3MWMA

Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
GRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative metal uptake regulation protein
total genus 42
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mwmA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3mwmA02
1HW1A 3K0LA 1W4MA 4KDPA 1GVJA 1IRFA 4L18B 3KEOA 1IW7F 2L4MA 1P4XA 3FXUA 4ENMA 3GVAA 4U88A 4NHJA 4WWCA 2OQRA 3WTZA 2FXAA 2K27A 4MQ9F 1FSHA 1Z05A 4MHGA 1I1GA 1S6LA 1BI3A 5D6EA 4L9VA 3M8FA 2W24A 2L02A 2XAJA 4YFKF 2VONA 4UV9A 2ISYA 4A6DA 2M45A 1QNTA 2DQRA 4A0ZA 3OOPA 1CGPA 3VOEA 1T38A 5CYVA 5HLIA 2OZ6A 5CVJA 3CUQB 2KIFA 4S04A 4QLCU 1TNSA 3V8JA 3U9GA 4XRFA 2K4BA 4HOBA 5AIPA 1ZGAA 1LB2A 4BHCA 3LWFA 1XSXA 3T8TA 2FQ3A 1G3WA 2MLGA 2XAGA 3K2ZA 3P7NA 4ESFA 2OQGA 4F7ZA 2DK8A 2PJPA 1FP1D 2VT3A 2FF4A 2F5FA 3C18A 1BOAA 3HSEA 3HUGA 2GZWA 5D4RA 5E1ZB 1KYZA 3Q9VA 2XIGA 3I64A 4CXFA 5L3CA 4P5OA 5DCMB 4CHUA 1I1SA 4EVIA 2F5DA 4MEYF 4IRHA 3HRTA 4EJWA 1XDUA 1KA8A 2Y48A 3HTSB 2AS5F 3WTUC 2IPQX 1ZRDA 4BH9A 4UVBA 2Q2EA 1XMAA 4PGHA 4XLPF 1L0OC 4UVCA 4YFNF 3KP4A 3KETA 2D45A 3KP7A 4OIOF 1BBYA 1HBXG 3WGIA 4KNYA 5E1WA 1FSEA 1TQMA 3ZMZA 2DI3A 3TDUC 4WX9A 3RI4A 1FYKA 3LA3A 2DK5A 2EWNA 5JHUA 2NNYA 2F5CA 3DXJF 1DPRA 3WE2A 4Y15A 3GO5A 1KQ8A 1KQ0A 2JPBA 2ZNZA 2ACJA 2EK5A 2X4HA 5E20A 2RDPA 1SD7A 5ICGA 4IF4A 1J75A 2M1BA 3REOA 4G7ZF 2R3SA 1SFXA 5E18F 3JTGA 3WGGA 1BIBA 3M1EA 2M30A 2O3FA 4E70A 3M9AA 4LLNA 2VN2A 1YTYA 2UZKA 1V3FA 2FOKA 4LFUA 5FLXK 4WF2A 3F21A 1XSDA 4O3MA 1R7JA 2GAUA 3B73A 1U8RA 5LGTA 2NAZA 5CVUA 2KKOA 4ENKA 2FE3A 1YFHA 1Z9CA 3V7RA 3EYIA 1ZG1A 2MLKA 4AIKA 4IHSA 2OBPA 2BGCA 2VBXA 1SAXA 3FHZA 1OPCA 4CZZA 3LQQA 1J5YA 4CICA 5FD5A 3EUHA 4P9UA 4TV7A 1SFEA 1ZH5A 5FD6A 2RNJA 2XASA 3DV8A 1FOKA 2TDXA 1QO0D 5ICFA 5DCMA 1BM9A 3ZN1A 1LQ1A 3VB2A 1DPUA 3WTVC 1R1VA 1DDNA 5FFZA 1G3TA 3QP6A 4HDUA 1R1TA 2ADUA 1LDDA 2R7DA 4MGRA 2CGPA 3J80Z 5HLGA 1WI9A 5JR3A 2FMLA 4BAYA 5BPDA 2KJCA 4NB5A 2W57A 2HTSA 3HRUA 4RB1A 2CWEA 2YSRA 3FXRA 1RI7A 3MQ0A 3P9KA 4EV0A 1FWZA 3RKYA 5HDNA 2FA5A 1KGSA 1UFMA 3O2PE 1S8NA 2YU3A 1H9GA 1XGMA 4I0AA 4ENJA 1FYLA 1I5ZA 4IXAA 2P8TA 3COAC 1SMYF 4UVAA 1YIOA 3SZTA 1K79A 2VBZA 5E8IA 2GA1A 2XAFA 3RKXA 3NEUA 3RJPA 3RKWA 2RVCA 3TO7A 1B1BA 2XKPA 2ZBKA 5J6XA 2VOOA 4HYEA 2DQLA 3CUOA 4LGWA 4N0BA 4HW0A 5LHIA 4I7HA 4M74A 1XN7A 1IXSB 3K1PA 1BI1A 1R22A 2XGXA 1LDJA 4U7DA 5EEHA 3TKYA 1JXSA 4QWQA 5L3BA 2PG4A 4S05A 5J8CA 2FRHA 2OD5A 3T0YA 3HSRA 2COMA 4R1HA 2W85A 3GW2A 2PBIA 2ZCWA 1E2XA 1P2FA 2CW0F 5LHGA 4Z2YA 3G3ZA 3EETA 3BOQA 5CJ9A 1QZYA 4XSXF 2ESNA 2NYXA 3GWZA 2V9VA 3N4MA 3GLXA 4A5NA 2FBIA 4ZYHA 2C6YA 5D8LB 1KU3A 2DAOA 1W5TA 1R5GA 5LBQA 4B8XA 4LD5A 2IA0A 5D5UB 3QPHA 4M6XA 5F6FA 2HZTA 4I0BA 2DFIA 3LSTA 1UHWA 4EM2A 3I59B 3HYIA 3WTWC 3ISPA 3R60A 3MAJA 2GIVA 1ZLJA 2LDUA 3HOTA 2JPCA 4HQEA 3BPXA 2K02A 3GF2A 1EH8A 3IRQA 1W7PD 2HFHA 1ON2A 4AIHA 1MJBA 3KZZA 4IRIA 2DW4A 2O03A 1FY7A 2EV5A 1YQAA 4HDVA 3BZ6A 2RKHA 5ILSA 3J81K 1GXQA 5D5VB 2MH9A 4G7OF 4KICA 4YIIA 4HQMA 2HEOA 1IXCA 1XGNA 2XVCA 1PUEE 4M73A 4ETSA 1BC7C 4OMZA 4KIGA 1U6GA 4BQAA 4A0YA 1D3YA 4MNUA 1LJ9A 2FSWA 5D5WB 4P96A 2QLZA 1O3TA 4KMUX 5BQTA 1T98A 1Z7UA 1E17A 3E5XA 4LG0A 4R79A 3F3XA 1QBJA 3SQNA 4G94A 4EJOA 3WU1B 4LMYA 2JRTA 4WXCA 1CF7B 4BXUA 3LA2A 4RAZA 1Z6RA 1O3RA 3FM3A 5HS9A 1S7OA 2O61A 2XRNA 1XD7A 3KFWX 3LAPA 1I6XA 4EM0B 1RUOA 4PZJA 1PP8F 2VXZA 3U2RA 2EA4A 2EFWA 3L00A 5BPIA 5CVIA 1HW5A 3U1DA 3F8BA 2VC0A 1KYWA 5HDGA 3DP7A 3F6OA 4P9FA 3HRSA 1ZRCA 4BHBA 4N9IA 1OR7A 4M71A 3WTYC 1SMTA 3BY6A 1QPMA 3F23A 5LEJA 1FBSA 3G73A 3W6KB 1ZRFA 4M6YA 4OIPF 2D1VA 4KA4A 4UXNA 2NNNA 2PMUA 4I02A 4L5IA 1XMKA 2JTVA 2HWVA 5JI6A 2CFXA 1Q1HA 2HS5A 5H6QA 2EFOA 5CVRA 1T2KA 3I59A 1XGSA 1U5TC 4KFCA 3KLNA 1J59A 2IW5A 4GO1A 3H3ZA 4RAYA 1IN8A 4MEXF 1R23A 1BI0A 3ZMTA 4HX4A 4LK0F 1U78A 2CG4A 1B6AA 1ZN2A 4XSZF 2J5OA 1VTNC 5E17F 1I27A 4ENNA 2P5VA 2BYVE 3T8RA 2D1HA 2H27A 1XCVA 2O6GE 1TTYA 4LJZF 2YX7A 4BYYA 3GYHX 1IN5A 1TBXA 2UXNA 1RUNA 4PDKA 1FPQA 3D0SA 3HTUA 2G9WA 1ZYRF 2CQKA 1T6SA 2PN6A 1FBQA 3CDHA 4LG0B 4IJAA 1FYMA 2HGCA 1CF7A 4ASNA 2WWYA 2GXBA 2MBFA 1ZREA 1P4AA 1IRGA 2A3SA 1A04A 5DDGA 2W25A 4U0YA 1SFUA 3WG9A 2ISZA 4RGXA 4BNCA 3IKTA 4G7HF 5H20A 4UUVA 2V79A 4N9HA 4HX7A 2LF7A 2WTEA 1FX7A 1TNTA 3E6CC 2LF8A 3Q9SA 5KK1A 4G9YA 1FP2A 4FHTA 4EM1A 3I4PA 3WU0A 1MD0A 2V1XA 3R6SA 4KYWA 2ZKZA 1SD6A 3LAJA 3E5QA 3TO9A 2NRAC 2LSOA 1Z1DA 5IT9K 4U0WA 4ESJA 5D5XB 3CO6C 4YG2F 3BP8A 1KU9A 2H6CA 5FLXZ 3T5XA 1KU2A 3TGNA 2IP2A 1HSJA 2ZO4A 2FNAA 2UWMA 2QQ9A 3BDDA 1TQIA 1KQ9A 2JT1A 5HS8A 4M72A 2EV0A 1HW2A 2F5EA 1O7FA 2E7XA 1T39A 2O8XA 5JFRA 2JZYA 1YW8A 2Z5UA 3V8LA 1EH7A 1XGOA 2DU9A 1D5VA 4Q5SF 4U7BA 4HZFA 4AIJA 1S29A 2W84A 1IF1A 2IJLA 3EQLF 5D4SA 2P6TA 3ZMSA 3GFJA 4D0PA 2Y0MA 4A6EA 1K78B 1ZG3A 4L9JA 3V4GA 3GFMA 5BMZA 3E5UA 1H0MA 2G7UA 4I09A 4Q48A 5JVTA 2STTA 5ILUA 1LNWA 1R58A 3CUQC 4DNCA 3WTXC 4HX8A 5EEGA 5K5QA 3KE2A 1YW9A 1STZA 2QENA 3J7AO 3OV8A 2H6BA 3RTRA 1RZ4A 3QAHA 5DCFA 3BWGA 4IPAA 2Q8KA 1B9NA 2EB7A 1G4DA 3E6BA 1Y0UA 2P6SA 2YX4A 4YFXF 3F8MA 4ZYDA 3TOBA 4EJUA 2PI0A 5L3FA 1YS7A 1HQCA 2XUBA 5TJJA 3KZYA 1IUYA 3I53A 4G6DA 1MDMA 5FFXA 1J2XA 4FX0A 1ZARA 3BROA 2VT2A 3QOPA 4KMFA 1MGTA 2YPRA 5BS6A 4ZH4F 2L3DA 3QRFF 4HV5A 2VODA 4MTDA 2DBBA 1AWCA 3RDIA 1JHHA 4DQ2A 3T1BA 2NS0A 3KLOA 4WK8F 2HQRA 3FMSA 3MCZA 1O3QA 4CO8A 2A61A 1ULYA 3GUDA 4HV6A 3CO7C 1WKMA 1HKQA 3L7WA 2HR3A 2UXXA 4BHPA 3C1DA 3H3UA 1G3YA 5LGUA 3GFLA 1UCRA 1L3LA 1B4AA 2IA2A 1WWXA 4L9TA 3FXQA 1ON1A 1F9NA 2P7CB 5DEQA 1O7LA 1X3UA 1ZAOA 2Z33A 2DPUA 3GZ5A 4KN4X 2CSOA 1K78A 5FGMA 3FMRA 1HKSA 4HLXA 2A6EF 5L3GA 1P6RA 1LEBA 4IHTA 5L3EA 1YS6A 1OYIA 3RIRA 1WQ2A 3EDPA 4HF0A 3IWFA 5ICCA 3TO6A 4LB5A 4HF2A 4I01A 1USSA 1Z91A 3R61A 5D8KB 5E8GA 3S2WA 2DPDA 2VBWA 2V1UA 1R1UA 2QVOA 2QQBA 4XLNF 1W5SA 1P92A 1WRJA 3NQOA 2ETHA 4GYGA 4OIQF 2P5KA 3ZMDA 5A2QZ 3KP3A 5DV5A 3ABUA 1KU7A 4ESBA 5L3DA 3HHHA 1GHCA 2HYGD 5HLHA 5TRDA 3EYYA 2Z3YA 2ZNYA 1MDMB 4AVPA 5HDKA 5DUKA 3L2CA 2HKOA 2XHKA 1U5TA 2XAQA 4GGGA 2BEOA 5CLSA 4AD9A 3SXYA 3B02A 4L9NA 2PQ8A 4PCQA 3JTHA 4EGZA 2F2EA 3CJNA 1ODDA 3ROUA 4RB3C 3LFKA 1FBUA 3LQRA 1EH6A 2PFBA 3O6BB 4NQWA 2MD5A 1JHFA 3FWEA 3ZMVA 3VFZA 5IT9Z 4UHTA 3V8KA 2A5YB 3R0JA 2J5PA 3E6MA 2LKPA 3I0TA 3RYRA 2RQPA 3ECOA 3VEPA 2FMYA 1REPC 3PFIA 1YYVA 3DFGA 1J9IA 2QM3A 4LLGF 4KUMA 1UHMA 3L09A 1LDKB 4WXHA 4HAMA 3RPQA 2BBYA 1K7AA 3MZYA 5ILVA 3DEUA 2EFPA 2K86A 3CLOA 5HOOA 2QQAA 3KCCA 4OIRF 4IVNA 2EFNA 1TW3A 3IHUA 2V6CA 5LGNA 4RB0A 4RGSA 5H6RA 3BJAA 1QZZA 2GWRA 2KIMA 1FZPB 5E1XA 5A2QK 2GA2A 2P5LC 2QBYB 1Z6TA 3IC7A 2RC4A 2IRFG 3TQNA 3N97A 1XDSA 1RNLA 3NRVA 1YW7A 3O3KA 2QYOA 1O57A 1R5HA 2E7WA 2GXGA 4RS8A 2O0YA 2A68F 1BI2A 2MH2A 4G8XA 4Q47A 2KIUA 3L9FA 4L5JA 3FX3A 2A69F 2JSCA 5D6FA 3ZP5A 4LLLA 1U5TB 4UNOA 3BJOA 4Y13A 2Q0OA 4G6QA 4PGGA 2P7VB 1OKRA 4RB2C 3QU3A 2ZMEA 1W7PB 1ZLKA 1D8JA 1RIOH 3F72A 5DD8A 1IN7A 2FBKA 3IL2A 1IN6A 3I71A 2P4WA 3RYPA 3FZVA 5DD4A 2ESHA 4HF1A 1OYYA 2BV6A 3FM5A 4CDGA 2GQQA 3DPLC 4U0VA 3ULQB 2EA2A 1DUXC 1JGSA 1IN4A 3GEZA 4JQFA 1LVAA 3M8EA 4GYIA 3ERED 3JSPA 4ZYEA 2G7HA 2QWWA 4FT8A 1FLIA 3BJ6A 5BOXA 2QZ8A 3D5LA 4GXOA 4A12A 4A0XA 3I5UA 5LRSA 1EV7A 3F8NA 3PQKA 1TW2A 4OU0A 1TQPA 3F22A 2Y75A 3BPVA 2IT0A 4RGUA 1PP7U 1OMIA 2VE9A 3E97A 2HYFA 1IXRC 2FEZA 1R00A 2HTJA 2QBYA 3DF8A 2L54A 2KRFA 2EFQA 5K5OA 1MJAA 1MZBA 2PEXA 4MTEA 1O3SA 5HS7A 5F64A 1J0RA 3J80K 1S7AA 1H9TA 3ZN0A 5F1RA 3JW4A 5FB2A 4M9SA 3JAMZ 1ONVA 3ABTA 2RN7A 1FT9A 3V7CA 3DQVC 4HA8A 2L4AA 4ZYGA 3K1MA 4M9ZA 3KEQA 2OA4A 4IRGA 3I54A 4I2OA 2ZMEB 1W7PA 4ON0A 3K69A 4AWXB 2E1NA 3JSOA 4EMSA 1SD4A 4B09A 2DLLA 3E3VA 4ZZLA 1G3SA 1YG2A 2M8EA 2E1CA 1T0FA 2MA3A 2M5WA 5FO5A 3P9IA 3ELKA 3F8FA 5K1YA 2Z9OA 3WTTC 2XAHA 2V1DA 2DTRA 3HIFA 2VBYA 4M9XA 1J7KA 2XKOA 4XBFA 2DO7A 3DKWA 3WE3A 2X0LA 4RGRA 1HKTA 2ELHA 4OOIA 3J81Z 2WC2A 3R4KA 2XROA 1IZ1A 4A5MA 3HOSA 3RPUA 3SHFA 4R8HA 3SFZA 4A2UA 1YLFA 5AIQA 6PAXA 1FNNA 4EJTA 3HSFA 4JBAA 4KIBA 1JE8A 3MFKA 2ZXJA 3KP6A 4WXDA 3V7SA 3TOAA 1U3EM 1GXPA 1F4KA 5ICEA 2VC1A 3K9TA 4KIFA 2KJBA 2DT5A 1WSUA 4LK1F 5KVRA 5LEKA 4OINF 3ML6A 4UV8A 2HQNA 1C0WA 4GCVA 3MEXA 4O6JA 5HVQC 3MWMA 2FU4A 2PLYA 5K5RA 5J8FA 1UB9A 2VE8A 3F6VA 1NHAA 2VOPA 5LLQA 1BC8C 5ERIA 2AXLA 3M7GA 4WCGA 2ZJ2A 3C3WA 3KP5A 2BE5F 4CGZA 3E6DA 5IT3A 1S3JA 2R7FA 1R36A 3QPTA 2A6HF 1XSVA 3DPTA 2STWA 1PDNC 1HSTA 3K1NA 3MZHA 3FF5A 2WV0A 4EQQA 3ZQ7A 3WODF 2PMHA 1G6NA 3CTAA 2CO5A 3ZMUA 3VODA 1BJAA 2L01A 1TLHB 4JK1X 2EV6A 4Q4ZF 1F1ZA 4MQVA 1B9MA 2IVMA 3GX4X 1B59A 5CVVA 3H92A 5LHHA 1V4RA 4HLYA 5ED4A 2RV8A 3C7JA 3LA7A 3Q5FA 1QQIA 2OZUA 1AOYA 2HKXA 1BN5A 2IA1A 4L0ZB 4LB6B 3FMQA 1ZG5A 3PQJA 2K4JA 3HRMA 4OMYA 5DYMA 3W6JB 3SZPA 2D2WA 3QP5A 2A07F 1QGPA 3GFIA 3I58A 3CUQA 2YR2A 1HXDA 2RGVA 4EGYA 3GZ6A 3WTSC 2HDCA 3HHGA 3R0AA 1XCBA 1IAWA 3JAMK 2FNPA 2CYYA 3ECHA 4O5VA 3GXOA 2M87A 4Y17A 1D8KA 4HBLA 1DP7P 2QUFA 3AAFA 3ZPLA 1USTA 4ZZDA 4K2EA 1U2WA 1OYWA 2OAZA 2OU2A 4I98B 2XV4S 3QU6A 4CYDA 3P9CA 5AONA 3IWZA 3WGHA 1ZHFA 2B0LA 2MC3A 1K6OA 1MKMA 4EJVA 2FBHA 1FC3A 1F5TA 2H09A 1P4WA 2Z99A 4KN7X 4H0EA 2LNBA 1LEAA 2H94A 4P55A 4L0YB 2HOEA 2K7LA 1MJ9A 5LRRA 1YO5C 1XB4A 1ZGJA 3F8CA 3KP2A 3IKVA 3IRRA 3TDZC 2EJRA 4KT5C 5DUIA 1SD5A 2ZFWA 4YIFA 1BIAA 4FX4A
chains in the Genus database with same CATH superfamily
1HW1A 1ETOA 3K0LA 1W4MA 5JVLA 3G1LA 2F4VH 1ETWA 2KLOA 4KDPA 1GVJA 2L7ZA 2LYCA 1RYSA 1IRFA 1Y0NA 4L18B 2W82A 3CD6I 3KEOA 1IW7F 2L4MA 1VF9A 1P4XA 3FXUA 2ME6A 1T8IA 4ENMA 4A3LG 2R7ZG 3GVAA 3G4SI 2EZIA 4A3IJ 3OL4A 4U88A 4WWCA 4NHJA 2OQRA 2IMWP 3WTZA 1ETXA 2FXAA 3KALA 2JEGA 2UXCH 2R8IA 2WAEA 5HBRB 2FJ1A 2K27A 4MQ9F 1WJ5A 1FSHA 1JGGA 1Z05A 3OYKA 4MHGA 1I1GA 3K7AJ 3QYEA 3FISA 4M3FA 3HM5A 2XD4A 1MBGA 1S6LA 1WCMG 1BI3A 1X1AA 1Z77A 2JWTA 2CJJA 1MMAA 4L9VA 5D6EA 3M8FA 4U7CA 5EJCA 1A5JA 5IY5H 4LFCH 3K10A 3QZ7A 3J7YJ 3L2UA 3EPZA 2CQQA 2W24A 1SC7A 2L02A 4Y8VB 2XAJA 3I4NJ 5C4XJ 1WJBA 4YFKF 2VONA 2VKEA 4AU7A 4UV9A 2ISYA 3AG1H 3CCUI 4A6DA 3BR1A 1LFBA 1SEIA 4IHYA 2M45A 2NVTJ 2B63G 1QNTA 2DQRA 3T5JA 4A0ZA 2M0MA 1D0ZA 3OOPA 3I3LA 2GPWA 4LF4H 1EKEA 1ZTRA 1CGPA 1JXLA 3VOEA 1WJDA 4XLFA 2VUMA 2HQAA 3FXOA 1T38A 4RLQA 3H20A 1B6RA 2I87A 5CYVA 5HLIA 1LPQA 2OZ6A 4XOPA 3Q8PB 1M6VA 2ASJA 4O3QA 5CVJA 2W9BB 1RKWA 2AQ4A 1ETKA 2W9AA 1SEUA 3PIOF 3CUQB 3IAM2 5KX5F 2KIFA 4S0HB 1HNWH 2E34A 4S04A 4QLCU 1TNSA 3V8JA 2JA6G 1FIAA 1MBJA 1ZR2A 3Q8QB 3U9GA 4XRFA 2VR1A 4B3TH 2K4BA 3FKIA 2X1DA 4HOBA 5AIPA 1ZGAA 2HDWA 3HB9A 2X0SA 1LB2A 3A2KA 1GSOA 5GTHC 2VOBA 4BXFA 4BBRG 5IP7G 3DLAA 3BTJA 1P9QC 4PJLA 2ZJRF 2R8HA 3FDYA 3QYBA 2R7MA 4I76A 4BHCA 3GTGJ 3LWFA 1XSXA 2K9MA 3T8TA 1VQ6I 5DQHA 5JLXA 2FQ3A 1G3WA 2MLGA 2NU8B 2XAGA 3K2ZA 5D8DA 1M1EB 1NG7A 3P7NA 2M3AA 2OQGA 4ESFA 4F7ZA 2LY1A 2DK8A 1Z67A 1FP1D 2PJPA 2VT3A 1ETYA 2FF4A 4XM3A 1MW7A 2F5FA 3C18A 2HXOA 1BOAA 3K5HA 2MC4A 4BUPA 3CC2I 4YJ3F 3HSEA 2LK2A 4JOMA 3HUGA 2GZWA 5D4RA 5EDNA 4IOAF 1WJAA 5E1ZB 1KYZA 2WBMA 1DV2A 4C3HJ 3Q9VA 2VQLA 2XIGA 3EUAA 4Y3OA 2ZJTA 3I64A 4CXFA 4CCOA 2R7VA 5L3CA 3KYLA 4P5OA 2E2IA 5IYDG 2JEFA 5DCMB 5KFGA 4DBQA 4FBTA 4CHUA 3CCEI 3N40P 2R92J 2EBIA 1K6YA 1T95A 5KG1A 3CMAI 1I1SA 5BPFA 1KZHA 4DL6A 4EVIA 1YJNI 2F5DA 4MEYF 1QZEA 3HRTA 4IRHA 3SEQA 4EJWA 1G8XA 5F0HA 1OCZH 2NVXA 1XDUA 3KPHA 1K4SA 1WFXA 1W1WE 2EZKA 1KA8A 2LC2A 4I55F 4RUAA 4GC6A 4A3IG 2WTFA 2Y48A 3HTSB 2QYZA 2AS5F 1B72B 3HKZE 3WTUC 2AO9A 2Y9ZA 2IPQX 2VPLA 3IN5A 1XMQH 3OWTA 4BH9A 1ZRDA 1ULZA 1MIJA 3K3VA 4UVBA 2Q2EA 3CF2A 3CCVI 1YRNA 1XMAA 4PGHA 5KFIA 3CP2A 3JRBA 3EPGA 4XLPF 1WJCA 4BDZA 3NWSA 3GBGA 1L0OC 4D5CA 1GDTA 4DL4A 2F4OB 2AQFA 3FK7A 4UVCA 3KP4A 4YFNF 3KETA 3S1MJ 1UNNC 2M05A 4HYKA 3N8DA 2D45A 2YL2A 2DJIA 3KP7A 4OIOF 3JSLA 3VPBA 4MV7A 2HDDA 1BBYA 1HBXG 5KFSA 3WGIA 4KNYA 1N48A 5E1WA 1FSEA 4MAMA 5FJ8G 1TQMA 3ZMZA 5DGAA 2DI3A 3TDUC 2CFOA 4WX9A 3N6XA 3HPHA 1QVTA 4NC8A 4XMYA 2HQ5A 2NU7B 3RI4A 1FYKA 3LA3A 3CP8A 2IGMA 4CC6A 5EOYA 2DK5A 1D0YA 2EWNA 5JHUA 2NNYA 3DTEA 1IBMH 1XMOH 2FX0A 2F5CA 3V6HA 3DXJF 3NARA 2FKLA 1DPRA 1T56A 1SCUB 3WE2A 4Y15A 5M3MJ 2WA0A 3UQ8A 1XNQH 2E2IJ 2HYJA 3GO5A 1KQ8A 5IYBJ 1KQ0A 4FCYA 2KFDA 3DU6A 2V4RA 1OLTA 3MWDA 2CV1A 1I50A 4ZHQF 3T1YH 2JPBA 2E60A 2ZNZA 2ACJA 5DG8A 1CE8A 3CVZA 5EEAA 2EK5A 2X4HA 2FUG2 5E20A 2J6UA 3DEEA 2RDPA 1WR2A 3GTKJ 3SE7A 1SD7A 2DTZA 4XIDA 5ICGA 1Z0XA 4IF4A 1J75A 2XSJC 5HLTA 1L2ZA 2M1BA 3CCQI 4B3MH 2KDZA 3REOA 4JI5H 2NS7A 3E1SA 5J1RA 4G7ZF 1XS9A 2R3SA 4FE4A 1SFXA 5E18F 3WGGA 3JTGA 1IGNA 4Q0YA 1BIBA 3PO3J 3M1EA 2M30A 1DGWY 2XRLA 3ZQGA 3MJFA 2FPPB 2O3FA 3IP4B 1RJQA 2YRXA 1I50J 4DZJA 4E70A 3ABMH 3M9AA 3L1PA 1FOYA 3AL0B 2V4QA 4LLNA 4K0KH 2VN2A 1YTYA 2M4GA 2UZKA 5KKNB 1V3FA 1I3QJ 2FOKA 4LFUA 4WF2A 4BE2A 5FLXK 3F21A 1XSDA 4JX4A 2OTLI 4O3MA 2GOMA 3B6AA 1R7JA 2GAUA 2LH9A 1OISA 3B73A 2V59A 3OYIA 1U8RA 1TWGJ 5LGTA 2VUMG 2NAZA 3OUUA 5H2FC 5CVUA 1YE9A 2KKOA 4TUYF 4ENKA 1XTAA 2FE3A 1YFHA 4M3BA 1Z9CA 2RDJA 2UUZA 5JVDF 3V7RA 2YRWA 3EYIA 4IHJF 5IYZF 1QRYA 1ZG1A 1I7NA 4KJZA 2MLKA 4D7NA 4AIKA 4IHSA 4F52A 2HJWA 2OBPA 1ZR4A 3VMMA 2BGCA 2VBXA 1SAXA 3FHZA 2DMTA 2X48A 3Q0VA 1OPCA 4Y7NJ 1BGWA 5EG0B 5KG0A 4DV7H 4DYRA 4EBEA 4CZZA 3LQQA 1J5YA 3U9TA 4CICA 5F08A 5FD5A 2BXYA 3EUHA 5EWGA 2KP6A 2ZXIA 4P9UA 2DOFA 4C30A 2NVUB 3VPDA 4QIWN 1P8LA 4TV7A 1SFEA 4O3NA 1ZH5A 1TT0A 5FD6A 3TMOA 5J3LA 3CZ6A 1PUFB 4XZ3B 1QHHD 3GCMA 3H9GA 1OCPA 1JI8A 1PYVA 3JRWA 3JRXA 2RNJA 1UJ8A 4IZOA 2XASA 1VQPI 4B3RH 3DV8A 3OYBA 1FOKA 1RR7A 4AYBA 2TDXA 1QO0D 5ICFA 1E3OC 4BY7J 5IYCG 5DCMA 1BM9A 4A3KG 4A3FJ 3ZN1A 1LQ1A 4NXNH 3VB2A 1DPUA 4ABZA 1IDZA 3H4DA 3WTVC 3RPUD 3PNTA 5LXTF 1R1VA 1DDNA 2JQ7A 4O4IF 4N4NB 2DA1A 4PFPA 3OTOH 2JUGA 5FFZA 4A2AA 1G3TA 3P5JA 1S9HA 3BR0A 3QP6A 4HDUA 5C44G 3J7AK 3ABKH 1D0XA 1R1TA 5IYBG 3G2BA 1B72A 2ADUA 3RGZA 5FLXW 4DV1H 4LFAH 1LDDA 3KEYA 2R7DA 4MGRA 1JT0A 3CJTB 2COBA 2CGPA 3OYDA 3J80Z 2BOLA 3VYSB 2DXIA 1NH3A 4CCMA 2E1OA 2BY3A 3HC7A 2KMUA 5HLGA 2VJ5A 3DEWA 1DGRM 4GDFA 1WI9A 2X1CA 3GTMJ 3MFHA 3L2PA 5JR3A 2FMLA 4BAYA 3M9NB 1RPWA 2R92A 5BPDA 2KJCA 2V26A 3RV4A 2E2HA 4HNTA 4NB5A 1R4NB 3PUFA 3QWLA 2VQEH 2ALZA 2W57A 2IEKA 3DBHB 1BR2A 4OAZA 3HRUA 2HTSA 2V7FA 4RB1A 2CWEA 2YSRA 5B1BH 3FXRA 1RI7A 3JRGA 3MQ0A 3P9KA 4EV0A 1FWZA 3RKYA 1NK2P 4M9UA 3KIOA 5HDNA 1D1CA 1R9TA 1HDDC 3T5HA 5C1PA 3PSFA 2FA5A 2PJRB 3BR6A 3MD2A 1R4MB 1KGSA 1ZQ7A 1UFMA 3O2PE 1V5FA 3MR2A 1TZLA 3TW6A 5KG5A 1S8NA 1W93A 3JAMW 3RCOA 2QEXI 3OY9A 2WAQN 2ASLA 4J01A 2YU3A 1ERDA 1H9GA 1XGMA 2ZDQA 3Q2OA 4I0AA 3QQAA 2JA7G 4ENJA 1FYLA 5KFRA 5B5EC 1S72I 3CF5F 3C0FB 3S1RJ 3W3CA 1I5ZA 4IXAA 1X19A 2W8LA 2P8TA 3COAC 1SMYF 1UC8A 2HVRA 4IQ4A 4UVAA 1YIOA 2E35A 3SZTA 4EATA 1K79A 2AU0A 5CPRB 3L2QA 2VBZA 5E8IA 2GA1A 3CC4I 2XAFA 2ME0A 2AGOA 3H4BA 3PW0A 3RKXA 1BXRA 3NEUA 3IG0A 2XC7A 1X2MA 4QTRA 2VQFH 3RJPA 1W36C 4LF7H 3RKWA 2RVCA 3TO7A 4XLAA 2X9DA 1B1BA 2XKPA 2ZBKA 5J6XA 4GRIA 2VOOA 4HYEA 4C3JJ 2DQLA 3BC8A 2JN6A 3ASNH 2X6XA 2IBDA 2F48A 3CUOA 4LGWA 4J9OA 2VKHA 2OCCH 4N0BA 4HW0A 2O8KA 2XF7A 2CQNA 5LHIA 4I7HA 3DTIA 4PJJA 4QPOA 4M74A 3ZCOA 1XN7A 5BNGA 4D5FA 1IXSB 3K1PA 3W2VA 4Q8EA 1VQNI 1BI1A 1BR4A 5KFOA 1R22A 2XGXA 1H8AC 4XQFA 3HOZG 1JKQC 1LDJA 3W2WA 5EEHA 1Q1VA 3ZQIA 3TKYA 4U7DA 2PVPA 2C00A 1UAAA 4F55A 4MLOA 2MYSA 4ANJA 1JXSA 1S97A 1J5EH 5KAFC 4QWQA 2VJIA 4JV2A 2EPFA 5L3BA 4I4TF 2PG4A 2CS3A 5FKOA 3J81W 4S05A 3JRDA 3OIPA 1FOWA 4W1UA 1VQ5I 3ESWB 5J8CA 2R8KA 2FRHA 3Q8RB 2RF4A 3QZ8A 2OD5A 4DV3H 3T0YA 5F9NA 3HSRA 4IRCA 5EG0A 2COMA 3LSJA 1HNXH 3SJMA 2K9LA 1M7JA 4R1HA 2C2RA 2W85A 3GW2A 2DA3A 1UG2A 4R7RA 4M3EA 1A0IA 2PBIA 2ZCWA 5K7ZA 1E0EA 1KJIA 4DUZH 4FM9A 3DBLB 1A9XA 3Q8SB 1E2XA 3A03A 1P2FA 2CW0F 1I94H 1PUFA 5LHGA 2VQDA 4Z2YA 3G3ZA 3EETA 3BOQA 5CJ9A 2VXDA 1K1QA 3V6KA 1QZYA 2VQHA 2ESNA 4XSXF 4Q45A 2OV7A 2NYXA 1Y6IA 3GWZA 5DLFA 2V9VA 3N4MA 2W6MA 3GLXA 4A5NA 2FBIA 4ZYHA 5DQGA 1NK3P 2C6YA 5C4JJ 5D8LB 3BJYA 1KU3A 2DAOA 1Y56A 1W5TA 1G2HA 1OCRH 1R5GA 5LBQA 5C3EJ 3E7LA 3G6EI 5EDWA 4B8XA 4LD5A 2IA0A 4XN0A 3I55I 5D5UB 3OSFA 5KFMA 1WJEA 3QPHA 1X58A 4M6XA 2HZTA 5F6FA 1E3PA 4I0BA 1SVLA 1DQUA 5J1UA 5EWEA 2DFIA 3LSTA 3BR2A 4BJTA 1HC8A 4JUZA 1UHWA 2IXSA 2KRCA 5J40A 4EM2A 3LWBA 5IP7J 3GLLA 3I59B 3L4KA 3HYIA 3RB6A 1RRJA 1WJFA 4JP0A 2NXNB 1MNDA 3WTWC 1W5CC 3ISPA 1JKOC 3R60A 3MAJA 2NVYJ 3GQCA 1ZLJA 2GIVA 2LDUA 4G12A 3GTOA 3HOTA 2JPCA 4HQEA 3BPXA 1N25A 1VS0A 2K02A 5M3FJ 5L1IA 3GF2A 1EH8A 3IRQA 1AUXA 2FLLA 1W7PD 2HFHA 4XLCA 1ON2A 3BR5A 5CQGA 4AIHA 1MJBA 1U8BA 3KZZA 1LUJB 3OYFA 4A3EJ 1AA7A 4IWYA 2X51A 3IH2A 1MMDA 4IRIA 3PO3G 2DW4A 2O03A 4LG3A 1FY7A 2R7XA 4GC7A 2EV5A 3OYHA 1YQAA 2Q2UA 4HDVA 1B04A 4ZDPA 4A69C 4U6PA 2PJRA 3TL4X 3PR5B 3BZ6A 4RA2A 3TIGA 2RKHA 1FKAH 2DA5A 5ILSA 4V2GA 4GKJH 3HEFA 2ZSIB 4MA5A 3HKZN 3RBEA 3J81K 1GXQA 2JUCA 5D5VB 3DKYA 1QVUA 2MH9A 4G7OF 3F0CA 4ZQIA 2OWOA 4MV9A 4B3XA 3S14J 2L7MP 4XNFA 1JJ8C 1APLC 4KICA 1V51A 4YIIA 4HQMA 2HEOA 1IXCA 2KL4A 1XGNA 2XVCA 1PUEE 1GV2A 4ED2A 2LMDA 4A3BG 5GPAA 4M73A 4ETSA 4XICA 2BQ3A 1BC7C 4OMZA 4KIGA 3CCMI 5JQWA 1U6GA 3CMMA 4BQAA 4A0YA 2Z1DA 4QWDA 1D3YA 2JA7A 4MNUA 1ZGWA 1LJ9A 1MBKA 2FSWA 3CMEI 4X0GA 3S3MA 5D5WB 4P96A 2QLZA 1O3TA 2ZJPF 4KMUX 2AGPA 5B66C 5BQTA 3H35A 1KJ8A 1T98A 1X4PA 1Z7UA 1E17A 4Z6YA 1DV1A 3E5XA 4LG0A 3R23A 4JI4H 3K70C 4R79A 3S3OA 3M9OB 5KFDA 3F3XA 1QBJA 3SQNA 3KHHA 4G94A 3RKQA 2X1EA 3HOZJ 1T3NA 4EJOA 3WU1B 3VSLA 1XX5A 4ED6A 4LMYA 4ECRA 2JRTA 4ED7A 4WXCA 2JA8J 1CF7B 4DBRA 5LMUH 2LP0A 2Y0SE 2R7TA 2DPIA 4BXUA 3LA2A 1WCMJ 4BJ6C 2R5ZB 4DOZA 4AUXA 4RAZA 1KEEA 1Z6RA 1VQ9I 2W6OA 3HGGA 2EILH 1O3RA 4IR1A 4E4TA 2FP4B 3FM3A 4XORA 4BQOA 4IOCF 2ECCA 4EYHB 2MFZA 4LF9H 5HS9A 2AGQA 4NLGA 2L9VA 1IJWC 1S7OA 2XGPA 5FROA 1YJ9I 2O61A 2XRNA 2XDVA 1XD7A 3KFWX 3LAPA 1I6XA 1A31A 1QHGA 5FKLA 4EM0B 2K9NA 1RUOA 4PZJA 3GTQJ 3ZOBA 1PP8F 3GIPA 4LIUA 3RQ4A 4F4YA 2VXZA 1WHUA 2XB5A 3ZQLA 2F5VA 3PW5A 2ZM6H 1B8IB 5J47A 3U2RA 1GV5A 2FOWA 3D5RC 2EA4A 4DL5A 1SANA 2EFWA 3SDGA 3L00A 1NTCA 4JX5A 4HNUA 4DV5H 2V9WA 4A3DG 5BPIA 3WNZA 5CVIA 5FLMG 1HW5A 2DT6A 2EH3A 3U1DA 3F8BA 2VC0A 1VQOI 4D9JA 1KYWA 5HDGA 2JSPA 1Z21A 4QIWA 3DP7A 2CW8A 2ZXHA 2N8GA 4QJFA 2IS6A 2QA4I 3ASOH 3F6OA 4P9FA 4EGJA 1RJRA 3HRSA 3TW7A 1ZRCA 1S68A 4BHBA 4Q43A 4N9IA 3ORRA 2HGSA 4B43A 2DT7B 1OR7A 3BZKA 4M71A 1MBHA 3WTYC 1SMTA 3BY6A 1QPMA 2XPWA 1A6IA 3F23A 5LEJA 3RTXA 3BT9A 1FBSA 2ZFUA 3G73A 3W6KB 3VYTB 4M6YA 2VJJA 1ZRFA 3CJQB 4OIPF 2D1VA 3AKZA 2YCHA 5FKMA 5KG2A 4KA4A 4EYIB 1B33N 1DU6A 4UXNA 2NNNA 2PMUA 3FIWA 4I02A 1VQ4I 1U9NA 2KPMA 4L5IA 4IAJA 1T0FC 2F4IA 2HOAA 4IRKA 1DP3A 4JI2H 1XMKA 2JTVA 2HWVA 5GAHJ 5JI6A 2CFXA 1T94A 4J9QA 1Q1HA 3S8PA 3TIIA 2HS5A 5H6QA 2DA2A 2EFOA 5CVRA 1T2KA 3OHAA 3I59A 2ZC2A 2R7SA 1MSEC 1GT0C 1XGSA 4UCOA 1OQYA 4DW6A 5DG7A 5CB4F 1MMGA 1S0MA 3DKXA 2E2JJ 3OYMA 1U5TC 3E0JB 2XF6A 2R93J 4BS9A 3HOUG 2HXIA 4KFCA 3KLNA 4YHHH 2OC6A 3AG2H 4BE1A 1J59A 3RBDA 2IW5A 4PSWA 4YELA 4CC5A 2W4SA 4GO1A 2WDTA 4LIVA 3H3ZA 2YU9J 1WCMA 4RAYA 1IN8A 3H9QA 4MEXF 1R23A 1BI0A 3ZMTA 4HX4A 5KG4A 3GTLA 5KFXA 4LK0F 1MBFA 1KJ9A 1D1AA 2NU9B 4RNOA 1U78A 4RM3A 4ZJZA 1HNZH 2KRHA 3VPRA 4B1RA 2CG4A 1B6AA 1ZN2A 2KQRA 4XSZF 1IBLH 1YITI 4II2A 1TWCJ 3WO0A 3S15J 2J5OA 2GM4A 4BBSG 1X9NA 1VTNC 5E17F 1I27A 3S3NA 4ENNA 4O3OA 5KFQA 1F36A 2CMPA 2P5VA 3KX2A 3QPSA 2BYVE 1WPKA 4O2AF 1VQ8I 3T8RA 2D1HA 2H27A 2RDIA 1XCVA 2O6GE 1TTYA 4LJZF 1POGA 2MABA 4PUSA 2YX7A 2M34A 4BYYA 3GYHX 1IN5A 4BQNA 1GLNA 1KJJA 3BQ1A 1TBXA 3GV5B 4ZI7F 1JKPC 1X1PA 3QOEA 4IX7A 2UXNA 1RUNA 4PDKA 2C35B 4RU9A 1I3QA 3OYJA 2V1NA 5D1OA 3FKIG 1FPQA 3D0SA 3HTUA 3O8GA 5D1PA 2G9WA 3TQTA 4BL0B 1Y14B 1ZYRF 1Z3YA 1VQ7I 2CQKA 1T6SA 1ACIA 2PN6A 3MZ8A 4UY8I 1FBQA 3O8HA 3C2BA 3L2RA 1ZELA 3CDHA 4IZZA 4LG0B 4A3MG 1W0UA 5A2QW 4EBDA 1EA3A 2Y9YA 3I4MJ 2KZGA 5F04A 4GLXA 3FKIJ 1ZETA 2JA5G 3ETJA 2E5LH 2M7BA 4IJAA 1FYMA 5KFPA 2HGCA 5KFKA 1CF7A 4F91B 4J0MA 3MR3A 2MG4A 2WB1N 4ASNA 2WWYA 2LY2A 2R5ZA 5E3OA 2GXBA 2MBFA 2Y31A 2E19A 1ZREA 1M0WA 1P4AA 2Y69H 1IRGA 2ZDHA 5KFEA 3PVXA 2JEIA 2A3SA 1A04A 5LFAA 4U87A 3OYNA 5DDGA 3HOYG 2ID6A 2W25A 4U0YA 2HHHH 1SFUA 2DCEA 2JA7J 4HQ6A 3HOXG 1Z3XA 3WG9A 2ISZA 2W71A 2I8CA 3OIOA 4RGXA 2UUCH 2DN0A 5I47A 1IRXA 3DLLF 4BNCA 3IKTA 4G7HF 1VQKI 1KONA 5H20A 3ZQFA 4UUVA 2YUSA 1TWCA 2V79A 2V9KA 4N9HA 4JV5H 4HX7A 3BTIA 2O7OA 3SZGA 1S0NA 2LF7A 2WTEA 1FX7A 3QPLA 1TNTA 5IPAA 3VWBA 1LE8A 3E6CC 2LF8A 3Q9SA 1B8IA 5KK1A 5H80A 4G9YA 1GSHA 1BW5A 3A01B 1AUVA 4UB8C 1FP2A 1X1CA 3MKLA 4FHTA 4EM1A 5F1JA 4APMA 5CA0F 5E3MA 1BNCA 3I4PA 4XOTA 3WU0A 1MD0A 2TCTA 4BJ5C 2R84A 2CV2A 2Q2TA 2V1XA 3R6SA 3RV3A 2DFEA 4KYWA 2ZKZA 3GZNB 1SD6A 2LG4A 2E1MB 1E4FT 2R0QC 1BW6A 3LAJA 3E5QA 3TO9A 2JK3A 2NRAC 1UC9A 4MIMA 1YOVB 3BQZA 1IV6A 2LSOA 1Z1DA 2DOAA 1MH3A 4BU2A 5IT9K 4XX0B 4YBZB 4BBRJ 4U0WA 3IV5A 2ZJQF 4ESJA 2QF7A 1R49A 2DJNA 1J09A 5D5XB 3CO6C 4EEFG 4JI0H 2VPQA 4YG2F 3BP8A 1KU9A 2H6CA 5FLXZ 4ZTFA 3T5XA 4PJNA 1KU2A 2NVQJ 3GTOJ 4C5BA 3Q0UA 2W7NA 2DFFA 3TGNA 2IP2A 4BGDA 1HSJA 3JRAA 3GTMA 4J9MA 2DWCA 5KFJA 2W48A 5IT9W 2VA3A 1VI0A 2ZO4A 1LFPA 2FNAA 2UWMA 4L5EA 2XGEA 2R8JA 2QQ9A 3BDDA 4DZPA 4FASD 2EIKH 4PSXA 1TQIA 4I99C 1KQ9A 2QK4A 2JT1A 5HS8A 5J2UF 4M72A 3G8CA 1N34H 2WV1A 5KFFA 2EV0A 1HW2A 3KHGA 2ZMEC 2F5EA 2C28A 1O7FA 3PSIA 4ECQA 2UXDH 2E7XA 1T39A 1HA8A 4DL7A 1P7JA 2O8XA 2JZYA 3S93A 5JFRA 3S1QJ 1HOMA 5L1KA 2W6ZA 1YW8A 1IUFA 1TWHJ 3CESA 1JKJB 2Z5UA 1TP4A 3V8LA 1EH7A 1TWAJ 1RJPA 1XGOA 1VKZA 2DU9A 1D5VA 2UXBH 2RREA 3PO2J 4CCLA 5DGBA 2HOSA 2A5WA 4Q5SF 2VIXA 3LL7A 2JA5J 5DS9A 4U7BA 4RZRA 4HZFA 4AIJA 1S29A 4NBQA 5C1OA 4YIRX 3D1NI 2W84A 3K70D 1IF1A 3J7AY 3IAS2 2V9PA 3HDDA 3PW2A 5LMNH 2IJLA 3EQLF 5DG9A 5D4SA 2P6TA 3ZMSA 4LSAA 3GFJA 4D0PA 4QWEA 2QSFX 3GTKA 2Y0MA 4E4HA 3HOYJ 3NAUA 4A6EA 1K78B 3H3VK 1ZG3A 4L9JA 4A2BA 1Z2PX 3V4GA 4ZDLA 3GFMA 5BMZA 3E5UA 1H0MA 2BQUA 3RJ0A 1IDYA 1AHDP 2G7UA 4I09A 4Q48A 5JVTA 2STTA 5ILUA 1I3AA 1LNWA 1R58A 1U9OA 3OYEA 3CUQC 4DNCA 3ZQCA 3KXYT 2AXTC 3R5HA 4FISA 3WTXC 1I6UA 2VJ4A 5DM7F 4HX8A 4TV9F 5EEGA 1BJTA 3R5FA 5D1OB 4M6VA 2E36A 3KE2A 5K5QA 1YW9A 4YY3H 4A3DJ 4ECXA 4C2TA 2ZDGA 1STZA 2QENA 4C9YA 3J7AO 1FVIA 5KFWA 3OV8A 4CCKA 2V6EA 2H6BA 3RTRA 5JLWA 1RZ4A 4GFBA 3QAHA 5DCFA 1TA8A 3BWGA 4W97A 4B44A 4IPAA 3LMMA 2O5RA 3CCSI 3M8JA 4XR6A 2Q8KA 3PL8A 3NGDA 3BLYA 1B9NA 4C2UA 5GONF 1VZ0A 2EB7A 1QU3A 4EEQA 2M7AA 2IA6A 2RGRA 1G4DA 2LD5A 1VBHA 1S0OA 1MNEA 2H1LA 5DQIA 3E6BA 3J80W 4X64H 3M07A 1Y0UA 2P6SA 1TWFJ 2MW8A 4YEJA 2JA5A 4DYQA 1IOVA 4C2MJ 5EWFA 5KHDA 3EUHC 3RB4A 2YX4A 4CCNA 4YFXF 3I9V2 3F8MA 3OSGA 2LREA 3A0HC 3FK6A 5KT5A 4ZYDA 5BR8H 1IRZA 3TOBA 2YZGA 2XCAA 4EJUA 3RAQA 4F3QA 2VQCA 2VPRA 2PI0A 5L3FA 1E4GT 1YS7A 1HQCA 3WO1A 5CQEA 5F0CA 3OYAA 2XUBA 3CC7I 5TJJA 1PVEA 2H8WA 4RAGA 3KZYA 1ZQ3P 1IUYA 3I53A 4G6DA 4MA0A 1MDMA 1LE8B 5BPHA 5FFXA 3A0BC 2BQRA 3GTPJ 1J2XA 3A01A 4MO7A 4X65H 1ETQA 4HPQA 2DA7A 5KFLA 3SI8A 2ECBA 2M8GX 3BG9A 4FX0A 1ZARA 1AKHB 3A1YA 3BROA 2VT2A 3C2GA 2PMZN 3QOPA 5KNLA 3KYDB 1Y1VJ 2Y0SN 4RM2A 4KMFA 1ZHSA 1MGTA 2YPRA 2FMAA 4I50F 3LSIA 5IYCJ 4BY7G 5BS6A 4GKKH 2FK3A 2UVUA 4CCJA 4ZH4F 2R92G 2L3DA 3QRFF 4HV5A 2R6FA 3JRIA 4J9PA 4Q44A 2VODA 4KISA 4MTDA 5E3LA 2VA2A 1HCRA 2CUJA 4BWSC 2DBBA 2PX9A 2QKMB 2FPIB 1BL0A 1AWCA 3GTGA 2GOXB 3K2AA 3RDIA 1Y1VG 3AG3H 4IRDA 2ZSHB 2IGOA 4RZQA 2QCOA 1JHHA 2VI6A 3T1BA 2NS0A 4DQ2A 3KLOA 4WK8F 2HQRA 4NQWB 2XAUA 2RAEA 3ZR8X 3FMSA 2Q1ZB 3MCZA 1A36A 3LSPA 2YU9A 1O3QA 4CO8A 2NOGA 3OSNA 2A61A 3BR3A 5LOVF 1ULYA 2XGQA 3WHCA 4PK4A 3GUDA 1ENHA 4HV6A 3CO7C 2KHMA 1R5ID 3F9KA 1WKMA 1R6RA 1CQJB 5CA1F 1HKQA 1OCCH 4YR3A 1FJLA 2AHQA 4E7HA 3OIQA 3H36A 4HR7A 5FLMJ 3L7WA 5E3NA 4IO9F 4YAKB 2HR3A 4EEYA 5C3EG 2ELJA 2UXXA 4ECVA 2X6YA 4BHPA 4LFBH 3JR9A 4RLFA 2OTJI 3C1DA 3K4MA 3H3UA 4IEJA 4DV6H 1G3YA 2P81A 4AYBN 5LGUA 3GFLA 1UCRA 1L3LA 1B4AA 3KYCB 2IA2A 1WWXA 4L9TA 4NNJA 4DR7H 3FXQA 1K61A 1ON1A 1F9NA 2EQRA 2P7CB 2DYSH 4UUSB 1YI2I 3K3PA 4MV6A 3H1CA 4XL9A 4JI7H 5DEQA 3K4NA 1O7LA 4A3JJ 1GYFA 3BTLA 2W6PA 1X3UA 1ZAOA 2LY9A 2NU6B 2Z33A 2DPUA 2L0KA 3GZ5A 2VPSA 3GIQA 4WBNF 2L9RA 4KN4X 5FJ8J 4L1KA 2CSOA 1K78A 3CQZA 4MV3A 2L9NA 5FGMA 5L9XA 3JRFA 3FMRA 1ZKGA 1OWTA 1HKSA 2IBKA 4HLXA 2A6EF 1WVRA 5L3GA 1P6RA 1LEBA 4IHTA 5L3EA 4FU0A 5KFAA 1OCTC 4HEA2 1YS6A 3IUOA 3ZRGA 1TWHA 1OYIA 3RIRA 4YR0A 1WQ2A 3EDPA 3H0GG 4HF0A 3IWFA 5ICCA 1K83A 1KJQA 1X3ZB 2DMUA 3RF2A 3TO6A 4LB5A 4HF2A 3G1MA 3HOUJ 4I01A 1USSA 3CDLA 5KT6A 1R71A 1Y1WJ 1Z91A 4WD3A 3R61A 5D8KB 4A3EG 5E8GA 3S2WA 1MSFC 2DPDA 4E7ZA 2VBWA 2H1KA 2V1UA 1GLVA 3V6JA 3PIPF 4IHXA 3LSRA 1FIPA 2VB6A 3G1OA 3KTMA 5IWAH 1R1UA 2QVOA 2QQBA 4OWRB 1JUMA 4XLNF 4YAJB 4B48A 1W5SA 3CDIA 1P92A 1WRJA 2K40A 2QQ8A 1YJWI 3DWLE 2ETHA 3NQOA 4GYGA 4OIQF 1M0TA 4IWXA 5KT4A 1P7IA 2P5KA 3ZMDA 5A2QZ 1W96A 4BKXA 3KP3A 1Z7LA 4HRIA 4ED8A 3GIJA 2BZTA 4V2FA 2HVQA 1ITYA 2R82A 5DV5A 3L4JA 3ABUA 3D5SC 2R7UA 1VBGA 1KU7A 4R8UB 3Q0WA 2R7QA 4ESBA 5KG6A 4EGQA 5L3DA 4A3BJ 3HHHA 1GHCA 2HYGD 4BACA 5HLHA 4C3IJ 3HOVG 3TEDA 2NOJB 4M7EA 5TRDA 3EYYA 3PO2G 3TQ1A 2Z3YA 2ZNYA 1MDMB 4M3GA 5K2MA 4AVPA 4XRSG 1SVOA 5HDKA 2CH0A 3GLKA 5B1AH 2AQEA 5DUKA 3L2CA 4ZOLF 3S2HJ 4BXXJ 3SDBA 1MMNA 2HKOA 1A35A 1AKHA 2XHKA 1U5TA 1JIHA 2XAQA 4GGGA 3HKZA 2WB1E 3N44B 2BEOA 5CLSA 1UZCA 4AD9A 1QA6A 3SXYA 4CZCA 1UG0A 3B02A 4L9NA 2K9SA 2PQ8A 2JVGA 2DA6A 2DMNA 3BCAA 2IGNA 3JTHA 4PCQA 3PJRA 4EGZA 2W7OA 2F2EA 1N78A 3AL0C 4OX9H 2A05A 4IR9A 1T36A 3CJNA 2IS4A 1GGOA 1ODDA 2FLPA 1S03G 3ROUA 4RB3C 1GVDA 2GBYA 3PFYA 3BQYA 4UCTA 3LFKA 2F4MB 4DV4H 4J9LA 1JDEA 4A3CJ 1FBUA 2M9HA 2VLAA 3LQRA 1AU7A 1EH6A 2PFBA 3O6BB 1K83J 4NQWA 3BAAA 1Z2OX 4QW8A 3LP8A 5FKNA 4A3JG 4DR3H 2MD5A 4ECWA 3ZXSA 1HLVA 2YS9A 2R7WA 4UFZA 1Y1VA 1T08B 2QSHX 3PZPA 1OR7C 4BDYA 1JHFA 3FWEA 3OL3A 4NDLA 3ZMVA 2O9LA 3VFZA 4A3LJ 2UVVA 2BHZA 3MR6A 4UCVA 2UVRA 5IT9Z 4UHTA 3V8KA 3CMYA 2XGCA 2A5YB 4J9RA 3R0JA 2J5PA 4J19A 3BG3A 3E6MA 2LKPA 3I0TA 4X66H 3RYRA 3OS2A 2XGDA 4F50A 2RQPA 1Z2NX 3L2VA 3ECOA 2CUFA 4XK4A 3VEPA 3KHRA 4LF5H 4KHPH 4XRMA 4YR2A 4O2BF 3ORQA 2FMYA 3GIMA 1REPC 2XB0X 1W36D 3PFIA 1YYVA 3U1KA 2YS6A 2C22A 3DFGA 4ZTJA 3HOWJ 5JHFA 2NVXJ 4ECUA 1N36H 2E1MC 2WAQA 3RZOJ 1AN7A 4F93B 1EZ1A 1J9IA 1SFKA 3IH4A 1DU0A 2R7OA 2QM3A 4LLGF 1E4EA 5E79C 4KUMA 3RIZA 1RETA 1UHMA 4UUSA 3L09A 3OR2C 1LDKB 3N05A 1QPIA 2R7ZA 2M4KA 2JJ7A 4WXHA 5T14A 4HAMA 1Y39A 9ANTA 4D1QA 3HOWG 2C2DA 4A3GJ 3FXJA 4HG2A 3RPQA 2K85A 2BBYA 2XCLA 4RNNA 3PW4A 3BTCA 3MMYB 2BY0A 3MZYA 4PFOA 1K7AA 1BA5A 5ILVA 3DEUA 2NUAB 2EFPA 4NUBA 2K86A 5KFYA 3CLOA 5KFCA 4RMNA 5HOOA 2CUEA 2QQAA 4E7SA 3GIIA 3KCCA 3OS1A 4F92B 4OIRF 2K5CA 2OJED 3H9JA 5BMVF 4IVNA 2EFNA 1UMQA 1MBEA 1TW3A 4ZYAA 2MCTA 3PNVA 2HPMA 2CV0A 2YS7A 3IHUA 3KHLA 1RC9A 3LSHA 2R87A 2V6CA 2R7LA 5LGNA 4RB0A 3CCYA 3H0GA 1SFOJ 2V4JC 4RGSA 1K1SA 2YYAA 3HBLA 4H4KC 5H6RA 3RSNA 3BJAA 2M2EA 1QZZA 2GWRA 3OOUA 5LA6F 2KIMA 1FZPB 5E1XA 5A2QK 4DL2A 2GA2A 2P5LC 2KT0A 3M4IA 2QBYB 1Z6TA 3OYLA 4MFDA 2JA6A 4YJ2F 1LFUP 4UCUA 3IC7A 4J9NA 2RC4A 5TGTA 2FD5A 2PN1A 2VQGA 2IRFG 3TQNA 3OYCA 5LYJF 1JT6A 3N97A 3S2DJ 1XDSA 1I6HJ 2X6WA 1RNLA 3NRVA 1YW7A 3O3KA 3CCLI 4R8UA 1RK5A 2QYOA 2IAIA 2JEJA 2JA8G 1MH4A 1O57A 1R5HA 2E7WA 3QODA 4RAFA 4E7IA 3U9SA 2R7ZJ 3RGXA 1X2NA 2GXGA 3VPCA 4JV0A 4RS8A 1FJGH 2O0YA 3Q3SA 2A68F 1CQIB 1BI2A 4ECSA 3K4BA 4C2MA 3H3VH 1F43A 2MH2A 4CA0A 3DF7A 3G71I 4J9KA 2J6TA 4LF6H 4G8XA 2W8KA 5IP9J 4Q47A 1IC8A 2KIUA 3L9FA 5DLGA 4L5JA 3FX3A 2A69F 2JSCA 4O3PA 5D6FA 3ZP5A 3HOXJ 4LLLA 4JI6H 4B47A 1WGXA 1U5TB 5M5WJ 2BW3A 4UNOA 3I12A 3BJOA 4Y13A 2EIMH 3B6CA 2Q0OA 2PBZA 2QGUA 5EF6A 1W0TA 3K6GA 2GPSA 4G6QA 4A93G 3KAJA 2R86A 2F6CA 4PGGA 2P7VB 1OKRA 3FXMA 4RB2C 1SFOA 1E3HA 2ZMEA 3QU3A 2VKDA 1W7PB 3V4ZA 2JMWA 1ZLKA 3MFIA 3H5RA 3R5XA 1D8JA 1RIOH 2L2OA 2BHYA 3F72A 4A3GG 2E5NA 1IN7A 2FBKA 2LR8A 5DD8A 3IL2A 3I4NG 3PM1A 1PX2A 1B6SA 1JLLB 1IN6A 5C4XG 4P1WA 1RESA 3I71A 2FLNA 2P4WA 2W00A 3HZJA 1A6QA 2XPUA 3RYPA 5LD2C 1O75A 3JCUC 1EYZA 2BR0A 3FZVA 4MFEA 5KT3A 5GP9A 5DD4A 2ESHA 1IOWA 5FLVA 1V5GA 4XKWA 4HF1A 1OYYA 1VQMI 3E5NA 2R7NA 2BV6A 3FM5A 4E6KG 3HGYA 2FK2A 1CQTA 3RZDJ 2PMZE 4CDGA 2GQQA 3DPLC 5EZYF 2I10A 1GSAA 5JVGF 4DLKA 4U0VA 3ULQB 4MV8A 3UFXB 5JH7F 1C30A 2EA2A 1DUXC 2R4GA 1JGSA 2L7KA 1IN4A 1TAEA 1EHIA 3GEZA 5GADJ 4LITA 4JQFA 1PK8A 4ZC3A 3KAKA 5JUMA 1I39A 1E4EB 2FJZA 3T5KA 4CUGA 1LVAA 3M8EA 2CUZA 4LH7A 2GLOA 2CZGA 2MGQA 4E7JA 3LSKA 4DR6H 4DR4H 4B4CA 3OS0A 3MKWB 4GYIA 3ERED 2ID3A 4QPQA 3JSPA 3N42B 4J9SA 4FETA 4ZYEA 2G7HA 4FQGA 2QWWA 4FT8A 3PR4A 2WB1A 3BG6A 4JYKA 2DDAA 2E71A 2OH2A 5IOYA 3S32A 2TRTA 3W2AA 1N75A 4XYLB 3G6VA 2D5VA 2BY1A 2L5QA 1FLIA 3HL2A 5TISC 5GTIC 3M9MB 1XG1A 4Y52J 1BJZA 3BJ6A 3UKGA 5BOXA 3U21A 2W9CB 4X6AJ 4LSXA 2QZ8A 4BE0A 2JVHA 5FRMA 2WADA 3SEZA 1EUDB 3D5LA 4UB6C 1T33A 1V54H 4GXOA 4A12A 4A0XA 3I5UA 5LRSA 2FQ4A 1EV7A 3F8NA 3BA8A 4AYBE 1N56A 3PQKA 1TW2A 4OU0A 2HZDA 2LKSA 4MV1A 2GLTA 4TQSA 1TL8A 1KBLA 3RAXA 1TQPA 3F22A 2Y75A 5GAGJ 5CAEB 3BPVA 2EZHA 4DJAA 3AFHA 3PUBA 2RQQA 3VYUB 2LFBA 3J7ZI 1EJ9A 2IT0A 2V5AA 4ECYA 5IOZA 4FTHA 4RGUA 1PP7U 4IKFA 1JJ6C 4ED0A 1OMIA 1WH5A 2X85A 2VE9A 1XNRH 3E97A 3NWTA 2HYFA 1X1BA 1IXRC 2FEZA 2W1OA 5KG3A 1R00A 2HTJA 5DTDA 1RK6A 1S7EA 1XC5A 2QBYA 1XPXA 3DF8A 2L54A 3LNQA 5KFZA 5C44J 4QWCA 2K3PA 5HNFA 2KRFA 2VL8A 3JREA 3BA9A 3TINA 2EZLA 2EFQA 3I4MG 5K5OA 1MJAA 1MZBA 3BQ2A 4RNMA 4XKBA 2PEXA 2ZB9A 4MTEA 3TP0A 5HV6A 5LP6F 3ZGKA 1IV8A 4DGWB 3RB0A 2Z2SB 1H88C 1O3SA 1LKXA 4ME6A 5HS7A 5IP9G 5F64A 4QW9A 1S5LC 5KFBA 1J0RA 3HPGA 1TWFA 3GV7B 1FMWA 1V5EA 3J80K 2XC9A 2WE6A 2LRDA 1U0JA 4JI3H 4PWQA 2DFHA 2CQXA 3SYTA 4HNVA 2MSYA 1GO3E 4C5AA 1S7AA 2HU9A 2DDBA 2YZMA 1X1DA 2Y2ZA 4O4LF 3GTJJ 2XF5A 1H9TA 1FMVA 3GMEA 3ZN0A 3CLQA 5F1RA 3JW4A 2V58A 1N32H 3K4KA 5FB2A 3PW7A 3BZCA 4M9SA 3DPUA 3JAMZ 1ONVA 3RUPA 3ABTA 1I7LA 2RN7A 1FT9A 3V7CA 3DQVC 4HSRA 4HA8A 2BW3B 2L4AA 2KISA 4FE7A 2GXAA 4ZYGA 4PDBA 2LBFB 2B63J 2DYRH 1ORKA 3K1MA 2YW2A 1V4YA 4RUCA 4M9ZA 3JRHA 2X6OA 5M5XJ 5EGOB 3IH3A 3KEQA 2OA4A 4IRGA 4XKCA 3I54A 4D7MA 5KFUA 4NC6A 4I2OA 2ZMEB 4QWBA 5F9LA 1W7PA 2DZDA 4XLEA 4ON0A 3K69A 5IP6A 2DIKA 4AWXB 2E1NA 3JSOA 4EMSA 1SD4A 3S17J 4B09A 1XMXA 2DLLA 3E3VA 1FOXA 4IHVA 3FHNA 4ZZLA 1G3SA 4Q8FA 1EUCB 1YG2A 2M8EA 2DODA 2E1CA 1T0FA 4FBUA 3AYHB 2MA3A 5KFHA 2M5WA 5C5JA 5FO5A 1FTZA 3DTKA 1OJLA 3P9IA 4QSHA 3ELKA 5F27A 3OHBA 3HJEA 4I6ZA 4Y33A 3F8FA 3X2QH 5K1YA 2Y0SA 2Z9OA 3K4JA 3WTTC 3UNGC 2XAHA 2OPTA 1VAJA 3ZQQA 1DGSA 1XDNA 3K5IA 5KCMA 5J4VA 2IP4A 4TV8F 5FPRA 2V1DA 5HNHA 4BXXG 1TC3C 2VUGA 1NG6A 2DTRA 3HIFA 2IS2A 3GIDA 2VBYA 1RKTA 1DIKA 3BG5A 1X4OA 1J7KA 2XKOA 3OMYA 4M9XA 4XBFA 2CRGA 5K7FA 1N33H 2DO7A 1SVMA 4EFEA 2IS1A 1KC7A 3DKWA 4JV1A 4B3AA 4E7KA 2R7RA 3GIKA 3BG7A 3WE3A 1HR0H 4CH7A 4RBOA 4NC7A 1WZ2A 2X0LA 4RGRA 1HKTA 1YHQI 1YX3A 2ELHA 1JKRC 4OOIA 3J81Z 3PN1A 2W70A 1TWGA 3RB3A 2WC2A 3R4KA 2BY2A 2XROA 2XCPA 4BEHB 3I56I 1IZ1A 1IG7A 4PJ0C 4DV0H 4A5MA 3V4SA 2ICWG 2W7PA 1X3WB 1FEXA 2BVMA 3HOSA 3OUZA 5KFNA 3RPUA 3H5AA 3LSMA 4R8HA 3SHFA 2R5YB 1K4TA 3SFZA 4A2UA 1IO2A 1YLFA 3HG9A 5AIQA 6PAXA 2VASA 4A3FG 1FNNA 4EJTA 3HSFA 4CYCB 2QSGX 4AC0A 3TBIA 4JBAA 2DMPA 3KZIC 3H5NA 4KIBA 4IHWA 3G6YA 5FPOA 1JE8A 2W9CA 3OYGA 3BABA 3MFKA 4DR2H 3GTLJ 2ZXJA 2LLKA 5B3SH 3SFIA 3KP6A 4WXDA 3V7SA 3TOAA 2OUMA 2XPVA 2WY8Q 3WHBA 1U3EM 1GXPA 1F4KA 5ICEA 4UCSA 4LF8H 2VC1A 1OCOH 4LOCA 3K9TA 1O4XA 2VKVA 3QYFA 2CU7A 3EUKL 2KJBA 4KIFA 1C3OA 3LOCA 4YP3A 2DT5A 1WSUA 2CKZB 3DCFA 4LK1F 5KVRA 2MD0A 3LMLA 5LEKA 5KFTA 2WY7Q 3W6VA 4OINF 2UVWA 3ML6A 1H89C 2HPIA 1BR1A 4ECZA 1OFCX 3H0GJ 4OAYA 4UV8A 2HQNA 1Y1WA 2I80A 4DL3A 4IL6C 1C0WA 3TP3A 2DA4A 4GCVA 4V19K 4ITVA 1JTYA 3MEXA 2JRMA 4O6JA 4X1EA 4N4OB 1FTTA 1ZK8A 1UHSA 5HVQC 3MWMA 2FU4A 1G59A 2PLYA 3GV8B 3VYRB 1LVKA 5K5RA 2DOEA 5L1LA 5J8FA 3WG7H 4DIQA 1YX5A 1UB9A 4UCRA 2HI3A 2R93A 3F6VA 1BOBA 2VE8A 1NHAA 4J00A 2VOPA 2ATLA 3ABLH 5LLQA 1BC8C 4EBCA 4UUTA 3FDSA 5ERIA 2AXLA 3M7GA 2NS8A 1JX4A 2R7KA 4DR5H 1V55H 3LSGA 1HF0A 4X62H 3K4CA 2ZJ2A 4WCGA 3C3WA 2HOTA 3KP5A 2R8GA 3LFUA 3HXLA 2BE5F 4CGZA 3E6DA 1CS0A 1Y8QB 5IT3A 1S3JA 2R7FA 3MKYB 1R36A 3CCRI 2E2HJ 1VNDA 4XLHA 2OF7A 3QPTA 2KIQA 2A6HF 4PJMA 4JI1H 1XSVA 2Y30A 2L9SA 3DPTA 5EZHA 1IBKH 1JTXA 3UR3C 2J6SA 2STWA 4XONA 4JX6A 1GUUA 1R9TJ 1PDNC 3BCBA 1HSTA 3ZQHA 4BQQA 5LL6b 5DM6F 3K1NA 3MZHA 1TT5B 3FF5A 2WV0A 2UV1A 5GAEJ 4EFBA 4EQQA 1WH7A 2LBFA 2CW7A 2WAFA 3S16J 5EGOA 3ZQ7A 3GTQA 1JDBB 2NVYA 2J9GA 2Z16A 1SAUA 1S10A 3PNYA 3WODF 1VQLI 2ASDA 4RDUA 2PMHA 1G6NA 1WSCA 2FPGB 3BQ0A 3CJRB 3GTJA 4DYCA 3CTAA 2CO5A 4TQRA 1YIJI 3ZMUA 4HSTA 3Q1KA 2KDOA 3M3YJ 3S1NJ 3HOVJ 3VODA 5GPCA 3FXKA 2BVLA 1BJAA 3DU5A 2L01A 1TLHB 2ZXWH 4ZDOA 4JK1X 4DV2H 2WYOA 3MN2A 2EV6A 4Q4ZF 4JI8H 1F1ZA 4MQVA 4A3MJ 1B9MA 4YB8B 4MV4A 2IVMA 3ONQA 4M3DA 3A4CA 4A3KJ 3GX4X 1B59A 4DR1H 5CVVA 2B63A 3H92A 2K9QA 5LHHA 1JUPA 3JZIA 1RYRA 1V4RA 4O3RA 2FK1A 2C2EA 4HLYA 4XN3A 5ED4A 4KT6A 5K7HA 2RV8A 2XSDC 4A3CG 1ETVA 3C7JA 4F4ZA 2HVSA 2GIZA 3LA7A 4AVZA 5L1JA 3Q5FA 3AG4H 3L2WA 1QQIA 2OZUA 3CQZJ 1AOYA 2HKXA 1BN5A 2IA1A 4CSWA 4L0ZB 2IGKA 4LB6B 3FMQA 1V9PA 1ZG5A 1D5YA 1N77A 2A6TA 2SCUB 4O4HF 4B3SH 4AQYH 3K4LA 3FXLA 4ED3A 3PQJA 2QKLB 2LVSA 2K4JA 3HRMA 4G6TB 4II3A 3RQIA 5DYMA 4BEHA 4OMYA 2LKXA 4QIWE 3W6JB 1WH2A 2EIJH 3SZPA 3GTPA 1SYXB 3CCJI 2D2WA 3QP5A 5F0FA 2A07F 2R5YA 1UELB 1QGPA 3JRCA 2W9BA 3GFIA 1MMSA 4G3IA 2E5ZA 3I58A 5KFVA 2LTPA 3CUQA 2BXZA 2YR2A 5EYRA 1HXDA 1S9FA 2RGVA 1EF4A 2UUBH 4EGYA 3A02A 4CYCA 3GZ6A 4YQWA 3WTSC 2HDCA 1TWAA 3HHGA 2H8RA 2UUAH 2DPJA 5KAIC 2W6NA 3JSNA 3R0AA 4XYMB 3FKJA 1XCBA 4XKVA 1IAWA 3ETHA 2P0AA 3JAMK 2FNPA 2CYYA 3ECHA 1WI3A 4FS1A 4O5VA 4A93J 2FB9A 3GXOA 3MR5A 5CKTA 2M87A 4Y17A 1D8KA 4HBLA 2JA6J 5HODA 1DP7P 2QUFA 5KG7A 3AAFA 3ZPLA 1USTA 4ZZDA 4K2EA 4F4XA 4AIDA 1U2WA 2B7EA 1OYWA 4KITB 1Y8RB 2I8DA 2OAZA 2OU2A 3QFFA 4I98B 2W6QA 4NXMH 2PMZA 3DBRB 3RFCA 3VDXA 4XRSA 2R85A 3H40A 3FMAA 2XV4S 3QU6A 3HUGB 4CYDA 2OCEA 5J4YA 4ED1A 5J2TF 2LOOA 4BY1J 2OLSA 3M4OJ 4Y4RA 5FRNA 2L7FP 2KZVA 3C2HA 3N43B 2K3FA 3P9CA 3VSKA 2I5UA 4LH6A 5AONA 2M0CA 3H0DA 4O3SA 2DLNA 3IWZA 5FKKA 3WGHA 1ZHFA 1Y1WG 2CQYA 4DUYH 2G0EA 2B0LA 4E7LA 2MC3A 3MVPA 1K6OA 3T5LA 1MKMA 4EJVA 4F4WA 4BY1G 2FBHA 1FC3A 3FBNB 3OSPA 3WU2C 1JUSA 1F5TA 1VFCA 5IYDJ 2WAQE 2R93G 2H09A 4QWAA 1P4WA 2Z99A 1D1BA 2EINH 2CQ7A 4KN7X 4H0EA 2Q2EB 5KT2A 5M5YJ 1YRNB 2LNBA 4EG0A 1LEAA 2H94A 4P55A 4L0YB 2HOEA 2K7LA 1MJ9A 5LRRA 2VUMJ 2ELKA 1YO5C 1PJRA 1XB4A 4BBSJ 2YZNA 1HDPA 1ZGJA 5C8YF 3EPIA 3F8CA 4YRVA 1RR8C 3KP2A 3N41B 3FBIB 3M1CA 3IKVA 5KT7A 3V42A 3T1HH 3MWEA 4IQJA 2HNHA 3G6XA 3IRRA 4FS2A 5EZGA 4JYAH 3TDZC 2JA2A 2EJRA 2RNGA 2P0WA 1ZHQA 2UU9H 5J1YA 4KT5C 5DUIA 3MKZA 1SD5A 3ERMA 1MNMC 3OR1C 2ZFWA 4YIFA 4AM3A 2KSWA 2DMQA 1BIAA 4ECTA 4FX4A 3GILA 2B9SA 4C5CA
chains in the Genus database with same CATH topology
1HW1A 3K0LA 1W4MA 2F4VH 4KDPA 1GVJA 1IRFA 4L18B 3KEOA 1IW7F 2L4MA 1P4XA 3FXUA 4ENMA 3GVAA 4U88A 4NHJA 4WWCA 2UXCH 2OQRA 3WTZA 3KALA 2FXAA 2K27A 4MQ9F 1FSHA 1Z05A 4MHGA 1I1GA 1S6LA 1BI3A 5D6EA 4L9VA 3M8FA 4LFCH 2W24A 2L02A 2XAJA 4YFKF 2VONA 4UV9A 2ISYA 4A6DA 1SEIA 2M45A 1QNTA 2DQRA 4A0ZA 3OOPA 4LF4H 1CGPA 3VOEA 1T38A 3H20A 5CYVA 5HLIA 2OZ6A 5CVJA 3CUQB 1HNWH 2KIFA 4S04A 4QLCU 1TNSA 3V8JA 3U9GA 4XRFA 4B3TH 2K4BA 4HOBA 5AIPA 1ZGAA 1LB2A 2VOBA 4BHCA 3LWFA 1XSXA 3T8TA 2FQ3A 1G3WA 2MLGA 2XAGA 3K2ZA 3P7NA 4ESFA 2OQGA 4F7ZA 2DK8A 2PJPA 1FP1D 2VT3A 2FF4A 2F5FA 3C18A 1BOAA 3HSEA 3HUGA 2GZWA 5D4RA 5E1ZB 1KYZA 3Q9VA 2XIGA 2ZJTA 3I64A 4CXFA 5L3CA 4P5OA 5DCMB 4CHUA 3N40P 1I1SA 4EVIA 2F5DA 4MEYF 4IRHA 3HRTA 4EJWA 1XDUA 1KA8A 2Y48A 3HTSB 2AS5F 3WTUC 2IPQX 1XMQH 1ZRDA 4BH9A 3K3VA 4UVBA 2Q2EA 1XMAA 4PGHA 4XLPF 1L0OC 4UVCA 4YFNF 3KP4A 3KETA 2D45A 3JSLA 3KP7A 4OIOF 4MV7A 1BBYA 1HBXG 3WGIA 4KNYA 5E1WA 1FSEA 1TQMA 3ZMZA 2DI3A 3TDUC 4WX9A 3N6XA 3RI4A 1FYKA 3LA3A 4CC6A 5EOYA 2DK5A 2EWNA 5JHUA 2NNYA 1IBMH 1XMOH 2F5CA 3DXJF 1DPRA 3WE2A 4Y15A 3UQ8A 1XNQH 3GO5A 1KQ8A 1KQ0A 3T1YH 2JPBA 2ZNZA 2ACJA 3CVZA 2EK5A 2X4HA 5E20A 2RDPA 1SD7A 5ICGA 4IF4A 1J75A 1L2ZA 2M1BA 4B3MH 3REOA 4JI5H 4G7ZF 2R3SA 1SFXA 5E18F 3JTGA 3WGGA 4Q0YA 1BIBA 3M1EA 2M30A 2O3FA 4E70A 3M9AA 4LLNA 4K0KH 2VN2A 1YTYA 2UZKA 1V3FA 2FOKA 4LFUA 5FLXK 4WF2A 3F21A 1XSDA 4O3MA 1R7JA 2GAUA 3B73A 1U8RA 5LGTA 2NAZA 5CVUA 2KKOA 4ENKA 2FE3A 1YFHA 1Z9CA 3V7RA 3EYIA 1ZG1A 2MLKA 4AIKA 4IHSA 2OBPA 2BGCA 2VBXA 1SAXA 3FHZA 1OPCA 1BGWA 4DV7H 4CZZA 3LQQA 1J5YA 4CICA 5FD5A 3EUHA 4P9UA 1P8LA 4TV7A 1SFEA 1ZH5A 5FD6A 2RNJA 2XASA 4B3RH 3DV8A 1FOKA 2TDXA 1QO0D 5ICFA 5DCMA 1BM9A 3ZN1A 1LQ1A 4NXNH 3VB2A 1DPUA 3WTVC 1R1VA 1DDNA 3OTOH 5FFZA 4A2AA 1G3TA 3QP6A 4HDUA 3J7AK 1R1TA 3RGZA 2ADUA 5FLXW 4DV1H 4LFAH 1LDDA 2R7DA 4MGRA 2CGPA 3J80Z 5HLGA 1WI9A 3L2PA 5JR3A 2FMLA 4BAYA 5BPDA 2KJCA 4NB5A 2VQEH 2W57A 2HTSA 3HRUA 4RB1A 2CWEA 2YSRA 3FXRA 1RI7A 3MQ0A 3P9KA 4EV0A 1FWZA 3RKYA 5HDNA 2FA5A 1KGSA 1UFMA 3O2PE 1S8NA 3JAMW 2YU3A 1H9GA 1XGMA 4I0AA 4ENJA 1FYLA 3C0FB 1I5ZA 4IXAA 2P8TA 3COAC 1SMYF 2HVRA 4UVAA 1YIOA 3SZTA 1K79A 2VBZA 5E8IA 2GA1A 2XAFA 3RKXA 3NEUA 3IG0A 2VQFH 3RJPA 4LF7H 3RKWA 2RVCA 3TO7A 1B1BA 2XKPA 2ZBKA 5J6XA 2VOOA 4HYEA 2DQLA 3CUOA 4LGWA 4N0BA 4HW0A 5LHIA 4I7HA 4M74A 1XN7A 1IXSB 3K1PA 1BI1A 1R22A 2XGXA 1LDJA 4U7DA 5EEHA 3TKYA 1JXSA 1J5EH 4QWQA 5L3BA 2PG4A 3J81W 4S05A 5J8CA 2FRHA 2OD5A 4DV3H 3T0YA 3HSRA 2COMA 1HNXH 4R1HA 2W85A 3GW2A 4R7RA 1A0IA 2PBIA 2ZCWA 4DUZH 4FM9A 1E2XA 1I94H 1P2FA 2CW0F 5LHGA 4Z2YA 3G3ZA 3EETA 3BOQA 5CJ9A 1QZYA 4XSXF 2ESNA 2NYXA 3GWZA 2V9VA 3N4MA 3GLXA 4A5NA 2FBIA 4ZYHA 2C6YA 5D8LB 1KU3A 2DAOA 1W5TA 1R5GA 5LBQA 4B8XA 4LD5A 2IA0A 5D5UB 3QPHA 4M6XA 5F6FA 2HZTA 4I0BA 2DFIA 3LSTA 1UHWA 4EM2A 3I59B 3L4KA 3HYIA 3WTWC 3ISPA 3R60A 3MAJA 2GIVA 1ZLJA 2LDUA 3HOTA 2JPCA 4HQEA 3BPXA 1VS0A 2K02A 3GF2A 1EH8A 3IRQA 1W7PD 2HFHA 1ON2A 4AIHA 1MJBA 3KZZA 4IRIA 2DW4A 2O03A 1FY7A 2EV5A 2Q2UA 1YQAA 4HDVA 1B04A 3BZ6A 1FKAH 2RKHA 5ILSA 4GKJH 3J81K 1GXQA 5D5VB 2MH9A 4G7OF 2OWOA 4MV9A 4KICA 4YIIA 4HQMA 2HEOA 1IXCA 1XGNA 2XVCA 1PUEE 4M73A 4ETSA 1BC7C 4OMZA 4KIGA 1U6GA 4BQAA 4A0YA 1D3YA 4MNUA 1LJ9A 2FSWA 5D5WB 4P96A 2QLZA 1O3TA 4KMUX 5BQTA 1T98A 1Z7UA 1E17A 4JI4H 3E5XA 4LG0A 4R79A 3F3XA 1QBJA 3SQNA 4G94A 4EJOA 3WU1B 4LMYA 2JRTA 4WXCA 1CF7B 5LMUH 4BXUA 3LA2A 4RAZA 1Z6RA 1O3RA 3FM3A 4LF9H 5HS9A 1S7OA 2O61A 2XRNA 1XD7A 3KFWX 3LAPA 1I6XA 4EM0B 1RUOA 4PZJA 1PP8F 2VXZA 2ZM6H 3U2RA 2EA4A 2EFWA 3L00A 4DV5H 5BPIA 5CVIA 1HW5A 3U1DA 3F8BA 2VC0A 1KYWA 5HDGA 3DP7A 2CW8A 3F6OA 4P9FA 3HRSA 1ZRCA 1S68A 4BHBA 4N9IA 2HGSA 1OR7A 4M71A 3WTYC 1SMTA 3BY6A 1QPMA 3F23A 5LEJA 3RTXA 1FBSA 3G73A 3W6KB 1ZRFA 4M6YA 4IAJA 4OIPF 2D1VA 2YCHA 4KA4A 4UXNA 2NNNA 2PMUA 4I02A 4L5IA 1S03G 4DR4H 4JI2H 1XMKA 2JTVA 2HWVA 5JI6A 2CFXA 1Q1HA 2HS5A 5H6QA 2EFOA 5CVRA 1T2KA 3I59A 1XGSA 4UCOA 1U5TC 4KFCA 3KLNA 4YHHH 1J59A 2IW5A 4CC5A 4GO1A 2WDTA 3H3ZA 4RAYA 1IN8A 4MEXF 1R23A 1BI0A 3ZMTA 4HX4A 4LK0F 1U78A 1HNZH 2CG4A 1B6AA 1ZN2A 4XSZF 1IBLH 2J5OA 1X9NA 1VTNC 5E17F 1I27A 4ENNA 2P5VA 2BYVE 3T8RA 2D1HA 2H27A 1XCVA 2O6GE 1TTYA 4LJZF 2YX7A 4BYYA 3GYHX 1IN5A 1TBXA 2UXNA 1RUNA 4PDKA 5D1OA 1FPQA 3D0SA 3HTUA 5D1PA 2G9WA 1ZYRF 2CQKA 1T6SA 2PN6A 1FBQA 3CDHA 4LG0B 5A2QW 4GLXA 2E5LH 4IJAA 1FYMA 2HGCA 1CF7A 4J0MA 4ASNA 2WWYA 2GXBA 2MBFA 1ZREA 1M0WA 1P4AA 1IRGA 2A3SA 1A04A 5DDGA 2W25A 4U0YA 2HHHH 1SFUA 3WG9A 2ISZA 2UUCH 4RGXA 4BNCA 3IKTA 4G7HF 5H20A 4UUVA 4JV5H 2V79A 4N9HA 4HX7A 2LF7A 2WTEA 1FX7A 1TNTA 3E6CC 2LF8A 3Q9SA 5KK1A 4G9YA 1FP2A 4FHTA 4EM1A 4APMA 3I4PA 3WU0A 1MD0A 2Q2TA 2V1XA 3R6SA 4KYWA 2ZKZA 1SD6A 1E4FT 3LAJA 3E5QA 3TO9A 2NRAC 2LSOA 1Z1DA 5IT9K 4U0WA 4ESJA 5D5XB 3CO6C 4JI0H 4YG2F 3BP8A 1KU9A 2H6CA 5FLXZ 3T5XA 1KU2A 3TGNA 2IP2A 1HSJA 5IT9W 2ZO4A 2FNAA 2UWMA 2QQ9A 3BDDA 1TQIA 1KQ9A 2JT1A 5HS8A 4M72A 1N34H 2EV0A 1HW2A 2F5EA 1O7FA 2UXDH 2E7XA 1T39A 2O8XA 5JFRA 2JZYA 1YW8A 2Z5UA 3V8LA 1EH7A 1XGOA 2DU9A 1D5VA 2UXBH 4Q5SF 4U7BA 4HZFA 4AIJA 1S29A 2W84A 1IF1A 5LMNH 2IJLA 3EQLF 5D4SA 2P6TA 3ZMSA 4LSAA 3GFJA 4D0PA 2Y0MA 4A6EA 1K78B 1ZG3A 4L9JA 4A2BA 1Z2PX 3V4GA 3GFMA 5BMZA 3E5UA 1H0MA 3RJ0A 2G7UA 4I09A 4Q48A 5JVTA 2STTA 5ILUA 1LNWA 1R58A 3CUQC 4DNCA 3KXYT 3WTXC 1I6UA 4HX8A 5EEGA 1BJTA 5D1OB 5K5QA 3KE2A 1YW9A 4YY3H 1STZA 2QENA 3J7AO 1FVIA 3OV8A 2H6BA 3RTRA 1RZ4A 3QAHA 5DCFA 1TA8A 3BWGA 4IPAA 2Q8KA 1B9NA 2EB7A 4EEQA 2RGRA 1G4DA 3E6BA 3J80W 4X64H 1Y0UA 2P6SA 2YX4A 4YFXF 3F8MA 5BR8H 4ZYDA 3TOBA 4EJUA 2PI0A 5L3FA 1E4GT 1YS7A 1HQCA 2XUBA 5TJJA 3KZYA 1IUYA 3I53A 4G6DA 1MDMA 5FFXA 1J2XA 4X65H 4FX0A 1ZARA 3BROA 2VT2A 3QOPA 4KMFA 1ZHSA 1MGTA 2YPRA 5BS6A 4GKKH 4ZH4F 2L3DA 3QRFF 4HV5A 2VODA 4MTDA 4BWSC 2DBBA 1AWCA 3RDIA 4RZQA 1JHHA 4DQ2A 3T1BA 2NS0A 3KLOA 4WK8F 2HQRA 3FMSA 3MCZA 1O3QA 4CO8A 2A61A 1ULYA 3GUDA 4HV6A 3CO7C 1WKMA 1HKQA 3L7WA 2HR3A 2UXXA 4LFBH 4BHPA 3C1DA 3H3UA 4DV6H 1G3YA 5LGUA 3GFLA 1UCRA 1L3LA 1B4AA 2IA2A 1WWXA 4L9TA 4DR7H 3FXQA 1ON1A 1F9NA 2P7CB 4JI7H 5DEQA 1O7LA 1GYFA 1X3UA 1ZAOA 2Z33A 2DPUA 3GZ5A 2VPSA 4KN4X 2CSOA 1K78A 5FGMA 3FMRA 1HKSA 4HLXA 2A6EF 5L3GA 1P6RA 1LEBA 4IHTA 5L3EA