1UNNC

Complex of beta-clamp processivity factor and little finger domain of poliv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
b'HHVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA POLYMERASE III BETA SUBUNIT
publication title Structural Basis for Recruitment of Translesion DNA Polymerase Pol Iv/Dinb to the Beta-Clamp
pubmed doi rcsb
source organism Escherichia coli
molecule tags Beta-clamp
total genus 32
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 1unnC00
5KG1A 3PW5A 4ECVA 5T14A 2AU0A 4ECTA 5L1IA 5KFBA 1S0NA 3OHBA 4ECZA 4ECQA 3G6XA 3OHAA 3KHHA 4R8UB 3PZPA 3GV5B 5KT6A 5KT5A 2W9CA 2AQ4A 5KFMA 2R8KA 4G3IA 5KG2A 3GIJA 2XC9A 3BQ0A 4JV0A 1K1SA 5KG5A 2V4RA 4GC7A 1S9FA 4RNMA 4DL2A 5DG8A 4DL3A 3V6HA 5L1KA 2C28A 5KFNA 4QWAA 2XGQA 4GC6A 5KFFA 3Q8RB 4FS2A 4J9RA 2R8IA 5KFQA 4ECSA 2ASJA 3PVXA 3NGDA 3Q8QB 5KFWA 4EYHB 2ASLA 1JXLA 2ALZA 4F4XA 5C5JA 2UVVA 4ED0A 3G6VA 3H40A 5KFHA 4FS1A 3RAXA 3OSNA 4F4YA 3T5JA 3V6JA 4ECXA 1T94A 2J6SA 2C2EA 3RB3A 5DLFA 5KG6A 2JEIA 2J6TA 4RZRA 2ASDA 4IR1A 1S0MA 4Q8EA 4QWCA 3GIMA 5KT3A 2UVUA 2R8GA 5JUMA 2C2RA 2VA2A 3EPGA 5KFGA 4IRDA 2W8LA 5KFKA 1RYRA 4ED8A 4JV1A 2UVRA 3EPIA 5KFAA 4QWDA 4RNOA 5DGAA 4Q8FA 4RU9A 3OSPA 5DQHA 5KFIA 3QZ7A 4YR2A 5KFVA 5KG7A 4O3RA 3BJYA 3GV8B 3PR5B 4U6PA 3M9OB 3QZ8A 1UNNC 4YQWA 4ED3A 5KFTA 3RB4A 3GQCA 2AGPA 1ZETA 4DL7A 1N48A 2DPIA 2W9BB 2RDIA 5L9XA 2FLPA 5KT7A 3Q8SB 2JEFA 2VA3A 5KG0A 4ED6A 3PR4A 3RBDA 4F50A 4EBCA 1N56A 4NLGA 3G6YA 4QWBA 5F9NA 5DQIA 5L1LA 5KFEA 4J9PA 1S0OA 3T5LA 2IA6A 4R8UA 3RB6A 5KFSA 3MR3A 4J9MA 2IBKA 5KG4A 5KFDA 2V9WA 4YR3A 2J6UA 4Q43A 2W7PA 1K1QA 2RDJA 4J9QA 4DL6A 2R8HA 4DL5A 2DPJA 5KFCA 4RUAA 2JEGA 4ED2A 2ATLA 1S97A 3MFIA 3PW2A 4RUCA 5F9LA 3KHGA 4J9KA 4ECUA 3BQ1A 3GIKA 2W9CB 3MR6A 4Q44A 4JV2A 3T5HA 5KFZA 4ED7A 3GV7B 4QWEA 3M9NB 3MR2A 2R8JA 5DG7A 3M9MB 2XCPA 3MR5A 5EWFA 2AGOA 2OH2A 2C22A 3FDSA 5KFXA 4ECYA 4J9OA 3KHLA 4TQRA 1RYSA 4J9LA 5KFOA 3RAQA 4JUZA 4O3NA 3MFHA 4EYIB 2BQUA 4EBEA 4O3SA 2JEJA 4FBUA 3PW7A 4IR9A 4O3QA 2BQRA 5EWGA 3IN5A 5KT2A 2WTFA 4EBDA 1S10A 2C2DA 4YR0A 3BQ2A 3PW4A 5KFRA 2FLNA 2AGQA 1JIHA 4YP3A 2W8KA 4U7CA 5DQGA 4IRCA 4ED1A 4QW9A 3Q8PB 4J9NA 3H4BA 4QW8A 3KHRA 3GIIA 4F4WA 4ECRA 3RB0A 5EDWA 2FLLA 4O3PA 4F4ZA 4EEYA 2IMWP 4RNNA 3H4DA 2XGPA 4DL4A 4TQSA 4Q45A 2BQ3A 2W9BA 5DGBA 5KFPA 2V4QA 2UVWA 5L1JA 3TQ1A 5KFJA 4J9SA 5DG9A 1T3NA 4ECWA 3SI8A 3V6KA 4O3OA 3GILA 2XCAA 5KFYA 5KG3A 5EWEA 1JX4A 2W7OA 5KFUA 3T5KA 2W9AA 5KFLA 4IRKA 5KT4A 3RBEA 2BR0A 3PW0A 4FBTA 4HYKA 5DLGA
chains in the Genus database with same CATH superfamily
2M05A 3HKZA 5KG1A 5C4XG 5C1OA 3PW5A 4ECVA 3R5HA 5T14A 5IYBG 2AU0A 4ECTA 3RV4A 5L1IA 1XMOH 5KFBA 1JLLB 1Z2OX 2YZNA 4ZOLF 1S0NA 3OHBA 1N36H 2B63G 3KAJA 4XYMB 1UC9A 3TQTA 4ECZA 5CB4F 2W71A 1V9PA 3G6XA 4ECQA 4LFBH 1MZBA 4MV4A 3OHAA 4YJ3F 3KHHA 1WSCA 1Y1WA 3T1YH 4LFAH 4I7HA 4DUZH 4R8UB 4RZQA 5JVLA 4LF6H 5KX5F 4X62H 1WR2A 3PO2G 3KAKA 3PZPA 3GV5B 5KT6A 4PWQA 1IBMH 5KT5A 2W9CA 2AQ4A 5KFMA 4EGQA 1IBKH 2R8KA 4G3IA 2JA8G 3U9SA 4Y8VB 5C1PA 2ZDQA 5KG2A 3GIJA 2XC9A 3BQ0A 1TA8A 1K1SA 4JV0A 4UCUA 5KG5A 4A3MG 4MV3A 3HOVG 4KHPH 4RB3C 2V4RA 3MWDA 2YZGA 4GC7A 1S9FA 1EHIA 4RNMA 4C5BA 4DL2A 4A3FG 1SCUB 5DG8A 2IP4A 4MTEA 5IYCG 4DL3A 1TAEA 3GTGA 3V6HA 2FB9A 2SCUB 5IWAH 2HVRA 2YZMA 2W6OA 4ETSA 5IYDG 5L1KA 2VUMG 4BY1G 4RAZA 2NU8B 4DUYH 2C28A 4LF8H 5KFNA 2GLTA 3FKIG 3CQZA 1Z2NX 4DV0H 2HHHH 1DV1A 2FPGB 1ZQ7A 4QWAA 4EGJA 3BABA 4LH6A 5BMVF 3GTPA 2XGQA 3DF7A 4AYBE 4GKKH 2HVSA 2CKZB 4GC6A 5KFFA 3JRXA 3Q8RB 4FS2A 3KTMA 2PMZA 4J9RA 2R8IA 4MV9A 5KFQA 1EZ1A 4ECSA 2ASJA 3PVXA 2R93G 4E4TA 3NGDA 3Q8QB 4DR7H 4GLXA 4A3JG 2W6QA 5GONF 3GIPA 5KFWA 4UCTA 1BGWA 4I55F 4EYHB 1K83A 4DR3H 3E5NA 3RIZA 2FE3A 5FPRA 5FPOA 2UUAH 2XIGA 4YY3H 2ZJTA 2P0AA 3G8CA 2ASLA 2FPIB 1FKAH 3TIGA 1S03G 4X65H 1CE8A 1JXLA 4NXNH 2DZDA 1BXRA 2ALZA 4L1KA 2JA7G 4A3DG 4F4XA 5C5JA 5JH7F 2UVVA 4NXMH 1EUDB 3K3PA 4IZOA 1HNZH 5LXTF 5FJ8G 3G6VA 4ED0A 3N40P 3HXLA 5FLXW 2CQYA 4LH7A 2VOBA 3H40A 1TWAA 3JZIA 4DLKA 5KFHA 4RB0A 2CZGA 2WAQA 4YJ2F 2GPWA 3VMMA 3J80W 1UC8A 2R82A 4FS1A 3GTLA 4HNTA 3RAXA 3OSNA 4JI5H 1BJTA 4F4YA 5LMNH 4LSXA 4O4HF 4M9UA 1IBLH 3RGZA 3T5JA 4BBRG 1I7NA 2UXDH 3V6JA 5JVDF 4ECXA 1EYZA 1T94A 2J6SA 2C2EA 3RB3A 3JSNA 5D1OA 2YS6A 1E4EA 5DLFA 4QIWA 1KJJA 3PO3G 2X0SA 4MV7A 3GTJA 5C44G 5KG6A 2JEIA 2J6TA 4RZRA 4JYAH 2ASDA 1OWTA 4IR1A 1S0MA 3GTMA 1C3OA 2OWOA 4Q8EA 5CAEB 1TWFA 1A0IA 4QWCA 1I6UA 3K5IA 3GIMA 3LWBA 2WB1A 4UCOA 5I47A 4EG0A 4DR4H 4IWYA 3U9TA 5KT3A 4JV5H 3UFXB 2UVUA 2R8GA 2XD4A 3BG5A 4ZQIA 5JUMA 2C2RA 4HR7A 2VA2A 4O4LF 3RF2A 5D8DA 3EPGA 5KFGA 3MWEA 5C8YF 2FPPB 2KSWA 1SEIA 4IRDA 1RJPA 5J2TF 1B33N 1AUXA 2W8LA 5KFKA 4JI2H 1RYRA 2DIKA 4ED8A 2R86A 3V4ZA 4JV1A 1EUCB 2O03A 2OLSA 4MA0A 5EOYA 2UVRA 3EPIA 4M7EA 5KFAA 4QWDA 3RJ0A 4RNOA 5DGAA 4A3GG 4Q8FA 4RU9A 3OSPA 5DQHA 5KFIA 1S68A 3QZ7A 2Y0SE 4DR1H 4YR2A 4B3SH 3L4JA 4GKJH 2JA5G 3OUZA 5KFVA 2R92A 5KG7A 3WO0A 4EFBA 3C0FB 2CW7A 4HQ6A 3TINA 4O3RA 3BJYA 2R84A 3PR5B 3GV8B 4U6PA 4RB2C 3M9OB 3QZ8A 1E4GT 1IOVA 1UNNC 4YQWA 2PBZA 2FK3A 5KFTA 4ED3A 3RB4A 2B63A 1DIKA 4ZI7F 1KBLA 3GQCA 2AGPA 1ZETA 3HBLA 4DL7A 1N48A 1KJQA 3HKZE 2DPIA 3I4NG 5FD6A 2NUAB 2W9BB 3GTOA 2RDIA 5HBRB 5L9XA 2FLPA 4JI8H 2W70A 4I4TF 1Z2PX 1KJ8A 1JDEA 4Q0YA 1JKJB 5KT7A 2E2IA 3Q8SB 2JEFA 2VA3A 3JAMW 2RF4A 3LP8A 1XNRH 1WCMG 1ULZA 5KG0A 1VKZA 3N42B 4WD3A 2DWCA 2VR1A 1N34H 2R7LA 4TUYF 1M0TA 4CC5A 4ED6A 1FVIA 1Y1VG 2W6ZA 3PR4A 3RBDA 4F50A 4LFCH 4A2BA 1T36A 4I50F 4EBCA 4JI6H 4YAKB 4IAJA 1HR0H 1VBHA 2NU6B 1N56A 5LP6F 4NLGA 4RAYA 2NU7B 4EEQA 2V5AA 1C30A 3G6YA 2W57A 4UFZA 4FM9A 4QWBA 3RTXA 3HOZG 3RUPA 1GO3E 5F9NA 3I4MG 4A3IG 4A3KG 1GGOA 5DQIA 5L1LA 2VUGA 2GPSA 1N33H 2YRWA 1RJQA 1V51A 2VUMA 2R7ZG 5KFEA 4J9PA 2HGSA 1S0OA 3T5LA 5A2QW 4R8UA 3FKIA 3RB6A 2IA6A 4TV9F 3OTOH 2UUBH 2E2HA 3QFFA 3L2PA 1L2ZA 5KFSA 3MR3A 4C5CA 4J9MA 2IBKA 1FJGH 5EZYF 5KG4A 2UUCH 5KFDA 2V9WA 3EYYA 4YR3A 1AN7A 2J6UA 4Q43A 2E5LH 2W7PA 2JA6G 2YCHA 2UXCH 1K1QA 3N43B 4LSAA 2FP4B 4DV4H 2I8CA 3IG0A 5K2MA 2RDJA 4A3LG 4XYLB 4J9QA 5J2UF 2YRXA 3WO1A 1VBGA 3GLKA 4DL6A 2R93A 3TIIA 2R8HA 2PMZE 4DV5H 4DL5A 4YHHH 2DPJA 5KFCA 4RUAA 2Q2TA 3HOWG 5FD5A 4WBNF 5BPFA 2JEGA 1TWCA 4ED2A 3M4IA 2ATLA 1S97A 3MFIA 2WDTA 1RK5A 2W6MA 3PW2A 4RUCA 5CA0F 3ORRA 1R9TA 5F9LA 1TWGA 3KHGA 2R85A 4J0MA 5CA1F 4J9KA 1JDBB 4O2AF 4UCRA 2NVYA 4ECUA 2JA7A 2JA6A 1GSHA 3H3VH 3BQ1A 1E4FT 3GIKA 2R92G 1GYFA 2WE6A 2W9CB 2FKLA 4IHJF 5IP9G 1W93A 2ZDHA 4Q44A 3MR6A 3N41B 4JV2A 5D1PA 3T5HA 3OUUA 1P8LA 5KFZA 4ED7A 2C35B 4QWEA 3GV7B 4PDBA 4IWXA 3M9NB 3MR2A 2R8JA 5DG7A 3M9MB 2XCPA 4BXXG 4K0KH 3ORQA 4HNUA 5LMUH 2PN1A 4LF5H 1BNCA 2NU9B 5LYJF 3MR5A 4YAJB 3ETJA 4AQYH 2C00A 5EWFA 2AGOA 1CQJB 1VAJA 3ETHA 1O75A 2R87A 2I87A 4DV6H 2OH2A 2C22A 1X9NA 4OX9H 5BR8H 4DR5H 3FDSA 5KFXA 2MCTA 4ECYA 4J9OA 4B3MH 2WYOA 2RGVA 2NVXA 4HNVA 4JI1H 2VQDA 1XNQH 1N32H 2HVQA 2DLNA 3VPCA 4QIWE 5H80A 4JI0H 1GSOA 3KHLA 4TQRA 3JSLA 3V4SA 4BWSC 1RYSA 3VPBA 2R7MA 3F8NA 4J9LA 5KFOA 3RAQA 3N44B 3UQ8A 4UCVA 4O3NA 4JUZA 3MFHA 1PX2A 4EYIB 4A2AA 1M0WA 3JRWA 3HOYG 2CW8A 3N8DA 4EFEA 2WB1E 2BQUA 4EBEA 4O3SA 4TV8F 4AYBA 2JEJA 3K3VA 4FBUA 3HOUG 4YBZB 3PW7A 4LF9H 1ZHQA 1I3QA 3N6XA 1KJIA 4JI4H 3H0GG 4IR9A 4MA5A 4O3QA 3J81W 2BQRA 4QJFA 1SYXB 5EWGA 2FK1A 3IN5A 5KT2A 2WTFA 5JQWA 4EBDA 1S10A 2C2DA 1CQIB 4BY7G 4YR0A 4RB1A 3BQ2A 3PW4A 1VS0A 3HB9A 3BAAA 5KFRA 3RGXA 2FLNA 5IT9W 3KXYT 3GTQA 2JA5A 3Q1KA 2AGQA 2W6PA 1JIHA 4YP3A 1KEEA 2W8KA 4CC6A 4O4IF 4LF7H 2VQFH 4U7CA 3T1HH 5KKNB 2V58A 3RV3A 3J7AK 1B04A 5DQGA 3KALA 4IRCA 2FK2A 4ED1A 4QW9A 3Q8PB 1SFOA 4J9NA 3SE7A 3H4BA 4DV2H 4X64H 4YB8B 3R5FA 4QW8A 2YL2A 3H0GA 3KHRA 3GIIA 4DV3H 2R7NA 2QYZA 5D1OB 4DR2H 1E4EB 1WCMA 1B6SA 4A3EG 4F4WA 4ECRA 3RB0A 1Y1VA 5EDWA 3R5XA 2FLLA 3K5HA 3GIDA 2VPQA 2VPSA 1I7LA 1A9XA 4BBSG 3GIQA 3MWMA 4O3PA 5IP7G 1RK6A 4DR6H 2HJWA 4F4ZA 1PK8A 4EEYA 2IMWP 4RNNA 3L4KA 2J9GA 3PN1A 1B6RA 2XGPA 3H4DA 1IOWA 4UCSA 4MAMA 4JI3H 4DL4A 1W96A 4X66H 1J5EH 1V4YA 4TQSA 1M7JA 1KJ9A 1XDNA 2V59A 1Y14B 4Q45A 2BQ3A 1GSAA 2VQEH 2R6FA 2W9BA 5DGBA 2W6NA 1M6VA 5KFPA 4LMYA 2R7ZA 5BPHA 4ZHQF 1HNXH 2ZDGA 2FJZA 2V4QA 2Q2UA 2UVWA 5L1JA 4A3CG 5LOVF 4C5AA 5HV6A 3GTKA 1CS0A 3TQ1A 3BA8A 2UXBH 3FMAA 1DGSA 3LMLA 2PVPA 5KFJA 1I50A 4J9SA 5DG9A 1DV2A 1T3NA 4MV8A 4A3BG 4O2BF 1HNWH 4JI7H 1I94H 1RJRA 3MJFA 5IYZF 2I80A 1ZHSA 5C3EG 4ECWA 3BA9A 3SI8A 3V6KA 3HOXG 4DV7H 5FLMG 4ME6A 3AYHB 4O3OA 3RFCA 5LL6b 3GILA 4B3TH 4MV1A 2XCAA 2RGRA 2XCLA 3R23A 5KFYA 3WNZA 5KG3A 5EWEA 4A93G 1KC7A 1JX4A 4MV6A 1XMQH 1GLVA 2WAQE 4APMA 2W7OA 5KFUA 3T5KA 2W9AA 1WH2A 2UU9H 2YU9A 2YS7A 5KFLA 4IRKA 2Y0SA 1Y1WG 4R7RA 5KT4A 2F4VH 3VPDA 3RBEA 3H20A 2R7KA 2QK4A 5LA6F 3Q2OA 4MTDA 2YYAA 2YW2A 2BR0A 3PW0A 1AUVA 4FU0A 2FMAA 3CVZA 4FBTA 1TWHA 4DV1H 4HYKA 4XZ3B 2ZM6H 5DLGA 3I12A 4C2MA 4XX0B 4LF4H 4B3RH
chains in the Genus database with same CATH topology
5KG1A 3PW5A 4ECVA 5T14A 2AU0A 4ECTA 5L1IA 5KFBA 1S0NA 3OHBA 4ECZA 4ECQA 3G6XA 3OHAA 3KHHA 4R8UB 3PZPA 3GV5B 5KT6A 5KT5A 2W9CA 2AQ4A 5KFMA 2R8KA 4G3IA 5KG2A 3GIJA 2XC9A 3BQ0A 4JV0A 1K1SA 5KG5A 2V4RA 4GC7A 1S9FA 4RNMA 4DL2A 5DG8A 4DL3A 3V6HA 5L1KA 2C28A 5KFNA 4QWAA 2XGQA 4GC6A 5KFFA 3Q8RB 4FS2A 4J9RA 2R8IA 5KFQA 4ECSA 2ASJA 3PVXA 3NGDA 3Q8QB 5KFWA 4EYHB 2ASLA 1JXLA 2ALZA 4F4XA 5C5JA 2UVVA 4ED0A 3G6VA 3H40A 5KFHA 4FS1A 3RAXA 3OSNA 4F4YA 3T5JA 3V6JA 4ECXA 1T94A 2J6SA 2C2EA 3RB3A 5DLFA 5KG6A 2JEIA 2J6TA 4RZRA 2ASDA 4IR1A 1S0MA 4Q8EA 4QWCA 3GIMA 5KT3A 2UVUA 2R8GA 5JUMA 2C2RA 2VA2A 3EPGA 5KFGA 4IRDA 2W8LA 5KFKA 1RYRA 4ED8A 4JV1A 2UVRA 3EPIA 5KFAA 4QWDA 4RNOA 5DGAA 4Q8FA 4RU9A 3OSPA 5DQHA 5KFIA 3QZ7A 4YR2A 5KFVA 5KG7A 4O3RA 3BJYA 3GV8B 3PR5B 4U6PA 3M9OB 3QZ8A 1UNNC 4YQWA 4ED3A 5KFTA 3RB4A 3GQCA 2AGPA 1ZETA 4DL7A 1N48A 2DPIA 2W9BB 2RDIA 5L9XA 2FLPA 5KT7A 3Q8SB 2JEFA 2VA3A 5KG0A 4ED6A 3PR4A 3RBDA 4F50A 4EBCA 1N56A 4NLGA 3G6YA 4QWBA 5F9NA 5DQIA 5L1LA 5KFEA 4J9PA 1S0OA 3T5LA 2IA6A 4R8UA 3RB6A 5KFSA 3MR3A 4J9MA 2IBKA 5KG4A 5KFDA 2V9WA 4YR3A 2J6UA 4Q43A 2W7PA 1K1QA 2RDJA 4J9QA 4DL6A 2R8HA 4DL5A 2DPJA 5KFCA 4RUAA 2JEGA 4ED2A 2ATLA 1S97A 3MFIA 3PW2A 4RUCA 5F9LA 3KHGA 4J9KA 4ECUA 3BQ1A 3GIKA 2W9CB 3MR6A 4Q44A 4JV2A 3T5HA 5KFZA 4ED7A 3GV7B 4QWEA 3M9NB 3MR2A 2R8JA 5DG7A 3M9MB 2XCPA 3MR5A 5EWFA 2AGOA 2OH2A 2C22A 3FDSA 5KFXA 4ECYA 4J9OA 3KHLA 4TQRA 1RYSA 4J9LA 5KFOA 3RAQA 4JUZA 4O3NA 3MFHA 4EYIB 2BQUA 4EBEA 4O3SA 2JEJA 4FBUA 3PW7A 4IR9A 4O3QA 2BQRA 5EWGA 3IN5A 5KT2A 2WTFA 4EBDA 1S10A 2C2DA 4YR0A 3BQ2A 3PW4A 5KFRA 2FLNA 2AGQA 1JIHA 4YP3A 2W8KA 4U7CA 5DQGA 4IRCA 4ED1A 4QW9A 3Q8PB 4J9NA 3H4BA 4QW8A 3KHRA 3GIIA 4F4WA 4ECRA 3RB0A 5EDWA 2FLLA 4O3PA 4F4ZA 4EEYA 2IMWP 4RNNA 3H4DA 2XGPA 4DL4A 4TQSA 4Q45A 2BQ3A 2W9BA 5DGBA 5KFPA 2V4QA 2UVWA 5L1JA 3TQ1A 5KFJA 4J9SA 5DG9A 1T3NA 4ECWA 3SI8A 3V6KA 4O3OA 3GILA 2XCAA 5KFYA 5KG3A 5EWEA 1JX4A 2W7OA 5KFUA 3T5KA 2W9AA 5KFLA 4IRKA 5KT4A 3RBEA 2BR0A 3PW0A 4FBTA 4HYKA 5DLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KG1 A;  3PW5 A;  4ECV A;  5T14 A;  2AU0 A;  4ECT A;  5L1I A;  5KFB A;  1S0N A;  3OHB A;  4ECZ A;  4ECQ A;  3G6X A;  3OHA A;  3KHH A;  4R8U B;  3PZP A;  3GV5 B;  5KT6 A;  5KT5 A;  2W9C A;  2AQ4 A;  5KFM A;  2R8K A;  4G3I A;  5KG2 A;  3GIJ A;  2XC9 A;  3BQ0 A;  4JV0 A;  1K1S A;  5KG5 A;  2V4R A;  4GC7 A;  1S9F A;  4RNM A;  4DL2 A;  5DG8 A;  4DL3 A;  3V6H A;  5L1K A;  2C28 A;  5KFN A;  4QWA A;  2XGQ A;  4GC6 A;  5KFF A;  3Q8R B;  4FS2 A;  4J9R A;  2R8I A;  5KFQ A;  4ECS A;  2ASJ A;  3PVX A;  3NGD A;  3Q8Q B;  5KFW A;  4EYH B;  2ASL A;  1JXL A;  2ALZ A;  4F4X A;  5C5J A;  2UVV A;  4ED0 A;  3G6V A;  3H40 A;  5KFH A;  4FS1 A;  3RAX A;  3OSN A;  4F4Y A;  3T5J A;  3V6J A;  4ECX A;  1T94 A;  2J6S A;  2C2E A;  3RB3 A;  5DLF A;  5KG6 A;  2JEI A;  2J6T A;  4RZR A;  2ASD A;  4IR1 A;  1S0M A;  4Q8E A;  4QWC A;  3GIM A;  5KT3 A;  2UVU A;  2R8G A;  5JUM A;  2C2R A;  2VA2 A;  3EPG A;  5KFG A;  4IRD A;  2W8L A;  5KFK A;  1RYR A;  4ED8 A;  4JV1 A;  2UVR A;  3EPI A;  5KFA A;  4QWD A;  4RNO A;  5DGA A;  4Q8F A;  4RU9 A;  3OSP A;  5DQH A;  5KFI A;  3QZ7 A;  4YR2 A;  5KFV A;  5KG7 A;  4O3R A;  3BJY A;  3GV8 B;  3PR5 B;  4U6P A;  3M9O B;  3QZ8 A;  1UNN C;  4YQW A;  4ED3 A;  5KFT A;  3RB4 A;  3GQC A;  2AGP A;  1ZET A;  4DL7 A;  1N48 A;  2DPI A;  2W9B B;  2RDI A;  5L9X A;  2FLP A;  5KT7 A;  3Q8S B;  2JEF A;  2VA3 A;  5KG0 A;  4ED6 A;  3PR4 A;  3RBD A;  4F50 A;  4EBC A;  1N56 A;  4NLG A;  3G6Y A;  4QWB A;  5F9N A;  5DQI A;  5L1L A;  5KFE A;  4J9P A;  1S0O A;  3T5L A;  2IA6 A;  4R8U A;  3RB6 A;  5KFS A;  3MR3 A;  4J9M A;  2IBK A;  5KG4 A;  5KFD A;  2V9W A;  4YR3 A;  2J6U A;  4Q43 A;  2W7P A;  1K1Q A;  2RDJ A;  4J9Q A;  4DL6 A;  2R8H A;  4DL5 A;  2DPJ A;  5KFC A;  4RUA A;  2JEG A;  4ED2 A;  2ATL A;  1S97 A;  3MFI A;  3PW2 A;  4RUC A;  5F9L A;  3KHG A;  4J9K A;  4ECU A;  3BQ1 A;  3GIK A;  2W9C B;  3MR6 A;  4Q44 A;  4JV2 A;  3T5H A;  5KFZ A;  4ED7 A;  3GV7 B;  4QWE A;  3M9N B;  3MR2 A;  2R8J A;  5DG7 A;  3M9M B;  2XCP A;  3MR5 A;  5EWF A;  2AGO A;  2OH2 A;  2C22 A;  3FDS A;  5KFX A;  4ECY A;  4J9O A;  3KHL A;  4TQR A;  1RYS A;  4J9L A;  5KFO A;  3RAQ A;  4JUZ A;  4O3N A;  3MFH A;  4EYI B;  2BQU A;  4EBE A;  4O3S A;  2JEJ A;  4FBU A;  3PW7 A;  4IR9 A;  4O3Q A;  2BQR A;  5EWG A;  3IN5 A;  5KT2 A;  2WTF A;  4EBD A;  1S10 A;  2C2D A;  4YR0 A;  3BQ2 A;  3PW4 A;  5KFR A;  2FLN A;  2AGQ A;  1JIH A;  4YP3 A;  2W8K A;  4U7C A;  5DQG A;  4IRC A;  4ED1 A;  4QW9 A;  3Q8P B;  4J9N A;  3H4B A;  4QW8 A;  3KHR A;  3GII A;  4F4W A;  4ECR A;  3RB0 A;  5EDW A;  2FLL A;  4O3P A;  4F4Z A;  4EEY A;  2IMW P;  4RNN A;  3H4D A;  2XGP A;  4DL4 A;  4TQS A;  4Q45 A;  2BQ3 A;  2W9B A;  5DGB A;  5KFP A;  2V4Q A;  2UVW A;  5L1J A;  3TQ1 A;  5KFJ A;  4J9S A;  5DG9 A;  1T3N A;  4ECW A;  3SI8 A;  3V6K A;  4O3O A;  3GIL A;  2XCA A;  5KFY A;  5KG3 A;  5EWE A;  1JX4 A;  2W7O A;  5KFU A;  3T5K A;  2W9A A;  5KFL A;  4IRK A;  5KT4 A;  3RBE A;  2BR0 A;  3PW0 A;  4FBT A;  4HYK A;  5DLG A; 
#chains in the Genus database with same CATH topology
 2M05 A;  3HKZ A;  5KG1 A;  5C4X G;  5C1O A;  3PW5 A;  4ECV A;  3R5H A;  5T14 A;  5IYB G;  2AU0 A;  4ECT A;  3RV4 A;  5L1I A;  1XMO H;  5KFB A;  1JLL B;  1Z2O X;  2YZN A;  4ZOL F;  1S0N A;  3OHB A;  1N36 H;  2B63 G;  3KAJ A;  4XYM B;  1UC9 A;  3TQT A;  4ECZ A;  5CB4 F;  2W71 A;  1V9P A;  3G6X A;  4ECQ A;  4LFB H;  1MZB A;  4MV4 A;  3OHA A;  4YJ3 F;  3KHH A;  1WSC A;  1Y1W A;  3T1Y H;  4LFA H;  4I7H A;  4DUZ H;  4R8U B;  4RZQ A;  5JVL A;  4LF6 H;  5KX5 F;  4X62 H;  1WR2 A;  3PO2 G;  3KAK A;  3PZP A;  3GV5 B;  5KT6 A;  4PWQ A;  1IBM H;  5KT5 A;  2W9C A;  2AQ4 A;  5KFM A;  4EGQ A;  1IBK H;  2R8K A;  4G3I A;  2JA8 G;  3U9S A;  4Y8V B;  5C1P A;  2ZDQ A;  5KG2 A;  3GIJ A;  2XC9 A;  3BQ0 A;  1TA8 A;  1K1S A;  4JV0 A;  4UCU A;  5KG5 A;  4A3M G;  4MV3 A;  3HOV G;  4KHP H;  4RB3 C;  2V4R A;  3MWD A;  2YZG A;  4GC7 A;  1S9F A;  1EHI A;  4RNM A;  4C5B A;  4DL2 A;  4A3F G;  1SCU B;  5DG8 A;  2IP4 A;  4MTE A;  5IYC G;  4DL3 A;  1TAE A;  3GTG A;  3V6H A;  2FB9 A;  2SCU B;  5IWA H;  2HVR A;  2YZM A;  2W6O A;  4ETS A;  5IYD G;  5L1K A;  2VUM G;  4BY1 G;  4RAZ A;  2NU8 B;  4DUY H;  2C28 A;  4LF8 H;  5KFN A;  2GLT A;  3FKI G;  3CQZ A;  1Z2N X;  4DV0 H;  2HHH H;  1DV1 A;  2FPG B;  1ZQ7 A;  4QWA A;  4EGJ A;  3BAB A;  4LH6 A;  5BMV F;  3GTP A;  2XGQ A;  3DF7 A;  4AYB E;  4GKK H;  2HVS A;  2CKZ B;  4GC6 A;  5KFF A;  3JRX A;  3Q8R B;  4FS2 A;  3KTM A;  2PMZ A;  4J9R A;  2R8I A;  4MV9 A;  5KFQ A;  1EZ1 A;  4ECS A;  2ASJ A;  3PVX A;  2R93 G;  4E4T A;  3NGD A;  3Q8Q B;  4DR7 H;  4GLX A;  4A3J G;  2W6Q A;  5GON F;  3GIP A;  5KFW A;  4UCT A;  1BGW A;  4I55 F;  4EYH B;  1K83 A;  4DR3 H;  3E5N A;  3RIZ A;  2FE3 A;  5FPR A;  5FPO A;  2UUA H;  2XIG A;  4YY3 H;  2ZJT A;  2P0A A;  3G8C A;  2ASL A;  2FPI B;  1FKA H;  3TIG A;  1S03 G;  4X65 H;  1CE8 A;  1JXL A;  4NXN H;  2DZD A;  1BXR A;  2ALZ A;  4L1K A;  2JA7 G;  4A3D G;  4F4X A;  5C5J A;  5JH7 F;  2UVV A;  4NXM H;  1EUD B;  3K3P A;  4IZO A;  1HNZ H;  5LXT F;  5FJ8 G;  3G6V A;  4ED0 A;  3N40 P;  3HXL A;  5FLX W;  2CQY A;  4LH7 A;  2VOB A;  3H40 A;  1TWA A;  3JZI A;  4DLK A;  5KFH A;  4RB0 A;  2CZG A;  2WAQ A;  4YJ2 F;  2GPW A;  3VMM A;  3J80 W;  1UC8 A;  2R82 A;  4FS1 A;  3GTL A;  4HNT A;  3RAX A;  3OSN A;  4JI5 H;  1BJT A;  4F4Y A;  5LMN H;  4LSX A;  4O4H F;  4M9U A;  1IBL H;  3RGZ A;  3T5J A;  4BBR G;  1I7N A;  2UXD H;  3V6J A;  5JVD F;  4ECX A;  1EYZ A;  1T94 A;  2J6S A;  2C2E A;  3RB3 A;  3JSN A;  5D1O A;  2YS6 A;  1E4E A;  5DLF A;  4QIW A;  1KJJ A;  3PO3 G;  2X0S A;  4MV7 A;  3GTJ A;  5C44 G;  5KG6 A;  2JEI A;  2J6T A;  4RZR A;  4JYA H;  2ASD A;  1OWT A;  4IR1 A;  1S0M A;  3GTM A;  1C3O A;  2OWO A;  4Q8E A;  5CAE B;  1TWF A;  1A0I A;  4QWC A;  1I6U A;  3K5I A;  3GIM A;  3LWB A;  2WB1 A;  4UCO A;  5I47 A;  4EG0 A;  4DR4 H;  4IWY A;  3U9T A;  5KT3 A;  4JV5 H;  3UFX B;  2UVU A;  2R8G A;  2XD4 A;  3BG5 A;  4ZQI A;  5JUM A;  2C2R A;  4HR7 A;  2VA2 A;  4O4L F;  3RF2 A;  5D8D A;  3EPG A;  5KFG A;  3MWE A;  5C8Y F;  2FPP B;  2KSW A;  1SEI A;  4IRD A;  1RJP A;  5J2T F;  1B33 N;  1AUX A;  2W8L A;  5KFK A;  4JI2 H;  1RYR A;  2DIK A;  4ED8 A;  2R86 A;  3V4Z A;  4JV1 A;  1EUC B;  2O03 A;  2OLS A;  4MA0 A;  5EOY A;  2UVR A;  3EPI A;  4M7E A;  5KFA A;  4QWD A;  3RJ0 A;  4RNO A;  5DGA A;  4A3G G;  4Q8F A;  4RU9 A;  3OSP A;  5DQH A;  5KFI A;  1S68 A;  3QZ7 A;  2Y0S E;  4DR1 H;  4YR2 A;  4B3S H;  3L4J A;  4GKJ H;  2JA5 G;  3OUZ A;  5KFV A;  2R92 A;  5KG7 A;  3WO0 A;  4EFB A;  3C0F B;  2CW7 A;  4HQ6 A;  3TIN A;  4O3R A;  3BJY A;  2R84 A;  3PR5 B;  3GV8 B;  4U6P A;  4RB2 C;  3M9O B;  3QZ8 A;  1E4G T;  1IOV A;  1UNN C;  4YQW A;  2PBZ A;  2FK3 A;  5KFT A;  4ED3 A;  3RB4 A;  2B63 A;  1DIK A;  4ZI7 F;  1KBL A;  3GQC A;  2AGP A;  1ZET A;  3HBL A;  4DL7 A;  1N48 A;  1KJQ A;  3HKZ E;  2DPI A;  3I4N G;  5FD6 A;  2NUA B;  2W9B B;  3GTO A;  2RDI A;  5HBR B;  5L9X A;  2FLP A;  4JI8 H;  2W70 A;  4I4T F;  1Z2P X;  1KJ8 A;  1JDE A;  4Q0Y A;  1JKJ B;  5KT7 A;  2E2I A;  3Q8S B;  2JEF A;  2VA3 A;  3JAM W;  2RF4 A;  3LP8 A;  1XNR H;  1WCM G;  1ULZ A;  5KG0 A;  1VKZ A;  3N42 B;  4WD3 A;  2DWC A;  2VR1 A;  1N34 H;  2R7L A;  4TUY F;  1M0T A;  4CC5 A;  4ED6 A;  1FVI A;  1Y1V G;  2W6Z A;  3PR4 A;  3RBD A;  4F50 A;  4LFC H;  4A2B A;  1T36 A;  4I50 F;  4EBC A;  4JI6 H;  4YAK B;  4IAJ A;  1HR0 H;  1VBH A;  2NU6 B;  1N56 A;  5LP6 F;  4NLG A;  4RAY A;  2NU7 B;  4EEQ A;  2V5A A;  1C30 A;  3G6Y A;  2W57 A;  4UFZ A;  4FM9 A;  4QWB A;  3RTX A;  3HOZ G;  3RUP A;  1GO3 E;  5F9N A;  3I4M G;  4A3I G;  4A3K G;  1GGO A;  5DQI A;  5L1L A;  2VUG A;  2GPS A;  1N33 H;  2YRW A;  1RJQ A;  1V51 A;  2VUM A;  2R7Z G;  5KFE A;  4J9P A;  2HGS A;  1S0O A;  3T5L A;  5A2Q W;  4R8U A;  3FKI A;  3RB6 A;  2IA6 A;  4TV9 F;  3OTO H;  2UUB H;  2E2H A;  3QFF A;  3L2P A;  1L2Z A;  5KFS A;  3MR3 A;  4C5C A;  4J9M A;  2IBK A;  1FJG H;  5EZY F;  5KG4 A;  2UUC H;  5KFD A;  2V9W A;  3EYY A;  4YR3 A;  1AN7 A;  2J6U A;  4Q43 A;  2E5L H;  2W7P A;  2JA6 G;  2YCH A;  2UXC H;  1K1Q A;  3N43 B;  4LSA A;  2FP4 B;  4DV4 H;  2I8C A;  3IG0 A;  5K2M A;  2RDJ A;  4A3L G;  4XYL B;  4J9Q A;  5J2U F;  2YRX A;  3WO1 A;  1VBG A;  3GLK A;  4DL6 A;  2R93 A;  3TII A;  2R8H A;  2PMZ E;  4DV5 H;  4DL5 A;  4YHH H;  2DPJ A;  5KFC A;  4RUA A;  2Q2T A;  3HOW G;  5FD5 A;  4WBN F;  5BPF A;  2JEG A;  1TWC A;  4ED2 A;  3M4I A;  2ATL A;  1S97 A;  3MFI A;  2WDT A;  1RK5 A;  2W6M A;  3PW2 A;  4RUC A;  5CA0 F;  3ORR A;  1R9T A;  5F9L A;  1TWG A;  3KHG A;  2R85 A;  4J0M A;  5CA1 F;  4J9K A;  1JDB B;  4O2A F;  4UCR A;  2NVY A;  4ECU A;  2JA7 A;  2JA6 A;  1GSH A;  3H3V H;  3BQ1 A;  1E4F T;  3GIK A;  2R92 G;  1GYF A;  2WE6 A;  2W9C B;  2FKL A;  4IHJ F;  5IP9 G;  1W93 A;  2ZDH A;  4Q44 A;  3MR6 A;  3N41 B;  4JV2 A;  5D1P A;  3T5H A;  3OUU A;  1P8L A;  5KFZ A;  4ED7 A;  2C35 B;  4QWE A;  3GV7 B;  4PDB A;  4IWX A;  3M9N B;  3MR2 A;  2R8J A;  5DG7 A;  3M9M B;  2XCP A;  4BXX G;  4K0K H;  3ORQ A;  4HNU A;  5LMU H;  2PN1 A;  4LF5 H;  1BNC A;  2NU9 B;  5LYJ F;  3MR5 A;  4YAJ B;  3ETJ A;  4AQY H;  2C00 A;  5EWF A;  2AGO A;  1CQJ B;  1VAJ A;  3ETH A;  1O75 A;  2R87 A;  2I87 A;  4DV6 H;  2OH2 A;  2C22 A;  1X9N A;  4OX9 H;  5BR8 H;  4DR5 H;  3FDS A;  5KFX A;  2MCT A;  4ECY A;  4J9O A;  4B3M H;  2WYO A;  2RGV A;  2NVX A;  4HNV A;  4JI1 H;  2VQD A;  1XNQ H;  1N32 H;  2HVQ A;  2DLN A;  3VPC A;  4QIW E;  5H80 A;  4JI0 H;  1GSO A;  3KHL A;  4TQR A;  3JSL A;  3V4S A;  4BWS C;  1RYS A;  3VPB A;  2R7M A;  3F8N A;  4J9L A;  5KFO A;  3RAQ A;  3N44 B;  3UQ8 A;  4UCV A;  4O3N A;  4JUZ A;  3MFH A;  1PX2 A;  4EYI B;  4A2A A;  1M0W A;  3JRW A;  3HOY G;  2CW8 A;  3N8D A;  4EFE A;  2WB1 E;  2BQU A;  4EBE A;  4O3S A;  4TV8 F;  4AYB A;  2JEJ A;  3K3V A;  4FBU A;  3HOU G;  4YBZ B;  3PW7 A;  4LF9 H;  1ZHQ A;  1I3Q A;  3N6X A;  1KJI A;  4JI4 H;  3H0G G;  4IR9 A;  4MA5 A;  4O3Q A;  3J81 W;  2BQR A;  4QJF A;  1SYX B;  5EWG A;  2FK1 A;  3IN5 A;  5KT2 A;  2WTF A;  5JQW A;  4EBD A;  1S10 A;  2C2D A;  1CQI B;  4BY7 G;  4YR0 A;  4RB1 A;  3BQ2 A;  3PW4 A;  1VS0 A;  3HB9 A;  3BAA A;  5KFR A;  3RGX A;  2FLN A;  5IT9 W;  3KXY T;  3GTQ A;  2JA5 A;  3Q1K A;  2AGQ A;  2W6P A;  1JIH A;  4YP3 A;  1KEE A;  2W8K A;  4CC6 A;  4O4I F;  4LF7 H;  2VQF H;  4U7C A;  3T1H H;  5KKN B;  2V58 A;  3RV3 A;  3J7A K;  1B04 A;  5DQG A;  3KAL A;  4IRC A;  2FK2 A;  4ED1 A;  4QW9 A;  3Q8P B;  1SFO A;  4J9N A;  3SE7 A;  3H4B A;  4DV2 H;  4X64 H;  4YB8 B;  3R5F A;  4QW8 A;  2YL2 A;  3H0G A;  3KHR A;  3GII A;  4DV3 H;  2R7N A;  2QYZ A;  5D1O B;  4DR2 H;  1E4E B;  1WCM A;  1B6S A;  4A3E G;  4F4W A;  4ECR A;  3RB0 A;  1Y1V A;  5EDW A;  3R5X A;  2FLL A;  3K5H A;  3GID A;  2VPQ A;  2VPS A;  1I7L A;  1A9X A;  4BBS G;  3GIQ A;  3MWM A;  4O3P A;  5IP7 G;  1RK6 A;  4DR6 H;  2HJW A;  4F4Z A;  1PK8 A;  4EEY A;  2IMW P;  4RNN A;  3L4K A;  2J9G A;  3PN1 A;  1B6R A;  2XGP A;  3H4D A;  1IOW A;  4UCS A;  4MAM A;  4JI3 H;  4DL4 A;  1W96 A;  4X66 H;  1J5E H;  1V4Y A;  4TQS A;  1M7J A;  1KJ9 A;  1XDN A;  2V59 A;  1Y14 B;  4Q45 A;  2BQ3 A;  1GSA A;  2VQE H;  2R6F A;  2W9B A;  5DGB A;  2W6N A;  1M6V A;  5KFP A;  4LMY A;  2R7Z A;  5BPH A;  4ZHQ F;  1HNX H;  2ZDG A;  2FJZ A;  2V4Q A;  2Q2U A;  2UVW A;  5L1J A;  4A3C G;  5LOV F;  4C5A A;  5HV6 A;  3GTK A;  1CS0 A;  3TQ1 A;  3BA8 A;  2UXB H;  3FMA A;  1DGS A;  3LML A;  2PVP A;  5KFJ A;  1I50 A;  4J9S A;  5DG9 A;  1DV2 A;  1T3N A;  4MV8 A;  4A3B G;  4O2B F;  1HNW H;  4JI7 H;  1I94 H;  1RJR A;  3MJF A;  5IYZ F;  2I80 A;  1ZHS A;  5C3E G;  4ECW A;  3BA9 A;  3SI8 A;  3V6K A;  3HOX G;  4DV7 H;  5FLM G;  4ME6 A;  3AYH B;  4O3O A;  3RFC A;  5LL6 b;  3GIL A;  4B3T H;  4MV1 A;  2XCA A;  2RGR A;  2XCL A;  3R23 A;  5KFY A;  3WNZ A;  5KG3 A;  5EWE A;  4A93 G;  1KC7 A;  1JX4 A;  4MV6 A;  1XMQ H;  1GLV A;  2WAQ E;  4APM A;  2W7O A;  5KFU A;  3T5K A;  2W9A A;  1WH2 A;  2UU9 H;  2YU9 A;  2YS7 A;  5KFL A;  4IRK A;  2Y0S A;  1Y1W G;  4R7R A;  5KT4 A;  2F4V H;  3VPD A;  3RBE A;  3H20 A;  2R7K A;  2QK4 A;  5LA6 F;  3Q2O A;  4MTD A;  2YYA A;  2YW2 A;  2BR0 A;  3PW0 A;  1AUV A;  4FU0 A;  2FMA A;  3CVZ A;  4FBT A;  1TWH A;  4DV1 H;  4HYK A;  4XZ3 B;  2ZM6 H;  5DLG A;  3I12 A;  4C2M A;  4XX0 B;  4LF4 H;  4B3R H; 
#chains in the Genus database with same CATH homology
 5KG1 A;  3PW5 A;  4ECV A;  5T14 A;  2AU0 A;  4ECT A;  5L1I A;  5KFB A;  1S0N A;  3OHB A;  4ECZ A;  4ECQ A;  3G6X A;  3OHA A;  3KHH A;  4R8U B;  3PZP A;  3GV5 B;  5KT6 A;  5KT5 A;  2W9C A;  2AQ4 A;  5KFM A;  2R8K A;  4G3I A;  5KG2 A;  3GIJ A;  2XC9 A;  3BQ0 A;  4JV0 A;  1K1S A;  5KG5 A;  2V4R A;  4GC7 A;  1S9F A;  4RNM A;  4DL2 A;  5DG8 A;  4DL3 A;  3V6H A;  5L1K A;  2C28 A;  5KFN A;  4QWA A;  2XGQ A;  4GC6 A;  5KFF A;  3Q8R B;  4FS2 A;  4J9R A;  2R8I A;  5KFQ A;  4ECS A;  2ASJ A;  3PVX A;  3NGD A;  3Q8Q B;  5KFW A;  4EYH B;  2ASL A;  1JXL A;  2ALZ A;  4F4X A;  5C5J A;  2UVV A;  4ED0 A;  3G6V A;  3H40 A;  5KFH A;  4FS1 A;  3RAX A;  3OSN A;  4F4Y A;  3T5J A;  3V6J A;  4ECX A;  1T94 A;  2J6S A;  2C2E A;  3RB3 A;  5DLF A;  5KG6 A;  2JEI A;  2J6T A;  4RZR A;  2ASD A;  4IR1 A;  1S0M A;  4Q8E A;  4QWC A;  3GIM A;  5KT3 A;  2UVU A;  2R8G A;  5JUM A;  2C2R A;  2VA2 A;  3EPG A;  5KFG A;  4IRD A;  2W8L A;  5KFK A;  1RYR A;  4ED8 A;  4JV1 A;  2UVR A;  3EPI A;  5KFA A;  4QWD A;  4RNO A;  5DGA A;  4Q8F A;  4RU9 A;  3OSP A;  5DQH A;  5KFI A;  3QZ7 A;  4YR2 A;  5KFV A;  5KG7 A;  4O3R A;  3BJY A;  3GV8 B;  3PR5 B;  4U6P A;  3M9O B;  3QZ8 A;  1UNN C;  4YQW A;  4ED3 A;  5KFT A;  3RB4 A;  3GQC A;  2AGP A;  1ZET A;  4DL7 A;  1N48 A;  2DPI A;  2W9B B;  2RDI A;  5L9X A;  2FLP A;  5KT7 A;  3Q8S B;  2JEF A;  2VA3 A;  5KG0 A;  4ED6 A;  3PR4 A;  3RBD A;  4F50 A;  4EBC A;  1N56 A;  4NLG A;  3G6Y A;  4QWB A;  5F9N A;  5DQI A;  5L1L A;  5KFE A;  4J9P A;  1S0O A;  3T5L A;  2IA6 A;  4R8U A;  3RB6 A;  5KFS A;  3MR3 A;  4J9M A;  2IBK A;  5KG4 A;  5KFD A;  2V9W A;  4YR3 A;  2J6U A;  4Q43 A;  2W7P A;  1K1Q A;  2RDJ A;  4J9Q A;  4DL6 A;  2R8H A;  4DL5 A;  2DPJ A;  5KFC A;  4RUA A;  2JEG A;  4ED2 A;  2ATL A;  1S97 A;  3MFI A;  3PW2 A;  4RUC A;  5F9L A;  3KHG A;  4J9K A;  4ECU A;  3BQ1 A;  3GIK A;  2W9C B;  3MR6 A;  4Q44 A;  4JV2 A;  3T5H A;  5KFZ A;  4ED7 A;  3GV7 B;  4QWE A;  3M9N B;  3MR2 A;  2R8J A;  5DG7 A;  3M9M B;  2XCP A;  3MR5 A;  5EWF A;  2AGO A;  2OH2 A;  2C22 A;  3FDS A;  5KFX A;  4ECY A;  4J9O A;  3KHL A;  4TQR A;  1RYS A;  4J9L A;  5KFO A;  3RAQ A;  4JUZ A;  4O3N A;  3MFH A;  4EYI B;  2BQU A;  4EBE A;  4O3S A;  2JEJ A;  4FBU A;  3PW7 A;  4IR9 A;  4O3Q A;  2BQR A;  5EWG A;  3IN5 A;  5KT2 A;  2WTF A;  4EBD A;  1S10 A;  2C2D A;  4YR0 A;  3BQ2 A;  3PW4 A;  5KFR A;  2FLN A;  2AGQ A;  1JIH A;  4YP3 A;  2W8K A;  4U7C A;  5DQG A;  4IRC A;  4ED1 A;  4QW9 A;  3Q8P B;  4J9N A;  3H4B A;  4QW8 A;  3KHR A;  3GII A;  4F4W A;  4ECR A;  3RB0 A;  5EDW A;  2FLL A;  4O3P A;  4F4Z A;  4EEY A;  2IMW P;  4RNN A;  3H4D A;  2XGP A;  4DL4 A;  4TQS A;  4Q45 A;  2BQ3 A;  2W9B A;  5DGB A;  5KFP A;  2V4Q A;  2UVW A;  5L1J A;  3TQ1 A;  5KFJ A;  4J9S A;  5DG9 A;  1T3N A;  4ECW A;  3SI8 A;  3V6K A;  4O3O A;  3GIL A;  2XCA A;  5KFY A;  5KG3 A;  5EWE A;  1JX4 A;  2W7O A;  5KFU A;  3T5K A;  2W9A A;  5KFL A;  4IRK A;  5KT4 A;  3RBE A;  2BR0 A;  3PW0 A;  4FBT A;  4HYK A;  5DLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...