3FKIG

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fkiG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3fkiG01
4A3FH 3CCEA 4QQBX 3H3VI 4BBRH 1HNZL 4O0AA 5JEAJ 5IYCG 4DPGA 1JMCA 4BBSG 2E8GA 1N8RC 4X66Q 1YHAA 5GROA 4DK3C 4A3KG 2AHOB 2R7ZH 2R7FA 1V1QA 2OCEA 2RCNA 1NJIC 3CAMA 2Q2TA 1PVOA 1I5FA 5GQOA 1XMOQ 2LXKA 4K0KQ 3VDYA 1FJGL 1HNXL 3CMAA 3GTLH 4AH6A 4B3TQ 2QEXA 1N36L 1X55A 1PH3A 1KL9A 4MNOA 5ELOA 4DUYL 1EUJA 4HJ9A 4POGA 1QZGA 4X62L 3ICEA 1I6HH 5HGQA 4YWLA 1HNWQ 1HNZQ 3CCUA 2E2JH 1XNQL 1K73C 1TWAH 4B3RL 4HIKA 3PO3H 1A8VA 5IY0A 3J81i 4HIDA 4JI0L 1QUQA 2YU9H 3K7AH 4DV6L 3CCRA 4DR1L 1HZBA 1OXSC 2LXJA 3I56A 4GNXA 1P16A 2WP8J 4PG3A 3CPFA 1K0RA 3NENA 1HNXQ 1FJGQ 4BY7G 1VQNA 1X3FA 2N49A 3HOXG 4DKAC 4LFAL 4X64L 5JJIA 1GO3E 4DV2Q 3HOZH 3F8TA 4OWXB 1WCMH 3IRBA 3PUZA 4BA1I 4X62Q 1JB7A 3H3VH 5FLMH 3CPWA 1YITA 2HT1A 2Y0SE 1KRSA 1VQDA 4JBWA 3RZOH 4A3JG 1C0AA 1D8LA 1Z47A 1LYLA 4C3JH 4DV4L 1Y1WH 1G6PA 3ULJA 4JI0Q 1YJ9A 4DV6Q 1B70B 1QUQB 4DV5Q 1VQFA 5JJLA 3PUVA 5IP7H 3B6YA 5LMUQ 4GNXB 2NVXH 4LNQA 1MJCA 2WAQE 1V9PA 2ATWA 1YI2A 3GO5A 3DLLA 3KF6A 4X64Q 3UDGA 4A3IH 5FLXc 2R92G 4GOPC 1QVFA 1EFWA 3GTQH 1XJVA 1I3QH 2IT1A 4JI1L 1EIYB 4GKKQ 1SFOH 2RHQB 1EQRA 1N33L 3CP0A 3KYHC 3OTOQ 4A3CH 5AJ3L 4HJ8A 4Y52H 4A93H 1YVCA 4L5TA 4YHHL 3I55A 4A3DH 1HH2P 2PQAA 4LUVA 1TWCH 4OO1G 1PH1A 4EX5A 2VUMH 1HR0W 3GD7A 3E9IA 2ZM6L 1Z9FA 3H15A 1VQPA 2JA5G 3W5OA 4IPCA 4JI1Q 4LFCL 1IBML 1CKOA 5IYDG 4NXMQ 3PIOA 3S17H 1Q8KA 3U4VA 3I2ZA 2KENA 3BJUA 2IHFA 5AJ3Q 2V1CC 4L5RC 3SGIA 1VS0A 2EIFA 2QA4A 1JT8A 4R1JA 3LGJA 2CFMA 1V43A 2OQKA 2PQAB 4JI8L 1FGUA 4A3JH 4JBKA 3I4MH 4DV1L 1BKBA 3KDFA 2ZJQA 2UUBL 4ME3A 1I50H 1JE5A 1IBMQ 2FXQA 3M4PA 3MEFA 4J15A 4IOCA 1NMGA 1VQLA 4LFCQ 4O2DA 4BXXG 5IYBG 3CCQA 1KD1C 4RG1A 1VQ9A 2OQ0A 4DAMA 1PYSB 4HJ5A 1Q81C 1VQ6A 3UDFA 2CKZB 1E7ZA 2BH8A 1CUKA 5C44H 2ZTDA 4P73A 4YCUA 5LMNL 1PH5A 3PSIA 1J5EQ 3CCMA 1A63A 3OYYA 4LUOA 4P74A 5GAGC 1Y1VG 4QJFA 4DV3Q 1WYDA 1W2BA 4JI8Q 5FJ8H 1S3OA 1LM0A 1X65A 3K8AA 2VNUD 3HOVG 4IFDG 2I5MX 1UWVA 1JJ2A 4YCVA 4LF6L 3PF4A 2UXCL 2N78A 3S24A 4X66L 3KJPA 4A3GG 1N34Q 1JJGA 1LUZA 1SROA 4RMFA 3K7UC 2OWOA 1E1TA 1OXUA 2DGYA 4QY7A 2UUCQ 1AE2A 1C9OA 2JA5H 4L5SA 4B3TL 1L2FA 1YEZA 1IXRA 4UY8C 1Q7YC 2MQHA 2XTIA 4P72A 1C7YA 2F3IA 5BR8Q 1RIPA 2BA0A 3PCOB 1VQIA 1YBYA 1HNWL 3M9BA 4IPDA 5M5XH 2UUAQ 3ULLA 2F4VQ 1SN8A 4LF6Q 2GVBA 2UXCQ 1IZ6A 4R4IA 3CCLA 4X6AH 2PI2E 1YJNA 3FKIH 4MTNA 3CC7A 1EYGA 1NY4A 2ID0A 3H0GH 4DV7L 3W1GA 4DNIA 2N8NA 1PHJA 4DR7Q 1HZCA 4LWCA 3RLFA 3TREA 4POFA 5ELNA 1OXXK 4A75A 4DV2L 1M90C 3M3YH 2UXDQ 5K36G 3S14H 1G291 1PH9A 3TRZA 5M5WH 3AYHB 4BY1H 2IX0A 4GN4B 2JA7G 4R4QA 1HZAA 4GNXC 3PO2G 3EN2A 2CWAA 4QGUA 1YNXA 5E7NA 1YZ6A 1SLJA 3CCSA 2B63G 3UE1A 4DV5L 4DV7Q 2IHEA 2MO1A 3S1RH 5C0XG 5M3MH 5LMUL 1CSPA 1VQCA 1UEBA 1PV4A 4A3BG 3STBD 1B7YB 1VQMA 5HY6A 2B3GA 2YTXA 2LSSA 1A62A 1L1OB 2ZTEA 3M4OH 2JA6H 4GKKL 3AFQA 2A1AA 3J80c 3HOUH 4A3MG 3D31A 1KXLA 3CC2A 3OTOL 3W1BA 2HHHQ 4YY3Q 4JYAQ 2KCMA 3F1ZA 3STBC 5C4XH 2E5LL 1K3RA 5M3FG 4JI2L 3L0OA 2B29A 2VL6A 3GDEA 1MKHA 5H1SE 4GLXA 4LF5Q 4A3LG 5IYCH 2JA8G 2EXDA 4NXNQ 4BBSH 3D0FA 4A3KH 4YCWA 4DR2L 1E24A 2CWPA 4C3HH 3L2PA 3S2DH 4UP9A 1S72A 4NXML 3PUWA 3UE0A 2ZJPA 1PFSA 3GTMH 3ZJYC 3J7A5 4JI4Q 2EQSA 2K52A 2VZAA 1VQ5A 1HR0Q 4B3MQ 1G51A 3HKZG 2VQEQ 3GTGH 3HOYG 1CKMA 2E5LQ 1H95A 3HOWG 4A4IA 2ZTCA 4JI2Q 3RZDH 2K4KA 2KBNA 1WJJA 1FL0A 2MO0A 4JOIA 3MXNB 4HJ7A 2Q2IA 1XPOA 2R93G 4DR3L 1NTGA 1SE8A 3CMEA 3M85A 3K0XA 4IJHA 4DR2Q 1NMFA 1Y14B 2HIXA 4DAYB 4BY7H 4JI5L 4JI3L 1BVSA 4OO1I 3S1QH 1GM5A 3HOXH 2ES2A 1CKNB 4OX9L 1KIXA 3CD6A 1J5EL 3UDXA 2CCZA 2YTVA 3BU2A 4A3EG 5IP9G 1UE1A 1KQSA 2WFWA 1EWIA 4DV3L 2NZHA 5EAYA 1WFQA 3RR5A 2UU9L 1QZHA 3KOJA 4JC0A 3F2DA 3NELA 4DR3Q 4LW1A 4R4OA 4DV0Q 3S2HH 4DR4Q 3K81C 1N34L 4KHZA 5C3EG 4JI3Q 4JI5Q 2NVTH 1OXVA 2R92H 1E3PA 1YHBA 2UUCL 2Z6KA 4JBMA 4PZ7A 3J81c 4GOPB 4A3FG 5M5YH 1QVCA 1YIJA 1PH7A 4BBRG 3AEVA 4IFDJ 1OXTA 1GKHA 4AYBG 2DUDA 2AWOA 1HZ9A 3CW2C 2NVYH 4IPGA 5BR8L 3AQQA 2UU9Q 5IE8A 1OTCA 2R7ZG 1U0LA 3A0JA 3WWVA 2UUAL 2F4VL 2NN6G 3J80i 3CXCA 1IBKQ 3U50C 4KLKA 3E0EA 4JV5L 1VQGA 3I4NG 4GS3A 2VW9A 1Q82C 1ASYA 4IFDI 3T1YQ 4DR7L 4HIMA 5J3BA 3UDIA 2VS1A 3KF8B 1XPRA 1X56A 3GTOH 1WOCA 1L0WA 2ZJRA 4GKJL 5IYDH 3FP9A 4JI6L 2UXDL 3TEHB 3G6EA 4LUZA 4JCVE 2Y0SG 2MFIA 4H02A 3PO3G 2KHJA 3KLWA 2JK8A 4KI0A 1VQ8A 4APVA 1IBLQ 5JJKA 2K75A 4Y7NH 4JV5Q 1DGSA 2AKWB 2PNHA 2WAQG 2K14A 3HFZB 5IWAQ 3HOZG 1WCMG 3T1HQ 3PF5A 1AE3A 1X54A 5FLMG 2MNAA 3I4OA 4GKJQ 4BXXH 5GAEC 4JI6Q 5IYBH 2D0OA 1L1OA 3RLNA 3EIVA 2D0PA 4B3SQ 3PUYA 1PH8A 1VQEA 3EBEA 1Y1WG 1I94L 1VQAA 4GLVB 4ALPA 1JJCB 1HJPA 2HHHL 1IL2A 4YY3L 4XIGS 5IP7G 4JYAL 4IO9A 5LMNW 1Y1VH 2JJQA 4DR6Q 5C0XJ 2UXBQ 4WJ3M 1KC8C 1X6OA 2AWNA 2GN5A 1X9NA 1ASZA 3E9HA 3HOVH 4JBJA 4A3IG 3GTKH 1GVPA 5JEAG 4LF8Q 3JAMc 4LF5L 4UP7A 2CQOA 2ALYB 4LF4Q 1SRUA 4NXNL 4LFBL 1XTDA 4QIWE 2WB1G 4TVAB 3GTPH 4A3GH 4LF7Q 1BBWA 3BZKA 3F2CA 4A3CG 2AMCB 1VQOA 3I4NH 3RN5A 1PH6A 4A93G 4GN3B 1I94Q 1E1OA 5C0XI 3RN2A 4OXPA 4IOAA 2NZOA 4JI4L 4MZ9A 4AYBE 3ERSX 4A3DG 4R4CA 4GN5A 4C2MH 2VQEL 1HR0L 4B3ML 2K5HA 2N3SA 1XPUA 5DLQE 1KHIA 3Q8DA 3F2BA 4LF9L 1VQJA 2VUMG 1EQQA 4PMWA 1X3GA 1SR3A 3NEMA 3A5UA 1NBWA 1K8AC 1Q46A 4LFBQ 3A74A 2OTJA 2BA1A 3DM3A 2A19A 3I7FA 5GADC 3PGZA 2L15A 2I0QA 1N36Q 3S1MH 2H5XA 2JEBI 3CF5A 1PA6A 4NB3A 1KRTA 2I5HA 1J6QA 4DUYQ 4OX9Q 2IX1A 3HKSA 3CCJA 1EOVA 3JC66 4EQ5A 1CKNA 4FDBA 4IJLA 2OTLA 2GVAA 3A5ZB 3S15H 1Q1EA 4JOIC 4UP8A 1YHQA 1XNQQ 4LF9Q 3I4MG 4B3RQ 1K83H 1CSQA 3KFUA 2IY5B 2JA9A 4YWMA 3GTJH 2BH2A 1Q86C 4DR1Q 1B8AA 4X65L 2JA7H 3PO2H 2RHSB 2Q2HA 1UE6A 3NBHB 2R6GA 4KHPL 4LFAQ 2B63H 1VQKA 1M1KC 1AH9A 4OONA 4TQUS 4DV0L 3S1NH 5C44G 1Q1BA 1E22A 4L5QA 4DR4L 4C3IH 4YWKA 4A3BH 1VQBA 5IT9c 1VQHA 3ULPA 1GD7A 1R9TH 5FJ8G 4GOPA 4DV4Q 1N32L 2A8VA 3J7ZC 1XNRL 2K50A 3J81j 2RF4A 4A3MH 2F52A 4X65Q 1U5KA 1VQ4A 1LTLA 1S40A 2I5LX 3S16H 4WJ4A 2E2IH 4KHPQ 4JG2A 3RLOA 5M3FH 4PZ6A 5GAHC 2Z6KC 1IBKL 4DR5L 1FVIA 1TXYA 3KF6B 2VQFL 1EIFA 2JE6I 2JQOA 2WB1E 4A3LH 4XTCS 2JA8H 3TQYA 4R4TA 3OW2A 3PV0A 1A0IA 3PIPA 4IPHA 1MJEA 1N33Q 4NPSA 3TS2A 4DUZL 1Q12A 3T1YL 3CCVA 1N32Q 4AQYL 2K5VA 1WI5A 3JAMi 4JI7L 4AIMA 4DK6C 4HJAA 1XNRQ 3U4ZA 1KAWA 2YYZA 1UE5A 4YHHQ 2JEAI 3CC4A 3HOYH 1T9HA 2R7DA 3FKIG 1TWFH 3FHWA 4OWTB 3H0GG 2E2HH 3HOWH 2HQLA 2ZM6Q 4DR5Q 4P71A 2VQFQ 3K80C 1P8LA 2KCTA 1IBLL 2PMZE 3AFPA 1UE7A 2KHIA 1QVGA 3G48A 1MIUA 1TWGH 1W3SA 5IWAL 2R93H 4DUZQ 3G4SA 3KJOA 4OWWB 2D62A 2NN6I 4AQYQ 1SMXA 4BY1G 3T1HL 4JI7Q 4QL5A 3HKZE 4A76A 2NVQH 1X3EA 2ASBA 4B3SL 4P75A 1VCIA 1XMQL 3M7NA 5C4JH 1YJWA 1PH2A 1IYJB 4HIOA 1K9MC 1N9WA 1O7IA 5IP9H 4DV1Q 3RNUA 4A3EH 4GLAC 5M3MG 3L7ZC 1VQ7A 2UUBQ 2UXBL 4DR6L 3KDFB 1TWHH 2XGTA 2YV5A 3BZCA 4PZ8A 2C35B 2K5NA 4BA2I 3U58A 4LF8L 1L1OC 1PYBA 3TS0A 1K8GA 2Z0SA 3PUXA 3G71A 1XMOL 4LF4L 3CQZH 2HIVA 1PH4A 2PI2A 1RL2A 2JA6G 4K0KL 5LMNQ 3HOUG 2Q2UA 2QGQA 2YTYA 4UPAA 4LF7L 2VY3A 5C3EH 1D7QA 1NE3A 1XMQQ 5C4XG 3M4QA 3ER0A 1BBUA
chains in the Genus database with same CATH superfamily
2XN9C 3GV7B 4I55F 3VA7A 4JVZA 4F8MA 4O0AA 1CQJB 2UXDH 1JMCA 2E8GA 5D14A 5KFGA 1K1SA 3OIPA 2R7FA 1V1QA 4ZUJA 3DWPA 3NHHA 4C3HG 3VDYA 5KNBA 2KECA 3CMAA 2KA7A 1S9FA 5ELOA 2XVSA 2XGPA 3BVGA 3TP7A 4DUYL 1EUJA 2C2DA 3A8JE 4OHJA 5IT9L 4ECWA 3ICEA 5KNDA 5CV5A 1A15A 4DV2H 4O4LF 4J9SA 2E2JH 1XNQL 5KG1A 5KX5F 3PO3H 5IY0A 3HS0C 4JI0L 2C00A 2FFKB 2EJFC 1HZBA 3I56A 2XWJB 2K04A 3MA2B 3QFFA 2HHHH 4Y7NB 1DD2A 1CQVA 3NENA 5I6WA 4DV5H 4X64L 3RB4A 5CA1F 2BCOA 4LF5H 2Z4HA 4Q44A 3F8TA 4QW8A 3X3MA 1DJRD 3PUZA 1BNZA 2YL2A 3H3VH 1AP0A 5A2QW 2JA6A 5FLMH 2HT1A 4F4YA 5JOBA 1SSOA 2EJGC 3NUCA 4Y8VB 4CJ2C 2F0GA 5L1LA 1V1OA 1VQFA 2VQEH 2K01A 2XCAA 5LMUQ 2NVXH 1EHIA 2WAQE 5ELFA 2YYAA 3DLLA 3KF6A 4JI2H 5FLXc 2AUJD 3DWQA 5JVG3 3GTQH 2F4IA 1EIYB 2IT1A 4GKKQ 3N52A 2FHTA 1EQRA 1N33L 1E4FT 3CP0A 3HEJA 2EPBA 5FK9C 3OTOQ 2HJWA 4O3OA 1H9SB 4A3CH 4DR2H 2PNRC 4I7HA 3T5HA 4ZRZA 4Y52H 2ASJA 5KFVA 1RK5A 1STAA 4L5TA 3ETJA 4RNMA 1SBBB 2PQAA 4H7BA 1KBLA 4HYKA 2HQEA 3A55A 2LFNA 1Z9FA 4B08A 1B4OA 3TMEA 1VQPA 4H0LC 4JI1Q 4LFCL 4NXMQ 1CKOA 5AFWA 5IYDG 3EYYA 3PIOA 3S17H 3OOCA 3K5IA 1F2ZA 2KENA 5AJ3Q 3QIAA 4ABNA 2HD3A 1BJTA 5ELBA 1Z2OX 1B9MA 2B2YC 2F0HA 1O75A 5DGAA 4R1JA 2CFMA 3MXPA 4F87A 4A3JH 2PQAB 1IW7D 1J5EH 2JA7B 3MFHA 3NE5B 3K5NA 1CE8A 4DV3H 2UUBL 1I50H 1KC7A 4YR2A 4ED0A 1VQLA 4O2DA 3CCQA 1SAPA 4RG1A 5HGTA 4O4HF 4V190 1PYSB 5DNFA 4IUUA 4MTKA 2ENBA 1Q81C 4KKTA 2CKZB 3C46A 4M1UB 1CUKA 2F0DA 5C44H 1ZXTA 4YCUA 4OX9Q 5IGGA 2ATLA 3E5NA 2B2TC 3BVMA 3WO0A 2UUCH 2ICEC 1JR0D 4ECSA 1PTOB 1YNJC 5FKAC 1XDNA 4YCVA 2ALZA 3S16B 5BR8H 2N78A 3EA6A 4X66L 1N34Q 1BXRA 1M0TA 2VUGA 2UUAH 3MWMA 5JUMA 1E1TA 1PRTD 2DGYA 2N88A 2O2LD 3R3OA 4NKLA 4J8QA 2QKIC 4QY7A 3J7YW 1PLFA 2BE5C 4L5SA 4B3TL 1YEZA 4Q8EA 1J9OA 2XTIA 3GTOA 5KFPA 4DR7H 2C5CA 3KXYT 2BA0A 5F2DA 4IURA 3OWFA 3QR8A 4GKJH 4IPDA 3QOJA 3ULLA 4JI6H 3HOYB 3TZDA 2UXCQ 5KFKA 2PI2E 3FKIH 4MTNA 1TWHA 2AGQA 4XQNA 1I7LA 2ID0A 4DV7L 3W1GA 2EXZA 2RSNA 3JAME 2FKLA 2L55A 2QYZA 1TWGB 2NUAB 5ELNA 3FDTA 4RGMA 4A75A 3KBXA 3SK4A 1Y8PB 1Q90A 2L4NA 4QUCA 3R93A 1PH9A 3TRZA 3H40A 2X6LA 2BOSA 3PO2G 4GNXC 4QGUA 1YNXA 5E7NA 1YZ6A 4DL3A 3CCSA 2YW2A 1I94H 4Q0YA 5JPMC 1TWHB 1Z2PX 2IHEA 2CVRA 2MO1A 3SE0A 1SEIA 3GTKA 2FB9A 1CSPA 5LL6S 1UUPA 1VQCA 4C3IG 3CQZB 5HY6A 3N8DA 2B3GA 5E1FA 1T36A 4QIWB 3H09A 5DQGA 4KN4C 1A2TA 3SEBA 1PK8A 1G91A 2QEJC 1ULZA 3G7LA 2BR0A 4BBRB 4EGJA 2V58A 3LWUA 5H1SE 1MKHA 2EE1A 1DONA 4MN3A 2E2DC 3SK5A 3P7JA 4LMYA 1Y69U 3Q8RB 2CWPA 4C3HH 3L2PA 2NU8B 3UQ8A 4TV8F 1GUGA 3UE0A 5LYJF 4XYLB 1E4EB 2KSWA 3J7A5 1EZ8A 5BN3A 4JI4Q 3JSLA 3NGDA 1VQ5A 1HR0Q 1JORA 3HKZG 1I6HB 2JEFA 2E5LQ 5COYA 3WOFA 4FS1A 2K4KA 1WJJA 3MAQA 2Y0SB 1TWAB 4ED3A 3M9OB 5IT9W 2YU9B 3IFDA 4ZKBB 2AUKA 1XPOA 2WE6A 2DJGC 1NTGA 3ONAB 3K0XA 2B63A 3VYTA 1NMFA 4J9MA 2R8KA 1KEEA 4RCOA 4DAYB 1ZETA 4JI5L 4JI3L 4YP3A 5KRUA 1GM5A 4HCEA 5KT7A 1CKNB 1K8MA 3SK8A 1DYQA 3D6CA 1R9TA 4DR4H 2CCZA 3BJYA 4A3EG 5IP9G 4Q8FA 4C3JB 4RB1A 2WFWA 4FF4A 1GUSA 5CC4A 1V8QA 3F2DA 2DWCA 1OO9B 5CB4F 5KFXA 2VUMA 2PW5A 2CW7A 5C3XA 1EY9A 4QWCA 4A3IB 4KHZA 1F9PA 3GIMA 1EWCA 1E3PA 4F4WA 1I3QB 1IBKH 3SDZA 4DR5H 2WKDA 4GOPB 4A3FG 1R9TB 1YIJA 2KQ3A 1OXTA 4A93B 1GKHA 4DUZH 1STNA 4AYBG 2DUDA 1S03G 1HZ9A 3AQQA 1CZGA 5BPFA 1OTCA 2B2VC 3JZIA 3GILA 2NN6G 1FR3A 1TWFA 2A68C 4KJOA 2E2HA 2VUMB 1LABA 2FMMA 5FO7B 1SCUB 2WINB 4MA0A 4BWGB 5IYZF 4GZYC 3I4NG 2EOTA 3T1YQ 2R7KA 3BG3A 1E0BA 4ECZA 4EGVA 2O5JC 5IYDH 2OH2A 5IWAH 4RH6A 3FP9A 2UXDL 4BWSC 3TEHB 4K6DA 4JCVE 2XCPA 4H02A 3VR3A 3HRZC 2MUYA 5I2YA 5JVH3 2JK8A 2B2UC 3I4MB 1F77A 2E2HB 1TAEA 3R5FA 1CT1D 1DGSA 2PZTA 5C3WA 2K14A 5KT2A 4L1KA 5EPJA 4B9XA 1WCMG 3PF5A 2H4OA 3I4OA 4K14A 3MTSA 3RLNA 1L1OA 1PFBA 1AN7A 4B3SQ 4LF4H 3PUYA 5CMDA 3RAQA 4ZAIA 4EFBA 3EBEA 3GV6A 4C1NI 1Y1WG 4MV8A 5BN4A 5FD6A 1JJCB 1SEBD 1HJPA 2HHHL 2BQRA 1ZQ7A 5IP7G 5TSSA 5G3LF 4WJ3M 1X6OA 2F3VA 1ASZA 1RODA 2W9CB 4LF8Q 2BQ3A 4LF5L 1PZKD 1HXYD 2ALYB 2F0EA 3OW7A 4N9TA 1G2TA 4NXNL 4LFBL 1X3PA 1XTDA 3R2IA 3G6VA 4MTEA 3BZKA 3T56B 2FJ2A 3D8GA 2R6FA 4RKLA 3RN5A 1SXTA 3RN2A 2NZOA 4JV0A 4A3DG 4C2MH 2VQEL 1B04A 1Y8OB 1ESFA 2N3SA 2UVVA 1NUCA 3X3NA 4ZK9B 1YNND 2B39A 3PQIA 3NWTA 4DN4M 3NEMA 2OF1A 1NBWA 1Q46A 1XNQH 3I7FA 2F0JA 3S1MH 3BYYB 4JI0H 2I0QA 1N36Q 2F0UA 2F0TA 4HMJA 1B3QA 5C8YF 1D1KA 1Z6HA 2I5HA 5FLXE 1WTVA 3PW0A 3TP5A 3I8ZA 3N44B 3JC66 4J9PA 4EQ5A 1LV9A 1RDPD 4IJLA 3J81L 4X64H 5IT9E 3A5ZB 1YHQA 2F0QA 3IL8A 4B3RQ 1CSQA 4YIJA 4DL7A 3GTJH 3TN2A 1UNNC 2ZT9C 1B8AA 4LAAA 4DR1Q 3PO2H 5E3FA 2RHSB 4KN7C 2Q2HA 1UE6A 3S1RB 1M4VA 4KHPL 1VQKA 1AH9A 3R23A 2HVSA 2ZDHA 4C3IH 3IAYA 3W2DA 3H4DA 4ECYA 5FJ8G 1EEFD 1N32L 2A8VA 4Z9CB 2K50A 4KTAA 5C5JA 3K6OA 1V51A 5CA0F 1VQ4A 1S40A 4WJ4A 2E2IH 1TWCA 5IIFA 4V0BA 3RLOA 5GAHC 2Z6KC 4RGTA 1FVIA 1MSGA 2VQFL 2JQOA 2WB1E 3KAKA 3A54A 4XTCS 4A3KB 2NU9B 3OW2A 5JPNC 2FP4B 1A0IA 5C5LA 4DLKA 3AB9A 2J6UA 3TS2A 4LH7A 1BUVT 3CCVA 2EYJA 3GTMB 3VPBA 1WI5A 3JAMi 3MR3A 4LFCH 4HJAA 1XNRQ 3U4ZA 1UE5A 4NDXA 1T9HA 1RKNA 1TA8A 4IUVA 5CYUA 4OWTB 4C5CA 1TWCB 4IUQA 3MXUA 3RIZA 3R5HA 4OELB 2PMZE 3SHLA 2R8JA 4RGNA 3JAML 1MIUA 3RBEA 2XNAC 3KJOA 2D62A 2QDLA 4AQYQ 4JI7Q 3HOXB 3NQTA 4QL5A 5KFIA 1K8OA 3HKZE 4EQPA 4P75A 1LO5D 1XMQL 5C4JH 4QUFA 1MD2D 1N9WA 4A3EH 5IP9H 3T13A 1EZ1A 1EY5A 1ICWA 2B2TA 3L7ZC 5M3MG 2UXBL 1A6XA 3KDFB 2YV5A 4CHTB 3BZCA 4PZ8A 1T94A 2C35B 3S2HB 3TS0A 1K8GA 3PUXA 3N43B 2JA6G 1O7LA 2F0SA 5LMNQ 4CGYB 2YTYA 4LF7L 2JA5A 4ZCKA 5LXTF 3EPIA 5C4XG 3M4QA 3RF2A 4K8JA 2F0FA 1TVXA 2O4XA 5IGCA 2F0IA 1IHZA 4A3FH 3CCEA 3QZ7A 3H3VI 2NBFA 2ICIA 1HTLD 1W6KA 2RA4A 4DPGA 1N8RC 1JOQA 3EROA 5GROA 1O7ZA 4JW0A 1UEAB 2AHOB 2YS7A 3N42B 2OCEA 2IL8A 3L4KA 2NN6H 1PVOA 1XMOQ 1GHKA 1F9QA 3GV3A 3QG1A 4K0KQ 2R85A 3H0GA 2C28A 1PH3A 4M8AA 3P20A 2JA5B 4DV7H 3PW5A 2DPJA 3BS1A 1CHPD 1JWUD 2J9GA 5HGQA 1M7JA 1BCPD 1HNWQ 1HNZQ 3OPOA 4Q45A 3CCUA 1E4GT 4CC5A 4EG0A 2RQXA 1K73C 4ED8A 1QUQA 5CORA 4H44C 5D65A 1O78A 4GNXA 4JYAH 1P16A 4FF1A 1K0RA 3H0GB 4BY7G 2KVMA 1VBHA 4DKAC 5JJIA 1RD9D 4DV2Q 1OWTA 1W6JA 4OWXB 4QMGA 5J2TF 1WCMH 3IRBA 3M3YB 2L9HA 1JB7A 3CPWA 5M5WB 3RZOH 1I6UA 4BY1B 4A3JG 1D8LA 1Z47A 3CHBD 4DV4L 3N6XA 1Y1WH 1YJ9A 1CM9A 4DV6Q 1B70B 1QUQB 4DV5Q 5JJLA 5M9OA 4IUPA 4B3MH 4HAEA 1GUNA 5IP7H 3B6YA 4GNXB 4LNQA 3HOVB 1RTOA 4DL5A 2R92G 3UDGA 4C5BA 4GOPC 1KJQA 4PMBA 3GTPB 4JI1L 1WH2A 1SFOH 1D2BA 3M4OB 1SDFA 3RB6A 5AJ3L 1RTNA 5C1OA 3GTGA 1MI2A 4RCNA 3NSWA 2IP4A 2BDOA 1K83A 4A3DH 4IHJF 2QK4A 4LUVA 1WTRA 2PYKA 4OO1G 4EX5A 3G6JB 4U68A 5ELEA 3GD7A 3E9IA 4IRKA 3H15A 1HQRD 4ETSA 3W5OA 4YAJB 3TQTA 5KFUA 1EY8A 2XD4A 3MFGA 4QWBA 3VA5A 4UFZA 3I2ZA 5LP6F 2AQ4A 1JQYD 4O42A 2V1CC 4XQJA 4FP5D 4L5RC 4DV0H 4C5AA 2EYHA 4JI5H 2DLNA 4JI3H 1M6VA 3S15B 3ND8A 1K83B 1RCVD 4U6PA 1V43A 1FGUA 4JBKA 2PN1A 1QCBD 5D8DA 3J81W 1U4MA 4I7ZC 4DV1L 1BKBA 1DOMA 4JV1A 1RJRA 1IBMQ 3M4PA 3MEFA 4BXXG 1FGBD 3SR1A 1SYBA 1JCKB 4GC7A 4DAMA 2LY7A 1IW7C 3ITPA 4HJ5A 4A3BB 2A73B 2BH8A 5DM73 1J5EQ 4JV2A 2PQEA 3L9AX 4LUOA 4DXFA 5GAGC 3N41B 1Y1VG 4QJFA 4DV3Q 4JPBW 5FJ8H 3K8AA 3NK9A 4IFDG 2K1BA 2NVYA 5D3DA 2O03A 1NSNS 2UXCL 4A3GG 2DY7A 4RUAA 2FK3A 2B2VA 4RMFA 1B44D 1QNUA 3T16A 2MP1A 2UUCQ 3H94A 1IBLH 4UY8C 1Q7YC 1EL0A 1ZHSA 5DG9A 5BR8Q 1RIPA 1CFMA 1PRTC 2NVYB 2UUAQ 1SN8A 3K5MA 4LF6Q 2GVBA 1IZ6A 3HOWB 5KFWA 4WJWA 4ZLTF 3CCLA 1LTID 5JJZA 3H20A 2B2UA 4IALA 1U4LA 4ED7A 1PHJA 4DR7Q 1HZCA 3TREA 5FLXL 2FMCA 4ILWA 1EIGA 2PCFB 1M90C 2P0AA 4ZYSA 3JAMW 3DXJC 5KFDA 2I8CA 5JVDF 3I3CA 2FJZA 1B1ZA 2EYOA 1HZAA 3MZ5A 3EN2A 2CWAA 1VF5C 4L6TB 1SLJA 3OIQA 2B63G 5EBDA 2VA3A 3SK6A 5C0XG 4TV9F 5M3MH 1C30A 2EY2A 3L4JA 1H9KA 1PV4A 3STBD 1RYSA 3KHHA 2YTXA 5IGFA 3BA8A 1LACA 1LT3D 2ZTEA 5C3EB 2JA6H 4NXNH 4LFBH 3J80c 4A3MG 1H9SA 3D31A 1SJED 2NYZD 2F0NA 3KLSX 3W1BA 5EKIA 4YY3Q 3CC2A 5EQ0A 2JYOA 5C4XH 2E5LL 4ME5A 2K7VA 5M3FG 2FLLA 3L0OA 1K3BC 4RAZA 4A3LG 3WNZA 3MXNA 2JA8G 3PVXA 1D5MC 1H9MA 3D0FA 2YCHA 1TT2A 5J2UF 4HCSA 1VBGA 1EIHA 4UCSA 2VR1A 2SNMA 2NUCA 4UP9A 3PUWA 1TY0A 2ZJPA 4QWAA 2VZAA 3G6XA 1G51A 4WBNF 3NTKA 3OWEB 5DG8A 3HXLA 4A4IA 2ZTCA 4DXGA 3RZDH 2KBNA 2LMCB 4PNYA 4CDFC 2E2JB 4O2AF 1FL0A 3PO3B 5CAEB 2JA7A 3MXNB 2IX3A 2Q2IA 1EQTA 2A74C 2C22A 3M85A 5KGUA 4RU9A 1Y14B 4BY7H 1BVSA 4KHPH 1BCPB 2ES2A 2PO4A 2IMWP 3URYA 2FK2A 2CH4W 3J81E 5GONF 1KIXA 1MBYA 1F2LA 1PTOF 3BU2A 2EY6A 1EWIA 5LL6b 4G3IA 1PTOH 1N32H 1BF4A 4UCRA 4RGOS 3NELA 4DR3Q 3LNNA 2NVXB 4IWYA 1SNQA 3LWEA 1FD7D 4DR4Q 2DJFC 4XDXA 3K81C 1BOSA 1S5FD 1F9RA 2R92H 1YHBA 2C2RA 2ZM6H 4RAYA 2Z6KA 4JBMA 5JVLA 2VQFH 4PZ7A 4RB0A 5KFLA 4ZUIA 2CW0D 1PH7A 5M5YH 1QVCA 2VA2A 4OL7A 3EFXD 2RGRA 4PDBA 4DNTB 2AWOA 4IPGA 2UU9Q 4CDCC 2YS6A 5F9LA 2IA6A 3WWVA 1U4RA 2F4VL 2F1MA 3TINA 4LK1C 5EWFA 3CXCA 1IBKQ 3U50C 4OO1H 3TDQA 1VQGA 3A56A 3BZDB 5T1IA 4C1NK 1Q82C 4MV3A 3U9TA 1TWGA 2R93A 4HIMA 5J3BA 3S17B 4ZI7F 2RDHA 2VS1A 3KF8B 3UDIA 4FXDA 5IGDA 1XPRA 2MPMA 3GTOH 2ZJRA 5DGBA 1LLRD 3FEWX 4MV9A 4YJ3F 3KLWA 3V4ZA 1IL8A 4HTHA 1CI3M 4J6HA 2DZDA 3SXHA 1KDCA 3LWBA 3WDNA 4LSXA 5FOBB 1XMQH 5ELDA 4JV5Q 2PNHA 1I50B 5IWAQ 3M7GA 4TRDA 3OHBA 2ZXRA 3HOZG 2MHVA 2OLSA 2UXBH 3Q24A 2QF7A 2A6HD 5G3LD 2R93B 1AE3A 1EOTA 1ESRA 1X54A 2EZVA 3CQZA 5KFNA 3SVMA 5EJWA 4BXXH 1I7NA 4G57A 2K05A 2RSOA 4QIWA 4RFBA 2YZMA 4CKCA 1VQEA 4F50A 4GLVB 4ALPA 4LF7H 1AW7A 3SI8A 4XIGS 2EY5A 3T51B 4QB4A 4JYAL 1Y1VH 2JJQA 4XXEA 3K5LA 4HN7A 2GN5A 4XX0B 4IFDH 4JBJA 3GTKH 5JEAG 2KJXA 1ZYRC 2R7ZA 1JDEA 2CQOA 4LF4Q 2WYOA 2RDIA 4QIWE 4TVAB 2WB1G 4A3GH 4EEQA 4YB8B 1BBWA 3LX0A 3OSOA 2W8LA 4HEDA 4N8X1 2C9OA 3DF7A 3GIIA 2SEBD 5KT3A 1E4EA 1E1OA 4FU0A 3BDOA 5HBRB 4B3ML 2OEOA 2W70A 2K5HA 5DLQE 3Q8DA 4TQSA 1NR4A 2I80A 5EGTA 3A7AB 2Y0SA 1TWAA 4HQ6A 2YU9A 4R8NA 1NAPA 2R7ZB 3FKIB 1TS2A 4MA5A 2ZXOA 4J9KA 1EZ6A 2B8GA 3DM3A 2L15A 1V4YA 5KFCA 1E2VA 1PMRA 1D5ZC 3CF5A 4DUYQ 1J6QA 2CQAA 4DAYA 4K2KA 5LMUH 2L1BA 2K5WA 1ENAA 4CKBA 2E74C 3CCJA 1CKNA 4FDBA 2GVAA 1GLVA 5FLXW 1C48A 4JOIC 1XNQQ 4LF9Q 3RGXA 4GKKH 3KFUA 2JA9A 1EYCA 2PBZA 4FF2A 1QJOA 4XT3B 1PYWD 4DV4H 5EPLA 3M4YA 1EU3A 3NBHB 4DK0A 5DLFA 2X0SA 1N56A 3BQ2A 3Q23A 2B63H 2EVBA 3S1NH 4DV0L 5C0XH 4M7EA 5KT5A 1E22A 2NWGA 4MV7A 3M4IA 1I3QA 1O80A 1VQHA 4YAKB 4IN3A 3QO2A 1R9TH 4GOPA 1L0YB 3RB0A 5KG6A 4JI1H 1XNRL 4QWEA 3J81j 5KFOA 2RF4A 4A3MH 4X65Q 4FBUA 1RJTA 5KFHA 4ED1A 1C8CA 1QE6A 4JG2A 5M3FH 1TXYA 4A3LH 2D2CC 2IW3A 2RGVA 3HB9A 2JA8H 2M9VA 2VB3X 4C3HB 3PIPA 4IPHA 1MJEA 1N33Q 4H13C 2VPQA 2RDFA 4AQYL 4JI7L 1TS4A 3Q6SA 1EQVA 4OEMB 1S68A 1TY2A 4O2BF 4DAVA 4XZ3B 2EYMA 1TWFH 3FHWA 2ZDGA 3H0GG 2E2HH 2AGOA 1S0OA 4ZHQF 5JQWA 1W93A 2WACA 1IBLL 1JE4A 4KV6A 4XYQA 4DV1H 4J9LA 2QCPX 3DWAA 4OWWB 1YNJD 3T1HL 2NN6I 4B9WA 1SMXA 4BY1G 3OSPA 5J39A 3FDSA 2JP1A 2L11A 2NVQH 2VXWA 3Q8PB 2ZXPA 1X3EA 2ASBA 2XGQA 5KFSA 3KK7A 4DU9A 1K28A 1VCIA 1XX8A 5DLGA 1PH2A 1O7IA 5KFZA 1EEID 1MGSA 1VQ7A 2UUBQ 5EPKA 4DR6L 1RK6A 2EYFA 2NU6B 2IBKA 3TP8A 2W9CA 2K5NA 4BA2I 2F03A 3SE7A 3Q1KA 3G71A 1XMOL 4CJ0B 2UXCH 4K0KL 5KFEA 4FBTA 1RL2A 5L1JA 3HOUG 1D7QA 2NU7B 3VYUA 3E3XA 2I07B 5E4XA 4IQZA 3TSSA 4J9NA 3ER0A 2UVUA 4QQBX 5L1IA 2DY8A 1EYZA 4WRDA 1HNZL 4FXGC 1PRTF 4F4ZA 4BBSG 4IWXA 4X66Q 1YHAA 2PVPA 4NP5A 1NJIC 2XIWA 3CAMA 3AMUA 3F8NA 3KHLA 1I5FA 5GQOA 3MWDA 2LXKA 1S10A 1C4QA 3T4AC 5I9OA 1B3AA 3GTLH 4B3TQ 2QEXA 1X55A 1KL9A 2SDFA 4DK1A 3TZUA 4HJ9A 3FPUB 1X3QA 3PZPA 1ICFB 1QZGA 1XTCD 2L5TA 2R8GA 3J80E 4E4TA 5LA6F 4UAIA 4EQNA 4ECTA 3KLSA 3KHRA 4HIKA 1ENCA 1A8VA 3J81i 4MV1A 1A9XA 4PWQA 3K7AH 4DV6L 3CCRA 1OXSC 1PRTB 1GUTA 2LXJA 1AZQA 2V5AA 3BDCA 2WP8J 1HNXQ 1FJGQ 1HA6A 1BCPC 3M9NB 2JSOA 1X3FA 1VQNA 1AFPA 2N49A 3H3VC 1NR2A 4LFAL 4RUCA 2W6QA 2FLNA 4PQXA 3HOZH 1MHWC 2A6EC 3RTXA 4X62Q 4BA1I 4K8IA 3S14B 3VR5A 1B6RA 3HG9A 1JLLB 4LJZC 1RYRA 1LYLA 1KNAA 2CQYA 2Q8TA 4EQOA 4C2MA 1T3NA 3ULJA 3J7AF 4JI4H 2F0MA 3PUVA 1ET9A 3C2PA 1HR0H 2W71A 5C4ZA 2ATWA 1MJCA 4GC6A 2E5LH 3HZXA 5I2XA 3GO5A 5EDWA 1FKAH 1D5XC 3FRPB 5JEAH 1QVFA 1IKMA 3GIKA 3KALA 1XJVA 2RHQB 1JC7A 3RMHA 3I70A 3KYHC 2GPSA 3GTMA 2XC9A 1B2TA 4C2MB 1YVCA 1D6EC 2J0TD 2OT2A 4YHHL 5CBEE 1KLGD 1G2SA 1TWCH 4LH6A 1PH1A 1LT6D 2ZM6L 1BBXC 3DM1A 2W57A 1X32A 1IBML 5KG5A 2JXMB 1Q8KA 5C5MA 1KAAA 1HTPA 3SGIA 2D5DA 5DAUA 4CJ1B 1WTOA 4HSPA 2EIFA 4K6LA 3E0JA 1JT8A 1UC9A 3LGJA 5EKLA 3GTJB 3N40P 4NLGA 3I73A 1RJQA 3PO2B 2G9HD 3KDFA 2ZJQA 2CHBD 4A2BA 1HCZA 1JE5A 4IOCA 1NMGA 1XXGA 5IYBG 1KD1C 1PDQA 2OQ0A 3DEOA 4C3IB 1VQ6A 2MCTA 1L2ZA 1PH5A 5EZYF 1A63A 1U4PA 2EYLA 1EY4A 3V6KA 1PFNA 4P74A 4RKBA 1W2BA 4O3RA 4JI8Q 2BQUA 1X65A 5D3IB 4F88A 1SE4A 1A3VA 4LF6L 3PF4A 2KHSA 2E2IB 1B50A 4DL6A 1JJGA 4QF4A 1H9RA 1LUZA 1SROA 3K7UC 2RBMA 4ZKCB 1S5ED 2OWOA 1KJ8A 2K28A 4F7XA 2F4VH 3PIO3 1AE2A 2JA5H 3V2TA 3MR2A 4P72A 1C7YA 5KFFA 1BQQT 2XSCA 5KG0A 1KLUD 2F3IA 4Q0FA 1Y8NB 1YBYA 1WR2A 3M9BA 5M5XH 3K5HA 3IFTA 2JEGA 4YJ2F 4B3SH 3LP8A 5KNCA 3CC7A 1WTXA 1EYGA 4EYHB 1LTAD 3H0GH 3MFYA 4DNIA 2N8NA 3R5XA 3K3PA 5DG7A 3NTHA 4ZOLF 4PV1C 3DEPA 1NNXA 4ZQ3A 1TS5A 3RAXA 3VYRA 1EY7A 3M3YH 2UXDQ 1JB3A 1WSCA 3KTMA 5KFQA 3RB3A 5M5WH 3MR6A 2ASLA 3TIIA 4BY1H 1KABA 4GN4B 1IYUA 2JA7G 5DQHA 2UVRA 1R4QB 2F0OA 5C4JB 1CQIB 4A3EB 2HVQA 2XCLA 1KXLA 1WD0A 2B2WC 3UE1A 1KDAA 2A69D 5LMUL 3CKIB 1I4PA 2HDMA 3T5KA 4X3TA 4L8JA 2UVWA 4EFEA 1UEBA 4UHVA 2Z4IA 3BA9A 1B7YB 1VQMA 3PW4A 3GTPA 2LSSA 3M4OH 4GKKL 2R84A 2A1AA 3HOUH 2Z9HA 4IR1A 3OTOL 2HHHQ 1CA6A 1BNCA 3F1ZA 2XWBB 3I4LA 3STBC 3MFIA 3PW2A 1CS0A 4HR7B 1K3RA 2F0KA 3P75A 4AYBB 2HCIA 5D1OB 2B29A 2VL6A 3GDEA 4GLXA 4J1MA 4LF5Q 1KNEA 3TIGA 3A8IE 1EYAA 4NXNQ 4BBSH 4B3RH 1DCZA 4O3QA 1B9NA 4YQWA 3QZ8A 2W9AA 1E24A 1AEXA 2G5DA 1ET6A 4DAPA 2I46A 3S2DH 1S72A 4NXML 2F0LA 3P1HA 3I4NB 5KFBA 3ZJYC 3CVZA 3VR2A 2VQEQ 3GTGH 3HOYG 1CKMA 1UNSA 1G6ZA 1H95A 2KEEA 4JI2Q 2RDJA 2MO0A 2QW7A 1FNVA 1STGA 1S4ZA 4JOIA 4HJ7A 2R86A 2DN8A 2R93G 1PTOD 4DR3L 4DR2Q 2KCNA 4HMIA 5ISRA 2M00A 1T5XD 2HIXA 2JN4A 4OO1I 3S1QH 4I7AA 1ONLA 2Q8IB 3NPPA 1WCMB 3G6YA 4N9PA 2K5DA 4OX9L 4O3SA 3UDXA 1GSOA 5EAYA 5LHY1 3RR5A 2UU9L 1QZHA 1KJIA 4JC0A 2H1EA 2YRWA 3KUPA 1XNRH 2R87A 4LW1A 3TBIB 3PR4A 3NQIA 4R4OA 3BAAA 4K5WA 2A5HA 1DV2A 1N34L 2NVTH 5CV8A 1OXVA 1SFOB 1K0SA 2NZ1D 4MAMA 2EY1A 4BBRG 4IFDJ 2K32A 1W96A 3MXGA 1CZWA 1XWEA 1KJ9A 1STYA 2NTSA 2NVYH 4AQYH 4JI7H 2R7ZG 2V4DA 4A3DB 3A0JA 3PN1A 2Z1CA 3T5JA 1DZ1A 3EPGA 3J80i 2TSSA 1VF7A 4FO2A 2F0PA 4KLKA 3HBLA 3E0EA 4JV5L 1DIKA 4IFDI 5KT4A 1IOWA 1JDBB 1LTSD 5K5PA 1RHPA 3HP3A 3J80L 2Y0SG 3T1HH 1Q3LA 2HVRA 3C1FA 1FNWA 3D6WA 1I6VC 4X3UA 5KYLA 2CW8A 4APMA 5JJKA 4EYIB 1PFMA 4YR0A 2K75A 2F0WA 3CU7A 4Y7NH 1B6SA 2AKWB 3Q8QB 2AGPA 1TIID 2R7LA 2OXPA 4FNFA 4DR6H 4ME6A 2AU0A 2X69A 4J9OA 4LMQD 2V4RA 2MNAA 4GKJQ 5BMVF 4JI6Q 1AUXA 5IYBH 2D0OA 2M05A 2RVLA 2D0PA 4C3JG 4DL2A 1XMOH 4K0KH 5I6YA 1VQAA 2LS01 1JOKA 1A3TA 2A6HC 3VPDA 2UXBQ 1K1QA 1HUMA 5C0XJ 1ZHQA 3E9HA 4A3IG 1HNWH 1IOVA 1HNZH 4UP7A 5KKNB 3GIDA 2WV6D 4NMZA 4LF7Q 3F2CA 3CRLC 4XT1B 1UC8A 2AMCB 1ZKOA 1VQOA 3RUPA 4A93G 1I94Q 5C0XI 1ILQA 1GOZA 4JI4L 3MEHA 4MZ9A 1JIHA 3ERSX 1I4QA 5CBAE 1HR0L 1AN8A 1XPUA 1GYFA 2VUMG 1H9JA 4NW2A 4LF9L 1EQQA 3VR4A 4G7HC 3A5UA 1SYDA 2L12A 1F2MA 3A74A 2BA1A 3I90A 5GADC 2OTJA 3PGZA 1JWMD 5T1GA 1PZJD 1BCPF 4DV6H 2H5XA 4NB3A 2WAQA 3HKSA 1EOVA 1J8IA 3EJIA 4RAUC 4BS9A 1KDBA 4LFAH 1Q1EA 4UP8A 5KG7A 3K0YA 2KUMA 3I4MG 2IY5B 3VPCA 2BH2A 1Q86C 4X65L 3Q0AA 2JA7H 1JOOA 1F2YA 4DA2A 1QB5D 5HURA 2WKCA 5FO8B 2NVXA 2R6GA 5M3MB 1L0XB 1SYEA 4TQUS 4O3PA 3E6ZX 1Q1BA 2WAQB 3GP7A 3GTQA 4FYDA 1LTGD 5IT9c 2JA6B 1EUDB 4TKOB 1S5CD 4Q5VA 3ULPA 1BO0A 3ORQA 2V59A 3GIQA 4DV4Q 1EY6A 3J7ZC 1KTKA 5C4XB 2F52A 2MGSA 4IUNA 5KFRA 4FF3A 1LTLA 2I5LX 1SMYD 3S16H 3GIPA 5L9XA 4DL4A 4OGQC 4YHHH 3KF6B 2YZGA 2AQ2B 2JE6I 1SYFA 5BPHA 4R4TA 3GTQB 3PV0A 5EBCA 2L0CA 3RD4A 1LTBD 1Q12A 3T1YL 1SNCA 4RB3C 3KF8A 4YR3A 3KLRA 2K5VA 2HUGA 1IBMH 2J6TA 4DK6C 3RUZA 3H6MA 4O3NA 2YYZA 2JEAI 3OUUA 4KD3A 3RZDB 3HOYH 1QG7A 4G7OC 2DNCA 2HQLA 4DR5Q 4P71A 3K80C 1FYCA 1P8LA 2KCTA 4IZ8A 1I50A 2KHIA 4ECXA 1TWGH 4IUTA 2R93H 4DUZQ 3G4SA 1CTMA 4BY7B 5KT6A 2R92A 1EFID 1ML0D 1QOHA 2LKVA 4A76A 1NCVA 3V6HA 4B3SL 4K5XA 1A3UA 1Z7TA 1WD1A 1YJWA 3FVQA 4HIOA 4A3JB 2O5IC 4DV1Q 3RNUA 1S0NA 2QDBA 4MV4A 1TWHH 1M0WA 4TUYF 2VB2X 1DOLA 4P2CB 3U58A 4LF8L 5F9NA 2Z0SA 2V9WA 2F3WA 3CQZH 4LF6H 1BXTA 2PI2A 3EQLC 2R92B 2QGQA 4UPAA 3TP6A 4UCVA 3RJ0A 5C44B 2J7ZA 1EUCB 2FK1A 5M5YB 4KY5A 1BBUA 5FPRA 4QWDA 2R8HA 4BBRH 2ASDA 5JEAJ 5IYCG 3GQCA 3I72A 2DIKA 5CR3A 4DK3C 4A3KG 2K33A 2R7ZH 2RCNA 2W6PA 3G8CA 3H4BA 2Q2TA 1S0MA 3FKIA 5KFAA 2SNSA 1RF2D 1HNXL 1FJGL 1HUNA 3A7LA 4XYMB 1TU2B 4AH6A 1N36L 4MNOA 5KFMA 4POGA 3GTOB 1V1PA 3T5LA 1SNOA 4X62L 5KFYA 3FMCA 3L3OC 1I6HH 3I12A 5HV6A 2GA4B 4YWLA 4WORA 1CHQD 2W8KA 2HDLA 1GSAA 5CV6A 1TWAH 4B3RL 1RJPA 4TQRA 3VYSA 4HIDA 1Y1VA 2YU9H 3GLKA 5I9PA 4DR1L 3J80W 1T5EA 4YY3H 2R8IA 1CK1A 4PG3A 3NBHA 3CPFA 5A2QE 2W6MA 4EBDA 3HOXG 2B2WA 1GO3E 1YNNC 2K03A 3BVZA 2DPIA 4KMUC 2W9BA 1V1PB 1YITA 2Y0SE 1KRSA 1VQDA 4JBWA 3KBGA 1C0AA 4CDDC 4C3JH 2N55A 2EYPA 1G6PA 4K5VA 4JI0Q 4CC6A 3Q8SB 4IR9A 1Y1VB 3OTOH 3W3AA 3GTKB 3JRWA 1V9PA 3ZYYX 1SYGA 4RB2C 1YI2A 4X64Q 4A3IH 5ELCA 1WVLA 1SNPA 3CRKC 1EFWA 2MJ8A 4A3GB 3LMLA 5H80A 2WDTA 1I3QH 2W9BB 2FPPB 1AUVA 3RGZA 2CH4A 4EBCA 4HJ8A 2X6GA 5EWEA 1S97A 4A93H 4MHEA 4NXMH 3GQBA 4EGQA 4YBZB 3I55A 1HH2P 3HGBA 2VUMH 3BYTB 1HR0W 5LOVF 4RA8A 2FMAA 1QILA 4ULLA 4KY7A 2JA5G 4IPCA 3KHGA 1AZPA 3J7AV 3OUZA 2HCCA 2I87A 4XQQA 4O1NA 4DR3H 3U4VA 3BJUA 2IHFA 2YZNA 3MC0B 4KHVA 4S3SA 1VS0A 2CZGA 1SE3A 5JAVA 2GPWA 3ORRA 2QA4A 4A2AA 4RNOA 4JI8L 2OQKA 4OX9H 3I4MH 3WO1A 1Z2NX 1QWYA 4QCLA 1D1IA 1S5DD 4ME3A 3ND9A 2YRXA 2B63B 2FXQA 1EYDA 4LFCQ 4J15A 3V05A 2UU9H 2F0VA 3S1NB 1GJXA 3FMAA 3DHQA 4R9WA 3Q22A 1VQ9A 2JEJA 2XRQD 3UDFA 1E7ZA 5LMNL 2ZTDA 4P73A 2VQDA 1N34H 3PSIA 3CCMA 3OYYA 3ETHA 2SOBA 1WYDA 1S3OA 1LM0A 4A3MB 2VNUD 5J22A 3HOVG 2I5MX 1TS3A 3JRXA 2BE5D 1UWVA 4KK7A 1JJ2A 3OHXC 4HNTA 2Q8RE 3IN5A 3S24A 3KJPA 5M3FB 2K5QA 2Z6BA 1DM0B 1HA5A 2WTFA 4RNNA 1LT5D 2JA8B 1OXUA 2R3ZA 1C9OA 4MIUA 2ZJTA 5EOYA 1L2FA 1IXRA 4JV5H 2MQHA 5CV4A 1HFGA 2KCCA 2ZDQA 3A8KE 4QW9A 5C4HA 3PCOB 1VQIA 1HNWL 2F4VQ 3O13A 3K3VA 3H91A 1TWFB 4G4KA 4R4IA 3V4SA 4X6AH 3F2UA 1YJNA 1NY4A 2G9DA 5BN5A 1GHJA 4LWCA 3RLFA 4POFA 5C6AA 1OXXK 5FPOA 2R7NA 4HNUA 4DV2L 1MSHA 5K36G 2FLPA 3S14H 3BQ0A 1G291 2NVQB 4RZQA 3AYHB 4DF7A 1ZYRD 4X3SA 2E75C 3K5OA 2IX0A 5T14A 2W7OA 1JICA 4R4QA 5DM63 4U673 1HRJA 1E2ZA 3EVQA 1TKWB 1UAPA 2RDGA 4J0MA 1JWSD 1PZID 4DV5L 4DV7Q 3S1RH 1R4PB 3NP8A 1STHA 3BDLA 3OMCA 4A3BG 2E76C 2PPBC 4MV6A 5KFJA 4EBEA 3GTLA 2AQ3B 1A62A 1L1OB 1CA5A 2V4QA 2A69C 3AFQA 1A2UA 2KCMA 4JYAQ 1Q8IA 4DUYH 2FPGB 4JI2L 1STEA 5LL6X 3FPPA 2P5ZX 5IYCH 2EXDA 4LF9H 2QILA 3OMGA 1JX4A 1I4HA 4A3KH 1JKJB 4YCWA 3GTLB 4DR2L 2EDGA 1GGOA 1JXLA 4PMCA 1PFSA 2IPKD 3GTMH 3GV5B 1SYXB 2EQSA 2K52A 4B3MQ 4ID6A 3JSNA 2R61A 2GLTA 3HOWG 1WTWA 4G7ZC 3GTJA 1VDZA 1LT4D 3K7AB 3S9WA 1HQMC 5KIXA 1SE8A 3DUZA 3CMEA 1BDOA 4IJHA 3S1MB 4X65H 5IGEA 4WD3A 4RHSA 1HHVA 2TMPA 3HOZB 3PR5B 3HOXH 2WB1A 1E2WA 4ED2A 1PTOC 4J9QA 3CD6A 1J5EL 4EEYA 3QWNA 2YTVA 3GV8B 1UE1A 1KQSA 1N33H 4DV3L 5CGKA 2NZHA 5JH7F 1WFQA 4KD4A 3WOEA 3MWYW 3D4WA 1DXMA 3KOJA 4ECUA 5FD5A 2E2IA 4DV0Q 3S2HH 4L63B 4ECQA 4JI5Q 5C3EG 4JI3Q 3TQ1A 3MJFA 2UUCL 1STBA 2WB1B 1F9SA 2PMZA 3J81c 2A68D 1LTTD 4UCOA 5CV7A 4OIKA 4Q43A 1VKZA 3AEVA 3T1YH 3CW2C 5BR8L 2VOBA 1II3A 1I4GA 4DFAA 5IE8A 3HKZA 4JUZA 1U0LA 3KAJA 2UUAL 5K2MA 1VAJA 2XRSD 2B2YA 1SNMA 3QOLA 3D4RA 3K58A 4ED6A 3NBIA 5DQIA 3UI2A 4GS3A 2VW9A 1S5BD 1ASYA 3C3LA 1HFNA 3C1EA 4DR7L 1KJJA 4CDEC 4UCTA 3RV4A 2UUBH 2PMZB 4IRDA 1WTHA 4KKSA 5KFTA 1X56A 1WOCA 1L0WA 4GKJL 3OHAA 4JI6L 4JK1C 3G6EA 4LUZA 2MFIA 3PO3G 2KHJA 1EWHA 2W6OA 3T53B 3HKZB 2J4XA 4KI0A 3NXWA 1VQ8A 5NUCA 3VR6A 3D4DA 2DNEA 2B8FA 4APVA 1IBLQ 4N8FA 3Q2OA 4C56C 4I4TF 4MTDA 5A2QL 3HFZB 2WAQG 4KJNA 4TSSA 5J1ZA 4CKEA 4M9UA 1N48A 3T1HQ 3K57A 5IGBA 5FO9B 2NTTA 5FLMG 5KYIA 1EY0A 4X66H 2KEDA 1BR9A 5GAEC 4LF8H 3EIVA 3U9OA 4FM9A 2AQ1B 3MHBA 3MVVA 3RV3A 1PH8A 3GIJA 1I94L 5L37A 2PZUA 5KG3A 4B3TH 4HNVA 1IL2A 1O7YA 4YY3L 3RBDA 4IO9A 5LMNW 4HR7A 3I91A 4DR6Q 2D9UA 1EU4A 1KC8C 2AWNA 5D1OA 1X9NA 4AYBA 3HOVH 3DMUA 1GVPA 1I4RA 3JAMc 2IJ0A 2K6AA 1SRUA 4DGZA 3GTPH 3V96A 4FXKC 1TQOA 1ZEQX 1ILPA 4A3CG 5EWGA 3I4NH 3R8BA 1PH6A 1FJGH 1HNXH 4GN3B 4F4XA 3AU7A 4OXPA 5IODA 4IOAA 1N36H 4AYBE 4E6IA 1GXDC 4GN5A 4R4CA 4I50F 4A3FB 1KHIA 3F2BA 5M5XB 2WIIB 1VQJA 4UDUC 4X62H 3IKJA 1WTPA 3BQ1A 2A6ED 2RKSA 4PMWA 1X3GA 4O4IF 1SR3A 5I47A 1DV1A 1K8AC 1GUWA 4LFBQ 4ECRA 1QNKA 2A19A 3D3RA 4DR1H 2BDNA 2JEBI 1PA6A 1KRTA 4ECVA 2IX1A 5I4DA 2PZWA 3MWEA 2VPSA 4WFN3 1WCMA 5D1PA 2OTLA 4ODGA 1PXUA 5K36H 3S15H 2JEIA 3PW7A 1K83H 4U7CA 4YWMA 4KY6A 3BABA 1Y1WA 4IZOA 2W7PA 5IOCA 4EVOA 1SE2A 1B53A 4LFAQ 5KEEA 4IRCA 4RHRA 1M1KC 4OONA 1ENFA 5C44G 4DR4L 4L5QA 1SYCA 1GUOA 1LTRD 4YWKA 1VMCA 4A3BH 1VQBA 4FS2A 1SFOA 1SNDA 1M8AA 1GD7A 3M9MB 4X3KA 3HOUB 3MR5A 5L1KA 3RZOB 2NB0A 5A35A 3V6JA 1B33N 4CBVA 2J6SA 1Y1WB 1U5KA 3R2TA 2FE3A 5KG4A 1IKLA 4KHPQ 2KOLA 3BG5A 2W6ZA 4RZRA 2SCUB 4PZ6A 4BBSB 1IBKL 4DR5L 1EIFA 1PX2A 5KG2A 3TQYA 2W6NA 4J9RA 2PW7A 2RCFA 4NPSA 4DUZL 3S2DB 2M2LA 4OIJA 1SMYC 1N32Q 4R8IA 1TR5A 4AIMA 2R7MA 3GTGB 3NTIA 1KAWA 3K59A 4YHHQ 1SJHD 3CC4A 4K2LA 2EJMA 2R7DA 3FKIG 3OSNA 4R8UA 3HOWH 4UCUA 2ZM6Q 2CW0C 4IAJA 2VQFQ 4I65A 1MZBA 1C3OA 4JI8H 1I4XA 1FNUA 3AFPA 1UE7A 1BGWA 1QVGA 2HGSA 3VMMA 5C1PA 3G48A 1W3SA 5IWAL 4ZQIA 3UFXB 3IG0A 1U9RA 1IYVA 3S1QB 3N6RA 1XYIA 3ERQA 5E4WC 1HPCA 4FVMA 5DEHA 2IWHA 4HSVA 3QJYA 4R7RA 2Z8LA 1GSHA 5LMNH 1G8ZD 3E5SA 5CV9A 1WTQA 3M7NA 1IYJB 1K9MC 2FINB 4R8UB 3C0FB 4KKUA 4GLAC 3U9SA 3J7AK 4XYOA 2XGTA 3PMFA 3NWSA 3QB3A 4DNRB 1L1OC 1PYBA 2NVTB 1VMPA 3PIP3 2HIVA 1PH4A 4LF4L 5EKKA 4LSAA 2Q2UA 2FPIB 2R82A 2VY3A 4RWSC 5C3EH 2XIGA 3RFCA 1NE3A 1DOKA 2C2EA 1XMQQ 1CQFA
chains in the Genus database with same CATH topology
4A3FH 3CCEA 4QQBX 3H3VI 4BBRH 1HNZL 4O0AA 5JEAJ 5IYCG 4DPGA 1JMCA 4BBSG 2E8GA 1N8RC 4X66Q 1YHAA 5GROA 4DK3C 4A3KG 2AHOB 2R7ZH 2R7FA 1V1QA 2OCEA 2RCNA 1NJIC 3CAMA 2Q2TA 1PVOA 1I5FA 5GQOA 1XMOQ 2LXKA 4K0KQ 3VDYA 1FJGL 1HNXL 3CMAA 3GTLH 4AH6A 4B3TQ 2QEXA 1N36L 1X55A 1PH3A 1KL9A 4MNOA 5ELOA 4DUYL 1EUJA 4HJ9A 4POGA 1QZGA 4X62L 3ICEA 1I6HH 5HGQA 4YWLA 1HNWQ 1HNZQ 3CCUA 2E2JH 1XNQL 1K73C 1TWAH 4B3RL 4HIKA 3PO3H 1A8VA 5IY0A 3J81i 4HIDA 4JI0L 1QUQA 2YU9H 3K7AH 4DV6L 3CCRA 4DR1L 1HZBA 1OXSC 2LXJA 3I56A 4GNXA 1P16A 2WP8J 4PG3A 3CPFA 1K0RA 3NENA 1HNXQ 1FJGQ 4BY7G 1VQNA 1X3FA 2N49A 3HOXG 4DKAC 4LFAL 4X64L 5JJIA 1GO3E 4DV2Q 3HOZH 3F8TA 4OWXB 1WCMH 3IRBA 3PUZA 4BA1I 4X62Q 1JB7A 3H3VH 5FLMH 3CPWA 1YITA 2HT1A 2Y0SE 1KRSA 1VQDA 4JBWA 3RZOH 4A3JG 1C0AA 1D8LA 1Z47A 1LYLA 4C3JH 4DV4L 1Y1WH 1G6PA 3ULJA 4JI0Q 1YJ9A 4DV6Q 1B70B 1QUQB 4DV5Q 1VQFA 5JJLA 3PUVA 5IP7H 3B6YA 5LMUQ 4GNXB 2NVXH 4LNQA 1MJCA 2WAQE 1V9PA 2ATWA 1YI2A 3GO5A 3DLLA 3KF6A 4X64Q 3UDGA 4A3IH 5FLXc 2R92G 4GOPC 1QVFA 1EFWA 3GTQH 1XJVA 1I3QH 2IT1A 4JI1L 1EIYB 4GKKQ 1SFOH 2RHQB 1EQRA 1N33L 3CP0A 3KYHC 3OTOQ 4A3CH 5AJ3L 4HJ8A 4Y52H 4A93H 1YVCA 4L5TA 4YHHL 3I55A 4A3DH 1HH2P 2PQAA 4LUVA 1TWCH 4OO1G 1PH1A 4EX5A 2VUMH 1HR0W 3GD7A 3E9IA 2ZM6L 1Z9FA 3H15A 1VQPA 2JA5G 3W5OA 4IPCA 4JI1Q 4LFCL 1IBML 1CKOA 5IYDG 4NXMQ 3PIOA 3S17H 1Q8KA 3U4VA 3I2ZA 2KENA 3BJUA 2IHFA 5AJ3Q 2V1CC 4L5RC 3SGIA 1VS0A 2EIFA 2QA4A 1JT8A 4R1JA 3LGJA 2CFMA 1V43A 2OQKA 2PQAB 4JI8L 1FGUA 4A3JH 4JBKA 3I4MH 4DV1L 1BKBA 3KDFA 2ZJQA 2UUBL 4ME3A 1I50H 1JE5A 1IBMQ 2FXQA 3M4PA 3MEFA 4J15A 4IOCA 1NMGA 1VQLA 4LFCQ 4O2DA 4BXXG 5IYBG 3CCQA 1KD1C 4RG1A 1VQ9A 2OQ0A 4DAMA 1PYSB 4HJ5A 1Q81C 1VQ6A 3UDFA 2CKZB 1E7ZA 2BH8A 1CUKA 5C44H 2ZTDA 4P73A 4YCUA 5LMNL 1PH5A 3PSIA 1J5EQ 3CCMA 1A63A 3OYYA 4LUOA 4P74A 5GAGC 1Y1VG 4QJFA 4DV3Q 1WYDA 1W2BA 4JI8Q 5FJ8H 1S3OA 1LM0A 1X65A 3K8AA 2VNUD 3HOVG 4IFDG 2I5MX 1UWVA 1JJ2A 4YCVA 4LF6L 3PF4A 2UXCL 2N78A 3S24A 4X66L 3KJPA 4A3GG 1N34Q 1JJGA 1LUZA 1SROA 4RMFA 3K7UC 2OWOA 1E1TA 1OXUA 2DGYA 4QY7A 2UUCQ 1AE2A 1C9OA 2JA5H 4L5SA 4B3TL 1L2FA 1YEZA 1IXRA 4UY8C 1Q7YC 2MQHA 2XTIA 4P72A 1C7YA 2F3IA 5BR8Q 1RIPA 2BA0A 3PCOB 1VQIA 1YBYA 1HNWL 3M9BA 4IPDA 5M5XH 2UUAQ 3ULLA 2F4VQ 1SN8A 4LF6Q 2GVBA 2UXCQ 1IZ6A 4R4IA 3CCLA 4X6AH 2PI2E 1YJNA 3FKIH 4MTNA 3CC7A 1EYGA 1NY4A 2ID0A 3H0GH 4DV7L 3W1GA 4DNIA 2N8NA 1PHJA 4DR7Q 1HZCA 4LWCA 3RLFA 3TREA 4POFA 5ELNA 1OXXK 4A75A 4DV2L 1M90C 3M3YH 2UXDQ 5K36G 3S14H 1G291 1PH9A 3TRZA 5M5WH 3AYHB 4BY1H 2IX0A 4GN4B 2JA7G 4R4QA 1HZAA 4GNXC 3PO2G 3EN2A 2CWAA 4QGUA 1YNXA 5E7NA 1YZ6A 1SLJA 3CCSA 2B63G 3UE1A 4DV5L 4DV7Q 2IHEA 2MO1A 3S1RH 5C0XG 5M3MH 5LMUL 1CSPA 1VQCA 1UEBA 1PV4A 4A3BG 3STBD 1B7YB 1VQMA 5HY6A 2B3GA 2YTXA 2LSSA 1A62A 1L1OB 2ZTEA 3M4OH 2JA6H 4GKKL 3AFQA 2A1AA 3J80c 3HOUH 4A3MG 3D31A 1KXLA 3CC2A 3OTOL 3W1BA 2HHHQ 4YY3Q 4JYAQ 2KCMA 3F1ZA 3STBC 5C4XH 2E5LL 1K3RA 5M3FG 4JI2L 3L0OA 2B29A 2VL6A 3GDEA 1MKHA 5H1SE 4GLXA 4LF5Q 4A3LG 5IYCH 2JA8G 2EXDA 4NXNQ 4BBSH 3D0FA 4A3KH 4YCWA 4DR2L 1E24A 2CWPA 4C3HH 3L2PA 3S2DH 4UP9A 1S72A 4NXML 3PUWA 3UE0A 2ZJPA 1PFSA 3GTMH 3ZJYC 3J7A5 4JI4Q 2EQSA 2K52A 2VZAA 1VQ5A 1HR0Q 4B3MQ 1G51A 3HKZG 2VQEQ 3GTGH 3HOYG 1CKMA 2E5LQ 1H95A 3HOWG 4A4IA 2ZTCA 4JI2Q 3RZDH 2K4KA 2KBNA 1WJJA 1FL0A 2MO0A 4JOIA 3MXNB 4HJ7A 2Q2IA 1XPOA 2R93G 4DR3L 1NTGA 1SE8A 3CMEA 3M85A 3K0XA 4IJHA 4DR2Q 1NMFA 1Y14B 2HIXA 4DAYB 4BY7H 4JI5L 4JI3L 1BVSA 4OO1I 3S1QH 1GM5A 3HOXH 2ES2A 1CKNB 4OX9L 1KIXA 3CD6A 1J5EL 3UDXA 2CCZA 2YTVA 3BU2A 4A3EG 5IP9G 1UE1A 1KQSA 2WFWA 1EWIA 4DV3L 2NZHA 5EAYA 1WFQA 3RR5A 2UU9L 1QZHA 3KOJA 4JC0A 3F2DA 3NELA 4DR3Q 4LW1A 4R4OA 4DV0Q 3S2HH 4DR4Q 3K81C 1N34L 4KHZA 5C3EG 4JI3Q 4JI5Q 2NVTH 1OXVA 2R92H 1E3PA 1YHBA 2UUCL 2Z6KA 4JBMA 4PZ7A 3J81c 4GOPB 4A3FG 5M5YH 1QVCA 1YIJA 1PH7A 4BBRG 3AEVA 4IFDJ 1OXTA 1GKHA 4AYBG 2DUDA 2AWOA 1HZ9A 3CW2C 2NVYH 4IPGA 5BR8L 3AQQA 2UU9Q 5IE8A 1OTCA 2R7ZG 1U0LA 3A0JA 3WWVA 2UUAL 2F4VL 2NN6G 3J80i 3CXCA 1IBKQ 3U50C 4KLKA 3E0EA 4JV5L 1VQGA 3I4NG 4GS3A 2VW9A 1Q82C 1ASYA 4IFDI 3T1YQ 4DR7L 4HIMA 5J3BA 3UDIA 2VS1A 3KF8B 1XPRA 1X56A 3GTOH 1WOCA 1L0WA 2ZJRA 4GKJL 5IYDH 3FP9A 4JI6L 2UXDL 3TEHB 3G6EA 4LUZA 4JCVE 2Y0SG 2MFIA 4H02A 3PO3G 2KHJA 3KLWA 2JK8A 4KI0A 1VQ8A 4APVA 1IBLQ 5JJKA 2K75A 4Y7NH 4JV5Q 1DGSA 2AKWB 2PNHA 2WAQG 2K14A 3HFZB 5IWAQ 3HOZG 1WCMG 3T1HQ 3PF5A 1AE3A 1X54A 5FLMG 2MNAA 3I4OA 4GKJQ 4BXXH 5GAEC 4JI6Q 5IYBH 2D0OA 1L1OA 3RLNA 3EIVA 2D0PA 4B3SQ 3PUYA 1PH8A 1VQEA 3EBEA 1Y1WG 1I94L 1VQAA 4GLVB 4ALPA 1JJCB 1HJPA 2HHHL 1IL2A 4YY3L 4XIGS 5IP7G 4JYAL 4IO9A 5LMNW 1Y1VH 2JJQA 4DR6Q 5C0XJ 2UXBQ 4WJ3M 1KC8C 1X6OA 2AWNA 2GN5A 1X9NA 1ASZA 3E9HA 3HOVH 4JBJA 4A3IG 3GTKH 1GVPA 5JEAG 4LF8Q 3JAMc 4LF5L 4UP7A 2CQOA 2ALYB 4LF4Q 1SRUA 4NXNL 4LFBL 1XTDA 4QIWE 2WB1G 4TVAB 3GTPH 4A3GH 4LF7Q 1BBWA 3BZKA 3F2CA 4A3CG 2AMCB 1VQOA 3I4NH 3RN5A 1PH6A 4A93G 4GN3B 1I94Q 1E1OA 5C0XI 3RN2A 4OXPA 4IOAA 2NZOA 4JI4L 4MZ9A 4AYBE 3ERSX 4A3DG 4R4CA 4GN5A 4C2MH 2VQEL 1HR0L 4B3ML 2K5HA 2N3SA 1XPUA 5DLQE 1KHIA 3Q8DA 3F2BA 4LF9L 1VQJA 2VUMG 1EQQA 4PMWA 1X3GA 1SR3A 3NEMA 3A5UA 1NBWA 1K8AC 1Q46A 4LFBQ 3A74A 2OTJA 2BA1A 3DM3A 2A19A 3I7FA 5GADC 3PGZA 2L15A 2I0QA 1N36Q 3S1MH 2H5XA 2JEBI 3CF5A 1PA6A 4NB3A 1KRTA 2I5HA 1J6QA 4DUYQ 4OX9Q 2IX1A 3HKSA 3CCJA 1EOVA 3JC66 4EQ5A 1CKNA 4FDBA 4IJLA 2OTLA 2GVAA 3A5ZB 3S15H 1Q1EA 4JOIC 4UP8A 1YHQA 1XNQQ 4LF9Q 3I4MG 4B3RQ 1K83H 1CSQA 3KFUA 2IY5B 2JA9A 4YWMA 3GTJH 2BH2A 1Q86C 4DR1Q 1B8AA 4X65L 2JA7H 3PO2H 2RHSB 2Q2HA 1UE6A 3NBHB 2R6GA 4KHPL 4LFAQ 2B63H 1VQKA 1M1KC 1AH9A 4OONA 4TQUS 4DV0L 3S1NH 5C44G 1Q1BA 1E22A 4L5QA 4DR4L 4C3IH 4YWKA 4A3BH 1VQBA 5IT9c 1VQHA 3ULPA 1GD7A 1R9TH 5FJ8G 4GOPA 4DV4Q 1N32L 2A8VA 3J7ZC 1XNRL 2K50A 3J81j 2RF4A 4A3MH 2F52A 4X65Q 1U5KA 1VQ4A 1LTLA 1S40A 2I5LX 3S16H 4WJ4A 2E2IH 4KHPQ 4JG2A 3RLOA 5M3FH 4PZ6A 5GAHC 2Z6KC 1IBKL 4DR5L 1FVIA 1TXYA 3KF6B 2VQFL 1EIFA 2JE6I 2JQOA 2WB1E 4A3LH 4XTCS 2JA8H 3TQYA 4R4TA 3OW2A 3PV0A 1A0IA 3PIPA 4IPHA 1MJEA 1N33Q 4NPSA 3TS2A 4DUZL 1Q12A 3T1YL 3CCVA 1N32Q 4AQYL 2K5VA 1WI5A 3JAMi 4JI7L 4AIMA 4DK6C 4HJAA 1XNRQ 3U4ZA 1KAWA 2YYZA 1UE5A 4YHHQ 2JEAI 3CC4A 3HOYH 1T9HA 2R7DA 3FKIG 1TWFH 3FHWA 4OWTB 3H0GG 2E2HH 3HOWH 2HQLA 2ZM6Q 4DR5Q 4P71A 2VQFQ 3K80C 1P8LA 2KCTA 1IBLL 2PMZE 3AFPA 1UE7A 2KHIA 1QVGA 3G48A 1MIUA 1TWGH 1W3SA 5IWAL 2R93H 4DUZQ 3G4SA 3KJOA 4OWWB 2D62A 2NN6I 4AQYQ 1SMXA 4BY1G 3T1HL 4JI7Q 4QL5A 3HKZE 4A76A 2NVQH 1X3EA 2ASBA 4B3SL 4P75A 1VCIA 1XMQL 3M7NA 5C4JH 1YJWA 1PH2A 1IYJB 4HIOA 1K9MC 1N9WA 1O7IA 5IP9H 4DV1Q 3RNUA 4A3EH 4GLAC 5M3MG 3L7ZC 1VQ7A 2UUBQ 2UXBL 4DR6L 3KDFB 1TWHH 2XGTA 2YV5A 3BZCA 4PZ8A 2C35B 2K5NA 4BA2I 3U58A 4LF8L 1L1OC 1PYBA 3TS0A 1K8GA 2Z0SA 3PUXA 3G71A 1XMOL 4LF4L 3CQZH 2HIVA 1PH4A 2PI2A 1RL2A 2JA6G 4K0KL 5LMNQ 3HOUG 2Q2UA 2QGQA 2YTYA 4UPAA 4LF7L 2VY3A 5C3EH 1D7QA 1NE3A 1XMQQ 5C4XG 3M4QA 3ER0A 1BBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F H;  3CCE A;  4QQB X;  3H3V I;  4BBR H;  1HNZ L;  4O0A A;  5JEA J;  5IYC G;  4DPG A;  1JMC A;  4BBS G;  2E8G A;  1N8R C;  4X66 Q;  1YHA A;  5GRO A;  4DK3 C;  4A3K G;  2AHO B;  2R7Z H;  2R7F A;  1V1Q A;  2OCE A;  2RCN A;  1NJI C;  3CAM A;  2Q2T A;  1PVO A;  1I5F A;  5GQO A;  1XMO Q;  2LXK A;  4K0K Q;  3VDY A;  1FJG L;  1HNX L;  3CMA A;  3GTL H;  4AH6 A;  4B3T Q;  2QEX A;  1N36 L;  1X55 A;  1PH3 A;  1KL9 A;  4MNO A;  5ELO A;  4DUY L;  1EUJ A;  4HJ9 A;  4POG A;  1QZG A;  4X62 L;  3ICE A;  1I6H H;  5HGQ A;  4YWL A;  1HNW Q;  1HNZ Q;  3CCU A;  2E2J H;  1XNQ L;  1K73 C;  1TWA H;  4B3R L;  4HIK A;  3PO3 H;  1A8V A;  5IY0 A;  3J81 i;  4HID A;  4JI0 L;  1QUQ A;  2YU9 H;  3K7A H;  4DV6 L;  3CCR A;  4DR1 L;  1HZB A;  1OXS C;  2LXJ A;  3I56 A;  4GNX A;  1P16 A;  2WP8 J;  4PG3 A;  3CPF A;  1K0R A;  3NEN A;  1HNX Q;  1FJG Q;  4BY7 G;  1VQN A;  1X3F A;  2N49 A;  3HOX G;  4DKA C;  4LFA L;  4X64 L;  5JJI A;  1GO3 E;  4DV2 Q;  3HOZ H;  3F8T A;  4OWX B;  1WCM H;  3IRB A;  3PUZ A;  4BA1 I;  4X62 Q;  1JB7 A;  3H3V H;  5FLM H;  3CPW A;  1YIT A;  2HT1 A;  2Y0S E;  1KRS A;  1VQD A;  4JBW A;  3RZO H;  4A3J G;  1C0A A;  1D8L A;  1Z47 A;  1LYL A;  4C3J H;  4DV4 L;  1Y1W H;  1G6P A;  3ULJ A;  4JI0 Q;  1YJ9 A;  4DV6 Q;  1B70 B;  1QUQ B;  4DV5 Q;  1VQF A;  5JJL A;  3PUV A;  5IP7 H;  3B6Y A;  5LMU Q;  4GNX B;  2NVX H;  4LNQ A;  1MJC A;  2WAQ E;  1V9P A;  2ATW A;  1YI2 A;  3GO5 A;  3DLL A;  3KF6 A;  4X64 Q;  3UDG A;  4A3I H;  5FLX c;  2R92 G;  4GOP C;  1QVF A;  1EFW A;  3GTQ H;  1XJV A;  1I3Q H;  2IT1 A;  4JI1 L;  1EIY B;  4GKK Q;  1SFO H;  2RHQ B;  1EQR A;  1N33 L;  3CP0 A;  3KYH C;  3OTO Q;  4A3C H;  5AJ3 L;  4HJ8 A;  4Y52 H;  4A93 H;  1YVC A;  4L5T A;  4YHH L;  3I55 A;  4A3D H;  1HH2 P;  2PQA A;  4LUV A;  1TWC H;  4OO1 G;  1PH1 A;  4EX5 A;  2VUM H;  1HR0 W;  3GD7 A;  3E9I A;  2ZM6 L;  1Z9F A;  3H15 A;  1VQP A;  2JA5 G;  3W5O A;  4IPC A;  4JI1 Q;  4LFC L;  1IBM L;  1CKO A;  5IYD G;  4NXM Q;  3PIO A;  3S17 H;  1Q8K A;  3U4V A;  3I2Z A;  2KEN A;  3BJU A;  2IHF A;  5AJ3 Q;  2V1C C;  4L5R C;  3SGI A;  1VS0 A;  2EIF A;  2QA4 A;  1JT8 A;  4R1J A;  3LGJ A;  2CFM A;  1V43 A;  2OQK A;  2PQA B;  4JI8 L;  1FGU A;  4A3J H;  4JBK A;  3I4M H;  4DV1 L;  1BKB A;  3KDF A;  2ZJQ A;  2UUB L;  4ME3 A;  1I50 H;  1JE5 A;  1IBM Q;  2FXQ A;  3M4P A;  3MEF A;  4J15 A;  4IOC A;  1NMG A;  1VQL A;  4LFC Q;  4O2D A;  4BXX G;  5IYB G;  3CCQ A;  1KD1 C;  4RG1 A;  1VQ9 A;  2OQ0 A;  4DAM A;  1PYS B;  4HJ5 A;  1Q81 C;  1VQ6 A;  3UDF A;  2CKZ B;  1E7Z A;  2BH8 A;  1CUK A;  5C44 H;  2ZTD A;  4P73 A;  4YCU A;  5LMN L;  1PH5 A;  3PSI A;  1J5E Q;  3CCM A;  1A63 A;  3OYY A;  4LUO A;  4P74 A;  5GAG C;  1Y1V G;  4QJF A;  4DV3 Q;  1WYD A;  1W2B A;  4JI8 Q;  5FJ8 H;  1S3O A;  1LM0 A;  1X65 A;  3K8A A;  2VNU D;  3HOV G;  4IFD G;  2I5M X;  1UWV A;  1JJ2 A;  4YCV A;  4LF6 L;  3PF4 A;  2UXC L;  2N78 A;  3S24 A;  4X66 L;  3KJP A;  4A3G G;  1N34 Q;  1JJG A;  1LUZ A;  1SRO A;  4RMF A;  3K7U C;  2OWO A;  1E1T A;  1OXU A;  2DGY A;  4QY7 A;  2UUC Q;  1AE2 A;  1C9O A;  2JA5 H;  4L5S A;  4B3T L;  1L2F A;  1YEZ A;  1IXR A;  4UY8 C;  1Q7Y C;  2MQH A;  2XTI A;  4P72 A;  1C7Y A;  2F3I A;  5BR8 Q;  1RIP A;  2BA0 A;  3PCO B;  1VQI A;  1YBY A;  1HNW L;  3M9B A;  4IPD A;  5M5X H;  2UUA Q;  3ULL A;  2F4V Q;  1SN8 A;  4LF6 Q;  2GVB A;  2UXC Q;  1IZ6 A;  4R4I A;  3CCL A;  4X6A H;  2PI2 E;  1YJN A;  3FKI H;  4MTN A;  3CC7 A;  1EYG A;  1NY4 A;  2ID0 A;  3H0G H;  4DV7 L;  3W1G A;  4DNI A;  2N8N A;  1PHJ A;  4DR7 Q;  1HZC A;  4LWC A;  3RLF A;  3TRE A;  4POF A;  5ELN A;  1OXX K;  4A75 A;  4DV2 L;  1M90 C;  3M3Y H;  2UXD Q;  5K36 G;  3S14 H;  1G29 1;  1PH9 A;  3TRZ A;  5M5W H;  3AYH B;  4BY1 H;  2IX0 A;  4GN4 B;  2JA7 G;  4R4Q A;  1HZA A;  4GNX C;  3PO2 G;  3EN2 A;  2CWA A;  4QGU A;  1YNX A;  5E7N A;  1YZ6 A;  1SLJ A;  3CCS A;  2B63 G;  3UE1 A;  4DV5 L;  4DV7 Q;  2IHE A;  2MO1 A;  3S1R H;  5C0X G;  5M3M H;  5LMU L;  1CSP A;  1VQC A;  1UEB A;  1PV4 A;  4A3B G;  3STB D;  1B7Y B;  1VQM A;  5HY6 A;  2B3G A;  2YTX A;  2LSS A;  1A62 A;  1L1O B;  2ZTE A;  3M4O H;  2JA6 H;  4GKK L;  3AFQ A;  2A1A A;  3J80 c;  3HOU H;  4A3M G;  3D31 A;  1KXL A;  3CC2 A;  3OTO L;  3W1B A;  2HHH Q;  4YY3 Q;  4JYA Q;  2KCM A;  3F1Z A;  3STB C;  5C4X H;  2E5L L;  1K3R A;  5M3F G;  4JI2 L;  3L0O A;  2B29 A;  2VL6 A;  3GDE A;  1MKH A;  5H1S E;  4GLX A;  4LF5 Q;  4A3L G;  5IYC H;  2JA8 G;  2EXD A;  4NXN Q;  4BBS H;  3D0F A;  4A3K H;  4YCW A;  4DR2 L;  1E24 A;  2CWP A;  4C3H H;  3L2P A;  3S2D H;  4UP9 A;  1S72 A;  4NXM L;  3PUW A;  3UE0 A;  2ZJP A;  1PFS A;  3GTM H;  3ZJY C;  3J7A 5;  4JI4 Q;  2EQS A;  2K52 A;  2VZA A;  1VQ5 A;  1HR0 Q;  4B3M Q;  1G51 A;  3HKZ G;  2VQE Q;  3GTG H;  3HOY G;  1CKM A;  2E5L Q;  1H95 A;  3HOW G;  4A4I A;  2ZTC A;  4JI2 Q;  3RZD H;  2K4K A;  2KBN A;  1WJJ A;  1FL0 A;  2MO0 A;  4JOI A;  3MXN B;  4HJ7 A;  2Q2I A;  1XPO A;  2R93 G;  4DR3 L;  1NTG A;  1SE8 A;  3CME A;  3M85 A;  3K0X A;  4IJH A;  4DR2 Q;  1NMF A;  1Y14 B;  2HIX A;  4DAY B;  4BY7 H;  4JI5 L;  4JI3 L;  1BVS A;  4OO1 I;  3S1Q H;  1GM5 A;  3HOX H;  2ES2 A;  1CKN B;  4OX9 L;  1KIX A;  3CD6 A;  1J5E L;  3UDX A;  2CCZ A;  2YTV A;  3BU2 A;  4A3E G;  5IP9 G;  1UE1 A;  1KQS A;  2WFW A;  1EWI A;  4DV3 L;  2NZH A;  5EAY A;  1WFQ A;  3RR5 A;  2UU9 L;  1QZH A;  3KOJ A;  4JC0 A;  3F2D A;  3NEL A;  4DR3 Q;  4LW1 A;  4R4O A;  4DV0 Q;  3S2H H;  4DR4 Q;  3K81 C;  1N34 L;  4KHZ A;  5C3E G;  4JI3 Q;  4JI5 Q;  2NVT H;  1OXV A;  2R92 H;  1E3P A;  1YHB A;  2UUC L;  2Z6K A;  4JBM A;  4PZ7 A;  3J81 c;  4GOP B;  4A3F G;  5M5Y H;  1QVC A;  1YIJ A;  1PH7 A;  4BBR G;  3AEV A;  4IFD J;  1OXT A;  1GKH A;  4AYB G;  2DUD A;  2AWO A;  1HZ9 A;  3CW2 C;  2NVY H;  4IPG A;  5BR8 L;  3AQQ A;  2UU9 Q;  5IE8 A;  1OTC A;  2R7Z G;  1U0L A;  3A0J A;  3WWV A;  2UUA L;  2F4V L;  2NN6 G;  3J80 i;  3CXC A;  1IBK Q;  3U50 C;  4KLK A;  3E0E A;  4JV5 L;  1VQG A;  3I4N G;  4GS3 A;  2VW9 A;  1Q82 C;  1ASY A;  4IFD I;  3T1Y Q;  4DR7 L;  4HIM A;  5J3B A;  3UDI A;  2VS1 A;  3KF8 B;  1XPR A;  1X56 A;  3GTO H;  1WOC A;  1L0W A;  2ZJR A;  4GKJ L;  5IYD H;  3FP9 A;  4JI6 L;  2UXD L;  3TEH B;  3G6E A;  4LUZ A;  4JCV E;  2Y0S G;  2MFI A;  4H02 A;  3PO3 G;  2KHJ A;  3KLW A;  2JK8 A;  4KI0 A;  1VQ8 A;  4APV A;  1IBL Q;  5JJK A;  2K75 A;  4Y7N H;  4JV5 Q;  1DGS A;  2AKW B;  2PNH A;  2WAQ G;  2K14 A;  3HFZ B;  5IWA Q;  3HOZ G;  1WCM G;  3T1H Q;  3PF5 A;  1AE3 A;  1X54 A;  5FLM G;  2MNA A;  3I4O A;  4GKJ Q;  4BXX H;  5GAE C;  4JI6 Q;  5IYB H;  2D0O A;  1L1O A;  3RLN A;  3EIV A;  2D0P A;  4B3S Q;  3PUY A;  1PH8 A;  1VQE A;  3EBE A;  1Y1W G;  1I94 L;  1VQA A;  4GLV B;  4ALP A;  1JJC B;  1HJP A;  2HHH L;  1IL2 A;  4YY3 L;  4XIG S;  5IP7 G;  4JYA L;  4IO9 A;  5LMN W;  1Y1V H;  2JJQ A;  4DR6 Q;  5C0X J;  2UXB Q;  4WJ3 M;  1KC8 C;  1X6O A;  2AWN A;  2GN5 A;  1X9N A;  1ASZ A;  3E9H A;  3HOV H;  4JBJ A;  4A3I G;  3GTK H;  1GVP A;  5JEA G;  4LF8 Q;  3JAM c;  4LF5 L;  4UP7 A;  2CQO A;  2ALY B;  4LF4 Q;  1SRU A;  4NXN L;  4LFB L;  1XTD A;  4QIW E;  2WB1 G;  4TVA B;  3GTP H;  4A3G H;  4LF7 Q;  1BBW A;  3BZK A;  3F2C A;  4A3C G;  2AMC B;  1VQO A;  3I4N H;  3RN5 A;  1PH6 A;  4A93 G;  4GN3 B;  1I94 Q;  1E1O A;  5C0X I;  3RN2 A;  4OXP A;  4IOA A;  2NZO A;  4JI4 L;  4MZ9 A;  4AYB E;  3ERS X;  4A3D G;  4R4C A;  4GN5 A;  4C2M H;  2VQE L;  1HR0 L;  4B3M L;  2K5H A;  2N3S A;  1XPU A;  5DLQ E;  1KHI A;  3Q8D A;  3F2B A;  4LF9 L;  1VQJ A;  2VUM G;  1EQQ A;  4PMW A;  1X3G A;  1SR3 A;  3NEM A;  3A5U A;  1NBW A;  1K8A C;  1Q46 A;  4LFB Q;  3A74 A;  2OTJ A;  2BA1 A;  3DM3 A;  2A19 A;  3I7F A;  5GAD C;  3PGZ A;  2L15 A;  2I0Q A;  1N36 Q;  3S1M H;  2H5X A;  2JEB I;  3CF5 A;  1PA6 A;  4NB3 A;  1KRT A;  2I5H A;  1J6Q A;  4DUY Q;  4OX9 Q;  2IX1 A;  3HKS A;  3CCJ A;  1EOV A;  3JC6 6;  4EQ5 A;  1CKN A;  4FDB A;  4IJL A;  2OTL A;  2GVA A;  3A5Z B;  3S15 H;  1Q1E A;  4JOI C;  4UP8 A;  1YHQ A;  1XNQ Q;  4LF9 Q;  3I4M G;  4B3R Q;  1K83 H;  1CSQ A;  3KFU A;  2IY5 B;  2JA9 A;  4YWM A;  3GTJ H;  2BH2 A;  1Q86 C;  4DR1 Q;  1B8A A;  4X65 L;  2JA7 H;  3PO2 H;  2RHS B;  2Q2H A;  1UE6 A;  3NBH B;  2R6G A;  4KHP L;  4LFA Q;  2B63 H;  1VQK A;  1M1K C;  1AH9 A;  4OON A;  4TQU S;  4DV0 L;  3S1N H;  5C44 G;  1Q1B A;  1E22 A;  4L5Q A;  4DR4 L;  4C3I H;  4YWK A;  4A3B H;  1VQB A;  5IT9 c;  1VQH A;  3ULP A;  1GD7 A;  1R9T H;  5FJ8 G;  4GOP A;  4DV4 Q;  1N32 L;  2A8V A;  3J7Z C;  1XNR L;  2K50 A;  3J81 j;  2RF4 A;  4A3M H;  2F52 A;  4X65 Q;  1U5K A;  1VQ4 A;  1LTL A;  1S40 A;  2I5L X;  3S16 H;  4WJ4 A;  2E2I H;  4KHP Q;  4JG2 A;  3RLO A;  5M3F H;  4PZ6 A;  5GAH C;  2Z6K C;  1IBK L;  4DR5 L;  1FVI A;  1TXY A;  3KF6 B;  2VQF L;  1EIF A;  2JE6 I;  2JQO A;  2WB1 E;  4A3L H;  4XTC S;  2JA8 H;  3TQY A;  4R4T A;  3OW2 A;  3PV0 A;  1A0I A;  3PIP A;  4IPH A;  1MJE A;  1N33 Q;  4NPS A;  3TS2 A;  4DUZ L;  1Q12 A;  3T1Y L;  3CCV A;  1N32 Q;  4AQY L;  2K5V A;  1WI5 A;  3JAM i;  4JI7 L;  4AIM A;  4DK6 C;  4HJA A;  1XNR Q;  3U4Z A;  1KAW A;  2YYZ A;  1UE5 A;  4YHH Q;  2JEA I;  3CC4 A;  3HOY H;  1T9H A;  2R7D A;  3FKI G;  1TWF H;  3FHW A;  4OWT B;  3H0G G;  2E2H H;  3HOW H;  2HQL A;  2ZM6 Q;  4DR5 Q;  4P71 A;  2VQF Q;  3K80 C;  1P8L A;  2KCT A;  1IBL L;  2PMZ E;  3AFP A;  1UE7 A;  2KHI A;  1QVG A;  3G48 A;  1MIU A;  1TWG H;  1W3S A;  5IWA L;  2R93 H;  4DUZ Q;  3G4S A;  3KJO A;  4OWW B;  2D62 A;  2NN6 I;  4AQY Q;  1SMX A;  4BY1 G;  3T1H L;  4JI7 Q;  4QL5 A;  3HKZ E;  4A76 A;  2NVQ H;  1X3E A;  2ASB A;  4B3S L;  4P75 A;  1VCI A;  1XMQ L;  3M7N A;  5C4J H;  1YJW A;  1PH2 A;  1IYJ B;  4HIO A;  1K9M C;  1N9W A;  1O7I A;  5IP9 H;  4DV1 Q;  3RNU A;  4A3E H;  4GLA C;  5M3M G;  3L7Z C;  1VQ7 A;  2UUB Q;  2UXB L;  4DR6 L;  3KDF B;  1TWH H;  2XGT A;  2YV5 A;  3BZC A;  4PZ8 A;  2C35 B;  2K5N A;  4BA2 I;  3U58 A;  4LF8 L;  1L1O C;  1PYB A;  3TS0 A;  1K8G A;  2Z0S A;  3PUX A;  3G71 A;  1XMO L;  4LF4 L;  3CQZ H;  2HIV A;  1PH4 A;  2PI2 A;  1RL2 A;  2JA6 G;  4K0K L;  5LMN Q;  3HOU G;  2Q2U A;  2QGQ A;  2YTY A;  4UPA A;  4LF7 L;  2VY3 A;  5C3E H;  1D7Q A;  1NE3 A;  1XMQ Q;  5C4X G;  3M4Q A;  3ER0 A;  1BBU A; 
#chains in the Genus database with same CATH topology
 2XN9 C;  3GV7 B;  4I55 F;  3VA7 A;  4JVZ A;  4F8M A;  4O0A A;  1CQJ B;  2UXD H;  1JMC A;  2E8G A;  5D14 A;  5KFG A;  1K1S A;  3OIP A;  2R7F A;  1V1Q A;  4ZUJ A;  3DWP A;  3NHH A;  4C3H G;  3VDY A;  5KNB A;  2KEC A;  3CMA A;  2KA7 A;  1S9F A;  5ELO A;  2XVS A;  2XGP A;  3BVG A;  3TP7 A;  4DUY L;  1EUJ A;  2C2D A;  3A8J E;  4OHJ A;  5IT9 L;  4ECW A;  3ICE A;  5KND A;  5CV5 A;  1A15 A;  4DV2 H;  4O4L F;  4J9S A;  2E2J H;  1XNQ L;  5KG1 A;  5KX5 F;  3PO3 H;  5IY0 A;  3HS0 C;  4JI0 L;  2C00 A;  2FFK B;  2EJF C;  1HZB A;  3I56 A;  2XWJ B;  2K04 A;  3MA2 B;  3QFF A;  2HHH H;  4Y7N B;  1DD2 A;  1CQV A;  3NEN A;  5I6W A;  4DV5 H;  4X64 L;  3RB4 A;  5CA1 F;  2BCO A;  4LF5 H;  2Z4H A;  4Q44 A;  3F8T A;  4QW8 A;  3X3M A;  1DJR D;  3PUZ A;  1BNZ A;  2YL2 A;  3H3V H;  1AP0 A;  5A2Q W;  2JA6 A;  5FLM H;  2HT1 A;  4F4Y A;  5JOB A;  1SSO A;  2EJG C;  3NUC A;  4Y8V B;  4CJ2 C;  2F0G A;  5L1L A;  1V1O A;  1VQF A;  2VQE H;  2K01 A;  2XCA A;  5LMU Q;  2NVX H;  1EHI A;  2WAQ E;  5ELF A;  2YYA A;  3DLL A;  3KF6 A;  4JI2 H;  5FLX c;  2AUJ D;  3DWQ A;  5JVG 3;  3GTQ H;  2F4I A;  1EIY B;  2IT1 A;  4GKK Q;  3N52 A;  2FHT A;  1EQR A;  1N33 L;  1E4F T;  3CP0 A;  3HEJ A;  2EPB A;  5FK9 C;  3OTO Q;  2HJW A;  4O3O A;  1H9S B;  4A3C H;  4DR2 H;  2PNR C;  4I7H A;  3T5H A;  4ZRZ A;  4Y52 H;  2ASJ A;  5KFV A;  1RK5 A;  1STA A;  4L5T A;  3ETJ A;  4RNM A;  1SBB B;  2PQA A;  4H7B A;  1KBL A;  4HYK A;  2HQE A;  3A55 A;  2LFN A;  1Z9F A;  4B08 A;  1B4O A;  3TME A;  1VQP A;  4H0L C;  4JI1 Q;  4LFC L;  4NXM Q;  1CKO A;  5AFW A;  5IYD G;  3EYY A;  3PIO A;  3S17 H;  3OOC A;  3K5I A;  1F2Z A;  2KEN A;  5AJ3 Q;  3QIA A;  4ABN A;  2HD3 A;  1BJT A;  5ELB A;  1Z2O X;  1B9M A;  2B2Y C;  2F0H A;  1O75 A;  5DGA A;  4R1J A;  2CFM A;  3MXP A;  4F87 A;  4A3J H;  2PQA B;  1IW7 D;  1J5E H;  2JA7 B;  3MFH A;  3NE5 B;  3K5N A;  1CE8 A;  4DV3 H;  2UUB L;  1I50 H;  1KC7 A;  4YR2 A;  4ED0 A;  1VQL A;  4O2D A;  3CCQ A;  1SAP A;  4RG1 A;  5HGT A;  4O4H F;  4V19 0;  1PYS B;  5DNF A;  4IUU A;  4MTK A;  2ENB A;  1Q81 C;  4KKT A;  2CKZ B;  3C46 A;  4M1U B;  1CUK A;  2F0D A;  5C44 H;  1ZXT A;  4YCU A;  4OX9 Q;  5IGG A;  2ATL A;  3E5N A;  2B2T C;  3BVM A;  3WO0 A;  2UUC H;  2ICE C;  1JR0 D;  4ECS A;  1PTO B;  1YNJ C;  5FKA C;  1XDN A;  4YCV A;  2ALZ A;  3S16 B;  5BR8 H;  2N78 A;  3EA6 A;  4X66 L;  1N34 Q;  1BXR A;  1M0T A;  2VUG A;  2UUA H;  3MWM A;  5JUM A;  1E1T A;  1PRT D;  2DGY A;  2N88 A;  2O2L D;  3R3O A;  4NKL A;  4J8Q A;  2QKI C;  4QY7 A;  3J7Y W;  1PLF A;  2BE5 C;  4L5S A;  4B3T L;  1YEZ A;  4Q8E A;  1J9O A;  2XTI A;  3GTO A;  5KFP A;  4DR7 H;  2C5C A;  3KXY T;  2BA0 A;  5F2D A;  4IUR A;  3OWF A;  3QR8 A;  4GKJ H;  4IPD A;  3QOJ A;  3ULL A;  4JI6 H;  3HOY B;  3TZD A;  2UXC Q;  5KFK A;  2PI2 E;  3FKI H;  4MTN A;  1TWH A;  2AGQ A;  4XQN A;  1I7L A;  2ID0 A;  4DV7 L;  3W1G A;  2EXZ A;  2RSN A;  3JAM E;  2FKL A;  2L55 A;  2QYZ A;  1TWG B;  2NUA B;  5ELN A;  3FDT A;  4RGM A;  4A75 A;  3KBX A;  3SK4 A;  1Y8P B;  1Q90 A;  2L4N A;  4QUC A;  3R93 A;  1PH9 A;  3TRZ A;  3H40 A;  2X6L A;  2BOS A;  3PO2 G;  4GNX C;  4QGU A;  1YNX A;  5E7N A;  1YZ6 A;  4DL3 A;  3CCS A;  2YW2 A;  1I94 H;  4Q0Y A;  5JPM C;  1TWH B;  1Z2P X;  2IHE A;  2CVR A;  2MO1 A;  3SE0 A;  1SEI A;  3GTK A;  2FB9 A;  1CSP A;  5LL6 S;  1UUP A;  1VQC A;  4C3I G;  3CQZ B;  5HY6 A;  3N8D A;  2B3G A;  5E1F A;  1T36 A;  4QIW B;  3H09 A;  5DQG A;  4KN4 C;  1A2T A;  3SEB A;  1PK8 A;  1G91 A;  2QEJ C;  1ULZ A;  3G7L A;  2BR0 A;  4BBR B;  4EGJ A;  2V58 A;  3LWU A;  5H1S E;  1MKH A;  2EE1 A;  1DON A;  4MN3 A;  2E2D C;  3SK5 A;  3P7J A;  4LMY A;  1Y69 U;  3Q8R B;  2CWP A;  4C3H H;  3L2P A;  2NU8 B;  3UQ8 A;  4TV8 F;  1GUG A;  3UE0 A;  5LYJ F;  4XYL B;  1E4E B;  2KSW A;  3J7A 5;  1EZ8 A;  5BN3 A;  4JI4 Q;  3JSL A;  3NGD A;  1VQ5 A;  1HR0 Q;  1JOR A;  3HKZ G;  1I6H B;  2JEF A;  2E5L Q;  5COY A;  3WOF A;  4FS1 A;  2K4K A;  1WJJ A;  3MAQ A;  2Y0S B;  1TWA B;  4ED3 A;  3M9O B;  5IT9 W;  2YU9 B;  3IFD A;  4ZKB B;  2AUK A;  1XPO A;  2WE6 A;  2DJG C;  1NTG A;  3ONA B;  3K0X A;  2B63 A;  3VYT A;  1NMF A;  4J9M A;  2R8K A;  1KEE A;  4RCO A;  4DAY B;  1ZET A;  4JI5 L;  4JI3 L;  4YP3 A;  5KRU A;  1GM5 A;  4HCE A;  5KT7 A;  1CKN B;  1K8M A;  3SK8 A;  1DYQ A;  3D6C A;  1R9T A;  4DR4 H;  2CCZ A;  3BJY A;  4A3E G;  5IP9 G;  4Q8F A;  4C3J B;  4RB1 A;  2WFW A;  4FF4 A;  1GUS A;  5CC4 A;  1V8Q A;  3F2D A;  2DWC A;  1OO9 B;  5CB4 F;  5KFX A;  2VUM A;  2PW5 A;  2CW7 A;  5C3X A;  1EY9 A;  4QWC A;  4A3I B;  4KHZ A;  1F9P A;  3GIM A;  1EWC A;  1E3P A;  4F4W A;  1I3Q B;  1IBK H;  3SDZ A;  4DR5 H;  2WKD A;  4GOP B;  4A3F G;  1R9T B;  1YIJ A;  2KQ3 A;  1OXT A;  4A93 B;  1GKH A;  4DUZ H;  1STN A;  4AYB G;  2DUD A;  1S03 G;  1HZ9 A;  3AQQ A;  1CZG A;  5BPF A;  1OTC A;  2B2V C;  3JZI A;  3GIL A;  2NN6 G;  1FR3 A;  1TWF A;  2A68 C;  4KJO A;  2E2H A;  2VUM B;  1LAB A;  2FMM A;  5FO7 B;  1SCU B;  2WIN B;  4MA0 A;  4BWG B;  5IYZ F;  4GZY C;  3I4N G;  2EOT A;  3T1Y Q;  2R7K A;  3BG3 A;  1E0B A;  4ECZ A;  4EGV A;  2O5J C;  5IYD H;  2OH2 A;  5IWA H;  4RH6 A;  3FP9 A;  2UXD L;  4BWS C;  3TEH B;  4K6D A;  4JCV E;  2XCP A;  4H02 A;  3VR3 A;  3HRZ C;  2MUY A;  5I2Y A;  5JVH 3;  2JK8 A;  2B2U C;  3I4M B;  1F77 A;  2E2H B;  1TAE A;  3R5F A;  1CT1 D;  1DGS A;  2PZT A;  5C3W A;  2K14 A;  5KT2 A;  4L1K A;  5EPJ A;  4B9X A;  1WCM G;  3PF5 A;  2H4O A;  3I4O A;  4K14 A;  3MTS A;  3RLN A;  1L1O A;  1PFB A;  1AN7 A;  4B3S Q;  4LF4 H;  3PUY A;  5CMD A;  3RAQ A;  4ZAI A;  4EFB A;  3EBE A;  3GV6 A;  4C1N I;  1Y1W G;  4MV8 A;  5BN4 A;  5FD6 A;  1JJC B;  1SEB D;  1HJP A;  2HHH L;  2BQR A;  1ZQ7 A;  5IP7 G;  5TSS A;  5G3L F;  4WJ3 M;  1X6O A;  2F3V A;  1ASZ A;  1ROD A;  2W9C B;  4LF8 Q;  2BQ3 A;  4LF5 L;  1PZK D;  1HXY D;  2ALY B;  2F0E A;  3OW7 A;  4N9T A;  1G2T A;  4NXN L;  4LFB L;  1X3P A;  1XTD A;  3R2I A;  3G6V A;  4MTE A;  3BZK A;  3T56 B;  2FJ2 A;  3D8G A;  2R6F A;  4RKL A;  3RN5 A;  1SXT A;  3RN2 A;  2NZO A;  4JV0 A;  4A3D G;  4C2M H;  2VQE L;  1B04 A;  1Y8O B;  1ESF A;  2N3S A;  2UVV A;  1NUC A;  3X3N A;  4ZK9 B;  1YNN D;  2B39 A;  3PQI A;  3NWT A;  4DN4 M;  3NEM A;  2OF1 A;  1NBW A;  1Q46 A;  1XNQ H;  3I7F A;  2F0J A;  3S1M H;  3BYY B;  4JI0 H;  2I0Q A;  1N36 Q;  2F0U A;  2F0T A;  4HMJ A;  1B3Q A;  5C8Y F;  1D1K A;  1Z6H A;  2I5H A;  5FLX E;  1WTV A;  3PW0 A;  3TP5 A;  3I8Z A;  3N44 B;  3JC6 6;  4J9P A;  4EQ5 A;  1LV9 A;  1RDP D;  4IJL A;  3J81 L;  4X64 H;  5IT9 E;  3A5Z B;  1YHQ A;  2F0Q A;  3IL8 A;  4B3R Q;  1CSQ A;  4YIJ A;  4DL7 A;  3GTJ H;  3TN2 A;  1UNN C;  2ZT9 C;  1B8A A;  4LAA A;  4DR1 Q;  3PO2 H;  5E3F A;  2RHS B;  4KN7 C;  2Q2H A;  1UE6 A;  3S1R B;  1M4V A;  4KHP L;  1VQK A;  1AH9 A;  3R23 A;  2HVS A;  2ZDH A;  4C3I H;  3IAY A;  3W2D A;  3H4D A;  4ECY A;  5FJ8 G;  1EEF D;  1N32 L;  2A8V A;  4Z9C B;  2K50 A;  4KTA A;  5C5J A;  3K6O A;  1V51 A;  5CA0 F;  1VQ4 A;  1S40 A;  4WJ4 A;  2E2I H;  1TWC A;  5IIF A;  4V0B A;  3RLO A;  5GAH C;  2Z6K C;  4RGT A;  1FVI A;  1MSG A;  2VQF L;  2JQO A;  2WB1 E;  3KAK A;  3A54 A;  4XTC S;  4A3K B;  2NU9 B;  3OW2 A;  5JPN C;  2FP4 B;  1A0I A;  5C5L A;  4DLK A;  3AB9 A;  2J6U A;  3TS2 A;  4LH7 A;  1BUV T;  3CCV A;  2EYJ A;  3GTM B;  3VPB A;  1WI5 A;  3JAM i;  3MR3 A;  4LFC H;  4HJA A;  1XNR Q;  3U4Z A;  1UE5 A;  4NDX A;  1T9H A;  1RKN A;  1TA8 A;  4IUV A;  5CYU A;  4OWT B;  4C5C A;  1TWC B;  4IUQ A;  3MXU A;  3RIZ A;  3R5H A;  4OEL B;  2PMZ E;  3SHL A;  2R8J A;  4RGN A;  3JAM L;  1MIU A;  3RBE A;  2XNA C;  3KJO A;  2D62 A;  2QDL A;  4AQY Q;  4JI7 Q;  3HOX B;  3NQT A;  4QL5 A;  5KFI A;  1K8O A;  3HKZ E;  4EQP A;  4P75 A;  1LO5 D;  1XMQ L;  5C4J H;  4QUF A;  1MD2 D;  1N9W A;  4A3E H;  5IP9 H;  3T13 A;  1EZ1 A;  1EY5 A;  1ICW A;  2B2T A;  3L7Z C;  5M3M G;  2UXB L;  1A6X A;  3KDF B;  2YV5 A;  4CHT B;  3BZC A;  4PZ8 A;  1T94 A;  2C35 B;  3S2H B;  3TS0 A;  1K8G A;  3PUX A;  3N43 B;  2JA6 G;  1O7L A;  2F0S A;  5LMN Q;  4CGY B;  2YTY A;  4LF7 L;  2JA5 A;  4ZCK A;  5LXT F;  3EPI A;  5C4X G;  3M4Q A;  3RF2 A;  4K8J A;  2F0F A;  1TVX A;  2O4X A;  5IGC A;  2F0I A;  1IHZ A;  4A3F H;  3CCE A;  3QZ7 A;  3H3V I;  2NBF A;  2ICI A;  1HTL D;  1W6K A;  2RA4 A;  4DPG A;  1N8R C;  1JOQ A;  3ERO A;  5GRO A;  1O7Z A;  4JW0 A;  1UEA B;  2AHO B;  2YS7 A;  3N42 B;  2OCE A;  2IL8 A;  3L4K A;  2NN6 H;  1PVO A;  1XMO Q;  1GHK A;  1F9Q A;  3GV3 A;  3QG1 A;  4K0K Q;  2R85 A;  3H0G A;  2C28 A;  1PH3 A;  4M8A A;  3P20 A;  2JA5 B;  4DV7 H;  3PW5 A;  2DPJ A;  3BS1 A;  1CHP D;  1JWU D;  2J9G A;  5HGQ A;  1M7J A;  1BCP D;  1HNW Q;  1HNZ Q;  3OPO A;  4Q45 A;  3CCU A;  1E4G T;  4CC5 A;  4EG0 A;  2RQX A;  1K73 C;  4ED8 A;  1QUQ A;  5COR A;  4H44 C;  5D65 A;  1O78 A;  4GNX A;  4JYA H;  1P16 A;  4FF1 A;  1K0R A;  3H0G B;  4BY7 G;  2KVM A;  1VBH A;  4DKA C;  5JJI A;  1RD9 D;  4DV2 Q;  1OWT A;  1W6J A;  4OWX B;  4QMG A;  5J2T F;  1WCM H;  3IRB A;  3M3Y B;  2L9H A;  1JB7 A;  3CPW A;  5M5W B;  3RZO H;  1I6U A;  4BY1 B;  4A3J G;  1D8L A;  1Z47 A;  3CHB D;  4DV4 L;  3N6X A;  1Y1W H;  1YJ9 A;  1CM9 A;  4DV6 Q;  1B70 B;  1QUQ B;  4DV5 Q;  5JJL A;  5M9O A;  4IUP A;  4B3M H;  4HAE A;  1GUN A;  5IP7 H;  3B6Y A;  4GNX B;  4LNQ A;  3HOV B;  1RTO A;  4DL5 A;  2R92 G;  3UDG A;  4C5B A;  4GOP C;  1KJQ A;  4PMB A;  3GTP B;  4JI1 L;  1WH2 A;  1SFO H;  1D2B A;  3M4O B;  1SDF A;  3RB6 A;  5AJ3 L;  1RTN A;  5C1O A;  3GTG A;  1MI2 A;  4RCN A;  3NSW A;  2IP4 A;  2BDO A;  1K83 A;  4A3D H;  4IHJ F;  2QK4 A;  4LUV A;  1WTR A;  2PYK A;  4OO1 G;  4EX5 A;  3G6J B;  4U68 A;  5ELE A;  3GD7 A;  3E9I A;  4IRK A;  3H15 A;  1HQR D;  4ETS A;  3W5O A;  4YAJ B;  3TQT A;  5KFU A;  1EY8 A;  2XD4 A;  3MFG A;  4QWB A;  3VA5 A;  4UFZ A;  3I2Z A;  5LP6 F;  2AQ4 A;  1JQY D;  4O42 A;  2V1C C;  4XQJ A;  4FP5 D;  4L5R C;  4DV0 H;  4C5A A;  2EYH A;  4JI5 H;  2DLN A;  4JI3 H;  1M6V A;  3S15 B;  3ND8 A;  1K83 B;  1RCV D;  4U6P A;  1V43 A;  1FGU A;  4JBK A;  2PN1 A;  1QCB D;  5D8D A;  3J81 W;  1U4M A;  4I7Z C;  4DV1 L;  1BKB A;  1DOM A;  4JV1 A;  1RJR A;  1IBM Q;  3M4P A;  3MEF A;  4BXX G;  1FGB D;  3SR1 A;  1SYB A;  1JCK B;  4GC7 A;  4DAM A;  2LY7 A;  1IW7 C;  3ITP A;  4HJ5 A;  4A3B B;  2A73 B;  2BH8 A;  5DM7 3;  1J5E Q;  4JV2 A;  2PQE A;  3L9A X;  4LUO A;  4DXF A;  5GAG C;  3N41 B;  1Y1V G;  4QJF A;  4DV3 Q;  4JPB W;  5FJ8 H;  3K8A A;  3NK9 A;  4IFD G;  2K1B A;  2NVY A;  5D3D A;  2O03 A;  1NSN S;  2UXC L;  4A3G G;  2DY7 A;  4RUA A;  2FK3 A;  2B2V A;  4RMF A;  1B44 D;  1QNU A;  3T16 A;  2MP1 A;  2UUC Q;  3H94 A;  1IBL H;  4UY8 C;  1Q7Y C;  1EL0 A;  1ZHS A;  5DG9 A;  5BR8 Q;  1RIP A;  1CFM A;  1PRT C;  2NVY B;  2UUA Q;  1SN8 A;  3K5M A;  4LF6 Q;  2GVB A;  1IZ6 A;  3HOW B;  5KFW A;  4WJW A;  4ZLT F;  3CCL A;  1LTI D;  5JJZ A;  3H20 A;  2B2U A;  4IAL A;  1U4L A;  4ED7 A;  1PHJ A;  4DR7 Q;  1HZC A;  3TRE A;  5FLX L;  2FMC A;  4ILW A;  1EIG A;  2PCF B;  1M90 C;  2P0A A;  4ZYS A;  3JAM W;  3DXJ C;  5KFD A;  2I8C A;  5JVD F;  3I3C A;  2FJZ A;  1B1Z A;  2EYO A;  1HZA A;  3MZ5 A;  3EN2 A;  2CWA A;  1VF5 C;  4L6T B;  1SLJ A;  3OIQ A;  2B63 G;  5EBD A;  2VA3 A;  3SK6 A;  5C0X G;  4TV9 F;  5M3M H;  1C30 A;  2EY2 A;  3L4J A;  1H9K A;  1PV4 A;  3STB D;  1RYS A;  3KHH A;  2YTX A;  5IGF A;  3BA8 A;  1LAC A;  1LT3 D;  2ZTE A;  5C3E B;  2JA6 H;  4NXN H;  4LFB H;  3J80 c;  4A3M G;  1H9S A;  3D31 A;  1SJE D;  2NYZ D;  2F0N A;  3KLS X;  3W1B A;  5EKI A;  4YY3 Q;  3CC2 A;  5EQ0 A;  2JYO A;  5C4X H;  2E5L L;  4ME5 A;  2K7V A;  5M3F G;  2FLL A;  3L0O A;  1K3B C;  4RAZ A;  4A3L G;  3WNZ A;  3MXN A;  2JA8 G;  3PVX A;  1D5M C;  1H9M A;  3D0F A;  2YCH A;  1TT2 A;  5J2U F;  4HCS A;  1VBG A;  1EIH A;  4UCS A;  2VR1 A;  2SNM A;  2NUC A;  4UP9 A;  3PUW A;  1TY0 A;  2ZJP A;  4QWA A;  2VZA A;  3G6X A;  1G51 A;  4WBN F;  3NTK A;  3OWE B;  5DG8 A;  3HXL A;  4A4I A;  2ZTC A;  4DXG A;  3RZD H;  2KBN A;  2LMC B;  4PNY A;  4CDF C;  2E2J B;  4O2A F;  1FL0 A;  3PO3 B;  5CAE B;  2JA7 A;  3MXN B;  2IX3 A;  2Q2I A;  1EQT A;  2A74 C;  2C22 A;  3M85 A;  5KGU A;  4RU9 A;  1Y14 B;  4BY7 H;  1BVS A;  4KHP H;  1BCP B;  2ES2 A;  2PO4 A;  2IMW P;  3URY A;  2FK2 A;  2CH4 W;  3J81 E;  5GON F;  1KIX A;  1MBY A;  1F2L A;  1PTO F;  3BU2 A;  2EY6 A;  1EWI A;  5LL6 b;  4G3I A;  1PTO H;  1N32 H;  1BF4 A;  4UCR A;  4RGO S;  3NEL A;  4DR3 Q;  3LNN A;  2NVX B;  4IWY A;  1SNQ A;  3LWE A;  1FD7 D;  4DR4 Q;  2DJF C;  4XDX A;  3K81 C;  1BOS A;  1S5F D;  1F9R A;  2R92 H;  1YHB A;  2C2R A;  2ZM6 H;  4RAY A;  2Z6K A;  4JBM A;  5JVL A;  2VQF H;  4PZ7 A;  4RB0 A;  5KFL A;  4ZUI A;  2CW0 D;  1PH7 A;  5M5Y H;  1QVC A;  2VA2 A;  4OL7 A;  3EFX D;  2RGR A;  4PDB A;  4DNT B;  2AWO A;  4IPG A;  2UU9 Q;  4CDC C;  2YS6 A;  5F9L A;  2IA6 A;  3WWV A;  1U4R A;  2F4V L;  2F1M A;  3TIN A;  4LK1 C;  5EWF A;  3CXC A;  1IBK Q;  3U50 C;  4OO1 H;  3TDQ A;  1VQG A;  3A56 A;  3BZD B;  5T1I A;  4C1N K;  1Q82 C;  4MV3 A;  3U9T A;  1TWG A;  2R93 A;  4HIM A;  5J3B A;  3S17 B;  4ZI7 F;  2RDH A;  2VS1 A;  3KF8 B;  3UDI A;  4FXD A;  5IGD A;  1XPR A;  2MPM A;  3GTO H;  2ZJR A;  5DGB A;  1LLR D;  3FEW X;  4MV9 A;  4YJ3 F;  3KLW A;  3V4Z A;  1IL8 A;  4HTH A;  1CI3 M;  4J6H A;  2DZD A;  3SXH A;  1KDC A;  3LWB A;  3WDN A;  4LSX A;  5FOB B;  1XMQ H;  5ELD A;  4JV5 Q;  2PNH A;  1I50 B;  5IWA Q;  3M7G A;  4TRD A;  3OHB A;  2ZXR A;  3HOZ G;  2MHV A;  2OLS A;  2UXB H;  3Q24 A;  2QF7 A;  2A6H D;  5G3L D;  2R93 B;  1AE3 A;  1EOT A;  1ESR A;  1X54 A;  2EZV A;  3CQZ A;  5KFN A;  3SVM A;  5EJW A;  4BXX H;  1I7N A;  4G57 A;  2K05 A;  2RSO A;  4QIW A;  4RFB A;  2YZM A;  4CKC A;  1VQE A;  4F50 A;  4GLV B;  4ALP A;  4LF7 H;  1AW7 A;  3SI8 A;  4XIG S;  2EY5 A;  3T51 B;  4QB4 A;  4JYA L;  1Y1V H;  2JJQ A;  4XXE A;  3K5L A;  4HN7 A;  2GN5 A;  4XX0 B;  4IFD H;  4JBJ A;  3GTK H;  5JEA G;  2KJX A;  1ZYR C;  2R7Z A;  1JDE A;  2CQO A;  4LF4 Q;  2WYO A;  2RDI A;  4QIW E;  4TVA B;  2WB1 G;  4A3G H;  4EEQ A;  4YB8 B;  1BBW A;  3LX0 A;  3OSO A;  2W8L A;  4HED A;  4N8X 1;  2C9O A;  3DF7 A;  3GII A;  2SEB D;  5KT3 A;  1E4E A;  1E1O A;  4FU0 A;  3BDO A;  5HBR B;  4B3M L;  2OEO A;  2W70 A;  2K5H A;  5DLQ E;  3Q8D A;  4TQS A;  1NR4 A;  2I80 A;  5EGT A;  3A7A B;  2Y0S A;  1TWA A;  4HQ6 A;  2YU9 A;  4R8N A;  1NAP A;  2R7Z B;  3FKI B;  1TS2 A;  4MA5 A;  2ZXO A;  4J9K A;  1EZ6 A;  2B8G A;  3DM3 A;  2L15 A;  1V4Y A;  5KFC A;  1E2V A;  1PMR A;  1D5Z C;  3CF5 A;  4DUY Q;  1J6Q A;  2CQA A;  4DAY A;  4K2K A;  5LMU H;  2L1B A;  2K5W A;  1ENA A;  4CKB A;  2E74 C;  3CCJ A;  1CKN A;  4FDB A;  2GVA A;  1GLV A;  5FLX W;  1C48 A;  4JOI C;  1XNQ Q;  4LF9 Q;  3RGX A;  4GKK H;  3KFU A;  2JA9 A;  1EYC A;  2PBZ A;  4FF2 A;  1QJO A;  4XT3 B;  1PYW D;  4DV4 H;  5EPL A;  3M4Y A;  1EU3 A;  3NBH B;  4DK0 A;  5DLF A;  2X0S A;  1N56 A;  3BQ2 A;  3Q23 A;  2B63 H;  2EVB A;  3S1N H;  4DV0 L;  5C0X H;  4M7E A;  5KT5 A;  1E22 A;  2NWG A;  4MV7 A;  3M4I A;  1I3Q A;  1O80 A;  1VQH A;  4YAK B;  4IN3 A;  3QO2 A;  1R9T H;  4GOP A;  1L0Y B;  3RB0 A;  5KG6 A;  4JI1 H;  1XNR L;  4QWE A;  3J81 j;  5KFO A;  2RF4 A;  4A3M H;  4X65 Q;  4FBU A;  1RJT A;  5KFH A;  4ED1 A;  1C8C A;  1QE6 A;  4JG2 A;  5M3F H;  1TXY A;  4A3L H;  2D2C C;  2IW3 A;  2RGV A;  3HB9 A;  2JA8 H;  2M9V A;  2VB3 X;  4C3H B;  3PIP A;  4IPH A;  1MJE A;  1N33 Q;  4H13 C;  2VPQ A;  2RDF A;  4AQY L;  4JI7 L;  1TS4 A;  3Q6S A;  1EQV A;  4OEM B;  1S68 A;  1TY2 A;  4O2B F;  4DAV A;  4XZ3 B;  2EYM A;  1TWF H;  3FHW A;  2ZDG A;  3H0G G;  2E2H H;  2AGO A;  1S0O A;  4ZHQ F;  5JQW A;  1W93 A;  2WAC A;  1IBL L;  1JE4 A;  4KV6 A;  4XYQ A;  4DV1 H;  4J9L A;  2QCP X;  3DWA A;  4OWW B;  1YNJ D;  3T1H L;  2NN6 I;  4B9W A;  1SMX A;  4BY1 G;  3OSP A;  5J39 A;  3FDS A;  2JP1 A;  2L11 A;  2NVQ H;  2VXW A;  3Q8P B;  2ZXP A;  1X3E A;  2ASB A;  2XGQ A;  5KFS A;  3KK7 A;  4DU9 A;  1K28 A;  1VCI A;  1XX8 A;  5DLG A;  1PH2 A;  1O7I A;  5KFZ A;  1EEI D;  1MGS A;  1VQ7 A;  2UUB Q;  5EPK A;  4DR6 L;  1RK6 A;  2EYF A;  2NU6 B;  2IBK A;  3TP8 A;  2W9C A;  2K5N A;  4BA2 I;  2F03 A;  3SE7 A;  3Q1K A;  3G71 A;  1XMO L;  4CJ0 B;  2UXC H;  4K0K L;  5KFE A;  4FBT A;  1RL2 A;  5L1J A;  3HOU G;  1D7Q A;  2NU7 B;  3VYU A;  3E3X A;  2I07 B;  5E4X A;  4IQZ A;  3TSS A;  4J9N A;  3ER0 A;  2UVU A;  4QQB X;  5L1I A;  2DY8 A;  1EYZ A;  4WRD A;  1HNZ L;  4FXG C;  1PRT F;  4F4Z A;  4BBS G;  4IWX A;  4X66 Q;  1YHA A;  2PVP A;  4NP5 A;  1NJI C;  2XIW A;  3CAM A;  3AMU A;  3F8N A;  3KHL A;  1I5F A;  5GQO A;  3MWD A;  2LXK A;  1S10 A;  1C4Q A;  3T4A C;  5I9O A;  1B3A A;  3GTL H;  4B3T Q;  2QEX A;  1X55 A;  1KL9 A;  2SDF A;  4DK1 A;  3TZU A;  4HJ9 A;  3FPU B;  1X3Q A;  3PZP A;  1ICF B;  1QZG A;  1XTC D;  2L5T A;  2R8G A;  3J80 E;  4E4T A;  5LA6 F;  4UAI A;  4EQN A;  4ECT A;  3KLS A;  3KHR A;  4HIK A;  1ENC A;  1A8V A;  3J81 i;  4MV1 A;  1A9X A;  4PWQ A;  3K7A H;  4DV6 L;  3CCR A;  1OXS C;  1PRT B;  1GUT A;  2LXJ A;  1AZQ A;  2V5A A;  3BDC A;  2WP8 J;  1HNX Q;  1FJG Q;  1HA6 A;  1BCP C;  3M9N B;  2JSO A;  1X3F A;  1VQN A;  1AFP A;  2N49 A;  3H3V C;  1NR2 A;  4LFA L;  4RUC A;  2W6Q A;  2FLN A;  4PQX A;  3HOZ H;  1MHW C;  2A6E C;  3RTX A;  4X62 Q;  4BA1 I;  4K8I A;  3S14 B;  3VR5 A;  1B6R A;  3HG9 A;  1JLL B;  4LJZ C;  1RYR A;  1LYL A;  1KNA A;  2CQY A;  2Q8T A;  4EQO A;  4C2M A;  1T3N A;  3ULJ A;  3J7A F;  4JI4 H;  2F0M A;  3PUV A;  1ET9 A;  3C2P A;  1HR0 H;  2W71 A;  5C4Z A;  2ATW A;  1MJC A;  4GC6 A;  2E5L H;  3HZX A;  5I2X A;  3GO5 A;  5EDW A;  1FKA H;  1D5X C;  3FRP B;  5JEA H;  1QVF A;  1IKM A;  3GIK A;  3KAL A;  1XJV A;  2RHQ B;  1JC7 A;  3RMH A;  3I70 A;  3KYH C;  2GPS A;  3GTM A;  2XC9 A;  1B2T A;  4C2M B;  1YVC A;  1D6E C;  2J0T D;  2OT2 A;  4YHH L;  5CBE E;  1KLG D;  1G2S A;  1TWC H;  4LH6 A;  1PH1 A;  1LT6 D;  2ZM6 L;  1BBX C;  3DM1 A;  2W57 A;  1X32 A;  1IBM L;  5KG5 A;  2JXM B;  1Q8K A;  5C5M A;  1KAA A;  1HTP A;  3SGI A;  2D5D A;  5DAU A;  4CJ1 B;  1WTO A;  4HSP A;  2EIF A;  4K6L A;  3E0J A;  1JT8 A;  1UC9 A;  3LGJ A;  5EKL A;  3GTJ B;  3N40 P;  4NLG A;  3I73 A;  1RJQ A;  3PO2 B;  2G9H D;  3KDF A;  2ZJQ A;  2CHB D;  4A2B A;  1HCZ A;  1JE5 A;  4IOC A;  1NMG A;  1XXG A;  5IYB G;  1KD1 C;  1PDQ A;  2OQ0 A;  3DEO A;  4C3I B;  1VQ6 A;  2MCT A;  1L2Z A;  1PH5 A;  5EZY F;  1A63 A;  1U4P A;  2EYL A;  1EY4 A;  3V6K A;  1PFN A;  4P74 A;  4RKB A;  1W2B A;  4O3R A;  4JI8 Q;  2BQU A;  1X65 A;  5D3I B;  4F88 A;  1SE4 A;  1A3V A;  4LF6 L;  3PF4 A;  2KHS A;  2E2I B;  1B50 A;  4DL6 A;  1JJG A;  4QF4 A;  1H9R A;  1LUZ A;  1SRO A;  3K7U C;  2RBM A;  4ZKC B;  1S5E D;  2OWO A;  1KJ8 A;  2K28 A;  4F7X A;  2F4V H;  3PIO 3;  1AE2 A;  2JA5 H;  3V2T A;  3MR2 A;  4P72 A;  1C7Y A;  5KFF A;  1BQQ T;  2XSC A;  5KG0 A;  1KLU D;  2F3I A;  4Q0F A;  1Y8N B;  1YBY A;  1WR2 A;  3M9B A;  5M5X H;  3K5H A;  3IFT A;  2JEG A;  4YJ2 F;  4B3S H;  3LP8 A;  5KNC A;  3CC7 A;  1WTX A;  1EYG A;  4EYH B;  1LTA D;  3H0G H;  3MFY A;  4DNI A;  2N8N A;  3R5X A;  3K3P A;  5DG7 A;  3NTH A;  4ZOL F;  4PV1 C;  3DEP A;  1NNX A;  4ZQ3 A;  1TS5 A;  3RAX A;  3VYR A;  1EY7 A;  3M3Y H;  2UXD Q;  1JB3 A;  1WSC A;  3KTM A;  5KFQ A;  3RB3 A;  5M5W H;  3MR6 A;  2ASL A;  3TII A;  4BY1 H;  1KAB A;  4GN4 B;  1IYU A;  2JA7 G;  5DQH A;  2UVR A;  1R4Q B;  2F0O A;  5C4J B;  1CQI B;  4A3E B;  2HVQ A;  2XCL A;  1KXL A;  1WD0 A;  2B2W C;  3UE1 A;  1KDA A;  2A69 D;  5LMU L;  3CKI B;  1I4P A;  2HDM A;  3T5K A;  4X3T A;  4L8J A;  2UVW A;  4EFE A;  1UEB A;  4UHV A;  2Z4I A;  3BA9 A;  1B7Y B;  1VQM A;  3PW4 A;  3GTP A;  2LSS A;  3M4O H;  4GKK L;  2R84 A;  2A1A A;  3HOU H;  2Z9H A;  4IR1 A;  3OTO L;  2HHH Q;  1CA6 A;  1BNC A;  3F1Z A;  2XWB B;  3I4L A;  3STB C;  3MFI A;  3PW2 A;  1CS0 A;  4HR7 B;  1K3R A;  2F0K A;  3P75 A;  4AYB B;  2HCI A;  5D1O B;  2B29 A;  2VL6 A;  3GDE A;  4GLX A;  4J1M A;  4LF5 Q;  1KNE A;  3TIG A;  3A8I E;  1EYA A;  4NXN Q;  4BBS H;  4B3R H;  1DCZ A;  4O3Q A;  1B9N A;  4YQW A;  3QZ8 A;  2W9A A;  1E24 A;  1AEX A;  2G5D A;  1ET6 A;  4DAP A;  2I46 A;  3S2D H;  1S72 A;  4NXM L;  2F0L A;  3P1H A;  3I4N B;  5KFB A;  3ZJY C;  3CVZ A;  3VR2 A;  2VQE Q;  3GTG H;  3HOY G;  1CKM A;  1UNS A;  1G6Z A;  1H95 A;  2KEE A;  4JI2 Q;  2RDJ A;  2MO0 A;  2QW7 A;  1FNV A;  1STG A;  1S4Z A;  4JOI A;  4HJ7 A;  2R86 A;  2DN8 A;  2R93 G;  1PTO D;  4DR3 L;  4DR2 Q;  2KCN A;  4HMI A;  5ISR A;  2M00 A;  1T5X D;  2HIX A;  2JN4 A;  4OO1 I;  3S1Q H;  4I7A A;  1ONL A;  2Q8I B;  3NPP A;  1WCM B;  3G6Y A;  4N9P A;  2K5D A;  4OX9 L;  4O3S A;  3UDX A;  1GSO A;  5EAY A;  5LHY 1;  3RR5 A;  2UU9 L;  1QZH A;  1KJI A;  4JC0 A;  2H1E A;  2YRW A;  3KUP A;  1XNR H;  2R87 A;  4LW1 A;  3TBI B;  3PR4 A;  3NQI A;  4R4O A;  3BAA A;  4K5W A;  2A5H A;  1DV2 A;  1N34 L;  2NVT H;  5CV8 A;  1OXV A;  1SFO B;  1K0S A;  2NZ1 D;  4MAM A;  2EY1 A;  4BBR G;  4IFD J;  2K32 A;  1W96 A;  3MXG A;  1CZW A;  1XWE A;  1KJ9 A;  1STY A;  2NTS A;  2NVY H;  4AQY H;  4JI7 H;  2R7Z G;  2V4D A;  4A3D B;  3A0J A;  3PN1 A;  2Z1C A;  3T5J A;  1DZ1 A;  3EPG A;  3J80 i;  2TSS A;  1VF7 A;  4FO2 A;  2F0P A;  4KLK A;  3HBL A;  3E0E A;  4JV5 L;  1DIK A;  4IFD I;  5KT4 A;  1IOW A;  1JDB B;  1LTS D;  5K5P A;  1RHP A;  3HP3 A;  3J80 L;  2Y0S G;  3T1H H;  1Q3L A;  2HVR A;  3C1F A;  1FNW A;  3D6W A;  1I6V C;  4X3U A;  5KYL A;  2CW8 A;  4APM A;  5JJK A;  4EYI B;  1PFM A;  4YR0 A;  2K75 A;  2F0W A;  3CU7 A;  4Y7N H;  1B6S A;  2AKW B;  3Q8Q B;  2AGP A;  1TII D;  2R7L A;  2OXP A;  4FNF A;  4DR6 H;  4ME6 A;  2AU0 A;  2X69 A;  4J9O A;  4LMQ D;  2V4R A;  2MNA A;  4GKJ Q;  5BMV F;  4JI6 Q;  1AUX A;  5IYB H;  2D0O A;  2M05 A;  2RVL A;  2D0P A;  4C3J G;  4DL2 A;  1XMO H;  4K0K H;  5I6Y A;  1VQA A;  2LS0 1;  1JOK A;  1A3T A;  2A6H C;  3VPD A;  2UXB Q;  1K1Q A;  1HUM A;  5C0X J;  1ZHQ A;  3E9H A;  4A3I G;  1HNW H;  1IOV A;  1HNZ H;  4UP7 A;  5KKN B;  3GID A;  2WV6 D;  4NMZ A;  4LF7 Q;  3F2C A;  3CRL C;  4XT1 B;  1UC8 A;  2AMC B;  1ZKO A;  1VQO A;  3RUP A;  4A93 G;  1I94 Q;  5C0X I;  1ILQ A;  1GOZ A;  4JI4 L;  3MEH A;  4MZ9 A;  1JIH A;  3ERS X;  1I4Q A;  5CBA E;  1HR0 L;  1AN8 A;  1XPU A;  1GYF A;  2VUM G;  1H9J A;  4NW2 A;  4LF9 L;  1EQQ A;  3VR4 A;  4G7H C;  3A5U A;  1SYD A;  2L12 A;  1F2M A;  3A74 A;  2BA1 A;  3I90 A;  5GAD C;  2OTJ A;  3PGZ A;  1JWM D;  5T1G A;  1PZJ D;  1BCP F;  4DV6 H;  2H5X A;  4NB3 A;  2WAQ A;  3HKS A;  1EOV A;  1J8I A;  3EJI A;  4RAU C;  4BS9 A;  1KDB A;  4LFA H;  1Q1E A;  4UP8 A;  5KG7 A;  3K0Y A;  2KUM A;  3I4M G;  2IY5 B;  3VPC A;  2BH2 A;  1Q86 C;  4X65 L;  3Q0A A;  2JA7 H;  1JOO A;  1F2Y A;  4DA2 A;  1QB5 D;  5HUR A;  2WKC A;  5FO8 B;  2NVX A;  2R6G A;  5M3M B;  1L0X B;  1SYE A;  4TQU S;  4O3P A;  3E6Z X;  1Q1B A;  2WAQ B;  3GP7 A;  3GTQ A;  4FYD A;  1LTG D;  5IT9 c;  2JA6 B;  1EUD B;  4TKO B;  1S5C D;  4Q5V A;  3ULP A;  1BO0 A;  3ORQ A;  2V59 A;  3GIQ A;  4DV4 Q;  1EY6 A;  3J7Z C;  1KTK A;  5C4X B;  2F52 A;  2MGS A;  4IUN A;  5KFR A;  4FF3 A;  1LTL A;  2I5L X;  1SMY D;  3S16 H;  3GIP A;  5L9X A;  4DL4 A;  4OGQ C;  4YHH H;  3KF6 B;  2YZG A;  2AQ2 B;  2JE6 I;  1SYF A;  5BPH A;  4R4T A;  3GTQ B;  3PV0 A;  5EBC A;  2L0C A;  3RD4 A;  1LTB D;  1Q12 A;  3T1Y L;  1SNC A;  4RB3 C;  3KF8 A;  4YR3 A;  3KLR A;  2K5V A;  2HUG A;  1IBM H;  2J6T A;  4DK6 C;  3RUZ A;  3H6M A;  4O3N A;  2YYZ A;  2JEA I;  3OUU A;  4KD3 A;  3RZD B;  3HOY H;  1QG7 A;  4G7O C;  2DNC A;  2HQL A;  4DR5 Q;  4P71 A;  3K80 C;  1FYC A;  1P8L A;  2KCT A;  4IZ8 A;  1I50 A;  2KHI A;  4ECX A;  1TWG H;  4IUT A;  2R93 H;  4DUZ Q;  3G4S A;  1CTM A;  4BY7 B;  5KT6 A;  2R92 A;  1EFI D;  1ML0 D;  1QOH A;  2LKV A;  4A76 A;  1NCV A;  3V6H A;  4B3S L;  4K5X A;  1A3U A;  1Z7T A;  1WD1 A;  1YJW A;  3FVQ A;  4HIO A;  4A3J B;  2O5I C;  4DV1 Q;  3RNU A;  1S0N A;  2QDB A;  4MV4 A;  1TWH H;  1M0W A;  4TUY F;  2VB2 X;  1DOL A;  4P2C B;  3U58 A;  4LF8 L;  5F9N A;  2Z0S A;  2V9W A;  2F3W A;  3CQZ H;  4LF6 H;  1BXT A;  2PI2 A;  3EQL C;  2R92 B;  2QGQ A;  4UPA A;  3TP6 A;  4UCV A;  3RJ0 A;  5C44 B;  2J7Z A;  1EUC B;  2FK1 A;  5M5Y B;  4KY5 A;  1BBU A;  5FPR A;  4QWD A;  2R8H A;  4BBR H;  2ASD A;  5JEA J;  5IYC G;  3GQC A;  3I72 A;  2DIK A;  5CR3 A;  4DK3 C;  4A3K G;  2K33 A;  2R7Z H;  2RCN A;  2W6P A;  3G8C A;  3H4B A;  2Q2T A;  1S0M A;  3FKI A;  5KFA A;  2SNS A;  1RF2 D;  1HNX L;  1FJG L;  1HUN A;  3A7L A;  4XYM B;  1TU2 B;  4AH6 A;  1N36 L;  4MNO A;  5KFM A;  4POG A;  3GTO B;  1V1P A;  3T5L A;  1SNO A;  4X62 L;  5KFY A;  3FMC A;  3L3O C;  1I6H H;  3I12 A;  5HV6 A;  2GA4 B;  4YWL A;  4WOR A;  1CHQ D;  2W8K A;  2HDL A;  1GSA A;  5CV6 A;  1TWA H;  4B3R L;  1RJP A;  4TQR A;  3VYS A;  4HID A;  1Y1V A;  2YU9 H;  3GLK A;  5I9P A;  4DR1 L;  3J80 W;  1T5E A;  4YY3 H;  2R8I A;  1CK1 A;  4PG3 A;  3NBH A;  3CPF A;  5A2Q E;  2W6M A;  4EBD A;  3HOX G;  2B2W A;  1GO3 E;  1YNN C;  2K03 A;  3BVZ A;  2DPI A;  4KMU C;  2W9B A;  1V1P B;  1YIT A;  2Y0S E;  1KRS A;  1VQD A;  4JBW A;  3KBG A;  1C0A A;  4CDD C;  4C3J H;  2N55 A;  2EYP A;  1G6P A;  4K5V A;  4JI0 Q;  4CC6 A;  3Q8S B;  4IR9 A;  1Y1V B;  3OTO H;  3W3A A;  3GTK B;  3JRW A;  1V9P A;  3ZYY X;  1SYG A;  4RB2 C;  1YI2 A;  4X64 Q;  4A3I H;  5ELC A;  1WVL A;  1SNP A;  3CRK C;  1EFW A;  2MJ8 A;  4A3G B;  3LML A;  5H80 A;  2WDT A;  1I3Q H;  2W9B B;  2FPP B;  1AUV A;  3RGZ A;  2CH4 A;  4EBC A;  4HJ8 A;  2X6G A;  5EWE A;  1S97 A;  4A93 H;  4MHE A;  4NXM H;  3GQB A;  4EGQ A;  4YBZ B;  3I55 A;  1HH2 P;  3HGB A;  2VUM H;  3BYT B;  1HR0 W;  5LOV F;  4RA8 A;  2FMA A;  1QIL A;  4ULL A;  4KY7 A;  2JA5 G;  4IPC A;  3KHG A;  1AZP A;  3J7A V;  3OUZ A;  2HCC A;  2I87 A;  4XQQ A;  4O1N A;  4DR3 H;  3U4V A;  3BJU A;  2IHF A;  2YZN A;  3MC0 B;  4KHV A;  4S3S A;  1VS0 A;  2CZG A;  1SE3 A;  5JAV A;  2GPW A;  3ORR A;  2QA4 A;  4A2A A;  4RNO A;  4JI8 L;  2OQK A;  4OX9 H;  3I4M H;  3WO1 A;  1Z2N X;  1QWY A;  4QCL A;  1D1I A;  1S5D D;  4ME3 A;  3ND9 A;  2YRX A;  2B63 B;  2FXQ A;  1EYD A;  4LFC Q;  4J15 A;  3V05 A;  2UU9 H;  2F0V A;  3S1N B;  1GJX A;  3FMA A;  3DHQ A;  4R9W A;  3Q22 A;  1VQ9 A;  2JEJ A;  2XRQ D;  3UDF A;  1E7Z A;  5LMN L;  2ZTD A;  4P73 A;  2VQD A;  1N34 H;  3PSI A;  3CCM A;  3OYY A;  3ETH A;  2SOB A;  1WYD A;  1S3O A;  1LM0 A;  4A3M B;  2VNU D;  5J22 A;  3HOV G;  2I5M X;  1TS3 A;  3JRX A;  2BE5 D;  1UWV A;  4KK7 A;  1JJ2 A;  3OHX C;  4HNT A;  2Q8R E;  3IN5 A;  3S24 A;  3KJP A;  5M3F B;  2K5Q A;  2Z6B A;  1DM0 B;  1HA5 A;  2WTF A;  4RNN A;  1LT5 D;  2JA8 B;  1OXU A;  2R3Z A;  1C9O A;  4MIU A;  2ZJT A;  5EOY A;  1L2F A;  1IXR A;  4JV5 H;  2MQH A;  5CV4 A;  1HFG A;  2KCC A;  2ZDQ A;  3A8K E;  4QW9 A;  5C4H A;  3PCO B;  1VQI A;  1HNW L;  2F4V Q;  3O13 A;  3K3V A;  3H91 A;  1TWF B;  4G4K A;  4R4I A;  3V4S A;  4X6A H;  3F2U A;  1YJN A;  1NY4 A;  2G9D A;  5BN5 A;  1GHJ A;  4LWC A;  3RLF A;  4POF A;  5C6A A;  1OXX K;  5FPO A;  2R7N A;  4HNU A;  4DV2 L;  1MSH A;  5K36 G;  2FLP A;  3S14 H;  3BQ0 A;  1G29 1;  2NVQ B;  4RZQ A;  3AYH B;  4DF7 A;  1ZYR D;  4X3S A;  2E75 C;  3K5O A;  2IX0 A;  5T14 A;  2W7O A;  1JIC A;  4R4Q A;  5DM6 3;  4U67 3;  1HRJ A;  1E2Z A;  3EVQ A;  1TKW B;  1UAP A;  2RDG A;  4J0M A;  1JWS D;  1PZI D;  4DV5 L;  4DV7 Q;  3S1R H;  1R4P B;  3NP8 A;  1STH A;  3BDL A;  3OMC A;  4A3B G;  2E76 C;  2PPB C;  4MV6 A;  5KFJ A;  4EBE A;  3GTL A;  2AQ3 B;  1A62 A;  1L1O B;  1CA5 A;  2V4Q A;  2A69 C;  3AFQ A;  1A2U A;  2KCM A;  4JYA Q;  1Q8I A;  4DUY H;  2FPG B;  4JI2 L;  1STE A;  5LL6 X;  3FPP A;  2P5Z X;  5IYC H;  2EXD A;  4LF9 H;  2QIL A;  3OMG A;  1JX4 A;  1I4H A;  4A3K H;  1JKJ B;  4YCW A;  3GTL B;  4DR2 L;  2EDG A;  1GGO A;  1JXL A;  4PMC A;  1PFS A;  2IPK D;  3GTM H;  3GV5 B;  1SYX B;  2EQS A;  2K52 A;  4B3M Q;  4ID6 A;  3JSN A;  2R61 A;  2GLT A;  3HOW G;  1WTW A;  4G7Z C;  3GTJ A;  1VDZ A;  1LT4 D;  3K7A B;  3S9W A;  1HQM C;  5KIX A;  1SE8 A;  3DUZ A;  3CME A;  1BDO A;  4IJH A;  3S1M B;  4X65 H;  5IGE A;  4WD3 A;  4RHS A;  1HHV A;  2TMP A;  3HOZ B;  3PR5 B;  3HOX H;  2WB1 A;  1E2W A;  4ED2 A;  1PTO C;  4J9Q A;  3CD6 A;  1J5E L;  4EEY A;  3QWN A;  2YTV A;  3GV8 B;  1UE1 A;  1KQS A;  1N33 H;  4DV3 L;  5CGK A;  2NZH A;  5JH7 F;  1WFQ A;  4KD4 A;  3WOE A;  3MWY W;  3D4W A;  1DXM A;  3KOJ A;  4ECU A;  5FD5 A;  2E2I A;  4DV0 Q;  3S2H H;  4L63 B;  4ECQ A;  4JI5 Q;  5C3E G;  4JI3 Q;  3TQ1 A;  3MJF A;  2UUC L;  1STB A;  2WB1 B;  1F9S A;  2PMZ A;  3J81 c;  2A68 D;  1LTT D;  4UCO A;  5CV7 A;  4OIK A;  4Q43 A;  1VKZ A;  3AEV A;  3T1Y H;  3CW2 C;  5BR8 L;  2VOB A;  1II3 A;  1I4G A;  4DFA A;  5IE8 A;  3HKZ A;  4JUZ A;  1U0L A;  3KAJ A;  2UUA L;  5K2M A;  1VAJ A;  2XRS D;  2B2Y A;  1SNM A;  3QOL A;  3D4R A;  3K58 A;  4ED6 A;  3NBI A;  5DQI A;  3UI2 A;  4GS3 A;  2VW9 A;  1S5B D;  1ASY A;  3C3L A;  1HFN A;  3C1E A;  4DR7 L;  1KJJ A;  4CDE C;  4UCT A;  3RV4 A;  2UUB H;  2PMZ B;  4IRD A;  1WTH A;  4KKS A;  5KFT A;  1X56 A;  1WOC A;  1L0W A;  4GKJ L;  3OHA A;  4JI6 L;  4JK1 C;  3G6E A;  4LUZ A;  2MFI A;  3PO3 G;  2KHJ A;  1EWH A;  2W6O A;  3T53 B;  3HKZ B;  2J4X A;  4KI0 A;  3NXW A;  1VQ8 A;  5NUC A;  3VR6 A;  3D4D A;  2DNE A;  2B8F A;  4APV A;  1IBL Q;  4N8F A;  3Q2O A;  4C56 C;  4I4T F;  4MTD A;  5A2Q L;  3HFZ B;  2WAQ G;  4KJN A;  4TSS A;  5J1Z A;  4CKE A;  4M9U A;  1N48 A;  3T1H Q;  3K57 A;  5IGB A;  5FO9 B;  2NTT A;  5FLM G;  5KYI A;  1EY0 A;  4X66 H;  2KED A;  1BR9 A;  5GAE C;  4LF8 H;  3EIV A;  3U9O A;  4FM9 A;  2AQ1 B;  3MHB A;  3MVV A;  3RV3 A;  1PH8 A;  3GIJ A;  1I94 L;  5L37 A;  2PZU A;  5KG3 A;  4B3T H;  4HNV A;  1IL2 A;  1O7Y A;  4YY3 L;  3RBD A;  4IO9 A;  5LMN W;  4HR7 A;  3I91 A;  4DR6 Q;  2D9U A;  1EU4 A;  1KC8 C;  2AWN A;  5D1O A;  1X9N A;  4AYB A;  3HOV H;  3DMU A;  1GVP A;  1I4R A;  3JAM c;  2IJ0 A;  2K6A A;  1SRU A;  4DGZ A;  3GTP H;  3V96 A;  4FXK C;  1TQO A;  1ZEQ X;  1ILP A;  4A3C G;  5EWG A;  3I4N H;  3R8B A;  1PH6 A;  1FJG H;  1HNX H;  4GN3 B;  4F4X A;  3AU7 A;  4OXP A;  5IOD A;  4IOA A;  1N36 H;  4AYB E;  4E6I A;  1GXD C;  4GN5 A;  4R4C A;  4I50 F;  4A3F B;  1KHI A;  3F2B A;  5M5X B;  2WII B;  1VQJ A;  4UDU C;  4X62 H;  3IKJ A;  1WTP A;  3BQ1 A;  2A6E D;  2RKS A;  4PMW A;  1X3G A;  4O4I F;  1SR3 A;  5I47 A;  1DV1 A;  1K8A C;  1GUW A;  4LFB Q;  4ECR A;  1QNK A;  2A19 A;  3D3R A;  4DR1 H;  2BDN A;  2JEB I;  1PA6 A;  1KRT A;  4ECV A;  2IX1 A;  5I4D A;  2PZW A;  3MWE A;  2VPS A;  4WFN 3;  1WCM A;  5D1P A;  2OTL A;  4ODG A;  1PXU A;  5K36 H;  3S15 H;  2JEI A;  3PW7 A;  1K83 H;  4U7C A;  4YWM A;  4KY6 A;  3BAB A;  1Y1W A;  4IZO A;  2W7P A;  5IOC A;  4EVO A;  1SE2 A;  1B53 A;  4LFA Q;  5KEE A;  4IRC A;  4RHR A;  1M1K C;  4OON A;  1ENF A;  5C44 G;  4DR4 L;  4L5Q A;  1SYC A;  1GUO A;  1LTR D;  4YWK A;  1VMC A;  4A3B H;  1VQB A;  4FS2 A;  1SFO A;  1SND A;  1M8A A;  1GD7 A;  3M9M B;  4X3K A;  3HOU B;  3MR5 A;  5L1K A;  3RZO B;  2NB0 A;  5A35 A;  3V6J A;  1B33 N;  4CBV A;  2J6S A;  1Y1W B;  1U5K A;  3R2T A;  2FE3 A;  5KG4 A;  1IKL A;  4KHP Q;  2KOL A;  3BG5 A;  2W6Z A;  4RZR A;  2SCU B;  4PZ6 A;  4BBS B;  1IBK L;  4DR5 L;  1EIF A;  1PX2 A;  5KG2 A;  3TQY A;  2W6N A;  4J9R A;  2PW7 A;  2RCF A;  4NPS A;  4DUZ L;  3S2D B;  2M2L A;  4OIJ A;  1SMY C;  1N32 Q;  4R8I A;  1TR5 A;  4AIM A;  2R7M A;  3GTG B;  3NTI A;  1KAW A;  3K59 A;  4YHH Q;  1SJH D;  3CC4 A;  4K2L A;  2EJM A;  2R7D A;  3FKI G;  3OSN A;  4R8U A;  3HOW H;  4UCU A;  2ZM6 Q;  2CW0 C;  4IAJ A;  2VQF Q;  4I65 A;  1MZB A;  1C3O A;  4JI8 H;  1I4X A;  1FNU A;  3AFP A;  1UE7 A;  1BGW A;  1QVG A;  2HGS A;  3VMM A;  5C1P A;  3G48 A;  1W3S A;  5IWA L;  4ZQI A;  3UFX B;  3IG0 A;  1U9R A;  1IYV A;  3S1Q B;  3N6R A;  1XYI A;  3ERQ A;  5E4W C;  1HPC A;  4FVM A;  5DEH A;  2IWH A;  4HSV A;  3QJY A;  4R7R A;  2Z8L A;  1GSH A;  5LMN H;  1G8Z D;  3E5S A;  5CV9 A;  1WTQ A;  3M7N A;  1IYJ B;  1K9M C;  2FIN B;  4R8U B;  3C0F B;  4KKU A;  4GLA C;  3U9S A;  3J7A K;  4XYO A;  2XGT A;  3PMF A;  3NWS A;  3QB3 A;  4DNR B;  1L1O C;  1PYB A;  2NVT B;  1VMP A;  3PIP 3;  2HIV A;  1PH4 A;  4LF4 L;  5EKK A;  4LSA A;  2Q2U A;  2FPI B;  2R82 A;  2VY3 A;  4RWS C;  5C3E H;  2XIG A;  3RFC A;  1NE3 A;  1DOK A;  2C2E A;  1XMQ Q;  1CQF A; 
#chains in the Genus database with same CATH homology
 4A3F H;  3CCE A;  4QQB X;  3H3V I;  4BBR H;  1HNZ L;  4O0A A;  5JEA J;  5IYC G;  4DPG A;  1JMC A;  4BBS G;  2E8G A;  1N8R C;  4X66 Q;  1YHA A;  5GRO A;  4DK3 C;  4A3K G;  2AHO B;  2R7Z H;  2R7F A;  1V1Q A;  2OCE A;  2RCN A;  1NJI C;  3CAM A;  2Q2T A;  1PVO A;  1I5F A;  5GQO A;  1XMO Q;  2LXK A;  4K0K Q;  3VDY A;  1FJG L;  1HNX L;  3CMA A;  3GTL H;  4AH6 A;  4B3T Q;  2QEX A;  1N36 L;  1X55 A;  1PH3 A;  1KL9 A;  4MNO A;  5ELO A;  4DUY L;  1EUJ A;  4HJ9 A;  4POG A;  1QZG A;  4X62 L;  3ICE A;  1I6H H;  5HGQ A;  4YWL A;  1HNW Q;  1HNZ Q;  3CCU A;  2E2J H;  1XNQ L;  1K73 C;  1TWA H;  4B3R L;  4HIK A;  3PO3 H;  1A8V A;  5IY0 A;  3J81 i;  4HID A;  4JI0 L;  1QUQ A;  2YU9 H;  3K7A H;  4DV6 L;  3CCR A;  4DR1 L;  1HZB A;  1OXS C;  2LXJ A;  3I56 A;  4GNX A;  1P16 A;  2WP8 J;  4PG3 A;  3CPF A;  1K0R A;  3NEN A;  1HNX Q;  1FJG Q;  4BY7 G;  1VQN A;  1X3F A;  2N49 A;  3HOX G;  4DKA C;  4LFA L;  4X64 L;  5JJI A;  1GO3 E;  4DV2 Q;  3HOZ H;  3F8T A;  4OWX B;  1WCM H;  3IRB A;  3PUZ A;  4BA1 I;  4X62 Q;  1JB7 A;  3H3V H;  5FLM H;  3CPW A;  1YIT A;  2HT1 A;  2Y0S E;  1KRS A;  1VQD A;  4JBW A;  3RZO H;  4A3J G;  1C0A A;  1D8L A;  1Z47 A;  1LYL A;  4C3J H;  4DV4 L;  1Y1W H;  1G6P A;  3ULJ A;  4JI0 Q;  1YJ9 A;  4DV6 Q;  1B70 B;  1QUQ B;  4DV5 Q;  1VQF A;  5JJL A;  3PUV A;  5IP7 H;  3B6Y A;  5LMU Q;  4GNX B;  2NVX H;  4LNQ A;  1MJC A;  2WAQ E;  1V9P A;  2ATW A;  1YI2 A;  3GO5 A;  3DLL A;  3KF6 A;  4X64 Q;  3UDG A;  4A3I H;  5FLX c;  2R92 G;  4GOP C;  1QVF A;  1EFW A;  3GTQ H;  1XJV A;  1I3Q H;  2IT1 A;  4JI1 L;  1EIY B;  4GKK Q;  1SFO H;  2RHQ B;  1EQR A;  1N33 L;  3CP0 A;  3KYH C;  3OTO Q;  4A3C H;  5AJ3 L;  4HJ8 A;  4Y52 H;  4A93 H;  1YVC A;  4L5T A;  4YHH L;  3I55 A;  4A3D H;  1HH2 P;  2PQA A;  4LUV A;  1TWC H;  4OO1 G;  1PH1 A;  4EX5 A;  2VUM H;  1HR0 W;  3GD7 A;  3E9I A;  2ZM6 L;  1Z9F A;  3H15 A;  1VQP A;  2JA5 G;  3W5O A;  4IPC A;  4JI1 Q;  4LFC L;  1IBM L;  1CKO A;  5IYD G;  4NXM Q;  3PIO A;  3S17 H;  1Q8K A;  3U4V A;  3I2Z A;  2KEN A;  3BJU A;  2IHF A;  5AJ3 Q;  2V1C C;  4L5R C;  3SGI A;  1VS0 A;  2EIF A;  2QA4 A;  1JT8 A;  4R1J A;  3LGJ A;  2CFM A;  1V43 A;  2OQK A;  2PQA B;  4JI8 L;  1FGU A;  4A3J H;  4JBK A;  3I4M H;  4DV1 L;  1BKB A;  3KDF A;  2ZJQ A;  2UUB L;  4ME3 A;  1I50 H;  1JE5 A;  1IBM Q;  2FXQ A;  3M4P A;  3MEF A;  4J15 A;  4IOC A;  1NMG A;  1VQL A;  4LFC Q;  4O2D A;  4BXX G;  5IYB G;  3CCQ A;  1KD1 C;  4RG1 A;  1VQ9 A;  2OQ0 A;  4DAM A;  1PYS B;  4HJ5 A;  1Q81 C;  1VQ6 A;  3UDF A;  2CKZ B;  1E7Z A;  2BH8 A;  1CUK A;  5C44 H;  2ZTD A;  4P73 A;  4YCU A;  5LMN L;  1PH5 A;  3PSI A;  1J5E Q;  3CCM A;  1A63 A;  3OYY A;  4LUO A;  4P74 A;  5GAG C;  1Y1V G;  4QJF A;  4DV3 Q;  1WYD A;  1W2B A;  4JI8 Q;  5FJ8 H;  1S3O A;  1LM0 A;  1X65 A;  3K8A A;  2VNU D;  3HOV G;  4IFD G;  2I5M X;  1UWV A;  1JJ2 A;  4YCV A;  4LF6 L;  3PF4 A;  2UXC L;  2N78 A;  3S24 A;  4X66 L;  3KJP A;  4A3G G;  1N34 Q;  1JJG A;  1LUZ A;  1SRO A;  4RMF A;  3K7U C;  2OWO A;  1E1T A;  1OXU A;  2DGY A;  4QY7 A;  2UUC Q;  1AE2 A;  1C9O A;  2JA5 H;  4L5S A;  4B3T L;  1L2F A;  1YEZ A;  1IXR A;  4UY8 C;  1Q7Y C;  2MQH A;  2XTI A;  4P72 A;  1C7Y A;  2F3I A;  5BR8 Q;  1RIP A;  2BA0 A;  3PCO B;  1VQI A;  1YBY A;  1HNW L;  3M9B A;  4IPD A;  5M5X H;  2UUA Q;  3ULL A;  2F4V Q;  1SN8 A;  4LF6 Q;  2GVB A;  2UXC Q;  1IZ6 A;  4R4I A;  3CCL A;  4X6A H;  2PI2 E;  1YJN A;  3FKI H;  4MTN A;  3CC7 A;  1EYG A;  1NY4 A;  2ID0 A;  3H0G H;  4DV7 L;  3W1G A;  4DNI A;  2N8N A;  1PHJ A;  4DR7 Q;  1HZC A;  4LWC A;  3RLF A;  3TRE A;  4POF A;  5ELN A;  1OXX K;  4A75 A;  4DV2 L;  1M90 C;  3M3Y H;  2UXD Q;  5K36 G;  3S14 H;  1G29 1;  1PH9 A;  3TRZ A;  5M5W H;  3AYH B;  4BY1 H;  2IX0 A;  4GN4 B;  2JA7 G;  4R4Q A;  1HZA A;  4GNX C;  3PO2 G;  3EN2 A;  2CWA A;  4QGU A;  1YNX A;  5E7N A;  1YZ6 A;  1SLJ A;  3CCS A;  2B63 G;  3UE1 A;  4DV5 L;  4DV7 Q;  2IHE A;  2MO1 A;  3S1R H;  5C0X G;  5M3M H;  5LMU L;  1CSP A;  1VQC A;  1UEB A;  1PV4 A;  4A3B G;  3STB D;  1B7Y B;  1VQM A;  5HY6 A;  2B3G A;  2YTX A;  2LSS A;  1A62 A;  1L1O B;  2ZTE A;  3M4O H;  2JA6 H;  4GKK L;  3AFQ A;  2A1A A;  3J80 c;  3HOU H;  4A3M G;  3D31 A;  1KXL A;  3CC2 A;  3OTO L;  3W1B A;  2HHH Q;  4YY3 Q;  4JYA Q;  2KCM A;  3F1Z A;  3STB C;  5C4X H;  2E5L L;  1K3R A;  5M3F G;  4JI2 L;  3L0O A;  2B29 A;  2VL6 A;  3GDE A;  1MKH A;  5H1S E;  4GLX A;  4LF5 Q;  4A3L G;  5IYC H;  2JA8 G;  2EXD A;  4NXN Q;  4BBS H;  3D0F A;  4A3K H;  4YCW A;  4DR2 L;  1E24 A;  2CWP A;  4C3H H;  3L2P A;  3S2D H;  4UP9 A;  1S72 A;  4NXM L;  3PUW A;  3UE0 A;  2ZJP A;  1PFS A;  3GTM H;  3ZJY C;  3J7A 5;  4JI4 Q;  2EQS A;  2K52 A;  2VZA A;  1VQ5 A;  1HR0 Q;  4B3M Q;  1G51 A;  3HKZ G;  2VQE Q;  3GTG H;  3HOY G;  1CKM A;  2E5L Q;  1H95 A;  3HOW G;  4A4I A;  2ZTC A;  4JI2 Q;  3RZD H;  2K4K A;  2KBN A;  1WJJ A;  1FL0 A;  2MO0 A;  4JOI A;  3MXN B;  4HJ7 A;  2Q2I A;  1XPO A;  2R93 G;  4DR3 L;  1NTG A;  1SE8 A;  3CME A;  3M85 A;  3K0X A;  4IJH A;  4DR2 Q;  1NMF A;  1Y14 B;  2HIX A;  4DAY B;  4BY7 H;  4JI5 L;  4JI3 L;  1BVS A;  4OO1 I;  3S1Q H;  1GM5 A;  3HOX H;  2ES2 A;  1CKN B;  4OX9 L;  1KIX A;  3CD6 A;  1J5E L;  3UDX A;  2CCZ A;  2YTV A;  3BU2 A;  4A3E G;  5IP9 G;  1UE1 A;  1KQS A;  2WFW A;  1EWI A;  4DV3 L;  2NZH A;  5EAY A;  1WFQ A;  3RR5 A;  2UU9 L;  1QZH A;  3KOJ A;  4JC0 A;  3F2D A;  3NEL A;  4DR3 Q;  4LW1 A;  4R4O A;  4DV0 Q;  3S2H H;  4DR4 Q;  3K81 C;  1N34 L;  4KHZ A;  5C3E G;  4JI3 Q;  4JI5 Q;  2NVT H;  1OXV A;  2R92 H;  1E3P A;  1YHB A;  2UUC L;  2Z6K A;  4JBM A;  4PZ7 A;  3J81 c;  4GOP B;  4A3F G;  5M5Y H;  1QVC A;  1YIJ A;  1PH7 A;  4BBR G;  3AEV A;  4IFD J;  1OXT A;  1GKH A;  4AYB G;  2DUD A;  2AWO A;  1HZ9 A;  3CW2 C;  2NVY H;  4IPG A;  5BR8 L;  3AQQ A;  2UU9 Q;  5IE8 A;  1OTC A;  2R7Z G;  1U0L A;  3A0J A;  3WWV A;  2UUA L;  2F4V L;  2NN6 G;  3J80 i;  3CXC A;  1IBK Q;  3U50 C;  4KLK A;  3E0E A;  4JV5 L;  1VQG A;  3I4N G;  4GS3 A;  2VW9 A;  1Q82 C;  1ASY A;  4IFD I;  3T1Y Q;  4DR7 L;  4HIM A;  5J3B A;  3UDI A;  2VS1 A;  3KF8 B;  1XPR A;  1X56 A;  3GTO H;  1WOC A;  1L0W A;  2ZJR A;  4GKJ L;  5IYD H;  3FP9 A;  4JI6 L;  2UXD L;  3TEH B;  3G6E A;  4LUZ A;  4JCV E;  2Y0S G;  2MFI A;  4H02 A;  3PO3 G;  2KHJ A;  3KLW A;  2JK8 A;  4KI0 A;  1VQ8 A;  4APV A;  1IBL Q;  5JJK A;  2K75 A;  4Y7N H;  4JV5 Q;  1DGS A;  2AKW B;  2PNH A;  2WAQ G;  2K14 A;  3HFZ B;  5IWA Q;  3HOZ G;  1WCM G;  3T1H Q;  3PF5 A;  1AE3 A;  1X54 A;  5FLM G;  2MNA A;  3I4O A;  4GKJ Q;  4BXX H;  5GAE C;  4JI6 Q;  5IYB H;  2D0O A;  1L1O A;  3RLN A;  3EIV A;  2D0P A;  4B3S Q;  3PUY A;  1PH8 A;  1VQE A;  3EBE A;  1Y1W G;  1I94 L;  1VQA A;  4GLV B;  4ALP A;  1JJC B;  1HJP A;  2HHH L;  1IL2 A;  4YY3 L;  4XIG S;  5IP7 G;  4JYA L;  4IO9 A;  5LMN W;  1Y1V H;  2JJQ A;  4DR6 Q;  5C0X J;  2UXB Q;  4WJ3 M;  1KC8 C;  1X6O A;  2AWN A;  2GN5 A;  1X9N A;  1ASZ A;  3E9H A;  3HOV H;  4JBJ A;  4A3I G;  3GTK H;  1GVP A;  5JEA G;  4LF8 Q;  3JAM c;  4LF5 L;  4UP7 A;  2CQO A;  2ALY B;  4LF4 Q;  1SRU A;  4NXN L;  4LFB L;  1XTD A;  4QIW E;  2WB1 G;  4TVA B;  3GTP H;  4A3G H;  4LF7 Q;  1BBW A;  3BZK A;  3F2C A;  4A3C G;  2AMC B;  1VQO A;  3I4N H;  3RN5 A;  1PH6 A;  4A93 G;  4GN3 B;  1I94 Q;  1E1O A;  5C0X I;  3RN2 A;  4OXP A;  4IOA A;  2NZO A;  4JI4 L;  4MZ9 A;  4AYB E;  3ERS X;  4A3D G;  4R4C A;  4GN5 A;  4C2M H;  2VQE L;  1HR0 L;  4B3M L;  2K5H A;  2N3S A;  1XPU A;  5DLQ E;  1KHI A;  3Q8D A;  3F2B A;  4LF9 L;  1VQJ A;  2VUM G;  1EQQ A;  4PMW A;  1X3G A;  1SR3 A;  3NEM A;  3A5U A;  1NBW A;  1K8A C;  1Q46 A;  4LFB Q;  3A74 A;  2OTJ A;  2BA1 A;  3DM3 A;  2A19 A;  3I7F A;  5GAD C;  3PGZ A;  2L15 A;  2I0Q A;  1N36 Q;  3S1M H;  2H5X A;  2JEB I;  3CF5 A;  1PA6 A;  4NB3 A;  1KRT A;  2I5H A;  1J6Q A;  4DUY Q;  4OX9 Q;  2IX1 A;  3HKS A;  3CCJ A;  1EOV A;  3JC6 6;  4EQ5 A;  1CKN A;  4FDB A;  4IJL A;  2OTL A;  2GVA A;  3A5Z B;  3S15 H;  1Q1E A;  4JOI C;  4UP8 A;  1YHQ A;  1XNQ Q;  4LF9 Q;  3I4M G;  4B3R Q;  1K83 H;  1CSQ A;  3KFU A;  2IY5 B;  2JA9 A;  4YWM A;  3GTJ H;  2BH2 A;  1Q86 C;  4DR1 Q;  1B8A A;  4X65 L;  2JA7 H;  3PO2 H;  2RHS B;  2Q2H A;  1UE6 A;  3NBH B;  2R6G A;  4KHP L;  4LFA Q;  2B63 H;  1VQK A;  1M1K C;  1AH9 A;  4OON A;  4TQU S;  4DV0 L;  3S1N H;  5C44 G;  1Q1B A;  1E22 A;  4L5Q A;  4DR4 L;  4C3I H;  4YWK A;  4A3B H;  1VQB A;  5IT9 c;  1VQH A;  3ULP A;  1GD7 A;  1R9T H;  5FJ8 G;  4GOP A;  4DV4 Q;  1N32 L;  2A8V A;  3J7Z C;  1XNR L;  2K50 A;  3J81 j;  2RF4 A;  4A3M H;  2F52 A;  4X65 Q;  1U5K A;  1VQ4 A;  1LTL A;  1S40 A;  2I5L X;  3S16 H;  4WJ4 A;  2E2I H;  4KHP Q;  4JG2 A;  3RLO A;  5M3F H;  4PZ6 A;  5GAH C;  2Z6K C;  1IBK L;  4DR5 L;  1FVI A;  1TXY A;  3KF6 B;  2VQF L;  1EIF A;  2JE6 I;  2JQO A;  2WB1 E;  4A3L H;  4XTC S;  2JA8 H;  3TQY A;  4R4T A;  3OW2 A;  3PV0 A;  1A0I A;  3PIP A;  4IPH A;  1MJE A;  1N33 Q;  4NPS A;  3TS2 A;  4DUZ L;  1Q12 A;  3T1Y L;  3CCV A;  1N32 Q;  4AQY L;  2K5V A;  1WI5 A;  3JAM i;  4JI7 L;  4AIM A;  4DK6 C;  4HJA A;  1XNR Q;  3U4Z A;  1KAW A;  2YYZ A;  1UE5 A;  4YHH Q;  2JEA I;  3CC4 A;  3HOY H;  1T9H A;  2R7D A;  3FKI G;  1TWF H;  3FHW A;  4OWT B;  3H0G G;  2E2H H;  3HOW H;  2HQL A;  2ZM6 Q;  4DR5 Q;  4P71 A;  2VQF Q;  3K80 C;  1P8L A;  2KCT A;  1IBL L;  2PMZ E;  3AFP A;  1UE7 A;  2KHI A;  1QVG A;  3G48 A;  1MIU A;  1TWG H;  1W3S A;  5IWA L;  2R93 H;  4DUZ Q;  3G4S A;  3KJO A;  4OWW B;  2D62 A;  2NN6 I;  4AQY Q;  1SMX A;  4BY1 G;  3T1H L;  4JI7 Q;  4QL5 A;  3HKZ E;  4A76 A;  2NVQ H;  1X3E A;  2ASB A;  4B3S L;  4P75 A;  1VCI A;  1XMQ L;  3M7N A;  5C4J H;  1YJW A;  1PH2 A;  1IYJ B;  4HIO A;  1K9M C;  1N9W A;  1O7I A;  5IP9 H;  4DV1 Q;  3RNU A;  4A3E H;  4GLA C;  5M3M G;  3L7Z C;  1VQ7 A;  2UUB Q;  2UXB L;  4DR6 L;  3KDF B;  1TWH H;  2XGT A;  2YV5 A;  3BZC A;  4PZ8 A;  2C35 B;  2K5N A;  4BA2 I;  3U58 A;  4LF8 L;  1L1O C;  1PYB A;  3TS0 A;  1K8G A;  2Z0S A;  3PUX A;  3G71 A;  1XMO L;  4LF4 L;  3CQZ H;  2HIV A;  1PH4 A;  2PI2 A;  1RL2 A;  2JA6 G;  4K0K L;  5LMN Q;  3HOU G;  2Q2U A;  2QGQ A;  2YTY A;  4UPA A;  4LF7 L;  2VY3 A;  5C3E H;  1D7Q A;  1NE3 A;  1XMQ Q;  5C4X G;  3M4Q A;  3ER0 A;  1BBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...