3FKIG

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
total genus 20
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fkiG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3fkiG01
2UXDL 1ASYA 2HT1A 4LFAQ 4LFCQ 1UEBA 2WB1E 2DGYA 1QVFA 4LW1A 5JJKA 4DR3L 1BKBA 4J15A 4JI0L 4JV5L 1I6HH 3U58A 4A3BG 4L5TA 3GTJH 3DLLA 4O2DA 3TREA 4A3MG 1JJGA 1UE7A 5LMUQ 3RLNA 2GVAA 1Y1VH 2OQ0A 3PUVA 3CMAA 2PI2A 5FJ8H 3T1HL 2JA5H 2KENA 4DR4L 4K0KL 4UPAA 2YV5A 4JI3L 2JQOA 3HKZE 1Y14B 2Z6KA 3CCRA 1N36Q 1Y1WG 1J5EQ 1VQ5A 2D0PA 2ZTEA 1XJVA 4NXMQ 3I4NH 2Y0SE 1N33L 2E5LL 1A0IA 3BU2A 1YJNA 2N49A 1OXVA 3GTPH 2AKWB 3S1RH 1PH4A 2UUCL 2RHQB 2R7ZG 3RN2A 4A3FG 4LF6Q 5IWAQ 2UXBL 3JAMi 4HJ9A 3H15A 2WP8J 1ASZA 4LF4Q 3NELA 4B3SL 3BZKA 4BY7H 1XMQQ 1VQ6A 3K7UC 1XNQQ 3CAMA 1S72A 1I94Q 2VUMH 2NZHA 1CUKA 3I2ZA 4JI5L 1VQFA 2A1AA 5FLMH 1JE5A 3K8AA 4IJHA 4LF8L 4DAYB 4PZ6A 3CW2C 3K7AH 4X62L 1EQQA 3HOZH 2CQOA 2YTYA 3NENA 3PCOB 2Z6KC 1KRTA 4P73A 1NJIC 4HIOA 4YCVA 3I56A 2IX1A 2UXCQ 3GO5A 4TVAB 5C44H 4BBSH 1KHIA 3I7FA 3KYHC 3ULLA 1N34Q 1SE8A 1QUQB 1TWFH 2UU9L 2JA7H 4A3GH 4JYAL 1IZ6A 4HJAA 4A3IG 2RHSB 2L15A 4UP9A 1XPUA 3S14H 2EIFA 4AQYQ 3UDGA 4DV6Q 1BBUA 1EUJA 1K83H 2JE6I 3I4OA 3CC7A 1IBKQ 2OTLA 3S1QH 1TWCH 2ZTCA 3I55A 1J6QA 4HJ7A 3KFUA 4GKKL 1UE6A 1GM5A 4YCUA 3H3VH 1Q82C 1XPRA 1KL9A 4GN4B 1HNWL 5JJIA 4LF9Q 4DPGA 1L1OB 3CC4A 4NB3A 1Q1EA 3CP0A 4GLAC 1G51A 1VQ4A 1VQOA 3KOJA 5C3EH 1XMOQ 2VZAA 1PH6A 4IOAA 4UY8C 2AMCB 4PG3A 4C3IH 4R4CA 1QUQA 1WI5A 5IYCH 4JCVE 5BR8Q 2YTXA 3T1YQ 4P71A 4IOCA 4B3TQ 4A3JH 5DLQE 1QVCA 2AHOB 5C0XG 3OTOQ 2B63H 3L7ZC 1PYBA 4QIWE 4X66L 1XMOL 1K73C 4KI0A 4A3CH 3B6YA 1PH9A 1PYSB 2BH8A 2WAQE 1OTCA 1XNRQ 1VQNA 3ZJYC 2MNAA 1E1TA 1HZCA 2KBNA 3TRZA 2E2JH 1L1OA 2HHHL 1Z47A 5IYBH 1Z9FA 4GKJQ 2R7DA 3HOXG 1WOCA 4NXNL 4OXPA 2WFWA 1K3RA 4DV4Q 4YY3L 4LFAL 5GAHC 4JI7Q 1IBML 2E2IH 2R93G 3GDEA 1E1OA 5LMNQ 4BY1G 3W1BA 3A5ZB 1TWAH 2DUDA 4LF7L 2CWPA 4DV2L 4DR7L 2Q2UA 5M3MG 4JI2Q 1PH7A 2I0QA 1GD7A 3GTQH 3UE0A 1EQRA 5C4JH 4MZ9A 4GNXC 1SFOH 1Q86C 2KCTA 1JJ2A 3HOYG 3HOVG 4DR2L 3S2DH 1CKOA 3STBC 1HNXQ 2BH2A 2ZTDA 4BBRH 3GD7A 1L1OC 2V1CC 4JOIA 4DUYL 1MKHA 3D0FA 3IRBA 2F3IA 1UE1A 1TWHH 5J3BA 1OXSC 1YHBA 2R92G 4DR6L 1HR0Q 4DV5Q 4LF4L 1CSQA 3I4MG 3CCVA 4R4TA 2VQFQ 3PO3H 5AJ3L 1I5FA 1RL2A 3PF5A 4GLVB 2LXKA 1YVCA 3HOUG 1TXYA 4B3RL 4C2MH 1HH2P 4PMWA 1LUZA 1N32L 5HY6A 2K4KA 2QGQA 3CD6A 1WCMG 2ES2A 1HNZL 2C35B 2MO0A 1QVGA 4POFA 1Q81C 4DV3Q 4A3BH 1A62A 1E7ZA 4BXXG 4A3MH 1YEZA 2JJQA 3SGIA 1CKNB 1Q8KA 3M9BA 2WAQG 3D31A 4QGUA 4R4QA 4OO1G 4DV7Q 1IBKL 2IY5B 4ME3A 1VQ7A 4UP7A 1Y1WH 2NN6I 3AQQA 3CPFA 3G71A 4IO9A 4QL5A 1UE5A 1EYGA 5K36G 3JAMc 3EN2A 1JMCA 2D62A 3CCEA 4LF9L 3M4QA 2MO1A 3FKIG 3NEMA 1JB7A 2R7ZH 3AEVA 2ZJRA 3F2CA 4JI6Q 1U0LA 2F4VQ 4X64L 4KHPL 4YHHQ 1C0AA 4NPSA 1CKMA 2UUAQ 4HIDA 1V9PA 1E3PA 2HIVA 3CF5A 3EBEA 5JEAJ 2K52A 4A3KG 2UUBL 1S3OA 2ZM6L 2OTJA 1CKNA 4FDBA 1OXXK 4H02A 1IBLQ 1Q46A 2NVTH 3PUWA 1VQEA 1PH2A 2K5HA 4JC0A 2R6GA 1YJ9A 2BA0A 2K5VA 2NVXH 1FJGQ 3HOWH 3KF6B 4X6AH 2GVBA 1Q12A 3CCUA 1GKHA 3K80C 4JI8L 4MNOA 1K8GA 5GROA 4DUZL 1KIXA 5IYDG 4DV0Q 4A3IH 2F52A 2ASBA 1BBWA 4JI1Q 2H5XA 5EAYA 4X62Q 4R4OA 2KHIA 2UXDQ 4RG1A 2VQEL 3S17H 3J81i 2OQKA 1AH9A 4OX9L 3PSIA 4YWLA 1L0WA 4LFBL 1VQKA 1LM0A 1IXRA 1OXUA 4R1JA 2GN5A 1WFQA 4JI4L 5IP9G 3BJUA 4JI0Q 4JV5Q 1KQSA 2KCMA 3BZCA 4DR1L 1EFWA 3Q8DA 5C44G 3KF6A 4X65L 2YU9H 2PQAB 3J80i 2ATWA 2IHEA 5FLXc 4LUVA 2K75A 2MQHA 4K0KQ 2B63G 4AIMA 3AFPA 2K5NA 4OWXB 2N78A 4QY7A 1X54A 1X55A 1N33Q 2K50A 1EWIA 4A3LG 2CFMA 2PMZE 5H1SE 2E5LQ 4C3HH 1E24A 4O0AA 2ZJPA 4TQUS 3AFQA 2UUCQ 4P72A 1TWGH 3PUYA 3PF4A 3RZOH 2CKZB 4DV1L 3GTOH 1PH5A 2UXBQ 4IPGA 2IT1A 4RMFA 3HOXH 2JEBI 3TS2A 2VS1A 4DR5L 4B3SQ 1PA6A 2Q2TA 2FXQA 4A93G 1NMGA 2PQAA 4OWTB 3PO2G 3KJOA 5C4XG 2YYZA 2JEAI 4LFCL 1K8AC 1YI2A 1X3EA 4JBJA 4A3EG 3KLWA 3E9HA 4JI5Q 2R93H 1YHQA 3ICEA 4LF8Q 3M3YH 2ZJQA 3JC66 4BY1H 3CC2A 4HIKA 3PGZA 5M3FG 3A0JA 4P75A 1YHAA 4DV3L 4YWKA 4IPCA 3RN5A 3H3VI 3VDYA 5LMUL 4Y52H 5M3MH 2Q2HA 2JA6G 1X3GA 3A5UA 2UU9Q 4JYAQ 2IX0A 4B3MQ 3HOYH 3TQYA 1N36L 1VQLA 1J5EL 3S2HH 3S1MH 4WJ4A 1HZAA 4NXML 1NY4A 1SR3A 1I50H 4APVA 3U4ZA 2I5MX 5JEAG 2KHJA 4EQ5A 3M7NA 1XTDA 3U50C 1VQAA 1B8AA 3PIPA 3RNUA 2E2HH 2EQSA 2I5HA 3A74A 3H0GG 4LUZA 3STBD 3UE1A 1A63A 1U5KA 1HNWQ 2NVYH 4LF6L 2R92H 5C0XI 3CPWA 5IWAL 1KRSA 1WYDA 4WJ3M 2MFIA 5JJLA 5IE8A 5IP7G 3CCLA 2A19A 3F8TA 2NVQH 3ER0A 3I4MH 1XMQL 4IFDI 1XNQL 1AE2A 1G6PA 2QA4A 4YWMA 1I94L 4IJLA 3PV0A 3L0OA 2QEXA 2CCZA 3HKSA 1WCMH 1YBYA 3F2DA 4X66Q 2UXCL 1P16A 2XTIA 1SMXA 2AWNA 4DK3C 4QQBX 4BXXH 1S40A 1N34L 4LF5Q 1XPOA 1L2FA 4JOIC 4GOPB 3CMEA 2YTVA 4LWCA 1K9MC 3CQZH 2HHHQ 3GTGH 4A3DG 4AQYL 4DV6L 1QZGA 4NXNQ 3PO3G 5C0XJ 2JA8G 2Q2IA 3CXCA 4ALPA 3MXNB 3K0XA 4YY3Q 2BA1A 3RLOA 1CSPA 1PH3A 4LUOA 3K81C 1IBMQ 3KF8B 1SN8A 4IFDJ 1FL0A 1NTGA 2RF4A 4GLXA 2NZOA 3FKIH 1NE3A 4A3FH 4LF7Q 3NBHB 3M85A 4DV2Q 2B3GA 2N3SA 1NBWA 3CCSA 3F1ZA 3LGJA 4JG2A 5GQOA 3E9IA 3TEHB 2CWAA 1Y1VG 3G4SA 1I3QH 1M90C 5FJ8G 2JA5G 1KD1C 2VY3A 3PUZA 5M5XH 1VQIA 1VQGA 5BR8L 3T1YL 4A3KH 2RCNA 4GOPA 1MJCA 4HJ5A 3ULPA 4PZ7A 4DR2Q 4B3TL 2OWOA 1SLJA 4PZ8A 4L5RC 3OTOL 3I4NG 3J7A5 1VQPA 5HGQA 4DUYQ 1VQHA 4R4IA 2K14A 3U4VA 1PV4A 4DAMA 1MJEA 1IYJB 2LXJA 1VQBA 1XNRL 3KDFB 3M4OH 4DR6Q 2HIXA 4GKJL 3W5OA 1D7QA 5IYDH 3UDXA 3AYHB 3J81c 4BY7G 2LSSA 1LTLA 2JK8A 4DV4L 3DM3A 4JBMA 3HFZB 1EOVA 4OONA 5AJ3Q 3KJPA 2VUMG 3TS0A 4JI7L 4B3RQ 3PUXA 4OO1I 1X3FA 5FLMG 1N32Q 4GS3A 1FVIA 5LMNL 3HOZG 3UDFA 1BVSA 3G48A 1HZ9A 4QJFA 1IL2A 4DR3Q 3J80c 5M5YH 5M5WH 4GOPC 1PH8A 5IP9H 3GTMH 3HOWG 3RZDH 1HNZQ 1X65A 4JI2L 4BBSG 2D0OA 3CCQA 4EX5A 2JA7G 4A3GG 1JJCB 1PVOA 3KDFA 2VNUD 3T1HQ 4POGA 4DR4Q 1UWVA 4B3ML 1HNXL 4JI3Q 4A76A 1H95A 1W3SA 2R7FA 1GO3E 4BA1I 1PH1A 1X56A 1W2BA 1Q7YC 5ELOA 4GNXB 4AYBG 1VS0A 4Y7NH 4A75A 2N8NA 4A3LH 3S1NH 2OCEA 1YZ6A 3ERSX 1R9TH 1KXLA 1SRUA 3ULJA 5LMNW 3L2PA 4GN5A 4L5SA 2WB1G 2VW9A 1VQDA 4DV5L 1HR0L 3W1GA 5E7NA 5IY0A 1VQCA 4X64Q 3MEFA 3M4PA 5GADC 5C3EG 2VQFL 1X9NA 4KHPQ 2ALYB 4KLKA 1VQMA 4A93H 5IYCG 2UUBQ 1E22A 5ELNA 3PO2H 3EIVA 5C4XH 2ZM6Q 4A3JG 1N9WA 1KAWA 1B7YB 1FGUA 1SROA 4DK6C 3F2BA 4A3EH 4HJ8A 1B70B 4HIMA 1VQ9A 3HKZG 4IPDA 1K0RA 4GNXA 4A3CG 3GTKH 2Y0SG 1OXTA 5M3FH 3GTLH 4OWWB 1VQ8A 4IFDG 4LF5L 4JI8Q 3PIOA 2I5LX 3CCJA 5IYBG 4DUZQ 2JA6H 2B29A 1HR0W 1N8RC 2XGTA 2JA9A 4DV7L 3HOVH 1LYLA 4GN3B 1HZBA 4DNIA 2PI2E 1VQJA 1Q1BA 1V1QA 3S24A 1YITA 3UDIA 2VQEQ 1V43A 2IHFA 3G6EA 4GKKQ 1X6OA 1DGSA 1PFSA 4MTNA 3RLFA 1KC8C 4OX9Q 3H0GH 4DKAC 3S16H 1YIJA 4LFBQ 4JBKA 4BA2I 5GAGC 1EIYB 2HQLA 4JI4Q 1MIUA 4JI6L 4P74A 2F4VL 4YHHL 2UUAL 2E8GA 3OYYA 1EIFA 4DR1Q 2Z0SA 5IP7H 3J81j 2NN6G 5GAEC 1JT8A 1A8VA 4X65Q 4DR7Q 1VCIA 3S15H 4KHZA 1AE3A 4XIGS 3J7ZC 4XTCS 1C7YA 1C9OA 1IBLL 3HOUH 1M1KC 4BBRG 1T9HA 4UP8A 1QZHA 1WJJA 4C3JH 2A8VA 1YJWA 2AWOA 3CCMA 1FJGL 1NMFA 1GVPA 2ID0A 4LNQA 2VL6A 1RIPA 1YNXA 3E0EA 4JBWA 4L5QA 3FP9A 4YCWA 4A4IA 1G291 2EXDA 3FHWA 4AH6A 4DV0L 1PHJA 1HJPA 4DV1Q 5IT9c 3WWVA 1O7IA 3OW2A 4AYBE 4A3DH 4JI1L 1D8LA 2PNHA 3RR5A 4IPHA 1P8LA 4DR5Q 2JA8H
chains in the Genus database with same CATH superfamily
3A7AB 4JK1C 2IWHA 1KDAA 4LFAQ 2C2DA 4LFCQ 5FD6A 2F1MA 3RBEA 4JI0L 5TSSA 1SYFA 3VPBA 4DL6A 3N42B 1JJGA 1EY4A 1UE7A 3CMAA 2OQ0A 2PW7A 5IIFA 2PI2A 3Q8QB 1NAPA 3E3XA 4UPAA 4JI3L 2O03A 3HKZE 1N36Q 3ITPA 4NXMQ 4A3IB 5KFCA 1N33L 2WTFA 1WSCA 2W71A 2E5LL 1A0IA 3BU2A 1GUNA 4FBTA 2WDTA 1UEAB 2AKWB 3S1RH 2A74C 1PH4A 2RHQB 3S17B 4K6DA 2VB3X 3RN2A 4LF6Q 3HRZC 2VR1A 5IWAQ 1B2TA 2EOTA 1HFGA 4HR7B 1ASZA 2WV6D 1CFMA 3NELA 3NWSA 4B3SL 2W70A 1JOKA 1IKMA 3RV3A 5DG8A 1XNQQ 3HB9A 4CKEA 2RDIA 1EY0A 1PZID 4CBVA 5EKIA 4QWBA 1ET9A 1WTXA 4RH6A 4F88A 2NVQH 3V4ZA 4DAYB 3CW2C 4LFCH 2CQOA 2YTYA 3PZPA 2B2YC 3PCOB 1ZKOA 1NJIC 4HEDA 5KG6A 4QUCA 4BBSH 1LTID 2F0KA 1N34Q 4A3GH 1L2ZA 4DV3H 1IZ6A 4HJAA 1QNKA 2L15A 4UP9A 1TA8A 2Z9HA 1EUJA 3RZOB 3D3RA 3I4OA 4B08A 2FLNA 5LA6F 1TWCH 3NUCA 1N36H 5KT3A 4GKKL 4NXMH 2ZXPA 4J6HA 2YU9A 1A3TA 4B9XA 2DNEA 4LF9Q 3N40P 3NTHA 4N9TA 4K5XA 2PBZA 4J9LA 1PH6A 1G51A 1VQOA 1AH9A 5T1IA 1VMCA 4IOAA 1RJRA 1S0NA 4C3IH 3K58A 1QUQA 4JCVE 3DWPA 2YTXA 3T53B 5C4HA 5F9NA 4A3JH 1B1ZA 4HYKA 4ED0A 3S2HB 3GTOA 3KHLA 1ZHQA 2YW2A 1A6XA 2NU8B 1Z2NX 4I50F 3PN1A 4MTDA 2E2HB 1HZCA 4XT3B 1L1OA 2RVLA 5EOYA 3NQIA 1Z9FA 5IYBH 2R7DA 3VR4A 3HOXG 4GC6A 4NXNL 4OXPA 5CR3A 4YAJB 1BGWA 2B2WC 5H80A 1DYQA 5GAHC 2R85A 1H9SA 4PQXA 4O4IF 2R93G 3HOUB 5KFKA 5LMNQ 1CTMA 4G7HC 3A8JE 3A5ZB 1TWAH 1DZ1A 2DUDA 2F0OA 3FRPB 4DR7L 2A69C 4C56C 1A15A 5M3MG 1PH7A 1EYZA 3UE0A 5KNDA 1EY8A 4K2KA 4KN7C 1PTOC 4ME5A 1A9XA 4DR2L 2PMZB 2KQ3A 2NVYA 3CQZB 2WAQB 1L1OC 3VA5A 1KEEA 4FBUA 2V1CC 4HMJA 4JOIA 5CV8A 3V6HA 2DPJA 1HPCA 2F3IA 3VYTA 2L12A 5J3BA 5LXTF 2R92G 4G4KA 1DV1A 2HVRA 2FMCA 1YNJD 4N8FA 5FPRA 3I4MG 3FKIB 2ATLA 3C1FA 3PO3H 4IRKA 1RL2A 1WCMA 1IW7C 1YVCA 5DLFA 4B3RL 2RKSA 4HTHA 4JPBW 3HBLA 1N32L 5HY6A 5KFRA 4A3KB 4MV3A 1C3OA 2EPBA 2SNMA 3GTGA 4KMUC 1N48A 1F2LA 1HNZL 2C35B 1QVGA 5LMNH 4I7HA 4RAYA 4HN7A 2XN9C 2JJQA 1CKNB 1Q8KA 4CC6A 3M4OB 4DV7Q 1VQ7A 4UP7A 4XYQA 1JXLA 4J9QA 2MHVA 3CPFA 1QG7A 5K36G 3JAMc 1EQVA 1JMCA 3R5HA 2Z4IA 2MO1A 2J6SA 3NEMA 2F4VQ 4KHPL 4YHHQ 4NPSA 1CKMA 4NLGA 4HIDA 1LTAD 2JP1A 5M5WB 5M5YB 1V9PA 2UUBL 3DEOA 3GLKA 1VF7A 1KC7A 1C48A 4EGQA 2K5HA 3RB0A 3QZ8A 1I6UA 4O2BF 4HNUA 2NVXH 1FJGQ 2KSWA 1H9RA 1OWTA 4X6AH 3R23A 4Y7NB 1GKHA 4MNOA 1K8GA 1JKJB 1R9TB 2B8GA 5KFEA 3MWMA 3I72A 2PQEA 2BQRA 2ASBA 1BBWA 2H5XA 5EAYA 4X62Q 2HD3A 2K5DA 1NSNS 2KHIA 4DV7H 4RG1A 4A93B 4QW8A 4ED1A 4ZRZA 1VQKA 2K1BA 5C4XB 4R1JA 5IP9G 2K32A 3BJUA 4JI0Q 3MR3A 2KCMA 2B63A 3KUPA 2L0CA 2SNSA 1EFWA 5T1GA 5CBAE 3KF6A 1VAJA 1RTOA 3GTKB 2K75A 1EY9A 3NHHA 4DNTB 3WO1A 2HGSA 4AIMA 2NTSA 5D3DA 3HEJA 1QJOA 5DNFA 2N78A 4TKOB 1X55A 1EU4A 1N33Q 1EWIA 4A3LG 3ZYYX 2E5LQ 4RAZA 4Q8EA 1F9QA 4TQUS 3AFQA 3NTIA 1BCPC 1QNUA 3AU7A 1PRTC 1D6EC 1TWGH 2KVMA 3PUYA 4P72A 1C8CA 4EYHB 1FJGH 2CKZB 4DV1L 3S16B 3TZUA 4L6TB 3HOXH 1SBBB 1WTQA 1RYRA 2JEBI 3TS2A 4B3SQ 1BNZA 2FXQA 1NMGA 3PO2G 4K5VA 3KJOA 4J9SA 2YYZA 3GTLA 1K8AC 1X3EA 4X62H 3E9HA 2R93H 1YHQA 1V1OA 2JA6A 2B2UC 5C6AA 3BABA 4P75A 2YCHA 3PIP3 4IPCA 2HQEA 5LMUL 4JI0H 5M3MH 5KRUA 4JV2A 3SE7A 2J6TA 2M00A 3C0FB 2IX0A 4B3MQ 3V05A 1J5EL 4ETSA 2Q8RE 1I50H 4UCVA 4KKSA 1F9PA 1GUSA 3U4ZA 4CHTB 2KHJA 5JEAG 4JI3H 4DN4M 1E4EB 1PTOD 1VQAA 2I5HA 1KNEA 1N33H 5EPJA 3N41B 5IYZF 2MUYA 5KFGA 2F0QA 5LL6X 2R92H 2VA2A 5C0XI 4DXGA 2C00A 4WBNF 1SJED 2DZDA 2AU0A 3I4MH 3IFDA 1XMQL 1IOVA 1G6PA 5J39A 3VR3A 4YWMA 5JVH3 1I94L 2ASLA 3TBIB 2B2VA 3HS0C 3PV0A 4B3SH 2QEXA 5KYLA 1B3QA 2NUAB 5FKAC 2UXCL 1F77A 1I7LA 2AWNA 2UVRA 2JYOA 5L37A 3QG1A 1S40A 4LF5Q 5KFDA 1RYSA 1L2FA 4GOPB 4RNMA 4DV6L 4NXNQ 4RB1A 4I65A 2Q2IA 3CXCA 3MXNB 1S5FD 4J1MA 2RSOA 2VPQA 1TAEA 2K03A 1UNSA 1PH3A 1ZYRC 2VQDA 5K36H 1SN8A 3OHAA 2JEIA 3VR6A 1G8ZD 2A6EC 2UVVA 2NZOA 3EFXD 4GKKH 2IX3A 4A3FH 2NUCA 1ILPA 3OSPA 1D1KA 3HOZB 2N3SA 1EY6A 5IGBA 3F1ZA 5GQOA 1XMOL 2EY6A 3E9IA 4DR7Q 2HJWA 3LP8A 1DOMA 2NYZD 1KD1C 2VY3A 2FJ2A 3BQ1A 5DM63 1QE6A 1VQGA 1NUCA 1J9OA 1X3PA 2RCNA 3OMGA 4HJ5A 5BN5A 4DR2Q 2JA7B 1G6ZA 1ESRA 3DXJC 4U7CA 1JR0D 4L5RC 3I4NG 1JDEA 3S14B 4IR9A 5C5JA 4XZ3B 1K83B 3ND8A 2K14A 3A56A 4XQQA 3S1QB 1XNRL 2LXJA 4AYBB 3KDFB 1DOKA 4ED6A 2O4XA 2LS01 3HG9A 3W5OA 3UDXA 3AYHB 4BY7G 2VB2X 4EGJA 1EOVA 3KJPA 2W7OA 1B04A 3V6JA 2VUMG 2EDGA 4EQOA 5C3EB 3TS0A 4JI7L 4B3RQ 3JSLA 4O3PA 4NXNH 1EOTA 4G57A 2F0NA 3T56B 1N32Q 1FVIA 4KY5A 1IL2A 4QJFA 3RB4A 5EWEA 5IP9H 1BUVT 2JEFA 3RZDH 1HNZQ 2CH4W 2KUMA 1HQRD 3HKZB 1TWCA 4DF7A 4R8UA 2Q8TA 1ICFB 4DR7H 3T1HQ 4DR4Q 3MHBA 4XYLB 1W3SA 3G6JB 1GO3E 1HTLD 1X56A 4DR2H 1VS0A 4OIJA 1U4MA 1W6KA 3IL8A 4A3LH 1Z2OX 2W8KA 1SDFA 1PDQA 3ULJA 4GN5A 2E2IB 5E7NA 5IY0A 4XQNA 2OLSA 4KHPQ 5GADC 3M4PA 2VQFL 5KFSA 2J7ZA 4X3KA 4J9NA 1BCPD 2ICIA 2X69A 1PRTD 2UUBQ 1E22A 5ELNA 3PO2H 3GTQB 2E75C 3PW4A 1STEA 5JPMC 1CZGA 1FGUA 1SROA 5E4WC 2SCUB 4B3RH 1B70B 4YJ2F 4FXKC 3PW5A 4LJZC 4GNXA 1N32H 4A3CG 1ENCA 4LH6A 1A2UA 4YAKB 4J9OA 2K7VA 2W6ZA 2FKLA 2SDFA 3PMFA 3PIOA 4UCOA 3RFCA 1HNZH 3N6RA 1KJ9A 2A68C 1N8RC 2V58A 3HOVH 1SMYC 1HZBA 4GN3B 4H7BA 1TWAA 1VQJA 5J1ZA 2F0HA 1Q1BA 4AQYH 3UDIA 5J2TF 3G6EA 2LFNA 2R3ZA 4MTNA 1KC8C 3RLFA 4G7OC 4FF3A 4XQJA 5GAGC 4O3OA 4RZQA 4ZCKA 5CGKA 2Z0SA 2NN6G 1EU3A 1VCIA 5G3LD 4A3BB 1AE3A 5CV9A 1PK8A 3J7ZC 4XTCS 1L0XB 1C9OA 4FXGC 3K57A 1JE4A 2DJFC 1IBLL 1STNA 1EQTA 4BBRG 3K59A 4UP8A 2VUGA 2W6QA 2UUBH 1QZHA 2AWOA 3TMEA 3CCMA 4S3SA 1WTWA 2R8IA 2VL6A 1RIPA 4A4IA 4AH6A 2HUGA 1ZQ7A 2BDNA 2EY1A 1PHJA 4DV1Q 3MJFA 3SK5A 5IT9c 4F4WA 5KG2A 3UI2A 4Q45A 1KJJA 1XYIA 1HA5A 1I4PA 1PLFA 2H4OA 4EFBA 3KHRA 4MV8A 5ELBA 3GIJA 2NBFA 4DR3L 2Z1CA 3RTXA 2NVTB 2EZVA 4EVOA 1ZYRD 2DY7A 1JORA 2VA3A 4XXEA 5JVG3 5LMUQ 3RLNA 1WVLA 2GVAA 3PUVA 4KD4A 2KENA 2R7MA 4JI2H 4K0KL 2YV5A 2JQOA 5CC4A 3X3MA 3CCRA 1J5EQ 1KJ8A 2EYPA 4Z9CB 1XJVA 4DL5A 3I4NH 2FINB 3I3CA 2O5IC 1SE3A 1YJNA 2N49A 1OXVA 2FPGB 5JVLA 4ZKBB 4I55F 2C28A 2K5WA 2JEGA 2WP8J 1AEXA 4LF4Q 2F0MA 1LTTD 4BY7H 3BZKA 2I80A 1XMQQ 4DV1H 2NVXA 1S72A 1I94Q 5KIXA 2YU9B 2VUMH 1CUKA 1NR2A 5LYJF 1F9SA 3I2ZA 4LMQD 1WTOA 4JI5L 4FF2A 4OO1I 3K5HA 4EFEA 1EQQA 4X62L 4NMZA 4UHVA 4P73A 2IX1A 3QO2A 1O7ZA 3GQBA 4K6LA 4MHEA 2UXCQ 1K0SA 5C44H 1EHIA 3I7FA 3KYHC 1TWFH 1QUQB 4C3HB 2UU9L 4ODGA 1M0WA 5LMUH 3SEBA 5NUCA 4IQZA 2B63H 1CQFA 1BBUA 4DV6Q 1IBKQ 4IALA 2OTLA 3GTOB 2NU9B 2CW7A 2K01A 5DM73 3I55A 4TUYF 5CAEB 1AZQA 1J5EH 1PTOB 2N55A 3KFUA 4HCSA 1UNNC 5KFJA 1L1OB 1GOZA 3NQTA 1VF5C 1A3UA 3GILA 3H4DA 4BY1B 1VQ4A 1XMOQ 5D3IB 3Q8PB 2EJMA 4C5BA 3OIPA 3IN5A 4R4CA 1H9SB 3D4DA 1WI5A 2PZUA 3KAJA 4HNVA 4RAUC 4IOCA 5ISRA 3C3LA 1XMQH 2Q8IB 1TWGA 2IL8A 1KDCA 1AN7A 3HOYB 4LSXA 1FR3A 5D14A 1U4LA 3H3VC 3HOVB 4H0LC 1K73C 2FPIB 4X66L 2F0UA 4A3CH 1ICWA 2C2RA 5E3FA 2BH8A 5KFPA 1XNRQ 1VQNA 3ZJYC 1E1TA 1T5EA 3TRZA 2QCPX 1G2SA 1BOSA 2NVYB 3GV6A 3OHBA 2R93A 1K3RA 1TT2A 3SXHA 4YY3L 4DV6H 1SSOA 4JI7Q 3R2IA 3I73A 4PMBA 1SMYD 3GDEA 2K04A 3P7JA 5IGEA 1DJRD 5FLXL 1L0YB 4M8AA 2CWPA 4JV5H 1I50A 1WCMB 1LT6D 2I0QA 5KFMA 2NN6H 3HXLA 5C4JH 4IWXA 1SFOH 1Q86C 3EPGA 1XMOH 3S2DH 2BE5C 4BBRH 2R92A 3GD7A 3GTGB 4DLKA 1IKLA 1RJPA 5CV5A 4DUYL 1YNJC 3IRBA 4O42A 1QCBD 1ZEQX 5FLXW 4CKBA 3OSNA 2F0VA 1LV9A 2KEDA 2VQFQ 5KT6A 2EYHA 1I5FA 1LACA 3PF5A 2G9DA 1YNNC 1TXYA 4C2MH 4ECRA 1HH2P 5EBCA 1Y8OB 3FPPA 2JSOA 3OWEB 1SYBA 4RGMA 2K4KA 2QGQA 1J8IA 2XGPA 4JI7H 2KECA 2EJFC 3EROA 5C5MA 3LWBA 4POFA 1Q81C 4DV3Q 1E7ZA 2AQ4A 4Q0YA 1EEFD 4KD3A 4EBCA 3SGIA 1O78A 5JVDF 1K8MA 3RMHA 3M4YA 4R4QA 4OO1G 4ME3A 4RB0A 1M4VA 4WRDA 2IPKD 3SE0A 4P2CB 4QL5A 2W6OA 3MTSA 3V2TA 2YL2A 3OUUA 3M4QA 2V5AA 5JJZA 4MAMA 5IODA 4XX0B 2W7PA 2ZJRA 2W6MA 1W93A 2AUKA 1E3PA 2HIVA 1BCPB 1PRTB 1FNVA 5JEAJ 2K52A 5FK9C 4U673 4WORA 2VQFH 5KG7A 5C44B 4H02A 1IBLQ 2YRWA 1GYFA 4ZI7F 3PUWA 1ILQA 1PH2A 4JC0A 2B63B 2R6GA 5L1JA 2BA0A 2K5VA 5IGCA 3KF6B 1PFMA 1Q12A 4ZLTF 3CCUA 4V190 1I4HA 4JI8L 1I7NA 4OL7A 5GROA 2XNAC 4X3TA 1Y69U 1AZPA 1SYGA 1KIXA 4OHJA 4QW9A 5A35A 5I9PA 4ECSA 4CJ1B 1O75A 3P75A 4K8IA 2Z4HA 1Q90A 5I9OA 2R61A 3J81i 4DXFA 4O3QA 3I70A 1L0WA 2EY5A 2IW3A 2WKDA 1LM0A 1MSHA 1OXUA 3ORRA 1S5BD 2GN5A 1DM0B 1Q3LA 3LNNA 3K3PA 1MBYA 4A3EB 5FD5A 1EZ1A 4H13C 4R7RA 3Q8DA 4OGQC 3I12A 2ZDQA 2ASJA 3J80i 2DLNA 5DQHA 3GTLB 5K5PA 1XTCD 1V1PA 4K0KQ 3VR5A 1ZETA 3PW0A 5KG5A 2JA6B 2K5NA 4OWXB 4FP5D 4K14A 1IBLH 1X54A 1S0OA 2ZDGA 3PR4A 2TSSA 2G5DA 5CV4A 5H1SE 3BS1A 2NU7B 3GIQA 5EDWA 4Q43A 4O0AA 3J81L 2ZDHA 4PMCA 2L5TA 3PF4A 1M8AA 1SNPA 5E1FA 3HZXA 4IPGA 2IT1A 3BG5A 3V4SA 5EBDA 4O4HF 4OWTB 2PQAA 3J80L 1JLLB 2JEAI 4ZQ3A 3GV7B 4HMIA 2WIIB 3KLWA 4JI5Q 3QZ7A 2LKVA 3S2DB 1CI3M 5IOCA 3M3YH 3JC66 4DL3A 2GPSA 5M3FG 4IUNA 2OH2A 1YHAA 4L63B 1EWHA 4DR3H 5J22A 3H20A 1T36A 3J81W 3JSNA 4GZYC 2EYJA 1HFNA 2Q2HA 1JB3A 3TN2A 1H9MA 2UU9Q 2F0IA 4ZKCB 4WJ4A 3TQYA 1WR2A 1IYUA 3KHHA 2XD4A 1GXDC 2BQUA 1VMPA 2B8FA 4RCOA 4K0KH 4KJOA 2I5MX 3BA9A 4A3DB 3KLSX 4EQ5A 3M7NA 3J80W 4I7ZC 1B8AA 4IRDA 2YZGA 2BE5D 3H0GG 2JA8B 4MN3A 3J81E 4IUQA 2C5CA 3CPWA 2HCCA 3RIZA 4NP5A 2FLPA 1XWEA 2EYFA 5IE8A 5IP7G 3E5SA 1V51A 2VXWA 3TIIA 4LAAA 4IFDI 2HVQA 1AE2A 2KOLA 3SK8A 5KG4A 2QA4A 3J80E 2RGRA 4HSVA 2R8GA 1MGSA 4C3JG 2CCZA 3HKSA 3K0YA 4IUPA 1YNND 3F2DA 4X66Q 4Q44A 3NBIA 2XTIA 2F0JA 4JI5H 3OW7A 3JZIA 2W9AA 4JOIC 2GA4B 2L1BA 1FYCA 4KTAA 4CJ2C 4Q5VA 3CMEA 2PZWA 3S1RB 5KFYA 4AQYL 4OO1H 2UU9H 2PNRC 5C3WA 3GIMA 5C0XJ 3QFFA 3WDNA 2E2DC 4YY3Q 2J4XA 3RLOA 5L1LA 1CSPA 1AUXA 5ELEA 5I2YA 2A5HA 5JOBA 4OX9H 2NVQB 4LFBH 2AQ2B 2KJXA 4EEYA 3A7LA 1Y1VG 3EQLC 5FJ8G 2JA5G 5EWGA 1SEBD 5M5XH 4ULLA 4BBSB 1MJCA 3H91A 4IURA 4A3GB 2R6FA 2RDHA 3IAYA 3OTOL 3KLRA 3J7A5 4Q0FA 4FS2A 4CC5A 4DUYQ 1O7LA 1ULZA 1TWCB 2R8KA 1IYJB 5DEHA 4R8UB 3KF8A 4FF1A 4ZHQF 4X66H 3LX0A 2VUMA 2TMPA 2RCFA 5I6WA 2IP4A 3NBHA 5KT7A 2LSSA 1LTLA 2JK8A 1UC8A 3GIPA 3GIKA 4ZUIA 3KHGA 1VBHA 3I91A 4RUAA 2N88A 5C8YF 4DR5H 1IYVA 4C3IB 4YY3H 1TWFA 1BVSA 4A3JB 1O80A 1PH8A 3KAKA 4K2LA 3HOWG 3QWNA 1JOQA 1GSOA 4FYDA 4JI2L 3BDCA 3CCQA 4EX5A 1PVOA 1WD0A 3ND9A 3MWDA 2DN8A 5CORA 4JI3Q 4A76A 1JWUD 3N43B 3RGXA 1H95A 2XC9A 1ZXTA 2OT2A 1W2BA 3SK4A 1Q7YC 2NTTA 5ELOA 4GNXB 4DFAA 4A75A 1GUGA 5T14A 1BBXC 2EXZA 2X6GA 3HP3A 3S1NH 4EG0A 4ECQA 2NZ1D 1XDNA 1SRUA 1GLVA 1MSGA 3EA6A 3L2PA 4DUYH 2WB1G 1HR0L 1VQDA 1E4FT 5KG0A 3H94A 3NPPA 4C5AA 3MEFA 4J9PA 1TWAB 4PNYA 2ALYB 1VQMA 2WINB 4IRCA 3PIO3 1XX8A 2CHBD 3TIGA 2CW0C 1KAWA 4DK6C 3F2BA 5EJWA 2D9UA 5KT4A 3F8NA 4C3HG 2XRSD 2Y0SG 1OXTA 5M3FH 4OWWB 1HXYD 3G7LA 4IFDG 1CK1A 4JI8Q 4CKCA 3E5NA 3OIQA 4A2BA 4ZAIA 1HR0W 2XGTA 4MV9A 2JA9A 4ECUA 3SR1A 5D65A 4ZOLF 1AN8A 2W57A 3PO3B 1YITA 4GKKQ 2F03A 1PFSA 1E2VA 3H0GH 4DKAC 5KEEA 1T94A 4JBKA 4BA2I 1SFOA 1NR4A 1EIYB 2HQLA 4JI6L 2UUAL 1CS0A 1AUVA 2E8GA 1MZBA 1EIFA 5IP7H 3W2DA 5KNCA 1HRJA 3U9TA 1B6SA 4N9PA 4XIGS 4IWYA 1KBLA 1M1KC 2AQ1B 1T9HA 1DXMA 3QOLA 2CH4A 5IGGA 1BO0A 4C3JH 2A8VA 5DLGA 3T5KA 4B3TH 3LMLA 4UFZA 2ID0A 1FGBD 4UCUA 1B4OA 5KFLA 4LSAA 4RGNA 1YNXA 1LLRD 5LOVF 3E0EA 4RCNA 3MFHA 4QMGA 4UCSA 3FHWA 4O2AF 1EWCA 4C2MA 3SDZA 2DIKA 4E4TA 4JI8H 4ZK9B 3L4JA 5LL6S 3R93A 4JI1L 4ECXA 5LP6F 4GKJH 2JXMB 5DAUA 3TP7A 5DGBA 1SXTA 1JICA 1R4PB 2DGYA 3FPUB 3OOCA 5JJKA 4JV5L 2ZJTA 3KLSA 3U58A 2B2VC 3GTJH 3DLLA 4O2DA 3TREA 5IGDA 3GIIA 4A3MG 2B2TA 1IHZA 1JOOA 2NVXB 1Y1VH 2ZXRA 3N44B 5FJ8H 1HQMC 2JA5H 1NNXA 3CVZA 4JUZA 1IL8A 5D8DA 1VQ5A 1Y1WG 4E6IA 3R8BA 1JQYD 1LT5D 4TQSA 1SNMA 2K05A 1TS2A 2FHTA 3J7AF 3D8GA 2L9HA 1I3QA 1BJTA 1EEID 2R7ZG 1W6JA 3BVZA 3RAXA 5KFUA 4NW2A 4EQPA 3NGDA 2HVSA 1VQ6A 2XCLA 2RDJA 3U9OA 1S9FA 3PW7A 3DWQA 1JWMD 1VQFA 2A1AA 3GTPH 1JE5A 4IJHA 2KHSA 3K7AH 4PZ6A 4NDXA 3FMAA 3NENA 4LMYA 4IZ8A 4IUTA 4YCVA 4HIOA 3GO5A 1KHIA 4EBEA 1PZJD 4JYAL 4A3IG 3M9OB 1XPUA 1B9NA 1TWGB 4AQYQ 3UDGA 1U4PA 4FF4A 3MR2A 1Z2PX 3GTMA 3HOXB 2ZTCA 1S97A 2F0WA 4RGTA 4CGYB 4ED7A 1S4ZA 2J0TD 3AMUA 1RCVD 1BR9A 4QF4A 4GN4B 5EGTA 5JJIA 4DPGA 3CC4A 2KEEA 4NB3A 1Q1EA 3CP0A 2R93B 3GV3A 3OMCA 3AB9A 5ELFA 1CA5A 1K3BC 4UY8C 3G8CA 2AMCB 5EPLA 2O2LD 5COYA 3VA7A 3U9SA 2CW8A 5M3MB 5CV7A 4X3UA 2P0AA 2FK3A 5DLQE 1BF4A 1QVCA 2Z8LA 2AHOB 5C0XG 3OTOQ 1UUPA 3HGBA 3BZDB 2PW5A 3L7ZC 1PYBA 2BR0A 2EE1A 1STGA 1AP0A 4KI0A 1I50B 5KFQA 2CW0D 1PYSB 2WAQE 5IGFA 1NCVA 2K33A 2KBNA 2E2JH 1GUTA 1RF2D 1SE4A 1Z47A 1HTPA 3DWAA 3KK7A 2HHHL 1HUNA 2R92B 1I4GA 2WFWA 2XIGA 2HDLA 3GV8B 1TKWB 2F0LA 3I4MB 5JEAH 4LFAL 1IBML 1GGOA 1SJHD 1WTPA 1WTHA 4UCTA 3W1BA 2XCPA 4LF7L 5HV6A 2L55A 1KJIA 1WTRA 1GJXA 4ECZA 1Z6HA 2Q2UA 4JI2Q 2YS7A 3GV5B 1GD7A 2XWJB 2IMWP 1EQRA 1KAAA 5JUMA 4GNXC 4NKLA 1JJ2A 3T5JA 2E74C 4KV6A 5CBEE 2X6LA 1CKOA 1CQIB 2RQXA 1SNDA 4YR3A 1DD2A 1Y8PB 2F0SA 4R8IA 4MTEA 1I6VC 2V4RA 1M7JA 1JDBB 2XGQA 3SK6A 3OTOH 4CDCC 2AGPA 1EUCB 3X3NA 1UE1A 1TWHH 1Q8IA 4DR6L 4ED2A 4RNOA 5F9LA 1HR0Q 4J9MA 2UUCH 5KKNB 1XXGA 3CCVA 4RB3C 4A3FB 4KN4C 1A2TA 1DCZA 5AJ3L 2UXBH 3BYTB 1BDOA 4GLVB 3HOUG 3SHLA 2RDGA 3Q0AA 1FKAH 4PMWA 4QWAA 1EUDB 2ES2A 2OXPA 2MO0A 4BXXG 4A3MH 1VDZA 1D2BA 2OF1A 1EZ6A 3M9BA 2WAQG 2MCTA 3D31A 4QGUA 2PVPA 1KJQA 4TRDA 2IY5B 4OEMB 1Y1WH 5I4DA 1SAPA 3FMCA 3AQQA 3G71A 4IO9A 1B33N 1H9JA 1UE5A 1EYGA 2F0PA 2RDFA 3EN2A 4O4LF 3CCEA 4LF9L 4YBZB 3FKIG 2R7ZH 1JB7A 3M9MB 3AEVA 1VBGA 1O7YA 4JI6Q 3F2CA 1U0LA 3BVMA 4UAIA 2UUAQ 4ECTA 2FK2A 4DK1A 1HR0H 3RZDB 4ABNA 3CF5A 1DOLA 3EBEA 1Z7TA 2WKCA 4H44C 4A3KG 2OTJA 2HDMA 4FDBA 4RKLA 3L3OC 1PTOF 1F9RA 3A54A 3MFYA 5KT5A 5KFAA 3QJYA 1YJ9A 4ECYA 1JWSD 1SNOA 2GVBA 1II3A 2EYLA 2R8HA 2VOBA 2QW7A 5CB4F 5EQ0A 1V1PB 1UC9A 5KT2A 5IYDG 4A3IH 1TR5A 2M9VA 3ERQA 1DIKA 4JI1Q 4MV1A 3R5XA 3KBGA 4IUVA 4PV1C 3RB3A 4R4OA 3G6VA 3NK9A 4WJWA 1QILA 3S17H 2W6NA 1EIGA 4OX9L 4J0MA 4YWLA 4BS9A 4LFBL 3PO2B 1IXRA 2FJZA 3DF7A 3PR5B 1WFQA 4JI4L 1FNWA 4JV5Q 2QDBA 5KFBA 1DONA 1LT4D 3BZCA 3NP8A 4DR1L 1B6RA 3TQTA 1GHJA 2PQAB 4JI6H 4RWSC 2ATWA 3VPCA 2UUAH 5FLXc 1S10A 2IBKA 2YYAA 2R8JA 4C1NI 3CRLC 2XIWA 4RKBA 4KY7A 4XT1B 3RUZA 5C0XH 1VKZA 1RODA 4TQRA 1E24A 2ZJPA 2LMCB 1RK6A 4KK7A 5D1OA 3MXUA 3RZOH 3IG0A 1ET6A 3K5MA 3G6YA 2R87A 2GLTA 2QEJC 1A3VA 4F4XA 4DR5L 3T13A 1PA6A 4A93G 1GHKA 3RGZA 1RDPD 2C2EA 5C4XG 3BA8A 3RV4A 4JI1H 2W9CA 2RA4A 4JBJA 4C5CA 4UCRA 4FS1A 1TU2B 1EYDA 2ZJQA 2FMMA 2PPBC 3A0JA 3RN5A 2W9BA 4YWKA 3H3VI 4RHRA 3VDYA 4Y52H 3MWEA 1S5ED 3T16A 5BN3A 4JYAQ 2MP1A 3S2HH 1JX4A 3H0GA 3S1MH 5EKKA 1CQJB 3RF2A 2OEOA 1NY4A 1SR3A 1SCUB 4APVA 1SNQA 2NB0A 3Q2OA 1K28A 1XTDA 4OELB 2EY2A 2E2HH 1ENAA 2EQSA 1TS5A 3UE1A 2EYOA 4LUZA 4ME6A 2F0GA 1WYDA 4V0BA 5JJLA 2MFIA 3H09A 2A19A 3F8TA 4TV9F 4KKTA 3ER0A 3ETHA 2FB9A 3WNZA 5BMVF 3L0OA 5GONF 5JAVA 1B3AA 4ZYSA 5FLXE 1SYXB 5HURA 3I4NB 1SMXA 4DK3C 5FOBB 4QQBX 4BXXH 3T5LA 2V4DA 1XPOA 1BCPF 1ONLA 1PRTF 2HHHQ 3CQZH 3PO3G 1QZGA 1D5XC 4HNTA 3Q8SB 4JYAH 4FXDA 4ED8A 3K0XA 3GTJA 1B53A 4LUOA 4BY7B 1BNCA 1IBMQ 3KF8B 1ML0D 3J7YW 4IFDJ 1Y1VA 3NWTA 1NTGA 2VUMB 4A2AA 3EJIA 2VQEH 3FKIH 1NE3A 2AUJD 3SI8A 2JA5A 4LF7Q 3RD4A 3NBHB 3LWUA 2B3GA 4QWCA 1NBWA 3CCSA 4JG2A 3QOJA 2CWAA 3IFTA 1M90C 1I3QH 2V4QA 5KFTA 3PUZA 2QILA 1VQIA 3T1YL 5BR8L 4A3KH 4KJNA 3ULPA 4B3TL 4X65H 1M0TA 4PZ7A 1TWFB 2B2YA 2EVBA 3LWEA 2OWOA 3Q1KA 1VQPA 1MI2A 1EY5A 4R4IA 1MHWC 5DGAA 4UDUC 1VQBA 2I87A 3M4OH 4DR6Q 2QKIC 5G3LF 2PN1A 4GKJL 1WH2A 4L1KA 2UVUA 1HUMA 5IYDH 3GTPA 3J81c 2O5JC 4DV4L 2HHHH 2UVWA 4OONA 1KNAA 1KLUD 5AJ3Q 3TP6A 3KTMA 3TQ1A 1ZHSA 4Q8FA 2KCNA 3PUXA 1HHVA 1GUWA 3KALA 1X3FA 1SNCA 4EEQA 5FLMG 3MR6A 4GS3A 5CA1F 3HOZG 5KYIA 4LFAH 1FNUA 3J80c 5M5YH 5M5WH 4DR3Q 2FMAA 3BQ0A 3GTMH 1IBMH 3J7AV 1X65A 1D5MC 4FNFA 3L9AX 2ZXOA 2JA7G 1HA6A 1JJCB 4MA0A 2W8LA 4LF7H 2CZGA 2VNUD 4POGA 1UWVA 4JVZA 4B3ML 1HNXL 1PFBA 1Y8NB 2R7FA 1SYDA 1PH1A 1S0MA 2WB1A 3VYSA 4AYBG 4Y7NH 4RNNA 2N8NA 3CKIB 4HSPA 2F3VA 2YRXA 4L8JA 4PWQA 3ERSX 1HCZA 1R9TH 2ENBA 3K5OA 2RBMA 1SEIA 4DV5L 1TVXA 5L1IA 4FVMA 2B2WA 1VQCA 4DR6H 5C3EG 4LF6H 4DL7A 1N56A 4KLKA 2FE3A 3M4IA 3M9NB 3C46A 5IWAH 4A93H 5IYCG 3EIVA 5C4XH 2Y0SA 1N9WA 1I4QA 5C4JB 2JA8H 1XNQH 1SFOB 1B7YB 4KY6A 4HJ8A 4MV7A 3OUZA 3HKZG 1LTGD 2R7KA 3S1MB 4IPDA 1RK5A 3H6MA 4BBRB 2R7LA 2I07B 3GTKH 2XWBB 4LF5L 4DAPA 5KGUA 2C9OA 2B29A 1N34H 4EGVA 2PI2E 1WTVA 5KFZA 5JH7F 1QOHA 1V8QA 4IZOA 3K5LA 1EYAA 1CZWA 2IHFA 3Q23A 1X6OA 4OX9Q 4LFBQ 3S16H 3OPOA 1YIJA 1RKNA 4C2MB 2K28A 2M2LA 2L4NA 1MIUA 1JC7A 4JI4Q 4LF9H 1CM9A 3OYYA 4DR1Q 1TY0A 4HCEA 3J81j 5GAEC 5D1PA 1A8VA 3S15H 2A6HC 5EKLA 3BJYA 1C7YA 1GUOA 1TWHA 4WFN3 2ASDA 3ETJA 1RJQA 4IR1A 3TP8A 5A2QL 3VR2A 3VYUA 4LNQA 2JN4A 1B50A 4JBWA 3QB3A 4L5QA 3FP9A 4F4YA 1U4RA 4DV0L 1JCKB 3WWVA 1O7IA 3OW2A 3N6XA 2PNHA 3D6WA 3RR5A 4IPHA 1P8LA 4DR5Q 4IUUA 2FPPB 3VPDA 2C22A 1TS4A 4ILWA 2UXDL 1ASYA 1UAPA 3I4LA 2HT1A 1I3QB 3EPIA 2XVSA 1UEBA 2WB1E 1QVFA 4QIWA 2BQ3A 3VMMA 4LW1A 3NE5B 1BKBA 4J15A 1I6HH 1V4YA 4A3BG 5A2QW 4L5TA 2LY7A 1Y1WA 4RZRA 4JI4H 4Y8VB 2J6UA 2DY8A 1KDBA 3T1HL 4DR4L 4DR1H 4DA2A 2KA7A 4DL2A 4CDFC 1Y14B 2Z6KA 4F7XA 2G9HD 2YS6A 2R7ZA 2D0PA 2ZTEA 2J9GA 2Y0SE 4RB2C 3C1EA 5A2QE 2BDOA 1K1SA 2UUCL 4A3FG 1RTNA 3A8KE 2UXBL 5KX5F 3JAMi 4O1NA 4HJ9A 5KFOA 1SYCA 3H15A 5BPFA 3GTMB 3K7UC 1KTKA 1M6VA 4LH7A 3CAMA 5DG9A 2NZHA 1K8OA 4XDXA 5FLMH 3K8AA 4LF8L 3HOZH 1C4QA 1CT1D 1PMRA 4C1NK 3DMUA 4DNRB 1GSAA 4IAJA 2Z6KC 1KRTA 4X3SA 3I56A 4TVAB 1AFPA 3ULLA 2JA7H 1SE8A 4I4TF 4MTKA 5E4XA 2RHSB 4DK0A 2XSCA 2EIFA 3JAML 3S14H 1K83H 2JE6I 1BXTA 3TDQA 3CC7A 4HR7A 1CHQD 3S1QH 1J6QA 4HJ7A 1UE6A 2P5ZX 4YCUA 1GM5A 5BN4A 4KHVA 1Q82C 3H3VH 3H40A 1XPRA 1KL9A 1HNWL 3CRKC 4DAYA 1LTRD 1PYWD 2EYMA 3TSSA 3M3YB 4GLAC 3KOJA 5C3EH 2VZAA 3RB6A 2F4VH 4PG3A 4YHHH 2B2UA 5JPNC 5IYCH 3T1YQ 5BR8Q 4P71A 4B3TQ 3JAMW 4ECVA 3FEWX 4PDBA 1JIHA 3DEPA 3WO0A 2AGOA 4QIWE 3VYRA 3B6YA 1PH9A 4O3NA 1LTBD 3W3AA 1OTCA 4QWDA 4EBDA 2MNAA 3UQ8A 1F2YA 3UFXB 2XRQD 4GKJQ 1S03G 3J7AK 1WOCA 3JAME 4FM9A 1E2WA 4DV4Q 3MA2B 3DUZA 3O13A 1E4GT 2YZMA 3S15B 4DL4A 2E2IH 5DQIA 5KFFA 1E1OA 2FFKB 4BY1G 2I46A 4DV2L 5C1OA 5DQGA 5C1PA 3GTQH 1D1IA 2ALZA 4MV6A 4R9WA 4K5WA 4MZ9A 3MZ5A 3Q6SA 2KCTA 3HOYG 2E2HA 2CQAA 3HOVG 3STBC 5I2XA 1HNXQ 3MXPA 2BH2A 2A69D 2ZTDA 3MFGA 1EL0A 3K3VA 3T1YH 4CDEC 5BR8H 4APMA 2A6HD 1MKHA 1EZ8A 3D0FA 4YB8B 1GSHA 3NXWA 4JV1A 4YP3A 5EZYF 2DWCA 1OXSC 1YHBA 5CMDA 5KNBA 2E5LH 5DG7A 1S5DD 2PCFB 3BDLA 4DV5Q 4LF4L 1CSQA 2F3WA 4R4TA 1I6HB 1BXRA 3WOFA 1DV2A 2LXKA 2V9WA 4DV4H 1LUZA 3G6XA 5M5XB 3BYYB 2PMZA 2BOSA 2VPSA 3CD6A 1WCMG 3CQZA 2WAQA 1IW7D 4A3BH 3K5IA 1A62A 1PFNA 1EFID 1YEZA 5KG3A 1E0BA 4WD3A 3R5FA 5KFNA 2MJ8A 5FO8B 3D4WA 1IBKL 4FO2A 3FKIA 4EYIB 2NN6I 3P1HA 4B3MH 5LL6b 1HNXH 1E2ZA 1QB5D 3SVMA 4TSSA 4CDDC 1T5XD 2SEBD 3P20A 2D62A 4G7ZC 1S5CD 4HAEA 1C0AA 4X64L 3I90A 1RD9D 2A73B 2F0EA 4DV5H 3M7GA 3Q24A 1STHA 1S3OA 1U9RA 2ZM6L 1CKNA 1G91A 1OXXK 1ESFA 2V59A 2B2TC 1Q46A 2MGSA 3BVGA 3MVVA 4QUFA 2NVTH 2FLLA 1OO9B 1EIHA 4F87A 4KKUA 3C2PA 1VQEA 3FVQA 4M7EA 2F0FA 3RBDA 1PZKD 3HOWH 3OWFA 1CE8A 2CVRA 2SOBA 5LHY1 3K80C 5C5LA 1T3NA 4DUZL 3K6OA 4RFBA 3S1NB 2K5QA 2R84A 4DV0Q 4LF5H 5J2UF 4EQNA 4ECWA 2F52A 1LTSD 3FDSA 5L9XA 2UXDQ 2PZTA 2VQEL 3H4BA 3WOEA 2OQKA 4O3RA 2F0DA 2PO4A 3PSIA 5K2MA 1RJTA 5D1OB 3PQIA 4ID6A 1STAA 1STBA 2DJGC 1KQSA 3ORQA 2NWGA 5L1KA 4MIUA 3PVXA 3EVQA 5EWFA 5C44G 2F4IA 3T4AC 4X65L 5C4ZA 3D4RA 2YU9H 2DPIA 4J9RA 5M3FB 2IHEA 4LUVA 2W9CB 2MQHA 2B63G 3OHXC 1R9TA 3AFPA 3MAQA 4BWSC 1CHPD 4OIKA 4QY7A 4RUCA 4YR2A 5KFXA 4RU9A 3EYYA 2R86A 2K50A 2W9BB 2CFMA 2PMZE 4C3HH 2QF7A 3MEHA 2UUCQ 4R8NA 4IFDH 2CQYA 1TQOA 1LT3D 3GTOH 3H0GB 1PH5A 2UXBQ 2R7NA 4M9UA 1TY2A 4RMFA 3R2TA 3S9WA 1PTOH 5KFHA 2VS1A 1B44D 4DV0H 2RSNA 2Q2TA 3QIAA 2IA6A 1AW7A 4IHJF 3RAQA 3GTKA 4LFCL 1YI2A 2W6PA 4MV4A 4A3EG 3ICEA 4YJ3F 4LF8Q 2UXDH 4BY1H 3CC2A 1TS3A 1X3QA 4HIKA 2HCIA 3PGZA 4DV3L 4C3JB 5ELDA 1LO5D 4G3IA 1IOWA 4N8X1 2JA6G 1X3GA 3A5UA 3IKJA 4LK1C 3HOYH 4ZQIA 1N36L 1VQLA 2ZT9C 1KLGD 1HZAA 5F2DA 2B39A 4NXML 3RJ0A 3T1HH 4DR4H 3E6ZX 1G2TA 3U50C 2K6AA 3BQ2A 2DNCA 3PIPA 3RNUA 3A74A 5CYUA 3STBD 4TV8F 1A63A 1U5KA 1HNWQ 2NVYH 4LF6L 1WD1A 5IWAL 2X0SA 2AQ3B 5KG1A 1KRSA 1PXUA 5C3XA 4WJ3M 5I47A 3BAAA 3MFIA 3CCLA 3Q22A 2GPWA 4J9KA 2PYKA 1X32A 3GTJB 1XNQL 4KHPH 2RGVA 1ENFA 4IJLA 1Y1VB 2JA5B 5KFVA 3MC0B 2E76C 1WCMH 1YBYA 1P16A 3MWYW 4LF8H 1E4EA 4QCLA 1N34L 1K9MC 2YTVA 4LWCA 3GTGH 1I4XA 2QYZA 3N52A 4A3DG 2ICEC 2JA8G 4ALPA 5AFWA 1QWYA 4MA5A 2BA1A 5FPOA 4GC7A 3K81C 4CJ0B 4JV0A 1FL0A 2RF4A 4GLXA 2IJ0A 3T5HA 3E0JA 3GTPB 3M85A 4DV2Q 1HNWH 3K7AB 1K1QA 3LGJA 4DAVA 3TEHB 3G4SA 2AGQA 2FP4B 4JW0A 2A6ED 3HOWB 4U68A 4RA8A 4GOPA 3T51B 3GP7A 1F2MA 1SLJA 4PZ8A 4RHSA 4F50A 3NTKA 5HGQA 3MXNA 1VQHA 1H9KA 3U4VA 5IT9L 1PV4A 2JEJA 4DAMA 1MJEA 3K5NA 2XCAA 2R82A 3BDOA 1BQQT 2HIXA 2QDLA 3QR8A 4U6PA 4QB4A 1D7QA 3JRWA 3D6CA 3A55A 2I8CA 1LABA 2WB1B 3DM3A 4JBMA 3HFZB 3V96A 4RGOS 1EYCA 3FDTA 4DGZA 4F4ZA 1C30A 4O3SA 5M9OA 2JA7A 5LMNL 5HBRB 3UDFA 5FO7B 3G48A 1HZ9A 3RUPA 3TINA 2YZNA 4GOPC 2M05A 1K83A 1PX2A 3F2UA 3NSWA 2D0OA 4BWGB 4BBSG 5IT9W 4A3GG 4DV2H 4AYBA 3KDFA 4DU9A 5CV6A 2Y0SB 2L11A 2WE6A 3V6KA 2E2JB 3TZDA 4BA1I 3BG3A 2WACA 5IT9E 2FK1A 4YR0A 4ZUJA 2OCEA 1YZ6A 3KBXA 1KXLA 1W96A 3R3OA 1SYEA 5LMNW 4L5SA 2VW9A 3W1GA 5I6YA 1MD2D 4X64Q 1X9NA 1CQVA 3JRXA 3GQCA 4C3IG 3HKZA 4LF4H 4QWEA 2ZM6Q 4A3JG 3L4KA 4A3EH 1I94H 4HIMA 1SE2A 1VQ9A 1K0RA 2F0TA 2D5DA 3DM1A 3GTLH 1VQ8A 1D5ZC 2I5LX 2UXCH 2NU6B 3CCJA 5IYBG 4DUZQ 2JA6H 1TWHB 2H1EA 2E2IA 5JQWA 2BCOA 4DV7L 2D2CC 1LYLA 4DNIA 5CA0F 4HQ6A 4K8JA 4B9WA 3I8ZA 3KXYT 3Q8RB 1F2ZA 1V1QA 3S24A 3MR5A 1IBKH 2A68D 2VQEQ 1V43A 3CHBD 3GTQA 3N8DA 1DGSA 4J8QA 1RHPA 5FO9B 5KFIA 1S68A 1STYA 2KCCA 4ED3A 4P74A 2F4VL 4YHHL 2MPMA 3URYA 1I4RA 1JT8A 4YQWA 5BPHA 4X65Q 3CU7A 4XYMB 4X64H 4KHZA 1R4QB 3MXGA 2Z6BA 3TP5A 4A3MB 4M1UB 4QIWB 1CA6A 2EJGC 3HOUH 4IN3A 4FU0A 4YIJA 3OSOA 3PW2A 1WJJA 2ZM6H 1YJWA 1FJGL 1NMFA 1GVPA 1Y1WB 3GIDA 3ONAB 3A8IE 2WYOA 4YCWA 1G291 2EXDA 5ELCA 4XYOA 5HGTA 1FD7D 3DHQA 2QK4A 1HJPA 1XNRH 1EY7A 4I7AA 2R7ZB 4AYBE 4A3DH 4DUZH 1D8LA 1TIID 4F8MA 5KFWA 1KABA 1B9MA 5EPKA
chains in the Genus database with same CATH topology
2UXDL 1ASYA 2HT1A 4LFAQ 4LFCQ 1UEBA 2WB1E 2DGYA 1QVFA 4LW1A 5JJKA 4DR3L 1BKBA 4J15A 4JI0L 4JV5L 1I6HH 3U58A 4A3BG 4L5TA 3GTJH 3DLLA 4O2DA 3TREA 4A3MG 1JJGA 1UE7A 5LMUQ 3RLNA 2GVAA 1Y1VH 2OQ0A 3PUVA 3CMAA 2PI2A 5FJ8H 3T1HL 2JA5H 2KENA 4DR4L 4K0KL 4UPAA 2YV5A 4JI3L 2JQOA 3HKZE 1Y14B 2Z6KA 3CCRA 1N36Q 1Y1WG 1J5EQ 1VQ5A 2D0PA 2ZTEA 1XJVA 4NXMQ 3I4NH 2Y0SE 1N33L 2E5LL 1A0IA 3BU2A 1YJNA 2N49A 1OXVA 3GTPH 2AKWB 3S1RH 1PH4A 2UUCL 2RHQB 2R7ZG 3RN2A 4A3FG 4LF6Q 5IWAQ 2UXBL 3JAMi 4HJ9A 3H15A 2WP8J 1ASZA 4LF4Q 3NELA 4B3SL 3BZKA 4BY7H 1XMQQ 1VQ6A 3K7UC 1XNQQ 3CAMA 1S72A 1I94Q 2VUMH 2NZHA 1CUKA 3I2ZA 4JI5L 1VQFA 2A1AA 5FLMH 1JE5A 3K8AA 4IJHA 4LF8L 4DAYB 4PZ6A 3CW2C 3K7AH 4X62L 1EQQA 3HOZH 2CQOA 2YTYA 3NENA 3PCOB 2Z6KC 1KRTA 4P73A 1NJIC 4HIOA 4YCVA 3I56A 2IX1A 2UXCQ 3GO5A 4TVAB 5C44H 4BBSH 1KHIA 3I7FA 3KYHC 3ULLA 1N34Q 1SE8A 1QUQB 1TWFH 2UU9L 2JA7H 4A3GH 4JYAL 1IZ6A 4HJAA 4A3IG 2RHSB 2L15A 4UP9A 1XPUA 3S14H 2EIFA 4AQYQ 3UDGA 4DV6Q 1BBUA 1EUJA 1K83H 2JE6I 3I4OA 3CC7A 1IBKQ 2OTLA 3S1QH 1TWCH 2ZTCA 3I55A 1J6QA 4HJ7A 3KFUA 4GKKL 1UE6A 1GM5A 4YCUA 3H3VH 1Q82C 1XPRA 1KL9A 4GN4B 1HNWL 5JJIA 4LF9Q 4DPGA 1L1OB 3CC4A 4NB3A 1Q1EA 3CP0A 4GLAC 1G51A 1VQ4A 1VQOA 3KOJA 5C3EH 1XMOQ 2VZAA 1PH6A 4IOAA 4UY8C 2AMCB 4PG3A 4C3IH 4R4CA 1QUQA 1WI5A 5IYCH 4JCVE 5BR8Q 2YTXA 3T1YQ 4P71A 4IOCA 4B3TQ 4A3JH 5DLQE 1QVCA 2AHOB 5C0XG 3OTOQ 2B63H 3L7ZC 1PYBA 4QIWE 4X66L 1XMOL 1K73C 4KI0A 4A3CH 3B6YA 1PH9A 1PYSB 2BH8A 2WAQE 1OTCA 1XNRQ 1VQNA 3ZJYC 2MNAA 1E1TA 1HZCA 2KBNA 3TRZA 2E2JH 1L1OA 2HHHL 1Z47A 5IYBH 1Z9FA 4GKJQ 2R7DA 3HOXG 1WOCA 4NXNL 4OXPA 2WFWA 1K3RA 4DV4Q 4YY3L 4LFAL 5GAHC 4JI7Q 1IBML 2E2IH 2R93G 3GDEA 1E1OA 5LMNQ 4BY1G 3W1BA 3A5ZB 1TWAH 2DUDA 4LF7L 2CWPA 4DV2L 4DR7L 2Q2UA 5M3MG 4JI2Q 1PH7A 2I0QA 1GD7A 3GTQH 3UE0A 1EQRA 5C4JH 4MZ9A 4GNXC 1SFOH 1Q86C 2KCTA 1JJ2A 3HOYG 3HOVG 4DR2L 3S2DH 1CKOA 3STBC 1HNXQ 2BH2A 2ZTDA 4BBRH 3GD7A 1L1OC 2V1CC 4JOIA 4DUYL 1MKHA 3D0FA 3IRBA 2F3IA 1UE1A 1TWHH 5J3BA 1OXSC 1YHBA 2R92G 4DR6L 1HR0Q 4DV5Q 4LF4L 1CSQA 3I4MG 3CCVA 4R4TA 2VQFQ 3PO3H 5AJ3L 1I5FA 1RL2A 3PF5A 4GLVB 2LXKA 1YVCA 3HOUG 1TXYA 4B3RL 4C2MH 1HH2P 4PMWA 1LUZA 1N32L 5HY6A 2K4KA 2QGQA 3CD6A 1WCMG 2ES2A 1HNZL 2C35B 2MO0A 1QVGA 4POFA 1Q81C 4DV3Q 4A3BH 1A62A 1E7ZA 4BXXG 4A3MH 1YEZA 2JJQA 3SGIA 1CKNB 1Q8KA 3M9BA 2WAQG 3D31A 4QGUA 4R4QA 4OO1G 4DV7Q 1IBKL 2IY5B 4ME3A 1VQ7A 4UP7A 1Y1WH 2NN6I 3AQQA 3CPFA 3G71A 4IO9A 4QL5A 1UE5A 1EYGA 5K36G 3JAMc 3EN2A 1JMCA 2D62A 3CCEA 4LF9L 3M4QA 2MO1A 3FKIG 3NEMA 1JB7A 2R7ZH 3AEVA 2ZJRA 3F2CA 4JI6Q 1U0LA 2F4VQ 4X64L 4KHPL 4YHHQ 1C0AA 4NPSA 1CKMA 2UUAQ 4HIDA 1V9PA 1E3PA 2HIVA 3CF5A 3EBEA 5JEAJ 2K52A 4A3KG 2UUBL 1S3OA 2ZM6L 2OTJA 1CKNA 4FDBA 1OXXK 4H02A 1IBLQ 1Q46A 2NVTH 3PUWA 1VQEA 1PH2A 2K5HA 4JC0A 2R6GA 1YJ9A 2BA0A 2K5VA 2NVXH 1FJGQ 3HOWH 3KF6B 4X6AH 2GVBA 1Q12A 3CCUA 1GKHA 3K80C 4JI8L 4MNOA 1K8GA 5GROA 4DUZL 1KIXA 5IYDG 4DV0Q 4A3IH 2F52A 2ASBA 1BBWA 4JI1Q 2H5XA 5EAYA 4X62Q 4R4OA 2KHIA 2UXDQ 4RG1A 2VQEL 3S17H 3J81i 2OQKA 1AH9A 4OX9L 3PSIA 4YWLA 1L0WA 4LFBL 1VQKA 1LM0A 1IXRA 1OXUA 4R1JA 2GN5A 1WFQA 4JI4L 5IP9G 3BJUA 4JI0Q 4JV5Q 1KQSA 2KCMA 3BZCA 4DR1L 1EFWA 3Q8DA 5C44G 3KF6A 4X65L 2YU9H 2PQAB 3J80i 2ATWA 2IHEA 5FLXc 4LUVA 2K75A 2MQHA 4K0KQ 2B63G 4AIMA 3AFPA 2K5NA 4OWXB 2N78A 4QY7A 1X54A 1X55A 1N33Q 2K50A 1EWIA 4A3LG 2CFMA 2PMZE 5H1SE 2E5LQ 4C3HH 1E24A 4O0AA 2ZJPA 4TQUS 3AFQA 2UUCQ 4P72A 1TWGH 3PUYA 3PF4A 3RZOH 2CKZB 4DV1L 3GTOH 1PH5A 2UXBQ 4IPGA 2IT1A 4RMFA 3HOXH 2JEBI 3TS2A 2VS1A 4DR5L 4B3SQ 1PA6A 2Q2TA 2FXQA 4A93G 1NMGA 2PQAA 4OWTB 3PO2G 3KJOA 5C4XG 2YYZA 2JEAI 4LFCL 1K8AC 1YI2A 1X3EA 4JBJA 4A3EG 3KLWA 3E9HA 4JI5Q 2R93H 1YHQA 3ICEA 4LF8Q 3M3YH 2ZJQA 3JC66 4BY1H 3CC2A 4HIKA 3PGZA 5M3FG 3A0JA 4P75A 1YHAA 4DV3L 4YWKA 4IPCA 3RN5A 3H3VI 3VDYA 5LMUL 4Y52H 5M3MH 2Q2HA 2JA6G 1X3GA 3A5UA 2UU9Q 4JYAQ 2IX0A 4B3MQ 3HOYH 3TQYA 1N36L 1VQLA 1J5EL 3S2HH 3S1MH 4WJ4A 1HZAA 4NXML 1NY4A 1SR3A 1I50H 4APVA 3U4ZA 2I5MX 5JEAG 2KHJA 4EQ5A 3M7NA 1XTDA 3U50C 1VQAA 1B8AA 3PIPA 3RNUA 2E2HH 2EQSA 2I5HA 3A74A 3H0GG 4LUZA 3STBD 3UE1A 1A63A 1U5KA 1HNWQ 2NVYH 4LF6L 2R92H 5C0XI 3CPWA 5IWAL 1KRSA 1WYDA 4WJ3M 2MFIA 5JJLA 5IE8A 5IP7G 3CCLA 2A19A 3F8TA 2NVQH 3ER0A 3I4MH 1XMQL 4IFDI 1XNQL 1AE2A 1G6PA 2QA4A 4YWMA 1I94L 4IJLA 3PV0A 3L0OA 2QEXA 2CCZA 3HKSA 1WCMH 1YBYA 3F2DA 4X66Q 2UXCL 1P16A 2XTIA 1SMXA 2AWNA 4DK3C 4QQBX 4BXXH 1S40A 1N34L 4LF5Q 1XPOA 1L2FA 4JOIC 4GOPB 3CMEA 2YTVA 4LWCA 1K9MC 3CQZH 2HHHQ 3GTGH 4A3DG 4AQYL 4DV6L 1QZGA 4NXNQ 3PO3G 5C0XJ 2JA8G 2Q2IA 3CXCA 4ALPA 3MXNB 3K0XA 4YY3Q 2BA1A 3RLOA 1CSPA 1PH3A 4LUOA 3K81C 1IBMQ 3KF8B 1SN8A 4IFDJ 1FL0A 1NTGA 2RF4A 4GLXA 2NZOA 3FKIH 1NE3A 4A3FH 4LF7Q 3NBHB 3M85A 4DV2Q 2B3GA 2N3SA 1NBWA 3CCSA 3F1ZA 3LGJA 4JG2A 5GQOA 3E9IA 3TEHB 2CWAA 1Y1VG 3G4SA 1I3QH 1M90C 5FJ8G 2JA5G 1KD1C 2VY3A 3PUZA 5M5XH 1VQIA 1VQGA 5BR8L 3T1YL 4A3KH 2RCNA 4GOPA 1MJCA 4HJ5A 3ULPA 4PZ7A 4DR2Q 4B3TL 2OWOA 1SLJA 4PZ8A 4L5RC 3OTOL 3I4NG 3J7A5 1VQPA 5HGQA 4DUYQ 1VQHA 4R4IA 2K14A 3U4VA 1PV4A 4DAMA 1MJEA 1IYJB 2LXJA 1VQBA 1XNRL 3KDFB 3M4OH 4DR6Q 2HIXA 4GKJL 3W5OA 1D7QA 5IYDH 3UDXA 3AYHB 3J81c 4BY7G 2LSSA 1LTLA 2JK8A 4DV4L 3DM3A 4JBMA 3HFZB 1EOVA 4OONA 5AJ3Q 3KJPA 2VUMG 3TS0A 4JI7L 4B3RQ 3PUXA 4OO1I 1X3FA 5FLMG 1N32Q 4GS3A 1FVIA 5LMNL 3HOZG 3UDFA 1BVSA 3G48A 1HZ9A 4QJFA 1IL2A 4DR3Q 3J80c 5M5YH 5M5WH 4GOPC 1PH8A 5IP9H 3GTMH 3HOWG 3RZDH 1HNZQ 1X65A 4JI2L 4BBSG 2D0OA 3CCQA 4EX5A 2JA7G 4A3GG 1JJCB 1PVOA 3KDFA 2VNUD 3T1HQ 4POGA 4DR4Q 1UWVA 4B3ML 1HNXL 4JI3Q 4A76A 1H95A 1W3SA 2R7FA 1GO3E 4BA1I 1PH1A 1X56A 1W2BA 1Q7YC 5ELOA 4GNXB 4AYBG 1VS0A 4Y7NH 4A75A 2N8NA 4A3LH 3S1NH 2OCEA 1YZ6A 3ERSX 1R9TH 1KXLA 1SRUA 3ULJA 5LMNW 3L2PA 4GN5A 4L5SA 2WB1G 2VW9A 1VQDA 4DV5L 1HR0L 3W1GA 5E7NA 5IY0A 1VQCA 4X64Q 3MEFA 3M4PA 5GADC 5C3EG 2VQFL 1X9NA 4KHPQ 2ALYB 4KLKA 1VQMA 4A93H 5IYCG 2UUBQ 1E22A 5ELNA 3PO2H 3EIVA 5C4XH 2ZM6Q 4A3JG 1N9WA 1KAWA 1B7YB 1FGUA 1SROA 4DK6C 3F2BA 4A3EH 4HJ8A 1B70B 4HIMA 1VQ9A 3HKZG 4IPDA 1K0RA 4GNXA 4A3CG 3GTKH 2Y0SG 1OXTA 5M3FH 3GTLH 4OWWB 1VQ8A 4IFDG 4LF5L 4JI8Q 3PIOA 2I5LX 3CCJA 5IYBG 4DUZQ 2JA6H 2B29A 1HR0W 1N8RC 2XGTA 2JA9A 4DV7L 3HOVH 1LYLA 4GN3B 1HZBA 4DNIA 2PI2E 1VQJA 1Q1BA 1V1QA 3S24A 1YITA 3UDIA 2VQEQ 1V43A 2IHFA 3G6EA 4GKKQ 1X6OA 1DGSA 1PFSA 4MTNA 3RLFA 1KC8C 4OX9Q 3H0GH 4DKAC 3S16H 1YIJA 4LFBQ 4JBKA 4BA2I 5GAGC 1EIYB 2HQLA 4JI4Q 1MIUA 4JI6L 4P74A 2F4VL 4YHHL 2UUAL 2E8GA 3OYYA 1EIFA 4DR1Q 2Z0SA 5IP7H 3J81j 2NN6G 5GAEC 1JT8A 1A8VA 4X65Q 4DR7Q 1VCIA 3S15H 4KHZA 1AE3A 4XIGS 3J7ZC 4XTCS 1C7YA 1C9OA 1IBLL 3HOUH 1M1KC 4BBRG 1T9HA 4UP8A 1QZHA 1WJJA 4C3JH 2A8VA 1YJWA 2AWOA 3CCMA 1FJGL 1NMFA 1GVPA 2ID0A 4LNQA 2VL6A 1RIPA 1YNXA 3E0EA 4JBWA 4L5QA 3FP9A 4YCWA 4A4IA 1G291 2EXDA 3FHWA 4AH6A 4DV0L 1PHJA 1HJPA 4DV1Q 5IT9c 3WWVA 1O7IA 3OW2A 4AYBE 4A3DH 4JI1L 1D8LA 2PNHA 3RR5A 4IPHA 1P8LA 4DR5Q 2JA8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD L;  1ASY A;  2HT1 A;  4LFA Q;  4LFC Q;  1UEB A;  2WB1 E;  2DGY A;  1QVF A;  4LW1 A;  5JJK A;  4DR3 L;  1BKB A;  4J15 A;  4JI0 L;  4JV5 L;  1I6H H;  3U58 A;  4A3B G;  4L5T A;  3GTJ H;  3DLL A;  4O2D A;  3TRE A;  4A3M G;  1JJG A;  1UE7 A;  5LMU Q;  3RLN A;  2GVA A;  1Y1V H;  2OQ0 A;  3PUV A;  3CMA A;  2PI2 A;  5FJ8 H;  3T1H L;  2JA5 H;  2KEN A;  4DR4 L;  4K0K L;  4UPA A;  2YV5 A;  4JI3 L;  2JQO A;  3HKZ E;  1Y14 B;  2Z6K A;  3CCR A;  1N36 Q;  1Y1W G;  1J5E Q;  1VQ5 A;  2D0P A;  2ZTE A;  1XJV A;  4NXM Q;  3I4N H;  2Y0S E;  1N33 L;  2E5L L;  1A0I A;  3BU2 A;  1YJN A;  2N49 A;  1OXV A;  3GTP H;  2AKW B;  3S1R H;  1PH4 A;  2UUC L;  2RHQ B;  2R7Z G;  3RN2 A;  4A3F G;  4LF6 Q;  5IWA Q;  2UXB L;  3JAM i;  4HJ9 A;  3H15 A;  2WP8 J;  1ASZ A;  4LF4 Q;  3NEL A;  4B3S L;  3BZK A;  4BY7 H;  1XMQ Q;  1VQ6 A;  3K7U C;  1XNQ Q;  3CAM A;  1S72 A;  1I94 Q;  2VUM H;  2NZH A;  1CUK A;  3I2Z A;  4JI5 L;  1VQF A;  2A1A A;  5FLM H;  1JE5 A;  3K8A A;  4IJH A;  4LF8 L;  4DAY B;  4PZ6 A;  3CW2 C;  3K7A H;  4X62 L;  1EQQ A;  3HOZ H;  2CQO A;  2YTY A;  3NEN A;  3PCO B;  2Z6K C;  1KRT A;  4P73 A;  1NJI C;  4HIO A;  4YCV A;  3I56 A;  2IX1 A;  2UXC Q;  3GO5 A;  4TVA B;  5C44 H;  4BBS H;  1KHI A;  3I7F A;  3KYH C;  3ULL A;  1N34 Q;  1SE8 A;  1QUQ B;  1TWF H;  2UU9 L;  2JA7 H;  4A3G H;  4JYA L;  1IZ6 A;  4HJA A;  4A3I G;  2RHS B;  2L15 A;  4UP9 A;  1XPU A;  3S14 H;  2EIF A;  4AQY Q;  3UDG A;  4DV6 Q;  1BBU A;  1EUJ A;  1K83 H;  2JE6 I;  3I4O A;  3CC7 A;  1IBK Q;  2OTL A;  3S1Q H;  1TWC H;  2ZTC A;  3I55 A;  1J6Q A;  4HJ7 A;  3KFU A;  4GKK L;  1UE6 A;  1GM5 A;  4YCU A;  3H3V H;  1Q82 C;  1XPR A;  1KL9 A;  4GN4 B;  1HNW L;  5JJI A;  4LF9 Q;  4DPG A;  1L1O B;  3CC4 A;  4NB3 A;  1Q1E A;  3CP0 A;  4GLA C;  1G51 A;  1VQ4 A;  1VQO A;  3KOJ A;  5C3E H;  1XMO Q;  2VZA A;  1PH6 A;  4IOA A;  4UY8 C;  2AMC B;  4PG3 A;  4C3I H;  4R4C A;  1QUQ A;  1WI5 A;  5IYC H;  4JCV E;  5BR8 Q;  2YTX A;  3T1Y Q;  4P71 A;  4IOC A;  4B3T Q;  4A3J H;  5DLQ E;  1QVC A;  2AHO B;  5C0X G;  3OTO Q;  2B63 H;  3L7Z C;  1PYB A;  4QIW E;  4X66 L;  1XMO L;  1K73 C;  4KI0 A;  4A3C H;  3B6Y A;  1PH9 A;  1PYS B;  2BH8 A;  2WAQ E;  1OTC A;  1XNR Q;  1VQN A;  3ZJY C;  2MNA A;  1E1T A;  1HZC A;  2KBN A;  3TRZ A;  2E2J H;  1L1O A;  2HHH L;  1Z47 A;  5IYB H;  1Z9F A;  4GKJ Q;  2R7D A;  3HOX G;  1WOC A;  4NXN L;  4OXP A;  2WFW A;  1K3R A;  4DV4 Q;  4YY3 L;  4LFA L;  5GAH C;  4JI7 Q;  1IBM L;  2E2I H;  2R93 G;  3GDE A;  1E1O A;  5LMN Q;  4BY1 G;  3W1B A;  3A5Z B;  1TWA H;  2DUD A;  4LF7 L;  2CWP A;  4DV2 L;  4DR7 L;  2Q2U A;  5M3M G;  4JI2 Q;  1PH7 A;  2I0Q A;  1GD7 A;  3GTQ H;  3UE0 A;  1EQR A;  5C4J H;  4MZ9 A;  4GNX C;  1SFO H;  1Q86 C;  2KCT A;  1JJ2 A;  3HOY G;  3HOV G;  4DR2 L;  3S2D H;  1CKO A;  3STB C;  1HNX Q;  2BH2 A;  2ZTD A;  4BBR H;  3GD7 A;  1L1O C;  2V1C C;  4JOI A;  4DUY L;  1MKH A;  3D0F A;  3IRB A;  2F3I A;  1UE1 A;  1TWH H;  5J3B A;  1OXS C;  1YHB A;  2R92 G;  4DR6 L;  1HR0 Q;  4DV5 Q;  4LF4 L;  1CSQ A;  3I4M G;  3CCV A;  4R4T A;  2VQF Q;  3PO3 H;  5AJ3 L;  1I5F A;  1RL2 A;  3PF5 A;  4GLV B;  2LXK A;  1YVC A;  3HOU G;  1TXY A;  4B3R L;  4C2M H;  1HH2 P;  4PMW A;  1LUZ A;  1N32 L;  5HY6 A;  2K4K A;  2QGQ A;  3CD6 A;  1WCM G;  2ES2 A;  1HNZ L;  2C35 B;  2MO0 A;  1QVG A;  4POF A;  1Q81 C;  4DV3 Q;  4A3B H;  1A62 A;  1E7Z A;  4BXX G;  4A3M H;  1YEZ A;  2JJQ A;  3SGI A;  1CKN B;  1Q8K A;  3M9B A;  2WAQ G;  3D31 A;  4QGU A;  4R4Q A;  4OO1 G;  4DV7 Q;  1IBK L;  2IY5 B;  4ME3 A;  1VQ7 A;  4UP7 A;  1Y1W H;  2NN6 I;  3AQQ A;  3CPF A;  3G71 A;  4IO9 A;  4QL5 A;  1UE5 A;  1EYG A;  5K36 G;  3JAM c;  3EN2 A;  1JMC A;  2D62 A;  3CCE A;  4LF9 L;  3M4Q A;  2MO1 A;  3FKI G;  3NEM A;  1JB7 A;  2R7Z H;  3AEV A;  2ZJR A;  3F2C A;  4JI6 Q;  1U0L A;  2F4V Q;  4X64 L;  4KHP L;  4YHH Q;  1C0A A;  4NPS A;  1CKM A;  2UUA Q;  4HID A;  1V9P A;  1E3P A;  2HIV A;  3CF5 A;  3EBE A;  5JEA J;  2K52 A;  4A3K G;  2UUB L;  1S3O A;  2ZM6 L;  2OTJ A;  1CKN A;  4FDB A;  1OXX K;  4H02 A;  1IBL Q;  1Q46 A;  2NVT H;  3PUW A;  1VQE A;  1PH2 A;  2K5H A;  4JC0 A;  2R6G A;  1YJ9 A;  2BA0 A;  2K5V A;  2NVX H;  1FJG Q;  3HOW H;  3KF6 B;  4X6A H;  2GVB A;  1Q12 A;  3CCU A;  1GKH A;  3K80 C;  4JI8 L;  4MNO A;  1K8G A;  5GRO A;  4DUZ L;  1KIX A;  5IYD G;  4DV0 Q;  4A3I H;  2F52 A;  2ASB A;  1BBW A;  4JI1 Q;  2H5X A;  5EAY A;  4X62 Q;  4R4O A;  2KHI A;  2UXD Q;  4RG1 A;  2VQE L;  3S17 H;  3J81 i;  2OQK A;  1AH9 A;  4OX9 L;  3PSI A;  4YWL A;  1L0W A;  4LFB L;  1VQK A;  1LM0 A;  1IXR A;  1OXU A;  4R1J A;  2GN5 A;  1WFQ A;  4JI4 L;  5IP9 G;  3BJU A;  4JI0 Q;  4JV5 Q;  1KQS A;  2KCM A;  3BZC A;  4DR1 L;  1EFW A;  3Q8D A;  5C44 G;  3KF6 A;  4X65 L;  2YU9 H;  2PQA B;  3J80 i;  2ATW A;  2IHE A;  5FLX c;  4LUV A;  2K75 A;  2MQH A;  4K0K Q;  2B63 G;  4AIM A;  3AFP A;  2K5N A;  4OWX B;  2N78 A;  4QY7 A;  1X54 A;  1X55 A;  1N33 Q;  2K50 A;  1EWI A;  4A3L G;  2CFM A;  2PMZ E;  5H1S E;  2E5L Q;  4C3H H;  1E24 A;  4O0A A;  2ZJP A;  4TQU S;  3AFQ A;  2UUC Q;  4P72 A;  1TWG H;  3PUY A;  3PF4 A;  3RZO H;  2CKZ B;  4DV1 L;  3GTO H;  1PH5 A;  2UXB Q;  4IPG A;  2IT1 A;  4RMF A;  3HOX H;  2JEB I;  3TS2 A;  2VS1 A;  4DR5 L;  4B3S Q;  1PA6 A;  2Q2T A;  2FXQ A;  4A93 G;  1NMG A;  2PQA A;  4OWT B;  3PO2 G;  3KJO A;  5C4X G;  2YYZ A;  2JEA I;  4LFC L;  1K8A C;  1YI2 A;  1X3E A;  4JBJ A;  4A3E G;  3KLW A;  3E9H A;  4JI5 Q;  2R93 H;  1YHQ A;  3ICE A;  4LF8 Q;  3M3Y H;  2ZJQ A;  3JC6 6;  4BY1 H;  3CC2 A;  4HIK A;  3PGZ A;  5M3F G;  3A0J A;  4P75 A;  1YHA A;  4DV3 L;  4YWK A;  4IPC A;  3RN5 A;  3H3V I;  3VDY A;  5LMU L;  4Y52 H;  5M3M H;  2Q2H A;  2JA6 G;  1X3G A;  3A5U A;  2UU9 Q;  4JYA Q;  2IX0 A;  4B3M Q;  3HOY H;  3TQY A;  1N36 L;  1VQL A;  1J5E L;  3S2H H;  3S1M H;  4WJ4 A;  1HZA A;  4NXM L;  1NY4 A;  1SR3 A;  1I50 H;  4APV A;  3U4Z A;  2I5M X;  5JEA G;  2KHJ A;  4EQ5 A;  3M7N A;  1XTD A;  3U50 C;  1VQA A;  1B8A A;  3PIP A;  3RNU A;  2E2H H;  2EQS A;  2I5H A;  3A74 A;  3H0G G;  4LUZ A;  3STB D;  3UE1 A;  1A63 A;  1U5K A;  1HNW Q;  2NVY H;  4LF6 L;  2R92 H;  5C0X I;  3CPW A;  5IWA L;  1KRS A;  1WYD A;  4WJ3 M;  2MFI A;  5JJL A;  5IE8 A;  5IP7 G;  3CCL A;  2A19 A;  3F8T A;  2NVQ H;  3ER0 A;  3I4M H;  1XMQ L;  4IFD I;  1XNQ L;  1AE2 A;  1G6P A;  2QA4 A;  4YWM A;  1I94 L;  4IJL A;  3PV0 A;  3L0O A;  2QEX A;  2CCZ A;  3HKS A;  1WCM H;  1YBY A;  3F2D A;  4X66 Q;  2UXC L;  1P16 A;  2XTI A;  1SMX A;  2AWN A;  4DK3 C;  4QQB X;  4BXX H;  1S40 A;  1N34 L;  4LF5 Q;  1XPO A;  1L2F A;  4JOI C;  4GOP B;  3CME A;  2YTV A;  4LWC A;  1K9M C;  3CQZ H;  2HHH Q;  3GTG H;  4A3D G;  4AQY L;  4DV6 L;  1QZG A;  4NXN Q;  3PO3 G;  5C0X J;  2JA8 G;  2Q2I A;  3CXC A;  4ALP A;  3MXN B;  3K0X A;  4YY3 Q;  2BA1 A;  3RLO A;  1CSP A;  1PH3 A;  4LUO A;  3K81 C;  1IBM Q;  3KF8 B;  1SN8 A;  4IFD J;  1FL0 A;  1NTG A;  2RF4 A;  4GLX A;  2NZO A;  3FKI H;  1NE3 A;  4A3F H;  4LF7 Q;  3NBH B;  3M85 A;  4DV2 Q;  2B3G A;  2N3S A;  1NBW A;  3CCS A;  3F1Z A;  3LGJ A;  4JG2 A;  5GQO A;  3E9I A;  3TEH B;  2CWA A;  1Y1V G;  3G4S A;  1I3Q H;  1M90 C;  5FJ8 G;  2JA5 G;  1KD1 C;  2VY3 A;  3PUZ A;  5M5X H;  1VQI A;  1VQG A;  5BR8 L;  3T1Y L;  4A3K H;  2RCN A;  4GOP A;  1MJC A;  4HJ5 A;  3ULP A;  4PZ7 A;  4DR2 Q;  4B3T L;  2OWO A;  1SLJ A;  4PZ8 A;  4L5R C;  3OTO L;  3I4N G;  3J7A 5;  1VQP A;  5HGQ A;  4DUY Q;  1VQH A;  4R4I A;  2K14 A;  3U4V A;  1PV4 A;  4DAM A;  1MJE A;  1IYJ B;  2LXJ A;  1VQB A;  1XNR L;  3KDF B;  3M4O H;  4DR6 Q;  2HIX A;  4GKJ L;  3W5O A;  1D7Q A;  5IYD H;  3UDX A;  3AYH B;  3J81 c;  4BY7 G;  2LSS A;  1LTL A;  2JK8 A;  4DV4 L;  3DM3 A;  4JBM A;  3HFZ B;  1EOV A;  4OON A;  5AJ3 Q;  3KJP A;  2VUM G;  3TS0 A;  4JI7 L;  4B3R Q;  3PUX A;  4OO1 I;  1X3F A;  5FLM G;  1N32 Q;  4GS3 A;  1FVI A;  5LMN L;  3HOZ G;  3UDF A;  1BVS A;  3G48 A;  1HZ9 A;  4QJF A;  1IL2 A;  4DR3 Q;  3J80 c;  5M5Y H;  5M5W H;  4GOP C;  1PH8 A;  5IP9 H;  3GTM H;  3HOW G;  3RZD H;  1HNZ Q;  1X65 A;  4JI2 L;  4BBS G;  2D0O A;  3CCQ A;  4EX5 A;  2JA7 G;  4A3G G;  1JJC B;  1PVO A;  3KDF A;  2VNU D;  3T1H Q;  4POG A;  4DR4 Q;  1UWV A;  4B3M L;  1HNX L;  4JI3 Q;  4A76 A;  1H95 A;  1W3S A;  2R7F A;  1GO3 E;  4BA1 I;  1PH1 A;  1X56 A;  1W2B A;  1Q7Y C;  5ELO A;  4GNX B;  4AYB G;  1VS0 A;  4Y7N H;  4A75 A;  2N8N A;  4A3L H;  3S1N H;  2OCE A;  1YZ6 A;  3ERS X;  1R9T H;  1KXL A;  1SRU A;  3ULJ A;  5LMN W;  3L2P A;  4GN5 A;  4L5S A;  2WB1 G;  2VW9 A;  1VQD A;  4DV5 L;  1HR0 L;  3W1G A;  5E7N A;  5IY0 A;  1VQC A;  4X64 Q;  3MEF A;  3M4P A;  5GAD C;  5C3E G;  2VQF L;  1X9N A;  4KHP Q;  2ALY B;  4KLK A;  1VQM A;  4A93 H;  5IYC G;  2UUB Q;  1E22 A;  5ELN A;  3PO2 H;  3EIV A;  5C4X H;  2ZM6 Q;  4A3J G;  1N9W A;  1KAW A;  1B7Y B;  1FGU A;  1SRO A;  4DK6 C;  3F2B A;  4A3E H;  4HJ8 A;  1B70 B;  4HIM A;  1VQ9 A;  3HKZ G;  4IPD A;  1K0R A;  4GNX A;  4A3C G;  3GTK H;  2Y0S G;  1OXT A;  5M3F H;  3GTL H;  4OWW B;  1VQ8 A;  4IFD G;  4LF5 L;  4JI8 Q;  3PIO A;  2I5L X;  3CCJ A;  5IYB G;  4DUZ Q;  2JA6 H;  2B29 A;  1HR0 W;  1N8R C;  2XGT A;  2JA9 A;  4DV7 L;  3HOV H;  1LYL A;  4GN3 B;  1HZB A;  4DNI A;  2PI2 E;  1VQJ A;  1Q1B A;  1V1Q A;  3S24 A;  1YIT A;  3UDI A;  2VQE Q;  1V43 A;  2IHF A;  3G6E A;  4GKK Q;  1X6O A;  1DGS A;  1PFS A;  4MTN A;  3RLF A;  1KC8 C;  4OX9 Q;  3H0G H;  4DKA C;  3S16 H;  1YIJ A;  4LFB Q;  4JBK A;  4BA2 I;  5GAG C;  1EIY B;  2HQL A;  4JI4 Q;  1MIU A;  4JI6 L;  4P74 A;  2F4V L;  4YHH L;  2UUA L;  2E8G A;  3OYY A;  1EIF A;  4DR1 Q;  2Z0S A;  5IP7 H;  3J81 j;  2NN6 G;  5GAE C;  1JT8 A;  1A8V A;  4X65 Q;  4DR7 Q;  1VCI A;  3S15 H;  4KHZ A;  1AE3 A;  4XIG S;  3J7Z C;  4XTC S;  1C7Y A;  1C9O A;  1IBL L;  3HOU H;  1M1K C;  4BBR G;  1T9H A;  4UP8 A;  1QZH A;  1WJJ A;  4C3J H;  2A8V A;  1YJW A;  2AWO A;  3CCM A;  1FJG L;  1NMF A;  1GVP A;  2ID0 A;  4LNQ A;  2VL6 A;  1RIP A;  1YNX A;  3E0E A;  4JBW A;  4L5Q A;  3FP9 A;  4YCW A;  4A4I A;  1G29 1;  2EXD A;  3FHW A;  4AH6 A;  4DV0 L;  1PHJ A;  1HJP A;  4DV1 Q;  5IT9 c;  3WWV A;  1O7I A;  3OW2 A;  4AYB E;  4A3D H;  4JI1 L;  1D8L A;  2PNH A;  3RR5 A;  4IPH A;  1P8L A;  4DR5 Q;  2JA8 H; 
#chains in the Genus database with same CATH topology
 3A7A B;  4JK1 C;  2IWH A;  1KDA A;  4LFA Q;  2C2D A;  4LFC Q;  5FD6 A;  2F1M A;  3RBE A;  4JI0 L;  5TSS A;  1SYF A;  3VPB A;  4DL6 A;  3N42 B;  1JJG A;  1EY4 A;  1UE7 A;  3CMA A;  2OQ0 A;  2PW7 A;  5IIF A;  2PI2 A;  3Q8Q B;  1NAP A;  3E3X A;  4UPA A;  4JI3 L;  2O03 A;  3HKZ E;  1N36 Q;  3ITP A;  4NXM Q;  4A3I B;  5KFC A;  1N33 L;  2WTF A;  1WSC A;  2W71 A;  2E5L L;  1A0I A;  3BU2 A;  1GUN A;  4FBT A;  2WDT A;  1UEA B;  2AKW B;  3S1R H;  2A74 C;  1PH4 A;  2RHQ B;  3S17 B;  4K6D A;  2VB3 X;  3RN2 A;  4LF6 Q;  3HRZ C;  2VR1 A;  5IWA Q;  1B2T A;  2EOT A;  1HFG A;  4HR7 B;  1ASZ A;  2WV6 D;  1CFM A;  3NEL A;  3NWS A;  4B3S L;  2W70 A;  1JOK A;  1IKM A;  3RV3 A;  5DG8 A;  1XNQ Q;  3HB9 A;  4CKE A;  2RDI A;  1EY0 A;  1PZI D;  4CBV A;  5EKI A;  4QWB A;  1ET9 A;  1WTX A;  4RH6 A;  4F88 A;  2NVQ H;  3V4Z A;  4DAY B;  3CW2 C;  4LFC H;  2CQO A;  2YTY A;  3PZP A;  2B2Y C;  3PCO B;  1ZKO A;  1NJI C;  4HED A;  5KG6 A;  4QUC A;  4BBS H;  1LTI D;  2F0K A;  1N34 Q;  4A3G H;  1L2Z A;  4DV3 H;  1IZ6 A;  4HJA A;  1QNK A;  2L15 A;  4UP9 A;  1TA8 A;  2Z9H A;  1EUJ A;  3RZO B;  3D3R A;  3I4O A;  4B08 A;  2FLN A;  5LA6 F;  1TWC H;  3NUC A;  1N36 H;  5KT3 A;  4GKK L;  4NXM H;  2ZXP A;  4J6H A;  2YU9 A;  1A3T A;  4B9X A;  2DNE A;  4LF9 Q;  3N40 P;  3NTH A;  4N9T A;  4K5X A;  2PBZ A;  4J9L A;  1PH6 A;  1G51 A;  1VQO A;  1AH9 A;  5T1I A;  1VMC A;  4IOA A;  1RJR A;  1S0N A;  4C3I H;  3K58 A;  1QUQ A;  4JCV E;  3DWP A;  2YTX A;  3T53 B;  5C4H A;  5F9N A;  4A3J H;  1B1Z A;  4HYK A;  4ED0 A;  3S2H B;  3GTO A;  3KHL A;  1ZHQ A;  2YW2 A;  1A6X A;  2NU8 B;  1Z2N X;  4I50 F;  3PN1 A;  4MTD A;  2E2H B;  1HZC A;  4XT3 B;  1L1O A;  2RVL A;  5EOY A;  3NQI A;  1Z9F A;  5IYB H;  2R7D A;  3VR4 A;  3HOX G;  4GC6 A;  4NXN L;  4OXP A;  5CR3 A;  4YAJ B;  1BGW A;  2B2W C;  5H80 A;  1DYQ A;  5GAH C;  2R85 A;  1H9S A;  4PQX A;  4O4I F;  2R93 G;  3HOU B;  5KFK A;  5LMN Q;  1CTM A;  4G7H C;  3A8J E;  3A5Z B;  1TWA H;  1DZ1 A;  2DUD A;  2F0O A;  3FRP B;  4DR7 L;  2A69 C;  4C56 C;  1A15 A;  5M3M G;  1PH7 A;  1EYZ A;  3UE0 A;  5KND A;  1EY8 A;  4K2K A;  4KN7 C;  1PTO C;  4ME5 A;  1A9X A;  4DR2 L;  2PMZ B;  2KQ3 A;  2NVY A;  3CQZ B;  2WAQ B;  1L1O C;  3VA5 A;  1KEE A;  4FBU A;  2V1C C;  4HMJ A;  4JOI A;  5CV8 A;  3V6H A;  2DPJ A;  1HPC A;  2F3I A;  3VYT A;  2L12 A;  5J3B A;  5LXT F;  2R92 G;  4G4K A;  1DV1 A;  2HVR A;  2FMC A;  1YNJ D;  4N8F A;  5FPR A;  3I4M G;  3FKI B;  2ATL A;  3C1F A;  3PO3 H;  4IRK A;  1RL2 A;  1WCM A;  1IW7 C;  1YVC A;  5DLF A;  4B3R L;  2RKS A;  4HTH A;  4JPB W;  3HBL A;  1N32 L;  5HY6 A;  5KFR A;  4A3K B;  4MV3 A;  1C3O A;  2EPB A;  2SNM A;  3GTG A;  4KMU C;  1N48 A;  1F2L A;  1HNZ L;  2C35 B;  1QVG A;  5LMN H;  4I7H A;  4RAY A;  4HN7 A;  2XN9 C;  2JJQ A;  1CKN B;  1Q8K A;  4CC6 A;  3M4O B;  4DV7 Q;  1VQ7 A;  4UP7 A;  4XYQ A;  1JXL A;  4J9Q A;  2MHV A;  3CPF A;  1QG7 A;  5K36 G;  3JAM c;  1EQV A;  1JMC A;  3R5H A;  2Z4I A;  2MO1 A;  2J6S A;  3NEM A;  2F4V Q;  4KHP L;  4YHH Q;  4NPS A;  1CKM A;  4NLG A;  4HID A;  1LTA D;  2JP1 A;  5M5W B;  5M5Y B;  1V9P A;  2UUB L;  3DEO A;  3GLK A;  1VF7 A;  1KC7 A;  1C48 A;  4EGQ A;  2K5H A;  3RB0 A;  3QZ8 A;  1I6U A;  4O2B F;  4HNU A;  2NVX H;  1FJG Q;  2KSW A;  1H9R A;  1OWT A;  4X6A H;  3R23 A;  4Y7N B;  1GKH A;  4MNO A;  1K8G A;  1JKJ B;  1R9T B;  2B8G A;  5KFE A;  3MWM A;  3I72 A;  2PQE A;  2BQR A;  2ASB A;  1BBW A;  2H5X A;  5EAY A;  4X62 Q;  2HD3 A;  2K5D A;  1NSN S;  2KHI A;  4DV7 H;  4RG1 A;  4A93 B;  4QW8 A;  4ED1 A;  4ZRZ A;  1VQK A;  2K1B A;  5C4X B;  4R1J A;  5IP9 G;  2K32 A;  3BJU A;  4JI0 Q;  3MR3 A;  2KCM A;  2B63 A;  3KUP A;  2L0C A;  2SNS A;  1EFW A;  5T1G A;  5CBA E;  3KF6 A;  1VAJ A;  1RTO A;  3GTK B;  2K75 A;  1EY9 A;  3NHH A;  4DNT B;  3WO1 A;  2HGS A;  4AIM A;  2NTS A;  5D3D A;  3HEJ A;  1QJO A;  5DNF A;  2N78 A;  4TKO B;  1X55 A;  1EU4 A;  1N33 Q;  1EWI A;  4A3L G;  3ZYY X;  2E5L Q;  4RAZ A;  4Q8E A;  1F9Q A;  4TQU S;  3AFQ A;  3NTI A;  1BCP C;  1QNU A;  3AU7 A;  1PRT C;  1D6E C;  1TWG H;  2KVM A;  3PUY A;  4P72 A;  1C8C A;  4EYH B;  1FJG H;  2CKZ B;  4DV1 L;  3S16 B;  3TZU A;  4L6T B;  3HOX H;  1SBB B;  1WTQ A;  1RYR A;  2JEB I;  3TS2 A;  4B3S Q;  1BNZ A;  2FXQ A;  1NMG A;  3PO2 G;  4K5V A;  3KJO A;  4J9S A;  2YYZ A;  3GTL A;  1K8A C;  1X3E A;  4X62 H;  3E9H A;  2R93 H;  1YHQ A;  1V1O A;  2JA6 A;  2B2U C;  5C6A A;  3BAB A;  4P75 A;  2YCH A;  3PIP 3;  4IPC A;  2HQE A;  5LMU L;  4JI0 H;  5M3M H;  5KRU A;  4JV2 A;  3SE7 A;  2J6T A;  2M00 A;  3C0F B;  2IX0 A;  4B3M Q;  3V05 A;  1J5E L;  4ETS A;  2Q8R E;  1I50 H;  4UCV A;  4KKS A;  1F9P A;  1GUS A;  3U4Z A;  4CHT B;  2KHJ A;  5JEA G;  4JI3 H;  4DN4 M;  1E4E B;  1PTO D;  1VQA A;  2I5H A;  1KNE A;  1N33 H;  5EPJ A;  3N41 B;  5IYZ F;  2MUY A;  5KFG A;  2F0Q A;  5LL6 X;  2R92 H;  2VA2 A;  5C0X I;  4DXG A;  2C00 A;  4WBN F;  1SJE D;  2DZD A;  2AU0 A;  3I4M H;  3IFD A;  1XMQ L;  1IOV A;  1G6P A;  5J39 A;  3VR3 A;  4YWM A;  5JVH 3;  1I94 L;  2ASL A;  3TBI B;  2B2V A;  3HS0 C;  3PV0 A;  4B3S H;  2QEX A;  5KYL A;  1B3Q A;  2NUA B;  5FKA C;  2UXC L;  1F77 A;  1I7L A;  2AWN A;  2UVR A;  2JYO A;  5L37 A;  3QG1 A;  1S40 A;  4LF5 Q;  5KFD A;  1RYS A;  1L2F A;  4GOP B;  4RNM A;  4DV6 L;  4NXN Q;  4RB1 A;  4I65 A;  2Q2I A;  3CXC A;  3MXN B;  1S5F D;  4J1M A;  2RSO A;  2VPQ A;  1TAE A;  2K03 A;  1UNS A;  1PH3 A;  1ZYR C;  2VQD A;  5K36 H;  1SN8 A;  3OHA A;  2JEI A;  3VR6 A;  1G8Z D;  2A6E C;  2UVV A;  2NZO A;  3EFX D;  4GKK H;  2IX3 A;  4A3F H;  2NUC A;  1ILP A;  3OSP A;  1D1K A;  3HOZ B;  2N3S A;  1EY6 A;  5IGB A;  3F1Z A;  5GQO A;  1XMO L;  2EY6 A;  3E9I A;  4DR7 Q;  2HJW A;  3LP8 A;  1DOM A;  2NYZ D;  1KD1 C;  2VY3 A;  2FJ2 A;  3BQ1 A;  5DM6 3;  1QE6 A;  1VQG A;  1NUC A;  1J9O A;  1X3P A;  2RCN A;  3OMG A;  4HJ5 A;  5BN5 A;  4DR2 Q;  2JA7 B;  1G6Z A;  1ESR A;  3DXJ C;  4U7C A;  1JR0 D;  4L5R C;  3I4N G;  1JDE A;  3S14 B;  4IR9 A;  5C5J A;  4XZ3 B;  1K83 B;  3ND8 A;  2K14 A;  3A56 A;  4XQQ A;  3S1Q B;  1XNR L;  2LXJ A;  4AYB B;  3KDF B;  1DOK A;  4ED6 A;  2O4X A;  2LS0 1;  3HG9 A;  3W5O A;  3UDX A;  3AYH B;  4BY7 G;  2VB2 X;  4EGJ A;  1EOV A;  3KJP A;  2W7O A;  1B04 A;  3V6J A;  2VUM G;  2EDG A;  4EQO A;  5C3E B;  3TS0 A;  4JI7 L;  4B3R Q;  3JSL A;  4O3P A;  4NXN H;  1EOT A;  4G57 A;  2F0N A;  3T56 B;  1N32 Q;  1FVI A;  4KY5 A;  1IL2 A;  4QJF A;  3RB4 A;  5EWE A;  5IP9 H;  1BUV T;  2JEF A;  3RZD H;  1HNZ Q;  2CH4 W;  2KUM A;  1HQR D;  3HKZ B;  1TWC A;  4DF7 A;  4R8U A;  2Q8T A;  1ICF B;  4DR7 H;  3T1H Q;  4DR4 Q;  3MHB A;  4XYL B;  1W3S A;  3G6J B;  1GO3 E;  1HTL D;  1X56 A;  4DR2 H;  1VS0 A;  4OIJ A;  1U4M A;  1W6K A;  3IL8 A;  4A3L H;  1Z2O X;  2W8K A;  1SDF A;  1PDQ A;  3ULJ A;  4GN5 A;  2E2I B;  5E7N A;  5IY0 A;  4XQN A;  2OLS A;  4KHP Q;  5GAD C;  3M4P A;  2VQF L;  5KFS A;  2J7Z A;  4X3K A;  4J9N A;  1BCP D;  2ICI A;  2X69 A;  1PRT D;  2UUB Q;  1E22 A;  5ELN A;  3PO2 H;  3GTQ B;  2E75 C;  3PW4 A;  1STE A;  5JPM C;  1CZG A;  1FGU A;  1SRO A;  5E4W C;  2SCU B;  4B3R H;  1B70 B;  4YJ2 F;  4FXK C;  3PW5 A;  4LJZ C;  4GNX A;  1N32 H;  4A3C G;  1ENC A;  4LH6 A;  1A2U A;  4YAK B;  4J9O A;  2K7V A;  2W6Z A;  2FKL A;  2SDF A;  3PMF A;  3PIO A;  4UCO A;  3RFC A;  1HNZ H;  3N6R A;  1KJ9 A;  2A68 C;  1N8R C;  2V58 A;  3HOV H;  1SMY C;  1HZB A;  4GN3 B;  4H7B A;  1TWA A;  1VQJ A;  5J1Z A;  2F0H A;  1Q1B A;  4AQY H;  3UDI A;  5J2T F;  3G6E A;  2LFN A;  2R3Z A;  4MTN A;  1KC8 C;  3RLF A;  4G7O C;  4FF3 A;  4XQJ A;  5GAG C;  4O3O A;  4RZQ A;  4ZCK A;  5CGK A;  2Z0S A;  2NN6 G;  1EU3 A;  1VCI A;  5G3L D;  4A3B B;  1AE3 A;  5CV9 A;  1PK8 A;  3J7Z C;  4XTC S;  1L0X B;  1C9O A;  4FXG C;  3K57 A;  1JE4 A;  2DJF C;  1IBL L;  1STN A;  1EQT A;  4BBR G;  3K59 A;  4UP8 A;  2VUG A;  2W6Q A;  2UUB H;  1QZH A;  2AWO A;  3TME A;  3CCM A;  4S3S A;  1WTW A;  2R8I A;  2VL6 A;  1RIP A;  4A4I A;  4AH6 A;  2HUG A;  1ZQ7 A;  2BDN A;  2EY1 A;  1PHJ A;  4DV1 Q;  3MJF A;  3SK5 A;  5IT9 c;  4F4W A;  5KG2 A;  3UI2 A;  4Q45 A;  1KJJ A;  1XYI A;  1HA5 A;  1I4P A;  1PLF A;  2H4O A;  4EFB A;  3KHR A;  4MV8 A;  5ELB A;  3GIJ A;  2NBF A;  4DR3 L;  2Z1C A;  3RTX A;  2NVT B;  2EZV A;  4EVO A;  1ZYR D;  2DY7 A;  1JOR A;  2VA3 A;  4XXE A;  5JVG 3;  5LMU Q;  3RLN A;  1WVL A;  2GVA A;  3PUV A;  4KD4 A;  2KEN A;  2R7M A;  4JI2 H;  4K0K L;  2YV5 A;  2JQO A;  5CC4 A;  3X3M A;  3CCR A;  1J5E Q;  1KJ8 A;  2EYP A;  4Z9C B;  1XJV A;  4DL5 A;  3I4N H;  2FIN B;  3I3C A;  2O5I C;  1SE3 A;  1YJN A;  2N49 A;  1OXV A;  2FPG B;  5JVL A;  4ZKB B;  4I55 F;  2C28 A;  2K5W A;  2JEG A;  2WP8 J;  1AEX A;  4LF4 Q;  2F0M A;  1LTT D;  4BY7 H;  3BZK A;  2I80 A;  1XMQ Q;  4DV1 H;  2NVX A;  1S72 A;  1I94 Q;  5KIX A;  2YU9 B;  2VUM H;  1CUK A;  1NR2 A;  5LYJ F;  1F9S A;  3I2Z A;  4LMQ D;  1WTO A;  4JI5 L;  4FF2 A;  4OO1 I;  3K5H A;  4EFE A;  1EQQ A;  4X62 L;  4NMZ A;  4UHV A;  4P73 A;  2IX1 A;  3QO2 A;  1O7Z A;  3GQB A;  4K6L A;  4MHE A;  2UXC Q;  1K0S A;  5C44 H;  1EHI A;  3I7F A;  3KYH C;  1TWF H;  1QUQ B;  4C3H B;  2UU9 L;  4ODG A;  1M0W A;  5LMU H;  3SEB A;  5NUC A;  4IQZ A;  2B63 H;  1CQF A;  1BBU A;  4DV6 Q;  1IBK Q;  4IAL A;  2OTL A;  3GTO B;  2NU9 B;  2CW7 A;  2K01 A;  5DM7 3;  3I55 A;  4TUY F;  5CAE B;  1AZQ A;  1J5E H;  1PTO B;  2N55 A;  3KFU A;  4HCS A;  1UNN C;  5KFJ A;  1L1O B;  1GOZ A;  3NQT A;  1VF5 C;  1A3U A;  3GIL A;  3H4D A;  4BY1 B;  1VQ4 A;  1XMO Q;  5D3I B;  3Q8P B;  2EJM A;  4C5B A;  3OIP A;  3IN5 A;  4R4C A;  1H9S B;  3D4D A;  1WI5 A;  2PZU A;  3KAJ A;  4HNV A;  4RAU C;  4IOC A;  5ISR A;  3C3L A;  1XMQ H;  2Q8I B;  1TWG A;  2IL8 A;  1KDC A;  1AN7 A;  3HOY B;  4LSX A;  1FR3 A;  5D14 A;  1U4L A;  3H3V C;  3HOV B;  4H0L C;  1K73 C;  2FPI B;  4X66 L;  2F0U A;  4A3C H;  1ICW A;  2C2R A;  5E3F A;  2BH8 A;  5KFP A;  1XNR Q;  1VQN A;  3ZJY C;  1E1T A;  1T5E A;  3TRZ A;  2QCP X;  1G2S A;  1BOS A;  2NVY B;  3GV6 A;  3OHB A;  2R93 A;  1K3R A;  1TT2 A;  3SXH A;  4YY3 L;  4DV6 H;  1SSO A;  4JI7 Q;  3R2I A;  3I73 A;  4PMB A;  1SMY D;  3GDE A;  2K04 A;  3P7J A;  5IGE A;  1DJR D;  5FLX L;  1L0Y B;  4M8A A;  2CWP A;  4JV5 H;  1I50 A;  1WCM B;  1LT6 D;  2I0Q A;  5KFM A;  2NN6 H;  3HXL A;  5C4J H;  4IWX A;  1SFO H;  1Q86 C;  3EPG A;  1XMO H;  3S2D H;  2BE5 C;  4BBR H;  2R92 A;  3GD7 A;  3GTG B;  4DLK A;  1IKL A;  1RJP A;  5CV5 A;  4DUY L;  1YNJ C;  3IRB A;  4O42 A;  1QCB D;  1ZEQ X;  5FLX W;  4CKB A;  3OSN A;  2F0V A;  1LV9 A;  2KED A;  2VQF Q;  5KT6 A;  2EYH A;  1I5F A;  1LAC A;  3PF5 A;  2G9D A;  1YNN C;  1TXY A;  4C2M H;  4ECR A;  1HH2 P;  5EBC A;  1Y8O B;  3FPP A;  2JSO A;  3OWE B;  1SYB A;  4RGM A;  2K4K A;  2QGQ A;  1J8I A;  2XGP A;  4JI7 H;  2KEC A;  2EJF C;  3ERO A;  5C5M A;  3LWB A;  4POF A;  1Q81 C;  4DV3 Q;  1E7Z A;  2AQ4 A;  4Q0Y A;  1EEF D;  4KD3 A;  4EBC A;  3SGI A;  1O78 A;  5JVD F;  1K8M A;  3RMH A;  3M4Y A;  4R4Q A;  4OO1 G;  4ME3 A;  4RB0 A;  1M4V A;  4WRD A;  2IPK D;  3SE0 A;  4P2C B;  4QL5 A;  2W6O A;  3MTS A;  3V2T A;  2YL2 A;  3OUU A;  3M4Q A;  2V5A A;  5JJZ A;  4MAM A;  5IOD A;  4XX0 B;  2W7P A;  2ZJR A;  2W6M A;  1W93 A;  2AUK A;  1E3P A;  2HIV A;  1BCP B;  1PRT B;  1FNV A;  5JEA J;  2K52 A;  5FK9 C;  4U67 3;  4WOR A;  2VQF H;  5KG7 A;  5C44 B;  4H02 A;  1IBL Q;  2YRW A;  1GYF A;  4ZI7 F;  3PUW A;  1ILQ A;  1PH2 A;  4JC0 A;  2B63 B;  2R6G A;  5L1J A;  2BA0 A;  2K5V A;  5IGC A;  3KF6 B;  1PFM A;  1Q12 A;  4ZLT F;  3CCU A;  4V19 0;  1I4H A;  4JI8 L;  1I7N A;  4OL7 A;  5GRO A;  2XNA C;  4X3T A;  1Y69 U;  1AZP A;  1SYG A;  1KIX A;  4OHJ A;  4QW9 A;  5A35 A;  5I9P A;  4ECS A;  4CJ1 B;  1O75 A;  3P75 A;  4K8I A;  2Z4H A;  1Q90 A;  5I9O A;  2R61 A;  3J81 i;  4DXF A;  4O3Q A;  3I70 A;  1L0W A;  2EY5 A;  2IW3 A;  2WKD A;  1LM0 A;  1MSH A;  1OXU A;  3ORR A;  1S5B D;  2GN5 A;  1DM0 B;  1Q3L A;  3LNN A;  3K3P A;  1MBY A;  4A3E B;  5FD5 A;  1EZ1 A;  4H13 C;  4R7R A;  3Q8D A;  4OGQ C;  3I12 A;  2ZDQ A;  2ASJ A;  3J80 i;  2DLN A;  5DQH A;  3GTL B;  5K5P A;  1XTC D;  1V1P A;  4K0K Q;  3VR5 A;  1ZET A;  3PW0 A;  5KG5 A;  2JA6 B;  2K5N A;  4OWX B;  4FP5 D;  4K14 A;  1IBL H;  1X54 A;  1S0O A;  2ZDG A;  3PR4 A;  2TSS A;  2G5D A;  5CV4 A;  5H1S E;  3BS1 A;  2NU7 B;  3GIQ A;  5EDW A;  4Q43 A;  4O0A A;  3J81 L;  2ZDH A;  4PMC A;  2L5T A;  3PF4 A;  1M8A A;  1SNP A;  5E1F A;  3HZX A;  4IPG A;  2IT1 A;  3BG5 A;  3V4S A;  5EBD A;  4O4H F;  4OWT B;  2PQA A;  3J80 L;  1JLL B;  2JEA I;  4ZQ3 A;  3GV7 B;  4HMI A;  2WII B;  3KLW A;  4JI5 Q;  3QZ7 A;  2LKV A;  3S2D B;  1CI3 M;  5IOC A;  3M3Y H;  3JC6 6;  4DL3 A;  2GPS A;  5M3F G;  4IUN A;  2OH2 A;  1YHA A;  4L63 B;  1EWH A;  4DR3 H;  5J22 A;  3H20 A;  1T36 A;  3J81 W;  3JSN A;  4GZY C;  2EYJ A;  1HFN A;  2Q2H A;  1JB3 A;  3TN2 A;  1H9M A;  2UU9 Q;  2F0I A;  4ZKC B;  4WJ4 A;  3TQY A;  1WR2 A;  1IYU A;  3KHH A;  2XD4 A;  1GXD C;  2BQU A;  1VMP A;  2B8F A;  4RCO A;  4K0K H;  4KJO A;  2I5M X;  3BA9 A;  4A3D B;  3KLS X;  4EQ5 A;  3M7N A;  3J80 W;  4I7Z C;  1B8A A;  4IRD A;  2YZG A;  2BE5 D;  3H0G G;  2JA8 B;  4MN3 A;  3J81 E;  4IUQ A;  2C5C A;  3CPW A;  2HCC A;  3RIZ A;  4NP5 A;  2FLP A;  1XWE A;  2EYF A;  5IE8 A;  5IP7 G;  3E5S A;  1V51 A;  2VXW A;  3TII A;  4LAA A;  4IFD I;  2HVQ A;  1AE2 A;  2KOL A;  3SK8 A;  5KG4 A;  2QA4 A;  3J80 E;  2RGR A;  4HSV A;  2R8G A;  1MGS A;  4C3J G;  2CCZ A;  3HKS A;  3K0Y A;  4IUP A;  1YNN D;  3F2D A;  4X66 Q;  4Q44 A;  3NBI A;  2XTI A;  2F0J A;  4JI5 H;  3OW7 A;  3JZI A;  2W9A A;  4JOI C;  2GA4 B;  2L1B A;  1FYC A;  4KTA A;  4CJ2 C;  4Q5V A;  3CME A;  2PZW A;  3S1R B;  5KFY A;  4AQY L;  4OO1 H;  2UU9 H;  2PNR C;  5C3W A;  3GIM A;  5C0X J;  3QFF A;  3WDN A;  2E2D C;  4YY3 Q;  2J4X A;  3RLO A;  5L1L A;  1CSP A;  1AUX A;  5ELE A;  5I2Y A;  2A5H A;  5JOB A;  4OX9 H;  2NVQ B;  4LFB H;  2AQ2 B;  2KJX A;  4EEY A;  3A7L A;  1Y1V G;  3EQL C;  5FJ8 G;  2JA5 G;  5EWG A;  1SEB D;  5M5X H;  4ULL A;  4BBS B;  1MJC A;  3H91 A;  4IUR A;  4A3G B;  2R6F A;  2RDH A;  3IAY A;  3OTO L;  3KLR A;  3J7A 5;  4Q0F A;  4FS2 A;  4CC5 A;  4DUY Q;  1O7L A;  1ULZ A;  1TWC B;  2R8K A;  1IYJ B;  5DEH A;  4R8U B;  3KF8 A;  4FF1 A;  4ZHQ F;  4X66 H;  3LX0 A;  2VUM A;  2TMP A;  2RCF A;  5I6W A;  2IP4 A;  3NBH A;  5KT7 A;  2LSS A;  1LTL A;  2JK8 A;  1UC8 A;  3GIP A;  3GIK A;  4ZUI A;  3KHG A;  1VBH A;  3I91 A;  4RUA A;  2N88 A;  5C8Y F;  4DR5 H;  1IYV A;  4C3I B;  4YY3 H;  1TWF A;  1BVS A;  4A3J B;  1O80 A;  1PH8 A;  3KAK A;  4K2L A;  3HOW G;  3QWN A;  1JOQ A;  1GSO A;  4FYD A;  4JI2 L;  3BDC A;  3CCQ A;  4EX5 A;  1PVO A;  1WD0 A;  3ND9 A;  3MWD A;  2DN8 A;  5COR A;  4JI3 Q;  4A76 A;  1JWU D;  3N43 B;  3RGX A;  1H95 A;  2XC9 A;  1ZXT A;  2OT2 A;  1W2B A;  3SK4 A;  1Q7Y C;  2NTT A;  5ELO A;  4GNX B;  4DFA A;  4A75 A;  1GUG A;  5T14 A;  1BBX C;  2EXZ A;  2X6G A;  3HP3 A;  3S1N H;  4EG0 A;  4ECQ A;  2NZ1 D;  1XDN A;  1SRU A;  1GLV A;  1MSG A;  3EA6 A;  3L2P A;  4DUY H;  2WB1 G;  1HR0 L;  1VQD A;  1E4F T;  5KG0 A;  3H94 A;  3NPP A;  4C5A A;  3MEF A;  4J9P A;  1TWA B;  4PNY A;  2ALY B;  1VQM A;  2WIN B;  4IRC A;  3PIO 3;  1XX8 A;  2CHB D;  3TIG A;  2CW0 C;  1KAW A;  4DK6 C;  3F2B A;  5EJW A;  2D9U A;  5KT4 A;  3F8N A;  4C3H G;  2XRS D;  2Y0S G;  1OXT A;  5M3F H;  4OWW B;  1HXY D;  3G7L A;  4IFD G;  1CK1 A;  4JI8 Q;  4CKC A;  3E5N A;  3OIQ A;  4A2B A;  4ZAI A;  1HR0 W;  2XGT A;  4MV9 A;  2JA9 A;  4ECU A;  3SR1 A;  5D65 A;  4ZOL F;  1AN8 A;  2W57 A;  3PO3 B;  1YIT A;  4GKK Q;  2F03 A;  1PFS A;  1E2V A;  3H0G H;  4DKA C;  5KEE A;  1T94 A;  4JBK A;  4BA2 I;  1SFO A;  1NR4 A;  1EIY B;  2HQL A;  4JI6 L;  2UUA L;  1CS0 A;  1AUV A;  2E8G A;  1MZB A;  1EIF A;  5IP7 H;  3W2D A;  5KNC A;  1HRJ A;  3U9T A;  1B6S A;  4N9P A;  4XIG S;  4IWY A;  1KBL A;  1M1K C;  2AQ1 B;  1T9H A;  1DXM A;  3QOL A;  2CH4 A;  5IGG A;  1BO0 A;  4C3J H;  2A8V A;  5DLG A;  3T5K A;  4B3T H;  3LML A;  4UFZ A;  2ID0 A;  1FGB D;  4UCU A;  1B4O A;  5KFL A;  4LSA A;  4RGN A;  1YNX A;  1LLR D;  5LOV F;  3E0E A;  4RCN A;  3MFH A;  4QMG A;  4UCS A;  3FHW A;  4O2A F;  1EWC A;  4C2M A;  3SDZ A;  2DIK A;  4E4T A;  4JI8 H;  4ZK9 B;  3L4J A;  5LL6 S;  3R93 A;  4JI1 L;  4ECX A;  5LP6 F;  4GKJ H;  2JXM B;  5DAU A;  3TP7 A;  5DGB A;  1SXT A;  1JIC A;  1R4P B;  2DGY A;  3FPU B;  3OOC A;  5JJK A;  4JV5 L;  2ZJT A;  3KLS A;  3U58 A;  2B2V C;  3GTJ H;  3DLL A;  4O2D A;  3TRE A;  5IGD A;  3GII A;  4A3M G;  2B2T A;  1IHZ A;  1JOO A;  2NVX B;  1Y1V H;  2ZXR A;  3N44 B;  5FJ8 H;  1HQM C;  2JA5 H;  1NNX A;  3CVZ A;  4JUZ A;  1IL8 A;  5D8D A;  1VQ5 A;  1Y1W G;  4E6I A;  3R8B A;  1JQY D;  1LT5 D;  4TQS A;  1SNM A;  2K05 A;  1TS2 A;  2FHT A;  3J7A F;  3D8G A;  2L9H A;  1I3Q A;  1BJT A;  1EEI D;  2R7Z G;  1W6J A;  3BVZ A;  3RAX A;  5KFU A;  4NW2 A;  4EQP A;  3NGD A;  2HVS A;  1VQ6 A;  2XCL A;  2RDJ A;  3U9O A;  1S9F A;  3PW7 A;  3DWQ A;  1JWM D;  1VQF A;  2A1A A;  3GTP H;  1JE5 A;  4IJH A;  2KHS A;  3K7A H;  4PZ6 A;  4NDX A;  3FMA A;  3NEN A;  4LMY A;  4IZ8 A;  4IUT A;  4YCV A;  4HIO A;  3GO5 A;  1KHI A;  4EBE A;  1PZJ D;  4JYA L;  4A3I G;  3M9O B;  1XPU A;  1B9N A;  1TWG B;  4AQY Q;  3UDG A;  1U4P A;  4FF4 A;  3MR2 A;  1Z2P X;  3GTM A;  3HOX B;  2ZTC A;  1S97 A;  2F0W A;  4RGT A;  4CGY B;  4ED7 A;  1S4Z A;  2J0T D;  3AMU A;  1RCV D;  1BR9 A;  4QF4 A;  4GN4 B;  5EGT A;  5JJI A;  4DPG A;  3CC4 A;  2KEE A;  4NB3 A;  1Q1E A;  3CP0 A;  2R93 B;  3GV3 A;  3OMC A;  3AB9 A;  5ELF A;  1CA5 A;  1K3B C;  4UY8 C;  3G8C A;  2AMC B;  5EPL A;  2O2L D;  5COY A;  3VA7 A;  3U9S A;  2CW8 A;  5M3M B;  5CV7 A;  4X3U A;  2P0A A;  2FK3 A;  5DLQ E;  1BF4 A;  1QVC A;  2Z8L A;  2AHO B;  5C0X G;  3OTO Q;  1UUP A;  3HGB A;  3BZD B;  2PW5 A;  3L7Z C;  1PYB A;  2BR0 A;  2EE1 A;  1STG A;  1AP0 A;  4KI0 A;  1I50 B;  5KFQ A;  2CW0 D;  1PYS B;  2WAQ E;  5IGF A;  1NCV A;  2K33 A;  2KBN A;  2E2J H;  1GUT A;  1RF2 D;  1SE4 A;  1Z47 A;  1HTP A;  3DWA A;  3KK7 A;  2HHH L;  1HUN A;  2R92 B;  1I4G A;  2WFW A;  2XIG A;  2HDL A;  3GV8 B;  1TKW B;  2F0L A;  3I4M B;  5JEA H;  4LFA L;  1IBM L;  1GGO A;  1SJH D;  1WTP A;  1WTH A;  4UCT A;  3W1B A;  2XCP A;  4LF7 L;  5HV6 A;  2L55 A;  1KJI A;  1WTR A;  1GJX A;  4ECZ A;  1Z6H A;  2Q2U A;  4JI2 Q;  2YS7 A;  3GV5 B;  1GD7 A;  2XWJ B;  2IMW P;  1EQR A;  1KAA A;  5JUM A;  4GNX C;  4NKL A;  1JJ2 A;  3T5J A;  2E74 C;  4KV6 A;  5CBE E;  2X6L A;  1CKO A;  1CQI B;  2RQX A;  1SND A;  4YR3 A;  1DD2 A;  1Y8P B;  2F0S A;  4R8I A;  4MTE A;  1I6V C;  2V4R A;  1M7J A;  1JDB B;  2XGQ A;  3SK6 A;  3OTO H;  4CDC C;  2AGP A;  1EUC B;  3X3N A;  1UE1 A;  1TWH H;  1Q8I A;  4DR6 L;  4ED2 A;  4RNO A;  5F9L A;  1HR0 Q;  4J9M A;  2UUC H;  5KKN B;  1XXG A;  3CCV A;  4RB3 C;  4A3F B;  4KN4 C;  1A2T A;  1DCZ A;  5AJ3 L;  2UXB H;  3BYT B;  1BDO A;  4GLV B;  3HOU G;  3SHL A;  2RDG A;  3Q0A A;  1FKA H;  4PMW A;  4QWA A;  1EUD B;  2ES2 A;  2OXP A;  2MO0 A;  4BXX G;  4A3M H;  1VDZ A;  1D2B A;  2OF1 A;  1EZ6 A;  3M9B A;  2WAQ G;  2MCT A;  3D31 A;  4QGU A;  2PVP A;  1KJQ A;  4TRD A;  2IY5 B;  4OEM B;  1Y1W H;  5I4D A;  1SAP A;  3FMC A;  3AQQ A;  3G71 A;  4IO9 A;  1B33 N;  1H9J A;  1UE5 A;  1EYG A;  2F0P A;  2RDF A;  3EN2 A;  4O4L F;  3CCE A;  4LF9 L;  4YBZ B;  3FKI G;  2R7Z H;  1JB7 A;  3M9M B;  3AEV A;  1VBG A;  1O7Y A;  4JI6 Q;  3F2C A;  1U0L A;  3BVM A;  4UAI A;  2UUA Q;  4ECT A;  2FK2 A;  4DK1 A;  1HR0 H;  3RZD B;  4ABN A;  3CF5 A;  1DOL A;  3EBE A;  1Z7T A;  2WKC A;  4H44 C;  4A3K G;  2OTJ A;  2HDM A;  4FDB A;  4RKL A;  3L3O C;  1PTO F;  1F9R A;  3A54 A;  3MFY A;  5KT5 A;  5KFA A;  3QJY A;  1YJ9 A;  4ECY A;  1JWS D;  1SNO A;  2GVB A;  1II3 A;  2EYL A;  2R8H A;  2VOB A;  2QW7 A;  5CB4 F;  5EQ0 A;  1V1P B;  1UC9 A;  5KT2 A;  5IYD G;  4A3I H;  1TR5 A;  2M9V A;  3ERQ A;  1DIK A;  4JI1 Q;  4MV1 A;  3R5X A;  3KBG A;  4IUV A;  4PV1 C;  3RB3 A;  4R4O A;  3G6V A;  3NK9 A;  4WJW A;  1QIL A;  3S17 H;  2W6N A;  1EIG A;  4OX9 L;  4J0M A;  4YWL A;  4BS9 A;  4LFB L;  3PO2 B;  1IXR A;  2FJZ A;  3DF7 A;  3PR5 B;  1WFQ A;  4JI4 L;  1FNW A;  4JV5 Q;  2QDB A;  5KFB A;  1DON A;  1LT4 D;  3BZC A;  3NP8 A;  4DR1 L;  1B6R A;  3TQT A;  1GHJ A;  2PQA B;  4JI6 H;  4RWS C;  2ATW A;  3VPC A;  2UUA H;  5FLX c;  1S10 A;  2IBK A;  2YYA A;  2R8J A;  4C1N I;  3CRL C;  2XIW A;  4RKB A;  4KY7 A;  4XT1 B;  3RUZ A;  5C0X H;  1VKZ A;  1ROD A;  4TQR A;  1E24 A;  2ZJP A;  2LMC B;  1RK6 A;  4KK7 A;  5D1O A;  3MXU A;  3RZO H;  3IG0 A;  1ET6 A;  3K5M A;  3G6Y A;  2R87 A;  2GLT A;  2QEJ C;  1A3V A;  4F4X A;  4DR5 L;  3T13 A;  1PA6 A;  4A93 G;  1GHK A;  3RGZ A;  1RDP D;  2C2E A;  5C4X G;  3BA8 A;  3RV4 A;  4JI1 H;  2W9C A;  2RA4 A;  4JBJ A;  4C5C A;  4UCR A;  4FS1 A;  1TU2 B;  1EYD A;  2ZJQ A;  2FMM A;  2PPB C;  3A0J A;  3RN5 A;  2W9B A;  4YWK A;  3H3V I;  4RHR A;  3VDY A;  4Y52 H;  3MWE A;  1S5E D;  3T16 A;  5BN3 A;  4JYA Q;  2MP1 A;  3S2H H;  1JX4 A;  3H0G A;  3S1M H;  5EKK A;  1CQJ B;  3RF2 A;  2OEO A;  1NY4 A;  1SR3 A;  1SCU B;  4APV A;  1SNQ A;  2NB0 A;  3Q2O A;  1K28 A;  1XTD A;  4OEL B;  2EY2 A;  2E2H H;  1ENA A;  2EQS A;  1TS5 A;  3UE1 A;  2EYO A;  4LUZ A;  4ME6 A;  2F0G A;  1WYD A;  4V0B A;  5JJL A;  2MFI A;  3H09 A;  2A19 A;  3F8T A;  4TV9 F;  4KKT A;  3ER0 A;  3ETH A;  2FB9 A;  3WNZ A;  5BMV F;  3L0O A;  5GON F;  5JAV A;  1B3A A;  4ZYS A;  5FLX E;  1SYX B;  5HUR A;  3I4N B;  1SMX A;  4DK3 C;  5FOB B;  4QQB X;  4BXX H;  3T5L A;  2V4D A;  1XPO A;  1BCP F;  1ONL A;  1PRT F;  2HHH Q;  3CQZ H;  3PO3 G;  1QZG A;  1D5X C;  4HNT A;  3Q8S B;  4JYA H;  4FXD A;  4ED8 A;  3K0X A;  3GTJ A;  1B53 A;  4LUO A;  4BY7 B;  1BNC A;  1IBM Q;  3KF8 B;  1ML0 D;  3J7Y W;  4IFD J;  1Y1V A;  3NWT A;  1NTG A;  2VUM B;  4A2A A;  3EJI A;  2VQE H;  3FKI H;  1NE3 A;  2AUJ D;  3SI8 A;  2JA5 A;  4LF7 Q;  3RD4 A;  3NBH B;  3LWU A;  2B3G A;  4QWC A;  1NBW A;  3CCS A;  4JG2 A;  3QOJ A;  2CWA A;  3IFT A;  1M90 C;  1I3Q H;  2V4Q A;  5KFT A;  3PUZ A;  2QIL A;  1VQI A;  3T1Y L;  5BR8 L;  4A3K H;  4KJN A;  3ULP A;  4B3T L;  4X65 H;  1M0T A;  4PZ7 A;  1TWF B;  2B2Y A;  2EVB A;  3LWE A;  2OWO A;  3Q1K A;  1VQP A;  1MI2 A;  1EY5 A;  4R4I A;  1MHW C;  5DGA A;  4UDU C;  1VQB A;  2I87 A;  3M4O H;  4DR6 Q;  2QKI C;  5G3L F;  2PN1 A;  4GKJ L;  1WH2 A;  4L1K A;  2UVU A;  1HUM A;  5IYD H;  3GTP A;  3J81 c;  2O5J C;  4DV4 L;  2HHH H;  2UVW A;  4OON A;  1KNA A;  1KLU D;  5AJ3 Q;  3TP6 A;  3KTM A;  3TQ1 A;  1ZHS A;  4Q8F A;  2KCN A;  3PUX A;  1HHV A;  1GUW A;  3KAL A;  1X3F A;  1SNC A;  4EEQ A;  5FLM G;  3MR6 A;  4GS3 A;  5CA1 F;  3HOZ G;  5KYI A;  4LFA H;  1FNU A;  3J80 c;  5M5Y H;  5M5W H;  4DR3 Q;  2FMA A;  3BQ0 A;  3GTM H;  1IBM H;  3J7A V;  1X65 A;  1D5M C;  4FNF A;  3L9A X;  2ZXO A;  2JA7 G;  1HA6 A;  1JJC B;  4MA0 A;  2W8L A;  4LF7 H;  2CZG A;  2VNU D;  4POG A;  1UWV A;  4JVZ A;  4B3M L;  1HNX L;  1PFB A;  1Y8N B;  2R7F A;  1SYD A;  1PH1 A;  1S0M A;  2WB1 A;  3VYS A;  4AYB G;  4Y7N H;  4RNN A;  2N8N A;  3CKI B;  4HSP A;  2F3V A;  2YRX A;  4L8J A;  4PWQ A;  3ERS X;  1HCZ A;  1R9T H;  2ENB A;  3K5O A;  2RBM A;  1SEI A;  4DV5 L;  1TVX A;  5L1I A;  4FVM A;  2B2W A;  1VQC A;  4DR6 H;  5C3E G;  4LF6 H;  4DL7 A;  1N56 A;  4KLK A;  2FE3 A;  3M4I A;  3M9N B;  3C46 A;  5IWA H;  4A93 H;  5IYC G;  3EIV A;  5C4X H;  2Y0S A;  1N9W A;  1I4Q A;  5C4J B;  2JA8 H;  1XNQ H;  1SFO B;  1B7Y B;  4KY6 A;  4HJ8 A;  4MV7 A;  3OUZ A;  3HKZ G;  1LTG D;  2R7K A;  3S1M B;  4IPD A;  1RK5 A;  3H6M A;  4BBR B;  2R7L A;  2I07 B;  3GTK H;  2XWB B;  4LF5 L;  4DAP A;  5KGU A;  2C9O A;  2B29 A;  1N34 H;  4EGV A;  2PI2 E;  1WTV A;  5KFZ A;  5JH7 F;  1QOH A;  1V8Q A;  4IZO A;  3K5L A;  1EYA A;  1CZW A;  2IHF A;  3Q23 A;  1X6O A;  4OX9 Q;  4LFB Q;  3S16 H;  3OPO A;  1YIJ A;  1RKN A;  4C2M B;  2K28 A;  2M2L A;  2L4N A;  1MIU A;  1JC7 A;  4JI4 Q;  4LF9 H;  1CM9 A;  3OYY A;  4DR1 Q;  1TY0 A;  4HCE A;  3J81 j;  5GAE C;  5D1P A;  1A8V A;  3S15 H;  2A6H C;  5EKL A;  3BJY A;  1C7Y A;  1GUO A;  1TWH A;  4WFN 3;  2ASD A;  3ETJ A;  1RJQ A;  4IR1 A;  3TP8 A;  5A2Q L;  3VR2 A;  3VYU A;  4LNQ A;  2JN4 A;  1B50 A;  4JBW A;  3QB3 A;  4L5Q A;  3FP9 A;  4F4Y A;  1U4R A;  4DV0 L;  1JCK B;  3WWV A;  1O7I A;  3OW2 A;  3N6X A;  2PNH A;  3D6W A;  3RR5 A;  4IPH A;  1P8L A;  4DR5 Q;  4IUU A;  2FPP B;  3VPD A;  2C22 A;  1TS4 A;  4ILW A;  2UXD L;  1ASY A;  1UAP A;  3I4L A;  2HT1 A;  1I3Q B;  3EPI A;  2XVS A;  1UEB A;  2WB1 E;  1QVF A;  4QIW A;  2BQ3 A;  3VMM A;  4LW1 A;  3NE5 B;  1BKB A;  4J15 A;  1I6H H;  1V4Y A;  4A3B G;  5A2Q W;  4L5T A;  2LY7 A;  1Y1W A;  4RZR A;  4JI4 H;  4Y8V B;  2J6U A;  2DY8 A;  1KDB A;  3T1H L;  4DR4 L;  4DR1 H;  4DA2 A;  2KA7 A;  4DL2 A;  4CDF C;  1Y14 B;  2Z6K A;  4F7X A;  2G9H D;  2YS6 A;  2R7Z A;  2D0P A;  2ZTE A;  2J9G A;  2Y0S E;  4RB2 C;  3C1E A;  5A2Q E;  2BDO A;  1K1S A;  2UUC L;  4A3F G;  1RTN A;  3A8K E;  2UXB L;  5KX5 F;  3JAM i;  4O1N A;  4HJ9 A;  5KFO A;  1SYC A;  3H15 A;  5BPF A;  3GTM B;  3K7U C;  1KTK A;  1M6V A;  4LH7 A;  3CAM A;  5DG9 A;  2NZH A;  1K8O A;  4XDX A;  5FLM H;  3K8A A;  4LF8 L;  3HOZ H;  1C4Q A;  1CT1 D;  1PMR A;  4C1N K;  3DMU A;  4DNR B;  1GSA A;  4IAJ A;  2Z6K C;  1KRT A;  4X3S A;  3I56 A;  4TVA B;  1AFP A;  3ULL A;  2JA7 H;  1SE8 A;  4I4T F;  4MTK A;  5E4X A;  2RHS B;  4DK0 A;  2XSC A;  2EIF A;  3JAM L;  3S14 H;  1K83 H;  2JE6 I;  1BXT A;  3TDQ A;  3CC7 A;  4HR7 A;  1CHQ D;  3S1Q H;  1J6Q A;  4HJ7 A;  1UE6 A;  2P5Z X;  4YCU A;  1GM5 A;  5BN4 A;  4KHV A;  1Q82 C;  3H3V H;  3H40 A;  1XPR A;  1KL9 A;  1HNW L;  3CRK C;  4DAY A;  1LTR D;  1PYW D;  2EYM A;  3TSS A;  3M3Y B;  4GLA C;  3KOJ A;  5C3E H;  2VZA A;  3RB6 A;  2F4V H;  4PG3 A;  4YHH H;  2B2U A;  5JPN C;  5IYC H;  3T1Y Q;  5BR8 Q;  4P71 A;  4B3T Q;  3JAM W;  4ECV A;  3FEW X;  4PDB A;  1JIH A;  3DEP A;  3WO0 A;  2AGO A;  4QIW E;  3VYR A;  3B6Y A;  1PH9 A;  4O3N A;  1LTB D;  3W3A A;  1OTC A;  4QWD A;  4EBD A;  2MNA A;  3UQ8 A;  1F2Y A;  3UFX B;  2XRQ D;  4GKJ Q;  1S03 G;  3J7A K;  1WOC A;  3JAM E;  4FM9 A;  1E2W A;  4DV4 Q;  3MA2 B;  3DUZ A;  3O13 A;  1E4G T;  2YZM A;  3S15 B;  4DL4 A;  2E2I H;  5DQI A;  5KFF A;  1E1O A;  2FFK B;  4BY1 G;  2I46 A;  4DV2 L;  5C1O A;  5DQG A;  5C1P A;  3GTQ H;  1D1I A;  2ALZ A;  4MV6 A;  4R9W A;  4K5W A;  4MZ9 A;  3MZ5 A;  3Q6S A;  2KCT A;  3HOY G;  2E2H A;  2CQA A;  3HOV G;  3STB C;  5I2X A;  1HNX Q;  3MXP A;  2BH2 A;  2A69 D;  2ZTD A;  3MFG A;  1EL0 A;  3K3V A;  3T1Y H;  4CDE C;  5BR8 H;  4APM A;  2A6H D;  1MKH A;  1EZ8 A;  3D0F A;  4YB8 B;  1GSH A;  3NXW A;  4JV1 A;  4YP3 A;  5EZY F;  2DWC A;  1OXS C;  1YHB A;  5CMD A;  5KNB A;  2E5L H;  5DG7 A;  1S5D D;  2PCF B;  3BDL A;  4DV5 Q;  4LF4 L;  1CSQ A;  2F3W A;  4R4T A;  1I6H B;  1BXR A;  3WOF A;  1DV2 A;  2LXK A;  2V9W A;  4DV4 H;  1LUZ A;  3G6X A;  5M5X B;  3BYY B;  2PMZ A;  2BOS A;  2VPS A;  3CD6 A;  1WCM G;  3CQZ A;  2WAQ A;  1IW7 D;  4A3B H;  3K5I A;  1A62 A;  1PFN A;  1EFI D;  1YEZ A;  5KG3 A;  1E0B A;  4WD3 A;  3R5F A;  5KFN A;  2MJ8 A;  5FO8 B;  3D4W A;  1IBK L;  4FO2 A;  3FKI A;  4EYI B;  2NN6 I;  3P1H A;  4B3M H;  5LL6 b;  1HNX H;  1E2Z A;  1QB5 D;  3SVM A;  4TSS A;  4CDD C;  1T5X D;  2SEB D;  3P20 A;  2D62 A;  4G7Z C;  1S5C D;  4HAE A;  1C0A A;  4X64 L;  3I90 A;  1RD9 D;  2A73 B;  2F0E A;  4DV5 H;  3M7G A;  3Q24 A;  1STH A;  1S3O A;  1U9R A;  2ZM6 L;  1CKN A;  1G91 A;  1OXX K;  1ESF A;  2V59 A;  2B2T C;  1Q46 A;  2MGS A;  3BVG A;  3MVV A;  4QUF A;  2NVT H;  2FLL A;  1OO9 B;  1EIH A;  4F87 A;  4KKU A;  3C2P A;  1VQE A;  3FVQ A;  4M7E A;  2F0F A;  3RBD A;  1PZK D;  3HOW H;  3OWF A;  1CE8 A;  2CVR A;  2SOB A;  5LHY 1;  3K80 C;  5C5L A;  1T3N A;  4DUZ L;  3K6O A;  4RFB A;  3S1N B;  2K5Q A;  2R84 A;  4DV0 Q;  4LF5 H;  5J2U F;  4EQN A;  4ECW A;  2F52 A;  1LTS D;  3FDS A;  5L9X A;  2UXD Q;  2PZT A;  2VQE L;  3H4B A;  3WOE A;  2OQK A;  4O3R A;  2F0D A;  2PO4 A;  3PSI A;  5K2M A;  1RJT A;  5D1O B;  3PQI A;  4ID6 A;  1STA A;  1STB A;  2DJG C;  1KQS A;  3ORQ A;  2NWG A;  5L1K A;  4MIU A;  3PVX A;  3EVQ A;  5EWF A;  5C44 G;  2F4I A;  3T4A C;  4X65 L;  5C4Z A;  3D4R A;  2YU9 H;  2DPI A;  4J9R A;  5M3F B;  2IHE A;  4LUV A;  2W9C B;  2MQH A;  2B63 G;  3OHX C;  1R9T A;  3AFP A;  3MAQ A;  4BWS C;  1CHP D;  4OIK A;  4QY7 A;  4RUC A;  4YR2 A;  5KFX A;  4RU9 A;  3EYY A;  2R86 A;  2K50 A;  2W9B B;  2CFM A;  2PMZ E;  4C3H H;  2QF7 A;  3MEH A;  2UUC Q;  4R8N A;  4IFD H;  2CQY A;  1TQO A;  1LT3 D;  3GTO H;  3H0G B;  1PH5 A;  2UXB Q;  2R7N A;  4M9U A;  1TY2 A;  4RMF A;  3R2T A;  3S9W A;  1PTO H;  5KFH A;  2VS1 A;  1B44 D;  4DV0 H;  2RSN A;  2Q2T A;  3QIA A;  2IA6 A;  1AW7 A;  4IHJ F;  3RAQ A;  3GTK A;  4LFC L;  1YI2 A;  2W6P A;  4MV4 A;  4A3E G;  3ICE A;  4YJ3 F;  4LF8 Q;  2UXD H;  4BY1 H;  3CC2 A;  1TS3 A;  1X3Q A;  4HIK A;  2HCI A;  3PGZ A;  4DV3 L;  4C3J B;  5ELD A;  1LO5 D;  4G3I A;  1IOW A;  4N8X 1;  2JA6 G;  1X3G A;  3A5U A;  3IKJ A;  4LK1 C;  3HOY H;  4ZQI A;  1N36 L;  1VQL A;  2ZT9 C;  1KLG D;  1HZA A;  5F2D A;  2B39 A;  4NXM L;  3RJ0 A;  3T1H H;  4DR4 H;  3E6Z X;  1G2T A;  3U50 C;  2K6A A;  3BQ2 A;  2DNC A;  3PIP A;  3RNU A;  3A74 A;  5CYU A;  3STB D;  4TV8 F;  1A63 A;  1U5K A;  1HNW Q;  2NVY H;  4LF6 L;  1WD1 A;  5IWA L;  2X0S A;  2AQ3 B;  5KG1 A;  1KRS A;  1PXU A;  5C3X A;  4WJ3 M;  5I47 A;  3BAA A;  3MFI A;  3CCL A;  3Q22 A;  2GPW A;  4J9K A;  2PYK A;  1X32 A;  3GTJ B;  1XNQ L;  4KHP H;  2RGV A;  1ENF A;  4IJL A;  1Y1V B;  2JA5 B;  5KFV A;  3MC0 B;  2E76 C;  1WCM H;  1YBY A;  1P16 A;  3MWY W;  4LF8 H;  1E4E A;  4QCL A;  1N34 L;  1K9M C;  2YTV A;  4LWC A;  3GTG H;  1I4X A;  2QYZ A;  3N52 A;  4A3D G;  2ICE C;  2JA8 G;  4ALP A;  5AFW A;  1QWY A;  4MA5 A;  2BA1 A;  5FPO A;  4GC7 A;  3K81 C;  4CJ0 B;  4JV0 A;  1FL0 A;  2RF4 A;  4GLX A;  2IJ0 A;  3T5H A;  3E0J A;  3GTP B;  3M85 A;  4DV2 Q;  1HNW H;  3K7A B;  1K1Q A;  3LGJ A;  4DAV A;  3TEH B;  3G4S A;  2AGQ A;  2FP4 B;  4JW0 A;  2A6E D;  3HOW B;  4U68 A;  4RA8 A;  4GOP A;  3T51 B;  3GP7 A;  1F2M A;  1SLJ A;  4PZ8 A;  4RHS A;  4F50 A;  3NTK A;  5HGQ A;  3MXN A;  1VQH A;  1H9K A;  3U4V A;  5IT9 L;  1PV4 A;  2JEJ A;  4DAM A;  1MJE A;  3K5N A;  2XCA A;  2R82 A;  3BDO A;  1BQQ T;  2HIX A;  2QDL A;  3QR8 A;  4U6P A;  4QB4 A;  1D7Q A;  3JRW A;  3D6C A;  3A55 A;  2I8C A;  1LAB A;  2WB1 B;  3DM3 A;  4JBM A;  3HFZ B;  3V96 A;  4RGO S;  1EYC A;  3FDT A;  4DGZ A;  4F4Z A;  1C30 A;  4O3S A;  5M9O A;  2JA7 A;  5LMN L;  5HBR B;  3UDF A;  5FO7 B;  3G48 A;  1HZ9 A;  3RUP A;  3TIN A;  2YZN A;  4GOP C;  2M05 A;  1K83 A;  1PX2 A;  3F2U A;  3NSW A;  2D0O A;  4BWG B;  4BBS G;  5IT9 W;  4A3G G;  4DV2 H;  4AYB A;  3KDF A;  4DU9 A;  5CV6 A;  2Y0S B;  2L11 A;  2WE6 A;  3V6K A;  2E2J B;  3TZD A;  4BA1 I;  3BG3 A;  2WAC A;  5IT9 E;  2FK1 A;  4YR0 A;  4ZUJ A;  2OCE A;  1YZ6 A;  3KBX A;  1KXL A;  1W96 A;  3R3O A;  1SYE A;  5LMN W;  4L5S A;  2VW9 A;  3W1G A;  5I6Y A;  1MD2 D;  4X64 Q;  1X9N A;  1CQV A;  3JRX A;  3GQC A;  4C3I G;  3HKZ A;  4LF4 H;  4QWE A;  2ZM6 Q;  4A3J G;  3L4K A;  4A3E H;  1I94 H;  4HIM A;  1SE2 A;  1VQ9 A;  1K0R A;  2F0T A;  2D5D A;  3DM1 A;  3GTL H;  1VQ8 A;  1D5Z C;  2I5L X;  2UXC H;  2NU6 B;  3CCJ A;  5IYB G;  4DUZ Q;  2JA6 H;  1TWH B;  2H1E A;  2E2I A;  5JQW A;  2BCO A;  4DV7 L;  2D2C C;  1LYL A;  4DNI A;  5CA0 F;  4HQ6 A;  4K8J A;  4B9W A;  3I8Z A;  3KXY T;  3Q8R B;  1F2Z A;  1V1Q A;  3S24 A;  3MR5 A;  1IBK H;  2A68 D;  2VQE Q;  1V43 A;  3CHB D;  3GTQ A;  3N8D A;  1DGS A;  4J8Q A;  1RHP A;  5FO9 B;  5KFI A;  1S68 A;  1STY A;  2KCC A;  4ED3 A;  4P74 A;  2F4V L;  4YHH L;  2MPM A;  3URY A;  1I4R A;  1JT8 A;  4YQW A;  5BPH A;  4X65 Q;  3CU7 A;  4XYM B;  4X64 H;  4KHZ A;  1R4Q B;  3MXG A;  2Z6B A;  3TP5 A;  4A3M B;  4M1U B;  4QIW B;  1CA6 A;  2EJG C;  3HOU H;  4IN3 A;  4FU0 A;  4YIJ A;  3OSO A;  3PW2 A;  1WJJ A;  2ZM6 H;  1YJW A;  1FJG L;  1NMF A;  1GVP A;  1Y1W B;  3GID A;  3ONA B;  3A8I E;  2WYO A;  4YCW A;  1G29 1;  2EXD A;  5ELC A;  4XYO A;  5HGT A;  1FD7 D;  3DHQ A;  2QK4 A;  1HJP A;  1XNR H;  1EY7 A;  4I7A A;  2R7Z B;  4AYB E;  4A3D H;  4DUZ H;  1D8L A;  1TII D;  4F8M A;  5KFW A;  1KAB A;  1B9M A;  5EPK A; 
#chains in the Genus database with same CATH homology
 2UXD L;  1ASY A;  2HT1 A;  4LFA Q;  4LFC Q;  1UEB A;  2WB1 E;  2DGY A;  1QVF A;  4LW1 A;  5JJK A;  4DR3 L;  1BKB A;  4J15 A;  4JI0 L;  4JV5 L;  1I6H H;  3U58 A;  4A3B G;  4L5T A;  3GTJ H;  3DLL A;  4O2D A;  3TRE A;  4A3M G;  1JJG A;  1UE7 A;  5LMU Q;  3RLN A;  2GVA A;  1Y1V H;  2OQ0 A;  3PUV A;  3CMA A;  2PI2 A;  5FJ8 H;  3T1H L;  2JA5 H;  2KEN A;  4DR4 L;  4K0K L;  4UPA A;  2YV5 A;  4JI3 L;  2JQO A;  3HKZ E;  1Y14 B;  2Z6K A;  3CCR A;  1N36 Q;  1Y1W G;  1J5E Q;  1VQ5 A;  2D0P A;  2ZTE A;  1XJV A;  4NXM Q;  3I4N H;  2Y0S E;  1N33 L;  2E5L L;  1A0I A;  3BU2 A;  1YJN A;  2N49 A;  1OXV A;  3GTP H;  2AKW B;  3S1R H;  1PH4 A;  2UUC L;  2RHQ B;  2R7Z G;  3RN2 A;  4A3F G;  4LF6 Q;  5IWA Q;  2UXB L;  3JAM i;  4HJ9 A;  3H15 A;  2WP8 J;  1ASZ A;  4LF4 Q;  3NEL A;  4B3S L;  3BZK A;  4BY7 H;  1XMQ Q;  1VQ6 A;  3K7U C;  1XNQ Q;  3CAM A;  1S72 A;  1I94 Q;  2VUM H;  2NZH A;  1CUK A;  3I2Z A;  4JI5 L;  1VQF A;  2A1A A;  5FLM H;  1JE5 A;  3K8A A;  4IJH A;  4LF8 L;  4DAY B;  4PZ6 A;  3CW2 C;  3K7A H;  4X62 L;  1EQQ A;  3HOZ H;  2CQO A;  2YTY A;  3NEN A;  3PCO B;  2Z6K C;  1KRT A;  4P73 A;  1NJI C;  4HIO A;  4YCV A;  3I56 A;  2IX1 A;  2UXC Q;  3GO5 A;  4TVA B;  5C44 H;  4BBS H;  1KHI A;  3I7F A;  3KYH C;  3ULL A;  1N34 Q;  1SE8 A;  1QUQ B;  1TWF H;  2UU9 L;  2JA7 H;  4A3G H;  4JYA L;  1IZ6 A;  4HJA A;  4A3I G;  2RHS B;  2L15 A;  4UP9 A;  1XPU A;  3S14 H;  2EIF A;  4AQY Q;  3UDG A;  4DV6 Q;  1BBU A;  1EUJ A;  1K83 H;  2JE6 I;  3I4O A;  3CC7 A;  1IBK Q;  2OTL A;  3S1Q H;  1TWC H;  2ZTC A;  3I55 A;  1J6Q A;  4HJ7 A;  3KFU A;  4GKK L;  1UE6 A;  1GM5 A;  4YCU A;  3H3V H;  1Q82 C;  1XPR A;  1KL9 A;  4GN4 B;  1HNW L;  5JJI A;  4LF9 Q;  4DPG A;  1L1O B;  3CC4 A;  4NB3 A;  1Q1E A;  3CP0 A;  4GLA C;  1G51 A;  1VQ4 A;  1VQO A;  3KOJ A;  5C3E H;  1XMO Q;  2VZA A;  1PH6 A;  4IOA A;  4UY8 C;  2AMC B;  4PG3 A;  4C3I H;  4R4C A;  1QUQ A;  1WI5 A;  5IYC H;  4JCV E;  5BR8 Q;  2YTX A;  3T1Y Q;  4P71 A;  4IOC A;  4B3T Q;  4A3J H;  5DLQ E;  1QVC A;  2AHO B;  5C0X G;  3OTO Q;  2B63 H;  3L7Z C;  1PYB A;  4QIW E;  4X66 L;  1XMO L;  1K73 C;  4KI0 A;  4A3C H;  3B6Y A;  1PH9 A;  1PYS B;  2BH8 A;  2WAQ E;  1OTC A;  1XNR Q;  1VQN A;  3ZJY C;  2MNA A;  1E1T A;  1HZC A;  2KBN A;  3TRZ A;  2E2J H;  1L1O A;  2HHH L;  1Z47 A;  5IYB H;  1Z9F A;  4GKJ Q;  2R7D A;  3HOX G;  1WOC A;  4NXN L;  4OXP A;  2WFW A;  1K3R A;  4DV4 Q;  4YY3 L;  4LFA L;  5GAH C;  4JI7 Q;  1IBM L;  2E2I H;  2R93 G;  3GDE A;  1E1O A;  5LMN Q;  4BY1 G;  3W1B A;  3A5Z B;  1TWA H;  2DUD A;  4LF7 L;  2CWP A;  4DV2 L;  4DR7 L;  2Q2U A;  5M3M G;  4JI2 Q;  1PH7 A;  2I0Q A;  1GD7 A;  3GTQ H;  3UE0 A;  1EQR A;  5C4J H;  4MZ9 A;  4GNX C;  1SFO H;  1Q86 C;  2KCT A;  1JJ2 A;  3HOY G;  3HOV G;  4DR2 L;  3S2D H;  1CKO A;  3STB C;  1HNX Q;  2BH2 A;  2ZTD A;  4BBR H;  3GD7 A;  1L1O C;  2V1C C;  4JOI A;  4DUY L;  1MKH A;  3D0F A;  3IRB A;  2F3I A;  1UE1 A;  1TWH H;  5J3B A;  1OXS C;  1YHB A;  2R92 G;  4DR6 L;  1HR0 Q;  4DV5 Q;  4LF4 L;  1CSQ A;  3I4M G;  3CCV A;  4R4T A;  2VQF Q;  3PO3 H;  5AJ3 L;  1I5F A;  1RL2 A;  3PF5 A;  4GLV B;  2LXK A;  1YVC A;  3HOU G;  1TXY A;  4B3R L;  4C2M H;  1HH2 P;  4PMW A;  1LUZ A;  1N32 L;  5HY6 A;  2K4K A;  2QGQ A;  3CD6 A;  1WCM G;  2ES2 A;  1HNZ L;  2C35 B;  2MO0 A;  1QVG A;  4POF A;  1Q81 C;  4DV3 Q;  4A3B H;  1A62 A;  1E7Z A;  4BXX G;  4A3M H;  1YEZ A;  2JJQ A;  3SGI A;  1CKN B;  1Q8K A;  3M9B A;  2WAQ G;  3D31 A;  4QGU A;  4R4Q A;  4OO1 G;  4DV7 Q;  1IBK L;  2IY5 B;  4ME3 A;  1VQ7 A;  4UP7 A;  1Y1W H;  2NN6 I;  3AQQ A;  3CPF A;  3G71 A;  4IO9 A;  4QL5 A;  1UE5 A;  1EYG A;  5K36 G;  3JAM c;  3EN2 A;  1JMC A;  2D62 A;  3CCE A;  4LF9 L;  3M4Q A;  2MO1 A;  3FKI G;  3NEM A;  1JB7 A;  2R7Z H;  3AEV A;  2ZJR A;  3F2C A;  4JI6 Q;  1U0L A;  2F4V Q;  4X64 L;  4KHP L;  4YHH Q;  1C0A A;  4NPS A;  1CKM A;  2UUA Q;  4HID A;  1V9P A;  1E3P A;  2HIV A;  3CF5 A;  3EBE A;  5JEA J;  2K52 A;  4A3K G;  2UUB L;  1S3O A;  2ZM6 L;  2OTJ A;  1CKN A;  4FDB A;  1OXX K;  4H02 A;  1IBL Q;  1Q46 A;  2NVT H;  3PUW A;  1VQE A;  1PH2 A;  2K5H A;  4JC0 A;  2R6G A;  1YJ9 A;  2BA0 A;  2K5V A;  2NVX H;  1FJG Q;  3HOW H;  3KF6 B;  4X6A H;  2GVB A;  1Q12 A;  3CCU A;  1GKH A;  3K80 C;  4JI8 L;  4MNO A;  1K8G A;  5GRO A;  4DUZ L;  1KIX A;  5IYD G;  4DV0 Q;  4A3I H;  2F52 A;  2ASB A;  1BBW A;  4JI1 Q;  2H5X A;  5EAY A;  4X62 Q;  4R4O A;  2KHI A;  2UXD Q;  4RG1 A;  2VQE L;  3S17 H;  3J81 i;  2OQK A;  1AH9 A;  4OX9 L;  3PSI A;  4YWL A;  1L0W A;  4LFB L;  1VQK A;  1LM0 A;  1IXR A;  1OXU A;  4R1J A;  2GN5 A;  1WFQ A;  4JI4 L;  5IP9 G;  3BJU A;  4JI0 Q;  4JV5 Q;  1KQS A;  2KCM A;  3BZC A;  4DR1 L;  1EFW A;  3Q8D A;  5C44 G;  3KF6 A;  4X65 L;  2YU9 H;  2PQA B;  3J80 i;  2ATW A;  2IHE A;  5FLX c;  4LUV A;  2K75 A;  2MQH A;  4K0K Q;  2B63 G;  4AIM A;  3AFP A;  2K5N A;  4OWX B;  2N78 A;  4QY7 A;  1X54 A;  1X55 A;  1N33 Q;  2K50 A;  1EWI A;  4A3L G;  2CFM A;  2PMZ E;  5H1S E;  2E5L Q;  4C3H H;  1E24 A;  4O0A A;  2ZJP A;  4TQU S;  3AFQ A;  2UUC Q;  4P72 A;  1TWG H;  3PUY A;  3PF4 A;  3RZO H;  2CKZ B;  4DV1 L;  3GTO H;  1PH5 A;  2UXB Q;  4IPG A;  2IT1 A;  4RMF A;  3HOX H;  2JEB I;  3TS2 A;  2VS1 A;  4DR5 L;  4B3S Q;  1PA6 A;  2Q2T A;  2FXQ A;  4A93 G;  1NMG A;  2PQA A;  4OWT B;  3PO2 G;  3KJO A;  5C4X G;  2YYZ A;  2JEA I;  4LFC L;  1K8A C;  1YI2 A;  1X3E A;  4JBJ A;  4A3E G;  3KLW A;  3E9H A;  4JI5 Q;  2R93 H;  1YHQ A;  3ICE A;  4LF8 Q;  3M3Y H;  2ZJQ A;  3JC6 6;  4BY1 H;  3CC2 A;  4HIK A;  3PGZ A;  5M3F G;  3A0J A;  4P75 A;  1YHA A;  4DV3 L;  4YWK A;  4IPC A;  3RN5 A;  3H3V I;  3VDY A;  5LMU L;  4Y52 H;  5M3M H;  2Q2H A;  2JA6 G;  1X3G A;  3A5U A;  2UU9 Q;  4JYA Q;  2IX0 A;  4B3M Q;  3HOY H;  3TQY A;  1N36 L;  1VQL A;  1J5E L;  3S2H H;  3S1M H;  4WJ4 A;  1HZA A;  4NXM L;  1NY4 A;  1SR3 A;  1I50 H;  4APV A;  3U4Z A;  2I5M X;  5JEA G;  2KHJ A;  4EQ5 A;  3M7N A;  1XTD A;  3U50 C;  1VQA A;  1B8A A;  3PIP A;  3RNU A;  2E2H H;  2EQS A;  2I5H A;  3A74 A;  3H0G G;  4LUZ A;  3STB D;  3UE1 A;  1A63 A;  1U5K A;  1HNW Q;  2NVY H;  4LF6 L;  2R92 H;  5C0X I;  3CPW A;  5IWA L;  1KRS A;  1WYD A;  4WJ3 M;  2MFI A;  5JJL A;  5IE8 A;  5IP7 G;  3CCL A;  2A19 A;  3F8T A;  2NVQ H;  3ER0 A;  3I4M H;  1XMQ L;  4IFD I;  1XNQ L;  1AE2 A;  1G6P A;  2QA4 A;  4YWM A;  1I94 L;  4IJL A;  3PV0 A;  3L0O A;  2QEX A;  2CCZ A;  3HKS A;  1WCM H;  1YBY A;  3F2D A;  4X66 Q;  2UXC L;  1P16 A;  2XTI A;  1SMX A;  2AWN A;  4DK3 C;  4QQB X;  4BXX H;  1S40 A;  1N34 L;  4LF5 Q;  1XPO A;  1L2F A;  4JOI C;  4GOP B;  3CME A;  2YTV A;  4LWC A;  1K9M C;  3CQZ H;  2HHH Q;  3GTG H;  4A3D G;  4AQY L;  4DV6 L;  1QZG A;  4NXN Q;  3PO3 G;  5C0X J;  2JA8 G;  2Q2I A;  3CXC A;  4ALP A;  3MXN B;  3K0X A;  4YY3 Q;  2BA1 A;  3RLO A;  1CSP A;  1PH3 A;  4LUO A;  3K81 C;  1IBM Q;  3KF8 B;  1SN8 A;  4IFD J;  1FL0 A;  1NTG A;  2RF4 A;  4GLX A;  2NZO A;  3FKI H;  1NE3 A;  4A3F H;  4LF7 Q;  3NBH B;  3M85 A;  4DV2 Q;  2B3G A;  2N3S A;  1NBW A;  3CCS A;  3F1Z A;  3LGJ A;  4JG2 A;  5GQO A;  3E9I A;  3TEH B;  2CWA A;  1Y1V G;  3G4S A;  1I3Q H;  1M90 C;  5FJ8 G;  2JA5 G;  1KD1 C;  2VY3 A;  3PUZ A;  5M5X H;  1VQI A;  1VQG A;  5BR8 L;  3T1Y L;  4A3K H;  2RCN A;  4GOP A;  1MJC A;  4HJ5 A;  3ULP A;  4PZ7 A;  4DR2 Q;  4B3T L;  2OWO A;  1SLJ A;  4PZ8 A;  4L5R C;  3OTO L;  3I4N G;  3J7A 5;  1VQP A;  5HGQ A;  4DUY Q;  1VQH A;  4R4I A;  2K14 A;  3U4V A;  1PV4 A;  4DAM A;  1MJE A;  1IYJ B;  2LXJ A;  1VQB A;  1XNR L;  3KDF B;  3M4O H;  4DR6 Q;  2HIX A;  4GKJ L;  3W5O A;  1D7Q A;  5IYD H;  3UDX A;  3AYH B;  3J81 c;  4BY7 G;  2LSS A;  1LTL A;  2JK8 A;  4DV4 L;  3DM3 A;  4JBM A;  3HFZ B;  1EOV A;  4OON A;  5AJ3 Q;  3KJP A;  2VUM G;  3TS0 A;  4JI7 L;  4B3R Q;  3PUX A;  4OO1 I;  1X3F A;  5FLM G;  1N32 Q;  4GS3 A;  1FVI A;  5LMN L;  3HOZ G;  3UDF A;  1BVS A;  3G48 A;  1HZ9 A;  4QJF A;  1IL2 A;  4DR3 Q;  3J80 c;  5M5Y H;  5M5W H;  4GOP C;  1PH8 A;  5IP9 H;  3GTM H;  3HOW G;  3RZD H;  1HNZ Q;  1X65 A;  4JI2 L;  4BBS G;  2D0O A;  3CCQ A;  4EX5 A;  2JA7 G;  4A3G G;  1JJC B;  1PVO A;  3KDF A;  2VNU D;  3T1H Q;  4POG A;  4DR4 Q;  1UWV A;  4B3M L;  1HNX L;  4JI3 Q;  4A76 A;  1H95 A;  1W3S A;  2R7F A;  1GO3 E;  4BA1 I;  1PH1 A;  1X56 A;  1W2B A;  1Q7Y C;  5ELO A;  4GNX B;  4AYB G;  1VS0 A;  4Y7N H;  4A75 A;  2N8N A;  4A3L H;  3S1N H;  2OCE A;  1YZ6 A;  3ERS X;  1R9T H;  1KXL A;  1SRU A;  3ULJ A;  5LMN W;  3L2P A;  4GN5 A;  4L5S A;  2WB1 G;  2VW9 A;  1VQD A;  4DV5 L;  1HR0 L;  3W1G A;  5E7N A;  5IY0 A;  1VQC A;  4X64 Q;  3MEF A;  3M4P A;  5GAD C;  5C3E G;  2VQF L;  1X9N A;  4KHP Q;  2ALY B;  4KLK A;  1VQM A;  4A93 H;  5IYC G;  2UUB Q;  1E22 A;  5ELN A;  3PO2 H;  3EIV A;  5C4X H;  2ZM6 Q;  4A3J G;  1N9W A;  1KAW A;  1B7Y B;  1FGU A;  1SRO A;  4DK6 C;  3F2B A;  4A3E H;  4HJ8 A;  1B70 B;  4HIM A;  1VQ9 A;  3HKZ G;  4IPD A;  1K0R A;  4GNX A;  4A3C G;  3GTK H;  2Y0S G;  1OXT A;  5M3F H;  3GTL H;  4OWW B;  1VQ8 A;  4IFD G;  4LF5 L;  4JI8 Q;  3PIO A;  2I5L X;  3CCJ A;  5IYB G;  4DUZ Q;  2JA6 H;  2B29 A;  1HR0 W;  1N8R C;  2XGT A;  2JA9 A;  4DV7 L;  3HOV H;  1LYL A;  4GN3 B;  1HZB A;  4DNI A;  2PI2 E;  1VQJ A;  1Q1B A;  1V1Q A;  3S24 A;  1YIT A;  3UDI A;  2VQE Q;  1V43 A;  2IHF A;  3G6E A;  4GKK Q;  1X6O A;  1DGS A;  1PFS A;  4MTN A;  3RLF A;  1KC8 C;  4OX9 Q;  3H0G H;  4DKA C;  3S16 H;  1YIJ A;  4LFB Q;  4JBK A;  4BA2 I;  5GAG C;  1EIY B;  2HQL A;  4JI4 Q;  1MIU A;  4JI6 L;  4P74 A;  2F4V L;  4YHH L;  2UUA L;  2E8G A;  3OYY A;  1EIF A;  4DR1 Q;  2Z0S A;  5IP7 H;  3J81 j;  2NN6 G;  5GAE C;  1JT8 A;  1A8V A;  4X65 Q;  4DR7 Q;  1VCI A;  3S15 H;  4KHZ A;  1AE3 A;  4XIG S;  3J7Z C;  4XTC S;  1C7Y A;  1C9O A;  1IBL L;  3HOU H;  1M1K C;  4BBR G;  1T9H A;  4UP8 A;  1QZH A;  1WJJ A;  4C3J H;  2A8V A;  1YJW A;  2AWO A;  3CCM A;  1FJG L;  1NMF A;  1GVP A;  2ID0 A;  4LNQ A;  2VL6 A;  1RIP A;  1YNX A;  3E0E A;  4JBW A;  4L5Q A;  3FP9 A;  4YCW A;  4A4I A;  1G29 1;  2EXD A;  3FHW A;  4AH6 A;  4DV0 L;  1PHJ A;  1HJP A;  4DV1 Q;  5IT9 c;  3WWV A;  1O7I A;  3OW2 A;  4AYB E;  4A3D H;  4JI1 L;  1D8L A;  2PNH A;  3RR5 A;  4IPH A;  1P8L A;  4DR5 Q;  2JA8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...