2JA8G

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja8G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja8G01
1VQOA 1HJPA 3MXNB 3PGZA 4P71A 3S15H 1X3FA 4DAYB 3RLOA 3HOVG 3HOYG 4X64L 1XNRQ 1L1OB 4HJ9A 4GNXA 3E9IA 1SR3A 4Y7NH 4LF7L 3I56A 2BH8A 2ZTCA 4OXPA 2F3IA 1PH3A 3PUYA 1VQ7A 2ZTDA 1YZ6A 4LF6Q 3GO5A 1PV4A 2HIXA 1N32Q 5HGQA 5IP9G 1JJ2A 4BA1I 1QVFA 3HOYH 2D0OA 4DV5L 4K0KL 3ICEA 1VQ8A 1YVCA 4DUYQ 2YTYA 2E8GA 4A3LG 5LMNL 2N78A 1Y1WH 1SRUA 2E5LQ 1CSQA 1HR0W 4WJ4A 4LF9Q 4BBRH 4JI4L 4LF8L 2JEAI 2UXCQ 1A0IA 1Q86C 5C44H 2WP8J 1VQ4A 5IYDG 2RHQB 3J80i 1E22A 2PNHA 1KL9A 4GN5A 3L7ZC 2UXDQ 2GN5A 1UE7A 5C4XG 1Q12A 5M3FG 4LWCA 4NXMQ 2OQ0A 4B3TL 2E2HH 4LUOA 3TRZA 5HY6A 2PQAA 5IP7G 3JAMi 2K52A 3BZCA 4BY7G 4JV5Q 4DV6L 5GROA 3AQQA 4A3KG 3CW2C 1I94L 4BBSH 1HNWQ 2ZJQA 5JJKA 1NTGA 3M85A 2UUBL 2V1CC 3S2HH 1XMOL 1VQEA 3CC2A 1V9PA 4H02A 3GTMH 1QUQA 4BY1H 3HOUH 1N34L 2KCTA 2IX1A 4HIMA 3Q8DA 3CP0A 3S1QH 4YHHQ 2UU9Q 4GN4B 4JBMA 2MQHA 5M3MG 1IYJB 4A76A 2UUAQ 3DLLA 1CKNA 3CXCA 4DR6Q 3GTQH 3K81C 3PUWA 5IYBH 3H0GH 3I4MH 2YYZA 1JMCA 4DUYL 2Q2TA 1ASZA 3L0OA 4LW1A 3L2PA 5JEAJ 1NE3A 1VQIA 2Q2HA 3J81c 3CCQA 1AH9A 3I2ZA 3PUXA 2VL6A 2VQFQ 1E3PA 1IBLQ 2UXCL 4JI3L 3RZDH 3PV0A 4B3RQ 4POGA 2ZM6L 3J7A5 3CC7A 1XPRA 1EIYB 2EIFA 2EQSA 2K4KA 4A3JG 3W1GA 2VW9A 4EX5A 2HHHL 4LFCQ 4A3LH 2NVQH 1KRTA 2KCMA 5AJ3Q 4LF4Q 3KJOA 2KENA 4DV4L 4NXML 1IZ6A 3EIVA 1PHJA 1HZBA 4X66Q 1LM0A 1VQCA 2R7ZG 4JI6Q 2IY5B 4DR2Q 5C4XH 4JI1L 4A3IG 5M3FH 3G6EA 4OX9L 4A3GG 3AFPA 2NVTH 1P16A 1IL2A 3K80C 2EXDA 4DK6C 3CPFA 4R4TA 3KDFB 3ERSX 3CCVA 1XMQQ 4GKJQ 4A93G 4IO9A 3UDIA 2VUMH 2VNUD 3NEMA 3IRBA 3CMEA 3I55A 1Q46A 1YHAA 1U5KA 1Q1BA 1FL0A 1KHIA 1SROA 3EN2A 1Q81C 4LFBQ 4JOIC 4Y52H 2UUAL 4O0AA 4DR6L 1XJVA 4L5SA 3ULLA 1Y1VH 1SMXA 1EUJA 5C3EG 2JA7H 1HZCA 4DUZL 1YI2A 5GAGC 2ZJRA 3OYYA 3WWVA 4DR5Q 3ZJYC 5M3MH 5LMUQ 1K73C 3S1MH 2UXBQ 3BU2A 1G6PA 1MJEA 2ZTEA 1JE5A 3KYHC 2JK8A 2JA5G 3CC4A 1L1OC 2IHEA 1UEBA 4UPAA 4DV2Q 2OQKA 4X65Q 4P72A 4GOPB 1VQPA 3PO2H 1C7YA 1KAWA 4JBKA 4JC0A 4DPGA 3F2DA 4A3BH 4GS3A 4HIDA 3CCLA 3U4ZA 1SN8A 4JI0L 1PH1A 4LF4L 3W1BA 5M5WH 1WJJA 4QIWE 4YCWA 4X66L 3J80c 2F52A 5C0XJ 4A3JH 1Q7YC 4JI6L 2ATWA 5IWAQ 3M4PA 1VQAA 1VQKA 4PZ7A 1AE2A 3FKIG 3NELA 3PCOB 2LSSA 2NVYH 3PUVA 1EOVA 4DKAC 3HOWG 5GADC 2NZHA 3JAMc 1H95A 2B29A 4IPDA 4QJFA 3BJUA 2RHSB 1OXVA 2Z6KC 2R6GA 1PYBA 1AE3A 4AH6A 2Z0SA 3J7ZC 1K8AC 1HNZQ 1WCMG 4QY7A 4AYBE 1XNQQ 4GKJL 1VQMA 4P73A 1EYGA 3CD6A 3M3YH 5IE8A 1DGSA 4A3IH 3CPWA 2VQEQ 1EWIA 3CMAA 3W5OA 2OWOA 3H3VH 1FJGQ 4IFDJ 3PSIA 5K36G 4DV3L 1S72A 3GDEA 3KF6A 1YEZA 1N36L 1N33L 4O2DA 2R92G 4A3MG 3PO3H 1RIPA 4PMWA 2A19A 1PH2A 4JI7L 4A93H 3AYHB 2PI2A 5DLQE 1VQHA 1V1QA 1VCIA 2JE6I 2AWNA 1J5EL 2NN6G 4IJHA 2RF4A 3TEHB 4X62L 1IBKQ 3G71A 3RZOH 4DR7L 3RLNA 5LMUL 1NBWA 1VQLA 4BA2I 4TQUS 3UE0A 4OONA 1A62A 2NN6I 1CUKA 1SE8A 3UDXA 4DV2L 2F4VQ 4BXXG 5C3EH 4OWTB 3T1YL 2MNAA 4DR4Q 3STBD 1JJGA 2Q2UA 1UE5A 3UE1A 4A4IA 4B3MQ 1X65A 4RMFA 4A3FG 5BR8L 1NY4A 1M1KC 4JCVE 2JA5H 2UUCL 2GVAA 4DV1L 2PI2E 3F2BA 2JA6G 3T1HQ 3A5ZB 4GKKQ 3ULJA 1W2BA 4GLXA 1K83H 3M4QA 3FHWA 3M9BA 1XNRL 5FJ8H 1R9TH 3I7FA 4A3EG 1HNXQ 1HR0Q 3HKSA 4UY8C 1I3QH 4LF6L 3GTOH 3GTPH 3STBC 2B3GA 4GNXB 1HNZL 1N32L 1GVPA 1VQGA 4DV7Q 4NXNQ 1XNQL 4GLAC 1N9WA 1VQDA 1BBWA 1L2FA 2RCNA 2XTIA 4P75A 2QEXA 3CCUA 3EBEA 1I6HH 1UE6A 4AYBG 3HOWH 1FJGL 4OO1I 2OTJA 3HOVH 4JI5Q 2IX0A 3KFUA 2E5LL 3K7AH 1KC8C 1HZ9A 5IP9H 4DR1Q 1WCMH 3ULPA 4LF9L 3KF6B 1V43A 5IYCG 4OWWB 1VQ6A 3HOZG 4PZ8A 1RL2A 5GQOA 1Z9FA 3NENA 4DV0Q 1IBKL 4DR3Q 4IPGA 2ASBA 3G48A 2R7FA 3PF4A 2NZOA 3TQYA 4A3MH 2UXDL 3M7NA 4JYAQ 2JQOA 1X3GA 1OXXK 4IPCA 4JI2Q 2LXJA 1YBYA 3OTOQ 4A3CG 4NPSA 1Z47A 3CCRA 5FLMG 2I5HA 1B7YB 5IYDH 3A74A 1W3SA 2YU9H 4JV5L 2B63G 5IY0A 4LUVA 3HKZE 1HNWL 3PIOA 2PQAB 1X6OA 2JA8G 3F8TA 3I4NG 4BXXH 1PH5A 2QA4A 1IBMQ 5LMNW 1Q82C 1YHBA 4JOIA 5IP7H 3CCMA 2JA9A 5C0XI 4BY7H 5E7NA 1EQQA 4C3IH 4A3FH 1B70B 3KLWA 4A3KH 1PH7A 3CCJA 2VS1A 3RN5A 1HNXL 4GOPC 4L5TA 1KQSA 1EQRA 1QUQB 4YHHL 1HR0L 2OTLA 2UU9L 1WFQA 4YY3Q 4YWMA 4MNOA 4AQYQ 2ZJPA 2JA6H 3S17H 2QGQA 1QVCA 4NB3A 1X54A 1PVOA 5FLXc 1KXLA 1L1OA 1GKHA 2IHFA 1QVGA 2AKWB 2D0PA 1FVIA 2YTXA 4A3EH 4WJ3M 1CKNB 4X64Q 2R93G 4UP9A 4HIKA 4LF7Q 3TS2A 4IFDI 1X3EA 4DR1L 1JJCB 3G4SA 4YCVA 2VQFL 2FXQA 1IBLL 1Y1WG 4A3DG 4LFAQ 3GTLH 4B3RL 3PF5A 4TVAB 4BBRG 2HIVA 2I5LX 4DV5Q 1OXUA 3U58A 3K7UC 2DUDA 2KBNA 4DK3C 1BKBA 1Y14B 4LFCL 5GAEC 1SFOH 1LUZA 2MO1A 3K8AA 4R4OA 5C44G 4EQ5A 1N8RC 1VQ9A 3S14H 1ASYA 5LMNQ 3JC66 5AJ3L 4YCUA 4IJLA 2GVBA 2YTVA 4JI4Q 3OTOL 2Z6KA 2NVXH 1J6QA 1K0RA 2MFIA 3PIPA 4DR2L 4IPHA 1VQJA 5ELOA 3CCSA 1CKMA 3HKZG 1M90C 4LF5Q 4HJAA 1TXYA 2K14A 4DNIA 1C9OA 1KD1C 2R7ZH 2CWPA 2B63H 4B3TQ 1XMQL 1YJNA 1K9MC 4JBJA 2L15A 1LYLA 2CCZA 4ME3A 2MO0A 3GTJH 3H15A 4A3GH 2JA8H 1I94Q 3AFQA 3I4NH 2R7DA 2WB1G 4PZ6A 4JI8Q 2N3SA 3RR5A 1JT8A 4AQYL 4LFBL 2UUBQ 3U50C 4R1JA 3KOJA 5C4JH 1XMOQ 4MTNA 2N8NA 3VDYA 5JEAG 1VQNA 4RG1A 5IYBG 3H0GG 1N34Q 3I4MG 5JJLA 2IT1A 4DR5L 2UXBL 5J3BA 4QGUA 3CF5A 4C3JH 3CQZH 4LFAL 4KHPQ 3A0JA 4R4QA 4X65L 4XTCS 3LGJA 3S24A 2VZAA 2WAQE 3E9HA 1PH8A 4R4CA 4GNXC 3OW2A 1TWAH 1VQFA 2KHJA 2YV5A 4FDBA 4C2MH 1YITA 1VQ5A 1BBUA 4A3DH 1E24A 1OTCA 4LUZA 2KHIA 1YHQA 2JJQA 1TWFH 3B6YA 1XPOA 3RN2A 3ER0A 1E1OA 1YJWA 4JI3Q 2ZM6Q 1YIJA 2R93H 5IT9c 1X56A 5IWAL 1C0AA 2HHHQ 1CSPA 3GD7A 3A5UA 1E7ZA 4ALPA 4LF5L 1NJIC 4XIGS 1PFSA 4DV4Q 1WI5A 4OO1G 2K5VA 4A75A 4OWXB 3FKIH 3CAMA 2CFMA 2BA1A 2AWOA 2ID0A 3BZKA 1WYDA 2VQEL 4HIOA 1NMFA 4JI1Q 3F1ZA 2VUMG 3S2DH 4JI8L 4OX9Q 1G51A 3KDFA 2ES2A 3HOXG 3J81j 1HZAA 1TWGH 1A63A 5JJIA 2CWAA 4KI0A 4J15A 4HJ8A 1PH4A 3HOUG 1VQBA 1Y1VG 3D31A 1D7QA 2JA7G 1PYSB 3S16H 2R92H 3AEVA 4L5RC 1P8LA 3I4OA 2I0QA 2E2IH 4KHPL 4UP7A 1UE1A 1X55A 2F4VL 2BA0A 2CQOA 1LTLA 2Y0SE 4DR4L 3D0FA 1X9NA 1PH6A 3UDGA 4B3ML 1OXSC 1JB7A 4DUZQ 3PO2G 2E2JH 3GTKH 2WAQG 3DM3A 2CKZB 1K8GA 4A3BG 4P74A 5C0XG 3M4OH 4GOPA 1VS0A 3CCEA 3S1RH 1Q8KA 2H5XA 1NMGA 1MKHA 1U0LA 4HJ5A 3T1HL 3E0EA 4R4IA 4B3SQ 4GKKL 4KHZA 1D8LA 1K3RA 1YNXA 2LXKA 2N49A 2WB1E 4UP8A 4IOAA 4JI0Q 2DGYA 4JBWA 2AMCB 1HH2P 1EFWA 4APVA 4DV7L 4NXNL 2WFWA 1G291 2D62A 4IFDG 2A1AA 4LNQA 2Q2IA 1UWVA 2HQLA 4KLKA 3RNUA 4IOCA 3NBHB 2PMZE 1A8VA 4JI5L 4POFA 3TS0A 2VY3A 3GTGH 4JG2A 3RLFA 3PO3G 3J81i 1FGUA 3H3VI 4DV0L 5H1SE 4K0KQ 2ALYB 1GM5A 1IXRA 1Q1EA 1I50H 2K5HA 2C35B 3SGIA 1TWHH 4DR3L 3HOXH 4PG3A 4YWKA 4QL5A 1SLJA 1PA6A 4JYAL 4DV3Q 5EAYA 1QZHA 3HFZB 1N36Q 1N33Q 4JI2L 5IYCH 3HOZH 5M5XH 4HJ7A 1MJCA 4JI7Q 1I5FA 4LF8Q 3FP9A 4DAMA 1MIUA 1TWCH 2OCEA 3K0XA 2Y0SG 4GLVB 3MEFA 3U4VA 3UDFA 1J5EQ 4X62Q 4DR7Q 2JEBI 1OXTA 1XTDA 2K5NA 1BVSA 2K75A 1KIXA 4BBSG 1QZGA 1PH9A 1IBML 2BH2A 4A3CH 1L0WA 5ELNA 5FLMH 3S1NH 1T9HA 5GAHC 1GD7A 3T1YQ 4MZ9A 4B3SL 2AHOB 2A8VA 2XGTA 1XPUA 4QQBX 1EIFA 3F2CA 3KF8B 1GO3E 2K50A 4YWLA 3KJPA 4DV6Q 1KRSA 5BR8Q 1YJ9A 4BY1G 1S40A 4L5QA 1B8AA 4C3HH 1WOCA 4AIMA 2I5MX 1CKOA 3PUZA 4GN3B 5FJ8G 4YY3L 2UUCQ 2HT1A 4DV1Q 5M5YH 4X6AH 3TREA 1O7IA 1S3OA 1E1TA
chains in the Genus database with same CATH superfamily
4HNTA 3PGZA 4JK1C 1B50A 2RVLA 2VOBA 5CV6A 3WO1A 1UUPA 1EWHA 3OTOH 4GNXA 3E9IA 2JSOA 1H9MA 2ASJA 3IAYA 2F3IA 3PUYA 2CW8A 4LF6Q 3GO5A 1N32Q 5HGQA 1KLUD 5IP9G 3J81L 1JJ2A 4YR3A 2BDOA 3GTGB 2EJFC 4JPBW 5FKAC 2KHSA 4LH6A 1BCPB 1CSQA 1SE3A 4XYQA 4WJ4A 1TT2A 1TY2A 3SVMA 4JI4L 5F2DA 4RU9A 4UCVA 1FKAH 1TWHB 1E4EA 4YY3H 1K0SA 1Q86C 3PIO3 5FOBB 4AQYH 5C44H 3OOCA 5EKIA 3C3LA 4RKLA 1E22A 2PNHA 3CU7A 2I07B 2Z1CA 1TWCB 1FNVA 3T4AC 3K6OA 2X0SA 4LF7H 4NXMQ 4F4WA 1STHA 2BQRA 4LUOA 3TRZA 3K5OA 2Y0SA 3HZXA 4IRCA 2K52A 4IUQA 4JV5Q 3V6JA 3PZPA 1I94L 4BBSH 4ECWA 2KVMA 5IT9W 3M85A 2J0TD 3ND8A 1K3BC 1WTHA 5G3LF 4DAVA 5LMNH 1QG7A 3I72A 1AUVA 3KBGA 4NP5A 1AZPA 2R8JA 4IRDA 1ONLA 1K8OA 2EDGA 3KAJA 4N8X1 3S15B 5CV9A 1IYJB 5M3MG 4K8IA 4R8IA 1EU4A 3JZIA 4DR6Q 2YL2A 3TMEA 3K81C 1GGOA 4UDUC 5EKKA 1I4XA 1ASZA 2G9DA 3L0OA 4LW1A 3L2PA 3I91A 1VQIA 1HUNA 1TA8A 4I7HA 3R5XA 4ZK9B 1BOSA 2PMZA 4HCEA 4DK1A 2D5DA 4L8JA 1E3PA 2EYOA 1IBLQ 4JI3L 2UXCL 3PV0A 4ME6A 3CC7A 2B8FA 1GHJA 1XPRA 4HEDA 2UUBH 2EIFA 2EQSA 2HHHL 5EOYA 2ENBA 1FR3A 1LTBD 3EIVA 1HZBA 3MXGA 3JAML 4LSAA 5KFMA 3WNZA 1MGSA 4FBUA 4KHPH 4G3IA 5A2QE 2NWGA 2O2LD 2Y0SB 4QUCA 3MFYA 4A3GG 5HBRB 4J9OA 3K80C 3RMHA 3MWMA 2EXDA 4RKBA 2QKIC 3KDFB 4RZQA 3ITPA 2AU0A 3PMFA 4A93G 2VNUD 3CMEA 1YNJD 1Q46A 5LL6b 1KHIA 1FL0A 1SROA 4QF4A 4YAJB 1WTVA 4Y52H 2EYFA 4DL6A 4BY1B 2LMCB 1XJVA 4QIWA 3ULLA 2UVVA 5EKLA 1JC7A 5C3EG 2JA7H 1Y8OB 1YI2A 1BCPD 2ZJRA 4DR5Q 4EVOA 3S1MH 2RDGA 2RDHA 3H0GB 2FJ2A 5IGEA 2CW0D 4O3RA 2JA5G 2AGQA 2IHEA 1UEBA 3EJIA 3GV3A 2I46A 2OQKA 1B1ZA 2PMZB 3P1HA 3IFTA 3LNNA 3QG1A 4GOPB 1AZQA 3PO2H 3GTLA 1YNJC 4FP5D 1WTPA 4A3BH 4ED7A 4JC0A 2VB2X 1H9KA 1JDBB 3RZDB 4E4TA 4DXGA 4RB2C 3V2TA 3VYUA 4ZI7F 1S5BD 4HN7A 4X66L 2F52A 5BN5A 3J80c 4A3JH 1RJQA 2ZDQA 5KFFA 1BCPC 5IWAQ 1D1KA 2RQXA 4PZ7A 4CDDC 4IWXA 3BG5A 4PDBA 3L9AX 2KCCA 2LSSA 2CW0C 2OEOA 3QO2A 4QJFA 1OXVA 2FLNA 1HCZA 2WV6D 1HNZQ 4AYBE 1XNQQ 4GKJL 4FYDA 4UCTA 2R7ZA 2AQ2B 3TP5A 2IP4A 5IE8A 4ODGA 2NVTB 4EBEA 1IOVA 3CMAA 4IFDJ 3PSIA 1AFPA 5KFGA 2B2WA 4A3MG 1RIPA 4PMWA 1PH2A 3BS1A 2VUMB 3AYHB 4JI0H 4OIJA 1V1QA 3HOXB 2AQ4A 2NN6G 3TEHB 4Q5VA 4DR7L 5TSSA 4K8JA 3L4KA 1NBWA 4BA2I 2R7KA 1UC8A 4I55F 5F9NA 4X64H 2F4VQ 5KFAA 4OWTB 3T1YL 2MNAA 2W71A 2CW7A 4MA0A 2Q2UA 3VA7A 1E2WA 1DIKA 1I4GA 3SI8A 1B33N 1HHVA 2GVAA 4YBZB 4DV1L 1HUMA 3NWTA 3F2BA 1BDOA 3V4ZA 4DV3H 4J9QA 5KFZA 4KMUC 3A5ZB 5KFLA 4GKKQ 1N36H 4GLXA 1K83H 2XWJB 3M4QA 5M5WB 4LF8H 3J7AF 5FJ8H 1R9TH 3I7FA 2CZGA 1RHPA 1J5EH 3HKSA 1LLRD 3GTOH 1SNDA 2W9CA 5DQGA 2IL8A 1BBWA 1L2FA 2KECA 4B08A 2GPWA 3EBEA 3DM1A 4RHRA 1I6HH 3FKIA 5FPRA 1HQMC 1FJGL 2OTJA 3EA6A 3GIKA 1M8AA 4IUTA 4UCOA 3KFUA 5IP9H 1KTKA 4DR1Q 3M3YB 1MSHA 3EYYA 5KT3A 4A2BA 3JRXA 1WH2A 1V43A 1IW7D 4X3SA 5IYCG 1VQ6A 3HOZG 3K58A 1PK8A 4YR2A 5KG0A 4HNVA 1BF4A 1KDCA 1STEA 3PO3B 3H4DA 3QOJA 3PF4A 4K14A 2DJFC 1OXXK 3O13A 2R92A 4EBCA 4MV6A 5DEHA 2E2IA 4A3CG 4NPSA 1Z47A 4FU0A 3SK5A 4LF6H 1B7YB 3HB9A 1W3SA 4G4KA 2YU9H 4FM9A 1N32H 1UNNC 3P7JA 3GTKA 2WIIB 2QCPX 2JA8G 4Q43A 1PH5A 1IW7C 2QA4A 4ED1A 5KYLA 5LMNW 1Q82C 4QWAA 1B2TA 1WTQA 1JWSD 3RAXA 5EBCA 1KC7A 4C5BA 2W6QA 3KLWA 4PWQA 1M6VA 2W8KA 1PDQA 3OMGA 3RN5A 1GXDC 4GOPC 2OF1A 1DOKA 1EQRA 3A55A 1SAPA 3D4RA 2J9GA 2IBKA 2JA6H 4DAYA 5FLXE 3S17H 2QGQA 1PVOA 3BA8A 1X54A 4A2AA 5FLXc 1EY5A 3P20A 1TS2A 4Q8FA 1QVGA 2AKWB 1B6SA 2D0PA 5CR3A 1I3QB 4A3EH 1HQRD 4WJ3M 4NXMH 2L11A 3C1FA 4O3OA 1X3PA 1X3EA 1F9PA 1STAA 4JV5H 5ELBA 1BNZA 4J6HA 4YCVA 4A3DG 1EZ1A 1Y1WG 3HOWB 1JIHA 2JXMB 5BN4A 4DV5Q 2DUDA 4DK3C 5ISRA 1E2ZA 1Y14B 3M4YA 4O3PA 1LUZA 1CQVA 4R4OA 4RHSA 4EQ5A 1VMPA 1XYIA 3S14H 4YB8B 2IPKD 5AJ3L 2GVBA 3OTOL 2Z6KA 2F3VA 3MAQA 2MFIA 5DQHA 2W6ZA 5K5PA 4QWDA 1EYAA 4IPHA 4DR6H 2F1MA 4FXKC 2EY5A 5ELOA 2ZDHA 3SE0A 3HKZG 4DNRB 1M90C 2W8LA 2FE3A 5IIFA 1SCUB 3MWDA 2CWPA 4B3TQ 2GA4B 1XMQL 1YJNA 4JBJA 1IBLH 2CCZA 3BQ1A 5CMDA 4ME3A 2B63A 3H15A 4A3GH 3UI2A 3PW5A 3GTJA 2N3SA 1XX8A 1JT8A 4R7RA 4AQYL 5L9XA 2KUMA 1ZETA 3MXPA 4R1JA 3F8NA 3QJYA 4F4ZA 1VQNA 4ZKBB 4B9XA 3K5HA 1CI3M 1ZHSA 5KFHA 5JJLA 2IT1A 4IALA 2UXBL 1EUCB 2WACA 3S9WA 3A0JA 3CRKC 3KK7A 1GSAA 3BQ0A 1LTGD 5T1IA 5KG2A 4R4CA 2H4OA 4YJ3F 4FDBA 3M9NB 2L4NA 4R9WA 2ICIA 4MAMA 4FNFA 2A73B 2FK3A 3OHAA 2R8HA 1XPOA 1E1OA 2ZM6Q 2R93H 5LA6F 2NU9B 1LACA 1CSPA 2EYJA 3GD7A 5DG7A 4KD4A 3ERQA 2NVXB 4ALPA 4XIGS 1DM0B 3BA9A 4DR5H 4DV4Q 3X3MA 3R2IA 3SXHA 5I6WA 4A75A 1I7LA 2NU7B 3T51B 4LJZC 2M05A 4MA5A 1XTCD 4HIOA 2CH4A 4CKEA 5KG5A 4JI1Q 5LOVF 4BS9A 3RFCA 4R8NA 1QWYA 2B63B 1HA5A 1ENAA 4OIKA 1GUGA 1JORA 2CWAA 4KI0A 1Z2NX 1WTRA 3D31A 4K2KA 3VYRA 3S16H 2WB1A 3LP8A 3CRLC 3I4OA 2I0QA 2WE6A 5IWAH 4KHPL 4FF2A 1XNRH 1UE1A 5JEAH 1DXMA 2AUKA 4RUAA 1LTLA 2Y0SE 2NN6H 4QW9A 4B3ML 4QWCA 4DUZQ 1HNZH 4MTEA 2R87A 1R4PB 3J81E 1K8GA 5JJZA 1XNQH 4LMYA 2IX3A 1DV2A 1O7LA 1TWAB 3BABA 2K7VA 2QDLA 5D65A 3E0EA 4B3SQ 1V51A 5KFKA 4JV2A 1D8LA 1KAAA 5FPOA 4ILWA 4XDXA 2VB3X 4HSVA 4DL5A 2OT2A 2AMCB 1EZ8A 2F0QA 4Y8VB 4TSSA 1EFWA 3K5IA 1W6JA 2WFWA 2J6UA 1PZKD 4NMZA 1T3NA 4N9TA 4KK7A 2X69A 2ZXRA 2F4VH 4HAEA 1ESFA 4KLKA 3SDZA 2PMZE 4ID6A 2GLTA 5C3WA 3TS0A 5KG4A 4OO1H 3TQTA 4JG2A 3PQIA 3TZUA 4ZRZA 3H3VI 4TRDA 4DV0L 5D1OA 5H1SE 3K59A 4K0KQ 2HVQA 2F0LA 1IXRA 2N88A 1JE4A 1I50H 3R23A 5ELEA 1WCMB 3HOXH 1D5MC 1SLJA 4GKKH 1TVXA 2XNAC 5EAYA 5CC4A 2PNRC 5IYCH 1TU2B 4HJ7A 4JI2L 3HOZH 4JI7Q 1I5FA 1IYVA 2D2CC 1SYCA 4HR7B 2OCEA 3UDFA 3GQCA 2UVUA 2QILA 3V05A 4X62Q 2JA7A 4HQ6A 2LY7A 3N40P 1SYEA 1XTDA 1RYSA 1SNMA 4RB0A 4BBSG 2W6OA 1PH9A 4A3CH 2O5JC 3S1NH 1CA5A 1GD7A 1D1IA 4DR1H 1O75A 2V5AA 2IMWP 5HURA 2K50A 2FMAA 5C0XH 1YJ9A 1SYGA 1B8AA 2UUCQ 5I9OA 4LFCH 4ZLTF 1O7IA 3NXWA 2IWHA 1VQOA 1PX2A 3MXNB 1LT5D 5COYA 1X3FA 4X64L 1XDNA 4FS2A 1L1OB 2EJGC 3JAME 1SR3A 4J9LA 3I56A 4QWBA 4OXPA 5KG1A 3RV3A 2FJZA 1JB3A 1F9RA 4BA1I 1QVFA 4JV1A 4L6TB 1VKZA 1A3VA 2R84A 3A56A 5DGBA 5D1OB 3TQ1A 4ZUIA 1LTID 4AYBB 2N78A 1Y1WH 2E5LQ 3U9TA 4K2LA 1PFNA 4LF9Q 3SK6A 4LF8L 4TV8F 1SFOB 2QK4A 1NR2A 3URYA 4M7EA 5JAVA 5LP6F 2SNSA 3NP8A 3J80i 5M5XB 5EBDA 4GN5A 3L7ZC 2UXDQ 5J39A 2HVSA 2GN5A 4KY6A 1ULZA 1Q12A 2XIGA 4DUZH 2C2DA 3T56B 3MR6A 2EYMA 4ED3A 3AMUA 4ED2A 2M9VA 2EZVA 2L55A 1B04A 4CJ1B 5IP7G 3BZCA 4C3IG 4JVZA 3CW2C 2K1BA 1LO5D 4PMBA 2ZJQA 5LXTF 4DV5H 4X3UA 2V1CC 1K8MA 3S2HH 4IR9A 1XMOL 1VQEA 2FP4B 4H02A 4C3HB 1QUQA 3I3CA 2E75C 4LMQD 1N34L 3JSLA 2EY2A 3GTMA 4RCOA 4FXGC 2O5IC 5M5YB 2B2TA 5EJWA 1K83A 2UVWA 3CP0A 3S1QH 2UU9Q 3X3NA 4GN4B 2JEFA 1OWTA 2UVRA 4HMIA 2F0UA 2G5DA 2Z4HA 2FK1A 4IUUA 2UUAQ 3DLLA 3GTOA 3CXCA 4U6PA 3GTQH 3PUWA 1CA6A 4Y7NB 2Q2TA 5LL6X 5EWFA 3CQZB 1NE3A 4FF4A 3OSPA 4B3TH 1LABA 1EY6A 2NUCA 1KJJA 1A6XA 2C5CA 2VL6A 2VQFQ 4B3RQ 4RH6A 3PIP3 4HSPA 2EYHA 3T13A 3J7A5 4K5XA 2E2DC 3J7YW 4FO2A 4A3JG 2VW9A 4A3LH 1JQYD 3WOEA 4BBRB 2NVQH 3OUZA 1KRTA 3ND9A 4M9UA 2W9BA 2Q8TA 1EQTA 4P2CB 3EPGA 3BYTB 3KJOA 2KENA 4NXML 2K33A 2DPJA 1PHJA 5CV5A 4C5CA 4JI6Q 2IY5B 4XQQA 4DR2Q 1M0WA 2A5HA 2YU9A 3OPOA 5C4XH 2FINB 5M3FH 4OX9L 3AFPA 2BCOA 2E2HB 1P16A 1IL2A 2FK2A 3NTHA 2XIWA 1S5DD 4XXEA 5CA0F 1A2UA 3NEMA 3IRBA 2ZM6H 4UCRA 4HNUA 4KJNA 1GYFA 3FPPA 1U5KA 3EN2A 1Q81C 4JOIC 2NZ1D 3HOUB 1RK6A 3TP8A 4C3JG 4DR6L 4XX0B 2JA6A 4L5SA 2F0VA 3R2TA 2LFNA 2MJ8A 1RJTA 1R4QB 2CHBD 2F0WA 3FVQA 3VR6A 4DV4H 1LT4D 5GAGC 5EZYF 1T36A 1N48A 3ZJYC 2PZTA 3V6KA 3BU2A 1MJEA 4MIUA 3W2DA 1BCPF 1JE5A 3G6JB 5CBAE 3I4MB 1AUXA 3CC4A 1L1OC 1Z2PX 1CHPD 4L1KA 1A9XA 2W7PA 4JI1H 1VQPA 3NSWA 4H44C 4UCUA 5HV6A 3F2DA 2FLLA 4GS3A 3CCLA 1SN8A 1PH1A 3FEWX 1DCZA 5C8YF 4YCWA 5JQWA 1Q7YC 5E1FA 3VPDA 4KY7A 2WKDA 1EY0A 1VQKA 1PMRA 3NELA 3G6XA 1W96A 2NVYH 4DKAC 5EGTA 3IG0A 3I90A 1H95A 3RIZA 5KT7A 4IPDA 5HGTA 4AH6A 2NUAB 1AE3A 1IHZA 4EGVA 2DY8A 4P73A 1EYGA 3CD6A 3NPPA 2K6AA 1DGSA 4A3IH 5KT4A 2K5DA 3CPWA 2VQEQ 1EWIA 1PFMA 2OWOA 4B3SH 1AEXA 3DHQA 1S72A 3KF6A 5KKNB 1N33L 3G7LA 2A19A 1VQHA 2YZMA 4QUFA 3RZOH 3G71A 1O7YA 4V0BA 4NDXA 4CDFC 1YNND 5EDWA 3HRZC 4WFN3 1II3A 1Y1VB 3ZYYX 2XRSD 4O2AF 3G6YA 3NTKA 1CUKA 3N6RA 1LTTD 1SE8A 5CBEE 5I4DA 4MV3A 5KX5F 1NR4A 3WDNA 4DR4Q 3RBEA 2LS01 1TS4A 2PZUA 5M3MB 3UE1A 2EYLA 3FMCA 3QZ7A 2EPBA 2HVRA 1C48A 2I8CA 5BR8L 5T1GA 1M1KC 2Z9HA 4JCVE 4FS1A 4K0KH 2DJGC 2X6GA 4XQJA 2JA5A 2PI2E 2B39A 1T5EA 3BYYB 2QF7A 2JA6G 1H9SB 2B2YC 3T1HQ 5E3FA 2XCPA 4JI7H 1YNNC 3M9BA 1XNRL 1SBBB 4A3EG 4X62H 5EWGA 3GTPH 3QZ8A 3RAQA 4GNXB 1HNZL 1SJHD 4DV7Q 4NXNQ 1XNQL 4DNTB 1N9WA 2RCNA 3NBHA 1B3AA 2SEBD 4JI5Q 2L12A 5ELFA 3HOVH 5KT5A 1KC8C 1WCMH 4XT3B 1ZEQX 2XGQA 3KF6B 2UUCH 2B2VA 2F0TA 4PZ8A 5GQOA 1Z9FA 3NENA 3I12A 3KLRA 1GUOA 2EXZA 2NTTA 1E4EB 1I4HA 3G48A 2R7FA 2NZOA 3TQYA 4A93B 3M7NA 4JYAQ 3H4BA 2JP1A 1X3GA 2J4XA 4IPCA 2OH2A 1EU3A 2LXJA 1YBYA 5FD6A 3CCRA 5FLMG 3IFDA 3K5LA 3VR5A 1HNWL 2JN4A 2V58A 5C3EB 4B9WA 4ECRA 2V9WA 3F8TA 2NB0A 2G9HD 3R93A 1IBMQ 3NWSA 2PYKA 1JOOA 5IP7H 3CCMA 4TQSA 2E5LH 5E7NA 1EQQA 4BWSC 2JA5B 4C3IH 4LF9H 1NAPA 5L37A 3VA5A 2Q8RE 2VQDA 1KQSA 4YHHL 3GILA 2ZJPA 4NB3A 2UXDH 2K32A 5CV4A 3M7GA 2QW7A 4KV6A 3MTSA 2TMPA 1GHKA 1GUTA 2HCCA 2ZXOA 3Q22A 1AN7A 1TY0A 3HOYB 5EPLA 1JJCB 3QR8A 4DR1L 1RYRA 5IGGA 4UAIA 3G4SA 1PRTF 3GIQA 4H7BA 1O78A 3PF5A 3HGBA 4TVAB 2HIVA 1SMYD 3JSNA 3K7UC 4K6DA 4F88A 3K7AB 5GAEC 2BH2A 4LFCL 1SFOH 2R93G 4RB3C 4N8FA 5IT9L 3T5LA 1VQ9A 2F0DA 5C6AA 4I7AA 4O2BF 3JC66 2W9AA 4OHJA 2YTVA 4JI4Q 2UU9H 4A3MB 3MR5A 5C5JA 2UUAH 1S0OA 1J9OA 3VR3A 3OIPA 2F0KA 4F4XA 4DGZA 1G8ZD 1CKMA 4PMCA 5T14A 2A6HD 5LHY1 4LF5Q 1XWEA 2FFKB 1AP0A 1SMYC 5CB4F 1V8QA 2VQFH 5KFRA 4B3RH 2WAQA 2EOTA 4J0MA 3I4NH 1I94Q 3AFQA 1S9FA 2R7DA 3Q6SA 4BY7B 3OIQA 4JI8Q 1HRJA 2DNCA 4LFBL 2KEDA 4A3KB 4F50A 4MTNA 1U4LA 2C2RA 3U9SA 3VDYA 5JEAG 4RG1A 5D14A 3H0GG 4CDCC 4QIWB 2A6HC 4EQNA 4JI6H 5J3BA 4QGUA 5KG7A 4DR2H 4C3JH 1RDPD 2R7LA 1LTRD 3CQZH 5BPHA 4F8MA 4X65L 3LGJA 1BO0A 1Z6HA 1V1OA 3R3OA 1PH8A 1ZHQA 4RNMA 1I4QA 1Z7TA 4RGTA 4ZAIA 4GNXC 2WTFA 1VQ5A 4C2MH 3GTLB 1BBUA 1PTOB 1E24A 3N52A 3D6CA 1TWFH 3B6YA 1Y1WA 3RN2A 3ER0A 4JI3Q 1YIJA 5C4HA 1X56A 4ABNA 4EG0A 3VYSA 2RCFA 1KJQA 4ME5A 2HHHQ 1L2ZA 3A5UA 3H3VC 1M7JA 1E7ZA 5KG6A 1ML0D 2HJWA 5M9OA 4CHTB 4O3NA 1CE8A 3OHXC 4OO1G 2K5VA 3RB4A 1L0YB 3BZKA 2B2UA 1GSHA 3D8GA 4XYOA 2VUMG 1VF7A 2R7ZB 1G51A 3HKZA 3HOXG 4DK0A 1TWGH 1A63A 4ULLA 5JJIA 2JA8B 1PH4A 2DNEA 1D7QA 1MZBA 5C4JB 2AQ3B 4KN4C 1P8LA 2FPGB 2PW7A 1D5XC 1G2SA 4ED0A 5IGBA 3TIIA 3NTIA 4I50F 3EFXD 3UDGA 2ALZA 2K05A 4O4HF 2WAQG 2KEEA 1RJPA 1SYXB 5DAUA 3E5NA 3M4OH 5C0XG 5KNDA 2F0JA 2VQEH 1JOKA 3CCEA 4O3SA 3H20A 1STNA 2H5XA 1RTOA 4Z9CB 4A3DB 1TKWB 3HG9A 1K3RA 2LXKA 1E0BA 2N49A 1KDBA 3H6MA 4UCSA 4IOAA 5EWEA 4RFBA 3MR3A 1AN8A 3KBXA 2BR0A 4Q0YA 2WDTA 1EHIA 3K57A 5A2QW 5KFOA 2W9CB 4YJ2F 4DR4H 1A8VA 2A74C 4RGOS 3FKIB 4C1NK 2VY3A 3GTGH 5KT2A 3HKZB 3PO3G 2RGRA 3S2DB 1FGUA 2R8GA 2ALYB 1GM5A 1QNKA 4DR3L 3UFXB 2K5HA 1PA6A 1TWHH 5CV7A 4YWKA 4QL5A 4ECYA 1LT3D 1RD9D 3HFZB 4KD3A 3ETJA 3FMAA 2R92B 1TWCH 1MSGA 3MEFA 1PTOD 2E2IB 4DR7Q 4DV7H 2F03A 4NXNH 5FO9B 1CQJB 1ILPA 3QFFA 3GV8B 1OXTA 3DEPA 3I73A 1F2YA 3HP3A 5FLMH 2E2JB 4JI5H 3GTKB 1T9HA 4EFBA 3T1YQ 3PW4A 2YZGA 4B3SL 4DL4A 1XPUA 2R6FA 1EFID 4YWLA 1GO3E 3G8CA 4YP3A 4DV6Q 1KRSA 1WD0A 3S1RB 4L5QA 4CC6A 3J80W 5C5MA 4YY3L 4EFEA 1S03G 3GQBA 4DV1Q 4A3FB 4X6AH 3D4WA 1S3OA 3R5FA 4JYAH 1PTOC 1HJPA 4R8UA 3S15H 4DAYB 3RLOA 3BJYA 2OLSA 4CJ2C 1C4QA 4LF7L 2L9HA 1V1PA 1PH3A 1VQ7A 3H91A 2ZTDA 4ECQA 4JV0A 1HFNA 1TS3A 1PV4A 4H0LC 4IFDH 1B3QA 2D0OA 2F0MA 2NBFA 3N44B 4K0KL 4ZQ3A 1IBMH 3ICEA 1BXTA 1YVCA 2KOLA 1VQ8A 4DUYQ 4ETSA 4IN3A 2YTYA 2E8GA 4A3LG 5LMNL 1SRUA 1HR0W 1SYBA 1V4YA 2JEAI 3V96A 1BXRA 5KG3A 4XYLB 2JEJA 2FHTA 3K5MA 2F0OA 2FB9A 2B2WC 3C46A 2SCUB 1UE7A 2CVRA 5C4XG 5M3FG 2XRQD 2OQ0A 1D2BA 4NKLA 5HY6A 2PQAA 2DN8A 5IGFA 4K6LA 4PNYA 5GROA 3AQQA 5JJKA 1OO9B 2UUBL 1RJRA 5I47A 2R7NA 4HCSA 3CC2A 3GTJB 2XSCA 2V4RA 3KHHA 1E2VA 4PV1C 4BY1H 4JI4H 1VDZA 4HIMA 2YS7A 2ZT9C 3Q8DA 3D3RA 1DZ1A 3BAAA 3Q8RB 3SK8A 4A76A 4EEYA 1CKNA 2AQ1B 3H0GH 4LF5H 2YYZA 1JMCA 2ATLA 3T16A 5GONF 5D1PA 3J81c 2R8KA 1EY8A 3CHBD 5ELCA 1C30A 3CCQA 3DF7A 4TV9F 3PUXA 3MR2A 1I94H 4G7OC 2DPIA 3RZDH 4POGA 1X3QA 4JI8H 5LL6S 1EIYB 3J80L 3E3XA 2MCTA 2KQ3A 1EY4A 1Q8IA 2KCMA 5AJ3Q 3RTXA 4LF4Q 5C44B 1IZ6A 3Q23A 1LM0A 1F2LA 3SE7A 4A3IG 2NVTH 2EVBA 3RB6A 3C2PA 5D3DA 2VUGA 2CQAA 2VPQA 4DK6C 3OWEB 3CPFA 4R4TA 4BBSB 1IOWA 3RBDA 3ERSX 3CCVA 1ICFB 1XMQQ 2O03A 4OEMB 4GZYC 3UDIA 5J22A 4JI3H 2VUMH 1CS0A 3I55A 2NTSA 1PYWD 2F0GA 5FLXW 4N9PA 2HHHH 2UUAL 4IZ8A 2WB1B 3AU7A 4RNOA 1BQQT 1EUJA 2RSOA 1HZCA 1TS5A 1SE2A 3R8BA 4ECUA 5J2TF 1JWUD 2VA2A 3OYYA 5LMUQ 2UXBQ 1A15A 3BQ2A 3RUPA 4Q45A 2ZTEA 2PBZA 1EIHA 3GIMA 1PTOH 4UPAA 4DV2Q 2F0NA 4P72A 2KJXA 4E6IA 1SYFA 3BVMA 3JRWA 4IRKA 4JBKA 4DPGA 4HIDA 1EYZA 4JI0L 3RF2A 3DUZA 4CBVA 1L0XB 4K5VA 4H13C 3W1BA 1BUVT 5M5WH 2R7MA 1WJJA 4QIWE 3A7AB 1UAPA 2E76C 4S3SA 1JOQA 2PQEA 2QEJC 4JI6L 2WINB 2RA4A 1PFBA 1AE2A 3E0JA 4Q8EA 2NZHA 3JAMc 2B29A 3HOVG 3BJUA 2RHSB 2Z6KC 2R6GA 1PYBA 5E4WC 5KFUA 3J7ZC 5J2UF 3M9OB 1WCMG 3A8IE 1VQMA 5JVH3 3M3YH 4DN4M 2BDNA 3KUPA 3DMUA 4DAPA 4DV3L 5K36G 1YEZA 1N36L 4ZKCB 2JEIA 3PO3H 2F0PA 4IWYA 3MEHA 2RBMA 1VCIA 1BJTA 2AWNA 1J5EL 1IBKQ 4IJHA 3MZ5A 3TP7A 4DA2A 3RLNA 1SNPA 1EIGA 1WTXA 4OONA 2NN6I 2JA7B 1KLGD 1FNUA 5C1PA 1SDFA 5L1LA 4WORA 3S1MB 1N56A 4B3MQ 3UQ8A 1X65A 3BDLA 4RMFA 2VR1A 4RB1A 3OW7A 1S0MA 2HDLA 4C2MA 3PO2B 1DD2A 1BBXC 5KFWA 4A3BB 4FVMA 5IT9E 4YR0A 1TWFA 1KBLA 2FLPA 3ULJA 1Y8PB 4EBDA 3FHWA 5FLXL 3H40A 4EYIB 4A3JB 2P0AA 1HNXQ 1HR0Q 2SDFA 2W6NA 5JOBA 4UY8C 1I3QH 4LF6L 1R9TA 4DR7H 2HUGA 1N32L 4IUVA 1VQGA 1O80A 4GLAC 4P75A 2XTIA 2YW2A 2AGPA 5EQ0A 4AYBG 1SJED 3HOWH 3T1YH 4OO1I 1EEID 5D3IB 4DL2A 5D8DA 2IX0A 2RSNA 1HZ9A 3ULPA 4IUNA 4TKOB 4DV6H 3RB0A 2BQUA 1STBA 1B53A 4G7ZC 5KFIA 1TWGA 3MC0B 2IJ0A 4DV0Q 3N41B 4DV1H 3GIPA 1K1QA 2ASBA 5JVLA 3A8KE 1NNXA 2JQOA 3KTMA 4CDEC 3EROA 4JI2Q 2A6ED 4J9MA 3QOLA 2V59A 1RK5A 4KTAA 3J81W 2I5HA 4JUZA 4JV5L 4RNNA 3M9MB 5IY0A 3HKZE 2C22A 1SSOA 3PIOA 2YZNA 1CZGA 4V190 3I4NG 4FF3A 4BXXH 1RCVD 4DUYH 3DXJC 2FPIB 3WO0A 3KF8A 5C0XI 4A3FH 4X3TA 1B70B 1PH7A 1JKJB 3CCJA 1SXTA 3KAKA 1CFMA 5JPNC 1Y69U 2A6EC 1QUQB 2OTLA 1WFQA 1EZ6A 3GTMB 1SYDA 1K83B 4CJ0B 1KXLA 4O42A 3V4SA 1GKHA 1R9TB 2YCHA 1RKNA 2IHFA 2XN9C 3V6HA 3GTOB 4X64Q 4UHVA 1WTWA 1SNOA 1IBLL 1I6HB 5C1OA 3PVXA 4LFAQ 1U9RA 3GTGA 2XGPA 5ELDA 4BBRG 2I5LX 3U58A 1OXUA 4PQXA 1JDEA 2KBNA 1KDAA 2K04A 3HS0C 3Q2OA 2Q8IB 4G7HC 3IL8A 1N8RC 1TWHA 4YCUA 4LH7A 4WD3A 2W9BB 2NVXH 1JWMD 1F2MA 1J6QA 4MV1A 3MWYW 2MUYA 5KNCA 4QB4A 1TWCA 1SNQA 5DGAA 3TIGA 2L0CA 2YU9B 3Q8SB 2K14A 4DNIA 1KD1C 1KNAA 3VPBA 2B63H 3SK4A 3N42B 1K9MC 2YS6A 3F2UA 2L15A 1IKLA 1LYLA 3QB3A 2MO0A 3GTJH 3ORRA 4UFZA 1I4RA 3P75A 4PZ6A 2J6SA 4FXDA 2OXPA 3KOJA 1XMOQ 1HFGA 2EE1A 2N8NA 3OSOA 2QYZA 4LF4H 5IYBG 3JAMW 1N34Q 3I4MG 2ASDA 2JA6B 3S17B 4WJWA 1MBYA 4DR5L 4YQWA 2KA7A 1GUSA 2B8GA 3CF5A 3W3AA 1GJXA 3KLSX 1GUWA 5K2MA 5CV8A 3MXUA 4A3EB 4R4QA 4XTCS 1VMCA 4ZUJA 2P5ZX 2VZAA 1IL8A 3LX0A 3E9HA 4IURA 1ZXTA 3OW2A 1A3TA 1TWAH 2KHJA 2YV5A 4U673 1YITA 1XMQH 1STGA 2XC9A 3KALA 3NHHA 4QW8A 4IUPA 2BE5D 4LUZA 3NGDA 1HTPA 3EQLC 1YJWA 4FBTA 1F9SA 4DF7A 3S14B 2W6PA 5IWAL 1B44D 3RD4A 2R93A 1C0AA 3NUCA 3HXLA 1ZQ7A 2HDMA 2FKLA 4ECSA 5JVG3 4LF5L 1NJIC 3GIIA 1MD2D 1PFSA 5LMUH 2UXBH 1WI5A 1TAEA 1ESRA 1QOHA 1C3OA 2BA1A 2AWOA 4RWSC 4WBNF 1SE4A 2IW3A 1WYDA 3MFGA 3WOFA 4DV2H 3BVGA 1NMFA 2BE5C 1U4PA 3F1ZA 4JI8L 4OX9Q 3KDFA 4EGJA 3E5SA 2AGOA 1D6EC 3GP7A 4A3GB 1EY7A 2TSSA 3BVZA 4F7XA 2XCAA 1EYCA 4J15A 4HJ8A 4J9KA 3A8JE 1Y1VG 5K36H 3AEVA 4L5RC 1CQIB 3LMLA 2R8IA 4I4TF 3I4LA 5KGUA 3MWEA 2F4VL 2CQOA 2K5QA 3D0FA 1X9NA 1PH6A 2WKCA 1OXSC 2J6TA 3Q8PB 2B2TC 3H0GA 1ENCA 3ETHA 5L1JA 4DL7A 4GOPA 3MFIA 1Q8KA 5FO8B 4QMGA 1QB5D 1U0LA 4HJ5A 4GKKL 5LYJF 3BDCA 2K28A 5KEEA 1EYDA 2WB1E 3G6VA 2R93B 2MP1A 1IBKH 3KHLA 2DGYA 3ONAB 1HH2P 3LWUA 4APVA 1TIID 2NU8B 1F9QA 3I8ZA 4ECVA 1G291 4IFDG 3QIAA 2A1AA 1M0TA 4LNQA 4RAZA 2Q2IA 4TQRA 2HQLA 4C56C 4O4LF 4APMA 4IOCA 3NBHB 4BWGB 4POFA 2DY7A 4B3MH 4YAKB 1FNWA 2CQYA 1GUNA 3J81i 3M4IA 5IYZF 3SGIA 1F2ZA 5KFBA 2VUMA 1PLFA 1I50A 1I7NA 1N33Q 4MTKA 5M5XH 2FMCA 1IYUA 1HNXH 4JW0A 3S16B 1HR0H 3FP9A 4O1NA 3K0XA 2Y0SG 4OELB 2JEBI 1PTOF 5DG9A 4O3QA 1QZGA 1S4ZA 4J9PA 2V4DA 3E6ZX 5ELNA 1PZJD 2GPSA 1GLVA 5GAHC 4MZ9A 1T5XD 2AHOB 2XGTA 1EIFA 5IGCA 3F2CA 1G2TA 3KJPA 1JCKB 5BR8Q 4DV0H 4BY1G 1S40A 4QCLA 4C3HH 2V4QA 2I5MX 1CKOA 5KIXA 3J80E 4GC7A 5M5YH 3DM3A 1E1TA 4P71A 5F9LA 4HYKA 2L5TA 4JI2H 4CKCA 3HOYG 1XNRQ 4HJ9A 2XVSA 3OHBA 4KY5A 2W57A 2HQEA 4LAAA 4Y7NH 4O4IF 2BH8A 2ZTCA 1K28A 1YZ6A 1WSCA 2HIXA 5KNBA 3D6WA 4NW2A 4DV5L 3NBIA 3KLSA 3TINA 1X32A 2RKSA 5CAEB 1S10A 3CVZA 3NQTA 1PRTB 1CM9A 4BBRH 3A54A 1I50B 2UXCQ 1U4MA 4KKSA 1VAJA 2RDIA 1A0IA 1CK1A 4TUYF 2FMMA 2WP8J 1VQ4A 5IYDG 1W6KA 2RHQB 1FD7D 3HOZB 2IA6A 1KL9A 2R86A 4LWCA 1D5ZC 1AW7A 4B3TL 2E2HH 3JAMi 4BY7G 4LFAH 4DV6L 1DONA 4A3KG 1HNWQ 3S1NB 3PW0A 2F0HA 5G3LD 1NTGA 2WAQB 4DXFA 3KHRA 3J7AV 5I2YA 2I80A 2K03A 5KFXA 1VBHA 1V9PA 2H1EA 3GTMH 4IZOA 3K3PA 3NE5B 3HOUH 2KCTA 2IX1A 2ZJTA 2C28A 1CHQD 2K01A 4YHHQ 2J7ZA 5JUMA 4JBMA 2MQHA 5IOCA 1C8CA 1I3QA 4HTHA 3RB3A 3C0FB 5IYBH 3I4MH 1UNSA 1E4GT 3ORQA 3DWAA 1JXLA 4DUYL 3GTQA 3TP6A 4ZQIA 4IHJF 5JEAJ 2Q2HA 3L3OC 1UEAB 2BOSA 1AH9A 3I2ZA 4OGQC 3MA2B 4DFAA 2PN1A 2ZM6L 3MFHA 5KFCA 1ZKOA 1NUCA 4KHVA 2K4KA 5DNFA 5BN3A 3W1GA 4KKTA 1Y1WB 2F3WA 4LFCQ 4EX5A 1XMOH 3PN1A 3MHBA 1N34H 1QJOA 2B2VC 4DV4L 2YRXA 4F4YA 4X66Q 4ECZA 2CH4W 1VQCA 3H94A 2R7ZG 1J8IA 3RV4A 2PZWA 2NYZD 1IKMA 4JI1L 3G6EA 3T5KA 5E4XA 5C5LA 1ET6A 4ED6A 3OUUA 4GKJQ 3Q24A 5H80A 4IO9A 3DEOA 3S2HB 1H9JA 3T1HH 1YHAA 1Q1BA 1QILA 4LFBQ 1BR9A 4J9RA 4O0AA 4XQNA 2ICEC 2F0SA 3BG3A 1Y1VH 3S1QB 1SMXA 4DUZL 4C5AA 1TQOA 3C1EA 1PRTD 3WWVA 1G6PA 5M3MH 1TR5A 1K73C 4LSXA 3GTQB 2EY1A 3KYHC 2JK8A 1DOMA 1LTAD 4OX9H 4X65Q 3HEJA 1EOTA 3I70A 1C7YA 5KFPA 1KAWA 4MV7A 2A69D 5KYIA 4XT1B 3U4ZA 3SEBA 3BDOA 1EWCA 4LF4L 1CZWA 3OWFA 3T5JA 3EPIA 2RDFA 5AFWA 1SNCA 5C0XJ 1I6UA 2NVQB 4QWEA 4RAUC 2ATWA 2O4XA 4MV4A 3VR4A 3GV7B 3M4PA 1VQAA 1PRTC 2NVXA 3TN2A 5IODA 3FKIG 3PCOB 3TBIB 4RA8A 3PUVA 1EOVA 2E74C 3DWPA 3HOWG 5GADC 2DZDA 2JYOA 1WD1A 2NVYA 1I4PA 1K8AC 2Z0SA 1BGWA 2PVPA 4RZRA 1DYQA 2A69C 4QY7A 5C4XB 4WRDA 5M3FB 1DV1A 1VBGA 3RGXA 5KT6A 3W5OA 3H3VH 1FJGQ 1S5FD 1WTOA 1DJRD 1KJ9A 2R92G 4O2DA 4I65A 3GIDA 4JI7L 4A93H 5DLQE 2PI2A 3FRPB 2JE6I 1B6RA 1QCBD 2KSWA 3H09A 5DG8A 2DWCA 2RF4A 1FYCA 4KJOA 4LK1C 4X62L 1QNUA 5LMUL 1VQLA 4TQUS 1M4VA 5KFJA 4X3KA 3UE0A 1A62A 2YYAA 2EY6A 2I87A 2R82A 3UDXA 4DV2L 4BXXG 5C3EH 2C2EA 3IKJA 3STBD 5A2QL 1JJGA 1UE5A 1ZYRD 4A4IA 1SEIA 1CTMA 1JX4A 2SNMA 1ENFA 3N43B 4EQOA 4A3FG 2ZDGA 1NY4A 2JA5H 1TWAA 4L63B 5DQIA 2UUCL 5C3XA 2W7OA 1F77A 1MHWC 1N33H 3RUZA 5KFYA 1Z2OX 1W2BA 3MVVA 4R8UB 4ZCKA 5J1ZA 1JICA 2M00A 3STBC 4J1MA 2B3GA 1VF5C 3PW7A 4M1UB 1GVPA 1KEEA 1ILQA 1ZYRC 1V1PB 3GTPA 2NVYB 1VQDA 2F0IA 3CCUA 2QEXA 3HOYH 1UE6A 2Z4IA 3SR1A 2HD3A 2R85A 2VA3A 4U68A 5L1KA 2E5LL 4CC5A 5JH7F 3K7AH 4M8AA 1T94A 4A3IB 4LF9L 5BR8H 2F0EA 4OWWB 1WCMA 1RL2A 2B2UC 1IBKL 1GOZA 4DR3Q 4IPGA 2BQ3A 1W93A 3TZDA 4IAJA 4J9SA 4A3MH 2UXDL 3KHGA 3MJFA 3T5HA 4HR7A 3RZOB 3VPCA 3OTOQ 5IGDA 1G91A 3LWBA 5IYDH 1NSNS 3A74A 3VR2A 5I6YA 2B63G 4LUVA 2C9OA 1B9MA 3N6XA 2PQAB 1X6OA 5JPMC 4FF1A 4ECTA 1YHBA 4JOIA 1QE6A 4BY7H 1PXUA 2JA9A 2ASLA 1EEFD 4A3KH 5KFSA 5C4ZA 2UXCH 1LTSD 2VS1A 1HNXL 1HR0L 4L5TA 4MV8A 5FO7B 1B9NA 2R3ZA 2UU9L 1LV9A 3MXNA 5CYUA 4YY3Q 4YWMA 4MNOA 3TSSA 4AQYQ 2AUJD 4DLKA 3PR4A 1QVCA 1L1OA 4IR1A 1WVLA 1FVIA 2YTXA 1CKNB 3GTPB 4UP9A 4HIKA 4LF7Q 2PCFB 3TS2A 4IFDI 4EQPA 2XCLA 2X6LA 2VQFL 1HNWH 2FXQA 4B3RL 3GTLH 3EVQA 2MHVA 3L4JA 2KCNA 5KFTA 2Z6BA 3HOVB 2MPMA 5EPJA 4AYBA 1BKBA 4RGMA 2N55A 2MO1A 3K8AA 4C1NI 5C44G 1ET9A 4RUCA 1ASYA 1SFOA 5LMNQ 3OMCA 3J7AK 4IJLA 3LWEA 2RGVA 1KJIA 4YHHH 2F0FA 2EJMA 1K0RA 1O7ZA 3PIPA 4DR2L 1VQJA 3DWQA 4IQZA 4ECXA 2EYPA 4RCNA 3CCSA 5CGKA 2HCIA 4HJAA 3Q0AA 1TXYA 1C9OA 2R7ZH 2DLNA 1EL0A 1WR2A 2NU6B 2JA8H 2SOBA 3RJ0A 1A3UA 2WB1G 2A68D 3VMMA 5KFNA 3RR5A 4C3IB 2UUBQ 3U50C 4OL7A 5DLFA 5C4JH 1S5ED 3U9OA 3TDQA 2XWBB 5EPKA 5JVDF 4X66H 4U7CA 1MI2A 3QWNA 2PPBC 4KHPQ 4LFAL 2L1BA 3FDSA 4DU9A 5DLGA 5CORA 1Q90A 4EYHB 3FPUB 3CQZA 3S24A 2WAQE 2B2YA 1RF2D 1DOLA 1XXGA 4I7ZC 2A68C 1VQFA 4J9NA 4GKJH 4A3DH 1OTCA 1K1SA 2KHIA 1YHQA 2JJQA 4YIJA 1KNEA 4K5WA 5IT9c 2C00A 4LFBH 3N8DA 2F4IA 3PR5B 1FGBD 3A7LA 3D4DA 3BZDB 4OWXB 3FKIH 1BNCA 3CAMA 2CFMA 4F87A 2ID0A 2E2HA 2R61A 2VQEL 4NLGA 1LT6D 3K5NA 4X65H 3S2DH 1Y8NB 4EGQA 4G57A 3SHLA 1SEBD 2ES2A 2RDJA 3J81j 1HZAA 4DL3A 4CKBA 3I4NB 3HBLA 1A2TA 1VQBA 1HTLD 2JA7G 1PYSB 2FPPB 2R92H 3GV5B 5A35A 2W6MA 1HPCA 4J8QA 2E2IH 4GC6A 1Q3LA 4UP7A 3FDTA 4ZYSA 1X55A 4ZHQF 2BA0A 1CQFA 2PO4A 4DR4L 1NCVA 1G6ZA 1KABA 1JB7A 4C3JB 3PO2G 2E2JH 3K3VA 3NK9A 3GTKH 4A3BG 2CKZB 3K0YA 5CA1F 2PW5A 5NUCA 4P74A 1S68A 1S0NA 4RAYA 1VS0A 5KFQA 4C3HG 1FJGH 2HGSA 3CKIB 1CT1D 3S1RH 5FD5A 1NMGA 1MKHA 4C2MB 3T1HL 2DIKA 1EUDB 1EQVA 4R4IA 4KHZA 4XYMB 4MTDA 1YNXA 4UP8A 2Z8LA 1TWFB 4ZOLF 4ED8A 4MV9A 4JI0Q 1H9RA 3Q8QB 2VPSA 4JBWA 4RGNA 4DV7L 4NXNL 5KFEA 2YRWA 3IN5A 3PW2A 2D62A 3VYTA 2M2LA 4KKUA 1UWVA 3NQIA 3RNUA 2K5WA 5KFDA 1I6VC 4JI5L 2XD4A 4KN7C 5I2XA 2ZXPA 3GV6A 2VXWA 3RLFA 1RODA 4EEQA 1EY9A 1Q1EA 5DM73 1ICWA 1HXYD 1TWGB 2C35B 2QDBA 4MN3A 4PG3A 4Q44A 1U4RA 2WYOA 4JYAL 4DV3Q 4Q0FA 1QZHA 2D9UA 1N36Q 5BMVF 1GSOA 1MJCA 3AB9A 4MHEA 4LF8Q 1S5CD 2JEGA 5FK9C 4HMJA 4DAMA 3RGZA 1MIUA 4GLVB 3U4VA 1J5EQ 4CGYB 1Y1VA 1RTNA 5KFVA 3R5HA 1HA6A 2K5NA 1BVSA 1S97A 2K75A 1KIXA 1IBML 2MGSA 2LKVA 4XZ3B 1L0WA 5BPFA 3GIJA 3T53B 5I9PA 5L1IA 3Q1KA 5DM63 2A8VA 3GLKA 3M4OB 1UC9A 4QQBX 1JR0D 1STYA 3KF8B 3OSNA 3HOUG 1JLLB 2W70A 1WOCA 4AIMA 5FJ8G 1E4FT 3PUZA 1B4OA 1H9SA 4GN3B 5KRUA 2HT1A 1KJ8A 4DR3H 1PZID 3KXYT 3TREA 3GDEA
chains in the Genus database with same CATH topology
1VQOA 1HJPA 3MXNB 3PGZA 4P71A 3S15H 1X3FA 4DAYB 3RLOA 3HOVG 3HOYG 4X64L 1XNRQ 1L1OB 4HJ9A 4GNXA 3E9IA 1SR3A 4Y7NH 4LF7L 3I56A 2BH8A 2ZTCA 4OXPA 2F3IA 1PH3A 3PUYA 1VQ7A 2ZTDA 1YZ6A 4LF6Q 3GO5A 1PV4A 2HIXA 1N32Q 5HGQA 5IP9G 1JJ2A 4BA1I 1QVFA 3HOYH 2D0OA 4DV5L 4K0KL 3ICEA 1VQ8A 1YVCA 4DUYQ 2YTYA 2E8GA 4A3LG 5LMNL 2N78A 1Y1WH 1SRUA 2E5LQ 1CSQA 1HR0W 4WJ4A 4LF9Q 4BBRH 4JI4L 4LF8L 2JEAI 2UXCQ 1A0IA 1Q86C 5C44H 2WP8J 1VQ4A 5IYDG 2RHQB 3J80i 1E22A 2PNHA 1KL9A 4GN5A 3L7ZC 2UXDQ 2GN5A 1UE7A 5C4XG 1Q12A 5M3FG 4LWCA 4NXMQ 2OQ0A 4B3TL 2E2HH 4LUOA 3TRZA 5HY6A 2PQAA 5IP7G 3JAMi 2K52A 3BZCA 4BY7G 4JV5Q 4DV6L 5GROA 3AQQA 4A3KG 3CW2C 1I94L 4BBSH 1HNWQ 2ZJQA 5JJKA 1NTGA 3M85A 2UUBL 2V1CC 3S2HH 1XMOL 1VQEA 3CC2A 1V9PA 4H02A 3GTMH 1QUQA 4BY1H 3HOUH 1N34L 2KCTA 2IX1A 4HIMA 3Q8DA 3CP0A 3S1QH 4YHHQ 2UU9Q 4GN4B 4JBMA 2MQHA 5M3MG 1IYJB 4A76A 2UUAQ 3DLLA 1CKNA 3CXCA 4DR6Q 3GTQH 3K81C 3PUWA 5IYBH 3H0GH 3I4MH 2YYZA 1JMCA 4DUYL 2Q2TA 1ASZA 3L0OA 4LW1A 3L2PA 5JEAJ 1NE3A 1VQIA 2Q2HA 3J81c 3CCQA 1AH9A 3I2ZA 3PUXA 2VL6A 2VQFQ 1E3PA 1IBLQ 2UXCL 4JI3L 3RZDH 3PV0A 4B3RQ 4POGA 2ZM6L 3J7A5 3CC7A 1XPRA 1EIYB 2EIFA 2EQSA 2K4KA 4A3JG 3W1GA 2VW9A 4EX5A 2HHHL 4LFCQ 4A3LH 2NVQH 1KRTA 2KCMA 5AJ3Q 4LF4Q 3KJOA 2KENA 4DV4L 4NXML 1IZ6A 3EIVA 1PHJA 1HZBA 4X66Q 1LM0A 1VQCA 2R7ZG 4JI6Q 2IY5B 4DR2Q 5C4XH 4JI1L 4A3IG 5M3FH 3G6EA 4OX9L 4A3GG 3AFPA 2NVTH 1P16A 1IL2A 3K80C 2EXDA 4DK6C 3CPFA 4R4TA 3KDFB 3ERSX 3CCVA 1XMQQ 4GKJQ 4A93G 4IO9A 3UDIA 2VUMH 2VNUD 3NEMA 3IRBA 3CMEA 3I55A 1Q46A 1YHAA 1U5KA 1Q1BA 1FL0A 1KHIA 1SROA 3EN2A 1Q81C 4LFBQ 4JOIC 4Y52H 2UUAL 4O0AA 4DR6L 1XJVA 4L5SA 3ULLA 1Y1VH 1SMXA 1EUJA 5C3EG 2JA7H 1HZCA 4DUZL 1YI2A 5GAGC 2ZJRA 3OYYA 3WWVA 4DR5Q 3ZJYC 5M3MH 5LMUQ 1K73C 3S1MH 2UXBQ 3BU2A 1G6PA 1MJEA 2ZTEA 1JE5A 3KYHC 2JK8A 2JA5G 3CC4A 1L1OC 2IHEA 1UEBA 4UPAA 4DV2Q 2OQKA 4X65Q 4P72A 4GOPB 1VQPA 3PO2H 1C7YA 1KAWA 4JBKA 4JC0A 4DPGA 3F2DA 4A3BH 4GS3A 4HIDA 3CCLA 3U4ZA 1SN8A 4JI0L 1PH1A 4LF4L 3W1BA 5M5WH 1WJJA 4QIWE 4YCWA 4X66L 3J80c 2F52A 5C0XJ 4A3JH 1Q7YC 4JI6L 2ATWA 5IWAQ 3M4PA 1VQAA 1VQKA 4PZ7A 1AE2A 3FKIG 3NELA 3PCOB 2LSSA 2NVYH 3PUVA 1EOVA 4DKAC 3HOWG 5GADC 2NZHA 3JAMc 1H95A 2B29A 4IPDA 4QJFA 3BJUA 2RHSB 1OXVA 2Z6KC 2R6GA 1PYBA 1AE3A 4AH6A 2Z0SA 3J7ZC 1K8AC 1HNZQ 1WCMG 4QY7A 4AYBE 1XNQQ 4GKJL 1VQMA 4P73A 1EYGA 3CD6A 3M3YH 5IE8A 1DGSA 4A3IH 3CPWA 2VQEQ 1EWIA 3CMAA 3W5OA 2OWOA 3H3VH 1FJGQ 4IFDJ 3PSIA 5K36G 4DV3L 1S72A 3GDEA 3KF6A 1YEZA 1N36L 1N33L 4O2DA 2R92G 4A3MG 3PO3H 1RIPA 4PMWA 2A19A 1PH2A 4JI7L 4A93H 3AYHB 2PI2A 5DLQE 1VQHA 1V1QA 1VCIA 2JE6I 2AWNA 1J5EL 2NN6G 4IJHA 2RF4A 3TEHB 4X62L 1IBKQ 3G71A 3RZOH 4DR7L 3RLNA 5LMUL 1NBWA 1VQLA 4BA2I 4TQUS 3UE0A 4OONA 1A62A 2NN6I 1CUKA 1SE8A 3UDXA 4DV2L 2F4VQ 4BXXG 5C3EH 4OWTB 3T1YL 2MNAA 4DR4Q 3STBD 1JJGA 2Q2UA 1UE5A 3UE1A 4A4IA 4B3MQ 1X65A 4RMFA 4A3FG 5BR8L 1NY4A 1M1KC 4JCVE 2JA5H 2UUCL 2GVAA 4DV1L 2PI2E 3F2BA 2JA6G 3T1HQ 3A5ZB 4GKKQ 3ULJA 1W2BA 4GLXA 1K83H 3M4QA 3FHWA 3M9BA 1XNRL 5FJ8H 1R9TH 3I7FA 4A3EG 1HNXQ 1HR0Q 3HKSA 4UY8C 1I3QH 4LF6L 3GTOH 3GTPH 3STBC 2B3GA 4GNXB 1HNZL 1N32L 1GVPA 1VQGA 4DV7Q 4NXNQ 1XNQL 4GLAC 1N9WA 1VQDA 1BBWA 1L2FA 2RCNA 2XTIA 4P75A 2QEXA 3CCUA 3EBEA 1I6HH 1UE6A 4AYBG 3HOWH 1FJGL 4OO1I 2OTJA 3HOVH 4JI5Q 2IX0A 3KFUA 2E5LL 3K7AH 1KC8C 1HZ9A 5IP9H 4DR1Q 1WCMH 3ULPA 4LF9L 3KF6B 1V43A 5IYCG 4OWWB 1VQ6A 3HOZG 4PZ8A 1RL2A 5GQOA 1Z9FA 3NENA 4DV0Q 1IBKL 4DR3Q 4IPGA 2ASBA 3G48A 2R7FA 3PF4A 2NZOA 3TQYA 4A3MH 2UXDL 3M7NA 4JYAQ 2JQOA 1X3GA 1OXXK 4IPCA 4JI2Q 2LXJA 1YBYA 3OTOQ 4A3CG 4NPSA 1Z47A 3CCRA 5FLMG 2I5HA 1B7YB 5IYDH 3A74A 1W3SA 2YU9H 4JV5L 2B63G 5IY0A 4LUVA 3HKZE 1HNWL 3PIOA 2PQAB 1X6OA 2JA8G 3F8TA 3I4NG 4BXXH 1PH5A 2QA4A 1IBMQ 5LMNW 1Q82C 1YHBA 4JOIA 5IP7H 3CCMA 2JA9A 5C0XI 4BY7H 5E7NA 1EQQA 4C3IH 4A3FH 1B70B 3KLWA 4A3KH 1PH7A 3CCJA 2VS1A 3RN5A 1HNXL 4GOPC 4L5TA 1KQSA 1EQRA 1QUQB 4YHHL 1HR0L 2OTLA 2UU9L 1WFQA 4YY3Q 4YWMA 4MNOA 4AQYQ 2ZJPA 2JA6H 3S17H 2QGQA 1QVCA 4NB3A 1X54A 1PVOA 5FLXc 1KXLA 1L1OA 1GKHA 2IHFA 1QVGA 2AKWB 2D0PA 1FVIA 2YTXA 4A3EH 4WJ3M 1CKNB 4X64Q 2R93G 4UP9A 4HIKA 4LF7Q 3TS2A 4IFDI 1X3EA 4DR1L 1JJCB 3G4SA 4YCVA 2VQFL 2FXQA 1IBLL 1Y1WG 4A3DG 4LFAQ 3GTLH 4B3RL 3PF5A 4TVAB 4BBRG 2HIVA 2I5LX 4DV5Q 1OXUA 3U58A 3K7UC 2DUDA 2KBNA 4DK3C 1BKBA 1Y14B 4LFCL 5GAEC 1SFOH 1LUZA 2MO1A 3K8AA 4R4OA 5C44G 4EQ5A 1N8RC 1VQ9A 3S14H 1ASYA 5LMNQ 3JC66 5AJ3L 4YCUA 4IJLA 2GVBA 2YTVA 4JI4Q 3OTOL 2Z6KA 2NVXH 1J6QA 1K0RA 2MFIA 3PIPA 4DR2L 4IPHA 1VQJA 5ELOA 3CCSA 1CKMA 3HKZG 1M90C 4LF5Q 4HJAA 1TXYA 2K14A 4DNIA 1C9OA 1KD1C 2R7ZH 2CWPA 2B63H 4B3TQ 1XMQL 1YJNA 1K9MC 4JBJA 2L15A 1LYLA 2CCZA 4ME3A 2MO0A 3GTJH 3H15A 4A3GH 2JA8H 1I94Q 3AFQA 3I4NH 2R7DA 2WB1G 4PZ6A 4JI8Q 2N3SA 3RR5A 1JT8A 4AQYL 4LFBL 2UUBQ 3U50C 4R1JA 3KOJA 5C4JH 1XMOQ 4MTNA 2N8NA 3VDYA 5JEAG 1VQNA 4RG1A 5IYBG 3H0GG 1N34Q 3I4MG 5JJLA 2IT1A 4DR5L 2UXBL 5J3BA 4QGUA 3CF5A 4C3JH 3CQZH 4LFAL 4KHPQ 3A0JA 4R4QA 4X65L 4XTCS 3LGJA 3S24A 2VZAA 2WAQE 3E9HA 1PH8A 4R4CA 4GNXC 3OW2A 1TWAH 1VQFA 2KHJA 2YV5A 4FDBA 4C2MH 1YITA 1VQ5A 1BBUA 4A3DH 1E24A 1OTCA 4LUZA 2KHIA 1YHQA 2JJQA 1TWFH 3B6YA 1XPOA 3RN2A 3ER0A 1E1OA 1YJWA 4JI3Q 2ZM6Q 1YIJA 2R93H 5IT9c 1X56A 5IWAL 1C0AA 2HHHQ 1CSPA 3GD7A 3A5UA 1E7ZA 4ALPA 4LF5L 1NJIC 4XIGS 1PFSA 4DV4Q 1WI5A 4OO1G 2K5VA 4A75A 4OWXB 3FKIH 3CAMA 2CFMA 2BA1A 2AWOA 2ID0A 3BZKA 1WYDA 2VQEL 4HIOA 1NMFA 4JI1Q 3F1ZA 2VUMG 3S2DH 4JI8L 4OX9Q 1G51A 3KDFA 2ES2A 3HOXG 3J81j 1HZAA 1TWGH 1A63A 5JJIA 2CWAA 4KI0A 4J15A 4HJ8A 1PH4A 3HOUG 1VQBA 1Y1VG 3D31A 1D7QA 2JA7G 1PYSB 3S16H 2R92H 3AEVA 4L5RC 1P8LA 3I4OA 2I0QA 2E2IH 4KHPL 4UP7A 1UE1A 1X55A 2F4VL 2BA0A 2CQOA 1LTLA 2Y0SE 4DR4L 3D0FA 1X9NA 1PH6A 3UDGA 4B3ML 1OXSC 1JB7A 4DUZQ 3PO2G 2E2JH 3GTKH 2WAQG 3DM3A 2CKZB 1K8GA 4A3BG 4P74A 5C0XG 3M4OH 4GOPA 1VS0A 3CCEA 3S1RH 1Q8KA 2H5XA 1NMGA 1MKHA 1U0LA 4HJ5A 3T1HL 3E0EA 4R4IA 4B3SQ 4GKKL 4KHZA 1D8LA 1K3RA 1YNXA 2LXKA 2N49A 2WB1E 4UP8A 4IOAA 4JI0Q 2DGYA 4JBWA 2AMCB 1HH2P 1EFWA 4APVA 4DV7L 4NXNL 2WFWA 1G291 2D62A 4IFDG 2A1AA 4LNQA 2Q2IA 1UWVA 2HQLA 4KLKA 3RNUA 4IOCA 3NBHB 2PMZE 1A8VA 4JI5L 4POFA 3TS0A 2VY3A 3GTGH 4JG2A 3RLFA 3PO3G 3J81i 1FGUA 3H3VI 4DV0L 5H1SE 4K0KQ 2ALYB 1GM5A 1IXRA 1Q1EA 1I50H 2K5HA 2C35B 3SGIA 1TWHH 4DR3L 3HOXH 4PG3A 4YWKA 4QL5A 1SLJA 1PA6A 4JYAL 4DV3Q 5EAYA 1QZHA 3HFZB 1N36Q 1N33Q 4JI2L 5IYCH 3HOZH 5M5XH 4HJ7A 1MJCA 4JI7Q 1I5FA 4LF8Q 3FP9A 4DAMA 1MIUA 1TWCH 2OCEA 3K0XA 2Y0SG 4GLVB 3MEFA 3U4VA 3UDFA 1J5EQ 4X62Q 4DR7Q 2JEBI 1OXTA 1XTDA 2K5NA 1BVSA 2K75A 1KIXA 4BBSG 1QZGA 1PH9A 1IBML 2BH2A 4A3CH 1L0WA 5ELNA 5FLMH 3S1NH 1T9HA 5GAHC 1GD7A 3T1YQ 4MZ9A 4B3SL 2AHOB 2A8VA 2XGTA 1XPUA 4QQBX 1EIFA 3F2CA 3KF8B 1GO3E 2K50A 4YWLA 3KJPA 4DV6Q 1KRSA 5BR8Q 1YJ9A 4BY1G 1S40A 4L5QA 1B8AA 4C3HH 1WOCA 4AIMA 2I5MX 1CKOA 3PUZA 4GN3B 5FJ8G 4YY3L 2UUCQ 2HT1A 4DV1Q 5M5YH 4X6AH 3TREA 1O7IA 1S3OA 1E1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO A;  1HJP A;  3MXN B;  3PGZ A;  4P71 A;  3S15 H;  1X3F A;  4DAY B;  3RLO A;  3HOV G;  3HOY G;  4X64 L;  1XNR Q;  1L1O B;  4HJ9 A;  4GNX A;  3E9I A;  1SR3 A;  4Y7N H;  4LF7 L;  3I56 A;  2BH8 A;  2ZTC A;  4OXP A;  2F3I A;  1PH3 A;  3PUY A;  1VQ7 A;  2ZTD A;  1YZ6 A;  4LF6 Q;  3GO5 A;  1PV4 A;  2HIX A;  1N32 Q;  5HGQ A;  5IP9 G;  1JJ2 A;  4BA1 I;  1QVF A;  3HOY H;  2D0O A;  4DV5 L;  4K0K L;  3ICE A;  1VQ8 A;  1YVC A;  4DUY Q;  2YTY A;  2E8G A;  4A3L G;  5LMN L;  2N78 A;  1Y1W H;  1SRU A;  2E5L Q;  1CSQ A;  1HR0 W;  4WJ4 A;  4LF9 Q;  4BBR H;  4JI4 L;  4LF8 L;  2JEA I;  2UXC Q;  1A0I A;  1Q86 C;  5C44 H;  2WP8 J;  1VQ4 A;  5IYD G;  2RHQ B;  3J80 i;  1E22 A;  2PNH A;  1KL9 A;  4GN5 A;  3L7Z C;  2UXD Q;  2GN5 A;  1UE7 A;  5C4X G;  1Q12 A;  5M3F G;  4LWC A;  4NXM Q;  2OQ0 A;  4B3T L;  2E2H H;  4LUO A;  3TRZ A;  5HY6 A;  2PQA A;  5IP7 G;  3JAM i;  2K52 A;  3BZC A;  4BY7 G;  4JV5 Q;  4DV6 L;  5GRO A;  3AQQ A;  4A3K G;  3CW2 C;  1I94 L;  4BBS H;  1HNW Q;  2ZJQ A;  5JJK A;  1NTG A;  3M85 A;  2UUB L;  2V1C C;  3S2H H;  1XMO L;  1VQE A;  3CC2 A;  1V9P A;  4H02 A;  3GTM H;  1QUQ A;  4BY1 H;  3HOU H;  1N34 L;  2KCT A;  2IX1 A;  4HIM A;  3Q8D A;  3CP0 A;  3S1Q H;  4YHH Q;  2UU9 Q;  4GN4 B;  4JBM A;  2MQH A;  5M3M G;  1IYJ B;  4A76 A;  2UUA Q;  3DLL A;  1CKN A;  3CXC A;  4DR6 Q;  3GTQ H;  3K81 C;  3PUW A;  5IYB H;  3H0G H;  3I4M H;  2YYZ A;  1JMC A;  4DUY L;  2Q2T A;  1ASZ A;  3L0O A;  4LW1 A;  3L2P A;  5JEA J;  1NE3 A;  1VQI A;  2Q2H A;  3J81 c;  3CCQ A;  1AH9 A;  3I2Z A;  3PUX A;  2VL6 A;  2VQF Q;  1E3P A;  1IBL Q;  2UXC L;  4JI3 L;  3RZD H;  3PV0 A;  4B3R Q;  4POG A;  2ZM6 L;  3J7A 5;  3CC7 A;  1XPR A;  1EIY B;  2EIF A;  2EQS A;  2K4K A;  4A3J G;  3W1G A;  2VW9 A;  4EX5 A;  2HHH L;  4LFC Q;  4A3L H;  2NVQ H;  1KRT A;  2KCM A;  5AJ3 Q;  4LF4 Q;  3KJO A;  2KEN A;  4DV4 L;  4NXM L;  1IZ6 A;  3EIV A;  1PHJ A;  1HZB A;  4X66 Q;  1LM0 A;  1VQC A;  2R7Z G;  4JI6 Q;  2IY5 B;  4DR2 Q;  5C4X H;  4JI1 L;  4A3I G;  5M3F H;  3G6E A;  4OX9 L;  4A3G G;  3AFP A;  2NVT H;  1P16 A;  1IL2 A;  3K80 C;  2EXD A;  4DK6 C;  3CPF A;  4R4T A;  3KDF B;  3ERS X;  3CCV A;  1XMQ Q;  4GKJ Q;  4A93 G;  4IO9 A;  3UDI A;  2VUM H;  2VNU D;  3NEM A;  3IRB A;  3CME A;  3I55 A;  1Q46 A;  1YHA A;  1U5K A;  1Q1B A;  1FL0 A;  1KHI A;  1SRO A;  3EN2 A;  1Q81 C;  4LFB Q;  4JOI C;  4Y52 H;  2UUA L;  4O0A A;  4DR6 L;  1XJV A;  4L5S A;  3ULL A;  1Y1V H;  1SMX A;  1EUJ A;  5C3E G;  2JA7 H;  1HZC A;  4DUZ L;  1YI2 A;  5GAG C;  2ZJR A;  3OYY A;  3WWV A;  4DR5 Q;  3ZJY C;  5M3M H;  5LMU Q;  1K73 C;  3S1M H;  2UXB Q;  3BU2 A;  1G6P A;  1MJE A;  2ZTE A;  1JE5 A;  3KYH C;  2JK8 A;  2JA5 G;  3CC4 A;  1L1O C;  2IHE A;  1UEB A;  4UPA A;  4DV2 Q;  2OQK A;  4X65 Q;  4P72 A;  4GOP B;  1VQP A;  3PO2 H;  1C7Y A;  1KAW A;  4JBK A;  4JC0 A;  4DPG A;  3F2D A;  4A3B H;  4GS3 A;  4HID A;  3CCL A;  3U4Z A;  1SN8 A;  4JI0 L;  1PH1 A;  4LF4 L;  3W1B A;  5M5W H;  1WJJ A;  4QIW E;  4YCW A;  4X66 L;  3J80 c;  2F52 A;  5C0X J;  4A3J H;  1Q7Y C;  4JI6 L;  2ATW A;  5IWA Q;  3M4P A;  1VQA A;  1VQK A;  4PZ7 A;  1AE2 A;  3FKI G;  3NEL A;  3PCO B;  2LSS A;  2NVY H;  3PUV A;  1EOV A;  4DKA C;  3HOW G;  5GAD C;  2NZH A;  3JAM c;  1H95 A;  2B29 A;  4IPD A;  4QJF A;  3BJU A;  2RHS B;  1OXV A;  2Z6K C;  2R6G A;  1PYB A;  1AE3 A;  4AH6 A;  2Z0S A;  3J7Z C;  1K8A C;  1HNZ Q;  1WCM G;  4QY7 A;  4AYB E;  1XNQ Q;  4GKJ L;  1VQM A;  4P73 A;  1EYG A;  3CD6 A;  3M3Y H;  5IE8 A;  1DGS A;  4A3I H;  3CPW A;  2VQE Q;  1EWI A;  3CMA A;  3W5O A;  2OWO A;  3H3V H;  1FJG Q;  4IFD J;  3PSI A;  5K36 G;  4DV3 L;  1S72 A;  3GDE A;  3KF6 A;  1YEZ A;  1N36 L;  1N33 L;  4O2D A;  2R92 G;  4A3M G;  3PO3 H;  1RIP A;  4PMW A;  2A19 A;  1PH2 A;  4JI7 L;  4A93 H;  3AYH B;  2PI2 A;  5DLQ E;  1VQH A;  1V1Q A;  1VCI A;  2JE6 I;  2AWN A;  1J5E L;  2NN6 G;  4IJH A;  2RF4 A;  3TEH B;  4X62 L;  1IBK Q;  3G71 A;  3RZO H;  4DR7 L;  3RLN A;  5LMU L;  1NBW A;  1VQL A;  4BA2 I;  4TQU S;  3UE0 A;  4OON A;  1A62 A;  2NN6 I;  1CUK A;  1SE8 A;  3UDX A;  4DV2 L;  2F4V Q;  4BXX G;  5C3E H;  4OWT B;  3T1Y L;  2MNA A;  4DR4 Q;  3STB D;  1JJG A;  2Q2U A;  1UE5 A;  3UE1 A;  4A4I A;  4B3M Q;  1X65 A;  4RMF A;  4A3F G;  5BR8 L;  1NY4 A;  1M1K C;  4JCV E;  2JA5 H;  2UUC L;  2GVA A;  4DV1 L;  2PI2 E;  3F2B A;  2JA6 G;  3T1H Q;  3A5Z B;  4GKK Q;  3ULJ A;  1W2B A;  4GLX A;  1K83 H;  3M4Q A;  3FHW A;  3M9B A;  1XNR L;  5FJ8 H;  1R9T H;  3I7F A;  4A3E G;  1HNX Q;  1HR0 Q;  3HKS A;  4UY8 C;  1I3Q H;  4LF6 L;  3GTO H;  3GTP H;  3STB C;  2B3G A;  4GNX B;  1HNZ L;  1N32 L;  1GVP A;  1VQG A;  4DV7 Q;  4NXN Q;  1XNQ L;  4GLA C;  1N9W A;  1VQD A;  1BBW A;  1L2F A;  2RCN A;  2XTI A;  4P75 A;  2QEX A;  3CCU A;  3EBE A;  1I6H H;  1UE6 A;  4AYB G;  3HOW H;  1FJG L;  4OO1 I;  2OTJ A;  3HOV H;  4JI5 Q;  2IX0 A;  3KFU A;  2E5L L;  3K7A H;  1KC8 C;  1HZ9 A;  5IP9 H;  4DR1 Q;  1WCM H;  3ULP A;  4LF9 L;  3KF6 B;  1V43 A;  5IYC G;  4OWW B;  1VQ6 A;  3HOZ G;  4PZ8 A;  1RL2 A;  5GQO A;  1Z9F A;  3NEN A;  4DV0 Q;  1IBK L;  4DR3 Q;  4IPG A;  2ASB A;  3G48 A;  2R7F A;  3PF4 A;  2NZO A;  3TQY A;  4A3M H;  2UXD L;  3M7N A;  4JYA Q;  2JQO A;  1X3G A;  1OXX K;  4IPC A;  4JI2 Q;  2LXJ A;  1YBY A;  3OTO Q;  4A3C G;  4NPS A;  1Z47 A;  3CCR A;  5FLM G;  2I5H A;  1B7Y B;  5IYD H;  3A74 A;  1W3S A;  2YU9 H;  4JV5 L;  2B63 G;  5IY0 A;  4LUV A;  3HKZ E;  1HNW L;  3PIO A;  2PQA B;  1X6O A;  2JA8 G;  3F8T A;  3I4N G;  4BXX H;  1PH5 A;  2QA4 A;  1IBM Q;  5LMN W;  1Q82 C;  1YHB A;  4JOI A;  5IP7 H;  3CCM A;  2JA9 A;  5C0X I;  4BY7 H;  5E7N A;  1EQQ A;  4C3I H;  4A3F H;  1B70 B;  3KLW A;  4A3K H;  1PH7 A;  3CCJ A;  2VS1 A;  3RN5 A;  1HNX L;  4GOP C;  4L5T A;  1KQS A;  1EQR A;  1QUQ B;  4YHH L;  1HR0 L;  2OTL A;  2UU9 L;  1WFQ A;  4YY3 Q;  4YWM A;  4MNO A;  4AQY Q;  2ZJP A;  2JA6 H;  3S17 H;  2QGQ A;  1QVC A;  4NB3 A;  1X54 A;  1PVO A;  5FLX c;  1KXL A;  1L1O A;  1GKH A;  2IHF A;  1QVG A;  2AKW B;  2D0P A;  1FVI A;  2YTX A;  4A3E H;  4WJ3 M;  1CKN B;  4X64 Q;  2R93 G;  4UP9 A;  4HIK A;  4LF7 Q;  3TS2 A;  4IFD I;  1X3E A;  4DR1 L;  1JJC B;  3G4S A;  4YCV A;  2VQF L;  2FXQ A;  1IBL L;  1Y1W G;  4A3D G;  4LFA Q;  3GTL H;  4B3R L;  3PF5 A;  4TVA B;  4BBR G;  2HIV A;  2I5L X;  4DV5 Q;  1OXU A;  3U58 A;  3K7U C;  2DUD A;  2KBN A;  4DK3 C;  1BKB A;  1Y14 B;  4LFC L;  5GAE C;  1SFO H;  1LUZ A;  2MO1 A;  3K8A A;  4R4O A;  5C44 G;  4EQ5 A;  1N8R C;  1VQ9 A;  3S14 H;  1ASY A;  5LMN Q;  3JC6 6;  5AJ3 L;  4YCU A;  4IJL A;  2GVB A;  2YTV A;  4JI4 Q;  3OTO L;  2Z6K A;  2NVX H;  1J6Q A;  1K0R A;  2MFI A;  3PIP A;  4DR2 L;  4IPH A;  1VQJ A;  5ELO A;  3CCS A;  1CKM A;  3HKZ G;  1M90 C;  4LF5 Q;  4HJA A;  1TXY A;  2K14 A;  4DNI A;  1C9O A;  1KD1 C;  2R7Z H;  2CWP A;  2B63 H;  4B3T Q;  1XMQ L;  1YJN A;  1K9M C;  4JBJ A;  2L15 A;  1LYL A;  2CCZ A;  4ME3 A;  2MO0 A;  3GTJ H;  3H15 A;  4A3G H;  2JA8 H;  1I94 Q;  3AFQ A;  3I4N H;  2R7D A;  2WB1 G;  4PZ6 A;  4JI8 Q;  2N3S A;  3RR5 A;  1JT8 A;  4AQY L;  4LFB L;  2UUB Q;  3U50 C;  4R1J A;  3KOJ A;  5C4J H;  1XMO Q;  4MTN A;  2N8N A;  3VDY A;  5JEA G;  1VQN A;  4RG1 A;  5IYB G;  3H0G G;  1N34 Q;  3I4M G;  5JJL A;  2IT1 A;  4DR5 L;  2UXB L;  5J3B A;  4QGU A;  3CF5 A;  4C3J H;  3CQZ H;  4LFA L;  4KHP Q;  3A0J A;  4R4Q A;  4X65 L;  4XTC S;  3LGJ A;  3S24 A;  2VZA A;  2WAQ E;  3E9H A;  1PH8 A;  4R4C A;  4GNX C;  3OW2 A;  1TWA H;  1VQF A;  2KHJ A;  2YV5 A;  4FDB A;  4C2M H;  1YIT A;  1VQ5 A;  1BBU A;  4A3D H;  1E24 A;  1OTC A;  4LUZ A;  2KHI A;  1YHQ A;  2JJQ A;  1TWF H;  3B6Y A;  1XPO A;  3RN2 A;  3ER0 A;  1E1O A;  1YJW A;  4JI3 Q;  2ZM6 Q;  1YIJ A;  2R93 H;  5IT9 c;  1X56 A;  5IWA L;  1C0A A;  2HHH Q;  1CSP A;  3GD7 A;  3A5U A;  1E7Z A;  4ALP A;  4LF5 L;  1NJI C;  4XIG S;  1PFS A;  4DV4 Q;  1WI5 A;  4OO1 G;  2K5V A;  4A75 A;  4OWX B;  3FKI H;  3CAM A;  2CFM A;  2BA1 A;  2AWO A;  2ID0 A;  3BZK A;  1WYD A;  2VQE L;  4HIO A;  1NMF A;  4JI1 Q;  3F1Z A;  2VUM G;  3S2D H;  4JI8 L;  4OX9 Q;  1G51 A;  3KDF A;  2ES2 A;  3HOX G;  3J81 j;  1HZA A;  1TWG H;  1A63 A;  5JJI A;  2CWA A;  4KI0 A;  4J15 A;  4HJ8 A;  1PH4 A;  3HOU G;  1VQB A;  1Y1V G;  3D31 A;  1D7Q A;  2JA7 G;  1PYS B;  3S16 H;  2R92 H;  3AEV A;  4L5R C;  1P8L A;  3I4O A;  2I0Q A;  2E2I H;  4KHP L;  4UP7 A;  1UE1 A;  1X55 A;  2F4V L;  2BA0 A;  2CQO A;  1LTL A;  2Y0S E;  4DR4 L;  3D0F A;  1X9N A;  1PH6 A;  3UDG A;  4B3M L;  1OXS C;  1JB7 A;  4DUZ Q;  3PO2 G;  2E2J H;  3GTK H;  2WAQ G;  3DM3 A;  2CKZ B;  1K8G A;  4A3B G;  4P74 A;  5C0X G;  3M4O H;  4GOP A;  1VS0 A;  3CCE A;  3S1R H;  1Q8K A;  2H5X A;  1NMG A;  1MKH A;  1U0L A;  4HJ5 A;  3T1H L;  3E0E A;  4R4I A;  4B3S Q;  4GKK L;  4KHZ A;  1D8L A;  1K3R A;  1YNX A;  2LXK A;  2N49 A;  2WB1 E;  4UP8 A;  4IOA A;  4JI0 Q;  2DGY A;  4JBW A;  2AMC B;  1HH2 P;  1EFW A;  4APV A;  4DV7 L;  4NXN L;  2WFW A;  1G29 1;  2D62 A;  4IFD G;  2A1A A;  4LNQ A;  2Q2I A;  1UWV A;  2HQL A;  4KLK A;  3RNU A;  4IOC A;  3NBH B;  2PMZ E;  1A8V A;  4JI5 L;  4POF A;  3TS0 A;  2VY3 A;  3GTG H;  4JG2 A;  3RLF A;  3PO3 G;  3J81 i;  1FGU A;  3H3V I;  4DV0 L;  5H1S E;  4K0K Q;  2ALY B;  1GM5 A;  1IXR A;  1Q1E A;  1I50 H;  2K5H A;  2C35 B;  3SGI A;  1TWH H;  4DR3 L;  3HOX H;  4PG3 A;  4YWK A;  4QL5 A;  1SLJ A;  1PA6 A;  4JYA L;  4DV3 Q;  5EAY A;  1QZH A;  3HFZ B;  1N36 Q;  1N33 Q;  4JI2 L;  5IYC H;  3HOZ H;  5M5X H;  4HJ7 A;  1MJC A;  4JI7 Q;  1I5F A;  4LF8 Q;  3FP9 A;  4DAM A;  1MIU A;  1TWC H;  2OCE A;  3K0X A;  2Y0S G;  4GLV B;  3MEF A;  3U4V A;  3UDF A;  1J5E Q;  4X62 Q;  4DR7 Q;  2JEB I;  1OXT A;  1XTD A;  2K5N A;  1BVS A;  2K75 A;  1KIX A;  4BBS G;  1QZG A;  1PH9 A;  1IBM L;  2BH2 A;  4A3C H;  1L0W A;  5ELN A;  5FLM H;  3S1N H;  1T9H A;  5GAH C;  1GD7 A;  3T1Y Q;  4MZ9 A;  4B3S L;  2AHO B;  2A8V A;  2XGT A;  1XPU A;  4QQB X;  1EIF A;  3F2C A;  3KF8 B;  1GO3 E;  2K50 A;  4YWL A;  3KJP A;  4DV6 Q;  1KRS A;  5BR8 Q;  1YJ9 A;  4BY1 G;  1S40 A;  4L5Q A;  1B8A A;  4C3H H;  1WOC A;  4AIM A;  2I5M X;  1CKO A;  3PUZ A;  4GN3 B;  5FJ8 G;  4YY3 L;  2UUC Q;  2HT1 A;  4DV1 Q;  5M5Y H;  4X6A H;  3TRE A;  1O7I A;  1S3O A;  1E1T A; 
#chains in the Genus database with same CATH topology
 4HNT A;  3PGZ A;  4JK1 C;  1B50 A;  2RVL A;  2VOB A;  5CV6 A;  3WO1 A;  1UUP A;  1EWH A;  3OTO H;  4GNX A;  3E9I A;  2JSO A;  1H9M A;  2ASJ A;  3IAY A;  2F3I A;  3PUY A;  2CW8 A;  4LF6 Q;  3GO5 A;  1N32 Q;  5HGQ A;  1KLU D;  5IP9 G;  3J81 L;  1JJ2 A;  4YR3 A;  2BDO A;  3GTG B;  2EJF C;  4JPB W;  5FKA C;  2KHS A;  4LH6 A;  1BCP B;  1CSQ A;  1SE3 A;  4XYQ A;  4WJ4 A;  1TT2 A;  1TY2 A;  3SVM A;  4JI4 L;  5F2D A;  4RU9 A;  4UCV A;  1FKA H;  1TWH B;  1E4E A;  4YY3 H;  1K0S A;  1Q86 C;  3PIO 3;  5FOB B;  4AQY H;  5C44 H;  3OOC A;  5EKI A;  3C3L A;  4RKL A;  1E22 A;  2PNH A;  3CU7 A;  2I07 B;  2Z1C A;  1TWC B;  1FNV A;  3T4A C;  3K6O A;  2X0S A;  4LF7 H;  4NXM Q;  4F4W A;  1STH A;  2BQR A;  4LUO A;  3TRZ A;  3K5O A;  2Y0S A;  3HZX A;  4IRC A;  2K52 A;  4IUQ A;  4JV5 Q;  3V6J A;  3PZP A;  1I94 L;  4BBS H;  4ECW A;  2KVM A;  5IT9 W;  3M85 A;  2J0T D;  3ND8 A;  1K3B C;  1WTH A;  5G3L F;  4DAV A;  5LMN H;  1QG7 A;  3I72 A;  1AUV A;  3KBG A;  4NP5 A;  1AZP A;  2R8J A;  4IRD A;  1ONL A;  1K8O A;  2EDG A;  3KAJ A;  4N8X 1;  3S15 B;  5CV9 A;  1IYJ B;  5M3M G;  4K8I A;  4R8I A;  1EU4 A;  3JZI A;  4DR6 Q;  2YL2 A;  3TME A;  3K81 C;  1GGO A;  4UDU C;  5EKK A;  1I4X A;  1ASZ A;  2G9D A;  3L0O A;  4LW1 A;  3L2P A;  3I91 A;  1VQI A;  1HUN A;  1TA8 A;  4I7H A;  3R5X A;  4ZK9 B;  1BOS A;  2PMZ A;  4HCE A;  4DK1 A;  2D5D A;  4L8J A;  1E3P A;  2EYO A;  1IBL Q;  4JI3 L;  2UXC L;  3PV0 A;  4ME6 A;  3CC7 A;  2B8F A;  1GHJ A;  1XPR A;  4HED A;  2UUB H;  2EIF A;  2EQS A;  2HHH L;  5EOY A;  2ENB A;  1FR3 A;  1LTB D;  3EIV A;  1HZB A;  3MXG A;  3JAM L;  4LSA A;  5KFM A;  3WNZ A;  1MGS A;  4FBU A;  4KHP H;  4G3I A;  5A2Q E;  2NWG A;  2O2L D;  2Y0S B;  4QUC A;  3MFY A;  4A3G G;  5HBR B;  4J9O A;  3K80 C;  3RMH A;  3MWM A;  2EXD A;  4RKB A;  2QKI C;  3KDF B;  4RZQ A;  3ITP A;  2AU0 A;  3PMF A;  4A93 G;  2VNU D;  3CME A;  1YNJ D;  1Q46 A;  5LL6 b;  1KHI A;  1FL0 A;  1SRO A;  4QF4 A;  4YAJ B;  1WTV A;  4Y52 H;  2EYF A;  4DL6 A;  4BY1 B;  2LMC B;  1XJV A;  4QIW A;  3ULL A;  2UVV A;  5EKL A;  1JC7 A;  5C3E G;  2JA7 H;  1Y8O B;  1YI2 A;  1BCP D;  2ZJR A;  4DR5 Q;  4EVO A;  3S1M H;  2RDG A;  2RDH A;  3H0G B;  2FJ2 A;  5IGE A;  2CW0 D;  4O3R A;  2JA5 G;  2AGQ A;  2IHE A;  1UEB A;  3EJI A;  3GV3 A;  2I46 A;  2OQK A;  1B1Z A;  2PMZ B;  3P1H A;  3IFT A;  3LNN A;  3QG1 A;  4GOP B;  1AZQ A;  3PO2 H;  3GTL A;  1YNJ C;  4FP5 D;  1WTP A;  4A3B H;  4ED7 A;  4JC0 A;  2VB2 X;  1H9K A;  1JDB B;  3RZD B;  4E4T A;  4DXG A;  4RB2 C;  3V2T A;  3VYU A;  4ZI7 F;  1S5B D;  4HN7 A;  4X66 L;  2F52 A;  5BN5 A;  3J80 c;  4A3J H;  1RJQ A;  2ZDQ A;  5KFF A;  1BCP C;  5IWA Q;  1D1K A;  2RQX A;  4PZ7 A;  4CDD C;  4IWX A;  3BG5 A;  4PDB A;  3L9A X;  2KCC A;  2LSS A;  2CW0 C;  2OEO A;  3QO2 A;  4QJF A;  1OXV A;  2FLN A;  1HCZ A;  2WV6 D;  1HNZ Q;  4AYB E;  1XNQ Q;  4GKJ L;  4FYD A;  4UCT A;  2R7Z A;  2AQ2 B;  3TP5 A;  2IP4 A;  5IE8 A;  4ODG A;  2NVT B;  4EBE A;  1IOV A;  3CMA A;  4IFD J;  3PSI A;  1AFP A;  5KFG A;  2B2W A;  4A3M G;  1RIP A;  4PMW A;  1PH2 A;  3BS1 A;  2VUM B;  3AYH B;  4JI0 H;  4OIJ A;  1V1Q A;  3HOX B;  2AQ4 A;  2NN6 G;  3TEH B;  4Q5V A;  4DR7 L;  5TSS A;  4K8J A;  3L4K A;  1NBW A;  4BA2 I;  2R7K A;  1UC8 A;  4I55 F;  5F9N A;  4X64 H;  2F4V Q;  5KFA A;  4OWT B;  3T1Y L;  2MNA A;  2W71 A;  2CW7 A;  4MA0 A;  2Q2U A;  3VA7 A;  1E2W A;  1DIK A;  1I4G A;  3SI8 A;  1B33 N;  1HHV A;  2GVA A;  4YBZ B;  4DV1 L;  1HUM A;  3NWT A;  3F2B A;  1BDO A;  3V4Z A;  4DV3 H;  4J9Q A;  5KFZ A;  4KMU C;  3A5Z B;  5KFL A;  4GKK Q;  1N36 H;  4GLX A;  1K83 H;  2XWJ B;  3M4Q A;  5M5W B;  4LF8 H;  3J7A F;  5FJ8 H;  1R9T H;  3I7F A;  2CZG A;  1RHP A;  1J5E H;  3HKS A;  1LLR D;  3GTO H;  1SND A;  2W9C A;  5DQG A;  2IL8 A;  1BBW A;  1L2F A;  2KEC A;  4B08 A;  2GPW A;  3EBE A;  3DM1 A;  4RHR A;  1I6H H;  3FKI A;  5FPR A;  1HQM C;  1FJG L;  2OTJ A;  3EA6 A;  3GIK A;  1M8A A;  4IUT A;  4UCO A;  3KFU A;  5IP9 H;  1KTK A;  4DR1 Q;  3M3Y B;  1MSH A;  3EYY A;  5KT3 A;  4A2B A;  3JRX A;  1WH2 A;  1V43 A;  1IW7 D;  4X3S A;  5IYC G;  1VQ6 A;  3HOZ G;  3K58 A;  1PK8 A;  4YR2 A;  5KG0 A;  4HNV A;  1BF4 A;  1KDC A;  1STE A;  3PO3 B;  3H4D A;  3QOJ A;  3PF4 A;  4K14 A;  2DJF C;  1OXX K;  3O13 A;  2R92 A;  4EBC A;  4MV6 A;  5DEH A;  2E2I A;  4A3C G;  4NPS A;  1Z47 A;  4FU0 A;  3SK5 A;  4LF6 H;  1B7Y B;  3HB9 A;  1W3S A;  4G4K A;  2YU9 H;  4FM9 A;  1N32 H;  1UNN C;  3P7J A;  3GTK A;  2WII B;  2QCP X;  2JA8 G;  4Q43 A;  1PH5 A;  1IW7 C;  2QA4 A;  4ED1 A;  5KYL A;  5LMN W;  1Q82 C;  4QWA A;  1B2T A;  1WTQ A;  1JWS D;  3RAX A;  5EBC A;  1KC7 A;  4C5B A;  2W6Q A;  3KLW A;  4PWQ A;  1M6V A;  2W8K A;  1PDQ A;  3OMG A;  3RN5 A;  1GXD C;  4GOP C;  2OF1 A;  1DOK A;  1EQR A;  3A55 A;  1SAP A;  3D4R A;  2J9G A;  2IBK A;  2JA6 H;  4DAY A;  5FLX E;  3S17 H;  2QGQ A;  1PVO A;  3BA8 A;  1X54 A;  4A2A A;  5FLX c;  1EY5 A;  3P20 A;  1TS2 A;  4Q8F A;  1QVG A;  2AKW B;  1B6S A;  2D0P A;  5CR3 A;  1I3Q B;  4A3E H;  1HQR D;  4WJ3 M;  4NXM H;  2L11 A;  3C1F A;  4O3O A;  1X3P A;  1X3E A;  1F9P A;  1STA A;  4JV5 H;  5ELB A;  1BNZ A;  4J6H A;  4YCV A;  4A3D G;  1EZ1 A;  1Y1W G;  3HOW B;  1JIH A;  2JXM B;  5BN4 A;  4DV5 Q;  2DUD A;  4DK3 C;  5ISR A;  1E2Z A;  1Y14 B;  3M4Y A;  4O3P A;  1LUZ A;  1CQV A;  4R4O A;  4RHS A;  4EQ5 A;  1VMP A;  1XYI A;  3S14 H;  4YB8 B;  2IPK D;  5AJ3 L;  2GVB A;  3OTO L;  2Z6K A;  2F3V A;  3MAQ A;  2MFI A;  5DQH A;  2W6Z A;  5K5P A;  4QWD A;  1EYA A;  4IPH A;  4DR6 H;  2F1M A;  4FXK C;  2EY5 A;  5ELO A;  2ZDH A;  3SE0 A;  3HKZ G;  4DNR B;  1M90 C;  2W8L A;  2FE3 A;  5IIF A;  1SCU B;  3MWD A;  2CWP A;  4B3T Q;  2GA4 B;  1XMQ L;  1YJN A;  4JBJ A;  1IBL H;  2CCZ A;  3BQ1 A;  5CMD A;  4ME3 A;  2B63 A;  3H15 A;  4A3G H;  3UI2 A;  3PW5 A;  3GTJ A;  2N3S A;  1XX8 A;  1JT8 A;  4R7R A;  4AQY L;  5L9X A;  2KUM A;  1ZET A;  3MXP A;  4R1J A;  3F8N A;  3QJY A;  4F4Z A;  1VQN A;  4ZKB B;  4B9X A;  3K5H A;  1CI3 M;  1ZHS A;  5KFH A;  5JJL A;  2IT1 A;  4IAL A;  2UXB L;  1EUC B;  2WAC A;  3S9W A;  3A0J A;  3CRK C;  3KK7 A;  1GSA A;  3BQ0 A;  1LTG D;  5T1I A;  5KG2 A;  4R4C A;  2H4O A;  4YJ3 F;  4FDB A;  3M9N B;  2L4N A;  4R9W A;  2ICI A;  4MAM A;  4FNF A;  2A73 B;  2FK3 A;  3OHA A;  2R8H A;  1XPO A;  1E1O A;  2ZM6 Q;  2R93 H;  5LA6 F;  2NU9 B;  1LAC A;  1CSP A;  2EYJ A;  3GD7 A;  5DG7 A;  4KD4 A;  3ERQ A;  2NVX B;  4ALP A;  4XIG S;  1DM0 B;  3BA9 A;  4DR5 H;  4DV4 Q;  3X3M A;  3R2I A;  3SXH A;  5I6W A;  4A75 A;  1I7L A;  2NU7 B;  3T51 B;  4LJZ C;  2M05 A;  4MA5 A;  1XTC D;  4HIO A;  2CH4 A;  4CKE A;  5KG5 A;  4JI1 Q;  5LOV F;  4BS9 A;  3RFC A;  4R8N A;  1QWY A;  2B63 B;  1HA5 A;  1ENA A;  4OIK A;  1GUG A;  1JOR A;  2CWA A;  4KI0 A;  1Z2N X;  1WTR A;  3D31 A;  4K2K A;  3VYR A;  3S16 H;  2WB1 A;  3LP8 A;  3CRL C;  3I4O A;  2I0Q A;  2WE6 A;  5IWA H;  4KHP L;  4FF2 A;  1XNR H;  1UE1 A;  5JEA H;  1DXM A;  2AUK A;  4RUA A;  1LTL A;  2Y0S E;  2NN6 H;  4QW9 A;  4B3M L;  4QWC A;  4DUZ Q;  1HNZ H;  4MTE A;  2R87 A;  1R4P B;  3J81 E;  1K8G A;  5JJZ A;  1XNQ H;  4LMY A;  2IX3 A;  1DV2 A;  1O7L A;  1TWA B;  3BAB A;  2K7V A;  2QDL A;  5D65 A;  3E0E A;  4B3S Q;  1V51 A;  5KFK A;  4JV2 A;  1D8L A;  1KAA A;  5FPO A;  4ILW A;  4XDX A;  2VB3 X;  4HSV A;  4DL5 A;  2OT2 A;  2AMC B;  1EZ8 A;  2F0Q A;  4Y8V B;  4TSS A;  1EFW A;  3K5I A;  1W6J A;  2WFW A;  2J6U A;  1PZK D;  4NMZ A;  1T3N A;  4N9T A;  4KK7 A;  2X69 A;  2ZXR A;  2F4V H;  4HAE A;  1ESF A;  4KLK A;  3SDZ A;  2PMZ E;  4ID6 A;  2GLT A;  5C3W A;  3TS0 A;  5KG4 A;  4OO1 H;  3TQT A;  4JG2 A;  3PQI A;  3TZU A;  4ZRZ A;  3H3V I;  4TRD A;  4DV0 L;  5D1O A;  5H1S E;  3K59 A;  4K0K Q;  2HVQ A;  2F0L A;  1IXR A;  2N88 A;  1JE4 A;  1I50 H;  3R23 A;  5ELE A;  1WCM B;  3HOX H;  1D5M C;  1SLJ A;  4GKK H;  1TVX A;  2XNA C;  5EAY A;  5CC4 A;  2PNR C;  5IYC H;  1TU2 B;  4HJ7 A;  4JI2 L;  3HOZ H;  4JI7 Q;  1I5F A;  1IYV A;  2D2C C;  1SYC A;  4HR7 B;  2OCE A;  3UDF A;  3GQC A;  2UVU A;  2QIL A;  3V05 A;  4X62 Q;  2JA7 A;  4HQ6 A;  2LY7 A;  3N40 P;  1SYE A;  1XTD A;  1RYS A;  1SNM A;  4RB0 A;  4BBS G;  2W6O A;  1PH9 A;  4A3C H;  2O5J C;  3S1N H;  1CA5 A;  1GD7 A;  1D1I A;  4DR1 H;  1O75 A;  2V5A A;  2IMW P;  5HUR A;  2K50 A;  2FMA A;  5C0X H;  1YJ9 A;  1SYG A;  1B8A A;  2UUC Q;  5I9O A;  4LFC H;  4ZLT F;  1O7I A;  3NXW A;  2IWH A;  1VQO A;  1PX2 A;  3MXN B;  1LT5 D;  5COY A;  1X3F A;  4X64 L;  1XDN A;  4FS2 A;  1L1O B;  2EJG C;  3JAM E;  1SR3 A;  4J9L A;  3I56 A;  4QWB A;  4OXP A;  5KG1 A;  3RV3 A;  2FJZ A;  1JB3 A;  1F9R A;  4BA1 I;  1QVF A;  4JV1 A;  4L6T B;  1VKZ A;  1A3V A;  2R84 A;  3A56 A;  5DGB A;  5D1O B;  3TQ1 A;  4ZUI A;  1LTI D;  4AYB B;  2N78 A;  1Y1W H;  2E5L Q;  3U9T A;  4K2L A;  1PFN A;  4LF9 Q;  3SK6 A;  4LF8 L;  4TV8 F;  1SFO B;  2QK4 A;  1NR2 A;  3URY A;  4M7E A;  5JAV A;  5LP6 F;  2SNS A;  3NP8 A;  3J80 i;  5M5X B;  5EBD A;  4GN5 A;  3L7Z C;  2UXD Q;  5J39 A;  2HVS A;  2GN5 A;  4KY6 A;  1ULZ A;  1Q12 A;  2XIG A;  4DUZ H;  2C2D A;  3T56 B;  3MR6 A;  2EYM A;  4ED3 A;  3AMU A;  4ED2 A;  2M9V A;  2EZV A;  2L55 A;  1B04 A;  4CJ1 B;  5IP7 G;  3BZC A;  4C3I G;  4JVZ A;  3CW2 C;  2K1B A;  1LO5 D;  4PMB A;  2ZJQ A;  5LXT F;  4DV5 H;  4X3U A;  2V1C C;  1K8M A;  3S2H H;  4IR9 A;  1XMO L;  1VQE A;  2FP4 B;  4H02 A;  4C3H B;  1QUQ A;  3I3C A;  2E75 C;  4LMQ D;  1N34 L;  3JSL A;  2EY2 A;  3GTM A;  4RCO A;  4FXG C;  2O5I C;  5M5Y B;  2B2T A;  5EJW A;  1K83 A;  2UVW A;  3CP0 A;  3S1Q H;  2UU9 Q;  3X3N A;  4GN4 B;  2JEF A;  1OWT A;  2UVR A;  4HMI A;  2F0U A;  2G5D A;  2Z4H A;  2FK1 A;  4IUU A;  2UUA Q;  3DLL A;  3GTO A;  3CXC A;  4U6P A;  3GTQ H;  3PUW A;  1CA6 A;  4Y7N B;  2Q2T A;  5LL6 X;  5EWF A;  3CQZ B;  1NE3 A;  4FF4 A;  3OSP A;  4B3T H;  1LAB A;  1EY6 A;  2NUC A;  1KJJ A;  1A6X A;  2C5C A;  2VL6 A;  2VQF Q;  4B3R Q;  4RH6 A;  3PIP 3;  4HSP A;  2EYH A;  3T13 A;  3J7A 5;  4K5X A;  2E2D C;  3J7Y W;  4FO2 A;  4A3J G;  2VW9 A;  4A3L H;  1JQY D;  3WOE A;  4BBR B;  2NVQ H;  3OUZ A;  1KRT A;  3ND9 A;  4M9U A;  2W9B A;  2Q8T A;  1EQT A;  4P2C B;  3EPG A;  3BYT B;  3KJO A;  2KEN A;  4NXM L;  2K33 A;  2DPJ A;  1PHJ A;  5CV5 A;  4C5C A;  4JI6 Q;  2IY5 B;  4XQQ A;  4DR2 Q;  1M0W A;  2A5H A;  2YU9 A;  3OPO A;  5C4X H;  2FIN B;  5M3F H;  4OX9 L;  3AFP A;  2BCO A;  2E2H B;  1P16 A;  1IL2 A;  2FK2 A;  3NTH A;  2XIW A;  1S5D D;  4XXE A;  5CA0 F;  1A2U A;  3NEM A;  3IRB A;  2ZM6 H;  4UCR A;  4HNU A;  4KJN A;  1GYF A;  3FPP A;  1U5K A;  3EN2 A;  1Q81 C;  4JOI C;  2NZ1 D;  3HOU B;  1RK6 A;  3TP8 A;  4C3J G;  4DR6 L;  4XX0 B;  2JA6 A;  4L5S A;  2F0V A;  3R2T A;  2LFN A;  2MJ8 A;  1RJT A;  1R4Q B;  2CHB D;  2F0W A;  3FVQ A;  3VR6 A;  4DV4 H;  1LT4 D;  5GAG C;  5EZY F;  1T36 A;  1N48 A;  3ZJY C;  2PZT A;  3V6K A;  3BU2 A;  1MJE A;  4MIU A;  3W2D A;  1BCP F;  1JE5 A;  3G6J B;  5CBA E;  3I4M B;  1AUX A;  3CC4 A;  1L1O C;  1Z2P X;  1CHP D;  4L1K A;  1A9X A;  2W7P A;  4JI1 H;  1VQP A;  3NSW A;  4H44 C;  4UCU A;  5HV6 A;  3F2D A;  2FLL A;  4GS3 A;  3CCL A;  1SN8 A;  1PH1 A;  3FEW X;  1DCZ A;  5C8Y F;  4YCW A;  5JQW A;  1Q7Y C;  5E1F A;  3VPD A;  4KY7 A;  2WKD A;  1EY0 A;  1VQK A;  1PMR A;  3NEL A;  3G6X A;  1W96 A;  2NVY H;  4DKA C;  5EGT A;  3IG0 A;  3I90 A;  1H95 A;  3RIZ A;  5KT7 A;  4IPD A;  5HGT A;  4AH6 A;  2NUA B;  1AE3 A;  1IHZ A;  4EGV A;  2DY8 A;  4P73 A;  1EYG A;  3CD6 A;  3NPP A;  2K6A A;  1DGS A;  4A3I H;  5KT4 A;  2K5D A;  3CPW A;  2VQE Q;  1EWI A;  1PFM A;  2OWO A;  4B3S H;  1AEX A;  3DHQ A;  1S72 A;  3KF6 A;  5KKN B;  1N33 L;  3G7L A;  2A19 A;  1VQH A;  2YZM A;  4QUF A;  3RZO H;  3G71 A;  1O7Y A;  4V0B A;  4NDX A;  4CDF C;  1YNN D;  5EDW A;  3HRZ C;  4WFN 3;  1II3 A;  1Y1V B;  3ZYY X;  2XRS D;  4O2A F;  3G6Y A;  3NTK A;  1CUK A;  3N6R A;  1LTT D;  1SE8 A;  5CBE E;  5I4D A;  4MV3 A;  5KX5 F;  1NR4 A;  3WDN A;  4DR4 Q;  3RBE A;  2LS0 1;  1TS4 A;  2PZU A;  5M3M B;  3UE1 A;  2EYL A;  3FMC A;  3QZ7 A;  2EPB A;  2HVR A;  1C48 A;  2I8C A;  5BR8 L;  5T1G A;  1M1K C;  2Z9H A;  4JCV E;  4FS1 A;  4K0K H;  2DJG C;  2X6G A;  4XQJ A;  2JA5 A;  2PI2 E;  2B39 A;  1T5E A;  3BYY B;  2QF7 A;  2JA6 G;  1H9S B;  2B2Y C;  3T1H Q;  5E3F A;  2XCP A;  4JI7 H;  1YNN C;  3M9B A;  1XNR L;  1SBB B;  4A3E G;  4X62 H;  5EWG A;  3GTP H;  3QZ8 A;  3RAQ A;  4GNX B;  1HNZ L;  1SJH D;  4DV7 Q;  4NXN Q;  1XNQ L;  4DNT B;  1N9W A;  2RCN A;  3NBH A;  1B3A A;  2SEB D;  4JI5 Q;  2L12 A;  5ELF A;  3HOV H;  5KT5 A;  1KC8 C;  1WCM H;  4XT3 B;  1ZEQ X;  2XGQ A;  3KF6 B;  2UUC H;  2B2V A;  2F0T A;  4PZ8 A;  5GQO A;  1Z9F A;  3NEN A;  3I12 A;  3KLR A;  1GUO A;  2EXZ A;  2NTT A;  1E4E B;  1I4H A;  3G48 A;  2R7F A;  2NZO A;  3TQY A;  4A93 B;  3M7N A;  4JYA Q;  3H4B A;  2JP1 A;  1X3G A;  2J4X A;  4IPC A;  2OH2 A;  1EU3 A;  2LXJ A;  1YBY A;  5FD6 A;  3CCR A;  5FLM G;  3IFD A;  3K5L A;  3VR5 A;  1HNW L;  2JN4 A;  2V58 A;  5C3E B;  4B9W A;  4ECR A;  2V9W A;  3F8T A;  2NB0 A;  2G9H D;  3R93 A;  1IBM Q;  3NWS A;  2PYK A;  1JOO A;  5IP7 H;  3CCM A;  4TQS A;  2E5L H;  5E7N A;  1EQQ A;  4BWS C;  2JA5 B;  4C3I H;  4LF9 H;  1NAP A;  5L37 A;  3VA5 A;  2Q8R E;  2VQD A;  1KQS A;  4YHH L;  3GIL A;  2ZJP A;  4NB3 A;  2UXD H;  2K32 A;  5CV4 A;  3M7G A;  2QW7 A;  4KV6 A;  3MTS A;  2TMP A;  1GHK A;  1GUT A;  2HCC A;  2ZXO A;  3Q22 A;  1AN7 A;  1TY0 A;  3HOY B;  5EPL A;  1JJC B;  3QR8 A;  4DR1 L;  1RYR A;  5IGG A;  4UAI A;  3G4S A;  1PRT F;  3GIQ A;  4H7B A;  1O78 A;  3PF5 A;  3HGB A;  4TVA B;  2HIV A;  1SMY D;  3JSN A;  3K7U C;  4K6D A;  4F88 A;  3K7A B;  5GAE C;  2BH2 A;  4LFC L;  1SFO H;  2R93 G;  4RB3 C;  4N8F A;  5IT9 L;  3T5L A;  1VQ9 A;  2F0D A;  5C6A A;  4I7A A;  4O2B F;  3JC6 6;  2W9A A;  4OHJ A;  2YTV A;  4JI4 Q;  2UU9 H;  4A3M B;  3MR5 A;  5C5J A;  2UUA H;  1S0O A;  1J9O A;  3VR3 A;  3OIP A;  2F0K A;  4F4X A;  4DGZ A;  1G8Z D;  1CKM A;  4PMC A;  5T14 A;  2A6H D;  5LHY 1;  4LF5 Q;  1XWE A;  2FFK B;  1AP0 A;  1SMY C;  5CB4 F;  1V8Q A;  2VQF H;  5KFR A;  4B3R H;  2WAQ A;  2EOT A;  4J0M A;  3I4N H;  1I94 Q;  3AFQ A;  1S9F A;  2R7D A;  3Q6S A;  4BY7 B;  3OIQ A;  4JI8 Q;  1HRJ A;  2DNC A;  4LFB L;  2KED A;  4A3K B;  4F50 A;  4MTN A;  1U4L A;  2C2R A;  3U9S A;  3VDY A;  5JEA G;  4RG1 A;  5D14 A;  3H0G G;  4CDC C;  4QIW B;  2A6H C;  4EQN A;  4JI6 H;  5J3B A;  4QGU A;  5KG7 A;  4DR2 H;  4C3J H;  1RDP D;  2R7L A;  1LTR D;  3CQZ H;  5BPH A;  4F8M A;  4X65 L;  3LGJ A;  1BO0 A;  1Z6H A;  1V1O A;  3R3O A;  1PH8 A;  1ZHQ A;  4RNM A;  1I4Q A;  1Z7T A;  4RGT A;  4ZAI A;  4GNX C;  2WTF A;  1VQ5 A;  4C2M H;  3GTL B;  1BBU A;  1PTO B;  1E24 A;  3N52 A;  3D6C A;  1TWF H;  3B6Y A;  1Y1W A;  3RN2 A;  3ER0 A;  4JI3 Q;  1YIJ A;  5C4H A;  1X56 A;  4ABN A;  4EG0 A;  3VYS A;  2RCF A;  1KJQ A;  4ME5 A;  2HHH Q;  1L2Z A;  3A5U A;  3H3V C;  1M7J A;  1E7Z A;  5KG6 A;  1ML0 D;  2HJW A;  5M9O A;  4CHT B;  4O3N A;  1CE8 A;  3OHX C;  4OO1 G;  2K5V A;  3RB4 A;  1L0Y B;  3BZK A;  2B2U A;  1GSH A;  3D8G A;  4XYO A;  2VUM G;  1VF7 A;  2R7Z B;  1G51 A;  3HKZ A;  3HOX G;  4DK0 A;  1TWG H;  1A63 A;  4ULL A;  5JJI A;  2JA8 B;  1PH4 A;  2DNE A;  1D7Q A;  1MZB A;  5C4J B;  2AQ3 B;  4KN4 C;  1P8L A;  2FPG B;  2PW7 A;  1D5X C;  1G2S A;  4ED0 A;  5IGB A;  3TII A;  3NTI A;  4I50 F;  3EFX D;  3UDG A;  2ALZ A;  2K05 A;  4O4H F;  2WAQ G;  2KEE A;  1RJP A;  1SYX B;  5DAU A;  3E5N A;  3M4O H;  5C0X G;  5KND A;  2F0J A;  2VQE H;  1JOK A;  3CCE A;  4O3S A;  3H20 A;  1STN A;  2H5X A;  1RTO A;  4Z9C B;  4A3D B;  1TKW B;  3HG9 A;  1K3R A;  2LXK A;  1E0B A;  2N49 A;  1KDB A;  3H6M A;  4UCS A;  4IOA A;  5EWE A;  4RFB A;  3MR3 A;  1AN8 A;  3KBX A;  2BR0 A;  4Q0Y A;  2WDT A;  1EHI A;  3K57 A;  5A2Q W;  5KFO A;  2W9C B;  4YJ2 F;  4DR4 H;  1A8V A;  2A74 C;  4RGO S;  3FKI B;  4C1N K;  2VY3 A;  3GTG H;  5KT2 A;  3HKZ B;  3PO3 G;  2RGR A;  3S2D B;  1FGU A;  2R8G A;  2ALY B;  1GM5 A;  1QNK A;  4DR3 L;  3UFX B;  2K5H A;  1PA6 A;  1TWH H;  5CV7 A;  4YWK A;  4QL5 A;  4ECY A;  1LT3 D;  1RD9 D;  3HFZ B;  4KD3 A;  3ETJ A;  3FMA A;  2R92 B;  1TWC H;  1MSG A;  3MEF A;  1PTO D;  2E2I B;  4DR7 Q;  4DV7 H;  2F03 A;  4NXN H;  5FO9 B;  1CQJ B;  1ILP A;  3QFF A;  3GV8 B;  1OXT A;  3DEP A;  3I73 A;  1F2Y A;  3HP3 A;  5FLM H;  2E2J B;  4JI5 H;  3GTK B;  1T9H A;  4EFB A;  3T1Y Q;  3PW4 A;  2YZG A;  4B3S L;  4DL4 A;  1XPU A;  2R6F A;  1EFI D;  4YWL A;  1GO3 E;  3G8C A;  4YP3 A;  4DV6 Q;  1KRS A;  1WD0 A;  3S1R B;  4L5Q A;  4CC6 A;  3J80 W;  5C5M A;  4YY3 L;  4EFE A;  1S03 G;  3GQB A;  4DV1 Q;  4A3F B;  4X6A H;  3D4W A;  1S3O A;  3R5F A;  4JYA H;  1PTO C;  1HJP A;  4R8U A;  3S15 H;  4DAY B;  3RLO A;  3BJY A;  2OLS A;  4CJ2 C;  1C4Q A;  4LF7 L;  2L9H A;  1V1P A;  1PH3 A;  1VQ7 A;  3H91 A;  2ZTD A;  4ECQ A;  4JV0 A;  1HFN A;  1TS3 A;  1PV4 A;  4H0L C;  4IFD H;  1B3Q A;  2D0O A;  2F0M A;  2NBF A;  3N44 B;  4K0K L;  4ZQ3 A;  1IBM H;  3ICE A;  1BXT A;  1YVC A;  2KOL A;  1VQ8 A;  4DUY Q;  4ETS A;  4IN3 A;  2YTY A;  2E8G A;  4A3L G;  5LMN L;  1SRU A;  1HR0 W;  1SYB A;  1V4Y A;  2JEA I;  3V96 A;  1BXR A;  5KG3 A;  4XYL B;  2JEJ A;  2FHT A;  3K5M A;  2F0O A;  2FB9 A;  2B2W C;  3C46 A;  2SCU B;  1UE7 A;  2CVR A;  5C4X G;  5M3F G;  2XRQ D;  2OQ0 A;  1D2B A;  4NKL A;  5HY6 A;  2PQA A;  2DN8 A;  5IGF A;  4K6L A;  4PNY A;  5GRO A;  3AQQ A;  5JJK A;  1OO9 B;  2UUB L;  1RJR A;  5I47 A;  2R7N A;  4HCS A;  3CC2 A;  3GTJ B;  2XSC A;  2V4R A;  3KHH A;  1E2V A;  4PV1 C;  4BY1 H;  4JI4 H;  1VDZ A;  4HIM A;  2YS7 A;  2ZT9 C;  3Q8D A;  3D3R A;  1DZ1 A;  3BAA A;  3Q8R B;  3SK8 A;  4A76 A;  4EEY A;  1CKN A;  2AQ1 B;  3H0G H;  4LF5 H;  2YYZ A;  1JMC A;  2ATL A;  3T16 A;  5GON F;  5D1P A;  3J81 c;  2R8K A;  1EY8 A;  3CHB D;  5ELC A;  1C30 A;  3CCQ A;  3DF7 A;  4TV9 F;  3PUX A;  3MR2 A;  1I94 H;  4G7O C;  2DPI A;  3RZD H;  4POG A;  1X3Q A;  4JI8 H;  5LL6 S;  1EIY B;  3J80 L;  3E3X A;  2MCT A;  2KQ3 A;  1EY4 A;  1Q8I A;  2KCM A;  5AJ3 Q;  3RTX A;  4LF4 Q;  5C44 B;  1IZ6 A;  3Q23 A;  1LM0 A;  1F2L A;  3SE7 A;  4A3I G;  2NVT H;  2EVB A;  3RB6 A;  3C2P A;  5D3D A;  2VUG A;  2CQA A;  2VPQ A;  4DK6 C;  3OWE B;  3CPF A;  4R4T A;  4BBS B;  1IOW A;  3RBD A;  3ERS X;  3CCV A;  1ICF B;  1XMQ Q;  2O03 A;  4OEM B;  4GZY C;  3UDI A;  5J22 A;  4JI3 H;  2VUM H;  1CS0 A;  3I55 A;  2NTS A;  1PYW D;  2F0G A;  5FLX W;  4N9P A;  2HHH H;  2UUA L;  4IZ8 A;  2WB1 B;  3AU7 A;  4RNO A;  1BQQ T;  1EUJ A;  2RSO A;  1HZC A;  1TS5 A;  1SE2 A;  3R8B A;  4ECU A;  5J2T F;  1JWU D;  2VA2 A;  3OYY A;  5LMU Q;  2UXB Q;  1A15 A;  3BQ2 A;  3RUP A;  4Q45 A;  2ZTE A;  2PBZ A;  1EIH A;  3GIM A;  1PTO H;  4UPA A;  4DV2 Q;  2F0N A;  4P72 A;  2KJX A;  4E6I A;  1SYF A;  3BVM A;  3JRW A;  4IRK A;  4JBK A;  4DPG A;  4HID A;  1EYZ A;  4JI0 L;  3RF2 A;  3DUZ A;  4CBV A;  1L0X B;  4K5V A;  4H13 C;  3W1B A;  1BUV T;  5M5W H;  2R7M A;  1WJJ A;  4QIW E;  3A7A B;  1UAP A;  2E76 C;  4S3S A;  1JOQ A;  2PQE A;  2QEJ C;  4JI6 L;  2WIN B;  2RA4 A;  1PFB A;  1AE2 A;  3E0J A;  4Q8E A;  2NZH A;  3JAM c;  2B29 A;  3HOV G;  3BJU A;  2RHS B;  2Z6K C;  2R6G A;  1PYB A;  5E4W C;  5KFU A;  3J7Z C;  5J2U F;  3M9O B;  1WCM G;  3A8I E;  1VQM A;  5JVH 3;  3M3Y H;  4DN4 M;  2BDN A;  3KUP A;  3DMU A;  4DAP A;  4DV3 L;  5K36 G;  1YEZ A;  1N36 L;  4ZKC B;  2JEI A;  3PO3 H;  2F0P A;  4IWY A;  3MEH A;  2RBM A;  1VCI A;  1BJT A;  2AWN A;  1J5E L;  1IBK Q;  4IJH A;  3MZ5 A;  3TP7 A;  4DA2 A;  3RLN A;  1SNP A;  1EIG A;  1WTX A;  4OON A;  2NN6 I;  2JA7 B;  1KLG D;  1FNU A;  5C1P A;  1SDF A;  5L1L A;  4WOR A;  3S1M B;  1N56 A;  4B3M Q;  3UQ8 A;  1X65 A;  3BDL A;  4RMF A;  2VR1 A;  4RB1 A;  3OW7 A;  1S0M A;  2HDL A;  4C2M A;  3PO2 B;  1DD2 A;  1BBX C;  5KFW A;  4A3B B;  4FVM A;  5IT9 E;  4YR0 A;  1TWF A;  1KBL A;  2FLP A;  3ULJ A;  1Y8P B;  4EBD A;  3FHW A;  5FLX L;  3H40 A;  4EYI B;  4A3J B;  2P0A A;  1HNX Q;  1HR0 Q;  2SDF A;  2W6N A;  5JOB A;  4UY8 C;  1I3Q H;  4LF6 L;  1R9T A;  4DR7 H;  2HUG A;  1N32 L;  4IUV A;  1VQG A;  1O80 A;  4GLA C;  4P75 A;  2XTI A;  2YW2 A;  2AGP A;  5EQ0 A;  4AYB G;  1SJE D;  3HOW H;  3T1Y H;  4OO1 I;  1EEI D;  5D3I B;  4DL2 A;  5D8D A;  2IX0 A;  2RSN A;  1HZ9 A;  3ULP A;  4IUN A;  4TKO B;  4DV6 H;  3RB0 A;  2BQU A;  1STB A;  1B53 A;  4G7Z C;  5KFI A;  1TWG A;  3MC0 B;  2IJ0 A;  4DV0 Q;  3N41 B;  4DV1 H;  3GIP A;  1K1Q A;  2ASB A;  5JVL A;  3A8K E;  1NNX A;  2JQO A;  3KTM A;  4CDE C;  3ERO A;  4JI2 Q;  2A6E D;  4J9M A;  3QOL A;  2V59 A;  1RK5 A;  4KTA A;  3J81 W;  2I5H A;  4JUZ A;  4JV5 L;  4RNN A;  3M9M B;  5IY0 A;  3HKZ E;  2C22 A;  1SSO A;  3PIO A;  2YZN A;  1CZG A;  4V19 0;  3I4N G;  4FF3 A;  4BXX H;  1RCV D;  4DUY H;  3DXJ C;  2FPI B;  3WO0 A;  3KF8 A;  5C0X I;  4A3F H;  4X3T A;  1B70 B;  1PH7 A;  1JKJ B;  3CCJ A;  1SXT A;  3KAK A;  1CFM A;  5JPN C;  1Y69 U;  2A6E C;  1QUQ B;  2OTL A;  1WFQ A;  1EZ6 A;  3GTM B;  1SYD A;  1K83 B;  4CJ0 B;  1KXL A;  4O42 A;  3V4S A;  1GKH A;  1R9T B;  2YCH A;  1RKN A;  2IHF A;  2XN9 C;  3V6H A;  3GTO B;  4X64 Q;  4UHV A;  1WTW A;  1SNO A;  1IBL L;  1I6H B;  5C1O A;  3PVX A;  4LFA Q;  1U9R A;  3GTG A;  2XGP A;  5ELD A;  4BBR G;  2I5L X;  3U58 A;  1OXU A;  4PQX A;  1JDE A;  2KBN A;  1KDA A;  2K04 A;  3HS0 C;  3Q2O A;  2Q8I B;  4G7H C;  3IL8 A;  1N8R C;  1TWH A;  4YCU A;  4LH7 A;  4WD3 A;  2W9B B;  2NVX H;  1JWM D;  1F2M A;  1J6Q A;  4MV1 A;  3MWY W;  2MUY A;  5KNC A;  4QB4 A;  1TWC A;  1SNQ A;  5DGA A;  3TIG A;  2L0C A;  2YU9 B;  3Q8S B;  2K14 A;  4DNI A;  1KD1 C;  1KNA A;  3VPB A;  2B63 H;  3SK4 A;  3N42 B;  1K9M C;  2YS6 A;  3F2U A;  2L15 A;  1IKL A;  1LYL A;  3QB3 A;  2MO0 A;  3GTJ H;  3ORR A;  4UFZ A;  1I4R A;  3P75 A;  4PZ6 A;  2J6S A;  4FXD A;  2OXP A;  3KOJ A;  1XMO Q;  1HFG A;  2EE1 A;  2N8N A;  3OSO A;  2QYZ A;  4LF4 H;  5IYB G;  3JAM W;  1N34 Q;  3I4M G;  2ASD A;  2JA6 B;  3S17 B;  4WJW A;  1MBY A;  4DR5 L;  4YQW A;  2KA7 A;  1GUS A;  2B8G A;  3CF5 A;  3W3A A;  1GJX A;  3KLS X;  1GUW A;  5K2M A;  5CV8 A;  3MXU A;  4A3E B;  4R4Q A;  4XTC S;  1VMC A;  4ZUJ A;  2P5Z X;  2VZA A;  1IL8 A;  3LX0 A;  3E9H A;  4IUR A;  1ZXT A;  3OW2 A;  1A3T A;  1TWA H;  2KHJ A;  2YV5 A;  4U67 3;  1YIT A;  1XMQ H;  1STG A;  2XC9 A;  3KAL A;  3NHH A;  4QW8 A;  4IUP A;  2BE5 D;  4LUZ A;  3NGD A;  1HTP A;  3EQL C;  1YJW A;  4FBT A;  1F9S A;  4DF7 A;  3S14 B;  2W6P A;  5IWA L;  1B44 D;  3RD4 A;  2R93 A;  1C0A A;  3NUC A;  3HXL A;  1ZQ7 A;  2HDM A;  2FKL A;  4ECS A;  5JVG 3;  4LF5 L;  1NJI C;  3GII A;  1MD2 D;  1PFS A;  5LMU H;  2UXB H;  1WI5 A;  1TAE A;  1ESR A;  1QOH A;  1C3O A;  2BA1 A;  2AWO A;  4RWS C;  4WBN F;  1SE4 A;  2IW3 A;  1WYD A;  3MFG A;  3WOF A;  4DV2 H;  3BVG A;  1NMF A;  2BE5 C;  1U4P A;  3F1Z A;  4JI8 L;  4OX9 Q;  3KDF A;  4EGJ A;  3E5S A;  2AGO A;  1D6E C;  3GP7 A;  4A3G B;  1EY7 A;  2TSS A;  3BVZ A;  4F7X A;  2XCA A;  1EYC A;  4J15 A;  4HJ8 A;  4J9K A;  3A8J E;  1Y1V G;  5K36 H;  3AEV A;  4L5R C;  1CQI B;  3LML A;  2R8I A;  4I4T F;  3I4L A;  5KGU A;  3MWE A;  2F4V L;  2CQO A;  2K5Q A;  3D0F A;  1X9N A;  1PH6 A;  2WKC A;  1OXS C;  2J6T A;  3Q8P B;  2B2T C;  3H0G A;  1ENC A;  3ETH A;  5L1J A;  4DL7 A;  4GOP A;  3MFI A;  1Q8K A;  5FO8 B;  4QMG A;  1QB5 D;  1U0L A;  4HJ5 A;  4GKK L;  5LYJ F;  3BDC A;  2K28 A;  5KEE A;  1EYD A;  2WB1 E;  3G6V A;  2R93 B;  2MP1 A;  1IBK H;  3KHL A;  2DGY A;  3ONA B;  1HH2 P;  3LWU A;  4APV A;  1TII D;  2NU8 B;  1F9Q A;  3I8Z A;  4ECV A;  1G29 1;  4IFD G;  3QIA A;  2A1A A;  1M0T A;  4LNQ A;  4RAZ A;  2Q2I A;  4TQR A;  2HQL A;  4C56 C;  4O4L F;  4APM A;  4IOC A;  3NBH B;  4BWG B;  4POF A;  2DY7 A;  4B3M H;  4YAK B;  1FNW A;  2CQY A;  1GUN A;  3J81 i;  3M4I A;  5IYZ F;  3SGI A;  1F2Z A;  5KFB A;  2VUM A;  1PLF A;  1I50 A;  1I7N A;  1N33 Q;  4MTK A;  5M5X H;  2FMC A;  1IYU A;  1HNX H;  4JW0 A;  3S16 B;  1HR0 H;  3FP9 A;  4O1N A;  3K0X A;  2Y0S G;  4OEL B;  2JEB I;  1PTO F;  5DG9 A;  4O3Q A;  1QZG A;  1S4Z A;  4J9P A;  2V4D A;  3E6Z X;  5ELN A;  1PZJ D;  2GPS A;  1GLV A;  5GAH C;  4MZ9 A;  1T5X D;  2AHO B;  2XGT A;  1EIF A;  5IGC A;  3F2C A;  1G2T A;  3KJP A;  1JCK B;  5BR8 Q;  4DV0 H;  4BY1 G;  1S40 A;  4QCL A;  4C3H H;  2V4Q A;  2I5M X;  1CKO A;  5KIX A;  3J80 E;  4GC7 A;  5M5Y H;  3DM3 A;  1E1T A;  4P71 A;  5F9L A;  4HYK A;  2L5T A;  4JI2 H;  4CKC A;  3HOY G;  1XNR Q;  4HJ9 A;  2XVS A;  3OHB A;  4KY5 A;  2W57 A;  2HQE A;  4LAA A;  4Y7N H;  4O4I F;  2BH8 A;  2ZTC A;  1K28 A;  1YZ6 A;  1WSC A;  2HIX A;  5KNB A;  3D6W A;  4NW2 A;  4DV5 L;  3NBI A;  3KLS A;  3TIN A;  1X32 A;  2RKS A;  5CAE B;  1S10 A;  3CVZ A;  3NQT A;  1PRT B;  1CM9 A;  4BBR H;  3A54 A;  1I50 B;  2UXC Q;  1U4M A;  4KKS A;  1VAJ A;  2RDI A;  1A0I A;  1CK1 A;  4TUY F;  2FMM A;  2WP8 J;  1VQ4 A;  5IYD G;  1W6K A;  2RHQ B;  1FD7 D;  3HOZ B;  2IA6 A;  1KL9 A;  2R86 A;  4LWC A;  1D5Z C;  1AW7 A;  4B3T L;  2E2H H;  3JAM i;  4BY7 G;  4LFA H;  4DV6 L;  1DON A;  4A3K G;  1HNW Q;  3S1N B;  3PW0 A;  2F0H A;  5G3L D;  1NTG A;  2WAQ B;  4DXF A;  3KHR A;  3J7A V;  5I2Y A;  2I80 A;  2K03 A;  5KFX A;  1VBH A;  1V9P A;  2H1E A;  3GTM H;  4IZO A;  3K3P A;  3NE5 B;  3HOU H;  2KCT A;  2IX1 A;  2ZJT A;  2C28 A;  1CHQ D;  2K01 A;  4YHH Q;  2J7Z A;  5JUM A;  4JBM A;  2MQH A;  5IOC A;  1C8C A;  1I3Q A;  4HTH A;  3RB3 A;  3C0F B;  5IYB H;  3I4M H;  1UNS A;  1E4G T;  3ORQ A;  3DWA A;  1JXL A;  4DUY L;  3GTQ A;  3TP6 A;  4ZQI A;  4IHJ F;  5JEA J;  2Q2H A;  3L3O C;  1UEA B;  2BOS A;  1AH9 A;  3I2Z A;  4OGQ C;  3MA2 B;  4DFA A;  2PN1 A;  2ZM6 L;  3MFH A;  5KFC A;  1ZKO A;  1NUC A;  4KHV A;  2K4K A;  5DNF A;  5BN3 A;  3W1G A;  4KKT A;  1Y1W B;  2F3W A;  4LFC Q;  4EX5 A;  1XMO H;  3PN1 A;  3MHB A;  1N34 H;  1QJO A;  2B2V C;  4DV4 L;  2YRX A;  4F4Y A;  4X66 Q;  4ECZ A;  2CH4 W;  1VQC A;  3H94 A;  2R7Z G;  1J8I A;  3RV4 A;  2PZW A;  2NYZ D;  1IKM A;  4JI1 L;  3G6E A;  3T5K A;  5E4X A;  5C5L A;  1ET6 A;  4ED6 A;  3OUU A;  4GKJ Q;  3Q24 A;  5H80 A;  4IO9 A;  3DEO A;  3S2H B;  1H9J A;  3T1H H;  1YHA A;  1Q1B A;  1QIL A;  4LFB Q;  1BR9 A;  4J9R A;  4O0A A;  4XQN A;  2ICE C;  2F0S A;  3BG3 A;  1Y1V H;  3S1Q B;  1SMX A;  4DUZ L;  4C5A A;  1TQO A;  3C1E A;  1PRT D;  3WWV A;  1G6P A;  5M3M H;  1TR5 A;  1K73 C;  4LSX A;  3GTQ B;  2EY1 A;  3KYH C;  2JK8 A;  1DOM A;  1LTA D;  4OX9 H;  4X65 Q;  3HEJ A;  1EOT A;  3I70 A;  1C7Y A;  5KFP A;  1KAW A;  4MV7 A;  2A69 D;  5KYI A;  4XT1 B;  3U4Z A;  3SEB A;  3BDO A;  1EWC A;  4LF4 L;  1CZW A;  3OWF A;  3T5J A;  3EPI A;  2RDF A;  5AFW A;  1SNC A;  5C0X J;  1I6U A;  2NVQ B;  4QWE A;  4RAU C;  2ATW A;  2O4X A;  4MV4 A;  3VR4 A;  3GV7 B;  3M4P A;  1VQA A;  1PRT C;  2NVX A;  3TN2 A;  5IOD A;  3FKI G;  3PCO B;  3TBI B;  4RA8 A;  3PUV A;  1EOV A;  2E74 C;  3DWP A;  3HOW G;  5GAD C;  2DZD A;  2JYO A;  1WD1 A;  2NVY A;  1I4P A;  1K8A C;  2Z0S A;  1BGW A;  2PVP A;  4RZR A;  1DYQ A;  2A69 C;  4QY7 A;  5C4X B;  4WRD A;  5M3F B;  1DV1 A;  1VBG A;  3RGX A;  5KT6 A;  3W5O A;  3H3V H;  1FJG Q;  1S5F D;  1WTO A;  1DJR D;  1KJ9 A;  2R92 G;  4O2D A;  4I65 A;  3GID A;  4JI7 L;  4A93 H;  5DLQ E;  2PI2 A;  3FRP B;  2JE6 I;  1B6R A;  1QCB D;  2KSW A;  3H09 A;  5DG8 A;  2DWC A;  2RF4 A;  1FYC A;  4KJO A;  4LK1 C;  4X62 L;  1QNU A;  5LMU L;  1VQL A;  4TQU S;  1M4V A;  5KFJ A;  4X3K A;  3UE0 A;  1A62 A;  2YYA A;  2EY6 A;  2I87 A;  2R82 A;  3UDX A;  4DV2 L;  4BXX G;  5C3E H;  2C2E A;  3IKJ A;  3STB D;  5A2Q L;  1JJG A;  1UE5 A;  1ZYR D;  4A4I A;  1SEI A;  1CTM A;  1JX4 A;  2SNM A;  1ENF A;  3N43 B;  4EQO A;  4A3F G;  2ZDG A;  1NY4 A;  2JA5 H;  1TWA A;  4L63 B;  5DQI A;  2UUC L;  5C3X A;  2W7O A;  1F77 A;  1MHW C;  1N33 H;  3RUZ A;  5KFY A;  1Z2O X;  1W2B A;  3MVV A;  4R8U B;  4ZCK A;  5J1Z A;  1JIC A;  2M00 A;  3STB C;  4J1M A;  2B3G A;  1VF5 C;  3PW7 A;  4M1U B;  1GVP A;  1KEE A;  1ILQ A;  1ZYR C;  1V1P B;  3GTP A;  2NVY B;  1VQD A;  2F0I A;  3CCU A;  2QEX A;  3HOY H;  1UE6 A;  2Z4I A;  3SR1 A;  2HD3 A;  2R85 A;  2VA3 A;  4U68 A;  5L1K A;  2E5L L;  4CC5 A;  5JH7 F;  3K7A H;  4M8A A;  1T94 A;  4A3I B;  4LF9 L;  5BR8 H;  2F0E A;  4OWW B;  1WCM A;  1RL2 A;  2B2U C;  1IBK L;  1GOZ A;  4DR3 Q;  4IPG A;  2BQ3 A;  1W93 A;  3TZD A;  4IAJ A;  4J9S A;  4A3M H;  2UXD L;  3KHG A;  3MJF A;  3T5H A;  4HR7 A;  3RZO B;  3VPC A;  3OTO Q;  5IGD A;  1G91 A;  3LWB A;  5IYD H;  1NSN S;  3A74 A;  3VR2 A;  5I6Y A;  2B63 G;  4LUV A;  2C9O A;  1B9M A;  3N6X A;  2PQA B;  1X6O A;  5JPM C;  4FF1 A;  4ECT A;  1YHB A;  4JOI A;  1QE6 A;  4BY7 H;  1PXU A;  2JA9 A;  2ASL A;  1EEF D;  4A3K H;  5KFS A;  5C4Z A;  2UXC H;  1LTS D;  2VS1 A;  1HNX L;  1HR0 L;  4L5T A;  4MV8 A;  5FO7 B;  1B9N A;  2R3Z A;  2UU9 L;  1LV9 A;  3MXN A;  5CYU A;  4YY3 Q;  4YWM A;  4MNO A;  3TSS A;  4AQY Q;  2AUJ D;  4DLK A;  3PR4 A;  1QVC A;  1L1O A;  4IR1 A;  1WVL A;  1FVI A;  2YTX A;  1CKN B;  3GTP B;  4UP9 A;  4HIK A;  4LF7 Q;  2PCF B;  3TS2 A;  4IFD I;  4EQP A;  2XCL A;  2X6L A;  2VQF L;  1HNW H;  2FXQ A;  4B3R L;  3GTL H;  3EVQ A;  2MHV A;  3L4J A;  2KCN A;  5KFT A;  2Z6B A;  3HOV B;  2MPM A;  5EPJ A;  4AYB A;  1BKB A;  4RGM A;  2N55 A;  2MO1 A;  3K8A A;  4C1N I;  5C44 G;  1ET9 A;  4RUC A;  1ASY A;  1SFO A;  5LMN Q;  3OMC A;  3J7A K;  4IJL A;  3LWE A;  2RGV A;  1KJI A;  4YHH H;  2F0F A;  2EJM A;  1K0R A;  1O7Z A;  3PIP A;  4DR2 L;  1VQJ A;  3DWQ A;  4IQZ A;  4ECX A;  2EYP A;  4RCN A;  3CCS A;  5CGK A;  2HCI A;  4HJA A;  3Q0A A;  1TXY A;  1C9O A;  2R7Z H;  2DLN A;  1EL0 A;  1WR2 A;  2NU6 B;  2JA8 H;  2SOB A;  3RJ0 A;  1A3U A;  2WB1 G;  2A68 D;  3VMM A;  5KFN A;  3RR5 A;  4C3I B;  2UUB Q;  3U50 C;  4OL7 A;  5DLF A;  5C4J H;  1S5E D;  3U9O A;  3TDQ A;  2XWB B;  5EPK A;  5JVD F;  4X66 H;  4U7C A;  1MI2 A;  3QWN A;  2PPB C;  4KHP Q;  4LFA L;  2L1B A;  3FDS A;  4DU9 A;  5DLG A;  5COR A;  1Q90 A;  4EYH B;  3FPU B;  3CQZ A;  3S24 A;  2WAQ E;  2B2Y A;  1RF2 D;  1DOL A;  1XXG A;  4I7Z C;  2A68 C;  1VQF A;  4J9N A;  4GKJ H;  4A3D H;  1OTC A;  1K1S A;  2KHI A;  1YHQ A;  2JJQ A;  4YIJ A;  1KNE A;  4K5W A;  5IT9 c;  2C00 A;  4LFB H;  3N8D A;  2F4I A;  3PR5 B;  1FGB D;  3A7L A;  3D4D A;  3BZD B;  4OWX B;  3FKI H;  1BNC A;  3CAM A;  2CFM A;  4F87 A;  2ID0 A;  2E2H A;  2R61 A;  2VQE L;  4NLG A;  1LT6 D;  3K5N A;  4X65 H;  3S2D H;  1Y8N B;  4EGQ A;  4G57 A;  3SHL A;  1SEB D;  2ES2 A;  2RDJ A;  3J81 j;  1HZA A;  4DL3 A;  4CKB A;  3I4N B;  3HBL A;  1A2T A;  1VQB A;  1HTL D;  2JA7 G;  1PYS B;  2FPP B;  2R92 H;  3GV5 B;  5A35 A;  2W6M A;  1HPC A;  4J8Q A;  2E2I H;  4GC6 A;  1Q3L A;  4UP7 A;  3FDT A;  4ZYS A;  1X55 A;  4ZHQ F;  2BA0 A;  1CQF A;  2PO4 A;  4DR4 L;  1NCV A;  1G6Z A;  1KAB A;  1JB7 A;  4C3J B;  3PO2 G;  2E2J H;  3K3V A;  3NK9 A;  3GTK H;  4A3B G;  2CKZ B;  3K0Y A;  5CA1 F;  2PW5 A;  5NUC A;  4P74 A;  1S68 A;  1S0N A;  4RAY A;  1VS0 A;  5KFQ A;  4C3H G;  1FJG H;  2HGS A;  3CKI B;  1CT1 D;  3S1R H;  5FD5 A;  1NMG A;  1MKH A;  4C2M B;  3T1H L;  2DIK A;  1EUD B;  1EQV A;  4R4I A;  4KHZ A;  4XYM B;  4MTD A;  1YNX A;  4UP8 A;  2Z8L A;  1TWF B;  4ZOL F;  4ED8 A;  4MV9 A;  4JI0 Q;  1H9R A;  3Q8Q B;  2VPS A;  4JBW A;  4RGN A;  4DV7 L;  4NXN L;  5KFE A;  2YRW A;  3IN5 A;  3PW2 A;  2D62 A;  3VYT A;  2M2L A;  4KKU A;  1UWV A;  3NQI A;  3RNU A;  2K5W A;  5KFD A;  1I6V C;  4JI5 L;  2XD4 A;  4KN7 C;  5I2X A;  2ZXP A;  3GV6 A;  2VXW A;  3RLF A;  1ROD A;  4EEQ A;  1EY9 A;  1Q1E A;  5DM7 3;  1ICW A;  1HXY D;  1TWG B;  2C35 B;  2QDB A;  4MN3 A;  4PG3 A;  4Q44 A;  1U4R A;  2WYO A;  4JYA L;  4DV3 Q;  4Q0F A;  1QZH A;  2D9U A;  1N36 Q;  5BMV F;  1GSO A;  1MJC A;  3AB9 A;  4MHE A;  4LF8 Q;  1S5C D;  2JEG A;  5FK9 C;  4HMJ A;  4DAM A;  3RGZ A;  1MIU A;  4GLV B;  3U4V A;  1J5E Q;  4CGY B;  1Y1V A;  1RTN A;  5KFV A;  3R5H A;  1HA6 A;  2K5N A;  1BVS A;  1S97 A;  2K75 A;  1KIX A;  1IBM L;  2MGS A;  2LKV A;  4XZ3 B;  1L0W A;  5BPF A;  3GIJ A;  3T53 B;  5I9P A;  5L1I A;  3Q1K A;  5DM6 3;  2A8V A;  3GLK A;  3M4O B;  1UC9 A;  4QQB X;  1JR0 D;  1STY A;  3KF8 B;  3OSN A;  3HOU G;  1JLL B;  2W70 A;  1WOC A;  4AIM A;  5FJ8 G;  1E4F T;  3PUZ A;  1B4O A;  1H9S A;  4GN3 B;  5KRU A;  2HT1 A;  1KJ8 A;  4DR3 H;  1PZI D;  3KXY T;  3TRE A;  3GDE A; 
#chains in the Genus database with same CATH homology
 1VQO A;  1HJP A;  3MXN B;  3PGZ A;  4P71 A;  3S15 H;  1X3F A;  4DAY B;  3RLO A;  3HOV G;  3HOY G;  4X64 L;  1XNR Q;  1L1O B;  4HJ9 A;  4GNX A;  3E9I A;  1SR3 A;  4Y7N H;  4LF7 L;  3I56 A;  2BH8 A;  2ZTC A;  4OXP A;  2F3I A;  1PH3 A;  3PUY A;  1VQ7 A;  2ZTD A;  1YZ6 A;  4LF6 Q;  3GO5 A;  1PV4 A;  2HIX A;  1N32 Q;  5HGQ A;  5IP9 G;  1JJ2 A;  4BA1 I;  1QVF A;  3HOY H;  2D0O A;  4DV5 L;  4K0K L;  3ICE A;  1VQ8 A;  1YVC A;  4DUY Q;  2YTY A;  2E8G A;  4A3L G;  5LMN L;  2N78 A;  1Y1W H;  1SRU A;  2E5L Q;  1CSQ A;  1HR0 W;  4WJ4 A;  4LF9 Q;  4BBR H;  4JI4 L;  4LF8 L;  2JEA I;  2UXC Q;  1A0I A;  1Q86 C;  5C44 H;  2WP8 J;  1VQ4 A;  5IYD G;  2RHQ B;  3J80 i;  1E22 A;  2PNH A;  1KL9 A;  4GN5 A;  3L7Z C;  2UXD Q;  2GN5 A;  1UE7 A;  5C4X G;  1Q12 A;  5M3F G;  4LWC A;  4NXM Q;  2OQ0 A;  4B3T L;  2E2H H;  4LUO A;  3TRZ A;  5HY6 A;  2PQA A;  5IP7 G;  3JAM i;  2K52 A;  3BZC A;  4BY7 G;  4JV5 Q;  4DV6 L;  5GRO A;  3AQQ A;  4A3K G;  3CW2 C;  1I94 L;  4BBS H;  1HNW Q;  2ZJQ A;  5JJK A;  1NTG A;  3M85 A;  2UUB L;  2V1C C;  3S2H H;  1XMO L;  1VQE A;  3CC2 A;  1V9P A;  4H02 A;  3GTM H;  1QUQ A;  4BY1 H;  3HOU H;  1N34 L;  2KCT A;  2IX1 A;  4HIM A;  3Q8D A;  3CP0 A;  3S1Q H;  4YHH Q;  2UU9 Q;  4GN4 B;  4JBM A;  2MQH A;  5M3M G;  1IYJ B;  4A76 A;  2UUA Q;  3DLL A;  1CKN A;  3CXC A;  4DR6 Q;  3GTQ H;  3K81 C;  3PUW A;  5IYB H;  3H0G H;  3I4M H;  2YYZ A;  1JMC A;  4DUY L;  2Q2T A;  1ASZ A;  3L0O A;  4LW1 A;  3L2P A;  5JEA J;  1NE3 A;  1VQI A;  2Q2H A;  3J81 c;  3CCQ A;  1AH9 A;  3I2Z A;  3PUX A;  2VL6 A;  2VQF Q;  1E3P A;  1IBL Q;  2UXC L;  4JI3 L;  3RZD H;  3PV0 A;  4B3R Q;  4POG A;  2ZM6 L;  3J7A 5;  3CC7 A;  1XPR A;  1EIY B;  2EIF A;  2EQS A;  2K4K A;  4A3J G;  3W1G A;  2VW9 A;  4EX5 A;  2HHH L;  4LFC Q;  4A3L H;  2NVQ H;  1KRT A;  2KCM A;  5AJ3 Q;  4LF4 Q;  3KJO A;  2KEN A;  4DV4 L;  4NXM L;  1IZ6 A;  3EIV A;  1PHJ A;  1HZB A;  4X66 Q;  1LM0 A;  1VQC A;  2R7Z G;  4JI6 Q;  2IY5 B;  4DR2 Q;  5C4X H;  4JI1 L;  4A3I G;  5M3F H;  3G6E A;  4OX9 L;  4A3G G;  3AFP A;  2NVT H;  1P16 A;  1IL2 A;  3K80 C;  2EXD A;  4DK6 C;  3CPF A;  4R4T A;  3KDF B;  3ERS X;  3CCV A;  1XMQ Q;  4GKJ Q;  4A93 G;  4IO9 A;  3UDI A;  2VUM H;  2VNU D;  3NEM A;  3IRB A;  3CME A;  3I55 A;  1Q46 A;  1YHA A;  1U5K A;  1Q1B A;  1FL0 A;  1KHI A;  1SRO A;  3EN2 A;  1Q81 C;  4LFB Q;  4JOI C;  4Y52 H;  2UUA L;  4O0A A;  4DR6 L;  1XJV A;  4L5S A;  3ULL A;  1Y1V H;  1SMX A;  1EUJ A;  5C3E G;  2JA7 H;  1HZC A;  4DUZ L;  1YI2 A;  5GAG C;  2ZJR A;  3OYY A;  3WWV A;  4DR5 Q;  3ZJY C;  5M3M H;  5LMU Q;  1K73 C;  3S1M H;  2UXB Q;  3BU2 A;  1G6P A;  1MJE A;  2ZTE A;  1JE5 A;  3KYH C;  2JK8 A;  2JA5 G;  3CC4 A;  1L1O C;  2IHE A;  1UEB A;  4UPA A;  4DV2 Q;  2OQK A;  4X65 Q;  4P72 A;  4GOP B;  1VQP A;  3PO2 H;  1C7Y A;  1KAW A;  4JBK A;  4JC0 A;  4DPG A;  3F2D A;  4A3B H;  4GS3 A;  4HID A;  3CCL A;  3U4Z A;  1SN8 A;  4JI0 L;  1PH1 A;  4LF4 L;  3W1B A;  5M5W H;  1WJJ A;  4QIW E;  4YCW A;  4X66 L;  3J80 c;  2F52 A;  5C0X J;  4A3J H;  1Q7Y C;  4JI6 L;  2ATW A;  5IWA Q;  3M4P A;  1VQA A;  1VQK A;  4PZ7 A;  1AE2 A;  3FKI G;  3NEL A;  3PCO B;  2LSS A;  2NVY H;  3PUV A;  1EOV A;  4DKA C;  3HOW G;  5GAD C;  2NZH A;  3JAM c;  1H95 A;  2B29 A;  4IPD A;  4QJF A;  3BJU A;  2RHS B;  1OXV A;  2Z6K C;  2R6G A;  1PYB A;  1AE3 A;  4AH6 A;  2Z0S A;  3J7Z C;  1K8A C;  1HNZ Q;  1WCM G;  4QY7 A;  4AYB E;  1XNQ Q;  4GKJ L;  1VQM A;  4P73 A;  1EYG A;  3CD6 A;  3M3Y H;  5IE8 A;  1DGS A;  4A3I H;  3CPW A;  2VQE Q;  1EWI A;  3CMA A;  3W5O A;  2OWO A;  3H3V H;  1FJG Q;  4IFD J;  3PSI A;  5K36 G;  4DV3 L;  1S72 A;  3GDE A;  3KF6 A;  1YEZ A;  1N36 L;  1N33 L;  4O2D A;  2R92 G;  4A3M G;  3PO3 H;  1RIP A;  4PMW A;  2A19 A;  1PH2 A;  4JI7 L;  4A93 H;  3AYH B;  2PI2 A;  5DLQ E;  1VQH A;  1V1Q A;  1VCI A;  2JE6 I;  2AWN A;  1J5E L;  2NN6 G;  4IJH A;  2RF4 A;  3TEH B;  4X62 L;  1IBK Q;  3G71 A;  3RZO H;  4DR7 L;  3RLN A;  5LMU L;  1NBW A;  1VQL A;  4BA2 I;  4TQU S;  3UE0 A;  4OON A;  1A62 A;  2NN6 I;  1CUK A;  1SE8 A;  3UDX A;  4DV2 L;  2F4V Q;  4BXX G;  5C3E H;  4OWT B;  3T1Y L;  2MNA A;  4DR4 Q;  3STB D;  1JJG A;  2Q2U A;  1UE5 A;  3UE1 A;  4A4I A;  4B3M Q;  1X65 A;  4RMF A;  4A3F G;  5BR8 L;  1NY4 A;  1M1K C;  4JCV E;  2JA5 H;  2UUC L;  2GVA A;  4DV1 L;  2PI2 E;  3F2B A;  2JA6 G;  3T1H Q;  3A5Z B;  4GKK Q;  3ULJ A;  1W2B A;  4GLX A;  1K83 H;  3M4Q A;  3FHW A;  3M9B A;  1XNR L;  5FJ8 H;  1R9T H;  3I7F A;  4A3E G;  1HNX Q;  1HR0 Q;  3HKS A;  4UY8 C;  1I3Q H;  4LF6 L;  3GTO H;  3GTP H;  3STB C;  2B3G A;  4GNX B;  1HNZ L;  1N32 L;  1GVP A;  1VQG A;  4DV7 Q;  4NXN Q;  1XNQ L;  4GLA C;  1N9W A;  1VQD A;  1BBW A;  1L2F A;  2RCN A;  2XTI A;  4P75 A;  2QEX A;  3CCU A;  3EBE A;  1I6H H;  1UE6 A;  4AYB G;  3HOW H;  1FJG L;  4OO1 I;  2OTJ A;  3HOV H;  4JI5 Q;  2IX0 A;  3KFU A;  2E5L L;  3K7A H;  1KC8 C;  1HZ9 A;  5IP9 H;  4DR1 Q;  1WCM H;  3ULP A;  4LF9 L;  3KF6 B;  1V43 A;  5IYC G;  4OWW B;  1VQ6 A;  3HOZ G;  4PZ8 A;  1RL2 A;  5GQO A;  1Z9F A;  3NEN A;  4DV0 Q;  1IBK L;  4DR3 Q;  4IPG A;  2ASB A;  3G48 A;  2R7F A;  3PF4 A;  2NZO A;  3TQY A;  4A3M H;  2UXD L;  3M7N A;  4JYA Q;  2JQO A;  1X3G A;  1OXX K;  4IPC A;  4JI2 Q;  2LXJ A;  1YBY A;  3OTO Q;  4A3C G;  4NPS A;  1Z47 A;  3CCR A;  5FLM G;  2I5H A;  1B7Y B;  5IYD H;  3A74 A;  1W3S A;  2YU9 H;  4JV5 L;  2B63 G;  5IY0 A;  4LUV A;  3HKZ E;  1HNW L;  3PIO A;  2PQA B;  1X6O A;  2JA8 G;  3F8T A;  3I4N G;  4BXX H;  1PH5 A;  2QA4 A;  1IBM Q;  5LMN W;  1Q82 C;  1YHB A;  4JOI A;  5IP7 H;  3CCM A;  2JA9 A;  5C0X I;  4BY7 H;  5E7N A;  1EQQ A;  4C3I H;  4A3F H;  1B70 B;  3KLW A;  4A3K H;  1PH7 A;  3CCJ A;  2VS1 A;  3RN5 A;  1HNX L;  4GOP C;  4L5T A;  1KQS A;  1EQR A;  1QUQ B;  4YHH L;  1HR0 L;  2OTL A;  2UU9 L;  1WFQ A;  4YY3 Q;  4YWM A;  4MNO A;  4AQY Q;  2ZJP A;  2JA6 H;  3S17 H;  2QGQ A;  1QVC A;  4NB3 A;  1X54 A;  1PVO A;  5FLX c;  1KXL A;  1L1O A;  1GKH A;  2IHF A;  1QVG A;  2AKW B;  2D0P A;  1FVI A;  2YTX A;  4A3E H;  4WJ3 M;  1CKN B;  4X64 Q;  2R93 G;  4UP9 A;  4HIK A;  4LF7 Q;  3TS2 A;  4IFD I;  1X3E A;  4DR1 L;  1JJC B;  3G4S A;  4YCV A;  2VQF L;  2FXQ A;  1IBL L;  1Y1W G;  4A3D G;  4LFA Q;  3GTL H;  4B3R L;  3PF5 A;  4TVA B;  4BBR G;  2HIV A;  2I5L X;  4DV5 Q;  1OXU A;  3U58 A;  3K7U C;  2DUD A;  2KBN A;  4DK3 C;  1BKB A;  1Y14 B;  4LFC L;  5GAE C;  1SFO H;  1LUZ A;  2MO1 A;  3K8A A;  4R4O A;  5C44 G;  4EQ5 A;  1N8R C;  1VQ9 A;  3S14 H;  1ASY A;  5LMN Q;  3JC6 6;  5AJ3 L;  4YCU A;  4IJL A;  2GVB A;  2YTV A;  4JI4 Q;  3OTO L;  2Z6K A;  2NVX H;  1J6Q A;  1K0R A;  2MFI A;  3PIP A;  4DR2 L;  4IPH A;  1VQJ A;  5ELO A;  3CCS A;  1CKM A;  3HKZ G;  1M90 C;  4LF5 Q;  4HJA A;  1TXY A;  2K14 A;  4DNI A;  1C9O A;  1KD1 C;  2R7Z H;  2CWP A;  2B63 H;  4B3T Q;  1XMQ L;  1YJN A;  1K9M C;  4JBJ A;  2L15 A;  1LYL A;  2CCZ A;  4ME3 A;  2MO0 A;  3GTJ H;  3H15 A;  4A3G H;  2JA8 H;  1I94 Q;  3AFQ A;  3I4N H;  2R7D A;  2WB1 G;  4PZ6 A;  4JI8 Q;  2N3S A;  3RR5 A;  1JT8 A;  4AQY L;  4LFB L;  2UUB Q;  3U50 C;  4R1J A;  3KOJ A;  5C4J H;  1XMO Q;  4MTN A;  2N8N A;  3VDY A;  5JEA G;  1VQN A;  4RG1 A;  5IYB G;  3H0G G;  1N34 Q;  3I4M G;  5JJL A;  2IT1 A;  4DR5 L;  2UXB L;  5J3B A;  4QGU A;  3CF5 A;  4C3J H;  3CQZ H;  4LFA L;  4KHP Q;  3A0J A;  4R4Q A;  4X65 L;  4XTC S;  3LGJ A;  3S24 A;  2VZA A;  2WAQ E;  3E9H A;  1PH8 A;  4R4C A;  4GNX C;  3OW2 A;  1TWA H;  1VQF A;  2KHJ A;  2YV5 A;  4FDB A;  4C2M H;  1YIT A;  1VQ5 A;  1BBU A;  4A3D H;  1E24 A;  1OTC A;  4LUZ A;  2KHI A;  1YHQ A;  2JJQ A;  1TWF H;  3B6Y A;  1XPO A;  3RN2 A;  3ER0 A;  1E1O A;  1YJW A;  4JI3 Q;  2ZM6 Q;  1YIJ A;  2R93 H;  5IT9 c;  1X56 A;  5IWA L;  1C0A A;  2HHH Q;  1CSP A;  3GD7 A;  3A5U A;  1E7Z A;  4ALP A;  4LF5 L;  1NJI C;  4XIG S;  1PFS A;  4DV4 Q;  1WI5 A;  4OO1 G;  2K5V A;  4A75 A;  4OWX B;  3FKI H;  3CAM A;  2CFM A;  2BA1 A;  2AWO A;  2ID0 A;  3BZK A;  1WYD A;  2VQE L;  4HIO A;  1NMF A;  4JI1 Q;  3F1Z A;  2VUM G;  3S2D H;  4JI8 L;  4OX9 Q;  1G51 A;  3KDF A;  2ES2 A;  3HOX G;  3J81 j;  1HZA A;  1TWG H;  1A63 A;  5JJI A;  2CWA A;  4KI0 A;  4J15 A;  4HJ8 A;  1PH4 A;  3HOU G;  1VQB A;  1Y1V G;  3D31 A;  1D7Q A;  2JA7 G;  1PYS B;  3S16 H;  2R92 H;  3AEV A;  4L5R C;  1P8L A;  3I4O A;  2I0Q A;  2E2I H;  4KHP L;  4UP7 A;  1UE1 A;  1X55 A;  2F4V L;  2BA0 A;  2CQO A;  1LTL A;  2Y0S E;  4DR4 L;  3D0F A;  1X9N A;  1PH6 A;  3UDG A;  4B3M L;  1OXS C;  1JB7 A;  4DUZ Q;  3PO2 G;  2E2J H;  3GTK H;  2WAQ G;  3DM3 A;  2CKZ B;  1K8G A;  4A3B G;  4P74 A;  5C0X G;  3M4O H;  4GOP A;  1VS0 A;  3CCE A;  3S1R H;  1Q8K A;  2H5X A;  1NMG A;  1MKH A;  1U0L A;  4HJ5 A;  3T1H L;  3E0E A;  4R4I A;  4B3S Q;  4GKK L;  4KHZ A;  1D8L A;  1K3R A;  1YNX A;  2LXK A;  2N49 A;  2WB1 E;  4UP8 A;  4IOA A;  4JI0 Q;  2DGY A;  4JBW A;  2AMC B;  1HH2 P;  1EFW A;  4APV A;  4DV7 L;  4NXN L;  2WFW A;  1G29 1;  2D62 A;  4IFD G;  2A1A A;  4LNQ A;  2Q2I A;  1UWV A;  2HQL A;  4KLK A;  3RNU A;  4IOC A;  3NBH B;  2PMZ E;  1A8V A;  4JI5 L;  4POF A;  3TS0 A;  2VY3 A;  3GTG H;  4JG2 A;  3RLF A;  3PO3 G;  3J81 i;  1FGU A;  3H3V I;  4DV0 L;  5H1S E;  4K0K Q;  2ALY B;  1GM5 A;  1IXR A;  1Q1E A;  1I50 H;  2K5H A;  2C35 B;  3SGI A;  1TWH H;  4DR3 L;  3HOX H;  4PG3 A;  4YWK A;  4QL5 A;  1SLJ A;  1PA6 A;  4JYA L;  4DV3 Q;  5EAY A;  1QZH A;  3HFZ B;  1N36 Q;  1N33 Q;  4JI2 L;  5IYC H;  3HOZ H;  5M5X H;  4HJ7 A;  1MJC A;  4JI7 Q;  1I5F A;  4LF8 Q;  3FP9 A;  4DAM A;  1MIU A;  1TWC H;  2OCE A;  3K0X A;  2Y0S G;  4GLV B;  3MEF A;  3U4V A;  3UDF A;  1J5E Q;  4X62 Q;  4DR7 Q;  2JEB I;  1OXT A;  1XTD A;  2K5N A;  1BVS A;  2K75 A;  1KIX A;  4BBS G;  1QZG A;  1PH9 A;  1IBM L;  2BH2 A;  4A3C H;  1L0W A;  5ELN A;  5FLM H;  3S1N H;  1T9H A;  5GAH C;  1GD7 A;  3T1Y Q;  4MZ9 A;  4B3S L;  2AHO B;  2A8V A;  2XGT A;  1XPU A;  4QQB X;  1EIF A;  3F2C A;  3KF8 B;  1GO3 E;  2K50 A;  4YWL A;  3KJP A;  4DV6 Q;  1KRS A;  5BR8 Q;  1YJ9 A;  4BY1 G;  1S40 A;  4L5Q A;  1B8A A;  4C3H H;  1WOC A;  4AIM A;  2I5M X;  1CKO A;  3PUZ A;  4GN3 B;  5FJ8 G;  4YY3 L;  2UUC Q;  2HT1 A;  4DV1 Q;  5M5Y H;  4X6A H;  3TRE A;  1O7I A;  1S3O A;  1E1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...