4BY1G

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by1G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by1G01
1V1QA 1PH6A 2H5XA 4LFCQ 4OONA 1HZ9A 4DUYL 4HIMA 3RNUA 1FL0A 2PQAA 2K75A 1J5EL 1XNRL 3WWVA 1J6QA 5JEAG 1M90C 4A3KH 2K5VA 3I2ZA 2E8GA 1EIFA 2PMZE 4O2DA 4DV3Q 1KIXA 4BY7H 2E2JH 1BBWA 1K8GA 4LFBL 4K0KL 1UE7A 2VW9A 2ZJPA 3KYHC 1UEBA 5LMUQ 1E1OA 2I5HA 2ID0A 4JI7L 5C4XH 1I3QH 3S1RH 1GM5A 3HOWH 2YV5A 4A3CG 1B8AA 1IBKL 4JG2A 4A3FH 1VQEA 1XPRA 4DV0Q 1VQKA 4JBJA 3RLNA 3UDIA 2R7DA 2JA9A 2NZOA 2WAQG 2EQSA 2VL6A 2YTYA 3GTGH 1Z9FA 4AYBE 4BBSG 2CWAA 2ATWA 4DK6C 4NB3A 1WYDA 2Z6KA 2A19A 2OWOA 4R4OA 4L5SA 4LF8L 3HOZG 3CW2C 3S17H 3TQYA 4B3SQ 3PCOB 1SRUA 1YHBA 4QY7A 4DV6L 4HJ8A 2IX0A 1VQOA 4PZ8A 4A3DH 4JV5L 2JA8G 2WAQE 3GTOH 2VQFQ 5M3FG 2ZTEA 1WFQA 1B70B 1GKHA 3HKSA 4DV7Q 1IL2A 3PO3G 3M9BA 1NMGA 1VQ8A 1X3EA 3IRBA 4A3GH 3FKIG 3PUVA 1VQBA 1X56A 4IPCA 1BBUA 3RZDH 3CMAA 4BY1H 3M7NA 3JC66 4L5QA 4JI1L 5M3MG 5IYCH 4Y7NH 1VCIA 1G51A 4LW1A 3J81c 4B3RL 3PUZA 5HGQA 5BR8Q 3DLLA 4JI0L 3J7A5 1NMFA 4YWKA 1HNZL 5LMNW 1RL2A 2N3SA 3Q8DA 3CD6A 4APVA 2K5NA 4A3MG 2Y0SE 4QQBX 2V1CC 4JI4L 1ASYA 3GO5A 3KJPA 1VQGA 1HZCA 3NEMA 4JC0A 1T9HA 5IYDG 4RG1A 4DV0L 3S16H 2GVBA 1HNXQ 3M4OH 4OX9Q 1O7IA 1V43A 4YY3Q 1Q86C 3BZKA 3K81C 3MEFA 4IPHA 4JI8L 1JJ2A 2HIVA 4R4CA 1VQ4A 4A4IA 1JB7A 1PH9A 2MO1A 2Y0SG 5JJIA 3RLOA 3F2BA 3ER0A 3STBD 3T1HL 2BH8A 1YJNA 4A3LG 4BY1G 4ALPA 3T1YQ 3I55A 2PQAB 2JQOA 1QUQB 4WJ4A 2JJQA 3MXNB 3KF8B 4DR5L 2R7FA 4AYBG 4A3EH 1FGUA 4LUZA 1X3FA 2LXJA 4L5RC 2D0OA 3H0GH 4DV5L 4A3JG 4DUZQ 1YJ9A 3H15A 1HJPA 2YYZA 1SLJA 4BA1I 2R7ZG 3S1NH 1HZBA 1KQSA 2HIXA 3CCMA 2MO0A 2UU9L 4DV4Q 3HOUG 3G6EA 2AWNA 1HH2P 3H3VI 1UE6A 4DAYB 1VQMA 2E2IH 1VQCA 3PUYA 1Q12A 4TQUS 1QZGA 1PHJA 2KENA 4DR6L 2ES2A 1NBWA 1N8RC 1SE8A 1UE1A 2K14A 2QA4A 1VQAA 3J81i 4LF6L 1VQJA 2D0PA 1LUZA 4LF5L 3PV0A 4R1JA 3BU2A 1EUJA 3S1QH 3TREA 3AQQA 3FHWA 1NJIC 3M3YH 3CXCA 3HOWG 5FJ8H 5JJLA 4X64L 5IY0A 4A3IH 1OTCA 2K50A 1PH4A 3OTOL 4OO1I 2K4KA 1K9MC 5BR8L 1KL9A 1SR3A 4R4QA 5AJ3Q 3I4NG 1YHQA 1Q46A 3J80c 2L15A 3CCEA 2IHFA 4EQ5A 2EXDA 2JEBI 1VQLA 3UDXA 4GLVB 5IWAQ 4OXPA 4YWLA 3F2DA 5LMNQ 4A3DG 1KC8C 1EOVA 4DV2Q 1QZHA 1I94Q 4JYAQ 1WOCA 1VQ5A 2KHJA 3F1ZA 2EIFA 2JA5H 2N8NA 1C0AA 5IYBG 4DR4Q 4PZ7A 1PH2A 5C4JH 1RIPA 1WCMH 1PFSA 2JA6H 4IJLA 2A1AA 4IOCA 5C44G 1CKOA 1CSQA 4UP7A 3JAMi 3GTKH 1L1OB 1LYLA 1NTGA 4WJ3M 2LSSA 1N33Q 4LF9L 1K8AC 4DR2Q 2Q2UA 1IZ6A 1A0IA 4IOAA 2CCZA 1PH8A 1XMQL 4B3TL 4GKKL 1I6HH 2VY3A 3AFQA 1YVCA 3CCSA 3CCVA 1JJGA 2JK8A 2Q2HA 3HKZG 1N9WA 1H95A 5K36G 1PH5A 2HHHQ 2JA8H 4DR6Q 3A74A 1MIUA 3RLFA 4DNIA 4X64Q 2ZJRA 3S14H 3U4ZA 1A8VA 4QGUA 2RCNA 2VUMG 3HOYH 1V9PA 3W1GA 4YY3L 3T1HQ 4B3SL 2NVQH 4BBRH 5E7NA 1L1OA 1Y1WH 3UE1A 2F4VQ 4OWWB 3HOVH 1EQRA 1MKHA 1WCMG 1N32Q 2NVYH 4LFCL 5C0XI 2GVAA 2ALYB 2K52A 4KHPL 4YHHQ 3S15H 3RN5A 4JI2L 4O0AA 2KBNA 2N49A 4P75A 4A75A 1Q82C 4DK3C 4C3IH 4JI6L 4JI0Q 3RR5A 3KDFB 5FLMG 1HR0L 1X65A 4J15A 2OTLA 2OCEA 2ZJQA 1U5KA 4YCWA 2IT1A 4IJHA 3KLWA 3GTPH 1E3PA 3HOYG 2IX1A 1W3SA 4JI4Q 4HJAA 2UUBQ 2KCMA 2JEAI 3PUXA 4DR1Q 1YI2A 4C3HH 1X54A 1AH9A 2MNAA 2UXBQ 4KI0A 4A3IG 1MJEA 1IBMQ 5IP7H 3HFZB 2YTXA 5GAHC 2AMCB 2ZM6L 3HOXH 4HIKA 3OTOQ 3J7ZC 3HOXG 1N36Q 3KOJA 3HOZH 5ELNA 4AQYL 2R7ZH 1Y1VG 3CCRA 4A3MH 1B7YB 2I0QA 2UXBL 2QEXA 4IPGA 4DR7Q 1IBLL 1GVPA 4LUOA 1Z47A 1I94L 4DR7L 4JYAL 1Y14B 2UXDQ 2VUMH 3S2HH 3L7ZC 2PI2E 1VQ6A 4GLAC 1UWVA 3VDYA 1PA6A 1I5FA 3B6YA 5LMUL 4GOPC 3K8AA 4LF4L 3PO3H 4A3GG 1VQDA 5M5XH 2D62A 3UDFA 4NXML 4LFAQ 1XNQQ 2KHIA 4JOIA 5C0XJ 3TRZA 1YJWA 4R4TA 5JJKA 4JI2Q 1G6PA 4LF7L 1C9OA 1UE5A 1P8LA 3KJOA 1GO3E 3GTJH 1L2FA 4JBKA 4OX9L 1K0RA 2AHOB 3F8TA 1XTDA 4MNOA 5C0XG 4DR2L 1HNXL 1PVOA 3K0XA 5H1SE 4NXNQ 4GKJQ 5JEAJ 1FVIA 1EWIA 4DUYQ 5HY6A 1Y1VH 3A0JA 3I4OA 5IYDH 1E1TA 2JA5G 4GN5A 4JI3L 4YCVA 2ZM6Q 1N32L 3ZJYC 1EIYB 3U58A 2OTJA 1CUKA 4YWMA 4DAMA 1NE3A 4B3RQ 4K0KQ 3HOVG 4DUZL 3HKZE 2HHHL 2YTVA 3E9IA 1DGSA 1KHIA 2Q2TA 1KAWA 2K5HA 1Q81C 3AYHB 5J3BA 1IBLQ 2R92H 5M3MH 4BXXG 1JMCA 3FP9A 4A3BG 3W5OA 1TXYA 3SGIA 4LF9Q 4KLKA 2RF4A 2F4VL 4A3BH 1X6OA 4B3TQ 4MTNA 1Q1BA 2UUCQ 3L0OA 5GAGC 3A5UA 1L1OC 2PNHA 4DR3L 2NN6G 3E0EA 2R6GA 4PZ6A 1N33L 2A8VA 1EFWA 4LWCA 3CPFA 3RN2A 4UPAA 1HR0W 3NELA 4JI6Q 1KRTA 3KFUA 4P72A 5IYBH 1JJCB 2OQKA 2B63G 3D31A 1Q7YC 4B3ML 3EBEA 5C4XG 4DV7L 2JA6G 4BA2I 2DGYA 4X62L 3M4QA 3PF5A 2YU9H 3FKIH 1S3OA 3NBHB 1P16A 3KF6A 1U0LA 2RHSB 4JOIC 4DR3Q 1XMOL 1QVGA 4JI1Q 1VQ9A 3GTMH 1GD7A 2F3IA 4JI3Q 1XJVA 1X55A 2GN5A 2E5LQ 4LF5Q 4JBMA 1Q8KA 2UXCL 2F52A 1QVFA 2CKZB 1EQQA 2CFMA 5DLQE 5GAEC 2NN6I 2Q2IA 2DUDA 2MQHA 1PH7A 1WJJA 1OXTA 2B3GA 2VS1A 1VQNA 1TWCH 1BKBA 2R93G 2KCTA 1Q1EA 1PV4A 4QJFA 5M3FH 2CQOA 1TWAH 2Z6KC 4DV6Q 4JV5Q 1MJCA 1YHAA 2N78A 4ME3A 4GNXC 2B63H 2OQ0A 3F2CA 4OO1G 2VQEQ 2QGQA 4LFAL 1XNQL 3CQZH 3ULJA 1YITA 4UY8C 4FDBA 4IFDJ 4DR5Q 2WFWA 2PI2A 2ZTDA 4NXNL 2NVTH 1YZ6A 1SROA 1E7ZA 1PYSB 4R4IA 1X9NA 3TEHB 3K7AH 1C7YA 2AWOA 4LNQA 2BA0A 4A76A 1SMXA 3KDFA 1IYJB 3G48A 4UP9A 4DV2L 4DV5Q 4XTCS 3ICEA 5IWAL 1OXVA 1OXXK 1KD1C 3EN2A 2C35B 4YHHL 5M5WH 4A3KG 1N36L 1SFOH 1L0WA 4HIDA 3I56A 1FJGQ 2I5MX 1VQHA 4JI8Q 4GLXA 4GNXB 1JE5A 1XPOA 3GDEA 1PYBA 2UXCQ 3AEVA 4A3LH 2WP8J 4TVAB 3I4MG 1E24A 3LGJA 3UDGA 3EIVA 1D8LA 5GQOA 5C44H 3PGZA 1EYGA 4JI5Q 3PUWA 4LF7Q 4P73A 1TWFH 3PSIA 4POGA 3PO2H 1HNWQ 1VQIA 3DM3A 4IO9A 1VS0A 4GOPA 3CP0A 3GTQH 1YBYA 2HT1A 4X66L 1A63A 4DV4L 1R9TH 4POFA 1E22A 3KF6B 3HOUH 1BVSA 4JI7Q 3ERSX 4HJ5A 2B29A 5AJ3L 2XGTA 1G291 2XTIA 4GS3A 3CAMA 3CCJA 4BY7G 4LFBQ 4P71A 3AFPA 3W1BA 5IP9H 3ULPA 4DR4L 1CSPA 1SN8A 1S40A 5EAYA 2IHEA 1PH3A 2ZTCA 5FJ8G 2UU9Q 1PH1A 1TWHH 2CWPA 1VQ7A 4C3JH 4DPGA 3RZOH 2WB1E 1HR0Q 2RHQB 4BBSH 1AE2A 4AH6A 1HZAA 1KRSA 5FLXc 4YCUA 4LF8Q 4X62Q 4DR1L 4X65Q 1AE3A 4JCVE 1K73C 4Y52H 2LXKA 2IY5B 3BJUA 4EX5A 4DV1L 3M4PA 3CF5A 3K7UC 1VQPA 1TWGH 2WB1G 3NENA 1XMQQ 4XIGS 5M5YH 4JBWA 5C3EG 4HIOA 1IBKQ 2UUAQ 1M1KC 2R93H 2I5LX 1A62A 1K3RA 3E9HA 4MZ9A 1LTLA 1CKMA 4BBRG 1OXUA 4GKJL 3I4MH 5IP9G 4DV3L 1VQFA 5IT9c 5GADC 1I50H 3TS2A 2AKWB 3STBC 1QUQA 1KXLA 3CC2A 4B3MQ 4DV1Q 2R92G 4KHPQ 4LUVA 4A93H 4GN3B 4RMFA 3JAMc 4P74A 4C2MH 2VQEL 4IFDG 2MFIA 5FLMH 4IPDA 3CCUA 1ASZA 4DKAC 2BH2A 3CCLA 1X3GA 2VNUD 3I7FA 3UE0A 3M85A 4GN4B 2E5LL 2NVXH 4GOPB 4PG3A 1J5EQ 4LF4Q 3T1YL 2UUBL 1XNRQ 3J80i 2UXDL 4NPSA 2FXQA 1CKNB 3U4VA 1N34L 3U50C 1Y1WG 1IBML 3A5ZB 3S2DH 4OWTB 4GKKQ 3BZCA 2JA7G 5LMNL 4A3CH 1YNXA 3CMEA 5IE8A 5IP7G 3S24A 3OW2A 3G71A 4AQYQ 1S72A 4A93G 3CC4A 4BXXH 3CC7A 3PIPA 1HNWL 4A3EG 4A3JH 4KHZA 3GD7A 4GNXA 3I4NH 2NZHA 2JE6I 3D0FA 4UP8A 1N34Q 2E2HH 1HNZQ 4HJ9A 3G4SA 4H02A 2ASBA 2VQFL 1JT8A 1XMOQ 1OXSC 1WI5A 4PMWA 3ULLA 5C3EH 3H3VH 4IFDI 4X6AH 3OYYA 3K80C 5ELOA 1CKNA 1FJGL 1XPUA 2UUAL 4X66Q 1YIJA 3J81j 4HJ7A 2VZAA 2UUCL 2BA1A 5GROA 3PIOA 3S1MH 1IXRA 1QVCA 2JA7H 4OWXB 4QIWE 1NY4A 4NXMQ 4A3FG 2HQLA 3CPWA 5IYCG 3TS0A 1W2BA 2Z0SA 4X65L 4JI5L 3GTLH 3PO2G 1LM0A 3L2PA 3CCQA 3PF4A 4AIMA 1D7QA 3H0GG 1YEZA 4L5TA 4QL5A 4LF6Q 1K83H
chains in the Genus database with same CATH superfamily
1V1QA 3I4MB 4DUYL 4G4KA 4KJNA 2PQAA 2K75A 1K83B 4J1MA 1J6QA 5JEAG 2F1MA 3A7AB 1AP0A 4LAAA 1UEBA 4QF4A 1WVLA 2I5HA 2ID0A 4KN7C 1BXTA 4C2MB 4JI7L 3IN5A 1Y1WA 1I3QH 3URYA 5FD5A 2K03A 1B8AA 2UXBL 3GILA 3RLNA 4RNOA 2IMWP 2VL6A 2J4XA 4F8MA 3HOZB 1Z9FA 2B63A 2XVSA 1A2UA 3MR2A 3NE5B 4IN3A 3KAKA 4R4OA 4K5XA 4CKBA 1STHA 1D5XC 2NN6H 3CW2C 4B3SQ 3JAML 4HJ8A 1VQOA 2SNMA 2UUBH 2IX0A 2PYKA 3NBHA 4PZ8A 4A3DH 1K1QA 4ZQIA 5CB4F 2WAQE 2VQFQ 1AEXA 4A3DB 3KHRA 4B9WA 2WYOA 4LMQD 3T5JA 4QUCA 4IRDA 1DM0B 2QW7A 4DV7Q 1IL2A 3M9BA 4EGQA 1ENAA 3K5NA 3CMAA 3JC66 4JI1L 5M3MG 1KJQA 5KNCA 4U673 5BR8Q 4HCEA 4JI0L 1NMFA 3IKJA 1NUCA 2E74C 3RF2A 4RUAA 1LTTD 3BVGA 2JA6B 4APVA 2Y0SE 3J81L 1ASYA 3GO5A 4H0LC 2CVRA 3GV8B 2FMMA 1HQRD 2KCCA 5DM63 2KVMA 5IYDG 4DV0L 3TINA 3S16H 1I6HB 3PMFA 1V43A 4IPHA 4JI8L 3RB0A 4JV0A 3V4ZA 4R4CA 3A8JE 5JJIA 3F2BA 3STBD 3T1HL 3W2DA 3Q22A 1EY6A 1YJNA 1FNUA 2YCHA 5L1KA 3I55A 2JQOA 1STYA 1NR2A 2JJQA 3GIJA 3BA9A 4DR5L 2R7FA 4KJOA 4A3BB 4UCOA 4NLGA 1S68A 1BCPD 3ZYYX 4L5RC 4A3JG 4DL3A 1EWCA 2PZWA 4BA1I 4DAVA 1KQSA 3BAAA 1JKJB 4IURA 4DV4Q 4F4ZA 3H3VI 2B39A 5EWFA 1LACA 2V9WA 1UE6A 1VQMA 1U4MA 1JC7A 1Y1VA 1G8ZD 1Q12A 4KKTA 2N88A 5DNFA 4B3RH 1SJHD 4N9PA 4TKOB 1NBWA 5KFFA 1HA6A 2JEIA 2K14A 2MPMA 3PIP3 3J81i 1VQJA 2D0PA 4LF5L 2W9CB 3PV0A 1PTOH 4LSAA 2JP1A 1EUJA 3TREA 3HOWG 4O4HF 4A3IH 3BA8A 3MXUA 4OO1I 2K4KA 1EFID 1BCPF 4LJZC 1KL9A 3J80c 3CCEA 1A3TA 1Z2NX 5IWAQ 1Q3LA 4A3DG 1KC8C 2R8IA 1EOVA 1QZHA 2ZDQA 1VQ5A 2R87A 4DNTB 5I6WA 2W7OA 4ED6A 2N8NA 1PZJD 2QCPX 3J80L 1X3PA 4PZ7A 2JA7A 3D8GA 1RIPA 2M05A 1Q8IA 2DPIA 2FLLA 2A1AA 4IOCA 4RAZA 1CKOA 1CSQA 3GTKH 3FKIA 3M4IA 1LYLA 4ED7A 1MZBA 3R23A 4Q0FA 1G2SA 4K14A 2PZUA 3GTKB 2Q2UA 5KX5F 3M4OB 4IOAA 2Q8IB 4IALA 2KUMA 4B3TL 2IA6A 4PDBA 4Q44A 3PR5B 3AFQA 1IOWA 3R2TA 1JJGA 2Q2HA 1QNUA 3KXYT 1N9WA 1HFNA 2JA8H 4DR6Q 3KUPA 5EWGA 4A2BA 4QGUA 5JJZA 3TN2A 1WTOA 3W1GA 2NVQH 3CU7A 3VR3A 4R9WA 5J22A 1L1OA 3UE1A 4F4WA 3EPIA 3PW4A 5KFAA 4RUCA 1EQRA 1MKHA 2HCCA 2NVYH 4LFCL 4DL2A 2GVAA 2ALYB 2K52A 3PO2B 4KHPL 4O2AF 1AUXA 4DUZH 3S15H 2E2IB 3UI2A 1Q82C 4JI6L 5KG0A 1HPCA 2O03A 4LH7A 2OCEA 5D14A 3TP7A 2A68D 1V1PB 1TQOA 1C48A 1EHIA 1EYZA 1S0OA 3C2PA 1TWHA 3SEBA 4R8IA 4EVOA 4C1NI 1ESFA 3EPGA 4C3HH 3K5MA 1GUTA 3RZOB 1X54A 2LKVA 1ICWA 2EYOA 2PPBC 3GV5B 2E75C 4KI0A 2PN1A 4RGMA 2D2CC 4A3IG 1OO9B 1HFGA 3HFZB 3FMAA 1N32H 2KEEA 3OTOQ 3VA7A 5LMNH 2EXZA 1RDPD 4WRDA 3HOZH 3RB4A 2AQ2B 5KFSA 1B7YB 4F4YA 1I4XA 5CAEB 1O75A 1CM9A 3UQ8A 1BCPB 1ESRA 1EY9A 1GVPA 1VF7A 4FVMA 4I7ZC 1F2LA 4RH6A 4DR7L 3X3NA 2DIKA 1XTCD 5JVG3 3PW2A 3L7ZC 2PI2E 1UWVA 1DONA 3VDYA 5C1OA 2WIIB 1I5FA 1PFNA 5LMUL 4LF4L 1IBLH 1M4VA 3KF8A 1VQDA 5M5XH 1XYIA 4TQSA 3P7JA 2BR0A 5DG8A 2GA4B 1DXMA 4LF9H 3N6RA 2MJ8A 1PFMA 1H9SA 4JI2Q 1UE5A 2AUKA 1UAPA 1P8LA 2B2UC 5GONF 4XDXA 5BPHA 1L2FA 4JBKA 4XT1B 4Q43A 3T1YH 5C0XG 3NTKA 1E0BA 4NXNQ 4GKJQ 2RSOA 3VPCA 1IBMH 1FVIA 5HY6A 1JICA 4QB4A 4J9RA 3WNZA 5JAVA 1SYCA 1EIGA 1RF2D 5IYDH 1C4QA 2JA5G 1U4LA 4JI3L 1RYSA 2CW8A 1NR4A 2K5WA 1EIYB 1ZQ7A 1NE3A 4K0KQ 2XRQD 2HHHL 5BR8H 3CKIB 1IL8A 1DGSA 4ZI7F 1W93A 1KAWA 1Q81C 3KLRA 4O4IF 4LF5H 3J7AK 5M3MH 2EJMA 2RSNA 3FP9A 1WTWA 5KG1A 4KLKA 2F4VL 4A3BH 4RKBA 4FBTA 3E0EA 4LWCA 3R5XA 3RTXA 1A3UA 3KFUA 4P72A 4O4LF 1RD9D 5KFGA 5F9LA 4B3ML 4DV2H 1PTOF 4ODGA 3R5HA 2JA6G 4BA2I 3PF5A 2YU9H 1GUSA 1S3OA 3NBHB 4JI1Q 4HEDA 2MHVA 5TSSA 2F3IA 4ZOLF 1X55A 2KHSA 2X6LA 3A54A 3ITPA 3G7LA 1QVFA 3EYYA 1V1OA 2PW5A 1EQQA 4IUNA 2W8LA 4G57A 1TWCH 2LY7A 4HNVA 2KCTA 3H0GA 1ENFA 2KSWA 1XNQH 2CQOA 1MJCA 4ME3A 3JAME 4GC7A 1SEIA 2V59A 2XIGA 4BWSC 2OLSA 5ELBA 3C46A 4LFAL 5KT2A 3QZ8A 4FDBA 1GSOA 3T56B 4KY7A 5IYZF 5C5JA 2PI2A 2ZTDA 3HS0C 2DLNA 1YZ6A 1SROA 1E7ZA 4R8NA 5IWAH 3V6KA 1CQIB 3I3CA 4APMA 2FK1A 2W71A 4LNQA 2BA0A 1MSHA 2F0GA 3G48A 4DV2L 1EU4A 4ID6A 4B3MH 3NP8A 4XTCS 1OXVA 1OXXK 5M5WH 4A3KG 1N36L 1L0WA 2I5MX 4GLXA 1GUGA 4WFN3 3GDEA 1XPOA 5JVH3 1ONLA 3M7GA 2P5ZX 3H0GB 2WP8J 2ZDHA 3IL8A 4XQJA 3K6OA 2NB0A 3SR1A 2JA5B 1SCUB 3PUWA 4LF7Q 4R8UB 4POGA 3PSIA 3PO2H 3NQIA 1HNWQ 5C4JB 1AW7A 1FD7D 1O78A 2FB9A 4UCRA 4GOPA 3CP0A 1YBYA 1A63A 1R9TH 5JVLA 4RA8A 4DU9A 1CS0A 2P0AA 4AYBA 2GPWA 1G291 3CCJA 4QWCA 1QWYA 4IUUA 3ERQA 3AFPA 2RA4A 5J1ZA 4DR3H 2PCFB 3SK5A 4DR7H 1SNCA 2J9GA 3FVQA 4GC6A 2IHEA 1VAJA 4EYIB 5KYLA 1PH3A 2ZTCA 1BNCA 4F7XA 4C3JH 4CGYB 4DPGA 1HR0Q 3RZOH 1R4PB 2HUGA 1HZAA 1KRSA 4C3JB 2JYOA 5KNDA 4TSSA 3HOVB 4Y52H 1LO5D 1LT4D 2F0UA 1HNXH 1Z2PX 2ZJTA 4YY3H 4QWDA 3BJUA 3AU7A 2EYLA 4RCNA 1TWGH 2WB1G 1XMQQ 2F0TA 5KFBA 2UXBH 2RCFA 4EGVA 4MZ9A 2K6AA 4CDCC 2PW7A 3GV6A 5IP9G 4DLKA 1VQFA 4N8FA 5IT9c 5GADC 1I50H 3RUZA 2A6HD 2QEJC 3TS2A 5D1OB 4YQWA 5M5XB 3MA2B 4QWBA 1KJIA 1SFOA 4RFBA 2V4QA 3IAYA 4LUVA 4A93H 4C5BA 4GN3B 3JAMc 4P74A 2A6ED 2VQEL 4IFDG 1EQTA 1CT1D 2H1EA 4BWGB 5KT7A 4RB3C 3DMUA 1UNSA 3HBLA 2DNCA 3GIDA 4LF8H 2MP1A 3M9MB 4JV2A 4OELB 2E5LL 2NVXH 4LF4Q 5C5LA 1XNRQ 4DL5A 1JWSD 3T1YL 3GIPA 1PZID 1EZ1A 2OEOA 3J80i 2NVXB 3VPDA 2RGRA 1TWFB 3RIZA 1CKNB 1DOMA 1CQVA 3U4VA 3E5SA 3UFXB 1I4QA 1YNXA 1BDOA 5CBAE 5JPNC 4K6DA 2ASLA 3HOUB 2W9CA 3V4SA 4BXXH 2PMZA 3CC7A 4UFZA 3RGZA 5DGAA 1HNWL 4A3EG 3GD7A 3I4NH 2NZHA 5LXTF 5DQGA 2W6PA 4UP8A 2O2LD 4CHTB 4JK1C 1SNPA 1L0XB 2VQFL 1JT8A 1UEAB 1XMOQ 4QWEA 1F9PA 1W6KA 1WI5A 1M6VA 4EG0A 1E2WA 3K80C 3KLSA 2EY5A 5C4HA 3J81j 4HJ7A 1YIJA 3HOXB 3VMMA 2W9AA 1YNNC 3H09A 3SE0A 3TP5A 1KEEA 1NY4A 4CKCA 3CPWA 2ZXRA 4EQNA 2YU9B 4JI5L 4DR1H 5KKNB 4OGQC 1IYVA 4HMIA 1PXUA 3CCQA 4AIMA 1D7QA 3KBXA 5I4DA 4YAKB 2VPQA 3TZDA 1PZKD 1FYCA 1PH6A 4HN7A 4LFCQ 4OONA 4J9KA 3RNUA 1J5EL 1WD1A 3WWVA 1HHVA 4B9XA 2E8GA 3LX0A 1BJTA 1FNVA 1HNZH 4O2DA 4BY7H 1CZGA 1BBWA 4ZCKA 2ZJPA 5LMUQ 2R7LA 1E1OA 2L12A 5KFMA 1GM5A 4QWAA 3HOWH 2R3ZA 2YV5A 3N41B 4X66H 4RGOS 4JBJA 1C3OA 3RBDA 1SDFA 2JA9A 5EKIA 2B2UA 1KJ8A 1WSCA 4UCVA 1ZEQX 1YNJC 5FLXW 1D6EC 3T5LA 2ATWA 3V96A 3OHBA 4L5SA 3M3YB 3MXGA 2R7NA 5NUCA 3S17H 1LTGD 1B3AA 1SRUA 4QY7A 2W6MA 4K2KA 4L1KA 5EPJA 2Q8RE 3S17B 3GTOH 2CW0D 5C3WA 5M3FG 1WFQA 4C5AA 3GTPA 1B70B 1GKHA 4ZQ3A 2XWBB 5M5WB 3NTHA 2B2WA 3Q2OA 5KT4A 4ULLA 4A3GH 5KFNA 3PUVA 1VQBA 1X56A 4IPCA 2HGSA 2RQXA 5KEEA 4G7HC 3RZDH 1VBGA 4L5QA 5IYCH 2XD4A 2R8HA 2QDLA 2GPSA 3RZDB 3J7A5 3DLLA 1HNZL 1I4HA 1QNKA 4IZ8A 2YS7A 1RL2A 4R7RA 3CQZB 4A3MG 3ETJA 4I50F 2V1CC 4JI4L 2FE3A 3KJPA 1VQGA 2NVTB 1E2ZA 4IUVA 2B2YC 1LTID 1R9TB 2UVRA 3NGDA 4QW9A 1KDAA 1RKNA 3K81C 1CA6A 3PN1A 4IHJF 2YZGA 1JB7A 2FPPB 3OWFA 1R9TA 2Y0SG 3RLOA 2XCLA 3ER0A 5E4WC 4M7EA 5KT3A 1SFOB 4WJ4A 3MFHA 4F50A 3MC0B 2AGPA 1RYRA 5FO7B 1X3FA 5JUMA 3ORQA 1TWAB 3VYTA 3JZIA 4Q8FA 2BDNA 3S1NH 4YAJB 2ASDA 1HZBA 2HIXA 3I4LA 3TMEA 2MO0A 3CCMA 2UU9L 5KT5A 1ENCA 4I7AA 2AWNA 1I3QB 4DAYB 1JOQA 3F8NA 5EOYA 4J9MA 3MR5A 5T1GA 3T13A 3PR4A 1SE8A 3T5KA 1UE1A 4A2AA 4LF6L 3TP6A 1SMYC 5L1LA 3Q8SB 3S1QH 3AQQA 5CA0F 3GTMB 1B1ZA 5FJ8H 3Q24A 4X64L 5JJLA 3T16A 3S1QB 1A2TA 2K50A 3VYRA 1WTPA 2OF1A 1AFPA 3OTOL 4XX0B 2L4NA 1D1IA 5DM73 5BR8L 2I8CA 2HHHH 1Q46A 1STAA 2L15A 2PMZB 1VQLA 2UXBQ 2JEBI 2KJXA 1LABA 1STGA 2L1BA 2SOBA 2RKSA 3IFDA 2KHJA 2FPIB 2C5CA 1JLLB 2EIFA 1WTRA 2ZXOA 4QMGA 1I6UA 3N42B 4DR4Q 1YNND 2X69A 2B8GA 2W9BA 2V4DA 2JA6H 1FJGH 1B53A 4JI0H 3VYUA 5M5YB 1KDCA 1BF4A 4Q0YA 1L1OB 1NTGA 1SNMA 4FXDA 2AQ3B 2FMCA 2LSSA 4LF9L 4DR2Q 2L9HA 3PO3B 1I6HH 1DV1A 3DF7A 5DLGA 1XMQL 5DAUA 2LS01 2QKIC 4XYLB 4DF7A 1LV9A 3MXNA 3J80E 3OHAA 4HCSA 2JK8A 1CZWA 2HCIA 3L4JA 5K36G 1STEA 1MIUA 4DNIA 5JEAH 4X64Q 3TQTA 2HVSA 1S5CD 2RCNA 4C2MA 2VUMG 2R86A 3T1HQ 4YY3L 4YJ2F 1WTQA 4B3SL 1WD0A 4BBRH 2NU7B 1SYXB 2F0MA 5C0XI 3DUZA 4U68A 2HVQA 3WOFA 3RN5A 2N49A 4FO2A 1BNZA 4A75A 1DD2A 4DK3C 4C3IH 2WAQA 5JH7F 2R93B 3MVVA 3QO2A 3RR5A 3AMUA 3H91A 5CV9A 1EYCA 1O7LA 5LHY1 3D4DA 3GIMA 4YCWA 4K6LA 2IT1A 2ENBA 4I4TF 3I70A 3PQIA 4X62H 4N8X1 1SYDA 1W3SA 3ONAB 4JI4Q 2UUBQ 4DR1Q 1GJXA 1AH9A 2MNAA 4DV7H 5KFEA 5IP7H 4QW8A 3KHLA 3N40P 2YTXA 4ECVA 1GXDC 2AMCB 2ZM6L 4QCLA 3OPOA 2B2VC 4L6TB 3J7ZC 1K1SA 3JSLA 2JA7B 5C6AA 1N36Q 4MV7A 4EEYA 2G9HD 1Y1VG 4A3MH 5KFPA 4J9OA 1ZKOA 1K28A 2QEXA 4IPGA 4PWQA 3ND8A 1IBLL 5LMUH 4LUOA 5DQHA 1Z47A 2UXDQ 3S2HH 1F2MA 1VQ6A 3MTSA 1RTNA 1PA6A 4GOPC 4A3GG 3S2HB 2D62A 4LFAQ 3MFGA 1U9RA 2F0KA 3TRZA 1TA8A 3KHGA 5KFZA 2F0EA 3QOJA 1GO3E 1UNNC 3GTJH 1EZ6A 3TP8A 3OHXC 4DR2L 4MNOA 4OX9L 1RK5A 2A69C 4DR6H 4DR5H 3K0XA 5JEAJ 1EWIA 2G5DA 3MXPA 2JEFA 1GSAA 3GTGA 1DOLA 2NVYB 1E1TA 4GN5A 4ZK9B 4UHVA 3VPBA 2QYZA 4YCVA 1CUKA 4J9PA 4DAMA 4B3RQ 4DUZL 2EPBA 4KHPH 1EY8A 1U4PA 3E9IA 3FDTA 1D2BA 1H9SB 1KDBA 2K5HA 2NTSA 3IFTA 5J3BA 2QDBA 1ZHQA 2UVWA 3W5OA 1TXYA 3SGIA 3KK7A 4CDFC 3N6XA 4B3TQ 4MTNA 1Q1BA 1L1OC 2PQEA 1MGSA 2NN6G 3D6CA 3S1NB 2A8VA 3DHQA 4C3HB 2A68C 5I9OA 3ETHA 3R5FA 3R93A 2V5AA 4UPAA 3NELA 3OIPA 4KY5A 2R82A 2VR1A 5KFIA 2W9BB 4DNRB 1MHWC 1JJCB 2B63G 3D31A 2E76C 3A8KE 3LWBA 3QR8A 4DFAA 2DGYA 3M4QA 3C1FA 3FKIH 3GTKA 1U0LA 4JOIC 1XMOL 3K3PA 5JPMC 5ELCA 1QVGA 4DL7A 1VQ9A 3GTMH 1D5ZC 1N34H 4IWXA 4JI3Q 2JEGA 4WJWA 3SE7A 2E5LQ 4DV0H 1Q8KA 2HD3A 1TU2B 2F52A 2UXCL 4V190 1BBXC 4JI8H 5DLQE 5GAEC 2DUDA 2MQHA 2O4XA 2VS1A 3M9OB 1VQNA 5IT9W 2UUCH 2JEJA 4JV5Q 4NXMH 4GNXC 4IWYA 2OQ0A 5L37A 4JI6H 2VQEQ 3JAMW 3BS1A 3GTGB 3SK4A 4RB1A 4DN4M 3K7AB 2WFWA 2V58A 1A3VA 4R4IA 1QB5D 3TEHB 4ED2A 2RDFA 3K7AH 3GTLA 2A73B 4YR3A 5A2QL 1XWEA 4IQZA 2VA2A 2KCNA 4QUFA 3ICEA 2XN9C 2DJGC 5H80A 5L1JA 1K83A 5D65A 4YHHL 2N55A 1TVXA 1FKAH 4ZKCB 3I56A 1FJGQ 2L55A 3H4BA 2M00A 3BG3A 1JE5A 1CI3M 3AEVA 4M9UA 2LFNA 5C44B 2ZXPA 4Y7NB 1IKLA 3MWEA 2SEBD 1KNEA 5C44H 3PGZA 5LL6b 1Y8NB 5G3LF 5FOBB 4MA5A 3BDCA 1ULZA 1VQIA 4KD3A 4MV9A 4RGTA 3MR6A 4IO9A 1RJPA 3GTQH 5BN4A 3OWEB 4X66L 4YB8B 4R8UA 3K5IA 1F9RA 3T1HH 4POFA 1PTOB 3TDQA 1BVSA 4RHSA 3ERSX 4FXKC 4I55F 1V51A 2IP4A 2FINB 4EEQA 2E2DC 4O3SA 2WKDA 2K05A 4JUZA 2OT2A 1CE8A 4JI1H 1B9NA 2CWPA 5C3EB 4O3NA 1KAAA 5K5PA 3V05A 2VUGA 1TWCB 1O80A 5FLXc 4X62Q 4DR1L 3Q1KA 4JI5H 4JCVE 2F0OA 2IY5B 1X32A 2YZMA 2YZNA 1NNXA 5IIFA 4DV1L 1RK6A 3K7UC 1EOTA 4GKJH 3NK9A 3D4RA 1A62A 3Q8PB 1K3RA 3WDNA 1CKMA 4BBRG 1OXUA 1RTOA 4FU0A 4LFBH 1VDZA 1O7YA 5K2MA 3Q8RB 2K5DA 3LP8A 1Z2OX 1KXLA 3G6JB 4LK1C 3E0JA 4ZKBB 1MBYA 3CC2A 4B3MQ 4DV1Q 2R92G 1NCVA 3RMHA 4RMFA 2B2VA 1SE4A 3FPPA 2UU9H 1HQMC 4XYOA 3BYTB 1S4ZA 4U7CA 2XRSD 2UXDH 4MV3A 2BH2A 4FS1A 5LL6S 4X65H 3UE0A 3M85A 3S2DB 1J5EQ 3GV3A 1F77A 1TS4A 5G3LD 3S2DH 1IBML 3A5ZB 1K8MA 4IR1A 3BZCA 1B6SA 4S3SA 1V1PA 3GIIA 3CMEA 1L2ZA 3OW2A 3S24A 4AQYQ 3G71A 1DIKA 3K5HA 4A93G 4M1UB 4IAJA 3K58A 3NQTA 5KFCA 4TV8F 1SE2A 3KLSX 1D5MC 4RU9A 2GLTA 4BY1B 2X0SA 1CQFA 2ALZA 2O5JC 1Q90A 4HQ6A 5D8DA 4EFEA 5CV4A 4PMWA 2F03A 4LMYA 1A6XA 3OYYA 1E2VA 1UC9A 5IGEA 1CKNA 2WAQB 1XPUA 4DXFA 1CA5A 1TR5A 1BOSA 2BA1A 3PIOA 3K59A 1IXRA 1HR0H 1KNAA 2K28A 2YRWA 4OX9H 1H9KA 4A3FG 4DAYA 2HQLA 1I3QA 2G9DA 3DEPA 4FXGC 2Z0SA 5FK9C 4FS2A 4B3TH 1S9FA 2I46A 3QB3A 1QOHA 3PF4A 3FPUB 5DGBA 1WTHA 2YU9A 4L5TA 4LF6Q 1TY2A 4ECUA 2DY7A 2H5XA 4OHJA 1HZ9A 3TZUA 4DA2A 1XNRL 1I4GA 1FGBD 3TBIB 2CQAA 1I4RA 1M90C 2K04A 5CA1F 2C2EA 3I2ZA 5M9OA 3KAJA 1EIFA 2BOSA 4DV3Q 1KIXA 4B08A 4FBUA 1K8GA 4K0KL 1UE7A 2VW9A 4DL6A 3KYHC 4RB0A 2Y0SA 2Z1CA 5CMDA 5C4XH 1ET6A 4H13C 4JI3H 4EQOA 2XSCA 4A3CG 1XPRA 1VQEA 4KD4A 4DV0Q 1ZXTA 5IOCA 2R7DA 4G7ZC 3GTGH 3A7LA 4AYBE 1AZPA 2BDOA 2AUJD 2Z6KA 1G6ZA 2A19A 2OWOA 1JQYD 3KTMA 4LF4H 3G6VA 3TQYA 1PFBA 5IGCA 4DV6L 4QIWA 1QJOA 1Y8OB 2EJGC 2VOBA 4RKLA 2ZTEA 2VQEH 3PW0A 3KALA 1F2ZA 1NMGA 1VQ8A 1XDNA 1X3EA 2C2RA 3IRBA 1LT6D 4XZ3B 4DR7Q 3J81c 3CRKC 4Y7NH 2I80A 5CYUA 1G51A 3PUZA 4J9QA 5HGQA 2RGVA 2F0LA 5LMNW 3DWQA 3SK6A 2N3SA 1QILA 3EVQA 3CD6A 4J9NA 1I6VC 4ILWA 1GGOA 4QQBX 4J9SA 3MFIA 3R3OA 1T9HA 1EZ8A 4ZUIA 5EKKA 1PK8A 2D5DA 2GVBA 1HNXQ 2F0WA 4YY3Q 1QE6A 3BZKA 1JJ2A 4A4IA 1JWMD 4C3HG 5T14A 2K33A 3D6WA 4BY1G 1R4QB 2PQAB 4O3RA 1RODA 4CJ0B 4AYBG 4A3EH 1I4PA 2PNRC 3W3AA 2LXJA 4X6AH 5KFJA 1YJ9A 4IUTA 5KFWA 3H15A 4BY7B 2R7ZG 4J6HA 4MAMA 2TSSA 3HOUG 3FDSA 4L63B 1VQCA 3PUYA 4TQUS 1SNDA 2KENA 4DR6L 2ES2A 2F0HA 3F2UA 1N8RC 2FK3A 2YL2A 3SXHA 1VQAA 3FRPB 1UUPA 1XNRH 1HTLD 3BU2A 1S5BD 3NBIA 3M3YH 4C56C 3CXCA 2R7ZA 4Q5VA 5IY0A 2W57A 2J0TD 3ORRA 2DY8A 5C5MA 1OTCA 5EKLA 5T1IA 4DK1A 3Q0AA 2AQ1B 1PH4A 4ED1A 4K2LA 1T5EA 2DWCA 1RJTA 1SR3A 4K5VA 5AJ3Q 3I4NG 2R84A 1IW7C 1JDBB 2RDJA 3GQCA 1S10A 3VR6A 3J7YW 2EXDA 3OSNA 2QF7A 3UDXA 4GLVB 5CV6A 4O42A 4OXPA 3F2DA 3OUUA 3NXWA 4CC6A 1S5DD 3RFCA 4RZQA 2SDFA 1I94Q 4JYAQ 3I72A 3F1ZA 2SCUB 2JA5H 4DV4H 1JWUD 1PLFA 3Q23A 1H9MA 3KBGA 5C4JH 4RNNA 3HXLA 4ZYSA 1RHPA 3HP3A 3H40A 1BQQT 4IJLA 1WH2A 5IODA 3V6JA 1F2YA 3E5NA 3SHLA 1S97A 1STNA 3JSNA 3RGXA 2PBZA 1N33Q 4MV8A 1K8AC 4J0MA 2W6NA 1A0IA 2CCZA 1PH8A 4GKKL 4ME6A 2VY3A 3HGBA 3CCSA 3CCVA 2I07B 2C9OA 3EJIA 3T4AC 1H95A 5KFOA 1GHJA 1HXYD 3J81E 4HAEA 3A74A 3HOYB 3HKZA 4ME5A 3U4ZA 1A8VA 3CHBD 3V2TA 2FK2A 3RAQA 1TWCA 3HOYH 1Y1WB 4LFCH 1V9PA 3GTJA 5E7NA 4AQYH 4NDXA 1PRTF 5I2XA 1Y1WH 4HR7B 2F4VQ 4OWWB 3HOVH 1N32Q 1WCMG 2WDTA 5CC4A 3GTQA 5KFXA 1B44D 4TV9F 4YHHQ 4JPBW 1N48A 3H94A 3SVMA 4O2BF 3PVXA 3VR4A 4JI2L 1TAEA 1SNQA 2JXMB 1DJRD 2OXPA 5FLMG 1HR0L 1X65A 2EY6A 2DJFC 1T36A 3VR2A 4CDEC 1U5KA 4CDDC 3A55A 2IW3A 2E2HA 3KLWA 3VYSA 2WTFA 1E3PA 5FLXL 3HOYG 1LTBD 2SNSA 5IGFA 5IGGA 4MN3A 2IX1A 2F0JA 2FFKB 2KCMA 2JEAI 2HDMA 2F0IA 1K0SA 1GUOA 1YI2A 4YR2A 5C4XB 1J9OA 2IL8A 1IBMQ 4C3IG 3TQ1A 4HIKA 1TWFA 2RDIA 3D3RA 3KOJA 4TRDA 2R7ZH 5F2DA 1JORA 4DV3H 1EY0A 1LTRD 2R7ZB 2F0NA 1I94L 4JYAL 1SBBB 1Z6HA 5KT6A 2VUMH 5BN5A 1ZYRC 3PO3H 3I4NB 4RWSC 2R7MA 2MUYA 3JRXA 5IGDA 3WO0A 4XYQA 4DR2H 5C0XJ 2HVRA 4R4TA 1G6PA 4LF7L 3G8CA 1AUVA 2J7ZA 5JVDF 1HUNA 1K0RA 2AHOB 3F8TA 1XTDA 1HNXL 3OSOA 5KRUA 4EBEA 2KA7A 3CRLC 4C1NK 3SI8A 2FLNA 1WR2A 1JR0D 1VF5C 4DUYQ 2E2IA 4FYDA 1M8AA 4MA0A 3A0JA 1NAPA 3I4OA 4OIJA 1SJED 4F87A 2L5TA 2ZM6Q 3RUPA 3ZJYC 1EWHA 2NZ1D 3N43B 3SK8A 1BO0A 5KIXA 5ELEA 5I47A 3HKZE 3NSWA 1LT3D 2CHBD 2R92B 2R6FA 3U9TA 2Q2TA 1B6RA 1M0WA 4ECSA 3AYHB 3HKZB 1IBLQ 2R92H 1O7ZA 4BXXG 3H6MA 1JMCA 5HURA 3WO1A 2WV6D 4F4XA 4DXGA 4LF9Q 5CORA 3E3XA 3GIQA 4A3EB 3L4KA 1U4RA 5GAGC 1TT2A 5KNBA 4PZ6A 5I6YA 3CPFA 5BPFA 4NXNH 1HR0W 3H20A 1GLVA 4EFBA 2OQKA 3QWNA 5KFTA 5DG7A 1Q7YC 3EBEA 5C4XG 2UVUA 1S0NA 3BQ0A 1PTOC 4A3MB 3KF6A 4DR4H 1N36H 2F0FA 1TWGA 1GD7A 1TKWB 3GTOB 3T51B 4LF5Q 1LTSD 1PRTD 2NU9B 2CKZB 2X6GA 4A3GB 1PH7A 2VA3A 1M7JA 1WJJA 2B3GA 5DLFA 2Z4IA 4PNYA 2IBKA 1Q1EA 1PV4A 4X3KA 4LFAH 4DV6Q 2Z6KC 5DQIA 1GUNA 2FKLA 3F2CA 1SYBA 1SSOA 5COYA 4LF7H 4A3FB 3E6ZX 4WORA 1XNQL 5KFQA 3CQZH 5KG2A 3ULJA 5LA6F 4IFDJ 4DR5Q 1AN7A 2JA5A 4NXNL 2NVTH 3V6HA 3O13A 1PYSB 1X9NA 2EE1A 5FLXE 2B2WC 1IKMA 1EYDA 1C7YA 4A76A 1SMXA 4UP9A 4DV5Q 1ET9A 3GP7A 1B50A 5KG7A 2J6UA 3L3OC 4A3IB 1KD1C 4V0BA 4FM9A 2C35B 4K5WA 1SFOH 4HIDA 3GV7B 1VQHA 1XX8A 4KKUA 5CV8A 1SEBD 3BDLA 2NUAB 4GZYC 2UXCQ 2QK4A 4A3LH 4TVAB 2YS6A 3QJYA 1JE4A 1TS3A 3NWSA 4JI4H 3LGJA 3UDGA 1EYGA 1D8LA 5GQOA 3RBEA 4P73A 1BGWA 3WOEA 4B3SH 3DM3A 4UCTA 4ECTA 3MWDA 2LMCB 2HT1A 1S03G 3OUZA 3KF6B 4JI7Q 3FKIB 2B29A 5AJ3L 1PX2A 2KQ3A 1KC7A 2J6SA 2F4VH 4BY7G 2NWGA 5C3XA 3W1BA 2Z8LA 1IOVA 3P1HA 4Q45A 5KYIA 1B3QA 1ILQA 2CH4A 1EQVA 1HA5A 1SN8A 1TWHB 4ZAIA 1S40A 5EZYF 3BDOA 2FJZA 1NSNS 1X3QA 2FMAA 1TWHH 1VQ7A 3RJ0A 2E5LH 2ICEC 2RHQB 3S9WA 4BBSH 4AH6A 4HMJA 1JB3A 3RD4A 2EYFA 4LF8Q 5EPKA 2EYMA 1AE3A 1K73C 2KECA 2XIWA 3MZ5A 2MGSA 2ZT9C 4TUYF 3M4PA 3CF5A 1VQPA 3G6YA 3NENA 5M5YH 1IBKQ 5FO9B 4HIOA 2UUAQ 2ZDGA 1M1KC 2I5LX 1S5ED 1LTLA 1CTMA 1EEID 2A6HC 1D1KA 2A5HA 4MHEA 4F88A 3I4MH 2B2TA 3QG1A 1CK1A 3T5HA 2EYPA 1QUQA 1E4FT 4RAYA 4O1NA 2F3WA 4KHPQ 4KKSA 2UVVA 3GQBA 4C2MH 5DEHA 3TIIA 2EYHA 2MFIA 4IPDA 4BBRB 3CCUA 2NU8B 2IX3A 4YBZB 3G6XA 4DKAC 2WE6A 5KFKA 1JDEA 2K01A 2D9UA 4KY6A 5I2YA 4MV6A 4JV1A 2Z9HA 3I7FA 3NUCA 4GN4B 4FNFA 4PG3A 4GOPB 2TMPA 1KTKA 2FXQA 2WB1B 4CKEA 4C3IB 4MTKA 1XMQH 2JA7G 4OO1H 1HUMA 5EBCA 3L9AX 5IE8A 1S72A 4MV4A 3Q8QB 4C3JG 4LH6A 3DM1A 4NP5A 1TS5A 4KHZA 5D1PA 5J39A 2JE6I 4EBCA 2A69D 1C8CA 2R61A 1N34Q 2E2HH 1HNZQ 2ZM6H 2CW7A 4H02A 2ASJA 2ASBA 1N56A 1TWAA 3RAXA 1H9JA 4PQXA 3ULLA 5C3EH 3J7AF 4IUPA 4KN4C 4X66Q 5FPOA 2UUCL 2F3VA 1EY5A 5GROA 3H3VC 1B2TA 1SE3A 2JA7H 1VMCA 4JV5H 1BUVT 4HTHA 4NXMQ 2DPJA 2L0CA 3PZPA 5IYCG 3TS0A 1W2BA 4X65L 3R2IA 3GTLH 2V4RA 4JW0A 2CH4W 1BR9A 5KFLA 4LSXA 3BYYB 3GTLB 1QCBD 2B8FA 4YP3A 2FJ2A 3DXJC 1YEZA 4QL5A 4ECXA 5HV6A 4HIMA 2B2YA 4ZHQF 2FP4B 1FL0A 3OIQA 3LMLA 5LOVF 1A15A 2K5VA 2RDHA 4E6IA 5BN3A 4A3KH 3GTOA 4NKLA 2PMZE 2E2JH 4LFBL 4K8JA 5E1FA 4A3KB 3GTJB 1RJQA 1EY7A 3LNNA 1PTOD 2W6QA 2E2JB 4H44C 4DV1H 3S1RH 1SXTA 4OO1G 2EVBA 1IBKL 3ND9A 4JG2A 4A3FH 1VQKA 2CZGA 2NVYA 4EGJA 3UDIA 3S1RB 2YTYA 2NZOA 2WAQG 5EQ0A 2EQSA 2O5IC 4ECRA 2NUCA 4BBSG 2CWAA 4DK6C 4NB3A 1WYDA 2VUMA 1JIHA 1VBHA 3MEHA 4LF8L 3HOZG 2EY2A 3HRZC 4MV1A 4RGNA 4YJ3F 3PCOB 1YHBA 4JV5L 5KG3A 3I90A 2JA8G 3Q6SA 4C5CA 2VB3X 5ELFA 3HKSA 4X3SA 1DOKA 2ICIA 3K5OA 4DAPA 3PO3G 5A2QW 3KHHA 3FKIG 1WTXA 2EJFC 1BBUA 3K0YA 2R92A 3RB6A 5KGUA 4EQPA 1SNOA 4BY1H 3M7NA 4B3RL 2CQYA 2VQDA 3C0FB 1VCIA 4LW1A 3BABA 1B33N 3X3MA 1M0TA 1W6JA 4YWKA 3DWPA 3OW7A 5KFVA 3MR3A 1CFMA 3HB9A 3GIKA 3Q8DA 2F4IA 3CVZA 5C1PA 3OOCA 2K5NA 4K8IA 4ED3A 4RCOA 5D3DA 1HZCA 3NEMA 5J2UF 4JC0A 4RG1A 2UXCH 1TY0A 3P75A 3M4OH 4OX9Q 1O7IA 1Q86C 3MEFA 2HIVA 3A8IE 4JI2H 1JX4A 1VQ4A 1PH9A 2MO1A 1S5FD 4A3LG 2JA8B 2BH8A 4DGZA 4ALPA 3T1YQ 5AFWA 2NBFA 1QUQB 4KMUC 3MXNB 1V8QA 3KF8B 4CBVA 4MTEA 3PIO3 1SYFA 1FGUA 4H7BA 4LUZA 4FF3A 2XGPA 2D0OA 3H0GH 4DV5L 4DUZQ 4BBSB 2Y0SB 1HJPA 2YYZA 1SLJA 1VKZA 3MFYA 3HG9A 1HRJA 1STBA 3G6EA 1HH2P 3MHBA 2E2IH 3DEOA 5D3IB 1QZGA 1PHJA 1K3BC 2A74C 4K0KH 3EQLC 4FF2A 2JN4A 4MIUA 1MI2A 4TQRA 2QA4A 1ZHSA 3P20A 3VA5A 3BVMA 4X3UA 2C28A 2R8GA 1LUZA 1J5EH 4R1JA 3QIAA 3FHWA 1NJIC 1S0MA 1AN8A 3J80W 2K32A 3N44B 1IYUA 1QG7A 1Z7TA 2AQ4A 4IFDH 4UAIA 1K9MC 4PMBA 4R4QA 4RNMA 4N9TA 1YHQA 4X64H 3FMCA 2ATLA 1IBKH 5E3FA 2IHFA 4EQ5A 1MD2D 2UUAH 1EEFD 4YWLA 5LMNQ 3OTOH 2XCPA 4UDUC 4FF4A 5EPLA 4DV2Q 5M3FB 1ICFB 4WD3A 4ZLTF 1WOCA 1HCZA 2M9VA 4ED8A 5FO8B 4J8QA 1C0AA 1PMRA 1WCMB 2IJ0A 5IYBG 1ILPA 1AZQA 3BQ2A 1PH2A 4U6PA 2PVPA 4DK0A 2F0SA 1WCMH 1PFSA 1C30A 2W70A 4WBNF 5D1OA 1KLUD 3GTQB 1TWGB 4OEMB 5C44G 2WACA 3JAMi 1EY4A 4QIWB 4UP7A 2W6OA 4WJ3M 2W6ZA 1I50A 3LWEA 1UC8A 5IT9L 5C0XH 4IRCA 2I87A 2PZTA 1IZ6A 4CC5A 2EOTA 4M8AA 1XXGA 1YVCA 5A35A 5BMVF 5CR3A 1B9MA 2EYJA 3HKZG 3I8ZA 4ECZA 1PH5A 2HHHQ 5KG5A 3RLFA 2E2HB 2ZJRA 3S14H 5LP6F 4P2CB 1JXLA 1II3A 1EIHA 1A9XA 3K5LA 4Q8EA 1MSGA 2JSOA 5CV7A 5HBRB 3CQZA 4O0AA 2KBNA 3QFFA 4HR7A 2EDGA 3EROA 1G2TA 4JI0Q 2R8JA 4ZUJA 3KDFB 4J15A 2OTLA 2C22A 1GOZA 2ZJQA 4EYHB 4G3IA 5CBEE 2F0QA 1IW7D 4IJHA 5M3MB 5JQWA 3GTPH 2K1BA 1GSHA 1SYGA 3GTPB 4HJAA 2YW2A 1SMYD 3PUXA 1ZYRD 3VR5A 2EZVA 1HNWH 2IWHA 4O3QA 4ETSA 5C8YF 1EUDB 1MJEA 1B04A 5F9NA 5GAHC 1LLRD 3FEWX 2YRXA 2XCAA 3HOXH 3HOXG 5JOBA 4KTAA 5CV5A 1I94H 4JYAH 1E4EA 5ELNA 4AQYL 3CCRA 1PDQA 2I0QA 2C2DA 1I7NA 1T5XD 4AYBB 4XT3B 5FKAC 5L9XA 4RZRA 1Y14B 3BG5A 1TIID 4HYKA 2Z4HA 4GLAC 1J8IA 4NW2A 3B6YA 3K8AA 1OWTA 4NXML 3UDFA 2WINB 1N33H 5HGTA 1XNQQ 2OH2A 2KHIA 4JOIA 2F0DA 2FLPA 1YJWA 4JVZA 4KK7A 5JJKA 1C9OA 3MJFA 1BXRA 1DYQA 3KJOA 2R85A 4KV6A 1EUCB 1F9QA 2F0VA 3K57A 1PVOA 1FNWA 3AB9A 5H1SE 3HOWB 1Y1VH 3SDZA 2HDLA 4IZOA 3H4DA 4HNTA 1Y1VB 5KG6A 2AGOA 1T94A 1N32L 1T3NA 1F9SA 3U58A 4XYMB 2OTJA 5KG4A 5ELDA 4YWMA 4IRKA 3HOVG 2YTVA 1KHIA 3J81W 2PO4A 3LWUA 1BCPC 3MWYW 1G91A 4ECWA 4E4TA 1PRTB 4RAUC 4A3BG 2RF4A 4RB2C 2MCTA 1X6OA 4GKKQ 2B2TC 2A6EC 2UUCQ 3L0OA 2BQUA 3A5UA 2PNHA 4DR3L 4BS9A 1N33L 2R6GA 3A56A 3NPPA 1VMPA 1EFWA 3U9OA 3RN2A 2K5QA 5KFYA 4JI6Q 1KRTA 5IYBH 2NVXA 4IUQA 2WB1A 1WCMA 1SAPA 2JA6A 4DV7L 4X62L 4XQQA 1CHQD 3BVZA 1LT5D 4HNUA 4MTDA 1P16A 4DR3Q 2VXWA 2RHSB 3RV3A 4ECYA 2R7KA 1GYFA 3OMGA 2RBMA 1XJVA 4NMZA 2GN5A 3JRWA 4JBMA 1XMOH 3C1EA 2CFMA 2EY1A 5FPRA 1WTVA 3M9NB 2NN6I 2Q2IA 5EWEA 1FR3A 1OXTA 1TS2A 1BKBA 2R93G 5KFUA 4QJFA 5M3FH 1TWAH 3TIGA 1YHAA 2N78A 4G7OC 2B63H 3RV4A 2Z6BA 2VQFH 2QGQA 3GLKA 1JOOA 5E4XA 2KEDA 2B63B 5EGTA 4UY8C 1YITA 2NTTA 3BQ1A 3M4YA 3QOLA 2AWOA 4YHHH 4I65A 3KDFA 1IYJB 1I50B 1GUWA 1KJ9A 1DZ1A 3NHHA 3K3VA 1ZETA 2BCOA 3MAQA 5IWAL 5IGBA 4X3TA 4FF1A 3IG0A 3EN2A 5K36H 3T53B 4A93B 4I7HA 2DNEA 2H4OA 3D4WA 4JI8Q 3EA6A 4GNXB 3S14B 3I73A 1E4GT 3MWMA 4IR9A 1PYBA 1V4YA 1EU3A 1Y8PB 3I4MG 1E24A 5IT9E 4DR4L 3EIVA 4CJ2C 4KHVA 4JI5Q 3DWAA 5EDWA 1KLGD 1TWFH 2DN8A 2BQ3A 1VS0A 4RHRA 4Z9CB 4DV4L 2XGQA 5C4ZA 1B4OA 1EL0A 1E22A 2NYZD 2KOLA 3HOUH 3S16B 2C00A 4DL4A 4HJ5A 2XGTA 2XTIA 4PV1C 4GS3A 3CAMA 4CJ1B 4LFBQ 4UCUA 4P71A 3OSPA 2R93A 1H9RA 5IP9H 3ULPA 1CSPA 3N8DA 5EAYA 2IPKD 2RVLA 5FJ8G 1PH1A 3EFXD 2UU9Q 2HQEA 2WB1E 1AE2A 4OL7A 2L11A 2M2LA 3C3LA 4YCUA 1JOKA 4X65Q 2LXKA 3OMCA 4EBDA 1SYEA 4ZRZA 4YR0A 3BZDB 4EX5A 3PW5A 2BE5C 3PW7A 4XIGS 5C3EG 4JBWA 4UCSA 4DUYH 2R93H 4YIJA 3R8BA 3E9HA 3BJYA 1RCVD 1GHKA 2W7PA 2CW0C 2R8KA 4GKJL 2AGQA 5L1IA 2Q8TA 2RDGA 3HEJA 4DV3L 2W8KA 1ML0D 1CHPD 2DZDA 4ABNA 2AKWB 3STBC 4DV5H 4O3PA 5KFRA 5I9PA 2BQRA 1YNJD 5FD6A 2XC9A 4HSVA 5FLMH 2XNAC 2FHTA 1ASZA 5EBDA 3I91A 3CCLA 1X3GA 2QILA 3U9SA 2VNUD 3RB3A 2VB2X 3I12A 5EJWA 1W96A 2BE5D 5LL6X 2NU6B 3TSSA 2UUBL 3NWTA 2UXDL 4NPSA 1N34L 1LTAD 1PYWD 3U50C 1Y1WG 5DG9A 4OWTB 4L8JA 3J7AV 5LYJF 1EYAA 3NTIA 4XXEA 5LMNL 4A3CH 1DCZA 1I7LA 3GTMA 4ECQA 4J9LA 5IP7G 2XWJB 4A3JB 4LF6H 3CC4A 3PIPA 4A3JH 4GNXA 2WKCA 5ISRA 2AU0A 3D0FA 3HZXA 2K7VA 3N52A 1DV2A 1HTPA 4Y8VB 1KBLA 4JI7H 1KABA 1PRTC 4FP5D 4ED0A 1L0YB 4HJ9A 3G4SA 1RJRA 5A2QE 2VPSA 5J2TF 1OXSC 2NVQB 4HSPA 2F0PA 3H3VH 3S1MB 4IFDI 5ELOA 1FJGL 2UUAL 2VZAA 1E4EB 1Y69U 3S1MH 3QZ7A 1QVCA 1IHZA 1JCKB 4OWXB 3S15B 4DV6H 4QIWE 1CQJB 4XQNA 2HJWA 4OIKA 4O3OA 4GKKH 3PO2G 2YYAA 5CGKA 2FPGB 1LM0A 3L2PA 4PMCA 1K8OA 3H0GG 2VUMB 5KFDA 5KFHA 4P75A 1KJJA 2J6TA 1K83H
chains in the Genus database with same CATH topology
1V1QA 1PH6A 2H5XA 4LFCQ 4OONA 1HZ9A 4DUYL 4HIMA 3RNUA 1FL0A 2PQAA 2K75A 1J5EL 1XNRL 3WWVA 1J6QA 5JEAG 1M90C 4A3KH 2K5VA 3I2ZA 2E8GA 1EIFA 2PMZE 4O2DA 4DV3Q 1KIXA 4BY7H 2E2JH 1BBWA 1K8GA 4LFBL 4K0KL 1UE7A 2VW9A 2ZJPA 3KYHC 1UEBA 5LMUQ 1E1OA 2I5HA 2ID0A 4JI7L 5C4XH 1I3QH 3S1RH 1GM5A 3HOWH 2YV5A 4A3CG 1B8AA 1IBKL 4JG2A 4A3FH 1VQEA 1XPRA 4DV0Q 1VQKA 4JBJA 3RLNA 3UDIA 2R7DA 2JA9A 2NZOA 2WAQG 2EQSA 2VL6A 2YTYA 3GTGH 1Z9FA 4AYBE 4BBSG 2CWAA 2ATWA 4DK6C 4NB3A 1WYDA 2Z6KA 2A19A 2OWOA 4R4OA 4L5SA 4LF8L 3HOZG 3CW2C 3S17H 3TQYA 4B3SQ 3PCOB 1SRUA 1YHBA 4QY7A 4DV6L 4HJ8A 2IX0A 1VQOA 4PZ8A 4A3DH 4JV5L 2JA8G 2WAQE 3GTOH 2VQFQ 5M3FG 2ZTEA 1WFQA 1B70B 1GKHA 3HKSA 4DV7Q 1IL2A 3PO3G 3M9BA 1NMGA 1VQ8A 1X3EA 3IRBA 4A3GH 3FKIG 3PUVA 1VQBA 1X56A 4IPCA 1BBUA 3RZDH 3CMAA 4BY1H 3M7NA 3JC66 4L5QA 4JI1L 5M3MG 5IYCH 4Y7NH 1VCIA 1G51A 4LW1A 3J81c 4B3RL 3PUZA 5HGQA 5BR8Q 3DLLA 4JI0L 3J7A5 1NMFA 4YWKA 1HNZL 5LMNW 1RL2A 2N3SA 3Q8DA 3CD6A 4APVA 2K5NA 4A3MG 2Y0SE 4QQBX 2V1CC 4JI4L 1ASYA 3GO5A 3KJPA 1VQGA 1HZCA 3NEMA 4JC0A 1T9HA 5IYDG 4RG1A 4DV0L 3S16H 2GVBA 1HNXQ 3M4OH 4OX9Q 1O7IA 1V43A 4YY3Q 1Q86C 3BZKA 3K81C 3MEFA 4IPHA 4JI8L 1JJ2A 2HIVA 4R4CA 1VQ4A 4A4IA 1JB7A 1PH9A 2MO1A 2Y0SG 5JJIA 3RLOA 3F2BA 3ER0A 3STBD 3T1HL 2BH8A 1YJNA 4A3LG 4BY1G 4ALPA 3T1YQ 3I55A 2PQAB 2JQOA 1QUQB 4WJ4A 2JJQA 3MXNB 3KF8B 4DR5L 2R7FA 4AYBG 4A3EH 1FGUA 4LUZA 1X3FA 2LXJA 4L5RC 2D0OA 3H0GH 4DV5L 4A3JG 4DUZQ 1YJ9A 3H15A 1HJPA 2YYZA 1SLJA 4BA1I 2R7ZG 3S1NH 1HZBA 1KQSA 2HIXA 3CCMA 2MO0A 2UU9L 4DV4Q 3HOUG 3G6EA 2AWNA 1HH2P 3H3VI 1UE6A 4DAYB 1VQMA 2E2IH 1VQCA 3PUYA 1Q12A 4TQUS 1QZGA 1PHJA 2KENA 4DR6L 2ES2A 1NBWA 1N8RC 1SE8A 1UE1A 2K14A 2QA4A 1VQAA 3J81i 4LF6L 1VQJA 2D0PA 1LUZA 4LF5L 3PV0A 4R1JA 3BU2A 1EUJA 3S1QH 3TREA 3AQQA 3FHWA 1NJIC 3M3YH 3CXCA 3HOWG 5FJ8H 5JJLA 4X64L 5IY0A 4A3IH 1OTCA 2K50A 1PH4A 3OTOL 4OO1I 2K4KA 1K9MC 5BR8L 1KL9A 1SR3A 4R4QA 5AJ3Q 3I4NG 1YHQA 1Q46A 3J80c 2L15A 3CCEA 2IHFA 4EQ5A 2EXDA 2JEBI 1VQLA 3UDXA 4GLVB 5IWAQ 4OXPA 4YWLA 3F2DA 5LMNQ 4A3DG 1KC8C 1EOVA 4DV2Q 1QZHA 1I94Q 4JYAQ 1WOCA 1VQ5A 2KHJA 3F1ZA 2EIFA 2JA5H 2N8NA 1C0AA 5IYBG 4DR4Q 4PZ7A 1PH2A 5C4JH 1RIPA 1WCMH 1PFSA 2JA6H 4IJLA 2A1AA 4IOCA 5C44G 1CKOA 1CSQA 4UP7A 3JAMi 3GTKH 1L1OB 1LYLA 1NTGA 4WJ3M 2LSSA 1N33Q 4LF9L 1K8AC 4DR2Q 2Q2UA 1IZ6A 1A0IA 4IOAA 2CCZA 1PH8A 1XMQL 4B3TL 4GKKL 1I6HH 2VY3A 3AFQA 1YVCA 3CCSA 3CCVA 1JJGA 2JK8A 2Q2HA 3HKZG 1N9WA 1H95A 5K36G 1PH5A 2HHHQ 2JA8H 4DR6Q 3A74A 1MIUA 3RLFA 4DNIA 4X64Q 2ZJRA 3S14H 3U4ZA 1A8VA 4QGUA 2RCNA 2VUMG 3HOYH 1V9PA 3W1GA 4YY3L 3T1HQ 4B3SL 2NVQH 4BBRH 5E7NA 1L1OA 1Y1WH 3UE1A 2F4VQ 4OWWB 3HOVH 1EQRA 1MKHA 1WCMG 1N32Q 2NVYH 4LFCL 5C0XI 2GVAA 2ALYB 2K52A 4KHPL 4YHHQ 3S15H 3RN5A 4JI2L 4O0AA 2KBNA 2N49A 4P75A 4A75A 1Q82C 4DK3C 4C3IH 4JI6L 4JI0Q 3RR5A 3KDFB 5FLMG 1HR0L 1X65A 4J15A 2OTLA 2OCEA 2ZJQA 1U5KA 4YCWA 2IT1A 4IJHA 3KLWA 3GTPH 1E3PA 3HOYG 2IX1A 1W3SA 4JI4Q 4HJAA 2UUBQ 2KCMA 2JEAI 3PUXA 4DR1Q 1YI2A 4C3HH 1X54A 1AH9A 2MNAA 2UXBQ 4KI0A 4A3IG 1MJEA 1IBMQ 5IP7H 3HFZB 2YTXA 5GAHC 2AMCB 2ZM6L 3HOXH 4HIKA 3OTOQ 3J7ZC 3HOXG 1N36Q 3KOJA 3HOZH 5ELNA 4AQYL 2R7ZH 1Y1VG 3CCRA 4A3MH 1B7YB 2I0QA 2UXBL 2QEXA 4IPGA 4DR7Q 1IBLL 1GVPA 4LUOA 1Z47A 1I94L 4DR7L 4JYAL 1Y14B 2UXDQ 2VUMH 3S2HH 3L7ZC 2PI2E 1VQ6A 4GLAC 1UWVA 3VDYA 1PA6A 1I5FA 3B6YA 5LMUL 4GOPC 3K8AA 4LF4L 3PO3H 4A3GG 1VQDA 5M5XH 2D62A 3UDFA 4NXML 4LFAQ 1XNQQ 2KHIA 4JOIA 5C0XJ 3TRZA 1YJWA 4R4TA 5JJKA 4JI2Q 1G6PA 4LF7L 1C9OA 1UE5A 1P8LA 3KJOA 1GO3E 3GTJH 1L2FA 4JBKA 4OX9L 1K0RA 2AHOB 3F8TA 1XTDA 4MNOA 5C0XG 4DR2L 1HNXL 1PVOA 3K0XA 5H1SE 4NXNQ 4GKJQ 5JEAJ 1FVIA 1EWIA 4DUYQ 5HY6A 1Y1VH 3A0JA 3I4OA 5IYDH 1E1TA 2JA5G 4GN5A 4JI3L 4YCVA 2ZM6Q 1N32L 3ZJYC 1EIYB 3U58A 2OTJA 1CUKA 4YWMA 4DAMA 1NE3A 4B3RQ 4K0KQ 3HOVG 4DUZL 3HKZE 2HHHL 2YTVA 3E9IA 1DGSA 1KHIA 2Q2TA 1KAWA 2K5HA 1Q81C 3AYHB 5J3BA 1IBLQ 2R92H 5M3MH 4BXXG 1JMCA 3FP9A 4A3BG 3W5OA 1TXYA 3SGIA 4LF9Q 4KLKA 2RF4A 2F4VL 4A3BH 1X6OA 4B3TQ 4MTNA 1Q1BA 2UUCQ 3L0OA 5GAGC 3A5UA 1L1OC 2PNHA 4DR3L 2NN6G 3E0EA 2R6GA 4PZ6A 1N33L 2A8VA 1EFWA 4LWCA 3CPFA 3RN2A 4UPAA 1HR0W 3NELA 4JI6Q 1KRTA 3KFUA 4P72A 5IYBH 1JJCB 2OQKA 2B63G 3D31A 1Q7YC 4B3ML 3EBEA 5C4XG 4DV7L 2JA6G 4BA2I 2DGYA 4X62L 3M4QA 3PF5A 2YU9H 3FKIH 1S3OA 3NBHB 1P16A 3KF6A 1U0LA 2RHSB 4JOIC 4DR3Q 1XMOL 1QVGA 4JI1Q 1VQ9A 3GTMH 1GD7A 2F3IA 4JI3Q 1XJVA 1X55A 2GN5A 2E5LQ 4LF5Q 4JBMA 1Q8KA 2UXCL 2F52A 1QVFA 2CKZB 1EQQA 2CFMA 5DLQE 5GAEC 2NN6I 2Q2IA 2DUDA 2MQHA 1PH7A 1WJJA 1OXTA 2B3GA 2VS1A 1VQNA 1TWCH 1BKBA 2R93G 2KCTA 1Q1EA 1PV4A 4QJFA 5M3FH 2CQOA 1TWAH 2Z6KC 4DV6Q 4JV5Q 1MJCA 1YHAA 2N78A 4ME3A 4GNXC 2B63H 2OQ0A 3F2CA 4OO1G 2VQEQ 2QGQA 4LFAL 1XNQL 3CQZH 3ULJA 1YITA 4UY8C 4FDBA 4IFDJ 4DR5Q 2WFWA 2PI2A 2ZTDA 4NXNL 2NVTH 1YZ6A 1SROA 1E7ZA 1PYSB 4R4IA 1X9NA 3TEHB 3K7AH 1C7YA 2AWOA 4LNQA 2BA0A 4A76A 1SMXA 3KDFA 1IYJB 3G48A 4UP9A 4DV2L 4DV5Q 4XTCS 3ICEA 5IWAL 1OXVA 1OXXK 1KD1C 3EN2A 2C35B 4YHHL 5M5WH 4A3KG 1N36L 1SFOH 1L0WA 4HIDA 3I56A 1FJGQ 2I5MX 1VQHA 4JI8Q 4GLXA 4GNXB 1JE5A 1XPOA 3GDEA 1PYBA 2UXCQ 3AEVA 4A3LH 2WP8J 4TVAB 3I4MG 1E24A 3LGJA 3UDGA 3EIVA 1D8LA 5GQOA 5C44H 3PGZA 1EYGA 4JI5Q 3PUWA 4LF7Q 4P73A 1TWFH 3PSIA 4POGA 3PO2H 1HNWQ 1VQIA 3DM3A 4IO9A 1VS0A 4GOPA 3CP0A 3GTQH 1YBYA 2HT1A 4X66L 1A63A 4DV4L 1R9TH 4POFA 1E22A 3KF6B 3HOUH 1BVSA 4JI7Q 3ERSX 4HJ5A 2B29A 5AJ3L 2XGTA 1G291 2XTIA 4GS3A 3CAMA 3CCJA 4BY7G 4LFBQ 4P71A 3AFPA 3W1BA 5IP9H 3ULPA 4DR4L 1CSPA 1SN8A 1S40A 5EAYA 2IHEA 1PH3A 2ZTCA 5FJ8G 2UU9Q 1PH1A 1TWHH 2CWPA 1VQ7A 4C3JH 4DPGA 3RZOH 2WB1E 1HR0Q 2RHQB 4BBSH 1AE2A 4AH6A 1HZAA 1KRSA 5FLXc 4YCUA 4LF8Q 4X62Q 4DR1L 4X65Q 1AE3A 4JCVE 1K73C 4Y52H 2LXKA 2IY5B 3BJUA 4EX5A 4DV1L 3M4PA 3CF5A 3K7UC 1VQPA 1TWGH 2WB1G 3NENA 1XMQQ 4XIGS 5M5YH 4JBWA 5C3EG 4HIOA 1IBKQ 2UUAQ 1M1KC 2R93H 2I5LX 1A62A 1K3RA 3E9HA 4MZ9A 1LTLA 1CKMA 4BBRG 1OXUA 4GKJL 3I4MH 5IP9G 4DV3L 1VQFA 5IT9c 5GADC 1I50H 3TS2A 2AKWB 3STBC 1QUQA 1KXLA 3CC2A 4B3MQ 4DV1Q 2R92G 4KHPQ 4LUVA 4A93H 4GN3B 4RMFA 3JAMc 4P74A 4C2MH 2VQEL 4IFDG 2MFIA 5FLMH 4IPDA 3CCUA 1ASZA 4DKAC 2BH2A 3CCLA 1X3GA 2VNUD 3I7FA 3UE0A 3M85A 4GN4B 2E5LL 2NVXH 4GOPB 4PG3A 1J5EQ 4LF4Q 3T1YL 2UUBL 1XNRQ 3J80i 2UXDL 4NPSA 2FXQA 1CKNB 3U4VA 1N34L 3U50C 1Y1WG 1IBML 3A5ZB 3S2DH 4OWTB 4GKKQ 3BZCA 2JA7G 5LMNL 4A3CH 1YNXA 3CMEA 5IE8A 5IP7G 3S24A 3OW2A 3G71A 4AQYQ 1S72A 4A93G 3CC4A 4BXXH 3CC7A 3PIPA 1HNWL 4A3EG 4A3JH 4KHZA 3GD7A 4GNXA 3I4NH 2NZHA 2JE6I 3D0FA 4UP8A 1N34Q 2E2HH 1HNZQ 4HJ9A 3G4SA 4H02A 2ASBA 2VQFL 1JT8A 1XMOQ 1OXSC 1WI5A 4PMWA 3ULLA 5C3EH 3H3VH 4IFDI 4X6AH 3OYYA 3K80C 5ELOA 1CKNA 1FJGL 1XPUA 2UUAL 4X66Q 1YIJA 3J81j 4HJ7A 2VZAA 2UUCL 2BA1A 5GROA 3PIOA 3S1MH 1IXRA 1QVCA 2JA7H 4OWXB 4QIWE 1NY4A 4NXMQ 4A3FG 2HQLA 3CPWA 5IYCG 3TS0A 1W2BA 2Z0SA 4X65L 4JI5L 3GTLH 3PO2G 1LM0A 3L2PA 3CCQA 3PF4A 4AIMA 1D7QA 3H0GG 1YEZA 4L5TA 4QL5A 4LF6Q 1K83H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1Q A;  1PH6 A;  2H5X A;  4LFC Q;  4OON A;  1HZ9 A;  4DUY L;  4HIM A;  3RNU A;  1FL0 A;  2PQA A;  2K75 A;  1J5E L;  1XNR L;  3WWV A;  1J6Q A;  5JEA G;  1M90 C;  4A3K H;  2K5V A;  3I2Z A;  2E8G A;  1EIF A;  2PMZ E;  4O2D A;  4DV3 Q;  1KIX A;  4BY7 H;  2E2J H;  1BBW A;  1K8G A;  4LFB L;  4K0K L;  1UE7 A;  2VW9 A;  2ZJP A;  3KYH C;  1UEB A;  5LMU Q;  1E1O A;  2I5H A;  2ID0 A;  4JI7 L;  5C4X H;  1I3Q H;  3S1R H;  1GM5 A;  3HOW H;  2YV5 A;  4A3C G;  1B8A A;  1IBK L;  4JG2 A;  4A3F H;  1VQE A;  1XPR A;  4DV0 Q;  1VQK A;  4JBJ A;  3RLN A;  3UDI A;  2R7D A;  2JA9 A;  2NZO A;  2WAQ G;  2EQS A;  2VL6 A;  2YTY A;  3GTG H;  1Z9F A;  4AYB E;  4BBS G;  2CWA A;  2ATW A;  4DK6 C;  4NB3 A;  1WYD A;  2Z6K A;  2A19 A;  2OWO A;  4R4O A;  4L5S A;  4LF8 L;  3HOZ G;  3CW2 C;  3S17 H;  3TQY A;  4B3S Q;  3PCO B;  1SRU A;  1YHB A;  4QY7 A;  4DV6 L;  4HJ8 A;  2IX0 A;  1VQO A;  4PZ8 A;  4A3D H;  4JV5 L;  2JA8 G;  2WAQ E;  3GTO H;  2VQF Q;  5M3F G;  2ZTE A;  1WFQ A;  1B70 B;  1GKH A;  3HKS A;  4DV7 Q;  1IL2 A;  3PO3 G;  3M9B A;  1NMG A;  1VQ8 A;  1X3E A;  3IRB A;  4A3G H;  3FKI G;  3PUV A;  1VQB A;  1X56 A;  4IPC A;  1BBU A;  3RZD H;  3CMA A;  4BY1 H;  3M7N A;  3JC6 6;  4L5Q A;  4JI1 L;  5M3M G;  5IYC H;  4Y7N H;  1VCI A;  1G51 A;  4LW1 A;  3J81 c;  4B3R L;  3PUZ A;  5HGQ A;  5BR8 Q;  3DLL A;  4JI0 L;  3J7A 5;  1NMF A;  4YWK A;  1HNZ L;  5LMN W;  1RL2 A;  2N3S A;  3Q8D A;  3CD6 A;  4APV A;  2K5N A;  4A3M G;  2Y0S E;  4QQB X;  2V1C C;  4JI4 L;  1ASY A;  3GO5 A;  3KJP A;  1VQG A;  1HZC A;  3NEM A;  4JC0 A;  1T9H A;  5IYD G;  4RG1 A;  4DV0 L;  3S16 H;  2GVB A;  1HNX Q;  3M4O H;  4OX9 Q;  1O7I A;  1V43 A;  4YY3 Q;  1Q86 C;  3BZK A;  3K81 C;  3MEF A;  4IPH A;  4JI8 L;  1JJ2 A;  2HIV A;  4R4C A;  1VQ4 A;  4A4I A;  1JB7 A;  1PH9 A;  2MO1 A;  2Y0S G;  5JJI A;  3RLO A;  3F2B A;  3ER0 A;  3STB D;  3T1H L;  2BH8 A;  1YJN A;  4A3L G;  4BY1 G;  4ALP A;  3T1Y Q;  3I55 A;  2PQA B;  2JQO A;  1QUQ B;  4WJ4 A;  2JJQ A;  3MXN B;  3KF8 B;  4DR5 L;  2R7F A;  4AYB G;  4A3E H;  1FGU A;  4LUZ A;  1X3F A;  2LXJ A;  4L5R C;  2D0O A;  3H0G H;  4DV5 L;  4A3J G;  4DUZ Q;  1YJ9 A;  3H15 A;  1HJP A;  2YYZ A;  1SLJ A;  4BA1 I;  2R7Z G;  3S1N H;  1HZB A;  1KQS A;  2HIX A;  3CCM A;  2MO0 A;  2UU9 L;  4DV4 Q;  3HOU G;  3G6E A;  2AWN A;  1HH2 P;  3H3V I;  1UE6 A;  4DAY B;  1VQM A;  2E2I H;  1VQC A;  3PUY A;  1Q12 A;  4TQU S;  1QZG A;  1PHJ A;  2KEN A;  4DR6 L;  2ES2 A;  1NBW A;  1N8R C;  1SE8 A;  1UE1 A;  2K14 A;  2QA4 A;  1VQA A;  3J81 i;  4LF6 L;  1VQJ A;  2D0P A;  1LUZ A;  4LF5 L;  3PV0 A;  4R1J A;  3BU2 A;  1EUJ A;  3S1Q H;  3TRE A;  3AQQ A;  3FHW A;  1NJI C;  3M3Y H;  3CXC A;  3HOW G;  5FJ8 H;  5JJL A;  4X64 L;  5IY0 A;  4A3I H;  1OTC A;  2K50 A;  1PH4 A;  3OTO L;  4OO1 I;  2K4K A;  1K9M C;  5BR8 L;  1KL9 A;  1SR3 A;  4R4Q A;  5AJ3 Q;  3I4N G;  1YHQ A;  1Q46 A;  3J80 c;  2L15 A;  3CCE A;  2IHF A;  4EQ5 A;  2EXD A;  2JEB I;  1VQL A;  3UDX A;  4GLV B;  5IWA Q;  4OXP A;  4YWL A;  3F2D A;  5LMN Q;  4A3D G;  1KC8 C;  1EOV A;  4DV2 Q;  1QZH A;  1I94 Q;  4JYA Q;  1WOC A;  1VQ5 A;  2KHJ A;  3F1Z A;  2EIF A;  2JA5 H;  2N8N A;  1C0A A;  5IYB G;  4DR4 Q;  4PZ7 A;  1PH2 A;  5C4J H;  1RIP A;  1WCM H;  1PFS A;  2JA6 H;  4IJL A;  2A1A A;  4IOC A;  5C44 G;  1CKO A;  1CSQ A;  4UP7 A;  3JAM i;  3GTK H;  1L1O B;  1LYL A;  1NTG A;  4WJ3 M;  2LSS A;  1N33 Q;  4LF9 L;  1K8A C;  4DR2 Q;  2Q2U A;  1IZ6 A;  1A0I A;  4IOA A;  2CCZ A;  1PH8 A;  1XMQ L;  4B3T L;  4GKK L;  1I6H H;  2VY3 A;  3AFQ A;  1YVC A;  3CCS A;  3CCV A;  1JJG A;  2JK8 A;  2Q2H A;  3HKZ G;  1N9W A;  1H95 A;  5K36 G;  1PH5 A;  2HHH Q;  2JA8 H;  4DR6 Q;  3A74 A;  1MIU A;  3RLF A;  4DNI A;  4X64 Q;  2ZJR A;  3S14 H;  3U4Z A;  1A8V A;  4QGU A;  2RCN A;  2VUM G;  3HOY H;  1V9P A;  3W1G A;  4YY3 L;  3T1H Q;  4B3S L;  2NVQ H;  4BBR H;  5E7N A;  1L1O A;  1Y1W H;  3UE1 A;  2F4V Q;  4OWW B;  3HOV H;  1EQR A;  1MKH A;  1WCM G;  1N32 Q;  2NVY H;  4LFC L;  5C0X I;  2GVA A;  2ALY B;  2K52 A;  4KHP L;  4YHH Q;  3S15 H;  3RN5 A;  4JI2 L;  4O0A A;  2KBN A;  2N49 A;  4P75 A;  4A75 A;  1Q82 C;  4DK3 C;  4C3I H;  4JI6 L;  4JI0 Q;  3RR5 A;  3KDF B;  5FLM G;  1HR0 L;  1X65 A;  4J15 A;  2OTL A;  2OCE A;  2ZJQ A;  1U5K A;  4YCW A;  2IT1 A;  4IJH A;  3KLW A;  3GTP H;  1E3P A;  3HOY G;  2IX1 A;  1W3S A;  4JI4 Q;  4HJA A;  2UUB Q;  2KCM A;  2JEA I;  3PUX A;  4DR1 Q;  1YI2 A;  4C3H H;  1X54 A;  1AH9 A;  2MNA A;  2UXB Q;  4KI0 A;  4A3I G;  1MJE A;  1IBM Q;  5IP7 H;  3HFZ B;  2YTX A;  5GAH C;  2AMC B;  2ZM6 L;  3HOX H;  4HIK A;  3OTO Q;  3J7Z C;  3HOX G;  1N36 Q;  3KOJ A;  3HOZ H;  5ELN A;  4AQY L;  2R7Z H;  1Y1V G;  3CCR A;  4A3M H;  1B7Y B;  2I0Q A;  2UXB L;  2QEX A;  4IPG A;  4DR7 Q;  1IBL L;  1GVP A;  4LUO A;  1Z47 A;  1I94 L;  4DR7 L;  4JYA L;  1Y14 B;  2UXD Q;  2VUM H;  3S2H H;  3L7Z C;  2PI2 E;  1VQ6 A;  4GLA C;  1UWV A;  3VDY A;  1PA6 A;  1I5F A;  3B6Y A;  5LMU L;  4GOP C;  3K8A A;  4LF4 L;  3PO3 H;  4A3G G;  1VQD A;  5M5X H;  2D62 A;  3UDF A;  4NXM L;  4LFA Q;  1XNQ Q;  2KHI A;  4JOI A;  5C0X J;  3TRZ A;  1YJW A;  4R4T A;  5JJK A;  4JI2 Q;  1G6P A;  4LF7 L;  1C9O A;  1UE5 A;  1P8L A;  3KJO A;  1GO3 E;  3GTJ H;  1L2F A;  4JBK A;  4OX9 L;  1K0R A;  2AHO B;  3F8T A;  1XTD A;  4MNO A;  5C0X G;  4DR2 L;  1HNX L;  1PVO A;  3K0X A;  5H1S E;  4NXN Q;  4GKJ Q;  5JEA J;  1FVI A;  1EWI A;  4DUY Q;  5HY6 A;  1Y1V H;  3A0J A;  3I4O A;  5IYD H;  1E1T A;  2JA5 G;  4GN5 A;  4JI3 L;  4YCV A;  2ZM6 Q;  1N32 L;  3ZJY C;  1EIY B;  3U58 A;  2OTJ A;  1CUK A;  4YWM A;  4DAM A;  1NE3 A;  4B3R Q;  4K0K Q;  3HOV G;  4DUZ L;  3HKZ E;  2HHH L;  2YTV A;  3E9I A;  1DGS A;  1KHI A;  2Q2T A;  1KAW A;  2K5H A;  1Q81 C;  3AYH B;  5J3B A;  1IBL Q;  2R92 H;  5M3M H;  4BXX G;  1JMC A;  3FP9 A;  4A3B G;  3W5O A;  1TXY A;  3SGI A;  4LF9 Q;  4KLK A;  2RF4 A;  2F4V L;  4A3B H;  1X6O A;  4B3T Q;  4MTN A;  1Q1B A;  2UUC Q;  3L0O A;  5GAG C;  3A5U A;  1L1O C;  2PNH A;  4DR3 L;  2NN6 G;  3E0E A;  2R6G A;  4PZ6 A;  1N33 L;  2A8V A;  1EFW A;  4LWC A;  3CPF A;  3RN2 A;  4UPA A;  1HR0 W;  3NEL A;  4JI6 Q;  1KRT A;  3KFU A;  4P72 A;  5IYB H;  1JJC B;  2OQK A;  2B63 G;  3D31 A;  1Q7Y C;  4B3M L;  3EBE A;  5C4X G;  4DV7 L;  2JA6 G;  4BA2 I;  2DGY A;  4X62 L;  3M4Q A;  3PF5 A;  2YU9 H;  3FKI H;  1S3O A;  3NBH B;  1P16 A;  3KF6 A;  1U0L A;  2RHS B;  4JOI C;  4DR3 Q;  1XMO L;  1QVG A;  4JI1 Q;  1VQ9 A;  3GTM H;  1GD7 A;  2F3I A;  4JI3 Q;  1XJV A;  1X55 A;  2GN5 A;  2E5L Q;  4LF5 Q;  4JBM A;  1Q8K A;  2UXC L;  2F52 A;  1QVF A;  2CKZ B;  1EQQ A;  2CFM A;  5DLQ E;  5GAE C;  2NN6 I;  2Q2I A;  2DUD A;  2MQH A;  1PH7 A;  1WJJ A;  1OXT A;  2B3G A;  2VS1 A;  1VQN A;  1TWC H;  1BKB A;  2R93 G;  2KCT A;  1Q1E A;  1PV4 A;  4QJF A;  5M3F H;  2CQO A;  1TWA H;  2Z6K C;  4DV6 Q;  4JV5 Q;  1MJC A;  1YHA A;  2N78 A;  4ME3 A;  4GNX C;  2B63 H;  2OQ0 A;  3F2C A;  4OO1 G;  2VQE Q;  2QGQ A;  4LFA L;  1XNQ L;  3CQZ H;  3ULJ A;  1YIT A;  4UY8 C;  4FDB A;  4IFD J;  4DR5 Q;  2WFW A;  2PI2 A;  2ZTD A;  4NXN L;  2NVT H;  1YZ6 A;  1SRO A;  1E7Z A;  1PYS B;  4R4I A;  1X9N A;  3TEH B;  3K7A H;  1C7Y A;  2AWO A;  4LNQ A;  2BA0 A;  4A76 A;  1SMX A;  3KDF A;  1IYJ B;  3G48 A;  4UP9 A;  4DV2 L;  4DV5 Q;  4XTC S;  3ICE A;  5IWA L;  1OXV A;  1OXX K;  1KD1 C;  3EN2 A;  2C35 B;  4YHH L;  5M5W H;  4A3K G;  1N36 L;  1SFO H;  1L0W A;  4HID A;  3I56 A;  1FJG Q;  2I5M X;  1VQH A;  4JI8 Q;  4GLX A;  4GNX B;  1JE5 A;  1XPO A;  3GDE A;  1PYB A;  2UXC Q;  3AEV A;  4A3L H;  2WP8 J;  4TVA B;  3I4M G;  1E24 A;  3LGJ A;  3UDG A;  3EIV A;  1D8L A;  5GQO A;  5C44 H;  3PGZ A;  1EYG A;  4JI5 Q;  3PUW A;  4LF7 Q;  4P73 A;  1TWF H;  3PSI A;  4POG A;  3PO2 H;  1HNW Q;  1VQI A;  3DM3 A;  4IO9 A;  1VS0 A;  4GOP A;  3CP0 A;  3GTQ H;  1YBY A;  2HT1 A;  4X66 L;  1A63 A;  4DV4 L;  1R9T H;  4POF A;  1E22 A;  3KF6 B;  3HOU H;  1BVS A;  4JI7 Q;  3ERS X;  4HJ5 A;  2B29 A;  5AJ3 L;  2XGT A;  1G29 1;  2XTI A;  4GS3 A;  3CAM A;  3CCJ A;  4BY7 G;  4LFB Q;  4P71 A;  3AFP A;  3W1B A;  5IP9 H;  3ULP A;  4DR4 L;  1CSP A;  1SN8 A;  1S40 A;  5EAY A;  2IHE A;  1PH3 A;  2ZTC A;  5FJ8 G;  2UU9 Q;  1PH1 A;  1TWH H;  2CWP A;  1VQ7 A;  4C3J H;  4DPG A;  3RZO H;  2WB1 E;  1HR0 Q;  2RHQ B;  4BBS H;  1AE2 A;  4AH6 A;  1HZA A;  1KRS A;  5FLX c;  4YCU A;  4LF8 Q;  4X62 Q;  4DR1 L;  4X65 Q;  1AE3 A;  4JCV E;  1K73 C;  4Y52 H;  2LXK A;  2IY5 B;  3BJU A;  4EX5 A;  4DV1 L;  3M4P A;  3CF5 A;  3K7U C;  1VQP A;  1TWG H;  2WB1 G;  3NEN A;  1XMQ Q;  4XIG S;  5M5Y H;  4JBW A;  5C3E G;  4HIO A;  1IBK Q;  2UUA Q;  1M1K C;  2R93 H;  2I5L X;  1A62 A;  1K3R A;  3E9H A;  4MZ9 A;  1LTL A;  1CKM A;  4BBR G;  1OXU A;  4GKJ L;  3I4M H;  5IP9 G;  4DV3 L;  1VQF A;  5IT9 c;  5GAD C;  1I50 H;  3TS2 A;  2AKW B;  3STB C;  1QUQ A;  1KXL A;  3CC2 A;  4B3M Q;  4DV1 Q;  2R92 G;  4KHP Q;  4LUV A;  4A93 H;  4GN3 B;  4RMF A;  3JAM c;  4P74 A;  4C2M H;  2VQE L;  4IFD G;  2MFI A;  5FLM H;  4IPD A;  3CCU A;  1ASZ A;  4DKA C;  2BH2 A;  3CCL A;  1X3G A;  2VNU D;  3I7F A;  3UE0 A;  3M85 A;  4GN4 B;  2E5L L;  2NVX H;  4GOP B;  4PG3 A;  1J5E Q;  4LF4 Q;  3T1Y L;  2UUB L;  1XNR Q;  3J80 i;  2UXD L;  4NPS A;  2FXQ A;  1CKN B;  3U4V A;  1N34 L;  3U50 C;  1Y1W G;  1IBM L;  3A5Z B;  3S2D H;  4OWT B;  4GKK Q;  3BZC A;  2JA7 G;  5LMN L;  4A3C H;  1YNX A;  3CME A;  5IE8 A;  5IP7 G;  3S24 A;  3OW2 A;  3G71 A;  4AQY Q;  1S72 A;  4A93 G;  3CC4 A;  4BXX H;  3CC7 A;  3PIP A;  1HNW L;  4A3E G;  4A3J H;  4KHZ A;  3GD7 A;  4GNX A;  3I4N H;  2NZH A;  2JE6 I;  3D0F A;  4UP8 A;  1N34 Q;  2E2H H;  1HNZ Q;  4HJ9 A;  3G4S A;  4H02 A;  2ASB A;  2VQF L;  1JT8 A;  1XMO Q;  1OXS C;  1WI5 A;  4PMW A;  3ULL A;  5C3E H;  3H3V H;  4IFD I;  4X6A H;  3OYY A;  3K80 C;  5ELO A;  1CKN A;  1FJG L;  1XPU A;  2UUA L;  4X66 Q;  1YIJ A;  3J81 j;  4HJ7 A;  2VZA A;  2UUC L;  2BA1 A;  5GRO A;  3PIO A;  3S1M H;  1IXR A;  1QVC A;  2JA7 H;  4OWX B;  4QIW E;  1NY4 A;  4NXM Q;  4A3F G;  2HQL A;  3CPW A;  5IYC G;  3TS0 A;  1W2B A;  2Z0S A;  4X65 L;  4JI5 L;  3GTL H;  3PO2 G;  1LM0 A;  3L2P A;  3CCQ A;  3PF4 A;  4AIM A;  1D7Q A;  3H0G G;  1YEZ A;  4L5T A;  4QL5 A;  4LF6 Q;  1K83 H; 
#chains in the Genus database with same CATH topology
 1V1Q A;  3I4M B;  4DUY L;  4G4K A;  4KJN A;  2PQA A;  2K75 A;  1K83 B;  4J1M A;  1J6Q A;  5JEA G;  2F1M A;  3A7A B;  1AP0 A;  4LAA A;  1UEB A;  4QF4 A;  1WVL A;  2I5H A;  2ID0 A;  4KN7 C;  1BXT A;  4C2M B;  4JI7 L;  3IN5 A;  1Y1W A;  1I3Q H;  3URY A;  5FD5 A;  2K03 A;  1B8A A;  2UXB L;  3GIL A;  3RLN A;  4RNO A;  2IMW P;  2VL6 A;  2J4X A;  4F8M A;  3HOZ B;  1Z9F A;  2B63 A;  2XVS A;  1A2U A;  3MR2 A;  3NE5 B;  4IN3 A;  3KAK A;  4R4O A;  4K5X A;  4CKB A;  1STH A;  1D5X C;  2NN6 H;  3CW2 C;  4B3S Q;  3JAM L;  4HJ8 A;  1VQO A;  2SNM A;  2UUB H;  2IX0 A;  2PYK A;  3NBH A;  4PZ8 A;  4A3D H;  1K1Q A;  4ZQI A;  5CB4 F;  2WAQ E;  2VQF Q;  1AEX A;  4A3D B;  3KHR A;  4B9W A;  2WYO A;  4LMQ D;  3T5J A;  4QUC A;  4IRD A;  1DM0 B;  2QW7 A;  4DV7 Q;  1IL2 A;  3M9B A;  4EGQ A;  1ENA A;  3K5N A;  3CMA A;  3JC6 6;  4JI1 L;  5M3M G;  1KJQ A;  5KNC A;  4U67 3;  5BR8 Q;  4HCE A;  4JI0 L;  1NMF A;  3IKJ A;  1NUC A;  2E74 C;  3RF2 A;  4RUA A;  1LTT D;  3BVG A;  2JA6 B;  4APV A;  2Y0S E;  3J81 L;  1ASY A;  3GO5 A;  4H0L C;  2CVR A;  3GV8 B;  2FMM A;  1HQR D;  2KCC A;  5DM6 3;  2KVM A;  5IYD G;  4DV0 L;  3TIN A;  3S16 H;  1I6H B;  3PMF A;  1V43 A;  4IPH A;  4JI8 L;  3RB0 A;  4JV0 A;  3V4Z A;  4R4C A;  3A8J E;  5JJI A;  3F2B A;  3STB D;  3T1H L;  3W2D A;  3Q22 A;  1EY6 A;  1YJN A;  1FNU A;  2YCH A;  5L1K A;  3I55 A;  2JQO A;  1STY A;  1NR2 A;  2JJQ A;  3GIJ A;  3BA9 A;  4DR5 L;  2R7F A;  4KJO A;  4A3B B;  4UCO A;  4NLG A;  1S68 A;  1BCP D;  3ZYY X;  4L5R C;  4A3J G;  4DL3 A;  1EWC A;  2PZW A;  4BA1 I;  4DAV A;  1KQS A;  3BAA A;  1JKJ B;  4IUR A;  4DV4 Q;  4F4Z A;  3H3V I;  2B39 A;  5EWF A;  1LAC A;  2V9W A;  1UE6 A;  1VQM A;  1U4M A;  1JC7 A;  1Y1V A;  1G8Z D;  1Q12 A;  4KKT A;  2N88 A;  5DNF A;  4B3R H;  1SJH D;  4N9P A;  4TKO B;  1NBW A;  5KFF A;  1HA6 A;  2JEI A;  2K14 A;  2MPM A;  3PIP 3;  3J81 i;  1VQJ A;  2D0P A;  4LF5 L;  2W9C B;  3PV0 A;  1PTO H;  4LSA A;  2JP1 A;  1EUJ A;  3TRE A;  3HOW G;  4O4H F;  4A3I H;  3BA8 A;  3MXU A;  4OO1 I;  2K4K A;  1EFI D;  1BCP F;  4LJZ C;  1KL9 A;  3J80 c;  3CCE A;  1A3T A;  1Z2N X;  5IWA Q;  1Q3L A;  4A3D G;  1KC8 C;  2R8I A;  1EOV A;  1QZH A;  2ZDQ A;  1VQ5 A;  2R87 A;  4DNT B;  5I6W A;  2W7O A;  4ED6 A;  2N8N A;  1PZJ D;  2QCP X;  3J80 L;  1X3P A;  4PZ7 A;  2JA7 A;  3D8G A;  1RIP A;  2M05 A;  1Q8I A;  2DPI A;  2FLL A;  2A1A A;  4IOC A;  4RAZ A;  1CKO A;  1CSQ A;  3GTK H;  3FKI A;  3M4I A;  1LYL A;  4ED7 A;  1MZB A;  3R23 A;  4Q0F A;  1G2S A;  4K14 A;  2PZU A;  3GTK B;  2Q2U A;  5KX5 F;  3M4O B;  4IOA A;  2Q8I B;  4IAL A;  2KUM A;  4B3T L;  2IA6 A;  4PDB A;  4Q44 A;  3PR5 B;  3AFQ A;  1IOW A;  3R2T A;  1JJG A;  2Q2H A;  1QNU A;  3KXY T;  1N9W A;  1HFN A;  2JA8 H;  4DR6 Q;  3KUP A;  5EWG A;  4A2B A;  4QGU A;  5JJZ A;  3TN2 A;  1WTO A;  3W1G A;  2NVQ H;  3CU7 A;  3VR3 A;  4R9W A;  5J22 A;  1L1O A;  3UE1 A;  4F4W A;  3EPI A;  3PW4 A;  5KFA A;  4RUC A;  1EQR A;  1MKH A;  2HCC A;  2NVY H;  4LFC L;  4DL2 A;  2GVA A;  2ALY B;  2K52 A;  3PO2 B;  4KHP L;  4O2A F;  1AUX A;  4DUZ H;  3S15 H;  2E2I B;  3UI2 A;  1Q82 C;  4JI6 L;  5KG0 A;  1HPC A;  2O03 A;  4LH7 A;  2OCE A;  5D14 A;  3TP7 A;  2A68 D;  1V1P B;  1TQO A;  1C48 A;  1EHI A;  1EYZ A;  1S0O A;  3C2P A;  1TWH A;  3SEB A;  4R8I A;  4EVO A;  4C1N I;  1ESF A;  3EPG A;  4C3H H;  3K5M A;  1GUT A;  3RZO B;  1X54 A;  2LKV A;  1ICW A;  2EYO A;  2PPB C;  3GV5 B;  2E75 C;  4KI0 A;  2PN1 A;  4RGM A;  2D2C C;  4A3I G;  1OO9 B;  1HFG A;  3HFZ B;  3FMA A;  1N32 H;  2KEE A;  3OTO Q;  3VA7 A;  5LMN H;  2EXZ A;  1RDP D;  4WRD A;  3HOZ H;  3RB4 A;  2AQ2 B;  5KFS A;  1B7Y B;  4F4Y A;  1I4X A;  5CAE B;  1O75 A;  1CM9 A;  3UQ8 A;  1BCP B;  1ESR A;  1EY9 A;  1GVP A;  1VF7 A;  4FVM A;  4I7Z C;  1F2L A;  4RH6 A;  4DR7 L;  3X3N A;  2DIK A;  1XTC D;  5JVG 3;  3PW2 A;  3L7Z C;  2PI2 E;  1UWV A;  1DON A;  3VDY A;  5C1O A;  2WII B;  1I5F A;  1PFN A;  5LMU L;  4LF4 L;  1IBL H;  1M4V A;  3KF8 A;  1VQD A;  5M5X H;  1XYI A;  4TQS A;  3P7J A;  2BR0 A;  5DG8 A;  2GA4 B;  1DXM A;  4LF9 H;  3N6R A;  2MJ8 A;  1PFM A;  1H9S A;  4JI2 Q;  1UE5 A;  2AUK A;  1UAP A;  1P8L A;  2B2U C;  5GON F;  4XDX A;  5BPH A;  1L2F A;  4JBK A;  4XT1 B;  4Q43 A;  3T1Y H;  5C0X G;  3NTK A;  1E0B A;  4NXN Q;  4GKJ Q;  2RSO A;  3VPC A;  1IBM H;  1FVI A;  5HY6 A;  1JIC A;  4QB4 A;  4J9R A;  3WNZ A;  5JAV A;  1SYC A;  1EIG A;  1RF2 D;  5IYD H;  1C4Q A;  2JA5 G;  1U4L A;  4JI3 L;  1RYS A;  2CW8 A;  1NR4 A;  2K5W A;  1EIY B;  1ZQ7 A;  1NE3 A;  4K0K Q;  2XRQ D;  2HHH L;  5BR8 H;  3CKI B;  1IL8 A;  1DGS A;  4ZI7 F;  1W93 A;  1KAW A;  1Q81 C;  3KLR A;  4O4I F;  4LF5 H;  3J7A K;  5M3M H;  2EJM A;  2RSN A;  3FP9 A;  1WTW A;  5KG1 A;  4KLK A;  2F4V L;  4A3B H;  4RKB A;  4FBT A;  3E0E A;  4LWC A;  3R5X A;  3RTX A;  1A3U A;  3KFU A;  4P72 A;  4O4L F;  1RD9 D;  5KFG A;  5F9L A;  4B3M L;  4DV2 H;  1PTO F;  4ODG A;  3R5H A;  2JA6 G;  4BA2 I;  3PF5 A;  2YU9 H;  1GUS A;  1S3O A;  3NBH B;  4JI1 Q;  4HED A;  2MHV A;  5TSS A;  2F3I A;  4ZOL F;  1X55 A;  2KHS A;  2X6L A;  3A54 A;  3ITP A;  3G7L A;  1QVF A;  3EYY A;  1V1O A;  2PW5 A;  1EQQ A;  4IUN A;  2W8L A;  4G57 A;  1TWC H;  2LY7 A;  4HNV A;  2KCT A;  3H0G A;  1ENF A;  2KSW A;  1XNQ H;  2CQO A;  1MJC A;  4ME3 A;  3JAM E;  4GC7 A;  1SEI A;  2V59 A;  2XIG A;  4BWS C;  2OLS A;  5ELB A;  3C46 A;  4LFA L;  5KT2 A;  3QZ8 A;  4FDB A;  1GSO A;  3T56 B;  4KY7 A;  5IYZ F;  5C5J A;  2PI2 A;  2ZTD A;  3HS0 C;  2DLN A;  1YZ6 A;  1SRO A;  1E7Z A;  4R8N A;  5IWA H;  3V6K A;  1CQI B;  3I3C A;  4APM A;  2FK1 A;  2W71 A;  4LNQ A;  2BA0 A;  1MSH A;  2F0G A;  3G48 A;  4DV2 L;  1EU4 A;  4ID6 A;  4B3M H;  3NP8 A;  4XTC S;  1OXV A;  1OXX K;  5M5W H;  4A3K G;  1N36 L;  1L0W A;  2I5M X;  4GLX A;  1GUG A;  4WFN 3;  3GDE A;  1XPO A;  5JVH 3;  1ONL A;  3M7G A;  2P5Z X;  3H0G B;  2WP8 J;  2ZDH A;  3IL8 A;  4XQJ A;  3K6O A;  2NB0 A;  3SR1 A;  2JA5 B;  1SCU B;  3PUW A;  4LF7 Q;  4R8U B;  4POG A;  3PSI A;  3PO2 H;  3NQI A;  1HNW Q;  5C4J B;  1AW7 A;  1FD7 D;  1O78 A;  2FB9 A;  4UCR A;  4GOP A;  3CP0 A;  1YBY A;  1A63 A;  1R9T H;  5JVL A;  4RA8 A;  4DU9 A;  1CS0 A;  2P0A A;  4AYB A;  2GPW A;  1G29 1;  3CCJ A;  4QWC A;  1QWY A;  4IUU A;  3ERQ A;  3AFP A;  2RA4 A;  5J1Z A;  4DR3 H;  2PCF B;  3SK5 A;  4DR7 H;  1SNC A;  2J9G A;  3FVQ A;  4GC6 A;  2IHE A;  1VAJ A;  4EYI B;  5KYL A;  1PH3 A;  2ZTC A;  1BNC A;  4F7X A;  4C3J H;  4CGY B;  4DPG A;  1HR0 Q;  3RZO H;  1R4P B;  2HUG A;  1HZA A;  1KRS A;  4C3J B;  2JYO A;  5KND A;  4TSS A;  3HOV B;  4Y52 H;  1LO5 D;  1LT4 D;  2F0U A;  1HNX H;  1Z2P X;  2ZJT A;  4YY3 H;  4QWD A;  3BJU A;  3AU7 A;  2EYL A;  4RCN A;  1TWG H;  2WB1 G;  1XMQ Q;  2F0T A;  5KFB A;  2UXB H;  2RCF A;  4EGV A;  4MZ9 A;  2K6A A;  4CDC C;  2PW7 A;  3GV6 A;  5IP9 G;  4DLK A;  1VQF A;  4N8F A;  5IT9 c;  5GAD C;  1I50 H;  3RUZ A;  2A6H D;  2QEJ C;  3TS2 A;  5D1O B;  4YQW A;  5M5X B;  3MA2 B;  4QWB A;  1KJI A;  1SFO A;  4RFB A;  2V4Q A;  3IAY A;  4LUV A;  4A93 H;  4C5B A;  4GN3 B;  3JAM c;  4P74 A;  2A6E D;  2VQE L;  4IFD G;  1EQT A;  1CT1 D;  2H1E A;  4BWG B;  5KT7 A;  4RB3 C;  3DMU A;  1UNS A;  3HBL A;  2DNC A;  3GID A;  4LF8 H;  2MP1 A;  3M9M B;  4JV2 A;  4OEL B;  2E5L L;  2NVX H;  4LF4 Q;  5C5L A;  1XNR Q;  4DL5 A;  1JWS D;  3T1Y L;  3GIP A;  1PZI D;  1EZ1 A;  2OEO A;  3J80 i;  2NVX B;  3VPD A;  2RGR A;  1TWF B;  3RIZ A;  1CKN B;  1DOM A;  1CQV A;  3U4V A;  3E5S A;  3UFX B;  1I4Q A;  1YNX A;  1BDO A;  5CBA E;  5JPN C;  4K6D A;  2ASL A;  3HOU B;  2W9C A;  3V4S A;  4BXX H;  2PMZ A;  3CC7 A;  4UFZ A;  3RGZ A;  5DGA A;  1HNW L;  4A3E G;  3GD7 A;  3I4N H;  2NZH A;  5LXT F;  5DQG A;  2W6P A;  4UP8 A;  2O2L D;  4CHT B;  4JK1 C;  1SNP A;  1L0X B;  2VQF L;  1JT8 A;  1UEA B;  1XMO Q;  4QWE A;  1F9P A;  1W6K A;  1WI5 A;  1M6V A;  4EG0 A;  1E2W A;  3K80 C;  3KLS A;  2EY5 A;  5C4H A;  3J81 j;  4HJ7 A;  1YIJ A;  3HOX B;  3VMM A;  2W9A A;  1YNN C;  3H09 A;  3SE0 A;  3TP5 A;  1KEE A;  1NY4 A;  4CKC A;  3CPW A;  2ZXR A;  4EQN A;  2YU9 B;  4JI5 L;  4DR1 H;  5KKN B;  4OGQ C;  1IYV A;  4HMI A;  1PXU A;  3CCQ A;  4AIM A;  1D7Q A;  3KBX A;  5I4D A;  4YAK B;  2VPQ A;  3TZD A;  1PZK D;  1FYC A;  1PH6 A;  4HN7 A;  4LFC Q;  4OON A;  4J9K A;  3RNU A;  1J5E L;  1WD1 A;  3WWV A;  1HHV A;  4B9X A;  2E8G A;  3LX0 A;  1BJT A;  1FNV A;  1HNZ H;  4O2D A;  4BY7 H;  1CZG A;  1BBW A;  4ZCK A;  2ZJP A;  5LMU Q;  2R7L A;  1E1O A;  2L12 A;  5KFM A;  1GM5 A;  4QWA A;  3HOW H;  2R3Z A;  2YV5 A;  3N41 B;  4X66 H;  4RGO S;  4JBJ A;  1C3O A;  3RBD A;  1SDF A;  2JA9 A;  5EKI A;  2B2U A;  1KJ8 A;  1WSC A;  4UCV A;  1ZEQ X;  1YNJ C;  5FLX W;  1D6E C;  3T5L A;  2ATW A;  3V96 A;  3OHB A;  4L5S A;  3M3Y B;  3MXG A;  2R7N A;  5NUC A;  3S17 H;  1LTG D;  1B3A A;  1SRU A;  4QY7 A;  2W6M A;  4K2K A;  4L1K A;  5EPJ A;  2Q8R E;  3S17 B;  3GTO H;  2CW0 D;  5C3W A;  5M3F G;  1WFQ A;  4C5A A;  3GTP A;  1B70 B;  1GKH A;  4ZQ3 A;  2XWB B;  5M5W B;  3NTH A;  2B2W A;  3Q2O A;  5KT4 A;  4ULL A;  4A3G H;  5KFN A;  3PUV A;  1VQB A;  1X56 A;  4IPC A;  2HGS A;  2RQX A;  5KEE A;  4G7H C;  3RZD H;  1VBG A;  4L5Q A;  5IYC H;  2XD4 A;  2R8H A;  2QDL A;  2GPS A;  3RZD B;  3J7A 5;  3DLL A;  1HNZ L;  1I4H A;  1QNK A;  4IZ8 A;  2YS7 A;  1RL2 A;  4R7R A;  3CQZ B;  4A3M G;  3ETJ A;  4I50 F;  2V1C C;  4JI4 L;  2FE3 A;  3KJP A;  1VQG A;  2NVT B;  1E2Z A;  4IUV A;  2B2Y C;  1LTI D;  1R9T B;  2UVR A;  3NGD A;  4QW9 A;  1KDA A;  1RKN A;  3K81 C;  1CA6 A;  3PN1 A;  4IHJ F;  2YZG A;  1JB7 A;  2FPP B;  3OWF A;  1R9T A;  2Y0S G;  3RLO A;  2XCL A;  3ER0 A;  5E4W C;  4M7E A;  5KT3 A;  1SFO B;  4WJ4 A;  3MFH A;  4F50 A;  3MC0 B;  2AGP A;  1RYR A;  5FO7 B;  1X3F A;  5JUM A;  3ORQ A;  1TWA B;  3VYT A;  3JZI A;  4Q8F A;  2BDN A;  3S1N H;  4YAJ B;  2ASD A;  1HZB A;  2HIX A;  3I4L A;  3TME A;  2MO0 A;  3CCM A;  2UU9 L;  5KT5 A;  1ENC A;  4I7A A;  2AWN A;  1I3Q B;  4DAY B;  1JOQ A;  3F8N A;  5EOY A;  4J9M A;  3MR5 A;  5T1G A;  3T13 A;  3PR4 A;  1SE8 A;  3T5K A;  1UE1 A;  4A2A A;  4LF6 L;  3TP6 A;  1SMY C;  5L1L A;  3Q8S B;  3S1Q H;  3AQQ A;  5CA0 F;  3GTM B;  1B1Z A;  5FJ8 H;  3Q24 A;  4X64 L;  5JJL A;  3T16 A;  3S1Q B;  1A2T A;  2K50 A;  3VYR A;  1WTP A;  2OF1 A;  1AFP A;  3OTO L;  4XX0 B;  2L4N A;  1D1I A;  5DM7 3;  5BR8 L;  2I8C A;  2HHH H;  1Q46 A;  1STA A;  2L15 A;  2PMZ B;  1VQL A;  2UXB Q;  2JEB I;  2KJX A;  1LAB A;  1STG A;  2L1B A;  2SOB A;  2RKS A;  3IFD A;  2KHJ A;  2FPI B;  2C5C A;  1JLL B;  2EIF A;  1WTR A;  2ZXO A;  4QMG A;  1I6U A;  3N42 B;  4DR4 Q;  1YNN D;  2X69 A;  2B8G A;  2W9B A;  2V4D A;  2JA6 H;  1FJG H;  1B53 A;  4JI0 H;  3VYU A;  5M5Y B;  1KDC A;  1BF4 A;  4Q0Y A;  1L1O B;  1NTG A;  1SNM A;  4FXD A;  2AQ3 B;  2FMC A;  2LSS A;  4LF9 L;  4DR2 Q;  2L9H A;  3PO3 B;  1I6H H;  1DV1 A;  3DF7 A;  5DLG A;  1XMQ L;  5DAU A;  2LS0 1;  2QKI C;  4XYL B;  4DF7 A;  1LV9 A;  3MXN A;  3J80 E;  3OHA A;  4HCS A;  2JK8 A;  1CZW A;  2HCI A;  3L4J A;  5K36 G;  1STE A;  1MIU A;  4DNI A;  5JEA H;  4X64 Q;  3TQT A;  2HVS A;  1S5C D;  2RCN A;  4C2M A;  2VUM G;  2R86 A;  3T1H Q;  4YY3 L;  4YJ2 F;  1WTQ A;  4B3S L;  1WD0 A;  4BBR H;  2NU7 B;  1SYX B;  2F0M A;  5C0X I;  3DUZ A;  4U68 A;  2HVQ A;  3WOF A;  3RN5 A;  2N49 A;  4FO2 A;  1BNZ A;  4A75 A;  1DD2 A;  4DK3 C;  4C3I H;  2WAQ A;  5JH7 F;  2R93 B;  3MVV A;  3QO2 A;  3RR5 A;  3AMU A;  3H91 A;  5CV9 A;  1EYC A;  1O7L A;  5LHY 1;  3D4D A;  3GIM A;  4YCW A;  4K6L A;  2IT1 A;  2ENB A;  4I4T F;  3I70 A;  3PQI A;  4X62 H;  4N8X 1;  1SYD A;  1W3S A;  3ONA B;  4JI4 Q;  2UUB Q;  4DR1 Q;  1GJX A;  1AH9 A;  2MNA A;  4DV7 H;  5KFE A;  5IP7 H;  4QW8 A;  3KHL A;  3N40 P;  2YTX A;  4ECV A;  1GXD C;  2AMC B;  2ZM6 L;  4QCL A;  3OPO A;  2B2V C;  4L6T B;  3J7Z C;  1K1S A;  3JSL A;  2JA7 B;  5C6A A;  1N36 Q;  4MV7 A;  4EEY A;  2G9H D;  1Y1V G;  4A3M H;  5KFP A;  4J9O A;  1ZKO A;  1K28 A;  2QEX A;  4IPG A;  4PWQ A;  3ND8 A;  1IBL L;  5LMU H;  4LUO A;  5DQH A;  1Z47 A;  2UXD Q;  3S2H H;  1F2M A;  1VQ6 A;  3MTS A;  1RTN A;  1PA6 A;  4GOP C;  4A3G G;  3S2H B;  2D62 A;  4LFA Q;  3MFG A;  1U9R A;  2F0K A;  3TRZ A;  1TA8 A;  3KHG A;  5KFZ A;  2F0E A;  3QOJ A;  1GO3 E;  1UNN C;  3GTJ H;  1EZ6 A;  3TP8 A;  3OHX C;  4DR2 L;  4MNO A;  4OX9 L;  1RK5 A;  2A69 C;  4DR6 H;  4DR5 H;  3K0X A;  5JEA J;  1EWI A;  2G5D A;  3MXP A;  2JEF A;  1GSA A;  3GTG A;  1DOL A;  2NVY B;  1E1T A;  4GN5 A;  4ZK9 B;  4UHV A;  3VPB A;  2QYZ A;  4YCV A;  1CUK A;  4J9P A;  4DAM A;  4B3R Q;  4DUZ L;  2EPB A;  4KHP H;  1EY8 A;  1U4P A;  3E9I A;  3FDT A;  1D2B A;  1H9S B;  1KDB A;  2K5H A;  2NTS A;  3IFT A;  5J3B A;  2QDB A;  1ZHQ A;  2UVW A;  3W5O A;  1TXY A;  3SGI A;  3KK7 A;  4CDF C;  3N6X A;  4B3T Q;  4MTN A;  1Q1B A;  1L1O C;  2PQE A;  1MGS A;  2NN6 G;  3D6C A;  3S1N B;  2A8V A;  3DHQ A;  4C3H B;  2A68 C;  5I9O A;  3ETH A;  3R5F A;  3R93 A;  2V5A A;  4UPA A;  3NEL A;  3OIP A;  4KY5 A;  2R82 A;  2VR1 A;  5KFI A;  2W9B B;  4DNR B;  1MHW C;  1JJC B;  2B63 G;  3D31 A;  2E76 C;  3A8K E;  3LWB A;  3QR8 A;  4DFA A;  2DGY A;  3M4Q A;  3C1F A;  3FKI H;  3GTK A;  1U0L A;  4JOI C;  1XMO L;  3K3P A;  5JPM C;  5ELC A;  1QVG A;  4DL7 A;  1VQ9 A;  3GTM H;  1D5Z C;  1N34 H;  4IWX A;  4JI3 Q;  2JEG A;  4WJW A;  3SE7 A;  2E5L Q;  4DV0 H;  1Q8K A;  2HD3 A;  1TU2 B;  2F52 A;  2UXC L;  4V19 0;  1BBX C;  4JI8 H;  5DLQ E;  5GAE C;  2DUD A;  2MQH A;  2O4X A;  2VS1 A;  3M9O B;  1VQN A;  5IT9 W;  2UUC H;  2JEJ A;  4JV5 Q;  4NXM H;  4GNX C;  4IWY A;  2OQ0 A;  5L37 A;  4JI6 H;  2VQE Q;  3JAM W;  3BS1 A;  3GTG B;  3SK4 A;  4RB1 A;  4DN4 M;  3K7A B;  2WFW A;  2V58 A;  1A3V A;  4R4I A;  1QB5 D;  3TEH B;  4ED2 A;  2RDF A;  3K7A H;  3GTL A;  2A73 B;  4YR3 A;  5A2Q L;  1XWE A;  4IQZ A;  2VA2 A;  2KCN A;  4QUF A;  3ICE A;  2XN9 C;  2DJG C;  5H80 A;  5L1J A;  1K83 A;  5D65 A;  4YHH L;  2N55 A;  1TVX A;  1FKA H;  4ZKC B;  3I56 A;  1FJG Q;  2L55 A;  3H4B A;  2M00 A;  3BG3 A;  1JE5 A;  1CI3 M;  3AEV A;  4M9U A;  2LFN A;  5C44 B;  2ZXP A;  4Y7N B;  1IKL A;  3MWE A;  2SEB D;  1KNE A;  5C44 H;  3PGZ A;  5LL6 b;  1Y8N B;  5G3L F;  5FOB B;  4MA5 A;  3BDC A;  1ULZ A;  1VQI A;  4KD3 A;  4MV9 A;  4RGT A;  3MR6 A;  4IO9 A;  1RJP A;  3GTQ H;  5BN4 A;  3OWE B;  4X66 L;  4YB8 B;  4R8U A;  3K5I A;  1F9R A;  3T1H H;  4POF A;  1PTO B;  3TDQ A;  1BVS A;  4RHS A;  3ERS X;  4FXK C;  4I55 F;  1V51 A;  2IP4 A;  2FIN B;  4EEQ A;  2E2D C;  4O3S A;  2WKD A;  2K05 A;  4JUZ A;  2OT2 A;  1CE8 A;  4JI1 H;  1B9N A;  2CWP A;  5C3E B;  4O3N A;  1KAA A;  5K5P A;  3V05 A;  2VUG A;  1TWC B;  1O80 A;  5FLX c;  4X62 Q;  4DR1 L;  3Q1K A;  4JI5 H;  4JCV E;  2F0O A;  2IY5 B;  1X32 A;  2YZM A;  2YZN A;  1NNX A;  5IIF A;  4DV1 L;  1RK6 A;  3K7U C;  1EOT A;  4GKJ H;  3NK9 A;  3D4R A;  1A62 A;  3Q8P B;  1K3R A;  3WDN A;  1CKM A;  4BBR G;  1OXU A;  1RTO A;  4FU0 A;  4LFB H;  1VDZ A;  1O7Y A;  5K2M A;  3Q8R B;  2K5D A;  3LP8 A;  1Z2O X;  1KXL A;  3G6J B;  4LK1 C;  3E0J A;  4ZKB B;  1MBY A;  3CC2 A;  4B3M Q;  4DV1 Q;  2R92 G;  1NCV A;  3RMH A;  4RMF A;  2B2V A;  1SE4 A;  3FPP A;  2UU9 H;  1HQM C;  4XYO A;  3BYT B;  1S4Z A;  4U7C A;  2XRS D;  2UXD H;  4MV3 A;  2BH2 A;  4FS1 A;  5LL6 S;  4X65 H;  3UE0 A;  3M85 A;  3S2D B;  1J5E Q;  3GV3 A;  1F77 A;  1TS4 A;  5G3L D;  3S2D H;  1IBM L;  3A5Z B;  1K8M A;  4IR1 A;  3BZC A;  1B6S A;  4S3S A;  1V1P A;  3GII A;  3CME A;  1L2Z A;  3OW2 A;  3S24 A;  4AQY Q;  3G71 A;  1DIK A;  3K5H A;  4A93 G;  4M1U B;  4IAJ A;  3K58 A;  3NQT A;  5KFC A;  4TV8 F;  1SE2 A;  3KLS X;  1D5M C;  4RU9 A;  2GLT A;  4BY1 B;  2X0S A;  1CQF A;  2ALZ A;  2O5J C;  1Q90 A;  4HQ6 A;  5D8D A;  4EFE A;  5CV4 A;  4PMW A;  2F03 A;  4LMY A;  1A6X A;  3OYY A;  1E2V A;  1UC9 A;  5IGE A;  1CKN A;  2WAQ B;  1XPU A;  4DXF A;  1CA5 A;  1TR5 A;  1BOS A;  2BA1 A;  3PIO A;  3K59 A;  1IXR A;  1HR0 H;  1KNA A;  2K28 A;  2YRW A;  4OX9 H;  1H9K A;  4A3F G;  4DAY A;  2HQL A;  1I3Q A;  2G9D A;  3DEP A;  4FXG C;  2Z0S A;  5FK9 C;  4FS2 A;  4B3T H;  1S9F A;  2I46 A;  3QB3 A;  1QOH A;  3PF4 A;  3FPU B;  5DGB A;  1WTH A;  2YU9 A;  4L5T A;  4LF6 Q;  1TY2 A;  4ECU A;  2DY7 A;  2H5X A;  4OHJ A;  1HZ9 A;  3TZU A;  4DA2 A;  1XNR L;  1I4G A;  1FGB D;  3TBI B;  2CQA A;  1I4R A;  1M90 C;  2K04 A;  5CA1 F;  2C2E A;  3I2Z A;  5M9O A;  3KAJ A;  1EIF A;  2BOS A;  4DV3 Q;  1KIX A;  4B08 A;  4FBU A;  1K8G A;  4K0K L;  1UE7 A;  2VW9 A;  4DL6 A;  3KYH C;  4RB0 A;  2Y0S A;  2Z1C A;  5CMD A;  5C4X H;  1ET6 A;  4H13 C;  4JI3 H;  4EQO A;  2XSC A;  4A3C G;  1XPR A;  1VQE A;  4KD4 A;  4DV0 Q;  1ZXT A;  5IOC A;  2R7D A;  4G7Z C;  3GTG H;  3A7L A;  4AYB E;  1AZP A;  2BDO A;  2AUJ D;  2Z6K A;  1G6Z A;  2A19 A;  2OWO A;  1JQY D;  3KTM A;  4LF4 H;  3G6V A;  3TQY A;  1PFB A;  5IGC A;  4DV6 L;  4QIW A;  1QJO A;  1Y8O B;  2EJG C;  2VOB A;  4RKL A;  2ZTE A;  2VQE H;  3PW0 A;  3KAL A;  1F2Z A;  1NMG A;  1VQ8 A;  1XDN A;  1X3E A;  2C2R A;  3IRB A;  1LT6 D;  4XZ3 B;  4DR7 Q;  3J81 c;  3CRK C;  4Y7N H;  2I80 A;  5CYU A;  1G51 A;  3PUZ A;  4J9Q A;  5HGQ A;  2RGV A;  2F0L A;  5LMN W;  3DWQ A;  3SK6 A;  2N3S A;  1QIL A;  3EVQ A;  3CD6 A;  4J9N A;  1I6V C;  4ILW A;  1GGO A;  4QQB X;  4J9S A;  3MFI A;  3R3O A;  1T9H A;  1EZ8 A;  4ZUI A;  5EKK A;  1PK8 A;  2D5D A;  2GVB A;  1HNX Q;  2F0W A;  4YY3 Q;  1QE6 A;  3BZK A;  1JJ2 A;  4A4I A;  1JWM D;  4C3H G;  5T14 A;  2K33 A;  3D6W A;  4BY1 G;  1R4Q B;  2PQA B;  4O3R A;  1ROD A;  4CJ0 B;  4AYB G;  4A3E H;  1I4P A;  2PNR C;  3W3A A;  2LXJ A;  4X6A H;  5KFJ A;  1YJ9 A;  4IUT A;  5KFW A;  3H15 A;  4BY7 B;  2R7Z G;  4J6H A;  4MAM A;  2TSS A;  3HOU G;  3FDS A;  4L63 B;  1VQC A;  3PUY A;  4TQU S;  1SND A;  2KEN A;  4DR6 L;  2ES2 A;  2F0H A;  3F2U A;  1N8R C;  2FK3 A;  2YL2 A;  3SXH A;  1VQA A;  3FRP B;  1UUP A;  1XNR H;  1HTL D;  3BU2 A;  1S5B D;  3NBI A;  3M3Y H;  4C56 C;  3CXC A;  2R7Z A;  4Q5V A;  5IY0 A;  2W57 A;  2J0T D;  3ORR A;  2DY8 A;  5C5M A;  1OTC A;  5EKL A;  5T1I A;  4DK1 A;  3Q0A A;  2AQ1 B;  1PH4 A;  4ED1 A;  4K2L A;  1T5E A;  2DWC A;  1RJT A;  1SR3 A;  4K5V A;  5AJ3 Q;  3I4N G;  2R84 A;  1IW7 C;  1JDB B;  2RDJ A;  3GQC A;  1S10 A;  3VR6 A;  3J7Y W;  2EXD A;  3OSN A;  2QF7 A;  3UDX A;  4GLV B;  5CV6 A;  4O42 A;  4OXP A;  3F2D A;  3OUU A;  3NXW A;  4CC6 A;  1S5D D;  3RFC A;  4RZQ A;  2SDF A;  1I94 Q;  4JYA Q;  3I72 A;  3F1Z A;  2SCU B;  2JA5 H;  4DV4 H;  1JWU D;  1PLF A;  3Q23 A;  1H9M A;  3KBG A;  5C4J H;  4RNN A;  3HXL A;  4ZYS A;  1RHP A;  3HP3 A;  3H40 A;  1BQQ T;  4IJL A;  1WH2 A;  5IOD A;  3V6J A;  1F2Y A;  3E5N A;  3SHL A;  1S97 A;  1STN A;  3JSN A;  3RGX A;  2PBZ A;  1N33 Q;  4MV8 A;  1K8A C;  4J0M A;  2W6N A;  1A0I A;  2CCZ A;  1PH8 A;  4GKK L;  4ME6 A;  2VY3 A;  3HGB A;  3CCS A;  3CCV A;  2I07 B;  2C9O A;  3EJI A;  3T4A C;  1H95 A;  5KFO A;  1GHJ A;  1HXY D;  3J81 E;  4HAE A;  3A74 A;  3HOY B;  3HKZ A;  4ME5 A;  3U4Z A;  1A8V A;  3CHB D;  3V2T A;  2FK2 A;  3RAQ A;  1TWC A;  3HOY H;  1Y1W B;  4LFC H;  1V9P A;  3GTJ A;  5E7N A;  4AQY H;  4NDX A;  1PRT F;  5I2X A;  1Y1W H;  4HR7 B;  2F4V Q;  4OWW B;  3HOV H;  1N32 Q;  1WCM G;  2WDT A;  5CC4 A;  3GTQ A;  5KFX A;  1B44 D;  4TV9 F;  4YHH Q;  4JPB W;  1N48 A;  3H94 A;  3SVM A;  4O2B F;  3PVX A;  3VR4 A;  4JI2 L;  1TAE A;  1SNQ A;  2JXM B;  1DJR D;  2OXP A;  5FLM G;  1HR0 L;  1X65 A;  2EY6 A;  2DJF C;  1T36 A;  3VR2 A;  4CDE C;  1U5K A;  4CDD C;  3A55 A;  2IW3 A;  2E2H A;  3KLW A;  3VYS A;  2WTF A;  1E3P A;  5FLX L;  3HOY G;  1LTB D;  2SNS A;  5IGF A;  5IGG A;  4MN3 A;  2IX1 A;  2F0J A;  2FFK B;  2KCM A;  2JEA I;  2HDM A;  2F0I A;  1K0S A;  1GUO A;  1YI2 A;  4YR2 A;  5C4X B;  1J9O A;  2IL8 A;  1IBM Q;  4C3I G;  3TQ1 A;  4HIK A;  1TWF A;  2RDI A;  3D3R A;  3KOJ A;  4TRD A;  2R7Z H;  5F2D A;  1JOR A;  4DV3 H;  1EY0 A;  1LTR D;  2R7Z B;  2F0N A;  1I94 L;  4JYA L;  1SBB B;  1Z6H A;  5KT6 A;  2VUM H;  5BN5 A;  1ZYR C;  3PO3 H;  3I4N B;  4RWS C;  2R7M A;  2MUY A;  3JRX A;  5IGD A;  3WO0 A;  4XYQ A;  4DR2 H;  5C0X J;  2HVR A;  4R4T A;  1G6P A;  4LF7 L;  3G8C A;  1AUV A;  2J7Z A;  5JVD F;  1HUN A;  1K0R A;  2AHO B;  3F8T A;  1XTD A;  1HNX L;  3OSO A;  5KRU A;  4EBE A;  2KA7 A;  3CRL C;  4C1N K;  3SI8 A;  2FLN A;  1WR2 A;  1JR0 D;  1VF5 C;  4DUY Q;  2E2I A;  4FYD A;  1M8A A;  4MA0 A;  3A0J A;  1NAP A;  3I4O A;  4OIJ A;  1SJE D;  4F87 A;  2L5T A;  2ZM6 Q;  3RUP A;  3ZJY C;  1EWH A;  2NZ1 D;  3N43 B;  3SK8 A;  1BO0 A;  5KIX A;  5ELE A;  5I47 A;  3HKZ E;  3NSW A;  1LT3 D;  2CHB D;  2R92 B;  2R6F A;  3U9T A;  2Q2T A;  1B6R A;  1M0W A;  4ECS A;  3AYH B;  3HKZ B;  1IBL Q;  2R92 H;  1O7Z A;  4BXX G;  3H6M A;  1JMC A;  5HUR A;  3WO1 A;  2WV6 D;  4F4X A;  4DXG A;  4LF9 Q;  5COR A;  3E3X A;  3GIQ A;  4A3E B;  3L4K A;  1U4R A;  5GAG C;  1TT2 A;  5KNB A;  4PZ6 A;  5I6Y A;  3CPF A;  5BPF A;  4NXN H;  1HR0 W;  3H20 A;  1GLV A;  4EFB A;  2OQK A;  3QWN A;  5KFT A;  5DG7 A;  1Q7Y C;  3EBE A;  5C4X G;  2UVU A;  1S0N A;  3BQ0 A;  1PTO C;  4A3M B;  3KF6 A;  4DR4 H;  1N36 H;  2F0F A;  1TWG A;  1GD7 A;  1TKW B;  3GTO B;  3T51 B;  4LF5 Q;  1LTS D;  1PRT D;  2NU9 B;  2CKZ B;  2X6G A;  4A3G B;  1PH7 A;  2VA3 A;  1M7J A;  1WJJ A;  2B3G A;  5DLF A;  2Z4I A;  4PNY A;  2IBK A;  1Q1E A;  1PV4 A;  4X3K A;  4LFA H;  4DV6 Q;  2Z6K C;  5DQI A;  1GUN A;  2FKL A;  3F2C A;  1SYB A;  1SSO A;  5COY A;  4LF7 H;  4A3F B;  3E6Z X;  4WOR A;  1XNQ L;  5KFQ A;  3CQZ H;  5KG2 A;  3ULJ A;  5LA6 F;  4IFD J;  4DR5 Q;  1AN7 A;  2JA5 A;  4NXN L;  2NVT H;  3V6H A;  3O13 A;  1PYS B;  1X9N A;  2EE1 A;  5FLX E;  2B2W C;  1IKM A;  1EYD A;  1C7Y A;  4A76 A;  1SMX A;  4UP9 A;  4DV5 Q;  1ET9 A;  3GP7 A;  1B50 A;  5KG7 A;  2J6U A;  3L3O C;  4A3I B;  1KD1 C;  4V0B A;  4FM9 A;  2C35 B;  4K5W A;  1SFO H;  4HID A;  3GV7 B;  1VQH A;  1XX8 A;  4KKU A;  5CV8 A;  1SEB D;  3BDL A;  2NUA B;  4GZY C;  2UXC Q;  2QK4 A;  4A3L H;  4TVA B;  2YS6 A;  3QJY A;  1JE4 A;  1TS3 A;  3NWS A;  4JI4 H;  3LGJ A;  3UDG A;  1EYG A;  1D8L A;  5GQO A;  3RBE A;  4P73 A;  1BGW A;  3WOE A;  4B3S H;  3DM3 A;  4UCT A;  4ECT A;  3MWD A;  2LMC B;  2HT1 A;  1S03 G;  3OUZ A;  3KF6 B;  4JI7 Q;  3FKI B;  2B29 A;  5AJ3 L;  1PX2 A;  2KQ3 A;  1KC7 A;  2J6S A;  2F4V H;  4BY7 G;  2NWG A;  5C3X A;  3W1B A;  2Z8L A;  1IOV A;  3P1H A;  4Q45 A;  5KYI A;  1B3Q A;  1ILQ A;  2CH4 A;  1EQV A;  1HA5 A;  1SN8 A;  1TWH B;  4ZAI A;  1S40 A;  5EZY F;  3BDO A;  2FJZ A;  1NSN S;  1X3Q A;  2FMA A;  1TWH H;  1VQ7 A;  3RJ0 A;  2E5L H;  2ICE C;  2RHQ B;  3S9W A;  4BBS H;  4AH6 A;  4HMJ A;  1JB3 A;  3RD4 A;  2EYF A;  4LF8 Q;  5EPK A;  2EYM A;  1AE3 A;  1K73 C;  2KEC A;  2XIW A;  3MZ5 A;  2MGS A;  2ZT9 C;  4TUY F;  3M4P A;  3CF5 A;  1VQP A;  3G6Y A;  3NEN A;  5M5Y H;  1IBK Q;  5FO9 B;  4HIO A;  2UUA Q;  2ZDG A;  1M1K C;  2I5L X;  1S5E D;  1LTL A;  1CTM A;  1EEI D;  2A6H C;  1D1K A;  2A5H A;  4MHE A;  4F88 A;  3I4M H;  2B2T A;  3QG1 A;  1CK1 A;  3T5H A;  2EYP A;  1QUQ A;  1E4F T;  4RAY A;  4O1N A;  2F3W A;  4KHP Q;  4KKS A;  2UVV A;  3GQB A;  4C2M H;  5DEH A;  3TII A;  2EYH A;  2MFI A;  4IPD A;  4BBR B;  3CCU A;  2NU8 B;  2IX3 A;  4YBZ B;  3G6X A;  4DKA C;  2WE6 A;  5KFK A;  1JDE A;  2K01 A;  2D9U A;  4KY6 A;  5I2Y A;  4MV6 A;  4JV1 A;  2Z9H A;  3I7F A;  3NUC A;  4GN4 B;  4FNF A;  4PG3 A;  4GOP B;  2TMP A;  1KTK A;  2FXQ A;  2WB1 B;  4CKE A;  4C3I B;  4MTK A;  1XMQ H;  2JA7 G;  4OO1 H;  1HUM A;  5EBC A;  3L9A X;  5IE8 A;  1S72 A;  4MV4 A;  3Q8Q B;  4C3J G;  4LH6 A;  3DM1 A;  4NP5 A;  1TS5 A;  4KHZ A;  5D1P A;  5J39 A;  2JE6 I;  4EBC A;  2A69 D;  1C8C A;  2R61 A;  1N34 Q;  2E2H H;  1HNZ Q;  2ZM6 H;  2CW7 A;  4H02 A;  2ASJ A;  2ASB A;  1N56 A;  1TWA A;  3RAX A;  1H9J A;  4PQX A;  3ULL A;  5C3E H;  3J7A F;  4IUP A;  4KN4 C;  4X66 Q;  5FPO A;  2UUC L;  2F3V A;  1EY5 A;  5GRO A;  3H3V C;  1B2T A;  1SE3 A;  2JA7 H;  1VMC A;  4JV5 H;  1BUV T;  4HTH A;  4NXM Q;  2DPJ A;  2L0C A;  3PZP A;  5IYC G;  3TS0 A;  1W2B A;  4X65 L;  3R2I A;  3GTL H;  2V4R A;  4JW0 A;  2CH4 W;  1BR9 A;  5KFL A;  4LSX A;  3BYY B;  3GTL B;  1QCB D;  2B8F A;  4YP3 A;  2FJ2 A;  3DXJ C;  1YEZ A;  4QL5 A;  4ECX A;  5HV6 A;  4HIM A;  2B2Y A;  4ZHQ F;  2FP4 B;  1FL0 A;  3OIQ A;  3LML A;  5LOV F;  1A15 A;  2K5V A;  2RDH A;  4E6I A;  5BN3 A;  4A3K H;  3GTO A;  4NKL A;  2PMZ E;  2E2J H;  4LFB L;  4K8J A;  5E1F A;  4A3K B;  3GTJ B;  1RJQ A;  1EY7 A;  3LNN A;  1PTO D;  2W6Q A;  2E2J B;  4H44 C;  4DV1 H;  3S1R H;  1SXT A;  4OO1 G;  2EVB A;  1IBK L;  3ND9 A;  4JG2 A;  4A3F H;  1VQK A;  2CZG A;  2NVY A;  4EGJ A;  3UDI A;  3S1R B;  2YTY A;  2NZO A;  2WAQ G;  5EQ0 A;  2EQS A;  2O5I C;  4ECR A;  2NUC A;  4BBS G;  2CWA A;  4DK6 C;  4NB3 A;  1WYD A;  2VUM A;  1JIH A;  1VBH A;  3MEH A;  4LF8 L;  3HOZ G;  2EY2 A;  3HRZ C;  4MV1 A;  4RGN A;  4YJ3 F;  3PCO B;  1YHB A;  4JV5 L;  5KG3 A;  3I90 A;  2JA8 G;  3Q6S A;  4C5C A;  2VB3 X;  5ELF A;  3HKS A;  4X3S A;  1DOK A;  2ICI A;  3K5O A;  4DAP A;  3PO3 G;  5A2Q W;  3KHH A;  3FKI G;  1WTX A;  2EJF C;  1BBU A;  3K0Y A;  2R92 A;  3RB6 A;  5KGU A;  4EQP A;  1SNO A;  4BY1 H;  3M7N A;  4B3R L;  2CQY A;  2VQD A;  3C0F B;  1VCI A;  4LW1 A;  3BAB A;  1B33 N;  3X3M A;  1M0T A;  1W6J A;  4YWK A;  3DWP A;  3OW7 A;  5KFV A;  3MR3 A;  1CFM A;  3HB9 A;  3GIK A;  3Q8D A;  2F4I A;  3CVZ A;  5C1P A;  3OOC A;  2K5N A;  4K8I A;  4ED3 A;  4RCO A;  5D3D A;  1HZC A;  3NEM A;  5J2U F;  4JC0 A;  4RG1 A;  2UXC H;  1TY0 A;  3P75 A;  3M4O H;  4OX9 Q;  1O7I A;  1Q86 C;  3MEF A;  2HIV A;  3A8I E;  4JI2 H;  1JX4 A;  1VQ4 A;  1PH9 A;  2MO1 A;  1S5F D;  4A3L G;  2JA8 B;  2BH8 A;  4DGZ A;  4ALP A;  3T1Y Q;  5AFW A;  2NBF A;  1QUQ B;  4KMU C;  3MXN B;  1V8Q A;  3KF8 B;  4CBV A;  4MTE A;  3PIO 3;  1SYF A;  1FGU A;  4H7B A;  4LUZ A;  4FF3 A;  2XGP A;  2D0O A;  3H0G H;  4DV5 L;  4DUZ Q;  4BBS B;  2Y0S B;  1HJP A;  2YYZ A;  1SLJ A;  1VKZ A;  3MFY A;  3HG9 A;  1HRJ A;  1STB A;  3G6E A;  1HH2 P;  3MHB A;  2E2I H;  3DEO A;  5D3I B;  1QZG A;  1PHJ A;  1K3B C;  2A74 C;  4K0K H;  3EQL C;  4FF2 A;  2JN4 A;  4MIU A;  1MI2 A;  4TQR A;  2QA4 A;  1ZHS A;  3P20 A;  3VA5 A;  3BVM A;  4X3U A;  2C28 A;  2R8G A;  1LUZ A;  1J5E H;  4R1J A;  3QIA A;  3FHW A;  1NJI C;  1S0M A;  1AN8 A;  3J80 W;  2K32 A;  3N44 B;  1IYU A;  1QG7 A;  1Z7T A;  2AQ4 A;  4IFD H;  4UAI A;  1K9M C;  4PMB A;  4R4Q A;  4RNM A;  4N9T A;  1YHQ A;  4X64 H;  3FMC A;  2ATL A;  1IBK H;  5E3F A;  2IHF A;  4EQ5 A;  1MD2 D;  2UUA H;  1EEF D;  4YWL A;  5LMN Q;  3OTO H;  2XCP A;  4UDU C;  4FF4 A;  5EPL A;  4DV2 Q;  5M3F B;  1ICF B;  4WD3 A;  4ZLT F;  1WOC A;  1HCZ A;  2M9V A;  4ED8 A;  5FO8 B;  4J8Q A;  1C0A A;  1PMR A;  1WCM B;  2IJ0 A;  5IYB G;  1ILP A;  1AZQ A;  3BQ2 A;  1PH2 A;  4U6P A;  2PVP A;  4DK0 A;  2F0S A;  1WCM H;  1PFS A;  1C30 A;  2W70 A;  4WBN F;  5D1O A;  1KLU D;  3GTQ B;  1TWG B;  4OEM B;  5C44 G;  2WAC A;  3JAM i;  1EY4 A;  4QIW B;  4UP7 A;  2W6O A;  4WJ3 M;  2W6Z A;  1I50 A;  3LWE A;  1UC8 A;  5IT9 L;  5C0X H;  4IRC A;  2I87 A;  2PZT A;  1IZ6 A;  4CC5 A;  2EOT A;  4M8A A;  1XXG A;  1YVC A;  5A35 A;  5BMV F;  5CR3 A;  1B9M A;  2EYJ A;  3HKZ G;  3I8Z A;  4ECZ A;  1PH5 A;  2HHH Q;  5KG5 A;  3RLF A;  2E2H B;  2ZJR A;  3S14 H;  5LP6 F;  4P2C B;  1JXL A;  1II3 A;  1EIH A;  1A9X A;  3K5L A;  4Q8E A;  1MSG A;  2JSO A;  5CV7 A;  5HBR B;  3CQZ A;  4O0A A;  2KBN A;  3QFF A;  4HR7 A;  2EDG A;  3ERO A;  1G2T A;  4JI0 Q;  2R8J A;  4ZUJ A;  3KDF B;  4J15 A;  2OTL A;  2C22 A;  1GOZ A;  2ZJQ A;  4EYH B;  4G3I A;  5CBE E;  2F0Q A;  1IW7 D;  4IJH A;  5M3M B;  5JQW A;  3GTP H;  2K1B A;  1GSH A;  1SYG A;  3GTP B;  4HJA A;  2YW2 A;  1SMY D;  3PUX A;  1ZYR D;  3VR5 A;  2EZV A;  1HNW H;  2IWH A;  4O3Q A;  4ETS A;  5C8Y F;  1EUD B;  1MJE A;  1B04 A;  5F9N A;  5GAH C;  1LLR D;  3FEW X;  2YRX A;  2XCA A;  3HOX H;  3HOX G;  5JOB A;  4KTA A;  5CV5 A;  1I94 H;  4JYA H;  1E4E A;  5ELN A;  4AQY L;  3CCR A;  1PDQ A;  2I0Q A;  2C2D A;  1I7N A;  1T5X D;  4AYB B;  4XT3 B;  5FKA C;  5L9X A;  4RZR A;  1Y14 B;  3BG5 A;  1TII D;  4HYK A;  2Z4H A;  4GLA C;  1J8I A;  4NW2 A;  3B6Y A;  3K8A A;  1OWT A;  4NXM L;  3UDF A;  2WIN B;  1N33 H;  5HGT A;  1XNQ Q;  2OH2 A;  2KHI A;  4JOI A;  2F0D A;  2FLP A;  1YJW A;  4JVZ A;  4KK7 A;  5JJK A;  1C9O A;  3MJF A;  1BXR A;  1DYQ A;  3KJO A;  2R85 A;  4KV6 A;  1EUC B;  1F9Q A;  2F0V A;  3K57 A;  1PVO A;  1FNW A;  3AB9 A;  5H1S E;  3HOW B;  1Y1V H;  3SDZ A;  2HDL A;  4IZO A;  3H4D A;  4HNT A;  1Y1V B;  5KG6 A;  2AGO A;  1T94 A;  1N32 L;  1T3N A;  1F9S A;  3U58 A;  4XYM B;  2OTJ A;  5KG4 A;  5ELD A;  4YWM A;  4IRK A;  3HOV G;  2YTV A;  1KHI A;  3J81 W;  2PO4 A;  3LWU A;  1BCP C;  3MWY W;  1G91 A;  4ECW A;  4E4T A;  1PRT B;  4RAU C;  4A3B G;  2RF4 A;  4RB2 C;  2MCT A;  1X6O A;  4GKK Q;  2B2T C;  2A6E C;  2UUC Q;  3L0O A;  2BQU A;  3A5U A;  2PNH A;  4DR3 L;  4BS9 A;  1N33 L;  2R6G A;  3A56 A;  3NPP A;  1VMP A;  1EFW A;  3U9O A;  3RN2 A;  2K5Q A;  5KFY A;  4JI6 Q;  1KRT A;  5IYB H;  2NVX A;  4IUQ A;  2WB1 A;  1WCM A;  1SAP A;  2JA6 A;  4DV7 L;  4X62 L;  4XQQ A;  1CHQ D;  3BVZ A;  1LT5 D;  4HNU A;  4MTD A;  1P16 A;  4DR3 Q;  2VXW A;  2RHS B;  3RV3 A;  4ECY A;  2R7K A;  1GYF A;  3OMG A;  2RBM A;  1XJV A;  4NMZ A;  2GN5 A;  3JRW A;  4JBM A;  1XMO H;  3C1E A;  2CFM A;  2EY1 A;  5FPR A;  1WTV A;  3M9N B;  2NN6 I;  2Q2I A;  5EWE A;  1FR3 A;  1OXT A;  1TS2 A;  1BKB A;  2R93 G;  5KFU A;  4QJF A;  5M3F H;  1TWA H;  3TIG A;  1YHA A;  2N78 A;  4G7O C;  2B63 H;  3RV4 A;  2Z6B A;  2VQF H;  2QGQ A;  3GLK A;  1JOO A;  5E4X A;  2KED A;  2B63 B;  5EGT A;  4UY8 C;  1YIT A;  2NTT A;  3BQ1 A;  3M4Y A;  3QOL A;  2AWO A;  4YHH H;  4I65 A;  3KDF A;  1IYJ B;  1I50 B;  1GUW A;  1KJ9 A;  1DZ1 A;  3NHH A;  3K3V A;  1ZET A;  2BCO A;  3MAQ A;  5IWA L;  5IGB A;  4X3T A;  4FF1 A;  3IG0 A;  3EN2 A;  5K36 H;  3T53 B;  4A93 B;  4I7H A;  2DNE A;  2H4O A;  3D4W A;  4JI8 Q;  3EA6 A;  4GNX B;  3S14 B;  3I73 A;  1E4G T;  3MWM A;  4IR9 A;  1PYB A;  1V4Y A;  1EU3 A;  1Y8P B;  3I4M G;  1E24 A;  5IT9 E;  4DR4 L;  3EIV A;  4CJ2 C;  4KHV A;  4JI5 Q;  3DWA A;  5EDW A;  1KLG D;  1TWF H;  2DN8 A;  2BQ3 A;  1VS0 A;  4RHR A;  4Z9C B;  4DV4 L;  2XGQ A;  5C4Z A;  1B4O A;  1EL0 A;  1E22 A;  2NYZ D;  2KOL A;  3HOU H;  3S16 B;  2C00 A;  4DL4 A;  4HJ5 A;  2XGT A;  2XTI A;  4PV1 C;  4GS3 A;  3CAM A;  4CJ1 B;  4LFB Q;  4UCU A;  4P71 A;  3OSP A;  2R93 A;  1H9R A;  5IP9 H;  3ULP A;  1CSP A;  3N8D A;  5EAY A;  2IPK D;  2RVL A;  5FJ8 G;  1PH1 A;  3EFX D;  2UU9 Q;  2HQE A;  2WB1 E;  1AE2 A;  4OL7 A;  2L11 A;  2M2L A;  3C3L A;  4YCU A;  1JOK A;  4X65 Q;  2LXK A;  3OMC A;  4EBD A;  1SYE A;  4ZRZ A;  4YR0 A;  3BZD B;  4EX5 A;  3PW5 A;  2BE5 C;  3PW7 A;  4XIG S;  5C3E G;  4JBW A;  4UCS A;  4DUY H;  2R93 H;  4YIJ A;  3R8B A;  3E9H A;  3BJY A;  1RCV D;  1GHK A;  2W7P A;  2CW0 C;  2R8K A;  4GKJ L;  2AGQ A;  5L1I A;  2Q8T A;  2RDG A;  3HEJ A;  4DV3 L;  2W8K A;  1ML0 D;  1CHP D;  2DZD A;  4ABN A;  2AKW B;  3STB C;  4DV5 H;  4O3P A;  5KFR A;  5I9P A;  2BQR A;  1YNJ D;  5FD6 A;  2XC9 A;  4HSV A;  5FLM H;  2XNA C;  2FHT A;  1ASZ A;  5EBD A;  3I91 A;  3CCL A;  1X3G A;  2QIL A;  3U9S A;  2VNU D;  3RB3 A;  2VB2 X;  3I12 A;  5EJW A;  1W96 A;  2BE5 D;  5LL6 X;  2NU6 B;  3TSS A;  2UUB L;  3NWT A;  2UXD L;  4NPS A;  1N34 L;  1LTA D;  1PYW D;  3U50 C;  1Y1W G;  5DG9 A;  4OWT B;  4L8J A;  3J7A V;  5LYJ F;  1EYA A;  3NTI A;  4XXE A;  5LMN L;  4A3C H;  1DCZ A;  1I7L A;  3GTM A;  4ECQ A;  4J9L A;  5IP7 G;  2XWJ B;  4A3J B;  4LF6 H;  3CC4 A;  3PIP A;  4A3J H;  4GNX A;  2WKC A;  5ISR A;  2AU0 A;  3D0F A;  3HZX A;  2K7V A;  3N52 A;  1DV2 A;  1HTP A;  4Y8V B;  1KBL A;  4JI7 H;  1KAB A;  1PRT C;  4FP5 D;  4ED0 A;  1L0Y B;  4HJ9 A;  3G4S A;  1RJR A;  5A2Q E;  2VPS A;  5J2T F;  1OXS C;  2NVQ B;  4HSP A;  2F0P A;  3H3V H;  3S1M B;  4IFD I;  5ELO A;  1FJG L;  2UUA L;  2VZA A;  1E4E B;  1Y69 U;  3S1M H;  3QZ7 A;  1QVC A;  1IHZ A;  1JCK B;  4OWX B;  3S15 B;  4DV6 H;  4QIW E;  1CQJ B;  4XQN A;  2HJW A;  4OIK A;  4O3O A;  4GKK H;  3PO2 G;  2YYA A;  5CGK A;  2FPG B;  1LM0 A;  3L2P A;  4PMC A;  1K8O A;  3H0G G;  2VUM B;  5KFD A;  5KFH A;  4P75 A;  1KJJ A;  2J6T A;  1K83 H; 
#chains in the Genus database with same CATH homology
 1V1Q A;  1PH6 A;  2H5X A;  4LFC Q;  4OON A;  1HZ9 A;  4DUY L;  4HIM A;  3RNU A;  1FL0 A;  2PQA A;  2K75 A;  1J5E L;  1XNR L;  3WWV A;  1J6Q A;  5JEA G;  1M90 C;  4A3K H;  2K5V A;  3I2Z A;  2E8G A;  1EIF A;  2PMZ E;  4O2D A;  4DV3 Q;  1KIX A;  4BY7 H;  2E2J H;  1BBW A;  1K8G A;  4LFB L;  4K0K L;  1UE7 A;  2VW9 A;  2ZJP A;  3KYH C;  1UEB A;  5LMU Q;  1E1O A;  2I5H A;  2ID0 A;  4JI7 L;  5C4X H;  1I3Q H;  3S1R H;  1GM5 A;  3HOW H;  2YV5 A;  4A3C G;  1B8A A;  1IBK L;  4JG2 A;  4A3F H;  1VQE A;  1XPR A;  4DV0 Q;  1VQK A;  4JBJ A;  3RLN A;  3UDI A;  2R7D A;  2JA9 A;  2NZO A;  2WAQ G;  2EQS A;  2VL6 A;  2YTY A;  3GTG H;  1Z9F A;  4AYB E;  4BBS G;  2CWA A;  2ATW A;  4DK6 C;  4NB3 A;  1WYD A;  2Z6K A;  2A19 A;  2OWO A;  4R4O A;  4L5S A;  4LF8 L;  3HOZ G;  3CW2 C;  3S17 H;  3TQY A;  4B3S Q;  3PCO B;  1SRU A;  1YHB A;  4QY7 A;  4DV6 L;  4HJ8 A;  2IX0 A;  1VQO A;  4PZ8 A;  4A3D H;  4JV5 L;  2JA8 G;  2WAQ E;  3GTO H;  2VQF Q;  5M3F G;  2ZTE A;  1WFQ A;  1B70 B;  1GKH A;  3HKS A;  4DV7 Q;  1IL2 A;  3PO3 G;  3M9B A;  1NMG A;  1VQ8 A;  1X3E A;  3IRB A;  4A3G H;  3FKI G;  3PUV A;  1VQB A;  1X56 A;  4IPC A;  1BBU A;  3RZD H;  3CMA A;  4BY1 H;  3M7N A;  3JC6 6;  4L5Q A;  4JI1 L;  5M3M G;  5IYC H;  4Y7N H;  1VCI A;  1G51 A;  4LW1 A;  3J81 c;  4B3R L;  3PUZ A;  5HGQ A;  5BR8 Q;  3DLL A;  4JI0 L;  3J7A 5;  1NMF A;  4YWK A;  1HNZ L;  5LMN W;  1RL2 A;  2N3S A;  3Q8D A;  3CD6 A;  4APV A;  2K5N A;  4A3M G;  2Y0S E;  4QQB X;  2V1C C;  4JI4 L;  1ASY A;  3GO5 A;  3KJP A;  1VQG A;  1HZC A;  3NEM A;  4JC0 A;  1T9H A;  5IYD G;  4RG1 A;  4DV0 L;  3S16 H;  2GVB A;  1HNX Q;  3M4O H;  4OX9 Q;  1O7I A;  1V43 A;  4YY3 Q;  1Q86 C;  3BZK A;  3K81 C;  3MEF A;  4IPH A;  4JI8 L;  1JJ2 A;  2HIV A;  4R4C A;  1VQ4 A;  4A4I A;  1JB7 A;  1PH9 A;  2MO1 A;  2Y0S G;  5JJI A;  3RLO A;  3F2B A;  3ER0 A;  3STB D;  3T1H L;  2BH8 A;  1YJN A;  4A3L G;  4BY1 G;  4ALP A;  3T1Y Q;  3I55 A;  2PQA B;  2JQO A;  1QUQ B;  4WJ4 A;  2JJQ A;  3MXN B;  3KF8 B;  4DR5 L;  2R7F A;  4AYB G;  4A3E H;  1FGU A;  4LUZ A;  1X3F A;  2LXJ A;  4L5R C;  2D0O A;  3H0G H;  4DV5 L;  4A3J G;  4DUZ Q;  1YJ9 A;  3H15 A;  1HJP A;  2YYZ A;  1SLJ A;  4BA1 I;  2R7Z G;  3S1N H;  1HZB A;  1KQS A;  2HIX A;  3CCM A;  2MO0 A;  2UU9 L;  4DV4 Q;  3HOU G;  3G6E A;  2AWN A;  1HH2 P;  3H3V I;  1UE6 A;  4DAY B;  1VQM A;  2E2I H;  1VQC A;  3PUY A;  1Q12 A;  4TQU S;  1QZG A;  1PHJ A;  2KEN A;  4DR6 L;  2ES2 A;  1NBW A;  1N8R C;  1SE8 A;  1UE1 A;  2K14 A;  2QA4 A;  1VQA A;  3J81 i;  4LF6 L;  1VQJ A;  2D0P A;  1LUZ A;  4LF5 L;  3PV0 A;  4R1J A;  3BU2 A;  1EUJ A;  3S1Q H;  3TRE A;  3AQQ A;  3FHW A;  1NJI C;  3M3Y H;  3CXC A;  3HOW G;  5FJ8 H;  5JJL A;  4X64 L;  5IY0 A;  4A3I H;  1OTC A;  2K50 A;  1PH4 A;  3OTO L;  4OO1 I;  2K4K A;  1K9M C;  5BR8 L;  1KL9 A;  1SR3 A;  4R4Q A;  5AJ3 Q;  3I4N G;  1YHQ A;  1Q46 A;  3J80 c;  2L15 A;  3CCE A;  2IHF A;  4EQ5 A;  2EXD A;  2JEB I;  1VQL A;  3UDX A;  4GLV B;  5IWA Q;  4OXP A;  4YWL A;  3F2D A;  5LMN Q;  4A3D G;  1KC8 C;  1EOV A;  4DV2 Q;  1QZH A;  1I94 Q;  4JYA Q;  1WOC A;  1VQ5 A;  2KHJ A;  3F1Z A;  2EIF A;  2JA5 H;  2N8N A;  1C0A A;  5IYB G;  4DR4 Q;  4PZ7 A;  1PH2 A;  5C4J H;  1RIP A;  1WCM H;  1PFS A;  2JA6 H;  4IJL A;  2A1A A;  4IOC A;  5C44 G;  1CKO A;  1CSQ A;  4UP7 A;  3JAM i;  3GTK H;  1L1O B;  1LYL A;  1NTG A;  4WJ3 M;  2LSS A;  1N33 Q;  4LF9 L;  1K8A C;  4DR2 Q;  2Q2U A;  1IZ6 A;  1A0I A;  4IOA A;  2CCZ A;  1PH8 A;  1XMQ L;  4B3T L;  4GKK L;  1I6H H;  2VY3 A;  3AFQ A;  1YVC A;  3CCS A;  3CCV A;  1JJG A;  2JK8 A;  2Q2H A;  3HKZ G;  1N9W A;  1H95 A;  5K36 G;  1PH5 A;  2HHH Q;  2JA8 H;  4DR6 Q;  3A74 A;  1MIU A;  3RLF A;  4DNI A;  4X64 Q;  2ZJR A;  3S14 H;  3U4Z A;  1A8V A;  4QGU A;  2RCN A;  2VUM G;  3HOY H;  1V9P A;  3W1G A;  4YY3 L;  3T1H Q;  4B3S L;  2NVQ H;  4BBR H;  5E7N A;  1L1O A;  1Y1W H;  3UE1 A;  2F4V Q;  4OWW B;  3HOV H;  1EQR A;  1MKH A;  1WCM G;  1N32 Q;  2NVY H;  4LFC L;  5C0X I;  2GVA A;  2ALY B;  2K52 A;  4KHP L;  4YHH Q;  3S15 H;  3RN5 A;  4JI2 L;  4O0A A;  2KBN A;  2N49 A;  4P75 A;  4A75 A;  1Q82 C;  4DK3 C;  4C3I H;  4JI6 L;  4JI0 Q;  3RR5 A;  3KDF B;  5FLM G;  1HR0 L;  1X65 A;  4J15 A;  2OTL A;  2OCE A;  2ZJQ A;  1U5K A;  4YCW A;  2IT1 A;  4IJH A;  3KLW A;  3GTP H;  1E3P A;  3HOY G;  2IX1 A;  1W3S A;  4JI4 Q;  4HJA A;  2UUB Q;  2KCM A;  2JEA I;  3PUX A;  4DR1 Q;  1YI2 A;  4C3H H;  1X54 A;  1AH9 A;  2MNA A;  2UXB Q;  4KI0 A;  4A3I G;  1MJE A;  1IBM Q;  5IP7 H;  3HFZ B;  2YTX A;  5GAH C;  2AMC B;  2ZM6 L;  3HOX H;  4HIK A;  3OTO Q;  3J7Z C;  3HOX G;  1N36 Q;  3KOJ A;  3HOZ H;  5ELN A;  4AQY L;  2R7Z H;  1Y1V G;  3CCR A;  4A3M H;  1B7Y B;  2I0Q A;  2UXB L;  2QEX A;  4IPG A;  4DR7 Q;  1IBL L;  1GVP A;  4LUO A;  1Z47 A;  1I94 L;  4DR7 L;  4JYA L;  1Y14 B;  2UXD Q;  2VUM H;  3S2H H;  3L7Z C;  2PI2 E;  1VQ6 A;  4GLA C;  1UWV A;  3VDY A;  1PA6 A;  1I5F A;  3B6Y A;  5LMU L;  4GOP C;  3K8A A;  4LF4 L;  3PO3 H;  4A3G G;  1VQD A;  5M5X H;  2D62 A;  3UDF A;  4NXM L;  4LFA Q;  1XNQ Q;  2KHI A;  4JOI A;  5C0X J;  3TRZ A;  1YJW A;  4R4T A;  5JJK A;  4JI2 Q;  1G6P A;  4LF7 L;  1C9O A;  1UE5 A;  1P8L A;  3KJO A;  1GO3 E;  3GTJ H;  1L2F A;  4JBK A;  4OX9 L;  1K0R A;  2AHO B;  3F8T A;  1XTD A;  4MNO A;  5C0X G;  4DR2 L;  1HNX L;  1PVO A;  3K0X A;  5H1S E;  4NXN Q;  4GKJ Q;  5JEA J;  1FVI A;  1EWI A;  4DUY Q;  5HY6 A;  1Y1V H;  3A0J A;  3I4O A;  5IYD H;  1E1T A;  2JA5 G;  4GN5 A;  4JI3 L;  4YCV A;  2ZM6 Q;  1N32 L;  3ZJY C;  1EIY B;  3U58 A;  2OTJ A;  1CUK A;  4YWM A;  4DAM A;  1NE3 A;  4B3R Q;  4K0K Q;  3HOV G;  4DUZ L;  3HKZ E;  2HHH L;  2YTV A;  3E9I A;  1DGS A;  1KHI A;  2Q2T A;  1KAW A;  2K5H A;  1Q81 C;  3AYH B;  5J3B A;  1IBL Q;  2R92 H;  5M3M H;  4BXX G;  1JMC A;  3FP9 A;  4A3B G;  3W5O A;  1TXY A;  3SGI A;  4LF9 Q;  4KLK A;  2RF4 A;  2F4V L;  4A3B H;  1X6O A;  4B3T Q;  4MTN A;  1Q1B A;  2UUC Q;  3L0O A;  5GAG C;  3A5U A;  1L1O C;  2PNH A;  4DR3 L;  2NN6 G;  3E0E A;  2R6G A;  4PZ6 A;  1N33 L;  2A8V A;  1EFW A;  4LWC A;  3CPF A;  3RN2 A;  4UPA A;  1HR0 W;  3NEL A;  4JI6 Q;  1KRT A;  3KFU A;  4P72 A;  5IYB H;  1JJC B;  2OQK A;  2B63 G;  3D31 A;  1Q7Y C;  4B3M L;  3EBE A;  5C4X G;  4DV7 L;  2JA6 G;  4BA2 I;  2DGY A;  4X62 L;  3M4Q A;  3PF5 A;  2YU9 H;  3FKI H;  1S3O A;  3NBH B;  1P16 A;  3KF6 A;  1U0L A;  2RHS B;  4JOI C;  4DR3 Q;  1XMO L;  1QVG A;  4JI1 Q;  1VQ9 A;  3GTM H;  1GD7 A;  2F3I A;  4JI3 Q;  1XJV A;  1X55 A;  2GN5 A;  2E5L Q;  4LF5 Q;  4JBM A;  1Q8K A;  2UXC L;  2F52 A;  1QVF A;  2CKZ B;  1EQQ A;  2CFM A;  5DLQ E;  5GAE C;  2NN6 I;  2Q2I A;  2DUD A;  2MQH A;  1PH7 A;  1WJJ A;  1OXT A;  2B3G A;  2VS1 A;  1VQN A;  1TWC H;  1BKB A;  2R93 G;  2KCT A;  1Q1E A;  1PV4 A;  4QJF A;  5M3F H;  2CQO A;  1TWA H;  2Z6K C;  4DV6 Q;  4JV5 Q;  1MJC A;  1YHA A;  2N78 A;  4ME3 A;  4GNX C;  2B63 H;  2OQ0 A;  3F2C A;  4OO1 G;  2VQE Q;  2QGQ A;  4LFA L;  1XNQ L;  3CQZ H;  3ULJ A;  1YIT A;  4UY8 C;  4FDB A;  4IFD J;  4DR5 Q;  2WFW A;  2PI2 A;  2ZTD A;  4NXN L;  2NVT H;  1YZ6 A;  1SRO A;  1E7Z A;  1PYS B;  4R4I A;  1X9N A;  3TEH B;  3K7A H;  1C7Y A;  2AWO A;  4LNQ A;  2BA0 A;  4A76 A;  1SMX A;  3KDF A;  1IYJ B;  3G48 A;  4UP9 A;  4DV2 L;  4DV5 Q;  4XTC S;  3ICE A;  5IWA L;  1OXV A;  1OXX K;  1KD1 C;  3EN2 A;  2C35 B;  4YHH L;  5M5W H;  4A3K G;  1N36 L;  1SFO H;  1L0W A;  4HID A;  3I56 A;  1FJG Q;  2I5M X;  1VQH A;  4JI8 Q;  4GLX A;  4GNX B;  1JE5 A;  1XPO A;  3GDE A;  1PYB A;  2UXC Q;  3AEV A;  4A3L H;  2WP8 J;  4TVA B;  3I4M G;  1E24 A;  3LGJ A;  3UDG A;  3EIV A;  1D8L A;  5GQO A;  5C44 H;  3PGZ A;  1EYG A;  4JI5 Q;  3PUW A;  4LF7 Q;  4P73 A;  1TWF H;  3PSI A;  4POG A;  3PO2 H;  1HNW Q;  1VQI A;  3DM3 A;  4IO9 A;  1VS0 A;  4GOP A;  3CP0 A;  3GTQ H;  1YBY A;  2HT1 A;  4X66 L;  1A63 A;  4DV4 L;  1R9T H;  4POF A;  1E22 A;  3KF6 B;  3HOU H;  1BVS A;  4JI7 Q;  3ERS X;  4HJ5 A;  2B29 A;  5AJ3 L;  2XGT A;  1G29 1;  2XTI A;  4GS3 A;  3CAM A;  3CCJ A;  4BY7 G;  4LFB Q;  4P71 A;  3AFP A;  3W1B A;  5IP9 H;  3ULP A;  4DR4 L;  1CSP A;  1SN8 A;  1S40 A;  5EAY A;  2IHE A;  1PH3 A;  2ZTC A;  5FJ8 G;  2UU9 Q;  1PH1 A;  1TWH H;  2CWP A;  1VQ7 A;  4C3J H;  4DPG A;  3RZO H;  2WB1 E;  1HR0 Q;  2RHQ B;  4BBS H;  1AE2 A;  4AH6 A;  1HZA A;  1KRS A;  5FLX c;  4YCU A;  4LF8 Q;  4X62 Q;  4DR1 L;  4X65 Q;  1AE3 A;  4JCV E;  1K73 C;  4Y52 H;  2LXK A;  2IY5 B;  3BJU A;  4EX5 A;  4DV1 L;  3M4P A;  3CF5 A;  3K7U C;  1VQP A;  1TWG H;  2WB1 G;  3NEN A;  1XMQ Q;  4XIG S;  5M5Y H;  4JBW A;  5C3E G;  4HIO A;  1IBK Q;  2UUA Q;  1M1K C;  2R93 H;  2I5L X;  1A62 A;  1K3R A;  3E9H A;  4MZ9 A;  1LTL A;  1CKM A;  4BBR G;  1OXU A;  4GKJ L;  3I4M H;  5IP9 G;  4DV3 L;  1VQF A;  5IT9 c;  5GAD C;  1I50 H;  3TS2 A;  2AKW B;  3STB C;  1QUQ A;  1KXL A;  3CC2 A;  4B3M Q;  4DV1 Q;  2R92 G;  4KHP Q;  4LUV A;  4A93 H;  4GN3 B;  4RMF A;  3JAM c;  4P74 A;  4C2M H;  2VQE L;  4IFD G;  2MFI A;  5FLM H;  4IPD A;  3CCU A;  1ASZ A;  4DKA C;  2BH2 A;  3CCL A;  1X3G A;  2VNU D;  3I7F A;  3UE0 A;  3M85 A;  4GN4 B;  2E5L L;  2NVX H;  4GOP B;  4PG3 A;  1J5E Q;  4LF4 Q;  3T1Y L;  2UUB L;  1XNR Q;  3J80 i;  2UXD L;  4NPS A;  2FXQ A;  1CKN B;  3U4V A;  1N34 L;  3U50 C;  1Y1W G;  1IBM L;  3A5Z B;  3S2D H;  4OWT B;  4GKK Q;  3BZC A;  2JA7 G;  5LMN L;  4A3C H;  1YNX A;  3CME A;  5IE8 A;  5IP7 G;  3S24 A;  3OW2 A;  3G71 A;  4AQY Q;  1S72 A;  4A93 G;  3CC4 A;  4BXX H;  3CC7 A;  3PIP A;  1HNW L;  4A3E G;  4A3J H;  4KHZ A;  3GD7 A;  4GNX A;  3I4N H;  2NZH A;  2JE6 I;  3D0F A;  4UP8 A;  1N34 Q;  2E2H H;  1HNZ Q;  4HJ9 A;  3G4S A;  4H02 A;  2ASB A;  2VQF L;  1JT8 A;  1XMO Q;  1OXS C;  1WI5 A;  4PMW A;  3ULL A;  5C3E H;  3H3V H;  4IFD I;  4X6A H;  3OYY A;  3K80 C;  5ELO A;  1CKN A;  1FJG L;  1XPU A;  2UUA L;  4X66 Q;  1YIJ A;  3J81 j;  4HJ7 A;  2VZA A;  2UUC L;  2BA1 A;  5GRO A;  3PIO A;  3S1M H;  1IXR A;  1QVC A;  2JA7 H;  4OWX B;  4QIW E;  1NY4 A;  4NXM Q;  4A3F G;  2HQL A;  3CPW A;  5IYC G;  3TS0 A;  1W2B A;  2Z0S A;  4X65 L;  4JI5 L;  3GTL H;  3PO2 G;  1LM0 A;  3L2P A;  3CCQ A;  3PF4 A;  4AIM A;  1D7Q A;  3H0G G;  1YEZ A;  4L5T A;  4QL5 A;  4LF6 Q;  1K83 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...