4BY1G

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by1G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4by1G01
1AE2A 4DV6L 3H0GH 3CC4A 2MQHA 4DKAC 2PQAA 2A19A 4DR2L 3EBEA 4DV5L 3HFZB 4DUZQ 4DK6C 4UY8C 2F4VL 5AJ3Q 5M5XH 3STBD 2R6GA 1LM0A 4NXML 3U4VA 1N34L 2JA6H 4IOAA 1CSQA 4O0AA 2JA8H 2KCMA 3AQQA 4Y7NH 3FP9A 4AYBG 3ER0A 2R7ZG 3CCUA 4BBRG 4IPHA 5IYCG 1N8RC 4A93G 3GTLH 1PH4A 1I5FA 4A3JG 4AQYQ 3DLLA 5DLQE 2HHHQ 1HR0W 4LF4Q 2WP8J 4L5QA 3BZKA 3PO3G 2OTJA 4MNOA 1PH3A 2UUCL 1X3EA 4L5TA 1E22A 1J5EL 1B8AA 1VQNA 2IY5B 1UE1A 4X66L 5HY6A 4B3SQ 1J6QA 1HZ9A 2ZTCA 3CCRA 5IWAQ 1B7YB 1EIYB 4LF8L 3PF4A 4K0KQ 4DR5L 2NN6I 4RMFA 2QGQA 5FLMH 4DV2Q 4NB3A 4HJ9A 3G48A 2JA8G 1Z47A 4WJ3M 3TREA 1X6OA 4DV6Q 3BU2A 1VQ4A 1N33L 1VQEA 3A0JA 4GN4B 5M3MH 3S1NH 1WYDA 3EN2A 4IJLA 4DR2Q 3W1GA 1XPOA 3CCQA 4DV5Q 3I4NG 4JI5Q 4DR4L 1VQBA 4LFBL 1N32Q 1SRUA 3NENA 1EUJA 1N9WA 1S3OA 1UE6A 1X3FA 2JEBI 4IPCA 4QY7A 4YWKA 3HOXG 1N34Q 1SROA 2VQEQ 3J7ZC 3I2ZA 4A3BH 1GD7A 4A3LG 2KCTA 3FHWA 3HOUH 1CKNA 1I6HH 1PV4A 1KRSA 3CMEA 3OTOQ 2IHFA 4A3MG 3I55A 5GADC 4X6AH 4LUVA 5FLMG 2UXDL 4A4IA 3NELA 4JI0Q 4LUOA 1PH5A 2VUMG 3L7ZC 2ZM6L 1YHAA 1M90C 4A3CH 1VQGA 4DV0L 4A76A 1RIPA 2UUCQ 1QUQB 5ELOA 4A3IH 3KYHC 4X66Q 3CCJA 5JEAJ 1HNZL 1NY4A 3E9HA 4AH6A 4LF8Q 1H95A 4OONA 5M5YH 1U0LA 1QZGA 3HOYH 4JI1L 4A3BG 4LF7L 1RL2A 5IYBG 1IL2A 1IBLL 1QZHA 1VQMA 1Q1EA 3CPWA 3CCSA 4DUYL 4DR4Q 4APVA 2BA1A 4PMWA 4GNXA 1XMQL 4LFBQ 2ATWA 1M1KC 1J5EQ 2UU9L 3IRBA 2NVQH 3HOWH 4PG3A 2UUAQ 2B29A 2YU9H 1QVGA 2CQOA 4A3IG 1KD1C 1Q46A 3HOZG 4JBMA 3M3YH 1Q7YC 3KJOA 1GKHA 1SR3A 2EIFA 5M3FH 4HIDA 1YJWA 3KDFB 2A1AA 1Q86C 1K73C 3I4MG 2ZM6Q 3KJPA 1AE3A 3K8AA 3PUWA 4IFDJ 4DV4Q 2RHSB 3S1QH 5C0XJ 1Y14B 4A3EG 3CCMA 1O7IA 4BY7H 1PYBA 4X62L 2UXBL 4P74A 1HNZQ 4LF6Q 2Y0SG 4JI8L 3CP0A 1XNRL 3RN2A 3HOWG 1UWVA 4GN3B 3S2HH 3CPFA 3RNUA 3UDFA 3T1HQ 1TWFH 1QVFA 1VCIA 4A3DG 2CWAA 1IBLQ 5K36G 4DNIA 1K8AC 2HIXA 4JV5L 3PO2G 4GLAC 5M3FG 2JA7H 2CCZA 1L1OC 4ALPA 1L0WA 4BXXG 4IFDI 1G6PA 5LMNL 1TWHH 5E7NA 1PH7A 2UU9Q 4JI7L 2K75A 1R9TH 4NXNL 2B3GA 2B63H 1YJ9A 3HKSA 5FLXc 1Q81C 1BBUA 4BY7G 1I3QH 3CW2C 4OXPA 4BBSH 1WFQA 1TWGH 2K5NA 2MO1A 1TWAH 1Q12A 1YZ6A 1Z9FA 4BY1H 1NE3A 3PUXA 1ASYA 1KIXA 1TWCH 2PI2E 1HZAA 3KF6A 2Q2IA 4LW1A 4R4TA 5C44G 2OQ0A 4X64L 2BH8A 1YHQA 2R92H 1LYLA 1KRTA 2NN6G 1E1OA 1X3GA 5IT9c 2UXBQ 4OWTB 3HKZE 1XNRQ 3RR5A 3UE0A 2VZAA 2E5LQ 1WCMH 3DM3A 5C3EG 1VQ6A 1EIFA 4BA1I 2VW9A 3CC7A 5LMUL 4LFAL 4L5RC 3CXCA 1XNQL 5GAEC 3SGIA 1CKMA 2EQSA 2ZTDA 2VQFL 1G51A 1QUQA 4JG2A 1EYGA 4IPDA 4JV5Q 4IOCA 1X55A 4PZ8A 2HQLA 5GAHC 2WB1E 4JI4L 4GOPA 2YV5A 4JI7Q 3KLWA 1EWIA 2R92G 3MXNB 2NVXH 3GTOH 1YHBA 3S1RH 3H0GG 4UPAA 3T1YQ 1GM5A 1YJNA 2EXDA 4DPGA 3TS0A 2ALYB 1L1OB 1C9OA 3F8TA 2JK8A 5JJKA 1D8LA 2ZJQA 1FJGQ 1E24A 1VQDA 1I50H 4DR3L 3RZDH 2JA6G 5EAYA 2GVBA 4DR1L 4X65L 4ME3A 1UE7A 2GN5A 2ASBA 3CCVA 4XIGS 4DR7L 3E0EA 1JB7A 5JJLA 3BJUA 3L0OA 1PH8A 3GTQH 1PH9A 1OXXK 1SLJA 4PZ6A 1HR0L 5HGQA 3I56A 3GTMH 3PCOB 4C3IH 3KDFA 2F4VQ 2YYZA 1KHIA 3K0XA 4TVAB 4LFAQ 5LMUQ 4NXMQ 4P71A 3TQYA 2E2JH 4JYAL 5JEAG 5JJIA 1LUZA 4O2DA 4R4IA 4YCUA 4LFCL 2KBNA 1NBWA 4RG1A 2NZOA 4NPSA 2IT1A 4JI6L 4Y52H 2N3SA 3F2CA 3A5UA 3U58A 3PF5A 3CC2A 5M3MG 4DAYB 3VDYA 1VQOA 4DV3L 4JBJA 5FJ8H 4UP7A 3HKZG 2XTIA 4DR5Q 2JJQA 2PI2A 4X65Q 1N36L 2UXCL 1NTGA 1V43A 1D7QA 1DGSA 1S72A 2I5LX 3RLOA 4DV7L 2Z6KC 2GVAA 1Q1BA 1IZ6A 3CD6A 3HOUG 1N33Q 1YI2A 4JI2L 1AH9A 3OYYA 4H02A 3W5OA 4YHHL 5C4XH 1KAWA 3STBC 2WB1G 4IFDG 4A3CG 3A5ZB 5C0XG 1P16A 4B3TQ 3F2BA 5FJ8G 1IYJB 1IXRA 1Y1VH 3J81j 3S1MH 1YBYA 2YTXA 1EOVA 3HOYG 2UXDQ 3PUYA 1JJ2A 3EIVA 4JI6Q 1VQFA 2MO0A 2WFWA 1E1TA 2IX1A 1VQJA 1PA6A 3S17H 1E3PA 4DV0Q 3J7A5 3S2DH 1XTDA 2JA9A 4P75A 4B3TL 3B6YA 4DV3Q 4DV1L 3ICEA 3J80i 3PIPA 1I94L 2CFMA 5BR8L 4A3GH 5C4XG 4WJ4A 2K5HA 1A63A 3UDGA 4GNXC 1N36Q 2K4KA 1UEBA 2I0QA 4JI1Q 3U50C 1VQHA 4QL5A 3K7UC 4HIMA 1YITA 4LF7Q 1OXTA 1VS0A 3AYHB 4R4QA 4JI2Q 1X9NA 4JBWA 5GQOA 4BBRH 2R93H 1OXVA 3J80c 1HZBA 4DUYQ 2N78A 4YHHQ 4B3RL 1XMQQ 2ID0A 5C0XI 1V1QA 4C3JH 4GS3A 1HNWL 3G71A 4BA2I 3UDIA 3MEFA 4GKJL 2LXJA 2D0PA 1CKNB 3GO5A 1VQKA 3W1BA 1UE5A 2LSSA 2K14A 4OO1G 2Q2UA 4A3KH 3NBHB 2JA5H 4DUZL 1V9PA 4R4OA 3ULJA 1NMFA 4EX5A 4POGA 5IP9H 1PH6A 4LF5L 1XPRA 4LUZA 4HJ7A 4A3FH 3CCLA 2D62A 3CCEA 3K80C 2C35B 4X62Q 4DV1Q 2JA7G 3GTKH 2JQOA 1SN8A 4JI8Q 3D0FA 3PGZA 4UP8A 1PFSA 2Z0SA 2B63G 4KHPL 1VQ8A 4AQYL 1FGUA 2HHHL 3CQZH 4LF4L 2F3IA 4JOIC 2AWOA 1SFOH 2I5MX 4BBSG 4HJ5A 4A3KG 4C3HH 3F2DA 4OX9L 4R4CA 4BY1G 2QA4A 4B3RQ 4GNXB 4A75A 5IWAL 4LNQA 1KL9A 5IYCH 5IP9G 5LMNQ 2HT1A 4A93H 2K5VA 4K0KL 2BA0A 2RF4A 4A3JH 5M5WH 4A3FG 1S40A 1K8GA 4NXNQ 5IYDH 1X56A 1VQ5A 1YVCA 2IHEA 3PO3H 4OO1I 2OWOA 4IJHA 2IX0A 4TQUS 5IE8A 3OW2A 4JC0A 4MZ9A 2OTLA 2VNUD 3BZCA 4JI5L 2R93G 4QQBX 1WCMG 2D0OA 4GLVB 1N32L 2Q2HA 2CWPA 1IBKL 3D31A 3WWVA 4LF5Q 1WJJA 4JI3L 2VQEL 4X64Q 2OQKA 3M9BA 1MJEA 1OTCA 2AWNA 1C7YA 2F52A 2ES2A 2N49A 2K52A 1WOCA 4LWCA 4YWLA 3Q8DA 4HJAA 2AKWB 2JE6I 2WAQE 3OTOL 2NVTH 1VQPA 4KHPQ 3I4NH 2H5XA 5IYDG 3E9IA 1JJGA 4HJ8A 3L2PA 4GOPC 4JI0L 1HNXL 4QJFA 3HOXH 1QVCA 2LXKA 1CUKA 3K81C 3PSIA 2VQFQ 1XNQQ 2PMZE 4HIKA 2Q2TA 3PUVA 4A3LH 3G6EA 2RCNA 2KENA 4OX9Q 5ELNA 4MTNA 4GN5A 4JI4Q 4A3MH 1T9HA 3J81i 5IY0A 3TS2A 3ERSX 2VUMH 1K9MC 1E7ZA 1FL0A 1SMXA 2DUDA 2YTYA 5GROA 1ASZA 2Y0SE 1PYSB 2MNAA 2QEXA 1YEZA 4R1JA 3ULPA 1KC8C 1WI5A 4B3ML 2NZHA 2NVYH 3J81c 1A8VA 2ZJRA 4KI0A 4AIMA 4DR3Q 1XMOL 4DR1Q 2UUAL 3S16H 3M4OH 3KF6B 2Z6KA 1HZCA 4JI3Q 4GLXA 3H15A 1VQAA 4DR7Q 3PIOA 1KQSA 1JMCA 1HNWQ 3AFPA 1G291 5IYBH 2XGTA 4UP9A 1JT8A 3LGJA 4DAMA 3G4SA 4XTCS 1HR0Q 4HIOA 3PUZA 2KHIA 2L15A 2PQAB 4JCVE 4EQ5A 1EQRA 1JJCB 1FVIA 1GVPA 1W2BA 1NJIC 1HNXQ 3RZOH 1L2FA 1OXUA 1Y1WH 4GKKL 4JYAQ 1W3SA 4YCWA 2HIVA 4DV4L 4PZ7A 1X54A 3I4OA 1OXSC 1X65A 1A0IA 4JBKA 3JC66 3HOZH 4P73A 1PH1A 4LF6L 4LF9L 1IBML 4LFCQ 3GTGH 3CAMA 3GD7A 4GOPB 1Q8KA 3M7NA 2VL6A 3I7FA 1GO3E 2N8NA 2E8GA 3ZJYC 1YIJA 1NMGA 5H1SE 3T1HL 3GTJH 3TRZA 4DR6L 2R7FA 3I4MH 3KOJA 1TXYA 2OCEA 3H3VH 3CF5A 1BBWA 1K0RA 1MKHA 4OWXB 4A3EH 1PH2A 4YY3L 3UDXA 5J3BA 2MFIA 4YWMA 1LTLA 4B3MQ 2WAQG 1XMOQ 1Y1WG 1U5KA 4J15A 3A74A 2UXCQ 3GTPH 1VQ9A 2VS1A 2YTVA 2I5HA 1MIUA 4A3DH 4DV7Q 4AYBE 2JEAI 4QIWE 1Y1VG 2UUBL 1EQQA 2E2IH 1L1OA 3PO2H 1PHJA 4YCVA 1KXLA 4BXXH 3RN5A 1VQ7A 4GKKQ 4L5SA 3K7AH 1IBKQ 3KF8B 2ZJPA 3S24A 1PVOA 5LMNW 3FKIH 2VY3A 2AHOB 4LF9Q 4P72A 2FXQA 5IP7H 5C4JH 1IBMQ 1Q82C 1CKOA 3HOVH 4A3GG 1VQIA 1VQLA 2A8VA 1EFWA 2E5LL 4GKJQ 5AJ3L 4DR6Q 3CMAA 1C0AA 1XJVA 2R7DA 3F1ZA 5C44H 2BH2A 3AFQA 3S14H 1HH2P 1B70B 2V1CC 2ZTEA 3M4PA 1K3RA 4FDBA 2DGYA 4KHZA 3TEHB 3U4ZA 3NEMA 3RLNA 3UE1A 4C2MH 4DK3C 4YY3Q 4IPGA 1I94Q 5BR8Q 4QGUA 3AEVA 2K50A 3PV0A 1YNXA 4JOIA 1BVSA 2KHJA 5C3EH 3FKIG 3JAMi 1K83H 3ULLA 3T1YL 2PNHA 2UUBQ 5IP7G 4OWWB 3HOVG 1BKBA 3M4QA 1CSPA 2JA5G 1XPUA 4B3SL 2R7ZH 1FJGL 4IO9A 3GDEA 4POFA 2E2HH 4KLKA 3H3VI 5GAGC 3RLFA 1P8LA 1A62A 1MJCA 1JE5A 1HJPA 1SE8A 2AMCB 2CKZB 3M85A 4DV2L 3KFUA 3S15H 1VQCA 2RHQB 3JAMc
chains in the Genus database with same CATH superfamily
1AE2A 2F3VA 2AQ1B 2GPSA 4DR2L 2A19A 3TMEA 4MAMA 4GKKH 2P0AA 3GIMA 1F9QA 5AJ3Q 1K1QA 2R6GA 4NXML 3U4VA 1JOKA 1SMYD 1STBA 4A3IB 2WKCA 2KCMA 4J9KA 3PR4A 4AYBG 4RH6A 4C3HG 3ER0A 4IUVA 5M5YB 1S0OA 4IPHA 2MJ8A 1K83A 2FMMA 3BS1A 3DLLA 3EPIA 4B3TH 2OTJA 2LFNA 3FDTA 3C2PA 4YY3H 2RCFA 2UUCL 1X3EA 2OT2A 1E22A 4ID6A 2PN1A 5KFIA 1ZETA 2IY5B 3NTKA 1GSOA 1EYCA 1CI3M 1B6RA 4B3SQ 4IZOA 1EIYB 2ZTCA 5IWAQ 1B7YB 3VR6A 4LF8L 4DR5L 3KK7A 5FLMH 2JA8G 2QGQA 1JXLA 4NB3A 1KJ8A 2F0OA 3O13A 3NGDA 4WJ3M 4C1NI 3F2UA 4LMYA 1EY4A 5M3FB 4BS9A 1WYDA 5CGKA 4DR2Q 3I4NG 5DG7A 1VQBA 1SRUA 5EPJA 2JEBI 3HOXG 1UE6A 4IPCA 2EZVA 1IBKQ 2FMAA 5DQHA 4J6HA 1CQVA 3KF8A 4ZLTF 2F0FA 1DZ1A 3I2ZA 2QCPX 4A3BH 4A3LG 1HTPA 2KCTA 3DUZA 3VMMA 3M9NB 1CKNA 3Q23A 4EBEA 2IHFA 5GADC 3KUPA 4LUVA 2DJGC 2K5DA 3NELA 5CV6A 3S14B 2NYZD 4K5VA 4PMCA 4UAIA 5GONF 3MZ5A 2UUCQ 1RIPA 4FF3A 2A6EC 3I4LA 1QUQB 4A3IH 2ZXPA 2XNAC 3VR5A 1CQJB 5T14A 5JEAJ 1HNZL 4AQYH 3MXGA 3RV4A 5I47A 1T5EA 4LF8Q 4LF4H 3T13A 1SNCA 4OONA 2M00A 2RA4A 5M5YH 4TV9F 2WKDA 4LF7L 3M4IA 3GILA 5IYBG 4C5CA 3E6ZX 3AMUA 4BY1B 1QZHA 3TP6A 1Q3LA 5EPLA 2NBFA 2X69A 4DUYL 1S5CD 4APVA 4PMWA 4GNXA 4DV2H 3K5LA 2ATWA 2UU9L 3GIDA 4DV6H 4PG3A 1V1PB 3C1EA 1DCZA 1U9RA 4JBMA 1N32H 3R2TA 1BNZA 4ZQ3A 1GKHA 1SR3A 2EIFA 1LACA 4RWSC 5M3FH 4RGOS 1YJWA 1RJRA 3SE7A 4RB2C 3LX0A 4L1KA 4RHRA 4A3EG 1EEFD 1MSHA 3HRZC 1HNZQ 3OWFA 1UNSA 3G6YA 3T53B 1BQQT 2Y0SG 1JICA 4X3SA 1WTVA 3GTOB 3ETJA 3RN2A 1UWVA 2ZXRA 1K1SA 1B2TA 5EKIA 1B6SA 4GC7A 2K01A 3A7AB 5K36G 3S9WA 2EJMA 1A2TA 1GUNA 4ECXA 4GLAC 3I90A 3GLKA 1SNPA 1G6PA 3MHBA 1QNKA 5LMNL 1S97A 1HHVA 5E7NA 2UU9Q 4RAZA 2K75A 4NXNL 4CJ0B 3RUPA 5EBCA 3GTQB 3LP8A 4YBZB 5FLXc 4DR4H 4EG0A 4QWEA 2K5NA 3H94A 1II3A 1J5EH 1MHWC 2K6AA 4BY1H 1RTOA 4EYHB 1NE3A 2QKIC 3X3MA 2PI2E 4EGJA 3KF6A 4LW1A 1A63A 1YHQA 1TS5A 3VYUA 3QZ8A 4RAYA 1KRTA 1F77A 1E1OA 2KCNA 4IURA 3U9TA 1X3GA 1BBXC 2X6LA 2DZDA 2V5AA 3K5NA 4DV4H 5C3EG 3MXPA 1R4QB 1EIFA 1B33N 5LMUL 4ZQIA 3CXCA 4JW0A 2ZTDA 2NWGA 1QUQA 3N42B 2EY5A 2RGVA 4OHJA 5GAHC 4GOPA 3T1HH 3FRPB 1QILA 3GTOH 3G6VA 5C5LA 4FU0A 2CW0D 2EXDA 3MVVA 5C4XB 2ALYB 4EVOA 2NB0A 3M7GA 2JEJA 2JK8A 4NMZA 2NVQB 1G2SA 2C00A 1KNAA 5COYA 1E24A 1VQDA 2VPQA 3RZDH 4HCEA 2GVBA 2GN5A 3DF7A 1V1PA 4DR7L 3G8CA 3CU7A 3V05A 3S1MB 4O4LF 3GTQH 1SLJA 4PZ6A 1ICWA 1HR0L 2R7LA 4QWCA 4OELB 4LSXA 1A9XA 4U673 1DV2A 3S2DB 5KNBA 2YYZA 3S1QB 5LMUQ 3M9OB 2UXBH 3NXWA 1STNA 1XNRH 5JJIA 1LUZA 4O2DA 3GTOA 2KBNA 4J8QA 3RIZA 1KJ9A 1STGA 2DNCA 1IW7D 2IT1A 4EYIB 2R8HA 4S3SA 4Y52H 4DA2A 3A5UA 5J39A 3U58A 5M3MG 1VQOA 4DV3L 5FD5A 4YB8B 4DU9A 4C3IG 2IPKD 4CDEC 4CJ2C 2QILA 3HOUG 1IZ6A 3CD6A 1N33Q 1AH9A 3OYYA 2FJ2A 4MN3A 5C4XH 1LTTD 2AUKA 5I6WA 3STBC 3MAQA 4IFDG 5KT7A 2GLTA 5KFDA 5JAVA 2FP4B 2PO4A 5D3DA 3F2BA 3K59A 2RQXA 5FJ8G 5EWEA 3L4JA 1T3NA 4UDUC 3J81j 3MFIA 3GIPA 3S1MH 2YTXA 2EPBA 4NXMH 1EOVA 3NE5B 5JH7F 1JJ2A 1SFOB 3EIVA 1JOQA 3TINA 1E1TA 4O3RA 1RHPA 4N9TA 4C3HB 3J7A5 3S2DH 1TIID 4HNTA 4P75A 4DV3Q 3J80i 3U9SA 4BWSC 2KCCA 2K5HA 1IYVA 3UDGA 5KT5A 2XIGA 3JRWA 4RHSA 3OOCA 1PRTF 3GIIA 2JEFA 3HXLA 4QL5A 4M7EA 1JKJB 2K7VA 2DN8A 1X9NA 1I4QA 1H9MA 1PRTD 5IGFA 3Q8SB 1HZBA 4DR5H 2NUAB 1XMQQ 2ID0A 4ED2A 5FO8B 2G9DA 1V1QA 2D9UA 1H9JA 3G6XA 3WDNA 2E74C 3I70A 4GKJL 2NVTB 2D0PA 4HAEA 2FK3A 2LSSA 2K14A 4WBNF 5JVG3 4KV6A 1CHPD 4DUZL 3ULJA 4EX5A 1WSCA 3H3VC 3R93A 5KFFA 4RGNA 2F0IA 5HGTA 1Q90A 3D4WA 4X62Q 3SK6A 2A74C 4B9XA 1SN8A 3D0FA 3PGZA 4UP8A 1PFSA 4KHPL 1O75A 2C28A 2IW3A 4MA0A 4QWAA 4U7CA 2F3IA 4JOIC 4ZAIA 1WD0A 1SFOH 2I5MX 1E4FT 4BBSG 2EOTA 3BYTB 2NU8B 3S16B 4C3HH 3F2DA 3D4RA 1C30A 1TR5A 1N36H 3BA8A 4LNQA 5IP9G 1ZYRC 5IYDH 4LF7H 5EJWA 1HFGA 4F4XA 1KC7A 4LSAA 1VQ5A 1TWAA 2IX0A 5IE8A 3OW2A 1ILPA 4DUYH 1EUDB 3RZOB 2VNUD 3BZCA 1IHZA 3K3PA 2WV6D 1MBYA 1SDFA 1WCMG 2Q2HA 3D31A 3WWVA 1DONA 5KFYA 1WJJA 2VQEL 2OQKA 2PMZB 4M8AA 4LMQD 2WE6A 4H13C 4G4KA 4IR1A 5F9LA 2D2CC 4A2AA 1M0TA 1S0NA 2WAQE 3KLSX 2ICEC 3HEJA 3GTJB 5J22A 2NVTH 3I4NH 4KHPQ 1JJGA 4JI0L 1SFOA 2AQ4A 3DEOA 4QJFA 3HOXH 4A3EB 3PSIA 4ECQA 1DOMA 3PUVA 1PTOD 4RB1A 4A3LH 2Y0SB 3KHGA 5ELNA 4FF4A 1F2ZA 4GN5A 5LHY1 1HTLD 2HGSA 1F2MA 2R84A 1T9HA 1S9FA 4RCNA 3ERSX 2E2IB 4HYKA 5GROA 1D6EC 1PYSB 2QEXA 3ULPA 5LMNH 2XVSA 4NXNH 2P5ZX 4L63B 4B3ML 2ZJRA 1XMOL 1EY7A 4KI0A 3S16H 1JE4A 1XTCD 3FKIB 4IWYA 2F0LA 2NZ1D 3PIOA 1RK6A 4KY7A 1KQSA 1JMCA 1A3UA 1RDPD 1SNOA 4Z9CB 1HUMA 5IGBA 5IYBH 3LGJA 3G4SA 2PQAB 3RF2A 3TP5A 2RVLA 5JPMC 1W2BA 1ONLA 1NJIC 3RZOH 4GKKL 4C2MB 4FO2A 2UVRA 3I4OA 2BDOA 5I4DA 3GTKB 1A0IA 3VA5A 5C5MA 4F8MA 5C3EB 2W6ZA 1EZ1A 2VL6A 2N55A 1JWMD 1NMGA 3TRZA 3GTJH 3ETHA 2BDNA 3RMHA 3H3VH 1BOSA 3CF5A 1EY6A 1PMRA 1BBWA 2R7ZB 2GPWA 4OWXB 4A3EH 4LK1C 5J2UF 4YY3L 3J81L 5I9PA 4B3MQ 1GJXA 1LTLA 1XMOQ 3EJIA 2SDFA 2UXCQ 3R23A 4IRKA 4MA5A 4IALA 2YTVA 5ELFA 3H4BA 1Z6HA 2C9OA 4XX0B 1XDNA 5K36H 1Y1VG 2V4RA 5E3FA 1EQQA 2E2IH 2B8GA 5M5XB 5D1PA 4DXGA 4ECVA 1E2VA 4GKKQ 2PVPA 4DR7H 1LT5D 2QEJC 3N40P 5KG2A 2PMZA 1PVOA 1HR0H 3FKIH 2VY3A 3GTLB 4MV6A 2W6MA 4A3GG 5KG4A 1HA5A 3GTJA 1SYXB 1HNXH 3IL8A 1KJJA 1EFWA 1TA8A 1TT2A 1CA6A 1B50A 1O80A 3D8GA 2VPSA 3F1ZA 1D2BA 4FDBA 2V1CC 2F0UA 2ZTEA 2O4XA 4B3TQ 4C2MH 3V6JA 4DK3C 4YY3Q 1GSHA 1HPCA 4F88A 3OHAA 2L12A 4XXEA 5ELEA 4QGUA 4UFZA 3SR1A 4LAAA 3PV0A 1L2ZA 3M4YA 3J81E 1YNXA 4JOIA 5C3EH 4IZ8A 2E2IA 5M3MB 2R93A 4IQZA 4IUTA 2W9AA 5DG8A 5IP7G 1GSAA 5A2QW 3HOVG 2N88A 5BN3A 1BKBA 2M2LA 2R7ZH 1FJGL 4POFA 3HB9A 3J80W 3BG3A 4O3SA 4KKSA 3RLFA 2VOBA 1MJCA 4I65A 3FKIA 1H9SB 4DV2L 3HOUB 4FNFA 2XGPA 3JAMc 1PFMA 4DV6L 1HQRD 4KD4A 4ILWA 3KALA 4ZK9B 5KFHA 3KXYT 2HQEA 1NSNS 2PQAA 5LL6S 3HFZB 4ZYSA 5DM63 2EYJA 2F4VL 4ED1A 5M5XH 4C2MA 2EY6A 3GTKA 4PDBA 3Q0AA 3CCUA 4ED6A 5JJZA 4DR6H 4QMGA 4A93G 3GTLH 1XXGA 4AQYQ 1EHIA 4LF4Q 4F4ZA 2Z6BA 4L5QA 3PO3G 1CM9A 4N9PA 2R7ZA 2WDTA 1YNND 3H09A 1O78A 1VQNA 1C3OA 1EIHA 4CDDC 4XQNA 2CW7A 2YU9B 2WINB 1J6QA 1U4PA 2NN6I 4HJ9A 4DV2Q 1HXYD 2UVVA 2A6HD 3G48A 2UUBH 3M3YB 4DV6Q 4JK1C 5M3MH 4Q8FA 3BDOA 5FO7B 4DR4L 1N32Q 3K6OA 1J5EL 4GKJH 2FLLA 3QJYA 2W8KA 2RDIA 3GTLA 5JVDF 3HOUH 4XYLB 5EBDA 3EA6A 4DUZH 5IIFA 1KRSA 2B8FA 3CMEA 2R86A 4X6AH 3I3CA 4K2KA 2PZUA 2UXDL 2W6PA 4MTEA 1VF7A 2WTFA 4IFDH 1VQGA 3MA2B 2W6OA 3NBIA 2EYPA 3Q24A 1TWHB 4HTHA 5IGEA 3NWTA 2FJZA 1NY4A 3E9HA 4CKBA 5KFZA 1FKAH 2VUMA 3PW0A 1H95A 1RYRA 3MR6A 1U0LA 3G6JB 1K0SA 1SYDA 4X3TA 4BBSB 5E4XA 2SNMA 1I4GA 1T5XD 4EEQA 4YAJB 2YZGA 1VQMA 4R7RA 5KFGA 3MR3A 3RB0A 4DR4Q 2MUYA 5LL6b 2BA1A 4J9PA 2R92B 2R87A 2R82A 5H80A 1J5EQ 2RDHA 4HN7A 1H9SA 2BQUA 2YU9H 1HFNA 2F0EA 2HVQA 1KDCA 2CQOA 2W9BB 3IG0A 1Q46A 3JSNA 4DV5H 5D1OA 3M3YH 1WCMB 3KHHA 3KJOA 3VR2A 1IYUA 1O7LA 2VQEH 3CHBD 3I4MG 2EYOA 1UUPA 4CC6A 3PUWA 4DV4Q 3IKJA 1KABA 5C0XJ 4O3NA 1Y14B 2A69C 3IFTA 2UXBL 4TV8F 1SEIA 2R85A 4JI0H 4XQJA 1XNRL 3S1RB 3V2TA 3HOWG 1JCKB 4EBCA 3DXJC 2YRXA 5DLFA 3RNUA 3UDFA 3T1HQ 1EZ6A 3A54A 1VCIA 4A3DG 2B2TC 3MFGA 1BNCA 1ZKOA 3RGXA 2CWAA 4WRDA 4DNIA 3W2DA 3KAKA 1PX2A 3PO2G 2YU9A 4BXXG 2R7KA 1L0WA 2JSOA 1TWHH 3TBIB 2HDLA 1AUVA 1S5ED 2W7OA 1V8QA 3HKSA 1Q81C 1V4YA 4BY7G 3NTHA 3GTMB 4EGVA 4OXPA 5KFQA 4PQXA 4BBSH 4LFBH 3HKZB 2KHSA 1Q12A 1YZ6A 3OSOA 1KIXA 2IBKA 5L1JA 1HZAA 4MV3A 2R92H 5C44G 4X64L 3MXUA 3RAQA 1LYLA 5CYUA 5CV5A 5IT9c 1EEID 2UXBQ 1E2WA 1I7NA 4OWTB 2PYKA 2WB1B 1XNRQ 2YRWA 5KFBA 3UE0A 2ZM6H 4JPBW 1WCMH 4IAJA 1XNQL 3N44B 3TP7A 1CKMA 2EQSA 2W6NA 2A6ED 1NCVA 2HQLA 3OIQA 1LLRD 3MTSA 1LABA 3E5NA 2KECA 5FLXL 4O3OA 2TSSA 1YHBA 3S1RH 2PZTA 3H0GG 3LWEA 1LO5D 5J2TF 5KT6A 1GUOA 3BAAA 1IKLA 2FFKB 2R92A 1QG7A 1SEBD 2NU9B 3GV5B 3E0JA 1G6ZA 4WFN3 4QCLA 2AGQA 4ME3A 1D5XC 4ZKBB 3VA7A 1Y1VB 2R8KA 1JB7A 5JJLA 3BJUA 1HUNA 1JC7A 3JSLA 1E4EB 1WCMA 5E4WC 3I56A 3GTMH 3S17B 1F9PA 3K0XA 3TQ1A 4NXMQ 5FPOA 3TQYA 4XT3B 2H4OA 3NQTA 4A3GB 3OPOA 2W9CB 4WORA 2KVMA 5JEAG 2HVSA 4JVZA 3DHQA 2QYZA 4QB4A 4RG1A 2NZOA 2LKVA 3GV3A 3N6RA 1JX4A 3N52A 4IUQA 1K8MA 2N3SA 1SNQA 4YIJA 4JV5H 2DNEA 3PF5A 3CC2A 1ENAA 1X3QA 4F4YA 3W3AA 4JI7H 2QDBA 1AUXA 4RB0A 4X3KA 4DR5Q 2JJQA 1D7QA 1VDZA 1X32A 1N36L 2YZNA 3PVXA 1S72A 2YL2A 2A68D 1GHJA 4DV7L 3NP8A 2OF1A 1Q1BA 4A3KB 4Q45A 3GTMA 4RKBA 1FJGH 4H02A 3HKZA 3QG1A 3OMGA 1RODA 2O5JC 4KMUC 3MC0B 2NU6B 4O4IF 2AGOA 2OEOA 5CAEB 2D5DA 2JP1A 5KFUA 1SMYC 4A3CG 1D1IA 1PZKD 1Y69U 4N8FA 4NP5A 2B2UC 2KQ3A 1Y1VH 4R9WA 3N43B 1EY0A 2F4VH 1M6VA 3CQZB 2WB1A 2EXZA 4LFAH 5L9XA 4RFBA 3SK8A 3HOYG 4RZRA 3PUYA 1SJED 3MWYW 2BE5C 2RDGA 3I12A 4ECSA 3NQIA 2WFWA 5EWFA 2L5TA 2IX1A 3S17H 5DQGA 5HBRB 1U4LA 3B6YA 4KJOA 3ICEA 3RJ0A 4LJZC 1I94L 4QW9A 2VXWA 4A3GH 4OO1H 1S03G 3PO3B 2B2TA 1N36Q 4ECTA 2K4KA 1UEBA 1VQHA 4IN3A 4J1MA 4NDXA 4YR0A 2J6SA 4LF7Q 1ZEQX 2F0WA 4JBWA 1GHKA 3R3OA 3RZDB 2YYAA 4DUYQ 3A8KE 3FEWX 1KTKA 1KEEA 1HNWL 3G71A 5KFKA 3UDIA 3C0FB 1Y1VA 3OUUA 2OLSA 4QUCA 3NUCA 1E4EA 1Z2OX 1UE5A 4K6LA 1FYCA 4A3KH 1V9PA 4G57A 4R4OA 4UCTA 4RUAA 3BDLA 1NMFA 5IYZF 1LTGD 4LUZA 3CCLA 2W9CA 3K80C 2C35B 2EY1A 2J6UA 4EFBA 2OXPA 1AP0A 2UXDH 4YJ3F 5FKAC 3J7AK 2B63G 5IODA 2Z0SA 2FLPA 2HHHL 1MGSA 3CQZH 4E4TA 3T56B 4IHJF 5KEEA 2TMPA 1WTOA 2FPGB 4HJ5A 3ERQA 2RKSA 5I6YA 5G3LD 4A75A 3OIPA 2HT1A 4K0KL 5LMNQ 2YW2A 4A93H 2RF4A 4NXNQ 4A3FG 1SAPA 4JI2H 3PW7A 1QB5D 4K14A 3PO3H 3KAJA 3QZ7A 2BOSA 1JOOA 4YHHH 4B08A 1IOVA 5ISRA 5CR3A 2B2VC 2ZDHA 2L1BA 2Z4HA 4JI5L 2MCTA 2XC9A 3G7LA 2A73B 2ASJA 4XYMB 4CKCA 1MJEA 2AWNA 1C7YA 2N49A 1J9OA 1KLUD 3OMCA 4LWCA 3CQZA 2JE6I 3OTOL 4C1NK 2H5XA 3SE0A 3I4MB 4HJ8A 3L2PA 3N41B 1HNXL 4EGQA 3TP8A 2LXKA 2PMZE 2ZDQA 5BN4A 2RCNA 4DK1A 5KYLA 2K33A 4KKTA 2VB2X 4A3DB 2PW5A 3ND9A 4F7XA 3J81i 1UC8A 4UCOA 1QE6A 4FS1A 1VBGA 1K9MC 3PO2B 3R2IA 4UCVA 4Q44A 1SMXA 1D5ZC 2YTYA 1GXDC 2Y0SE 2MNAA 4IUPA 1YEZA 4MTKA 4Q0FA 4HSVA 3GV6A 3WNZA 2CZGA 4HNUA 1A8VA 2UUAL 3ND8A 4I7ZC 4BWGB 1HZCA 3GTQA 1TY0A 4DR7Q 2IA6A 3A8IE 1G291 5C3XA 1HR0Q 5EWGA 4HIOA 3PUZA 2L15A 5C44B 1FVIA 4X64H 3T5LA 1ILQA 2ZXOA 1HNXQ 1G2TA 1EUCB 1JIHA 2K5WA 1PZJD 4O3QA 4QWBA 1W3SA 5KFSA 5L1IA 2B2UA 3EYYA 1X54A 4OL7A 5KKNB 1CS0A 4DL6A 4DN4M 5KFPA 5D8DA 4LF6L 1JDBB 2A5HA 2MGSA 4KKUA 3GTGH 3GP7A 2AQ3B 1XNQH 3I7FA 3ZJYC 2N8NA 3L4KA 5H1SE 4DR6L 3I4MH 5KFOA 2CW0C 1TXYA 4AYBB 1NR2A 5F9NA 2DJFC 1PH2A 4YWMA 4G7HC 1CQFA 5CBEE 2WAQG 2FHTA 4J15A 1Y1WG 3H0GB 1VQ9A 2VS1A 2NU7B 4RNOA 3T4AC 4A3DH 2I5HA 2JN4A 2JEAI 2UUBL 4B9WA 4M9UA 3PO2H 4YCVA 1KXLA 3PN1A 2JA8B 4BXXH 4JI3H 3HS0C 3PW5A 1ET9A 5KX5F 1DYQA 4LH6A 3BVMA 5DM73 2AHOB 3I4NB 2DY8A 5FOBB 2BQRA 1H9KA 2L0CA 4V0BA 3HOXB 2E5LL 2SNSA 4DR6Q 3CMAA 2BH2A 5C44H 2EJGC 3H91A 3AFQA 1YJ9A 2FE3A 4BBRG 1JORA 4J0MA 3BYYB 3FPUB 3RBEA 3NEMA 1WVLA 2R7NA 4RUCA 2KEDA 5ELBA 3KLSA 3V4ZA 2F4IA 1G8ZD 4KHVA 3BQ1A 4I7HA 1STEA 1JLLB 3MR2A 4PWQA 3S1NB 3T5KA 1EU4A 3T1YL 2UUBQ 3M4QA 2JA5G 1T94A 2FINB 2CH4A 3GDEA 4IO9A 1CTMA 4KLKA 1P8LA 2CCZA 3KFUA 4RNMA 4DV7H 1I6HB 3PW2A 1U4RA 1AW7A 4GKJQ 3H0GH 2B2VA 5BMVF 2JXMB 2MQHA 3EBEA 4DV5L 4DUZQ 4R8UB 4DK6C 4UY8C 1VAJA 1EQTA 1LM0A 4IOAA 2JA8H 3K58A 3WO0A 1RD9D 4JV2A 4Y7NH 3FP9A 3HOYB 1UEAB 5C8YF 1N8RC 4A3JG 3T16A 1PTOF 1SE2A 2RBMA 5DLQE 3BZKA 4AYBA 4MNOA 3IN5A 4EQNA 1I94H 1KLGD 1B8AA 1PRTC 3K5IA 5JEAH 1UE1A 3Q8QB 3PF4A 3CCRA 5KG1A 3AU7A 3ZYYX 3JAML 3GQCA 1CHQD 1BUVT 1UC9A 5KT3A 1X6OA 5D65A 1VBHA 1VQ4A 5D3IB 2XWJB 3S1NH 4ED0A 2SEBD 4IJLA 3W1GA 1XPOA 4DV5Q 1HNWH 1BCPF 4LFBL 4QY7A 5K5PA 2SOBA 1SROA 2VQEQ 3NPPA 3J7ZC 5F2DA 1GD7A 1BCPD 5KFXA 2J9GA 1I6HH 2RDJA 2RDFA 2IMWP 4A3MG 3I55A 5BPHA 3IFDA 2VQDA 4APMA 5FLMG 1SE3A 4A4IA 3C46A 5CV7A 4JI0Q 4A2BA 1EY9A 3L7ZC 2CQAA 1YHAA 2ZM6L 4A3CH 1XYIA 4DV0L 3DWQA 4A76A 1CFMA 2K03A 3X3NA 5ELOA 3TIGA 1VF5C 2B63B 3KYHC 1R9TB 1B9MA 4CDFC 4AH6A 2HHHH 2H1EA 5KFTA 4Q8EA 3HOYH 2R8IA 1I3QB 4JI1L 1GUSA 5CC4A 4A3BG 4F4WA 1FR3A 4KJNA 1RL2A 1PRTB 1IL2A 1BF4A 3JAME 2EE1A 1RCVD 1Q1EA 4K0KH 1TWCB 3CPWA 3CCSA 1ZHQA 5ELCA 2F0NA 4YR3A 4WJWA 4LFBQ 3SI8A 3L9AX 1F2YA 5KYIA 3J81W 3KBXA 1QVGA 2AGPA 2PCFB 1A15A 4A3IG 4FBUA 1KD1C 3HOZG 4JI5H 1AEXA 3PW4A 4Y8VB 3D4DA 2I87A 1EZ8A 4HIDA 4R8UA 1N34H 3KDFB 2WYOA 1MSGA 2A1AA 1K73C 4IWXA 2C2RA 2ZM6Q 3KJPA 1AE3A 3VYSA 4PMBA 2J4XA 3OTOH 1O7IA 1PYBA 2K1BA 2IX3A 4XQQA 4ECWA 4JI8L 2NVXB 3CP0A 2GA4B 5HV6A 3OSPA 1YNJD 4ULLA 2EY2A 3DMUA 4JV0A 2PZWA 4K5XA 4X66H 1EYDA 1ESFA 2Y0SA 4JV5L 2C5CA 5M3FG 2I8CA 1L1OC 4ALPA 4KD3A 2HD3A 1DIKA 2KA7A 3SXHA 4O2AF 2PBZA 2K5QA 4JI7L 2B63H 5I2XA 1R9TH 3V6HA 2XRSD 5JVLA 1I3QH 4C3IB 4ZKCB 1MI2A 2MO1A 1Z9FA 2J0TD 1B44D 4DK0A 1NAPA 5LL6X 2E2JB 4ECUA 2UUAH 3PUXA 1ASYA 1TWCH 5J1ZA 1KDAA 4C56C 4DXFA 3GIQA 4FXGC 2NN6G 1Y8PB 1SNMA 4TRDA 3VPCA 2J6TA 3EFXD 3TQTA 3HKZE 2F0VA 3KBGA 2VZAA 1SYFA 2MHVA 1VQ6A 4DLKA 5T1IA 2VW9A 4LFAL 3UFXB 3LNNA 4L5RC 5GAEC 2VQFL 2ZT9C 3BVZA 4LF6H 5EKLA 4JG2A 1SYBA 4IPDA 4JV5Q 2B63A 4IOCA 1R9TA 1X55A 4PZ8A 2L9HA 2WB1E 4JI4L 3RFCA 4KY6A 1RJTA 4JI7Q 1L0YB 5EZYF 3BQ2A 1I3QA 3KLWA 1IBLH 3MXNB 4K5WA 2X6GA 2NVXH 3V4SA 3MWMA 2HVRA 3HBLA 1B3QA 1FNVA 5CMDA 2EVBA 3MR5A 4DL4A 3TS0A 3RB3A 1L1OB 1TWCA 1C9OA 1HQMC 3F8TA 3QR8A 1IKMA 5FD6A 1FJGQ 5KG6A 4DR3L 3WOEA 2JA6G 5EAYA 4DR1L 2EJFC 5C4ZA 1WTQA 2ASBA 4XIGS 1LT6D 3E0EA 5IT9L 3L0OA 1OXXK 4QUFA 4V190 4DGZA 5HGQA 5JVH3 2F0KA 4C3IH 3KDFA 2F4VQ 3R8BA 4LFAQ 4YJ2F 3N6XA 1I4PA 4JYAL 4P71A 2E2JH 1CT1D 2R8GA 4N8X1 5C1OA 1EWHA 4LFCL 2E5LH 2NVXA 1LTBD 1NBWA 5KFCA 2QF7A 4NPSA 4M1UB 2I46A 4RNNA 3K5HA 4K8JA 4BBRB 3I8ZA 3A56A 3F2CA 1NUCA 4DL5A 1I7LA 1M4VA 3NHHA 4DAYB 1PTOH 4ED3A 1EFID 5FJ8H 5DGBA 5IGCA 1I4XA 1S5DD 5BPFA 3VPDA 1KDBA 1NTGA 1SYEA 1V43A 3T1YH 4ABNA 2I5LX 2Z6KC 2JA5B 1YI2A 4JI2L 3P7JA 1IOWA 3W5OA 4XZ3B 4I7AA 1STAA 3N8DA 2Q8IB 4YHHL 1WTHA 2K05A 1KAWA 3PR5B 2JEGA 1V1OA 3V96A 3A5ZB 5C0XG 4ZRZA 2K32A 2F03A 2EYFA 2F0GA 1IXRA 4OGQC 4XYOA 2PQEA 4DL2A 2UXDQ 1C4QA 4HCSA 2R7MA 2MPMA 1VQJA 2ALZA 4Q5VA 1XTDA 1YNNC 5D14A 1DOLA 3BZDB 3PIPA 5M5WB 5C4XG 5BR8L 3RGZA 1S5BD 4WJ4A 3Q8PB 4GNXC 2A6HC 2I0QA 3MXNA 3U50C 1ZHSA 3K7UC 3T51B 5C3WA 3TDQA 4HIMA 5L37A 4R4QA 1VS0A 3AYHB 4FF1A 2DWCA 4MV9A 5DLGA 4JI2Q 4ECZA 4BBRH 5GQOA 2Q8TA 1OXVA 3J80c 2XWBB 2RSNA 3QOJA 4X65H 4YHHQ 5C0XI 4GS3A 3SK5A 4BA2I 1O7YA 3SEBA 4J9OA 1MD2D 4RGTA 5BN5A 3RAXA 2LXJA 4L6TB 1CKNB 3GO5A 5KFAA 3W1BA 5LA6F 2Q2UA 2KJXA 3NBHB 5EPKA 2JA5H 3ITPA 4HMIA 2K04A 3OSNA 2ATLA 1B4OA 2JEIA 1F9SA 4J9SA 1S10A 4POGA 5IP9H 3P20A 3FPPA 4CDCC 4PV1C 3CCEA 4A3MB 2JYOA 1KAAA 1GUWA 2JA7G 4JI6H 3RB6A 1AZPA 1Z2PX 1FGUA 4DV0H 1STHA 2Z8LA 2FPPB 1QNUA 4NW2A 2C22A 3A55A 3PMFA 2AWOA 5KFWA 4DAYA 4DL7A 1EIGA 5C5JA 1PXUA 1TWHA 4X3UA 4UCSA 3M4OB 1QWYA 2QA4A 1HCZA 4GZYC 4GNXB 5IWAL 4JI1H 1JWUD 2BA0A 4A3JH 1S40A 5M5WH 2FLNA 5DG9A 2V58A 4PNYA 1YVCA 2IHEA 2OWOA 2FMCA 2JA5A 3MFHA 4TQUS 5FLXW 4JC0A 3CKIB 3ORRA 5CA1F 4QQBX 2LY7A 4GLVB 1D5MC 1IBKL 4JI3L 3HOZB 3NWSA 4X64Q 3M9BA 1OTCA 2W9BA 2ES2A 4YWLA 4HJAA 2Z9HA 3RD4A 2K28A 3P1HA 4IUNA 2CW8A 2B2YC 5IYDG 2CH4W 3OW7A 4GOPC 4EFEA 2BE5D 1O7ZA 1V51A 1XNQQ 1CUKA 4DV1H 5ELDA 4HIKA 2Q2TA 5FPRA 4JI8H 4QWDA 4MTNA 5EKKA 4A3MH 3R5HA 2YZMA 3JRXA 4FF2A 3TS2A 4MTDA 3JZIA 1E7ZA 5FLXE 4ODGA 4B3RH 4TKOB 5IGGA 1KC8C 2F0TA 2KUMA 1WI5A 1BXTA 3P75A 3NSWA 5LYJF 4AIMA 3M4OH 3QFFA 3KF6B 2Z6KA 4JI3Q 5DGAA 4GLXA 3H15A 5C4JB 3HOVB 2IL8A 4JUZA 2O5IC 3AFPA 1JT8A 2F0MA 4UP9A 3H20A 1SJHD 4IUUA 4JCVE 3NBHA 1FNWA 3Q8RB 1F2LA 1FNUA 1PFBA 4LF5H 1L2FA 3NK9A 1OXUA 3J7AF 1DXMA 2FPIB 5I2YA 2HIVA 4RB3C 1PZID 4XT1B 4XYQA 1X65A 3QIAA 3VYTA 3HOZH 4P73A 1PH1A 2IP4A 5JQWA 3PIO3 3FVQA 3UQ8A 2YS6A 4GOPB 1Q8KA 1WH2A 1FD7D 3M7NA 2XD4A 2DLNA 1TAEA 2E8GA 1W93A 1YIJA 1WD1A 2VQFH 1S0MA 1DOKA 2R6FA 2OCEA 4RAUC 5KT2A 4OX9H 4QIWB 1MKHA 2E2HB 4JI4H 3Q1KA 4KTAA 4DF7A 4A93B 3QO2A 5KNDA 2ZJTA 4CHTB 1U5KA 3A74A 4KN4C 1RKNA 3R5FA 2XCLA 4DV7Q 4AYBE 1QCBD 3DM1A 1GUTA 4RGMA 1U4MA 4DNTB 1WTRA 2IWHA 4TUYF 1EY5A 4DR3H 2JA6B 3CRKC 1EU3A 3BDCA 4DR1H 4ED8A 5NUCA 1B3AA 1C48A 1XWEA 4FP5D 4L5SA 5KT4A 3URYA 3KLRA 3RTXA 2ZJPA 4K8IA 5LP6F 1F9RA 5LMNW 1TS2A 2XCPA 1LT3D 1E0BA 4HSPA 4P72A 5IP7H 5C4JH 1Y8NB 3GQBA 1CKOA 3HOVH 4MV4A 3K5OA 1JQYD 1VQLA 2LMCB 2A8VA 4JYAH 2V4QA 4KK7A 1Z7TA 1C0AA 2EYHA 2PPBC 5KFRA 1PYWD 3SDZA 2R7DA 3U9OA 1IL8A 3VR3A 3S14H 1HH2P 4I4TF 3QB3A 2NN6H 5CV9A 2R93G 4F87A 4LFCH 4IPGA 1I94Q 4DFAA 4ME6A 5EGTA 3A7LA 1ENFA 2K50A 4C3JG 2B2WC 5KFVA 1AN7A 4ZHQF 1DV1A 1ENCA 2W6QA 2KSWA 2A68C 5KFNA 3FKIG 3BJYA 5G3LF 3JAMi 4YQWA 1PLFA 3SVMA 2XIWA 4OWWB 1HA6A 1SSOA 5DAUA 2W71A 3BVGA 1W96A 4U68A 2Z4IA 3H3VI 2E2HH 5GAGC 1I6VC 1A62A 1SE8A 5CORA 3M85A 1HNWQ 4G7OC 2CQYA 4Q0YA 4HQ6A 1VQCA 1A6XA 1EWCA 3CC4A 3D6WA 4DKAC 2R61A 1EY8A 1CZWA 3V6KA 4G3IA 3STBD 1N48A 2JA6H 5JUMA 1N34L 2E76C 1CSQA 4O0AA 3AQQA 4ZUJA 4FVMA 4P2CB 4Q43A 1IBMH 4LF9H 3GTGB 2I07B 2E2DC 2ICIA 2R7ZG 2B2YA 1C8CA 4IR9A 2I80A 1A3VA 4YAKB 5IYCG 3TN2A 2X0SA 4UCRA 3K57A 1PH4A 1I5FA 3D6CA 2BCOA 2HHHQ 1HR0W 2WP8J 4MV8A 1RK5A 1PH3A 4QIWA 4L5TA 2E2HA 1RJPA 5BR8H 5TSSA 3KHLA 1OO9B 4X66L 5HY6A 3HOWB 1K8OA 4FBTA 2MP1A 1HZ9A 3HZXA 4K0KQ 1GUGA 4RMFA 2AU0A 1Z47A 3TREA 3BU2A 4O2BF 1N33L 1VQEA 3A0JA 1LTAD 4GN4B 3EN2A 2KEEA 2JA6A 5I9OA 3K5MA 3CCQA 4QF4A 4JI5Q 4MV7A 2EDGA 4ED7A 3NENA 1EUJA 1N9WA 1S3OA 1X3FA 1N34Q 4YWKA 4BY7B 5K2MA 1NR4A 1JWSD 3FHWA 5KFEA 3I73A 4UHVA 3I91A 1PV4A 3S2HB 3OTOQ 4G7ZC 1TWFB 5CV4A 1B53A 4HR7B 3NTIA 2J7ZA 2B39A 4LUOA 2EYLA 1PH5A 2VUMG 1M90C 5C0XH 2JA7B 3D3RA 4X66Q 3CCJA 1STYA 4HEDA 4MV1A 1WTPA 3KTMA 1AN8A 1QZGA 2Z1CA 1TWGB 2ASLA 1TWAB 3A8JE 1IBLL 4O42A 4B3SH 4QW8A 5IWAH 1BJTA 1RYSA 1XMQL 1E2ZA 5A35A 1M1KC 1ZYRD 3IRBA 2NVQH 3HOWH 2UUAQ 2B29A 3H6MA 2V9WA 3UI2A 3J7YW 4DR2H 2G5DA 4H44C 2DPJA 1XX8A 1Q7YC 1IBKH 4RU9A 1Q86C 4Y7NB 3K8AA 4IFDJ 3I72A 2RHSB 5DEHA 3S1QH 1QJOA 4O4HF 3GTGA 3CCMA 4BY7H 1Z2NX 4X62L 4P74A 4LF6Q 2F0PA 4RZQA 4XDXA 2DIKA 1Y8OB 1CK1A 1IW7C 4GN3B 5CBAE 3WO1A 3LWUA 1ESRA 3CPFA 3S2HH 1QVFA 2V4DA 1TWFH 2UUCH 5KG5A 3BG5A 4I55F 1IBLQ 1K8AC 3J7AV 2HIXA 3CVZA 1I50B 1SNDA 4LF8H 2OH2A 2JA7H 2B2WA 4IFDI 2L4NA 1PH7A 3PIP3 4CC5A 2B3GA 1DD2A 2F0JA 4HMJA 1BBUA 1CZGA 3CW2C 1WFQA 4R8IA 4E6IA 1TWGH 1TWAH 1CE8A 1TKWB 5JPNC 2F0DA 2FB9A 1M7JA 4FXDA 5EDWA 4R4TA 2Q2IA 2OQ0A 5CV8A 2BH8A 1TS3A 3MWDA 4DAPA 3GIKA 2XN9C 1TY2A 1PFNA 1TWFA 1KBLA 4HR7A 3BABA 3RR5A 4ECYA 2M05A 1TQOA 4KY5A 4TQRA 2E5LQ 5E1FA 3DM3A 1I4RA 2F0QA 4BA1I 2WIIB 3CC7A 3R5XA 5KFJA 1KNEA 3SGIA 2JA7A 1GLVA 3SK4A 1HNZH 1G51A 1EYGA 2V59A 1VMPA 5KG7A 4FXKC 4O1NA 5KG3A 2LS01 5LXTF 2YV5A 1PK8A 1G91A 5HURA 2R92G 1EWIA 1CA5A 1E4GT 1TWGA 4UPAA 5KFLA 3T1YQ 1GM5A 1YJNA 1GYFA 4DPGA 1BR9A 1HRJA 2PW7A 1OWTA 2UU9H 3FMAA 5JJKA 1D8LA 2ZJQA 1KJIA 3QWNA 1I50H 3LWBA 3H0GA 4X65L 1UE7A 2RSOA 3CCVA 3L3OC 1B9NA 1NNXA 1PH8A 1PH9A 3JAMW 3GIJA 2DPIA 4CKEA 3PCOB 1WTWA 4JV1A 1B1ZA 5FK9C 1EQVA 5IGDA 4ZI7F 3KHRA 1KHIA 4TVAB 4IRDA 3H40A 1R4PB 2AUJD 2FKLA 4R4IA 4YCUA 3VPBA 2C2EA 4RCOA 2XGQA 1K3BC 4DAVA 1DM0B 5JOBA 4I50F 4JI6L 1KJQA 2XCAA 2R93B 2CVRA 3VDYA 1I50A 4CGYB 1D1KA 4JBJA 4C3JB 4UP7A 2HDMA 3HKZG 1JB3A 1LTRD 2XTIA 2PI2A 4X65Q 3BA9A 2UXCL 3C1FA 1DGSA 2R8JA 1TS4A 3RLOA 4FS2A 2GVAA 4YR2A 1SYGA 3EVQA 2W57A 4ME5A 4A3FB 2WB1G 3M9MB 4DL3A 3OHXC 4J9MA 1P16A 5FO9B 2NTTA 1SXTA 1WTXA 1IYJB 1W6KA 4J9RA 3OWEB 1LTSD 1L0XB 3WOFA 1YBYA 4J9NA 5LMUH 4R8NA 4JI6Q 4EBDA 1VQFA 2MO0A 5DQIA 4J9QA 3EQLC 3RB4A 1N56A 1PA6A 1E3PA 4DV0Q 5IOCA 2JA9A 1PTOC 4B3TL 3T5HA 4DV1L 2R3ZA 4LH7A 2CFMA 3C3LA 3QOLA 1A2UA 5KRUA 4JI1Q 1RF2D 1YITA 1X3PA 3TZUA 1OXTA 5KIXA 3OUZA 3FMCA 1S5FD 1K28A 2R93H 1VMCA 3FDSA 2HUGA 2N78A 4B3RL 2BQ3A 3Q6SA 4C3JH 2WACA 4TQSA 3ORQA 5EQ0A 3MEFA 1N33H 5KFMA 1BCPC 4OEMB 1EOTA 1VQKA 1QOHA 4OO1G 2BR0A 2QDLA 2DY7A 4EQPA 1LV9A 1SYCA 2Q8RE 1TU2B 5T1GA 4K2LA 1PH6A 1AZQA 3PQIA 1XPRA 4HJ7A 4A3FH 4LF5L 5EOYA 4NKLA 1ZXTA 2D62A 2CHBD 5C6AA 1AFPA 1LTID 4DV1Q 2VA2A 1ICFB 3GTKH 2JQOA 4O3PA 1S4ZA 4JI8Q 5L1KA 2VUMB 2KOLA 1VQ8A 4AQYL 5A2QL 3TSSA 2W7PA 4LF4L 1TVXA 3MFYA 3TZDA 1PTOB 1JR0D 3VR4A 1BGWA 4ETSA 4DV3H 3J80L 2NVYB 3DEPA 4A3KG 4OX9L 4R4CA 4BY1G 4B3RQ 4WD3A 1KL9A 5IYCH 4EEYA 3TIIA 2VB3X 2K5VA 2IJ0A 3IAYA 4U6PA 1K8GA 1X56A 5KNCA 4OO1I 1BDOA 4IJHA 5KGUA 1ZQ7A 5D1OB 2PNRC 2QK4A 4MZ9A 1XMQH 2WAQB 2OTLA 4ECRA 1Y1WB 1FGBD 2L11A 1N32L 2D0OA 2EYMA 2FK1A 2CWPA 4FM9A 1BCPB 4LF5Q 1ET6A 3RBDA 4EQOA 2F0HA 2E75C 2F52A 2K52A 2M9VA 1WOCA 4GC6A 3Q8DA 2HCIA 2AKWB 4DNRB 3K3VA 1W6JA 1BXRA 1RJQA 2HCCA 3E5SA 1VQPA 4FYDA 5IT9W 3MEHA 3E9IA 1YNJC 4ZUIA 1QVCA 2F3WA 2NTSA 3K0YA 3K81C 2VQFQ 1GGOA 4X62H 4C5BA 1S68A 3BQ0A 5A2QE 4MHEA 1JDEA 2A69D 1M8AA 3G6EA 2KENA 4OX9Q 3GTPB 1UNNC 3J80E 1A3TA 4JI4Q 2XRQD 3LMLA 2NUCA 3HP3A 5IY0A 4F50A 2VUMH 4RKLA 1VKZA 1FL0A 2DUDA 1RTNA 5C4HA 1ASZA 3RV3A 4R1JA 3K7AB 3CRLC 1T36A 2NZHA 2W70A 2NVYH 3J81c 4DR3Q 1I4HA 5L1LA 4DR1Q 2G9HD 1VQAA 5LOVF 2UVWA 3E3XA 2XGTA 2VR1A 4DAMA 4XTCS 1SE4A 2KHIA 4EQ5A 5IT9E 2UVUA 1GOZA 1EQRA 1JJCB 4OIKA 4H7BA 1GVPA 2AQ2B 2SCUB 5AFWA 1Y1WH 1EYAA 3EROA 3PZPA 4JYAQ 4YCWA 3F8NA 4DV4L 4PZ7A 1MZBA 5C1PA 1OXSC 4JBKA 3JC66 4KHPH 4H0LC 4LF9L 1IBML 4LFCQ 3ONAB 3CAMA 3EPGA 3GD7A 4HNVA 1K83B 1GO3E 4ZCKA 3RUZA 2F0SA 4KN7C 5CA0F 3T1HL 5CB4F 4IRCA 2F1MA 2R7FA 4MIUA 3KOJA 1ML0D 1UAPA 4UCUA 2HJWA 3GV7B 1K0RA 2NVYA 2QW7A 1CQIB 3UDXA 5J3BA 4A3JB 3S15B 2MFIA 1J8IA 3MWEA 4CJ1B 2L55A 3VYRA 3GTPH 5KG0A 1MIUA 4QIWE 1ULZA 1L1OA 2WAQA 2ENBA 1Y1WA 1PHJA 2ASDA 2RGRA 1DJRD 2ZDGA 3RN5A 3DWAA 1VQ7A 1B04A 3MJFA 1SCUB 2O2LD 3K7AH 3KF8B 1M0WA 3S24A 2FK2A 2VUGA 4LF9Q 2O03A 2FXQA 5DNFA 1IBMQ 1BO0A 1Q82C 3SHLA 1EL0A 2VA3A 1VQIA 2YCHA 4NLGA 1EYZA 1PDQA 5AJ3L 4TSSA 4J9LA 1XJVA 4CBVA 1B70B 3M4PA 4KHZA 3U4ZA 1K3RA 3UE1A 2DGYA 3TEHB 3RLNA 4YP3A 1WR2A 3GV8B 3DWPA 3GTPA 5BR8Q 1Q8IA 1LT4D 1SBBB 2XSCA 3HGBA 3AEVA 2C2DA 1BVSA 2KHJA 4OIJA 5M9OA 3H4DA 4RA8A 1K83H 3ULLA 2YS7A 4K6DA 2PNHA 4L8JA 3T5JA 1I6UA 3HG9A 4C5AA 4B3MH 3OHBA 1XMOH 1XPUA 1CSPA 3AB9A 4B3SL 2UXCH 1H9RA 4A3BB 2CKZB 1JE5A 1HJPA 2AMCB 3Q22A 3S15H 3Q2OA 2RHQB 4ZOLF 2W8LA
chains in the Genus database with same CATH topology
1AE2A 4DV6L 3H0GH 3CC4A 2MQHA 4DKAC 2PQAA 2A19A 4DR2L 3EBEA 4DV5L 3HFZB 4DUZQ 4DK6C 4UY8C 2F4VL 5AJ3Q 5M5XH 3STBD 2R6GA 1LM0A 4NXML 3U4VA 1N34L 2JA6H 4IOAA 1CSQA 4O0AA 2JA8H 2KCMA 3AQQA 4Y7NH 3FP9A 4AYBG 3ER0A 2R7ZG 3CCUA 4BBRG 4IPHA 5IYCG 1N8RC 4A93G 3GTLH 1PH4A 1I5FA 4A3JG 4AQYQ 3DLLA 5DLQE 2HHHQ 1HR0W 4LF4Q 2WP8J 4L5QA 3BZKA 3PO3G 2OTJA 4MNOA 1PH3A 2UUCL 1X3EA 4L5TA 1E22A 1J5EL 1B8AA 1VQNA 2IY5B 1UE1A 4X66L 5HY6A 4B3SQ 1J6QA 1HZ9A 2ZTCA 3CCRA 5IWAQ 1B7YB 1EIYB 4LF8L 3PF4A 4K0KQ 4DR5L 2NN6I 4RMFA 2QGQA 5FLMH 4DV2Q 4NB3A 4HJ9A 3G48A 2JA8G 1Z47A 4WJ3M 3TREA 1X6OA 4DV6Q 3BU2A 1VQ4A 1N33L 1VQEA 3A0JA 4GN4B 5M3MH 3S1NH 1WYDA 3EN2A 4IJLA 4DR2Q 3W1GA 1XPOA 3CCQA 4DV5Q 3I4NG 4JI5Q 4DR4L 1VQBA 4LFBL 1N32Q 1SRUA 3NENA 1EUJA 1N9WA 1S3OA 1UE6A 1X3FA 2JEBI 4IPCA 4QY7A 4YWKA 3HOXG 1N34Q 1SROA 2VQEQ 3J7ZC 3I2ZA 4A3BH 1GD7A 4A3LG 2KCTA 3FHWA 3HOUH 1CKNA 1I6HH 1PV4A 1KRSA 3CMEA 3OTOQ 2IHFA 4A3MG 3I55A 5GADC 4X6AH 4LUVA 5FLMG 2UXDL 4A4IA 3NELA 4JI0Q 4LUOA 1PH5A 2VUMG 3L7ZC 2ZM6L 1YHAA 1M90C 4A3CH 1VQGA 4DV0L 4A76A 1RIPA 2UUCQ 1QUQB 5ELOA 4A3IH 3KYHC 4X66Q 3CCJA 5JEAJ 1HNZL 1NY4A 3E9HA 4AH6A 4LF8Q 1H95A 4OONA 5M5YH 1U0LA 1QZGA 3HOYH 4JI1L 4A3BG 4LF7L 1RL2A 5IYBG 1IL2A 1IBLL 1QZHA 1VQMA 1Q1EA 3CPWA 3CCSA 4DUYL 4DR4Q 4APVA 2BA1A 4PMWA 4GNXA 1XMQL 4LFBQ 2ATWA 1M1KC 1J5EQ 2UU9L 3IRBA 2NVQH 3HOWH 4PG3A 2UUAQ 2B29A 2YU9H 1QVGA 2CQOA 4A3IG 1KD1C 1Q46A 3HOZG 4JBMA 3M3YH 1Q7YC 3KJOA 1GKHA 1SR3A 2EIFA 5M3FH 4HIDA 1YJWA 3KDFB 2A1AA 1Q86C 1K73C 3I4MG 2ZM6Q 3KJPA 1AE3A 3K8AA 3PUWA 4IFDJ 4DV4Q 2RHSB 3S1QH 5C0XJ 1Y14B 4A3EG 3CCMA 1O7IA 4BY7H 1PYBA 4X62L 2UXBL 4P74A 1HNZQ 4LF6Q 2Y0SG 4JI8L 3CP0A 1XNRL 3RN2A 3HOWG 1UWVA 4GN3B 3S2HH 3CPFA 3RNUA 3UDFA 3T1HQ 1TWFH 1QVFA 1VCIA 4A3DG 2CWAA 1IBLQ 5K36G 4DNIA 1K8AC 2HIXA 4JV5L 3PO2G 4GLAC 5M3FG 2JA7H 2CCZA 1L1OC 4ALPA 1L0WA 4BXXG 4IFDI 1G6PA 5LMNL 1TWHH 5E7NA 1PH7A 2UU9Q 4JI7L 2K75A 1R9TH 4NXNL 2B3GA 2B63H 1YJ9A 3HKSA 5FLXc 1Q81C 1BBUA 4BY7G 1I3QH 3CW2C 4OXPA 4BBSH 1WFQA 1TWGH 2K5NA 2MO1A 1TWAH 1Q12A 1YZ6A 1Z9FA 4BY1H 1NE3A 3PUXA 1ASYA 1KIXA 1TWCH 2PI2E 1HZAA 3KF6A 2Q2IA 4LW1A 4R4TA 5C44G 2OQ0A 4X64L 2BH8A 1YHQA 2R92H 1LYLA 1KRTA 2NN6G 1E1OA 1X3GA 5IT9c 2UXBQ 4OWTB 3HKZE 1XNRQ 3RR5A 3UE0A 2VZAA 2E5LQ 1WCMH 3DM3A 5C3EG 1VQ6A 1EIFA 4BA1I 2VW9A 3CC7A 5LMUL 4LFAL 4L5RC 3CXCA 1XNQL 5GAEC 3SGIA 1CKMA 2EQSA 2ZTDA 2VQFL 1G51A 1QUQA 4JG2A 1EYGA 4IPDA 4JV5Q 4IOCA 1X55A 4PZ8A 2HQLA 5GAHC 2WB1E 4JI4L 4GOPA 2YV5A 4JI7Q 3KLWA 1EWIA 2R92G 3MXNB 2NVXH 3GTOH 1YHBA 3S1RH 3H0GG 4UPAA 3T1YQ 1GM5A 1YJNA 2EXDA 4DPGA 3TS0A 2ALYB 1L1OB 1C9OA 3F8TA 2JK8A 5JJKA 1D8LA 2ZJQA 1FJGQ 1E24A 1VQDA 1I50H 4DR3L 3RZDH 2JA6G 5EAYA 2GVBA 4DR1L 4X65L 4ME3A 1UE7A 2GN5A 2ASBA 3CCVA 4XIGS 4DR7L 3E0EA 1JB7A 5JJLA 3BJUA 3L0OA 1PH8A 3GTQH 1PH9A 1OXXK 1SLJA 4PZ6A 1HR0L 5HGQA 3I56A 3GTMH 3PCOB 4C3IH 3KDFA 2F4VQ 2YYZA 1KHIA 3K0XA 4TVAB 4LFAQ 5LMUQ 4NXMQ 4P71A 3TQYA 2E2JH 4JYAL 5JEAG 5JJIA 1LUZA 4O2DA 4R4IA 4YCUA 4LFCL 2KBNA 1NBWA 4RG1A 2NZOA 4NPSA 2IT1A 4JI6L 4Y52H 2N3SA 3F2CA 3A5UA 3U58A 3PF5A 3CC2A 5M3MG 4DAYB 3VDYA 1VQOA 4DV3L 4JBJA 5FJ8H 4UP7A 3HKZG 2XTIA 4DR5Q 2JJQA 2PI2A 4X65Q 1N36L 2UXCL 1NTGA 1V43A 1D7QA 1DGSA 1S72A 2I5LX 3RLOA 4DV7L 2Z6KC 2GVAA 1Q1BA 1IZ6A 3CD6A 3HOUG 1N33Q 1YI2A 4JI2L 1AH9A 3OYYA 4H02A 3W5OA 4YHHL 5C4XH 1KAWA 3STBC 2WB1G 4IFDG 4A3CG 3A5ZB 5C0XG 1P16A 4B3TQ 3F2BA 5FJ8G 1IYJB 1IXRA 1Y1VH 3J81j 3S1MH 1YBYA 2YTXA 1EOVA 3HOYG 2UXDQ 3PUYA 1JJ2A 3EIVA 4JI6Q 1VQFA 2MO0A 2WFWA 1E1TA 2IX1A 1VQJA 1PA6A 3S17H 1E3PA 4DV0Q 3J7A5 3S2DH 1XTDA 2JA9A 4P75A 4B3TL 3B6YA 4DV3Q 4DV1L 3ICEA 3J80i 3PIPA 1I94L 2CFMA 5BR8L 4A3GH 5C4XG 4WJ4A 2K5HA 1A63A 3UDGA 4GNXC 1N36Q 2K4KA 1UEBA 2I0QA 4JI1Q 3U50C 1VQHA 4QL5A 3K7UC 4HIMA 1YITA 4LF7Q 1OXTA 1VS0A 3AYHB 4R4QA 4JI2Q 1X9NA 4JBWA 5GQOA 4BBRH 2R93H 1OXVA 3J80c 1HZBA 4DUYQ 2N78A 4YHHQ 4B3RL 1XMQQ 2ID0A 5C0XI 1V1QA 4C3JH 4GS3A 1HNWL 3G71A 4BA2I 3UDIA 3MEFA 4GKJL 2LXJA 2D0PA 1CKNB 3GO5A 1VQKA 3W1BA 1UE5A 2LSSA 2K14A 4OO1G 2Q2UA 4A3KH 3NBHB 2JA5H 4DUZL 1V9PA 4R4OA 3ULJA 1NMFA 4EX5A 4POGA 5IP9H 1PH6A 4LF5L 1XPRA 4LUZA 4HJ7A 4A3FH 3CCLA 2D62A 3CCEA 3K80C 2C35B 4X62Q 4DV1Q 2JA7G 3GTKH 2JQOA 1SN8A 4JI8Q 3D0FA 3PGZA 4UP8A 1PFSA 2Z0SA 2B63G 4KHPL 1VQ8A 4AQYL 1FGUA 2HHHL 3CQZH 4LF4L 2F3IA 4JOIC 2AWOA 1SFOH 2I5MX 4BBSG 4HJ5A 4A3KG 4C3HH 3F2DA 4OX9L 4R4CA 4BY1G 2QA4A 4B3RQ 4GNXB 4A75A 5IWAL 4LNQA 1KL9A 5IYCH 5IP9G 5LMNQ 2HT1A 4A93H 2K5VA 4K0KL 2BA0A 2RF4A 4A3JH 5M5WH 4A3FG 1S40A 1K8GA 4NXNQ 5IYDH 1X56A 1VQ5A 1YVCA 2IHEA 3PO3H 4OO1I 2OWOA 4IJHA 2IX0A 4TQUS 5IE8A 3OW2A 4JC0A 4MZ9A 2OTLA 2VNUD 3BZCA 4JI5L 2R93G 4QQBX 1WCMG 2D0OA 4GLVB 1N32L 2Q2HA 2CWPA 1IBKL 3D31A 3WWVA 4LF5Q 1WJJA 4JI3L 2VQEL 4X64Q 2OQKA 3M9BA 1MJEA 1OTCA 2AWNA 1C7YA 2F52A 2ES2A 2N49A 2K52A 1WOCA 4LWCA 4YWLA 3Q8DA 4HJAA 2AKWB 2JE6I 2WAQE 3OTOL 2NVTH 1VQPA 4KHPQ 3I4NH 2H5XA 5IYDG 3E9IA 1JJGA 4HJ8A 3L2PA 4GOPC 4JI0L 1HNXL 4QJFA 3HOXH 1QVCA 2LXKA 1CUKA 3K81C 3PSIA 2VQFQ 1XNQQ 2PMZE 4HIKA 2Q2TA 3PUVA 4A3LH 3G6EA 2RCNA 2KENA 4OX9Q 5ELNA 4MTNA 4GN5A 4JI4Q 4A3MH 1T9HA 3J81i 5IY0A 3TS2A 3ERSX 2VUMH 1K9MC 1E7ZA 1FL0A 1SMXA 2DUDA 2YTYA 5GROA 1ASZA 2Y0SE 1PYSB 2MNAA 2QEXA 1YEZA 4R1JA 3ULPA 1KC8C 1WI5A 4B3ML 2NZHA 2NVYH 3J81c 1A8VA 2ZJRA 4KI0A 4AIMA 4DR3Q 1XMOL 4DR1Q 2UUAL 3S16H 3M4OH 3KF6B 2Z6KA 1HZCA 4JI3Q 4GLXA 3H15A 1VQAA 4DR7Q 3PIOA 1KQSA 1JMCA 1HNWQ 3AFPA 1G291 5IYBH 2XGTA 4UP9A 1JT8A 3LGJA 4DAMA 3G4SA 4XTCS 1HR0Q 4HIOA 3PUZA 2KHIA 2L15A 2PQAB 4JCVE 4EQ5A 1EQRA 1JJCB 1FVIA 1GVPA 1W2BA 1NJIC 1HNXQ 3RZOH 1L2FA 1OXUA 1Y1WH 4GKKL 4JYAQ 1W3SA 4YCWA 2HIVA 4DV4L 4PZ7A 1X54A 3I4OA 1OXSC 1X65A 1A0IA 4JBKA 3JC66 3HOZH 4P73A 1PH1A 4LF6L 4LF9L 1IBML 4LFCQ 3GTGH 3CAMA 3GD7A 4GOPB 1Q8KA 3M7NA 2VL6A 3I7FA 1GO3E 2N8NA 2E8GA 3ZJYC 1YIJA 1NMGA 5H1SE 3T1HL 3GTJH 3TRZA 4DR6L 2R7FA 3I4MH 3KOJA 1TXYA 2OCEA 3H3VH 3CF5A 1BBWA 1K0RA 1MKHA 4OWXB 4A3EH 1PH2A 4YY3L 3UDXA 5J3BA 2MFIA 4YWMA 1LTLA 4B3MQ 2WAQG 1XMOQ 1Y1WG 1U5KA 4J15A 3A74A 2UXCQ 3GTPH 1VQ9A 2VS1A 2YTVA 2I5HA 1MIUA 4A3DH 4DV7Q 4AYBE 2JEAI 4QIWE 1Y1VG 2UUBL 1EQQA 2E2IH 1L1OA 3PO2H 1PHJA 4YCVA 1KXLA 4BXXH 3RN5A 1VQ7A 4GKKQ 4L5SA 3K7AH 1IBKQ 3KF8B 2ZJPA 3S24A 1PVOA 5LMNW 3FKIH 2VY3A 2AHOB 4LF9Q 4P72A 2FXQA 5IP7H 5C4JH 1IBMQ 1Q82C 1CKOA 3HOVH 4A3GG 1VQIA 1VQLA 2A8VA 1EFWA 2E5LL 4GKJQ 5AJ3L 4DR6Q 3CMAA 1C0AA 1XJVA 2R7DA 3F1ZA 5C44H 2BH2A 3AFQA 3S14H 1HH2P 1B70B 2V1CC 2ZTEA 3M4PA 1K3RA 4FDBA 2DGYA 4KHZA 3TEHB 3U4ZA 3NEMA 3RLNA 3UE1A 4C2MH 4DK3C 4YY3Q 4IPGA 1I94Q 5BR8Q 4QGUA 3AEVA 2K50A 3PV0A 1YNXA 4JOIA 1BVSA 2KHJA 5C3EH 3FKIG 3JAMi 1K83H 3ULLA 3T1YL 2PNHA 2UUBQ 5IP7G 4OWWB 3HOVG 1BKBA 3M4QA 1CSPA 2JA5G 1XPUA 4B3SL 2R7ZH 1FJGL 4IO9A 3GDEA 4POFA 2E2HH 4KLKA 3H3VI 5GAGC 3RLFA 1P8LA 1A62A 1MJCA 1JE5A 1HJPA 1SE8A 2AMCB 2CKZB 3M85A 4DV2L 3KFUA 3S15H 1VQCA 2RHQB 3JAMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AE2 A;  4DV6 L;  3H0G H;  3CC4 A;  2MQH A;  4DKA C;  2PQA A;  2A19 A;  4DR2 L;  3EBE A;  4DV5 L;  3HFZ B;  4DUZ Q;  4DK6 C;  4UY8 C;  2F4V L;  5AJ3 Q;  5M5X H;  3STB D;  2R6G A;  1LM0 A;  4NXM L;  3U4V A;  1N34 L;  2JA6 H;  4IOA A;  1CSQ A;  4O0A A;  2JA8 H;  2KCM A;  3AQQ A;  4Y7N H;  3FP9 A;  4AYB G;  3ER0 A;  2R7Z G;  3CCU A;  4BBR G;  4IPH A;  5IYC G;  1N8R C;  4A93 G;  3GTL H;  1PH4 A;  1I5F A;  4A3J G;  4AQY Q;  3DLL A;  5DLQ E;  2HHH Q;  1HR0 W;  4LF4 Q;  2WP8 J;  4L5Q A;  3BZK A;  3PO3 G;  2OTJ A;  4MNO A;  1PH3 A;  2UUC L;  1X3E A;  4L5T A;  1E22 A;  1J5E L;  1B8A A;  1VQN A;  2IY5 B;  1UE1 A;  4X66 L;  5HY6 A;  4B3S Q;  1J6Q A;  1HZ9 A;  2ZTC A;  3CCR A;  5IWA Q;  1B7Y B;  1EIY B;  4LF8 L;  3PF4 A;  4K0K Q;  4DR5 L;  2NN6 I;  4RMF A;  2QGQ A;  5FLM H;  4DV2 Q;  4NB3 A;  4HJ9 A;  3G48 A;  2JA8 G;  1Z47 A;  4WJ3 M;  3TRE A;  1X6O A;  4DV6 Q;  3BU2 A;  1VQ4 A;  1N33 L;  1VQE A;  3A0J A;  4GN4 B;  5M3M H;  3S1N H;  1WYD A;  3EN2 A;  4IJL A;  4DR2 Q;  3W1G A;  1XPO A;  3CCQ A;  4DV5 Q;  3I4N G;  4JI5 Q;  4DR4 L;  1VQB A;  4LFB L;  1N32 Q;  1SRU A;  3NEN A;  1EUJ A;  1N9W A;  1S3O A;  1UE6 A;  1X3F A;  2JEB I;  4IPC A;  4QY7 A;  4YWK A;  3HOX G;  1N34 Q;  1SRO A;  2VQE Q;  3J7Z C;  3I2Z A;  4A3B H;  1GD7 A;  4A3L G;  2KCT A;  3FHW A;  3HOU H;  1CKN A;  1I6H H;  1PV4 A;  1KRS A;  3CME A;  3OTO Q;  2IHF A;  4A3M G;  3I55 A;  5GAD C;  4X6A H;  4LUV A;  5FLM G;  2UXD L;  4A4I A;  3NEL A;  4JI0 Q;  4LUO A;  1PH5 A;  2VUM G;  3L7Z C;  2ZM6 L;  1YHA A;  1M90 C;  4A3C H;  1VQG A;  4DV0 L;  4A76 A;  1RIP A;  2UUC Q;  1QUQ B;  5ELO A;  4A3I H;  3KYH C;  4X66 Q;  3CCJ A;  5JEA J;  1HNZ L;  1NY4 A;  3E9H A;  4AH6 A;  4LF8 Q;  1H95 A;  4OON A;  5M5Y H;  1U0L A;  1QZG A;  3HOY H;  4JI1 L;  4A3B G;  4LF7 L;  1RL2 A;  5IYB G;  1IL2 A;  1IBL L;  1QZH A;  1VQM A;  1Q1E A;  3CPW A;  3CCS A;  4DUY L;  4DR4 Q;  4APV A;  2BA1 A;  4PMW A;  4GNX A;  1XMQ L;  4LFB Q;  2ATW A;  1M1K C;  1J5E Q;  2UU9 L;  3IRB A;  2NVQ H;  3HOW H;  4PG3 A;  2UUA Q;  2B29 A;  2YU9 H;  1QVG A;  2CQO A;  4A3I G;  1KD1 C;  1Q46 A;  3HOZ G;  4JBM A;  3M3Y H;  1Q7Y C;  3KJO A;  1GKH A;  1SR3 A;  2EIF A;  5M3F H;  4HID A;  1YJW A;  3KDF B;  2A1A A;  1Q86 C;  1K73 C;  3I4M G;  2ZM6 Q;  3KJP A;  1AE3 A;  3K8A A;  3PUW A;  4IFD J;  4DV4 Q;  2RHS B;  3S1Q H;  5C0X J;  1Y14 B;  4A3E G;  3CCM A;  1O7I A;  4BY7 H;  1PYB A;  4X62 L;  2UXB L;  4P74 A;  1HNZ Q;  4LF6 Q;  2Y0S G;  4JI8 L;  3CP0 A;  1XNR L;  3RN2 A;  3HOW G;  1UWV A;  4GN3 B;  3S2H H;  3CPF A;  3RNU A;  3UDF A;  3T1H Q;  1TWF H;  1QVF A;  1VCI A;  4A3D G;  2CWA A;  1IBL Q;  5K36 G;  4DNI A;  1K8A C;  2HIX A;  4JV5 L;  3PO2 G;  4GLA C;  5M3F G;  2JA7 H;  2CCZ A;  1L1O C;  4ALP A;  1L0W A;  4BXX G;  4IFD I;  1G6P A;  5LMN L;  1TWH H;  5E7N A;  1PH7 A;  2UU9 Q;  4JI7 L;  2K75 A;  1R9T H;  4NXN L;  2B3G A;  2B63 H;  1YJ9 A;  3HKS A;  5FLX c;  1Q81 C;  1BBU A;  4BY7 G;  1I3Q H;  3CW2 C;  4OXP A;  4BBS H;  1WFQ A;  1TWG H;  2K5N A;  2MO1 A;  1TWA H;  1Q12 A;  1YZ6 A;  1Z9F A;  4BY1 H;  1NE3 A;  3PUX A;  1ASY A;  1KIX A;  1TWC H;  2PI2 E;  1HZA A;  3KF6 A;  2Q2I A;  4LW1 A;  4R4T A;  5C44 G;  2OQ0 A;  4X64 L;  2BH8 A;  1YHQ A;  2R92 H;  1LYL A;  1KRT A;  2NN6 G;  1E1O A;  1X3G A;  5IT9 c;  2UXB Q;  4OWT B;  3HKZ E;  1XNR Q;  3RR5 A;  3UE0 A;  2VZA A;  2E5L Q;  1WCM H;  3DM3 A;  5C3E G;  1VQ6 A;  1EIF A;  4BA1 I;  2VW9 A;  3CC7 A;  5LMU L;  4LFA L;  4L5R C;  3CXC A;  1XNQ L;  5GAE C;  3SGI A;  1CKM A;  2EQS A;  2ZTD A;  2VQF L;  1G51 A;  1QUQ A;  4JG2 A;  1EYG A;  4IPD A;  4JV5 Q;  4IOC A;  1X55 A;  4PZ8 A;  2HQL A;  5GAH C;  2WB1 E;  4JI4 L;  4GOP A;  2YV5 A;  4JI7 Q;  3KLW A;  1EWI A;  2R92 G;  3MXN B;  2NVX H;  3GTO H;  1YHB A;  3S1R H;  3H0G G;  4UPA A;  3T1Y Q;  1GM5 A;  1YJN A;  2EXD A;  4DPG A;  3TS0 A;  2ALY B;  1L1O B;  1C9O A;  3F8T A;  2JK8 A;  5JJK A;  1D8L A;  2ZJQ A;  1FJG Q;  1E24 A;  1VQD A;  1I50 H;  4DR3 L;  3RZD H;  2JA6 G;  5EAY A;  2GVB A;  4DR1 L;  4X65 L;  4ME3 A;  1UE7 A;  2GN5 A;  2ASB A;  3CCV A;  4XIG S;  4DR7 L;  3E0E A;  1JB7 A;  5JJL A;  3BJU A;  3L0O A;  1PH8 A;  3GTQ H;  1PH9 A;  1OXX K;  1SLJ A;  4PZ6 A;  1HR0 L;  5HGQ A;  3I56 A;  3GTM H;  3PCO B;  4C3I H;  3KDF A;  2F4V Q;  2YYZ A;  1KHI A;  3K0X A;  4TVA B;  4LFA Q;  5LMU Q;  4NXM Q;  4P71 A;  3TQY A;  2E2J H;  4JYA L;  5JEA G;  5JJI A;  1LUZ A;  4O2D A;  4R4I A;  4YCU A;  4LFC L;  2KBN A;  1NBW A;  4RG1 A;  2NZO A;  4NPS A;  2IT1 A;  4JI6 L;  4Y52 H;  2N3S A;  3F2C A;  3A5U A;  3U58 A;  3PF5 A;  3CC2 A;  5M3M G;  4DAY B;  3VDY A;  1VQO A;  4DV3 L;  4JBJ A;  5FJ8 H;  4UP7 A;  3HKZ G;  2XTI A;  4DR5 Q;  2JJQ A;  2PI2 A;  4X65 Q;  1N36 L;  2UXC L;  1NTG A;  1V43 A;  1D7Q A;  1DGS A;  1S72 A;  2I5L X;  3RLO A;  4DV7 L;  2Z6K C;  2GVA A;  1Q1B A;  1IZ6 A;  3CD6 A;  3HOU G;  1N33 Q;  1YI2 A;  4JI2 L;  1AH9 A;  3OYY A;  4H02 A;  3W5O A;  4YHH L;  5C4X H;  1KAW A;  3STB C;  2WB1 G;  4IFD G;  4A3C G;  3A5Z B;  5C0X G;  1P16 A;  4B3T Q;  3F2B A;  5FJ8 G;  1IYJ B;  1IXR A;  1Y1V H;  3J81 j;  3S1M H;  1YBY A;  2YTX A;  1EOV A;  3HOY G;  2UXD Q;  3PUY A;  1JJ2 A;  3EIV A;  4JI6 Q;  1VQF A;  2MO0 A;  2WFW A;  1E1T A;  2IX1 A;  1VQJ A;  1PA6 A;  3S17 H;  1E3P A;  4DV0 Q;  3J7A 5;  3S2D H;  1XTD A;  2JA9 A;  4P75 A;  4B3T L;  3B6Y A;  4DV3 Q;  4DV1 L;  3ICE A;  3J80 i;  3PIP A;  1I94 L;  2CFM A;  5BR8 L;  4A3G H;  5C4X G;  4WJ4 A;  2K5H A;  1A63 A;  3UDG A;  4GNX C;  1N36 Q;  2K4K A;  1UEB A;  2I0Q A;  4JI1 Q;  3U50 C;  1VQH A;  4QL5 A;  3K7U C;  4HIM A;  1YIT A;  4LF7 Q;  1OXT A;  1VS0 A;  3AYH B;  4R4Q A;  4JI2 Q;  1X9N A;  4JBW A;  5GQO A;  4BBR H;  2R93 H;  1OXV A;  3J80 c;  1HZB A;  4DUY Q;  2N78 A;  4YHH Q;  4B3R L;  1XMQ Q;  2ID0 A;  5C0X I;  1V1Q A;  4C3J H;  4GS3 A;  1HNW L;  3G71 A;  4BA2 I;  3UDI A;  3MEF A;  4GKJ L;  2LXJ A;  2D0P A;  1CKN B;  3GO5 A;  1VQK A;  3W1B A;  1UE5 A;  2LSS A;  2K14 A;  4OO1 G;  2Q2U A;  4A3K H;  3NBH B;  2JA5 H;  4DUZ L;  1V9P A;  4R4O A;  3ULJ A;  1NMF A;  4EX5 A;  4POG A;  5IP9 H;  1PH6 A;  4LF5 L;  1XPR A;  4LUZ A;  4HJ7 A;  4A3F H;  3CCL A;  2D62 A;  3CCE A;  3K80 C;  2C35 B;  4X62 Q;  4DV1 Q;  2JA7 G;  3GTK H;  2JQO A;  1SN8 A;  4JI8 Q;  3D0F A;  3PGZ A;  4UP8 A;  1PFS A;  2Z0S A;  2B63 G;  4KHP L;  1VQ8 A;  4AQY L;  1FGU A;  2HHH L;  3CQZ H;  4LF4 L;  2F3I A;  4JOI C;  2AWO A;  1SFO H;  2I5M X;  4BBS G;  4HJ5 A;  4A3K G;  4C3H H;  3F2D A;  4OX9 L;  4R4C A;  4BY1 G;  2QA4 A;  4B3R Q;  4GNX B;  4A75 A;  5IWA L;  4LNQ A;  1KL9 A;  5IYC H;  5IP9 G;  5LMN Q;  2HT1 A;  4A93 H;  2K5V A;  4K0K L;  2BA0 A;  2RF4 A;  4A3J H;  5M5W H;  4A3F G;  1S40 A;  1K8G A;  4NXN Q;  5IYD H;  1X56 A;  1VQ5 A;  1YVC A;  2IHE A;  3PO3 H;  4OO1 I;  2OWO A;  4IJH A;  2IX0 A;  4TQU S;  5IE8 A;  3OW2 A;  4JC0 A;  4MZ9 A;  2OTL A;  2VNU D;  3BZC A;  4JI5 L;  2R93 G;  4QQB X;  1WCM G;  2D0O A;  4GLV B;  1N32 L;  2Q2H A;  2CWP A;  1IBK L;  3D31 A;  3WWV A;  4LF5 Q;  1WJJ A;  4JI3 L;  2VQE L;  4X64 Q;  2OQK A;  3M9B A;  1MJE A;  1OTC A;  2AWN A;  1C7Y A;  2F52 A;  2ES2 A;  2N49 A;  2K52 A;  1WOC A;  4LWC A;  4YWL A;  3Q8D A;  4HJA A;  2AKW B;  2JE6 I;  2WAQ E;  3OTO L;  2NVT H;  1VQP A;  4KHP Q;  3I4N H;  2H5X A;  5IYD G;  3E9I A;  1JJG A;  4HJ8 A;  3L2P A;  4GOP C;  4JI0 L;  1HNX L;  4QJF A;  3HOX H;  1QVC A;  2LXK A;  1CUK A;  3K81 C;  3PSI A;  2VQF Q;  1XNQ Q;  2PMZ E;  4HIK A;  2Q2T A;  3PUV A;  4A3L H;  3G6E A;  2RCN A;  2KEN A;  4OX9 Q;  5ELN A;  4MTN A;  4GN5 A;  4JI4 Q;  4A3M H;  1T9H A;  3J81 i;  5IY0 A;  3TS2 A;  3ERS X;  2VUM H;  1K9M C;  1E7Z A;  1FL0 A;  1SMX A;  2DUD A;  2YTY A;  5GRO A;  1ASZ A;  2Y0S E;  1PYS B;  2MNA A;  2QEX A;  1YEZ A;  4R1J A;  3ULP A;  1KC8 C;  1WI5 A;  4B3M L;  2NZH A;  2NVY H;  3J81 c;  1A8V A;  2ZJR A;  4KI0 A;  4AIM A;  4DR3 Q;  1XMO L;  4DR1 Q;  2UUA L;  3S16 H;  3M4O H;  3KF6 B;  2Z6K A;  1HZC A;  4JI3 Q;  4GLX A;  3H15 A;  1VQA A;  4DR7 Q;  3PIO A;  1KQS A;  1JMC A;  1HNW Q;  3AFP A;  1G29 1;  5IYB H;  2XGT A;  4UP9 A;  1JT8 A;  3LGJ A;  4DAM A;  3G4S A;  4XTC S;  1HR0 Q;  4HIO A;  3PUZ A;  2KHI A;  2L15 A;  2PQA B;  4JCV E;  4EQ5 A;  1EQR A;  1JJC B;  1FVI A;  1GVP A;  1W2B A;  1NJI C;  1HNX Q;  3RZO H;  1L2F A;  1OXU A;  1Y1W H;  4GKK L;  4JYA Q;  1W3S A;  4YCW A;  2HIV A;  4DV4 L;  4PZ7 A;  1X54 A;  3I4O A;  1OXS C;  1X65 A;  1A0I A;  4JBK A;  3JC6 6;  3HOZ H;  4P73 A;  1PH1 A;  4LF6 L;  4LF9 L;  1IBM L;  4LFC Q;  3GTG H;  3CAM A;  3GD7 A;  4GOP B;  1Q8K A;  3M7N A;  2VL6 A;  3I7F A;  1GO3 E;  2N8N A;  2E8G A;  3ZJY C;  1YIJ A;  1NMG A;  5H1S E;  3T1H L;  3GTJ H;  3TRZ A;  4DR6 L;  2R7F A;  3I4M H;  3KOJ A;  1TXY A;  2OCE A;  3H3V H;  3CF5 A;  1BBW A;  1K0R A;  1MKH A;  4OWX B;  4A3E H;  1PH2 A;  4YY3 L;  3UDX A;  5J3B A;  2MFI A;  4YWM A;  1LTL A;  4B3M Q;  2WAQ G;  1XMO Q;  1Y1W G;  1U5K A;  4J15 A;  3A74 A;  2UXC Q;  3GTP H;  1VQ9 A;  2VS1 A;  2YTV A;  2I5H A;  1MIU A;  4A3D H;  4DV7 Q;  4AYB E;  2JEA I;  4QIW E;  1Y1V G;  2UUB L;  1EQQ A;  2E2I H;  1L1O A;  3PO2 H;  1PHJ A;  4YCV A;  1KXL A;  4BXX H;  3RN5 A;  1VQ7 A;  4GKK Q;  4L5S A;  3K7A H;  1IBK Q;  3KF8 B;  2ZJP A;  3S24 A;  1PVO A;  5LMN W;  3FKI H;  2VY3 A;  2AHO B;  4LF9 Q;  4P72 A;  2FXQ A;  5IP7 H;  5C4J H;  1IBM Q;  1Q82 C;  1CKO A;  3HOV H;  4A3G G;  1VQI A;  1VQL A;  2A8V A;  1EFW A;  2E5L L;  4GKJ Q;  5AJ3 L;  4DR6 Q;  3CMA A;  1C0A A;  1XJV A;  2R7D A;  3F1Z A;  5C44 H;  2BH2 A;  3AFQ A;  3S14 H;  1HH2 P;  1B70 B;  2V1C C;  2ZTE A;  3M4P A;  1K3R A;  4FDB A;  2DGY A;  4KHZ A;  3TEH B;  3U4Z A;  3NEM A;  3RLN A;  3UE1 A;  4C2M H;  4DK3 C;  4YY3 Q;  4IPG A;  1I94 Q;  5BR8 Q;  4QGU A;  3AEV A;  2K50 A;  3PV0 A;  1YNX A;  4JOI A;  1BVS A;  2KHJ A;  5C3E H;  3FKI G;  3JAM i;  1K83 H;  3ULL A;  3T1Y L;  2PNH A;  2UUB Q;  5IP7 G;  4OWW B;  3HOV G;  1BKB A;  3M4Q A;  1CSP A;  2JA5 G;  1XPU A;  4B3S L;  2R7Z H;  1FJG L;  4IO9 A;  3GDE A;  4POF A;  2E2H H;  4KLK A;  3H3V I;  5GAG C;  3RLF A;  1P8L A;  1A62 A;  1MJC A;  1JE5 A;  1HJP A;  1SE8 A;  2AMC B;  2CKZ B;  3M85 A;  4DV2 L;  3KFU A;  3S15 H;  1VQC A;  2RHQ B;  3JAM c; 
#chains in the Genus database with same CATH topology
 1AE2 A;  2F3V A;  2AQ1 B;  2GPS A;  4DR2 L;  2A19 A;  3TME A;  4MAM A;  4GKK H;  2P0A A;  3GIM A;  1F9Q A;  5AJ3 Q;  1K1Q A;  2R6G A;  4NXM L;  3U4V A;  1JOK A;  1SMY D;  1STB A;  4A3I B;  2WKC A;  2KCM A;  4J9K A;  3PR4 A;  4AYB G;  4RH6 A;  4C3H G;  3ER0 A;  4IUV A;  5M5Y B;  1S0O A;  4IPH A;  2MJ8 A;  1K83 A;  2FMM A;  3BS1 A;  3DLL A;  3EPI A;  4B3T H;  2OTJ A;  2LFN A;  3FDT A;  3C2P A;  4YY3 H;  2RCF A;  2UUC L;  1X3E A;  2OT2 A;  1E22 A;  4ID6 A;  2PN1 A;  5KFI A;  1ZET A;  2IY5 B;  3NTK A;  1GSO A;  1EYC A;  1CI3 M;  1B6R A;  4B3S Q;  4IZO A;  1EIY B;  2ZTC A;  5IWA Q;  1B7Y B;  3VR6 A;  4LF8 L;  4DR5 L;  3KK7 A;  5FLM H;  2JA8 G;  2QGQ A;  1JXL A;  4NB3 A;  1KJ8 A;  2F0O A;  3O13 A;  3NGD A;  4WJ3 M;  4C1N I;  3F2U A;  4LMY A;  1EY4 A;  5M3F B;  4BS9 A;  1WYD A;  5CGK A;  4DR2 Q;  3I4N G;  5DG7 A;  1VQB A;  1SRU A;  5EPJ A;  2JEB I;  3HOX G;  1UE6 A;  4IPC A;  2EZV A;  1IBK Q;  2FMA A;  5DQH A;  4J6H A;  1CQV A;  3KF8 A;  4ZLT F;  2F0F A;  1DZ1 A;  3I2Z A;  2QCP X;  4A3B H;  4A3L G;  1HTP A;  2KCT A;  3DUZ A;  3VMM A;  3M9N B;  1CKN A;  3Q23 A;  4EBE A;  2IHF A;  5GAD C;  3KUP A;  4LUV A;  2DJG C;  2K5D A;  3NEL A;  5CV6 A;  3S14 B;  2NYZ D;  4K5V A;  4PMC A;  4UAI A;  5GON F;  3MZ5 A;  2UUC Q;  1RIP A;  4FF3 A;  2A6E C;  3I4L A;  1QUQ B;  4A3I H;  2ZXP A;  2XNA C;  3VR5 A;  1CQJ B;  5T14 A;  5JEA J;  1HNZ L;  4AQY H;  3MXG A;  3RV4 A;  5I47 A;  1T5E A;  4LF8 Q;  4LF4 H;  3T13 A;  1SNC A;  4OON A;  2M00 A;  2RA4 A;  5M5Y H;  4TV9 F;  2WKD A;  4LF7 L;  3M4I A;  3GIL A;  5IYB G;  4C5C A;  3E6Z X;  3AMU A;  4BY1 B;  1QZH A;  3TP6 A;  1Q3L A;  5EPL A;  2NBF A;  2X69 A;  4DUY L;  1S5C D;  4APV A;  4PMW A;  4GNX A;  4DV2 H;  3K5L A;  2ATW A;  2UU9 L;  3GID A;  4DV6 H;  4PG3 A;  1V1P B;  3C1E A;  1DCZ A;  1U9R A;  4JBM A;  1N32 H;  3R2T A;  1BNZ A;  4ZQ3 A;  1GKH A;  1SR3 A;  2EIF A;  1LAC A;  4RWS C;  5M3F H;  4RGO S;  1YJW A;  1RJR A;  3SE7 A;  4RB2 C;  3LX0 A;  4L1K A;  4RHR A;  4A3E G;  1EEF D;  1MSH A;  3HRZ C;  1HNZ Q;  3OWF A;  1UNS A;  3G6Y A;  3T53 B;  1BQQ T;  2Y0S G;  1JIC A;  4X3S A;  1WTV A;  3GTO B;  3ETJ A;  3RN2 A;  1UWV A;  2ZXR A;  1K1S A;  1B2T A;  5EKI A;  1B6S A;  4GC7 A;  2K01 A;  3A7A B;  5K36 G;  3S9W A;  2EJM A;  1A2T A;  1GUN A;  4ECX A;  4GLA C;  3I90 A;  3GLK A;  1SNP A;  1G6P A;  3MHB A;  1QNK A;  5LMN L;  1S97 A;  1HHV A;  5E7N A;  2UU9 Q;  4RAZ A;  2K75 A;  4NXN L;  4CJ0 B;  3RUP A;  5EBC A;  3GTQ B;  3LP8 A;  4YBZ B;  5FLX c;  4DR4 H;  4EG0 A;  4QWE A;  2K5N A;  3H94 A;  1II3 A;  1J5E H;  1MHW C;  2K6A A;  4BY1 H;  1RTO A;  4EYH B;  1NE3 A;  2QKI C;  3X3M A;  2PI2 E;  4EGJ A;  3KF6 A;  4LW1 A;  1A63 A;  1YHQ A;  1TS5 A;  3VYU A;  3QZ8 A;  4RAY A;  1KRT A;  1F77 A;  1E1O A;  2KCN A;  4IUR A;  3U9T A;  1X3G A;  1BBX C;  2X6L A;  2DZD A;  2V5A A;  3K5N A;  4DV4 H;  5C3E G;  3MXP A;  1R4Q B;  1EIF A;  1B33 N;  5LMU L;  4ZQI A;  3CXC A;  4JW0 A;  2ZTD A;  2NWG A;  1QUQ A;  3N42 B;  2EY5 A;  2RGV A;  4OHJ A;  5GAH C;  4GOP A;  3T1H H;  3FRP B;  1QIL A;  3GTO H;  3G6V A;  5C5L A;  4FU0 A;  2CW0 D;  2EXD A;  3MVV A;  5C4X B;  2ALY B;  4EVO A;  2NB0 A;  3M7G A;  2JEJ A;  2JK8 A;  4NMZ A;  2NVQ B;  1G2S A;  2C00 A;  1KNA A;  5COY A;  1E24 A;  1VQD A;  2VPQ A;  3RZD H;  4HCE A;  2GVB A;  2GN5 A;  3DF7 A;  1V1P A;  4DR7 L;  3G8C A;  3CU7 A;  3V05 A;  3S1M B;  4O4L F;  3GTQ H;  1SLJ A;  4PZ6 A;  1ICW A;  1HR0 L;  2R7L A;  4QWC A;  4OEL B;  4LSX A;  1A9X A;  4U67 3;  1DV2 A;  3S2D B;  5KNB A;  2YYZ A;  3S1Q B;  5LMU Q;  3M9O B;  2UXB H;  3NXW A;  1STN A;  1XNR H;  5JJI A;  1LUZ A;  4O2D A;  3GTO A;  2KBN A;  4J8Q A;  3RIZ A;  1KJ9 A;  1STG A;  2DNC A;  1IW7 D;  2IT1 A;  4EYI B;  2R8H A;  4S3S A;  4Y52 H;  4DA2 A;  3A5U A;  5J39 A;  3U58 A;  5M3M G;  1VQO A;  4DV3 L;  5FD5 A;  4YB8 B;  4DU9 A;  4C3I G;  2IPK D;  4CDE C;  4CJ2 C;  2QIL A;  3HOU G;  1IZ6 A;  3CD6 A;  1N33 Q;  1AH9 A;  3OYY A;  2FJ2 A;  4MN3 A;  5C4X H;  1LTT D;  2AUK A;  5I6W A;  3STB C;  3MAQ A;  4IFD G;  5KT7 A;  2GLT A;  5KFD A;  5JAV A;  2FP4 B;  2PO4 A;  5D3D A;  3F2B A;  3K59 A;  2RQX A;  5FJ8 G;  5EWE A;  3L4J A;  1T3N A;  4UDU C;  3J81 j;  3MFI A;  3GIP A;  3S1M H;  2YTX A;  2EPB A;  4NXM H;  1EOV A;  3NE5 B;  5JH7 F;  1JJ2 A;  1SFO B;  3EIV A;  1JOQ A;  3TIN A;  1E1T A;  4O3R A;  1RHP A;  4N9T A;  4C3H B;  3J7A 5;  3S2D H;  1TII D;  4HNT A;  4P75 A;  4DV3 Q;  3J80 i;  3U9S A;  4BWS C;  2KCC A;  2K5H A;  1IYV A;  3UDG A;  5KT5 A;  2XIG A;  3JRW A;  4RHS A;  3OOC A;  1PRT F;  3GII A;  2JEF A;  3HXL A;  4QL5 A;  4M7E A;  1JKJ B;  2K7V A;  2DN8 A;  1X9N A;  1I4Q A;  1H9M A;  1PRT D;  5IGF A;  3Q8S B;  1HZB A;  4DR5 H;  2NUA B;  1XMQ Q;  2ID0 A;  4ED2 A;  5FO8 B;  2G9D A;  1V1Q A;  2D9U A;  1H9J A;  3G6X A;  3WDN A;  2E74 C;  3I70 A;  4GKJ L;  2NVT B;  2D0P A;  4HAE A;  2FK3 A;  2LSS A;  2K14 A;  4WBN F;  5JVG 3;  4KV6 A;  1CHP D;  4DUZ L;  3ULJ A;  4EX5 A;  1WSC A;  3H3V C;  3R93 A;  5KFF A;  4RGN A;  2F0I A;  5HGT A;  1Q90 A;  3D4W A;  4X62 Q;  3SK6 A;  2A74 C;  4B9X A;  1SN8 A;  3D0F A;  3PGZ A;  4UP8 A;  1PFS A;  4KHP L;  1O75 A;  2C28 A;  2IW3 A;  4MA0 A;  4QWA A;  4U7C A;  2F3I A;  4JOI C;  4ZAI A;  1WD0 A;  1SFO H;  2I5M X;  1E4F T;  4BBS G;  2EOT A;  3BYT B;  2NU8 B;  3S16 B;  4C3H H;  3F2D A;  3D4R A;  1C30 A;  1TR5 A;  1N36 H;  3BA8 A;  4LNQ A;  5IP9 G;  1ZYR C;  5IYD H;  4LF7 H;  5EJW A;  1HFG A;  4F4X A;  1KC7 A;  4LSA A;  1VQ5 A;  1TWA A;  2IX0 A;  5IE8 A;  3OW2 A;  1ILP A;  4DUY H;  1EUD B;  3RZO B;  2VNU D;  3BZC A;  1IHZ A;  3K3P A;  2WV6 D;  1MBY A;  1SDF A;  1WCM G;  2Q2H A;  3D31 A;  3WWV A;  1DON A;  5KFY A;  1WJJ A;  2VQE L;  2OQK A;  2PMZ B;  4M8A A;  4LMQ D;  2WE6 A;  4H13 C;  4G4K A;  4IR1 A;  5F9L A;  2D2C C;  4A2A A;  1M0T A;  1S0N A;  2WAQ E;  3KLS X;  2ICE C;  3HEJ A;  3GTJ B;  5J22 A;  2NVT H;  3I4N H;  4KHP Q;  1JJG A;  4JI0 L;  1SFO A;  2AQ4 A;  3DEO A;  4QJF A;  3HOX H;  4A3E B;  3PSI A;  4ECQ A;  1DOM A;  3PUV A;  1PTO D;  4RB1 A;  4A3L H;  2Y0S B;  3KHG A;  5ELN A;  4FF4 A;  1F2Z A;  4GN5 A;  5LHY 1;  1HTL D;  2HGS A;  1F2M A;  2R84 A;  1T9H A;  1S9F A;  4RCN A;  3ERS X;  2E2I B;  4HYK A;  5GRO A;  1D6E C;  1PYS B;  2QEX A;  3ULP A;  5LMN H;  2XVS A;  4NXN H;  2P5Z X;  4L63 B;  4B3M L;  2ZJR A;  1XMO L;  1EY7 A;  4KI0 A;  3S16 H;  1JE4 A;  1XTC D;  3FKI B;  4IWY A;  2F0L A;  2NZ1 D;  3PIO A;  1RK6 A;  4KY7 A;  1KQS A;  1JMC A;  1A3U A;  1RDP D;  1SNO A;  4Z9C B;  1HUM A;  5IGB A;  5IYB H;  3LGJ A;  3G4S A;  2PQA B;  3RF2 A;  3TP5 A;  2RVL A;  5JPM C;  1W2B A;  1ONL A;  1NJI C;  3RZO H;  4GKK L;  4C2M B;  4FO2 A;  2UVR A;  3I4O A;  2BDO A;  5I4D A;  3GTK B;  1A0I A;  3VA5 A;  5C5M A;  4F8M A;  5C3E B;  2W6Z A;  1EZ1 A;  2VL6 A;  2N55 A;  1JWM D;  1NMG A;  3TRZ A;  3GTJ H;  3ETH A;  2BDN A;  3RMH A;  3H3V H;  1BOS A;  3CF5 A;  1EY6 A;  1PMR A;  1BBW A;  2R7Z B;  2GPW A;  4OWX B;  4A3E H;  4LK1 C;  5J2U F;  4YY3 L;  3J81 L;  5I9P A;  4B3M Q;  1GJX A;  1LTL A;  1XMO Q;  3EJI A;  2SDF A;  2UXC Q;  3R23 A;  4IRK A;  4MA5 A;  4IAL A;  2YTV A;  5ELF A;  3H4B A;  1Z6H A;  2C9O A;  4XX0 B;  1XDN A;  5K36 H;  1Y1V G;  2V4R A;  5E3F A;  1EQQ A;  2E2I H;  2B8G A;  5M5X B;  5D1P A;  4DXG A;  4ECV A;  1E2V A;  4GKK Q;  2PVP A;  4DR7 H;  1LT5 D;  2QEJ C;  3N40 P;  5KG2 A;  2PMZ A;  1PVO A;  1HR0 H;  3FKI H;  2VY3 A;  3GTL B;  4MV6 A;  2W6M A;  4A3G G;  5KG4 A;  1HA5 A;  3GTJ A;  1SYX B;  1HNX H;  3IL8 A;  1KJJ A;  1EFW A;  1TA8 A;  1TT2 A;  1CA6 A;  1B50 A;  1O80 A;  3D8G A;  2VPS A;  3F1Z A;  1D2B A;  4FDB A;  2V1C C;  2F0U A;  2ZTE A;  2O4X A;  4B3T Q;  4C2M H;  3V6J A;  4DK3 C;  4YY3 Q;  1GSH A;  1HPC A;  4F88 A;  3OHA A;  2L12 A;  4XXE A;  5ELE A;  4QGU A;  4UFZ A;  3SR1 A;  4LAA A;  3PV0 A;  1L2Z A;  3M4Y A;  3J81 E;  1YNX A;  4JOI A;  5C3E H;  4IZ8 A;  2E2I A;  5M3M B;  2R93 A;  4IQZ A;  4IUT A;  2W9A A;  5DG8 A;  5IP7 G;  1GSA A;  5A2Q W;  3HOV G;  2N88 A;  5BN3 A;  1BKB A;  2M2L A;  2R7Z H;  1FJG L;  4POF A;  3HB9 A;  3J80 W;  3BG3 A;  4O3S A;  4KKS A;  3RLF A;  2VOB A;  1MJC A;  4I65 A;  3FKI A;  1H9S B;  4DV2 L;  3HOU B;  4FNF A;  2XGP A;  3JAM c;  1PFM A;  4DV6 L;  1HQR D;  4KD4 A;  4ILW A;  3KAL A;  4ZK9 B;  5KFH A;  3KXY T;  2HQE A;  1NSN S;  2PQA A;  5LL6 S;  3HFZ B;  4ZYS A;  5DM6 3;  2EYJ A;  2F4V L;  4ED1 A;  5M5X H;  4C2M A;  2EY6 A;  3GTK A;  4PDB A;  3Q0A A;  3CCU A;  4ED6 A;  5JJZ A;  4DR6 H;  4QMG A;  4A93 G;  3GTL H;  1XXG A;  4AQY Q;  1EHI A;  4LF4 Q;  4F4Z A;  2Z6B A;  4L5Q A;  3PO3 G;  1CM9 A;  4N9P A;  2R7Z A;  2WDT A;  1YNN D;  3H09 A;  1O78 A;  1VQN A;  1C3O A;  1EIH A;  4CDD C;  4XQN A;  2CW7 A;  2YU9 B;  2WIN B;  1J6Q A;  1U4P A;  2NN6 I;  4HJ9 A;  4DV2 Q;  1HXY D;  2UVV A;  2A6H D;  3G48 A;  2UUB H;  3M3Y B;  4DV6 Q;  4JK1 C;  5M3M H;  4Q8F A;  3BDO A;  5FO7 B;  4DR4 L;  1N32 Q;  3K6O A;  1J5E L;  4GKJ H;  2FLL A;  3QJY A;  2W8K A;  2RDI A;  3GTL A;  5JVD F;  3HOU H;  4XYL B;  5EBD A;  3EA6 A;  4DUZ H;  5IIF A;  1KRS A;  2B8F A;  3CME A;  2R86 A;  4X6A H;  3I3C A;  4K2K A;  2PZU A;  2UXD L;  2W6P A;  4MTE A;  1VF7 A;  2WTF A;  4IFD H;  1VQG A;  3MA2 B;  2W6O A;  3NBI A;  2EYP A;  3Q24 A;  1TWH B;  4HTH A;  5IGE A;  3NWT A;  2FJZ A;  1NY4 A;  3E9H A;  4CKB A;  5KFZ A;  1FKA H;  2VUM A;  3PW0 A;  1H95 A;  1RYR A;  3MR6 A;  1U0L A;  3G6J B;  1K0S A;  1SYD A;  4X3T A;  4BBS B;  5E4X A;  2SNM A;  1I4G A;  1T5X D;  4EEQ A;  4YAJ B;  2YZG A;  1VQM A;  4R7R A;  5KFG A;  3MR3 A;  3RB0 A;  4DR4 Q;  2MUY A;  5LL6 b;  2BA1 A;  4J9P A;  2R92 B;  2R87 A;  2R82 A;  5H80 A;  1J5E Q;  2RDH A;  4HN7 A;  1H9S A;  2BQU A;  2YU9 H;  1HFN A;  2F0E A;  2HVQ A;  1KDC A;  2CQO A;  2W9B B;  3IG0 A;  1Q46 A;  3JSN A;  4DV5 H;  5D1O A;  3M3Y H;  1WCM B;  3KHH A;  3KJO A;  3VR2 A;  1IYU A;  1O7L A;  2VQE H;  3CHB D;  3I4M G;  2EYO A;  1UUP A;  4CC6 A;  3PUW A;  4DV4 Q;  3IKJ A;  1KAB A;  5C0X J;  4O3N A;  1Y14 B;  2A69 C;  3IFT A;  2UXB L;  4TV8 F;  1SEI A;  2R85 A;  4JI0 H;  4XQJ A;  1XNR L;  3S1R B;  3V2T A;  3HOW G;  1JCK B;  4EBC A;  3DXJ C;  2YRX A;  5DLF A;  3RNU A;  3UDF A;  3T1H Q;  1EZ6 A;  3A54 A;  1VCI A;  4A3D G;  2B2T C;  3MFG A;  1BNC A;  1ZKO A;  3RGX A;  2CWA A;  4WRD A;  4DNI A;  3W2D A;  3KAK A;  1PX2 A;  3PO2 G;  2YU9 A;  4BXX G;  2R7K A;  1L0W A;  2JSO A;  1TWH H;  3TBI B;  2HDL A;  1AUV A;  1S5E D;  2W7O A;  1V8Q A;  3HKS A;  1Q81 C;  1V4Y A;  4BY7 G;  3NTH A;  3GTM B;  4EGV A;  4OXP A;  5KFQ A;  4PQX A;  4BBS H;  4LFB H;  3HKZ B;  2KHS A;  1Q12 A;  1YZ6 A;  3OSO A;  1KIX A;  2IBK A;  5L1J A;  1HZA A;  4MV3 A;  2R92 H;  5C44 G;  4X64 L;  3MXU A;  3RAQ A;  1LYL A;  5CYU A;  5CV5 A;  5IT9 c;  1EEI D;  2UXB Q;  1E2W A;  1I7N A;  4OWT B;  2PYK A;  2WB1 B;  1XNR Q;  2YRW A;  5KFB A;  3UE0 A;  2ZM6 H;  4JPB W;  1WCM H;  4IAJ A;  1XNQ L;  3N44 B;  3TP7 A;  1CKM A;  2EQS A;  2W6N A;  2A6E D;  1NCV A;  2HQL A;  3OIQ A;  1LLR D;  3MTS A;  1LAB A;  3E5N A;  2KEC A;  5FLX L;  4O3O A;  2TSS A;  1YHB A;  3S1R H;  2PZT A;  3H0G G;  3LWE A;  1LO5 D;  5J2T F;  5KT6 A;  1GUO A;  3BAA A;  1IKL A;  2FFK B;  2R92 A;  1QG7 A;  1SEB D;  2NU9 B;  3GV5 B;  3E0J A;  1G6Z A;  4WFN 3;  4QCL A;  2AGQ A;  4ME3 A;  1D5X C;  4ZKB B;  3VA7 A;  1Y1V B;  2R8K A;  1JB7 A;  5JJL A;  3BJU A;  1HUN A;  1JC7 A;  3JSL A;  1E4E B;  1WCM A;  5E4W C;  3I56 A;  3GTM H;  3S17 B;  1F9P A;  3K0X A;  3TQ1 A;  4NXM Q;  5FPO A;  3TQY A;  4XT3 B;  2H4O A;  3NQT A;  4A3G B;  3OPO A;  2W9C B;  4WOR A;  2KVM A;  5JEA G;  2HVS A;  4JVZ A;  3DHQ A;  2QYZ A;  4QB4 A;  4RG1 A;  2NZO A;  2LKV A;  3GV3 A;  3N6R A;  1JX4 A;  3N52 A;  4IUQ A;  1K8M A;  2N3S A;  1SNQ A;  4YIJ A;  4JV5 H;  2DNE A;  3PF5 A;  3CC2 A;  1ENA A;  1X3Q A;  4F4Y A;  3W3A A;  4JI7 H;  2QDB A;  1AUX A;  4RB0 A;  4X3K A;  4DR5 Q;  2JJQ A;  1D7Q A;  1VDZ A;  1X32 A;  1N36 L;  2YZN A;  3PVX A;  1S72 A;  2YL2 A;  2A68 D;  1GHJ A;  4DV7 L;  3NP8 A;  2OF1 A;  1Q1B A;  4A3K B;  4Q45 A;  3GTM A;  4RKB A;  1FJG H;  4H02 A;  3HKZ A;  3QG1 A;  3OMG A;  1ROD A;  2O5J C;  4KMU C;  3MC0 B;  2NU6 B;  4O4I F;  2AGO A;  2OEO A;  5CAE B;  2D5D A;  2JP1 A;  5KFU A;  1SMY C;  4A3C G;  1D1I A;  1PZK D;  1Y69 U;  4N8F A;  4NP5 A;  2B2U C;  2KQ3 A;  1Y1V H;  4R9W A;  3N43 B;  1EY0 A;  2F4V H;  1M6V A;  3CQZ B;  2WB1 A;  2EXZ A;  4LFA H;  5L9X A;  4RFB A;  3SK8 A;  3HOY G;  4RZR A;  3PUY A;  1SJE D;  3MWY W;  2BE5 C;  2RDG A;  3I12 A;  4ECS A;  3NQI A;  2WFW A;  5EWF A;  2L5T A;  2IX1 A;  3S17 H;  5DQG A;  5HBR B;  1U4L A;  3B6Y A;  4KJO A;  3ICE A;  3RJ0 A;  4LJZ C;  1I94 L;  4QW9 A;  2VXW A;  4A3G H;  4OO1 H;  1S03 G;  3PO3 B;  2B2T A;  1N36 Q;  4ECT A;  2K4K A;  1UEB A;  1VQH A;  4IN3 A;  4J1M A;  4NDX A;  4YR0 A;  2J6S A;  4LF7 Q;  1ZEQ X;  2F0W A;  4JBW A;  1GHK A;  3R3O A;  3RZD B;  2YYA A;  4DUY Q;  3A8K E;  3FEW X;  1KTK A;  1KEE A;  1HNW L;  3G71 A;  5KFK A;  3UDI A;  3C0F B;  1Y1V A;  3OUU A;  2OLS A;  4QUC A;  3NUC A;  1E4E A;  1Z2O X;  1UE5 A;  4K6L A;  1FYC A;  4A3K H;  1V9P A;  4G57 A;  4R4O A;  4UCT A;  4RUA A;  3BDL A;  1NMF A;  5IYZ F;  1LTG D;  4LUZ A;  3CCL A;  2W9C A;  3K80 C;  2C35 B;  2EY1 A;  2J6U A;  4EFB A;  2OXP A;  1AP0 A;  2UXD H;  4YJ3 F;  5FKA C;  3J7A K;  2B63 G;  5IOD A;  2Z0S A;  2FLP A;  2HHH L;  1MGS A;  3CQZ H;  4E4T A;  3T56 B;  4IHJ F;  5KEE A;  2TMP A;  1WTO A;  2FPG B;  4HJ5 A;  3ERQ A;  2RKS A;  5I6Y A;  5G3L D;  4A75 A;  3OIP A;  2HT1 A;  4K0K L;  5LMN Q;  2YW2 A;  4A93 H;  2RF4 A;  4NXN Q;  4A3F G;  1SAP A;  4JI2 H;  3PW7 A;  1QB5 D;  4K14 A;  3PO3 H;  3KAJ A;  3QZ7 A;  2BOS A;  1JOO A;  4YHH H;  4B08 A;  1IOV A;  5ISR A;  5CR3 A;  2B2V C;  2ZDH A;  2L1B A;  2Z4H A;  4JI5 L;  2MCT A;  2XC9 A;  3G7L A;  2A73 B;  2ASJ A;  4XYM B;  4CKC A;  1MJE A;  2AWN A;  1C7Y A;  2N49 A;  1J9O A;  1KLU D;  3OMC A;  4LWC A;  3CQZ A;  2JE6 I;  3OTO L;  4C1N K;  2H5X A;  3SE0 A;  3I4M B;  4HJ8 A;  3L2P A;  3N41 B;  1HNX L;  4EGQ A;  3TP8 A;  2LXK A;  2PMZ E;  2ZDQ A;  5BN4 A;  2RCN A;  4DK1 A;  5KYL A;  2K33 A;  4KKT A;  2VB2 X;  4A3D B;  2PW5 A;  3ND9 A;  4F7X A;  3J81 i;  1UC8 A;  4UCO A;  1QE6 A;  4FS1 A;  1VBG A;  1K9M C;  3PO2 B;  3R2I A;  4UCV A;  4Q44 A;  1SMX A;  1D5Z C;  2YTY A;  1GXD C;  2Y0S E;  2MNA A;  4IUP A;  1YEZ A;  4MTK A;  4Q0F A;  4HSV A;  3GV6 A;  3WNZ A;  2CZG A;  4HNU A;  1A8V A;  2UUA L;  3ND8 A;  4I7Z C;  4BWG B;  1HZC A;  3GTQ A;  1TY0 A;  4DR7 Q;  2IA6 A;  3A8I E;  1G29 1;  5C3X A;  1HR0 Q;  5EWG A;  4HIO A;  3PUZ A;  2L15 A;  5C44 B;  1FVI A;  4X64 H;  3T5L A;  1ILQ A;  2ZXO A;  1HNX Q;  1G2T A;  1EUC B;  1JIH A;  2K5W A;  1PZJ D;  4O3Q A;  4QWB A;  1W3S A;  5KFS A;  5L1I A;  2B2U A;  3EYY A;  1X54 A;  4OL7 A;  5KKN B;  1CS0 A;  4DL6 A;  4DN4 M;  5KFP A;  5D8D A;  4LF6 L;  1JDB B;  2A5H A;  2MGS A;  4KKU A;  3GTG H;  3GP7 A;  2AQ3 B;  1XNQ H;  3I7F A;  3ZJY C;  2N8N A;  3L4K A;  5H1S E;  4DR6 L;  3I4M H;  5KFO A;  2CW0 C;  1TXY A;  4AYB B;  1NR2 A;  5F9N A;  2DJF C;  1PH2 A;  4YWM A;  4G7H C;  1CQF A;  5CBE E;  2WAQ G;  2FHT A;  4J15 A;  1Y1W G;  3H0G B;  1VQ9 A;  2VS1 A;  2NU7 B;  4RNO A;  3T4A C;  4A3D H;  2I5H A;  2JN4 A;  2JEA I;  2UUB L;  4B9W A;  4M9U A;  3PO2 H;  4YCV A;  1KXL A;  3PN1 A;  2JA8 B;  4BXX H;  4JI3 H;  3HS0 C;  3PW5 A;  1ET9 A;  5KX5 F;  1DYQ A;  4LH6 A;  3BVM A;  5DM7 3;  2AHO B;  3I4N B;  2DY8 A;  5FOB B;  2BQR A;  1H9K A;  2L0C A;  4V0B A;  3HOX B;  2E5L L;  2SNS A;  4DR6 Q;  3CMA A;  2BH2 A;  5C44 H;  2EJG C;  3H91 A;  3AFQ A;  1YJ9 A;  2FE3 A;  4BBR G;  1JOR A;  4J0M A;  3BYY B;  3FPU B;  3RBE A;  3NEM A;  1WVL A;  2R7N A;  4RUC A;  2KED A;  5ELB A;  3KLS A;  3V4Z A;  2F4I A;  1G8Z D;  4KHV A;  3BQ1 A;  4I7H A;  1STE A;  1JLL B;  3MR2 A;  4PWQ A;  3S1N B;  3T5K A;  1EU4 A;  3T1Y L;  2UUB Q;  3M4Q A;  2JA5 G;  1T94 A;  2FIN B;  2CH4 A;  3GDE A;  4IO9 A;  1CTM A;  4KLK A;  1P8L A;  2CCZ A;  3KFU A;  4RNM A;  4DV7 H;  1I6H B;  3PW2 A;  1U4R A;  1AW7 A;  4GKJ Q;  3H0G H;  2B2V A;  5BMV F;  2JXM B;  2MQH A;  3EBE A;  4DV5 L;  4DUZ Q;  4R8U B;  4DK6 C;  4UY8 C;  1VAJ A;  1EQT A;  1LM0 A;  4IOA A;  2JA8 H;  3K58 A;  3WO0 A;  1RD9 D;  4JV2 A;  4Y7N H;  3FP9 A;  3HOY B;  1UEA B;  5C8Y F;  1N8R C;  4A3J G;  3T16 A;  1PTO F;  1SE2 A;  2RBM A;  5DLQ E;  3BZK A;  4AYB A;  4MNO A;  3IN5 A;  4EQN A;  1I94 H;  1KLG D;  1B8A A;  1PRT C;  3K5I A;  5JEA H;  1UE1 A;  3Q8Q B;  3PF4 A;  3CCR A;  5KG1 A;  3AU7 A;  3ZYY X;  3JAM L;  3GQC A;  1CHQ D;  1BUV T;  1UC9 A;  5KT3 A;  1X6O A;  5D65 A;  1VBH A;  1VQ4 A;  5D3I B;  2XWJ B;  3S1N H;  4ED0 A;  2SEB D;  4IJL A;  3W1G A;  1XPO A;  4DV5 Q;  1HNW H;  1BCP F;  4LFB L;  4QY7 A;  5K5P A;  2SOB A;  1SRO A;  2VQE Q;  3NPP A;  3J7Z C;  5F2D A;  1GD7 A;  1BCP D;  5KFX A;  2J9G A;  1I6H H;  2RDJ A;  2RDF A;  2IMW P;  4A3M G;  3I55 A;  5BPH A;  3IFD A;  2VQD A;  4APM A;  5FLM G;  1SE3 A;  4A4I A;  3C46 A;  5CV7 A;  4JI0 Q;  4A2B A;  1EY9 A;  3L7Z C;  2CQA A;  1YHA A;  2ZM6 L;  4A3C H;  1XYI A;  4DV0 L;  3DWQ A;  4A76 A;  1CFM A;  2K03 A;  3X3N A;  5ELO A;  3TIG A;  1VF5 C;  2B63 B;  3KYH C;  1R9T B;  1B9M A;  4CDF C;  4AH6 A;  2HHH H;  2H1E A;  5KFT A;  4Q8E A;  3HOY H;  2R8I A;  1I3Q B;  4JI1 L;  1GUS A;  5CC4 A;  4A3B G;  4F4W A;  1FR3 A;  4KJN A;  1RL2 A;  1PRT B;  1IL2 A;  1BF4 A;  3JAM E;  2EE1 A;  1RCV D;  1Q1E A;  4K0K H;  1TWC B;  3CPW A;  3CCS A;  1ZHQ A;  5ELC A;  2F0N A;  4YR3 A;  4WJW A;  4LFB Q;  3SI8 A;  3L9A X;  1F2Y A;  5KYI A;  3J81 W;  3KBX A;  1QVG A;  2AGP A;  2PCF B;  1A15 A;  4A3I G;  4FBU A;  1KD1 C;  3HOZ G;  4JI5 H;  1AEX A;  3PW4 A;  4Y8V B;  3D4D A;  2I87 A;  1EZ8 A;  4HID A;  4R8U A;  1N34 H;  3KDF B;  2WYO A;  1MSG A;  2A1A A;  1K73 C;  4IWX A;  2C2R A;  2ZM6 Q;  3KJP A;  1AE3 A;  3VYS A;  4PMB A;  2J4X A;  3OTO H;  1O7I A;  1PYB A;  2K1B A;  2IX3 A;  4XQQ A;  4ECW A;  4JI8 L;  2NVX B;  3CP0 A;  2GA4 B;  5HV6 A;  3OSP A;  1YNJ D;  4ULL A;  2EY2 A;  3DMU A;  4JV0 A;  2PZW A;  4K5X A;  4X66 H;  1EYD A;  1ESF A;  2Y0S A;  4JV5 L;  2C5C A;  5M3F G;  2I8C A;  1L1O C;  4ALP A;  4KD3 A;  2HD3 A;  1DIK A;  2KA7 A;  3SXH A;  4O2A F;  2PBZ A;  2K5Q A;  4JI7 L;  2B63 H;  5I2X A;  1R9T H;  3V6H A;  2XRS D;  5JVL A;  1I3Q H;  4C3I B;  4ZKC B;  1MI2 A;  2MO1 A;  1Z9F A;  2J0T D;  1B44 D;  4DK0 A;  1NAP A;  5LL6 X;  2E2J B;  4ECU A;  2UUA H;  3PUX A;  1ASY A;  1TWC H;  5J1Z A;  1KDA A;  4C56 C;  4DXF A;  3GIQ A;  4FXG C;  2NN6 G;  1Y8P B;  1SNM A;  4TRD A;  3VPC A;  2J6T A;  3EFX D;  3TQT A;  3HKZ E;  2F0V A;  3KBG A;  2VZA A;  1SYF A;  2MHV A;  1VQ6 A;  4DLK A;  5T1I A;  2VW9 A;  4LFA L;  3UFX B;  3LNN A;  4L5R C;  5GAE C;  2VQF L;  2ZT9 C;  3BVZ A;  4LF6 H;  5EKL A;  4JG2 A;  1SYB A;  4IPD A;  4JV5 Q;  2B63 A;  4IOC A;  1R9T A;  1X55 A;  4PZ8 A;  2L9H A;  2WB1 E;  4JI4 L;  3RFC A;  4KY6 A;  1RJT A;  4JI7 Q;  1L0Y B;  5EZY F;  3BQ2 A;  1I3Q A;  3KLW A;  1IBL H;  3MXN B;  4K5W A;  2X6G A;  2NVX H;  3V4S A;  3MWM A;  2HVR A;  3HBL A;  1B3Q A;  1FNV A;  5CMD A;  2EVB A;  3MR5 A;  4DL4 A;  3TS0 A;  3RB3 A;  1L1O B;  1TWC A;  1C9O A;  1HQM C;  3F8T A;  3QR8 A;  1IKM A;  5FD6 A;  1FJG Q;  5KG6 A;  4DR3 L;  3WOE A;  2JA6 G;  5EAY A;  4DR1 L;  2EJF C;  5C4Z A;  1WTQ A;  2ASB A;  4XIG S;  1LT6 D;  3E0E A;  5IT9 L;  3L0O A;  1OXX K;  4QUF A;  4V19 0;  4DGZ A;  5HGQ A;  5JVH 3;  2F0K A;  4C3I H;  3KDF A;  2F4V Q;  3R8B A;  4LFA Q;  4YJ2 F;  3N6X A;  1I4P A;  4JYA L;  4P71 A;  2E2J H;  1CT1 D;  2R8G A;  4N8X 1;  5C1O A;  1EWH A;  4LFC L;  2E5L H;  2NVX A;  1LTB D;  1NBW A;  5KFC A;  2QF7 A;  4NPS A;  4M1U B;  2I46 A;  4RNN A;  3K5H A;  4K8J A;  4BBR B;  3I8Z A;  3A56 A;  3F2C A;  1NUC A;  4DL5 A;  1I7L A;  1M4V A;  3NHH A;  4DAY B;  1PTO H;  4ED3 A;  1EFI D;  5FJ8 H;  5DGB A;  5IGC A;  1I4X A;  1S5D D;  5BPF A;  3VPD A;  1KDB A;  1NTG A;  1SYE A;  1V43 A;  3T1Y H;  4ABN A;  2I5L X;  2Z6K C;  2JA5 B;  1YI2 A;  4JI2 L;  3P7J A;  1IOW A;  3W5O A;  4XZ3 B;  4I7A A;  1STA A;  3N8D A;  2Q8I B;  4YHH L;  1WTH A;  2K05 A;  1KAW A;  3PR5 B;  2JEG A;  1V1O A;  3V96 A;  3A5Z B;  5C0X G;  4ZRZ A;  2K32 A;  2F03 A;  2EYF A;  2F0G A;  1IXR A;  4OGQ C;  4XYO A;  2PQE A;  4DL2 A;  2UXD Q;  1C4Q A;  4HCS A;  2R7M A;  2MPM A;  1VQJ A;  2ALZ A;  4Q5V A;  1XTD A;  1YNN C;  5D14 A;  1DOL A;  3BZD B;  3PIP A;  5M5W B;  5C4X G;  5BR8 L;  3RGZ A;  1S5B D;  4WJ4 A;  3Q8P B;  4GNX C;  2A6H C;  2I0Q A;  3MXN A;  3U50 C;  1ZHS A;  3K7U C;  3T51 B;  5C3W A;  3TDQ A;  4HIM A;  5L37 A;  4R4Q A;  1VS0 A;  3AYH B;  4FF1 A;  2DWC A;  4MV9 A;  5DLG A;  4JI2 Q;  4ECZ A;  4BBR H;  5GQO A;  2Q8T A;  1OXV A;  3J80 c;  2XWB B;  2RSN A;  3QOJ A;  4X65 H;  4YHH Q;  5C0X I;  4GS3 A;  3SK5 A;  4BA2 I;  1O7Y A;  3SEB A;  4J9O A;  1MD2 D;  4RGT A;  5BN5 A;  3RAX A;  2LXJ A;  4L6T B;  1CKN B;  3GO5 A;  5KFA A;  3W1B A;  5LA6 F;  2Q2U A;  2KJX A;  3NBH B;  5EPK A;  2JA5 H;  3ITP A;  4HMI A;  2K04 A;  3OSN A;  2ATL A;  1B4O A;  2JEI A;  1F9S A;  4J9S A;  1S10 A;  4POG A;  5IP9 H;  3P20 A;  3FPP A;  4CDC C;  4PV1 C;  3CCE A;  4A3M B;  2JYO A;  1KAA A;  1GUW A;  2JA7 G;  4JI6 H;  3RB6 A;  1AZP A;  1Z2P X;  1FGU A;  4DV0 H;  1STH A;  2Z8L A;  2FPP B;  1QNU A;  4NW2 A;  2C22 A;  3A55 A;  3PMF A;  2AWO A;  5KFW A;  4DAY A;  4DL7 A;  1EIG A;  5C5J A;  1PXU A;  1TWH A;  4X3U A;  4UCS A;  3M4O B;  1QWY A;  2QA4 A;  1HCZ A;  4GZY C;  4GNX B;  5IWA L;  4JI1 H;  1JWU D;  2BA0 A;  4A3J H;  1S40 A;  5M5W H;  2FLN A;  5DG9 A;  2V58 A;  4PNY A;  1YVC A;  2IHE A;  2OWO A;  2FMC A;  2JA5 A;  3MFH A;  4TQU S;  5FLX W;  4JC0 A;  3CKI B;  3ORR A;  5CA1 F;  4QQB X;  2LY7 A;  4GLV B;  1D5M C;  1IBK L;  4JI3 L;  3HOZ B;  3NWS A;  4X64 Q;  3M9B A;  1OTC A;  2W9B A;  2ES2 A;  4YWL A;  4HJA A;  2Z9H A;  3RD4 A;  2K28 A;  3P1H A;  4IUN A;  2CW8 A;  2B2Y C;  5IYD G;  2CH4 W;  3OW7 A;  4GOP C;  4EFE A;  2BE5 D;  1O7Z A;  1V51 A;  1XNQ Q;  1CUK A;  4DV1 H;  5ELD A;  4HIK A;  2Q2T A;  5FPR A;  4JI8 H;  4QWD A;  4MTN A;  5EKK A;  4A3M H;  3R5H A;  2YZM A;  3JRX A;  4FF2 A;  3TS2 A;  4MTD A;  3JZI A;  1E7Z A;  5FLX E;  4ODG A;  4B3R H;  4TKO B;  5IGG A;  1KC8 C;  2F0T A;  2KUM A;  1WI5 A;  1BXT A;  3P75 A;  3NSW A;  5LYJ F;  4AIM A;  3M4O H;  3QFF A;  3KF6 B;  2Z6K A;  4JI3 Q;  5DGA A;  4GLX A;  3H15 A;  5C4J B;  3HOV B;  2IL8 A;  4JUZ A;  2O5I C;  3AFP A;  1JT8 A;  2F0M A;  4UP9 A;  3H20 A;  1SJH D;  4IUU A;  4JCV E;  3NBH A;  1FNW A;  3Q8R B;  1F2L A;  1FNU A;  1PFB A;  4LF5 H;  1L2F A;  3NK9 A;  1OXU A;  3J7A F;  1DXM A;  2FPI B;  5I2Y A;  2HIV A;  4RB3 C;  1PZI D;  4XT1 B;  4XYQ A;  1X65 A;  3QIA A;  3VYT A;  3HOZ H;  4P73 A;  1PH1 A;  2IP4 A;  5JQW A;  3PIO 3;  3FVQ A;  3UQ8 A;  2YS6 A;  4GOP B;  1Q8K A;  1WH2 A;  1FD7 D;  3M7N A;  2XD4 A;  2DLN A;  1TAE A;  2E8G A;  1W93 A;  1YIJ A;  1WD1 A;  2VQF H;  1S0M A;  1DOK A;  2R6F A;  2OCE A;  4RAU C;  5KT2 A;  4OX9 H;  4QIW B;  1MKH A;  2E2H B;  4JI4 H;  3Q1K A;  4KTA A;  4DF7 A;  4A93 B;  3QO2 A;  5KND A;  2ZJT A;  4CHT B;  1U5K A;  3A74 A;  4KN4 C;  1RKN A;  3R5F A;  2XCL A;  4DV7 Q;  4AYB E;  1QCB D;  3DM1 A;  1GUT A;  4RGM A;  1U4M A;  4DNT B;  1WTR A;  2IWH A;  4TUY F;  1EY5 A;  4DR3 H;  2JA6 B;  3CRK C;  1EU3 A;  3BDC A;  4DR1 H;  4ED8 A;  5NUC A;  1B3A A;  1C48 A;  1XWE A;  4FP5 D;  4L5S A;  5KT4 A;  3URY A;  3KLR A;  3RTX A;  2ZJP A;  4K8I A;  5LP6 F;  1F9R A;  5LMN W;  1TS2 A;  2XCP A;  1LT3 D;  1E0B A;  4HSP A;  4P72 A;  5IP7 H;  5C4J H;  1Y8N B;  3GQB A;  1CKO A;  3HOV H;  4MV4 A;  3K5O A;  1JQY D;  1VQL A;  2LMC B;  2A8V A;  4JYA H;  2V4Q A;  4KK7 A;  1Z7T A;  1C0A A;  2EYH A;  2PPB C;  5KFR A;  1PYW D;  3SDZ A;  2R7D A;  3U9O A;  1IL8 A;  3VR3 A;  3S14 H;  1HH2 P;  4I4T F;  3QB3 A;  2NN6 H;  5CV9 A;  2R93 G;  4F87 A;  4LFC H;  4IPG A;  1I94 Q;  4DFA A;  4ME6 A;  5EGT A;  3A7L A;  1ENF A;  2K50 A;  4C3J G;  2B2W C;  5KFV A;  1AN7 A;  4ZHQ F;  1DV1 A;  1ENC A;  2W6Q A;  2KSW A;  2A68 C;  5KFN A;  3FKI G;  3BJY A;  5G3L F;  3JAM i;  4YQW A;  1PLF A;  3SVM A;  2XIW A;  4OWW B;  1HA6 A;  1SSO A;  5DAU A;  2W71 A;  3BVG A;  1W96 A;  4U68 A;  2Z4I A;  3H3V I;  2E2H H;  5GAG C;  1I6V C;  1A62 A;  1SE8 A;  5COR A;  3M85 A;  1HNW Q;  4G7O C;  2CQY A;  4Q0Y A;  4HQ6 A;  1VQC A;  1A6X A;  1EWC A;  3CC4 A;  3D6W A;  4DKA C;  2R61 A;  1EY8 A;  1CZW A;  3V6K A;  4G3I A;  3STB D;  1N48 A;  2JA6 H;  5JUM A;  1N34 L;  2E76 C;  1CSQ A;  4O0A A;  3AQQ A;  4ZUJ A;  4FVM A;  4P2C B;  4Q43 A;  1IBM H;  4LF9 H;  3GTG B;  2I07 B;  2E2D C;  2ICI A;  2R7Z G;  2B2Y A;  1C8C A;  4IR9 A;  2I80 A;  1A3V A;  4YAK B;  5IYC G;  3TN2 A;  2X0S A;  4UCR A;  3K57 A;  1PH4 A;  1I5F A;  3D6C A;  2BCO A;  2HHH Q;  1HR0 W;  2WP8 J;  4MV8 A;  1RK5 A;  1PH3 A;  4QIW A;  4L5T A;  2E2H A;  1RJP A;  5BR8 H;  5TSS A;  3KHL A;  1OO9 B;  4X66 L;  5HY6 A;  3HOW B;  1K8O A;  4FBT A;  2MP1 A;  1HZ9 A;  3HZX A;  4K0K Q;  1GUG A;  4RMF A;  2AU0 A;  1Z47 A;  3TRE A;  3BU2 A;  4O2B F;  1N33 L;  1VQE A;  3A0J A;  1LTA D;  4GN4 B;  3EN2 A;  2KEE A;  2JA6 A;  5I9O A;  3K5M A;  3CCQ A;  4QF4 A;  4JI5 Q;  4MV7 A;  2EDG A;  4ED7 A;  3NEN A;  1EUJ A;  1N9W A;  1S3O A;  1X3F A;  1N34 Q;  4YWK A;  4BY7 B;  5K2M A;  1NR4 A;  1JWS D;  3FHW A;  5KFE A;  3I73 A;  4UHV A;  3I91 A;  1PV4 A;  3S2H B;  3OTO Q;  4G7Z C;  1TWF B;  5CV4 A;  1B53 A;  4HR7 B;  3NTI A;  2J7Z A;  2B39 A;  4LUO A;  2EYL A;  1PH5 A;  2VUM G;  1M90 C;  5C0X H;  2JA7 B;  3D3R A;  4X66 Q;  3CCJ A;  1STY A;  4HED A;  4MV1 A;  1WTP A;  3KTM A;  1AN8 A;  1QZG A;  2Z1C A;  1TWG B;  2ASL A;  1TWA B;  3A8J E;  1IBL L;  4O42 A;  4B3S H;  4QW8 A;  5IWA H;  1BJT A;  1RYS A;  1XMQ L;  1E2Z A;  5A35 A;  1M1K C;  1ZYR D;  3IRB A;  2NVQ H;  3HOW H;  2UUA Q;  2B29 A;  3H6M A;  2V9W A;  3UI2 A;  3J7Y W;  4DR2 H;  2G5D A;  4H44 C;  2DPJ A;  1XX8 A;  1Q7Y C;  1IBK H;  4RU9 A;  1Q86 C;  4Y7N B;  3K8A A;  4IFD J;  3I72 A;  2RHS B;  5DEH A;  3S1Q H;  1QJO A;  4O4H F;  3GTG A;  3CCM A;  4BY7 H;  1Z2N X;  4X62 L;  4P74 A;  4LF6 Q;  2F0P A;  4RZQ A;  4XDX A;  2DIK A;  1Y8O B;  1CK1 A;  1IW7 C;  4GN3 B;  5CBA E;  3WO1 A;  3LWU A;  1ESR A;  3CPF A;  3S2H H;  1QVF A;  2V4D A;  1TWF H;  2UUC H;  5KG5 A;  3BG5 A;  4I55 F;  1IBL Q;  1K8A C;  3J7A V;  2HIX A;  3CVZ A;  1I50 B;  1SND A;  4LF8 H;  2OH2 A;  2JA7 H;  2B2W A;  4IFD I;  2L4N A;  1PH7 A;  3PIP 3;  4CC5 A;  2B3G A;  1DD2 A;  2F0J A;  4HMJ A;  1BBU A;  1CZG A;  3CW2 C;  1WFQ A;  4R8I A;  4E6I A;  1TWG H;  1TWA H;  1CE8 A;  1TKW B;  5JPN C;  2F0D A;  2FB9 A;  1M7J A;  4FXD A;  5EDW A;  4R4T A;  2Q2I A;  2OQ0 A;  5CV8 A;  2BH8 A;  1TS3 A;  3MWD A;  4DAP A;  3GIK A;  2XN9 C;  1TY2 A;  1PFN A;  1TWF A;  1KBL A;  4HR7 A;  3BAB A;  3RR5 A;  4ECY A;  2M05 A;  1TQO A;  4KY5 A;  4TQR A;  2E5L Q;  5E1F A;  3DM3 A;  1I4R A;  2F0Q A;  4BA1 I;  2WII B;  3CC7 A;  3R5X A;  5KFJ A;  1KNE A;  3SGI A;  2JA7 A;  1GLV A;  3SK4 A;  1HNZ H;  1G51 A;  1EYG A;  2V59 A;  1VMP A;  5KG7 A;  4FXK C;  4O1N A;  5KG3 A;  2LS0 1;  5LXT F;  2YV5 A;  1PK8 A;  1G91 A;  5HUR A;  2R92 G;  1EWI A;  1CA5 A;  1E4G T;  1TWG A;  4UPA A;  5KFL A;  3T1Y Q;  1GM5 A;  1YJN A;  1GYF A;  4DPG A;  1BR9 A;  1HRJ A;  2PW7 A;  1OWT A;  2UU9 H;  3FMA A;  5JJK A;  1D8L A;  2ZJQ A;  1KJI A;  3QWN A;  1I50 H;  3LWB A;  3H0G A;  4X65 L;  1UE7 A;  2RSO A;  3CCV A;  3L3O C;  1B9N A;  1NNX A;  1PH8 A;  1PH9 A;  3JAM W;  3GIJ A;  2DPI A;  4CKE A;  3PCO B;  1WTW A;  4JV1 A;  1B1Z A;  5FK9 C;  1EQV A;  5IGD A;  4ZI7 F;  3KHR A;  1KHI A;  4TVA B;  4IRD A;  3H40 A;  1R4P B;  2AUJ D;  2FKL A;  4R4I A;  4YCU A;  3VPB A;  2C2E A;  4RCO A;  2XGQ A;  1K3B C;  4DAV A;  1DM0 B;  5JOB A;  4I50 F;  4JI6 L;  1KJQ A;  2XCA A;  2R93 B;  2CVR A;  3VDY A;  1I50 A;  4CGY B;  1D1K A;  4JBJ A;  4C3J B;  4UP7 A;  2HDM A;  3HKZ G;  1JB3 A;  1LTR D;  2XTI A;  2PI2 A;  4X65 Q;  3BA9 A;  2UXC L;  3C1F A;  1DGS A;  2R8J A;  1TS4 A;  3RLO A;  4FS2 A;  2GVA A;  4YR2 A;  1SYG A;  3EVQ A;  2W57 A;  4ME5 A;  4A3F B;  2WB1 G;  3M9M B;  4DL3 A;  3OHX C;  4J9M A;  1P16 A;  5FO9 B;  2NTT A;  1SXT A;  1WTX A;  1IYJ B;  1W6K A;  4J9R A;  3OWE B;  1LTS D;  1L0X B;  3WOF A;  1YBY A;  4J9N A;  5LMU H;  4R8N A;  4JI6 Q;  4EBD A;  1VQF A;  2MO0 A;  5DQI A;  4J9Q A;  3EQL C;  3RB4 A;  1N56 A;  1PA6 A;  1E3P A;  4DV0 Q;  5IOC A;  2JA9 A;  1PTO C;  4B3T L;  3T5H A;  4DV1 L;  2R3Z A;  4LH7 A;  2CFM A;  3C3L A;  3QOL A;  1A2U A;  5KRU A;  4JI1 Q;  1RF2 D;  1YIT A;  1X3P A;  3TZU A;  1OXT A;  5KIX A;  3OUZ A;  3FMC A;  1S5F D;  1K28 A;  2R93 H;  1VMC A;  3FDS A;  2HUG A;  2N78 A;  4B3R L;  2BQ3 A;  3Q6S A;  4C3J H;  2WAC A;  4TQS A;  3ORQ A;  5EQ0 A;  3MEF A;  1N33 H;  5KFM A;  1BCP C;  4OEM B;  1EOT A;  1VQK A;  1QOH A;  4OO1 G;  2BR0 A;  2QDL A;  2DY7 A;  4EQP A;  1LV9 A;  1SYC A;  2Q8R E;  1TU2 B;  5T1G A;  4K2L A;  1PH6 A;  1AZQ A;  3PQI A;  1XPR A;  4HJ7 A;  4A3F H;  4LF5 L;  5EOY A;  4NKL A;  1ZXT A;  2D62 A;  2CHB D;  5C6A A;  1AFP A;  1LTI D;  4DV1 Q;  2VA2 A;  1ICF B;  3GTK H;  2JQO A;  4O3P A;  1S4Z A;  4JI8 Q;  5L1K A;  2VUM B;  2KOL A;  1VQ8 A;  4AQY L;  5A2Q L;  3TSS A;  2W7P A;  4LF4 L;  1TVX A;  3MFY A;  3TZD A;  1PTO B;  1JR0 D;  3VR4 A;  1BGW A;  4ETS A;  4DV3 H;  3J80 L;  2NVY B;  3DEP A;  4A3K G;  4OX9 L;  4R4C A;  4BY1 G;  4B3R Q;  4WD3 A;  1KL9 A;  5IYC H;  4EEY A;  3TII A;  2VB3 X;  2K5V A;  2IJ0 A;  3IAY A;  4U6P A;  1K8G A;  1X56 A;  5KNC A;  4OO1 I;  1BDO A;  4IJH A;  5KGU A;  1ZQ7 A;  5D1O B;  2PNR C;  2QK4 A;  4MZ9 A;  1XMQ H;  2WAQ B;  2OTL A;  4ECR A;  1Y1W B;  1FGB D;  2L11 A;  1N32 L;  2D0O A;  2EYM A;  2FK1 A;  2CWP A;  4FM9 A;  1BCP B;  4LF5 Q;  1ET6 A;  3RBD A;  4EQO A;  2F0H A;  2E75 C;  2F52 A;  2K52 A;  2M9V A;  1WOC A;  4GC6 A;  3Q8D A;  2HCI A;  2AKW B;  4DNR B;  3K3V A;  1W6J A;  1BXR A;  1RJQ A;  2HCC A;  3E5S A;  1VQP A;  4FYD A;  5IT9 W;  3MEH A;  3E9I A;  1YNJ C;  4ZUI A;  1QVC A;  2F3W A;  2NTS A;  3K0Y A;  3K81 C;  2VQF Q;  1GGO A;  4X62 H;  4C5B A;  1S68 A;  3BQ0 A;  5A2Q E;  4MHE A;  1JDE A;  2A69 D;  1M8A A;  3G6E A;  2KEN A;  4OX9 Q;  3GTP B;  1UNN C;  3J80 E;  1A3T A;  4JI4 Q;  2XRQ D;  3LML A;  2NUC A;  3HP3 A;  5IY0 A;  4F50 A;  2VUM H;  4RKL A;  1VKZ A;  1FL0 A;  2DUD A;  1RTN A;  5C4H A;  1ASZ A;  3RV3 A;  4R1J A;  3K7A B;  3CRL C;  1T36 A;  2NZH A;  2W70 A;  2NVY H;  3J81 c;  4DR3 Q;  1I4H A;  5L1L A;  4DR1 Q;  2G9H D;  1VQA A;  5LOV F;  2UVW A;  3E3X A;  2XGT A;  2VR1 A;  4DAM A;  4XTC S;  1SE4 A;  2KHI A;  4EQ5 A;  5IT9 E;  2UVU A;  1GOZ A;  1EQR A;  1JJC B;  4OIK A;  4H7B A;  1GVP A;  2AQ2 B;  2SCU B;  5AFW A;  1Y1W H;  1EYA A;  3ERO A;  3PZP A;  4JYA Q;  4YCW A;  3F8N A;  4DV4 L;  4PZ7 A;  1MZB A;  5C1P A;  1OXS C;  4JBK A;  3JC6 6;  4KHP H;  4H0L C;  4LF9 L;  1IBM L;  4LFC Q;  3ONA B;  3CAM A;  3EPG A;  3GD7 A;  4HNV A;  1K83 B;  1GO3 E;  4ZCK A;  3RUZ A;  2F0S A;  4KN7 C;  5CA0 F;  3T1H L;  5CB4 F;  4IRC A;  2F1M A;  2R7F A;  4MIU A;  3KOJ A;  1ML0 D;  1UAP A;  4UCU A;  2HJW A;  3GV7 B;  1K0R A;  2NVY A;  2QW7 A;  1CQI B;  3UDX A;  5J3B A;  4A3J B;  3S15 B;  2MFI A;  1J8I A;  3MWE A;  4CJ1 B;  2L55 A;  3VYR A;  3GTP H;  5KG0 A;  1MIU A;  4QIW E;  1ULZ A;  1L1O A;  2WAQ A;  2ENB A;  1Y1W A;  1PHJ A;  2ASD A;  2RGR A;  1DJR D;  2ZDG A;  3RN5 A;  3DWA A;  1VQ7 A;  1B04 A;  3MJF A;  1SCU B;  2O2L D;  3K7A H;  3KF8 B;  1M0W A;  3S24 A;  2FK2 A;  2VUG A;  4LF9 Q;  2O03 A;  2FXQ A;  5DNF A;  1IBM Q;  1BO0 A;  1Q82 C;  3SHL A;  1EL0 A;  2VA3 A;  1VQI A;  2YCH A;  4NLG A;  1EYZ A;  1PDQ A;  5AJ3 L;  4TSS A;  4J9L A;  1XJV A;  4CBV A;  1B70 B;  3M4P A;  4KHZ A;  3U4Z A;  1K3R A;  3UE1 A;  2DGY A;  3TEH B;  3RLN A;  4YP3 A;  1WR2 A;  3GV8 B;  3DWP A;  3GTP A;  5BR8 Q;  1Q8I A;  1LT4 D;  1SBB B;  2XSC A;  3HGB A;  3AEV A;  2C2D A;  1BVS A;  2KHJ A;  4OIJ A;  5M9O A;  3H4D A;  4RA8 A;  1K83 H;  3ULL A;  2YS7 A;  4K6D A;  2PNH A;  4L8J A;  3T5J A;  1I6U A;  3HG9 A;  4C5A A;  4B3M H;  3OHB A;  1XMO H;  1XPU A;  1CSP A;  3AB9 A;  4B3S L;  2UXC H;  1H9R A;  4A3B B;  2CKZ B;  1JE5 A;  1HJP A;  2AMC B;  3Q22 A;  3S15 H;  3Q2O A;  2RHQ B;  4ZOL F;  2W8L A; 
#chains in the Genus database with same CATH homology
 1AE2 A;  4DV6 L;  3H0G H;  3CC4 A;  2MQH A;  4DKA C;  2PQA A;  2A19 A;  4DR2 L;  3EBE A;  4DV5 L;  3HFZ B;  4DUZ Q;  4DK6 C;  4UY8 C;  2F4V L;  5AJ3 Q;  5M5X H;  3STB D;  2R6G A;  1LM0 A;  4NXM L;  3U4V A;  1N34 L;  2JA6 H;  4IOA A;  1CSQ A;  4O0A A;  2JA8 H;  2KCM A;  3AQQ A;  4Y7N H;  3FP9 A;  4AYB G;  3ER0 A;  2R7Z G;  3CCU A;  4BBR G;  4IPH A;  5IYC G;  1N8R C;  4A93 G;  3GTL H;  1PH4 A;  1I5F A;  4A3J G;  4AQY Q;  3DLL A;  5DLQ E;  2HHH Q;  1HR0 W;  4LF4 Q;  2WP8 J;  4L5Q A;  3BZK A;  3PO3 G;  2OTJ A;  4MNO A;  1PH3 A;  2UUC L;  1X3E A;  4L5T A;  1E22 A;  1J5E L;  1B8A A;  1VQN A;  2IY5 B;  1UE1 A;  4X66 L;  5HY6 A;  4B3S Q;  1J6Q A;  1HZ9 A;  2ZTC A;  3CCR A;  5IWA Q;  1B7Y B;  1EIY B;  4LF8 L;  3PF4 A;  4K0K Q;  4DR5 L;  2NN6 I;  4RMF A;  2QGQ A;  5FLM H;  4DV2 Q;  4NB3 A;  4HJ9 A;  3G48 A;  2JA8 G;  1Z47 A;  4WJ3 M;  3TRE A;  1X6O A;  4DV6 Q;  3BU2 A;  1VQ4 A;  1N33 L;  1VQE A;  3A0J A;  4GN4 B;  5M3M H;  3S1N H;  1WYD A;  3EN2 A;  4IJL A;  4DR2 Q;  3W1G A;  1XPO A;  3CCQ A;  4DV5 Q;  3I4N G;  4JI5 Q;  4DR4 L;  1VQB A;  4LFB L;  1N32 Q;  1SRU A;  3NEN A;  1EUJ A;  1N9W A;  1S3O A;  1UE6 A;  1X3F A;  2JEB I;  4IPC A;  4QY7 A;  4YWK A;  3HOX G;  1N34 Q;  1SRO A;  2VQE Q;  3J7Z C;  3I2Z A;  4A3B H;  1GD7 A;  4A3L G;  2KCT A;  3FHW A;  3HOU H;  1CKN A;  1I6H H;  1PV4 A;  1KRS A;  3CME A;  3OTO Q;  2IHF A;  4A3M G;  3I55 A;  5GAD C;  4X6A H;  4LUV A;  5FLM G;  2UXD L;  4A4I A;  3NEL A;  4JI0 Q;  4LUO A;  1PH5 A;  2VUM G;  3L7Z C;  2ZM6 L;  1YHA A;  1M90 C;  4A3C H;  1VQG A;  4DV0 L;  4A76 A;  1RIP A;  2UUC Q;  1QUQ B;  5ELO A;  4A3I H;  3KYH C;  4X66 Q;  3CCJ A;  5JEA J;  1HNZ L;  1NY4 A;  3E9H A;  4AH6 A;  4LF8 Q;  1H95 A;  4OON A;  5M5Y H;  1U0L A;  1QZG A;  3HOY H;  4JI1 L;  4A3B G;  4LF7 L;  1RL2 A;  5IYB G;  1IL2 A;  1IBL L;  1QZH A;  1VQM A;  1Q1E A;  3CPW A;  3CCS A;  4DUY L;  4DR4 Q;  4APV A;  2BA1 A;  4PMW A;  4GNX A;  1XMQ L;  4LFB Q;  2ATW A;  1M1K C;  1J5E Q;  2UU9 L;  3IRB A;  2NVQ H;  3HOW H;  4PG3 A;  2UUA Q;  2B29 A;  2YU9 H;  1QVG A;  2CQO A;  4A3I G;  1KD1 C;  1Q46 A;  3HOZ G;  4JBM A;  3M3Y H;  1Q7Y C;  3KJO A;  1GKH A;  1SR3 A;  2EIF A;  5M3F H;  4HID A;  1YJW A;  3KDF B;  2A1A A;  1Q86 C;  1K73 C;  3I4M G;  2ZM6 Q;  3KJP A;  1AE3 A;  3K8A A;  3PUW A;  4IFD J;  4DV4 Q;  2RHS B;  3S1Q H;  5C0X J;  1Y14 B;  4A3E G;  3CCM A;  1O7I A;  4BY7 H;  1PYB A;  4X62 L;  2UXB L;  4P74 A;  1HNZ Q;  4LF6 Q;  2Y0S G;  4JI8 L;  3CP0 A;  1XNR L;  3RN2 A;  3HOW G;  1UWV A;  4GN3 B;  3S2H H;  3CPF A;  3RNU A;  3UDF A;  3T1H Q;  1TWF H;  1QVF A;  1VCI A;  4A3D G;  2CWA A;  1IBL Q;  5K36 G;  4DNI A;  1K8A C;  2HIX A;  4JV5 L;  3PO2 G;  4GLA C;  5M3F G;  2JA7 H;  2CCZ A;  1L1O C;  4ALP A;  1L0W A;  4BXX G;  4IFD I;  1G6P A;  5LMN L;  1TWH H;  5E7N A;  1PH7 A;  2UU9 Q;  4JI7 L;  2K75 A;  1R9T H;  4NXN L;  2B3G A;  2B63 H;  1YJ9 A;  3HKS A;  5FLX c;  1Q81 C;  1BBU A;  4BY7 G;  1I3Q H;  3CW2 C;  4OXP A;  4BBS H;  1WFQ A;  1TWG H;  2K5N A;  2MO1 A;  1TWA H;  1Q12 A;  1YZ6 A;  1Z9F A;  4BY1 H;  1NE3 A;  3PUX A;  1ASY A;  1KIX A;  1TWC H;  2PI2 E;  1HZA A;  3KF6 A;  2Q2I A;  4LW1 A;  4R4T A;  5C44 G;  2OQ0 A;  4X64 L;  2BH8 A;  1YHQ A;  2R92 H;  1LYL A;  1KRT A;  2NN6 G;  1E1O A;  1X3G A;  5IT9 c;  2UXB Q;  4OWT B;  3HKZ E;  1XNR Q;  3RR5 A;  3UE0 A;  2VZA A;  2E5L Q;  1WCM H;  3DM3 A;  5C3E G;  1VQ6 A;  1EIF A;  4BA1 I;  2VW9 A;  3CC7 A;  5LMU L;  4LFA L;  4L5R C;  3CXC A;  1XNQ L;  5GAE C;  3SGI A;  1CKM A;  2EQS A;  2ZTD A;  2VQF L;  1G51 A;  1QUQ A;  4JG2 A;  1EYG A;  4IPD A;  4JV5 Q;  4IOC A;  1X55 A;  4PZ8 A;  2HQL A;  5GAH C;  2WB1 E;  4JI4 L;  4GOP A;  2YV5 A;  4JI7 Q;  3KLW A;  1EWI A;  2R92 G;  3MXN B;  2NVX H;  3GTO H;  1YHB A;  3S1R H;  3H0G G;  4UPA A;  3T1Y Q;  1GM5 A;  1YJN A;  2EXD A;  4DPG A;  3TS0 A;  2ALY B;  1L1O B;  1C9O A;  3F8T A;  2JK8 A;  5JJK A;  1D8L A;  2ZJQ A;  1FJG Q;  1E24 A;  1VQD A;  1I50 H;  4DR3 L;  3RZD H;  2JA6 G;  5EAY A;  2GVB A;  4DR1 L;  4X65 L;  4ME3 A;  1UE7 A;  2GN5 A;  2ASB A;  3CCV A;  4XIG S;  4DR7 L;  3E0E A;  1JB7 A;  5JJL A;  3BJU A;  3L0O A;  1PH8 A;  3GTQ H;  1PH9 A;  1OXX K;  1SLJ A;  4PZ6 A;  1HR0 L;  5HGQ A;  3I56 A;  3GTM H;  3PCO B;  4C3I H;  3KDF A;  2F4V Q;  2YYZ A;  1KHI A;  3K0X A;  4TVA B;  4LFA Q;  5LMU Q;  4NXM Q;  4P71 A;  3TQY A;  2E2J H;  4JYA L;  5JEA G;  5JJI A;  1LUZ A;  4O2D A;  4R4I A;  4YCU A;  4LFC L;  2KBN A;  1NBW A;  4RG1 A;  2NZO A;  4NPS A;  2IT1 A;  4JI6 L;  4Y52 H;  2N3S A;  3F2C A;  3A5U A;  3U58 A;  3PF5 A;  3CC2 A;  5M3M G;  4DAY B;  3VDY A;  1VQO A;  4DV3 L;  4JBJ A;  5FJ8 H;  4UP7 A;  3HKZ G;  2XTI A;  4DR5 Q;  2JJQ A;  2PI2 A;  4X65 Q;  1N36 L;  2UXC L;  1NTG A;  1V43 A;  1D7Q A;  1DGS A;  1S72 A;  2I5L X;  3RLO A;  4DV7 L;  2Z6K C;  2GVA A;  1Q1B A;  1IZ6 A;  3CD6 A;  3HOU G;  1N33 Q;  1YI2 A;  4JI2 L;  1AH9 A;  3OYY A;  4H02 A;  3W5O A;  4YHH L;  5C4X H;  1KAW A;  3STB C;  2WB1 G;  4IFD G;  4A3C G;  3A5Z B;  5C0X G;  1P16 A;  4B3T Q;  3F2B A;  5FJ8 G;  1IYJ B;  1IXR A;  1Y1V H;  3J81 j;  3S1M H;  1YBY A;  2YTX A;  1EOV A;  3HOY G;  2UXD Q;  3PUY A;  1JJ2 A;  3EIV A;  4JI6 Q;  1VQF A;  2MO0 A;  2WFW A;  1E1T A;  2IX1 A;  1VQJ A;  1PA6 A;  3S17 H;  1E3P A;  4DV0 Q;  3J7A 5;  3S2D H;  1XTD A;  2JA9 A;  4P75 A;  4B3T L;  3B6Y A;  4DV3 Q;  4DV1 L;  3ICE A;  3J80 i;  3PIP A;  1I94 L;  2CFM A;  5BR8 L;  4A3G H;  5C4X G;  4WJ4 A;  2K5H A;  1A63 A;  3UDG A;  4GNX C;  1N36 Q;  2K4K A;  1UEB A;  2I0Q A;  4JI1 Q;  3U50 C;  1VQH A;  4QL5 A;  3K7U C;  4HIM A;  1YIT A;  4LF7 Q;  1OXT A;  1VS0 A;  3AYH B;  4R4Q A;  4JI2 Q;  1X9N A;  4JBW A;  5GQO A;  4BBR H;  2R93 H;  1OXV A;  3J80 c;  1HZB A;  4DUY Q;  2N78 A;  4YHH Q;  4B3R L;  1XMQ Q;  2ID0 A;  5C0X I;  1V1Q A;  4C3J H;  4GS3 A;  1HNW L;  3G71 A;  4BA2 I;  3UDI A;  3MEF A;  4GKJ L;  2LXJ A;  2D0P A;  1CKN B;  3GO5 A;  1VQK A;  3W1B A;  1UE5 A;  2LSS A;  2K14 A;  4OO1 G;  2Q2U A;  4A3K H;  3NBH B;  2JA5 H;  4DUZ L;  1V9P A;  4R4O A;  3ULJ A;  1NMF A;  4EX5 A;  4POG A;  5IP9 H;  1PH6 A;  4LF5 L;  1XPR A;  4LUZ A;  4HJ7 A;  4A3F H;  3CCL A;  2D62 A;  3CCE A;  3K80 C;  2C35 B;  4X62 Q;  4DV1 Q;  2JA7 G;  3GTK H;  2JQO A;  1SN8 A;  4JI8 Q;  3D0F A;  3PGZ A;  4UP8 A;  1PFS A;  2Z0S A;  2B63 G;  4KHP L;  1VQ8 A;  4AQY L;  1FGU A;  2HHH L;  3CQZ H;  4LF4 L;  2F3I A;  4JOI C;  2AWO A;  1SFO H;  2I5M X;  4BBS G;  4HJ5 A;  4A3K G;  4C3H H;  3F2D A;  4OX9 L;  4R4C A;  4BY1 G;  2QA4 A;  4B3R Q;  4GNX B;  4A75 A;  5IWA L;  4LNQ A;  1KL9 A;  5IYC H;  5IP9 G;  5LMN Q;  2HT1 A;  4A93 H;  2K5V A;  4K0K L;  2BA0 A;  2RF4 A;  4A3J H;  5M5W H;  4A3F G;  1S40 A;  1K8G A;  4NXN Q;  5IYD H;  1X56 A;  1VQ5 A;  1YVC A;  2IHE A;  3PO3 H;  4OO1 I;  2OWO A;  4IJH A;  2IX0 A;  4TQU S;  5IE8 A;  3OW2 A;  4JC0 A;  4MZ9 A;  2OTL A;  2VNU D;  3BZC A;  4JI5 L;  2R93 G;  4QQB X;  1WCM G;  2D0O A;  4GLV B;  1N32 L;  2Q2H A;  2CWP A;  1IBK L;  3D31 A;  3WWV A;  4LF5 Q;  1WJJ A;  4JI3 L;  2VQE L;  4X64 Q;  2OQK A;  3M9B A;  1MJE A;  1OTC A;  2AWN A;  1C7Y A;  2F52 A;  2ES2 A;  2N49 A;  2K52 A;  1WOC A;  4LWC A;  4YWL A;  3Q8D A;  4HJA A;  2AKW B;  2JE6 I;  2WAQ E;  3OTO L;  2NVT H;  1VQP A;  4KHP Q;  3I4N H;  2H5X A;  5IYD G;  3E9I A;  1JJG A;  4HJ8 A;  3L2P A;  4GOP C;  4JI0 L;  1HNX L;  4QJF A;  3HOX H;  1QVC A;  2LXK A;  1CUK A;  3K81 C;  3PSI A;  2VQF Q;  1XNQ Q;  2PMZ E;  4HIK A;  2Q2T A;  3PUV A;  4A3L H;  3G6E A;  2RCN A;  2KEN A;  4OX9 Q;  5ELN A;  4MTN A;  4GN5 A;  4JI4 Q;  4A3M H;  1T9H A;  3J81 i;  5IY0 A;  3TS2 A;  3ERS X;  2VUM H;  1K9M C;  1E7Z A;  1FL0 A;  1SMX A;  2DUD A;  2YTY A;  5GRO A;  1ASZ A;  2Y0S E;  1PYS B;  2MNA A;  2QEX A;  1YEZ A;  4R1J A;  3ULP A;  1KC8 C;  1WI5 A;  4B3M L;  2NZH A;  2NVY H;  3J81 c;  1A8V A;  2ZJR A;  4KI0 A;  4AIM A;  4DR3 Q;  1XMO L;  4DR1 Q;  2UUA L;  3S16 H;  3M4O H;  3KF6 B;  2Z6K A;  1HZC A;  4JI3 Q;  4GLX A;  3H15 A;  1VQA A;  4DR7 Q;  3PIO A;  1KQS A;  1JMC A;  1HNW Q;  3AFP A;  1G29 1;  5IYB H;  2XGT A;  4UP9 A;  1JT8 A;  3LGJ A;  4DAM A;  3G4S A;  4XTC S;  1HR0 Q;  4HIO A;  3PUZ A;  2KHI A;  2L15 A;  2PQA B;  4JCV E;  4EQ5 A;  1EQR A;  1JJC B;  1FVI A;  1GVP A;  1W2B A;  1NJI C;  1HNX Q;  3RZO H;  1L2F A;  1OXU A;  1Y1W H;  4GKK L;  4JYA Q;  1W3S A;  4YCW A;  2HIV A;  4DV4 L;  4PZ7 A;  1X54 A;  3I4O A;  1OXS C;  1X65 A;  1A0I A;  4JBK A;  3JC6 6;  3HOZ H;  4P73 A;  1PH1 A;  4LF6 L;  4LF9 L;  1IBM L;  4LFC Q;  3GTG H;  3CAM A;  3GD7 A;  4GOP B;  1Q8K A;  3M7N A;  2VL6 A;  3I7F A;  1GO3 E;  2N8N A;  2E8G A;  3ZJY C;  1YIJ A;  1NMG A;  5H1S E;  3T1H L;  3GTJ H;  3TRZ A;  4DR6 L;  2R7F A;  3I4M H;  3KOJ A;  1TXY A;  2OCE A;  3H3V H;  3CF5 A;  1BBW A;  1K0R A;  1MKH A;  4OWX B;  4A3E H;  1PH2 A;  4YY3 L;  3UDX A;  5J3B A;  2MFI A;  4YWM A;  1LTL A;  4B3M Q;  2WAQ G;  1XMO Q;  1Y1W G;  1U5K A;  4J15 A;  3A74 A;  2UXC Q;  3GTP H;  1VQ9 A;  2VS1 A;  2YTV A;  2I5H A;  1MIU A;  4A3D H;  4DV7 Q;  4AYB E;  2JEA I;  4QIW E;  1Y1V G;  2UUB L;  1EQQ A;  2E2I H;  1L1O A;  3PO2 H;  1PHJ A;  4YCV A;  1KXL A;  4BXX H;  3RN5 A;  1VQ7 A;  4GKK Q;  4L5S A;  3K7A H;  1IBK Q;  3KF8 B;  2ZJP A;  3S24 A;  1PVO A;  5LMN W;  3FKI H;  2VY3 A;  2AHO B;  4LF9 Q;  4P72 A;  2FXQ A;  5IP7 H;  5C4J H;  1IBM Q;  1Q82 C;  1CKO A;  3HOV H;  4A3G G;  1VQI A;  1VQL A;  2A8V A;  1EFW A;  2E5L L;  4GKJ Q;  5AJ3 L;  4DR6 Q;  3CMA A;  1C0A A;  1XJV A;  2R7D A;  3F1Z A;  5C44 H;  2BH2 A;  3AFQ A;  3S14 H;  1HH2 P;  1B70 B;  2V1C C;  2ZTE A;  3M4P A;  1K3R A;  4FDB A;  2DGY A;  4KHZ A;  3TEH B;  3U4Z A;  3NEM A;  3RLN A;  3UE1 A;  4C2M H;  4DK3 C;  4YY3 Q;  4IPG A;  1I94 Q;  5BR8 Q;  4QGU A;  3AEV A;  2K50 A;  3PV0 A;  1YNX A;  4JOI A;  1BVS A;  2KHJ A;  5C3E H;  3FKI G;  3JAM i;  1K83 H;  3ULL A;  3T1Y L;  2PNH A;  2UUB Q;  5IP7 G;  4OWW B;  3HOV G;  1BKB A;  3M4Q A;  1CSP A;  2JA5 G;  1XPU A;  4B3S L;  2R7Z H;  1FJG L;  4IO9 A;  3GDE A;  4POF A;  2E2H H;  4KLK A;  3H3V I;  5GAG C;  3RLF A;  1P8L A;  1A62 A;  1MJC A;  1JE5 A;  1HJP A;  1SE8 A;  2AMC B;  2CKZ B;  3M85 A;  4DV2 L;  3KFU A;  3S15 H;  1VQC A;  2RHQ B;  3JAM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...