2FJZA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fjzA00
1OWTA 2FJZA 2M05A 3KTMA 2FKLA 2FK2A 4PWQA 2FK3A 2FK1A 2FMAA
chains in the Genus database with same CATH superfamily
2R6FA 3BG5A 1ULZA 2YL2A 4ECTA 2J6UA 4A3DG 4ZHQF 2R92G 5KT2A 3VMMA 3GTGA 3R5HA 2XD4A 3GIPA 3ORRA 4I50F 3GTQA 2FB9A 3GV5B 4FM9A 2RGRA 1Y14B 3BQ0A 1O75A 3DF7A 4O3PA 2BQUA 3PW2A 1E4GT 2DPJA 4QIWE 2RDIA 2PMZA 2DPIA 1GSOA 1M0WA 2V4QA 1KBLA 2OLSA 3PVXA 2CW7A 3IN5A 4QW8A 3RAXA 4GKKH 4HR7A 4LF4H 3GV7B 4J9LA 1S10A 5L1JA 5KFJA 2R8HA 4F4XA 3MFIA 1S0OA 5KFXA 2R84A 4TV8F 3JZIA 4YR3A 2ASJA 1S97A 3NGDA 1S68A 5DGAA 2ALZA 3GIDA 1VAJA 4DV3H 3LP8A 3CQZA 2M05A 5IYCG 3Q8RB 4O3RA 5KFMA 1DIKA 4A3IG 5KFAA 4EBDA 4JYAH 3Q1KA 4YAJB 5L9XA 3RGZA 5F9LA 4R7RA 2NVYA 1RYRA 3U9SA 4EYIB 5CAEB 4APMA 1VBGA 3G6XA 1N34H 1J5EH 2R93G 4DR3H 1EUDB 2YW2A 3C0FB 4U7CA 5BR8H 2VA2A 1BNCA 1FVIA 5D8DA 3V4ZA 5FPOA 4AYBE 4LF9H 3BA8A 3HXLA 3HOUG 2UXCH 5BMVF 2W9BA 4C5CA 2WB1E 2JEJA 4CC6A 3GLKA 5C3EG 4EG0A 5FPRA 3K5HA 2W7PA 1EUCB 3OHAA 4J9SA 3PW5A 4EBCA 2BQ3A 1C3OA 4ECYA 3KAJA 2V4RA 4LF6H 2AQ4A 2YRWA 3U9TA 1IBLH 4MV4A 3VPBA 2CQYA 4JV0A 4MA0A 4RNMA 3TIIA 1RJPA 4Q45A 4OX9H 3KALA 4DUYH 3HOVG 2RF4A 5KFUA 4BWSC 4EEQA 3PW4A 4IZOA 1TWCA 2HVQA 3OUZA 4UCSA 3GTPA 5J2TF 3T1HH 3RB3A 1IOVA 2YZGA 4YP3A 1RK6A 3KHLA 3T5KA 2YS6A 2DIKA 3PO2G 3F8NA 2AGQA 1JIHA 5IYZF 4IRDA 4JI1H 1XNQH 1TA8A 5KG4A 4MTEA 4YQWA 1E4FT 5KFLA 1HNXH 3EPIA 4FBTA 2VOBA 1WR2A 2VUMG 5J2UF 3JAMW 1ZETA 1V9PA 2Y0SE 3E5NA 2XGQA 3GQCA 5DQGA 3H3VH 5KFIA 2YZMA 2HVSA 1VS0A 3KAKA 4JV5H 1FKAH 3N42B 2ASLA 2GPSA 4IHJF 3M9MB 3OSPA 3BABA 4DR2H 1S0NA 2R8JA 5LMNH 4QJFA 4DLKA 4DV5H 5IT9W 1I6UA 3N41B 3EPGA 1I50A 2ZDQA 3G8CA 2V9WA 2JEGA 2UUCH 5L1KA 5LXTF 4RAZA 5KG1A 2VPSA 2R7MA 4IWXA 4HNTA 5KG7A 4WD3A 5KFOA 1N36H 3QFFA 1SFOA 3TQTA 2WTFA 4MV8A 5KKNB 3GTMA 4HYKA 4O4LF 5EZYF 3MR3A 5C1PA 1KC7A 2UXBH 4TQRA 2JA6A 1HNZH 2W9BB 4LSXA 4DL5A 4I7HA 3BQ1A 3BQ2A 1Y1WG 3UFXB 3MJFA 4EGQA 3LMLA 3GIKA 4ED7A 2YCHA 1M6VA 2Q2TA 4M9UA 4B3MH 4Q8EA 1VBHA 5KFQA 4UCTA 1ZHSA 4E4TA 4DR5H 1DGSA 5DLFA 4GC7A 1AN7A 4EFBA 1KJIA 4DR1H 4QWEA 4Q43A 3V6HA 1S03G 3RFCA 3V6KA 2W70A 4MTDA 4J9KA 4L1KA 3QZ8A 2IP4A 1XMQH 5F9NA 2RDJA 4RB1A 4GKJH 2JEFA 2W6OA 4X66H 4G3IA 1KJ9A 2W6MA 4Q44A 2R7ZG 4A3BG 3MR6A 2NU7B 2I8CA 3H0GG 1CQIB 4R8UB 5KFBA 4IWYA 4DV0H 2FE3A 4EBEA 2UVUA 4JI2H 4JV2A 3TINA 1UNNC 3R23A 1XNRH 5KT5A 1XMOH 4DV1H 3GIMA 4DV2H 1WSCA 3N8DA 1TAEA 1JDBB 4UCVA 2YRXA 2YU9A 4RUAA 4RUCA 3PN1A 5BPHA 1FJGH 1Y1VA 5C1OA 3PZPA 2R7NA 1RYSA 4ECSA 3VPCA 3RB0A 4O4IF 5GONF 4DV7H 4ECWA 3RUPA 3RTXA 3JRWA 5DLGA 4DV4H 4A3FG 3Q2OA 4YY3H 3GTLA 4ZOLF 5KFEA 2R8IA 1EZ1A 4F50A 2J6SA 4ED1A 2FLLA 4ETSA 2HHHH 5KG0A 3KHRA 2R85A 4LSAA 1WH2A 1Z2NX 1CE8A 2CZGA 5K2MA 1JDEA 1GSAA 2VUGA 4LH6A 5FD5A 3RBEA 3HOYG 3GIJA 5KFVA 4J9NA 3K3VA 4LH7A 4Q8FA 1VKZA 5KFTA 4EFEA 4J0MA 1I3QA 1N48A 2VQDA 1EHIA 2FMAA 4HNUA 1CQJB 3R5FA 4TV9F 3OSNA 2XGPA 3MWMA 4FBUA 2XCLA 2E5LH 1TWFA 4C2MA 1KJJA 4HNVA 1KJ8A 3RF2A 2WE6A 4JI8H 2I87A 5JQWA 2E2IA 5JVDF 5JH7F 4RZRA 2DWCA 4HQ6A 5KG2A 3GILA 1T36A 2UUBH 4TUYF 2WAQA 3Q8PB 4XX0B 2UUAH 2O03A 5LA6F 1B33N 3WNZA 1DV2A 1UC8A 1ZHQA 5C8YF 2FPPB 2R93A 4BBSG 2FLPA 1DV1A 4ECUA 4DR7H 2R7KA 4GC6A 4MV6A 3RV3A 4QWBA 2GPWA 1RJQA 4TQSA 3PW7A 3SI8A 1E4EB 4IRKA 4EEYA 4A3CG 3K3PA 2QYZA 4YBZB 4WBNF 3MWEA 1JLLB 4MV3A 4ED2A 3VPDA 3EYYA 5LOVF 2NVXA 2C35B 2ZJTA 3I4MG 2AGPA 3M4IA 3KTMA 2HJWA 2W6NA 2XIGA 5IP7G 3GIIA 3RAQA 4JI6H 4B3RH 4A93G 2JA5A 4O3OA 2PBZA 5A2QW 4XZ3B 2I80A 5D1OB 5L1LA 4MV9A 3RBDA 2FPGB 3WO0A 3LWBA 5CB4F 4J9QA 2C22A 4RNNA 4MV1A 2V59A 5KG5A 5IYDG 5EWGA 5I47A 2RGVA 2W9AA 2P0AA 2C28A 2VA3A 4LFBH 4EGJA 4LF8H 1L2ZA 4MA5A 2C2EA 4J9MA 4QWDA 4UCRA 4QW9A 1HR0H 4LF7H 1HNWH 4FS1A 3T5LA 3H40A 2YS7A 3PO3G 2V5AA 4ED3A 5L1IA 1E4EA 1R9TA 1V51A 1A9XA 1T3NA 4YAKB 2J9GA 2UVVA 4B3SH 5KFSA 3JRXA 2E2HA 4YR2A 5KFRA 4CC5A 3RGXA 5KFKA 1M0TA 3GIQA 5FJ8G 4A3EG 2VQFH 2BR0A 5KFYA 4DUZH 4RAYA 4A3JG 4ECVA 4ED8A 5HV6A 2WAQE 2R7LA 1SEIA 5JVLA 2R7ZA 4AQYH 5KFNA 3N43B 4RU9A 1KEEA 2VPQA 1GGOA 3QZ7A 4AYBA 4EYHB 2SCUB 1Z2PX 4JI3H 4X65H 4J9PA 5KFDA 2JA6G 3GTOA 3ORQA 2R87A 5KFFA 4NXNH 2ZDGA 1Y1WA 5LYJF 4IR1A 1TWGA 2NU8B 5LP6F 2PVPA 2ASDA 4DL6A 4IR9A 4O3SA 5C4XG 1K1SA 2W57A 3BA9A 3RJ0A 4UCOA 1BGWA 2CKZB 5EDWA 4F4YA 4ED0A 3G6VA 1GO3E 3KXYT 2CW8A 5KFCA 5DG8A 3N6XA 2NU9B 5KFHA 3WO1A 3MFHA 3GTKA 2W71A 1B04A 3BJYA 4F4WA 4KHPH 2X0SA 2FK3A 3H4BA 4MV7A 2JA7A 4BY1G 3HKZA 4JI5H 3BAAA 1IBKH 1N56A 2F4VH 5HBRB 5KT7A 5KT4A 2DLNA 1JKJB 4ZI7F 5KFPA 3AYHB 4J9RA 1RJRA 5KG6A 4I4TF 2FP4B 2R86A 2J6TA 1N33H 4LFCH 4PWQA 1ZQ7A 3HOXG 4B3TH 4QWAA 5KFGA 2WYOA 1Y1VG 5KFZA 2R82A 2VUMA 4ED6A 2PN1A 3FKIA 3ETHA 5DG7A 3G6YA 2HVRA 4NXMH 2FKLA 3HOWG 5KT3A 5C5JA 3I4NG 4PDBA 1K1QA 2B63A 3T1YH 4J9OA 4DL7A 2W8LA 3M9NB 5DG9A 1RK5A 2UXDH 1OWTA 3H20A 3J80W 2IA6A 5IP9G 2PMZE 1TWAA 1MZBA 1WCMG 3TIGA 1A0IA 3J7AK 2R92A 4LF5H 2OWOA 4YB8B 3RV4A 5CA1F 5EWFA 4I55F 4DR4H 4XYLB 1C30A 3L4KA 2W8KA 1GYFA 5C44G 1UC9A 4X62H 2R8GA 4JUZA 3J81W 5LL6b 4NLGA 3ETJA 1I94H 5FD6A 2WB1A 1IOWA 2ZM6H 2UVWA 4DR6H 1B6RA 2JA5G 2VR1A 5EOYA 2JA7G 4O2BF 4YJ2F 5IYBG 2FK1A 1SYXB 4Q0YA 4RB2C 4JI7H 3CVZA 4MAMA 4BXXG 1K83A 1IBMH 3MWDA 4O2AF 3KHGA 5DQHA 2Q2UA 4C5BA 4A3LG 3FDSA 3TQ1A 1AUVA 4IAJA 1KJQA 4O3QA 2XCAA 3V6JA 2R8KA 3L2PA 4DL3A 4QIWA 4UFZA 2DZDA 2XCPA 3FKIG 4DV6H 4YR0A 2C2RA 1W93A 4YJ3F 2XC9A 1TWHA 2FJZA 3Q8SB 3RB6A 5T14A 2W6QA 2V58A 1SCUB 2B63G 3N44B 2YZNA 4O3NA 1I7NA 1P8LA 3OHBA 4QWCA 3UQ8A 4XYMB 1BXRA 4ECRA 2AGOA 2VQEH 3HOZG 2W9CA 3V4SA 5D1PA 2IBKA 1BJTA 1CS0A 1PX2A 4ME6A 2MCTA 1WCMA 3PR5B 4GLXA 3KHHA 4LFAH 1B6SA 2C2DA 3K5IA 3PW0A 1I7LA 2JEIA 1XDNA 5KX5F 1T94A 4RB3C 3H4DA 1EYZA 3OTOH 1S0MA 2FPIB 5CA0F 2W6ZA 3HBLA 2W9CB 2Y0SA 3T5HA 3MR2A 4RB0A 4A3KG 3N40P 2NUAB 2QK4A 3GTJA 4O4HF 1GLVA 1GSHA 1PK8A 1W96A 3JSLA 4ECZA 4JI4H 2GLTA 4LMYA 4RNOA 3MR5A 4ECQA 4DL4A 5DQIA 1N32H 4BBRG 1Z2OX 5IWAH 2ZDHA 3GV8B 4F4ZA 5EWEA 3L4JA 4A2AA 1JX4A 1JXLA 4R8UA 4X64H 2OH2A 5KT6A 5KFWA 2IMWP 2BQRA 2AU0A 3JSNA 3OUUA 4FU0A 2JA8G 1V4YA 2UU9H 4YHHH 5JUMA 3PR4A 3RB4A 4ZQIA 2HGSA 3IG0A 4M7EA 3HB9A 4RZQA 5BPFA 3M9OB 3Q8QB 5FLXW 2W7OA 4A3MG 4JV1A 3RIZA 2UVRA 2W6PA 4BY7G 2C00A 5KG3A 4A2BA 4U6PA 5D1OA 1M7JA 5LMUH 5FLMG 3R5XA 4IRCA 3HKZE 1X9NA 3H0GA 4UCUA 2FK2A 2KSWA 2NU6B 4FS2A 4ECXA 4Y8VB 3I12A 5H80A 2ATLA 2YYAA 4A3GG 3T5JA 1S9FA 4JI0H 4DL2A 3SE7A 2FLNA 4K0KH 3FMAA 4C5AA 2WDTA 5DGBA 1AUXA
chains in the Genus database with same CATH topology
1OWTA 2FJZA 2M05A 3KTMA 2FKLA 2FK2A 4PWQA 2FK3A 2FK1A 2FMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWT A;  2FJZ A;  2M05 A;  3KTM A;  2FKL A;  2FK2 A;  4PWQ A;  2FK3 A;  2FK1 A;  2FMA A; 
#chains in the Genus database with same CATH topology
 2R6F A;  3BG5 A;  1ULZ A;  2YL2 A;  4ECT A;  2J6U A;  4A3D G;  4ZHQ F;  2R92 G;  5KT2 A;  3VMM A;  3GTG A;  3R5H A;  2XD4 A;  3GIP A;  3ORR A;  4I50 F;  3GTQ A;  2FB9 A;  3GV5 B;  4FM9 A;  2RGR A;  1Y14 B;  3BQ0 A;  1O75 A;  3DF7 A;  4O3P A;  2BQU A;  3PW2 A;  1E4G T;  2DPJ A;  4QIW E;  2RDI A;  2PMZ A;  2DPI A;  1GSO A;  1M0W A;  2V4Q A;  1KBL A;  2OLS A;  3PVX A;  2CW7 A;  3IN5 A;  4QW8 A;  3RAX A;  4GKK H;  4HR7 A;  4LF4 H;  3GV7 B;  4J9L A;  1S10 A;  5L1J A;  5KFJ A;  2R8H A;  4F4X A;  3MFI A;  1S0O A;  5KFX A;  2R84 A;  4TV8 F;  3JZI A;  4YR3 A;  2ASJ A;  1S97 A;  3NGD A;  1S68 A;  5DGA A;  2ALZ A;  3GID A;  1VAJ A;  4DV3 H;  3LP8 A;  3CQZ A;  2M05 A;  5IYC G;  3Q8R B;  4O3R A;  5KFM A;  1DIK A;  4A3I G;  5KFA A;  4EBD A;  4JYA H;  3Q1K A;  4YAJ B;  5L9X A;  3RGZ A;  5F9L A;  4R7R A;  2NVY A;  1RYR A;  3U9S A;  4EYI B;  5CAE B;  4APM A;  1VBG A;  3G6X A;  1N34 H;  1J5E H;  2R93 G;  4DR3 H;  1EUD B;  2YW2 A;  3C0F B;  4U7C A;  5BR8 H;  2VA2 A;  1BNC A;  1FVI A;  5D8D A;  3V4Z A;  5FPO A;  4AYB E;  4LF9 H;  3BA8 A;  3HXL A;  3HOU G;  2UXC H;  5BMV F;  2W9B A;  4C5C A;  2WB1 E;  2JEJ A;  4CC6 A;  3GLK A;  5C3E G;  4EG0 A;  5FPR A;  3K5H A;  2W7P A;  1EUC B;  3OHA A;  4J9S A;  3PW5 A;  4EBC A;  2BQ3 A;  1C3O A;  4ECY A;  3KAJ A;  2V4R A;  4LF6 H;  2AQ4 A;  2YRW A;  3U9T A;  1IBL H;  4MV4 A;  3VPB A;  2CQY A;  4JV0 A;  4MA0 A;  4RNM A;  3TII A;  1RJP A;  4Q45 A;  4OX9 H;  3KAL A;  4DUY H;  3HOV G;  2RF4 A;  5KFU A;  4BWS C;  4EEQ A;  3PW4 A;  4IZO A;  1TWC A;  2HVQ A;  3OUZ A;  4UCS A;  3GTP A;  5J2T F;  3T1H H;  3RB3 A;  1IOV A;  2YZG A;  4YP3 A;  1RK6 A;  3KHL A;  3T5K A;  2YS6 A;  2DIK A;  3PO2 G;  3F8N A;  2AGQ A;  1JIH A;  5IYZ F;  4IRD A;  4JI1 H;  1XNQ H;  1TA8 A;  5KG4 A;  4MTE A;  4YQW A;  1E4F T;  5KFL A;  1HNX H;  3EPI A;  4FBT A;  2VOB A;  1WR2 A;  2VUM G;  5J2U F;  3JAM W;  1ZET A;  1V9P A;  2Y0S E;  3E5N A;  2XGQ A;  3GQC A;  5DQG A;  3H3V H;  5KFI A;  2YZM A;  2HVS A;  1VS0 A;  3KAK A;  4JV5 H;  1FKA H;  3N42 B;  2ASL A;  2GPS A;  4IHJ F;  3M9M B;  3OSP A;  3BAB A;  4DR2 H;  1S0N A;  2R8J A;  5LMN H;  4QJF A;  4DLK A;  4DV5 H;  5IT9 W;  1I6U A;  3N41 B;  3EPG A;  1I50 A;  2ZDQ A;  3G8C A;  2V9W A;  2JEG A;  2UUC H;  5L1K A;  5LXT F;  4RAZ A;  5KG1 A;  2VPS A;  2R7M A;  4IWX A;  4HNT A;  5KG7 A;  4WD3 A;  5KFO A;  1N36 H;  3QFF A;  1SFO A;  3TQT A;  2WTF A;  4MV8 A;  5KKN B;  3GTM A;  4HYK A;  4O4L F;  5EZY F;  3MR3 A;  5C1P A;  1KC7 A;  2UXB H;  4TQR A;  2JA6 A;  1HNZ H;  2W9B B;  4LSX A;  4DL5 A;  4I7H A;  3BQ1 A;  3BQ2 A;  1Y1W G;  3UFX B;  3MJF A;  4EGQ A;  3LML A;  3GIK A;  4ED7 A;  2YCH A;  1M6V A;  2Q2T A;  4M9U A;  4B3M H;  4Q8E A;  1VBH A;  5KFQ A;  4UCT A;  1ZHS A;  4E4T A;  4DR5 H;  1DGS A;  5DLF A;  4GC7 A;  1AN7 A;  4EFB A;  1KJI A;  4DR1 H;  4QWE A;  4Q43 A;  3V6H A;  1S03 G;  3RFC A;  3V6K A;  2W70 A;  4MTD A;  4J9K A;  4L1K A;  3QZ8 A;  2IP4 A;  1XMQ H;  5F9N A;  2RDJ A;  4RB1 A;  4GKJ H;  2JEF A;  2W6O A;  4X66 H;  4G3I A;  1KJ9 A;  2W6M A;  4Q44 A;  2R7Z G;  4A3B G;  3MR6 A;  2NU7 B;  2I8C A;  3H0G G;  1CQI B;  4R8U B;  5KFB A;  4IWY A;  4DV0 H;  2FE3 A;  4EBE A;  2UVU A;  4JI2 H;  4JV2 A;  3TIN A;  1UNN C;  3R23 A;  1XNR H;  5KT5 A;  1XMO H;  4DV1 H;  3GIM A;  4DV2 H;  1WSC A;  3N8D A;  1TAE A;  1JDB B;  4UCV A;  2YRX A;  2YU9 A;  4RUA A;  4RUC A;  3PN1 A;  5BPH A;  1FJG H;  1Y1V A;  5C1O A;  3PZP A;  2R7N A;  1RYS A;  4ECS A;  3VPC A;  3RB0 A;  4O4I F;  5GON F;  4DV7 H;  4ECW A;  3RUP A;  3RTX A;  3JRW A;  5DLG A;  4DV4 H;  4A3F G;  3Q2O A;  4YY3 H;  3GTL A;  4ZOL F;  5KFE A;  2R8I A;  1EZ1 A;  4F50 A;  2J6S A;  4ED1 A;  2FLL A;  4ETS A;  2HHH H;  5KG0 A;  3KHR A;  2R85 A;  4LSA A;  1WH2 A;  1Z2N X;  1CE8 A;  2CZG A;  5K2M A;  1JDE A;  1GSA A;  2VUG A;  4LH6 A;  5FD5 A;  3RBE A;  3HOY G;  3GIJ A;  5KFV A;  4J9N A;  3K3V A;  4LH7 A;  4Q8F A;  1VKZ A;  5KFT A;  4EFE A;  4J0M A;  1I3Q A;  1N48 A;  2VQD A;  1EHI A;  2FMA A;  4HNU A;  1CQJ B;  3R5F A;  4TV9 F;  3OSN A;  2XGP A;  3MWM A;  4FBU A;  2XCL A;  2E5L H;  1TWF A;  4C2M A;  1KJJ A;  4HNV A;  1KJ8 A;  3RF2 A;  2WE6 A;  4JI8 H;  2I87 A;  5JQW A;  2E2I A;  5JVD F;  5JH7 F;  4RZR A;  2DWC A;  4HQ6 A;  5KG2 A;  3GIL A;  1T36 A;  2UUB H;  4TUY F;  2WAQ A;  3Q8P B;  4XX0 B;  2UUA H;  2O03 A;  5LA6 F;  1B33 N;  3WNZ A;  1DV2 A;  1UC8 A;  1ZHQ A;  5C8Y F;  2FPP B;  2R93 A;  4BBS G;  2FLP A;  1DV1 A;  4ECU A;  4DR7 H;  2R7K A;  4GC6 A;  4MV6 A;  3RV3 A;  4QWB A;  2GPW A;  1RJQ A;  4TQS A;  3PW7 A;  3SI8 A;  1E4E B;  4IRK A;  4EEY A;  4A3C G;  3K3P A;  2QYZ A;  4YBZ B;  4WBN F;  3MWE A;  1JLL B;  4MV3 A;  4ED2 A;  3VPD A;  3EYY A;  5LOV F;  2NVX A;  2C35 B;  2ZJT A;  3I4M G;  2AGP A;  3M4I A;  3KTM A;  2HJW A;  2W6N A;  2XIG A;  5IP7 G;  3GII A;  3RAQ A;  4JI6 H;  4B3R H;  4A93 G;  2JA5 A;  4O3O A;  2PBZ A;  5A2Q W;  4XZ3 B;  2I80 A;  5D1O B;  5L1L A;  4MV9 A;  3RBD A;  2FPG B;  3WO0 A;  3LWB A;  5CB4 F;  4J9Q A;  2C22 A;  4RNN A;  4MV1 A;  2V59 A;  5KG5 A;  5IYD G;  5EWG A;  5I47 A;  2RGV A;  2W9A A;  2P0A A;  2C28 A;  2VA3 A;  4LFB H;  4EGJ A;  4LF8 H;  1L2Z A;  4MA5 A;  2C2E A;  4J9M A;  4QWD A;  4UCR A;  4QW9 A;  1HR0 H;  4LF7 H;  1HNW H;  4FS1 A;  3T5L A;  3H40 A;  2YS7 A;  3PO3 G;  2V5A A;  4ED3 A;  5L1I A;  1E4E A;  1R9T A;  1V51 A;  1A9X A;  1T3N A;  4YAK B;  2J9G A;  2UVV A;  4B3S H;  5KFS A;  3JRX A;  2E2H A;  4YR2 A;  5KFR A;  4CC5 A;  3RGX A;  5KFK A;  1M0T A;  3GIQ A;  5FJ8 G;  4A3E G;  2VQF H;  2BR0 A;  5KFY A;  4DUZ H;  4RAY A;  4A3J G;  4ECV A;  4ED8 A;  5HV6 A;  2WAQ E;  2R7L A;  1SEI A;  5JVL A;  2R7Z A;  4AQY H;  5KFN A;  3N43 B;  4RU9 A;  1KEE A;  2VPQ A;  1GGO A;  3QZ7 A;  4AYB A;  4EYH B;  2SCU B;  1Z2P X;  4JI3 H;  4X65 H;  4J9P A;  5KFD A;  2JA6 G;  3GTO A;  3ORQ A;  2R87 A;  5KFF A;  4NXN H;  2ZDG A;  1Y1W A;  5LYJ F;  4IR1 A;  1TWG A;  2NU8 B;  5LP6 F;  2PVP A;  2ASD A;  4DL6 A;  4IR9 A;  4O3S A;  5C4X G;  1K1S A;  2W57 A;  3BA9 A;  3RJ0 A;  4UCO A;  1BGW A;  2CKZ B;  5EDW A;  4F4Y A;  4ED0 A;  3G6V A;  1GO3 E;  3KXY T;  2CW8 A;  5KFC A;  5DG8 A;  3N6X A;  2NU9 B;  5KFH A;  3WO1 A;  3MFH A;  3GTK A;  2W71 A;  1B04 A;  3BJY A;  4F4W A;  4KHP H;  2X0S A;  2FK3 A;  3H4B A;  4MV7 A;  2JA7 A;  4BY1 G;  3HKZ A;  4JI5 H;  3BAA A;  1IBK H;  1N56 A;  2F4V H;  5HBR B;  5KT7 A;  5KT4 A;  2DLN A;  1JKJ B;  4ZI7 F;  5KFP A;  3AYH B;  4J9R A;  1RJR A;  5KG6 A;  4I4T F;  2FP4 B;  2R86 A;  2J6T A;  1N33 H;  4LFC H;  4PWQ A;  1ZQ7 A;  3HOX G;  4B3T H;  4QWA A;  5KFG A;  2WYO A;  1Y1V G;  5KFZ A;  2R82 A;  2VUM A;  4ED6 A;  2PN1 A;  3FKI A;  3ETH A;  5DG7 A;  3G6Y A;  2HVR A;  4NXM H;  2FKL A;  3HOW G;  5KT3 A;  5C5J A;  3I4N G;  4PDB A;  1K1Q A;  2B63 A;  3T1Y H;  4J9O A;  4DL7 A;  2W8L A;  3M9N B;  5DG9 A;  1RK5 A;  2UXD H;  1OWT A;  3H20 A;  3J80 W;  2IA6 A;  5IP9 G;  2PMZ E;  1TWA A;  1MZB A;  1WCM G;  3TIG A;  1A0I A;  3J7A K;  2R92 A;  4LF5 H;  2OWO A;  4YB8 B;  3RV4 A;  5CA1 F;  5EWF A;  4I55 F;  4DR4 H;  4XYL B;  1C30 A;  3L4K A;  2W8K A;  1GYF A;  5C44 G;  1UC9 A;  4X62 H;  2R8G A;  4JUZ A;  3J81 W;  5LL6 b;  4NLG A;  3ETJ A;  1I94 H;  5FD6 A;  2WB1 A;  1IOW A;  2ZM6 H;  2UVW A;  4DR6 H;  1B6R A;  2JA5 G;  2VR1 A;  5EOY A;  2JA7 G;  4O2B F;  4YJ2 F;  5IYB G;  2FK1 A;  1SYX B;  4Q0Y A;  4RB2 C;  4JI7 H;  3CVZ A;  4MAM A;  4BXX G;  1K83 A;  1IBM H;  3MWD A;  4O2A F;  3KHG A;  5DQH A;  2Q2U A;  4C5B A;  4A3L G;  3FDS A;  3TQ1 A;  1AUV A;  4IAJ A;  1KJQ A;  4O3Q A;  2XCA A;  3V6J A;  2R8K A;  3L2P A;  4DL3 A;  4QIW A;  4UFZ A;  2DZD A;  2XCP A;  3FKI G;  4DV6 H;  4YR0 A;  2C2R A;  1W93 A;  4YJ3 F;  2XC9 A;  1TWH A;  2FJZ A;  3Q8S B;  3RB6 A;  5T14 A;  2W6Q A;  2V58 A;  1SCU B;  2B63 G;  3N44 B;  2YZN A;  4O3N A;  1I7N A;  1P8L A;  3OHB A;  4QWC A;  3UQ8 A;  4XYM B;  1BXR A;  4ECR A;  2AGO A;  2VQE H;  3HOZ G;  2W9C A;  3V4S A;  5D1P A;  2IBK A;  1BJT A;  1CS0 A;  1PX2 A;  4ME6 A;  2MCT A;  1WCM A;  3PR5 B;  4GLX A;  3KHH A;  4LFA H;  1B6S A;  2C2D A;  3K5I A;  3PW0 A;  1I7L A;  2JEI A;  1XDN A;  5KX5 F;  1T94 A;  4RB3 C;  3H4D A;  1EYZ A;  3OTO H;  1S0M A;  2FPI B;  5CA0 F;  2W6Z A;  3HBL A;  2W9C B;  2Y0S A;  3T5H A;  3MR2 A;  4RB0 A;  4A3K G;  3N40 P;  2NUA B;  2QK4 A;  3GTJ A;  4O4H F;  1GLV A;  1GSH A;  1PK8 A;  1W96 A;  3JSL A;  4ECZ A;  4JI4 H;  2GLT A;  4LMY A;  4RNO A;  3MR5 A;  4ECQ A;  4DL4 A;  5DQI A;  1N32 H;  4BBR G;  1Z2O X;  5IWA H;  2ZDH A;  3GV8 B;  4F4Z A;  5EWE A;  3L4J A;  4A2A A;  1JX4 A;  1JXL A;  4R8U A;  4X64 H;  2OH2 A;  5KT6 A;  5KFW A;  2IMW P;  2BQR A;  2AU0 A;  3JSN A;  3OUU A;  4FU0 A;  2JA8 G;  1V4Y A;  2UU9 H;  4YHH H;  5JUM A;  3PR4 A;  3RB4 A;  4ZQI A;  2HGS A;  3IG0 A;  4M7E A;  3HB9 A;  4RZQ A;  5BPF A;  3M9O B;  3Q8Q B;  5FLX W;  2W7O A;  4A3M G;  4JV1 A;  3RIZ A;  2UVR A;  2W6P A;  4BY7 G;  2C00 A;  5KG3 A;  4A2B A;  4U6P A;  5D1O A;  1M7J A;  5LMU H;  5FLM G;  3R5X A;  4IRC A;  3HKZ E;  1X9N A;  3H0G A;  4UCU A;  2FK2 A;  2KSW A;  2NU6 B;  4FS2 A;  4ECX A;  4Y8V B;  3I12 A;  5H80 A;  2ATL A;  2YYA A;  4A3G G;  3T5J A;  1S9F A;  4JI0 H;  4DL2 A;  3SE7 A;  2FLN A;  4K0K H;  3FMA A;  4C5A A;  2WDT A;  5DGB A;  1AUX A; 
#chains in the Genus database with same CATH homology
 1OWT A;  2FJZ A;  2M05 A;  3KTM A;  2FKL A;  2FK2 A;  4PWQ A;  2FK3 A;  2FK1 A;  2FMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...