3MWMA

Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
b'GRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNVAHTVEIFGTCADCAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal uptake regulation protein
publication title Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 42
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mwmA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3mwmA02
1ZLKA 4OMZA 1V4RA 3T8RA 3K2ZA 4UXNA 2DLLA 4GYGA 3RKXA 3ZPLA 3WTVC 5HVQC 4LJZF 2HYGD 2A6EF 2HS5A 3B02A 1S7AA 5F1RA 1O3TA 4IJAA 2CO5A 1HSJA 1R58A 4YFXF 2L02A 3P9CA 1EH6A 5D8LB 4ZYGA 2EFQA 3TQNA 5ICCA 1S3JA 3GWZA 2P8TA 1LVAA 3R60A 2R7FA 4YIFA 4A0YA 2LSOA 4EGZA 2WTEA 4OMYA 2IVMA 3NEUA 1K78A 2HYFA 2VODA 4G6DA 3E5XA 5LGNA 2XAQA 5LBQA 3LQRA 2ZFWA 1YLFA 1ZN2A 3VOEA 3I71A 3ZMUA 3R0AA 4LGWA 2FMYA 4XBFA 1B1BA 1FP1D 4B09A 1XDSA 4I7HA 3VEPA 1Z7UA 4ENNA 2CFXA 1RNLA 3RIRA 5E1WA 2XROA 3M7GA 2FNAA 3WTUC 5BOXA 1O3QA 2E1CA 2G7UA 5IT9K 4GCVA 1WSUA 1EH7A 3BZ6A 4L9NA 1I1GA 2KIFA 4IRIA 3ZN0A 3WTYC 2FNPA 1W4MA 2A6HF 5F64A 1FX7A 5LEKA 4A0ZA 2P5VA 5EEHA 3IKTA 1CF7B 2KKOA 2FMLA 3FXUA 4YFNF 1ZRCA 2FF4A 4WF2A 1XCVA 1REPC 3WTXC 3OV8A 1Z6RA 1YS7A 1B4AA 4I09A 3HRUA 3IRRA 5A2QK 1TTYA 3GFJA 1T98A 5DCMB 1FZPB 2P5KA 1FP2A 5HDNA 4M6XA 1YIOA 4QLCU 2B0LA 3CUQB 1S29A 4AD9A 3E6MA 5JFRA 5ILVA 4IHTA 4I01A 1XN7A 3IKVA 3NRVA 4HW0A 4M73A 1FBQA 3T8TA 4MQVA 4EV0A 1R1UA 3E3VA 1L3LA 2HTSA 1Z05A 3KP3A 1OMIA 3J81Z 1P4XA 3V8KA 3IHUA 5HS8A 1I1SA 2M8EA 4LK0F 1BI2A 5D5VB 2GA1A 3F6VA 2PEXA 5K5RA 1QZYA 3F22A 4MEXF 1ZG5A 1MKMA 2IP2A 1ONVA 4ASNA 3ISPA 2FBKA 3QU3A 5HS7A 3J80K 4RGXA 1YTYA 1YQAA 4FX4A 2BE5F 1IRFA 2HTJA 4P55A 4U0YA 3TOAA 5E18F 4XSXF 3DPLC 3GVAA 1KGSA 1PDNC 1Z91A 2EFOA 3IL2A 3JTHA 4L18B 3QPHA 2OAZA 3W6KB 4EJWA 3DEUA 3KCCA 2GXBA 3GXOA 2Y75A 3ERED 4ETSA 1KQ9A 5FO5A 1MJBA 2MLGA 4UVCA 4ZYHA 1ZG3A 2RDPA 4L9TA 4CICA 3BY6A 2NAZA 1G3TA 4HQEA 3CTAA 2BEOA 3I64A 1R00A 5ED4A 5H6RA 1SD4A 3FWEA 3K1PA 3I59B 5ILUA 4U0VA 3WGGA 1EV7A 1YYVA 3S2WA 3Q9SA 3QP5A 2OQRA 3EETA 5E8IA 2HGCA 1HQCA 1O3SA 3KP5A 5CJ9A 3E6BA 1T2KA 2XAGA 2XUBA 1T39A 5FB2A 1FBUA 5ICEA 4WK8F 4HX4A 3L9FA 5AIQA 3CO7C 1P4AA 2FEZA 1D3YA 1XSXA 1W5TA 1MZBA 2ZMEA 3E5QA 3RKYA 2FA5A 1IF1A 5BQTA 2XGXA 1ULYA 1LNWA 4U88A 4CDGA 4UV8A 2LF7A 1K79A 1ZREA 4L9VA 3HHHA 2XAHA 3GW2A 1MDMA 2EWNA 3IC7A 1R36A 2ETHA 2VT2A 2V1XA 3HSFA 4I98B 3EUHA 2Z33A 2KJCA 5LLQA 4UV9A 1HXDA 1S6LA 4JK1X 3SXYA 4HF0A 1LDDA 3DXJF 1D8KA 3F8BA 2W24A 1SAXA 1JXSA 2JT1A 2ZCWA 1XD7A 4ON0A 3ABTA 1J9IA 5E1ZB 1OYWA 2LNBA 4M9ZA 4IVNA 3C7JA 4HZFA 1U78A 2XHKA 5ICFA 1XGNA 3KP7A 2BBYA 1W7PA 3RTRA 2V1DA 1HKTA 3ZN1A 1F4KA 2FRHA 3EYIA 1FT9A 4RAZA 4R8HA 2BGCA 2YPRA 2QQBA 3GFLA 4U7DA 3T5XA 5LEJA 4EQQA 4KN4X 4F7ZA 2EA2A 2C6YA 1ON2A 2VXZA 3MZYA 5DD4A 2P6SA 1G3YA 2PJPA 1BIAA 4EJTA 1KA8A 3GF2A 4M6YA 4HA8A 5LHIA 3VFZA 2E7XA 4FX0A 1JE8A 4EM1A 2NRAC 2F5EA 1SD5A 3N97A 3MQ0A 1ZLJA 4ZYDA 2STTA 5HDGA 2EV5A 3LQQA 4XSZF 1O3RA 1ZRFA 3V8JA 2QZ8A 2F2EA 4MTDA 4HV5A 2CQKA 4KMFA 3WTTC 2NNYA 4BAYA 3E6DA 3I54A 1KU9A 1X3UA 5TJJA 3BDDA 4A0XA 5A2QZ 4JBAA 2JPCA 1YW9A 3O2PE 3W6JB 4JQFA 5FLXZ 2Z99A 2EV6A 4FT8A 2XKOA 3EDPA 2EFWA 1BIBA 3JSPA 4OIOF 2H6BA 2HOEA 3JW4A 2A07F 1R1VA 2BV6A 2KRFA 1SD6A 1FPQA 1YW8A 1MJ9A 1FYLA 1IRGA 4BHBA 2PLYA 2Z3YA 1UHMA 4EJUA 2QQ9A 5D5UB 3WE2A 4M72A 2G7HA 4AWXB 1IAWA 4YIIA 2QLZA 1LDKB 5DUIA 3I59A 4NQWA 4ENKA 4I0AA 3FMQA 3LWFA 4G7HF 2HKXA 2RV8A 2M87A 3F6OA 1JGSA 5J8CA 5HDKA 4HX8A 2QVOA 2IW5A 3FZVA 1O7FA 1WWXA 1W7PD 1T6SA 3M1EA 3V7SA 2D1VA 3LA7A 3I58A 3F8CA 2CYYA 3F8FA 3D5LA 4EM0B 4KICA 2OBPA 3T1BA 3SZTA 1USTA 2COMA 3GFMA 3I53A 4XLPF 4QWQA 4AVPA 1PP7U 2F5DA 1RUNA 3TDZC 4HYEA 3QAHA 3KFWX 1TLHB 2VE9A 3MFKA 1J0RA 2G9WA 3HTSB 2ZMEB 5JR3A 4Q5SF 1QQIA 1FOKA 3EYYA 3TGNA 2ZJ2A 4G7OF 1OYIA 1LJ9A 2OZUA 4CO8A 1TNSA 1DUXC 1SMTA 1DDNA 1MDMB 4N9HA 2JPBA 3P9IA 1RI7A 1T0FA 1E2XA 5LGTA 3BJ6A 2D2WA 1IW7F 5CVVA 2PI0A 2LDUA 2K27A 5DUKA 1IZ1A 4RGSA 1IXCA 3KLOA 1QZZA 3GUDA 3WE3A 1FLIA 5BPDA 1P4WA 4L9JA 4DNCA 2RVCA 2Q2EA 3Q5FA 5IT3A 3BJOA 2O6GE 2YX7A 2P4WA 3F23A 2UXNA 2K4JA 4O3MA 3HRSA 4R79A 3TO7A 4CHUA 3EQLF 1W7PB 4HDUA 5K1YA 1KQ8A 3BPXA 1V3FA 2QYOA 3FHZA 2R3SA 3ELKA 1U5TB 2VONA 2MLKA 1BI1A 1HBXG 2DK5A 3N4MA 3V7CA 3U1DA 2ZXJA 2UXXA 4EGYA 4CYDA 2DPUA 4LLNA 1QGPA 3I5UA 2W85A 2VC0A 2HZTA 1YO5C 1WKMA 1ZH5A 4P9UA 1D5VA 1FYKA 1R5GA 3GO5A 5DYMA 3QRFF 4O6JA 4BYYA 5LHHA 5L3DA 5HS9A 2VBZA 4FHTA 1OYYA 1FSEA 3LSTA 2Y0MA 4BHCA 3K1MA 2ELHA 1XSDA 3RPUA 4G94A 3JAMK 3H92A 3FXQA 4P5OA 2MH9A 1RUOA 4BHPA 1NHAA 1HW5A 5DV5A 3DV8A 3H3ZA 1BI0A 3GX4X 4KA4A 4ENJA 2DAOA 3CUOA 4N0BA 4GO1A 4LLGF 1XSVA 1YG2A 5AONA 1G4DA 2O03A 1XGMA 2CSOA 5D8KB 3ML6A 3RDIA 4KFCA 2D1HA 4RGRA 1Z1DA 3QP6A 5CVRA 3ZMSA 5BPIA 2VT3A 4KIBA 5DDGA 2O8XA 5L3EA 2DQRA 1U3EM 4UNOA 1YW7A 1F5TA 4OIPF 3C18A 1EH8A 3I4PA 2AS5F 1H9GA 2VBWA 5JI6A 4ESBA 2V9VA 4UHTA 1MD0A 2EV0A 3DKWA 3VODA 5BS6A 4EJVA 3O3KA 3U9GA 2QENA 2HDCA 2AXLA 2HEOA 4IHSA 2PG4A 5ILSA 2OZ6A 2Z9OA 3B73A 2FOKA 1IN6A 3SHFA 2EJRA 2HKOA 3KEQA 3GZ5A 1SFEA 1ZGAA 3LA2A 1S8NA 1SFUA 2IT0A 3HSRA 2FU4A 1B9MA 3KP6A 1KYWA 4NB5A 4Q4ZF 1FC3A 5LRRA 2L01A 5CYVA 4TV7A 3U2RA 2Z5UA 1MGTA 2A61A 3BPVA 4ZZDA 2FBHA 4OOIA 1DPRA 1HKSA 3KZYA 4ESFA 4A5MA 3CUQC 1I6XA 5D4SA 1A04A 1XMKA 2IA2A 1BN5A 3FXRA 3GYHX 3C3WA 2M45A 5DEQA 2O3FA 2H27A 3WG9A 1FYMA 1QNTA 4OU0A 4DQ2A 2GAUA 2OQGA 4A12A 5E8GA 2L3DA 1AOYA 4LD5A 3BWGA 5LHGA 4ZZLA 4RGUA 3L2CA 3R6SA 2GXGA 3SFZA 3KLNA 2A3SA 4HAMA 4HQMA 1JHFA 2CWEA 4HLXA 6PAXA 4HLYA 2W57A 1KQ0A 4R1HA 4RB1A 4IF4A 1E17A 1UB9A 3J7AO 2A68F 1F9NA 2F5FA 1OPCA 3T0YA 4U7BA 1WI9A 1PP8F 1D8JA 1ZAOA 5CVJA 4BH9A 1U5TA 2GWRA 3RKWA 4IPAA 5D6EA 1J7KA 1FNNA 2ZNYA 1IN4A 3CDHA 3QPTA 2IA0A 4GGGA 5HOOA 4A2UA 1WRJA 2YR2A 4EVIA 5IT9Z 1TNTA 1J5YA 3KE2A 3HHGA 4Z2YA 2FXAA 4YFKF 3RI4A 5FD6A 4XRFA 1KU2A 3F8MA 1R5HA 3F21A 2XVCA 4GYIA 3HRTA 3R4KA 2CG4A 1BM9A 4A6EA 4KUMA 2ZBKA 3ZMVA 4WCGA 3DF8A 2GA2A 2ZO4A 1WQ2A 1TQPA 4EJOA 2DFIA 3WGIA 2EA4A 3FMSA 1ON1A 4P9FA 3KEOA 1TQIA 5BMZA 4AIKA 1FY7A 4PGGA 4IRGA 3Q9VA 2RQPA 2X0LA 4LB6B 3TOBA 4KT5C 2YSRA 4OIQF 2QM3A 5LRSA 1U2WA 3QU6A 1IN8A 4LG0A 5CVUA 1I5ZA 3R61A 3WTSC 1HW1A 1B9NA 1ZGJA 1R7JA 2L4AA 4ZYEA 4PGHA 4HX7A 2FE3A 2VE8A 2P5LC 3FX3A 3GEZA 1TW3A 1QBJA 2XKPA 4LFUA 5FGMA 1BOAA 5KK1A 2DQLA 1O57A 5H20A 1R22A 1G6NA 2MD5A 1K7AA 2PQ8A 5ICGA 1G3SA 3VB2A 3WGHA 5HLGA 4P96A 2O61A 5FFXA 4A5NA 3JAMZ 4RS8A 3FM3A 4AIHA 3J80Z 3GFIA 1RIOH 2IA1A 1S7OA 5E17F 3P9KA 1Z9CA 2NNNA 2WWYA 3TKYA 5D5XB 3LAJA 2H94A 2V6CA 1LDJA 4HF1A 1Z6TA 3PQKA 2Q0OA 1TW2A 2JRTA 3MEXA 2DTRA 4M9SA 2HFHA 2EFNA 3BROA 3KP2A 2VBYA 1R1TA 3P7NA 2F5CA 2PN6A 1P6RA 1UCRA 3RJPA 3WTZA 2MC3A 4Y13A 4KIGA 1XGOA 2JZYA 3C1DA 3KP4A 4MEYF 2RC4A 3ECOA 3G73A 2EK5A 2W25A 5L3BA 5L3GA 2CGPA 2O0YA 5JVTA 3DQVC 3GZ6A 4EMSA 4Q48A 5K5QA 4L0YB 2XAJA 2STWA 1UFMA 2P6TA 2RKHA 1P2FA 2X4HA 4LLLA 1SFXA 2EFPA 2K86A 3JTGA 3MWMA 4MTEA 3F72A 2QBYB 5E1XA 3KETA 1K6OA 4MNUA 2ACJA 1ZRDA 3CO6C 1GXPA 4MHGA 1XMAA 3JSOA 1ODDA 3V7RA 5K5OA 4YG2F 3PQJA 1FBSA 1IXRC 1LQ1A 5J8FA 4ESJA 2V1UA 3HIFA 1IN5A 5D4RA 5JHUA 4I2OA 2KIMA 3COAC 3TDUC 2GZWA 3DPTA 4BXUA 1LEAA 4PZJA 4UVAA 2DBBA 4Y17A 3SZPA 1VTNC 5FLXK 2E1NA 3IRQA 4PDKA 2HQRA 2VOOA 2RNJA 3QOPA 3ROUA 1SD7A 2DT5A 1AWCA 2ISZA 3K1NA 2VOPA 2VBXA 1J59A 2NYXA 1U6GA 3F3XA 1ZHFA 4U0WA 2YX4A 3RPQA 4I02A 2GQQA 1LB2A 4WXHA 1XGSA 2L54A 2J5OA 3ZMTA 2PFBA 1XDUA 2DU9A 1STZA 3LAPA 4HOBA 1T38A 4KYWA 2XASA 4M74A 2M1BA 3M8FA 3OOPA 1H9TA 3FMRA 2XIGA 3WTWC 1O7LA 2R7DA 2XV4S 2D45A 4RB0A 4LG0B 5AIPA 3F8NA 1BC7C 3L00A 4ENMA 2M5WA 3M8EA 2BYVE 1FSHA 3O6BB 4CXFA 2FSWA 2H09A 2KJBA 1P92A 4MGRA 3K9TA 5HLHA 4LK1F 1UHWA 4L0ZB 4G9YA 2L4MA 4G6QA 3BOQA 2OU2A 1DP7P 4GXOA 1FWZA 2VN2A 4I0BA 4WXCA 2PMUA 1SMYF 3DP7A 2A5YB 2WC2A 2YU3A 4B8XA 2Q8KA 1GVJA 1XCBA 3H3UA 3DFGA 2HQNA 5KVRA 4Q47A 4KMUX 3E97A 5D6FA 1JHHA 1U5TC 4WWCA 4UVBA 3V4GA 4M9XA 5F6FA 3REOA 3SQNA 3TO6A 2GIVA 4XLNF 1PUEE 5J6XA 2RGVA 4L5IA 3BP8A 3NQOA 4OINF 2HWVA 1C0WA 3LFKA 3I0TA 4KNYA 1BJAA 2QQAA 4H0EA 2K02A 2K4BA 1OKRA 1GXQA 1L0OC 3L09A 2ISYA 4S04A 4ZH4F 4S05A 1U8RA 3M9AA 4HDVA 1I27A 2OA4A 2XAFA 2HR3A 4RB2C 4G8XA 2DK8A 1H0MA 3ZP5A 2Y48A 3MZHA 1R23A 2QBYA 4IXAA 1USSA 4MQ9F 4KIFA 1J75A 1K78B 2XRNA 5ERIA 3ZQ7A 1Y0UA 3WODF 3V8LA 4KN7X 5E20A 5DD8A 3HTUA 1OR7A 2ADUA 1HSTA 4WXDA 3TO9A 3HSEA 1YFHA 2IJLA 3ECHA 1F1ZA 2DW4A 1BI3A 1LEBA 1KU7A 3L7WA 3IWZA 4OIRF 3D0SA 1CF7A 5L3CA 2DI3A 1RZ4A 3K69A 1GHCA 2RN7A 3CJNA 1HW2A 3G3ZA 5L3FA 1XB4A 4Y15A 5TRDA 3J81K 2FBIA 3GLXA 2H6CA 1KU3A 1KYZA 2JTVA 2ESHA 1QPMA 2V79A 5DCMA 2EB7A 2K7LA 4E70A 1IUYA 1G3WA 1QO0D 5HLIA 4HV6A 3ZMZA 4CZZA 4LB5A 2MBFA 4M71A 3FF5A 2PMHA 3CUQA 2MH2A 1TQMA 3MCZA 2LKPA 2WV0A 3HRMA 3RYRA 3IWFA 3E5UA 4NHJA 4L5JA 3BJAA 2M30A 2QUFA 1B6AA 4G7ZF 1BBYA 4BQAA 2QWWA 2A69F 4UUVA 2NS0A 2ZKZA 2P7CB 1B59A 3K0LA 3E6CC 1DPUA 1YS6A 5EEGA 3RYPA 4BNCA 4HBLA 4PCQA 1ZYRF 3ABUA 3ULQB 4RB3C 4D0PA 3LA3A 1MJAA 1ZG1A 4A6DA 5D5WB 5CLSA 2OD5A 5CVIA 1BC8C 2JSCA 2FQ3A 3KZZA 2E7WA 2IPQX 4CGZA 1W5SA 4K2EA 4O5VA 2LF8A 2KIUA 4IRHA 2CW0F 3ZMDA 3CLOA 1IN7A 2J5PA 4LMYA 5DCFA 3R0JA 3HYIA 1J2XA 1TBXA 2UWMA 4N9IA 2DO7A 2P7VB 4KDPA 2MA3A 5LGUA 2TDXA 1ZARA 1Q1HA 3AAFA 2IRFG 1IXSB 2VC1A 5FFZA 4EM2A 3HOSA 2W84A 1HKQA 3WU1B 3FM5A 1CGPA 2ZNZA 3HOTA 4RAYA 3PFIA 4AIJA 5FD5A 5H6QA 2DPDA 3MAJA 4HF2A 4WX9A 3WU0A 2ESNA 2UZKA 2PBIA 3HUGA
chains in the Genus database with same CATH superfamily
1ZLKA 4OMZA 1V4RA 3T8RA 3H3VK 3K2ZA 3PFYA 1FOXA 1KJQA 4IRDA 2R7OA 4UXNA 2DLLA 4GYGA 1YI2I 1AKHB 1Z2OX 3K10A 3GIQA 3N44B 3RKXA 3UKGA 3ZPLA 1EUCB 4L1KA 1YE9A 3WTVC 1SVOA 2W1OA 2DMQA 2K40A 5HVQC 1VQ8I 1WCMG 4LJZF 1V5EA 2HYGD 2A6EF 2HS5A 2IGMA 3L4KA 3LSHA 2YRWA 2K9NA 3B02A 2H8RA 1S7AA 1LVKA 5F1RA 1Z2NX 2AQFA 1O3TA 4IJAA 2CO5A 1HSJA 3TBIA 1R58A 2BZTA 2L02A 3P9CA 4YFXF 1EH6A 5D8LB 1U0JA 4ZYGA 3BG6A 2M9HA 2EFQA 3K70D 3TQNA 2R86A 5ICCA 1B6SA 3ESWB 1S3JA 3GWZA 4YJ3F 2P8TA 1LVAA 3R60A 3CCQI 4YIRX 2R7FA 3PIPF 2DFHA 4YIFA 3TP3A 5F9LA 4A0YA 4O3SA 2R92J 2LSOA 2Q2TA 1ETXA 4EGZA 3DTIA 1JJ6C 4A2AA 4I99C 2NS7A 2WTEA 2Y69H 4OMYA 2X1CA 5KFDA 2IVMA 1TAEA 3NEUA 1TWCA 1YJ9I 2W6MA 5KFGA 3HOVG 1HR0H 2UUZA 1K78A 1ZQ3P 2HYFA 2VODA 4G6DA 2LVSA 3E5XA 5LGNA 1YX3A 5KFTA 2XAQA 5LBQA 1AUXA 3LQRA 2LFBA 2ZFWA 4UB6C 2R8GA 3OYLA 1YLFA 1ZN2A 3CDLA 2WY7Q 2CFOA 3BCBA 1T08B 3I71A 2NVUB 3VOEA 3ZMUA 1HCRA 4DV5H 3VPCA 4A3MJ 3R0AA 2QQ8A 1VBGA 2QSGX 4LGWA 1UHSA 4NC7A 4C5AA 2FMYA 4XBFA 1B1BA 3BQ2A 3VDXA 1FP1D 3HOZG 4B09A 1XDSA 4I7HA 3B6AA 3K3PA 1ZELA 3VEPA 1Z7UA 1XS9A 2V59A 4ENNA 2C22A 2VKHA 2CFXA 1RNLA 3RIRA 3BC8A 3ZQGA 4XL9A 1BL0A 2DTZA 4B48A 4AM3A 3KXYT 1I6UA 4JX6A 5E1WA 2XROA 3M7GA 2FNAA 3WTUC 5BOXA 1O3QA 2E1CA 1EHIA 2G7UA 1B04A 3R5HA 4A93G 4W97A 5IT9K 4QIWA 2QCOA 1A6QA 4GCVA 1WSUA 4RUCA 2LOOA 1MBGA 4QWEA 1P7IA 1EH7A 2BY0A 3BZ6A 3WNZA 4L9NA 2M3AA 4IWXA 5E79C 1I1GA 2GOMA 2KIFA 3ZN0A 3WTYC 4IRIA 5FRNA 4J9OA 4EEYA 2FNPA 5M5YJ 4BBSG 4QWCA 1W4MA 2A6HF 3J80W 4DV3H 5F1JA 3FHNA 5F64A 1X4PA 4OX9H 1X2MA 1FX7A 5LEKA 2W7PA 3L2WA 4XONA 4A0ZA 4EBCA 2P5VA 1QHGA 3GTLA 4U87A 3KAJA 2ZJTA 2UUAH 2TRTA 3CCUI 5EEHA 4FS2A 1N56A 1FTTA 3IKTA 1CF7B 3CJTB 4YJ2F 2KKOA 5F0HA 2FMLA 3FXUA 3SFIA 3VSLA 3OYNA 2WAQN 4M3GA 4YFNF 1SC7A 3HOYJ 2YL2A 3GZNB 1ZRCA 1XX5A 4IEJA 2QSHX 2FF4A 4WF2A 3L1PA 2W6ZA 1XCVA 2L9SA 3HOXJ 2B63J 1REPC 4DR6H 3WTXC 3OV8A 1Z6RA 1YS7A 5GAEJ 1B4AA 2JUGA 3BCAA 2XCLA 4HR7A 3HB9A 1XMOH 1R4NB 2GLOA 4I09A 5C1OA 3S16J 3M07A 2KSWA 3HRUA 4XICA 3IRRA 4MA5A 3GTKA 5A2QK 3E1SA 1TTYA 1HNXH 1JJ8C 3ORRA 2XF5A 3GFJA 5B3SH 2P0AA 1T98A 3VYTB 2V5AA 1EA3A 4BDZA 4D7MA 5DCMB 1FZPB 2P5KA 2DPJA 4TV8F 2WA0A 4J19A 3Q8RB 3KHGA 2JK3A 5JUMA 4CYCA 1FP2A 2JMWA 2R8HA 5HDNA 3BJYA 4M6XA 1YIOA 3R5XA 3IP4B 4BE1A 3RQ4A 1N75A 4QLCU 2IS2A 4LFBH 3VYUB 4X66H 5L1JA 1JKJB 1ENHA 1ETYA 3V6JA 2B0LA 2KIQA 4MV4A 3TL4X 1TT5B 4XR6A 5FRMA 3FXKA 1E4FT 3BQ0A 1X1PA 3CUQB 1S29A 5F08A 4AD9A 3W2VA 3Q3SA 2V7FA 3E6MA 5KFFA 2EIMH 5IYBG 3I3LA 4XM3A 2VUMA 5JFRA 2PN1A 1VQNI 4IRKA 5ILVA 1BNCA 1OCZH 4IHTA 4I01A 3BTCA 1WJDA 2UVRA 3AL0B 4F55A 1XN7A 3IKVA 4BUPA 3S1RJ 5D1OB 3WO0A 5FJ8G 2L7ZA 3BQYA 1I3QA 3NRVA 4HW0A 1ZHSA 3Q1KA 4M73A 3RUPA 1FBQA 2H8WA 4AVZA 3T8TA 4MQVA 4EV0A 1R1UA 3E3VA 1PX2A 5L1IA 5GPAA 1WH2A 1L3LA 4G12A 2JA8G 2HTSA 1Z05A 3KP3A 1OMIA 5J3LA 1GO3E 2R7ZA 3J81Z 2DWCA 3AFHA 1P4XA 3PUBA 3V8KA 2UXBH 3LOCA 1VQ6I 3SEZA 3IHUA 5HS8A 1I1SA 4FU0A 2M8EA 1VQPI 4ED2A 4LK0F 1EUDB 2I87A 4A3BJ 1BI2A 2DT6A 3DTKA 5D5VB 4DV4H 2GA1A 4ZDPA 3F6VA 2KHMA 2PEXA 4IQ4A 4BS9A 1QZYA 5K5RA 3MR6A 3F22A 3K5HA 4MEXF 1ZG5A 1MKMA 2IP2A 2XGCA 5BMVF 5C4XG 2CV0A 2GXAA 3M9OB 1ONVA 3VYRB 4ASNA 3J7AY 2KRCA 1I39A 3IH2A 3ISPA 5EDWA 2FBKA 2KQRA 3QU3A 5HS7A 4QTRA 3J80K 1IJWC 2YZNA 4RGXA 4J00A 1YTYA 1I6HJ 1YQAA 4QW9A 2OWOA 5KFQA 3P5JA 4LOCA 4FX4A 2FMAA 2BE5F 2IEKA 1PUFB 1IRFA 2HTJA 2XSDC 1JI8A 1W93A 1KC7A 4P55A 3MD2A 4U0YA 3TOAA 5EWFA 5E18F 3MKLA 4XSXF 3DPLC 3GVAA 4IZOA 1KGSA 5DS9A 1PDNC 1Z91A 2C2DA 4ZTFA 2EFOA 4JX5A 3IL2A 3JTHA 2GOXB 3KIOA 1JT6A 4DYQA 5BPFA 3CP2A 4L18B 2XF6A 1TWCJ 1KBLA 3QPHA 1D5YA 1VZ0A 2OAZA 2YS7A 3W6KB 4EJWA 4XLAA 2DCEA 4RNOA 3DEUA 4UCUA 3D5RC 2DMNA 3KCCA 2HQAA 2GXBA 3GXOA 2Y75A 3ERED 4ETSA 2CW7A 2WAQA 3ORQA 1TP4A 4BY7J 1KQ9A 2KPMA 5KG0A 3DU6A 5FO5A 1MJBA 1R6RA 2MLGA 4UVCA 1Y39A 3S17J 2ID3A 1Z21A 4ZYHA 3HDDA 1XC5A 1ZG3A 2M2EA 4E7SA 2OF7A 2RDPA 2R8KA 4L9TA 4CICA 2AQEA 3JCUC 3BY6A 2NAZA 1G3TA 3VPDA 1OR7C 2EILH 4HQEA 3HXLA 5KFVA 3CTAA 5DG9A 1Z77A 2NVYA 2BEOA 4M6VA 3I64A 3K2AA 3VSKA 5C44G 4EYIB 3PW0A 3PW4A 2OV7A 1R00A 5ED4A 3A2KA 5H6RA 3ABMH 2W8LA 4BXXG 1SD4A 3FWEA 3K1PA 3PSFA 1SYXB 3U21A 4GDFA 4YY3H 2XDVA 4QWDA 3PIOF 3ZQCA 2XCPA 2L7FP 1D0XA 2F4MB 2CUZA 3I59B 4NQWB 4Q8EA 4GKJH 3S1MJ 4M3EA 1XNRH 5ILUA 3EPGA 4U0VA 3WGGA 1XTAA 3K4LA 1EV7A 1YYVA 2ZXHA 3S2WA 3Q9SA 1ULZA 1YJNI 3QP5A 2OQRA 3EETA 4XYLB 4UCTA 5E8IA 1XPXA 2HGCA 1HQCA 1O3SA 4DL2A 3KP5A 5CJ9A 3E6BA 1W36D 1T2KA 2XAGA 3GTLJ 2XUBA 1T39A 4CCLA 5KFRA 5FB2A 2HU9A 4C5BA 3HUGB 4J0MA 1FBUA 2HVQA 2ZSHB 2RNGA 4C9YA 5ICEA 2YW2A 4WK8F 3K5IA 4HX4A 2LLKA 4PJMA 4RUAA 3L9FA 1BA5A 1GV5A 5AIQA 3CO7C 5LMNH 3RGXA 1P4AA 4XOTA 1R9TA 2FEZA 2YCHA 1RKTA 2KT0A 2EH3A 1D3YA 4CZCA 3GIKA 2KDZA 4C30A 5EWGA 1XSXA 5J2TF 4BE2A 5EZHA 2X1DA 1W5TA 1MZBA 5FLMG 2UUBH 1AHDP 4MAMA 2NU9B 2ZMEA 3N42B 3E5QA 3RKYA 3GTKJ 5KFJA 4YR0A 2FA5A 1IF1A 3RB0A 4PWQA 1X1BA 5BQTA 2XGQA 4J9SA 3PW7A 1BR2A 2XGXA 4U7CA 2B7EA 2DPIA 2IA6A 4PJNA 1ULYA 2JVGA 3UR3C 2E1OA 1LNWA 4U88A 3Q8PB 4M7EA 4J9PA 3V42A 4CDGA 2K3FA 4UV8A 1VQ5I 2LF7A 3ZQLA 1K79A 1ZREA 4L9VA 2C35B 3ZCOA 3LSRA 3HHHA 1WJ5A 2XAHA 4A3GG 3OYMA 3GW2A 5C5JA 1MDMA 2EWNA 3IC7A 5KFLA 1R36A 2ETHA 2R93G 2ASDA 4QW8A 1KZHA 2R5YA 5FKLA 5DM6F 4EBDA 1GUUA 2VT2A 2V1XA 3I56I 2MW8A 4IKFA 2V6EA 3HSFA 2VUMJ 4I98B 1UG2A 3EUHA 3ONQA 3OYBA 2KJCA 5LLQA 4UV9A 3G4SI 2Z33A 1GT0C 1HXDA 5DQGA 4A3LG 2W6OA 2AHQA 3OYGA 3K4JA 3TINA 1A35A 1I3QJ 3H5AA 2DDBA 1S6LA 4EYHB 2QEXI 1SFKA 3IAM2 4JK1X 1TWFA 3SXYA 4HF0A 3MFIA 1LDDA 5KFMA 3DXJF 2M4GA 1D8KA 1SANA 4ECWA 3F8BA 2R7ZJ 2W24A 1E3HA 1X2NA 1SAXA 3RPUD 2LC2A 3OMYA 1XMXA 4FETA 4PJLA 1SVMA 1N33H 2R85A 3KYDB 3LSMA 1JXSA 2JT1A 3H9GA 4P1WA 1LFBA 4CCKA 5KFNA 2ZCWA 1XD7A 4ON0A 3ABTA 1J9IA 3CQZA 2BQUA 3MR3A 5E1ZB 1QPIA 2W7NA 3CCJI 1OYWA 3SDGA 2LNBA 4M9ZA 3CMEI 4IVNA 1I3AA 3C7JA 4LSAA 1RJRA 5IP7G 3GIPA 2IGNA 3N43B 3DKXA 4HZFA 1U78A 2XHKA 5ICFA 5KFSA 5CB4F 2HJWA 1G2HA 1W96A 1XGNA 5M3MJ 3JRAA 5JVDF 2CS3A 3KP7A 2BBYA 3RJ0A 4QWAA 1W7PA 3RTRA 3TMOA 2V1DA 4J9RA 1O4XA 1HKTA 1ETKA 1R71A 3BTLA 5EF6A 1CE8A 2VQLA 5B1AH 5KT3A 2DA2A 3FK6A 3GQCA 3ZN1A 3T5LA 2Q2EB 3V4SA 2DA1A 4A3DG 1F4KA 1B33N 2FRHA 1WJFA 4CCOA 3CCRI 3EYIA 1FT9A 3OIPA 1N77A 5IYCG 3B6CA 3FIWA 3ABKH 4RAZA 4BJ6C 4HQ6A 1A0IA 4R8HA 2BGCA 2FUG2 3LSIA 2YPRA 1LFPA 2ZJRF 2VUGA 4O3NA 4U6PA 2QQBA 3GFLA 4U7DA 1Z0XA 1I7LA 2R8JA 4V2FA 3T5XA 5LEJA 4DLKA 3M4OJ 1CQTA 2HVRA 2E2IA 4EQQA 3J7AK 2CQQA 5D8DA 4KN4X 4F7ZA 2EA2A 3OYCA 2MYSA 2C6YA 4ABZA 4UUTA 2V4QA 1Y1VA 1ON2A 4FM9A 1P8LA 5KFIA 4C3JJ 4GLXA 4XRSG 1YX5A 1JLLB 3G1LA 2VXZA 3MZYA 3VWBA 2IXSA 5DD4A 2IP4A 5C8YF 2P6SA 1JDEA 3MJFA 3C0FB 2R7XA 4HNVA 1G3YA 1IO2A 2LG4A 3EPZA 5J1RA 3PVXA 2PJPA 1BIAA 3G6XA 2KISA 4DZPA 2NVTJ 4Q44A 4EJTA 1EKEA 1KA8A 3GF2A 4GRIA 4M6YA 4XIDA 4CYCB 4HA8A 5LHIA 3VFZA 2E7XA 2NVYJ 4FX0A 4JX4A 1JE8A 2V26A 1DP3A 3GIMA 4EM1A 4JI3H 2NRAC 5B1BH 3JRCA 2F5EA 1SD5A 3RBEA 3N97A 3MQ0A 4B3XA 3QFFA 1ZLJA 2R93A 4ZYDA 2B9SA 3FBNB 5KFHA 2E1MB 1VQ7I 2STTA 5HDGA 3Q0VA 2EV5A 3LQQA 4PSWA 4XSZF 5HBRB 2VIXA 3H36A 4HPQA 4A3JJ 1O3RA 3V8JA 2QZ8A 1ZRFA 3W6VA 2WB1E 2F2EA 4MTDA 4HV5A 1V5GA 2VLAA 2CQKA 4KMFA 5DG8A 3G2BA 4HSRA 1RETA 3HPGA 4DR1H 2YZGA 4BBRG 3PN1A 5IWAH 3WTTC 5H2FC 2BY3A 2DOFA 4XLFA 2NNYA 2FJZA 1NTCA 1S0OA 2F4IA 4AYBE 3QYBA 2PX9A 1K1SA 4BAYA 5B66C 3D1NI 3E6DA 2WDTA 3MR2A 2M7BA 3I54A 2Y0SE 3KHHA 1KU9A 1X3UA 3AG3H 5TJJA 5T14A 4Q45A 1RJPA 3BDDA 4CH7A 2J6TA 4A0XA 3OR1C 3FK7A 5A2QZ 3PW5A 1PUFA 4JBAA 4RA2A 2JPCA 1YW9A 3CJRB 2R7TA 3O2PE 3HBLA 3W6JB 2FP4B 2E5NA 1R9TJ 4JQFA 2CV2A 5FLXZ 3N41B 4B3TH 4A3KG 2Z99A 1V51A 2EV6A 3E7LA 4NDLA 4A3FJ 5KFZA 4GKKH 4MFDA 5HLTA 4FT8A 2XKOA 2MCTA 1W5CC 3EDPA 1RYSA 5HNHA 2EFWA 2W71A 2QKMB 3KYCB 3BR2A 1GLNA 2W8KA 1BIBA 2CQXA 3JSPA 4OIOF 1HDPA 5KG1A 2H6BA 2HOEA 3JW4A 3AKZA 4EFEA 3H3VH 2A07F 1IBMH 3HOUJ 5C4XJ 5BNGA 4DL5A 2VQGA 4A3EG 1R1VA 2BV6A 2KRFA 5M5WJ 2HZDA 2LRDA 1FTZA 1BJZA 1F43A 4DYCA 3GV8B 1CQIB 2L0KA 4HSTA 1SD6A 1FPQA 5GP9A 1YW8A 3QODA 3DPUA 1MJ9A 3DLLF 1RRJA 1FYLA 4XKCA 2YYAA 1IRGA 4WBNF 2VR1A 4BHBA 1IBKH 3OYDA 2PLYA 2Z3YA 1UHMA 2CRGA 4EJUA 2L9VA 2QQ9A 1U9NA 4PUSA 3PO2G 5D5UB 1TC3C 2HVSA 2C2EA 2O8KA 2JA5A 3FKIA 4JOMA 4LSXA 1ZHQA 4OAYA 3WE2A 2G0EA 2NXNB 4M72A 1MBEA 1GGOA 3GV7B 3BR6A 3CCMI 1LFUP 2G7HA 3ZQQA 3DBRB 4AWXB 5IP6A 1IAWA 2FK1A 2W6QA 4YIIA 2QLZA 1LDKB 2DT7B 3I59A 4NQWA 5DUIA 4ENKA 4I0AA 3FMQA 2PVPA 4F50A 4TQSA 3LWFA 3JRHA 2R7LA 3IAS2 4G7HF 2HKXA 3I4MJ 3M9MB 2RV8A 2LTPA 2M87A 4XORA 2XSJC 2QK4A 3F6OA 3PNVA 3RQIA 1DGSA 4ZHQF 4JI4H 1JGSA 2K9QA 4PFOA 5J8CA 1Q1VA 5HDKA 2GIZA 3OWTA 4C2TA 3RV4A 4HX8A 4DUZH 2QVOA 3OSNA 2IW5A 3FZVA 2ME6A 1JDBB 1O7FA 1WWXA 3MKWB 3ZQIA 3NGDA 4F4XA 3OIOA 2CQ7A 1W7PD 2VPQA 5KFBA 3CQZJ 1SVLA 2FPPB 3RB4A 1T6SA 3M1EA 5C44J 3L2PA 5J2UF 4CCNA 4X0GA 2KLOA 3QPLA 2W6NA 4JI0H 2WTFA 3V7SA 2OPTA 3PSIA 2SCUB 1T3NA 2R7QA 2CH0A 2D1VA 3TP0A 3OYAA 3LA7A 4D9JA 5DLGA 3I58A 2DMPA 1X19A 3F8CA 4FBUA 4TQRA 2M05A 2CYYA 3F8FA 2VA3A 3HOWJ 3D5LA 4O3OA 4EM0B 2XPVA 1VQ9I 4KICA 2OBPA 1MNDA 4DOZA 3T1BA 5CQGA 4JV1A 3HC7A 3CD6I 2EINH 1USTA 2COMA 2HYJA 3GFMA 2LK2A 3I53A 3SZTA 4XLPF 4QWQA 4AVPA 1PP7U 2F5DA 5IP9J 1RUNA 3TDZC 3T1HH 4HYEA 3DF7A 3GTQA 2R7VA 3T5JA 2JA7G 1OCPA 3H0GG 3QAHA 4PK4A 3KFWX 1DU6A 2EIKH 2E2IJ 1TLHB 2VE9A 4FISA 2VJIA 1KJIA 4RAFA 2YZMA 3MFKA 1J0RA 2G9WA 3HTSB 1X58A 3JR9A 1UC8A 4B3MH 1Y1VJ 4BXFA 2BQ3A 2JRMA 2ZMEB 3ZRGA 5JR3A 4Q5SF 1V4YA 4C3IJ 2Y9ZA 4BY1G 1QQIA 2C00A 3GBGA 2R7WA 3MVPA 1FOKA 1Z3XA 2VPRA 3EYYA 1ORKA 4X6AJ 3KAKA 3TGNA 5I47A 2ZJ2A 4G7OF 1XMQH 4BJTA 2VOBA 2OH2A 1OYIA 1LJ9A 2E1MC 2OZUA 2P0WA 5TISC 4B1RA 1TNSA 3CLQA 4CO8A 2NU7B 4YAJB 1DUXC 4F4WA 1SMTA 1DDNA 2BVLA 3I4NJ 4XLEA 1MDMB 3OYJA 4N9HA 1PVEA 2CQNA 1TL8A 2CU7A 2JPBA 3P9IA 2VQHA 1RI7A 1T0FA 2R5YB 2PMZN 1A9XA 4IL6C 3CMYA 1E2XA 5KT2A 4AUXA 1WH5A 5LGTA 2R5ZA 2J6UA 3BJ6A 2FK2A 2R93J 1K4TA 5KKNB 1PYVA 1Y1WG 4A69C 2YRXA 3G8CA 2ASJA 2D2WA 1IW7F 5CVVA 2PI0A 2LDUA 3C2HA 2K27A 3U1KA 4JV0A 3N6XA 5DUKA 1IZ1A 2Y30A 4UCRA 5M5XJ 5JVGF 4LIVA 3EPIA 1T8IA 3ASOH 4RGSA 1IXCA 3KLOA 3JAMW 4MV1A 1QZZA 3GUDA 4FS1A 2NVQJ 3WE3A 1FLIA 1ETOA 5BPDA 1XG1A 3PM1A 1LE8B 4HG2A 4JI6H 3WHBA 1P4WA 2VKVA 1X3WB 5LL6b 4CCJA 2WAFA 4L9JA 4DNCA 4IR9A 2RVCA 2Q2EA 1A31A 3W2WA 3Q5FA 5IT3A 4YBZB 3NWSA 3G1MA 3BJOA 2O6GE 2YX7A 4DV2H 4I76A 2P4WA 3H5NA 1J09A 2GLTA 4A3CG 3F23A 4AQYH 1M6VA 2NU8B 3MKZA 2UXNA 2K4JA 2R7MA 4O3MA 2OUMA 3HRSA 3OUUA 3KX2A 2O5RA 4BEHB 2DFEA 1GV2A 3TO7A 4R79A 1RJQA 4CHUA 2JWTA 1VNDA 3EQLF 4HEA2 4W1UA 3UNGC 1WCMA 5IP7J 1W7PB 3BR3A 5FROA 2X6YA 1MMDA 5J4YA 4HDUA 4F91B 1OCTC 2HXOA 3PR4A 3BR5A 1M1EB 5K1YA 1S5LC 4YRVA 2DDAA 2Y31A 1EZ1A 1KQ8A 3BPXA 1L2ZA 1V3FA 2QYOA 3FHZA 2HGSA 4LH6A 2R3SA 3ELKA 4IRCA 1U5TB 1K4SA 4ECVA 4CCMA 4DYRA 2VONA 2MLKA 1OFCX 4IOAF 1BI1A 5E3LA 1W0TA 1HBXG 3OYKA 1VS0A 1QVUA 1S0NA 1S7EA 2Y0SN 2COBA 2JA5J 2DK5A 2NOJB 5IYCJ 3N4MA 2E35A 2KDOA 3FKIJ 4IHYA 5L1KA 3V7CA 3WU2C 4Q0YA 3U1DA 3JRBA 1MBJA 1MSFC 1VBHA 2ZXJA 2UXXA 2L2OA 3QYFA 1WJEA 4FTHA 4EGYA 3KZIC 4CYDA 2DPUA 2FD5A 1QGPA 4B43A 2DA7A 4LLNA 4N4OB 1RK6A 3I5UA 3E5NA 2W85A 2VC0A 2HZTA 1YO5C 1WKMA 3VPRA 1RR7A 1UMQA 4ZDLA 2DOEA 1ZH5A 4P9UA 1D5VA 1FYKA 1PK8A 3FBIB 4J9MA 2V9WA 1R5GA 1D0ZA 4DV1H 2ZFUA 1B72A 2XB0X 4DV6H 5C1PA 1MH4A 3GO5A 5C3EJ 2ZM6H 4JV5H 5DYMA 2XC9A 3K4KA 3QRFF 5D1PA 4O6JA 1TA8A 2UV1A 1DQUA 4BYYA 4ED0A 4IZZA 2EIJH 5LHHA 5L3DA 2A05A 2X6WA 5HS9A 2VBZA 2PMZA 3MZ8A 2DXIA 1FIAA 4FHTA 4C2UA 3G6EI 1OYYA 1FSEA 4ECXA 3LSTA 1JXLA 2Y0MA 5KFWA 4BHCA 3K1MA 2ELHA 1XSDA 3RPUA 4V19K 2AQ4A 4G94A 2FLPA 2XGPA 3JAMK 1R5ID 5LYJF 1UAAA 1WHUA 3H92A 4EEQA 4MIMA 2RGRA 3FXQA 3KPHA 4P5OA 1D0YA 5LMUH 2MH9A 1RUOA 4BHPA 4LFCH 2CUEA 1NHAA 1HW5A 5DV5A 3DV8A 2ZMEC 2FLLA 3H3ZA 1BI0A 1JUSA 3GX4X 4KA4A 3E0JB 3GTQJ 2JEFA 4E7HA 3OS2A 4XQFA 4ENJA 1Z2PX 2M4KA 3HJEA 3CUOA 2DAOA 2K9SA 3CC4I 1DGRM 4GO1A 4N0BA 5KG3A 4LLGF 2WYOA 1XSVA 4JV2A 2OTLI 5KX5F 3OSGA 1YG2A 5AONA 5DLFA 4RMNA 2MABA 1G4DA 1A5JA 4O4HF 2LH9A 2O03A 3BQZA 2BY1A 4HNUA 5KNLA 1AU7A 1GDTA 2ID6A 1XGMA 2CSOA 2OCCH 2M0CA 5D8KB 5FLVA 2F4OB 1YITI 3MFHA 1OCOH 1ZK8A 3ML6A 3RDIA 1MW7A 1N78A 4KFCA 3RF2A 5EWEA 3CCSI 3GTJA 3S8PA 2Q1ZB 2D1HA 4RGRA 2GPSA 1Z1DA 1ETQA 3QP6A 2M8GX 4A3IJ 4G3IA 3FMAA 5CVRA 5DTDA 3ZMSA 3TEDA 3BR1A 4ZC3A 1JKOC 5KFCA 5BPIA 2VT3A 3PO3J 3M1CA 1KEEA 5EG0B 4KIBA 2ECCA 2LP0A 5DDGA 2HPMA 1HA8A 2O8XA 5L3EA 3S2DJ 4QWBA 5EOYA 2EZKA 3GTMA 2DQRA 1E0EA 1U3EM 3SI8A 2W9CB 4UNOA 1YW7A 1F5TA 4OIPF 3C18A 4XN0A 1X3ZB 1EH8A 3I4PA 1BW6A 3PO2J 2XGEA 2AS5F 2K9MA 4X1EA 2JSPA 3K4CA 1H9GA 2VBWA 2R0QC 5JI6A 1TWAA 3LSPA 4ESBA 1O75A 4DR5H 1N34H 2V9VA 4UHTA 1MD0A 5GPCA 2NU6B 4NXNH 3IG0A 2EV0A 3DKWA 1RESA 4BQQA 3ZR8X 4X62H 3VODA 2JA6G 2IMWP 4HRIA 5J40A 4DJAA 3I55I 5KG6A 2K9LA 5KG5A 5BS6A 4EJVA 3O3KA 3U9GA 2QENA 2HDCA 4II2A 2AXLA 2BHYA 2WV1A 4C2MA 2HEOA 4IHSA 3JZIA 2FB9A 2PG4A 4K0KH 5ILSA 2OZ6A 5GAGJ 2LKXA 2Z9OA 2NVXA 4FBTA 3B73A 2FOKA 1IN6A 2JA2A 3SHFA 2EJRA 3TW6A 2HKOA 3KEQA 2VKDA 1SFEA 1ZGAA 3GZ5A 3LA2A 1S8NA 2R84A 1SFUA 2KFDA 3RTXA 2EZLA 2IT0A 3HSRA 2FU4A 1B9MA 4I6ZA 1IBLH 3KP6A 3CF5F 1KYWA 3EUKL 4NB5A 4Q4ZF 4APMA 3J81W 2HHHH 1FC3A 5LRRA 2L01A 1WCMJ 5CYVA 2OCEA 4TV7A 4RLQA 2Z5UA 3U2RA 3BA8A 4JI1H 1MGTA 2A61A 4XK4A 4QIWE 5E3MA 1N36H 3BPVA 1FEXA 4FASD 4ZZDA 1HNWH 2FBHA 4OOIA 1FMWA 3H40A 1DPRA 1HKSA 4JI2H 3KZYA 4ESFA 2IBKA 2O7OA 2JEGA 4UUSA 3TIIA 4A5MA 3K70C 1S10A 3G1OA 3CF2A 1ITYA 3CUQC 4FE4A 1I6XA 5EYRA 4QPQA 5D4SA 1A04A 4YELA 2XRLA 3H9JA 1JT0A 2E19A 5IOZA 4IAJA 1VQKI 1Z3YA 1V55H 1XMKA 5BPHA 3AL0C 2VQDA 2P81A 4CSWA 2IA2A 4ZTJA 1I7NA 1BN5A 3L2VA 3W3CA 3FXRA 3QPSA 5CPRB 5KFOA 1JX4A 3BG9A 5IY5H 3GYHX 4A3MG 3RV3A 3C3WA 1B6RA 4EG0A 4RM2A 2QF7A 2M45A 5DEQA 3HOVJ 1IRZA 2I80A 3OL4A 2O3FA 1WJBA 2H27A 3WG9A 3SEQA 4XRMA 5LFAA 1FMVA 1FYMA 3G71I 4LF6H 1QNTA 3S2HJ 4OU0A 4TV9F 5KG7A 1Y14B 4E4HA 3M3YJ 4DQ2A 2F6CA 2GAUA 2BHZA 2OQGA 4A12A 3S15J 5E8GA 2L3DA 2MC4A 4LD5A 2GM4A 3BWGA 1AOYA 1IOWA 5LHGA 1LE8A 4ZZLA 2R5ZB 4RGUA 3L2CA 2O9LA 2CUFA 3FDSA 3R6SA 2GXGA 4ECQA 2LREA 2RREA 1SEUA 3PL8A 1CS0A 3SFZA 3IN5A 4C5CA 4ECRA 2OC6A 2UUCH 3HOZJ 3KLNA 4RM3A 1FOYA 2A3SA 3N05A 3A03A 1EF4A 1G8XA 1GLVA 1BGWA 1SAUA 4HAMA 4HQMA 1JHFA 2CWEA 4HLXA 2HDWA 4HLYA 6PAXA 1C30A 2W57A 3RGZA 1QRYA 4A93J 3RAXA 1T94A 5LA6F 5LXTF 1KQ0A 4R1HA 4BEHA 4RB1A 1KJ8A 4IF4A 1E17A 4MV8A 5GAHJ 4CC6A 1IV6A 1UB9A 3T1YH 3J7AO 2A68F 4EATA 2IAIA 2R7NA 1YHQI 1F9NA 1K1QA 4UCSA 2F5FA 4RAGA 1OPCA 1HF0A 2E60A 3T0YA 4U7BA 4BQNA 3BG7A 3HOYG 1WI9A 5KFPA 3H0DA 2L7KA 2V9PA 2ZXIA 1PP8F 1APLC 1WPKA 4BBSJ 1D8JA 5KFAA 1WI3A 2VXDA 5F9NA 3HOXG 2B63G 1ZAOA 5EEAA 5CVJA 2E34A 1MIJA 1U5TA 5F0FA 2GWRA 4BH9A 3MWEA 2FPIB 3RKWA 3CJQB 1FIPA 1MBHA 4IPAA 5D6EA 3RCOA 2BQRA 4ECZA 1J7KA 2EBIA 1FNNA 5J1YA 5KT5A 5IYDG 2DMTA 2ZNYA 1IN4A 3HM5A 3Q8SB 2BR0A 1DV1A 1VF9A 3CDHA 2JVHA 4XNFA 1X1CA 3QPTA 4R7RA 2HOSA 4MV3A 3S3MA 2I5UA 3PNTA 2IA0A 4GGGA 5HOOA 4A2UA 1WRJA 4ZDOA 3GTJJ 4O2BF 4ZI7F 3QQAA 2W82A 2MGQA 4DV0H 1FJGH 3GIIA 1HDDC 2YR2A 4PDBA 4EVIA 5IT9Z 3ZGKA 1TNTA 3GTGA 5EZYF 3MR5A 1J5YA 4J9NA 2E36A 3KE2A 1JTYA 3HHGA 1OCCH 4Z2YA 2FXAA 3GTMJ 1ZQ7A 4YFKF 3EUAA 3RI4A 2VKEA 1R49A 4EFBA 5FD6A 4XRFA 1KU2A 3F8MA 1R5HA 1UELB 3F21A 2XVCA 5TGTA 2VB6A 4GYIA 3HRTA 3R4KA 3OSFA 1JUMA 2PJRB 2CG4A 1BM9A 2YU9A 4A6EA 2X0SA 4KUMA 2ZBKA 1TWAJ 3ZMVA 4WCGA 3DF8A 2GA2A 2ZO4A 2CZGA 1WQ2A 1TQPA 4ZYAA 3F0CA 4EJOA 2R7KA 2DFIA 2LY1A 2M7AA 4MFEA 3ZQHA 3V4ZA 2VQFH 3M9NB 4E7ZA 1Y0NA 5IYBJ 2OLSA 4Q8FA 3A02A 5B5EC 3WGIA 2WAQE 2EA4A 1B72B 3FMSA 5FJ8J 1ON1A 4P9FA 4C2MJ 3A01B 4MV7A 2JN6A 3KEOA 4A3BG 1TQIA 2NVXJ 5BMZA 5HNFA 4AIKA 1FY7A 4NXMH 2Y2ZA 3NARA 4PGGA 3DWLE 4IRGA 3BZKA 4KITB 3Q9VA 2ECBA 2RQPA 1JUPA 2X0LA 4LB6B 4DW6A 1A36A 2JA8J 3TOBA 4Y3OA 4KT5C 1HNZH 2AGOA 1PJRA 2LKSA 1K6YA 2KZGA 2YSRA 5DQHA 1EJ9A 2K85A 2QKLB 2R7UA 2E2JJ 3S1QJ 1ERDA 5KG2A 3LSGA 3L2RA 4OIQF 2QM3A 3ASNH 1T36A 3U9TA 4JUZA 3I9V2 1SFOA 5LRSA 2UVVA 3CVZA 1U2WA 3M8JA 3QU6A 1IN8A 2TCTA 2R8IA 2HOTA 2WE6A 4LG0A 3BA9A 2W9AA 2YS9A 3BAAA 2VJ4A 5GONF 5CVUA 3DTEA 1I5ZA 2QGUA 3KTMA 3BTJA 3NAUA 3R61A 3WTSC 4PSXA 4IHWA 1HW1A 1TZLA 1Y8RB 2R87A 4O3RA 3A4CA 1B9NA 4CC5A 1ZGJA 4UY8I 1R7JA 4EEFG 2L4AA 4M3BA 4ITVA 4PGHA 4ZYEA 2QA4I 3GTPA 4HX7A 2FE3A 2UXDH 4Q43A 2VE8A 2P5LC 3FX3A 3OYFA 5EG0A 3DU5A 3HPHA 4BY7G 2LBFB 4E7IA 3GEZA 1BR4A 1TW3A 1QBJA 4PJJA 2XKPA 5KFYA 4ZQIA 4HNTA 4LFUA 5FGMA 2A5WA 4XLHA 1V54H 2I8DA 2W9CA 1BOAA 1T0FC 1V5FA 4NBQA 1Y6IA 1WJCA 1QVTA 4UB8C 5KK1A 4B47A 4F4YA 2DQLA 1O57A 4BWSC 5H20A 1R22A 1G6NA 4D5FA 2AXTC 2MD5A 4KISA 2ALZA 1K7AA 5CA0F 2PQ8A 1KJJA 3GIDA 3ETHA 3K4BA 4XRSA 5ICGA 1G3SA 3VB2A 1S9FA 1WR2A 3WGHA 2CKZB 5HLGA 3VYSB 1R4MB 4P96A 9ANTA 2O61A 5FFXA 4A5NA 3JAMZ 4RS8A 3FM3A 5DGAA 2ASLA 1IOVA 2L9RA 4AIHA 1MH3A 1IUFA 1FKAH 3AG1H 3J80Z 3GFIA 1MBKA 2VJJA 3WO1A 4Y4RA 1RIOH 2JJ7A 2IA1A 3PNYA 1S7OA 4AU7A 5E17F 4BXXJ 3P9KA 2QYZA 3LWBA 4NLGA 1Z9CA 2NNNA 3K3VA 2K3PA 2WWYA 5J1UA 3TKYA 3IV5A 2PBZA 5D5XB 3V6KA 1N25A 3LAJA 2E5ZA 2H94A 4IHXA 2J6SA 2V6CA 1LDJA 4E7KA 4L5EA 4HF1A 2W9BB 4QPOA 1Z6TA 3PQKA 5FPOA 4MV9A 2Q0OA 1TW2A 2JRTA 1W36C 3MEXA 2JA6J 4LF9H 2DTRA 4YR2A 3PR5B 4M9SA 2HFHA 4RU9A 2NOGA 2R4GA 1MMSA 2EFNA 2LR8A 4JP0A 5JHFA 4PJ0C 3BROA 1P7JA 3KP2A 4DR3H 2UVWA 2CV1A 2VBYA 3FKJA 3SE7A 1I50A 3A0BC 1R1TA 4YAKB 3P7NA 4ED7A 1K83A 4J01A 5DM7F 1S97A 2F5CA 1NK3P 4WD3A 2PN6A 5A2QW 1WVRA 1P6RA 5IPAA 1UCRA 1ZTRA 2EPFA 2K5CA 3RJPA 1S0MA 3QYEA 3WTZA 2R82A 1N48A 2MC3A 4NC6A 2J9GA 5FLXW 1D1CA 4Y13A 1M7JA 4PFPA 5KFXA 4KIGA 5FLMJ 1XGOA 3T5HA 3SJMA 1EYZA 3OR2C 2ZXWH 2JZYA 3C1DA 3KP4A 3GTGJ 4UUSB 4MEYF 5L1LA 2RC4A 3ECOA 3G73A 2EK5A 2W25A 1ZGWA 5L3BA 2QSFX 5L3GA 2CGPA 4ECUA 2DOAA 4DGWB 2O0YA 4JYAH 2W4SA 5JVTA 2VUMG 2ZDGA 3LSKA 3DQVC 2Z2SB 1UJ8A 3GZ6A 2KP6A 3PUFA 4A3GJ 4XX0B 5CKTA 3BR0A 4YEJA 3R5FA 2YU9J 4YQWA 4EMSA 4Q48A 4I50F 5K5QA 4L0YB 2XAJA 2STWA 4DR4H 1SCUB 1UFMA 2P6TA 2ZSIB 4ME6A 2XCAA 3LMLA 1OWTA 2RKHA 1P2FA 1K61A 2X4HA 4LLLA 1SFXA 3IUOA 3O8GA 2EFPA 3KHRA 3CESA 2K86A 2ELKA 1IGNA 3JTGA 1GSHA 2R7ZG 2A6TA 1TWGA 3MWMA 2VJ5A 2N8GA 4MTEA 2HXIA 2KMUA 1POGA 3F72A 1QU3A 4HYKA 4A3LJ 2QBYB 3LNQA 1MNMC 5E1XA 2ZDQA 1LKXA 1U8BA 1HLVA 4CUGA 5GADJ 3OL3A 3KETA 2F4VH 1K6OA 1F36A 1X1AA 4MNUA 2ACJA 3F9KA 3A0HC 1ZRDA 3CO6C 3CCLI 1GXPA 4RDUA 4MHGA 1DGWY 1XMAA 2F5VA 3U9SA 3GTOA 1X4OA 2RQQA 3HKZE 2X85A 3JSOA 1DV2A 4UFZA 2BXYA 1ODDA 1TWHA 3V7RA 4Y8VB 4OWRB 3RZDJ 1B8IB 3RIZA 3QZ8A 2DA6A 5DG7A 5K5OA 4BJ5C 3QZ7A 4YG2F 3PQJA 1FBSA 2LD5A 1IXRC 1JKPC 1WZ2A 3SZGA 1LQ1A 5J8FA 4ESJA 2V1UA 1RKWA 1SFOJ 2V4JC 2DA3A 3DCFA 3GMEA 2XF7A 1IRXA 4B3AA 3HIFA 1NG6A 2BW3A 4DBRA 3H9QA 4M3DA 1IN5A 5D4RA 4F92B 3DEWA 5JHUA 2WB1N 1WSCA 4ANJA 4I2OA 2KIMA 3COAC 3TDUC 2DMUA 3OSPA 2HQ5A 3X2QH 1BW5A 3GTPJ 3JRWA 2GZWA 2C2RA 3DPTA 5F04A 3BZCA 4AYBN 4B4CA 4BXUA 3JREA 4A3DJ 3MN2A 3FISA 5M3FJ 2DLNA 3RFCA 2H1LA 1LEAA 3PZPA 4RBOA 3FXMA 3C2BA 4XN3A 3H4BA 4PZJA 4UVAA 4D7NA 2L9NA 1ZR2A 2W00A 1DIKA 1ZETA 2DBBA 4Y17A 5IYDJ 2ZC2A 3SDBA 3CMMA 5JH7F 2JA7A 3JRIA 2PJRA 4FQGA 3SZPA 3H0GA 3BLYA 1VTNC 2V1NA 4DIQA 3RZOJ 1ACIA 1S68A 3RAQA 5FLXK 1WH7A 1AUVA 2AO9A 3Q2OA 4BDYA 3VMMA 2E1NA 2GBYA 1V9PA 2BXZA 3IRQA 1VKZA 1D1BA 4PDKA 2HQRA 3BT9A 5C4JJ 2VOOA 1P9QC 2RNJA 3QOPA 3DBHB 3ROUA 3TW7A 3DKYA 3L2QA 3CC7I 1SD7A 4IWYA 4GC7A 3TQ1A 1BJTA 2DT5A 1AWCA 4MLOA 4FE7A 3K7AJ 5KFEA 3H4DA 2AU0A 4LH7A 2ISZA 1YRNA 3K1NA 2VOPA 3A01A 2VBXA 4BGDA 4R8UB 3AYHB 4A3JG 2L7MP 2OJED 2HOAA 2NYXA 1J59A 1JKQC 4BL0B 3BABA 1GSAA 1U6GA 3F3XA 1ZHFA 4U0WA 2YX4A 3N40P 3RPQA 3KEYA 4I02A 2KRHA 2GQQA 3BQ1A 2DFFA 2DYRH 5KT4A 1JIHA 1LB2A 1W1WE 5JQWA 4S0HB 1VAJA 4LITA 2AGQA 4WXHA 3K4NA 1G59A 2WBMA 1XGSA 4D5CA 2L54A 1Y1WA 4MV6A 2FPGB 2J5OA 2XPUA 1OLTA 2L5QA 1NK2P 3ZMTA 4ED3A 5KAIC 3H20A 4CA0A 2WAEA 3IH4A 2RDIA 2CJJA 4LF8H 2PFBA 1RC9A 1XDUA 4XYMB 1J5EH 2DU9A 1STZA 4BBRJ 4IOCF 4TUYF 5J4VA 4A3FG 1SEIA 2VQEH 3LAPA 3Q0UA 5DQIA 2IS4A 4N4NB 2FKLA 4HOBA 3BG5A 4B44A 1T38A 4KYWA 2XASA 4M74A 2M1BA 4II3A 1K83J 1I50J 3HGGA 1H89C 2XC7A 3M8FA 1JGGA 3OOPA 1H9TA 4ED6A 1LPQA 3HOUG 4DL7A 2YS6A 3FXOA 3FMRA 2LBFA 2XIGA 4A3KJ 4KJZA 3WTWC 2RDJA 2IS1A 5H80A 4E7JA 1O7LA 2R7DA 2XV4S 1E3OC 4BACA 1U9OA 3OTOH 2D45A 4RB0A 4LF5H 2W6PA 1GVDA 1VI0A 4LG0B 2UXCH 5AIPA 3D5SC 2FLNA 5EGOB 3F8NA 1BC7C 4FCYA 3L00A 4ENMA 5HV6A 3OS1A 2M5WA 2AGPA 2DZDA 2YUSA 3M8EA 2BYVE 4F3QA 3S14J 2FK3A 1I94H 1FSHA 2X1EA 3O6BB 5K2MA 4CXFA 2FSWA 4BU2A 2H09A 3EUHC 2I8CA 4A3EJ 2KJBA 2OTJI 4QSHA 2IGKA 4ECYA 4XMYA 1P92A 4DUYH 4KT6A 2E2HA 4MGRA 1UNNC 1Z67A 3K9TA 2HNHA 2WB1A 1AN7A 2ZDHA 5HLHA 5KFKA 3CCYA 4LK1F 1UHWA 1T56A 4RLFA 1WJAA 3QOEA 4G9YA 3LSJA 3GLLA 2H1KA 4L0ZB 2M34A 4X65H 2L4MA 3I4MG 3BG3A 4G6QA 4H4KC 5FKMA 3ABLH 4AYBA 3HL2A 3BOQA 3HG9A 3AG2H 5J47A 2Y0SA 1TWGJ 2OU2A 1DP7P 4GXOA 2IBDA 4V2GA 1HOMA 4M9UA 5IOYA 2JEIA 2FQ4A 1FWZA 3KALA 3UQ8A 1MBFA 2VN2A 2VL8A 4I0BA 4WXCA 4IHVA 5E3NA 2PMUA 3HGYA 5KT6A 2Y9YA 1SMYF 1JKRC 5KHDA 5FKOA 5JLWA 2DN0A 2W9BA 3GTOJ 4F93B 4I4TF 3OYHA 3DP7A 3OYEA 2A5YB 5KAFC 2WC2A 3LFUA 1AKHA 2NUAB 3SYTA 4JI8H 2YU3A 4O3PA 4B8XA 1TWHJ 4AC0A 1FVIA 4O4IF 2Q8KA 1VQLI 5CA1F 3ETJA 2KL4A 4F4ZA 1GVJA 1XCBA 3GILA 2RAEA 3H3UA 2Z1DA 3R23A 3OS0A 3DFGA 4YR3A 2HQNA 3Q0WA 4NC8A 5KVRA 4Q47A 3HOWG 1MMNA 4XKVA 4KMUX 2F48A 4RZRA 3E97A 5D6FA 3AG4H 1JHHA 3OHBA 2LYCA 1E4EB 1U5TC 4WWCA 2DA4A 4UVBA 3JRGA 3V4GA 3HZJA 4M9XA 5F6FA 3REOA 4DL6A 1NG7A 1OISA 4LFAH 3ERMA 3SQNA 3VPBA 3TO6A 5IP9G 4J9KA 2GIVA 4J9LA 4XLNF 1PUEE 1BOBA 2R92G 4I55F 3CP8A 5J6XA 2RGVA 1A6IA 2FX0A 4L5IA 4LF4H 3BP8A 3NQOA 1KJ9A 5E3OA 2MD0A 3LL7A 4OINF 2CQYA 5IYZF 2HWVA 1C0WA 2R7SA 1S03G 3LFKA 3S93A 3CZ6A 1Y1VG 3I0TA 4B3SH 2E71A 4KNYA 4RNMA 2I10A 4YHHH 1BJAA 2QQAA 4H0EA 3Q8QB 3OY9A 2DJNA 2K02A 2K4BA 4NNJA 1OKRA 3I12A 1IV8A 1GXQA 1L0OC 3HKZN 3L09A 4XOPA 2R7RA 1ZKGA 2ISYA 4S04A 4ZH4F 1QZEA 3WHCA 2JA7J 4S05A 3H0GJ 3M9AA 1U8RA 4HDVA 1I27A 2DJIA 2X48A 4EGJA 2OA4A 1GYFA 4X64H 4GFBA 3GIJA 3RKQA 4D1QA 2XAFA 3I4NG 2HR3A 4LG3A 4EGQA 1XDNA 2V9KA 1OJLA 4G8XA 4RB2C 2DK8A 2EZHA 1IG7A 1H0MA 1ETWA 3GV5B 3ZP5A 4BY1J 2Y48A 4ZOLF 3FXLA 3MZHA 1FJLA 4DR2H 5K7ZA 1R23A 2QBYA 4IXAA 2ZB9A 4AIDA 1USSA 1X1DA 1ZR4A 4BKXA 4RNNA 4MQ9F 2JUCA 4O2AF 3DLAA 4ED1A 1OCRH 1RYRA 2HI3A 3A1YA 4KIFA 1J75A 1K78B 2XRNA 1M0TA 3DEEA 2ATLA 2ELJA 2W48A 3MWDA 2KZVA 1E3PA 2VPLA 2MSYA 3JSNA 4LF7H 5ERIA 2X6OA 3ZQ7A 1TT0A 1QA6A 5KT7A 3G6YA 1Y0UA 3V8LA 3WODF 4KN7X 4DZJA 3T5KA 5E20A 4ECTA 5DD8A 4Z6YA 1B8IA 3HTUA 3KYLA 4O3QA 1OR7A 1YOVB 3OOUA 1KONA 1YJWI 1S9HA 2ADUA 1VQ4I 2V4RA 4XZ3B 4JYKA 1HSTA 2BY2A 4WXDA 4F52A 2CW8A 1Y1WJ 5JVLA 3TO9A 3HSEA 1YFHA 2IJLA 4UCOA 3ECHA 2XD4A 3LP8A 1M0WA 5BR8H 1Z7LA 1F1ZA 2C28A 2DW4A 1BI3A 3JRFA 1X9NA 3ZQFA 1LEBA 4C3HJ 4LIUA 1KU7A 4A2BA 1T33A 4IHJF 3L7WA 3IWZA 4QJFA 2UU9H 2DA5A 5GTIC 4OIRF 5EZGA 3D0SA 3DBLB 5FKKA 5HODA 3S3NA 1CF7A 2JA6A 5L3CA 2DI3A 1RZ4A 3K69A 1GHCA 2ZJPF 2RN7A 3CJNA 3G6VA 1HW2A 3G3ZA 3NWTA 1XNQH 1UZCA 5L3FA 1XB4A 1UG0A 1D1AA 4Y15A 3WG7H 1RPWA 5TRDA 1S72I 4G6TB 4A3CJ 2GPWA 3TIGA 3L4JA 2ZJQF 1FOWA 2LY2A 3K6GA 4XKWA 3J81K 4JI5H 2FBIA 2BW3B 3H1CA 3GLXA 2H6CA 3QWLA 1KU3A 2ICWG 2XB5A 4JI7H 2PMZE 1KYZA 2JTVA 1H88C 2ESHA 3OHAA 1BR1A 1QPMA 3OIQA 2BOLA 1OQYA 3JRDA 5LD2C 1VQMI 2RF4A 4YP3A 2V79A 2XAUA 1C3OA 1H8AC 2JA5G 3HEFA 3JRXA 2VA2A 5DCMA 3H5RA 3FKIG 4YB8B 4E7LA 3S1NJ 2EB7A 2K7LA 2IGOA 4E70A 1IUYA 3TQTA 1IDYA 1G3WA 1VQOI 5FKNA 2E2HJ 3RB6A 3ZXSA 1QO0D 5HLIA 2R92A 1BXRA 4HV6A 4GC6A 1E4GT 3ZMZA 3W2AA 1Y56A 5LP6F 4CZZA 4LB5A 2VPSA 2XPWA 1LUJB 1RK5A 4Y33A 2MBFA 1DU0A 3RB3A 4M71A 3FF5A 4R8UA 1YIJI 2PMHA 3CUQA 2MH2A 1TQMA 3MCZA 4ED8A 3CCVI 2LKPA 2WV0A 1NH3A 3HRMA 3HKZA 2UVUA 2X9DA 3RYRA 5DGBA 5D1OA 2EZIA 5C3EG 3LMMA 3IWFA 3E5UA 1N32H 3ZOBA 4NHJA 1T95A 1MSEC 2VQCA 1WGXA 4B3RH 4L5JA 1QHHD 3BJAA 4ZJZA 2M30A 2QUFA 4OAZA 1B6AA 3FDYA 1YRNB 2MG4A 4G7ZF 2BVMA 4Y7NJ 4DL4A 1BBYA 2W70A 4DV7H 4BQAA 3GCMA 1HC8A 4O4LF 3UFXB 2QWWA 2A69F 4UUVA 4E4TA 2NS0A 2ZKZA 2IS6A 3S3OA 5L9XA 2LY9A 2VI6A 3CMAI 2P7CB 1B59A 1JTXA 3K0LA 5KFUA 2DIKA 3MMYB 2DODA 3E6CC 2NS8A 1CQJB 1DPUA 1YS6A 5EEGA 2D5VA 3RYPA 1MNEA 4BNCA 4RZQA 4HBLA 4PCQA 3RBDA 1MMGA 1ZYRF 4ECSA 4BE0A 3ABUA 3ULQB 3RSNA 2M0MA 4RB3C 2WY8Q 4MA0A 4D0PA 3LA3A 1MJAA 1ZG1A 5CAEB 4A6DA 1AA7A 4IX7A 5CQEA 5EGOA 5D5WB 5CLSA 2OD5A 5CVIA 1BC8C 2CUJA 5LOVF 2JSCA 2FQ3A 3KZZA 2E7WA 2IPQX 4CGZA 4J9QA 1W5SA 2FJ1A 4K2EA 1VFCA 4IQJA 2LMDA 4O5VA 5K7HA 3OUZA 2LF8A 2KIUA 2VASA 4IRHA 2CW0F 3H35A 4XLCA 3ZMDA 2W7OA 3CDIA 4NUBA 1WFXA 2EQRA 2JEJA 4XKBA 2B63A 3OYIA 2CMPA 4DBQA 3N8DA 2V58A 4DR7H 2MFZA 3CLOA 1IN7A 2J5PA 4LMYA 4A3IG 5F0CA 5DCFA 1UC9A 3KHLA 3R0JA 3PW2A 3HYIA 1J2XA 1TBXA 3M4IA 3S32A 2UWMA 4KHPH 3PO3G 4N9IA 2DO7A 2P7VB 4MO7A 4KDPA 2FOWA 2MA3A 4Y52J 4UCVA 3MKYB 2R6FA 3C2GA 2Z16A 5LGUA 5K7FA 2TDXA 5EJCA 5EDNA 3PJRA 2DYSH 5F27A 4EBEA 2X6XA 4QIWN 1MMAA 4IO9F 1W0UA 1ZARA 3V6HA 1Q1HA 3O8HA 3JSLA 3AAFA 5KCMA 1GSOA 3J7YJ 2Q2UA 3K4MA 3BTIA 5FPRA 4IR1A 2IRFG 2X51A 1IXSB 2VC1A 5FFZA 4EM2A 4DL3A 2E5LH 5IT9W 3FXJA 1RR8C 3HOSA 2W84A 4BQOA 2HPIA 2ME0A 3L2UA 2WADA 1HKQA 3WU1B 3FM5A 1CGPA 1TWFJ 3IH3A 2XGDA 5KG4A 3GLKA 2ZNZA 3HOTA 5GTHC 4RAYA 3PFIA 1IC8A 4AIJA 2HDDA 4M3FA 5FD5A 1Y8QB 5H6QA 2DPDA 3CCEI 3MAJA 1E4EA 3CC2I 5JLXA 4E6KG 4HF2A 1IDZA 4WX9A 3WU0A 2JQ7A 2ESNA 1ETVA 2UZKA 3J7ZI 2PBIA 3HUGA
chains in the Genus database with same CATH topology
1ZLKA 4OMZA 1V4RA 3T8RA 3K2ZA 4UXNA 1Z2OX 2DLLA 4GYGA 3N44B 3RKXA 3ZPLA 3WTVC 5HVQC 4LJZF 2HYGD 2A6EF 2HS5A 3L4KA 3B02A 1S7AA 5F1RA 1Z2NX 1O3TA 4IJAA 2CO5A 1HSJA 1R58A 4YFXF 2L02A 3P9CA 1EH6A 5D8LB 4ZYGA 2EFQA 3TQNA 5ICCA 1S3JA 3GWZA 2P8TA 1LVAA 3R60A 2R7FA 4YIFA 4A0YA 2LSOA 2Q2TA 4EGZA 4A2AA 2WTEA 4OMYA 2IVMA 1TAEA 3NEUA 1HR0H 1K78A 2HYFA 2VODA 4G6DA 3E5XA 5LGNA 2XAQA 5LBQA 3LQRA 2ZFWA 1YLFA 1ZN2A 3VOEA 3I71A 3ZMUA 4DV5H 3R0AA 4LGWA 2FMYA 4XBFA 1B1BA 1FP1D 4B09A 1XDSA 4I7HA 3VEPA 1Z7UA 4ENNA 2CFXA 1RNLA 3RIRA 3KXYT 1I6UA 5E1WA 2XROA 3M7GA 2FNAA 3WTUC 5BOXA 1O3QA 2E1CA 1B04A 2G7UA 5IT9K 4GCVA 1WSUA 1EH7A 3BZ6A 4L9NA 1I1GA 2KIFA 4IRIA 3ZN0A 3WTYC 2FNPA 1W4MA 2A6HF 3J80W 4DV3H 5F64A 4OX9H 1FX7A 5LEKA 4A0ZA 2P5VA 3KAJA 2ZJTA 2UUAH 5EEHA 3IKTA 1CF7B 2KKOA 2FMLA 3FXUA 4YFNF 1ZRCA 2FF4A 4WF2A 1XCVA 1REPC 4DR6H 3WTXC 3OV8A 1Z6RA 1YS7A 1B4AA 1XMOH 4I09A 2KSWA 3HRUA 3IRRA 5A2QK 1TTYA 1HNXH 3GFJA 1T98A 5DCMB 1FZPB 2P5KA 1FP2A 5HDNA 4M6XA 1YIOA 4QLCU 4LFBH 4X66H 2B0LA 1E4FT 3CUQB 1S29A 4AD9A 3E6MA 5JFRA 5ILVA 4IHTA 4I01A 1XN7A 3IKVA 5D1OB 3NRVA 4HW0A 1ZHSA 4M73A 1FBQA 3T8TA 4MQVA 4EV0A 1R1UA 3E3VA 1WH2A 1L3LA 2HTSA 1Z05A 3KP3A 1OMIA 3J81Z 1P4XA 3V8KA 2UXBH 3IHUA 5HS8A 1I1SA 2M8EA 4LK0F 1BI2A 5D5VB 4DV4H 2GA1A 3F6VA 2PEXA 5K5RA 1QZYA 3F22A 4MEXF 1ZG5A 1MKMA 2IP2A 1ONVA 4ASNA 3ISPA 2FBKA 3QU3A 5HS7A 3J80K 4RGXA 1YTYA 1YQAA 2OWOA 4FX4A 2BE5F 1IRFA 2HTJA 4P55A 4U0YA 3TOAA 5E18F 4XSXF 3DPLC 3GVAA 1KGSA 1PDNC 1Z91A 2EFOA 3IL2A 3JTHA 4L18B 3QPHA 2OAZA 3W6KB 4EJWA 3DEUA 4UCUA 3KCCA 2GXBA 3GXOA 2Y75A 3ERED 4ETSA 2CW7A 1KQ9A 5FO5A 1MJBA 2MLGA 4UVCA 4ZYHA 1ZG3A 2RDPA 4L9TA 4CICA 3BY6A 2NAZA 1G3TA 4HQEA 3HXLA 3CTAA 2BEOA 3I64A 1R00A 5ED4A 5H6RA 1SD4A 3FWEA 3K1PA 1SYXB 4YY3H 3I59B 4GKJH 1XNRH 5ILUA 4U0VA 3WGGA 1EV7A 1YYVA 3S2WA 3Q9SA 3QP5A 2OQRA 3EETA 4UCTA 5E8IA 2HGCA 1HQCA 1O3SA 3KP5A 5CJ9A 3E6BA 1T2KA 2XAGA 2XUBA 1T39A 5FB2A 4J0MA 1FBUA 2HVQA 5ICEA 4WK8F 4HX4A 3L9FA 5AIQA 3CO7C 5LMNH 3RGXA 1P4AA 2FEZA 2YCHA 1D3YA 1XSXA 1W5TA 1MZBA 2UUBH 2ZMEA 3N42B 3E5QA 3RKYA 2FA5A 1IF1A 5BQTA 2XGXA 1ULYA 1LNWA 4U88A 4M7EA 4CDGA 4UV8A 2LF7A 1K79A 1ZREA 4L9VA 3HHHA 2XAHA 3GW2A 1MDMA 2EWNA 3IC7A 1R36A 2ETHA 2VT2A 2V1XA 3HSFA 4I98B 3EUHA 2Z33A 2KJCA 5LLQA 4UV9A 1HXDA 1S6LA 4JK1X 3SXYA 4HF0A 1LDDA 3DXJF 1D8KA 3F8BA 2W24A 1SAXA 1N33H 1JXSA 2JT1A 2ZCWA 1XD7A 4ON0A 3ABTA 1J9IA 5E1ZB 1OYWA 2LNBA 4M9ZA 4IVNA 3C7JA 4LSAA 3N43B 4HZFA 1U78A 2XHKA 5ICFA 1XGNA 3KP7A 2BBYA 3RJ0A 1W7PA 3RTRA 2V1DA 1HKTA 3ZN1A 1F4KA 2FRHA 3EYIA 1FT9A 4RAZA 1A0IA 4R8HA 2BGCA 2VUGA 2YPRA 2QQBA 3GFLA 4U7DA 3T5XA 5LEJA 2HVRA 4EQQA 3J7AK 4KN4X 4F7ZA 2EA2A 2C6YA 4FM9A 1ON2A 1P8LA 4GLXA 2VXZA 3MZYA 5DD4A 2P6SA 3C0FB 1G3YA 2PJPA 1BIAA 4EJTA 1KA8A 3GF2A 4M6YA 4HA8A 5LHIA 3VFZA 2E7XA 4FX0A 1JE8A 4JI3H 4EM1A 2NRAC 2F5EA 1SD5A 3N97A 3MQ0A 1ZLJA 4ZYDA 2STTA 5HDGA 2EV5A 3LQQA 4XSZF 1O3RA 1ZRFA 3V8JA 2QZ8A 2F2EA 4MTDA 4HV5A 2CQKA 4KMFA 4DR1H 5IWAH 3PN1A 3WTTC 2NNYA 4BAYA 3E6DA 2WDTA 3I54A 1KU9A 1X3UA 5TJJA 3BDDA 4A0XA 5A2QZ 4JBAA 2JPCA 1YW9A 3O2PE 3W6JB 4JQFA 5FLXZ 3N41B 4B3TH 2Z99A 2EV6A 4GKKH 4FT8A 2XKOA 2MCTA 3EDPA 2EFWA 1BIBA 3JSPA 4OIOF 2H6BA 2HOEA 3JW4A 4EFEA 2A07F 1IBMH 1R1VA 2BV6A 2KRFA 1SD6A 1FPQA 1YW8A 1MJ9A 1FYLA 1IRGA 4BHBA 1IBKH 2PLYA 2Z3YA 1UHMA 4EJUA 2QQ9A 5D5UB 2HVSA 4LSXA 1ZHQA 3WE2A 4M72A 2G7HA 4AWXB 1IAWA 4YIIA 2QLZA 1LDKB 5DUIA 3I59A 4NQWA 4ENKA 4I0AA 3FMQA 3LWFA 4G7HF 2HKXA 2RV8A 2M87A 3F6OA 1DGSA 4JI4H 1JGSA 5J8CA 5HDKA 4HX8A 4DUZH 2QVOA 2IW5A 3FZVA 1O7FA 1WWXA 1W7PD 1T6SA 3M1EA 3L2PA 4JI0H 3V7SA 2D1VA 3LA7A 3I58A 3F8CA 2CYYA 3F8FA 3D5LA 4EM0B 4KICA 2OBPA 3T1BA 3SZTA 1USTA 2COMA 3GFMA 3I53A 4XLPF 4QWQA 4AVPA 1PP7U 2F5DA 1RUNA 3TDZC 3T1HH 4HYEA 3DF7A 3QAHA 3KFWX 1TLHB 2VE9A 3MFKA 1J0RA 2G9WA 3HTSB 4B3MH 2ZMEB 5JR3A 4Q5SF 1QQIA 1FOKA 3EYYA 3KAKA 3TGNA 2ZJ2A 4G7OF 1XMQH 2VOBA 1OYIA 1LJ9A 2OZUA 4CO8A 1TNSA 1DUXC 1SMTA 1DDNA 1MDMB 4N9HA 2JPBA 3P9IA 1RI7A 1T0FA 1E2XA 5LGTA 3BJ6A 2D2WA 1IW7F 5CVVA 2PI0A 2LDUA 2K27A 3N6XA 5DUKA 1IZ1A 4UCRA 4RGSA 1IXCA 3KLOA 3JAMW 1QZZA 3GUDA 3WE3A 1FLIA 5BPDA 4JI6H 1P4WA 5LL6b 4L9JA 4DNCA 2RVCA 2Q2EA 3Q5FA 5IT3A 3BJOA 2O6GE 2YX7A 4DV2H 2P4WA 3F23A 4AQYH 2UXNA 2K4JA 4O3MA 3HRSA 4R79A 3TO7A 4CHUA 3EQLF 1W7PB 4HDUA 5K1YA 1KQ8A 3BPXA 1L2ZA 1V3FA 2QYOA 3FHZA 2HGSA 4LH6A 2R3SA 3ELKA 1U5TB 2VONA 2MLKA 1BI1A 1HBXG 1VS0A 2DK5A 3N4MA 3V7CA 4Q0YA 3U1DA 2ZXJA 2UXXA 4EGYA 4CYDA 2DPUA 4LLNA 1QGPA 3I5UA 2W85A 2VC0A 2HZTA 1YO5C 1WKMA 1ZH5A 4P9UA 1D5VA 1FYKA 1R5GA 4DV1H 4DV6H 3GO5A 2ZM6H 4JV5H 5DYMA 3QRFF 5D1PA 4O6JA 1TA8A 4BYYA 5LHHA 5L3DA 5HS9A 2VBZA 4FHTA 1OYYA 1FSEA 3LSTA 2Y0MA 4BHCA 3K1MA 2ELHA 1XSDA 3RPUA 4G94A 3JAMK 3H92A 4EEQA 2RGRA 3FXQA 4P5OA 5LMUH 2MH9A 1RUOA 4BHPA 4LFCH 1NHAA 1HW5A 5DV5A 3DV8A 3H3ZA 1BI0A 3GX4X 4KA4A 4ENJA 1Z2PX 2DAOA 3CUOA 4N0BA 4GO1A 4LLGF 2WYOA 1XSVA 1YG2A 5AONA 1G4DA 2O03A 1XGMA 2CSOA 5D8KB 3ML6A 3RDIA 4KFCA 3RF2A 2D1HA 4RGRA 1Z1DA 3QP6A 3FMAA 5CVRA 3ZMSA 5BPIA 2VT3A 4KIBA 5DDGA 2O8XA 5L3EA 5EOYA 2DQRA 1U3EM 4UNOA 1YW7A 1F5TA 4OIPF 3C18A 1EH8A 3I4PA 2AS5F 1H9GA 2VBWA 5JI6A 4ESBA 1O75A 4DR5H 1N34H 2V9VA 4UHTA 1MD0A 4NXNH 3IG0A 2EV0A 3DKWA 4X62H 3VODA 5BS6A 4EJVA 3O3KA 3U9GA 2QENA 2HDCA 2AXLA 2HEOA 4IHSA 4K0KH 2PG4A 5ILSA 2OZ6A 2Z9OA 3B73A 2FOKA 1IN6A 3SHFA 2EJRA 2HKOA 3KEQA 3GZ5A 1SFEA 1ZGAA 3LA2A 3RTXA 1S8NA 1SFUA 2IT0A 3HSRA 2FU4A 1B9MA 1IBLH 3KP6A 1KYWA 4NB5A 4Q4ZF 4APMA 3J81W 2HHHH 1FC3A 5LRRA 2L01A 5CYVA 4TV7A 3U2RA 2Z5UA 3BA8A 4JI1H 1MGTA 2A61A 1N36H 3BPVA 4ZZDA 1HNWH 2FBHA 4OOIA 1DPRA 1HKSA 4JI2H 3KZYA 4ESFA 4A5MA 3CUQC 1I6XA 5D4SA 1A04A 4IAJA 1XMKA 2IA2A 1BN5A 3FXRA 3GYHX 3C3WA 2M45A 5DEQA 2O3FA 2H27A 3WG9A 1FYMA 4LF6H 1QNTA 4OU0A 4DQ2A 2GAUA 2OQGA 4A12A 5E8GA 2L3DA 1AOYA 4LD5A 3BWGA 5LHGA 4ZZLA 4RGUA 3L2CA 3R6SA 2GXGA 3SFZA 2UUCH 3KLNA 2A3SA 1BGWA 4HAMA 4HQMA 1JHFA 2CWEA 4HLXA 6PAXA 4HLYA 2W57A 3RGZA 1KQ0A 4R1HA 4RB1A 4IF4A 1E17A 4CC6A 3T1YH 1UB9A 3J7AO 2A68F 1F9NA 4UCSA 2F5FA 1OPCA 3T0YA 4U7BA 1WI9A 1PP8F 1D8JA 1ZAOA 5CVJA 4BH9A 1U5TA 2GWRA 3RKWA 4IPAA 5D6EA 1J7KA 1FNNA 2ZNYA 1IN4A 3CDHA 3QPTA 4R7RA 2IA0A 4GGGA 5HOOA 4A2UA 1WRJA 4DV0H