2JA8G

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja8G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja8G01
1HNXL 1VQ9A 1MKHA 1HR0W 2R6GA 2Z6KC 5GROA 4EQ5A 1CSQA 5HGQA 3PIOA 1HZAA 5M5WH 3RNUA 1HNZQ 4JI0Q 4DV6Q 3HOZH 1TWHH 3PF5A 3OW2A 4A3DG 3U50C 4HJ5A 4A3JH 3K80C 1VQOA 4LFAL 3ERSX 3KJOA 4GKKQ 2IX0A 3RLOA 1PH5A 4R4TA 4DUYL 2EIFA 5AJ3Q 1VQFA 1YJNA 4IFDJ 1U5KA 1V9PA 2IT1A 1YEZA 1MJCA 5E7NA 4B3MQ 4JI6Q 2AMCB 4GOPA 1HNWL 1L1OC 5HY6A 4A3DH 2AKWB 1Q12A 4UY8C 1IBKQ 1TWAH 1YHQA 4LWCA 3S1QH 2GVBA 2K5NA 3BU2A 2PMZE 1TWGH 1I3QH 4A4IA 1DGSA 2PQAA 4APVA 2LXJA 1YITA 4JYAL 1FJGL 4GN4B 1IBLL 4LF5Q 2IY5B 5GADC 1SRUA 4JC0A 1XNQL 2VQFL 2EQSA 4LF7L 4AIMA 4DUZL 4JI4Q 1SE8A 4OX9Q 1CUKA 2HIVA 1G51A 1EOVA 3J81c 5EAYA 4DV2L 2UUCL 3H3VI 1LTLA 1YNXA 2CWPA 4O0AA 2GN5A 3PGZA 2RHSB 4JOIC 2ZJQA 2XTIA 2JA6G 2HT1A 3GTMH 3KDFA 1E7ZA 1CKNA 2QEXA 1Q7YC 4A3GG 4DAYB 1NJIC 1A62A 1PH9A 2OWOA 5M3FG 1S72A 4OONA 3CPFA 4DR3L 1JE5A 4A3FG 1JJ2A 3PUYA 2JA6H 1MIUA 3VDYA 1NMGA 1YVCA 2YYZA 4A76A 4A3GH 1N33L 4JBJA 4NB3A 2VQEL 1WOCA 1KAWA 4DV1Q 4BBRG 3TRZA 4IOAA 5M3FH 4UP7A 3G4SA 4A3FH 4K0KL 2JA9A 2KHIA 3HKZG 2YU9H 4BY7G 4LF8L 1SROA 3UDFA 4LUOA 3CCRA 1PFSA 1KXLA 1T9HA 4PZ7A 5LMUQ 4LF4L 4UP8A 1X3EA 2PNHA 4P73A 3OYYA 4BBRH 2ZTEA 1NE3A 1VQ8A 2N8NA 1KL9A 1ASZA 4X65L 2ATWA 1VQGA 2HIXA 2ZM6Q 4BY7H 2UXBQ 1LM0A 4KLKA 3HOYH 1V1QA 2MO1A 2OTLA 1WFQA 1E1TA 1V43A 4FDBA 4X66L 4DKAC 5FLMG 1NY4A 3UDGA 3K0XA 1K83H 3PUVA 4OO1G 3S1NH 4YCVA 1Q1BA 2VUMH 1Y14B 2VL6A 1J5EL 1MJEA 3CCSA 4DR6L 4JV5Q 4WJ4A 2MFIA 3CCVA 4JI3L 3PO3G 2OQKA 3HOVG 4LNQA 2LXKA 3PSIA 4YY3L 4L5RC 5FLMH 3GTQH 4B3TL 2C35B 1SR3A 4YWMA 3AFQA 3KYHC 4LF6L 1VQIA 3OTOL 1QVFA 2CFMA 3CCQA 2ID0A 3PV0A 1AE3A 4AQYL 1WJJA 5IWAL 1P16A 4GNXB 4LW1A 3PO3H 3BZKA 3HOVH 2VNUD 5FJ8G 1N36L 5C44G 4Y52H 1IZ6A 1H95A 4LFBL 5ELOA 3W5OA 1XMQQ 3PUXA 1XJVA 1HH2P 4GOPC 4DV0Q 1Y1VG 2N3SA 1Y1WG 4AYBE 1B70B 2K50A 1JB7A 1NBWA 2Y0SE 3L0OA 4DR5Q 5FJ8H 1HR0Q 4QGUA 3G6EA 4GKJL 4PZ8A 4LFCL 4UP9A 1N34L 2E5LQ 1VQPA 2BH8A 3S1MH 4L5SA 1HZBA 1IBML 1YZ6A 5M3MG 4PZ6A 5LMNL 1Y1VH 5JJLA 1Y1WH 2MQHA 2FXQA 1VQCA 2Q2IA 2UU9L 3HOZG 4LUZA 1K3RA 3A74A 4P75A 1K8AC 2IX1A 2IHEA 3I2ZA 4A3JG 1N8RC 1Q46A 4MTNA 3U4ZA 3AYHB 5M3MH 4XIGS 1BBWA 5IYBG 1EIYB 1SMXA 4B3RQ 2OCEA 2K14A 2NZOA 4HJAA 3M7NA 3KF6B 4DV5L 2I5MX 1KRSA 1A63A 4IFDG 4RMFA 2KHJA 4JI1Q 4C3HH 4X64L 2BH2A 5C0XI 3RZOH 1N32Q 4LF9Q 4A3IG 3MXNB 1XNRQ 5K36G 4JBMA 3CCEA 5C4JH 5ELNA 5IYBH 3F2CA 4DV4Q 1VQ7A 1PH3A 2ES2A 4A3LG 4A93G 1PYBA 3TS2A 2HHHL 1UE6A 1I94Q 3CD6A 4DR1L 2UXCL 3T1HL 4GNXA 4P74A 2DGYA 4POGA 4X62Q 1BVSA 4JI5L 4A3IH 4BA2I 3JAMc 2JE6I 3T1YQ 3S15H 1KHIA 4A3MG 2VW9A 4GN3B 4A3LH 3PO2G 2R93G 1L1OB 5JEAG 1I5FA 1BBUA 1FGUA 1R9TH 1HNXQ 4A93H 2RF4A 3A0JA 3CMEA 1QVCA 1PH1A 2E2IH 1YJ9A 4HJ9A 4A3BH 2R7DA 5JEAJ 1IXRA 4LFAQ 4DR2L 3GTGH 4A3MH 1GVPA 1B7YB 2JEBI 1XMOL 4QQBX 3PO2H 2R93H 1OXXK 4DUYQ 5M5XH 2JA7G 2NZHA 1HNWQ 4DV3L 4OWTB 3UE1A 4DNIA 4KHPL 1QUQB 1UE1A 4HIDA 3LGJA 2E2HH 3KOJA 4J15A 4TQUS 4JI2L 4NXML 1TXYA 2B29A 3GTKH 1EYGA 3H15A 4QIWE 2E2JH 4X6AH 2JA7H 2JJQA 1W2BA 1E1OA 4NXNL 3CF5A 4HIOA 1VQAA 1NMFA 2JA5H 3EBEA 3UDIA 2Q2TA 4JYAQ 1K0RA 3ULJA 1FJGQ 1IBLQ 1VCIA 3PUWA 1J6QA 5DLQE 4MNOA 1XNQQ 3S2DH 4R4QA 2VQFQ 4LF7Q 4DUZQ 3WWVA 4OWXB 2Z6KA 2MO0A 3GTLH 1C9OA 4DV2Q 2D0OA 3IRBA 1C7YA 2UUCQ 3HOUH 4YHHL 3HOYG 3TQYA 3UE0A 1C0AA 1EWIA 1CKMA 1O7IA 1PH7A 2I5HA 4C3IH 2CWAA 3PF4A 2K5HA 2BA1A 2KCMA 4GN5A 2UUAL 2VUMG 3PUZA 3D31A 1GD7A 5J3BA 1QZHA 2MNAA 2I5LX 4B3SL 4GLAC 2GVAA 2BA0A 1JJCB 1X54A 1E3PA 3CC2A 1JJGA 4ME3A 1L1OA 4DR3Q 4JI7L 3S14H 4JI8L 1WI5A 4HJ7A 3K7AH 2B3GA 1N33Q 3CW2C 2VQEQ 1HZCA 3H3VH 3M85A 4YCWA 4IPDA 2NN6I 1YBYA 4YWLA 2I0QA 1Q1EA 3CC7A 4R4IA 4K0KQ 3NBHB 1JT8A 1OXUA 1XPOA 4LF8Q 4DV7L 3I4MG 2WAQE 1VQLA 2E8GA 1X55A 1M1KC 1QUQA 4LF4Q 3E9IA 1CSPA 2RCNA 1NTGA 3KJPA 1KIXA 2KCTA 4X65Q 4R1JA 5BR8L 1N9WA 4JOIA 3J80c 3ULPA 5GAEC 2R92G 3I4MH 1VQKA 4HIKA 2ASBA 1UWVA 4UPAA 4X66Q 1BKBA 3RN2A 4A3CG 4DAMA 4BXXG 4AYBG 2YTVA 1Q82C 1EUJA 3L2PA 3RZDH 5GQOA 2NVYH 3CQZH 3H0GH 2Y0SG 1J5EQ 4DR6Q 3EIVA 2VY3A 2F4VL 1JMCA 1YHBA 4JI3Q 1D8LA 2R92H 4L5QA 3D0FA 4DR7L 4YY3Q 4GOPB 2QA4A 2XGTA 4B3TQ 4A3CH 1FVIA 2F52A 2ZJRA 4BXXH 2UXDL 4DK3C 1PA6A 3F8TA 4DR4L 4LF6Q 3FP9A 4C2MH 3SGIA 3OTOQ 2V1CC 2YTYA 3BJUA 5IP7G 4GLVB 1YHAA 4AQYQ 5IWAQ 1X3GA 3UDXA 4GS3A 1YJWA 3J81j 3GTOH 2R7FA 1N36Q 1FL0A 4JI0L 2K75A 1HNZL 4DV6L 1WCMG 1E22A 3A5ZB 4IPGA 4RG1A 4LFBQ 4MZ9A 5IE8A 4JI1L 1IYJB 5C3EH 5IYDG 5IP7H 3ICEA 4GKKL 2JA5G 3DM3A 5JJKA 1Z47A 3CCMA 5AJ3L 1Q81C 4QJFA 1EFWA 1SN8A 1X56A 4B3ML 2A1AA 3M9BA 1AE2A 1GKHA 1P8LA 2HQLA 3J81i 4JI6L 3J7A5 3CPWA 4GKJQ 1WCMH 5IT9c 3B6YA 4LFCQ 2ZJPA 3S24A 2NVTH 2F3IA 1N34Q 1CKNB 1IBKL 2WP8J 1IBMQ 5IYDH 5LMNQ 3GDEA 2R7ZH 1EQRA 1W3SA 2WB1E 3FKIG 4LUVA 4NPSA 1XPRA 1SFOH 1SLJA 2LSSA 2UUBQ 1EIFA 2UU9Q 4KI0A 3STBC 4O2DA 3EN2A 3Q8DA 2OQ0A 3TREA 4A3BG 2YV5A 5IY0A 1OXTA 3S17H 5GAGC 3J7ZC 4LF5L 1X65A 5M5YH 2JQOA 3ZJYC 3HFZB 3FKIH 3K81C 4JI4L 4OX9L 4IJLA 2D0PA 3MEFA 3GTJH 2JK8A 3AEVA 4DK6C 4DV5Q 3JC66 5GAHC 1K73C 5LMNW 1VS0A 4X64Q 2NVXH 2ALYB 4BBSG 1WYDA 1OXSC 1VQDA 2YTXA 3E0EA 3K8AA 2CCZA 2Z0SA 1GM5A 4AH6A 5C0XG 1HZ9A 2HHHQ 3GTPH 3NELA 4QY7A 4DR1Q 3RN5A 3T1HQ 2QGQA 2UXCQ 1PHJA 2VZAA 3ULLA 3BZCA 4JBKA 4JCVE 4JI5Q 1IL2A 5C0XJ 3CAMA 2NVQH 4BBSH 5IP9G 3AFPA 1X6OA 1S40A 3RR5A 3M4QA 3RLNA 4DV1L 3HOUG 3M4OH 3KF6A 2A19A 3HKSA 4HIMA 1L2FA 3M3YH 1VQHA 4TVAB 4XTCS 3A5UA 3G71A 3W1BA 1KQSA 4H02A 4IPCA 1KC8C 4DR2Q 1Z9FA 5IP9H 1XMOQ 1G6PA 5LMUL 3CCLA 1VQNA 4IJHA 1PH2A 3CC4A 2CKZB 2N49A 5IYCG 4DV3Q 3S2HH 4WJ3M 4HJ8A 4OO1I 2JA8G 5FLXc 2ZM6L 3GD7A 1PYSB 1I50H 4KHPQ 4PMWA 2A8VA 2UXBL 4JI2Q 3F1ZA 4NXMQ 2CQOA 1TWCH 2IHFA 4YWKA 3J80i 2PI2E 1QVGA 3HOWG 2AWNA 2EXDA 3AQQA 4R4OA 4A3EG 1K9MC 2Q2UA 3CXCA 1LUZA 4L5TA 5IYCH 1RL2A 3L7ZC 3CP0A 4P72A 1OXVA 4NXNQ 2JA8H 4JV5L 1A8VA 2AHOB 3PIPA 1VQBA 3F2DA 4BY1G 2K52A 1PH6A 3CMAA 3GO5A 5H1SE 3HKZE 4C3JH 3HOWH 4A3EH 3KLWA 1X9NA 4IO9A 1HJPA 3STBD 1RIPA 1M90C 2WAQG 1A0IA 3I56A 4YHHQ 1YIJA 4P71A 4BY1H 4QL5A 4A3KG 3PCOB 4BA1I 2KBNA 4IPHA 2Q2HA 2ZTCA 2UUAQ 2K5VA 3HOXG 3H0GG 1TWFH 1XMQL 3F2BA 3I4NG 3I4OA 4IOCA 2VS1A 2WFWA 1VQ4A 4B3SQ 4DV0L 3K7UC 1UE7A 2N78A 4JI7Q 3U58A 4JI8Q 5C4XG 1G291 4A3KH 4DR5L 1YI2A 3FHWA 2H5XA 1HR0L 1AH9A 1Q86C 1E24A 4POFA 3CCUA 3HOXH 4R4CA 4GNXC 3S1RH 3I4NH 2K4KA 4JBWA 2E5LL 1KRTA 3CCJA 3U4VA 1KD1C 4ALPA 4A75A 2KENA 2PI2A 1OTCA 1U0LA 1VQMA 1XTDA 1B8AA 1Q8KA 1L0WA 5C4XH 1PH4A 1GO3E 4DV7Q 3S16H 1S3OA 2AWOA 2NN6G 3M4PA 4JG2A 4GLXA 1EQQA 1PH8A 3E9HA 4YCUA 5C3EG 1UEBA 1K8GA 1XPUA 1VQJA 3ER0A 4IFDI 4KHZA 2L15A 3JAMi 3I55A 2RHQB 4Y7NH 1VQ5A 4B3RL 5BR8Q 2PQAB 2DUDA 3TS0A 1UE5A 4PG3A 1CKOA 3I7FA 4EX5A 3G48A 4OWWB 3NEMA 1N32L 5C44H 4LF9L 2R7ZG 1PVOA 1X3FA 3KF8B 1XNRL 2B63G 3KFUA 3W1GA 1D7QA 4DV4L 2F4VQ 1I6HH 4DR7Q 2UUBL 3DLLA 1LYLA 3NENA 4DPGA 1I94L 3KDFB 5JJIA 1VQ6A 4X62L 2UXDQ 2WB1G 1PV4A 2D62A 3RLFA 3T1YL 2JEAI 2B63H 4OXPA 4DR4Q 2OTJA 2ZTDA 1VQEA 3TEHB 1ASYA 1QZGA
chains in the Genus database with same CATH superfamily
1VQ9A 1HR0W 2R7KA 2M05A 2OF1A 5KFBA 1CSQA 5HGQA 5EZYF 3RNUA 3HOZH 4JV0A 3A7AB 1CFMA 3P75A 5KYLA 3TZUA 5M5YB 4LFAL 1C30A 5JJZA 3ERSX 3GP7A 3KJOA 1RD9D 2NVYA 3BABA 4R4TA 5J1ZA 1VQFA 1B9MA 1V9PA 5E7NA 4PDBA 1QILA 4HQ6A 5HY6A 4A3DH 1LLRD 1Q12A 3VPDA 4AYBA 1YHQA 1ET6A 1GUTA 4C2MA 2F0OA 2J9GA 2UXBH 1IOWA 1I3QH 4JVZA 3C2PA 5C5MA 4APVA 2LXJA 4BBSB 1HRJA 1M8AA 1T36A 2OLSA 4A2AA 1WTWA 1IBLL 4M9UA 1WTVA 5G3LD 4XYOA 3OMGA 2JN4A 1FYCA 4ZRZA 1E4EA 4APMA 3GV7B 3BJYA 3KF8A 1J8IA 5EAYA 5JOBA 5JEAH 2IBKA 2F0LA 1YNXA 4IWXA 5C5JA 2SCUB 3ETJA 4EGJA 5KFPA 2QEXA 2QW7A 4DAYB 4MV8A 5J22A 3Q24A 1S97A 5KNBA 2KEEA 2K6AA 1S72A 1EFID 4OONA 3CPFA 5CV9A 5KG3A 1TWCB 2JA6H 1MIUA 1MSHA 2EYHA 2HCCA 1DIKA 1NMGA 1YVCA 2EY6A 4NB3A 1N33L 2NUAB 1WOCA 4DV0H 2KCCA 5M9OA 3SE7A 2OXPA 2BCOA 4ME5A 4BBRG 1W96A 4QWDA 3GTJA 4DR5H 4R8NA 3G4SA 4A3FH 2KHIA 1SROA 3GTGA 3CCRA 4C3JB 1UNNC 3HB9A 1PRTF 4G57A 1KL9A 4KKUA 2ZDGA 5D1OA 3J81E 2LFNA 2ZM6Q 4KLKA 5EBCA 2HVSA 1WFQA 1E1TA 4DKAC 1MZBA 1ZQ7A 5KFTA 1NY4A 1TQOA 3K0XA 4ID6A 2DY7A 3UDGA 1Q1BA 4HAEA 3JSNA 2EDGA 1Y14B 4EQPA 5IODA 4TUYF 2W8KA 4JI3L 1DOKA 3T13A 1X3PA 4YY3L 1AUVA 1TIID 3A8IE 4ZUIA 5FLMH 3I4NB 4YJ3F 1S5FD 1WH2A 4OO1H 4YWMA 2EE1A 2FLLA 3GTLA 4LF6L 2TSSA 5KIXA 2ID0A 4QWAA 2GPSA 4ECUA 3PO3H 4O1NA 2K04A 2VNUD 1S68A 4X62H 4Y52H 4EEYA 4BS9A 1XMQQ 3T5LA 3PUXA 1QJOA 3GLKA 1HH2P 3TIIA 4OL7A 4ABNA 2N3SA 2ICEC 1Y1WG 4AYBE 4G7HC 3VR2A 1GUGA 2K50A 3N6RA 1NBWA 1II3A 5FJ8H 1RODA 3LX0A 3QB3A 2AQ4A 1N34L 4L5SA 5JJLA 4RGTA 2W9BB 2MQHA 3D3RA 1HNWH 1PTOC 3U9OA 2UU9L 5BPFA 1CQJB 2RDHA 3HOZG 2HHHH 2XWBB 4J9KA 2IHEA 3N52A 2QF7A 2X6GA 2NU9B 4DR1H 3E0JA 4MTNA 1TWFA 1PTOH 1PFBA 2R8IA 5BMVF 3EPIA 4UCRA 3OSOA 5C6AA 2RDIA 3M7NA 3GV3A 1YNND 2I5MX 5ELDA 2F4IA 2WB1B 3KALA 3NSWA 2KHJA 4C3HH 3J80E 2BH2A 4K5WA 1CS0A 4LF7H 2YRWA 3MXNB 4ECRA 2E74C 1XNRQ 3K6OA 5K36G 1JOOA 5KFXA 5ELNA 1VQ7A 4A3LG 2UUCH 2ES2A 2FINB 3J7AV 2OEOA 1UE6A 3KUPA 1RJRA 4YAJB 4IFDH 4P74A 2PZUA 2WYOA 5C1PA 5KFNA 1TS2A 1BVSA 3NXWA 4A3IH 4RNOA 3PW2A 3T1YQ 2VPQA 2VW9A 2R93G 3OW7A 1L1OB 5EKIA 5JEAG 3RUZA 5EJWA 2RF4A 3A0JA 4HTHA 2FJ2A 1PH1A 2CW0D 3BZDB 3D4DA 2E2IH 4HJ9A 2R7DA 5EPLA 2VQEH 1B9NA 3TMEA 2PW7A 1RJPA 1ULZA 1S0OA 1O75A 2K03A 1GLVA 1ONLA 5EGTA 2V58A 5T1IA 1UC9A 1M0WA 2B2WC 1H9JA 3UE1A 4DNIA 1RTNA 3LWBA 4CC5A 4HIDA 4LF4H 3LGJA 5L9XA 2R7ZA 4DAPA 3GTKH 4XQQA 1EYGA 3H15A 3QOLA 2I46A 5KEEA 4UAIA 2QDLA 2IX3A 1E1OA 3CF5A 4HIOA 1NMFA 2Q2TA 2YCHA 1KDAA 2EY5A 1FJGQ 5DLQE 2O5JC 4DA2A 5C4HA 5ELEA 2B2YA 1J5EH 4DR6H 5M3FB 4N9PA 5I9OA 5DQHA 2DJFC 2YU9B 4DV2Q 2R84A 2NVXA 4YHHL 2PN1A 1PH7A 2A6HC 2CWAA 3PF4A 2KVMA 2K5HA 4U68A 2KCMA 2P0AA 1AN8A 5IGDA 4DU9A 1GD7A 2R85A 2PVPA 3H3VC 2GVAA 3HKZB 1X54A 3CC2A 3MR5A 1TWGA 1LTBD 4JI7L 1LTSD 3OWFA 2FK3A 3CVZA 2R7NA 1K83B 4RU9A 3S1NB 1Y69U 3CW2C 3H3VH 1A6XA 4YCWA 2EJGC 1BNZA 2DPIA 4EYIB 3M9MB 1EU3A 2NN6I 3VPCA 5ELCA 3CC7A 2Z4HA 2PQEA 3KHRA 4R4IA 4O3PA 4K0KQ 1JT8A 1XPOA 4UDUC 4DV7L 4LF8Q 1K8OA 5JAVA 1VQLA 4MTEA 4C1NK 5JVH3 4FF4A 3H6MA 4FBUA 1WVLA 1CZGA 1NUCA 3KK7A 4WORA 3PR5B 1SE3A 4XYLB 3HOVB 3VPBA 3I4MH 2OT2A 4HIKA 1TWCA 4X66Q 4DN4M 4J9OA 3MHBA 4DAMA 4BXXG 1PRTC 2J6UA 4K6LA 3L2PA 3RZDH 2UVWA 3H0GH 2QKIC 3EIVA 3V6HA 5D1PA 2A6EC 4TQSA 1ML0D 2R92H 4J9QA 4DR7L 3N42B 4NLGA 2XGTA 5D3IB 1HFNA 4B3TQ 4A3CH 4JV1A 1LT4D 3DMUA 4DK3C 4HEDA 1EY5A 3T5KA 4EGVA 2D2CC 4LK1C 4AQYQ 5IWAQ 1CQVA 1X3GA 1Q8IA 2VXWA 1N36Q 1GSOA 4MV7A 4JI5H 2K75A 5C4ZA 1HNZL 1PMRA 1WCMG 4DV6L 5M3MB 3R5HA 5KFYA 2NN6H 3URYA 4JI1L 1IYJB 2IL8A 2VB3X 5EWEA 1RHPA 4GKKL 2F3WA 5AJ3L 1EFWA 2K01A 1X56A 4ECXA 4HR7A 2A1AA 3M9BA 4KN4C 1P8LA 5EQ0A 4JI6L 4DR2H 4FF1A 3NBHA 4LFCQ 2PBZA 4RGMA 3U9SA 3TSSA 3NTHA 4ZK9B 1X3QA 4ZKCB 1IBKL 1IBMQ 5J2UF 5LMNQ 1W3SA 4HMIA 4LUVA 4DV3H 1SLJA 1EQTA 3F8NA 1TVXA 3TREA 5EWFA 4JI2H 3D8GA 3TP8A 3S17H 3S15B 3J81W 2L55A 3OHBA 5GAGC 3J7ZC 1STEA 1X65A 5KG6A 4PWQA 3BDOA 4CJ0B 1TR5A 3FKIH 2I87A 2J4XA 5KX5F 3RB0A 1Q3LA 4IJLA 3AEVA 3K5LA 1ZXTA 3JC66 5GAHC 3BA8A 2J0TD 5I6WA 5LMNW 4TQRA 4X64Q 4BBSG 3PO2B 3Q23A 3K8AA 1OXSC 3ORRA 4E4TA 4YR2A 1GM5A 4ULLA 1Y1VA 4F50A 4UCSA 4K5XA 4RH6A 4AH6A 3GTPH 1W6JA 1DZ1A 3NELA 2UXCQ 2E2HB 2KUMA 2XC9A 2HVRA 1PHJA 2VZAA 4R8UB 2DPJA 5L1KA 3CAMA 2WTFA 5KFWA 2PNRC 5DGAA 4B3SH 3AFPA 1S40A 2JA7B 3M4OH 5C0XH 3A8JE 4JI8H 3T16A 3VR3A 3M3YH 3SHLA 4TVAB 3A5UA 4XYQA 3S2DB 1KJ8A 3TN2A 4RWSC 1CTMA 5BN5A 3MXNA 1KC8C 4MV3A 1Z9FA 1XMOQ 4BWSC 2RA4A 1A9XA 4DL7A 3PZPA 2JEGA 4GZYC 2F0WA 4IUNA 4IJHA 2L9HA 3CC4A 2CKZB 2N49A 2F0JA 5IYCG 4FBTA 3S2HH 4RAUC 5FLXc 1UC8A 5IGEA 2UXBL 3OIQA 3RTXA 4PMWA 1S03G 5IGCA 4O3SA 1U4LA 1ICWA 4C3JG 2AWNA 1JCKB 3AQQA 2I8CA 1B44D 3J7AK 5KFFA 3K7AB 4NXNQ 1EYDA 2BE5D 2JA8H 2F0IA 2PZWA 3MFGA 4RZRA 5IT9L 2K05A 4MAMA 4U673 2ZXOA 3IKJA 2F0SA 4RB2C 3J80W 2F1MA 1ENAA 4IO9A 2AGOA 3STBD 1W93A 1M90C 1EY7A 1MGSA 1ZYRD 2Z6BA 2WE6A 5KG2A 5KFOA 3QZ8A 4NP5A 4QL5A 4BA1I 2D9UA 4IPHA 3EFXD 2N88A 3JRWA 3N8DA 4DR4H 4DNRB 1XXGA 2UUAQ 1MD2D 3H0GG 2W9CB 3I4NG 1CZWA 1JICA 3F2UA 3M7GA 3OMCA 2F3VA 2WFWA 4IOCA 4QF4A 4DV0L 1UE7A 4Q5VA 5CAEB 4JI0H 1QB5D 5KFMA 4DR5L 5IIFA 1YNJC 3N41B 2YS7A 1STAA 3VA7A 4R4CA 2NVYB 2SDFA 3H20A 1KRTA 4H13C 3RGXA 2VA3A 5HGTA 5KT6A 3OUZA 2UVVA 4A75A 2KENA 4B3MH 2YU9A 2PI2A 1OTCA 1U0LA 2F0TA 4EBDA 1B8AA 1Q8KA 1ENCA 1STHA 1GO3E 1GJXA 2AWOA 4GLXA 2NN6G 4RKLA 1TKWB 4AYBB 3BQ2A 2W6NA 2QDBA 4C2MB 2XGQA 5FPRA 1VQJA 3ER0A 4Q0YA 4KHZA 4B3RL 1B6SA 1E4GT 3CKIB 3TS0A 3K3PA 4PG3A 3GIKA 2A69D 4LF5H 1K83A 3NEMA 5C44H 4JI4H 1E4EB 3V6KA 3KF8B 2DZDA 2QYZA 1Y8NB 4EGQA 1JB3A 3DLLA 1GYFA 2R8KA 1QWYA 2NTSA 5KG0A 4QB4A 3J7AF 1VQ6A 4X62L 2UXDQ 2WB1G 3RLFA 2JA5B 2JEAI 1QG7A 3TEHB 5DM63 1ASYA 4YR3A 3WNZA 4IUTA 3NE5B 1R4QB 1EY0A 2Z6KC 4OIKA 4J9LA 3GV5B 1HZAA 5M5WH 1V1OA 3Q8RB 1TWHH 1HA5A 1NAPA 3U50C 3Q8PB 3K80C 1ESFA 1KDCA 2F0KA 3R93A 3GTJB 3S9WA 2IX0A 1PH5A 2EIFA 1ILQA 1KJ9A 1DV2A 1YJNA 4I7AA 1U5KA 1HNWL 4O2BF 3QO2A 1MJCA 2B39A 3SEBA 3WOFA 5BPHA 1KC7A 2YZMA 1B50A 5KFDA 4N9TA 1D1IA 1KNEA 2AKWB 1TY0A 5LMUH 2R8GA 1BGWA 3C1EA 4RB3C 4LWCA 3A8KE 2Y0SA 5F9LA 1C8CA 4A4IA 3I90A 4IR9A 1DGSA 3FRPB 2NYZD 1YITA 2W57A 4GN4B 3R8BA 1IOVA 2HGSA 2AQ3B 4JC0A 3WOEA 4P2CB 4ECTA 4ECQA 4LF7L 1VF5C 4JV5H 4MV4A 2B8GA 2V4DA 1CUKA 2HIVA 4OX9Q 1G2SA 1EOVA 2F0NA 2RDFA 1DV1A 1E2WA 2UUCL 3K5OA 2GN5A 1PDQA 4JOIC 3GTMH 4LF8H 2WDTA 1E7ZA 2PW5A 3HOUB 3PW5A 3KLSX 5JUMA 3UI2A 3DF7A 4RGNA 4RCOA 2OWOA 1AEXA 5M3FG 1EZ1A 3PR4A 4L63B 1JE5A 5EBDA 5CMDA 1JJ2A 3MFHA 3VDYA 5CORA 2YYZA 4A76A 4TSSA 1O7YA 2VQEL 1KAWA 1Z2NX 5KFSA 3RIZA 2HDMA 3TRZA 3BVZA 2RDGA 3NWTA 2YS6A 3HKZG 5IGGA 3UDFA 3HOWB 2E5LH 4F88A 3KAJA 1KXLA 4LF4L 4UP8A 1X3EA 4BBRH 1NE3A 1S5ED 4BY1B 5DNFA 2M2LA 1EIHA 2LS01 4IURA 2F0DA 4KJOA 4R8UA 2MO1A 1JWUD 3E3XA 1TWFB 2EYLA 2MP1A 2W8LA 1NSNS 1PTOF 2JA7A 1JWSD 1KJQA 4Z9CB 4WJ4A 1J5EL 4DR6L 1SMYC 4A3KB 4M7EA 2JYOA 1TT2A 3HOVG 1N32H 3HOXB 1BUVT 5GONF 4LFCH 1SR3A 3AFQA 3KYHC 4DV4H 3MA2B 3JAML 1QVFA 2CFMA 3CCQA 5C4XB 1KLUD 1AE3A 1I94H 5KT2A 1SJHD 4ED8A 4LW1A 1I50A 4FXGC 5C44G 4LFBL 5ELOA 3W5OA 2EYOA 4TV9F 3DM1A 5E1FA 1HNXH 3CRKC 4U7CA 4KN7C 3HGBA 1F9PA 2Y0SE 3L0OA 1HR0Q 2RSOA 2FLNA 2WKCA 1SYGA 1WD1A 1GUWA 3S1MH 1VQPA 2BH8A 1HZBA 4DUYH 5M3MG 5CGKA 1AZQA 2MGSA 1Y1WH 5JVLA 2FXQA 4Q8EA 4LUZA 1K3RA 3SE0A 5LHY1 2R7ZB 1ZHQA 3ND8A 1Q46A 4PV1C 2HJWA 3QOJA 3X3MA 3AYHB 3Q2OA 5F9NA 1BBWA 2RCFA 3HZXA 5IYBG 1SMXA 4EG0A 5I47A 3U9TA 2NZOA 5KFEA 1IKMA 1ESRA 2K7VA 4JYAH 4FP5D 1EUCB 2KQ3A 2C9OA 3RZOH 3BYTB 1XNQH 2EZVA 2VQFH 4LF9Q 3KAKA 4DUZH 4IFDJ 3F2CA 1K1SA 1CK1A 2NVXB 1FKAH 3IFTA 4O4HF 3CD6A 4GNXA 3TP5A 5KFUA 2DGYA 1EY4A 5CV4A 4JI5L 1AUXA 3S1QB 4BA2I 3JAMc 5K36H 2PYKA 1KHIA 4IHJF 1EY6A 3GTOA 1HTPA 1F2ZA 1TWGB 3NTIA 4GN3B 3PO2G 4A3LH 1FGUA 3H94A 4ZOLF 4DR3H 3MAQA 2I07B 3BYYB 4N8X1 1RYSA 1IXRA 4LFAQ 4DR2L 3GTGH 1GVPA 4CC6A 1PZJD 2R93H 1OXXK 1MHWC 1BCPC 2JA7G 4UCOA 4DV3L 2BQRA 2SOBA 3MWMA 3PIP3 3K5HA 2F0HA 1B53A 2MJ8A 4JI2L 4L6TB 4TQUS 4ECYA 3GIJA 2JA5A 2EYPA 1FNWA 1I7NA 4X65H 2E2JH 3MR3A 5EKLA 4X6AH 1W2BA 4EEQA 2EYMA 2B2VC 1KEEA 4A3GB 1IBLQ 3PUWA 1J6QA 2NBFA 4HSPA 2H4OA 4R4QA 2O03A 2B2UC 3WWVA 5DG8A 1PTOD 2DLNA 3MXUA 5FOBB 3OUUA 3V6JA 3GTLH 1XTCD 1B2TA 3HOUH 1CKMA 4UCTA 2I5HA 1R4PB 2A5HA 1G6ZA 3PUZA 3D31A 3OTOH 1BQQT 4F4YA 4HYKA 2I5LX 4B3SL 1HCZA 2UU9H 4BY7B 1M6VA 1JJGA 3OOCA 3S14H 4JI8L 4YJ2F 4C5BA 5I2XA 1FGBD 1CI3M 1N33Q 2VUMB 3M85A 4PNYA 4YWLA 4EQOA 3FPPA 3MTSA 4HR7B 4GKJH 3GTQB 3NBHB 1ICFB 3I4LA 2CQYA 1EEFD 1X55A 4H0LC 1QE6A 4QUFA 5D3DA 1G91A 1EUDB 4R1JA 4KY7A 1N9WA 1U9RA 5LL6X 3ULPA 2F0PA 5GAEC 5JPNC 2ASBA 1UWVA 4UPAA 4IAJA 2JA6A 1BKBA 3K58A 2K5DA 4RNNA 5EKKA 4AYBG 2YTVA 1Q82C 3CQZH 3KHLA 4DV5H 4YIJA 4DL4A 1JMCA 1YHBA 4JI3Q 4EQNA 4L5QA 3D0FA 5I6YA 4YY3Q 4GOPB 4ZQ3A 2QA4A 4F8MA 1FVIA 1SNPA 4BXXH 1Y1VB 1L0XB 2KECA 1PA6A 4DR4L 4LF6Q 3FP9A 2MCTA 3SGIA 1QOHA 1YHAA 1JQYD 2K1BA 1C48A 2Z9HA 1EYZA 3T1HH 1S9FA 1YJWA 3J81j 2R7FA 1FL0A 3AB9A 4JI0L 5IE8A 1C3OA 1ZHSA 3L9AX 4HCSA 1RYRA 2R8HA 3ND9A 2JA5G 5KG5A 1Q81C 4QJFA 3PW7A 4CDCC 2A6HD 4B3ML 1DOMA 1GKHA 1NCVA 1XWEA 1LTAD 4XQJA 2R86A 1WCMH 2RVLA 3S24A 4FF2A 5JQWA 2F3IA 4F7XA 1N34Q 3Q8QB 1CKNB 3V05A 2WP8J 2UVRA 2R7ZH 4K8JA 4V0BA 2C28A 2UU9Q 4F87A 1SFOH 1OWTA 3FDSA 4KI0A 4KHPH 5C8YF 4O2DA 1LACA 1EYAA 2B2YC 3SXHA 2YV5A 4NXMH 5IY0A 1A3VA 4ILWA 4ED2A 4KJNA 4LF5L 1PZKD 4Q43A 2HQEA 2R3ZA 2JQOA 5M5YH 4A93B 1JORA 3OPOA 3K81C 4JI4L 1PK8A 2CH4A 2LMCB 2WV6D 1F9RA 1WSCA 4HNVA 1D5XC 4HN7A 1HTLD 2NVXH 4A3MB 1HUNA 4QWBA 1JLLB 5I4DA 1WYDA 5M5XB 3ETHA 1DCZA 3RN5A 1EL0A 5C3WA 4O3NA 4X3KA 3FMCA 5IT9E 5C0XJ 1PRTD 4BBSH 4O2AF 1LO5D 4M1UB 3K5NA 5IP9G 3RR5A 3M4QA 4DV1L 2A6ED 3HOUG 5CBEE 4GC7A 2A19A 1L2FA 3HEJA 3VR6A 4K8IA 3E5NA 1JWMD 1KQSA 2XIWA 3IN5A 4DL2A 5LMUL 4QW8A 3SK8A 3CCLA 5KG7A 1PH2A 1A15A 3E5SA 3C3LA 5CYUA 1V1PA 1F9QA 3VR4A 1RDPD 1C4QA 4WJ3M 2XCLA 4C3IB 3GD7A 1TWAA 1A3TA 3F1ZA 1DXMA 1I4HA 1EQVA 1TWCH 3HOWG 4R8IA 5HBRB 4DGZA 4R4OA 1K9MC 1GUNA 2Q2UA 3HOYB 3CXCA 5BR8H 4JV5L 5IYCH 3L7ZC 3CP0A 1EY9A 3BS1A 1A8VA 3PIPA 4BWGB 2E2IA 4BY1G 1HR0H 4CDEC 2AGQA 3CMAA 1O80A 2ZDHA 1LABA 4C3JH 1TA8A 3RFCA 2PMZA 1GHKA 1VBHA 2G9DA 2DJGC 5L1LA 2F4VH 2WINB 2XCAA 4EVOA 3QIAA 1QNUA 4YHHQ 4P71A 2FMMA 4A3KG 4YAKB 2N55A 3DWAA 2KBNA 1F9SA 3H4DA 3EROA 2K5VA 3HOXG 3BVGA 1B33N 1VQ4A 4O4LF 4UFZA 4F4ZA 3TQ1A 2B2WA 1F2YA 4JI7Q 3L3OC 1SYBA 5C4XG 1G291 1YI2A 1AH9A 1Y8OB 1HPCA 1Q86C 5CBAE 1EIGA 1K3BC 3I4NH 4LF9H 4JBWA 4CBVA 2E5LL 5KT4A 1LTGD 2RSNA 3CCJA 4ALPA 4KK7A 4RZQA 2FK2A 1VQMA 1STGA 3N40P 2RGVA 4EFEA 4DV7Q 2VQDA 3M4PA 2FMCA 4JG2A 4LJZC 5LXTF 2O5IC 1BNCA 2C2RA 5L1IA 2Y0SB 3M4YA 1EWCA 1B1ZA 3I55A 4ODGA 5KFJA 1B3AA 1LT6D 5D65A 4KD3A 2IPKD 2VB2X 3G48A 5J39A 1N32L 2VUMA 2A73B 2R7ZG 1X3FA 3D6WA 4EBEA 4DV4L 5FLXL 4DR7Q 3GTQA 2EPBA 3SK5A 1LYLA 1I94L 2NVTB 2ASLA 5JJIA 5DLGA 4TV8F 4DF7A 4ECWA 2ZTDA 1VQEA 2IA6A 4RKBA 1HNXL 4RUCA 1MKHA 3NHHA 5CB4F 2R6GA 3T5HA 4EQ5A 4G4KA 3PIOA 1HNZQ 1N48A 4DV6Q 3PF5A 3OW2A 1M7JA 2IJ0A 2XGPA 2JXMB 4GKKQ 4A3BB 3RLOA 1D2BA 4U6PA 4DUYL 2Z4IA 5AJ3Q 2ZDQA 1CQIB 2YYAA 3NGDA 5E3FA 3SK4A 2IT1A 4EBCA 4JI6Q 4GOPA 2VUGA 1L1OC 2L11A 3R2TA 2ASDA 1IBKQ 4QWEA 4K2KA 3G6YA 5FD5A 2F0VA 5A2QE 4QW9A 2K5NA 3DEPA 2ZM6H 2PMZE 1XDNA 2E76C 3RAQA 3Q0AA 1YNJD 1H9MA 2PQAA 2NVQB 4JYAL 5FKAC 2ZJTA 3HXLA 5GADC 3KLRA 1XNQL 2VQFL 2EQSA 1SE2A 2F0MA 4AIMA 4DUZL 4F4XA 1TS4A 2KEDA 5KFKA 1Z6HA 2BDNA 3J81c 3OHAA 4UCVA 4ZHQF 1LTLA 5COYA 3OHXC 4KKTA 3PGZA 2RHSB 2ZJQA 5CV6A 4UCUA 3MJFA 3KDFA 3QR8A 2D5DA 1CKNA 1Q7YC 2ICIA 4A3GG 4MV9A 4JUZA 4FM9A 4NMZA 1NJIC 1RF2D 3HP3A 4ZUJA 1I50B 2IP4A 3RBEA 4DR3L 5EDWA 3PUYA 1WTPA 2F0EA 1XMQH 1GUSA 3KXYT 3RB6A 1S10A 4JBJA 3LNNA 1R9TA 5DG7A 2FFKB 1SYEA 1T5EA 3KLSA 3JAME 5CV8A 5M3FH 4K6DA 3W2DA 4DXFA 3I91A 4UP7A 1JR0D 1LTID 2JA9A 4BY7G 2YU9H 2YRXA 5LL6S 4ZQIA 4ZLTF 4YY3H 4A3EB 1RKNA 1PFSA 1T9HA 4ME6A 2PNHA 4P73A 1D5ZC 1VAJA 3OYYA 4J1MA 2N8NA 2E2DC 1ASZA 1AN7A 4X65L 3BVMA 4KV6A 3GTPA 1VQGA 1LTRD 2HIXA 2V5AA 2UXBQ 3HOYH 2YW2A 1V1QA 1V43A 4YQWA 4IR1A 4LH7A 1K83H 3PUVA 3S1NH 4YCVA 3V96A 1SNDA 3D6CA 3CCVA 2PO4A 5CC4A 5KFRA 3GIMA 2OQKA 1AW7A 3OIPA 4LNQA 1IYVA 2LXKA 3S1RB 3MXPA 1XNRH 3NQTA 3NUCA 1DONA 3TINA 3OTOL 3RUPA 4CDFC 3PV0A 3S16B 1P16A 3O13A 4GNXB 2W9AA 3G6VA 3HOVH 2F0UA 2P5ZX 1IZ6A 1S5BD 3T1YH 4I55F 1H9KA 3GTOB 1VBGA 1HQRD 3QFFA 2F0GA 2Q8IB 4Y7NB 1XJVA 1KJIA 1STBA 5IT9W 4DV0Q 2PZTA 1Y1VG 4O3OA 1E4FT 3WO0A 4DR5Q 3TDQA 5C3EB 4QGUA 3G6EA 1I6UA 5JVG3 4GKJL 4PZ8A 3MWDA 3G8CA 3K57A 3FMAA 1E2ZA 3MR6A 1I6HB 5DQGA 3CHBD 2OH2A 2Q2IA 1WTQA 2J6TA 4P75A 1GHJA 1K8AC 3OSNA 4IUPA 1D5MC 3R5FA 5KG4A 3I2ZA 3I70A 2B63B 4O42A 4ETSA 1SNMA 2CHBD 5M3MH 4QCLA 1BCPF 3DWPA 4XIGS 4B3RQ 2WAQA 2OCEA 1H9RA 2K14A 4HJAA 4K5VA 3KF6B 1SEBD 4JW0A 1A2TA 3T53B 3HOZB 1FJGH 4DV5L 1KRSA 2LY7A 1RK5A 2EYFA 4WBNF 1EZ6A 4IQZA 2X0SA 1VDZA 1I4PA 4LH6A 3EVQA 5KYIA 5IYBH 1UEAB 4DV2H 1PH3A 3MFYA 4A93G 2KJXA 2BQ3A 2HHHL 2EJMA 4A3DB 4DR1L 3T1HL 3FDTA 1JKJB 4X62Q 2VOBA 2JE6I 1CA6A 3GV8B 3S15H 2FE3A 3BDLA 4A3MG 4RB1A 4FO2A 1SMYD 5T14A 1I3QB 3AMUA 3CMEA 2PPBC 1B6RA 1BJTA 2VA2A 3NQIA 1YJ9A 4A3BH 3JZIA 2BR0A 5JEAJ 4RHRA 2DWCA 1NR4A 5K2MA 2JEBI 1B7YB 4QQBX 1GSAA 3Q8SB 3PO2H 2W6ZA 4YB8B 1GGOA 3PVXA 4K0KH 4IUQA 1HNWQ 4ED7A 4KHPL 1UE1A 2W71A 3V4SA 2E2HH 4NXML 1KBLA 1TXYA 3OWEB 3MXGA 4KTAA 2CH4W 1SNCA 1X32A 4QIWE 5HURA 2C00A 2JA7H 2X6LA 2JA6B 4X66H 1I4RA 5IGFA 1K0RA 3ULJA 2EOTA 4I65A 4C3IG 1TWHA 1TS3A 1VCIA 5A2QL 4FU0A 4PMCA 4MNOA 4IWYA 3S2DH 1JDEA 1EWHA 1S4ZA 4LF7Q 1BXRA 5KFGA 4EYHB 1KABA 5D14A 2Z6KA 5FD6A 4A3FB 1WTRA 2MO0A 4X3UA 2UUCQ 3HOYG 3TQYA 3UE0A 4IUUA 1EWIA 1C0AA 4B3TH 4CHTB 3MR2A 3C1FA 5E4XA 2L12A 5KFHA 2HDLA 5G3LF 4AQYH 3EQLC 5IWAH 4GLAC 4ZAIA 4QUCA 1JJCB 2VR1A 1IKLA 4ME3A 3GV6A 1N36H 1T94A 4J9RA 1WI5A 1I4XA 4HJ7A 3K7AH 1L0YB 2B3GA 1JIHA 2VQEQ 1HZCA 3PQIA 4IPDA 2FJZA 1LV9A 4FNFA 1EHIA 5A35A 2I0QA 4JV2A 3FVQA 1OXUA 2WAQE 1IBMH 2SNMA 1QUQA 4LF4Q 5LMNH 4ED6A 3BG3A 3EJIA 2EY1A 3CU7A 5K5PA 1KIXA 4HNUA 4R7RA 5IYZF 4LMQD 3PO3B 5BR8L 1RJQA 4JOIA 4ECZA 4H7BA 5A2QW 4ED3A 3T51B 2A74C 3RN2A 1IL8A 1XX8A 2GPWA 1EUJA 5GQOA 2NVYH 2FP4B 1BCPD 2Y0SG 1J5EQ 4DR6Q 4NKLA 1HFGA 2F4VL 3KBGA 3ITPA 4X64H 3W3AA 3Q6SA 1CA5A 3V4ZA 4Q44A 3OSPA 2EXZA 1MI2A 1O7LA 2DY8A 2K28A 4MN3A 5FO8B 2ZJRA 4YP3A 2ALZA 1LT5D 4C2MH 3RF2A 2V1CC 4NW2A 4B9XA 5IP7G 4CKBA 1BOSA 4GLVB 4CKCA 2UXCH 3GTOH 1B3QA 3VYSA 3T5JA 2HD3A 1PTOB 4RG1A 4LFBQ 2NTTA 1UNSA 4DL6A 4DFAA 3GILA 2K33A 5C3EH 5IYDG 2E75C 3DM3A 2Q8RE 4IUVA 5JJKA 1EOTA 4DLKA 1SN8A 4A3JB 4ED0A 4C3HB 1AE2A 2HQLA 1SAPA 3JAMW 3NK9A 4PQXA 3B6YA 1V4YA 1XMOH 2ZJPA 2R7LA 3RBDA 1GOZA 2G9HD 4I50F 1CT1D 2ZT9C 3BA9A 1V1PB 2JA5H 2UUBQ 4K14A 1XPRA 1SYCA 5KFVA 2R87A 2RGRA 1EIFA 4A3BG 1TWAB 2OQ0A 3LWEA 3MFIA 4A3IB 1OXTA 2IW3A 5FPOA 2C22A 2B2TA 2V59A 4NXNH 3GTJH 2D0PA 2E2IB 1VMCA 4C5CA 4MV1A 4FVMA 3MC0B 1D6EC 2M9VA 2PMZB 1FD7D 2ALYB 2DNCA 1IW7C 1SJED 5KFLA 3L4JA 1VQDA 3E0EA 2V9WA 1G2TA 5I9PA 1Y1WA 3N43B 1I4GA 1HZ9A 4QY7A 4RCNA 1ILPA 2UUAH 2B63A 1WD0A 4JI5Q 3GTKB 2MHVA 1PZID 2Z1CA 3GQBA 5FK9C 3HRZC 4Q45A 5NUCA 3KF6A 3HKSA 3R2IA 4TRDA 3V2TA 1U4RA 1LT3D 4MIUA 1VQHA 3PMFA 3R23A 1S0NA 3G71A 2ZXRA 3W1BA 5CR3A 4DR2Q 5IP9H 1G6PA 4XX0B 1D1KA 1VQNA 1BXTA 2CQAA 5JPMC 1AP0A 4XXEA 1JE4A 4DV3Q 4HJ8A 2AUJD 4OO1I 2EY2A 2ZM6L 4J9SA 1PYSB 2QEJC 1DM0B 4JI2Q 2CQOA 2A68C 4KY5A 2IHFA 4YWKA 2AU0A 1QVGA 4FS1A 4WD3A 2EXDA 4A3EG 2TMPA 1PXUA 1I3QA 1SBBB 4QMGA 4P72A 1HHVA 2QK4A 4JPBW 2JEJA 1VQBA 2LKVA 1PH6A 4DAVA 4FS2A 1L2ZA 1MSGA 3T4AC 5CA0F 3HOWH 4NDXA 1W6KA 3QWNA 3KLWA 2R93A 1X9NA 1HJPA 5ISRA 1RIPA 2XRQD 3QZ7A 5KFAA 3H91A 1YIJA 1ZEQX 4BY1H 3PCOB 5EPJA 2JP1A 2M00A 4UHVA 2UXDH 3DWQA 3D4RA 3IL8A 3A7LA 1Q90A 1QCBD 1XMQL 1TWFH 1VMPA 2RQXA 3I4OA 4B3SQ 3K7UC 5KFQA 3I4MB 4DL3A 4B3RH 3U58A 4JI8Q 4A3KH 5FLXE 2W7PA 2ASJA 3MWYW 2KOLA 2NU7B 3CCUA 3HOXH 3RZDB 3H0GB 2K4KA 3U4VA 1KD1C 1T3NA 2B2VA 1GUOA 2R92B 3RB4A 1J9OA 2HUGA 1XTDA 5C4XH 3PIO3 1PH4A 1PRTB 2CZGA 2H1EA 2B2UA 4YCUA 2W6OA 5C3EG 1UEBA 4I7ZC 1XPUA 2FPPB 4FXDA 4IFDI 2L15A 3JAMi 2RHQB 5EPKA 1K8MA 2W6QA 2QCPX 2PQAB 4HMJA 2DUDA 1UE5A 2Z8LA 3I7FA 4J8QA 2G5DA 4EX5A 4OWWB 1VKZA 2FMAA 2BDOA 5KT3A 3TBIB 3BQ0A 1PVOA 1IHZA 5FO7B 4OX9H 1XNRL 2B63G 3KFUA 2GLTA 3W1GA 2UVUA 1JC7A 1DOLA 5D8DA 1E2VA 5LYJF 4A2BA 4DPGA 1V8QA 3KDFB 2DN8A 3QG1A 5C4JB 2RDJA 4IRKA 1PV4A 2D62A 4DR4Q 3T1YL 2OTJA 3HBLA 4OXPA 4RA8A 1DJRD 1QZGA 1E0BA 1SDFA 2J7ZA 1STYA 5GROA 3LMLA 3S17B 4JI0Q 1R9TB 4A3DG 4HJ5A 3FKIB 4A3JH 1VQOA 4XQNA 3CQZA 2JSOA 1V51A 4J9PA 3VYTA 3M9NB 4K2LA 3H4BA 2MUYA 3MVVA 4I4TF 4B3MQ 1YEZA 2AMCB 3P1HA 4UY8C 1GXDC 1TWAH 2L4NA 3S1QH 4MTKA 2GVBA 2W6PA 3GTPB 4S3SA 3BU2A 4X3SA 4RAZA 1TWGH 4X3TA 1I6VC 2NUCA 2W7OA 2PCFB 1TU2B 1FNUA 2HCIA 1FJGL 4LF5Q 2IY5B 2R61A 1SRUA 3K59A 1SNQA 1QNKA 3M4OB 4OHJA 4JI4Q 1SE8A 1Z2OX 4DXGA 1B4OA 1G51A 3M3YB 3H09A 4DV2L 3H3VI 4QIWB 2CWPA 4O0AA 2JA6G 1WCMA 2XTIA 2HT1A 1KAAA 1PLFA 3PW0A 1A62A 1RJTA 1PH9A 3S2HB 4CGYB 2ZXPA 1SFOA 2FPGB 3IAYA 5C3XA 2C2DA 3L4KA 4A3FG 2X69A 1A2UA 2O4XA 4A3GH 4LSXA 4IZOA 2NU6B 4DV1Q 2JA8B 4IOAA 1I4QA 5KT7A 2XN9C 1RCVD 3M9OB 4ECVA 3K5IA 4ZKBB 4K0KL 4LF8L 1YNNC 3AU7A 2QILA 3LWUA 4LUOA 4PZ7A 5DLFA 5LMUQ 3WO1A 5LOVF 1F2MA 2IMWP 3SR1A 2ZTEA 1VQ8A 1BBXC 3ZYYX 2R7MA 2V4QA 2ATWA 1FR3A 1PYWD 4HSVA 4BY7H 1LM0A 2OTLA 4FDBA 4X66L 4V190 3GTKA 5FLMG 3Q22A 2ATLA 4LFBH 3FEWX 5EWGA 4OO1G 1M0TA 2WAQB 4C56C 2VUMH 2VL6A 1MJEA 2CVRA 4JV5Q 1KLGD 3CCSA 2MFIA 1SEIA 1VF7A 3RV3A 4CJ1B 3H40A 3PO3G 3A56A 5F2DA 3PSIA 4L5RC 3GTQH 2CW0C 1UAPA 4IALA 4B3TL 1WTHA 2C35B 5JH7F 3C46A 3I8ZA 1VQIA 3SI8A 4DAYA 4FYDA 1S5DD 5JVDF 2UUBH 1H9SB 4AQYL 1WJJA 5IWAL 2NWGA 5CV5A 3BZKA 5FJ8G 1N36L 1H95A 1JXLA 4MHEA 1XYIA 3GIDA 4GOPC 3J81L 1B70B 1JB7A 1OO9B 5KRUA 1BR9A 5C44B 1TAEA 4ED1A 4LFAH 2EJFC 4LFCL 4UP9A 4OEMB 2F03A 2XSCA 2E5LQ 1SXTA 5L37A 1IBML 1YZ6A 4PZ6A 4CJ2C 5LMNL 1Y1VH 1T5XD 2SNSA 1VQCA 5KNDA 2R82A 2IX1A 3A74A 3LP8A 1B04A 4MA0A 5AFWA 4A3JG 1N8RC 4C3HG 1AZPA 5DM73 3K3VA 3U4ZA 4WRDA 1RK6A 4GC6A 3CRLC 1EIYB 3NPPA 3IFDA 3TQTA 5M5WB 1F77A 4M8AA 1SCUB 4EFBA 1TWHB 4WFN3 1IBLH 1A63A 4B08A 4IFDG 4E6IA 4RMFA 4JI1Q 4J6HA 4X64L 1N32Q 5C0XI 4A3IG 3H0GA 2WACA 3EYYA 4JBMA 3GIQA 3CCEA 5C4JH 1UUPA 4DV4Q 2R92A 3HS0C 4Q8FA 1PYBA 3TS2A 1I94Q 3RGZA 3DHQA 2UXCL 4POGA 2EYJA 4G3IA 2XVSA 5E4WC 4YBZB 1IYUA 1MBYA 3R3OA 1HNXQ 1I5FA 1BBUA 1R9TH 4A93H 4HNTA 1QVCA 1O78A 1N33H 3NWSA 5ELFA 2W70A 4WJWA 3T56B 3UFXB 1HQMC 5FLXW 4A3MH 1XMOL 4Q0FA 3G7LA 4DUYQ 2FLPA 4G7OC 2FPIB 5M5XH 2W9BA 2NZHA 4KHVA 3GTMB 4OWTB 3J80L 3D4WA 1QUQB 3KOJA 4J15A 3WDNA 2B29A 1FNVA 2FB9A 2K32A 4G7ZC 2JJQA 4NXNL 2XD4A 3EPGA 1VQAA 3EBEA 3UDIA 4L8JA 3DXJC 4JYAQ 3UQ8A 5KKNB 2FK1A 1EY8A 2WB1A 1K28A 4RUAA 3FKIA 1XNQQ 2VQFQ 3E6ZX 3I72A 4DUZQ 2MPMA 4MA5A 4OWXB 3HG9A 4JI3H 4QWCA 1C9OA 1C7YA 2D0OA 3IRBA 3K0YA 3BG5A 3KBXA 1O7IA 4C3IH 2BA1A 4LF6H 4GN5A 3NBIA 4BBRB 5J3BA 3J7YW 1QZHA 1O7ZA 1BO0A 2UUAL 2VUMG 2MNAA 5I2YA 2BA0A 4O3QA 1E3PA 1L1OA 4DR3Q 5FO9B 5LA6F 3EA6A 2R8JA 2NZ1D 2XRSD 1HA6A 1K1QA 1YBYA 1AFPA 2C2EA 1Q1EA 5T1GA 1U4MA 2KCNA 4HCEA 1PX2A 1SYXB 3ORQA 5BN4A 4QIWA 3RD4A 4MV6A 3I4MG 5DGBA 1N34H 3ONAB 2E8GA 2DIKA 1M1KC 1CM9A 3RV4A 3RMHA 3K5MA 5L1JA 3E9IA 1KJJA 3GIIA 3PW4A 1CSPA 2RCNA 1NTGA 4XT3B 3TZDA 3KJPA 4L1KA 5HV6A 3VYRA 4F4WA 1JX4A 2KCTA 4X65Q 1RTOA 5IGBA 3J80c 3FPUB 5ELBA 1A3UA 2R92G 4DNTB 1VQKA 1KTKA 4ZI7F 3DUZA 3TP6A 4FF3A 4A3CG 2AQ1B 2VY3A 5KFZA 2K5QA 2KHSA 2J6SA 1D8LA 2AUKA 3NP8A 2YZGA 1S0MA 4KD4A 1SE4A 1NR2A 3S1MB 1JDBB 2F52A 5KGUA 2UXDL 3F8TA 1Y1WB 2L1BA 5EOYA 3OTOQ 2FKLA 2YTYA 3BJUA 4RHSA 3I12A 1SYFA 3GIPA 3UDXA 1EU4A 4GS3A 5IOCA 3HKZA 1PFNA 3RAXA 2AGPA 1SYDA 1E22A 3A5ZB 4IPGA 4MZ9A 2KA7A 4MTDA 1BF4A 5BN3A 5IP7H 3ICEA 1EYCA 1K0SA 1Z47A 4KKSA 3CCMA 3RZOB 3MWEA 3J7A5 2BE5C 3J81i 4GKJQ 1BDOA 3QJYA 3A55A 3CPWA 5IT9c 3PN1A 5KG1A 2NVTH 4FXKC 5IYDH 3GDEA 2XCPA 1EQRA 2WB1E 3FKIG 1KDBA 1SSOA 4NPSA 1H9SA 2LSSA 4XDXA 3R5XA 2BOSA 4Y8VB 3STBC 3NTKA 3EN2A 3Q8DA 1ZYRC 4OELB 2V4RA 3VYUA 3KHHA 2RBMA 1Z7TA 2Q8TA 4PMBA 4OIJA 2O2LD 3HFZB 3ZJYC 3SVMA 1PFMA 4OX9L 4LMYA 2K5WA 4DV1H 2ENBA 4IN3A 3MEFA 5LL6b 2JK8A 3VA5A 4DK6C 1KNAA 4DV5Q 1K73C 2XIGA 5KFCA 3M4IA 1VS0A 3GTGB 4C1NI 1LTTD 2SEBD 2R93B 2YTXA 2CCZA 2Z0SA 2I80A 2AQ2B 1HUMA 4RAYA 3P7JA 4YHHH 5C0XG 4RFBA 4XYMB 2HHHQ 1EZ8A 5KNCA 4R9WA 2YL2A 5D1OB 4DR1Q 3T1HQ 2QGQA 2L0CA 3ULLA 3BZCA 4JBKA 4JCVE 2DNEA 1IL2A 2NVQH 3RB3A 1BCPB 2JEFA 4DK1A 2E2JB 1ENFA 3JRXA 3TIGA 1X6OA 3VMMA 3KHGA 3RLNA 2WKDA 4JI7H 4JK1C 1NNXA 1N56A 4HIMA 4H44C 2C5CA 2XNAC 5DQIA 4XTCS 1GSHA 2F0QA 4KMUC 2A69C 4H02A 4IPCA 1DD2A 4CKEA 3G6JB 3N44B 4J9MA 2BQUA 3GTLB 5H80A 3MEHA 3KTMA 5KFIA 4DV7H 4O4IF 2JA8G 3BQ1A 5DEHA 1I50H 4KHPQ 1JOKA 2A8VA 3SDZA 2CW7A 4NXMQ 2EVBA 2YZNA 1STNA 3J80i 2PI2E 3DEOA 1S5CD 3I3CA 2NB0A 4DL5A 2IWHA 1LUZA 4L5TA 3S14B 1RL2A 3X3NA 1OXVA 4ZCKA 2AHOB 5TSSA 3BDCA 3F2DA 2K52A 1EEID 1HXYD 3TP7A 2HVQA 4ZYSA 3GO5A 5H1SE 2NU8B 3HKZE 2F0FA 4A3EH 4ECSA 4O3RA 5CA1F 4DR7H 3MZ5A 2WAQG 1A0IA 3I56A 3BAAA 4J9NA 1ZETA 1DYQA 3GTMA 4OGQC 5KT5A 2FHTA 1WR2A 1CHPD 1G8ZD 2WIIB 4RGOS 1I7LA 2E2HA 2Q2HA 2ZTCA 1CHQD 3F2BA 1U4PA 2VS1A 3GQCA 3IG0A 3RJ0A 1WTOA 3C0FB 1SNOA 2N78A 1HNZH 4DV6H 3FHWA 2H5XA 4B9WA 1HR0L 5LP6F 2RKSA 1TY2A 2W6MA 1IW7D 1E24A 4POFA 4JI1H 4XZ3B 3I73A 1JOQA 5C1OA 3G6XA 4GNXC 3S1RH 3CQZB 4GKKH 3Q1KA 4RB0A 1TS5A 1ET9A 4JI6H 1L0WA 2B2TC 1F2LA 1ZKOA 3N6XA 3S16H 1S3OA 3A54A 1EQQA 1PH8A 3JSLA 3ERQA 1CQFA 3E9HA 2R6FA 1IBKH 4C5AA 1WTXA 1K8GA 3VR5A 3SK6A 2L5TA 4TKOB 1Z2PX 5DG9A 1VQ5A 4Y7NH 4XT1B 5BR8Q 4CDDC 2KSWA 4LAAA 4J0MA 1CKOA 4LF9L 2B8FA 1CE8A 1Y8PB 2GA4B 4IZ8A 1D7QA 4IRCA 2F4VQ 1I6HH 4LSAA 2JEIA 2CW8A 4YR0A 4KY6A 4DK0A 2UUBL 2VPSA 1WCMB 5CV7A 5C5LA 3NENA 4N8FA 4I7HA 4IRDA 2A68D 1M4VA 2XWJB 5J2TF 4RNMA 2B63H 1SFOB 2W9CA 3P20A 5DAUA
chains in the Genus database with same CATH topology
1HNXL 1VQ9A 1MKHA 1HR0W 2R6GA 2Z6KC 5GROA 4EQ5A 1CSQA 5HGQA 3PIOA 1HZAA 5M5WH 3RNUA 1HNZQ 4JI0Q 4DV6Q 3HOZH 1TWHH 3PF5A 3OW2A 4A3DG 3U50C 4HJ5A 4A3JH 3K80C 1VQOA 4LFAL 3ERSX 3KJOA 4GKKQ 2IX0A 3RLOA 1PH5A 4R4TA 4DUYL 2EIFA 5AJ3Q 1VQFA 1YJNA 4IFDJ 1U5KA 1V9PA 2IT1A 1YEZA 1MJCA 5E7NA 4B3MQ 4JI6Q 2AMCB 4GOPA 1HNWL 1L1OC 5HY6A 4A3DH 2AKWB 1Q12A 4UY8C 1IBKQ 1TWAH 1YHQA 4LWCA 3S1QH 2GVBA 2K5NA 3BU2A 2PMZE 1TWGH 1I3QH 4A4IA 1DGSA 2PQAA 4APVA 2LXJA 1YITA 4JYAL 1FJGL 4GN4B 1IBLL 4LF5Q 2IY5B 5GADC 1SRUA 4JC0A 1XNQL 2VQFL 2EQSA 4LF7L 4AIMA 4DUZL 4JI4Q 1SE8A 4OX9Q 1CUKA 2HIVA 1G51A 1EOVA 3J81c 5EAYA 4DV2L 2UUCL 3H3VI 1LTLA 1YNXA 2CWPA 4O0AA 2GN5A 3PGZA 2RHSB 4JOIC 2ZJQA 2XTIA 2JA6G 2HT1A 3GTMH 3KDFA 1E7ZA 1CKNA 2QEXA 1Q7YC 4A3GG 4DAYB 1NJIC 1A62A 1PH9A 2OWOA 5M3FG 1S72A 4OONA 3CPFA 4DR3L 1JE5A 4A3FG 1JJ2A 3PUYA 2JA6H 1MIUA 3VDYA 1NMGA 1YVCA 2YYZA 4A76A 4A3GH 1N33L 4JBJA 4NB3A 2VQEL 1WOCA 1KAWA 4DV1Q 4BBRG 3TRZA 4IOAA 5M3FH 4UP7A 3G4SA 4A3FH 4K0KL 2JA9A 2KHIA 3HKZG 2YU9H 4BY7G 4LF8L 1SROA 3UDFA 4LUOA 3CCRA 1PFSA 1KXLA 1T9HA 4PZ7A 5LMUQ 4LF4L 4UP8A 1X3EA 2PNHA 4P73A 3OYYA 4BBRH 2ZTEA 1NE3A 1VQ8A 2N8NA 1KL9A 1ASZA 4X65L 2ATWA 1VQGA 2HIXA 2ZM6Q 4BY7H 2UXBQ 1LM0A 4KLKA 3HOYH 1V1QA 2MO1A 2OTLA 1WFQA 1E1TA 1V43A 4FDBA 4X66L 4DKAC 5FLMG 1NY4A 3UDGA 3K0XA 1K83H 3PUVA 4OO1G 3S1NH 4YCVA 1Q1BA 2VUMH 1Y14B 2VL6A 1J5EL 1MJEA 3CCSA 4DR6L 4JV5Q 4WJ4A 2MFIA 3CCVA 4JI3L 3PO3G 2OQKA 3HOVG 4LNQA 2LXKA 3PSIA 4YY3L 4L5RC 5FLMH 3GTQH 4B3TL 2C35B 1SR3A 4YWMA 3AFQA 3KYHC 4LF6L 1VQIA 3OTOL 1QVFA 2CFMA 3CCQA 2ID0A 3PV0A 1AE3A 4AQYL 1WJJA 5IWAL 1P16A 4GNXB 4LW1A 3PO3H 3BZKA 3HOVH 2VNUD 5FJ8G 1N36L 5C44G 4Y52H 1IZ6A 1H95A 4LFBL 5ELOA 3W5OA 1XMQQ 3PUXA 1XJVA 1HH2P 4GOPC 4DV0Q 1Y1VG 2N3SA 1Y1WG 4AYBE 1B70B 2K50A 1JB7A 1NBWA 2Y0SE 3L0OA 4DR5Q 5FJ8H 1HR0Q 4QGUA 3G6EA 4GKJL 4PZ8A 4LFCL 4UP9A 1N34L 2E5LQ 1VQPA 2BH8A 3S1MH 4L5SA 1HZBA 1IBML 1YZ6A 5M3MG 4PZ6A 5LMNL 1Y1VH 5JJLA 1Y1WH 2MQHA 2FXQA 1VQCA 2Q2IA 2UU9L 3HOZG 4LUZA 1K3RA 3A74A 4P75A 1K8AC 2IX1A 2IHEA 3I2ZA 4A3JG 1N8RC 1Q46A 4MTNA 3U4ZA 3AYHB 5M3MH 4XIGS 1BBWA 5IYBG 1EIYB 1SMXA 4B3RQ 2OCEA 2K14A 2NZOA 4HJAA 3M7NA 3KF6B 4DV5L 2I5MX 1KRSA 1A63A 4IFDG 4RMFA 2KHJA 4JI1Q 4C3HH 4X64L 2BH2A 5C0XI 3RZOH 1N32Q 4LF9Q 4A3IG 3MXNB 1XNRQ 5K36G 4JBMA 3CCEA 5C4JH 5ELNA 5IYBH 3F2CA 4DV4Q 1VQ7A 1PH3A 2ES2A 4A3LG 4A93G 1PYBA 3TS2A 2HHHL 1UE6A 1I94Q 3CD6A 4DR1L 2UXCL 3T1HL 4GNXA 4P74A 2DGYA 4POGA 4X62Q 1BVSA 4JI5L 4A3IH 4BA2I 3JAMc 2JE6I 3T1YQ 3S15H 1KHIA 4A3MG 2VW9A 4GN3B 4A3LH 3PO2G 2R93G 1L1OB 5JEAG 1I5FA 1BBUA 1FGUA 1R9TH 1HNXQ 4A93H 2RF4A 3A0JA 3CMEA 1QVCA 1PH1A 2E2IH 1YJ9A 4HJ9A 4A3BH 2R7DA 5JEAJ 1IXRA 4LFAQ 4DR2L 3GTGH 4A3MH 1GVPA 1B7YB 2JEBI 1XMOL 4QQBX 3PO2H 2R93H 1OXXK 4DUYQ 5M5XH 2JA7G 2NZHA 1HNWQ 4DV3L 4OWTB 3UE1A 4DNIA 4KHPL 1QUQB 1UE1A 4HIDA 3LGJA 2E2HH 3KOJA 4J15A 4TQUS 4JI2L 4NXML 1TXYA 2B29A 3GTKH 1EYGA 3H15A 4QIWE 2E2JH 4X6AH 2JA7H 2JJQA 1W2BA 1E1OA 4NXNL 3CF5A 4HIOA 1VQAA 1NMFA 2JA5H 3EBEA 3UDIA 2Q2TA 4JYAQ 1K0RA 3ULJA 1FJGQ 1IBLQ 1VCIA 3PUWA 1J6QA 5DLQE 4MNOA 1XNQQ 3S2DH 4R4QA 2VQFQ 4LF7Q 4DUZQ 3WWVA 4OWXB 2Z6KA 2MO0A 3GTLH 1C9OA 4DV2Q 2D0OA 3IRBA 1C7YA 2UUCQ 3HOUH 4YHHL 3HOYG 3TQYA 3UE0A 1C0AA 1EWIA 1CKMA 1O7IA 1PH7A 2I5HA 4C3IH 2CWAA 3PF4A 2K5HA 2BA1A 2KCMA 4GN5A 2UUAL 2VUMG 3PUZA 3D31A 1GD7A 5J3BA 1QZHA 2MNAA 2I5LX 4B3SL 4GLAC 2GVAA 2BA0A 1JJCB 1X54A 1E3PA 3CC2A 1JJGA 4ME3A 1L1OA 4DR3Q 4JI7L 3S14H 4JI8L 1WI5A 4HJ7A 3K7AH 2B3GA 1N33Q 3CW2C 2VQEQ 1HZCA 3H3VH 3M85A 4YCWA 4IPDA 2NN6I 1YBYA 4YWLA 2I0QA 1Q1EA 3CC7A 4R4IA 4K0KQ 3NBHB 1JT8A 1OXUA 1XPOA 4LF8Q 4DV7L 3I4MG 2WAQE 1VQLA 2E8GA 1X55A 1M1KC 1QUQA 4LF4Q 3E9IA 1CSPA 2RCNA 1NTGA 3KJPA 1KIXA 2KCTA 4X65Q 4R1JA 5BR8L 1N9WA 4JOIA 3J80c 3ULPA 5GAEC 2R92G 3I4MH 1VQKA 4HIKA 2ASBA 1UWVA 4UPAA 4X66Q 1BKBA 3RN2A 4A3CG 4DAMA 4BXXG 4AYBG 2YTVA 1Q82C 1EUJA 3L2PA 3RZDH 5GQOA 2NVYH 3CQZH 3H0GH 2Y0SG 1J5EQ 4DR6Q 3EIVA 2VY3A 2F4VL 1JMCA 1YHBA 4JI3Q 1D8LA 2R92H 4L5QA 3D0FA 4DR7L 4YY3Q 4GOPB 2QA4A 2XGTA 4B3TQ 4A3CH 1FVIA 2F52A 2ZJRA 4BXXH 2UXDL 4DK3C 1PA6A 3F8TA 4DR4L 4LF6Q 3FP9A 4C2MH 3SGIA 3OTOQ 2V1CC 2YTYA 3BJUA 5IP7G 4GLVB 1YHAA 4AQYQ 5IWAQ 1X3GA 3UDXA 4GS3A 1YJWA 3J81j 3GTOH 2R7FA 1N36Q 1FL0A 4JI0L 2K75A 1HNZL 4DV6L 1WCMG 1E22A 3A5ZB 4IPGA 4RG1A 4LFBQ 4MZ9A 5IE8A 4JI1L 1IYJB 5C3EH 5IYDG 5IP7H 3ICEA 4GKKL 2JA5G 3DM3A 5JJKA 1Z47A 3CCMA 5AJ3L 1Q81C 4QJFA 1EFWA 1SN8A 1X56A 4B3ML 2A1AA 3M9BA 1AE2A 1GKHA 1P8LA 2HQLA 3J81i 4JI6L 3J7A5 3CPWA 4GKJQ 1WCMH 5IT9c 3B6YA 4LFCQ 2ZJPA 3S24A 2NVTH 2F3IA 1N34Q 1CKNB 1IBKL 2WP8J 1IBMQ 5IYDH 5LMNQ 3GDEA 2R7ZH 1EQRA 1W3SA 2WB1E 3FKIG 4LUVA 4NPSA 1XPRA 1SFOH 1SLJA 2LSSA 2UUBQ 1EIFA 2UU9Q 4KI0A 3STBC 4O2DA 3EN2A 3Q8DA 2OQ0A 3TREA 4A3BG 2YV5A 5IY0A 1OXTA 3S17H 5GAGC 3J7ZC 4LF5L 1X65A 5M5YH 2JQOA 3ZJYC 3HFZB 3FKIH 3K81C 4JI4L 4OX9L 4IJLA 2D0PA 3MEFA 3GTJH 2JK8A 3AEVA 4DK6C 4DV5Q 3JC66 5GAHC 1K73C 5LMNW 1VS0A 4X64Q 2NVXH 2ALYB 4BBSG 1WYDA 1OXSC 1VQDA 2YTXA 3E0EA 3K8AA 2CCZA 2Z0SA 1GM5A 4AH6A 5C0XG 1HZ9A 2HHHQ 3GTPH 3NELA 4QY7A 4DR1Q 3RN5A 3T1HQ 2QGQA 2UXCQ 1PHJA 2VZAA 3ULLA 3BZCA 4JBKA 4JCVE 4JI5Q 1IL2A 5C0XJ 3CAMA 2NVQH 4BBSH 5IP9G 3AFPA 1X6OA 1S40A 3RR5A 3M4QA 3RLNA 4DV1L 3HOUG 3M4OH 3KF6A 2A19A 3HKSA 4HIMA 1L2FA 3M3YH 1VQHA 4TVAB 4XTCS 3A5UA 3G71A 3W1BA 1KQSA 4H02A 4IPCA 1KC8C 4DR2Q 1Z9FA 5IP9H 1XMOQ 1G6PA 5LMUL 3CCLA 1VQNA 4IJHA 1PH2A 3CC4A 2CKZB 2N49A 5IYCG 4DV3Q 3S2HH 4WJ3M 4HJ8A 4OO1I 2JA8G 5FLXc 2ZM6L 3GD7A 1PYSB 1I50H 4KHPQ 4PMWA 2A8VA 2UXBL 4JI2Q 3F1ZA 4NXMQ 2CQOA 1TWCH 2IHFA 4YWKA 3J80i 2PI2E 1QVGA 3HOWG 2AWNA 2EXDA 3AQQA 4R4OA 4A3EG 1K9MC 2Q2UA 3CXCA 1LUZA 4L5TA 5IYCH 1RL2A 3L7ZC 3CP0A 4P72A 1OXVA 4NXNQ 2JA8H 4JV5L 1A8VA 2AHOB 3PIPA 1VQBA 3F2DA 4BY1G 2K52A 1PH6A 3CMAA 3GO5A 5H1SE 3HKZE 4C3JH 3HOWH 4A3EH 3KLWA 1X9NA 4IO9A 1HJPA 3STBD 1RIPA 1M90C 2WAQG 1A0IA 3I56A 4YHHQ 1YIJA 4P71A 4BY1H 4QL5A 4A3KG 3PCOB 4BA1I 2KBNA 4IPHA 2Q2HA 2ZTCA 2UUAQ 2K5VA 3HOXG 3H0GG 1TWFH 1XMQL 3F2BA 3I4NG 3I4OA 4IOCA 2VS1A 2WFWA 1VQ4A 4B3SQ 4DV0L 3K7UC 1UE7A 2N78A 4JI7Q 3U58A 4JI8Q 5C4XG 1G291 4A3KH 4DR5L 1YI2A 3FHWA 2H5XA 1HR0L 1AH9A 1Q86C 1E24A 4POFA 3CCUA 3HOXH 4R4CA 4GNXC 3S1RH 3I4NH 2K4KA 4JBWA 2E5LL 1KRTA 3CCJA 3U4VA 1KD1C 4ALPA 4A75A 2KENA 2PI2A 1OTCA 1U0LA 1VQMA 1XTDA 1B8AA 1Q8KA 1L0WA 5C4XH 1PH4A 1GO3E 4DV7Q 3S16H 1S3OA 2AWOA 2NN6G 3M4PA 4JG2A 4GLXA 1EQQA 1PH8A 3E9HA 4YCUA 5C3EG 1UEBA 1K8GA 1XPUA 1VQJA 3ER0A 4IFDI 4KHZA 2L15A 3JAMi 3I55A 2RHQB 4Y7NH 1VQ5A 4B3RL 5BR8Q 2PQAB 2DUDA 3TS0A 1UE5A 4PG3A 1CKOA 3I7FA 4EX5A 3G48A 4OWWB 3NEMA 1N32L 5C44H 4LF9L 2R7ZG 1PVOA 1X3FA 3KF8B 1XNRL 2B63G 3KFUA 3W1GA 1D7QA 4DV4L 2F4VQ 1I6HH 4DR7Q 2UUBL 3DLLA 1LYLA 3NENA 4DPGA 1I94L 3KDFB 5JJIA 1VQ6A 4X62L 2UXDQ 2WB1G 1PV4A 2D62A 3RLFA 3T1YL 2JEAI 2B63H 4OXPA 4DR4Q 2OTJA 2ZTDA 1VQEA 3TEHB 1ASYA 1QZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX L;  1VQ9 A;  1MKH A;  1HR0 W;  2R6G A;  2Z6K C;  5GRO A;  4EQ5 A;  1CSQ A;  5HGQ A;  3PIO A;  1HZA A;  5M5W H;  3RNU A;  1HNZ Q;  4JI0 Q;  4DV6 Q;  3HOZ H;  1TWH H;  3PF5 A;  3OW2 A;  4A3D G;  3U50 C;  4HJ5 A;  4A3J H;  3K80 C;  1VQO A;  4LFA L;  3ERS X;  3KJO A;  4GKK Q;  2IX0 A;  3RLO A;  1PH5 A;  4R4T A;  4DUY L;  2EIF A;  5AJ3 Q;  1VQF A;  1YJN A;  4IFD J;  1U5K A;  1V9P A;  2IT1 A;  1YEZ A;  1MJC A;  5E7N A;  4B3M Q;  4JI6 Q;  2AMC B;  4GOP A;  1HNW L;  1L1O C;  5HY6 A;  4A3D H;  2AKW B;  1Q12 A;  4UY8 C;  1IBK Q;  1TWA H;  1YHQ A;  4LWC A;  3S1Q H;  2GVB A;  2K5N A;  3BU2 A;  2PMZ E;  1TWG H;  1I3Q H;  4A4I A;  1DGS A;  2PQA A;  4APV A;  2LXJ A;  1YIT A;  4JYA L;  1FJG L;  4GN4 B;  1IBL L;  4LF5 Q;  2IY5 B;  5GAD C;  1SRU A;  4JC0 A;  1XNQ L;  2VQF L;  2EQS A;  4LF7 L;  4AIM A;  4DUZ L;  4JI4 Q;  1SE8 A;  4OX9 Q;  1CUK A;  2HIV A;  1G51 A;  1EOV A;  3J81 c;  5EAY A;  4DV2 L;  2UUC L;  3H3V I;  1LTL A;  1YNX A;  2CWP A;  4O0A A;  2GN5 A;  3PGZ A;  2RHS B;  4JOI C;  2ZJQ A;  2XTI A;  2JA6 G;  2HT1 A;  3GTM H;  3KDF A;  1E7Z A;  1CKN A;  2QEX A;  1Q7Y C;  4A3G G;  4DAY B;  1NJI C;  1A62 A;  1PH9 A;  2OWO A;  5M3F G;  1S72 A;  4OON A;  3CPF A;  4DR3 L;  1JE5 A;  4A3F G;  1JJ2 A;  3PUY A;  2JA6 H;  1MIU A;  3VDY A;  1NMG A;  1YVC A;  2YYZ A;  4A76 A;  4A3G H;  1N33 L;  4JBJ A;  4NB3 A;  2VQE L;  1WOC A;  1KAW A;  4DV1 Q;  4BBR G;  3TRZ A;  4IOA A;  5M3F H;  4UP7 A;  3G4S A;  4A3F H;  4K0K L;  2JA9 A;  2KHI A;  3HKZ G;  2YU9 H;  4BY7 G;  4LF8 L;  1SRO A;  3UDF A;  4LUO A;  3CCR A;  1PFS A;  1KXL A;  1T9H A;  4PZ7 A;  5LMU Q;  4LF4 L;  4UP8 A;  1X3E A;  2PNH A;  4P73 A;  3OYY A;  4BBR H;  2ZTE A;  1NE3 A;  1VQ8 A;  2N8N A;  1KL9 A;  1ASZ A;  4X65 L;  2ATW A;  1VQG A;  2HIX A;  2ZM6 Q;  4BY7 H;  2UXB Q;  1LM0 A;  4KLK A;  3HOY H;  1V1Q A;  2MO1 A;  2OTL A;  1WFQ A;  1E1T A;  1V43 A;  4FDB A;  4X66 L;  4DKA C;  5FLM G;  1NY4 A;  3UDG A;  3K0X A;  1K83 H;  3PUV A;  4OO1 G;  3S1N H;  4YCV A;  1Q1B A;  2VUM H;  1Y14 B;  2VL6 A;  1J5E L;  1MJE A;  3CCS A;  4DR6 L;  4JV5 Q;  4WJ4 A;  2MFI A;  3CCV A;  4JI3 L;  3PO3 G;  2OQK A;  3HOV G;  4LNQ A;  2LXK A;  3PSI A;  4YY3 L;  4L5R C;  5FLM H;  3GTQ H;  4B3T L;  2C35 B;  1SR3 A;  4YWM A;  3AFQ A;  3KYH C;  4LF6 L;  1VQI A;  3OTO L;  1QVF A;  2CFM A;  3CCQ A;  2ID0 A;  3PV0 A;  1AE3 A;  4AQY L;  1WJJ A;  5IWA L;  1P16 A;  4GNX B;  4LW1 A;  3PO3 H;  3BZK A;  3HOV H;  2VNU D;  5FJ8 G;  1N36 L;  5C44 G;  4Y52 H;  1IZ6 A;  1H95 A;  4LFB L;  5ELO A;  3W5O A;  1XMQ Q;  3PUX A;  1XJV A;  1HH2 P;  4GOP C;  4DV0 Q;  1Y1V G;  2N3S A;  1Y1W G;  4AYB E;  1B70 B;  2K50 A;  1JB7 A;  1NBW A;  2Y0S E;  3L0O A;  4DR5 Q;  5FJ8 H;  1HR0 Q;  4QGU A;  3G6E A;  4GKJ L;  4PZ8 A;  4LFC L;  4UP9 A;  1N34 L;  2E5L Q;  1VQP A;  2BH8 A;  3S1M H;  4L5S A;  1HZB A;  1IBM L;  1YZ6 A;  5M3M G;  4PZ6 A;  5LMN L;  1Y1V H;  5JJL A;  1Y1W H;  2MQH A;  2FXQ A;  1VQC A;  2Q2I A;  2UU9 L;  3HOZ G;  4LUZ A;  1K3R A;  3A74 A;  4P75 A;  1K8A C;  2IX1 A;  2IHE A;  3I2Z A;  4A3J G;  1N8R C;  1Q46 A;  4MTN A;  3U4Z A;  3AYH B;  5M3M H;  4XIG S;  1BBW A;  5IYB G;  1EIY B;  1SMX A;  4B3R Q;  2OCE A;  2K14 A;  2NZO A;  4HJA A;  3M7N A;  3KF6 B;  4DV5 L;  2I5M X;  1KRS A;  1A63 A;  4IFD G;  4RMF A;  2KHJ A;  4JI1 Q;  4C3H H;  4X64 L;  2BH2 A;  5C0X I;  3RZO H;  1N32 Q;  4LF9 Q;  4A3I G;  3MXN B;  1XNR Q;  5K36 G;  4JBM A;  3CCE A;  5C4J H;  5ELN A;  5IYB H;  3F2C A;  4DV4 Q;  1VQ7 A;  1PH3 A;  2ES2 A;  4A3L G;  4A93 G;  1PYB A;  3TS2 A;  2HHH L;  1UE6 A;  1I94 Q;  3CD6 A;  4DR1 L;  2UXC L;  3T1H L;  4GNX A;  4P74 A;  2DGY A;  4POG A;  4X62 Q;  1BVS A;  4JI5 L;  4A3I H;  4BA2 I;  3JAM c;  2JE6 I;  3T1Y Q;  3S15 H;  1KHI A;  4A3M G;  2VW9 A;  4GN3 B;  4A3L H;  3PO2 G;  2R93 G;  1L1O B;  5JEA G;  1I5F A;  1BBU A;  1FGU A;  1R9T H;  1HNX Q;  4A93 H;  2RF4 A;  3A0J A;  3CME A;  1QVC A;  1PH1 A;  2E2I H;  1YJ9 A;  4HJ9 A;  4A3B H;  2R7D A;  5JEA J;  1IXR A;  4LFA Q;  4DR2 L;  3GTG H;  4A3M H;  1GVP A;  1B7Y B;  2JEB I;  1XMO L;  4QQB X;  3PO2 H;  2R93 H;  1OXX K;  4DUY Q;  5M5X H;  2JA7 G;  2NZH A;  1HNW Q;  4DV3 L;  4OWT B;  3UE1 A;  4DNI A;  4KHP L;  1QUQ B;  1UE1 A;  4HID A;  3LGJ A;  2E2H H;  3KOJ A;  4J15 A;  4TQU S;  4JI2 L;  4NXM L;  1TXY A;  2B29 A;  3GTK H;  1EYG A;  3H15 A;  4QIW E;  2E2J H;  4X6A H;  2JA7 H;  2JJQ A;  1W2B A;  1E1O A;  4NXN L;  3CF5 A;  4HIO A;  1VQA A;  1NMF A;  2JA5 H;  3EBE A;  3UDI A;  2Q2T A;  4JYA Q;  1K0R A;  3ULJ A;  1FJG Q;  1IBL Q;  1VCI A;  3PUW A;  1J6Q A;  5DLQ E;  4MNO A;  1XNQ Q;  3S2D H;  4R4Q A;  2VQF Q;  4LF7 Q;  4DUZ Q;  3WWV A;  4OWX B;  2Z6K A;  2MO0 A;  3GTL H;  1C9O A;  4DV2 Q;  2D0O A;  3IRB A;  1C7Y A;  2UUC Q;  3HOU H;  4YHH L;  3HOY G;  3TQY A;  3UE0 A;  1C0A A;  1EWI A;  1CKM A;  1O7I A;  1PH7 A;  2I5H A;  4C3I H;  2CWA A;  3PF4 A;  2K5H A;  2BA1 A;  2KCM A;  4GN5 A;  2UUA L;  2VUM G;  3PUZ A;  3D31 A;  1GD7 A;  5J3B A;  1QZH A;  2MNA A;  2I5L X;  4B3S L;  4GLA C;  2GVA A;  2BA0 A;  1JJC B;  1X54 A;  1E3P A;  3CC2 A;  1JJG A;  4ME3 A;  1L1O A;  4DR3 Q;  4JI7 L;  3S14 H;  4JI8 L;  1WI5 A;  4HJ7 A;  3K7A H;  2B3G A;  1N33 Q;  3CW2 C;  2VQE Q;  1HZC A;  3H3V H;  3M85 A;  4YCW A;  4IPD A;  2NN6 I;  1YBY A;  4YWL A;  2I0Q A;  1Q1E A;  3CC7 A;  4R4I A;  4K0K Q;  3NBH B;  1JT8 A;  1OXU A;  1XPO A;  4LF8 Q;  4DV7 L;  3I4M G;  2WAQ E;  1VQL A;  2E8G A;  1X55 A;  1M1K C;  1QUQ A;  4LF4 Q;  3E9I A;  1CSP A;  2RCN A;  1NTG A;  3KJP A;  1KIX A;  2KCT A;  4X65 Q;  4R1J A;  5BR8 L;  1N9W A;  4JOI A;  3J80 c;  3ULP A;  5GAE C;  2R92 G;  3I4M H;  1VQK A;  4HIK A;  2ASB A;  1UWV A;  4UPA A;  4X66 Q;  1BKB A;  3RN2 A;  4A3C G;  4DAM A;  4BXX G;  4AYB G;  2YTV A;  1Q82 C;  1EUJ A;  3L2P A;  3RZD H;  5GQO A;  2NVY H;  3CQZ H;  3H0G H;  2Y0S G;  1J5E Q;  4DR6 Q;  3EIV A;  2VY3 A;  2F4V L;  1JMC A;  1YHB A;  4JI3 Q;  1D8L A;  2R92 H;  4L5Q A;  3D0F A;  4DR7 L;  4YY3 Q;  4GOP B;  2QA4 A;  2XGT A;  4B3T Q;  4A3C H;  1FVI A;  2F52 A;  2ZJR A;  4BXX H;  2UXD L;  4DK3 C;  1PA6 A;  3F8T A;  4DR4 L;  4LF6 Q;  3FP9 A;  4C2M H;  3SGI A;  3OTO Q;  2V1C C;  2YTY A;  3BJU A;  5IP7 G;  4GLV B;  1YHA A;  4AQY Q;  5IWA Q;  1X3G A;  3UDX A;  4GS3 A;  1YJW A;  3J81 j;  3GTO H;  2R7F A;  1N36 Q;  1FL0 A;  4JI0 L;  2K75 A;  1HNZ L;  4DV6 L;  1WCM G;  1E22 A;  3A5Z B;  4IPG A;  4RG1 A;  4LFB Q;  4MZ9 A;  5IE8 A;  4JI1 L;  1IYJ B;  5C3E H;  5IYD G;  5IP7 H;  3ICE A;  4GKK L;  2JA5 G;  3DM3 A;  5JJK A;  1Z47 A;  3CCM A;  5AJ3 L;  1Q81 C;  4QJF A;  1EFW A;  1SN8 A;  1X56 A;  4B3M L;  2A1A A;  3M9B A;  1AE2 A;  1GKH A;  1P8L A;  2HQL A;  3J81 i;  4JI6 L;  3J7A 5;  3CPW A;  4GKJ Q;  1WCM H;  5IT9 c;  3B6Y A;  4LFC Q;  2ZJP A;  3S24 A;  2NVT H;  2F3I A;  1N34 Q;  1CKN B;  1IBK L;  2WP8 J;  1IBM Q;  5IYD H;  5LMN Q;  3GDE A;  2R7Z H;  1EQR A;  1W3S A;  2WB1 E;  3FKI G;  4LUV A;  4NPS A;  1XPR A;  1SFO H;  1SLJ A;  2LSS A;  2UUB Q;  1EIF A;  2UU9 Q;  4KI0 A;  3STB C;  4O2D A;  3EN2 A;  3Q8D A;  2OQ0 A;  3TRE A;  4A3B G;  2YV5 A;  5IY0 A;  1OXT A;  3S17 H;  5GAG C;  3J7Z C;  4LF5 L;  1X65 A;  5M5Y H;  2JQO A;  3ZJY C;  3HFZ B;  3FKI H;  3K81 C;  4JI4 L;  4OX9 L;  4IJL A;  2D0P A;  3MEF A;  3GTJ H;  2JK8 A;  3AEV A;  4DK6 C;  4DV5 Q;  3JC6 6;  5GAH C;  1K73 C;  5LMN W;  1VS0 A;  4X64 Q;  2NVX H;  2ALY B;  4BBS G;  1WYD A;  1OXS C;  1VQD A;  2YTX A;  3E0E A;  3K8A A;  2CCZ A;  2Z0S A;  1GM5 A;  4AH6 A;  5C0X G;  1HZ9 A;  2HHH Q;  3GTP H;  3NEL A;  4QY7 A;  4DR1 Q;  3RN5 A;  3T1H Q;  2QGQ A;  2UXC Q;  1PHJ A;  2VZA A;  3ULL A;  3BZC A;  4JBK A;  4JCV E;  4JI5 Q;  1IL2 A;  5C0X J;  3CAM A;  2NVQ H;  4BBS H;  5IP9 G;  3AFP A;  1X6O A;  1S40 A;  3RR5 A;  3M4Q A;  3RLN A;  4DV1 L;  3HOU G;  3M4O H;  3KF6 A;  2A19 A;  3HKS A;  4HIM A;  1L2F A;  3M3Y H;  1VQH A;  4TVA B;  4XTC S;  3A5U A;  3G71 A;  3W1B A;  1KQS A;  4H02 A;  4IPC A;  1KC8 C;  4DR2 Q;  1Z9F A;  5IP9 H;  1XMO Q;  1G6P A;  5LMU L;  3CCL A;  1VQN A;  4IJH A;  1PH2 A;  3CC4 A;  2CKZ B;  2N49 A;  5IYC G;  4DV3 Q;  3S2H H;  4WJ3 M;  4HJ8 A;  4OO1 I;  2JA8 G;  5FLX c;  2ZM6 L;  3GD7 A;  1PYS B;  1I50 H;  4KHP Q;  4PMW A;  2A8V A;  2UXB L;  4JI2 Q;  3F1Z A;  4NXM Q;  2CQO A;  1TWC H;  2IHF A;  4YWK A;  3J80 i;  2PI2 E;  1QVG A;  3HOW G;  2AWN A;  2EXD A;  3AQQ A;  4R4O A;  4A3E G;  1K9M C;  2Q2U A;  3CXC A;  1LUZ A;  4L5T A;  5IYC H;  1RL2 A;  3L7Z C;  3CP0 A;  4P72 A;  1OXV A;  4NXN Q;  2JA8 H;  4JV5 L;  1A8V A;  2AHO B;  3PIP A;  1VQB A;  3F2D A;  4BY1 G;  2K52 A;  1PH6 A;  3CMA A;  3GO5 A;  5H1S E;  3HKZ E;  4C3J H;  3HOW H;  4A3E H;  3KLW A;  1X9N A;  4IO9 A;  1HJP A;  3STB D;  1RIP A;  1M90 C;  2WAQ G;  1A0I A;  3I56 A;  4YHH Q;  1YIJ A;  4P71 A;  4BY1 H;  4QL5 A;  4A3K G;  3PCO B;  4BA1 I;  2KBN A;  4IPH A;  2Q2H A;  2ZTC A;  2UUA Q;  2K5V A;  3HOX G;  3H0G G;  1TWF H;  1XMQ L;  3F2B A;  3I4N G;  3I4O A;  4IOC A;  2VS1 A;  2WFW A;  1VQ4 A;  4B3S Q;  4DV0 L;  3K7U C;  1UE7 A;  2N78 A;  4JI7 Q;  3U58 A;  4JI8 Q;  5C4X G;  1G29 1;  4A3K H;  4DR5 L;  1YI2 A;  3FHW A;  2H5X A;  1HR0 L;  1AH9 A;  1Q86 C;  1E24 A;  4POF A;  3CCU A;  3HOX H;  4R4C A;  4GNX C;  3S1R H;  3I4N H;  2K4K A;  4JBW A;  2E5L L;  1KRT A;  3CCJ A;  3U4V A;  1KD1 C;  4ALP A;  4A75 A;  2KEN A;  2PI2 A;  1OTC A;  1U0L A;  1VQM A;  1XTD A;  1B8A A;  1Q8K A;  1L0W A;  5C4X H;  1PH4 A;  1GO3 E;  4DV7 Q;  3S16 H;  1S3O A;  2AWO A;  2NN6 G;  3M4P A;  4JG2 A;  4GLX A;  1EQQ A;  1PH8 A;  3E9H A;  4YCU A;  5C3E G;  1UEB A;  1K8G A;  1XPU A;  1VQJ A;  3ER0 A;  4IFD I;  4KHZ A;  2L15 A;  3JAM i;  3I55 A;  2RHQ B;  4Y7N H;  1VQ5 A;  4B3R L;  5BR8 Q;  2PQA B;  2DUD A;  3TS0 A;  1UE5 A;  4PG3 A;  1CKO A;  3I7F A;  4EX5 A;  3G48 A;  4OWW B;  3NEM A;  1N32 L;  5C44 H;  4LF9 L;  2R7Z G;  1PVO A;  1X3F A;  3KF8 B;  1XNR L;  2B63 G;  3KFU A;  3W1G A;  1D7Q A;  4DV4 L;  2F4V Q;  1I6H H;  4DR7 Q;  2UUB L;  3DLL A;  1LYL A;  3NEN A;  4DPG A;  1I94 L;  3KDF B;  5JJI A;  1VQ6 A;  4X62 L;  2UXD Q;  2WB1 G;  1PV4 A;  2D62 A;  3RLF A;  3T1Y L;  2JEA I;  2B63 H;  4OXP A;  4DR4 Q;  2OTJ A;  2ZTD A;  1VQE A;  3TEH B;  1ASY A;  1QZG A; 
#chains in the Genus database with same CATH topology
 1VQ9 A;  1HR0 W;  2R7K A;  2M05 A;  2OF1 A;  5KFB A;  1CSQ A;  5HGQ A;  5EZY F;  3RNU A;  3HOZ H;  4JV0 A;  3A7A B;  1CFM A;  3P75 A;  5KYL A;  3TZU A;  5M5Y B;  4LFA L;  1C30 A;  5JJZ A;  3ERS X;  3GP7 A;  3KJO A;  1RD9 D;  2NVY A;  3BAB A;  4R4T A;  5J1Z A;  1VQF A;  1B9M A;  1V9P A;  5E7N A;  4PDB A;  1QIL A;  4HQ6 A;  5HY6 A;  4A3D H;  1LLR D;  1Q12 A;  3VPD A;  4AYB A;  1YHQ A;  1ET6 A;  1GUT A;  4C2M A;  2F0O A;  2J9G A;  2UXB H;  1IOW A;  1I3Q H;  4JVZ A;  3C2P A;  5C5M A;  4APV A;  2LXJ A;  4BBS B;  1HRJ A;  1M8A A;  1T36 A;  2OLS A;  4A2A A;  1WTW A;  1IBL L;  4M9U A;  1WTV A;  5G3L D;  4XYO A;  3OMG A;  2JN4 A;  1FYC A;  4ZRZ A;  1E4E A;  4APM A;  3GV7 B;  3BJY A;  3KF8 A;  1J8I A;  5EAY A;  5JOB A;  5JEA H;  2IBK A;  2F0L A;  1YNX A;  4IWX A;  5C5J A;  2SCU B;  3ETJ A;  4EGJ A;  5KFP A;  2QEX A;  2QW7 A;  4DAY B;  4MV8 A;  5J22 A;  3Q24 A;  1S97 A;  5KNB A;  2KEE A;  2K6A A;  1S72 A;  1EFI D;  4OON A;  3CPF A;  5CV9 A;  5KG3 A;  1TWC B;  2JA6 H;  1MIU A;  1MSH A;  2EYH A;  2HCC A;  1DIK A;  1NMG A;  1YVC A;  2EY6 A;  4NB3 A;  1N33 L;  2NUA B;  1WOC A;  4DV0 H;  2KCC A;  5M9O A;  3SE7 A;  2OXP A;  2BCO A;  4ME5 A;  4BBR G;  1W96 A;  4QWD A;  3GTJ A;  4DR5 H;  4R8N A;  3G4S A;  4A3F H;  2KHI A;  1SRO A;  3GTG A;  3CCR A;  4C3J B;  1UNN C;  3HB9 A;  1PRT F;  4G57 A;  1KL9 A;  4KKU A;  2ZDG A;  5D1O A;  3J81 E;  2LFN A;  2ZM6 Q;  4KLK A;  5EBC A;  2HVS A;  1WFQ A;  1E1T A;  4DKA C;  1MZB A;  1ZQ7 A;  5KFT A;  1NY4 A;  1TQO A;  3K0X A;  4ID6 A;  2DY7 A;  3UDG A;  1Q1B A;  4HAE A;  3JSN A;  2EDG A;  1Y14 B;  4EQP A;  5IOD A;  4TUY F;  2W8K A;  4JI3 L;  1DOK A;  3T13 A;  1X3P A;  4YY3 L;  1AUV A;  1TII D;  3A8I E;  4ZUI A;  5FLM H;  3I4N B;  4YJ3 F;  1S5F D;  1WH2 A;  4OO1 H;  4YWM A;  2EE1 A;  2FLL A;  3GTL A;  4LF6 L;  2TSS A;  5KIX A;  2ID0 A;  4QWA A;  2GPS A;  4ECU A;  3PO3 H;  4O1N A;  2K04 A;  2VNU D;  1S68 A;  4X62 H;  4Y52 H;  4EEY A;  4BS9 A;  1XMQ Q;  3T5L A;  3PUX A;  1QJO A;  3GLK A;  1HH2 P;  3TII A;  4OL7 A;  4ABN A;  2N3S A;  2ICE C;  1Y1W G;  4AYB E;  4G7H C;  3VR2 A;  1GUG A;  2K50 A;  3N6R A;  1NBW A;  1II3 A;  5FJ8 H;  1ROD A;  3LX0 A;  3QB3 A;  2AQ4 A;  1N34 L;  4L5S A;  5JJL A;  4RGT A;  2W9B B;  2MQH A;  3D3R A;  1HNW H;  1PTO C;  3U9O A;  2UU9 L;  5BPF A;  1CQJ B;  2RDH A;  3HOZ G;  2HHH H;  2XWB B;  4J9K A;  2IHE A;  3N52 A;  2QF7 A;  2X6G A;  2NU9 B;  4DR1 H;  3E0J A;  4MTN A;  1TWF A;  1PTO H;  1PFB A;  2R8I A;  5BMV F;  3EPI A;  4UCR A;  3OSO A;  5C6A A;  2RDI A;  3M7N A;  3GV3 A;  1YNN D;  2I5M X;  5ELD A;  2F4I A;  2WB1 B;  3KAL A;  3NSW A;  2KHJ A;  4C3H H;  3J80 E;  2BH2 A;  4K5W A;  1CS0 A;  4LF7 H;  2YRW A;  3MXN B;  4ECR A;  2E74 C;  1XNR Q;  3K6O A;  5K36 G;  1JOO A;  5KFX A;  5ELN A;  1VQ7 A;  4A3L G;  2UUC H;  2ES2 A;  2FIN B;  3J7A V;  2OEO A;  1UE6 A;  3KUP A;  1RJR A;  4YAJ B;  4IFD H;  4P74 A;  2PZU A;  2WYO A;  5C1P A;  5KFN A;  1TS2 A;  1BVS A;  3NXW A;  4A3I H;  4RNO A;  3PW2 A;  3T1Y Q;  2VPQ A;  2VW9 A;  2R93 G;  3OW7 A;  1L1O B;  5EKI A;  5JEA G;  3RUZ A;  5EJW A;  2RF4 A;  3A0J A;  4HTH A;  2FJ2 A;  1PH1 A;  2CW0 D;  3BZD B;  3D4D A;  2E2I H;  4HJ9 A;  2R7D A;  5EPL A;  2VQE H;  1B9N A;  3TME A;  2PW7 A;  1RJP A;  1ULZ A;  1S0O A;  1O75 A;  2K03 A;  1GLV A;  1ONL A;  5EGT A;  2V58 A;  5T1I A;  1UC9 A;  1M0W A;  2B2W C;  1H9J A;  3UE1 A;  4DNI A;  1RTN A;  3LWB A;  4CC5 A;  4HID A;  4LF4 H;  3LGJ A;  5L9X A;  2R7Z A;  4DAP A;  3GTK H;  4XQQ A;  1EYG A;  3H15 A;  3QOL A;  2I46 A;  5KEE A;  4UAI A;  2QDL A;  2IX3 A;  1E1O A;  3CF5 A;  4HIO A;  1NMF A;  2Q2T A;  2YCH A;  1KDA A;  2EY5 A;  1FJG Q;  5DLQ E;  2O5J C;  4DA2 A;  5C4H A;  5ELE A;  2B2Y A;  1J5E H;  4DR6 H;  5M3F B;  4N9P A;  5I9O A;  5DQH A;  2DJF C;  2YU9 B;  4DV2 Q;  2R84 A;  2NVX A;  4YHH L;  2PN1 A;  1PH7 A;  2A6H C;  2CWA A;  3PF4 A;  2KVM A;  2K5H A;  4U68 A;  2KCM A;  2P0A A;  1AN8 A;  5IGD A;  4DU9 A;  1GD7 A;  2R85 A;  2PVP A;  3H3V C;  2GVA A;  3HKZ B;  1X54 A;  3CC2 A;  3MR5 A;  1TWG A;  1LTB D;  4JI7 L;  1LTS D;  3OWF A;  2FK3 A;  3CVZ A;  2R7N A;  1K83 B;  4RU9 A;  3S1N B;  1Y69 U;  3CW2 C;  3H3V H;  1A6X A;  4YCW A;  2EJG C;  1BNZ A;  2DPI A;  4EYI B;  3M9M B;  1EU3 A;  2NN6 I;  3VPC A;  5ELC A;  3CC7 A;  2Z4H A;  2PQE A;  3KHR A;  4R4I A;  4O3P A;  4K0K Q;  1JT8 A;  1XPO A;  4UDU C;  4DV7 L;  4LF8 Q;  1K8O A;  5JAV A;  1VQL A;  4MTE A;  4C1N K;  5JVH 3;  4FF4 A;  3H6M A;  4FBU A;  1WVL A;  1CZG A;  1NUC A;  3KK7 A;  4WOR A;  3PR5 B;  1SE3 A;  4XYL B;  3HOV B;  3VPB A;  3I4M H;  2OT2 A;  4HIK A;  1TWC A;  4X66 Q;  4DN4 M;  4J9O A;  3MHB A;  4DAM A;  4BXX G;  1PRT C;  2J6U A;  4K6L A;  3L2P A;  3RZD H;  2UVW A;  3H0G H;  2QKI C;  3EIV A;  3V6H A;  5D1P A;  2A6E C;  4TQS A;  1ML0 D;  2R92 H;  4J9Q A;  4DR7 L;  3N42 B;  4NLG A;  2XGT A;  5D3I B;  1HFN A;  4B3T Q;  4A3C H;  4JV1 A;  1LT4 D;  3DMU A;  4DK3 C;  4HED A;  1EY5 A;  3T5K A;  4EGV A;  2D2C C;  4LK1 C;  4AQY Q;  5IWA Q;  1CQV A;  1X3G A;  1Q8I A;  2VXW A;  1N36 Q;  1GSO A;  4MV7 A;  4JI5 H;  2K75 A;  5C4Z A;  1HNZ L;  1PMR A;  1WCM G;  4DV6 L;  5M3M B;  3R5H A;  5KFY A;  2NN6 H;  3URY A;  4JI1 L;  1IYJ B;  2IL8 A;  2VB3 X;  5EWE A;  1RHP A;  4GKK L;  2F3W A;  5AJ3 L;  1EFW A;  2K01 A;  1X56 A;  4ECX A;  4HR7 A;  2A1A A;  3M9B A;  4KN4 C;  1P8L A;  5EQ0 A;  4JI6 L;  4DR2 H;  4FF1 A;  3NBH A;  4LFC Q;  2PBZ A;  4RGM A;  3U9S A;  3TSS A;  3NTH A;  4ZK9 B;  1X3Q A;  4ZKC B;  1IBK L;  1IBM Q;  5J2U F;  5LMN Q;  1W3S A;  4HMI A;  4LUV A;  4DV3 H;  1SLJ A;  1EQT A;  3F8N A;  1TVX A;  3TRE A;  5EWF A;  4JI2 H;  3D8G A;  3TP8 A;  3S17 H;  3S15 B;  3J81 W;  2L55 A;  3OHB A;  5GAG C;  3J7Z C;  1STE A;  1X65 A;  5KG6 A;  4PWQ A;  3BDO A;  4CJ0 B;  1TR5 A;  3FKI H;  2I87 A;  2J4X A;  5KX5 F;  3RB0 A;  1Q3L A;  4IJL A;  3AEV A;  3K5L A;  1ZXT A;  3JC6 6;  5GAH C;  3BA8 A;  2J0T D;  5I6W A;  5LMN W;  4TQR A;  4X64 Q;  4BBS G;  3PO2 B;  3Q23 A;  3K8A A;  1OXS C;  3ORR A;  4E4T A;  4YR2 A;  1GM5 A;  4ULL A;  1Y1V A;  4F50 A;  4UCS A;  4K5X A;  4RH6 A;  4AH6 A;  3GTP H;  1W6J A;  1DZ1 A;  3NEL A;  2UXC Q;  2E2H B;  2KUM A;  2XC9 A;  2HVR A;  1PHJ A;  2VZA A;  4R8U B;  2DPJ A;  5L1K A;  3CAM A;  2WTF A;  5KFW A;  2PNR C;  5DGA A;  4B3S H;  3AFP A;  1S40 A;  2JA7 B;  3M4O H;  5C0X H;  3A8J E;  4JI8 H;  3T16 A;  3VR3 A;  3M3Y H;  3SHL A;  4TVA B;  3A5U A;  4XYQ A;  3S2D B;  1KJ8 A;  3TN2 A;  4RWS C;  1CTM A;  5BN5 A;  3MXN A;  1KC8 C;  4MV3 A;  1Z9F A;  1XMO Q;  4BWS C;  2RA4 A;  1A9X A;  4DL7 A;  3PZP A;  2JEG A;  4GZY C;  2F0W A;  4IUN A;  4IJH A;  2L9H A;  3CC4 A;  2CKZ B;  2N49 A;  2F0J A;  5IYC G;  4FBT A;  3S2H H;  4RAU C;  5FLX c;  1UC8 A;  5IGE A;  2UXB L;  3OIQ A;  3RTX A;  4PMW A;  1S03 G;  5IGC A;  4O3S A;  1U4L A;  1ICW A;  4C3J G;  2AWN A;  1JCK B;  3AQQ A;  2I8C A;  1B44 D;  3J7A K;  5KFF A;  3K7A B;  4NXN Q;  1EYD A;  2BE5 D;  2JA8 H;  2F0I A;  2PZW A;  3MFG A;  4RZR A;  5IT9 L;  2K05 A;  4MAM A;  4U67 3;  2ZXO A;  3IKJ A;  2F0S A;  4RB2 C;  3J80 W;  2F1M A;  1ENA A;  4IO9 A;  2AGO A;  3STB D;  1W93 A;  1M90 C;  1EY7 A;  1MGS A;  1ZYR D;  2Z6B A;  2WE6 A;  5KG2 A;  5KFO A;  3QZ8 A;  4NP5 A;  4QL5 A;  4BA1 I;  2D9U A;  4IPH A;  3EFX D;  2N88 A;  3JRW A;  3N8D A;  4DR4 H;  4DNR B;  1XXG A;  2UUA Q;  1MD2 D;  3H0G G;  2W9C B;  3I4N G;  1CZW A;  1JIC A;  3F2U A;  3M7G A;  3OMC A;  2F3V A;  2WFW A;  4IOC A;  4QF4 A;  4DV0 L;  1UE7 A;  4Q5V A;  5CAE B;  4JI0 H;  1QB5 D;  5KFM A;  4DR5 L;  5IIF A;  1YNJ C;  3N41 B;  2YS7 A;  1STA A;  3VA7 A;  4R4C A;  2NVY B;  2SDF A;  3H20 A;  1KRT A;  4H13 C;  3RGX A;  2VA3 A;  5HGT A;  5KT6 A;  3OUZ A;  2UVV A;  4A75 A;  2KEN A;  4B3M H;  2YU9 A;  2PI2 A;  1OTC A;  1U0L A;  2F0T A;  4EBD A;  1B8A A;  1Q8K A;  1ENC A;  1STH A;  1GO3 E;  1GJX A;  2AWO A;  4GLX A;  2NN6 G;  4RKL A;  1TKW B;  4AYB B;  3BQ2 A;  2W6N A;  2QDB A;  4C2M B;  2XGQ A;  5FPR A;  1VQJ A;  3ER0 A;  4Q0Y A;  4KHZ A;  4B3R L;  1B6S A;  1E4G T;  3CKI B;  3TS0 A;  3K3P A;  4PG3 A;  3GIK A;  2A69 D;  4LF5 H;  1K83 A;  3NEM A;  5C44 H;  4JI4 H;  1E4E B;  3V6K A;  3KF8 B;  2DZD A;  2QYZ A;  1Y8N B;  4EGQ A;  1JB3 A;  3DLL A;  1GYF A;  2R8K A;  1QWY A;  2NTS A;  5KG0 A;  4QB4 A;  3J7A F;  1VQ6 A;  4X62 L;  2UXD Q;  2WB1 G;  3RLF A;  2JA5 B;  2JEA I;  1QG7 A;  3TEH B;  5DM6 3;  1ASY A;  4YR3 A;  3WNZ A;  4IUT A;  3NE5 B;  1R4Q B;  1EY0 A;  2Z6K C;  4OIK A;  4J9L A;  3GV5 B;  1HZA A;  5M5W H;  1V1O A;  3Q8R B;  1TWH H;  1HA5 A;  1NAP A;  3U50 C;  3Q8P B;  3K80 C;  1ESF A;  1KDC A;  2F0K A;  3R93 A;  3GTJ B;  3S9W A;  2IX0 A;  1PH5 A;  2EIF A;  1ILQ A;  1KJ9 A;  1DV2 A;  1YJN A;  4I7A A;  1U5K A;  1HNW L;  4O2B F;  3QO2 A;  1MJC A;  2B39 A;  3SEB A;  3WOF A;  5BPH A;  1KC7 A;  2YZM A;  1B50 A;  5KFD A;  4N9T A;  1D1I A;  1KNE A;  2AKW B;  1TY0 A;  5LMU H;  2R8G A;  1BGW A;  3C1E A;  4RB3 C;  4LWC A;  3A8K E;  2Y0S A;  5F9L A;  1C8C A;  4A4I A;  3I90 A;  4IR9 A;  1DGS A;  3FRP B;  2NYZ D;  1YIT A;  2W57 A;  4GN4 B;  3R8B A;  1IOV A;  2HGS A;  2AQ3 B;  4JC0 A;  3WOE A;  4P2C B;  4ECT A;  4ECQ A;  4LF7 L;  1VF5 C;  4JV5 H;  4MV4 A;  2B8G A;  2V4D A;  1CUK A;  2HIV A;  4OX9 Q;  1G2S A;  1EOV A;  2F0N A;  2RDF A;  1DV1 A;  1E2W A;  2UUC L;  3K5O A;  2GN5 A;  1PDQ A;  4JOI C;  3GTM H;  4LF8 H;  2WDT A;  1E7Z A;  2PW5 A;  3HOU B;  3PW5 A;  3KLS X;  5JUM A;  3UI2 A;  3DF7 A;  4RGN A;  4RCO A;  2OWO A;  1AEX A;  5M3F G;  1EZ1 A;  3PR4 A;  4L63 B;  1JE5 A;  5EBD A;  5CMD A;  1JJ2 A;  3MFH A;  3VDY A;  5COR A;  2YYZ A;  4A76 A;  4TSS A;  1O7Y A;  2VQE L;  1KAW A;  1Z2N X;  5KFS A;  3RIZ A;  2HDM A;  3TRZ A;  3BVZ A;  2RDG A;  3NWT A;  2YS6 A;  3HKZ G;  5IGG A;  3UDF A;  3HOW B;  2E5L H;  4F88 A;  3KAJ A;  1KXL A;  4LF4 L;  4UP8 A;  1X3E A;  4BBR H;  1NE3 A;  1S5E D;  4BY1 B;  5DNF A;  2M2L A;  1EIH A;  2LS0 1;  4IUR A;  2F0D A;  4KJO A;  4R8U A;  2MO1 A;  1JWU D;  3E3X A;  1TWF B;  2EYL A;  2MP1 A;  2W8L A;  1NSN S;  1PTO F;  2JA7 A;  1JWS D;  1KJQ A;  4Z9C B;  4WJ4 A;  1J5E L;  4DR6 L;  1SMY C;  4A3K B;  4M7E A;  2JYO A;  1TT2 A;  3HOV G;  1N32 H;  3HOX B;  1BUV T;  5GON F;  4LFC H;  1SR3 A;  3AFQ A;  3KYH C;  4DV4 H;  3MA2 B;  3JAM L;  1QVF A;  2CFM A;  3CCQ A;  5C4X B;  1KLU D;  1AE3 A;  1I94 H;  5KT2 A;  1SJH D;  4ED8 A;  4LW1 A;  1I50 A;  4FXG C;  5C44 G;  4LFB L;  5ELO A;  3W5O A;  2EYO A;  4TV9 F;  3DM1 A;  5E1F A;  1HNX H;  3CRK C;  4U7C A;  4KN7 C;  3HGB A;  1F9P A;  2Y0S E;  3L0O A;  1HR0 Q;  2RSO A;  2FLN A;  2WKC A;  1SYG A;  1WD1 A;  1GUW A;  3S1M H;  1VQP A;  2BH8 A;  1HZB A;  4DUY H;  5M3M G;  5CGK A;  1AZQ A;  2MGS A;  1Y1W H;  5JVL A;  2FXQ A;  4Q8E A;  4LUZ A;  1K3R A;  3SE0 A;  5LHY 1;  2R7Z B;  1ZHQ A;  3ND8 A;  1Q46 A;  4PV1 C;  2HJW A;  3QOJ A;  3X3M A;  3AYH B;  3Q2O A;  5F9N A;  1BBW A;  2RCF A;  3HZX A;  5IYB G;  1SMX A;  4EG0 A;  5I47 A;  3U9T A;  2NZO A;  5KFE A;  1IKM A;  1ESR A;  2K7V A;  4JYA H;  4FP5 D;  1EUC B;  2KQ3 A;  2C9O A;  3RZO H;  3BYT B;  1XNQ H;  2EZV A;  2VQF H;  4LF9 Q;  3KAK A;  4DUZ H;  4IFD J;  3F2C A;  1K1S A;  1CK1 A;  2NVX B;  1FKA H;  3IFT A;  4O4H F;  3CD6 A;  4GNX A;  3TP5 A;  5KFU A;  2DGY A;  1EY4 A;  5CV4 A;  4JI5 L;  1AUX A;  3S1Q B;  4BA2 I;  3JAM c;  5K36 H;  2PYK A;  1KHI A;  4IHJ F;  1EY6 A;  3GTO A;  1HTP A;  1F2Z A;  1TWG B;  3NTI A;  4GN3 B;  3PO2 G;  4A3L H;  1FGU A;  3H94 A;  4ZOL F;  4DR3 H;  3MAQ A;  2I07 B;  3BYY B;  4N8X 1;  1RYS A;  1IXR A;  4LFA Q;  4DR2 L;  3GTG H;  1GVP A;  4CC6 A;  1PZJ D;  2R93 H;  1OXX K;  1MHW C;  1BCP C;  2JA7 G;  4UCO A;  4DV3 L;  2BQR A;  2SOB A;  3MWM A;  3PIP 3;  3K5H A;  2F0H A;  1B53 A;  2MJ8 A;  4JI2 L;  4L6T B;  4TQU S;  4ECY A;  3GIJ A;  2JA5 A;  2EYP A;  1FNW A;  1I7N A;  4X65 H;  2E2J H;  3MR3 A;  5EKL A;  4X6A H;  1W2B A;  4EEQ A;  2EYM A;  2B2V C;  1KEE A;  4A3G B;  1IBL Q;  3PUW A;  1J6Q A;  2NBF A;  4HSP A;  2H4O A;  4R4Q A;  2O03 A;  2B2U C;  3WWV A;  5DG8 A;  1PTO D;  2DLN A;  3MXU A;  5FOB B;  3OUU A;  3V6J A;  3GTL H;  1XTC D;  1B2T A;  3HOU H;  1CKM A;  4UCT A;  2I5H A;  1R4P B;  2A5H A;  1G6Z A;  3PUZ A;  3D31 A;  3OTO H;  1BQQ T;  4F4Y A;  4HYK A;  2I5L X;  4B3S L;  1HCZ A;  2UU9 H;  4BY7 B;  1M6V A;  1JJG A;  3OOC A;  3S14 H;  4JI8 L;  4YJ2 F;  4C5B A;  5I2X A;  1FGB D;  1CI3 M;  1N33 Q;  2VUM B;  3M85 A;  4PNY A;  4YWL A;  4EQO A;  3FPP A;  3MTS A;  4HR7 B;  4GKJ H;  3GTQ B;  3NBH B;  1ICF B;  3I4L A;  2CQY A;  1EEF D;  1X55 A;  4H0L C;  1QE6 A;  4QUF A;  5D3D A;  1G91 A;  1EUD B;  4R1J A;  4KY7 A;  1N9W A;  1U9R A;  5LL6 X;  3ULP A;  2F0P A;  5GAE C;  5JPN C;  2ASB A;  1UWV A;  4UPA A;  4IAJ A;  2JA6 A;  1BKB A;  3K58 A;  2K5D A;  4RNN A;  5EKK A;  4AYB G;  2YTV A;  1Q82 C;  3CQZ H;  3KHL A;  4DV5 H;  4YIJ A;  4DL4 A;  1JMC A;  1YHB A;  4JI3 Q;  4EQN A;  4L5Q A;  3D0F A;  5I6Y A;  4YY3 Q;  4GOP B;  4ZQ3 A;  2QA4 A;  4F8M A;  1FVI A;  1SNP A;  4BXX H;  1Y1V B;  1L0X B;  2KEC A;  1PA6 A;  4DR4 L;  4LF6 Q;  3FP9 A;  2MCT A;  3SGI A;  1QOH A;  1YHA A;  1JQY D;  2K1B A;  1C48 A;  2Z9H A;  1EYZ A;  3T1H H;  1S9F A;  1YJW A;  3J81 j;  2R7F A;  1FL0 A;  3AB9 A;  4JI0 L;  5IE8 A;  1C3O A;  1ZHS A;  3L9A X;  4HCS A;  1RYR A;  2R8H A;  3ND9 A;  2JA5 G;  5KG5 A;  1Q81 C;  4QJF A;  3PW7 A;  4CDC C;  2A6H D;  4B3M L;  1DOM A;  1GKH A;  1NCV A;  1XWE A;  1LTA D;  4XQJ A;  2R86 A;  1WCM H;  2RVL A;  3S24 A;  4FF2 A;  5JQW A;  2F3I A;  4F7X A;  1N34 Q;  3Q8Q B;  1CKN B;  3V05 A;  2WP8 J;  2UVR A;  2R7Z H;  4K8J A;  4V0B A;  2C28 A;  2UU9 Q;  4F87 A;  1SFO H;  1OWT A;  3FDS A;  4KI0 A;  4KHP H;  5C8Y F;  4O2D A;  1LAC A;  1EYA A;  2B2Y C;  3SXH A;  2YV5 A;  4NXM H;  5IY0 A;  1A3V A;  4ILW A;  4ED2 A;  4KJN A;  4LF5 L;  1PZK D;  4Q43 A;  2HQE A;  2R3Z A;  2JQO A;  5M5Y H;  4A93 B;  1JOR A;  3OPO A;  3K81 C;  4JI4 L;  1PK8 A;  2CH4 A;  2LMC B;  2WV6 D;  1F9R A;  1WSC A;  4HNV A;  1D5X C;  4HN7 A;  1HTL D;  2NVX H;  4A3M B;  1HUN A;  4QWB A;  1JLL B;  5I4D A;  1WYD A;  5M5X B;  3ETH A;  1DCZ A;  3RN5 A;  1EL0 A;  5C3W A;  4O3N A;  4X3K A;  3FMC A;  5IT9 E;  5C0X J;  1PRT D;  4BBS H;  4O2A F;  1LO5 D;  4M1U B;  3K5N A;  5IP9 G;  3RR5 A;  3M4Q A;  4DV1 L;  2A6E D;  3HOU G;  5CBE E;  4GC7 A;  2A19 A;  1L2F A;  3HEJ A;  3VR6 A;  4K8I A;  3E5N A;  1JWM D;  1KQS A;  2XIW A;  3IN5 A;  4DL2 A;  5LMU L;  4QW8 A;  3SK8 A;  3CCL A;  5KG7 A;  1PH2 A;  1A15 A;  3E5S A;  3C3L A;  5CYU A;  1V1P A;  1F9Q A;  3VR4 A;  1RDP D;  1C4Q A;  4WJ3 M;  2XCL A;  4C3I B;  3GD7 A;  1TWA A;  1A3T A;  3F1Z A;  1DXM A;  1I4H A;  1EQV A;  1TWC H;  3HOW G;  4R8I A;  5HBR B;  4DGZ A;  4R4O A;  1K9M C;  1GUN A;  2Q2U A;  3HOY B;  3CXC A;  5BR8 H;  4JV5 L;  5IYC H;  3L7Z C;  3CP0 A;  1EY9 A;  3BS1 A;  1A8V A;  3PIP A;  4BWG B;  2E2I A;  4BY1 G;  1HR0 H;  4CDE C;  2AGQ A;  3CMA A;  1O80 A;  2ZDH A;  1LAB A;  4C3J H;  1TA8 A;  3RFC A;  2PMZ A;  1GHK A;  1VBH A;  2G9D A;  2DJG C;  5L1L A;  2F4V H;  2WIN B;  2XCA A;  4EVO A;  3QIA A;  1QNU A;  4YHH Q;  4P71 A;  2FMM A;  4A3K G;  4YAK B;  2N55 A;  3DWA A;  2KBN A;  1F9S A;  3H4D A;  3ERO A;  2K5V A;  3HOX G;  3BVG A;  1B33 N;  1VQ4 A;  4O4L F;  4UFZ A;  4F4Z A;  3TQ1 A;  2B2W A;  1F2Y A;  4JI7 Q;  3L3O C;  1SYB A;  5C4X G;  1G29 1;  1YI2 A;  1AH9 A;  1Y8O B;  1HPC A;  1Q86 C;  5CBA E;  1EIG A;  1K3B C;  3I4N H;  4LF9 H;  4JBW A;  4CBV A;  2E5L L;  5KT4 A;  1LTG D;  2RSN A;  3CCJ A;  4ALP A;  4KK7 A;  4RZQ A;  2FK2 A;  1VQM A;  1STG A;  3N40 P;  2RGV A;  4EFE A;  4DV7 Q;  2VQD A;  3M4P A;  2FMC A;  4JG2 A;  4LJZ C;  5LXT F;  2O5I C;  1BNC A;  2C2R A;  5L1I A;  2Y0S B;  3M4Y A;  1EWC A;  1B1Z A;  3I55 A;  4ODG A;  5KFJ A;  1B3A A;  1LT6 D;  5D65 A;  4KD3 A;  2IPK D;  2VB2 X;  3G48 A;  5J39 A;  1N32 L;  2VUM A;  2A73 B;  2R7Z G;  1X3F A;  3D6W A;  4EBE A;  4DV4 L;  5FLX L;  4DR7 Q;  3GTQ A;  2EPB A;  3SK5 A;  1LYL A;  1I94 L;  2NVT B;  2ASL A;  5JJI A;  5DLG A;  4TV8 F;  4DF7 A;  4ECW A;  2ZTD A;  1VQE A;  2IA6 A;  4RKB A;  1HNX L;  4RUC A;  1MKH A;  3NHH A;  5CB4 F;  2R6G A;  3T5H A;  4EQ5 A;  4G4K A;  3PIO A;  1HNZ Q;  1N48 A;  4DV6 Q;  3PF5 A;  3OW2 A;  1M7J A;  2IJ0 A;  2XGP A;  2JXM B;  4GKK Q;  4A3B B;  3RLO A;  1D2B A;  4U6P A;  4DUY L;  2Z4I A;  5AJ3 Q;  2ZDQ A;  1CQI B;  2YYA A;  3NGD A;  5E3F A;  3SK4 A;  2IT1 A;  4EBC A;  4JI6 Q;  4GOP A;  2VUG A;  1L1O C;  2L11 A;  3R2T A;  2ASD A;  1IBK Q;  4QWE A;  4K2K A;  3G6Y A;  5FD5 A;  2F0V A;  5A2Q E;  4QW9 A;  2K5N A;  3DEP A;  2ZM6 H;  2PMZ E;  1XDN A;  2E76 C;  3RAQ A;  3Q0A A;  1YNJ D;  1H9M A;  2PQA A;  2NVQ B;  4JYA L;  5FKA C;  2ZJT A;  3HXL A;  5GAD C;  3KLR A;  1XNQ L;  2VQF L;  2EQS A;  1SE2 A;  2F0M A;  4AIM A;  4DUZ L;  4F4X A;  1TS4 A;  2KED A;  5KFK A;  1Z6H A;  2BDN A;  3J81 c;  3OHA A;  4UCV A;  4ZHQ F;  1LTL A;  5COY A;  3OHX C;  4KKT A;  3PGZ A;  2RHS B;  2ZJQ A;  5CV6 A;  4UCU A;  3MJF A;  3KDF A;  3QR8 A;  2D5D A;  1CKN A;  1Q7Y C;  2ICI A;  4A3G G;  4MV9 A;  4JUZ A;  4FM9 A;  4NMZ A;  1NJI C;  1RF2 D;  3HP3 A;  4ZUJ A;  1I50 B;  2IP4 A;  3RBE A;  4DR3 L;  5EDW A;  3PUY A;  1WTP A;  2F0E A;  1XMQ H;  1GUS A;  3KXY T;  3RB6 A;  1S10 A;  4JBJ A;  3LNN A;  1R9T A;  5DG7 A;  2FFK B;  1SYE A;  1T5E A;  3KLS A;  3JAM E;  5CV8 A;  5M3F H;  4K6D A;  3W2D A;  4DXF A;  3I91 A;  4UP7 A;  1JR0 D;  1LTI D;  2JA9 A;  4BY7 G;  2YU9 H;  2YRX A;  5LL6 S;  4ZQI A;  4ZLT F;  4YY3 H;  4A3E B;  1RKN A;  1PFS A;  1T9H A;  4ME6 A;  2PNH A;  4P73 A;  1D5Z C;  1VAJ A;  3OYY A;  4J1M A;  2N8N A;  2E2D C;  1ASZ A;  1AN7 A;  4X65 L;  3BVM A;  4KV6 A;  3GTP A;  1VQG A;  1LTR D;  2HIX A;  2V5A A;  2UXB Q;  3HOY H;  2YW2 A;  1V1Q A;  1V43 A;  4YQW A;  4IR1 A;  4LH7 A;  1K83 H;  3PUV A;  3S1N H;  4YCV A;  3V96 A;  1SND A;  3D6C A;  3CCV A;  2PO4 A;  5CC4 A;  5KFR A;  3GIM A;  2OQK A;  1AW7 A;  3OIP A;  4LNQ A;  1IYV A;  2LXK A;  3S1R B;  3MXP A;  1XNR H;  3NQT A;  3NUC A;  1DON A;  3TIN A;  3OTO L;  3RUP A;  4CDF C;  3PV0 A;  3S16 B;  1P16 A;  3O13 A;  4GNX B;  2W9A A;  3G6V A;  3HOV H;  2F0U A;  2P5Z X;  1IZ6 A;  1S5B D;  3T1Y H;  4I55 F;  1H9K A;  3GTO B;  1VBG A;  1HQR D;  3QFF A;  2F0G A;  2Q8I B;  4Y7N B;  1XJV A;  1KJI A;  1STB A;  5IT9 W;  4DV0 Q;  2PZT A;  1Y1V G;  4O3O A;  1E4F T;  3WO0 A;  4DR5 Q;  3TDQ A;  5C3E B;  4QGU A;  3G6E A;  1I6U A;  5JVG 3;  4GKJ L;  4PZ8 A;  3MWD A;  3G8C A;  3K57 A;  3FMA A;  1E2Z A;  3MR6 A;  1I6H B;  5DQG A;  3CHB D;  2OH2 A;  2Q2I A;  1WTQ A;  2J6T A;  4P75 A;  1GHJ A;  1K8A C;  3OSN A;  4IUP A;  1D5M C;  3R5F A;  5KG4 A;  3I2Z A;  3I70 A;  2B63 B;  4O42 A;  4ETS A;  1SNM A;  2CHB D;  5M3M H;  4QCL A;  1BCP F;  3DWP A;  4XIG S;  4B3R Q;  2WAQ A;  2OCE A;  1H9R A;  2K14 A;  4HJA A;  4K5V A;  3KF6 B;  1SEB D;  4JW0 A;  1A2T A;  3T53 B;  3HOZ B;  1FJG H;  4DV5 L;  1KRS A;  2LY7 A;  1RK5 A;  2EYF A;  4WBN F;  1EZ6 A;  4IQZ A;  2X0S A;  1VDZ A;  1I4P A;  4LH6 A;  3EVQ A;  5KYI A;  5IYB H;  1UEA B;  4DV2 H;  1PH3 A;  3MFY A;  4A93 G;  2KJX A;  2BQ3 A;  2HHH L;  2EJM A;  4A3D B;  4DR1 L;  3T1H L;  3FDT A;  1JKJ B;  4X62 Q;  2VOB A;  2JE6 I;  1CA6 A;  3GV8 B;  3S15 H;  2FE3 A;  3BDL A;  4A3M G;  4RB1 A;  4FO2 A;  1SMY D;  5T14 A;  1I3Q B;  3AMU A;  3CME A;  2PPB C;  1B6R A;  1BJT A;  2VA2 A;  3NQI A;  1YJ9 A;  4A3B H;  3JZI A;  2BR0 A;  5JEA J;  4RHR A;  2DWC A;  1NR4 A;  5K2M A;  2JEB I;  1B7Y B;  4QQB X;  1GSA A;  3Q8S B;  3PO2 H;  2W6Z A;  4YB8 B;  1GGO A;  3PVX A;  4K0K H;  4IUQ A;  1HNW Q;  4ED7 A;  4KHP L;  1UE1 A;  2W71 A;  3V4S A;  2E2H H;  4NXM L;  1KBL A;  1TXY A;  3OWE B;  3MXG A;  4KTA A;  2CH4 W;  1SNC A;  1X32 A;  4QIW E;  5HUR A;  2C00 A;  2JA7 H;  2X6L A;  2JA6 B;  4X66 H;  1I4R A;  5IGF A;  1K0R A;  3ULJ A;  2EOT A;  4I65 A;  4C3I G;  1TWH A;  1TS3 A;  1VCI A;  5A2Q L;  4FU0 A;  4PMC A;  4MNO A;  4IWY A;  3S2D H;  1JDE A;  1EWH A;  1S4Z A;  4LF7 Q;  1BXR A;  5KFG A;  4EYH B;  1KAB A;  5D14 A;  2Z6K A;  5FD6 A;  4A3F B;  1WTR A;  2MO0 A;  4X3U A;  2UUC Q;  3HOY G;  3TQY A;  3UE0 A;  4IUU A;  1EWI A;  1C0A A;  4B3T H;  4CHT B;  3MR2 A;  3C1F A;  5E4X A;  2L12 A;  5KFH A;  2HDL A;  5G3L F;  4AQY H;  3EQL C;  5IWA H;  4GLA C;  4ZAI A;  4QUC A;  1JJC B;  2VR1 A;  1IKL A;  4ME3 A;  3GV6 A;  1N36 H;  1T94 A;  4J9R A;  1WI5 A;  1I4X A;  4HJ7 A;  3K7A H;  1L0Y B;  2B3G A;  1JIH A;  2VQE Q;  1HZC A;  3PQI A;  4IPD A;  2FJZ A;  1LV9 A;  4FNF A;  1EHI A;  5A35 A;  2I0Q A;  4JV2 A;  3FVQ A;  1OXU A;  2WAQ E;  1IBM H;  2SNM A;  1QUQ A;  4LF4 Q;  5LMN H;  4ED6 A;  3BG3 A;  3EJI A;  2EY1 A;  3CU7 A;  5K5P A;  1KIX A;  4HNU A;  4R7R A;  5IYZ F;  4LMQ D;  3PO3 B;  5BR8 L;  1RJQ A;  4JOI A;  4ECZ A;  4H7B A;  5A2Q W;  4ED3 A;  3T51 B;  2A74 C;  3RN2 A;  1IL8 A;  1XX8 A;  2GPW A;  1EUJ A;  5GQO A;  2NVY H;  2FP4 B;  1BCP D;  2Y0S G;  1J5E Q;  4DR6 Q;  4NKL A;  1HFG A;  2F4V L;  3KBG A;  3ITP A;  4X64 H;  3W3A A;  3Q6S A;  1CA5 A;  3V4Z A;  4Q44 A;  3OSP A;  2EXZ A;  1MI2 A;  1O7L A;  2DY8 A;  2K28 A;  4MN3 A;  5FO8 B;  2ZJR A;  4YP3 A;  2ALZ A;  1LT5 D;  4C2M H;  3RF2 A;  2V1C C;  4NW2 A;  4B9X A;  5IP7 G;  4CKB A;  1BOS A;  4GLV B;  4CKC A;  2UXC H;  3GTO H;  1B3Q A;  3VYS A;  3T5J A;  2HD3 A;  1PTO B;  4RG1 A;  4LFB Q;  2NTT A;  1UNS A;  4DL6 A;  4DFA A;  3GIL A;  2K33 A;  5C3E H;  5IYD G;  2E75 C;  3DM3 A;  2Q8R E;  4IUV A;  5JJK A;  1EOT A;  4DLK A;  1SN8 A;  4A3J B;  4ED0 A;  4C3H B;  1AE2 A;  2HQL A;  1SAP A;  3JAM W;  3NK9 A;  4PQX A;  3B6Y A;  1V4Y A;  1XMO H;  2ZJP A;  2R7L A;  3RBD A;  1GOZ A;  2G9H D;  4I50 F;  1CT1 D;  2ZT9 C;  3BA9 A;  1V1P B;  2JA5 H;  2UUB Q;  4K14 A;  1XPR A;  1SYC A;  5KFV A;  2R87 A;  2RGR A;  1EIF A;  4A3B G;  1TWA B;  2OQ0 A;  3LWE A;  3MFI A;  4A3I B;  1OXT A;  2IW3 A;  5FPO A;  2C22 A;  2B2T A;  2V59 A;  4NXN H;  3GTJ H;  2D0P A;  2E2I B;  1VMC A;  4C5C A;  4MV1 A;  4FVM A;  3MC0 B;  1D6E C;  2M9V A;  2PMZ B;  1FD7 D;  2ALY B;  2DNC A;  1IW7 C;  1SJE D;  5KFL A;  3L4J A;  1VQD A;  3E0E A;  2V9W A;  1G2T A;  5I9P A;  1Y1W A;  3N43 B;  1I4G A;  1HZ9 A;  4QY7 A;  4RCN A;  1ILP A;  2UUA H;  2B63 A;  1WD0 A;  4JI5 Q;  3GTK B;  2MHV A;  1PZI D;  2Z1C A;  3GQB A;  5FK9 C;  3HRZ C;  4Q45 A;  5NUC A;  3KF6 A;  3HKS A;  3R2I A;  4TRD A;  3V2T A;  1U4R A;  1LT3 D;  4MIU A;  1VQH A;  3PMF A;  3R23 A;  1S0N A;  3G71 A;  2ZXR A;  3W1B A;  5CR3 A;  4DR2 Q;  5IP9 H;  1G6P A;  4XX0 B;  1D1K A;  1VQN A;  1BXT A;  2CQA A;  5JPM C;  1AP0 A;  4XXE A;  1JE4 A;  4DV3 Q;  4HJ8 A;  2AUJ D;  4OO1 I;  2EY2 A;  2ZM6 L;  4J9S A;  1PYS B;  2QEJ C;  1DM0 B;  4JI2 Q;  2CQO A;  2A68 C;  4KY5 A;  2IHF A;  4YWK A;  2AU0 A;  1QVG A;  4FS1 A;  4WD3 A;  2EXD A;  4A3E G;  2TMP A;  1PXU A;  1I3Q A;  1SBB B;  4QMG A;  4P72 A;  1HHV A;  2QK4 A;  4JPB W;  2JEJ A;  1VQB A;  2LKV A;  1PH6 A;  4DAV A;  4FS2 A;  1L2Z A;  1MSG A;  3T4A C;  5CA0 F;  3HOW H;  4NDX A;  1W6K A;  3QWN A;  3KLW A;  2R93 A;  1X9N A;  1HJP A;  5ISR A;  1RIP A;  2XRQ D;  3QZ7 A;  5KFA A;  3H91 A;  1YIJ A;  1ZEQ X;  4BY1 H;  3PCO B;  5EPJ A;  2JP1 A;  2M00 A;  4UHV A;  2UXD H;  3DWQ A;  3D4R A;  3IL8 A;  3A7L A;  1Q90 A;  1QCB D;  1XMQ L;  1TWF H;  1VMP A;  2RQX A;  3I4O A;  4B3S Q;  3K7U C;  5KFQ A;  3I4M B;  4DL3 A;  4B3R H;  3U58 A;  4JI8 Q;  4A3K H;  5FLX E;  2W7P A;  2ASJ A;  3MWY W;  2KOL A;  2NU7 B;  3CCU A;  3HOX H;  3RZD B;  3H0G B;  2K4K A;  3U4V A;  1KD1 C;  1T3N A;  2B2V A;  1GUO A;  2R92 B;  3RB4 A;  1J9O A;  2HUG A;  1XTD A;  5C4X H;  3PIO 3;  1PH4 A;  1PRT B;  2CZG A;  2H1E A;  2B2U A;  4YCU A;  2W6O A;  5C3E G;  1UEB A;  4I7Z C;  1XPU A;  2FPP B;  4FXD A;  4IFD I;  2L15 A;  3JAM i;  2RHQ B;  5EPK A;  1K8M A;  2W6Q A;  2QCP X;  2PQA B;  4HMJ A;  2DUD A;  1UE5 A;  2Z8L A;  3I7F A;  4J8Q A;  2G5D A;  4EX5 A;  4OWW B;  1VKZ A;  2FMA A;  2BDO A;  5KT3 A;  3TBI B;  3BQ0 A;  1PVO A;  1IHZ A;  5FO7 B;  4OX9 H;  1XNR L;  2B63 G;  3KFU A;  2GLT A;  3W1G A;  2UVU A;  1JC7 A;  1DOL A;  5D8D A;  1E2V A;  5LYJ F;  4A2B A;  4DPG A;  1V8Q A;  3KDF B;  2DN8 A;  3QG1 A;  5C4J B;  2RDJ A;  4IRK A;  1PV4 A;  2D62 A;  4DR4 Q;  3T1Y L;  2OTJ A;  3HBL A;  4OXP A;  4RA8 A;  1DJR D;  1QZG A;  1E0B A;  1SDF A;  2J7Z A;  1STY A;  5GRO A;  3LML A;  3S17 B;  4JI0 Q;  1R9T B;  4A3D G;  4HJ5 A;  3FKI B;  4A3J H;  1VQO A;  4XQN A;  3CQZ A;  2JSO A;  1V51 A;  4J9P A;  3VYT A;  3M9N B;  4K2L A;  3H4B A;  2MUY A;  3MVV A;  4I4T F;  4B3M Q;  1YEZ A;  2AMC B;  3P1H A;  4UY8 C;  1GXD C;  1TWA H;  2L4N A;  3S1Q H;  4MTK A;  2GVB A;  2W6P A;  3GTP B;  4S3S A;  3BU2 A;  4X3S A;  4RAZ A;  1TWG H;  4X3T A;  1I6V C;  2NUC A;  2W7O A;  2PCF B;  1TU2 B;  1FNU A;  2HCI A;  1FJG L;  4LF5 Q;  2IY5 B;  2R61 A;  1SRU A;  3K59 A;  1SNQ A;  1QNK A;  3M4O B;  4OHJ A;  4JI4 Q;  1SE8 A;  1Z2O X;  4DXG A;  1B4O A;  1G51 A;  3M3Y B;  3H09 A;  4DV2 L;  3H3V I;  4QIW B;  2CWP A;  4O0A A;  2JA6 G;  1WCM A;  2XTI A;  2HT1 A;  1KAA A;  1PLF A;  3PW0 A;  1A62 A;  1RJT A;  1PH9 A;  3S2H B;  4CGY B;  2ZXP A;  1SFO A;  2FPG B;  3IAY A;  5C3X A;  2C2D A;  3L4K A;  4A3F G;  2X69 A;  1A2U A;  2O4X A;  4A3G H;  4LSX A;  4IZO A;  2NU6 B;  4DV1 Q;  2JA8 B;  4IOA A;  1I4Q A;  5KT7 A;  2XN9 C;  1RCV D;  3M9O B;  4ECV A;  3K5I A;  4ZKB B;  4K0K L;  4LF8 L;  1YNN C;  3AU7 A;  2QIL A;  3LWU A;  4LUO A;  4PZ7 A;  5DLF A;  5LMU Q;  3WO1 A;  5LOV F;  1F2M A;  2IMW P;  3SR1 A;  2ZTE A;  1VQ8 A;  1BBX C;  3ZYY X;  2R7M A;  2V4Q A;  2ATW A;  1FR3 A;  1PYW D;  4HSV A;  4BY7 H;  1LM0 A;  2OTL A;  4FDB A;  4X66 L;  4V19 0;  3GTK A;  5FLM G;  3Q22 A;  2ATL A;  4LFB H;  3FEW X;  5EWG A;  4OO1 G;  1M0T A;  2WAQ B;  4C56 C;  2VUM H;  2VL6 A;  1MJE A;  2CVR A;  4JV5 Q;  1KLG D;  3CCS A;  2MFI A;  1SEI A;  1VF7 A;  3RV3 A;  4CJ1 B;  3H40 A;  3PO3 G;  3A56 A;  5F2D A;  3PSI A;  4L5R C;  3GTQ H;  2CW0 C;  1UAP A;  4IAL A;  4B3T L;  1WTH A;  2C35 B;  5JH7 F;  3C46 A;  3I8Z A;  1VQI A;  3SI8 A;  4DAY A;  4FYD A;  1S5D D;  5JVD F;  2UUB H;  1H9S B;  4AQY L;  1WJJ A;  5IWA L;  2NWG A;  5CV5 A;  3BZK A;  5FJ8 G;  1N36 L;  1H95 A;  1JXL A;  4MHE A;  1XYI A;  3GID A;  4GOP C;  3J81 L;  1B70 B;  1JB7 A;  1OO9 B;  5KRU A;  1BR9 A;  5C44 B;  1TAE A;  4ED1 A;  4LFA H;  2EJF C;  4LFC L;  4UP9 A;  4OEM B;  2F03 A;  2XSC A;  2E5L Q;  1SXT A;  5L37 A;  1IBM L;  1YZ6 A;  4PZ6 A;  4CJ2 C;  5LMN L;  1Y1V H;  1T5X D;  2SNS A;  1VQC A;  5KND A;  2R82 A;  2IX1 A;  3A74 A;  3LP8 A;  1B04 A;  4MA0 A;  5AFW A;  4A3J G;  1N8R C;  4C3H G;  1AZP A;  5DM7 3;  3K3V A;  3U4Z A;  4WRD A;  1RK6 A;  4GC6 A;  3CRL C;  1EIY B;  3NPP A;  3IFD A;  3TQT A;  5M5W B;  1F77 A;  4M8A A;  1SCU B;  4EFB A;  1TWH B;  4WFN 3;  1IBL H;  1A63 A;  4B08 A;  4IFD G;  4E6I A;  4RMF A;  4JI1 Q;  4J6H A;  4X64 L;  1N32 Q;  5C0X I;  4A3I G;  3H0G A;  2WAC A;  3EYY A;  4JBM A;  3GIQ A;  3CCE A;  5C4J H;  1UUP A;  4DV4 Q;  2R92 A;  3HS0 C;  4Q8F A;  1PYB A;  3TS2 A;  1I94 Q;  3RGZ A;  3DHQ A;  2UXC L;  4POG A;  2EYJ A;  4G3I A;  2XVS A;  5E4W C;  4YBZ B;  1IYU A;  1MBY A;  3R3O A;  1HNX Q;  1I5F A;  1BBU A;  1R9T H;  4A93 H;  4HNT A;  1QVC A;  1O78 A;  1N33 H;  3NWS A;  5ELF A;  2W70 A;  4WJW A;  3T56 B;  3UFX B;  1HQM C;  5FLX W;  4A3M H;  1XMO L;  4Q0F A;  3G7L A;  4DUY Q;  2FLP A;  4G7O C;  2FPI B;  5M5X H;  2W9B A;  2NZH A;  4KHV A;  3GTM B;  4OWT B;  3J80 L;  3D4W A;  1QUQ B;  3KOJ A;  4J15 A;  3WDN A;  2B29 A;  1FNV A;  2FB9 A;  2K32 A;  4G7Z C;  2JJQ A;  4NXN L;  2XD4 A;  3EPG A;  1VQA A;  3EBE A;  3UDI A;  4L8J A;  3DXJ C;  4JYA Q;  3UQ8 A;  5KKN B;  2FK1 A;  1EY8 A;  2WB1 A;  1K28 A;  4RUA A;  3FKI A;  1XNQ Q;  2VQF Q;  3E6Z X;  3I72 A;  4DUZ Q;  2MPM A;  4MA5 A;  4OWX B;  3HG9 A;  4JI3 H;  4QWC A;  1C9O A;  1C7Y A;  2D0O A;  3IRB A;  3K0Y A;  3BG5 A;  3KBX A;  1O7I A;  4C3I H;  2BA1 A;  4LF6 H;  4GN5 A;  3NBI A;  4BBR B;  5J3B A;  3J7Y W;  1QZH A;  1O7Z A;  1BO0 A;  2UUA L;  2VUM G;  2MNA A;  5I2Y A;  2BA0 A;  4O3Q A;  1E3P A;  1L1O A;  4DR3 Q;  5FO9 B;  5LA6 F;  3EA6 A;  2R8J A;  2NZ1 D;  2XRS D;  1HA6 A;  1K1Q A;  1YBY A;  1AFP A;  2C2E A;  1Q1E A;  5T1G A;  1U4M A;  2KCN A;  4HCE A;  1PX2 A;  1SYX B;  3ORQ A;  5BN4 A;  4QIW A;  3RD4 A;  4MV6 A;  3I4M G;  5DGB A;  1N34 H;  3ONA B;  2E8G A;  2DIK A;  1M1K C;  1CM9 A;  3RV4 A;  3RMH A;  3K5M A;  5L1J A;  3E9I A;  1KJJ A;  3GII A;  3PW4 A;  1CSP A;  2RCN A;  1NTG A;  4XT3 B;  3TZD A;  3KJP A;  4L1K A;  5HV6 A;  3VYR A;  4F4W A;  1JX4 A;  2KCT A;  4X65 Q;  1RTO A;  5IGB A;  3J80 c;  3FPU B;  5ELB A;  1A3U A;  2R92 G;  4DNT B;  1VQK A;  1KTK A;  4ZI7 F;  3DUZ A;  3TP6 A;  4FF3 A;  4A3C G;  2AQ1 B;  2VY3 A;  5KFZ A;  2K5Q A;  2KHS A;  2J6S A;  1D8L A;  2AUK A;  3NP8 A;  2YZG A;  1S0M A;  4KD4 A;  1SE4 A;  1NR2 A;  3S1M B;  1JDB B;  2F52 A;  5KGU A;  2UXD L;  3F8T A;  1Y1W B;  2L1B A;  5EOY A;  3OTO Q;  2FKL A;  2YTY A;  3BJU A;  4RHS A;  3I12 A;  1SYF A;  3GIP A;  3UDX A;  1EU4 A;  4GS3 A;  5IOC A;  3HKZ A;  1PFN A;  3RAX A;  2AGP A;  1SYD A;  1E22 A;  3A5Z B;  4IPG A;  4MZ9 A;  2KA7 A;  4MTD A;  1BF4 A;  5BN3 A;  5IP7 H;  3ICE A;  1EYC A;  1K0S A;  1Z47 A;  4KKS A;  3CCM A;  3RZO B;  3MWE A;  3J7A 5;  2BE5 C;  3J81 i;  4GKJ Q;  1BDO A;  3QJY A;  3A55 A;  3CPW A;  5IT9 c;  3PN1 A;  5KG1 A;  2NVT H;  4FXK C;  5IYD H;  3GDE A;  2XCP A;  1EQR A;  2WB1 E;  3FKI G;  1KDB A;  1SSO A;  4NPS A;  1H9S A;  2LSS A;  4XDX A;  3R5X A;  2BOS A;  4Y8V B;  3STB C;  3NTK A;  3EN2 A;  3Q8D A;  1ZYR C;  4OEL B;  2V4R A;  3VYU A;  3KHH A;  2RBM A;  1Z7T A;  2Q8T A;  4PMB A;  4OIJ A;  2O2L D;  3HFZ B;  3ZJY C;  3SVM A;  1PFM A;  4OX9 L;  4LMY A;  2K5W A;  4DV1 H;  2ENB A;  4IN3 A;  3MEF A;  5LL6 b;  2JK8 A;  3VA5 A;  4DK6 C;  1KNA A;  4DV5 Q;  1K73 C;  2XIG A;  5KFC A;  3M4I A;  1VS0 A;  3GTG B;  4C1N I;  1LTT D;  2SEB D;  2R93 B;  2YTX A;  2CCZ A;  2Z0S A;  2I80 A;  2AQ2 B;  1HUM A;  4RAY A;  3P7J A;  4YHH H;  5C0X G;  4RFB A;  4XYM B;  2HHH Q;  1EZ8 A;  5KNC A;  4R9W A;  2YL2 A;  5D1O B;  4DR1 Q;  3T1H Q;  2QGQ A;  2L0C A;  3ULL A;  3BZC A;  4JBK A;  4JCV E;  2DNE A;  1IL2 A;  2NVQ H;  3RB3 A;  1BCP B;  2JEF A;  4DK1 A;  2E2J B;  1ENF A;  3JRX A;  3TIG A;  1X6O A;  3VMM A;  3KHG A;  3RLN A;  2WKD A;  4JI7 H;  4JK1 C;  1NNX A;  1N56 A;  4HIM A;  4H44 C;  2C5C A;  2XNA C;  5DQI A;  4XTC S;  1GSH A;  2F0Q A;  4KMU C;  2A69 C;  4H02 A;  4IPC A;  1DD2 A;  4CKE A;  3G6J B;  3N44 B;  4J9M A;  2BQU A;  3GTL B;  5H80 A;  3MEH A;  3KTM A;  5KFI A;  4DV7 H;  4O4I F;  2JA8 G;  3BQ1 A;  5DEH A;  1I50 H;  4KHP Q;  1JOK A;  2A8V A;  3SDZ A;  2CW7 A;  4NXM Q;  2EVB A;  2YZN A;  1STN A;  3J80 i;  2PI2 E;  3DEO A;  1S5C D;  3I3C A;  2NB0 A;  4DL5 A;  2IWH A;  1LUZ A;  4L5T A;  3S14 B;  1RL2 A;  3X3N A;  1OXV A;  4ZCK A;  2AHO B;  5TSS A;  3BDC A;  3F2D A;  2K52 A;  1EEI D;  1HXY D;  3TP7 A;  2HVQ A;  4ZYS A;  3GO5 A;  5H1S E;  2NU8 B;  3HKZ E;  2F0F A;  4A3E H;  4ECS A;  4O3R A;  5CA1 F;  4DR7 H;  3MZ5 A;  2WAQ G;  1A0I A;  3I56 A;  3BAA A;  4J9N A;  1ZET A;  1DYQ A;  3GTM A;  4OGQ C;  5KT5 A;  2FHT A;  1WR2 A;  1CHP D;  1G8Z D;  2WII B;  4RGO S;  1I7L A;  2E2H A;  2Q2H A;  2ZTC A;  1CHQ D;  3F2B A;  1U4P A;  2VS1 A;  3GQC A;  3IG0 A;  3RJ0 A;  1WTO A;  3C0F B;  1SNO A;  2N78 A;  1HNZ H;  4DV6 H;  3FHW A;  2H5X A;  4B9W A;  1HR0 L;  5LP6 F;  2RKS A;  1TY2 A;  2W6M A;  1IW7 D;  1E24 A;  4POF A;  4JI1 H;  4XZ3 B;  3I73 A;  1JOQ A;  5C1O A;  3G6X A;  4GNX C;  3S1R H;  3CQZ B;  4GKK H;  3Q1K A;  4RB0 A;  1TS5 A;  1ET9 A;  4JI6 H;  1L0W A;  2B2T C;  1F2L A;  1ZKO A;  3N6X A;  3S16 H;  1S3O A;  3A54 A;  1EQQ A;  1PH8 A;  3JSL A;  3ERQ A;  1CQF A;  3E9H A;  2R6F A;  1IBK H;  4C5A A;  1WTX A;  1K8G A;  3VR5 A;  3SK6 A;  2L5T A;  4TKO B;  1Z2P X;  5DG9 A;  1VQ5 A;  4Y7N H;  4XT1 B;  5BR8 Q;  4CDD C;  2KSW A;  4LAA A;  4J0M A;  1CKO A;  4LF9 L;  2B8F A;  1CE8 A;  1Y8P B;  2GA4 B;  4IZ8 A;  1D7Q A;  4IRC A;  2F4V Q;  1I6H H;  4LSA A;  2JEI A;  2CW8 A;  4YR0 A;  4KY6 A;  4DK0 A;  2UUB L;  2VPS A;  1WCM B;  5CV7 A;  5C5L A;  3NEN A;  4N8F A;  4I7H A;  4IRD A;  2A68 D;  1M4V A;  2XWJ B;  5J2T F;  4RNM A;  2B63 H;  1SFO B;  2W9C A;  3P20 A;  5DAU A; 
#chains in the Genus database with same CATH homology
 1HNX L;  1VQ9 A;  1MKH A;  1HR0 W;  2R6G A;  2Z6K C;  5GRO A;  4EQ5 A;  1CSQ A;  5HGQ A;  3PIO A;  1HZA A;  5M5W H;  3RNU A;  1HNZ Q;  4JI0 Q;  4DV6 Q;  3HOZ H;  1TWH H;  3PF5 A;  3OW2 A;  4A3D G;  3U50 C;  4HJ5 A;  4A3J H;  3K80 C;  1VQO A;  4LFA L;  3ERS X;  3KJO A;  4GKK Q;  2IX0 A;  3RLO A;  1PH5 A;  4R4T A;  4DUY L;  2EIF A;  5AJ3 Q;  1VQF A;  1YJN A;  4IFD J;  1U5K A;  1V9P A;  2IT1 A;  1YEZ A;  1MJC A;  5E7N A;  4B3M Q;  4JI6 Q;  2AMC B;  4GOP A;  1HNW L;  1L1O C;  5HY6 A;  4A3D H;  2AKW B;  1Q12 A;  4UY8 C;  1IBK Q;  1TWA H;  1YHQ A;  4LWC A;  3S1Q H;  2GVB A;  2K5N A;  3BU2 A;  2PMZ E;  1TWG H;  1I3Q H;  4A4I A;  1DGS A;  2PQA A;  4APV A;  2LXJ A;  1YIT A;  4JYA L;  1FJG L;  4GN4 B;  1IBL L;  4LF5 Q;  2IY5 B;  5GAD C;  1SRU A;  4JC0 A;  1XNQ L;  2VQF L;  2EQS A;  4LF7 L;  4AIM A;  4DUZ L;  4JI4 Q;  1SE8 A;  4OX9 Q;  1CUK A;  2HIV A;  1G51 A;  1EOV A;  3J81 c;  5EAY A;  4DV2 L;  2UUC L;  3H3V I;  1LTL A;  1YNX A;  2CWP A;  4O0A A;  2GN5 A;  3PGZ A;  2RHS B;  4JOI C;  2ZJQ A;  2XTI A;  2JA6 G;  2HT1 A;  3GTM H;  3KDF A;  1E7Z A;  1CKN A;  2QEX A;  1Q7Y C;  4A3G G;  4DAY B;  1NJI C;  1A62 A;  1PH9 A;  2OWO A;  5M3F G;  1S72 A;  4OON A;  3CPF A;  4DR3 L;  1JE5 A;  4A3F G;  1JJ2 A;  3PUY A;  2JA6 H;  1MIU A;  3VDY A;  1NMG A;  1YVC A;  2YYZ A;  4A76 A;  4A3G H;  1N33 L;  4JBJ A;  4NB3 A;  2VQE L;  1WOC A;  1KAW A;  4DV1 Q;  4BBR G;  3TRZ A;  4IOA A;  5M3F H;  4UP7 A;  3G4S A;  4A3F H;  4K0K L;  2JA9 A;  2KHI A;  3HKZ G;  2YU9 H;  4BY7 G;  4LF8 L;  1SRO A;  3UDF A;  4LUO A;  3CCR A;  1PFS A;  1KXL A;  1T9H A;  4PZ7 A;  5LMU Q;  4LF4 L;  4UP8 A;  1X3E A;  2PNH A;  4P73 A;  3OYY A;  4BBR H;  2ZTE A;  1NE3 A;  1VQ8 A;  2N8N A;  1KL9 A;  1ASZ A;  4X65 L;  2ATW A;  1VQG A;  2HIX A;  2ZM6 Q;  4BY7 H;  2UXB Q;  1LM0 A;  4KLK A;  3HOY H;  1V1Q A;  2MO1 A;  2OTL A;  1WFQ A;  1E1T A;  1V43 A;  4FDB A;  4X66 L;  4DKA C;  5FLM G;  1NY4 A;  3UDG A;  3K0X A;  1K83 H;  3PUV A;  4OO1 G;  3S1N H;  4YCV A;  1Q1B A;  2VUM H;  1Y14 B;  2VL6 A;  1J5E L;  1MJE A;  3CCS A;  4DR6 L;  4JV5 Q;  4WJ4 A;  2MFI A;  3CCV A;  4JI3 L;  3PO3 G;  2OQK A;  3HOV G;  4LNQ A;  2LXK A;  3PSI A;  4YY3 L;  4L5R C;  5FLM H;  3GTQ H;  4B3T L;  2C35 B;  1SR3 A;  4YWM A;  3AFQ A;  3KYH C;  4LF6 L;  1VQI A;  3OTO L;  1QVF A;  2CFM A;  3CCQ A;  2ID0 A;  3PV0 A;  1AE3 A;  4AQY L;  1WJJ A;  5IWA L;  1P16 A;  4GNX B;  4LW1 A;  3PO3 H;  3BZK A;  3HOV H;  2VNU D;  5FJ8 G;  1N36 L;  5C44 G;  4Y52 H;  1IZ6 A;  1H95 A;  4LFB L;  5ELO A;  3W5O A;  1XMQ Q;  3PUX A;  1XJV A;  1HH2 P;  4GOP C;  4DV0 Q;  1Y1V G;  2N3S A;  1Y1W G;  4AYB E;  1B70 B;  2K50 A;  1JB7 A;  1NBW A;  2Y0S E;  3L0O A;  4DR5 Q;  5FJ8 H;  1HR0 Q;  4QGU A;  3G6E A;  4GKJ L;  4PZ8 A;  4LFC L;  4UP9 A;  1N34 L;  2E5L Q;  1VQP A;  2BH8 A;  3S1M H;  4L5S A;  1HZB A;  1IBM L;  1YZ6 A;  5M3M G;  4PZ6 A;  5LMN L;  1Y1V H;  5JJL A;  1Y1W H;  2MQH A;  2FXQ A;  1VQC A;  2Q2I A;  2UU9 L;  3HOZ G;  4LUZ A;  1K3R A;  3A74 A;  4P75 A;  1K8A C;  2IX1 A;  2IHE A;  3I2Z A;  4A3J G;  1N8R C;  1Q46 A;  4MTN A;  3U4Z A;  3AYH B;  5M3M H;  4XIG S;  1BBW A;  5IYB G;  1EIY B;  1SMX A;  4B3R Q;  2OCE A;  2K14 A;  2NZO A;  4HJA A;  3M7N A;  3KF6 B;  4DV5 L;  2I5M X;  1KRS A;  1A63 A;  4IFD G;  4RMF A;  2KHJ A;  4JI1 Q;  4C3H H;  4X64 L;  2BH2 A;  5C0X I;  3RZO H;  1N32 Q;  4LF9 Q;  4A3I G;  3MXN B;  1XNR Q;  5K36 G;  4JBM A;  3CCE A;  5C4J H;  5ELN A;  5IYB H;  3F2C A;  4DV4 Q;  1VQ7 A;  1PH3 A;  2ES2 A;  4A3L G;  4A93 G;  1PYB A;  3TS2 A;  2HHH L;  1UE6 A;  1I94 Q;  3CD6 A;  4DR1 L;  2UXC L;  3T1H L;  4GNX A;  4P74 A;  2DGY A;  4POG A;  4X62 Q;  1BVS A;  4JI5 L;  4A3I H;  4BA2 I;  3JAM c;  2JE6 I;  3T1Y Q;  3S15 H;  1KHI A;  4A3M G;  2VW9 A;  4GN3 B;  4A3L H;  3PO2 G;  2R93 G;  1L1O B;  5JEA G;  1I5F A;  1BBU A;  1FGU A;  1R9T H;  1HNX Q;  4A93 H;  2RF4 A;  3A0J A;  3CME A;  1QVC A;  1PH1 A;  2E2I H;  1YJ9 A;  4HJ9 A;  4A3B H;  2R7D A;  5JEA J;  1IXR A;  4LFA Q;  4DR2 L;  3GTG H;  4A3M H;  1GVP A;  1B7Y B;  2JEB I;  1XMO L;  4QQB X;  3PO2 H;  2R93 H;  1OXX K;  4DUY Q;  5M5X H;  2JA7 G;  2NZH A;  1HNW Q;  4DV3 L;  4OWT B;  3UE1 A;  4DNI A;  4KHP L;  1QUQ B;  1UE1 A;  4HID A;  3LGJ A;  2E2H H;  3KOJ A;  4J15 A;  4TQU S;  4JI2 L;  4NXM L;  1TXY A;  2B29 A;  3GTK H;  1EYG A;  3H15 A;  4QIW E;  2E2J H;  4X6A H;  2JA7 H;  2JJQ A;  1W2B A;  1E1O A;  4NXN L;  3CF5 A;  4HIO A;  1VQA A;  1NMF A;  2JA5 H;  3EBE A;  3UDI A;  2Q2T A;  4JYA Q;  1K0R A;  3ULJ A;  1FJG Q;  1IBL Q;  1VCI A;  3PUW A;  1J6Q A;  5DLQ E;  4MNO A;  1XNQ Q;  3S2D H;  4R4Q A;  2VQF Q;  4LF7 Q;  4DUZ Q;  3WWV A;  4OWX B;  2Z6K A;  2MO0 A;  3GTL H;  1C9O A;  4DV2 Q;  2D0O A;  3IRB A;  1C7Y A;  2UUC Q;  3HOU H;  4YHH L;  3HOY G;  3TQY A;  3UE0 A;  1C0A A;  1EWI A;  1CKM A;  1O7I A;  1PH7 A;  2I5H A;  4C3I H;  2CWA A;  3PF4 A;  2K5H A;  2BA1 A;  2KCM A;  4GN5 A;  2UUA L;  2VUM G;  3PUZ A;  3D31 A;  1GD7 A;  5J3B A;  1QZH A;  2MNA A;  2I5L X;  4B3S L;  4GLA C;  2GVA A;  2BA0 A;  1JJC B;  1X54 A;  1E3P A;  3CC2 A;  1JJG A;  4ME3 A;  1L1O A;  4DR3 Q;  4JI7 L;  3S14 H;  4JI8 L;  1WI5 A;  4HJ7 A;  3K7A H;  2B3G A;  1N33 Q;  3CW2 C;  2VQE Q;  1HZC A;  3H3V H;  3M85 A;  4YCW A;  4IPD A;  2NN6 I;  1YBY A;  4YWL A;  2I0Q A;  1Q1E A;  3CC7 A;  4R4I A;  4K0K Q;  3NBH B;  1JT8 A;  1OXU A;  1XPO A;  4LF8 Q;  4DV7 L;  3I4M G;  2WAQ E;  1VQL A;  2E8G A;  1X55 A;  1M1K C;  1QUQ A;  4LF4 Q;  3E9I A;  1CSP A;  2RCN A;  1NTG A;  3KJP A;  1KIX A;  2KCT A;  4X65 Q;  4R1J A;  5BR8 L;  1N9W A;  4JOI A;  3J80 c;  3ULP A;  5GAE C;  2R92 G;  3I4M H;  1VQK A;  4HIK A;  2ASB A;  1UWV A;  4UPA A;  4X66 Q;  1BKB A;  3RN2 A;  4A3C G;  4DAM A;  4BXX G;  4AYB G;  2YTV A;  1Q82 C;  1EUJ A;  3L2P A;  3RZD H;  5GQO A;  2NVY H;  3CQZ H;  3H0G H;  2Y0S G;  1J5E Q;  4DR6 Q;  3EIV A;  2VY3 A;  2F4V L;  1JMC A;  1YHB A;  4JI3 Q;  1D8L A;  2R92 H;  4L5Q A;  3D0F A;  4DR7 L;  4YY3 Q;  4GOP B;  2QA4 A;  2XGT A;  4B3T Q;  4A3C H;  1FVI A;  2F52 A;  2ZJR A;  4BXX H;  2UXD L;  4DK3 C;  1PA6 A;  3F8T A;  4DR4 L;  4LF6 Q;  3FP9 A;  4C2M H;  3SGI A;  3OTO Q;  2V1C C;  2YTY A;  3BJU A;  5IP7 G;  4GLV B;  1YHA A;  4AQY Q;  5IWA Q;  1X3G A;  3UDX A;  4GS3 A;  1YJW A;  3J81 j;  3GTO H;  2R7F A;  1N36 Q;  1FL0 A;  4JI0 L;  2K75 A;  1HNZ L;  4DV6 L;  1WCM G;  1E22 A;  3A5Z B;  4IPG A;  4RG1 A;  4LFB Q;  4MZ9 A;  5IE8 A;  4JI1 L;  1IYJ B;  5C3E H;  5IYD G;  5IP7 H;  3ICE A;  4GKK L;  2JA5 G;  3DM3 A;  5JJK A;  1Z47 A;  3CCM A;  5AJ3 L;  1Q81 C;  4QJF A;  1EFW A;  1SN8 A;  1X56 A;  4B3M L;  2A1A A;  3M9B A;  1AE2 A;  1GKH A;  1P8L A;  2HQL A;  3J81 i;  4JI6 L;  3J7A 5;  3CPW A;  4GKJ Q;  1WCM H;  5IT9 c;  3B6Y A;  4LFC Q;  2ZJP A;  3S24 A;  2NVT H;  2F3I A;  1N34 Q;  1CKN B;  1IBK L;  2WP8 J;  1IBM Q;  5IYD H;  5LMN Q;  3GDE A;  2R7Z H;  1EQR A;  1W3S A;  2WB1 E;  3FKI G;  4LUV A;  4NPS A;  1XPR A;  1SFO H;  1SLJ A;  2LSS A;  2UUB Q;  1EIF A;  2UU9 Q;  4KI0 A;  3STB C;  4O2D A;  3EN2 A;  3Q8D A;  2OQ0 A;  3TRE A;  4A3B G;  2YV5 A;  5IY0 A;  1OXT A;  3S17 H;  5GAG C;  3J7Z C;  4LF5 L;  1X65 A;  5M5Y H;  2JQO A;  3ZJY C;  3HFZ B;  3FKI H;  3K81 C;  4JI4 L;  4OX9 L;  4IJL A;  2D0P A;  3MEF A;  3GTJ H;  2JK8 A;  3AEV A;  4DK6 C;  4DV5 Q;  3JC6 6;  5GAH C;  1K73 C;  5LMN W;  1VS0 A;  4X64 Q;  2NVX H;  2ALY B;  4BBS G;  1WYD A;  1OXS C;  1VQD A;  2YTX A;  3E0E A;  3K8A A;  2CCZ A;  2Z0S A;  1GM5 A;  4AH6 A;  5C0X G;  1HZ9 A;  2HHH Q;  3GTP H;  3NEL A;  4QY7 A;  4DR1 Q;  3RN5 A;  3T1H Q;  2QGQ A;  2UXC Q;  1PHJ A;  2VZA A;  3ULL A;  3BZC A;  4JBK A;  4JCV E;  4JI5 Q;  1IL2 A;  5C0X J;  3CAM A;  2NVQ H;  4BBS H;  5IP9 G;  3AFP A;  1X6O A;  1S40 A;  3RR5 A;  3M4Q A;  3RLN A;  4DV1 L;  3HOU G;  3M4O H;  3KF6 A;  2A19 A;  3HKS A;  4HIM A;  1L2F A;  3M3Y H;  1VQH A;  4TVA B;  4XTC S;  3A5U A;  3G71 A;  3W1B A;  1KQS A;  4H02 A;  4IPC A;  1KC8 C;  4DR2 Q;  1Z9F A;  5IP9 H;  1XMO Q;  1G6P A;  5LMU L;  3CCL A;  1VQN A;  4IJH A;  1PH2 A;  3CC4 A;  2CKZ B;  2N49 A;  5IYC G;  4DV3 Q;  3S2H H;  4WJ3 M;  4HJ8 A;  4OO1 I;  2JA8 G;  5FLX c;  2ZM6 L;  3GD7 A;  1PYS B;  1I50 H;  4KHP Q;  4PMW A;  2A8V A;  2UXB L;  4JI2 Q;  3F1Z A;  4NXM Q;  2CQO A;  1TWC H;  2IHF A;  4YWK A;  3J80 i;  2PI2 E;  1QVG A;  3HOW G;  2AWN A;  2EXD A;  3AQQ A;  4R4O A;  4A3E G;  1K9M C;  2Q2U A;  3CXC A;  1LUZ A;  4L5T A;  5IYC H;  1RL2 A;  3L7Z C;  3CP0 A;  4P72 A;  1OXV A;  4NXN Q;  2JA8 H;  4JV5 L;  1A8V A;  2AHO B;  3PIP A;  1VQB A;  3F2D A;  4BY1 G;  2K52 A;  1PH6 A;  3CMA A;  3GO5 A;  5H1S E;  3HKZ E;  4C3J H;  3HOW H;  4A3E H;  3KLW A;  1X9N A;  4IO9 A;  1HJP A;  3STB D;  1RIP A;  1M90 C;  2WAQ G;  1A0I A;  3I56 A;  4YHH Q;  1YIJ A;  4P71 A;  4BY1 H;  4QL5 A;  4A3K G;  3PCO B;  4BA1 I;  2KBN A;  4IPH A;  2Q2H A;  2ZTC A;  2UUA Q;  2K5V A;  3HOX G;  3H0G G;  1TWF H;  1XMQ L;  3F2B A;  3I4N G;  3I4O A;  4IOC A;  2VS1 A;  2WFW A;  1VQ4 A;  4B3S Q;  4DV0 L;  3K7U C;  1UE7 A;  2N78 A;  4JI7 Q;  3U58 A;  4JI8 Q;  5C4X G;  1G29 1;  4A3K H;  4DR5 L;  1YI2 A;  3FHW A;  2H5X A;  1HR0 L;  1AH9 A;  1Q86 C;  1E24 A;  4POF A;  3CCU A;  3HOX H;  4R4C A;  4GNX C;  3S1R H;  3I4N H;  2K4K A;  4JBW A;  2E5L L;  1KRT A;  3CCJ A;  3U4V A;  1KD1 C;  4ALP A;  4A75 A;  2KEN A;  2PI2 A;  1OTC A;  1U0L A;  1VQM A;  1XTD A;  1B8A A;  1Q8K A;  1L0W A;  5C4X H;  1PH4 A;  1GO3 E;  4DV7 Q;  3S16 H;  1S3O A;  2AWO A;  2NN6 G;  3M4P A;  4JG2 A;  4GLX A;  1EQQ A;  1PH8 A;  3E9H A;  4YCU A;  5C3E G;  1UEB A;  1K8G A;  1XPU A;  1VQJ A;  3ER0 A;  4IFD I;  4KHZ A;  2L15 A;  3JAM i;  3I55 A;  2RHQ B;  4Y7N H;  1VQ5 A;  4B3R L;  5BR8 Q;  2PQA B;  2DUD A;  3TS0 A;  1UE5 A;  4PG3 A;  1CKO A;  3I7F A;  4EX5 A;  3G48 A;  4OWW B;  3NEM A;  1N32 L;  5C44 H;  4LF9 L;  2R7Z G;  1PVO A;  1X3F A;  3KF8 B;  1XNR L;  2B63 G;  3KFU A;  3W1G A;  1D7Q A;  4DV4 L;  2F4V Q;  1I6H H;  4DR7 Q;  2UUB L;  3DLL A;  1LYL A;  3NEN A;  4DPG A;  1I94 L;  3KDF B;  5JJI A;  1VQ6 A;  4X62 L;  2UXD Q;  2WB1 G;  1PV4 A;  2D62 A;  3RLF A;  3T1Y L;  2JEA I;  2B63 H;  4OXP A;  4DR4 Q;  2OTJ A;  2ZTD A;  1VQE A;  3TEH B;  1ASY A;  1QZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...