3MWMA

Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
GRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal uptake regulation protein
publication title Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 42
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mwmA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3mwmA02
2P5VA 2FMYA 2VE9A 5ICGA 1RI7A 5H6RA 4P9FA 4TV7A 1T6SA 5CJ9A 2GA1A 3FF5A 3GLXA 1LQ1A 2RKHA 2UXXA 4UXNA 3RYPA 2CYYA 1YW8A 2GXGA 2JTVA 1ZRCA 1IN6A 1B1BA 1U3EM 4JQFA 1SD6A 1BI1A 5K5RA 4G9YA 2YX4A 3DQVC 1D3YA 4A5NA 1T2KA 1XGSA 3T8TA 4AD9A 1TLHB 2H94A 2RN7A 4R79A 1SAXA 2L4MA 3QPHA 2F5CA 2K86A 4PCQA 4U0VA 5TRDA 3M7GA 4KIBA 1YS7A 2W57A 1UHMA 3CDHA 1BM9A 1DPRA 3F6OA 1ZG5A 1TQIA 4OOIA 2PLYA 4EJUA 2XKPA 3I0TA 2M5WA 1UHWA 4BAYA 5IT9K 4HYEA 4U0WA 1I1GA 1I6XA 1I27A 3PFIA 3VOEA 1QO0D 4YG2F 1W4MA 1HW2A 4WX9A 2K4JA 4LK0F 5DYMA 4G6QA 1P92A 2QYOA 2A6HF 5AIPA 5JVTA 1SMYF 2OBPA 2EV6A 5D6EA 3EYYA 3LA3A 2QBYA 5DCMB 3IRQA 3ZMZA 1YLFA 3MCZA 3NRVA 5ERIA 1WKMA 1Z6RA 1FC3A 2XRNA 3V7SA 1XN7A 3KETA 1LDKB 4CYDA 4M71A 4KIGA 5HDKA 3R0JA 4N9HA 1HBXG 4HAMA 4HV6A 2H09A 1FPQA 1HW1A 5JHUA 1R1TA 4HZFA 1JE8A 1ON2A 4L5JA 1PUEE 2BV6A 3M8FA 4UHTA 3LA7A 5EEGA 2IP2A 4HOBA 3P9IA 5L3FA 3EYIA 2O3FA 3KP5A 4HQMA 1XDSA 1KU3A 2FA5A 3TDZC 4N9IA 1J9IA 5HS8A 3C1DA 1IXRC 4RGUA 3WGGA 3F8CA 1JHHA 1FBSA 3HRTA 2STTA 1IRGA 2PN6A 4IF4A 3FMSA 3U1DA 2NNYA 1FYMA 4HBLA 2L02A 1U5TA 3ZMUA 1C0WA 3KP2A 4ETSA 1BI3A 1OPCA 1YW7A 1I1SA 2IA1A 3E5XA 2VBXA 5CVIA 2NS0A 4RB3C 3VEPA 1XCVA 5HDGA 5HLHA 4I2OA 4I98B 2M45A 1R1UA 1O3QA 4ZYEA 1SFXA 3ZPLA 3H3ZA 3I5UA 3BROA 4BXUA 3N4MA 4OU0A 4RB1A 4ZYHA 3IKTA 5F64A 3I54A 1QZYA 4M6XA 4S05A 3WTXC 1BIAA 5D8LB 5FO5A 5J8CA 2A6EF 2HS5A 5L3DA 4Q47A 4KA4A 2CQKA 2VT2A 4A0ZA 3MQ0A 2ZXJA 4EJWA 5L3BA 2HQRA 3R6SA 3DPLC 5E1XA 3GFLA 2RNJA 3HYIA 2KRFA 4D0PA 2IRFG 1F1ZA 2VC0A 4A5MA 4MTEA 2ZNYA 1S7AA 1S3JA 1Z05A 4AWXB 4G7OF 2IW5A 5F1RA 2IA0A 1ZH5A 3BOQA 3WGHA 4HDUA 1XB4A 4ZH4F 1W7PA 4GO1A 2NAZA 3HSEA 3JAMK 4ON0A 2BE5F 3W6JB 3KZYA 1YW9A 2K7LA 3E5UA 1HKQA 4MEXF 1LVAA 1ZAOA 2XHKA 3V8KA 1LEBA 1RZ4A 3REOA 5LRSA 3FMQA 4I09A 3QU6A 3S2WA 3LQRA 1VTNC 1ZG1A 4L18B 2W24A 3ABTA 2K4BA 1IUYA 3J81Z 3E5QA 3MEXA 3B02A 1G4DA 4BYYA 4ZZDA 1Z1DA 2XVCA 5AIQA 2O61A 4RB2C 4Y15A 2XV4S 1H0MA 4A0YA 3G73A 1G3TA 1ZHFA 4LB6B 5D8KB 1R7JA 2LF8A 2FF4A 4M9XA 2KJCA 4WXHA 1XSDA 4PZJA 5CVRA 4HF0A 2DT5A 3J7AO 2F2EA 5JR3A 2MC3A 2PFBA 2XAQA 2O0YA 2EFNA 2PMUA 1PDNC 2OQGA 2EFQA 2QQBA 1IXSB 4P9UA 5ED4A 3TO7A 4EGZA 1MZBA 2PG4A 4GYGA 3MWMA 3ELKA 3K0LA 1XGMA 5ICCA 2ACJA 3MAJA 1D5VA 1ONVA 4NB5A 4EVIA 1OYYA 4MEYF 2HGCA 5FGMA 2RV8A 1BI0A 2A07F 1TW3A 4M9SA 1V4RA 3CO6C 3KP7A 1B4AA 4P96A 4LJZF 1TQMA 3I53A 4RGXA 2H6CA 5HLIA 4LG0B 4IPAA 4U88A 4A6DA 3PQJA 2J5OA 3DXJF 3MZYA 3HHHA 3KEOA 3KP4A 3HSFA 4EQQA 2DFIA 4YFXF 1R22A 4EJTA 1ZN2A 4M73A 4M9ZA 1XGOA 2CWEA 2JSCA 3B73A 2EV0A 3FXQA 1LB2A 2BBYA 2M87A 3F8NA 1MDMB 2HYGD 4XLNF 4K2EA 3QPTA 2DQRA 4YFNF 5ICEA 1Z6TA 1L0OC 1J2XA 3H92A 3LWFA 3O6BB 1NHAA 5ILUA 1BC7C 4FHTA 1B9NA 3K2ZA 2V1XA 3BWGA 4IVNA 4B8XA 2GQQA 2OQRA 1KA8A 1UB9A 2Y48A 3ML6A 3CTAA 1SD5A 3MZHA 2G7HA 3TOAA 2PJPA 2LSOA 1MGTA 2WC2A 5H6QA 4EM1A 2QM3A 3CJNA 2L3DA 2GA2A 2XAFA 3DPTA 2EA2A 3TQNA 1F4KA 3KP6A 1MKMA 1Z91A 3BJOA 4CGZA 3F21A 4FX0A 2X0LA 4OIRF 1IW7F 3LAPA 1TNSA 1QGPA 2VOOA 1BOAA 1HKTA 2UWMA 4ASNA 4BHPA 3COAC 5FFZA 2QZ8A 1FYLA 2ZBKA 4IHTA 5FFXA 3ZN1A 3H3UA 1P6RA 2FNAA 3F6VA 3GEZA 4PDKA 4RGRA 3QP5A 5AONA 2JRTA 2LKPA 3I71A 3FM5A 5IT3A 4S04A 1LJ9A 3SZTA 1J7KA 1OMIA 3BP8A 5DD4A 1XD7A 1J75A 3ZMSA 2M30A 4CO8A 1FLIA 5DCMA 2MD5A 5D5XB 4G94A 4EV0A 1PP7U 3GF2A 1BC8C 3LFKA 4HX7A 1GXPA 3EDPA 4FT8A 1YO5C 3J80Z 4P5OA 3SXYA 3SZPA 4EMSA 2DLLA 4RAZA 4HDVA 4Q4ZF 1B6AA 3WG9A 4FX4A 2F5DA 4BHCA 4XSZF 2X4HA 3L09A 1T38A 3IC7A 2QQAA 5K5OA 5K5QA 5DEQA 2IVMA 3F72A 1UFMA 1MJBA 4GGGA 1ZARA 3DFGA 3E6BA 2PEXA 2MH9A 4QWQA 4O5VA 2CGPA 1YQAA 3GZ6A 4BHBA 4HQEA 2DO7A 1REPC 3BJAA 1O7LA 3WU0A 1IN5A 4KMUX 5E18F 4NQWA 2VONA 4EGYA 4PGHA 3TGNA 3FWEA 3T0YA 3L7WA 3FXRA 1L3LA 2NRAC 1TTYA 2FSWA 1HSJA 4EJOA 5E1WA 4UV8A 3V8JA 3RJPA 4JK1X 1V3FA 1QNTA 5ILSA 5D4RA 5A2QZ 4KN4X 1S6LA 1U8RA 3HTUA 1KYWA 2EJRA 2FE3A 3JTGA 4UVAA 5BPDA 3GWZA 3DKWA 1BN5A 2YR2A 1HQCA 3BY6A 2QUFA 5IT9Z 1G3YA 1GVJA 4I0AA 1ODDA 1DUXC 4MHGA 4M74A 3FHZA 5JI6A 3RTRA 2Z5UA 5DV5A 2YX7A 5LGTA 3I59B 1EH7A 3CUQC 2YPRA 2QENA 1XDUA 2LF7A 1XMAA 1AOYA 2VOPA 3DV8A 1SFUA 1FY7A 2DBBA 2PQ8A 2DAOA 3G3ZA 3P9CA 1S8NA 2ZFWA 4A6EA 4BH9A 2GIVA 4IJAA 1QZZA 4R1HA 3NQOA 3HRMA 1YFHA 4HX8A 4I0BA 3J81K 5LEJA 2VBWA 3RYRA 1XSXA 4YIIA 2Z33A 2Z3YA 3KZZA 3F8BA 3RPUA 1CF7B 3WTVC 4XSXF 3SFZA 3R4KA 2R7FA 3IRRA 1RIOH 4LB5A 1SD4A 2OA4A 1BBYA 1XGNA 4UVCA 4AIKA 1ON1A 5LHIA 1FP1D 1WSUA 6PAXA 2ZMEA 3ZMDA 5KK1A 4G6DA 2DI3A 2XKOA 2Q0OA 4OMZA 4E70A 1XSVA 2EFOA 1WQ2A 2BYVE 2XAHA 3ROUA 2P6TA 2IPQX 3HSRA 4I02A 2DPUA 2L4AA 2F5FA 2DK8A 5CYVA 4QLCU 3CUQB 1YG2A 5F6FA 2JZYA 2FEZA 5DUIA 2DTRA 5HS9A 2OU2A 4MGRA 4HF2A 1IAWA 4L0YB 1FNNA 2VBZA 3MFKA 5FLXK 1T0FA 2HKOA 2CSOA 3FMRA 3JTHA 4CXFA 1BI2A 2A69F 3VFZA 4KICA 1J5YA 3K69A 2VC1A 3WE2A 4L9VA 2D1HA 1XCBA 2NNNA 1STZA 2XROA 3HTSB 2ELHA 4IHSA 2YSRA 2VE8A 3JSPA 3QU3A 1IZ1A 5FD6A 4WK8F 3R61A 5DUKA 3CLOA 4XBFA 5TJJA 2HYFA 1ZREA 1FWZA 1U78A 1ZG3A 5L3EA 2P6SA 1KQ9A 5LRRA 4IXAA 2GZWA 3HOTA 1W5SA 5LBQA 5D5WB 2DW4A 2NYXA 2GAUA 4BQAA 2R7DA 3WTSC 3ERED 1ZGAA 2W84A 3K1MA 3E6MA 5BPIA 3E97A 3WTYC 4I01A 2J5PA 3F8MA 1BIBA 4OINF 4AIHA 1O3SA 3EUHA 5FB2A 2OAZA 3WGIA 3WE3A 1U2WA 3M1EA 4U7BA 4G7ZF 3ISPA 3VB2A 4G8XA 4KN7X 1F9NA 2C6YA 2QQ9A 5E8IA 3FX3A 2RQPA 2PI0A 4RS8A 2QLZA 3SHFA 5FD5A 4BNCA 1HKSA 3ZN0A 3WTUC 4CZZA 3W6KB 1QBJA 1QPMA 5K1YA 2QWWA 3BPVA 1MDMA 5LLQA 4L9TA 2XASA 1IF1A 1R5HA 1IXCA 1ZGJA 4B09A 4HA8A 2P5LC 2EFWA 1O7FA 3HRSA 3BPXA 2XIGA 4IRGA 4YIFA 3GFIA 1FSEA 2LNBA 1WI9A 2RGVA 1R23A 3KFWX 1D8KA 3IWZA 1K6OA 4OIOF 2L01A 1B9MA 3JSOA 2P7CB 5LHGA 2FOKA 3ABUA 5D5VB 4GCVA 3AAFA 5J6XA 3KLOA 2Y75A 2EFPA 2OZ6A 5HOOA 3ZQ7A 1X3UA 1Y0UA 5BQTA 2M8EA 3Q9SA 3TO9A 5LHHA 1DDNA 2MA3A 2EWNA 4WXDA 4WF2A 2D45A 5LGNA 5L3CA 3L2CA 1K78B 4Y13A 5ICFA 3HIFA 4ZYGA 4UNOA 3QP6A 1KQ8A 2JPBA 3F8FA 4ESJA 3V7RA 3QOPA 4M72A 3T8RA 3ECHA 4IRIA 3NEUA 4MTDA 3BZ6A 3J80K 1DPUA 2W25A 5LEKA 2ISYA 2BEOA 2FBIA 2R3SA 3BJ6A 5JFRA 3IHUA 4L9NA 4ENKA 4HLYA 3WODF 2RVCA 2P7VB 4ESFA 4RB0A 2VN2A 2DK5A 1OKRA 3VODA 5HS7A 1E2XA 4LGWA 3GW2A 4L9JA 1J59A 3K1PA 2MH2A 4CHUA 3LQQA 1MJ9A 4EM2A 4R8HA 1EH6A 2HOEA 4OIPF 3PQKA 1P4AA 4LFUA 5E1ZB 2A5YB 4UUVA 2GWRA 1G3SA 3E3VA 2V79A 5BOXA 3GFJA 4KIFA 4PGGA 2EK5A 3SQNA 5J8FA 1BJAA 3R60A 5E17F 5A2QK 3L00A 4UVBA 2D1VA 4O6JA 3KP3A 4WXCA 3IKVA 4HX4A 1OR7A 5DD8A 2D2WA 2ISZA 1CGPA 2LDUA 4LD5A 1KQ0A 1TW2A 4OMYA 3GXOA 2Z9OA 2KJBA 1JGSA 1R5GA 3KLNA 2DQLA 4WWCA 2JPCA 2TDXA 3LSTA 4DNCA 1G6NA 1T98A 3GYHX 4Y17A 1P2FA 1GHCA 1JXSA 3WTTC 2E7WA 2FBKA 2P5KA 1KU7A 5ILVA 1KU9A 3U2RA 3Q5FA 3M8EA 3GFMA 4KUMA 1YTYA 2VBYA 2ZKZA 2CG4A 4AIJA 2W85A 2G7UA 4DQ2A 1WWXA 3U9GA 2E1CA 2YU3A 4LLNA 1GXQA 2AXLA 3C7JA 4A0XA 1U5TC 2MLKA 2A61A 3O3KA 1FBQA 1OYWA 1LEAA 1Q1HA 5EEHA 1UCRA 2Q8KA 4KMFA 4A12A 2CFXA 4Q5SF 3I59A 4L0ZB 3ZP5A 1S29A 1ZLKA 3HRUA 2H6BA 4KYWA 1KYZA 2HR3A 1IRFA 2KIUA 2QBYB 4XLPF 3KCCA 2UZKA 1O3TA 3GUDA 3E6DA 2KIMA 2P8TA 1LNWA 5BS6A 3D5LA 3IL2A 2EA4A 2HTSA 1R1VA 2MLGA 1QQIA 1FP2A 2FNPA 3T5XA 1DP7P 2DPDA 2ZNZA 2V6CA 2ESNA 4L5IA 3DF8A 5H20A 1Z9CA 2XUBA 3P7NA 3V8LA 3T1BA 2RDPA 2XAJA 3FZVA 2WTEA 2HDCA 1EH8A 1CF7A 4KDPA 2K02A 1O57A 3P9KA 4A2UA 4ENJA 3KEQA 2HWVA 1FT9A 1TNTA 3I64A 2Z99A 1YS6A 3HUGA 2E1NA 1IN4A 2RC4A 1AWCA 2HZTA 1USSA 5E8GA 3RPQA 5E20A 2EV5A 4CICA 1E17A 5HVQC 1U5TB 1RUOA 4M6YA 1IN8A 4P55A 3IWFA 2FQ3A 3OV8A 3KE2A 3HHGA 1ZYRF 3JW4A 3TOBA 5CVJA 4ZYDA 3I58A 2HFHA 4LMYA 4GXOA 1O3RA 2VXZA 3CUQA 1FSHA 3DP7A 3C18A 3K9TA 4HF1A 1FX7A 5HLGA 3ECOA 4YFKF 3HOSA 3QRFF 1KU2A 2A3SA 2B0LA 3TDUC 1K7AA 3F3XA 1HW5A 4XRFA 1SD7A 1S7OA 3C3WA 4EJVA 1D8JA 3RKYA 4F7ZA 2HKXA 3DEUA 3F23A 3WTWC 1FYKA 2ZCWA 4WCGA 2G9WA 5D4SA 2KKOA 1R58A 2WWYA 2VODA 3LAJA 5L3GA 1LDJA 2VT3A 1H9TA 5CLSA 2ZO4A 2FMLA 1SMTA 2Q2EA 3M9AA 2PBIA 3RDIA 2XGXA 1P4XA 5D5UB 4KT5C 2V1UA 1JHFA 4KFCA 4LK1F 2FRHA 4JBAA 2O6GE 3RKXA 4IRHA 2E7XA 2HQNA 2OZUA 2ZMEB 3RKWA 2EB7A 3K1NA 3ULQB 3WU1B 1Z7UA 2O03A 3RIRA 4O3MA 3I4PA 4Z2YA 1W7PB 2FBHA 1ZRFA 4U0YA 3BDDA 4ZZLA 1H9GA 5CVVA 1YYVA 1F5TA 5CVUA 2CO5A 4G7HF 2COMA 2GXBA 3TO6A 3ZMTA 5DDGA 2V1DA 1J0RA 2JT1A 2MBFA 4LLGF 1RNLA 1MD0A 2AS5F 4GYIA 2O8XA 4UV9A 1ULYA 2K27A 2V9VA 4KNYA 3Q9VA 3WTZA 1U6GA 3GZ5A 4HV5A 3V7CA 4U7DA 1K79A 3E6CC 4LG0A 4HLXA 3LA2A 2P4WA 3CO7C 3GX4X 1R00A 1RUNA 3FXUA 2IT0A 2WV0A 4ENMA 3L9FA 1IN7A 1P4WA 1W5TA 3JAMZ 1SFEA 2HTJA 3GVAA 2ZJ2A 1T39A 2ADUA 2FU4A 1G3WA 5FLXZ 5BMZA 4HW0A 1LDDA 2A68F 1HXDA 2UXNA 4RAYA 3V4GA 2DU9A 5DCFA 3CUOA 3EQLF 4MQVA 1WRJA 1FBUA 4EM0B 1XMKA 4MNUA 2IA2A 3FM3A 1B59A 4RGSA 2QVOA 1K78A 4LLLA 4NHJA 3TKYA 1USTA 1A04A 2Y0MA 3GO5A 1R36A 1PP8F 1EV7A 4MQ9F 2ETHA 2BGCA 2M1BA 1ZLJA 4H0EA 2FXAA 2ESHA 4N0BA 1MJAA 1OYIA 2PMHA 3EETA 1FOKA 3QAHA 1W7PD 3ZMVA 5D6FA 3R0AA 3N97A 2KIFA 4Q48A 4I7HA 3D0SA 2IJLA 5HDNA 3F22A 4CDGA 3RI4A 1HSTA 4OIQF 2H27A 1ZRDA 1TQPA 1FZPB 4ESBA 4AVPA 4ENNA 2XAGA 1YIOA 3OOPA 2CW0F 2OD5A 2F5EA 1I5ZA 1KGSA 5KVRA 5LGUA 2STWA 2L54A 3O2PE 2HEOA 1TBXA
chains in the Genus database with same CATH superfamily
4DZPA 5JH7F 4A3BJ 2P5VA 2FMYA 2VE9A 4UB6C 5ICGA 3K4NA 1RI7A 1IRXA 5H6RA 1HOMA 5KFOA 4IR9A 4P9FA 3HOZJ 4TV7A 5FRNA 3JRDA 1T6SA 2WAQA 4PJMA 2XRLA 2PBZA 3CVZA 2CW8A 3MKLA 5CJ9A 3PNTA 3H4BA 2GA1A 5DGBA 3FF5A 4FQGA 3GLXA 2R7WA 1LQ1A 1BR2A 2RDIA 1IDYA 2KFDA 2RKHA 2UXXA 4UXNA 2ECCA 4JX6A 1EF4A 2XCLA 5GAEJ 3RYPA 1KBLA 3AL0C 2KIQA 4FU0A 4UCVA 1JLLB 2IEKA 2FK2A 1GLVA 2CYYA 1OR7C 1YW8A 2FX0A 2GXGA 2JTVA 3AKZA 2M0MA 2LG4A 1JTXA 1ZRCA 5LL6b 4ZDPA 1IN6A 3PNYA 2UVRA 3N05A 2FMAA 1B1BA 3LNQA 1U3EM 4ZJZA 4JQFA 3MKWB 4BWSC 1SD6A 3OR1C 3V6HA 1BI1A 5K5RA 3QPLA 5GADJ 1KJQA 4G9YA 1VQ8I 2YX4A 3S93A 3DQVC 1ETWA 1H88C 1D3YA 4A5NA 3QWLA 3L4KA 2Y69H 1MH3A 2KISA 1T2KA 3HL2A 1XGSA 4A93J 4XZ3B 1HNXH 3PZPA 3RGXA 3FK7A 3T8TA 4AD9A 1M1EB 1T36A 1Z2PX 5CA0F 1TLHB 4CYCA 2LTPA 5IOZA 2H94A 3FDSA 3KYDB 4XRSA 3SI8A 1MNEA 4C30A 1VQ9I 2RN7A 4R79A 1SAXA 2YW2A 2L4MA 3QPHA 1W36C 2B9SA 2F5CA 4S0HB 3JRFA 2K86A 4PCQA 4U0VA 5TRDA 4RUAA 5IPAA 3M7GA 2LFBA 1S68A 3GMEA 4XOTA 3GTGJ 1RJQA 4KIBA 1YS7A 4ZQIA 2M34A 2W57A 4HPQA 3GIIA 1UHMA 2L2OA 3CDHA 1BA5A 1BM9A 1DPRA 4NXNH 3F6OA 1DQUA 1ZG5A 1TQIA 2WTFA 4OOIA 2PLYA 2RQQA 1WJAA 4EJUA 4LH6A 2XKPA 2OLSA 2X48A 3I0TA 2M5WA 3JRXA 2QQ8A 2CRGA 2MYSA 5KFJA 1UHWA 1MBJA 4BAYA 3KXYT 2YCHA 3HKZN 2CQXA 5IT9K 2K9LA 3J80W 4EG0A 4HYEA 1TL8A 2IGMA 3Q0WA 1Y39A 3Q3SA 1SFOJ 5DG9A 3DTEA 2LKSA 3HB9A 4U0WA 4IHVA 2A5WA 1QHHD 2QCOA 4RMNA 5E3NA 1I1GA 2SCUB 1X1DA 3OL3A 1GV2A 2KDZA 1ITYA 5FPRA 5C3EJ 1I6XA 1I27A 3PFIA 3VOEA 1QO0D 1I39A 4YG2F 2CH0A 4EEQA 2R8IA 2W70A 1W4MA 4KT6A 1HW2A 3HOYJ 3M4OJ 4WX9A 2K4JA 4LK0F 3CP2A 3G6YA 2WY7Q 2CV1A 4IHJF 5KAIC 2KDOA 2HYJA 4A3GJ 2DTZA 5DYMA 2B63G 2JK3A 3Q8SB 2BW3B 2WBMA 4G6QA 1P92A 2DMNA 2QYOA 3BG9A 3UKGA 2A6HF 2O5RA 4U6PA 2X6YA 3CJTB 5AIPA 5DLFA 4NXMH 4OAZA 5JVTA 2P0WA 1SMYF 4LF9H 1V5FA 2W48A 2OBPA 4BKXA 3LSPA 5IYZF 1K4SA 2EV6A 5D6EA 2R7QA 2HOSA 4J9LA 1UHSA 3C0FB 3EYYA 2XGCA 3A0HC 3LA3A 4BBRG 2OWOA 2QBYA 5DCMB 5F0CA 1GVDA 1V55H 3IRQA 3ZMZA 3ETHA 1D0XA 1YLFA 3AL0B 3I4NG 3MCZA 3ONQA 4GC7A 3KAJA 3NRVA 5EJCA 4YJ3F 4BE1A 2VPSA 2KZVA 5ERIA 2R86A 1WKMA 2R7XA 1Z6RA 5CA1F 1FC3A 1J09A 2QSHX 3BLYA 2WB1N 3GLKA 3GTOA 1EHIA 3M07A 2GIZA 2XRNA 4AYBN 3WO0A 1KEEA 3V7SA 4F3QA 4BXXG 2E60A 1ERDA 3HKZE 1XN7A 3KETA 1LDKB 1TWFJ 4CYDA 4M71A 4KIGA 4JI1H 5HDKA 3R0JA 5DM7F 3OSNA 2W9BB 2ZSHB 4N9HA 1JJ8C 1B72B 2Y0SN 1TWCJ 1R71A 1HBXG 5KFCA 1VF9A 4HAMA 4HV6A 2H09A 3ZCOA 5TGTA 3OUZA 1F36A 4XLHA 1FVIA 2ID6A 1FPQA 1HW1A 5JHUA 1R1TA 4A3JJ 5FLVA 4HZFA 1JE8A 1ON2A 1G2HA 5A2QW 3LL7A 3OUUA 3QFFA 2K5CA 4L5JA 1PUEE 2BV6A 1JUMA 4UUTA 5LYJF 3C2GA 3M8FA 5B5EC 4YHHH 2NU9B 4UHTA 4O3NA 3LA7A 3IUOA 5B1AH 5EEGA 2XSDC 1SEIA 2IP2A 1MIJA 4J9OA 3RJ0A 4HOBA 2R5YA 3P9IA 5L3FA 2V5AA 1R5ID 2QEXI 2O3FA 3KP5A 4HQMA 2Q1ZB 3EYIA 1XDSA 2KT0A 2BQ3A 3NGDA 4Y52J 2W6MA 1KU3A 1MMGA 2CU7A 2FA5A 4BQQA 4IWYA 3ZOBA 3TDZC 3S17J 4N9IA 1J9IA 3GIDA 3T5LA 5HS8A 5IT9W 3C1DA 3SFIA 5DQHA 1S5LC 3QYFA 1IXRC 4RGUA 3WGGA 4NQWB 3R5XA 5L1JA 1V5GA 3F8CA 4M3GA 5KFKA 1JHHA 1FBSA 3HRTA 2STTA 1IRGA 2PN6A 4IF4A 1SEUA 3FMSA 3U1DA 2W6ZA 4AYBE 2NNYA 1FYMA 2LBFA 4HBLA 3OS1A 1I94H 4A3CJ 3DEEA 1N75A 3GTPJ 2L02A 1HA8A 1U5TA 3U1KA 3ZMUA 1C0WA 4I4TF 3GTMJ 3KP2A 4ETSA 3MKZA 1Y1WA 1BI3A 1OPCA 1YW7A 4B4CA 3CC7I 3TBIA 1NG7A 1I1SA 1W0UA 2IA1A 5EDNA 2LKXA 1I7LA 1WFXA 3E5XA 4M3FA 3PVXA 4IHXA 1N32H 4XN0A 2VBXA 4OX9H 2ZSIB 3K4MA 1FMWA 3BCBA 3WNZA 3H0GG 1S0MA 5CVIA 2NS0A 4RB3C 3VEPA 4UUSA 2NU7B 5DG8A 3RB0A 2M8GX 1DGWY 4BQOA 1HLVA 3OYGA 5EWFA 1XCVA 3K2AA 3N8DA 5HDGA 5HLHA 4I2OA 1T3NA 1XMQH 4I98B 2C22A 2M45A 1I3QJ 1R1UA 2Q2TA 1WJ5A 1O3QA 1EZ1A 4ZYEA 1SFXA 3ZPLA 3H3ZA 3I5UA 1A9XA 2CUFA 5L1IA 1Z77A 2ZXHA 3OYIA 4JV5H 3BROA 3DKYA 4RU9A 5F08A 2IA6A 4BXUA 3N4MA 4OU0A 2PN1A 2CQYA 4RB1A 4PSWA 5IP9G 2E36A 3AFHA 4ZYHA 1X1AA 4RNMA 4ED7A 4AU7A 5LD2C 3IKTA 4DV1H 4CCKA 5F64A 4BXFA 4Q8EA 4YR0A 3I54A 3S3MA 3J7ZI 1HF0A 5JLXA 1V9PA 2LRDA 1NH3A 3H0GA 5TISC 3W6VA 1QZYA 4M6XA 2W71A 4S05A 3WTXC 2EZIA 4B3XA 1GSAA 1XNRH 1BIAA 4KISA 5D8LB 5FO5A 2E2JJ 5J8CA 2A6EF 3JRBA 2IS6A 2HS5A 1E0EA 1T0FC 1KC7A 2YS7A 2NVQJ 5IYBG 5L3DA 3TEDA 2VI6A 3EUAA 2C2DA 4Q44A 4BUPA 2ZJTA 3JSNA 4Q47A 4KA4A 2BXZA 2CQKA 3FKIA 4BBSJ 2VT2A 4A0ZA 2UXCH 3MQ0A 4UCSA 2LR8A 5LXTF 2ZXJA 4M3BA 4EJWA 1DU6A 5L3BA 3KPHA 3PW2A 2HQRA 3JR9A 3R6SA 4JI0H 1JT6A 3DPLC 5E1XA 3RB6A 4PDBA 4JUZA 5IYCJ 3JRAA 4IKFA 1MBKA 4HNTA 1FEXA 3GFLA 4EBDA 5KFPA 4F4WA 3RQ4A 2RNJA 3S16J 3HYIA 2KRFA 2VQEH 4D0PA 2NVUB 2IRFG 1F1ZA 2VC0A 1JKPC 4A5MA 4MTEA 2ZNYA 1S7AA 1S3JA 4AM3A 1K83A 1Z05A 1TC3C 4XYLB 3KZIC 4AWXB 9ANTA 4G7OF 2IW5A 1AA7A 1JUPA 2IA0A 5F1RA 1ZH5A 1JXLA 3BOQA 4Q43A 4Z6YA 4XKBA 4BY7G 4CSWA 3WGHA 4IHYA 3QYBA 5KG7A 2BVMA 4HDUA 3SDBA 1HR0H 3JRIA 1XB4A 3RF2A 2DFFA 4ZH4F 1W7PA 4CH7A 5EF6A 4ZI7F 4GO1A 4L1KA 3CESA 2W1OA 4F52A 2NAZA 5FRMA 4HQ6A 1T95A 2VB6A 3BQ2A 1OLTA 2B63J 1TWAA 2JA5G 3HSEA 1SAUA 4V2GA 3JAMK 4TV8F 3MFHA 4ON0A 2BE5F 3W6JB 3KZYA 5HODA 1YW9A 2K7LA 1AKHB 2JEFA 4X62H 1NG6A 3IP4B 3E5UA 4TUYF 1HKQA 4QW9A 2QA4I 4YIRX 4MEXF 2KRHA 1LVAA 1ZAOA 2XHKA 5EZHA 3V8KA 3GZNB 1LEBA 3OYAA 1S9FA 4BBRJ 2KZGA 1AU7A 1RZ4A 1WH2A 1BOBA 2HOTA 5IOYA 3REOA 3S1RJ 4FE4A 5LRSA 2FD5A 3FMQA 4A3IG 4I09A 4FM9A 3QU6A 4BQNA 3S2WA 3LQRA 3EUHC 1VTNC 3ZXSA 1B8IB 3EPIA 3PIPF 4JX5A 4E7JA 2WADA 1X1PA 2W4SA 3RV3A 1ZG1A 1WCMA 5KFZA 2BXYA 4L18B 3W3CA 2W24A 4BXXJ 2DA5A 2DJIA 3ABTA 2K4BA 1IUYA 1V5EA 3NARA 4IO9F 3J81Z 3E5QA 2AGOA 3MEXA 3B02A 4XNFA 5BPHA 1G4DA 4BYYA 4ZZDA 2DYSH 1Z1DA 2XVCA 3DLLF 3UQ8A 4RAGA 2COBA 5AIQA 2O61A 4RB2C 4Y15A 2XV4S 4HR7A 3WO1A 1H0MA 2JA5A 4A0YA 2HZDA 1M6VA 3G73A 3OYEA 2L0KA 4C2MJ 4FISA 4XK4A 3VWBA 2UXDH 1G3TA 1ZHFA 5FKOA 3VYTB 4XLCA 4LB6B 5D8KB 4C9YA 2WYOA 2XF7A 1R49A 5EZYF 2W8LA 1R7JA 4JP0A 2F4OB 2LF8A 1CS0A 2FF4A 2EQRA 2KJCA 4M9XA 4WXHA 1VQ6I 1XSDA 5C1OA 3MR2A 4PZJA 1OWTA 5CVRA 4HF0A 4CUGA 1GO3E 2DT5A 1GV5A 4XKCA 2NOJB 3J7AO 1D0ZA 2F2EA 5JR3A 4E4HA 1R9TJ 4EBEA 2MC3A 3FXMA 4E4TA 2HU9A 2PFBA 2FK1A 2NVXJ 3GTQJ 2XAQA 2O0YA 2EFNA 4YY3H 2PMUA 1B33N 2UUZA 2OQGA 1PDNC 4QWBA 4J9SA 1S0NA 1WHUA 2EFQA 2KL4A 2QQBA 2E5NA 3K3PA 1IXSB 4JI3H 3C2BA 4DGWB 4P9UA 5L1KA 5ED4A 1XS9A 3TO7A 3D5RC 1MZBA 4EGZA 2GOXB 4XKWA 1ZGWA 1KJJA 1ETXA 4MFDA 4I50F 2PG4A 4GYGA 5GP9A 3MWMA 4DR2H 1ETYA 4X6AJ 1Y56A 5KT2A 4O2BF 3ELKA 3K0LA 3JAMW 4UB8C 1XGMA 4TQRA 2L5QA 4Q0YA 1TWHA 5ICCA 5FLMJ 2XGQA 2ACJA 3KYCB 3MAJA 3W2VA 2OH2A 1D5VA 1ONVA 2DN0A 4J9KA 1VI0A 4O4LF 2CV0A 1ORKA 5LOVF 4NB5A 1FTTA 4DV4H 4EVIA 3GTKA 1MSFC 1OYYA 1V54H 3HKZA 4EFEA 4MEYF 2HGCA 3LSKA 5FGMA 2RF4A 4A3KG 2TRTA 3ZGKA 2JA7J 2RV8A 3BTJA 4EATA 3MKYB 3A01A 1E4GT 1BI0A 2R5ZA 2A07F 1CE8A 2DT6A 1TW3A 2IBKA 2MABA 1ZQ3P 2CJJA 4IOCF 4C2TA 1UC8A 4DV2H 1OFCX 2V7FA 4M9SA 1E3OC 2YU9J 1V4RA 2QKMB 5GAHJ 3CO6C 1FOXA 4BEHB 1N48A 2GLTA 3KP7A 2VPRA 3CLQA 5J3LA 2BHZA 2HPIA 1B4AA 4P96A 3RPUD 4LJZF 1TQMA 3I53A 4IX7A 1JKJB 3SDGA 2FUG2 3FHNA 4RGXA 5DM6F 4BACA 2FPGB 2ELJA 2H6CA 5HLIA 5E79C 4LG0B 3G1MA 4NC7A 4A2AA 4IPAA 4U88A 4A6DA 5I47A 2HDWA 3BR1A 2BQUA 2DLNA 3PQJA 2J5OA 2XCAA 1SC7A 3DXJF 3MZYA 3HHHA 3E5NA 3ZR8X 1O75A 3KEOA 3KP4A 3HSFA 1KJ8A 2XC9A 4EQQA 2DFIA 4YFXF 2V59A 1BW6A 1ZHSA 2WAEA 4QSHA 4LFBH 2LOOA 2FPIB 3GIMA 2F4VH 1R22A 4EJTA 3BR2A 2VUMJ 1ZN2A 5KT5A 4M73A 4FS1A 4M9ZA 3CMAI 1XGOA 3K70C 2CWEA 2KMUA 5KCMA 2R87A 2JSCA 2LC2A 4U87A 3B73A 2EV0A 1A0IA 1UZCA 3FXQA 4O4IF 1FKAH 2VQFH 1LB2A 2BBYA 2DFEA 5H80A 4HNUA 3L2QA 4AYBA 2M87A 4Y3OA 3F8NA 2DZDA 5KFNA 1MDMB 2NS7A 2HYGD 4XLNF 4K2EA 3QPTA 3VYUB 4A3LJ 2FB9A 2DQRA 2R92A 4AUXA 1I50A 1KONA 4F92B 2UVUA 5DG7A 2UXBH 2BR0A 4YFNF 3TP3A 3AG4H 2EH3A 3R5FA 4B48A 1V4YA 4ZTJA 5ICEA 2R4GA 1TAEA 4B3MH 1S10A 1Z6TA 3DBRB 3MWEA 4XYMB 1LVKA 1L0OC 1G8XA 1VQMI 4EEFG 2KSWA 4DW6A 1J2XA 3H92A 3LWFA 3O6BB 1N34H 3QYEA 1NHAA 5ILUA 4F91B 1IOWA 1BC7C 3RB3A 3PO2G 1RETA 2BHYA 4FHTA 1A36A 1B9NA 3K2ZA 1D1CA 2OCEA 2XF5A 2V1XA 3ZQGA 3BWGA 3K4JA 1RJRA 1AUXA 4IVNA 1HNZH 4CC6A 4B8XA 3HOUG 2E19A 2GQQA 4I76A 4XONA 1Y0NA 2IS1A 2XPWA 2OQRA 1QVUA 1KA8A 1OCPA 2V9WA 2XD4A 4OWRB 1UB9A 1ENHA 2Z2SB 2HQAA 3S2HJ 2Y48A 3TL4X 5KFGA 3ML6A 4XRSG 3CTAA 1SD5A 3RQIA 3MZHA 2G7HA 4XM3A 2ELKA 3TOAA 3WU2C 3ZQQA 3S3OA 2LSOA 2PJPA 5KFWA 2JEIA 1H8AC 1GYFA 1MGTA 3TQ1A 2E5LH 4ECUA 2WC2A 1JT0A 5H6QA 3A0BC 5GONF 4C2UA 1Y1VJ 3VMMA 2ID3A 4EM1A 5DS9A 1QRYA 1RK5A 2Z1DA 2OPTA 1BJZA 1UNNC 2QM3A 4IOAF 5DQGA 5KT3A 3PO3G 3K10A 3MVPA 3CJNA 2D5VA 5HNHA 4CCMA 3KYLA 2L3DA 2GA2A 5KFFA 2VASA 2XAFA 3DPTA 1OJLA 3JCUC 2EA2A 3TQNA 1TA8A 4Y33A 4PJLA 1F4KA 3KP6A 1MKMA 2IS2A 1Z91A 3BJOA 4H4KC 4JX4A 2LY2A 2M3AA 4CGZA 5FKNA 2FQ4A 4PJJA 3F21A 4FX0A 2X0LA 4OIRF 1IW7F 1RESA 3LAPA 3B6AA 3VPCA 1D1AA 2HXOA 4EGJA 1TNSA 1QGPA 2W9AA 2VOOA 1BOAA 3UNGC 2V26A 5CAEB 1HKTA 4J9NA 2UWMA 1EYZA 4DR3H 4ASNA 2F6CA 4BHPA 3COAC 5KT7A 4FS2A 4YQWA 2ALZA 1MMNA 5FFZA 2R93J 2LH9A 2QZ8A 1B04A 3PR5B 1FYLA 3T1HH 2R7ZG 4AC0A 2ZBKA 4O3QA 4FTHA 1RJPA 4IHTA 5FFXA 3ZN1A 4E7ZA 2CUEA 2VR1A 2V6EA 1TWGA 3CQZJ 3ERMA 3H3UA 1P6RA 2FNAA 3F6VA 1P9QC 3GEZA 4PJNA 4YP3A 3G6VA 2M0CA 4PDKA 2HHHH 1N77A 3JSLA 4RGRA 3QP5A 5AONA 3BQZA 3HPHA 4DIQA 5KG4A 2OJED 1BXRA 3CJQB 4LITA 2BW3A 3FISA 2JRTA 2LKPA 3I71A 3AYHB 1VQPI 2R7MA 3E7LA 3FM5A 5IT3A 4S04A 2GM4A 3S1NJ 2BQRA 4MV7A 5L9XA 1LJ9A 2DOEA 3SZTA 1J7KA 1OMIA 3BP8A 2RNGA 1XD7A 5DD4A 5EGOB 1J75A 3ZMSA 2M30A 2W7OA 1EKEA 4C3HJ 1XG1A 4CO8A 3DTIA 3BTCA 3CCLI 1FLIA 5DCMA 2MD5A 5D5XB 5IP6A 4YAKB 4G94A 4EV0A 1PP7U 4R7RA 5KG5A 3M9NB 3GF2A 3SJMA 1AN7A 1R4MB 2DFHA 1BC8C 3LFKA 2EIJH 4HX7A 1U9NA 3IH4A 4RLQA 3EPGA 1X2MA 4DBQA 1GXPA 2C28A 3EDPA 1IRZA 4FT8A 1YO5C 2R7ZA 4RA2A 4ECXA 3J80Z 1I6HJ 5GPCA 4JV1A 4P5OA 5J1YA 3SXYA 3CMEI 3SZPA 1Z2OX 4EMSA 1OCRH 4QIWN 1JGGA 1WH5A 1JX4A 4A69C 4ABZA 3A03A 4IHWA 2W9BA 2DLLA 1MBFA 4RAZA 4HDVA 1BR4A 4Q4ZF 4A3KJ 4A3EG 1B6AA 2WDTA 1ETOA 3MMYB 3WG9A 2I80A 3HOVG 4IQJA 1Y6IA 4FX4A 2C2RA 2R8KA 2F5DA 4BHCA 4XSZF 2X4HA 3LP8A 3L09A 1T38A 5FJ8G 3IC7A 2QQAA 5IYDG 2RGRA 1MNMC 2VJIA 5K5OA 5E3OA 4ECSA 5K5QA 4ECVA 5DEQA 3BT9A 5CKTA 1E4EA 4M9UA 2IVMA 3F72A 1UFMA 4DL3A 3OHAA 3Q8PB 4HSTA 1VBGA 1MJBA 3BG5A 4PFOA 4GGGA 1ZARA 4PSXA 3N44B 3DFGA 3E6BA 2PEXA 1Z2NX 4RAFA 4YR3A 2MH9A 3K3VA 4QWQA 4O5VA 1FTZA 3Q2OA 3VYRB 2CGPA 3I9V2 1YQAA 3GZ6A 4J9QA 2X51A 2R7OA 2L7FP 4BHBA 3S2DJ 4HQEA 2DO7A 1REPC 3BJAA 1O7LA 3WU0A 4EFBA 2M05A 2HQ5A 2K3PA 1IN5A 2W6QA 4J9RA 5FKLA 5F0FA 3CMYA 4EYIB 3HOXJ 4KMUX 4RUCA 5E18F 4QWDA 4NQWA 1JDEA 3N41B 3K6GA 1TP4A 3Q0VA 2VONA 4EGYA 2I8CA 4J9MA 4PGHA 3TGNA 3FWEA 3ABMH 3T0YA 3ZQHA 3L7WA 3FXRA 3LFUA 1L3LA 2NRAC 5KFUA 1TTYA 3H40A 3OS2A 2B7EA 3U21A 5C44G 1K6YA 1POGA 2FSWA 2LYCA 2JRMA 5J2TF 1HSJA 4DL6A 3ASOH 2E34A 2HVSA 1Y1WG 4EJOA 1ZHQA 5E1WA 2Y31A 4UV8A 2NVYJ 2W6PA 3V8JA 2JWTA 3RJPA 4XL9A 4ANJA 3J7YJ 4JK1X 2NU6B 4YBZB 1V3FA 1QNTA 3BABA 5ILSA 3KHLA 2DA7A 5D4RA 2MW8A 2DMPA 5A2QZ 4GKKH 4KN4X 2XC7A 2MG4A 3W2AA 1S6LA 1U8RA 3HTUA 1KYWA 1LFBA 3BCAA 1O4XA 2EJRA 2KLOA 4KJZA 3H9GA 3RSNA 4MV3A 2FE3A 1RKWA 2H8RA 3JTGA 3GCMA 4UVAA 5BPDA 3GWZA 2AQFA 2IGNA 1WZ2A 1W0TA 2YYAA 3OYFA 3QZ7A 2LP0A 2EIKH 2WB1E 2ASDA 3DKWA 1BN5A 2YR2A 1HQCA 3BY6A 2QUFA 3DBHB 5FROA 5IT9Z 2VLAA 1G3YA 3CDIA 2VKVA 1IUFA 1GVJA 1BR1A 3H36A 4I0AA 1ODDA 4XORA 4DZJA 1DUXC 4MHGA 1D5YA 1PVEA 4M74A 4JYKA 3HDDA 2CUZA 3FHZA 2IMWP 5JI6A 3PUFA 3RTRA 2Y0SE 4MAMA 4XOPA 5KFBA 2N8GA 1I3AA 3RKQA 2JQ7A 2Z5UA 2DOAA 1UMQA 3HOUJ 5DV5A 2YX7A 2UV1A 2VJ4A 5LGTA 1A6IA 4DYQA 5KAFC 4YELA 3I59B 1EH7A 1X4OA 3CUQC 2HVRA 2YPRA 3HM5A 5C4JJ 2QENA 1XDUA 1YI2I 2LF7A 4WD3A 1XMAA 2VPQA 2WAQN 1IOVA 3CCRI 1AOYA 3X2QH 2PVPA 1YRNB 3OWTA 2VOPA 3M3YJ 1SVOA 1ZK8A 3CF2A 4PUSA 5KX5F 1N36H 1N33H 2C35B 4EGQA 3KHRA 2FLPA 3DV8A 1SFUA 5DTDA 5KFAA 2BOLA 1FY7A 3FKIG 3LWBA 3UR3C 3PO3J 1GLNA 2DBBA 4P1WA 3ORRA 4QJFA 2IGKA 2VKDA 2M4GA 2E2IA 2PQ8A 3U9TA 4D7NA 2KHMA 2DAOA 3CJRB 1I6UA 2VKEA 3G3ZA 3P9CA 1T8IA 5C1PA 1S8NA 3LSJA 2ZFWA 4A6EA 3OR2C 1YJNI 4BH9A 3OYBA 2GIVA 2LK2A 1YJ9I 2R8GA 4LSXA 4IJAA 1QZZA 3BZKA 3NQOA 4R1HA 4KITB 5JVLA 2EILH 2VJ5A 4RNNA 3HRMA 2MFZA 3PW5A 1ZELA 4A3MG 2OTLI 4MV9A 1LKXA 1IDZA 3LMLA 1MSEC 1DGRM 4M6VA 3ZQIA 4R8UA 1PUFB 5M5XJ 1YFHA 4UCOA 4GC6A 4HX8A 3M9MB 3BR6A 4I0BA 3J81K 5LEJA 2VBWA 3RYRA 1XSXA 3OIPA 4YIIA 2Z33A 3BAAA 3RUPA 1FIPA 2Z3YA 2WY8Q 3KZZA 5EEAA 4ZHQF 5BMVF 2K9QA 3F8BA 3RPUA 2X6OA 5IY5H 3CC4I 1CF7B 4XQFA 5KT6A 5IP7G 2W9CB 1MH4A 3WTVC 1ETVA 4XSXF 3M4IA 3SFZA 4LF7H 3R4KA 2R7FA 3CCMI 2C00A 3IRRA 1Y8RB 4RBOA 3D1NI 2R7RA 2CFOA 3H5NA 1FJLA 2XB5A 1RIOH 4LB5A 2WAQE 4MLOA 4C5CA 2L9NA 1AKHA 1Y14B 1SD4A 1X1CA 1BBYA 2OA4A 1XGNA 3BQYA 3HUGB 1LE8B 4JV0A 4UVCA 1HNWH 4ED1A 4AIKA 1ON1A 4BY1G 5LHIA 1FP1D 4IAJA 1WSUA 1DP3A 4IQ4A 6PAXA 3RGZA 2CS3A 1S72I 3PW0A 2XAUA 3RCOA 3Q8RB 2IGOA 2ZMEA 3FXJA 3ZMDA 1DIKA 5KK1A 4G6DA 3EPZA 3RB4A 2DI3A 5F04A 1W36D 2BY1A 2XKOA 2Q0OA 3BJYA 2X1DA 4GLXA 4OMZA 4ZC3A 3GTOJ 3GTJA 2YS6A 4E70A 1XSVA 2NXNB 2EFOA 1WQ2A 1B8IA 1WCMG 3H20A 5C4XG 3J7AK 2BYVE 2XAHA 3ROUA 5KFXA 2P6TA 4RM2A 2IPQX 4HYKA 3HSRA 4GFBA 4I02A 2DPUA 4DV5H 2L4AA 3V6JA 3BR0A 3TP0A 2W6NA 1VQ5I 5J1RA 2AO9A 2F5FA 3BG6A 2DK8A 2ZDGA 2V1NA 3H1CA 5CYVA 3FMAA 3GTLA 4QLCU 5KT4A 2LLKA 4F93B 1Z67A 1YG2A 3CUQB 5F6FA 2JZYA 3VPRA 3CCQI 4TV9F 2E1MC 1XMXA 2ZB9A 3HOVJ 3S14J 2FEZA 2L9RA 3VDXA 5DUIA 2DTRA 3V4SA 5HS9A 4O2AF 1YITI 2OU2A 4BDYA 5FJ8J 1A35A 1WR2A 5IYDJ 3CCYA 3S1QJ 4MGRA 4HF2A 4UCRA 1IAWA 4L0YB 3H5AA 3IAS2 4MV8A 1FNNA 2VBZA 3A1YA 3MFKA 3MFIA 5FLXK 1T0FA 2HKOA 3CDLA 3IG0A 4FBTA 2CSOA 3FMRA 5DLGA 3JTHA 4Y4RA 4CXFA 4LF8H 3I4NJ 1BI2A 1T08B 1ETKA 1TT5B 2A69F 3VFZA 2VUGA 4KICA 4C3IJ 1J5YA 3K69A 1QVTA 3CCSI 2R7TA 4ME6A 2RREA 2VC1A 4I99C 3WE2A 2WAFA 2D1HA 4L9VA 1VQOI 1JKQC 3OHBA 3GV7B 2BVLA 4B1RA 1XCBA 3L2UA 4X0GA 2NNNA 4ED6A 1STZA 3B6CA 4D1QA 2XROA 2ELHA 3HTSB 4IHSA 2YZNA 3V4ZA 2YSRA 5LP6F 2X6WA 5E3LA 3FK6A 3RBDA 2JA6A 1L2ZA 2MSYA 3K4CA 3BA8A 2VE8A 5CQGA 3JSPA 3JRWA 3BQ0A 4DV6H 2ZM6H 3HOZG 5LFAA 4EYHB 3O8HA 2UVWA 1WVRA 3QU3A 3UFXB 5HV6A 1IZ1A 5FD6A 4WK8F 2E71A 2JA2A 2HI3A 4JV2A 4D5CA 3R61A 5DUKA 2HNHA 3PNVA 3CLOA 2IXSA 4XBFA 5C44J 3OYLA 2DPJA 1XC5A 2HYFA 5TJJA 1ZREA 1FWZA 2Q2EB 1U78A 1Z7LA 1ZG3A 1DV2A 5L3EA 1Y1WJ 3BR3A 2ZDQA 2P6SA 5EZGA 4BJ5C 4IZZA 1KQ9A 5LRRA 3K4LA 1VQ7I 1EUCB 3HZJA 2XPVA 4IXAA 1IV6A 4ED8A 2GZWA 5EOYA 3HOTA 4ZTFA 1W5SA 5LBQA 1M7JA 2E2HA 5D5WB 4AQYH 2DW4A 2NYXA 2PJRB 2GAUA 4BQAA 2R7DA 1KZHA 3S32A 3WTSC 3ERED 1BNCA 1ZGAA 2W84A 3K1MA 1MMSA 3E6MA 3H9QA 3L2VA 5BPIA 1PX2A 3E97A 1RKTA 2HXIA 3WTYC 3FBIB 3G8CA 4I01A 1FOYA 1B6RA 2J5PA 1X4PA 1WPKA 1BIBA 3F8MA 2J6UA 4N4NB 4OINF 3SEZA 5BR8H 3PR4A 3LSGA 2GOMA 4BL0B 3S1MJ 2K85A 4RNOA 4AIHA 2V9PA 2DMQA 1O3SA 4BDZA 3EUHA 3CC2I 5FB2A 2M2EA 4BEHA 4DBRA 2CUJA 2I8DA 5JVDF 2OAZA 5M5YJ 3WGIA 3WE3A 3M9OB 1U2WA 2DA2A 3M1EA 4U7BA 1W96A 2A05A 4MO7A 2W6OA 4G7ZF 4ECRA 3ISPA 3VB2A 4XKVA 1RK6A 2YZMA 4A2BA 2VOBA 4G8XA 1UJ8A 3F0CA 5F9NA 4E7SA 1U0JA 5EYRA 2K9NA 4TQSA 4BE2A 2AGPA 4DYRA 1VQ4I 2E1MB 4KN7X 1F9NA 2C6YA 2QQ9A 1VKZA 2ASLA 5E8IA 1WJFA 3FX3A 1X19A 4UY8I 2RQPA 3H0GJ 3OYKA 1X2NA 2PI0A 1A31A 1SCUB 4RS8A 2QLZA 4FE7A 3ORQA 1Y8QB 2L7ZA 3SHFA 3PIOF 4J00A 5KFLA 1FOWA 5FLXW 3PSFA 1ZKGA 3K4KA 4HG2A 4II2A 5FD5A 4CZCA 3JRCA 4XICA 3HG9A 4BNCA 2VQGA 1HKSA 2A6TA 4BJ6C 3ZN0A 3WTUC 4CZZA 3I55I 4X64H 3W6KB 3G2BA 1QBJA 1QPMA 2M9HA 3FKIJ 5K1YA 3HOYG 2QWWA 4LF5H 3H0DA 3BPVA 1E4FT 2FJ1A 1MBHA 4C5BA 4A3BG 1MDMA 5LLQA 2R92G 4L9TA 2XASA 1IF1A 3GTGA 2ASJA 3LSHA 1R5HA 4I55F 1IXCA 1ZGJA 5IP9J 4B09A 3H4DA 5F1JA 4ECQA 1ULZA 3E0JB 4HA8A 4DL4A 1YX3A 2DIKA 2P5LC 5D1OB 5KG1A 4HNVA 4IZOA 2EFWA 4JOMA 1SFKA 2L9SA 4JI7H 1O7FA 3HRSA 3BPXA 1YOVB 4W1UA 2XIGA 2KP6A 1K83J 4IRGA 1Z3XA 4YIFA 2K9MA 3GFIA 1QPIA 1FSEA 1NTCA 4NNJA 2LNBA 2H1KA 1VQNI 4X66H 2UU9H 1WJEA 1I7NA 1WI9A 4MV1A 2RGVA 1R23A 5K7FA 1SFOA 2GBYA 1LPQA 5GPAA 3KFWX 2FLLA 3JZIA 2YRXA 1D8KA 2JA8G 3DCFA 1LUJB 2WB1A 3IWZA 3K7AJ 3I12A 5IYBJ 3BA9A 2KRCA 1TWAJ 4ED3A 3N6XA 4O4HF 1K6OA 4OIOF 2L01A 2DT7B 2JVHA 1B9MA 4X1EA 4F55A 2V9KA 2NU8B 3GQCA 2CQ7A 3JSOA 3KHHA 2P7CB 4C3JJ 4JI2H 5LHGA 4DOZA 4F4YA 2FOKA 3VPBA 2Y30A 3WHBA 3ABUA 5EDWA 4N4OB 2Y0SA 4YJ2F 3OYCA 5D5VB 1SYXB 4GCVA 5KG0A 3AAFA 4A3JG 2IAIA 5J6XA 3KLOA 4BY1J 4J01A 3L4JA 2Y75A 2EFPA 3PW4A 2OZ6A 3RAXA 2M7AA 5HOOA 3ZQ7A 4K0KH 3N43B 1X3UA 4RM3A 1Y0UA 5BQTA 2M8EA 3Q9SA 3TO9A 1UAAA 1WJDA 5LHHA 1DDNA 1K61A 3Q1KA 2R7KA 2MA3A 3O8GA 4BE0A 2EWNA 1N56A 4XIDA 1OQYA 4WXDA 3HGYA 5C4XJ 1WCMJ 4WF2A 3V6KA 2D45A 1WH7A 4GRIA 4BY7J 1AUVA 1PJRA 1IGNA 2DODA 5LGNA 5L3CA 3L2CA 4DR5H 2BZTA 1QZEA 4Y13A 5ICFA 1K78B 5M3MJ 2R7VA 1B6SA 3HIFA 4CCLA 4ZYGA 5B66C 4UNOA 5FKMA 5M5WJ 2BY2A 3QP6A 2JA5J 1KQ8A 2JPBA 2MC4A 3F8FA 1TWFA 4O3SA 4ESJA 1K1QA 3V7RA 1QU3A 2Y2ZA 4JYAH 3QOPA 5D8DA 4M72A 3WG7H 3T8RA 1SVMA 3ECHA 3G4SI 3CCEI 1TWCA 3RBEA 4IRIA 4A3FG 3NEUA 4MTDA 2ZDHA 3SYTA 2Z16A 4LIUA 3BZ6A 3J80K 1DPUA 3DEWA 4DL7A 2X0SA 1P7JA 2W25A 2DJNA 4E6KG 5LEKA 2G0EA 4A3IJ 2XGEA 1VNDA 2QYZA 2ISYA 2BEOA 3IV5A 2FBIA 4NC6A 2R3SA 3BJ6A 1MMAA 5JFRA 3IHUA 5EG0B 1IG7A 1BGWA 2NS8A 4L9NA 4ENKA 1EJ9A 1UG0A 3HOWG 3BZCA 4HLYA 2CZGA 3WODF 5KFIA 2RVCA 4W97A 2QSGX 4J0MA 2P7VB 3DF7A 2P0AA 2V58A 3QOEA 3HPGA 4RB0A 3ZQFA 4CCNA 2M7BA 2VN2A 4ESFA 2DK5A 3E1SA 1VS0A 1OKRA 3VODA 2JUCA 3AG1H 3OSGA 3OS0A 4JI6H 4DV3H 1S97A 1D1BA 2HOAA 5HS7A 2L7MP 3MN2A 2HGSA 5EGOA 1E2XA 4LGWA 2DOFA 3GW2A 4L9JA 1UG2A 4BGDA 1J59A 3K1PA 2MH2A 1YIJI 3A2KA 3U9SA 3ESWB 4CHUA 1TZLA 2ZXWH 3LQQA 4BJTA 1MJ9A 4EM2A 1QHGA 1EH6A 4R8HA 4FCYA 1XDNA 4ECTA 2HOEA 2NOGA 3A02A 2W7PA 2JMWA 1K4TA 4OIPF 2YZGA 3GTPA 3PQKA 1P4AA 3JREA 4LFUA 1TWHJ 2WA0A 4ED2A 3GTMA 5EWGA 5E1ZB 1IBLH 2DYRH 2Q2UA 2A5YB 2KPMA 2GXAA 4UUVA 1RYRA 1FJGH 4MIMA 3FXLA 3GTKJ 4JI5H 2GWRA 1CQJB 1G3SA 1HDPA 3E3VA 3PL8A 1Z0XA 3KHGA 3ZQCA 1R6RA 1A6QA 2V79A 3J7AY 4F50A 4EBCA 3OSPA 5BOXA 2WE6A 3LOCA 3LMMA 4OAYA 3GFJA 4KIFA 4PGGA 2EK5A 3GV5B 4DR1H 2X1EA 3SQNA 3KX2A 5J8FA 2XGDA 4V2FA 5B1BH 1BJAA 3R60A 2JUGA 1XMOH 3CF5F 2HDDA 5E17F 4V19K 2LVSA 2EPFA 2LMDA 4NBQA 5A2QK 3L00A 1GSOA 2ICWG 5J1UA 2VQLA 2D1VA 4UVBA 1I3QA 2OC6A 3FKJA 4QWEA 4O6JA 3KP3A 4BBSG 1XTAA 3IKVA 4WXCA 4CA0A 3TW6A 1GDTA 2OCCH 4HX4A 1OR7A 1RPWA 5DD8A 2D2WA 2ISZA 1CGPA 3MR6A 2LDUA 4LD5A 1KQ0A 5IYCG 3MD2A 1TW2A 5H2FC 2DA1A 4Q8FA 4OMYA 2KQRA 3GXOA 1JJ6C 2Z9OA 1RR7A 4FBUA 2W00A 2KJBA 1JGSA 1X9NA 2AXTC 5J4VA 1R5GA 1B72A 3PFYA 4M3DA 2DMTA 3BG7A 4NDLA 2F4IA 1BL0A 3KLNA 2DQLA 4CYCB 3WHCA 4WWCA 4UCUA 2JPCA 2TDXA 3LSTA 4DNCA 2H8WA 3BQ1A 3DBLB 2JSPA 2OV7A 3G1OA 5JHFA 1X3WB 1VFCA 4PJ0C 1G6NA 3PJRA 2FPPB 1T98A 3GYHX 4Y17A 1P2FA 1P8LA 2R92J 1I50J 5KNLA 1GHCA 1JXSA 3WTTC 1OCZH 2ME6A 2E7WA 3QQAA 3LSRA 1C3OA 2EZKA 3T5HA 2UUCH 2FBKA 3L1PA 2P5KA 1KU7A 5ILVA 1KU9A 3K5HA 2XPUA 2R8HA 3U2RA 2ECBA 1X3ZB 3Q5FA 3M8EA 5DGAA 3GFMA 4KUMA 2IS4A 5K7HA 1YTYA 1X58A 3G71I 2VBYA 2ZKZA 2CG4A 4AIJA 2W85A 4XR6A 2G7UA 1V51A 4DQ2A 2GPSA 1WWXA 3Q0UA 1T56A 3U9GA 2E1CA 4O3RA 2YU3A 2VPLA 4LLNA 2QGUA 3OSFA 3I4MG 1GXQA 2AXLA 2K9SA 3C7JA 4A0XA 4BU2A 2JA8J 4EEYA 4LF4H 1IBKH 1U5TC 2MLKA 4QIWE 3W2WA 3N42B 3VSLA 2A61A 2XCPA 3O3KA 1FBQA 3FDYA 3SEQA 1Z21A 1ZR2A 4CCOA 1OYWA 2LY1A 2FLNA 1LEAA 4LSAA 1Q1HA 5EEHA 4ZYAA 2R8JA 1UCRA 3OIQA 2Q8KA 2FK3A 2B63A 3L2RA 3P5JA 1YHQI 4KMFA 2WV1A 4II3A 1YX5A 4A12A 2CFXA 3BTIA 4Q5SF 3I59A 4L0ZB 3TINA 3ZP5A 1S29A 1ZLKA 3HRUA 1WJCA 2H6BA 3Q8QB 4J9PA 4KYWA 1KYZA 2HR3A 4DUZH 1IRFA 1IV8A 1E4EB 3DTKA 2R93G 3K70D 2KIUA 5FKKA 2Y9ZA 4E7IA 2QBYB 5J2UF 2YL2A 3GILA 1YRNA 4XLPF 5F27A 3KCCA 2GPWA 3LSMA 2UZKA 3VSKA 3ABLH 3K4BA 3OY9A 1X1BA 1O3TA 1VZ0A 5BNGA 5B3SH 1JKOC 1JDBB 3GUDA 3PO2J 3E6DA 4YRVA 3FXOA 2VQCA 2ZXIA 4QPOA 2KIMA 4CCJA 1D0YA 2P8TA 1LNWA 4L5EA 4PFPA 4ZDOA 2W82A 5BS6A 2MCTA 2QF7A 4DLKA 3D5LA 3NWTA 1F43A 3VPDA 2VA2A 5JQWA 5LMUH 2PMZN 1MBGA 3IL2A 2CMPA 2EA4A 2NVTJ 3L2PA 2HTSA 2ZJPF 4IR1A 1IO2A 1R1VA 4I6ZA 2BY0A 2MLGA 1QQIA 3GIKA 1FP2A 4A3FJ 3VYSB 2FNPA 2PX9A 4NUBA 3T5XA 2IP4A 3DKXA 4D7MA 5F0HA 1DP7P 4XMYA 2ZJQF 1E3PA 2DPDA 2ZNZA 4QTRA 2V6CA 1PUFA 5KFEA 4C2MA 2ESNA 4FASD 3OYJA 4L5IA 3DF8A 2I10A 4BS9A 5H20A 1Z9CA 2XUBA 3P7NA 1G59A 3GIPA 2J6SA 4LFAH 1APLC 1TWGJ 3RAQA 3V8LA 1HDDC 2E1OA 2RDPA 2XDVA 1UELB 2XAJA 3FZVA 3T1BA 1RYSA 2R5YB 2WTEA 2EINH 2HDCA 1EH8A 4M3EA 2VKHA 1S9HA 5HNFA 1CF7A 4KDPA 2MD0A 3TQTA 5FLMG 3HOWJ 2W9CA 2M4KA 2K02A 2ZC2A 1O57A 3P9KA 4A2UA 3MR3A 3QODA 4ENJA 1W5CC 3KEQA 3MJFA 2HWVA 3GIJA 1FT9A 1PYVA 3BR5A 1TNTA 1JIHA 1Z3YA 3I64A 2Z99A 2JA7G 5C8YF 3T5JA 1R9TA 1R4NB 1YS6A 3ZRGA 3TIGA 1JKRC 3IH3A 1LE8A 2OF7A 2E1NA 1IN4A 2P81A 2RC4A 3HUGA 4F4XA 3GTQA 2K40A 2IBDA 2NVXA 1AWCA 3FXKA 4ZDLA 5KKNB 2HZTA 1USSA 5DQIA 3T1YH 4A3DG 1RC9A 5JLWA 2AGQA 5E8GA 3G6EI 2ZMEC 3RPQA 2LBFB 2CV2A 5E20A 2EV5A 4CICA 4WBNF 1E17A 2FKLA 2LREA 3HGGA 5HVQC 1U5TB 3OYMA 1IC8A 1RUOA 5JUMA 1SANA 3DPUA 4M6YA 2R7ZJ 2PMZE 4QW8A 3HXLA 1IN8A 4P55A 3IWFA 2FQ3A 3OV8A 3RZOJ 4MV6A 4RLFA 1TT0A 3KE2A 4HRIA 1GUUA 3HHGA 3GV8B 1ZYRF 3JW4A 3TOBA 3NWSA 2V4JC 5CVJA 5J4YA 4ZYDA 5KFQA 2XGPA 3I58A 3KIOA 4ITVA 2HFHA 4LMYA 4GXOA 2VJJA 1O3RA 4UUSB 3OTOH 2VXZA 1E3HA 3CUQA 3RIZA 1T94A 1FSHA 3DP7A 2VUMG 3C18A 3K9TA 4HF1A 1OCOH 1FX7A 5CPRB 5HLGA 1J5EH 2JA7A 3L2WA 3ECOA 4YFKF 5C5JA 5EWEA 2AQEA 3HOSA 1Q1VA 1YE9A 1ETQA 2YS9A 4B3TH 3QRFF 3S3NA 1KU2A 2A3SA 2B0LA 3TDUC 3V42A 3F3XA 1K7AA 5KFVA 3ABKH 1HW5A 3KEYA 5HBRB 2YU9A 4G3IA 4XRFA 1SD7A 4NC8A 1S7OA 1XX5A 3C3WA 3RTXA 2R7NA 4EJVA 2HJWA 4XX0B 5L1LA 1D8JA 4G6TB 4A3LG 1YJWI 4DL5A 3RKYA 3N40P 4LFCH 5CB4F 4F7ZA 2HKXA 3DEUA 2XF6A 3F23A 3WTWC 1FYKA 2ZCWA 4WCGA 1S7EA 2G9WA 5D4SA 3T5KA 2KKOA 3CMMA 1R58A 4FETA 1DGSA 5KFRA 2VA3A 2JA6G 2WWYA 2VODA 1U8BA 3LAJA 1MBEA 3R5HA 5KFSA 1UC9A 2O8KA 5L3GA 5LMNH 1GGOA 5KG6A 4DYCA 5F9LA 4R8UB 3BTLA 4A3EJ 2DCEA 2DWCA 1HC8A 2VIXA 3C2HA 1LDJA 2QKLB 2X6XA 4XLEA 1KJIA 2VT3A 4JI4H 3PUBA 5E3MA 2F4MB 4XLFA 1ACIA 4D9JA 1H9TA 5CLSA 3AG3H 2YRWA 1WSCA 3R23A 4AIDA 4XRMA 2VUMA 1N78A 4E7HA 1N25A 2ZO4A 2FMLA 1SMTA 2Q2EA 5HLTA 3IAM2 2PBIA 3M9AA 1ZR4A 4LOCA 1DV1A 4IRCA 2E5ZA 3CZ6A 2DDBA 4YR2A 3RDIA 2XGXA 4Y7NJ 4MA0A 1P4XA 5D5UB 4KT5C 3I56I 2V1UA 1JHFA 3H9JA 4KFCA 3K5IA 2MGQA 2UUAH 3ZQLA 4MFEA 3PW7A 4ECYA 2PJRA 3ETJA 3AG2H 4LK1F 2FRHA 2QSFX 2JN6A 4JBAA 1GT0C 1OCTC 2O6GE 2CKZB 5BPFA 3RKXA 4IRHA 1RR8C 4HSRA 2E7XA 2C2EA 2HQNA 2OZUA 3OIOA 5FPOA 2ZMEB 2I87A 3RKWA 2EB7A 3J81W 4XLAA 3JRHA 1VAJA 3K1NA 5LA6F 3ULQB 1IBMH 5K2MA 4M7EA 3WU1B 1Y1VG 2AHQA 3MR5A 1Z7UA 3RV4A 3I4MJ 2DMUA 2O03A 3RIRA 2L9VA 4O3MA 4ECZA 3I4PA 2VQHA 2XSJC 3OYHA 3S8PA 4Z2YA 1DU0A 1W7PB 2FBHA 4IRKA 2JVGA 1ZRFA 4U0YA 3BDDA 4ZZLA 2FP4B 1H9GA 5CVVA 4X65H 1YYVA 2DA6A 3QZ8A 1F5TA 5CVUA 2J6TA 1WGXA 2CO5A 3MWDA 5M3FJ 4G7HF 2V4RA 2COMA 2GXBA 2I5UA 2ZJRF 2UVVA 3IH2A 2O7OA 4G12A 2ATLA 5KFMA 3H5RA 3TO6A 3ZMTA 4MA5A 5DDGA 3H3VK 4ED0A 2DDAA 1XNQH 4A93G 3EUKL 2OUMA 4DR7H 2V1DA 3G6XA 1J0RA 3F9KA 2ME0A 4E7LA 2JT1A 3S15J 2MBFA 4LLGF 1W93A 5KG3A 5CQEA 1RNLA 1MD0A 4C5AA 2AS5F 2R7UA 3MZ8A 4GYIA 1C30A 1S03G 2O8XA 4PK4A 4AVZA 3OOUA 5KHDA 2E2IJ 3ASNH 4CC5A 3CD6I 1Y1VA 4UV9A 1ULYA 2X9DA 4D5FA 2K27A 2V9VA 3CCUI 4KNYA 3Q9VA 4GDFA 3WTZA 5GAGJ 1U6GA 3LSIA 3GZ5A 3M1CA 1ZETA 1W1WE 4HV5A 2CW7A 3V7CA 4U7DA 1K79A 4UCTA 3DU5A 3E6CC 4LG0A 2X1CA 4HLXA 3LA2A 2P4WA 5D1OA 3CO7C 1EA3A 4B43A 1R00A 3GX4X 1RUNA 4MV4A 3RFCA 3FXUA 3GBGA 3H35A 1NK2P 2IT0A 1H89C 2EIMH 3DLAA 4O3OA 4U7CA 2WV0A 2LD5A 4ENMA 1A5JA 3L9FA 1IN7A 1P4WA 1W5TA 2DA3A 2R7LA 3JAMZ 5KG2A 2NUAB 2L7KA 3TIIA 5K7ZA 4Y8VB 3BC8A 1SFEA 1RRJA 4B3AA 1HCRA 5C3EG 4ZOLF 2R93A 4IEJA 2HTJA 3GVAA 3HBLA 3PM1A 2ZJ2A 5GTIC 5GTHC 1T39A 2ADUA 3OYNA 2FU4A 2OTJI 4DV0H 2F48A 1M0WA 3GIQA 1G3WA 5FLXZ 2FOWA 5J47A 5BMZA 1JUSA 3CQZA 3G1LA 1LDDA 4HW0A 4DR4H 2F5VA 4A3GG 2AU0A 4QIWA 1ZTRA 4ECWA 2K3FA 2A68F 2VL8A 3GLLA 2YUSA 2EZHA 1HXDA 4B3SH 1OISA 2UXNA 4B47A 4RAYA 3V4GA 1AHDP 3H3VH 2LY9A 2DU9A 4DV7H 4RZQA 3OL4A 2UUBH 5DCFA 3CUOA 4A3DJ 3EQLF 1LFPA 4IWXA 4A3MJ 3SZGA 4MQVA 1FMVA 3BG3A 1WRJA 4RDUA 1CQIB 3GTJJ 2R84A 5KFDA 3KALA 3FBNB 3FIWA 1PK8A 1FBUA 4EM0B 2FJZA 4LIVA 5T14A 2EZLA 3D5SC 1XMKA 4MNUA 3DU6A 2E35A 1SVLA 3HC7A 3NAUA 2R0QC 2IA2A 4DJAA 4JI8H 1NK3P 3FM3A 3IN5A 4B3RH 1B59A 4RGSA 2QVOA 2ZFUA 1K78A 4LLLA 5IP7J 4APMA 2DXIA 3GTLJ 4NHJA 4RZRA 3TKYA 2Y9YA 3HOXG 1USTA 1A04A 1T33A 3JRGA 2R7SA 4O3PA 2Y0MA 3GO5A 1R36A 1PP8F 1EV7A 2EBIA 4HEA2 4YAJB 4MQ9F 2ETHA 3A01B 1JTYA 2R5ZB 3QPSA 2BGCA 2M1BA 1WI3A 1BJTA 4Q45A 2R82A 2R85A 1U9OA 1ZLJA 2JEJA 1MNDA 4H0EA 2DPIA 2RAEA 3PN1A 2FXAA 3CCVI 1LFUP 1VQKI 2ESHA 2R6FA 2VXDA 1IJWC 1VBHA 4DL2A 4N0BA 4B44A 1MJAA 1OYIA 2PMHA 3EETA 2CQNA 2GLOA 1ZQ7A 1GSHA 1FOKA 3QAHA 1XPXA 4J19A 1W7PD 2AQ4A 3ZMVA 3KTMA 5KFHA 5D1PA 5EG0A 2W7NA 5JVGF 4GKJH 2CQQA 4LF6H 5D6FA 2HPMA 1BW5A 4DR6H 3R0AA 1P7IA 4UFZA 3N97A 3M8JA 2JA6J 4YB8B 1M0TA 2W8KA 2KIFA 4Q48A 4I7HA 3D0SA 4PWQA 2V4QA 2IJLA 5HDNA 3RZDJ 3F22A 2J9GA 4KHPH 4QWAA 4CDGA 3RI4A 1HSTA 4OIQF 2TCTA 3PSIA 4XN3A 5J40A 2H27A 2O9LA 1ZRDA 1TQPA 2JJ7A 2X85A 1FZPB 2RDJA 4ESBA 4AVPA 3KAKA 2QK4A 5KFTA 1MMDA 4ENNA 1WJBA 1VQLI 2DA4A 2XAGA 1EUDB 4QPQA 1K1SA 1YIOA 3OMYA 3OOPA 3OYDA 3I3LA 3CCJI 4A3CG 2CW0F 2VQDA 3TW7A 2OD5A 5KFYA 4IL6C 4IRDA 4NLGA 4F4ZA 2F5EA 1KJ9A 1I5ZA 3CP8A 4YEJA 3A4CA 1KGSA 2BY3A 2E2HJ 4QWCA 2HVQA 3TMOA 5KVRA 1OCCH 1QA6A 4LG3A 5LGUA 3HEFA 1CQTA 2NVYA 4DUYH 1MW7A 4LH7A 2PMZA 3SE7A 2STWA 2H1LA 2L54A 4E7KA 3O2PE 1JI8A 2HEOA 2XB0X 1FIAA 3DWLE 1S0OA 1TBXA 3HJEA 2JEGA 5IWAH
chains in the Genus database with same CATH topology
2P5VA 2FMYA 2VE9A 5ICGA 1RI7A 5H6RA 4P9FA 4TV7A 1T6SA 3CVZA 2CW8A 5CJ9A 2GA1A 3FF5A 3GLXA 1LQ1A 2RKHA 2UXXA 4UXNA 3RYPA 4UCVA 2CYYA 1YW8A 2GXGA 2JTVA 1ZRCA 5LL6b 1IN6A 1B1BA 1U3EM 4JQFA 4BWSC 1SD6A 1BI1A 5K5RA 4G9YA 2YX4A 3DQVC 1D3YA 4A5NA 3L4KA 1T2KA 1HNXH 1XGSA 3RGXA 3T8TA 4AD9A 1Z2PX 1TLHB 2H94A 2RN7A 4R79A 1SAXA 2L4MA 3QPHA 2F5CA 2K86A 4PCQA 4U0VA 5TRDA 3M7GA 1S68A 4KIBA 1YS7A 2W57A 1UHMA 3CDHA 1BM9A 1DPRA 4NXNH 3F6OA 1ZG5A 1TQIA 4OOIA 2PLYA 4EJUA 4LH6A 2XKPA 3I0TA 2M5WA 1UHWA 4BAYA 3KXYT 2YCHA 5IT9K 3J80W 4HYEA 4U0WA 1I1GA 5FPRA 1I6XA 1I27A 3PFIA 3VOEA 1QO0D 4YG2F 4EEQA 1W4MA 1HW2A 4WX9A 2K4JA 4LK0F 5DYMA 4G6QA 1P92A 2QYOA 2A6HF 4NXMH 5AIPA 5JVTA 1SMYF 4LF9H 2OBPA 2EV6A 5D6EA 3C0FB 3EYYA 3LA3A 2OWOA 2QBYA 5DCMB 3IRQA 3ZMZA 1YLFA 3MCZA 3KAJA 3NRVA 2VPSA 5ERIA 1WKMA 1Z6RA 1FC3A 2XRNA 3V7SA 1XN7A 3KETA 1LDKB 4CYDA 4M71A 4KIGA 4JI1H 5HDKA 3R0JA 4N9HA 1HBXG 4HAMA 4HV6A 2H09A 1FVIA 1FPQA 1HW1A 5JHUA 1R1TA 4HZFA 1JE8A 1ON2A 5A2QW 4L5JA 1PUEE 2BV6A 3M8FA 4YHHH 4UHTA 3LA7A 5EEGA 1SEIA 2IP2A 3RJ0A 4HOBA 3P9IA 5L3FA 3EYIA 2O3FA 3KP5A 4HQMA 1XDSA 1KU3A 2FA5A 3TDZC 4N9IA 1J9IA 5HS8A 5IT9W 3C1DA 1IXRC 4RGUA 3WGGA 3F8CA 1JHHA 1FBSA 3HRTA 2STTA 1IRGA 2PN6A 4IF4A 3FMSA 3U1DA 2NNYA 1FYMA 4HBLA 1I94H 2L02A 1U5TA 3ZMUA 1C0WA 3KP2A 4ETSA 1BI3A 1OPCA 1YW7A 1I1SA 2IA1A 3E5XA 1N32H 4OX9H 2VBXA 5CVIA 2NS0A 4RB3C 3VEPA 1XCVA 5HDGA 5HLHA 4I2OA 1XMQH 4I98B 2M45A 1R1UA 2Q2TA 1O3QA 4ZYEA 1SFXA 3ZPLA 3H3ZA 3I5UA 4JV5H 3BROA 4BXUA 3N4MA 4OU0A 4RB1A 4ZYHA 3IKTA 4DV1H 5F64A 3I54A 1V9PA 1QZYA 4M6XA 4S05A 3WTXC 1XNRH 1BIAA 5D8LB 5FO5A 5J8CA 2A6EF 2HS5A 5L3DA 2ZJTA 3JSNA 4Q47A 4KA4A 2CQKA 2VT2A 4A0ZA 2UXCH 3MQ0A 4UCSA 2ZXJA 4EJWA 5L3BA 2HQRA 4JI0H 3R6SA 3DPLC 5E1XA 4PDBA 3GFLA 2RNJA 3HYIA 2KRFA 2VQEH 4D0PA 2IRFG 1F1ZA 2VC0A 4A5MA 4MTEA 2ZNYA 1S7AA 1S3JA 1Z05A 4AWXB 4G7OF 2IW5A 5F1RA 2IA0A 1ZH5A 3BOQA 3WGHA 4HDUA 1HR0H 1XB4A 3RF2A 4ZH4F 1W7PA 4GO1A 2NAZA 3HSEA 3JAMK 4ON0A 2BE5F 3W6JB 3KZYA 1YW9A 2K7LA 4X62H 3E5UA 1HKQA 4MEXF 1LVAA 1ZAOA 2XHKA 3V8KA 1LEBA 1RZ4A 1WH2A 3REOA 5LRSA 3FMQA 4I09A 4FM9A 3QU6A 3S2WA 3LQRA 1VTNC 1ZG1A 4L18B 2W24A 3ABTA 2K4BA 1IUYA 3J81Z 3E5QA 3MEXA 3B02A 1G4DA 4BYYA 4ZZDA 1Z1DA 2XVCA 3UQ8A 5AIQA 2O61A 4RB2C 4Y15A 2XV4S 1H0MA 4A0YA 3G73A 2UXDH 1G3TA 1ZHFA 4LB6B 5D8KB 2WYOA 1R7JA 2LF8A 2FF4A 4M9XA 2KJCA 4WXHA 1XSDA 4PZJA 5CVRA 4HF0A 2DT5A 3J7AO 2F2EA 5JR3A 2MC3A 2PFBA 2XAQA 2O0YA 2EFNA 4YY3H 2PMUA 1PDNC 2OQGA 2EFQA 2QQBA 1IXSB 4JI3H 4P9UA 5ED4A 3TO7A 4EGZA 1MZBA 2PG4A 4GYGA 3MWMA 4DR2H 3ELKA 3K0LA 3JAMW 1XGMA 4Q0YA 5ICCA 2ACJA 3MAJA 1D5VA 1ONVA 4DV4H 4NB5A 4EVIA 1OYYA 4EFEA 4MEYF 2HGCA 5FGMA 2RV8A 1E4GT 1BI0A 2A07F 1TW3A 4DV2H 4M9SA 1V4RA 3CO6C 3KP7A 1B4AA 4P96A 4LJZF 1TQMA 3I53A 4RGXA 2H6CA 5HLIA 4LG0B 4A2AA 4IPAA 4U88A 4A6DA 3PQJA 2J5OA 3DXJF 3MZYA 3HHHA 1O75A 3KEOA 3KP4A 3HSFA 4EQQA 2DFIA 4YFXF 1ZHSA 4LFBH 2F4VH 1R22A 4EJTA 1ZN2A 4M73A 4M9ZA 1XGOA 2CWEA 2JSCA 3B73A 2EV0A 1A0IA 3FXQA 1FKAH 2VQFH 1LB2A 2BBYA 2M87A 3F8NA 1MDMB 2HYGD 4XLNF 4K2EA 3QPTA 2DQRA 2UXBH 4YFNF 1TAEA 5ICEA 4B3MH 1Z6TA 1L0OC 2KSWA 1J2XA 3H92A 3LWFA 3O6BB 1N34H 1NHAA 5ILUA 1BC7C 4FHTA 1B9NA 3K2ZA 2V1XA 3BWGA 4IVNA 1HNZH 4CC6A 4B8XA 2GQQA 2OQRA 1KA8A 1UB9A 2Y48A 3ML6A 3CTAA 1SD5A 3MZHA 2G7HA 3TOAA 2PJPA 2LSOA 1GYFA 1MGTA 2E5LH 2WC2A 5H6QA 4EM1A 2QM3A 3CJNA 2L3DA 2GA2A 2XAFA 3DPTA 1TA8A 2EA2A 3TQNA 1F4KA 3KP6A 1MKMA 1Z91A 3BJOA 4CGZA 3F21A 4FX0A 2X0LA 4OIRF 1IW7F 3LAPA 1TNSA 1QGPA 2VOOA 1BOAA 1HKTA 2UWMA 4DR3H 4ASNA 4BHPA 3COAC 5FFZA 1B04A 2QZ8A 3T1HH 1FYLA 2ZBKA 4IHTA 5FFXA 3ZN1A 3H3UA 1P6RA 2FNAA 3F6VA 3GEZA 4PDKA 2HHHH 3JSLA 4RGRA 3QP5A 5AONA 2JRTA 2LKPA 3I71A 3FM5A 5IT3A 4S04A 4MV7A 1LJ9A 3SZTA 1J7KA 1OMIA 3BP8A 5DD4A 1XD7A 1J75A 3ZMSA 2M30A 4CO8A 1FLIA 5DCMA 2MD5A 5D5XB 4G94A 4EV0A 1PP7U 4R7RA 3GF2A 1AN7A 1BC8C 3LFKA 4HX7A 1GXPA 3EDPA 4FT8A 1YO5C 3J80Z 4P5OA 3SXYA 3SZPA 1Z2OX 4EMSA 2DLLA 4RAZA 4HDVA 4Q4ZF 1B6AA 2WDTA 3WG9A 4FX4A 2F5DA 4BHCA 4XSZF 2X4HA 3L09A 1T38A 3IC7A 2QQAA 2RGRA 5K5OA 5K5QA 5DEQA 2IVMA 3F72A 1UFMA 1MJBA 4GGGA 1ZARA 3N44B 3DFGA 3E6BA 2PEXA 1Z2NX 2MH9A 3K3VA 4QWQA 4O5VA 2CGPA 1YQAA 3GZ6A 4BHBA 4HQEA 2DO7A 1REPC 3BJAA 1O7LA 3WU0A 4EFBA 1IN5A 4KMUX 5E18F 4NQWA 3N41B 2VONA 4EGYA 4PGHA 3TGNA 3FWEA 3T0YA 3L7WA 3FXRA 1L3LA 2NRAC 1TTYA 2FSWA 1HSJA 2HVSA 4EJOA 1ZHQA 5E1WA 4UV8A 3V8JA 3RJPA 4JK1X 1V3FA 1QNTA 3BABA 5ILSA 5D4RA 5A2QZ 4GKKH 4KN4X 1S6LA 1U8RA 3HTUA 1KYWA 2EJRA 2FE3A 3JTGA 4UVAA 5BPDA 3GWZA 3DKWA 1BN5A 2YR2A 1HQCA 3BY6A 2QUFA 5IT9Z 1G3YA 1GVJA 4I0AA 1ODDA 1DUXC 4MHGA 4M74A 3FHZA 5JI6A 3RTRA 2Z5UA 5DV5A 2YX7A 5LGTA 3I59B 1EH7A 3CUQC 2HVRA 2YPRA 2QENA 1XDUA 2LF7A 1XMAA 1AOYA 2VOPA 1N36H 1N33H 3DV8A 1SFUA 1FY7A 2DBBA 2PQ8A 2DAOA 1I6UA 3G3ZA 3P9CA 1S8NA 2ZFWA 4A6EA 4BH9A 2GIVA 4LSXA 4IJAA 1QZZA 4R1HA 3NQOA 3HRMA 4MV9A 3LMLA 1YFHA 4UCOA 4HX8A 4I0BA 3J81K 5LEJA 2VBWA 3RYRA 1XSXA 4YIIA 2Z33A 3BAAA 2Z3YA 3KZZA 3F8BA 3RPUA 1CF7B 3WTVC 4XSXF 3M4IA 3SFZA 4LF7H 3R4KA 2R7FA 3IRRA 1RIOH 4LB5A 1SD4A 2OA4A 1BBYA 1XGNA 1HNWH 4UVCA 4AIKA 1ON1A 5LHIA 1FP1D 4IAJA 1WSUA 6PAXA 3RGZA 2ZMEA 3ZMDA 5KK1A 4G6DA 2DI3A 2XKOA 2Q0OA 4GLXA 4OMZA 4E70A 1XSVA 2EFOA 1WQ2A 3H20A 3J7AK 2BYVE 2XAHA 3ROUA 2P6TA 2IPQX 3HSRA 4I02A 2DPUA 4DV5H 2L4AA 2F5FA 2DK8A 3FMAA 5CYVA 4QLCU 3CUQB 1YG2A 5F6FA 2JZYA 2FEZA 5DUIA 2DTRA 5HS9A 2OU2A 4MGRA 4HF2A 4UCRA 1IAWA 4L0YB 1FNNA 2VBZA 3MFKA 5FLXK 1T0FA 2HKOA 3IG0A 2CSOA 3FMRA 3JTHA 4CXFA 4LF8H 1BI2A 2A69F 3VFZA 2VUGA 4KICA 1J5YA 3K69A 2VC1A 3WE2A 4L9VA 2D1HA 1XCBA 2NNNA 1STZA 2XROA 3HTSB 2ELHA 4IHSA 2YSRA 1L2ZA 3BA8A 2VE8A 3JSPA 4DV6H 2ZM6H 3QU3A 1IZ1A 5FD6A 4WK8F 3R61A 5DUKA 3CLOA 4XBFA 5TJJA 2HYFA 1ZREA 1FWZA 1U78A 1ZG3A 5L3EA 2P6SA 1KQ9A 5LRRA 4IXAA 2GZWA 5EOYA 3HOTA 1W5SA 5LBQA 5D5WB 4AQYH 2DW4A 2NYXA 2GAUA 4BQAA 2R7DA 3WTSC 3ERED 1ZGAA 2W84A 3K1MA 3E6MA 5BPIA 3E97A 3WTYC 4I01A 2J5PA 3F8MA 1BIBA 4OINF 5BR8H 4AIHA 1O3SA 3EUHA 5FB2A 2OAZA 3WGIA 3WE3A 1U2WA 3M1EA 4U7BA 4G7ZF 3ISPA 3VB2A 4A2BA 2VOBA 4G8XA 4KN7X 1F9NA 2C6YA 2QQ9A 5E8IA 3FX3A 2RQPA 2PI0A 4RS8A 2QLZA 3SHFA 5FLXW 5FD5A 4BNCA 1HKSA 3ZN0A 3WTUC 4CZZA 4X64H 3W6KB 1QBJA 1QPMA 5K1YA