3MWMA

Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
GRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative metal uptake regulation protein
total genus 42
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mwmA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3mwmA02
1SD4A 3WG9A 4E70A 4S05A 2L4AA 3OV8A 2FU4A 4KUMA 4M9SA 2YR2A 4OIQF 1BIAA 2RV8A 4ZYDA 1XSXA 1K7AA 1SMYF 3E3VA 5K5OA 4IJAA 1U3EM 1KYWA 2BV6A 2LDUA 2H94A 1OKRA 1Y0UA 1MZBA 2IPQX 5DUKA 4HDVA 2BBYA 3NRVA 3TO6A 1CF7B 5BOXA 4M73A 3J7AO 2M87A 2D1VA 2QQAA 4IPAA 1YO5C 1E17A 2D2WA 4Q47A 4HF1A 1I1SA 2DLLA 2Z3YA 3JAMZ 2ESHA 3BOQA 2Y48A 4P9UA 4PGGA 1KU7A 3KEQA 2W85A 4A6DA 4EJOA 4I01A 4YFKF 2Z9OA 2STWA 1GXQA 2RVCA 2R7FA 2B0LA 3HSFA 2CFXA 2HOEA 2ISZA 4A5NA 1G3SA 3KZYA 3ECHA 4GYIA 3HYIA 1TQMA 1YLFA 2Y0MA 3ZQ7A 1XCBA 1MGTA 3ISPA 1STZA 2CW0F 3P9IA 1FOKA 5L3DA 4HBLA 3ROUA 3L9FA 4LMYA 4L18B 1IF1A 5HS8A 2JZYA 2AS5F 3TGNA 4YG2F 3K0LA 4MQVA 3QU6A 4Z2YA 4ESFA 3DPLC 1WSUA 1I27A 3BY6A 4ENMA 4PCQA 1OMIA 2NYXA 2IJLA 5FLXZ 3EYIA 5EEGA 3WTSC 1OYYA 3GZ6A 1ZG1A 2P5KA 2ZNZA 4OMZA 2XKOA 4EM0B 1IUYA 3JAMK 3HRUA 2UZKA 4AIKA 2FOKA 3F6VA 4EJVA 1R7JA 2LNBA 1BI0A 2HYFA 1R00A 4XLNF 1W4MA 3SXYA 2HWVA 4EJTA 3DV8A 3CUOA 4BXUA 5D4RA 1I5ZA 1XN7A 3FMRA 4F7ZA 3ZMUA 2ETHA 4G7ZF 4L9VA 4LK1F 3F22A 1IXCA 5LEJA 2E1NA 3RTRA 4EJUA 3HOSA 3DP7A 3VOEA 4BQAA 4KA4A 4LLNA 1XGMA 1TQPA 2KIMA 5AIPA 3WTWC 1QGPA 1B6AA 3P9KA 3V8LA 2PMHA 3D5LA 1YYVA 4MTDA 4OIRF 2IA0A 2GWRA 2NAZA 1U8RA 4HQEA 2Q0OA 4M6XA 2JPCA 2KIFA 3R61A 3WTYC 3KP7A 1G4DA 2MD5A 2V1XA 1R23A 4ZYEA 1B1BA 5HOOA 3BJAA 4NB5A 5DCMA 5JI6A 2A6EF 2FMLA 2DFIA 4GGGA 4L9NA 4CO8A 5LRSA 1F4KA 5A2QZ 2KKOA 3GX4X 2XIGA 5L3FA 3MZYA 1FYMA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 2FF4A 1K78A 2VXZA 4EM2A 1D3YA 4I98B 1ZRFA 3GVAA 3FWEA 2VC0A 4KIFA 1ZARA 4N0BA 3K69A 3QP6A 3Q9SA 1BBYA 2GAUA 3TKYA 2OZ6A 1XCVA 2ZFWA 3WGIA 2RKHA 2XUBA 3KCCA 2HQRA 2K86A 2P6TA 1ZHFA 4BAYA 4BHPA 3FXUA 4MNUA 4KNYA 5JR3A 1O3RA 4HX8A 1KQ0A 2M1BA 1JHFA 2HDCA 3KEOA 1RZ4A 3T1BA 1XD7A 4RB1A 1IZ1A 3R0AA 2CGPA 1ONVA 3DPTA 2A69F 4MEYF 4NHJA 2XAQA 1MJAA 1R58A 2E1CA 2ZMEB 2F5CA 5DUIA 4G7OF 3E6MA 4A2UA 4Y15A 4ENNA 1Z91A 3FM3A 1FY7A 4LK0F 2FQ3A 2H6CA 1E2XA 2BYVE 1FX7A 4TV7A 3BROA 5DDGA 3N4MA 4UVAA 3FHZA 3QP5A 2EJRA 1HQCA 1XMKA 3SZPA 2A07F 3WU0A 2PFBA 2YU3A 3J81K 3RKXA 1ZAOA 1HW5A 2HYGD 2QQ9A 1R5GA 2ZMEA 1YIOA 2PN6A 3DKWA 4HLXA 4P96A 2OU2A 3GXOA 4HDUA 3MZHA 2F5EA 4HZFA 5CYVA 3VODA 2P5LC 2MC3A 2W57A 4H0EA 3K1PA 1RUNA 3ZMSA 4IHSA 5D5UB 2JRTA 1OR7A 4ZZLA 3Q5FA 3JSPA 1ZRDA 4CDGA 1Z9CA 1U2WA 3KE2A 4ESJA 3PQKA 3RJPA 4LB5A 4U88A 1CGPA 4CGZA 1KYZA 3U2RA 3R60A 4HLYA 2JSCA 1R5HA 3VFZA 3I59A 4MEXF 3J80Z 2GIVA 1TW2A 4A5MA 1QNTA 1HSTA 3H3UA 4D0PA 4L0YB 5DD8A 5DYMA 1Z6TA 3TOBA 2O8XA 5HVQC 3IRQA 1J5YA 1C0WA 3L09A 4P9FA 3GF2A 1TBXA 4LG0B 4XBFA 1IAWA 3KZZA 2F2EA 2ZO4A 4O3MA 4A6EA 2QBYB 1PP7U 3S2WA 1J9IA 2QWWA 4KIGA 4RGXA 3QOPA 5D5XB 1HKTA 1G6NA 4RB0A 5E8IA 1SAXA 3F21A 1FSHA 2L01A 3HUGA 1IXSB 3ERED 4MGRA 3FZVA 3RPQA 1ON2A 4IF4A 2XAHA 4OOIA 5ICFA 2XASA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 3G73A 4M6YA 5D8KB 2E7XA 3KP3A 3R0JA 3F3XA 4UHTA 3E6DA 2GQQA 5CJ9A 2ZXJA 4IRGA 2VE8A 3M7GA 2GZWA 2DI3A 2V6CA 2XAGA 3WTUC 5LBQA 2DQLA 4JQFA 5LHGA 5BQTA 1UFMA 1T38A 4EMSA 4YFNF 1H9TA 4ZZDA 3WTVC 3O2PE 1KA8A 4S04A 1BOAA 2VC1A 3U9GA 4QWQA 1H9GA 5E20A 2D45A 3LSTA 1FLIA 3KP4A 5HLHA 5D6FA 1ZG5A 3KETA 4AVPA 4N9IA 2A3SA 1AOYA 4L9TA 5ILSA 4B09A 1EH7A 1T0FA 3ZPLA 1U6GA 4RAYA 3QAHA 3GLXA 1YQAA 1S7OA 4KMFA 3HIFA 2EFNA 4GCVA 1JXSA 2FSWA 2VODA 1D8KA 1TLHB 3GW2A 4UXNA 1HBXG 1ZLJA 1S29A 2ELHA 4UUVA 1P4WA 3MWMA 2UWMA 1B9MA 4I0AA 4UV8A 3TDUC 5FD5A 1O57A 5FFZA 2QM3A 3GYHX 4CYDA 2DQRA 4A0YA 2KRFA 2EFOA 2E7WA 3KP2A 3ABTA 1T39A 3N97A 2ZNYA 2Q8KA 5EEHA 4EM1A 2F5DA 3HHHA 3KFWX 3DQVC 1FBSA 1LNWA 1MDMB 2X0LA 5D5WB 1R1VA 1U78A 2VOPA 1QZZA 1YS6A 2MH9A 3CTAA 2VONA 2XVCA 5L3CA 3GO5A 4R1HA 2CWEA 3LWFA 1MKMA 2XHKA 3ZN0A 4WF2A 3F8BA 3Q9VA 4DQ2A 2O03A 3JW4A 2VT3A 1BM9A 4KICA 3LQRA 1ZG3A 3VB2A 5D6EA 4UVBA 4M72A 2FBIA 1SFEA 4RGRA 2HKOA 2NS0A 2D1HA 3HOTA 2HQNA 2MLGA 4ETSA 1S7AA 1B4AA 5H6RA 1W7PD 3ZN1A 2O61A 2FBHA 2Z99A 3M1EA 1IN4A 3TO9A 1LEBA 1S8NA 1U5TB 1FYLA 3V7CA 5IT9Z 3LQQA 1FP2A 3HTSB 3WTXC 5D5VB 1ZREA 3E6BA 1OYIA 4HQMA 5FD6A 4RAZA 3WU1B 5LGTA 3ZMTA 3EQLF 4G6DA 3T8TA 5ICCA 3E5QA 5CVJA 3F23A 2QQBA 1WRJA 1GHCA 4I02A 4HYEA 4CXFA 2RDPA 4G8XA 2DTRA 1Q1HA 5LGUA 3OOPA 4MHGA 3IL2A 3GEZA 2DPDA 2CSOA 3HTUA 1BN5A 2QUFA 1K6OA 3ZMZA 3R6SA 5A2QK 2P7VB 3KLOA 2KJCA 2WTEA 4KFCA 2EFPA 2A5YB 3K1NA 3PQJA 3GFLA 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 2IW5A 4ON0A 3IC7A 4HF2A 3M9AA 2UXXA 2GXBA 2DK8A 4UNOA 1K78B 2H09A 1O3TA 4AIHA 2ADUA 1KU3A 1DP7P 4XSZF 1D5VA 5F64A 2G7UA 1Z1DA 2OQGA 3BJ6A 1F9NA 3B02A 2RC4A 1LQ1A 1K79A 3DF8A 4OIOF 4LJZF 2TDXA 5ICGA 3I59B 2EK5A 2MA3A 1D8JA 2EV6A 2VE9A 3RKWA 1RNLA 2L54A 3F8MA 3ZMDA 3W6JB 2AXLA 3RI4A 3QRFF 4IRHA 1R1TA 3I53A 1TNTA 4L9JA 5K1YA 3V4GA 4ENKA 4WK8F 4I2OA 4BYYA 1DUXC 2P4WA 4QLCU 3HRSA 1TW3A 3M8EA 1LDDA 2XAFA 3TQNA 2COMA 1ZYRF 4G7HF 3WODF 2MBFA 1V3FA 4EGZA 3CUQB 4P55A 5J6XA 3E5XA 2RGVA 1JGSA 1DPUA 1SFXA 3MAJA 3RYRA 2XROA 1Z6RA 3U1DA 3IKTA 2WC2A 5F6FA 5E1ZB 3F72A 5DCFA 2PQ8A 2RNJA 2CQKA 2HZTA 4I0BA 1W5TA 2FA5A 4KIBA 3RKYA 2P8TA 2EB7A 3FXRA 1G3WA 3FMQA 3JTHA 5K5RA 1XGNA 1KU9A 4EV0A 3E5UA 2EWNA 2M30A 1UHMA 3LAJA 1FWZA 2M45A 3AAFA 1KU2A 4O5VA 3ML6A 2IRFG 1O7LA 4LFUA 1ZLKA 2K4JA 3IKVA 2YPRA 2IA2A 3QPHA 3ZMVA 5L3EA 5LHIA 1A04A 3K9TA 3FM5A 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3TO7A 3V7SA 4PGHA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 1LDKB 1IW7F 1JE8A 1NHAA 4RB3C 1J7KA 2YSRA 1SMTA 5ERIA 1YW8A 1HKSA 2FEZA 2IP2A 3L00A 4LLGF 1YTYA 3GFIA 5L3BA 5E17F 2FE3A 2MH2A 2OZUA 3EDPA 1L3LA 3K2ZA 2ACJA 3WE3A 4R79A 1WQ2A 3I71A 1DPRA 3T8RA 4XRFA 2OBPA 5HLGA 2QYOA 1JHHA 4DNCA 4EJWA 1XDUA 5BMZA 4U0VA 2RN7A 3SQNA 3JSOA 1W7PB 1T98A 3SFZA 2K7LA 2HKXA 3I4PA 3HSRA 4IVNA 3VEPA 4M9ZA 4RGUA 4ZYGA 3FF5A 6PAXA 3L2CA 5E8GA 4BHBA 2LKPA 1QPMA 5D8LB 3K1MA 4OIPF 4NQWA 2DO7A 4I7HA 4CICA 3GWZA 5ICEA 4ZYHA 3WTZA 4CHUA 4A0XA 2EV0A 5HS7A 2MLKA 2LSOA 2UXNA 2XKPA 5BPDA 4HOBA 4EQQA 4KN4X 3ELKA 1PP8F 3IHUA 4OINF 4CZZA 4N9HA 4G9YA 1HW1A 2LF7A 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 3LFKA 3C3WA 1J75A 3LA2A 3V8JA 4LLLA 1XMAA 1P6RA 4WXCA 5CVIA 2V1DA 3ECOA 2BE5F 5E1XA 2W24A 2PG4A 1SD5A 1GXPA 3EUHA 3COAC 2O0YA 2HTJA 2NRAC 2NNNA 4O6JA 1FP1D 1WI9A 3HSEA 1FC3A 3LA7A 1ZGJA 3F6OA 2ISYA 2DT5A 1BI2A 1IN6A 1J2XA 1WKMA 3IWZA 2K27A 3H92A 5IT9K 3J80K 1HSJA 2CO5A 2IA1A 1I1GA 3KP5A 1EH6A 3RPUA 1O3SA 3REOA 2OQRA 4P5OA 4U7DA 2BEOA 2O6GE 1MJ9A 2DAOA 4HAMA 3MQ0A 4KN7X 5HDKA 1EV7A 1J0RA 1EH8A 4K2EA 4IXAA 2PJPA 3V7RA 2GXGA 2P5VA 1ULYA 3DFGA 2P6SA 2VBXA 4MQ9F 1ZN2A 4PDKA 1USTA 2ZCWA 5TJJA 4MTEA 1IN7A 5JVTA 1SFUA 4HX4A 3EYYA 2V1UA 1FZPB 1UB9A 4ASNA 4RGSA 3F8FA 1PUEE 1L0OC 4FX4A 1P2FA 1HW2A 2VBZA 1LDJA 2W25A 1Z7UA 3IWFA 1X3UA 2WWYA 2W84A 3CLOA 4B8XA 2K02A 1QQIA 1FYKA 2IT0A 5AIQA 1IRFA 1FT9A 2VBWA 1U5TC 1W5SA 3ZP5A 4RB2C 3KLNA 2IVMA 3GFMA 3C7JA 5FFXA 2GA1A 4FT8A 5ILVA 2ZKZA 2Y75A 1IRGA 3R4KA 5IT3A 3O3KA 2GA2A 2H6BA 5E18F 5AONA 1I6XA 4UVCA 3NEUA 1R22A 1RI7A 1R1UA 4ESBA 2R3SA 5ED4A 3LAPA 1WWXA 1W7PA 2JT1A 1BC7C 2Q2EA 5JHUA 2CYYA 2X4HA 3QPTA 2H27A 3CDHA 2VOOA 3BPVA 4EVIA 2JTVA 4WXHA 2PLYA 3P9CA 4IHTA 1HXDA 5E1WA 1IN8A 3BZ6A 2QLZA 3MCZA 2WV0A 1P92A 1OPCA 1ON1A 4Y17A 1O7FA 2A68F 3I58A 4HV5A 5KK1A 1REPC 2FRHA 3FX3A 2HGCA 4L5IA 2DPUA 2DW4A 4R8HA 4AD9A 4WWCA 3F8NA 1G3TA 1XGSA 5K5QA 2VN2A 3BP8A 1BC8C 3I54A 2HEOA 3T0YA 4JK1X 2L02A 2ESNA 4GYGA 1TQIA 2HFHA 4GXOA 1BJAA 2Z5UA 3H3ZA 4M9XA 3WTTC 3IRRA 2PMUA 5D4SA 5LRRA 4BH9A 5H6QA 1HKQA 1FSEA 5DD4A 2FMYA 4FHTA 2V79A 4IRIA 1ZGAA 5LGNA 1ZRCA 3CUQC 2KIUA 2PBIA 5J8FA 3KP6A 4LG0A 4BHCA 3GUDA 4UV9A 4KT5C 1LVAA 1ODDA 3I5UA 2EA4A 3BJOA 3SHFA 3GZ5A 2VT2A 3GFJA 1MDMA 4HW0A 5FO5A 1CF7A 1B9NA 3MFKA 2OAZA 3CO6C 5FB2A 1FBUA 1FPQA 5BPIA 4WXDA 4Q4ZF 4ZH4F 1T2KA 2NNYA 2A61A 3HRMA 2YX7A 1AWCA 1FBQA 4JBAA 1KQ8A 1F1ZA 3SZTA 1RIOH 1OYWA 5J8CA 3BWGA 4M74A 1USSA 3BPXA 1BI1A 1QBJA 5JFRA 4OU0A 3T5XA 2Z33A 5HDGA 3C18A 4LB6B 2G7HA 4ENJA 5ILUA 2DBBA 1YW7A 5CLSA 1LJ9A 4KMUX 4PZJA 1P4AA 4L0ZB 2KJBA 2F5FA 3BDDA 4YIFA 2M8EA 2P7CB 4I09A 1T6SA 1R36A 2XAJA 2EFQA 1MJBA 2CG4A 2RQPA 2M5WA 3HHGA 2ZBKA 5CVUA 2VBYA 1KGSA 5BS6A 1IXRC 2XRNA 2J5OA 3ULQB 1GVJA 2A6HF 3I64A 4Q48A 3FXQA 5LEKA 2DK5A 2FBKA 3RYPA 5H20A 4EGYA 4L5JA 3O6BB 4KYWA 3B73A 4U0WA 4A12A 3EETA 4XLPF 3CO7C 5FLXK 1RUOA 5DCMB 1S3JA 4M71A 3I0TA 3FMSA 4HV6A 1FNNA 4WX9A 5LHHA 2HS5A 3NQOA 3MEXA 2J5PA 5KVRA 1YG2A 1LEAA 4GO1A 1VTNC 1H0MA 2QVOA 4YIIA 1XSVA 3TDZC 2O3FA 4G6QA 1SD6A 2JPBA 5HDNA 1XGOA 3F8CA 3E6CC 1B59A 1LB2A 5LLQA 3QU3A 2EA2A 4Y13A 3G3ZA 1IN5A 2QENA 4A0ZA 3RDIA 2FNPA 4LD5A 3P7NA 1QZYA 3J81Z 1J59A 5DV5A 3C1DA 4HX7A 1BIBA 3HRTA 3JTGA 2STTA 3DXJF 1F5TA 5DEQA 3V8KA 1QO0D 1UCRA 2XGXA 2XV4S 4LGWA 5FGMA 1PDNC 4AWXB 4G94A 1Z05A 2HR3A 3LA3A 5TRDA 5CVVA 3M8FA 2K4BA 1YS7A 1KQ9A 1UHWA 1DDNA 1BI3A 3PFIA 1TNSA 3WE2A 2OD5A 2LF8A 1MD0A 1TTYA 1SD7A 4YFXF 2EV5A 2PI0A 3E97A 2YX4A 2G9WA 2EFWA 1XSDA 2L4MA 2FXAA 5L3GA 2C6YA 1XDSA 4HF0A 5CVRA 4Q5SF 2L3DA 1ZH5A 3DEUA 1S6LA 2FNAA 3WGHA 1YFHA 1G3YA 2V9VA 3TOAA 4U0YA 4FX0A 4U7BA 3RIRA
chains in the Genus database with same CATH superfamily
4YELA 4AYBA 2R93J 4XLAA 1XDNA 2Y2ZA 1Z3YA 4TUYF 3PUFA 3QOEA 3AYHB 4A2BA 4QWDA 3PVXA 2DOAA 1SD4A 3IAS2 3OWTA 4NNJA 3WG9A 2L4AA 3ZQHA 4E70A 3OV8A 4S05A 1DU0A 1BNCA 2PN1A 5FLXW 2FU4A 4A3CG 3JREA 2VQEH 2L9SA 1IV8A 2L7FP 2YR2A 4KUMA 4M9SA 2DXIA 4OIQF 2VOBA 5J2UF 1BIAA 3JSLA 2KQRA 2RV8A 3CCVI 2JA7J 4ZYDA 2GXAA 2EZLA 2Q2EB 1XSXA 1OCOH 1PVEA 1K7AA 1SMYF 3HOZJ 1ZHSA 3V6HA 2IGMA 3E3VA 3Q0VA 5K5OA 4IJAA 4I6ZA 2YRXA 3G6XA 4K0KH 4I76A 1U3EM 1KYWA 2BV6A 2LDUA 2H94A 2V6EA 1OKRA 1Y0UA 3A0BC 3VPDA 2ZXHA 2YZNA 1MZBA 2UUAH 4FCYA 1QZEA 2IPQX 5DUKA 4CH7A 3N42B 4ECRA 2L7KA 2FPIB 5H80A 2CQQA 2OJED 5J1RA 1JUSA 2BBYA 3NRVA 2WA0A 4HDVA 2OTLI 2OTJI 2DYRH 3TO6A 4BDYA 3CESA 4E7IA 5BOXA 3X2QH 1CF7B 3LSRA 4M73A 2ID6A 3J7AO 2M87A 2D1VA 2MC4A 4F92B 5IYDJ 4TV8F 2QQAA 4LSAA 4JV2A 2W6OA 2XF5A 5JH7F 4FS2A 3J7ZI 4IPAA 2QA4I 1YO5C 2XCAA 3WO1A 1E17A 5GONF 2D2WA 1Y0NA 4Q47A 4HF1A 5C4XG 2WAQN 1I1SA 1S0NA 4IAJA 2DLLA 3ZR8X 3WNZA 1VFCA 4EFEA 2CQYA 1MNMC 2OC6A 2Z3YA 3JAMZ 2ESHA 2VJIA 3BOQA 1Z2PX 3G71I 2Y48A 4HSRA 2FP4B 4P9UA 3G6YA 4X65H 2MGQA 3LSMA 2H1LA 4PGGA 4ZI7F 4ED8A 3VPCA 1KU7A 2ELKA 3KEQA 1DGSA 2X0SA 2UVWA 3VYUB 3OYGA 2W85A 4A6DA 1GSHA 3BQ2A 1IO2A 4EJOA 1JT6A 5CAEB 3BQ1A 5KFJA 4I01A 4B3TH 4YFKF 2EILH 2Z9OA 2JA8G 2STWA 1GXQA 1NTCA 2RVCA 2R7FA 2B0LA 1WH5A 4RA2A 1S0MA 1VKZA 3BG9A 2LY1A 3HSFA 2CFXA 3NGDA 4RUAA 2HOEA 2FLNA 2ELJA 4E7SA 4A5NA 2ISZA 2V9WA 5LP6F 4YR0A 1G3SA 1VQKI 3GTKJ 2LBFA 3DU5A 3GTOA 1E0EA 3KZYA 3ECHA 3GV5B 2E5ZA 2Z16A 1MH4A 4GYIA 4IWXA 3HYIA 3AG3H 4ZQIA 1TQMA 4JV1A 2V5AA 3LSGA 4O2BF 1YLFA 4LF8H 2Y0MA 2F48A 1DIKA 2GOMA 2UV1A 3ZQ7A 1OR7C 1XCBA 1K6YA 5EEAA 1IRXA 5BNGA 2DMTA 1MGTA 4M3GA 2KPMA 3ISPA 3ZCOA 2R7UA 1STZA 2ZSIB 2CW0F 1I7NA 3P9IA 1FOKA 3GIIA 1VI0A 5L3DA 4HBLA 4HNUA 2JJ7A 3ROUA 1JJ6C 3L9FA 2MABA 3OYAA 2V4JC 4LMYA 4L18B 1IF1A 5HS8A 2JZYA 2AS5F 2ZSHB 3TGNA 1RK6A 1MBFA 4TV9F 4DL3A 4YG2F 1TL8A 5DQHA 3K0LA 5DG8A 4DL7A 5DLFA 4MQVA 2ZXIA 3QU6A 3BJYA 1KC7A 4Z2YA 3FXLA 1ZTRA 2L0KA 3HM5A 4ESFA 3RCOA 3DPLC 4BL0B 1WSUA 4BXXJ 1I27A 3BY6A 3RGZA 2DA2A 4ENMA 2DPIA 2CW7A 4PCQA 5J1YA 1T8IA 1OMIA 2NYXA 2IJLA 3RSNA 1Y1WG 2VJ5A 3GTMA 5FLXZ 4GC6A 3GTPA 3SFIA 1IBLH 1MMDA 1T33A 3EYIA 2BY0A 4BBRJ 1RESA 5EEGA 3WTSC 1OYYA 3GZ6A 4R8UA 3KYCB 4DIQA 1UZCA 3T5KA 1ZG1A 4QW9A 1XMQH 4C3HJ 4XYLB 2P5KA 1YI2I 2ZNZA 1K1SA 4OMZA 4L5EA 2XKOA 1U8BA 4EM0B 1IUYA 3SE7A 4G3IA 3JAMK 3MWDA 3HRUA 2UZKA 4AIKA 1D1CA 3I4NG 1E4EA 1YJNI 4O2AF 3TL4X 2FOKA 3MKLA 4AYBE 3F6VA 4EJVA 2W82A 3FDSA 4EBDA 1R7JA 1SANA 4GC7A 2R85A 2LNBA 2AQEA 1BI0A 2YCHA 2HYFA 1GGOA 5IYBG 1Z67A 1R00A 4XLNF 4Y7NJ 1I6UA 1W4MA 3H9JA 1K4SA 2HXOA 4BU2A 3SXYA 5KAFC 5EWEA 4LF4H 2VKDA 4CC5A 2HWVA 2QF7A 3G6VA 4PK4A 2J6SA 4EJTA 4DV6H 4X62H 3BG7A 2QKLB 3DV8A 4U87A 1X2NA 3CUOA 2IS4A 3A2KA 3OS2A 1RKWA 1HA8A 3H9GA 4B3AA 2W1OA 4XN0A 3VSKA 2DMUA 3RZOJ 4PWQA 5IT9W 2WTFA 3K4NA 4XMYA 5J1UA 4KT6A 3SDBA 4BXUA 4IOAF 2Z2SB 2NS7A 5D4RA 1I5ZA 1W96A 5C3EJ 1O75A 1XPXA 1S68A 2LY9A 1XN7A 2BHZA 3FMRA 4F7ZA 2R82A 4LF5H 3ZMUA 3CC2I 2RDIA 5IWAH 2ETHA 2EIMH 2JA5J 4G7ZF 3JRCA 1E4EB 4L9VA 4LK1F 3PW2A 1T0FC 3PSIA 4ED0A 1I50J 3F22A 1G2HA 1IXCA 4CCNA 2E1NA 3RTRA 4EJUA 5LEJA 4AIDA 2V9KA 3HOSA 1LPQA 3DP7A 3BA8A 5C3EG 3VOEA 2FX0A 2ZDQA 1F36A 4BQAA 2VA2A 4PSXA 3W2AA 3PO3J 3S3NA 3K3VA 1X3ZB 1M6VA 4KA4A 5GTIC 2JN6A 1VQ9I 1IOWA 2VUMG 4GRIA 5C4XJ 3IV5A 4O4HF 4C30A 4LLNA 2W9CA 2NOGA 2CV2A 1XGMA 3BTCA 1APLC 2R84A 5BPHA 4JI4H 2ZMEC 5B3SH 1TQPA 2E2IA 3K4MA 2FD5A 5KFEA 3BA9A 2KIMA 5AIPA 3WTWC 2KISA 2FB9A 3Q2OA 1QGPA 2UVRA 4XZ3B 1B6AA 3P9KA 3V8LA 4IRDA 2NVXA 2PMHA 5CB4F 1G59A 4I99C 1I50A 4H4KC 2K9NA 3D5LA 1YYVA 4MTDA 4OIRF 3BT9A 2IA0A 4M7EA 2LBFB 1UELB 1F43A 3L4JA 5FRMA 3K4CA 2GWRA 2NAZA 3LWBA 1U8RA 5KAIC 3OYBA 4HQEA 2Q0OA 4M6XA 2HU9A 1TWCA 2JPCA 3K70D 2KIFA 3R61A 3WTYC 2CRGA 2IXSA 4ED7A 1UG2A 4IZOA 1BGWA 3I3LA 3N43B 1WCMJ 3KP7A 1MBEA 3CCRI 3GIDA 1G4DA 4MA5A 1MMAA 2CUFA 4J9SA 2MD5A 2V1XA 3OIPA 4II2A 3SEZA 3R5XA 1E4FT 1S10A 3PO3G 1R23A 4ZYEA 5F0HA 4E7JA 2FPPB 4EBCA 1B1BA 5IP7J 2VR1A 4X1EA 2JA6A 3PNTA 4GDFA 5HOOA 5EJCA 3SI8A 1UG0A 3BJAA 4NB5A 3KX2A 3K70C 5DCMA 2KLOA 5JI6A 1WJAA 3N41B 1TT0A 1A9XA 2A6EF 2FMLA 3QYEA 5HBRB 2KDZA 2DFIA 1D0XA 2ASDA 1QRYA 2DYSH 2N8GA 1B8IA 4ED1A 4GGGA 1I7LA 4L9NA 4CO8A 2VPRA 4DUYH 2E2HA 4ECXA 2R7VA 3HOUJ 4JI3H 5LRSA 4ITVA 2EZHA 1F4KA 5A2QZ 1Z77A 2UUZA 2BHYA 2KKOA 2JK3A 3GX4X 3RBDA 3FXMA 2XIGA 5L3FA 2CQ7A 1Y39A 2KZGA 5KT5A 4PFPA 1I6HJ 1Y56A 3DF7A 3MZYA 2R7ZJ 4EFBA 2DWCA 1FYMA 2LR8A 3DKYA 3HKZA 1YRNB 1WJDA 1E3OC 4RLFA 2XGQA 4AYBN 4HEA2 3OSGA 4HPQA 3DU6A 4F4WA 2HNHA 1SFOA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 5FPOA 5L1IA 2FF4A 4RDUA 4A3GJ 1K78A 1PJRA 2AQ4A 2R7ZG 3H36A 2VXZA 3HOVJ 1DU6A 1X9NA 4NXNH 1R5ID 4MV1A 5J47A 2X1CA 2IP4A 2GBYA 4LH6A 2VA3A 5CPRB 4EM2A 1D3YA 3A01A 4I98B 1ZRFA 1XMOH 3GVAA 3BQYA 3FWEA 2VC0A 4KIFA 1FOWA 1ZARA 4N0BA 5EGOA 4HR7A 5F0CA 3AG2H 2R8HA 4O3RA 3GTQA 3K69A 4ZDLA 2ICWG 3BR6A 3QP6A 4UY8I 4E7LA 4MV8A 2JMWA 2AGPA 3CQZJ 2CQXA 1B72B 1MSEC 3J7AY 3Q9SA 1BBYA 4MA0A 4A3LJ 3S8PA 2FOWA 4EYHB 1YIJI 5KFAA 3U21A 5IP7G 2GAUA 3TKYA 3TQ1A 1WJ5A 2M4GA 2OZ6A 2Y9YA 2BQRA 2JEIA 4BJ5C 2Z1DA 2HOSA 1XCVA 2ZFWA 4LIVA 5HLTA 2KT0A 5IPAA 4IQJA 4BBSG 1WCMG 1OCCH 3IH3A 3WGIA 2RKHA 3GIJA 2XUBA 4BQQA 1HCRA 3RB4A 4PUSA 3KCCA 2HQRA 2K86A 4BQNA 4EATA 4JI8H 3MD2A 3QQAA 2M8GX 2P6TA 2R7SA 2Y30A 4OWRB 1ZGWA 1ZHFA 4I50F 4BAYA 4BHPA 3FXUA 3CCJI 2VJ4A 2MD0A 2R7ZA 5KX5F 4MNUA 4KNYA 5JR3A 1O3RA 2NVTJ 4HX8A 5KG2A 1KQ0A 2M1BA 2Q2TA 1X4PA 2WAEA 1A36A 3K5HA 1FOYA 1JHFA 3HOWJ 3GBGA 2K3FA 3KEOA 2HDCA 1RZ4A 3T1BA 3L2WA 5B1BH 1XD7A 3L2VA 3RUPA 4B4CA 5EDWA 2E2HJ 3JRAA 2XPWA 4RB1A 2R7RA 4DV0H 1IZ1A 3R0AA 1VQMI 2CGPA 1ONVA 3DPTA 2A69F 2FLLA 3L4KA 2LKSA 4MEYF 5FPRA 4NHJA 3ESWB 2XAQA 1MJAA 1V9PA 2LMDA 1R58A 1RC9A 2CH0A 2HVQA 3FISA 1VQOI 2E1CA 1BXRA 2ZMEB 1ZR2A 2QK4A 2UVVA 1S5LC 2F5CA 5DUIA 5EZYF 1Y8QB 4G7OF 3FXKA 3E6MA 4A2UA 3H35A 3LSKA 4Y15A 4FBUA 1FTTA 1R4MB 2BXZA 4HG2A 5KFQA 4ENNA 1Z91A 3FM3A 2R5YB 2AO9A 3K6GA 2B9SA 1I3QA 1FY7A 2DA3A 2FQ3A 4LK0F 2HHHH 2H6CA 1E2XA 2BYVE 1FX7A 4TV7A 3BROA 5DDGA 3MR3A 2L9RA 1S9FA 3N4MA 5KFDA 1WCMA 2I5UA 4PJ0C 4UVAA 4A3IJ 1SFKA 2BW3B 2ASJA 2VQHA 5KG1A 4A3KG 2R7TA 3FHZA 2IGKA 4CYCB 5C4JJ 3QP5A 1AU7A 4DV2H 4DR6H 1AUXA 3PSFA 2EJRA 4ECTA 5KFYA 1QVTA 2OF7A 1HQCA 1XMKA 3SZPA 4BY1G 2O5RA 2XC7A 5FKOA 1KBLA 3QZ8A 2A07F 2ZM6H 3WU0A 3RV3A 4A3JJ 2PFBA 4BEHA 2YU3A 3J81K 1ZAOA 1HW5A 3RKXA 4MV7A 3CC7I 2HYGD 2QQ9A 1R9TA 2XGDA 3AG4H 1R5GA 2ZMEA 3OYKA 2XF7A 1YIOA 2PN6A 3DKWA 4NC7A 1FIAA 5FLMJ 4HLXA 3AL0B 4P96A 4W1UA 2OU2A 3GXOA 4HDUA 3MZHA 3RJ0A 1JLLB 3V6JA 2F5EA 2X1EA 3BR3A 1P8LA 4HZFA 2A05A 4MIMA 2HYJA 3BTJA 3LMMA 5CYVA 3VODA 4BJTA 2P5LC 5KT2A 4U6PA 3TMOA 2BVMA 2MC3A 2W57A 2IA6A 3DEEA 3CMYA 3KHGA 3QYFA 2JVHA 4H0EA 3K1PA 5JVLA 1RUNA 3GMEA 4WD3A 4XM3A 3ZMSA 4IHSA 5D5UB 5KFMA 5KFCA 2DJIA 2DPJA 3QZ7A 2JRTA 2ME6A 2FQ4A 5F9NA 1OR7A 4ZZLA 3I55I 1DV2A 3AG1H 3Q5FA 3CJRB 5DG7A 1L2ZA 3JSPA 2HI3A 2XDVA 1ZRDA 3PIOF 4CDGA 1Z9CA 1U2WA 2SCUB 2VPQA 5KFVA 2X48A 3KE2A 4ESJA 3PQKA 3RJPA 2W9BA 5JLXA 1RRJA 4LB5A 4KHPH 3ASOH 4XOTA 3BLYA 1Y6IA 4DW6A 2DFEA 1MSFC 2UXDH 4U88A 1CGPA 5LMNH 2EIJH 2R0QC 4CGZA 5JQWA 1KYZA 3U2RA 3HBLA 2V1NA 3R60A 4HLYA 3Q1KA 2JSCA 2CW8A 1R5HA 1DV1A 3H5NA 3VFZA 3I59A 3LSIA 4MEXF 4LFCH 3J80Z 5FRNA 1IUFA 2GIVA 5JUMA 1TW2A 3OYNA 3RAXA 1T3NA 5F0FA 2W8KA 2CUJA 5GAGJ 3OYIA 5DQIA 4A5MA 2ATLA 4J01A 1QNTA 1HSTA 3GLLA 1EA3A 3ASNH 3ERMA 2CS3A 3H3UA 2GOXB 3PM1A 3BG3A 4D0PA 5D1PA 1LKXA 3WU2C 3E7LA 3QYBA 3K4LA 2F6CA 2IGOA 3TEDA 4L0YB 5DD8A 2DTZA 5DYMA 5IP6A 3R5HA 4UCTA 3QFFA 3DCFA 1Z6TA 3TOBA 2AU0A 1BOBA 2O8XA 5HVQC 3IRQA 1J5YA 2DA4A 4BACA 1C0WA 5KFZA 2Y0SN 4D5CA 4V2GA 2OCEA 5GPAA 3L09A 5LOVF 4NC6A 4P9FA 3GF2A 1TBXA 4LG0B 2WE6A 1U9OA 4MV4A 4XBFA 3EUAA 3IP4B 1IAWA 3KZZA 4BEHB 2F2EA 2XPVA 4ZDOA 2ZO4A 4S0HB 4O3MA 3PW7A 3FXOA 3PW0A 4A6EA 2QBYB 2GPWA 1V5GA 1PP7U 3S2WA 1J9IA 2QWWA 2HOTA 5F9LA 5LFAA 4KIGA 3A02A 4AQYH 4RGXA 2WYOA 4LG3A 4LSXA 2L7ZA 1X1CA 3GTMJ 3PZPA 3QOPA 3FKIG 1P9QC 1Z7LA 5D5XB 2FUG2 1HKTA 5E3OA 2R6FA 2UVUA 1G6NA 4RB0A 3S2DJ 4DL4A 5CQGA 5FKMA 5E8IA 1IBKH 1SAXA 3F21A 1SVLA 1NK2P 2FK3A 3OHAA 1FSHA 2L01A 1J5EH 3HUGA 1IXSB 1TWAJ 3ERED 1SVMA 1B72A 4MGRA 3FZVA 2DODA 3RPQA 1ON2A 4IF4A 3OY9A 2K40A 2XAHA 4OOIA 5ICFA 1T08B 2XASA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 2WAQA 3G73A 4M6YA 4XOPA 3S1RJ 1TA8A 1Y1VG 1Z21A 4LIUA 1KZHA 5D8KB 2E7XA 1JDBB 2HZDA 3FXJA 3KP3A 1GT0C 4ED6A 3CF2A 3R0JA 3F3XA 4UHTA 3E6DA 2AHQA 2GQQA 2R93G 1B6SA 5CJ9A 4JI1H 2M0MA 1AN7A 2ZXJA 3DTKA 4IHYA 4IRGA 4UCVA 3UR3C 2VE8A 3M7GA 3K5IA 2GZWA 2DI3A 1TAEA 2V6CA 2XAGA 3WTUC 4QWEA 3V6KA 3KXYT 1T56A 3EUHC 2DQLA 4JQFA 5LBQA 4BY1J 2VJJA 2F5VA 5LHGA 2WV1A 3M1CA 2R8KA 5BQTA 4UCSA 3PR5B 1UFMA 3AKZA 5DLGA 3BAAA 4GKKH 1T38A 1WJBA 4AM3A 1IGNA 2OV7A 2Q1ZB 4EMSA 4YFNF 4EBEA 3QODA 2HQAA 1JUPA 2R7LA 1H9TA 3DTIA 4ZZDA 2IEKA 4RM2A 3WTVC 3ZQFA 3O2PE 2MFZA 1KA8A 3PO2J 3CCMI 3ABLH 5FKLA 2K9MA 4ZJZA 4S04A 3VMMA 1BOAA 4BE2A 2VC1A 3U9GA 1A6IA 4QWQA 2ZDHA 3FIWA 1H9GA 5E20A 3K10A 3VSLA 4XLCA 1HNXH 2D45A 4EGQA 3ZQQA 3G4SI 3LSTA 2M7AA 3AL0C 1FLIA 4ECWA 3BR0A 3KP4A 4Q0YA 3LFUA 5HLHA 5D6FA 1ZG5A 2C2DA 3KETA 1JGGA 4AVPA 4A93G 1Z3XA 4N9IA 2A3SA 4QSHA 4F91B 3DTEA 1XX5A 1AOYA 3R23A 2W4SA 3HOUG 4L9TA 5ILSA 1SFOJ 3OL4A 4O3NA 4B44A 1D1BA 4B09A 1EH7A 2HXIA 2XRLA 1GSAA 1T0FA 3ZPLA 1U6GA 4RAYA 4DLKA 3QAHA 3GLXA 3D5RC 3PFYA 3MKYB 3GTQJ 4UUSA 1K83J 1YQAA 1S7OA 4KMFA 1JKOC 3HIFA 2XGPA 3J7AK 2EFNA 2LG4A 5KG0A 2WY7Q 2NU8B 1KJQA 2H1KA 4IHJF 4XRSA 3W2WA 3J81W 4GCVA 1KJIA 1JXSA 1OCZH 2FSWA 5GP9A 5K7ZA 4IHXA 4QWCA 2VODA 1TWAA 1D8KA 4XRSG 2FPGB 4XN3A 1TLHB 2I80A 3GW2A 3J7YJ 1KEEA 1GYFA 4QPQA 4UXNA 1HBXG 1ZLJA 1HNWH 1BW5A 1S29A 5FKNA 1M0TA 3OUZA 2ELHA 2V4RA 4YY3H 4UUVA 1P4WA 5EWFA 5LMUH 1VNDA 3D1NI 4D9JA 2WBMA 3MWMA 2LKXA 1B9MA 3K4BA 2UWMA 4I0AA 4UV8A 3TDUC 3Q0WA 5KKNB 4DL5A 3FKIA 3Q0UA 5FD5A 1O57A 4C2MA 4BJ6C 2QGUA 5FFZA 3GLKA 2VQDA 1HF0A 4J9NA 1OQYA 1VQNI 2QM3A 1UAAA 3GYHX 1W1WE 4CYDA 2VUGA 3IUOA 2DQRA 4A0YA 1YITI 2BOLA 2LC2A 2KRFA 2EFOA 4FTHA 2E7WA 5EZHA 5IYDG 3BABA 1PK8A 3SZGA 3KP2A 3ABTA 1T39A 4ECUA 3N97A 2ZNYA 2PMZA 2Q8KA 3LP8A 3VYTB 4JI2H 4IR9A 5EEHA 4EM1A 2F5DA 3HHHA 5DGAA 1U9NA 4HNTA 3KFWX 1A0IA 1VQ7I 3CD6I 3DQVC 1FBSA 1AA7A 4DV1H 1LNWA 1MDMB 4AU7A 2X0LA 4DV7H 5D5WB 2W8LA 1JXLA 3ZOBA 1R1VA 4IQ4A 2VL8A 2KIQA 1YE9A 1U78A 2VOPA 1QZZA 1K1QA 3A03A 1ZQ7A 4QW8A 1V5FA 2W7NA 1YS6A 1E3HA 2MH9A 1ZELA 3CTAA 3RQ4A 4AC0A 2JEFA 2VONA 3MR5A 1MW7A 3HOWG 2XVCA 2F4VH 3A4CA 1YOVB 2BY1A 1TP4A 1C3OA 2I8DA 4MAMA 3K7AJ 2FKLA 3U9SA 3SDGA 4D1QA 1IV6A 4QIWN 4C3JJ 5L3CA 2PBZA 4DZPA 2DA5A 2X85A 3GO5A 2RF4A 3HOXJ 1Y1VA 4J00A 4R1HA 3W3CA 2CWEA 2JVGA 4XLFA 1NH3A 4MFEA 3LWFA 1MKMA 1JUMA 1RR7A 2XHKA 3OIQA 3G8CA 1AKHA 3ZN0A 4WF2A 3F8BA 1Z0XA 3Q9VA 3Q3SA 4DQ2A 5C1OA 4XLHA 1EHIA 2O03A 3JW4A 2LRDA 5JHFA 2VT3A 2HVSA 3MR6A 1BM9A 4KICA 3LQRA 3OUUA 5CA1F 1ZG3A 4YEJA 2L7MP 1FEXA 2COBA 2RNGA 1DP3A 2JEJA 3VB2A 2EQRA 5D6EA 1MBHA 2C22A 3HOYJ 3RBEA 3KHRA 4PSWA 4L1KA 4YR3A 4UVBA 4M72A 2FBIA 1H8AC 1SFEA 4MO7A 4RGRA 2HKOA 4DV5H 4UB6C 2NS0A 1I39A 4BDZA 3IG0A 2D1HA 3GZNB 3BG5A 3HOTA 1R9TJ 4HRIA 2HQNA 4ZYAA 2W9BB 2MLGA 2PX9A 4ETSA 1S7AA 1B4AA 3IH4A 5H6RA 1HOMA 3GTJA 1W7PD 1QHHD 3B6CA 3ZN1A 2O61A 4KISA 3ORRA 3JRDA 2FBHA 2Z99A 3M1EA 3VPBA 3I56I 3P5JA 2LK2A 1JJ8C 1IN4A 5D1OB 3TO9A 1LEBA 1JI8A 1S8NA 1U5TB 4HSTA 2E35A 4EG0A 1SC7A 1XG1A 2W9AA 1FYLA 5IOZA 2J6TA 3KHLA 5K7FA 3V7CA 2MCTA 3V4SA 5IT9Z 1IC8A 4BBRG 1QHGA 2VIXA 2IS6A 2MYSA 5DG9A 3LQQA 1I3QJ 3BR2A 4BS9A 2QYZA 4PDBA 4V2FA 1FP2A 1WGXA 1WJFA 3M9MB 4ECYA 3HTSB 1ETOA 1X1DA 3SJMA 5KT6A 4RAGA 3WTXC 5D5VB 2K3PA 1ZR4A 5KFRA 2KHMA 1QA6A 3E6BA 1ZREA 4RBOA 1T36A 2R7NA 1OYIA 1X1BA 4DJAA 1A5JA 2CFOA 4HQMA 5FD6A 4RAZA 4YRVA 3WU1B 5LGTA 3A01B 3ZMTA 3EQLF 3GILA 4G6DA 5L1KA 3T8TA 5C44J 3MKZA 3NAUA 3IH2A 3L2QA 5ICCA 3E5QA 5CVJA 3F23A 2QQBA 3FK6A 1WRJA 1GHCA 4IRCA 2EH3A 3OL3A 4I02A 4HYEA 4CXFA 3GQCA 4IR1A 2RDPA 1RYSA 1RJRA 5K2MA 4G8XA 2W7PA 2DTRA 3OYLA 1Q1HA 5LGUA 2TCTA 2R7OA 3OOPA 3L1PA 4A3DJ 3GIKA 3HOVG 2AQFA 1VQLI 4MHGA 3TIGA 3M4OJ 3IL2A 3CZ6A 3GEZA 2DPDA 4LH7A 1TWFA 2CSOA 2WAFA 3HTUA 1BN5A 2QUFA 3GV8B 4DBQA 3CCQI 1K6OA 3ZMZA 1OCTC 1RJPA 2P0AA 4QJFA 3R6SA 1W36D 3M8JA 4FU0A 5A2QK 2P7VB 1VQ8I 3O8HA 3KLOA 4YAJB 2V4QA 2KJCA 1N32H 4O3SA 2WTEA 3OR2C 1CE8A 2W9CB 4KFCA 4JV5H 2EFPA 5KCMA 2A5YB 3K1NA 4XKCA 3PQJA 3GFLA 4EYIB 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 1UC9A 1NG7A 1W5CC 2IW5A 5HV6A 4ON0A 3IC7A 4HF2A 1X2MA 3M9AA 2B63J 2UXXA 2GXBA 4XKBA 2VQLA 3HJEA 3PN1A 2DK8A 3HGGA 4UNOA 3N40P 1K78B 2H09A 4BKXA 3MZ8A 2ECCA 1O3TA 3HUGB 4AIHA 4F3QA 2ADUA 2R5ZB 3WHBA 1GLNA 1D5YA 1KU3A 3I4MG 1DP7P 2ID3A 1FJGH 1LFPA 4XSZF 4FS1A 2IGNA 1D5VA 2HDDA 3BQ0A 5F64A 1ZETA 2CUEA 4F4YA 4IZZA 1JKJB 4U7CA 3G1LA 2G7UA 1Z1DA 3CCEI 4V19K 1YJ9I 3LSPA 2E2IJ 2J9GA 3U9TA 2OQGA 3BJ6A 1F9NA 3B02A 3G2BA 2RC4A 4WBNF 4ED2A 3OS1A 1LQ1A 2VASA 5IYZF 1K79A 2R7XA 4E4HA 5EDNA 2QQ8A 3DPUA 4ME6A 1A35A 3DF8A 4OIOF 4DR2H 4UUTA 5C1PA 5KFXA 2BY3A 2NOJB 4LJZF 2TDXA 1KJ8A 1N77A 2NUAB 5ICGA 3BG6A 5EG0A 2O8KA 2RDJA 3I59B 4J9PA 2EK5A 4XNFA 4B3SH 2MA3A 3L2PA 1JKRC 4HQ6A 2X6OA 2OPTA 2ZB9A 3ZQCA 1SCUB 1TWHA 3KEYA 1D8JA 1Y8RB 2QSHX 2EV6A 2NXNB 2VE9A 3RKWA 4M3FA 4C5BA 1RNLA 2L54A 3F8MA 1NG6A 4C3IJ 3ZMDA 1KJ9A 4JI0H 3W6JB 2DLNA 1FTZA 2AXLA 2NU9B 3RI4A 4RNOA 4ECSA 3QRFF 2OWOA 4IRHA 1B04A 1R1TA 1GVDA 1ZKGA 1X1AA 3BZKA 4FE7A 3I53A 4NC8A 1MMSA 4RAFA 3HKZE 1EUCB 1TNTA 4L9JA 5E3LA 5K1YA 3V4GA 2WDTA 5KG5A 3KZIC 3OS0A 4JV0A 4ENKA 4WK8F 1RR8C 4I2OA 2X6XA 4BYYA 1DUXC 2P4WA 4BE0A 4QLCU 3HRSA 1TW3A 3M8EA 2B7EA 1LDDA 2XAFA 5B5EC 4NLGA 3TQNA 4O4IF 3OYHA 2BR0A 2COMA 4FISA 2BZTA 1JDEA 5HNFA 4YJ2F 5FROA 3MN2A 1ZYRF 3M4IA 3RV4A 4G7HF 3WODF 3RAQA 2MBFA 1V3FA 2WB1E 3M9NB 3EUKL 2IS1A 3ZQLA 4RNNA 3I4NJ 3TIIA 4EGZA 5L1LA 3CUQB 4YIRX 4Q45A 4P55A 5J6XA 2DA6A 5J4VA 3E5XA 4XIDA 2RGVA 1JGSA 1DPUA 1LVKA 1SFXA 3MAJA 2B63G 3BR1A 2ZJQF 1BW6A 2QCOA 2HQ5A 3MVPA 3RYRA 1N48A 5KT4A 2I8CA 4C5CA 1SEIA 2XROA 2L5QA 3IAM2 3SEQA 1RETA 1Z6RA 1XNQH 2PJRA 3U1DA 3IKTA 2WC2A 2EZIA 3BQZA 5F6FA 4MV9A 3EPGA 3I4MJ 4ANJA 2E5LH 5E1ZB 4BXXG 3F72A 5DCFA 2PQ8A 2YS6A 5KFTA 2ALZA 2RNJA 4BGDA 2CQKA 3A0HC 1W0TA 2HZTA 2R93A 4I0BA 5FKKA 1W5TA 2FA5A 4KIBA 3RKYA 4EGJA 1EYZA 2P8TA 3KAJA 4LF9H 2EB7A 1X1PA 3FXRA 2X9DA 1G3WA 3FMQA 3JTHA 5K5RA 3H0GG 1XGNA 4MV6A 4M3BA 1KU9A 2LTPA 4EV0A 2QSFX 1D1AA 3E5UA 3HG9A 2EWNA 2M30A 2HJWA 1Y14B 2HVRA 4C2UA 2E2JJ 2F4MB 1UHMA 2LD5A 2HOAA 4Y33A 3KALA 3C2HA 3LAJA 1FWZA 2M45A 2UXBH 4DV4H 3AAFA 1KU2A 3Q8SB 2FK2A 2Y0SA 2YUSA 4O5VA 2YYAA 3B6AA 4DGWB 3ML6A 1CS0A 2IRFG 1O7LA 4LFUA 2HDWA 1ZLKA 2K4JA 3IKVA 2R7MA 2YPRA 2IA2A 3QPHA 1W0UA 3ZMVA 5L3EA 5LHIA 1A04A 2P0WA 3GV7B 1EZ1A 3UQ8A 3K9TA 1YX5A 3FM5A 5CKTA 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3O8GA 3TO7A 2WADA 1S97A 3V7SA 1HC8A 4PGHA 3PUBA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 3G6EI 4F52A 1QPIA 1EKEA 4E7ZA 3NWTA 1LDKB 1UHSA 3CJTB 5B1AH 2ZJRF 1O4XA 1IW7F 4IWYA 2C35B 2XSDC 3OYFA 1JE8A 3GTGJ 1V54H 5JVDF 1VF9A 1NHAA 3JRXA 4RB3C 1ACIA 1J7KA 2CUZA 4PJMA 2YSRA 1SMTA 5ERIA 1YW8A 4HYKA 4Q8FA 2R5YA 4UCOA 4YP3A 4IKFA 1HKSA 5KFLA 2FEZA 2IP2A 3L00A 4LLGF 2I10A 3WG7H 1YTYA 3GFIA 2M2EA 5L3BA 5E17F 2FE3A 2MH2A 2OZUA 5KT3A 3Q8QB 3EDPA 4TQRA 1L3LA 3K2ZA 2Q2UA 1LUJB 2J6UA 2OUMA 1KJJA 4TQSA 1N34H 2ACJA 2X6YA 4II3A 1IJWC 1ZHQA 3WE3A 4R79A 4IEJA 3TP3A 1WQ2A 1VQPI 1UC8A 3K4JA 3I71A 4XX0B 1DPRA 3T8RA 4JI7H 1ETXA 2KDOA 1RPWA 2E34A 4XRFA 2KL4A 2V58A 2OBPA 3T1YH 2RREA 5GADJ 5HLGA 2QYOA 4CCOA 3PJRA 4O3PA 4J9RA 1N56A 1JHHA 4DNCA 4EJWA 1XDUA 5BMZA 1ERDA 2ME0A 3FBNB 4U0VA 1FJLA 2RN7A 3SQNA 2V59A 3JSOA 2AGOA 3FMAA 4N4OB 4DOZA 2W71A 2WB1A 1W7PB 1T98A 3SFZA 2K7LA 1X19A 1IDYA 5LA6F 5BR8H 2HKXA 2DIKA 1GUUA 3I4PA 1H88C 3Q8RB 3ZQGA 3RFCA 1EJ9A 3HSRA 5C44G 2DCEA 4IVNA 3VEPA 2DT6A 4M9ZA 2IBKA 4ABZA 5LXTF 2KRCA 2C28A 4RGUA 2LYCA 4ZYGA 4QPOA 3RB6A 1ETVA 3FF5A 3H5AA 6PAXA 3L2CA 1HNZH 1OCRH 5E8GA 4BHBA 2LKPA 1QPMA 5B66C 1B33N 5D8LB 3K1MA 5FJ8J 3VYSB 2R7KA 5EYRA 3HPGA 1GDTA 4OIPF 4NQWA 5LYJF 2DO7A 4I7HA 4CICA 3GWZA 4APMA 5CA0F 2LFBA 2JRMA 4XYMB 5T14A 4MV3A 3S3OA 5ICEA 3R5FA 1IBMH 4N4NB 1N36H 3PNVA 4MLOA 4ZYHA 4RUCA 4C2TA 2OH2A 3WO0A 5FJ8G 3WTZA 4CCJA 4CHUA 4Y8VB 4A0XA 4J0MA 2W6MA 2EV0A 4J9KA 2PVPA 5HS7A 2MLKA 2LSOA 4C5AA 4JP0A 2UXNA 2VQGA 1RYRA 2LREA 2XKPA 5BPDA 2M34A 5F1JA 1N33H 2TRTA 4HOBA 1PX2A 4EQQA 1HR0H 2YU9A 4KN4X 3ELKA 1ETKA 3CMEI 1PP8F 3T5JA 3IHUA 2JA7G 1R4NB 4OINF 4FQGA 1ETQA 3MWEA 2VKHA 4CZZA 3OYJA 4YQWA 3FBIB 4N9HA 3TW6A 3PO2G 4G9YA 4RMNA 3UNGC 4QWBA 1HW1A 1VBHA 4OAZA 3V42A 2DFFA 2LF7A 3LSJA 1I94H 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 2NVUB 1XC5A 4CSWA 3LFKA 3C3WA 1J75A 1UNNC 2CMPA 3LA2A 3V8JA 4LLLA 1MNDA 1XMAA 3E5NA 3H0GJ 1P6RA 4WXCA 5CVIA 4UFZA 1AKHB 2V1DA 4ZDPA 4A3GG 4A3LG 3S17J 1XS9A 4PJNA 1PUFB 4A93J 3ECOA 2BE5F 5E1XA 5KFHA 2W24A 4ZC3A 2PG4A 1BR1A 1SD5A 2XD4A 2Y69H 2VKEA 5M3FJ 1AUVA 1GXPA 1K61A 4M9UA 3EUHA 3COAC 2O0YA 2HTJA 2XB5A 2NRAC 2NNNA 3JRBA 4O6JA 1FP1D 1WI9A 2VB6A 4AVZA 3HSEA 3N8DA 1ORKA 3ETJA 2W7OA 1FC3A 3LA7A 3OYMA 1ZGJA 3F6OA 2ISYA 3BTLA 3FKJA 2D5VA 2DT5A 3ZGKA 4PFOA 4DBRA 5DQGA 1BI2A 1WPKA 3K4KA 4UB8C 3TBIA 1VS0A 1IN6A 3KHHA 5J4YA 1J2XA 4E6KG 3ZRGA 1WKMA 1X58A 1H89C 3IWZA 2ZJPF 2K27A 3H92A 4DL2A 5IT9K 3J80K 1SVOA 1HSJA 4B1RA 2CO5A 2IA1A 4DYRA 2P81A 2DMNA 1WVRA 1I1GA 4XKVA 2F4OB 5KFKA 1IOVA 1FVIA 3KP5A 1EH6A 3C2BA 1J09A 3RPUA 1O3SA 3REOA 4IHWA 2C2EA 2YS7A 3RGXA 3FKIJ 1WHUA 2OQRA 2ECBA 4ED3A 4P5OA 1V4YA 4U7DA 3VPRA 2R87A 2KZVA 5L9XA 2W6NA 2BEOA 3BZCA 3GIPA 3HB9A 2O6GE 1MJ9A 2DAOA 4HAMA 2GM4A 5DM7F 4BBSJ 2BXYA 3MQ0A 2M9HA 4KN7X 4J9QA 3M07A 3GTPJ 2DA7A 4C9YA 5HDKA 1IG7A 3CDIA 2QSGX 2NVYJ 4CZCA 4A3CJ 3S1QJ 1EV7A 5GAHJ 1J0RA 4O3QA 4GKJH 1EH8A 3BCAA 2BW3A 2E60A 4K2EA 2M05A 1N25A 4IXAA 2PJPA 4A2AA 2YW2A 4CUGA 3V7RA 5IYCJ 2GXGA 3VYRB 2CQNA 2WAQE 3I12A 2P5VA 1ULYA 3DFGA 2X6WA 2P6SA 2VBXA 4C2MJ 4MQ9F 3RF2A 2A6TA 5KFNA 5C5JA 1V51A 1ZN2A 5KFFA 3H3VH 3J80W 2K5CA 4PDKA 1USTA 2ZCWA 5TJJA 4MTEA 1QVUA 1IN7A 5JVTA 3ZXSA 2XPUA 1SFUA 5KFPA 1GO3E 3OTOH 4ECVA 2DA1A 4HX4A 1Z2OX 3EYYA 2V1UA 1VQ5I 1FZPB 1MIJA 1UB9A 2DDAA 4I55F 4BXFA 1C30A 4FBTA 1CQJB 4O3OA 5BMVF 3F9KA 3HDDA 4DZJA 4ASNA 4RGSA 4BY7G 1VBGA 3RQIA 1MMGA 3H5RA 1FMWA 3GTOJ 4NBQA 3F8FA 1PUEE 1L0OC 1S7EA 4NQWB 1P2FA 4FX4A 5J2TF 4YAKB 1HW2A 2VBZA 1LDJA 2RAEA 5KT7A 2W25A 4G12A 3DEWA 1Z7UA 2AXTC 2X1DA 3IWFA 1X3UA 2WWYA 3CVZA 5TISC 2VQCA 1RKTA 1TWHJ 1RK5A 5GPCA 3A1YA 4IOCF 1HDDC 1K83A 2KMUA 2W84A 3CLOA 2W70A 4B8XA 2K02A 1QQIA 1FYKA 3KPHA 2CKZB 2YS9A 2MW8A 3OIOA 2IT0A 5KFGA 2X51A 1LFUP 3MFIA 2FMAA 5AIQA 1IRFA 5EG0B 1BL0A 1FT9A 3DBLB 2VBWA 5I47A 4KJZA 1U5TC 1UJ8A 1W5SA 4RM3A 3CMAI 4JUZA 3GTLA 2CU7A 4XRMA 4EEQA 2IMWP 1LE8B 3JSNA 2DMPA 2VPSA 4A3FJ 3ZP5A 4RB2C 3KLNA 2IVMA 3DBHB 3GFMA 1I3AA 4OX9H 2EINH 2XGEA 5E3NA 3C7JA 2H8WA 2R7QA 1CQTA 4J9LA 5FFXA 2R86A 1YJWI 2KFDA 2HPMA 4QIWA 1S03G 5CQEA 2GA1A 1XTAA 2JQ7A 4BY7J 4LFAH 2DN0A 4FT8A 5ILVA 2ZKZA 3HGYA 2Y75A 1GV5A 4GFBA 1IRGA 3S16J 3EPIA 2Y31A 4CCKA 5KNLA 3R4KA 3GCMA 5IT3A 2PMZN 3O3KA 3RIZA 1ULZA 1W36C 1TZLA 2YU9J 1YX3A 2GA2A 4A3BG 5M3MJ 4QWAA 4A3MG 2H6BA 5E18F 4Y52J 4UCRA 4B47A 3S1NJ 5J3LA 1DQUA 2AGQA 4IRKA 2E1OA 2L9NA 3DLAA 1A6QA 5AONA 4IO9F 1VQ4I 1I6XA 4FETA 4UVCA 3NEUA 4A3JG 2JEGA 3ORQA 2R4GA 4XLEA 1X3WB 2PMZE 3RB0A 1R22A 4RNMA 1Q1VA 4E7KA 1ITYA 2CJJA 2XAUA 4YB8B 3G1OA 4ZTFA 1RI7A 3W6VA 4DR3H 1SAUA 1HDPA 1R1UA 4ESBA 3AFHA 5K7HA 5DTDA 2R3SA 1BR2A 3HOYG 1WH2A 3TQTA 5ED4A 4M3EA 3LAPA 1WWXA 1W7PA 2JT1A 1BC7C 2JA6J 4X66H 1Y1WJ 2Q2EA 5JHUA 4CCLA 2CYYA 2X4HA 3OOUA 3QPTA 5J40A 1IDZA 4YJ3F 5TGTA 2H27A 2BVLA 1NK3P 3CDHA 4RZRA 2RQQA 2VOOA 3BPVA 4EVIA 5C8YF 3H4BA 2DJNA 2JTVA 2R8JA 4WXHA 3TW7A 1T94A 1TC3C 2PLYA 5EGOB 3CCSI 1E4GT 2W48A 3P9CA 4JYKA 4NXMH 3OR1C 5DM6F 9ANTA 4IHTA 3K3PA 1HXDA 1P7IA 3CDLA 5E1WA 1IN8A 4A3DG 4GLXA 3T5HA 1FMVA 2EPFA 3BZ6A 4A3KJ 2QLZA 2XCLA 1OCPA 3V4ZA 2UU9H 2JA7A 3MCZA 4IL6C 2ZXWH 3U1KA 5D8DA 3DKXA 3UFXB 4QTRA 2WV0A 1GV2A 2DOFA 1POGA 1S72I 1P92A 4LITA 3H9QA 4JX6A 4B3RH 3Q8PB 1ZK8A 3EPZA 4B3MH 1OPCA 1OFCX 1ON1A 5D1OA 4Y17A 1T95A 4EEFG 1YHQI 4O4LF 3HC7A 3PW4A 1BA5A 1O7FA 3BTIA 5HODA 2A68F 3I58A 3UKGA 1A31A 4D7MA 5KG4A 4A3EJ 4LFBH 5JLWA 4HV5A 2NVQJ 5KK1A 2V7FA 1REPC 1HLVA 4PJLA 2UXCH 2VXDA 2FRHA 2IAIA 3CP8A 1N78A 2OCCH 3FX3A 1N75A 2HGCA 4ZOLF 4NUBA 4L5IA 3JR9A 3JRGA 2DPUA 5EWGA 1X4OA 2DW4A 4R8HA 4AD9A 2ZDGA 5KG7A 4LF6H 4WWCA 4F4XA 3KTMA 3JAMW 3F8NA 1PYVA 3OMYA 3S15J 1G3TA 3GTJJ 1XGSA 3QPSA 1DGWY 5K5QA 2VN2A 3BP8A 2R92A 1BC8C 1BR4A 3I54A 2NVXJ 5F04A 2DMQA 4DYQA 2HEOA 2VUMA 5HNHA 1B8IB 1QU3A 2R8GA 3T0YA 1RJQA 4JK1X 5BPFA 2L02A 3NARA 2ESNA 3RB3A 2FLPA 4GYGA 2GLTA 1TQIA 2HFHA 4GXOA 2YL2A 1BJAA 2ZC2A 4A69C 5A2QW 4DL6A 2Z5UA 3H3ZA 4M9XA 1WJCA 3HZJA 2R92G 4DR5H 3WTTC 2M0CA 3IRRA 2JWTA 2C2RA 2OLSA 3H20A 2PMUA 3NWSA 4UUSB 3JCUC 5D4SA 2O7OA 2EBIA 2LH9A 5LRRA 5LD2C 4BH9A 5H6QA 1HKQA 1FSEA 3MJFA 1MBJA 3CJQB 3TP0A 3CLQA 5DD4A 2R92J 2FMYA 4FHTA 4J9OA 2V79A 1P7JA 2E36A 4IRIA 1YRNA 3L2UA 1ZGAA 5LGNA 1ZRCA 3OSFA 3DWLE 5F08A 5DS9A 3OHBA 3CUQC 2KIUA 3LL7A 4FM9A 1R71A 3MKWB 2PBIA 1EF4A 5J8FA 1S0OA 1SYXB 3N44B 2XCPA 2CV1A 3KP6A 4Y3OA 4LG0A 4A3FG 4Z6YA 2HPIA 3S93A 1B6RA 4BHCA 1TWGA 2GPSA 2Y0SE 3GUDA 4UV9A 4KT5C 3PIPF 1LVAA 1ODDA 4RLQA 4EEYA 3I5UA 4X64H 2EA4A 5KFOA 2JA8J 4JYAH 2VLAA 3BJOA 3SHFA 3GZ5A 5EZGA 2VT2A 3L2RA 4ECQA 3OYDA 4F55A 3GFJA 1BJTA 3KIOA 1MDMA 3S1MJ 3BR5A 3CP2A 2LOOA 4HW0A 3RZDJ 1ZQ3P 5IYCG 5FO5A 1CF7A 4XICA 1KONA 2V26A 3H1CA 3S2HJ 1M1EB 1B9NA 3MFKA 4FASD 2EIKH 4MFDA 1DGRM 2XF6A 4BQOA 1FOXA 1WI3A 3MR2A 1IRZA 2OAZA 3CO6C 5IOYA 1FBUA 3WHCA 1FPQA 5FB2A 3ZQIA 3CCLI 3C0FB 1VAJA 5BPIA 1JKQC 4DR7H 5M5XJ 4NDLA 3CCYA 3BC8A 4WXDA 1WR2A 3T1HH 4Q4ZF 5KG3A 4ZH4F 1ETWA 1G8XA 5L1JA 4CA0A 2H8RA 1T2KA 2NS8A 2NNYA 1BJZA 2A61A 2V9PA 2E1MC 3HRMA 2YX7A 1AWCA 2I87A 4YBZB 3IN5A 2R5ZA 4DR1H 1FBQA 4JBAA 3GIMA 1VQ6I 4M6VA 4CYCA 1KQ8A 4LOCA 1V55H 2E19A 1F1ZA 3F0CA 3SZTA 1FIPA 4CCMA 5M5YJ 1RIOH 2VQFH 3FK7A 1M0WA 3H0DA 1Y1WA 1OYWA 5J8CA 4R7RA 3BWGA 3VWBA 4M74A 1USSA 1D0ZA 3BPXA 4DV3H 1BI1A 1V5EA 1QBJA 1ETYA 2WY8Q 3PW5A 4CC6A 2MG4A 4OU0A 5JFRA 3T5XA 2PJRB 2CV0A 2Z33A 4G6TB 2FJZA 3JRHA 4YHHH 3GTKA 5HDGA 3C18A 3FHNA 4ZHQF 4LB6B 3H0GA 2YZMA 2G7HA 3FDYA 4A3BJ 4ENJA 5ILUA 2DBBA 1SEUA 1FKAH 4QIWE 3ETHA 1YW7A 2K9LA 3RKQA 2JA2A 4XORA 3T5LA 5CLSA 1LJ9A 4KMUX 2UUCH 1Z2NX 4PZJA 3H3VK 2W6ZA 1JT0A 1P4AA 1WH7A 2ZFUA 4BE1A 4L0ZB 2DFHA 2KJBA 2F5FA 3BDDA 4XONA 4YIFA 4OAYA 3CQZA 5KG6A 2L2OA 2M8EA 5H2FC 2P7CB 4A3EG 4I09A 1T6SA 2BQ3A 1R36A 2XAJA 2EFQA 1MJBA 3VDXA 2CG4A 2RQPA 4X6AJ 2B63A 2M5WA 3HHGA 4IX7A 4F4ZA 2ZBKA 3GTGA 4D7NA 3ABMH 3QPLA 2FK1A 5CVUA 2VBYA 1KGSA 4BWSC 2XB0X 3ABKH 4JI6H 5JVGF 1AHDP 5BS6A 3S3MA 4R8UB 3HKZN 3E0JB 2C00A 1IXRC 2GIZA 3HXLA 1D0YA 5FLMG 1XNRH 3PR4A 4HNVA 2E1MB 1OLTA 2XRNA 2J5OA 3ULQB 4LF7H 3RTXA 1GVJA 2A6HF 3I64A 3K2AA 3HL2A 3DLLF 4Q48A 4E4TA 3FXQA 3LOCA 4A3MJ 1MH3A 5LEKA 2DK5A 2FBKA 3G1MA 3RYPA 2VKVA 3H4DA 5H20A 2QEXI 2DOEA 2A5WA 3OSNA 4ECZA 2E71A 2R7WA 4L5JA 3O6BB 4EGYA 4KYWA 3HOXG 3B73A 4U0WA 2IS2A 3KAKA 4A12A 3EETA 4XLPF 3CO7C 3ONQA 5DCMB 1RUOA 5FLXK 1S3JA 4M71A 3I0TA 4ZTJA 3OSPA 2M7BA 2JA5G 1R49A 4J19A 1WZ2A 3N05A 3FMSA 4HV6A 1FNNA 4WX9A 3N6XA 3KYDB 4F93B 1JKPC 2LVSA 5LHHA 4Y4RA 4J9MA 2HS5A 1U0JA 3NQOA 3MEXA 3LNQA 5LL6b 1W93A 2J5PA 5KVRA 2W6QA 2ASLA 4RU9A 3MFHA 1YG2A 2MSYA 2R8IA 4DR4H 2JSPA 2LY2A 1LEAA 4JOMA 1TWFJ 4GO1A 5GTHC 1VTNC 1GLVA 1H0MA 4FE4A 3CCUI 1JIHA 2JUCA 4PJJA 5EF6A 2NU7B 2QVOA 5IY5H 5E79C 2F4IA 4YIIA 2JA6G 2ZJTA 1XSVA 5KFUA 3TDZC 2O3FA 3JZIA 1XMXA 4G6QA 5KHDA 1WFXA 1UMQA 4AUXA 1MBGA 1SD6A 2JPBA 5HDNA 1XGOA 4IHVA 2CZGA 3F8CA 2E5NA 3QWLA 1MBKA 5IP9G 3D5SC 2LP0A 3E6CC 2RGRA 1B59A 1LB2A 5LLQA 1M7JA 3QU3A 2EA2A 4BUPA 4Y13A 3G3ZA 2NVYA 1IN5A 3C2GA 2QENA 3S14J 4F50A 3M9OB 4A0ZA 3RDIA 2YRWA 4A3IG 2BQUA 2IBDA 2FNPA 1OJLA 4LD5A 3M3YJ 3P7NA 1QZYA 3J81Z 3KYLA 2GLOA 5GAEJ 2KSWA 2VPLA 1MMNA 1J59A 3DBRB 5DV5A 1OISA 5M5WJ 3SYTA 1PUFA 3C1DA 4HX7A 2Y9ZA 5IP9J 2BY2A 1LFBA 2DDBA 1BIBA 3BCBA 5KFSA 1OWTA 3HRTA 5IYBJ 3S32A 1TWGJ 3JTGA 3E1SA 2STTA 1TWCJ 3DXJF 1F5TA 2K85A 3PL8A 2O9LA 5DEQA 2HGSA 3GTLJ 3V8KA 3OYEA 1QO0D 1UCRA 2M4KA 2XGXA 2QKMB 2XV4S 4LGWA 4Q8EA 4JX5A 5FGMA 2DT7B 1PDNC 1JTXA 4AWXB 4G94A 2VI6A 5KFWA 1Z05A 4P1WA 2HR3A 3LA3A 5TRDA 5CVVA 3M8FA 2K4BA 1YS7A 1KQ9A 1UHWA 3CMMA 1DDNA 4X0GA 4RZQA 1E3PA 3RPUD 1MNEA 2EZKA 1BI3A 3I9V2 3PFIA 1TNSA 2XGCA 3WE2A 3JRWA 4DYCA 2OD5A 1K4TA 4JX4A 2LF8A 1MD0A 1TTYA 1SD7A 4YFXF 1CQIB 4Q44A 2EV5A 4DUZH 3GIQA 2PI0A 3E97A 2W00A 2KP6A 2FJ1A 2WB1N 2YX4A 2G9WA 3JRIA 5DGBA 1S9HA 2G0EA 1JTYA 1WJEA 4B48A 2EFWA 2DZDA 4W97A 1XSDA 2L4MA 1LE8A 4YR2A 2K9SA 4M3DA 2JUGA 2YZGA 2FXAA 2VUMJ 4XL9A 3LSHA 1WSCA 4UCUA 5L3GA 2C6YA 1EUDB 1XDSA 3TINA 1ENHA 4HF0A 3JRFA 1Y1VJ 4Q43A 5CVRA 4E7HA 4Q5SF 1TT5B 4XQFA 2JA5A 4JI5H 2L3DA 3LMLA 3PNYA 4XR6A 1ZH5A 3DEUA 4XKWA 3MMYB 5EOYA 3W2VA 3CC4I 5KFBA 3OYCA 2XSJC 1S6LA 1VZ0A 2M3AA 2FNAA 2XC9A 5E3MA 3WGHA 1YFHA 1G3YA 1R6RA 4I4TF 2L9VA 2V9VA 5FLVA 3HEFA 1GSOA 3TOAA 2UUBH 3HOZG 2NU6B 4U0YA 4XK4A 2W6PA 1JX4A 4B3XA 5F27A 4FX0A 5KFIA 4U7BA 3HPHA 4D5FA 3H40A 2LLKA 3RIRA 4B43A 2K9QA 4KITB 2KRHA 3CF5F
chains in the Genus database with same CATH topology
1XDNA 4A2BA 1SD4A 3WG9A 4E70A 4S05A 2L4AA 3OV8A 5FLXW 2FU4A 2VQEH 4KUMA 4M9SA 2YR2A 4OIQF 2VOBA 1BIAA 3JSLA 2RV8A 4ZYDA 1XSXA 1K7AA 1SMYF 1ZHSA 3E3VA 5K5OA 4IJAA 4K0KH 1U3EM 1KYWA 2BV6A 2LDUA 2H94A 1OKRA 1Y0UA 2UUAH 1MZBA 2IPQX 5DUKA 3N42B 4HDVA 2BBYA 3NRVA 3TO6A 1CF7B 5BOXA 4M73A 3J7AO 2M87A 2D1VA 4LSAA 2QQAA 4IPAA 1YO5C 1E17A 2D2WA 4Q47A 4HF1A 1I1SA 4IAJA 2DLLA 4EFEA 2Z3YA 3JAMZ 1Z2PX 2ESHA 3BOQA 2Y48A 4P9UA 4X65H 4PGGA 1KU7A 1DGSA 3KEQA 2W85A 4A6DA 4EJOA 4I01A 4B3TH 4YFKF 2Z9OA 2STWA 1GXQA 2RVCA 2R7FA 2B0LA 3HSFA 2CFXA 2HOEA 2ISZA 4A5NA 1G3SA 3KZYA 3ECHA 4GYIA 3HYIA 1TQMA 1YLFA 4LF8H 2Y0MA 3ZQ7A 1XCBA 1MGTA 3ISPA 1STZA 2CW0F 3P9IA 1FOKA 5L3DA 4HBLA 3ROUA 3L9FA 4LMYA 4L18B 1IF1A 5HS8A 2JZYA 2AS5F 3TGNA 4YG2F 3K0LA 4MQVA 3QU6A 4Z2YA 4ESFA 3DPLC 1WSUA 1I27A 3BY6A 3RGZA 4ENMA 4PCQA 2CW7A 1OMIA 2NYXA 2IJLA 5FLXZ 1IBLH 3EYIA 5EEGA 3WTSC 1OYYA 3GZ6A 1ZG1A 1XMQH 2P5KA 2ZNZA 4OMZA 2XKOA 4EM0B 1IUYA 3JAMK 3HRUA 2UZKA 4AIKA 2FOKA 3F6VA 4EJVA 1R7JA 2LNBA 1BI0A 2YCHA 2HYFA 1R00A 4XLNF 1I6UA 1W4MA 3SXYA 4LF4H 4CC5A 2HWVA 4EJTA 4DV6H 4X62H 3DV8A 3CUOA 5IT9W 4BXUA 5D4RA 1I5ZA 1O75A 1S68A 1XN7A 3FMRA 4LF5H 4F7ZA 3ZMUA 5IWAH 2ETHA 4G7ZF 4L9VA 4LK1F 3F22A 1IXCA 5LEJA 2E1NA 3RTRA 4EJUA 3BA8A 3HOSA 3DP7A 3VOEA 4BQAA 3K3VA 4KA4A 4LLNA 1XGMA 4JI4H 1TQPA 3BA9A 2KIMA 5AIPA 3WTWC 1QGPA 1B6AA 3P9KA 3V8LA 2PMHA 3D5LA 1YYVA 4MTDA 4OIRF 2IA0A 4M7EA 3L4JA 2GWRA 2NAZA 1U8RA 4HQEA 2Q0OA 4M6XA 2JPCA 2KIFA 3R61A 3WTYC 1BGWA 3N43B 3KP7A 1G4DA 2MD5A 2V1XA 1E4FT 1R23A 4ZYEA 1B1BA 5HOOA 3BJAA 4NB5A 5DCMA 5JI6A 3N41B 2A6EF 2FMLA 2DFIA 4GGGA 4L9NA 4CO8A 4DUYH 4JI3H 5LRSA 1F4KA 5A2QZ 2KKOA 3GX4X 2XIGA 5L3FA 3DF7A 3MZYA 4EFBA 1FYMA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 5FPOA 2FF4A 1K78A 2VXZA 1X9NA 4NXNH 4LH6A 4EM2A 1D3YA 4I98B 1ZRFA 1XMOH 3GVAA 3FWEA 2VC0A 4KIFA 1ZARA 4N0BA 3K69A 3QP6A 3Q9SA 1BBYA 2GAUA 3TKYA 2OZ6A 1XCVA 2ZFWA 3WGIA 2RKHA 2XUBA 3KCCA 2HQRA 2K86A 4JI8H 2P6TA 1ZHFA 4BAYA 4BHPA 3FXUA 4MNUA 4KNYA 5JR3A 1O3RA 4HX8A 1KQ0A 2M1BA 2Q2TA 1JHFA 2HDCA 3KEOA 1RZ4A 3T1BA 1XD7A 4RB1A 4DV0H 1IZ1A 3R0AA 2CGPA 1ONVA 3DPTA 2A69F 3L4KA 4MEYF 5FPRA 4NHJA 1V9PA 2XAQA 1MJAA 1R58A 2HVQA 2E1CA 2ZMEB 2F5CA 5DUIA 4G7OF 3E6MA 4A2UA 4Y15A 4ENNA 1Z91A 3FM3A 1FY7A 4LK0F 2FQ3A 2HHHH 2H6CA 1E2XA 2BYVE 1FX7A 4TV7A 3BROA 5DDGA 3N4MA 4UVAA 3FHZA 3QP5A 4DV2H 4DR6H 2EJRA 1HQCA 1XMKA 3SZPA 2ZM6H 2A07F 3WU0A 2PFBA 2YU3A 3J81K 3RKXA 1ZAOA 1HW5A 4MV7A 2HYGD 2QQ9A 1R5GA 2ZMEA 1YIOA 2PN6A 3DKWA 4HLXA 4P96A 2OU2A 3GXOA 4HDUA 3MZHA 3RJ0A 2F5EA 1P8LA 4HZFA 5CYVA 3VODA 2P5LC 2MC3A 2W57A 4H0EA 3K1PA 1RUNA 3ZMSA 4IHSA 5D5UB 2JRTA 1OR7A 4ZZLA 3Q5FA 1L2ZA 3JSPA 1ZRDA 4CDGA 1Z9CA 1U2WA 3KE2A 4ESJA 3PQKA 3RJPA 4LB5A 4KHPH 2UXDH 4U88A 1CGPA 5LMNH 4CGZA 1KYZA 3U2RA 3R60A 4HLYA 2JSCA 2CW8A 1R5HA 3VFZA 3I59A 4MEXF 4LFCH 3J80Z 2GIVA 1TW2A 4A5MA 1QNTA 1HSTA 3H3UA 5D1PA 4D0PA 4L0YB 5DD8A 5DYMA 4UCTA 1Z6TA 3TOBA 2O8XA 5HVQC 3IRQA 1J5YA 1C0WA 3L09A 4P9FA 3GF2A 1TBXA 4LG0B 2WE6A 4XBFA 1IAWA 3KZZA 2F2EA 2ZO4A 4O3MA 4A6EA 2QBYB 1PP7U 3S2WA 1J9IA 2QWWA 4KIGA 4AQYH 4RGXA 2WYOA 4LSXA 3QOPA 5D5XB 1HKTA 1G6NA 4RB0A 5E8IA 1IBKH 1SAXA 3F21A 1J5EH 1FSHA 2L01A 3HUGA 1IXSB 3ERED 4MGRA 3FZVA 3RPQA 1ON2A 4IF4A 2XAHA 4OOIA 5ICFA 2XASA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 3G73A 4M6YA 1TA8A 5D8KB 2E7XA 3KP3A 3R0JA 3F3XA 4UHTA 3E6DA 2GQQA 5CJ9A 4JI1H 1AN7A 4UCVA 2ZXJA 4IRGA 2VE8A 3M7GA 2GZWA 2DI3A 1TAEA 2V6CA 2XAGA 3WTUC 3KXYT 5LBQA 2DQLA 4JQFA 5LHGA 5BQTA 4UCSA 1UFMA 4GKKH 3BAAA 1T38A 4EMSA 4YFNF 1H9TA 4ZZDA 3WTVC 3O2PE 1KA8A 4S04A 1BOAA 2VC1A 3U9GA 4QWQA 1H9GA 5E20A 1HNXH 2D45A 3LSTA 1FLIA 3KP4A 4Q0YA 5HLHA 5D6FA 1ZG5A 3KETA 4AVPA 4N9IA 2A3SA 1AOYA 4L9TA 5ILSA 4B09A 1EH7A 1T0FA 3ZPLA 1U6GA 4RAYA 3QAHA 3GLXA 1YQAA 1S7OA 4KMFA 3HIFA 3J7AK 2EFNA 3J81W 4GCVA 1JXSA 2FSWA 2VODA 1D8KA 1TLHB 3GW2A 1GYFA 4UXNA 1HBXG 1ZLJA 1HNWH 1S29A 1M0TA 2ELHA 4YY3H 4UUVA 1P4WA 5LMUH 3MWMA 2UWMA 1B9MA 4I0AA 4UV8A 3TDUC 5FD5A 1O57A 5FFZA 2QM3A 3GYHX 4CYDA 2VUGA 2DQRA 4A0YA 2KRFA 2EFOA 2E7WA 3BABA 3KP2A 3ABTA 1T39A 3N97A 2ZNYA 4JI2H 2Q8KA 5EEHA 4EM1A 2F5DA 3HHHA 3KFWX 1A0IA 3DQVC 1FBSA 4DV1H 1LNWA 1MDMB 2X0LA 4DV7H 5D5WB 1R1VA 1U78A 2VOPA 1QZZA 1YS6A 2MH9A 3CTAA 2VONA 2XVCA 2F4VH 5L3CA 3GO5A 4R1HA 2CWEA 3LWFA 1MKMA 2XHKA 3ZN0A 4WF2A 3F8BA 3Q9VA 4DQ2A 2O03A 3JW4A 2VT3A 2HVSA 1BM9A 4KICA 3LQRA 1ZG3A 3VB2A 5D6EA 4UVBA 4M72A 2FBIA 1SFEA 4RGRA 4DV5H 2HKOA 2NS0A 3IG0A 2D1HA 3HOTA 2HQNA 2MLGA 4ETSA 1S7AA 1B4AA 5H6RA 1W7PD 3ZN1A 2O61A 2FBHA 2Z99A 3M1EA 1IN4A 5D1OB 3TO9A 1LEBA 1S8NA 1U5TB 1FYLA 3V7CA 2MCTA 5IT9Z 3LQQA 4PDBA 1FP2A 3HTSB 3WTXC 5D5VB 1ZREA 3E6BA 1OYIA 4HQMA 5FD6A 4RAZA 3WU1B 5LGTA 3ZMTA 3EQLF 4G6DA 3T8TA 5ICCA 3E5QA 5CVJA 3F23A 2QQBA 1WRJA 1GHCA 4I02A 4HYEA 4CXFA 2RDPA 4G8XA 2DTRA 1Q1HA 5LGUA 3OOPA 4MHGA 3IL2A 3GEZA 2DPDA 4LH7A 2CSOA 3HTUA 1BN5A 2QUFA 1K6OA 3ZMZA 3R6SA 5A2QK 2P7VB 3KLOA 2KJCA 1N32H 2WTEA 4KFCA 4JV5H 2EFPA 2A5YB 3K1NA 3PQJA 3GFLA 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 2IW5A 4ON0A 3IC7A 4HF2A 3M9AA 2UXXA 2GXBA 3PN1A 2DK8A 4UNOA 3N40P 1K78B 2H09A 1O3TA 4AIHA 2ADUA 1KU3A 1DP7P 1FJGH 4XSZF 1D5VA 5F64A 2G7UA 1Z1DA 2OQGA 3BJ6A 1F9NA 3B02A 2RC4A 1LQ1A 1K79A 3DF8A 4OIOF 4DR2H 4LJZF 2TDXA 5ICGA 4B3SH 3I59B 2EK5A 2MA3A 3L2PA 1D8JA 2EV6A 2VE9A 3RKWA 1RNLA 2L54A 3F8MA 3ZMDA 4JI0H 3W6JB 2AXLA 3RI4A 3QRFF 2OWOA 4IRHA 1B04A 1R1TA 3I53A 1TNTA 4L9JA 5K1YA 3V4GA 2WDTA 4ENKA 4WK8F 4I2OA 4BYYA 1DUXC 2P4WA 4QLCU 3HRSA 1TW3A 3M8EA 1LDDA 2XAFA 3TQNA 2COMA 3M4IA 1ZYRF 4G7HF 3WODF 2MBFA 1V3FA 4EGZA 3CUQB 4P55A 5J6XA 3E5XA 2RGVA 1JGSA 1DPUA 1SFXA 3MAJA 3RYRA 1SEIA 2XROA 1Z6RA 1XNQH 3U1DA 3IKTA 2WC2A 4MV9A 5F6FA 2E5LH 5E1ZB 3F72A 5DCFA 2PQ8A 2RNJA 2CQKA 2HZTA 4I0BA 1W5TA 2FA5A 4KIBA 3RKYA 2P8TA 3KAJA 4LF9H 2EB7A 3FXRA 1G3WA 3FMQA 3JTHA 5K5RA 1XGNA 1KU9A 4EV0A 3E5UA 2EWNA 2M30A 2HVRA 1UHMA 3KALA 3LAJA 1FWZA 2M45A 2UXBH 4DV4H 3AAFA 1KU2A 4O5VA 3ML6A 2IRFG 1O7LA 4LFUA 1ZLKA 2K4JA 3IKVA 2YPRA 2IA2A 3QPHA 3ZMVA 5L3EA 5LHIA 1A04A 3UQ8A 3K9TA 3FM5A 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3TO7A 3V7SA 4PGHA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 1LDKB 1IW7F 1JE8A 1NHAA 4RB3C 1J7KA 2YSRA 1SMTA 5ERIA