2FJZA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
b'EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fjzA00
2FKLA 2FK1A 2M05A 2FJZA 3KTMA 2FK2A 1OWTA 4PWQA 2FMAA 2FK3A
chains in the Genus database with same CATH superfamily
2DWCA 4RB3C 3F8NA 2W57A 4DR3H 3BABA 3VPDA 2GPSA 4XYLB 2QYZA 5A2QW 3J81W 4JV0A 5BPFA 5IP9G 3GTQA 5KT6A 4YBZB 2R86A 2YRWA 1B6RA 4MAMA 2OH2A 4DR1H 4C2MA 2W9CB 2UXDH 4LMYA 4O4LF 3UQ8A 3ORRA 4O3OA 4ED3A 2VQDA 5DGAA 1AN7A 4RB1A 1ZETA 4RUAA 4DL2A 2CZGA 3KHLA 4GKJH 3LP8A 4WBNF 5LOVF 2XD4A 2J6TA 3OSNA 2W9AA 4OX9H 5KX5F 5DGBA 3RBEA 2R7NA 4ZHQF 3RAXA 1DV2A 4YY3H 4ECRA 1FJGH 1SEIA 4ED0A 2Q2TA 3PO2G 4EBCA 3JSNA 2I87A 5C1PA 3L4JA 4FS2A 4RUCA 1N36H 2AGOA 4G3IA 5DG7A 2W6OA 2FE3A 5DQGA 2YL2A 5KFGA 4MV4A 3MR5A 5KFJA 5C3EG 4NXNH 3I4NG 5JUMA 1DGSA 2BR0A 5LXTF 2W9BA 4QJFA 4ECXA 1S0NA 4JI6H 1VKZA 4DR5H 4ECTA 3H40A 2NVXA 2HVSA 3MR3A 3N44B 3FMAA 5KFNA 4MV9A 3CVZA 3GTMA 3V4SA 4LFCH 5C44G 5FD5A 2FLNA 1Y1WA 3TIGA 4A3MG 1IBKH 2R7KA 5KFVA 3GIJA 1ZHSA 5IWAH 5FD6A 3WO1A 4MV8A 4RZQA 2VUMA 4JV5H 2JA6A 2NUAB 4DV3H 3BQ1A 2R85A 4MTDA 3KALA 1M0WA 1T36A 2FK2A 2UVVA 2B63G 3G6XA 3KXYT 5JH7F 2HJWA 3Q1KA 2W9BB 4RB0A 1T3NA 4ZOLF 3RJ0A 4MV3A 1GSAA 4LH6A 2JA5G 2XCPA 1SYXB 3U9TA 4JI4H 3HOUG 3GTOA 1IOVA 2R92A 4Q8EA 2YYAA 2FMAA 5KG7A 1JDBB 5KG2A 2JEJA 5KFKA 3PW0A 2FB9A 4WD3A 2YZMA 5KFPA 1AUXA 5H80A 5DG8A 4YQWA 5L1KA 4XX0B 4XYMB 2W8LA 1HR0H 2JA7A 4J9LA 3T5HA 4JI0H 4GLXA 4UCVA 2R8JA 4KHPH 4DUYH 3EYYA 4ME6A 4B3RH 4A2BA 4YJ3F 3BQ2A 2R8HA 1S9FA 3RB3A 3JAMW 2XGPA 1KJ8A 2FLLA 1ZHQA 1WCMA 1T94A 3HOWG 4Y8VB 4DV0H 2W6NA 3LWBA 4TV9F 1GLVA 3MR2A 2CKZB 1KBLA 3KTMA 2DIKA 5KFOA 1E4FT 3OUZA 5EOYA 4DV6H 1S03G 4K0KH 4Q43A 5L9XA 5LYJF 5EWEA 4J9RA 4F4YA 5F9LA 4O3PA 4YR3A 3MJFA 4QW9A 1IBMH 3J7AK 2HVQA 3TIIA 4TV8F 2VQFH 4J9OA 1N56A 3KHRA 5JVDF 2BQUA 4QWDA 3H4DA 4F50A 2XC9A 3SI8A 1BXRA 4C5AA 2DLNA 2MCTA 1HNXH 3V6KA 1Z2OX 3PZPA 5KFXA 4J9QA 2R7MA 5T14A 1RK6A 4DUZH 1I94H 4I4TF 2J9GA 3K5IA 1RYRA 4ETSA 3I4MG 4YP3A 1EHIA 1RK5A 2W9CA 5LP6F 4RNOA 3MWMA 3MWDA 2R8GA 2W71A 3DF7A 4BBRG 4YR2A 3GIIA 2CW7A 4O3RA 1JX4A 1UNNC 3HKZA 4MTEA 4QIWA 4X65H 4QWEA 4EGQA 5KG3A 1VS0A 4RNNA 2O03A 1GYFA 2C00A 5CA1F 4ED1A 4ECSA 2YZGA 5HV6A 5KT3A 5KFRA 2WTFA 4ECYA 2W6ZA 3HKZE 3HB9A 5KT5A 5LMNH 4J9NA 2DPIA 3H3VH 4JV2A 5FJ8G 5EWFA 2Q2UA 1B6SA 1DV1A 1TWGA 2VR1A 3T1HH 4MV6A 3JSLA 2V9WA 1KJQA 3QFFA 4Q45A 1EUCB 4O3SA 2RF4A 4Q44A 1EYZA 5IYCG 3RAQA 2ZJTA 2CQYA 5DQHA 3RIZA 2GLTA 2R84A 5CAEB 4PWQA 1WH2A 2VPSA 2C2EA 4HNVA 4IR9A 4O3NA 3BJYA 4DL3A 3Q2OA 4J9SA 1Y1VG 1K1QA 2HHHH 2JEFA 3JRWA 1W96A 2W7PA 5EDWA 4UCUA 3VMMA 4CC5A 4QWAA 4F4XA 5C8YF 4DL4A 5F9NA 1GGOA 3T5LA 3FKIA 3I12A 4LF9H 2NU7B 3GV8B 4QW8A 3MR6A 3N6XA 5KFAA 4EYHB 3GIKA 4DL5A 2J6UA 4NXMH 2B63A 5D8DA 2M05A 4UCOA 1K1SA 1I7NA 2OLSA 3T5JA 4A3KG 2YS7A 5EZYF 3RGZA 3L2PA 4HYKA 4LF4H 1M6VA 1UC9A 4GC7A 1S68A 3C0FB 3H0GG 3FDSA 3N40P 2FPPB 2VOBA 2NVYA 3WO0A 4BWSC 4B3TH 5KFUA 2AGPA 1KJIA 5DLFA 3TINA 4BY1G 1SCUB 2ZDHA 3BG5A 2HGSA 3PO3G 5KFZA 1JIHA 1UC8A 4I7HA 5GONF 5CA0F 5IYDG 3GIPA 4BY7G 1W93A 3M4IA 4A3CG 5C4XG 2R87A 1BNCA 5KFHA 5L1IA 5HBRB 3OTOH 3V6JA 5IYZF 5K2MA 4IAJA 1J5EH 5KFBA 1OWTA 4X66H 2FLPA 4XZ3B 4J0MA 2ZM6H 1A9XA 1TWHA 4IRKA 2JEGA 1X9NA 2P0AA 2FP4B 4RNMA 1JDEA 1KJJA 2PN1A 2E2HA 2ASJA 3RB6A 1JKJB 5KG6A 3SE7A 3R5FA 1TWCA 5IP7G 3Q8PB 3R23A 4FU0A 4IRDA 2UU9H 4ED7A 1E4GT 3GIQA 5C5JA 4JI7H 5DG9A 1C3OA 2C28A 4JI8H 3MWEA 1I6UA 3PVXA 3BA9A 5LL6b 5L1JA 3PN1A 1WR2A 1GSHA 2W70A 2UUBH 1KEEA 1TAEA 3RV4A 1S0MA 1R9TA 2NU8B 5KFIA 4A3GG 4I50F 2R8KA 1Y14B 4BXXG 2WB1A 2UVWA 4MA0A 4O2AF 4UCTA 3M9MB 2X0SA 2WDTA 2Y0SA 3N8DA 1Y1WG 4AYBA 2IA6A 4LSXA 3R5XA 4TUYF 5KFQA 4U7CA 4GC6A 2W6QA 3VPCA 3NGDA 2VUMG 4GKKH 3G8CA 5KT2A 4DV2H 3WNZA 5JVLA 5KKNB 2Y0SE 2ZDQA 2R8IA 4DL7A 4B3MH 4DR7H 2JEIA 4E4TA 1VAJA 4C5CA 4DV4H 3BA8A 3GQCA 5FLMG 1CQIB 3PW4A 4BBSG 4APMA 5KFCA 1TWAA 3HOVG 4IRCA 2R92G 2F4VH 2JA8G 1Z2NX 5J2UF 4X64H 4TQSA 1AUVA 2UUCH 3GTKA 3TQTA 3L4KA 3HXLA 4A3LG 4EBEA 2ASDA 1CQJB 4LF8H 2C35B 1KC7A 4A3EG 4O4IF 3ORQA 4A3FG 2IMWP 4PDBA 1I3QA 4EEQA 3N41B 1XMOH 4JV1A 1PK8A 5FLXW 2UUAH 2XCLA 3RTXA 4DR2H 1ULZA 5L1LA 2BQRA 3OHBA 4FBTA 2NU6B 2SCUB 1RJRA 1WCMG 1I50A 4U6PA 3RUPA 3J80W 4X62H 4NLGA 3GTJA 2ALZA 1A0IA 4QIWE 4EYIB 3N42B 2I8CA 3KAKA 2FPIB 2RDJA 2V59A 4Q0YA 5KFTA 4O2BF 2W6PA 2C22A 1JXLA 2R7ZG 4LFBH 5D1OA 4MA5A 4QWCA 4ED8A 4A3DG 1BGWA 3MFIA 4YHHH 4YAJB 4DV5H 3BQ0A 1N33H 1MZBA 3KHGA 1N48A 1ZQ7A 3VPBA 4A3IG 3T1YH 4J9KA 2QK4A 3OUUA 4ECZA 4LF6H 4QWBA 1PX2A 3H0GA 2R93G 3GLKA 4DV1H 3T5KA 1IBLH 2R7ZA 2WAQA 3HOZG 2E5LH 3V4ZA 3EPGA 2PBZA 3R5HA 3U9SA 5IYBG 3OSPA 2V5AA 4ZQIA 4IWYA 2WAQE 2WYOA 2ATLA 5KFEA 4J9PA 5BMVF 5DQIA 4DR4H 2XIGA 3HBLA 4FBUA 2PVPA 4EBDA 3QZ7A 1IOWA 4I55F 3RF2A 4EFEA 3K3VA 4J9MA 4FM9A 5D1OB 4ECQA 1FVIA 1B04A 3G6VA 2J6SA 4F4WA 4ED6A 2ZDGA 3LMLA 2DZDA 4JI1H 2IBKA 3PW2A 5JQWA 2JA5A 3M9NB 2XCAA 4LF7H 1KJ9A 2HVRA 3PR4A 3MFHA 4YJ2F 4FS1A 5CB4F 3V6HA 3AYHB 4EGJA 2YRXA 5FPRA 2FJZA 2WE6A 3GV5B 1N32H 4ZI7F 1V51A 1VBHA 2CW8A 4A3BG 4MV1A 1M7JA 3Q8RB 3RBDA 4UCRA 5J2TF 3Q8SB 4IHJF 2R82A 5KG4A 3KAJA 1XDNA 5KT4A 3ETJA 3PR5B 1CS0A 2UVRA 4R7RA 5KG0A 4YAKB 3GIMA 3RB0A 1N34H 4RB2C 5KFMA 5BPHA 2FK1A 3CQZA 4JYAH 3RB4A 2ASLA 1RJPA 1V4YA 2PMZA 2YS6A 3K5HA 2AU0A 1S10A 4UFZA 1JLLB 4HQ6A 2V4RA 1L2ZA 2AQ4A 5KFLA 4EG0A 4A93G 1XMQH 5KFYA 2E2IA 4JI2H 3FKIG 2NU9B 4ECUA 5FPOA 2PMZE 2FK3A 5EWGA 1S97A 2VPQA 2GPWA 5KT7A 3EPIA 1GSOA 1S0OA 5KG1A 1XNQH 1GO3E 1EUDB 2R7LA 5KG5A 3BAAA 3QZ8A 3GTLA 3OHAA 2FPGB 1XNRH 4M7EA 1SFOA 4IR1A 5I47A 3M9OB 4F4ZA 1O75A 3JRXA 3RFCA 2FKLA 5DLGA 5KFFA 4UCSA 4HR7A 4HNTA 3IG0A 4RAZA 1V9PA 1E4EA 2W8KA 4DR6H 2RGVA 3UFXB 2R6FA 3JZIA 2IP4A 4LH7A 3GILA 2WB1E 3H4BA 1HNZH 2RGRA 4RU9A 3KHHA 3GTPA 2JA6G 2UXBH 3HOYG 2YCHA 1Z2PX 4CC6A 4LSAA 4EEYA 2VA2A 3Q8QB 3PW5A 4AYBE 1TA8A 4R8UA 4LFAH 2V4QA 1WSCA 2C2DA 4M9UA 4JI5H 1VBGA 4O3QA 2DPJA 2AGQA 3GIDA 2UVUA 4IZOA 1M0TA 1B33N 4YR0A 3IN5A 2BQ3A 4JI3H 3K3PA 2XGQA 3GV7B 3TQ1A 4Q8FA 4TQRA 2VQEH 1K83A 4MV7A 5D1PA 2YZNA 2RDIA 1C30A 2KSWA 3H20A 4O4HF 5LMUH 4AQYH 2V58A 1FKAH 1E4EB 2JA7G 4A2AA 4A3JG 3PW7A 3RV3A 5IT9W 5KFDA 3ETHA 4YB8B 4HNUA 1DIKA 3HOXG 2R93A 4LF5H 2C2RA 4RZRA 1TWFA 2I80A 4JUZA 4EFBA 2YU9A 4DLKA 1Y1VA 3E5NA 4R8UB 5BR8H 4ECWA 4ED2A 4L1KA 5KFSA 3RGXA 2UXCH 2W6MA 2VUGA 1RJQA 1I7LA 3G6YA 5LA6F 1BJTA 1CE8A 4IWXA 2OWOA 4C5BA 1EZ1A 3GTGA 4DV7H 4DL6A 1RYSA 1HNWH 2YW2A 2VA3A 4B3SH 4RAYA 3N43B 2W7OA 4ECVA 5KFWA 1P8LA 5C1OA
chains in the Genus database with same CATH topology
2FKLA 2FK1A 2M05A 2FJZA 3KTMA 2FK2A 1OWTA 4PWQA 2FMAA 2FK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKL A;  2FK1 A;  2M05 A;  2FJZ A;  3KTM A;  2FK2 A;  1OWT A;  4PWQ A;  2FMA A;  2FK3 A; 
#chains in the Genus database with same CATH topology
 2DWC A;  4RB3 C;  3F8N A;  2W57 A;  4DR3 H;  3BAB A;  3VPD A;  2GPS A;  4XYL B;  2QYZ A;  5A2Q W;  3J81 W;  4JV0 A;  5BPF A;  5IP9 G;  3GTQ A;  5KT6 A;  4YBZ B;  2R86 A;  2YRW A;  1B6R A;  4MAM A;  2OH2 A;  4DR1 H;  4C2M A;  2W9C B;  2UXD H;  4LMY A;  4O4L F;  3UQ8 A;  3ORR A;  4O3O A;  4ED3 A;  2VQD A;  5DGA A;  1AN7 A;  4RB1 A;  1ZET A;  4RUA A;  4DL2 A;  2CZG A;  3KHL A;  4GKJ H;  3LP8 A;  4WBN F;  5LOV F;  2XD4 A;  2J6T A;  3OSN A;  2W9A A;  4OX9 H;  5KX5 F;  5DGB A;  3RBE A;  2R7N A;  4ZHQ F;  3RAX A;  1DV2 A;  4YY3 H;  4ECR A;  1FJG H;  1SEI A;  4ED0 A;  2Q2T A;  3PO2 G;  4EBC A;  3JSN A;  2I87 A;  5C1P A;  3L4J A;  4FS2 A;  4RUC A;  1N36 H;  2AGO A;  4G3I A;  5DG7 A;  2W6O A;  2FE3 A;  5DQG A;  2YL2 A;  5KFG A;  4MV4 A;  3MR5 A;  5KFJ A;  5C3E G;  4NXN H;  3I4N G;  5JUM A;  1DGS A;  2BR0 A;  5LXT F;  2W9B A;  4QJF A;  4ECX A;  1S0N A;  4JI6 H;  1VKZ A;  4DR5 H;  4ECT A;  3H40 A;  2NVX A;  2HVS A;  3MR3 A;  3N44 B;  3FMA A;  5KFN A;  4MV9 A;  3CVZ A;  3GTM A;  3V4S A;  4LFC H;  5C44 G;  5FD5 A;  2FLN A;  1Y1W A;  3TIG A;  4A3M G;  1IBK H;  2R7K A;  5KFV A;  3GIJ A;  1ZHS A;  5IWA H;  5FD6 A;  3WO1 A;  4MV8 A;  4RZQ A;  2VUM A;  4JV5 H;  2JA6 A;  2NUA B;  4DV3 H;  3BQ1 A;  2R85 A;  4MTD A;  3KAL A;  1M0W A;  1T36 A;  2FK2 A;  2UVV A;  2B63 G;  3G6X A;  3KXY T;  5JH7 F;  2HJW A;  3Q1K A;  2W9B B;  4RB0 A;  1T3N A;  4ZOL F;  3RJ0 A;  4MV3 A;  1GSA A;  4LH6 A;  2JA5 G;  2XCP A;  1SYX B;  3U9T A;  4JI4 H;  3HOU G;  3GTO A;  1IOV A;  2R92 A;  4Q8E A;  2YYA A;  2FMA A;  5KG7 A;  1JDB B;  5KG2 A;  2JEJ A;  5KFK A;  3PW0 A;  2FB9 A;  4WD3 A;  2YZM A;  5KFP A;  1AUX A;  5H80 A;  5DG8 A;  4YQW A;  5L1K A;  4XX0 B;  4XYM B;  2W8L A;  1HR0 H;  2JA7 A;  4J9L A;  3T5H A;  4JI0 H;  4GLX A;  4UCV A;  2R8J A;  4KHP H;  4DUY H;  3EYY A;  4ME6 A;  4B3R H;  4A2B A;  4YJ3 F;  3BQ2 A;  2R8H A;  1S9F A;  3RB3 A;  3JAM W;  2XGP A;  1KJ8 A;  2FLL A;  1ZHQ A;  1WCM A;  1T94 A;  3HOW G;  4Y8V B;  4DV0 H;  2W6N A;  3LWB A;  4TV9 F;  1GLV A;  3MR2 A;  2CKZ B;  1KBL A;  3KTM A;  2DIK A;  5KFO A;  1E4F T;  3OUZ A;  5EOY A;  4DV6 H;  1S03 G;  4K0K H;  4Q43 A;  5L9X A;  5LYJ F;  5EWE A;  4J9R A;  4F4Y A;  5F9L A;  4O3P A;  4YR3 A;  3MJF A;  4QW9 A;  1IBM H;  3J7A K;  2HVQ A;  3TII A;  4TV8 F;  2VQF H;  4J9O A;  1N56 A;  3KHR A;  5JVD F;  2BQU A;  4QWD A;  3H4D A;  4F50 A;  2XC9 A;  3SI8 A;  1BXR A;  4C5A A;  2DLN A;  2MCT A;  1HNX H;  3V6K A;  1Z2O X;  3PZP A;  5KFX A;  4J9Q A;  2R7M A;  5T14 A;  1RK6 A;  4DUZ H;  1I94 H;  4I4T F;  2J9G A;  3K5I A;  1RYR A;  4ETS A;  3I4M G;  4YP3 A;  1EHI A;  1RK5 A;  2W9C A;  5LP6 F;  4RNO A;  3MWM A;  3MWD A;  2R8G A;  2W71 A;  3DF7 A;  4BBR G;  4YR2 A;  3GII A;  2CW7 A;  4O3R A;  1JX4 A;  1UNN C;  3HKZ A;  4MTE A;  4QIW A;  4X65 H;  4QWE A;  4EGQ A;  5KG3 A;  1VS0 A;  4RNN A;  2O03 A;  1GYF A;  2C00 A;  5CA1 F;  4ED1 A;  4ECS A;  2YZG A;  5HV6 A;  5KT3 A;  5KFR A;  2WTF A;  4ECY A;  2W6Z A;  3HKZ E;  3HB9 A;  5KT5 A;  5LMN H;  4J9N A;  2DPI A;  3H3V H;  4JV2 A;  5FJ8 G;  5EWF A;  2Q2U A;  1B6S A;  1DV1 A;  1TWG A;  2VR1 A;  3T1H H;  4MV6 A;  3JSL A;  2V9W A;  1KJQ A;  3QFF A;  4Q45 A;  1EUC B;  4O3S A;  2RF4 A;  4Q44 A;  1EYZ A;  5IYC G;  3RAQ A;  2ZJT A;  2CQY A;  5DQH A;  3RIZ A;  2GLT A;  2R84 A;  5CAE B;  4PWQ A;  1WH2 A;  2VPS A;  2C2E A;  4HNV A;  4IR9 A;  4O3N A;  3BJY A;  4DL3 A;  3Q2O A;  4J9S A;  1Y1V G;  1K1Q A;  2HHH H;  2JEF A;  3JRW A;  1W96 A;  2W7P A;  5EDW A;  4UCU A;  3VMM A;  4CC5 A;  4QWA A;  4F4X A;  5C8Y F;  4DL4 A;  5F9N A;  1GGO A;  3T5L A;  3FKI A;  3I12 A;  4LF9 H;  2NU7 B;  3GV8 B;  4QW8 A;  3MR6 A;  3N6X A;  5KFA A;  4EYH B;  3GIK A;  4DL5 A;  2J6U A;  4NXM H;  2B63 A;  5D8D A;  2M05 A;  4UCO A;  1K1S A;  1I7N A;  2OLS A;  3T5J A;  4A3K G;  2YS7 A;  5EZY F;  3RGZ A;  3L2P A;  4HYK A;  4LF4 H;  1M6V A;  1UC9 A;  4GC7 A;  1S68 A;  3C0F B;  3H0G G;  3FDS A;  3N40 P;  2FPP B;  2VOB A;  2NVY A;  3WO0 A;  4BWS C;  4B3T H;  5KFU A;  2AGP A;  1KJI A;  5DLF A;  3TIN A;  4BY1 G;  1SCU B;  2ZDH A;  3BG5 A;  2HGS A;  3PO3 G;  5KFZ A;  1JIH A;  1UC8 A;  4I7H A;  5GON F;  5CA0 F;  5IYD G;  3GIP A;  4BY7 G;  1W93 A;  3M4I A;  4A3C G;  5C4X G;  2R87 A;  1BNC A;  5KFH A;  5L1I A;  5HBR B;  3OTO H;  3V6J A;  5IYZ F;  5K2M A;  4IAJ A;  1J5E H;  5KFB A;  1OWT A;  4X66 H;  2FLP A;  4XZ3 B;  4J0M A;  2ZM6 H;  1A9X A;  1TWH A;  4IRK A;  2JEG A;  1X9N A;  2P0A A;  2FP4 B;  4RNM A;  1JDE A;  1KJJ A;  2PN1 A;  2E2H A;  2ASJ A;  3RB6 A;  1JKJ B;  5KG6 A;  3SE7 A;  3R5F A;  1TWC A;  5IP7 G;  3Q8P B;  3R23 A;  4FU0 A;  4IRD A;  2UU9 H;  4ED7 A;  1E4G T;  3GIQ A;  5C5J A;  4JI7 H;  5DG9 A;  1C3O A;  2C28 A;  4JI8 H;  3MWE A;  1I6U A;  3PVX A;  3BA9 A;  5LL6 b;  5L1J A;  3PN1 A;  1WR2 A;  1GSH A;  2W70 A;  2UUB H;  1KEE A;  1TAE A;  3RV4 A;  1S0M A;  1R9T A;  2NU8 B;  5KFI A;  4A3G G;  4I50 F;  2R8K A;  1Y14 B;  4BXX G;  2WB1 A;  2UVW A;  4MA0 A;  4O2A F;  4UCT A;  3M9M B;  2X0S A;  2WDT A;  2Y0S A;  3N8D A;  1Y1W G;  4AYB A;  2IA6 A;  4LSX A;  3R5X A;  4TUY F;  5KFQ A;  4U7C A;  4GC6 A;  2W6Q A;  3VPC A;  3NGD A;  2VUM G;  4GKK H;  3G8C A;  5KT2 A;  4DV2 H;  3WNZ A;  5JVL A;  5KKN B;  2Y0S E;  2ZDQ A;  2R8I A;  4DL7 A;  4B3M H;  4DR7 H;  2JEI A;  4E4T A;  1VAJ A;  4C5C A;  4DV4 H;  3BA8 A;  3GQC A;  5FLM G;  1CQI B;  3PW4 A;  4BBS G;  4APM A;  5KFC A;  1TWA A;  3HOV G;  4IRC A;  2R92 G;  2F4V H;  2JA8 G;  1Z2N X;  5J2U F;  4X64 H;  4TQS A;  1AUV A;  2UUC H;  3GTK A;  3TQT A;  3L4K A;  3HXL A;  4A3L G;  4EBE A;  2ASD A;  1CQJ B;  4LF8 H;  2C35 B;  1KC7 A;  4A3E G;  4O4I F;  3ORQ A;  4A3F G;  2IMW P;  4PDB A;  1I3Q A;  4EEQ A;  3N41 B;  1XMO H;  4JV1 A;  1PK8 A;  5FLX W;  2UUA H;  2XCL A;  3RTX A;  4DR2 H;  1ULZ A;  5L1L A;  2BQR A;  3OHB A;  4FBT A;  2NU6 B;  2SCU B;  1RJR A;  1WCM G;  1I50 A;  4U6P A;  3RUP A;  3J80 W;  4X62 H;  4NLG A;  3GTJ A;  2ALZ A;  1A0I A;  4QIW E;  4EYI B;  3N42 B;  2I8C A;  3KAK A;  2FPI B;  2RDJ A;  2V59 A;  4Q0Y A;  5KFT A;  4O2B F;  2W6P A;  2C22 A;  1JXL A;  2R7Z G;  4LFB H;  5D1O A;  4MA5 A;  4QWC A;  4ED8 A;  4A3D G;  1BGW A;  3MFI A;  4YHH H;  4YAJ B;  4DV5 H;  3BQ0 A;  1N33 H;  1MZB A;  3KHG A;  1N48 A;  1ZQ7 A;  3VPB A;  4A3I G;  3T1Y H;  4J9K A;  2QK4 A;  3OUU A;  4ECZ A;  4LF6 H;  4QWB A;  1PX2 A;  3H0G A;  2R93 G;  3GLK A;  4DV1 H;  3T5K A;  1IBL H;  2R7Z A;  2WAQ A;  3HOZ G;  2E5L H;  3V4Z A;  3EPG A;  2PBZ A;  3R5H A;  3U9S A;  5IYB G;  3OSP A;  2V5A A;  4ZQI A;  4IWY A;  2WAQ E;  2WYO A;  2ATL A;  5KFE A;  4J9P A;  5BMV F;  5DQI A;  4DR4 H;  2XIG A;  3HBL A;  4FBU A;  2PVP A;  4EBD A;  3QZ7 A;  1IOW A;  4I55 F;  3RF2 A;  4EFE A;  3K3V A;  4J9M A;  4FM9 A;  5D1O B;  4ECQ A;  1FVI A;  1B04 A;  3G6V A;  2J6S A;  4F4W A;  4ED6 A;  2ZDG A;  3LML A;  2DZD A;  4JI1 H;  2IBK A;  3PW2 A;  5JQW A;  2JA5 A;  3M9N B;  2XCA A;  4LF7 H;  1KJ9 A;  2HVR A;  3PR4 A;  3MFH A;  4YJ2 F;  4FS1 A;  5CB4 F;  3V6H A;  3AYH B;  4EGJ A;  2YRX A;  5FPR A;  2FJZ A;  2WE6 A;  3GV5 B;  1N32 H;  4ZI7 F;  1V51 A;  1VBH A;  2CW8 A;  4A3B G;  4MV1 A;  1M7J A;  3Q8R B;  3RBD A;  4UCR A;  5J2T F;  3Q8S B;  4IHJ F;  2R82 A;  5KG4 A;  3KAJ A;  1XDN A;  5KT4 A;  3ETJ A;  3PR5 B;  1CS0 A;  2UVR A;  4R7R A;  5KG0 A;  4YAK B;  3GIM A;  3RB0 A;  1N34 H;  4RB2 C;  5KFM A;  5BPH A;  2FK1 A;  3CQZ A;  4JYA H;  3RB4 A;  2ASL A;  1RJP A;  1V4Y A;  2PMZ A;  2YS6 A;  3K5H A;  2AU0 A;  1S10 A;  4UFZ A;  1JLL B;  4HQ6 A;  2V4R A;  1L2Z A;  2AQ4 A;  5KFL A;  4EG0 A;  4A93 G;  1XMQ H;  5KFY A;  2E2I A;  4JI2 H;  3FKI G;  2NU9 B;  4ECU A;  5FPO A;  2PMZ E;  2FK3 A;  5EWG A;  1S97 A;  2VPQ A;  2GPW A;  5KT7 A;  3EPI A;  1GSO A;  1S0O A;  5KG1 A;  1XNQ H;  1GO3 E;  1EUD B;  2R7L A;  5KG5 A;  3BAA A;  3QZ8 A;  3GTL A;  3OHA A;  2FPG B;  1XNR H;  4M7E A;  1SFO A;  4IR1 A;  5I47 A;  3M9O B;  4F4Z A;  1O75 A;  3JRX A;  3RFC A;  2FKL A;  5DLG A;  5KFF A;  4UCS A;  4HR7 A;  4HNT A;  3IG0 A;  4RAZ A;  1V9P A;  1E4E A;  2W8K A;  4DR6 H;  2RGV A;  3UFX B;  2R6F A;  3JZI A;  2IP4 A;  4LH7 A;  3GIL A;  2WB1 E;  3H4B A;  1HNZ H;  2RGR A;  4RU9 A;  3KHH A;  3GTP A;  2JA6 G;  2UXB H;  3HOY G;  2YCH A;  1Z2P X;  4CC6 A;  4LSA A;  4EEY A;  2VA2 A;  3Q8Q B;  3PW5 A;  4AYB E;  1TA8 A;  4R8U A;  4LFA H;  2V4Q A;  1WSC A;  2C2D A;  4M9U A;  4JI5 H;  1VBG A;  4O3Q A;  2DPJ A;  2AGQ A;  3GID A;  2UVU A;  4IZO A;  1M0T A;  1B33 N;  4YR0 A;  3IN5 A;  2BQ3 A;  4JI3 H;  3K3P A;  2XGQ A;  3GV7 B;  3TQ1 A;  4Q8F A;  4TQR A;  2VQE H;  1K83 A;  4MV7 A;  5D1P A;  2YZN A;  2RDI A;  1C30 A;  2KSW A;  3H20 A;  4O4H F;  5LMU H;  4AQY H;  2V58 A;  1FKA H;  1E4E B;  2JA7 G;  4A2A A;  4A3J G;  3PW7 A;  3RV3 A;  5IT9 W;  5KFD A;  3ETH A;  4YB8 B;  4HNU A;  1DIK A;  3HOX G;  2R93 A;  4LF5 H;  2C2R A;  4RZR A;  1TWF A;  2I80 A;  4JUZ A;  4EFB A;  2YU9 A;  4DLK A;  1Y1V A;  3E5N A;  4R8U B;  5BR8 H;  4ECW A;  4ED2 A;  4L1K A;  5KFS A;  3RGX A;  2UXC H;  2W6M A;  2VUG A;  1RJQ A;  1I7L A;  3G6Y A;  5LA6 F;  1BJT A;  1CE8 A;  4IWX A;  2OWO A;  4C5B A;  1EZ1 A;  3GTG A;  4DV7 H;  4DL6 A;  1RYS A;  1HNW H;  2YW2 A;  2VA3 A;  4B3S H;  4RAY A;  3N43 B;  2W7O A;  4ECV A;  5KFW A;  1P8L A;  5C1O A; 
#chains in the Genus database with same CATH homology
 2FKL A;  2FK1 A;  2M05 A;  2FJZ A;  3KTM A;  2FK2 A;  1OWT A;  4PWQ A;  2FMA A;  2FK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...