2JA8G

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja8G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja8G01
4PZ8A 4A3EG 1VQIA 2NZHA 4P72A 3CP0A 2BH8A 2PNHA 1Y14B 1W2BA 3PO2G 3H0GH 3ICEA 4DPGA 3L7ZC 1TWHH 1YHBA 3CW2C 4R4QA 1DGSA 4KHPQ 4GKKQ 1QUQB 4XIGS 4X64L 3TS2A 4BY7H 1G51A 4LUVA 2K14A 1VQEA 1X3EA 4JI5Q 4LW1A 4BA2I 1GO3E 1G6PA 1BBUA 3T1HQ 4X62Q 2CFMA 2AMCB 3I4OA 4KI0A 4IFDG 4GLVB 3J81j 1LUZA 1SROA 3S1RH 3RR5A 4DUZQ 1IXRA 2GVBA 5IYDH 2YV5A 1VQNA 1EYGA 2NZOA 2PMZE 5AJ3L 5GADC 4MZ9A 3PV0A 4NPSA 4POFA 1AE2A 4GS3A 2YTXA 3D0FA 1VQ9A 2K4KA 4JI4L 4O2DA 3W1BA 4DAYB 3K0XA 1HZCA 2BA0A 2UXBL 1YITA 4B3TQ 3KDFB 3CXCA 5GAGC 1PYSB 4DR1Q 1C0AA 1SLJA 4BA1I 1PH7A 1L1OC 4H02A 1PH5A 2JA9A 1VQFA 3Q8DA 5FLXc 2EXDA 2JK8A 3T1YL 4ALPA 2ASBA 4LF7Q 4DV3L 3K80C 1RIPA 4R4OA 2BH2A 2ZJRA 4PMWA 3F2BA 3HOXG 4LNQA 4P74A 2DGYA 1K73C 4K0KQ 4DV5Q 1B7YB 1UWVA 1MJEA 3GTKH 4A3LG 1N33Q 2A19A 1HR0W 3HKSA 2K50A 1NY4A 2IHEA 2K52A 3NBHB 1J6QA 1V9PA 4UPAA 4DR5Q 1C7YA 1HNXQ 1YJNA 4JI0Q 1UE6A 2VS1A 1QZGA 4IPHA 2OTLA 4OWWB 1XNQQ 3I7FA 2VY3A 4GN5A 5C4XH 5M3MG 5BR8L 5LMNL 3CCEA 2VQFL 2UXCL 4LF9Q 3LGJA 5GQOA 4JI2Q 4A4IA 5C4JH 1CKMA 2Q2TA 4NXNQ 4GLAC 2RHSB 1M1KC 1IBML 5IYCH 3KF8B 4LF5Q 1CKNA 4JC0A 4BXXG 1X65A 3J80i 1X3FA 3PCOB 3AFPA 2MO0A 5GAHC 1E1OA 1QZHA 2E5LL 1Y1VG 3ULJA 1IBKL 4DV6L 2E8GA 4DR7L 1RL2A 4A3MH 1EWIA 4L5TA 2R7DA 2JA7G 1Q1BA 4X64Q 2EIFA 1V1QA 1YBYA 3PUWA 4X65L 2ZTDA 3L0OA 4B3RL 1JJGA 4PZ7A 3GTJH 3TRZA 3STBD 3SGIA 3UDIA 4JI3Q 2EQSA 4ME3A 3J81i 1HNZQ 2VZAA 4LFCQ 2UXDL 3HFZB 1PH1A 3S16H 3DM3A 1NMGA 1T9HA 3NENA 3RLFA 2R7ZG 1Q12A 4O0AA 5IY0A 2K5HA 2Z0SA 4DV7Q 1BBWA 1HZAA 2WAQE 1S72A 4JOIA 1QUQA 4BBRH 3ULPA 3ZJYC 3CC7A 4A3BH 4OWTB 4YY3Q 2JA8H 4C3JH 5M3FH 5JJLA 3I4MG 4EQ5A 1PH9A 1E22A 2OTJA 4EX5A 4OX9Q 3PUXA 4DR3L 2ALYB 1S3OA 2OWOA 1I94Q 3F1ZA 1W3SA 3KJOA 3KYHC 1FJGQ 3PUZA 2HIVA 2Q2HA 3CMAA 2CWAA 5C44H 1Q7YC 3FKIG 3GTGH 3K8AA 2QEXA 5ELOA 4DV3Q 4LF8L 1TWGH 3HOZG 1OXXK 3CMEA 2Q2IA 1K83H 4JI1L 1EFWA 2JA8G 5M3FG 1KXLA 3CCSA 2R92G 2AKWB 4IJLA 1Q8KA 1TWFH 3KDFA 3CC4A 1WOCA 4IFDI 2R6GA 4L5SA 4LF6Q 1CKNB 1NJIC 1GVPA 3S1NH 4DR4L 1AH9A 4A3EH 4LF4Q 4AQYL 3CC2A 2I5HA 1HH2P 4GNXC 3S1MH 2WFWA 5BR8Q 3HOUH 4P73A 5C44G 1L0WA 3F2CA 4GNXB 2UUBL 1TXYA 3W5OA 4BBSH 1SE8A 5C0XI 1PV4A 4IPGA 2ES2A 1EOVA 1YVCA 1A63A 2HIXA 1KRTA 1VQ7A 3CCMA 3RZOH 2NN6G 4DAMA 3KFUA 3I2ZA 2K5NA 2KENA 3S2HH 4B3SL 3HOWG 4LWCA 1MJCA 5M5WH 1HZ9A 1WCMG 4IPDA 3JAMc 3HOUG 4OO1G 1VQDA 4JBWA 1VQHA 3MXNB 4AYBE 2UUCQ 2JEAI 4LUZA 2RF4A 4UP7A 4JBKA 4LFAL 4BBSG 4YHHQ 4X65Q 1J5EL 3S14H 1Q86C 1HR0Q 2AHOB 3PSIA 3KJPA 3CCUA 1XMOQ 1MKHA 3GTMH 3TQYA 2ZTCA 1N36Q 2KHJA 1ASZA 3WWVA 2N8NA 1VQCA 1HNWL 4AIMA 3BZKA 3J7A5 4YWKA 3GD7A 5LMNW 4JBMA 3E9HA 3BJUA 3HOXH 2OQ0A 4DK6C 5C0XG 4QIWE 1VQ5A 3H15A 1E1TA 3FP9A 3STBC 4A3LH 2NVTH 1LTLA 4DUYL 2F4VQ 3TEHB 1UE1A 4C3IH 2IX1A 1K0RA 5E7NA 5C3EG 4YCVA 4GKJL 4APVA 4X66Q 2AWOA 5M3MH 1PH8A 1L1OB 3CCQA 2NVQH 5JJIA 1B8AA 1D8LA 1X3GA 2JA6G 1OTCA 4L5RC 3M7NA 3E9IA 5M5YH 4X6AH 3KLWA 5K36G 5DLQE 1S40A 3MEFA 3UDXA 2NVYH 4BXXH 1NMFA 4LFBL 2N3SA 4JV5Q 1QVGA 2QA4A 3I56A 2MQHA 1XMQL 2HHHQ 1Y1VH 4AQYQ 4DV4L 1K8AC 3JC66 1O7IA 2I5LX 3RN2A 4JI8L 1A0IA 2NVXH 2JA7H 3UE0A 4HJAA 4B3ML 2UU9L 4DR2L 1IL2A 3PUYA 1PVOA 3A74A 2RHQB 2WAQG 4DV1L 5M5XH 1JJ2A 2XGTA 1WJJA 1YZ6A 4A75A 2Q2UA 1OXVA 1L2FA 2MFIA 4J15A 1VQKA 3HOVG 1JJCB 4P75A 1KC8C 2R7ZH 2Z6KC 3OW2A 4A3DG 4FDBA 1N32L 1VQJA 3CCJA 3CCRA 1AE3A 2JEBI 4QJFA 4GNXA 4GOPC 1PHJA 4JI6L 4GN4B 2RCNA 4DR6L 1TWCH 4LFAQ 3I4MH 1FGUA 1J5EQ 1N34L 1SMXA 4DK3C 3B6YA 1OXSC 3A5ZB 4NXML 1FL0A 1I3QH 1VQ4A 3CPFA 2VQEL 4RG1A 1Z9FA 2BA1A 3BU2A 2D62A 4A93H 3EIVA 3NEMA 3J80c 4IOAA 1E24A 2MNAA 4HIKA 3U4VA 5AJ3Q 3FKIH 5HY6A 4JYAL 3S24A 2WB1G 3UE1A 4A3IG 1VS0A 2DUDA 4BY1G 3HOZH 1YNXA 3PIOA 5J3BA 2R92H 4JI4Q 3S2DH 3PF5A 2ZJPA 4KHPL 2E2HH 5IT9c 2LXKA 1YHQA 1HZBA 4GKKL 2UXBQ 4DUYQ 1GM5A 2NN6I 2GN5A 4QQBX 4A3CG 3T1HL 4X62L 3J81c 4POGA 4A93G 1P16A 3HKZG 3M4PA 1UE7A 1QVFA 1WFQA 4HJ9A 4GLXA 3T1YQ 4OO1I 4DUZL 5FLMH 4DKAC 2VL6A 3U50C 3H3VI 3DLLA 3PGZA 1IYJB 1VQ6A 2QGQA 2F3IA 4YWLA 4AYBG 4LFBQ 1I50H 2WB1E 2Y0SE 4UY8C 4QL5A 3K7UC 1IZ6A 2VW9A 2I0QA 4L5QA 4DV4Q 4B3TL 3HOWH 1L1OA 2K75A 1WCMH 1NE3A 3TS0A 2IY5B 5LMNQ 2R7FA 1YEZA 3PF4A 1H95A 4MTNA 1P8LA 5FLMG 2VQFQ 3CD6A 2B29A 1GD7A 2UU9Q 2B63G 4DR2Q 3H3VH 2UXCQ 1PH2A 1KAWA 1KL9A 1QVCA 1K8GA 2ZM6L 1E3PA 3G48A 2YTVA 3HKZE 1IBMQ 3I4NG 4P71A 3HOYG 1Y1WG 1OXUA 4PG3A 4K0KL 1VCIA 4OONA 5HGQA 4DV5L 2A1AA 4A3FG 1X9NA 1N32Q 1V43A 1I5FA 1LM0A 5LMUL 3L2PA 3G4SA 2E5LQ 1N33L 1IBKQ 4DV6Q 2ID0A 1K9MC 4DR7Q 2KHIA 2N78A 5JJKA 4YWMA 4NB3A 4DR5L 4JI6Q 4IFDJ 3CCVA 1ASYA 3GTPH 4JI0L 4DR6Q 1PFSA 3EN2A 1PA6A 1KRSA 4B3RQ 2C35B 1N9WA 2IT1A 5IP9G 4IJHA 1YJWA 2YYZA 4KHZA 4LF9L 3A0JA 1UEBA 3M85A 4JBJA 2VQEQ 5IP7H 2JA5G 3ULLA 4NXNL 4HIOA 1XNRL 5C3EH 2UXDQ 3F8TA 3RLOA 3AYHB 1JB7A 1VQAA 4LF5L 2Z6KA 2CQOA 1M90C 3J7ZC 2JQOA 4OWXB 3FHWA 4PZ6A 1IBLL 2VUMG 4GOPA 4DNIA 4JG2A 4A3JG 4WJ4A 2JA6H 3D31A 4JOIC 3W1GA 1SN8A 5IWAL 2E2IH 2KBNA 4AH6A 3GO5A 2ZTEA 2YTYA 1XPRA 3PO3H 1EIYB 2R93G 2L15A 2N49A 4DR3Q 3M4OH 5IP7G 3RLNA 1YIJA 3RZDH 1JT8A 4QY7A 1X55A 2LXJA 4KLKA 4GN3B 1CKOA 4JI3L 1SRUA 1HNZL 3S17H 4LFCL 1A8VA 3S15H 1HJPA 2JJQA 4R4IA 2UUAL 5JEAJ 4LF8Q 4JI1Q 5ELNA 2D0PA 4QGUA 1XPUA 4DV7L 3H0GG 1VQMA 3OTOL 3S1QH 2A8VA 4IO9A 4YY3L 3PO3G 2KCTA 5IYBH 4BY7G 3IRBA 1UE5A 4DR4Q 4A76A 3HOVH 4A3KH 4A3DH 1WYDA 2F52A 1EIFA 1Z47A 4JI7L 1VQOA 4HJ5A 4OX9L 3GDEA 1I94L 1NBWA 5IYDG 3PIPA 2UUBQ 1FJGL 1BKBA 2CCZA 3K7AH 2AWNA 3ER0A 2ZM6Q 2E2JH 1X6OA 3M4QA 4C2MH 3ERSX 5IE8A 5IYBG 2H5XA 3U4ZA 4A3KG 2LSSA 4R1JA 4YCUA 5LMUQ 1KQSA 4B3SQ 4LF6L 4MNOA 2D0OA 3G71A 3VDYA 4A3IH 5JEAG 3KOJA 4BY1H 4DV0L 1FVIA 4LF4L 2KCMA 3K81C 3CF5A 1PH3A 2K5VA 4GOPB 4IPCA 4TQUS 3EBEA 5GROA 2CWPA 1E7ZA 2FXQA 3BZCA 1VQPA 2JE6I 1VQLA 1PH6A 4DV2L 4WJ3M 1R9TH 4A3CH 1LYLA 2ZJQA 1XNRQ 3GTOH 3CAMA 1MIUA 4XTCS 1HNWQ 4UP8A 2B3GA 2GVAA 1XJVA 4JCVE 2YU9H 3AFQA 4A3GH 1CUKA 2Y0SG 4R4TA 3CPWA 1IBLQ 2ATWA 1WI5A 2XTIA 1OXTA 4YCWA 1I6HH 3KF6A 5IWAQ 3I55A 1PH4A 5C4XG 2PQAA 1YHAA 2UUCL 3E0EA 1TWAH 1EQQA 4JI5L 2PI2E 3M9BA 4YHHL 5EAYA 4Y7NH 1X56A 1HR0L 1XMOL 4GKJQ 5IYCG 1A62A 1N36L 2HQLA 1KIXA 3RNUA 3GTQH 4HIDA 4A3GG 1VQBA 2UUAQ 2B63H 1K3RA 1NTGA 1XTDA 3OTOQ 3A5UA 5H1SE 4A3MG 1XPOA 2IX0A 3I4NH 1Q46A 3HOYH 1B70B 1Y1WH 1SFOH 4R4CA 4TVAB 4A3FH 4HIMA 2IHFA 1XMQQ 4HJ7A 3GTLH 4Y52H 4JI7Q 1C9OA 1CSPA 2F4VL 4LUOA 1U0LA 4JI8Q 1D7QA 4DR1L 1GKHA 2PI2A 1G291 3U58A 1Q82C 1EUJA 4B3MQ 3AEVA 1PYBA 4X66L 3OYYA 1BVSA 5FJ8H 4RMFA 4C3HH 4DV1Q 2MO1A 5IP9H 4BBRG 1N8RC 4LF7L 4A3BG 1JE5A 1VQ8A 3G6EA 2CKZB 1JMCA 4UP9A 3UDGA 2JA5H 1EQRA 2OCEA 3F2DA 1SR3A 3TREA 2VUMH 4IOCA 4JV5L 1U5KA 4DV0Q 1X54A 1YI2A 1HNXL 2OQKA 2V1CC 1CSQA 4A3JH 1Q81C 3CQZH 2HHHL 4OXPA 3JAMi 3CCLA 1XNQL 3PO2H 3AQQA 5GAEC 3PUVA 5FJ8G 3KF6B 1N34Q 1VQGA 1Q1EA 4NXMQ 4HJ8A 2PQAB 3RN5A 2R93H 4DV2Q 4JI2L 2WP8J 3UDFA 1KD1C 3M3YH 2HT1A 5C0XJ 1YJ9A 2I5MX 1KHIA 2VNUD 3NELA 4JYAQ
chains in the Genus database with same CATH superfamily
4S3SA 4A3EG 2HGSA 3RD4A 2R87A 3CP0A 2BH8A 4J9RA 1Y14B 4J9KA 2A68D 3ICEA 3E5NA 1G51A 4LUVA 4JI5Q 4DL5A 1R4PB 3I4OA 3VPBA 1BQQT 4J8QA 1AN8A 2YV5A 3RF2A 4H7BA 1DXMA 1QB5D 4MZ9A 4WORA 5M3MB 3PR4A 3LWUA 2L55A 2K4KA 3CHBD 1VMPA 3U9SA 1YITA 5M5YB 4ZHQF 2SCUB 3CXCA 1PYSB 1U4MA 4DR1Q 1SLJA 1C0AA 2W8KA 3QZ7A 4C56C 1VQFA 5EOYA 1K8MA 4J6HA 2NVXB 3Q1KA 3GV6A 5EKKA 2JA7B 4PMWA 4PDBA 4O4IF 1UWVA 4C5CA 3SE0A 1H9KA 2K50A 4LH7A 1NY4A 4M1UB 3TZUA 3J81W 3E0JA 4UPAA 2B2TC 3BVZA 1HNXQ 1YJNA 1UE6A 4QB4A 5IOCA 2BCOA 5KNBA 1XNQQ 2R7ZB 1AFPA 5C4XH 5M3MG 5KX5F 4NW2A 3M9MB 1GUNA 1BNZA 2KQ3A 5F2DA 1WTRA 3JAME 1XMQH 5C4JH 1LT4D 2B2UC 4DL4A 2RDJA 3GIQA 3KF8B 1CKNA 4JK1C 2L9HA 3DM1A 4BXXG 3VYRA 1X65A 2E8GA 2L11A 2R8IA 1IBMH 2MPMA 4L5TA 2JA7G 4X64Q 2EIFA 3HXLA 1V1QA 5CBAE 4B3RL 3L0OA 1IBKH 4PZ7A 5M3FB 4XZ3B 3TRZA 4E6IA 4JI6H 4TV8F 5C1OA 4ME3A 5IYZF 3RBDA 3HFZB 5J22A 3L3OC 2W6MA 4F4XA 1T9HA 3DEPA 2R7ZG 1AW7A 1HPCA 1BBWA 3FVQA 1HZAA 4R8NA 4BBRH 3NSWA 2IP4A 2UXDH 2FLNA 1KABA 5JJLA 2K5WA 4N8X1 4TUYF 4EQ5A 3OHAA 2YZMA 4J9QA 1PH9A 4ECUA 4EX5A 4KHVA 4RKBA 4QWCA 4DR3L 2ALZA 1XDNA 3F1ZA 1W3SA 3G6JB 1FJGQ 3PUZA 3CMAA 5EPJA 4BS9A 4G7ZC 1F2ZA 3GTGH 2F0QA 4LF8L 4X62H 4JI1L 1V8QA 1EFWA 5M3FG 4DXGA 4BBSB 4I4TF 1TWFH 2EY6A 3UI2A 1S03G 1WOCA 3X3MA 2NVYA 5KFLA 1NJIC 1GVPA 4DR4L 4A3EH 3BG5A 1XWEA 4YBZB 2XD4A 1HH2P 5KFYA 2WFWA 3HOUH 2XWJB 3NTHA 5C44G 4J9SA 2JEIA 4IALA 1UNNC 2ES2A 4F88A 1A63A 2HIXA 1XTCD 3RZOH 3MAQA 4DAMA 3JRWA 1CZWA 3I2ZA 1ESFA 4HSPA 5COYA 1MJCA 5M5WH 2QK4A 5C5MA 4OO1G 5I47A 4JBWA 3F2UA 4AYBE 2JEAI 2FK2A 4LUZA 1CQFA 1TWCA 4BBSG 5C5LA 5LMUH 1R4QB 2XRQD 1MKHA 3GTMH 3TQYA 1LTAD 3WWVA 4QWBA 2C2DA 2FFKB 4RGNA 3FKIA 4ED6A 4JBMA 3E9HA 3RIZA 2OQ0A 4DK6C 1A3UA 1C3OA 4QIWE 2W70A 3STBC 3OWEB 5KT5A 4PV1C 4DNTB 2E2HA 1LTLA 3VR6A 2WAQB 1SCUB 4AYBA 3BVMA 3TEHB 5E7NA 4UFZA 3HZXA 5EPKA 1T3NA 4GKJL 4A3DB 4X66Q 1SE2A 5M3MH 1YNJC 1K8OA 1X3GA 1B6RA 1NR2A 4R7RA 3E9IA 4HSVA 4JI3H 5M5YH 4X6AH 4RZQA 5C8YF 5EKIA 2W7OA 5DLQE 1GYFA 5BN4A 4EFBA 4BXXH 2ZJTA 1NMFA 2H1EA 2R82A 1SFOA 2QA4A 2W9BA 3I56A 1XMQL 4IHJF 4QIWA 1HNZL 3EA6A 4AQYQ 1O7IA 2NVXH 2JEGA 4YY3H 2JA7H 1SNDA 5KFBA 1GXDC 4OGQC 3L9AX 3W2DA 1IL2A 1PVOA 4DF7A 5D1OA 4PMCA 1M7JA 2HDLA 2WAQG 2WKCA 1JJ2A 4A75A 2Q2UA 3A54A 3KLSX 4V190 3T5KA 4J15A 3D8GA 3OSOA 4A3DG 2R7ZH 1KC8C 1ET6A 4ZLTF 3ORRA 3CCRA 1AE3A 4JI6L 4QJFA 2OLSA 3K3VA 2EJFC 2RCNA 4A3GB 3FRPB 1Q8IA 2HCCA 1SMXA 2NZ1D 4M8AA 1FL0A 3R3OA 5KFPA 1VQ4A 4DV0H 5FD6A 4XDXA 1Z7TA 4KD3A 4ED1A 2FLLA 1E24A 4KY5A 2Z6BA 5KFOA 4FM9A 1N34H 2W7PA 3MXNA 3UE1A 2K33A 4YJ3F 1VF5C 2F03A 3H40A 1CQIB 2JA6A 5FK9C 5IT9c 1HUNA 4GKKL 1HZBA 2SDFA 3QB3A 3I4NB 1GM5A 2EYLA 2GN5A 1UEAB 5IGFA 1DD2A 4A3CG 3GP7A 1B9NA 4X62L 1CS0A 3RTXA 4JVZA 4EGVA 2UVRA 4RHRA 4FO2A 3TBIB 1SYBA 4JI5H 3IFTA 2VL6A 1SJED 1SXTA 3BAAA 2EYHA 4CDFC 3V4ZA 4YWLA 5C1PA 1BCPC 4LSXA 3PMFA 4FF4A 2A6HD 5KG6A 2WB1E 1NAPA 1SAPA 2FPGB 1IZ6A 2VW9A 2JA5B 1UC8A 4CJ2C 2R84A 4B3TL 3TS0A 1GHJA 2IY5B 4OO1H 2RA4A 2Z9HA 1FYCA 3P7JA 3PF4A 1K0SA 3GV7B 2J7ZA 2UU9Q 4DR2Q 3BDOA 1PH2A 1KAWA 1E2VA 1K8GA 2R85A 3PO2B 2F4VH 1E3PA 2KECA 3I4NG 2J9GA 3T5LA 4DR1H 1B3QA 1STAA 2R93B 4EYHB 4ECRA 3C46A 1I5FA 1N33L 2B8GA 5LMUL 3M3YB 2I07B 5KYIA 3PW0A 1T5XD 1SE4A 4IFDJ 2WB1A 1A6XA 4EVOA 4FVMA 4B3RQ 4N9TA 1SYGA 4E4TA 2A69D 3H0GB 1ONLA 3EVQA 2YYZA 1SNPA 1UEBA 1HNXH 5M9OA 3OMGA 2JA5G 3MC0B 4BY7B 1XNQH 3F8TA 4HCEA 2BQ3A 4OHJA 3AYHB 3GIMA 4YJ2F 2CQOA 2QILA 4O42A 4OWXB 3FHWA 4PZ6A 3J7ZC 1DJRD 3S17B 4DNIA 3QG1A 3S15B 1JICA 1BOSA 3MWMA 3PVXA 4Q45A 1E4EA 2ZTEA 1H9SB 3P1HA 5KFWA 1EWCA 2OF1A 1VDZA 1CK1A 1EIYB 2R93G 4O4HF 2HD3A 4DR3Q 4GC7A 3I70A 5E4XA 1X55A 2F0SA 2K7VA 1CQVA 4JI3L 3TMEA 2AU0A 4X64H 3SEBA 1IOWA 1IL8A 1YNND 3QOJA 3UFXB 4PMBA 4LF8Q 5DM73 4JI1Q 4RKLA 2D0PA 4QGUA 4DV7L 3H0GG 4RNNA 3MZ5A 4DK1A 1VQMA 2BE5D 2A8VA 1SYXB 4I7AA 5NUCA 4YY3L 3PO3G 4BY7G 3ETJA 4DR4Q 2PN1A 4A3DH 4A3KH 5JVDF 1JCKB 1WYDA 4MV4A 1VQOA 4O3RA 3GDEA 3K5IA 1VKZA 1L0YB 2Y0SB 5KT2A 2E74C 2EY5A 2ZM6Q 1Z2PX 1SYFA 2EYFA 3M9OB 3GTGA 3N40P 3ERSX 2M00A 5IE8A 5IYBG 1Q3LA 2FJZA 1FJGH 1CI3M 4R1JA 1TWFA 3T1YH 5C3XA 5CR3A 2D0OA 2F4IA 3VDYA 3H20A 3KOJA 2VUMA 4DV0L 2EYJA 1D1IA 2KCMA 4XYMB 4IPCA 4TQUS 5CORA 5C6AA 3EBEA 1QILA 2CHBD 2CWPA 5A2QW 1E7ZA 3BZCA 4HQ6A 3R93A 1VBGA 2E2DC 2OT2A 1WH2A 1WTPA 4A3CH 2ZDHA 3RV3A 4FXDA 2DIKA 3I8ZA 4ME6A 3AFQA 4A3GH 2Y0SG 4R4TA 1X32A 4RHSA 2XTIA 2WTFA 2CW0C 2R7NA 2M2LA 2R61A 1S5FD 1TWHA 2VA3A 1TIID 4JI5L 3M9BA 5L9XA 2IJ0A 4KJNA 4A3BB 1TVXA 2R8JA 4DV6H 4MA5A 4DR7H 4O3NA 3J81L 4GKJQ 3GTLB 3TP5A 1RD9D 1G8ZD 3GTQH 1TKWB 2PCFB 5KFTA 3SK4A 5I9OA 2DJFC 5JQWA 4DK0A 3OTOQ 3A5UA 4IZ8A 1A3TA 1KDBA 2IX0A 3I4NH 1DV1A 1G91A 4MA0A 3I91A 1EQTA 2WV6D 2GPWA 1BCPB 1TWGB 1F9RA 3MWDA 4MV9A 1K83B 2BDNA 1XMQQ 4Y52H 3RB3A 3RUZA 2F4VL 5FKAC 1U0LA 1D7QA 5JVH3 4DR1L 1GKHA 1PK8A 4ZCKA 2SNSA 1PYBA 1BVSA 4RMFA 4RUAA 2DY7A 4ME5A 3R5XA 4A3BG 2O03A 3MR5A 1JMCA 2JA5H 4UP9A 4YP3A 5EBDA 4X66H 2OCEA 3K5NA 3F2DA 5KFIA 1STHA 2IWHA 5KGUA 3N52A 1CA6A 3PW5A 3K5HA 1ZYRD 1HNXL 1C30A 2AQ3B 2I8CA 3JAMi 3PO2H 1XNQL 4G7HC 1EYZA 4OELB 3PZPA 4ECYA 2NVXA 2P5ZX 2O2LD 4HJ8A 2PQAB 2R93H 2RDHA 4DV2Q 2WP8J 4RA8A 4AQYH 3M3YH 1EY0A 3GV5B 3S14B 4KV6A 2VNUD 3OHBA 4WD3A 3WNZA 3BZDB 1SNMA 5EBCA 1LTGD 4P72A 2PNHA 3H0GH 3J80E 3L7ZC 3CW2C 3FDSA 4QUFA 4GKKQ 1QUQB 2FP4B 4X64L 2PZWA 4BY7H 4BA2I 1X3EA 1II3A 3Q0AA 1BBUA 4B3SH 4X62Q 3KF8A 2AMCB 1JDBB 2NVTB 3Q8PB 5CV8A 4ETSA 1SROA 3AU7A 2B2YA 4ABNA 3A56A 1IXRA 2GVBA 1J8IA 4F50A 1JLLB 1EYGA 1JOKA 2NZOA 5AJ3L 1F2MA 3K0YA 3PV0A 4POFA 5KT4A 2G9DA 2NVQB 1BXTA 5CAEB 3N6XA 4DAYB 4NDXA 2BA0A 4QCLA 3ND8A 4B3TQ 1X3PA 3KDFB 2HDMA 2QDBA 4ZRZA 5GAGC 5KEEA 1EIGA 4RGTA 5I9PA 5KNCA 1HA6A 2WIIB 1WR2A 3T53B 1PH7A 3KAJA 1ENAA 3T1YL 4ALPA 2C5CA 4TV9F 2NTTA 2BH2A 1RIPA 4IUNA 4R4OA 4DLKA 4LNQA 1I4QA 3VPCA 2BQUA 1B7YB 1V1PA 3GTKH 3GIKA 4A3LG 1N33Q 3MR6A 1STYA 1E2ZA 1M8AA 2L5TA 5D3IB 2K52A 3RBEA 3CRLC 1JR0D 1QZGA 3EPIA 4IPHA 1JWUD 2OTLA 1O7LA 4U6PA 4IUTA 4GN5A 5LP6F 2DNEA 4EG0A 1HCZA 2QDLA 3S9WA 4HCSA 1RTOA 2R8GA 2RQXA 3LGJA 4A4IA 1CKMA 2Q2TA 1F9QA 4GLAC 1U9RA 5TSSA 5JPMC 4JC0A 3FDTA 3KHRA 1I3QB 4J9NA 4DR2H 1GUTA 2UU9H 2MO0A 1QZHA 1E0BA 4IUQA 1U4RA 4DV6L 1K3BC 4DR7L 1RL2A 1RJTA 4J9OA 3RMHA 4ED7A 1EY9A 1Q1BA 2OXPA 1KLUD 1YBYA 3QZ8A 3HOZB 2C9OA 2YZGA 3OIQA 1D6EC 2F0JA 4FS2A 5HGTA 1NNXA 1PZID 4HAEA 4JI3Q 2EQSA 2FK3A 2D5DA 2VZAA 2NUAB 2CH4A 1PH1A 4QF4A 1EFID 3NENA 4B3RH 3HBLA 3H94A 2Z0SA 3VYSA 4DAPA 4DV7Q 2FE3A 2WAQE 2D9UA 3MJFA 3ND9A 3ZJYC 3CC7A 4A3BH 4OWTB 4YY3Q 1EYDA 3K3PA 2JA8H 5I4DA 4X3UA 1E22A 1MI2A 4ECSA 2PMZB 2R8HA 4JYAH 1GLVA 4RU9A 4UCVA 1TQOA 1S3OA 2DN8A 1FR3A 4RWSC 1JORA 3KJOA 2C22A 2J6TA 1ET9A 3N8DA 4XQQA 2HIVA 4IN3A 5KG4A 3K57A 3HOUB 1WCMB 3DMUA 3K8AA 5ELOA 2QEXA 4DV3Q 1TWGH 3HOZG 1Z2NX 3CMEA 2Q2IA 1K83H 4MHEA 2F0GA 3U9TA 2WAQA 2B2VA 2O4XA 1I4GA 4JI1H 4AQYL 2I5HA 3W3AA 4G4KA 1Y1VA 3NQIA 5BR8Q 4P73A 4QUCA 1BCPF 1L0WA 4GNXB 1HXYD 2C00A 2UUBL 1DONA 4DR4H 3GTPB 4IWYA 1PFMA 4I7ZC 1KRTA 1GUGA 5KFMA 2M05A 3CCMA 1S10A 2HVSA 4OIJA 3GTMB 3BYTB 2KENA 2B2TA 3KUPA 2ZM6H 4B3SL 5KFRA 2JSOA 3HOUG 1WCMG 3Q24A 1VQDA 1VQHA 3ZYYX 5KFJA 4DV5H 1EQVA 4X65Q 3S14H 1WD0A 3PSIA 5CB4F 2E2IB 3CCUA 4Q8FA 2KOLA 1BJTA 3HRZC 5J1ZA 1BXRA 2KHJA 5ELDA 5IT9E 2B8FA 2L0CA 3HP3A 1ENCA 1JQYD 4NP5A 4X3KA 1EY6A 4AIMA 3RZDB 2YCHA 5KFKA 1PRTF 4LF9H 3J7A5 2TSSA 3GD7A 1EZ8A 3BJUA 5BN5A 3K6OA 4CJ0B 1VQ5A 1ZKOA 3FP9A 4A3LH 2DWCA 2NVTH 4F4WA 5FOBB 1QE6A 2K1BA 3IL8A 2F4VQ 1KJJA 5EQ0A 1EY4A 4CBVA 2VPSA 4MIUA 2A6ED 1TS2A 5KFXA 1PH8A 4J0MA 2RBMA 4MV3A 2NVQH 2VXWA 1WTOA 2I80A 4IUVA 4DN4M 4L5RC 2VOBA 4GKJH 1CHPD 3KLWA 3K5LA 4CDCC 5K36G 2W6OA 1DZ1A 4M9UA 1JX4A 2E2JB 1TS4A 5DM63 4DNRB 1QVGA 2MQHA 2EJMA 3WDNA 3OTOH 2ZXRA 4JI8L 5E1FA 2NB0A 3UE0A 2W9CB 1PTOD 3QO2A 4DR2L 2UU9L 1A2TA 1W6JA 5I2XA 2C28A 2RHQB 1JOQA 2XGTA 2Z1CA 1ZQ7A 2EYMA 1OXVA 2JA5A 1VQKA 1KAAA 3MXPA 1R9TB 1A2UA 2JP1A 2EY2A 4FDBA 3OW2A 1VQJA 2PNRC 3OUZA 3HKZB 2JEBI 1K28A 4GOPC 4EFEA 4R8UB 1S0OA 4LFAQ 4HMJA 5I6WA 1MSGA 1RKNA 1I3QH 2R93A 3OMCA 2D62A 3EIVA 3J80c 4IOAA 5D8DA 4HIKA 4KKSA 2IA6A 2PVPA 1B2TA 5AJ3Q 4JYAL 3S24A 4DV2H 3HOZH 1ICFB 2EXZA 1B50A 4U68A 3PIOA 2B63B 5J3BA 3NUCA 5GONF 4KHPL 2EYPA 1B33N 4DUYQ 4PQXA 2K5QA 3HEJA 3MFYA 1Y1WB 3T1HL 3J81c 4A3FB 3HKZG 1QVFA 4PWQA 5KT6A 4GKKH 1TA8A 1ESRA 3T1YQ 2IPKD 1RDPD 4DUZL 4OO1I 1QNUA 4DKAC 5JPNC 1EZ6A 1O7ZA 2UVWA 5A2QL 1H9SA 1KTKA 3TN2A 3RB4A 4FBUA 2F3IA 3VPDA 1JXLA 5L1LA 1HQMC 2AUJD 1I50H 2Y0SE 1ZEQX 4UY8C 1WVLA 1AZQA 2I0QA 3T4AC 1PX2A 1N48A 5CGKA 1L1OA 1YNNC 1WCMH 2XC9A 1YEZA 4MTNA 1KLGD 3I3CA 2B63G 3FEWX 1SBBB 2Q8IB 4EEYA 2RGRA 1KL9A 1QVCA 2ZM6L 4B3TH 1BO0A 2R86A 1Y1WG 4C2MA 2EOTA 1OXUA 5ISRA 4OONA 5HGQA 3QOLA 4DV5L 2A1AA 4A3FG 1N32Q 1V43A 3C0FB 3G4SA 4OIKA 4DV6Q 4DR7Q 2Z4IA 5JJKA 4NB3A 1LTSD 3GTPH 4DR6Q 2L4NA 3EN2A 5FLXW 3GV3A 1KRSA 3BQ0A 1N33H 3C2PA 3OOCA 1PMRA 2F3WA 3NTKA 5KFHA 3R8BA 2ZDGA 1YJWA 4LF9L 4KHZA 3CU7A 2V59A 4JV5H 2VQEQ 4K14A 5IP7H 4HIOA 3H6MA 3BA9A 4IWXA 1PLFA 5CV9A 1S0NA 2YU9A 4WJ4A 4JG2A 3S1RB 3D31A 3C1FA 4FP5D 1SN8A 2FMMA 2E2IH 2KBNA 3I90A 1EU3A 2C2RA 5K36H 1HFNA 1JDEA 2YTYA 5J2UF 1LABA 4IUUA 4U673 3OUUA 1TWAA 2L15A 1HA5A 2N49A 1QNKA 1YIJA 3RZDH 4ED3A 2LXJA 3V6JA 4A3KB 3EQLC 3HG9A 1D5MC 1UAPA 4K5WA 2F0DA 4V0BA 1FNWA 1HJPA 1STBA 4R4IA 1GSAA 2QYZA 4RB1A 5KFNA 5JEAJ 3H4DA 5KFVA 2MUYA 5LL6X 3OTOL 4UCOA 4IO9A 4F87A 1O75A 1NCVA 3IRBA 4UHVA 4A76A 4DV7H 3GTLA 1EIFA 1LTID 4OX9L 4L8JA 4GC6A 2W6PA 4QW9A 2PQEA 3PIP3 5A35A 2UUBQ 1AUXA 4HMIA 1BKBA 1MSHA 3M9NB 2F0IA 5DG7A 2E2JH 1X6OA 3M4QA 1S5BD 2EY1A 3T16A 4DU9A 5EDWA 1K83A 4A2BA 4A3KG 3NP8A 1KQSA 4O2BF 4B3SQ 4DV3H 2KHSA 5JEAG 4MAMA 1FVIA 2VB2X 2NU6B 1PH3A 2K5VA 4GOPB 1M0WA 4MTDA 4DL7A 4IQZA 4IZOA 1F2YA 2FJ2A 4MV6A 4A3MB 3T5HA 2B39A 4OL7A 1VBHA 4DV2L 3MFHA 1R9TH 4FS1A 1LYLA 2ZJQA 5L37A 1XNRQ 1V4YA 5BR8H 3CAMA 1MIUA 4UP8A 2B3GA 2GVAA 1XJVA 3GTJB 2VQFH 1CUKA 3BG3A 2ATWA 4H13C 4APMA 1WI5A 4YCWA 3GTQB 3MR2A 3J7YW 3TINA 4UCTA 4HNTA 1KNAA 2PQAA 1W96A 1A3VA 1YHAA 5FO7B 4KK7A 4ZAIA 1HQRD 2BQRA 1FGBD 4YHHL 1WTQA 1B1ZA 2XWBB 4DA2A 5IYCG 1A62A 4B9XA 2HQLA 3RNUA 4A3GG 3IG0A 4X65H 3L4KA 2B63H 3H4BA 5KG5A 3JAMW 5DAUA 4A3MG 1XPOA 1SYDA 5HURA 1Q46A 1Y1WH 4K2LA 4R4CA 1JWMD 4A3FH 5C4HA 4HIMA 4Y8VB 4HJ7A 1KBLA 2O5IC 4JI7Q 3ERQA 1KJQA 1CSPA 1STGA 4JI8Q 5LA6F 5FO9B 3AEVA 4EGQA 4FXKC 3OYYA 5FJ8H 3OHXC 4C3HH 3D6WA 1S4ZA 2MO1A 5IGEA 2WE6A 2W8LA 1AZPA 2QF7A 1BNCA 4DAYA 3UDGA 1F9PA 5CC4A 1TR5A 4QWEA 2FMCA 4JV5L 1DM0B 3EPGA 2J0TD 1YI2A 2V1CC 5IIFA 4OXPA 3S2HB 5G3LF 3V6HA 4LH6A 3KF6B 2UVUA 4ZOLF 1PRTC 4K8IA 3IFDA 2W9AA 3DWQA 2MHVA 1KD1C 1OWTA 2HT1A 4WBNF 5C0XJ 2KEDA 1YJ9A 2YS7A 2I5MX 3P75A 2K28A 5CV7A 4JYAQ 1IHZA 4PZ8A 2YZNA 1VQIA 2NZHA 3BQ1A 3TIGA 1W2BA 5L1IA 4H44C 3PO2G 3A7LA 4DPGA 2Z8LA 4KHPQ 1SMYD 1DGSA 2MGSA 2MJ8A 4XIGS 5CV5A 4TQRA 1G6PA 3G6VA 2K14A 4JW0A 2DLNA 4LW1A 1GO3E 2EZVA 2I46A 2JXMB 3T1HQ 3BDLA 3HOXB 4U7CA 3GQCA 2CFMA 3A8KE 3VMMA 4IFDG 1I3QA 3J81j 2DJGC 3S1RH 4DUZQ 4LFAH 3Q8QB 4C3IB 5KKNB 2JN4A 3Q6SA 2RDGA 2PMZE 5GADC 2W6ZA 3TQ1A 2F0HA 4NPSA 1AE2A 3PW4A 1VQ9A 4RAUC 5LHY1 4JI4L 4RGOS 3K0XA 1HZCA 2UXBL 2QEJC 4J9PA 3GTKB 5JVG3 2EDGA 3NBIA 5JEAH 1TS5A 2NVYB 2B2WA 3R23A 1G2TA 1B9MA 3OSPA 2KCNA 3Q8DA 2DPJA 2JK8A 2ASBA 4DUYH 4DAVA 3MA2B 4LF7Q 3ONAB 5KG3A 4KY6A 3K80C 4DV3L 2ZJRA 3F2BA 5EWGA 3HOXG 2F0OA 2X6GA 4DV5Q 4XT3B 1MJEA 2PMZA 5KFSA 4Q43A 4IRDA 1HR0W 2IHEA 2WINB 3T5JA 1C7YA 3KBGA 4C3IG 1BF4A 5HBRB 1PZJD 4FU0A 4OWWB 5BR8L 3FMCA 4DFAA 2KCCA 1WCMA 2PW5A 2VQFL 1BBXC 2UXCL 4LF9Q 3JZIA 4X3SA 2X6LA 5GQOA 4JI2Q 3Q2OA 2CVRA 2RHSB 2CW7A 2LS01 5IYCH 1QOHA 2PZTA 1QG7A 2QW7A 4ECXA 1X3FA 3AFPA 4RNMA 3R2IA 5GAHC 3JRXA 2E5LL 3ULJA 1KDAA 2VQDA 4A3MH 3KLSA 3FKIB 3O13A 5ELBA 4IR1A 3GTPA 5BPFA 4EBDA 1N32H 4X65L 1JJGA 4JV0A 3MWYW 5KYLA 2JA8B 3GTJH 2R92B 4FF1A 3S2DB 3STBD 3SGIA 2E2HB 1UC9A 4DR6H 3GTMA 2LKVA 4RAYA 2A68C 3DM3A 4RZRA 2A74C 1Q12A 3GIPA 2K5HA 4HN7A 5BPHA 1S72A 4JOIA 2VQEH 4C1NI 3ULPA 3AMUA 4IURA 1B4OA 2OTJA 5F9NA 1PYWD 3TSSA 1MD2D 3GLKA 3PN1A 4OX9Q 2ALYB 2NU7B 3KYHC 2Q2HA 4XQJA 4CGYB 2CWAA 2DY8A 5KFAA 3TP7A 3FKIG 4ULLA 2K6AA 5CA1F 2ASDA 1HFGA 1OXXK 2NBFA 3D6CA 2JA8G 2KUMA 3CCSA 2R92G 2AKWB 4IJLA 4JPBW 3CC4A 2P0AA 3GILA 5DQGA 2ICEC 4YQWA 1OO9B 2IX3A 2A6EC 3K58A 4ED2A 4ZUIA 2A5HA 3DWPA 3CC2A 3Q8SB 4GNXC 2F0FA 4BWGB 2JA7A 4ED0A 1TXYA 1AP0A 3W5OA 1PRTB 1SE8A 3DXJC 1PV4A 4TSSA 2VA2A 2KSWA 1EOVA 3K59A 4IFDH 2XCAA 2NN6G 2UUBH 2K5NA 1HRJA 3S2HH 3J7AF 2R7ZA 3D4DA 1B04A 1IW7D 3JSLA 2W9CA 3A7AB 3MXNB 1I6UA 2RF4A 3PQIA 4UP7A 4LFAL 3N41B 5C0XH 4YHHQ 3G7LA 2JA6B 4ECWA 3GIJA 4G3IA 1DIKA 1NSNS 1AEXA 1CTMA 4CDDC 2ZTCA 4DR5H 4JI0H 1ASZA 5KFFA 1R9TA 4WJWA 1SNCA 1VQCA 3A55A 4C1NK 3V05A 1EOTA 3J81E 5KFEA 1SSOA 4YWKA 5LMNW 4J9LA 4NXNH 1XNRH 3T56B 3HOXH 4YIJA 1MGSA 1E1TA 3BQ2A 3A8IE 3SK8A 5E3FA 1X3QA 3S1QB 4ECVA 4DUYL 1ILQA 4C3IH 1UE1A 4L63B 2IX1A 1W6KA 1Z6HA 1K0RA 5DQIA 4RGMA 4YCVA 1Z2OX 5T14A 4APVA 3HOVB 3PR5B 1MBYA 5FLXL 5JJIA 1B8AA 1ICWA 1D8LA 1XYIA 5LOVF 2B63A 2JA6G 3SDZA 1OTCA 1EY5A 1PFBA 3M7NA 1I7NA 3N43B 1S40A 4K2KA 4NKLA 1RJQA 3MEFA 2K03A 2NVYH 2N3SA 2RCFA 3OIPA 4JV5Q 1ILPA 4WRDA 3MEHA 2W6QA 1K8AC 3JC66 2I5LX 4JV2A 3RN2A 1I4XA 4QMGA 2RKSA 3ITPA 3MR3A 4HJAA 1XXGA 2WB1B 4A3IB 4B3ML 4BY1B 4X3TA 3PUYA 3Q22A 4JI7H 3I73A 4KKUA 4JI8H 4B9WA 3F8NA 1YZ6A 1L2FA 2MFIA 5DEHA 4B08A 1JJCB 3HOVG 2FHTA 1N32L 2Z6KC 2CW8A 1D5ZC 2PO4A 3CCJA 3GTOB 1LACA 1LV9A 4DR6L 1TWCH 2F0MA 4FF2A 2QCPX 2EJGC 1J5EQ 3SK5A 1I6HB 4DK3C 4EQPA 4LF6H 5CYUA 4NXML 1E4EB 3CPFA 2VQEL 4RG1A 1Y8NB 4LF4H 4KJOA 4A93H 3TIIA 2FLPA 3NEMA 2IMWP 4Y7NB 4LMQD 2B2YC 2X0SA 3FKIH 4XQNA 2WB1G 4A3IG 5EWEA 4BY1G 1YNXA 2NUCA 2XNAC 2PZUA 2R92H 3E6ZX 4JI4Q 3CKIB 2ZJPA 3S2DH 5I2YA 2E2HH 2UXBQ 3LNNA 2Z4HA 4K8JA 3VR4A 4QQBX 5IGGA 1GUOA 1I50B 1ULZA 4HR7B 2K04A 1P16A 3U9OA 2R7MA 4KHPH 2N55A 4HJ9A 2UUCH 4GLXA 3WO1A 5FLMH 2M9VA 3DUZA 3T1HH 1D2BA 3DLLA 1SYEA 3PGZA 4LMYA 1VQ6A 1XMOH 1JOOA 3EJIA 3BS1A 1G2SA 4XXEA 2IW3A 4DUZH 4CHTB 2NN6H 3IKJA 2HCIA 4LFBQ 2UVVA 3JSNA 1E4GT 4K6DA 1JB3A 2L1BA 4DV4Q 1IKMA 1RHPA 1D5XC 5FPOA 2K75A 1NE3A 2F0LA 2R7FA 1H95A 1P8LA 2VQFQ 2VUMB 2B29A 2UXCQ 3H3VH 4A3JB 1V1OA 3CQZB 1LTTD 1IKLA 4ID6A 4P71A 1BR9A 5JVLA 2V4RA 5JOBA 5KG2A 2F0NA 2KJXA 4MN3A 4K0KL 1VCIA 2X69A 5DG9A 1TY0A 4O3SA 4ILWA 3L2PA 2E5LQ 1K9MC 2ID0A 4LF7H 2KHIA 2N78A 4RB0A 4DR5L 1ASYA 2G5DA 3JAML 4JI0L 1PFSA 1EWHA 3NTIA 1ML0D 3FMAA 3R5FA 5KFQA 2C35B 5IP9G 1NR4A 2B2UA 1I4PA 3M85A 3LWBA 4JBJA 3WO0A 3LWEA 4F4YA 1SJHD 4NXNL 1XNRL 3KAKA 4IR9A 2BDOA 3IAYA 1JB7A 1VQAA 4LF5L 1EL0A 5EZYF 1WSCA 4QWDA 2VUMG 4CKCA 1QCBD 2JQOA 4G7OC 1KXLA 4JI2H 4HNUA 4GOPA 4A3JG 4ZKBB 2JA6H 2AGOA 2SOBA 2XCLA 1EY7A 3GO5A 1XPRA 1HUMA 2AQ2B 2XGQA 1I4RA 5IP7G 3GV8B 4QY7A 1SYCA 1RCVD 3GTJA 2NWGA 4KLKA 4GN3B 1CKOA 4HNVA 2HVRA 1LT6D 2NYZD 3D4WA 4LFCL 1A8VA 4K5XA 2JJQA 4P2CB 1TU2B 2F1MA 4FYDA 1CT1D 2NU9B 3BJYA 3GTQA 3BABA 4CJ1B 5ELNA 1XPUA 3GIDA 3S1QH 3RGXA 2SNMA 1XX8A 2FINB 1M4VA 2KCTA 5KFDA 1F77A 1UE5A 1DCZA 3HOVH 3N42B 1BUVT 2B2VC 3NE5B 4JI7L 1B53A 4XX0B 2LMCB 4HJ5A 1GSOA 3J80W 1I94L 4MV1A 1NBWA 4YR3A 1EEID 5IYDG 1B44D 3WOEA 2YRXA 1J9OA 2AWNA 3ER0A 1SEBD 4OX9H 4CKBA 2A6HC 5K5PA 4R8IA 1O78A 1GSHA 1GOZA 4KMUC 3U4ZA 2I87A 4MTEA 2LSSA 4KTAA 1KJ9A 5LL6b 4LF6L 3EFXD 3G71A 4A3IH 3HB9A 4EBEA 3LX0A 4BY1H 3R2TA 4LF4L 3SVMA 1DOLA 3NPPA 2FXQA 1VQPA 1VQLA 1FKAH 4XYOA 3GTOH 4XTCS 3ORQA 2SEBD 2YRWA 5LMNH 4EQNA 3OW7A 1IBLQ 1I6HH 3S16B 2LY7A 4PNYA 3KF6A 1SNQA 2A69C 5IWAQ 5FPRA 3RFCA 2FMAA 1PH4A 3H0GA 4TQSA 5L1KA 2UUCL 3E0EA 2OH2A 2ASJA 5DQHA 2IL8A 4J1MA 3MFIA 5EAYA 4Y7NH 1HR0L 4C3JB 1XMOL 4L1KA 5KT3A 2AGQA 4A2AA 2MP1A 1N36L 3KTMA 1F2LA 1VQBA 4C5BA 3KK7A 4YHHH 2UUAQ 1K3RA 1SMYC 2CH4W 1NTGA 1XTDA 5H1SE 2V4DA 4C3HB 5C44B 3SXHA 5KG1A 1B70B 5EGTA 1CE8A 3RUPA 5L1JA 4IUPA 1AN7A 4TVAB 3VA7A 2IHFA 1V1PB 2V58A 4LUOA 2F0EA 4RH6A 4EBCA 4RB3C 1M6VA 2ENBA 1Q82C 1EUJA 4B3MQ 3S1NB 4FXGC 3VR5A 4F7XA 3Q8RB 2BE5C 1RK5A 2ZXOA 3D3RA 3TP6A 3S1MB 4LF7L 4KKTA 5IP9H 2D2CC 4QW8A 1JE5A 5CV6A 3G6EA 2CKZB 4C3JG 1F9SA 1H9JA 3GTKA 1IOVA 3TREA 2QKIC 3CRKC 5J2TF 2VUMH 4IOCA 1U5KA 2Y0SA 5H80A 4A3JH 1Q81C 2HHHL 2PPBC 3KHGA 3CQZH 1EHIA 3AQQA 1PDQA 5FJ8G 4C3HG 2EE1A 1Q1EA 4NXMQ 5KG0A 1PZKD 1VF7A 3URYA 4JI2L 2AQ1B 2PW7A 3UDFA 4DXFA 2KVMA 1KHIA 3LP8A 3NELA 3DWAA 3SR1A 3RB6A 4UAIA 1PTOH 2HQEA 3KBXA 3ETHA 3M4YA 4JV1A 1TWHH 1YHBA 4R4QA 5CBEE 2EPBA 3TS2A 1WTWA 1VQEA 1LO5D 1HTPA 4KI0A 4ECZA 2ZT9C 4GLVB 3AB9A 4XT1B 1PTOF 1LUZA 3OWFA 2CZGA 3RR5A 3QIAA 5IYDH 1J5EH 1VQNA 5LYJF 2AQ4A 5D14A 3T51B 2YS6A 4GS3A 4KY7A 2YTXA 1U4PA 1T5EA 5ELEA 3D0FA 5DLFA 1HNWH 4O2DA 3W1BA 3NK9A 2R92A 5A2QE 5G3LD 4EYIB 5DGAA 2A73B 5E4WC 4QWAA 3D4RA 1CZGA 2RSNA 2WKDA 4N8FA 4BA1I 1GUWA 1RYSA 2DPIA 1L1OC 4H02A 4JI4H 1PH5A 2JA9A 4Q5VA 1Y1VB 2EXDA 5FLXc 2UXBH 4DL3A 1MHWC 1SE3A 2EVBA 5KFZA 4ECTA 2VR1A 5CA0F 2YL2A 1TWGA 2O5JC 1EIHA 1T36A 4P74A 4R9WA 2DGYA 1K73C 3MXUA 4K0KQ 5IT9W 2A19A 3BA8A 3HKSA 1RJPA 4ODGA 3NBHB 1J6QA 4ZYSA 1V9PA 5M5XB 4DR5Q 5D1PA 4JI0Q 2VS1A 4LAAA 3I7FA 2VY3A 2XRSD 1KC7A 1EYCA 2HUGA 2F0KA 3CCEA 4KN7C 5LMNL 2ZDQA 3UQ8A 4LFBH 4CC6A 4DV4H 4NXNQ 2XN9C 3I4MB 1ZETA 1M1KC 1IBML 1L2ZA 4LF5Q 4UCSA 1ZYRC 2F0VA 3V96A 5I6YA 3J80i 2UXCH 1WD1A 3PCOB 1E1OA 5CMDA 1Y1VG 4H0LC 1IBKL 4DV1H 2WDTA 1EWIA 1QWYA 4F8MA 2V5AA 2R7DA 2YW2A 1KNEA 1A9XA 1GJXA 5EWFA 1I4HA 3PUWA 2ZTDA 1HTLD 2E5LH 1FNUA 3KHHA 2RDIA 4I50F 3UDIA 3N6RA 3J81i 1HNZQ 5KFUA 4LFCQ 2UXDL 3S16H 1NMGA 3RLFA 5JH7F 1IW7C 1EZ1A 4O0AA 3MTSA 5IY0A 1Q90A 3SE7A 4IAJA 1QUQA 2TMPA 2CQYA 1RF2D 2KEEA 5BN3A 1STEA 4C3JH 5M3FH 3I4MG 3H09A 1DOMA 5KFGA 4F4ZA 1IYUA 2F0UA 3KLRA 3PUXA 2OWOA 1I94Q 4HEDA 4RAZA 3TQTA 3EYYA 1WTVA 4O3PA 5C44H 1Q7YC 3HOWB 1ZXTA 1K1SA 3H3VC 3MXGA 1C48A 4RCNA 2WYOA 4FF3A 3SI8A 3SHLA 2G9HD 1S97A 4M7EA 1Q8KA 3KDFA 1C8CA 5KT7A 4IFDI 4YAJB 2R6GA 4L5SA 4LF6Q 2FK1A 4YAKB 4EEQA 1CKNB 1AH9A 3S1NH 2AGPA 2MCTA 3VR3A 4LF4Q 3E3XA 2K01A 3S1MH 1C4QA 3MVVA 1I6VC 2E75C 3CVZA 1N56A 2R6FA 3F2CA 5BMVF 1LTRD 5AFWA 3PW7A 4BBSH 2F0WA 5C0XI 3DHQA 2W6NA 2XIWA 4IPGA 4CKEA 3I12A 1YVCA 3RJ0A 1KEEA 1VQ7A 3NHHA 3KFUA 1WTHA 5C3EB 3HOWG 1S0MA 4LWCA 5C4ZA 1FNVA 1HZ9A 4IPDA 3JAMc 4ZQIA 3J7AV 2FKLA 2NTSA 2H4OA 2UUCQ 5D65A 4JBKA 2W57A 3K5MA 1BGWA 1J5EL 1Q86C 1HR0Q 2AHOB 3KJPA 1XMOQ 2JEFA 3QFFA 2BOSA 5DLGA 4N9PA 1N36Q 1JWSD 4YB8B 3PO3B 2GLTA 2N8NA 2PYKA 3M4OB 3GTOA 1HNWL 3BZKA 1GUSA 1ZHQA 3RGZA 4ZK9B 1RYRA 1CA5A 5C0XG 5JUMA 3H15A 3T13A 1S68A 5IGBA 3FPUB 1IBLH 4LJZC 2HVQA 3J7AK 1GGOA 4ZQ3A 2FPIB 3RV4A 5C3EG 5IWAH 2FPPB 2RDFA 5KNDA 2AWOA 1L1OB 3CCQA 4MV8A 1IYVA 4YR2A 2J6SA 2XCPA 3I72A 3OPOA 4ZUJA 3K7AB 3H91A 3UDXA 1Y8PB 1LLRD 3K5OA 4LFBL 2UUAH 2RGVA 4C2MB 1I50A 4HR7A 2HHHQ 1Y1VH 4DV4L 2PBZA 5DGBA 1VAJA 4EQOA 1A0IA 4O1NA 1AUVA 4RFBA 3RAQA 4XYQA 2AUKA 2JEJA 1TWCB 3A74A 1I7LA 2VB3X 4DV1L 5F9LA 5IGCA 5M5XH 4ZI7F 1WJJA 4CC5A 5T1IA 4B3MH 4MV7A 3DEOA 4IRCA 4P75A 2XGPA 3NGDA 1LTBD 3VR2A 3P20A 2R7LA 4A93B 3KHLA 4GNXA 1PHJA 1ENFA 4GN4B 2YU9B 4I55F 2R3ZA 2NU8B 4HYKA 3CQZA 3G8CA 2XVSA 3QWNA 1FGUA 3I4MH 4RB2C 1N34L 4L6TB 1QJOA 1CM9A 1OXSC 3A5ZB 3B6YA 1M0TA 1K1QA 3MWEA 4TKOB 1RJRA 2EYOA 4AYBB 1TWAB 1Z9FA 2BA1A 3BU2A 2F0PA 2ICIA 2MNAA 3BDCA 3J80L 2J6UA 4NXMH 3U4VA 5HY6A 4K6LA 3WOFA 5FO8B 1CQJB 1VS0A 2DUDA 1YNJD 4UDUC 3M7GA 4UCRA 5LXTF 2GPSA 3BYYB 5LL6S 3RAXA 4FNFA 3PIO3 1SDFA 1KJ8A 2E2IA 3PF5A 1S5ED 3RB0A 2LXKA 1GHKA 5J39A 1YHQA 3IN5A 1EYAA 1MZBA 2NN6I 3HOYB 2K32A 4POGA 1SFOB 4A93G 2W9BB 1Y8OB 2E76C 4QIWB 3M4PA 1UE7A 4LK1C 1WFQA 2B2WC 2KA7A 1SNOA 4RNOA 3H3VI 3U50C 4YR0A 1O7YA 4IRKA 5KG7A 5JAVA 1IYJB 5KIXA 3M4IA 2QGQA 5D1OB 4I7HA 1JC7A 4AYBG 3KALA 3TZDA 2R8KA 4Q0FA 4QL5A 3K7UC 4L5QA 3NQTA 3SK6A 3HOWH 1E2WA 1EY8A 5LMNQ 2CQAA 3X3NA 5FLMG 3CD6A 1GD7A 1O80A 1JIHA 2OEOA 3G48A 2YTVA 3HKZE 5EPLA 1IBMQ 1Y69U 3HOYG 2N88A 1ZHSA 1WTXA 4PG3A 1X9NA 4MTKA 3GQBA 1LM0A 1T94A 1IBKQ 1TT2A 1E4FT 4YWMA 4JI6Q 2BR0A 2VPQA 2V9WA 1PTOC 3CCVA 4NLGA 4DGZA 2K5DA 2W71A 4K0KH 1PA6A 4O3QA 2IT1A 1N9WA 2RSOA 2WACA 4IJHA 3A0JA 1BDOA 5T1GA 4ED8A 3ULLA 2Q8RE 2UXDQ 5C3EH 1LT5D 1RODA 1FD7D 3RLOA 1PFNA 3HKZA 2Z6KA 3TP8A 1EUDB 4R8UA 1M90C 3LMLA 1IBLL 1TS3A 4JOIC 3W1GA 5IWAL 5IODA 3V2TA 4AH6A 4LF5H 3PW2A 3PO3H 3N44B 5C5JA 1BCPD 2YYAA 1H9MA 1D1KA 3M4OH 3RLNA 2ZXPA 4ZKCB 5KRUA 1JT8A 1S5DD 2L12A 1SRUA 3S17H 3HS0C 3S15H 2R7KA 2UUAL 4OEMB 3NXWA 5EKLA 2XSCA 1EUCB 1HNZH 1V51A 4EGJA 4LFCH 4O2AF 4UCUA 5IYBH 2JYOA 3C3LA 1Y1WA 3MHBA 2F52A 2RVLA 3G6YA 1Z47A 1CFMA 5DNFA 2C2EA 1VMCA 1NUCA 3PIPA 1TAEA 1FJGL 2CCZA 3K7AH 1DV2A 4Q0YA 5ELFA 5C4XB 1UUPA 1PRTD 4C2MH 1I94H 3E5SA 4LSAA 1DYQA 1U4LA 5JJZA 2H5XA 5C4JB 4YCUA 5LMUQ 2VUGA 1KDCA 4MNOA 3R5HA 3DF7A 4KN4C 3BVGA 4K5VA 3K81C 3CF5A 1LT3D 2XIGA 1B3AA 5GROA 5D3DA 2JE6I 4DL6A 1PH6A 4WJ3M 3OSNA 4NMZA 4HTHA 1EU4A 1RK6A 4XYLB 3C1EA 1HNWQ 1G6ZA 4KD4A 4FBTA 4JCVE 2YU9H 3CPWA 4RUCA 1OXTA 1HHVA 4CDEC 5CV4A 1CHQD 3GIIA 3I55A 5C4XG 5HV6A 4J9MA 1SEIA 1S9FA 2J4XA 2K05A 4I65A 1A15A 1TWAH 1TY2A 5IT9L 1EQQA 4BBRB 4GZYC 5IGDA 4WFN3 2PI2E 1X56A 3QR8A 3V6KA 2GA4B 2Q8TA 1PXUA 4O4LF 4C5AA 3VA5A 1KIXA 4HIDA 5FD5A 1RTNA 1EEFD 1HR0H 2F0TA 3Q23A 1S5CD 3V4SA 1N36H 3HOYH 1H9RA 5FLXE 2LFNA 3GTGB 2F3VA 1SFOH 1DOKA 3MFGA 4JUZA 4Q44A 4Q8EA 3GTLH 3KXYT 3G6XA 1C9OA 1TWFB 4O3OA 3NWSA 1JE4A 2PI2A 1G291 3U58A 2ATLA 3I4LA 2FB9A 4A3EB 3QJYA 4X66L 4TRDA 4ECQA 4Z9CB 5K2MA 4DL2A 2ASLA 5ELCA 5EJWA 4DV1Q 3NWTA 4BBRG 4G57A 1N8RC 4BWSC 4DR3H 2IBKA 3VYUA 1VQ8A 3FPPA 1JKJB 1STNA 1EQRA 1KJIA 1SR3A 3L4JA 4RCOA 5KFCA 5DG8A 2V4QA 4LF8H 4DV0Q 1X54A 3RZOB 1L0XB 2OQKA 1CSQA 1B6SA 3CCLA 1PTOB 5GAEC 3PUVA 5C3WA 2CW0D 1N34Q 1VQGA 3VYTA 2HJWA 5M5WB 3HGBA 3EROA 1TWHB 3RN5A 2DZDA 2HHHH 3NBHA 1W93A 3A8JE 1UNSA 2DNCA 3TDQA
chains in the Genus database with same CATH topology
4PZ8A 4A3EG 1VQIA 2NZHA 4P72A 3CP0A 2BH8A 2PNHA 1Y14B 1W2BA 3PO2G 3H0GH 3ICEA 4DPGA 3L7ZC 1TWHH 1YHBA 3CW2C 4R4QA 1DGSA 4KHPQ 4GKKQ 1QUQB 4XIGS 4X64L 3TS2A 4BY7H 1G51A 4LUVA 2K14A 1VQEA 1X3EA 4JI5Q 4LW1A 4BA2I 1GO3E 1G6PA 1BBUA 3T1HQ 4X62Q 2CFMA 2AMCB 3I4OA 4KI0A 4IFDG 4GLVB 3J81j 1LUZA 1SROA 3S1RH 3RR5A 4DUZQ 1IXRA 2GVBA 5IYDH 2YV5A 1VQNA 1EYGA 2NZOA 2PMZE 5AJ3L 5GADC 4MZ9A 3PV0A 4NPSA 4POFA 1AE2A 4GS3A 2YTXA 3D0FA 1VQ9A 2K4KA 4JI4L 4O2DA 3W1BA 4DAYB 3K0XA 1HZCA 2BA0A 2UXBL 1YITA 4B3TQ 3KDFB 3CXCA 5GAGC 1PYSB 4DR1Q 1C0AA 1SLJA 4BA1I 1PH7A 1L1OC 4H02A 1PH5A 2JA9A 1VQFA 3Q8DA 5FLXc 2EXDA 2JK8A 3T1YL 4ALPA 2ASBA 4LF7Q 4DV3L 3K80C 1RIPA 4R4OA 2BH2A 2ZJRA 4PMWA 3F2BA 3HOXG 4LNQA 4P74A 2DGYA 1K73C 4K0KQ 4DV5Q 1B7YB 1UWVA 1MJEA 3GTKH 4A3LG 1N33Q 2A19A 1HR0W 3HKSA 2K50A 1NY4A 2IHEA 2K52A 3NBHB 1J6QA 1V9PA 4UPAA 4DR5Q 1C7YA 1HNXQ 1YJNA 4JI0Q 1UE6A 2VS1A 1QZGA 4IPHA 2OTLA 4OWWB 1XNQQ 3I7FA 2VY3A 4GN5A 5C4XH 5M3MG 5BR8L 5LMNL 3CCEA 2VQFL 2UXCL 4LF9Q 3LGJA 5GQOA 4JI2Q 4A4IA 5C4JH 1CKMA 2Q2TA 4NXNQ 4GLAC 2RHSB 1M1KC 1IBML 5IYCH 3KF8B 4LF5Q 1CKNA 4JC0A 4BXXG 1X65A 3J80i 1X3FA 3PCOB 3AFPA 2MO0A 5GAHC 1E1OA 1QZHA 2E5LL 1Y1VG 3ULJA 1IBKL 4DV6L 2E8GA 4DR7L 1RL2A 4A3MH 1EWIA 4L5TA 2R7DA 2JA7G 1Q1BA 4X64Q 2EIFA 1V1QA 1YBYA 3PUWA 4X65L 2ZTDA 3L0OA 4B3RL 1JJGA 4PZ7A 3GTJH 3TRZA 3STBD 3SGIA 3UDIA 4JI3Q 2EQSA 4ME3A 3J81i 1HNZQ 2VZAA 4LFCQ 2UXDL 3HFZB 1PH1A 3S16H 3DM3A 1NMGA 1T9HA 3NENA 3RLFA 2R7ZG 1Q12A 4O0AA 5IY0A 2K5HA 2Z0SA 4DV7Q 1BBWA 1HZAA 2WAQE 1S72A 4JOIA 1QUQA 4BBRH 3ULPA 3ZJYC 3CC7A 4A3BH 4OWTB 4YY3Q 2JA8H 4C3JH 5M3FH 5JJLA 3I4MG 4EQ5A 1PH9A 1E22A 2OTJA 4EX5A 4OX9Q 3PUXA 4DR3L 2ALYB 1S3OA 2OWOA 1I94Q 3F1ZA 1W3SA 3KJOA 3KYHC 1FJGQ 3PUZA 2HIVA 2Q2HA 3CMAA 2CWAA 5C44H 1Q7YC 3FKIG 3GTGH 3K8AA 2QEXA 5ELOA 4DV3Q 4LF8L 1TWGH 3HOZG 1OXXK 3CMEA 2Q2IA 1K83H 4JI1L 1EFWA 2JA8G 5M3FG 1KXLA 3CCSA 2R92G 2AKWB 4IJLA 1Q8KA 1TWFH 3KDFA 3CC4A 1WOCA 4IFDI 2R6GA 4L5SA 4LF6Q 1CKNB 1NJIC 1GVPA 3S1NH 4DR4L 1AH9A 4A3EH 4LF4Q 4AQYL 3CC2A 2I5HA 1HH2P 4GNXC 3S1MH 2WFWA 5BR8Q 3HOUH 4P73A 5C44G 1L0WA 3F2CA 4GNXB 2UUBL 1TXYA 3W5OA 4BBSH 1SE8A 5C0XI 1PV4A 4IPGA 2ES2A 1EOVA 1YVCA 1A63A 2HIXA 1KRTA 1VQ7A 3CCMA 3RZOH 2NN6G 4DAMA 3KFUA 3I2ZA 2K5NA 2KENA 3S2HH 4B3SL 3HOWG 4LWCA 1MJCA 5M5WH 1HZ9A 1WCMG 4IPDA 3JAMc 3HOUG 4OO1G 1VQDA 4JBWA 1VQHA 3MXNB 4AYBE 2UUCQ 2JEAI 4LUZA 2RF4A 4UP7A 4JBKA 4LFAL 4BBSG 4YHHQ 4X65Q 1J5EL 3S14H 1Q86C 1HR0Q 2AHOB 3PSIA 3KJPA 3CCUA 1XMOQ 1MKHA 3GTMH 3TQYA 2ZTCA 1N36Q 2KHJA 1ASZA 3WWVA 2N8NA 1VQCA 1HNWL 4AIMA 3BZKA 3J7A5 4YWKA 3GD7A 5LMNW 4JBMA 3E9HA 3BJUA 3HOXH 2OQ0A 4DK6C 5C0XG 4QIWE 1VQ5A 3H15A 1E1TA 3FP9A 3STBC 4A3LH 2NVTH 1LTLA 4DUYL 2F4VQ 3TEHB 1UE1A 4C3IH 2IX1A 1K0RA 5E7NA 5C3EG 4YCVA 4GKJL 4APVA 4X66Q 2AWOA 5M3MH 1PH8A 1L1OB 3CCQA 2NVQH 5JJIA 1B8AA 1D8LA 1X3GA 2JA6G 1OTCA 4L5RC 3M7NA 3E9IA 5M5YH 4X6AH 3KLWA 5K36G 5DLQE 1S40A 3MEFA 3UDXA 2NVYH 4BXXH 1NMFA 4LFBL 2N3SA 4JV5Q 1QVGA 2QA4A 3I56A 2MQHA 1XMQL 2HHHQ 1Y1VH 4AQYQ 4DV4L 1K8AC 3JC66 1O7IA 2I5LX 3RN2A 4JI8L 1A0IA 2NVXH 2JA7H 3UE0A 4HJAA 4B3ML 2UU9L 4DR2L 1IL2A 3PUYA 1PVOA 3A74A 2RHQB 2WAQG 4DV1L 5M5XH 1JJ2A 2XGTA 1WJJA 1YZ6A 4A75A 2Q2UA 1OXVA 1L2FA 2MFIA 4J15A 1VQKA 3HOVG 1JJCB 4P75A 1KC8C 2R7ZH 2Z6KC 3OW2A 4A3DG 4FDBA 1N32L 1VQJA 3CCJA 3CCRA 1AE3A 2JEBI 4QJFA 4GNXA 4GOPC 1PHJA 4JI6L 4GN4B 2RCNA 4DR6L 1TWCH 4LFAQ 3I4MH 1FGUA 1J5EQ 1N34L 1SMXA 4DK3C 3B6YA 1OXSC 3A5ZB 4NXML 1FL0A 1I3QH 1VQ4A 3CPFA 2VQEL 4RG1A 1Z9FA 2BA1A 3BU2A 2D62A 4A93H 3EIVA 3NEMA 3J80c 4IOAA 1E24A 2MNAA 4HIKA 3U4VA 5AJ3Q 3FKIH 5HY6A 4JYAL 3S24A 2WB1G 3UE1A 4A3IG 1VS0A 2DUDA 4BY1G 3HOZH 1YNXA 3PIOA 5J3BA 2R92H 4JI4Q 3S2DH 3PF5A 2ZJPA 4KHPL 2E2HH 5IT9c 2LXKA 1YHQA 1HZBA 4GKKL 2UXBQ 4DUYQ 1GM5A 2NN6I 2GN5A 4QQBX 4A3CG 3T1HL 4X62L 3J81c 4POGA 4A93G 1P16A 3HKZG 3M4PA 1UE7A 1QVFA 1WFQA 4HJ9A 4GLXA 3T1YQ 4OO1I 4DUZL 5FLMH 4DKAC 2VL6A 3U50C 3H3VI 3DLLA 3PGZA 1IYJB 1VQ6A 2QGQA 2F3IA 4YWLA 4AYBG 4LFBQ 1I50H 2WB1E 2Y0SE 4UY8C 4QL5A 3K7UC 1IZ6A 2VW9A 2I0QA 4L5QA 4DV4Q 4B3TL 3HOWH 1L1OA 2K75A 1WCMH 1NE3A 3TS0A 2IY5B 5LMNQ 2R7FA 1YEZA 3PF4A 1H95A 4MTNA 1P8LA 5FLMG 2VQFQ 3CD6A 2B29A 1GD7A 2UU9Q 2B63G 4DR2Q 3H3VH 2UXCQ 1PH2A 1KAWA 1KL9A 1QVCA 1K8GA 2ZM6L 1E3PA 3G48A 2YTVA 3HKZE 1IBMQ 3I4NG 4P71A 3HOYG 1Y1WG 1OXUA 4PG3A 4K0KL 1VCIA 4OONA 5HGQA 4DV5L 2A1AA 4A3FG 1X9NA 1N32Q 1V43A 1I5FA 1LM0A 5LMUL 3L2PA 3G4SA 2E5LQ 1N33L 1IBKQ 4DV6Q 2ID0A 1K9MC 4DR7Q 2KHIA 2N78A 5JJKA 4YWMA 4NB3A 4DR5L 4JI6Q 4IFDJ 3CCVA 1ASYA 3GTPH 4JI0L 4DR6Q 1PFSA 3EN2A 1PA6A 1KRSA 4B3RQ 2C35B 1N9WA 2IT1A 5IP9G 4IJHA 1YJWA 2YYZA 4KHZA 4LF9L 3A0JA 1UEBA 3M85A 4JBJA 2VQEQ 5IP7H 2JA5G 3ULLA 4NXNL 4HIOA 1XNRL 5C3EH 2UXDQ 3F8TA 3RLOA 3AYHB 1JB7A 1VQAA 4LF5L 2Z6KA 2CQOA 1M90C 3J7ZC 2JQOA 4OWXB 3FHWA 4PZ6A 1IBLL 2VUMG 4GOPA 4DNIA 4JG2A 4A3JG 4WJ4A 2JA6H 3D31A 4JOIC 3W1GA 1SN8A 5IWAL 2E2IH 2KBNA 4AH6A 3GO5A 2ZTEA 2YTYA 1XPRA 3PO3H 1EIYB 2R93G 2L15A 2N49A 4DR3Q 3M4OH 5IP7G 3RLNA 1YIJA 3RZDH 1JT8A 4QY7A 1X55A 2LXJA 4KLKA 4GN3B 1CKOA 4JI3L 1SRUA 1HNZL 3S17H 4LFCL 1A8VA 3S15H 1HJPA 2JJQA 4R4IA 2UUAL 5JEAJ 4LF8Q 4JI1Q 5ELNA 2D0PA 4QGUA 1XPUA 4DV7L 3H0GG 1VQMA 3OTOL 3S1QH 2A8VA 4IO9A 4YY3L 3PO3G 2KCTA 5IYBH 4BY7G 3IRBA 1UE5A 4DR4Q 4A76A 3HOVH 4A3KH 4A3DH 1WYDA 2F52A 1EIFA 1Z47A 4JI7L 1VQOA 4HJ5A 4OX9L 3GDEA 1I94L 1NBWA 5IYDG 3PIPA 2UUBQ 1FJGL 1BKBA 2CCZA 3K7AH 2AWNA 3ER0A 2ZM6Q 2E2JH 1X6OA 3M4QA 4C2MH 3ERSX 5IE8A 5IYBG 2H5XA 3U4ZA 4A3KG 2LSSA 4R1JA 4YCUA 5LMUQ 1KQSA 4B3SQ 4LF6L 4MNOA 2D0OA 3G71A 3VDYA 4A3IH 5JEAG 3KOJA 4BY1H 4DV0L 1FVIA 4LF4L 2KCMA 3K81C 3CF5A 1PH3A 2K5VA 4GOPB 4IPCA 4TQUS 3EBEA 5GROA 2CWPA 1E7ZA 2FXQA 3BZCA 1VQPA 2JE6I 1VQLA 1PH6A 4DV2L 4WJ3M 1R9TH 4A3CH 1LYLA 2ZJQA 1XNRQ 3GTOH 3CAMA 1MIUA 4XTCS 1HNWQ 4UP8A 2B3GA 2GVAA 1XJVA 4JCVE 2YU9H 3AFQA 4A3GH 1CUKA 2Y0SG 4R4TA 3CPWA 1IBLQ 2ATWA 1WI5A 2XTIA 1OXTA 4YCWA 1I6HH 3KF6A 5IWAQ 3I55A 1PH4A 5C4XG 2PQAA 1YHAA 2UUCL 3E0EA 1TWAH 1EQQA 4JI5L 2PI2E 3M9BA 4YHHL 5EAYA 4Y7NH 1X56A 1HR0L 1XMOL 4GKJQ 5IYCG 1A62A 1N36L 2HQLA 1KIXA 3RNUA 3GTQH 4HIDA 4A3GG 1VQBA 2UUAQ 2B63H 1K3RA 1NTGA 1XTDA 3OTOQ 3A5UA 5H1SE 4A3MG 1XPOA 2IX0A 3I4NH 1Q46A 3HOYH 1B70B 1Y1WH 1SFOH 4R4CA 4TVAB 4A3FH 4HIMA 2IHFA 1XMQQ 4HJ7A 3GTLH 4Y52H 4JI7Q 1C9OA 1CSPA 2F4VL 4LUOA 1U0LA 4JI8Q 1D7QA 4DR1L 1GKHA 2PI2A 1G291 3U58A 1Q82C 1EUJA 4B3MQ 3AEVA 1PYBA 4X66L 3OYYA 1BVSA 5FJ8H 4RMFA 4C3HH 4DV1Q 2MO1A 5IP9H 4BBRG 1N8RC 4LF7L 4A3BG 1JE5A 1VQ8A 3G6EA 2CKZB 1JMCA 4UP9A 3UDGA 2JA5H 1EQRA 2OCEA 3F2DA 1SR3A 3TREA 2VUMH 4IOCA 4JV5L 1U5KA 4DV0Q 1X54A 1YI2A 1HNXL 2OQKA 2V1CC 1CSQA 4A3JH 1Q81C 3CQZH 2HHHL 4OXPA 3JAMi 3CCLA 1XNQL 3PO2H 3AQQA 5GAEC 3PUVA 5FJ8G 3KF6B 1N34Q 1VQGA 1Q1EA 4NXMQ 4HJ8A 2PQAB 3RN5A 2R93H 4DV2Q 4JI2L 2WP8J 3UDFA 1KD1C 3M3YH 2HT1A 5C0XJ 1YJ9A 2I5MX 1KHIA 2VNUD 3NELA 4JYAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ8 A;  4A3E G;  1VQI A;  2NZH A;  4P72 A;  3CP0 A;  2BH8 A;  2PNH A;  1Y14 B;  1W2B A;  3PO2 G;  3H0G H;  3ICE A;  4DPG A;  3L7Z C;  1TWH H;  1YHB A;  3CW2 C;  4R4Q A;  1DGS A;  4KHP Q;  4GKK Q;  1QUQ B;  4XIG S;  4X64 L;  3TS2 A;  4BY7 H;  1G51 A;  4LUV A;  2K14 A;  1VQE A;  1X3E A;  4JI5 Q;  4LW1 A;  4BA2 I;  1GO3 E;  1G6P A;  1BBU A;  3T1H Q;  4X62 Q;  2CFM A;  2AMC B;  3I4O A;  4KI0 A;  4IFD G;  4GLV B;  3J81 j;  1LUZ A;  1SRO A;  3S1R H;  3RR5 A;  4DUZ Q;  1IXR A;  2GVB A;  5IYD H;  2YV5 A;  1VQN A;  1EYG A;  2NZO A;  2PMZ E;  5AJ3 L;  5GAD C;  4MZ9 A;  3PV0 A;  4NPS A;  4POF A;  1AE2 A;  4GS3 A;  2YTX A;  3D0F A;  1VQ9 A;  2K4K A;  4JI4 L;  4O2D A;  3W1B A;  4DAY B;  3K0X A;  1HZC A;  2BA0 A;  2UXB L;  1YIT A;  4B3T Q;  3KDF B;  3CXC A;  5GAG C;  1PYS B;  4DR1 Q;  1C0A A;  1SLJ A;  4BA1 I;  1PH7 A;  1L1O C;  4H02 A;  1PH5 A;  2JA9 A;  1VQF A;  3Q8D A;  5FLX c;  2EXD A;  2JK8 A;  3T1Y L;  4ALP A;  2ASB A;  4LF7 Q;  4DV3 L;  3K80 C;  1RIP A;  4R4O A;  2BH2 A;  2ZJR A;  4PMW A;  3F2B A;  3HOX G;  4LNQ A;  4P74 A;  2DGY A;  1K73 C;  4K0K Q;  4DV5 Q;  1B7Y B;  1UWV A;  1MJE A;  3GTK H;  4A3L G;  1N33 Q;  2A19 A;  1HR0 W;  3HKS A;  2K50 A;  1NY4 A;  2IHE A;  2K52 A;  3NBH B;  1J6Q A;  1V9P A;  4UPA A;  4DR5 Q;  1C7Y A;  1HNX Q;  1YJN A;  4JI0 Q;  1UE6 A;  2VS1 A;  1QZG A;  4IPH A;  2OTL A;  4OWW B;  1XNQ Q;  3I7F A;  2VY3 A;  4GN5 A;  5C4X H;  5M3M G;  5BR8 L;  5LMN L;  3CCE A;  2VQF L;  2UXC L;  4LF9 Q;  3LGJ A;  5GQO A;  4JI2 Q;  4A4I A;  5C4J H;  1CKM A;  2Q2T A;  4NXN Q;  4GLA C;  2RHS B;  1M1K C;  1IBM L;  5IYC H;  3KF8 B;  4LF5 Q;  1CKN A;  4JC0 A;  4BXX G;  1X65 A;  3J80 i;  1X3F A;  3PCO B;  3AFP A;  2MO0 A;  5GAH C;  1E1O A;  1QZH A;  2E5L L;  1Y1V G;  3ULJ A;  1IBK L;  4DV6 L;  2E8G A;  4DR7 L;  1RL2 A;  4A3M H;  1EWI A;  4L5T A;  2R7D A;  2JA7 G;  1Q1B A;  4X64 Q;  2EIF A;  1V1Q A;  1YBY A;  3PUW A;  4X65 L;  2ZTD A;  3L0O A;  4B3R L;  1JJG A;  4PZ7 A;  3GTJ H;  3TRZ A;  3STB D;  3SGI A;  3UDI A;  4JI3 Q;  2EQS A;  4ME3 A;  3J81 i;  1HNZ Q;  2VZA A;  4LFC Q;  2UXD L;  3HFZ B;  1PH1 A;  3S16 H;  3DM3 A;  1NMG A;  1T9H A;  3NEN A;  3RLF A;  2R7Z G;  1Q12 A;  4O0A A;  5IY0 A;  2K5H A;  2Z0S A;  4DV7 Q;  1BBW A;  1HZA A;  2WAQ E;  1S72 A;  4JOI A;  1QUQ A;  4BBR H;  3ULP A;  3ZJY C;  3CC7 A;  4A3B H;  4OWT B;  4YY3 Q;  2JA8 H;  4C3J H;  5M3F H;  5JJL A;  3I4M G;  4EQ5 A;  1PH9 A;  1E22 A;  2OTJ A;  4EX5 A;  4OX9 Q;  3PUX A;  4DR3 L;  2ALY B;  1S3O A;  2OWO A;  1I94 Q;  3F1Z A;  1W3S A;  3KJO A;  3KYH C;  1FJG Q;  3PUZ A;  2HIV A;  2Q2H A;  3CMA A;  2CWA A;  5C44 H;  1Q7Y C;  3FKI G;  3GTG H;  3K8A A;  2QEX A;  5ELO A;  4DV3 Q;  4LF8 L;  1TWG H;  3HOZ G;  1OXX K;  3CME A;  2Q2I A;  1K83 H;  4JI1 L;  1EFW A;  2JA8 G;  5M3F G;  1KXL A;  3CCS A;  2R92 G;  2AKW B;  4IJL A;  1Q8K A;  1TWF H;  3KDF A;  3CC4 A;  1WOC A;  4IFD I;  2R6G A;  4L5S A;  4LF6 Q;  1CKN B;  1NJI C;  1GVP A;  3S1N H;  4DR4 L;  1AH9 A;  4A3E H;  4LF4 Q;  4AQY L;  3CC2 A;  2I5H A;  1HH2 P;  4GNX C;  3S1M H;  2WFW A;  5BR8 Q;  3HOU H;  4P73 A;  5C44 G;  1L0W A;  3F2C A;  4GNX B;  2UUB L;  1TXY A;  3W5O A;  4BBS H;  1SE8 A;  5C0X I;  1PV4 A;  4IPG A;  2ES2 A;  1EOV A;  1YVC A;  1A63 A;  2HIX A;  1KRT A;  1VQ7 A;  3CCM A;  3RZO H;  2NN6 G;  4DAM A;  3KFU A;  3I2Z A;  2K5N A;  2KEN A;  3S2H H;  4B3S L;  3HOW G;  4LWC A;  1MJC A;  5M5W H;  1HZ9 A;  1WCM G;  4IPD A;  3JAM c;  3HOU G;  4OO1 G;  1VQD A;  4JBW A;  1VQH A;  3MXN B;  4AYB E;  2UUC Q;  2JEA I;  4LUZ A;  2RF4 A;  4UP7 A;  4JBK A;  4LFA L;  4BBS G;  4YHH Q;  4X65 Q;  1J5E L;  3S14 H;  1Q86 C;  1HR0 Q;  2AHO B;  3PSI A;  3KJP A;  3CCU A;  1XMO Q;  1MKH A;  3GTM H;  3TQY A;  2ZTC A;  1N36 Q;  2KHJ A;  1ASZ A;  3WWV A;  2N8N A;  1VQC A;  1HNW L;  4AIM A;  3BZK A;  3J7A 5;  4YWK A;  3GD7 A;  5LMN W;  4JBM A;  3E9H A;  3BJU A;  3HOX H;  2OQ0 A;  4DK6 C;  5C0X G;  4QIW E;  1VQ5 A;  3H15 A;  1E1T A;  3FP9 A;  3STB C;  4A3L H;  2NVT H;  1LTL A;  4DUY L;  2F4V Q;  3TEH B;  1UE1 A;  4C3I H;  2IX1 A;  1K0R A;  5E7N A;  5C3E G;  4YCV A;  4GKJ L;  4APV A;  4X66 Q;  2AWO A;  5M3M H;  1PH8 A;  1L1O B;  3CCQ A;  2NVQ H;  5JJI A;  1B8A A;  1D8L A;  1X3G A;  2JA6 G;  1OTC A;  4L5R C;  3M7N A;  3E9I A;  5M5Y H;  4X6A H;  3KLW A;  5K36 G;  5DLQ E;  1S40 A;  3MEF A;  3UDX A;  2NVY H;  4BXX H;  1NMF A;  4LFB L;  2N3S A;  4JV5 Q;  1QVG A;  2QA4 A;  3I56 A;  2MQH A;  1XMQ L;  2HHH Q;  1Y1V H;  4AQY Q;  4DV4 L;  1K8A C;  3JC6 6;  1O7I A;  2I5L X;  3RN2 A;  4JI8 L;  1A0I A;  2NVX H;  2JA7 H;  3UE0 A;  4HJA A;  4B3M L;  2UU9 L;  4DR2 L;  1IL2 A;  3PUY A;  1PVO A;  3A74 A;  2RHQ B;  2WAQ G;  4DV1 L;  5M5X H;  1JJ2 A;  2XGT A;  1WJJ A;  1YZ6 A;  4A75 A;  2Q2U A;  1OXV A;  1L2F A;  2MFI A;  4J15 A;  1VQK A;  3HOV G;  1JJC B;  4P75 A;  1KC8 C;  2R7Z H;  2Z6K C;  3OW2 A;  4A3D G;  4FDB A;  1N32 L;  1VQJ A;  3CCJ A;  3CCR A;  1AE3 A;  2JEB I;  4QJF A;  4GNX A;  4GOP C;  1PHJ A;  4JI6 L;  4GN4 B;  2RCN A;  4DR6 L;  1TWC H;  4LFA Q;  3I4M H;  1FGU A;  1J5E Q;  1N34 L;  1SMX A;  4DK3 C;  3B6Y A;  1OXS C;  3A5Z B;  4NXM L;  1FL0 A;  1I3Q H;  1VQ4 A;  3CPF A;  2VQE L;  4RG1 A;  1Z9F A;  2BA1 A;  3BU2 A;  2D62 A;  4A93 H;  3EIV A;  3NEM A;  3J80 c;  4IOA A;  1E24 A;  2MNA A;  4HIK A;  3U4V A;  5AJ3 Q;  3FKI H;  5HY6 A;  4JYA L;  3S24 A;  2WB1 G;  3UE1 A;  4A3I G;  1VS0 A;  2DUD A;  4BY1 G;  3HOZ H;  1YNX A;  3PIO A;  5J3B A;  2R92 H;  4JI4 Q;  3S2D H;  3PF5 A;  2ZJP A;  4KHP L;  2E2H H;  5IT9 c;  2LXK A;  1YHQ A;  1HZB A;  4GKK L;  2UXB Q;  4DUY Q;  1GM5 A;  2NN6 I;  2GN5 A;  4QQB X;  4A3C G;  3T1H L;  4X62 L;  3J81 c;  4POG A;  4A93 G;  1P16 A;  3HKZ G;  3M4P A;  1UE7 A;  1QVF A;  1WFQ A;  4HJ9 A;  4GLX A;  3T1Y Q;  4OO1 I;  4DUZ L;  5FLM H;  4DKA C;  2VL6 A;  3U50 C;  3H3V I;  3DLL A;  3PGZ A;  1IYJ B;  1VQ6 A;  2QGQ A;  2F3I A;  4YWL A;  4AYB G;  4LFB Q;  1I50 H;  2WB1 E;  2Y0S E;  4UY8 C;  4QL5 A;  3K7U C;  1IZ6 A;  2VW9 A;  2I0Q A;  4L5Q A;  4DV4 Q;  4B3T L;  3HOW H;  1L1O A;  2K75 A;  1WCM H;  1NE3 A;  3TS0 A;  2IY5 B;  5LMN Q;  2R7F A;  1YEZ A;  3PF4 A;  1H95 A;  4MTN A;  1P8L A;  5FLM G;  2VQF Q;  3CD6 A;  2B29 A;  1GD7 A;  2UU9 Q;  2B63 G;  4DR2 Q;  3H3V H;  2UXC Q;  1PH2 A;  1KAW A;  1KL9 A;  1QVC A;  1K8G A;  2ZM6 L;  1E3P A;  3G48 A;  2YTV A;  3HKZ E;  1IBM Q;  3I4N G;  4P71 A;  3HOY G;  1Y1W G;  1OXU A;  4PG3 A;  4K0K L;  1VCI A;  4OON A;  5HGQ A;  4DV5 L;  2A1A A;  4A3F G;  1X9N A;  1N32 Q;  1V43 A;  1I5F A;  1LM0 A;  5LMU L;  3L2P A;  3G4S A;  2E5L Q;  1N33 L;  1IBK Q;  4DV6 Q;  2ID0 A;  1K9M C;  4DR7 Q;  2KHI A;  2N78 A;  5JJK A;  4YWM A;  4NB3 A;  4DR5 L;  4JI6 Q;  4IFD J;  3CCV A;  1ASY A;  3GTP H;  4JI0 L;  4DR6 Q;  1PFS A;  3EN2 A;  1PA6 A;  1KRS A;  4B3R Q;  2C35 B;  1N9W A;  2IT1 A;  5IP9 G;  4IJH A;  1YJW A;  2YYZ A;  4KHZ A;  4LF9 L;  3A0J A;  1UEB A;  3M85 A;  4JBJ A;  2VQE Q;  5IP7 H;  2JA5 G;  3ULL A;  4NXN L;  4HIO A;  1XNR L;  5C3E H;  2UXD Q;  3F8T A;  3RLO A;  3AYH B;  1JB7 A;  1VQA A;  4LF5 L;  2Z6K A;  2CQO A;  1M90 C;  3J7Z C;  2JQO A;  4OWX B;  3FHW A;  4PZ6 A;  1IBL L;  2VUM G;  4GOP A;  4DNI A;  4JG2 A;  4A3J G;  4WJ4 A;  2JA6 H;  3D31 A;  4JOI C;  3W1G A;  1SN8 A;  5IWA L;  2E2I H;  2KBN A;  4AH6 A;  3GO5 A;  2ZTE A;  2YTY A;  1XPR A;  3PO3 H;  1EIY B;  2R93 G;  2L15 A;  2N49 A;  4DR3 Q;  3M4O H;  5IP7 G;  3RLN A;  1YIJ A;  3RZD H;  1JT8 A;  4QY7 A;  1X55 A;  2LXJ A;  4KLK A;  4GN3 B;  1CKO A;  4JI3 L;  1SRU A;  1HNZ L;  3S17 H;  4LFC L;  1A8V A;  3S15 H;  1HJP A;  2JJQ A;  4R4I A;  2UUA L;  5JEA J;  4LF8 Q;  4JI1 Q;  5ELN A;  2D0P A;  4QGU A;  1XPU A;  4DV7 L;  3H0G G;  1VQM A;  3OTO L;  3S1Q H;  2A8V A;  4IO9 A;  4YY3 L;  3PO3 G;  2KCT A;  5IYB H;  4BY7 G;  3IRB A;  1UE5 A;  4DR4 Q;  4A76 A;  3HOV H;  4A3K H;  4A3D H;  1WYD A;  2F52 A;  1EIF A;  1Z47 A;  4JI7 L;  1VQO A;  4HJ5 A;  4OX9 L;  3GDE A;  1I94 L;  1NBW A;  5IYD G;  3PIP A;  2UUB Q;  1FJG L;  1BKB A;  2CCZ A;  3K7A H;  2AWN A;  3ER0 A;  2ZM6 Q;  2E2J H;  1X6O A;  3M4Q A;  4C2M H;  3ERS X;  5IE8 A;  5IYB G;  2H5X A;  3U4Z A;  4A3K G;  2LSS A;  4R1J A;  4YCU A;  5LMU Q;  1KQS A;  4B3S Q;  4LF6 L;  4MNO A;  2D0O A;  3G71 A;  3VDY A;  4A3I H;  5JEA G;  3KOJ A;  4BY1 H;  4DV0 L;  1FVI A;  4LF4 L;  2KCM A;  3K81 C;  3CF5 A;  1PH3 A;  2K5V A;  4GOP B;  4IPC A;  4TQU S;  3EBE A;  5GRO A;  2CWP A;  1E7Z A;  2FXQ A;  3BZC A;  1VQP A;  2JE6 I;  1VQL A;  1PH6 A;  4DV2 L;  4WJ3 M;  1R9T H;  4A3C H;  1LYL A;  2ZJQ A;  1XNR Q;  3GTO H;  3CAM A;  1MIU A;  4XTC S;  1HNW Q;  4UP8 A;  2B3G A;  2GVA A;  1XJV A;  4JCV E;  2YU9 H;  3AFQ A;  4A3G H;  1CUK A;  2Y0S G;  4R4T A;  3CPW A;  1IBL Q;  2ATW A;  1WI5 A;  2XTI A;  1OXT A;  4YCW A;  1I6H H;  3KF6 A;  5IWA Q;  3I55 A;  1PH4 A;  5C4X G;  2PQA A;  1YHA A;  2UUC L;  3E0E A;  1TWA H;  1EQQ A;  4JI5 L;  2PI2 E;  3M9B A;  4YHH L;  5EAY A;  4Y7N H;  1X56 A;  1HR0 L;  1XMO L;  4GKJ Q;  5IYC G;  1A62 A;  1N36 L;  2HQL A;  1KIX A;  3RNU A;  3GTQ H;  4HID A;  4A3G G;  1VQB A;  2UUA Q;  2B63 H;  1K3R A;  1NTG A;  1XTD A;  3OTO Q;  3A5U A;  5H1S E;  4A3M G;  1XPO A;  2IX0 A;  3I4N H;  1Q46 A;  3HOY H;  1B70 B;  1Y1W H;  1SFO H;  4R4C A;  4TVA B;  4A3F H;  4HIM A;  2IHF A;  1XMQ Q;  4HJ7 A;  3GTL H;  4Y52 H;  4JI7 Q;  1C9O A;  1CSP A;  2F4V L;  4LUO A;  1U0L A;  4JI8 Q;  1D7Q A;  4DR1 L;  1GKH A;  2PI2 A;  1G29 1;  3U58 A;  1Q82 C;  1EUJ A;  4B3M Q;  3AEV A;  1PYB A;  4X66 L;  3OYY A;  1BVS A;  5FJ8 H;  4RMF A;  4C3H H;  4DV1 Q;  2MO1 A;  5IP9 H;  4BBR G;  1N8R C;  4LF7 L;  4A3B G;  1JE5 A;  1VQ8 A;  3G6E A;  2CKZ B;  1JMC A;  4UP9 A;  3UDG A;  2JA5 H;  1EQR A;  2OCE A;  3F2D A;  1SR3 A;  3TRE A;  2VUM H;  4IOC A;  4JV5 L;  1U5K A;  4DV0 Q;  1X54 A;  1YI2 A;  1HNX L;  2OQK A;  2V1C C;  1CSQ A;  4A3J H;  1Q81 C;  3CQZ H;  2HHH L;  4OXP A;  3JAM i;  3CCL A;  1XNQ L;  3PO2 H;  3AQQ A;  5GAE C;  3PUV A;  5FJ8 G;  3KF6 B;  1N34 Q;  1VQG A;  1Q1E A;  4NXM Q;  4HJ8 A;  2PQA B;  3RN5 A;  2R93 H;  4DV2 Q;  4JI2 L;  2WP8 J;  3UDF A;  1KD1 C;  3M3Y H;  2HT1 A;  5C0X J;  1YJ9 A;  2I5M X;  1KHI A;  2VNU D;  3NEL A;  4JYA Q; 
#chains in the Genus database with same CATH topology
 4S3S A;  4A3E G;  2HGS A;  3RD4 A;  2R87 A;  3CP0 A;  2BH8 A;  4J9R A;  1Y14 B;  4J9K A;  2A68 D;  3ICE A;  3E5N A;  1G51 A;  4LUV A;  4JI5 Q;  4DL5 A;  1R4P B;  3I4O A;  3VPB A;  1BQQ T;  4J8Q A;  1AN8 A;  2YV5 A;  3RF2 A;  4H7B A;  1DXM A;  1QB5 D;  4MZ9 A;  4WOR A;  5M3M B;  3PR4 A;  3LWU A;  2L55 A;  2K4K A;  3CHB D;  1VMP A;  3U9S A;  1YIT A;  5M5Y B;  4ZHQ F;  2SCU B;  3CXC A;  1PYS B;  1U4M A;  4DR1 Q;  1SLJ A;  1C0A A;  2W8K A;  3QZ7 A;  4C56 C;  1VQF A;  5EOY A;  1K8M A;  4J6H A;  2NVX B;  3Q1K A;  3GV6 A;  5EKK A;  2JA7 B;  4PMW A;  4PDB A;  4O4I F;  1UWV A;  4C5C A;  3SE0 A;  1H9K A;  2K50 A;  4LH7 A;  1NY4 A;  4M1U B;  3TZU A;  3J81 W;  3E0J A;  4UPA A;  2B2T C;  3BVZ A;  1HNX Q;  1YJN A;  1UE6 A;  4QB4 A;  5IOC A;  2BCO A;  5KNB A;  1XNQ Q;  2R7Z B;  1AFP A;  5C4X H;  5M3M G;  5KX5 F;  4NW2 A;  3M9M B;  1GUN A;  1BNZ A;  2KQ3 A;  5F2D A;  1WTR A;  3JAM E;  1XMQ H;  5C4J H;  1LT4 D;  2B2U C;  4DL4 A;  2RDJ A;  3GIQ A;  3KF8 B;  1CKN A;  4JK1 C;  2L9H A;  3DM1 A;  4BXX G;  3VYR A;  1X65 A;  2E8G A;  2L11 A;  2R8I A;  1IBM H;  2MPM A;  4L5T A;  2JA7 G;  4X64 Q;  2EIF A;  3HXL A;  1V1Q A;  5CBA E;  4B3R L;  3L0O A;  1IBK H;  4PZ7 A;  5M3F B;  4XZ3 B;  3TRZ A;  4E6I A;  4JI6 H;  4TV8 F;  5C1O A;  4ME3 A;  5IYZ F;  3RBD A;  3HFZ B;  5J22 A;  3L3O C;  2W6M A;  4F4X A;  1T9H A;  3DEP A;  2R7Z G;  1AW7 A;  1HPC A;  1BBW A;  3FVQ A;  1HZA A;  4R8N A;  4BBR H;  3NSW A;  2IP4 A;  2UXD H;  2FLN A;  1KAB A;  5JJL A;  2K5W A;  4N8X 1;  4TUY F;  4EQ5 A;  3OHA A;  2YZM A;  4J9Q A;  1PH9 A;  4ECU A;  4EX5 A;  4KHV A;  4RKB A;  4QWC A;  4DR3 L;  2ALZ A;  1XDN A;  3F1Z A;  1W3S A;  3G6J B;  1FJG Q;  3PUZ A;  3CMA A;  5EPJ A;  4BS9 A;  4G7Z C;  1F2Z A;  3GTG H;  2F0Q A;  4LF8 L;  4X62 H;  4JI1 L;  1V8Q A;  1EFW A;  5M3F G;  4DXG A;  4BBS B;  4I4T F;  1TWF H;  2EY6 A;  3UI2 A;  1S03 G;  1WOC A;  3X3M A;  2NVY A;  5KFL A;  1NJI C;  1GVP A;  4DR4 L;  4A3E H;  3BG5 A;  1XWE A;  4YBZ B;  2XD4 A;  1HH2 P;  5KFY A;  2WFW A;  3HOU H;  2XWJ B;  3NTH A;  5C44 G;  4J9S A;  2JEI A;  4IAL A;  1UNN C;  2ES2 A;  4F88 A;  1A63 A;  2HIX A;  1XTC D;  3RZO H;  3MAQ A;  4DAM A;  3JRW A;  1CZW A;  3I2Z A;  1ESF A;  4HSP A;  5COY A;  1MJC A;  5M5W H;  2QK4 A;  5C5M A;  4OO1 G;  5I47 A;  4JBW A;  3F2U A;  4AYB E;  2JEA I;  2FK2 A;  4LUZ A;  1CQF A;  1TWC A;  4BBS G;  5C5L A;  5LMU H;  1R4Q B;  2XRQ D;  1MKH A;  3GTM H;  3TQY A;  1LTA D;  3WWV A;  4QWB A;  2C2D A;  2FFK B;  4RGN A;  3FKI A;  4ED6 A;  4JBM A;  3E9H A;  3RIZ A;  2OQ0 A;  4DK6 C;  1A3U A;  1C3O A;  4QIW E;  2W70 A;  3STB C;  3OWE B;  5KT5 A;  4PV1 C;  4DNT B;  2E2H A;  1LTL A;  3VR6 A;  2WAQ B;  1SCU B;  4AYB A;  3BVM A;  3TEH B;  5E7N A;  4UFZ A;  3HZX A;  5EPK A;  1T3N A;  4GKJ L;  4A3D B;  4X66 Q;  1SE2 A;  5M3M H;  1YNJ C;  1K8O A;  1X3G A;  1B6R A;  1NR2 A;  4R7R A;  3E9I A;  4HSV A;  4JI3 H;  5M5Y H;  4X6A H;  4RZQ A;  5C8Y F;  5EKI A;  2W7O A;  5DLQ E;  1GYF A;  5BN4 A;  4EFB A;  4BXX H;  2ZJT A;  1NMF A;  2H1E A;  2R82 A;  1SFO A;  2QA4 A;  2W9B A;  3I56 A;  1XMQ L;  4IHJ F;  4QIW A;  1HNZ L;  3EA6 A;  4AQY Q;  1O7I A;  2NVX H;  2JEG A;  4YY3 H;  2JA7 H;  1SND A;  5KFB A;  1GXD C;  4OGQ C;  3L9A X;  3W2D A;  1IL2 A;  1PVO A;  4DF7 A;  5D1O A;  4PMC A;  1M7J A;  2HDL A;  2WAQ G;  2WKC A;  1JJ2 A;  4A75 A;  2Q2U A;  3A54 A;  3KLS X;  4V19 0;  3T5K A;  4J15 A;  3D8G A;  3OSO A;  4A3D G;  2R7Z H;  1KC8 C;  1ET6 A;  4ZLT F;  3ORR A;  3CCR A;  1AE3 A;  4JI6 L;  4QJF A;  2OLS A;  3K3V A;  2EJF C;  2RCN A;  4A3G B;  3FRP B;  1Q8I A;  2HCC A;  1SMX A;  2NZ1 D;  4M8A A;  1FL0 A;  3R3O A;  5KFP A;  1VQ4 A;  4DV0 H;  5FD6 A;  4XDX A;  1Z7T A;  4KD3 A;  4ED1 A;  2FLL A;  1E24 A;  4KY5 A;  2Z6B A;  5KFO A;  4FM9 A;  1N34 H;  2W7P A;  3MXN A;  3UE1 A;  2K33 A;  4YJ3 F;  1VF5 C;  2F03 A;  3H40 A;  1CQI B;  2JA6 A;  5FK9 C;  5IT9 c;  1HUN A;  4GKK L;  1HZB A;  2SDF A;  3QB3 A;  3I4N B;  1GM5 A;  2EYL A;  2GN5 A;  1UEA B;  5IGF A;  1DD2 A;  4A3C G;  3GP7 A;  1B9N A;  4X62 L;  1CS0 A;  3RTX A;  4JVZ A;  4EGV A;  2UVR A;  4RHR A;  4FO2 A;  3TBI B;  1SYB A;  4JI5 H;  3IFT A;  2VL6 A;  1SJE D;  1SXT A;  3BAA A;  2EYH A;  4CDF C;  3V4Z A;  4YWL A;  5C1P A;  1BCP C;  4LSX A;  3PMF A;  4FF4 A;  2A6H D;  5KG6 A;  2WB1 E;  1NAP A;  1SAP A;  2FPG B;  1IZ6 A;  2VW9 A;  2JA5 B;  1UC8 A;  4CJ2 C;  2R84 A;  4B3T L;  3TS0 A;  1GHJ A;  2IY5 B;  4OO1 H;  2RA4 A;  2Z9H A;  1FYC A;  3P7J A;  3PF4 A;  1K0S A;  3GV7 B;  2J7Z A;  2UU9 Q;  4DR2 Q;  3BDO A;  1PH2 A;  1KAW A;  1E2V A;  1K8G A;  2R85 A;  3PO2 B;  2F4V H;  1E3P A;  2KEC A;  3I4N G;  2J9G A;  3T5L A;  4DR1 H;  1B3Q A;  1STA A;  2R93 B;  4EYH B;  4ECR A;  3C46 A;  1I5F A;  1N33 L;  2B8G A;  5LMU L;  3M3Y B;  2I07 B;  5KYI A;  3PW0 A;  1T5X D;  1SE4 A;  4IFD J;  2WB1 A;  1A6X A;  4EVO A;  4FVM A;  4B3R Q;  4N9T A;  1SYG A;  4E4T A;  2A69 D;  3H0G B;  1ONL A;  3EVQ A;  2YYZ A;  1SNP A;  1UEB A;  1HNX H;  5M9O A;  3OMG A;  2JA5 G;  3MC0 B;  4BY7 B;  1XNQ H;  3F8T A;  4HCE A;  2BQ3 A;  4OHJ A;  3AYH B;  3GIM A;  4YJ2 F;  2CQO A;  2QIL A;  4O42 A;  4OWX B;  3FHW A;  4PZ6 A;  3J7Z C;  1DJR D;  3S17 B;  4DNI A;  3QG1 A;  3S15 B;  1JIC A;  1BOS A;  3MWM A;  3PVX A;  4Q45 A;  1E4E A;  2ZTE A;  1H9S B;  3P1H A;  5KFW A;  1EWC A;  2OF1 A;  1VDZ A;  1CK1 A;  1EIY B;  2R93 G;  4O4H F;  2HD3 A;  4DR3 Q;  4GC7 A;  3I70 A;  5E4X A;  1X55 A;  2F0S A;  2K7V A;  1CQV A;  4JI3 L;  3TME A;  2AU0 A;  4X64 H;  3SEB A;  1IOW A;  1IL8 A;  1YNN D;  3QOJ A;  3UFX B;  4PMB A;  4LF8 Q;  5DM7 3;  4JI1 Q;  4RKL A;  2D0P A;  4QGU A;  4DV7 L;  3H0G G;  4RNN A;  3MZ5 A;  4DK1 A;  1VQM A;  2BE5 D;  2A8V A;  1SYX B;  4I7A A;  5NUC A;  4YY3 L;  3PO3 G;  4BY7 G;  3ETJ A;  4DR4 Q;  2PN1 A;  4A3D H;  4A3K H;  5JVD F;  1JCK B;  1WYD A;  4MV4 A;  1VQO A;  4O3R A;  3GDE A;  3K5I A;  1VKZ A;  1L0Y B;  2Y0S B;  5KT2 A;  2E74 C;  2EY5 A;  2ZM6 Q;  1Z2P X;  1SYF A;  2EYF A;  3M9O B;  3GTG A;  3N40 P;  3ERS X;  2M00 A;  5IE8 A;  5IYB G;  1Q3L A;  2FJZ A;  1FJG H;  1CI3 M;  4R1J A;  1TWF A;  3T1Y H;  5C3X A;  5CR3 A;  2D0O A;  2F4I A;  3VDY A;  3H20 A;  3KOJ A;  2VUM A;  4DV0 L;  2EYJ A;  1D1I A;  2KCM A;  4XYM B;  4IPC A;  4TQU S;  5COR A;  5C6A A;  3EBE A;  1QIL A;  2CHB D;  2CWP A;  5A2Q W;  1E7Z A;  3BZC A;  4HQ6 A;  3R93 A;  1VBG A;  2E2D C;  2OT2 A;  1WH2 A;  1WTP A;  4A3C H;  2ZDH A;  3RV3 A;  4FXD A;  2DIK A;  3I8Z A;  4ME6 A;  3AFQ A;  4A3G H;  2Y0S G;  4R4T A;  1X32 A;  4RHS A;  2XTI A;  2WTF A;  2CW0 C;  2R7N A;  2M2L A;  2R61 A;  1S5F D;  1TWH A;  2VA3 A;  1TII D;  4JI5 L;  3M9B A;  5L9X A;  2IJ0 A;  4KJN A;  4A3B B;  1TVX A;  2R8J A;  4DV6 H;  4MA5 A;  4DR7 H;  4O3N A;  3J81 L;  4GKJ Q;  3GTL B;  3TP5 A;  1RD9 D;  1G8Z D;  3GTQ H;  1TKW B;  2PCF B;  5KFT A;  3SK4 A;  5I9O A;  2DJF C;  5JQW A;  4DK0 A;  3OTO Q;  3A5U A;  4IZ8 A;  1A3T A;  1KDB A;  2IX0 A;  3I4N H;  1DV1 A;  1G91 A;  4MA0 A;  3I91 A;  1EQT A;  2WV6 D;  2GPW A;  1BCP B;  1TWG B;  1F9R A;  3MWD A;  4MV9 A;  1K83 B;  2BDN A;  1XMQ Q;  4Y52 H;  3RB3 A;  3RUZ A;  2F4V L;  5FKA C;  1U0L A;  1D7Q A;  5JVH 3;  4DR1 L;  1GKH A;  1PK8 A;  4ZCK A;  2SNS A;  1PYB A;  1BVS A;  4RMF A;  4RUA A;  2DY7 A;  4ME5 A;  3R5X A;  4A3B G;  2O03 A;  3MR5 A;  1JMC A;  2JA5 H;  4UP9 A;  4YP3 A;  5EBD A;  4X66 H;  2OCE A;  3K5N A;  3F2D A;  5KFI A;  1STH A;  2IWH A;  5KGU A;  3N52 A;  1CA6 A;  3PW5 A;  3K5H A;  1ZYR D;  1HNX L;  1C30 A;  2AQ3 B;  2I8C A;  3JAM i;  3PO2 H;  1XNQ L;  4G7H C;  1EYZ A;  4OEL B;  3PZP A;  4ECY A;  2NVX A;  2P5Z X;  2O2L D;  4HJ8 A;  2PQA B;  2R93 H;  2RDH A;  4DV2 Q;  2WP8 J;  4RA8 A;  4AQY H;  3M3Y H;  1EY0 A;  3GV5 B;  3S14 B;  4KV6 A;  2VNU D;  3OHB A;  4WD3 A;  3WNZ A;  3BZD B;  1SNM A;  5EBC A;  1LTG D;  4P72 A;  2PNH A;  3H0G H;  3J80 E;  3L7Z C;  3CW2 C;  3FDS A;  4QUF A;  4GKK Q;  1QUQ B;  2FP4 B;  4X64 L;  2PZW A;  4BY7 H;  4BA2 I;  1X3E A;  1II3 A;  3Q0A A;  1BBU A;  4B3S H;  4X62 Q;  3KF8 A;  2AMC B;  1JDB B;  2NVT B;  3Q8P B;  5CV8 A;  4ETS A;  1SRO A;  3AU7 A;  2B2Y A;  4ABN A;  3A56 A;  1IXR A;  2GVB A;  1J8I A;  4F50 A;  1JLL B;  1EYG A;  1JOK A;  2NZO A;  5AJ3 L;  1F2M A;  3K0Y A;  3PV0 A;  4POF A;  5KT4 A;  2G9D A;  2NVQ B;  1BXT A;  5CAE B;  3N6X A;  4DAY B;  4NDX A;  2BA0 A;  4QCL A;  3ND8 A;  4B3T Q;  1X3P A;  3KDF B;  2HDM A;  2QDB A;  4ZRZ A;  5GAG C;  5KEE A;  1EIG A;  4RGT A;  5I9P A;  5KNC A;  1HA6 A;  2WII B;  1WR2 A;  3T53 B;  1PH7 A;  3KAJ A;  1ENA A;  3T1Y L;  4ALP A;  2C5C A;  4TV9 F;  2NTT A;  2BH2 A;  1RIP A;  4IUN A;  4R4O A;  4DLK A;  4LNQ A;  1I4Q A;  3VPC A;  2BQU A;  1B7Y B;  1V1P A;  3GTK H;  3GIK A;  4A3L G;  1N33 Q;  3MR6 A;  1STY A;  1E2Z A;  1M8A A;  2L5T A;  5D3I B;  2K52 A;  3RBE A;  3CRL C;  1JR0 D;  1QZG A;  3EPI A;  4IPH A;  1JWU D;  2OTL A;  1O7L A;  4U6P A;  4IUT A;  4GN5 A;  5LP6 F;  2DNE A;  4EG0 A;  1HCZ A;  2QDL A;  3S9W A;  4HCS A;  1RTO A;  2R8G A;  2RQX A;  3LGJ A;  4A4I A;  1CKM A;  2Q2T A;  1F9Q A;  4GLA C;  1U9R A;  5TSS A;  5JPM C;  4JC0 A;  3FDT A;  3KHR A;  1I3Q B;  4J9N A;  4DR2 H;  1GUT A;  2UU9 H;  2MO0 A;  1QZH A;  1E0B A;  4IUQ A;  1U4R A;  4DV6 L;  1K3B C;  4DR7 L;  1RL2 A;  1RJT A;  4J9O A;  3RMH A;  4ED7 A;  1EY9 A;  1Q1B A;  2OXP A;  1KLU D;  1YBY A;  3QZ8 A;  3HOZ B;  2C9O A;  2YZG A;  3OIQ A;  1D6E C;  2F0J A;  4FS2 A;  5HGT A;  1NNX A;  1PZI D;  4HAE A;  4JI3 Q;  2EQS A;  2FK3 A;  2D5D A;  2VZA A;  2NUA B;  2CH4 A;  1PH1 A;  4QF4 A;  1EFI D;  3NEN A;  4B3R H;  3HBL A;  3H94 A;  2Z0S A;  3VYS A;  4DAP A;  4DV7 Q;  2FE3 A;  2WAQ E;  2D9U A;  3MJF A;  3ND9 A;  3ZJY C;  3CC7 A;  4A3B H;  4OWT B;  4YY3 Q;  1EYD A;  3K3P A;  2JA8 H;  5I4D A;  4X3U A;  1E22 A;  1MI2 A;  4ECS A;  2PMZ B;  2R8H A;  4JYA H;  1GLV A;  4RU9 A;  4UCV A;  1TQO A;  1S3O A;  2DN8 A;  1FR3 A;  4RWS C;  1JOR A;  3KJO A;  2C22 A;  2J6T A;  1ET9 A;  3N8D A;  4XQQ A;  2HIV A;  4IN3 A;  5KG4 A;  3K57 A;  3HOU B;  1WCM B;  3DMU A;  3K8A A;  5ELO A;  2QEX A;  4DV3 Q;  1TWG H;  3HOZ G;  1Z2N X;  3CME A;  2Q2I A;  1K83 H;  4MHE A;  2F0G A;  3U9T A;  2WAQ A;  2B2V A;  2O4X A;  1I4G A;  4JI1 H;  4AQY L;  2I5H A;  3W3A A;  4G4K A;  1Y1V A;  3NQI A;  5BR8 Q;  4P73 A;  4QUC A;  1BCP F;  1L0W A;  4GNX B;  1HXY D;  2C00 A;  2UUB L;  1DON A;  4DR4 H;  3GTP B;  4IWY A;  1PFM A;  4I7Z C;  1KRT A;  1GUG A;  5KFM A;  2M05 A;  3CCM A;  1S10 A;  2HVS A;  4OIJ A;  3GTM B;  3BYT B;  2KEN A;  2B2T A;  3KUP A;  2ZM6 H;  4B3S L;  5KFR A;  2JSO A;  3HOU G;  1WCM G;  3Q24 A;  1VQD A;  1VQH A;  3ZYY X;  5KFJ A;  4DV5 H;  1EQV A;  4X65 Q;  3S14 H;  1WD0 A;  3PSI A;  5CB4 F;  2E2I B;  3CCU A;  4Q8F A;  2KOL A;  1BJT A;  3HRZ C;  5J1Z A;  1BXR A;  2KHJ A;  5ELD A;  5IT9 E;  2B8F A;  2L0C A;  3HP3 A;  1ENC A;  1JQY D;  4NP5 A;  4X3K A;  1EY6 A;  4AIM A;  3RZD B;  2YCH A;  5KFK A;  1PRT F;  4LF9 H;  3J7A 5;  2TSS A;  3GD7 A;  1EZ8 A;  3BJU A;  5BN5 A;  3K6O A;  4CJ0 B;  1VQ5 A;  1ZKO A;  3FP9 A;  4A3L H;  2DWC A;  2NVT H;  4F4W A;  5FOB B;  1QE6 A;  2K1B A;  3IL8 A;  2F4V Q;  1KJJ A;  5EQ0 A;  1EY4 A;  4CBV A;  2VPS A;  4MIU A;  2A6E D;  1TS2 A;  5KFX A;  1PH8 A;  4J0M A;  2RBM A;  4MV3 A;  2NVQ H;  2VXW A;  1WTO A;  2I80 A;  4IUV A;  4DN4 M;  4L5R C;  2VOB A;  4GKJ H;  1CHP D;  3KLW A;  3K5L A;  4CDC C;  5K36 G;  2W6O A;  1DZ1 A;  4M9U A;  1JX4 A;  2E2J B;  1TS4 A;  5DM6 3;  4DNR B;  1QVG A;  2MQH A;  2EJM A;  3WDN A;  3OTO H;  2ZXR A;  4JI8 L;  5E1F A;  2NB0 A;  3UE0 A;  2W9C B;  1PTO D;  3QO2 A;  4DR2 L;  2UU9 L;  1A2T A;  1W6J A;  5I2X A;  2C28 A;  2RHQ B;  1JOQ A;  2XGT A;  2Z1C A;  1ZQ7 A;  2EYM A;  1OXV A;  2JA5 A;  1VQK A;  1KAA A;  3MXP A;  1R9T B;  1A2U A;  2JP1 A;  2EY2 A;  4FDB A;  3OW2 A;  1VQJ A;  2PNR C;  3OUZ A;  3HKZ B;  2JEB I;  1K28 A;  4GOP C;  4EFE A;  4R8U B;  1S0O A;  4LFA Q;  4HMJ A;  5I6W A;  1MSG A;  1RKN A;  1I3Q H;  2R93 A;  3OMC A;  2D62 A;  3EIV A;  3J80 c;  4IOA A;  5D8D A;  4HIK A;  4KKS A;  2IA6 A;  2PVP A;  1B2T A;  5AJ3 Q;  4JYA L;  3S24 A;  4DV2 H;  3HOZ H;  1ICF B;  2EXZ A;  1B50 A;  4U68 A;  3PIO A;  2B63 B;  5J3B A;  3NUC A;  5GON F;  4KHP L;  2EYP A;  1B33 N;  4DUY Q;  4PQX A;  2K5Q A;  3HEJ A;  3MFY A;  1Y1W B;  3T1H L;  3J81 c;  4A3F B;  3HKZ G;  1QVF A;  4PWQ A;  5KT6 A;  4GKK H;  1TA8 A;  1ESR A;  3T1Y Q;  2IPK D;  1RDP D;  4DUZ L;  4OO1 I;  1QNU A;  4DKA C;  5JPN C;  1EZ6 A;  1O7Z A;  2UVW A;  5A2Q L;  1H9S A;  1KTK A;  3TN2 A;  3RB4 A;  4FBU A;  2F3I A;  3VPD A;  1JXL A;  5L1L A;  1HQM C;  2AUJ D;  1I50 H;  2Y0S E;  1ZEQ X;  4UY8 C;  1WVL A;  1AZQ A;  2I0Q A;  3T4A C;  1PX2 A;  1N48 A;  5CGK A;  1L1O A;  1YNN C;  1WCM H;  2XC9 A;  1YEZ A;  4MTN A;  1KLG D;  3I3C A;  2B63 G;  3FEW X;  1SBB B;  2Q8I B;  4EEY A;  2RGR A;  1KL9 A;  1QVC A;  2ZM6 L;  4B3T H;  1BO0 A;  2R86 A;  1Y1W G;  4C2M A;  2EOT A;  1OXU A;  5ISR A;  4OON A;  5HGQ A;  3QOL A;  4DV5 L;  2A1A A;  4A3F G;  1N32 Q;  1V43 A;  3C0F B;  3G4S A;  4OIK A;  4DV6 Q;  4DR7 Q;  2Z4I A;  5JJK A;  4NB3 A;  1LTS D;  3GTP H;  4DR6 Q;  2L4N A;  3EN2 A;  5FLX W;  3GV3 A;  1KRS A;  3BQ0 A;  1N33 H;  3C2P A;  3OOC A;  1PMR A;  2F3W A;  3NTK A;  5KFH A;  3R8B A;  2ZDG A;  1YJW A;  4LF9 L;  4KHZ A;  3CU7 A;  2V59 A;  4JV5 H;  2VQE Q;  4K14 A;  5IP7 H;  4HIO A;  3H6M A;  3BA9 A;  4IWX A;  1PLF A;  5CV9 A;  1S0N A;  2YU9 A;  4WJ4 A;  4JG2 A;  3S1R B;  3D31 A;  3C1F A;  4FP5 D;  1SN8 A;  2FMM A;  2E2I H;  2KBN A;  3I90 A;  1EU3 A;  2C2R A;  5K36 H;  1HFN A;  1JDE A;  2YTY A;  5J2U F;  1LAB A;  4IUU A;  4U67 3;  3OUU A;  1TWA A;  2L15 A;  1HA5 A;  2N49 A;  1QNK A;  1YIJ A;  3RZD H;  4ED3 A;  2LXJ A;  3V6J A;  4A3K B;  3EQL C;  3HG9 A;  1D5M C;  1UAP A;  4K5W A;  2F0D A;  4V0B A;  1FNW A;  1HJP A;  1STB A;  4R4I A;  1GSA A;  2QYZ A;  4RB1 A;  5KFN A;  5JEA J;  3H4D A;  5KFV A;  2MUY A;  5LL6 X;  3OTO L;  4UCO A;  4IO9 A;  4F87 A;  1O75 A;  1NCV A;  3IRB A;  4UHV A;  4A76 A;  4DV7 H;  3GTL A;  1EIF A;  1LTI D;  4OX9 L;  4L8J A;  4GC6 A;  2W6P A;  4QW9 A;  2PQE A;  3PIP 3;  5A35 A;  2UUB Q;  1AUX A;  4HMI A;  1BKB A;  1MSH A;  3M9N B;  2F0I A;  5DG7 A;  2E2J H;  1X6O A;  3M4Q A;  1S5B D;  2EY1 A;  3T16 A;  4DU9 A;  5EDW A;  1K83 A;  4A2B A;  4A3K G;  3NP8 A;  1KQS A;  4O2B F;  4B3S Q;  4DV3 H;  2KHS A;  5JEA G;  4MAM A;  1FVI A;  2VB2 X;  2NU6 B;  1PH3 A;  2K5V A;  4GOP B;  1M0W A;  4MTD A;  4DL7 A;  4IQZ A;  4IZO A;  1F2Y A;  2FJ2 A;  4MV6 A;  4A3M B;  3T5H A;  2B39 A;  4OL7 A;  1VBH A;  4DV2 L;  3MFH A;  1R9T H;  4FS1 A;  1LYL A;  2ZJQ A;  5L37 A;  1XNR Q;  1V4Y A;  5BR8 H;  3CAM A;  1MIU A;  4UP8 A;  2B3G A;  2GVA A;  1XJV A;  3GTJ B;  2VQF H;  1CUK A;  3BG3 A;  2ATW A;  4H13 C;  4APM A;  1WI5 A;  4YCW A;  3GTQ B;  3MR2 A;  3J7Y W;  3TIN A;  4UCT A;  4HNT A;  1KNA A;  2PQA A;  1W96 A;  1A3V A;  1YHA A;  5FO7 B;  4KK7 A;  4ZAI A;  1HQR D;  2BQR A;  1FGB D;  4YHH L;  1WTQ A;  1B1Z A;  2XWB B;  4DA2 A;  5IYC G;  1A62 A;  4B9X A;  2HQL A;  3RNU A;  4A3G G;  3IG0 A;  4X65 H;  3L4K A;  2B63 H;  3H4B A;  5KG5 A;  3JAM W;  5DAU A;  4A3M G;  1XPO A;  1SYD A;  5HUR A;  1Q46 A;  1Y1W H;  4K2L A;  4R4C A;  1JWM D;  4A3F H;  5C4H A;  4HIM A;  4Y8V B;  4HJ7 A;  1KBL A;  2O5I C;  4JI7 Q;  3ERQ A;  1KJQ A;  1CSP A;  1STG A;  4JI8 Q;  5LA6 F;  5FO9 B;  3AEV A;  4EGQ A;  4FXK C;  3OYY A;  5FJ8 H;  3OHX C;  4C3H H;  3D6W A;  1S4Z A;  2MO1 A;  5IGE A;  2WE6 A;  2W8L A;  1AZP A;  2QF7 A;  1BNC A;  4DAY A;  3UDG A;  1F9P A;  5CC4 A;  1TR5 A;  4QWE A;  2FMC A;  4JV5 L;  1DM0 B;  3EPG A;  2J0T D;  1YI2 A;  2V1C C;  5IIF A;  4OXP A;  3S2H B;  5G3L F;  3V6H A;  4LH6 A;  3KF6 B;  2UVU A;  4ZOL F;  1PRT C;  4K8I A;  3IFD A;  2W9A A;  3DWQ A;  2MHV A;  1KD1 C;  1OWT A;  2HT1 A;  4WBN F;  5C0X J;  2KED A;  1YJ9 A;  2YS7 A;  2I5M X;  3P75 A;  2K28 A;  5CV7 A;  4JYA Q;  1IHZ A;  4PZ8 A;  2YZN A;  1VQI A;  2NZH A;  3BQ1 A;  3TIG A;  1W2B A;  5L1I A;  4H44 C;  3PO2 G;  3A7L A;  4DPG A;  2Z8L A;  4KHP Q;  1SMY D;  1DGS A;  2MGS A;  2MJ8 A;  4XIG S;  5CV5 A;  4TQR A;  1G6P A;  3G6V A;  2K14 A;  4JW0 A;  2DLN A;  4LW1 A;  1GO3 E;  2EZV A;  2I46 A;  2JXM B;  3T1H Q;  3BDL A;  3HOX B;  4U7C A;  3GQC A;  2CFM A;  3A8K E;  3VMM A;  4IFD G;  1I3Q A;  3J81 j;  2DJG C;  3S1R H;  4DUZ Q;  4LFA H;  3Q8Q B;  4C3I B;  5KKN B;  2JN4 A;  3Q6S A;  2RDG A;  2PMZ E;  5GAD C;  2W6Z A;  3TQ1 A;  2F0H A;  4NPS A;  1AE2 A;  3PW4 A;  1VQ9 A;  4RAU C;  5LHY 1;  4JI4 L;  4RGO S;  3K0X A;  1HZC A;  2UXB L;  2QEJ C;  4J9P A;  3GTK B;  5JVG 3;  2EDG A;  3NBI A;  5JEA H;  1TS5 A;  2NVY B;  2B2W A;  3R23 A;  1G2T A;  1B9M A;  3OSP A;  2KCN A;  3Q8D A;  2DPJ A;  2JK8 A;  2ASB A;  4DUY H;  4DAV A;  3MA2 B;  4LF7 Q;  3ONA B;  5KG3 A;  4KY6 A;  3K80 C;  4DV3 L;  2ZJR A;  3F2B A;  5EWG A;  3HOX G;  2F0O A;  2X6G A;  4DV5 Q;  4XT3 B;  1MJE A;  2PMZ A;  5KFS A;  4Q43 A;  4IRD A;  1HR0 W;  2IHE A;  2WIN B;  3T5J A;  1C7Y A;  3KBG A;  4C3I G;  1BF4 A;  5HBR B;  1PZJ D;  4FU0 A;  4OWW B;  5BR8 L;  3FMC A;  4DFA A;  2KCC A;  1WCM A;  2PW5 A;  2VQF L;  1BBX C;  2UXC L;  4LF9 Q;  3JZI A;  4X3S A;  2X6L A;  5GQO A;  4JI2 Q;  3Q2O A;  2CVR A;  2RHS B;  2CW7 A;  2LS0 1;  5IYC H;  1QOH A;  2PZT A;  1QG7 A;  2QW7 A;  4ECX A;  1X3F A;  3AFP A;  4RNM A;  3R2I A;  5GAH C;  3JRX A;  2E5L L;  3ULJ A;  1KDA A;  2VQD A;  4A3M H;  3KLS A;  3FKI B;  3O13 A;  5ELB A;  4IR1 A;  3GTP A;  5BPF A;  4EBD A;  1N32 H;  4X65 L;  1JJG A;  4JV0 A;  3MWY W;  5KYL A;  2JA8 B;  3GTJ H;  2R92 B;  4FF1 A;  3S2D B;  3STB D;  3SGI A;  2E2H B;  1UC9 A;  4DR6 H;  3GTM A;  2LKV A;  4RAY A;  2A68 C;  3DM3 A;  4RZR A;  2A74 C;  1Q12 A;  3GIP A;  2K5H A;  4HN7 A;  5BPH A;  1S72 A;  4JOI A;  2VQE H;  4C1N I;  3ULP A;  3AMU A;  4IUR A;  1B4O A;  2OTJ A;  5F9N A;  1PYW D;  3TSS A;  1MD2 D;  3GLK A;  3PN1 A;  4OX9 Q;  2ALY B;  2NU7 B;  3KYH C;  2Q2H A;  4XQJ A;  4CGY B;  2CWA A;  2DY8 A;  5KFA A;  3TP7 A;  3FKI G;  4ULL A;  2K6A A;  5CA1 F;  2ASD A;  1HFG A;  1OXX K;  2NBF A;  3D6C A;  2JA8 G;  2KUM A;  3CCS A;  2R92 G;  2AKW B;  4IJL A;  4JPB W;  3CC4 A;  2P0A A;  3GIL A;  5DQG A;  2ICE C;  4YQW A;  1OO9 B;  2IX3 A;  2A6E C;  3K58 A;  4ED2 A;  4ZUI A;  2A5H A;  3DWP A;  3CC2 A;  3Q8S B;  4GNX C;  2F0F A;  4BWG B;  2JA7 A;  4ED0 A;  1TXY A;  1AP0 A;  3W5O A;  1PRT B;  1SE8 A;  3DXJ C;  1PV4 A;  4TSS A;  2VA2 A;  2KSW A;  1EOV A;  3K59 A;  4IFD H;  2XCA A;  2NN6 G;  2UUB H;  2K5N A;  1HRJ A;  3S2H H;  3J7A F;  2R7Z A;  3D4D A;  1B04 A;  1IW7 D;  3JSL A;  2W9C A;  3A7A B;  3MXN B;  1I6U A;  2RF4 A;  3PQI A;  4UP7 A;  4LFA L;  3N41 B;  5C0X H;  4YHH Q;  3G7L A;  2JA6 B;  4ECW A;  3GIJ A;  4G3I A;  1DIK A;  1NSN S;  1AEX A;  1CTM A;  4CDD C;  2ZTC A;  4DR5 H;  4JI0 H;  1ASZ A;  5KFF A;  1R9T A;  4WJW A;  1SNC A;  1VQC A;  3A55 A;  4C1N K;  3V05 A;  1EOT A;  3J81 E;  5KFE A;  1SSO A;  4YWK A;  5LMN W;  4J9L A;  4NXN H;  1XNR H;  3T56 B;  3HOX H;  4YIJ A;  1MGS A;  1E1T A;  3BQ2 A;  3A8I E;  3SK8 A;  5E3F A;  1X3Q A;  3S1Q B;  4ECV A;  4DUY L;  1ILQ A;  4C3I H;  1UE1 A;  4L63 B;  2IX1 A;  1W6K A;  1Z6H A;  1K0R A;  5DQI A;  4RGM A;  4YCV A;  1Z2O X;  5T14 A;  4APV A;  3HOV B;  3PR5 B;  1MBY A;  5FLX L;  5JJI A;  1B8A A;  1ICW A;  1D8L A;  1XYI A;  5LOV F;  2B63 A;  2JA6 G;  3SDZ A;  1OTC A;  1EY5 A;  1PFB A;  3M7N A;  1I7N A;  3N43 B;  1S40 A;  4K2K A;  4NKL A;  1RJQ A;  3MEF A;  2K03 A;  2NVY H;  2N3S A;  2RCF A;  3OIP A;  4JV5 Q;  1ILP A;  4WRD A;  3MEH A;  2W6Q A;  1K8A C;  3JC6 6;  2I5L X;  4JV2 A;  3RN2 A;  1I4X A;  4QMG A;  2RKS A;  3ITP A;  3MR3 A;  4HJA A;  1XXG A;  2WB1 B;  4A3I B;  4B3M L;  4BY1 B;  4X3T A;  3PUY A;  3Q22 A;  4JI7 H;  3I73 A;  4KKU A;  4JI8 H;  4B9W A;  3F8N A;  1YZ6 A;  1L2F A;  2MFI A;  5DEH A;  4B08 A;  1JJC B;  3HOV G;  2FHT A;  1N32 L;  2Z6K C;  2CW8 A;  1D5Z C;  2PO4 A;  3CCJ A;  3GTO B;  1LAC A;  1LV9 A;  4DR6 L;  1TWC H;  2F0M A;  4FF2 A;  2QCP X;  2EJG C;  1J5E Q;  3SK5 A;  1I6H B;  4DK3 C;  4EQP A;  4LF6 H;  5CYU A;  4NXM L;  1E4E B;  3CPF A;  2VQE L;  4RG1 A;  1Y8N B;  4LF4 H;  4KJO A;  4A93 H;  3TII A;  2FLP A;  3NEM A;  2IMW P;  4Y7N B;  4LMQ D;  2B2Y C;  2X0S A;  3FKI H;  4XQN A;  2WB1 G;  4A3I G;  5EWE A;  4BY1 G;  1YNX A;  2NUC A;  2XNA C;  2PZU A;  2R92 H;  3E6Z X;  4JI4 Q;  3CKI B;  2ZJP A;  3S2D H;  5I2Y A;  2E2H H;  2UXB Q;  3LNN A;  2Z4H A;  4K8J A;  3VR4 A;  4QQB X;  5IGG A;  1GUO A;  1I50 B;  1ULZ A;  4HR7 B;  2K04 A;  1P16 A;  3U9O A;  2R7M A;  4KHP H;  2N55 A;  4HJ9 A;  2UUC H;  4GLX A;  3WO1 A;  5FLM H;  2M9V A;  3DUZ A;  3T1H H;  1D2B A;  3DLL A;  1SYE A;  3PGZ A;  4LMY A;  1VQ6 A;  1XMO H;  1JOO A;  3EJI A;  3BS1 A;  1G2S A;  4XXE A;  2IW3 A;  4DUZ H;  4CHT B;  2NN6 H;  3IKJ A;  2HCI A;  4LFB Q;  2UVV A;  3JSN A;  1E4G T;  4K6D A;  1JB3 A;  2L1B A;  4DV4 Q;  1IKM A;  1RHP A;  1D5X C;  5FPO A;  2K75 A;  1NE3 A;  2F0L A;  2R7F A;  1H95 A;  1P8L A;  2VQF Q;  2VUM B;  2B29 A;  2UXC Q;  3H3V H;  4A3J B;  1V1O A;  3CQZ B;  1LTT D;  1IKL A;  4ID6 A;  4P71 A;  1BR9 A;  5JVL A;  2V4R A;  5JOB A;  5KG2 A;  2F0N A;  2KJX A;  4MN3 A;  4K0K L;  1VCI A;  2X69 A;  5DG9 A;  1TY0 A;  4O3S A;  4ILW A;  3L2P A;  2E5L Q;  1K9M C;  2ID0 A;  4LF7 H;  2KHI A;  2N78 A;  4RB0 A;  4DR5 L;  1ASY A;  2G5D A;  3JAM L;  4JI0 L;  1PFS A;  1EWH A;  3NTI A;  1ML0 D;  3FMA A;  3R5F A;  5KFQ A;  2C35 B;  5IP9 G;  1NR4 A;  2B2U A;  1I4P A;  3M85 A;  3LWB A;  4JBJ A;  3WO0 A;  3LWE A;  4F4Y A;  1SJH D;  4NXN L;  1XNR L;  3KAK A;  4IR9 A;  2BDO A;  3IAY A;  1JB7 A;  1VQA A;  4LF5 L;  1EL0 A;  5EZY F;  1WSC A;  4QWD A;  2VUM G;  4CKC A;  1QCB D;  2JQO A;  4G7O C;  1KXL A;  4JI2 H;  4HNU A;  4GOP A;  4A3J G;  4ZKB B;  2JA6 H;  2AGO A;  2SOB A;  2XCL A;  1EY7 A;  3GO5 A;  1XPR A;  1HUM A;  2AQ2 B;  2XGQ A;  1I4R A;  5IP7 G;  3GV8 B;  4QY7 A;  1SYC A;  1RCV D;  3GTJ A;  2NWG A;  4KLK A;  4GN3 B;  1CKO A;  4HNV A;  2HVR A;  1LT6 D;  2NYZ D;  3D4W A;  4LFC L;  1A8V A;  4K5X A;  2JJQ A;  4P2C B;  1TU2 B;  2F1M A;  4FYD A;  1CT1 D;  2NU9 B;  3BJY A;  3GTQ A;  3BAB A;  4CJ1 B;  5ELN A;  1XPU A;  3GID A;  3S1Q H;  3RGX A;  2SNM A;  1XX8 A;  2FIN B;  1M4V A;  2KCT A;  5KFD A;  1F77 A;  1UE5 A;  1DCZ A;  3HOV H;  3N42 B;  1BUV T;  2B2V C;  3NE5 B;  4JI7 L;  1B53 A;  4XX0 B;  2LMC B;  4HJ5 A;  1GSO A;  3J80 W;  1I94 L;  4MV1 A;  1NBW A;  4YR3 A;  1EEI D;  5IYD G;  1B44 D;  3WOE A;  2YRX A;  1J9O A;  2AWN A;  3ER0 A;  1SEB D;  4OX9 H;  4CKB A;  2A6H C;  5K5P A;  4R8I A;  1O78 A;  1GSH A;  1GOZ A;  4KMU C;  3U4Z A;  2I87 A;  4MTE A;  2LSS A;  4KTA A;  1KJ9 A;  5LL6 b;  4LF6 L;  3EFX D;  3G71 A;  4A3I H;  3HB9 A;  4EBE A;  3LX0 A;  4BY1 H;  3R2T A;  4LF4 L;  3SVM A;  1DOL A;  3NPP A;  2FXQ A;  1VQP A;  1VQL A;  1FKA H;  4XYO A;  3GTO H;  4XTC S;  3ORQ A;  2SEB D;  2YRW A;  5LMN H;  4EQN A;  3OW7 A;  1IBL Q;  1I6H H;  3S16 B;  2LY7 A;  4PNY A;  3KF6 A;  1SNQ A;  2A69 C;  5IWA Q;  5FPR A;  3RFC A;  2FMA A;  1PH4 A;  3H0G A;  4TQS A;  5L1K A;  2UUC L;  3E0E A;  2OH2 A;  2ASJ A;  5DQH A;  2IL8 A;  4J1M A;  3MFI A;  5EAY A;  4Y7N H;  1HR0 L;  4C3J B;  1XMO L;  4L1K A;  5KT3 A;  2AGQ A;  4A2A A;  2MP1 A;  1N36 L;  3KTM A;  1F2L A;  1VQB A;  4C5B A;  3KK7 A;  4YHH H;  2UUA Q;  1K3R A;  1SMY C;  2CH4 W;  1NTG A;  1XTD A;  5H1S E;  2V4D A;  4C3H B;  5C44 B;  3SXH A;  5KG1 A;  1B70 B;  5EGT A;  1CE8 A;  3RUP A;  5L1J A;  4IUP A;  1AN7 A;  4TVA B;  3VA7 A;  2IHF A;  1V1P B;  2V58 A;  4LUO A;  2F0E A;  4RH6 A;  4EBC A;  4RB3 C;  1M6V A;  2ENB A;  1Q82 C;  1EUJ A;  4B3M Q;  3S1N B;  4FXG C;  3VR5 A;  4F7X A;  3Q8R B;  2BE5 C;  1RK5 A;  2ZXO A;  3D3R A;  3TP6 A;  3S1M B;  4LF7 L;  4KKT A;  5IP9 H;  2D2C C;  4QW8 A;  1JE5 A;  5CV6 A;  3G6E A;  2CKZ B;  4C3J G;  1F9S A;  1H9J A;  3GTK A;  1IOV A;  3TRE A;  2QKI C;  3CRK C;  5J2T F;  2VUM H;  4IOC A;  1U5K A;  2Y0S A;  5H80 A;  4A3J H;  1Q81 C;  2HHH L;  2PPB C;  3KHG A;  3CQZ H;  1EHI A;  3AQQ A;  1PDQ A;  5FJ8 G;  4C3H G;  2EE1 A;  1Q1E A;  4NXM Q;  5KG0 A;  1PZK D;  1VF7 A;  3URY A;  4JI2 L;  2AQ1 B;  2PW7 A;  3UDF A;  4DXF A;  2KVM A;  1KHI A;  3LP8 A;  3NEL A;  3DWA A;  3SR1 A;  3RB6 A;  4UAI A;  1PTO H;  2HQE A;  3KBX A;  3ETH A;  3M4Y A;  4JV1 A;  1TWH H;  1YHB A;  4R4Q A;  5CBE E;  2EPB A;  3TS2 A;  1WTW A;  1VQE A;  1LO5 D;  1HTP A;  4KI0 A;  4ECZ A;  2ZT9 C;  4GLV B;  3AB9 A;  4XT1 B;  1PTO F;  1LUZ A;  3OWF A;  2CZG A;  3RR5 A;  3QIA A;  5IYD H;  1J5E H;  1VQN A;  5LYJ F;  2AQ4 A;  5D14 A;  3T51 B;  2YS6 A;  4GS3 A;  4KY7 A;  2YTX A;  1U4P A;  1T5E A;  5ELE A;  3D0F A;  5DLF A;  1HNW H;  4O2D A;  3W1B A;  3NK9 A;  2R92 A;  5A2Q E;  5G3L D;  4EYI B;  5DGA A;  2A73 B;  5E4W C;  4QWA A;  3D4R A;  1CZG A;  2RSN A;  2WKD A;  4N8F A;  4BA1 I;  1GUW A;  1RYS A;  2DPI A;  1L1O C;  4H02 A;  4JI4 H;  1PH5 A;  2JA9 A;  4Q5V A;  1Y1V B;  2EXD A;  5FLX c;  2UXB H;  4DL3 A;  1MHW C;  1SE3 A;  2EVB A;  5KFZ A;  4ECT A;  2VR1 A;  5CA0 F;  2YL2 A;  1TWG A;  2O5J C;  1EIH A;  1T36 A;  4P74 A;  4R9W A;  2DGY A;  1K73 C;  3MXU A;  4K0K Q;  5IT9 W;  2A19 A;  3BA8 A;  3HKS A;  1RJP A;  4ODG A;  3NBH B;  1J6Q A;  4ZYS A;  1V9P A;  5M5X B;  4DR5 Q;  5D1P A;  4JI0 Q;  2VS1 A;  4LAA A;  3I7F A;  2VY3 A;  2XRS D;  1KC7 A;  1EYC A;  2HUG A;  2F0K A;  3CCE A;  4KN7 C;  5LMN L;  2ZDQ A;  3UQ8 A;  4LFB H;  4CC6 A;  4DV4 H;  4NXN Q;  2XN9 C;  3I4M B;  1ZET A;  1M1K C;  1IBM L;  1L2Z A;  4LF5 Q;  4UCS A;  1ZYR C;  2F0V A;  3V96 A;  5I6Y A;  3J80 i;  2UXC H;  1WD1 A;  3PCO B;  1E1O A;  5CMD A;  1Y1V G;  4H0L C;  1IBK L;  4DV1 H;  2WDT A;  1EWI A;  1QWY A;  4F8M A;  2V5A A;  2R7D A;  2YW2 A;  1KNE A;  1A9X A;  1GJX A;  5EWF A;  1I4H A;  3PUW A;  2ZTD A;  1HTL D;  2E5L H;  1FNU A;  3KHH A;  2RDI A;  4I50 F;  3UDI A;  3N6R A;  3J81 i;  1HNZ Q;  5KFU A;  4LFC Q;  2UXD L;  3S16 H;  1NMG A;  3RLF A;  5JH7 F;  1IW7 C;  1EZ1 A;  4O0A A;  3MTS A;  5IY0 A;  1Q90 A;  3SE7 A;  4IAJ A;  1QUQ A;  2TMP A;  2CQY A;  1RF2 D;  2KEE A;  5BN3 A;  1STE A;  4C3J H;  5M3F H;  3I4M G;  3H09 A;  1DOM A;  5KFG A;  4F4Z A;  1IYU A;  2F0U A;  3KLR A;  3PUX A;  2OWO A;  1I94 Q;  4HED A;  4RAZ A;  3TQT A;  3EYY A;  1WTV A;  4O3P A;  5C44 H;  1Q7Y C;  3HOW B;  1ZXT A;  1K1S A;  3H3V C;  3MXG A;  1C48 A;  4RCN A;  2WYO A;  4FF3 A;  3SI8 A;  3SHL A;  2G9H D;  1S97 A;  4M7E A;  1Q8K A;  3KDF A;  1C8C A;  5KT7 A;  4IFD I;  4YAJ B;  2R6G A;  4L5S A;  4LF6 Q;  2FK1 A;  4YAK B;  4EEQ A;  1CKN B;  1AH9 A;  3S1N H;  2AGP A;  2MCT A;  3VR3 A;  4LF4 Q;  3E3X A;  2K01 A;  3S1M H;  1C4Q A;  3MVV A;  1I6V C;  2E75 C;  3CVZ A;  1N56 A;  2R6F A;  3F2C A;  5BMV F;  1LTR D;  5AFW A;  3PW7 A;  4BBS H;  2F0W A;  5C0X I;  3DHQ A;  2W6N A;  2XIW A;  4IPG A;  4CKE A;  3I12 A;  1YVC A;  3RJ0 A;  1KEE A;  1VQ7 A;  3NHH A;  3KFU A;  1WTH A;  5C3E B;  3HOW G;  1S0M A;  4LWC A;  5C4Z A;  1FNV A;  1HZ9 A;  4IPD A;  3JAM c;  4ZQI A;  3J7A V;  2FKL A;  2NTS A;  2H4O A;  2UUC Q;  5D65 A;  4JBK A;  2W57 A;  3K5M A;  1BGW A;  1J5E L;  1Q86 C;  1HR0 Q;  2AHO B;  3KJP A;  1XMO Q;  2JEF A;  3QFF A;  2BOS A;  5DLG A;  4N9P A;  1N36 Q;  1JWS D;  4YB8 B;  3PO3 B;  2GLT A;  2N8N A;  2PYK A;  3M4O B;  3GTO A;  1HNW L;  3BZK A;  1GUS A;  1ZHQ A;  3RGZ A;  4ZK9 B;  1RYR A;  1CA5 A;  5C0X G;  5JUM A;  3H15 A;  3T13 A;  1S68 A;  5IGB A;  3FPU B;  1IBL H;  4LJZ C;  2HVQ A;  3J7A K;  1GGO A;  4ZQ3 A;  2FPI B;  3RV4 A;  5C3E G;  5IWA H;  2FPP B;  2RDF A;  5KND A;  2AWO A;  1L1O B;  3CCQ A;  4MV8 A;  1IYV A;  4YR2 A;  2J6S A;  2XCP A;  3I72 A;  3OPO A;  4ZUJ A;  3K7A B;  3H91 A;  3UDX A;  1Y8P B;  1LLR D;  3K5O A;  4LFB L;  2UUA H;  2RGV A;  4C2M B;  1I50 A;  4HR7 A;  2HHH Q;  1Y1V H;  4DV4 L;  2PBZ A;  5DGB A;  1VAJ A;  4EQO A;  1A0I A;  4O1N A;  1AUV A;  4RFB A;  3RAQ A;  4XYQ A;  2AUK A;  2JEJ A;  1TWC B;  3A74 A;  1I7L A;  2VB3 X;  4DV1 L;  5F9L A;  5IGC A;  5M5X H;  4ZI7 F;  1WJJ A;  4CC5 A;  5T1I A;  4B3M H;  4MV7 A;  3DEO A;  4IRC A;  4P75 A;  2XGP A;  3NGD A;  1LTB D;  3VR2 A;  3P20 A;  2R7L A;  4A93 B;  3KHL A;  4GNX A;  1PHJ A;  1ENF A;  4GN4 B;  2YU9 B;  4I55 F;  2R3Z A;  2NU8 B;  4HYK A;  3CQZ A;  3G8C A;  2XVS A;  3QWN A;  1FGU A;  3I4M H;  4RB2 C;  1N34 L;  4L6T B;  1QJO A;  1CM9 A;  1OXS C;  3A5Z B;  3B6Y A;  1M0T A;  1K1Q A;  3MWE A;  4TKO B;  1RJR A;  2EYO A;  4AYB B;  1TWA B;  1Z9F A;  2BA1 A;  3BU2 A;  2F0P A;  2ICI A;  2MNA A;  3BDC A;  3J80 L;  2J6U A;  4NXM H;  3U4V A;  5HY6 A;  4K6L A;  3WOF A;  5FO8 B;  1CQJ B;  1VS0 A;  2DUD A;  1YNJ D;  4UDU C;  3M7G A;  4UCR A;  5LXT F;  2GPS A;  3BYY B;  5LL6 S;  3RAX A;  4FNF A;  3PIO 3;  1SDF A;  1KJ8 A;  2E2I A;  3PF5 A;  1S5E D;  3RB0 A;  2LXK A;  1GHK A;  5J39 A;  1YHQ A;  3IN5 A;  1EYA A;  1MZB A;  2NN6 I;  3HOY B;  2K32 A;  4POG A;  1SFO B;  4A93 G;  2W9B B;  1Y8O B;  2E76 C;  4QIW B;  3M4P A;  1UE7 A;  4LK1 C;  1WFQ A;  2B2W C;  2KA7 A;  1SNO A;  4RNO A;  3H3V I;  3U50 C;  4YR0 A;  1O7Y A;  4IRK A;  5KG7 A;  5JAV A;  1IYJ B;  5KIX A;  3M4I A;  2QGQ A;  5D1O B;  4I7H A;  1JC7 A;  4AYB G;  3KAL A;  3TZD A;  2R8K A;  4Q0F A;  4QL5 A;  3K7U C;  4L5Q A;  3NQT A;  3SK6 A;  3HOW H;  1E2W A;  1EY8 A;  5LMN Q;  2CQA A;  3X3N A;  5FLM G;  3CD6 A;  1GD7 A;  1O80 A;  1JIH A;  2OEO A;  3G48 A;  2YTV A;  3HKZ E;  5EPL A;  1IBM Q;  1Y69 U;  3HOY G;  2N88 A;  1ZHS A;  1WTX A;  4PG3 A;  1X9N A;  4MTK A;  3GQB A;  1LM0 A;  1T94 A;  1IBK Q;  1TT2 A;  1E4F T;  4YWM A;  4JI6 Q;  2BR0 A;  2VPQ A;  2V9W A;  1PTO C;  3CCV A;  4NLG A;  4DGZ A;  2K5D A;  2W71 A;  4K0K H;  1PA6 A;  4O3Q A;  2IT1 A;  1N9W A;  2RSO A;  2WAC A;  4IJH A;  3A0J A;  1BDO A;  5T1G A;  4ED8 A;  3ULL A;  2Q8R E;  2UXD Q;  5C3E H;  1LT5 D;  1ROD A;  1FD7 D;  3RLO A;  1PFN A;  3HKZ A;  2Z6K A;  3TP8 A;  1EUD B;  4R8U A;  1M90 C;  3LML A;  1IBL L;  1TS3 A;  4JOI C;  3W1G A;  5IWA L;  5IOD A;  3V2T A;  4AH6 A;  4LF5 H;  3PW2 A;  3PO3 H;  3N44 B;  5C5J A;  1BCP D;  2YYA A;  1H9M A;  1D1K A;  3M4O H;  3RLN A;  2ZXP A;  4ZKC B;  5KRU A;  1JT8 A;  1S5D D;  2L12 A;  1SRU A;  3S17 H;  3HS0 C;  3S15 H;  2R7K A;  2UUA L;  4OEM B;  3NXW A;  5EKL A;  2XSC A;  1EUC B;  1HNZ H;  1V51 A;  4EGJ A;  4LFC H;  4O2A F;  4UCU A;  5IYB H;  2JYO A;  3C3L A;  1Y1W A;  3MHB A;  2F52 A;  2RVL A;  3G6Y A;  1Z47 A;  1CFM A;  5DNF A;  2C2E A;  1VMC A;  1NUC A;  3PIP A;  1TAE A;  1FJG L;  2CCZ A;  3K7A H;  1DV2 A;  4Q0Y A;  5ELF A;  5C4X B;  1UUP A;  1PRT D;  4C2M H;  1I94 H;  3E5S A;  4LSA A;  1DYQ A;  1U4L A;  5JJZ A;  2H5X A;  5C4J B;  4YCU A;  5LMU Q;  2VUG A;  1KDC A;  4MNO A;  3R5H A;  3DF7 A;  4KN4 C;  3BVG A;  4K5V A;  3K81 C;  3CF5 A;  1LT3 D;  2XIG A;  1B3A A;  5GRO A;  5D3D A;  2JE6 I;  4DL6 A;  1PH6 A;  4WJ3 M;  3OSN A;  4NMZ A;  4HTH A;  1EU4 A;  1RK6 A;  4XYL B;  3C1E A;  1HNW Q;  1G6Z A;  4KD4 A;  4FBT A;  4JCV E;  2YU9 H;  3CPW A;  4RUC A;  1OXT A;  1HHV A;  4CDE C;  5CV4 A;  1CHQ D;  3GII A;  3I55 A;  5C4X G;  5HV6 A;  4J9M A;  1SEI A;  1S9F A;  2J4X A;  2K05 A;  4I65 A;  1A15 A;  1TWA H;  1TY2 A;  5IT9 L;  1EQQ A;  4BBR B;  4GZY C;  5IGD A;  4WFN 3;  2PI2 E;  1X56 A;  3QR8 A;  3V6K A;  2GA4 B;  2Q8T A;  1PXU A;  4O4L F;  4C5A A;  3VA5 A;  1KIX A;  4HID A;  5FD5 A;  1RTN A;  1EEF D;  1HR0 H;  2F0T A;  3Q23 A;  1S5C D;  3V4S A;  1N36 H;  3HOY H;  1H9R A;  5FLX E;  2LFN A;  3GTG B;  2F3V A;  1SFO H;  1DOK A;  3MFG A;  4JUZ A;  4Q44 A;  4Q8E A;  3GTL H;  3KXY T;  3G6X A;  1C9O A;  1TWF B;  4O3O A;  3NWS A;  1JE4 A;  2PI2 A;  1G29 1;  3U58 A;  2ATL A;  3I4L A;  2FB9 A;  4A3E B;  3QJY A;  4X66 L;  4TRD A;  4ECQ A;  4Z9C B;  5K2M A;  4DL2 A;  2ASL A;  5ELC A;  5EJW A;  4DV1 Q;  3NWT A;  4BBR G;  4G57 A;  1N8R C;  4BWS C;  4DR3 H;  2IBK A;  3VYU A;  1VQ8 A;  3FPP A;  1JKJ B;  1STN A;  1EQR A;  1KJI A;  1SR3 A;  3L4J A;  4RCO A;  5KFC A;  5DG8 A;  2V4Q A;  4LF8 H;  4DV0 Q;  1X54 A;  3RZO B;  1L0X B;  2OQK A;  1CSQ A;  1B6S A;  3CCL A;  1PTO B;  5GAE C;  3PUV A;  5C3W A;  2CW0 D;  1N34 Q;  1VQG A;  3VYT A;  2HJW A;  5M5W B;  3HGB A;  3ERO A;  1TWH B;  3RN5 A;  2DZD A;  2HHH H;  3NBH A;  1W93 A;  3A8J E;  1UNS A;  2DNC A;  3TDQ A; 
#chains in the Genus database with same CATH homology
 4PZ8 A;  4A3E G;  1VQI A;  2NZH A;  4P72 A;  3CP0 A;  2BH8 A;  2PNH A;  1Y14 B;  1W2B A;  3PO2 G;  3H0G H;  3ICE A;  4DPG A;  3L7Z C;  1TWH H;  1YHB A;  3CW2 C;  4R4Q A;  1DGS A;  4KHP Q;  4GKK Q;  1QUQ B;  4XIG S;  4X64 L;  3TS2 A;  4BY7 H;  1G51 A;  4LUV A;  2K14 A;  1VQE A;  1X3E A;  4JI5 Q;  4LW1 A;  4BA2 I;  1GO3 E;  1G6P A;  1BBU A;  3T1H Q;  4X62 Q;  2CFM A;  2AMC B;  3I4O A;  4KI0 A;  4IFD G;  4GLV B;  3J81 j;  1LUZ A;  1SRO A;  3S1R H;  3RR5 A;  4DUZ Q;  1IXR A;  2GVB A;  5IYD H;  2YV5 A;  1VQN A;  1EYG A;  2NZO A;  2PMZ E;  5AJ3 L;  5GAD C;  4MZ9 A;  3PV0 A;  4NPS A;  4POF A;  1AE2 A;  4GS3 A;  2YTX A;  3D0F A;  1VQ9 A;  2K4K A;  4JI4 L;  4O2D A;  3W1B A;  4DAY B;  3K0X A;  1HZC A;  2BA0 A;  2UXB L;  1YIT A;  4B3T Q;  3KDF B;  3CXC A;  5GAG C;  1PYS B;  4DR1 Q;  1C0A A;  1SLJ A;  4BA1 I;  1PH7 A;  1L1O C;  4H02 A;  1PH5 A;  2JA9 A;  1VQF A;  3Q8D A;  5FLX c;  2EXD A;  2JK8 A;  3T1Y L;  4ALP A;  2ASB A;  4LF7 Q;  4DV3 L;  3K80 C;  1RIP A;  4R4O A;  2BH2 A;  2ZJR A;  4PMW A;  3F2B A;  3HOX G;  4LNQ A;  4P74 A;  2DGY A;  1K73 C;  4K0K Q;  4DV5 Q;  1B7Y B;  1UWV A;  1MJE A;  3GTK H;  4A3L G;  1N33 Q;  2A19 A;  1HR0 W;  3HKS A;  2K50 A;  1NY4 A;  2IHE A;  2K52 A;  3NBH B;  1J6Q A;  1V9P A;  4UPA A;  4DR5 Q;  1C7Y A;  1HNX Q;  1YJN A;  4JI0 Q;  1UE6 A;  2VS1 A;  1QZG A;  4IPH A;  2OTL A;  4OWW B;  1XNQ Q;  3I7F A;  2VY3 A;  4GN5 A;  5C4X H;  5M3M G;  5BR8 L;  5LMN L;  3CCE A;  2VQF L;  2UXC L;  4LF9 Q;  3LGJ A;  5GQO A;  4JI2 Q;  4A4I A;  5C4J H;  1CKM A;  2Q2T A;  4NXN Q;  4GLA C;  2RHS B;  1M1K C;  1IBM L;  5IYC H;  3KF8 B;  4LF5 Q;  1CKN A;  4JC0 A;  4BXX G;  1X65 A;  3J80 i;  1X3F A;  3PCO B;  3AFP A;  2MO0 A;  5GAH C;  1E1O A;  1QZH A;  2E5L L;  1Y1V G;  3ULJ A;  1IBK L;  4DV6 L;  2E8G A;  4DR7 L;  1RL2 A;  4A3M H;  1EWI A;  4L5T A;  2R7D A;  2JA7 G;  1Q1B A;  4X64 Q;  2EIF A;  1V1Q A;  1YBY A;  3PUW A;  4X65 L;  2ZTD A;  3L0O A;  4B3R L;  1JJG A;  4PZ7 A;  3GTJ H;  3TRZ A;  3STB D;  3SGI A;  3UDI A;  4JI3 Q;  2EQS A;  4ME3 A;  3J81 i;  1HNZ Q;  2VZA A;  4LFC Q;  2UXD L;  3HFZ B;  1PH1 A;  3S16 H;  3DM3 A;  1NMG A;  1T9H A;  3NEN A;  3RLF A;  2R7Z G;  1Q12 A;  4O0A A;  5IY0 A;  2K5H A;  2Z0S A;  4DV7 Q;  1BBW A;  1HZA A;  2WAQ E;  1S72 A;  4JOI A;  1QUQ A;  4BBR H;  3ULP A;  3ZJY C;  3CC7 A;  4A3B H;  4OWT B;  4YY3 Q;  2JA8 H;  4C3J H;  5M3F H;  5JJL A;  3I4M G;  4EQ5 A;  1PH9 A;  1E22 A;  2OTJ A;  4EX5 A;  4OX9 Q;  3PUX A;  4DR3 L;  2ALY B;  1S3O A;  2OWO A;  1I94 Q;  3F1Z A;  1W3S A;  3KJO A;  3KYH C;  1FJG Q;  3PUZ A;  2HIV A;  2Q2H A;  3CMA A;  2CWA A;  5C44 H;  1Q7Y C;  3FKI G;  3GTG H;  3K8A A;  2QEX A;  5ELO A;  4DV3 Q;  4LF8 L;  1TWG H;  3HOZ G;  1OXX K;  3CME A;  2Q2I A;  1K83 H;  4JI1 L;  1EFW A;  2JA8 G;  5M3F G;  1KXL A;  3CCS A;  2R92 G;  2AKW B;  4IJL A;  1Q8K A;  1TWF H;  3KDF A;  3CC4 A;  1WOC A;  4IFD I;  2R6G A;  4L5S A;  4LF6 Q;  1CKN B;  1NJI C;  1GVP A;  3S1N H;  4DR4 L;  1AH9 A;  4A3E H;  4LF4 Q;  4AQY L;  3CC2 A;  2I5H A;  1HH2 P;  4GNX C;  3S1M H;  2WFW A;  5BR8 Q;  3HOU H;  4P73 A;  5C44 G;  1L0W A;  3F2C A;  4GNX B;  2UUB L;  1TXY A;  3W5O A;  4BBS H;  1SE8 A;  5C0X I;  1PV4 A;  4IPG A;  2ES2 A;  1EOV A;  1YVC A;  1A63 A;  2HIX A;  1KRT A;  1VQ7 A;  3CCM A;  3RZO H;  2NN6 G;  4DAM A;  3KFU A;  3I2Z A;  2K5N A;  2KEN A;  3S2H H;  4B3S L;  3HOW G;  4LWC A;  1MJC A;  5M5W H;  1HZ9 A;  1WCM G;  4IPD A;  3JAM c;  3HOU G;  4OO1 G;  1VQD A;  4JBW A;  1VQH A;  3MXN B;  4AYB E;  2UUC Q;  2JEA I;  4LUZ A;  2RF4 A;  4UP7 A;  4JBK A;  4LFA L;  4BBS G;  4YHH Q;  4X65 Q;  1J5E L;  3S14 H;  1Q86 C;  1HR0 Q;  2AHO B;  3PSI A;  3KJP A;  3CCU A;  1XMO Q;  1MKH A;  3GTM H;  3TQY A;  2ZTC A;  1N36 Q;  2KHJ A;  1ASZ A;  3WWV A;  2N8N A;  1VQC A;  1HNW L;  4AIM A;  3BZK A;  3J7A 5;  4YWK A;  3GD7 A;  5LMN W;  4JBM A;  3E9H A;  3BJU A;  3HOX H;  2OQ0 A;  4DK6 C;  5C0X G;  4QIW E;  1VQ5 A;  3H15 A;  1E1T A;  3FP9 A;  3STB C;  4A3L H;  2NVT H;  1LTL A;  4DUY L;  2F4V Q;  3TEH B;  1UE1 A;  4C3I H;  2IX1 A;  1K0R A;  5E7N A;  5C3E G;  4YCV A;  4GKJ L;  4APV A;  4X66 Q;  2AWO A;  5M3M H;  1PH8 A;  1L1O B;  3CCQ A;  2NVQ H;  5JJI A;  1B8A A;  1D8L A;  1X3G A;  2JA6 G;  1OTC A;  4L5R C;  3M7N A;  3E9I A;  5M5Y H;  4X6A H;  3KLW A;  5K36 G;  5DLQ E;  1S40 A;  3MEF A;  3UDX A;  2NVY H;  4BXX H;  1NMF A;  4LFB L;  2N3S A;  4JV5 Q;  1QVG A;  2QA4 A;  3I56 A;  2MQH A;  1XMQ L;  2HHH Q;  1Y1V H;  4AQY Q;  4DV4 L;  1K8A C;  3JC6 6;  1O7I A;  2I5L X;  3RN2 A;  4JI8 L;  1A0I A;  2NVX H;  2JA7 H;  3UE0 A;  4HJA A;  4B3M L;  2UU9 L;  4DR2 L;  1IL2 A;  3PUY A;  1PVO A;  3A74 A;  2RHQ B;  2WAQ G;  4DV1 L;  5M5X H;  1JJ2 A;  2XGT A;  1WJJ A;  1YZ6 A;  4A75 A;  2Q2U A;  1OXV A;  1L2F A;  2MFI A;  4J15 A;  1VQK A;  3HOV G;  1JJC B;  4P75 A;  1KC8 C;  2R7Z H;  2Z6K C;  3OW2 A;  4A3D G;  4FDB A;  1N32 L;  1VQJ A;  3CCJ A;  3CCR A;  1AE3 A;  2JEB I;  4QJF A;  4GNX A;  4GOP C;  1PHJ A;  4JI6 L;  4GN4 B;  2RCN A;  4DR6 L;  1TWC H;  4LFA Q;  3I4M H;  1FGU A;  1J5E Q;  1N34 L;  1SMX A;  4DK3 C;  3B6Y A;  1OXS C;  3A5Z B;  4NXM L;  1FL0 A;  1I3Q H;  1VQ4 A;  3CPF A;  2VQE L;  4RG1 A;  1Z9F A;  2BA1 A;  3BU2 A;  2D62 A;  4A93 H;  3EIV A;  3NEM A;  3J80 c;  4IOA A;  1E24 A;  2MNA A;  4HIK A;  3U4V A;  5AJ3 Q;  3FKI H;  5HY6 A;  4JYA L;  3S24 A;  2WB1 G;  3UE1 A;  4A3I G;  1VS0 A;  2DUD A;  4BY1 G;  3HOZ H;  1YNX A;  3PIO A;  5J3B A;  2R92 H;  4JI4 Q;  3S2D H;  3PF5 A;  2ZJP A;  4KHP L;  2E2H H;  5IT9 c;  2LXK A;  1YHQ A;  1HZB A;  4GKK L;  2UXB Q;  4DUY Q;  1GM5 A;  2NN6 I;  2GN5 A;  4QQB X;  4A3C G;  3T1H L;  4X62 L;  3J81 c;  4POG A;  4A93 G;  1P16 A;  3HKZ G;  3M4P A;  1UE7 A;  1QVF A;  1WFQ A;  4HJ9 A;  4GLX A;  3T1Y Q;  4OO1 I;  4DUZ L;  5FLM H;  4DKA C;  2VL6 A;  3U50 C;  3H3V I;  3DLL A;  3PGZ A;  1IYJ B;  1VQ6 A;  2QGQ A;  2F3I A;  4YWL A;  4AYB G;  4LFB Q;  1I50 H;  2WB1 E;  2Y0S E;  4UY8 C;  4QL5 A;  3K7U C;  1IZ6 A;  2VW9 A;  2I0Q A;  4L5Q A;  4DV4 Q;  4B3T L;  3HOW H;  1L1O A;  2K75 A;  1WCM H;  1NE3 A;  3TS0 A;  2IY5 B;  5LMN Q;  2R7F A;  1YEZ A;  3PF4 A;  1H95 A;  4MTN A;  1P8L A;  5FLM G;  2VQF Q;  3CD6 A;  2B29 A;  1GD7 A;  2UU9 Q;  2B63 G;  4DR2 Q;  3H3V H;  2UXC Q;  1PH2 A;  1KAW A;  1KL9 A;  1QVC A;  1K8G A;  2ZM6 L;  1E3P A;  3G48 A;  2YTV A;  3HKZ E;  1IBM Q;  3I4N G;  4P71 A;  3HOY G;  1Y1W G;  1OXU A;  4PG3 A;  4K0K L;  1VCI A;  4OON A;  5HGQ A;  4DV5 L;  2A1A A;  4A3F G;  1X9N A;  1N32 Q;  1V43 A;  1I5F A;  1LM0 A;  5LMU L;  3L2P A;  3G4S A;  2E5L Q;  1N33 L;  1IBK Q;  4DV6 Q;  2ID0 A;  1K9M C;  4DR7 Q;  2KHI A;  2N78 A;  5JJK A;  4YWM A;  4NB3 A;  4DR5 L;  4JI6 Q;  4IFD J;  3CCV A;  1ASY A;  3GTP H;  4JI0 L;  4DR6 Q;  1PFS A;  3EN2 A;  1PA6 A;  1KRS A;  4B3R Q;  2C35 B;  1N9W A;  2IT1 A;  5IP9 G;  4IJH A;  1YJW A;  2YYZ A;  4KHZ A;  4LF9 L;  3A0J A;  1UEB A;  3M85 A;  4JBJ A;  2VQE Q;  5IP7 H;  2JA5 G;  3ULL A;  4NXN L;  4HIO A;  1XNR L;  5C3E H;  2UXD Q;  3F8T A;  3RLO A;  3AYH B;  1JB7 A;  1VQA A;  4LF5 L;  2Z6K A;  2CQO A;  1M90 C;  3J7Z C;  2JQO A;  4OWX B;  3FHW A;  4PZ6 A;  1IBL L;  2VUM G;  4GOP A;  4DNI A;  4JG2 A;  4A3J G;  4WJ4 A;  2JA6 H;  3D31 A;  4JOI C;  3W1G A;  1SN8 A;  5IWA L;  2E2I H;  2KBN A;  4AH6 A;  3GO5 A;  2ZTE A;  2YTY A;  1XPR A;  3PO3 H;  1EIY B;  2R93 G;  2L15 A;  2N49 A;  4DR3 Q;  3M4O H;  5IP7 G;  3RLN A;  1YIJ A;  3RZD H;  1JT8 A;  4QY7 A;  1X55 A;  2LXJ A;  4KLK A;  4GN3 B;  1CKO A;  4JI3 L;  1SRU A;  1HNZ L;  3S17 H;  4LFC L;  1A8V A;  3S15 H;  1HJP A;  2JJQ A;  4R4I A;  2UUA L;  5JEA J;  4LF8 Q;  4JI1 Q;  5ELN A;  2D0P A;  4QGU A;  1XPU A;  4DV7 L;  3H0G G;  1VQM A;  3OTO L;  3S1Q H;  2A8V A;  4IO9 A;  4YY3 L;  3PO3 G;  2KCT A;  5IYB H;  4BY7 G;  3IRB A;  1UE5 A;  4DR4 Q;  4A76 A;  3HOV H;  4A3K H;  4A3D H;  1WYD A;  2F52 A;  1EIF A;  1Z47 A;  4JI7 L;  1VQO A;  4HJ5 A;  4OX9 L;  3GDE A;  1I94 L;  1NBW A;  5IYD G;  3PIP A;  2UUB Q;  1FJG L;  1BKB A;  2CCZ A;  3K7A H;  2AWN A;  3ER0 A;  2ZM6 Q;  2E2J H;  1X6O A;  3M4Q A;  4C2M H;  3ERS X;  5IE8 A;  5IYB G;  2H5X A;  3U4Z A;  4A3K G;  2LSS A;  4R1J A;  4YCU A;  5LMU Q;  1KQS A;  4B3S Q;  4LF6 L;  4MNO A;  2D0O A;  3G71 A;  3VDY A;  4A3I H;  5JEA G;  3KOJ A;  4BY1 H;  4DV0 L;  1FVI A;  4LF4 L;  2KCM A;  3K81 C;  3CF5 A;  1PH3 A;  2K5V A;  4GOP B;  4IPC A;  4TQU S;  3EBE A;  5GRO A;  2CWP A;  1E7Z A;  2FXQ A;  3BZC A;  1VQP A;  2JE6 I;  1VQL A;  1PH6 A;  4DV2 L;  4WJ3 M;  1R9T H;  4A3C H;  1LYL A;  2ZJQ A;  1XNR Q;  3GTO H;  3CAM A;  1MIU A;  4XTC S;  1HNW Q;  4UP8 A;  2B3G A;  2GVA A;  1XJV A;  4JCV E;  2YU9 H;  3AFQ A;  4A3G H;  1CUK A;  2Y0S G;  4R4T A;  3CPW A;  1IBL Q;  2ATW A;  1WI5 A;  2XTI A;  1OXT A;  4YCW A;  1I6H H;  3KF6 A;  5IWA Q;  3I55 A;  1PH4 A;  5C4X G;  2PQA A;  1YHA A;  2UUC L;  3E0E A;  1TWA H;  1EQQ A;  4JI5 L;  2PI2 E;  3M9B A;  4YHH L;  5EAY A;  4Y7N H;  1X56 A;  1HR0 L;  1XMO L;  4GKJ Q;  5IYC G;  1A62 A;  1N36 L;  2HQL A;  1KIX A;  3RNU A;  3GTQ H;  4HID A;  4A3G G;  1VQB A;  2UUA Q;  2B63 H;  1K3R A;  1NTG A;  1XTD A;  3OTO Q;  3A5U A;  5H1S E;  4A3M G;  1XPO A;  2IX0 A;  3I4N H;  1Q46 A;  3HOY H;  1B70 B;  1Y1W H;  1SFO H;  4R4C A;  4TVA B;  4A3F H;  4HIM A;  2IHF A;  1XMQ Q;  4HJ7 A;  3GTL H;  4Y52 H;  4JI7 Q;  1C9O A;  1CSP A;  2F4V L;  4LUO A;  1U0L A;  4JI8 Q;  1D7Q A;  4DR1 L;  1GKH A;  2PI2 A;  1G29 1;  3U58 A;  1Q82 C;  1EUJ A;  4B3M Q;  3AEV A;  1PYB A;  4X66 L;  3OYY A;  1BVS A;  5FJ8 H;  4RMF A;  4C3H H;  4DV1 Q;  2MO1 A;  5IP9 H;  4BBR G;  1N8R C;  4LF7 L;  4A3B G;  1JE5 A;  1VQ8 A;  3G6E A;  2CKZ B;  1JMC A;  4UP9 A;  3UDG A;  2JA5 H;  1EQR A;  2OCE A;  3F2D A;  1SR3 A;  3TRE A;  2VUM H;  4IOC A;  4JV5 L;  1U5K A;  4DV0 Q;  1X54 A;  1YI2 A;  1HNX L;  2OQK A;  2V1C C;  1CSQ A;  4A3J H;  1Q81 C;  3CQZ H;  2HHH L;  4OXP A;  3JAM i;  3CCL A;  1XNQ L;  3PO2 H;  3AQQ A;  5GAE C;  3PUV A;  5FJ8 G;  3KF6 B;  1N34 Q;  1VQG A;  1Q1E A;  4NXM Q;  4HJ8 A;  2PQA B;  3RN5 A;  2R93 H;  4DV2 Q;  4JI2 L;  2WP8 J;  3UDF A;  1KD1 C;  3M3Y H;  2HT1 A;  5C0X J;  1YJ9 A;  2I5M X;  1KHI A;  2VNU D;  3NEL A;  4JYA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...