1UNNC

Complex of beta-clamp processivity factor and little finger domain of poliv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
HHVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA POLYMERASE III BETA SUBUNIT
publication title Structural Basis for Recruitment of Translesion DNA Polymerase Pol Iv/Dinb to the Beta-Clamp
pubmed doi rcsb
source organism Escherichia coli
molecule tags Beta-clamp
total genus 32
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 1unnC00
2V4QA 4ED0A 5KG1A 4YR2A 2IA6A 2UVUA 4ECXA 3OHAA 5KFZA 5KFOA 2XCPA 4IRDA 4NLGA 5KT4A 3RB4A 2XGPA 5L9XA 5L1LA 4IRCA 3TQ1A 4Q43A 1T94A 3EPGA 4Q8EA 1ZETA 2AU0A 4QWEA 2BR0A 5KFYA 3FDSA 4J9SA 3T5LA 2AGQA 5KG5A 3G6YA 5KT3A 4RNMA 4F50A 5F9LA 3G6XA 4J9LA 5KT6A 2XCAA 4DL6A 3Q8SB 4F4XA 4ECSA 4J9NA 3GV8B 4QWBA 4YR3A 3Q8QB 4EBDA 4IR9A 4RUCA 5KG2A 5KFRA 5DG7A 4EBCA 4FS1A 1RYSA 4FS2A 2JEJA 2VA3A 5F9NA 2JEGA 5DQGA 5EDWA 3KHHA 5KFPA 3OSPA 2UVRA 3PW2A 5KFDA 1S0OA 3H4BA 2DPJA 4EYIB 2WTFA 3GIIA 4YP3A 4JV1A 3EPIA 3MFIA 3MFHA 4JV2A 4TQSA 4J9RA 3Q8PB 5KFSA 3PVXA 3RB0A 4ECUA 2OH2A 2AGOA 3MR6A 4F4WA 3OHBA 3RAXA 3V6KA 4ECTA 5L1KA 1UNNC 4R8UA 3V6HA 2W9AA 5KFUA 4J9KA 5KFMA 4ED7A 4ECRA 3RB6A 3GIJA 4ECVA 4RNNA 5L1IA 5KG4A 5KFNA 4O3PA 4J9OA 5DLGA 2R8JA 2XC9A 3PZPA 2W8KA 2ATLA 2C2DA 1S0MA 5KG0A 5KFEA 3PW0A 3PR5B 4QWDA 2ASLA 3NGDA 2ALZA 4Q44A 3KHRA 4FBUA 3GV5B 4IRKA 4QW9A 3MR3A 2DPIA 5KG3A 1K1QA 4YQWA 3RBEA 5KT5A 3GV7B 4RUAA 3KHGA 4DL7A 4FBTA 4Q8FA 3M9NB 5EWEA 5KFWA 3M9MB 2FLLA 2JEFA 2R8KA 5KFQA 3GIKA 2J6TA 4O3OA 3KHLA 4YR0A 5JUMA 4EBEA 2AQ4A 5KT7A 2C22A 2W9CB 2W8LA 4IR1A 2JEIA 1N56A 1JIHA 4ED2A 2C28A 2VA2A 4J9PA 3SI8A 5KFHA 4QW8A 4ECQA 1S0NA 5T14A 4ECWA 2BQUA 2IMWP 3RBDA 5KFLA 5KG7A 3OSNA 2UVVA 4O3RA 2W9BB 4U7CA 4G3IA 5EWGA 5KFGA 5EWFA 1N48A 2AGPA 2V4RA 5KFKA 4ED6A 2FLPA 3MR2A 2W7OA 5KG6A 2BQ3A 4F4ZA 4ECYA 4TQRA 2R8GA 4GC6A 5DGBA 4U6PA 4Q45A 2W9CA 4O3NA 4O3QA 3QZ7A 4ED8A 4RNOA 3PR4A 1RYRA 2BQRA 4DL2A 4EEYA 2J6SA 5C5JA 3QZ8A 3BQ0A 4O3SA 4ED1A 5DG8A 4GC7A 2W9BA 3G6VA 3BJYA 2UVWA 2ASJA 3M9OB 3V6JA 3GQCA 2R8HA 2RDJA 2V9WA 2J6UA 5KFXA 5DLFA 4J9MA 3PW4A 5KFCA 3IN5A 3RB3A 1S9FA 2W7PA 3H40A 3H4DA 2ASDA 4ECZA 1T3NA 2IBKA 3BQ2A 4RZRA 5KFBA 4RU9A 4F4YA 3BQ1A 4EYHB 1S97A 4DL4A 5KFFA 4J9QA 5DGAA 1K1SA 4ED3A 5KFIA 3GIMA 5DQIA 4JUZA 1JX4A 3GILA 5KFTA 4DL5A 2FLNA 3T5KA 5DQHA 2R8IA 3T5HA 4R8UB 3T5JA 5KT2A 4DL3A 5DG9A 5KFJA 4HYKA 5L1JA 1JXLA 5KFAA 5KFVA 2C2RA 1S10A 4QWCA 2RDIA 2XGQA 3PW5A 4QWAA 3RAQA 3PW7A 3MR5A 3Q8RB 4JV0A 2C2EA
chains in the Genus database with same CATH superfamily
1BGWA 2V4QA 1S68A 1I50A 4ED0A 5JVDF 1X9NA 4B3TH 5KG1A 4X64H 2YL2A 2YS6A 4YR2A 2VQFH 1O75A 1WH2A 2IA6A 1RK6A 2UVUA 4GKJH 2HGSA 4UFZA 3HOVG 2R92A 4ECXA 1UC9A 1KEEA 1ZQ7A 3OHAA 2YRWA 1GGOA 1M6VA 4RB1A 2RGRA 4QJFA 1SFOA 4M7EA 5KFZA 5KFOA 2XCPA 4IRDA 4NLGA 5JH7F 2KSWA 5KT4A 4DV6H 1KBLA 3WNZA 2XGPA 5FD6A 3RB4A 5IT9W 2DWCA 2YRXA 4K0KH 5L9XA 2NVYA 3HKZE 3R5HA 4HNTA 5L1LA 4IRCA 2VQDA 3GIDA 3TQ1A 2FK2A 1DIKA 1KJIA 4IWXA 4HR7A 4Q43A 1T94A 3EPGA 4FM9A 4Q8EA 2NVXA 4GLXA 1ZETA 4HQ6A 5D1PA 2UU9H 2F4VH 2AU0A 2C00A 2HJWA 2YYAA 5FPOA 1IBLH 1WSCA 5LL6b 4EGQA 3J80W 2HVRA 4QWEA 2BR0A 5KFYA 2FPGB 2YZNA 3JSNA 2CW7A 2SCUB 3FDSA 1T36A 3C0FB 3KALA 4MA0A 3TQTA 5LP6F 3UQ8A 3RUPA 4HNVA 2WB1E 2PVPA 2AGQA 4A3JG 2V58A 4BY7G 1V9PA 2B63A 5KG5A 3G6YA 1N34H 5KT3A 4RNMA 4F50A 5F9LA 1FJGH 3G6XA 2DIKA 4J9LA 5KT6A 1WCMA 1W96A 2R92G 2XCAA 5J2UF 1C30A 1RJPA 2E5LH 4YJ3F 5FPRA 4DL6A 3Q8SB 2HHHH 4O2BF 4F4XA 4ECSA 4J9NA 2JA7A 4I7HA 4DR4H 3GV8B 4QWBA 2VUMA 2WAQE 5D8DA 5IWAH 3R23A 4YR3A 1Y1WA 4O4HF 2NUAB 3R5XA 5D1OB 4ZOLF 2WDTA 1B6SA 2R93A 3Q8QB 4EBDA 2W6ZA 4RUCA 4IR9A 5FJ8G 3GTLA 1VAJA 1XMQH 5KG2A 4FU0A 5KFRA 5DG7A 1AN7A 3RJ0A 3K3VA 4DR5H 4AQYH 4BWSC 3H0GG 4FS1A 3ORQA 4EBCA 2CQYA 4FS2A 1RYSA 2VPSA 2JEJA 2VA3A 4BBSG 5LMNH 5F9NA 1FKAH 4UCTA 4LF6H 3BAAA 3HOYG 3WO1A 2JEGA 5DQGA 4ME6A 5EDWA 3KHHA 2VUGA 5KFPA 2UXBH 3OSPA 4A3GG 2W6MA 3H20A 4DUYH 2UVRA 3GTQA 1V51A 2PMZA 4DV3H 3RTXA 4OX9H 1Y1VG 3PW2A 4L1KA 5KFDA 4J0MA 1TA8A 1S0OA 3SE7A 4Y8VB 5J2TF 3H4BA 2DPJA 4EYIB 3T5LA 2WTFA 3AYHB 4BY1G 3GIIA 2W70A 3J81W 4O4LF 4YP3A 3E5NA 4JV1A 3EPIA 4A3EG 3MFIA 3MFHA 1Y1WG 1EYZA 4JV2A 4TQSA 4LF9H 4J9RA 2VOBA 1B6RA 1PK8A 3Q8PB 5KFSA 2E2IA 3RGXA 3PVXA 1GSHA 4DV2H 5CB4F 1SCUB 3RB0A 3KAKA 4ECUA 3R5FA 4TV9F 2HVQA 3RGZA 2R87A 3RV3A 3VPCA 2YU9A 5C4XG 2QK4A 2OH2A 2AGOA 4JI3H 3MR6A 4F4WA 2M05A 3OHBA 3RAXA 3K5HA 3LWBA 3V6KA 1VS0A 1RJRA 4ECTA 1KJ9A 4UCVA 5L1KA 4MV7A 1KJQA 1UNNC 1DGSA 3HOUG 4YB8B 3J7AK 3TIGA 4IAJA 2IP4A 4R8UA 4YBZB 3V6HA 3GTOA 2W9AA 1I7NA 1B33N 1W93A 1CS0A 4Q0YA 5KFUA 4J9KA 1I7LA 4EFEA 5KFMA 4B3SH 2W6NA 4ED7A 2YS7A 3QFFA 4ECRA 3RB6A 2R8JA 3GIJA 1XNQH 5K2MA 3KTMA 4JI7H 1E4GT 4ECVA 4X62H 5LMUH 4BBRG 5IYDG 4RNNA 5L1IA 4CC6A 4XYMB 5KG4A 4MV3A 3TIIA 5C8YF 2X0SA 3I12A 5KFNA 3GTJA 1E4EA 2V5AA 3GTPA 4O3PA 4J9OA 2V59A 5DLGA 1E4FT 2FK1A 3K3PA 1TAEA 4MV4A 4APMA 4DLKA 4RB3C 2XC9A 4DV5H 2R7ZA 3T1YH 1A9XA 3PZPA 3N42B 2W8KA 2ATLA 2C2DA 3JSLA 1S0MA 4DV0H 3L4JA 5KG0A 5KKNB 5KFEA 3PW0A 1ULZA 2DLNA 1I3QA 3PR5B 2I8CA 3HBLA 4IHJF 4QWDA 2WE6A 1JDEA 3GIPA 3NGDA 2ASLA 3MWDA 2JA5G 3F8NA 2ALZA 5FLMG 1CE8A 2P0AA 4MV9A 1SEIA 2RF4A 4Q44A 3KHRA 1HNZH 4FBUA 3GV5B 4EGJA 1S03G 3V4ZA 4IRKA 1Z2OX 1BNCA 1TWFA 3N41B 4QW9A 3MR3A 5CA0F 2DPIA 4DR7H 1CQIB 5C1PA 2W6QA 5KG3A 2FE3A 5KX5F 3BABA 5LYJF 1K1QA 2GPSA 3OUUA 4YQWA 3M4IA 3RBEA 5KT5A 3FKIA 5IYBG 3GV7B 2Q2UA 3IG0A 4RUAA 3KHGA 1M7JA 4A93G 4DL7A 3HKZA 4FBTA 4JI4H 4Q8FA 1FVIA 3M9NB 3GTKA 1EHIA 5EWEA 3I4MG 4RAYA 5HBRB 5KFWA 4EFBA 3M9MB 2R7ZG 3G8CA 3HB9A 2Y0SE 2FLLA 4ZHQF 4A3KG 4YY3H 2GPWA 3KXYT 2JEFA 3HXLA 2R8KA 4JI1H 1UC8A 3GTGA 5KFQA 3GIKA 4B3MH 2CKZB 4A3MG 2XD4A 2J6TA 4LF7H 4C5BA 4WBNF 3JRWA 4C5CA 2WB1A 2HVSA 3TINA 4O3OA 4XX0B 3KHLA 4YR0A 2QYZA 4M9UA 1BJTA 2R86A 5JUMA 3GLKA 3PO2G 4EBEA 2VQEH 5KT7A 4J9SA 5FLXW 2AQ4A 2UUCH 2FKLA 4LFBH 2C22A 2W9CB 2B63G 2W8LA 1HNXH 4A3DG 4IR1A 2JEIA 4MA5A 1WCMG 1N56A 2FK3A 1J5EH 1XNRH 1GO3E 2FPIB 1JIHA 4ZI7F 4ED2A 2C28A 2VA2A 4J9PA 4NXNH 3SI8A 5KFHA 4LSAA 4CC5A 4NXMH 1ZHSA 1JLLB 2WAQA 4QW8A 4C2MA 3FKIG 4ECQA 1S0NA 4LFCH 1IOWA 5T14A 4ECWA 5I47A 2BQUA 2ZM6H 2IMWP 2JA7G 1XDNA 2JA8G 1TWAA 4A2BA 1RJQA 2VUMG 5IP9G 1XMOH 4X66H 3RBDA 3EYYA 4RAZA 1VBGA 2W6PA 1Z2NX 3OUZA 5KFLA 5KG7A 2R93G 3MWEA 3OSNA 5H80A 1K83A 4QIWE 4A3FG 2UVVA 4UCOA 4O3RA 2R7MA 2W9BB 4U7CA 4LF8H 4G3IA 5D1OA 4JI0H 5EWGA 4JV5H 4YAJB 5KFGA 5EWFA 1N48A 2AGPA 4WD3A 2VPQA 2UXCH 1ZHQA 4LSXA 5KFKA 2V4RA 1EUCB 5BMVF 1IOVA 5BR8H 3N43B 4ED6A 2FLPA 4DUZH 2FP4B 3MR2A 2W7OA 4I50F 4A3CG 3HOWG 4JI6H 5KG6A 2BQ3A 4F4ZA 3LMLA 4ECYA 3K5IA 4MV8A 4GKKH 3WO0A 3GIQA 2R84A 4TQRA 4GC6A 2R8GA 3U9TA 4DV7H 5DGBA 4O2AF 1GSAA 4UCSA 5GONF 4U6PA 1SYXB 4Q45A 5JQWA 1DV2A 5JVLA 2W9CA 5FD5A 4O3NA 4O3QA 3QZ7A 4ED8A 1V4YA 3RF2A 4C5AA 4RNOA 3PR4A 1M0WA 1RYRA 2MCTA 5C44G 2ZDQA 2BQRA 1AUXA 1GSOA 2NU9B 1A0IA 4RB2C 3HOXG 3U9SA 4ETSA 1I6UA 5C1OA 4UCRA 1EZ1A 4DL2A 4A3IG 3ORRA 4EEYA 4A2AA 2J6SA 2Q2TA 5BPFA 3VMMA 5C5JA 1L2ZA 3UFXB 2XIGA 2OWOA 4JI5H 2JA6A 2CZGA 3ETHA 2OLSA 3QZ8A 3BQ0A 1CQJB 1VBHA 3MWMA 4O3SA 4EEQA 5IP7G 3OTOH 4ED1A 5DG8A 1IBMH 1JKJB 5CAEB 3KAJA 2W9BA 4GC7A 1GYFA 3G6VA 3BJYA 4TV8F 5A2QW 2CW8A 2ASJA 2UVWA 4A3BG 3M9OB 4X65H 4DV1H 5C3EG 3V6JA 2RGVA 4YJ2F 3VPDA 1I94H 4MAMA 3CVZA 1P8LA 3BA9A 1AUVA 1M0TA 3BG5A 2E2HA 1Y14B 2R7KA 5BPHA 3GQCA 4E4TA 2R8HA 5EZYF 3GTMA 2R7NA 2J9GA 4KHPH 4O4IF 2FPPB 2R6FA 2RDJA 1GLVA 2V9WA 2J6UA 1WR2A 3H0GA 1KC7A 5KFXA 4PDBA 3Q2OA 1EUDB 5LXTF 4J9MA 5DLFA 1N33H 5EOYA 3PW4A 3HOZG 4ZQIA 4AYBE 4LF5H 2YZMA 5KFCA 3IN5A 3RB3A 2JA6G 4DR2H 1S9FA 1TWGA 2W7PA 2UUBH 1N32H 3H40A 3H4DA 4DR3H 2ASDA 4ECZA 1T3NA 2IBKA 3BQ2A 1JDBB 4PWQA 1Y1VA 1TWHA 4RZRA 5KFBA 1DV1A 1KJJA 4RU9A 4DV4H 3JAMW 4F4YA 4BXXG 3MJFA 1OWTA 3BQ1A 1RK5A 3VPBA 3N44B 4RZQA 2YCHA 2PMZE 4EYHB 4DL4A 1S97A 4XZ3B 3I4NG 1B04A 3N40P 5KFFA 2O03A 3L2PA 4J9QA 3N6XA 5DGAA 3DF7A 2GLTA 2I87A 2UUAH 4XYLB 4UCUA 4LF4H 2PN1A 2C35B 1K1SA 5CA1F 4LH7A 1MZBA 5HV6A 4ED3A 3CQZA 2YW2A 2W6OA 2ZJTA 1C3OA 2NU6B 5KFIA 2DZDA 3GIMA 4MV1A 4AYBA 5DQIA 3N8DA 3FMAA 4JUZA 2UXDH 1JX4A 2NU8B 2Y0SA 4IWYA 5KFTA 3JZIA 3GILA 4DL5A 2FLNA 3T5KA 3JRXA 4JYAH 2ZDGA 4MV6A 4MTDA 3ETJA 5DQHA 3L4KA 3RV4A 2R8IA 3T5HA 3H3VH 1PX2A 4R8UB 3Q1KA 2ZDHA 4TUYF 4HNUA 3T1HH 3T5JA 5KT2A 4B3RH 4DL3A 2VR1A 1HR0H 3V4SA 4JI8H 4I55F 1KJ8A 2R82A 5DG9A 2R85A 5KFJA 4HYKA 4LMYA 1IBKH 4LFAH 1TWCA 4IZOA 1E4EB 1VKZA 3RFCA 2FB9A 2I80A 5L1JA 4RB0A 2XCLA 1JXLA 4A3LG 4I4TF 2W57A 2YZGA 2PBZA 3LP8A 5KFAA 5KFVA 4YHHH 2C2RA 4MTEA 1HNWH 1S10A 5LOVF 4QWCA 2FMAA 2RDIA 2XGQA 4R7RA 3PW5A 2R7LA 4LH6A 5IYZF 4QWAA 1Z2PX 2FJZA 4DR6H 5LA6F 1BXRA 2NU7B 3RAQA 3PN1A 3PW7A 4DR1H 4EG0A 3BA8A 3MR5A 3Q8RB 1R9TA 4JI2H 2JA5A 2WYOA 5IYCG 4QIWA 3PO3G 4JV0A 1N36H 2C2EA 3RIZA 2W71A 4YAKB
chains in the Genus database with same CATH topology
2V4QA 4ED0A 5KG1A 4YR2A 2IA6A 2UVUA 4ECXA 3OHAA 5KFZA 5KFOA 2XCPA 4IRDA 4NLGA 5KT4A 3RB4A 2XGPA 5L9XA 5L1LA 4IRCA 3TQ1A 4Q43A 1T94A 3EPGA 4Q8EA 1ZETA 2AU0A 4QWEA 2BR0A 5KFYA 3FDSA 4J9SA 3T5LA 2AGQA 5KG5A 3G6YA 5KT3A 4RNMA 4F50A 5F9LA 3G6XA 4J9LA 5KT6A 2XCAA 4DL6A 3Q8SB 4F4XA 4ECSA 4J9NA 3GV8B 4QWBA 4YR3A 3Q8QB 4EBDA 4IR9A 4RUCA 5KG2A 5KFRA 5DG7A 4EBCA 4FS1A 1RYSA 4FS2A 2JEJA 2VA3A 5F9NA 2JEGA 5DQGA 5EDWA 3KHHA 5KFPA 3OSPA 2UVRA 3PW2A 5KFDA 1S0OA 3H4BA 2DPJA 4EYIB 2WTFA 3GIIA 4YP3A 4JV1A 3EPIA 3MFIA 3MFHA 4JV2A 4TQSA 4J9RA 3Q8PB 5KFSA 3PVXA 3RB0A 4ECUA 2OH2A 2AGOA 3MR6A 4F4WA 3OHBA 3RAXA 3V6KA 4ECTA 5L1KA 1UNNC 4R8UA 3V6HA 2W9AA 5KFUA 4J9KA 5KFMA 4ED7A 4ECRA 3RB6A 3GIJA 4ECVA 4RNNA 5L1IA 5KG4A 5KFNA 4O3PA 4J9OA 5DLGA 2R8JA 2XC9A 3PZPA 2W8KA 2ATLA 2C2DA 1S0MA 5KG0A 5KFEA 3PW0A 3PR5B 4QWDA 2ASLA 3NGDA 2ALZA 4Q44A 3KHRA 4FBUA 3GV5B 4IRKA 4QW9A 3MR3A 2DPIA 5KG3A 1K1QA 4YQWA 3RBEA 5KT5A 3GV7B 4RUAA 3KHGA 4DL7A 4FBTA 4Q8FA 3M9NB 5EWEA 5KFWA 3M9MB 2FLLA 2JEFA 2R8KA 5KFQA 3GIKA 2J6TA 4O3OA 3KHLA 4YR0A 5JUMA 4EBEA 2AQ4A 5KT7A 2C22A 2W9CB 2W8LA 4IR1A 2JEIA 1N56A 1JIHA 4ED2A 2C28A 2VA2A 4J9PA 3SI8A 5KFHA 4QW8A 4ECQA 1S0NA 5T14A 4ECWA 2BQUA 2IMWP 3RBDA 5KFLA 5KG7A 3OSNA 2UVVA 4O3RA 2W9BB 4U7CA 4G3IA 5EWGA 5KFGA 5EWFA 1N48A 2AGPA 2V4RA 5KFKA 4ED6A 2FLPA 3MR2A 2W7OA 5KG6A 2BQ3A 4F4ZA 4ECYA 4TQRA 2R8GA 4GC6A 5DGBA 4U6PA 4Q45A 2W9CA 4O3NA 4O3QA 3QZ7A 4ED8A 4RNOA 3PR4A 1RYRA 2BQRA 4DL2A 4EEYA 2J6SA 5C5JA 3QZ8A 3BQ0A 4O3SA 4ED1A 5DG8A 4GC7A 2W9BA 3G6VA 3BJYA 2UVWA 2ASJA 3M9OB 3V6JA 3GQCA 2R8HA 2RDJA 2V9WA 2J6UA 5KFXA 5DLFA 4J9MA 3PW4A 5KFCA 3IN5A 3RB3A 1S9FA 2W7PA 3H40A 3H4DA 2ASDA 4ECZA 1T3NA 2IBKA 3BQ2A 4RZRA 5KFBA 4RU9A 4F4YA 3BQ1A 4EYHB 1S97A 4DL4A 5KFFA 4J9QA 5DGAA 1K1SA 4ED3A 5KFIA 3GIMA 5DQIA 4JUZA 1JX4A 3GILA 5KFTA 4DL5A 2FLNA 3T5KA 5DQHA 2R8IA 3T5HA 4R8UB 3T5JA 5KT2A 4DL3A 5DG9A 5KFJA 4HYKA 5L1JA 1JXLA 5KFAA 5KFVA 2C2RA 1S10A 4QWCA 2RDIA 2XGQA 3PW5A 4QWAA 3RAQA 3PW7A 3MR5A 3Q8RB 4JV0A 2C2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4Q A;  4ED0 A;  5KG1 A;  4YR2 A;  2IA6 A;  2UVU A;  4ECX A;  3OHA A;  5KFZ A;  5KFO A;  2XCP A;  4IRD A;  4NLG A;  5KT4 A;  3RB4 A;  2XGP A;  5L9X A;  5L1L A;  4IRC A;  3TQ1 A;  4Q43 A;  1T94 A;  3EPG A;  4Q8E A;  1ZET A;  2AU0 A;  4QWE A;  2BR0 A;  5KFY A;  3FDS A;  4J9S A;  3T5L A;  2AGQ A;  5KG5 A;  3G6Y A;  5KT3 A;  4RNM A;  4F50 A;  5F9L A;  3G6X A;  4J9L A;  5KT6 A;  2XCA A;  4DL6 A;  3Q8S B;  4F4X A;  4ECS A;  4J9N A;  3GV8 B;  4QWB A;  4YR3 A;  3Q8Q B;  4EBD A;  4IR9 A;  4RUC A;  5KG2 A;  5KFR A;  5DG7 A;  4EBC A;  4FS1 A;  1RYS A;  4FS2 A;  2JEJ A;  2VA3 A;  5F9N A;  2JEG A;  5DQG A;  5EDW A;  3KHH A;  5KFP A;  3OSP A;  2UVR A;  3PW2 A;  5KFD A;  1S0O A;  3H4B A;  2DPJ A;  4EYI B;  2WTF A;  3GII A;  4YP3 A;  4JV1 A;  3EPI A;  3MFI A;  3MFH A;  4JV2 A;  4TQS A;  4J9R A;  3Q8P B;  5KFS A;  3PVX A;  3RB0 A;  4ECU A;  2OH2 A;  2AGO A;  3MR6 A;  4F4W A;  3OHB A;  3RAX A;  3V6K A;  4ECT A;  5L1K A;  1UNN C;  4R8U A;  3V6H A;  2W9A A;  5KFU A;  4J9K A;  5KFM A;  4ED7 A;  4ECR A;  3RB6 A;  3GIJ A;  4ECV A;  4RNN A;  5L1I A;  5KG4 A;  5KFN A;  4O3P A;  4J9O A;  5DLG A;  2R8J A;  2XC9 A;  3PZP A;  2W8K A;  2ATL A;  2C2D A;  1S0M A;  5KG0 A;  5KFE A;  3PW0 A;  3PR5 B;  4QWD A;  2ASL A;  3NGD A;  2ALZ A;  4Q44 A;  3KHR A;  4FBU A;  3GV5 B;  4IRK A;  4QW9 A;  3MR3 A;  2DPI A;  5KG3 A;  1K1Q A;  4YQW A;  3RBE A;  5KT5 A;  3GV7 B;  4RUA A;  3KHG A;  4DL7 A;  4FBT A;  4Q8F A;  3M9N B;  5EWE A;  5KFW A;  3M9M B;  2FLL A;  2JEF A;  2R8K A;  5KFQ A;  3GIK A;  2J6T A;  4O3O A;  3KHL A;  4YR0 A;  5JUM A;  4EBE A;  2AQ4 A;  5KT7 A;  2C22 A;  2W9C B;  2W8L A;  4IR1 A;  2JEI A;  1N56 A;  1JIH A;  4ED2 A;  2C28 A;  2VA2 A;  4J9P A;  3SI8 A;  5KFH A;  4QW8 A;  4ECQ A;  1S0N A;  5T14 A;  4ECW A;  2BQU A;  2IMW P;  3RBD A;  5KFL A;  5KG7 A;  3OSN A;  2UVV A;  4O3R A;  2W9B B;  4U7C A;  4G3I A;  5EWG A;  5KFG A;  5EWF A;  1N48 A;  2AGP A;  2V4R A;  5KFK A;  4ED6 A;  2FLP A;  3MR2 A;  2W7O A;  5KG6 A;  2BQ3 A;  4F4Z A;  4ECY A;  4TQR A;  2R8G A;  4GC6 A;  5DGB A;  4U6P A;  4Q45 A;  2W9C A;  4O3N A;  4O3Q A;  3QZ7 A;  4ED8 A;  4RNO A;  3PR4 A;  1RYR A;  2BQR A;  4DL2 A;  4EEY A;  2J6S A;  5C5J A;  3QZ8 A;  3BQ0 A;  4O3S A;  4ED1 A;  5DG8 A;  4GC7 A;  2W9B A;  3G6V A;  3BJY A;  2UVW A;  2ASJ A;  3M9O B;  3V6J A;  3GQC A;  2R8H A;  2RDJ A;  2V9W A;  2J6U A;  5KFX A;  5DLF A;  4J9M A;  3PW4 A;  5KFC A;  3IN5 A;  3RB3 A;  1S9F A;  2W7P A;  3H40 A;  3H4D A;  2ASD A;  4ECZ A;  1T3N A;  2IBK A;  3BQ2 A;  4RZR A;  5KFB A;  4RU9 A;  4F4Y A;  3BQ1 A;  4EYH B;  1S97 A;  4DL4 A;  5KFF A;  4J9Q A;  5DGA A;  1K1S A;  4ED3 A;  5KFI A;  3GIM A;  5DQI A;  4JUZ A;  1JX4 A;  3GIL A;  5KFT A;  4DL5 A;  2FLN A;  3T5K A;  5DQH A;  2R8I A;  3T5H A;  4R8U B;  3T5J A;  5KT2 A;  4DL3 A;  5DG9 A;  5KFJ A;  4HYK A;  5L1J A;  1JXL A;  5KFA A;  5KFV A;  2C2R A;  1S10 A;  4QWC A;  2RDI A;  2XGQ A;  3PW5 A;  4QWA A;  3RAQ A;  3PW7 A;  3MR5 A;  3Q8R B;  4JV0 A;  2C2E A; 
#chains in the Genus database with same CATH topology
 1BGW A;  2V4Q A;  1S68 A;  1I50 A;  4ED0 A;  5JVD F;  1X9N A;  4B3T H;  5KG1 A;  4X64 H;  2YL2 A;  2YS6 A;  4YR2 A;  2VQF H;  1O75 A;  1WH2 A;  2IA6 A;  1RK6 A;  2UVU A;  4GKJ H;  2HGS A;  4UFZ A;  3HOV G;  2R92 A;  4ECX A;  1UC9 A;  1KEE A;  1ZQ7 A;  3OHA A;  2YRW A;  1GGO A;  1M6V A;  4RB1 A;  2RGR A;  4QJF A;  1SFO A;  4M7E A;  5KFZ A;  5KFO A;  2XCP A;  4IRD A;  4NLG A;  5JH7 F;  2KSW A;  5KT4 A;  4DV6 H;  1KBL A;  3WNZ A;  2XGP A;  5FD6 A;  3RB4 A;  5IT9 W;  2DWC A;  2YRX A;  4K0K H;  5L9X A;  2NVY A;  3HKZ E;  3R5H A;  4HNT A;  5L1L A;  4IRC A;  2VQD A;  3GID A;  3TQ1 A;  2FK2 A;  1DIK A;  1KJI A;  4IWX A;  4HR7 A;  4Q43 A;  1T94 A;  3EPG A;  4FM9 A;  4Q8E A;  2NVX A;  4GLX A;  1ZET A;  4HQ6 A;  5D1P A;  2UU9 H;  2F4V H;  2AU0 A;  2C00 A;  2HJW A;  2YYA A;  5FPO A;  1IBL H;  1WSC A;  5LL6 b;  4EGQ A;  3J80 W;  2HVR A;  4QWE A;  2BR0 A;  5KFY A;  2FPG B;  2YZN A;  3JSN A;  2CW7 A;  2SCU B;  3FDS A;  1T36 A;  3C0F B;  3KAL A;  4MA0 A;  3TQT A;  5LP6 F;  3UQ8 A;  3RUP A;  4HNV A;  2WB1 E;  2PVP A;  2AGQ A;  4A3J G;  2V58 A;  4BY7 G;  1V9P A;  2B63 A;  5KG5 A;  3G6Y A;  1N34 H;  5KT3 A;  4RNM A;  4F50 A;  5F9L A;  1FJG H;  3G6X A;  2DIK A;  4J9L A;  5KT6 A;  1WCM A;  1W96 A;  2R92 G;  2XCA A;  5J2U F;  1C30 A;  1RJP A;  2E5L H;  4YJ3 F;  5FPR A;  4DL6 A;  3Q8S B;  2HHH H;  4O2B F;  4F4X A;  4ECS A;  4J9N A;  2JA7 A;  4I7H A;  4DR4 H;  3GV8 B;  4QWB A;  2VUM A;  2WAQ E;  5D8D A;  5IWA H;  3R23 A;  4YR3 A;  1Y1W A;  4O4H F;  2NUA B;  3R5X A;  5D1O B;  4ZOL F;  2WDT A;  1B6S A;  2R93 A;  3Q8Q B;  4EBD A;  2W6Z A;  4RUC A;  4IR9 A;  5FJ8 G;  3GTL A;  1VAJ A;  1XMQ H;  5KG2 A;  4FU0 A;  5KFR A;  5DG7 A;  1AN7 A;  3RJ0 A;  3K3V A;  4DR5 H;  4AQY H;  4BWS C;  3H0G G;  4FS1 A;  3ORQ A;  4EBC A;  2CQY A;  4FS2 A;  1RYS A;  2VPS A;  2JEJ A;  2VA3 A;  4BBS G;  5LMN H;  5F9N A;  1FKA H;  4UCT A;  4LF6 H;  3BAA A;  3HOY G;  3WO1 A;  2JEG A;  5DQG A;  4ME6 A;  5EDW A;  3KHH A;  2VUG A;  5KFP A;  2UXB H;  3OSP A;  4A3G G;  2W6M A;  3H20 A;  4DUY H;  2UVR A;  3GTQ A;  1V51 A;  2PMZ A;  4DV3 H;  3RTX A;  4OX9 H;  1Y1V G;  3PW2 A;  4L1K A;  5KFD A;  4J0M A;  1TA8 A;  1S0O A;  3SE7 A;  4Y8V B;  5J2T F;  3H4B A;  2DPJ A;  4EYI B;  3T5L A;  2WTF A;  3AYH B;  4BY1 G;  3GII A;  2W70 A;  3J81 W;  4O4L F;  4YP3 A;  3E5N A;  4JV1 A;  3EPI A;  4A3E G;  3MFI A;  3MFH A;  1Y1W G;  1EYZ A;  4JV2 A;  4TQS A;  4LF9 H;  4J9R A;  2VOB A;  1B6R A;  1PK8 A;  3Q8P B;  5KFS A;  2E2I A;  3RGX A;  3PVX A;  1GSH A;  4DV2 H;  5CB4 F;  1SCU B;  3RB0 A;  3KAK A;  4ECU A;  3R5F A;  4TV9 F;  2HVQ A;  3RGZ A;  2R87 A;  3RV3 A;  3VPC A;  2YU9 A;  5C4X G;  2QK4 A;  2OH2 A;  2AGO A;  4JI3 H;  3MR6 A;  4F4W A;  2M05 A;  3OHB A;  3RAX A;  3K5H A;  3LWB A;  3V6K A;  1VS0 A;  1RJR A;  4ECT A;  1KJ9 A;  4UCV A;  5L1K A;  4MV7 A;  1KJQ A;  1UNN C;  1DGS A;  3HOU G;  4YB8 B;  3J7A K;  3TIG A;  4IAJ A;  2IP4 A;  4R8U A;  4YBZ B;  3V6H A;  3GTO A;  2W9A A;  1I7N A;  1B33 N;  1W93 A;  1CS0 A;  4Q0Y A;  5KFU A;  4J9K A;  1I7L A;  4EFE A;  5KFM A;  4B3S H;  2W6N A;  4ED7 A;  2YS7 A;  3QFF A;  4ECR A;  3RB6 A;  2R8J A;  3GIJ A;  1XNQ H;  5K2M A;  3KTM A;  4JI7 H;  1E4G T;  4ECV A;  4X62 H;  5LMU H;  4BBR G;  5IYD G;  4RNN A;  5L1I A;  4CC6 A;  4XYM B;  5KG4 A;  4MV3 A;  3TII A;  5C8Y F;  2X0S A;  3I12 A;  5KFN A;  3GTJ A;  1E4E A;  2V5A A;  3GTP A;  4O3P A;  4J9O A;  2V59 A;  5DLG A;  1E4F T;  2FK1 A;  3K3P A;  1TAE A;  4MV4 A;  4APM A;  4DLK A;  4RB3 C;  2XC9 A;  4DV5 H;  2R7Z A;  3T1Y H;  1A9X A;  3PZP A;  3N42 B;  2W8K A;  2ATL A;  2C2D A;  3JSL A;  1S0M A;  4DV0 H;  3L4J A;  5KG0 A;  5KKN B;  5KFE A;  3PW0 A;  1ULZ A;  2DLN A;  1I3Q A;  3PR5 B;  2I8C A;  3HBL A;  4IHJ F;  4QWD A;  2WE6 A;  1JDE A;  3GIP A;  3NGD A;  2ASL A;  3MWD A;  2JA5 G;  3F8N A;  2ALZ A;  5FLM G;  1CE8 A;  2P0A A;  4MV9 A;  1SEI A;  2RF4 A;  4Q44 A;  3KHR A;  1HNZ H;  4FBU A;  3GV5 B;  4EGJ A;  1S03 G;  3V4Z A;  4IRK A;  1Z2O X;  1BNC A;  1TWF A;  3N41 B;  4QW9 A;  3MR3 A;  5CA0 F;  2DPI A;  4DR7 H;  1CQI B;  5C1P A;  2W6Q A;  5KG3 A;  2FE3 A;  5KX5 F;  3BAB A;  5LYJ F;  1K1Q A;  2GPS A;  3OUU A;  4YQW A;  3M4I A;  3RBE A;  5KT5 A;  3FKI A;  5IYB G;  3GV7 B;  2Q2U A;  3IG0 A;  4RUA A;  3KHG A;  1M7J A;  4A93 G;  4DL7 A;  3HKZ A;  4FBT A;  4JI4 H;  4Q8F A;  1FVI A;  3M9N B;  3GTK A;  1EHI A;  5EWE A;  3I4M G;  4RAY A;  5HBR B;  5KFW A;  4EFB A;  3M9M B;  2R7Z G;  3G8C A;  3HB9 A;  2Y0S E;  2FLL A;  4ZHQ F;  4A3K G;  4YY3 H;  2GPW A;  3KXY T;  2JEF A;  3HXL A;  2R8K A;  4JI1 H;  1UC8 A;  3GTG A;  5KFQ A;  3GIK A;  4B3M H;  2CKZ B;  4A3M G;  2XD4 A;  2J6T A;  4LF7 H;  4C5B A;  4WBN F;  3JRW A;  4C5C A;  2WB1 A;  2HVS A;  3TIN A;  4O3O A;  4XX0 B;  3KHL A;  4YR0 A;  2QYZ A;  4M9U A;  1BJT A;  2R86 A;  5JUM A;  3GLK A;  3PO2 G;  4EBE A;  2VQE H;  5KT7 A;  4J9S A;  5FLX W;  2AQ4 A;  2UUC H;  2FKL A;  4LFB H;  2C22 A;  2W9C B;  2B63 G;  2W8L A;  1HNX H;  4A3D G;  4IR1 A;  2JEI A;  4MA5 A;  1WCM G;  1N56 A;  2FK3 A;  1J5E H;  1XNR H;  1GO3 E;  2FPI B;  1JIH A;  4ZI7 F;  4ED2 A;  2C28 A;  2VA2 A;  4J9P A;  4NXN H;  3SI8 A;  5KFH A;  4LSA A;  4CC5 A;  4NXM H;  1ZHS A;  1JLL B;  2WAQ A;  4QW8 A;  4C2M A;  3FKI G;  4ECQ A;  1S0N A;  4LFC H;  1IOW A;  5T14 A;  4ECW A;  5I47 A;  2BQU A;  2ZM6 H;  2IMW P;  2JA7 G;  1XDN A;  2JA8 G;  1TWA A;  4A2B A;  1RJQ A;  2VUM G;  5IP9 G;  1XMO H;  4X66 H;  3RBD A;  3EYY A;  4RAZ A;  1VBG A;  2W6P A;  1Z2N X;  3OUZ A;  5KFL A;  5KG7 A;  2R93 G;  3MWE A;  3OSN A;  5H80 A;  1K83 A;  4QIW E;  4A3F G;  2UVV A;  4UCO A;  4O3R A;  2R7M A;  2W9B B;  4U7C A;  4LF8 H;  4G3I A;  5D1O A;  4JI0 H;  5EWG A;  4JV5 H;  4YAJ B;  5KFG A;  5EWF A;  1N48 A;  2AGP A;  4WD3 A;  2VPQ A;  2UXC H;  1ZHQ A;  4LSX A;  5KFK A;  2V4R A;  1EUC B;  5BMV F;  1IOV A;  5BR8 H;  3N43 B;  4ED6 A;  2FLP A;  4DUZ H;  2FP4 B;  3MR2 A;  2W7O A;  4I50 F;  4A3C G;  3HOW G;  4JI6 H;  5KG6 A;  2BQ3 A;  4F4Z A;  3LML A;  4ECY A;  3K5I A;  4MV8 A;  4GKK H;  3WO0 A;  3GIQ A;  2R84 A;  4TQR A;  4GC6 A;  2R8G A;  3U9T A;  4DV7 H;  5DGB A;  4O2A F;  1GSA A;  4UCS A;  5GON F;  4U6P A;  1SYX B;  4Q45 A;  5JQW A;  1DV2 A;  5JVL A;  2W9C A;  5FD5 A;  4O3N A;  4O3Q A;  3QZ7 A;  4ED8 A;  1V4Y A;  3RF2 A;  4C5A A;  4RNO A;  3PR4 A;  1M0W A;  1RYR A;  2MCT A;  5C44 G;  2ZDQ A;  2BQR A;  1AUX A;  1GSO A;  2NU9 B;  1A0I A;  4RB2 C;  3HOX G;  3U9S A;  4ETS A;  1I6U A;  5C1O A;  4UCR A;  1EZ1 A;  4DL2 A;  4A3I G;  3ORR A;  4EEY A;  4A2A A;  2J6S A;  2Q2T A;  5BPF A;  3VMM A;  5C5J A;  1L2Z A;  3UFX B;  2XIG A;  2OWO A;  4JI5 H;  2JA6 A;  2CZG A;  3ETH A;  2OLS A;  3QZ8 A;  3BQ0 A;  1CQJ B;  1VBH A;  3MWM A;  4O3S A;  4EEQ A;  5IP7 G;  3OTO H;  4ED1 A;  5DG8 A;  1IBM H;  1JKJ B;  5CAE B;  3KAJ A;  2W9B A;  4GC7 A;  1GYF A;  3G6V A;  3BJY A;  4TV8 F;  5A2Q W;  2CW8 A;  2ASJ A;  2UVW A;  4A3B G;  3M9O B;  4X65 H;  4DV1 H;  5C3E G;  3V6J A;  2RGV A;  4YJ2 F;  3VPD A;  1I94 H;  4MAM A;  3CVZ A;  1P8L A;  3BA9 A;  1AUV A;  1M0T A;  3BG5 A;  2E2H A;  1Y14 B;  2R7K A;  5BPH A;  3GQC A;  4E4T A;  2R8H A;  5EZY F;  3GTM A;  2R7N A;  2J9G A;  4KHP H;  4O4I F;  2FPP B;  2R6F A;  2RDJ A;  1GLV A;  2V9W A;  2J6U A;  1WR2 A;  3H0G A;  1KC7 A;  5KFX A;  4PDB A;  3Q2O A;  1EUD B;  5LXT F;  4J9M A;  5DLF A;  1N33 H;  5EOY A;  3PW4 A;  3HOZ G;  4ZQI A;  4AYB E;  4LF5 H;  2YZM A;  5KFC A;  3IN5 A;  3RB3 A;  2JA6 G;  4DR2 H;  1S9F A;  1TWG A;  2W7P A;  2UUB H;  1N32 H;  3H40 A;  3H4D A;  4DR3 H;  2ASD A;  4ECZ A;  1T3N A;  2IBK A;  3BQ2 A;  1JDB B;  4PWQ A;  1Y1V A;  1TWH A;  4RZR A;  5KFB A;  1DV1 A;  1KJJ A;  4RU9 A;  4DV4 H;  3JAM W;  4F4Y A;  4BXX G;  3MJF A;  1OWT A;  3BQ1 A;  1RK5 A;  3VPB A;  3N44 B;  4RZQ A;  2YCH A;  2PMZ E;  4EYH B;  4DL4 A;  1S97 A;  4XZ3 B;  3I4N G;  1B04 A;  3N40 P;  5KFF A;  2O03 A;  3L2P A;  4J9Q A;  3N6X A;  5DGA A;  3DF7 A;  2GLT A;  2I87 A;  2UUA H;  4XYL B;  4UCU A;  4LF4 H;  2PN1 A;  2C35 B;  1K1S A;  5CA1 F;  4LH7 A;  1MZB A;  5HV6 A;  4ED3 A;  3CQZ A;  2YW2 A;  2W6O A;  2ZJT A;  1C3O A;  2NU6 B;  5KFI A;  2DZD A;  3GIM A;  4MV1 A;  4AYB A;  5DQI A;  3N8D A;  3FMA A;  4JUZ A;  2UXD H;  1JX4 A;  2NU8 B;  2Y0S A;  4IWY A;  5KFT A;  3JZI A;  3GIL A;  4DL5 A;  2FLN A;  3T5K A;  3JRX A;  4JYA H;  2ZDG A;  4MV6 A;  4MTD A;  3ETJ A;  5DQH A;  3L4K A;  3RV4 A;  2R8I A;  3T5H A;  3H3V H;  1PX2 A;  4R8U B;  3Q1K A;  2ZDH A;  4TUY F;  4HNU A;  3T1H H;  3T5J A;  5KT2 A;  4B3R H;  4DL3 A;  2VR1 A;  1HR0 H;  3V4S A;  4JI8 H;  4I55 F;  1KJ8 A;  2R82 A;  5DG9 A;  2R85 A;  5KFJ A;  4HYK A;  4LMY A;  1IBK H;  4LFA H;  1TWC A;  4IZO A;  1E4E B;  1VKZ A;  3RFC A;  2FB9 A;  2I80 A;  5L1J A;  4RB0 A;  2XCL A;  1JXL A;  4A3L G;  4I4T F;  2W57 A;  2YZG A;  2PBZ A;  3LP8 A;  5KFA A;  5KFV A;  4YHH H;  2C2R A;  4MTE A;  1HNW H;  1S10 A;  5LOV F;  4QWC A;  2FMA A;  2RDI A;  2XGQ A;  4R7R A;  3PW5 A;  2R7L A;  4LH6 A;  5IYZ F;  4QWA A;  1Z2P X;  2FJZ A;  4DR6 H;  5LA6 F;  1BXR A;  2NU7 B;  3RAQ A;  3PN1 A;  3PW7 A;  4DR1 H;  4EG0 A;  3BA8 A;  3MR5 A;  3Q8R B;  1R9T A;  4JI2 H;  2JA5 A;  2WYO A;  5IYC G;  4QIW A;  3PO3 G;  4JV0 A;  1N36 H;  2C2E A;  3RIZ A;  2W71 A;  4YAK B; 
#chains in the Genus database with same CATH homology
 2V4Q A;  4ED0 A;  5KG1 A;  4YR2 A;  2IA6 A;  2UVU A;  4ECX A;  3OHA A;  5KFZ A;  5KFO A;  2XCP A;  4IRD A;  4NLG A;  5KT4 A;  3RB4 A;  2XGP A;  5L9X A;  5L1L A;  4IRC A;  3TQ1 A;  4Q43 A;  1T94 A;  3EPG A;  4Q8E A;  1ZET A;  2AU0 A;  4QWE A;  2BR0 A;  5KFY A;  3FDS A;  4J9S A;  3T5L A;  2AGQ A;  5KG5 A;  3G6Y A;  5KT3 A;  4RNM A;  4F50 A;  5F9L A;  3G6X A;  4J9L A;  5KT6 A;  2XCA A;  4DL6 A;  3Q8S B;  4F4X A;  4ECS A;  4J9N A;  3GV8 B;  4QWB A;  4YR3 A;  3Q8Q B;  4EBD A;  4IR9 A;  4RUC A;  5KG2 A;  5KFR A;  5DG7 A;  4EBC A;  4FS1 A;  1RYS A;  4FS2 A;  2JEJ A;  2VA3 A;  5F9N A;  2JEG A;  5DQG A;  5EDW A;  3KHH A;  5KFP A;  3OSP A;  2UVR A;  3PW2 A;  5KFD A;  1S0O A;  3H4B A;  2DPJ A;  4EYI B;  2WTF A;  3GII A;  4YP3 A;  4JV1 A;  3EPI A;  3MFI A;  3MFH A;  4JV2 A;  4TQS A;  4J9R A;  3Q8P B;  5KFS A;  3PVX A;  3RB0 A;  4ECU A;  2OH2 A;  2AGO A;  3MR6 A;  4F4W A;  3OHB A;  3RAX A;  3V6K A;  4ECT A;  5L1K A;  1UNN C;  4R8U A;  3V6H A;  2W9A A;  5KFU A;  4J9K A;  5KFM A;  4ED7 A;  4ECR A;  3RB6 A;  3GIJ A;  4ECV A;  4RNN A;  5L1I A;  5KG4 A;  5KFN A;  4O3P A;  4J9O A;  5DLG A;  2R8J A;  2XC9 A;  3PZP A;  2W8K A;  2ATL A;  2C2D A;  1S0M A;  5KG0 A;  5KFE A;  3PW0 A;  3PR5 B;  4QWD A;  2ASL A;  3NGD A;  2ALZ A;  4Q44 A;  3KHR A;  4FBU A;  3GV5 B;  4IRK A;  4QW9 A;  3MR3 A;  2DPI A;  5KG3 A;  1K1Q A;  4YQW A;  3RBE A;  5KT5 A;  3GV7 B;  4RUA A;  3KHG A;  4DL7 A;  4FBT A;  4Q8F A;  3M9N B;  5EWE A;  5KFW A;  3M9M B;  2FLL A;  2JEF A;  2R8K A;  5KFQ A;  3GIK A;  2J6T A;  4O3O A;  3KHL A;  4YR0 A;  5JUM A;  4EBE A;  2AQ4 A;  5KT7 A;  2C22 A;  2W9C B;  2W8L A;  4IR1 A;  2JEI A;  1N56 A;  1JIH A;  4ED2 A;  2C28 A;  2VA2 A;  4J9P A;  3SI8 A;  5KFH A;  4QW8 A;  4ECQ A;  1S0N A;  5T14 A;  4ECW A;  2BQU A;  2IMW P;  3RBD A;  5KFL A;  5KG7 A;  3OSN A;  2UVV A;  4O3R A;  2W9B B;  4U7C A;  4G3I A;  5EWG A;  5KFG A;  5EWF A;  1N48 A;  2AGP A;  2V4R A;  5KFK A;  4ED6 A;  2FLP A;  3MR2 A;  2W7O A;  5KG6 A;  2BQ3 A;  4F4Z A;  4ECY A;  4TQR A;  2R8G A;  4GC6 A;  5DGB A;  4U6P A;  4Q45 A;  2W9C A;  4O3N A;  4O3Q A;  3QZ7 A;  4ED8 A;  4RNO A;  3PR4 A;  1RYR A;  2BQR A;  4DL2 A;  4EEY A;  2J6S A;  5C5J A;  3QZ8 A;  3BQ0 A;  4O3S A;  4ED1 A;  5DG8 A;  4GC7 A;  2W9B A;  3G6V A;  3BJY A;  2UVW A;  2ASJ A;  3M9O B;  3V6J A;  3GQC A;  2R8H A;  2RDJ A;  2V9W A;  2J6U A;  5KFX A;  5DLF A;  4J9M A;  3PW4 A;  5KFC A;  3IN5 A;  3RB3 A;  1S9F A;  2W7P A;  3H40 A;  3H4D A;  2ASD A;  4ECZ A;  1T3N A;  2IBK A;  3BQ2 A;  4RZR A;  5KFB A;  4RU9 A;  4F4Y A;  3BQ1 A;  4EYH B;  1S97 A;  4DL4 A;  5KFF A;  4J9Q A;  5DGA A;  1K1S A;  4ED3 A;  5KFI A;  3GIM A;  5DQI A;  4JUZ A;  1JX4 A;  3GIL A;  5KFT A;  4DL5 A;  2FLN A;  3T5K A;  5DQH A;  2R8I A;  3T5H A;  4R8U B;  3T5J A;  5KT2 A;  4DL3 A;  5DG9 A;  5KFJ A;  4HYK A;  5L1J A;  1JXL A;  5KFA A;  5KFV A;  2C2R A;  1S10 A;  4QWC A;  2RDI A;  2XGQ A;  3PW5 A;  4QWA A;  3RAQ A;  3PW7 A;  3MR5 A;  3Q8R B;  4JV0 A;  2C2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...