2FJZA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fjzA00
2FKLA 1OWTA 3KTMA 2FK2A 2FK1A 4PWQA 2FK3A 2M05A 2FJZA 2FMAA
chains in the Genus database with same CATH superfamily
5KFKA 3KAJA 3V4ZA 1VKZA 3RJ0A 2FP4B 5L1JA 5KT6A 2DWCA 5FLXW 2VUMG 4LF9H 1M6VA 4E4TA 5C3EG 4Q8FA 5BR8H 4A3KG 2I80A 3H4DA 3PVXA 4I50F 2JA8G 3UFXB 4MA0A 4GC7A 4LMYA 5KFIA 1KBLA 2V9WA 3C0FB 4YR2A 4I4TF 1Y1WA 4DLKA 3JSNA 4YY3H 1A0IA 5KFNA 3BJYA 4IRKA 5KFUA 1RYRA 4A3GG 3N8DA 3UQ8A 3H0GA 5K2MA 5JH7F 4DR4H 1E4FT 2C2EA 3KALA 3GTKA 2R92A 4U7CA 4DV1H 1Z2NX 2XD4A 4DR3H 1B6SA 3I4NG 1S68A 5KFQA 4F4WA 2W8LA 2W9CA 2HJWA 4MV1A 5DQIA 4YB8B 5A2QW 3TIGA 3MR6A 3HBLA 5L1IA 2AQ4A 2C2RA 2HHHH 3LMLA 2R8GA 5KG6A 2KSWA 4ECSA 2DIKA 3WO1A 3GIIA 4XX0B 2WE6A 5LP6F 4GKJH 5LMUH 5DLFA 2DZDA 2R8IA 3K5IA 3H40A 4C5AA 4ZOLF 3F8NA 5KFFA 2XC9A 1N34H 1BJTA 1TAEA 3LP8A 3KAKA 5IP7G 2UVRA 4R7RA 3Q8RB 2FB9A 3T5JA 4ZQIA 4FU0A 1EYZA 4UCRA 4C2MA 4O3RA 3L4JA 5D8DA 2FK3A 1JDEA 2FPGB 4I55F 2J6SA 5KFJA 4EFEA 2AGOA 1ZQ7A 4FS2A 4O2BF 4QJFA 5DGBA 4QW9A 1HNXH 3N41B 4RNNA 5KFGA 4DL3A 2UVUA 2R82A 1KJ8A 3MJFA 4RAZA 3JSLA 5KFHA 2YL2A 3OHAA 4DUZH 4DR2H 1V9PA 2UU9H 5KT3A 1GSHA 4C5CA 1KJQA 4CC6A 4RNMA 2PMZE 2X0SA 5KFEA 1T36A 4JI0H 4ED6A 1I7NA 1JKJB 2AGQA 2DLNA 4RZQA 4XZ3B 2QK4A 2WAQE 4DL4A 2JEFA 1SFOA 4JI1H 3RTXA 4RB2C 1TWCA 3GV8B 5KT7A 2YCHA 1AUVA 4AYBA 4FS1A 4NXNH 1TWGA 3GTMA 4ECWA 4A3FG 4JI6H 3TQTA 2NU9B 4TV9F 5KFDA 4DV2H 3GILA 4EEYA 4QWEA 3PO2G 2W6ZA 4J9OA 3H3VH 4GKKH 1I6UA 4ECQA 2RGRA 2SCUB 4QIWE 1GGOA 2VUMA 1N33H 2AGPA 1WR2A 4ECYA 1SYXB 3HOVG 2ATLA 4IWYA 3L4KA 5IYCG 3HKZA 1XMOH 4O3OA 4IR9A 2C2DA 4IWXA 4K0KH 1V51A 5C8YF 4A3MG 4M7EA 1RJPA 1VBGA 3TIIA 5C1OA 2R7ZG 4PWQA 1JIHA 2FE3A 1IBKH 4PDBA 4ECRA 2V59A 3BQ1A 3IN5A 2J6TA 2VA3A 3BA9A 5DLGA 1S0MA 5KFYA 2C22A 4MA5A 3GTQA 4YR3A 2GPSA 5KG2A 2CW8A 3GIJA 2W9CB 3EPGA 5KFSA 4YAKB 1KJ9A 2PVPA 2W9AA 3G6XA 1IBLH 4KHPH 1RK6A 4X62H 3JAMW 4YR0A 3OHBA 3H4BA 1JDBB 1VAJA 4I7HA 4LH6A 3NGDA 2DPIA 5JVDF 2RGVA 3RGZA 4LSAA 1KC7A 3MFIA 5KG1A 1K1QA 2V4RA 3PW5A 1Z2OX 2DPJA 2OH2A 1BGWA 2W6PA 3QZ7A 2UUAH 5BPFA 3N43B 3PW2A 5KFTA 2VPSA 5KG3A 4JV0A 2RDJA 5JQWA 4ED7A 2UUCH 2WAQA 4A3IG 3HOUG 5KFBA 3Q1KA 1KJJA 4WD3A 2VQFH 2IBKA 4LF6H 2CZGA 2ZJTA 3PW7A 4DL5A 1RJRA 4DR1H 5L1LA 4DL6A 3J7AK 5DQHA 1UNNC 1IOVA 2XCLA 2YS6A 2YZNA 4AYBE 5KT2A 3T1YH 1T94A 2I8CA 4IZOA 3U9SA 4IRCA 4ZHQF 4RUCA 1EUDB 2VR1A 3RFCA 4QIWA 1P8LA 4ECVA 1VS0A 1RYSA 5KFXA 2ZDGA 4DV7H 2PN1A 3M9NB 2BQUA 2FJZA 4JI3H 3GTOA 4MV6A 2C00A 4JV1A 2R7NA 2Q2TA 5KG5A 4QWDA 3PW0A 3HKZE 2ALZA 1N48A 3RBDA 1OWTA 2R84A 2ASDA 4QWCA 4Q0YA 2VQEH 2JA5G 1I7LA 2HVRA 3GIPA 3V6HA 1E4GT 1IOWA 1O75A 1CE8A 2FKLA 1WH2A 2RF4A 4LH7A 2R8KA 1GLVA 2RDIA 4EBDA 4ECXA 2V4QA 4A3CG 5LA6F 1S10A 5DQGA 2FLPA 5KFCA 2YRWA 2NVYA 2VPQA 5IYZF 3BQ2A 4HR7A 1X9NA 3GTLA 4JI7H 3BQ0A 4G3IA 5LXTF 2R8JA 3RB6A 2Q2UA 4A93G 3G6VA 4JV2A 2R7ZA 2R85A 5IP9G 3V6KA 3WNZA 4R8UB 2W6MA 4GC6A 2ASLA 1SCUB 1SEIA 3PW4A 4AQYH 4JI2H 4BWSC 3OUZA 3VPBA 2FPPB 1HR0H 2NUAB 4UCUA 1IBMH 5J2UF 2FLLA 4M9UA 3FMAA 4O4HF 4ED2A 4EGQA 2XCAA 1A9XA 5IYDG 4QWBA 4BY1G 3BG5A 4O3NA 4IR1A 1FJGH 1XNQH 1C30A 1I50A 4ED1A 4FM9A 4RZRA 3V6JA 3VPCA 4EGJA 1M7JA 3BABA 5KFPA 2GLTA 3BAAA 1BNCA 1EZ1A 3DF7A 4RNOA 2V58A 5KKNB 2CKZB 5JUMA 3R5HA 3KHRA 3RAQA 4ECUA 4DV3H 2F4VH 2J9GA 2VOBA 5FD6A 4DR7H 3RIZA 3E5NA 1GSAA 3CQZA 5KFZA 5DG7A 5IYBG 2W9BA 2W8KA 4ECZA 2UXBH 4EEQA 4QW8A 4F4ZA 1TA8A 3GIMA 3RUPA 2OLSA 5DG9A 3MWDA 1WCMG 5C44G 3GTGA 2C35B 4TUYF 3GV7B 2JA7G 1W93A 4Q45A 2FLNA 1TWAA 3CVZA 2FMAA 5C4XG 5KFOA 1HNWH 2V5AA 3ETHA 4BY7G 1ZHQA 3K3PA 2UVVA 5D1OA 3RB3A 3R23A 4C5BA 2IP4A 4HNTA 1DGSA 3KHLA 4DV0H 1M0TA 3MWEA 3RGXA 2WB1A 5FPRA 4MV8A 1XMQH 3BA8A 4OX9H 2ZM6H 4R8UA 4TQRA 2W6QA 2W57A 2I87A 4BBRG 4X64H 2R93G 3L2PA 1GYFA 3KHGA 4MV9A 3G6YA 3MR2A 1DV2A 3AYHB 1Y1VG 5LOVF 4O3SA 3T5LA 2HVSA 3GQCA 4Q43A 5DGAA 4QWAA 4DL2A 4JV5H 4RB3C 4EYIB 2YW2A 2JA5A 3WO0A 4JYAH 4J9MA 4LFAH 3HXLA 2P0AA 3G8CA 3ORQA 2NVXA 3EYYA 5LYJF 5KT5A 1S0NA 4J9SA 2CW7A 4UFZA 1S0OA 2IA6A 4B3MH 2E5LH 1PK8A 4HYKA 2UXDH 4EG0A 4HNUA 2WYOA 4A3BG 2XCPA 2R7LA 4JI8H 1W96A 4F50A 4J9RA 4YQWA 4FBUA 2R7KA 1K83A 4LF8H 2UVWA 5FJ8G 1L2ZA 2YZGA 4O4LF 4EBCA 3N40P 3RB0A 1PX2A 3Q8QB 4YHHH 4MAMA 5L1KA 2ZDQA 3ORRA 3RV3A 3FKIG 5T14A 3N6XA 3GIKA 2UUBH 4XYLB 4RU9A 4IRDA 4UCTA 4U6PA 4DR5H 4LSXA 4TV8F 4B3SH 3J80W 3H20A 5CA1F 3EPIA 2E2IA 3Q8SB 3Q2OA 1J5EH 5H80A 3N42B 4ECTA 1E4EA 3K3VA 3HOYG 3JRXA 5KG7A 4LF7H 4JUZA 5FLMG 4TQSA 5J2TF 3RAXA 2JA6G 2XGQA 5EZYF 5KFVA 3MWMA 5LL6b 5I47A 2FK2A 2HGSA 4DL7A 1JX4A 5IT9W 5DG8A 4YP3A 4UCOA 2HVQA 5KFMA 2W9BB 1JLLB 2B63G 4DR6H 4DV4H 2WB1E 1JXLA 1C3OA 5C5JA 3J81W 4F4YA 1WCMA 3VPDA 4ETSA 1M0WA 4O3QA 2C28A 4J9NA 3MR3A 1Y14B 4LF4H 4J9KA 3KTMA 1HNZH 2JA7A 2WDTA 2WTFA 4DV6H 2BQRA 1S97A 1N32H 3JZIA 1KEEA 4ED8A 3OSNA 3K5HA 4DV5H 3I4MG 2CQYA 4WBNF 5D1OB 1XNRH 1TWHA 4JI5H 3VMMA 5F9NA 2O03A 3TINA 4NLGA 1CQIB 3GIDA 1FKAH 1N56A 5HV6A 5EDWA 2FK1A 4EBEA 4A3LG 4A3DG 5HBRB 4EFBA 4Q44A 4YBZB 3U9TA 4A2BA 2R93A 4ED3A 2GPWA 1GSOA 3PR4A 4J9QA 3ETJA 1KJIA 5F9LA 2W7PA 1RK5A 3PZPA 1Y1VA 4UCVA 3RF2A 4JI4H 4APMA 2XIGA 2W7OA 3HOWG 5LMNH 3R5XA 1FVIA 4MV7A 2JEGA 2IMWP 4NXMH 3RBEA 1BXRA 2R7MA 1Z2PX 4J9PA 4LFCH 5BMVF 3KHHA 1EHIA 2YS7A 3PN1A 2E2HA 5KFRA 4F4XA 3T5HA 3KXYT 5KFAA 4YJ2F 2UXCH 2R87A 3V4SA 2PBZA 2Y0SE 3SE7A 1T3NA 2YU9A 2JEJA 1B04A 4IAJA 4ED0A 1Y1WG 2R86A 4GLXA 3PO3G 3HOZG 4O2AF 2R8HA 1I94H 3TQ1A 2YYAA 4MTDA 3R5FA 3Q8PB 5KG4A 2BR0A 3FKIA 1ZETA 3H0GG 4IHJF 4ME6A 5BPHA 3T5KA 2VA2A 2W6NA 3HOXG 2R92G 5CA0F 3MR5A 1UC8A 2BQ3A 2J6UA 1CQJB 4RAYA 1E4EB 1R9TA 4ZI7F 1WSCA 3GLKA 5CB4F 2AU0A 2M05A 2JA6A 3IG0A 3GIQA 4CC5A 4HNVA 5C1PA 3GTPA 3M4IA 5IWAH 2VUGA 4X66H 5FD5A 2YZMA 5KG0A 1RJQA 5KFWA 5FPOA 4LFBH 5EWEA 5EWFA 3QZ8A 4UCSA 4Q8EA 2B63A 5KT4A 3SI8A 1ZHSA 4MTEA 3QFFA 2OWOA 3GTJA 3LWBA 3GV5B 2ASJA 1UC9A 4XYMB 1VBHA 4A2AA 5CAEB 1DV1A 3OSPA 1GO3E 2ZDHA 3N44B 2QYZA 4O3PA 4A3JG 1TWFA 4HQ6A 3RB4A 3T1HH 4RB1A 2NU6B 4O4IF 2XGPA 3OTOH 3OUUA 1AUXA 4J0MA 2NU7B 4MV3A 4Y8VB 4RUAA 5KX5F 3MFHA 2VQDA 5KFLA 5JVLA 4FBTA 2JEIA 1B6RA 1DIKA 5EWGA 3RV4A 2YRXA 2W71A 1V4YA 5EOYA 1S03G 4YJ3F 3FDSA 3JRWA 1MZBA 4MV4A 4B3RH 1B33N 3M9MB 1EUCB 5L9XA 4RB0A 1ULZA 5GONF 2NU8B 3PR5B 4BBSG 1CS0A 1K1SA 4L1KA 2Y0SA 3M9OB 1N36H 1I3QA 2W70A 2W6OA 4A3EG 4BXXG 2R6FA 2FPIB 3HB9A 4X65H 4YAJB 2MCTA 4B3TH 2PMZA 1AN7A 1XDNA 4EYHB 4LF5H 4DUYH 3I12A 4J9LA 1S9FA 5D1PA
chains in the Genus database with same CATH topology
2FKLA 1OWTA 3KTMA 2FK2A 2FK1A 4PWQA 2FK3A 2M05A 2FJZA 2FMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKL A;  1OWT A;  3KTM A;  2FK2 A;  2FK1 A;  4PWQ A;  2FK3 A;  2M05 A;  2FJZ A;  2FMA A; 
#chains in the Genus database with same CATH topology
 5KFK A;  3KAJ A;  3V4Z A;  1VKZ A;  3RJ0 A;  2FP4 B;  5L1J A;  5KT6 A;  2DWC A;  5FLX W;  2VUM G;  4LF9 H;  1M6V A;  4E4T A;  5C3E G;  4Q8F A;  5BR8 H;  4A3K G;  2I80 A;  3H4D A;  3PVX A;  4I50 F;  2JA8 G;  3UFX B;  4MA0 A;  4GC7 A;  4LMY A;  5KFI A;  1KBL A;  2V9W A;  3C0F B;  4YR2 A;  4I4T F;  1Y1W A;  4DLK A;  3JSN A;  4YY3 H;  1A0I A;  5KFN A;  3BJY A;  4IRK A;  5KFU A;  1RYR A;  4A3G G;  3N8D A;  3UQ8 A;  3H0G A;  5K2M A;  5JH7 F;  4DR4 H;  1E4F T;  2C2E A;  3KAL A;  3GTK A;  2R92 A;  4U7C A;  4DV1 H;  1Z2N X;  2XD4 A;  4DR3 H;  1B6S A;  3I4N G;  1S68 A;  5KFQ A;  4F4W A;  2W8L A;  2W9C A;  2HJW A;  4MV1 A;  5DQI A;  4YB8 B;  5A2Q W;  3TIG A;  3MR6 A;  3HBL A;  5L1I A;  2AQ4 A;  2C2R A;  2HHH H;  3LML A;  2R8G A;  5KG6 A;  2KSW A;  4ECS A;  2DIK A;  3WO1 A;  3GII A;  4XX0 B;  2WE6 A;  5LP6 F;  4GKJ H;  5LMU H;  5DLF A;  2DZD A;  2R8I A;  3K5I A;  3H40 A;  4C5A A;  4ZOL F;  3F8N A;  5KFF A;  2XC9 A;  1N34 H;  1BJT A;  1TAE A;  3LP8 A;  3KAK A;  5IP7 G;  2UVR A;  4R7R A;  3Q8R B;  2FB9 A;  3T5J A;  4ZQI A;  4FU0 A;  1EYZ A;  4UCR A;  4C2M A;  4O3R A;  3L4J A;  5D8D A;  2FK3 A;  1JDE A;  2FPG B;  4I55 F;  2J6S A;  5KFJ A;  4EFE A;  2AGO A;  1ZQ7 A;  4FS2 A;  4O2B F;  4QJF A;  5DGB A;  4QW9 A;  1HNX H;  3N41 B;  4RNN A;  5KFG A;  4DL3 A;  2UVU A;  2R82 A;  1KJ8 A;  3MJF A;  4RAZ A;  3JSL A;  5KFH A;  2YL2 A;  3OHA A;  4DUZ H;  4DR2 H;  1V9P A;  2UU9 H;  5KT3 A;  1GSH A;  4C5C A;  1KJQ A;  4CC6 A;  4RNM A;  2PMZ E;  2X0S A;  5KFE A;  1T36 A;  4JI0 H;  4ED6 A;  1I7N A;  1JKJ B;  2AGQ A;  2DLN A;  4RZQ A;  4XZ3 B;  2QK4 A;  2WAQ E;  4DL4 A;  2JEF A;  1SFO A;  4JI1 H;  3RTX A;  4RB2 C;  1TWC A;  3GV8 B;  5KT7 A;  2YCH A;  1AUV A;  4AYB A;  4FS1 A;  4NXN H;  1TWG A;  3GTM A;  4ECW A;  4A3F G;  4JI6 H;  3TQT A;  2NU9 B;  4TV9 F;  5KFD A;  4DV2 H;  3GIL A;  4EEY A;  4QWE A;  3PO2 G;  2W6Z A;  4J9O A;  3H3V H;  4GKK H;  1I6U A;  4ECQ A;  2RGR A;  2SCU B;  4QIW E;  1GGO A;  2VUM A;  1N33 H;  2AGP A;  1WR2 A;  4ECY A;  1SYX B;  3HOV G;  2ATL A;  4IWY A;  3L4K A;  5IYC G;  3HKZ A;  1XMO H;  4O3O A;  4IR9 A;  2C2D A;  4IWX A;  4K0K H;  1V51 A;  5C8Y F;  4A3M G;  4M7E A;  1RJP A;  1VBG A;  3TII A;  5C1O A;  2R7Z G;  4PWQ A;  1JIH A;  2FE3 A;  1IBK H;  4PDB A;  4ECR A;  2V59 A;  3BQ1 A;  3IN5 A;  2J6T A;  2VA3 A;  3BA9 A;  5DLG A;  1S0M A;  5KFY A;  2C22 A;  4MA5 A;  3GTQ A;  4YR3 A;  2GPS A;  5KG2 A;  2CW8 A;  3GIJ A;  2W9C B;  3EPG A;  5KFS A;  4YAK B;  1KJ9 A;  2PVP A;  2W9A A;  3G6X A;  1IBL H;  4KHP H;  1RK6 A;  4X62 H;  3JAM W;  4YR0 A;  3OHB A;  3H4B A;  1JDB B;  1VAJ A;  4I7H A;  4LH6 A;  3NGD A;  2DPI A;  5JVD F;  2RGV A;  3RGZ A;  4LSA A;  1KC7 A;  3MFI A;  5KG1 A;  1K1Q A;  2V4R A;  3PW5 A;  1Z2O X;  2DPJ A;  2OH2 A;  1BGW A;  2W6P A;  3QZ7 A;  2UUA H;  5BPF A;  3N43 B;  3PW2 A;  5KFT A;  2VPS A;  5KG3 A;  4JV0 A;  2RDJ A;  5JQW A;  4ED7 A;  2UUC H;  2WAQ A;  4A3I G;  3HOU G;  5KFB A;  3Q1K A;  1KJJ A;  4WD3 A;  2VQF H;  2IBK A;  4LF6 H;  2CZG A;  2ZJT A;  3PW7 A;  4DL5 A;  1RJR A;  4DR1 H;  5L1L A;  4DL6 A;  3J7A K;  5DQH A;  1UNN C;  1IOV A;  2XCL A;  2YS6 A;  2YZN A;  4AYB E;  5KT2 A;  3T1Y H;  1T94 A;  2I8C A;  4IZO A;  3U9S A;  4IRC A;  4ZHQ F;  4RUC A;  1EUD B;  2VR1 A;  3RFC A;  4QIW A;  1P8L A;  4ECV A;  1VS0 A;  1RYS A;  5KFX A;  2ZDG A;  4DV7 H;  2PN1 A;  3M9N B;  2BQU A;  2FJZ A;  4JI3 H;  3GTO A;  4MV6 A;  2C00 A;  4JV1 A;  2R7N A;  2Q2T A;  5KG5 A;  4QWD A;  3PW0 A;  3HKZ E;  2ALZ A;  1N48 A;  3RBD A;  1OWT A;  2R84 A;  2ASD A;  4QWC A;  4Q0Y A;  2VQE H;  2JA5 G;  1I7L A;  2HVR A;  3GIP A;  3V6H A;  1E4G T;  1IOW A;  1O75 A;  1CE8 A;  2FKL A;  1WH2 A;  2RF4 A;  4LH7 A;  2R8K A;  1GLV A;  2RDI A;  4EBD A;  4ECX A;  2V4Q A;  4A3C G;  5LA6 F;  1S10 A;  5DQG A;  2FLP A;  5KFC A;  2YRW A;  2NVY A;  2VPQ A;  5IYZ F;  3BQ2 A;  4HR7 A;  1X9N A;  3GTL A;  4JI7 H;  3BQ0 A;  4G3I A;  5LXT F;  2R8J A;  3RB6 A;  2Q2U A;  4A93 G;  3G6V A;  4JV2 A;  2R7Z A;  2R85 A;  5IP9 G;  3V6K A;  3WNZ A;  4R8U B;  2W6M A;  4GC6 A;  2ASL A;  1SCU B;  1SEI A;  3PW4 A;  4AQY H;  4JI2 H;  4BWS C;  3OUZ A;  3VPB A;  2FPP B;  1HR0 H;  2NUA B;  4UCU A;  1IBM H;  5J2U F;  2FLL A;  4M9U A;  3FMA A;  4O4H F;  4ED2 A;  4EGQ A;  2XCA A;  1A9X A;  5IYD G;  4QWB A;  4BY1 G;  3BG5 A;  4O3N A;  4IR1 A;  1FJG H;  1XNQ H;  1C30 A;  1I50 A;  4ED1 A;  4FM9 A;  4RZR A;  3V6J A;  3VPC A;  4EGJ A;  1M7J A;  3BAB A;  5KFP A;  2GLT A;  3BAA A;  1BNC A;  1EZ1 A;  3DF7 A;  4RNO A;  2V58 A;  5KKN B;  2CKZ B;  5JUM A;  3R5H A;  3KHR A;  3RAQ A;  4ECU A;  4DV3 H;  2F4V H;  2J9G A;  2VOB A;  5FD6 A;  4DR7 H;  3RIZ A;  3E5N A;  1GSA A;  3CQZ A;  5KFZ A;  5DG7 A;  5IYB G;  2W9B A;  2W8K A;  4ECZ A;  2UXB H;  4EEQ A;  4QW8 A;  4F4Z A;  1TA8 A;  3GIM A;  3RUP A;  2OLS A;  5DG9 A;  3MWD A;  1WCM G;  5C44 G;  3GTG A;  2C35 B;  4TUY F;  3GV7 B;  2JA7 G;  1W93 A;  4Q45 A;  2FLN A;  1TWA A;  3CVZ A;  2FMA A;  5C4X G;  5KFO A;  1HNW H;  2V5A A;  3ETH A;  4BY7 G;  1ZHQ A;  3K3P A;  2UVV A;  5D1O A;  3RB3 A;  3R23 A;  4C5B A;  2IP4 A;  4HNT A;  1DGS A;  3KHL A;  4DV0 H;  1M0T A;  3MWE A;  3RGX A;  2WB1 A;  5FPR A;  4MV8 A;  1XMQ H;  3BA8 A;  4OX9 H;  2ZM6 H;  4R8U A;  4TQR A;  2W6Q A;  2W57 A;  2I87 A;  4BBR G;  4X64 H;  2R93 G;  3L2P A;  1GYF A;  3KHG A;  4MV9 A;  3G6Y A;  3MR2 A;  1DV2 A;  3AYH B;  1Y1V G;  5LOV F;  4O3S A;  3T5L A;  2HVS A;  3GQC A;  4Q43 A;  5DGA A;  4QWA A;  4DL2 A;  4JV5 H;  4RB3 C;  4EYI B;  2YW2 A;  2JA5 A;  3WO0 A;  4JYA H;  4J9M A;  4LFA H;  3HXL A;  2P0A A;  3G8C A;  3ORQ A;  2NVX A;  3EYY A;  5LYJ F;  5KT5 A;  1S0N A;  4J9S A;  2CW7 A;  4UFZ A;  1S0O A;  2IA6 A;  4B3M H;  2E5L H;  1PK8 A;  4HYK A;  2UXD H;  4EG0 A;  4HNU A;  2WYO A;  4A3B G;  2XCP A;  2R7L A;  4JI8 H;  1W96 A;  4F50 A;  4J9R A;  4YQW A;  4FBU A;  2R7K A;  1K83 A;  4LF8 H;  2UVW A;  5FJ8 G;  1L2Z A;  2YZG A;  4O4L F;  4EBC A;  3N40 P;  3RB0 A;  1PX2 A;  3Q8Q B;  4YHH H;  4MAM A;  5L1K A;  2ZDQ A;  3ORR A;  3RV3 A;  3FKI G;  5T14 A;  3N6X A;  3GIK A;  2UUB H;  4XYL B;  4RU9 A;  4IRD A;  4UCT A;  4U6P A;  4DR5 H;  4LSX A;  4TV8 F;  4B3S H;  3J80 W;  3H20 A;  5CA1 F;  3EPI A;  2E2I A;  3Q8S B;  3Q2O A;  1J5E H;  5H80 A;  3N42 B;  4ECT A;  1E4E A;  3K3V A;  3HOY G;  3JRX A;  5KG7 A;  4LF7 H;  4JUZ A;  5FLM G;  4TQS A;  5J2T F;  3RAX A;  2JA6 G;  2XGQ A;  5EZY F;  5KFV A;  3MWM A;  5LL6 b;  5I47 A;  2FK2 A;  2HGS A;  4DL7 A;  1JX4 A;  5IT9 W;  5DG8 A;  4YP3 A;  4UCO A;  2HVQ A;  5KFM A;  2W9B B;  1JLL B;  2B63 G;  4DR6 H;  4DV4 H;  2WB1 E;  1JXL A;  1C3O A;  5C5J A;  3J81 W;  4F4Y A;  1WCM A;  3VPD A;  4ETS A;  1M0W A;  4O3Q A;  2C28 A;  4J9N A;  3MR3 A;  1Y14 B;  4LF4 H;  4J9K A;  3KTM A;  1HNZ H;  2JA7 A;  2WDT A;  2WTF A;  4DV6 H;  2BQR A;  1S97 A;  1N32 H;  3JZI A;  1KEE A;  4ED8 A;  3OSN A;  3K5H A;  4DV5 H;  3I4M G;  2CQY A;  4WBN F;  5D1O B;  1XNR H;  1TWH A;  4JI5 H;  3VMM A;  5F9N A;  2O03 A;  3TIN A;  4NLG A;  1CQI B;  3GID A;  1FKA H;  1N56 A;  5HV6 A;  5EDW A;  2FK1 A;  4EBE A;  4A3L G;  4A3D G;  5HBR B;  4EFB A;  4Q44 A;  4YBZ B;  3U9T A;  4A2B A;  2R93 A;  4ED3 A;  2GPW A;  1GSO A;  3PR4 A;  4J9Q A;  3ETJ A;  1KJI A;  5F9L A;  2W7P A;  1RK5 A;  3PZP A;  1Y1V A;  4UCV A;  3RF2 A;  4JI4 H;  4APM A;  2XIG A;  2W7O A;  3HOW G;  5LMN H;  3R5X A;  1FVI A;  4MV7 A;  2JEG A;  2IMW P;  4NXM H;  3RBE A;  1BXR A;  2R7M A;  1Z2P X;  4J9P A;  4LFC H;  5BMV F;  3KHH A;  1EHI A;  2YS7 A;  3PN1 A;  2E2H A;  5KFR A;  4F4X A;  3T5H A;  3KXY T;  5KFA A;  4YJ2 F;  2UXC H;  2R87 A;  3V4S A;  2PBZ A;  2Y0S E;  3SE7 A;  1T3N A;  2YU9 A;  2JEJ A;  1B04 A;  4IAJ A;  4ED0 A;  1Y1W G;  2R86 A;  4GLX A;  3PO3 G;  3HOZ G;  4O2A F;  2R8H A;  1I94 H;  3TQ1 A;  2YYA A;  4MTD A;  3R5F A;  3Q8P B;  5KG4 A;  2BR0 A;  3FKI A;  1ZET A;  3H0G G;  4IHJ F;  4ME6 A;  5BPH A;  3T5K A;  2VA2 A;  2W6N A;  3HOX G;  2R92 G;  5CA0 F;  3MR5 A;  1UC8 A;  2BQ3 A;  2J6U A;  1CQJ B;  4RAY A;  1E4E B;  1R9T A;  4ZI7 F;  1WSC A;  3GLK A;  5CB4 F;  2AU0 A;  2M05 A;  2JA6 A;  3IG0 A;  3GIQ A;  4CC5 A;  4HNV A;  5C1P A;  3GTP A;  3M4I A;  5IWA H;  2VUG A;  4X66 H;  5FD5 A;  2YZM A;  5KG0 A;  1RJQ A;  5KFW A;  5FPO A;  4LFB H;  5EWE A;  5EWF A;  3QZ8 A;  4UCS A;  4Q8E A;  2B63 A;  5KT4 A;  3SI8 A;  1ZHS A;  4MTE A;  3QFF A;  2OWO A;  3GTJ A;  3LWB A;  3GV5 B;  2ASJ A;  1UC9 A;  4XYM B;  1VBH A;  4A2A A;  5CAE B;  1DV1 A;  3OSP A;  1GO3 E;  2ZDH A;  3N44 B;  2QYZ A;  4O3P A;  4A3J G;  1TWF A;  4HQ6 A;  3RB4 A;  3T1H H;  4RB1 A;  2NU6 B;  4O4I F;  2XGP A;  3OTO H;  3OUU A;  1AUX A;  4J0M A;  2NU7 B;  4MV3 A;  4Y8V B;  4RUA A;  5KX5 F;  3MFH A;  2VQD A;  5KFL A;  5JVL A;  4FBT A;  2JEI A;  1B6R A;  1DIK A;  5EWG A;  3RV4 A;  2YRX A;  2W71 A;  1V4Y A;  5EOY A;  1S03 G;  4YJ3 F;  3FDS A;  3JRW A;  1MZB A;  4MV4 A;  4B3R H;  1B33 N;  3M9M B;  1EUC B;  5L9X A;  4RB0 A;  1ULZ A;  5GON F;  2NU8 B;  3PR5 B;  4BBS G;  1CS0 A;  1K1S A;  4L1K A;  2Y0S A;  3M9O B;  1N36 H;  1I3Q A;  2W70 A;  2W6O A;  4A3E G;  4BXX G;  2R6F A;  2FPI B;  3HB9 A;  4X65 H;  4YAJ B;  2MCT A;  4B3T H;  2PMZ A;  1AN7 A;  1XDN A;  4EYH B;  4LF5 H;  4DUY H;  3I12 A;  4J9L A;  1S9F A;  5D1P A; 
#chains in the Genus database with same CATH homology
 2FKL A;  1OWT A;  3KTM A;  2FK2 A;  2FK1 A;  4PWQ A;  2FK3 A;  2M05 A;  2FJZ A;  2FMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...