3MWMA

Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
GRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative metal uptake regulation protein
total genus 42
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mwmA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3mwmA02
1T0FA 1K7AA 3V7CA 5CVJA 3HTUA 3W6JB 3RI4A 2DTRA 2K7LA 2PI0A 4ZZDA 1JGSA 3K1NA 1IW7F 4KA4A 3R61A 2QQBA 3P9CA 5IT9Z 2EFWA 1FYLA 3WTZA 1EV7A 1U3EM 2PJPA 3ML6A 3ZMVA 2M5WA 2RVCA 3O6BB 3DXJF 3BWGA 4HZFA 2L4MA 4IJAA 5K5OA 5DCFA 2IA1A 4MHGA 1T39A 4I01A 3V8LA 4IVNA 4KT5C 2LF8A 1IUYA 2P6TA 2YPRA 3RPUA 3L09A 1K78A 1T6SA 4ZYDA 3CJNA 2R7DA 2DQLA 4EMSA 4MEXF 3CLOA 2P5VA 4O6JA 2E1CA 2UXNA 2WC2A 4YIFA 4LLGF 3HOTA 2Z5UA 1HKTA 2KIUA 3HHHA 1USTA 1F5TA 2JPBA 1MDMA 2QBYB 2EWNA 2IA2A 4A6DA 1QZZA 2EFQA 2HZTA 3L7WA 4D0PA 2XKOA 4EM1A 2Y75A 3ABTA 1Z05A 3SZPA 1P4AA 3J7AO 3HYIA 1FYMA 5BPDA 5AIPA 3REOA 2VBZA 3Q9SA 1U8RA 2FXAA 1ZG5A 4HW0A 4OOIA 5J8FA 2FA5A 1O7LA 1R7JA 1XGNA 5CVRA 3QP5A 4M9ZA 5KK1A 2VOPA 1XD7A 3JW4A 4KN4X 2WWYA 1R58A 1DDNA 1IXCA 1WWXA 4PDKA 4KIBA 4MNUA 2XAQA 4HV5A 3TO7A 1CF7B 1FP1D 3DQVC 3KP4A 4UNOA 4BAYA 2DT5A 1R1VA 1YQAA 2A5YB 3T8RA 4MEYF 3MZHA 1HKQA 1B9MA 5EEGA 4EJTA 1YTYA 3I59A 4P5OA 3CUOA 1SD5A 2MD5A 3H3ZA 1W7PB 3FZVA 2QBYA 5A2QK 3HIFA 2NNNA 3VODA 5DD4A 3BPXA 4BXUA 4U0YA 4CZZA 2FSWA 5JVTA 4Q48A 3TDUC 4EVIA 2H6BA 2VC1A 2TDXA 3P9IA 1BN5A 3PQJA 3T0YA 4A0YA 2UWMA 2R3SA 2RKHA 3BJOA 2K4JA 4BHPA 3BROA 2EFPA 3WTUC 3RIRA 3E97A 2A07F 4K2EA 1KYZA 5LHGA 4KNYA 4Q47A 1UB9A 4A5MA 5L3FA 3KFWX 3OOPA 1AWCA 3ZMUA 2VT2A 5LHHA 1WSUA 3E6BA 3WU1B 1YIOA 3FF5A 5HDGA 4G9YA 4MQ9F 1SFEA 5LEKA 5BPIA 4JBAA 4TV7A 2K86A 3F8NA 3HHGA 4WX9A 2FMLA 4HF2A 3FM3A 4MQVA 5DCMB 3ECHA 1YW7A 2RQPA 3MAJA 1RIOH 1KU9A 2HYFA 1HW5A 2DW4A 2XROA 1KU2A 2HKOA 1TNTA 3RDIA 1BC8C 2W24A 3DKWA 5KVRA 2WTEA 1XDUA 2Q2EA 3S2WA 1W7PD 1LDKB 2M45A 2F2EA 4U7DA 2ACJA 2HQNA 2W57A 1OMIA 4Y13A 3K69A 1EH7A 3BP8A 3O2PE 4KICA 4PCQA 1TQPA 3T1BA 3EYYA 2IW5A 3F72A 5EEHA 2UZKA 2P6SA 4OMYA 1O3RA 2GA2A 3CUQB 4H0EA 1WQ2A 2ESNA 1H9GA 2VONA 4BH9A 4I02A 4KFCA 2HQRA 1F1ZA 5LGUA 2E7XA 3M1EA 1KU3A 2G7UA 4AIJA 5FFZA 1Z9CA 1J2XA 2EK5A 5ILVA 3WGHA 1B4AA 3LAPA 3VB2A 3QP6A 1J59A 5LGNA 3E6DA 4E70A 2XVCA 1D8JA 2HR3A 4G6DA 2AS5F 4ENKA 2FRHA 3VEPA 1IN5A 4LK0F 1DUXC 5ICGA 1ZN2A 5FLXK 3WTXC 3TQNA 5ICEA 1B1BA 4OIRF 2NRAC 3LA3A 3GW2A 2RV8A 3SXYA 1JHHA 4KMFA 5IT3A 3KEOA 2CW0F 2Q8KA 3MQ0A 2VE8A 2O8XA 5L3BA 1VTNC 2OA4A 4WK8F 3WGIA 2OQGA 3EUHA 1ON2A 4GYGA 2A69F 5AONA 3BZ6A 1J5YA 4N9HA 4FHTA 4XLPF 2J5PA 2V6CA 4RS8A 1G6NA 2PMUA 3RJPA 5CVUA 3DV8A 1R00A 4PGHA 4UXNA 2XHKA 2B0LA 5ICCA 3GWZA 1LQ1A 2QZ8A 2DLLA 2ESHA 4UVCA 1Z91A 3E6MA 3ZMDA 3IHUA 1TQIA 3LFKA 1F9NA 3K9TA 4ESFA 3MWMA 2ZMEB 2RGVA 3TOBA 4IF4A 4O3MA 4LD5A 5HVQC 3C18A 3LSTA 2Y48A 1GXQA 5DEQA 2GQQA 3GUDA 4MTDA 3E5XA 3ZN0A 2E7WA 3KP2A 1ZH5A 1P4WA 2DK5A 1FOKA 1R5GA 4U0VA 4DQ2A 3HSRA 2V1XA 3N97A 2QM3A 1H0MA 5H20A 4N9IA 2K27A 4BHCA 1XSVA 1B6AA 3EYIA 4OU0A 1OYWA 1J75A 4HX7A 3GO5A 4UV8A 3V7SA 1G3WA 4BNCA 4YFXF 5CLSA 3RYPA 4GCVA 2COMA 1O3QA 2MH9A 3U1DA 3HRSA 1P2FA 1U2WA 1W7PA 1HW2A 2FU4A 4GGGA 1IN8A 5DD8A 5FFXA 2P7VB 3BOQA 2XAFA 3VFZA 3WGGA 1PDNC 4NHJA 3R0JA 3CUQC 2EA2A 4I7HA 3ZP5A 3CTAA 1IRFA 4U0WA 4R8HA 3IL2A 4G7OF 1R5HA 5J8CA 3F8FA 5ED4A 2FMYA 3SQNA 4HLYA 2F5CA 2DU9A 3I5UA 2LDUA 1P92A 2ISZA 3E6CC 1U78A 2HGCA 1KGSA 3DPLC 1O3SA 3KEQA 3F3XA 3KP5A 3L9FA 3ERED 2ZMEA 4BQAA 1STZA 4LGWA 5D4SA 5JI6A 3GLXA 4KUMA 3V7RA 3J80K 2L02A 1HSTA 3ZMSA 2GWRA 1LNWA 1XGOA 4BYYA 1QO0D 3ZQ7A 5K1YA 1O57A 1FBUA 1I1GA 4XLNF 2GA1A 5H6RA 4Q4ZF 4KDPA 4HV6A 3HRTA 2J5OA 3FXUA 1K79A 2FBIA 1ZRDA 1Z1DA 4JK1X 4IXAA 1XN7A 1KQ9A 1OPCA 2JSCA 2H94A 1FY7A 2DQRA 5ICFA 4EJOA 2IJLA 4LB5A 3IKVA 5ILSA 1S7OA 2NS0A 3MFKA 2WV0A 4OIPF 1E17A 2QWWA 2A6EF 3EQLF 3PFIA 4CICA 2IPQX 2XASA 5BOXA 3K1MA 2DFIA 2RNJA 2QENA 3JTGA 1REPC 4G7ZF 5F64A 1TBXA 2QQ9A 5D8LB 2VXZA 4IRIA 4EGYA 1MZBA 3L2CA 4M6XA 4WXHA 5BQTA 1TNSA 3JSOA 3TO9A 3QRFF 1SMYF 5FB2A 2QUFA 2NYXA 1OYYA 1QZYA 3CDHA 1T38A 3GZ6A 5L3DA 1HSJA 4XSZF 4EM0B 1U5TC 2M8EA 2VC0A 1H9TA 1BI2A 3BDDA 1S29A 4S05A 4QLCU 3IC7A 4ASNA 4F7ZA 4IHSA 4RGSA 2D45A 3F8CA 1A04A 4ZYHA 2OU2A 5E18F 2FF4A 5D5UB 3E5UA 2KJCA 2CG4A 2X4HA 4LG0B 3G3ZA 2BBYA 3I53A 2OQRA 2MH2A 2YR2A 2F5EA 2YX4A 3DFGA 2RN7A 1L0OC 2EV6A 1KA8A 4DNCA 4CYDA 3F23A 1BIAA 5BMZA 5CJ9A 4M6YA 2HWVA 4FT8A 4EV0A 4P9UA 3J80Z 2GXBA 2RC4A 2ZJ2A 3GF2A 2CSOA 2VE9A 3GYHX 3ISPA 3WTWC 5LHIA 4JQFA 2P8TA 1ZAOA 1FLIA 1TTYA 1IN6A 1R36A 3D5LA 2ZFWA 2P5LC 2CYYA 1YS7A 3QPTA 5E17F 4Y15A 1KU7A 2BV6A 2F5DA 3CO6C 4ETSA 3GVAA 4HYEA 4LG0A 1OKRA 4G7HF 5HS7A 4LB6B 2OBPA 1FP2A 2EA4A 1D3YA 4EGZA 3GXOA 1KQ0A 1XSXA 1RI7A 4RGUA 4EM2A 5JFRA 1D5VA 4A0ZA 3FX3A 3I71A 4ZH4F 1ZRCA 4YG2F 1FSHA 2D1VA 4KMUX 1XGMA 2BEOA 4IPAA 5FO5A 2XUBA 2XAHA 4LLLA 2GIVA 2L01A 3WTYC 3IRRA 5DUIA 2BGCA 3JTHA 3U9GA 3BPVA 5AIQA 1S7AA 5H6QA 1L3LA 5HS9A 3KZZA 3Q5FA 2KIFA 3LAJA 3M7GA 1CF7A 3FXRA 2ZXJA 3SZTA 1WRJA 5FLXZ 1DP7P 2Z9OA 1I27A 2A6HF 3RYRA 1LDDA 1O3TA 1ZGAA 2D1HA 3OV8A 1YS6A 3CUQA 2C6YA 2P7CB 1SFUA 1FYKA 2KRFA 3QU6A 4S04A 5D6EA 4UUVA 5D6FA 3C1DA 3P9KA 4ZYEA 1YFHA 3HOSA 4YFNF 5JR3A 1Y0UA 2IRFG 4IHTA 1ZYRF 4ESJA 3VOEA 3F22A 3MEXA 3GZ5A 4NB5A 3EETA 1LEAA 1IZ1A 1XMAA 3M8EA 2EFNA 1QBJA 2CGPA 2YSRA 3NRVA 3T8TA 1SMTA 1SD4A 5D5WB 3IWZA 3K0LA 4A5NA 5TJJA 5E1ZB 2PG4A 3EDPA 3DEUA 4I0AA 4PZJA 2HTJA 1EH6A 3HTSB 1HBXG 1J7KA 2DPUA 1FBSA 4G8XA 4CO8A 1ODDA 2HKXA 1I6XA 5LRSA 3I4PA 4EJUA 5JHUA 4IRHA 4L9VA 1HQCA 1D8KA 1XMKA 3LA2A 1ON1A 1HW1A 2CFXA 1SFXA 3J81K 4EQQA 4EJVA 1IXSB 1BIBA 3DP7A 1XB4A 3E3VA 3LQRA 4HDVA 2IVMA 1EH8A 2KIMA 4R79A 3R0AA 2L54A 4M9SA 3RTRA 1S3JA 1LJ9A 2K02A 5DYMA 2MBFA 4AWXB 2K4BA 5J6XA 3FM5A 3O3KA 2CWEA 2MC3A 2JTVA 4HBLA 1S6LA 2FE3A 1HXDA 3H92A 4FX4A 3GFJA 3WG9A 3NEUA 4PGGA 3GX4X 1USSA 3I54A 3U2RA 1V4RA 1IRGA 1RUNA 1W4MA 3F6OA 2MLKA 1ONVA 4ENJA 1JXSA 2OZUA 5E1XA 5HLIA 1FWZA 3D0SA 1UHWA 2QLZA 3J81Z 4AIHA 1YW8A 1SD6A 4RB0A 4RGRA 4RB2C 3V8JA 2HDCA 3TOAA 3MCZA 2FNAA 5BS6A 3JSPA 1HKSA 4M74A 5DUKA 2VBXA 2PBIA 1KYWA 2JZYA 2EV5A 2CO5A 4RGXA 3FMSA 2IA0A 3QAHA 4BHBA 2NAZA 2H09A 2XV4S 4WWCA 1G3TA 2QQAA 4P55A 4N0BA 2VN2A 2JRTA 5E8GA 2G9WA 3KP6A 4XRFA 1MGTA 1MDMB 4HQMA 3L00A 4OMZA 1LDJA 1Z7UA 5D5XB 4L9JA 1WI9A 4WXCA 1GHCA 3ZMZA 2O6GE 3HRUA 3TKYA 3KP7A 1JE8A 1S8NA 2XKPA 3N4MA 1FBQA 1G3YA 2KJBA 2ELHA 2IP2A 4YFKF 3I0TA 1NHAA 1ULYA 4CHUA 2EB7A 3I58A 5HS8A 1OR7A 5LLQA 2QYOA 4I09A 3ECOA 2LKPA 3TO6A 1RZ4A 3P7NA 1E2XA 2O03A 2X0LA 4LFUA 2L3DA 3FXQA 2XIGA 4OIQF 4LK1F 3FWEA 4AD9A 3M8FA 3F21A 4ZYGA 4GXOA 1XCVA 1B59A 1I5ZA 2BE5F 5CVIA 2FQ3A 4LLNA 1BI0A 3ROUA 2FNPA 1LB2A 1FZPB 5IT9K 2E1NA 4G94A 2LNBA 2Q0OA 3E5QA 3WE3A 1YO5C 5K5RA 3C3WA 2MLGA 4P96A 3K1PA 4CXFA 1PP8F 5HLHA 2ZCWA 4L0ZB 5E1WA 3ZN1A 3MZYA 1ZHFA 3GEZA 1QPMA 2DPDA 1PP7U 2F5FA 2PEXA 1Z6TA 2ETHA 2G7HA 2PMHA 1IF1A 2ADUA 5DDGA 4XSXF 4CDGA 4HAMA 3HSFA 2KKOA 1W5SA 5DV5A 2A3SA 2XAJA 3IRQA 4A2UA 1YW9A 5L3EA 2GAUA 5F6FA 3TGNA 4CGZA 4ESBA 1J9IA 2O0YA 4M71A 2FBKA 2Z3YA 3NQOA 3FMRA 2M1BA 1FT9A 2V1UA 2HS5A 3HRMA 2RDPA 1AOYA 3R6SA 5HDNA 3G73A 2VBWA 1TW3A 5LGTA 4HA8A 4L9NA 4NQWA 4Q5SF 4LJZF 1R1TA 2A68F 2OZ6A 1FPQA 4WXDA 2CQKA 2H6CA 1IN4A 1LVAA 2V79A 5D8KB 3IKTA 1Z6RA 1XDSA 3ZMTA 3KE2A 1ZG3A 2FBHA 1O7FA 1XCBA 1WKMA 1UCRA 1TLHB 4HF1A 1MD0A 5FD5A 4AVPA 3ELKA 1XGSA 4YIIA 3FHZA 2FEZA 2UXXA 3QU3A 3WTTC 1QNTA 4B8XA 4A0XA 1C0WA 3WTSC 4HOBA 2HFHA 3KZYA 5ILUA 5HOOA 4HQEA 1W5TA 1BI1A 4QWQA 2NNYA 3LQQA 1K6OA 2OD5A 6PAXA 3I59B 2YU3A 2JPCA 1ZLJA 3LA7A 2DK8A 3CO7C 1DPRA 1ZREA 5LBQA 4UVBA 1T98A 4WCGA 5D4RA 3PQKA 1P6RA 2W25A 4B09A 5A2QZ 2M30A 2DO7A 1ZRFA 4FX0A 1BM9A 4RAZA 2ZBKA 4IRGA 1YYVA 4P9FA 1UHMA 1JHFA 1U6GA 4KIFA 1QGPA 1RNLA 2EJRA 1ZGJA 4HLXA 2P5KA 3F8BA 3C7JA 2ISYA 5E20A 4UVAA 5FD6A 2JT1A 1TQMA 2STTA 4Z2YA 1FX7A 4HX8A 4ZZLA 3HUGA 3DPTA 3KP3A 2DBBA 3COAC 4Y17A 2HOEA 4I98B 5F1RA 3ZPLA 4ENMA 3Q9VA 2VOOA 3SFZA 4I0BA 1BBYA 4L5JA 2PLYA 4UV9A 1MJAA 3QPHA 4L18B 2VT3A 1GVJA 3H3UA 4AIKA 1KQ8A 1BI3A 4GO1A 2ZNZA 1G4DA 5HDKA 4L9TA 3GFLA 4UHTA 2STWA 2XAGA 2LF7A 4WF2A 1FC3A 4A6EA 3RKWA 5K5QA 1MJ9A 3R60A 3HSEA 2A61A 1YG2A 1T2KA 1TW2A 1K78B 2VODA 4OIOF 3BY6A 2Z33A 3GFIA 1IAWA 4MTEA 1YLFA 2HYGD 4U88A 5CVVA 5ERIA 1GXPA 1QQIA 4A12A 2Y0MA 3JAMZ 2HEOA 3V4GA 3K2ZA 2W85A 2YX7A 3B02A 5D5VB 4U7BA 3WTVC 3KLNA 4M9XA 2XGXA 3AAFA 1F4KA 1B9NA 2GZWA 1Q1HA 3BJAA 4KYWA 3F8MA 3F6VA 3RKYA 3ULQB 3LWFA 4RAYA 1OYIA 2R7FA 3BJ6A 1U5TA 4I2OA 1MJBA 2O61A 4ON0A 2H27A 2V9VA 2LSOA 3M9AA 1BJAA 5TRDA 4KIGA 3WU0A 3DF8A 2DI3A 2D2WA 3JAMK 1X3UA 5L3CA 4HX4A 4R1HA 4O5VA 2DAOA 2V1DA 5CYVA 4OINF 4L0YB 1I1SA 1J0RA 3R4KA 3RKXA 2ZKZA 5E8IA 2VBYA 5L3GA 3KETA 1ZARA 1UFMA 5FGMA 1R1UA 2EV0A 1V3FA 3FMQA 1ZLKA 3TDZC 3I64A 4RB3C 4XBFA 3V8KA 4G6QA 3SHFA 1LEBA 1SD7A 2OAZA 2M87A 1P4XA 3B73A 1XSDA 2IT0A 2QVOA 4HF0A 4RB1A 3RPQA 2O3FA 3T5XA 3KCCA 5LRRA 4LMYA 1R23A 4GYIA 1CGPA 5LEJA 3WODF 2HTSA 4HDUA 2MA3A 2PN6A 3IWFA 4MGRA 1IN7A 3WE2A 3GFMA 1BC7C 2W84A 1RUOA 2L4AA 4M73A 5HLGA 1BOAA 1SAXA 2ZO4A 2PQ8A 2XRNA 1PUEE 1IXRC 2GXGA 1FSEA 4EJWA 2EFOA 3W6KB 1DPUA 1MKMA 3KLOA 4ENNA 4KN7X 5DCMA 2P4WA 4M72A 1FNNA 2PFBA 2Z99A 1G3SA 1ZG1A 2BYVE 3ABUA 1R22A 3QOPA 2FOKA 2ZNYA 4L5IA 1U5TB 2AXLA
chains in the Genus database with same CATH superfamily
1T0FA 3HJEA 1K7AA 1CE8A 2OJED 3V7CA 2R8IA 2VXDA 5CVJA 3HTUA 3W6JB 3RI4A 4QWEA 2HGSA 2DTRA 5JQWA 4AYBN 2K7LA 2PI0A 3JAMW 4ZZDA 2P81A 1JGSA 1XMOH 3DBRB 3K1NA 1IW7F 4KA4A 3R61A 1C30A 2QQBA 2VKDA 3P9CA 5IT9Z 2R7MA 2EFWA 2XPUA 1FYLA 3QYEA 3WTZA 5KFYA 4IL6C 2EBIA 1EV7A 1BW5A 3GIQA 4PJMA 4NC8A 1U3EM 2DJIA 4LF8H 4XR6A 2PJPA 1B33N 4A3CG 3ML6A 3ZMVA 2GPWA 3CCLI 2YS9A 2M5WA 3E7LA 1SEUA 4M3EA 1EYZA 3DU6A 1IBLH 4QWBA 2CQQA 2RVCA 3O6BB 3DXJF 3BWGA 4RM2A 1WI3A 3RFCA 4HZFA 1HNWH 2VPQA 2L4MA 4IJAA 5K5OA 5LMNH 5DCFA 4BJTA 4A3MJ 1QRYA 2VI6A 2IA1A 5DQGA 3CQZJ 3ZQFA 2VUMJ 1SCUB 4CC5A 4MHGA 3GIJA 3BQ2A 1B72A 2BHYA 1T39A 5JHFA 1APLC 3BTLA 4I01A 3V8LA 4KITB 4IVNA 1Z2NX 1JKPC 4KT5C 4R8UB 2LF8A 3CCYA 1GVDA 5KFXA 4F4WA 1IUYA 1X9NA 2P6TA 4IZOA 5K7ZA 2YPRA 2CU7A 3RPUA 3PFYA 1CQTA 3L09A 1K78A 2LKXA 2UVUA 1T6SA 4ZYDA 4LIUA 3RB4A 1LPQA 3GIIA 4I99C 5C5JA 3CJNA 2W6QA 1N25A 5IYBG 2COBA 3ZQLA 4ED7A 2R7DA 2XSDC 2DQLA 5KFFA 4EMSA 3E1SA 3DLLF 4JOMA 5M5YJ 3M8JA 3OSGA 4MEXF 3CLOA 4BBSG 2V4QA 1D1CA 2P5VA 3SEQA 1DU0A 3DTIA 5CKTA 2IS6A 3BTJA 1X2MA 2MC4A 4O6JA 4BDYA 2FJZA 1SVMA 1HCRA 1W0TA 2E1CA 2UXNA 2WC2A 4J9MA 4A3LG 4MV9A 4YIFA 1XPXA 4IHVA 4LLGF 2XF6A 3RQ4A 5DM7F 2DA4A 4EYHB 2HQ5A 4LITA 2QKMB 4IHJF 5IPAA 3HOTA 2J6TA 5KFNA 3OYEA 1IO2A 2RQQA 2WB1N 2Z5UA 1HKTA 3N8DA 2HHHH 1JI8A 2P0AA 5HODA 5KFDA 5EDWA 4PUSA 1WGXA 2KIUA 3CMMA 1PYVA 3HHHA 2CQYA 2W71A 5B5EC 1USTA 3A01A 3DCFA 3OSFA 5FLXW 2C2EA 2W6NA 3K4LA 4O3SA 1F5TA 1JUSA 4ZDOA 2JPBA 4IAJA 5FKLA 2DOAA 4NXMH 1FVIA 3QPLA 1MDMA 2R85A 2LR8A 4DUYH 2QBYB 1POGA 2EWNA 3ZR8X 4F4XA 2IA2A 4A6DA 5C44G 5FLVA 1QZZA 2EFQA 5KFZA 2HZTA 5EGOB 2ZJTA 3L7WA 4D0PA 2XKOA 4LIVA 4EM1A 2Y75A 3ABTA 3BCBA 1YITI 4IHXA 4D7MA 1Z05A 3SZPA 2LRDA 3V4ZA 3I9V2 1P4AA 3S93A 4JI1H 2R7OA 1YRNA 4RDUA 3J7AO 4B4CA 3HYIA 2V58A 4HPQA 5FKMA 1YI2I 1FYMA 2FPIB 2X85A 3G1LA 5BPDA 5KG5A 2ELKA 4UCRA 1JTYA 5AIPA 3REOA 3CCQI 2VBZA 3Q9SA 1U8RA 4UUSA 4BY1J 3RAXA 4IOAF 2FXAA 4DR3H 1ZG5A 1ACIA 4CCKA 3H0DA 4ZC3A 4HW0A 4OOIA 5J8FA 2FA5A 1O7LA 4C9YA 2K85A 3VWBA 2XB0X 2HDWA 1R7JA 4O4IF 1XGNA 5KKNB 2Y31A 5CVRA 4E4HA 4ED3A 1ETKA 3QP5A 1ZETA 1SVLA 3BR3A 1AKHA 2GLOA 4O2BF 4JV2A 2G0EA 2IP4A 3PNYA 4M9ZA 3MFIA 5F0CA 5KK1A 1E4FT 2VOPA 2BW3B 5KFUA 1XD7A 2VL8A 2QCOA 1N75A 3RCOA 2AGPA 3PUFA 4ME6A 3RPUD 3IUOA 3JW4A 4KN4X 2WWYA 1ZHQA 1K4SA 1R58A 2FB9A 1DDNA 4XKWA 2YU9J 2WYOA 3RB6A 1IUFA 1IXCA 3KHRA 4PFPA 1WWXA 4QPOA 1BA5A 3TL4X 5HLTA 4PDKA 2YUSA 4KIBA 2XAQA 4HV5A 4MNUA 3TO7A 1FP1D 4E7JA 3DQVC 1CF7B 2L7MP 3KHGA 3H1CA 3KP4A 4UNOA 4BAYA 2DT5A 3RB3A 1R9TJ 3HOZJ 2VQEH 1R1VA 3PO2G 2L7KA 1YQAA 2A5YB 3T8RA 3CCEI 4MEYF 2E2HJ 3MZHA 4BDZA 1YRNB 5FKOA 3PSIA 3LSRA 4KHPH 1HKQA 2Y0SN 1B9MA 5EEGA 4IHYA 4EJTA 1FKAH 3DBLB 3LSKA 1NTCA 1X2NA 3I59A 4P5OA 1YTYA 4PJLA 1ZR2A 2JJ7A 5J47A 3MD2A 2QK4A 2DMPA 3CUOA 1E4EB 4A3KJ 1SD5A 2MD5A 3H3ZA 1W7PB 3FZVA 4FE7A 3S3MA 3RZOJ 3A03A 1ZQ7A 3KAKA 2OH2A 2QBYA 3JRBA 5A2QK 4J9QA 2BY3A 3HIFA 2NNNA 3HOWG 1LFUP 3VODA 5DD4A 1UJ8A 5EYRA 1A36A 1QZEA 4AM3A 3BPXA 1TP4A 2V5AA 2VJJA 3FXLA 4BXUA 3GV8B 4E6KG 3G6VA 3HOYG 5EJCA 1I3QJ 1UG2A 4U0YA 5EZYF 4XN3A 2IBDA 1V55H 2NU8B 4CZZA 2VJIA 2FSWA 1HNZH 3K4KA 2WDTA 5JVTA 2NOGA 4Q48A 4W97A 2WV1A 3TW6A 1YJ9I 3TDUC 2QSGX 2FK3A 4EVIA 2H6BA 2VC1A 1TL8A 1KJ8A 4ZHQF 2TDXA 3P9IA 1BN5A 3PQJA 3T0YA 3S1MJ 4F93B 4JP0A 1K83A 4A0YA 4NDLA 2HYJA 2UWMA 1Z0XA 2R3SA 2RKHA 3BJOA 3HOXJ 2K4JA 2TCTA 3QYBA 4BHPA 3H9QA 1R71A 2FPGB 3SE7A 4TV9F 3BROA 2ZJRF 3BQZA 2XCAA 2EFPA 3WTUC 4Q8FA 3RIRA 3E97A 2A07F 1OCPA 2Q1ZB 5KFIA 4XLFA 4K2EA 1N56A 1KYZA 2KP6A 5LHGA 3CMAI 2DDBA 5KFAA 4X0GA 4C2UA 2XCLA 1T3NA 2HI3A 3BABA 3OTOH 1RESA 1MNEA 1JJ8C 2R8KA 5EEAA 4KNYA 4Q47A 3PSFA 1Z2OX 1UB9A 4A5MA 1CQIB 3OIOA 5L3FA 3GIPA 4XNFA 1Z67A 3KFWX 3OOPA 1IRZA 2XF5A 3S14J 1AWCA 3ZMUA 4I55F 2VT2A 2OCEA 4RZRA 2WAQA 4DR1H 1WJ5A 1Z3YA 3OYIA 2JA7J 1T33A 5LHHA 1IBMH 1WSUA 3LSHA 1XG1A 5KFEA 3E6BA 1ORKA 3WU1B 4XKBA 1YIOA 3JZIA 1YX5A 1PX2A 4DV7H 4MV3A 3J7AK 3FF5A 5HDGA 4G9YA 4KT6A 4MQ9F 4QSHA 1TT0A 1SFEA 3FKJA 2EZHA 5H2FC 5LEKA 5BPIA 4JBAA 2FUG2 3DF7A 1UC8A 4TV7A 2K86A 3F8NA 3HHGA 3LL7A 4RZQA 1TZLA 4IR9A 4WX9A 4XLAA 5KT7A 5C4XG 2FMLA 4HF2A 4EEYA 4DL2A 3FM3A 1OR7C 1XTAA 3GTMJ 1OCCH 3Q8PB 4MQVA 5DCMB 2MD0A 1X1AA 3BA8A 3ECHA 4QW9A 2DN0A 1YW7A 4BY7G 2RQPA 2WAQN 3MAJA 3QYFA 5F0FA 1DU6A 2YRWA 1RIOH 1KU9A 3VPCA 3HM5A 3AG3H 2HYFA 1HW5A 2DW4A 4W1UA 2XROA 3S15J 3H0GG 3OL3A 1I3QA 1KU2A 3HL2A 2JA5A 1MIJA 2HKOA 3BZKA 5B66C 1TNTA 2JA8J 2JA6A 3CC2I 4YB8B 3RDIA 3H3VH 1BC8C 2W24A 3M4OJ 1SYXB 3KYDB 2WBMA 2IMWP 3DKWA 5KVRA 3MR5A 2ECBA 4XL9A 3GTGJ 2WTEA 1BL0A 1A9XA 1XDUA 2Q2EA 3S2WA 2CQXA 1W7PD 4DBQA 3AKZA 1FOYA 4BWSC 3GTQA 1LDKB 1WR2A 1EZ1A 2M45A 3HOUG 4IRCA 2F2EA 3AG4H 4U7DA 2ACJA 3I4NG 2HQNA 3IH3A 2W57A 1ENHA 1OMIA 3JR9A 4Y13A 3AG2H 4FBTA 3K69A 3DPUA 1EH7A 3BP8A 3O2PE 3ZQHA 2IS2A 4KICA 4PCQA 1TQPA 3T1BA 1MH4A 1JUMA 1MBEA 2IW5A 1EKEA 3EYYA 1Z21A 3F72A 3WHCA 3CC4I 4X62H 3G6XA 1FOWA 1E3PA 5EEHA 3EUHC 2UZKA 1MBGA 2P6SA 4PJNA 2O8KA 4OMYA 2WB1A 2NVYA 1ZKGA 2HU9A 1O3RA 2GA2A 2JA2A 3CUQB 3OYFA 1QPIA 1W93A 4H0EA 2E71A 3JCUC 4RUAA 2M7BA 4Q43A 3RQIA 1WQ2A 2JEFA 3GTPA 2ESNA 1VBGA 1WSCA 1H9GA 2VONA 2DOEA 4MIMA 4BH9A 5C4XJ 4I02A 2UXDH 4KFCA 2HQRA 4QIWN 5D8DA 1F1ZA 2DPIA 4MV6A 2AHQA 3G1OA 5LGUA 2BQ3A 3K5HA 2O5RA 2E7XA 3M1EA 1KU3A 3N41B 2D5VA 4GRIA 3J7AY 1WJEA 2K9MA 2G7UA 3OYCA 5FFZA 4AIJA 1Z9CA 5I47A 1J2XA 1IV6A 2HVRA 3K70C 2CQ7A 4ECUA 2EK5A 5ILVA 3PM1A 5F27A 3WGHA 4J01A 1SANA 1B4AA 5B1AH 1S5LC 3K5IA 3LAPA 3VB2A 3QP6A 1J59A 2XGQA 2PX9A 5GPCA 4YELA 4PJJA 4E4TA 5LGNA 3E6DA 4E70A 2XVCA 1D8JA 2HR3A 4G6DA 2VQDA 3VDXA 1S0MA 3FDYA 2AS5F 3DLAA 4ENKA 2X1CA 3FKIG 1VQKI 3GV5B 2Q2TA 2FRHA 4B48A 3VEPA 4M3GA 1IN5A 4LK0F 1VF9A 1DUXC 4FBUA 2X51A 1D1AA 5J3LA 2W7NA 1JKQC 4C5CA 5ICGA 1ZK8A 5A2QW 2UVRA 4B3TH 4JI0H 2GM4A 1ZN2A 5FLXK 3WTXC 3TQNA 3CCSI 5ICEA 1B1BA 4OIRF 2NRAC 3BR1A 3K6GA 3GTQJ 3ZXSA 3IAS2 3LA3A 4HNTA 3D1NI 5IWAH 3L2WA 1TWGJ 3GW2A 3C2GA 5CQEA 4RAGA 1XS9A 4NNJA 2RV8A 1SVOA 1V5GA 3SXYA 2WB1E 1JHHA 2DA2A 4M9UA 1W1WE 3AFHA 2VLAA 1H88C 2BHZA 1VQ4I 4KMFA 2YS7A 2ZDHA 4UCOA 4JI6H 5IT3A 3RKQA 3Q1KA 3KEOA 5GADJ 1WJBA 2CW0F 2Q8KA 4YEJA 5IOZA 3MQ0A 1Z7LA 2VE8A 3JRGA 2AQ4A 2O8XA 5L3BA 3GTGA 5J2UF 1VTNC 2OA4A 4WK8F 3WGIA 3OL4A 3A0HC 2UUBH 2BVLA 1V54H 2OQGA 1D5YA 5DQHA 1IC8A 3EUHA 1ON2A 4GYGA 3MKZA 2NUAB 4JI5H 2R0QC 2A69F 2KZGA 4BQQA 5AONA 3BZ6A 2JVGA 1J5YA 2FJ1A 3EUKL 4N9HA 5L1LA 3HPHA 3T1HH 4FHTA 5F1JA 2SCUB 4XLPF 3JRWA 3QODA 4JI3H 2J5PA 2V6CA 4AU7A 3CCUI 3S3NA 4RS8A 1G6NA 2PMUA 1ULZA 3RJPA 5CVUA 4II3A 3DV8A 4AQYH 1R00A 1SC7A 4LF7H 4PGHA 2W9AA 3CZ6A 4QWDA 3B6CA 3HG9A 4UXNA 2DA3A 2W48A 5JVGF 1UMQA 2XHKA 3MWEA 2JMWA 5FPOA 2B0LA 5KFQA 1WH7A 4GKKH 2F48A 2OF7A 3GWZA 5ICCA 3Q8SB 5TISC 1LQ1A 4NC6A 3BJYA 2QZ8A 4LF4H 4HNUA 2DLLA 2ESHA 4UVCA 1TAEA 1OQYA 1Z91A 3E6MA 4C3HJ 1GSOA 3ZMDA 2HOTA 3IHUA 1TQIA 4DR2H 3LFKA 1F9NA 1LFBA 1TA8A 3K9TA 4ZDPA 4DL6A 4ESFA 3MWMA 1ETXA 2ZMEB 4Y4RA 1ZELA 2AO9A 2RGVA 2UUAH 2KFDA 3TOBA 2DYSH 3V4SA 3H5NA 2KT0A 4IF4A 2HVQA 4O3MA 1XMXA 4LD5A 5HVQC 4OWRB 3C18A 3LSTA 3CF2A 3OS2A 3E5NA 3K3VA 1JKOC 2Y48A 1GXQA 2ELJA 5CA1F 4CYCB 3PR4A 4CCMA 2DJNA 5DEQA 5IYBJ 3KTMA 2A5WA 4MA5A 2LFBA 2KDZA 2LH9A 2R7VA 2GQQA 3OR2C 3AL0B 3GUDA 5C8YF 5KG7A 2KPMA 5J4YA 4FTHA 3PO3J 3KALA 1XMQH 4FISA 4MTDA 2MFZA 3E5XA 1ETOA 4B47A 3ZN0A 2E7WA 2HQAA 3KP2A 2I87A 1ZH5A 3JSNA 4F91B 2R8HA 1P4WA 2W82A 2DK5A 2R5YA 4CH7A 2LTPA 5EZHA 1FOKA 4UUSB 1VS0A 4D5CA 1GT0C 1R5GA 4U0VA 4F50A 1Y1WG 4J9OA 2VKEA 3OOUA 4L1KA 1N78A 4A3FG 4DQ2A 3HSRA 2Y0SE 2V1XA 3VYSB 3OIQA 3SDBA 2CV1A 5C1PA 4Y8VB 3N97A 4FCYA 4DYQA 4JYAH 4B3SH 2QM3A 5FKKA 2HJWA 3ETJA 3RB0A 4I6ZA 3C2BA 1VQOI 1H0MA 1K1QA 4II2A 4XICA 5H80A 5EDNA 3BC8A 5H20A 2EZKA 4O4HF 2DMNA 4N9IA 2K27A 4BHCA 2EPFA 3OHAA 1XSVA 1B6AA 3EYIA 2VA3A 4U6PA 2NU6B 2FLPA 4OU0A 5KNLA 2PMZA 1OYWA 3VYTB 2HNHA 5C4JJ 3RGXA 4A3EJ 1J75A 2BQRA 1HDDC 2VASA 4HX7A 3A4CA 3GO5A 1W36D 4UV8A 1T8IA 2NVXA 3I4MJ 4JYKA 2W7OA 2R7TA 2HXOA 2O7OA 2JK3A 4XORA 3V7SA 1G3WA 4QTRA 5CA0F 4BNCA 4YFXF 5CLSA 4HQ6A 2VQLA 3A02A 2K3PA 2COMA 4GCVA 3RYPA 1O3QA 2MH9A 3Q0UA 3U1DA 4E7SA 3N42B 3RV3A 4X64H 3HRSA 1P2FA 3PUBA 1U2WA 1W7PA 5JLXA 1HW2A 2FU4A 3Q0VA 1E4EA 2WY7Q 4ECYA 1FEXA 3EUAA 4GGGA 4JX5A 2OUMA 1IN8A 3HB9A 5DD8A 5HV6A 5FFXA 1G59A 2P7VB 5JH7F 4XX0B 2YRXA 2E5NA 2F4OB 3S2DJ 3BOQA 2C28A 4JUZA 2XAFA 3VFZA 2W6ZA 3WGGA 1PDNC 1WPKA 4NHJA 1MMDA 2Q2UA 1OCRH 4FETA 3R0JA 3CUQC 1BW6A 2JA7A 2EA2A 3V6HA 1E3OC 4I7HA 5KFOA 3ZP5A 2VPSA 3CTAA 4J9KA 1IRFA 2OPTA 4U0WA 4R8HA 3IL2A 5KFLA 4YIRX 5EWGA 1V5FA 4Q45A 3K7AJ 4G7OF 4LH6A 2X6OA 1VQ8I 1H89C 2PJRA 1R5HA 4BEHA 1P7IA 3F8FA 5J8CA 5DG8A 4J9NA 1RYSA 4LF9H 2V9KA 2IBKA 4AVZA 3HPGA 1RJQA 5ED4A 1U0JA 2FMYA 3SQNA 2IXSA 2M4KA 4HLYA 2F5CA 2DU9A 5KCMA 1JDEA 3L2PA 1N48A 3I5UA 2DMQA 2DXIA 4RMNA 2LDUA 4CYCA 3VPBA 1P92A 2DFEA 2DA6A 1LE8A 5KFRA 2ISZA 3E6CC 1U78A 4LFCH 2HGCA 2K9SA 1KGSA 2WAFA 3L2VA 3DPLC 1V5EA 1JJ6C 4RA2A 1O3SA 3KEQA 3F3XA 3KP5A 1U8BA 3WNZA 3HKZA 3H9JA 2V4JC 3L9FA 4V2GA 2FLNA 1IV8A 2KIQA 2XC7A 3ERED 2ZMEA 2W6MA 1Q1VA 4BQAA 5C1OA 1STZA 4LGWA 4E7ZA 1VNDA 5D4SA 1BJTA 2RF4A 5KT4A 4HR7A 5JI6A 3GTLA 2KQRA 3ZQIA 1ZGWA 2HPIA 3GLXA 4KUMA 1I6HJ 3V7RA 1BR1A 3J80K 3GCMA 2K3FA 2L02A 3TIGA 1HSTA 1IG7A 4DR6H 1TWAJ 3ZMSA 1FJGH 2GWRA 1LNWA 4O3QA 5EWEA 1AA7A 2WAEA 1MBHA 1XGOA 4BYYA 4DV4H 5EGOA 1QO0D 3ZQ7A 5BR8H 1FMWA 4A93J 3LMLA 5F9NA 5K1YA 1O57A 1FBUA 1I1GA 4XLNF 2GA1A 5H6RA 2CRGA 3ZOBA 1Z3XA 5CAEB 2NVXJ 4Q4ZF 4KDPA 4B3MH 4HV6A 2IS4A 2UXBH 2OCCH 1Y1VG 3DU5A 3H3VK 3HRTA 3FK7A 2ZDGA 1N32H 3A01B 3HGGA 1HR0H 1YOVB 2J5OA 3B6AA 3FXUA 5IYCJ 5DLFA 1K79A 4EFEA 2FBIA 2VJ5A 3WHBA 1NK2P 4YJ3F 3T1YH 3HXLA 1ZRDA 1Z1DA 2EIMH 3GTJJ 1JIHA 4JK1X 4EATA 4DV2H 2CJJA 4A3FJ 3GMEA 4IXAA 1XN7A 3C2HA 1KQ9A 1OPCA 2R7XA 1AU7A 3WO0A 2JSCA 2H94A 1FY7A 3M1CA 4JX4A 2BOLA 3KPHA 3N6XA 2Y0SA 2DQRA 5ICFA 2PMZN 4E7KA 2NU7B 4EJOA 1K61A 2IJLA 3ASOH 5L1JA 1RJPA 2YZMA 2OC6A 3BTIA 4LB5A 3IKVA 5ILSA 1S7OA 3NAUA 2NS0A 5IP6A 3VPRA 1X3WB 3HOXG 3MFKA 2WV0A 4OIPF 3N40P 3TINA 1E17A 1KBLA 2QWWA 2A6EF 2OV7A 2OTJI 1P9QC 2X6WA 3EQLF 3PFIA 3Q2OA 4CICA 3PW7A 2IPQX 1S0NA 2XASA 5LOVF 5BOXA 3K1MA 4MO7A 5KAFC 2DFIA 2LG4A 2RNJA 2JA6G 3JRDA 2QENA 3KX2A 3JTGA 4GFBA 2R7UA 2K40A 2YL2A 4UCTA 4DLKA 2BZTA 2MABA 3BZCA 1REPC 3HOUJ 2XGEA 1VBHA 4ED2A 4UB8C 2JSPA 2ECCA 1A6QA 1V9PA 4G7ZF 3BG5A 5F64A 1VQNI 1TBXA 2QQ9A 2ME0A 1D0XA 5D8LB 3S1NJ 2VXZA 5GTHC 4E7HA 4DIQA 4IRIA 4DV5H 1IOWA 4YY3H 3GIKA 4EGYA 5BPHA 1YX3A 4YRVA 1MZBA 3OYHA 4XYLB 1ETWA 3L2CA 4LH7A 4M6XA 4WXHA 5BQTA 1DIKA 1TNSA 2H1KA 4KJZA 3JSOA 3TO9A 2GOMA 4YR0A 2F4IA 3JRCA 4RU9A 3QRFF 2UVVA 1SMYF 3K4MA 3S1RJ 1RKTA 5FB2A 5F04A 4YJ2F 3JRIA 1FTTA 2QUFA 2VQGA 2ZJPF 2NYXA 2W6OA 1OYYA 1CS0A 1QZYA 1RPWA 3CDHA 2EINH 3WU2C 3N05A 1W36C 2WADA 3DTEA 4UUTA 1T38A 3FKIA 2JQ7A 3GZ6A 5KT2A 1XC5A 3D5RC 2LP0A 3BG3A 1NK3P 3RAQA 5L3DA 1HSJA 1IDYA 4PWQA 4XSZF 4ZJZA 1VQMI 4EM0B 1OJLA 2P0WA 1VQPI 4CCJA 1LKXA 1U5TC 4A3BG 2M8EA 2ZM6H 3RIZA 2VC0A 5EWFA 3SZGA 1BI2A 1H9TA 4JX6A 2V6EA 2DCEA 3NARA 3BDDA 2CMPA 2X9DA 4XZ3B 1S29A 4S05A 2RDIA 3ABMH 1T95A 3UFXB 1R49A 4QLCU 4IEJA 2FX0A 2HVSA 5K7HA 4LF6H 4YHHH 1FIPA 2E1MC 3IC7A 2MGQA 4ASNA 4DV3H 2JA6J 3BQ0A 4F7ZA 4IHSA 1EUDB 4RGSA 2DZDA 3PW5A 2D45A 3F8CA 1Y0NA 2E1MB 4HEA2 1A04A 4ZYHA 2OU2A 5E18F 3Q8RB 2Q2EB 4BE0A 3CVZA 2FF4A 3KYCB 2X1DA 5D5UB 3E5UA 2F5VA 2KJCA 3G6YA 1Y8QB 2CG4A 2C22A 2X4HA 4LG0B 4MV4A 2R92J 1I7LA 1DP3A 4EYIB 2I10A 3G3ZA 2BBYA 3I53A 1B04A 1VKZA 3G1MA 2VQHA 3OMYA 4RLFA 2LK2A 2OQRA 2GXAA 3HOVJ 3AYHB 1WCMJ 2CZGA 2MH2A 1RR7A 4ZOLF 2YR2A 4P1WA 4ITVA 2F5EA 2YX4A 3DFGA 4BBSJ 5T14A 1AUVA 2RN7A 1L0OC 2NOJB 2EV6A 2XC9A 5KG1A 3OUZA 1KA8A 2E5LH 3BQYA 4DNCA 3GIMA 4CYDA 3F23A 5F0HA 2E2IA 1BIAA 2RGRA 1GYFA 2B7EA 3OS1A 5BMZA 4Q44A 5CJ9A 4A2BA 1MBKA 4M6YA 3VYUB 3BCAA 1M6VA 3V6KA 2DOFA 3SDGA 2HWVA 4FT8A 4EV0A 4P9UA 3J80Z 2B9SA 2V4RA 3OYJA 2RC4A 2GXBA 2ZJ2A 4A2AA 1T08B 5KG6A 2KHMA 3GF2A 2CSOA 4J00A 2XGDA 2VE9A 3GYHX 4A3JJ 4OAYA 4O3PA 3ISPA 3WTWC 3ZQCA 4ED6A 4EFBA 2FD5A 3L2UA 4TV8F 5LHIA 2NS8A 4JQFA 2P8TA 1ZAOA 5F08A 1FLIA 1A5JA 1TTYA 3RBDA 3KYLA 1IN6A 1B8IA 1R36A 4I50F 2UV1A 3UNGC 4J19A 3R5FA 3A1YA 3D5LA 2ZFWA 3GTPJ 3G2BA 3N44B 1XX5A 2P5LC 2CYYA 1YS7A 3K70D 2HXIA 4EGJA 2R7KA 3QPTA 4LG3A 1FMVA 3PN1A 1H8AC 5E17F 1Y39A 3T5LA 4EGQA 4DL3A 2LC2A 3H4DA 4Y15A 1FOXA 1KU7A 2BV6A 2F5DA 3CO6C 1X1CA 4ETSA 1TWCA 5KFTA 2KLOA 3GVAA 4HYEA 4LG0A 4B43A 1FJLA 2CFOA 1OKRA 4ECTA 5GP9A 5IYZF 4G7HF 4JV0A 5HS7A 1Y8RB 4J9RA 1M0TA 2AQFA 4LB6B 2OBPA 3UR3C 4B3AA 1IDZA 1OISA 1HDPA 1FP2A 2EA4A 2ZSIB 2RREA 5CB4F 4X66H 1MW7A 2ASLA 3I3LA 1RR8C 3U9TA 4LSAA 4ECRA 1D3YA 4JV1A 3FISA 4EGZA 3T5HA 2UUCH 2JEIA 2DWCA 3GXOA 1KQ0A 1XSXA 1RI7A 5C3EJ 1DV1A 3BR6A 3ESWB 1G2HA 1S72I 3IV5A 4RGUA 3PIPF 1IRXA 1MBJA 3WG7H 4CSWA 4A0ZA 4CUGA 3ABKH 4EM2A 5JFRA 4A3BJ 1D5VA 3CLQA 2R7SA 3H4BA 1D0ZA 4B3RH 4QJFA 4D1QA 1JX4A 1X4OA 1U9NA 3FX3A 3I71A 4F3QA 3CJTB 4ZH4F 1RC9A 1ZRCA 4YG2F 1FSHA 4V19K 2D1VA 2Z16A 2GLTA 5KX5F 4KMUX 1XGMA 2BEOA 2L2OA 4IPAA 2XUBA 5FO5A 3BG9A 3M3YJ 4XM3A 5KFBA 2W9CB 2VR1A 3HC7A 2XAHA 1DQUA 1ZR4A 1MNMC 4BXXJ 4LLLA 2GIVA 2L01A 2X1EA 3WTYC 3IRRA 2X48A 5DUIA 1ZTRA 2BGCA 2JRMA 3JTHA 4K0KH 3U9GA 3TQTA 3BPVA 4BUPA 4U7CA 5LP6F 5AIQA 2XGPA 4C5AA 1S7AA 5H6QA 3L4KA 2B63G 1L3LA 3OHBA 5E79C 1D0YA 5HS9A 2CUFA 3KZZA 4IZZA 1DGRM 2JWTA 3Q5FA 2KIFA 3LAJA 1JLLB 2AXTC 3ZQQA 3M7GA 1CF7A 2NU9B 3FXRA 1KEEA 3R5HA 2XRLA 2ZXJA 3SZTA 4GKJH 4XRMA 4ED8A 1TWFJ 5FPRA 2W9BB 5E3MA 2R5ZA 5J40A 4DZPA 1WRJA 5FLXZ 1DP7P 1RYRA 3MVPA 2Z9OA 1I27A 2Y2ZA 5FJ8J 3CJRB 2BW3A 1Y14B 3RUPA 2A6HF 4NUBA 2PBZA 3RYRA 1AKHB 3DKXA 1T36A 4DBRA 2E2JJ 1LDDA 3HUGB 1O3TA 1ZGAA 2D1HA 2L9VA 1YS6A 3OV8A 5J1UA 5EOYA 1OCOH 3CUQA 3FHNA 2C6YA 2P7CB 4DV1H 1SFUA 1FYKA 2EQRA 1WJDA 1A6IA 2KRFA 1FTZA 2E35A 3G8CA 3QU6A 1WHUA 4S04A 5D6EA 2ZXHA 4UUVA 5D6FA 3C1DA 3P9KA 4XLCA 4DZJA 4ZYEA 1YFHA 3CDLA 2J9GA 4MLOA 3VPDA 4XLHA 3HOSA 2HOSA 4YFNF 2LY2A 2HDDA 4F4ZA 1Y56A 2WY8Q 4S0HB 5KHDA 5JR3A 1DGSA 3OS0A 4MV1A 2QYZA 1Y0UA 1Y1WA 2WE6A 2DFFA 2IRFG 2ICWG 4IHTA 1ZYRF 4ESJA 3VOEA 3F22A 2LYCA 2R87A 1N77A 3MEXA 1SAUA 4CA0A 3GZ5A 1D1BA 3EETA 3QQAA 4NB5A 1SEIA 1LEAA 2V26A 5D1PA 5DQIA 2K9LA 1IZ1A 1XMAA 3M8EA 2EFNA 4CCLA 3FXOA 1QBJA 5J4VA 2CGPA 4Q8EA 3QZ7A 2YSRA 2CH0A 2NXNB 2R86A 3NRVA 4RNMA 3T8TA 3OSPA 5KT6A 1RK5A 1SMTA 1SD4A 4QWCA 3CCMI 5D5WB 5B3SH 1AUXA 5GTIC 2VKHA 3IWZA 2JUGA 3LMMA 4GC6A 3K0LA 1P7JA 2X0SA 4A5NA 5TJJA 5D1OB 2J6UA 5E1ZB 2R6FA 2M0MA 2PG4A 3ERMA 1WJCA 3CP2A 3EDPA 2NS7A 3DEUA 4I0AA 2LD5A 4PZJA 4XN0A 4PK4A 3PVXA 2HTJA 4QPQA 1EH6A 3HTSB 2XF7A 1Y6IA 1OCZH 1HBXG 1J7KA 3GQCA 2VQFH 1WCMG 3EPZA 1KONA 1JXLA 2DPUA 1FBSA 2H8WA 3GLLA 4G8XA 4CO8A 1PVEA 1IGNA 1UHSA 1MSEC 2R7NA 2IAIA 1ODDA 3HKZE 2HKXA 3JREA 3L2RA 2TRTA 4LSXA 1DGWY 3MKYB 2VQCA 1BGWA 3W2AA 5DLGA 5KFCA 1I6XA 2R7LA 3RBEA 1TWFA 4C5BA 3CCVI 5LRSA 1JDBB 4IQ4A 2CUEA 5E3OA 1JUPA 4XRSA 3I4PA 1YHQI 3RV4A 1IOVA 4J0MA 3Q8QB 4EBCA 4H4KC 4ECXA 4EJUA 2M7AA 1U9OA 5JHUA 4IRHA 5F9LA 4RUCA 5DG9A 2W00A 4L9VA 4M3DA 1HQCA 3MFHA 1D8KA 3RZDJ 1XMKA 3CJQB 4BBRG 3LA2A 2FP4B 4QIWA 2R7ZA 1W0UA 4R8UA 4N4NB 4AYBA 4O2AF 4QIWE 1ON1A 4JV5H 1BOBA 1RKWA 1HW1A 3ZCOA 2WTFA 2CFXA 2L9NA 2VUMG 1F36A 1SFXA 4YQWA 2V59A 3J81K 3R23A 4EQQA 1KJJA 4EJVA 1X19A 3GIDA 1IXSB 1R4NB 1BIBA 3RTXA 4AC0A 3DP7A 4XOPA 2DTZA 1XB4A 2CQNA 4HSTA 1UC9A 3E3VA 3GZNB 4LF5H 3LQRA 5LFAA 4YBZB 5FJ8G 4UB6C 4BQNA 2IVMA 4HDVA 2NVQJ 2DMTA 1EH8A 2KIMA 2ZFUA 4R79A 2RDJA 1S03G 3ZQGA 3R0AA 5IY5H 2L54A 4M9SA 3RTRA 1AN7A 2YYAA 3MZ8A 4IRKA 1S3JA 1LJ9A 3MR3A 3K10A 5D1OA 4XMYA 4IKFA 1KC7A 4BGDA 2KDOA 3F0CA 2K02A 4FQGA 5DYMA 4BS9A 4A3GJ 2ASDA 2MBFA 4AWXB 2K4BA 2PVPA 3GTKJ 5J6XA 3PW2A 3FM5A 5C44J 3O3KA 2CWEA 2MC3A 1LUJB 5GONF 4PDBA 2R7ZG 2JTVA 1Z2PX 1L2ZA 4HBLA 3BR0A 1S6LA 3ONQA 3Q3SA 2FE3A 1HXDA 3H92A 1UZCA 4A93G 4FX4A 2W1OA 3GFJA 5IP9G 4JI4H 1YJWI 4C2MA 3WG9A 3M4IA 3HEFA 2BQUA 3NEUA 4PGGA 2VB6A 2K5CA 3GX4X 1USSA 3I54A 3ASNH 1GSHA 1F43A 3U2RA 1V4RA 1IRGA 5L9XA 4DOZA 5IYDJ 1RUNA 1XNRH 1W4MA 3W2WA 2UXCH 3F6OA 3H5AA 2BY0A 1ETYA 2E60A 2MLKA 1ONVA 2OWOA 3G4SI 2R84A 4ENJA 1R6RA 4WD3A 5KT5A 1JXSA 3QPSA 4IWXA 2OZUA 4FM9A 1W5CC 5E1XA 4BJ5C 4XONA 2DIKA 3GTOA 2L9RA 5HLIA 4D5FA 1FWZA 3D0SA 1UHWA 2Y30A 1EJ9A 2QLZA 2KISA 1ETVA 4AIHA 3J81Z 2UU9H 1YW8A 1NG6A 3FBIB 4CCNA 1SD6A 4RB0A 4RGRA 4RB2C 3V8JA 4TQRA 4M7EA 3CMEI 2VUGA 3SI8A 2HDCA 4RNOA 4DV0H 3TOAA 3MCZA 5LA6F 1V4YA 1I50J 4XKVA 2FNAA 2IGNA 1PJRA 3O8GA 1VQ9I 5BS6A 4UY8I 3JSPA 1HKSA 1Y1VA 3PZPA 4M74A 3TW7A 2GOXB 4BEHB 5KFVA 1X1DA 5DUKA 4IHWA 2VBXA 2PBIA 1KYWA 2R5ZB 3JRAA 3HGYA 2V9WA 2JZYA 4UCSA 1K6YA 2EV5A 3OYGA 2CO5A 2F4MB 2DT7B 5J1YA 4RGXA 1ETQA 4TUYF 3FMSA 4BQOA 3OYMA 1JGGA 4IRDA 2IA0A 3QAHA 3Q0WA 4BHBA 2NAZA 1EA3A 2H09A 2XV4S 1G3TA 4WWCA 2RAEA 1GLVA 4NBQA 1M0WA 1VQ7I 2QQAA 4P55A 4N0BA 2C2RA 2VN2A 3OYKA 4F4YA 3BG7A 2JRTA 5E8GA 2G9WA 3AG1H 3KP6A 4ED0A 4O4LF 4XRFA 3CESA 2W9BA 1MGTA 1MDMB 4A3IJ 3I55I 1BR2A 5KFKA 3PR5B 4RBOA 1N33H 2R7RA 4HQMA 3L00A 4OMZA 1LDJA 1Z7UA 4HNVA 2HPMA 3ETHA 3PL8A 5D5XB 4LOCA 3SJMA 3KZIC 4G3IA 1MMSA 3U9SA 2FOWA 3D5SC 2BY1A 4L9JA 1WI9A 2LMDA 3ABLH 3GBGA 1VQ5I 4DJAA 4WXCA 2M2EA 3KIOA 3ZMZA 1VZ0A 1GHCA 2O6GE 4EBDA 3V6JA 4D9JA 1QVUA 2I80A 3HRUA 3LSMA 1KJ9A 3ORRA 3TKYA 3F9KA 3KP7A 1JT0A 1JE8A 1S8NA 5KFWA 2XKPA 3N4MA 2ZXWH 1FBQA 3NGDA 2CV0A 3GTLJ 1G3YA 1VFCA 2IA6A 2KJBA 2R93A 1N36H 1QU3A 2ELHA 1PUFB 3H0GA 2IP2A 4YFKF 1PUFA 1UNNC 3I0TA 1NHAA 1ULYA 3PIOF 2E5ZA 4JI2H 4Y33A 1ZHSA 1HLVA 4CHUA 2EB7A 3I58A 5HS8A 1OR7A 2QGUA 1OFCX 3LSGA 3S1QJ 2XCPA 3K3PA 2ASJA 2VKVA 2LREA 5LLQA 3GTMA 2CUZA 1OLTA 2QYOA 4QW8A 2VJ4A 2FQ4A 4DYCA 2QQ8A 2ATLA 4I09A 4C3IJ 2E36A 3TP3A 4A3DG 3ECOA 2LKPA 3TO6A 1RZ4A 2IEKA 3P7NA 1E2XA 2O03A 2JA5G 2X0LA 4LFUA 1B72B 3GLKA 2R4GA 2L3DA 3FXQA 2XIGA 3LSIA 4OIQF 2B63A 2ZXIA 4LK1F 4RAFA 3K2AA 1NG7A 1O4XA 1VAJA 5JLWA 3FWEA 2CW8A 3M8FA 4AD9A 3F21A 1YJNI 1TWAA 2JA8G 2GIZA 4ZYGA 3N43B 1XNQH 2BR0A 4XYMB 4GXOA 2GPSA 4EG0A 1XCVA 1B59A 2K9QA 1I5ZA 3RSNA 1BJZA 3HDDA 2A6TA 1GSAA 2BE5F 5CVIA 1SFOJ 2DLNA 2IS1A 2FQ3A 2PMZE 1RETA 4LLNA 4N4OB 1BI0A 2DT6A 4BJ6C 3ROUA 5GAHJ 1I6UA 2FNPA 1LB2A 3QFFA 4O3RA 1M7JA 1FZPB 5IT9K 4ZI7F 2E1NA 4G94A 2LNBA 4I76A 2LBFB 2HZDA 2Q0OA 2W4SA 3E5QA 3WE3A 4BE1A 1YO5C 2AU0A 5K5RA 3C3WA 3FXMA 2MLGA 4P96A 3K1PA 1ERDA 2M34A 1G8XA 4CXFA 3O8HA 1PP8F 5HLHA 2ZCWA 4L0ZB 5E1WA 3ZN1A 2DDAA 3GILA 3MZYA 3GTJA 1A31A 1LVKA 1ZHFA 3PNVA 4FS1A 3GEZA 3MMYB 1QPMA 2CV2A 2DPDA 1PP7U 1S0OA 1FIAA 2BXZA 2XAUA 4DUZH 3I4MG 3H9GA 2IGOA 2F5FA 2PEXA 1UAAA 1Z6TA 2DFHA 3PO3G 3IH2A 5DM6F 4E7LA 2ETHA 2NVYJ 3W6VA 2G7HA 2PMHA 1IF1A 2ADUA 2VPRA 4XSXF 5DDGA 1RJRA 4CDGA 2C00A 1BR4A 4C2TA 5KFSA 4LFAH 4HAMA 5KAIC 4ECZA 1PK8A 2FMAA 3VMMA 2KSWA 3J81W 4B44A 3H40A 5TGTA 1S97A 4A3MG 2FPPB 3HSFA 4UCVA 2KKOA 1W5SA 2LOOA 5DV5A 2A3SA 2XAJA 3UKGA 4AYBE 3IRQA 5LD2C 2M8GX 5IP7J 1RRJA 2UUZA 3H5RA 5FROA 4F52A 1TWHA 1QVTA 2V7FA 4A2UA 3FBNB 3OYDA 1YW9A 5L3EA 2JVHA 5FLMJ 2GAUA 3X2QH 5F6FA 3TGNA 5IOYA 4IR1A 2KL4A 4CGZA 3QZ8A 4ESBA 2ME6A 3S8PA 1J9IA 2O0YA 4M71A 2FBKA 4IO9F 1VI0A 4C30A 3DTKA 5GAGJ 2Z3YA 2F4VH 1S9HA 5CQGA 3KXYT 4BBRJ 4CC6A 3NQOA 3OSNA 5J2TF 3P5JA 2IGKA 3FMRA 3MKWB 2M1BA 1FT9A 4DR4H 3PO2J 2V1UA 3HOZG 3K4BA 2HS5A 3HRMA 2RDPA 3IP4B 1AOYA 2DPJA 3R6SA 5HDNA 3G73A 3WO1A 2VBWA 1TW3A 3JRXA 3KAJA 5EG0B 5LGTA 1TWHJ 4CCOA 3S17J 4HA8A 2I8DA 3NWSA 2QKLB 4L9NA 2DA1A 4NQWA 4Q5SF 2L5QA 4LJZF 1R1TA 4EEFG 1X1PA 3LSPA 4ED1A 2A68F 2OZ6A 4QWAA 1FPQA 3M07A 4WXDA 3I56I 2CQKA 1R5ID 2BY2A 3HOWJ 2WAQE 1I3AA 5K7FA 1S7EA 2H6CA 4A3DJ 2OTLI 2M4GA 4XOTA 3PW4A 3DEWA 2ALZA 1GUUA 1ZQ3P 1IN4A 1LVAA 3RJ0A 2V79A 2XDVA 5D8KB 3IKTA 1Z6RA 1UELB 4MFEA 3JRHA 5DTDA 1XDSA 4X1EA 3ZMTA 3KE2A 4ZDLA 4M3BA 5JVLA 1ZG3A 2FBHA 4A69C 1O7FA 1XCBA 1Z77A 3HOVG 5EZGA 3G6EI 3SFIA 1WKMA 4BY1G 4PFOA 2AGOA 4O3NA 1UCRA 1TLHB 4AUXA 4HF1A 1MD0A 5FLMG 1MMNA 2L7ZA 2V9PA 5FD5A 4AVPA 3G71I 3ELKA 2VIXA 3BT9A 1XGSA 4YIIA 3FHZA 5KFPA 3EPGA 4BE2A 2VPLA 3BA9A 2FEZA 2UXXA 3A0BC 3SEZA 3QU3A 3WTTC 1QNTA 1WJFA 2EILH 4B8XA 4YAKB 2JEGA 2JN6A 2R7QA 4RNNA 3EPIA 3C0FB 2PN1A 3CC7I 1VQLI 4IQJA 3GTOJ 2X6XA 2M9HA 4PSWA 4A0XA 1X3ZB 1C0WA 4X65H 1X1BA 3L2QA 3WTSC 4HOBA 2HFHA 3KZYA 3KEYA 5ILUA 4ECWA 5HOOA 3SYTA 2O9LA 1WZ2A 2MSYA 4HQEA 1W5TA 4YAJB 4DYRA 1EHIA 2EIJH 5GAEJ 2B63J 1BI1A 1A0IA 3H0GJ 4QWQA 2NNYA 4ECVA 3UQ8A 3LQQA 1K6OA 1BNCA 3K4CA 4J9LA 1O75A 1WFXA 2OD5A 5JUMA 6PAXA 4PSXA 2MG4A 1K83J 4F92B 5M5XJ 3S2HJ 3I59B 1WH5A 2W6PA 4BXXG 2BVMA 3LSJA 1TWGA 2YU3A 2JPCA 1GGOA 2CKZB 2UVWA 3J80W 2ZC2A 1ZLJA 3OYBA 5KT3A 4NXNH 2FK2A 3TQ1A 3LA7A 2DK8A 3CO7C 2EZIA 1DPRA 3QOEA 1ZREA 3BLYA 4IOCF 3BTCA 5LBQA 4J9PA 5KFJA 3BR5A 4UVBA 5IP9J 1X58A 1T98A 5GPAA 4IWYA 1IBKH 3H36A 4WCGA 1GV2A 5D4RA 2Y9ZA 3FKIJ 4X6AJ 4B1RA 3BQ1A 3PQKA 1P6RA 5J1RA 5JVDF 3MWDA 2W25A 4DL7A 3TEDA 4B09A 2JA7G 2XSJC 1LFPA 2NVTJ 4A3EG 3H20A 5A2QZ 1YE9A 2DODA 2DYRH 2M30A 1TWCJ 1W96A 2DO7A 2MW8A 1ZRFA 4XQFA 2KRHA 3VSLA 4FX0A 1BM9A 4RAZA 5C3EG 2ZBKA 4IRGA 1YYVA 3CDIA 4P9FA 1UHMA 3U21A 1JHFA 1U6GA 4KIFA 5EF6A 1QGPA 3CF5F 5KG4A 3A2KA 1V51A 2PJRB 1RNLA 1HNXH 2EJRA 1ZGJA 4FE4A 4HLXA 2P5KA 4HRIA 3F8BA 1I50A 3T5JA 3C7JA 5KG2A 4UCUA 2ISYA 1R9TA 1UG0A 3LP8A 5E20A 2ZSHB 4UVAA 1C3OA 3CQZA 2VUMA 5FD6A 2CS3A 2JT1A 5M3MJ 3ZGKA 1TQMA 2STTA 4Z2YA 3FIWA 1FX7A 4GC7A 2J6SA 1LE8B 1K1SA 2W70A 2A05A 4HX8A 4ZZLA 3HUGA 3DPTA 2MYSA 3KP3A 2DBBA 3COAC 4Y17A 2AQEA 2HOEA 4I98B 5F1RA 2Y9YA 4C3JJ 1OWTA 3ZPLA 2FK1A 2X6YA 3M9NB 4ENMA 2V1NA 3Q9VA 4KISA 2DMUA 3CCRI 2VOOA 3SFZA 4I0BA 1BBYA 3CP8A 1WJAA 4L5JA 3NWTA 5DS9A 3CMYA 1OCTC 1I94H 2PLYA 4UV9A 1MJAA 1QHHD 3I4NJ 3CCJI 2ZMEC 5KG3A 4Z6YA 2QA4I 2JEJA 3QPHA 1MMAA 5HNHA 4L18B 4XK4A 2VT3A 4ZTFA 1GVJA 3H3UA 4AIKA 1KQ8A 4O3OA 3KHHA 1SFKA 1P8LA 4I4TF 2M05A 3MN2A 1BI3A 3W3CA 3VSKA 4GO1A 1T0FC 3VYRB 4NQWB 1XDNA 1WVRA 2ZNZA 3M9OB 1G4DA 1MMGA 1E0EA 4A3GG 4BKXA 1RK6A 2QSHX 4XLEA 5HDKA 1GV5A 3J7YJ 3T5KA 4JI7H 5EG0A 3OIPA 4L9TA 4A3IG 2R8JA 3GFLA 4UHTA 3FXJA 1JT6A 3J7ZI 2EZLA 4Y52J 4A3KG 2STWA 2XAGA 2RNGA 3OYAA 2YZGA 2W9CA 2LF7A 4J9SA 2YS6A 2R92A 2XB5A 3OYLA 4C2MJ 3OYNA 4MAMA 2F6CA 4WF2A 1MBFA 2H1LA 1S68A 2MCTA 1FC3A 4A6EA 2ZDQA 2R82A 3RKWA 5K5QA 2EH3A 3DKYA 1WH2A 1MJ9A 1YIJI 4D7NA 3R60A 2XPVA 4A3JG 1Y1WJ 3HSEA 1IJWC 4GLXA 3PNTA 5K2MA 2A61A 4L5EA 3JSLA 4F55A 2R5YB 1YG2A 3LNQA 1T2KA 1TW2A 1JTXA 4BL0B 1K78B 4WBNF 2VODA 4OIOF 3BY6A 2Z33A 3GFIA 1IAWA 4MTEA 1YLFA 2HYGD 2AGQA 2JA5J 2LY9A 4U88A 2DA5A 5CVVA 5ERIA 1QQIA 1GXPA 1I7NA 3LFUA 3QWLA 2DA7A 2XGCA 4AIDA 3S32A 3M9MB 4A12A 2YZNA 5KFGA 5DG7A 2Y0MA 2QSFX 5BNGA 3V4GA 3JAMZ 2HEOA 5DGBA 4TQSA 4FS2A 1J5EH 3GTKA 3MJFA 1E3HA 1B6SA 3IN5A 1A35A 3K2ZA 2VA2A 2W85A 2FKLA 4R7RA 5KFHA 3L1PA 4Q0YA 2YX7A 2C2DA 3B02A 5LL6b 5D5VB 4BY7J 1DV2A 4ECSA 4U7BA 3WTVC 2R92G 2N8GA 3KLNA 3OR1C 2GBYA 3K4NA 4G6TB 4M9XA 5IYDG 1GLNA 4RM3A 5LYJF 2XGXA 3AAFA 3HZJA 3BAAA 1F4KA 1B9NA 2E34A 2GZWA 1Q1HA 4XKCA 4V2FA 1K4TA 4YR2A 2LBFA 3BJAA 1S9FA 3H35A 2R93J 4ZYAA 4FU0A 4MV7A 4KYWA 3F8MA 2WA0A 3LOCA 3L4JA 1MH3A 3F6VA 3OWTA 3U1KA 2JUCA 3RKYA 1HOMA 4NLGA 1Y1VJ 3ULQB 5M3FJ 3S3OA 2Y69H 3DEEA 3DBHB 3LWFA 4RAYA 1OYIA 3K4JA 2R7FA 3BJ6A 4M6VA 2R7ZJ 1U5TA 4ABZA 2Z1DA 1MJBA 1KZHA 2R7WA 4ON0A 4I2OA 2H27A 2O61A 3TMOA 2C35B 2V9VA 2FLLA 2YW2A 4MA0A 2BXYA 2LSOA 5FRNA 3M9AA 1BJAA 5TRDA 1GO3E 4KIGA 3WU0A 1AHDP 5DGAA 3LWBA 3DF8A 2DI3A 2D2WA 3JAMK 1X3UA 1TC3C 5E3NA 3MR6A 4M3FA 2QEXI 1VQ6I 4DL4A 4HSRA 1S10A 2W8LA 4DR7H 4DL5A 5L3CA 3TBIA 2W7PA 4HX4A 4R1HA 1N34H 4O5VA 2ID6A 4A3LJ 4LFBH 2M0CA 2DAOA 2V1DA 3IAM2 5CYVA 2CUJA 2I8CA 4BXFA 4OINF 4L0YB 2CW7A 1I1SA 1J0RA 3R4KA 3RKXA 5KFMA 3MKLA 9ANTA 2ZKZA 3RF2A 3I12A 5E8IA 2VBYA 2E1OA 5L3GA 1HF0A 2QF7A 3DWLE 3KETA 2H8RA 1B6RA 2W8KA 4YP3A 3FDSA 1MSFC 2ID3A 4JI8H 3CD6I 4ZQIA 1ZARA 2EIKH 4OX9H 3TIIA 4PJ0C 1UFMA 5FGMA 1R1UA 2EV0A 3FMQA 1V3FA 3TDZC 1ZLKA 2LLKA 2ZB9A 3I64A 4RB3C 1ITYA 4XBFA 3V8KA 3W2VA 3BG6A 4CZCA 2ZJQF 4G6QA 2IGMA 3IG0A 1KJIA 3HOYJ 2Z2SB 2E19A 3SHFA 1MNDA 3V42A 1QA6A 1SD7A 5CPRB 1LEBA 3R5XA 5FKNA 2OAZA 3PW0A 2M87A 5E3LA 4OAZA 1P4XA 3B73A 4ZTJA 4EBEA 1XSDA 2IT0A 2QVOA 4UFZA 4APMA 4HF0A 4RB1A 2K9NA 4MFDA 4Y7NJ 3IH4A 1X4PA 2NVUB 1NH3A 3BR2A 2LY1A 3RPQA 3AL0C 4IX7A 3S16J 2O3FA 5BPFA 3T5XA 4DV6H 3FMAA 1HA8A 2YCHA 1JKJB 3KCCA 1BXRA 4NC7A 1SFOA 5LRRA 4Y3OA 4LMYA 1R23A 4ANJA 1GDTA 4XIDA 1B8IB 1HC8A 2XD4A 4YR3A 2OLSA 5M5WJ 4GYIA 4U87A 1CGPA 5LEJA 1T94A 3HBLA 5KG0A 3WODF 4FASD 2KMUA 1EUCB 2HTSA 4HDUA 2MA3A 2PN6A 1M1EB 4HYKA 3IWFA 3PJRA 4E7IA 2KRCA 4MGRA 1IN7A 2E2IJ 5L1KA 5BMVF 5LXTF 3WE2A 5IT9W 4HG2A 3ZRGA 3GFMA 1TT5B 1JKRC 5HNFA 2R8GA 4ECQA 1T56A 1BC7C 2W84A 1RUOA 2L4AA 4M73A 4XRSG 3ORQA 5HLGA 5LMUH 2R93G 1J09A 3JRFA 3OUUA 1WCMA 5HBRB 4G12A 2VOBA 1BOAA 3HKZN 3E0JB 1SAXA 2ZO4A 3GV7B 3RGZA 2HOAA 5FRMA 2PQ8A 2XRNA 4MV8A 2LKSA 2LVSA 3KHLA 3FK6A 3MR2A 4DGWB 1PUEE 1KJQA 1IXRC 1FSEA 2GXGA 2M3AA 4EJWA 5L1IA 2EFOA 5IP7G 3W6KB 1CQJB 4DR5H 4B3XA 4GDFA 3OY9A 1I39A 4RLQA 1DPUA 2E2HA 4A3CJ 1MKMA 3KLOA 4ENNA 4KN7X 5DCMA 2L9SA 2P4WA 4M72A 1R4MB 1EF4A 2KZVA 5B1BH 1FNNA 3FXKA 2PFBA 2XPWA 2Z99A 3TP0A 1G3SA 2BYVE 2L7FP 3ABUA 1R22A 2L0KA 4BU2A 4BACA 1ZG1A 3QOPA 1E4GT 5IYCG 2I5UA 2FOKA 4DW6A 4EEQA 2ZNYA 2YU9A 1QHGA 4L5IA 1U5TB 2AXLA
chains in the Genus database with same CATH topology
1T0FA 1K7AA 3V7CA 5CVJA 3HTUA 3W6JB 3RI4A 2HGSA 2DTRA 2K7LA 2PI0A 3JAMW 4ZZDA 1JGSA 1XMOH 3K1NA 1IW7F 4KA4A 3R61A 2QQBA 3P9CA 5IT9Z 2EFWA 1FYLA 3WTZA 1EV7A 1U3EM 4LF8H 2PJPA 3ML6A 3ZMVA 2M5WA 1IBLH 2RVCA 3O6BB 3DXJF 3BWGA 1HNWH 4HZFA 2L4MA 4IJAA 5K5OA 5LMNH 5DCFA 2IA1A 4CC5A 4MHGA 1T39A 4I01A 3V8LA 4IVNA 1Z2NX 4KT5C 2LF8A 1IUYA 1X9NA 2P6TA 2YPRA 3RPUA 3L09A 1K78A 1T6SA 4ZYDA 3CJNA 2R7DA 2DQLA 4EMSA 4MEXF 3CLOA 2P5VA 4O6JA 2E1CA 2UXNA 2WC2A 4MV9A 4YIFA 4LLGF 3HOTA 2Z5UA 1HKTA 2HHHH 2KIUA 3HHHA 1USTA 5FLXW 1F5TA 2JPBA 4IAJA 4NXMH 1FVIA 4DUYH 1MDMA 2QBYB 2EWNA 2IA2A 4A6DA 1QZZA 2EFQA 2HZTA 2ZJTA 3L7WA 4D0PA 2XKOA 4EM1A 2Y75A 3ABTA 1Z05A 3SZPA 4JI1H 1P4AA 3J7AO 3HYIA 1FYMA 5BPDA 4UCRA 5AIPA 3REOA 2VBZA 3Q9SA 1U8RA 2FXAA 4DR3H 1ZG5A 4HW0A 4OOIA 5J8FA 2FA5A 1O7LA 1R7JA 1XGNA 5CVRA 3QP5A 4M9ZA 5KK1A 1E4FT 2VOPA 1XD7A 3JW4A 4KN4X 2WWYA 1ZHQA 1R58A 1DDNA 2WYOA 1IXCA 1WWXA 4PDKA 4KIBA 4MNUA 2XAQA 4HV5A 3TO7A 1CF7B 1FP1D 3DQVC 3KP4A 4UNOA 4BAYA 2DT5A 2VQEH 1R1VA 1YQAA 2A5YB 3T8RA 4MEYF 3MZHA 4KHPH 1HKQA 1B9MA 5EEGA 4EJTA 1FKAH 1YTYA 3I59A 4P5OA 3CUOA 1SD5A 2MD5A 3H3ZA 1W7PB 3FZVA 3KAKA 2QBYA 5A2QK 3HIFA 2NNNA 3VODA 5DD4A 3BPXA 4BXUA 4U0YA 4CZZA 1HNZH 2FSWA 2WDTA 5JVTA 4Q48A 3TDUC 4EVIA 2H6BA 2VC1A 2TDXA 3P9IA 1BN5A 3PQJA 3T0YA 4A0YA 2UWMA 2R3SA 2RKHA 3BJOA 2K4JA 4BHPA 3BROA 2EFPA 3WTUC 3RIRA 3E97A 2A07F 4K2EA 1KYZA 5LHGA 3BABA 3OTOH 4KNYA 4Q47A 1Z2OX 1UB9A 4A5MA 5L3FA 3KFWX 3OOPA 1AWCA 3ZMUA 2VT2A 4DR1H 5LHHA 1IBMH 1WSUA 3E6BA 3WU1B 1YIOA 4DV7H 3J7AK 3FF5A 5HDGA 4G9YA 4MQ9F 1SFEA 5LEKA 5BPIA 4JBAA 3DF7A 4TV7A 2K86A 3F8NA 3HHGA 4RZQA 4WX9A 2FMLA 4HF2A 3FM3A 4MQVA 5DCMB 3BA8A 3ECHA 1YW7A 2RQPA 3MAJA 1RIOH 1KU9A 2HYFA 1HW5A 2DW4A 2XROA 1KU2A 2HKOA 1TNTA 3RDIA 1BC8C 2W24A 1SYXB 3DKWA 5KVRA 2WTEA 5IWAH 1XDUA 2Q2EA 3S2WA 1W7PD 4BWSC 1LDKB 2M45A 2F2EA 4U7DA 2ACJA 2HQNA 2W57A 1OMIA 4Y13A 3K69A 1EH7A 3BP8A 3O2PE 4KICA 4PCQA 1TQPA 3T1BA 3EYYA 2IW5A 3F72A 4X62H 5EEHA 2UZKA 2P6SA 4OMYA 1O3RA 2GA2A 3CUQB 4H0EA 1WQ2A 2ESNA 1H9GA 2VONA 4BH9A 4I02A 2UXDH 4KFCA 2HQRA 1F1ZA 5LGUA 2E7XA 3M1EA 1KU3A 3N41B 2G7UA 4AIJA 5FFZA 1Z9CA 1J2XA 2HVRA 2EK5A 5ILVA 3WGHA 1B4AA 3LAPA 3VB2A 3QP6A 1J59A 5LGNA 3E6DA 4E70A 2XVCA 1D8JA 2HR3A 4G6DA 2AS5F 4ENKA 2Q2TA 2FRHA 3VEPA 1IN5A 4LK0F 1DUXC 5A2QW 4B3TH 5ICGA 4JI0H 1ZN2A 5FLXK 3WTXC 3TQNA 5ICEA 1B1BA 4OIRF 2NRAC 3LA3A 3GW2A 2RV8A 3SXYA 1JHHA 4JI6H 4KMFA 4UCOA 5IT3A 3KEOA 2CW0F 2Q8KA 3MQ0A 2VE8A 2O8XA 5L3BA 1VTNC 2OA4A 4WK8F 3WGIA 2UUBH 2OQGA 3EUHA 1ON2A 4GYGA 4JI5H 2A69F 5AONA 3BZ6A 1J5YA 4N9HA 3T1HH 4FHTA 4JI3H 4XLPF 2J5PA 2V6CA 4RS8A 1G6NA 2PMUA 3RJPA 5CVUA 3DV8A 4AQYH 1R00A 4LF7H 4PGHA 4UXNA 2XHKA 4GKKH 5FPOA 2B0LA 5ICCA 3GWZA 1LQ1A 2QZ8A 4LF4H 2DLLA 2ESHA 4UVCA 1TAEA 1Z91A 3E6MA 3ZMDA 3IHUA 1TQIA 4DR2H 3LFKA 1F9NA 1TA8A 3K9TA 4ESFA 3MWMA 2ZMEB 2RGVA 2UUAH 3TOBA 4IF4A 2HVQA 4O3MA 4LD5A 5HVQC 3C18A 3LSTA 3K3VA 2Y48A 1GXQA 5DEQA 2GQQA 3GUDA 3KALA 1XMQH 4MTDA 3E5XA 3ZN0A 2E7WA 3KP2A 1ZH5A 3JSNA 1P4WA 2DK5A 1FOKA 1VS0A 1R5GA 4U0VA 4DQ2A 3HSRA 2V1XA 3N97A 4JYAH 4B3SH 2QM3A 1H0MA 5H20A 4N9IA 2K27A 4BHCA 1XSVA 1B6AA 3EYIA 4OU0A 1OYWA 3RGXA 1J75A 4HX7A 3GO5A 4UV8A 3V7SA 1G3WA 4BNCA 4YFXF 5CLSA 3RYPA 4GCVA 2COMA 1O3QA 2MH9A 3U1DA 3N42B 4X64H 3HRSA 1P2FA 1U2WA 1W7PA 1HW2A 2FU4A 4GGGA 1IN8A 5DD8A 5FFXA 2P7VB 3BOQA 2XAFA 3VFZA 3WGGA 1PDNC 4NHJA 2Q2UA 3R0JA 3CUQC 2EA2A 4I7HA 3ZP5A 2VPSA 3CTAA 1IRFA 4U0WA 4R8HA 3IL2A 4G7OF 4LH6A 1R5HA 5J8CA 3F8FA 4LF9H 5ED4A 2FMYA 3SQNA 4HLYA 3L2PA 2F5CA 2DU9A 3I5UA 2LDUA 1P92A 2ISZA 3E6CC 1U78A 4LFCH 2HGCA 1KGSA 3DPLC 1O3SA 3KEQA 3F3XA 3KP5A 3L9FA 3ERED 2ZMEA 4BQAA 1STZA 4LGWA 5D4SA 1BJTA 5JI6A 3GLXA 4KUMA 3V7RA 3J80K 2L02A 1HSTA 4DR6H 1FJGH 3ZMSA 2GWRA 1LNWA 1XGOA 4BYYA 4DV4H 1QO0D 3ZQ7A 5BR8H 3LMLA 5K1YA 1O57A 1FBUA 1I1GA 4XLNF 2GA1A 5H6RA 4Q4ZF 4KDPA 4B3MH 4HV6A 2UXBH 3HRTA 1N32H 1HR0H 2J5OA 3FXUA 1K79A 4EFEA 2FBIA 3T1YH 3HXLA 1ZRDA 1Z1DA 4JK1X 4DV2H 4IXAA 1XN7A 1KQ9A 1OPCA 2JSCA 2H94A 1FY7A 3N6XA 2DQRA 5ICFA 4EJOA 2IJLA 4LB5A 3IKVA 5ILSA 1S7OA 2NS0A 3MFKA 2WV0A 4OIPF 3N40P 1E17A 2QWWA 2A6EF 3EQLF 3PFIA 4CICA 2IPQX 2XASA 5BOXA 3K1MA 2DFIA 2RNJA 2QENA 3JTGA 4UCTA 1REPC 1V9PA 4G7ZF 5F64A 1TBXA 2QQ9A 5D8LB 2VXZA 4IRIA 4DV5H 4YY3H 4EGYA 1MZBA 3L2CA 4LH7A 4M6XA 4WXHA 5BQTA 1TNSA 3JSOA 3TO9A 3QRFF 1SMYF 5FB2A 2QUFA 2NYXA 1OYYA 1QZYA 3CDHA 1T38A 3GZ6A 5L3DA 1HSJA 4XSZF 4EM0B 1U5TC 2M8EA 2ZM6H 3RIZA 2VC0A 1H9TA 1BI2A 3BDDA 1S29A 4S05A 4QLCU 2HVSA 4LF6H 4YHHH 3IC7A 4DV3H 4ASNA 4F7ZA 4IHSA 4RGSA 2D45A 3F8CA 1A04A 4ZYHA 2OU2A 5E18F 3CVZA 2FF4A 5D5UB 3E5UA 2KJCA 2CG4A 2X4HA 4LG0B 3G3ZA 2BBYA 3I53A 1B04A 2OQRA 2MH2A 2YR2A 2F5EA 2YX4A 3DFGA 2RN7A 1L0OC 2EV6A 1KA8A 2E5LH 4DNCA 4CYDA 3F23A 1BIAA 2RGRA 1GYFA 5BMZA 5CJ9A 4A2BA 4M6YA 2HWVA 4FT8A 4EV0A 4P9UA 3J80Z 2GXBA 2RC4A 2ZJ2A 4A2AA 3GF2A 2CSOA 2VE9A 3GYHX 3ISPA 3WTWC 4EFBA 5LHIA 4JQFA 2P8TA 1ZAOA 1FLIA 1TTYA 1IN6A 1R36A 3D5LA 2ZFWA 3N44B 2P5LC 2CYYA 1YS7A 3QPTA 3PN1A 5E17F 4Y15A 1KU7A 2BV6A 2F5DA 3CO6C 4ETSA 3GVAA 4HYEA 4LG0A 1OKRA 4G7HF 5HS7A 1M0TA 4LB6B 2OBPA 1FP2A 2EA4A 4X66H 4LSAA 1D3YA 4EGZA 2UUCH 3GXOA 1KQ0A 1XSXA 1RI7A 4RGUA 4EM2A 5JFRA 1D5VA 4A0ZA 4B3RH 3FX3A 3I71A 4ZH4F 1ZRCA 4YG2F 1FSHA 2D1VA 4KMUX 1XGMA 2BEOA 4IPAA 5FO5A 2XUBA 2XAHA 4LLLA 2GIVA 2L01A 3WTYC 3IRRA 5DUIA 2BGCA 3JTHA 4K0KH 3U9GA 3BPVA 5AIQA 1S7AA 5H6QA 3L4KA 1L3LA 5HS9A 3KZZA 3Q5FA 2KIFA 3LAJA 3M7GA 1CF7A 3FXRA 2ZXJA 3SZTA 4GKJH 5FPRA 1WRJA 5FLXZ 1DP7P 2Z9OA 1I27A 2A6HF 3RYRA 1LDDA 1O3TA 1ZGAA 2D1HA 3OV8A 1YS6A 5EOYA 3CUQA 2C6YA 2P7CB 4DV1H 1SFUA 1FYKA 2KRFA 3QU6A 4S04A 5D6EA 4UUVA 5D6FA 3C1DA 3P9KA 4ZYEA 1YFHA 3HOSA 4YFNF 5JR3A 1DGSA 1Y0UA 2WE6A 2IRFG 4IHTA 1ZYRF 4ESJA 3VOEA 3F22A 3MEXA 3GZ5A 4NB5A 3EETA 1SEIA 1LEAA 5D1PA 1IZ1A 1XMAA 3M8EA 2EFNA 1QBJA 2CGPA 2YSRA 3NRVA 3T8TA 1SMTA 1SD4A 5D5WB 3IWZA 3K0LA 4A5NA 5TJJA 5D1OB 5E1ZB 2PG4A 3EDPA 3DEUA 4I0AA 4PZJA 2HTJA 1EH6A 3HTSB 1HBXG 2VQFH 1J7KA 2DPUA 1FBSA 4G8XA 4CO8A 1ODDA 2HKXA 4LSXA 1BGWA 1I6XA 5LRSA 3I4PA 4J0MA 4EJUA 5JHUA 4IRHA 4L9VA 1HQCA 1D8KA 1XMKA 3LA2A 1ON1A 4JV5H 1HW1A 2CFXA 1SFXA 3J81K 4EQQA 4EJVA 1IXSB 1BIBA 3RTXA 3DP7A