2FJZA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fjzA00
1OWTA 2FK2A 2FK3A 2FJZA 2FK1A 4PWQA 3KTMA 2M05A 2FMAA 2FKLA
chains in the Genus database with same CATH superfamily
3FKIG 1B33N 2KSWA 2IP4A 4DV4H 3K3PA 4DR6H 3GQCA 5KFTA 4PWQA 4DUZH 5KG5A 3U9SA 1ZHQA 1DIKA 4IAJA 4E4TA 2V9WA 1XDNA 1B6RA 5DQGA 1VBGA 4MTEA 4X62H 4DR1H 1VKZA 4PDBA 3RB6A 2VR1A 4RUCA 1M6VA 4Y8VB 4QWDA 1KJJA 1FVIA 3HOZG 1JKJB 2I87A 2V59A 4HNTA 1DV1A 4MAMA 4TQRA 3G6XA 2C35B 1S0NA 3F8NA 1HR0H 4LFBH 1R9TA 2YS6A 2YW2A 5DQIA 4JI5H 3GTLA 2YRWA 5JVLA 4J9QA 1WSCA 3GTQA 1EYZA 2W57A 2YRXA 4YR0A 4QIWE 3J80W 3G6VA 4O4HF 3RB4A 1KJQA 3ETJA 1S0OA 3TIGA 2VA2A 4A3BG 2R8KA 1FKAH 3R5HA 3LP8A 5KFDA 2V4QA 2R7ZG 2W6NA 4AYBA 3UQ8A 2VUMA 5KT5A 4JI0H 5KT3A 4O3PA 5L9XA 3N42B 1O75A 4HNUA 2YYAA 4QWBA 4YQWA 2RDJA 1N48A 1WR2A 2C00A 4A3KG 4DV7H 3K5IA 4RNMA 5KFNA 3GIMA 2UUBH 1J5EH 4B3MH 3VPDA 3V6HA 1HNWH 5BPFA 2R7MA 5EWEA 3HBLA 1I50A 4QWCA 3RAXA 2WB1E 5KG1A 3KHHA 1VAJA 4DR2H 1N36H 1M7JA 4MV3A 2QYZA 2SCUB 3HOVG 1V9PA 2R84A 4ECXA 3RV3A 1SEIA 1K83A 1E4FT 4UCSA 3MR6A 1N56A 2ZDHA 5KG2A 3RBDA 3Q8RB 2UUAH 3PR5B 4B3SH 3H0GG 4X66H 2R8IA 3H4DA 2J6SA 5KFFA 2JA8G 1SCUB 2C2DA 4ETSA 3M9MB 3BQ1A 2ALZA 5KT7A 2JA6G 3H3VH 2FK3A 5J2TF 1BJTA 4RU9A 4QWAA 2GPSA 2ZDGA 3BAAA 5DGAA 2FKLA 3QZ7A 2V4RA 3H4BA 1RJRA 1JLLB 5C1OA 2VA3A 4I55F 5C1PA 2R82A 4O4LF 3OHAA 4J9SA 2JEJA 5I47A 5IP9G 3ORQA 2UVRA 2WE6A 4IZOA 5CB4F 1KJ9A 1WCMA 4YHHH 2XCLA 2WTFA 1Y1WG 4A3DG 4RAZA 1Z2OX 5LA6F 4DR7H 2NVYA 3IN5A 4EFEA 3LWBA 4DV2H 4ECZA 5FJ8G 2PBZA 3EYYA 4LMYA 3J81W 3BQ2A 2W6OA 4DV1H 1S0MA 4O3QA 1HNXH 4K0KH 1WH2A 5DQHA 4ED1A 2JA7G 4LF4H 4O2BF 1T94A 3GIPA 2HGSA 4JI8H 4O3SA 2UXDH 2XIGA 5KT4A 3HB9A 1CS0A 2FP4B 5L1KA 1XMQH 4GKJH 4F4YA 1A9XA 4CC6A 4ECVA 2R8HA 4KHPH 4APMA 5IWAH 4JI4H 5EWGA 4F4WA 4EYIB 1E4EB 3HKZE 4J9NA 4ECRA 4HQ6A 3PW2A 4JV1A 1B6SA 4FBUA 5F9LA 5KFHA 2MCTA 3OHBA 5DLGA 3T1YH 2IA6A 1Y14B 2W9AA 5BPHA 3TQTA 3EPIA 4LH7A 3T5HA 4MA5A 2BQRA 2W9BB 4RB2C 3T5LA 2XCAA 3MJFA 5LMUH 2WAQE 2FLPA 3VMMA 3RUPA 4YJ2F 4B3RH 3R5FA 2W7OA 4GLXA 3GTPA 1EZ1A 2RDIA 2ZJTA 1C3OA 4O4IF 4R7RA 4QJFA 3RTXA 2E5LH 4AQYH 2FLNA 1I7NA 4ED7A 4DL5A 4A93G 1Z2NX 4F4XA 2CZGA 4DL2A 4UCOA 3K5HA 1CQIB 3MWEA 4X65H 2DPIA 4IRCA 2W70A 4NXNH 2YU9A 2CW8A 4U6PA 3OUUA 4RB0A 3M9NB 3GTGA 4A2BA 5GONF 5KFWA 5KX5F 3PO3G 1PX2A 5IYBG 1TWGA 4A3JG 2Y0SE 2FJZA 2FK1A 4BBSG 2BQ3A 3GTMA 4EGQA 4MA0A 1ULZA 1S03G 3Q8PB 1AUVA 1TWCA 4Q45A 3RGXA 4JUZA 2M05A 3KHLA 3N41B 4IHJF 4IRKA 2W71A 4FM9A 2R8GA 2UU9H 2NU9B 4JI6H 2YZMA 3VPCA 4J9MA 2PMZA 2V5AA 3L4JA 4GKKH 1UNNC 4I50F 4IRDA 3Q2OA 4YBZB 2NUAB 1A0IA 5JUMA 3T5JA 5FD5A 5KFXA 5L1LA 1V51A 2JA5A 1WCMG 1TWAA 2UUCH 3BJYA 3J7AK 1JDBB 5FLXW 2ZM6H 3PR4A 1OWTA 4TQSA 5CA1F 5L1JA 4A3MG 4YP3A 3Q8QB 5D1PA 4I7HA 5K2MA 4ECQA 4UCRA 1IBKH 2W6QA 3FMAA 1Y1VA 2R85A 3N8DA 5KFJA 5CAEB 4EG0A 4F50A 1XMOH 4ED8A 4Q8EA 3M9OB 5C44G 2ASLA 4QW9A 1M0WA 3M4IA 2IMWP 3R5XA 2FLLA 4YY3H 1JXLA 2J6UA 2W6PA 4J0MA 4DL4A 5JH7F 2R93A 3EPGA 4MV4A 5DLFA 4DV3H 1P8LA 2NU7B 4A2AA 2XC9A 3KALA 5EOYA 4MV6A 1E4EA 1AN7A 2JEFA 2AGQA 4YJ3F 3PW7A 3GIKA 1EUCB 2B63G 3RJ0A 4J9RA 1VBHA 3E5NA 4EEYA 2BR0A 4ZI7F 5IP7G 5C3EG 2YL2A 2V58A 3PN1A 3QFFA 3N6XA 3GV7B 5D8DA 2VUGA 1CQJB 3SI8A 4O2AF 4LF7H 3RB3A 1B04A 4TV9F 2HHHH 1I6UA 2WDTA 4IWYA 4WBNF 3I4NG 4DV0H 4J9KA 4BY7G 4F4ZA 2CW7A 3MFHA 2NVXA 2I8CA 4A3LG 4RNOA 4J9PA 1GSAA 2NU6B 5L1IA 2C28A 3MWMA 5KFPA 2R8JA 2FB9A 4RB1A 1GO3E 3GTKA 2FK2A 2PN1A 3IG0A 3CVZA 5FPRA 1SFOA 2HVRA 4M9UA 1VS0A 5KFOA 3KAKA 5KG6A 4ED3A 1S10A 2DZDA 2Q2TA 4JV5H 2VOBA 4EEQA 2O03A 5LYJF 4A3IG 2UVUA 1FJGH 4HYKA 1JIHA 2BQUA 4JI7H 3N44B 4LH6A 2F4VH 4TV8F 3I12A 2R92A 4RAYA 4LF6H 2C2RA 1I3QA 2W7PA 4LF8H 4A3CG 1CE8A 2RGRA 4QIWA 5KT6A 4RUAA 1KEEA 1N34H 3RGZA 2E2IA 3LMLA 1IBMH 5KKNB 3VPBA 2XGPA 4MV7A 2AU0A 3JAMW 3V4ZA 2FPIB 3KAJA 4LFCH 4CC5A 2JA5G 4C5CA 5KFEA 5KFIA 1HNZH 4AYBE 5D1OB 4Q8FA 1N33H 5C8YF 4DR3H 2YZGA 3GTOA 1I94H 1V4YA 5FD6A 4ECUA 1UC9A 4LF9H 4ECSA 1RYSA 2VUMG 2DPJA 1M0TA 1RK5A 2WB1A 3OUZA 5LXTF 4C2MA 5EDWA 2YZNA 4O3NA 3AYHB 5IYCG 2ASJA 3BQ0A 3JSLA 2DWCA 1RJPA 5EWFA 1GSHA 3WO1A 5H80A 2R7LA 2WYOA 4IR1A 1EHIA 4HR7A 4A3GG 1JDEA 5KG3A 2OH2A 5HV6A 3GIJA 5BR8H 3T1HH 1GGOA 1RK6A 5BMVF 4OX9H 4ED2A 2W9CB 5J2UF 1T3NA 4EGJA 2R93G 3MR5A 4YB8B 2JA6A 1S9FA 2HVSA 4G3IA 4QW8A 3ORRA 2IBKA 5KG0A 5DG9A 2FMAA 1TWFA 4JV0A 5KFBA 4DR5H 1ZETA 3FDSA 4MV9A 5KFKA 4FBTA 1KBLA 1L2ZA 3HOYG 5HBRB 3OTOH 3ETHA 1K1SA 4YAKB 2R87A 4R8UB 2AGOA 1TAEA 4YR3A 2R6FA 4Q44A 4JV2A 2JEGA 4TUYF 2NU8B 2PVPA 3KHGA 3JRWA 3G6YA 4BXXG 2DIKA 3U9TA 3PO2G 1IBLH 3RIZA 3Q8SB 2AQ4A 5IYDG 1DGSA 5CA0F 4DLKA 2W8KA 2JA7A 3TIIA 3OSNA 2UXBH 4IWXA 3BA8A 2W8LA 3BG5A 3C0FB 2QK4A 1S68A 5KG7A 5KFYA 1K1QA 5EZYF 2VQFH 3GIDA 2C2EA 3WNZA 1GYFA 1IOWA 2R7NA 3N43B 5F9NA 4UCVA 4UCUA 4RNNA 2W6ZA 4A3EG 4U7CA 2VPQA 4A3FG 1N32H 3HKZA 2R92G 4ZHQF 5DG7A 5FLMG 4ECTA 4FS2A 3HOWG 1EUDB 5DGBA 3JSNA 2FPPB 2ATLA 4BBRG 1GLVA 5KFRA 3N40P 4QWEA 2YCHA 3G8CA 3H20A 4YAJB 3BABA 2R86A 2AGPA 4C5AA 2VQEH 4NLGA 4DL6A 4O3RA 4JI1H 4X64H 2WAQA 4Q43A 4L1KA 1Z2PX 1SYXB 3V6JA 3GLKA 3BA9A 1BGWA 4DUYH 2XD4A 2Q2UA 2YS7A 3RB0A 1AUXA 1TWHA 1KJ8A 3OSPA 1X9NA 2RGVA 4JI2H 3RV4A 3KHRA 4DR4H 1IOVA 3PZPA 2W9BA 2XGQA 2X0SA 4FS1A 4YR2A 3RF2A 5KFMA 2ASDA 3DF7A 3GTJA 3FKIA 5T14A 5D1OA 2CQYA 1RYRA 3GIQA 2GLTA 1XNRH 4B3TH 3HOUG 4BWSC 4EYHB 5KT2A 5C5JA 3T5KA 2FE3A 2J9GA 3KTMA 3L2PA 4NXMH 5KFSA 1C30A 2Y0SA 3RAQA 2VQDA 5LOVF 4ED6A 2GPWA 4JYAH 1TA8A 4RB3C 2UVWA 2OWOA 2HVQA 5LP6F 1BXRA 2E2HA 4J9OA 4DL7A 3MR2A 4XYLB 3JRXA 5KFVA 3NGDA 2DLNA 4MV1A 5KG4A 4LSXA 2R7KA 5KFUA 2ZDQA 2W9CA 4ME6A 4C5BA 3UFXB 4LFAH 2C22A 5KFAA 4MV8A 4J9LA 3K3VA 5JVDF 5KFGA 2PMZE 1UC8A 4WD3A 5JQWA 4GC6A 1W93A 4ED0A 1ZQ7A 4R8UA 5KFQA 3SE7A 4MTDA 2CKZB 2R7ZA 3V4SA 4ZOLF 1PK8A 3GILA 3TQ1A 3I4MG 3PW4A 5FPOA 4ECYA 1Y1WA 4UCTA 1MZBA 4LSAA 3GV5B 3R23A 5LL6b 1BNCA 4EBDA 4IR9A 3CQZA 3GIIA 3H40A 5KFCA 2FPGB 1KJIA 3KXYT 4RZQA 4RZRA 3RBEA 1ZHSA 1E4GT 4EBCA 2P0AA 2UVVA 4XX0B 5DG8A 4DL3A 4JI3H 1Y1VG 3MR3A 2VPSA 5IYZF 4DV5H 1XNQH 2UXCH 3JZIA 2RF4A 2XCPA 3HOXG 4XYMB 1I7LA 4I4TF 4Q0YA 1GSOA 4DV6H 5IT9W 5KFLA 5A2QW 3MWDA 3H0GA 1RJQA 5KFZA 4LF5H 5LMNH 2B63A 2W6MA 1JX4A 2J6TA 5C4XG 4BY1G 4FU0A 1T36A 3GV8B 3V6KA 2I80A 4XZ3B 3WO0A 2JEIA 3L4KA 4GC7A 3Q1KA 1KC7A 3QZ8A 3MFIA 3PVXA 3PW0A 3PW5A 2OLSA 4M7EA 1DV2A 4HNVA 3HXLA 4ZQIA 3RFCA 4O3OA 3TINA 4EBEA 4ECWA 1W96A 4UFZA 4EFBA 1S97A 2HJWA
chains in the Genus database with same CATH topology
1OWTA 2FK2A 2FK3A 2FJZA 2FK1A 4PWQA 3KTMA 2M05A 2FMAA 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWT A;  2FK2 A;  2FK3 A;  2FJZ A;  2FK1 A;  4PWQ A;  3KTM A;  2M05 A;  2FMA A;  2FKL A; 
#chains in the Genus database with same CATH topology
 3FKI G;  1B33 N;  2KSW A;  2IP4 A;  4DV4 H;  3K3P A;  4DR6 H;  3GQC A;  5KFT A;  4PWQ A;  4DUZ H;  5KG5 A;  3U9S A;  1ZHQ A;  1DIK A;  4IAJ A;  4E4T A;  2V9W A;  1XDN A;  1B6R A;  5DQG A;  1VBG A;  4MTE A;  4X62 H;  4DR1 H;  1VKZ A;  4PDB A;  3RB6 A;  2VR1 A;  4RUC A;  1M6V A;  4Y8V B;  4QWD A;  1KJJ A;  1FVI A;  3HOZ G;  1JKJ B;  2I87 A;  2V59 A;  4HNT A;  1DV1 A;  4MAM A;  4TQR A;  3G6X A;  2C35 B;  1S0N A;  3F8N A;  1HR0 H;  4LFB H;  1R9T A;  2YS6 A;  2YW2 A;  5DQI A;  4JI5 H;  3GTL A;  2YRW A;  5JVL A;  4J9Q A;  1WSC A;  3GTQ A;  1EYZ A;  2W57 A;  2YRX A;  4YR0 A;  4QIW E;  3J80 W;  3G6V A;  4O4H F;  3RB4 A;  1KJQ A;  3ETJ A;  1S0O A;  3TIG A;  2VA2 A;  4A3B G;  2R8K A;  1FKA H;  3R5H A;  3LP8 A;  5KFD A;  2V4Q A;  2R7Z G;  2W6N A;  4AYB A;  3UQ8 A;  2VUM A;  5KT5 A;  4JI0 H;  5KT3 A;  4O3P A;  5L9X A;  3N42 B;  1O75 A;  4HNU A;  2YYA A;  4QWB A;  4YQW A;  2RDJ A;  1N48 A;  1WR2 A;  2C00 A;  4A3K G;  4DV7 H;  3K5I A;  4RNM A;  5KFN A;  3GIM A;  2UUB H;  1J5E H;  4B3M H;  3VPD A;  3V6H A;  1HNW H;  5BPF A;  2R7M A;  5EWE A;  3HBL A;  1I50 A;  4QWC A;  3RAX A;  2WB1 E;  5KG1 A;  3KHH A;  1VAJ A;  4DR2 H;  1N36 H;  1M7J A;  4MV3 A;  2QYZ A;  2SCU B;  3HOV G;  1V9P A;  2R84 A;  4ECX A;  3RV3 A;  1SEI A;  1K83 A;  1E4F T;  4UCS A;  3MR6 A;  1N56 A;  2ZDH A;  5KG2 A;  3RBD A;  3Q8R B;  2UUA H;  3PR5 B;  4B3S H;  3H0G G;  4X66 H;  2R8I A;  3H4D A;  2J6S A;  5KFF A;  2JA8 G;  1SCU B;  2C2D A;  4ETS A;  3M9M B;  3BQ1 A;  2ALZ A;  5KT7 A;  2JA6 G;  3H3V H;  2FK3 A;  5J2T F;  1BJT A;  4RU9 A;  4QWA A;  2GPS A;  2ZDG A;  3BAA A;  5DGA A;  2FKL A;  3QZ7 A;  2V4R A;  3H4B A;  1RJR A;  1JLL B;  5C1O A;  2VA3 A;  4I55 F;  5C1P A;  2R82 A;  4O4L F;  3OHA A;  4J9S A;  2JEJ A;  5I47 A;  5IP9 G;  3ORQ A;  2UVR A;  2WE6 A;  4IZO A;  5CB4 F;  1KJ9 A;  1WCM A;  4YHH H;  2XCL A;  2WTF A;  1Y1W G;  4A3D G;  4RAZ A;  1Z2O X;  5LA6 F;  4DR7 H;  2NVY A;  3IN5 A;  4EFE A;  3LWB A;  4DV2 H;  4ECZ A;  5FJ8 G;  2PBZ A;  3EYY A;  4LMY A;  3J81 W;  3BQ2 A;  2W6O A;  4DV1 H;  1S0M A;  4O3Q A;  1HNX H;  4K0K H;  1WH2 A;  5DQH A;  4ED1 A;  2JA7 G;  4LF4 H;  4O2B F;  1T94 A;  3GIP A;  2HGS A;  4JI8 H;  4O3S A;  2UXD H;  2XIG A;  5KT4 A;  3HB9 A;  1CS0 A;  2FP4 B;  5L1K A;  1XMQ H;  4GKJ H;  4F4Y A;  1A9X A;  4CC6 A;  4ECV A;  2R8H A;  4KHP H;  4APM A;  5IWA H;  4JI4 H;  5EWG A;  4F4W A;  4EYI B;  1E4E B;  3HKZ E;  4J9N A;  4ECR A;  4HQ6 A;  3PW2 A;  4JV1 A;  1B6S A;  4FBU A;  5F9L A;  5KFH A;  2MCT A;  3OHB A;  5DLG A;  3T1Y H;  2IA6 A;  1Y14 B;  2W9A A;  5BPH A;  3TQT A;  3EPI A;  4LH7 A;  3T5H A;  4MA5 A;  2BQR A;  2W9B B;  4RB2 C;  3T5L A;  2XCA A;  3MJF A;  5LMU H;  2WAQ E;  2FLP A;  3VMM A;  3RUP A;  4YJ2 F;  4B3R H;  3R5F A;  2W7O A;  4GLX A;  3GTP A;  1EZ1 A;  2RDI A;  2ZJT A;  1C3O A;  4O4I F;  4R7R A;  4QJF A;  3RTX A;  2E5L H;  4AQY H;  2FLN A;  1I7N A;  4ED7 A;  4DL5 A;  4A93 G;  1Z2N X;  4F4X A;  2CZG A;  4DL2 A;  4UCO A;  3K5H A;  1CQI B;  3MWE A;  4X65 H;  2DPI A;  4IRC A;  2W70 A;  4NXN H;  2YU9 A;  2CW8 A;  4U6P A;  3OUU A;  4RB0 A;  3M9N B;  3GTG A;  4A2B A;  5GON F;  5KFW A;  5KX5 F;  3PO3 G;  1PX2 A;  5IYB G;  1TWG A;  4A3J G;  2Y0S E;  2FJZ A;  2FK1 A;  4BBS G;  2BQ3 A;  3GTM A;  4EGQ A;  4MA0 A;  1ULZ A;  1S03 G;  3Q8P B;  1AUV A;  1TWC A;  4Q45 A;  3RGX A;  4JUZ A;  2M05 A;  3KHL A;  3N41 B;  4IHJ F;  4IRK A;  2W71 A;  4FM9 A;  2R8G A;  2UU9 H;  2NU9 B;  4JI6 H;  2YZM A;  3VPC A;  4J9M A;  2PMZ A;  2V5A A;  3L4J A;  4GKK H;  1UNN C;  4I50 F;  4IRD A;  3Q2O A;  4YBZ B;  2NUA B;  1A0I A;  5JUM A;  3T5J A;  5FD5 A;  5KFX A;  5L1L A;  1V51 A;  2JA5 A;  1WCM G;  1TWA A;  2UUC H;  3BJY A;  3J7A K;  1JDB B;  5FLX W;  2ZM6 H;  3PR4 A;  1OWT A;  4TQS A;  5CA1 F;  5L1J A;  4A3M G;  4YP3 A;  3Q8Q B;  5D1P A;  4I7H A;  5K2M A;  4ECQ A;  4UCR A;  1IBK H;  2W6Q A;  3FMA A;  1Y1V A;  2R85 A;  3N8D A;  5KFJ A;  5CAE B;  4EG0 A;  4F50 A;  1XMO H;  4ED8 A;  4Q8E A;  3M9O B;  5C44 G;  2ASL A;  4QW9 A;  1M0W A;  3M4I A;  2IMW P;  3R5X A;  2FLL A;  4YY3 H;  1JXL A;  2J6U A;  2W6P A;  4J0M A;  4DL4 A;  5JH7 F;  2R93 A;  3EPG A;  4MV4 A;  5DLF A;  4DV3 H;  1P8L A;  2NU7 B;  4A2A A;  2XC9 A;  3KAL A;  5EOY A;  4MV6 A;  1E4E A;  1AN7 A;  2JEF A;  2AGQ A;  4YJ3 F;  3PW7 A;  3GIK A;  1EUC B;  2B63 G;  3RJ0 A;  4J9R A;  1VBH A;  3E5N A;  4EEY A;  2BR0 A;  4ZI7 F;  5IP7 G;  5C3E G;  2YL2 A;  2V58 A;  3PN1 A;  3QFF A;  3N6X A;  3GV7 B;  5D8D A;  2VUG A;  1CQJ B;  3SI8 A;  4O2A F;  4LF7 H;  3RB3 A;  1B04 A;  4TV9 F;  2HHH H;  1I6U A;  2WDT A;  4IWY A;  4WBN F;  3I4N G;  4DV0 H;  4J9K A;  4BY7 G;  4F4Z A;  2CW7 A;  3MFH A;  2NVX A;  2I8C A;  4A3L G;  4RNO A;  4J9P A;  1GSA A;  2NU6 B;  5L1I A;  2C28 A;  3MWM A;  5KFP A;  2R8J A;  2FB9 A;  4RB1 A;  1GO3 E;  3GTK A;  2FK2 A;  2PN1 A;  3IG0 A;  3CVZ A;  5FPR A;  1SFO A;  2HVR A;  4M9U A;  1VS0 A;  5KFO A;  3KAK A;  5KG6 A;  4ED3 A;  1S10 A;  2DZD A;  2Q2T A;  4JV5 H;  2VOB A;  4EEQ A;  2O03 A;  5LYJ F;  4A3I G;  2UVU A;  1FJG H;  4HYK A;  1JIH A;  2BQU A;  4JI7 H;  3N44 B;  4LH6 A;  2F4V H;  4TV8 F;  3I12 A;  2R92 A;  4RAY A;  4LF6 H;  2C2R A;  1I3Q A;  2W7P A;  4LF8 H;  4A3C G;  1CE8 A;  2RGR A;  4QIW A;  5KT6 A;  4RUA A;  1KEE A;  1N34 H;  3RGZ A;  2E2I A;  3LML A;  1IBM H;  5KKN B;  3VPB A;  2XGP A;  4MV7 A;  2AU0 A;  3JAM W;  3V4Z A;  2FPI B;  3KAJ A;  4LFC H;  4CC5 A;  2JA5 G;  4C5C A;  5KFE A;  5KFI A;  1HNZ H;  4AYB E;  5D1O B;  4Q8F A;  1N33 H;  5C8Y F;  4DR3 H;  2YZG A;  3GTO A;  1I94 H;  1V4Y A;  5FD6 A;  4ECU A;  1UC9 A;  4LF9 H;  4ECS A;  1RYS A;  2VUM G;  2DPJ A;  1M0T A;  1RK5 A;  2WB1 A;  3OUZ A;  5LXT F;  4C2M A;  5EDW A;  2YZN A;  4O3N A;  3AYH B;  5IYC G;  2ASJ A;  3BQ0 A;  3JSL A;  2DWC A;  1RJP A;  5EWF A;  1GSH A;  3WO1 A;  5H80 A;  2R7L A;  2WYO A;  4IR1 A;  1EHI A;  4HR7 A;  4A3G G;  1JDE A;  5KG3 A;  2OH2 A;  5HV6 A;  3GIJ A;  5BR8 H;  3T1H H;  1GGO A;  1RK6 A;  5BMV F;  4OX9 H;  4ED2 A;  2W9C B;  5J2U F;  1T3N A;  4EGJ A;  2R93 G;  3MR5 A;  4YB8 B;  2JA6 A;  1S9F A;  2HVS A;  4G3I A;  4QW8 A;  3ORR A;  2IBK A;  5KG0 A;  5DG9 A;  2FMA A;  1TWF A;  4JV0 A;  5KFB A;  4DR5 H;  1ZET A;  3FDS A;  4MV9 A;  5KFK A;  4FBT A;  1KBL A;  1L2Z A;  3HOY G;  5HBR B;  3OTO H;  3ETH A;  1K1S A;  4YAK B;  2R87 A;  4R8U B;  2AGO A;  1TAE A;  4YR3 A;  2R6F A;  4Q44 A;  4JV2 A;  2JEG A;  4TUY F;  2NU8 B;  2PVP A;  3KHG A;  3JRW A;  3G6Y A;  4BXX G;  2DIK A;  3U9T A;  3PO2 G;  1IBL H;  3RIZ A;  3Q8S B;  2AQ4 A;  5IYD G;  1DGS A;  5CA0 F;  4DLK A;  2W8K A;  2JA7 A;  3TII A;  3OSN A;  2UXB H;  4IWX A;  3BA8 A;  2W8L A;  3BG5 A;  3C0F B;  2QK4 A;  1S68 A;  5KG7 A;  5KFY A;  1K1Q A;  5EZY F;  2VQF H;  3GID A;  2C2E A;  3WNZ A;  1GYF A;  1IOW A;  2R7N A;  3N43 B;  5F9N A;  4UCV A;  4UCU A;  4RNN A;  2W6Z A;  4A3E G;  4U7C A;  2VPQ A;  4A3F G;  1N32 H;  3HKZ A;  2R92 G;  4ZHQ F;  5DG7 A;  5FLM G;  4ECT A;  4FS2 A;  3HOW G;  1EUD B;  5DGB A;  3JSN A;  2FPP B;  2ATL A;  4BBR G;  1GLV A;  5KFR A;  3N40 P;  4QWE A;  2YCH A;  3G8C A;  3H20 A;  4YAJ B;  3BAB A;  2R86 A;  2AGP A;  4C5A A;  2VQE H;  4NLG A;  4DL6 A;  4O3R A;  4JI1 H;  4X64 H;  2WAQ A;  4Q43 A;  4L1K A;  1Z2P X;  1SYX B;  3V6J A;  3GLK A;  3BA9 A;  1BGW A;  4DUY H;  2XD4 A;  2Q2U A;  2YS7 A;  3RB0 A;  1AUX A;  1TWH A;  1KJ8 A;  3OSP A;  1X9N A;  2RGV A;  4JI2 H;  3RV4 A;  3KHR A;  4DR4 H;  1IOV A;  3PZP A;  2W9B A;  2XGQ A;  2X0S A;  4FS1 A;  4YR2 A;  3RF2 A;  5KFM A;  2ASD A;  3DF7 A;  3GTJ A;  3FKI A;  5T14 A;  5D1O A;  2CQY A;  1RYR A;  3GIQ A;  2GLT A;  1XNR H;  4B3T H;  3HOU G;  4BWS C;  4EYH B;  5KT2 A;  5C5J A;  3T5K A;  2FE3 A;  2J9G A;  3KTM A;  3L2P A;  4NXM H;  5KFS A;  1C30 A;  2Y0S A;  3RAQ A;  2VQD A;  5LOV F;  4ED6 A;  2GPW A;  4JYA H;  1TA8 A;  4RB3 C;  2UVW A;  2OWO A;  2HVQ A;  5LP6 F;  1BXR A;  2E2H A;  4J9O A;  4DL7 A;  3MR2 A;  4XYL B;  3JRX A;  5KFV A;  3NGD A;  2DLN A;  4MV1 A;  5KG4 A;  4LSX A;  2R7K A;  5KFU A;  2ZDQ A;  2W9C A;  4ME6 A;  4C5B A;  3UFX B;  4LFA H;  2C22 A;  5KFA A;  4MV8 A;  4J9L A;  3K3V A;  5JVD F;  5KFG A;  2PMZ E;  1UC8 A;  4WD3 A;  5JQW A;  4GC6 A;  1W93 A;  4ED0 A;  1ZQ7 A;  4R8U A;  5KFQ A;  3SE7 A;  4MTD A;  2CKZ B;  2R7Z A;  3V4S A;  4ZOL F;  1PK8 A;  3GIL A;  3TQ1 A;  3I4M G;  3PW4 A;  5FPO A;  4ECY A;  1Y1W A;  4UCT A;  1MZB A;  4LSA A;  3GV5 B;  3R23 A;  5LL6 b;  1BNC A;  4EBD A;  4IR9 A;  3CQZ A;  3GII A;  3H40 A;  5KFC A;  2FPG B;  1KJI A;  3KXY T;  4RZQ A;  4RZR A;  3RBE A;  1ZHS A;  1E4G T;  4EBC A;  2P0A A;  2UVV A;  4XX0 B;  5DG8 A;  4DL3 A;  4JI3 H;  1Y1V G;  3MR3 A;  2VPS A;  5IYZ F;  4DV5 H;  1XNQ H;  2UXC H;  3JZI A;  2RF4 A;  2XCP A;  3HOX G;  4XYM B;  1I7L A;  4I4T F;  4Q0Y A;  1GSO A;  4DV6 H;  5IT9 W;  5KFL A;  5A2Q W;  3MWD A;  3H0G A;  1RJQ A;  5KFZ A;  4LF5 H;  5LMN H;  2B63 A;  2W6M A;  1JX4 A;  2J6T A;  5C4X G;  4BY1 G;  4FU0 A;  1T36 A;  3GV8 B;  3V6K A;  2I80 A;  4XZ3 B;  3WO0 A;  2JEI A;  3L4K A;  4GC7 A;  3Q1K A;  1KC7 A;  3QZ8 A;  3MFI A;  3PVX A;  3PW0 A;  3PW5 A;  2OLS A;  4M7E A;  1DV2 A;  4HNV A;  3HXL A;  4ZQI A;  3RFC A;  4O3O A;  3TIN A;  4EBE A;  4ECW A;  1W96 A;  4UFZ A;  4EFB A;  1S97 A;  2HJW A; 
#chains in the Genus database with same CATH homology
 1OWT A;  2FK2 A;  2FK3 A;  2FJZ A;  2FK1 A;  4PWQ A;  3KTM A;  2M05 A;  2FMA A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...