3MWMA

Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
GRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal uptake regulation protein
publication title Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 42
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mwmA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3mwmA02
1YW8A 5L3BA 5HVQC 4OIRF 1XGSA 4G8XA 5CVIA 2DW4A 4CICA 5J8CA 2FSWA 4YIFA 3GWZA 5KVRA 1SD7A 4EJVA 3IL2A 4HBLA 2EA4A 3GW2A 5L3DA 5BPDA 1W7PA 3EYIA 2AXLA 1R22A 4M72A 5ERIA 4BH9A 4LB5A 4BQAA 4K2EA 3NRVA 4L9TA 2EFNA 3QP5A 4MTEA 3KZYA 1LEAA 2Q0OA 3U2RA 2ETHA 2STTA 1DUXC 4LFUA 1ZGAA 1FX7A 3B02A 2GXGA 4HX4A 2CG4A 3I71A 5DDGA 4G7HF 3I59B 1TNSA 1W5TA 2FE3A 4Q47A 3BP8A 1H0MA 3NQOA 3MAJA 3R6SA 2FNPA 3MQ0A 4HF0A 5HDGA 4ZZLA 5D5UB 1XSDA 3W6JB 2QVOA 1KGSA 4HOBA 2RQPA 4I0AA 4PDKA 2VC1A 3LFKA 2XV4S 4ASNA 3LQQA 1UB9A 2JT1A 1R00A 1ZARA 3BPXA 2KJBA 4XLPF 2FOKA 5HS7A 4XLNF 1U3EM 3LWFA 2H09A 1FSHA 5BQTA 4M9SA 2QLZA 4ENKA 3TO6A 3ZMDA 2HTJA 3QAHA 2EB7A 4N0BA 1IRFA 2V79A 5JI6A 1F4KA 4G7OF 3F8FA 4FHTA 5DV5A 1RUOA 1O7LA 3GUDA 2QWWA 2FRHA 4LGWA 2B0LA 4YFNF 2FMYA 1IN5A 1YLFA 4PGGA 1O3TA 1BJAA 3D0SA 2D45A 2V1UA 4UHTA 1MJ9A 1KQ9A 2MH9A 2RVCA 1K78A 1O3SA 5ILUA 3K69A 1XSVA 2IW5A 3E3VA 2WTEA 3TGNA 3IC7A 2HYGD 1D8JA 4L5IA 1Z1DA 4A0XA 3VB2A 2KJCA 2ZKZA 2M87A 2CWEA 4GCVA 4OINF 3KEQA 4M71A 5D4RA 2O8XA 3RYPA 4MTDA 5FLXK 2K27A 3MCZA 1O3RA 3V8KA 1OPCA 4MGRA 1TQPA 2EV5A 5LHHA 5IT9K 3QRFF 2M30A 3WODF 1QPMA 1TNTA 2P8TA 4L0YB 4ENNA 3GO5A 3S2WA 1ULYA 3I0TA 1RNLA 5FD5A 1DP7P 3KCCA 3P9IA 1ODDA 1XGNA 1WI9A 4BHCA 3I4PA 5CVVA 1U5TB 3KLOA 1UFMA 2UXXA 3GZ6A 3F8BA 1OYWA 4UV8A 4OOIA 4S05A 5FLXZ 3JSPA 1IN8A 1HKTA 1LDJA 4PZJA 5AIQA 4LK0F 2A68F 3V8JA 1IAWA 4P9FA 5IT9Z 1W4MA 2CGPA 4CZZA 3DPTA 3HRUA 4LD5A 3CJNA 4I09A 1S6LA 3O6BB 1JGSA 1TQMA 1HKQA 3G73A 1K6OA 4LLNA 2HTSA 4ESBA 1ON2A 3LAPA 2W24A 5LLQA 3TOBA 5A2QK 1B4AA 1Z6TA 2IJLA 4G7ZF 4BNCA 2HGCA 3K2ZA 1IF1A 4O5VA 4UVCA 2M1BA 1JE8A 2A6HF 4EJTA 2MLKA 2VOPA 4WF2A 5FO5A 3RJPA 4HQEA 2GA1A 3WTSC 3BWGA 2L4MA 3U9GA 1KQ8A 1LVAA 4QLCU 2YSRA 3NEUA 2H6CA 4IRGA 2HKXA 1MDMA 4RGXA 3O3KA 2JTVA 3E6BA 4O6JA 2R7DA 3EUHA 1S7OA 4EV0A 3L00A 3J81K 1SFUA 3K9TA 1IW7F 2M8EA 2XAHA 2OZ6A 2P4WA 2IA1A 1PUEE 2EK5A 4HQMA 5JFRA 4P55A 1SMYF 4IRHA 1I6XA 5L3EA 5DEQA 2NNYA 1YO5C 1UHMA 5DYMA 4EJWA 2EWNA 2P6SA 1XN7A 4Q48A 1ZRFA 3J81Z 4Y17A 5CVJA 2L3DA 1ZLKA 4I98B 3BJ6A 3JAMK 1KYZA 3GF2A 4ETSA 2RNJA 3PFIA 1YW7A 4NB5A 3ZQ7A 2OA4A 1G6NA 1Z6RA 2IPQX 2HQRA 2LF8A 4KA4A 3LSTA 4RB0A 2P7CB 1EH8A 4D0PA 1D5VA 1Z05A 2VBYA 4WXCA 4XRFA 3KLNA 1Z91A 4Q5SF 2O03A 2PEXA 3I64A 2JRTA 2IP2A 1SD6A 3LA2A 1REPC 1TW3A 3E5QA 5FFZA 1LQ1A 1ZN2A 1FP2A 4A6DA 2YU3A 3TDZC 4YFKF 2DQLA 2CYYA 4LMYA 5BPIA 1MJBA 5J6XA 1XCBA 5L3CA 4UVBA 3ELKA 5AIPA 2R7FA 5E20A 1ZH5A 1U2WA 2DPUA 1MJAA 3SQNA 3L2CA 4CHUA 1FYKA 2QQ9A 5F6FA 2VT3A 4R79A 2DAOA 1XMKA 3CUQB 3LQRA 3GFIA 3CO7C 1VTNC 3I58A 3T1BA 4RGRA 2GAUA 1ZAOA 4L9VA 2A69F 4HV5A 2VODA 3DXJF 2EFQA 2FQ3A 3KP3A 1J0RA 1YS7A 5DCMB 4B8XA 1LEBA 1YYVA 1YIOA 1WSUA 4ENMA 1ZG3A 4OIQF 1W5SA 5E1ZB 1OYYA 3WGGA 1FSEA 2QYOA 1HSTA 5FGMA 1QZZA 1DPUA 1V4RA 3HUGA 5E18F 3QP6A 3R0JA 3FM5A 4M73A 2QBYA 4HYEA 2DPDA 1SD4A 1FY7A 1H9GA 2ZXJA 4O3MA 1BC8C 1W7PD 2XAGA 2D1VA 3OV8A 5LBQA 3VODA 1K79A 1FWZA 1SD5A 3DQVC 1ZYRF 1XCVA 2VT2A 3T8TA 2UZKA 4I7HA 2M5WA 5E1XA 5LEJA 1S7AA 1ZRDA 2DQRA 2ZJ2A 3KP6A 4KNYA 2D2WA 1RUNA 3E6DA 3COAC 2ZMEA 3C7JA 2ELHA 5CJ9A 3GEZA 1CF7B 1JXSA 2LDUA 5D5WB 1U6GA 2F5FA 4GYIA 2VBZA 2RKHA 5DD4A 1Z7UA 5K1YA 4KICA 1FPQA 2XASA 2LNBA 2ACJA 1WRJA 1ZGJA 1PP8F 4AWXB 3FZVA 1OKRA 2PI0A 3T5XA 3QPTA 4I01A 4GGGA 4HZFA 3T0YA 3GYHX 3H92A 4KIBA 2GXBA 1HW1A 4LG0A 4LJZF 3F72A 3R4KA 1FNNA 1H9TA 2COMA 4LLGF 1XD7A 3MZHA 5E17F 2L02A 2XIGA 4RB3C 1IN4A 4M9ZA 2O6GE 2R3SA 3WU1B 4G6DA 4RAZA 4S04A 4EGYA 2W84A 1I1SA 3IKVA 2ISYA 3DV8A 3F6VA 1YQAA 2ZNZA 3O2PE 3WTXC 1IXRC 2HEOA 2VOOA 5LHIA 3QU3A 4G6QA 1OMIA 1OR7A 1P4AA 4M74A 4YFXF 1FC3A 5E8IA 1B1BA 3HHGA 2MLGA 1WWXA 2GQQA 3KP5A 2P7VB 3K1MA 4MEYF 4IVNA 2WV0A 6PAXA 5KK1A 1J59A 4Z2YA 3J80K 4L5JA 3AAFA 2FMLA 1GXQA 1KQ0A 2IA2A 3MWMA 2BE5F 5DUKA 1XSXA 3EYYA 2ESNA 4HAMA 3WTZA 5FB2A 3K0LA 3BOQA 1SAXA 2FNAA 2RC4A 3FWEA 1WKMA 3BPVA 4HDVA 4ON0A 4G9YA 1D3YA 3WG9A 2OQRA 3F3XA 2TDXA 2JPBA 2W85A 4G94A 3J80Z 2KIUA 2JSCA 3ZMZA 4BYYA 1BOAA 2GWRA 2YR2A 5HDNA 5TJJA 4IHTA 4XBFA 3WU0A 1W7PB 5HLIA 5F1RA 1PDNC 2IRFG 1T6SA 1QBJA 2VE9A 3IRQA 3GLXA 1BI0A 4OMYA 2KKOA 1AOYA 2XKOA 1P4WA 2PG4A 1YS6A 2H94A 1SMTA 2BGCA 1KU9A 1R1TA 4L9JA 4P5OA 3G3ZA 4EJUA 2XRNA 1R7JA 4XSZF 1S8NA 2EJRA 4ZYEA 5DUIA 3RKYA 1LNWA 3DFGA 4QWQA 3RPUA 4HF2A 2XUBA 5D6FA 2VE8A 1T0FA 2QUFA 4UV9A 1KA8A 3HYIA 4GO1A 1IXCA 2Z5UA 3DEUA 2BBYA 2P5KA 1HW5A 3HOSA 1F9NA 3L9FA 4A2UA 2NRAC 3JW4A 1USSA 2NS0A 3LAJA 4HV6A 4ZZDA 3SZPA 2QM3A 5EEHA 3TOAA 5K5QA 1BBYA 1I1GA 1TW2A 3F21A 1WQ2A 1SFXA 3RKXA 1HW2A 1L3LA 2J5OA 2DTRA 5ICFA 4ENJA 1J7KA 2BYVE 4A12A 2V1XA 1O57A 1P2FA 2VONA 4I02A 1I27A 4M6YA 1K78B 2FA5A 2RGVA 4IRIA 2CFXA 5D4SA 2GIVA 2HFHA 3F8MA 5LRSA 2FXAA 3BY6A 1KYWA 3WE2A 1S3JA 1GVJA 4HW0A 2FEZA 4A0YA 4LB6B 4AIKA 3WTTC 5HS8A 4WX9A 1ZG5A 2DU9A 3BJOA 5LRRA 3F8CA 4UVAA 1O3QA 4A0ZA 1FT9A 5F64A 1BI1A 3GFJA 2Z3YA 4ZH4F 2XHKA 4JBAA 1SFEA 3CTAA 2K4BA 2IVMA 4M9XA 4EMSA 2PJPA 4LK1F 2ZCWA 2RDPA 2OQGA 1BN5A 4OIOF 2OD5A 3HSFA 3M8EA 4HDUA 2PMHA 3KE2A 1Z9CA 3RIRA 4GYGA 2OU2A 4OMZA 3ECOA 2MH2A 2F5CA 3KEOA 3P7NA 4IJAA 3RI4A 3FF5A 5JR3A 2QQAA 5AONA 2ZNYA 3HIFA 4ESJA 4FX0A 3ROUA 2VC0A 2XGXA 3JTGA 2PLYA 2DBBA 3R61A 1U78A 1TQIA 4EM1A 5E1WA 2BV6A 3E6CC 3K1NA 1HSJA 1CGPA 1LB2A 3I59A 3LA3A 4HX8A 2HS5A 2QZ8A 1ZRCA 5HOOA 4R1HA 5K5RA 2K4JA 3C3WA 3H3UA 3GVAA 2OZUA 2V1DA 3TKYA 2Y48A 2FU4A 1IN7A 3IKTA 4EGZA 5H6RA 3ZN1A 3R0AA 4Y13A 1E17A 2HKOA 5LGNA 4UXNA 4OIPF 3HOTA 3HTUA 2YX4A 5BMZA 4HX7A 2GA2A 1XGMA 3M7GA 2D1HA 3L09A 5J8FA 4WWCA 1MDMB 1FBSA 3ABUA 1RI7A 4U0WA 2E7XA 2HWVA 3GXOA 1Q1HA 1XGOA 1Y0UA 2Z9OA 1XDUA 1TBXA 2HDCA 2F5EA 2F5DA 2NAZA 3IWZA 2KIMA 4AIJA 3FM3A 3QPHA 1R23A 2HR3A 4DQ2A 2ISZA 4P9UA 1FYLA 5HLHA 4I0BA 1R5GA 1BIAA 3J7AO 3H3ZA 5JVTA 2H6BA 3CUQC 2E1NA 2JZYA 2XAFA 2EFWA 2E7WA 3V7CA 5FFXA 3FHZA 4L0ZB 2Y0MA 1G4DA 4DNCA 4IHSA 1TTYA 1BC7C 2O0YA 4KN7X 3FMQA 2VXZA 2UWMA 1LJ9A 3TO7A 1ON1A 2FF4A 2FBHA 4EQQA 4CGZA 1B9MA 1IUYA 1TLHB 3I53A 4RGSA 1J5YA 3RYRA 3HRMA 3TO9A 5LGTA 5CLSA 3HTSB 3C18A 3W6KB 4CDGA 3KP7A 4P96A 3R60A 3FMSA 1YW9A 3GFLA 5ILSA 2KRFA 2DLLA 4L9NA 2VBWA 3Q9SA 2J5PA 2Z33A 1E2XA 1U5TA 5TRDA 3E6MA 3RKWA 3CDHA 3SFZA 4BHPA 4CXFA 2HOEA 2YX7A 2A3SA 4HLXA 2LF7A 3VOEA 4N9HA 2UXNA 1EH7A 4YIIA 4KDPA 3WTUC 2HYFA 1NHAA 3ML6A 1IXSB 3MEXA 2QQBA 4CYDA 2K86A 4FX4A 3K1PA 5CVUA 4MHGA 4CO8A 1J9IA 1RZ4A 2XKPA 3M1EA 2PQ8A 3N4MA 1IZ1A 1ZG1A 2ADUA 3V4GA 4B09A 1BM9A 1BI2A 3E97A 4ZYDA 1L0OC 2L01A 1IN6A 4KMFA 2XAQA 5H20A 1G3YA 5BOXA 5E8GA 1R1VA 3GZ5A 2O61A 5LGUA 2V6CA 2BEOA 2NYXA 2P5VA 1FOKA 2XAJA 5L3GA 1B59A 2K7LA 1G3TA 2DK5A 4U0YA 3SZTA 4KIGA 1I5ZA 5D8KB 3HRSA 1O7FA 5BS6A 2ESHA 2LSOA 2STWA 1QO0D 2ZFWA 4RB2C 3N97A 1FYMA 2QBYB 4KIFA 1JHFA 1YTYA 3MZYA 3IRRA 4AVPA 2RN7A 2X4HA 4KYWA 1FZPB 4WXDA 1J75A 3ZPLA 5D5VB 1B9NA 3EQLF 3D5LA 3ZMUA 2OBPA 1DPRA 3DPLC 2W25A 4JK1X 5L3FA 1XDSA 3DP7A 1UCRA 4MQ9F 2CW0F 2W57A 2DFIA 5DD8A 5ICCA 2YPRA 5H6QA 2CO5A 2MC3A 4U88A 1HBXG 2NNNA 3ISPA 2E1CA 3LA7A 4RAYA 2A61A 4UNOA 1A04A 3FX3A 2ZMEB 4EM0B 2IT0A 2WC2A 4N9IA 1BIBA 1QQIA 4A6EA 3L7WA 2Y75A 1KU3A 2F2EA 4M6XA 3KZZA 2MBFA 1R1UA 1KU2A 2LKPA 3C1DA 5D6EA 4MEXF 1T38A 4E70A 2VBXA 2FBKA 5FD6A 4U7BA 1S29A 3IWFA 5CYVA 1ZLJA 4R8HA 3VFZA 4WXHA 2EV0A 5HDKA 3EDPA 3PQKA 3WE3A 2GZWA 4LG0B 3IHUA 3TDUC 5ED4A 4Q4ZF 3SXYA 4KUMA 4BXUA 5ICGA 1R36A 4A5MA 5CVRA 3FMRA 3KP4A 3P9KA 3RTRA 1LDDA 4BHBA 1FP1D 4U7DA 2ZO4A 1QNTA 1U5TC 3RPQA 3ZP5A 4OU0A 5IT3A 3FXQA 1YG2A 1ONVA 4ESFA 3BDDA 4KT5C 1HKSA 4GXOA 1R58A 3CUQA 1UHWA 2DO7A 3ZMTA 3BZ6A 4RB1A 2O3FA 1KU7A 1D8KA 1FBQA 3MFKA 5D5XB 3BJAA 1ZHFA 5ILVA 1MZBA 2PBIA 4UUVA 4HA8A 1STZA 1T98A 5A2QZ 2MA3A 1EV7A 3KP2A 3HHHA 2DT5A 5DCMA 4EJOA 1GHCA 3FXRA 4XSXF 4KN4X 2EFPA 2C6YA 1DDNA 3Q9VA 2RV8A 4HLYA 4NQWA 2OAZA 2P5LC 4PGHA 4IXAA 1U8RA 5JHUA 3I5UA 1USTA 2L54A 4ZYHA 2A07F 3E5XA 5HLGA 3V7RA 3E5UA 2P6TA 5DCFA 3U1DA 1AWCA 4L18B 1F1ZA 3ECHA 4WCGA 2MD5A 4NHJA 3DKWA 2AS5F 3F6OA 3CLOA 4MQVA 3GX4X 1OYIA 4RS8A 4EM2A 3KETA 1MD0A 2EA2A 4A5NA 5EEGA 2DI3A 3QOPA 3M8FA 2EFOA 2G7HA 2XROA 4EVIA 2L4AA 2X0LA 2A5YB 5D8LB 3ULQB 2KIFA 3REOA 1F5TA 2EV6A 3QU6A 3F23A 2HZTA 2FBIA 3CO6C 1CF7A 2Z99A 1P4XA 3T8RA 3V8LA 4WK8F 3HSRA 5ICEA 5LEKA 4HF1A 3JAMZ 1QGPA 2HQNA 4H0EA 3FXUA 1IRGA 3ZMVA 2XVCA 3F8NA 1GXPA 5LHGA 2CQKA 1QZYA 1FLIA 3PQJA 2PFBA 2IA0A 2Q2EA 1FBUA 2ZBKA 4AIHA 3WTYC 4AD9A 3ZN0A 2Q8KA 1LDKB 4Y15A 3WGHA 2PMUA 3I54A 4KMUX 2CSOA 1PP7U 1T39A 1P92A 3SHFA 2WWYA 1HQCA 2A6EF 3BROA 4IPAA 4YG2F 1J2XA 1ZREA 1JHHA 5HS9A 1K7AA 4IF4A 2JPCA 1R5HA 3HRTA 1XB4A 4LLLA 1B6AA 3V7SA 1MKMA 1G3SA 1MGTA 3B73A 1T2KA 1YFHA 2QENA 1HXDA 1RIOH 2V9VA 3WTVC 3HSEA 1X3UA 2K02A 3WTWC 3TQNA 2PN6A 3EETA 1V3FA 3RDIA 1XMAA 3DF8A 3GFMA 2M45A 4BAYA 3Q5FA 4JQFA 3JSOA 3ERED 4MNUA 2H27A 1BI3A 2VN2A 3M9AA 4I2OA 4ZYGA 4PCQA 3JTHA 2G9WA 3WGIA 3F22A 4RGUA 2G7UA 4TV7A 4KFCA 3VEPA 1C0WA 4F7ZA 3ABTA 2DK8A 3KFWX 1P6RA 5K5OA 3ZMSA 1G3WA 3CUOA 1EH6A 4U0VA 3P9CA 4FT8A 3OOPA
chains in the Genus database with same CATH superfamily
3OYAA 1TWFJ 1DV1A 2VOBA 1YW8A 1SAUA 5L3BA 3GTJA 5HVQC 2R7UA 4OIRF 3I12A 4DR2H 1XGSA 4DL4A 2X6WA 2X6XA 4DV4H 3H35A 4G8XA 5CVIA 2KDZA 4RUCA 2ELJA 4IRKA 2LREA 2DW4A 2EBIA 4XR6A 4CICA 5J8CA 2FSWA 4YIFA 2Y9ZA 1K83A 1W36D 1ETYA 3PW2A 2NU9B 1TT0A 5FLVA 3OIPA 2R5ZA 3GWZA 3VSLA 5EZYF 3RB0A 5HNFA 2R86A 3ORRA 3RB6A 5M3FJ 2FX0A 5KVRA 1TWAA 1GSHA 3GIPA 5F9LA 2JEIA 3OSGA 1SD7A 5IYZF 4EJVA 3IL2A 4HBLA 2W9BB 2ICWG 3G1LA 2VPSA 2EA4A 2YZGA 3GW2A 1GSOA 2E1OA 5L3DA 2GOMA 2JUCA 5BPDA 1RK6A 4DL3A 1W7PA 3GIMA 4A3JG 3EYIA 2V9WA 2AXLA 1FVIA 4XKCA 1R22A 2NXNB 4M72A 4M6VA 5F1JA 2VKDA 5D1PA 2R82A 3TP0A 2HQ5A 3OS0A 2A5WA 5ERIA 5EG0A 3EUHC 4QIWN 4BH9A 1CE8A 2I10A 5KFSA 4QWEA 2MSYA 1A6QA 2JA6J 3HGYA 1MW7A 2Z2SB 4LB5A 4DR4H 2X6YA 4BQAA 4O2AF 2LH9A 5C4XG 4K2EA 5BR8H 3NRVA 3LWBA 1SFKA 1X4PA 4L9TA 5KFGA 1L2ZA 2YS6A 4AM3A 2EFNA 3QP5A 4MTEA 1QZEA 5JLXA 3HOXJ 1V4YA 2M9HA 3N8DA 3HG9A 1GLNA 1WPKA 4IOCF 2L9RA 4UCRA 3KZYA 4UCSA 1WH5A 5KG1A 2XRLA 2DFHA 1LEAA 4II3A 3HOXG 2Q0OA 3U2RA 2ETHA 2YUSA 3QODA 2STTA 2RAEA 2B63J 3LSRA 4LFUA 1DUXC 1ZGAA 2ZFUA 1FX7A 3B02A 2GXGA 4HX4A 4B47A 1M0TA 4A2BA 2CG4A 3WU2C 3I71A 5KFTA 4DOZA 2CV0A 5J4YA 3G8CA 5KG4A 2UU9H 5DDGA 5FJ8G 2JA5G 4G7HF 3LSMA 3I59B 1TNSA 3BR1A 4EGJA 3WO0A 1W5TA 2FE3A 1ETXA 2WBMA 4Q47A 3BP8A 1JTXA 4FCYA 3OYEA 1H0MA 5DM6F 3NQOA 2W71A 2A6TA 3MAJA 4NC7A 3R6SA 1GSAA 3FBIB 3V6HA 2FNPA 3MQ0A 3OYFA 4B3MH 4IOAF 4HF0A 5HDGA 4NC8A 4ZZLA 5D5UB 1XSDA 2NVQJ 3W6JB 2QVOA 1KGSA 4HOBA 4ECVA 2RQPA 1OJLA 1VQ4I 4F93B 1WH7A 4I0AA 1B8IB 3DEWA 4PDKA 3KIOA 2CV2A 4B3SH 1LFPA 2VC1A 3LFKA 4BQQA 3RFCA 3KZIC 3PNYA 1JUSA 2YYAA 4DLKA 5DQIA 3Q8RB 3M9OB 4A3FJ 2MYSA 1Y1VA 5DGBA 4RU9A 5LMNH 1GUUA 2XV4S 4OWRB 1BW6A 2X9DA 3ZQHA 4MFDA 4NC6A 4ASNA 2R7XA 1J5EH 3LQQA 1UB9A 3HM5A 3EPZA 3ZQLA 2JT1A 1R00A 1ZARA 4A3FG 4CCOA 3BPXA 5E3NA 2KJBA 4XLPF 4ZQIA 3FKIG 2FOKA 1MBGA 1GVDA 5HS7A 4D7NA 4XLNF 1JXLA 1GT0C 4RM2A 1U3EM 1T33A 4RBOA 3GIJA 2WAQA 4QPOA 3V4SA 4FS2A 3LWFA 4FTHA 2F4MB 2H09A 1FSHA 4A2AA 5BQTA 4M9SA 2QLZA 2DODA 3TO6A 3ZMDA 4ENKA 1XS9A 4EEYA 4DR6H 2PBZA 1JGGA 2HTJA 3QAHA 2EB7A 3I4MJ 2ECBA 4N0BA 1VQMI 2VJ4A 3TP3A 1IRFA 2V79A 2Y0SA 3GTOJ 5JI6A 4JI0H 2R7VA 1F4KA 4G7OF 1X1BA 4AVZA 4R8UA 3F8FA 4FHTA 5DV5A 1RUOA 3I4MG 1YRNA 3V6JA 3LSJA 2WAFA 5IY5H 1A6IA 1O7LA 5KG5A 3GUDA 2QWWA 2FRHA 4LGWA 3OR2C 1ETOA 2B0LA 4YFNF 2FMYA 1APLC 1Z2PX 1IN5A 1YLFA 4PGGA 1O3TA 2V5AA 4JV1A 4XLFA 2MFZA 1VBGA 4XRSA 2R7MA 1BJAA 3HOZJ 3RTXA 1A5JA 4EYHB 2DYSH 3KYDB 3ETHA 3D0SA 2D45A 1X3WB 2V1UA 1TWHA 4UHTA 2AGPA 3M4IA 1MJ9A 5EWFA 1Y8RB 1KQ9A 2MH9A 1XTAA 4CA0A 2RVCA 1K78A 2R87A 3PFYA 2M34A 3S93A 5GAEJ 3N42B 3G1OA 1O3SA 1Y14B 2HVQA 5CQGA 5ILUA 4IHXA 3K69A 1XSVA 5FPRA 1W0UA 2IW5A 2VKEA 3E3VA 1V5EA 2WTEA 3TGNA 3IC7A 4JOMA 2HYGD 1D8JA 3CCUI 2RQQA 4L5IA 1Z1DA 4A0XA 5DGAA 2DFEA 3VB2A 3N44B 2KJCA 2ZKZA 3BZKA 1N56A 2V4RA 1M7JA 1WI3A 1IV6A 4JUZA 4BY7J 2M87A 3J7ZI 2CWEA 1Y39A 4GCVA 4M7EA 5A2QW 4OINF 1X58A 1X9NA 3KEQA 4M71A 4MFEA 5FKLA 5D4RA 2O8XA 3RYPA 3BQZA 1K6YA 4MTDA 5FLXK 1ZELA 2K27A 2W9CA 3MCZA 1U9OA 1O3RA 3K5HA 3V8KA 1SFOA 1SEIA 5B66C 1OPCA 4MGRA 3TIIA 5JVLA 4NBQA 1TQPA 2EV5A 4II2A 5LHHA 5IT9K 3QRFF 2M30A 4B3TH 1MSFC 3WODF 1QPMA 4YP3A 1BGWA 2YU9J 1TNTA 2P8TA 4L0YB 4ENNA 3GO5A 5B3SH 3QZ7A 5KG3A 1DGWY 3I9V2 4ZOLF 3S2WA 2R93A 2OC6A 1ULYA 3GTQJ 3I0TA 1RNLA 4XNFA 5FD5A 1DP7P 3KCCA 4LF5H 3P9IA 5JVDF 1ODDA 1XGNA 3OHBA 1WI9A 4ED0A 4BHCA 1R6RA 3NWSA 2MCTA 3I4PA 4DV1H 1VQ8I 5CVVA 1R71A 1XNQH 1U5TB 1EHIA 2FK1A 3LMLA 2RREA 3HZJA 3KLOA 4E7SA 3HOVJ 3OHAA 3MR2A 1UFMA 2UXXA 3GZ6A 5KAFC 3G6EI 3F8BA 4KISA 1OYWA 2W9AA 4UV8A 3S3NA 4F50A 2KZGA 2Q1ZB 4OOIA 4S05A 5FLXZ 3PR4A 3JSPA 1IN8A 1HKTA 1LDJA 3IH4A 3HKZE 2XC9A 4PZJA 3HOVG 5AIQA 3HPGA 2LY9A 3ZCOA 4LK0F 1VQ5I 2A68F 2FLNA 1RK5A 5KFVA 3V8JA 2W7OA 3T5LA 1DQUA 1JT0A 1IAWA 4P9FA 5IT9Z 1PK8A 3K4NA 2PN1A 1W4MA 1WVRA 5GPAA 1G59A 4QIWE 2E2IA 2HJWA 1OCZH 2X85A 3BLYA 1AU7A 2PVPA 2EIMH 4CZZA 4YIRX 2CGPA 3QZ8A 3DPTA 3HRUA 4LD5A 2K9NA 2W4SA 3CJNA 1I39A 2WB1N 4I09A 3VSKA 5L1KA 2NVYA 4NNJA 1BR4A 3CQZA 1S6LA 3O6BB 3HBLA 4YAJB 4BY1J 2DA1A 4FS1A 4X62H 1JGSA 4BJTA 3VPBA 1TQMA 1DV2A 2PMZE 2CUZA 3S8PA 1HKQA 3BR3A 5IYDG 3T5HA 3G73A 3UKGA 1K6OA 1FTZA 1Z77A 3K4LA 3OYBA 2FK3A 2R7LA 2X48A 4XKWA 2W6QA 4LF4H 2BZTA 3BG9A 2R8HA 3TMOA 3FDSA 3PIPF 4A93G 3OYHA 1AUVA 4LLNA 4A3BG 3HOUJ 2HHHH 2HTSA 2DA3A 3GTGA 4I76A 1ON2A 5FKNA 4ESBA 3LAPA 2BY3A 1YHQI 2W24A 5LLQA 3TOBA 5A2QK 4UCUA 1B4AA 2XCAA 3K10A 4QTRA 1WJCA 1M0WA 4B3XA 1LUJB 4C2MJ 1TL8A 2C00A 5LOVF 2XD4A 4DYCA 1Z6TA 1MMNA 2IJLA 3L2WA 4G7ZF 3AG2H 3JAMW 4BNCA 3JCUC 3L2UA 2VR1A 2Z16A 2HGCA 3K2ZA 1IF1A 1JKPC 2V9KA 1MH3A 1YE9A 3QYEA 4O5VA 4UVCA 2M1BA 1S03G 3OTOH 1JE8A 4MA0A 4XQFA 3JRAA 2A6HF 2ME0A 4EJTA 2MLKA 3H3VK 2VOPA 2EZHA 4WF2A 4XLAA 2R5YB 4IHYA 5FO5A 3RJPA 4HQEA 1CQIB 1RPWA 1FIPA 2GA1A 4I50F 4XYLB 5KFOA 3WTSC 3QYBA 3BWGA 2L4MA 1U0JA 1SEUA 2Y0SN 2ZXWH 4ZI7F 1MBHA 3OYJA 3U9GA 2YS7A 1KQ8A 4LIUA 1LVAA 4QLCU 2X6OA 2YSRA 2JA7J 3NEUA 3L2VA 5KT6A 1B72A 2R7RA 2H6CA 4IRGA 1VBHA 3SFIA 2HKXA 5FRMA 1IO2A 1MDMA 4RGXA 2NS7A 2XB5A 1S0NA 2ZC2A 2E35A 4B4CA 2X1CA 3O3KA 2JTVA 4DJAA 2PJRB 3E6BA 4O6JA 2W82A 1WJBA 2R7DA 2R7WA 4BJ5C 4JYKA 2LBFA 3EUHA 2E1MB 3TW7A 1UZCA 1S7OA 1FTTA 5L9XA 4EV0A 3L00A 2VIXA 3TIGA 3GILA 2O8KA 5IP9J 3J81K 1SFUA 3K9TA 3AL0B 2K3FA 4LFAH 2UUAH 1IW7F 2M8EA 2XAHA 2OZ6A 2JA6A 2P4WA 2IA1A 1PUEE 3RZOJ 5EOYA 2EK5A 4KHPH 1MIJA 2VKVA 3OSPA 2FK2A 4HQMA 5JFRA 3CC2I 2AU0A 4P55A 5DQGA 4A3KJ 5IYBG 1UG0A 2DMQA 1SMYF 4IRHA 1I6XA 4QW9A 5L3EA 2CFOA 2W00A 4BACA 1ZK8A 5DTDA 2CZGA 2RF4A 5JH7F 5DEQA 1E4EB 2NNYA 2DWCA 1YO5C 1UHMA 3OYLA 4WD3A 4CC6A 5DYMA 4EJWA 2EWNA 3PW4A 2P6SA 3OMYA 1XN7A 1E4FT 5M5YJ 3QYFA 3MN2A 4M3DA 2B63A 3H0GG 5E3OA 4Q0YA 4Q48A 2K9QA 4A69C 3ZQQA 1ZRFA 4UCVA 4PWQA 1YI2I 4DL2A 4XM3A 3J81Z 4Y17A 5CVJA 3S3OA 2L3DA 1ZLKA 2OWOA 5KKNB 4I98B 4B3AA 2FUG2 3BJ6A 1KYZA 3GF2A 3JAMK 1QRYA 1WHUA 4A3LG 1GYFA 4AYBA 1RJPA 4XRSG 4ETSA 2RNJA 2VB6A 4ED8A 4JP0A 3PFIA 1YW7A 4ECWA 4NB5A 3ZQ7A 3L4KA 3VPRA 3LL7A 3DLLF 3K2AA 3BR0A 3H3VH 4BBSJ 2OA4A 4BEHA 2L0KA 3GLKA 1G6NA 4M3GA 5KFUA 3DCFA 2L9NA 3A2KA 3FXLA 4DUZH 1X1CA 5KX5F 3N40P 1Z6RA 3DEEA 3HKZA 4BDYA 2IPQX 4RM3A 2AGOA 4BBSG 2FKLA 2HQRA 2I8CA 2LF8A 4F3QA 3AYHB 4CSWA 4BL0B 5TGTA 2RDIA 4KA4A 3LSTA 1U8BA 3KX2A 4CYCA 4RB0A 2P7CB 1Y1WG 2M4KA 2V4JC 1X2NA 3CDIA 1EH8A 4D0PA 2L9VA 5E3MA 4Y52J 3FKIA 1D5VA 1Z05A 3H4DA 2VBYA 4WXCA 4XRFA 3PO3J 2BVMA 1MH4A 1Z91A 2RNGA 3KLNA 2O03A 4Q5SF 2ASJA 4JI1H 1DP3A 2DA6A 3RGXA 2PEXA 2V9PA 3GMEA 3I64A 2R7TA 1U9NA 2JRTA 2BHZA 2P0AA 3GIKA 4N4NB 5FKOA 2IP2A 2LYCA 1SD6A 3RSNA 4MV8A 2BR0A 3NARA 2PMZA 4D1QA 3LA2A 1REPC 3OUZA 4DL6A 1TW3A 2QK4A 3E5QA 4HSRA 5FFZA 1LQ1A 2BOLA 1ZN2A 4XOPA 3PNVA 1QPIA 1FJGH 1WCMG 4DL7A 3X2QH 1FP2A 3H5AA 2YU3A 4A6DA 1SCUB 4F4ZA 1GGOA 3TDZC 4YFKF 2HXIA 3PUFA 3GTOA 2DQLA 2CYYA 4LMYA 5BPIA 3H0DA 1MJBA 5J6XA 2UV1A 1YJWI 4LSAA 1RC9A 2XSJC 3LSGA 1VF9A 1XCBA 3K70C 5L3CA 1KJJA 5KG6A 4UVBA 3ELKA 1Y6IA 5AIPA 2R7FA 3MKLA 3H20A 3HOWG 1BJZA 5E20A 1BA5A 1ZH5A 1POGA 2ECCA 1U2WA 2E5LH 4C3JJ 2DPUA 5KFLA 2BW3B 1DGRM 4MV3A 1MJAA 2WB1E 5H80A 2DYRH 3SQNA 2L5QA 3L2CA 2OV7A 2M0MA 3VYRB 2EILH 4CHUA 1Z2OX 1NTCA 2YRXA 1FYKA 4QWAA 5FLMJ 2NVTJ 2FJ1A 2QQ9A 3H9GA 1VQ6I 5F6FA 2VT3A 4R79A 2DAOA 2DIKA 1XMKA 3H9JA 4F91B 4C5CA 3Q8QB 4XLHA 3CUQB 3LQRA 1T36A 2CUFA 2NOGA 2M7BA 2CQQA 4XK4A 3GFIA 1JDBB 4IEJA 3CO7C 1CQJB 2DDAA 2QYZA 1MNDA 1VTNC 2JA8J 2DZDA 2XPUA 4X66H 3I58A 3AG4H 3I55I 2BHYA 3FIWA 2DA4A 1E3OC 2FP4B 3AG1H 5E79C 2AO9A 3T1BA 3LSPA 3HDDA 1N78A 4RGRA 4ED7A 2GAUA 1EA3A 1CS0A 1ZAOA 4LSXA 4L9VA 4JX6A 3G6YA 2A69F 2FMAA 1OLTA 1VQ9I 1S68A 2ID3A 3RQ4A 2LTPA 1UELB 2P0WA 3A0BC 4HV5A 5K7FA 3Q2OA 2VODA 3KALA 3SYTA 4M9UA 4I55F 2LD5A 2JEGA 2ZJTA 2CUEA 3DXJF 2GPWA 3I56I 2BQ3A 3OYMA 2EFQA 2FQ3A 3KP3A 4C3HJ 1J0RA 1YS7A 2R6FA 3C2GA 5DCMB 4UFZA 1WGXA 1HR0H 3DKYA 3OWTA 2HPIA 1YX5A 5C3EJ 2C2DA 2V59A 4B8XA 1T0FC 1LEBA 1YYVA 1YIOA 2IS4A 4EFBA 1WSUA 5IYCJ 2W6MA 4ENMA 4IWYA 2G0EA 1ZG3A 4OIQF 4GLXA 1W5SA 2IEKA 3H36A 1OYYA 5E1ZB 3WGGA 5C3EG 1FSEA 2IS1A 2QYOA 4EBCA 1HSTA 2VXDA 2XPWA 4PJ0C 3CCMI 5FGMA 1IJWC 1QZZA 4NQWB 3FXJA 3FBNB 1GLVA 1D5YA 3CCVI 4I6ZA 1DPUA 1V4RA 3HUGA 5E18F 3QP6A 3R0JA 3FM5A 4O3OA 3PJRA 3H9QA 4M73A 2QBYA 4HYEA 3WG7H 3FISA 2DPDA 3OSFA 1SD4A 3OR1C 4C3IJ 1FY7A 2BY1A 2VL8A 1XDNA 1H9GA 2LC2A 2ZXJA 5EGOB 2ZJRF 3KAJA 1VKZA 2HYJA 4DW6A 4O3MA 4A3DJ 1I7NA 2J9GA 2R7KA 3LOCA 4DV5H 2R8JA 1BC8C 1W7PD 2XAGA 2VI6A 3VPDA 2GIZA 2H1KA 1ITYA 1JDEA 2D1VA 4Z6YA 2FOWA 2QCOA 1IV8A 3OV8A 4S0HB 5LBQA 1N34H 1D0XA 3ZQFA 2E60A 2HVSA 2C22A 3CF5F 3VODA 1A31A 1K79A 1FWZA 4FISA 4RDUA 3GV5B 1N77A 4CCKA 3TL4X 4RNNA 2KL4A 3MWDA 3RAQA 1SD5A 3DQVC 1F36A 1LPQA 1ZYRF 2FB9A 3J7AY 1XCVA 2VT2A 3BTCA 2KPMA 2XGCA 3T8TA 1RKTA 5EZHA 1R9TJ 2UZKA 4I7HA 4Q44A 2M5WA 5E1XA 3BAAA 5LEJA 1S7AA 2XDVA 3S1MJ 4JI2H 3WNZA 4J9MA 1UC9A 4MV1A 3PUBA 3NAUA 2W6PA 4IHJF 1ZRDA 3H1CA 2DQRA 2ZJ2A 3K4CA 3KP6A 3A01B 4KNYA 2D2WA 2R92J 3IH2A 4XRMA 1H89C 1RUNA 3BABA 3L4JA 3QQAA 1OCCH 4BQNA 2JA6G 3E6DA 3COAC 2ZMEA 4UY8I 4CCLA 5JUMA 1UAAA 5EWGA 3C7JA 2ELHA 4LF7H 1K61A 5CJ9A 5KFFA 2Q2UA 3GEZA 5B5EC 4V2FA 1CF7B 1JXSA 3K4BA 2LDUA 2WY7Q 5D5WB 1MNMC 4I4TF 2UVVA 4C2MA 3J80W 3GCMA 2E2JJ 1U6GA 2F5FA 5CA0F 4GYIA 3PVXA 3B6CA 3QPLA 2VBZA 3FHNA 2RKHA 5DD4A 1S9FA 2HPMA 1RKWA 1UMQA 5F0FA 3SE7A 1Z7UA 5K1YA 1IDZA 2YZNA 2DJNA 4KICA 1I7LA 3SEQA 1FPQA 2XASA 2LNBA 2JQ7A 2JK3A 2ACJA 2B63G 1WRJA 1ZGJA 1PP8F 4AWXB 1AKHA 4IWXA 2WTFA 2HOTA 3FZVA 2XPVA 1OKRA 2PI0A 2KHMA 3T5XA 3W6VA 3QPTA 3T5JA 3VWBA 4LFBH 2Q2EB 5J47A 1PUFA 4OX9H 3S3MA 4I01A 4GGGA 4FQGA 4YELA 4HZFA 3T0YA 3GYHX 3H92A 5GONF 4KIBA 2GXBA 1ZKGA 3D1NI 1HW1A 3DPUA 1OQYA 1PJRA 2L7KA 3G1MA 3NGDA 4LG0A 1EKEA 1YIJI 4MV6A 4LJZF 4YR3A 3L2PA 4JV2A 2EIJH 3F72A 3J7AK 3M1CA 3R4KA 1FNNA 1H9TA 2ZM6H 2COMA 3DTKA 1XD7A 4LLGF 3MZHA 2VUMJ 3I4NJ 1FMVA 2L02A 5E17F 2XIGA 4RB3C 3TBIA 2KSWA 3E5NA 2UUBH 1IN4A 4M9ZA 5FLXW 4J0MA 2O6GE 2W6ZA 4FE4A 2YZMA 3IAM2 4Y8VB 4CUGA 2R3SA 3WU1B 4G6DA 1NG7A 1TWGA 4RAZA 4S04A 1ZTRA 4ECTA 4NXNH 4EGYA 2W84A 3RQIA 4ECUA 1EUDB 3DU6A 5IT9W 1I1SA 3OS2A 3IKVA 2ISYA 3DV8A 2XGQA 4ECZA 1KBLA 1VI0A 4DL5A 3F6VA 1W96A 2W8LA 2K9LA 2DFFA 2OCEA 3TEDA 1YQAA 2HOSA 2ZNZA 3O2PE 1TAEA 3WTXC 1IXRC 2XGPA 2DN0A 3LFUA 1T8IA 2HEOA 2VOOA 2FLLA 3RB3A 2WA0A 3QU3A 5LHIA 4QPQA 1UNNC 4G6QA 1E3PA 3C2BA 3CCJI 1OMIA 1OR7A 1YJ9I 1P4AA 3HJEA 4M74A 4YFXF 3LSIA 1FC3A 4EEQA 5E8IA 4Q8EA 5KFIA 1B1BA 3HHGA 2SCUB 2MLGA 1WWXA 2GQQA 3KP5A 2W7NA 3M07A 2NVXA 1S97A 2P7VB 5LP6F 1EF4A 1I94H 3K1MA 5T14A 2GOXB 4UUSB 3H0GA 2C2RA 3PW7A 4MEYF 1R49A 4LF8H 3OL4A 2LG4A 1ETQA 4IVNA 3OSNA 2WV0A 6PAXA 5LXTF 3IH3A 4GDFA 1AN7A 1T08B 1JTYA 1KONA 3JRCA 3BCBA 4KITB 5DG8A 2DMUA 3ABLH 4NDLA 5KK1A 4DUYH 1J59A 4Z2YA 5C1PA 3J80K 4L5JA 2B7EA 3AAFA 2FMLA 3FXKA 1GXQA 1V51A 1KQ0A 4HEA2 2BY0A 1OCRH 2EH3A 2IA2A 2YRWA 3MKYB 3HOZG 3MWMA 2CQYA 1I3QJ 2BE5F 5DUKA 3ZRGA 1XSXA 3EYYA 2ESNA 4HAMA 2VLAA 5KFPA 3WTZA 5FB2A 2ZSIB 3K0LA 2LK2A 3B6AA 1I6UA 2GXAA 5KFWA 4FBUA 3BOQA 4UUVA 1SAXA 2FNAA 2RC4A 4Y3OA 3FWEA 1Y1WA 2D5VA 1WKMA 3BPVA 4HDVA 4ED6A 2EZKA 4ON0A 4G9YA 5DG9A 1D3YA 4LG3A 5DM7F 2DA2A 1XMOH 3CC7I 3H5RA 3WG9A 2OQRA 3F3XA 1RRJA 2TDXA 2JPBA 2FD5A 2W85A 4BY7G 3S1RJ 4G94A 2R5ZB 3J80Z 2KIUA 2JSCA 4D5FA 1O75A 3ZMZA 2VPQA 4CCJA 2DPIA 4BYYA 1BOAA 1ENHA 2GWRA 1TWCJ 3K70D 2ZJQF 4ECYA 2YR2A 5HDNA 5TJJA 4IHTA 4XBFA 4LFCH 4BUPA 1Z21A 1P7IA 3WU0A 1SANA 1WCMA 2KP6A 2LP0A 1W7PB 5HLIA 4C30A 5F1RA 3PSIA 1PDNC 3U9SA 2IRFG 3DBLB 4BWSC 2OTJI 1T6SA 2KRCA 1QBJA 2C2EA 1MMAA 4IZZA 2VE9A 4ZDOA 4YHHH 5EG0B 3IRQA 3KXYT 2UXBH 2QEXI 1A0IA 5M3MJ 3JRWA 3GLXA 4U7CA 1GDTA 5EYRA 1BI0A 1TP4A 1HC8A 4OMYA 1JI8A 1BJTA 4QWBA 2KKOA 3LP8A 1AOYA 2XKOA 4B3RH 5KT7A 1P4WA 3MVPA 3LMMA 2FPPB 1A36A 3W2WA 3MKWB 3QWLA 3OIQA 4ABZA 3ABMH 2PG4A 3GTMJ 1KJ8A 1YS6A 2H94A 4OAZA 2UXCH 1SMTA 4KJZA 4B44A 2BGCA 5DLGA 1R5ID 3RKQA 2DT7B 1KU9A 1R1TA 1B6SA 3RGZA 1N25A 4L9JA 3GTJJ 4C9YA 4XYMB 5KT5A 4PJJA 3J81W 4P5OA 4G12A 3G3ZA 5FPOA 4EJUA 4DZPA 2XRNA 1R7JA 4XSZF 4C5BA 3GIDA 1S8NA 4QW8A 5KFHA 4E7KA 1S72I 2EJRA 1NG6A 1T56A 1LFBA 1K83J 2BXYA 4ZYEA 5DUIA 2BXZA 3RKYA 3CJQB 5LL6b 1LNWA 4JI6H 2IGMA 3DFGA 3M4OJ 4QWQA 2UVRA 4BY1G 4J00A 5D8DA 4DIQA 1FMWA 3RPUA 4HF2A 3V6KA 2K40A 2XUBA 4FM9A 2OH2A 5D6FA 1MMDA 2VE8A 1JKRC 4OAYA 5HNHA 5LA6F 1I3AA 1T0FA 4O4HF 5BPHA 2QUFA 3JRXA 1V54H 2DJIA 2M2EA 4DBQA 4A3MJ 2VJJA 3HOUG 2CQXA 3ASNH 3GTPA 1XX5A 2ZMEC 4UV9A 1KA8A 5F0CA 3HYIA 2FPGB 4A3IJ 3A02A 3RBEA 4GO1A 4BDZA 1IXCA 2Z5UA 3DEUA 3TQTA 4RZRA 4AU7A 2V4QA 1AA7A 2BBYA 2P5KA 1HW5A 3HOSA 4ECRA 1F9NA 3BG6A 3ZQIA 3DBRB 3L9FA 2K9MA 4A2UA 5J4VA 2NRAC 4A3IG 1IBLH 3JW4A 1USSA 5D1OB 2CQ7A 4F52A 2NS0A 4ECSA 3TW6A 2WAQN 2QSHX 1J09A 4HV6A 4ZZDA 3SZPA 4E6KG 3LAJA 2QM3A 1PYVA 5EEHA 3TOAA 1B33N 1TWFA 5K5QA 1BBYA 1IRXA 4PSXA 1ZHSA 1I1GA 3T1HH 1TW2A 3M9NB 2W1OA 3SDBA 3F21A 1X1AA 3BTJA 3KHLA 3N6XA 4MV7A 2CMPA 3CMAI 3C0FB 1Q1VA 3L2RA 2IGKA 3PN1A 2O7OA 2CKZB 2ATLA 1WQ2A 3KYCB 1SFXA 5KFQA 4R8UB 5F0HA 1YRNB 3RKXA 3PM1A 1HW2A 1L3LA 2DPJA 2L7ZA 2DDBA 2JA7G 2J5OA 4DGWB 4UCTA 3JRHA 4DZJA 2XF6A 4ZC3A 2DTRA 5ICFA 4HNTA 3JSLA 2H1LA 3CP8A 2R7ZJ 4ENJA 1J7KA 3GQCA 2BYVE 4AC0A 4A12A 2V1XA 2LY1A 1EJ9A 1O57A 1R4MB 5C1OA 1P2FA 4RMNA 2VONA 2V26A 4X1EA 4IHVA 4F92B 4I02A 1I27A 4M6YA 2AQEA 3CCQI 2FA5A 3CMYA 5TISC 1K78B 1LE8A 1IOWA 2YCHA 2NUAB 2RGVA 2E36A 5FKMA 4BS9A 4IRIA 5KG0A 3GIQA 2CFXA 5IP9G 3GV7B 5D4SA 2GIVA 2HFHA 3F8MA 3UFXB 2LKSA 2WV1A 5LRSA 3G6VA 4UCOA 4BGDA 1A35A 1XPXA 3OS1A 5K7HA 4ZTFA 4PJLA 4ED2A 2FXAA 3BY6A 1D1AA 1KYWA 3WE2A 3ZQCA 2VQEH 2BQRA 3U1KA 3BG3A 3HXLA 4DV6H 1S3JA 4Y33A 1GVJA 3VYSB 4HW0A 2FEZA 1OR7C 4A0YA 2DA5A 4DR7H 5KFEA 1JJ6C 2X0SA 2W6NA 2YW2A 4FBTA 3JSNA 4A3KG 4LB6B 4AIKA 2DT6A 3WTTC 2HQAA 2IS2A 1RYRA 1T94A 3Q8SB 5HS8A 3CMEI 3PO2J 4WX9A 3JRBA 2ZDQA 2VJ5A 1ZG5A 5J1UA 4E7LA 5JHFA 2DU9A 2GPSA 3H40A 2W9CB 3BJOA 5LRRA 3F8CA 4UVAA 1VQKI 3S32A 3MJFA 1O3QA 1HCRA 2JVGA 2XAUA 4A0ZA 1YJNI 1HNXH 2GBYA 1FT9A 5F64A 3S15J 2M05A 3TQ1A 1BI1A 5GTIC 3GFJA 4UB8C 2VQDA 1WJFA 2Z3YA 2XHKA 5F27A 3H5NA 4ZH4F 3KHGA 2QSGX 4JBAA 1SFEA 3CTAA 3OYCA 3MKZA 2K4BA 2IVMA 1N33H 2EINH 2COBA 4M9XA 4EMSA 3RAXA 4PFOA 1UG2A 4IHWA 2PJPA 2EZLA 4LK1F 4PDBA 2W9BA 4KT6A 3PSFA 2ZCWA 4DR3H 4O3PA 2RDPA 2OQGA 3JRDA 5B1BH 4AQYH 1BN5A 1FOYA 4OIOF 2VUMA 1C30A 9ANTA 2OD5A 1Z3YA 2M0CA 4FU0A 1TWHJ 2LFBA 2E2HJ 2C28A 1X3ZB 3HSFA 3M8EA 4HDUA 2MD0A 2WAEA 5GADJ 1DU6A 2PMHA 1MNEA 3GTLJ 3KE2A 3MD2A 2O5RA 1Z9CA 2E1MC 3RIRA 4IRDA 3OY9A 3ABKH 4BBRJ 1K1QA 4GYGA 2OU2A 3CCYA 3ECOA 4OMZA 4QIWA 2F4VH 2I87A 2MH2A 2F5CA 1S10A 4MO7A 3G2BA 3DTEA 3KEOA 3E0JB 3P7NA 5JLWA 3PO3G 4HNVA 2E19A 4IJAA 3RI4A 3IAS2 3FF5A 5JR3A 2QQAA 2NOJB 2VQCA 5AONA 2IS6A 2ZNYA 5KFBA 4XONA 3HIFA 2B9SA 3VMMA 4C2UA 4ESJA 4FX0A 5GAHJ 4DR1H 3ROUA 3LSHA 2VC0A 2XGXA 3QOEA 5LFAA 3JTGA 2PLYA 2W48A 2DBBA 3R61A 3VPCA 3G4SI 1U78A 3U9TA 3RUPA 1TQIA 4EM1A 2CQNA 4R7RA 4GKJH 5E1WA 1E3HA 2BV6A 3K1NA 3E6CC 4F4XA 1HSJA 1CGPA 3HC7A 3LSKA 1W5CC 1LB2A 3I59A 5J1YA 4P1WA 1G8XA 1JLLB 1ZGWA 3LA3A 3K3VA 2FJZA 4LF9H 3ORQA 4HX8A 2HS5A 2QZ8A 1ZRCA 5HOOA 1JT6A 4R1HA 5K5RA 2HXOA 2K4JA 1AUXA 2CJJA 4XORA 3JRFA 4A3GJ 1A9XA 3C3WA 2VA2A 3T1YH 4IKFA 2XCLA 4PJMA 4PUSA 3H3UA 2IMWP 3GVAA 2QF7A 2OZUA 4A3GG 2EZIA 2V1DA 3TKYA 2Y48A 1I3QA 2M7AA 2FU4A 1IN7A 3IKTA 4Q43A 4ECQA 5FLMG 2E5NA 2F6CA 1B8IA 4YJ3F 4UUTA 4O2BF 4EGZA 3DF7A 2YL2A 4IAJA 2K3PA 5H6RA 3ZN1A 3R0AA 2VUGA 1RETA 4K0KH 5FKKA 3D5RC 4Y13A 1E17A 3GBGA 2HKOA 4YR0A 4E7HA 4GFBA 2KLOA 5LGNA 3CLQA 2MW8A 2R8KA 4JI3H 2NU8B 4LF6H 2KQRA 2OLSA 4UXNA 2JA8G 4TQRA 4OIPF 3DTIA 3HOTA 1I50J 3HTUA 4M3BA 1IBKH 2YX4A 5BMZA 2E2IJ 1RJQA 2MG4A 2OUMA 5KFAA 4HX7A 5M5WJ 5IP7J 2GA2A 4MA5A 1XGMA 4B1RA 3M7GA 3F0CA 1B72B 2D1HA 3CC4I 5I47A 3L09A 5J8FA 2VASA 1BNCA 3CQZJ 4WWCA 1MDMB 1TWCA 2ZSHB 3ASOH 2MGQA 2QQ8A 1PVEA 2WAQE 1FBSA 3ABUA 1RI7A 4U0WA 1S0MA 4G3IA 2E7XA 1QU3A 3AKZA 2HWVA 3GXOA 2XGEA 1V9PA 1Q1HA 1XGOA 4JV0A 1Y0UA 2LBFB 2Z9OA 2YU9A 4DV7H 1XDUA 4JX5A 2DCEA 1IC8A 1WR2A 2Y0SE 1TBXA 1S7EA 2HDCA 2E34A 5C8YF 2F5EA 5IYCG 3GTQA 2VPRA 1KJ9A 4A3EJ 3PW5A 1UJ8A 2F5DA 2N8GA 2NAZA 3BJYA 2AGQA 1MBEA 1JKJB 2Q2TA 3IWZA 4U6PA 2KIMA 4AIJA 4A3EG 2VKHA 3FM3A 3QPHA 1R23A 2HR3A 1RYSA 3BQYA 4EFEA 2KZVA 2ASDA 3OL3A 4DQ2A 5KT3A 2ISZA 4P9UA 3UQ8A 1FYLA 3GTMA 3CVZA 1W1WE 5HLHA 4I0BA 3F9KA 1R5GA 2V6EA 1BIAA 3J7AO 2TRTA 2IAIA 4X64H 3H3ZA 5JVTA 1WZ2A 2XF7A 2H6BA 3OYGA 4A3DG 3CUQC 2E1NA 2JZYA 1ZQ3P 2XAFA 2EFWA 2E7WA 2ZXHA 4PSWA 5FFXA 3V7CA 3FHZA 4L0ZB 4EBDA 2Y0MA 4BXXJ 1G4DA 2ZXIA 4DNCA 2R84A 5KFNA 4IHSA 1TTYA 1BC7C 1FJLA 2O0YA 4KN7X 4AYBN 4F55A 3R23A 4IZOA 5L1LA 4EYIB 1HNZH 3FMQA 2VXZA 2UWMA 3JRIA 1LJ9A 3TO7A 4O3QA 1P8LA 3MFIA 4BXXG 5DLFA 1E0EA 1ON1A 2FF4A 4MIMA 2FBHA 1SVLA 2R7NA 2CH0A 4NXMH 4HNUA 5KFCA 3PNTA 4EQQA 4CGZA 3CJRB 1B9MA 2FQ4A 2K85A 1IUYA 2ASLA 4A3JJ 5EF6A 1TLHB 3I53A 4RGSA 1J5YA 2LVSA 3RYRA 2C35B 2QA4I 3HRMA 4BEHB 3TO9A 3HKZN 5HV6A 1OISA 4XICA 2DMNA 5LGTA 2KISA 2KFDA 5CLSA 3HTSB 2R92G 3C18A 5EZGA 1Z3XA 2AXTC 3W6KB 4CDGA 3KP7A 4P96A 3K4MA 3R60A 1LKXA 4YRVA 3FMSA 4CH7A 4V19K 1Z0XA 1YW9A 5KNLA 3GFLA 4CYCB 2E71A 4XOTA 1V55H 3V4ZA 5ILSA 2KRFA 2K9SA 5C4XJ 2DLLA 2QGUA 1C3OA 2DXIA 4L9NA 2VBWA 1P7JA 3Q9SA 1X4OA 2J5PA 2Z33A 1E2XA 2Y30A 3CCEI 5KFKA 1U5TA 3KAKA 5TRDA 3E6MA 3RKWA 2UXDH 4ME6A 2LRDA 2TCTA 3OIOA 3ZXSA 3P5JA 5LYJF 4JI7H 3CDHA 3SFZA 4BHPA 4CXFA 2PMZN 2HOEA 2V7FA 2YX7A 3DLAA 5CAEB 2A3SA 4HLXA 4JI8H 4M3EA 2JJ7A 2LF7A 4ZDPA 3S1QJ 5H2FC 3VOEA 1ZETA 3A1YA 4CCNA 4N9HA 4DV2H 2UXNA 1EH7A 4YIIA 4XZ3B 1BOBA 3Q0UA 5IOYA 5DS9A 1G2HA 4KDPA 3WTUC 2NU6B 4O3NA 2HYFA 1NHAA 5KFJA 1EYZA 3ML6A 1IXSB 2H8WA 2IXSA 5FJ8J 2JA5J 3MEXA 3NWTA 2QQBA 4CYDA 2K86A 2R0QC 4JV5H 2JA7A 4FX4A 3K1PA 5CVUA 1BW5A 3S16J 4MHGA 1OCOH 4ED3A 4CO8A 1J9IA 1SVMA 4ZJZA 3R5FA 3ZQGA 1RZ4A 2XKPA 3M1EA 2PQ8A 2WB1A 3S2HJ 4C5AA 3GTKJ 5J3LA 1RJRA 3WO1A 2IGNA 4YEJA 3N4MA 1IZ1A 1ZG1A 2ADUA 2VUMG 3I4NG 3W2AA 4DR5H 3V4GA 4DV0H 2R7ZA 3SJMA 4B09A 1BM9A 1BI2A 3CESA 1LVKA 1B04A 1OFCX 3E97A 4HQ6A 1MBJA 3HGGA 2JN6A 1RESA 1Y56A 4ZYDA 1L0OC 2F4IA 2VPLA 1XG1A 3ESWB 2L01A 5KAIC 3OYDA 4V2GA 5KG2A 5IPAA 1IN6A 1QVUA 2QKLB 2EQRA 4BXFA 3RV4A 4KMFA 2XAQA 1AHDP 2JUGA 5H20A 4F4YA 2HVRA 3A03A 4RNOA 1LFUP 1OCTC 5J2TF 3BZCA 1G3YA 2OJED 5BOXA 5E8GA 1R1VA 3GZ5A 3JRGA 2GLOA 4YR2A 4MAMA 4JYAH 3MZ8A 2HGSA 4IR1A 3FKIJ 2O61A 4Y4RA 5LGUA 2V6CA 2BEOA 2NYXA 3KHRA 1IOVA 3ONQA 3ETJA 5D1OA 2P5VA 4XIDA 1FOKA 2XAJA 1RR8C 3U21A 3RBDA 5L3GA 4J9LA 1B59A 2R5YA 2A05A 2MC4A 1JIHA 4W1UA 2K7LA 2L2OA 1G3TA 2DMPA 4HPQA 1JX4A 2DK5A 4O3RA 4XKBA 2IA6A 4U0YA 3SZTA 3FK6A 1Z2NX 2KRHA 1WFXA 2OF7A 2X1DA 4KIGA 1EUCB 1I5ZA 5D8KB 4J9RA 4L1KA 3HRSA 4RNMA 4LIVA 3H4BA 1O7FA 1MMSA 1ETWA 3CDLA 5BS6A 3DWLE 5LD2C 3HEFA 3KTMA 4IO9F 4FASD 3BQ2A 2DA7A 2ESHA 4Q45A 2GLTA 4DBRA 4LH6A 2CV1A 1KEEA 2LSOA 3BA9A 1NH3A 2STWA 2PJRA 3RIZA 2HNHA 1QO0D 3HUGB 2ZFWA 3RF2A 4RB2C 3N97A 1FYMA 2E2HA 2QBYB 4KIFA 2ID6A 2J6UA 1M1EB 2JMWA 1JHFA 3BG7A 3GLLA 4N4OB 1YTYA 3GTLA 1KC7A 3MZYA 3TINA 1ZHQA 3IRRA 3FK7A 3BQ0A 1ERDA 4AVPA 1UHSA 3VYUB 4B43A 2RN7A 2X4HA 4KYWA 1ZR4A 4QWCA 1FZPB 4WXDA 4RAGA 1J75A 1TC3C 1FEXA 1D0YA 1X1DA 3ZPLA 5D5VB 2FPIB 1BR1A 4C2TA 2JEFA 1B9NA 3EQLF 3BR2A 3D5LA 4Y7NJ 3K4KA 4E7JA 1X2MA 3ZMUA 4PFPA 2OBPA 1DPRA 2UVWA 5GAGJ 3DPLC 3CZ6A 3MFHA 2W25A 4JK1X 4BKXA 1XDSA 5L3FA 1E4EA 3R5HA 3OYNA 2DOEA 1WJ5A 2R4GA 3DP7A 1UCRA 2M3AA 2UUZA 4MQ9F 2CW0F 2W57A 2LR8A 3FKJA 3SI8A 2R85A 2DFIA 2V1NA 1VAJA 2VQHA 5DD8A 5ICCA 5L1JA 2YPRA 5H6QA 1W0TA 3BR5A 2CO5A 3K7AJ 1KJQA 2MC3A 2Y9YA 4PK4A 2KIQA 4U88A 4XLEA 1JJ8C 2NNNA 1HBXG 3ISPA 2E1CA 4XLCA 3LA7A 1KJIA 4RAYA 4IQ4A 2A61A 1FOXA 4UNOA 1A04A 2CU7A 3A0HC 3FX3A 1XMQH 1JUMA 4IL6C 2ZMEB 4ECXA 4EM0B 3UR3C 2IT0A 2WC2A 4N9IA 3BG5A 1BIBA 3PZPA 1QQIA 3JR9A 4AYBE 3MR3A 1ORKA 4A6EA 1IDYA 2HU9A 4BE1A 3L7WA 1F43A 3VDXA 2GM4A 1B6RA 4GC6A 2Y75A 2X1EA 3N41B 4LOCA 4E7IA 1KU3A 3M9MB 3HL2A 2F2EA 4M6XA 3KZZA 1DIKA 1YOVB 5KG7A 5KT4A 1N48A 2LY2A 4J9OA 2EPFA 2MBFA 3GV8B 1R1UA 5K7ZA 1KU2A 2LKPA 3C1DA 5D6EA 4MEXF 2I80A 3W2VA 4NUBA 3I3LA 4E70A 1T38A 2ZDGA 2VBXA 2FBKA 3Q0WA 3RPUD 5FD6A 1VQLI 1AKHB 5KFXA 2XCPA 1I6HJ 3W3CA 4Q8FA 4U7BA 1S29A 3IWFA 4CZCA 1H88C 1V5GA 2XGDA 5CYVA 3GZNB 2R8GA 1ZLJA 4XL9A 4ZDLA 3J7YJ 3G6XA 2RGRA 1FOWA 3EPIA 1PUFB 1GV5A 2VJIA 4R8HA 1HDPA 3IN5A 3VFZA 2ALZA 4WXHA 3L2QA 1H8AC 1TWAJ 2EV0A 1I50A 5HDKA 2R7SA 4RUAA 3D5SC 3EDPA 3PQKA 2VQLA 3WE3A 3A4CA 1R4NB 2DTZA 5EEAA 2GZWA 5GTHC 1XNRH 4LG0B 3Q1KA 3L1PA 4ANJA 3CCSI 4FETA 1GO3E 4I99C 2HI3A 4EATA 3IHUA 5IYDJ 5EDNA 2I5UA 3TDUC 5ED4A 2JRMA 4Q4ZF 2UVUA 3SXYA 3EUKL 1W36C 3CP2A 3IUOA 2VQGA 5DQHA 2H8RA 4KUMA 2BVLA 4BXUA 4EEFG 2IBKA 2HOAA 3BC8A 4A93J 5J2UF 2CW7A 5ICGA 1R36A 2OCCH 4W97A 4A3BJ 1Z7LA 4A5MA 4A3MG 5CVRA 5CQEA 1M6VA 5KFRA 2W8KA 3KHHA 3FMRA 4J9SA 1N32H 3KP4A 5DG7A 1WH2A 3P9KA 3PIOF 1D1CA 5KCMA 3MMYB 5BPFA 5KFZA 4H4KC 3RTRA 1LDDA 1Y0NA 4XKVA 4BHBA 1FP1D 4U7DA 4LH7A 4QWDA 2ZO4A 2BW3A 3N05A 1QNTA 1U5TC 5CA1F 4UB6C 2ZB9A 3RPQA 3ZP5A 2DLNA 3N43B 4O4LF 4OU0A 1K1SA 2ME6A 4PJNA 4IQJA 4J9NA 5IT3A 2NVUB 3FXQA 1GV2A 5M5XJ 1O4XA 1YG2A 1ONVA 4ESFA 4J9KA 3BDDA 1X19A 3CD6I 4KT5C 3S14J 1HKSA 4BQOA 4GXOA 1P9QC 1R58A 3QPSA 3CUQA 1S5LC 4XX0B 1UHWA 2J6SA 2DO7A 5HBRB 3ZMTA 3BZ6A 1ACIA 2M8GX 4IR9A 3Q3SA 4XMYA 2O3FA 5KHDA 3E7LA 4RB1A 1KU7A 1VS0A 1D8KA 2WADA 2Z1DA 4JX4A 1K4SA 1X1PA 5KT2A 3R5XA 4JI4H 5KFYA 1FBQA 1TA8A 5EWEA 2Y2ZA 4J9PA 3MFKA 2XF5A 2LLKA 5D5XB 3BJAA 3MR5A 1ZHFA 5ILVA 1HNWH 3S17J 2HZDA 2F5VA 3KEYA 2VQFH 4QJFA 3KPHA 1MZBA 2OPTA 1MBFA 2PBIA 3OYIA 4HA8A 5HODA 5JVGF 1JKOC 1IGNA 1STZA 2R7ZG 3DU5A 1T98A 4G6TB 1MBKA 4HG2A 4QSHA 2MA3A 5A2QZ 1EV7A 3KP2A 3K5IA 2CW8A 1R9TA 4YY3H 3DBHB 3IG0A 3Q0VA 3HHHA 2Y31A 4D9JA 4E4TA 2DT5A 2NS8A 5DCMA 3ZGKA 4EJOA 2QSFX 1GHCA 3FXRA 2R92A 1HOMA 2QKMB 4X6AJ 5JQWA 1TWGJ 4U87A 4XSXF 1QVTA 4KN4X 1Y1VJ 5CKTA 2EFPA 3G71I 2C6YA 1SVOA 3MR6A 1QHHD 1DDNA 2XC7A 3QFFA 2BQUA 3Q9VA 4CCMA 3EPGA 4O4IF 2RV8A 1FIAA 1Y1VG 4HLYA 4NQWA 2OAZA 5C4JJ 3SDGA 2P5LC 1VNDA 4HRIA 3IV5A 4PGHA 4IXAA 3CCRI 1U8RA 1Z67A 4RAFA 5JHUA 2PX9A 5IYBJ 2CS3A 3I5UA 2J6TA 1RR7A 4E4HA 5J40A 1HDDC 1USTA 2L54A 4ZYHA 2A07F 1IG7A 5EJCA 3E5XA 5HLGA 2DMTA 4J9QA 2AQ4A 3OYKA 4NLGA 3PO2G 1SYXB 1HA8A 2P81A 3V7RA 5EGOA 3LNQA 1CQTA 1NK3P 2I8DA 1IRZA 2L7FP 3ERMA 3E5UA 2NVXJ 4ZHQF 2UUCH 4RLFA 1IBMH 2WY8Q 3H0GJ 1TZLA 2P6TA 2AQFA 5DCFA 3U1DA 2CUJA 1AWCA 4L18B 5CPRB 1F1ZA 3RJ0A 3ECHA 4X0GA 2CRGA 4WCGA 2MD5A 4NHJA 4J01A 1E4GT 5BMVF 1S0OA 2F4OB 3DKWA 3SEZA 5FRNA 2JA5A 2JA2A 1VQPI 4MV9A 4TV8F 4A3LJ 2LOOA 2AS5F 3F6OA 5IOZA 3PW0A 3CLOA 3EUAA 4ED1A 1QA6A 4MQVA 1QHGA 2MABA 1OYIA 4RS8A 3GX4X 2NU7B 4EM2A 4LITA 3KETA 3ZOBA 4XN3A 1HF0A 4O3SA 5IP6A 5CB4F 3GTKA 1MD0A 2EA2A 4A5NA 1ULZA 1XC5A 4E7ZA 3JREA 5EEGA 5L1IA 2DI3A 3QOPA 3M8FA 2XSDC 2EFOA 2G7HA 2XROA 1VQNI 3K6GA 4EVIA 2L4AA 2X0LA 3A01A 2A5YB 1WJAA 4ITVA 5D8LB 3AL0C 4ZTJA 4A3CJ 3ULQB 4TV9F 2KIFA 3VYTB 4FE7A 3JZIA 4HSTA 3REOA 3ZR8X 4BBRG 1F5TA 2EV6A 1D1BA 3QU6A 3F23A 1MSEC 2M4GA 2Y69H 1JUPA 2HZTA 2FBIA 4DYRA 4D7MA 1N36H 4A3CG 1Y1WJ 3RV3A 1VZ0A 1VQOI 1SC7A 3DKXA 4BE0A 2IGOA 2XB0X 3CO6C 1CF7A 5B1AH 4ZYAA 2OTLI 1WSCA 5K2MA 2Z99A 4L5EA 1P4XA 2VA3A 3OOUA 4YAKB 3T8RA 4BJ6C 4MLOA 3BR6A 3V8LA 2JWTA 4WK8F 2WE6A 3HSRA 5ICEA 3E1SA 1ZR2A 3T5KA 5LEKA 4HF1A 2W70A 3JAMZ 3GIIA 1W93A 4IRCA 2AHQA 1QGPA 3AFHA 2HQNA 4H0EA 3FXUA 1IRGA 3ZMVA 5GPCA 2XVCA 2R7OA 3FDYA 3F8NA 1SFOJ 1GXPA 1PX2A 3CCLI 1Y8QB 4CC5A 5LHGA 2CQKA 1TT5B 4HR7A 4EG0A 2E5ZA 2W6OA 3K3PA 1QZYA 5LMUH 3HPHA 5F04A 1FLIA 1WCMJ 1FKAH 1BL0A 3M8JA 3PQJA 4D5CA 5J1RA 3S2DJ 1V5FA 2PFBA 2IA0A 2Q2EA 1FBUA 2ZBKA 4AIHA 5FROA 3WTYC 4JI5H 2R8IA 1MMGA 2ZJPF 5C44J 1OCPA 2R93J 2WDTA 3BQ1A 1DGSA 4AD9A 1WJDA 3ZN0A 3BCAA 2ELKA 2Q8KA 3HOWJ 1LDKB 3RZDJ 2DOAA 3AG3H 2PMUA 4Y15A 3WGHA 4B48A 5C44G 2R93G 2IP4A 3FXMA 3I54A 4RZQA 2LMDA 4KMUX 1BXRA 5GP9A 3RCOA 4YBZB 4MV4A 1DU0A 2FLPA 3SZGA 1T3NA 3WHCA 2LKXA 2CSOA 3RB4A 1PP7U 4EGQA 1T39A 1ETVA 1P92A 3SHFA 2WWYA 4GC7A 1HQCA 2A6EF 3BROA 2F48A 4IPAA 4YG2F 4X65H 1J2XA 4RA2A 1JHHA 1VQ7I 5HS9A 1ZREA 4YB8B 1BR2A 2ZDHA 2DOFA 4WBNF 1YX3A 2IBDA 3FXOA 4DYQA 1T95A 4IF4A 1K7AA 2JPCA 1JKQC 1R5HA 2WYOA 3WHBA 2K5CA 4DV3H 3HRTA 5IWAH 4GRIA 1XB4A 4LLLA 5KFMA 1D0ZA 1B6AA 3V7SA 4BE2A 4TUYF 1MKMA 5KFDA 3M3YJ 1G3SA 1MGTA 3B73A 1T2KA 3UNGC 3O8HA 3HOYJ 1YFHA 4AIDA 2JEJA 2QENA 1HXDA 1RIOH 3S1NJ 2V9VA 3WTVC 1K4TA 3HSEA 1X3UA 2K02A 1NK2P 5F9NA 1WJEA 1UC8A 3WTWC 2NVYJ 3TQNA 3HOYG 2PN6A 3EETA 3PL8A 5IP7G 1V3FA 3CJTB 3RDIA 1XMAA 3OUUA 2R7QA 4F4WA 3DF8A 3BTIA 3BT9A 3GFMA 2V58A 1XMXA 3O8GA 5C5JA 3PR5B 3V42A 2M45A 4BAYA 4M3FA 3Q5FA 4JQFA 3CF2A 4EBEA 3JSOA 4BU2A 3ERED 5EDWA 1HLVA 4MNUA 3Q8PB 2JSPA 4UUSA 2H27A 2VN2A 1BI3A 3M9AA 4I2OA 4ZYGA 3HB9A 4PCQA 4XN0A 1S9HA 2L7MP 2O9LA 2W7PA 3JTHA 2G9WA 3WGIA 3F22A 2HDDA 1IUFA 2KT0A 1LE8B 4RGUA 1OWTA 4GKKH 2G7UA 3C2HA 4TV7A 4KFCA 3GTGJ 1ETKA 3VEPA 1C0WA 4F7ZA 3ABTA 2HDWA 2DK8A 3KFWX 5HLTA 2EIKH 4J19A 3IP4B 5F08A 5E3LA 3GTPJ 1EZ1A 3FMAA 3BTLA 1P6RA 5K5OA 3KYLA 3ZMSA 1G3WA 4YJ2F 2KMUA 4RLQA 2KDOA 2YS9A 4IX7A 1KZHA 1VFCA 2X51A 4APMA 3CMMA 5BNGA 3CUOA 3BA8A 4TQSA 4YQWA 1YITI 1EH6A 2BY2A 1ZQ7A 4U0VA 2L9SA 3K4JA 3MWEA 3P9CA 4HYKA 2RDJA 4FT8A 4AUXA 2JVHA 3OOPA 1N75A
chains in the Genus database with same CATH topology
2VOBA 1YW8A 5L3BA 5HVQC 4OIRF 4DR2H 1XGSA 4DV4H 4G8XA 5CVIA 2DW4A 4CICA 5J8CA 2FSWA 4YIFA 3GWZA 5KVRA 1SD7A 4EJVA 3IL2A 4HBLA 2VPSA 2EA4A 3GW2A 5L3DA 5BPDA 1W7PA 3EYIA 2AXLA 1FVIA 1R22A 4M72A 5D1PA 5ERIA 4BH9A 4DR4H 4LB5A 4BQAA 4K2EA 5BR8H 3NRVA 4L9TA 1L2ZA 2EFNA 3QP5A 4MTEA 4UCRA 3KZYA 4UCSA 1LEAA 2Q0OA 3U2RA 2ETHA 2STTA 1DUXC 4LFUA 1ZGAA 1FX7A 3B02A 2GXGA 4HX4A 1M0TA 4A2BA 2CG4A 3I71A 2UU9H 5DDGA 4G7HF 3I59B 1TNSA 1W5TA 2FE3A 4Q47A 3BP8A 1H0MA 3NQOA 3MAJA 3R6SA 2FNPA 3MQ0A 4B3MH 4HF0A 5HDGA 4ZZLA 5D5UB 1XSDA 3W6JB 2QVOA 1KGSA 4HOBA 2RQPA 4I0AA 4PDKA 4B3SH 2VC1A 3LFKA 5LMNH 2XV4S 4ASNA 1J5EH 3LQQA 1UB9A 2JT1A 1R00A 1ZARA 3BPXA 2KJBA 4XLPF 2FOKA 5HS7A 4XLNF 1U3EM 3LWFA 2H09A 1FSHA 4A2AA 5BQTA 4M9SA 2QLZA 4ENKA 3TO6A 3ZMDA 4DR6H 2HTJA 3QAHA 2EB7A 4N0BA 1IRFA 2V79A 4JI0H 5JI6A 1F4KA 4G7OF 3F8FA 4FHTA 5DV5A 1RUOA 1O7LA 3GUDA 2QWWA 2FRHA 4LGWA 2B0LA 4YFNF 2FMYA 1Z2PX 1IN5A 1YLFA 4PGGA 1O3TA 1BJAA 3RTXA 3D0SA 2D45A 2V1UA 4UHTA 3M4IA 1MJ9A 1KQ9A 2MH9A 2RVCA 1K78A 3N42B 1O3SA 2HVQA 5ILUA 3K69A 1XSVA 5FPRA 2IW5A 3E3VA 2WTEA 3TGNA 3IC7A 2HYGD 1D8JA 4L5IA 1Z1DA 4A0XA 3VB2A 3N44B 2KJCA 2ZKZA 2M87A 2CWEA 4GCVA 4M7EA 5A2QW 4OINF 1X9NA 3KEQA 4M71A 5D4RA 2O8XA 3RYPA 4MTDA 5FLXK 2K27A 3MCZA 1O3RA 3V8KA 1SEIA 1OPCA 4MGRA 1TQPA 2EV5A 5LHHA 5IT9K 3QRFF 2M30A 4B3TH 3WODF 1QPMA 1BGWA 1TNTA 2P8TA 4L0YB 4ENNA 3GO5A 3S2WA 1ULYA 3I0TA 1RNLA 5FD5A 1DP7P 3KCCA 4LF5H 3P9IA 1ODDA 1XGNA 1WI9A 4BHCA 2MCTA 3I4PA 4DV1H 5CVVA 1XNQH 1U5TB 3LMLA 3KLOA 1UFMA 2UXXA 3GZ6A 3F8BA 1OYWA 4UV8A 4OOIA 4S05A 5FLXZ 3JSPA 1IN8A 1HKTA 1LDJA 4PZJA 5AIQA 4LK0F 2A68F 3V8JA 1IAWA 4P9FA 5IT9Z 1W4MA 2CGPA 4CZZA 3DPTA 3HRUA 4LD5A 3CJNA 4I09A 1S6LA 3O6BB 4X62H 1JGSA 1TQMA 1HKQA 3G73A 1K6OA 4LF4H 4LLNA 2HHHH 2HTSA 4ESBA 1ON2A 3LAPA 2W24A 5LLQA 3TOBA 5A2QK 4UCUA 1B4AA 1M0WA 1Z6TA 2IJLA 4G7ZF 3JAMW 4BNCA 2HGCA 3K2ZA 1IF1A 4O5VA 4UVCA 2M1BA 1S03G 3OTOH 1JE8A 2A6HF 4EJTA 2MLKA 2VOPA 4WF2A 5FO5A 3RJPA 4HQEA 2GA1A 3WTSC 3BWGA 2L4MA 3U9GA 1KQ8A 1LVAA 4QLCU 2YSRA 3NEUA 2H6CA 4IRGA 2HKXA 1MDMA 4RGXA 3O3KA 2JTVA 3E6BA 4O6JA 2R7DA 3EUHA 1S7OA 4EV0A 3L00A 3J81K 1SFUA 3K9TA 4LFAH 2UUAH 1IW7F 2M8EA 2XAHA 2OZ6A 2P4WA 2IA1A 1PUEE 5EOYA 2EK5A 4KHPH 4HQMA 5JFRA 4P55A 1SMYF 4IRHA 1I6XA 5L3EA 5DEQA 2NNYA 1YO5C 1UHMA 4CC6A 5DYMA 4EJWA 2EWNA 2P6SA 1XN7A 1E4FT 4Q0YA 4Q48A 1ZRFA 4UCVA 3J81Z 4Y17A 5CVJA 2L3DA 1ZLKA 2OWOA 4I98B 1GYFA 3BJ6A 3JAMK 1KYZA 3GF2A 4ETSA 2RNJA 3PFIA 1YW7A 4NB5A 3ZQ7A 3L4KA 2OA4A 1G6NA 4DUZH 3N40P 1Z6RA 2IPQX 2HQRA 2LF8A 4KA4A 3LSTA 4RB0A 2P7CB 1EH8A 4D0PA 1D5VA 1Z05A 2VBYA 4WXCA 4XRFA 3KLNA 1Z91A 4Q5SF 2O03A 4JI1H 3RGXA 2PEXA 3I64A 2JRTA 2IP2A 1SD6A 3LA2A 1REPC 1TW3A 3E5QA 5FFZA 1LQ1A 1ZN2A 1FJGH 1FP2A 4A6DA 2YU3A 3TDZC 4YFKF 2DQLA 2CYYA 4LMYA 5BPIA 1MJBA 5J6XA 4LSAA 1XCBA 5L3CA 4UVBA 3ELKA 5AIPA 2R7FA 3H20A 5E20A 1ZH5A 1U2WA 2E5LH 2DPUA 1MJAA 3SQNA 3L2CA 1Z2OX 4CHUA 1FYKA 2QQ9A 5F6FA 2VT3A 4R79A 2DAOA 1XMKA 3CUQB 3LQRA 3GFIA 3CO7C 1VTNC 4X66H 3I58A 3T1BA 4RGRA 2GAUA 1ZAOA 4LSXA 4L9VA 2A69F 1S68A 4HV5A 2VODA 3KALA 2ZJTA 3DXJF 2EFQA 2FQ3A 3KP3A 1J0RA 1YS7A 4UFZA 5DCMB 1HR0H 4B8XA 1LEBA 1YYVA 1YIOA 4EFBA 1WSUA 4ENMA 1ZG3A 4OIQF 4GLXA 1W5SA 5E1ZB 1OYYA 3WGGA 1FSEA 2QYOA 1HSTA 5FGMA 1QZZA 1DPUA 1V4RA 3HUGA 5E18F 3QP6A 3R0JA 3FM5A 4M73A 2QBYA 4HYEA 2DPDA 1SD4A 1FY7A 1XDNA 1H9GA 2ZXJA 3KAJA 4O3MA 4DV5H 1BC8C 1W7PD 2XAGA 2D1VA 3OV8A 5LBQA 1N34H 2HVSA 3VODA 1K79A 1FWZA 1SD5A 3DQVC 1ZYRF 1XCVA 2VT2A 3T8TA 2UZKA 4I7HA 2M5WA 5E1XA 3BAAA 5LEJA 1S7AA 4JI2H 1ZRDA 2DQRA 2ZJ2A 3KP6A 4KNYA 2D2WA 1RUNA 3BABA 3L4JA 3E6DA 3COAC 2ZMEA 3C7JA 2ELHA 4LF7H 5CJ9A 2Q2UA 3GEZA 1CF7B 1JXSA 2LDUA 5D5WB 3J80W 1U6GA 2F5FA 4GYIA 2VBZA 2RKHA 5DD4A 1Z7UA 5K1YA 4KICA 1FPQA 2XASA 2LNBA 2ACJA 1WRJA 1ZGJA 1PP8F 4AWXB 3FZVA 1OKRA 2PI0A 3T5XA 3QPTA 4LFBH 4OX9H 4I01A 4GGGA 4HZFA 3T0YA 3GYHX 3H92A 4KIBA 2GXBA 1HW1A 4LG0A 3L2PA 4LJZF 3J7AK 3F72A 3R4KA 2ZM6H 1FNNA 1H9TA 2COMA 4LLGF 1XD7A 3MZHA 5E17F 2L02A 2XIGA 4RB3C 2KSWA 2UUBH 1IN4A 4M9ZA 5FLXW 4J0MA 2O6GE 2R3SA 3WU1B 4G6DA 4RAZA 4S04A 4NXNH 4EGYA 2W84A 5IT9W 1I1SA 3IKVA 2ISYA 3DV8A 3F6VA 1YQAA 2ZNZA 3O2PE 1TAEA 3WTXC 1IXRC 2HEOA 2VOOA 5LHIA 3QU3A 4G6QA 1OMIA 1OR7A 1P4AA 4M74A 4YFXF 1FC3A 4EEQA 5E8IA 1B1BA 3HHGA 2MLGA 1WWXA 2GQQA 3KP5A 2P7VB 1I94H 3K1MA 4MEYF 4LF8H 4IVNA 2WV0A 6PAXA 1AN7A 5KK1A 4DUYH 1J59A 4Z2YA 3J80K 4L5JA 3AAFA 2FMLA 1GXQA 1KQ0A 2IA2A 3MWMA 2BE5F 5DUKA 1XSXA 3EYYA 2ESNA 4HAMA 3WTZA 5FB2A 3K0LA 1I6UA 3BOQA 1SAXA 2FNAA 2RC4A 3FWEA 1WKMA 3BPVA 4HDVA 4ON0A 4G9YA 1D3YA 1XMOH 3WG9A 2OQRA 3F3XA 2TDXA 2JPBA 2W85A 4G94A 3J80Z 2KIUA 2JSCA 1O75A 3ZMZA 4BYYA 1BOAA 2GWRA 2YR2A 5HDNA 5TJJA 4IHTA 4XBFA 4LFCH 3WU0A 1W7PB 5HLIA 5F1RA 1PDNC 2IRFG 4BWSC 1T6SA 1QBJA 4YHHH 2VE9A 3IRQA 3KXYT 2UXBH 1A0IA 3GLXA 1BI0A 4OMYA 1BJTA 2KKOA 1AOYA 2XKOA 4B3RH 1P4WA 2PG4A 2UXCH 1YS6A 2H94A 1SMTA 2BGCA 1KU9A 1R1TA 3RGZA 4L9JA 3J81W 4P5OA 3G3ZA 5FPOA 4EJUA 2XRNA 1R7JA 4XSZF 1S8NA 2EJRA 4ZYEA 5DUIA 3RKYA 5LL6b 1LNWA 4JI6H 3DFGA 4QWQA 3RPUA 4HF2A 2XUBA 4FM9A 5D6FA 2VE8A 1T0FA 2QUFA 4UV9A 1KA8A 3HYIA 4GO1A 1IXCA 2Z5UA 3DEUA 2BBYA 2P5KA 1HW5A 3HOSA 1F9NA 3L9FA 4A2UA 2NRAC 1IBLH 3JW4A 1USSA 5D1OB 2NS0A 3LAJA 4HV6A 4ZZDA 3SZPA 2QM3A 5EEHA 3TOAA 5K5QA 1BBYA 1ZHSA 1I1GA 3T1HH 1TW2A 3F21A 3N6XA 4MV7A 3C0FB 3PN1A 1WQ2A 1SFXA 3RKXA 1HW2A 1L3LA 2J5OA 4UCTA 2DTRA 5ICFA 3JSLA 4ENJA 1J7KA 2BYVE 4A12A 2V1XA 1O57A 1P2FA 2VONA 4I02A 1I27A 4M6YA 1K78B 2FA5A 2YCHA 2RGVA 4IRIA 2CFXA 5D4SA 2GIVA 2HFHA 3F8MA 5LRSA 4UCOA 2FXAA 3BY6A 1KYWA 3WE2A 2VQEH 3HXLA 4DV6H 1S3JA 1GVJA 4HW0A 2FEZA 4A0YA 4DR7H 3JSNA 4LB6B 4AIKA 3WTTC 5HS8A 4WX9A 1ZG5A 2DU9A 3BJOA 5LRRA 3F8CA 4UVAA 1O3QA 4A0ZA 1HNXH 1FT9A 5F64A 1BI1A 3GFJA 2Z3YA 4ZH4F 2XHKA 4JBAA 1SFEA 3CTAA 2K4BA 2IVMA 1N33H 4M9XA 4EMSA 2PJPA 4PDBA 4LK1F 2ZCWA 4DR3H 2RDPA 2OQGA 4AQYH 1BN5A 4OIOF 2OD5A 3HSFA 3M8EA 4HDUA 2PMHA 3KE2A 1Z9CA 3RIRA 4GYGA 2OU2A 4OMZA 3ECOA 2F4VH 2MH2A 2F5CA 3KEOA 3P7NA 4IJAA 3RI4A 3FF5A 5JR3A 2QQAA 5AONA 2ZNYA 3HIFA 4ESJA 4FX0A 4DR1H 3ROUA 2VC0A 2XGXA 3JTGA 2PLYA 2DBBA 3R61A 1U78A 1TQIA 4EM1A 4GKJH 4R7RA 5E1WA 2BV6A 3E6CC 3K1NA 1HSJA 1CGPA 1LB2A