3FKIG

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 20
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fkiG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3fkiG01
1XTDA 2N49A 1NBWA 3CXCA 1N32L 4JI5Q 1Z47A 4B3RQ 1YEZA 3CC4A 1GKHA 4DR2L 1JE5A 4UPAA 3GTJH 4A93H 4LF6L 2HHHL 1HR0Q 1A62A 2LSSA 2A19A 1N34L 5LMUL 3EBEA 2WP8J 4MTNA 5IE8A 4A4IA 4OWTB 3L7ZC 4GNXC 3T1YQ 1XMOL 2VUMH 2JA5G 3D31A 1VQCA 3RN5A 4BBRG 2Z6KA 1RIPA 5GROA 3HOVG 4OWXB 1YIJA 4MZ9A 2JJQA 1S40A 1PH9A 3T1HL 4HJ7A 4R4TA 5JEAJ 2QA4A 2YV5A 1X54A 2B29A 1UE7A 3A0JA 4P75A 2NVYH 3PF4A 2YYZA 3GTLH 2UXCL 4XTCS 1WFQA 4PG3A 2UXBL 1QUQA 3JAMi 5IYDH 4YY3L 3ZJYC 2I5LX 2R7ZG 3KF8B 4A3IH 3U50C 3KOJA 1A0IA 4DV6Q 1PA6A 3G48A 1PH8A 1VCIA 4DR5Q 1MJEA 4JG2A 1XPRA 4DR6L 3S2HH 5FLXc 4IO9A 3CF5A 3F8TA 4KHPQ 3HOYG 4JCVE 4YWKA 1FJGL 4KI0A 2VQEL 3L0OA 4TQUS 1K8GA 3A5UA 4IFDG 4B3TL 4QGUA 4HIMA 4DAMA 1XNQQ 1Q82C 4X62L 1K83H 3J81i 4A3KG 1VQ9A 4A3LH 5FJ8H 1P16A 3G4SA 1GVPA 5LMNW 2BH2A 4DV7L 3K7UC 3D0FA 1N33Q 3F1ZA 5IYBG 2OWOA 3E0EA 1Y1WG 3M4OH 1HNWQ 3NENA 1SMXA 5E7NA 4C3JH 4DUZL 1EYGA 5IP7H 4X6AH 2LXJA 3S14H 4AQYL 3CW2C 4PZ8A 1E1TA 3M4QA 1Q8KA 1IBLQ 1V9PA 4H02A 1VQEA 3S1NH 2R93G 2AWNA 2N3SA 4HJ8A 3PO2G 2MO1A 3GTGH 3F2DA 3RR5A 1AE3A 3HOUG 1Q1BA 3J7A5 2Y0SG 3CD6A 4JC0A 4QY7A 4JI7Q 3KJOA 2K52A 3HOXH 3ER0A 3Q8DA 5JJKA 2C35B 2HHHQ 4A93G 3HOWH 1B7YB 4DKAC 2E5LL 3KJPA 5M5XH 1H95A 2IX1A 2UXBQ 5HY6A 1IBMQ 3PUWA 3OTOL 3KLWA 3S17H 4IPHA 1C9OA 4KHZA 3G71A 1C7YA 4PZ7A 3I4NG 4LFAL 2I0QA 3AQQA 2VNUD 4B3SQ 1HZBA 3TRZA 3PCOB 2NN6G 3JC66 2Z0SA 4DV4Q 2UUBL 2UUAL 3KDFB 4A3CG 1X3GA 4DR3L 1X9NA 1QZHA 3EIVA 2NVTH 4JI5L 4DAYB 1R9TH 1VQ8A 1JJCB 5DLQE 3CCEA 3H3VH 4B3RL 3H15A 4OX9Q 1B8AA 2XTIA 2K5NA 2GVAA 1W3SA 1XPUA 4BA2I 4GN3B 3ULLA 1VQIA 1YJ9A 4O0AA 3PUXA 4NXML 4UY8C 3ERSX 4A3EH 3FHWA 3PIOA 1YHBA 1BBWA 1PH7A 2PMZE 4QJFA 4BXXG 1EWIA 1HZAA 2QGQA 4BBRH 1PYSB 2K5VA 4A3DG 5JJLA 4GNXA 3BZCA 4EX5A 1VQOA 2N8NA 3KYHC 1QUQB 5GAGC 2I5HA 2BA0A 3GD7A 1NY4A 1XMQL 1B70B 3T1HQ 4R4CA 5C4JH 1QZGA 3HOUH 3M3YH 1HNWL 3I7FA 1XPOA 1VQNA 4DR2Q 1NJIC 1OXUA 2RHQB 2VQEQ 2KBNA 3GTKH 3S15H 4OONA 3E9HA 1N36Q 4A3GH 4GKJL 5C0XG 4NB3A 3DM3A 1G291 2NZHA 1CKMA 4AH6A 2E2IH 1HZCA 4A3FG 3K7AH 1YJNA 4LF9Q 1XJVA 1I3QH 1O7IA 2WB1E 1Y1WH 1VQPA 4J15A 4P72A 3S1MH 3GTPH 2R7DA 4PZ6A 4NXNL 1ASYA 4LFCQ 2WB1G 1HH2P 4BXXH 3H0GH 4Y52H 3PV0A 4JYAL 2IT1A 2OCEA 4OXPA 3T1YL 2Y0SE 4KHPL 1E22A 2GVBA 3RLOA 3RNUA 1S72A 4DR5L 4LFAQ 1JJGA 4B3SL 4JI8L 4JBKA 1SE8A 2ALYB 1V43A 3KF6B 4R4QA 5M3MG 3CCJA 3CCSA 4DR1Q 2ZM6L 4YY3Q 1I94Q 4X65L 4HIKA 3RN2A 1KC8C 2VUMG 3K0XA 1IZ6A 2NN6I 4A75A 1K9MC 3BZKA 3FKIG 3CCUA 4DV6L 1YI2A 2R6GA 3PUYA 3UE1A 4EQ5A 3U4ZA 3J81j 1J5EL 3CMEA 1YITA 1IL2A 4LW1A 1Q46A 5BR8L 2R93H 2R92G 4JV5Q 4UP8A 1L0WA 2JA8G 5M5WH 4DR7Q 4BY1H 4DV5Q 5C3EG 4LF5L 4GS3A 1JJ2A 5M3MH 1Q81C 3UE0A 5AJ3L 5GAHC 1N32Q 2KCTA 1EIFA 4DUZQ 3PO3H 2R7FA 3PUZA 5C4XH 5ELOA 4HJ9A 4Y7NH 1V1QA 1WCMG 1HZ9A 2ZJPA 3HFZB 1VQMA 4JI0Q 3HOYH 1VQ7A 2FXQA 2EQSA 5C44G 3UDGA 4DV7Q 1X56A 4YHHQ 1HNZQ 4L5SA 1J6QA 4ALPA 4L5RC 4GKJQ 4POFA 5IWAQ 1IBKQ 2IHEA 2PQAB 2ZJQA 1NTGA 1EIYB 1OXSC 4DV1L 4YWLA 2QEXA 4JI6Q 4DNIA 1X6OA 1E1OA 4POGA 5K36G 1QVCA 4P71A 1I50H 3B6YA 3STBC 1EOVA 3CCRA 2NVQH 2F52A 3CP0A 2JE6I 3I4OA 5IYBH 1A8VA 1P8LA 2B3GA 2K75A 4JI1L 2LXKA 1KD1C 4LF8L 1NE3A 4IOAA 5H1SE 1VQGA 4AQYQ 3K81C 1OTCA 3S1QH 1KHIA 3CC7A 4R1JA 4QQBX 2D62A 3SGIA 3JAMc 1Q12A 5C0XI 1N9WA 4JI8Q 2WAQG 1PH3A 4GOPC 1I5FA 2UU9L 3BJUA 4LF9L 3UDXA 3GTMH 1T9HA 1EQRA 1L2FA 3KDFA 2WAQE 2KENA 2JK8A 4DR6Q 2E5LQ 4BBSG 1N8RC 2HQLA 1PHJA 2YTXA 5FJ8G 4DV2L 4C2MH 1XNRL 1BBUA 4HJ5A 4A3JH 4DR7L 3CPWA 1Q1EA 1WCMH 3L2PA 3S2DH 2Z6KC 4C3IH 1WYDA 4DK6C 3GDEA 1M1KC 4LWCA 3ULJA 3S16H 3I56A 3I4NH 4X65Q 5M5YH 3RLFA 1UE5A 4A3MH 1K73C 1UE6A 1N33L 2B63G 5C0XJ 3ULPA 4BA1I 3H3VI 1PFSA 3UDFA 3TS2A 4DV0Q 4HIOA 5M3FH 1LYLA 4JOIA 1SR3A 2RHSB 4LF7Q 1G6PA 4GN4B 3CPFA 1X65A 1SRUA 3AFPA 4QL5A 4TVAB 4A3DH 2N78A 2ZTDA 4LUZA 3K80C 4P73A 5C44H 4LF4L 1OXXK 1YHAA 4NPSA 2I5MX 5IP9G 4GLXA 5GQOA 1HJPA 1VS0A 4ME3A 4X66Q 2VY3A 2ES2A 1SN8A 3A5ZB 1Y1VH 1VQFA 5IY0A 3OW2A 2UUCL 4GLAC 2ZM6Q 2VQFQ 1CKOA 5M3FG 1VQ4A 2ZTEA 1I94L 2D0OA 2JA8H 1PH2A 1E7ZA 3S24A 4JI3Q 2OTJA 2UXDL 3HOXG 4A3JG 2JA9A 3TQYA 2F4VQ 4C3HH 1X3EA 5ELNA 1J5EQ 4WJ3M 1TWHH 2JA5H 4OO1G 4YCWA 2HIXA 2WFWA 1VQLA 2JA6H 3NEMA 5C4XG 1YNXA 4DK3C 1VQKA 4JI2L 4K0KQ 4DV5L 4LF5Q 1KRSA 4JI0L 3CQZH 4JOIC 4A3IG 4DV3L 2BA1A 2OQ0A 5BR8Q 2ZTCA 4HIDA 1AH9A 1LUZA 1VQBA 2CQOA 4IPDA 1CSPA 1GM5A 1TWCH 3U58A 4LFCL 1ASZA 4YHHL 3CCMA 3MXNB 2VZAA 4A3EG 1L1OB 2E8GA 4JV5L 1XMQQ 1PH4A 1D7QA 4DV1Q 5EAYA 1TXYA 4JBJA 4DV2Q 2NVXH 3I4MG 3M7NA 3CAMA 2JA6G 1IXRA 5AJ3Q 3E9IA 4MNOA 4DR1L 2IY5B 2JA7H 1YVCA 1SROA 3F2BA 1RL2A 3PIPA 2R7ZH 3KFUA 4OO1I 1PVOA 3M85A 1LTLA 4JBWA 3HKSA 3A74A 1FVIA 1WOCA 2JEBI 3WWVA 4GOPA 1TWGH 1NMGA 5IWAL 3J80i 1IBKL 4LUVA 3CC2A 2CKZB 3G6EA 3I55A 2HIVA 3NBHB 1KQSA 3I2ZA 3CCVA 4JI3L 4A3BG 2UXDQ 4R4IA 2JA7G 2R92H 1LM0A 4LFBL 5IYCH 4UP7A 4GKKQ 1HNXQ 4IPGA 4B3MQ 3J80c 1TWAH 1NMFA 1M90C 1K3RA 1JT8A 1DGSA 1HNZL 1PYBA 3J7ZC 2ID0A 3VDYA 2MQHA 2IHFA 1VQJA 4PMWA 5GAEC 2B63H 2NZOA 1N34Q 2Q2IA 3W1GA 1Q7YC 3HOZH 3F2CA 2UU9Q 4JI6L 2ZJRA 1XNQL 1OXTA 3CMAA 2A1AA 3I4MH 1X55A 4HJAA 2L15A 1JMCA 2YTVA 1MIUA 4IJHA 1FGUA 2VS1A 4GN5A 4JI4L 3BU2A 3NELA 2Q2TA 4JI1Q 4KLKA 2AHOB 1Y14B 4LF4Q 3STBD 2K50A 1A63A 4LF7L 2AMCB 3HKZE 4X64L 5LMNL 4K0KL 1JB7A 2MO0A 5FLMG 1AE2A 3CCLA 4LF6Q 1I6HH 2H5XA 2Q2HA 2PI2E 3J81c 1KIXA 2HT1A 3HOZG 4DR4Q 2CWAA 1IBLL 2KHIA 5IT9c 4IOCA 3PO3G 2MFIA 1BVSA 2D0PA 1FL0A 4LUOA 1WI5A 1HR0L 4JI7L 2CCZA 4XIGS 2DUDA 5LMUQ 1EQQA 1X3FA 2GN5A 3DLLA 2VQFL 1YZ6A 4BY1G 4DUYL 4AYBE 4LF8Q 4A3CH 1HR0W 1VQDA 1Z9FA 4DV0L 2AKWB 3PSIA 4A3MG 3M9BA 4X66L 1W2BA 1K8AC 2OQKA 1CKNB 2AWOA 1SLJA 3CCQA 3TEHB 2EIFA 3S1RH 1MJCA 1MKHA 2PNHA 3PUVA 3TS0A 4B3TQ 2KCMA 5J3BA 1KAWA 3HOWG 2CWPA 5HGQA 3GTOH 4X62Q 1L1OC 3EN2A 5IP9H 1TWFH 2PQAA 2MNAA 2F4VL 4YCVA 4AIMA 2OTLA 1KL9A 1D8LA 2JQOA 1VQ5A 4NXMQ 3PO2H 1XNRQ 4WJ4A 4BY7G 5IYDG 1QVGA 5IYCG 1UWVA 1VQ6A 3H0GG 1FJGQ 4APVA 3RLNA 2K5HA 1Y1VG 4IJLA 3K8AA 3TREA 4GLVB 1WJJA 1PH5A 3HKZG 4JBMA 1YHQA 4RG1A 4DV3Q 1GO3E 1CKNA 4DV4L 1G51A 1BKBA 2UUBQ 1HNXL 4B3ML 1U5KA 2F3IA 3AYHB 4A3FH 1SFOH 2Q2UA 3GTQH 1S3OA 2A8VA 3W1BA 2ATWA 3KF6A 1EUJA 4AYBG 2KHJA 2VL6A 3UDIA 4BY7H 4A76A 2UUCQ 4IPCA 3PF5A 2JEAI 4DR4L 4RMFA 3M4PA 3FKIH 3W5OA 1GD7A 2XGTA 1XMOQ 4OWWB 3MEFA 4GOPB 2K14A 1PH6A 4P74A 2ASBA 4BBSH 1VQHA 1Q86C 4R4OA 4L5TA 1PH1A 3ICEA 4IFDJ 2V1CC 2RF4A 3AEVA 4UP9A 1VQAA 1L1OA 5C3EH 4JI4Q 2PI2A 3PGZA 2VW9A 1UE1A 4LFBQ 3LGJA 1E3PA 4YWMA 4JI2Q 1IBML 3OTOQ 4JYAQ 5GADC 4A3KH 4A3LG 1UEBA 4LNQA 4DPGA 2UXCQ 1KXLA 4QIWE 4OX9L 2IX0A 3OYYA 1CUKA 1YBYA 4X64Q 5LMNQ 3HOVH 1IYJB 2YTYA 4FDBA 3RZOH 3FP9A 2BH8A 3IRBA 1N36L 4GKKL 4GNXB 1K0RA 2EXDA 1OXVA 4YCUA 5IP7G 1CSQA 3U4VA 2K4KA 4O2DA 1EFWA 1QVFA 2DGYA 1E24A 5FLMH 4L5QA 2CFMA 3AFQA 4NXNQ 2UUAQ 4A3GG 4IFDI 5JJIA 4DR3Q 4DUYQ 1U0LA 2RCNA 5JEAG 3RZDH 4A3BH 1C0AA 2E2JH 3GO5A 1YJWA 2YU9H 2E2HH 1KRTA 1PV4A
chains in the Genus database with same CATH superfamily
1XTDA 2L9HA 1A9XA 4TQRA 2XIGA 1GUGA 1N32L 3M9OB 3OSPA 4B9WA 3MXUA 4KN4C 3JSNA 1PXUA 3CC4A 3OIPA 2KHSA 1HR0Q 4OELB 3L4KA 1KC7A 1FD7D 5EDWA 4C1NI 2VR1A 1TVXA 4FXGC 5CV9A 2ZM6H 4H0LC 3K0YA 1XMOL 1EZ6A 2VUMH 2K32A 5K2MA 5M3FB 2Y0SB 1LTAD 1E4FT 2Z6KA 2HHHH 2ALZA 4OWXB 2J9GA 1GUWA 1YIJA 2R93B 2JJQA 4U68A 1J8IA 5JEAJ 4UCVA 2XWJB 5LYJF 2NVYH 2YYZA 1Y1VB 5CC4A 3VPBA 2UXBL 3MZ5A 1QUQA 4ECYA 3PW4A 2W9AA 2JA8B 3KF8B 3C1FA 3Q6SA 4J9KA 1Z7TA 1A0IA 4JG2A 1XPRA 1Y8NB 2X6GA 5FLXL 3S2HH 4G57A 3F8TA 3OUUA 3OIQA 3HOYG 3RGXA 3KHRA 4X3SA 1FJGL 3AMUA 3HKZA 1K8GA 3SHLA 5C1OA 4CDDC 4IFDG 5KFEA 4R8IA 3Q0AA 3H4DA 3PW5A 1XNQQ 1Q82C 4X62L 1ESFA 3J81i 5CORA 5FJ8H 3G4SA 1GVPA 4ZLTF 2YYAA 3NGDA 4XYLB 2OWOA 3L9AX 2GLTA 1HNWQ 2RDGA 3MXPA 3M4OH 5KFPA 1EY5A 1SMXA 2CW0C 3NENA 5E7NA 4C3JH 1K0SA 1TWGA 1GLVA 2LXJA 4TKOB 1AUVA 2DLNA 4PZ8A 1HUMA 2C2EA 4FO2A 4MV1A 3PO2G 1R4QB 3GTGH 3QR8A 3LWBA 1AE3A 2Y0SG 4DV0H 2CW8A 3CD6A 3GTMA 4QY7A 2MCTA 1NNXA 3HOXH 4XYQA 3ER0A 3Q8DA 1KTKA 4IURA 5JJKA 1JICA 3NQTA 3C2PA 2YU9A 4PNYA 2E5LL 3R23A 3KK7A 4ZUJA 2YZNA 3MA2B 1IBMQ 3PO3B 3PUWA 3OTOL 3S17H 4RGTA 1L0YB 2I0QA 3AQQA 2HJWA 3GIIA 1HZBA 2QKIC 4KV6A 2NN6G 3ETJA 2RQXA 2WINB 2UUBL 3VMMA 1CE8A 3JZIA 3BA8A 1B50A 1X3GA 1X9NA 1BR9A 1C48A 4FF2A 3H3VH 1KJQA 3PW7A 5DGBA 4OX9Q 1B8AA 1FJGH 2K5NA 4MIUA 4ABNA 1PZKD 2R7ZA 3ULLA 1VQIA 3PUXA 2DJFC 4A3EH 2K6AA 4ETSA 1BBWA 2FMAA 5IGDA 5CGKA 1PH7A 2PMZE 3R5HA 4BXXG 1HZAA 4BBRH 2B2VA 1PYSB 2K5VA 2Z4HA 4EX5A 5KFGA 2N8NA 3KYHC 5ELDA 1QUQB 4MV4A 5GAGC 5KT7A 3T1HQ 1S5ED 3HOUH 3M3YH 1VQNA 1KDBA 4QIWA 1F9SA 1ZYRD 2RHQB 2OEOA 4RAUC 1ZYRC 1RF2D 4OONA 3W2DA 1N36Q 2TMPA 3KAKA 5COYA 1G291 4OO1H 1B3AA 2HVRA 5I6YA 4DR1H 1YJNA 1XJVA 2A6HC 3WOFA 1Y1WH 1RD9D 3RZDB 1VQPA 4J15A 4P72A 3KF8A 3GTPH 2E2HA 4LFCQ 4NXNL 1JOQA 2I07B 2PZUA 3Q22A 3GLKA 2IW3A 4G7OC 2OCEA 5HBRB 1HQMC 1K83A 4HMJA 4RB1A 4YR3A 3RLOA 4DFAA 2OLSA 1JJGA 3RB6A 4B3SL 4JBKA 1S68A 2ALYB 2EJFC 3KF6B 4M8AA 3GQBA 2UVUA 2C9OA 1KC8C 1TY0A 4C5AA 1IZ6A 4XQQA 2NN6I 1SNMA 1XYIA 1HTPA 4MV9A 1YI2A 4M7EA 1W6JA 1PYWD 2SNSA 3U4ZA 4A3DB 1W96A 3CMEA 2NUCA 4GKJH 4UP8A 3GIPA 2SNMA 4DR7Q 2R7ZB 2B2UC 4IAJA 1GUNA 1MGSA 1O78A 1FKAH 2W6NA 2F0SA 3UE0A 5M3MB 2ASDA 3DXJC 2GPWA 5FLXE 4YY3H 1EIFA 3EQLC 4KKSA 1K8MA 4HJ9A 4TV8F 1HZ9A 3A56A 4BY7B 5C44G 1X56A 3S2HB 4GKJQ 3MWDA 2IHEA 2PQAB 2WV6D 1HRJA 1OXSC 4DV1L 4YWLA 2G5DA 5CAEB 1F2ZA 2FHTA 1E1OA 5I6WA 5ELCA 2F52A 2R84A 1A8VA 1KD1C 2K75A 2LXKA 1VQGA 1KHIA 1CS0A 1SDFA 2K04A 1Q12A 3Q24A 3KTMA 3OMCA 4JI8Q 4N8X1 4K6DA 3V6KA 2PO4A 3GTMH 2JXMB 3KDFA 3QIAA 5KT5A 5LL6b 2IL8A 1PHJA 2R6FA 2DN8A 2NBFA 5FJ8G 4K6LA 1O75A 1I50A 2XRSD 1BBUA 3NBHA 1U4RA 2UXBH 4E6IA 4GZYC 5F2DA 3S2DH 1X3PA 4KK7A 4DK6C 3Q2OA 1WYDA 4LF9H 2VUMA 1M1KC 2NVYA 5KFOA 3MR3A 5EKIA 3I56A 2Z6BA 2XCPA 3MFHA 2EXZA 5M5YB 1K73C 3RUPA 5BPHA 4A3MB 1S5CD 3H91A 3SK8A 1AZQA 1FR3A 4JI6H 5CV6A 5C0XJ 3MWEA 2A5HA 3ULPA 2FB9A 2EPBA 4DV3H 5ELEA 2I46A 1K28A 2OT2A 2NU9B 1PFSA 3UDFA 5JH7F 4DV0Q 3T53B 5IT9L 4Z9CB 4MTEA 1KLGD 4A3DH 1SRUA 4KHVA 4TVAB 2WKCA 4DL7A 2N78A 1S4ZA 1B6RA 5E4WC 3K58A 5KT3A 1ESRA 2I5MX 4UFZA 1HJPA 3EJIA 1YNJD 5KFZA 1UEAB 2VQDA 2ES2A 2HCIA 1Y1VH 1STHA 2LMCB 3N43B 5CV5A 2MUYA 2UUCL 2VQFQ 1CKOA 1VQ4A 2ZTEA 1S0NA 3ND9A 1H9KA 2OTJA 1DXMA 4ZQ3A 5JEAH 3BG3A 5KG6A 1J5EQ 4WJ3M 4EBDA 2CW0D 2JA5H 2FMMA 1VQLA 2JA6H 2F0KA 3SR1A 1Z2OX 4DK3C 1HNZH 4K0KQ 1STYA 4IUQA 1VF7A 1N48A 3CQZH 5LOVF 1OWTA 5EBDA 4I7HA 4DV3L 1NCVA 4HSVA 2ZTCA 1K83B 4CHTB 2GA4B 1VQBA 4RUCA 2CQOA 4IPDA 2O4XA 2C22A 3U58A 3HXLA 4MV7A 3KUPA 3EFXD 3CCMA 3MXNB 4EGQA 4HCEA 3MFGA 5IGCA 2DPIA 4DV2Q 2NVXH 4FM9A 2KEEA 1H9RA 3G6XA 1IXRA 4MTDA 5KIXA 1DOMA 4B3SH 1ICFB 3C1EA 1UNNC 3E9IA 2IY5B 3HZXA 3PO2B 2R7ZH 2P5ZX 3KFUA 1PVOA 3TDQA 3M85A 1LTLA 1R4PB 1VF5C 5I9OA 5EOYA 5JUMA 3DF7A 1FVIA 1SNCA 2JEBI 2ASLA 1NMGA 1NR2A 4QW8A 2LY7A 2B8FA 5D1PA 4MN3A 3CC2A 1WVLA 1LLRD 4X3KA 4YHHH 4A3FB 5L1LA 1ZHQA 3S17B 3RBDA 4JI3L 3GQCA 3SEBA 1IBLH 4IZ8A 4EFBA 2K5WA 3NBIA 5C5MA 2XCLA 4R9WA 4MV6A 2E2DC 2RA4A 4ECUA 5K36H 1T5XD 1PYBA 3J7ZC 4NKLA 3R8BA 3NE5B 2NZOA 3A54A 3GIJA 2IJ0A 5EWGA 3F2CA 4A3EB 1DOKA 4JI6L 4KHPH 5FO7B 5T1IA 2ZJRA 1OXTA 2A1AA 3I4MH 4F4XA 4F7XA 1FGUA 3PVXA 1Y1WA 3K5MA 1QNKA 2AHOB 3HOUB 3M3YB 2MHVA 5HV6A 5CA0F 5LMNL 4H7BA 3GTKB 2MO0A 1B04A 4LF6Q 1TS5A 2H5XA 2PI2E 4DR4Q 2HT1A 2F0PA 4UCOA 5KX5F 2AQ4A 2K03A 2UUCH 3MFYA 1BVSA 1WTQA 1FL0A 4LUOA 4AQYH 1DOLA 4XIGS 4YQWA 3AU7A 1EQQA 3HBLA 4L6TB 4KMUC 4WD3A 1TU2B 2VQFL 4GC7A 1M4VA 2BDNA 4AYBE 4A3CH 3U9TA 3T1HH 3QWNA 1Z9FA 2SDFA 3PSIA 2R8GA 3M9BA 1GSHA 1W93A 3T1YH 5KT6A 2AWOA 3CCQA 5CV7A 4B3TQ 1MJCA 2PNHA 4F4YA 3S1RB 2KCMA 4G7ZC 2HCCA 2CWPA 1T36A 4ZQIA 2J7ZA 2F4VL 2H4OA 1F9RA 2JN4A 2B39A 1JKJB 1D8LA 2JQOA 4WJWA 3BAAA 3P75A 2ZDQA 1X32A 4DR6H 3MR6A 1RTNA 5EKKA 1HFGA 4ZI7F 2QILA 3FRPB 3R2IA 4DUYH 1I7LA 4IJLA 3VYSA 2F0DA 1Y1VA 2C28A 5KT4A 4FBTA 2FINB 2LFNA 4DV3Q 4NDXA 3HKZB 2UUBQ 1WSCA 2F0MA 2VQEH 3GTQH 3DEOA 2IMWP 1E2VA 1S3OA 1T3NA 2ATWA 3X3NA 3KF6A 1KJIA 4AYBG 2A6ED 2UUCQ 3PF5A 3A55A 4NXMH 4RZRA 3M4PA 2XGTA 3NK9A 4OWWB 4GOPB 4P74A 2ZXOA 1PRTF 4BBSH 3N52A 3BJYA 3KHHA 1WD1A 5IOCA 2QDLA 3VYTA 4IFDJ 4J9OA 2RF4A 5JVG3 3QG1A 2PBZA 1VQAA 3LP8A 1U9RA 3D4DA 4JI4Q 4LFBQ 1E3PA 4YWMA 5C0XH 1LABA 5GADC 4JYAQ 4A3LG 4YAKB 3K5NA 4QIWE 3RZOH 1FYCA 5HGTA 2BH8A 4GNXB 1KLUD 3SDZA 3E5SA 5KFHA 2K01A 3MC0B 1CM9A 4EQNA 1WTHA 2XSCA 1QB5D 1EFWA 2DGYA 4EYIB 1SEBD 4NXNQ 4A3GG 2FK1A 3BZDB 4EVOA 2YS6A 4RKLA 2JEIA 5FD5A 5JEAG 4HYKA 2E2JB 2J6SA 1JXLA 4A3BH 1C0AA 4RB2C 2L55A 4QIWB 1YJWA 1NUCA 1MI2A 2YU9H 1F2YA 1PV4A 3S2DB 2OH2A 4JI5Q 4OEMB 1Z47A 1CQIB 3BVMA 3NWSA 4GKKH 4CBVA 5DM63 1JE5A 5K5PA 3GTJH 3BABA 1A62A 2LSSA 3VR5A 2K05A 2RGVA 5DG7A 3EBEA 2R86A 3H0GA 1NR4A 1EZ8A 4RZQA 4OWTB 3L7ZC 5TSSA 4FVMA 3D31A 1VQCA 3RN5A 3MXGA 4BBRG 3HOVG 3K57A 3GTJA 1Q3LA 2QF7A 1DJRD 5CV8A 1PH9A 4O4LF 4AYBA 4XT1B 1HCZA 2QA4A 1ILPA 1EY0A 2KOLA 1HPCA 3A0JA 3GV6A 4P75A 3PF4A 2KCNA 3DWQA 3E6ZX 1S5FD 1DONA 3UQ8A 5BN4A 4ECWA 3ZJYC 2I5LX 2R7ZG 4QWEA 3VR4A 4A3IH 1BNZA 3CQZA 1I4HA 1PH8A 3KLRA 1EWHA 1VCIA 4EFEA 4ZUIA 5IGEA 5FLXc 4IO9A 3VR3A 5LL6X 4KHPQ 3OWFA 4KKUA 4DK1A 3Q23A 4XYMB 2VQEL 3A7AB 2WAQB 2W9CB 2EY6A 4IUPA 4B3TL 1YNJC 3P7JA 5T14A 3E0JA 4QGUA 4X65H 3H0GB 2UUAH 2F0EA 3GP7A 3TN2A 2F3WA 1UAPA 3RAXA 1K83H 4YBZB 1TWCB 1V4YA 3EPIA 3H94A 2HGSA 2H1EA 4DNRB 2Z9HA 2ZJTA 2R7KA 4OIKA 1EYGA 2YS7A 1SJED 2DPJA 2PZWA 4X6AH 5E1FA 2NVXB 4V190 1KDCA 3S14H 3MR2A 1N56A 3L4JA 1HR0H 3S1NH 1B6SA 1V9PA 4H02A 1VQEA 2R93G 4IR9A 1BCPB 2MO1A 2Y0SA 4RCNA 4C2MB 5M5WB 2NU8B 2B2VC 3HOXB 1PTOF 4K5VA 4JI7Q 1IYVA 1SXTA 2K52A 5J2TF 5KFAA 5KFFA 2FLPA 3X3MA 2HHHQ 4A93G 1QOHA 1B7YB 3OW7A 4CDEC 3KJPA 1XX8A 3FKIA 1BDOA 1KEEA 3NHHA 4S3SA 3OHBA 4IPHA 1C9OA 4Y7NB 1WD0A 4YJ2F 3PIP3 1MSHA 4LFAL 3TRZA 2BQ3A 3G7LA 2M00A 3PCOB 3JC66 3R3OA 2Z0SA 5CMDA 4DV4Q 4LMYA 1BCPD 4A3CG 4DR3L 5KFCA 3MTSA 1G91A 1SNQA 1R9TH 3TIGA 4B3RL 3CCEA 2XN9C 3UFXB 1XPUA 4BA2I 3LMLA 4C5BA 2KJXA 1YJ9A 1SE2A 4DR4H 3FHWA 4R8NA 1OO9B 1BO0A 3ORQA 1BNCA 4QJFA 2E2IA 1GUTA 1E2ZA 1EWIA 1LT5D 1VQOA 1I3QA 3Q8SB 4F4ZA 2PYKA 3HRZC 3DWPA 3GD7A 1XMQL 1QZGA 4A3IB 4R4CA 5C4JH 1S5BD 3IL8A 3I7FA 1XPOA 1OXUA 5KKNB 4G7HC 3GTKH 3NSWA 1PRTC 4BWGB 5C0XG 1EY8A 4OIJA 4GKJL 4K8IA 1WTXA 4AH6A 1HZCA 1RHPA 4LF9Q 1I94H 2A68C 1I3QH 5EQ0A 1D6EC 1O7IA 2WB1E 1M7JA 2B8GA 3CQZB 5KG5A 2WB1G 1HH2P 3H0GH 4K8JA 4JYAL 4OXPA 4LF5H 4LF4H 3N40P 1JWSD 4ODGA 1BJTA 2GVBA 4ZHQF 1ZKOA 2MP1A 5BR8H 3GTQA 1AN8A 4NXNH 5M3MG 3J7YW 1I94Q 2G9DA 3FMCA 4X65L 2VUMG 2D2CC 2L5TA 1IL8A 2F0VA 3FKIG 3CCUA 5D1OB 1CT1D 3J81j 3UE1A 1SYFA 4LW1A 3P20A 4UCTA 2BR0A 4BY1H 5BN3A 3HP3A 4HR7B 5C3EG 3MFIA 1HUNA 4GS3A 3GTLB 1LTID 5M3MH 1Q81C 3J7AF 5AJ3L 5GAHC 4JI4H 1Y8PB 1RK6A 3C3LA 2DJGC 1Q90A 2RCFA 2CQAA 3PUZA 5C4XH 2V58A 4FS2A 1PTOC 1V1QA 1STEA 4JI0Q 3HOYH 3GV3A 4RB0A 2FXQA 5KG1A 1UC8A 4ALPA 1WH2A 4POFA 3P1HA 2WB1B 1TWFA 1MSGA 4DXGA 1NTGA 2OXPA 2ZDGA 4ULLA 4JI6Q 4K2LA 4DNIA 3DEPA 5K36G 4PV1C 4P71A 4C2MA 1STAA 1JIHA 1EOVA 2UUBH 1FNUA 3HOZB 3D8GA 1P8LA 4LFAH 3T56B 1S10A 4OHJA 1NE3A 5T1GA 5H1SE 1PX2A 3S1QH 1EYZA 2HQEA 3CC7A 4MHEA 3N42B 1JCKB 3SGIA 5IWAH 1EHIA 1IBKH 1N9WA 2X6LA 4GOPC 1PH3A 2UU9L 2NVXA 5BPFA 1T9HA 4HR7A 4ZK9B 4CJ1B 2WAQE 2KCCA 5A2QL 4RGOS 1LT4D 4J0MA 4F88A 2E5LQ 4LFBH 3NWTA 2E2IB 4CGYB 2JA7A 3SXHA 2PPBC 4K2KA 5D1OA 4HJ5A 1Q1EA 3R2TA 5C5JA 4EBCA 3J7AK 2NZ1D 4LF7H 3IN5A 1WCMB 1EWCA 3L2PA 2Z6KC 3U9OA 4C3IH 4FYDA 3K6OA 4ILWA 2UVWA 4LWCA 3GIDA 1LTBD 3ULJA 2Z8LA 3WOEA 3I4NH 4TUYF 4HNUA 5M5YH 4KD4A 1UE5A 5H80A 3KXYT 1XNQH 1T94A 1N33L 1R9TA 3TS2A 2ZDHA 1SYCA 1SYEA 4JOIA 2RDIA 1SR3A 2KQ3A 2WB1A 2AGQA 2R82A 4O4IF 5LA6F 3Q8RB 3CPFA 1X65A 3AFPA 4QL5A 1GHKA 2F0HA 5C44H 4P73A 1UNSA 2Q8IB 4GLXA 5GQOA 4K0KH 3J80L 3T5LA 1PTOB 2VY3A 5KFBA 3A5ZB 1VQFA 1O80A 3IG0A 5IY0A 3OW2A 1I94L 2JA8H 2QCPX 2D0OA 3I72A 2KSWA 3I90A 2IPKD 3HOXG 4F50A 5EPJA 3RB3A 2M2LA 3TQYA 3BS1A 5JPNC 3KALA 1X3EA 5KG0A 2W6OA 2PVPA 4OO1G 3VPDA 1ENAA 4WORA 1XMQH 5C4XG 1SFOA 1VQKA 5L37A 1HA6A 3SE0A 4N9PA 4O2BF 2VB2X 1I50B 2FK2A 3DHQA 1QCBD 2FE3A 4OX9H 2NVQB 3ZYYX 1A6XA 2X69A 1AH9A 4HIDA 4JI1H 2ZXPA 5LL6S 2VA2A 2JP1A 1C3OA 2WKDA 4HTHA 1ASZA 4QUCA 3QO2A 1VMCA 1CA5A 4A3EG 3M4OB 3OMGA 4FF3A 1XMQQ 1SNDA 2A6HD 3R5XA 2FJ2A 4DV1Q 4O4HF 3PR4A 5LMUH 4MNOA 2O5JC 1YVCA 3J81W 4G3IA 2F4IA 1LV9A 4BY1B 4HEDA 3I91A 1JWUD 4EQOA 2VQFH 2AQ2B 1SAPA 3M4IA 3A74A 3WWVA 4CKCA 4GOPA 1IHZA 1TWGH 4ECTA 1C4QA 4L8JA 5M5XB 1I4RA 4LUVA 1HQRD 2L4NA 2NU7B 4M9UA 2IX3A 2HIVA 3I55A 1KQSA 5FPOA 2UXDQ 4RFBA 1XXGA 2JYOA 1LM0A 2DIKA 2PW5A 3D4WA 4GKKQ 1BGWA 4IPGA 4RNOA 5IGGA 4HNVA 2A73B 1K3RA 4G4KA 4XYOA 1VDZA 3J80E 2SEBD 4IZOA 3SK6A 2R3ZA 1N34Q 2JEGA 2Q2IA 4CJ2C 2M9VA 4O3PA 5J39A 1MZBA 4ED7A 2OF1A 5C3WA 2K33A 4HJAA 2L15A 2VB3X 3BYYB 4IJHA 3TP5A 1K8OA 4GN5A 3BU2A 3NELA 1SSOA 4JI1Q 1ML0D 2EY1A 1DIKA 2K50A 4J6HA 1B53A 5L1JA 4X64L 1WTOA 5FLMG 3CCLA 1I6HH 1S9FA 1FNVA 3J81c 3QFFA 4A3GB 1IBLL 1KJ9A 1DV1A 2KHIA 3K7AB 4IOCA 1PK8A 2F4VH 5A35A 2MJ8A 5IGBA 1GSAA 5CBAE 1HA5A 2D0PA 4FBUA 4FU0A 1FNWA 2K5DA 1ICWA 4JI7L 1XMOH 1CQVA 2EYHA 2E75C 2DUDA 5C5LA 2F03A 3RB0A 1X3FA 3I4LA 4BS9A 5KFLA 4J9SA 1HR0W 1VQDA 4DV0L 2AKWB 2TSSA 4A3MG 1PDQA 1G2TA 2C2DA 1W2BA 4IFDH 1K8AC 1CKNB 3VYUA 1PRTB 4UCRA 3S1RH 5FO8B 3OHAA 3BA9A 1KAWA 4C3JB 5CR3A 5HGQA 3GTOH 3HOWG 5KNCA 1KBLA 1L1OC 2EY2A 2ASJA 2CHBD 1KJ8A 2CH4A 4DF7A 4RGNA 3LWEA 4MV3A 1KL9A 3PO2H 2QK4A 2IWHA 5IYCG 5F9NA 2XGPA 1VQ6A 3H0GG 2QYZA 3SI8A 2W8LA 3RLNA 2EYMA 2K7VA 3TREA 1PH5A 2EYOA 3HKZG 4JBMA 5CBEE 4DV4L 1G51A 1SFOH 3AYHB 1KNEA 4A3FH 5GONF 4J9PA 1EQTA 3W1BA 5JVDF 1B1ZA 2VL6A 4ZCKA 3UDIA 4IUVA 5D3DA 2B2WA 3W5OA 1XMOQ 3FKIB 1PH6A 2K14A 1VQHA 3ICEA 4UP9A 3D6WA 2YCHA 2PI2A 1WTRA 4IQZA 4A3KH 5KFYA 3HOVB 2IX0A 3OYYA 4FP5D 3NTKA 5KNDA 5LMNQ 3BQ0A 4FF4A 5JVLA 1E2WA 4GKKL 1CA6A 1K0RA 1OXVA 3K5OA 4YCUA 3VR2A 4IHJF 3GTMB 2LKVA 3QJYA 4CJ0B 1K3BC 2CFMA 2UUAQ 5JJIA 1IOVA 4RHRA 1GGOA 1DCZA 5I47A 3RJ0A 1PTOD 4IWXA 2FFKB 3GO5A 2W9CA 1KRTA 2V59A 4C3JG 3HOWB 5I9PA 4J9NA 3CXCA 4JI8H 3GILA 1LO5D 4ZKCB 3WO1A 4DR2L 4RCOA 4UPAA 4LF6L 2W9BB 1FGBD 1PZID 3SVMA 2A19A 1N34L 2RDHA 1XWEA 4I7AA 5LMUL 2RDJA 4MTNA 5IE8A 1BCPF 4QF4A 2NVTB 3TIIA 4GNXC 5KFIA 4HNTA 4I50F 4PDBA 1TS3A 3JSLA 5GROA 4RU9A 3A8IE 2KUMA 2AUKA 2F0WA 3QOLA 4MZ9A 2I8CA 3T1HL 4IRCA 1EUDB 4R4TA 4JV0A 5DGAA 1X54A 4YAJB 4Y8VB 2B29A 4NW2A 3K5LA 2W6PA 3GTLH 5KG3A 2NVYB 4XTCS 4ZOLF 2FK3A 1GUSA 1WFQA 2EJMA 4PG3A 4A93B 2FPGB 4YY3L 5KFXA 3TP7A 1I6UA 3U50C 3VYRA 1YNNC 3KOJA 4JPBW 1PA6A 2D9UA 3G48A 5CV4A 4LK1C 4DR5Q 1MJEA 3H40A 5IIFA 1EIHA 1TWHB 1BXRA 5DQIA 3HG9A 1D2BA 2W6ZA 1PRTD 2PW7A 1PMRA 3MAQA 1I7NA 4Q45A 4TQUS 4ZRZA 1GOZA 4ECQA 2Z1CA 3ETHA 1TIID 2ENBA 2EVBA 3FPUB 5KG2A 1STGA 3RAQA 4O3QA 4A3LH 2BDOA 1P16A 4ECZA 5LMNW 1AEXA 3K7UC 3D0FA 1AP0A 1S5DD 4E4TA 1N33Q 4TQSA 5IYBG 3E0EA 3GIKA 2AQ3B 5IP7H 2RVLA 1MBYA 3I70A 4KTAA 1XTCD 3CW2C 2BQUA 1E1TA 3M4QA 1Q8KA 1IBLQ 4JUZA 3RTXA 1ZEQX 2N3SA 1GSOA 1PFMA 4KJNA 3RR5A 4H44C 4A3JB 1E4EB 1LTGD 2RSOA 3KJOA 2I87A 2E2HB 4JV1A 3HOWH 4DKAC 4ZKBB 5KRUA 4CDFC 4IUUA 2IX1A 2A68D 5HY6A 1KDAA 1I4XA 4ME6A 2R61A 4PQXA 4KHZA 4ZAIA 3EA6A 2RKSA 4J8QA 1C7YA 1YNND 2VNUD 4B3SQ 3PZPA 2R7MA 5F9LA 1M8AA 3EIVA 1V51A 1VQ8A 1JJCB 5DLQE 2XC9A 2PN1A 3H15A 2XCAA 4DR5H 4FF1A 1A3VA 3VR6A 2K5QA 3SK4A 5EKLA 4JVZA 1WR2A 1QJOA 4EBEA 2W7PA 3R5FA 3LNNA 2F1MA 3FVQA 4A3DG 4Q44A 4GNXA 3BZCA 1DM0B 1MD2D 5C4JB 1NY4A 1HNWL 4XQJA 2FJZA 1F9PA 1ZQ7A 4DR3H 3L3OC 2VQEQ 1NJIC 1G2SA 2KBNA 3S15H 4NB3A 1TWHA 4RA8A 3A8KE 1CKMA 5C8YF 3K7AH 4DV6H 2B63A 2HDLA 3OTOH 3NTHA 1ET9A 1I3QB 5HURA 5M9OA 1EUCB 2YU9B 4PZ6A 1ASYA 3OPOA 1B4OA 2B2YA 3V96A 3PV0A 4Y52H 4CDCC 4DNTB 3NXWA 4U6PA 2Y0SE 1B9MA 5IGFA 3D3RA 1E22A 1SYGA 2WDTA 2W9BA 4DR5L 2A74C 4JI8L 1SE8A 4R4QA 1V43A 3CCJA 3F8NA 2MGSA 3CCSA 2ZM6L 4YY3Q 2VPQA 3K0XA 3GTOB 1A3TA 4A75A 3KLSX 3GTLA 2O5IC 4KKTA 3MWMA 2R6GA 2QEJC 3MVVA 1LT6D 1YITA 5BR8L 1XDNA 2R92G 3GTGB 3HGBA 5C44B 2E74C 4JV5Q 2JA8G 5EZYF 5M5WH 3U9SA 4DAPA 4LF5L 1JJ2A 4RAZA 1VMPA 2KCTA 3PO3H 4JI2H 5CB4F 4Y7NH 1WCMG 3T16A 2ZJPA 2DY8A 3HFZB 1VQMA 2PNRC 1VQ7A 3H09A 2EQSA 3UDGA 3PW0A 4L5SA 4YHHQ 5IT9W 1J6QA 3V6JA 2NN6H 2AGOA 5IWAQ 1IBKQ 1GJXA 1RODA 1TWAB 1EIYB 5J1ZA 2XRQD 2QEXA 4JW0A 1KABA 5FKAC 4R7RA 4POGA 3BVZA 1QVCA 3LX0A 3B6YA 3STBC 5EBCA 1RKNA 3MXNA 2NVQH 4O2AF 5FLXW 5L1KA 3I4OA 4Q0YA 2Z4IA 3M9MB 3O13A 4JI1L 4IOAA 2PZTA 3RBEA 4FNFA 4NLGA 5EWFA 1EY7A 2G9HD 5KYIA 1WTWA 2D62A 4QQBX 1S0MA 5C0XI 1CQFA 2WAQG 3BYTB 3NPPA 1I5FA 5KFJA 3QOJA 3BJUA 4LF9L 4B3RH 3UDXA 2KENA 2XWBB 2QW7A 1JOKA 2BOSA 4DR6Q 4BBSG 3TP8A 2YTXA 3BQ2A 4IWYA 1J5EH 1U4PA 4C2MH 4A3JH 2R7NA 3CPWA 4ED1A 3GTPA 3GTKA 5DG9A 2W6QA 3GV7B 1JQYD 3GDEA 4J1MA 4YR0A 2A69C 1NSNS 1RJPA 4X65Q 3FMAA 4DV2H 3I4NB 2B2UA 3RLFA 1SYXB 3CU7A 3EPGA 4A3MH 5KFDA 1LTRD 1SEIA 4ED2A 1B9NA 2HVQA 2R8KA 2B63G 3M7GA 3KHGA 3H3VI 5DQGA 3PMFA 1LYLA 1JB3A 2RHSB 4MA0A 3ND8A 1TA8A 1B44D 4GN4B 2B63B 1HHVA 3J81E 3C46A 1RJQA 4L1KA 1GYFA 3JAML 3RD4A 4LF4L 1STNA 1OXXK 5D3IB 4O1NA 5IP9G 2FKLA 2W57A 1NAPA 1O7LA 4ME3A 4X66Q 2CH4W 1DV2A 5KFNA 4J9LA 1EEFD 3H6MA 3T51B 4GLAC 5JOBA 3QB3A 2ZM6Q 3OWEB 3N41B 1D5ZC 4JI3Q 3S24A 3QZ7A 4HAEA 1SCUB 3D6CA 2JA9A 5C4HA 3WO0A 5KEEA 2CVRA 4M1UB 1I6HB 3SE7A 4J9QA 1TWHH 4C1NK 1RYSA 3BG5A 4YCWA 4DXFA 3TQTA 3DM1A 4LH7A 4LF5Q 1EU3A 3S1MB 4JOIC 4RNMA 4A3IG 4QWCA 2BA1A 3E5NA 2OQ0A 1BCPC 2F0GA 5BR8Q 2V4RA 2EYJA 3RV3A 1CI3M 5G3LD 1GM5A 3S1QB 4IN3A 1LTTD 2VZAA 2CZGA 4O3NA 4EEQA 4JV5L 2FLLA 3T13A 5EWEA 1PH4A 1D7QA 4HQ6A 3T5HA 5EAYA 1TXYA 4C3IG 3KHLA 2AU0A 4FS1A 4Q8EA 2NWGA 2F0JA 3CAMA 4R8UA 4I65A 4DAYA 5AJ3Q 1TWAA 4QB4A 2JA7H 1JDEA 1SROA 1RL2A 3KBGA 3J7AV 1SE3A 3HKSA 1I4QA 4A3BB 1TWGB 4EGVA 4C3IB 5IWAL 1IBKL 3V4SA 4HMIA 4YR2A 3RIZA 2K28A 3G6EA 2SOBA 3NBHB 4IRDA 5DNFA 4A3BG 4KY7A 1T5EA 2R92B 2JA7G 3IFTA 3BDOA 4OGQC 2R92H 5KYLA 5FOBB 4LFBL 4UCSA 1HNXQ 3AB9A 4B3MQ 3J80c 2EOTA 1BUVT 1M90C 1JT8A 2SCUB 1DGSA 3GV5B 1HNZL 2EDGA 2ID0A 3VDYA 1WTVA 3TMEA 1VQJA 5GAEC 2B63H 1N36H 2FLNA 2XGQA 3I3CA 4CKEA 3W1GA 2UU9Q 5EPKA 4XT3B 4RH6A 3GIQA 4HSPA 5IT9E 5KFWA 1PFNA 1JMCA 4MTKA 1MIUA 2V9WA 2VS1A 4JI4L 3HB9A 4PWQA 1STBA 4KLKA 1F2LA 2AUJD 1Y14B 2E5LH 2N88A 3STBD 5KG7A 3HKZE 4K0KL 2IP4A 1L0XB 2KA7A 4C3HB 2F0FA 1ZXTA 2Q2HA 4Q5VA 1KIXA 3HOZG 2UVRA 1UC9A 2V4DA 1F2MA 5IT9c 3PO3G 4J9MA 1UUPA 3S9WA 3FDTA 1HR0L 1Z2PX 1I4GA 2F3VA 2GN5A 4DUYL 4LF8Q 1QILA 5IYZF 2XNAC 4JV5H 3Q1KA 1C30A 5C3XA 4X66L 2OQKA 5A2QW 3RFCA 2EIFA 3CRLC 3PUVA 3TS0A 5J3BA 5KFQA 1HFNA 4DUZH 3TBIB 1IYUA 3EN2A 1GUOA 4JI0H 2MNAA 2JEFA 3JRWA 4YCVA 3N8DA 2HUGA 2R7LA 4DV7H 2OTLA 1VQ5A 3EYYA 2ICIA 3G6YA 4F8MA 1XNRQ 2J6TA 5DLGA 3LWUA 5IYDG 1QVGA 4BY7G 4K5XA 1M0WA 1FJGQ 3H20A 3K5HA 1BQQT 1Y1VG 4GLVB 1WJJA 3TZUA 2BE5C 4RG1A 4DK0A 2F0IA 3URYA 3IAYA 1CKNA 4A93H 1U5KA 2F3IA 2JA6A 2A8VA 3OUZA 3HOYB 1EUJA 2KHJA 4BY7H 4CKBA 4A76A 1EY4A 1IBMH 4DR4L 4RMFA 2J0TD 3FKIH 3MEFA 4EQPA 1Q86C 4R4OA 1PH1A 3NP8A 1JC7A 1W6KA 2V1CC 3FPPA 1AZPA 2I80A 3J80W 1PZJD 1L1OA 2NTTA 4JI2Q 4EYHB 4A3KB 4C3HG 3TQ1A 4LNQA 1KXLA 4DPGA 4P2CB 3RZOB 4OX9L 3MJFA 3KAJA 4BBRB 4X64Q 3BDLA 5DEHA 4A2BA 1IYJB 2YTYA 4FDBA 1C8CA 3FP9A 1QG7A 2KVMA 3IRBA 2EXDA 5IP7G 2WACA 2YZGA 2K1BA 4I7ZC 1EL0A 4DLKA 3U4VA 4O2DA 1RCVD 3S15B 3S1NB 4DR7H 4UDUC 1E24A 2BCOA 3AFQA 1K1QA 4IFDI 2R8IA 2NB0A 5KGUA 4DR2H 1U0LA 2RCNA 4KN7C 1EFID 1SE4A 4ED6A 3V6HA 4X64H 4QWAA 3GTPB 3TSSA 2N49A 2M05A 1NBWA 1B33N 5KFMA 4B3RQ 1YEZA 3I8ZA 3RMHA 3GTJB 1GKHA 1G8ZD 4UCUA 2HHHL 5CYUA 2YW2A 2WP8J 2ZXRA 1GHJA 1EYAA 4Q8FA 4LJZC 4A4IA 5EPLA 3T1YQ 1SBBB 1JDBB 3M9NB 1V1PB 2JA5G 3IFDA 3SK5A 1V8QA 2B2TC 4RAYA 1TR5A 1RIPA 5I2YA 1CHQD 3K3PA 5KG4A 1S40A 4ECRA 4U7CA 1I6VC 4HJ7A 4O42A 2YV5A 2WYOA 1UE7A 3I4MB 4O3OA 1D1KA 2UXDH 1O7YA 2UXCL 1B2TA 1D5MC 2RBMA 3MEHA 5LXTF 1EIGA 4ID6A 3JAMi 1HNXH 5IYDH 5C1PA 4B3MH 4DGZA 1A3UA 1KAAA 3CHBD 3N6RA 4FXDA 4RNNA 4DV6Q 3K3VA 5ELFA 3MR5A 4AYBB 3ERQA 4UHVA 4DR6L 4DL5A 2EJGC 3CF5A 4EEYA 4RUAA 5JAVA 4XX0B 2UU9H 4JCVE 4YWKA 4KI0A 1SMYD 3D4RA 3L0OA 3A5UA 5IODA 1U4MA 4DL4A 4RKBA 5C3EB 1Y69U 3DUZA 4HIMA 4DAMA 2F0LA 2C5CA 3GIMA 1H9SB 1HXYD 1ZETA 3BVGA 2EY5A 4A3KG 1VQ9A 2Q8RE 3IKJA 2NYZD 4DV7L 2BH2A 4V0BA 5FPRA 2YZMA 3F1ZA 1Y1WG 4ECSA 2EYLA 4DUZL 3N6XA 2E76C 5KFRA 1XNRH 4AQYL 2ATLA 1CTMA 2LS01 2AWNA 4HJ8A 2YRWA 3G6VA 3F2DA 4LF6H 3HOUG 3J7A5 1Q1BA 1PFBA 4JC0A 1IW7D 3GV8B 1TT2A 2C35B 5NUCA 1HNWH 4RGMA 5M5XH 1H95A 2UXBQ 3TINA 3I12A 3KLWA 5BN5A 3I4NG 3G71A 2HVSA 2A6EC 4PZ7A 4LF8H 2F0TA 4BWSC 4KJOA 5E4XA 4QWDA 4HN7A 2UUAL 1RK5A 3KDFB 2CQYA 1QZHA 2NVTH 2VXWA 4JI5L 1EU4A 3BDCA 1V1PA 2BE5D 4DAYB 2DNEA 1F9QA 2XVSA 1EOTA 2WAQA 2XTIA 4YB8B 2AGPA 2GVAA 1W3SA 1RYRA 1AW7A 2ICEC 3HS0C 4GN3B 5FO9B 4UY8C 1ILQA 2EE1A 4O0AA 4NXML 5DLFA 3ERSX 4DAVA 2L12A 1E4GT 3PIOA 4L63B 1YHBA 5BMVF 5KFVA 3PN1A 5JQWA 1PTOH 2QGQA 5JJLA 1H9SA 5AFWA 4DV4H 1CHPD 3F2UA 1JWMD 2I5HA 5C6AA 2BA0A 4WBNF 1B70B 1EYCA 2F0NA 3OHXC 4LAAA 2D5DA 4DR2Q 1BOSA 3E9HA 1IKLA 4A3GH 4RB3C 3DM3A 1SYDA 1ULZA 1HTLD 2NZHA 2E2IH 4IRKA 2GPSA 4A3FG 4MAMA 1DZ1A 1TS2A 4J9RA 1Y1WB 1LACA 1GXDC 3H3VC 3S1MH 2R7DA 2JEJA 4O3SA 4BXXH 1QE6A 2IT1A 3T1YL 3S16B 4KHPL 4JK1C 5ISRA 2R8HA 3RNUA 4XQNA 1S72A 4LFAQ 3DWAA 1CZWA 2HDMA 4A2AA 4X3TA 1JE4A 1RJRA 1JOOA 1JX4A 4JV2A 4DR1Q 3V4ZA 4OL7A 4HIKA 3RN2A 2CW7A 4DL3A 1N34H 1F77A 1K9MC 2O2LD 3S14B 4CC5A 2ZT9C 3BZKA 1TWFB 4DV6L 2C2RA 1J5EL 3PUYA 4EQ5A 5KFSA 3OSNA 4DV1H 1IL2A 1RDPD 2W6MA 1Q46A 2PMZB 4WFN3 2JA7B 2R93H 1L0WA 3GTGA 1K1SA 1CZGA 4DV5Q 1M0TA 3DMUA 1N32Q 3TP6A 3A8JE 3GTQB 4JI7H 2NU6B 2L11A 3K5IA 5EJWA 4DUZQ 1BXTA 2B2YC 2R7FA 1SFOB 5ELOA 2RSNA 1ENFA 4QMGA 3RV4A 2R93A 4YIJA 4DA2A 2UXCH 2JSOA 1Z2NX 1HNZQ 1ENCA 4DV7Q 4L5RC 1IW7C 5KFKA 2PQEA 2ZJQA 1R9TB 1X6OA 1D5XC 1Q8IA 1SNOA 1I50H 5DAUA 5D8DA 3CCRA 2X0SA 4ED3A 3VPCA 3CP0A 2JE6I 3I73A 5IYBH 1TKWB 2B3GA 4LF8L 4U673 1KJJA 4ECVA 1TAEA 4JI3H 1RTOA 4AQYQ 3K81C 1OTCA 4QUFA 4R1JA 2P0AA 4UAIA 4ZYSA 3V05A 2WIIB 5D14A 3JAMc 2L0CA 4IALA 4X3UA 4TV9F 2R85A 2VUGA 4QWBA 1EQRA 1L2FA 1V1OA 3W3AA 1SNPA 4LMQD 2JK8A 3R93A 5DM73 1N8RC 2HQLA 4FXKC 4K5WA 3NUCA 5FK9C 1EY9A 4DV2L 1XNRL 2V5AA 4DR7L 3JAME 1O7ZA 1N32H 1WCMH 3ITPA 4C56C 5EGTA 1ONLA 5A2QE 4YP3A 1J9OA 1EZ1A 3TZDA 4Q0FA 3S16H 4ED0A 1D1IA 2WTFA 1S03G 2RGRA 2DY7A 3HEJA 5J22A 1UE6A 2R92A 5JVH3 2WE6A 2FPIB 4KY5A 4BA1I 2YRXA 1DYQA 1H9MA 4QW9A 4IUTA 3ONAB 4HIOA 5M3FH 2RDFA 4LF7Q 1X3QA 1G6PA 4YJ3F 2VOBA 5FD6A 2ZTDA 4LUZA 3K80C 2AQ1B 4XXEA 2F0QA 3T5JA 1YHAA 4NPSA 2FP4B 1VS0A 3MHBA 2FMCA 3A7LA 4PMCA 3H4BA 1SN8A 3OOCA 1A2UA 5M3FG 5C4ZA 4EG0A 4I55F 3CVZA 4ED8A 1PH2A 1E7ZA 2UXDL 5J2UF 5DG8A 4A3JG 2PMZA 2O03A 2F4VQ 4C3HH 2B2TA 5ELNA 2VPSA 1ET6A 3OSOA 5DQHA 1TWCA 1QWYA 1SYBA 2HIXA 2WFWA 1VKZA 3NEMA 2Q8TA 1YNXA 4JI2L 2JA6B 3PR5B 4DV5L 3RF2A 1KRSA 4JI0L 4JI5H 2DWCA 3CRKC 4DU9A 2HD3A 1AFPA 2R8JA 3EVQA 1DD2A 1LUZA 1CSPA 1TWCH 5E3FA 4LFCL 4YHHL 4MV8A 4X62H 1L1OB 2E8GA 2J6UA 4XZ3B 3PQIA 3WDNA 1AUXA 4GC6A 4JBJA 3I4MG 2JA5A 3NTIA 4K14A 3M7NA 3NQIA 2JA6G 2F0OA 1A2TA 4DL2A 4DR1L 4F4WA 4X66H 2QDBA 2J4XA 1M6VA 3F2BA 3PIPA 4OO1I 4JBWA 1IOWA 1G6ZA 2B2WC 1WOCA 3T4AC 3EROA 3J80i 2CKZB 3PIO3 1LT3D 4IUNA 1KNAA 4LFCH 1WTPA 3I2ZA 3E3XA 3CCVA 1S97A 4R4IA 4LH6A 3VA5A 5IYCH 2W7OA 4UP7A 1S0OA 4IR1A 1TWAH 2W71A 5LHY1 3JRXA 1AN7A 1NMFA 2VUMB 4DV5H 5CA1F 1RJTA 3K59A 4I4TF 2MQHA 4LSXA 2IHFA 3QZ8A 4PMWA 3RUZA 4ECXA 5KNBA 1Q7YC 2EYPA 3HOZH 1XNQL 2YL2A 3CMAA 1X55A 1QNUA 2EZVA 2YTVA 3G6JB 4H13C 2UVVA 2Q2TA 1B3QA 5L1IA 3V2TA 3CKIB 4LF4Q 1E0BA 1A63A 4LF7L 2AMCB 1WCMA 2L1BA 1JB7A 1Y8OB 1AE2A 1PLFA 2A69D 4PMBA 2CWAA 3M4YA 1TY2A 2MPMA 2MFIA 4RWSC 5KT2A 2KECA 4DN4M 5I2XA 1WI5A 1IKMA 5L9XA 4RHSA 1A15A 1EEID 3FDSA 3Q8QB 2CCZA 4TRDA 5LMUQ 1L2ZA 3MWYW 3DLLA 1CK1A 1YZ6A 4BY1G 2PCFB 1U4LA 5G3LF 2VA3A 4N9TA 4APMA 2DNCA 4JYAH 1SLJA 2NTSA 3FEWX 3TEHB 4B9XA 2R87A 1MKHA 5ELBA 1BF4A 4QCLA 3JAMW 3PW2A 4EGJA 5I4DA 4X62Q 1EQVA 5IP9H 3WNZA 1N33H 1JR0D 1TWFH 2PQAA 3C0FB 4LSAA 1TS4A 4AIMA 2XD4A 1JLLB 3KLSA 4NXMQ 2IA6A 4WJ4A 1I4PA 1II3A 1UWVA 4Q43A 4C5CA 4CC6A 5JJZA 4NMZA 4N8FA 4APVA 2K5HA 2XIWA 4B08A 5KFTA 3K8AA 4B3TH 3J81L 3GTOA 1YHQA 5LP6F 1EYDA 1GO3E 2C00A 1BKBA 1HNXL 4B3ML 2Q2UA 5C4XB 3G8CA 3BQ1A 5JPMC 1VAJA 3Q8PB 4IPCA 2JEAI 2JA5B 2IBKA 1GD7A 2ASBA 4R8UB 1EY6A 4BBSB 4L5TA 3UI2A 1BBXC 1MHWC 3AEVA 4DL6A 3T5KA 2DZDA 5C3EH 4TSSA 1SMYC 3PGZA 4XDXA 1UE1A 1Z6HA 3LGJA 4HCSA 2VW9A 2W8KA 1IBML 1H9JA 3OTOQ 1UEBA 2W70A 2UXCQ 3RGZA 1CUKA 1YBYA 3HOVH 4O3RA 1VBHA 1N36L 1SJHD 2EYFA 3KBXA 4ME5A 1VBGA 3RB4A 2KEDA 3VA7A 1TQOA 1CSQA 2K4KA 1E4EA 4MA5A 2V4QA 4KD3A 1QVFA 3N44B 5FLMH 2N55A 1JORA 1CQJB 4L5QA 2BQRA 2FPPB 4DR3Q 2NUAB 4DUYQ 2F0UA 4F87A 1CFMA 4NP5A 3RZDH 4WRDA 5LMNH 1LTSD 5D65A 1ZHSA 2E2JH 4KY6A 5KFUA 2E2HH 3ORRA
chains in the Genus database with same CATH topology
1XTDA 2N49A 1NBWA 3CXCA 1N32L 4JI5Q 1Z47A 4B3RQ 1YEZA 3CC4A 1GKHA 4DR2L 1JE5A 4UPAA 3GTJH 4A93H 4LF6L 2HHHL 1HR0Q 1A62A 2LSSA 2A19A 1N34L 5LMUL 3EBEA 2WP8J 4MTNA 5IE8A 4A4IA 4OWTB 3L7ZC 4GNXC 3T1YQ 1XMOL 2VUMH 2JA5G 3D31A 1VQCA 3RN5A 4BBRG 2Z6KA 1RIPA 5GROA 3HOVG 4OWXB 1YIJA 4MZ9A 2JJQA 1S40A 1PH9A 3T1HL 4HJ7A 4R4TA 5JEAJ 2QA4A 2YV5A 1X54A 2B29A 1UE7A 3A0JA 4P75A 2NVYH 3PF4A 2YYZA 3GTLH 2UXCL 4XTCS 1WFQA 4PG3A 2UXBL 1QUQA 3JAMi 5IYDH 4YY3L 3ZJYC 2I5LX 2R7ZG 3KF8B 4A3IH 3U50C 3KOJA 1A0IA 4DV6Q 1PA6A 3G48A 1PH8A 1VCIA 4DR5Q 1MJEA 4JG2A 1XPRA 4DR6L 3S2HH 5FLXc 4IO9A 3CF5A 3F8TA 4KHPQ 3HOYG 4JCVE 4YWKA 1FJGL 4KI0A 2VQEL 3L0OA 4TQUS 1K8GA 3A5UA 4IFDG 4B3TL 4QGUA 4HIMA 4DAMA 1XNQQ 1Q82C 4X62L 1K83H 3J81i 4A3KG 1VQ9A 4A3LH 5FJ8H 1P16A 3G4SA 1GVPA 5LMNW 2BH2A 4DV7L 3K7UC 3D0FA 1N33Q 3F1ZA 5IYBG 2OWOA 3E0EA 1Y1WG 3M4OH 1HNWQ 3NENA 1SMXA 5E7NA 4C3JH 4DUZL 1EYGA 5IP7H 4X6AH 2LXJA 3S14H 4AQYL 3CW2C 4PZ8A 1E1TA 3M4QA 1Q8KA 1IBLQ 1V9PA 4H02A 1VQEA 3S1NH 2R93G 2AWNA 2N3SA 4HJ8A 3PO2G 2MO1A 3GTGH 3F2DA 3RR5A 1AE3A 3HOUG 1Q1BA 3J7A5 2Y0SG 3CD6A 4JC0A 4QY7A 4JI7Q 3KJOA 2K52A 3HOXH 3ER0A 3Q8DA 5JJKA 2C35B 2HHHQ 4A93G 3HOWH 1B7YB 4DKAC 2E5LL 3KJPA 5M5XH 1H95A 2IX1A 2UXBQ 5HY6A 1IBMQ 3PUWA 3OTOL 3KLWA 3S17H 4IPHA 1C9OA 4KHZA 3G71A 1C7YA 4PZ7A 3I4NG 4LFAL 2I0QA 3AQQA 2VNUD 4B3SQ 1HZBA 3TRZA 3PCOB 2NN6G 3JC66 2Z0SA 4DV4Q 2UUBL 2UUAL 3KDFB 4A3CG 1X3GA 4DR3L 1X9NA 1QZHA 3EIVA 2NVTH 4JI5L 4DAYB 1R9TH 1VQ8A 1JJCB 5DLQE 3CCEA 3H3VH 4B3RL 3H15A 4OX9Q 1B8AA 2XTIA 2K5NA 2GVAA 1W3SA 1XPUA 4BA2I 4GN3B 3ULLA 1VQIA 1YJ9A 4O0AA 3PUXA 4NXML 4UY8C 3ERSX 4A3EH 3FHWA 3PIOA 1YHBA 1BBWA 1PH7A 2PMZE 4QJFA 4BXXG 1EWIA 1HZAA 2QGQA 4BBRH 1PYSB 2K5VA 4A3DG 5JJLA 4GNXA 3BZCA 4EX5A 1VQOA 2N8NA 3KYHC 1QUQB 5GAGC 2I5HA 2BA0A 3GD7A 1NY4A 1XMQL 1B70B 3T1HQ 4R4CA 5C4JH 1QZGA 3HOUH 3M3YH 1HNWL 3I7FA 1XPOA 1VQNA 4DR2Q 1NJIC 1OXUA 2RHQB 2VQEQ 2KBNA 3GTKH 3S15H 4OONA 3E9HA 1N36Q 4A3GH 4GKJL 5C0XG 4NB3A 3DM3A 1G291 2NZHA 1CKMA 4AH6A 2E2IH 1HZCA 4A3FG 3K7AH 1YJNA 4LF9Q 1XJVA 1I3QH 1O7IA 2WB1E 1Y1WH 1VQPA 4J15A 4P72A 3S1MH 3GTPH 2R7DA 4PZ6A 4NXNL 1ASYA 4LFCQ 2WB1G 1HH2P 4BXXH 3H0GH 4Y52H 3PV0A 4JYAL 2IT1A 2OCEA 4OXPA 3T1YL 2Y0SE 4KHPL 1E22A 2GVBA 3RLOA 3RNUA 1S72A 4DR5L 4LFAQ 1JJGA 4B3SL 4JI8L 4JBKA 1SE8A 2ALYB 1V43A 3KF6B 4R4QA 5M3MG 3CCJA 3CCSA 4DR1Q 2ZM6L 4YY3Q 1I94Q 4X65L 4HIKA 3RN2A 1KC8C 2VUMG 3K0XA 1IZ6A 2NN6I 4A75A 1K9MC 3BZKA 3FKIG 3CCUA 4DV6L 1YI2A 2R6GA 3PUYA 3UE1A 4EQ5A 3U4ZA 3J81j 1J5EL 3CMEA 1YITA 1IL2A 4LW1A 1Q46A 5BR8L 2R93H 2R92G 4JV5Q 4UP8A 1L0WA 2JA8G 5M5WH 4DR7Q 4BY1H 4DV5Q 5C3EG 4LF5L 4GS3A 1JJ2A 5M3MH 1Q81C 3UE0A 5AJ3L 5GAHC 1N32Q 2KCTA 1EIFA 4DUZQ 3PO3H 2R7FA 3PUZA 5C4XH 5ELOA 4HJ9A 4Y7NH 1V1QA 1WCMG 1HZ9A 2ZJPA 3HFZB 1VQMA 4JI0Q 3HOYH 1VQ7A 2FXQA 2EQSA 5C44G 3UDGA 4DV7Q 1X56A 4YHHQ 1HNZQ 4L5SA 1J6QA 4ALPA 4L5RC 4GKJQ 4POFA 5IWAQ 1IBKQ 2IHEA 2PQAB 2ZJQA 1NTGA 1EIYB 1OXSC 4DV1L 4YWLA 2QEXA 4JI6Q 4DNIA 1X6OA 1E1OA 4POGA 5K36G 1QVCA 4P71A 1I50H 3B6YA 3STBC 1EOVA 3CCRA 2NVQH 2F52A 3CP0A 2JE6I 3I4OA 5IYBH 1A8VA 1P8LA 2B3GA 2K75A 4JI1L 2LXKA 1KD1C 4LF8L 1NE3A 4IOAA 5H1SE 1VQGA 4AQYQ 3K81C 1OTCA 3S1QH 1KHIA 3CC7A 4R1JA 4QQBX 2D62A 3SGIA 3JAMc 1Q12A 5C0XI 1N9WA 4JI8Q 2WAQG 1PH3A 4GOPC 1I5FA 2UU9L 3BJUA 4LF9L 3UDXA 3GTMH 1T9HA 1EQRA 1L2FA 3KDFA 2WAQE 2KENA 2JK8A 4DR6Q 2E5LQ 4BBSG 1N8RC 2HQLA 1PHJA 2YTXA 5FJ8G 4DV2L 4C2MH 1XNRL 1BBUA 4HJ5A 4A3JH 4DR7L 3CPWA 1Q1EA 1WCMH 3L2PA 3S2DH 2Z6KC 4C3IH 1WYDA 4DK6C 3GDEA 1M1KC 4LWCA 3ULJA 3S16H 3I56A 3I4NH 4X65Q 5M5YH 3RLFA 1UE5A 4A3MH 1K73C 1UE6A 1N33L 2B63G 5C0XJ 3ULPA 4BA1I 3H3VI 1PFSA 3UDFA 3TS2A 4DV0Q 4HIOA 5M3FH 1LYLA 4JOIA 1SR3A 2RHSB 4LF7Q 1G6PA 4GN4B 3CPFA 1X65A 1SRUA 3AFPA 4QL5A 4TVAB 4A3DH 2N78A 2ZTDA 4LUZA 3K80C 4P73A 5C44H 4LF4L 1OXXK 1YHAA 4NPSA 2I5MX 5IP9G 4GLXA 5GQOA 1HJPA 1VS0A 4ME3A 4X66Q 2VY3A 2ES2A 1SN8A 3A5ZB 1Y1VH 1VQFA 5IY0A 3OW2A 2UUCL 4GLAC 2ZM6Q 2VQFQ 1CKOA 5M3FG 1VQ4A 2ZTEA 1I94L 2D0OA 2JA8H 1PH2A 1E7ZA 3S24A 4JI3Q 2OTJA 2UXDL 3HOXG 4A3JG 2JA9A 3TQYA 2F4VQ 4C3HH 1X3EA 5ELNA 1J5EQ 4WJ3M 1TWHH 2JA5H 4OO1G 4YCWA 2HIXA 2WFWA 1VQLA 2JA6H 3NEMA 5C4XG 1YNXA 4DK3C 1VQKA 4JI2L 4K0KQ 4DV5L 4LF5Q 1KRSA 4JI0L 3CQZH 4JOIC 4A3IG 4DV3L 2BA1A 2OQ0A 5BR8Q 2ZTCA 4HIDA 1AH9A 1LUZA 1VQBA 2CQOA 4IPDA 1CSPA 1GM5A 1TWCH 3U58A 4LFCL 1ASZA 4YHHL 3CCMA 3MXNB 2VZAA 4A3EG 1L1OB 2E8GA 4JV5L 1XMQQ 1PH4A 1D7QA 4DV1Q 5EAYA 1TXYA 4JBJA 4DV2Q 2NVXH 3I4MG 3M7NA 3CAMA 2JA6G 1IXRA 5AJ3Q 3E9IA 4MNOA 4DR1L 2IY5B 2JA7H 1YVCA 1SROA 3F2BA 1RL2A 3PIPA 2R7ZH 3KFUA 4OO1I 1PVOA 3M85A 1LTLA 4JBWA 3HKSA 3A74A 1FVIA 1WOCA 2JEBI 3WWVA 4GOPA 1TWGH 1NMGA 5IWAL 3J80i 1IBKL 4LUVA 3CC2A 2CKZB 3G6EA 3I55A 2HIVA 3NBHB 1KQSA 3I2ZA 3CCVA 4JI3L 4A3BG 2UXDQ 4R4IA 2JA7G 2R92H 1LM0A 4LFBL 5IYCH 4UP7A 4GKKQ 1HNXQ 4IPGA 4B3MQ 3J80c 1TWAH 1NMFA 1M90C 1K3RA 1JT8A 1DGSA 1HNZL 1PYBA 3J7ZC 2ID0A 3VDYA 2MQHA 2IHFA 1VQJA 4PMWA 5GAEC 2B63H 2NZOA 1N34Q 2Q2IA 3W1GA 1Q7YC 3HOZH 3F2CA 2UU9Q 4JI6L 2ZJRA 1XNQL 1OXTA 3CMAA 2A1AA 3I4MH 1X55A 4HJAA 2L15A 1JMCA 2YTVA 1MIUA 4IJHA 1FGUA 2VS1A 4GN5A 4JI4L 3BU2A 3NELA 2Q2TA 4JI1Q 4KLKA 2AHOB 1Y14B 4LF4Q 3STBD 2K50A 1A63A 4LF7L 2AMCB 3HKZE 4X64L 5LMNL 4K0KL 1JB7A 2MO0A 5FLMG 1AE2A 3CCLA 4LF6Q 1I6HH 2H5XA 2Q2HA 2PI2E 3J81c 1KIXA 2HT1A 3HOZG 4DR4Q 2CWAA 1IBLL 2KHIA 5IT9c 4IOCA 3PO3G 2MFIA 1BVSA 2D0PA 1FL0A 4LUOA 1WI5A 1HR0L 4JI7L 2CCZA 4XIGS 2DUDA 5LMUQ 1EQQA 1X3FA 2GN5A 3DLLA 2VQFL 1YZ6A 4BY1G 4DUYL 4AYBE 4LF8Q 4A3CH 1HR0W 1VQDA 1Z9FA 4DV0L 2AKWB 3PSIA 4A3MG 3M9BA 4X66L 1W2BA 1K8AC 2OQKA 1CKNB 2AWOA 1SLJA 3CCQA 3TEHB 2EIFA 3S1RH 1MJCA 1MKHA 2PNHA 3PUVA 3TS0A 4B3TQ 2KCMA 5J3BA 1KAWA 3HOWG 2CWPA 5HGQA 3GTOH 4X62Q 1L1OC 3EN2A 5IP9H 1TWFH 2PQAA 2MNAA 2F4VL 4YCVA 4AIMA 2OTLA 1KL9A 1D8LA 2JQOA 1VQ5A 4NXMQ 3PO2H 1XNRQ 4WJ4A 4BY7G 5IYDG 1QVGA 5IYCG 1UWVA 1VQ6A 3H0GG 1FJGQ 4APVA 3RLNA 2K5HA 1Y1VG 4IJLA 3K8AA 3TREA 4GLVB 1WJJA 1PH5A 3HKZG 4JBMA 1YHQA 4RG1A 4DV3Q 1GO3E 1CKNA 4DV4L 1G51A 1BKBA 2UUBQ 1HNXL 4B3ML 1U5KA 2F3IA 3AYHB 4A3FH 1SFOH 2Q2UA 3GTQH 1S3OA 2A8VA 3W1BA 2ATWA 3KF6A 1EUJA 4AYBG 2KHJA 2VL6A 3UDIA 4BY7H 4A76A 2UUCQ 4IPCA 3PF5A 2JEAI 4DR4L 4RMFA 3M4PA 3FKIH 3W5OA 1GD7A 2XGTA 1XMOQ 4OWWB 3MEFA 4GOPB 2K14A 1PH6A 4P74A 2ASBA 4BBSH 1VQHA 1Q86C 4R4OA 4L5TA 1PH1A 3ICEA 4IFDJ 2V1CC 2RF4A 3AEVA 4UP9A 1VQAA 1L1OA 5C3EH 4JI4Q 2PI2A 3PGZA 2VW9A 1UE1A 4LFBQ 3LGJA 1E3PA 4YWMA 4JI2Q 1IBML 3OTOQ 4JYAQ 5GADC 4A3KH 4A3LG 1UEBA 4LNQA 4DPGA 2UXCQ 1KXLA 4QIWE 4OX9L 2IX0A 3OYYA 1CUKA 1YBYA 4X64Q 5LMNQ 3HOVH 1IYJB 2YTYA 4FDBA 3RZOH 3FP9A 2BH8A 3IRBA 1N36L 4GKKL 4GNXB 1K0RA 2EXDA 1OXVA 4YCUA 5IP7G 1CSQA 3U4VA 2K4KA 4O2DA 1EFWA 1QVFA 2DGYA 1E24A 5FLMH 4L5QA 2CFMA 3AFQA 4NXNQ 2UUAQ 4A3GG 4IFDI 5JJIA 4DR3Q 4DUYQ 1U0LA 2RCNA 5JEAG 3RZDH 4A3BH 1C0AA 2E2JH 3GO5A 1YJWA 2YU9H 2E2HH 1KRTA 1PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTD A;  2N49 A;  1NBW A;  3CXC A;  1N32 L;  4JI5 Q;  1Z47 A;  4B3R Q;  1YEZ A;  3CC4 A;  1GKH A;  4DR2 L;  1JE5 A;  4UPA A;  3GTJ H;  4A93 H;  4LF6 L;  2HHH L;  1HR0 Q;  1A62 A;  2LSS A;  2A19 A;  1N34 L;  5LMU L;  3EBE A;  2WP8 J;  4MTN A;  5IE8 A;  4A4I A;  4OWT B;  3L7Z C;  4GNX C;  3T1Y Q;  1XMO L;  2VUM H;  2JA5 G;  3D31 A;  1VQC A;  3RN5 A;  4BBR G;  2Z6K A;  1RIP A;  5GRO A;  3HOV G;  4OWX B;  1YIJ A;  4MZ9 A;  2JJQ A;  1S40 A;  1PH9 A;  3T1H L;  4HJ7 A;  4R4T A;  5JEA J;  2QA4 A;  2YV5 A;  1X54 A;  2B29 A;  1UE7 A;  3A0J A;  4P75 A;  2NVY H;  3PF4 A;  2YYZ A;  3GTL H;  2UXC L;  4XTC S;  1WFQ A;  4PG3 A;  2UXB L;  1QUQ A;  3JAM i;  5IYD H;  4YY3 L;  3ZJY C;  2I5L X;  2R7Z G;  3KF8 B;  4A3I H;  3U50 C;  3KOJ A;  1A0I A;  4DV6 Q;  1PA6 A;  3G48 A;  1PH8 A;  1VCI A;  4DR5 Q;  1MJE A;  4JG2 A;  1XPR A;  4DR6 L;  3S2H H;  5FLX c;  4IO9 A;  3CF5 A;  3F8T A;  4KHP Q;  3HOY G;  4JCV E;  4YWK A;  1FJG L;  4KI0 A;  2VQE L;  3L0O A;  4TQU S;  1K8G A;  3A5U A;  4IFD G;  4B3T L;  4QGU A;  4HIM A;  4DAM A;  1XNQ Q;  1Q82 C;  4X62 L;  1K83 H;  3J81 i;  4A3K G;  1VQ9 A;  4A3L H;  5FJ8 H;  1P16 A;  3G4S A;  1GVP A;  5LMN W;  2BH2 A;  4DV7 L;  3K7U C;  3D0F A;  1N33 Q;  3F1Z A;  5IYB G;  2OWO A;  3E0E A;  1Y1W G;  3M4O H;  1HNW Q;  3NEN A;  1SMX A;  5E7N A;  4C3J H;  4DUZ L;  1EYG A;  5IP7 H;  4X6A H;  2LXJ A;  3S14 H;  4AQY L;  3CW2 C;  4PZ8 A;  1E1T A;  3M4Q A;  1Q8K A;  1IBL Q;  1V9P A;  4H02 A;  1VQE A;  3S1N H;  2R93 G;  2AWN A;  2N3S A;  4HJ8 A;  3PO2 G;  2MO1 A;  3GTG H;  3F2D A;  3RR5 A;  1AE3 A;  3HOU G;  1Q1B A;  3J7A 5;  2Y0S G;  3CD6 A;  4JC0 A;  4QY7 A;  4JI7 Q;  3KJO A;  2K52 A;  3HOX H;  3ER0 A;  3Q8D A;  5JJK A;  2C35 B;  2HHH Q;  4A93 G;  3HOW H;  1B7Y B;  4DKA C;  2E5L L;  3KJP A;  5M5X H;  1H95 A;  2IX1 A;  2UXB Q;  5HY6 A;  1IBM Q;  3PUW A;  3OTO L;  3KLW A;  3S17 H;  4IPH A;  1C9O A;  4KHZ A;  3G71 A;  1C7Y A;  4PZ7 A;  3I4N G;  4LFA L;  2I0Q A;  3AQQ A;  2VNU D;  4B3S Q;  1HZB A;  3TRZ A;  3PCO B;  2NN6 G;  3JC6 6;  2Z0S A;  4DV4 Q;  2UUB L;  2UUA L;  3KDF B;  4A3C G;  1X3G A;  4DR3 L;  1X9N A;  1QZH A;  3EIV A;  2NVT H;  4JI5 L;  4DAY B;  1R9T H;  1VQ8 A;  1JJC B;  5DLQ E;  3CCE A;  3H3V H;  4B3R L;  3H15 A;  4OX9 Q;  1B8A A;  2XTI A;  2K5N A;  2GVA A;  1W3S A;  1XPU A;  4BA2 I;  4GN3 B;  3ULL A;  1VQI A;  1YJ9 A;  4O0A A;  3PUX A;  4NXM L;  4UY8 C;  3ERS X;  4A3E H;  3FHW A;  3PIO A;  1YHB A;  1BBW A;  1PH7 A;  2PMZ E;  4QJF A;  4BXX G;  1EWI A;  1HZA A;  2QGQ A;  4BBR H;  1PYS B;  2K5V A;  4A3D G;  5JJL A;  4GNX A;  3BZC A;  4EX5 A;  1VQO A;  2N8N A;  3KYH C;  1QUQ B;  5GAG C;  2I5H A;  2BA0 A;  3GD7 A;  1NY4 A;  1XMQ L;  1B70 B;  3T1H Q;  4R4C A;  5C4J H;  1QZG A;  3HOU H;  3M3Y H;  1HNW L;  3I7F A;  1XPO A;  1VQN A;  4DR2 Q;  1NJI C;  1OXU A;  2RHQ B;  2VQE Q;  2KBN A;  3GTK H;  3S15 H;  4OON A;  3E9H A;  1N36 Q;  4A3G H;  4GKJ L;  5C0X G;  4NB3 A;  3DM3 A;  1G29 1;  2NZH A;  1CKM A;  4AH6 A;  2E2I H;  1HZC A;  4A3F G;  3K7A H;  1YJN A;  4LF9 Q;  1XJV A;  1I3Q H;  1O7I A;  2WB1 E;  1Y1W H;  1VQP A;  4J15 A;  4P72 A;  3S1M H;  3GTP H;  2R7D A;  4PZ6 A;  4NXN L;  1ASY A;  4LFC Q;  2WB1 G;  1HH2 P;  4BXX H;  3H0G H;  4Y52 H;  3PV0 A;  4JYA L;  2IT1 A;  2OCE A;  4OXP A;  3T1Y L;  2Y0S E;  4KHP L;  1E22 A;  2GVB A;  3RLO A;  3RNU A;  1S72 A;  4DR5 L;  4LFA Q;  1JJG A;  4B3S L;  4JI8 L;  4JBK A;  1SE8 A;  2ALY B;  1V43 A;  3KF6 B;  4R4Q A;  5M3M G;  3CCJ A;  3CCS A;  4DR1 Q;  2ZM6 L;  4YY3 Q;  1I94 Q;  4X65 L;  4HIK A;  3RN2 A;  1KC8 C;  2VUM G;  3K0X A;  1IZ6 A;  2NN6 I;  4A75 A;  1K9M C;  3BZK A;  3FKI G;  3CCU A;  4DV6 L;  1YI2 A;  2R6G A;  3PUY A;  3UE1 A;  4EQ5 A;  3U4Z A;  3J81 j;  1J5E L;  3CME A;  1YIT A;  1IL2 A;  4LW1 A;  1Q46 A;  5BR8 L;  2R93 H;  2R92 G;  4JV5 Q;  4UP8 A;  1L0W A;  2JA8 G;  5M5W H;  4DR7 Q;  4BY1 H;  4DV5 Q;  5C3E G;  4LF5 L;  4GS3 A;  1JJ2 A;  5M3M H;  1Q81 C;  3UE0 A;  5AJ3 L;  5GAH C;  1N32 Q;  2KCT A;  1EIF A;  4DUZ Q;  3PO3 H;  2R7F A;  3PUZ A;  5C4X H;  5ELO A;  4HJ9 A;  4Y7N H;  1V1Q A;  1WCM G;  1HZ9 A;  2ZJP A;  3HFZ B;  1VQM A;  4JI0 Q;  3HOY H;  1VQ7 A;  2FXQ A;  2EQS A;  5C44 G;  3UDG A;  4DV7 Q;  1X56 A;  4YHH Q;  1HNZ Q;  4L5S A;  1J6Q A;  4ALP A;  4L5R C;  4GKJ Q;  4POF A;  5IWA Q;  1IBK Q;  2IHE A;  2PQA B;  2ZJQ A;  1NTG A;  1EIY B;  1OXS C;  4DV1 L;  4YWL A;  2QEX A;  4JI6 Q;  4DNI A;  1X6O A;  1E1O A;  4POG A;  5K36 G;  1QVC A;  4P71 A;  1I50 H;  3B6Y A;  3STB C;  1EOV A;  3CCR A;  2NVQ H;  2F52 A;  3CP0 A;  2JE6 I;  3I4O A;  5IYB H;  1A8V A;  1P8L A;  2B3G A;  2K75 A;  4JI1 L;  2LXK A;  1KD1 C;  4LF8 L;  1NE3 A;  4IOA A;  5H1S E;  1VQG A;  4AQY Q;  3K81 C;  1OTC A;  3S1Q H;  1KHI A;  3CC7 A;  4R1J A;  4QQB X;  2D62 A;  3SGI A;  3JAM c;  1Q12 A;  5C0X I;  1N9W A;  4JI8 Q;  2WAQ G;  1PH3 A;  4GOP C;  1I5F A;  2UU9 L;  3BJU A;  4LF9 L;  3UDX A;  3GTM H;  1T9H A;  1EQR A;  1L2F A;  3KDF A;  2WAQ E;  2KEN A;  2JK8 A;  4DR6 Q;  2E5L Q;  4BBS G;  1N8R C;  2HQL A;  1PHJ A;  2YTX A;  5FJ8 G;  4DV2 L;  4C2M H;  1XNR L;  1BBU A;  4HJ5 A;  4A3J H;  4DR7 L;  3CPW A;  1Q1E A;  1WCM H;  3L2P A;  3S2D H;  2Z6K C;  4C3I H;  1WYD A;  4DK6 C;  3GDE A;  1M1K C;  4LWC A;  3ULJ A;  3S16 H;  3I56 A;  3I4N H;  4X65 Q;  5M5Y H;  3RLF A;  1UE5 A;  4A3M H;  1K73 C;  1UE6 A;  1N33 L;  2B63 G;  5C0X J;  3ULP A;  4BA1 I;  3H3V I;  1PFS A;  3UDF A;  3TS2 A;  4DV0 Q;  4HIO A;  5M3F H;  1LYL A;  4JOI A;  1SR3 A;  2RHS B;  4LF7 Q;  1G6P A;  4GN4 B;  3CPF A;  1X65 A;  1SRU A;  3AFP A;  4QL5 A;  4TVA B;  4A3D H;  2N78 A;  2ZTD A;  4LUZ A;  3K80 C;  4P73 A;  5C44 H;  4LF4 L;  1OXX K;  1YHA A;  4NPS A;  2I5M X;  5IP9 G;  4GLX A;  5GQO A;  1HJP A;  1VS0 A;  4ME3 A;  4X66 Q;  2VY3 A;  2ES2 A;  1SN8 A;  3A5Z B;  1Y1V H;  1VQF A;  5IY0 A;  3OW2 A;  2UUC L;  4GLA C;  2ZM6 Q;  2VQF Q;  1CKO A;  5M3F G;  1VQ4 A;  2ZTE A;  1I94 L;  2D0O A;  2JA8 H;  1PH2 A;  1E7Z A;  3S24 A;  4JI3 Q;  2OTJ A;  2UXD L;  3HOX G;  4A3J G;  2JA9 A;  3TQY A;  2F4V Q;  4C3H H;  1X3E A;  5ELN A;  1J5E Q;  4WJ3 M;  1TWH H;  2JA5 H;  4OO1 G;  4YCW A;  2HIX A;  2WFW A;  1VQL A;  2JA6 H;  3NEM A;  5C4X G;  1YNX A;  4DK3 C;  1VQK A;  4JI2 L;  4K0K Q;  4DV5 L;  4LF5 Q;  1KRS A;  4JI0 L;  3CQZ H;  4JOI C;  4A3I G;  4DV3 L;  2BA1 A;  2OQ0 A;  5BR8 Q;  2ZTC A;  4HID A;  1AH9 A;  1LUZ A;  1VQB A;  2CQO A;  4IPD A;  1CSP A;  1GM5 A;  1TWC H;  3U58 A;  4LFC L;  1ASZ A;  4YHH L;  3CCM A;  3MXN B;  2VZA A;  4A3E G;  1L1O B;  2E8G A;  4JV5 L;  1XMQ Q;  1PH4 A;  1D7Q A;  4DV1 Q;  5EAY A;  1TXY A;  4JBJ A;  4DV2 Q;  2NVX H;  3I4M G;  3M7N A;  3CAM A;  2JA6 G;  1IXR A;  5AJ3 Q;  3E9I A;  4MNO A;  4DR1 L;  2IY5 B;  2JA7 H;  1YVC A;  1SRO A;  3F2B A;  1RL2 A;  3PIP A;  2R7Z H;  3KFU A;  4OO1 I;  1PVO A;  3M85 A;  1LTL A;  4JBW A;  3HKS A;  3A74 A;  1FVI A;  1WOC A;  2JEB I;  3WWV A;  4GOP A;  1TWG H;  1NMG A;  5IWA L;  3J80 i;  1IBK L;  4LUV A;  3CC2 A;  2CKZ B;  3G6E A;  3I55 A;  2HIV A;  3NBH B;  1KQS A;  3I2Z A;  3CCV A;  4JI3 L;  4A3B G;  2UXD Q;  4R4I A;  2JA7 G;  2R92 H;  1LM0 A;  4LFB L;  5IYC H;  4UP7 A;  4GKK Q;  1HNX Q;  4IPG A;  4B3M Q;  3J80 c;  1TWA H;  1NMF A;  1M90 C;  1K3R A;  1JT8 A;  1DGS A;  1HNZ L;  1PYB A;  3J7Z C;  2ID0 A;  3VDY A;  2MQH A;  2IHF A;  1VQJ A;  4PMW A;  5GAE C;  2B63 H;  2NZO A;  1N34 Q;  2Q2I A;  3W1G A;  1Q7Y C;  3HOZ H;  3F2C A;  2UU9 Q;  4JI6 L;  2ZJR A;  1XNQ L;  1OXT A;  3CMA A;  2A1A A;  3I4M H;  1X55 A;  4HJA A;  2L15 A;  1JMC A;  2YTV A;  1MIU A;  4IJH A;  1FGU A;  2VS1 A;  4GN5 A;  4JI4 L;  3BU2 A;  3NEL A;  2Q2T A;  4JI1 Q;  4KLK A;  2AHO B;  1Y14 B;  4LF4 Q;  3STB D;  2K50 A;  1A63 A;  4LF7 L;  2AMC B;  3HKZ E;  4X64 L;  5LMN L;  4K0K L;  1JB7 A;  2MO0 A;  5FLM G;  1AE2 A;  3CCL A;  4LF6 Q;  1I6H H;  2H5X A;  2Q2H A;  2PI2 E;  3J81 c;  1KIX A;  2HT1 A;  3HOZ G;  4DR4 Q;  2CWA A;  1IBL L;  2KHI A;  5IT9 c;  4IOC A;  3PO3 G;  2MFI A;  1BVS A;  2D0P A;  1FL0 A;  4LUO A;  1WI5 A;  1HR0 L;  4JI7 L;  2CCZ A;  4XIG S;  2DUD A;  5LMU Q;  1EQQ A;  1X3F A;  2GN5 A;  3DLL A;  2VQF L;  1YZ6 A;  4BY1 G;  4DUY L;  4AYB E;  4LF8 Q;  4A3C H;  1HR0 W;  1VQD A;  1Z9F A;  4DV0 L;  2AKW B;  3PSI A;  4A3M G;  3M9B A;  4X66 L;  1W2B A;  1K8A C;  2OQK A;  1CKN B;  2AWO A;  1SLJ A;  3CCQ A;  3TEH B;  2EIF A;  3S1R H;  1MJC A;  1MKH A;  2PNH A;  3PUV A;  3TS0 A;  4B3T Q;  2KCM A;  5J3B A;  1KAW A;  3HOW G;  2CWP A;  5HGQ A;  3GTO H;  4X62 Q;  1L1O C;  3EN2 A;  5IP9 H;  1TWF H;  2PQA A;  2MNA A;  2F4V L;  4YCV A;  4AIM A;  2OTL A;  1KL9 A;  1D8L A;  2JQO A;  1VQ5 A;  4NXM Q;  3PO2 H;  1XNR Q;  4WJ4 A;  4BY7 G;  5IYD G;  1QVG A;  5IYC G;  1UWV A;  1VQ6 A;  3H0G G;  1FJG Q;  4APV A;  3RLN A;  2K5H A;  1Y1V G;  4IJL A;  3K8A A;  3TRE A;  4GLV B;  1WJJ A;  1PH5 A;  3HKZ G;  4JBM A;  1YHQ A;  4RG1 A;  4DV3 Q;  1GO3 E;  1CKN A;  4DV4 L;  1G51 A;  1BKB A;  2UUB Q;  1HNX L;  4B3M L;  1U5K A;  2F3I A;  3AYH B;  4A3F H;  1SFO H;  2Q2U A;  3GTQ H;  1S3O A;  2A8V A;  3W1B A;  2ATW A;  3KF6 A;  1EUJ A;  4AYB G;  2KHJ A;  2VL6 A;  3UDI A;  4BY7 H;  4A76 A;  2UUC Q;  4IPC A;  3PF5 A;  2JEA I;  4DR4 L;  4RMF A;  3M4P A;  3FKI H;  3W5O A;  1GD7 A;  2XGT A;  1XMO Q;  4OWW B;  3MEF A;  4GOP B;  2K14 A;  1PH6 A;  4P74 A;  2ASB A;  4BBS H;  1VQH A;  1Q86 C;  4R4O A;  4L5T A;  1PH1 A;  3ICE A;  4IFD J;  2V1C C;  2RF4 A;  3AEV A;  4UP9 A;  1VQA A;  1L1O A;  5C3E H;  4JI4 Q;  2PI2 A;  3PGZ A;  2VW9 A;  1UE1 A;  4LFB Q;  3LGJ A;  1E3P A;  4YWM A;  4JI2 Q;  1IBM L;  3OTO Q;  4JYA Q;  5GAD C;  4A3K H;  4A3L G;  1UEB A;  4LNQ A;  4DPG A;  2UXC Q;  1KXL A;  4QIW E;  4OX9 L;  2IX0 A;  3OYY A;  1CUK A;  1YBY A;  4X64 Q;  5LMN Q;  3HOV H;  1IYJ B;  2YTY A;  4FDB A;  3RZO H;  3FP9 A;  2BH8 A;  3IRB A;  1N36 L;  4GKK L;  4GNX B;  1K0R A;  2EXD A;  1OXV A;  4YCU A;  5IP7 G;  1CSQ A;  3U4V A;  2K4K A;  4O2D A;  1EFW A;  1QVF A;  2DGY A;  1E24 A;  5FLM H;  4L5Q A;  2CFM A;  3AFQ A;  4NXN Q;  2UUA Q;  4A3G G;  4IFD I;  5JJI A;  4DR3 Q;  4DUY Q;  1U0L A;  2RCN A;  5JEA G;  3RZD H;  4A3B H;  1C0A A;  2E2J H;  3GO5 A;  1YJW A;  2YU9 H;  2E2H H;  1KRT A;  1PV4 A; 
#chains in the Genus database with same CATH topology
 1XTD A;  2L9H A;  1A9X A;  4TQR A;  2XIG A;  1GUG A;  1N32 L;  3M9O B;  3OSP A;  4B9W A;  3MXU A;  4KN4 C;  3JSN A;  1PXU A;  3CC4 A;  3OIP A;  2KHS A;  1HR0 Q;  4OEL B;  3L4K A;  1KC7 A;  1FD7 D;  5EDW A;  4C1N I;  2VR1 A;  1TVX A;  4FXG C;  5CV9 A;  2ZM6 H;  4H0L C;  3K0Y A;  1XMO L;  1EZ6 A;  2VUM H;  2K32 A;  5K2M A;  5M3F B;  2Y0S B;  1LTA D;  1E4F T;  2Z6K A;  2HHH H;  2ALZ A;  4OWX B;  2J9G A;  1GUW A;  1YIJ A;  2R93 B;  2JJQ A;  4U68 A;  1J8I A;  5JEA J;  4UCV A;  2XWJ B;  5LYJ F;  2NVY H;  2YYZ A;  1Y1V B;  5CC4 A;  3VPB A;  2UXB L;  3MZ5 A;  1QUQ A;  4ECY A;  3PW4 A;  2W9A A;  2JA8 B;  3KF8 B;  3C1F A;  3Q6S A;  4J9K A;  1Z7T A;  1A0I A;  4JG2 A;  1XPR A;  1Y8N B;  2X6G A;  5FLX L;  3S2H H;  4G57 A;  3F8T A;  3OUU A;  3OIQ A;  3HOY G;  3RGX A;  3KHR A;  4X3S A;  1FJG L;  3AMU A;  3HKZ A;  1K8G A;  3SHL A;  5C1O A;  4CDD C;  4IFD G;  5KFE A;  4R8I A;  3Q0A A;  3H4D A;  3PW5 A;  1XNQ Q;  1Q82 C;  4X62 L;  1ESF A;  3J81 i;  5COR A;  5FJ8 H;  3G4S A;  1GVP A;  4ZLT F;  2YYA A;  3NGD A;  4XYL B;  2OWO A;  3L9A X;  2GLT A;  1HNW Q;  2RDG A;  3MXP A;  3M4O H;  5KFP A;  1EY5 A;  1SMX A;  2CW0 C;  3NEN A;  5E7N A;  4C3J H;  1K0S A;  1TWG A;  1GLV A;  2LXJ A;  4TKO B;  1AUV A;  2DLN A;  4PZ8 A;  1HUM A;  2C2E A;  4FO2 A;  4MV1 A;  3PO2 G;  1R4Q B;  3GTG H;  3QR8 A;  3LWB A;  1AE3 A;  2Y0S G;  4DV0 H;  2CW8 A;  3CD6 A;  3GTM A;  4QY7 A;  2MCT A;  1NNX A;  3HOX H;  4XYQ A;  3ER0 A;  3Q8D A;  1KTK A;  4IUR A;  5JJK A;  1JIC A;  3NQT A;  3C2P A;  2YU9 A;  4PNY A;  2E5L L;  3R23 A;  3KK7 A;  4ZUJ A;  2YZN A;  3MA2 B;  1IBM Q;  3PO3 B;  3PUW A;  3OTO L;  3S17 H;  4RGT A;  1L0Y B;  2I0Q A;  3AQQ A;  2HJW A;  3GII A;  1HZB A;  2QKI C;  4KV6 A;  2NN6 G;  3ETJ A;  2RQX A;  2WIN B;  2UUB L;  3VMM A;  1CE8 A;  3JZI A;  3BA8 A;  1B50 A;  1X3G A;  1X9N A;  1BR9 A;  1C48 A;  4FF2 A;  3H3V H;  1KJQ A;  3PW7 A;  5DGB A;  4OX9 Q;  1B8A A;  1FJG H;  2K5N A;  4MIU A;  4ABN A;  1PZK D;  2R7Z A;  3ULL A;  1VQI A;  3PUX A;  2DJF C;  4A3E H;  2K6A A;  4ETS A;  1BBW A;  2FMA A;  5IGD A;  5CGK A;  1PH7 A;  2PMZ E;  3R5H A;  4BXX G;  1HZA A;  4BBR H;  2B2V A;  1PYS B;  2K5V A;  2Z4H A;  4EX5 A;  5KFG A;  2N8N A;  3KYH C;  5ELD A;  1QUQ B;  4MV4 A;  5GAG C;  5KT7 A;  3T1H Q;  1S5E D;  3HOU H;  3M3Y H;  1VQN A;  1KDB A;  4QIW A;  1F9S A;  1ZYR D;  2RHQ B;  2OEO A;  4RAU C;  1ZYR C;  1RF2 D;  4OON A;  3W2D A;  1N36 Q;  2TMP A;  3KAK A;  5COY A;  1G29 1;  4OO1 H;  1B3A A;  2HVR A;  5I6Y A;  4DR1 H;  1YJN A;  1XJV A;  2A6H C;  3WOF A;  1Y1W H;  1RD9 D;  3RZD B;  1VQP A;  4J15 A;  4P72 A;  3KF8 A;  3GTP H;  2E2H A;  4LFC Q;  4NXN L;  1JOQ A;  2I07 B;  2PZU A;  3Q22 A;  3GLK A;  2IW3 A;  4G7O C;  2OCE A;  5HBR B;  1HQM C;  1K83 A;  4HMJ A;  4RB1 A;  4YR3 A;  3RLO A;  4DFA A;  2OLS A;  1JJG A;  3RB6 A;  4B3S L;  4JBK A;  1S68 A;  2ALY B;  2EJF C;  3KF6 B;  4M8A A;  3GQB A;  2UVU A;  2C9O A;  1KC8 C;  1TY0 A;  4C5A A;  1IZ6 A;  4XQQ A;  2NN6 I;  1SNM A;  1XYI A;  1HTP A;  4MV9 A;  1YI2 A;  4M7E A;  1W6J A;  1PYW D;  2SNS A;  3U4Z A;  4A3D B;  1W96 A;  3CME A;  2NUC A;  4GKJ H;  4UP8 A;  3GIP A;  2SNM A;  4DR7 Q;  2R7Z B;  2B2U C;  4IAJ A;  1GUN A;  1MGS A;  1O78 A;  1FKA H;  2W6N A;  2F0S A;  3UE0 A;  5M3M B;  2ASD A;  3DXJ C;  2GPW A;  5FLX E;  4YY3 H;  1EIF A;  3EQL C;  4KKS A;  1K8M A;  4HJ9 A;  4TV8 F;  1HZ9 A;  3A56 A;  4BY7 B;  5C44 G;  1X56 A;  3S2H B;  4GKJ Q;  3MWD A;  2IHE A;  2PQA B;  2WV6 D;  1HRJ A;  1OXS C;  4DV1 L;  4YWL A;  2G5D A;  5CAE B;  1F2Z A;  2FHT A;  1E1O A;  5I6W A;  5ELC A;  2F52 A;  2R84 A;  1A8V A;  1KD1 C;  2K75 A;  2LXK A;  1VQG A;  1KHI A;  1CS0 A;  1SDF A;  2K04 A;  1Q12 A;  3Q24 A;  3KTM A;  3OMC A;  4JI8 Q;  4N8X 1;  4K6D A;  3V6K A;  2PO4 A;  3GTM H;  2JXM B;  3KDF A;  3QIA A;  5KT5 A;  5LL6 b;  2IL8 A;  1PHJ A;  2R6F A;  2DN8 A;  2NBF A;  5FJ8 G;  4K6L A;  1O75 A;  1I50 A;  2XRS D;  1BBU A;  3NBH A;  1U4R A;  2UXB H;  4E6I A;  4GZY C;  5F2D A;  3S2D H;  1X3P A;  4KK7 A;  4DK6 C;  3Q2O A;  1WYD A;  4LF9 H;  2VUM A;  1M1K C;  2NVY A;  5KFO A;  3MR3 A;  5EKI A;  3I56 A;  2Z6B A;  2XCP A;  3MFH A;  2EXZ A;  5M5Y B;  1K73 C;  3RUP A;  5BPH A;  4A3M B;  1S5C D;  3H91 A;  3SK8 A;  1AZQ A;  1FR3 A;  4JI6 H;  5CV6 A;  5C0X J;  3MWE A;  2A5H A;  3ULP A;  2FB9 A;  2EPB A;  4DV3 H;  5ELE A;  2I46 A;  1K28 A;  2OT2 A;  2NU9 B;  1PFS A;  3UDF A;  5JH7 F;  4DV0 Q;  3T53 B;  5IT9 L;  4Z9C B;  4MTE A;  1KLG D;  4A3D H;  1SRU A;  4KHV A;  4TVA B;  2WKC A;  4DL7 A;  2N78 A;  1S4Z A;  1B6R A;  5E4W C;  3K58 A;  5KT3 A;  1ESR A;  2I5M X;  4UFZ A;  1HJP A;  3EJI A;  1YNJ D;  5KFZ A;  1UEA B;  2VQD A;  2ES2 A;  2HCI A;  1Y1V H;  1STH A;  2LMC B;  3N43 B;  5CV5 A;  2MUY A;  2UUC L;  2VQF Q;  1CKO A;  1VQ4 A;  2ZTE A;  1S0N A;  3ND9 A;  1H9K A;  2OTJ A;  1DXM A;  4ZQ3 A;  5JEA H;  3BG3 A;  5KG6 A;  1J5E Q;  4WJ3 M;  4EBD A;  2CW0 D;  2JA5 H;  2FMM A;  1VQL A;  2JA6 H;  2F0K A;  3SR1 A;  1Z2O X;  4DK3 C;  1HNZ H;  4K0K Q;  1STY A;  4IUQ A;  1VF7 A;  1N48 A;  3CQZ H;  5LOV F;  1OWT A;  5EBD A;  4I7H A;  4DV3 L;  1NCV A;  4HSV A;  2ZTC A;  1K83 B;  4CHT B;  2GA4 B;  1VQB A;  4RUC A;  2CQO A;  4IPD A;  2O4X A;  2C22 A;  3U58 A;  3HXL A;  4MV7 A;  3KUP A;  3EFX D;  3CCM A;  3MXN B;  4EGQ A;  4HCE A;  3MFG A;  5IGC A;  2DPI A;  4DV2 Q;  2NVX H;  4FM9 A;  2KEE A;  1H9R A;  3G6X A;  1IXR A;  4MTD A;  5KIX A;  1DOM A;  4B3S H;  1ICF B;  3C1E A;  1UNN C;  3E9I A;  2IY5 B;  3HZX A;  3PO2 B;  2R7Z H;  2P5Z X;  3KFU A;  1PVO A;  3TDQ A;  3M85 A;  1LTL A;  1R4P B;  1VF5 C;  5I9O A;  5EOY A;  5JUM A;  3DF7 A;  1FVI A;  1SNC A;  2JEB I;  2ASL A;  1NMG A;  1NR2 A;  4QW8 A;  2LY7 A;  2B8F A;  5D1P A;  4MN3 A;  3CC2 A;  1WVL A;  1LLR D;  4X3K A;  4YHH H;  4A3F B;  5L1L A;  1ZHQ A;  3S17 B;  3RBD A;  4JI3 L;  3GQC A;  3SEB A;  1IBL H;  4IZ8 A;  4EFB A;  2K5W A;  3NBI A;  5C5M A;  2XCL A;  4R9W A;  4MV6 A;  2E2D C;  2RA4 A;  4ECU A;  5K36 H;  1T5X D;  1PYB A;  3J7Z C;  4NKL A;  3R8B A;  3NE5 B;  2NZO A;  3A54 A;  3GIJ A;  2IJ0 A;  5EWG A;  3F2C A;  4A3E B;  1DOK A;  4JI6 L;  4KHP H;  5FO7 B;  5T1I A;  2ZJR A;  1OXT A;  2A1A A;  3I4M H;  4F4X A;  4F7X A;  1FGU A;  3PVX A;  1Y1W A;  3K5M A;  1QNK A;  2AHO B;  3HOU B;  3M3Y B;  2MHV A;  5HV6 A;  5CA0 F;  5LMN L;  4H7B A;  3GTK B;  2MO0 A;  1B04 A;  4LF6 Q;  1TS5 A;  2H5X A;  2PI2 E;  4DR4 Q;  2HT1 A;  2F0P A;  4UCO A;  5KX5 F;  2AQ4 A;  2K03 A;  2UUC H;  3MFY A;  1BVS A;  1WTQ A;  1FL0 A;  4LUO A;  4AQY H;  1DOL A;  4XIG S;  4YQW A;  3AU7 A;  1EQQ A;  3HBL A;  4L6T B;  4KMU C;  4WD3 A;  1TU2 B;  2VQF L;  4GC7 A;  1M4V A;  2BDN A;  4AYB E;  4A3C H;  3U9T A;  3T1H H;  3QWN A;  1Z9F A;  2SDF A;  3PSI A;  2R8G A;  3M9B A;  1GSH A;  1W93 A;  3T1Y H;  5KT6 A;  2AWO A;  3CCQ A;  5CV7 A;  4B3T Q;  1MJC A;  2PNH A;  4F4Y A;  3S1R B;  2KCM A;  4G7Z C;  2HCC A;  2CWP A;  1T36 A;  4ZQI A;  2J7Z A;  2F4V L;  2H4O A;  1F9R A;  2JN4 A;  2B39 A;  1JKJ B;  1D8L A;  2JQO A;  4WJW A;  3BAA A;  3P75 A;  2ZDQ A;  1X32 A;  4DR6 H;  3MR6 A;  1RTN A;  5EKK A;  1HFG A;  4ZI7 F;  2QIL A;  3FRP B;  3R2I A;  4DUY H;  1I7L A;  4IJL A;  3VYS A;  2F0D A;  1Y1V A;  2C28 A;  5KT4 A;  4FBT A;  2FIN B;  2LFN A;  4DV3 Q;  4NDX A;  3HKZ B;  2UUB Q;  1WSC A;  2F0M A;  2VQE H;  3GTQ H;  3DEO A;  2IMW P;  1E2V A;  1S3O A;  1T3N A;  2ATW A;  3X3N A;  3KF6 A;  1KJI A;  4AYB G;  2A6E D;  2UUC Q;  3PF5 A;  3A55 A;  4NXM H;  4RZR A;  3M4P A;  2XGT A;  3NK9 A;  4OWW B;  4GOP B;  4P74 A;  2ZXO A;  1PRT F;  4BBS H;  3N52 A;  3BJY A;  3KHH A;  1WD1 A;  5IOC A;  2QDL A;  3VYT A;  4IFD J;  4J9O A;  2RF4 A;  5JVG 3;  3QG1 A;  2PBZ A;  1VQA A;  3LP8 A;  1U9R A;  3D4D A;  4JI4 Q;  4LFB Q;  1E3P A;  4YWM A;  5C0X H;  1LAB A;  5GAD C;  4JYA Q;  4A3L G;  4YAK B;  3K5N A;  4QIW E;  3RZO H;  1FYC A;  5HGT A;  2BH8 A;  4GNX B;  1KLU D;  3SDZ A;  3E5S A;  5KFH A;  2K01 A;  3MC0 B;  1CM9 A;  4EQN A;  1WTH A;  2XSC A;  1QB5 D;  1EFW A;  2DGY A;  4EYI B;  1SEB D;  4NXN Q;  4A3G G;  2FK1 A;  3BZD B;  4EVO A;  2YS6 A;  4RKL A;  2JEI A;  5FD5 A;  5JEA G;  4HYK A;  2E2J B;  2J6S A;  1JXL A;  4A3B H;  1C0A A;  4RB2 C;  2L55 A;  4QIW B;  1YJW A;  1NUC A;  1MI2 A;  2YU9 H;  1F2Y A;  1PV4 A;  3S2D B;  2OH2 A;  4JI5 Q;  4OEM B;  1Z47 A;  1CQI B;  3BVM A;  3NWS A;  4GKK H;  4CBV A;  5DM6 3;  1JE5 A;  5K5P A;  3GTJ H;  3BAB A;  1A62 A;  2LSS A;  3VR5 A;  2K05 A;  2RGV A;  5DG7 A;  3EBE A;  2R86 A;  3H0G A;  1NR4 A;  1EZ8 A;  4RZQ A;  4OWT B;  3L7Z C;  5TSS A;  4FVM A;  3D31 A;  1VQC A;  3RN5 A;  3MXG A;  4BBR G;  3HOV G;  3K57 A;  3GTJ A;  1Q3L A;  2QF7 A;  1DJR D;  5CV8 A;  1PH9 A;  4O4L F;  4AYB A;  4XT1 B;  1HCZ A;  2QA4 A;  1ILP A;  1EY0 A;  2KOL A;  1HPC A;  3A0J A;  3GV6 A;  4P75 A;  3PF4 A;  2KCN A;  3DWQ A;  3E6Z X;  1S5F D;  1DON A;  3UQ8 A;  5BN4 A;  4ECW A;  3ZJY C;  2I5L X;  2R7Z G;  4QWE A;  3VR4 A;  4A3I H;  1BNZ A;  3CQZ A;  1I4H A;  1PH8 A;  3KLR A;  1EWH A;  1VCI A;  4EFE A;  4ZUI A;  5IGE A;  5FLX c;  4IO9 A;  3VR3 A;  5LL6 X;  4KHP Q;  3OWF A;  4KKU A;  4DK1 A;  3Q23 A;  4XYM B;  2VQE L;  3A7A B;  2WAQ B;  2W9C B;  2EY6 A;  4IUP A;  4B3T L;  1YNJ C;  3P7J A;  5T14 A;  3E0J A;  4QGU A;  4X65 H;  3H0G B;  2UUA H;  2F0E A;  3GP7 A;  3TN2 A;  2F3W A;  1UAP A;  3RAX A;  1K83 H;  4YBZ B;  1TWC B;  1V4Y A;  3EPI A;  3H94 A;  2HGS A;  2H1E A;  4DNR B;  2Z9H A;  2ZJT A;  2R7K A;  4OIK A;  1EYG A;  2YS7 A;  1SJE D;  2DPJ A;  2PZW A;  4X6A H;  5E1F A;  2NVX B;  4V19 0;  1KDC A;  3S14 H;  3MR2 A;  1N56 A;  3L4J A;  1HR0 H;  3S1N H;  1B6S A;  1V9P A;  4H02 A;  1VQE A;  2R93 G;  4IR9 A;  1BCP B;  2MO1 A;  2Y0S A;  4RCN A;  4C2M B;  5M5W B;  2NU8 B;  2B2V C;  3HOX B;  1PTO F;  4K5V A;  4JI7 Q;  1IYV A;  1SXT A;  2K52 A;  5J2T F;  5KFA A;  5KFF A;  2FLP A;  3X3M A;  2HHH Q;  4A93 G;  1QOH A;  1B7Y B;  3OW7 A;  4CDE C;  3KJP A;  1XX8 A;  3FKI A;  1BDO A;  1KEE A;  3NHH A;  4S3S A;  3OHB A;  4IPH A;  1C9O A;  4Y7N B;  1WD0 A;  4YJ2 F;  3PIP 3;  1MSH A;  4LFA L;  3TRZ A;  2BQ3 A;  3G7L A;  2M00 A;  3PCO B;  3JC6 6;  3R3O A;  2Z0S A;  5CMD A;  4DV4 Q;  4LMY A;  1BCP D;  4A3C G;  4DR3 L;  5KFC A;  3MTS A;  1G91 A;  1SNQ A;  1R9T H;  3TIG A;  4B3R L;  3CCE A;  2XN9 C;  3UFX B;  1XPU A;  4BA2 I;  3LML A;  4C5B A;  2KJX A;  1YJ9 A;  1SE2 A;  4DR4 H;  3FHW A;  4R8N A;  1OO9 B;  1BO0 A;  3ORQ A;  1BNC A;  4QJF A;  2E2I A;  1GUT A;  1E2Z A;  1EWI A;  1LT5 D;  1VQO A;  1I3Q A;  3Q8S B;  4F4Z A;  2PYK A;  3HRZ C;  3DWP A;  3GD7 A;  1XMQ L;  1QZG A;  4A3I B;  4R4C A;  5C4J H;  1S5B D;  3IL8 A;  3I7F A;  1XPO A;  1OXU A;  5KKN B;  4G7H C;  3GTK H;  3NSW A;  1PRT C;  4BWG B;  5C0X G;  1EY8 A;  4OIJ A;  4GKJ L;  4K8I A;  1WTX A;  4AH6 A;  1HZC A;  1RHP A;  4LF9 Q;  1I94 H;  2A68 C;  1I3Q H;  5EQ0 A;  1D6E C;  1O7I A;  2WB1 E;  1M7J A;  2B8G A;  3CQZ B;  5KG5 A;  2WB1 G;  1HH2 P;  3H0G H;  4K8J A;  4JYA L;  4OXP A;  4LF5 H;  4LF4 H;  3N40 P;  1JWS D;  4ODG A;  1BJT A;  2GVB A;  4ZHQ F;  1ZKO A;  2MP1 A;  5BR8 H;  3GTQ A;  1AN8 A;  4NXN H;  5M3M G;  3J7Y W;  1I94 Q;  2G9D A;  3FMC A;  4X65 L;  2VUM G;  2D2C C;  2L5T A;  1IL8 A;  2F0V A;  3FKI G;  3CCU A;  5D1O B;  1CT1 D;  3J81 j;  3UE1 A;  1SYF A;  4LW1 A;  3P20 A;  4UCT A;  2BR0 A;  4BY1 H;  5BN3 A;  3HP3 A;  4HR7 B;  5C3E G;  3MFI A;  1HUN A;  4GS3 A;  3GTL B;  1LTI D;  5M3M H;  1Q81 C;  3J7A F;  5AJ3 L;  5GAH C;  4JI4 H;  1Y8P B;  1RK6 A;  3C3L A;  2DJG C;  1Q90 A;  2RCF A;  2CQA A;  3PUZ A;  5C4X H;  2V58 A;  4FS2 A;  1PTO C;  1V1Q A;  1STE A;  4JI0 Q;  3HOY H;  3GV3 A;  4RB0 A;  2FXQ A;  5KG1 A;  1UC8 A;  4ALP A;  1WH2 A;  4POF A;  3P1H A;  2WB1 B;  1TWF A;  1MSG A;  4DXG A;  1NTG A;  2OXP A;  2ZDG A;  4ULL A;  4JI6 Q;  4K2L A;  4DNI A;  3DEP A;  5K36 G;  4PV1 C;  4P71 A;  4C2M A;  1STA A;  1JIH A;  1EOV A;  2UUB H;  1FNU A;  3HOZ B;  3D8G A;  1P8L A;  4LFA H;  3T56 B;  1S10 A;  4OHJ A;  1NE3 A;  5T1G A;  5H1S E;  1PX2 A;  3S1Q H;  1EYZ A;  2HQE A;  3CC7 A;  4MHE A;  3N42 B;  1JCK B;  3SGI A;  5IWA H;  1EHI A;  1IBK H;  1N9W A;  2X6L A;  4GOP C;  1PH3 A;  2UU9 L;  2NVX A;  5BPF A;  1T9H A;  4HR7 A;  4ZK9 B;  4CJ1 B;  2WAQ E;  2KCC A;  5A2Q L;  4RGO S;  1LT4 D;  4J0M A;  4F88 A;  2E5L Q;  4LFB H;  3NWT A;  2E2I B;  4CGY B;  2JA7 A;  3SXH A;  2PPB C;  4K2K A;  5D1O A;  4HJ5 A;  1Q1E A;  3R2T A;  5C5J A;  4EBC A;  3J7A K;  2NZ1 D;  4LF7 H;  3IN5 A;  1WCM B;  1EWC A;  3L2P A;  2Z6K C;  3U9O A;  4C3I H;  4FYD A;  3K6O A;  4ILW A;  2UVW A;  4LWC A;  3GID A;  1LTB D;  3ULJ A;  2Z8L A;  3WOE A;  3I4N H;  4TUY F;  4HNU A;  5M5Y H;  4KD4 A;  1UE5 A;  5H80 A;  3KXY T;  1XNQ H;  1T94 A;  1N33 L;  1R9T A;  3TS2 A;  2ZDH A;  1SYC A;  1SYE A;  4JOI A;  2RDI A;  1SR3 A;  2KQ3 A;  2WB1 A;  2AGQ A;  2R82 A;  4O4I F;  5LA6 F;  3Q8R B;  3CPF A;  1X65 A;  3AFP A;  4QL5 A;  1GHK A;  2F0H A;  5C44 H;  4P73 A;  1UNS A;  2Q8I B;  4GLX A;  5GQO A;  4K0K H;  3J80 L;  3T5L A;  1PTO B;  2VY3 A;  5KFB A;  3A5Z B;  1VQF A;  1O80 A;  3IG0 A;  5IY0 A;  3OW2 A;  1I94 L;  2JA8 H;  2QCP X;  2D0O A;  3I72 A;  2KSW A;  3I90 A;  2IPK D;  3HOX G;  4F50 A;  5EPJ A;  3RB3 A;  2M2L A;  3TQY A;  3BS1 A;  5JPN C;  3KAL A;  1X3E A;  5KG0 A;  2W6O A;  2PVP A;  4OO1 G;  3VPD A;  1ENA A;  4WOR A;  1XMQ H;  5C4X G;  1SFO A;  1VQK A;  5L37 A;  1HA6 A;  3SE0 A;  4N9P A;  4O2B F;  2VB2 X;  1I50 B;  2FK2 A;  3DHQ A;  1QCB D;  2FE3 A;  4OX9 H;  2NVQ B;  3ZYY X;  1A6X A;  2X69 A;  1AH9 A;  4HID A;  4JI1 H;  2ZXP A;  5LL6 S;  2VA2 A;  2JP1 A;  1C3O A;  2WKD A;  4HTH A;  1ASZ A;  4QUC A;  3QO2 A;  1VMC A;  1CA5 A;  4A3E G;  3M4O B;  3OMG A;  4FF3 A;  1XMQ Q;  1SND A;  2A6H D;  3R5X A;  2FJ2 A;  4DV1 Q;  4O4H F;  3PR4 A;  5LMU H;  4MNO A;  2O5J C;  1YVC A;  3J81 W;  4G3I A;  2F4I A;  1LV9 A;  4BY1 B;  4HED A;  3I91 A;  1JWU D;  4EQO A;  2VQF H;  2AQ2 B;  1SAP A;  3M4I A;  3A74 A;  3WWV A;  4CKC A;  4GOP A;  1IHZ A;  1TWG H;  4ECT A;  1C4Q A;  4L8J A;  5M5X B;  1I4R A;  4LUV A;  1HQR D;  2L4N A;  2NU7 B;  4M9U A;  2IX3 A;  2HIV A;  3I55 A;  1KQS A;  5FPO A;  2UXD Q;  4RFB A;  1XXG A;  2JYO A;  1LM0 A;  2DIK A;  2PW5 A;  3D4W A;  4GKK Q;  1BGW A;  4IPG A;  4RNO A;  5IGG A;  4HNV A;  2A73 B;  1K3R A;  4G4K A;  4XYO A;  1VDZ A;  3J80 E;  2SEB D;  4IZO A;  3SK6 A;  2R3Z A;  1N34 Q;  2JEG A;  2Q2I A;  4CJ2 C;  2M9V A;  4O3P A;  5J39 A;  1MZB A;  4ED7 A;  2OF1 A;  5C3W A;  2K33 A;  4HJA A;  2L15 A;  2VB3 X;  3BYY B;  4IJH A;  3TP5 A;  1K8O A;  4GN5 A;  3BU2 A;  3NEL A;  1SSO A;  4JI1 Q;  1ML0 D;  2EY1 A;  1DIK A;  2K50 A;  4J6H A;  1B53 A;  5L1J A;  4X64 L;  1WTO A;  5FLM G;  3CCL A;  1I6H H;  1S9F A;  1FNV A;  3J81 c;  3QFF A;  4A3G B;  1IBL L;  1KJ9 A;  1DV1 A;  2KHI A;  3K7A B;  4IOC A;  1PK8 A;  2F4V H;  5A35 A;  2MJ8 A;  5IGB A;  1GSA A;  5CBA E;  1HA5 A;  2D0P A;  4FBU A;  4FU0 A;  1FNW A;  2K5D A;  1ICW A;  4JI7 L;  1XMO H;  1CQV A;  2EYH A;  2E75 C;  2DUD A;  5C5L A;  2F03 A;  3RB0 A;  1X3F A;  3I4L A;  4BS9 A;  5KFL A;  4J9S A;  1HR0 W;  1VQD A;  4DV0 L;  2AKW B;  2TSS A;  4A3M G;  1PDQ A;  1G2T A;  2C2D A;  1W2B A;  4IFD H;  1K8A C;  1CKN B;  3VYU A;  1PRT B;  4UCR A;  3S1R H;  5FO8 B;  3OHA A;  3BA9 A;  1KAW A;  4C3J B;  5CR3 A;  5HGQ A;  3GTO H;  3HOW G;  5KNC A;  1KBL A;  1L1O C;  2EY2 A;  2ASJ A;  2CHB D;  1KJ8 A;  2CH4 A;  4DF7 A;  4RGN A;  3LWE A;  4MV3 A;  1KL9 A;  3PO2 H;  2QK4 A;  2IWH A;  5IYC G;  5F9N A;  2XGP A;  1VQ6 A;  3H0G G;  2QYZ A;  3SI8 A;  2W8L A;  3RLN A;  2EYM A;  2K7V A;  3TRE A;  1PH5 A;  2EYO A;  3HKZ G;  4JBM A;  5CBE E;  4DV4 L;  1G51 A;  1SFO H;  3AYH B;  1KNE A;  4A3F H;  5GON F;  4J9P A;  1EQT A;  3W1B A;  5JVD F;  1B1Z A;  2VL6 A;  4ZCK A;  3UDI A;  4IUV A;  5D3D A;  2B2W A;  3W5O A;  1XMO Q;  3FKI B;  1PH6 A;  2K14 A;  1VQH A;  3ICE A;  4UP9 A;  3D6W A;  2YCH A;  2PI2 A;  1WTR A;  4IQZ A;  4A3K H;  5KFY A;  3HOV B;  2IX0 A;  3OYY A;  4FP5 D;  3NTK A;  5KND A;  5LMN Q;  3BQ0 A;  4FF4 A;  5JVL A;  1E2W A;  4GKK L;  1CA6 A;  1K0R A;  1OXV A;  3K5O A;  4YCU A;  3VR2 A;  4IHJ F;  3GTM B;  2LKV A;  3QJY A;  4CJ0 B;  1K3B C;  2CFM A;  2UUA Q;  5JJI A;  1IOV A;  4RHR A;  1GGO A;  1DCZ A;  5I47 A;  3RJ0 A;  1PTO D;  4IWX A;  2FFK B;  3GO5 A;  2W9C A;  1KRT A;  2V59 A;  4C3J G;  3HOW B;  5I9P A;  4J9N A;  3CXC A;  4JI8 H;  3GIL A;  1LO5 D;  4ZKC B;  3WO1 A;  4DR2 L;  4RCO A;  4UPA A;  4LF6 L;  2W9B B;  1FGB D;  1PZI D;  3SVM A;  2A19 A;  1N34 L;  2RDH A;  1XWE A;  4I7A A;  5LMU L;  2RDJ A;  4MTN A;  5IE8 A;  1BCP F;  4QF4 A;  2NVT B;  3TII A;  4GNX C;  5KFI A;  4HNT A;  4I50 F;  4PDB A;  1TS3 A;  3JSL A;  5GRO A;  4RU9 A;  3A8I E;  2KUM A;  2AUK A;  2F0W A;  3QOL A;  4MZ9 A;  2I8C A;  3T1H L;  4IRC A;  1EUD B;  4R4T A;  4JV0 A;  5DGA A;  1X54 A;  4YAJ B;  4Y8V B;  2B29 A;  4NW2 A;  3K5L A;  2W6P A;  3GTL H;  5KG3 A;  2NVY B;  4XTC S;  4ZOL F;  2FK3 A;  1GUS A;  1WFQ A;  2EJM A;  4PG3 A;  4A93 B;  2FPG B;  4YY3 L;  5KFX A;  3TP7 A;  1I6U A;  3U50 C;  3VYR A;  1YNN C;  3KOJ A;  4JPB W;  1PA6 A;  2D9U A;  3G48 A;  5CV4 A;  4LK1 C;  4DR5 Q;  1MJE A;  3H40 A;  5IIF A;  1EIH A;  1TWH B;  1BXR A;  5DQI A;  3HG9 A;  1D2B A;  2W6Z A;  1PRT D;  2PW7 A;  1PMR A;  3MAQ A;  1I7N A;  4Q45 A;  4TQU S;  4ZRZ A;  1GOZ A;  4ECQ A;  2Z1C A;  3ETH A;  1TII D;  2ENB A;  2EVB A;  3FPU B;  5KG2 A;  1STG A;  3RAQ A;  4O3Q A;  4A3L H;  2BDO A;  1P16 A;  4ECZ A;  5LMN W;  1AEX A;  3K7U C;  3D0F A;  1AP0 A;  1S5D D;  4E4T A;  1N33 Q;  4TQS A;  5IYB G;  3E0E A;  3GIK A;  2AQ3 B;  5IP7 H;  2RVL A;  1MBY A;  3I70 A;  4KTA A;  1XTC D;  3CW2 C;  2BQU A;  1E1T A;  3M4Q A;  1Q8K A;  1IBL Q;  4JUZ A;  3RTX A;  1ZEQ X;  2N3S A;  1GSO A;  1PFM A;  4KJN A;  3RR5 A;  4H44 C;  4A3J B;  1E4E B;  1LTG D;  2RSO A;  3KJO A;  2I87 A;  2E2H B;  4JV1 A;  3HOW H;  4DKA C;  4ZKB B;  5KRU A;  4CDF C;  4IUU A;  2IX1 A;  2A68 D;  5HY6 A;  1KDA A;  1I4X A;  4ME6 A;  2R61 A;  4PQX A;  4KHZ A;  4ZAI A;  3EA6 A;  2RKS A;  4J8Q A;  1C7Y A;  1YNN D;  2VNU D;  4B3S Q;  3PZP A;  2R7M A;  5F9L A;  1M8A A;  3EIV A;  1V51 A;  1VQ8 A;  1JJC B;  5DLQ E;  2XC9 A;  2PN1 A;  3H15 A;  2XCA A;  4DR5 H;  4FF1 A;  1A3V A;  3VR6 A;  2K5Q A;  3SK4 A;  5EKL A;  4JVZ A;  1WR2 A;  1QJO A;  4EBE A;  2W7P A;  3R5F A;  3LNN A;  2F1M A;  3FVQ A;  4A3D G;  4Q44 A;  4GNX A;  3BZC A;  1DM0 B;  1MD2 D;  5C4J B;  1NY4 A;  1HNW L;  4XQJ A;  2FJZ A;  1F9P A;  1ZQ7 A;  4DR3 H;  3L3O C;  2VQE Q;  1NJI C;  1G2S A;  2KBN A;  3S15 H;  4NB3 A;  1TWH A;  4RA8 A;  3A8K E;  1CKM A;  5C8Y F;  3K7A H;  4DV6 H;  2B63 A;  2HDL A;  3OTO H;  3NTH A;  1ET9 A;  1I3Q B;  5HUR A;  5M9O A;  1EUC B;  2YU9 B;  4PZ6 A;  1ASY A;  3OPO A;  1B4O A;  2B2Y A;  3V96 A;  3PV0 A;  4Y52 H;  4CDC C;  4DNT B;  3NXW A;  4U6P A;  2Y0S E;  1B9M A;  5IGF A;  3D3R A;  1E22 A;  1SYG A;  2WDT A;  2W9B A;  4DR5 L;  2A74 C;  4JI8 L;  1SE8 A;  4R4Q A;  1V43 A;  3CCJ A;  3F8N A;  2MGS A;  3CCS A;  2ZM6 L;  4YY3 Q;  2VPQ A;  3K0X A;  3GTO B;  1A3T A;  4A75 A;  3KLS X;  3GTL A;  2O5I C;  4KKT A;  3MWM A;  2R6G A;  2QEJ C;  3MVV A;  1LT6 D;  1YIT A;  5BR8 L;  1XDN A;  2R92 G;  3GTG B;  3HGB A;  5C44 B;  2E74 C;  4JV5 Q;  2JA8 G;  5EZY F;  5M5W H;  3U9S A;  4DAP A;  4LF5 L;  1JJ2 A;  4RAZ A;  1VMP A;  2KCT A;  3PO3 H;  4JI2 H;  5CB4 F;  4Y7N H;  1WCM G;  3T16 A;  2ZJP A;  2DY8 A;  3HFZ B;  1VQM A;  2PNR C;  1VQ7 A;  3H09 A;  2EQS A;  3UDG A;  3PW0 A;  4L5S A;  4YHH Q;  5IT9 W;  1J6Q A;  3V6J A;  2NN6 H;  2AGO A;  5IWA Q;  1IBK Q;  1GJX A;  1ROD A;  1TWA B;  1EIY B;  5J1Z A;  2XRQ D;  2QEX A;  4JW0 A;  1KAB A;  5FKA C;  4R7R A;  4POG A;  3BVZ A;  1QVC A;  3LX0 A;  3B6Y A;  3STB C;  5EBC A;  1RKN A;  3MXN A;  2NVQ H;  4O2A F;  5FLX W;  5L1K A;  3I4O A;  4Q0Y A;  2Z4I A;  3M9M B;  3O13 A;  4JI1 L;  4IOA A;  2PZT A;  3RBE A;  4FNF A;  4NLG A;  5EWF A;  1EY7 A;  2G9H D;  5KYI A;  1WTW A;  2D62 A;  4QQB X;  1S0M A;  5C0X I;  1CQF A;  2WAQ G;  3BYT B;  3NPP A;  1I5F A;  5KFJ A;  3QOJ A;  3BJU A;  4LF9 L;  4B3R H;  3UDX A;  2KEN A;  2XWB B;  2QW7 A;  1JOK A;  2BOS A;  4DR6 Q;  4BBS G;  3TP8 A;  2YTX A;  3BQ2 A;  4IWY A;  1J5E H;  1U4P A;  4C2M H;  4A3J H;  2R7N A;  3CPW A;  4ED1 A;  3GTP A;  3GTK A;  5DG9 A;  2W6Q A;  3GV7 B;  1JQY D;  3GDE A;  4J1M A;  4YR0 A;  2A69 C;  1NSN S;  1RJP A;  4X65 Q;  3FMA A;  4DV2 H;  3I4N B;  2B2U A;  3RLF A;  1SYX B;  3CU7 A;  3EPG A;  4A3M H;  5KFD A;  1LTR D;  1SEI A;  4ED2 A;  1B9N A;  2HVQ A;  2R8K A;  2B63 G;  3M7G A;  3KHG A;  3H3V I;  5DQG A;  3PMF A;  1LYL A;  1JB3 A;  2RHS B;  4MA0 A;  3ND8 A;  1TA8 A;  1B44 D;  4GN4 B;  2B63 B;  1HHV A;  3J81 E;  3C46 A;  1RJQ A;  4L1K A;  1GYF A;  3JAM L;  3RD4 A;  4LF4 L;  1STN A;  1OXX K;  5D3I B;  4O1N A;  5IP9 G;  2FKL A;  2W57 A;  1NAP A;  1O7L A;  4ME3 A;  4X66 Q;  2CH4 W;  1DV2 A;  5KFN A;  4J9L A;  1EEF D;  3H6M A;  3T51 B;  4GLA C;  5JOB A;  3QB3 A;  2ZM6 Q;  3OWE B;  3N41 B;  1D5Z C;  4JI3 Q;  3S24 A;  3QZ7 A;  4HAE A;  1SCU B;  3D6C A;  2JA9 A;  5C4H A;  3WO0 A;  5KEE A;  2CVR A;  4M1U B;  1I6H B;  3SE7 A;  4J9Q A;  1TWH H;  4C1N K;  1RYS A;  3BG5 A;  4YCW A;  4DXF A;  3TQT A;  3DM1 A;  4LH7 A;  4LF5 Q;  1EU3 A;  3S1M B;  4JOI C;  4RNM A;  4A3I G;  4QWC A;  2BA1 A;  3E5N A;  2OQ0 A;  1BCP C;  2F0G A;  5BR8 Q;  2V4R A;  2EYJ A;  3RV3 A;  1CI3 M;  5G3L D;  1GM5 A;  3S1Q B;  4IN3 A;  1LTT D;  2VZA A;  2CZG A;  4O3N A;  4EEQ A;  4JV5 L;  2FLL A;  3T13 A;  5EWE A;  1PH4 A;  1D7Q A;  4HQ6 A;  3T5H A;  5EAY A;  1TXY A;  4C3I G;  3KHL A;  2AU0 A;  4FS1 A;  4Q8E A;  2NWG A;  2F0J A;  3CAM A;  4R8U A;  4I65 A;  4DAY A;  5AJ3 Q;  1TWA A;  4QB4 A;  2JA7 H;  1JDE A;  1SRO A;  1RL2 A;  3KBG A;  3J7A V;  1SE3 A;  3HKS A;  1I4Q A;  4A3B B;  1TWG B;  4EGV A;  4C3I B;  5IWA L;  1IBK L;  3V4S A;  4HMI A;  4YR2 A;  3RIZ A;  2K28 A;  3G6E A;  2SOB A;  3NBH B;  4IRD A;  5DNF A;  4A3B G;  4KY7 A;  1T5E A;  2R92 B;  2JA7 G;  3IFT A;  3BDO A;  4OGQ C;  2R92 H;  5KYL A;  5FOB B;  4LFB L;  4UCS A;  1HNX Q;  3AB9 A;  4B3M Q;  3J80 c;  2EOT A;  1BUV T;  1M90 C;  1JT8 A;  2SCU B;  1DGS A;  3GV5 B;  1HNZ L;  2EDG A;  2ID0 A;  3VDY A;  1WTV A;  3TME A;  1VQJ A;  5GAE C;  2B63 H;  1N36 H;  2FLN A;  2XGQ A;  3I3C A;  4CKE A;  3W1G A;  2UU9 Q;  5EPK A;  4XT3 B;  4RH6 A;  3GIQ A;  4HSP A;  5IT9 E;  5KFW A;  1PFN A;  1JMC A;  4MTK A;  1MIU A;  2V9W A;  2VS1 A;  4JI4 L;  3HB9 A;  4PWQ A;  1STB A;  4KLK A;  1F2L A;  2AUJ D;  1Y14 B;  2E5L H;  2N88 A;  3STB D;  5KG7 A;  3HKZ E;  4K0K L;  2IP4 A;  1L0X B;  2KA7 A;  4C3H B;  2F0F A;  1ZXT A;  2Q2H A;  4Q5V A;  1KIX A;  3HOZ G;  2UVR A;  1UC9 A;  2V4D A;  1F2M A;  5IT9 c;  3PO3 G;  4J9M A;  1UUP A;  3S9W A;  3FDT A;  1HR0 L;  1Z2P X;  1I4G A;  2F3V A;  2GN5 A;  4DUY L;  4LF8 Q;  1QIL A;  5IYZ F;  2XNA C;  4JV5 H;  3Q1K A;  1C30 A;  5C3X A;  4X66 L;  2OQK A;  5A2Q W;  3RFC A;  2EIF A;  3CRL C;  3PUV A;  3TS0 A;  5J3B A;  5KFQ A;  1HFN A;  4DUZ H;  3TBI B;  1IYU A;  3EN2 A;  1GUO A;  4JI0 H;  2MNA A;  2JEF A;  3JRW A;  4YCV A;  3N8D A;  2HUG A;  2R7L A;  4DV7 H;  2OTL A;  1VQ5 A;  3EYY A;  2ICI A;  3G6Y A;  4F8M A;  1XNR Q;  2J6T A;  5DLG A;  3LWU A;  5IYD G;  1QVG A;  4BY7 G;  4K5X A;  1M0W A;  1FJG Q;  3H20 A;  3K5H A;  1BQQ T;  1Y1V G;  4GLV B;  1WJJ A;  3TZU A;  2BE5 C;  4RG1 A;  4DK0 A;  2F0I A;  3URY A;  3IAY A;  1CKN A;  4A93 H;  1U5K A;  2F3I A;  2JA6 A;  2A8V A;  3OUZ A;  3HOY B;  1EUJ A;  2KHJ A;  4BY7 H;  4CKB A;  4A76 A;  1EY4 A;  1IBM H;  4DR4 L;  4RMF A;  2J0T D;  3FKI H;  3MEF A;  4EQP A;  1Q86 C;  4R4O A;  1PH1 A;  3NP8 A;  1JC7 A;  1W6K A;  2V1C C;  3FPP A;  1AZP A;  2I80 A;  3J80 W;  1PZJ D;  1L1O A;  2NTT A;  4JI2 Q;  4EYH B;  4A3K B;  4C3H G;  3TQ1 A;  4LNQ A;  1KXL A;  4DPG A;  4P2C B;  3RZO B;  4OX9 L;  3MJF A;  3KAJ A;  4BBR B;  4X64 Q;  3BDL A;  5DEH A;  4A2B A;  1IYJ B;  2YTY A;  4FDB A;  1C8C A;  3FP9 A;  1QG7 A;  2KVM A;  3IRB A;  2EXD A;  5IP7 G;  2WAC A;  2YZG A;  2K1B A;  4I7Z C;  1EL0 A;  4DLK A;  3U4V A;  4O2D A;  1RCV D;  3S15 B;  3S1N B;  4DR7 H;  4UDU C;  1E24 A;  2BCO A;  3AFQ A;  1K1Q A;  4IFD I;  2R8I A;  2NB0 A;  5KGU A;  4DR2 H;  1U0L A;  2RCN A;  4KN7 C;  1EFI D;  1SE4 A;  4ED6 A;  3V6H A;  4X64 H;  4QWA A;  3GTP B;  3TSS A;  2N49 A;  2M05 A;  1NBW A;  1B33 N;  5KFM A;  4B3R Q;  1YEZ A;  3I8Z A;  3RMH A;  3GTJ B;  1GKH A;  1G8Z D;  4UCU A;  2HHH L;  5CYU A;  2YW2 A;  2WP8 J;  2ZXR A;  1GHJ A;  1EYA A;  4Q8F A;  4LJZ C;  4A4I A;  5EPL A;  3T1Y Q;  1SBB B;  1JDB B;  3M9N B;  1V1P B;  2JA5 G;  3IFD A;  3SK5 A;  1V8Q A;  2B2T C;  4RAY A;  1TR5 A;  1RIP A;  5I2Y A;  1CHQ D;  3K3P A;  5KG4 A;  1S40 A;  4ECR A;  4U7C A;  1I6V C;  4HJ7 A;  4O42 A;  2YV5 A;  2WYO A;  1UE7 A;  3I4M B;  4O3O A;  1D1K A;  2UXD H;  1O7Y A;  2UXC L;  1B2T A;  1D5M C;  2RBM A;  3MEH A;  5LXT F;  1EIG A;  4ID6 A;  3JAM i;  1HNX H;  5IYD H;  5C1P A;  4B3M H;  4DGZ A;  1A3U A;  1KAA A;  3CHB D;  3N6R A;  4FXD A;  4RNN A;  4DV6 Q;  3K3V A;  5ELF A;  3MR5 A;  4AYB B;  3ERQ A;  4UHV A;  4DR6 L;  4DL5 A;  2EJG C;  3CF5 A;  4EEY A;  4RUA A;  5JAV A;  4XX0 B;  2UU9 H;  4JCV E;  4YWK A;  4KI0 A;  1SMY D;  3D4R A;  3L0O A;  3A5U A;  5IOD A;  1U4M A;  4DL4 A;  4RKB A;  5C3E B;  1Y69 U;  3DUZ A;  4HIM A;  4DAM A;  2F0L A;  2C5C A;  3GIM A;  1H9S B;  1HXY D;  1ZET A;  3BVG A;  2EY5 A;  4A3K G;  1VQ9 A;  2Q8R E;  3IKJ A;  2NYZ D;  4DV7 L;  2BH2 A;  4V0B A;  5FPR A;  2YZM A;  3F1Z A;  1Y1W G;  4ECS A;  2EYL A;  4DUZ L;  3N6X A;  2E76 C;  5KFR A;  1XNR H;  4AQY L;  2ATL A;  1CTM A;  2LS0 1;  2AWN A;  4HJ8 A;  2YRW A;  3G6V A;  3F2D A;  4LF6 H;  3HOU G;  3J7A 5;  1Q1B A;  1PFB A;  4JC0 A;  1IW7 D;  3GV8 B;  1TT2 A;  2C35 B;  5NUC A;  1HNW H;  4RGM A;  5M5X H;  1H95 A;  2UXB Q;  3TIN A;  3I12 A;  3KLW A;  5BN5 A;  3I4N G;  3G71 A;  2HVS A;  2A6E C;  4PZ7 A;  4LF8 H;  2F0T A;  4BWS C;  4KJO A;  5E4X A;  4QWD A;  4HN7 A;  2UUA L;  1RK5 A;  3KDF B;  2CQY A;  1QZH A;  2NVT H;  2VXW A;  4JI5 L;  1EU4 A;  3BDC A;  1V1P A;  2BE5 D;  4DAY B;  2DNE A;  1F9Q A;  2XVS A;  1EOT A;  2WAQ A;  2XTI A;  4YB8 B;  2AGP A;  2GVA A;  1W3S A;  1RYR A;  1AW7 A;  2ICE C;  3HS0 C;  4GN3 B;  5FO9 B;  4UY8 C;  1ILQ A;  2EE1 A;  4O0A A;  4NXM L;  5DLF A;  3ERS X;  4DAV A;  2L12 A;  1E4G T;  3PIO A;  4L63 B;  1YHB A;  5BMV F;  5KFV A;  3PN1 A;  5JQW A;  1PTO H;  2QGQ A;  5JJL A;  1H9S A;  5AFW A;  4DV4 H;  1CHP D;  3F2U A;  1JWM D;  2I5H A;  5C6A A;  2BA0 A;  4WBN F;  1B70 B;  1EYC A;  2F0N A;  3OHX C;  4LAA A;  2D5D A;  4DR2 Q;  1BOS A;  3E9H A;  1IKL A;  4A3G H;  4RB3 C;  3DM3 A;  1SYD A;  1ULZ A;  1HTL D;  2NZH A;  2E2I H;  4IRK A;  2GPS A;  4A3F G;  4MAM A;  1DZ1 A;  1TS2 A;  4J9R A;  1Y1W B;  1LAC A;  1GXD C;  3H3V C;  3S1M H;  2R7D A;  2JEJ A;  4O3S A;  4BXX H;  1QE6 A;  2IT1 A;  3T1Y L;  3S16 B;  4KHP L;  4JK1 C;  5ISR A;  2R8H A;  3RNU A;  4XQN A;  1S72 A;  4LFA Q;  3DWA A;  1CZW A;  2HDM A;  4A2A A;  4X3T A;  1JE4 A;  1RJR A;  1JOO A;  1JX4 A;  4JV2 A;  4DR1 Q;  3V4Z A;  4OL7 A;  4HIK A;  3RN2 A;  2CW7 A;  4DL3 A;  1N34 H;  1F77 A;  1K9M C;  2O2L D;  3S14 B;  4CC5 A;  2ZT9 C;  3BZK A;  1TWF B;  4DV6 L;  2C2R A;  1J5E L;  3PUY A;  4EQ5 A;  5KFS A;  3OSN A;  4DV1 H;  1IL2 A;  1RDP D;  2W6M A;  1Q46 A;  2PMZ B;  4WFN 3;  2JA7 B;  2R93 H;  1L0W A;  3GTG A;  1K1S A;  1CZG A;  4DV5 Q;  1M0T A;  3DMU A;  1N32 Q;  3TP6 A;  3A8J E;  3GTQ B;  4JI7 H;  2NU6 B;  2L11 A;  3K5I A;  5EJW A;  4DUZ Q;  1BXT A;  2B2Y C;  2R7F A;  1SFO B;  5ELO A;  2RSN A;  1ENF A;  4QMG A;  3RV4 A;  2R93 A;  4YIJ A;  4DA2 A;  2UXC H;  2JSO A;  1Z2N X;  1HNZ Q;  1ENC A;  4DV7 Q;  4L5R C;  1IW7 C;  5KFK A;  2PQE A;  2ZJQ A;  1R9T B;  1X6O A;  1D5X C;  1Q8I A;  1SNO A;  1I50 H;  5DAU A;  5D8D A;  3CCR A;  2X0S A;  4ED3 A;  3VPC A;  3CP0 A;  2JE6 I;  3I73 A;  5IYB H;  1TKW B;  2B3G A;  4LF8 L;  4U67 3;  1KJJ A;  4ECV A;  1TAE A;  4JI3 H;  1RTO A;  4AQY Q;  3K81 C;  1OTC A;  4QUF A;  4R1J A;  2P0A A;  4UAI A;  4ZYS A;  3V05 A;  2WII B;  5D14 A;  3JAM c;  2L0C A;  4IAL A;  4X3U A;  4TV9 F;  2R85 A;  2VUG A;  4QWB A;  1EQR A;  1L2F A;  1V1O A;  3W3A A;  1SNP A;  4LMQ D;  2JK8 A;  3R93 A;  5DM7 3;  1N8R C;  2HQL A;  4FXK C;  4K5W A;  3NUC A;  5FK9 C;  1EY9 A;  4DV2 L;  1XNR L;  2V5A A;  4DR7 L;  3JAM E;  1O7Z A;  1N32 H;  1WCM H;  3ITP A;  4C56 C;  5EGT A;  1ONL A;  5A2Q E;  4YP3 A;  1J9O A;  1EZ1 A;  3TZD A;  4Q0F A;  3S16 H;  4ED0 A;  1D1I A;  2WTF A;  1S03 G;  2RGR A;  2DY7 A;  3HEJ A;  5J22 A;  1UE6 A;  2R92 A;  5JVH 3;  2WE6 A;  2FPI B;  4KY5 A;  4BA1 I;  2YRX A;  1DYQ A;  1H9M A;  4QW9 A;  4IUT A;  3ONA B;  4HIO A;  5M3F H;  2RDF A;  4LF7 Q;  1X3Q A;  1G6P A;  4YJ3 F;  2VOB A;  5FD6 A;  2ZTD A;  4LUZ A;  3K80 C;  2AQ1 B;  4XXE A;  2F0Q A;  3T5J A;  1YHA A;  4NPS A;  2FP4 B;  1VS0 A;  3MHB A;  2FMC A;  3A7L A;  4PMC A;  3H4B A;  1SN8 A;  3OOC A;  1A2U A;  5M3F G;  5C4Z A;  4EG0 A;  4I55 F;  3CVZ A;  4ED8 A;  1PH2 A;  1E7Z A;  2UXD L;  5J2U F;  5DG8 A;  4A3J G;  2PMZ A;  2O03 A;  2F4V Q;  4C3H H;  2B2T A;  5ELN A;  2VPS A;  1ET6 A;  3OSO A;  5DQH A;  1TWC A;  1QWY A;  1SYB A;  2HIX A;  2WFW A;  1VKZ A;  3NEM A;  2Q8T A;  1YNX A;  4JI2 L;  2JA6 B;  3PR5 B;  4DV5 L;  3RF2 A;  1KRS A;  4JI0 L;  4JI5 H;  2DWC A;  3CRK C;  4DU9 A;  2HD3 A;  1AFP A;  2R8J A;  3EVQ A;  1DD2 A;  1LUZ A;  1CSP A;  1TWC H;  5E3F A;  4LFC L;  4YHH L;  4MV8 A;  4X62 H;  1L1O B;  2E8G A;  2J6U A;  4XZ3 B;  3PQI A;  3WDN A;  1AUX A;  4GC6 A;  4JBJ A;  3I4M G;  2JA5 A;  3NTI A;  4K14 A;  3M7N A;  3NQI A;  2JA6 G;  2F0O A;  1A2T A;  4DL2 A;  4DR1 L;  4F4W A;  4X66 H;  2QDB A;  2J4X A;  1M6V A;  3F2B A;  3PIP A;  4OO1 I;  4JBW A;  1IOW A;  1G6Z A;  2B2W C;  1WOC A;  3T4A C;  3ERO A;  3J80 i;  2CKZ B;  3PIO 3;  1LT3 D;  4IUN A;  1KNA A;  4LFC H;  1WTP A;  3I2Z A;  3E3X A;  3CCV A;  1S97 A;  4R4I A;  4LH6 A;  3VA5 A;  5IYC H;  2W7O A;  4UP7 A;  1S0O A;  4IR1 A;  1TWA H;  2W71 A;  5LHY 1;  3JRX A;  1AN7 A;  1NMF A;  2VUM B;  4DV5 H;  5CA1 F;  1RJT A;  3K59 A;  4I4T F;  2MQH A;  4LSX A;  2IHF A;  3QZ8 A;  4PMW A;  3RUZ A;  4ECX A;  5KNB A;  1Q7Y C;  2EYP A;  3HOZ H;  1XNQ L;  2YL2 A;  3CMA A;  1X55 A;  1QNU A;  2EZV A;  2YTV A;  3G6J B;  4H13 C;  2UVV A;  2Q2T A;  1B3Q A;  5L1I A;  3V2T A;  3CKI B;  4LF4 Q;  1E0B A;  1A63 A;  4LF7 L;  2AMC B;  1WCM A;  2L1B A;  1JB7 A;  1Y8O B;  1AE2 A;  1PLF A;  2A69 D;  4PMB A;  2CWA A;  3M4Y A;  1TY2 A;  2MPM A;  2MFI A;  4RWS C;  5KT2 A;  2KEC A;  4DN4 M;  5I2X A;  1WI5 A;  1IKM A;  5L9X A;  4RHS A;  1A15 A;  1EEI D;  3FDS A;  3Q8Q B;  2CCZ A;  4TRD A;  5LMU Q;  1L2Z A;  3MWY W;  3DLL A;  1CK1 A;  1YZ6 A;  4BY1 G;  2PCF B;  1U4L A;  5G3L F;  2VA3 A;  4N9T A;  4APM A;  2DNC A;  4JYA H;  1SLJ A;  2NTS A;  3FEW X;  3TEH B;  4B9X A;  2R87 A;  1MKH A;  5ELB A;  1BF4 A;  4QCL A;  3JAM W;  3PW2 A;  4EGJ A;  5I4D A;  4X62 Q;  1EQV A;  5IP9 H;  3WNZ A;  1N33 H;  1JR0 D;  1TWF H;  2PQA A;  3C0F B;  4LSA A;  1TS4 A;  4AIM A;  2XD4 A;  1JLL B;  3KLS A;  4NXM Q;  2IA6 A;  4WJ4 A;  1I4P A;  1II3 A;  1UWV A;  4Q43 A;  4C5C A;  4CC6 A;  5JJZ A;  4NMZ A;  4N8F A;  4APV A;  2K5H A;  2XIW A;  4B08 A;  5KFT A;  3K8A A;  4B3T H;  3J81 L;  3GTO A;  1YHQ A;  5LP6 F;  1EYD A;  1GO3 E;  2C00 A;  1BKB A;  1HNX L;  4B3M L;  2Q2U A;  5C4X B;  3G8C A;  3BQ1 A;  5JPM C;  1VAJ A;  3Q8P B;  4IPC A;  2JEA I;  2JA5 B;  2IBK A;  1GD7 A;  2ASB A;  4R8U B;  1EY6 A;  4BBS B;  4L5T A;  3UI2 A;  1BBX C;  1MHW C;  3AEV A;  4DL6 A;  3T5K A;  2DZD A;  5C3E H;  4TSS A;  1SMY C;  3PGZ A;  4XDX A;  1UE1 A;  1Z6H A;  3LGJ A;  4HCS A;  2VW9 A;  2W8K A;  1IBM L;  1H9J A;  3OTO Q;  1UEB A;  2W70 A;  2UXC Q;  3RGZ A;  1CUK A;  1YBY A;  3HOV H;  4O3R A;  1VBH A;  1N36 L;  1SJH D;  2EYF A;  3KBX A;  4ME5 A;  1VBG A;  3RB4 A;  2KED A;  3VA7 A;  1TQO A;  1CSQ A;  2K4K A;  1E4E A;  4MA5 A;  2V4Q A;  4KD3 A;  1QVF A;  3N44 B;  5FLM H;  2N55 A;  1JOR A;  1CQJ B;  4L5Q A;  2BQR A;  2FPP B;  4DR3 Q;  2NUA B;  4DUY Q;  2F0U A;  4F87 A;  1CFM A;  4NP5 A;  3RZD H;  4WRD A;  5LMN H;  1LTS D;  5D65 A;  1ZHS A;  2E2J H;  4KY6 A;  5KFU A;  2E2H H;  3ORR A; 
#chains in the Genus database with same CATH homology
 1XTD A;  2N49 A;  1NBW A;  3CXC A;  1N32 L;  4JI5 Q;  1Z47 A;  4B3R Q;  1YEZ A;  3CC4 A;  1GKH A;  4DR2 L;  1JE5 A;  4UPA A;  3GTJ H;  4A93 H;  4LF6 L;  2HHH L;  1HR0 Q;  1A62 A;  2LSS A;  2A19 A;  1N34 L;  5LMU L;  3EBE A;  2WP8 J;  4MTN A;  5IE8 A;  4A4I A;  4OWT B;  3L7Z C;  4GNX C;  3T1Y Q;  1XMO L;  2VUM H;  2JA5 G;  3D31 A;  1VQC A;  3RN5 A;  4BBR G;  2Z6K A;  1RIP A;  5GRO A;  3HOV G;  4OWX B;  1YIJ A;  4MZ9 A;  2JJQ A;  1S40 A;  1PH9 A;  3T1H L;  4HJ7 A;  4R4T A;  5JEA J;  2QA4 A;  2YV5 A;  1X54 A;  2B29 A;  1UE7 A;  3A0J A;  4P75 A;  2NVY H;  3PF4 A;  2YYZ A;  3GTL H;  2UXC L;  4XTC S;  1WFQ A;  4PG3 A;  2UXB L;  1QUQ A;  3JAM i;  5IYD H;  4YY3 L;  3ZJY C;  2I5L X;  2R7Z G;  3KF8 B;  4A3I H;  3U50 C;  3KOJ A;  1A0I A;  4DV6 Q;  1PA6 A;  3G48 A;  1PH8 A;  1VCI A;  4DR5 Q;  1MJE A;  4JG2 A;  1XPR A;  4DR6 L;  3S2H H;  5FLX c;  4IO9 A;  3CF5 A;  3F8T A;  4KHP Q;  3HOY G;  4JCV E;  4YWK A;  1FJG L;  4KI0 A;  2VQE L;  3L0O A;  4TQU S;  1K8G A;  3A5U A;  4IFD G;  4B3T L;  4QGU A;  4HIM A;  4DAM A;  1XNQ Q;  1Q82 C;  4X62 L;  1K83 H;  3J81 i;  4A3K G;  1VQ9 A;  4A3L H;  5FJ8 H;  1P16 A;  3G4S A;  1GVP A;  5LMN W;  2BH2 A;  4DV7 L;  3K7U C;  3D0F A;  1N33 Q;  3F1Z A;  5IYB G;  2OWO A;  3E0E A;  1Y1W G;  3M4O H;  1HNW Q;  3NEN A;  1SMX A;  5E7N A;  4C3J H;  4DUZ L;  1EYG A;  5IP7 H;  4X6A H;  2LXJ A;  3S14 H;  4AQY L;  3CW2 C;  4PZ8 A;  1E1T A;  3M4Q A;  1Q8K A;  1IBL Q;  1V9P A;  4H02 A;  1VQE A;  3S1N H;  2R93 G;  2AWN A;  2N3S A;  4HJ8 A;  3PO2 G;  2MO1 A;  3GTG H;  3F2D A;  3RR5 A;  1AE3 A;  3HOU G;  1Q1B A;  3J7A 5;  2Y0S G;  3CD6 A;  4JC0 A;  4QY7 A;  4JI7 Q;  3KJO A;  2K52 A;  3HOX H;  3ER0 A;  3Q8D A;  5JJK A;  2C35 B;  2HHH Q;  4A93 G;  3HOW H;  1B7Y B;  4DKA C;  2E5L L;  3KJP A;  5M5X H;  1H95 A;  2IX1 A;  2UXB Q;  5HY6 A;  1IBM Q;  3PUW A;  3OTO L;  3KLW A;  3S17 H;  4IPH A;  1C9O A;  4KHZ A;  3G71 A;  1C7Y A;  4PZ7 A;  3I4N G;  4LFA L;  2I0Q A;  3AQQ A;  2VNU D;  4B3S Q;  1HZB A;  3TRZ A;  3PCO B;  2NN6 G;  3JC6 6;  2Z0S A;  4DV4 Q;  2UUB L;  2UUA L;  3KDF B;  4A3C G;  1X3G A;  4DR3 L;  1X9N A;  1QZH A;  3EIV A;  2NVT H;  4JI5 L;  4DAY B;  1R9T H;  1VQ8 A;  1JJC B;  5DLQ E;  3CCE A;  3H3V H;  4B3R L;  3H15 A;  4OX9 Q;  1B8A A;  2XTI A;  2K5N A;  2GVA A;  1W3S A;  1XPU A;  4BA2 I;  4GN3 B;  3ULL A;  1VQI A;  1YJ9 A;  4O0A A;  3PUX A;  4NXM L;  4UY8 C;  3ERS X;  4A3E H;  3FHW A;  3PIO A;  1YHB A;  1BBW A;  1PH7 A;  2PMZ E;  4QJF A;  4BXX G;  1EWI A;  1HZA A;  2QGQ A;  4BBR H;  1PYS B;  2K5V A;  4A3D G;  5JJL A;  4GNX A;  3BZC A;  4EX5 A;  1VQO A;  2N8N A;  3KYH C;  1QUQ B;  5GAG C;  2I5H A;  2BA0 A;  3GD7 A;  1NY4 A;  1XMQ L;  1B70 B;  3T1H Q;  4R4C A;  5C4J H;  1QZG A;  3HOU H;  3M3Y H;  1HNW L;  3I7F A;  1XPO A;  1VQN A;  4DR2 Q;  1NJI C;  1OXU A;  2RHQ B;  2VQE Q;  2KBN A;  3GTK H;  3S15 H;  4OON A;  3E9H A;  1N36 Q;  4A3G H;  4GKJ L;  5C0X G;  4NB3 A;  3DM3 A;  1G29 1;  2NZH A;  1CKM A;  4AH6 A;  2E2I H;  1HZC A;  4A3F G;  3K7A H;  1YJN A;  4LF9 Q;  1XJV A;  1I3Q H;  1O7I A;  2WB1 E;  1Y1W H;  1VQP A;  4J15 A;  4P72 A;  3S1M H;  3GTP H;  2R7D A;  4PZ6 A;  4NXN L;  1ASY A;  4LFC Q;  2WB1 G;  1HH2 P;  4BXX H;  3H0G H;  4Y52 H;  3PV0 A;  4JYA L;  2IT1 A;  2OCE A;  4OXP A;  3T1Y L;  2Y0S E;  4KHP L;  1E22 A;  2GVB A;  3RLO A;  3RNU A;  1S72 A;  4DR5 L;  4LFA Q;  1JJG A;  4B3S L;  4JI8 L;  4JBK A;  1SE8 A;  2ALY B;  1V43 A;  3KF6 B;  4R4Q A;  5M3M G;  3CCJ A;  3CCS A;  4DR1 Q;  2ZM6 L;  4YY3 Q;  1I94 Q;  4X65 L;  4HIK A;  3RN2 A;  1KC8 C;  2VUM G;  3K0X A;  1IZ6 A;  2NN6 I;  4A75 A;  1K9M C;  3BZK A;  3FKI G;  3CCU A;  4DV6 L;  1YI2 A;  2R6G A;  3PUY A;  3UE1 A;  4EQ5 A;  3U4Z A;  3J81 j;  1J5E L;  3CME A;  1YIT A;  1IL2 A;  4LW1 A;  1Q46 A;  5BR8 L;  2R93 H;  2R92 G;  4JV5 Q;  4UP8 A;  1L0W A;  2JA8 G;  5M5W H;  4DR7 Q;  4BY1 H;  4DV5 Q;  5C3E G;  4LF5 L;  4GS3 A;  1JJ2 A;  5M3M H;  1Q81 C;  3UE0 A;  5AJ3 L;  5GAH C;  1N32 Q;  2KCT A;  1EIF A;  4DUZ Q;  3PO3 H;  2R7F A;  3PUZ A;  5C4X H;  5ELO A;  4HJ9 A;  4Y7N H;  1V1Q A;  1WCM G;  1HZ9 A;  2ZJP A;  3HFZ B;  1VQM A;  4JI0 Q;  3HOY H;  1VQ7 A;  2FXQ A;  2EQS A;  5C44 G;  3UDG A;  4DV7 Q;  1X56 A;  4YHH Q;  1HNZ Q;  4L5S A;  1J6Q A;  4ALP A;  4L5R C;  4GKJ Q;  4POF A;  5IWA Q;  1IBK Q;  2IHE A;  2PQA B;  2ZJQ A;  1NTG A;  1EIY B;  1OXS C;  4DV1 L;  4YWL A;  2QEX A;  4JI6 Q;  4DNI A;  1X6O A;  1E1O A;  4POG A;  5K36 G;  1QVC A;  4P71 A;  1I50 H;  3B6Y A;  3STB C;  1EOV A;  3CCR A;  2NVQ H;  2F52 A;  3CP0 A;  2JE6 I;  3I4O A;  5IYB H;  1A8V A;  1P8L A;  2B3G A;  2K75 A;  4JI1 L;  2LXK A;  1KD1 C;  4LF8 L;  1NE3 A;  4IOA A;  5H1S E;  1VQG A;  4AQY Q;  3K81 C;  1OTC A;  3S1Q H;  1KHI A;  3CC7 A;  4R1J A;  4QQB X;  2D62 A;  3SGI A;  3JAM c;  1Q12 A;  5C0X I;  1N9W A;  4JI8 Q;  2WAQ G;  1PH3 A;  4GOP C;  1I5F A;  2UU9 L;  3BJU A;  4LF9 L;  3UDX A;  3GTM H;  1T9H A;  1EQR A;  1L2F A;  3KDF A;  2WAQ E;  2KEN A;  2JK8 A;  4DR6 Q;  2E5L Q;  4BBS G;  1N8R C;  2HQL A;  1PHJ A;  2YTX A;  5FJ8 G;  4DV2 L;  4C2M H;  1XNR L;  1BBU A;  4HJ5 A;  4A3J H;  4DR7 L;  3CPW A;  1Q1E A;  1WCM H;  3L2P A;  3S2D H;  2Z6K C;  4C3I H;  1WYD A;  4DK6 C;  3GDE A;  1M1K C;  4LWC A;  3ULJ A;  3S16 H;  3I56 A;  3I4N H;  4X65 Q;  5M5Y H;  3RLF A;  1UE5 A;  4A3M H;  1K73 C;  1UE6 A;  1N33 L;  2B63 G;  5C0X J;  3ULP A;  4BA1 I;  3H3V I;  1PFS A;  3UDF A;  3TS2 A;  4DV0 Q;  4HIO A;  5M3F H;  1LYL A;  4JOI A;  1SR3 A;  2RHS B;  4LF7 Q;  1G6P A;  4GN4 B;  3CPF A;  1X65 A;  1SRU A;  3AFP A;  4QL5 A;  4TVA B;  4A3D H;  2N78 A;  2ZTD A;  4LUZ A;  3K80 C;  4P73 A;  5C44 H;  4LF4 L;  1OXX K;  1YHA A;  4NPS A;  2I5M X;  5IP9 G;  4GLX A;  5GQO A;  1HJP A;  1VS0 A;  4ME3 A;  4X66 Q;  2VY3 A;  2ES2 A;  1SN8 A;  3A5Z B;  1Y1V H;  1VQF A;  5IY0 A;  3OW2 A;  2UUC L;  4GLA C;  2ZM6 Q;  2VQF Q;  1CKO A;  5M3F G;  1VQ4 A;  2ZTE A;  1I94 L;  2D0O A;  2JA8 H;  1PH2 A;  1E7Z A;  3S24 A;  4JI3 Q;  2OTJ A;  2UXD L;  3HOX G;  4A3J G;  2JA9 A;  3TQY A;  2F4V Q;  4C3H H;  1X3E A;  5ELN A;  1J5E Q;  4WJ3 M;  1TWH H;  2JA5 H;  4OO1 G;  4YCW A;  2HIX A;  2WFW A;  1VQL A;  2JA6 H;  3NEM A;  5C4X G;  1YNX A;  4DK3 C;  1VQK A;  4JI2 L;  4K0K Q;  4DV5 L;  4LF5 Q;  1KRS A;  4JI0 L;  3CQZ H;  4JOI C;  4A3I G;  4DV3 L;  2BA1 A;  2OQ0 A;  5BR8 Q;  2ZTC A;  4HID A;  1AH9 A;  1LUZ A;  1VQB A;  2CQO A;  4IPD A;  1CSP A;  1GM5 A;  1TWC H;  3U58 A;  4LFC L;  1ASZ A;  4YHH L;  3CCM A;  3MXN B;  2VZA A;  4A3E G;  1L1O B;  2E8G A;  4JV5 L;  1XMQ Q;  1PH4 A;  1D7Q A;  4DV1 Q;  5EAY A;  1TXY A;  4JBJ A;  4DV2 Q;  2NVX H;  3I4M G;  3M7N A;  3CAM A;  2JA6 G;  1IXR A;  5AJ3 Q;  3E9I A;  4MNO A;  4DR1 L;  2IY5 B;  2JA7 H;  1YVC A;  1SRO A;  3F2B A;  1RL2 A;  3PIP A;  2R7Z H;  3KFU A;  4OO1 I;  1PVO A;  3M85 A;  1LTL A;  4JBW A;  3HKS A;  3A74 A;  1FVI A;  1WOC A;  2JEB I;  3WWV A;  4GOP A;  1TWG H;  1NMG A;  5IWA L;  3J80 i;  1IBK L;  4LUV A;  3CC2 A;  2CKZ B;  3G6E A;  3I55 A;  2HIV A;  3NBH B;  1KQS A;  3I2Z A;  3CCV A;  4JI3 L;  4A3B G;  2UXD Q;  4R4I A;  2JA7 G;  2R92 H;  1LM0 A;  4LFB L;  5IYC H;  4UP7 A;  4GKK Q;  1HNX Q;  4IPG A;  4B3M Q;  3J80 c;  1TWA H;  1NMF A;  1M90 C;  1K3R A;  1JT8 A;  1DGS A;  1HNZ L;  1PYB A;  3J7Z C;  2ID0 A;  3VDY A;  2MQH A;  2IHF A;  1VQJ A;  4PMW A;  5GAE C;  2B63 H;  2NZO A;  1N34 Q;  2Q2I A;  3W1G A;  1Q7Y C;  3HOZ H;  3F2C A;  2UU9 Q;  4JI6 L;  2ZJR A;  1XNQ L;  1OXT A;  3CMA A;  2A1A A;  3I4M H;  1X55 A;  4HJA A;  2L15 A;  1JMC A;  2YTV A;  1MIU A;  4IJH A;  1FGU A;  2VS1 A;  4GN5 A;  4JI4 L;  3BU2 A;  3NEL A;  2Q2T A;  4JI1 Q;  4KLK A;  2AHO B;  1Y14 B;  4LF4 Q;  3STB D;  2K50 A;  1A63 A;  4LF7 L;  2AMC B;  3HKZ E;  4X64 L;  5LMN L;  4K0K L;  1JB7 A;  2MO0 A;  5FLM G;  1AE2 A;  3CCL A;  4LF6 Q;  1I6H H;  2H5X A;  2Q2H A;  2PI2 E;  3J81 c;  1KIX A;  2HT1 A;  3HOZ G;  4DR4 Q;  2CWA A;  1IBL L;  2KHI A;  5IT9 c;  4IOC A;  3PO3 G;  2MFI A;  1BVS A;  2D0P A;  1FL0 A;  4LUO A;  1WI5 A;  1HR0 L;  4JI7 L;  2CCZ A;  4XIG S;  2DUD A;  5LMU Q;  1EQQ A;  1X3F A;  2GN5 A;  3DLL A;  2VQF L;  1YZ6 A;  4BY1 G;  4DUY L;  4AYB E;  4LF8 Q;  4A3C H;  1HR0 W;  1VQD A;  1Z9F A;  4DV0 L;  2AKW B;  3PSI A;  4A3M G;  3M9B A;  4X66 L;  1W2B A;  1K8A C;  2OQK A;  1CKN B;  2AWO A;  1SLJ A;  3CCQ A;  3TEH B;  2EIF A;  3S1R H;  1MJC A;  1MKH A;  2PNH A;  3PUV A;  3TS0 A;  4B3T Q;  2KCM A;  5J3B A;  1KAW A;  3HOW G;  2CWP A;  5HGQ A;  3GTO H;  4X62 Q;  1L1O C;  3EN2 A;  5IP9 H;  1TWF H;  2PQA A;  2MNA A;  2F4V L;  4YCV A;  4AIM A;  2OTL A;  1KL9 A;  1D8L A;  2JQO A;  1VQ5 A;  4NXM Q;  3PO2 H;  1XNR Q;  4WJ4 A;  4BY7 G;  5IYD G;  1QVG A;  5IYC G;  1UWV A;  1VQ6 A;  3H0G G;  1FJG Q;  4APV A;  3RLN A;  2K5H A;  1Y1V G;  4IJL A;  3K8A A;  3TRE A;  4GLV B;  1WJJ A;  1PH5 A;  3HKZ G;  4JBM A;  1YHQ A;  4RG1 A;  4DV3 Q;  1GO3 E;  1CKN A;  4DV4 L;  1G51 A;  1BKB A;  2UUB Q;  1HNX L;  4B3M L;  1U5K A;  2F3I A;  3AYH B;  4A3F H;  1SFO H;  2Q2U A;  3GTQ H;  1S3O A;  2A8V A;  3W1B A;  2ATW A;  3KF6 A;  1EUJ A;  4AYB G;  2KHJ A;  2VL6 A;  3UDI A;  4BY7 H;  4A76 A;  2UUC Q;  4IPC A;  3PF5 A;  2JEA I;  4DR4 L;  4RMF A;  3M4P A;  3FKI H;  3W5O A;  1GD7 A;  2XGT A;  1XMO Q;  4OWW B;  3MEF A;  4GOP B;  2K14 A;  1PH6 A;  4P74 A;  2ASB A;  4BBS H;  1VQH A;  1Q86 C;  4R4O A;  4L5T A;  1PH1 A;  3ICE A;  4IFD J;  2V1C C;  2RF4 A;  3AEV A;  4UP9 A;  1VQA A;  1L1O A;  5C3E H;  4JI4 Q;  2PI2 A;  3PGZ A;  2VW9 A;  1UE1 A;  4LFB Q;  3LGJ A;  1E3P A;  4YWM A;  4JI2 Q;  1IBM L;  3OTO Q;  4JYA Q;  5GAD C;  4A3K H;  4A3L G;  1UEB A;  4LNQ A;  4DPG A;  2UXC Q;  1KXL A;  4QIW E;  4OX9 L;  2IX0 A;  3OYY A;  1CUK A;  1YBY A;  4X64 Q;  5LMN Q;  3HOV H;  1IYJ B;  2YTY A;  4FDB A;  3RZO H;  3FP9 A;  2BH8 A;  3IRB A;  1N36 L;  4GKK L;  4GNX B;  1K0R A;  2EXD A;  1OXV A;  4YCU A;  5IP7 G;  1CSQ A;  3U4V A;  2K4K A;  4O2D A;  1EFW A;  1QVF A;  2DGY A;  1E24 A;  5FLM H;  4L5Q A;  2CFM A;  3AFQ A;  4NXN Q;  2UUA Q;  4A3G G;  4IFD I;  5JJI A;  4DR3 Q;  4DUY Q;  1U0L A;  2RCN A;  5JEA G;  3RZD H;  4A3B H;  1C0A A;  2E2J H;  3GO5 A;  1YJW A;  2YU9 H;  2E2H H;  1KRT A;  1PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...