3FKIG

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
total genus 20
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fkiG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3fkiG01
1VQ8A 4B3TQ 2IT1A 3J80c 1Y1WH 1HJPA 4APVA 2HIXA 1G291 4IO9A 1TWHH 3H15A 2R92H 1K0RA 3KF6B 4C3HH 3I4OA 4HJ9A 1GM5A 4DV3L 1UE6A 4DR5Q 2B63G 1YJWA 4DK3C 1IYJB 1YBYA 3PUWA 3KFUA 2Q2IA 3S2DH 4LNQA 4NXNQ 3CF5A 1TWFH 4PMWA 1PA6A 2UU9Q 1L2FA 4LF5L 1FVIA 1MJCA 4MTNA 5IY0A 4QQBX 2ZJRA 2Q2TA 4KHPQ 4A3KH 3HOUH 1RIPA 4WJ4A 1KHIA 1Y14B 5HGQA 4P73A 1X54A 2OWOA 1VQMA 2C35B 1BVSA 3RR5A 4X6AH 2JEAI 1YHAA 4POGA 2K4KA 3CXCA 1EFWA 4LF4Q 4YCWA 4DV0Q 1I6HH 3RLNA 1PHJA 4KLKA 2K5VA 1X3FA 1E22A 1VQNA 3A0JA 4DV6L 1E7ZA 3J81i 4B3TL 1SR3A 3CP0A 1K83H 2UUBL 2OTJA 1QUQA 2NN6I 3GTQH 3H3VI 2AWNA 2HIVA 1YEZA 4IOAA 3S14H 3UDFA 1IBML 4OWTB 4GKKQ 4QGUA 4YWMA 2IX0A 1W3SA 5LMNW 1HR0L 3PO3G 5M3FH 1Q86C 1OXVA 3RNUA 1VQ6A 2VL6A 1A0IA 2JA9A 1EWIA 4QL5A 3STBD 3A5ZB 4DV5Q 1YI2A 4A3BG 3VDYA 5ELNA 4XIGS 1ASYA 4P74A 4O0AA 3H3VH 2K5HA 3CMAA 1XNQL 2JA6H 4X64Q 4X66Q 4IFDJ 1JJGA 1M90C 1VQ5A 3K80C 4DR1Q 4DAYB 4PG3A 2ZTEA 3Q8DA 4A3BH 1U0LA 1GKHA 4A3EH 3ERSX 1EUJA 1P16A 4YY3Q 4A3MG 3DLLA 1YZ6A 2D62A 2WFWA 4A3GH 4A93H 4WJ3M 1HZAA 4EQ5A 4DUYQ 4DV1L 1XJVA 4LF4L 4LF9L 1WCMG 2JK8A 4C2MH 3KJPA 4JI3Q 2EXDA 4DK6C 3U50C 3ZJYC 1YVCA 1NJIC 5M5WH 4NB3A 2A1AA 4BBRG 2MO0A 4IOCA 1X3EA 1XPRA 4DKAC 4GOPC 2ZM6L 2ATWA 2R7ZG 4HJ7A 3M85A 1QUQB 2ZM6Q 3PGZA 1KL9A 2VQFL 4A3CH 1VQIA 4C3JH 2WB1G 5BR8L 4PZ8A 5BR8Q 4GKKL 3E0EA 1FGUA 2OCEA 1E1OA 4DNIA 1S3OA 5C4XH 4GN4B 2R92G 1QZGA 4GKJL 4QY7A 4DV7L 4OWWB 2ZTCA 1PH4A 2GN5A 2F52A 2AMCB 1I3QH 4LF5Q 3I4MG 1Y1WG 1PYSB 2HQLA 1YNXA 5IYBH 1KRTA 4JOIC 1SRUA 5M5YH 3G4SA 2NN6G 4UPAA 1EOVA 1PH2A 4LFCL 5JJLA 2GVBA 4BA1I 3L7ZC 4YCVA 1TXYA 4IPCA 4UY8C 4JYAL 2HT1A 2VNUD 2PI2A 4JI5L 3I7FA 5IYCH 3HKSA 3M3YH 1E24A 2UXCL 3DM3A 3FHWA 4DV0L 3UDGA 4JBWA 4DR3L 3JC66 5M3MH 4A3DH 5GAHC 4KHZA 4JI4L 4L5SA 4B3RQ 4TQUS 2RCNA 1VQGA 3KDFB 4TVAB 1HNWQ 1SLJA 1K8AC 1VQEA 3J81c 4A3KG 1FJGQ 1CKNA 5C44G 5C3EG 1NY4A 3HOZH 3HKZE 4L5TA 4BY7H 2N3SA 3S2HH 2UXDL 1CKOA 4XTCS 3CD6A 3RLFA 2JQOA 1OXXK 4DV3Q 2D0OA 5IP7H 4BXXG 3GD7A 3BU2A 4JI2L 4PZ6A 1AE3A 4DUZQ 4IFDG 2JJQA 3GTKH 1E1TA 3K81C 1PH9A 3CCEA 3PO2G 1XNRQ 4A3IG 5IT9c 3U58A 4IPHA 4HIMA 2ES2A 1SE8A 1IBLL 3ULPA 4H02A 1IBLQ 1OXSC 3PSIA 2UUCL 3TQYA 2K5NA 1K8GA 4OWXB 3CCSA 4B3SL 4JG2A 4DR2L 4BA2I 4LUVA 4L5QA 4AIMA 1I94L 4JV5L 3M7NA 3AFPA 3PCOB 5ELOA 1NE3A 3T1YQ 1I94Q 2N8NA 3GTGH 4JOIA 2EQSA 3UDXA 2NVXH 3JAMi 2I5LX 4EX5A 3CC2A 2JEBI 1VQOA 3EN2A 3CCRA 3GTPH 1XNQQ 1X56A 1DGSA 1SN8A 1XMOL 1FJGL 1PFSA 1C0AA 2JA5H 1SMXA 4OO1G 3GO5A 2K14A 3J80i 2I0QA 5M5XH 3CC4A 4LFAL 3MXNB 1N33L 1IBKL 4AQYL 3HOYG 2MQHA 4A3EG 1BBUA 3PUVA 4DV1Q 2E2JH 1IZ6A 3FKIG 1A8VA 1HZ9A 4GNXA 1VQFA 3S24A 1WI5A 5EAYA 1UE7A 4DUZL 5IP9H 4LUZA 4X65Q 3PIPA 3ULJA 1V43A 2WP8J 4DV7Q 4GKJQ 4HJAA 1A63A 2BH2A 2Y0SE 3KJOA 1N32L 1WOCA 2YTVA 3M4OH 2VQEQ 4DR6Q 4JBKA 4BBSH 1UE5A 4RMFA 2VS1A 1TWGH 3LGJA 4A3LG 5LMNL 4GN5A 1NMGA 3F8TA 3EBEA 1HNXQ 5IP9G 4DV2Q 1K9MC 4JBMA 4R4CA 5C0XJ 3S17H 4DV2L 4UP7A 4L5RC 1O7IA 4YCUA 4X62L 2B63H 1HR0Q 2KCTA 4LW1A 3T1YL 2E8GA 3BJUA 4NPSA 5C4XG 5GAGC 2ZJPA 3STBC 1XPOA 2JE6I 3BZKA 1QVFA 1G6PA 4MZ9A 1RL2A 2IHFA 1UEBA 4NXNL 3RZOH 5K36G 1YHBA 2KCMA 5LMUL 3U4ZA 1MKHA 1K3RA 2PMZE 2MNAA 2JA7G 1J5EL 1IXRA 1HZCA 1VCIA 5JEAJ 4A3FH 2VY3A 1U5KA 1HNZL 1CUKA 2I5HA 2VW9A 1AE2A 1KC8C 1IBKQ 5HY6A 4JYAQ 2KENA 1PVOA 4K0KL 2N78A 1GO3E 2RHSB 3HOXG 4K0KQ 2LXJA 5IWAQ 1L1OB 1H95A 1EQRA 4JBJA 5FJ8G 3NELA 1K73C 3W5OA 1PH8A 4DR7Q 3KLWA 2CWPA 1VQAA 2YYZA 5AJ3L 3BZCA 3KF6A 5C44H 3HOXH 1BKBA 4B3MQ 4LFBL 1N34L 1Q8KA 4LF7L 2N49A 3HFZB 4LF7Q 1WFQA 5GAEC 2VQFQ 4JC0A 4AYBE 4A3JH 1Q1BA 1VQ7A 3PO2H 3ULLA 4YWKA 3OW2A 2IY5B 2E2IH 1XPUA 4DR5L 1CKNB 1YJNA 2AHOB 1WCMH 2UUAL 3RLOA 1YHQA 1SFOH 1PYBA 2Z6KC 1HH2P 3TEHB 3J81j 3F2CA 4HJ5A 2YU9H 4DR3Q 4DR4Q 1XNRL 3UDIA 4A3IH 1PH3A 1MIUA 2ZJQA 4POFA 2QA4A 3HOVG 4A93G 3CC7A 3NENA 3TRZA 1C7YA 4P75A 1X6OA 2A19A 2BH8A 3PUYA 4LFAQ 1A62A 4LFCQ 2IX1A 1YITA 3E9HA 2NVYH 3PUZA 1Q12A 4LWCA 4NXML 2PNHA 4DV4Q 2HHHQ 4HJ8A 1EIFA 4B3RL 2ID0A 3GDEA 1OTCA 4LF6L 1X55A 3I4NG 4LF6Q 3J7ZC 1X9NA 4YHHQ 2I5MX 4LFBQ 4YHHL 1LM0A 4KI0A 3HOWG 1TWAH 3NBHB 4Y52H 4R4IA 4IPDA 3S1MH 1N36L 1VQ4A 1I50H 3H0GG 4IJLA 4RG1A 4A3CG 4JI1Q 4JCVE 3FP9A 4DR2Q 3MEFA 4QJFA 4GOPA 5M3MG 4A3FG 1TWCH 2CWAA 4BY1G 2DGYA 2GVAA 2YV5A 3KYHC 4DR4L 1L0WA 1N8RC 1IL2A 2WAQG 4PZ7A 2Q2HA 3I4MH 5H1SE 3U4VA 1QVCA 4HIDA 3PF4A 4X64L 1JB7A 3GTJH 4A75A 1OXUA 1HNZQ 3D0FA 4GNXB 2AWOA 4DR1L 4LF8Q 3A74A 1JT8A 1EYGA 1SROA 1VS0A 2XTIA 1V1QA 1LYLA 2CFMA 3M4PA 3M9BA 5IP7G 4ALPA 1W2BA 1Q7YC 3GTMH 3HOUG 3K8AA 2PI2E 3CQZH 2F3IA 1Y1VH 2B3GA 3GTLH 4JI3L 2A8VA 3A5UA 1C9OA 5AJ3Q 1NMFA 2RF4A 2OQ0A 3CW2C 5IYBG 2CCZA 1HR0W 1N32Q 4DR6L 4QIWE 3WWVA 3JAMc 2F4VL 1D7QA 2E2HH 2K75A 2WAQE 3RN2A 3W1GA 1Q46A 3K7UC 3L2PA 1PV4A 2YTXA 1IBMQ 2NVQH 3CPWA 3CMEA 5IWAL 3S16H 3T1HQ 3OTOL 4GOPB 2KHIA 5FLMG 4HIOA 3HOVH 3OTOQ 3G6EA 3S1QH 1KRSA 2PQAB 1NTGA 3KDFA 4JI0L 4IJHA 3RN5A 3F2DA 1LTLA 2JA6G 5E7NA 4YWLA 1VQHA 4OXPA 5C3EH 1L1OA 4X66L 3TS2A 1HZBA 3HOYH 1KIXA 1AH9A 3UE0A 4A3JG 2V1CC 3I4NH 1B70B 1PH5A 2VUMH 2JA8G 1LUZA 3TREA 3F2BA 4X62Q 5IYDG 2R93H 4DAMA 3CPFA 4JV5Q 3CCJA 3PUXA 4LF9Q 2BA1A 1X3GA 1VQ9A 2UXCQ 1E3PA 5M3FG 3CCVA 1G51A 1YIJA 1Q82C 1KD1C 3S1RH 1EIYB 2NZHA 3AFQA 4JI8L 1NBWA 1S40A 2E5LQ 4UP8A 2JA8H 3H0GH 1JMCA 2E5LL 4MNOA 1J5EQ 2Q2UA 1WJJA 3KF8B 2UUBQ 5DLQE 4R4TA 1XTDA 1PH7A 1MJEA 2OTLA 1B8AA 4AH6A 1VQJA 1N33Q 1JJCB 2BA0A 1CKMA 3G71A 1M1KC 4LUOA 2ASBA 3I56A 1N36Q 2MO1A 3PIOA 5C0XG 1VQPA 3K7AH 4R1JA 4JI2Q 5GADC 4GLAC 5IYCG 5JJKA 3CCLA 4A4IA 1UWVA 1JE5A 1EQQA 2ZTDA 3CCQA 4GS3A 4DV5L 1ASZA 1J6QA 1BBWA 2NZOA 3AYHB 2UU9L 2KHJA 4JI6L 4FDBA 2K52A 3E9IA 2VQEL 4GNXC 4GLXA 1PH6A 4JI6Q 1KXLA 2IHEA 4BBSG 1D8LA 4KHPL 3HOZG 5LMNQ 2R7ZH 2R7FA 3CAMA 2XGTA 3HKZG 1QVGA 4BY7G 1Y1VG 4Y7NH 1HNXL 2RHQB 1Z47A 2PQAA 1CSQA 4J15A 1VQCA 4AYBG 4B3SQ 5J3BA 4JI5Q 3M4QA 3S15H 4A3DG 5C0XI 5GROA 3KOJA 2D0PA 2KBNA 2LSSA 5FLXc 1OXTA 4HIKA 4JI7Q 3UE1A 4JI8Q 4JI7L 4C3IH 2UXBL 3W1BA 3RZDH 4P71A 3ICEA 2UXBQ 2R6GA 3K0XA 4OONA 3CCMA 3SGIA 3D31A 2ALYB 1VQBA 1Q81C 3I55A 1VQDA 1KQSA 2Z0SA 2F4VQ 2UXDQ 4GLVB 4DPGA 4R4OA 2K50A 3AEVA 4AQYQ 3CCUA 4IFDI 5GQOA 3AQQA 2OQKA 2CQOA 1XMQL 3OYYA 4DV4L 2VZAA 2Y0SG 2HHHL 4OX9L 3PO3H 5FJ8H 2EIFA 3S1NH 3L0OA 1WYDA 1P8LA 3PV0A 1YJ9A 1CSPA 4DV6Q 1B7YB 5JJIA 2JA7H 4B3ML 1UE1A 3G48A 1N34Q 3I2ZA 4GN3B 1VQKA 2JA5G 4R4QA 2B29A 4IPGA 2UUCQ 1T9HA 1L1OC 2H5XA 2MFIA 5IE8A 2R7DA 4JI1L 2QGQA 5FLMH 4A76A 4YY3L 3FKIH 1N9WA 1GD7A 4BXXH 1V9PA 2WB1E 3IRBA 1R9TH 1QZHA 4DUYL 2CKZB 4P72A 2UUAQ 3EIVA 3J7A5 4OO1I 2VUMG 1FL0A 2DUDA 2R93G 1VQLA 5IYDH 1XMOQ 2AKWB 3B6YA 1Z9FA 3F1ZA 5LMUQ 2NVTH 2YTYA 3HOWH 1X65A 4ME3A 1Q1EA 2Z6KA 3GTOH 4A3LH 3PF5A 4LF8L 3TS0A 1S72A 3NEMA 1PH1A 4BBRH 1GVPA 5C4JH 2QEXA 2L15A 2LXKA 1XMQQ 4NXMQ 4OX9Q 3T1HL 4DR7L 4JI4Q 4BY1H 3ER0A 5JEAG 4X65L 1HNWL 2FXQA 4A3MH 4A3GG 4O2DA 4UP9A 1KAWA 4JI0Q 1I5FA 1JJ2A
chains in the Genus database with same CATH superfamily
4F4WA 4B3TQ 2IT1A 3J80c 4WORA 1G291 2CQAA 3N43B 1FJGH 1K0RA 3KF6B 2Q8TA 1K8MA 2R61A 1UE6A 4RB0A 4FS1A 2B63G 1YJWA 4DK3C 2XVSA 2JN4A 2E75C 3H6MA 3I3CA 3Q0AA 5CA1F 2Q2IA 2VA3A 2DPJA 1LTID 4FO2A 4NXNQ 3CF5A 1TWFH 1BBXC 1LTRD 1MJCA 1STEA 3K7AB 4HSVA 4DL3A 5IY0A 2Q2TA 5KNCA 4EGJA 5HGTA 4DL7A 1LABA 5EGTA 4ED6A 1KHIA 2IX3A 2BCOA 4L63B 3L4JA 2F0JA 1WVLA 1SFOB 2R7ZA 4ECVA 3RR5A 4IWXA 3OSNA 1MI2A 1GUNA 3L9AX 1RF2D 4YCWA 1XTCD 3IAYA 2VPSA 3EVQA 1AFPA 4MV1A 1X3FA 4K5VA 3A0JA 3IFDA 3OSPA 4EQOA 4B3TL 3IG0A 2O03A 4UCTA 1N56A 3RJ0A 2AWNA 2HIVA 4FNFA 5M5YB 1ZYRD 4KKUA 4CC5A 4F8MA 4OWTB 1JXLA 2CHBD 5EKLA 4OGQC 4GKKQ 4YAJB 1HR0L 4JV2A 5M3FH 5KFSA 1OXVA 3LMLA 4DV5Q 3JZIA 5ELNA 2A68D 3SE7A 4JYAH 3I90A 3DEPA 1QG7A 2JA6H 2LS01 4X65H 4L6TB 5IT9L 4IFDJ 1JJGA 3K5IA 1VQ5A 2LKVA 3K80C 4DAPA 2H1EA 1U0LA 1EUJA 2B63B 3VPDA 4FVMA 3DLLA 4WJ3M 5D8DA 1PX2A 5KT5A 4EQ5A 4DUYQ 4EYHB 1SYCA 4OO1H 4JVZA 3KJPA 3RUPA 3ETJA 2EXDA 1YVCA 1NJIC 1UEAB 4BBRG 2HD3A 4UDUC 2UUCH 4XYOA 4C5CA 4QWAA 2R7ZG 2ATWA 3M85A 1QUQB 3ND8A 3PGZA 3GIJA 2ASJA 4A3CH 1VQIA 1EWCA 4GKKL 1FGUA 1JOOA 2OCEA 1TWFB 1E1OA 4X3KA 4Q0YA 1S3OA 2R92G 3KK7A 4QWDA 3RIZA 2ZTCA 4K2KA 1PH4A 2F52A 2AMCB 4LF5Q 3SK6A 4ECZA 5HV6A 1YNXA 4A3JB 1EY9A 3S1RB 3GTPB 2G9DA 2MCTA 5D3IB 1SRUA 2PNRC 1CZGA 2YZGA 4DAVA 3G6JB 3JAML 4YCVA 5LL6S 2I8CA 1DIKA 3I7FA 5IYCH 1WTVA 5L1IA 3DM3A 3FHWA 4DV0L 3UDGA 5JVLA 4DR3L 3MR2A 4CKCA 4XYMB 1VQGA 2JXMB 5A35A 1HNWQ 4DN4M 2WTFA 1F2YA 1TWFA 4H13C 3J81c 2NU9B 2XN9C 5C44G 3A55A 3HKZE 1B9MA 2FPPB 5JQWA 4PV1C 4JV1A 3CRLC 1HQMC 2ZXOA 4A3KB 4YJ2F 1XYIA 4BXXG 3GD7A 5IT9W 3KHRA 2JP1A 4PZ6A 2N55A 4IFDG 2OH2A 1E1TA 1PH9A 2OT2A 4IWYA 1SBBB 3PO2G 1EY6A 5EWFA 4A3IG 3D4WA 5EJWA 4Q5VA 4IPHA 2ES2A 1SE8A 2RDHA 3ULPA 1RK6A 4H02A 2YRXA 2AU0A 5DM63 2K5NA 5KFJA 2VA2A 1K8GA 4JG2A 4IURA 4MV4A 5CBAE 3URYA 2JEGA 5ELOA 1I94Q 1WD1A 2L55A 1SMYD 2N8NA 4JOIA 3NTIA 2EQSA 3UDXA 2NVXH 3JAMi 2KUMA 5E4XA 4EX5A 1VQOA 3I4MB 1DGSA 2J0TD 5KFDA 4M7EA 3FDTA 3OSOA 1C0AA 1SMXA 2FLPA 2K14A 3Q8QB 3TIGA 3HOYG 1BCPF 4FP5D 1I50A 4KD4A 4AQYL 1JE4A 1QNUA 3PR5B 1BBUA 1SEBD 2QEJC 4DV1Q 4MV9A 1A8VA 4B9WA 2VQDA 1SNPA 1UE7A 4LUZA 3Q8PB 4GKJQ 1I7LA 1A63A 2B2WC 1N32L 3M4OH 4NW2A 2XGPA 5NUCA 2C5CA 4RMFA 4QW9A 4DV1H 3F8TA 1DZ1A 4A2AA 1SDFA 2EZVA 3G8CA 2V59A 2L4NA 4X62L 4LW1A 1I4QA 2E8GA 3MVVA 2SCUB 2DZDA 3STBC 5KFZA 2QCPX 2VUGA 4MZ9A 2IHFA 1UNSA 5G3LD 4NXNL 1LTGD 1X3PA 5LMUL 1WTRA 2HJWA 1GHKA 3H09A 2NU8B 1B3QA 1CUKA 5KFOA 1AE2A 1PRTF 1DD2A 2JEJA 4O3RA 4JYAQ 4HR7B 2N78A 2J6SA 2R8GA 1Z2PX 5IWAQ 5BN4A 1QWYA 3H3VC 2JSOA 4JBJA 2EJGC 5FJ8G 1K73C 3K6OA 4DR7Q 3BVMA 4J9LA 1Q90A 3R8BA 1AZQA 3GV8B 2A6HC 3GTGB 3BZCA 4FF1A 4RKLA 1H9SB 5C44H 4B3MQ 5EPKA 2W6PA 5JAVA 4EYIB 1KC7A 3R3OA 3HFZB 4K0KH 2VQFQ 4RUAA 4AYBE 1IOVA 1RDPD 4YWKA 2IY5B 2F4VH 2UXDH 2PYKA 3TSSA 5AFWA 3K5NA 5F9LA 4C5BA 1JR0D 4DA2A 3BAAA 3F2CA 4DR3Q 1EOTA 4DR4Q 4A3IH 3HS0C 1PH3A 4HCSA 2W9BA 3X3MA 3OWFA 4P75A 1X6OA 5C5LA 2VR1A 4F50A 1YITA 3E9HA 3QZ7A 1H9JA 4MTKA 1G2TA 4LWCA 1XDNA 1SYDA 4QIWA 1S5BD 2PNHA 3JRXA 2VB3X 4DV4Q 2HHHQ 2PZTA 3BYYB 3TN2A 4B3RL 4JI1H 5KEEA 3R5HA 3A7AB 2AQ4A 3K5HA 4LF6Q 3J7ZC 1X9NA 1PTOD 4YHHQ 1CT1D 1BOSA 5KFGA 3RB3A 4A3MB 2AQ3B 5BN3A 3CVZA 3RGXA 4CKEA 1DOLA 3AB9A 1BXRA 1N36L 1I50H 2F0LA 3MFHA 4RB3C 2AUKA 4BBRB 2NTSA 4DR2Q 4WJWA 4GOPA 5EDWA 2PW7A 1CTMA 2O5JC 3MFIA 1CE8A 4A3FG 4FF2A 1RTOA 1HA6A 4RAZA 3KYHC 2BR0A 2YV5A 5EKIA 5IOCA 4IRCA 4DR4L 1L0WA 1IL2A 4J9NA 1RJTA 4G57A 4PZ7A 3F2UA 4K6LA 2NU7B 3OWEB 4LF9H 4HIDA 4FXGC 4X64L 4DV6H 1EQVA 2QDLA 4LMYA 1N32H 1JT8A 1HCZA 2J6TA 1ZKOA 1T5EA 3UI2A 5DAUA 4MA5A 3CQZH 4FF3A 4IFDH 1CQJB 5L37A 3H4DA 2P5ZX 1S4ZA 1RODA 2B3GA 2KEDA 4JI3L 2A8VA 2R7KA 4DL5A 1S0MA 2C22A 2CCZA 1N32Q 1HTLD 4P2CB 4QIWE 5JUMA 3JAMc 4IN3A 2F4VL 5DNFA 3RN2A 1VBHA 1KNAA 3L2PA 4O4IF 5T14A 3MR5A 4EFBA 1X32A 3OTOL 2FMAA 4GOPB 2KHIA 4HIOA 4KHPH 3HOVH 1KEEA 3G6EA 3BJYA 2W70A 1KRSA 4DNRB 1NTGA 4EG0A 4RHRA 1GSHA 3A7LA 4DNTB 2A69C 3RN5A 4ZLTF 4LMQD 2V5AA 2YW2A 2JA8B 2IL8A 4OXPA 1L1OA 1WTOA 3NQIA 4X66L 1IKLA 2E5LH 4IQZA 3HOYH 2CW0D 1Q3LA 5M3MB 2J6UA 1RCVD 1PH5A 2VUMH 3TZDA 1LUZA 4XZ3B 4GC6A 5I4DA 5IYDG 5C1PA 3T1HH 1L0YB 4ZKBB 4C56C 2K05A 1KD1C 4XT3B 1YIJA 2B2VA 1Q82C 1RJQA 2F0IA 4JI8L 2UU9H 4KV6A 2HVSA 2NUCA 1TVXA 1JMCA 1IW7D 1GUOA 2J7ZA 3KF8B 2Q2UA 3N8DA 5IGBA 1B8AA 1B44D 1SYEA 4XQNA 3MZ5A 3G71A 1CKMA 1KABA 2MO1A 2CVRA 3O13A 1VQPA 5DLGA 4B08A 4IZ8A 4R1JA 4JI2Q 5GADC 1CS0A 4U6PA 4X66H 4GLAC 4O3QA 3CCLA 2ZTDA 5FLXE 3CCQA 5LL6X 3S2DB 2UU9L 1IW7C 3E9IA 4K2LA 4XT1B 1KXLA 3NTKA 3QB3A 1STYA 3HOZG 4I65A 3NXWA 2CZGA 2R7FA 4BY7G 2XGTA 3HKZG 2LFNA 2MHVA 4TV8F 3T53B 3U9OA 4AYBG 4JI5Q 5J3BA 2KEEA 2FINB 2R93B 2YS6A 3TINA 1LT5D 2E74C 4DL2A 3DUZA 3KOJA 2D0PA 4HIKA 4AYBA 2F0MA 3PO3B 5JPNC 4JI8Q 4JI7L 2UXBL 2SOBA 2O2LD 2ALYB 3HKZB 2GLTA 3I55A 4QCLA 1VQDA 1RYSA 1F9RA 4F7XA 4DPGA 3AEVA 3CCUA 5GQOA 3AQQA 4EQPA 4OX9L 2QILA 4YJ3F 2VZAA 3Q6SA 1RJPA 2NVQB 3S1NH 3CQZA 4EEQA 2RKSA 1WYDA 3E6ZX 1P8LA 3PV0A 1C30A 2EJMA 5JJIA 4ED0A 2JA7H 5CAEB 4B3ML 4YBZB 4ECTA 2WDTA 3OIPA 3I2ZA 4R4QA 2B29A 2RBMA 5I6WA 5G3LF 2R7DA 1ESRA 4RGMA 2BQRA 3Q1KA 5BR8H 3W3AA 4YY3L 1N9WA 1GD7A 3ITPA 4NKLA 4F4YA 1QZHA 5DLFA 3E5NA 2CKZB 2PW5A 1BCPC 2XIGA 2HVQA 1G8ZD 4Q43A 1FL0A 1VQLA 1XMOQ 1EYDA 4U7CA 1PXUA 2AKWB 4ZCKA 4MTEA 3N6RA 4IRKA 5KFVA 3VR4A 3N40P 1DONA 1X65A 2EYFA 2E2DC 1Q1EA 2Z6KA 5ELDA 4A3LH 2I46A 5KFAA 1PH1A 2EYOA 2W8LA 3J7AV 5C4JH 1GVPA 3K59A 1BNZA 3KHLA 1O7YA 2PVPA 2ZT9C 2A68C 2YU9A 4UP9A 3R5XA 1TAEA 1VQ8A 1Y1WH 1F2LA 1GUSA 2HIXA 3CHBD 4I55F 1CA5A 3M9OB 1MSHA 2PZUA 4C1NK 4RNMA 2XCAA 2R87A 4C3HH 2IA6A 3T5JA 4DV3L 4JI4H 5DG8A 4TV9F 2AGPA 2F0KA 5TSSA 5JVG3 3JAMW 2K03A 4R8UB 1J9OA 3S2DH 4EGVA 1N34H 4E6IA 3SDZA 3MWYW 3S1QB 1PA6A 5CMDA 4LF5L 1B04A 2YYAA 1FVIA 1LT6D 1R4QB 4CJ1B 4QQBX 3ETHA 5KFXA 4KHPQ 2I87A 4J9RA 5C8YF 2SNMA 5KFQA 2C2EA 4WJ4A 5DQGA 1IBLH 1Y14B 2BDOA 5HGQA 2M00A 5IWAH 2C35B 2C9OA 1BVSA 4X6AH 3T5KA 3IN5A 3CXCA 3OW7A 4LF4Q 4RWSC 3WO0A 4XQQA 3GTKA 3RLNA 4MV8A 1SCUB 5KKNB 1E22A 3A8KE 3MXPA 1VQNA 1B6RA 1WSCA 1VKZA 4F88A 4DV6L 3J81i 3CP0A 1TY2A 4A3EB 1QUQA 3GTQH 1VF7A 3H3VI 2R7NA 4EEYA 2B39A 1YEZA 2QKIC 3HOYB 1UC8A 1F9PA 2F0PA 4I4TF 2UUBH 2IX0A 1PZID 3DWPA 4EFEA 2VL6A 2DPIA 1YI2A 4A3FB 4P74A 4O0AA 3H3VH 1VMPA 4JI3H 1XNQL 4X64Q 2JA7A 3GIPA 5EBCA 1BF4A 1KDAA 2ALZA 1ZEQX 2A73B 4J9SA 3ERSX 4A3MG 4A3GH 1CM9A 2L5TA 3T13A 4K6DA 1XJVA 4LF4L 5M5WB 4YHHH 5GONF 3VR3A 2JK8A 4C2MH 4JI3Q 4QWCA 4RFBA 2HQEA 3U50C 3CQZB 4UCSA 4LAAA 2MO0A 1LTTD 1XPRA 1PTOC 4DKAC 2W6OA 1PYWD 2EJFC 5JJZA 2B2VC 3SXHA 1M7JA 4C3JH 3VYUA 3J81E 3MXNA 3GIQA 1N33H 5IGCA 4WBNF 1DJRD 3BG3A 5C5MA 4KJNA 4CJ0B 1H9KA 1HHVA 3TIIA 1QZGA 2W9BB 4GKJL 1HPCA 3TDQA 1HNWH 1DYQA 2GN5A 1Y1WG 5ELEA 2HQLA 2NTTA 4JW0A 1BCPB 2YZNA 1BO0A 1KRTA 1C48A 4ZHQF 4C3HG 1EY0A 1ILPA 4UPAA 4B9XA 5JJLA 3LWUA 3L7ZC 2AQ1B 2VNUD 1QNKA 2QK4A 1W6KA 4QWBA 1U4RA 1I7NA 1EY5A 2Z8LA 3MWMA 4JBWA 5M3MH 5GAHC 5CC4A 4JI4L 4B3RQ 4DR2H 2RCFA 1E4GT 1SLJA 3SE0A 4DL4A 1B1ZA 2WACA 1FJGQ 5FPOA 4JV0A 5C3EG 4L5TA 2MJ8A 3HBLA 5HURA 3KLRA 4V0BA 5E3FA 5IIFA 4LFCH 2F0GA 5LL6b 1M4VA 3RGZA 1B3AA 4IZOA 2EPBA 3D6WA 2JQOA 2NWGA 2D0OA 1ENCA 3K5OA 5K5PA 2FLNA 1AN8A 2QW7A 3GTKH 2R8KA 2ZXRA 4X3SA 3MFYA 1U9RA 1PZKD 3S17B 4HIMA 1V1PB 1Z2OX 2PPBC 2R8IA 2UUCL 3TQYA 4MAMA 3IFTA 4L8JA 2BE5C 2Z4HA 2IBKA 4Q8EA 4DUZH 3V6JA 1FNUA 2F0FA 3PCOB 3T1YQ 3GTGH 4O4LF 3G7LA 1LT3D 3EN2A 2R8HA 1SN8A 4RAUC 1FJGL 4EBCA 2YZMA 3SHLA 3KXYT 3J80i 4LFAL 2I0QA 2HGSA 4Q8FA 1N33L 1ET9A 1IBKL 3GTOB 2RVLA 3NP8A 2A6HD 2ZDHA 1PTOH 1K1SA 1SJHD 1B9NA 1JORA 3C1FA 3QOLA 2QF7A 1WI5A 2XWJB 5EAYA 2NU6B 5KFPA 4C2MA 4HJAA 3FKIB 3KJOA 2BH2A 1WOCA 5ELCA 2VQEQ 2UVUA 5L1JA 4BBSH 3NHHA 5DG7A 2HUGA 2C2DA 2VS1A 4ME6A 4GN5A 1Y1VB 5IGDA 3SVMA 5IP9G 4DV2Q 3QOJA 3L4KA 3S17H 4UP7A 4ZKCB 2KCTA 1JC7A 3T1YL 3BJUA 3SEBA 1XPOA 3BZKA 1PRTD 1QVFA 3BYTB 3J81W 5K36G 2KCMA 3TQ1A 4A3IB 3U4ZA 4RU9A 1K3RA 2MNAA 3JSNA 5KT4A 2KCNA 5CORA 3GV5B 1IXRA 1HZCA 1VCIA 4A3FH 2VY3A 2I5HA 1FGBD 3QO2A 5HY6A 1PVOA 1AW7A 3DMUA 2EOTA 3KAKA 1EQRA 4U673 2R92B 1CI3M 1X3QA 3KLWA 2CWPA 1VQAA 1TWHB 2FK3A 2W57A 3EPGA 4HN7A 1C8CA 1GYFA 4C3IG 3C3LA 1B53A 2DJFC 3HOXH 1BKBA 4LFBL 1JX4A 1STBA 3WNZA 4QIWB 2Z6BA 4H7BA 1BNCA 1SNDA 1O80A 1K8OA 1WFQA 3FDSA 2MPMA 1F9SA 4JC0A 3RB6A 2R93A 3P7JA 3BDCA 3ULLA 3OW2A 2E2IH 2WYOA 2XCPA 2AHOB 1JWUD 5HBRB 4IUQA 3TEHB 1HH2P 4GKKH 2AGQA 3UQ8A 1LO5D 3H0GA 5CBEE 3UDIA 2FMMA 2ZJQA 1MIUA 2ZM6H 2QA4A 3QJYA 2EE1A 4HSPA 3MXGA 3HOVG 1O78A 1K28A 4QW8A 4ECSA 4RNNA 1GSOA 3J80L 2YU9B 1A62A 1I4PA 4C3JG 5IODA 4OL7A 4JI6H 2IX1A 5CV6A 1QB5D 2NVYH 3EROA 3PUZA 1EYZA 1HFNA 1IKMA 1Z2NX 2JEFA 4NXML 4ED3A 2K32A 4HJ8A 5J22A 4C2MB 1FR3A 2ID0A 1OTCA 2C00A 5KFTA 5KG1A 4L1KA 3GTGA 4EVOA 4ED8A 3M4OB 1FKAH 4YHHL 1ZQ7A 4DU9A 2L11A 1LT4D 2JA6A 3I4NB 1XMOH 5J2UF 2ATLA 3GTJB 5KFHA 5FD6A 4R4IA 3BQ2A 4IPDA 1ZHQA 1HA5A 3S1MH 2PBZA 1VQ4A 4AQYH 1TS4A 4RG1A 4KKTA 5K2MA 1KLUD 4YAKB 5C4JB 3RB0A 3JAME 4JCVE 1K3BC 3FP9A 1IL8A 4RKBA 5M3MG 5DG9A 4LF7H 1M0TA 3RUZA 3HXLA 1QOHA 2KVMA 1SEIA 3I4MH 5H1SE 2HCIA 3TZUA 3N52A 3EPIA 1TWAB 1OXUA 1HNZQ 3MJFA 2DN8A 2AWOA 1EY8A 2K28A 2B2YC 3A74A 4EBDA 2J9GA 1VS0A 2XTIA 1V1QA 3M9BA 4ZRZA 1H95A 4ALPA 4APMA 3GQBA 1D5XC 1LV9A 3HG9A 3Q8SB 5KG5A 4LSXA 4S3SA 5K36H 1C9OA 1SYGA 2B2TC 2OQ0A 1DCZA 3TP8A 1JKJB 5KFIA 2FJ2A 5KT2A 2EYLA 1KBLA 3W1GA 1Q46A 2NVQH 4I50F 4LF6H 3FKIA 1MGSA 3V05A 1IHZA 3T1HQ 4QF4A 5FLMG 4DGZA 3OTOQ 3S1QH 5FK9C 1S5DD 5KNBA 3TP7A 1PFBA 2JA5B 4YR0A 2JA6G 1DM0B 4YWLA 2OLSA 3PO2B 3VYTA 2QYZA 3TS2A 4J6HA 4C3HB 2D2CC 4G7HC 1HZBA 1KIXA 3I4NH 3TREA 5LXTF 4X62Q 2R93H 3CCJA 3PUXA 2E2IA 3OIQA 1VQ9A 2O5IC 4ED7A 2XNAC 5M9OA 3S1RH 1D5MC 1BUVT 1NBWA 4DK0A 2NYZD 2TMPA 3SK4A 3H0GH 3TP5A 1KNEA 2E5LL 5BMVF 1D2BA 1TWHA 5BPHA 2W9AA 3PW2A 1SE4A 2R92A 2WV6D 3G6YA 1KJQA 2PMZB 4AH6A 1N33Q 1JJCB 3RV3A 1T5XD 5JEAH 2VPQA 2R8JA 4LUOA 1SAPA 4N8FA 3I56A 2ZDGA 1N36Q 2R82A 3PIOA 2DY7A 5C0XG 2NB0A 3K7AH 2M05A 5JVH3 1AP0A 1LACA 4A2BA 2RDJA 5JJKA 1S0NA 1RKNA 4UAIA 4N8X1 1S68A 1JE5A 3R5FA 3Q8RB 2RA4A 1J6QA 2NZOA 3GIMA 2ASDA 4FBUA 5DEHA 3OHBA 2K52A 2E2IB 4GNXC 5JPMC 1E4EA 5FO9B 1I4RA 4TQRA 3CAMA 4KN7C 2V4QA 3HB9A 2CH4A 2BQUA 4NMZA 3GV6A 5C4HA 4J15A 4F4XA 2L12A 2DIKA 5C0XI 3Q22A 2LSSA 3C1EA 1RYRA 1UAPA 1EY7A 1TU2B 4C3IH 4NLGA 3W1BA 1BGWA 4RUCA 4J9MA 5T1GA 2JA6B 4J1MA 2E2JB 3SGIA 4OX9H 3D31A 4TRDA 5C1OA 2BQ3A 2Z0SA 2F4VQ 2R85A 3NBHA 3K57A 5CR3A 2W8KA 2AQ2B 4IFDI 3JRWA 1JDEA 1DV2A 3TQTA 3KBXA 1XMQL 3OYYA 5DGBA 4GC7A 1W96A 3PO3H 3BA9A 4DV6Q 1PLFA 2RGVA 1Y8NB 1NUCA 1NNXA 1UE1A 4J8QA 2JA5G 1TA8A 5EZYF 3M4IA 1T9HA 2JEIA 3AMUA 1W6JA 2MFIA 5IE8A 3K5LA 1BXTA 4EGQA 4JI1L 4BBSB 1EEFD 1UUPA 5KFMA 2QGQA 5FLMH 2NVYB 3FKIH 5KFEA 2WB1E 2FHTA 3T51B 3KUPA 3DXJC 1UNNC 2DUDA 3FPPA 3RBEA 5LMUQ 2NVTH 2YTYA 4I7AA 1O75A 4FF4A 4MN3A 4ME3A 3GTOH 5FD5A 2D9UA 3NEMA 3S9WA 1GUTA 2B2WA 2ZXPA 4BBRH 2QEXA 1XMQQ 2R6FA 4NXMQ 3T1HL 3U9SA 1SNQA 3RBDA 2L0CA 2FXQA 1KJ9A 4A3MH 4A3GG 1KJIA 2XSCA 4MHEA 1I5FA 4P73A 1JJ2A 5KFRA 4UCVA 3HP3A 4APVA 4IO9A 4QMGA 1TWHH 2C2RA 1AN7A 3J7AK 1SNCA 3H15A 3BQ1A 2R92H 5FOBB 4MIUA 1JWSD 4M1UB 2KOLA 1U4PA 1QE6A 4DR5Q 5LYJF 3T5HA 5CGKA 4J9QA 1IYJB 1TKWB 1YBYA 3PUWA 3KFUA 4MV3A 1ILQA 5KFBA 4LNQA 1Y69U 5EPLA 3HOVB 3QZ8A 3ND9A 1AEXA 1L2FA 2K6AA 2ZJRA 1H9SA 1SSOA 1X54A 4IHJF 3VR2A 4EBEA 1PTOF 4O3OA 5EWGA 1Q8IA 2JEAI 1YHAA 2LMCB 2Y0SA 2L9HA 5I9PA 3OUUA 2CW0C 4WRDA 3L3OC 3RD4A 1E7ZA 2JYOA 5C44B 2VOBA 2UUBL 1EIGA 5D1OA 1AUXA 2EVBA 4JI5H 3S14H 1IBML 4KY7A 4QGUA 2XWBB 4YWMA 3MC0B 1W3SA 5J1ZA 4DV0H 3PO3G 4LF4H 4NP5A 3HGBA 3GTPA 1SJED 1EWIA 4QL5A 3VDYA 2M2LA 4XIGS 5KFFA 3CMAA 4J9KA 3K5MA 1ULZA 1M90C 1BR9A 4HNUA 1EUDB 3PZPA 4DR7H 3KHGA 4PG3A 5KG0A 4A3BH 5J2TF 4Y8VB 4RA8A 1NR2A 3M9MB 1P16A 2D62A 2WFWA 4DV1L 4ZUIA 4LF9L 1VDZA 2R7ZB 1BJTA 4DK6C 2W6ZA 3ZJYC 1I4XA 4NB3A 5M5WH 3GTMB 4IOCA 2I80A 4PWQA 2F3WA 1II3A 4GOPC 4A3GB 4FU0A 3GTKB 4KD3A 3C0FB 3T5LA 3J7AF 2ZM6Q 1KL9A 2XRSD 2V58A 5BR8L 3NUCA 4UFZA 3GTOA 4DR4H 4TSSA 3MXUA 2VUMA 1NAPA 3I8ZA 1O7LA 1JWMD 3VMMA 4QY7A 4DV7L 1PYSB 5IYBH 2W6QA 1N48A 2E2HA 1TQOA 1I4HA 4NDXA 1EFID 2CW8A 3MWEA 5IGFA 2W7OA 3G4SA 2NN6G 1PH2A 4LFCL 2GVBA 4BA1I 4UY8C 2K33A 4IPCA 4JYAL 1D1KA 1M6VA 1DOKA 3HKSA 2UXCL 1E24A 1FNVA 1ZHSA 5E4WC 4A3DH 1JCKB 1FNWA 3JC66 4U68A 5CYUA 4KHZA 4L5SA 4CDDC 4TQUS 4TVAB 3I12A 3NBIA 1AZPA 1JICA 1K8AC 4K5XA 3VPCA 1EYAA 4BWSC 5D65A 1CKNA 1NY4A 3HOZH 4OEMB 5COYA 4BY7H 3J81L 2N3SA 3S2HH 5EQ0A 2UXDL 4CJ2C 2FJZA 4KK7A 2FK2A 2ZJTA 4ZQIA 3CD6A 3RLFA 4DV7H 3EFXD 3GLKA 2AGOA 1HRJA 1HNZH 1EHIA 4C3JB 3DM1A 4JI2L 1AE3A 1PRTC 2DNCA 5H80A 4NXNH 2F4IA 3NE5B 3CCEA 4XYLB 2IPKD 1XNRQ 2B2UC 1SYXB 3U58A 4CBVA 3EA6A 1IBLL 2XC9A 3BG5A 4FXKC 2MUYA 2X0SA 3CCSA 3I72A 4B3SL 4DR2L 4CDCC 4YB8B 4L5QA 1Z6HA 1S9FA 1VF5C 2WE6A 4H0LC 1Y8PB 2I5LX 4XYQA 2JEBI 3GTPH 1X56A 4OO1G 1TWAA 3LWEA 3GO5A 5A2QE 4ETSA 5M5XH 3MXNB 5J39A 3MA2B 3KLSA 4DV2H 3EJIA 3RTXA 1B33N 2E2JH 3HZXA 3KBGA 1CHPD 1VQFA 3D6CA 3T1YH 2A6ED 3MR6A 3BZDB 3PR4A 5IP9H 3KHHA 2EYJA 2Y0SE 4DR1H 1ENAA 2YTVA 3CRKC 1V4YA 1S5FD 2Z9HA 3Q24A 1TWGH 4A3LG 5LMNL 5IGEA 1NMGA 3G6VA 3EBEA 1HNXQ 3D8GA 4JBMA 4DL6A 5C0XJ 4DV2L 1O7IA 2V4RA 5I9OA 2B63H 1SXTA 1IYUA 4ID6A 4NPSA 5GAGC 3GV7B 2W71A 1G6PA 1EZ6A 3FVQA 1RL2A 3RZOH 1UEBA 2TSSA 1ZXTA 2UVVA 5JEAJ 4QB4A 5IGGA 1U5KA 1HNZL 2VW9A 1KC8C 4HAEA 4CKBA 4UCOA 3FRPB 2KENA 3IL8A 5JH7F 1GOZA 2RHSB 3H0GB 3HOXG 4K0KQ 1R9TA 4ED2A 3LP8A 2RSNA 1PH8A 3NELA 2B2TA 3W5OA 4OHJA 1W93A 5KFCA 1EL0A 2KJXA 5EPJA 4N9TA 1LTAD 2GA4B 4CGYB 4LSAA 3KF6A 4JI7H 4Q44A 1S10A 2YL2A 4IRDA 1Q8KA 1HTPA 1YNND 1TT2A 4LF7Q 3PW7A 4CHTB 2EY5A 1M8AA 5EKKA 4A3JH 1A3VA 3PO2H 3N44B 2UVRA 2PO4A 1XPUA 4FYDA 1CKNB 3KLSX 1YJNA 1GUGA 3RLOA 1SFOH 1PYBA 2Z6KC 3J81j 5KT6A 3V2TA 2K01A 1XNRL 3R2TA 5I47A 5C3WA 4LH6A 1E2WA 5CV5A 1ENFA 3CC7A 3TRZA 1C7YA 2A19A 3BABA 5KG3A 3PUYA 4LFAQ 2HDMA 3Q23A 2WAQA 4LF5H 4PDBA 1S97A 4KMUC 3BDOA 4XXEA 3CU7A 3X3NA 2XRQD 3GDEA 3I4NG 2K5QA 1RTNA 2I5MX 1ESFA 2JA7B 1BDOA 1EZ1A 1WD0A 1PFNA 4RNOA 3S1NB 2F03A 1TWAH 3NBHB 3HOWG 4Y52H 4M9UA 1HQRD 3V96A 1S03G 1S0OA 4A3CG 3H0GG 1F77A 4XDXA 1B50A 4JI1Q 1EU4A 2DJGC 3V6HA 3J80W 1TWCH 4QWEA 5M3FB 2DGYA 2GVAA 2R7MA 5C4XB 5C0XH 2I07B 1J8IA 1JB7A 1I6VC 3GTJH 4A75A 3UFXB 4GNXB 4DR1L 1IBMH 4LF8Q 4J9PA 3R23A 4XX0B 4HTHA 1SROA 3V4SA 1VQ6A 1LYLA 3HOUG 5FKAC 2PCFB 1Q7YC 1VAJA 3H4BA 2PI2E 1A15A 1FD7D 4IUTA 5LOVF 3GIIA 5FLXL 2F3IA 2J4XA 4KY6A 1RD9D 1HUNA 5AJ3Q 1F2MA 3WDNA 1RJRA 4FBTA 3KF8A 2WKDA 1EZ8A 3FPUB 3WWVA 1LTSD 5KGUA 2X69A 1D7QA 2K75A 2WAQE 4WFN3 4ECQA 5IWAL 1H9MA 2FFKB 2PZWA 1YNNC 4ECYA 4RGOS 1SE2A 4BWGB 4IJHA 5LA6F 5KFWA 1E2VA 4AYBB 1LTLA 3F2DA 5DQHA 5C3EH 4G7ZC 4OELB 2F1MA 2XGQA 4K8JA 2XD4A 3HEJA 5KT3A 4B3TH 4A3JG 4GKJH 3M3YB 4LH7A 1N36H 2R7LA 3F2BA 1CHQD 3CKIB 3CPFA 2B2UA 2VUMB 3QG1A 2Q8IB 2BA1A 1X3GA 3OUZA 3CCVA 1G51A 3GIDA 1EIYB 1SFOA 2NZHA 5EWEA 3P75A 1S40A 2E5LQ 3DWQA 5A2QW 2JA8H 4J0MA 4MNOA 1J5EQ 2UUBQ 1XTDA 1MJEA 1YNJD 4KY5A 3DHQA 2Y0SB 2B8GA 3WOFA 1NSNS 1M1KC 3PN1A 2F0UA 2BOSA 3VR5A 1NR4A 3P1HA 3OPOA 5IYCG 1VMCA 3W2DA 2KSWA 2KECA 1UWVA 3LX0A 1EQQA 1R9TB 4BY7B 4DV5L 4GS3A 1M0WA 2F0EA 1ASZA 2WINB 4FDBA 4GLXA 4JI6Q 4MV6A 2IP4A 4KHPL 3OTOH 5LMNQ 2EDGA 1QVGA 1Y1VG 1C4QA 5CV7A 4Y7NH 2RHQB 1HNXL 4A93B 2PQAA 3PW5A 1CSQA 1ONLA 1VQCA 2WKCA 4Q0FA 1EY4A 3M4QA 2B2YA 3S15H 4GZYC 5EBDA 5LHY1 1L2ZA 2IW3A 1TWCA 3RZDH 2R6GA 4ULLA 3SI8A 3NK9A 4RB1A 1XMQH 4DXFA 1VQBA 1Q81C 1SNMA 1A2UA 4ZAIA 2UXCH 1B2TA 4GLVB 1TR5A 2H4OA 4PQXA 3K58A 2K50A 3GTJA 5KFYA 4JI0H 1V1PA 3ONAB 3FEWX 4KHVA 1JOKA 2CQOA 1GXDC 2NVXA 1PFMA 1PZJD 3MAQA 5FJ8H 2EIFA 4WD3A 1BCPD 3L0OA 2EXZA 4DLKA 2X6LA 3FMAA 1CSPA 1B7YB 1L0XB 3IKJA 1CQVA 4MTDA 1VQKA 1H9RA 4GN3B 5E1FA 4DV4H 2HHHH 2UUCQ 2SDFA 4ZK9B 4YP3A 1JDBB 1HFGA 2A69D 3E5SA 2VXWA 3VYSA 2R84A 3IRBA 1WTXA 4P72A 4A3BB 3A8JE 2VUMG 2NBFA 5IYDH 2FB9A 2L1BA 2EY2A 3B6YA 1D1IA 3KTMA 2EYHA 3N6XA 4IAJA 3HOWH 2ASLA 1XNRH 2K7VA 5C5JA 3PF5A 1S72A 2K5DA 2YCHA 2UXBH 3NWSA 2L15A 4OX9Q 4E4TA 4R8NA 3E0JA 4DR7L 2W6NA 3VPBA 4JI4Q 5F2DA 3ER0A 2W6MA 4X65L 2NVXB 1CZWA 2NZ1D 4LF8H 2Q8RE 5KG7A 1TY0A 3OOCA 4C5AA 3I73A 2P0AA 1HJPA 3VYRA 5KIXA 1STAA 1JIHA 1PRTB 3I4OA 4HJ9A 1GM5A 3M7GA 2MP1A 2NVYA 5LP6F 3R93A 4TQSA 2LY7A 5IYZF 1YNJC 4O3NA 4ZUJA 1WTPA 2UU9Q 4PMWA 1EYCA 1G6ZA 4MTNA 2A5HA 3H94A 3S16B 1U4MA 2WAQB 3WO1A 4A3KH 3HOUH 1RIPA 2CH4W 1SNOA 1JLLB 2E2HB 4HEDA 1I4GA 2OWOA 1T3NA 1VQMA 3KAJA 5KT7A 1XX8A 2V9WA 4POGA 3ZYYX 2K4KA 2WB1A 4ILWA 1EFWA 1ET6A 4DV0Q 1S5ED 1SYFA 3J80E 3GTLB 1I6HH 1PDQA 2SEBD 1PHJA 4KLKA 2K5VA 4HCEA 4ED1A 4DAYA 5CV9A 1EUCB 2RGRA 2F0DA 4QUCA 1SR3A 1K83H 2OTJA 2NN6I 3V4ZA 2D5DA 3G6XA 2FK1A 4X62H 4IOAA 5CV8A 3DEOA 4I7HA 3UDFA 3A54A 1G2SA 1MD2D 1TIID 5LMNW 1Q86C 3RNUA 3F8NA 1A0IA 2JA9A 3STBD 4A3BG 3A5ZB 1STGA 1ASYA 2O4XA 2NVTB 4LFAH 1STHA 2K5HA 4X66Q 4R8IA 1A3UA 1E0BA 1QJOA 1XXGA 4DAYB 4DR1Q 1HUMA 3HKZA 4TUYF 2ZTEA 4B3MH 3Q8DA 3M4YA 4F4ZA 3GTQB 1GKHA 1GUWA 4A3EH 3T56B 2V4DA 4YY3Q 1YZ6A 2FPGB 2WB1B 5D3DA 4A93H 1HZAA 1HR0H 1FYCA 4Y7NB 1WCMG 4C1NI 1DXMA 4DV5H 2M9VA 4O1NA 2R86A 2A1AA 1ICWA 3NWTA 3PVXA 1X3EA 4G7OC 3D3RA 2ZM6L 4HJ7A 1ZETA 5D1OB 4B3SH 2VQFL 3DF7A 4N9PA 4JI8H 2WB1G 2HCCA 4IALA 4PZ8A 5BR8Q 3J7YW 3I91A 2F3VA 3E0EA 1HXYD 4DNIA 3TBIB 5C4XH 4GN4B 4HMJA 2NN6H 4JUZA 1TWCB 4OWWB 2QDBA 5DM73 1I3QH 2PN1A 4OIKA 1O7ZA 2KHSA 3I4MG 2YRWA 5KG6A 4B3RH 3E3XA 2F0HA 4LJZC 4ZOLF 4JOIC 5KG2A 4F87A 5M5YH 1TS5A 3OHXC 1EOVA 2EY6A 3GV3A 1Y1WB 1TXYA 2HT1A 1KAAA 2PI2A 2EYPA 1EQTA 4JI5L 3T4AC 4R7RA 5FPRA 5L1LA 3M3YH 3LWBA 1A3TA 4ECWA 3RF2A 2E76C 2RCNA 1V51A 1MSGA 3KDFB 2NUAB 2SNSA 1GSAA 5L9XA 1VQEA 4A3KG 2GPWA 4RGNA 2KCCA 1B6SA 4RB2C 4ECXA 4DR5H 4O4HF 1CKOA 4XTCS 1OXXK 4DV3Q 1WCMA 1KLGD 3RAXA 5IP7H 2OXPA 3NGDA 3BU2A 4Z9CB 1E2ZA 3K3VA 4DUZQ 2JJQA 3K81C 5F9NA 5IT9c 5BN5A 3T16A 2IWHA 1K83A 1IBLQ 1OXSC 3PSIA 3A8IE 1T94A 2ICEC 2ICIA 1F2ZA 4DFAA 3MWDA 3GILA 4OWXB 1JQYD 2K5WA 4O42A 5IT9E 4BA2I 4LUVA 4AIMA 4JV5L 1I94L 5KFNA 3M7NA 3AFPA 2PMZA 3NPPA 1NE3A 1IOWA 4JK1C 2DWCA 5EOYA 2BDNA 3CC2A 4BY1B 3ERQA 3CCRA 1K0SA 3OHAA 1XNQQ 4IUUA 1XMOL 1PFSA 2JA5H 1I3QB 5C3XA 3CC4A 5D14A 3PW4A 3GIKA 2RDFA 2MQHA 2RSOA 5LMUH 1WTHA 4RHSA 4A3EG 1EIHA 1HNXH 5KFLA 3PUVA 1IZ6A 3FKIG 1HZ9A 4GNXA 1MHWC 1V1OA 3I70A 3PQIA 1I94H 3S24A 1XNQH 4DUZL 3RZOB 3RAQA 4UCUA 1SMYC 2Z1CA 4X65Q 3PIPA 3ULJA 1V43A 2WP8J 4DV7Q 4CC6A 3MTSA 4DR6Q 3VA5A 3QFFA 1TS3A 2DNEA 4JBKA 1UE5A 4X64H 3LGJA 1WTQA 1ZYRC 2EYMA 1K9MC 1TWGB 4R4CA 4HQ6A 4O3PA 4ECRA 3GTMA 4L5RC 3BS1A 4YCUA 1IBKH 3PMFA 3VA7A 1HR0Q 4UHVA 5C4XG 3GTLA 2ZJPA 3SR1A 2JE6I 3VR6A 4DR6H 2C28A 1BQQT 3V6KA 1CK1A 1CQIB 2B8FA 1YHBA 1ML0D 4XQJA 1MKHA 2PMZE 4QUFA 2JA7G 1I3QA 4YR3A 1J5EL 3RV4A 3MFGA 3HRZC 4RCOA 3RFCA 3NSWA 1IBKQ 2N88A 2RDIA 4K0KL 4R9WA 5KX5F 1GO3E 1SYBA 1WTWA 2LXJA 1L1OB 2G5DA 2PQEA 3S1MB 5KRUA 5A2QL 4TKOB 4EQNA 4IUPA 3K3PA 3R2IA 2YYZA 4PNYA 4RZQA 4G3IA 5AJ3L 1V8QA 2FE3A 1U4LA 1N34L 4LF7L 1EWHA 4FXDA 4YR2A 1QILA 2N49A 3MR3A 2OEOA 5GAEC 4R8UA 4IR9A 1I6HB 4DF7A 1KTKA 1Q1BA 4CDFC 1VQ7A 1CFMA 1G91A 1LTBD 4DR5L 3ORQA 3GP7A 1WCMH 2UUAL 1YHQA 3TP6A 4HJ5A 2YU9H 2BE5D 2F0VA 1Y1WA 4ME5A 4H44C 2FLLA 4POFA 4ABNA 5KNDA 4A93G 3NENA 5D1PA 3OMGA 4ZI7F 1SE3A 3PIP3 2BH8A 3BQ0A 4LFBH 1NCVA 1VBGA 4YQWA 4LFCQ 2FP4B 4I7ZC 5LMNH 1Q12A 5C6AA 2IMWP 4K5WA 3M9NB 2F0TA 2K04A 1EIFA 4HR7A 2W9CA 4LF6L 1X55A 3PW0A 3HOXB 4LFBQ 2RDGA 2WIIB 5T1IA 1LM0A 4KTAA 1STNA 3LNNA 4KI0A 3H91A 2UUAH 2JA5A 3NTHA 2RQXA 4IJLA 1RHPA 2XIWA 5ELFA 3MEFA 4QJFA 4ECUA 2CWAA 5M5XB 4BY1G 3MEHA 2K1BA 2ZDQA 4OIJA 3I4LA 3BA8A 5C4ZA 1N8RC 2WAQG 2F0QA 3GTQA 1EU3A 2Q2HA 1I50B 3DWAA 3U4VA 4ODGA 3N42B 1QVCA 4FM9A 3PF4A 3C46A 4IR1A 3D0FA 1EYGA 1K83B 5IP7G 2CFMA 3M4PA 1W2BA 4PMBA 3GQCA 3GTMH 3RMHA 5I6YA 3K8AA 4RZRA 1K1QA 4ZQ3A 2EY1A 1Y1VH 5CV4A 1CA6A 3GTLH 5CA0F 3A5UA 2ENBA 1RK5A 3U9TA 1NMFA 2RF4A 3CW2C 3K0YA 5IYBG 1HR0W 4IUVA 4DR6L 1D6EC 4X3UA 1JOQA 5KG4A 2E2HH 1S5CD 3FMCA 3K7UC 4JPBW 1PV4A 2YTXA 3WOEA 1IBMQ 2MGSA 3CPWA 3CMEA 3HOUB 1UC9A 1WH2A 4G4KA 3S16H 3KALA 1PTOB 4NXMH 5JVDF 2PQAB 3S2HB 3KDFA 2W7PA 4HMIA 5FO8B 3H20A 2YS7A 3HOZB 4JI0L 1GJXA 2GPSA 5CB4F 5E7NA 1VQHA 2FPIB 3RZDB 5L1KA 1AH9A 5FO7B 4A3DB 3UE0A 2R3ZA 2V1CC 1B70B 2JA8G 1OO9B 3S15B 4K14A 4DAMA 5KYLA 2FMCA 4RCNA 4JV5Q 2VB2X 1KJ8A 4JI2H 4Q45A 4HYKA 4LF9Q 1MZBA 2UXCQ 5ISRA 1E3PA 5M3FG 5KFKA 4M8AA 3AFQA 3D4DA 4IUNA 4DXGA 4HNTA 4K8IA 4UP8A 3BVGA 1XWEA 3QWNA 4RGTA 5FLXW 3RB4A 1DOMA 3BVZA 3OMCA 5JOBA 1WJJA 4LK1C 5DLQE 4R4TA 1PH7A 2OTLA 4O2AF 1VQJA 4YIJA 2BA0A 3HOWB 4JV5H 2ASBA 2DY8A 2A6EC 4DR3H 1JB3A 4KKSA 2F0OA 1A9XA 3JSLA 4A4IA 4RH6A 2F0SA 2KQ3A 1GGOA 1WCMB 2UVWA 3AYHB 1BBWA 2HVRA 2KHJA 4JI6L 2F0NA 4RAYA 4X3TA 4BS9A 2VQEL 5I2XA 1PH6A 4MA0A 3AU7A 1J5EH 2IHEA 4BBSG 1D8LA 1AUVA 1KDBA 2R7ZH 2FKLA 1TS2A 2HDLA 3QIAA 3P20A 4O3SA 3NQTA 1B4OA 1Z47A 2IJ0A 3A56A 4KJOA 4MV7A 3PIO3 4B3SQ 1E4FT 4A3DG 1QCBD 1IYVA 3MHBA 5GROA 5FLXc 2KBNA 1OXTA 3D4RA 4JI7Q 2OF1A 3UE1A 4KN4C 1Y8OB 3ICEA 4P71A 2UXBQ 3K0XA 1A2TA 5C3EB 4OONA 3CCMA 1KQSA 2A74C 2UXDQ 1TWGA 3ORRA 3TMEA 2W9CB 4R4OA 2CW7A 2XCLA 3EYYA 4HNVA 4AQYQ 1C3OA 4V190 2CQYA 1E4EB 1OWTA 5BPFA 2OQKA 3SK5A 4DUYH 4DV4L 2HHHL 2Y0SG 3S14B 1LLRD 1DV1A 2B63A 4YY3H 1KJJA 1YJ9A 1Y1VA 1GLVA 2KA7A 3G48A 3N41B 1N34Q 1I6UA 1A6XA 1F9QA 4IPGA 3H40A 1L1OC 2H5XA 1Z7TA 1GHJA 2G9HD 1R4PB 1ICFB 3QR8A 2VQFH 4A76A 1EEID 3C2PA 1V9PA 4BXXH 1R9TH 2UUAQ 2Z4IA 4DUYL 4OO1I 3EIVA 3J7A5 4DV3H 4O2BF 3SK8A 2R93G 3EQLC 1Z9FA 5KYIA 3F1ZA 5DGAA 4PMCA 1T36A 5ELBA 1PK8A 1WR2A 1D5ZC 1KDCA 2AUJD 4LF8L 3TS0A 1CQFA 1PMRA 4DK1A 2DLNA 4UCRA 4J9OA 1MBYA 3Q2OA 5DQIA 2LXKA 4ZYSA 2X6GA 5I2YA 4CDEC 4C3IB 4BY1H 5JEAG 2VQEH 1HNWL 5KFUA 4FS2A 4O2DA 2F0WA 1KAWA 4JI0Q 3BDLA
chains in the Genus database with same CATH topology
1VQ8A 4B3TQ 2IT1A 3J80c 1Y1WH 1HJPA 4APVA 2HIXA 1G291 4IO9A 1TWHH 3H15A 2R92H 1K0RA 3KF6B 4C3HH 3I4OA 4HJ9A 1GM5A 4DV3L 1UE6A 4DR5Q 2B63G 1YJWA 4DK3C 1IYJB 1YBYA 3PUWA 3KFUA 2Q2IA 3S2DH 4LNQA 4NXNQ 3CF5A 1TWFH 4PMWA 1PA6A 2UU9Q 1L2FA 4LF5L 1FVIA 1MJCA 4MTNA 5IY0A 4QQBX 2ZJRA 2Q2TA 4KHPQ 4A3KH 3HOUH 1RIPA 4WJ4A 1KHIA 1Y14B 5HGQA 4P73A 1X54A 2OWOA 1VQMA 2C35B 1BVSA 3RR5A 4X6AH 2JEAI 1YHAA 4POGA 2K4KA 3CXCA 1EFWA 4LF4Q 4YCWA 4DV0Q 1I6HH 3RLNA 1PHJA 4KLKA 2K5VA 1X3FA 1E22A 1VQNA 3A0JA 4DV6L 1E7ZA 3J81i 4B3TL 1SR3A 3CP0A 1K83H 2UUBL 2OTJA 1QUQA 2NN6I 3GTQH 3H3VI 2AWNA 2HIVA 1YEZA 4IOAA 3S14H 3UDFA 1IBML 4OWTB 4GKKQ 4QGUA 4YWMA 2IX0A 1W3SA 5LMNW 1HR0L 3PO3G 5M3FH 1Q86C 1OXVA 3RNUA 1VQ6A 2VL6A 1A0IA 2JA9A 1EWIA 4QL5A 3STBD 3A5ZB 4DV5Q 1YI2A 4A3BG 3VDYA 5ELNA 4XIGS 1ASYA 4P74A 4O0AA 3H3VH 2K5HA 3CMAA 1XNQL 2JA6H 4X64Q 4X66Q 4IFDJ 1JJGA 1M90C 1VQ5A 3K80C 4DR1Q 4DAYB 4PG3A 2ZTEA 3Q8DA 4A3BH 1U0LA 1GKHA 4A3EH 3ERSX 1EUJA 1P16A 4YY3Q 4A3MG 3DLLA 1YZ6A 2D62A 2WFWA 4A3GH 4A93H 4WJ3M 1HZAA 4EQ5A 4DUYQ 4DV1L 1XJVA 4LF4L 4LF9L 1WCMG 2JK8A 4C2MH 3KJPA 4JI3Q 2EXDA 4DK6C 3U50C 3ZJYC 1YVCA 1NJIC 5M5WH 4NB3A 2A1AA 4BBRG 2MO0A 4IOCA 1X3EA 1XPRA 4DKAC 4GOPC 2ZM6L 2ATWA 2R7ZG 4HJ7A 3M85A 1QUQB 2ZM6Q 3PGZA 1KL9A 2VQFL 4A3CH 1VQIA 4C3JH 2WB1G 5BR8L 4PZ8A 5BR8Q 4GKKL 3E0EA 1FGUA 2OCEA 1E1OA 4DNIA 1S3OA 5C4XH 4GN4B 2R92G 1QZGA 4GKJL 4QY7A 4DV7L 4OWWB 2ZTCA 1PH4A 2GN5A 2F52A 2AMCB 1I3QH 4LF5Q 3I4MG 1Y1WG 1PYSB 2HQLA 1YNXA 5IYBH 1KRTA 4JOIC 1SRUA 5M5YH 3G4SA 2NN6G 4UPAA 1EOVA 1PH2A 4LFCL 5JJLA 2GVBA 4BA1I 3L7ZC 4YCVA 1TXYA 4IPCA 4UY8C 4JYAL 2HT1A 2VNUD 2PI2A 4JI5L 3I7FA 5IYCH 3HKSA 3M3YH 1E24A 2UXCL 3DM3A 3FHWA 4DV0L 3UDGA 4JBWA 4DR3L 3JC66 5M3MH 4A3DH 5GAHC 4KHZA 4JI4L 4L5SA 4B3RQ 4TQUS 2RCNA 1VQGA 3KDFB 4TVAB 1HNWQ 1SLJA 1K8AC 1VQEA 3J81c 4A3KG 1FJGQ 1CKNA 5C44G 5C3EG 1NY4A 3HOZH 3HKZE 4L5TA 4BY7H 2N3SA 3S2HH 2UXDL 1CKOA 4XTCS 3CD6A 3RLFA 2JQOA 1OXXK 4DV3Q 2D0OA 5IP7H 4BXXG 3GD7A 3BU2A 4JI2L 4PZ6A 1AE3A 4DUZQ 4IFDG 2JJQA 3GTKH 1E1TA 3K81C 1PH9A 3CCEA 3PO2G 1XNRQ 4A3IG 5IT9c 3U58A 4IPHA 4HIMA 2ES2A 1SE8A 1IBLL 3ULPA 4H02A 1IBLQ 1OXSC 3PSIA 2UUCL 3TQYA 2K5NA 1K8GA 4OWXB 3CCSA 4B3SL 4JG2A 4DR2L 4BA2I 4LUVA 4L5QA 4AIMA 1I94L 4JV5L 3M7NA 3AFPA 3PCOB 5ELOA 1NE3A 3T1YQ 1I94Q 2N8NA 3GTGH 4JOIA 2EQSA 3UDXA 2NVXH 3JAMi 2I5LX 4EX5A 3CC2A 2JEBI 1VQOA 3EN2A 3CCRA 3GTPH 1XNQQ 1X56A 1DGSA 1SN8A 1XMOL 1FJGL 1PFSA 1C0AA 2JA5H 1SMXA 4OO1G 3GO5A 2K14A 3J80i 2I0QA 5M5XH 3CC4A 4LFAL 3MXNB 1N33L 1IBKL 4AQYL 3HOYG 2MQHA 4A3EG 1BBUA 3PUVA 4DV1Q 2E2JH 1IZ6A 3FKIG 1A8VA 1HZ9A 4GNXA 1VQFA 3S24A 1WI5A 5EAYA 1UE7A 4DUZL 5IP9H 4LUZA 4X65Q 3PIPA 3ULJA 1V43A 2WP8J 4DV7Q 4GKJQ 4HJAA 1A63A 2BH2A 2Y0SE 3KJOA 1N32L 1WOCA 2YTVA 3M4OH 2VQEQ 4DR6Q 4JBKA 4BBSH 1UE5A 4RMFA 2VS1A 1TWGH 3LGJA 4A3LG 5LMNL 4GN5A 1NMGA 3F8TA 3EBEA 1HNXQ 5IP9G 4DV2Q 1K9MC 4JBMA 4R4CA 5C0XJ 3S17H 4DV2L 4UP7A 4L5RC 1O7IA 4YCUA 4X62L 2B63H 1HR0Q 2KCTA 4LW1A 3T1YL 2E8GA 3BJUA 4NPSA 5C4XG 5GAGC 2ZJPA 3STBC 1XPOA 2JE6I 3BZKA 1QVFA 1G6PA 4MZ9A 1RL2A 2IHFA 1UEBA 4NXNL 3RZOH 5K36G 1YHBA 2KCMA 5LMUL 3U4ZA 1MKHA 1K3RA 2PMZE 2MNAA 2JA7G 1J5EL 1IXRA 1HZCA 1VCIA 5JEAJ 4A3FH 2VY3A 1U5KA 1HNZL 1CUKA 2I5HA 2VW9A 1AE2A 1KC8C 1IBKQ 5HY6A 4JYAQ 2KENA 1PVOA 4K0KL 2N78A 1GO3E 2RHSB 3HOXG 4K0KQ 2LXJA 5IWAQ 1L1OB 1H95A 1EQRA 4JBJA 5FJ8G 3NELA 1K73C 3W5OA 1PH8A 4DR7Q 3KLWA 2CWPA 1VQAA 2YYZA 5AJ3L 3BZCA 3KF6A 5C44H 3HOXH 1BKBA 4B3MQ 4LFBL 1N34L 1Q8KA 4LF7L 2N49A 3HFZB 4LF7Q 1WFQA 5GAEC 2VQFQ 4JC0A 4AYBE 4A3JH 1Q1BA 1VQ7A 3PO2H 3ULLA 4YWKA 3OW2A 2IY5B 2E2IH 1XPUA 4DR5L 1CKNB 1YJNA 2AHOB 1WCMH 2UUAL 3RLOA 1YHQA 1SFOH 1PYBA 2Z6KC 1HH2P 3TEHB 3J81j 3F2CA 4HJ5A 2YU9H 4DR3Q 4DR4Q 1XNRL 3UDIA 4A3IH 1PH3A 1MIUA 2ZJQA 4POFA 2QA4A 3HOVG 4A93G 3CC7A 3NENA 3TRZA 1C7YA 4P75A 1X6OA 2A19A 2BH8A 3PUYA 4LFAQ 1A62A 4LFCQ 2IX1A 1YITA 3E9HA 2NVYH 3PUZA 1Q12A 4LWCA 4NXML 2PNHA 4DV4Q 2HHHQ 4HJ8A 1EIFA 4B3RL 2ID0A 3GDEA 1OTCA 4LF6L 1X55A 3I4NG 4LF6Q 3J7ZC 1X9NA 4YHHQ 2I5MX 4LFBQ 4YHHL 1LM0A 4KI0A 3HOWG 1TWAH 3NBHB 4Y52H 4R4IA 4IPDA 3S1MH 1N36L 1VQ4A 1I50H 3H0GG 4IJLA 4RG1A 4A3CG 4JI1Q 4JCVE 3FP9A 4DR2Q 3MEFA 4QJFA 4GOPA 5M3MG 4A3FG 1TWCH 2CWAA 4BY1G 2DGYA 2GVAA 2YV5A 3KYHC 4DR4L 1L0WA 1N8RC 1IL2A 2WAQG 4PZ7A 2Q2HA 3I4MH 5H1SE 3U4VA 1QVCA 4HIDA 3PF4A 4X64L 1JB7A 3GTJH 4A75A 1OXUA 1HNZQ 3D0FA 4GNXB 2AWOA 4DR1L 4LF8Q 3A74A 1JT8A 1EYGA 1SROA 1VS0A 2XTIA 1V1QA 1LYLA 2CFMA 3M4PA 3M9BA 5IP7G 4ALPA 1W2BA 1Q7YC 3GTMH 3HOUG 3K8AA 2PI2E 3CQZH 2F3IA 1Y1VH 2B3GA 3GTLH 4JI3L 2A8VA 3A5UA 1C9OA 5AJ3Q 1NMFA 2RF4A 2OQ0A 3CW2C 5IYBG 2CCZA 1HR0W 1N32Q 4DR6L 4QIWE 3WWVA 3JAMc 2F4VL 1D7QA 2E2HH 2K75A 2WAQE 3RN2A 3W1GA 1Q46A 3K7UC 3L2PA 1PV4A 2YTXA 1IBMQ 2NVQH 3CPWA 3CMEA 5IWAL 3S16H 3T1HQ 3OTOL 4GOPB 2KHIA 5FLMG 4HIOA 3HOVH 3OTOQ 3G6EA 3S1QH 1KRSA 2PQAB 1NTGA 3KDFA 4JI0L 4IJHA 3RN5A 3F2DA 1LTLA 2JA6G 5E7NA 4YWLA 1VQHA 4OXPA 5C3EH 1L1OA 4X66L 3TS2A 1HZBA 3HOYH 1KIXA 1AH9A 3UE0A 4A3JG 2V1CC 3I4NH 1B70B 1PH5A 2VUMH 2JA8G 1LUZA 3TREA 3F2BA 4X62Q 5IYDG 2R93H 4DAMA 3CPFA 4JV5Q 3CCJA 3PUXA 4LF9Q 2BA1A 1X3GA 1VQ9A 2UXCQ 1E3PA 5M3FG 3CCVA 1G51A 1YIJA 1Q82C 1KD1C 3S1RH 1EIYB 2NZHA 3AFQA 4JI8L 1NBWA 1S40A 2E5LQ 4UP8A 2JA8H 3H0GH 1JMCA 2E5LL 4MNOA 1J5EQ 2Q2UA 1WJJA 3KF8B 2UUBQ 5DLQE 4R4TA 1XTDA 1PH7A 1MJEA 2OTLA 1B8AA 4AH6A 1VQJA 1N33Q 1JJCB 2BA0A 1CKMA 3G71A 1M1KC 4LUOA 2ASBA 3I56A 1N36Q 2MO1A 3PIOA 5C0XG 1VQPA 3K7AH 4R1JA 4JI2Q 5GADC 4GLAC 5IYCG 5JJKA 3CCLA 4A4IA 1UWVA 1JE5A 1EQQA 2ZTDA 3CCQA 4GS3A 4DV5L 1ASZA 1J6QA 1BBWA 2NZOA 3AYHB 2UU9L 2KHJA 4JI6L 4FDBA 2K52A 3E9IA 2VQEL 4GNXC 4GLXA 1PH6A 4JI6Q 1KXLA 2IHEA 4BBSG 1D8LA 4KHPL 3HOZG 5LMNQ 2R7ZH 2R7FA 3CAMA 2XGTA 3HKZG 1QVGA 4BY7G 1Y1VG 4Y7NH 1HNXL 2RHQB 1Z47A 2PQAA 1CSQA 4J15A 1VQCA 4AYBG 4B3SQ 5J3BA 4JI5Q 3M4QA 3S15H 4A3DG 5C0XI 5GROA 3KOJA 2D0PA 2KBNA 2LSSA 5FLXc 1OXTA 4HIKA 4JI7Q 3UE1A 4JI8Q 4JI7L 4C3IH 2UXBL 3W1BA 3RZDH 4P71A 3ICEA 2UXBQ 2R6GA 3K0XA 4OONA 3CCMA 3SGIA 3D31A 2ALYB 1VQBA 1Q81C 3I55A 1VQDA 1KQSA 2Z0SA 2F4VQ 2UXDQ 4GLVB 4DPGA 4R4OA 2K50A 3AEVA 4AQYQ 3CCUA 4IFDI 5GQOA 3AQQA 2OQKA 2CQOA 1XMQL 3OYYA 4DV4L 2VZAA 2Y0SG 2HHHL 4OX9L 3PO3H 5FJ8H 2EIFA 3S1NH 3L0OA 1WYDA 1P8LA 3PV0A 1YJ9A 1CSPA 4DV6Q 1B7YB 5JJIA 2JA7H 4B3ML 1UE1A 3G48A 1N34Q 3I2ZA 4GN3B 1VQKA 2JA5G 4R4QA 2B29A 4IPGA 2UUCQ 1T9HA 1L1OC 2H5XA 2MFIA 5IE8A 2R7DA 4JI1L 2QGQA 5FLMH 4A76A 4YY3L 3FKIH 1N9WA 1GD7A 4BXXH 1V9PA 2WB1E 3IRBA 1R9TH 1QZHA 4DUYL 2CKZB 4P72A 2UUAQ 3EIVA 3J7A5 4OO1I 2VUMG 1FL0A 2DUDA 2R93G 1VQLA 5IYDH 1XMOQ 2AKWB 3B6YA 1Z9FA 3F1ZA 5LMUQ 2NVTH 2YTYA 3HOWH 1X65A 4ME3A 1Q1EA 2Z6KA 3GTOH 4A3LH 3PF5A 4LF8L 3TS0A 1S72A 3NEMA 1PH1A 4BBRH 1GVPA 5C4JH 2QEXA 2L15A 2LXKA 1XMQQ 4NXMQ 4OX9Q 3T1HL 4DR7L 4JI4Q 4BY1H 3ER0A 5JEAG 4X65L 1HNWL 2FXQA 4A3MH 4A3GG 4O2DA 4UP9A 1KAWA 4JI0Q 1I5FA 1JJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 A;  4B3T Q;  2IT1 A;  3J80 c;  1Y1W H;  1HJP A;  4APV A;  2HIX A;  1G29 1;  4IO9 A;  1TWH H;  3H15 A;  2R92 H;  1K0R A;  3KF6 B;  4C3H H;  3I4O A;  4HJ9 A;  1GM5 A;  4DV3 L;  1UE6 A;  4DR5 Q;  2B63 G;  1YJW A;  4DK3 C;  1IYJ B;  1YBY A;  3PUW A;  3KFU A;  2Q2I A;  3S2D H;  4LNQ A;  4NXN Q;  3CF5 A;  1TWF H;  4PMW A;  1PA6 A;  2UU9 Q;  1L2F A;  4LF5 L;  1FVI A;  1MJC A;  4MTN A;  5IY0 A;  4QQB X;  2ZJR A;  2Q2T A;  4KHP Q;  4A3K H;  3HOU H;  1RIP A;  4WJ4 A;  1KHI A;  1Y14 B;  5HGQ A;  4P73 A;  1X54 A;  2OWO A;  1VQM A;  2C35 B;  1BVS A;  3RR5 A;  4X6A H;  2JEA I;  1YHA A;  4POG A;  2K4K A;  3CXC A;  1EFW A;  4LF4 Q;  4YCW A;  4DV0 Q;  1I6H H;  3RLN A;  1PHJ A;  4KLK A;  2K5V A;  1X3F A;  1E22 A;  1VQN A;  3A0J A;  4DV6 L;  1E7Z A;  3J81 i;  4B3T L;  1SR3 A;  3CP0 A;  1K83 H;  2UUB L;  2OTJ A;  1QUQ A;  2NN6 I;  3GTQ H;  3H3V I;  2AWN A;  2HIV A;  1YEZ A;  4IOA A;  3S14 H;  3UDF A;  1IBM L;  4OWT B;  4GKK Q;  4QGU A;  4YWM A;  2IX0 A;  1W3S A;  5LMN W;  1HR0 L;  3PO3 G;  5M3F H;  1Q86 C;  1OXV A;  3RNU A;  1VQ6 A;  2VL6 A;  1A0I A;  2JA9 A;  1EWI A;  4QL5 A;  3STB D;  3A5Z B;  4DV5 Q;  1YI2 A;  4A3B G;  3VDY A;  5ELN A;  4XIG S;  1ASY A;  4P74 A;  4O0A A;  3H3V H;  2K5H A;  3CMA A;  1XNQ L;  2JA6 H;  4X64 Q;  4X66 Q;  4IFD J;  1JJG A;  1M90 C;  1VQ5 A;  3K80 C;  4DR1 Q;  4DAY B;  4PG3 A;  2ZTE A;  3Q8D A;  4A3B H;  1U0L A;  1GKH A;  4A3E H;  3ERS X;  1EUJ A;  1P16 A;  4YY3 Q;  4A3M G;  3DLL A;  1YZ6 A;  2D62 A;  2WFW A;  4A3G H;  4A93 H;  4WJ3 M;  1HZA A;  4EQ5 A;  4DUY Q;  4DV1 L;  1XJV A;  4LF4 L;  4LF9 L;  1WCM G;  2JK8 A;  4C2M H;  3KJP A;  4JI3 Q;  2EXD A;  4DK6 C;  3U50 C;  3ZJY C;  1YVC A;  1NJI C;  5M5W H;  4NB3 A;  2A1A A;  4BBR G;  2MO0 A;  4IOC A;  1X3E A;  1XPR A;  4DKA C;  4GOP C;  2ZM6 L;  2ATW A;  2R7Z G;  4HJ7 A;  3M85 A;  1QUQ B;  2ZM6 Q;  3PGZ A;  1KL9 A;  2VQF L;  4A3C H;  1VQI A;  4C3J H;  2WB1 G;  5BR8 L;  4PZ8 A;  5BR8 Q;  4GKK L;  3E0E A;  1FGU A;  2OCE A;  1E1O A;  4DNI A;  1S3O A;  5C4X H;  4GN4 B;  2R92 G;  1QZG A;  4GKJ L;  4QY7 A;  4DV7 L;  4OWW B;  2ZTC A;  1PH4 A;  2GN5 A;  2F52 A;  2AMC B;  1I3Q H;  4LF5 Q;  3I4M G;  1Y1W G;  1PYS B;  2HQL A;  1YNX A;  5IYB H;  1KRT A;  4JOI C;  1SRU A;  5M5Y H;  3G4S A;  2NN6 G;  4UPA A;  1EOV A;  1PH2 A;  4LFC L;  5JJL A;  2GVB A;  4BA1 I;  3L7Z C;  4YCV A;  1TXY A;  4IPC A;  4UY8 C;  4JYA L;  2HT1 A;  2VNU D;  2PI2 A;  4JI5 L;  3I7F A;  5IYC H;  3HKS A;  3M3Y H;  1E24 A;  2UXC L;  3DM3 A;  3FHW A;  4DV0 L;  3UDG A;  4JBW A;  4DR3 L;  3JC6 6;  5M3M H;  4A3D H;  5GAH C;  4KHZ A;  4JI4 L;  4L5S A;  4B3R Q;  4TQU S;  2RCN A;  1VQG A;  3KDF B;  4TVA B;  1HNW Q;  1SLJ A;  1K8A C;  1VQE A;  3J81 c;  4A3K G;  1FJG Q;  1CKN A;  5C44 G;  5C3E G;  1NY4 A;  3HOZ H;  3HKZ E;  4L5T A;  4BY7 H;  2N3S A;  3S2H H;  2UXD L;  1CKO A;  4XTC S;  3CD6 A;  3RLF A;  2JQO A;  1OXX K;  4DV3 Q;  2D0O A;  5IP7 H;  4BXX G;  3GD7 A;  3BU2 A;  4JI2 L;  4PZ6 A;  1AE3 A;  4DUZ Q;  4IFD G;  2JJQ A;  3GTK H;  1E1T A;  3K81 C;  1PH9 A;  3CCE A;  3PO2 G;  1XNR Q;  4A3I G;  5IT9 c;  3U58 A;  4IPH A;  4HIM A;  2ES2 A;  1SE8 A;  1IBL L;  3ULP A;  4H02 A;  1IBL Q;  1OXS C;  3PSI A;  2UUC L;  3TQY A;  2K5N A;  1K8G A;  4OWX B;  3CCS A;  4B3S L;  4JG2 A;  4DR2 L;  4BA2 I;  4LUV A;  4L5Q A;  4AIM A;  1I94 L;  4JV5 L;  3M7N A;  3AFP A;  3PCO B;  5ELO A;  1NE3 A;  3T1Y Q;  1I94 Q;  2N8N A;  3GTG H;  4JOI A;  2EQS A;  3UDX A;  2NVX H;  3JAM i;  2I5L X;  4EX5 A;  3CC2 A;  2JEB I;  1VQO A;  3EN2 A;  3CCR A;  3GTP H;  1XNQ Q;  1X56 A;  1DGS A;  1SN8 A;  1XMO L;  1FJG L;  1PFS A;  1C0A A;  2JA5 H;  1SMX A;  4OO1 G;  3GO5 A;  2K14 A;  3J80 i;  2I0Q A;  5M5X H;  3CC4 A;  4LFA L;  3MXN B;  1N33 L;  1IBK L;  4AQY L;  3HOY G;  2MQH A;  4A3E G;  1BBU A;  3PUV A;  4DV1 Q;  2E2J H;  1IZ6 A;  3FKI G;  1A8V A;  1HZ9 A;  4GNX A;  1VQF A;  3S24 A;  1WI5 A;  5EAY A;  1UE7 A;  4DUZ L;  5IP9 H;  4LUZ A;  4X65 Q;  3PIP A;  3ULJ A;  1V43 A;  2WP8 J;  4DV7 Q;  4GKJ Q;  4HJA A;  1A63 A;  2BH2 A;  2Y0S E;  3KJO A;  1N32 L;  1WOC A;  2YTV A;  3M4O H;  2VQE Q;  4DR6 Q;  4JBK A;  4BBS H;  1UE5 A;  4RMF A;  2VS1 A;  1TWG H;  3LGJ A;  4A3L G;  5LMN L;  4GN5 A;  1NMG A;  3F8T A;  3EBE A;  1HNX Q;  5IP9 G;  4DV2 Q;  1K9M C;  4JBM A;  4R4C A;  5C0X J;  3S17 H;  4DV2 L;  4UP7 A;  4L5R C;  1O7I A;  4YCU A;  4X62 L;  2B63 H;  1HR0 Q;  2KCT A;  4LW1 A;  3T1Y L;  2E8G A;  3BJU A;  4NPS A;  5C4X G;  5GAG C;  2ZJP A;  3STB C;  1XPO A;  2JE6 I;  3BZK A;  1QVF A;  1G6P A;  4MZ9 A;  1RL2 A;  2IHF A;  1UEB A;  4NXN L;  3RZO H;  5K36 G;  1YHB A;  2KCM A;  5LMU L;  3U4Z A;  1MKH A;  1K3R A;  2PMZ E;  2MNA A;  2JA7 G;  1J5E L;  1IXR A;  1HZC A;  1VCI A;  5JEA J;  4A3F H;  2VY3 A;  1U5K A;  1HNZ L;  1CUK A;  2I5H A;  2VW9 A;  1AE2 A;  1KC8 C;  1IBK Q;  5HY6 A;  4JYA Q;  2KEN A;  1PVO A;  4K0K L;  2N78 A;  1GO3 E;  2RHS B;  3HOX G;  4K0K Q;  2LXJ A;  5IWA Q;  1L1O B;  1H95 A;  1EQR A;  4JBJ A;  5FJ8 G;  3NEL A;  1K73 C;  3W5O A;  1PH8 A;  4DR7 Q;  3KLW A;  2CWP A;  1VQA A;  2YYZ A;  5AJ3 L;  3BZC A;  3KF6 A;  5C44 H;  3HOX H;  1BKB A;  4B3M Q;  4LFB L;  1N34 L;  1Q8K A;  4LF7 L;  2N49 A;  3HFZ B;  4LF7 Q;  1WFQ A;  5GAE C;  2VQF Q;  4JC0 A;  4AYB E;  4A3J H;  1Q1B A;  1VQ7 A;  3PO2 H;  3ULL A;  4YWK A;  3OW2 A;  2IY5 B;  2E2I H;  1XPU A;  4DR5 L;  1CKN B;  1YJN A;  2AHO B;  1WCM H;  2UUA L;  3RLO A;  1YHQ A;  1SFO H;  1PYB A;  2Z6K C;  1HH2 P;  3TEH B;  3J81 j;  3F2C A;  4HJ5 A;  2YU9 H;  4DR3 Q;  4DR4 Q;  1XNR L;  3UDI A;  4A3I H;  1PH3 A;  1MIU A;  2ZJQ A;  4POF A;  2QA4 A;  3HOV G;  4A93 G;  3CC7 A;  3NEN A;  3TRZ A;  1C7Y A;  4P75 A;  1X6O A;  2A19 A;  2BH8 A;  3PUY A;  4LFA Q;  1A62 A;  4LFC Q;  2IX1 A;  1YIT A;  3E9H A;  2NVY H;  3PUZ A;  1Q12 A;  4LWC A;  4NXM L;  2PNH A;  4DV4 Q;  2HHH Q;  4HJ8 A;  1EIF A;  4B3R L;  2ID0 A;  3GDE A;  1OTC A;  4LF6 L;  1X55 A;  3I4N G;  4LF6 Q;  3J7Z C;  1X9N A;  4YHH Q;  2I5M X;  4LFB Q;  4YHH L;  1LM0 A;  4KI0 A;  3HOW G;  1TWA H;  3NBH B;  4Y52 H;  4R4I A;  4IPD A;  3S1M H;  1N36 L;  1VQ4 A;  1I50 H;  3H0G G;  4IJL A;  4RG1 A;  4A3C G;  4JI1 Q;  4JCV E;  3FP9 A;  4DR2 Q;  3MEF A;  4QJF A;  4GOP A;  5M3M G;  4A3F G;  1TWC H;  2CWA A;  4BY1 G;  2DGY A;  2GVA A;  2YV5 A;  3KYH C;  4DR4 L;  1L0W A;  1N8R C;  1IL2 A;  2WAQ G;  4PZ7 A;  2Q2H A;  3I4M H;  5H1S E;  3U4V A;  1QVC A;  4HID A;  3PF4 A;  4X64 L;  1JB7 A;  3GTJ H;  4A75 A;  1OXU A;  1HNZ Q;  3D0F A;  4GNX B;  2AWO A;  4DR1 L;  4LF8 Q;  3A74 A;  1JT8 A;  1EYG A;  1SRO A;  1VS0 A;  2XTI A;  1V1Q A;  1LYL A;  2CFM A;  3M4P A;  3M9B A;  5IP7 G;  4ALP A;  1W2B A;  1Q7Y C;  3GTM H;  3HOU G;  3K8A A;  2PI2 E;  3CQZ H;  2F3I A;  1Y1V H;  2B3G A;  3GTL H;  4JI3 L;  2A8V A;  3A5U A;  1C9O A;  5AJ3 Q;  1NMF A;  2RF4 A;  2OQ0 A;  3CW2 C;  5IYB G;  2CCZ A;  1HR0 W;  1N32 Q;  4DR6 L;  4QIW E;  3WWV A;  3JAM c;  2F4V L;  1D7Q A;  2E2H H;  2K75 A;  2WAQ E;  3RN2 A;  3W1G A;  1Q46 A;  3K7U C;  3L2P A;  1PV4 A;  2YTX A;  1IBM Q;  2NVQ H;  3CPW A;  3CME A;  5IWA L;  3S16 H;  3T1H Q;  3OTO L;  4GOP B;  2KHI A;  5FLM G;  4HIO A;  3HOV H;  3OTO Q;  3G6E A;  3S1Q H;  1KRS A;  2PQA B;  1NTG A;  3KDF A;  4JI0 L;  4IJH A;  3RN5 A;  3F2D A;  1LTL A;  2JA6 G;  5E7N A;  4YWL A;  1VQH A;  4OXP A;  5C3E H;  1L1O A;  4X66 L;  3TS2 A;  1HZB A;  3HOY H;  1KIX A;  1AH9 A;  3UE0 A;  4A3J G;  2V1C C;  3I4N H;  1B70 B;  1PH5 A;  2VUM H;  2JA8 G;  1LUZ A;  3TRE A;  3F2B A;  4X62 Q;  5IYD G;  2R93 H;  4DAM A;  3CPF A;  4JV5 Q;  3CCJ A;  3PUX A;  4LF9 Q;  2BA1 A;  1X3G A;  1VQ9 A;  2UXC Q;  1E3P A;  5M3F G;  3CCV A;  1G51 A;  1YIJ A;  1Q82 C;  1KD1 C;  3S1R H;  1EIY B;  2NZH A;  3AFQ A;  4JI8 L;  1NBW A;  1S40 A;  2E5L Q;  4UP8 A;  2JA8 H;  3H0G H;  1JMC A;  2E5L L;  4MNO A;  1J5E Q;  2Q2U A;  1WJJ A;  3KF8 B;  2UUB Q;  5DLQ E;  4R4T A;  1XTD A;  1PH7 A;  1MJE A;  2OTL A;  1B8A A;  4AH6 A;  1VQJ A;  1N33 Q;  1JJC B;  2BA0 A;  1CKM A;  3G71 A;  1M1K C;  4LUO A;  2ASB A;  3I56 A;  1N36 Q;  2MO1 A;  3PIO A;  5C0X G;  1VQP A;  3K7A H;  4R1J A;  4JI2 Q;  5GAD C;  4GLA C;  5IYC G;  5JJK A;  3CCL A;  4A4I A;  1UWV A;  1JE5 A;  1EQQ A;  2ZTD A;  3CCQ A;  4GS3 A;  4DV5 L;  1ASZ A;  1J6Q A;  1BBW A;  2NZO A;  3AYH B;  2UU9 L;  2KHJ A;  4JI6 L;  4FDB A;  2K52 A;  3E9I A;  2VQE L;  4GNX C;  4GLX A;  1PH6 A;  4JI6 Q;  1KXL A;  2IHE A;  4BBS G;  1D8L A;  4KHP L;  3HOZ G;  5LMN Q;  2R7Z H;  2R7F A;  3CAM A;  2XGT A;  3HKZ G;  1QVG A;  4BY7 G;  1Y1V G;  4Y7N H;  1HNX L;  2RHQ B;  1Z47 A;  2PQA A;  1CSQ A;  4J15 A;  1VQC A;  4AYB G;  4B3S Q;  5J3B A;  4JI5 Q;  3M4Q A;  3S15 H;  4A3D G;  5C0X I;  5GRO A;  3KOJ A;  2D0P A;  2KBN A;  2LSS A;  5FLX c;  1OXT A;  4HIK A;  4JI7 Q;  3UE1 A;  4JI8 Q;  4JI7 L;  4C3I H;  2UXB L;  3W1B A;  3RZD H;  4P71 A;  3ICE A;  2UXB Q;  2R6G A;  3K0X A;  4OON A;  3CCM A;  3SGI A;  3D31 A;  2ALY B;  1VQB A;  1Q81 C;  3I55 A;  1VQD A;  1KQS A;  2Z0S A;  2F4V Q;  2UXD Q;  4GLV B;  4DPG A;  4R4O A;  2K50 A;  3AEV A;  4AQY Q;  3CCU A;  4IFD I;  5GQO A;  3AQQ A;  2OQK A;  2CQO A;  1XMQ L;  3OYY A;  4DV4 L;  2VZA A;  2Y0S G;  2HHH L;  4OX9 L;  3PO3 H;  5FJ8 H;  2EIF A;  3S1N H;  3L0O A;  1WYD A;  1P8L A;  3PV0 A;  1YJ9 A;  1CSP A;  4DV6 Q;  1B7Y B;  5JJI A;  2JA7 H;  4B3M L;  1UE1 A;  3G48 A;  1N34 Q;  3I2Z A;  4GN3 B;  1VQK A;  2JA5 G;  4R4Q A;  2B29 A;  4IPG A;  2UUC Q;  1T9H A;  1L1O C;  2H5X A;  2MFI A;  5IE8 A;  2R7D A;  4JI1 L;  2QGQ A;  5FLM H;  4A76 A;  4YY3 L;  3FKI H;  1N9W A;  1GD7 A;  4BXX H;  1V9P A;  2WB1 E;  3IRB A;  1R9T H;  1QZH A;  4DUY L;  2CKZ B;  4P72 A;  2UUA Q;  3EIV A;  3J7A 5;  4OO1 I;  2VUM G;  1FL0 A;  2DUD A;  2R93 G;  1VQL A;  5IYD H;  1XMO Q;  2AKW B;  3B6Y A;  1Z9F A;  3F1Z A;  5LMU Q;  2NVT H;  2YTY A;  3HOW H;  1X65 A;  4ME3 A;  1Q1E A;  2Z6K A;  3GTO H;  4A3L H;  3PF5 A;  4LF8 L;  3TS0 A;  1S72 A;  3NEM A;  1PH1 A;  4BBR H;  1GVP A;  5C4J H;  2QEX A;  2L15 A;  2LXK A;  1XMQ Q;  4NXM Q;  4OX9 Q;  3T1H L;  4DR7 L;  4JI4 Q;  4BY1 H;  3ER0 A;  5JEA G;  4X65 L;  1HNW L;  2FXQ A;  4A3M H;  4A3G G;  4O2D A;  4UP9 A;  1KAW A;  4JI0 Q;  1I5F A;  1JJ2 A; 
#chains in the Genus database with same CATH topology
 4F4W A;  4B3T Q;  2IT1 A;  3J80 c;  4WOR A;  1G29 1;  2CQA A;  3N43 B;  1FJG H;  1K0R A;  3KF6 B;  2Q8T A;  1K8M A;  2R61 A;  1UE6 A;  4RB0 A;  4FS1 A;  2B63 G;  1YJW A;  4DK3 C;  2XVS A;  2JN4 A;  2E75 C;  3H6M A;  3I3C A;  3Q0A A;  5CA1 F;  2Q2I A;  2VA3 A;  2DPJ A;  1LTI D;  4FO2 A;  4NXN Q;  3CF5 A;  1TWF H;  1BBX C;  1LTR D;  1MJC A;  1STE A;  3K7A B;  4HSV A;  4DL3 A;  5IY0 A;  2Q2T A;  5KNC A;  4EGJ A;  5HGT A;  4DL7 A;  1LAB A;  5EGT A;  4ED6 A;  1KHI A;  2IX3 A;  2BCO A;  4L63 B;  3L4J A;  2F0J A;  1WVL A;  1SFO B;  2R7Z A;  4ECV A;  3RR5 A;  4IWX A;  3OSN A;  1MI2 A;  1GUN A;  3L9A X;  1RF2 D;  4YCW A;  1XTC D;  3IAY A;  2VPS A;  3EVQ A;  1AFP A;  4MV1 A;  1X3F A;  4K5V A;  3A0J A;  3IFD A;  3OSP A;  4EQO A;  4B3T L;  3IG0 A;  2O03 A;  4UCT A;  1N56 A;  3RJ0 A;  2AWN A;  2HIV A;  4FNF A;  5M5Y B;  1ZYR D;  4KKU A;  4CC5 A;  4F8M A;  4OWT B;  1JXL A;  2CHB D;  5EKL A;  4OGQ C;  4GKK Q;  4YAJ B;  1HR0 L;  4JV2 A;  5M3F H;  5KFS A;  1OXV A;  3LML A;  4DV5 Q;  3JZI A;  5ELN A;  2A68 D;  3SE7 A;  4JYA H;  3I90 A;  3DEP A;  1QG7 A;  2JA6 H;  2LS0 1;  4X65 H;  4L6T B;  5IT9 L;  4IFD J;  1JJG A;  3K5I A;  1VQ5 A;  2LKV A;  3K80 C;  4DAP A;  2H1E A;  1U0L A;  1EUJ A;  2B63 B;  3VPD A;  4FVM A;  3DLL A;  4WJ3 M;  5D8D A;  1PX2 A;  5KT5 A;  4EQ5 A;  4DUY Q;  4EYH B;  1SYC A;  4OO1 H;  4JVZ A;  3KJP A;  3RUP A;  3ETJ A;  2EXD A;  1YVC A;  1NJI C;  1UEA B;  4BBR G;  2HD3 A;  4UDU C;  2UUC H;  4XYO A;  4C5C A;  4QWA A;  2R7Z G;  2ATW A;  3M85 A;  1QUQ B;  3ND8 A;  3PGZ A;  3GIJ A;  2ASJ A;  4A3C H;  1VQI A;  1EWC A;  4GKK L;  1FGU A;  1JOO A;  2OCE A;  1TWF B;  1E1O A;  4X3K A;  4Q0Y A;  1S3O A;  2R92 G;  3KK7 A;  4QWD A;  3RIZ A;  2ZTC A;  4K2K A;  1PH4 A;  2F52 A;  2AMC B;  4LF5 Q;  3SK6 A;  4ECZ A;  5HV6 A;  1YNX A;  4A3J B;  1EY9 A;  3S1R B;  3GTP B;  2G9D A;  2MCT A;  5D3I B;  1SRU A;  2PNR C;  1CZG A;  2YZG A;  4DAV A;  3G6J B;  3JAM L;  4YCV A;  5LL6 S;  2I8C A;  1DIK A;  3I7F A;  5IYC H;  1WTV A;  5L1I A;  3DM3 A;  3FHW A;  4DV0 L;  3UDG A;  5JVL A;  4DR3 L;  3MR2 A;  4CKC A;  4XYM B;  1VQG A;  2JXM B;  5A35 A;  1HNW Q;  4DN4 M;  2WTF A;  1F2Y A;  1TWF A;  4H13 C;  3J81 c;  2NU9 B;  2XN9 C;  5C44 G;  3A55 A;  3HKZ E;  1B9M A;  2FPP B;  5JQW A;  4PV1 C;  4JV1 A;  3CRL C;  1HQM C;  2ZXO A;  4A3K B;  4YJ2 F;  1XYI A;  4BXX G;  3GD7 A;  5IT9 W;  3KHR A;  2JP1 A;  4PZ6 A;  2N55 A;  4IFD G;  2OH2 A;  1E1T A;  1PH9 A;  2OT2 A;  4IWY A;  1SBB B;  3PO2 G;  1EY6 A;  5EWF A;  4A3I G;  3D4W A;  5EJW A;  4Q5V A;  4IPH A;  2ES2 A;  1SE8 A;  2RDH A;  3ULP A;  1RK6 A;  4H02 A;  2YRX A;  2AU0 A;  5DM6 3;  2K5N A;  5KFJ A;  2VA2 A;  1K8G A;  4JG2 A;  4IUR A;  4MV4 A;  5CBA E;  3URY A;  2JEG A;  5ELO A;  1I94 Q;  1WD1 A;  2L55 A;  1SMY D;  2N8N A;  4JOI A;  3NTI A;  2EQS A;  3UDX A;  2NVX H;  3JAM i;  2KUM A;  5E4X A;  4EX5 A;  1VQO A;  3I4M B;  1DGS A;  2J0T D;  5KFD A;  4M7E A;  3FDT A;  3OSO A;  1C0A A;  1SMX A;  2FLP A;  2K14 A;  3Q8Q B;  3TIG A;  3HOY G;  1BCP F;  4FP5 D;  1I50 A;  4KD4 A;  4AQY L;  1JE4 A;  1QNU A;  3PR5 B;  1BBU A;  1SEB D;  2QEJ C;  4DV1 Q;  4MV9 A;  1A8V A;  4B9W A;  2VQD A;  1SNP A;  1UE7 A;  4LUZ A;  3Q8P B;  4GKJ Q;  1I7L A;  1A63 A;  2B2W C;  1N32 L;  3M4O H;  4NW2 A;  2XGP A;  5NUC A;  2C5C A;  4RMF A;  4QW9 A;  4DV1 H;  3F8T A;  1DZ1 A;  4A2A A;  1SDF A;  2EZV A;  3G8C A;  2V59 A;  2L4N A;  4X62 L;  4LW1 A;  1I4Q A;  2E8G A;  3MVV A;  2SCU B;  2DZD A;  3STB C;  5KFZ A;  2QCP X;  2VUG A;  4MZ9 A;  2IHF A;  1UNS A;  5G3L D;  4NXN L;  1LTG D;  1X3P A;  5LMU L;  1WTR A;  2HJW A;  1GHK A;  3H09 A;  2NU8 B;  1B3Q A;  1CUK A;  5KFO A;  1AE2 A;  1PRT F;  1DD2 A;  2JEJ A;  4O3R A;  4JYA Q;  4HR7 B;  2N78 A;  2J6S A;  2R8G A;  1Z2P X;  5IWA Q;  5BN4 A;  1QWY A;  3H3V C;  2JSO A;  4JBJ A;  2EJG C;  5FJ8 G;  1K73 C;  3K6O A;  4DR7 Q;  3BVM A;  4J9L A;  1Q90 A;  3R8B A;  1AZQ A;  3GV8 B;  2A6H C;  3GTG B;  3BZC A;  4FF1 A;  4RKL A;  1H9S B;  5C44 H;  4B3M Q;  5EPK A;  2W6P A;  5JAV A;  4EYI B;  1KC7 A;  3R3O A;  3HFZ B;  4K0K H;  2VQF Q;  4RUA A;  4AYB E;  1IOV A;  1RDP D;  4YWK A;  2IY5 B;  2F4V H;  2UXD H;  2PYK A;  3TSS A;  5AFW A;  3K5N A;  5F9L A;  4C5B A;  1JR0 D;  4DA2 A;  3BAA A;  3F2C A;  4DR3 Q;  1EOT A;  4DR4 Q;  4A3I H;  3HS0 C;  1PH3 A;  4HCS A;  2W9B A;  3X3M A;  3OWF A;  4P75 A;  1X6O A;  5C5L A;  2VR1 A;  4F50 A;  1YIT A;  3E9H A;  3QZ7 A;  1H9J A;  4MTK A;  1G2T A;  4LWC A;  1XDN A;  1SYD A;  4QIW A;  1S5B D;  2PNH A;  3JRX A;  2VB3 X;  4DV4 Q;  2HHH Q;  2PZT A;  3BYY B;  3TN2 A;  4B3R L;  4JI1 H;  5KEE A;  3R5H A;  3A7A B;  2AQ4 A;  3K5H A;  4LF6 Q;  3J7Z C;  1X9N A;  1PTO D;  4YHH Q;  1CT1 D;  1BOS A;  5KFG A;  3RB3 A;  4A3M B;  2AQ3 B;  5BN3 A;  3CVZ A;  3RGX A;  4CKE A;  1DOL A;  3AB9 A;  1BXR A;  1N36 L;  1I50 H;  2F0L A;  3MFH A;  4RB3 C;  2AUK A;  4BBR B;  2NTS A;  4DR2 Q;  4WJW A;  4GOP A;  5EDW A;  2PW7 A;  1CTM A;  2O5J C;  3MFI A;  1CE8 A;  4A3F G;  4FF2 A;  1RTO A;  1HA6 A;  4RAZ A;  3KYH C;  2BR0 A;  2YV5 A;  5EKI A;  5IOC A;  4IRC A;  4DR4 L;  1L0W A;  1IL2 A;  4J9N A;  1RJT A;  4G57 A;  4PZ7 A;  3F2U A;  4K6L A;  2NU7 B;  3OWE B;  4LF9 H;  4HID A;  4FXG C;  4X64 L;  4DV6 H;  1EQV A;  2QDL A;  4LMY A;  1N32 H;  1JT8 A;  1HCZ A;  2J6T A;  1ZKO A;  1T5E A;  3UI2 A;  5DAU A;  4MA5 A;  3CQZ H;  4FF3 A;  4IFD H;  1CQJ B;  5L37 A;  3H4D A;  2P5Z X;  1S4Z A;  1ROD A;  2B3G A;  2KED A;  4JI3 L;  2A8V A;  2R7K A;  4DL5 A;  1S0M A;  2C22 A;  2CCZ A;  1N32 Q;  1HTL D;  4P2C B;  4QIW E;  5JUM A;  3JAM c;  4IN3 A;  2F4V L;  5DNF A;  3RN2 A;  1VBH A;  1KNA A;  3L2P A;  4O4I F;  5T14 A;  3MR5 A;  4EFB A;  1X32 A;  3OTO L;  2FMA A;  4GOP B;  2KHI A;  4HIO A;  4KHP H;  3HOV H;  1KEE A;  3G6E A;  3BJY A;  2W70 A;  1KRS A;  4DNR B;  1NTG A;  4EG0 A;  4RHR A;  1GSH A;  3A7L A;  4DNT B;  2A69 C;  3RN5 A;  4ZLT F;  4LMQ D;  2V5A A;  2YW2 A;  2JA8 B;  2IL8 A;  4OXP A;  1L1O A;  1WTO A;  3NQI A;  4X66 L;  1IKL A;  2E5L H;  4IQZ A;  3HOY H;  2CW0 D;  1Q3L A;  5M3M B;  2J6U A;  1RCV D;  1PH5 A;  2VUM H;  3TZD A;  1LUZ A;  4XZ3 B;  4GC6 A;  5I4D A;  5IYD G;  5C1P A;  3T1H H;  1L0Y B;  4ZKB B;  4C56 C;  2K05 A;  1KD1 C;  4XT3 B;  1YIJ A;  2B2V A;  1Q82 C;  1RJQ A;  2F0I A;  4JI8 L;  2UU9 H;  4KV6 A;  2HVS A;  2NUC A;  1TVX A;  1JMC A;  1IW7 D;  1GUO A;  2J7Z A;  3KF8 B;  2Q2U A;  3N8D A;  5IGB A;  1B8A A;  1B44 D;  1SYE A;  4XQN A;  3MZ5 A;  3G71 A;  1CKM A;  1KAB A;  2MO1 A;  2CVR A;  3O13 A;  1VQP A;  5DLG A;  4B08 A;  4IZ8 A;  4R1J A;  4JI2 Q;  5GAD C;  1CS0 A;  4U6P A;  4X66 H;  4GLA C;  4O3Q A;  3CCL A;  2ZTD A;  5FLX E;  3CCQ A;  5LL6 X;  3S2D B;  2UU9 L;  1IW7 C;  3E9I A;  4K2L A;  4XT1 B;  1KXL A;  3NTK A;  3QB3 A;  1STY A;  3HOZ G;  4I65 A;  3NXW A;  2CZG A;  2R7F A;  4BY7 G;  2XGT A;  3HKZ G;  2LFN A;  2MHV A;  4TV8 F;  3T53 B;  3U9O A;  4AYB G;  4JI5 Q;  5J3B A;  2KEE A;  2FIN B;  2R93 B;  2YS6 A;  3TIN A;  1LT5 D;  2E74 C;  4DL2 A;  3DUZ A;  3KOJ A;  2D0P A;  4HIK A;  4AYB A;  2F0M A;  3PO3 B;  5JPN C;  4JI8 Q;  4JI7 L;  2UXB L;  2SOB A;  2O2L D;  2ALY B;  3HKZ B;  2GLT A;  3I55 A;  4QCL A;  1VQD A;  1RYS A;  1F9R A;  4F7X A;  4DPG A;  3AEV A;  3CCU A;  5GQO A;  3AQQ A;  4EQP A;  4OX9 L;  2QIL A;  4YJ3 F;  2VZA A;  3Q6S A;  1RJP A;  2NVQ B;  3S1N H;  3CQZ A;  4EEQ A;  2RKS A;  1WYD A;  3E6Z X;  1P8L A;  3PV0 A;  1C30 A;  2EJM A;  5JJI A;  4ED0 A;  2JA7 H;  5CAE B;  4B3M L;  4YBZ B;  4ECT A;  2WDT A;  3OIP A;  3I2Z A;  4R4Q A;  2B29 A;  2RBM A;  5I6W A;  5G3L F;  2R7D A;  1ESR A;  4RGM A;  2BQR A;  3Q1K A;  5BR8 H;  3W3A A;  4YY3 L;  1N9W A;  1GD7 A;  3ITP A;  4NKL A;  4F4Y A;  1QZH A;  5DLF A;  3E5N A;  2CKZ B;  2PW5 A;  1BCP C;  2XIG A;  2HVQ A;  1G8Z D;  4Q43 A;  1FL0 A;  1VQL A;  1XMO Q;  1EYD A;  4U7C A;  1PXU A;  2AKW B;  4ZCK A;  4MTE A;  3N6R A;  4IRK A;  5KFV A;  3VR4 A;  3N40 P;  1DON A;  1X65 A;  2EYF A;  2E2D C;  1Q1E A;  2Z6K A;  5ELD A;  4A3L H;  2I46 A;  5KFA A;  1PH1 A;  2EYO A;  2W8L A;  3J7A V;  5C4J H;  1GVP A;  3K59 A;  1BNZ A;  3KHL A;  1O7Y A;  2PVP A;  2ZT9 C;  2A68 C;  2YU9 A;  4UP9 A;  3R5X A;  1TAE A;  1VQ8 A;  1Y1W H;  1F2L A;  1GUS A;  2HIX A;  3CHB D;  4I55 F;  1CA5 A;  3M9O B;  1MSH A;  2PZU A;  4C1N K;  4RNM A;  2XCA A;  2R87 A;  4C3H H;  2IA6 A;  3T5J A;  4DV3 L;  4JI4 H;  5DG8 A;  4TV9 F;  2AGP A;  2F0K A;  5TSS A;  5JVG 3;  3JAM W;  2K03 A;  4R8U B;  1J9O A;  3S2D H;  4EGV A;  1N34 H;  4E6I A;  3SDZ A;  3MWY W;  3S1Q B;  1PA6 A;  5CMD A;  4LF5 L;  1B04 A;  2YYA A;  1FVI A;  1LT6 D;  1R4Q B;  4CJ1 B;  4QQB X;  3ETH A;  5KFX A;  4KHP Q;  2I87 A;  4J9R A;  5C8Y F;  2SNM A;  5KFQ A;  2C2E A;  4WJ4 A;  5DQG A;  1IBL H;  1Y14 B;  2BDO A;  5HGQ A;  2M00 A;  5IWA H;  2C35 B;  2C9O A;  1BVS A;  4X6A H;  3T5K A;  3IN5 A;  3CXC A;  3OW7 A;  4LF4 Q;  4RWS C;  3WO0 A;  4XQQ A;  3GTK A;  3RLN A;  4MV8 A;  1SCU B;  5KKN B;  1E22 A;  3A8K E;  3MXP A;  1VQN A;  1B6R A;  1WSC A;  1VKZ A;  4F88 A;  4DV6 L;  3J81 i;  3CP0 A;  1TY2 A;  4A3E B;  1QUQ A;  3GTQ H;  1VF7 A;  3H3V I;  2R7N A;  4EEY A;  2B39 A;  1YEZ A;  2QKI C;  3HOY B;  1UC8 A;  1F9P A;  2F0P A;  4I4T F;  2UUB H;  2IX0 A;  1PZI D;  3DWP A;  4EFE A;  2VL6 A;  2DPI A;  1YI2 A;  4A3F B;  4P74 A;  4O0A A;  3H3V H;  1VMP A;  4JI3 H;  1XNQ L;  4X64 Q;  2JA7 A;  3GIP A;  5EBC A;  1BF4 A;  1KDA A;  2ALZ A;  1ZEQ X;  2A73 B;  4J9S A;  3ERS X;  4A3M G;  4A3G H;  1CM9 A;  2L5T A;  3T13 A;  4K6D A;  1XJV A;  4LF4 L;  5M5W B;  4YHH H;  5GON F;  3VR3 A;  2JK8 A;  4C2M H;  4JI3 Q;  4QWC A;  4RFB A;  2HQE A;  3U50 C;  3CQZ B;  4UCS A;  4LAA A;  2MO0 A;  1LTT D;  1XPR A;  1PTO C;  4DKA C;  2W6O A;  1PYW D;  2EJF C;  5JJZ A;  2B2V C;  3SXH A;  1M7J A;  4C3J H;  3VYU A;  3J81 E;  3MXN A;  3GIQ A;  1N33 H;  5IGC A;  4WBN F;  1DJR D;  3BG3 A;  5C5M A;  4KJN A;  4CJ0 B;  1H9K A;  1HHV A;  3TII A;  1QZG A;  2W9B B;  4GKJ L;  1HPC A;  3TDQ A;  1HNW H;  1DYQ A;  2GN5 A;  1Y1W G;  5ELE A;  2HQL A;  2NTT A;  4JW0 A;  1BCP B;  2YZN A;  1BO0 A;  1KRT A;  1C48 A;  4ZHQ F;  4C3H G;  1EY0 A;  1ILP A;  4UPA A;  4B9X A;  5JJL A;  3LWU A;  3L7Z C;  2AQ1 B;  2VNU D;  1QNK A;  2QK4 A;  1W6K A;  4QWB A;  1U4R A;  1I7N A;  1EY5 A;  2Z8L A;  3MWM A;  4JBW A;  5M3M H;  5GAH C;  5CC4 A;  4JI4 L;  4B3R Q;  4DR2 H;  2RCF A;  1E4G T;  1SLJ A;  3SE0 A;  4DL4 A;  1B1Z A;  2WAC A;  1FJG Q;  5FPO A;  4JV0 A;  5C3E G;  4L5T A;  2MJ8 A;  3HBL A;  5HUR A;  3KLR A;  4V0B A;  5E3F A;  5IIF A;  4LFC H;  2F0G A;  5LL6 b;  1M4V A;  3RGZ A;  1B3A A;  4IZO A;  2EPB A;  3D6W A;  2JQO A;  2NWG A;  2D0O A;  1ENC A;  3K5O A;  5K5P A;  2FLN A;  1AN8 A;  2QW7 A;  3GTK H;  2R8K A;  2ZXR A;  4X3S A;  3MFY A;  1U9R A;  1PZK D;  3S17 B;  4HIM A;  1V1P B;  1Z2O X;  2PPB C;  2R8I A;  2UUC L;  3TQY A;  4MAM A;  3IFT A;  4L8J A;  2BE5 C;  2Z4H A;  2IBK A;  4Q8E A;  4DUZ H;  3V6J A;  1FNU A;  2F0F A;  3PCO B;  3T1Y Q;  3GTG H;  4O4L F;  3G7L A;  1LT3 D;  3EN2 A;  2R8H A;  1SN8 A;  4RAU C;  1FJG L;  4EBC A;  2YZM A;  3SHL A;  3KXY T;  3J80 i;  4LFA L;  2I0Q A;  2HGS A;  4Q8F A;  1N33 L;  1ET9 A;  1IBK L;  3GTO B;  2RVL A;  3NP8 A;  2A6H D;  2ZDH A;  1PTO H;  1K1S A;  1SJH D;  1B9N A;  1JOR A;  3C1F A;  3QOL A;  2QF7 A;  1WI5 A;  2XWJ B;  5EAY A;  2NU6 B;  5KFP A;  4C2M A;  4HJA A;  3FKI B;  3KJO A;  2BH2 A;  1WOC A;  5ELC A;  2VQE Q;  2UVU A;  5L1J A;  4BBS H;  3NHH A;  5DG7 A;  2HUG A;  2C2D A;  2VS1 A;  4ME6 A;  4GN5 A;  1Y1V B;  5IGD A;  3SVM A;  5IP9 G;  4DV2 Q;  3QOJ A;  3L4K A;  3S17 H;  4UP7 A;  4ZKC B;  2KCT A;  1JC7 A;  3T1Y L;  3BJU A;  3SEB A;  1XPO A;  3BZK A;  1PRT D;  1QVF A;  3BYT B;  3J81 W;  5K36 G;  2KCM A;  3TQ1 A;  4A3I B;  3U4Z A;  4RU9 A;  1K3R A;  2MNA A;  3JSN A;  5KT4 A;  2KCN A;  5COR A;  3GV5 B;  1IXR A;  1HZC A;  1VCI A;  4A3F H;  2VY3 A;  2I5H A;  1FGB D;  3QO2 A;  5HY6 A;  1PVO A;  1AW7 A;  3DMU A;  2EOT A;  3KAK A;  1EQR A;  4U67 3;  2R92 B;  1CI3 M;  1X3Q A;  3KLW A;  2CWP A;  1VQA A;  1TWH B;  2FK3 A;  2W57 A;  3EPG A;  4HN7 A;  1C8C A;  1GYF A;  4C3I G;  3C3L A;  1B53 A;  2DJF C;  3HOX H;  1BKB A;  4LFB L;  1JX4 A;  1STB A;  3WNZ A;  4QIW B;  2Z6B A;  4H7B A;  1BNC A;  1SND A;  1O80 A;  1K8O A;  1WFQ A;  3FDS A;  2MPM A;  1F9S A;  4JC0 A;  3RB6 A;  2R93 A;  3P7J A;  3BDC A;  3ULL A;  3OW2 A;  2E2I H;  2WYO A;  2XCP A;  2AHO B;  1JWU D;  5HBR B;  4IUQ A;  3TEH B;  1HH2 P;  4GKK H;  2AGQ A;  3UQ8 A;  1LO5 D;  3H0G A;  5CBE E;  3UDI A;  2FMM A;  2ZJQ A;  1MIU A;  2ZM6 H;  2QA4 A;  3QJY A;  2EE1 A;  4HSP A;  3MXG A;  3HOV G;  1O78 A;  1K28 A;  4QW8 A;  4ECS A;  4RNN A;  1GSO A;  3J80 L;  2YU9 B;  1A62 A;  1I4P A;  4C3J G;  5IOD A;  4OL7 A;  4JI6 H;  2IX1 A;  5CV6 A;  1QB5 D;  2NVY H;  3ERO A;  3PUZ A;  1EYZ A;  1HFN A;  1IKM A;  1Z2N X;  2JEF A;  4NXM L;  4ED3 A;  2K32 A;  4HJ8 A;  5J22 A;  4C2M B;  1FR3 A;  2ID0 A;  1OTC A;  2C00 A;  5KFT A;  5KG1 A;  4L1K A;  3GTG A;  4EVO A;  4ED8 A;  3M4O B;  1FKA H;  4YHH L;  1ZQ7 A;  4DU9 A;  2L11 A;  1LT4 D;  2JA6 A;  3I4N B;  1XMO H;  5J2U F;  2ATL A;  3GTJ B;  5KFH A;  5FD6 A;  4R4I A;  3BQ2 A;  4IPD A;  1ZHQ A;  1HA5 A;  3S1M H;  2PBZ A;  1VQ4 A;  4AQY H;  1TS4 A;  4RG1 A;  4KKT A;  5K2M A;  1KLU D;  4YAK B;  5C4J B;  3RB0 A;  3JAM E;  4JCV E;  1K3B C;  3FP9 A;  1IL8 A;  4RKB A;  5M3M G;  5DG9 A;  4LF7 H;  1M0T A;  3RUZ A;  3HXL A;  1QOH A;  2KVM A;  1SEI A;  3I4M H;  5H1S E;  2HCI A;  3TZU A;  3N52 A;  3EPI A;  1TWA B;  1OXU A;  1HNZ Q;  3MJF A;  2DN8 A;  2AWO A;  1EY8 A;  2K28 A;  2B2Y C;  3A74 A;  4EBD A;  2J9G A;  1VS0 A;  2XTI A;  1V1Q A;  3M9B A;  4ZRZ A;  1H95 A;  4ALP A;  4APM A;  3GQB A;  1D5X C;  1LV9 A;  3HG9 A;  3Q8S B;  5KG5 A;  4LSX A;  4S3S A;  5K36 H;  1C9O A;  1SYG A;  2B2T C;  2OQ0 A;  1DCZ A;  3TP8 A;  1JKJ B;  5KFI A;  2FJ2 A;  5KT2 A;  2EYL A;  1KBL A;  3W1G A;  1Q46 A;  2NVQ H;  4I50 F;  4LF6 H;  3FKI A;  1MGS A;  3V05 A;  1IHZ A;  3T1H Q;  4QF4 A;  5FLM G;  4DGZ A;  3OTO Q;  3S1Q H;  5FK9 C;  1S5D D;  5KNB A;  3TP7 A;  1PFB A;  2JA5 B;  4YR0 A;  2JA6 G;  1DM0 B;  4YWL A;  2OLS A;  3PO2 B;  3VYT A;  2QYZ A;  3TS2 A;  4J6H A;  4C3H B;  2D2C C;  4G7H C;  1HZB A;  1KIX A;  3I4N H;  3TRE A;  5LXT F;  4X62 Q;  2R93 H;  3CCJ A;  3PUX A;  2E2I A;  3OIQ A;  1VQ9 A;  2O5I C;  4ED7 A;  2XNA C;  5M9O A;  3S1R H;  1D5M C;  1BUV T;  1NBW A;  4DK0 A;  2NYZ D;  2TMP A;  3SK4 A;  3H0G H;  3TP5 A;  1KNE A;  2E5L L;  5BMV F;  1D2B A;  1TWH A;  5BPH A;  2W9A A;  3PW2 A;  1SE4 A;  2R92 A;  2WV6 D;  3G6Y A;  1KJQ A;  2PMZ B;  4AH6 A;  1N33 Q;  1JJC B;  3RV3 A;  1T5X D;  5JEA H;  2VPQ A;  2R8J A;  4LUO A;  1SAP A;  4N8F A;  3I56 A;  2ZDG A;  1N36 Q;  2R82 A;  3PIO A;  2DY7 A;  5C0X G;  2NB0 A;  3K7A H;  2M05 A;  5JVH 3;  1AP0 A;  1LAC A;  4A2B A;  2RDJ A;  5JJK A;  1S0N A;  1RKN A;  4UAI A;  4N8X 1;  1S68 A;  1JE5 A;  3R5F A;  3Q8R B;  2RA4 A;  1J6Q A;  2NZO A;  3GIM A;  2ASD A;  4FBU A;  5DEH A;  3OHB A;  2K52 A;  2E2I B;  4GNX C;  5JPM C;  1E4E A;  5FO9 B;  1I4R A;  4TQR A;  3CAM A;  4KN7 C;  2V4Q A;  3HB9 A;  2CH4 A;  2BQU A;  4NMZ A;  3GV6 A;  5C4H A;  4J15 A;  4F4X A;  2L12 A;  2DIK A;  5C0X I;  3Q22 A;  2LSS A;  3C1E A;  1RYR A;  1UAP A;  1EY7 A;  1TU2 B;  4C3I H;  4NLG A;  3W1B A;  1BGW A;  4RUC A;  4J9M A;  5T1G A;  2JA6 B;  4J1M A;  2E2J B;  3SGI A;  4OX9 H;  3D31 A;  4TRD A;  5C1O A;  2BQ3 A;  2Z0S A;  2F4V Q;  2R85 A;  3NBH A;  3K57 A;  5CR3 A;  2W8K A;  2AQ2 B;  4IFD I;  3JRW A;  1JDE A;  1DV2 A;  3TQT A;  3KBX A;  1XMQ L;  3OYY A;  5DGB A;  4GC7 A;  1W96 A;  3PO3 H;  3BA9 A;  4DV6 Q;  1PLF A;  2RGV A;  1Y8N B;  1NUC A;  1NNX A;  1UE1 A;  4J8Q A;  2JA5 G;  1TA8 A;  5EZY F;  3M4I A;  1T9H A;  2JEI A;  3AMU A;  1W6J A;  2MFI A;  5IE8 A;  3K5L A;  1BXT A;  4EGQ A;  4JI1 L;  4BBS B;  1EEF D;  1UUP A;  5KFM A;  2QGQ A;  5FLM H;  2NVY B;  3FKI H;  5KFE A;  2WB1 E;  2FHT A;  3T51 B;  3KUP A;  3DXJ C;  1UNN C;  2DUD A;  3FPP A;  3RBE A;  5LMU Q;  2NVT H;  2YTY A;  4I7A A;  1O75 A;  4FF4 A;  4MN3 A;  4ME3 A;  3GTO H;  5FD5 A;  2D9U A;  3NEM A;  3S9W A;  1GUT A;  2B2W A;  2ZXP A;  4BBR H;  2QEX A;  1XMQ Q;  2R6F A;  4NXM Q;  3T1H L;  3U9S A;  1SNQ A;  3RBD A;  2L0C A;  2FXQ A;  1KJ9 A;  4A3M H;  4A3G G;  1KJI A;  2XSC A;  4MHE A;  1I5F A;  4P73 A;  1JJ2 A;  5KFR A;  4UCV A;  3HP3 A;  4APV A;  4IO9 A;  4QMG A;  1TWH H;  2C2R A;  1AN7 A;  3J7A K;  1SNC A;  3H15 A;  3BQ1 A;  2R92 H;  5FOB B;  4MIU A;  1JWS D;  4M1U B;  2KOL A;  1U4P A;  1QE6 A;  4DR5 Q;  5LYJ F;  3T5H A;  5CGK A;  4J9Q A;  1IYJ B;  1TKW B;  1YBY A;  3PUW A;  3KFU A;  4MV3 A;  1ILQ A;  5KFB A;  4LNQ A;  1Y69 U;  5EPL A;  3HOV B;  3QZ8 A;  3ND9 A;  1AEX A;  1L2F A;  2K6A A;  2ZJR A;  1H9S A;  1SSO A;  1X54 A;  4IHJ F;  3VR2 A;  4EBE A;  1PTO F;  4O3O A;  5EWG A;  1Q8I A;  2JEA I;  1YHA A;  2LMC B;  2Y0S A;  2L9H A;  5I9P A;  3OUU A;  2CW0 C;  4WRD A;  3L3O C;  3RD4 A;  1E7Z A;  2JYO A;  5C44 B;  2VOB A;  2UUB L;  1EIG A;  5D1O A;  1AUX A;  2EVB A;  4JI5 H;  3S14 H;  1IBM L;  4KY7 A;  4QGU A;  2XWB B;  4YWM A;  3MC0 B;  1W3S A;  5J1Z A;  4DV0 H;  3PO3 G;  4LF4 H;  4NP5 A;  3HGB A;  3GTP A;  1SJE D;  1EWI A;  4QL5 A;  3VDY A;  2M2L A;  4XIG S;  5KFF A;  3CMA A;  4J9K A;  3K5M A;  1ULZ A;  1M90 C;  1BR9 A;  4HNU A;  1EUD B;  3PZP A;  4DR7 H;  3KHG A;  4PG3 A;  5KG0 A;  4A3B H;  5J2T F;  4Y8V B;  4RA8 A;  1NR2 A;  3M9M B;  1P16 A;  2D62 A;  2WFW A;  4DV1 L;  4ZUI A;  4LF9 L;  1VDZ A;  2R7Z B;  1BJT A;  4DK6 C;  2W6Z A;  3ZJY C;  1I4X A;  4NB3 A;  5M5W H;  3GTM B;  4IOC A;  2I80 A;  4PWQ A;  2F3W A;  1II3 A;  4GOP C;  4A3G B;  4FU0 A;  3GTK B;  4KD3 A;  3C0F B;  3T5L A;  3J7A F;  2ZM6 Q;  1KL9 A;  2XRS D;  2V58 A;  5BR8 L;  3NUC A;  4UFZ A;  3GTO A;  4DR4 H;  4TSS A;  3MXU A;  2VUM A;  1NAP A;  3I8Z A;  1O7L A;  1JWM D;  3VMM A;  4QY7 A;  4DV7 L;  1PYS B;  5IYB H;  2W6Q A;  1N48 A;  2E2H A;  1TQO A;  1I4H A;  4NDX A;  1EFI D;  2CW8 A;  3MWE A;  5IGF A;  2W7O A;  3G4S A;  2NN6 G;  1PH2 A;  4LFC L;  2GVB A;  4BA1 I;  4UY8 C;  2K33 A;  4IPC A;  4JYA L;  1D1K A;  1M6V A;  1DOK A;  3HKS A;  2UXC L;  1E24 A;  1FNV A;  1ZHS A;  5E4W C;  4A3D H;  1JCK B;  1FNW A;  3JC6 6;  4U68 A;  5CYU A;  4KHZ A;  4L5S A;  4CDD C;  4TQU S;  4TVA B;  3I12 A;  3NBI A;  1AZP A;  1JIC A;  1K8A C;  4K5X A;  3VPC A;  1EYA A;  4BWS C;  5D65 A;  1CKN A;  1NY4 A;  3HOZ H;  4OEM B;  5COY A;  4BY7 H;  3J81 L;  2N3S A;  3S2H H;  5EQ0 A;  2UXD L;  4CJ2 C;  2FJZ A;  4KK7 A;  2FK2 A;  2ZJT A;  4ZQI A;  3CD6 A;  3RLF A;  4DV7 H;  3EFX D;  3GLK A;  2AGO A;  1HRJ A;  1HNZ H;  1EHI A;  4C3J B;  3DM1 A;  4JI2 L;  1AE3 A;  1PRT C;  2DNC A;  5H80 A;  4NXN H;  2F4I A;  3NE5 B;  3CCE A;  4XYL B;  2IPK D;  1XNR Q;  2B2U C;  1SYX B;  3U58 A;  4CBV A;  3EA6 A;  1IBL L;  2XC9 A;  3BG5 A;  4FXK C;  2MUY A;  2X0S A;  3CCS A;  3I72 A;  4B3S L;  4DR2 L;  4CDC C;  4YB8 B;  4L5Q A;  1Z6H A;  1S9F A;  1VF5 C;  2WE6 A;  4H0L C;  1Y8P B;  2I5L X;  4XYQ A;  2JEB I;  3GTP H;  1X56 A;  4OO1 G;  1TWA A;  3LWE A;  3GO5 A;  5A2Q E;  4ETS A;  5M5X H;  3MXN B;  5J39 A;  3MA2 B;  3KLS A;  4DV2 H;  3EJI A;  3RTX A;  1B33 N;  2E2J H;  3HZX A;  3KBG A;  1CHP D;  1VQF A;  3D6C A;  3T1Y H;  2A6E D;  3MR6 A;  3BZD B;  3PR4 A;  5IP9 H;  3KHH A;  2EYJ A;  2Y0S E;  4DR1 H;  1ENA A;  2YTV A;  3CRK C;  1V4Y A;  1S5F D;  2Z9H A;  3Q24 A;  1TWG H;  4A3L G;  5LMN L;  5IGE A;  1NMG A;  3G6V A;  3EBE A;  1HNX Q;  3D8G A;  4JBM A;  4DL6 A;  5C0X J;  4DV2 L;  1O7I A;  2V4R A;  5I9O A;  2B63 H;  1SXT A;  1IYU A;  4ID6 A;  4NPS A;  5GAG C;  3GV7 B;  2W71 A;  1G6P A;  1EZ6 A;  3FVQ A;  1RL2 A;  3RZO H;  1UEB A;  2TSS A;  1ZXT A;  2UVV A;  5JEA J;  4QB4 A;  5IGG A;  1U5K A;  1HNZ L;  2VW9 A;  1KC8 C;  4HAE A;  4CKB A;  4UCO A;  3FRP B;  2KEN A;  3IL8 A;  5JH7 F;  1GOZ A;  2RHS B;  3H0G B;  3HOX G;  4K0K Q;  1R9T A;  4ED2 A;  3LP8 A;  2RSN A;  1PH8 A;  3NEL A;  2B2T A;  3W5O A;  4OHJ A;  1W93 A;  5KFC A;  1EL0 A;  2KJX A;  5EPJ A;  4N9T A;  1LTA D;  2GA4 B;  4CGY B;  4LSA A;  3KF6 A;  4JI7 H;  4Q44 A;  1S10 A;  2YL2 A;  4IRD A;  1Q8K A;  1HTP A;  1YNN D;  1TT2 A;  4LF7 Q;  3PW7 A;  4CHT B;  2EY5 A;  1M8A A;  5EKK A;  4A3J H;  1A3V A;  3PO2 H;  3N44 B;  2UVR A;  2PO4 A;  1XPU A;  4FYD A;  1CKN B;  3KLS X;  1YJN A;  1GUG A;  3RLO A;  1SFO H;  1PYB A;  2Z6K C;  3J81 j;  5KT6 A;  3V2T A;  2K01 A;  1XNR L;  3R2T A;  5I47 A;  5C3W A;  4LH6 A;  1E2W A;  5CV5 A;  1ENF A;  3CC7 A;  3TRZ A;  1C7Y A;  2A19 A;  3BAB A;  5KG3 A;  3PUY A;  4LFA Q;  2HDM A;  3Q23 A;  2WAQ A;  4LF5 H;  4PDB A;  1S97 A;  4KMU C;  3BDO A;  4XXE A;  3CU7 A;  3X3N A;  2XRQ D;  3GDE A;  3I4N G;  2K5Q A;  1RTN A;  2I5M X;  1ESF A;  2JA7 B;  1BDO A;  1EZ1 A;  1WD0 A;  1PFN A;  4RNO A;  3S1N B;  2F03 A;  1TWA H;  3NBH B;  3HOW G;  4Y52 H;  4M9U A;  1HQR D;  3V96 A;  1S03 G;  1S0O A;  4A3C G;  3H0G G;  1F77 A;  4XDX A;  1B50 A;  4JI1 Q;  1EU4 A;  2DJG C;  3V6H A;  3J80 W;  1TWC H;  4QWE A;  5M3F B;  2DGY A;  2GVA A;  2R7M A;  5C4X B;  5C0X H;  2I07 B;  1J8I A;  1JB7 A;  1I6V C;  3GTJ H;  4A75 A;  3UFX B;  4GNX B;  4DR1 L;  1IBM H;  4LF8 Q;  4J9P A;  3R23 A;  4XX0 B;  4HTH A;  1SRO A;  3V4S A;  1VQ6 A;  1LYL A;  3HOU G;  5FKA C;  2PCF B;  1Q7Y C;  1VAJ A;  3H4B A;  2PI2 E;  1A15 A;  1FD7 D;  4IUT A;  5LOV F;  3GII A;  5FLX L;  2F3I A;  2J4X A;  4KY6 A;  1RD9 D;  1HUN A;  5AJ3 Q;  1F2M A;  3WDN A;  1RJR A;  4FBT A;  3KF8 A;  2WKD A;  1EZ8 A;  3FPU B;  3WWV A;  1LTS D;  5KGU A;  2X69 A;  1D7Q A;  2K75 A;  2WAQ E;  4WFN 3;  4ECQ A;  5IWA L;  1H9M A;  2FFK B;  2PZW A;  1YNN C;  4ECY A;  4RGO S;  1SE2 A;  4BWG B;  4IJH A;  5LA6 F;  5KFW A;  1E2V A;  4AYB B;  1LTL A;  3F2D A;  5DQH A;  5C3E H;  4G7Z C;  4OEL B;  2F1M A;  2XGQ A;  4K8J A;  2XD4 A;  3HEJ A;  5KT3 A;  4B3T H;  4A3J G;  4GKJ H;  3M3Y B;  4LH7 A;  1N36 H;  2R7L A;  3F2B A;  1CHQ D;  3CKI B;  3CPF A;  2B2U A;  2VUM B;  3QG1 A;  2Q8I B;  2BA1 A;  1X3G A;  3OUZ A;  3CCV A;  1G51 A;  3GID A;  1EIY B;  1SFO A;  2NZH A;  5EWE A;  3P75 A;  1S40 A;  2E5L Q;  3DWQ A;  5A2Q W;  2JA8 H;  4J0M A;  4MNO A;  1J5E Q;  2UUB Q;  1XTD A;  1MJE A;  1YNJ D;  4KY5 A;  3DHQ A;  2Y0S B;  2B8G A;  3WOF A;  1NSN S;  1M1K C;  3PN1 A;  2F0U A;  2BOS A;  3VR5 A;  1NR4 A;  3P1H A;  3OPO A;  5IYC G;  1VMC A;  3W2D A;  2KSW A;  2KEC A;  1UWV A;  3LX0 A;  1EQQ A;  1R9T B;  4BY7 B;  4DV5 L;  4GS3 A;  1M0W A;  2F0E A;  1ASZ A;  2WIN B;  4FDB A;  4GLX A;  4JI6 Q;  4MV6 A;  2IP4 A;  4KHP L;  3OTO H;  5LMN Q;  2EDG A;  1QVG A;  1Y1V G;  1C4Q A;  5CV7 A;  4Y7N H;  2RHQ B;  1HNX L;  4A93 B;  2PQA A;  3PW5 A;  1CSQ A;  1ONL A;  1VQC A;  2WKC A;  4Q0F A;  1EY4 A;  3M4Q A;  2B2Y A;  3S15 H;  4GZY C;  5EBD A;  5LHY 1;  1L2Z A;  2IW3 A;  1TWC A;  3RZD H;  2R6G A;  4ULL A;  3SI8 A;  3NK9 A;  4RB1 A;  1XMQ H;  4DXF A;  1VQB A;  1Q81 C;  1SNM A;  1A2U A;  4ZAI A;  2UXC H;  1B2T A;  4GLV B;  1TR5 A;  2H4O A;  4PQX A;  3K58 A;  2K50 A;  3GTJ A;  5KFY A;  4JI0 H;  1V1P A;  3ONA B;  3FEW X;  4KHV A;  1JOK A;  2CQO A;  1GXD C;  2NVX A;  1PFM A;  1PZJ D;  3MAQ A;  5FJ8 H;  2EIF A;  4WD3 A;  1BCP D;  3L0O A;  2EXZ A;  4DLK A;  2X6L A;  3FMA A;  1CSP A;  1B7Y B;  1L0X B;  3IKJ A;  1CQV A;  4MTD A;  1VQK A;  1H9R A;  4GN3 B;  5E1F A;  4DV4 H;  2HHH H;  2UUC Q;  2SDF A;  4ZK9 B;  4YP3 A;  1JDB B;  1HFG A;  2A69 D;  3E5S A;  2VXW A;  3VYS A;  2R84 A;  3IRB A;  1WTX A;  4P72 A;  4A3B B;  3A8J E;  2VUM G;  2NBF A;  5IYD H;  2FB9 A;  2L1B A;  2EY2 A;  3B6Y A;  1D1I A;  3KTM A;  2EYH A;  3N6X A;  4IAJ A;  3HOW H;  2ASL A;  1XNR H;  2K7V A;  5C5J A;  3PF5 A;  1S72 A;  2K5D A;  2YCH A;  2UXB H;  3NWS A;  2L15 A;  4OX9 Q;  4E4T A;  4R8N A;  3E0J A;  4DR7 L;  2W6N A;  3VPB A;  4JI4 Q;  5F2D A;  3ER0 A;  2W6M A;  4X65 L;  2NVX B;  1CZW A;  2NZ1 D;  4LF8 H;  2Q8R E;  5KG7 A;  1TY0 A;  3OOC A;  4C5A A;  3I73 A;  2P0A A;  1HJP A;  3VYR A;  5KIX A;  1STA A;  1JIH A;  1PRT B;  3I4O A;  4HJ9 A;  1GM5 A;  3M7G A;  2MP1 A;  2NVY A;  5LP6 F;  3R93 A;  4TQS A;  2LY7 A;  5IYZ F;  1YNJ C;  4O3N A;  4ZUJ A;  1WTP A;  2UU9 Q;  4PMW A;  1EYC A;  1G6Z A;  4MTN A;  2A5H A;  3H94 A;  3S16 B;  1U4M A;  2WAQ B;  3WO1 A;  4A3K H;  3HOU H;  1RIP A;  2CH4 W;  1SNO A;  1JLL B;  2E2H B;  4HED A;  1I4G A;  2OWO A;  1T3N A;  1VQM A;  3KAJ A;  5KT7 A;  1XX8 A;  2V9W A;  4POG A;  3ZYY X;  2K4K A;  2WB1 A;  4ILW A;  1EFW A;  1ET6 A;  4DV0 Q;  1S5E D;  1SYF A;  3J80 E;  3GTL B;  1I6H H;  1PDQ A;  2SEB D;  1PHJ A;  4KLK A;  2K5V A;  4HCE A;  4ED1 A;  4DAY A;  5CV9 A;  1EUC B;  2RGR A;  2F0D A;  4QUC A;  1SR3 A;  1K83 H;  2OTJ A;  2NN6 I;  3V4Z A;  2D5D A;  3G6X A;  2FK1 A;  4X62 H;  4IOA A;  5CV8 A;  3DEO A;  4I7H A;  3UDF A;  3A54 A;  1G2S A;  1MD2 D;  1TII D;  5LMN W;  1Q86 C;  3RNU A;  3F8N A;  1A0I A;  2JA9 A;  3STB D;  4A3B G;  3A5Z B;  1STG A;  1ASY A;  2O4X A;  2NVT B;  4LFA H;  1STH A;  2K5H A;  4X66 Q;  4R8I A;  1A3U A;  1E0B A;  1QJO A;  1XXG A;  4DAY B;  4DR1 Q;  1HUM A;  3HKZ A;  4TUY F;  2ZTE A;  4B3M H;  3Q8D A;  3M4Y A;  4F4Z A;  3GTQ B;  1GKH A;  1GUW A;  4A3E H;  3T56 B;  2V4D A;  4YY3 Q;  1YZ6 A;  2FPG B;  2WB1 B;  5D3D A;  4A93 H;  1HZA A;  1HR0 H;  1FYC A;  4Y7N B;  1WCM G;  4C1N I;  1DXM A;  4DV5 H;  2M9V A;  4O1N A;  2R86 A;  2A1A A;  1ICW A;  3NWT A;  3PVX A;  1X3E A;  4G7O C;  3D3R A;  2ZM6 L;  4HJ7 A;  1ZET A;  5D1O B;  4B3S H;  2VQF L;  3DF7 A;  4N9P A;  4JI8 H;  2WB1 G;  2HCC A;  4IAL A;  4PZ8 A;  5BR8 Q;  3J7Y W;  3I91 A;  2F3V A;  3E0E A;  1HXY D;  4DNI A;  3TBI B;  5C4X H;  4GN4 B;  4HMJ A;  2NN6 H;  4JUZ A;  1TWC B;  4OWW B;  2QDB A;  5DM7 3;  1I3Q H;  2PN1 A;  4OIK A;  1O7Z A;  2KHS A;  3I4M G;  2YRW A;  5KG6 A;  4B3R H;  3E3X A;  2F0H A;  4LJZ C;  4ZOL F;  4JOI C;  5KG2 A;  4F87 A;  5M5Y H;  1TS5 A;  3OHX C;  1EOV A;  2EY6 A;  3GV3 A;  1Y1W B;  1TXY A;  2HT1 A;  1KAA A;  2PI2 A;  2EYP A;  1EQT A;  4JI5 L;  3T4A C;  4R7R A;  5FPR A;  5L1L A;  3M3Y H;  3LWB A;  1A3T A;  4ECW A;  3RF2 A;  2E76 C;  2RCN A;  1V51 A;  1MSG A;  3KDF B;  2NUA B;  2SNS A;  1GSA A;  5L9X A;  1VQE A;  4A3K G;  2GPW A;  4RGN A;  2KCC A;  1B6S A;  4RB2 C;  4ECX A;  4DR5 H;  4O4H F;  1CKO A;  4XTC S;  1OXX K;  4DV3 Q;  1WCM A;  1KLG D;  3RAX A;  5IP7 H;  2OXP A;  3NGD A;  3BU2 A;  4Z9C B;  1E2Z A;  3K3V A;  4DUZ Q;  2JJQ A;  3K81 C;  5F9N A;  5IT9 c;  5BN5 A;  3T16 A;  2IWH A;  1K83 A;  1IBL Q;  1OXS C;  3PSI A;  3A8I E;  1T94 A;  2ICE C;  2ICI A;  1F2Z A;  4DFA A;  3MWD A;  3GIL A;  4OWX B;  1JQY D;  2K5W A;  4O42 A;  5IT9 E;  4BA2 I;  4LUV A;  4AIM A;  4JV5 L;  1I94 L;  5KFN A;  3M7N A;  3AFP A;  2PMZ A;  3NPP A;  1NE3 A;  1IOW A;  4JK1 C;  2DWC A;  5EOY A;  2BDN A;  3CC2 A;  4BY1 B;  3ERQ A;  3CCR A;  1K0S A;  3OHA A;  1XNQ Q;  4IUU A;  1XMO L;  1PFS A;  2JA5 H;  1I3Q B;  5C3X A;  3CC4 A;  5D14 A;  3PW4 A;  3GIK A;  2RDF A;  2MQH A;  2RSO A;  5LMU H;  1WTH A;  4RHS A;  4A3E G;  1EIH A;  1HNX H;  5KFL A;  3PUV A;  1IZ6 A;  3FKI G;  1HZ9 A;  4GNX A;  1MHW C;  1V1O A;  3I70 A;  3PQI A;  1I94 H;  3S24 A;  1XNQ H;  4DUZ L;  3RZO B;  3RAQ A;  4UCU A;  1SMY C;  2Z1C A;  4X65 Q;  3PIP A;  3ULJ A;  1V43 A;  2WP8 J;  4DV7 Q;  4CC6 A;  3MTS A;  4DR6 Q;  3VA5 A;  3QFF A;  1TS3 A;  2DNE A;  4JBK A;  1UE5 A;  4X64 H;  3LGJ A;  1WTQ A;  1ZYR C;  2EYM A;  1K9M C;  1TWG B;  4R4C A;  4HQ6 A;  4O3P A;  4ECR A;  3GTM A;  4L5R C;  3BS1 A;  4YCU A;  1IBK H;  3PMF A;  3VA7 A;  1HR0 Q;  4UHV A;  5C4X G;  3GTL A;  2ZJP A;  3SR1 A;  2JE6 I;  3VR6 A;  4DR6 H;  2C28 A;  1BQQ T;  3V6K A;  1CK1 A;  1CQI B;  2B8F A;  1YHB A;  1ML0 D;  4XQJ A;  1MKH A;  2PMZ E;  4QUF A;  2JA7 G;  1I3Q A;  4YR3 A;  1J5E L;  3RV4 A;  3MFG A;  3HRZ C;  4RCO A;  3RFC A;  3NSW A;  1IBK Q;  2N88 A;  2RDI A;  4K0K L;  4R9W A;  5KX5 F;  1GO3 E;  1SYB A;  1WTW A;  2LXJ A;  1L1O B;  2G5D A;  2PQE A;  3S1M B;  5KRU A;  5A2Q L;  4TKO B;  4EQN A;  4IUP A;  3K3P A;  3R2I A;  2YYZ A;  4PNY A;  4RZQ A;  4G3I A;  5AJ3 L;  1V8Q A;  2FE3 A;  1U4L A;  1N34 L;  4LF7 L;  1EWH A;  4FXD A;  4YR2 A;  1QIL A;  2N49 A;  3MR3 A;  2OEO A;  5GAE C;  4R8U A;  4IR9 A;  1I6H B;  4DF7 A;  1KTK A;  1Q1B A;  4CDF C;  1VQ7 A;  1CFM A;  1G91 A;  1LTB D;  4DR5 L;  3ORQ A;  3GP7 A;  1WCM H;  2UUA L;  1YHQ A;  3TP6 A;  4HJ5 A;  2YU9 H;  2BE5 D;  2F0V A;  1Y1W A;  4ME5 A;  4H44 C;  2FLL A;  4POF A;  4ABN A;  5KND A;  4A93 G;  3NEN A;  5D1P A;  3OMG A;  4ZI7 F;  1SE3 A;  3PIP 3;  2BH8 A;  3BQ0 A;  4LFB H;  1NCV A;  1VBG A;  4YQW A;  4LFC Q;  2FP4 B;  4I7Z C;  5LMN H;  1Q12 A;  5C6A A;  2IMW P;  4K5W A;  3M9N B;  2F0T A;  2K04 A;  1EIF A;  4HR7 A;  2W9C A;  4LF6 L;  1X55 A;  3PW0 A;  3HOX B;  4LFB Q;  2RDG A;  2WII B;  5T1I A;  1LM0 A;  4KTA A;  1STN A;  3LNN A;  4KI0 A;  3H91 A;  2UUA H;  2JA5 A;  3NTH A;  2RQX A;  4IJL A;  1RHP A;  2XIW A;  5ELF A;  3MEF A;  4QJF A;  4ECU A;  2CWA A;  5M5X B;  4BY1 G;  3MEH A;  2K1B A;  2ZDQ A;  4OIJ A;  3I4L A;  3BA8 A;  5C4Z A;  1N8R C;  2WAQ G;  2F0Q A;  3GTQ A;  1EU3 A;  2Q2H A;  1I50 B;  3DWA A;  3U4V A;  4ODG A;  3N42 B;  1QVC A;  4FM9 A;  3PF4 A;  3C46 A;  4IR1 A;  3D0F A;  1EYG A;  1K83 B;  5IP7 G;  2CFM A;  3M4P A;  1W2B A;  4PMB A;  3GQC A;  3GTM H;  3RMH A;  5I6Y A;  3K8A A;  4RZR A;  1K1Q A;  4ZQ3 A;  2EY1 A;  1Y1V H;  5CV4 A;  1CA6 A;  3GTL H;  5CA0 F;  3A5U A;  2ENB A;  1RK5 A;  3U9T A;  1NMF A;  2RF4 A;  3CW2 C;  3K0Y A;  5IYB G;  1HR0 W;  4IUV A;  4DR6 L;  1D6E C;  4X3U A;  1JOQ A;  5KG4 A;  2E2H H;  1S5C D;  3FMC A;  3K7U C;  4JPB W;  1PV4 A;  2YTX A;  3WOE A;  1IBM Q;  2MGS A;  3CPW A;  3CME A;  3HOU B;  1UC9 A;  1WH2 A;  4G4K A;  3S16 H;  3KAL A;  1PTO B;  4NXM H;  5JVD F;  2PQA B;  3S2H B;  3KDF A;  2W7P A;  4HMI A;  5FO8 B;  3H20 A;  2YS7 A;  3HOZ B;  4JI0 L;  1GJX A;  2GPS A;  5CB4 F;  5E7N A;  1VQH A;  2FPI B;  3RZD B;  5L1K A;  1AH9 A;  5FO7 B;  4A3D B;  3UE0 A;  2R3Z A;  2V1C C;  1B70 B;  2JA8 G;  1OO9 B;  3S15 B;  4K14 A;  4DAM A;  5KYL A;  2FMC A;  4RCN A;  4JV5 Q;  2VB2 X;  1KJ8 A;  4JI2 H;  4Q45 A;  4HYK A;  4LF9 Q;  1MZB A;  2UXC Q;  5ISR A;  1E3P A;  5M3F G;  5KFK A;  4M8A A;  3AFQ A;  3D4D A;  4IUN A;  4DXG A;  4HNT A;  4K8I A;  4UP8 A;  3BVG A;  1XWE A;  3QWN A;  4RGT A;  5FLX W;  3RB4 A;  1DOM A;  3BVZ A;  3OMC A;  5JOB A;  1WJJ A;  4LK1 C;  5DLQ E;  4R4T A;  1PH7 A;  2OTL A;  4O2A F;  1VQJ A;  4YIJ A;  2BA0 A;  3HOW B;  4JV5 H;  2ASB A;  2DY8 A;  2A6E C;  4DR3 H;  1JB3 A;  4KKS A;  2F0O A;  1A9X A;  3JSL A;  4A4I A;  4RH6 A;  2F0S A;  2KQ3 A;  1GGO A;  1WCM B;  2UVW A;  3AYH B;  1BBW A;  2HVR A;  2KHJ A;  4JI6 L;  2F0N A;  4RAY A;  4X3T A;  4BS9 A;  2VQE L;  5I2X A;  1PH6 A;  4MA0 A;  3AU7 A;  1J5E H;  2IHE A;  4BBS G;  1D8L A;  1AUV A;  1KDB A;  2R7Z H;  2FKL A;  1TS2 A;  2HDL A;  3QIA A;  3P20 A;  4O3S A;  3NQT A;  1B4O A;  1Z47 A;  2IJ0 A;  3A56 A;  4KJO A;  4MV7 A;  3PIO 3;  4B3S Q;  1E4F T;  4A3D G;  1QCB D;  1IYV A;  3MHB A;  5GRO A;  5FLX c;  2KBN A;  1OXT A;  3D4R A;  4JI7 Q;  2OF1 A;  3UE1 A;  4KN4 C;  1Y8O B;  3ICE A;  4P71 A;  2UXB Q;  3K0X A;  1A2T A;  5C3E B;  4OON A;  3CCM A;  1KQS A;  2A74 C;  2UXD Q;  1TWG A;  3ORR A;  3TME A;  2W9C B;  4R4O A;  2CW7 A;  2XCL A;  3EYY A;  4HNV A;  4AQY Q;  1C3O A;  4V19 0;  2CQY A;  1E4E B;  1OWT A;  5BPF A;  2OQK A;  3SK5 A;  4DUY H;  4DV4 L;  2HHH L;  2Y0S G;  3S14 B;  1LLR D;  1DV1 A;  2B63 A;  4YY3 H;  1KJJ A;  1YJ9 A;  1Y1V A;  1GLV A;  2KA7 A;  3G48 A;  3N41 B;  1N34 Q;  1I6U A;  1A6X A;  1F9Q A;  4IPG A;  3H40 A;  1L1O C;  2H5X A;  1Z7T A;  1GHJ A;  2G9H D;  1R4P B;  1ICF B;  3QR8 A;  2VQF H;  4A76 A;  1EEI D;  3C2P A;  1V9P A;  4BXX H;  1R9T H;  2UUA Q;  2Z4I A;  4DUY L;  4OO1 I;  3EIV A;  3J7A 5;  4DV3 H;  4O2B F;  3SK8 A;  2R93 G;  3EQL C;  1Z9F A;  5KYI A;  3F1Z A;  5DGA A;  4PMC A;  1T36 A;  5ELB A;  1PK8 A;  1WR2 A;  1D5Z C;  1KDC A;  2AUJ D;  4LF8 L;  3TS0 A;  1CQF A;  1PMR A;  4DK1 A;  2DLN A;  4UCR A;  4J9O A;  1MBY A;  3Q2O A;  5DQI A;  2LXK A;  4ZYS A;  2X6G A;  5I2Y A;  4CDE C;  4C3I B;  4BY1 H;  5JEA G;  2VQE H;  1HNW L;  5KFU A;  4FS2 A;  4O2D A;  2F0W A;  1KAW A;  4JI0 Q;  3BDL A; 
#chains in the Genus database with same CATH homology
 1VQ8 A;  4B3T Q;  2IT1 A;  3J80 c;  1Y1W H;  1HJP A;  4APV A;  2HIX A;  1G29 1;  4IO9 A;  1TWH H;  3H15 A;  2R92 H;  1K0R A;  3KF6 B;  4C3H H;  3I4O A;  4HJ9 A;  1GM5 A;  4DV3 L;  1UE6 A;  4DR5 Q;  2B63 G;  1YJW A;  4DK3 C;  1IYJ B;  1YBY A;  3PUW A;  3KFU A;  2Q2I A;  3S2D H;  4LNQ A;  4NXN Q;  3CF5 A;  1TWF H;  4PMW A;  1PA6 A;  2UU9 Q;  1L2F A;  4LF5 L;  1FVI A;  1MJC A;  4MTN A;  5IY0 A;  4QQB X;  2ZJR A;  2Q2T A;  4KHP Q;  4A3K H;  3HOU H;  1RIP A;  4WJ4 A;  1KHI A;  1Y14 B;  5HGQ A;  4P73 A;  1X54 A;  2OWO A;  1VQM A;  2C35 B;  1BVS A;  3RR5 A;  4X6A H;  2JEA I;  1YHA A;  4POG A;  2K4K A;  3CXC A;  1EFW A;  4LF4 Q;  4YCW A;  4DV0 Q;  1I6H H;  3RLN A;  1PHJ A;  4KLK A;  2K5V A;  1X3F A;  1E22 A;  1VQN A;  3A0J A;  4DV6 L;  1E7Z A;  3J81 i;  4B3T L;  1SR3 A;  3CP0 A;  1K83 H;  2UUB L;  2OTJ A;  1QUQ A;  2NN6 I;  3GTQ H;  3H3V I;  2AWN A;  2HIV A;  1YEZ A;  4IOA A;  3S14 H;  3UDF A;  1IBM L;  4OWT B;  4GKK Q;  4QGU A;  4YWM A;  2IX0 A;  1W3S A;  5LMN W;  1HR0 L;  3PO3 G;  5M3F H;  1Q86 C;  1OXV A;  3RNU A;  1VQ6 A;  2VL6 A;  1A0I A;  2JA9 A;  1EWI A;  4QL5 A;  3STB D;  3A5Z B;  4DV5 Q;  1YI2 A;  4A3B G;  3VDY A;  5ELN A;  4XIG S;  1ASY A;  4P74 A;  4O0A A;  3H3V H;  2K5H A;  3CMA A;  1XNQ L;  2JA6 H;  4X64 Q;  4X66 Q;  4IFD J;  1JJG A;  1M90 C;  1VQ5 A;  3K80 C;  4DR1 Q;  4DAY B;  4PG3 A;  2ZTE A;  3Q8D A;  4A3B H;  1U0L A;  1GKH A;  4A3E H;  3ERS X;  1EUJ A;  1P16 A;  4YY3 Q;  4A3M G;  3DLL A;  1YZ6 A;  2D62 A;  2WFW A;  4A3G H;  4A93 H;  4WJ3 M;  1HZA A;  4EQ5 A;  4DUY Q;  4DV1 L;  1XJV A;  4LF4 L;  4LF9 L;  1WCM G;  2JK8 A;  4C2M H;  3KJP A;  4JI3 Q;  2EXD A;  4DK6 C;  3U50 C;  3ZJY C;  1YVC A;  1NJI C;  5M5W H;  4NB3 A;  2A1A A;  4BBR G;  2MO0 A;  4IOC A;  1X3E A;  1XPR A;  4DKA C;  4GOP C;  2ZM6 L;  2ATW A;  2R7Z G;  4HJ7 A;  3M85 A;  1QUQ B;  2ZM6 Q;  3PGZ A;  1KL9 A;  2VQF L;  4A3C H;  1VQI A;  4C3J H;  2WB1 G;  5BR8 L;  4PZ8 A;  5BR8 Q;  4GKK L;  3E0E A;  1FGU A;  2OCE A;  1E1O A;  4DNI A;  1S3O A;  5C4X H;  4GN4 B;  2R92 G;  1QZG A;  4GKJ L;  4QY7 A;  4DV7 L;  4OWW B;  2ZTC A;  1PH4 A;  2GN5 A;  2F52 A;  2AMC B;  1I3Q H;  4LF5 Q;  3I4M G;  1Y1W G;  1PYS B;  2HQL A;  1YNX A;  5IYB H;  1KRT A;  4JOI C;  1SRU A;  5M5Y H;  3G4S A;  2NN6 G;  4UPA A;  1EOV A;  1PH2 A;  4LFC L;  5JJL A;  2GVB A;  4BA1 I;  3L7Z C;  4YCV A;  1TXY A;  4IPC A;  4UY8 C;  4JYA L;  2HT1 A;  2VNU D;  2PI2 A;  4JI5 L;  3I7F A;  5IYC H;  3HKS A;  3M3Y H;  1E24 A;  2UXC L;  3DM3 A;  3FHW A;  4DV0 L;  3UDG A;  4JBW A;  4DR3 L;  3JC6 6;  5M3M H;  4A3D H;  5GAH C;  4KHZ A;  4JI4 L;  4L5S A;  4B3R Q;  4TQU S;  2RCN A;  1VQG A;  3KDF B;  4TVA B;  1HNW Q;  1SLJ A;  1K8A C;  1VQE A;  3J81 c;  4A3K G;  1FJG Q;  1CKN A;  5C44 G;  5C3E G;  1NY4 A;  3HOZ H;  3HKZ E;  4L5T A;  4BY7 H;  2N3S A;  3S2H H;  2UXD L;  1CKO A;  4XTC S;  3CD6 A;  3RLF A;  2JQO A;  1OXX K;  4DV3 Q;  2D0O A;  5IP7 H;  4BXX G;  3GD7 A;  3BU2 A;  4JI2 L;  4PZ6 A;  1AE3 A;  4DUZ Q;  4IFD G;  2JJQ A;  3GTK H;  1E1T A;  3K81 C;  1PH9 A;  3CCE A;  3PO2 G;  1XNR Q;  4A3I G;  5IT9 c;  3U58 A;  4IPH A;  4HIM A;  2ES2 A;  1SE8 A;  1IBL L;  3ULP A;  4H02 A;  1IBL Q;  1OXS C;  3PSI A;  2UUC L;  3TQY A;  2K5N A;  1K8G A;  4OWX B;  3CCS A;  4B3S L;  4JG2 A;  4DR2 L;  4BA2 I;  4LUV A;  4L5Q A;  4AIM A;  1I94 L;  4JV5 L;  3M7N A;  3AFP A;  3PCO B;  5ELO A;  1NE3 A;  3T1Y Q;  1I94 Q;  2N8N A;  3GTG H;  4JOI A;  2EQS A;  3UDX A;  2NVX H;  3JAM i;  2I5L X;  4EX5 A;  3CC2 A;  2JEB I;  1VQO A;  3EN2 A;  3CCR A;  3GTP H;  1XNQ Q;  1X56 A;  1DGS A;  1SN8 A;  1XMO L;  1FJG L;  1PFS A;  1C0A A;  2JA5 H;  1SMX A;  4OO1 G;  3GO5 A;  2K14 A;  3J80 i;  2I0Q A;  5M5X H;  3CC4 A;  4LFA L;  3MXN B;  1N33 L;  1IBK L;  4AQY L;  3HOY G;  2MQH A;  4A3E G;  1BBU A;  3PUV A;  4DV1 Q;  2E2J H;  1IZ6 A;  3FKI G;  1A8V A;  1HZ9 A;  4GNX A;  1VQF A;  3S24 A;  1WI5 A;  5EAY A;  1UE7 A;  4DUZ L;  5IP9 H;  4LUZ A;  4X65 Q;  3PIP A;  3ULJ A;  1V43 A;  2WP8 J;  4DV7 Q;  4GKJ Q;  4HJA A;  1A63 A;  2BH2 A;  2Y0S E;  3KJO A;  1N32 L;  1WOC A;  2YTV A;  3M4O H;  2VQE Q;  4DR6 Q;  4JBK A;  4BBS H;  1UE5 A;  4RMF A;  2VS1 A;  1TWG H;  3LGJ A;  4A3L G;  5LMN L;  4GN5 A;  1NMG A;  3F8T A;  3EBE A;  1HNX Q;  5IP9 G;  4DV2 Q;  1K9M C;  4JBM A;  4R4C A;  5C0X J;  3S17 H;  4DV2 L;  4UP7 A;  4L5R C;  1O7I A;  4YCU A;  4X62 L;  2B63 H;  1HR0 Q;  2KCT A;  4LW1 A;  3T1Y L;  2E8G A;  3BJU A;  4NPS A;  5C4X G;  5GAG C;  2ZJP A;  3STB C;  1XPO A;  2JE6 I;  3BZK A;  1QVF A;  1G6P A;  4MZ9 A;  1RL2 A;  2IHF A;  1UEB A;  4NXN L;  3RZO H;  5K36 G;  1YHB A;  2KCM A;  5LMU L;  3U4Z A;  1MKH A;  1K3R A;  2PMZ E;  2MNA A;  2JA7 G;  1J5E L;  1IXR A;  1HZC A;  1VCI A;  5JEA J;  4A3F H;  2VY3 A;  1U5K A;  1HNZ L;  1CUK A;  2I5H A;  2VW9 A;  1AE2 A;  1KC8 C;  1IBK Q;  5HY6 A;  4JYA Q;  2KEN A;  1PVO A;  4K0K L;  2N78 A;  1GO3 E;  2RHS B;  3HOX G;  4K0K Q;  2LXJ A;  5IWA Q;  1L1O B;  1H95 A;  1EQR A;  4JBJ A;  5FJ8 G;  3NEL A;  1K73 C;  3W5O A;  1PH8 A;  4DR7 Q;  3KLW A;  2CWP A;  1VQA A;  2YYZ A;  5AJ3 L;  3BZC A;  3KF6 A;  5C44 H;  3HOX H;  1BKB A;  4B3M Q;  4LFB L;  1N34 L;  1Q8K A;  4LF7 L;  2N49 A;  3HFZ B;  4LF7 Q;  1WFQ A;  5GAE C;  2VQF Q;  4JC0 A;  4AYB E;  4A3J H;  1Q1B A;  1VQ7 A;  3PO2 H;  3ULL A;  4YWK A;  3OW2 A;  2IY5 B;  2E2I H;  1XPU A;  4DR5 L;  1CKN B;  1YJN A;  2AHO B;  1WCM H;  2UUA L;  3RLO A;  1YHQ A;  1SFO H;  1PYB A;  2Z6K C;  1HH2 P;  3TEH B;  3J81 j;  3F2C A;  4HJ5 A;  2YU9 H;  4DR3 Q;  4DR4 Q;  1XNR L;  3UDI A;  4A3I H;  1PH3 A;  1MIU A;  2ZJQ A;  4POF A;  2QA4 A;  3HOV G;  4A93 G;  3CC7 A;  3NEN A;  3TRZ A;  1C7Y A;  4P75 A;  1X6O A;  2A19 A;  2BH8 A;  3PUY A;  4LFA Q;  1A62 A;  4LFC Q;  2IX1 A;  1YIT A;  3E9H A;  2NVY H;  3PUZ A;  1Q12 A;  4LWC A;  4NXM L;  2PNH A;  4DV4 Q;  2HHH Q;  4HJ8 A;  1EIF A;  4B3R L;  2ID0 A;  3GDE A;  1OTC A;  4LF6 L;  1X55 A;  3I4N G;  4LF6 Q;  3J7Z C;  1X9N A;  4YHH Q;  2I5M X;  4LFB Q;  4YHH L;  1LM0 A;  4KI0 A;  3HOW G;  1TWA H;  3NBH B;  4Y52 H;  4R4I A;  4IPD A;  3S1M H;  1N36 L;  1VQ4 A;  1I50 H;  3H0G G;  4IJL A;  4RG1 A;  4A3C G;  4JI1 Q;  4JCV E;  3FP9 A;  4DR2 Q;  3MEF A;  4QJF A;  4GOP A;  5M3M G;  4A3F G;  1TWC H;  2CWA A;  4BY1 G;  2DGY A;  2GVA A;  2YV5 A;  3KYH C;  4DR4 L;  1L0W A;  1N8R C;  1IL2 A;  2WAQ G;  4PZ7 A;  2Q2H A;  3I4M H;  5H1S E;  3U4V A;  1QVC A;  4HID A;  3PF4 A;  4X64 L;  1JB7 A;  3GTJ H;  4A75 A;  1OXU A;  1HNZ Q;  3D0F A;  4GNX B;  2AWO A;  4DR1 L;  4LF8 Q;  3A74 A;  1JT8 A;  1EYG A;  1SRO A;  1VS0 A;  2XTI A;  1V1Q A;  1LYL A;  2CFM A;  3M4P A;  3M9B A;  5IP7 G;  4ALP A;  1W2B A;  1Q7Y C;  3GTM H;  3HOU G;  3K8A A;  2PI2 E;  3CQZ H;  2F3I A;  1Y1V H;  2B3G A;  3GTL H;  4JI3 L;  2A8V A;  3A5U A;  1C9O A;  5AJ3 Q;  1NMF A;  2RF4 A;  2OQ0 A;  3CW2 C;  5IYB G;  2CCZ A;  1HR0 W;  1N32 Q;  4DR6 L;  4QIW E;  3WWV A;  3JAM c;  2F4V L;  1D7Q A;  2E2H H;  2K75 A;  2WAQ E;  3RN2 A;  3W1G A;  1Q46 A;  3K7U C;  3L2P A;  1PV4 A;  2YTX A;  1IBM Q;  2NVQ H;  3CPW A;  3CME A;  5IWA L;  3S16 H;  3T1H Q;  3OTO L;  4GOP B;  2KHI A;  5FLM G;  4HIO A;  3HOV H;  3OTO Q;  3G6E A;  3S1Q H;  1KRS A;  2PQA B;  1NTG A;  3KDF A;  4JI0 L;  4IJH A;  3RN5 A;  3F2D A;  1LTL A;  2JA6 G;  5E7N A;  4YWL A;  1VQH A;  4OXP A;  5C3E H;  1L1O A;  4X66 L;  3TS2 A;  1HZB A;  3HOY H;  1KIX A;  1AH9 A;  3UE0 A;  4A3J G;  2V1C C;  3I4N H;  1B70 B;  1PH5 A;  2VUM H;  2JA8 G;  1LUZ A;  3TRE A;  3F2B A;  4X62 Q;  5IYD G;  2R93 H;  4DAM A;  3CPF A;  4JV5 Q;  3CCJ A;  3PUX A;  4LF9 Q;  2BA1 A;  1X3G A;  1VQ9 A;  2UXC Q;  1E3P A;  5M3F G;  3CCV A;  1G51 A;  1YIJ A;  1Q82 C;  1KD1 C;  3S1R H;  1EIY B;  2NZH A;  3AFQ A;  4JI8 L;  1NBW A;  1S40 A;  2E5L Q;  4UP8 A;  2JA8 H;  3H0G H;  1JMC A;  2E5L L;  4MNO A;  1J5E Q;  2Q2U A;  1WJJ A;  3KF8 B;  2UUB Q;  5DLQ E;  4R4T A;  1XTD A;  1PH7 A;  1MJE A;  2OTL A;  1B8A A;  4AH6 A;  1VQJ A;  1N33 Q;  1JJC B;  2BA0 A;  1CKM A;  3G71 A;  1M1K C;  4LUO A;  2ASB A;  3I56 A;  1N36 Q;  2MO1 A;  3PIO A;  5C0X G;  1VQP A;  3K7A H;  4R1J A;  4JI2 Q;  5GAD C;  4GLA C;  5IYC G;  5JJK A;  3CCL A;  4A4I A;  1UWV A;  1JE5 A;  1EQQ A;  2ZTD A;  3CCQ A;  4GS3 A;  4DV5 L;  1ASZ A;  1J6Q A;  1BBW A;  2NZO A;  3AYH B;  2UU9 L;  2KHJ A;  4JI6 L;  4FDB A;  2K52 A;  3E9I A;  2VQE L;  4GNX C;  4GLX A;  1PH6 A;  4JI6 Q;  1KXL A;  2IHE A;  4BBS G;  1D8L A;  4KHP L;  3HOZ G;  5LMN Q;  2R7Z H;  2R7F A;  3CAM A;  2XGT A;  3HKZ G;  1QVG A;  4BY7 G;  1Y1V G;  4Y7N H;  1HNX L;  2RHQ B;  1Z47 A;  2PQA A;  1CSQ A;  4J15 A;  1VQC A;  4AYB G;  4B3S Q;  5J3B A;  4JI5 Q;  3M4Q A;  3S15 H;  4A3D G;  5C0X I;  5GRO A;  3KOJ A;  2D0P A;  2KBN A;  2LSS A;  5FLX c;  1OXT A;  4HIK A;  4JI7 Q;  3UE1 A;  4JI8 Q;  4JI7 L;  4C3I H;  2UXB L;  3W1B A;  3RZD H;  4P71 A;  3ICE A;  2UXB Q;  2R6G A;  3K0X A;  4OON A;  3CCM A;  3SGI A;  3D31 A;  2ALY B;  1VQB A;  1Q81 C;  3I55 A;  1VQD A;  1KQS A;  2Z0S A;  2F4V Q;  2UXD Q;  4GLV B;  4DPG A;  4R4O A;  2K50 A;  3AEV A;  4AQY Q;  3CCU A;  4IFD I;  5GQO A;  3AQQ A;  2OQK A;  2CQO A;  1XMQ L;  3OYY A;  4DV4 L;  2VZA A;  2Y0S G;  2HHH L;  4OX9 L;  3PO3 H;  5FJ8 H;  2EIF A;  3S1N H;  3L0O A;  1WYD A;  1P8L A;  3PV0 A;  1YJ9 A;  1CSP A;  4DV6 Q;  1B7Y B;  5JJI A;  2JA7 H;  4B3M L;  1UE1 A;  3G48 A;  1N34 Q;  3I2Z A;  4GN3 B;  1VQK A;  2JA5 G;  4R4Q A;  2B29 A;  4IPG A;  2UUC Q;  1T9H A;  1L1O C;  2H5X A;  2MFI A;  5IE8 A;  2R7D A;  4JI1 L;  2QGQ A;  5FLM H;  4A76 A;  4YY3 L;  3FKI H;  1N9W A;  1GD7 A;  4BXX H;  1V9P A;  2WB1 E;  3IRB A;  1R9T H;  1QZH A;  4DUY L;  2CKZ B;  4P72 A;  2UUA Q;  3EIV A;  3J7A 5;  4OO1 I;  2VUM G;  1FL0 A;  2DUD A;  2R93 G;  1VQL A;  5IYD H;  1XMO Q;  2AKW B;  3B6Y A;  1Z9F A;  3F1Z A;  5LMU Q;  2NVT H;  2YTY A;  3HOW H;  1X65 A;  4ME3 A;  1Q1E A;  2Z6K A;  3GTO H;  4A3L H;  3PF5 A;  4LF8 L;  3TS0 A;  1S72 A;  3NEM A;  1PH1 A;  4BBR H;  1GVP A;  5C4J H;  2QEX A;  2L15 A;  2LXK A;  1XMQ Q;  4NXM Q;  4OX9 Q;  3T1H L;  4DR7 L;  4JI4 Q;  4BY1 H;  3ER0 A;  5JEA G;  4X65 L;  1HNW L;  2FXQ A;  4A3M H;  4A3G G;  4O2D A;  4UP9 A;  1KAW A;  4JI0 Q;  1I5F A;  1JJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...