3FKIG

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fkiG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3fkiG01
3FP9A 1EFWA 1KIXA 4LFBQ 2VL6A 1FL0A 4AQYQ 3AFPA 4MNOA 5IP7H 2UXCL 4C3HH 2UUBL 1SN8A 3JC66 3K0XA 4DAMA 3TS2A 2VQFQ 3BJUA 2PMZE 4A3JH 4UP9A 5DLQE 1OXTA 1YZ6A 4JI1L 2JA7G 1X55A 2MQHA 4KHZA 3M7NA 5C44G 2ZJQA 2LXKA 5GAEC 3E0EA 4NPSA 1PH2A 1B70B 3CC2A 4B3SL 2YV5A 3NELA 5EAYA 1N8RC 4DV7L 4YY3L 3RN2A 1X3GA 2F4VL 2CWPA 1BVSA 4BBRH 5C0XI 2E5LL 2Z6KA 3K81C 5IT9c 4Y52H 2CKZB 2A8VA 5GROA 2E2JH 3CF5A 5BR8L 1VQNA 3I4MH 2HQLA 3HOYG 1NMGA 2FXQA 4MZ9A 5IP9H 4A93H 1SROA 2JA5H 1CKNB 4IPHA 2VUMH 2Y0SG 2ID0A 4A3GH 4PZ8A 4DR2L 4P72A 3RLFA 2JA9A 1YBYA 4GOPC 4LF9L 2YTVA 4HJ9A 3PO2G 1PYBA 2B29A 2NVXH 4DUYQ 4OWTB 4IOCA 5M3MG 4B3RQ 1DGSA 3T1YL 2ZTDA 2N78A 1HNWQ 3AQQA 4J15A 2JA8H 4JYAQ 1VQEA 3SGIA 1CKMA 1FJGQ 4A3CH 3PF4A 4OO1I 4UP8A 4LF6L 4WJ4A 5C44H 2QA4A 3KLWA 4HJ7A 4LF5Q 2AWOA 1MKHA 4A4IA 2N49A 4POFA 1CUKA 3K80C 2EIFA 4GNXA 4DV3Q 1NMFA 4A75A 3PO3H 3IRBA 3M9BA 2UUCQ 2WAQE 2I5LX 1IXRA 2UUAL 1GM5A 5JEAG 2K50A 3OTOQ 3CCEA 4IPDA 3J81j 1UEBA 2BH8A 3UDFA 5IY0A 2HHHQ 3JAMi 2QGQA 3PIOA 4JOIA 1IBML 3S1QH 2WP8J 4JI4Q 2Y0SE 3CCJA 1TXYA 1HZCA 4DV6Q 2PI2E 4DR4L 2K14A 1G51A 3CAMA 3ZJYC 5M5YH 4KHPL 3RLOA 3KFUA 3GTKH 3I55A 4JBJA 3RLNA 3CCQA 1I94Q 5M3FG 2E8GA 1E24A 1A62A 1PH3A 2YTYA 4IPCA 1Y1WG 4LF4L 2IY5B 1A63A 4JI0Q 3T1HL 4BY7H 5IYDH 3CCRA 1X65A 4DV5L 1HR0Q 3CCSA 4KI0A 2KCMA 3E9IA 4JI3L 2E2IH 4BXXH 5ELOA 3AEVA 2BA0A 1PFSA 4X65Q 1S72A 1TWHH 1X56A 1FVIA 3UE0A 3UDXA 4C3IH 4MTNA 4X64Q 1WCMH 3F2CA 2B63G 3HOUH 1IBKQ 4IFDG 2VY3A 1N36L 3F8TA 3W5OA 2IT1A 4A3EG 4GOPB 1J6QA 1VQKA 2MFIA 2UXBQ 1QVCA 2H5XA 3OW2A 3GTQH 3CPWA 1OXUA 4A3KH 3CPFA 2K5NA 4XIGS 1NJIC 4NXNL 4B3TL 4DAYB 2BH2A 4JI2L 2IX1A 1XMQL 5IP7G 1QUQB 1TWAH 1EYGA 2NVQH 5JJIA 1VQGA 3GO5A 2QEXA 3GTOH 4PMWA 3M4QA 1D7QA 4AH6A 1VCIA 4A3JG 3EN2A 1JJ2A 4R4IA 4JI8Q 2XTIA 1T9HA 3U4VA 5FLMH 4R4OA 1PHJA 1VQ7A 1NTGA 3DM3A 3FHWA 1X3EA 4K0KL 2ZJRA 4LF7L 4GNXC 4KLKA 3J81i 1QVFA 4GKJL 4DV4L 1EUJA 1TWGH 5IE8A 1HNZL 3J80i 1OXXK 1CSPA 1VQDA 4GLVB 1KRTA 3PCOB 4BBRG 1N33Q 3CMAA 3TEHB 1L1OA 4A3FH 3NEMA 2VQEQ 4LF8Q 3I4MG 2OTJA 5IP9G 3M85A 3AFQA 4AYBE 1IBLL 4A93G 1D8LA 1R9TH 3KOJA 1PVOA 4QL5A 2A19A 5GAHC 2AKWB 4JBMA 2UXDL 1E7ZA 3ER0A 4A3MH 1JJCB 2VUMG 3L0OA 4A3GG 4JI7Q 3L2PA 4X62Q 4POGA 5HGQA 5JJKA 2A1AA 3A74A 3H0GH 4LW1A 4ME3A 5C0XJ 3CCVA 1EIFA 2NN6I 5LMUQ 4YWMA 2Q2TA 4NXML 4IJHA 3ULLA 4JBKA 2AWNA 4PZ7A 3TREA 4UY8C 3I4NH 3S15H 3PF5A 3DLLA 4YHHQ 1K8GA 4QGUA 4LNQA 3CQZH 2JA8G 3HOZH 4A3CG 3KF8B 1BKBA 1EOVA 1WFQA 1FGUA 2ZJPA 2UU9L 2JJQA 1JB7A 1KQSA 1YEZA 1VQHA 1HNXQ 1GD7A 1H95A 1A8VA 1XNQQ 3PO3G 4X66L 3BZKA 4JV5L 3A0JA 3W1GA 3S1RH 3GDEA 1ASYA 1YI2A 2LSSA 4EX5A 2ZM6Q 5IWAL 4BA2I 1K3RA 4DR5Q 4A3LH 1N34Q 2WAQG 4DKAC 1PH4A 2GVAA 1Q7YC 2ES2A 4RMFA 3CXCA 1E3PA 4GKKL 4DNIA 3S16H 2KHJA 2D0PA 3HOVH 1JJGA 3I56A 3NENA 1NE3A 4QY7A 4HJAA 5AJ3Q 2PQAA 2R6GA 4GNXB 4A3IH 1EIYB 1CKOA 4DV2Q 4OX9L 2LXJA 1J5EQ 1P16A 3HOXH 4LFAL 2IX0A 4DR3L 3UE1A 2RCNA 5IYDG 3TRZA 1L1OC 4JI5Q 3GTJH 2RF4A 4BY7G 2IHFA 4B3ML 3CP0A 1VQ5A 4LFCQ 2C35B 3A5UA 3UDGA 2ZTEA 3J7ZC 4BXXG 1M1KC 4LFBL 4RG1A 5ELNA 4AQYL 4DPGA 1VQCA 4JI6Q 3HOZG 3HOUG 1X3FA 1SRUA 1WCMG 3H3VI 4QQBX 4IO9A 5H1SE 2VQFL 4HJ8A 1VQMA 4P75A 1V9PA 1UE1A 1KD1C 3GTLH 2IHEA 4P74A 4DUZQ 1IL2A 4A3KG 1UWVA 1B8AA 4HIOA 2NVYH 1KXLA 1MJEA 1VQOA 2R7ZH 4BBSH 5FJ8G 3PUVA 1WJJA 1VQ4A 1XNRQ 4Y7NH 5M5WH 5GADC 1HZBA 1Z9FA 5FLMG 1KRSA 5LMNQ 4DR1Q 3KJPA 2Z0SA 1Q12A 2F52A 5JJLA 4BA1I 2HIVA 2VS1A 3M4OH 5HY6A 1L0WA 1Y14B 4DV1Q 1Q1EA 2HT1A 4A3FG 1Q82C 2R93H 1KL9A 4GN4B 4A76A 3MEFA 1N32Q 4IJLA 4C2MH 4JBWA 3CCUA 2JA6H 1G6PA 4DUYL 1Q86C 4O0AA 3S2HH 2K75A 4DR7Q 4B3RL 2CFMA 1K0RA 3ICEA 1HNWL 2JE6I 4XTCS 3EBEA 1QZHA 2N3SA 4A3MG 1I5FA 4TVAB 4AYBG 4JYAL 1FJGL 3OYYA 1W3SA 1YNXA 1W2BA 3TS0A 1LYLA 3H0GG 1Z47A 2MO1A 3TQYA 1YJ9A 4LF5L 2GN5A 4A3BH 4DV3L 1L1OB 3I4NG 2UUCL 1SLJA 1TWCH 4UPAA 1C9OA 5FJ8H 4DV0Q 1XMOQ 4APVA 1PH9A 2JEAI 1VQLA 1XTDA 5FLXc 1PH1A 3OTOL 4C3JH 1K9MC 4JCVE 4DR6Q 3KDFA 3L7ZC 1PA6A 2HHHL 1RIPA 1GO3E 3A5ZB 3S1MH 5GQOA 2F3IA 4JI4L 5C3EH 1Q81C 4IFDI 5M5XH 3UDIA 4DV6L 1IZ6A 1KC8C 4LWCA 1VQAA 2HIXA 2UUBQ 2UXCQ 4YWKA 2K5HA 4OXPA 3NBHB 4A3LG 2ALYB 1I94L 1SFOH 1JE5A 2KHIA 4JI1Q 2D0OA 3GTGH 2AHOB 5K36G 2OQKA 4JI0L 3KF6A 1PH6A 3CD6A 4B3SQ 4A3DH 4YCVA 3HOVG 1XJVA 1HR0L 4DV7Q 2I5HA 2V1CC 1AE2A 2DUDA 4YY3Q 2F4VQ 1RL2A 4R4TA 2NZOA 2D62A 4X65L 4A3IG 2E5LQ 3Q8DA 3S24A 2R7FA 3F1ZA 4L5TA 1YHQA 4X64L 3HOXG 3AYHB 1U5KA 5BR8Q 1K73C 1IBKL 1HJPA 3ULPA 1Q8KA 2ATWA 3HOWH 2VZAA 1SMXA 1QVGA 4X6AH 2UXBL 4L5SA 3GTPH 1VQ8A 2N8NA 4WJ3M 2VW9A 1V1QA 1LUZA 3ERSX 3H15A 4DR2Q 1E22A 1I3QH 4LF9Q 1VQ9A 4JG2A 2PQAB 4FDBA 3RN5A 1MIUA 1K8AC 3FKIH 3T1YQ 1I6HH 4JI8L 5C0XG 1HZ9A 2WB1E 2K52A 1EQRA 4ALPA 4LUZA 4GLXA 3CCMA 4YCWA 1UE5A 3EIVA 3VDYA 3LGJA 2MNAA 3KJOA 2YU9H 3M4PA 4LF6Q 1YVCA 3ULJA 2R7ZG 4BBSG 1B7YB 3STBC 1QZGA 1N33L 3PUXA 1KHIA 1PH5A 1C7YA 2PNHA 4HIDA 3HOYH 1UE7A 4LF8L 2VQEL 1YJWA 2UUAQ 1P8LA 1UE6A 3U50C 3PUWA 3PGZA 4BY1H 3RNUA 2JQOA 5E7NA 2YYZA 3G71A 3STBD 1IBMQ 4JI7L 2RHQB 1L2FA 3PSIA 1HH2P 2KCTA 4X62L 4HIKA 1C0AA 1YIJA 2Q2IA 4PZ6A 2R93G 4DR4Q 5LMUL 2JA6G 5IYBG 3S2DH 4OO1G 4H02A 4UP7A 4KHPQ 4GN3B 4DK6C 4YHHL 1EWIA 1WI5A 5IYCH 4L5RC 4LF4Q 3U4ZA 3CCLA 3WWVA 1Y1VH 3T1HQ 2Q2HA 5C4XH 4DV5Q 1KAWA 3G6EA 4OONA 5JEAJ 1N9WA 3JAMc 3I7FA 2R7DA 3D31A 1M90C 1HNXL 4JI3Q 1XNQL 3GD7A 1XPUA 4A3BG 4AIMA 1YITA 3G4SA 2ZM6L 3I4OA 1WYDA 4DR5L 1N36Q 3PUZA 1N34L 1XPOA 1OXVA 5J3BA 1S40A 2R92G 3G48A 1CKNA 2JA7H 1VQFA 4YCUA 2KBNA 1HZAA 5C3EG 2PI2A 4R4CA 1SE8A 1VQBA 2OWOA 1YHAA 4B3TQ 4NXNQ 4P71A 4JI2Q 1XMQQ 5AJ3L 3M3YH 4QIWE 1V43A 4HJ5A 4YWLA 1E1TA 4DV2L 3RZDH 1K83H 1E1OA 2B3GA 1J5EL 4GLAC 3J7A5 2WFWA 1VQPA 2E2HH 5IYBH 3HKZG 3CC7A 1XPRA 3CC4A 1SR3A 1VQIA 1YHBA 2NZHA 2OCEA 4QJFA 4R4QA 1BBWA 1TWFH 4LF7Q 4K0KQ 4OWWB 3KDFB 4JI5L 4A3DG 3CW2C 3H3VH 4GKJQ 3RR5A 4DV4Q 4IOAA 5LMNW 4LFCL 1S3OA 4IFDJ 1HNZQ 3CMEA 2GVBA 3S14H 4JI6L 3PO2H 1OXSC 2RHSB 3K8AA 5C4JH 5M3MH 3K7AH 3HOWG 1IBLQ 2Z6KC 1PYSB 1HR0W 4NB3A 2AMCB 4DUZL 2UXDQ 5GAGC 1EQQA 3KF6B 3PV0A 2R92H 3PUYA 2ASBA 1MJCA 2MO0A 3E9HA 3BZCA 3J81c 1U0LA 1PV4A 3GTMH 1WOCA 3S17H 1A0IA 4NXMQ 3J80c 4OWXB 1XNRL 3I2ZA 3FKIG 3PIPA 1Q46A 2I0QA 1BBUA 4LUOA 5LMNL 4DR1L 3HKZE 3D0FA 3KYHC 1JMCA 1X6OA 1JT8A 2KENA 4GN5A 2WB1G 4R1JA 3MXNB 3HFZB 1O7IA 2EQSA 4DK3C 2UU9Q 1AH9A 2EXDA 2L15A 4EQ5A 2Q2UA 1Q1BA 1GVPA 1LTLA 4DV1L 2K4KA 4X66Q 3F2DA 4JV5Q 1N32L 2VNUD 2K5VA 1CSQA 4PG3A 2NVTH 1VS0A 1ASZA 5IWAQ 3F2BA 3S1NH 4GS3A 3B6YA 1NBWA 4DR7L 2NN6G 4GOPA 2OQ0A 4L5QA 5M3FH 4BY1G 1GKHA 1YJNA 2CQOA 1LM0A 2BA1A 1Y1WH 1NY4A 4GKKQ 4P73A 2I5MX 1PH8A 1QUQA 3RZOH 4JOIC 1AE3A 2JK8A 4TQUS 1OTCA 3HKSA 2OTLA 4OX9Q 4HIMA 1XMOL 4DV0L 2DGYA 1VQJA 3BU2A 3W1BA 4O2DA 5IYCG 1X9NA 2CCZA 2JA5G 1I50H 1X54A 4LFAQ 2B63H 1G291 4DR3Q 1IYJB 2YTXA 1Y1VG 3U58A 4A3EH 1VQ6A 1PH7A 2JEBI 4DR6L 2ZTCA 5C4XG 4B3MQ 4JC0A 4IPGA 2CWAA 4LUVA 3K7UC 2XGTA
chains in the Genus database with same CATH superfamily
4LFBQ 2NYZD 4RAUC 3MA2B 2JA8B 4C3HH 1ENCA 3NXWA 1K8OA 4EYIB 3BVMA 3BJUA 1IBLH 4UP9A 3A8JE 5D1PA 2IBKA 1YZ6A 5G3LF 4JI1L 1MD2D 5C44G 2UXDH 4XYOA 5GAEC 3PO3B 3CC2A 1B70B 2NU8B 3T51B 2JSOA 3F8NA 5IGDA 3RN2A 1X3GA 2F4VL 4BBRH 4JV0A 3Q8QB 1S5FD 2IJ0A 5IT9c 4QCLA 1V51A 2ATLA 5GROA 4U6PA 1PXUA 4ED1A 3CF5A 2R7ZB 2UXBH 1VQNA 2A73B 3I4MH 3HOYG 5IP9H 2R85A 3KF8A 2B8GA 1CKNB 1K28A 1PZKD 3RB6A 2ID0A 3KHLA 4PZ8A 3GTKB 2NU6B 3RB4A 4EFBA 4IR9A 3GTLA 2YTVA 1TVXA 1B9MA 1M0WA 5JPNC 4DL7A 4OWTB 1PTOD 5K2MA 5M3MG 5C8YF 4EBDA 1DGSA 4B08A 1HNWQ 5EWEA 1EL0A 4F50A 3QJYA 5KG3A 4A3CH 2KQ3A 2W8LA 4OO1I 4UP8A 1F9RA 4C3IB 2YS6A 3SHLA 4HJ7A 4LF5Q 1EY0A 3AB9A 2R86A 4DV3Q 1VMCA 2WKDA 3NP8A 2R8HA 2UUCQ 2WAQE 2I5LX 4K2LA 2QW7A 3CCEA 1PK8A 3OWEB 1AFPA 3QZ7A 3BS1A 5IY0A 1STAA 1LT4D 2F0UA 3RUPA 2R93A 1IBML 5I9PA 4JI4Q 5ISRA 1KEEA 1TXYA 1BDOA 3N6RA 4UFZA 3RZOB 4AQYH 3CAMA 3ZJYC 1WVLA 1XDNA 5KFXA 1GSOA 4N8FA 2Z9HA 4JBJA 3CCQA 4CKBA 4GC6A 1A62A 2K33A 3DWAA 4IPCA 1U4MA 3CCRA 2FPPB 2F03A 3PW4A 1W6KA 3RBEA 3V6KA 1LT5D 2PZTA 4K6DA 4JI3L 5ELOA 2E2IH 4BXXH 1C30A 1S72A 4CDDC 2L12A 1TWHH 2M9VA 3UE0A 1FVIA 3HOUH 3F2CA 1ZYRD 1WCMH 2K7VA 5JPMC 4RGNA 2J6SA 2VY3A 1II3A 3FRPB 5KNDA 4A3EG 2IT1A 3KTMA 2UXBQ 4DU9A 4FBTA 4J9OA 2F0NA 5JEAH 1B6SA 4A3KH 1SYDA 3ZYYX 4XIGS 3TQTA 3QFFA 1LTBD 4B3TL 2XD4A 4DAYB 2BH2A 4JI2L 3TN2A 5IP7G 1QUQB 5EKLA 5LL6S 4Q44A 4AH6A 5CV4A 1ZHQA 3FMAA 1L0YB 4R4OA 1VQ7A 4WORA 5CBAE 4H44C 4KLKA 1QVFA 1FJGH 1UAPA 1OXXK 5KFKA 4GLVB 2FK1A 3K58A 5EKIA 3P20A 1L1OA 4JK1C 5FO8B 1S5DD 3BDLA 3NEMA 1NAPA 2OTJA 4DUZH 1B3QA 1E2WA 1ZKOA 4AYBE 2ZDGA 3E0JA 1PVOA 4JBMA 2A19A 3URYA 1EUDB 4A3MH 2VUMG 5FPOA 1I50A 3L0OA 4L8JA 3Q2OA 1D5MC 2OLSA 4POGA 5HGQA 5JJKA 3KALA 1XNRH 2N88A 3VA7A 5LMUQ 5LMNH 4UY8C 2AWNA 2HCCA 1VKZA 3I4NH 2CW7A 2YU9A 1WD1A 1YNND 4QGUA 4LNQA 2F1MA 4ZAIA 5L37A 3T5HA 1D5XC 5IGFA 1EZ8A 1AUXA 4DV1H 3KXYT 2ZJPA 4IWYA 5EZYF 2VQDA 1HR0H 4ZHQF 2EPBA 1JB7A 1D1IA 4CDCC 2R82A 4X66L 4JV5L 2Q8IB 3GDEA 2IW3A 5KFAA 4X64H 4EX5A 2FPIB 1H9SB 2NVYB 2ZXOA 3V6JA 3M4YA 1PH4A 5G3LD 4MV9A 1F2YA 4XQJA 5KX5F 3CXCA 2IA6A 1AP0A 3HGBA 3S16H 4ECQA 3TIGA 3I56A 4HJAA 3MJFA 4YAJB 1JX4A 5AJ3Q 2R6GA 4GNXB 1GUSA 1FGBD 1EIYB 1CKOA 2CZGA 2DNEA 4OX9L 1NUCA 3HOXH 2VXWA 3OIPA 2B2TC 2TSSA 2IX0A 4BY7G 5IYDG 4B3ML 4C2MB 1PMRA 3W2DA 3J7ZC 3S2HB 1M1KC 4LFBL 4H7BA 2V5AA 5JQWA 4JI6Q 2JA7A 3NHHA 3HOZG 1X3FA 3ND9A 5KRUA 3BA9A 3H3VI 4YP3A 1VQMA 1ILQA 1V9PA 1UE1A 1KD1C 3T5JA 4DUZQ 4A3BB 2ZXRA 2YYAA 1H9JA 4HIOA 2R7LA 1KJQA 4X62H 1K83A 1DYQA 2R7ZH 4BBSH 4HMJA 5FLXE 2L1BA 1KDAA 3WOFA 4F88A 1VQ4A 1XNRQ 1L2ZA 5GADC 4YHHH 3OMGA 4MV8A 5LMNQ 2Y0SA 5E4XA 1EFID 4ILWA 5IT9W 1SBBB 2D5DA 4EGVA 2EY1A 4RHRA 4QWAA 2FJ2A 4XYMB 2VS1A 1HNXH 1C3OA 4DV1Q 2HT1A 4WRDA 1XNQH 1Q82C 3KUPA 1G6PA 4OIJA 4JBWA 2JA6H 5KNCA 2PZUA 3IKJA 4OO1H 4EBCA 1Q86C 2W7PA 2K75A 1MI2A 1PYWD 3I90A 3ICEA 3GTMA 1HNWL 1TWHA 4KJNA 3ERQA 3U9SA 1GSHA 4ZK9B 3IN5A 4TVAB 4PV1C 2H4OA 3VYUA 2UVRA 2K01A 3H0GG 1YJ9A 3R2IA 4LF5L 4O4IF 2OEOA 5CAEB 4DV3L 4YB8B 2UUCL 4DV0Q 1PH9A 2W9AA 1HTLD 2R61A 1K9MC 4MTDA 4DR6Q 4UCRA 1BXRA 3S1MH 5GQOA 1PLFA 4JI4L 4LFCH 3TZDA 5C3EH 1HQMC 2E76C 4TV9F 1DV1A 4MTEA 2XGPA 2HIXA 3GV8B 4IQZA 3DF7A 1F9QA 1SJED 4LF4H 2ALYB 4ZQIA 1EY5A 2KHIA 3R8BA 5DNFA 2OQKA 3CD6A 1ESFA 3D4WA 3H3VC 1XJVA 3NQIA 5M9OA 4DV7Q 2MPMA 3C1EA 4YY3Q 1F2ZA 2E2DC 2D62A 4RZQA 1EWHA 3V2TA 3I70A 1S0NA 1QOHA 1UEAB 2PW7A 3AYHB 2A68D 1HJPA 3ND8A 3NBHA 5C5MA 1SMXA 5HURA 2UXBL 1B6RA 2E2JB 4FM9A 2D9UA 4NXNH 3GIMA 4IALA 2N8NA 2G5DA 2E75C 2CHBD 1LUZA 1B2TA 1JICA 1GLVA 4C5CA 2JA5B 5KFMA 1E22A 3NQTA 1Z2PX 4Y8VB 1R4QB 4L1KA 3OW7A 1TY0A 1K8AC 3AMUA 1RKNA 5DQIA 4K0KH 4ME5A 2KVMA 2WB1E 2K52A 5KFFA 3LGJA 2MNAA 5FLXW 5KT6A 5BMVF 4XZ3B 3ULJA 5K36H 1O75A 1QZGA 5T14A 3M7GA 3LWBA 1QILA 3RAQA 2AGPA 1JKJB 1RCVD 1UE7A 3DEOA 2FLLA 1YJWA 2B2YC 2EYHA 1WTXA 3VPBA 3U50C 1HXYD 3K3VA 2X6LA 5E7NA 4OELB 2F0HA 2WIIB 3RZDB 3PSIA 4FYDA 4ECVA 1YIJA 1BJTA 2E2HB 2R93G 2XN9C 4DR4Q 2DPJA 5LMUL 4O3RA 3BABA 3S2DH 4I7HA 1TWFB 3ORQA 5FLXL 2Q8TA 1V1OA 1EWIA 1EY4A 3KK7A 4JI1H 1VMPA 2F0GA 2QDBA 4LF4Q 3NSWA 3U4ZA 4L5RC 3WWVA 3T1HQ 2H1EA 2V58A 4QMGA 3PO2B 2RGVA 3G6EA 3SK8A 5C4JB 5AFWA 3JAMc 3N41B 1N9WA 2F4VH 3I7FA 2SEBD 3GD7A 4XT1B 1XYIA 4IRKA 3TQ1A 3MZ5A 2HDMA 3G4SA 1STNA 4HSVA 3NTKA 4RUCA 1S9FA 1AZPA 1N36Q 4LK1C 3J81E 3RIZA 1CKNA 5CV7A 1VBGA 3J80E 1D1KA 2PZWA 2PI2A 3GTKA 1VQBA 2OWOA 4NXNQ 2BQRA 1XMQQ 5AJ3L 3M3YH 3KLRA 4WJWA 4HJ5A 4IN3A 4YWLA 1TAEA 2SOBA 4XDXA 3NBIA 4RGMA 2FP4B 2V4QA 4IUQA 3C3LA 4G7OC 1TWAB 4Y52H 4R4QA 1VQIA 1YHBA 4RCNA 2OCEA 2PN1A 1BBWA 2F0LA 4K0KQ 5D8DA 3KDFB 1LTGD 4A3DG 3H3VH 1A3UA 2RBMA 1DIKA 2CW8A 3RR5A 5HBRB 2PQEA 3NWSA 5LMNW 4JV1A 1S3OA 1HNZQ 3TZUA 4JI6L 1OXSC 1TWGB 1Y1WB 3MFGA 3D4DA 1O7ZA 1OO9B 3MVVA 3HOWG 1T5XD 4V0BA 1QNKA 1HR0W 2V59A 4RNOA 3GQBA 2OH2A 1M6VA 4DUZL 4RU9A 1IBMH 1EQQA 5KFEA 2V4RA 3PUYA 1ET6A 1MJCA 3E9HA 2B63B 2X0SA 4I65A 1ZEQX 2KEDA 1PV4A 3S17H 1ENAA 4ED3A 3PW5A 3N52A 4ABNA 2KHSA 1XNRL 2EY6A 1RODA 4RB2C 2C22A 1Q46A 2I0QA 1BBUA 3SK4A 5LMNL 5DG8A 2F0VA 4CHTB 2KENA 2P5ZX 4GN5A 4G7HC 2SNMA 3HFZB 1AH9A 4DK3C 1EUCB 2K03A 4C3HB 1WTPA 2QYZA 3CQZB 1GVPA 5BN5A 4DV1L 4JI3H 2K4KA 1I7NA 4JUZA 3F2DA 5E3FA 4CJ0B 2PMZB 2RA4A 3F2BA 4GS3A 1NBWA 4ECTA 2ZDHA 1GXDC 2OQ0A 4L5QA 4BY1G 1YJNA 1GUTA 4XYLB 2CQOA 1BNZA 1LM0A 2BA1A 4BBRB 3GIDA 2VOBA 4OGQC 5EWFA 3OSNA 1NCVA 4GKKQ 4M7EA 2YZMA 5KG0A 1DOLA 2AUKA 4B3TH 4DAYA 4MV4A 4G57A 1QUQA 2K04A 4JI2H 2ICIA 2B2VC 1OTCA 2OTLA 1RJQA 3OTOH 1TS5A 4DV0L 2R8GA 1I6UA 3BU2A 3N40P 1ICFB 2GPWA 3FEWX 4LFAQ 4ME6A 3M9MB 2YTXA 5IGCA 4DR6L 5JJZA 4R9WA 1IKMA 2CWAA 5EDWA 3K7UC 2XGTA 3EPGA 2F0PA 2JYOA 2BE5C 1L0XB 2HDLA 3FP9A 1KIXA 1DV2A 4BWSC 3GTJB 1G91A 3RFCA 4QUCA 3J81W 3K0XA 3JC66 1SNCA 4DAMA 2QF7A 4LMYA 1VF5C 1KTKA 1K0SA 3MHBA 2JA7G 1X55A 4CKCA 3RMHA 2LXKA 4EVOA 3E0EA 4FS1A 1PDQA 3I3CA 4JW0A 4NPSA 2HGSA 3IFDA 3UI2A 4X65H 1N8RC 4DV7L 3BZDB 1BCPF 4YY3L 1BCPC 1JWUD 1BVSA 1G2TA 3K81C 1KJJA 2E2JH 3DXJC 1NMGA 1PTOC 1HUMA 1S5ED 2JA5H 4RAZA 2JEFA 2VB3X 4HNUA 2J9GA 3J81L 2Y0SG 5KFWA 3KHRA 1VDZA 5KFTA 4ED0A 3SE7A 3RLFA 2JA9A 1YBYA 5JVG3 3J80L 1DM0B 4HJ9A 3OIQA 1NR2A 3D4RA 3H94A 3MAQA 4PQXA 2F0OA 4B3RQ 1H9SA 2NVYA 3PMFA 3R23A 2ZTDA 2N78A 1HFGA 1K1QA 5KT3A 3AQQA 4Q45A 1CKMA 1PRTF 2BR0A 1PRTC 5JVLA 3HOUB 4EBEA 4IRCA 1WCMB 2F0KA 4NMZA 4RKLA 4POFA 1JIHA 3K80C 4GNXA 3IRBA 5EKKA 4ZI7F 3GQCA 2YW2A 4OX9H 3J7AV 1U9RA 4A3KB 2EJMA 2K50A 5JEAG 2W71A 4YR0A 4ECZA 3OTOQ 1JDBB 1TWCB 3UDFA 2HHHQ 4C2MA 4B3MH 3PIOA 4JOIA 4KY5A 3MWMA 5KKNB 2O5IC 2QCPX 4LFBH 4LH7A 2WE6A 1EIHA 5EOYA 4DR4L 4B9XA 2K14A 4J9LA 3MTSA 2NUCA 3SEBA 3BVGA 1I94Q 3RV3A 1E24A 1I4RA 1ZYRC 1PH3A 2YTYA 4LF4L 1A63A 1T5EA 2B8FA 4JI0Q 2YRXA 3TDQA 3T1HL 5KGUA 2AGOA 3VR4A 3GTGB 5C1OA 4DK1A 2ZM6H 2BA0A 1PFSA 4X65Q 3Q23A 2I8CA 3IFTA 1X56A 5I9OA 4IFDG 4HNVA 4A3MB 1IBKQ 2L11A 2O2LD 1N36L 2WYOA 5KFGA 3F8TA 3K5LA 1VQKA 3GTQH 5IGEA 2B2UC 1KNEA 3I4NB 2K5NA 1E0BA 3GP7A 1NJIC 4NXNL 5JJIA 1XMQL 2NVQH 1TWAH 2UVUA 4BWGB 1TA8A 1E2ZA 4RA8A 4A3JG 4RZRA 1LO5D 2NTTA 5FLMH 5A2QW 1HNWH 1EZ1A 1B4OA 4DK0A 4UAIA 4K5VA 2ZJRA 4K0KL 1RJRA 5DGAA 2A6ED 3FKIB 1SDFA 1ULZA 1EUJA 1TWGH 5IE8A 1HNZL 4C56C 1N33Q 4LF5H 1CSPA 1VQDA 1SNQA 4NP5A 4DL5A 1HA5A 3Q24A 3CMAA 3P1HA 3OMCA 4DV3H 4A3FH 2EYPA 2WB1B 4J9SA 2UUCH 3GTPA 1TKWB 2HVSA 1PTOH 3M85A 4A93G 4DF7A 2K05A 1R9TH 3KOJA 1I3QA 5T1IA 2AKWB 1E7ZA 1CA6A 1JJCB 4ODGA 4JI7Q 4A3GG 3L2PA 4JI4H 4LH6A 3QO2A 2ASDA 2A1AA 2CW0C 3A74A 1MSGA 5A2QL 3G8CA 3CCVA 2NN6I 4YWMA 2Q2TA 1O78A 4JBKA 3S15H 3NUCA 5KYIA 5KFBA 1MSHA 3CQZH 2JA8G 1BQQT 2Z8LA 1SE3A 1EOVA 1S10A 5DQHA 2BE5D 2F0WA 3A8IE 1VQHA 1GD7A 1B9NA 4MTKA 3PO3G 4ULLA 1BUVT 5FO9B 1S4ZA 2EJGC 3A0JA 3S1RH 4JV2A 2K6AA 1TS2A 1ASYA 2LSSA 2ZM6Q 1E4EB 4PWQA 1K3RA 4DR5Q 4A3LH 4CKEA 4IRDA 4BBSB 3BQ1A 2ZT9C 3K5HA 4K5WA 2F0DA 4QWBA 1G8ZD 4GKKL 4FXDA 4MV7A 5CYUA 2JA5A 1BCPD 3NENA 2FPGB 3RGXA 4A3IH 5J2TF 4LJZC 5DAUA 1DJRD 4LFAL 2XSCA 2EY5A 4H0LC 5JH7F 3HB9A 4JI5Q 3GTJH 2JA6B 1SYBA 1TQOA 3CP0A 2AQ2B 3HOYB 2C00A 5ELNA 3DWPA 1RK6A 5CMDA 4X3KA 4C3IG 3WOEA 1SRUA 2ICEC 3EROA 4U68A 3H91A 4HJ8A 2J4XA 2ASLA 4P75A 1VBHA 4KHVA 1KDCA 1U4PA 1IL2A 5FPRA 3NGDA 1GYFA 1PRTD 3GILA 1KXLA 4JPBW 1KBLA 1QJOA 3GV6A 2E2HA 3OOCA 5LMUH 5DEHA 1TWFA 1JR0D 2R92B 1D6EC 5DG7A 5M5WH 1HZBA 1Z9FA 3S1MB 1KRSA 1KAAA 3MWYW 5CC4A 5C3EB 3L4KA 4YR3A 1CI3M 1Q12A 4DR2H 3TIIA 1I4XA 3W3AA 2I07B 4BA1I 2PVPA 1EEID 3T5LA 1L0WA 1Y14B 5T1GA 1WTWA 1KL9A 4GN4B 4A76A 3MEFA 3VMMA 4IJLA 3PR4A 1F2LA 1SYGA 3OSOA 4B3RL 4XQQA 2JE6I 4NKLA 4XTCS 3EBEA 1QZHA 3HZXA 2NVTB 1Z7TA 3MXGA 1LABA 2B2WA 3TS0A 4G3IA 1STEA 3C1FA 4MV1A 2XVSA 4MAMA 4LSAA 5BPHA 1TWCH 1FNVA 1C9OA 3BVZA 3EA6A 1TWAA 5FLXc 1PH1A 5D3IB 4C3JH 3OTOL 3QZ8A 4I50F 3BDCA 3KDFA 2DPIA 2HHHL 1TT2A 2DJGC 1GO3E 1HQRD 5CR3A 3CRKC 5M5XH 4TQSA 1STHA 1KC8C 4JI6H 4LWCA 2SCUB 1Y1WA 1TWGA 2UUBQ 1SYXB 2F0TA 1I6HB 1LT3D 4IUNA 3M9OB 1KJIA 2J7ZA 1I94L 1S97A 2G9DA 3GTGH 4ED7A 5K36G 2A68C 3TSSA 2PYKA 4JI0L 1AW7A 4O4HF 2NU9B 1T94A 3HOVG 1Y8PB 2B63A 2V1CC 1AE2A 2DUDA 4UCSA 2NBFA 5IIFA 4X65L 5KT7A 4U673 3Q8DA 3S24A 1Q8IA 2R7FA 3F1ZA 1A2UA 2F0EA 1ILPA 1LACA 1SNOA 1K73C 1IBKL 1CE8A 1LTID 1U4RA 3DM1A 4ZRZA 4ZCKA 4XT3B 5KFHA 1KJ8A 3S2DB 2VW9A 3RJ0A 2DLNA 4DR2Q 2CW0D 4IR1A 2EYMA 2RSNA 4HTHA 4DL4A 4JG2A 1EYCA 2IPKD 1SEIA 2F0SA 3E5SA 3TP6A 2PMZA 2XCPA 2F4IA 3FKIH 5NUCA 5C0XG 1HZ9A 1HUNA 4O3OA 3VPCA 3CCMA 1PFNA 1GUNA 1UE5A 3GIJA 4RFBA 3M4PA 4LF6Q 1B7YB 4JVZA 1N33L 4EGJA 4DAVA 3PUXA 1KHIA 5L1IA 1PH5A 1C7YA 2K28A 3QOLA 3E6ZX 5KFOA 1E2VA 2M05A 4DV0H 2NN6H 3PUWA 1EOTA 2I87A 2C28A 4DR6H 3RNUA 2M00A 3M3YB 5KG2A 2NZ1D 3STBD 4MA5A 1ICWA 2PBZA 4JI7L 5KFCA 1L2FA 4HIKA 2KCTA 4ZQ3A 3T13A 4PZ6A 1CHPD 4QIWB 4ETSA 4C5BA 4H02A 1F9PA 2QEJC 3CRLC 1WI5A 4KTAA 1JORA 4E6IA 1Y1VH 4G4KA 5C3XA 2Q2HA 1LTRD 4TUYF 5C4XH 2R7KA 4DV7H 4YY3H 1M90C 4UCTA 3P7JA 4A3BG 3BG3A 3A56A 5BN3A 2ZM6L 3I4OA 1WYDA 5CORA 1ENFA 4DR5L 3V4ZA 1DCZA 1OXVA 3G48A 3S17B 2KBNA 1HZAA 1GUGA 1EQTA 2QDLA 4E4TA 1ZETA 4RB3C 2WTFA 4I4TF 2ALZA 2DZDA 5KFYA 1V43A 2E74C 1FKAH 5KG4A 3H6MA 1VQPA 1Z2NX 3HOYH 3F2UA 2E2IA 1D5ZC 4QB4A 5J1ZA 1DOKA 3SR1A 4LF7Q 4JI5L 3GTOB 5CB4F 5ELEA 4IOAA 3BDOA 4GKJQ 4C5AA 3OHAA 1WCMA 1Q3LA 1KNAA 1B53A 3N8DA 1GOZA 3VR5A 2G9HD 5ELBA 4RB0A 2KCNA 4KKSA 4RHSA 3K7AH 5M3MH 5KFDA 1CK1A 1O80A 5GAGC 2R92H 3K5MA 2BDNA 5LXTF 2MO0A 3BZCA 4ID6A 3J81c 3Q8PB 4DR4H 1SE4A 5JVDF 4NXMQ 3J80c 1YNJD 4HN7A 4RKBA 4OWXB 1EY7A 3I2ZA 3PIPA 3BYTB 3I73A 3DWQA 4LUOA 5KG7A 3HKZE 1EHIA 3NTHA 3T1HH 4FNFA 2V4DA 3BQ2A 1O7IA 1EZ6A 2EQSA 2UU9Q 2EXDA 3GTGA 4FVMA 4N9TA 1LTLA 1SAPA 4RNMA 5DM73 1EWCA 2TMPA 2VNUD 2NVTH 1VS0A 1ASZA 5IWAQ 2F0FA 1N36H 2W57A 5KFJA 4H13C 4IWXA 3IL8A 1QB5D 3BA8A 1H9MA 1NY4A 4CJ1B 2FINB 4KY7A 1XMQH 4JOIC 2JK8A 4RGOS 3R3OA 4TQUS 2W6NA 4QW9A 1X9NA 3W1BA 2CCZA 2JA5G 4O2DA 5IYCG 1MGSA 1HFNA 1G2SA 4DNRB 1G291 4DR3Q 1IYJB 5JOBA 4A3EH 1CA5A 1GGOA 2ZTCA 2A6HD 2RDHA 4JC0A 2LFNA 1XXGA 1HRJA 2JEIA 4TRDA 3RLNA 1I6HH 1HNZH 4K5XA 3AFPA 2RDJA 2WB1A 3PW0A 5IP7H 2UUBL 4FF2A 1UC9A 2NB0A 2LMCB 4IHJF 5BPFA 2VQFQ 1VF7A 3KAJA 2C5CA 1OXTA 5CBEE 2R8IA 3RAXA 2C2EA 4KHZA 2ASJA 5D14A 2ZJQA 1CQIB 3A7AB 5EPLA 3NELA 5EAYA 5JAVA 4QUFA 5H80A 4FF3A 2ENBA 1GUOA 2FJZA 2WAQB 2Z6KA 4OEMB 2A8VA 2YCHA 1SMYC 5D65A 5E4WC 2HQLA 2FXQA 2KJXA 1FNWA 1SROA 5FK9C 1GJXA 2VUMH 4FP5D 1IYVA 4MIUA 2FK2A 4DR2L 4P72A 4L6TB 2K5DA 4GOPC 3PO2G 2B29A 1E4EA 4IOCA 2R8JA 3GV7B 3PR5B 4EG0A 1DD2A 2R7ZA 4J15A 2O5JC 1IOVA 4JYAQ 1VQEA 1EYZA 4DXGA 3PF4A 4GKKH 4LF6L 3G6XA 3VYRA 1B50A 3KLWA 4KD4A 2AWOA 4N9PA 4O3PA 4A4IA 3J7AF 1CUKA 4A75A 3KLSA 1W6JA 3V05A 5A35A 3GTQB 4KMUC 2FB9A 1GM5A 2RDIA 4LFAH 3A55A 2VUGA 4R8NA 2K5QA 4IUTA 4O1NA 5EJWA 1UEBA 4ZUIA 3A7LA 3J81j 1B33N 3H09A 3JAMi 2NVQB 2CVRA 3S1QH 2JA6A 3TBIB 3CCJA 1HZCA 2HD3A 2PI2E 2XCAA 3K57A 3GIIA 5M5YH 3RLOA 4ZKBB 4KD3A 4FBUA 4C1NI 5M3FG 2E8GA 1BCPB 2IY5B 2FMAA 3O13A 5DM63 1Y1WG 2ZJTA 4BY7H 5IYDH 4A3FB 1SJHD 1EU4A 4KN7C 4MA0A 2KCMA 3E9IA 2BDOA 1PTOB 3AEVA 3L3OC 5LP6F 5L1JA 1R9TB 2R92A 1XTCD 3HOZH 1KLUD 2WKCA 2B63G 4AYBB 1MZBA 1WTVA 4RCOA 5LA6F 3W5OA 2MFIA 2FE3A 4RB1A 3OW2A 3BQ0A 3NK9A 3CPWA 1OXUA 2CH4W 3CPFA 3S15B 4DXFA 2W6QA 5KNBA 2A6EC 1Y69U 2IX1A 4HMIA 3K6OA 4IAJA 1T3NA 1EYGA 2QEXA 3QWNA 4C3HG 3IAYA 4K2KA 5EPKA 4IURA 1PRTB 3M4QA 4OIKA 4PMWA 3GTOH 4EEQA 3PW2A 4B3RH 1JJ2A 4JI8Q 3U4VA 1PHJA 1NTGA 3LWEA 1FNUA 1X3EA 1FR3A 4LF7L 3A8KE 3MR3A 3G6JB 3JRXA 3Q1KA 1CZWA 3S1RB 4GKJL 5EQ0A 2B2TA 1KRTA 4BBRG 3PCOB 3S9WA 4EQOA 1ZHSA 4CC5A 2X69A 3TEHB 1WH2A 3T5KA 4RAYA 1EU3A 4DAPA 3I4MG 2VQEQ 5J2UF 5IP9G 4HEDA 1W96A 2F3WA 4QL5A 2HHHH 1LTSD 4A3IB 1SNPA 2GA4B 4DL3A 4EEYA 4DNTB 3H0GH 4LW1A 3D6WA 1WD0A 1KABA 2PNRC 4LMQD 4NXML 5KEEA 1ZXTA 2XRQD 3DLLA 1K8GA 2OXPA 1I94H 1CZGA 4FXKC 3RB3A 2BQUA 2BQ3A 2L5TA 4A3CG 4JI0H 3J80W 1BKBA 2YZNA 1WFQA 2UU9L 1KQSA 1YEZA 1AZQA 1A8VA 5EGTA 3X3NA 2UVWA 3BZKA 3W1GA 4O4LF 2W6MA 5LL6b 4F7XA 5IWAL 4BA2I 1IBKH 2KA7A 2YL2A 1N34Q 3KLSX 2QKIC 4DGZA 2GVAA 1Q7YC 1A3TA 4YBZB 2DWCA 2ES2A 4RMFA 1E3PA 3Q6SA 4DNIA 4DN4M 5M5WB 3KBXA 1NE3A 1Z6HA 4MN3A 3EQLC 5KIXA 4DV2Q 1SMYD 2LXJA 1J5EQ 1P16A 4B9WA 4R8IA 4DR3L 4FF4A 3UE1A 1CQFA 5DG9A 3TRZA 1L1OC 2KECA 4ECRA 2MGSA 4O3NA 3I4LA 1A3VA 3A5UA 3UDGA 3CU7A 4BXXG 1N33H 4DPGA 1VQCA 3HOUG 2P0AA 5KFQA 1WCMG 4IO9A 5H1SE 2VQFL 3ETJA 1SXTA 2XGQA 4ED2A 2EXZA 1S68A 3GTLH 1HTPA 2IHEA 4P74A 4A3KG 4OHJA 4JI7H 1MJEA 1VQOA 4ED8A 4QIWA 4C3JB 1LTAD 4KJOA 5DLGA 4KKTA 3Q8RB 2C2DA 4Y7NH 3CKIB 3C2PA 5CV5A 4HNTA 2VA2A 5M5XB 1BNCA 4HR7B 2EOTA 4KV6A 2Z0SA 2F52A 5JJLA 3OUUA 3NPPA 1GSAA 2PPBC 5EWGA 4IUVA 3R5HA 3WO1A 5KFLA 5I47A 2HIVA 3JSNA 3M4OH 5K5PA 1Q1EA 2R93H 3HKZB 1N32Q 1HA6A 1RJTA 4O0AA 4DR7Q 3Q8SB 4DR5H 2CFMA 4MV3A 1EQVA 2GLTA 4HQ6A 1RTOA 2K1BA 4JYAL 4A3MG 1I5FA 5LOVF 3MR5A 3PVXA 3OYYA 2J0TD 3T16A 1CM9A 4XXEA 1SCUB 1LYLA 3TQYA 3N6XA 1JC7A 2GN5A 2HUGA 4DFAA 3I4NG 1AN7A 2WV6D 1WR2A 4UPAA 5I2YA 1XMOQ 4ECYA 5FJ8H 3K5NA 2JEAI 5CV9A 1LT6D 1SYEA 1QCBD 2R7MA 4ECXA 3GTOA 1DONA 4JI5H 3GLKA 2IL8A 5F2DA 3R5FA 2B2YA 3A5ZB 1KC7A 2F3IA 3Q22A 1I6VC 3SK6A 5FOBB 4IFDI 4FU0A 2W9BB 3D3RA 3AU7A 1IZ6A 2KEEA 5L1LA 1EY6A 1SYFA 4QW8A 2UXCQ 4J9QA 1EYAA 3NBHB 2Z1CA 4Q8FA 4EQPA 4DV5H 5E1FA 2W70A 1PH6A 2UVVA 4B3SQ 4A3DH 4A3JB 4YCVA 5FKAC 5ELDA 5HGTA 3EVQA 1I7LA 1RL2A 4IZOA 4DL6A 2E5LQ 3HXLA 1YHQA 2K32A 4K6LA 3HOXG 5BR8Q 1Q8KA 3HOWH 3TMEA 3H20A 2HVRA 4WJ3M 3D8GA 3H15A 3MFHA 1IOWA 1JWMD 4LF9Q 1VQ9A 3L9AX 3DEPA 2PQAB 2PW5A 4FDBA 1Y1VB 4A3GB 3EYYA 1MIUA 1R4PB 3EFXD 4A2BA 4WFN3 1ET9A 5CA1F 4EYHB 3T1YQ 1NNXA 2X6GA 4JI8L 3J7YW 2RVLA 5C4XB 2XWBB 4LUZA 2JN4A 4K8IA 4FS2A 3KJOA 2YU9H 2QILA 1RHPA 4O3QA 3R2TA 2R7ZG 4BBSG 2A5HA 3KHHA 3STBC 5DLFA 3E5NA 4IUPA 4EGQA 5EBCA 4CGYB 2PNHA 4HIDA 5C44B 2HVQA 2VQEL 2UUAQ 1P8LA 1UE6A 3DUZA 1TIID 1KDBA 4Q0YA 3LMLA 1JB3A 4K14A 4BY1H 4J9RA 2EVBA 1HH2P 2R6FA 3QG1A 2JA6G 5KFVA 4O2AF 4OO1G 4KHPQ 3HBLA 3KAKA 2UUBH 3U9TA 1WTHA 4GN3B 3BAAA 4NLGA 4DK6C 1UNNC 1V8QA 3QB3A 3GIPA 2NU7B 3T53B 2R87A 1SE2A 2W8KA 3JRWA 4DV5Q 4QWCA 5JEAJ 5M3MB 3K7AB 2R7DA 3D31A 5L9XA 2WAQA 4AIMA 1T36A 3FDSA 4UCOA 2BCOA 3PUZA 1N34L 1XPOA 4O2BF 5J3BA 1S40A 2R92G 2JA7H 4YCUA 3MFYA 4F87A 4R8UB 5JUMA 1IKLA 5C3EG 4R4CA 1X32A 1SE8A 1STGA 1GUWA 4FF1A 1PFMA 1YHAA 2WACA 1DZ1A 4P71A 4J9KA 4CJ2C 3MWEA 4ZKCB 4KKUA 4DV2L 1A2TA 1K83H 2B3GA 1J5EL 1ZQ7A 1M0TA 3LNNA 4YJ2F 3H4DA 2WFWA 5IYBH 3CC7A 3VA5A 1XPRA 2YRWA 1SR3A 2NZHA 4QJFA 2AQ4A 2B2VA 5KFZA 5LHY1 3CW2C 4DV4Q 2NVXB 4LF6H 4IFDJ 4C1NK 1QE6A 1QNUA 3I8ZA 2GVBA 3CMEA 2RCFA 4G7ZC 3S14H 3GTQA 3T56B 3K8AA 5KT5A 1YNJC 1IBLQ 2Z6KC 1PX2A 5D1OB 4NB3A 2AMCB 4I7AA 1G6ZA 2UXDQ 2DNCA 1IW7C 3KF6B 3MXUA 1I4GA 3KHGA 2ASBA 3G6VA 3GTMH 2NUAB 1WOCA 4CDEC 5CA0F 1A0IA 2DIKA 3MR6A 2IMWP 2EYLA 4A3EB 1CS0A 3K0YA 1B1ZA 4PMBA 2W9CB 2JEGA 3D0FA 5CV8A 1A6XA 1JMCA 5GONF 1JE4A 3N42B 1WSCA 4R1JA 3MXNB 3E3XA 4EQ5A 1RD9D 4DUYH 1R9TA 1N32L 1CTMA 4AYBA 3S1NH 4DR7L 1FYCA 5FD5A 2VPQA 1DXMA 2MP1A 3V4SA 4IUUA 5IT9E 2FLNA 1V1PB 2F3VA 3CHBD 3HS0C 2I5MX 2A6HC 1PH8A 2CQAA 3CQZA 2Z4IA 4TSSA 1AE3A 2O03A 1XMOL 3HOVB 2DGYA 1VQJA 3TINA 4IFDH 2VUMB 2DY7A 2EYOA 1CHQD 1O7YA 4LF7H 1PH7A 2JEBI 1EIGA 2IWHA 1V4YA 4GKJH 3RUZA 4DV6H 3MC0B 4IPGA 4N8X1 4RUAA 1EFWA 4OL7A 1RK5A 2VL6A 1FL0A 4AQYQ 4MNOA 1PZJD 1S5CD 2UXCL 1SN8A 2L4NA 3TS2A 4J9NA 1RF2D 2PMZE 4A3JH 5DLQE 3M7NA 3D6CA 2F0IA 2MQHA 2VB2X 4XX0B 5IGBA 4B3SL 1PH2A 1LV9A 2YV5A 4Q43A 1C48A 1TU2B 4EFEA 1X3PA 1K1SA 5D3DA 2CWPA 5C0XI 5FD6A 2E5LL 3HEJA 4NXMH 1TR5A 2CKZB 3GTJA 4KN4C 1UNSA 5BR8L 3S1QB 1BR9A 4MZ9A 1I4PA 5ELCA 4A93H 2XRSD 2UU9H 4IPHA 5M5YB 4A3GH 3RGZA 1H9KA 3TP5A 3WO0A 2VA3A 2J6UA 1FD7D 4LF9L 2N55A 2MUYA 2PO4A 1PYBA 3OWFA 3LWUA 2R7NA 2B2UA 4IZ8A 4DUYQ 3CVZA 5IWAH 4BY7B 1Z2OX 3T1YL 1W93A 1A9XA 3X3MA 5CV6A 2I46A 2JA8H 2EY2A 3SGIA 2FK3A 1FJGQ 3GIQA 5TSSA 2GPSA 4GZYC 3HOZB 5C44H 2QA4A 4QWEA 3BG5A 3H40A 5I2XA 4M1UB 1MKHA 3WDNA 2N49A 3OHXC 4LF8H 3PW7A 2EIFA 3PO3H 1NMFA 2HCIA 4I55F 3M9BA 1RYSA 2XIGA 1IXRA 4NW2A 2UUAL 3MXPA 3NWTA 5I6WA 4DR3H 1LLRD 4HCSA 4IPDA 3SK5A 2BH8A 4TKOB 5KFNA 2OT2A 2QGQA 4YQWA 2WP8J 1PZID 2Y0SE 2QK4A 2LS01 3VR2A 4O3SA 2JEJA 4DV6Q 4U7CA 1G51A 3FDTA 4MV6A 4KHPL 1UUPA 3KFUA 3GTKH 3I55A 2VQFH 1OWTA 1MHWC 1I4HA 2C9OA 2F0MA 2AU0A 1J9OA 1HPCA 2KCCA 4FO2A 3HP3A 1X65A 4DV5L 2K5WA 1TWCA 1SFOB 1HR0Q 3CCSA 4KI0A 3OPOA 3JZIA 4UCUA 2DN8A 3RBDA 2XWJB 5EPJA 4F4WA 3UDXA 4C3IH 4X64Q 3FPPA 4MTNA 4P2CB 2W6PA 4YAKB 1HHVA 4HR7A 1S5BD 4GOPB 1J6QA 5KG6A 3H0GB 1QVCA 2H5XA 1IW7D 1NSNS 4M8AA 4O42A 1BO0A 5IT9L 3PIO3 4UCVA 3GTPB 2AUJD 3HKZA 3FPUB 1VQGA 3GO5A 1N56A 2FLPA 1D7QA 4J6HA 1VCIA 1M8AA 3EN2A 3C0FB 2NVXH 4R4IA 3RZOH 2XTIA 1I3QB 1T9HA 4TV8F 1RJPA 3FHWA 3DM3A 5IOCA 2EDGA 4JYAH 4GNXC 3J81i 2R84A 4DV4L 3I12A 3J80i 4APMA 4L63B 1JXLA 1BF4A 2LY7A 2Q8RE 3TP8A 4LF8Q 5C3WA 4HYKA 2KUMA 3AFQA 1IBLL 1D8LA 5GAHC 3C46A 2UXDL 4TQRA 3ER0A 3ORRA 5C5LA 4X62Q 2W9BA 3FKIA 2JXMB 4ME3A 4F4YA 5C0XJ 1EIFA 4IJHA 3ULLA 2HJWA 4DR1H 4PZ7A 5COYA 3TREA 3PF5A 1SNMA 3FMCA 4YHHQ 1EY9A 4PMCA 3BYYB 3FVQA 1KLGD 2CH4A 3KF8B 1F2MA 1FGUA 5KFPA 2JJQA 2FKLA 3VR6A 3N43B 1HNXQ 2A74C 1H95A 1XNQQ 1O7LA 1CQVA 3HG9A 2RQXA 2Z4HA 3GTLB 1YI2A 2YZGA 4K8JA 2D2CC 3K5OA 4RGTA 2WAQG 1WTQA 4DKAC 3RTXA 4S3SA 5J22A 3I91A 2DY8A 2RDFA 2I80A 4YR2A 3GV5B 4HCEA 4Y7NB 2KHJA 2D0PA 3HOVH 1JJGA 1RYRA 3RV4A 2XC9A 5KYLA 4XQNA 4QY7A 5F9LA 2PQAA 1Y1VA 4X3UA 4DA2A 4M9UA 3EPIA 5IODA 4JI8H 1HCZA 1TS4A 2F0QA 2C2RA 4LAAA 3M4OB 2W6ZA 2RCNA 4GC7A 2R93B 2RF4A 2IHFA 3GIKA 1VQ5A 4LFCQ 2C35B 4RH6A 2ZTEA 5LYJF 4RG1A 4AQYL 2IP4A 1JOQA 2R3ZA 4QQBX 2VQEH 1IHZA 2LKVA 3NTIA 1JOOA 1JDEA 5KFIA 5C0XH 3LX0A 4YJ3F 3PQIA 5KG5A 5JVH3 4CC6A 5C6AA 2VPSA 5EBDA 1BXTA 1UWVA 1B8AA 2NVYH 2AQ1B 1BBXC 5C5JA 5FJ8G 1QG7A 2MJ8A 3PUVA 3N44B 3MFIA 1WJJA 4CBVA 5FLMG 2OF1A 4DR1Q 3KJPA 1BGWA 1H9RA 4X3SA 1D2BA 1E4GT 3UQ8A 5I6YA 5HY6A 2DJFC 1STYA 4A3FG 2CQYA 1AUVA 4C2MH 2B39A 3CCUA 3WNZA 2FMCA 4RWSC 4DUYL 1M4VA 2EZVA 3S2HH 4A3DB 3QR8A 1N34H 1K0RA 1NR4A 3SDZA 1XX8A 4R8UA 2N3SA 5KG1A 4AYBG 1SNDA 1FJGL 2ZXPA 1TY2A 1W3SA 3T4AC 1YNXA 1W2BA 5M3FB 1Z47A 2MO1A 2EE1A 2L9HA 3HOWB 4A3BH 1L1OB 5C4HA 4DV2H 1SLJA 4ZUJA 1J5EH 2ZDQA 4APVA 1VQLA 1XTDA 1J8IA 1CQJB 4JCVE 5ELFA 2V9WA 4KY6A 3L7ZC 3R93A 2A69C 1PA6A 1RIPA 2NVXA 1ESRA 3M4IA 1I50B 4ECUA 1Q81C 4YIJA 3MWDA 3UDIA 4DV6L 1JQYD 1VQAA 3G7LA 4YWKA 2K5HA 4OXPA 3Q0AA 1K8MA 4A3LG 3EJIA 2YU9B 4RNNA 1WTOA 5D1OA 1SFOH 1JE5A 4JI1Q 4J0MA 2D0OA 1TS3A 2AHOB 2L55A 4J9PA 3KF6A 4XYQA 3IG0A 2Z6BA 2XIWA 3ITPA 1HR0L 1JLLB 2I5HA 3DMUA 4ZLTF 4QWDA 1E4FT 2F4VQ 4R4TA 2NZOA 4A3IG 3SE0A 4BY1B 2SDFA 4L5TA 4X64L 1U5KA 2KOLA 2W9CA 1X3QA 3ULPA 2ATWA 3V96A 2M2LA 2VZAA 4X6AH 1QVGA 3MXNA 2O4XA 1F77A 4L5SA 3GTPH 3PN1A 3I4MB 1VQ8A 1CFMA 4Q8EA 3G6YA 1V1QA 3ERSX 4HSPA 4V190 3LP8A 4X3TA 1I3QH 1SSOA 3A54A 1N32H 3RN5A 4DR7H 4PDBA 2B2WC 5KFUA 1WTRA 3JAME 1EQRA 4ALPA 4GLXA 2WINB 4YCWA 3EIVA 3VDYA 4ED6A 1V1PA 2JP1A 2XCLA 1S0OA 4A2AA 1YVCA 4J1MA 2EYJA 1U4LA 2JA7B 1XMOH 3SI8A 4LF8L 3ETHA 1MBYA 2VUMA 4NDXA 2MCTA 5A2QE 1Q90A 3PGZA 1JWSD 2JQOA 3G71A 2YYZA 3HRZC 1IBMQ 5F9NA 3L4JA 4WD3A 2RHQB 1SEBD 4X62L 1K83B 1C0AA 5L1KA 1N48A 2Q2IA 1JCKB 3JSLA 3OUZA 5KT4A 1AN8A 5IYBG 3SXHA 1GHJA 2VR1A 4UP7A 2UXCH 1PTOF 3KBGA 3NE5B 1EEFD 4UDUC 2FHTA 4YHHL 5IYCH 2W6OA 4FXGC 4F8MA 2W7OA 4F4ZA 2Y0SB 5I4DA 4I7ZC 3CCLA 1A15A 2XNAC 4CDFC 3S14B 4F4XA 4B3SH 4QF4A 4WBNF 2L0CA 1ML0D 1KAWA 5FO7B 4ZOLF 4X66H 4JV5H 4OONA 4BS9A 1HNXL 4JI3Q 1XPUA 1F9SA 1XNQL 2E5LH 1VAJA 5IGGA 2EJFC 1YITA 5BN4A 1GHKA 2RKSA 2RGRA 1Y8OB 5BR8H 3H4BA 2E2IB 4HAEA 4C3JG 2IX3A 1M7JA 3VYTA 3GTMB 1TWHB 1I4QA 1VQFA 2BOSA 3RB0A 4B3TQ 5J39A 4JI2Q 4LF9H 1EY8A 4DL2A 4QIWE 2FFKB 2SNSA 2MHVA 3QOJA 1E1TA 4ECWA 2EYFA 3RZDH 1E1OA 4UHVA 1C4QA 4GLAC 3J7A5 3T1YH 2E2HH 3CC4A 3BJYA 3HKZG 1TWFH 2WDTA 4ZYSA 3K5IA 4OWWB 3RF2A 2J6TA 2HQEA 3R5XA 1RDPD 4LFCL 3S1NB 3QIAA 3I72A 4PNYA 4J9MA 1RTNA 3RD4A 3K59A 3PO2H 2RHSB 2UUAH 3DHQA 3UFXB 2R8KA 5C4JH 1PYSB 1QWYA 4LSXA 3U9OA 4Q0FA 3PV0A 2F0JA 2AGQA 1STBA 3K3PA 1DOMA 1U0LA 4R7RA 4Q5VA 2YS7A 4KHPH 3MR2A 3JAMW 1EYDA 3FKIG 2NWGA 1ONLA 3VPDA 1IYUA 4DR1L 1AEXA 1B3AA 3VYSA 3KYHC 4MHEA 1X6OA 3VR3A 1BOSA 1JT8A 4DLKA 2A69D 3MEHA 2WB1G 1CT1D 1SFOA 3OSPA 2L15A 2Q2UA 1Q1BA 2NTSA 2KSWA 3V6HA 2RSOA 4X66Q 4ECSA 4JV5Q 3J7AK 2K5VA 1CSQA 4PG3A 1K3BC 5KFRA 3OHBA 2AQ3B 3B6YA 5IYZF 2NN6G 5C1PA 2FMMA 4GOPA 5M3FH 3H0GA 1GKHA 1LTTD 4J8QA 4Z9CB 5KT2A 2PCFB 1Y1WH 5CGKA 5LL6X 3JAML 3GV3A 3ONAB 4P73A 5DQGA 1S03G 1XWEA 1KJ9A 1S0MA 4EQNA 1C8CA 3SVMA 1SYCA 4A93B 5HV6A 4KK7A 3HKSA 3S16B 4OX9Q 4HIMA 4WJ4A 1JOKA 2B63H 1YNNC 1I50H 1PFBA 1X54A 3PZPA 5DGBA 3U58A 3TP7A 3PIP3 1Y1VG 1UC8A 1Y8NB 1VQ6A 1B04A 3M9NB 1IL8A 5C4XG 4B3MQ 3HOXB 4DV4H 5C4ZA 4LUVA 3P75A 5KFSA 2RDGA 1B44D
chains in the Genus database with same CATH topology
3FP9A 1EFWA 1KIXA 4LFBQ 2VL6A 1FL0A 4AQYQ 3AFPA 4MNOA 5IP7H 2UXCL 4C3HH 2UUBL 1SN8A 3JC66 3K0XA 4DAMA 3TS2A 2VQFQ 3BJUA 2PMZE 4A3JH 4UP9A 5DLQE 1OXTA 1YZ6A 4JI1L 2JA7G 1X55A 2MQHA 4KHZA 3M7NA 5C44G 2ZJQA 2LXKA 5GAEC 3E0EA 4NPSA 1PH2A 1B70B 3CC2A 4B3SL 2YV5A 3NELA 5EAYA 1N8RC 4DV7L 4YY3L 3RN2A 1X3GA 2F4VL 2CWPA 1BVSA 4BBRH 5C0XI 2E5LL 2Z6KA 3K81C 5IT9c 4Y52H 2CKZB 2A8VA 5GROA 2E2JH 3CF5A 5BR8L 1VQNA 3I4MH 2HQLA 3HOYG 1NMGA 2FXQA 4MZ9A 5IP9H 4A93H 1SROA 2JA5H 1CKNB 4IPHA 2VUMH 2Y0SG 2ID0A 4A3GH 4PZ8A 4DR2L 4P72A 3RLFA 2JA9A 1YBYA 4GOPC 4LF9L 2YTVA 4HJ9A 3PO2G 1PYBA 2B29A 2NVXH 4DUYQ 4OWTB 4IOCA 5M3MG 4B3RQ 1DGSA 3T1YL 2ZTDA 2N78A 1HNWQ 3AQQA 4J15A 2JA8H 4JYAQ 1VQEA 3SGIA 1CKMA 1FJGQ 4A3CH 3PF4A 4OO1I 4UP8A 4LF6L 4WJ4A 5C44H 2QA4A 3KLWA 4HJ7A 4LF5Q 2AWOA 1MKHA 4A4IA 2N49A 4POFA 1CUKA 3K80C 2EIFA 4GNXA 4DV3Q 1NMFA 4A75A 3PO3H 3IRBA 3M9BA 2UUCQ 2WAQE 2I5LX 1IXRA 2UUAL 1GM5A 5JEAG 2K50A 3OTOQ 3CCEA 4IPDA 3J81j 1UEBA 2BH8A 3UDFA 5IY0A 2HHHQ 3JAMi 2QGQA 3PIOA 4JOIA 1IBML 3S1QH 2WP8J 4JI4Q 2Y0SE 3CCJA 1TXYA 1HZCA 4DV6Q 2PI2E 4DR4L 2K14A 1G51A 3CAMA 3ZJYC 5M5YH 4KHPL 3RLOA 3KFUA 3GTKH 3I55A 4JBJA 3RLNA 3CCQA 1I94Q 5M3FG 2E8GA 1E24A 1A62A 1PH3A 2YTYA 4IPCA 1Y1WG 4LF4L 2IY5B 1A63A 4JI0Q 3T1HL 4BY7H 5IYDH 3CCRA 1X65A 4DV5L 1HR0Q 3CCSA 4KI0A 2KCMA 3E9IA 4JI3L 2E2IH 4BXXH 5ELOA 3AEVA 2BA0A 1PFSA 4X65Q 1S72A 1TWHH 1X56A 1FVIA 3UE0A 3UDXA 4C3IH 4MTNA 4X64Q 1WCMH 3F2CA 2B63G 3HOUH 1IBKQ 4IFDG 2VY3A 1N36L 3F8TA 3W5OA 2IT1A 4A3EG 4GOPB 1J6QA 1VQKA 2MFIA 2UXBQ 1QVCA 2H5XA 3OW2A 3GTQH 3CPWA 1OXUA 4A3KH 3CPFA 2K5NA 4XIGS 1NJIC 4NXNL 4B3TL 4DAYB 2BH2A 4JI2L 2IX1A 1XMQL 5IP7G 1QUQB 1TWAH 1EYGA 2NVQH 5JJIA 1VQGA 3GO5A 2QEXA 3GTOH 4PMWA 3M4QA 1D7QA 4AH6A 1VCIA 4A3JG 3EN2A 1JJ2A 4R4IA 4JI8Q 2XTIA 1T9HA 3U4VA 5FLMH 4R4OA 1PHJA 1VQ7A 1NTGA 3DM3A 3FHWA 1X3EA 4K0KL 2ZJRA 4LF7L 4GNXC 4KLKA 3J81i 1QVFA 4GKJL 4DV4L 1EUJA 1TWGH 5IE8A 1HNZL 3J80i 1OXXK 1CSPA 1VQDA 4GLVB 1KRTA 3PCOB 4BBRG 1N33Q 3CMAA 3TEHB 1L1OA 4A3FH 3NEMA 2VQEQ 4LF8Q 3I4MG 2OTJA 5IP9G 3M85A 3AFQA 4AYBE 1IBLL 4A93G 1D8LA 1R9TH 3KOJA 1PVOA 4QL5A 2A19A 5GAHC 2AKWB 4JBMA 2UXDL 1E7ZA 3ER0A 4A3MH 1JJCB 2VUMG 3L0OA 4A3GG 4JI7Q 3L2PA 4X62Q 4POGA 5HGQA 5JJKA 2A1AA 3A74A 3H0GH 4LW1A 4ME3A 5C0XJ 3CCVA 1EIFA 2NN6I 5LMUQ 4YWMA 2Q2TA 4NXML 4IJHA 3ULLA 4JBKA 2AWNA 4PZ7A 3TREA 4UY8C 3I4NH 3S15H 3PF5A 3DLLA 4YHHQ 1K8GA 4QGUA 4LNQA 3CQZH 2JA8G 3HOZH 4A3CG 3KF8B 1BKBA 1EOVA 1WFQA 1FGUA 2ZJPA 2UU9L 2JJQA 1JB7A 1KQSA 1YEZA 1VQHA 1HNXQ 1GD7A 1H95A 1A8VA 1XNQQ 3PO3G 4X66L 3BZKA 4JV5L 3A0JA 3W1GA 3S1RH 3GDEA 1ASYA 1YI2A 2LSSA 4EX5A 2ZM6Q 5IWAL 4BA2I 1K3RA 4DR5Q 4A3LH 1N34Q 2WAQG 4DKAC 1PH4A 2GVAA 1Q7YC 2ES2A 4RMFA 3CXCA 1E3PA 4GKKL 4DNIA 3S16H 2KHJA 2D0PA 3HOVH 1JJGA 3I56A 3NENA 1NE3A 4QY7A 4HJAA 5AJ3Q 2PQAA 2R6GA 4GNXB 4A3IH 1EIYB 1CKOA 4DV2Q 4OX9L 2LXJA 1J5EQ 1P16A 3HOXH 4LFAL 2IX0A 4DR3L 3UE1A 2RCNA 5IYDG 3TRZA 1L1OC 4JI5Q 3GTJH 2RF4A 4BY7G 2IHFA 4B3ML 3CP0A 1VQ5A 4LFCQ 2C35B 3A5UA 3UDGA 2ZTEA 3J7ZC 4BXXG 1M1KC 4LFBL 4RG1A 5ELNA 4AQYL 4DPGA 1VQCA 4JI6Q 3HOZG 3HOUG 1X3FA 1SRUA 1WCMG 3H3VI 4QQBX 4IO9A 5H1SE 2VQFL 4HJ8A 1VQMA 4P75A 1V9PA 1UE1A 1KD1C 3GTLH 2IHEA 4P74A 4DUZQ 1IL2A 4A3KG 1UWVA 1B8AA 4HIOA 2NVYH 1KXLA 1MJEA 1VQOA 2R7ZH 4BBSH 5FJ8G 3PUVA 1WJJA 1VQ4A 1XNRQ 4Y7NH 5M5WH 5GADC 1HZBA 1Z9FA 5FLMG 1KRSA 5LMNQ 4DR1Q 3KJPA 2Z0SA 1Q12A 2F52A 5JJLA 4BA1I 2HIVA 2VS1A 3M4OH 5HY6A 1L0WA 1Y14B 4DV1Q 1Q1EA 2HT1A 4A3FG 1Q82C 2R93H 1KL9A 4GN4B 4A76A 3MEFA 1N32Q 4IJLA 4C2MH 4JBWA 3CCUA 2JA6H 1G6PA 4DUYL 1Q86C 4O0AA 3S2HH 2K75A 4DR7Q 4B3RL 2CFMA 1K0RA 3ICEA 1HNWL 2JE6I 4XTCS 3EBEA 1QZHA 2N3SA 4A3MG 1I5FA 4TVAB 4AYBG 4JYAL 1FJGL 3OYYA 1W3SA 1YNXA 1W2BA 3TS0A 1LYLA 3H0GG 1Z47A 2MO1A 3TQYA 1YJ9A 4LF5L 2GN5A 4A3BH 4DV3L 1L1OB 3I4NG 2UUCL 1SLJA 1TWCH 4UPAA 1C9OA 5FJ8H 4DV0Q 1XMOQ 4APVA 1PH9A 2JEAI 1VQLA 1XTDA 5FLXc 1PH1A 3OTOL 4C3JH 1K9MC 4JCVE 4DR6Q 3KDFA 3L7ZC 1PA6A 2HHHL 1RIPA 1GO3E 3A5ZB 3S1MH 5GQOA 2F3IA 4JI4L 5C3EH 1Q81C 4IFDI 5M5XH 3UDIA 4DV6L 1IZ6A 1KC8C 4LWCA 1VQAA 2HIXA 2UUBQ 2UXCQ 4YWKA 2K5HA 4OXPA 3NBHB 4A3LG 2ALYB 1I94L 1SFOH 1JE5A 2KHIA 4JI1Q 2D0OA 3GTGH 2AHOB 5K36G 2OQKA 4JI0L 3KF6A 1PH6A 3CD6A 4B3SQ 4A3DH 4YCVA 3HOVG 1XJVA 1HR0L 4DV7Q 2I5HA 2V1CC 1AE2A 2DUDA 4YY3Q 2F4VQ 1RL2A 4R4TA 2NZOA 2D62A 4X65L 4A3IG 2E5LQ 3Q8DA 3S24A 2R7FA 3F1ZA 4L5TA 1YHQA 4X64L 3HOXG 3AYHB 1U5KA 5BR8Q 1K73C 1IBKL 1HJPA 3ULPA 1Q8KA 2ATWA 3HOWH 2VZAA 1SMXA 1QVGA 4X6AH 2UXBL 4L5SA 3GTPH 1VQ8A 2N8NA 4WJ3M 2VW9A 1V1QA 1LUZA 3ERSX 3H15A 4DR2Q 1E22A 1I3QH 4LF9Q 1VQ9A 4JG2A 2PQAB 4FDBA 3RN5A 1MIUA 1K8AC 3FKIH 3T1YQ 1I6HH 4JI8L 5C0XG 1HZ9A 2WB1E 2K52A 1EQRA 4ALPA 4LUZA 4GLXA 3CCMA 4YCWA 1UE5A 3EIVA 3VDYA 3LGJA 2MNAA 3KJOA 2YU9H 3M4PA 4LF6Q 1YVCA 3ULJA 2R7ZG 4BBSG 1B7YB 3STBC 1QZGA 1N33L 3PUXA 1KHIA 1PH5A 1C7YA 2PNHA 4HIDA 3HOYH 1UE7A 4LF8L 2VQEL 1YJWA 2UUAQ 1P8LA 1UE6A 3U50C 3PUWA 3PGZA 4BY1H 3RNUA 2JQOA 5E7NA 2YYZA 3G71A 3STBD 1IBMQ 4JI7L 2RHQB 1L2FA 3PSIA 1HH2P 2KCTA 4X62L 4HIKA 1C0AA 1YIJA 2Q2IA 4PZ6A 2R93G 4DR4Q 5LMUL 2JA6G 5IYBG 3S2DH 4OO1G 4H02A 4UP7A 4KHPQ 4GN3B 4DK6C 4YHHL 1EWIA 1WI5A 5IYCH 4L5RC 4LF4Q 3U4ZA 3CCLA 3WWVA 1Y1VH 3T1HQ 2Q2HA 5C4XH 4DV5Q 1KAWA 3G6EA 4OONA 5JEAJ 1N9WA 3JAMc 3I7FA 2R7DA 3D31A 1M90C 1HNXL 4JI3Q 1XNQL 3GD7A 1XPUA 4A3BG 4AIMA 1YITA 3G4SA 2ZM6L 3I4OA 1WYDA 4DR5L 1N36Q 3PUZA 1N34L 1XPOA 1OXVA 5J3BA 1S40A 2R92G 3G48A 1CKNA 2JA7H 1VQFA 4YCUA 2KBNA 1HZAA 5C3EG 2PI2A 4R4CA 1SE8A 1VQBA 2OWOA 1YHAA 4B3TQ 4NXNQ 4P71A 4JI2Q 1XMQQ 5AJ3L 3M3YH 4QIWE 1V43A 4HJ5A 4YWLA 1E1TA 4DV2L 3RZDH 1K83H 1E1OA 2B3GA 1J5EL 4GLAC 3J7A5 2WFWA 1VQPA 2E2HH 5IYBH 3HKZG 3CC7A 1XPRA 3CC4A 1SR3A 1VQIA 1YHBA 2NZHA 2OCEA 4QJFA 4R4QA 1BBWA 1TWFH 4LF7Q 4K0KQ 4OWWB 3KDFB 4JI5L 4A3DG 3CW2C 3H3VH 4GKJQ 3RR5A 4DV4Q 4IOAA 5LMNW 4LFCL 1S3OA 4IFDJ 1HNZQ 3CMEA 2GVBA 3S14H 4JI6L 3PO2H 1OXSC 2RHSB 3K8AA 5C4JH 5M3MH 3K7AH 3HOWG 1IBLQ 2Z6KC 1PYSB 1HR0W 4NB3A 2AMCB 4DUZL 2UXDQ 5GAGC 1EQQA 3KF6B 3PV0A 2R92H 3PUYA 2ASBA 1MJCA 2MO0A 3E9HA 3BZCA 3J81c 1U0LA 1PV4A 3GTMH 1WOCA 3S17H 1A0IA 4NXMQ 3J80c 4OWXB 1XNRL 3I2ZA 3FKIG 3PIPA 1Q46A 2I0QA 1BBUA 4LUOA 5LMNL 4DR1L 3HKZE 3D0FA 3KYHC 1JMCA 1X6OA 1JT8A 2KENA 4GN5A 2WB1G 4R1JA 3MXNB 3HFZB 1O7IA 2EQSA 4DK3C 2UU9Q 1AH9A 2EXDA 2L15A 4EQ5A 2Q2UA 1Q1BA 1GVPA 1LTLA 4DV1L 2K4KA 4X66Q 3F2DA 4JV5Q 1N32L 2VNUD 2K5VA 1CSQA 4PG3A 2NVTH 1VS0A 1ASZA 5IWAQ 3F2BA 3S1NH 4GS3A 3B6YA 1NBWA 4DR7L 2NN6G 4GOPA 2OQ0A 4L5QA 5M3FH 4BY1G 1GKHA 1YJNA 2CQOA 1LM0A 2BA1A 1Y1WH 1NY4A 4GKKQ 4P73A 2I5MX 1PH8A 1QUQA 3RZOH 4JOIC 1AE3A 2JK8A 4TQUS 1OTCA 3HKSA 2OTLA 4OX9Q 4HIMA 1XMOL 4DV0L 2DGYA 1VQJA 3BU2A 3W1BA 4O2DA 5IYCG 1X9NA 2CCZA 2JA5G 1I50H 1X54A 4LFAQ 2B63H 1G291 4DR3Q 1IYJB 2YTXA 1Y1VG 3U58A 4A3EH 1VQ6A 1PH7A 2JEBI 4DR6L 2ZTCA 5C4XG 4B3MQ 4JC0A 4IPGA 2CWAA 4LUVA 3K7UC 2XGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FP9 A;  1EFW A;  1KIX A;  4LFB Q;  2VL6 A;  1FL0 A;  4AQY Q;  3AFP A;  4MNO A;  5IP7 H;  2UXC L;  4C3H H;  2UUB L;  1SN8 A;  3JC6 6;  3K0X A;  4DAM A;  3TS2 A;  2VQF Q;  3BJU A;  2PMZ E;  4A3J H;  4UP9 A;  5DLQ E;  1OXT A;  1YZ6 A;  4JI1 L;  2JA7 G;  1X55 A;  2MQH A;  4KHZ A;  3M7N A;  5C44 G;  2ZJQ A;  2LXK A;  5GAE C;  3E0E A;  4NPS A;  1PH2 A;  1B70 B;  3CC2 A;  4B3S L;  2YV5 A;  3NEL A;  5EAY A;  1N8R C;  4DV7 L;  4YY3 L;  3RN2 A;  1X3G A;  2F4V L;  2CWP A;  1BVS A;  4BBR H;  5C0X I;  2E5L L;  2Z6K A;  3K81 C;  5IT9 c;  4Y52 H;  2CKZ B;  2A8V A;  5GRO A;  2E2J H;  3CF5 A;  5BR8 L;  1VQN A;  3I4M H;  2HQL A;  3HOY G;  1NMG A;  2FXQ A;  4MZ9 A;  5IP9 H;  4A93 H;  1SRO A;  2JA5 H;  1CKN B;  4IPH A;  2VUM H;  2Y0S G;  2ID0 A;  4A3G H;  4PZ8 A;  4DR2 L;  4P72 A;  3RLF A;  2JA9 A;  1YBY A;  4GOP C;  4LF9 L;  2YTV A;  4HJ9 A;  3PO2 G;  1PYB A;  2B29 A;  2NVX H;  4DUY Q;  4OWT B;  4IOC A;  5M3M G;  4B3R Q;  1DGS A;  3T1Y L;  2ZTD A;  2N78 A;  1HNW Q;  3AQQ A;  4J15 A;  2JA8 H;  4JYA Q;  1VQE A;  3SGI A;  1CKM A;  1FJG Q;  4A3C H;  3PF4 A;  4OO1 I;  4UP8 A;  4LF6 L;  4WJ4 A;  5C44 H;  2QA4 A;  3KLW A;  4HJ7 A;  4LF5 Q;  2AWO A;  1MKH A;  4A4I A;  2N49 A;  4POF A;  1CUK A;  3K80 C;  2EIF A;  4GNX A;  4DV3 Q;  1NMF A;  4A75 A;  3PO3 H;  3IRB A;  3M9B A;  2UUC Q;  2WAQ E;  2I5L X;  1IXR A;  2UUA L;  1GM5 A;  5JEA G;  2K50 A;  3OTO Q;  3CCE A;  4IPD A;  3J81 j;  1UEB A;  2BH8 A;  3UDF A;  5IY0 A;  2HHH Q;  3JAM i;  2QGQ A;  3PIO A;  4JOI A;  1IBM L;  3S1Q H;  2WP8 J;  4JI4 Q;  2Y0S E;  3CCJ A;  1TXY A;  1HZC A;  4DV6 Q;  2PI2 E;  4DR4 L;  2K14 A;  1G51 A;  3CAM A;  3ZJY C;  5M5Y H;  4KHP L;  3RLO A;  3KFU A;  3GTK H;  3I55 A;  4JBJ A;  3RLN A;  3CCQ A;  1I94 Q;  5M3F G;  2E8G A;  1E24 A;  1A62 A;  1PH3 A;  2YTY A;  4IPC A;  1Y1W G;  4LF4 L;  2IY5 B;  1A63 A;  4JI0 Q;  3T1H L;  4BY7 H;  5IYD H;  3CCR A;  1X65 A;  4DV5 L;  1HR0 Q;  3CCS A;  4KI0 A;  2KCM A;  3E9I A;  4JI3 L;  2E2I H;  4BXX H;  5ELO A;  3AEV A;  2BA0 A;  1PFS A;  4X65 Q;  1S72 A;  1TWH H;  1X56 A;  1FVI A;  3UE0 A;  3UDX A;  4C3I H;  4MTN A;  4X64 Q;  1WCM H;  3F2C A;  2B63 G;  3HOU H;  1IBK Q;  4IFD G;  2VY3 A;  1N36 L;  3F8T A;  3W5O A;  2IT1 A;  4A3E G;  4GOP B;  1J6Q A;  1VQK A;  2MFI A;  2UXB Q;  1QVC A;  2H5X A;  3OW2 A;  3GTQ H;  3CPW A;  1OXU A;  4A3K H;  3CPF A;  2K5N A;  4XIG S;  1NJI C;  4NXN L;  4B3T L;  4DAY B;  2BH2 A;  4JI2 L;  2IX1 A;  1XMQ L;  5IP7 G;  1QUQ B;  1TWA H;  1EYG A;  2NVQ H;  5JJI A;  1VQG A;  3GO5 A;  2QEX A;  3GTO H;  4PMW A;  3M4Q A;  1D7Q A;  4AH6 A;  1VCI A;  4A3J G;  3EN2 A;  1JJ2 A;  4R4I A;  4JI8 Q;  2XTI A;  1T9H A;  3U4V A;  5FLM H;  4R4O A;  1PHJ A;  1VQ7 A;  1NTG A;  3DM3 A;  3FHW A;  1X3E A;  4K0K L;  2ZJR A;  4LF7 L;  4GNX C;  4KLK A;  3J81 i;  1QVF A;  4GKJ L;  4DV4 L;  1EUJ A;  1TWG H;  5IE8 A;  1HNZ L;  3J80 i;  1OXX K;  1CSP A;  1VQD A;  4GLV B;  1KRT A;  3PCO B;  4BBR G;  1N33 Q;  3CMA A;  3TEH B;  1L1O A;  4A3F H;  3NEM A;  2VQE Q;  4LF8 Q;  3I4M G;  2OTJ A;  5IP9 G;  3M85 A;  3AFQ A;  4AYB E;  1IBL L;  4A93 G;  1D8L A;  1R9T H;  3KOJ A;  1PVO A;  4QL5 A;  2A19 A;  5GAH C;  2AKW B;  4JBM A;  2UXD L;  1E7Z A;  3ER0 A;  4A3M H;  1JJC B;  2VUM G;  3L0O A;  4A3G G;  4JI7 Q;  3L2P A;  4X62 Q;  4POG A;  5HGQ A;  5JJK A;  2A1A A;  3A74 A;  3H0G H;  4LW1 A;  4ME3 A;  5C0X J;  3CCV A;  1EIF A;  2NN6 I;  5LMU Q;  4YWM A;  2Q2T A;  4NXM L;  4IJH A;  3ULL A;  4JBK A;  2AWN A;  4PZ7 A;  3TRE A;  4UY8 C;  3I4N H;  3S15 H;  3PF5 A;  3DLL A;  4YHH Q;  1K8G A;  4QGU A;  4LNQ A;  3CQZ H;  2JA8 G;  3HOZ H;  4A3C G;  3KF8 B;  1BKB A;  1EOV A;  1WFQ A;  1FGU A;  2ZJP A;  2UU9 L;  2JJQ A;  1JB7 A;  1KQS A;  1YEZ A;  1VQH A;  1HNX Q;  1GD7 A;  1H95 A;  1A8V A;  1XNQ Q;  3PO3 G;  4X66 L;  3BZK A;  4JV5 L;  3A0J A;  3W1G A;  3S1R H;  3GDE A;  1ASY A;  1YI2 A;  2LSS A;  4EX5 A;  2ZM6 Q;  5IWA L;  4BA2 I;  1K3R A;  4DR5 Q;  4A3L H;  1N34 Q;  2WAQ G;  4DKA C;  1PH4 A;  2GVA A;  1Q7Y C;  2ES2 A;  4RMF A;  3CXC A;  1E3P A;  4GKK L;  4DNI A;  3S16 H;  2KHJ A;  2D0P A;  3HOV H;  1JJG A;  3I56 A;  3NEN A;  1NE3 A;  4QY7 A;  4HJA A;  5AJ3 Q;  2PQA A;  2R6G A;  4GNX B;  4A3I H;  1EIY B;  1CKO A;  4DV2 Q;  4OX9 L;  2LXJ A;  1J5E Q;  1P16 A;  3HOX H;  4LFA L;  2IX0 A;  4DR3 L;  3UE1 A;  2RCN A;  5IYD G;  3TRZ A;  1L1O C;  4JI5 Q;  3GTJ H;  2RF4 A;  4BY7 G;  2IHF A;  4B3M L;  3CP0 A;  1VQ5 A;  4LFC Q;  2C35 B;  3A5U A;  3UDG A;  2ZTE A;  3J7Z C;  4BXX G;  1M1K C;  4LFB L;  4RG1 A;  5ELN A;  4AQY L;  4DPG A;  1VQC A;  4JI6 Q;  3HOZ G;  3HOU G;  1X3F A;  1SRU A;  1WCM G;  3H3V I;  4QQB X;  4IO9 A;  5H1S E;  2VQF L;  4HJ8 A;  1VQM A;  4P75 A;  1V9P A;  1UE1 A;  1KD1 C;  3GTL H;  2IHE A;  4P74 A;  4DUZ Q;  1IL2 A;  4A3K G;  1UWV A;  1B8A A;  4HIO A;  2NVY H;  1KXL A;  1MJE A;  1VQO A;  2R7Z H;  4BBS H;  5FJ8 G;  3PUV A;  1WJJ A;  1VQ4 A;  1XNR Q;  4Y7N H;  5M5W H;  5GAD C;  1HZB A;  1Z9F A;  5FLM G;  1KRS A;  5LMN Q;  4DR1 Q;  3KJP A;  2Z0S A;  1Q12 A;  2F52 A;  5JJL A;  4BA1 I;  2HIV A;  2VS1 A;  3M4O H;  5HY6 A;  1L0W A;  1Y14 B;  4DV1 Q;  1Q1E A;  2HT1 A;  4A3F G;  1Q82 C;  2R93 H;  1KL9 A;  4GN4 B;  4A76 A;  3MEF A;  1N32 Q;  4IJL A;  4C2M H;  4JBW A;  3CCU A;  2JA6 H;  1G6P A;  4DUY L;  1Q86 C;  4O0A A;  3S2H H;  2K75 A;  4DR7 Q;  4B3R L;  2CFM A;  1K0R A;  3ICE A;  1HNW L;  2JE6 I;  4XTC S;  3EBE A;  1QZH A;  2N3S A;  4A3M G;  1I5F A;  4TVA B;  4AYB G;  4JYA L;  1FJG L;  3OYY A;  1W3S A;  1YNX A;  1W2B A;  3TS0 A;  1LYL A;  3H0G G;  1Z47 A;  2MO1 A;  3TQY A;  1YJ9 A;  4LF5 L;  2GN5 A;  4A3B H;  4DV3 L;  1L1O B;  3I4N G;  2UUC L;  1SLJ A;  1TWC H;  4UPA A;  1C9O A;  5FJ8 H;  4DV0 Q;  1XMO Q;  4APV A;  1PH9 A;  2JEA I;  1VQL A;  1XTD A;  5FLX c;  1PH1 A;  3OTO L;  4C3J H;  1K9M C;  4JCV E;  4DR6 Q;  3KDF A;  3L7Z C;  1PA6 A;  2HHH L;  1RIP A;  1GO3 E;  3A5Z B;  3S1M H;  5GQO A;  2F3I A;  4JI4 L;  5C3E H;  1Q81 C;  4IFD I;  5M5X H;  3UDI A;  4DV6 L;  1IZ6 A;  1KC8 C;  4LWC A;  1VQA A;  2HIX A;  2UUB Q;  2UXC Q;  4YWK A;  2K5H A;  4OXP A;  3NBH B;  4A3L G;  2ALY B;  1I94 L;  1SFO H;  1JE5 A;  2KHI A;  4JI1 Q;  2D0O A;  3GTG H;  2AHO B;  5K36 G;  2OQK A;  4JI0 L;  3KF6 A;  1PH6 A;  3CD6 A;  4B3S Q;  4A3D H;  4YCV A;  3HOV G;  1XJV A;  1HR0 L;  4DV7 Q;  2I5H A;  2V1C C;  1AE2 A;  2DUD A;  4YY3 Q;  2F4V Q;  1RL2 A;  4R4T A;  2NZO A;  2D62 A;  4X65 L;  4A3I G;  2E5L Q;  3Q8D A;  3S24 A;  2R7F A;  3F1Z A;  4L5T A;  1YHQ A;  4X64 L;  3HOX G;  3AYH B;  1U5K A;  5BR8 Q;  1K73 C;  1IBK L;  1HJP A;  3ULP A;  1Q8K A;  2ATW A;  3HOW H;  2VZA A;  1SMX A;  1QVG A;  4X6A H;  2UXB L;  4L5S A;  3GTP H;  1VQ8 A;  2N8N A;  4WJ3 M;  2VW9 A;  1V1Q A;  1LUZ A;  3ERS X;  3H15 A;  4DR2 Q;  1E22 A;  1I3Q H;  4LF9 Q;  1VQ9 A;  4JG2 A;  2PQA B;  4FDB A;  3RN5 A;  1MIU A;  1K8A C;  3FKI H;  3T1Y Q;  1I6H H;  4JI8 L;  5C0X G;  1HZ9 A;  2WB1 E;  2K52 A;  1EQR A;  4ALP A;  4LUZ A;  4GLX A;  3CCM A;  4YCW A;  1UE5 A;  3EIV A;  3VDY A;  3LGJ A;  2MNA A;  3KJO A;  2YU9 H;  3M4P A;  4LF6 Q;  1YVC A;  3ULJ A;  2R7Z G;  4BBS G;  1B7Y B;  3STB C;  1QZG A;  1N33 L;  3PUX A;  1KHI A;  1PH5 A;  1C7Y A;  2PNH A;  4HID A;  3HOY H;  1UE7 A;  4LF8 L;  2VQE L;  1YJW A;  2UUA Q;  1P8L A;  1UE6 A;  3U50 C;  3PUW A;  3PGZ A;  4BY1 H;  3RNU A;  2JQO A;  5E7N A;  2YYZ A;  3G71 A;  3STB D;  1IBM Q;  4JI7 L;  2RHQ B;  1L2F A;  3PSI A;  1HH2 P;  2KCT A;  4X62 L;  4HIK A;  1C0A A;  1YIJ A;  2Q2I A;  4PZ6 A;  2R93 G;  4DR4 Q;  5LMU L;  2JA6 G;  5IYB G;  3S2D H;  4OO1 G;  4H02 A;  4UP7 A;  4KHP Q;  4GN3 B;  4DK6 C;  4YHH L;  1EWI A;  1WI5 A;  5IYC H;  4L5R C;  4LF4 Q;  3U4Z A;  3CCL A;  3WWV A;  1Y1V H;  3T1H Q;  2Q2H A;  5C4X H;  4DV5 Q;  1KAW A;  3G6E A;  4OON A;  5JEA J;  1N9W A;  3JAM c;  3I7F A;  2R7D A;  3D31 A;  1M90 C;  1HNX L;  4JI3 Q;  1XNQ L;  3GD7 A;  1XPU A;  4A3B G;  4AIM A;  1YIT A;  3G4S A;  2ZM6 L;  3I4O A;  1WYD A;  4DR5 L;  1N36 Q;  3PUZ A;  1N34 L;  1XPO A;  1OXV A;  5J3B A;  1S40 A;  2R92 G;  3G48 A;  1CKN A;  2JA7 H;  1VQF A;  4YCU A;  2KBN A;  1HZA A;  5C3E G;  2PI2 A;  4R4C A;  1SE8 A;  1VQB A;  2OWO A;  1YHA A;  4B3T Q;  4NXN Q;  4P71 A;  4JI2 Q;  1XMQ Q;  5AJ3 L;  3M3Y H;  4QIW E;  1V43 A;  4HJ5 A;  4YWL A;  1E1T A;  4DV2 L;  3RZD H;  1K83 H;  1E1O A;  2B3G A;  1J5E L;  4GLA C;  3J7A 5;  2WFW A;  1VQP A;  2E2H H;  5IYB H;  3HKZ G;  3CC7 A;  1XPR A;  3CC4 A;  1SR3 A;  1VQI A;  1YHB A;  2NZH A;  2OCE A;  4QJF A;  4R4Q A;  1BBW A;  1TWF H;  4LF7 Q;  4K0K Q;  4OWW B;  3KDF B;  4JI5 L;  4A3D G;  3CW2 C;  3H3V H;  4GKJ Q;  3RR5 A;  4DV4 Q;  4IOA A;  5LMN W;  4LFC L;  1S3O A;  4IFD J;  1HNZ Q;  3CME A;  2GVB A;  3S14 H;  4JI6 L;  3PO2 H;  1OXS C;  2RHS B;  3K8A A;  5C4J H;  5M3M H;  3K7A H;  3HOW G;  1IBL Q;  2Z6K C;  1PYS B;  1HR0 W;  4NB3 A;  2AMC B;  4DUZ L;  2UXD Q;  5GAG C;  1EQQ A;  3KF6 B;  3PV0 A;  2R92 H;  3PUY A;  2ASB A;  1MJC A;  2MO0 A;  3E9H A;  3BZC A;  3J81 c;  1U0L A;  1PV4 A;  3GTM H;  1WOC A;  3S17 H;  1A0I A;  4NXM Q;  3J80 c;  4OWX B;  1XNR L;  3I2Z A;  3FKI G;  3PIP A;  1Q46 A;  2I0Q A;  1BBU A;  4LUO A;  5LMN L;  4DR1 L;  3HKZ E;  3D0F A;  3KYH C;  1JMC A;  1X6O A;  1JT8 A;  2KEN A;  4GN5 A;  2WB1 G;  4R1J A;  3MXN B;  3HFZ B;  1O7I A;  2EQS A;  4DK3 C;  2UU9 Q;  1AH9 A;  2EXD A;  2L15 A;  4EQ5 A;  2Q2U A;  1Q1B A;  1GVP A;  1LTL A;  4DV1 L;  2K4K A;  4X66 Q;  3F2D A;  4JV5 Q;  1N32 L;  2VNU D;  2K5V A;  1CSQ A;  4PG3 A;  2NVT H;  1VS0 A;  1ASZ A;  5IWA Q;  3F2B A;  3S1N H;  4GS3 A;  3B6Y A;  1NBW A;  4DR7 L;  2NN6 G;  4GOP A;  2OQ0 A;  4L5Q A;  5M3F H;  4BY1 G;  1GKH A;  1YJN A;  2CQO A;  1LM0 A;  2BA1 A;  1Y1W H;  1NY4 A;  4GKK Q;  4P73 A;  2I5M X;  1PH8 A;  1QUQ A;  3RZO H;  4JOI C;  1AE3 A;  2JK8 A;  4TQU S;  1OTC A;  3HKS A;  2OTL A;  4OX9 Q;  4HIM A;  1XMO L;  4DV0 L;  2DGY A;  1VQJ A;  3BU2 A;  3W1B A;  4O2D A;  5IYC G;  1X9N A;  2CCZ A;  2JA5 G;  1I50 H;  1X54 A;  4LFA Q;  2B63 H;  1G29 1;  4DR3 Q;  1IYJ B;  2YTX A;  1Y1V G;  3U58 A;  4A3E H;  1VQ6 A;  1PH7 A;  2JEB I;  4DR6 L;  2ZTC A;  5C4X G;  4B3M Q;  4JC0 A;  4IPG A;  2CWA A;  4LUV A;  3K7U C;  2XGT A; 
#chains in the Genus database with same CATH topology
 4LFB Q;  2NYZ D;  4RAU C;  3MA2 B;  2JA8 B;  4C3H H;  1ENC A;  3NXW A;  1K8O A;  4EYI B;  3BVM A;  3BJU A;  1IBL H;  4UP9 A;  3A8J E;  5D1P A;  2IBK A;  1YZ6 A;  5G3L F;  4JI1 L;  1MD2 D;  5C44 G;  2UXD H;  4XYO A;  5GAE C;  3PO3 B;  3CC2 A;  1B70 B;  2NU8 B;  3T51 B;  2JSO A;  3F8N A;  5IGD A;  3RN2 A;  1X3G A;  2F4V L;  4BBR H;  4JV0 A;  3Q8Q B;  1S5F D;  2IJ0 A;  5IT9 c;  4QCL A;  1V51 A;  2ATL A;  5GRO A;  4U6P A;  1PXU A;  4ED1 A;  3CF5 A;  2R7Z B;  2UXB H;  1VQN A;  2A73 B;  3I4M H;  3HOY G;  5IP9 H;  2R85 A;  3KF8 A;  2B8G A;  1CKN B;  1K28 A;  1PZK D;  3RB6 A;  2ID0 A;  3KHL A;  4PZ8 A;  3GTK B;  2NU6 B;  3RB4 A;  4EFB A;  4IR9 A;  3GTL A;  2YTV A;  1TVX A;  1B9M A;  1M0W A;  5JPN C;  4DL7 A;  4OWT B;  1PTO D;  5K2M A;  5M3M G;  5C8Y F;  4EBD A;  1DGS A;  4B08 A;  1HNW Q;  5EWE A;  1EL0 A;  4F50 A;  3QJY A;  5KG3 A;  4A3C H;  2KQ3 A;  2W8L A;  4OO1 I;  4UP8 A;  1F9R A;  4C3I B;  2YS6 A;  3SHL A;  4HJ7 A;  4LF5 Q;  1EY0 A;  3AB9 A;  2R86 A;  4DV3 Q;  1VMC A;  2WKD A;  3NP8 A;  2R8H A;  2UUC Q;  2WAQ E;  2I5L X;  4K2L A;  2QW7 A;  3CCE A;  1PK8 A;  3OWE B;  1AFP A;  3QZ7 A;  3BS1 A;  5IY0 A;  1STA A;  1LT4 D;  2F0U A;  3RUP A;  2R93 A;  1IBM L;  5I9P A;  4JI4 Q;  5ISR A;  1KEE A;  1TXY A;  1BDO A;  3N6R A;  4UFZ A;  3RZO B;  4AQY H;  3CAM A;  3ZJY C;  1WVL A;  1XDN A;  5KFX A;  1GSO A;  4N8F A;  2Z9H A;  4JBJ A;  3CCQ A;  4CKB A;  4GC6 A;  1A62 A;  2K33 A;  3DWA A;  4IPC A;  1U4M A;  3CCR A;  2FPP B;  2F03 A;  3PW4 A;  1W6K A;  3RBE A;  3V6K A;  1LT5 D;  2PZT A;  4K6D A;  4JI3 L;  5ELO A;  2E2I H;  4BXX H;  1C30 A;  1S72 A;  4CDD C;  2L12 A;  1TWH H;  2M9V A;  3UE0 A;  1FVI A;  3HOU H;  3F2C A;  1ZYR D;  1WCM H;  2K7V A;  5JPM C;  4RGN A;  2J6S A;  2VY3 A;  1II3 A;  3FRP B;  5KND A;  4A3E G;  2IT1 A;  3KTM A;  2UXB Q;  4DU9 A;  4FBT A;  4J9O A;  2F0N A;  5JEA H;  1B6S A;  4A3K H;  1SYD A;  3ZYY X;  4XIG S;  3TQT A;  3QFF A;  1LTB D;  4B3T L;  2XD4 A;  4DAY B;  2BH2 A;  4JI2 L;  3TN2 A;  5IP7 G;  1QUQ B;  5EKL A;  5LL6 S;  4Q44 A;  4AH6 A;  5CV4 A;  1ZHQ A;  3FMA A;  1L0Y B;  4R4O A;  1VQ7 A;  4WOR A;  5CBA E;  4H44 C;  4KLK A;  1QVF A;  1FJG H;  1UAP A;  1OXX K;  5KFK A;  4GLV B;  2FK1 A;  3K58 A;  5EKI A;  3P20 A;  1L1O A;  4JK1 C;  5FO8 B;  1S5D D;  3BDL A;  3NEM A;  1NAP A;  2OTJ A;  4DUZ H;  1B3Q A;  1E2W A;  1ZKO A;  4AYB E;  2ZDG A;  3E0J A;  1PVO A;  4JBM A;  2A19 A;  3URY A;  1EUD B;  4A3M H;  2VUM G;  5FPO A;  1I50 A;  3L0O A;  4L8J A;  3Q2O A;  1D5M C;  2OLS A;  4POG A;  5HGQ A;  5JJK A;  3KAL A;  1XNR H;  2N88 A;  3VA7 A;  5LMU Q;  5LMN H;  4UY8 C;  2AWN A;  2HCC A;  1VKZ A;  3I4N H;  2CW7 A;  2YU9 A;  1WD1 A;  1YNN D;  4QGU A;  4LNQ A;  2F1M A;  4ZAI A;  5L37 A;  3T5H A;  1D5X C;  5IGF A;  1EZ8 A;  1AUX A;  4DV1 H;  3KXY T;  2ZJP A;  4IWY A;  5EZY F;  2VQD A;  1HR0 H;  4ZHQ F;  2EPB A;  1JB7 A;  1D1I A;  4CDC C;  2R82 A;  4X66 L;  4JV5 L;  2Q8I B;  3GDE A;  2IW3 A;  5KFA A;  4X64 H;  4EX5 A;  2FPI B;  1H9S B;  2NVY B;  2ZXO A;  3V6J A;  3M4Y A;  1PH4 A;  5G3L D;  4MV9 A;  1F2Y A;  4XQJ A;  5KX5 F;  3CXC A;  2IA6 A;  1AP0 A;  3HGB A;  3S16 H;  4ECQ A;  3TIG A;  3I56 A;  4HJA A;  3MJF A;  4YAJ B;  1JX4 A;  5AJ3 Q;  2R6G A;  4GNX B;  1GUS A;  1FGB D;  1EIY B;  1CKO A;  2CZG A;  2DNE A;  4OX9 L;  1NUC A;  3HOX H;  2VXW A;  3OIP A;  2B2T C;  2TSS A;  2IX0 A;  4BY7 G;  5IYD G;  4B3M L;  4C2M B;  1PMR A;  3W2D A;  3J7Z C;  3S2H B;  1M1K C;  4LFB L;  4H7B A;  2V5A A;  5JQW A;  4JI6 Q;  2JA7 A;  3NHH A;  3HOZ G;  1X3F A;  3ND9 A;  5KRU A;  3BA9 A;  3H3V I;  4YP3 A;  1VQM A;  1ILQ A;  1V9P A;  1UE1 A;  1KD1 C;  3T5J A;  4DUZ Q;  4A3B B;  2ZXR A;  2YYA A;  1H9J A;  4HIO A;  2R7L A;  1KJQ A;  4X62 H;  1K83 A;  1DYQ A;  2R7Z H;  4BBS H;  4HMJ A;  5FLX E;  2L1B A;  1KDA A;  3WOF A;  4F88 A;  1VQ4 A;  1XNR Q;  1L2Z A;  5GAD C;  4YHH H;  3OMG A;  4MV8 A;  5LMN Q;  2Y0S A;  5E4X A;  1EFI D;  4ILW A;  5IT9 W;  1SBB B;  2D5D A;  4EGV A;  2EY1 A;  4RHR A;  4QWA A;  2FJ2 A;  4XYM B;  2VS1 A;  1HNX H;  1C3O A;  4DV1 Q;  2HT1 A;  4WRD A;  1XNQ H;  1Q82 C;  3KUP A;  1G6P A;  4OIJ A;  4JBW A;  2JA6 H;  5KNC A;  2PZU A;  3IKJ A;  4OO1 H;  4EBC A;  1Q86 C;  2W7P A;  2K75 A;  1MI2 A;  1PYW D;  3I90 A;  3ICE A;  3GTM A;  1HNW L;  1TWH A;  4KJN A;  3ERQ A;  3U9S A;  1GSH A;  4ZK9 B;  3IN5 A;  4TVA B;  4PV1 C;  2H4O A;  3VYU A;  2UVR A;  2K01 A;  3H0G G;  1YJ9 A;  3R2I A;  4LF5 L;  4O4I F;  2OEO A;  5CAE B;  4DV3 L;  4YB8 B;  2UUC L;  4DV0 Q;  1PH9 A;  2W9A A;  1HTL D;  2R61 A;  1K9M C;  4MTD A;  4DR6 Q;  4UCR A;  1BXR A;  3S1M H;  5GQO A;  1PLF A;  4JI4 L;  4LFC H;  3TZD A;  5C3E H;  1HQM C;  2E76 C;  4TV9 F;  1DV1 A;  4MTE A;  2XGP A;  2HIX A;  3GV8 B;  4IQZ A;  3DF7 A;  1F9Q A;  1SJE D;  4LF4 H;  2ALY B;  4ZQI A;  1EY5 A;  2KHI A;  3R8B A;  5DNF A;  2OQK A;  3CD6 A;  1ESF A;  3D4W A;  3H3V C;  1XJV A;  3NQI A;  5M9O A;  4DV7 Q;  2MPM A;  3C1E A;  4YY3 Q;  1F2Z A;  2E2D C;  2D62 A;  4RZQ A;  1EWH A;  3V2T A;  3I70 A;  1S0N A;  1QOH A;  1UEA B;  2PW7 A;  3AYH B;  2A68 D;  1HJP A;  3ND8 A;  3NBH A;  5C5M A;  1SMX A;  5HUR A;  2UXB L;  1B6R A;  2E2J B;  4FM9 A;  2D9U A;  4NXN H;  3GIM A;  4IAL A;  2N8N A;  2G5D A;  2E75 C;  2CHB D;  1LUZ A;  1B2T A;  1JIC A;  1GLV A;  4C5C A;  2JA5 B;  5KFM A;  1E22 A;  3NQT A;  1Z2P X;  4Y8V B;  1R4Q B;  4L1K A;  3OW7 A;  1TY0 A;  1K8A C;  3AMU A;  1RKN A;  5DQI A;  4K0K H;  4ME5 A;  2KVM A;  2WB1 E;  2K52 A;  5KFF A;  3LGJ A;  2MNA A;  5FLX W;  5KT6 A;  5BMV F;  4XZ3 B;  3ULJ A;  5K36 H;  1O75 A;  1QZG A;  5T14 A;  3M7G A;  3LWB A;  1QIL A;  3RAQ A;  2AGP A;  1JKJ B;  1RCV D;  1UE7 A;  3DEO A;  2FLL A;  1YJW A;  2B2Y C;  2EYH A;  1WTX A;  3VPB A;  3U50 C;  1HXY D;  3K3V A;  2X6L A;  5E7N A;  4OEL B;  2F0H A;  2WII B;  3RZD B;  3PSI A;  4FYD A;  4ECV A;  1YIJ A;  1BJT A;  2E2H B;  2R93 G;  2XN9 C;  4DR4 Q;  2DPJ A;  5LMU L;  4O3R A;  3BAB A;  3S2D H;  4I7H A;  1TWF B;  3ORQ A;  5FLX L;  2Q8T A;  1V1O A;  1EWI A;  1EY4 A;  3KK7 A;  4JI1 H;  1VMP A;  2F0G A;  2QDB A;  4LF4 Q;  3NSW A;  3U4Z A;  4L5R C;  3WWV A;  3T1H Q;  2H1E A;  2V58 A;  4QMG A;  3PO2 B;  2RGV A;  3G6E A;  3SK8 A;  5C4J B;  5AFW A;  3JAM c;  3N41 B;  1N9W A;  2F4V H;  3I7F A;  2SEB D;  3GD7 A;  4XT1 B;  1XYI A;  4IRK A;  3TQ1 A;  3MZ5 A;  2HDM A;  3G4S A;  1STN A;  4HSV A;  3NTK A;  4RUC A;  1S9F A;  1AZP A;  1N36 Q;  4LK1 C;  3J81 E;  3RIZ A;  1CKN A;  5CV7 A;  1VBG A;  3J80 E;  1D1K A;  2PZW A;  2PI2 A;  3GTK A;  1VQB A;  2OWO A;  4NXN Q;  2BQR A;  1XMQ Q;  5AJ3 L;  3M3Y H;  3KLR A;  4WJW A;  4HJ5 A;  4IN3 A;  4YWL A;  1TAE A;  2SOB A;  4XDX A;  3NBI A;  4RGM A;  2FP4 B;  2V4Q A;  4IUQ A;  3C3L A;  4G7O C;  1TWA B;  4Y52 H;  4R4Q A;  1VQI A;  1YHB A;  4RCN A;  2OCE A;  2PN1 A;  1BBW A;  2F0L A;  4K0K Q;  5D8D A;  3KDF B;  1LTG D;  4A3D G;  3H3V H;  1A3U A;  2RBM A;  1DIK A;  2CW8 A;  3RR5 A;  5HBR B;  2PQE A;  3NWS A;  5LMN W;  4JV1 A;  1S3O A;  1HNZ Q;  3TZU A;  4JI6 L;  1OXS C;  1TWG B;  1Y1W B;  3MFG A;  3D4D A;  1O7Z A;  1OO9 B;  3MVV A;  3HOW G;  1T5X D;  4V0B A;  1QNK A;  1HR0 W;  2V59 A;  4RNO A;  3GQB A;  2OH2 A;  1M6V A;  4DUZ L;  4RU9 A;  1IBM H;  1EQQ A;  5KFE A;  2V4R A;  3PUY A;  1ET6 A;  1MJC A;  3E9H A;  2B63 B;  2X0S A;  4I65 A;  1ZEQ X;  2KED A;  1PV4 A;  3S17 H;  1ENA A;  4ED3 A;  3PW5 A;  3N52 A;  4ABN A;  2KHS A;  1XNR L;  2EY6 A;  1ROD A;  4RB2 C;  2C22 A;  1Q46 A;  2I0Q A;  1BBU A;  3SK4 A;  5LMN L;  5DG8 A;  2F0V A;  4CHT B;  2KEN A;  2P5Z X;  4GN5 A;  4G7H C;  2SNM A;  3HFZ B;  1AH9 A;  4DK3 C;  1EUC B;  2K03 A;  4C3H B;  1WTP A;  2QYZ A;  3CQZ B;  1GVP A;  5BN5 A;  4DV1 L;  4JI3 H;  2K4K A;  1I7N A;  4JUZ A;  3F2D A;  5E3F A;  4CJ0 B;  2PMZ B;  2RA4 A;  3F2B A;  4GS3 A;  1NBW A;  4ECT A;  2ZDH A;  1GXD C;  2OQ0 A;  4L5Q A;  4BY1 G;  1YJN A;  1GUT A;  4XYL B;  2CQO A;  1BNZ A;  1LM0 A;  2BA1 A;  4BBR B;  3GID A;  2VOB A;  4OGQ C;  5EWF A;  3OSN A;  1NCV A;  4GKK Q;  4M7E A;  2YZM A;  5KG0 A;  1DOL A;  2AUK A;  4B3T H;  4DAY A;  4MV4 A;  4G57 A;  1QUQ A;  2K04 A;  4JI2 H;  2ICI A;  2B2V C;  1OTC A;  2OTL A;  1RJQ A;  3OTO H;  1TS5 A;  4DV0 L;  2R8G A;  1I6U A;  3BU2 A;  3N40 P;  1ICF B;  2GPW A;  3FEW X;  4LFA Q;  4ME6 A;  3M9M B;  2YTX A;  5IGC A;  4DR6 L;  5JJZ A;  4R9W A;  1IKM A;  2CWA A;  5EDW A;  3K7U C;  2XGT A;  3EPG A;  2F0P A;  2JYO A;  2BE5 C;  1L0X B;  2HDL A;  3FP9 A;  1KIX A;  1DV2 A;  4BWS C;  3GTJ B;  1G91 A;  3RFC A;  4QUC A;  3J81 W;  3K0X A;  3JC6 6;  1SNC A;  4DAM A;  2QF7 A;  4LMY A;  1VF5 C;  1KTK A;  1K0S A;  3MHB A;  2JA7 G;  1X55 A;  4CKC A;  3RMH A;  2LXK A;  4EVO A;  3E0E A;  4FS1 A;  1PDQ A;  3I3C A;  4JW0 A;  4NPS A;  2HGS A;  3IFD A;  3UI2 A;  4X65 H;  1N8R C;  4DV7 L;  3BZD B;  1BCP F;  4YY3 L;  1BCP C;  1JWU D;  1BVS A;  1G2T A;  3K81 C;  1KJJ A;  2E2J H;  3DXJ C;  1NMG A;  1PTO C;  1HUM A;  1S5E D;  2JA5 H;  4RAZ A;  2JEF A;  2VB3 X;  4HNU A;  2J9G A;  3J81 L;  2Y0S G;  5KFW A;  3KHR A;  1VDZ A;  5KFT A;  4ED0 A;  3SE7 A;  3RLF A;  2JA9 A;  1YBY A;  5JVG 3;  3J80 L;  1DM0 B;  4HJ9 A;  3OIQ A;  1NR2 A;  3D4R A;  3H94 A;  3MAQ A;  4PQX A;  2F0O A;  4B3R Q;  1H9S A;  2NVY A;  3PMF A;  3R23 A;  2ZTD A;  2N78 A;  1HFG A;  1K1Q A;  5KT3 A;  3AQQ A;  4Q45 A;  1CKM A;  1PRT F;  2BR0 A;  1PRT C;  5JVL A;  3HOU B;  4EBE A;  4IRC A;  1WCM B;  2F0K A;  4NMZ A;  4RKL A;  4POF A;  1JIH A;  3K80 C;  4GNX A;  3IRB A;  5EKK A;  4ZI7 F;  3GQC A;  2YW2 A;  4OX9 H;  3J7A V;  1U9R A;  4A3K B;  2EJM A;  2K50 A;  5JEA G;  2W71 A;  4YR0 A;  4ECZ A;  3OTO Q;  1JDB B;  1TWC B;  3UDF A;  2HHH Q;  4C2M A;  4B3M H;  3PIO A;  4JOI A;  4KY5 A;  3MWM A;  5KKN B;  2O5I C;  2QCP X;  4LFB H;  4LH7 A;  2WE6 A;  1EIH A;  5EOY A;  4DR4 L;  4B9X A;  2K14 A;  4J9L A;  3MTS A;  2NUC A;  3SEB A;  3BVG A;  1I94 Q;  3RV3 A;  1E24 A;  1I4R A;  1ZYR C;  1PH3 A;  2YTY A;  4LF4 L;  1A63 A;  1T5E A;  2B8F A;  4JI0 Q;  2YRX A;  3TDQ A;  3T1H L;  5KGU A;  2AGO A;  3VR4 A;  3GTG B;  5C1O A;  4DK1 A;  2ZM6 H;  2BA0 A;  1PFS A;  4X65 Q;  3Q23 A;  2I8C A;  3IFT A;  1X56 A;  5I9O A;  4IFD G;  4HNV A;  4A3M B;  1IBK Q;  2L11 A;  2O2L D;  1N36 L;  2WYO A;  5KFG A;  3F8T A;  3K5L A;  1VQK A;  3GTQ H;  5IGE A;  2B2U C;  1KNE A;  3I4N B;  2K5N A;  1E0B A;  3GP7 A;  1NJI C;  4NXN L;  5JJI A;  1XMQ L;  2NVQ H;  1TWA H;  2UVU A;  4BWG B;  1TA8 A;  1E2Z A;  4RA8 A;  4A3J G;  4RZR A;  1LO5 D;  2NTT A;  5FLM H;  5A2Q W;  1HNW H;  1EZ1 A;  1B4O A;  4DK0 A;  4UAI A;  4K5V A;  2ZJR A;  4K0K L;  1RJR A;  5DGA A;  2A6E D;  3FKI B;  1SDF A;  1ULZ A;  1EUJ A;  1TWG H;  5IE8 A;  1HNZ L;  4C56 C;  1N33 Q;  4LF5 H;  1CSP A;  1VQD A;  1SNQ A;  4NP5 A;  4DL5 A;  1HA5 A;  3Q24 A;  3CMA A;  3P1H A;  3OMC A;  4DV3 H;  4A3F H;  2EYP A;  2WB1 B;  4J9S A;  2UUC H;  3GTP A;  1TKW B;  2HVS A;  1PTO H;  3M85 A;  4A93 G;  4DF7 A;  2K05 A;  1R9T H;  3KOJ A;  1I3Q A;  5T1I A;  2AKW B;  1E7Z A;  1CA6 A;  1JJC B;  4ODG A;  4JI7 Q;  4A3G G;  3L2P A;  4JI4 H;  4LH6 A;  3QO2 A;  2ASD A;  2A1A A;  2CW0 C;  3A74 A;  1MSG A;  5A2Q L;  3G8C A;  3CCV A;  2NN6 I;  4YWM A;  2Q2T A;  1O78 A;  4JBK A;  3S15 H;  3NUC A;  5KYI A;  5KFB A;  1MSH A;  3CQZ H;  2JA8 G;  1BQQ T;  2Z8L A;  1SE3 A;  1EOV A;  1S10 A;  5DQH A;  2BE5 D;  2F0W A;  3A8I E;  1VQH A;  1GD7 A;  1B9N A;  4MTK A;  3PO3 G;  4ULL A;  1BUV T;  5FO9 B;  1S4Z A;  2EJG C;  3A0J A;  3S1R H;  4JV2 A;  2K6A A;  1TS2 A;  1ASY A;  2LSS A;  2ZM6 Q;  1E4E B;  4PWQ A;  1K3R A;  4DR5 Q;  4A3L H;  4CKE A;  4IRD A;  4BBS B;  3BQ1 A;  2ZT9 C;  3K5H A;  4K5W A;  2F0D A;  4QWB A;  1G8Z D;  4GKK L;  4FXD A;  4MV7 A;  5CYU A;  2JA5 A;  1BCP D;  3NEN A;  2FPG B;  3RGX A;  4A3I H;  5J2T F;  4LJZ C;  5DAU A;  1DJR D;  4LFA L;  2XSC A;  2EY5 A;  4H0L C;  5JH7 F;  3HB9 A;  4JI5 Q;  3GTJ H;  2JA6 B;  1SYB A;  1TQO A;  3CP0 A;  2AQ2 B;  3HOY B;  2C00 A;  5ELN A;  3DWP A;  1RK6 A;  5CMD A;  4X3K A;  4C3I G;  3WOE A;  1SRU A;  2ICE C;  3ERO A;  4U68 A;  3H91 A;  4HJ8 A;  2J4X A;  2ASL A;  4P75 A;  1VBH A;  4KHV A;  1KDC A;  1U4P A;  1IL2 A;  5FPR A;  3NGD A;  1GYF A;  1PRT D;  3GIL A;  1KXL A;  4JPB W;  1KBL A;  1QJO A;  3GV6 A;  2E2H A;  3OOC A;  5LMU H;  5DEH A;  1TWF A;  1JR0 D;  2R92 B;  1D6E C;  5DG7 A;  5M5W H;  1HZB A;  1Z9F A;  3S1M B;  1KRS A;  1KAA A;  3MWY W;  5CC4 A;  5C3E B;  3L4K A;  4YR3 A;  1CI3 M;  1Q12 A;  4DR2 H;  3TII A;  1I4X A;  3W3A A;  2I07 B;  4BA1 I;  2PVP A;  1EEI D;  3T5L A;  1L0W A;  1Y14 B;  5T1G A;  1WTW A;  1KL9 A;  4GN4 B;  4A76 A;  3MEF A;  3VMM A;  4IJL A;  3PR4 A;  1F2L A;  1SYG A;  3OSO A;  4B3R L;  4XQQ A;  2JE6 I;  4NKL A;  4XTC S;  3EBE A;  1QZH A;  3HZX A;  2NVT B;  1Z7T A;  3MXG A;  1LAB A;  2B2W A;  3TS0 A;  4G3I A;  1STE A;  3C1F A;  4MV1 A;  2XVS A;  4MAM A;  4LSA A;  5BPH A;  1TWC H;  1FNV A;  1C9O A;  3BVZ A;  3EA6 A;  1TWA A;  5FLX c;  1PH1 A;  5D3I B;  4C3J H;  3OTO L;  3QZ8 A;  4I50 F;  3BDC A;  3KDF A;  2DPI A;  2HHH L;  1TT2 A;  2DJG C;  1GO3 E;  1HQR D;  5CR3 A;  3CRK C;  5M5X H;  4TQS A;  1STH A;  1KC8 C;  4JI6 H;  4LWC A;  2SCU B;  1Y1W A;  1TWG A;  2UUB Q;  1SYX B;  2F0T A;  1I6H B;  1LT3 D;  4IUN A;  3M9O B;  1KJI A;  2J7Z A;  1I94 L;  1S97 A;  2G9D A;  3GTG H;  4ED7 A;  5K36 G;  2A68 C;  3TSS A;  2PYK A;  4JI0 L;  1AW7 A;  4O4H F;  2NU9 B;  1T94 A;  3HOV G;  1Y8P B;  2B63 A;  2V1C C;  1AE2 A;  2DUD A;  4UCS A;  2NBF A;  5IIF A;  4X65 L;  5KT7 A;  4U67 3;  3Q8D A;  3S24 A;  1Q8I A;  2R7F A;  3F1Z A;  1A2U A;  2F0E A;  1ILP A;  1LAC A;  1SNO A;  1K73 C;  1IBK L;  1CE8 A;  1LTI D;  1U4R A;  3DM1 A;  4ZRZ A;  4ZCK A;  4XT3 B;  5KFH A;  1KJ8 A;  3S2D B;  2VW9 A;  3RJ0 A;  2DLN A;  4DR2 Q;  2CW0 D;  4IR1 A;  2EYM A;  2RSN A;  4HTH A;  4DL4 A;  4JG2 A;  1EYC A;  2IPK D;  1SEI A;  2F0S A;  3E5S A;  3TP6 A;  2PMZ A;  2XCP A;  2F4I A;  3FKI H;  5NUC A;  5C0X G;  1HZ9 A;  1HUN A;  4O3O A;  3VPC A;  3CCM A;  1PFN A;  1GUN A;  1UE5 A;  3GIJ A;  4RFB A;  3M4P A;  4LF6 Q;  1B7Y B;  4JVZ A;  1N33 L;  4EGJ A;  4DAV A;  3PUX A;  1KHI A;  5L1I A;  1PH5 A;  1C7Y A;  2K28 A;  3QOL A;  3E6Z X;  5KFO A;  1E2V A;  2M05 A;  4DV0 H;  2NN6 H;  3PUW A;  1EOT A;  2I87 A;  2C28 A;  4DR6 H;  3RNU A;  2M00 A;  3M3Y B;  5KG2 A;  2NZ1 D;  3STB D;  4MA5 A;  1ICW A;  2PBZ A;  4JI7 L;  5KFC A;  1L2F A;  4HIK A;  2KCT A;  4ZQ3 A;  3T13 A;  4PZ6 A;  1CHP D;  4QIW B;  4ETS A;  4C5B A;  4H02 A;  1F9P A;  2QEJ C;  3CRL C;  1WI5 A;  4KTA A;  1JOR A;  4E6I A;  1Y1V H;  4G4K A;  5C3X A;  2Q2H A;  1LTR D;  4TUY F;  5C4X H;  2R7K A;  4DV7 H;  4YY3 H;  1M90 C;  4UCT A;  3P7J A;  4A3B G;  3BG3 A;  3A56 A;  5BN3 A;  2ZM6 L;  3I4O A;  1WYD A;  5COR A;  1ENF A;  4DR5 L;  3V4Z A;  1DCZ A;  1OXV A;  3G48 A;  3S17 B;  2KBN A;  1HZA A;  1GUG A;  1EQT A;  2QDL A;  4E4T A;  1ZET A;  4RB3 C;  2WTF A;  4I4T F;  2ALZ A;  2DZD A;  5KFY A;  1V43 A;  2E74 C;  1FKA H;  5KG4 A;  3H6M A;  1VQP A;  1Z2N X;  3HOY H;  3F2U A;  2E2I A;  1D5Z C;  4QB4 A;  5J1Z A;  1DOK A;  3SR1 A;  4LF7 Q;  4JI5 L;  3GTO B;  5CB4 F;  5ELE A;  4IOA A;  3BDO A;  4GKJ Q;  4C5A A;  3OHA A;  1WCM A;  1Q3L A;  1KNA A;  1B53 A;  3N8D A;  1GOZ A;  3VR5 A;  2G9H D;  5ELB A;  4RB0 A;  2KCN A;  4KKS A;  4RHS A;  3K7A H;  5M3M H;  5KFD A;  1CK1 A;  1O80 A;  5GAG C;  2R92 H;  3K5M A;  2BDN A;  5LXT F;  2MO0 A;  3BZC A;  4ID6 A;  3J81 c;  3Q8P B;  4DR4 H;  1SE4 A;  5JVD F;  4NXM Q;  3J80 c;  1YNJ D;  4HN7 A;  4RKB A;  4OWX B;  1EY7 A;  3I2Z A;  3PIP A;  3BYT B;  3I73 A;  3DWQ A;  4LUO A;  5KG7 A;  3HKZ E;  1EHI A;  3NTH A;  3T1H H;  4FNF A;  2V4D A;  3BQ2 A;  1O7I A;  1EZ6 A;  2EQS A;  2UU9 Q;  2EXD A;  3GTG A;  4FVM A;  4N9T A;  1LTL A;  1SAP A;  4RNM A;  5DM7 3;  1EWC A;  2TMP A;  2VNU D;  2NVT H;  1VS0 A;  1ASZ A;  5IWA Q;  2F0F A;  1N36 H;  2W57 A;  5KFJ A;  4H13 C;  4IWX A;  3IL8 A;  1QB5 D;  3BA8 A;  1H9M A;  1NY4 A;  4CJ1 B;  2FIN B;  4KY7 A;  1XMQ H;  4JOI C;  2JK8 A;  4RGO S;  3R3O A;  4TQU S;  2W6N A;  4QW9 A;  1X9N A;  3W1B A;  2CCZ A;  2JA5 G;  4O2D A;  5IYC G;  1MGS A;  1HFN A;  1G2S A;  4DNR B;  1G29 1;  4DR3 Q;  1IYJ B;  5JOB A;  4A3E H;  1CA5 A;  1GGO A;  2ZTC A;  2A6H D;  2RDH A;  4JC0 A;  2LFN A;  1XXG A;  1HRJ A;  2JEI A;  4TRD A;  3RLN A;  1I6H H;  1HNZ H;  4K5X A;  3AFP A;  2RDJ A;  2WB1 A;  3PW0 A;  5IP7 H;  2UUB L;  4FF2 A;  1UC9 A;  2NB0 A;  2LMC B;  4IHJ F;  5BPF A;  2VQF Q;  1VF7 A;  3KAJ A;  2C5C A;  1OXT A;  5CBE E;  2R8I A;  3RAX A;  2C2E A;  4KHZ A;  2ASJ A;  5D14 A;  2ZJQ A;  1CQI B;  3A7A B;  5EPL A;  3NEL A;  5EAY A;  5JAV A;  4QUF A;  5H80 A;  4FF3 A;  2ENB A;  1GUO A;  2FJZ A;  2WAQ B;  2Z6K A;  4OEM B;  2A8V A;  2YCH A;  1SMY C;  5D65 A;  5E4W C;  2HQL A;  2FXQ A;  2KJX A;  1FNW A;  1SRO A;  5FK9 C;  1GJX A;  2VUM H;  4FP5 D;  1IYV A;  4MIU A;  2FK2 A;  4DR2 L;  4P72 A;  4L6T B;  2K5D A;  4GOP C;  3PO2 G;  2B29 A;  1E4E A;  4IOC A;  2R8J A;  3GV7 B;  3PR5 B;  4EG0 A;  1DD2 A;  2R7Z A;  4J15 A;  2O5J C;  1IOV A;  4JYA Q;  1VQE A;  1EYZ A;  4DXG A;  3PF4 A;  4GKK H;  4LF6 L;  3G6X A;  3VYR A;  1B50 A;  3KLW A;  4KD4 A;  2AWO A;  4N9P A;  4O3P A;  4A4I A;  3J7A F;  1CUK A;  4A75 A;  3KLS A;  1W6J A;  3V05 A;  5A35 A;  3GTQ B;  4KMU C;  2FB9 A;  1GM5 A;  2RDI A;  4LFA H;  3A55 A;  2VUG A;  4R8N A;  2K5Q A;  4IUT A;  4O1N A;  5EJW A;  1UEB A;  4ZUI A;  3A7L A;  3J81 j;  1B33 N;  3H09 A;  3JAM i;  2NVQ B;  2CVR A;  3S1Q H;  2JA6 A;  3TBI B;  3CCJ A;  1HZC A;  2HD3 A;  2PI2 E;  2XCA A;  3K57 A;  3GII A;  5M5Y H;  3RLO A;  4ZKB B;  4KD3 A;  4FBU A;  4C1N I;  5M3F G;  2E8G A;  1BCP B;  2IY5 B;  2FMA A;  3O13 A;  5DM6 3;  1Y1W G;  2ZJT A;  4BY7 H;  5IYD H;  4A3F B;  1SJH D;  1EU4 A;  4KN7 C;  4MA0 A;  2KCM A;  3E9I A;  2BDO A;  1PTO B;  3AEV A;  3L3O C;  5LP6 F;  5L1J A;  1R9T B;  2R92 A;  1XTC D;  3HOZ H;  1KLU D;  2WKC A;  2B63 G;  4AYB B;  1MZB A;  1WTV A;  4RCO A;  5LA6 F;  3W5O A;  2MFI A;  2FE3 A;  4RB1 A;  3OW2 A;  3BQ0 A;  3NK9 A;  3CPW A;  1OXU A;  2CH4 W;  3CPF A;  3S15 B;  4DXF A;  2W6Q A;  5KNB A;  2A6E C;  1Y69 U;  2IX1 A;  4HMI A;  3K6O A;  4IAJ A;  1T3N A;  1EYG A;  2QEX A;  3QWN A;  4C3H G;  3IAY A;  4K2K A;  5EPK A;  4IUR A;  1PRT B;  3M4Q A;  4OIK A;  4PMW A;  3GTO H;  4EEQ A;  3PW2 A;  4B3R H;  1JJ2 A;  4JI8 Q;  3U4V A;  1PHJ A;  1NTG A;  3LWE A;  1FNU A;  1X3E A;  1FR3 A;  4LF7 L;  3A8K E;  3MR3 A;  3G6J B;  3JRX A;  3Q1K A;  1CZW A;  3S1R B;  4GKJ L;  5EQ0 A;  2B2T A;  1KRT A;  4BBR G;  3PCO B;  3S9W A;  4EQO A;  1ZHS A;  4CC5 A;  2X69 A;  3TEH B;  1WH2 A;  3T5K A;  4RAY A;  1EU3 A;  4DAP A;  3I4M G;  2VQE Q;  5J2U F;  5IP9 G;  4HED A;  1W96 A;  2F3W A;  4QL5 A;  2HHH H;  1LTS D;  4A3I B;  1SNP A;  2GA4 B;  4DL3 A;  4EEY A;  4DNT B;  3H0G H;  4LW1 A;  3D6W A;  1WD0 A;  1KAB A;  2PNR C;  4LMQ D;  4NXM L;  5KEE A;  1ZXT A;  2XRQ D;  3DLL A;  1K8G A;  2OXP A;  1I94 H;  1CZG A;  4FXK C;  3RB3 A;  2BQU A;  2BQ3 A;  2L5T A;  4A3C G;  4JI0 H;  3J80 W;  1BKB A;  2YZN A;  1WFQ A;  2UU9 L;  1KQS A;  1YEZ A;  1AZQ A;  1A8V A;  5EGT A;  3X3N A;  2UVW A;  3BZK A;  3W1G A;  4O4L F;  2W6M A;  5LL6 b;  4F7X A;  5IWA L;  4BA2 I;  1IBK H;  2KA7 A;  2YL2 A;  1N34 Q;  3KLS X;  2QKI C;  4DGZ A;  2GVA A;  1Q7Y C;  1A3T A;  4YBZ B;  2DWC A;  2ES2 A;  4RMF A;  1E3P A;  3Q6S A;  4DNI A;  4DN4 M;  5M5W B;  3KBX A;  1NE3 A;  1Z6H A;  4MN3 A;  3EQL C;  5KIX A;  4DV2 Q;  1SMY D;  2LXJ A;  1J5E Q;  1P16 A;  4B9W A;  4R8I A;  4DR3 L;  4FF4 A;  3UE1 A;  1CQF A;  5DG9 A;  3TRZ A;  1L1O C;  2KEC A;  4ECR A;  2MGS A;  4O3N A;  3I4L A;  1A3V A;  3A5U A;  3UDG A;  3CU7 A;  4BXX G;  1N33 H;  4DPG A;  1VQC A;  3HOU G;  2P0A A;  5KFQ A;  1WCM G;  4IO9 A;  5H1S E;  2VQF L;  3ETJ A;  1SXT A;  2XGQ A;  4ED2 A;  2EXZ A;  1S68 A;  3GTL H;  1HTP A;  2IHE A;  4P74 A;  4A3K G;  4OHJ A;  4JI7 H;  1MJE A;  1VQO A;  4ED8 A;  4QIW A;  4C3J B;  1LTA D;  4KJO A;  5DLG A;  4KKT A;  3Q8R B;  2C2D A;  4Y7N H;  3CKI B;  3C2P A;  5CV5 A;  4HNT A;  2VA2 A;  5M5X B;  1BNC A;  4HR7 B;  2EOT A;  4KV6 A;  2Z0S A;  2F52 A;  5JJL A;  3OUU A;  3NPP A;  1GSA A;  2PPB C;  5EWG A;  4IUV A;  3R5H A;  3WO1 A;  5KFL A;  5I47 A;  2HIV A;  3JSN A;  3M4O H;  5K5P A;  1Q1E A;  2R93 H;  3HKZ B;  1N32 Q;  1HA6 A;  1RJT A;  4O0A A;  4DR7 Q;  3Q8S B;  4DR5 H;  2CFM A;  4MV3 A;  1EQV A;  2GLT A;  4HQ6 A;  1RTO A;  2K1B A;  4JYA L;  4A3M G;  1I5F A;  5LOV F;  3MR5 A;  3PVX A;  3OYY A;  2J0T D;  3T16 A;  1CM9 A;  4XXE A;  1SCU B;  1LYL A;  3TQY A;  3N6X A;  1JC7 A;  2GN5 A;  2HUG A;  4DFA A;  3I4N G;  1AN7 A;  2WV6 D;  1WR2 A;  4UPA A;  5I2Y A;  1XMO Q;  4ECY A;  5FJ8 H;  3K5N A;  2JEA I;  5CV9 A;  1LT6 D;  1SYE A;  1QCB D;  2R7M A;  4ECX A;  3GTO A;  1DON A;  4JI5 H;  3GLK A;  2IL8 A;  5F2D A;  3R5F A;  2B2Y A;  3A5Z B;  1KC7 A;  2F3I A;  3Q22 A;  1I6V C;  3SK6 A;  5FOB B;  4IFD I;  4FU0 A;  2W9B B;  3D3R A;  3AU7 A;  1IZ6 A;  2KEE A;  5L1L A;  1EY6 A;  1SYF A;  4QW8 A;  2UXC Q;  4J9Q A;  1EYA A;  3NBH B;  2Z1C A;  4Q8F A;  4EQP A;  4DV5 H;  5E1F A;  2W70 A;  1PH6 A;  2UVV A;  4B3S Q;  4A3D H;  4A3J B;  4YCV A;  5FKA C;  5ELD A;  5HGT A;  3EVQ A;  1I7L A;  1RL2 A;  4IZO A;  4DL6 A;  2E5L Q;  3HXL A;  1YHQ A;  2K32 A;  4K6L A;  3HOX G;  5BR8 Q;  1Q8K A;  3HOW H;  3TME A;  3H20 A;  2HVR A;  4WJ3 M;  3D8G A;  3H15 A;  3MFH A;  1IOW A;  1JWM D;  4LF9 Q;  1VQ9 A;  3L9A X;  3DEP A;  2PQA B;  2PW5 A;  4FDB A;  1Y1V B;  4A3G B;  3EYY A;  1MIU A;  1R4P B;  3EFX D;  4A2B A;  4WFN 3;  1ET9 A;  5CA1 F;  4EYH B;  3T1Y Q;  1NNX A;  2X6G A;  4JI8 L;  3J7Y W;  2RVL A;  5C4X B;  2XWB B;  4LUZ A;  2JN4 A;  4K8I A;  4FS2 A;  3KJO A;  2YU9 H;  2QIL A;  1RHP A;  4O3Q A;  3R2T A;  2R7Z G;  4BBS G;  2A5H A;  3KHH A;  3STB C;  5DLF A;  3E5N A;  4IUP A;  4EGQ A;  5EBC A;  4CGY B;  2PNH A;  4HID A;  5C44 B;  2HVQ A;  2VQE L;  2UUA Q;  1P8L A;  1UE6 A;  3DUZ A;  1TII D;  1KDB A;  4Q0Y A;  3LML A;  1JB3 A;  4K14 A;  4BY1 H;  4J9R A;  2EVB A;  1HH2 P;  2R6F A;  3QG1 A;  2JA6 G;  5KFV A;  4O2A F;  4OO1 G;  4KHP Q;  3HBL A;  3KAK A;  2UUB H;  3U9T A;  1WTH A;  4GN3 B;  3BAA A;  4NLG A;  4DK6 C;  1UNN C;  1V8Q A;  3QB3 A;  3GIP A;  2NU7 B;  3T53 B;  2R87 A;  1SE2 A;  2W8K A;  3JRW A;  4DV5 Q;  4QWC A;  5JEA J;  5M3M B;  3K7A B;  2R7D A;  3D31 A;  5L9X A;  2WAQ A;  4AIM A;  1T36 A;  3FDS A;  4UCO A;  2BCO A;  3PUZ A;  1N34 L;  1XPO A;  4O2B F;  5J3B A;  1S40 A;  2R92 G;  2JA7 H;  4YCU A;  3MFY A;  4F87 A;  4R8U B;  5JUM A;  1IKL A;  5C3E G;  4R4C A;  1X32 A;  1SE8 A;  1STG A;  1GUW A;  4FF1 A;  1PFM A;  1YHA A;  2WAC A;  1DZ1 A;  4P71 A;  4J9K A;  4CJ2 C;  3MWE A;  4ZKC B;  4KKU A;  4DV2 L;  1A2T A;  1K83 H;  2B3G A;  1J5E L;  1ZQ7 A;  1M0T A;  3LNN A;  4YJ2 F;  3H4D A;  2WFW A;  5IYB H;  3CC7 A;  3VA5 A;  1XPR A;  2YRW A;  1SR3 A;  2NZH A;  4QJF A;  2AQ4 A;  2B2V A;  5KFZ A;  5LHY 1;  3CW2 C;  4DV4 Q;  2NVX B;  4LF6 H;  4IFD J;  4C1N K;  1QE6 A;  1QNU A;  3I8Z A;  2GVB A;  3CME A;  2RCF A;  4G7Z C;  3S14 H;  3GTQ A;  3T56 B;  3K8A A;  5KT5 A;  1YNJ C;  1IBL Q;  2Z6K C;  1PX2 A;  5D1O B;  4NB3 A;  2AMC B;  4I7A A;  1G6Z A;  2UXD Q;  2DNC A;  1IW7 C;  3KF6 B;  3MXU A;  1I4G A;  3KHG A;  2ASB A;  3G6V A;  3GTM H;  2NUA B;  1WOC A;  4CDE C;  5CA0 F;  1A0I A;  2DIK A;  3MR6 A;  2IMW P;  2EYL A;  4A3E B;  1CS0 A;  3K0Y A;  1B1Z A;  4PMB A;  2W9C B;  2JEG A;  3D0F A;  5CV8 A;  1A6X A;  1JMC A;  5GON F;  1JE4 A;  3N42 B;  1WSC A;  4R1J A;  3MXN B;  3E3X A;  4EQ5 A;  1RD9 D;  4DUY H;  1R9T A;  1N32 L;  1CTM A;  4AYB A;  3S1N H;  4DR7 L;  1FYC A;  5FD5 A;  2VPQ A;  1DXM A;  2MP1 A;  3V4S A;  4IUU A;  5IT9 E;  2FLN A;  1V1P B;  2F3V A;  3CHB D;  3HS0 C;  2I5M X;  2A6H C;  1PH8 A;  2CQA A;  3CQZ A;  2Z4I A;  4TSS A;  1AE3 A;  2O03 A;  1XMO L;  3HOV B;  2DGY A;  1VQJ A;  3TIN A;  4IFD H;  2VUM B;  2DY7 A;  2EYO A;  1CHQ D;  1O7Y A;  4LF7 H;  1PH7 A;  2JEB I;  1EIG A;  2IWH A;  1V4Y A;  4GKJ H;  3RUZ A;  4DV6 H;  3MC0 B;  4IPG A;  4N8X 1;  4RUA A;  1EFW A;  4OL7 A;  1RK5 A;  2VL6 A;  1FL0 A;  4AQY Q;  4MNO A;  1PZJ D;  1S5C D;  2UXC L;  1SN8 A;  2L4N A;  3TS2 A;  4J9N A;  1RF2 D;  2PMZ E;  4A3J H;  5DLQ E;  3M7N A;  3D6C A;  2F0I A;  2MQH A;  2VB2 X;  4XX0 B;  5IGB A;  4B3S L;  1PH2 A;  1LV9 A;  2YV5 A;  4Q43 A;  1C48 A;  1TU2 B;  4EFE A;  1X3P A;  1K1S A;  5D3D A;  2CWP A;  5C0X I;  5FD6 A;  2E5L L;  3HEJ A;  4NXM H;  1TR5 A;  2CKZ B;  3GTJ A;  4KN4 C;  1UNS A;  5BR8 L;  3S1Q B;  1BR9 A;  4MZ9 A;  1I4P A;  5ELC A;  4A93 H;  2XRS D;  2UU9 H;  4IPH A;  5M5Y B;  4A3G H;  3RGZ A;  1H9K A;  3TP5 A;  3WO0 A;  2VA3 A;  2J6U A;  1FD7 D;  4LF9 L;  2N55 A;  2MUY A;  2PO4 A;  1PYB A;  3OWF A;  3LWU A;  2R7N A;  2B2U A;  4IZ8 A;  4DUY Q;  3CVZ A;  5IWA H;  4BY7 B;  1Z2O X;  3T1Y L;  1W93 A;  1A9X A;  3X3M A;  5CV6 A;  2I46 A;  2JA8 H;  2EY2 A;  3SGI A;  2FK3 A;  1FJG Q;  3GIQ A;  5TSS A;  2GPS A;  4GZY C;  3HOZ B;  5C44 H;  2QA4 A;  4QWE A;  3BG5 A;  3H40 A;  5I2X A;  4M1U B;  1MKH A;  3WDN A;  2N49 A;  3OHX C;  4LF8 H;  3PW7 A;  2EIF A;  3PO3 H;  1NMF A;  2HCI A;  4I55 F;  3M9B A;  1RYS A;  2XIG A;  1IXR A;  4NW2 A;  2UUA L;  3MXP A;  3NWT A;  5I6W A;  4DR3 H;  1LLR D;  4HCS A;  4IPD A;  3SK5 A;  2BH8 A;  4TKO B;  5KFN A;  2OT2 A;  2QGQ A;  4YQW A;  2WP8 J;  1PZI D;  2Y0S E;  2QK4 A;  2LS0 1;  3VR2 A;  4O3S A;  2JEJ A;  4DV6 Q;  4U7C A;  1G51 A;  3FDT A;  4MV6 A;  4KHP L;  1UUP A;  3KFU A;  3GTK H;  3I55 A;  2VQF H;  1OWT A;  1MHW C;  1I4H A;  2C9O A;  2F0M A;  2AU0 A;  1J9O A;  1HPC A;  2KCC A;  4FO2 A;  3HP3 A;  1X65 A;  4DV5 L;  2K5W A;  1TWC A;  1SFO B;  1HR0 Q;  3CCS A;  4KI0 A;  3OPO A;  3JZI A;  4UCU A;  2DN8 A;  3RBD A;  2XWJ B;  5EPJ A;  4F4W A;  3UDX A;  4C3I H;  4X64 Q;  3FPP A;  4MTN A;  4P2C B;  2W6P A;  4YAK B;  1HHV A;  4HR7 A;  1S5B D;  4GOP B;  1J6Q A;  5KG6 A;  3H0G B;  1QVC A;  2H5X A;  1IW7 D;  1NSN S;  4M8A A;  4O42 A;  1BO0 A;  5IT9 L;  3PIO 3;  4UCV A;  3GTP B;  2AUJ D;  3HKZ A;  3FPU B;  1VQG A;  3GO5 A;  1N56 A;  2FLP A;  1D7Q A;  4J6H A;  1VCI A;  1M8A A;  3EN2 A;  3C0F B;  2NVX H;  4R4I A;  3RZO H;  2XTI A;  1I3Q B;  1T9H A;  4TV8 F;  1RJP A;  3FHW A;  3DM3 A;  5IOC A;  2EDG A;  4JYA H;  4GNX C;  3J81 i;  2R84 A;  4DV4 L;  3I12 A;  3J80 i;  4APM A;  4L63 B;  1JXL A;  1BF4 A;  2LY7 A;  2Q8R E;  3TP8 A;  4LF8 Q;  5C3W A;  4HYK A;  2KUM A;  3AFQ A;  1IBL L;  1D8L A;  5GAH C;  3C46 A;  2UXD L;  4TQR A;  3ER0 A;  3ORR A;  5C5L A;  4X62 Q;  2W9B A;  3FKI A;  2JXM B;  4ME3 A;  4F4Y A;  5C0X J;  1EIF A;  4IJH A;  3ULL A;  2HJW A;  4DR1 H;  4PZ7 A;  5COY A;  3TRE A;  3PF5 A;  1SNM A;  3FMC A;  4YHH Q;  1EY9 A;  4PMC A;  3BYY B;  3FVQ A;  1KLG D;  2CH4 A;  3KF8 B;  1F2M A;  1FGU A;  5KFP A;  2JJQ A;  2FKL A;  3VR6 A;  3N43 B;  1HNX Q;  2A74 C;  1H95 A;  1XNQ Q;  1O7L A;  1CQV A;  3HG9 A;  2RQX A;  2Z4H A;  3GTL B;  1YI2 A;  2YZG A;  4K8J A;  2D2C C;  3K5O A;  4RGT A;  2WAQ G;  1WTQ A;  4DKA C;  3RTX A;  4S3S A;  5J22 A;  3I91 A;  2DY8 A;  2RDF A;  2I80 A;  4YR2 A;  3GV5 B;  4HCE A;  4Y7N B;  2KHJ A;  2D0P A;  3HOV H;  1JJG A;  1RYR A;  3RV4 A;  2XC9 A;  5KYL A;  4XQN A;  4QY7 A;  5F9L A;  2PQA A;  1Y1V A;  4X3U A;  4DA2 A;  4M9U A;  3EPI A;  5IOD A;  4JI8 H;  1HCZ A;  1TS4 A;  2F0Q A;  2C2R A;  4LAA A;  3M4O B;  2W6Z A;  2RCN A;  4GC7 A;  2R93 B;  2RF4 A;  2IHF A;  3GIK A;  1VQ5 A;  4LFC Q;  2C35 B;  4RH6 A;  2ZTE A;  5LYJ F;  4RG1 A;  4AQY L;  2IP4 A;  1JOQ A;  2R3Z A;  4QQB X;  2VQE H;  1IHZ A;  2LKV A;  3NTI A;  1JOO A;  1JDE A;  5KFI A;  5C0X H;  3LX0 A;  4YJ3 F;  3PQI A;  5KG5 A;  5JVH 3;  4CC6 A;  5C6A A;  2VPS A;  5EBD A;  1BXT A;  1UWV A;  1B8A A;  2NVY H;  2AQ1 B;  1BBX C;  5C5J A;  5FJ8 G;  1QG7 A;  2MJ8 A;  3PUV A;  3N44 B;  3MFI A;  1WJJ A;  4CBV A;  5FLM G;  2OF1 A;  4DR1 Q;  3KJP A;  1BGW A;  1H9R A;  4X3S A;  1D2B A;  1E4G T;  3UQ8 A;  5I6Y A;  5HY6 A;  2DJF C;  1STY A;  4A3F G;  2CQY A;  1AUV A;  4C2M H;  2B39 A;  3CCU A;  3WNZ A;  2FMC A;  4RWS C;  4DUY L;  1M4V A;  2EZV A;  3S2H H;  4A3D B;  3QR8 A;  1N34 H;  1K0R A;  1NR4 A;  3SDZ A;  1XX8 A;  4R8U A;  2N3S A;  5KG1 A;  4AYB G;  1SND A;  1FJG L;  2ZXP A;  1TY2 A;  1W3S A;  3T4A C;  1YNX A;  1W2B A;  5M3F B;  1Z47 A;  2MO1 A;  2EE1 A;  2L9H A;  3HOW B;  4A3B H;  1L1O B;  5C4H A;  4DV2 H;  1SLJ A;  4ZUJ A;  1J5E H;  2ZDQ A;  4APV A;  1VQL A;  1XTD A;  1J8I A;  1CQJ B;  4JCV E;  5ELF A;  2V9W A;  4KY6 A;  3L7Z C;  3R93 A;  2A69 C;  1PA6 A;  1RIP A;  2NVX A;  1ESR A;  3M4I A;  1I50 B;  4ECU A;  1Q81 C;  4YIJ A;  3MWD A;  3UDI A;  4DV6 L;  1JQY D;  1VQA A;  3G7L A;  4YWK A;  2K5H A;  4OXP A;  3Q0A A;  1K8M A;  4A3L G;  3EJI A;  2YU9 B;  4RNN A;  1WTO A;  5D1O A;  1SFO H;  1JE5 A;  4JI1 Q;  4J0M A;  2D0O A;  1TS3 A;  2AHO B;  2L55 A;  4J9P A;  3KF6 A;  4XYQ A;  3IG0 A;  2Z6B A;  2XIW A;  3ITP A;  1HR0 L;  1JLL B;  2I5H A;  3DMU A;  4ZLT F;  4QWD A;  1E4F T;  2F4V Q;  4R4T A;  2NZO A;  4A3I G;  3SE0 A;  4BY1 B;  2SDF A;  4L5T A;  4X64 L;  1U5K A;  2KOL A;  2W9C A;  1X3Q A;  3ULP A;  2ATW A;  3V96 A;  2M2L A;  2VZA A;  4X6A H;  1QVG A;  3MXN A;  2O4X A;  1F77 A;  4L5S A;  3GTP H;  3PN1 A;  3I4M B;  1VQ8 A;  1CFM A;  4Q8E A;  3G6Y A;  1V1Q A;  3ERS X;  4HSP A;  4V19 0;  3LP8 A;  4X3T A;  1I3Q H;  1SSO A;  3A54 A;  1N32 H;  3RN5 A;  4DR7 H;  4PDB A;  2B2W C;  5KFU A;  1WTR A;  3JAM E;  1EQR A;  4ALP A;  4GLX A;  2WIN B;  4YCW A;  3EIV A;  3VDY A;  4ED6 A;  1V1P A;  2JP1 A;  2XCL A;  1S0O A;  4A2A A;  1YVC A;  4J1M A;  2EYJ A;  1U4L A;  2JA7 B;  1XMO H;  3SI8 A;  4LF8 L;  3ETH A;  1MBY A;  2VUM A;  4NDX A;  2MCT A;  5A2Q E;  1Q90 A;  3PGZ A;  1JWS D;  2JQO A;  3G71 A;  2YYZ A;  3HRZ C;  1IBM Q;  5F9N A;  3L4J A;  4WD3 A;  2RHQ B;  1SEB D;  4X62 L;  1K83 B;  1C0A A;  5L1K A;  1N48 A;  2Q2I A;  1JCK B;  3JSL A;  3OUZ A;  5KT4 A;  1AN8 A;  5IYB G;  3SXH A;  1GHJ A;  2VR1 A;  4UP7 A;  2UXC H;  1PTO F;  3KBG A;  3NE5 B;  1EEF D;  4UDU C;  2FHT A;  4YHH L;  5IYC H;  2W6O A;  4FXG C;  4F8M A;  2W7O A;  4F4Z A;  2Y0S B;  5I4D A;  4I7Z C;  3CCL A;  1A15 A;  2XNA C;  4CDF C;  3S14 B;  4F4X A;  4B3S H;  4QF4 A;  4WBN F;  2L0C A;  1ML0 D;  1KAW A;  5FO7 B;  4ZOL F;  4X66 H;  4JV5 H;  4OON A;  4BS9 A;  1HNX L;  4JI3 Q;  1XPU A;  1F9S A;  1XNQ L;  2E5L H;  1VAJ A;  5IGG A;  2EJF C;  1YIT A;  5BN4 A;  1GHK A;  2RKS A;  2RGR A;  1Y8O B;  5BR8 H;  3H4B A;  2E2I B;  4HAE A;  4C3J G;  2IX3 A;  1M7J A;  3VYT A;  3GTM B;  1TWH B;  1I4Q A;  1VQF A;  2BOS A;  3RB0 A;  4B3T Q;  5J39 A;  4JI2 Q;  4LF9 H;  1EY8 A;  4DL2 A;  4QIW E;  2FFK B;  2SNS A;  2MHV A;  3QOJ A;  1E1T A;  4ECW A;  2EYF A;  3RZD H;  1E1O A;  4UHV A;  1C4Q A;  4GLA C;  3J7A 5;  3T1Y H;  2E2H H;  3CC4 A;  3BJY A;  3HKZ G;  1TWF H;  2WDT A;  4ZYS A;  3K5I A;  4OWW B;  3RF2 A;  2J6T A;  2HQE A;  3R5X A;  1RDP D;  4LFC L;  3S1N B;  3QIA A;  3I72 A;  4PNY A;  4J9M A;  1RTN A;  3RD4 A;  3K59 A;  3PO2 H;  2RHS B;  2UUA H;  3DHQ A;  3UFX B;  2R8K A;  5C4J H;  1PYS B;  1QWY A;  4LSX A;  3U9O A;  4Q0F A;  3PV0 A;  2F0J A;  2AGQ A;  1STB A;  3K3P A;  1DOM A;  1U0L A;  4R7R A;  4Q5V A;  2YS7 A;  4KHP H;  3MR2 A;  3JAM W;  1EYD A;  3FKI G;  2NWG A;  1ONL A;  3VPD A;  1IYU A;  4DR1 L;  1AEX A;  1B3A A;  3VYS A;  3KYH C;  4MHE A;  1X6O A;  3VR3 A;  1BOS A;  1JT8 A;  4DLK A;  2A69 D;  3MEH A;  2WB1 G;  1CT1 D;  1SFO A;  3OSP A;  2L15 A;  2Q2U A;  1Q1B A;  2NTS A;  2KSW A;  3V6H A;  2RSO A;  4X66 Q;  4ECS A;  4JV5 Q;  3J7A K;  2K5V A;  1CSQ A;  4PG3 A;  1K3B C;  5KFR A;  3OHB A;  2AQ3 B;  3B6Y A;  5IYZ F;  2NN6 G;  5C1P A;  2FMM A;  4GOP A;  5M3F H;  3H0G A;  1GKH A;  1LTT D;  4J8Q A;  4Z9C B;  5KT2 A;  2PCF B;  1Y1W H;  5CGK A;  5LL6 X;  3JAM L;  3GV3 A;  3ONA B;  4P73 A;  5DQG A;  1S03 G;  1XWE A;  1KJ9 A;  1S0M A;  4EQN A;  1C8C A;  3SVM A;  1SYC A;  4A93 B;  5HV6 A;  4KK7 A;  3HKS A;  3S16 B;  4OX9 Q;  4HIM A;  4WJ4 A;  1JOK A;  2B63 H;  1YNN C;  1I50 H;  1PFB A;  1X54 A;  3PZP A;  5DGB A;  3U58 A;  3TP7 A;  3PIP 3;  1Y1V G;  1UC8 A;  1Y8N B;  1VQ6 A;  1B04 A;  3M9N B;  1IL8 A;  5C4X G;  4B3M Q;  3HOX B;  4DV4 H;  5C4Z A;  4LUV A;  3P75 A;  5KFS A;  2RDG A;  1B44 D; 
#chains in the Genus database with same CATH homology
 3FP9 A;  1EFW A;  1KIX A;  4LFB Q;  2VL6 A;  1FL0 A;  4AQY Q;  3AFP A;  4MNO A;  5IP7 H;  2UXC L;  4C3H H;  2UUB L;  1SN8 A;  3JC6 6;  3K0X A;  4DAM A;  3TS2 A;  2VQF Q;  3BJU A;  2PMZ E;  4A3J H;  4UP9 A;  5DLQ E;  1OXT A;  1YZ6 A;  4JI1 L;  2JA7 G;  1X55 A;  2MQH A;  4KHZ A;  3M7N A;  5C44 G;  2ZJQ A;  2LXK A;  5GAE C;  3E0E A;  4NPS A;  1PH2 A;  1B70 B;  3CC2 A;  4B3S L;  2YV5 A;  3NEL A;  5EAY A;  1N8R C;  4DV7 L;  4YY3 L;  3RN2 A;  1X3G A;  2F4V L;  2CWP A;  1BVS A;  4BBR H;  5C0X I;  2E5L L;  2Z6K A;  3K81 C;  5IT9 c;  4Y52 H;  2CKZ B;  2A8V A;  5GRO A;  2E2J H;  3CF5 A;  5BR8 L;  1VQN A;  3I4M H;  2HQL A;  3HOY G;  1NMG A;  2FXQ A;  4MZ9 A;  5IP9 H;  4A93 H;  1SRO A;  2JA5 H;  1CKN B;  4IPH A;  2VUM H;  2Y0S G;  2ID0 A;  4A3G H;  4PZ8 A;  4DR2 L;  4P72 A;  3RLF A;  2JA9 A;  1YBY A;  4GOP C;  4LF9 L;  2YTV A;  4HJ9 A;  3PO2 G;  1PYB A;  2B29 A;  2NVX H;  4DUY Q;  4OWT B;  4IOC A;  5M3M G;  4B3R Q;  1DGS A;  3T1Y L;  2ZTD A;  2N78 A;  1HNW Q;  3AQQ A;  4J15 A;  2JA8 H;  4JYA Q;  1VQE A;  3SGI A;  1CKM A;  1FJG Q;  4A3C H;  3PF4 A;  4OO1 I;  4UP8 A;  4LF6 L;  4WJ4 A;  5C44 H;  2QA4 A;  3KLW A;  4HJ7 A;  4LF5 Q;  2AWO A;  1MKH A;  4A4I A;  2N49 A;  4POF A;  1CUK A;  3K80 C;  2EIF A;  4GNX A;  4DV3 Q;  1NMF A;  4A75 A;  3PO3 H;  3IRB A;  3M9B A;  2UUC Q;  2WAQ E;  2I5L X;  1IXR A;  2UUA L;  1GM5 A;  5JEA G;  2K50 A;  3OTO Q;  3CCE A;  4IPD A;  3J81 j;  1UEB A;  2BH8 A;  3UDF A;  5IY0 A;  2HHH Q;  3JAM i;  2QGQ A;  3PIO A;  4JOI A;  1IBM L;  3S1Q H;  2WP8 J;  4JI4 Q;  2Y0S E;  3CCJ A;  1TXY A;  1HZC A;  4DV6 Q;  2PI2 E;  4DR4 L;  2K14 A;  1G51 A;  3CAM A;  3ZJY C;  5M5Y H;  4KHP L;  3RLO A;  3KFU A;  3GTK H;  3I55 A;  4JBJ A;  3RLN A;  3CCQ A;  1I94 Q;  5M3F G;  2E8G A;  1E24 A;  1A62 A;  1PH3 A;  2YTY A;  4IPC A;  1Y1W G;  4LF4 L;  2IY5 B;  1A63 A;  4JI0 Q;  3T1H L;  4BY7 H;  5IYD H;  3CCR A;  1X65 A;  4DV5 L;  1HR0 Q;  3CCS A;  4KI0 A;  2KCM A;  3E9I A;  4JI3 L;  2E2I H;  4BXX H;  5ELO A;  3AEV A;  2BA0 A;  1PFS A;  4X65 Q;  1S72 A;  1TWH H;  1X56 A;  1FVI A;  3UE0 A;  3UDX A;  4C3I H;  4MTN A;  4X64 Q;  1WCM H;  3F2C A;  2B63 G;  3HOU H;  1IBK Q;  4IFD G;  2VY3 A;  1N36 L;  3F8T A;  3W5O A;  2IT1 A;  4A3E G;  4GOP B;  1J6Q A;  1VQK A;  2MFI A;  2UXB Q;  1QVC A;  2H5X A;  3OW2 A;  3GTQ H;  3CPW A;  1OXU A;  4A3K H;  3CPF A;  2K5N A;  4XIG S;  1NJI C;  4NXN L;  4B3T L;  4DAY B;  2BH2 A;  4JI2 L;  2IX1 A;  1XMQ L;  5IP7 G;  1QUQ B;  1TWA H;  1EYG A;  2NVQ H;  5JJI A;  1VQG A;  3GO5 A;  2QEX A;  3GTO H;  4PMW A;  3M4Q A;  1D7Q A;  4AH6 A;  1VCI A;  4A3J G;  3EN2 A;  1JJ2 A;  4R4I A;  4JI8 Q;  2XTI A;  1T9H A;  3U4V A;  5FLM H;  4R4O A;  1PHJ A;  1VQ7 A;  1NTG A;  3DM3 A;  3FHW A;  1X3E A;  4K0K L;  2ZJR A;  4LF7 L;  4GNX C;  4KLK A;  3J81 i;  1QVF A;  4GKJ L;  4DV4 L;  1EUJ A;  1TWG H;  5IE8 A;  1HNZ L;  3J80 i;  1OXX K;  1CSP A;  1VQD A;  4GLV B;  1KRT A;  3PCO B;  4BBR G;  1N33 Q;  3CMA A;  3TEH B;  1L1O A;  4A3F H;  3NEM A;  2VQE Q;  4LF8 Q;  3I4M G;  2OTJ A;  5IP9 G;  3M85 A;  3AFQ A;  4AYB E;  1IBL L;  4A93 G;  1D8L A;  1R9T H;  3KOJ A;  1PVO A;  4QL5 A;  2A19 A;  5GAH C;  2AKW B;  4JBM A;  2UXD L;  1E7Z A;  3ER0 A;  4A3M H;  1JJC B;  2VUM G;  3L0O A;  4A3G G;  4JI7 Q;  3L2P A;  4X62 Q;  4POG A;  5HGQ A;  5JJK A;  2A1A A;  3A74 A;  3H0G H;  4LW1 A;  4ME3 A;  5C0X J;  3CCV A;  1EIF A;  2NN6 I;  5LMU Q;  4YWM A;  2Q2T A;  4NXM L;  4IJH A;  3ULL A;  4JBK A;  2AWN A;  4PZ7 A;  3TRE A;  4UY8 C;  3I4N H;  3S15 H;  3PF5 A;  3DLL A;  4YHH Q;  1K8G A;  4QGU A;  4LNQ A;  3CQZ H;  2JA8 G;  3HOZ H;  4A3C G;  3KF8 B;  1BKB A;  1EOV A;  1WFQ A;  1FGU A;  2ZJP A;  2UU9 L;  2JJQ A;  1JB7 A;  1KQS A;  1YEZ A;  1VQH A;  1HNX Q;  1GD7 A;  1H95 A;  1A8V A;  1XNQ Q;  3PO3 G;  4X66 L;  3BZK A;  4JV5 L;  3A0J A;  3W1G A;  3S1R H;  3GDE A;  1ASY A;  1YI2 A;  2LSS A;  4EX5 A;  2ZM6 Q;  5IWA L;  4BA2 I;  1K3R A;  4DR5 Q;  4A3L H;  1N34 Q;  2WAQ G;  4DKA C;  1PH4 A;  2GVA A;  1Q7Y C;  2ES2 A;  4RMF A;  3CXC A;  1E3P A;  4GKK L;  4DNI A;  3S16 H;  2KHJ A;  2D0P A;  3HOV H;  1JJG A;  3I56 A;  3NEN A;  1NE3 A;  4QY7 A;  4HJA A;  5AJ3 Q;  2PQA A;  2R6G A;  4GNX B;  4A3I H;  1EIY B;  1CKO A;  4DV2 Q;  4OX9 L;  2LXJ A;  1J5E Q;  1P16 A;  3HOX H;  4LFA L;  2IX0 A;  4DR3 L;  3UE1 A;  2RCN A;  5IYD G;  3TRZ A;  1L1O C;  4JI5 Q;  3GTJ H;  2RF4 A;  4BY7 G;  2IHF A;  4B3M L;  3CP0 A;  1VQ5 A;  4LFC Q;  2C35 B;  3A5U A;  3UDG A;  2ZTE A;  3J7Z C;  4BXX G;  1M1K C;  4LFB L;  4RG1 A;  5ELN A;  4AQY L;  4DPG A;  1VQC A;  4JI6 Q;  3HOZ G;  3HOU G;  1X3F A;  1SRU A;  1WCM G;  3H3V I;  4QQB X;  4IO9 A;  5H1S E;  2VQF L;  4HJ8 A;  1VQM A;  4P75 A;  1V9P A;  1UE1 A;  1KD1 C;  3GTL H;  2IHE A;  4P74 A;  4DUZ Q;  1IL2 A;  4A3K G;  1UWV A;  1B8A A;  4HIO A;  2NVY H;  1KXL A;  1MJE A;  1VQO A;  2R7Z H;  4BBS H;  5FJ8 G;  3PUV A;  1WJJ A;  1VQ4 A;  1XNR Q;  4Y7N H;  5M5W H;  5GAD C;  1HZB A;  1Z9F A;  5FLM G;  1KRS A;  5LMN Q;  4DR1 Q;  3KJP A;  2Z0S A;  1Q12 A;  2F52 A;  5JJL A;  4BA1 I;  2HIV A;  2VS1 A;  3M4O H;  5HY6 A;  1L0W A;  1Y14 B;  4DV1 Q;  1Q1E A;  2HT1 A;  4A3F G;  1Q82 C;  2R93 H;  1KL9 A;  4GN4 B;  4A76 A;  3MEF A;  1N32 Q;  4IJL A;  4C2M H;  4JBW A;  3CCU A;  2JA6 H;  1G6P A;  4DUY L;  1Q86 C;  4O0A A;  3S2H H;  2K75 A;  4DR7 Q;  4B3R L;  2CFM A;  1K0R A;  3ICE A;  1HNW L;  2JE6 I;  4XTC S;  3EBE A;  1QZH A;  2N3S A;  4A3M G;  1I5F A;  4TVA B;  4AYB G;  4JYA L;  1FJG L;  3OYY A;  1W3S A;  1YNX A;  1W2B A;  3TS0 A;  1LYL A;  3H0G G;  1Z47 A;  2MO1 A;  3TQY A;  1YJ9 A;  4LF5 L;  2GN5 A;  4A3B H;  4DV3 L;  1L1O B;  3I4N G;  2UUC L;  1SLJ A;  1TWC H;  4UPA A;  1C9O A;  5FJ8 H;  4DV0 Q;  1XMO Q;  4APV A;  1PH9 A;  2JEA I;  1VQL A;  1XTD A;  5FLX c;  1PH1 A;  3OTO L;  4C3J H;  1K9M C;  4JCV E;  4DR6 Q;  3KDF A;  3L7Z C;  1PA6 A;  2HHH L;  1RIP A;  1GO3 E;  3A5Z B;  3S1M H;  5GQO A;  2F3I A;  4JI4 L;  5C3E H;  1Q81 C;  4IFD I;  5M5X H;  3UDI A;  4DV6 L;  1IZ6 A;  1KC8 C;  4LWC A;  1VQA A;  2HIX A;  2UUB Q;  2UXC Q;  4YWK A;  2K5H A;  4OXP A;  3NBH B;  4A3L G;  2ALY B;  1I94 L;  1SFO H;  1JE5 A;  2KHI A;  4JI1 Q;  2D0O A;  3GTG H;  2AHO B;  5K36 G;  2OQK A;  4JI0 L;  3KF6 A;  1PH6 A;  3CD6 A;  4B3S Q;  4A3D H;  4YCV A;  3HOV G;  1XJV A;  1HR0 L;  4DV7 Q;  2I5H A;  2V1C C;  1AE2 A;  2DUD A;  4YY3 Q;  2F4V Q;  1RL2 A;  4R4T A;  2NZO A;  2D62 A;  4X65 L;  4A3I G;  2E5L Q;  3Q8D A;  3S24 A;  2R7F A;  3F1Z A;  4L5T A;  1YHQ A;  4X64 L;  3HOX G;  3AYH B;  1U5K A;  5BR8 Q;  1K73 C;  1IBK L;  1HJP A;  3ULP A;  1Q8K A;  2ATW A;  3HOW H;  2VZA A;  1SMX A;  1QVG A;  4X6A H;  2UXB L;  4L5S A;  3GTP H;  1VQ8 A;  2N8N A;  4WJ3 M;  2VW9 A;  1V1Q A;  1LUZ A;  3ERS X;  3H15 A;  4DR2 Q;  1E22 A;  1I3Q H;  4LF9 Q;  1VQ9 A;  4JG2 A;  2PQA B;  4FDB A;  3RN5 A;  1MIU A;  1K8A C;  3FKI H;  3T1Y Q;  1I6H H;  4JI8 L;  5C0X G;  1HZ9 A;  2WB1 E;  2K52 A;  1EQR A;  4ALP A;  4LUZ A;  4GLX A;  3CCM A;  4YCW A;  1UE5 A;  3EIV A;  3VDY A;  3LGJ A;  2MNA A;  3KJO A;  2YU9 H;  3M4P A;  4LF6 Q;  1YVC A;  3ULJ A;  2R7Z G;  4BBS G;  1B7Y B;  3STB C;  1QZG A;  1N33 L;  3PUX A;  1KHI A;  1PH5 A;  1C7Y A;  2PNH A;  4HID A;  3HOY H;  1UE7 A;  4LF8 L;  2VQE L;  1YJW A;  2UUA Q;  1P8L A;  1UE6 A;  3U50 C;  3PUW A;  3PGZ A;  4BY1 H;  3RNU A;  2JQO A;  5E7N A;  2YYZ A;  3G71 A;  3STB D;  1IBM Q;  4JI7 L;  2RHQ B;  1L2F A;  3PSI A;  1HH2 P;  2KCT A;  4X62 L;  4HIK A;  1C0A A;  1YIJ A;  2Q2I A;  4PZ6 A;  2R93 G;  4DR4 Q;  5LMU L;  2JA6 G;  5IYB G;  3S2D H;  4OO1 G;  4H02 A;  4UP7 A;  4KHP Q;  4GN3 B;  4DK6 C;  4YHH L;  1EWI A;  1WI5 A;  5IYC H;  4L5R C;  4LF4 Q;  3U4Z A;  3CCL A;  3WWV A;  1Y1V H;  3T1H Q;  2Q2H A;  5C4X H;  4DV5 Q;  1KAW A;  3G6E A;  4OON A;  5JEA J;  1N9W A;  3JAM c;  3I7F A;  2R7D A;  3D31 A;  1M90 C;  1HNX L;  4JI3 Q;  1XNQ L;  3GD7 A;  1XPU A;  4A3B G;  4AIM A;  1YIT A;  3G4S A;  2ZM6 L;  3I4O A;  1WYD A;  4DR5 L;  1N36 Q;  3PUZ A;  1N34 L;  1XPO A;  1OXV A;  5J3B A;  1S40 A;  2R92 G;  3G48 A;  1CKN A;  2JA7 H;  1VQF A;  4YCU A;  2KBN A;  1HZA A;  5C3E G;  2PI2 A;  4R4C A;  1SE8 A;  1VQB A;  2OWO A;  1YHA A;  4B3T Q;  4NXN Q;  4P71 A;  4JI2 Q;  1XMQ Q;  5AJ3 L;  3M3Y H;  4QIW E;  1V43 A;  4HJ5 A;  4YWL A;  1E1T A;  4DV2 L;  3RZD H;  1K83 H;  1E1O A;  2B3G A;  1J5E L;  4GLA C;  3J7A 5;  2WFW A;  1VQP A;  2E2H H;  5IYB H;  3HKZ G;  3CC7 A;  1XPR A;  3CC4 A;  1SR3 A;  1VQI A;  1YHB A;  2NZH A;  2OCE A;  4QJF A;  4R4Q A;  1BBW A;  1TWF H;  4LF7 Q;  4K0K Q;  4OWW B;  3KDF B;  4JI5 L;  4A3D G;  3CW2 C;  3H3V H;  4GKJ Q;  3RR5 A;  4DV4 Q;  4IOA A;  5LMN W;  4LFC L;  1S3O A;  4IFD J;  1HNZ Q;  3CME A;  2GVB A;  3S14 H;  4JI6 L;  3PO2 H;  1OXS C;  2RHS B;  3K8A A;  5C4J H;  5M3M H;  3K7A H;  3HOW G;  1IBL Q;  2Z6K C;  1PYS B;  1HR0 W;  4NB3 A;  2AMC B;  4DUZ L;  2UXD Q;  5GAG C;  1EQQ A;  3KF6 B;  3PV0 A;  2R92 H;  3PUY A;  2ASB A;  1MJC A;  2MO0 A;  3E9H A;  3BZC A;  3J81 c;  1U0L A;  1PV4 A;  3GTM H;  1WOC A;  3S17 H;  1A0I A;  4NXM Q;  3J80 c;  4OWX B;  1XNR L;  3I2Z A;  3FKI G;  3PIP A;  1Q46 A;  2I0Q A;  1BBU A;  4LUO A;  5LMN L;  4DR1 L;  3HKZ E;  3D0F A;  3KYH C;  1JMC A;  1X6O A;  1JT8 A;  2KEN A;  4GN5 A;  2WB1 G;  4R1J A;  3MXN B;  3HFZ B;  1O7I A;  2EQS A;  4DK3 C;  2UU9 Q;  1AH9 A;  2EXD A;  2L15 A;  4EQ5 A;  2Q2U A;  1Q1B A;  1GVP A;  1LTL A;  4DV1 L;  2K4K A;  4X66 Q;  3F2D A;  4JV5 Q;  1N32 L;  2VNU D;  2K5V A;  1CSQ A;  4PG3 A;  2NVT H;  1VS0 A;  1ASZ A;  5IWA Q;  3F2B A;  3S1N H;  4GS3 A;  3B6Y A;  1NBW A;  4DR7 L;  2NN6 G;  4GOP A;  2OQ0 A;  4L5Q A;  5M3F H;  4BY1 G;  1GKH A;  1YJN A;  2CQO A;  1LM0 A;  2BA1 A;  1Y1W H;  1NY4 A;  4GKK Q;  4P73 A;  2I5M X;  1PH8 A;  1QUQ A;  3RZO H;  4JOI C;  1AE3 A;  2JK8 A;  4TQU S;  1OTC A;  3HKS A;  2OTL A;  4OX9 Q;  4HIM A;  1XMO L;  4DV0 L;  2DGY A;  1VQJ A;  3BU2 A;  3W1B A;  4O2D A;  5IYC G;  1X9N A;  2CCZ A;  2JA5 G;  1I50 H;  1X54 A;  4LFA Q;  2B63 H;  1G29 1;  4DR3 Q;  1IYJ B;  2YTX A;  1Y1V G;  3U58 A;  4A3E H;  1VQ6 A;  1PH7 A;  2JEB I;  4DR6 L;  2ZTC A;  5C4X G;  4B3M Q;  4JC0 A;  4IPG A;  2CWA A;  4LUV A;  3K7U C;  2XGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...