5C44G

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c44G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c44G01
1SFOH 1XJVA 5C3EH 2LXKA 4QQBX 2E8GA 2CFMA 1A63A 4JV5L 1SRUA 2KENA 1U5KA 2ZTDA 3G4SA 1NJIC 1IBLL 3TRZA 1PHJA 2BA1A 4BY1G 3CCRA 2E2JH 5ELNA 5AJ3Q 4A3KG 4L5RC 2ATWA 2BH2A 1FVIA 3M3YH 1PH8A 1YEZA 1YIJA 3ICEA 1KC8C 2QGQA 5IP9G 1PH1A 2AMCB 1X3FA 1IBLQ 1EOVA 1UE5A 1M90C 4BA1I 3GTPH 4LF9Q 2UU9Q 1KIXA 3HOUH 5IYDH 3CCJA 4GN5A 1N33Q 3U4VA 2UXDL 5GAGC 5GAHC 1RL2A 1Y14B 4QJFA 4AYBG 1OXSC 3H0GH 5C3EG 5AJ3L 1W2BA 5C0XI 2OTLA 3S14H 4DV0Q 1G291 3M9BA 1EYGA 4UY8C 3PF4A 3NBHB 5JEAJ 1XNRQ 3PIPA 1I50H 1YJ9A 3E0EA 3GD7A 2FXQA 3M85A 2QEXA 1PH6A 4ALPA 1HNWL 4YHHL 1FGUA 3I2ZA 4A3MG 2GVBA 4KLKA 1P16A 2OQKA 3BZKA 4O0AA 2OCEA 5IWAL 1KRSA 3DLLA 3NEMA 4IFDG 1QUQB 2F52A 4JBWA 2HQLA 4O2DA 4LUZA 1X54A 4R4CA 3AEVA 1Y1WG 1HR0W 5LMNQ 4DV7Q 3HOYH 3CXCA 1K73C 3S1MH 4YHHQ 1E1OA 2WFWA 3J81i 5FLMH 3S2DH 1WFQA 4EQ5A 4DV2Q 4GNXB 1JMCA 1JT8A 1E7ZA 1YITA 2D0OA 4JI8L 4YWKA 3F2BA 1VS0A 4HIDA 5BR8Q 1WYDA 2CWPA 1NMFA 4DV0L 2D0PA 2CKZB 4HJ5A 1CKMA 1PH7A 2KCTA 4OWTB 4A3LH 5IP7H 2CWAA 1KXLA 3M4PA 4R4QA 2UU9L 4BBRG 3CCLA 1OXTA 1WJJA 5IYCH 4DUYQ 4JI0L 2R7DA 2ZJQA 2BH8A 3S17H 2YTXA 3GDEA 2VS1A 4DR3Q 2DUDA 4OWXB 5M5XH 1MJEA 1E24A 3HOYG 3T1YL 4X6AH 1FJGQ 4C3HH 5C44G 3A74A 3F2CA 2R93H 2K14A 4DV4L 4JOIA 4XIGS 3RR5A 1XPRA 3ERSX 1AE2A 4OO1I 4A93H 1DGSA 1LUZA 5IY0A 4A4IA 5C0XJ 5GQOA 2VW9A 1I94Q 1YHAA 3S1NH 3MEFA 4UP9A 4GN3B 5GROA 2B63H 1JB7A 2GN5A 4IFDI 4H02A 4NXMQ 2Q2HA 2OQ0A 2ZM6Q 2EXDA 1QUQA 4JYAL 1D7QA 1U0LA 4YCUA 4B3RL 3CCUA 1CKOA 1B8AA 4YWLA 4MTNA 2Q2TA 4DUZQ 3HKZE 3STBD 2OWOA 4B3TL 3OTOQ 2IHEA 1Q12A 3F8TA 4GS3A 4UPAA 2UUCQ 2JEBI 1PYBA 4IPDA 4IOCA 2UUBL 1VQGA 4YY3Q 3G71A 4C2MH 3Q8DA 5HGQA 5IT9c 5IYBH 4A3GH 2Q2IA 1C7YA 1V9PA 2UXBL 1HJPA 4DR2L 1TWCH 2JEAI 3ULPA 4BY7G 1R9TH 4YY3L 3L2PA 1Y1WH 4JBMA 1C9OA 3HKZG 3OTOL 3T1HL 1EUJA 1J5EL 3M4OH 3PUYA 1IL2A 4R4OA 3HOWH 4IJLA 3TEHB 1N32Q 4DV5Q 1NBWA 4JI8Q 4B3RQ 4NPSA 4P74A 1KQSA 4DK6C 2B63G 3MXNB 3ULLA 2EQSA 4HJ8A 3FKIH 4A3CG 1X56A 4DPGA 3TS0A 1Q82C 1CSPA 2L15A 1I94L 4A93G 3H3VI 2Z0SA 2K52A 3J81j 1N36L 3I7FA 4JI6L 1IYJB 3PO2G 1KRTA 4AH6A 3PO3H 2ZTCA 2E5LL 4DR6Q 1O7IA 3U58A 2K4KA 4TVAB 2VQFQ 5LMNL 4DV7L 1B70B 4DR6L 2YV5A 4OX9Q 4KI0A 4IFDJ 2MFIA 1PH9A 1VQFA 1QVFA 1K8GA 1VQAA 5E7NA 3H15A 1XTDA 5IWAQ 3A0JA 1E1TA 2Z6KA 2JA6H 2RF4A 1VQDA 3NELA 4QY7A 1UEBA 4KHPL 3ER0A 2A19A 1I5FA 3W5OA 1PH4A 1GD7A 1PYSB 5FLXc 2IHFA 1Y1VG 3NENA 1ASYA 3S1RH 1XNRL 2HHHQ 5C4JH 2Y0SE 4WJ4A 2NZHA 1HH2P 1IXRA 3W1GA 4DAYB 3CF5A 4DKAC 1HNXL 1SMXA 4POGA 5FLMG 1XNQQ 1TXYA 1VQIA 3CP0A 2JA5G 1Q1BA 3CCSA 2HT1A 4A3EG 2MO1A 2YTVA 3BZCA 2CQOA 1VQ8A 4B3ML 1S40A 1EQQA 3M4QA 3PO3G 4LF4Q 4JI1Q 4A3IG 5FJ8G 3GTQH 3ULJA 3KF6B 4B3MQ 1JJ2A 2JE6I 4AQYQ 1EWIA 4DK3C 3U50C 1CSQA 3VDYA 4JCVE 2DGYA 3FKIG 2I5HA 4DV6L 5M3FH 2KHJA 2K5NA 2NVYH 5IYCG 1MKHA 2IX0A 2YYZA 3CPWA 1N8RC 1FL0A 2R7ZG 3S1QH 2ZM6L 5JJLA 3KF6A 4NXML 3PUZA 3HOWG 1MJCA 1IBML 3I56A 1HR0Q 1VQ6A 2A8VA 1TWGH 3GTOH 1CKNA 1TWAH 1QZHA 1N34L 1V43A 4GKKL 3HOVH 4LFBL 2B29A 2VY3A 4JI5Q 4RMFA 3L7ZC 2JA6G 3M7NA 4BY7H 2JK8A 4HIMA 1Q86C 4A3FH 2YTYA 5C4XG 2BA0A 1IBKL 4J15A 1N33L 1VQKA 2UXDQ 4DR5L 3S15H 1GKHA 4P73A 4OXPA 2F4VQ 3UE0A 2R92G 1KL9A 2WP8J 2NVQH 1KHIA 2Y0SG 3E9HA 3BU2A 1W3SA 2WAQE 3CPFA 4HIOA 4HJ7A 3UDGA 1XPOA 1KAWA 2QA4A 4DR1Q 1VQ9A 1BBWA 4DR3L 4P72A 4LF5Q 1GVPA 4AQYL 2VL6A 1T9HA 5H1SE 4RG1A 3K8AA 3HOVG 4GOPB 3PO2H 4DV3L 3S16H 4BXXH 4IOAA 4X64L 4R4IA 4IJHA 3I4MH 4LF7L 3UDFA 3AFPA 1PFSA 3GTJH 4JG2A 1TWFH 2VQEQ 2PQAA 4L5QA 4Y7NH 3AYHB 1JJGA 4JI2L 1D8LA 1VQMA 4A3CH 2R6GA 1X3EA 1BBUA 2ALYB 2UXCL 2K75A 3BJUA 1CUKA 1J6QA 1HNZL 3LGJA 2JA7H 2ZJPA 3T1HQ 4R1JA 5C0XG 3I4MG 5C44H 2VQEL 3GTGH 3PGZA 1JJCB 2IY5B 3RNUA 1EFWA 4QL5A 4DR2Q 3JAMi 2MO0A 2RCNA 1CKNB 1VQEA 5EAYA 3KJPA 1NY4A 4LFCQ 4DV1L 4DR7L 1A62A 1E22A 1JE5A 1GO3E 4LUOA 2JA9A 4A3DH 1NTGA 1IZ6A 2WB1E 5IYBG 4OONA 1YBYA 4X62L 4LFCL 4DR1L 4A3GG 4B3SQ 3K81C 1BKBA 1AE3A 3UDIA 4A3FG 4LFBQ 1LM0A 4YCWA 3CC7A 3CC2A 4L5SA 1Q7YC 2F4VL 3FHWA 2HIXA 4JI6Q 1S3OA 4HJ9A 2N78A 1PH5A 2UUAQ 4DR4L 5JJIA 1VQOA 2ID0A 1XPUA 3GTLH 1VQ5A 3CCMA 1VQBA 1XMOQ 3KDFA 1Z9FA 2CCZA 5LMNW 3PF5A 3HOXG 1UWVA 3EN2A 4JI7L 1NE3A 1OTCA 4YWMA 1LTLA 1SE8A 3K7AH 3CW2C 1YHBA 2MQHA 3UDXA 2N49A 5M3MG 2UXBQ 4LF4L 1VQ4A 4QIWE 4X64Q 5LMUQ 3PSIA 4QGUA 4A3IH 2R93G 1X3GA 3K7UC 2PQAB 1Q46A 1G51A 4GLAC 2EIFA 4LF5L 3B6YA 3J7ZC 1X65A 1SLJA 5LMUL 4DUYL 4JI0Q 4HIKA 4X66Q 2R7FA 3AQQA 4DNIA 2IT1A 3DM3A 3IRBA 1VCIA 2UXCQ 3I4NG 3HOXH 4Y52H 2UUBQ 4GNXC 2UUCL 1P8LA 2V1CC 4KHZA 4ME3A 1QVGA 2E2IH 2LSSA 2PI2E 4DUZL 3G6EA 2AWOA 1N9WA 5JJKA 2NN6I 4IPCA 5JEAG 1N34Q 1XNQL 4TQUS 3H0GG 1RIPA 1X6OA 1YNXA 1XMOL 3JAMc 4LUVA 1XMQL 3S2HH 4OO1G 3J80i 2K5HA 1QVCA 1WI5A 4C3IH 4DR7Q 1YVCA 3EIVA 1K3RA 3RZOH 4DV4Q 4LF8L 1VQPA 3A5ZB 4MZ9A 2PNHA 2AWNA 3S24A 4DV6Q 4B3SL 4UP8A 1PH3A 2LXJA 1FJGL 3STBC 5M5WH 1WOCA 2I5MX 3TREA 4BY1H 4A3JH 3PV0A 3HKSA 4LF8Q 4JI3L 4LFAL 3HOZH 4POFA 4DV1Q 3RLOA 3U4ZA 3FP9A 1BVSA 4OX9L 4JI1L 1EQRA 1E3PA 5M5YH 1EIFA 4GKKQ 1PVOA 1VQCA 3T1YQ 4LF6Q 4IPHA 4LNQA 4BA2I 4GLVB 2H5XA 1L1OA 4LW1A 4PG3A 3J81c 4BBSH 2VUMG 4MNOA 1H95A 4DV5L 2AKWB 2B3GA 1N32L 3EBEA 2PI2A 3TS2A 1EIYB 2ES2A 2VUMH 3I55A 1J5EQ 4BBSG 2I5LX 4JBJA 5ELOA 1VQNA 5J3BA 3K80C 3RLFA 4AYBE 4R4TA 3GTKH 1L1OC 3D0FA 4LF6L 4BXXG 4LF7Q 4YCVA 1Z47A 1KD1C 2ASBA 1A8VA 4A75A 3E9IA 4XTCS 3KF8B 4P71A 2JQOA 4HJAA 1TWHH 1I3QH 3W1BA 3WWVA 1S72A 2JA8H 2XTIA 3PIOA 2A1AA 4DV2L 2K5VA 4IPGA 5IP9H 2NN6G 1B7YB 4PZ8A 4JI7Q 3SGIA 2R92H 2N8NA 4A3DG 1I6HH 3D31A 3CCVA 4JV5Q 4NB3A 4A3KH 2JA8G 5DLQE 2NVXH 4A3LG 4GOPA 3AFQA 1PA6A 1PH2A 2KBNA 2VZAA 4PMWA 3CAMA 3KOJA 2UUAL 4DR4Q 5HY6A 1C0AA 4JI4Q 1WCMG 1ASZA 1VQLA 1A0IA 1Q8KA 2YU9H 2F3IA 4JOIC 3HOUG 4C3JH 1OXXK 3G48A 2KCMA 4JBKA 3TQYA 3CMEA 2WAQG 2R7ZH 4DAMA 3PUXA 1HR0L 4APVA 4UP7A 4JI4L 1K83H 4X62Q 1OXUA 1QZGA 3I4NH 1LYLA 4JYAQ 4K0KL 1UE1A 3RZDH 2Q2UA 3ZJYC 4LF9L 2XGTA 4GLXA 3J7A5 1HZBA 4JC0A 4X66L 2C35B 3KDFB 4EX5A 4IO9A 1YI2A 2KHIA 2ZJRA 1G6PA 3J80c 1HZAA 2AHOB 3CD6A 3A5UA 5K36G 2K50A 3GTMH 4GN4B 4P75A 1YJNA 1L1OB 1K0RA 1HNXQ 2N3SA 2RHQB 4A3JG 3RN2A 3RN5A 4A3EH 3JC66 1K8AC 2JA5H 1SROA 5GADC 2D62A 1PV4A 4BBRH 2ZTEA 4JI2Q 4LWCA 5GAEC 1SN8A 4GNXA 4KHPQ 4B3TQ 2GVAA 5C4XH 3CCEA 1HZCA 2RHSB 5IP7G 1Q81C 3CC4A 3CCQA 1WCMH 1HNZQ 5BR8L 1VQ7A 2NVTH 2Z6KC 3UE1A 3CMAA 2I0QA 2HHHL 1YJWA 3PCOB 4A3BH 1UE7A 1M1KC 2E2HH 1VQHA 1K9MC 2VNUD 5IYDG 3H3VH 1SR3A 3CQZH 3L0OA 1GM5A 1X9NA 1MIUA 1YZ6A 2E5LQ 3KJOA 4NXNQ 3GO5A 5M3FG 3KYHC 4DV3Q 4DR5Q 4X65Q 4GKJL 2NZOA 4LFAQ 1IBKQ 1UE6A 1VQJA 3OW2A 3F2DA 4JI3Q 4A3BG 3RLNA 1HZ9A 4L5TA 4GOPC 3PUWA 4FDBA 4JI5L 1OXVA 3F1ZA 1V1QA 4PZ7A 5FJ8H 2VQFL 3KFUA 2JA7G 1HNWQ 5M3MH 1X55A 1IBMQ 2OTJA 4WJ3M 1YHQA 1L0WA 4X65L 3HFZB 4A3MH 4OWWB 4K0KQ 4NXNL 1N36Q 4GKJQ 3K0XA 1Q1EA 2PMZE 2WB1G 3KLWA 4A76A 1XMQQ 1L2FA 2JJQA 1AH9A 2IX1A 1NMGA 3PUVA 5IE8A 2MNAA 4AIMA 3I4OA 4PZ6A 3HOZG 1Y1VH 3OYYA 2HIVA
chains in the Genus database with same CATH superfamily
2EY1A 5A35A 1WVLA 1SFOH 1XJVA 5C3EH 1XTCD 1SYGA 5KG7A 2E8GA 2KVMA 4JV5L 2KENA 1U5KA 2WACA 5ELBA 4L5RC 5ELNA 1PRTD 1KNEA 1HCZA 3OSNA 2QGQA 3PO3B 3MR5A 5E4WC 1TWCB 1X3FA 3VR5A 5JAVA 2KECA 3HOUH 1K3BC 2HVSA 3RUPA 5KFPA 5DG7A 1N33Q 3GQCA 4A3KB 2XGPA 4LJZC 2IP4A 3MXPA 4ZYSA 1Y14B 4FYDA 4MV9A 3C1FA 1W2BA 5AJ3L 4FNFA 4EEYA 1NSNS 1D6EC 3S14H 1G291 3L3OC 4CHTB 5M5YB 3KHHA 3PF4A 2N55A 3NBHB 1TKWB 2KSWA 2DLNA 4FF1A 3E0EA 3QB3A 2W9CB 1R4QB 2FXQA 3KHGA 1YNJC 1EYDA 4FBTA 4YHHL 2OQKA 2Q8IB 5IOCA 2OCEA 2I80A 1KRSA 4O2BF 1HNXH 2BCOA 2IMWP 1IBMH 3GP7A 3JSNA 1NNXA 2F52A 3R5HA 3NQTA 3F2UA 1ESRA 2RGVA 4LUZA 4A3GB 5KT2A 4RHSA 3L4JA 3BZDB 3WOEA 3KXYT 5E3FA 4I65A 2F0OA 2IX3A 1HR0W 3BQ1A 4EYIB 3U9SA 1WFQA 2UUCH 2EYOA 1RTNA 3A7AB 3EROA 4C3JG 4ZOLF 4MA0A 1JQYD 2L0CA 2NVYB 1NMFA 2CVRA 2R6FA 2CKZB 1Y1WA 5KFMA 4OWTB 1PMRA 4QW9A 2XD4A 4CJ0B 2C2RA 2CWAA 3MWYW 1JIHA 5I9OA 1KXLA 4QCLA 1SAPA 5TSSA 5I2XA 4E4TA 2CZGA 1WJJA 4LFBH 4JI0L 5FD5A 2B2TC 1LTGD 5BMVF 1SFOA 3EA6A 2F0NA 1X3QA 1ZKOA 5M5XH 3HOYG 4HQ6A 2B8FA 5DG8A 3RR5A 4DK1A 2ZT9C 2EYPA 4A93H 4RUAA 5IY0A 5KT7A 4ECXA 1QNKA 1RHPA 5C0XJ 2XC9A 4NDXA 3GTPA 4J6HA 1BXTA 3S1NH 3Q8SB 2W6NA 1WTQA 4GN3B 1CQVA 1A3VA 3QWNA 1CFMA 1IW7C 2Q2HA 2ZM6Q 5C5JA 1QUQA 4EQNA 4K5VA 5T1IA 2F0SA 5EPKA 1FGBD 2NUCA 4MTNA 2R61A 3OTOQ 2FKLA 1S10A 2UUCQ 4RB3C 2JEBI 1PYBA 2PO4A 4IPDA 3S9WA 3G71A 3Q8DA 3N40P 4EBCA 1PTOF 1DZ1A 2Q2IA 1C7YA 5KFNA 5KT6A 4DR2L 1X32A 4HCSA 1R9TH 1J9OA 2PMZA 4YY3L 5M3MB 3C2PA 2YW2A 5G3LD 5BN4A 1EHIA 3PUYA 1IL2A 4LSAA 1S5ED 3M9NB 4DR1H 5CV5A 3TEHB 1A2TA 3CVZA 1ULZA 4NPSA 2R87A 4DF7A 4IUNA 1Y1VB 5C3WA 3MXNB 3ULLA 4A3CG 4G7ZC 1N56A 3MTSA 1Z2OX 2MPMA 1CI3M 5CV9A 4LMYA 5EQ0A 4A93G 5DNFA 1EYCA 3H3VI 4RHRA 2W9BA 1BUVT 1B9MA 1HUMA 4DR6Q 2E5LL 1O7IA 4ILWA 3U58A 2K4KA 4TVAB 1Y1WB 4DR4H 2RA4A 1B70B 3RAQA 2VXWA 4I55F 4TQSA 1L2ZA 4I50F 3QR8A 1JX4A 1BCPC 1PH9A 1VQFA 2W7PA 1CS0A 2AGPA 4RAZA 4IQZA 2AU0A 1E1TA 4R7RA 2JA6H 3C0FB 3BVMA 1F2LA 4ECYA 3H0GB 5ELCA 1IOVA 1BJTA 1S68A 5D3DA 4J9QA 1H9JA 1EIHA 1I5FA 1PH4A 2RDJA 1ET9A 5FLXc 1ASYA 1M0WA 4QW8A 3S1QB 2KQ3A 1F9QA 2Y0SE 2NZHA 3W1GA 1EUDB 1HNXL 1SMXA 4POGA 2EYLA 2HT1A 3CCSA 1WD1A 1TWAB 1RD9D 2YTVA 3BZCA 3GIKA 2NUAB 1B3AA 1IL8A 3GV7B 1XNRH 1HPCA 2VUMA 1GHJA 3NBHA 2W57A 1RJRA 2DJFC 4JI1Q 4A3IG 4ZCKA 3KF6B 1C8CA 1JJ2A 4B3MQ 2JYOA 1GUOA 2NTSA 2NBFA 3U50C 3T5KA 4NXNH 1KJ8A 3FKIG 1QCBD 2J6SA 5T14A 2KHJA 5IYCG 3W3AA 2R7ZG 3HOXB 3S1QH 2ZM6L 2VQFH 1Q8IA 3KF6A 3WDNA 3KHRA 1M8AA 3PUZA 5CV7A 1BF4A 4ED7A 4DL4A 3PVXA 3I56A 1ONLA 3R23A 4F7XA 2KJXA 4LFBL 1N34L 1GSAA 2Z1CA 2JA6G 1TT2A 3LWUA 5C4XG 4DR5L 4OXPA 1SYFA 2WP8J 4QWDA 1KHIA 4KY7A 3MR3A 3CPFA 2WAQE 3A8JE 4PMCA 1VQ9A 1KAWA 4A2AA 5KFOA 4Q45A 1T9HA 2A5HA 2HCIA 2FLLA 2P5ZX 3DWQA 3SEBA 2C2DA 4IOAA 4I7ZC 5FOBB 5C0XH 3I4MH 2JA5A 4LF7L 3RGZA 4K8IA 1F9PA 2F0EA 3IAYA 4O2AF 5KYLA 4RCOA 3AYHB 4X3UA 1JJGA 4YR2A 1VQMA 2OXPA 4A3CH 4KY5A 2OT2A 2R8KA 4IURA 1G2TA 2UXCL 1I7LA 1A3UA 2SOBA 3LGJA 2FFKB 2W9BB 4KHVA 4XYOA 5LP6F 1EY9A 2IY5B 1AUXA 1EFWA 2R8GA 4K5WA 1CKNB 5EAYA 3KJPA 2WAQA 4MV7A 3BDOA 1LT4D 4ZKCB 4TV8F 4LUOA 2K01A 4QWBA 2NN6H 4DR1L 4LFCL 4JVZA 2NVTB 4LFBQ 4C3IG 1GUSA 1E0BA 3JAME 4L5SA 2YRXA 1Q7YC 3RB6A 4J0MA 3HB9A 3RB4A 4JI6Q 3I70A 3X3NA 1PH5A 2N78A 4RAYA 2RSOA 4JV0A 1VQ5A 2IJ0A 3BDLA 1JXLA 2ALZA 1XMOQ 2NTTA 1VMCA 3QIAA 3HOXG 1NE3A 1OTCA 1LTLA 1RODA 1AEXA 1SYBA 2A73B 2B2UA 3UDXA 5LL6b 4QIWE 3K7UC 3TINA 3CRKC 4G4KA 1K8MA 1SNOA 4KK7A 3PQIA 1B04A 4LF5L 3GTOA 3KBXA 3J7ZC 4NXMH 5LMUL 3N6RA 5EWEA 4X66Q 3NE5B 2IT1A 4CKBA 3I4NG 4ECSA 4MV8A 3FDTA 2Y0SA 2V1CC 3P7JA 1PZJD 1QVGA 4AQYH 4ED8A 4XXEA 5KFIA 1CHQD 3IKJA 1B53A 1L0YB 1N9WA 4HMIA 1MD2D 2NN6I 5JEAG 1N34Q 4EEQA 3D4WA 4HYKA 4TQUS 2FPGB 1XMQL 3JAMc 1S0MA 1VF5C 2C28A 3P1HA 4DU9A 5ISRA 4DR7Q 4AYBA 5C8YF 2DNEA 4DV4Q 2XCAA 3DUZA 3A5ZB 2PNHA 2AWNA 4RB0A 4B3SL 5EBDA 4K0KH 4C5BA 1FJGL 2QDLA 4LF8Q 2I5MX 4BY1H 4A3JH 3GIMA 5KNDA 5KFZA 3RLOA 1BVSA 4JI1L 3KALA 4GKKQ 2K03A 4U7CA 1VQCA 4BA2I 3KTMA 3CKIB 4PG3A 4F4WA 1H95A 4UCTA 5F9NA 1DV2A 1PZKD 3J80W 1CTMA 2PI2A 2RDGA 1EIYB 4TUYF 2VUMH 3I55A 1I4RA 4BBSG 2FPPB 1BGWA 3J81E 3Q22A 2VB3X 1WTWA 2QW7A 3K80C 4H44C 2GA4B 2OF1A 4LF6L 4F8MA 3VPDA 4XT3B 2AQ1B 2EDGA 1E4GT 3PW2A 3E9IA 1STGA 3KF8B 4HR7A 4RGNA 3W1BA 2RGRA 3K5MA 4CDEC 2F3VA 2XTIA 4DXGA 5J22A 4HNUA 5I9PA 2W9CA 2K5VA 2R92H 1RJTA 4PZ8A 3SGIA 4Q43A 3U9OA 3J7AV 2KA7A 2JA8G 3HZXA 3S1MB 1DJRD 4A3LG 1S5CD 1SE3A 3AFQA 4GOPA 4APMA 1TS2A 3CAMA 5KT3A 5HY6A 3T1HH 1WCMG 4FM9A 1L0XB 2JEGA 1TWFB 4LFAH 4JBKA 2HQEA 1H9RA 3AB9A 1A15A 2F0HA 3CMEA 4CKCA 4DAMA 3ND9A 2ZDQA 3K57A 4APVA 4XQQA 1QZGA 1CK1A 4JYAQ 1STHA 4WORA 2PN1A 3J7A5 2WB1A 4JC0A 4X66L 3KDFB 4EX5A 1JICA 1YI2A 3PR5B 1N32H 2ZJRA 2PNRC 2XRQD 4ZRZA 3J80c 1HZAA 4J8QA 2CW0C 5K36G 1WH2A 3V4ZA 1SYEA 4A3BH 4P75A 1M6VA 1K0RA 1JR0D 1VAJA 4LH7A 3RN2A 1DOMA 4A3EH 3S2DB 1K8AC 1QOHA 1D5ZC 3GIDA 4HMJA 1J5EH 3VR6A 5GADC 2E2IB 4BBRH 4IWXA 4NP5A 1B33N 3NP8A 3BJYA 4FXGC 4ZAIA 4F87A 1HZCA 2NVTH 1WCMH 1ZXTA 1SYXB 1X3PA 4OEMB 3RV4A 1YJWA 1LACA 3PCOB 4QIWB 5KIXA 1JOQA 1M1KC 4LMQD 3MWEA 4C2MA 1Z7TA 1SR3A 1VDZA 5KFBA 1LT6D 1EY0A 4GKJL 4BS9A 4DR5Q 3H4BA 5IIFA 4ED1A 5I47A 3BG3A 1S97A 3NTIA 3E3XA 1Z2PX 3I4LA 3RLNA 4FDBA 2XIGA 4EGJA 1V1QA 4PZ7A 5FJ8H 4Q8EA 1DM0B 2JA6A 1HNWQ 5CA0F 1X55A 2RDIA 2WIIB 1YHQA 4OWWB 1RJPA 3V6HA 1N36Q 1K1SA 1Q1EA 2PMZE 4A76A 2JJQA 2WINB 3VR3A 1E2ZA 5D3IB 1DXMA 3RD4A 1Y1VH 3OYYA 4J9PA 4JV2A 2I8CA 4EFBA 1CM9A 4PQXA 4QUFA 2LXKA 4QQBX 2CFMA 4MN3A 1SRUA 2ZTDA 4A3JB 4BY1G 4A3KG 1FVIA 2XIWA 3MHBA 1YEZA 4BWGB 1YIJA 1KC8C 3MR6A 5CGKA 1IBLQ 1SJED 2WV6D 4BA1I 2ATLA 2UU9Q 5ELDA 5HBRB 3CCJA 4NLGA 5GAGC 4BY1B 1RL2A 2IBKA 2ICIA 1YNNC 5DGBA 3V05A 4EGQA 2OTLA 1B9NA 4DV0Q 3M9BA 2EJGC 1RTOA 2WKCA 2DY7A 1SXTA 3TDQA 4UY8C 3Q1KA 5KX5F 2R8JA 2WAQB 5JEAJ 5KG5A 1TWGB 1OO9B 1N48A 3MZ5A 1SNDA 3PMFA 5FLXE 1SE4A 3M85A 2DY8A 2A68C 1GJXA 3OUZA 3DLLA 3BZKA 3HS0C 2D2CC 2K7VA 1V51A 4IFDG 4C2MB 1U9RA 4O2DA 1BQQT 2PYKA 2OEOA 4R4CA 3X3MA 3VYUA 1R4PB 4QIWA 1Y1WG 2R7NA 4DV7Q 3NPPA 4N8FA 2FINB 1VMPA 3S1MH 3HOZB 1PK8A 2F0QA 1B44D 1F2YA 3NXWA 5DAUA 3W2DA 4EQ5A 4EBEA 3GTJA 4KD4A 1WTOA 3G6VA 5IT9L 1I4XA 4BBRB 3SDZA 1PXUA 1O7ZA 5E1FA 4CGYB 1VS0A 4HNVA 2VA3A 2W6PA 1WYDA 5LMNH 4HJ5A 4OO1H 2BDNA 3VYRA 1BCPB 2C22A 3Q8QB 3GTKA 1IBLH 3M4PA 5CAEB 2UU9L 4HAEA 4BBRG 3CCLA 5CA1F 4CJ1B 4HCEA 1DYQA 2VQEH 2ZJQA 4EFEA 2YTXA 3GDEA 2VS1A 4DR3Q 5L1LA 1KLUD 5IGEA 4N9TA 1JWUD 1FJGQ 5KFRA 3F2CA 3A74A 1TWFA 4MV4A 4XIGS 1XPRA 4FP5D 2P0AA 2X0SA 1LUZA 3TMEA 3DM1A 4A4IA 5C4XB 1RK5A 2VW9A 4DUYH 4UP9A 4H0LC 4OIKA 1JB7A 2GN5A 3P20A 4H02A 3RTXA 4NXMQ 1TA8A 4TQRA 2NU7B 3MC0B 1II3A 1BNZA 5JPMC 4HR7B 4MAMA 2SNSA 5LOVF 4PNYA 5G3LF 3BABA 3TP6A 4RKLA 4B3TL 4GS3A 1HNZH 4UPAA 4IOCA 4YY3Q 2E2HA 5IT9c 2L12A 1Y8OB 5IYBH 4JI2H 1H9KA 1WTRA 3MR2A 3T5HA 1TWCH 2JEAI 1PX2A 4KN7C 2CH4W 4F88A 3L2PA 1Y1WH 3OTOL 1VBGA 2FLNA 1EUJA 1J5EL 2ENBA 2I46A 1V8QA 4XYMB 1Y8PB 4IJLA 2O4XA 4B3RQ 1JOKA 3VYSA 4XT1B 2R93A 2BOSA 3NWTA 2B63G 1PZID 3M4IA 1F9SA 3FKIH 5M9OA 2WE6A 1X56A 2WB1B 5KG2A 1Q82C 4X66H 5HGTA 2O03A 4JK1C 3FDSA 4ZUJA 3HKZA 4YAKB 2K52A 1N36L 4JI6L 1NCVA 3KLSA 3SK6A 1WCMA 4IAJA 1HR0H 4AH6A 5KFLA 2QK4A 2F0KA 3QFFA 1KC7A 1EUCB 2AGOA 4OX9Q 2Z4HA 2C9OA 4IRDA 2VB2X 1MZBA 1QVFA 2Z4IA 5EKLA 5KFYA 3H15A 1WTPA 5IWAQ 2Z6KA 1EQVA 2RF4A 3RIZA 1VQDA 3NELA 1TQOA 3D8GA 5EPLA 3J81W 3ER0A 2A19A 5K2MA 1MSGA 3W5OA 1TWHA 1LV9A 1PYSB 1Y1VG 1K0SA 1O80A 2FMMA 5C1PA 4J9SA 5JVDF 4WJ4A 5F2DA 1IXRA 1XNQQ 2B2UC 4DKAC 5FLMG 2CW7A 2JA5G 3CP0A 4CC5A 2F0DA 4JW0A 3GIQA 2CQOA 1TY0A 3ERQA 4DGZA 4B3ML 3VPCA 2RDFA 5J2UF 5KFHA 3RAXA 5KGUA 5FJ8G 5KFQA 4AQYQ 3D6CA 1SSOA 4DK3C 2J6UA 3TBIB 4MHEA 2K5DA 3VA7A 1CSQA 3VDYA 3EYYA 4RA8A 3PIP3 2DIKA 1SDFA 4CKEA 4OX9H 2YYZA 5JJLA 3SR1A 1NUCA 1KJIA 1MJCA 4RZRA 2A8VA 5CR3A 3V2TA 1A2UA 3GTOH 1CKNA 4UDUC 1TY2A 1WSCA 2HD3A 3HOVH 4Z9CB 2VY3A 3WOFA 4C3IB 4JI5Q 3AMUA 4RMFA 5CORA 3LX0A 3M7NA 5BPFA 3GTGA 2JK8A 3FKIA 4J9LA 4HIMA 3A55A 1A3TA 2WTFA 2YTYA 1V1PB 4DL5A 2F4VQ 1Q3LA 1XMOH 1XMQH 1RJQA 3A54A 3Q23A 1XNQH 2K28A 4G3IA 1E4EA 1W3SA 4HJ7A 5M5XB 3UDGA 5EBCA 2QA4A 2UVWA 2BE5C 1BBWA 4DR3L 2QCPX 4P72A 3V6KA 1SYDA 3QZ8A 2VL6A 5JOBA 3C3LA 3HOVG 3K8AA 4ZLTF 3HOYB 4H13C 3PO2H 2RBMA 3S16H 4BXXH 2VUGA 2EPBA 3H6MA 4X3KA 4RGMA 1G2SA 4C56C 3MJFA 1EY7A 5LMUH 4L5QA 4Y7NH 1XDNA 3RF2A 3NGDA 4BBSB 1JE4A 4JI2L 3N41B 1DCZA 1UEAB 2R6GA 1X3EA 2ALYB 4DR2H 4EG0A 4GC7A 1CUKA 1J6QA 1ZHSA 1HNZL 3NTKA 2V5AA 4OIJA 4UCOA 3TIIA 3H94A 2DZDA 5I2YA 5C0XG 3I4MG 1UNNC 3PGZA 1F9RA 3E0JA 4EQOA 4DR2Q 2RCNA 3J7YW 3R5XA 1VQEA 2X69A 1TAEA 3A8KE 1E22A 1GO3E 1JE5A 4A3GG 1IZ6A 3A56A 3M4OB 2JP1A 3K81C 2UXDH 1AE3A 3UDIA 4Y7NB 3GILA 1D5MC 1LM0A 3K58A 3CC7A 3CC2A 4Q0YA 4L8JA 1BDOA 2F0WA 2HIXA 1S3OA 1TWCA 4U6PA 1HQRD 1STYA 3GIIA 2XWBB 4ZI7F 4FXDA 3G6JB 3CCMA 2R7ZB 1MI2A 1Z9FA 1IOWA 2CCZA 1N33H 4GKJH 2EYMA 1UWVA 3EN2A 3CQZA 1C30A 2JA7A 3K7AH 3RZDB 1I6VC 2MQHA 1JC7A 3OIPA 4HTHA 2XSCA 2LY7A 1PTOC 4X64Q 2A69D 5LMUQ 5CMDA 4A3IH 4XYLB 3WO1A 4GLAC 1NAPA 4IUTA 3SK4A 3B6YA 1X65A 4JI0Q 3H0GA 2JA5B 3UI2A 2PPBC 3IRBA 4KKUA 4F4XA 5J39A 2UXCQ 2R82A 2UUBQ 2UUCL 5LXTF 2R92A 2LSSA 1EY5A 4DUZL 4JI1H 1HFNA 5DLFA 5JJKA 1XNQL 3P75A 2R84A 1XMOL 2WKDA 1GSOA 3RFCA 3K7AB 4LUVA 1PFMA 3VMMA 4O3NA 3IFDA 5JEAH 1FJGH 2JA7B 1WI5A 4EGVA 1YVCA 3EIVA 1K3RA 5FPRA 1S0OA 1VQPA 1HRJA 4DV6Q 2R7ZA 2F4IA 4CJ2C 2LXJA 5C6AA 3TREA 2E2JB 2F0MA 3PV0A 4LFAL 1CA6A 2PBZA 3I4MB 2AQ2B 4OX9L 3FMAA 2IW3A 3Q8PB 3KHLA 1EIFA 2ZJTA 2EXZA 4L1KA 3T1YQ 4LNQA 3ONAB 4LW1A 1L1OA 3MWDA 3J81c 4MA5A 2V58A 2N88A 3A8IE 2B3GA 1BBXC 3TS2A 4ECRA 2CQAA 1NR2A 2YZNA 5HURA 4DR6H 1D1IA 1W6JA 3RUZA 4H7BA 4JBJA 4B3MH 4WBNF 5L9XA 1KDBA 1VQNA 5J3BA 3GV6A 4AYBE 1L1OC 1M0TA 3D0FA 1ZHQA 4BXXG 4YCVA 4JV5H 2VPQA 3HOZG 3MA2B 2JQOA 4J9KA 3NK9A 1S72A 2J7ZA 5LL6X 2A1AA 3M3YB 4IPGA 2NN6G 1B7YB 4JI7Q 3D31A 1TU2B 2KUMA 5DLQE 3HOUB 1PA6A 1K8OA 3KBGA 4A3MB 2VZAA 3KOJA 2QF7A 3O13A 4DAVA 2YU9H 1A0IA 1Q8KA 2R86A 4JOIC 1E4EB 1OXXK 3IN5A 2KCMA 4UCSA 3TQYA 1S0NA 1V1PA 1HR0L 4Q5VA 4ETSA 1LO5D 4K0KL 1I50B 1WCMB 2NYZD 1SFOB 1S5BD 4CDCC 3GV3A 1C48A 3ZJYC 2G9HD 4LF9L 1JCKB 2XGTA 3T13A 4XZ3B 4RAUC 4MTDA 2A6HD 5KT4A 1Y1VA 3G8CA 1V1OA 3S15B 3T56B 5KFJA 3CD6A 5JVG3 3GTMH 1HNXQ 3C46A 2NVYA 4DL6A 2N3SA 1A9XA 3PW7A 3RN5A 1SBBB 4ULLA 5KFSA 3BVZA 2JA5H 4DL7A 2D62A 4KV6A 1PV4A 5KFUA 2ZTEA 4JI2Q 5GAEC 1SN8A 4KHPQ 2PMZB 5C4XH 4X62H 1F2MA 4YY3H 5E4XA 1HNZQ 5BR8L 2V9WA 1F77A 4FS2A 1I3QA 2HHHL 5CB4F 1I4GA 3TZUA 1RDPD 1UE7A 1S5FD 1VQHA 2VNUD 2PZTA 2K04A 4LAAA 5KRUA 1GUTA 2A69C 3CQZH 4RH6A 3VA5A 2HVRA 1X9NA 2EJFC 3ITPA 3PIO3 2NZ1D 1YZ6A 3S17B 3GO5A 4X65Q 2NZOA 1LT5D 1TWHB 3PZPA 1CHPD 2PW5A 4GOPC 3PUWA 4JI5L 3TQTA 3F1ZA 2SCUB 2VQFL 2F0LA 1W96A 2ZM6H 3KFUA 2JA7G 2ZDHA 4NMZA 1JB3A 4X65L 3HFZB 5DG9A 4NXNL 3M4YA 2BE5D 5C4ZA 5KNBA 2WB1G 4KKTA 1HA5A 3DEOA 1XMQQ 5KYIA 2IX1A 3PUVA 1AH9A 5IE8A 1PTOB 1ENAA 4UAIA 1TS3A 2C5CA 1KBLA 3HKZB 3HEJA 3OMGA 5FLXL 5CV6A 4LF6H 2VPSA 1EZ6A 1NJIC 1FNWA 5KG0A 1IBLL 3U9TA 1PHJA 2BA1A 2E2JH 3CCRA 2ATWA 4O3PA 1PH8A 4KMUC 3ICEA 3JSLA 4JYAH 2JXMB 5LL6S 5IP9G 3J7AF 1DD2A 1HQMC 3GTPH 1M90C 4U68A 4LF9Q 1KIXA 4KJNA 4GN5A 1EYZA 1Z2NX 3U4VA 5GAHC 1ZQ7A 5IGBA 4QJFA 3RB0A 1OXSC 5C3EG 1PTOH 5C0XI 1FD7D 4DK0A 4IRKA 5EJWA 4DV2H 3PIPA 1EOTA 1CQIB 1YJ9A 2QEXA 4B3SH 3MFYA 1PH6A 4M9UA 1HNWL 3I2ZA 3KK7A 5C1OA 2CW8A 4A3MG 4QUCA 2GVBA 2W70A 5K36H 5IWAL 4KTAA 4N9PA 5BN3A 3NEMA 1N34H 4RB1A 3NWSA 4DV0H 2HQLA 5D8DA 1BXRA 1UC9A 5EWFA 2B63A 5LMNQ 1K73C 1T3NA 5DLGA 2X6GA 4YHHQ 1E1OA 3J81i 1IKLA 2L9HA 3S2DH 4GNXB 3LMLA 5EZYF 4DV3H 2TSSA 4J9MA 1E7ZA 3T5JA 1YITA 1EWCA 2D0OA 4JI8L 3ORRA 4YWKA 5KT5A 1EWHA 2ZXPA 1GOZA 3F2BA 2CWPA 4QF4A 4DV7H 4CBVA 3RBEA 1I4HA 1PH7A 4A3LH 1QILA 4WFN3 3BAAA 5IP7H 2K33A 5KFGA 1T5XD 1STEA 1U4LA 2A6HC 4R4QA 1G8ZD 1JOOA 3I3CA 4DUYQ 2HCCA 2BH8A 2RKSA 4ECUA 3T1YL 4X6AH 1G91A 4DL3A 2SNMA 3GTLA 5C44G 2R93H 2K14A 3TSSA 4KJOA 2F1MA 4OO1I 4RKBA 1DGSA 1JWMD 5GQOA 4G7HC 1I94Q 4MV6A 2F4VH 2IL8A 2B8GA 2JA6B 5BPHA 3MEFA 4YQWA 5I6WA 4IFDI 1SEIA 1O7LA 2OQ0A 1M7JA 4JYAL 3HOWB 3R8BA 5C3EB 4B3RL 3CCUA 4XQJA 1CKOA 2W71A 4CC6A 2HJWA 1B8AA 1ML0D 1K83B 1SEBD 5EPJA 5KFEA 4DUZQ 5CBEE 4RGTA 3FKIB 3STBD 1VKZA 4LF9H 2Z8LA 4RFBA 3F8TA 4A3DB 2K32A 2JEFA 4CDFC 2UUBL 2H1EA 2FP4B 3DF7A 5HGQA 4KHPH 2E74C 3R2IA 3E6ZX 1B1ZA 1V9PA 2UXBL 3E5SA 2QYZA 1JLLB 1GGOA 3JAML 1LTAD 1WTHA 1CT1D 2YRWA 3HKZG 2E2IA 3M4OH 4R4OA 5IGCA 3HOWH 5D1OA 3GTLB 1CE8A 5D1PA 1NBWA 4WD3A 2K5WA 3GTMA 1UC8A 4EVOA 2EQSA 5HV6A 4DR5H 3Q8RB 1D1KA 3TS0A 1IKMA 4FU0A 4ED3A 2ZDGA 1FYCA 2UVRA 3K5OA 1EYAA 3J81j 5EKKA 2R3ZA 1EEFD 1CZWA 2W8KA 2VQFQ 4ECVA 2EY6A 3OWEB 4DV7L 1ILPA 4DR6L 4V190 3I91A 3Q6SA 2MFIA 3PO2B 4A93B 3V4SA 1VQAA 3OIQA 5E7NA 5KG6A 3K5LA 1WTVA 5LA6F 3A0JA 4RZQA 5IODA 1WR2A 2B63B 1UAPA 1UEBA 4KHPL 3RJ0A 3M7GA 5L1JA 3ETJA 1GD7A 4RCNA 3NENA 1M4VA 1XNRL 4M1UB 1E2VA 2B2VA 4WRDA 5C4JH 2HHHQ 4DAYB 2WDTA 2BR0A 5IWAH 3QJYA 1PRTB 4XX0B 1TR5A 3HGBA 4A3EG 2UXCH 4YJ2F 3DHQA 1VQ8A 1PLFA 2J0TD 2B2YA 3M4QA 3PO3G 4PWQA 3GTQH 4UFZA 1B2TA 3ULJA 1KEEA 3OHBA 2JE6I 2F0IA 2R93B 1VBHA 1EWIA 4G7OC 3OPOA 4JCVE 5DEHA 4IN3A 5M3FH 4DNRB 2K5NA 3CPWA 1MKHA 2CW0D 1V4YA 3GLKA 3S16B 5C4JB 1O7YA 3FPUB 5AFWA 5KEEA 2EVBA 1E4FT 1HR0Q 1VQ6A 4ZUIA 2UXBH 5JJZA 1G6ZA 3QO2A 5JPNC 1CA5A 2F0FA 2HVQA 1FNVA 3L7ZC 5KG1A 1EY4A 4BY7H 4HNTA 4A3FH 1GUGA 1IBKL 2D5DA 2UXDQ 1VQKA 2JA8B 3S15H 4P73A 2SEBD 2R92G 1KL9A 2NVQH 4K6DA 1EY8A 4HIOA 2L4NA 3SI8A 1H9MA 2FE3A 4B9WA 4DR1Q 4LF5Q 4ZQIA 2V59A 3Q0AA 4AQYL 4DA2A 2HDLA 1ESFA 5H1SE 4RG1A 4FF3A 2NVXB 2PQEA 4GOPB 4DV3L 3EVQA 5FKAC 4IJHA 1EQTA 2R8HA 3ETHA 3IG0A 3GTJH 1PFSA 4O3QA 4JI3H 2F0VA 3BVGA 4M7EA 3G6YA 4YR0A 4DV1H 4ECZA 3G7LA 2FHTA 1D8LA 2RSNA 4JUZA 3KF8A 2DPIA 2CH4A 4LF8H 1BBUA 3BJUA 2M2LA 3KUPA 1KJJA 3GTQA 3H3VC 1EIGA 4TKOB 3T1YH 4IALA 3I12A 2JA7H 1LTSD 3T1HQ 1IYVA 3GTGH 4P2CB 2RQXA 4QL5A 3OWFA 1EZ8A 1GLVA 1I3QB 2MO0A 4XDXA 2JEIA 2M9VA 3CHBD 1NY4A 4LFCQ 4DV1L 2R85A 4NW2A 1E2WA 1A62A 3L4KA 4YIJA 4A3DH 2AQ4A 2JA9A 2WB1E 2K05A 4X62L 1YBYA 1JORA 3WO0A 1BKBA 2CHBD 5KNCA 4K8JA 3FHWA 3DMUA 4DAPA 2YS6A 4HJ9A 2UUAQ 4DR4L 1KJQA 1VQOA 3GTLH 2E76C 2HGSA 2UVVA 1VQBA 4DR3H 3TQ1A 4J9NA 2UUBH 3K59A 5LMNW 1SNCA 2B2YC 3K5NA 1IBKH 1I4QA 3FPPA 3SK8A 3JAMW 4JPBW 3OHXC 4DN4M 5GONF 1SE8A 3K0YA 1I50A 2PVPA 2KCCA 2LFNA 1DONA 4FS1A 2F03A 3J80L 4QGUA 1GHKA 3BQ0A 2R93G 1X3GA 2FJ2A 3H40A 2PQAB 1Q46A 1TWGA 3ZYYX 1SLJA 2B2WA 1S03G 4HIKA 2R7FA 4DNIA 1VCIA 2EE1A 3RB3A 2ASJA 3HOXH 4EBDA 4ECTA 4IRCA 2SDFA 1P8LA 4KHZA 4ME3A 2YZMA 3BA8A 2F3WA 1RF2D 4YBZB 2EYHA 2PI2E 3TZDA 1KLGD 1VF7A 3G6EA 2PZUA 4LK1C 3H0GG 1WD0A 1X6OA 1YNXA 4HSVA 1JWSD 3S2HH 5DQGA 3FMCA 2K5HA 4ABNA 4C3IH 2TMPA 2XWJB 1AN8A 2K6AA 2X6LA 4C1NK 1LTTD 3RZOH 4LF8L 2F0JA 1B4OA 2XCLA 2YS7A 2VR1A 4C5CA 4N8X1 3DWPA 3IL8A 1I6UA 3HOZH 4JI3L 4XQNA 4A3BB 2VA2A 2KCNA 1QE6A 2BQRA 3U4ZA 3FP9A 3K5IA 3N44B 1EQRA 3KLSX 1E3PA 4O42A 4O4HF 1J8IA 1PVOA 3T53B 3KAKA 5NUCA 4LF6Q 4X65H 4GLVB 1DV1A 5DGAA 5LYJF 4MNOA 2K1BA 4KKSA 4L63B 2HDMA 4JV1A 2K5QA 3G6XA 2J9GA 2KEEA 4ZQ3A 3R3OA 4QMGA 4FVMA 3RLFA 2A6ED 4LF4H 1MBYA 2Z9HA 4O1NA 3HOVB 4JI6H 5DQHA 4R8NA 1Z47A 5I4DA 1KD1C 5I6YA 1S4ZA 3MEHA 1A8VA 4A75A 4TV9F 4P71A 1MHWC 3WWVA 2JA8H 3TIGA 2FB9A 4DV2L 4R8UA 5IP9H 2HHHH 1STNA 2FMAA 2N8NA 3V96A 1GYFA 5IT9E 2NVQB 2NVXH 3ORQA 3K6OA 2F0UA 1PH2A 4NKLA 4PMWA 5IGDA 2UUAL 4DR4Q 5COYA 3URYA 1C0AA 4TSSA 1VQLA 4FF2A 3KAJA 3HG9A 4C3JH 2AUJD 5C3XA 4X3SA 3S14B 2B39A 1RCVD 2WAQG 1DOKA 2R7ZH 3PUXA 2QILA 4JI4L 4UP7A 1K83H 5FO7B 4X62Q 1EY6A 1LYLA 4YHHH 4K6LA 1I94H 4K2LA 4GLXA 3BG5A 3SXHA 4YJ3F 3PW5A 2C35B 4IO9A 1B50A 5KFXA 4B3RH 1AFPA 4C3HB 4CDDC 4GC6A 2KHIA 5FO8B 1B6RA 2BQUA 1I4PA 2Q8TA 3A5UA 2K50A 5EKIA 4GN4B 2W6ZA 3RGXA 2RHQB 3F8NA 1FNUA 4A3JG 2FK2A 3JC66 2RDHA 4RU9A 1D2BA 2I87A 2ASDA 3CCEA 2RHSB 2EJMA 1Q81C 3CC4A 4MV3A 1VQ7A 4I7AA 2Z6KC 3UE1A 3CMAA 1T36A 2W9AA 2VUMB 3N8DA 1C3OA 4A2BA 1DIKA 4PMBA 3BDCA 2E2HH 3MWMA 3PW4A 1K9MC 1UNSA 3DXJC 1U4RA 1RYSA 3L0OA 1GM5A 2LS01 2PCFB 2IPKD 1CQJB 3H4DA 4F50A 4EYHB 4DV3Q 3KYHC 4FF4A 4LFAQ 1IBKQ 1VQJA 4Q44A 3J80E 3HRZC 5BR8H 1HZ9A 2XVSA 4JI8H 2YU9A 1Y69U 1GUWA 1W6KA 3H91A 3VR2A 2AGQA 1IYUA 1XYIA 3GTPB 1KABA 2NWGA 1JDBB 4DV6H 2GLTA 2EOTA 4GKJQ 1QG7A 1AN7A 3K0XA 2LMCB 3PW0A 3LWEA 1NMGA 2MNAA 4Q0FA 1CZGA 2Q8RE 4PZ6A 1PRTC 4ZKBB 2HIVA 1HUNA 1A63A 2OLSA 5IT9W 3G4SA 4AYBB 3TRZA 5M5WB 3VPBA 3M3YH 3MXNA 5AJ3Q 4Y8VB 5KG4A 2BH2A 5J2TF 4ID6A 2FK3A 2KEDA 1PH1A 1XWEA 2AMCB 4UCVA 1EOVA 1UE5A 5FK9C 5IYDH 4DUZH 2UXDL 2MGSA 5IYZF 5EWGA 3GV5B 1O78A 4AYBG 4X64H 3H0GH 3R93A 3K5HA 5KKNB 4IUUA 1BO0A 1GUNA 1GSHA 1EYGA 3T5LA 2YU9B 1XNRQ 1YNND 3GTOB 3S1RB 1I50H 2ASLA 3A7LA 3GD7A 4RWSC 2Z6BA 5KFTA 2EZVA 3N43B 4ALPA 3OUUA 1FGUA 1EFID 3H20A 5CYUA 4KLKA 4O0AA 1P16A 4MTEA 3J81L 1I7NA 4ED0A 3HP3A 3GTQB 2MCTA 5KG3A 3SE7A 1QUQB 2FK1A 5KFDA 4JBWA 1ZYRC 4HEDA 2CQYA 1X54A 3AEVA 3DEPA 4E6IA 5JVH3 3HOYH 1HTLD 5M3FB 3CXCA 2C00A 1ILQA 4QWEA 2WFWA 5FLMH 4DV2Q 5FO9B 4RUCA 3FVQA 2NVXA 1JMCA 3TP7A 1JT8A 2MJ8A 4S3SA 1KTKA 1PFBA 4O3RA 2DJGC 3M9OB 4HIDA 2BDOA 2DNCA 5BR8Q 4ZHQF 4DV0L 2D0PA 3GV8B 1CKMA 4OELB 2KCTA 2PW7A 3Q24A 4C3JB 5KFWA 4F4ZA 5ELFA 2F0GA 4KD3A 2G5DA 2L1BA 3T4AC 5CV8A 4O3SA 1PDQA 1OXTA 1XX8A 4JI7H 5IYCH 2R7DA 3OMCA 3S17H 1SJHD 4RB2C 2DUDA 3MXUA 2GPWA 4OWXB 1MJEA 1BOSA 1E24A 1K1QA 4DV5H 1SE2A 1ET6A 1T5EA 4C3HH 2MUYA 4LSXA 2LKVA 4U673 4DV4L 4JOIA 4PV1C 5C4HA 3ERSX 3NSWA 1AE2A 3EPGA 2PZWA 3OOCA 4C3HG 3PN1A 3EPIA 2MHVA 1U4MA 1YHAA 2R8IA 5GROA 2B63H 4YAJB 4UCRA 2E5LH 2FJZA 4FBUA 2E2HB 2EXDA 1U0LA 4YCUA 1LTID 3CRLC 1KDAA 4RGOS 4YWLA 4UCUA 4IR9A 2Q2TA 3I4NB 4DAYA 5H80A 1QB5D 3HKZE 2OWOA 1LLRD 1STAA 3CQZB 2IHEA 1Q12A 3HOUG 4A3IB 2OH2A 1VQGA 2O2LD 4C2MH 4A3GH 1HJPA 3ULPA 2V4QA 4BY7G 3SE0A 4ME6A 1QNUA 4OHJA 4JBMA 1C9OA 3T1HL 4A3EB 4IZOA 4JI5H 1HTPA 5DM73 1N32Q 1MSHA 4DV5Q 4JI8Q 4P74A 5D14A 1KQSA 4DK6C 3S2HB 3BYYB 2W6MA 4HJ8A 4M8AA 3N42B 4L6TB 4DPGA 4EQPA 1CSPA 2L11A 1ZEQX 1SNQA 2L15A 1I94L 1TWAA 1SMYD 2Z0SA 4IHJF 4A3FB 3I7FA 4GKKH 2GPSA 4ECQA 1IYJB 3PO2G 4JI4H 1KRTA 3PO3H 2V4DA 2ZTCA 2A68D 4BWSC 4OL7A 5LMNL 2MP1A 2YV5A 1ZETA 3SK5A 4KI0A 4IFDJ 3I72A 1U4PA 3HXLA 4B08A 3OSPA 2L55A 1K8GA 2B2TA 4YB8B 4OGQC 4IWYA 4F4YA 1XTDA 4DR7H 2KOLA 1CQFA 3SHLA 4DFAA 4R8UB 2B2WC 5CC4A 4QY7A 2EYJA 4C1NI 2W8LA 2IHFA 4PDBA 3S1RH 3OW7A 1PTOD 1HH2P 5EGTA 3CF5A 1H9SA 2E75C 2XCPA 1B3QA 1TXYA 1VQIA 1Q1BA 1N36H 3GTGB 2MO1A 4HSPA 4X3TA 5DQIA 1S40A 1EQQA 5JQWA 5IGGA 3VR4A 4DL2A 4C5AA 4LF4Q 2WYOA 4IFDH 4IUVA 1EZ1A 4B9XA 2XRSD 4WJWA 1FR3A 2L5TA 2BQ3A 2DGYA 1HXYD 2I5HA 2B2VC 4DV6L 2XN9C 2NVYH 3NTHA 3L9AX 2IX0A 1AW7A 1MGSA 1FL0A 1N8RC 3M9MB 1ENCA 2IWHA 2FLPA 4NXML 1KDCA 1K28A 1SNMA 3HOWG 2UVUA 4G57A 1IBML 1TS5A 1KAAA 1TWGH 1SCUB 3BS1A 1TWAH 1QZHA 4GKKL 1V43A 1EL0A 2W7OA 1ICFB 1AUVA 2B29A 3TN2A 1ENFA 4B3TH 1Q86C 5C5MA 2BA0A 4MV1A 4J15A 1N33L 1NR4A 5L1KA 1GKHA 3UE0A 2Y0SG 3E9HA 3RMHA 3BU2A 4XYQA 4GZYC 3Q2OA 3D4RA 2EY2A 1XPOA 1GVPA 1S9FA 2JN4A 1HHVA 3RV3A 4X64L 4R4IA 3UDFA 3VYTA 3MFHA 2J6TA 3AFPA 1BCPD 4JG2A 1TWFH 2RVLA 2VQEQ 2PQAA 4J1MA 4LFCH 1KNAA 4MIUA 3S1NB 2HUGA 2K75A 4ODGA 1SYCA 3MXGA 3I8ZA 2ZJPA 1JKJB 4R1JA 3OHAA 3QZ7A 5C44H 2VQEL 3BQ2A 2NB0A 1JJCB 5L37A 3RNUA 1EEID 2YL2A 3LP8A 3JAMi 3QOJA 3MAQA 1A6XA 5A2QL 1RYRA 2O5IC 4ED2A 4K14A 4DR7L 1D7QA 1ICWA 1NTGA 5IYBG 3AU7A 4OONA 2H4OA 3MFGA 2ZXOA 5JVLA 1D5XC 2EYFA 4YR3A 4DXFA 4B3SQ 4A3FG 4J9OA 2VOBA 4YCWA 1YNJD 2F4VL 2JSOA 5JJIA 4LF5H 5JH7F 2W6QA 1XPUA 2ID0A 2J4XA 4K2KA 2A6EC 3UQ8A 4FXKC 1SMYC 3KDFA 5F9LA 3QOLA 3D6WA 3PF5A 3OSOA 3T16A 4JI7L 2DPJA 2NU9B 4YWMA 2QEJC 5EOYA 3CW2C 1YHBA 1C4QA 4YP3A 3JZIA 2VQDA 2N49A 5M3MG 2UXBQ 4LF4L 1VQ4A 3PSIA 1GXDC 1UUPA 1LT3D 4Q8FA 1G51A 4TRDA 2EIFA 5JUMA 4DUYL 3NQIA 2E2DC 2QDBA 1R9TB 3AQQA 4R8IA 3DM3A 1R9TA 3K3PA 4Y52H 2EY5A 2YCHA 4RNMA 4GNXC 5EDWA 2JEJA 5LHY1 2E2IH 2AWOA 3R2TA 3TP5A 4IPCA 1QJOA 2DWCA 1F2ZA 1RIPA 4OO1G 3BA9A 1AZQA 3ND8A 2A74C 1HFGA 3J80i 1QVCA 3E5NA 5FD6A 1B6SA 4HN7A 1JDEA 5K5PA 1TIID 3BYTB 1AZPA 4MZ9A 3WNZA 4DNTB 3S24A 4UP8A 2AUKA 1PH3A 3NBIA 3GTKB 5KFAA 3STBC 1PYWD 1WOCA 5M5WH 2YYAA 1HNWH 3HKSA 2ICEC 4POFA 3GTMB 4DV1Q 5L1IA 5FPOA 1BCPF 1QWYA 4QB4A 3GIPA 5M5YH 2O5JC 3FEWX 2FPIB 2G9DA 2AQ3B 1OWTA 3D3RA 4IPHA 1I6HB 3LWBA 5J1ZA 2DN8A 2H5XA 4BBSH 3GTJB 5KFFA 3MVVA 2VUMG 2R7MA 2M00A 4IUPA 3SVMA 4DV5L 2AKWB 1N32L 3EBEA 3R5FA 5KFVA 5ELEA 4QWAA 2ES2A 3I73A 1J5EQ 2I5LX 4ECWA 1ZYRD 2NU6B 5ELOA 3EFXD 3I90A 3RBDA 3GTKH 4R4TA 2R7KA 4LF7Q 3PR4A 5CV4A 3DWAA 1H9SB 4MTKA 2ASBA 4BY7B 3MFIA 4XTCS 4HJAA 4K5XA 1TWHH 1I3QH 3PIOA 3KLRA 2ZXRA 2M05A 1I6HH 5CBAE 2Y0SB 1IW7D 4A3DG 1BR9A 3J7AK 3NUCA 1T94A 3CCVA 1RKNA 4JV5Q 1PRTF 4NB3A 4A3KH 3QG1A 4RNOA 3OTOH 3K3VA 2KBNA 2C2EA 1RK6A 1Z6HA 4I7HA 5A2QW 4JI4Q 1ASZA 2XNAC 2F3IA 3G48A 2FMCA 4KY6A 3N6XA 5C5LA 3I4NH 1OXUA 1UE1A 3RZDH 4KN4C 4LH6A 1DOLA 2Q2UA 1LTRD 4V0BA 3IFTA 4O4IF 1HZBA 3FRPB 5C44B 3JRXA 1SNPA 3TP8A 1G6PA 3H09A 3JRWA 2AHOB 1W93A 5D1OB 1YJNA 1L1OB 5A2QE 2KHSA 4R9WA 1LABA 4O4LF 3NHHA 5BN5A 4IZ8A 1EU3A 1SROA 4DLKA 3GIJA 1TVXA 4LWCA 1S5DD 4ME5A 4GNXA 2GVAA 4B3TQ 4I4TF 1IHZA 5KFKA 4QWCA 4J9RA 3V6JA 2XGQA 5IP7G 3CCQA 3UFXB 2IA6A 3LNNA 2I0QA 1WTXA 5DM63 1O75A 2YZGA 2W6OA 5IYDG 3H3VH 4ZK9B 1Y8NB 4O3OA 2R7LA 1K83A 1AP0A 2NU8B 2QKIC 2UU9H 1MIUA 3EJIA 3RZOB 4JI0H 2F0PA 2E5LQ 3KJOA 4NXNQ 4FO2A 5M3FG 1KJ9A 1TS4A 2D9UA 2V4RA 1UE6A 5FLXW 4ED6A 3GQBA 1STBA 3D4DA 3HBLA 3OW2A 3F2DA 4JI3Q 4A3BG 3N52A 4L5TA 2R92B 1LTBD 1PFNA 1EU4A 1OXVA 4UHVA 2F0TA 2UUAH 4LF7H 4IR1A 1Q90A 5M3MH 1IBMQ 2OTJA 4WJ3M 5D65A 1L0WA 4A3MH 4K0KQ 2RCFA 5KFCA 5IGFA 3EQLC 3C1EA 4DV4H 3KLWA 1XXGA 1HA6A 1BNCA 1L2FA 2I07B 5T1GA 4RNNA 3CU7A 4AIMA 3I4OA 4IUQA 1FKAH 3T51B
chains in the Genus database with same CATH topology
1SFOH 1XJVA 5C3EH 2LXKA 4QQBX 2E8GA 2CFMA 1A63A 4JV5L 1SRUA 2KENA 1U5KA 2ZTDA 3G4SA 1NJIC 1IBLL 3TRZA 1PHJA 2BA1A 4BY1G 3CCRA 2E2JH 5ELNA 5AJ3Q 4A3KG 4L5RC 2ATWA 2BH2A 1FVIA 3M3YH 1PH8A 1YEZA 1YIJA 3ICEA 1KC8C 2QGQA 5IP9G 1PH1A 2AMCB 1X3FA 1IBLQ 1EOVA 1UE5A 1M90C 4BA1I 3GTPH 4LF9Q 2UU9Q 1KIXA 3HOUH 5IYDH 3CCJA 4GN5A 1N33Q 3U4VA 2UXDL 5GAGC 5GAHC 1RL2A 1Y14B 4QJFA 4AYBG 1OXSC 3H0GH 5C3EG 5AJ3L 1W2BA 5C0XI 2OTLA 3S14H 4DV0Q 1G291 3M9BA 1EYGA 4UY8C 3PF4A 3NBHB 5JEAJ 1XNRQ 3PIPA 1I50H 1YJ9A 3E0EA 3GD7A 2FXQA 3M85A 2QEXA 1PH6A 4ALPA 1HNWL 4YHHL 1FGUA 3I2ZA 4A3MG 2GVBA 4KLKA 1P16A 2OQKA 3BZKA 4O0AA 2OCEA 5IWAL 1KRSA 3DLLA 3NEMA 4IFDG 1QUQB 2F52A 4JBWA 2HQLA 4O2DA 4LUZA 1X54A 4R4CA 3AEVA 1Y1WG 1HR0W 5LMNQ 4DV7Q 3HOYH 3CXCA 1K73C 3S1MH 4YHHQ 1E1OA 2WFWA 3J81i 5FLMH 3S2DH 1WFQA 4EQ5A 4DV2Q 4GNXB 1JMCA 1JT8A 1E7ZA 1YITA 2D0OA 4JI8L 4YWKA 3F2BA 1VS0A 4HIDA 5BR8Q 1WYDA 2CWPA 1NMFA 4DV0L 2D0PA 2CKZB 4HJ5A 1CKMA 1PH7A 2KCTA 4OWTB 4A3LH 5IP7H 2CWAA 1KXLA 3M4PA 4R4QA 2UU9L 4BBRG 3CCLA 1OXTA 1WJJA 5IYCH 4DUYQ 4JI0L 2R7DA 2ZJQA 2BH8A 3S17H 2YTXA 3GDEA 2VS1A 4DR3Q 2DUDA 4OWXB 5M5XH 1MJEA 1E24A 3HOYG 3T1YL 4X6AH 1FJGQ 4C3HH 5C44G 3A74A 3F2CA 2R93H 2K14A 4DV4L 4JOIA 4XIGS 3RR5A 1XPRA 3ERSX 1AE2A 4OO1I 4A93H 1DGSA 1LUZA 5IY0A 4A4IA 5C0XJ 5GQOA 2VW9A 1I94Q 1YHAA 3S1NH 3MEFA 4UP9A 4GN3B 5GROA 2B63H 1JB7A 2GN5A 4IFDI 4H02A 4NXMQ 2Q2HA 2OQ0A 2ZM6Q 2EXDA 1QUQA 4JYAL 1D7QA 1U0LA 4YCUA 4B3RL 3CCUA 1CKOA 1B8AA 4YWLA 4MTNA 2Q2TA 4DUZQ 3HKZE 3STBD 2OWOA 4B3TL 3OTOQ 2IHEA 1Q12A 3F8TA 4GS3A 4UPAA 2UUCQ 2JEBI 1PYBA 4IPDA 4IOCA 2UUBL 1VQGA 4YY3Q 3G71A 4C2MH 3Q8DA 5HGQA 5IT9c 5IYBH 4A3GH 2Q2IA 1C7YA 1V9PA 2UXBL 1HJPA 4DR2L 1TWCH 2JEAI 3ULPA 4BY7G 1R9TH 4YY3L 3L2PA 1Y1WH 4JBMA 1C9OA 3HKZG 3OTOL 3T1HL 1EUJA 1J5EL 3M4OH 3PUYA 1IL2A 4R4OA 3HOWH 4IJLA 3TEHB 1N32Q 4DV5Q 1NBWA 4JI8Q 4B3RQ 4NPSA 4P74A 1KQSA 4DK6C 2B63G 3MXNB 3ULLA 2EQSA 4HJ8A 3FKIH 4A3CG 1X56A 4DPGA 3TS0A 1Q82C 1CSPA 2L15A 1I94L 4A93G 3H3VI 2Z0SA 2K52A 3J81j 1N36L 3I7FA 4JI6L 1IYJB 3PO2G 1KRTA 4AH6A 3PO3H 2ZTCA 2E5LL 4DR6Q 1O7IA 3U58A 2K4KA 4TVAB 2VQFQ 5LMNL 4DV7L 1B70B 4DR6L 2YV5A 4OX9Q 4KI0A 4IFDJ 2MFIA 1PH9A 1VQFA 1QVFA 1K8GA 1VQAA 5E7NA 3H15A 1XTDA 5IWAQ 3A0JA 1E1TA 2Z6KA 2JA6H 2RF4A 1VQDA 3NELA 4QY7A 1UEBA 4KHPL 3ER0A 2A19A 1I5FA 3W5OA 1PH4A 1GD7A 1PYSB 5FLXc 2IHFA 1Y1VG 3NENA 1ASYA 3S1RH 1XNRL 2HHHQ 5C4JH 2Y0SE 4WJ4A 2NZHA 1HH2P 1IXRA 3W1GA 4DAYB 3CF5A 4DKAC 1HNXL 1SMXA 4POGA 5FLMG 1XNQQ 1TXYA 1VQIA 3CP0A 2JA5G 1Q1BA 3CCSA 2HT1A 4A3EG 2MO1A 2YTVA 3BZCA 2CQOA 1VQ8A 4B3ML 1S40A 1EQQA 3M4QA 3PO3G 4LF4Q 4JI1Q 4A3IG 5FJ8G 3GTQH 3ULJA 3KF6B 4B3MQ 1JJ2A 2JE6I 4AQYQ 1EWIA 4DK3C 3U50C 1CSQA 3VDYA 4JCVE 2DGYA 3FKIG 2I5HA 4DV6L 5M3FH 2KHJA 2K5NA 2NVYH 5IYCG 1MKHA 2IX0A 2YYZA 3CPWA 1N8RC 1FL0A 2R7ZG 3S1QH 2ZM6L 5JJLA 3KF6A 4NXML 3PUZA 3HOWG 1MJCA 1IBML 3I56A 1HR0Q 1VQ6A 2A8VA 1TWGH 3GTOH 1CKNA 1TWAH 1QZHA 1N34L 1V43A 4GKKL 3HOVH 4LFBL 2B29A 2VY3A 4JI5Q 4RMFA 3L7ZC 2JA6G 3M7NA 4BY7H 2JK8A 4HIMA 1Q86C 4A3FH 2YTYA 5C4XG 2BA0A 1IBKL 4J15A 1N33L 1VQKA 2UXDQ 4DR5L 3S15H 1GKHA 4P73A 4OXPA 2F4VQ 3UE0A 2R92G 1KL9A 2WP8J 2NVQH 1KHIA 2Y0SG 3E9HA 3BU2A 1W3SA 2WAQE 3CPFA 4HIOA 4HJ7A 3UDGA 1XPOA 1KAWA 2QA4A 4DR1Q 1VQ9A 1BBWA 4DR3L 4P72A 4LF5Q 1GVPA 4AQYL 2VL6A 1T9HA 5H1SE 4RG1A 3K8AA 3HOVG 4GOPB 3PO2H 4DV3L 3S16H 4BXXH 4IOAA 4X64L 4R4IA 4IJHA 3I4MH 4LF7L 3UDFA 3AFPA 1PFSA 3GTJH 4JG2A 1TWFH 2VQEQ 2PQAA 4L5QA 4Y7NH 3AYHB 1JJGA 4JI2L 1D8LA 1VQMA 4A3CH 2R6GA 1X3EA 1BBUA 2ALYB 2UXCL 2K75A 3BJUA 1CUKA 1J6QA 1HNZL 3LGJA 2JA7H 2ZJPA 3T1HQ 4R1JA 5C0XG 3I4MG 5C44H 2VQEL 3GTGH 3PGZA 1JJCB 2IY5B 3RNUA 1EFWA 4QL5A 4DR2Q 3JAMi 2MO0A 2RCNA 1CKNB 1VQEA 5EAYA 3KJPA 1NY4A 4LFCQ 4DV1L 4DR7L 1A62A 1E22A 1JE5A 1GO3E 4LUOA 2JA9A 4A3DH 1NTGA 1IZ6A 2WB1E 5IYBG 4OONA 1YBYA 4X62L 4LFCL 4DR1L 4A3GG 4B3SQ 3K81C 1BKBA 1AE3A 3UDIA 4A3FG 4LFBQ 1LM0A 4YCWA 3CC7A 3CC2A 4L5SA 1Q7YC 2F4VL 3FHWA 2HIXA 4JI6Q 1S3OA 4HJ9A 2N78A 1PH5A 2UUAQ 4DR4L 5JJIA 1VQOA 2ID0A 1XPUA 3GTLH 1VQ5A 3CCMA 1VQBA 1XMOQ 3KDFA 1Z9FA 2CCZA 5LMNW 3PF5A 3HOXG 1UWVA 3EN2A 4JI7L 1NE3A 1OTCA 4YWMA 1LTLA 1SE8A 3K7AH 3CW2C 1YHBA 2MQHA 3UDXA 2N49A 5M3MG 2UXBQ 4LF4L 1VQ4A 4QIWE 4X64Q 5LMUQ 3PSIA 4QGUA 4A3IH 2R93G 1X3GA 3K7UC 2PQAB 1Q46A 1G51A 4GLAC 2EIFA 4LF5L 3B6YA 3J7ZC 1X65A 1SLJA 5LMUL 4DUYL 4JI0Q 4HIKA 4X66Q 2R7FA 3AQQA 4DNIA 2IT1A 3DM3A 3IRBA 1VCIA 2UXCQ 3I4NG 3HOXH 4Y52H 2UUBQ 4GNXC 2UUCL 1P8LA 2V1CC 4KHZA 4ME3A 1QVGA 2E2IH 2LSSA 2PI2E 4DUZL 3G6EA 2AWOA 1N9WA 5JJKA 2NN6I 4IPCA 5JEAG 1N34Q 1XNQL 4TQUS 3H0GG 1RIPA 1X6OA 1YNXA 1XMOL 3JAMc 4LUVA 1XMQL 3S2HH 4OO1G 3J80i 2K5HA 1QVCA 1WI5A 4C3IH 4DR7Q 1YVCA 3EIVA 1K3RA 3RZOH 4DV4Q 4LF8L 1VQPA 3A5ZB 4MZ9A 2PNHA 2AWNA 3S24A 4DV6Q 4B3SL 4UP8A 1PH3A 2LXJA 1FJGL 3STBC 5M5WH 1WOCA 2I5MX 3TREA 4BY1H 4A3JH 3PV0A 3HKSA 4LF8Q 4JI3L 4LFAL 3HOZH 4POFA 4DV1Q 3RLOA 3U4ZA 3FP9A 1BVSA 4OX9L 4JI1L 1EQRA 1E3PA 5M5YH 1EIFA 4GKKQ 1PVOA 1VQCA 3T1YQ 4LF6Q 4IPHA 4LNQA 4BA2I 4GLVB 2H5XA 1L1OA 4LW1A 4PG3A 3J81c 4BBSH 2VUMG 4MNOA 1H95A 4DV5L 2AKWB 2B3GA 1N32L 3EBEA 2PI2A 3TS2A 1EIYB 2ES2A 2VUMH 3I55A 1J5EQ 4BBSG 2I5LX 4JBJA 5ELOA 1VQNA 5J3BA 3K80C 3RLFA 4AYBE 4R4TA 3GTKH 1L1OC 3D0FA 4LF6L 4BXXG 4LF7Q 4YCVA 1Z47A 1KD1C 2ASBA 1A8VA 4A75A 3E9IA 4XTCS 3KF8B 4P71A 2JQOA 4HJAA 1TWHH 1I3QH 3W1BA 3WWVA 1S72A 2JA8H 2XTIA 3PIOA 2A1AA 4DV2L 2K5VA 4IPGA 5IP9H 2NN6G 1B7YB 4PZ8A 4JI7Q 3SGIA 2R92H 2N8NA 4A3DG 1I6HH 3D31A 3CCVA 4JV5Q 4NB3A 4A3KH 2JA8G 5DLQE 2NVXH 4A3LG 4GOPA 3AFQA 1PA6A 1PH2A 2KBNA 2VZAA 4PMWA 3CAMA 3KOJA 2UUAL 4DR4Q 5HY6A 1C0AA 4JI4Q 1WCMG 1ASZA 1VQLA 1A0IA 1Q8KA 2YU9H 2F3IA 4JOIC 3HOUG 4C3JH 1OXXK 3G48A 2KCMA 4JBKA 3TQYA 3CMEA 2WAQG 2R7ZH 4DAMA 3PUXA 1HR0L 4APVA 4UP7A 4JI4L 1K83H 4X62Q 1OXUA 1QZGA 3I4NH 1LYLA 4JYAQ 4K0KL 1UE1A 3RZDH 2Q2UA 3ZJYC 4LF9L 2XGTA 4GLXA 3J7A5 1HZBA 4JC0A 4X66L 2C35B 3KDFB 4EX5A 4IO9A 1YI2A 2KHIA 2ZJRA 1G6PA 3J80c 1HZAA 2AHOB 3CD6A 3A5UA 5K36G 2K50A 3GTMH 4GN4B 4P75A 1YJNA 1L1OB 1K0RA 1HNXQ 2N3SA 2RHQB 4A3JG 3RN2A 3RN5A 4A3EH 3JC66 1K8AC 2JA5H 1SROA 5GADC 2D62A 1PV4A 4BBRH 2ZTEA 4JI2Q 4LWCA 5GAEC 1SN8A 4GNXA 4KHPQ 4B3TQ 2GVAA 5C4XH 3CCEA 1HZCA 2RHSB 5IP7G 1Q81C 3CC4A 3CCQA 1WCMH 1HNZQ 5BR8L 1VQ7A 2NVTH 2Z6KC 3UE1A 3CMAA 2I0QA 2HHHL 1YJWA 3PCOB 4A3BH 1UE7A 1M1KC 2E2HH 1VQHA 1K9MC 2VNUD 5IYDG 3H3VH 1SR3A 3CQZH 3L0OA 1GM5A 1X9NA 1MIUA 1YZ6A 2E5LQ 3KJOA 4NXNQ 3GO5A 5M3FG 3KYHC 4DV3Q 4DR5Q 4X65Q 4GKJL 2NZOA 4LFAQ 1IBKQ 1UE6A 1VQJA 3OW2A 3F2DA 4JI3Q 4A3BG 3RLNA 1HZ9A 4L5TA 4GOPC 3PUWA 4FDBA 4JI5L 1OXVA 3F1ZA 1V1QA 4PZ7A 5FJ8H 2VQFL 3KFUA 2JA7G 1HNWQ 5M3MH 1X55A 1IBMQ 2OTJA 4WJ3M 1YHQA 1L0WA 4X65L 3HFZB 4A3MH 4OWWB 4K0KQ 4NXNL 1N36Q 4GKJQ 3K0XA 1Q1EA 2PMZE 2WB1G 3KLWA 4A76A 1XMQQ 1L2FA 2JJQA 1AH9A 2IX1A 1NMGA 3PUVA 5IE8A 2MNAA 4AIMA 3I4OA 4PZ6A 3HOZG 1Y1VH 3OYYA 2HIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO H;  1XJV A;  5C3E H;  2LXK A;  4QQB X;  2E8G A;  2CFM A;  1A63 A;  4JV5 L;  1SRU A;  2KEN A;  1U5K A;  2ZTD A;  3G4S A;  1NJI C;  1IBL L;  3TRZ A;  1PHJ A;  2BA1 A;  4BY1 G;  3CCR A;  2E2J H;  5ELN A;  5AJ3 Q;  4A3K G;  4L5R C;  2ATW A;  2BH2 A;  1FVI A;  3M3Y H;  1PH8 A;  1YEZ A;  1YIJ A;  3ICE A;  1KC8 C;  2QGQ A;  5IP9 G;  1PH1 A;  2AMC B;  1X3F A;  1IBL Q;  1EOV A;  1UE5 A;  1M90 C;  4BA1 I;  3GTP H;  4LF9 Q;  2UU9 Q;  1KIX A;  3HOU H;  5IYD H;  3CCJ A;  4GN5 A;  1N33 Q;  3U4V A;  2UXD L;  5GAG C;  5GAH C;  1RL2 A;  1Y14 B;  4QJF A;  4AYB G;  1OXS C;  3H0G H;  5C3E G;  5AJ3 L;  1W2B A;  5C0X I;  2OTL A;  3S14 H;  4DV0 Q;  1G29 1;  3M9B A;  1EYG A;  4UY8 C;  3PF4 A;  3NBH B;  5JEA J;  1XNR Q;  3PIP A;  1I50 H;  1YJ9 A;  3E0E A;  3GD7 A;  2FXQ A;  3M85 A;  2QEX A;  1PH6 A;  4ALP A;  1HNW L;  4YHH L;  1FGU A;  3I2Z A;  4A3M G;  2GVB A;  4KLK A;  1P16 A;  2OQK A;  3BZK A;  4O0A A;  2OCE A;  5IWA L;  1KRS A;  3DLL A;  3NEM A;  4IFD G;  1QUQ B;  2F52 A;  4JBW A;  2HQL A;  4O2D A;  4LUZ A;  1X54 A;  4R4C A;  3AEV A;  1Y1W G;  1HR0 W;  5LMN Q;  4DV7 Q;  3HOY H;  3CXC A;  1K73 C;  3S1M H;  4YHH Q;  1E1O A;  2WFW A;  3J81 i;  5FLM H;  3S2D H;  1WFQ A;  4EQ5 A;  4DV2 Q;  4GNX B;  1JMC A;  1JT8 A;  1E7Z A;  1YIT A;  2D0O A;  4JI8 L;  4YWK A;  3F2B A;  1VS0 A;  4HID A;  5BR8 Q;  1WYD A;  2CWP A;  1NMF A;  4DV0 L;  2D0P A;  2CKZ B;  4HJ5 A;  1CKM A;  1PH7 A;  2KCT A;  4OWT B;  4A3L H;  5IP7 H;  2CWA A;  1KXL A;  3M4P A;  4R4Q A;  2UU9 L;  4BBR G;  3CCL A;  1OXT A;  1WJJ A;  5IYC H;  4DUY Q;  4JI0 L;  2R7D A;  2ZJQ A;  2BH8 A;  3S17 H;  2YTX A;  3GDE A;  2VS1 A;  4DR3 Q;  2DUD A;  4OWX B;  5M5X H;  1MJE A;  1E24 A;  3HOY G;  3T1Y L;  4X6A H;  1FJG Q;  4C3H H;  5C44 G;  3A74 A;  3F2C A;  2R93 H;  2K14 A;  4DV4 L;  4JOI A;  4XIG S;  3RR5 A;  1XPR A;  3ERS X;  1AE2 A;  4OO1 I;  4A93 H;  1DGS A;  1LUZ A;  5IY0 A;  4A4I A;  5C0X J;  5GQO A;  2VW9 A;  1I94 Q;  1YHA A;  3S1N H;  3MEF A;  4UP9 A;  4GN3 B;  5GRO A;  2B63 H;  1JB7 A;  2GN5 A;  4IFD I;  4H02 A;  4NXM Q;  2Q2H A;  2OQ0 A;  2ZM6 Q;  2EXD A;  1QUQ A;  4JYA L;  1D7Q A;  1U0L A;  4YCU A;  4B3R L;  3CCU A;  1CKO A;  1B8A A;  4YWL A;  4MTN A;  2Q2T A;  4DUZ Q;  3HKZ E;  3STB D;  2OWO A;  4B3T L;  3OTO Q;  2IHE A;  1Q12 A;  3F8T A;  4GS3 A;  4UPA A;  2UUC Q;  2JEB I;  1PYB A;  4IPD A;  4IOC A;  2UUB L;  1VQG A;  4YY3 Q;  3G71 A;  4C2M H;  3Q8D A;  5HGQ A;  5IT9 c;  5IYB H;  4A3G H;  2Q2I A;  1C7Y A;  1V9P A;  2UXB L;  1HJP A;  4DR2 L;  1TWC H;  2JEA I;  3ULP A;  4BY7 G;  1R9T H;  4YY3 L;  3L2P A;  1Y1W H;  4JBM A;  1C9O A;  3HKZ G;  3OTO L;  3T1H L;  1EUJ A;  1J5E L;  3M4O H;  3PUY A;  1IL2 A;  4R4O A;  3HOW H;  4IJL A;  3TEH B;  1N32 Q;  4DV5 Q;  1NBW A;  4JI8 Q;  4B3R Q;  4NPS A;  4P74 A;  1KQS A;  4DK6 C;  2B63 G;  3MXN B;  3ULL A;  2EQS A;  4HJ8 A;  3FKI H;  4A3C G;  1X56 A;  4DPG A;  3TS0 A;  1Q82 C;  1CSP A;  2L15 A;  1I94 L;  4A93 G;  3H3V I;  2Z0S A;  2K52 A;  3J81 j;  1N36 L;  3I7F A;  4JI6 L;  1IYJ B;  3PO2 G;  1KRT A;  4AH6 A;  3PO3 H;  2ZTC A;  2E5L L;  4DR6 Q;  1O7I A;  3U58 A;  2K4K A;  4TVA B;  2VQF Q;  5LMN L;  4DV7 L;  1B70 B;  4DR6 L;  2YV5 A;  4OX9 Q;  4KI0 A;  4IFD J;  2MFI A;  1PH9 A;  1VQF A;  1QVF A;  1K8G A;  1VQA A;  5E7N A;  3H15 A;  1XTD A;  5IWA Q;  3A0J A;  1E1T A;  2Z6K A;  2JA6 H;  2RF4 A;  1VQD A;  3NEL A;  4QY7 A;  1UEB A;  4KHP L;  3ER0 A;  2A19 A;  1I5F A;  3W5O A;  1PH4 A;  1GD7 A;  1PYS B;  5FLX c;  2IHF A;  1Y1V G;  3NEN A;  1ASY A;  3S1R H;  1XNR L;  2HHH Q;  5C4J H;  2Y0S E;  4WJ4 A;  2NZH A;  1HH2 P;  1IXR A;  3W1G A;  4DAY B;  3CF5 A;  4DKA C;  1HNX L;  1SMX A;  4POG A;  5FLM G;  1XNQ Q;  1TXY A;  1VQI A;  3CP0 A;  2JA5 G;  1Q1B A;  3CCS A;  2HT1 A;  4A3E G;  2MO1 A;  2YTV A;  3BZC A;  2CQO A;  1VQ8 A;  4B3M L;  1S40 A;  1EQQ A;  3M4Q A;  3PO3 G;  4LF4 Q;  4JI1 Q;  4A3I G;  5FJ8 G;  3GTQ H;  3ULJ A;  3KF6 B;  4B3M Q;  1JJ2 A;  2JE6 I;  4AQY Q;  1EWI A;  4DK3 C;  3U50 C;  1CSQ A;  3VDY A;  4JCV E;  2DGY A;  3FKI G;  2I5H A;  4DV6 L;  5M3F H;  2KHJ A;  2K5N A;  2NVY H;  5IYC G;  1MKH A;  2IX0 A;  2YYZ A;  3CPW A;  1N8R C;  1FL0 A;  2R7Z G;  3S1Q H;  2ZM6 L;  5JJL A;  3KF6 A;  4NXM L;  3PUZ A;  3HOW G;  1MJC A;  1IBM L;  3I56 A;  1HR0 Q;  1VQ6 A;  2A8V A;  1TWG H;  3GTO H;  1CKN A;  1TWA H;  1QZH A;  1N34 L;  1V43 A;  4GKK L;  3HOV H;  4LFB L;  2B29 A;  2VY3 A;  4JI5 Q;  4RMF A;  3L7Z C;  2JA6 G;  3M7N A;  4BY7 H;  2JK8 A;  4HIM A;  1Q86 C;  4A3F H;  2YTY A;  5C4X G;  2BA0 A;  1IBK L;  4J15 A;  1N33 L;  1VQK A;  2UXD Q;  4DR5 L;  3S15 H;  1GKH A;  4P73 A;  4OXP A;  2F4V Q;  3UE0 A;  2R92 G;  1KL9 A;  2WP8 J;  2NVQ H;  1KHI A;  2Y0S G;  3E9H A;  3BU2 A;  1W3S A;  2WAQ E;  3CPF A;  4HIO A;  4HJ7 A;  3UDG A;  1XPO A;  1KAW A;  2QA4 A;  4DR1 Q;  1VQ9 A;  1BBW A;  4DR3 L;  4P72 A;  4LF5 Q;  1GVP A;  4AQY L;  2VL6 A;  1T9H A;  5H1S E;  4RG1 A;  3K8A A;  3HOV G;  4GOP B;  3PO2 H;  4DV3 L;  3S16 H;  4BXX H;  4IOA A;  4X64 L;  4R4I A;  4IJH A;  3I4M H;  4LF7 L;  3UDF A;  3AFP A;  1PFS A;  3GTJ H;  4JG2 A;  1TWF H;  2VQE Q;  2PQA A;  4L5Q A;  4Y7N H;  3AYH B;  1JJG A;  4JI2 L;  1D8L A;  1VQM A;  4A3C H;  2R6G A;  1X3E A;  1BBU A;  2ALY B;  2UXC L;  2K75 A;  3BJU A;  1CUK A;  1J6Q A;  1HNZ L;  3LGJ A;  2JA7 H;  2ZJP A;  3T1H Q;  4R1J A;  5C0X G;  3I4M G;  5C44 H;  2VQE L;  3GTG H;  3PGZ A;  1JJC B;  2IY5 B;  3RNU A;  1EFW A;  4QL5 A;  4DR2 Q;  3JAM i;  2MO0 A;  2RCN A;  1CKN B;  1VQE A;  5EAY A;  3KJP A;  1NY4 A;  4LFC Q;  4DV1 L;  4DR7 L;  1A62 A;  1E22 A;  1JE5 A;  1GO3 E;  4LUO A;  2JA9 A;  4A3D H;  1NTG A;  1IZ6 A;  2WB1 E;  5IYB G;  4OON A;  1YBY A;  4X62 L;  4LFC L;  4DR1 L;  4A3G G;  4B3S Q;  3K81 C;  1BKB A;  1AE3 A;  3UDI A;  4A3F G;  4LFB Q;  1LM0 A;  4YCW A;  3CC7 A;  3CC2 A;  4L5S A;  1Q7Y C;  2F4V L;  3FHW A;  2HIX A;  4JI6 Q;  1S3O A;  4HJ9 A;  2N78 A;  1PH5 A;  2UUA Q;  4DR4 L;  5JJI A;  1VQO A;  2ID0 A;  1XPU A;  3GTL H;  1VQ5 A;  3CCM A;  1VQB A;  1XMO Q;  3KDF A;  1Z9F A;  2CCZ A;  5LMN W;  3PF5 A;  3HOX G;  1UWV A;  3EN2 A;  4JI7 L;  1NE3 A;  1OTC A;  4YWM A;  1LTL A;  1SE8 A;  3K7A H;  3CW2 C;  1YHB A;  2MQH A;  3UDX A;  2N49 A;  5M3M G;  2UXB Q;  4LF4 L;  1VQ4 A;  4QIW E;  4X64 Q;  5LMU Q;  3PSI A;  4QGU A;  4A3I H;  2R93 G;  1X3G A;  3K7U C;  2PQA B;  1Q46 A;  1G51 A;  4GLA C;  2EIF A;  4LF5 L;  3B6Y A;  3J7Z C;  1X65 A;  1SLJ A;  5LMU L;  4DUY L;  4JI0 Q;  4HIK A;  4X66 Q;  2R7F A;  3AQQ A;  4DNI A;  2IT1 A;  3DM3 A;  3IRB A;  1VCI A;  2UXC Q;  3I4N G;  3HOX H;  4Y52 H;  2UUB Q;  4GNX C;  2UUC L;  1P8L A;  2V1C C;  4KHZ A;  4ME3 A;  1QVG A;  2E2I H;  2LSS A;  2PI2 E;  4DUZ L;  3G6E A;  2AWO A;  1N9W A;  5JJK A;  2NN6 I;  4IPC A;  5JEA G;  1N34 Q;  1XNQ L;  4TQU S;  3H0G G;  1RIP A;  1X6O A;  1YNX A;  1XMO L;  3JAM c;  4LUV A;  1XMQ L;  3S2H H;  4OO1 G;  3J80 i;  2K5H A;  1QVC A;  1WI5 A;  4C3I H;  4DR7 Q;  1YVC A;  3EIV A;  1K3R A;  3RZO H;  4DV4 Q;  4LF8 L;  1VQP A;  3A5Z B;  4MZ9 A;  2PNH A;  2AWN A;  3S24 A;  4DV6 Q;  4B3S L;  4UP8 A;  1PH3 A;  2LXJ A;  1FJG L;  3STB C;  5M5W H;  1WOC A;  2I5M X;  3TRE A;  4BY1 H;  4A3J H;  3PV0 A;  3HKS A;  4LF8 Q;  4JI3 L;  4LFA L;  3HOZ H;  4POF A;  4DV1 Q;  3RLO A;  3U4Z A;  3FP9 A;  1BVS A;  4OX9 L;  4JI1 L;  1EQR A;  1E3P A;  5M5Y H;  1EIF A;  4GKK Q;  1PVO A;  1VQC A;  3T1Y Q;  4LF6 Q;  4IPH A;  4LNQ A;  4BA2 I;  4GLV B;  2H5X A;  1L1O A;  4LW1 A;  4PG3 A;  3J81 c;  4BBS H;  2VUM G;  4MNO A;  1H95 A;  4DV5 L;  2AKW B;  2B3G A;  1N32 L;  3EBE A;  2PI2 A;  3TS2 A;  1EIY B;  2ES2 A;  2VUM H;  3I55 A;  1J5E Q;  4BBS G;  2I5L X;  4JBJ A;  5ELO A;  1VQN A;  5J3B A;  3K80 C;  3RLF A;  4AYB E;  4R4T A;  3GTK H;  1L1O C;  3D0F A;  4LF6 L;  4BXX G;  4LF7 Q;  4YCV A;  1Z47 A;  1KD1 C;  2ASB A;  1A8V A;  4A75 A;  3E9I A;  4XTC S;  3KF8 B;  4P71 A;  2JQO A;  4HJA A;  1TWH H;  1I3Q H;  3W1B A;  3WWV A;  1S72 A;  2JA8 H;  2XTI A;  3PIO A;  2A1A A;  4DV2 L;  2K5V A;  4IPG A;  5IP9 H;  2NN6 G;  1B7Y B;  4PZ8 A;  4JI7 Q;  3SGI A;  2R92 H;  2N8N A;  4A3D G;  1I6H H;  3D31 A;  3CCV A;  4JV5 Q;  4NB3 A;  4A3K H;  2JA8 G;  5DLQ E;  2NVX H;  4A3L G;  4GOP A;  3AFQ A;  1PA6 A;  1PH2 A;  2KBN A;  2VZA A;  4PMW A;  3CAM A;  3KOJ A;  2UUA L;  4DR4 Q;  5HY6 A;  1C0A A;  4JI4 Q;  1WCM G;  1ASZ A;  1VQL A;  1A0I A;  1Q8K A;  2YU9 H;  2F3I A;  4JOI C;  3HOU G;  4C3J H;  1OXX K;  3G48 A;  2KCM A;  4JBK A;  3TQY A;  3CME A;  2WAQ G;  2R7Z H;  4DAM A;  3PUX A;  1HR0 L;  4APV A;  4UP7 A;  4JI4 L;  1K83 H;  4X62 Q;  1OXU A;  1QZG A;  3I4N H;  1LYL A;  4JYA Q;  4K0K L;  1UE1 A;  3RZD H;  2Q2U A;  3ZJY C;  4LF9 L;  2XGT A;  4GLX A;  3J7A 5;  1HZB A;  4JC0 A;  4X66 L;  2C35 B;  3KDF B;  4EX5 A;  4IO9 A;  1YI2 A;  2KHI A;  2ZJR A;  1G6P A;  3J80 c;  1HZA A;  2AHO B;  3CD6 A;  3A5U A;  5K36 G;  2K50 A;  3GTM H;  4GN4 B;  4P75 A;  1YJN A;  1L1O B;  1K0R A;  1HNX Q;  2N3S A;  2RHQ B;  4A3J G;  3RN2 A;  3RN5 A;  4A3E H;  3JC6 6;  1K8A C;  2JA5 H;  1SRO A;  5GAD C;  2D62 A;  1PV4 A;  4BBR H;  2ZTE A;  4JI2 Q;  4LWC A;  5GAE C;  1SN8 A;  4GNX A;  4KHP Q;  4B3T Q;  2GVA A;  5C4X H;  3CCE A;  1HZC A;  2RHS B;  5IP7 G;  1Q81 C;  3CC4 A;  3CCQ A;  1WCM H;  1HNZ Q;  5BR8 L;  1VQ7 A;  2NVT H;  2Z6K C;  3UE1 A;  3CMA A;  2I0Q A;  2HHH L;  1YJW A;  3PCO B;  4A3B H;  1UE7 A;  1M1K C;  2E2H H;  1VQH A;  1K9M C;  2VNU D;  5IYD G;  3H3V H;  1SR3 A;  3CQZ H;  3L0O A;  1GM5 A;  1X9N A;  1MIU A;  1YZ6 A;  2E5L Q;  3KJO A;  4NXN Q;  3GO5 A;  5M3F G;  3KYH C;  4DV3 Q;  4DR5 Q;  4X65 Q;  4GKJ L;  2NZO A;  4LFA Q;  1IBK Q;  1UE6 A;  1VQJ A;  3OW2 A;  3F2D A;  4JI3 Q;  4A3B G;  3RLN A;  1HZ9 A;  4L5T A;  4GOP C;  3PUW A;  4FDB A;  4JI5 L;  1OXV A;  3F1Z A;  1V1Q A;  4PZ7 A;  5FJ8 H;  2VQF L;  3KFU A;  2JA7 G;  1HNW Q;  5M3M H;  1X55 A;  1IBM Q;  2OTJ A;  4WJ3 M;  1YHQ A;  1L0W A;  4X65 L;  3HFZ B;  4A3M H;  4OWW B;  4K0K Q;  4NXN L;  1N36 Q;  4GKJ Q;  3K0X A;  1Q1E A;  2PMZ E;  2WB1 G;  3KLW A;  4A76 A;  1XMQ Q;  1L2F A;  2JJQ A;  1AH9 A;  2IX1 A;  1NMG A;  3PUV A;  5IE8 A;  2MNA A;  4AIM A;  3I4O A;  4PZ6 A;  3HOZ G;  1Y1V H;  3OYY A;  2HIV A; 
#chains in the Genus database with same CATH topology
 2EY1 A;  5A35 A;  1WVL A;  1SFO H;  1XJV A;  5C3E H;  1XTC D;  1SYG A;  5KG7 A;  2E8G A;  2KVM A;  4JV5 L;  2KEN A;  1U5K A;  2WAC A;  5ELB A;  4L5R C;  5ELN A;  1PRT D;  1KNE A;  1HCZ A;  3OSN A;  2QGQ A;  3PO3 B;  3MR5 A;  5E4W C;  1TWC B;  1X3F A;  3VR5 A;  5JAV A;  2KEC A;  3HOU H;  1K3B C;  2HVS A;  3RUP A;  5KFP A;  5DG7 A;  1N33 Q;  3GQC A;  4A3K B;  2XGP A;  4LJZ C;  2IP4 A;  3MXP A;  4ZYS A;  1Y14 B;  4FYD A;  4MV9 A;  3C1F A;  1W2B A;  5AJ3 L;  4FNF A;  4EEY A;  1NSN S;  1D6E C;  3S14 H;  1G29 1;  3L3O C;  4CHT B;  5M5Y B;  3KHH A;  3PF4 A;  2N55 A;  3NBH B;  1TKW B;  2KSW A;  2DLN A;  4FF1 A;  3E0E A;  3QB3 A;  2W9C B;  1R4Q B;  2FXQ A;  3KHG A;  1YNJ C;  1EYD A;  4FBT A;  4YHH L;  2OQK A;  2Q8I B;  5IOC A;  2OCE A;  2I80 A;  1KRS A;  4O2B F;  1HNX H;  2BCO A;  2IMW P;  1IBM H;  3GP7 A;  3JSN A;  1NNX A;  2F52 A;  3R5H A;  3NQT A;  3F2U A;  1ESR A;  2RGV A;  4LUZ A;  4A3G B;  5KT2 A;  4RHS A;  3L4J A;  3BZD B;  3WOE A;  3KXY T;  5E3F A;  4I65 A;  2F0O A;  2IX3 A;  1HR0 W;  3BQ1 A;  4EYI B;  3U9S A;  1WFQ A;  2UUC H;  2EYO A;  1RTN A;  3A7A B;  3ERO A;  4C3J G;  4ZOL F;  4MA0 A;  1JQY D;  2L0C A;  2NVY B;  1NMF A;  2CVR A;  2R6F A;  2CKZ B;  1Y1W A;  5KFM A;  4OWT B;  1PMR A;  4QW9 A;  2XD4 A;  4CJ0 B;  2C2R A;  2CWA A;  3MWY W;  1JIH A;  5I9O A;  1KXL A;  4QCL A;  1SAP A;  5TSS A;  5I2X A;  4E4T A;  2CZG A;  1WJJ A;  4LFB H;  4JI0 L;  5FD5 A;  2B2T C;  1LTG D;  5BMV F;  1SFO A;  3EA6 A;  2F0N A;  1X3Q A;  1ZKO A;  5M5X H;  3HOY G;  4HQ6 A;  2B8F A;  5DG8 A;  3RR5 A;  4DK1 A;  2ZT9 C;  2EYP A;  4A93 H;  4RUA A;  5IY0 A;  5KT7 A;  4ECX A;  1QNK A;  1RHP A;  5C0X J;  2XC9 A;  4NDX A;  3GTP A;  4J6H A;  1BXT A;  3S1N H;  3Q8S B;  2W6N A;  1WTQ A;  4GN3 B;  1CQV A;  1A3V A;  3QWN A;  1CFM A;  1IW7 C;  2Q2H A;  2ZM6 Q;  5C5J A;  1QUQ A;  4EQN A;  4K5V A;  5T1I A;  2F0S A;  5EPK A;  1FGB D;  2NUC A;  4MTN A;  2R61 A;  3OTO Q;  2FKL A;  1S10 A;  2UUC Q;  4RB3 C;  2JEB I;  1PYB A;  2PO4 A;  4IPD A;  3S9W A;  3G71 A;  3Q8D A;  3N40 P;  4EBC A;  1PTO F;  1DZ1 A;  2Q2I A;  1C7Y A;  5KFN A;  5KT6 A;  4DR2 L;  1X32 A;  4HCS A;  1R9T H;  1J9O A;  2PMZ A;  4YY3 L;  5M3M B;  3C2P A;  2YW2 A;  5G3L D;  5BN4 A;  1EHI A;  3PUY A;  1IL2 A;  4LSA A;  1S5E D;  3M9N B;  4DR1 H;  5CV5 A;  3TEH B;  1A2T A;  3CVZ A;  1ULZ A;  4NPS A;  2R87 A;  4DF7 A;  4IUN A;  1Y1V B;  5C3W A;  3MXN B;  3ULL A;  4A3C G;  4G7Z C;  1N56 A;  3MTS A;  1Z2O X;  2MPM A;  1CI3 M;  5CV9 A;  4LMY A;  5EQ0 A;  4A93 G;  5DNF A;  1EYC A;  3H3V I;  4RHR A;  2W9B A;  1BUV T;  1B9M A;  1HUM A;  4DR6 Q;  2E5L L;  1O7I A;  4ILW A;  3U58 A;  2K4K A;  4TVA B;  1Y1W B;  4DR4 H;  2RA4 A;  1B70 B;  3RAQ A;  2VXW A;  4I55 F;  4TQS A;  1L2Z A;  4I50 F;  3QR8 A;  1JX4 A;  1BCP C;  1PH9 A;  1VQF A;  2W7P A;  1CS0 A;  2AGP A;  4RAZ A;  4IQZ A;  2AU0 A;  1E1T A;  4R7R A;  2JA6 H;  3C0F B;  3BVM A;  1F2L A;  4ECY A;  3H0G B;  5ELC A;  1IOV A;  1BJT A;  1S68 A;  5D3D A;  4J9Q A;  1H9J A;  1EIH A;  1I5F A;  1PH4 A;  2RDJ A;  1ET9 A;  5FLX c;  1ASY A;  1M0W A;  4QW8 A;  3S1Q B;  2KQ3 A;  1F9Q A;  2Y0S E;  2NZH A;  3W1G A;  1EUD B;  1HNX L;  1SMX A;  4POG A;  2EYL A;  2HT1 A;  3CCS A;  1WD1 A;  1TWA B;  1RD9 D;  2YTV A;  3BZC A;  3GIK A;  2NUA B;  1B3A A;  1IL8 A;  3GV7 B;  1XNR H;  1HPC A;  2VUM A;  1GHJ A;  3NBH A;  2W57 A;  1RJR A;  2DJF C;  4JI1 Q;  4A3I G;  4ZCK A;  3KF6 B;  1C8C A;  1JJ2 A;  4B3M Q;  2JYO A;  1GUO A;  2NTS A;  2NBF A;  3U50 C;  3T5K A;  4NXN H;  1KJ8 A;  3FKI G;  1QCB D;  2J6S A;  5T14 A;  2KHJ A;  5IYC G;  3W3A A;  2R7Z G;  3HOX B;  3S1Q H;  2ZM6 L;  2VQF H;  1Q8I A;  3KF6 A;  3WDN A;  3KHR A;  1M8A A;  3PUZ A;  5CV7 A;  1BF4 A;  4ED7 A;  4DL4 A;  3PVX A;  3I56 A;  1ONL A;  3R23 A;  4F7X A;  2KJX A;  4LFB L;  1N34 L;  1GSA A;  2Z1C A;  2JA6 G;  1TT2 A;  3LWU A;  5C4X G;  4DR5 L;  4OXP A;  1SYF A;  2WP8 J;  4QWD A;  1KHI A;  4KY7 A;  3MR3 A;  3CPF A;  2WAQ E;  3A8J E;  4PMC A;  1VQ9 A;  1KAW A;  4A2A A;  5KFO A;  4Q45 A;  1T9H A;  2A5H A;  2HCI A;  2FLL A;  2P5Z X;  3DWQ A;  3SEB A;  2C2D A;  4IOA A;  4I7Z C;  5FOB B;  5C0X H;  3I4M H;  2JA5 A;  4LF7 L;  3RGZ A;  4K8I A;  1F9P A;  2F0E A;  3IAY A;  4O2A F;  5KYL A;  4RCO A;  3AYH B;  4X3U A;  1JJG A;  4YR2 A;  1VQM A;  2OXP A;  4A3C H;  4KY5 A;  2OT2 A;  2R8K A;  4IUR A;  1G2T A;  2UXC L;  1I7L A;  1A3U A;  2SOB A;  3LGJ A;  2FFK B;  2W9B B;  4KHV A;  4XYO A;  5LP6 F;  1EY9 A;  2IY5 B;  1AUX A;  1EFW A;  2R8G A;  4K5W A;  1CKN B;  5EAY A;  3KJP A;  2WAQ A;  4MV7 A;  3BDO A;  1LT4 D;  4ZKC B;  4TV8 F;  4LUO A;  2K01 A;  4QWB A;  2NN6 H;  4DR1 L;  4LFC L;  4JVZ A;  2NVT B;  4LFB Q;  4C3I G;  1GUS A;  1E0B A;  3JAM E;  4L5S A;  2YRX A;  1Q7Y C;  3RB6 A;  4J0M A;  3HB9 A;  3RB4 A;  4JI6 Q;  3I70 A;  3X3N A;  1PH5 A;  2N78 A;  4RAY A;  2RSO A;  4JV0 A;  1VQ5 A;  2IJ0 A;  3BDL A;  1JXL A;  2ALZ A;  1XMO Q;  2NTT A;  1VMC A;  3QIA A;  3HOX G;  1NE3 A;  1OTC A;  1LTL A;  1ROD A;  1AEX A;  1SYB A;  2A73 B;  2B2U A;  3UDX A;  5LL6 b;  4QIW E;  3K7U C;  3TIN A;  3CRK C;  4G4K A;  1K8M A;  1SNO A;  4KK7 A;  3PQI A;  1B04 A;  4LF5 L;  3GTO A;  3KBX A;  3J7Z C;  4NXM H;  5LMU L;  3N6R A;  5EWE A;  4X66 Q;  3NE5 B;  2IT1 A;  4CKB A;  3I4N G;  4ECS A;  4MV8 A;  3FDT A;  2Y0S A;  2V1C C;  3P7J A;  1PZJ D;  1QVG A;  4AQY H;  4ED8 A;  4XXE A;  5KFI A;  1CHQ D;  3IKJ A;  1B53 A;  1L0Y B;  1N9W A;  4HMI A;  1MD2 D;  2NN6 I;  5JEA G;  1N34 Q;  4EEQ A;  3D4W A;  4HYK A;  4TQU S;  2FPG B;  1XMQ L;  3JAM c;  1S0M A;  1VF5 C;  2C28 A;  3P1H A;  4DU9 A;  5ISR A;  4DR7 Q;  4AYB A;  5C8Y F;  2DNE A;  4DV4 Q;  2XCA A;  3DUZ A;  3A5Z B;  2PNH A;  2AWN A;  4RB0 A;  4B3S L;  5EBD A;  4K0K H;  4C5B A;  1FJG L;  2QDL A;  4LF8 Q;  2I5M X;  4BY1 H;  4A3J H;  3GIM A;  5KND A;  5KFZ A;  3RLO A;  1BVS A;  4JI1 L;  3KAL A;  4GKK Q;  2K03 A;  4U7C A;  1VQC A;  4BA2 I;  3KTM A;  3CKI B;  4PG3 A;  4F4W A;  1H95 A;  4UCT A;  5F9N A;  1DV2 A;  1PZK D;  3J80 W;  1CTM A;  2PI2 A;  2RDG A;  1EIY B;  4TUY F;  2VUM H;  3I55 A;  1I4R A;  4BBS G;  2FPP B;  1BGW A;  3J81 E;  3Q22 A;  2VB3 X;  1WTW A;  2QW7 A;  3K80 C;  4H44 C;  2GA4 B;  2OF1 A;  4LF6 L;  4F8M A;  3VPD A;  4XT3 B;  2AQ1 B;  2EDG A;  1E4G T;  3PW2 A;  3E9I A;  1STG A;  3KF8 B;  4HR7 A;  4RGN A;  3W1B A;  2RGR A;  3K5M A;  4CDE C;  2F3V A;  2XTI A;  4DXG A;  5J22 A;  4HNU A;  5I9P A;  2W9C A;  2K5V A;  2R92 H;  1RJT A;  4PZ8 A;  3SGI A;  4Q43 A;  3U9O A;  3J7A V;  2KA7 A;  2JA8 G;  3HZX A;  3S1M B;  1DJR D;  4A3L G;  1S5C D;  1SE3 A;  3AFQ A;  4GOP A;  4APM A;  1TS2 A;  3CAM A;  5KT3 A;  5HY6 A;  3T1H H;  1WCM G;  4FM9 A;  1L0X B;  2JEG A;  1TWF B;  4LFA H;  4JBK A;  2HQE A;  1H9R A;  3AB9 A;  1A15 A;  2F0H A;  3CME A;  4CKC A;  4DAM A;  3ND9 A;  2ZDQ A;  3K57 A;  4APV A;  4XQQ A;  1QZG A;  1CK1 A;  4JYA Q;  1STH A;  4WOR A;  2PN1 A;  3J7A 5;  2WB1 A;  4JC0 A;  4X66 L;  3KDF B;  4EX5 A;  1JIC A;  1YI2 A;  3PR5 B;  1N32 H;  2ZJR A;  2PNR C;  2XRQ D;  4ZRZ A;  3J80 c;  1HZA A;  4J8Q A;  2CW0 C;  5K36 G;  1WH2 A;  3V4Z A;  1SYE A;  4A3B H;  4P75 A;  1M6V A;  1K0R A;  1JR0 D;  1VAJ A;  4LH7 A;  3RN2 A;  1DOM A;  4A3E H;  3S2D B;  1K8A C;  1QOH A;  1D5Z C;  3GID A;  4HMJ A;  1J5E H;  3VR6 A;  5GAD C;  2E2I B;  4BBR H;  4IWX A;  4NP5 A;  1B33 N;  3NP8 A;  3BJY A;  4FXG C;  4ZAI A;  4F87 A;  1HZC A;  2NVT H;  1WCM H;  1ZXT A;  1SYX B;  1X3P A;  4OEM B;  3RV4 A;  1YJW A;  1LAC A;  3PCO B;  4QIW B;  5KIX A;  1JOQ A;  1M1K C;  4LMQ D;  3MWE A;  4C2M A;  1Z7T A;  1SR3 A;  1VDZ A;  5KFB A;  1LT6 D;  1EY0 A;  4GKJ L;  4BS9 A;  4DR5 Q;  3H4B A;  5IIF A;  4ED1 A;  5I47 A;  3BG3 A;  1S97 A;  3NTI A;  3E3X A;  1Z2P X;  3I4L A;  3RLN A;  4FDB A;  2XIG A;  4EGJ A;  1V1Q A;  4PZ7 A;  5FJ8 H;  4Q8E A;  1DM0 B;  2JA6 A;  1HNW Q;  5CA0 F;  1X55 A;  2RDI A;  2WII B;  1YHQ A;  4OWW B;  1RJP A;  3V6H A;  1N36 Q;  1K1S A;  1Q1E A;  2PMZ E;  4A76 A;  2JJQ A;  2WIN B;  3VR3 A;  1E2Z A;  5D3I B;  1DXM A;  3RD4 A;  1Y1V H;  3OYY A;  4J9P A;  4JV2 A;  2I8C A;  4EFB A;  1CM9 A;  4PQX A;  4QUF A;  2LXK A;  4QQB X;  2CFM A;  4MN3 A;  1SRU A;  2ZTD A;  4A3J B;  4BY1 G;  4A3K G;  1FVI A;  2XIW A;  3MHB A;  1YEZ A;  4BWG B;  1YIJ A;  1KC8 C;  3MR6 A;  5CGK A;  1IBL Q;  1SJE D;  2WV6 D;  4BA1 I;  2ATL A;  2UU9 Q;  5ELD A;  5HBR B;  3CCJ A;  4NLG A;  5GAG C;  4BY1 B;  1RL2 A;  2IBK A;  2ICI A;  1YNN C;  5DGB A;  3V05 A;  4EGQ A;  2OTL A;  1B9N A;  4DV0 Q;  3M9B A;  2EJG C;  1RTO A;  2WKC A;  2DY7 A;  1SXT A;  3TDQ A;  4UY8 C;  3Q1K A;  5KX5 F;  2R8J A;  2WAQ B;  5JEA J;  5KG5 A;  1TWG B;  1OO9 B;  1N48 A;  3MZ5 A;  1SND A;  3PMF A;  5FLX E;  1SE4 A;  3M85 A;  2DY8 A;  2A68 C;  1GJX A;  3OUZ A;  3DLL A;  3BZK A;  3HS0 C;  2D2C C;  2K7V A;  1V51 A;  4IFD G;  4C2M B;  1U9R A;  4O2D A;  1BQQ T;  2PYK A;  2OEO A;  4R4C A;  3X3M A;  3VYU A;  1R4P B;  4QIW A;  1Y1W G;  2R7N A;  4DV7 Q;  3NPP A;  4N8F A;  2FIN B;  1VMP A;  3S1M H;  3HOZ B;  1PK8 A;  2F0Q A;  1B44 D;  1F2Y A;  3NXW A;  5DAU A;  3W2D A;  4EQ5 A;  4EBE A;  3GTJ A;  4KD4 A;  1WTO A;  3G6V A;  5IT9 L;  1I4X A;  4BBR B;  3SDZ A;  1PXU A;  1O7Z A;  5E1F A;  4CGY B;  1VS0 A;  4HNV A;  2VA3 A;  2W6P A;  1WYD A;  5LMN H;  4HJ5 A;  4OO1 H;  2BDN A;  3VYR A;  1BCP B;  2C22 A;  3Q8Q B;  3GTK A;  1IBL H;  3M4P A;  5CAE B;  2UU9 L;  4HAE A;  4BBR G;  3CCL A;  5CA1 F;  4CJ1 B;  4HCE A;  1DYQ A;  2VQE H;  2ZJQ A;  4EFE A;  2YTX A;  3GDE A;  2VS1 A;  4DR3 Q;  5L1L A;  1KLU D;  5IGE A;  4N9T A;  1JWU D;  1FJG Q;  5KFR A;  3F2C A;  3A74 A;  1TWF A;  4MV4 A;  4XIG S;  1XPR A;  4FP5 D;  2P0A A;  2X0S A;  1LUZ A;  3TME A;  3DM1 A;  4A4I A;  5C4X B;  1RK5 A;  2VW9 A;  4DUY H;  4UP9 A;  4H0L C;  4OIK A;  1JB7 A;  2GN5 A;  3P20 A;  4H02 A;  3RTX A;  4NXM Q;  1TA8 A;  4TQR A;  2NU7 B;  3MC0 B;  1II3 A;  1BNZ A;  5JPM C;  4HR7 B;  4MAM A;  2SNS A;  5LOV F;  4PNY A;  5G3L F;  3BAB A;  3TP6 A;  4RKL A;  4B3T L;  4GS3 A;  1HNZ H;  4UPA A;  4IOC A;  4YY3 Q;  2E2H A;  5IT9 c;  2L12 A;  1Y8O B;  5IYB H;  4JI2 H;  1H9K A;  1WTR A;  3MR2 A;  3T5H A;  1TWC H;  2JEA I;  1PX2 A;  4KN7 C;  2CH4 W;  4F88 A;  3L2P A;  1Y1W H;  3OTO L;  1VBG A;  2FLN A;  1EUJ A;  1J5E L;  2ENB A;  2I46 A;  1V8Q A;  4XYM B;  1Y8P B;  4IJL A;  2O4X A;  4B3R Q;  1JOK A;  3VYS A;  4XT1 B;  2R93 A;  2BOS A;  3NWT A;  2B63 G;  1PZI D;  3M4I A;  1F9S A;  3FKI H;  5M9O A;  2WE6 A;  1X56 A;  2WB1 B;  5KG2 A;  1Q82 C;  4X66 H;  5HGT A;  2O03 A;  4JK1 C;  3FDS A;  4ZUJ A;  3HKZ A;  4YAK B;  2K52 A;  1N36 L;  4JI6 L;  1NCV A;  3KLS A;  3SK6 A;  1WCM A;  4IAJ A;  1HR0 H;  4AH6 A;  5KFL A;  2QK4 A;  2F0K A;  3QFF A;  1KC7 A;  1EUC B;  2AGO A;  4OX9 Q;  2Z4H A;  2C9O A;  4IRD A;  2VB2 X;  1MZB A;  1QVF A;  2Z4I A;  5EKL A;  5KFY A;  3H15 A;  1WTP A;  5IWA Q;  2Z6K A;  1EQV A;  2RF4 A;  3RIZ A;  1VQD A;  3NEL A;  1TQO A;  3D8G A;  5EPL A;  3J81 W;  3ER0 A;  2A19 A;  5K2M A;  1MSG A;  3W5O A;  1TWH A;  1LV9 A;  1PYS B;  1Y1V G;  1K0S A;  1O80 A;  2FMM A;  5C1P A;  4J9S A;  5JVD F;  4WJ4 A;  5F2D A;  1IXR A;  1XNQ Q;  2B2U C;  4DKA C;  5FLM G;  2CW7 A;  2JA5 G;  3CP0 A;  4CC5 A;  2F0D A;  4JW0 A;  3GIQ A;  2CQO A;  1TY0 A;  3ERQ A;  4DGZ A;  4B3M L;  3VPC A;  2RDF A;  5J2U F;  5KFH A;  3RAX A;  5KGU A;  5FJ8 G;  5KFQ A;  4AQY Q;  3D6C A;  1SSO A;  4DK3 C;  2J6U A;  3TBI B;  4MHE A;  2K5D A;  3VA7 A;  1CSQ A;  3VDY A;  3EYY A;  4RA8 A;  3PIP 3;  2DIK A;  1SDF A;  4CKE A;  4OX9 H;  2YYZ A;  5JJL A;  3SR1 A;  1NUC A;  1KJI A;  1MJC A;  4RZR A;  2A8V A;  5CR3 A;  3V2T A;  1A2U A;  3GTO H;  1CKN A;  4UDU C;  1TY2 A;  1WSC A;  2HD3 A;  3HOV H;  4Z9C B;  2VY3 A;  3WOF A;  4C3I B;  4JI5 Q;  3AMU A;  4RMF A;  5COR A;  3LX0 A;  3M7N A;  5BPF A;  3GTG A;  2JK8 A;  3FKI A;  4J9L A;  4HIM A;  3A55 A;  1A3T A;  2WTF A;  2YTY A;  1V1P B;  4DL5 A;  2F4V Q;  1Q3L A;  1XMO H;  1XMQ H;  1RJQ A;  3A54 A;  3Q23 A;  1XNQ H;  2K28 A;  4G3I A;  1E4E A;  1W3S A;  4HJ7 A;  5M5X B;  3UDG A;  5EBC A;  2QA4 A;  2UVW A;  2BE5 C;  1BBW A;  4DR3 L;  2QCP X;  4P72 A;  3V6K A;  1SYD A;  3QZ8 A;  2VL6 A;  5JOB A;  3C3L A;  3HOV G;  3K8A A;  4ZLT F;  3HOY B;  4H13 C;  3PO2 H;  2RBM A;  3S16 H;  4BXX H;  2VUG A;  2EPB A;  3H6M A;  4X3K A;  4RGM A;  1G2S A;  4C56 C;  3MJF A;  1EY7 A;  5LMU H;  4L5Q A;  4Y7N H;  1XDN A;  3RF2 A;  3NGD A;  4BBS B;  1JE4 A;  4JI2 L;  3N41 B;  1DCZ A;  1UEA B;  2R6G A;  1X3E A;  2ALY B;  4DR2 H;  4EG0 A;  4GC7 A;  1CUK A;  1J6Q A;  1ZHS A;  1HNZ L;  3NTK A;  2V5A A;  4OIJ A;  4UCO A;  3TII A;  3H94 A;  2DZD A;  5I2Y A;  5C0X G;  3I4M G;  1UNN C;  3PGZ A;  1F9R A;  3E0J A;  4EQO A;  4DR2 Q;  2RCN A;  3J7Y W;  3R5X A;  1VQE A;  2X69 A;  1TAE A;  3A8K E;  1E22 A;  1GO3 E;  1JE5 A;  4A3G G;  1IZ6 A;  3A56 A;  3M4O B;  2JP1 A;  3K81 C;  2UXD H;  1AE3 A;  3UDI A;  4Y7N B;  3GIL A;  1D5M C;  1LM0 A;  3K58 A;  3CC7 A;  3CC2 A;  4Q0Y A;  4L8J A;  1BDO A;  2F0W A;  2HIX A;  1S3O A;  1TWC A;  4U6P A;  1HQR D;  1STY A;  3GII A;  2XWB B;  4ZI7 F;  4FXD A;  3G6J B;  3CCM A;  2R7Z B;  1MI2 A;  1Z9F A;  1IOW A;  2CCZ A;  1N33 H;  4GKJ H;  2EYM A;  1UWV A;  3EN2 A;  3CQZ A;  1C30 A;  2JA7 A;  3K7A H;  3RZD B;  1I6V C;  2MQH A;  1JC7 A;  3OIP A;  4HTH A;  2XSC A;  2LY7 A;  1PTO C;  4X64 Q;  2A69 D;  5LMU Q;  5CMD A;  4A3I H;  4XYL B;  3WO1 A;  4GLA C;  1NAP A;  4IUT A;  3SK4 A;  3B6Y A;  1X65 A;  4JI0 Q;  3H0G A;  2JA5 B;  3UI2 A;  2PPB C;  3IRB A;  4KKU A;  4F4X A;  5J39 A;  2UXC Q;  2R82 A;  2UUB Q;  2UUC L;  5LXT F;  2R92 A;  2LSS A;  1EY5 A;  4DUZ L;  4JI1 H;  1HFN A;  5DLF A;  5JJK A;  1XNQ L;  3P75 A;  2R84 A;  1XMO L;  2WKD A;  1GSO A;  3RFC A;  3K7A B;  4LUV A;  1PFM A;  3VMM A;  4O3N A;  3IFD A;  5JEA H;  1FJG H;  2JA7 B;  1WI5 A;  4EGV A;  1YVC A;  3EIV A;  1K3R A;  5FPR A;  1S0O A;  1VQP A;  1HRJ A;  4DV6 Q;  2R7Z A;  2F4I A;  4CJ2 C;  2LXJ A;  5C6A A;  3TRE A;  2E2J B;  2F0M A;  3PV0 A;  4LFA L;  1CA6 A;  2PBZ A;  3I4M B;  2AQ2 B;  4OX9 L;  3FMA A;  2IW3 A;  3Q8P B;  3KHL A;  1EIF A;  2ZJT A;  2EXZ A;  4L1K A;  3T1Y Q;  4LNQ A;  3ONA B;  4LW1 A;  1L1O A;  3MWD A;  3J81 c;  4MA5 A;  2V58 A;  2N88 A;  3A8I E;  2B3G A;  1BBX C;  3TS2 A;  4ECR A;  2CQA A;  1NR2 A;  2YZN A;  5HUR A;  4DR6 H;  1D1I A;  1W6J A;  3RUZ A;  4H7B A;  4JBJ A;  4B3M H;  4WBN F;  5L9X A;  1KDB A;  1VQN A;  5J3B A;  3GV6 A;  4AYB E;  1L1O C;  1M0T A;  3D0F A;  1ZHQ A;  4BXX G;  4YCV A;  4JV5 H;  2VPQ A;  3HOZ G;  3MA2 B;  2JQO A;  4J9K A;  3NK9 A;  1S72 A;  2J7Z A;  5LL6 X;  2A1A A;  3M3Y B;  4IPG A;  2NN6 G;  1B7Y B;  4JI7 Q;  3D31 A;  1TU2 B;  2KUM A;  5DLQ E;  3HOU B;  1PA6 A;  1K8O A;  3KBG A;  4A3M B;  2VZA A;  3KOJ A;  2QF7 A;  3O13 A;  4DAV A;  2YU9 H;  1A0I A;  1Q8K A;  2R86 A;  4JOI C;  1E4E B;  1OXX K;  3IN5 A;  2KCM A;  4UCS A;  3TQY A;  1S0N A;  1V1P A;  1HR0 L;  4Q5V A;  4ETS A;  1LO5 D;  4K0K L;  1I50 B;  1WCM B;  2NYZ D;  1SFO B;  1S5B D;  4CDC C;  3GV3 A;  1C48 A;  3ZJY C;  2G9H D;  4LF9 L;  1JCK B;  2XGT A;  3T13 A;  4XZ3 B;  4RAU C;  4MTD A;  2A6H D;  5KT4 A;  1Y1V A;  3G8C A;  1V1O A;  3S15 B;  3T56 B;  5KFJ A;  3CD6 A;  5JVG 3;  3GTM H;  1HNX Q;  3C46 A;  2NVY A;  4DL6 A;  2N3S A;  1A9X A;  3PW7 A;  3RN5 A;  1SBB B;  4ULL A;  5KFS A;  3BVZ A;  2JA5 H;  4DL7 A;  2D62 A;  4KV6 A;  1PV4 A;  5KFU A;  2ZTE A;  4JI2 Q;  5GAE C;  1SN8 A;  4KHP Q;  2PMZ B;  5C4X H;  4X62 H;  1F2M A;  4YY3 H;  5E4X A;  1HNZ Q;  5BR8 L;  2V9W A;  1F77 A;  4FS2 A;  1I3Q A;  2HHH L;  5CB4 F;  1I4G A;  3TZU A;  1RDP D;  1UE7 A;  1S5F D;  1VQH A;  2VNU D;  2PZT A;  2K04 A;  4LAA A;  5KRU A;  1GUT A;  2A69 C;  3CQZ H;  4RH6 A;  3VA5 A;  2HVR A;  1X9N A;  2EJF C;  3ITP A;  3PIO 3;  2NZ1 D;  1YZ6 A;  3S17 B;  3GO5 A;  4X65 Q;  2NZO A;  1LT5 D;  1TWH B;  3PZP A;  1CHP D;  2PW5 A;  4GOP C;  3PUW A;  4JI5 L;  3TQT A;  3F1Z A;  2SCU B;  2VQF L;  2F0L A;  1W96 A;  2ZM6 H;  3KFU A;  2JA7 G;  2ZDH A;  4NMZ A;  1JB3 A;  4X65 L;  3HFZ B;  5DG9 A;  4NXN L;  3M4Y A;  2BE5 D;  5C4Z A;  5KNB A;  2WB1 G;  4KKT A;  1HA5 A;  3DEO A;  1XMQ Q;  5KYI A;  2IX1 A;  3PUV A;  1AH9 A;  5IE8 A;  1PTO B;  1ENA A;  4UAI A;  1TS3 A;  2C5C A;  1KBL A;  3HKZ B;  3HEJ A;  3OMG A;  5FLX L;  5CV6 A;  4LF6 H;  2VPS A;  1EZ6 A;  1NJI C;  1FNW A;  5KG0 A;  1IBL L;  3U9T A;  1PHJ A;  2BA1 A;  2E2J H;  3CCR A;  2ATW A;  4O3P A;  1PH8 A;  4KMU C;  3ICE A;  3JSL A;  4JYA H;  2JXM B;  5LL6 S;  5IP9 G;  3J7A F;  1DD2 A;  1HQM C;  3GTP H;  1M90 C;  4U68 A;  4LF9 Q;  1KIX A;  4KJN A;  4GN5 A;  1EYZ A;  1Z2N X;  3U4V A;  5GAH C;  1ZQ7 A;  5IGB A;  4QJF A;  3RB0 A;  1OXS C;  5C3E G;  1PTO H;  5C0X I;  1FD7 D;  4DK0 A;  4IRK A;  5EJW A;  4DV2 H;  3PIP A;  1EOT A;  1CQI B;  1YJ9 A;  2QEX A;  4B3S H;  3MFY A;  1PH6 A;  4M9U A;  1HNW L;  3I2Z A;  3KK7 A;  5C1O A;  2CW8 A;  4A3M G;  4QUC A;  2GVB A;  2W70 A;  5K36 H;  5IWA L;  4KTA A;  4N9P A;  5BN3 A;  3NEM A;  1N34 H;  4RB1 A;  3NWS A;  4DV0 H;  2HQL A;  5D8D A;  1BXR A;  1UC9 A;  5EWF A;  2B63 A;  5LMN Q;  1K73 C;  1T3N A;  5DLG A;  2X6G A;  4YHH Q;  1E1O A;  3J81 i;  1IKL A;  2L9H A;  3S2D H;  4GNX B;  3LML A;  5EZY F;  4DV3 H;  2TSS A;  4J9M A;  1E7Z A;  3T5J A;  1YIT A;  1EWC A;  2D0O A;  4JI8 L;  3ORR A;  4YWK A;  5KT5 A;  1EWH A;  2ZXP A;  1GOZ A;  3F2B A;  2CWP A;  4QF4 A;  4DV7 H;  4CBV A;  3RBE A;  1I4H A;  1PH7 A;  4A3L H;  1QIL A;  4WFN 3;  3BAA A;  5IP7 H;  2K33 A;  5KFG A;  1T5X D;  1STE A;  1U4L A;  2A6H C;  4R4Q A;  1G8Z D;  1JOO A;  3I3C A;  4DUY Q;  2HCC A;  2BH8 A;  2RKS A;  4ECU A;  3T1Y L;  4X6A H;  1G91 A;  4DL3 A;  2SNM A;  3GTL A;  5C44 G;  2R93 H;  2K14 A;  3TSS A;  4KJO A;  2F1M A;  4OO1 I;  4RKB A;  1DGS A;  1JWM D;  5GQO A;  4G7H C;  1I94 Q;  4MV6 A;  2F4V H;  2IL8 A;  2B8G A;  2JA6 B;  5BPH A;  3MEF A;  4YQW A;  5I6W A;  4IFD I;  1SEI A;  1O7L A;  2OQ0 A;  1M7J A;  4JYA L;  3HOW B;  3R8B A;  5C3E B;  4B3R L;  3CCU A;  4XQJ A;  1CKO A;  2W71 A;  4CC6 A;  2HJW A;  1B8A A;  1ML0 D;  1K83 B;  1SEB D;  5EPJ A;  5KFE A;  4DUZ Q;  5CBE E;  4RGT A;  3FKI B;  3STB D;  1VKZ A;  4LF9 H;  2Z8L A;  4RFB A;  3F8T A;  4A3D B;  2K32 A;  2JEF A;  4CDF C;  2UUB L;  2H1E A;  2FP4 B;  3DF7 A;  5HGQ A;  4KHP H;  2E74 C;  3R2I A;  3E6Z X;  1B1Z A;  1V9P A;  2UXB L;  3E5S A;  2QYZ A;  1JLL B;  1GGO A;  3JAM L;  1LTA D;  1WTH A;  1CT1 D;  2YRW A;  3HKZ G;  2E2I A;  3M4O H;  4R4O A;  5IGC A;  3HOW H;  5D1O A;  3GTL B;  1CE8 A;  5D1P A;  1NBW A;  4WD3 A;  2K5W A;  3GTM A;  1UC8 A;  4EVO A;  2EQS A;  5HV6 A;  4DR5 H;  3Q8R B;  1D1K A;  3TS0 A;  1IKM A;  4FU0 A;  4ED3 A;  2ZDG A;  1FYC A;  2UVR A;  3K5O A;  1EYA A;  3J81 j;  5EKK A;  2R3Z A;  1EEF D;  1CZW A;  2W8K A;  2VQF Q;  4ECV A;  2EY6 A;  3OWE B;  4DV7 L;  1ILP A;  4DR6 L;  4V19 0;  3I91 A;  3Q6S A;  2MFI A;  3PO2 B;  4A93 B;  3V4S A;  1VQA A;  3OIQ A;  5E7N A;  5KG6 A;  3K5L A;  1WTV A;  5LA6 F;  3A0J A;  4RZQ A;  5IOD A;  1WR2 A;  2B63 B;  1UAP A;  1UEB A;  4KHP L;  3RJ0 A;  3M7G A;  5L1J A;  3ETJ A;  1GD7 A;  4RCN A;  3NEN A;  1M4V A;  1XNR L;  4M1U B;  1E2V A;  2B2V A;  4WRD A;  5C4J H;  2HHH Q;  4DAY B;  2WDT A;  2BR0 A;  5IWA H;  3QJY A;  1PRT B;  4XX0 B;  1TR5 A;  3HGB A;  4A3E G;  2UXC H;  4YJ2 F;  3DHQ A;  1VQ8 A;  1PLF A;  2J0T D;  2B2Y A;  3M4Q A;  3PO3 G;  4PWQ A;  3GTQ H;  4UFZ A;  1B2T A;  3ULJ A;  1KEE A;  3OHB A;  2JE6 I;  2F0I A;  2R93 B;  1VBH A;  1EWI A;  4G7O C;  3OPO A;  4JCV E;  5DEH A;  4IN3 A;  5M3F H;  4DNR B;  2K5N A;  3CPW A;  1MKH A;  2CW0 D;  1V4Y A;  3GLK A;  3S16 B;  5C4J B;  1O7Y A;  3FPU B;  5AFW A;  5KEE A;  2EVB A;  1E4F T;  1HR0 Q;  1VQ6 A;  4ZUI A;  2UXB H;  5JJZ A;  1G6Z A;  3QO2 A;  5JPN C;  1CA5 A;  2F0F A;  2HVQ A;  1FNV A;  3L7Z C;  5KG1 A;  1EY4 A;  4BY7 H;  4HNT A;  4A3F H;  1GUG A;  1IBK L;  2D5D A;  2UXD Q;  1VQK A;  2JA8 B;  3S15 H;  4P73 A;  2SEB D;  2R92 G;  1KL9 A;  2NVQ H;  4K6D A;  1EY8 A;  4HIO A;  2L4N A;  3SI8 A;  1H9M A;  2FE3 A;  4B9W A;  4DR1 Q;  4LF5 Q;  4ZQI A;  2V59 A;  3Q0A A;  4AQY L;  4DA2 A;  2HDL A;  1ESF A;  5H1S E;  4RG1 A;  4FF3 A;  2NVX B;  2PQE A;  4GOP B;  4DV3 L;  3EVQ A;  5FKA C;  4IJH A;  1EQT A;  2R8H A;  3ETH A;  3IG0 A;  3GTJ H;  1PFS A;  4O3Q A;  4JI3 H;  2F0V A;  3BVG A;  4M7E A;  3G6Y A;  4YR0 A;  4DV1 H;  4ECZ A;  3G7L A;  2FHT A;  1D8L A;  2RSN A;  4JUZ A;  3KF8 A;  2DPI A;  2CH4 A;  4LF8 H;  1BBU A;  3BJU A;  2M2L A;  3KUP A;  1KJJ A;  3GTQ A;  3H3V C;  1EIG A;  4TKO B;  3T1Y H;  4IAL A;  3I12 A;  2JA7 H;  1LTS D;  3T1H Q;  1IYV A;  3GTG H;  4P2C B;  2RQX A;  4QL5 A;  3OWF A;  1EZ8 A;  1GLV A;  1I3Q B;  2MO0 A;  4XDX A;  2JEI A;  2M9V A;  3CHB D;  1NY4 A;  4LFC Q;  4DV1 L;  2R85 A;  4NW2 A;  1E2W A;  1A62 A;  3L4K A;  4YIJ A;  4A3D H;  2AQ4 A;  2JA9 A;  2WB1 E;  2K05 A;  4X62 L;  1YBY A;  1JOR A;  3WO0 A;  1BKB A;  2CHB D;  5KNC A;  4K8J A;  3FHW A;  3DMU A;  4DAP A;  2YS6 A;  4HJ9 A;  2UUA Q;  4DR4 L;  1KJQ A;  1VQO A;  3GTL H;  2E76 C;  2HGS A;  2UVV A;  1VQB A;  4DR3 H;  3TQ1 A;  4J9N A;  2UUB H;  3K59 A;  5LMN W;  1SNC A;  2B2Y C;  3K5N A;  1IBK H;  1I4Q A;  3FPP A;  3SK8 A;  3JAM W;  4JPB W;  3OHX C;  4DN4 M;  5GON F;  1SE8 A;  3K0Y A;  1I50 A;  2PVP A;  2KCC A;  2LFN A;  1DON A;  4FS1 A;  2F03 A;  3J80 L;  4QGU A;  1GHK A;  3BQ0 A;  2R93 G;  1X3G A;  2FJ2 A;  3H40 A;  2PQA B;  1Q46 A;  1TWG A;  3ZYY X;  1SLJ A;  2B2W A;  1S03 G;  4HIK A;  2R7F A;  4DNI A;  1VCI A;  2EE1 A;  3RB3 A;  2ASJ A;  3HOX H;  4EBD A;  4ECT A;  4IRC A;  2SDF A;  1P8L A;  4KHZ A;  4ME3 A;  2YZM A;  3BA8 A;  2F3W A;  1RF2 D;  4YBZ B;  2EYH A;  2PI2 E;  3TZD A;  1KLG D;  1VF7 A;  3G6E A;  2PZU A;  4LK1 C;  3H0G G;  1WD0 A;  1X6O A;  1YNX A;  4HSV A;  1JWS D;  3S2H H;  5DQG A;  3FMC A;  2K5H A;  4ABN A;  4C3I H;  2TMP A;  2XWJ B;  1AN8 A;  2K6A A;  2X6L A;  4C1N K;  1LTT D;  3RZO H;  4LF8 L;  2F0J A;  1B4O A;  2XCL A;  2YS7 A;  2VR1 A;  4C5C A;  4N8X 1;  3DWP A;  3IL8 A;  1I6U A;  3HOZ H;  4JI3 L;  4XQN A;  4A3B B;  2VA2 A;  2KCN A;  1QE6 A;  2BQR A;  3U4Z A;  3FP9 A;  3K5I A;  3N44 B;  1EQR A;  3KLS X;  1E3P A;  4O42 A;  4O4H F;  1J8I A;  1PVO A;  3T53 B;  3KAK A;  5NUC A;  4LF6 Q;  4X65 H;  4GLV B;  1DV1 A;  5DGA A;  5LYJ F;  4MNO A;  2K1B A;  4KKS A;  4L63 B;  2HDM A;  4JV1 A;  2K5Q A;  3G6X A;  2J9G A;  2KEE A;  4ZQ3 A;  3R3O A;  4QMG A;  4FVM A;  3RLF A;  2A6E D;  4LF4 H;  1MBY A;  2Z9H A;  4O1N A;  3HOV B;  4JI6 H;  5DQH A;  4R8N A;  1Z47 A;  5I4D A;  1KD1 C;  5I6Y A;  1S4Z A;  3MEH A;  1A8V A;  4A75 A;  4TV9 F;  4P71 A;  1MHW C;  3WWV A;  2JA8 H;  3TIG A;  2FB9 A;  4DV2 L;  4R8U A;  5IP9 H;  2HHH H;  1STN A;  2FMA A;  2N8N A;  3V96 A;  1GYF A;  5IT9 E;  2NVQ B;  2NVX H;  3ORQ A;  3K6O A;  2F0U A;  1PH2 A;  4NKL A;  4PMW A;  5IGD A;  2UUA L;  4DR4 Q;  5COY A;  3URY A;  1C0A A;  4TSS A;  1VQL A;  4FF2 A;  3KAJ A;  3HG9 A;  4C3J H;  2AUJ D;  5C3X A;  4X3S A;  3S14 B;  2B39 A;  1RCV D;  2WAQ G;  1DOK A;  2R7Z H;  3PUX A;  2QIL A;  4JI4 L;  4UP7 A;  1K83 H;  5FO7 B;  4X62 Q;  1EY6 A;  1LYL A;  4YHH H;  4K6L A;  1I94 H;  4K2L A;  4GLX A;  3BG5 A;  3SXH A;  4YJ3 F;  3PW5 A;  2C35 B;  4IO9 A;  1B50 A;  5KFX A;  4B3R H;  1AFP A;  4C3H B;  4CDD C;  4GC6 A;  2KHI A;  5FO8 B;  1B6R A;  2BQU A;  1I4P A;  2Q8T A;  3A5U A;  2K50 A;  5EKI A;  4GN4 B;  2W6Z A;  3RGX A;  2RHQ B;  3F8N A;  1FNU A;  4A3J G;  2FK2 A;  3JC6 6;  2RDH A;  4RU9 A;  1D2B A;  2I87 A;  2ASD A;  3CCE A;  2RHS B;  2EJM A;  1Q81 C;  3CC4 A;  4MV3 A;  1VQ7 A;  4I7A A;  2Z6K C;  3UE1 A;  3CMA A;  1T36 A;  2W9A A;  2VUM B;  3N8D A;  1C3O A;  4A2B A;  1DIK A;  4PMB A;  3BDC A;  2E2H H;  3MWM A;  3PW4 A;  1K9M C;  1UNS A;  3DXJ C;  1U4R A;  1RYS A;  3L0O A;  1GM5 A;  2LS0 1;  2PCF B;  2IPK D;  1CQJ B;  3H4D A;  4F50 A;  4EYH B;  4DV3 Q;  3KYH C;  4FF4 A;  4LFA Q;  1IBK Q;  1VQJ A;  4Q44 A;  3J80 E;  3HRZ C;  5BR8 H;  1HZ9 A;  2XVS A;  4JI8 H;  2YU9 A;  1Y69 U;  1GUW A;  1W6K A;  3H91 A;  3VR2 A;  2AGQ A;  1IYU A;  1XYI A;  3GTP B;  1KAB A;  2NWG A;  1JDB B;  4DV6 H;  2GLT A;  2EOT A;  4GKJ Q;  1QG7 A;  1AN7 A;  3K0X A;  2LMC B;  3PW0 A;  3LWE A;  1NMG A;  2MNA A;  4Q0F A;  1CZG A;  2Q8R E;  4PZ6 A;  1PRT C;  4ZKB B;  2HIV A;  1HUN A;  1A63 A;  2OLS A;  5IT9 W;  3G4S A;  4AYB B;  3TRZ A;  5M5W B;  3VPB A;  3M3Y H;  3MXN A;  5AJ3 Q;  4Y8V B;  5KG4 A;  2BH2 A;  5J2T F;  4ID6 A;  2FK3 A;  2KED A;  1PH1 A;  1XWE A;  2AMC B;  4UCV A;  1EOV A;  1UE5 A;  5FK9 C;  5IYD H;  4DUZ H;  2UXD L;  2MGS A;  5IYZ F;  5EWG A;  3GV5 B;  1O78 A;  4AYB G;  4X64 H;  3H0G H;  3R93 A;  3K5H A;  5KKN B;  4IUU A;  1BO0 A;  1GUN A;  1GSH A;  1EYG A;  3T5L A;  2YU9 B;  1XNR Q;  1YNN D;  3GTO B;  3S1R B;  1I50 H;  2ASL A;  3A7L A;  3GD7 A;  4RWS C;  2Z6B A;  5KFT A;  2EZV A;  3N43 B;  4ALP A;  3OUU A;  1FGU A;  1EFI D;  3H20 A;  5CYU A;  4KLK A;  4O0A A;  1P16 A;  4MTE A;  3J81 L;  1I7N A;  4ED0 A;  3HP3 A;  3GTQ B;  2MCT A;  5KG3 A;  3SE7 A;  1QUQ B;  2FK1 A;  5KFD A;  4JBW A;  1ZYR C;  4HED A;  2CQY A;  1X54 A;  3AEV A;  3DEP A;  4E6I A;  5JVH 3;  3HOY H;  1HTL D;  5M3F B;  3CXC A;  2C00 A;  1ILQ A;  4QWE A;  2WFW A;  5FLM H;  4DV2 Q;  5FO9 B;  4RUC A;  3FVQ A;  2NVX A;  1JMC A;  3TP7 A;  1JT8 A;  2MJ8 A;  4S3S A;  1KTK A;  1PFB A;  4O3R A;  2DJG C;  3M9O B;  4HID A;  2BDO A;  2DNC A;  5BR8 Q;  4ZHQ F;  4DV0 L;  2D0P A;  3GV8 B;  1CKM A;  4OEL B;  2KCT A;  2PW7 A;  3Q24 A;  4C3J B;  5KFW A;  4F4Z A;  5ELF A;  2F0G A;  4KD3 A;  2G5D A;  2L1B A;  3T4A C;  5CV8 A;  4O3S A;  1PDQ A;  1OXT A;  1XX8 A;  4JI7 H;  5IYC H;  2R7D A;  3OMC A;  3S17 H;  1SJH D;  4RB2 C;  2DUD A;  3MXU A;  2GPW A;  4OWX B;  1MJE A;  1BOS A;  1E24 A;  1K1Q A;  4DV5 H;  1SE2 A;  1ET6 A;  1T5E A;  4C3H H;  2MUY A;  4LSX A;  2LKV A;  4U67 3;  4DV4 L;  4JOI A;  4PV1 C;  5C4H A;  3ERS X;  3NSW A;  1AE2 A;  3EPG A;  2PZW A;  3OOC A;  4C3H G;  3PN1 A;  3EPI A;  2MHV A;  1U4M A;  1YHA A;  2R8I A;  5GRO A;  2B63 H;  4YAJ B;  4UCR A;  2E5L H;  2FJZ A;  4FBU A;  2E2H B;  2EXD A;  1U0L A;  4YCU A;  1LTI D;  3CRL C;  1KDA A;  4RGO S;  4YWL A;  4UCU A;  4IR9 A;  2Q2T A;  3I4N B;  4DAY A;  5H80 A;  1QB5 D;  3HKZ E;  2OWO A;  1LLR D;  1STA A;  3CQZ B;  2IHE A;  1Q12 A;  3HOU G;  4A3I B;  2OH2 A;  1VQG A;  2O2L D;  4C2M H;  4A3G H;  1HJP A;  3ULP A;  2V4Q A;  4BY7 G;  3SE0 A;  4ME6 A;  1QNU A;  4OHJ A;  4JBM A;  1C9O A;  3T1H L;  4A3E B;  4IZO A;  4JI5 H;  1HTP A;  5DM7 3;  1N32 Q;  1MSH A;  4DV5 Q;  4JI8 Q;  4P74 A;  5D14 A;  1KQS A;  4DK6 C;  3S2H B;  3BYY B;  2W6M A;  4HJ8 A;  4M8A A;  3N42 B;  4L6T B;  4DPG A;  4EQP A;  1CSP A;  2L11 A;  1ZEQ X;  1SNQ A;  2L15 A;  1I94 L;  1TWA A;  1SMY D;  2Z0S A;  4IHJ F;  4A3F B;  3I7F A;  4GKK H;  2GPS A;  4ECQ A;  1IYJ B;  3PO2 G;  4JI4 H;  1KRT A;  3PO3 H;  2V4D A;  2ZTC A;  2A68 D;  4BWS C;  4OL7 A;  5LMN L;  2MP1 A;  2YV5 A;  1ZET A;  3SK5 A;  4KI0 A;  4IFD J;  3I72 A;  1U4P A;  3HXL A;  4B08 A;  3OSP A;  2L55 A;  1K8G A;  2B2T A;  4YB8 B;  4OGQ C;  4IWY A;  4F4Y A;  1XTD A;  4DR7 H;  2KOL A;  1CQF A;  3SHL A;  4DFA A;  4R8U B;  2B2W C;  5CC4 A;  4QY7 A;  2EYJ A;  4C1N I;  2W8L A;  2IHF A;  4PDB A;  3S1R H;  3OW7 A;  1PTO D;  1HH2 P;  5EGT A;  3CF5 A;  1H9S A;  2E75 C;  2XCP A;  1B3Q A;  1TXY A;  1VQI A;  1Q1B A;  1N36 H;  3GTG B;  2MO1 A;  4HSP A;  4X3T A;  5DQI A;  1S40 A;  1EQQ A;  5JQW A;  5IGG A;  3VR4 A;  4DL2 A;  4C5A A;  4LF4 Q;  2WYO A;  4IFD H;  4IUV A;  1EZ1 A;  4B9X A;  2XRS D;  4WJW A;  1FR3 A;  2L5T A;  2BQ3 A;  2DGY A;  1HXY D;  2I5H A;  2B2V C;  4DV6 L;  2XN9 C;  2NVY H;  3NTH A;  3L9A X;  2IX0 A;  1AW7 A;  1MGS A;  1FL0 A;  1N8R C;  3M9M B;  1ENC A;  2IWH A;  2FLP A;  4NXM L;  1KDC A;  1K28 A;  1SNM A;  3HOW G;  2UVU A;  4G57 A;  1IBM L;  1TS5 A;  1KAA A;  1TWG H;  1SCU B;  3BS1 A;  1TWA H;  1QZH A;  4GKK L;  1V43 A;  1EL0 A;  2W7O A;  1ICF B;  1AUV A;  2B29 A;  3TN2 A;  1ENF A;  4B3T H;  1Q86 C;  5C5M A;  2BA0 A;  4MV1 A;  4J15 A;  1N33 L;  1NR4 A;  5L1K A;  1GKH A;  3UE0 A;  2Y0S G;  3E9H A;  3RMH A;  3BU2 A;  4XYQ A;  4GZY C;  3Q2O A;  3D4R A;  2EY2 A;  1XPO A;  1GVP A;  1S9F A;  2JN4 A;  1HHV A;  3RV3 A;  4X64 L;  4R4I A;  3UDF A;  3VYT A;  3MFH A;  2J6T A;  3AFP A;  1BCP D;  4JG2 A;  1TWF H;  2RVL A;  2VQE Q;  2PQA A;  4J1M A;  4LFC H;  1KNA A;  4MIU A;  3S1N B;  2HUG A;  2K75 A;  4ODG A;  1SYC A;  3MXG A;  3I8Z A;  2ZJP A;  1JKJ B;  4R1J A;  3OHA A;  3QZ7 A;  5C44 H;  2VQE L;  3BQ2 A;  2NB0 A;  1JJC B;  5L37 A;  3RNU A;  1EEI D;  2YL2 A;  3LP8 A;  3JAM i;  3QOJ A;  3MAQ A;  1A6X A;  5A2Q L;  1RYR A;  2O5I C;  4ED2 A;  4K14 A;  4DR7 L;  1D7Q A;  1ICW A;  1NTG A;  5IYB G;  3AU7 A;  4OON A;  2H4O A;  3MFG A;  2ZXO A;  5JVL A;  1D5X C;  2EYF A;  4YR3 A;  4DXF A;  4B3S Q;  4A3F G;  4J9O A;  2VOB A;  4YCW A;  1YNJ D;  2F4V L;  2JSO A;  5JJI A;  4LF5 H;  5JH7 F;  2W6Q A;  1XPU A;  2ID0 A;  2J4X A;  4K2K A;  2A6E C;  3UQ8 A;  4FXK C;  1SMY C;  3KDF A;  5F9L A;  3QOL A;  3D6W A;  3PF5 A;  3OSO A;  3T16 A;  4JI7 L;  2DPJ A;  2NU9 B;  4YWM A;  2QEJ C;  5EOY A;  3CW2 C;  1YHB A;  1C4Q A;  4YP3 A;  3JZI A;  2VQD A;  2N49 A;  5M3M G;  2UXB Q;  4LF4 L;  1VQ4 A;  3PSI A;  1GXD C;  1UUP A;  1LT3 D;  4Q8F A;  1G51 A;  4TRD A;  2EIF A;  5JUM A;  4DUY L;  3NQI A;  2E2D C;  2QDB A;  1R9T B;  3AQQ A;  4R8I A;  3DM3 A;  1R9T A;  3K3P A;  4Y52 H;  2EY5 A;  2YCH A;  4RNM A;  4GNX C;  5EDW A;  2JEJ A;  5LHY 1;  2E2I H;  2AWO A;  3R2T A;  3TP5 A;  4IPC A;  1QJO A;  2DWC A;  1F2Z A;  1RIP A;  4OO1 G;  3BA9 A;  1AZQ A;  3ND8 A;  2A74 C;  1HFG A;  3J80 i;  1QVC A;  3E5N A;  5FD6 A;  1B6S A;  4HN7 A;  1JDE A;  5K5P A;  1TII D;  3BYT B;  1AZP A;  4MZ9 A;  3WNZ A;  4DNT B;  3S24 A;  4UP8 A;  2AUK A;  1PH3 A;  3NBI A;  3GTK B;  5KFA A;  3STB C;  1PYW D;  1WOC A;  5M5W H;  2YYA A;  1HNW H;  3HKS A;  2ICE C;  4POF A;  3GTM B;  4DV1 Q;  5L1I A;  5FPO A;  1BCP F;  1QWY A;  4QB4 A;  3GIP A;  5M5Y H;  2O5J C;  3FEW X;  2FPI B;  2G9D A;  2AQ3 B;  1OWT A;  3D3R A;  4IPH A;  1I6H B;  3LWB A;  5J1Z A;  2DN8 A;  2H5X A;  4BBS H;  3GTJ B;  5KFF A;  3MVV A;  2VUM G;  2R7M A;  2M00 A;  4IUP A;  3SVM A;  4DV5 L;  2AKW B;  1N32 L;  3EBE A;  3R5F A;  5KFV A;  5ELE A;  4QWA A;  2ES2 A;  3I73 A;  1J5E Q;  2I5L X;  4ECW A;  1ZYR D;  2NU6 B;  5ELO A;  3EFX D;  3I90 A;  3RBD A;  3GTK H;  4R4T A;  2R7K A;  4LF7 Q;  3PR4 A;  5CV4 A;  3DWA A;  1H9S B;  4MTK A;  2ASB A;  4BY7 B;  3MFI A;  4XTC S;  4HJA A;  4K5X A;  1TWH H;  1I3Q H;  3PIO A;  3KLR A;  2ZXR A;  2M05 A;  1I6H H;  5CBA E;  2Y0S B;  1IW7 D;  4A3D G;  1BR9 A;  3J7A K;  3NUC A;  1T94 A;  3CCV A;  1RKN A;  4JV5 Q;  1PRT F;  4NB3 A;  4A3K H;  3QG1 A;  4RNO A;  3OTO H;  3K3V A;  2KBN A;  2C2E A;  1RK6 A;  1Z6H A;  4I7H A;  5A2Q W;  4JI4 Q;  1ASZ A;  2XNA C;  2F3I A;  3G48 A;  2FMC A;  4KY6 A;  3N6X A;  5C5L A;  3I4N H;  1OXU A;  1UE1 A;  3RZD H;  4KN4 C;  4LH6 A;  1DOL A;  2Q2U A;  1LTR D;  4V0B A;  3IFT A;  4O4I F;  1HZB A;  3FRP B;  5C44 B;  3JRX A;  1SNP A;  3TP8 A;  1G6P A;  3H09 A;  3JRW A;  2AHO B;  1W93 A;  5D1O B;  1YJN A;  1L1O B;  5A2Q E;  2KHS A;  4R9W A;  1LAB A;  4O4L F;  3NHH A;  5BN5 A;  4IZ8 A;  1EU3 A;  1SRO A;  4DLK A;  3GIJ A;  1TVX A;  4LWC A;  1S5D D;  4ME5 A;  4GNX A;  2GVA A;  4B3T Q;  4I4T F;  1IHZ A;  5KFK A;  4QWC A;  4J9R A;  3V6J A;  2XGQ A;  5IP7 G;  3CCQ A;  3UFX B;  2IA6 A;  3LNN A;  2I0Q A;  1WTX A;  5DM6 3;  1O75 A;  2YZG A;  2W6O A;  5IYD G;  3H3V H;  4ZK9 B;  1Y8N B;  4O3O A;  2R7L A;  1K83 A;  1AP0 A;  2NU8 B;  2QKI C;  2UU9 H;  1MIU A;  3EJI A;  3RZO B;  4JI0 H;  2F0P A;  2E5L Q;  3KJO A;  4NXN Q;  4FO2 A;  5M3F G;  1KJ9 A;  1TS4 A;  2D9U A;  2V4R A;  1UE6 A;  5FLX W;  4ED6 A;  3GQB A;  1STB A;  3D4D A;  3HBL A;  3OW2 A;  3F2D A;  4JI3 Q;  4A3B G;  3N52 A;  4L5T A;  2R92 B;  1LTB D;  1PFN A;  1EU4 A;  1OXV A;  4UHV A;  2F0T A;  2UUA H;  4LF7 H;  4IR1 A;  1Q90 A;  5M3M H;  1IBM Q;  2OTJ A;  4WJ3 M;  5D65 A;  1L0W A;  4A3M H;  4K0K Q;  2RCF A;  5KFC A;  5IGF A;  3EQL C;  3C1E A;  4DV4 H;  3KLW A;  1XXG A;  1HA6 A;  1BNC A;  1L2F A;  2I07 B;  5T1G A;  4RNN A;  3CU7 A;  4AIM A;  3I4O A;  4IUQ A;  1FKA H;  3T51 B; 
#chains in the Genus database with same CATH homology
 1SFO H;  1XJV A;  5C3E H;  2LXK A;  4QQB X;  2E8G A;  2CFM A;  1A63 A;  4JV5 L;  1SRU A;  2KEN A;  1U5K A;  2ZTD A;  3G4S A;  1NJI C;  1IBL L;  3TRZ A;  1PHJ A;  2BA1 A;  4BY1 G;  3CCR A;  2E2J H;  5ELN A;  5AJ3 Q;  4A3K G;  4L5R C;  2ATW A;  2BH2 A;  1FVI A;  3M3Y H;  1PH8 A;  1YEZ A;  1YIJ A;  3ICE A;  1KC8 C;  2QGQ A;  5IP9 G;  1PH1 A;  2AMC B;  1X3F A;  1IBL Q;  1EOV A;  1UE5 A;  1M90 C;  4BA1 I;  3GTP H;  4LF9 Q;  2UU9 Q;  1KIX A;  3HOU H;  5IYD H;  3CCJ A;  4GN5 A;  1N33 Q;  3U4V A;  2UXD L;  5GAG C;  5GAH C;  1RL2 A;  1Y14 B;  4QJF A;  4AYB G;  1OXS C;  3H0G H;  5C3E G;  5AJ3 L;  1W2B A;  5C0X I;  2OTL A;  3S14 H;  4DV0 Q;  1G29 1;  3M9B A;  1EYG A;  4UY8 C;  3PF4 A;  3NBH B;  5JEA J;  1XNR Q;  3PIP A;  1I50 H;  1YJ9 A;  3E0E A;  3GD7 A;  2FXQ A;  3M85 A;  2QEX A;  1PH6 A;  4ALP A;  1HNW L;  4YHH L;  1FGU A;  3I2Z A;  4A3M G;  2GVB A;  4KLK A;  1P16 A;  2OQK A;  3BZK A;  4O0A A;  2OCE A;  5IWA L;  1KRS A;  3DLL A;  3NEM A;  4IFD G;  1QUQ B;  2F52 A;  4JBW A;  2HQL A;  4O2D A;  4LUZ A;  1X54 A;  4R4C A;  3AEV A;  1Y1W G;  1HR0 W;  5LMN Q;  4DV7 Q;  3HOY H;  3CXC A;  1K73 C;  3S1M H;  4YHH Q;  1E1O A;  2WFW A;  3J81 i;  5FLM H;  3S2D H;  1WFQ A;  4EQ5 A;  4DV2 Q;  4GNX B;  1JMC A;  1JT8 A;  1E7Z A;  1YIT A;  2D0O A;  4JI8 L;  4YWK A;  3F2B A;  1VS0 A;  4HID A;  5BR8 Q;  1WYD A;  2CWP A;  1NMF A;  4DV0 L;  2D0P A;  2CKZ B;  4HJ5 A;  1CKM A;  1PH7 A;  2KCT A;  4OWT B;  4A3L H;  5IP7 H;  2CWA A;  1KXL A;  3M4P A;  4R4Q A;  2UU9 L;  4BBR G;  3CCL A;  1OXT A;  1WJJ A;  5IYC H;  4DUY Q;  4JI0 L;  2R7D A;  2ZJQ A;  2BH8 A;  3S17 H;  2YTX A;  3GDE A;  2VS1 A;  4DR3 Q;  2DUD A;  4OWX B;  5M5X H;  1MJE A;  1E24 A;  3HOY G;  3T1Y L;  4X6A H;  1FJG Q;  4C3H H;  5C44 G;  3A74 A;  3F2C A;  2R93 H;  2K14 A;  4DV4 L;  4JOI A;  4XIG S;  3RR5 A;  1XPR A;  3ERS X;  1AE2 A;  4OO1 I;  4A93 H;  1DGS A;  1LUZ A;  5IY0 A;  4A4I A;  5C0X J;  5GQO A;  2VW9 A;  1I94 Q;  1YHA A;  3S1N H;  3MEF A;  4UP9 A;  4GN3 B;  5GRO A;  2B63 H;  1JB7 A;  2GN5 A;  4IFD I;  4H02 A;  4NXM Q;  2Q2H A;  2OQ0 A;  2ZM6 Q;  2EXD A;  1QUQ A;  4JYA L;  1D7Q A;  1U0L A;  4YCU A;  4B3R L;  3CCU A;  1CKO A;  1B8A A;  4YWL A;  4MTN A;  2Q2T A;  4DUZ Q;  3HKZ E;  3STB D;  2OWO A;  4B3T L;  3OTO Q;  2IHE A;  1Q12 A;  3F8T A;  4GS3 A;  4UPA A;  2UUC Q;  2JEB I;  1PYB A;  4IPD A;  4IOC A;  2UUB L;  1VQG A;  4YY3 Q;  3G71 A;  4C2M H;  3Q8D A;  5HGQ A;  5IT9 c;  5IYB H;  4A3G H;  2Q2I A;  1C7Y A;  1V9P A;  2UXB L;  1HJP A;  4DR2 L;  1TWC H;  2JEA I;  3ULP A;  4BY7 G;  1R9T H;  4YY3 L;  3L2P A;  1Y1W H;  4JBM A;  1C9O A;  3HKZ G;  3OTO L;  3T1H L;  1EUJ A;  1J5E L;  3M4O H;  3PUY A;  1IL2 A;  4R4O A;  3HOW H;  4IJL A;  3TEH B;  1N32 Q;  4DV5 Q;  1NBW A;  4JI8 Q;  4B3R Q;  4NPS A;  4P74 A;  1KQS A;  4DK6 C;  2B63 G;  3MXN B;  3ULL A;  2EQS A;  4HJ8 A;  3FKI H;  4A3C G;  1X56 A;  4DPG A;  3TS0 A;  1Q82 C;  1CSP A;  2L15 A;  1I94 L;  4A93 G;  3H3V I;  2Z0S A;  2K52 A;  3J81 j;  1N36 L;  3I7F A;  4JI6 L;  1IYJ B;  3PO2 G;  1KRT A;  4AH6 A;  3PO3 H;  2ZTC A;  2E5L L;  4DR6 Q;  1O7I A;  3U58 A;  2K4K A;  4TVA B;  2VQF Q;  5LMN L;  4DV7 L;  1B70 B;  4DR6 L;  2YV5 A;  4OX9 Q;  4KI0 A;  4IFD J;  2MFI A;  1PH9 A;  1VQF A;  1QVF A;  1K8G A;  1VQA A;  5E7N A;  3H15 A;  1XTD A;  5IWA Q;  3A0J A;  1E1T A;  2Z6K A;  2JA6 H;  2RF4 A;  1VQD A;  3NEL A;  4QY7 A;  1UEB A;  4KHP L;  3ER0 A;  2A19 A;  1I5F A;  3W5O A;  1PH4 A;  1GD7 A;  1PYS B;  5FLX c;  2IHF A;  1Y1V G;  3NEN A;  1ASY A;  3S1R H;  1XNR L;  2HHH Q;  5C4J H;  2Y0S E;  4WJ4 A;  2NZH A;  1HH2 P;  1IXR A;  3W1G A;  4DAY B;  3CF5 A;  4DKA C;  1HNX L;  1SMX A;  4POG A;  5FLM G;  1XNQ Q;  1TXY A;  1VQI A;  3CP0 A;  2JA5 G;  1Q1B A;  3CCS A;  2HT1 A;  4A3E G;  2MO1 A;  2YTV A;  3BZC A;  2CQO A;  1VQ8 A;  4B3M L;  1S40 A;  1EQQ A;  3M4Q A;  3PO3 G;  4LF4 Q;  4JI1 Q;  4A3I G;  5FJ8 G;  3GTQ H;  3ULJ A;  3KF6 B;  4B3M Q;  1JJ2 A;  2JE6 I;  4AQY Q;  1EWI A;  4DK3 C;  3U50 C;  1CSQ A;  3VDY A;  4JCV E;  2DGY A;  3FKI G;  2I5H A;  4DV6 L;  5M3F H;  2KHJ A;  2K5N A;  2NVY H;  5IYC G;  1MKH A;  2IX0 A;  2YYZ A;  3CPW A;  1N8R C;  1FL0 A;  2R7Z G;  3S1Q H;  2ZM6 L;  5JJL A;  3KF6 A;  4NXM L;  3PUZ A;  3HOW G;  1MJC A;  1IBM L;  3I56 A;  1HR0 Q;  1VQ6 A;  2A8V A;  1TWG H;  3GTO H;  1CKN A;  1TWA H;  1QZH A;  1N34 L;  1V43 A;  4GKK L;  3HOV H;  4LFB L;  2B29 A;  2VY3 A;  4JI5 Q;  4RMF A;  3L7Z C;  2JA6 G;  3M7N A;  4BY7 H;  2JK8 A;  4HIM A;  1Q86 C;  4A3F H;  2YTY A;  5C4X G;  2BA0 A;  1IBK L;  4J15 A;  1N33 L;  1VQK A;  2UXD Q;  4DR5 L;  3S15 H;  1GKH A;  4P73 A;  4OXP A;  2F4V Q;  3UE0 A;  2R92 G;  1KL9 A;  2WP8 J;  2NVQ H;  1KHI A;  2Y0S G;  3E9H A;  3BU2 A;  1W3S A;  2WAQ E;  3CPF A;  4HIO A;  4HJ7 A;  3UDG A;  1XPO A;  1KAW A;  2QA4 A;  4DR1 Q;  1VQ9 A;  1BBW A;  4DR3 L;  4P72 A;  4LF5 Q;  1GVP A;  4AQY L;  2VL6 A;  1T9H A;  5H1S E;  4RG1 A;  3K8A A;  3HOV G;  4GOP B;  3PO2 H;  4DV3 L;  3S16 H;  4BXX H;  4IOA A;  4X64 L;  4R4I A;  4IJH A;  3I4M H;  4LF7 L;  3UDF A;  3AFP A;  1PFS A;  3GTJ H;  4JG2 A;  1TWF H;  2VQE Q;  2PQA A;  4L5Q A;  4Y7N H;  3AYH B;  1JJG A;  4JI2 L;  1D8L A;  1VQM A;  4A3C H;  2R6G A;  1X3E A;  1BBU A;  2ALY B;  2UXC L;  2K75 A;  3BJU A;  1CUK A;  1J6Q A;  1HNZ L;  3LGJ A;  2JA7 H;  2ZJP A;  3T1H Q;  4R1J A;  5C0X G;  3I4M G;  5C44 H;  2VQE L;  3GTG H;  3PGZ A;  1JJC B;  2IY5 B;  3RNU A;  1EFW A;  4QL5 A;  4DR2 Q;  3JAM i;  2MO0 A;  2RCN A;  1CKN B;  1VQE A;  5EAY A;  3KJP A;  1NY4 A;  4LFC Q;  4DV1 L;  4DR7 L;  1A62 A;  1E22 A;  1JE5 A;  1GO3 E;  4LUO A;  2JA9 A;  4A3D H;  1NTG A;  1IZ6 A;  2WB1 E;  5IYB G;  4OON A;  1YBY A;  4X62 L;  4LFC L;  4DR1 L;  4A3G G;  4B3S Q;  3K81 C;  1BKB A;  1AE3 A;  3UDI A;  4A3F G;  4LFB Q;  1LM0 A;  4YCW A;  3CC7 A;  3CC2 A;  4L5S A;  1Q7Y C;  2F4V L;  3FHW A;  2HIX A;  4JI6 Q;  1S3O A;  4HJ9 A;  2N78 A;  1PH5 A;  2UUA Q;  4DR4 L;  5JJI A;  1VQO A;  2ID0 A;  1XPU A;  3GTL H;  1VQ5 A;  3CCM A;  1VQB A;  1XMO Q;  3KDF A;  1Z9F A;  2CCZ A;  5LMN W;  3PF5 A;  3HOX G;  1UWV A;  3EN2 A;  4JI7 L;  1NE3 A;  1OTC A;  4YWM A;  1LTL A;  1SE8 A;  3K7A H;  3CW2 C;  1YHB A;  2MQH A;  3UDX A;  2N49 A;  5M3M G;  2UXB Q;  4LF4 L;  1VQ4 A;  4QIW E;  4X64 Q;  5LMU Q;  3PSI A;  4QGU A;  4A3I H;  2R93 G;  1X3G A;  3K7U C;  2PQA B;  1Q46 A;  1G51 A;  4GLA C;  2EIF A;  4LF5 L;  3B6Y A;  3J7Z C;  1X65 A;  1SLJ A;  5LMU L;  4DUY L;  4JI0 Q;  4HIK A;  4X66 Q;  2R7F A;  3AQQ A;  4DNI A;  2IT1 A;  3DM3 A;  3IRB A;  1VCI A;  2UXC Q;  3I4N G;  3HOX H;  4Y52 H;  2UUB Q;  4GNX C;  2UUC L;  1P8L A;  2V1C C;  4KHZ A;  4ME3 A;  1QVG A;  2E2I H;  2LSS A;  2PI2 E;  4DUZ L;  3G6E A;  2AWO A;  1N9W A;  5JJK A;  2NN6 I;  4IPC A;  5JEA G;  1N34 Q;  1XNQ L;  4TQU S;  3H0G G;  1RIP A;  1X6O A;  1YNX A;  1XMO L;  3JAM c;  4LUV A;  1XMQ L;  3S2H H;  4OO1 G;  3J80 i;  2K5H A;  1QVC A;  1WI5 A;  4C3I H;  4DR7 Q;  1YVC A;  3EIV A;  1K3R A;  3RZO H;  4DV4 Q;  4LF8 L;  1VQP A;  3A5Z B;  4MZ9 A;  2PNH A;  2AWN A;  3S24 A;  4DV6 Q;  4B3S L;  4UP8 A;  1PH3 A;  2LXJ A;  1FJG L;  3STB C;  5M5W H;  1WOC A;  2I5M X;  3TRE A;  4BY1 H;  4A3J H;  3PV0 A;  3HKS A;  4LF8 Q;  4JI3 L;  4LFA L;  3HOZ H;  4POF A;  4DV1 Q;  3RLO A;  3U4Z A;  3FP9 A;  1BVS A;  4OX9 L;  4JI1 L;  1EQR A;  1E3P A;  5M5Y H;  1EIF A;  4GKK Q;  1PVO A;  1VQC A;  3T1Y Q;  4LF6 Q;  4IPH A;  4LNQ A;  4BA2 I;  4GLV B;  2H5X A;  1L1O A;  4LW1 A;  4PG3 A;  3J81 c;  4BBS H;  2VUM G;  4MNO A;  1H95 A;  4DV5 L;  2AKW B;  2B3G A;  1N32 L;  3EBE A;  2PI2 A;  3TS2 A;  1EIY B;  2ES2 A;  2VUM H;  3I55 A;  1J5E Q;  4BBS G;  2I5L X;  4JBJ A;  5ELO A;  1VQN A;  5J3B A;  3K80 C;  3RLF A;  4AYB E;  4R4T A;  3GTK H;  1L1O C;  3D0F A;  4LF6 L;  4BXX G;  4LF7 Q;  4YCV A;  1Z47 A;  1KD1 C;  2ASB A;  1A8V A;  4A75 A;  3E9I A;  4XTC S;  3KF8 B;  4P71 A;  2JQO A;  4HJA A;  1TWH H;  1I3Q H;  3W1B A;  3WWV A;  1S72 A;  2JA8 H;  2XTI A;  3PIO A;  2A1A A;  4DV2 L;  2K5V A;  4IPG A;  5IP9 H;  2NN6 G;  1B7Y B;  4PZ8 A;  4JI7 Q;  3SGI A;  2R92 H;  2N8N A;  4A3D G;  1I6H H;  3D31 A;  3CCV A;  4JV5 Q;  4NB3 A;  4A3K H;  2JA8 G;  5DLQ E;  2NVX H;  4A3L G;  4GOP A;  3AFQ A;  1PA6 A;  1PH2 A;  2KBN A;  2VZA A;  4PMW A;  3CAM A;  3KOJ A;  2UUA L;  4DR4 Q;  5HY6 A;  1C0A A;  4JI4 Q;  1WCM G;  1ASZ A;  1VQL A;  1A0I A;  1Q8K A;  2YU9 H;  2F3I A;  4JOI C;  3HOU G;  4C3J H;  1OXX K;  3G48 A;  2KCM A;  4JBK A;  3TQY A;  3CME A;  2WAQ G;  2R7Z H;  4DAM A;  3PUX A;  1HR0 L;  4APV A;  4UP7 A;  4JI4 L;  1K83 H;  4X62 Q;  1OXU A;  1QZG A;  3I4N H;  1LYL A;  4JYA Q;  4K0K L;  1UE1 A;  3RZD H;  2Q2U A;  3ZJY C;  4LF9 L;  2XGT A;  4GLX A;  3J7A 5;  1HZB A;  4JC0 A;  4X66 L;  2C35 B;  3KDF B;  4EX5 A;  4IO9 A;  1YI2 A;  2KHI A;  2ZJR A;  1G6P A;  3J80 c;  1HZA A;  2AHO B;  3CD6 A;  3A5U A;  5K36 G;  2K50 A;  3GTM H;  4GN4 B;  4P75 A;  1YJN A;  1L1O B;  1K0R A;  1HNX Q;  2N3S A;  2RHQ B;  4A3J G;  3RN2 A;  3RN5 A;  4A3E H;  3JC6 6;  1K8A C;  2JA5 H;  1SRO A;  5GAD C;  2D62 A;  1PV4 A;  4BBR H;  2ZTE A;  4JI2 Q;  4LWC A;  5GAE C;  1SN8 A;  4GNX A;  4KHP Q;  4B3T Q;  2GVA A;  5C4X H;  3CCE A;  1HZC A;  2RHS B;  5IP7 G;  1Q81 C;  3CC4 A;  3CCQ A;  1WCM H;  1HNZ Q;  5BR8 L;  1VQ7 A;  2NVT H;  2Z6K C;  3UE1 A;  3CMA A;  2I0Q A;  2HHH L;  1YJW A;  3PCO B;  4A3B H;  1UE7 A;  1M1K C;  2E2H H;  1VQH A;  1K9M C;  2VNU D;  5IYD G;  3H3V H;  1SR3 A;  3CQZ H;  3L0O A;  1GM5 A;  1X9N A;  1MIU A;  1YZ6 A;  2E5L Q;  3KJO A;  4NXN Q;  3GO5 A;  5M3F G;  3KYH C;  4DV3 Q;  4DR5 Q;  4X65 Q;  4GKJ L;  2NZO A;  4LFA Q;  1IBK Q;  1UE6 A;  1VQJ A;  3OW2 A;  3F2D A;  4JI3 Q;  4A3B G;  3RLN A;  1HZ9 A;  4L5T A;  4GOP C;  3PUW A;  4FDB A;  4JI5 L;  1OXV A;  3F1Z A;  1V1Q A;  4PZ7 A;  5FJ8 H;  2VQF L;  3KFU A;  2JA7 G;  1HNW Q;  5M3M H;  1X55 A;  1IBM Q;  2OTJ A;  4WJ3 M;  1YHQ A;  1L0W A;  4X65 L;  3HFZ B;  4A3M H;  4OWW B;  4K0K Q;  4NXN L;  1N36 Q;  4GKJ Q;  3K0X A;  1Q1E A;  2PMZ E;  2WB1 G;  3KLW A;  4A76 A;  1XMQ Q;  1L2F A;  2JJQ A;  1AH9 A;  2IX1 A;  1NMG A;  3PUV A;  5IE8 A;  2MNA A;  4AIM A;  3I4O A;  4PZ6 A;  3HOZ G;  1Y1V H;  3OYY A;  2HIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...