8 A;  1B6R A;  4G4K A;  3M9B A;  3A5U A;  3T1Y H;  4R4T A;  2O5I C;  4DL7 A;  4OHJ A;  3C2P A;  3GV3 A;  4I55 F;  4I4T F;  2CH4 W;  5KFY A;  3C3L A;  3ND9 A;  1FL0 A;  1KXL A;  2HDL A;  2RDI A;  3KDF B;  1J8I A;  1SYE A;  1HNZ H;  5IE8 A;  4K5V A;  2RDJ A;  2UUC H;  1EEF D;  1RIP A;  1RTO A;  4Q5V A;  3TP8 A;  2QW7 A;  1PH4 A;  1JMC A;  3VYR A;  4JI3 H;  1S5B D;  4A3D G;  1XTD A;  4FYD A;  1IOV A;  4UPA A;  2UUA L;  5D3I B;  3CC2 A;  4IPH A;  4XYL B;  3ERS X;  1XPO A;  1AUV A;  3F2U A;  2MCT A;  2GA4 B;  2GVB A;  1EWI A;  2SOB A;  4ZQ3 A;  2OCE A;  5HGT A;  1H95 A;  4X3S A;  1PH8 A;  1Y8P B;  3FDS A;  4RUC A;  3KXY T;  3GP7 A;  4RB1 A;  3J7A V;  2EQS A;  2MFI A;  4OIJ A;  2WYO A;  1N33 Q;  1GO3 E;  2MO0 A;  1WCM G;  2JA5 G;  2PBZ A;  4IRK A;  3H4D A;  5K36 G;  2W9B A;  1TXY A;  5FOB B;  1XMO Q;  2ZJR A;  2BE5 C;  4F4W A;  1PA6 A;  3RTX A;  4HNU A;  2XCA A;  1VBG A;  2R93 H;  5IGG A;  1X56 A;  5FO8 B;  3CME A;  2NWG A;  3NK9 A;  3GTM B;  3CVZ A;  3R5H A;  3G6Y A;  3PF4 A;  3U9S A;  2Q2I A;  5KFJ A;  3AB9 A;  1DOM A;  1KAA A;  2F4V Q;  4LF4 H;  4RKB A;  4L5T A;  2KA7 A;  4R8I A;  4DNR B;  2F0Q A;  2XN9 C;  4B3S Q;  2VUG A;  3I4N G;  2VQF Q;  3J80 L;  4DAY B;  1BR9 A;  5C4X G;  2R85 A;  1TWG B;  1BKB A;  1UAP A;  1UE1 A;  1O78 A;  3BVG A;  1BCP F;  1WTQ A;  1G6P A;  1E4E B;  2DUD A;  4G3I A;  2JA7 B;  1FNV A;  5M3M B;  2XGP A;  2XCL A;  4LFB H;  3LWB A;  2VQD A;  1OXU A;  1YNN D;  4HMI A;  2ASB A;  4X66 H;  4LUO A;  1L2F A;  1EEI D;  2WAC A;  4JYA H;  4BBS G;  2KCM A;  3GV6 A;  4DL6 A;  3LX0 A;  4X62 H;  5DM7 3;  1G6Z A;  4ZAI A;  4LH6 A;  1K83 A;  4IRC A;  3K57 A;  1EL0 A;  4ED6 A;  5F2D A;  3MR3 A;  2VA3 A;  3ZJY C;  2F4V L;  1WI5 A;  1KQS A;  4XT3 B;  4OEM B;  4XX0 B;  4O3N A;  4B3S L;  2VQF L;  2LFN A;  4OWW B;  4JG2 A;  2A6H C;  4GLV B;  3CC7 A;  4BA1 I;  4ILW A;  3H20 A;  3I56 A;  1J6Q A;  4LSA A;  3K3P A;  2EJM A;  3K7A B;  2KHS A;  5IWA H;  2WFW A;  4KY6 A;  4IJH A;  2A19 A;  2XIG A;  4KY5 A;  3HOV B;  1VQC A;  5EGT A;  4B3T Q;  4CJ2 C;  2F0I A;  2HJW A;  5L1L A;  3UI2 A;  2F52 A;  1IYU A;  3SXH A;  3E9I A;  4TQU S;  3U50 C;  1JT8 A;  4K2K A;  2NZH A;  3Q8S B;  3KF8 A;  4NXN Q;  2AHO B;  3KLS A;  2QF7 A;  2FPI B;  5IYB H;  2EY5 A;  1WCM A;  2JA5 A;  5CAE B;  2DPI A;  1H9S A;  3PUZ A;  4KKS A;  5KYL A;  2W6Z A;  4ME3 A;  1STA A;  4ECQ A;  2B2T C;  1AE2 A;  3QIA A;  2HT1 A;  2CH4 A;  4Y7N H;  4GKK L;  2FMM A;  3CCV A;  3CAM A;  3HKS A;  3W5O A;  1S72 A;  2ZDH A;  2NZ1 D;  1W6K A;  4WJW A;  3S1Q H;  1ZHS A;  1S9F A;  4IAL A;  2SNS A;  4DUZ L;  4YY3 H;  4ECW A;  1Y1W G;  2L1B A;  3I4M B;  3G6E A;  2E2H B;  4A3J G;  4OO1 G;  4HTH A;  2RF4 A;  4X64 Q;  2UU9 Q;  4F87 A;  3NE5 B;  5T14 A;  2IA6 A;  1HR0 H;  5A2Q E;  3MVV A;  2K14 A;  1UE7 A;  4F7X A;  1AZP A;  2L5T A;  2BR0 A;  3E0J A;  1M0W A;  5KFD A;  3GTJ H;  3DM3 A;  1GUN A;  1LT5 D;  2EXD A;  4QIW E;  3A0J A;  1HCZ A;  1MGS A;  4C3H B;  2R7Z G;  1W3S A;  4A93 B;  5J3B A;  2W71 A;  2IX0 A;  2FK3 A;  3PGZ A;  2UXC Q;  2EYP A;  3PUV A;  3HOW B;  3S15 H;  3Q8Q B;  2FMA A;  3WWV A;  4B3R H;  4L5S A;  3A8I E;  4UCU A;  4IZO A;  5HV6 A;  3Q6S A;  1SYF A;  2SDF A;  4DR1 H;  2K52 A;  5I4D A;  3DWQ A;  5KRU A;  1UC9 A;  3FVQ A;  2UXB Q;  1PLF A;  4RGN A;  1Y14 B;  2JA6 G;  2UXD H;  1WOC A;  1NAP A;  4DK6 C;  4RU9 A;  2A69 D;  5KFF A;  1QNK A;  4QB4 A;  4DU9 A;  2DIK A;  3TSS A;  2YTX A;  1YHB A;  2CCZ A;  4U6P A;  3J81 E;  3RZD H;  1ASY A;  3M3Y B;  3UFX B;  2E76 C;  4GNX B;  1CA6 A;  4L5R C;  1D7Q A;  4V0B A;  1BXR A;  4K6L A;  5IP7 H;  1QVC A;  1VQG A;  3RB3 A;  4JI4 L;  1C3O A;  1KLU D;  3MTS A;  4X3U A;  5G3L F;  2FPP B;  4XQQ A;  2UXC L;  2N8N A;  1BJT A;  5IYB G;  1WYD A;  5IT9 c;  1TWC H;  2E74 C;  2AQ2 B;  1S0M A;  1N34 Q;  1M6V A;  2Z6B A;  4DR4 Q;  1HPC A;  3RV3 A;  4JBJ A;  3W2D A;  3E9H A;  4JI8 L;  5J22 A;  4QWD A;  2KHI A;  2R93 A;  3FPU B;  1YNX A;  1KRT A;  1WTH A;  2UXB L;  5KFE A;  4XQJ A;  2B8F A;  1XWE A;  3TEH B;  4POG A;  4BA2 I;  3RLF A;  3FMC A;  1I50 A;  2RDG A;  3GIP A;  1PV4 A;  4JC0 A;  1JCK B;  2K1B A;  2A8V A;  3I4O A;  1TWF B;  5IY0 A;  2LKV A;  1ULZ A;  5EOY A;  3EPG A;  5KFK A;  2MPM A;  3ORR A;  1QJO A;  2L15 A;  4DV3 L;  4CKB A;  1SEI A;  2ID0 A;  1HZB A;  2NTS A;  4LF7 H;  1TWA H;  2ASL A;  2C5C A;  3DLL A;  1SYC A;  2WKC A;  1N34 L;  2W6M A;  5EAY A;  1WD1 A;  4DR4 L;  3RGX A;  4QW9 A;  1K0R A;  2CWP A;  1WTX A;  4B08 A;  4C5A A;  2W9B B;  4RMF A;  1M0T A;  1X65 A;  1AN7 A;  4ME6 A;  4NB3 A;  5I2Y A;  4H02 A;  1PYW D;  4LW1 A;  3PCO B;  4Q0F A;  2B2T A;  2D0O A;  1YJW A;  2PO4 A;  2ALY B;  4PZ6 A;  3RN2 A;  1SCU B;  2Y0S G;  4IHJ F;  1B3A A;  1BF4 A;  4LF6 Q;  3BU2 A;  1JIC A;  1RKN A;  3RF2 A;  1CKM A;  5CMD A;  4U68 A;  4IFD H;  2IT1 A;  3HB9 A;  3R5F A;  4KN4 C;  2B2W C;  1KJ9 A;  5KFC A;  3CPW A;  3GTQ H;  1EY6 A;  3TII A;  3JAM W;  4P75 A;  1CZG A;  2R7F A;  1FGB D;  4R4Q A;  5IP7 G;  2QGQ A;  2WE6 A;  5IGD A;  2XGT A;  5KG5 A;  1JJC B;  5LXT F;  1ONL A;  1EUJ A;  1T9H A;  4TVA B;  4XIG S;  3CF5 A;  4H0L C;  4PMB A;  4AQY Q;  2R8J A;  2RHS B;  5H80 A;  4QGU A;  2YZG A;  3TBI B;  4LFA Q;  2EPB A;  3PIO 3;  5JJL A;  5KFN A;  1STY A;  5BN5 A;  2HHH H;  2JQO A;  1EYZ A;  5DNF A;  3T1H H;  1EQV A;  1IZ6 A;  5FKA C;  5JEA G;  2J7Z A;  3S1N H;  3SEB A;  5LA6 F;  1K3R A;  3PN1 A;  3WO0 A;  4XT1 B;  1YIJ A;  3N52 A;  3M7G A;  4BY7 H;  1SAP A;  3OHB A;  2ASJ A;  4TQS A;  2IL8 A;  4RH6 A;  4QUC A;  3PW5 A;  3BJU A;  4C1N K;  1LV9 A;  4A3E H;  3J80 W;  1O75 A;  3K5M A;  2E5L L;  5JQW A;  3BAB A;  3MXG A;  3J7A 5;  3V96 A;  4ME5 A;  1R9T H;  4B3S H;  1E4G T;  5C3W A;  3P1H A;  3K0Y A;  2J4X A;  2PMZ A;  1K0S A;  1NBW A;  1E1T A;  3UDX A;  1M90 C;  4O0A A;  3FP9 A;  3QJY A;  3C1F A;  5IGF A;  3MFI A;  5E4X A;  5GON F;  3V2T A;  1S3O A;  2ICE C;  1PH1 A;  3HKZ B;  1TVX A;  3PUW A;  1UEB A;  1MHW C;  2D62 A;  3BYY B;  2NVT H;  4RAY A;  5DG7 A;  4PZ7 A;  3KAK A;  2QIL A;  4UFZ A;  3PO2 B;  5COR A;  1Z2O X;  4A3D B;  4ID6 A;  4A3K B;  3WOE A;  3EVQ A;  4DV6 Q;  3ETJ A;  3S1M H;  4MHE A;  4ECS A;  3K5O A;  2AWO A;  3VDY A;  4P72 A;  3GV5 B;  4EYH B;  2I5L X;  1BBU A;  5IOD A;  4CKC A;  3N42 B;  1XDN A;  2TMP A;  3K5N A;  4JI1 L;  2IBK A;  2LXJ A;  3GTJ A;  3N43 B;  1I4G A;  1I4H A;  2X6L A;  3KF8 B;  4IFD G;  1A8V A;  5CV5 A;  2FK2 A;  3MWM A;  1N36 L;  4QMG A;  3PIP 3;  1JIH A;  4GKK H;  5F9L A;  4IJL A;  1WCM B;  2JA5 B;  1TR5 A;  1H9S B;  2F0J A;  3ERO A;  4UP7 A;  2ZJQ A;  3TQT A;  3DUZ A;  3QZ7 A;  2AGP A;  5C5L A;  1ZEQ X;  2F1M A;  4DUZ H;  1BCP C;  2IHF A;  3PSI A;  1Q86 C;  1SFO H;  5I2X A;  3GIQ A;  5M5Y B;  3K6O A;  2MQH A;  1P16 A;  1S97 A;  4NDX A;  3D4R A;  1F9S A;  3CCR A;  4KHP Q;  2FLL A;  2ZM6 Q;  4DUY Q;  4IFD I;  2F0V A;  3TIN A;  4DV6 L;  2CQO A;  4OXP A;  3I91 A;  3TP5 A;  2KJX A;  4DR7 Q;  1C30 A;  3QG1 A;  2YU9 H;  2VUM G;  1KJI A;  3RV4 A;  3TDQ A;  3MHB A;  2W8K A;  1HNX H;  4A3L H;  1VQP A;  1IBL Q;  1TY2 A;  5GAD C;  5IYD H;  5C3X A;  4O3R A;  3M4Y A;  4J8Q A;  1X3P A;  3GD7 A;  3TQY A;  4XDX A;  1T3N A;  1X3F A;  3I70 A;  3VR4 A;  4I50 F;  2SEB D;  4DL5 A;  1QZH A;  2ZDQ A;  5KT2 A;  1A9X A;  1TWC A;  2EYL A;  3X3M A;  4RNM A;  1B2T A;  1FGU A;  4A3I G;  1SRO A;  1PDQ A;  1H9J A;  5L1I A;  3A8J E;  1EHI A;  3UDF A;  4JI6 H;  1XMQ Q;  2B2W A;  1GVP A;  3HGB A;  5KG1 A;  4RAZ A;  4X3T A;  1XX8 A;  4ZOL F;  1E22 A;  2F3V A;  2IPK D;  4KHP L;  2X0S A;  3HOX G;  2XD4 A;  1ENA A;  4DUY L;  2JJQ A;  2G5D A;  2H1E A;  2MHV A;  4DR7 L;  4WD3 A;  3BZK A;  5KT4 A;  3OTO Q;  1K1Q A;  1BDO A;  5HUR A;  4JI4 H;  1IBL L;  1EU4 A;  5KFQ A;  2OTJ A;  3EQL C;  3G6V A;  4IPC A;  5KG4 A;  1X9N A;  4IWY A;  4FS1 A;  3BQ0 A;  4EBE A;  4PMC A;  4DR6 L;  1GLV A;  1KC7 A;  5HGQ A;  4A3G G;  3K8A A;  3OW7 A;  3G48 A;  3UQ8 A;  2G9D A;  3V4S A;  4OON A;  1Z47 A;  1TWA A;  2EDG A;  4JI8 H;  5EKI A;  4XYQ A;  1WTV A;  2JEI A;  1E2Z A;  1ESR A;  3CRL C;  2FLN A;  1XMQ L;  4GN4 B;  4O3Q A;  2YZN A;  1Q8K A;  2Q8T A;  2V4Q A;  3LP8 A;  3HOY G;  1CE8 A;  4YAK B;  2M00 A;  4R1J A;  4O4H F;  1G29 1;  2R93 B;  3VYT A;  4A3C H;  2KOL A;  3LNN A;  3H0G B;  2K03 A;  2W6O A;  5KFG A;  3OTO L;  3I12 A;  1SE4 A;  1IKM A;  4APM A;  4DV3 H;  1MJE A;  1B8A A;  3GTQ A;  4RWS C;  1LTI D;  3D6W A;  5M3F H;  5DQI A;  1MSG A;  1CQF A;  3ITP A;  5L37 A;  1DYQ A;  1N34 H;  4JI2 Q;  4DV1 Q;  1MI2 A;  4MTK A;  4DK0 A;  3KHL A;  4DR4 H;  4XYO A;  1M1K C;  1SJE D;  2K5N A;  1BBX C;  4F4X A;  1WH2 A;  2A5H A;  5KFO A;  1Y1V H;  1VQH A;  4KLK A;  5KFP A;  4JI7 H;  1C0A A;  4DAP A;  5C4J H;  1FKA H;  1NSN S;  2DY7 A;  4CC5 A;  2CHB D;  1BCP D;  3H4B A;  4LWC A;  1N32 Q;  2ZTD A;  5E1F A;  4N9P A;  3RIZ A;  2VOB A;  2ZXR A;  3J7Z C;  1EU3 A;  1ZET A;  3CP0 A;  1TAE A;  5KFH A;  1NR2 A;  2N49 A;  2GN5 A;  4A3F B;  3T4A C;  4LF8 L;  5JJZ A;  1GUT A;  4JPB W;  4MZ9 A;  4EX5 A;  1T94 A;  1BGW A;  2HVR A;  1FJG L;  1EQR A;  2EYJ A;  3KF6 A;  1UNS A;  1XNR L;  3BDL A;  3GTK B;  4YBZ B;  3I8Z A;  3W1G A;  1E1O A;  2JA8 B;  1K8O A;  1R9T A;  3BVM A;  4RZR A;  3QZ8 A;  1E0B A;  1CQI B;  1KNA A;  5LYJ F;  4DV1 L;  4JI2 L;  3J7A F;  2L55 A;  1GUW A;  1JDE A;  1U4R A;  4OX9 H;  3RGZ A;  5C0X J;  2WDT A;  4RB0 A;  1PH6 A;  4MV7 A;  2HGS A;  4EGJ A;  2PMZ E;  3D8G A;  3GTG H;  4BBR H;  2ICI A;  4M9U A;  4O4L F;  4GKJ L;  4QY7 A;  4S3S A;  4FBT A;  3DEO A;  1N32 L;  2W6N A;  1YVC A;  4HYK A;  4I65 A;  2E5L H;  3NGD A;  3MR6 A;  2J0T D;  5GRO A;  5FLX c;  1HUM A;  2FK1 A;  4RZQ A;  1Z2N X;  3MA2 B;  4UCO A;  4J9P A;  2NU6 B;  1VKZ A;  4A3C G;  1KC8 C;  2OEO A;  4AYB G;  3NQI A;  3IFT A;  2XWB B;  3VA7 A;  1EY8 A;  3S2H B;  4ED1 A;  2RDF A;  2VQE Q;  3ZYY X;  4DV2 Q;  2OTL A;  2FXQ A;  5FJ8 G;  2YZM A;  4LFC Q;  4JI5 H;  2PYK A;  2BH2 A;  2C2E A;  4DA2 A;  1BOS A;  2PMZ B;  1GSA A;  4E4T A;  4Q44 A;  2UVU A;  2VW9 A;  4DK3 C;  1EZ8 A; 
#chains in the Genus database with same CATH homology
 1V9P A;  3ULP A;  3ZJY C;  3J81 i;  1WI5 A;  2F4V L;  1QZG A;  1KL9 A;  5JJI A;  2CWA A;  4GOP C;  1KQS A;  3HOV G;  3MXN B;  4JI3 L;  1Y1V G;  4B3S L;  1MIU A;  3J80 i;  3GDE A;  2ZM6 L;  2VQF L;  3G71 A;  1QVF A;  2E2I H;  4OWW B;  3K80 C;  4JG2 A;  4K0K Q;  1HZ9 A;  2OWO A;  1V1Q A;  3J80 c;  2JEA I;  4GLV B;  2Z6K A;  3CC7 A;  4BA1 I;  4FDB A;  1HNW L;  3I56 A;  1J6Q A;  3S1R H;  3EN2 A;  4DPG A;  1Q81 C;  2V1C C;  5IYC H;  3CD6 A;  2VZA A;  1UE6 A;  4HIK A;  4OX9 Q;  2WFW A;  4IJH A;  2A19 A;  3UDG A;  1K73 C;  2JA7 H;  4YWM A;  1G51 A;  1AE3 A;  1OXT A;  1VQC A;  4GN3 B;  3RR5 A;  3CCE A;  4B3T Q;  5LMN Q;  4JI7 L;  3F8T A;  2F52 A;  1JB7 A;  3U50 C;  3E9I A;  4TQU S;  1CUK A;  4DV2 L;  4IFD J;  1JT8 A;  2NZH A;  4AH6 A;  4NXN Q;  2B63 G;  2AHO B;  1NTG A;  1A63 A;  5C3E H;  4NPS A;  3I4N H;  3UE1 A;  4DV0 L;  2E5L Q;  5C4X H;  5IYB H;  3I4M G;  4IFD G;  1VQM A;  3PUZ A;  1PVO A;  1K83 H;  3AFQ A;  3JC6 6;  4X66 Q;  1TWF H;  3FKI G;  1VS0 A;  4ME3 A;  1X3E A;  2DGY A;  2YTY A;  4P71 A;  3KJP A;  1SMX A;  4GLA C;  1AE2 A;  4A4I A;  4IPD A;  4BBR G;  2HT1 A;  4NXM Q;  5JJK A;  5C0X G;  4Y7N H;  4GKK L;  4JI5 Q;  3CCV A;  3CAM A;  3HKS A;  3W5O A;  4X62 Q;  3MEF A;  1S72 A;  4BBS H;  5HY6 A;  3TRZ A;  3NEM A;  3PIO A;  4DV5 L;  3S1Q H;  4A93 G;  2LSS A;  5ELN A;  4DUZ L;  5FJ8 H;  1LM0 A;  1Y1W G;  4DR3 Q;  4OX9 L;  3HOW G;  3HKZ E;  1HJP A;  3G6E A;  1V43 A;  4A3J G;  4OO1 G;  2NVY H;  2RF4 A;  3K7A H;  4OWT B;  4X64 Q;  2UU9 Q;  1GD7 A;  1QUQ B;  1VQ9 A;  5LMN L;  4UP8 A;  3ER0 A;  5GAG C;  2K14 A;  1UE7 A;  3GO5 A;  1Q1E A;  4JI1 Q;  4HJ8 A;  1AH9 A;  4EQ5 A;  3DM3 A;  4QIW E;  3GTJ H;  2EXD A;  2QEX A;  3A0J A;  2ZJP A;  1VQ6 A;  1GM5 A;  2R7Z G;  1W3S A;  5J3B A;  1VCI A;  2IX0 A;  2HIV A;  3PGZ A;  2K75 A;  2UXC Q;  2IY5 B;  1L1O B;  3PUV A;  5IWA Q;  3S15 H;  4DR5 L;  1HNW Q;  4X66 L;  3AYH B;  3CXC A;  1N36 Q;  3K81 C;  4O2D A;  3S2D H;  3WWV A;  4L5S A;  1VQ4 A;  2ZTE A;  3S14 H;  3Q8D A;  4GS3 A;  2Q2U A;  4NXM L;  2K52 A;  2KEN A;  3TS2 A;  4JI5 L;  2E2J H;  4X62 L;  4R4O A;  3CC4 A;  3KOJ A;  5BR8 Q;  5IP9 G;  5C44 H;  3NBH B;  1E24 A;  1I6H H;  1KHI A;  1S40 A;  4HIM A;  2UXB Q;  4JOI C;  1QVG A;  2JA6 G;  1Y14 B;  1WOC A;  1YJ9 A;  4LF5 Q;  4A3B H;  1I50 H;  2PI2 A;  4J15 A;  4DK6 C;  1NJI C;  2R92 H;  4HIO A;  3CMA A;  2MO1 A;  1VQI A;  2F3I A;  2YTX A;  1YHB A;  4A76 A;  1XNQ Q;  2CCZ A;  2NZO A;  2E2H H;  3S16 H;  3RZD H;  3ULJ A;  1NMG A;  3A5Z B;  2CKZ B;  3G4S A;  1ASY A;  4L5R C;  2CFM A;  1OXX K;  4GNX B;  1HNZ Q;  1D7Q A;  2NN6 G;  2UUC Q;  5IP7 H;  1QVC A;  1VQG A;  4JBK A;  4JI4 L;  4DV7 Q;  4YY3 Q;  1PFS A;  4YCU A;  5C3E G;  2AMC B;  1N33 L;  2UXC L;  2N8N A;  5GAE C;  3S24 A;  5IWA L;  1WYD A;  4C3H H;  5IT9 c;  1TWC H;  5IYB G;  4IOC A;  1VQ7 A;  4B3M Q;  3I2Z A;  5JEA J;  1Y1W H;  3HOW H;  1N34 Q;  3JAM i;  2A1A A;  1XMO L;  4DV4 Q;  3GTO H;  4DR4 Q;  3UE0 A;  4A3J H;  1HR0 Q;  4JBJ A;  3H15 A;  3E9H A;  4JI8 L;  2ES2 A;  4ALP A;  2KHI A;  3E0E A;  3JAM c;  5BR8 L;  4GOP A;  3KDF A;  1YIT A;  1YNX A;  1KRT A;  3OW2 A;  2UXB L;  1LTL A;  3TEH B;  4POG A;  4LF5 L;  2N3S A;  4BA2 I;  3RLF A;  2JK8 A;  2R7Z H;  3AFP A;  1PH7 A;  1XPU A;  1HZC A;  1PV4 A;  1JE5 A;  4JC0 A;  4YWL A;  1K8A C;  1CSQ A;  2A8V A;  4X6A H;  4P73 A;  3L7Z C;  1XNQ L;  3I4O A;  5IY0 A;  3F2C A;  4DR1 Q;  1I5F A;  1HNZ L;  3U4V A;  4BY7 G;  2PQA B;  2UUC L;  3M3Y H;  1W2B A;  2KCT A;  4R4I A;  2YV5 A;  4DV7 L;  2N78 A;  2L15 A;  5E7N A;  4DV3 L;  3K0X A;  4L5Q A;  4A3E G;  4DR6 Q;  2K4K A;  3M4O H;  4HID A;  5IP9 H;  2UXD Q;  1EOV A;  2ID0 A;  1HZB A;  1CKO A;  4B3M L;  2VNU D;  1TWA H;  4AIM A;  4A75 A;  3IRB A;  3PUY A;  4YWK A;  3DLL A;  1E3P A;  5FLM G;  3RNU A;  2JA6 H;  4HJA A;  1N34 L;  1CSP A;  1K8G A;  5EAY A;  4DR4 L;  3M4Q A;  1K0R A;  1UE5 A;  2CWP A;  2Y0S E;  2YTV A;  4Y52 H;  2NVX H;  4LF4 Q;  4RMF A;  4JBM A;  4POF A;  1X65 A;  1N8R C;  4NB3 A;  4H02 A;  1SRU A;  4LW1 A;  3PCO B;  1RL2 A;  2D0O A;  4MTN A;  5C44 G;  3TS0 A;  1PH3 A;  1YJW A;  2ALY B;  4PZ6 A;  3RN2 A;  2Y0S G;  1X3G A;  1L0W A;  2VQE L;  3STB C;  4LF6 Q;  4LFC L;  3BU2 A;  4A3B G;  3U4Z A;  1VQO A;  3D0F A;  4JV5 Q;  1CKM A;  1L1O C;  2R92 G;  4OWX B;  1NY4 A;  3F2D A;  4BY1 G;  3L2P A;  1NMF A;  2IT1 A;  4P74 A;  5AJ3 Q;  4JYA Q;  1I94 Q;  1NE3 A;  3CCS A;  4LFB Q;  2LXK A;  3CPW A;  3GTQ H;  3ULL A;  2XTI A;  4P75 A;  3GTP H;  2R7F A;  4R4Q A;  3UDI A;  3GTL H;  3L0O A;  1C9O A;  1A62 A;  2B3G A;  2QGQ A;  3NEN A;  4UP9 A;  5IP7 G;  2XGT A;  4HJ7 A;  1ASZ A;  1KAW A;  2UXD L;  1JJC B;  4TVA B;  1EUJ A;  1T9H A;  1E7Z A;  1DGS A;  1SE8 A;  2I5H A;  2K5H A;  1YHA A;  1KRS A;  3M4P A;  1Z9F A;  2Q2H A;  4PMW A;  4AQY Q;  1IBK Q;  2RHS B;  4QGU A;  4LFA Q;  3CCU A;  5GQO A;  5JJL A;  1WJJ A;  2JQO A;  4QL5 A;  2I0Q A;  4LF4 L;  4LUV A;  4GLX A;  1IZ6 A;  2BH8 A;  1U5K A;  5JEA G;  3S1N H;  4B3T L;  4GNX C;  1K3R A;  1YIJ A;  4BY7 H;  1PHJ A;  1XJV A;  1SLJ A;  3BJU A;  3HKZ G;  3CCL A;  4NXN L;  1OXV A;  5C0X I;  1OTC A;  1KD1 C;  4LF7 Q;  4A3E H;  4JV5 L;  2EIF A;  3KFU A;  2E5L L;  3M7N A;  4LF8 Q;  5M5X H;  3J7A 5;  1R9T H;  1EIF A;  4JOI A;  3HFZ B;  2WAQ E;  5AJ3 L;  1I94 L;  5FLM H;  1FJG Q;  3EBE A;  1XNR Q;  2JA9 A;  4LFB L;  2GVA A;  4A3K G;  1VQL A;  4A3L G;  3KYH C;  1CKN A;  1NBW A;  2JEB I;  2I5M X;  1VQ5 A;  1E1T A;  3UDX A;  4JYA L;  5IYD G;  4OO1 I;  1M90 C;  4O0A A;  4LNQ A;  3FP9 A;  2C35 B;  1SN8 A;  2PQA A;  3CPF A;  3CCM A;  1WFQ A;  2WAQ G;  1S3O A;  4YHH Q;  2VL6 A;  1X54 A;  1HZA A;  3PUW A;  1PH1 A;  1IBK L;  1UEB A;  2YYZ A;  1I3Q H;  2D62 A;  2NVT H;  1SR3 A;  1VQE A;  4PZ7 A;  4DR3 L;  4GKJ Q;  1PH9 A;  4X64 L;  2UU9 L;  1Q7Y C;  4BY1 H;  4DV6 Q;  4LF9 Q;  1VQJ A;  1JJG A;  3S1M H;  4DAM A;  2AWO A;  3VDY A;  4APV A;  4P72 A;  1B7Y B;  1PH5 A;  2I5L X;  1BBU A;  4LF7 L;  4JI1 L;  4UY8 C;  2LXJ A;  2VS1 A;  3W1B A;  3KF8 B;  4LUZ A;  1A8V A;  3FHW A;  1VQK A;  2HHH Q;  3H0G H;  3I55 A;  1EQQ A;  1BVS A;  1O7I A;  1N36 L;  2H5X A;  4YCW A;  4KI0 A;  3T1H Q;  1XPR A;  4X65 Q;  1GKH A;  2B29 A;  4IJL A;  4JCV E;  3RZO H;  4JBW A;  1PYB A;  2ZJQ A;  4UP7 A;  3PO2 G;  1N9W A;  3LGJ A;  4YHH L;  2IHF A;  3PSI A;  1Q86 C;  1SFO H;  1X55 A;  2NN6 I;  4XTC S;  4R4C A;  2MQH A;  1P16 A;  3F1Z A;  2JE6 I;  1MJC A;  3CCR A;  4KHP Q;  4RG1 A;  2WP8 J;  2ZM6 Q;  4DUY Q;  4IFD I;  3ICE A;  4DV6 L;  1Q46 A;  2CQO A;  4LF9 L;  1D8L A;  4OXP A;  3PO2 H;  4PZ8 A;  4DR7 Q;  4A3D H;  4C3J H;  4B3R Q;  5DLQ E;  2YU9 H;  2VUM G;  2R7D A;  1YJN A;  4A3K H;  1J5E Q;  4A3L H;  1VQP A;  3M85 A;  2QA4 A;  1IBL Q;  2UUB Q;  1QUQ A;  5GAD C;  1VQ8 A;  1X6O A;  5IYD H;  3STB D;  1K9M C;  1YBY A;  2BA1 A;  2PI2 E;  1VQA A;  1EIY B;  4WJ3 M;  3PUX A;  4YY3 L;  3GD7 A;  3TQY A;  2ZTC A;  3A74 A;  4A3F H;  2HHH L;  1X3F A;  3AQQ A;  1QZH A;  3T1H L;  4X65 L;  4QJF A;  5GAH C;  3GTK H;  2JA8 H;  3RLO A;  4DV4 L;  1FGU A;  2IHE A;  4A3I G;  1L1O A;  1SRO A;  3PV0 A;  1VQN A;  5M3F G;  3BZC A;  1HR0 L;  4DV0 Q;  4IO9 A;  4C3I H;  4A3M G;  5LMN W;  1WCM H;  3UDF A;  2JA5 H;  4HJ5 A;  1PYS B;  3B6Y A;  1XMQ Q;  1EYG A;  1EFW A;  1GVP A;  1U0L A;  3HOZ H;  4WJ4 A;  1E22 A;  1HH2 P;  4KHP L;  3HOX G;  3HOU G;  4IPG A;  5M5Y H;  3J81 c;  3KF6 B;  4DUY L;  4KHZ A;  2WB1 E;  3H3V H;  2JJQ A;  4GKK Q;  1YI2 A;  4B3R L;  3U58 A;  4DR7 L;  2AKW B;  1A0I A;  3BZK A;  3OTO Q;  1J5E L;  2VY3 A;  4DV5 Q;  4DR1 L;  1TWG H;  1IBL L;  1B70 B;  2UUA Q;  2UUB L;  4DUZ Q;  2OTJ A;  4IPC A;  3KJO A;  1KIX A;  4BXX H;  2WB1 G;  1UWV A;  3CW2 C;  2Z0S A;  3I7F A;  3CCJ A;  1X9N A;  2HQL A;  1TWH H;  3PO3 H;  5M3M H;  4GNX A;  4DR6 L;  1VQD A;  2R93 G;  5HGQ A;  4A3G G;  3K8A A;  3SGI A;  3G48 A;  1IXR A;  2RHQ B;  4OON A;  1Z47 A;  3H0G G;  2Z6K C;  3M9B A;  3A5U A;  1HNX Q;  4R4T A;  2OQK A;  1OXS C;  3S2H H;  3EIV A;  1XMQ L;  2RCN A;  4GN4 B;  2VUM H;  1IL2 A;  1Q8K A;  4DR5 Q;  1YEZ A;  1MKH A;  1FL0 A;  3HOY G;  1KXL A;  4R1J A;  1G29 1;  4GOP B;  1C7Y A;  4DR2 Q;  1YZ6 A;  4LF6 L;  3KDF B;  1P8L A;  4A3C H;  4K0K L;  2KBN A;  5IE8 A;  3S17 H;  4C2M H;  1RIP A;  1PH4 A;  1JMC A;  3CQZ H;  3OTO L;  1JJ2 A;  1FVI A;  4A3D G;  1XTD A;  5LMU Q;  2NVQ H;  3RN5 A;  4UPA A;  2UUA L;  3CC2 A;  4IPH A;  4JI6 Q;  4JI0 Q;  2HIX A;  3ERS X;  1B8A A;  4A3I H;  1XPO A;  4PG3 A;  1MJE A;  5M3F H;  4A3M H;  2GVB A;  3D31 A;  1EWI A;  4HJ9 A;  4JI2 Q;  3CCQ A;  4DV1 Q;  2OCE A;  2K5V A;  1M1K C;  4MNO A;  2K5N A;  4AQY L;  2K50 A;  4A3F G;  1PH8 A;  3HOV H;  1H95 A;  1LUZ A;  5H1S E;  3AEV A;  3HOX H;  1Y1V H;  4LFA L;  3HOU H;  1HNX L;  1VQH A;  4KLK A;  2JA8 G;  2EQS A;  4JI4 Q;  1C0A A;  2MFI A;  5C4J H;  1N33 Q;  1GO3 E;  2MO0 A;  1WCM G;  2JA5 G;  4LWC A;  4QQB X;  1N32 Q;  3HOZ G;  1IBM Q;  5K36 G;  1TXY A;  2ZTD A;  1VQF A;  1LYL A;  4DR2 L;  4YCV A;  1XMO Q;  3J7Z C;  2ZJR A;  3CP0 A;  2Q2T A;  1PA6 A;  2N49 A;  2GN5 A;  4LF8 L;  2R93 H;  4A3G H;  4JI8 Q;  4MZ9 A;  4EX5 A;  3T1Y Q;  1IYJ B;  1FJG L;  1EQR A;  1X56 A;  3KF6 A;  1XNR L;  5LMU L;  5M5W H;  1Q82 C;  3W1G A;  1E1O A;  3CME A;  4JI6 L;  4JI0 L;  2B63 H;  2ATW A;  1HR0 W;  2OQ0 A;  3PF5 A;  5IYC G;  4IOA A;  4BXX G;  1PH2 A;  3PF4 A;  2Q2I A;  3NEL A;  4DNI A;  4DV1 L;  4JI2 L;  3I4M H;  2JA7 G;  3PO3 G;  5M3M G;  3HOY H;  3FKI H;  5C0X J;  2F4V Q;  1PH6 A;  2IX1 A;  4L5T A;  3RLN A;  2PMZ E;  4JI3 Q;  3GTG H;  4BBR H;  5ELO A;  4B3S Q;  4GKJ L;  3H3V I;  4DKA C;  2PNH A;  4QY7 A;  1Q1B A;  4DV3 Q;  3I4N G;  2VQF Q;  4DAY B;  3TRE A;  3PIP A;  3KLW A;  5C4X G;  1N32 L;  1BKB A;  1YVC A;  1IBM L;  4A93 H;  1UE1 A;  4AYB E;  1G6P A;  2DUD A;  3F2B A;  2R6G A;  5GRO A;  5FLX c;  1OXU A;  2ASB A;  4LUO A;  1L2F A;  3T1Y L;  4A3C G;  1KC8 C;  3J81 j;  4AYB G;  2KHJ A;  1VQB A;  4JI7 Q;  2D0P A;  2KCM A;  4XIG S;  4BBS G;  4GN5 A;  3CF5 A;  2VQE Q;  4DV2 Q;  2OTL A;  2FXQ A;  5FJ8 G;  2E8G A;  3K7U C;  4LFC Q;  3OYY A;  2MNA A;  1Q12 A;  2BH2 A;  2BA0 A;  1BBW A;  1CKN B;  2AWN A;  1YHQ A;  3GTM H;  2VW9 A;  4DK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...