2FJZA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fjzA00
2FK3A 2FMAA 2FJZA 1OWTA 2M05A 2FK2A 2FK1A 3KTMA 4PWQA 2FKLA
chains in the Genus database with same CATH superfamily
3HOZG 3MWMA 3E5NA 4UFZA 4E4TA 3KHLA 3N41B 3GQCA 4MV3A 5C1OA 3MR2A 4ECXA 2WTFA 4A3EG 3N44B 2VQFH 4DV6H 2W9BA 4TV8F 3KAJA 4O4IF 4QJFA 3H4DA 3T1YH 5KG7A 2WDTA 4O3QA 5DLGA 4ECQA 4YAKB 4DL3A 3BQ2A 5KFFA 2NU7B 1S9FA 1XMOH 2W6OA 3GTKA 2R93A 4RAZA 4IR1A 3I4NG 2PBZA 5KFJA 3IG0A 2YRWA 3V4ZA 3BAAA 4EFBA 2R8HA 3GTLA 2XGQA 2UXDH 4LFCH 4DL6A 2HVSA 5J2UF 4X65H 2WAQE 4LF9H 1M7JA 3HOUG 1PK8A 2C22A 4F4XA 3GIMA 1RYSA 5BR8H 4QW9A 1VKZA 4B3TH 3MWDA 2NU8B 1ZHSA 5JUMA 1V9PA 1TWHA 5IYDG 3PVXA 3MR5A 3BA8A 3RB6A 2ALZA 1WR2A 3OTOH 4A3BG 5JH7F 3T1HH 5KFXA 4Q0YA 3PZPA 4TQSA 2AU0A 3M9OB 3QFFA 3F8NA 4F4YA 1Z2OX 1KC7A 2XCPA 1IBKH 3BA9A 4MV8A 4YP3A 4A3IG 2W9CB 3V6JA 4JV2A 2JEIA 2YW2A 3KXYT 5CB4F 2BQ3A 1EYZA 3PN1A 2UU9H 4JI0H 2Y0SE 4LF4H 2JA8G 3Q8PB 4J0MA 3GV8B 2SCUB 2YCHA 3RV4A 1XDNA 4LF6H 5CA0F 5KFKA 2J6SA 1A0IA 4Y8VB 4M7EA 1PX2A 3KTMA 4EBEA 3PW2A 4J9RA 3N40P 3HXLA 2W7OA 4HNVA 2R85A 2YZMA 3QZ8A 2V4QA 3Q8RB 3OSPA 1ZHQA 3MR3A 2FKLA 5KX5F 1UC9A 2QK4A 3RV3A 1GYFA 1XNQH 5JVLA 3KHRA 4R8UB 3RFCA 5CAEB 3OUUA 3PR5B 4LH7A 1KJIA 5KFUA 4I4TF 4LH6A 3RTXA 1P8LA 3ETJA 5KFMA 4YHHH 2XGPA 4FU0A 2R8IA 4C2MA 4RUAA 5L1IA 2CW7A 5KFOA 4G3IA 2AGOA 4L1KA 2DPJA 1Y1VG 4ME6A 5KFEA 5DGBA 2WAQA 3G8CA 1KBLA 3T5KA 2ASDA 1IBLH 1E4EA 2R92A 5FPOA 4EFEA 1N56A 2UVUA 4RU9A 2C35B 5KFAA 3BQ0A 4EBDA 2RF4A 4BWSC 4XYLB 4RZRA 2ATLA 3I12A 4IR9A 2YU9A 4EGQA 4YJ3F 4I55F 2ZDQA 4ED8A 3ORRA 2P0AA 1HR0H 1AUVA 1L2ZA 4DR4H 4Q8FA 2Y0SA 3N43B 4RNOA 2UVRA 2R93G 3RAXA 2YYAA 4IRCA 1J5EH 3T5JA 3H40A 5C3EG 1S10A 4J9OA 1MZBA 2ZDHA 1SFOA 2V58A 4O4HF 4DLKA 3GV5B 3G6YA 1XNRH 4AYBE 5KFDA 2OLSA 5FD5A 5CA1F 5L1JA 5HBRB 2Q2UA 4MA0A 3LMLA 2AGPA 3NGDA 4Q8EA 4QWDA 2CKZB 4FS2A 5DGAA 3R23A 4B3RH 4EG0A 3V4SA 5FLMG 2R8GA 2FE3A 1VAJA 2R84A 3JRWA 4ETSA 1HNWH 5F9NA 4MV1A 5KFIA 5KFCA 2XC9A 4J9QA 2HJWA 1CQJB 2FK1A 2AGQA 4A3LG 5EZYF 4X62H 4UCSA 1JX4A 5DQHA 4UCRA 3BG5A 4ECYA 3GTQA 4ED1A 5KT6A 1CE8A 1IOVA 5F9LA 3VPCA 2YL2A 2VQEH 3JRXA 3HOXG 2JA7A 2W57A 5EWGA 3PW5A 1N32H 2B63A 1UC8A 3LWBA 5KFRA 4RZQA 4A3MG 3Q1KA 4O4LF 3SI8A 1CS0A 2IP4A 4DR3H 1BNCA 5JVDF 4J9KA 1FJGH 5KFHA 2ASJA 4QIWE 2KSWA 4DR5H 1I50A 5BPFA 4RB0A 5LXTF 1Z2NX 2R8JA 4MAMA 2QYZA 4IAJA 3GTJA 3U9SA 5DLFA 4A3GG 4BXXG 4O3OA 4YAJB 2ZJTA 1KEEA 5EOYA 5LL6b 4MTDA 2Q2TA 1T94A 2C00A 5IYCG 1I6UA 1S68A 4DR7H 2JA6A 4DL4A 5D1PA 5EWEA 3H20A 1BJTA 3FKIA 4RB3C 4RNMA 4WBNF 2W8LA 3H3VH 2RGVA 2J6TA 1WSCA 4QW8A 5C44G 1S97A 4XYMB 1B04A 4ZHQF 2HHHH 4CC6A 3RB0A 4AYBA 4NLGA 2VQDA 4KHPH 1K83A 3EPGA 2R92G 1I7LA 3Q2OA 2VPQA 5LMUH 3GTOA 2VPSA 2W6ZA 2ZM6H 5T14A 2UUCH 1RJRA 2UUAH 5KFPA 3L4KA 5HV6A 3AYHB 4F4ZA 2UVWA 4O3RA 2DPIA 3J7AK 1JXLA 1C3OA 2WB1E 4PWQA 2MCTA 4ECVA 5C5JA 4DL5A 4DL2A 2VA2A 2GPSA 3MFHA 5D1OA 3RGXA 5KFQA 2R7LA 1I3QA 4ED0A 5KT7A 5KKNB 4DV0H 4BY7G 2FJZA 3H0GA 2R87A 1BGWA 1IBMH 1TWAA 2W6QA 4I7HA 4TUYF 4Q44A 2UVVA 4FBUA 4GKKH 1X9NA 5KFGA 4QIWA 2VA3A 1M0WA 2HGSA 2NU9B 5A2QW 4OX9H 2RGRA 2JEFA 2J6UA 4AQYH 3KHHA 4UCTA 1DGSA 5L9XA 2V5AA 2CQYA 5L1KA 3PO3G 1V51A 2XD4A 4WD3A 3K5HA 4DV7H 3LP8A 4M9UA 4QWAA 4C5AA 2W7PA 3RIZA 4BBSG 3U9TA 2E5LH 4MV9A 4YY3H 5KT5A 2WYOA 3JZIA 2R7MA 5I47A 2HVRA 1T36A 3PW0A 4JI3H 4RB2C 4X66H 2W9BB 2FPGB 1EZ1A 4TV9F 3UFXB 4J9NA 3M9NB 2JEGA 4HNTA 5C1PA 5KG2A 2JEJA 3R5XA 2R8KA 5K2MA 1WCMA 4I50F 4LF7H 2JA7G 3CVZA 2B63G 1DIKA 2NVYA 3KALA 1RYRA 2FP4B 4A93G 4LSAA 4A3KG 2NVXA 1ZQ7A 4LFAH 3GIDA 1JLLB 2WE6A 1CQIB 3FMAA 4BY1G 4EYIB 3PW7A 4GC7A 1XMQH 5IYZF 4YJ2F 4EBCA 4EEQA 4O3SA 2W6PA 5FLXW 1B33N 2J9GA 2BQUA 2WB1A 4ED2A 3UQ8A 5IYBG 4YR0A 2CW8A 4J9SA 4RUCA 1W96A 2M05A 2YZGA 3T5HA 2IMWP 1GO3E 1I7NA 2FPPB 5DG9A 3TQ1A 2UUBH 2JA6G 3PW4A 3PR4A 4GLXA 3C0FB 3FKIG 3RF2A 2DLNA 1SYXB 3HBLA 3M4IA 5KFLA 4JI8H 4HNUA 2FPIB 3V6HA 4R7RA 4A2BA 3IN5A 4EYHB 4DL7A 1AUXA 1M6VA 5KG1A 2BR0A 5DG7A 4GKJH 4K0KH 4RAYA 2W70A 1JDEA 4RB1A 2VOBA 2C2EA 5KG3A 1OWTA 3GIPA 3K3VA 3EPIA 4GC6A 4ECUA 2E2HA 1IOWA 2W6MA 2GLTA 5C8YF 3EYYA 3TIGA 2PN1A 4ED3A 3WNZA 4Q45A 4A2AA 3K3PA 4X64H 2ASLA 1TAEA 1I94H 2NU6B 3KHGA 5C4XG 4XZ3B 4JI6H 4JI2H 3HOYG 3G6VA 2YS6A 4UCVA 1B6RA 5IP9G 2FB9A 4EGJA 4LF5H 5KFZA 3H0GG 5DG8A 3CQZA 1WH2A 2JA5A 3VPBA 3JSNA 2GPWA 3GIJA 1GSHA 2DWCA 4DV2H 2V9WA 3GTMA 2W9AA 3J80W 4IWYA 2VUGA 3MR6A 4ECRA 2FLPA 1S03G 3GTPA 1M0TA 1K1SA 5BMVF 1E4EB 1Y1WA 5LMNH 2R82A 4NXMH 4HQ6A 2I80A 3L4JA 3RBEA 1N36H 1TA8A 2XCLA 2NUAB 4DV3H 1RK5A 4IWXA 4U6PA 1DV2A 5LP6F 3K5IA 3HB9A 4O3PA 3L2PA 4JUZA 2R6FA 5EWFA 1JKJB 3OHAA 4ECZA 2W8KA 4A3DG 3GIKA 5IWAH 3JSLA 2OWOA 3BJYA 1V4YA 2UXBH 3GLKA 4MV6A 4ED7A 1WCMG 5LOVF 1N34H 2VUMA 3SE7A 2PMZE 4HR7A 2XCAA 2VR1A 4C5CA 4JI7H 3RGZA 1W93A 1GGOA 5H80A 2E2IA 1KJJA 4ZQIA 3BABA 1UNNC 1HNXH 1E4GT 3GIQA 1FKAH 4IRKA 4PDBA 3GTGA 3MWEA 1Z2PX 4ECWA 4YB8B 3RBDA 1N33H 4F50A 5KFBA 3H4BA 4A3JG 4JYAH 5KFWA 4B3MH 4J9MA 1RJPA 3N8DA 1KJ9A 2FK2A 5FPRA 1VS0A 1DV1A 2C2DA 1VBHA 4DV4H 5LYJF 2FLLA 4LSXA 3WO0A 2V4RA 3G6XA 4O3NA 4LMYA 3M9MB 5IT9W 3GIIA 2XIGA 3ORQA 2IBKA 3OUZA 3N42B 4C5BA 5KFTA 4UCOA 3V6KA 3ETHA 3MJFA 3HOVG 2PVPA 5GONF 5BPHA 3HKZE 1RK6A 3OHBA 2R7ZA 1KJQA 5IP7G 4EEYA 1SEIA 2RDJA 5EDWA 4JI5H 1SCUB 2FLNA 4DUYH 3PO2G 1AN7A 4LFBH 1N48A 4ZOLF 4QWEA 2HVQA 1TWFA 4QWBA 5KG0A 5KT2A 4HYKA 5KG6A 1HNZH 5KFNA 4IZOA 5KFVA 3R5HA 1R9TA 4ED6A 3KAKA 1C30A 2C2RA 1ZETA 4TQRA 3GILA 2YS7A 4LF8H 3Q8SB 1EUCB 2PMZA 2ZDGA 3J81W 1Y14B 3T5LA 4XX0B 2JA5G 4DR6H 3I4MG 4O2BF 3FDSA 4APMA 2W71A 4BBRG 3GV7B 4JV0A 1B6SA 2YRXA 1TWGA 1TWCA 2O03A 4ECTA 5LA6F 4ECSA 4MV4A 1Y1WG 2V59A 2W6NA 4ZI7F 2I8CA 3TQTA 1T3NA 3JAMW 3WO1A 3RJ0A 3QZ7A 1JIHA 4JI4H 4JV1A 3R5FA 3VMMA 1K1QA 4CC5A 3RAQA 1GSOA 2R7KA 1S0NA 1BXRA 2DZDA 5JQWA 4U7CA 2FK3A 4NXNH 1JDBB 4YBZB 3HOWG 1RJQA 1KJ8A 4DR2H 1O75A 5KFSA 4A3CG 4MA5A 1ULZA 5FJ8G 5L1LA 4YR2A 4DV1H 4FM9A 1A9XA 5KT3A 1VBGA 4FS1A 2OH2A 5D1OB 5J2TF 4IRDA 2VUMG 4MTEA 4J9LA 3HKZA 2FMAA 3TIIA 1GSAA 4F4WA 2C28A 5FD6A 4B3SH 5KG4A 2W9CA 2IA6A 4JV5H 5DQIA 3MFIA 1GLVA 4DUZH 2AQ4A 2DIKA 4UCUA 3OSNA 5KFYA 2RDIA 4YQWA 4A3FG 1FVIA 1S0MA 5D8DA 1EUDB 3BQ1A 2CZGA 1EHIA 2YZNA 4Q43A 2I87A 4YR3A 2UXCH 4QWCA 1E4FT 2BQRA 3DF7A 3VPDA 2X0SA 2R86A 1Y1VA 3RB3A 4JI1H 3RUPA 4R8UA 4J9PA 5KT4A 5DQGA 4IHJF 4FBTA 4O2AF 3TINA 4DR1H 1S0OA 4RNNA 2F4VH 2R7NA 3N6XA 5KG5A 3Q8QB 4DV5H 3RB4A 2R7ZG 4MV7A
chains in the Genus database with same CATH topology
2FK3A 2FMAA 2FJZA 1OWTA 2M05A 2FK2A 2FK1A 3KTMA 4PWQA 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK3 A;  2FMA A;  2FJZ A;  1OWT A;  2M05 A;  2FK2 A;  2FK1 A;  3KTM A;  4PWQ A;  2FKL A; 
#chains in the Genus database with same CATH topology
 3HOZ G;  3MWM A;  3E5N A;  4UFZ A;  4E4T A;  3KHL A;  3N41 B;  3GQC A;  4MV3 A;  5C1O A;  3MR2 A;  4ECX A;  2WTF A;  4A3E G;  3N44 B;  2VQF H;  4DV6 H;  2W9B A;  4TV8 F;  3KAJ A;  4O4I F;  4QJF A;  3H4D A;  3T1Y H;  5KG7 A;  2WDT A;  4O3Q A;  5DLG A;  4ECQ A;  4YAK B;  4DL3 A;  3BQ2 A;  5KFF A;  2NU7 B;  1S9F A;  1XMO H;  2W6O A;  3GTK A;  2R93 A;  4RAZ A;  4IR1 A;  3I4N G;  2PBZ A;  5KFJ A;  3IG0 A;  2YRW A;  3V4Z A;  3BAA A;  4EFB A;  2R8H A;  3GTL A;  2XGQ A;  2UXD H;  4LFC H;  4DL6 A;  2HVS A;  5J2U F;  4X65 H;  2WAQ E;  4LF9 H;  1M7J A;  3HOU G;  1PK8 A;  2C22 A;  4F4X A;  3GIM A;  1RYS A;  5BR8 H;  4QW9 A;  1VKZ A;  4B3T H;  3MWD A;  2NU8 B;  1ZHS A;  5JUM A;  1V9P A;  1TWH A;  5IYD G;  3PVX A;  3MR5 A;  3BA8 A;  3RB6 A;  2ALZ A;  1WR2 A;  3OTO H;  4A3B G;  5JH7 F;  3T1H H;  5KFX A;  4Q0Y A;  3PZP A;  4TQS A;  2AU0 A;  3M9O B;  3QFF A;  3F8N A;  4F4Y A;  1Z2O X;  1KC7 A;  2XCP A;  1IBK H;  3BA9 A;  4MV8 A;  4YP3 A;  4A3I G;  2W9C B;  3V6J A;  4JV2 A;  2JEI A;  2YW2 A;  3KXY T;  5CB4 F;  2BQ3 A;  1EYZ A;  3PN1 A;  2UU9 H;  4JI0 H;  2Y0S E;  4LF4 H;  2JA8 G;  3Q8P B;  4J0M A;  3GV8 B;  2SCU B;  2YCH A;  3RV4 A;  1XDN A;  4LF6 H;  5CA0 F;  5KFK A;  2J6S A;  1A0I A;  4Y8V B;  4M7E A;  1PX2 A;  3KTM A;  4EBE A;  3PW2 A;  4J9R A;  3N40 P;  3HXL A;  2W7O A;  4HNV A;  2R85 A;  2YZM A;  3QZ8 A;  2V4Q A;  3Q8R B;  3OSP A;  1ZHQ A;  3MR3 A;  2FKL A;  5KX5 F;  1UC9 A;  2QK4 A;  3RV3 A;  1GYF A;  1XNQ H;  5JVL A;  3KHR A;  4R8U B;  3RFC A;  5CAE B;  3OUU A;  3PR5 B;  4LH7 A;  1KJI A;  5KFU A;  4I4T F;  4LH6 A;  3RTX A;  1P8L A;  3ETJ A;  5KFM A;  4YHH H;  2XGP A;  4FU0 A;  2R8I A;  4C2M A;  4RUA A;  5L1I A;  2CW7 A;  5KFO A;  4G3I A;  2AGO A;  4L1K A;  2DPJ A;  1Y1V G;  4ME6 A;  5KFE A;  5DGB A;  2WAQ A;  3G8C A;  1KBL A;  3T5K A;  2ASD A;  1IBL H;  1E4E A;  2R92 A;  5FPO A;  4EFE A;  1N56 A;  2UVU A;  4RU9 A;  2C35 B;  5KFA A;  3BQ0 A;  4EBD A;  2RF4 A;  4BWS C;  4XYL B;  4RZR A;  2ATL A;  3I12 A;  4IR9 A;  2YU9 A;  4EGQ A;  4YJ3 F;  4I55 F;  2ZDQ A;  4ED8 A;  3ORR A;  2P0A A;  1HR0 H;  1AUV A;  1L2Z A;  4DR4 H;  4Q8F A;  2Y0S A;  3N43 B;  4RNO A;  2UVR A;  2R93 G;  3RAX A;  2YYA A;  4IRC A;  1J5E H;  3T5J A;  3H40 A;  5C3E G;  1S10 A;  4J9O A;  1MZB A;  2ZDH A;  1SFO A;  2V58 A;  4O4H F;  4DLK A;  3GV5 B;  3G6Y A;  1XNR H;  4AYB E;  5KFD A;  2OLS A;  5FD5 A;  5CA1 F;  5L1J A;  5HBR B;  2Q2U A;  4MA0 A;  3LML A;  2AGP A;  3NGD A;  4Q8E A;  4QWD A;  2CKZ B;  4FS2 A;  5DGA A;  3R23 A;  4B3R H;  4EG0 A;  3V4S A;  5FLM G;  2R8G A;  2FE3 A;  1VAJ A;  2R84 A;  3JRW A;  4ETS A;  1HNW H;  5F9N A;  4MV1 A;  5KFI A;  5KFC A;  2XC9 A;  4J9Q A;  2HJW A;  1CQJ B;  2FK1 A;  2AGQ A;  4A3L G;  5EZY F;  4X62 H;  4UCS A;  1JX4 A;  5DQH A;  4UCR A;  3BG5 A;  4ECY A;  3GTQ A;  4ED1 A;  5KT6 A;  1CE8 A;  1IOV A;  5F9L A;  3VPC A;  2YL2 A;  2VQE H;  3JRX A;  3HOX G;  2JA7 A;  2W57 A;  5EWG A;  3PW5 A;  1N32 H;  2B63 A;  1UC8 A;  3LWB A;  5KFR A;  4RZQ A;  4A3M G;  3Q1K A;  4O4L F;  3SI8 A;  1CS0 A;  2IP4 A;  4DR3 H;  1BNC A;  5JVD F;  4J9K A;  1FJG H;  5KFH A;  2ASJ A;  4QIW E;  2KSW A;  4DR5 H;  1I50 A;  5BPF A;  4RB0 A;  5LXT F;  1Z2N X;  2R8J A;  4MAM A;  2QYZ A;  4IAJ A;  3GTJ A;  3U9S A;  5DLF A;  4A3G G;  4BXX G;  4O3O A;  4YAJ B;  2ZJT A;  1KEE A;  5EOY A;  5LL6 b;  4MTD A;  2Q2T A;  1T94 A;  2C00 A;  5IYC G;  1I6U A;  1S68 A;  4DR7 H;  2JA6 A;  4DL4 A;  5D1P A;  5EWE A;  3H20 A;  1BJT A;  3FKI A;  4RB3 C;  4RNM A;  4WBN F;  2W8L A;  3H3V H;  2RGV A;  2J6T A;  1WSC A;  4QW8 A;  5C44 G;  1S97 A;  4XYM B;  1B04 A;  4ZHQ F;  2HHH H;  4CC6 A;  3RB0 A;  4AYB A;  4NLG A;  2VQD A;  4KHP H;  1K83 A;  3EPG A;  2R92 G;  1I7L A;  3Q2O A;  2VPQ A;  5LMU H;  3GTO A;  2VPS A;  2W6Z A;  2ZM6 H;  5T14 A;  2UUC H;  1RJR A;  2UUA H;  5KFP A;  3L4K A;  5HV6 A;  3AYH B;  4F4Z A;  2UVW A;  4O3R A;  2DPI A;  3J7A K;  1JXL A;  1C3O A;  2WB1 E;  4PWQ A;  2MCT A;  4ECV A;  5C5J A;  4DL5 A;  4DL2 A;  2VA2 A;  2GPS A;  3MFH A;  5D1O A;  3RGX A;  5KFQ A;  2R7L A;  1I3Q A;  4ED0 A;  5KT7 A;  5KKN B;  4DV0 H;  4BY7 G;  2FJZ A;  3H0G A;  2R87 A;  1BGW A;  1IBM H;  1TWA A;  2W6Q A;  4I7H A;  4TUY F;  4Q44 A;  2UVV A;  4FBU A;  4GKK H;  1X9N A;  5KFG A;  4QIW A;  2VA3 A;  1M0W A;  2HGS A;  2NU9 B;  5A2Q W;  4OX9 H;  2RGR A;  2JEF A;  2J6U A;  4AQY H;  3KHH A;  4UCT A;  1DGS A;  5L9X A;  2V5A A;  2CQY A;  5L1K A;  3PO3 G;  1V51 A;  2XD4 A;  4WD3 A;  3K5H A;  4DV7 H;  3LP8 A;  4M9U A;  4QWA A;  4C5A A;  2W7P A;  3RIZ A;  4BBS G;  3U9T A;  2E5L H;  4MV9 A;  4YY3 H;  5KT5 A;  2WYO A;  3JZI A;  2R7M A;  5I47 A;  2HVR A;  1T36 A;  3PW0 A;  4JI3 H;  4RB2 C;  4X66 H;  2W9B B;  2FPG B;  1EZ1 A;  4TV9 F;  3UFX B;  4J9N A;  3M9N B;  2JEG A;  4HNT A;  5C1P A;  5KG2 A;  2JEJ A;  3R5X A;  2R8K A;  5K2M A;  1WCM A;  4I50 F;  4LF7 H;  2JA7 G;  3CVZ A;  2B63 G;  1DIK A;  2NVY A;  3KAL A;  1RYR A;  2FP4 B;  4A93 G;  4LSA A;  4A3K G;  2NVX A;  1ZQ7 A;  4LFA H;  3GID A;  1JLL B;  2WE6 A;  1CQI B;  3FMA A;  4BY1 G;  4EYI B;  3PW7 A;  4GC7 A;  1XMQ H;  5IYZ F;  4YJ2 F;  4EBC A;  4EEQ A;  4O3S A;  2W6P A;  5FLX W;  1B33 N;  2J9G A;  2BQU A;  2WB1 A;  4ED2 A;  3UQ8 A;  5IYB G;  4YR0 A;  2CW8 A;  4J9S A;  4RUC A;  1W96 A;  2M05 A;  2YZG A;  3T5H A;  2IMW P;  1GO3 E;  1I7N A;  2FPP B;  5DG9 A;  3TQ1 A;  2UUB H;  2JA6 G;  3PW4 A;  3PR4 A;  4GLX A;  3C0F B;  3FKI G;  3RF2 A;  2DLN A;  1SYX B;  3HBL A;  3M4I A;  5KFL A;  4JI8 H;  4HNU A;  2FPI B;  3V6H A;  4R7R A;  4A2B A;  3IN5 A;  4EYH B;  4DL7 A;  1AUX A;  1M6V A;  5KG1 A;  2BR0 A;  5DG7 A;  4GKJ H;  4K0K H;  4RAY A;  2W70 A;  1JDE A;  4RB1 A;  2VOB A;  2C2E A;  5KG3 A;  1OWT A;  3GIP A;  3K3V A;  3EPI A;  4GC6 A;  4ECU A;  2E2H A;  1IOW A;  2W6M A;  2GLT A;  5C8Y F;  3EYY A;  3TIG A;  2PN1 A;  4ED3 A;  3WNZ A;  4Q45 A;  4A2A A;  3K3P A;  4X64 H;  2ASL A;  1TAE A;  1I94 H;  2NU6 B;  3KHG A;  5C4X G;  4XZ3 B;  4JI6 H;  4JI2 H;  3HOY G;  3G6V A;  2YS6 A;  4UCV A;  1B6R A;  5IP9 G;  2FB9 A;  4EGJ A;  4LF5 H;  5KFZ A;  3H0G G;  5DG8 A;  3CQZ A;  1WH2 A;  2JA5 A;  3VPB A;  3JSN A;  2GPW A;  3GIJ A;  1GSH A;  2DWC A;  4DV2 H;  2V9W A;  3GTM A;  2W9A A;  3J80 W;  4IWY A;  2VUG A;  3MR6 A;  4ECR A;  2FLP A;  1S03 G;  3GTP A;  1M0T A;  1K1S A;  5BMV F;  1E4E B;  1Y1W A;  5LMN H;  2R82 A;  4NXM H;  4HQ6 A;  2I80 A;  3L4J A;  3RBE A;  1N36 H;  1TA8 A;  2XCL A;  2NUA B;  4DV3 H;  1RK5 A;  4IWX A;  4U6P A;  1DV2 A;  5LP6 F;  3K5I A;  3HB9 A;  4O3P A;  3L2P A;  4JUZ A;  2R6F A;  5EWF A;  1JKJ B;  3OHA A;  4ECZ A;  2W8K A;  4A3D G;  3GIK A;  5IWA H;  3JSL A;  2OWO A;  3BJY A;  1V4Y A;  2UXB H;  3GLK A;  4MV6 A;  4ED7 A;  1WCM G;  5LOV F;  1N34 H;  2VUM A;  3SE7 A;  2PMZ E;  4HR7 A;  2XCA A;  2VR1 A;  4C5C A;  4JI7 H;  3RGZ A;  1W93 A;  1GGO A;  5H80 A;  2E2I A;  1KJJ A;  4ZQI A;  3BAB A;  1UNN C;  1HNX H;  1E4G T;  3GIQ A;  1FKA H;  4IRK A;  4PDB A;  3GTG A;  3MWE A;  1Z2P X;  4ECW A;  4YB8 B;  3RBD A;  1N33 H;  4F50 A;  5KFB A;  3H4B A;  4A3J G;  4JYA H;  5KFW A;  4B3M H;  4J9M A;  1RJP A;  3N8D A;  1KJ9 A;  2FK2 A;  5FPR A;  1VS0 A;  1DV1 A;  2C2D A;  1VBH A;  4DV4 H;  5LYJ F;  2FLL A;  4LSX A;  3WO0 A;  2V4R A;  3G6X A;  4O3N A;  4LMY A;  3M9M B;  5IT9 W;  3GII A;  2XIG A;  3ORQ A;  2IBK A;  3OUZ A;  3N42 B;  4C5B A;  5KFT A;  4UCO A;  3V6K A;  3ETH A;  3MJF A;  3HOV G;  2PVP A;  5GON F;  5BPH A;  3HKZ E;  1RK6 A;  3OHB A;  2R7Z A;  1KJQ A;  5IP7 G;  4EEY A;  1SEI A;  2RDJ A;  5EDW A;  4JI5 H;  1SCU B;  2FLN A;  4DUY H;  3PO2 G;  1AN7 A;  4LFB H;  1N48 A;  4ZOL F;  4QWE A;  2HVQ A;  1TWF A;  4QWB A;  5KG0 A;  5KT2 A;  4HYK A;  5KG6 A;  1HNZ H;  5KFN A;  4IZO A;  5KFV A;  3R5H A;  1R9T A;  4ED6 A;  3KAK A;  1C30 A;  2C2R A;  1ZET A;  4TQR A;  3GIL A;  2YS7 A;  4LF8 H;  3Q8S B;  1EUC B;  2PMZ A;  2ZDG A;  3J81 W;  1Y14 B;  3T5L A;  4XX0 B;  2JA5 G;  4DR6 H;  3I4M G;  4O2B F;  3FDS A;  4APM A;  2W71 A;  4BBR G;  3GV7 B;  4JV0 A;  1B6S A;  2YRX A;  1TWG A;  1TWC A;  2O03 A;  4ECT A;  5LA6 F;  4ECS A;  4MV4 A;  1Y1W G;  2V59 A;  2W6N A;  4ZI7 F;  2I8C A;  3TQT A;  1T3N A;  3JAM W;  3WO1 A;  3RJ0 A;  3QZ7 A;  1JIH A;  4JI4 H;  4JV1 A;  3R5F A;  3VMM A;  1K1Q A;  4CC5 A;  3RAQ A;  1GSO A;  2R7K A;  1S0N A;  1BXR A;  2DZD A;  5JQW A;  4U7C A;  2FK3 A;  4NXN H;  1JDB B;  4YBZ B;  3HOW G;  1RJQ A;  1KJ8 A;  4DR2 H;  1O75 A;  5KFS A;  4A3C G;  4MA5 A;  1ULZ A;  5FJ8 G;  5L1L A;  4YR2 A;  4DV1 H;  4FM9 A;  1A9X A;  5KT3 A;  1VBG A;  4FS1 A;  2OH2 A;  5D1O B;  5J2T F;  4IRD A;  2VUM G;  4MTE A;  4J9L A;  3HKZ A;  2FMA A;  3TII A;  1GSA A;  4F4W A;  2C28 A;  5FD6 A;  4B3S H;  5KG4 A;  2W9C A;  2IA6 A;  4JV5 H;  5DQI A;  3MFI A;  1GLV A;  4DUZ H;  2AQ4 A;  2DIK A;  4UCU A;  3OSN A;  5KFY A;  2RDI A;  4YQW A;  4A3F G;  1FVI A;  1S0M A;  5D8D A;  1EUD B;  3BQ1 A;  2CZG A;  1EHI A;  2YZN A;  4Q43 A;  2I87 A;  4YR3 A;  2UXC H;  4QWC A;  1E4F T;  2BQR A;  3DF7 A;  3VPD A;  2X0S A;  2R86 A;  1Y1V A;  3RB3 A;  4JI1 H;  3RUP A;  4R8U A;  4J9P A;  5KT4 A;  5DQG A;  4IHJ F;  4FBT A;  4O2A F;  3TIN A;  4DR1 H;  1S0O A;  4RNN A;  2F4V H;  2R7N A;  3N6X A;  5KG5 A;  3Q8Q B;  4DV5 H;  3RB4 A;  2R7Z G;  4MV7 A; 
#chains in the Genus database with same CATH homology
 2FK3 A;  2FMA A;  2FJZ A;  1OWT A;  2M05 A;  2FK2 A;  2FK1 A;  3KTM A;  4PWQ A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...