1UNNC

Complex of beta-clamp processivity factor and little finger domain of poliv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
HHVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Beta-clamp
molecule keywords DNA POLYMERASE III BETA SUBUNIT
publication title Structural Basis for Recruitment of Translesion DNA Polymerase Pol Iv/Dinb to the Beta-Clamp
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 1unnC00
3MR5A 2R8KA 2C2RA 3OSNA 4R8UA 5KFZA 2W9BA 2DPIA 5KFLA 5DGAA 1T3NA 4IRCA 2IA6A 2ASLA 4GC7A 2FLNA 3PR4A 2AGPA 4JUZA 3GV7B 4IR9A 2R8GA 2XCAA 2FLPA 2ATLA 4EYHB 4QWEA 3MR6A 4FS1A 4ED6A 3RB0A 4QW8A 4Q44A 3QZ7A 3RB4A 3RBEA 2XGQA 4J9LA 3KHHA 3MR2A 3PW7A 3RB6A 2AQ4A 3MFIA 3G6XA 1N56A 3MFHA 4F50A 4RUAA 5DG9A 2W8KA 5KT7A 2R8HA 2VA3A 4ECXA 4IR1A 4TQSA 3BQ0A 4ECTA 5KFVA 4RNOA 2C22A 3GIKA 3OHAA 5KFFA 5KG6A 5T14A 4RNMA 5KFIA 3RAQA 5KFJA 3PW5A 2IMWP 5KG2A 4EBCA 3V6HA 4HYKA 4O3NA 3PR5B 3MR3A 2W9BB 2XGPA 4F4WA 5F9LA 5DQGA 5DLGA 4ECSA 2R8IA 4J9PA 3T5HA 2J6TA 5KT5A 3G6VA 3PW2A 3BQ1A 3QZ8A 4DL4A 4EBEA 4JV2A 5L1JA 5DG8A 4ED3A 2UVRA 2V4QA 4J9QA 3FDSA 4YR0A 1K1SA 5KG4A 5KG7A 4EEYA 4Q43A 2AU0A 5C5JA 3IN5A 4ECUA 2JEGA 2W7PA 5EWFA 4O3RA 4NLGA 4ED0A 3SI8A 4Q8EA 2V9WA 3H4DA 2BQRA 3PVXA 5KFKA 3Q8RB 3GV5B 5F9NA 4JV0A 5DQIA 3PW0A 5KFTA 3PW4A 4FS2A 4O3QA 4FBTA 4ECWA 5KFEA 5KFOA 2WTFA 5KFMA 4IRKA 4J9MA 4QWBA 5KFXA 2JEFA 4ECZA 5KG3A 4YP3A 4RUCA 2W8LA 3NGDA 4YR2A 2W9CA 5L1KA 5KFBA 2XCPA 5EDWA 3T5LA 3M9NB 5L1IA 4ECQA 4ECRA 4ED2A 5KFYA 3GIJA 4DL5A 2J6SA 5KG5A 5EWGA 1RYSA 5KFAA 2AGQA 4Q45A 2UVUA 2R8JA 4R8UB 4O3OA 4F4XA 2BR0A 4IRDA 4EBDA 2JEIA 5EWEA 5DG7A 4RU9A 3BQ2A 5KFCA 3H4BA 4RNNA 4O3PA 4RZRA 4JV1A 5KFDA 4TQRA 4F4ZA 3KHGA 5KFQA 5L1LA 5KFNA 1T94A 3G6YA 3RAXA 4FBUA 5KG0A 4DL6A 3OSPA 3RBDA 2UVVA 3T5KA 3Q8SB 5DLFA 2C28A 2XC9A 3M9MB 5KT2A 5L9XA 4QWAA 3H40A 2BQUA 2ALZA 4YQWA 3TQ1A 4O3SA 1S0OA 1JXLA 4ED8A 2W9CB 4J9NA 4ECYA 2VA2A 3EPGA 3KHRA 4DL2A 2BQ3A 2J6UA 2JEJA 4J9OA 2ASJA 3V6KA 3RB3A 1ZETA 1UNNC 3Q8PB 4J9SA 2V4RA 2AGOA 1S97A 4U6PA 5KFSA 4QW9A 4ED1A 4DL3A 3GV8B 2DPJA 3EPIA 1JIHA 5KFWA 1S10A 2OH2A 4QWCA 4U7CA 1K1QA 4EYIB 5KT3A 2C2EA 2W9AA 4J9KA 2RDIA 3V6JA 3T5JA 4F4YA 3GILA 1RYRA 5KFRA 5KT4A 2IBKA 2ASDA 1JX4A 4G3IA 5DQHA 4GC6A 5KT6A 1S0MA 3GQCA 4J9RA 4Q8FA 1S9FA 2W7OA 1N48A 5JUMA 2RDJA 3PZPA 3BJYA 1S0NA 3M9OB 4DL7A 5KFGA 4ECVA 2C2DA 5KFPA 3GIIA 4QWDA 5KG1A 5KFUA 3GIMA 3OHBA 3Q8QB 3KHLA 5DGBA 5KFHA 4ED7A 4YR3A 2UVWA 2FLLA
chains in the Genus database with same CATH superfamily
1RJPA 1WR2A 3N41B 1FKAH 3MR5A 4DR1H 3MWEA 2R8KA 5KKNB 1CQJB 5CAEB 4A3FG 2C2RA 4LFAH 3OSNA 5LMNH 4R8UA 3HBLA 5KFZA 2W9BA 3OTOH 3QFFA 4FM9A 2DPIA 4KHPH 1I6UA 4MV9A 4XYMB 5KFLA 4L1KA 5DGAA 1T3NA 5IYZF 5K2MA 4IRCA 2YS7A 3RV4A 5J2UF 1XMOH 2IA6A 2ASLA 4K0KH 1A9XA 2HGSA 4GC7A 1Y14B 2FLNA 2FK2A 3PR4A 2VUMA 1E4GT 2YRWA 2FK1A 1ZQ7A 4AYBE 1TWHA 2AGPA 2B63A 2YZGA 4JUZA 5BMVF 3GV7B 4IR9A 5LMUH 2R8GA 3UQ8A 2XCAA 3BABA 4O4HF 2QYZA 3U9TA 3GTGA 3K5HA 5I47A 2FLPA 4WD3A 1O75A 4I7HA 2QK4A 2JA5G 3KTMA 4YJ3F 3GLKA 4QJFA 3LWBA 2Q2TA 3SE7A 3HKZE 4LSXA 4DV3H 4EEQA 2UU9H 4ME6A 2VPSA 4PWQA 2ATLA 3GTPA 4C2MA 4AYBA 4DUZH 4JYAH 4IZOA 2R82A 2W6QA 4HQ6A 3U9SA 4EYHB 5LP6F 1WCMA 4QWEA 1TAEA 1VBHA 2PMZE 3OUUA 5CB4F 3I4MG 3MR6A 1TWGA 4FS1A 4ED6A 1IOWA 3MWDA 3RB0A 1GSAA 3CQZA 3HXLA 1BGWA 1EUCB 3HOZG 3GTJA 4NXMH 4A3CG 2JA7A 1DGSA 4QW8A 4O4LF 3I12A 5JH7F 3GIPA 4Q44A 3QZ7A 3RB4A 2R92A 3HKZA 3RBEA 4MV6A 4QIWE 2NVXA 2XGQA 4YHHH 4J9LA 1I7LA 3KHHA 4DV7H 2ZJTA 4HNVA 3MR2A 1GYFA 3PW7A 3RGZA 2PMZA 1E4EB 2FE3A 3RB6A 2AQ4A 3MFIA 3G6XA 3WO0A 1KBLA 4BBSG 3HOWG 1N56A 2R7MA 3MFHA 1SEIA 4F50A 2PBZA 4UCRA 3BA8A 4GKJH 3TIIA 1FVIA 4RUAA 3RUPA 5DG9A 1E4FT 5KT7A 2W8KA 2R8HA 2VA3A 4QIWA 3WO1A 4ECXA 4IR1A 4GLXA 1EZ1A 5EZYF 4TQSA 3BQ0A 3H3VH 3H0GA 4ECTA 3I4NG 3FKIG 5KFVA 3JAMW 2V58A 4EG0A 4RNOA 2C22A 2RGRA 2R86A 4A3LG 3GIKA 4MTDA 3OHAA 1SFOA 5IP7G 4HNTA 1K83A 5FPRA 5C44G 2OLSA 5KFFA 1DIKA 5KG6A 4LSAA 5T14A 5KFIA 3KALA 4A2AA 2YCHA 4RNMA 3RAQA 2E2HA 5KFJA 1XDNA 1TWAA 2X0SA 3PW5A 1JDEA 1N36H 4EFBA 2IMWP 1P8LA 4UCSA 5KG2A 4EBCA 3V6HA 4HYKA 4C5AA 4UCTA 4O3NA 4RB2C 3J80W 1HNXH 3E5NA 1M0WA 3PR5B 3MR3A 4PDBA 2W9BB 2XGPA 4F4WA 2W6MA 3C0FB 4C5CA 3H20A 3L4KA 5F9LA 5DQGA 5DLGA 5IYCG 2DIKA 1N34H 3VPDA 2E2IA 3HOUG 4XYLB 3K3VA 5D1OA 5LYJF 3RIZA 1V51A 4ECSA 1HNZH 2R8IA 2CKZB 1B33N 4J9PA 4A3BG 4E4TA 4JV5H 1Z2NX 3GTKA 4B3RH 4DV2H 3T5HA 1KJIA 2J6TA 5KT5A 3G6VA 3PW2A 1Y1WG 1J5EH 1IBMH 5EOYA 3BQ1A 2HHHH 5J2TF 3QZ8A 3JSNA 5IP9G 4DL4A 4EBEA 1PX2A 4JV2A 1Y1VG 3KAKA 5L1JA 4I4TF 2WE6A 2ZDHA 1S68A 2R87A 5DG8A 2Y0SE 4ED3A 4LF5H 2UVRA 2V4QA 2HJWA 4J9QA 4MA0A 4JI6H 3FDSA 5C8YF 4YBZB 4YR0A 2YU9A 1K1SA 5KG4A 1ZHQA 5KG7A 4EEYA 4A3MG 3PO3G 4Q43A 4LH6A 2V59A 2AU0A 5C5JA 4DLKA 4TUYF 3IN5A 4FU0A 1RJQA 4ECUA 2W57A 2JEGA 2DZDA 2W7PA 1VS0A 1W93A 5JQWA 2XCLA 2YS6A 5EWFA 2C00A 3GTQA 4O3RA 2Y0SA 1ZHSA 4A3DG 2R93A 5FD6A 4O4IF 1EYZA 4NLGA 2HVQA 2I87A 4LF6H 2GLTA 4AQYH 4ED0A 3SI8A 4Q8EA 2V9WA 2YZNA 3DF7A 1GO3E 3T1YH 4O2AF 3H4DA 3PVXA 2BQRA 2YZMA 1SCUB 5KFKA 3BA9A 1W96A 5CA0F 3Q8RB 4EGJA 2GPWA 4LMYA 3GV5B 2XD4A 5F9NA 4JV0A 2WAQE 4DR3H 5DQIA 1EUDB 4DV0H 3PW0A 5KFTA 2XIGA 4C5BA 3PW4A 3G8CA 5C3EG 5D8DA 4JI0H 1B6RA 5FPOA 4FS2A 4O3QA 1XNRH 4FBTA 2NUAB 1GSOA 2PN1A 3TIGA 5KFEA 4ECWA 5HV6A 2HVRA 3RTXA 1AN7A 4BWSC 5KFOA 4RAYA 5KFMA 2WTFA 4DUYH 1XNQH 4DR6H 4IRKA 2R7ZG 2JA5A 3JRWA 1KEEA 3RFCA 4J9MA 4MTEA 3HOYG 4QWBA 2WAQA 5KFXA 4DV5H 1C30A 2JEFA 3VPBA 2FP4B 2SCUB 4ECZA 4ZQIA 3KXYT 3TQTA 1MZBA 2R7KA 5KG3A 2VPQA 2V5AA 4YP3A 4DV6H 4A3JG 1XMQH 4JI8H 2NU9B 4X64H 4LF9H 4RUCA 4YB8B 2W8LA 1BXRA 4B3SH 1KJ8A 5LOVF 3NGDA 4YR2A 1GGOA 2J9GA 3N44B 3RGXA 2E5LH 4A2BA 2VQDA 2W9CA 2W6NA 2W6ZA 1Z2OX 5L1KA 4ZOLF 5KFBA 4ZHQF 2JA6G 2XCPA 2UXDH 5EDWA 4A3KG 3HOVG 1VBGA 4M9UA 5BPFA 3T5LA 2GPSA 5D1OB 3M9NB 5L1IA 2ZDGA 4ECQA 2UUCH 1RK5A 3FMAA 2YW2A 4ECRA 2WDTA 5GONF 4ED2A 4JI1H 4IWYA 5KFYA 3GIJA 4YJ2F 2NU6B 1DV2A 4DL5A 2J6SA 3K3PA 3JSLA 1VAJA 2W6OA 5KG5A 5EWGA 1RYSA 1FJGH 1R9TA 5KFAA 4DR7H 3GTOA 2AGQA 4Q45A 4HNUA 2UVUA 2R8JA 4XX0B 4UFZA 4UCUA 2W70A 3N42B 4DV4H 4X62H 4R8UB 1TA8A 4O3OA 4F4XA 2BR0A 4IRDA 4EBDA 3Q2OA 3FKIA 1B04A 4BXXG 4ETSA 2JEIA 4LFBH 5EWEA 3N6XA 2R6FA 5DG7A 1N33H 4RU9A 4DR5H 3BQ2A 5KFCA 3H4BA 1I7NA 3BG5A 3JRXA 4MV3A 3N8DA 5HBRB 3VMMA 4RNNA 4O3PA 2R84A 4CC6A 3L4JA 4A3GG 3T1HH 3MWMA 3N40P 4MV7A 5JVLA 1UC9A 1C3OA 4LF7H 2MCTA 4RZRA 2FKLA 1I50A 2CW7A 4B3TH 4EFEA 3J7AK 4JV1A 3AYHB 1IBLH 5KFDA 3K5IA 4TQRA 3ORRA 2OWOA 4F4ZA 3KHGA 5KFQA 2W71A 3R5XA 1I94H 1M7JA 4LH7A 5L1LA 5KFNA 4TV9F 4EGQA 3R5HA 5LXTF 3TINA 3R5FA 4WBNF 4YAKB 4I55F 5H80A 1AUXA 1T94A 4ZI7F 5LA6F 2VUMG 4A3IG 3G6YA 3RJ0A 2B63G 2R7NA 3RAXA 4FBUA 1GLVA 4DR2H 4B3MH 5KG0A 4DL6A 3MJFA 3OSPA 3RBDA 1AUVA 2UVVA 3BAAA 3T5KA 4LF4H 4M7EA 3Q8SB 1V9PA 4OX9H 1KJ9A 1Y1WA 1CE8A 1IBKH 5DLFA 1KJQA 2WYOA 2C28A 1V4YA 3HB9A 2XC9A 1TWCA 3M9MB 3KAJA 1EHIA 5KT2A 2O03A 1Y1VA 5L9XA 4QWAA 3H40A 4TV8F 2CZGA 4R7RA 4BY1G 5LL6b 2ALZA 2BQUA 1WCMG 2JA8G 1RK6A 4YAJB 4I50F 4YQWA 2CQYA 3TQ1A 1A0IA 4YY3H 5FLXW 4O3SA 1S0OA 5BR8H 2UUBH 2CW8A 1N32H 2JA7G 5A2QW 1JXLA 3ETHA 4ED8A 2R92G 2W9CB 4J9NA 5FLMG 4ECYA 2YRXA 2YL2A 3R23A 2NVYA 5BPHA 3EPGA 3KHRA 2VA2A 1I3QA 4RB1A 4DL2A 2BQ3A 1UC8A 4BY7G 2NU7B 2J6UA 4RB0A 2YYAA 1M0TA 2JEJA 3GTMA 3GIQA 5IT9W 1TWFA 1DV1A 4J9OA 4LFCH 2ASJA 3HOXG 3J81W 4IAJA 3V6KA 4HR7A 3RB3A 1L2ZA 4A3EG 1ZETA 1UNNC 3Q8PB 4MV1A 1JKJB 4J9SA 4IWXA 3L2PA 2V4RA 2AGOA 3CVZA 4CC5A 5IYDG 4A93G 2UXBH 2UUAH 1B6SA 3N43B 3H0GG 1ULZA 1S97A 3Q1KA 2C35B 5FJ8G 1M6VA 2FPGB 4Q0YA 4RAZA 1T36A 4U6PA 3LMLA 5KFSA 3OUZA 4J0MA 2WB1E 2NU8B 1KC7A 4UCVA 4QW9A 4ED1A 4DL3A 2R85A 3GV8B 3V4ZA 2DPJA 3EPIA 4JI5H 1JIHA 5KFWA 1S10A 4DR4H 2F4VH 2R7ZA 4MV8A 2OH2A 2VQFH 2DWCA 2FK3A 1VKZA 3M4IA 4QWCA 4U7CA 1K1QA 3VPCA 4GKKH 5KT3A 4EYIB 4JI3H 2C2EA 2W9AA 4J9KA 4XZ3B 2RDIA 3V6JA 3T5JA 2I8CA 4F4YA 3PN1A 4JI4H 2I80A 2R7LA 3PO2G 3GILA 1RJRA 1BNCA 2VQEH 1S03G 4JI2H 1RYRA 2WB1A 1HNWH 3UFXB 1Z2PX 2RGVA 4UCOA 5KFRA 1JDBB 5C1PA 3ETJA 4MAMA 5KT4A 2IBKA 3RF2A 3WNZA 4MV4A 2ZM6H 2FJZA 3JZIA 2ASDA 1CS0A 1IOVA 1CQIB 2JA6A 1JX4A 5CA1F 1SYXB 4G3IA 2UXCH 3IG0A 5DQHA 4GC6A 2FB9A 3ORQA 1E4EA 5KT6A 2RF4A 4LF8H 2FPIB 1S0MA 2Q2UA 5D1PA 3GQCA 1GSHA 4J9RA 3LP8A 1S9FA 4X66H 4Q8FA 2W7OA 4RZQA 1N48A 2M05A 4JI7H 5JVDF 5JUMA 3EYYA 2RDJA 1OWTA 1WSCA 2KSWA 3F8NA 3PZPA 3BJYA 2IP4A 2FPPB 1S0NA 4Y8VB 2VOBA 5C1OA 3M9OB 2FMAA 2VUGA 4DL7A 5KFGA 4ECVA 3GTLA 5KX5F 5IYBG 1WH2A 4DV1H 2C2DA 4O2BF 2HVSA 5KFPA 3GIIA 2W6PA 1KJJA 3GIDA 2P0AA 2PVPA 5FD5A 4MA5A 4QWDA 5KG1A 1JLLB 5KFUA 5C4XG 2VR1A 3GIMA 3OHBA 4BBRG 4NXNH 4IHJF 3V4SA 3Q8QB 3KHLA 1X9NA 1BJTA 5DGBA 5KFHA 1HR0H 2ZDQA 4X65H 1PK8A 4ED7A 4YR3A 2DLNA 4APMA 2UVWA 2R93G 4RB3C 3RV3A 2FLLA 5IWAH
chains in the Genus database with same CATH topology
3MR5A 2R8KA 2C2RA 3OSNA 4R8UA 5KFZA 2W9BA 2DPIA 5KFLA 5DGAA 1T3NA 4IRCA 2IA6A 2ASLA 4GC7A 2FLNA 3PR4A 2AGPA 4JUZA 3GV7B 4IR9A 2R8GA 2XCAA 2FLPA 2ATLA 4EYHB 4QWEA 3MR6A 4FS1A 4ED6A 3RB0A 4QW8A 4Q44A 3QZ7A 3RB4A 3RBEA 2XGQA 4J9LA 3KHHA 3MR2A 3PW7A 3RB6A 2AQ4A 3MFIA 3G6XA 1N56A 3MFHA 4F50A 4RUAA 5DG9A 2W8KA 5KT7A 2R8HA 2VA3A 4ECXA 4IR1A 4TQSA 3BQ0A 4ECTA 5KFVA 4RNOA 2C22A 3GIKA 3OHAA 5KFFA 5KG6A 5T14A 4RNMA 5KFIA 3RAQA 5KFJA 3PW5A 2IMWP 5KG2A 4EBCA 3V6HA 4HYKA 4O3NA 3PR5B 3MR3A 2W9BB 2XGPA 4F4WA 5F9LA 5DQGA 5DLGA 4ECSA 2R8IA 4J9PA 3T5HA 2J6TA 5KT5A 3G6VA 3PW2A 3BQ1A 3QZ8A 4DL4A 4EBEA 4JV2A 5L1JA 5DG8A 4ED3A 2UVRA 2V4QA 4J9QA 3FDSA 4YR0A 1K1SA 5KG4A 5KG7A 4EEYA 4Q43A 2AU0A 5C5JA 3IN5A 4ECUA 2JEGA 2W7PA 5EWFA 4O3RA 4NLGA 4ED0A 3SI8A 4Q8EA 2V9WA 3H4DA 2BQRA 3PVXA 5KFKA 3Q8RB 3GV5B 5F9NA 4JV0A 5DQIA 3PW0A 5KFTA 3PW4A 4FS2A 4O3QA 4FBTA 4ECWA 5KFEA 5KFOA 2WTFA 5KFMA 4IRKA 4J9MA 4QWBA 5KFXA 2JEFA 4ECZA 5KG3A 4YP3A 4RUCA 2W8LA 3NGDA 4YR2A 2W9CA 5L1KA 5KFBA 2XCPA 5EDWA 3T5LA 3M9NB 5L1IA 4ECQA 4ECRA 4ED2A 5KFYA 3GIJA 4DL5A 2J6SA 5KG5A 5EWGA 1RYSA 5KFAA 2AGQA 4Q45A 2UVUA 2R8JA 4R8UB 4O3OA 4F4XA 2BR0A 4IRDA 4EBDA 2JEIA 5EWEA 5DG7A 4RU9A 3BQ2A 5KFCA 3H4BA 4RNNA 4O3PA 4RZRA 4JV1A 5KFDA 4TQRA 4F4ZA 3KHGA 5KFQA 5L1LA 5KFNA 1T94A 3G6YA 3RAXA 4FBUA 5KG0A 4DL6A 3OSPA 3RBDA 2UVVA 3T5KA 3Q8SB 5DLFA 2C28A 2XC9A 3M9MB 5KT2A 5L9XA 4QWAA 3H40A 2BQUA 2ALZA 4YQWA 3TQ1A 4O3SA 1S0OA 1JXLA 4ED8A 2W9CB 4J9NA 4ECYA 2VA2A 3EPGA 3KHRA 4DL2A 2BQ3A 2J6UA 2JEJA 4J9OA 2ASJA 3V6KA 3RB3A 1ZETA 1UNNC 3Q8PB 4J9SA 2V4RA 2AGOA 1S97A 4U6PA 5KFSA 4QW9A 4ED1A 4DL3A 3GV8B 2DPJA 3EPIA 1JIHA 5KFWA 1S10A 2OH2A 4QWCA 4U7CA 1K1QA 4EYIB 5KT3A 2C2EA 2W9AA 4J9KA 2RDIA 3V6JA 3T5JA 4F4YA 3GILA 1RYRA 5KFRA 5KT4A 2IBKA 2ASDA 1JX4A 4G3IA 5DQHA 4GC6A 5KT6A 1S0MA 3GQCA 4J9RA 4Q8FA 1S9FA 2W7OA 1N48A 5JUMA 2RDJA 3PZPA 3BJYA 1S0NA 3M9OB 4DL7A 5KFGA 4ECVA 2C2DA 5KFPA 3GIIA 4QWDA 5KG1A 5KFUA 3GIMA 3OHBA 3Q8QB 3KHLA 5DGBA 5KFHA 4ED7A 4YR3A 2UVWA 2FLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MR5 A;  2R8K A;  2C2R A;  3OSN A;  4R8U A;  5KFZ A;  2W9B A;  2DPI A;  5KFL A;  5DGA A;  1T3N A;  4IRC A;  2IA6 A;  2ASL A;  4GC7 A;  2FLN A;  3PR4 A;  2AGP A;  4JUZ A;  3GV7 B;  4IR9 A;  2R8G A;  2XCA A;  2FLP A;  2ATL A;  4EYH B;  4QWE A;  3MR6 A;  4FS1 A;  4ED6 A;  3RB0 A;  4QW8 A;  4Q44 A;  3QZ7 A;  3RB4 A;  3RBE A;  2XGQ A;  4J9L A;  3KHH A;  3MR2 A;  3PW7 A;  3RB6 A;  2AQ4 A;  3MFI A;  3G6X A;  1N56 A;  3MFH A;  4F50 A;  4RUA A;  5DG9 A;  2W8K A;  5KT7 A;  2R8H A;  2VA3 A;  4ECX A;  4IR1 A;  4TQS A;  3BQ0 A;  4ECT A;  5KFV A;  4RNO A;  2C22 A;  3GIK A;  3OHA A;  5KFF A;  5KG6 A;  5T14 A;  4RNM A;  5KFI A;  3RAQ A;  5KFJ A;  3PW5 A;  2IMW P;  5KG2 A;  4EBC A;  3V6H A;  4HYK A;  4O3N A;  3PR5 B;  3MR3 A;  2W9B B;  2XGP A;  4F4W A;  5F9L A;  5DQG A;  5DLG A;  4ECS A;  2R8I A;  4J9P A;  3T5H A;  2J6T A;  5KT5 A;  3G6V A;  3PW2 A;  3BQ1 A;  3QZ8 A;  4DL4 A;  4EBE A;  4JV2 A;  5L1J A;  5DG8 A;  4ED3 A;  2UVR A;  2V4Q A;  4J9Q A;  3FDS A;  4YR0 A;  1K1S A;  5KG4 A;  5KG7 A;  4EEY A;  4Q43 A;  2AU0 A;  5C5J A;  3IN5 A;  4ECU A;  2JEG A;  2W7P A;  5EWF A;  4O3R A;  4NLG A;  4ED0 A;  3SI8 A;  4Q8E A;  2V9W A;  3H4D A;  2BQR A;  3PVX A;  5KFK A;  3Q8R B;  3GV5 B;  5F9N A;  4JV0 A;  5DQI A;  3PW0 A;  5KFT A;  3PW4 A;  4FS2 A;  4O3Q A;  4FBT A;  4ECW A;  5KFE A;  5KFO A;  2WTF A;  5KFM A;  4IRK A;  4J9M A;  4QWB A;  5KFX A;  2JEF A;  4ECZ A;  5KG3 A;  4YP3 A;  4RUC A;  2W8L A;  3NGD A;  4YR2 A;  2W9C A;  5L1K A;  5KFB A;  2XCP A;  5EDW A;  3T5L A;  3M9N B;  5L1I A;  4ECQ A;  4ECR A;  4ED2 A;  5KFY A;  3GIJ A;  4DL5 A;  2J6S A;  5KG5 A;  5EWG A;  1RYS A;  5KFA A;  2AGQ A;  4Q45 A;  2UVU A;  2R8J A;  4R8U B;  4O3O A;  4F4X A;  2BR0 A;  4IRD A;  4EBD A;  2JEI A;  5EWE A;  5DG7 A;  4RU9 A;  3BQ2 A;  5KFC A;  3H4B A;  4RNN A;  4O3P A;  4RZR A;  4JV1 A;  5KFD A;  4TQR A;  4F4Z A;  3KHG A;  5KFQ A;  5L1L A;  5KFN A;  1T94 A;  3G6Y A;  3RAX A;  4FBU A;  5KG0 A;  4DL6 A;  3OSP A;  3RBD A;  2UVV A;  3T5K A;  3Q8S B;  5DLF A;  2C28 A;  2XC9 A;  3M9M B;  5KT2 A;  5L9X A;  4QWA A;  3H40 A;  2BQU A;  2ALZ A;  4YQW A;  3TQ1 A;  4O3S A;  1S0O A;  1JXL A;  4ED8 A;  2W9C B;  4J9N A;  4ECY A;  2VA2 A;  3EPG A;  3KHR A;  4DL2 A;  2BQ3 A;  2J6U A;  2JEJ A;  4J9O A;  2ASJ A;  3V6K A;  3RB3 A;  1ZET A;  1UNN C;  3Q8P B;  4J9S A;  2V4R A;  2AGO A;  1S97 A;  4U6P A;  5KFS A;  4QW9 A;  4ED1 A;  4DL3 A;  3GV8 B;  2DPJ A;  3EPI A;  1JIH A;  5KFW A;  1S10 A;  2OH2 A;  4QWC A;  4U7C A;  1K1Q A;  4EYI B;  5KT3 A;  2C2E A;  2W9A A;  4J9K A;  2RDI A;  3V6J A;  3T5J A;  4F4Y A;  3GIL A;  1RYR A;  5KFR A;  5KT4 A;  2IBK A;  2ASD A;  1JX4 A;  4G3I A;  5DQH A;  4GC6 A;  5KT6 A;  1S0M A;  3GQC A;  4J9R A;  4Q8F A;  1S9F A;  2W7O A;  1N48 A;  5JUM A;  2RDJ A;  3PZP A;  3BJY A;  1S0N A;  3M9O B;  4DL7 A;  5KFG A;  4ECV A;  2C2D A;  5KFP A;  3GII A;  4QWD A;  5KG1 A;  5KFU A;  3GIM A;  3OHB A;  3Q8Q B;  3KHL A;  5DGB A;  5KFH A;  4ED7 A;  4YR3 A;  2UVW A;  2FLL A; 
#chains in the Genus database with same CATH topology
 1RJP A;  1WR2 A;  3N41 B;  1FKA H;  3MR5 A;  4DR1 H;  3MWE A;  2R8K A;  5KKN B;  1CQJ B;  5CAE B;  4A3F G;  2C2R A;  4LFA H;  3OSN A;  5LMN H;  4R8U A;  3HBL A;  5KFZ A;  2W9B A;  3OTO H;  3QFF A;  4FM9 A;  2DPI A;  4KHP H;  1I6U A;  4MV9 A;  4XYM B;  5KFL A;  4L1K A;  5DGA A;  1T3N A;  5IYZ F;  5K2M A;  4IRC A;  2YS7 A;  3RV4 A;  5J2U F;  1XMO H;  2IA6 A;  2ASL A;  4K0K H;  1A9X A;  2HGS A;  4GC7 A;  1Y14 B;  2FLN A;  2FK2 A;  3PR4 A;  2VUM A;  1E4G T;  2YRW A;  2FK1 A;  1ZQ7 A;  4AYB E;  1TWH A;  2AGP A;  2B63 A;  2YZG A;  4JUZ A;  5BMV F;  3GV7 B;  4IR9 A;  5LMU H;  2R8G A;  3UQ8 A;  2XCA A;  3BAB A;  4O4H F;  2QYZ A;  3U9T A;  3GTG A;  3K5H A;  5I47 A;  2FLP A;  4WD3 A;  1O75 A;  4I7H A;  2QK4 A;  2JA5 G;  3KTM A;  4YJ3 F;  3GLK A;  4QJF A;  3LWB A;  2Q2T A;  3SE7 A;  3HKZ E;  4LSX A;  4DV3 H;  4EEQ A;  2UU9 H;  4ME6 A;  2VPS A;  4PWQ A;  2ATL A;  3GTP A;  4C2M A;  4AYB A;  4DUZ H;  4JYA H;  4IZO A;  2R82 A;  2W6Q A;  4HQ6 A;  3U9S A;  4EYH B;  5LP6 F;  1WCM A;  4QWE A;  1TAE A;  1VBH A;  2PMZ E;  3OUU A;  5CB4 F;  3I4M G;  3MR6 A;  1TWG A;  4FS1 A;  4ED6 A;  1IOW A;  3MWD A;  3RB0 A;  1GSA A;  3CQZ A;  3HXL A;  1BGW A;  1EUC B;  3HOZ G;  3GTJ A;  4NXM H;  4A3C G;  2JA7 A;  1DGS A;  4QW8 A;  4O4L F;  3I12 A;  5JH7 F;  3GIP A;  4Q44 A;  3QZ7 A;  3RB4 A;  2R92 A;  3HKZ A;  3RBE A;  4MV6 A;  4QIW E;  2NVX A;  2XGQ A;  4YHH H;  4J9L A;  1I7L A;  3KHH A;  4DV7 H;  2ZJT A;  4HNV A;  3MR2 A;  1GYF A;  3PW7 A;  3RGZ A;  2PMZ A;  1E4E B;  2FE3 A;  3RB6 A;  2AQ4 A;  3MFI A;  3G6X A;  3WO0 A;  1KBL A;  4BBS G;  3HOW G;  1N56 A;  2R7M A;  3MFH A;  1SEI A;  4F50 A;  2PBZ A;  4UCR A;  3BA8 A;  4GKJ H;  3TII A;  1FVI A;  4RUA A;  3RUP A;  5DG9 A;  1E4F T;  5KT7 A;  2W8K A;  2R8H A;  2VA3 A;  4QIW A;  3WO1 A;  4ECX A;  4IR1 A;  4GLX A;  1EZ1 A;  5EZY F;  4TQS A;  3BQ0 A;  3H3V H;  3H0G A;  4ECT A;  3I4N G;  3FKI G;  5KFV A;  3JAM W;  2V58 A;  4EG0 A;  4RNO A;  2C22 A;  2RGR A;  2R86 A;  4A3L G;  3GIK A;  4MTD A;  3OHA A;  1SFO A;  5IP7 G;  4HNT A;  1K83 A;  5FPR A;  5C44 G;  2OLS A;  5KFF A;  1DIK A;  5KG6 A;  4LSA A;  5T14 A;  5KFI A;  3KAL A;  4A2A A;  2YCH A;  4RNM A;  3RAQ A;  2E2H A;  5KFJ A;  1XDN A;  1TWA A;  2X0S A;  3PW5 A;  1JDE A;  1N36 H;  4EFB A;  2IMW P;  1P8L A;  4UCS A;  5KG2 A;  4EBC A;  3V6H A;  4HYK A;  4C5A A;  4UCT A;  4O3N A;  4RB2 C;  3J80 W;  1HNX H;  3E5N A;  1M0W A;  3PR5 B;  3MR3 A;  4PDB A;  2W9B B;  2XGP A;  4F4W A;  2W6M A;  3C0F B;  4C5C A;  3H20 A;  3L4K A;  5F9L A;  5DQG A;  5DLG A;  5IYC G;  2DIK A;  1N34 H;  3VPD A;  2E2I A;  3HOU G;  4XYL B;  3K3V A;  5D1O A;  5LYJ F;  3RIZ A;  1V51 A;  4ECS A;  1HNZ H;  2R8I A;  2CKZ B;  1B33 N;  4J9P A;  4A3B G;  4E4T A;  4JV5 H;  1Z2N X;  3GTK A;  4B3R H;  4DV2 H;  3T5H A;  1KJI A;  2J6T A;  5KT5 A;  3G6V A;  3PW2 A;  1Y1W G;  1J5E H;  1IBM H;  5EOY A;  3BQ1 A;  2HHH H;  5J2T F;  3QZ8 A;  3JSN A;  5IP9 G;  4DL4 A;  4EBE A;  1PX2 A;  4JV2 A;  1Y1V G;  3KAK A;  5L1J A;  4I4T F;  2WE6 A;  2ZDH A;  1S68 A;  2R87 A;  5DG8 A;  2Y0S E;  4ED3 A;  4LF5 H;  2UVR A;  2V4Q A;  2HJW A;  4J9Q A;  4MA0 A;  4JI6 H;  3FDS A;  5C8Y F;  4YBZ B;  4YR0 A;  2YU9 A;  1K1S A;  5KG4 A;  1ZHQ A;  5KG7 A;  4EEY A;  4A3M G;  3PO3 G;  4Q43 A;  4LH6 A;  2V59 A;  2AU0 A;  5C5J A;  4DLK A;  4TUY F;  3IN5 A;  4FU0 A;  1RJQ A;  4ECU A;  2W57 A;  2JEG A;  2DZD A;  2W7P A;  1VS0 A;  1W93 A;  5JQW A;  2XCL A;  2YS6 A;  5EWF A;  2C00 A;  3GTQ A;  4O3R A;  2Y0S A;  1ZHS A;  4A3D G;  2R93 A;  5FD6 A;  4O4I F;  1EYZ A;  4NLG A;  2HVQ A;  2I87 A;  4LF6 H;  2GLT A;  4AQY H;  4ED0 A;  3SI8 A;  4Q8E A;  2V9W A;  2YZN A;  3DF7 A;  1GO3 E;  3T1Y H;  4O2A F;  3H4D A;  3PVX A;  2BQR A;  2YZM A;  1SCU B;  5KFK A;  3BA9 A;  1W96 A;  5CA0 F;  3Q8R B;  4EGJ A;  2GPW A;  4LMY A;  3GV5 B;  2XD4 A;  5F9N A;  4JV0 A;  2WAQ E;  4DR3 H;  5DQI A;  1EUD B;  4DV0 H;  3PW0 A;  5KFT A;  2XIG A;  4C5B A;  3PW4 A;  3G8C A;  5C3E G;  5D8D A;  4JI0 H;  1B6R A;  5FPO A;  4FS2 A;  4O3Q A;  1XNR H;  4FBT A;  2NUA B;  1GSO A;  2PN1 A;  3TIG A;  5KFE A;  4ECW A;  5HV6 A;  2HVR A;  3RTX A;  1AN7 A;  4BWS C;  5KFO A;  4RAY A;  5KFM A;  2WTF A;  4DUY H;  1XNQ H;  4DR6 H;  4IRK A;  2R7Z G;  2JA5 A;  3JRW A;  1KEE A;  3RFC A;  4J9M A;  4MTE A;  3HOY G;  4QWB A;  2WAQ A;  5KFX A;  4DV5 H;  1C30 A;  2JEF A;  3VPB A;  2FP4 B;  2SCU B;  4ECZ A;  4ZQI A;  3KXY T;  3TQT A;  1MZB A;  2R7K A;  5KG3 A;  2VPQ A;  2V5A A;  4YP3 A;  4DV6 H;  4A3J G;  1XMQ H;  4JI8 H;  2NU9 B;  4X64 H;  4LF9 H;  4RUC A;  4YB8 B;  2W8L A;  1BXR A;  4B3S H;  1KJ8 A;  5LOV F;  3NGD A;  4YR2 A;  1GGO A;  2J9G A;  3N44 B;  3RGX A;  2E5L H;  4A2B A;  2VQD A;  2W9C A;  2W6N A;  2W6Z A;  1Z2O X;  5L1K A;  4ZOL F;  5KFB A;  4ZHQ F;  2JA6 G;  2XCP A;  2UXD H;  5EDW A;  4A3K G;  3HOV G;  1VBG A;  4M9U A;  5BPF A;  3T5L A;  2GPS A;  5D1O B;  3M9N B;  5L1I A;  2ZDG A;  4ECQ A;  2UUC H;  1RK5 A;  3FMA A;  2YW2 A;  4ECR A;  2WDT A;  5GON F;  4ED2 A;  4JI1 H;  4IWY A;  5KFY A;  3GIJ A;  4YJ2 F;  2NU6 B;  1DV2 A;  4DL5 A;  2J6S A;  3K3P A;  3JSL A;  1VAJ A;  2W6O A;  5KG5 A;  5EWG A;  1RYS A;  1FJG H;  1R9T A;  5KFA A;  4DR7 H;  3GTO A;  2AGQ A;  4Q45 A;  4HNU A;  2UVU A;  2R8J A;  4XX0 B;  4UFZ A;  4UCU A;  2W70 A;  3N42 B;  4DV4 H;  4X62 H;  4R8U B;  1TA8 A;  4O3O A;  4F4X A;  2BR0 A;  4IRD A;  4EBD A;  3Q2O A;  3FKI A;  1B04 A;  4BXX G;  4ETS A;  2JEI A;  4LFB H;  5EWE A;  3N6X A;  2R6F A;  5DG7 A;  1N33 H;  4RU9 A;  4DR5 H;  3BQ2 A;  5KFC A;  3H4B A;  1I7N A;  3BG5 A;  3JRX A;  4MV3 A;  3N8D A;  5HBR B;  3VMM A;  4RNN A;  4O3P A;  2R84 A;  4CC6 A;  3L4J A;  4A3G G;  3T1H H;  3MWM A;  3N40 P;  4MV7 A;  5JVL A;  1UC9 A;  1C3O A;  4LF7 H;  2MCT A;  4RZR A;  2FKL A;  1I50 A;  2CW7 A;  4B3T H;  4EFE A;  3J7A K;  4JV1 A;  3AYH B;  1IBL H;  5KFD A;  3K5I A;  4TQR A;  3ORR A;  2OWO A;  4F4Z A;  3KHG A;  5KFQ A;  2W71 A;  3R5X A;  1I94 H;  1M7J A;  4LH7 A;  5L1L A;  5KFN A;  4TV9 F;  4EGQ A;  3R5H A;  5LXT F;  3TIN A;  3R5F A;  4WBN F;  4YAK B;  4I55 F;  5H80 A;  1AUX A;  1T94 A;  4ZI7 F;  5LA6 F;  2VUM G;  4A3I G;  3G6Y A;  3RJ0 A;  2B63 G;  2R7N A;  3RAX A;  4FBU A;  1GLV A;  4DR2 H;  4B3M H;  5KG0 A;  4DL6 A;  3MJF A;  3OSP A;  3RBD A;  1AUV A;  2UVV A;  3BAA A;  3T5K A;  4LF4 H;  4M7E A;  3Q8S B;  1V9P A;  4OX9 H;  1KJ9 A;  1Y1W A;  1CE8 A;  1IBK H;  5DLF A;  1KJQ A;  2WYO A;  2C28 A;  1V4Y A;  3HB9 A;  2XC9 A;  1TWC A;  3M9M B;  3KAJ A;  1EHI A;  5KT2 A;  2O03 A;  1Y1V A;  5L9X A;  4QWA A;  3H40 A;  4TV8 F;  2CZG A;  4R7R A;  4BY1 G;  5LL6 b;  2ALZ A;  2BQU A;  1WCM G;  2JA8 G;  1RK6 A;  4YAJ B;  4I50 F;  4YQW A;  2CQY A;  3TQ1 A;  1A0I A;  4YY3 H;  5FLX W;  4O3S A;  1S0O A;  5BR8 H;  2UUB H;  2CW8 A;  1N32 H;  2JA7 G;  5A2Q W;  1JXL A;  3ETH A;  4ED8 A;  2R92 G;  2W9C B;  4J9N A;  5FLM G;  4ECY A;  2YRX A;  2YL2 A;  3R23 A;  2NVY A;  5BPH A;  3EPG A;  3KHR A;  2VA2 A;  1I3Q A;  4RB1 A;  4DL2 A;  2BQ3 A;  1UC8 A;  4BY7 G;  2NU7 B;  2J6U A;  4RB0 A;  2YYA A;  1M0T A;  2JEJ A;  3GTM A;  3GIQ A;  5IT9 W;  1TWF A;  1DV1 A;  4J9O A;  4LFC H;  2ASJ A;  3HOX G;  3J81 W;  4IAJ A;  3V6K A;  4HR7 A;  3RB3 A;  1L2Z A;  4A3E G;  1ZET A;  1UNN C;  3Q8P B;  4MV1 A;  1JKJ B;  4J9S A;  4IWX A;  3L2P A;  2V4R A;  2AGO A;  3CVZ A;  4CC5 A;  5IYD G;  4A93 G;  2UXB H;  2UUA H;  1B6S A;  3N43 B;  3H0G G;  1ULZ A;  1S97 A;  3Q1K A;  2C35 B;  5FJ8 G;  1M6V A;  2FPG B;  4Q0Y A;  4RAZ A;  1T36 A;  4U6P A;  3LML A;  5KFS A;  3OUZ A;  4J0M A;  2WB1 E;  2NU8 B;  1KC7 A;  4UCV A;  4QW9 A;  4ED1 A;  4DL3 A;  2R85 A;  3GV8 B;  3V4Z A;  2DPJ A;  3EPI A;  4JI5 H;  1JIH A;  5KFW A;  1S10 A;  4DR4 H;  2F4V H;  2R7Z A;  4MV8 A;  2OH2 A;  2VQF H;  2DWC A;  2FK3 A;  1VKZ A;  3M4I A;  4QWC A;  4U7C A;  1K1Q A;  3VPC A;  4GKK H;  5KT3 A;  4EYI B;  4JI3 H;  2C2E A;  2W9A A;  4J9K A;  4XZ3 B;  2RDI A;  3V6J A;  3T5J A;  2I8C A;  4F4Y A;  3PN1 A;  4JI4 H;  2I80 A;  2R7L A;  3PO2 G;  3GIL A;  1RJR A;  1BNC A;  2VQE H;  1S03 G;  4JI2 H;  1RYR A;  2WB1 A;  1HNW H;  3UFX B;  1Z2P X;  2RGV A;  4UCO A;  5KFR A;  1JDB B;  5C1P A;  3ETJ A;  4MAM A;  5KT4 A;  2IBK A;  3RF2 A;  3WNZ A;  4MV4 A;  2ZM6 H;  2FJZ A;  3JZI A;  2ASD A;  1CS0 A;  1IOV A;  1CQI B;  2JA6 A;  1JX4 A;  5CA1 F;  1SYX B;  4G3I A;  2UXC H;  3IG0 A;  5DQH A;  4GC6 A;  2FB9 A;  3ORQ A;  1E4E A;  5KT6 A;  2RF4 A;  4LF8 H;  2FPI B;  1S0M A;  2Q2U A;  5D1P A;  3GQC A;  1GSH A;  4J9R A;  3LP8 A;  1S9F A;  4X66 H;  4Q8F A;  2W7O A;  4RZQ A;  1N48 A;  2M05 A;  4JI7 H;  5JVD F;  5JUM A;  3EYY A;  2RDJ A;  1OWT A;  1WSC A;  2KSW A;  3F8N A;  3PZP A;  3BJY A;  2IP4 A;  2FPP B;  1S0N A;  4Y8V B;  2VOB A;  5C1O A;  3M9O B;  2FMA A;  2VUG A;  4DL7 A;  5KFG A;  4ECV A;  3GTL A;  5KX5 F;  5IYB G;  1WH2 A;  4DV1 H;  2C2D A;  4O2B F;  2HVS A;  5KFP A;  3GII A;  2W6P A;  1KJJ A;  3GID A;  2P0A A;  2PVP A;  5FD5 A;  4MA5 A;  4QWD A;  5KG1 A;  1JLL B;  5KFU A;  5C4X G;  2VR1 A;  3GIM A;  3OHB A;  4BBR G;  4NXN H;  4IHJ F;  3V4S A;  3Q8Q B;  3KHL A;  1X9N A;  1BJT A;  5DGB A;  5KFH A;  1HR0 H;  2ZDQ A;  4X65 H;  1PK8 A;  4ED7 A;  4YR3 A;  2DLN A;  4APM A;  2UVW A;  2R93 G;  4RB3 C;  3RV3 A;  2FLL A;  5IWA H; 
#chains in the Genus database with same CATH homology
 3MR5 A;  2R8K A;  2C2R A;  3OSN A;  4R8U A;  5KFZ A;  2W9B A;  2DPI A;  5KFL A;  5DGA A;  1T3N A;  4IRC A;  2IA6 A;  2ASL A;  4GC7 A;  2FLN A;  3PR4 A;  2AGP A;  4JUZ A;  3GV7 B;  4IR9 A;  2R8G A;  2XCA A;  2FLP A;  2ATL A;  4EYH B;  4QWE A;  3MR6 A;  4FS1 A;  4ED6 A;  3RB0 A;  4QW8 A;  4Q44 A;  3QZ7 A;  3RB4 A;  3RBE A;  2XGQ A;  4J9L A;  3KHH A;  3MR2 A;  3PW7 A;  3RB6 A;  2AQ4 A;  3MFI A;  3G6X A;  1N56 A;  3MFH A;  4F50 A;  4RUA A;  5DG9 A;  2W8K A;  5KT7 A;  2R8H A;  2VA3 A;  4ECX A;  4IR1 A;  4TQS A;  3BQ0 A;  4ECT A;  5KFV A;  4RNO A;  2C22 A;  3GIK A;  3OHA A;  5KFF A;  5KG6 A;  5T14 A;  4RNM A;  5KFI A;  3RAQ A;  5KFJ A;  3PW5 A;  2IMW P;  5KG2 A;  4EBC A;  3V6H A;  4HYK A;  4O3N A;  3PR5 B;  3MR3 A;  2W9B B;  2XGP A;  4F4W A;  5F9L A;  5DQG A;  5DLG A;  4ECS A;  2R8I A;  4J9P A;  3T5H A;  2J6T A;  5KT5 A;  3G6V A;  3PW2 A;  3BQ1 A;  3QZ8 A;  4DL4 A;  4EBE A;  4JV2 A;  5L1J A;  5DG8 A;  4ED3 A;  2UVR A;  2V4Q A;  4J9Q A;  3FDS A;  4YR0 A;  1K1S A;  5KG4 A;  5KG7 A;  4EEY A;  4Q43 A;  2AU0 A;  5C5J A;  3IN5 A;  4ECU A;  2JEG A;  2W7P A;  5EWF A;  4O3R A;  4NLG A;  4ED0 A;  3SI8 A;  4Q8E A;  2V9W A;  3H4D A;  2BQR A;  3PVX A;  5KFK A;  3Q8R B;  3GV5 B;  5F9N A;  4JV0 A;  5DQI A;  3PW0 A;  5KFT A;  3PW4 A;  4FS2 A;  4O3Q A;  4FBT A;  4ECW A;  5KFE A;  5KFO A;  2WTF A;  5KFM A;  4IRK A;  4J9M A;  4QWB A;  5KFX A;  2JEF A;  4ECZ A;  5KG3 A;  4YP3 A;  4RUC A;  2W8L A;  3NGD A;  4YR2 A;  2W9C A;  5L1K A;  5KFB A;  2XCP A;  5EDW A;  3T5L A;  3M9N B;  5L1I A;  4ECQ A;  4ECR A;  4ED2 A;  5KFY A;  3GIJ A;  4DL5 A;  2J6S A;  5KG5 A;  5EWG A;  1RYS A;  5KFA A;  2AGQ A;  4Q45 A;  2UVU A;  2R8J A;  4R8U B;  4O3O A;  4F4X A;  2BR0 A;  4IRD A;  4EBD A;  2JEI A;  5EWE A;  5DG7 A;  4RU9 A;  3BQ2 A;  5KFC A;  3H4B A;  4RNN A;  4O3P A;  4RZR A;  4JV1 A;  5KFD A;  4TQR A;  4F4Z A;  3KHG A;  5KFQ A;  5L1L A;  5KFN A;  1T94 A;  3G6Y A;  3RAX A;  4FBU A;  5KG0 A;  4DL6 A;  3OSP A;  3RBD A;  2UVV A;  3T5K A;  3Q8S B;  5DLF A;  2C28 A;  2XC9 A;  3M9M B;  5KT2 A;  5L9X A;  4QWA A;  3H40 A;  2BQU A;  2ALZ A;  4YQW A;  3TQ1 A;  4O3S A;  1S0O A;  1JXL A;  4ED8 A;  2W9C B;  4J9N A;  4ECY A;  2VA2 A;  3EPG A;  3KHR A;  4DL2 A;  2BQ3 A;  2J6U A;  2JEJ A;  4J9O A;  2ASJ A;  3V6K A;  3RB3 A;  1ZET A;  1UNN C;  3Q8P B;  4J9S A;  2V4R A;  2AGO A;  1S97 A;  4U6P A;  5KFS A;  4QW9 A;  4ED1 A;  4DL3 A;  3GV8 B;  2DPJ A;  3EPI A;  1JIH A;  5KFW A;  1S10 A;  2OH2 A;  4QWC A;  4U7C A;  1K1Q A;  4EYI B;  5KT3 A;  2C2E A;  2W9A A;  4J9K A;  2RDI A;  3V6J A;  3T5J A;  4F4Y A;  3GIL A;  1RYR A;  5KFR A;  5KT4 A;  2IBK A;  2ASD A;  1JX4 A;  4G3I A;  5DQH A;  4GC6 A;  5KT6 A;  1S0M A;  3GQC A;  4J9R A;  4Q8F A;  1S9F A;  2W7O A;  1N48 A;  5JUM A;  2RDJ A;  3PZP A;  3BJY A;  1S0N A;  3M9O B;  4DL7 A;  5KFG A;  4ECV A;  2C2D A;  5KFP A;  3GII A;  4QWD A;  5KG1 A;  5KFU A;  3GIM A;  3OHB A;  3Q8Q B;  3KHL A;  5DGB A;  5KFH A;  4ED7 A;  4YR3 A;  2UVW A;  2FLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...