2FJZA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fjzA00
3KTMA 2FK1A 1OWTA 2FJZA 2FK2A 2FK3A 2FKLA 2M05A 2FMAA 4PWQA
chains in the Genus database with same CATH superfamily
2FK1A 4UCSA 2V4QA 4A3BG 4Q0YA 4RB0A 4O3RA 4JI2H 4LF4H 1SYXB 4LF5H 2W6NA 3V6HA 3M4IA 2W9BA 5CAEB 5HBRB 3L4KA 2JEFA 1EYZA 4IRDA 5KFGA 3RBEA 4Q43A 3R5FA 3V6KA 3HKZA 5KFBA 4IAJA 4XZ3B 2Q2TA 3JSLA 2FLPA 1GO3E 1ZHSA 3I4NG 1JLLB 5L1KA 4FS2A 4ZHQF 5J2UF 1S03G 5LOVF 3KHHA 2HVRA 1B6SA 3RIZA 3R5XA 3GTPA 2VUGA 2YCHA 3RJ0A 1E4EA 4J9PA 4ED0A 2FK3A 1VAJA 3GTLA 2ASJA 4JV5H 3FKIA 1V4YA 3I12A 2Q2UA 3VPDA 4A3CG 5KFEA 1M0WA 1WSCA 2V5AA 3WO1A 3OHAA 1BNCA 2NU6B 3H40A 5KG6A 3GIJA 1MZBA 5C4XG 3JZIA 3K3PA 4XYMB 3LP8A 3PR4A 2W6MA 2M05A 1PX2A 5JH7F 4ED3A 1W93A 4MV7A 3KTMA 3QFFA 3T5JA 2AGQA 3T5HA 3N8DA 4QJFA 2E2IA 4ETSA 3PVXA 3H0GG 4XYLB 1WCMA 4F4ZA 3BA8A 4JI4H 2W6PA 1GSHA 4A3KG 4Q8EA 3C0FB 1Y1WA 3BAAA 2WDTA 2ZDQA 4LF9H 2YU9A 2C35B 2RDIA 5KG0A 4JI5H 1IOVA 2NU8B 5IYDG 4I4TF 1AUVA 1T36A 2WAQA 3KALA 4DV1H 2UUCH 1EHIA 2C00A 1TWGA 2Y0SE 1VKZA 1RJRA 2ASDA 5KG2A 1M6VA 5DG9A 2R8IA 3SE7A 5KT2A 3U9TA 3HBLA 5FPOA 3OUZA 3PW2A 3OTOH 2PBZA 1KJ9A 4EG0A 4DUZH 3IN5A 5KT4A 2JA7A 2XC9A 3SI8A 2UVUA 1SEIA 3ORQA 4QWEA 4PDBA 3KAJA 3G6VA 2NVYA 4ME6A 1KJQA 4QIWA 3IG0A 1KC7A 4MV6A 1IBLH 5BR8H 2J6TA 1JDBB 2BQ3A 4JV2A 2JA7G 2UXCH 4DUYH 4GKKH 5KG3A 2QK4A 2XIGA 2R92G 1I3QA 4A2BA 3PO3G 2YYAA 1DV2A 2R8KA 2J6SA 3M9OB 2GPWA 3EPGA 4ECTA 2W6ZA 3HOWG 3GLKA 4DR1H 2RGRA 4IWXA 3OUUA 3VPBA 5EDWA 4Q8FA 3AYHB 3GV8B 4UFZA 3RUPA 2R8HA 4DV0H 4L1KA 5C44G 2R7KA 3J81W 2B63G 2NU7B 2JA8G 4RUAA 4RNOA 4EEYA 1VS0A 5IWAH 1C3OA 1UNNC 3RB0A 1A9XA 3BQ2A 1Z2OX 4JI7H 4UCOA 5KFTA 3J7AK 1L2ZA 1GYFA 3ETJA 3M9MB 3CQZA 1TWCA 3G6XA 2Y0SA 1IOWA 4UCTA 2BQRA 2HVSA 1S0OA 4YY3H 3RBDA 2I8CA 2XGPA 4A3LG 1EUDB 1UC8A 2RGVA 4RAZA 3TQTA 5DGBA 1GSOA 4F4WA 4B3TH 4JYAH 4BBRG 1Z2NX 4X65H 1WCMG 2R84A 1S68A 3GTGA 4DR4H 1DIKA 1IBKH 2PVPA 3N40P 2ZM6H 5GONF 1RYSA 4JI1H 1GSAA 3RAQA 2W7PA 4HR7A 2R85A 4DV3H 1CS0A 5KFDA 1X9NA 3HXLA 4MA5A 2AQ4A 4X64H 2J6UA 4LF7H 2FE3A 1JDEA 2GLTA 2V4RA 2HVQA 4YJ3F 5EWGA 3KHGA 2DIKA 3MR3A 3EPIA 1V9PA 4LSAA 2FPGB 5KFNA 3RB4A 3KXYT 4LF6H 1I7NA 4HNVA 1N32H 2FMAA 5KG4A 4B3RH 1S10A 5JVLA 5JUMA 5C3EG 2XGQA 2W8LA 2YRWA 2UU9H 3RAXA 4RB1A 3N43B 4LH6A 4J9SA 5IP9G 1EUCB 3V4SA 4EYHB 4ED6A 2OWOA 2WB1E 5BPFA 2W6OA 4NLGA 1KBLA 3GIIA 1Y1WG 4AYBE 2XCLA 1FJGH 3H20A 4IHJF 1B04A 1P8LA 3T1YH 1RJPA 2FPPB 5KFUA 5CB4F 4QWAA 3GILA 1TAEA 2W8KA 3K5HA 2V58A 1ULZA 1CQIB 3GIDA 5KFIA 4DL7A 3H3VH 5KFJA 2FJZA 4F4YA 1XDNA 5FD6A 1WH2A 2XD4A 4QW9A 2CZGA 2UUBH 2R8JA 1E4EB 4ED2A 4O3NA 3HOUG 5F9LA 5DQGA 3HOZG 5KFAA 4WBNF 4ECZA 2ZDHA 4TUYF 3HB9A 2VQDA 3G8CA 4O4LF 4YR0A 2VQFH 2AGOA 1J5EH 4NXMH 4EGJA 2OH2A 1A0IA 3PW5A 3FDSA 1I50A 5KFPA 2YRXA 3GTJA 3PW7A 5DQIA 5BPHA 5FLXW 3KHRA 4U7CA 4JI3H 4YJ2F 3U9SA 4UCUA 5LMNH 4C2MA 4DR6H 1K1QA 4O2AF 1S97A 4QWDA 4FBTA 4MV9A 2I80A 4LMYA 3HOXG 1BXRA 3MR6A 2IMWP 3GIPA 2AGPA 2W9BB 4DL2A 1JKJB 1BGWA 5KFWA 2O03A 5KFLA 4DL3A 1I7LA 2C2DA 5LL6b 4AQYH 1SFOA 5T14A 3HOVG 2KSWA 1Y14B 4IWYA 2V59A 2ATLA 2JA6A 5LYJF 4J9QA 1JX4A 2R8GA 5D8DA 5EZYF 3VMMA 4C5CA 3N44B 5D1OB 4J9LA 3GTMA 4YR3A 4Y8VB 3RV3A 1RYRA 2E5LH 4GC6A 2CW7A 5EWEA 5FLMG 2UXDH 1M0TA 3TIIA 2C2EA 2RF4A 3EYYA 4R7RA 3BA9A 4E4TA 3QZ7A 3V6JA 4R8UB 4LSXA 2YZMA 2YW2A 3L4JA 4RZQA 4HNUA 3JRWA 3GQCA 2YZNA 4J9RA 5D1PA 2DWCA 5H80A 2NU9B 3JAMW 4QIWE 2F4VH 2BQUA 3RGZA 4RU9A 4HYKA 4ED1A 3Q1KA 4A3FG 1RJQA 1RK5A 4MV1A 4JUZA 4AYBA 2XCPA 2VQEH 4M7EA 4BY7G 2R93A 2WB1A 1N34H 4TQRA 3Q8PB 4J9NA 2X0SA 3BQ1A 4DL5A 1T94A 4A2AA 4JI8H 3GIKA 2FLNA 4EYIB 4DV4H 3ORRA 4J9MA 5IYZF 3MFIA 4TV8F 5FPRA 4O4HF 4YBZB 4O3QA 2FPIB 4TV9F 4MV4A 4NXNH 2WAQE 1JIHA 1XMQH 1UC9A 4EBDA 5DLFA 2IBKA 4BXXG 2WYOA 3FMAA 4JI0H 2NVXA 1W96A 4YQWA 3GTKA 4CC5A 3TINA 2W71A 3PR5B 3VPCA 4ZI7F 1CQJB 5KFSA 4K0KH 1KJ8A 5DQHA 4U6PA 5KG5A 4GKJH 3GTOA 1HR0H 2YS7A 4RB3C 2FB9A 3OSPA 2VUMA 4A3DG 4A3JG 4Q45A 3PO2G 4YAKB 2R7ZA 5KFCA 4RUCA 4LFBH 4EEQA 3TIGA 4ZOLF 3MJFA 3H0GA 3NGDA 4GLXA 4DR2H 3BJYA 4EBEA 1SCUB 4RAYA 2R87A 5DLGA 1DGSA 4I55F 4JV0A 3MR5A 4C5BA 1PK8A 2HJWA 5KFOA 4LFAH 2UVWA 4DV2H 5IYCG 1EZ1A 2VPQA 2SCUB 4UCVA 2B63A 4A3IG 4MTEA 1FVIA 4G3IA 3FKIG 4WD3A 2UUAH 4XX0B 1T3NA 4B3MH 4ECQA 2MCTA 3MR2A 2W70A 3RV4A 4IRCA 5I47A 4MAMA 1V51A 4ECYA 4A3EG 5KFXA 2FLLA 5D1OA 3RTXA 4JV1A 5C8YF 5DG7A 5C5JA 4TQSA 3HKZE 3G6YA 4LF8H 4BY1G 4ECSA 2C22A 4Q44A 4FU0A 5KFRA 4ECRA 3ETHA 3GV7B 4R8UA 2R7ZG 4MV8A 5KFQA 3QZ8A 5KG7A 4BBSG 4O3OA 2QYZA 2OLSA 1Y1VG 4YB8B 5FJ8G 5KT7A 4X62H 3GIQA 3K5IA 1IBMH 5LA6F 4A3MG 5CA0F 1I6UA 2FK2A 3Q2OA 3I4MG 4QW8A 1Z2PX 2VOBA 4IR1A 2PN1A 5CA1F 4DLKA 5LMUH 2JA5G 1E4GT 2CW8A 4I50F 1XMOH 1S0MA 2JEIA 2ZJTA 4DR3H 4ECVA 2UXBH 3H4BA 4B3SH 1C30A 3RF2A 1B33N 4CC6A 5FD5A 4RZRA 3GIMA 5KFZA 2DLNA 5KFKA 1N48A 1S0NA 1BJTA 4I7HA 2VPSA 4ECXA 4ED8A 2UVRA 3RFCA 2PMZE 5L1IA 3V4ZA 4FBUA 5JQWA 2V9WA 4MA0A 2JA6G 5LP6F 4DV5H 1TWAA 5KT3A 1Y1VA 2VA3A 1O75A 3LMLA 3N6XA 4ZQIA 2W57A 4BWSC 4RB2C 5KG1A 4DL4A 2DPIA 4FM9A 3JRXA 2NUAB 1GLVA 5LXTF 2RDJA 2AU0A 5C1OA 4M9UA 2JEJA 2YL2A 1KJIA 3BG5A 2W9CB 2VA2A 4MTDA 3MWMA 5L1LA 3PN1A 4F50A 3R23A 3PW4A 5KFHA 2JEGA 2WTFA 5F9NA 1AUXA 1JXLA 4O2BF 1R9TA 4ECWA 3HOYG 1TWFA 1I94H 4YP3A 3E5NA 1N56A 2I87A 4APMA 2R82A 4OX9H 4O4IF 2R7LA 3J80W 3JSNA 1WR2A 5BMVF 5HV6A 2FP4B 5KFMA 4IZOA 1HNXH 5A2QW 2VR1A 4J9OA 2R7NA 2HGSA 5KT5A 2ASLA 3L2PA 4EGQA 5KT6A 4DR5H 5EOYA 4HNTA 2W7OA 4IRKA 3N42B 4DL6A 3T5KA 1DV1A 1XNQH 2J9GA 4RNMA 3H4DA 4PWQA 1TWHA 5L9XA 4LH7A 5K2MA 1TA8A 5EWFA 3Q8QB 4FS1A 4EBCA 4YR2A 3RB6A 4GC7A 3BQ0A 2WE6A 5KFYA 1CE8A 4YHHH 2R7MA 4A3GG 3BABA 4LFCH 3N41B 5C1PA 3TQ1A 2YZGA 5KX5F 4IR9A 2HHHH 2P0AA 3Q8RB 3GTQA 4J9KA 4X66H 4EFEA 4A93G 2DZDA 3OHBA 2VUMG 4QWCA 4J0MA 2E2HA 4KHPH 2CKZB 2YS6A 5KFFA 2W6QA 2W9CA 3DF7A 4HQ6A 3UQ8A 4ECUA 3LWBA 1M7JA 4EFBA 3PW0A 1VBGA 1FKAH 5JVDF 1ZQ7A 5J2TF 4QWBA 3KAKA 2R92A 3PZPA 1RK6A 2CQYA 3OSNA 2GPSA 3UFXB 5L1JA 1E4FT 3RGXA 1N33H 1KEEA 4DV6H 5IP7G 4RNNA 1K83A 3K3VA 2DPJA 2C28A 3KHLA 3Q8SB 3F8NA 2IA6A 4O3SA 5KFVA 1B6RA 2PMZA 2ZDGA 4ED7A 1GGOA 2XCAA 2ALZA 5IT9W 3GV5B 1XNRH 2IP4A 2R93G 3T5LA 1AN7A 3RB3A 3R5HA 1S9FA 1HNWH 2JA5A 2R6FA 3MWEA 2FKLA 3M9NB 5KKNB 2BR0A 3WO0A 1K1SA 5DG8A 4YAJB 2W9AA 2C2RA 4O3PA 4JI6H 3T1HH 1ZETA 2R86A 4F4XA 3MWDA 5DGAA 1VBHA 4DR7H 1ZHQA 4C5AA 3MFHA 1OWTA 4DV7H 4MV3A 1KJJA 5IYBG 1HNZH 1N36H 4UCRA 2UVVA 3WNZA 3CVZA
chains in the Genus database with same CATH topology
3KTMA 2FK1A 1OWTA 2FJZA 2FK2A 2FK3A 2FKLA 2M05A 2FMAA 4PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTM A;  2FK1 A;  1OWT A;  2FJZ A;  2FK2 A;  2FK3 A;  2FKL A;  2M05 A;  2FMA A;  4PWQ A; 
#chains in the Genus database with same CATH topology
 2FK1 A;  4UCS A;  2V4Q A;  4A3B G;  4Q0Y A;  4RB0 A;  4O3R A;  4JI2 H;  4LF4 H;  1SYX B;  4LF5 H;  2W6N A;  3V6H A;  3M4I A;  2W9B A;  5CAE B;  5HBR B;  3L4K A;  2JEF A;  1EYZ A;  4IRD A;  5KFG A;  3RBE A;  4Q43 A;  3R5F A;  3V6K A;  3HKZ A;  5KFB A;  4IAJ A;  4XZ3 B;  2Q2T A;  3JSL A;  2FLP A;  1GO3 E;  1ZHS A;  3I4N G;  1JLL B;  5L1K A;  4FS2 A;  4ZHQ F;  5J2U F;  1S03 G;  5LOV F;  3KHH A;  2HVR A;  1B6S A;  3RIZ A;  3R5X A;  3GTP A;  2VUG A;  2YCH A;  3RJ0 A;  1E4E A;  4J9P A;  4ED0 A;  2FK3 A;  1VAJ A;  3GTL A;  2ASJ A;  4JV5 H;  3FKI A;  1V4Y A;  3I12 A;  2Q2U A;  3VPD A;  4A3C G;  5KFE A;  1M0W A;  1WSC A;  2V5A A;  3WO1 A;  3OHA A;  1BNC A;  2NU6 B;  3H40 A;  5KG6 A;  3GIJ A;  1MZB A;  5C4X G;  3JZI A;  3K3P A;  4XYM B;  3LP8 A;  3PR4 A;  2W6M A;  2M05 A;  1PX2 A;  5JH7 F;  4ED3 A;  1W93 A;  4MV7 A;  3KTM A;  3QFF A;  3T5J A;  2AGQ A;  3T5H A;  3N8D A;  4QJF A;  2E2I A;  4ETS A;  3PVX A;  3H0G G;  4XYL B;  1WCM A;  4F4Z A;  3BA8 A;  4JI4 H;  2W6P A;  1GSH A;  4A3K G;  4Q8E A;  3C0F B;  1Y1W A;  3BAA A;  2WDT A;  2ZDQ A;  4LF9 H;  2YU9 A;  2C35 B;  2RDI A;  5KG0 A;  4JI5 H;  1IOV A;  2NU8 B;  5IYD G;  4I4T F;  1AUV A;  1T36 A;  2WAQ A;  3KAL A;  4DV1 H;  2UUC H;  1EHI A;  2C00 A;  1TWG A;  2Y0S E;  1VKZ A;  1RJR A;  2ASD A;  5KG2 A;  1M6V A;  5DG9 A;  2R8I A;  3SE7 A;  5KT2 A;  3U9T A;  3HBL A;  5FPO A;  3OUZ A;  3PW2 A;  3OTO H;  2PBZ A;  1KJ9 A;  4EG0 A;  4DUZ H;  3IN5 A;  5KT4 A;  2JA7 A;  2XC9 A;  3SI8 A;  2UVU A;  1SEI A;  3ORQ A;  4QWE A;  4PDB A;  3KAJ A;  3G6V A;  2NVY A;  4ME6 A;  1KJQ A;  4QIW A;  3IG0 A;  1KC7 A;  4MV6 A;  1IBL H;  5BR8 H;  2J6T A;  1JDB B;  2BQ3 A;  4JV2 A;  2JA7 G;  2UXC H;  4DUY H;  4GKK H;  5KG3 A;  2QK4 A;  2XIG A;  2R92 G;  1I3Q A;  4A2B A;  3PO3 G;  2YYA A;  1DV2 A;  2R8K A;  2J6S A;  3M9O B;  2GPW A;  3EPG A;  4ECT A;  2W6Z A;  3HOW G;  3GLK A;  4DR1 H;  2RGR A;  4IWX A;  3OUU A;  3VPB A;  5EDW A;  4Q8F A;  3AYH B;  3GV8 B;  4UFZ A;  3RUP A;  2R8H A;  4DV0 H;  4L1K A;  5C44 G;  2R7K A;  3J81 W;  2B63 G;  2NU7 B;  2JA8 G;  4RUA A;  4RNO A;  4EEY A;  1VS0 A;  5IWA H;  1C3O A;  1UNN C;  3RB0 A;  1A9X A;  3BQ2 A;  1Z2O X;  4JI7 H;  4UCO A;  5KFT A;  3J7A K;  1L2Z A;  1GYF A;  3ETJ A;  3M9M B;  3CQZ A;  1TWC A;  3G6X A;  2Y0S A;  1IOW A;  4UCT A;  2BQR A;  2HVS A;  1S0O A;  4YY3 H;  3RBD A;  2I8C A;  2XGP A;  4A3L G;  1EUD B;  1UC8 A;  2RGV A;  4RAZ A;  3TQT A;  5DGB A;  1GSO A;  4F4W A;  4B3T H;  4JYA H;  4BBR G;  1Z2N X;  4X65 H;  1WCM G;  2R84 A;  1S68 A;  3GTG A;  4DR4 H;  1DIK A;  1IBK H;  2PVP A;  3N40 P;  2ZM6 H;  5GON F;  1RYS A;  4JI1 H;  1GSA A;  3RAQ A;  2W7P A;  4HR7 A;  2R85 A;  4DV3 H;  1CS0 A;  5KFD A;  1X9N A;  3HXL A;  4MA5 A;  2AQ4 A;  4X64 H;  2J6U A;  4LF7 H;  2FE3 A;  1JDE A;  2GLT A;  2V4R A;  2HVQ A;  4YJ3 F;  5EWG A;  3KHG A;  2DIK A;  3MR3 A;  3EPI A;  1V9P A;  4LSA A;  2FPG B;  5KFN A;  3RB4 A;  3KXY T;  4LF6 H;  1I7N A;  4HNV A;  1N32 H;  2FMA A;  5KG4 A;  4B3R H;  1S10 A;  5JVL A;  5JUM A;  5C3E G;  2XGQ A;  2W8L A;  2YRW A;  2UU9 H;  3RAX A;  4RB1 A;  3N43 B;  4LH6 A;  4J9S A;  5IP9 G;  1EUC B;  3V4S A;  4EYH B;  4ED6 A;  2OWO A;  2WB1 E;  5BPF A;  2W6O A;  4NLG A;  1KBL A;  3GII A;  1Y1W G;  4AYB E;  2XCL A;  1FJG H;  3H20 A;  4IHJ F;  1B04 A;  1P8L A;  3T1Y H;  1RJP A;  2FPP B;  5KFU A;  5CB4 F;  4QWA A;  3GIL A;  1TAE A;  2W8K A;  3K5H A;  2V58 A;  1ULZ A;  1CQI B;  3GID A;  5KFI A;  4DL7 A;  3H3V H;  5KFJ A;  2FJZ A;  4F4Y A;  1XDN A;  5FD6 A;  1WH2 A;  2XD4 A;  4QW9 A;  2CZG A;  2UUB H;  2R8J A;  1E4E B;  4ED2 A;  4O3N A;  3HOU G;  5F9L A;  5DQG A;  3HOZ G;  5KFA A;  4WBN F;  4ECZ A;  2ZDH A;  4TUY F;  3HB9 A;  2VQD A;  3G8C A;  4O4L F;  4YR0 A;  2VQF H;  2AGO A;  1J5E H;  4NXM H;  4EGJ A;  2OH2 A;  1A0I A;  3PW5 A;  3FDS A;  1I50 A;  5KFP A;  2YRX A;  3GTJ A;  3PW7 A;  5DQI A;  5BPH A;  5FLX W;  3KHR A;  4U7C A;  4JI3 H;  4YJ2 F;  3U9S A;  4UCU A;  5LMN H;  4C2M A;  4DR6 H;  1K1Q A;  4O2A F;  1S97 A;  4QWD A;  4FBT A;  4MV9 A;  2I80 A;  4LMY A;  3HOX G;  1BXR A;  3MR6 A;  2IMW P;  3GIP A;  2AGP A;  2W9B B;  4DL2 A;  1JKJ B;  1BGW A;  5KFW A;  2O03 A;  5KFL A;  4DL3 A;  1I7L A;  2C2D A;  5LL6 b;  4AQY H;  1SFO A;  5T14 A;  3HOV G;  2KSW A;  1Y14 B;  4IWY A;  2V59 A;  2ATL A;  2JA6 A;  5LYJ F;  4J9Q A;  1JX4 A;  2R8G A;  5D8D A;  5EZY F;  3VMM A;  4C5C A;  3N44 B;  5D1O B;  4J9L A;  3GTM A;  4YR3 A;  4Y8V B;  3RV3 A;  1RYR A;  2E5L H;  4GC6 A;  2CW7 A;  5EWE A;  5FLM G;  2UXD H;  1M0T A;  3TII A;  2C2E A;  2RF4 A;  3EYY A;  4R7R A;  3BA9 A;  4E4T A;  3QZ7 A;  3V6J A;  4R8U B;  4LSX A;  2YZM A;  2YW2 A;  3L4J A;  4RZQ A;  4HNU A;  3JRW A;  3GQC A;  2YZN A;  4J9R A;  5D1P A;  2DWC A;  5H80 A;  2NU9 B;  3JAM W;  4QIW E;  2F4V H;  2BQU A;  3RGZ A;  4RU9 A;  4HYK A;  4ED1 A;  3Q1K A;  4A3F G;  1RJQ A;  1RK5 A;  4MV1 A;  4JUZ A;  4AYB A;  2XCP A;  2VQE H;  4M7E A;  4BY7 G;  2R93 A;  2WB1 A;  1N34 H;  4TQR A;  3Q8P B;  4J9N A;  2X0S A;  3BQ1 A;  4DL5 A;  1T94 A;  4A2A A;  4JI8 H;  3GIK A;  2FLN A;  4EYI B;  4DV4 H;  3ORR A;  4J9M A;  5IYZ F;  3MFI A;  4TV8 F;  5FPR A;  4O4H F;  4YBZ B;  4O3Q A;  2FPI B;  4TV9 F;  4MV4 A;  4NXN H;  2WAQ E;  1JIH A;  1XMQ H;  1UC9 A;  4EBD A;  5DLF A;  2IBK A;  4BXX G;  2WYO A;  3FMA A;  4JI0 H;  2NVX A;  1W96 A;  4YQW A;  3GTK A;  4CC5 A;  3TIN A;  2W71 A;  3PR5 B;  3VPC A;  4ZI7 F;  1CQJ B;  5KFS A;  4K0K H;  1KJ8 A;  5DQH A;  4U6P A;  5KG5 A;  4GKJ H;  3GTO A;  1HR0 H;  2YS7 A;  4RB3 C;  2FB9 A;  3OSP A;  2VUM A;  4A3D G;  4A3J G;  4Q45 A;  3PO2 G;  4YAK B;  2R7Z A;  5KFC A;  4RUC A;  4LFB H;  4EEQ A;  3TIG A;  4ZOL F;  3MJF A;  3H0G A;  3NGD A;  4GLX A;  4DR2 H;  3BJY A;  4EBE A;  1SCU B;  4RAY A;  2R87 A;  5DLG A;  1DGS A;  4I55 F;  4JV0 A;  3MR5 A;  4C5B A;  1PK8 A;  2HJW A;  5KFO A;  4LFA H;  2UVW A;  4DV2 H;  5IYC G;  1EZ1 A;  2VPQ A;  2SCU B;  4UCV A;  2B63 A;  4A3I G;  4MTE A;  1FVI A;  4G3I A;  3FKI G;  4WD3 A;  2UUA H;  4XX0 B;  1T3N A;  4B3M H;  4ECQ A;  2MCT A;  3MR2 A;  2W70 A;  3RV4 A;  4IRC A;  5I47 A;  4MAM A;  1V51 A;  4ECY A;  4A3E G;  5KFX A;  2FLL A;  5D1O A;  3RTX A;  4JV1 A;  5C8Y F;  5DG7 A;  5C5J A;  4TQS A;  3HKZ E;  3G6Y A;  4LF8 H;  4BY1 G;  4ECS A;  2C22 A;  4Q44 A;  4FU0 A;  5KFR A;  4ECR A;  3ETH A;  3GV7 B;  4R8U A;  2R7Z G;  4MV8 A;  5KFQ A;  3QZ8 A;  5KG7 A;  4BBS G;  4O3O A;  2QYZ A;  2OLS A;  1Y1V G;  4YB8 B;  5FJ8 G;  5KT7 A;  4X62 H;  3GIQ A;  3K5I A;  1IBM H;  5LA6 F;  4A3M G;  5CA0 F;  1I6U A;  2FK2 A;  3Q2O A;  3I4M G;  4QW8 A;  1Z2P X;  2VOB A;  4IR1 A;  2PN1 A;  5CA1 F;  4DLK A;  5LMU H;  2JA5 G;  1E4G T;  2CW8 A;  4I50 F;  1XMO H;  1S0M A;  2JEI A;  2ZJT A;  4DR3 H;  4ECV A;  2UXB H;  3H4B A;  4B3S H;  1C30 A;  3RF2 A;  1B33 N;  4CC6 A;  5FD5 A;  4RZR A;  3GIM A;  5KFZ A;  2DLN A;  5KFK A;  1N48 A;  1S0N A;  1BJT A;  4I7H A;  2VPS A;  4ECX A;  4ED8 A;  2UVR A;  3RFC A;  2PMZ E;  5L1I A;  3V4Z A;  4FBU A;  5JQW A;  2V9W A;  4MA0 A;  2JA6 G;  5LP6 F;  4DV5 H;  1TWA A;  5KT3 A;  1Y1V A;  2VA3 A;  1O75 A;  3LML A;  3N6X A;  4ZQI A;  2W57 A;  4BWS C;  4RB2 C;  5KG1 A;  4DL4 A;  2DPI A;  4FM9 A;  3JRX A;  2NUA B;  1GLV A;  5LXT F;  2RDJ A;  2AU0 A;  5C1O A;  4M9U A;  2JEJ A;  2YL2 A;  1KJI A;  3BG5 A;  2W9C B;  2VA2 A;  4MTD A;  3MWM A;  5L1L A;  3PN1 A;  4F50 A;  3R23 A;  3PW4 A;  5KFH A;  2JEG A;  2WTF A;  5F9N A;  1AUX A;  1JXL A;  4O2B F;  1R9T A;  4ECW A;  3HOY G;  1TWF A;  1I94 H;  4YP3 A;  3E5N A;  1N56 A;  2I87 A;  4APM A;  2R82 A;  4OX9 H;  4O4I F;  2R7L A;  3J80 W;  3JSN A;  1WR2 A;  5BMV F;  5HV6 A;  2FP4 B;  5KFM A;  4IZO A;  1HNX H;  5A2Q W;  2VR1 A;  4J9O A;  2R7N A;  2HGS A;  5KT5 A;  2ASL A;  3L2P A;  4EGQ A;  5KT6 A;  4DR5 H;  5EOY A;  4HNT A;  2W7O A;  4IRK A;  3N42 B;  4DL6 A;  3T5K A;  1DV1 A;  1XNQ H;  2J9G A;  4RNM A;  3H4D A;  4PWQ A;  1TWH A;  5L9X A;  4LH7 A;  5K2M A;  1TA8 A;  5EWF A;  3Q8Q B;  4FS1 A;  4EBC A;  4YR2 A;  3RB6 A;  4GC7 A;  3BQ0 A;  2WE6 A;  5KFY A;  1CE8 A;  4YHH H;  2R7M A;  4A3G G;  3BAB A;  4LFC H;  3N41 B;  5C1P A;  3TQ1 A;  2YZG A;  5KX5 F;  4IR9 A;  2HHH H;  2P0A A;  3Q8R B;  3GTQ A;  4J9K A;  4X66 H;  4EFE A;  4A93 G;  2DZD A;  3OHB A;  2VUM G;  4QWC A;  4J0M A;  2E2H A;  4KHP H;  2CKZ B;  2YS6 A;  5KFF A;  2W6Q A;  2W9C A;  3DF7 A;  4HQ6 A;  3UQ8 A;  4ECU A;  3LWB A;  1M7J A;  4EFB A;  3PW0 A;  1VBG A;  1FKA H;  5JVD F;  1ZQ7 A;  5J2T F;  4QWB A;  3KAK A;  2R92 A;  3PZP A;  1RK6 A;  2CQY A;  3OSN A;  2GPS A;  3UFX B;  5L1J A;  1E4F T;  3RGX A;  1N33 H;  1KEE A;  4DV6 H;  5IP7 G;  4RNN A;  1K83 A;  3K3V A;  2DPJ A;  2C28 A;  3KHL A;  3Q8S B;  3F8N A;  2IA6 A;  4O3S A;  5KFV A;  1B6R A;  2PMZ A;  2ZDG A;  4ED7 A;  1GGO A;  2XCA A;  2ALZ A;  5IT9 W;  3GV5 B;  1XNR H;  2IP4 A;  2R93 G;  3T5L A;  1AN7 A;  3RB3 A;  3R5H A;  1S9F A;  1HNW H;  2JA5 A;  2R6F A;  3MWE A;  2FKL A;  3M9N B;  5KKN B;  2BR0 A;  3WO0 A;  1K1S A;  5DG8 A;  4YAJ B;  2W9A A;  2C2R A;  4O3P A;  4JI6 H;  3T1H H;  1ZET A;  2R86 A;  4F4X A;  3MWD A;  5DGA A;  1VBH A;  4DR7 H;  1ZHQ A;  4C5A A;  3MFH A;  1OWT A;  4DV7 H;  4MV3 A;  1KJJ A;  5IYB G;  1HNZ H;  1N36 H;  4UCR A;  2UVV A;  3WNZ A;  3CVZ A; 
#chains in the Genus database with same CATH homology
 3KTM A;  2FK1 A;  1OWT A;  2FJZ A;  2FK2 A;  2FK3 A;  2FKL A;  2M05 A;  2FMA A;  4PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...