1UNNC

Complex of beta-clamp processivity factor and little finger domain of poliv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
b'HHVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA POLYMERASE III BETA SUBUNIT
molecule tags Beta-clamp
source organism Escherichia coli
publication title Structural Basis for Recruitment of Translesion DNA Polymerase Pol Iv/Dinb to the Beta-Clamp
pubmed doi rcsb
total genus 32
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 1unnC00
4U6PA 2IBKA 5KFNA 2C22A 2W9CB 3BJYA 5KFAA 3OHAA 3PW7A 3V6KA 4J9KA 4DL7A 4J9SA 5KFEA 3G6VA 5KFXA 1S10A 5KT6A 4ECTA 4JV1A 4ECZA 5KG3A 3GQCA 3M9NB 3PW2A 1ZETA 1K1QA 5KFQA 5EWGA 5KFCA 4RNNA 4DL5A 5KFYA 4J9MA 5JUMA 4YR0A 2C2DA 1S9FA 2BQ3A 3H40A 3Q8SB 2JEIA 4ED8A 4DL2A 4EBCA 4O3QA 5DQHA 4O3NA 5KT4A 4J9RA 4ED7A 4ECXA 5KFJA 3Q8PB 4RU9A 4Q8FA 4DL4A 4ED1A 3G6YA 3GV7B 4YP3A 5L1IA 4ED6A 3T5JA 4DL6A 1N48A 2IMWP 1N56A 1RYSA 4YQWA 5L9XA 2R8HA 5KG7A 3TQ1A 4Q45A 4GC6A 2J6SA 4EYHB 4QWAA 3MFIA 5EDWA 4RUAA 4QW9A 1JIHA 5DGBA 5L1LA 4FBUA 3Q8RB 4RNOA 3PW0A 5DLFA 5KT5A 2BR0A 3FDSA 4EYIB 2JEGA 2RDIA 3OSPA 3RB3A 2FLPA 5KFWA 3OSNA 2W7PA 5KFVA 2ASJA 3BQ1A 1S0NA 3V6JA 3MR2A 4FS2A 2C2EA 1S97A 2FLNA 2J6TA 5T14A 4ECUA 1T3NA 5KFIA 1T94A 4O3PA 5KT2A 3KHHA 4F4YA 4F50A 4F4XA 4J9QA 4ED0A 3PR5B 2AU0A 3Q8QB 2XC9A 3RBDA 2ATLA 3QZ8A 1UNNC 5F9NA 4QWCA 3KHRA 5KG4A 4YR3A 3MR3A 5DQIA 2VA3A 4ECWA 2UVRA 2XCAA 2ASLA 3PR4A 4FBTA 2BQRA 4IRKA 4ED3A 4GC7A 4R8UB 4G3IA 4ECRA 3PZPA 1JX4A 5KFPA 4ECQA 3GIIA 5KG0A 5KFSA 2V4QA 4TQRA 2W8LA 5F9LA 1K1SA 5EWEA 3KHGA 5DQGA 3GILA 2R8GA 4ECVA 2ALZA 4F4WA 4J9LA 5KFRA 5KFDA 2AGPA 3RB4A 4IRCA 2C28A 3T5HA 5KG2A 4RNMA 3MR6A 3RAXA 4F4ZA 3PW5A 2W8KA 4O3SA 4JUZA 4TQSA 4NLGA 2WTFA 2W9BA 4QWEA 4QWDA 3MFHA 3BQ0A 2VA2A 2UVUA 2XGQA 4DL3A 2W9BB 2V9WA 5KFFA 2W9AA 2W9CA 3NGDA 2ASDA 4Q8EA 2RDJA 1JXLA 5KFLA 2R8KA 4JV0A 3T5KA 4EBDA 2DPJA 3H4BA 5KFTA 3GV8B 4IRDA 4RUCA 2BQUA 5KFOA 3OHBA 4Q44A 3M9MB 2V4RA 3KHLA 4U7CA 5C5JA 3T5LA 2W7OA 5KFBA 5KFUA 3QZ7A 4ECSA 2AQ4A 3GIJA 5KT3A 5DG9A 4O3RA 4EBEA 3H4DA 3G6XA 2JEFA 3MR5A 2UVWA 2OH2A 4J9PA 2AGQA 2C2RA 4EEYA 5KFZA 1RYRA 5KT7A 3BQ2A 4J9OA 3M9OB 5EWFA 3SI8A 4Q43A 5DLGA 5KFMA 4J9NA 2UVVA 2XGPA 4ECYA 1S0OA 4O3OA 2J6UA 3GIMA 3V6HA 2DPIA 4ED2A 5KFKA 3PVXA 3IN5A 2FLLA 2IA6A 4FS1A 2JEJA 5KG1A 3RAQA 2XCPA 5KG5A 4IR1A 5DG8A 4RZRA 2R8IA 5L1JA 5DG7A 4YR2A 3GIKA 3GV5B 3RB6A 3RBEA 5KFGA 3RB0A 3PW4A 1S0MA 4IR9A 3EPIA 5L1KA 2AGOA 5KFHA 4HYKA 5DGAA 4JV2A 4QWBA 4R8UA 3EPGA 5KG6A 4QW8A 2R8JA
chains in the Genus database with same CATH superfamily
4M9UA 4DR2H 5KFNA 4JV5H 4LH6A 2JA5A 3HOUG 3BJYA 4MTDA 2CW7A 2FK1A 2HVQA 4APMA 4OX9H 4WD3A 4C5AA 1ULZA 3UQ8A 1I50A 2Q2TA 3PW2A 2FMAA 1SFOA 5EWGA 3KXYT 1EHIA 5A2QW 3OUUA 5KFYA 4RB1A 4RNNA 4YR0A 4J9MA 5C4XG 4A3KG 4QIWE 4ED8A 1N33H 4EBCA 5DQHA 1B6RA 4O3NA 4MV7A 5KFJA 3GIQA 4DL4A 2UUCH 4O4LF 1GGOA 1VS0A 2R6FA 5KX5F 2CKZB 4ZHQF 3C0FB 4NXNH 3ETHA 4YQWA 5L9XA 2ZJTA 4B3SH 5KG7A 3TQ1A 3N42B 2J6SA 4IZOA 4QWAA 3RJ0A 2PMZE 4QW9A 2W57A 5L1LA 4DR1H 5BPHA 4EYIB 1AUVA 1UC8A 2W7PA 5KFVA 2ASJA 1TWHA 2C2EA 1S97A 4FS2A 3J80W 2V59A 2J6TA 4JI1H 2FPPB 1EZ1A 1T94A 4O3PA 3KHHA 4F4YA 4F4XA 4A3GG 1Y1VG 3QFFA 4XYMB 2NVYA 5F9NA 4CC5A 3QZ8A 3KHRA 5KG4A 2VA3A 5DQIA 1DV1A 4NXMH 4TV9F 1VKZA 4LFBH 3AYHB 3VPBA 4C2MA 4CC6A 3WO1A 2VQFH 5C3EG 3PZPA 2R7NA 5KG0A 3L2PA 2V4QA 2WYOA 2W8LA 1RK5A 3R5HA 1K1SA 5F9LA 3GILA 1EUCB 2CW8A 4E4TA 3RTXA 4UCUA 2AGPA 3RB4A 4Y8VB 2FPGB 4LFAH 3T5HA 5I47A 4A3JG 5KKNB 2R92G 4MA5A 4X65H 3H3VH 3I4MG 3BG5A 4QWEA 2W6QA 3MFHA 4B3TH 2UVUA 2GPWA 4UCRA 4DR3H 2Q2UA 2V9WA 3NGDA 1M0WA 2ASDA 1JXLA 2R8KA 2GLTA 4IRDA 3V4ZA 1V51A 4RUCA 3JSNA 4QIWA 5JQWA 5KFOA 3T5LA 4Q44A 2HJWA 3M4IA 1BNCA 5FPRA 3RGZA 4EGJA 3QZ7A 4O4HF 4DUYH 4ECSA 1M0TA 5KT3A 4BY7G 4EBEA 4IHJF 3U9TA 4YY3H 2OH2A 3GTLA 4EEYA 5KFZA 2UXCH 1TWAA 3RUPA 5KT7A 4XX0B 4A3MG 4DR7H 3IG0A 5EWFA 2W6NA 4AQYH 4J9NA 3CVZA 2VOBA 4IAJA 2UXBH 3V6HA 3HKZA 4ED2A 2GPSA 4DV7H 3PVXA 4MTEA 2YU9A 4FS1A 5KG1A 4EEQA 5KG5A 5DG7A 1S03G 1KEEA 1Y1WA 3V4SA 1XNRH 4C5CA 2JA6G 4IR9A 1S0MA 3EPIA 5L1KA 4BY1G 1VBGA 2YZNA 1GYFA 3RF2A 3J7AK 1Y14B 3TIGA 4R8UA 3EPGA 3T5JA 2HVSA 5HBRB 2JA8G 1IBLH 2ZDQA 1DIKA 4MAMA 3WNZA 2W9CB 3GIDA 2PBZA 3FKIA 5KFAA 3OHAA 3PW7A 3PO2G 4J9KA 4J9SA 4EFBA 1S10A 4LF4H 4LH7A 4ECZA 4ZI7F 3GQCA 3M9NB 1VAJA 1ZETA 4MV4A 1K1QA 3PN1A 5KFQA 5IYZF 2VPSA 4DL5A 2BQ3A 2R7ZA 5JUMA 2I8CA 4MV1A 1E4EB 3H40A 2YRWA 2XIGA 4O3QA 1SCUB 1TWGA 3K5HA 2ZDHA 5KT4A 4ZQIA 2E2HA 1TWCA 2WE6A 3H0GG 3R5FA 4JI7H 1FJGH 2OWOA 2E5LH 2VPQA 3HKZE 2DWCA 1RYSA 1ZHSA 3HOVG 5JVDF 2Y0SA 3RV4A 4UFZA 1RJPA 4MV8A 4RAZA 3T1HH 2R82A 3MFIA 1AUXA 5DGBA 4FBUA 1KJIA 3PW0A 5DLFA 5HV6A 2RDIA 3RB3A 5KFWA 5FD6A 3GIPA 3V6JA 4JYAH 1E4EA 4A2BA 1TAEA 2BQUA 2P0AA 2FP4B 4DR5H 4J9QA 4ED0A 2XC9A 3RBDA 4DLKA 4ZOLF 5FLXW 3TINA 2UVRA 4LF9H 1HNZH 2ASLA 1L2ZA 4I50F 4XYLB 4MV3A 4X64H 1VBHA 1B6SA 3BABA 2R7KA 4IRKA 4ED3A 1I7LA 2VR1A 4ECRA 1P8LA 1C30A 5BMVF 5KFPA 3N40P 3GIIA 2R7MA 2F4VH 5KFSA 2RGVA 4TQRA 4ME6A 1WH2A 3EYYA 5EWEA 2RF4A 3KHGA 2NU8B 2ALZA 4F4WA 1DGSA 4UCVA 4L1KA 5KFDA 1HNWH 1KJ8A 1N32H 4LF6H 2C28A 4EG0A 5IP7G 1JDBB 5D1OA 4F4ZA 2W8KA 3JRXA 3PW5A 1V9PA 4JUZA 4TQSA 3Q2OA 2W9BA 3JAMW 5D8DA 1W93A 4XZ3B 5FLMG 2W9BB 3KAJA 4LF7H 5KFFA 2VUMG 2W9CA 3E5NA 3KTMA 1EUDB 1M6VA 4Q8EA 2I80A 4O2AF 4EBDA 3R5XA 3H4BA 1GLVA 2W6PA 4I4TF 1TA8A 5D1PA 3OHBA 2I87A 1KJQA 3K3VA 2AQ4A 5KFUA 2R92A 1KBLA 4O3RA 2WAQE 4ETSA 4J0MA 2JEFA 1W96A 2R93A 1I94H 3BAAA 2C2RA 3HBLA 1RYRA 1C3OA 4J9OA 1GO3E 1XMQH 2YYAA 4MV9A 2YRXA 3TQTA 5BR8H 3M9OB 3SI8A 4YB8B 5KFMA 2UUAH 1GSHA 1ZQ7A 4ECYA 4DV6H 4O3OA 2FK2A 1A9XA 1S0OA 3GIMA 2UVVA 4BBSG 5KFKA 4A93G 1WCMA 1A0IA 3IN5A 5C1PA 2XCPA 4GLXA 3RBEA 5L1JA 3GIKA 3GV5B 5CA1F 1V4YA 2KSWA 2AGOA 2R84A 3VPDA 2FJZA 5KFHA 4A3CG 5GONF 4QWBA 1FKAH 4A3DG 2IBKA 5LL6b 2C22A 5CB4F 4RB2C 4BBRG 5K2MA 4IWXA 1O75A 2B63G 1XNQH 3K5IA 3U9SA 5KFXA 3G6VA 5KT6A 4ECTA 4GKKH 2NVXA 2JA5G 5C8YF 5KFCA 4JI4H 2JA6A 4O4IF 2VQDA 3ORRA 1E4GT 2FB9A 5CA0F 2ZM6H 2HVRA 3GTQA 4C5BA 1WSCA 4ED7A 3Q8PB 4Q8FA 3PO3G 3HXLA 2PMZA 3G6YA 4ED1A 1BGWA 2YZMA 3BA9A 4YP3A 1CE8A 4DL6A 1N48A 2IMWP 2J9GA 1SYXB 2E2IA 1FVIA 1JDEA 4EYHB 4LMYA 4TUYF 4R7RA 1JIHA 4QJFA 3FMAA 3JZIA 4RNOA 4Q0YA 1K83A 4LSAA 2XD4A 3FDSA 2BR0A 2UUBH 4DUZH 4KHPH 1Y1VA 2O03A 4RB0A 3RGXA 2YCHA 3BQ1A 1S0NA 1Z2PX 3H0GA 2NUAB 5IWAH 2FLNA 1PK8A 5T14A 4WBNF 5IYDG 4BXXG 4X62H 5KT2A 5FJ8G 2AU0A 1N56A 2JA7G 3Q8QB 1UNNC 4BWSC 4QWCA 4A3EG 2PN1A 4YR3A 3MR3A 1IOVA 4RZQA 4ECWA 1SEIA 4FBTA 2BQRA 2CZGA 5JH7F 4GC7A 1ZHQA 4G3IA 4B3RH 2RGRA 4ECQA 3HOWG 5LOVF 3OTOH 5LYJF 4IRCA 1RJRA 3LP8A 3JRWA 5KG2A 4RNMA 2VUGA 2DIKA 2NU7B 1J5EH 1Z2OX 4O3SA 3HOXG 4NLGA 2WTFA 1JLLB 2FPIB 1Z2NX 2NU9B 3BQ0A 2VA2A 1N36H 1GSAA 4M7EA 4K0KH 4DL3A 3LMLA 4PWQA 1R9TA 2UXDH 2RDJA 5KFLA 3HOYG 1EYZA 4JV0A 1HR0H 3T5KA 5KFTA 3GV8B 4A3FG 2CQYA 3SE7A 1B33N 2V4RA 2YS6A 5C5JA 4U7CA 2W7OA 1X9NA 2R86A 5BPFA 5DG9A 3MWDA 3RFCA 5IP9G 3G6XA 3JSLA 3MR5A 1N34H 4J9PA 2AGQA 2WB1A 3T1YH 1KJ9A 4DV3H 3BQ2A 2W6MA 1HNXH 5FPOA 2VUMA 4Q43A 4DV4H 5IT9W 2Y0SE 3CQZA 4UCOA 2XGPA 2VQEH 2J6UA 2V58A 4YBZB 1IBMH 2FLLA 3L4JA 2IA6A 3RAQA 3WO0A 2R8IA 2PVPA 4MV6A 1JX4A 3RB0A 3PW4A 4FM9A 4TV8F 5DGAA 3RIZA 4JV2A 4JI8H 4I7HA 1S68A 4U6PA 2QYZA 1I3QA 3L4KA 1E4FT 1Y1WG 3GTKA 4YJ3F 5LA6F 1IOWA 2HGSA 4DV5H 4DV0H 4MA0A 1BJTA 3V6KA 5H80A 5KFEA 3N44B 1T36A 4A2AA 2W70A 4EGQA 4JV1A 1JKJB 3G8CA 5KG3A 3GTGA 3I12A 1KJJA 5D1OB 3FKIG 5EOYA 2FKLA 2C2DA 1S9FA 2ZDGA 3Q8SB 2JEIA 2W6ZA 1GSOA 4DL2A 3HB9A 3KALA 4J9RA 4UCSA 2R7LA 4ECXA 4RU9A 4LFCH 3GV7B 5L1IA 2NU6B 2X0SA 4ED6A 1CQJB 5IYBG 2DZDA 4YAKB 5J2UF 3MWEA 3OUZA 4EFEA 3J81W 2R8HA 4Q45A 1PX2A 1B04A 4GC6A 1MZBA 2WDTA 2W6OA 2OLSA 5EDWA 2V5AA 1IBKH 4RUAA 2YZGA 2C00A 2QK4A 4JI5H 3MWMA 2FK3A 3K3PA 3N43B 3Q8RB 4LF5H 4YHHH 3ETJA 3RV3A 5KT5A 2JEGA 3MJFA 3OSPA 2FLPA 1WR2A 3OSNA 1BXRA 4AYBE 4HQ6A 1DV2A 3MR2A 4PDBA 1OWTA 4ECUA 3TIIA 1T3NA 4UCTA 1CQIB 5KFIA 4LSXA 4DL7A 4DV1H 4F50A 3PR5B 2ATLA 5FD5A 4DV2H 4IWYA 2XCAA 3PR4A 2WAQA 2YS7A 4R8UB 1I6UA 4RB3C 1M7JA 3HOZG 2R85A 4AYBA 3ORQA 2SCUB 5DQGA 2R8GA 4ECVA 5EZYF 3I4NG 4J9LA 3N8DA 5KFRA 3GLKA 3GTPA 4LF8H 2JA7A 1CS0A 2IP4A 2MCTA 4JI2H 4B3MH 2YW2A 5C44G 3MR6A 3RAXA 4RAYA 4YJ2F 4QWDA 4HR7A 1AN7A 2UU9H 2XGQA 5LMNH 4A3LG 2WB1E 3R23A 2HHHH 5J2TF 2W9AA 3N41B 3F8NA 4A3IG 3GTMA 4FU0A 4JI3H 4I55F 2DPJA 2M05A 2YL2A 3KAKA 5IYCG 3GTOA 5JVLA 3N6XA 1XDNA 3M9MB 3KHLA 3GTJA 4HNUA 4X66H 5KFBA 3GIJA 1RK6A 3BA8A 3H4DA 2UVWA 3VPCA 2R87A 4JI6H 5C1OA 4A3BG 4DR4H 3VMMA 5DLGA 5CAEB 4HNTA 2DPIA 2R93G 1XMOH 1I7NA 1TWFA 3UFXB 3H20A 1KC7A 2C35B 2JEJA 4JI0H 4O2BF 4DR6H 3LWBA 4IR1A 1UC9A 5DG8A 4YAJB 4RZRA 3RB6A 3DF7A 4YR2A 1RJQA 2W71A 5KFGA 5LMUH 2R7ZG 2DLNA 4HNVA 4GKJH 1WCMG 2XCLA 2B63A 4HYKA 2FE3A 5LXTF 3Q1KA 5KG6A 4QW8A 2R8JA 5LP6F
chains in the Genus database with same CATH topology
4U6PA 2IBKA 5KFNA 2C22A 2W9CB 3BJYA 5KFAA 3OHAA 3PW7A 3V6KA 4J9KA 4DL7A 4J9SA 5KFEA 3G6VA 5KFXA 1S10A 5KT6A 4ECTA 4JV1A 4ECZA 5KG3A 3GQCA 3M9NB 3PW2A 1ZETA 1K1QA 5KFQA 5EWGA 5KFCA 4RNNA 4DL5A 5KFYA 4J9MA 5JUMA 4YR0A 2C2DA 1S9FA 2BQ3A 3H40A 3Q8SB 2JEIA 4ED8A 4DL2A 4EBCA 4O3QA 5DQHA 4O3NA 5KT4A 4J9RA 4ED7A 4ECXA 5KFJA 3Q8PB 4RU9A 4Q8FA 4DL4A 4ED1A 3G6YA 3GV7B 4YP3A 5L1IA 4ED6A 3T5JA 4DL6A 1N48A 2IMWP 1N56A 1RYSA 4YQWA 5L9XA 2R8HA 5KG7A 3TQ1A 4Q45A 4GC6A 2J6SA 4EYHB 4QWAA 3MFIA 5EDWA 4RUAA 4QW9A 1JIHA 5DGBA 5L1LA 4FBUA 3Q8RB 4RNOA 3PW0A 5DLFA 5KT5A 2BR0A 3FDSA 4EYIB 2JEGA 2RDIA 3OSPA 3RB3A 2FLPA 5KFWA 3OSNA 2W7PA 5KFVA 2ASJA 3BQ1A 1S0NA 3V6JA 3MR2A 4FS2A 2C2EA 1S97A 2FLNA 2J6TA 5T14A 4ECUA 1T3NA 5KFIA 1T94A 4O3PA 5KT2A 3KHHA 4F4YA 4F50A 4F4XA 4J9QA 4ED0A 3PR5B 2AU0A 3Q8QB 2XC9A 3RBDA 2ATLA 3QZ8A 1UNNC 5F9NA 4QWCA 3KHRA 5KG4A 4YR3A 3MR3A 5DQIA 2VA3A 4ECWA 2UVRA 2XCAA 2ASLA 3PR4A 4FBTA 2BQRA 4IRKA 4ED3A 4GC7A 4R8UB 4G3IA 4ECRA 3PZPA 1JX4A 5KFPA 4ECQA 3GIIA 5KG0A 5KFSA 2V4QA 4TQRA 2W8LA 5F9LA 1K1SA 5EWEA 3KHGA 5DQGA 3GILA 2R8GA 4ECVA 2ALZA 4F4WA 4J9LA 5KFRA 5KFDA 2AGPA 3RB4A 4IRCA 2C28A 3T5HA 5KG2A 4RNMA 3MR6A 3RAXA 4F4ZA 3PW5A 2W8KA 4O3SA 4JUZA 4TQSA 4NLGA 2WTFA 2W9BA 4QWEA 4QWDA 3MFHA 3BQ0A 2VA2A 2UVUA 2XGQA 4DL3A 2W9BB 2V9WA 5KFFA 2W9AA 2W9CA 3NGDA 2ASDA 4Q8EA 2RDJA 1JXLA 5KFLA 2R8KA 4JV0A 3T5KA 4EBDA 2DPJA 3H4BA 5KFTA 3GV8B 4IRDA 4RUCA 2BQUA 5KFOA 3OHBA 4Q44A 3M9MB 2V4RA 3KHLA 4U7CA 5C5JA 3T5LA 2W7OA 5KFBA 5KFUA 3QZ7A 4ECSA 2AQ4A 3GIJA 5KT3A 5DG9A 4O3RA 4EBEA 3H4DA 3G6XA 2JEFA 3MR5A 2UVWA 2OH2A 4J9PA 2AGQA 2C2RA 4EEYA 5KFZA 1RYRA 5KT7A 3BQ2A 4J9OA 3M9OB 5EWFA 3SI8A 4Q43A 5DLGA 5KFMA 4J9NA 2UVVA 2XGPA 4ECYA 1S0OA 4O3OA 2J6UA 3GIMA 3V6HA 2DPIA 4ED2A 5KFKA 3PVXA 3IN5A 2FLLA 2IA6A 4FS1A 2JEJA 5KG1A 3RAQA 2XCPA 5KG5A 4IR1A 5DG8A 4RZRA 2R8IA 5L1JA 5DG7A 4YR2A 3GIKA 3GV5B 3RB6A 3RBEA 5KFGA 3RB0A 3PW4A 1S0MA 4IR9A 3EPIA 5L1KA 2AGOA 5KFHA 4HYKA 5DGAA 4JV2A 4QWBA 4R8UA 3EPGA 5KG6A 4QW8A 2R8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6P A;  2IBK A;  5KFN A;  2C22 A;  2W9C B;  3BJY A;  5KFA A;  3OHA A;  3PW7 A;  3V6K A;  4J9K A;  4DL7 A;  4J9S A;  5KFE A;  3G6V A;  5KFX A;  1S10 A;  5KT6 A;  4ECT A;  4JV1 A;  4ECZ A;  5KG3 A;  3GQC A;  3M9N B;  3PW2 A;  1ZET A;  1K1Q A;  5KFQ A;  5EWG A;  5KFC A;  4RNN A;  4DL5 A;  5KFY A;  4J9M A;  5JUM A;  4YR0 A;  2C2D A;  1S9F A;  2BQ3 A;  3H40 A;  3Q8S B;  2JEI A;  4ED8 A;  4DL2 A;  4EBC A;  4O3Q A;  5DQH A;  4O3N A;  5KT4 A;  4J9R A;  4ED7 A;  4ECX A;  5KFJ A;  3Q8P B;  4RU9 A;  4Q8F A;  4DL4 A;  4ED1 A;  3G6Y A;  3GV7 B;  4YP3 A;  5L1I A;  4ED6 A;  3T5J A;  4DL6 A;  1N48 A;  2IMW P;  1N56 A;  1RYS A;  4YQW A;  5L9X A;  2R8H A;  5KG7 A;  3TQ1 A;  4Q45 A;  4GC6 A;  2J6S A;  4EYH B;  4QWA A;  3MFI A;  5EDW A;  4RUA A;  4QW9 A;  1JIH A;  5DGB A;  5L1L A;  4FBU A;  3Q8R B;  4RNO A;  3PW0 A;  5DLF A;  5KT5 A;  2BR0 A;  3FDS A;  4EYI B;  2JEG A;  2RDI A;  3OSP A;  3RB3 A;  2FLP A;  5KFW A;  3OSN A;  2W7P A;  5KFV A;  2ASJ A;  3BQ1 A;  1S0N A;  3V6J A;  3MR2 A;  4FS2 A;  2C2E A;  1S97 A;  2FLN A;  2J6T A;  5T14 A;  4ECU A;  1T3N A;  5KFI A;  1T94 A;  4O3P A;  5KT2 A;  3KHH A;  4F4Y A;  4F50 A;  4F4X A;  4J9Q A;  4ED0 A;  3PR5 B;  2AU0 A;  3Q8Q B;  2XC9 A;  3RBD A;  2ATL A;  3QZ8 A;  1UNN C;  5F9N A;  4QWC A;  3KHR A;  5KG4 A;  4YR3 A;  3MR3 A;  5DQI A;  2VA3 A;  4ECW A;  2UVR A;  2XCA A;  2ASL A;  3PR4 A;  4FBT A;  2BQR A;  4IRK A;  4ED3 A;  4GC7 A;  4R8U B;  4G3I A;  4ECR A;  3PZP A;  1JX4 A;  5KFP A;  4ECQ A;  3GII A;  5KG0 A;  5KFS A;  2V4Q A;  4TQR A;  2W8L A;  5F9L A;  1K1S A;  5EWE A;  3KHG A;  5DQG A;  3GIL A;  2R8G A;  4ECV A;  2ALZ A;  4F4W A;  4J9L A;  5KFR A;  5KFD A;  2AGP A;  3RB4 A;  4IRC A;  2C28 A;  3T5H A;  5KG2 A;  4RNM A;  3MR6 A;  3RAX A;  4F4Z A;  3PW5 A;  2W8K A;  4O3S A;  4JUZ A;  4TQS A;  4NLG A;  2WTF A;  2W9B A;  4QWE A;  4QWD A;  3MFH A;  3BQ0 A;  2VA2 A;  2UVU A;  2XGQ A;  4DL3 A;  2W9B B;  2V9W A;  5KFF A;  2W9A A;  2W9C A;  3NGD A;  2ASD A;  4Q8E A;  2RDJ A;  1JXL A;  5KFL A;  2R8K A;  4JV0 A;  3T5K A;  4EBD A;  2DPJ A;  3H4B A;  5KFT A;  3GV8 B;  4IRD A;  4RUC A;  2BQU A;  5KFO A;  3OHB A;  4Q44 A;  3M9M B;  2V4R A;  3KHL A;  4U7C A;  5C5J A;  3T5L A;  2W7O A;  5KFB A;  5KFU A;  3QZ7 A;  4ECS A;  2AQ4 A;  3GIJ A;  5KT3 A;  5DG9 A;  4O3R A;  4EBE A;  3H4D A;  3G6X A;  2JEF A;  3MR5 A;  2UVW A;  2OH2 A;  4J9P A;  2AGQ A;  2C2R A;  4EEY A;  5KFZ A;  1RYR A;  5KT7 A;  3BQ2 A;  4J9O A;  3M9O B;  5EWF A;  3SI8 A;  4Q43 A;  5DLG A;  5KFM A;  4J9N A;  2UVV A;  2XGP A;  4ECY A;  1S0O A;  4O3O A;  2J6U A;  3GIM A;  3V6H A;  2DPI A;  4ED2 A;  5KFK A;  3PVX A;  3IN5 A;  2FLL A;  2IA6 A;  4FS1 A;  2JEJ A;  5KG1 A;  3RAQ A;  2XCP A;  5KG5 A;  4IR1 A;  5DG8 A;  4RZR A;  2R8I A;  5L1J A;  5DG7 A;  4YR2 A;  3GIK A;  3GV5 B;  3RB6 A;  3RBE A;  5KFG A;  3RB0 A;  3PW4 A;  1S0M A;  4IR9 A;  3EPI A;  5L1K A;  2AGO A;  5KFH A;  4HYK A;  5DGA A;  4JV2 A;  4QWB A;  4R8U A;  3EPG A;  5KG6 A;  4QW8 A;  2R8J A; 
#chains in the Genus database with same CATH topology
 4M9U A;  4DR2 H;  5KFN A;  4JV5 H;  4LH6 A;  2JA5 A;  3HOU G;  3BJY A;  4MTD A;  2CW7 A;  2FK1 A;  2HVQ A;  4APM A;  4OX9 H;  4WD3 A;  4C5A A;  1ULZ A;  3UQ8 A;  1I50 A;  2Q2T A;  3PW2 A;  2FMA A;  1SFO A;  5EWG A;  3KXY T;  1EHI A;  5A2Q W;  3OUU A;  5KFY A;  4RB1 A;  4RNN A;  4YR0 A;  4J9M A;  5C4X G;  4A3K G;  4QIW E;  4ED8 A;  1N33 H;  4EBC A;  5DQH A;  1B6R A;  4O3N A;  4MV7 A;  5KFJ A;  3GIQ A;  4DL4 A;  2UUC H;  4O4L F;  1GGO A;  1VS0 A;  2R6F A;  5KX5 F;  2CKZ B;  4ZHQ F;  3C0F B;  4NXN H;  3ETH A;  4YQW A;  5L9X A;  2ZJT A;  4B3S H;  5KG7 A;  3TQ1 A;  3N42 B;  2J6S A;  4IZO A;  4QWA A;  3RJ0 A;  2PMZ E;  4QW9 A;  2W57 A;  5L1L A;  4DR1 H;  5BPH A;  4EYI B;  1AUV A;  1UC8 A;  2W7P A;  5KFV A;  2ASJ A;  1TWH A;  2C2E A;  1S97 A;  4FS2 A;  3J80 W;  2V59 A;  2J6T A;  4JI1 H;  2FPP B;  1EZ1 A;  1T94 A;  4O3P A;  3KHH A;  4F4Y A;  4F4X A;  4A3G G;  1Y1V G;  3QFF A;  4XYM B;  2NVY A;  5F9N A;  4CC5 A;  3QZ8 A;  3KHR A;  5KG4 A;  2VA3 A;  5DQI A;  1DV1 A;  4NXM H;  4TV9 F;  1VKZ A;  4LFB H;  3AYH B;  3VPB A;  4C2M A;  4CC6 A;  3WO1 A;  2VQF H;  5C3E G;  3PZP A;  2R7N A;  5KG0 A;  3L2P A;  2V4Q A;  2WYO A;  2W8L A;  1RK5 A;  3R5H A;  1K1S A;  5F9L A;  3GIL A;  1EUC B;  2CW8 A;  4E4T A;  3RTX A;  4UCU A;  2AGP A;  3RB4 A;  4Y8V B;  2FPG B;  4LFA H;  3T5H A;  5I47 A;  4A3J G;  5KKN B;  2R92 G;  4MA5 A;  4X65 H;  3H3V H;  3I4M G;  3BG5 A;  4QWE A;  2W6Q A;  3MFH A;  4B3T H;  2UVU A;  2GPW A;  4UCR A;  4DR3 H;  2Q2U A;  2V9W A;  3NGD A;  1M0W A;  2ASD A;  1JXL A;  2R8K A;  2GLT A;  4IRD A;  3V4Z A;  1V51 A;  4RUC A;  3JSN A;  4QIW A;  5JQW A;  5KFO A;  3T5L A;  4Q44 A;  2HJW A;  3M4I A;  1BNC A;  5FPR A;  3RGZ A;  4EGJ A;  3QZ7 A;  4O4H F;  4DUY H;  4ECS A;  1M0T A;  5KT3 A;  4BY7 G;  4EBE A;  4IHJ F;  3U9T A;  4YY3 H;  2OH2 A;  3GTL A;  4EEY A;  5KFZ A;  2UXC H;  1TWA A;  3RUP A;  5KT7 A;  4XX0 B;  4A3M G;  4DR7 H;  3IG0 A;  5EWF A;  2W6N A;  4AQY H;  4J9N A;  3CVZ A;  2VOB A;  4IAJ A;  2UXB H;  3V6H A;  3HKZ A;  4ED2 A;  2GPS A;  4DV7 H;  3PVX A;  4MTE A;  2YU9 A;  4FS1 A;  5KG1 A;  4EEQ A;  5KG5 A;  5DG7 A;  1S03 G;  1KEE A;  1Y1W A;  3V4S A;  1XNR H;  4C5C A;  2JA6 G;  4IR9 A;  1S0M A;  3EPI A;  5L1K A;  4BY1 G;  1VBG A;  2YZN A;  1GYF A;  3RF2 A;  3J7A K;  1Y14 B;  3TIG A;  4R8U A;  3EPG A;  3T5J A;  2HVS A;  5HBR B;  2JA8 G;  1IBL H;  2ZDQ A;  1DIK A;  4MAM A;  3WNZ A;  2W9C B;  3GID A;  2PBZ A;  3FKI A;  5KFA A;  3OHA A;  3PW7 A;  3PO2 G;  4J9K A;  4J9S A;  4EFB A;  1S10 A;  4LF4 H;  4LH7 A;  4ECZ A;  4ZI7 F;  3GQC A;  3M9N B;  1VAJ A;  1ZET A;  4MV4 A;  1K1Q A;  3PN1 A;  5KFQ A;  5IYZ F;  2VPS A;  4DL5 A;  2BQ3 A;  2R7Z A;  5JUM A;  2I8C A;  4MV1 A;  1E4E B;  3H40 A;  2YRW A;  2XIG A;  4O3Q A;  1SCU B;  1TWG A;  3K5H A;  2ZDH A;  5KT4 A;  4ZQI A;  2E2H A;  1TWC A;  2WE6 A;  3H0G G;  3R5F A;  4JI7 H;  1FJG H;  2OWO A;  2E5L H;  2VPQ A;  3HKZ E;  2DWC A;  1RYS A;  1ZHS A;  3HOV G;  5JVD F;  2Y0S A;  3RV4 A;  4UFZ A;  1RJP A;  4MV8 A;  4RAZ A;  3T1H H;  2R82 A;  3MFI A;  1AUX A;  5DGB A;  4FBU A;  1KJI A;  3PW0 A;  5DLF A;  5HV6 A;  2RDI A;  3RB3 A;  5KFW A;  5FD6 A;  3GIP A;  3V6J A;  4JYA H;  1E4E A;  4A2B A;  1TAE A;  2BQU A;  2P0A A;  2FP4 B;  4DR5 H;  4J9Q A;  4ED0 A;  2XC9 A;  3RBD A;  4DLK A;  4ZOL F;  5FLX W;  3TIN A;  2UVR A;  4LF9 H;  1HNZ H;  2ASL A;  1L2Z A;  4I50 F;  4XYL B;  4MV3 A;  4X64 H;  1VBH A;  1B6S A;  3BAB A;  2R7K A;  4IRK A;  4ED3 A;  1I7L A;  2VR1 A;  4ECR A;  1P8L A;  1C30 A;  5BMV F;  5KFP A;  3N40 P;  3GII A;  2R7M A;  2F4V H;  5KFS A;  2RGV A;  4TQR A;  4ME6 A;  1WH2 A;  3EYY A;  5EWE A;  2RF4 A;  3KHG A;  2NU8 B;  2ALZ A;  4F4W A;  1DGS A;  4UCV A;  4L1K A;  5KFD A;  1HNW H;  1KJ8 A;  1N32 H;  4LF6 H;  2C28 A;  4EG0 A;  5IP7 G;  1JDB B;  5D1O A;  4F4Z A;  2W8K A;  3JRX A;  3PW5 A;  1V9P A;  4JUZ A;  4TQS A;  3Q2O A;  2W9B A;  3JAM W;  5D8D A;  1W93 A;  4XZ3 B;  5FLM G;  2W9B B;  3KAJ A;  4LF7 H;  5KFF A;  2VUM G;  2W9C A;  3E5N A;  3KTM A;  1EUD B;  1M6V A;  4Q8E A;  2I80 A;  4O2A F;  4EBD A;  3R5X A;  3H4B A;  1GLV A;  2W6P A;  4I4T F;  1TA8 A;  5D1P A;  3OHB A;  2I87 A;  1KJQ A;  3K3V A;  2AQ4 A;  5KFU A;  2R92 A;  1KBL A;  4O3R A;  2WAQ E;  4ETS A;  4J0M A;  2JEF A;  1W96 A;  2R93 A;  1I94 H;  3BAA A;  2C2R A;  3HBL A;  1RYR A;  1C3O A;  4J9O A;  1GO3 E;  1XMQ H;  2YYA A;  4MV9 A;  2YRX A;  3TQT A;  5BR8 H;  3M9O B;  3SI8 A;  4YB8 B;  5KFM A;  2UUA H;  1GSH A;  1ZQ7 A;  4ECY A;  4DV6 H;  4O3O A;  2FK2 A;  1A9X A;  1S0O A;  3GIM A;  2UVV A;  4BBS G;  5KFK A;  4A93 G;  1WCM A;  1A0I A;  3IN5 A;  5C1P A;  2XCP A;  4GLX A;  3RBE A;  5L1J A;  3GIK A;  3GV5 B;  5CA1 F;  1V4Y A;  2KSW A;  2AGO A;  2R84 A;  3VPD A;  2FJZ A;  5KFH A;  4A3C G;  5GON F;  4QWB A;  1FKA H;  4A3D G;  2IBK A;  5LL6 b;  2C22 A;  5CB4 F;  4RB2 C;  4BBR G;  5K2M A;  4IWX A;  1O75 A;  2B63 G;  1XNQ H;  3K5I A;  3U9S A;  5KFX A;  3G6V A;  5KT6 A;  4ECT A;  4GKK H;  2NVX A;  2JA5 G;  5C8Y F;  5KFC A;  4JI4 H;  2JA6 A;  4O4I F;  2VQD A;  3ORR A;  1E4G T;  2FB9 A;  5CA0 F;  2ZM6 H;  2HVR A;  3GTQ A;  4C5B A;  1WSC A;  4ED7 A;  3Q8P B;  4Q8F A;  3PO3 G;  3HXL A;  2PMZ A;  3G6Y A;  4ED1 A;  1BGW A;  2YZM A;  3BA9 A;  4YP3 A;  1CE8 A;  4DL6 A;  1N48 A;  2IMW P;  2J9G A;  1SYX B;  2E2I A;  1FVI A;  1JDE A;  4EYH B;  4LMY A;  4TUY F;  4R7R A;  1JIH A;  4QJF A;  3FMA A;  3JZI A;  4RNO A;  4Q0Y A;  1K83 A;  4LSA A;  2XD4 A;  3FDS A;  2BR0 A;  2UUB H;  4DUZ H;  4KHP H;  1Y1V A;  2O03 A;  4RB0 A;  3RGX A;  2YCH A;  3BQ1 A;  1S0N A;  1Z2P X;  3H0G A;  2NUA B;  5IWA H;  2FLN A;  1PK8 A;  5T14 A;  4WBN F;  5IYD G;  4BXX G;  4X62 H;  5KT2 A;  5FJ8 G;  2AU0 A;  1N56 A;  2JA7 G;  3Q8Q B;  1UNN C;  4BWS C;  4QWC A;  4A3E G;  2PN1 A;  4YR3 A;  3MR3 A;  1IOV A;  4RZQ A;  4ECW A;  1SEI A;  4FBT A;  2BQR A;  2CZG A;  5JH7 F;  4GC7 A;  1ZHQ A;  4G3I A;  4B3R H;  2RGR A;  4ECQ A;  3HOW G;  5LOV F;  3OTO H;  5LYJ F;  4IRC A;  1RJR A;  3LP8 A;  3JRW A;  5KG2 A;  4RNM A;  2VUG A;  2DIK A;  2NU7 B;  1J5E H;  1Z2O X;  4O3S A;  3HOX G;  4NLG A;  2WTF A;  1JLL B;  2FPI B;  1Z2N X;  2NU9 B;  3BQ0 A;  2VA2 A;  1N36 H;  1GSA A;  4M7E A;  4K0K H;  4DL3 A;  3LML A;  4PWQ A;  1R9T A;  2UXD H;  2RDJ A;  5KFL A;  3HOY G;  1EYZ A;  4JV0 A;  1HR0 H;  3T5K A;  5KFT A;  3GV8 B;  4A3F G;  2CQY A;  3SE7 A;  1B33 N;  2V4R A;  2YS6 A;  5C5J A;  4U7C A;  2W7O A;  1X9N A;  2R86 A;  5BPF A;  5DG9 A;  3MWD A;  3RFC A;  5IP9 G;  3G6X A;  3JSL A;  3MR5 A;  1N34 H;  4J9P A;  2AGQ A;  2WB1 A;  3T1Y H;  1KJ9 A;  4DV3 H;  3BQ2 A;  2W6M A;  1HNX H;  5FPO A;  2VUM A;  4Q43 A;  4DV4 H;  5IT9 W;  2Y0S E;  3CQZ A;  4UCO A;  2XGP A;  2VQE H;  2J6U A;  2V58 A;  4YBZ B;  1IBM H;  2FLL A;  3L4J A;  2IA6 A;  3RAQ A;  3WO0 A;  2R8I A;  2PVP A;  4MV6 A;  1JX4 A;  3RB0 A;  3PW4 A;  4FM9 A;  4TV8 F;  5DGA A;  3RIZ A;  4JV2 A;  4JI8 H;  4I7H A;  1S68 A;  4U6P A;  2QYZ A;  1I3Q A;  3L4K A;  1E4F T;  1Y1W G;  3GTK A;  4YJ3 F;  5LA6 F;  1IOW A;  2HGS A;  4DV5 H;  4DV0 H;  4MA0 A;  1BJT A;  3V6K A;  5H80 A;  5KFE A;  3N44 B;  1T36 A;  4A2A A;  2W70 A;  4EGQ A;  4JV1 A;  1JKJ B;  3G8C A;  5KG3 A;  3GTG A;  3I12 A;  1KJJ A;  5D1O B;  3FKI G;  5EOY A;  2FKL A;  2C2D A;  1S9F A;  2ZDG A;  3Q8S B;  2JEI A;  2W6Z A;  1GSO A;  4DL2 A;  3HB9 A;  3KAL A;  4J9R A;  4UCS A;  2R7L A;  4ECX A;  4RU9 A;  4LFC H;  3GV7 B;  5L1I A;  2NU6 B;  2X0S A;  4ED6 A;  1CQJ B;  5IYB G;  2DZD A;  4YAK B;  5J2U F;  3MWE A;  3OUZ A;  4EFE A;  3J81 W;  2R8H A;  4Q45 A;  1PX2 A;  1B04 A;  4GC6 A;  1MZB A;  2WDT A;  2W6O A;  2OLS A;  5EDW A;  2V5A A;  1IBK H;  4RUA A;  2YZG A;  2C00 A;  2QK4 A;  4JI5 H;  3MWM A;  2FK3 A;  3K3P A;  3N43 B;  3Q8R B;  4LF5 H;  4YHH H;  3ETJ A;  3RV3 A;  5KT5 A;  2JEG A;  3MJF A;  3OSP A;  2FLP A;  1WR2 A;  3OSN A;  1BXR A;  4AYB E;  4HQ6 A;  1DV2 A;  3MR2 A;  4PDB A;  1OWT A;  4ECU A;  3TII A;  1T3N A;  4UCT A;  1CQI B;  5KFI A;  4LSX A;  4DL7 A;  4DV1 H;  4F50 A;  3PR5 B;  2ATL A;  5FD5 A;  4DV2 H;  4IWY A;  2XCA A;  3PR4 A;  2WAQ A;  2YS7 A;  4R8U B;  1I6U A;  4RB3 C;  1M7J A;  3HOZ G;  2R85 A;  4AYB A;  3ORQ A;  2SCU B;  5DQG A;  2R8G A;  4ECV A;  5EZY F;  3I4N G;  4J9L A;  3N8D A;  5KFR A;  3GLK A;  3GTP A;  4LF8 H;  2JA7 A;  1CS0 A;  2IP4 A;  2MCT A;  4JI2 H;  4B3M H;  2YW2 A;  5C44 G;  3MR6 A;  3RAX A;  4RAY A;  4YJ2 F;  4QWD A;  4HR7 A;  1AN7 A;  2UU9 H;  2XGQ A;  5LMN H;  4A3L G;  2WB1 E;  3R23 A;  2HHH H;  5J2T F;  2W9A A;  3N41 B;  3F8N A;  4A3I G;  3GTM A;  4FU0 A;  4JI3 H;  4I55 F;  2DPJ A;  2M05 A;  2YL2 A;  3KAK A;  5IYC G;  3GTO A;  5JVL A;  3N6X A;  1XDN A;  3M9M B;  3KHL A;  3GTJ A;  4HNU A;  4X66 H;  5KFB A;  3GIJ A;  1RK6 A;  3BA8 A;  3H4D A;  2UVW A;  3VPC A;  2R87 A;  4JI6 H;  5C1O A;  4A3B G;  4DR4 H;  3VMM A;  5DLG A;  5CAE B;  4HNT A;  2DPI A;  2R93 G;  1XMO H;  1I7N A;  1TWF A;  3UFX B;  3H20 A;  1KC7 A;  2C35 B;  2JEJ A;  4JI0 H;  4O2B F;  4DR6 H;  3LWB A;  4IR1 A;  1UC9 A;  5DG8 A;  4YAJ B;  4RZR A;  3RB6 A;  3DF7 A;  4YR2 A;  1RJQ A;  2W71 A;  5KFG A;  5LMU H;  2R7Z G;  2DLN A;  4HNV A;  4GKJ H;  1WCM G;  2XCL A;  2B63 A;  4HYK A;  2FE3 A;  5LXT F;  3Q1K A;  5KG6 A;  4QW8 A;  2R8J A;  5LP6 F; 
#chains in the Genus database with same CATH homology
 4U6P A;  2IBK A;  5KFN A;  2C22 A;  2W9C B;  3BJY A;  5KFA A;  3OHA A;  3PW7 A;  3V6K A;  4J9K A;  4DL7 A;  4J9S A;  5KFE A;  3G6V A;  5KFX A;  1S10 A;  5KT6 A;  4ECT A;  4JV1 A;  4ECZ A;  5KG3 A;  3GQC A;  3M9N B;  3PW2 A;  1ZET A;  1K1Q A;  5KFQ A;  5EWG A;  5KFC A;  4RNN A;  4DL5 A;  5KFY A;  4J9M A;  5JUM A;  4YR0 A;  2C2D A;  1S9F A;  2BQ3 A;  3H40 A;  3Q8S B;  2JEI A;  4ED8 A;  4DL2 A;  4EBC A;  4O3Q A;  5DQH A;  4O3N A;  5KT4 A;  4J9R A;  4ED7 A;  4ECX A;  5KFJ A;  3Q8P B;  4RU9 A;  4Q8F A;  4DL4 A;  4ED1 A;  3G6Y A;  3GV7 B;  4YP3 A;  5L1I A;  4ED6 A;  3T5J A;  4DL6 A;  1N48 A;  2IMW P;  1N56 A;  1RYS A;  4YQW A;  5L9X A;  2R8H A;  5KG7 A;  3TQ1 A;  4Q45 A;  4GC6 A;  2J6S A;  4EYH B;  4QWA A;  3MFI A;  5EDW A;  4RUA A;  4QW9 A;  1JIH A;  5DGB A;  5L1L A;  4FBU A;  3Q8R B;  4RNO A;  3PW0 A;  5DLF A;  5KT5 A;  2BR0 A;  3FDS A;  4EYI B;  2JEG A;  2RDI A;  3OSP A;  3RB3 A;  2FLP A;  5KFW A;  3OSN A;  2W7P A;  5KFV A;  2ASJ A;  3BQ1 A;  1S0N A;  3V6J A;  3MR2 A;  4FS2 A;  2C2E A;  1S97 A;  2FLN A;  2J6T A;  5T14 A;  4ECU A;  1T3N A;  5KFI A;  1T94 A;  4O3P A;  5KT2 A;  3KHH A;  4F4Y A;  4F50 A;  4F4X A;  4J9Q A;  4ED0 A;  3PR5 B;  2AU0 A;  3Q8Q B;  2XC9 A;  3RBD A;  2ATL A;  3QZ8 A;  1UNN C;  5F9N A;  4QWC A;  3KHR A;  5KG4 A;  4YR3 A;  3MR3 A;  5DQI A;  2VA3 A;  4ECW A;  2UVR A;  2XCA A;  2ASL A;  3PR4 A;  4FBT A;  2BQR A;  4IRK A;  4ED3 A;  4GC7 A;  4R8U B;  4G3I A;  4ECR A;  3PZP A;  1JX4 A;  5KFP A;  4ECQ A;  3GII A;  5KG0 A;  5KFS A;  2V4Q A;  4TQR A;  2W8L A;  5F9L A;  1K1S A;  5EWE A;  3KHG A;  5DQG A;  3GIL A;  2R8G A;  4ECV A;  2ALZ A;  4F4W A;  4J9L A;  5KFR A;  5KFD A;  2AGP A;  3RB4 A;  4IRC A;  2C28 A;  3T5H A;  5KG2 A;  4RNM A;  3MR6 A;  3RAX A;  4F4Z A;  3PW5 A;  2W8K A;  4O3S A;  4JUZ A;  4TQS A;  4NLG A;  2WTF A;  2W9B A;  4QWE A;  4QWD A;  3MFH A;  3BQ0 A;  2VA2 A;  2UVU A;  2XGQ A;  4DL3 A;  2W9B B;  2V9W A;  5KFF A;  2W9A A;  2W9C A;  3NGD A;  2ASD A;  4Q8E A;  2RDJ A;  1JXL A;  5KFL A;  2R8K A;  4JV0 A;  3T5K A;  4EBD A;  2DPJ A;  3H4B A;  5KFT A;  3GV8 B;  4IRD A;  4RUC A;  2BQU A;  5KFO A;  3OHB A;  4Q44 A;  3M9M B;  2V4R A;  3KHL A;  4U7C A;  5C5J A;  3T5L A;  2W7O A;  5KFB A;  5KFU A;  3QZ7 A;  4ECS A;  2AQ4 A;  3GIJ A;  5KT3 A;  5DG9 A;  4O3R A;  4EBE A;  3H4D A;  3G6X A;  2JEF A;  3MR5 A;  2UVW A;  2OH2 A;  4J9P A;  2AGQ A;  2C2R A;  4EEY A;  5KFZ A;  1RYR A;  5KT7 A;  3BQ2 A;  4J9O A;  3M9O B;  5EWF A;  3SI8 A;  4Q43 A;  5DLG A;  5KFM A;  4J9N A;  2UVV A;  2XGP A;  4ECY A;  1S0O A;  4O3O A;  2J6U A;  3GIM A;  3V6H A;  2DPI A;  4ED2 A;  5KFK A;  3PVX A;  3IN5 A;  2FLL A;  2IA6 A;  4FS1 A;  2JEJ A;  5KG1 A;  3RAQ A;  2XCP A;  5KG5 A;  4IR1 A;  5DG8 A;  4RZR A;  2R8I A;  5L1J A;  5DG7 A;  4YR2 A;  3GIK A;  3GV5 B;  3RB6 A;  3RBE A;  5KFG A;  3RB0 A;  3PW4 A;  1S0M A;  4IR9 A;  3EPI A;  5L1K A;  2AGO A;  5KFH A;  4HYK A;  5DGA A;  4JV2 A;  4QWB A;  4R8U A;  3EPG A;  5KG6 A;  4QW8 A;  2R8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...