5C44G

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c44G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c44G01
4YWMA 2MFIA 3PUWA 4PG3A 4JI5Q 4GNXB 2HHHQ 5C3EG 3PUYA 3PUXA 4DR3L 5JEAJ 1X55A 2JA6G 1VQPA 4JI1Q 4Y7NH 1PVOA 5ELOA 3OW2A 1Y1WG 1VQDA 1QZGA 4A3MG 1SRUA 3CCEA 2VY3A 4DV2L 3AQQA 4DR5L 1J6QA 1VQBA 4P75A 4R1JA 4DV7Q 4BBSH 2R7FA 4AIMA 4YY3L 4LNQA 2K4KA 1UE6A 1U0LA 1KIXA 3AFPA 2MO0A 3KDFA 5C0XI 4HJ5A 3SGIA 1WCMG 4YY3Q 4GS3A 1BBUA 1CUKA 3G4SA 1SMXA 1NTGA 3HOYG 2KHJA 1S3OA 2Q2HA 2CWPA 3M85A 3CPWA 2WAQE 3G48A 1ASZA 1IXRA 2AWNA 4KI0A 1Q86C 2VQFL 1VQNA 5IP9G 1B7YB 4DV2Q 4DV6L 4X6AH 1K73C 1SN8A 2F3IA 2KCTA 1DGSA 4WJ3M 3ZJYC 3S15H 2JK8A 4NXNL 1UEBA 4LW1A 4O2DA 4LFBQ 1N8RC 3U4VA 3STBD 4BY7G 2R7DA 3CCMA 1EUJA 4IPCA 4EX5A 2N3SA 1UE7A 2KENA 4PZ6A 4JI6L 4NXML 4B3ML 1YVCA 2AWOA 4BY7H 2UXBQ 1X56A 4DK3C 3KF8B 1YHQA 1TWGH 2EIFA 4OONA 3GTPH 3GDEA 3CMEA 1PA6A 4B3SQ 1N32Q 4GKJQ 2RHQB 2DUDA 3G71A 4B3TL 1RIPA 4A3FG 4J15A 4LF8L 1Y1VG 3VDYA 4A3BG 2VZAA 4YHHQ 4XTCS 2VUMH 1AH9A 1PH8A 1KHIA 1HH2P 4BBRG 3J81j 1VQLA 2NVXH 3ULLA 4LF4L 4JI0Q 3KJOA 4A3FH 1PH9A 4BXXG 1A0IA 1PV4A 2R7ZH 4A3CG 4OO1G 1AE2A 1PYSB 3LGJA 3OYYA 2E2IH 4B3TQ 4JI0L 1PH6A 3WWVA 1W3SA 4X62Q 2YTXA 4X65L 1I3QH 2OWOA 2KCMA 1KRTA 1VQ5A 2RHSB 3GD7A 1BKBA 4MNOA 4YCVA 3CXCA 4GLXA 5IWAL 3KYHC 1SFOH 4JOIC 1X9NA 1GD7A 3TS2A 3CPFA 3CQZH 1TXYA 1HNZQ 5DLQE 4DR4Q 1VQHA 4C3HH 3MEFA 1G291 3H0GG 4JI3L 2I5LX 1MJEA 1KXLA 1WCMH 3M4QA 1J5EL 2NVYH 1V1QA 4GLAC 3UE0A 4JV5Q 4A3LH 3HOWH 4X65Q 4P73A 3PO3G 1EOVA 4IPGA 4OX9L 4GOPC 2JQOA 2D62A 3D31A 4A3DG 2JA9A 3A0JA 4BA1I 2LSSA 5IP9H 1YNXA 5IWAQ 3J81i 4GOPB 1S72A 5GAEC 4B3RQ 4A3GG 3H3VI 4LF7L 4IPDA 4A3IH 2ZJPA 3PO3H 1L1OB 1NE3A 1XTDA 2HIVA 4DNIA 4LUOA 2RF4A 2R7ZG 1VQ4A 4KHZA 2AHOB 1Y1VH 1XNQL 5HGQA 4HIDA 3H0GH 3ULJA 2YTYA 1KD1C 4IFDJ 2XTIA 2LXKA 3W1BA 4DV5L 4QGUA 1GVPA 1G6PA 3T1HL 2HIXA 2PI2A 2BA1A 5M5YH 3I4MG 1A63A 3NBHB 5C0XG 4A3MH 2B29A 1CKMA 4DV5Q 4B3RL 1B8AA 3KF6A 1VQOA 3RZOH 1EIYB 3J81c 1I6HH 4L5QA 4BA2I 1V9PA 4UP7A 4R4QA 3G6EA 1YHBA 5LMUL 1N34Q 2ASBA 3S1NH 4GN3B 2AKWB 2VS1A 3AFQA 4JCVE 4JOIA 1GM5A 1VQIA 2E5LQ 4A93G 5ELNA 1Q1BA 2PI2E 2HT1A 3T1YQ 2E5LL 1TWFH 1XMQL 1EIFA 2KBNA 3M4PA 3I4MH 2ZTCA 2QEXA 3PGZA 4DR3Q 1XMQQ 1K9MC 5C4XG 2Q2IA 3PIPA 4PMWA 1OTCA 4GN4B 1K3RA 4DV6Q 1LUZA 2IHEA 3RLOA 3E9IA 1E22A 4JI7Q 2UXCQ 1LYLA 4HJ8A 3HKZG 1WJJA 1IL2A 2UUCL 4A3GH 1XMOQ 3NEMA 1HNWQ 2PQAB 4LF9Q 4IJLA 4DPGA 4DR6Q 1RL2A 2A19A 4RG1A 3UE1A 5HY6A 2ID0A 5IY0A 1Q81C 2I0QA 4IOAA 1B70B 1VQAA 3PUZA 3L2PA 4GKJL 2WP8J 2FXQA 4HIOA 1K8GA 2B63H 3FKIG 1K8AC 3A5ZB 4DV1L 1IBKQ 2NZOA 3J80i 1VQFA 1QUQA 4JYAL 1E3PA 1HZBA 1BBWA 2WAQG 4DUZQ 2ZM6L 2N78A 1L0WA 1CSPA 1EYGA 3K80C 1E24A 2JA5H 2R6GA 4HJAA 3PUVA 1Q46A 4X66Q 3RNUA 2ZM6Q 4JG2A 1S40A 1O7IA 1YJWA 2NVTH 2B3GA 1XPRA 4X64Q 3TEHB 3JAMi 2OTJA 2IY5B 3HOZH 4HIMA 3RLFA 4LF8Q 2Z0SA 1HZAA 3M7NA 2QGQA 4BY1G 5FLMH 3HOXH 1QVGA 1D7QA 1HR0L 5LMNW 1HNZL 2WFWA 4A3BH 4C3JH 4YCUA 3I2ZA 3GTGH 4OWTB 1H95A 1WYDA 2IX0A 2XGTA 5IYCG 2Q2UA 4ME3A 2F52A 2I5HA 1LTLA 2K75A 1FL0A 3I56A 3HOXG 1VQ6A 3CCQA 1GKHA 1X6OA 3CAMA 3CP0A 4DV3Q 3TS0A 3AEVA 4UP9A 4EQ5A 3GTLH 2ZTEA 4QY7A 1IZ6A 1MIUA 4A3JG 2LXJA 4DV4L 3M9BA 5K36G 3KOJA 4X62L 1I50H 2NZHA 1K83H 4R4IA 4DV0Q 2BH2A 2K5NA 4HJ9A 4JI2Q 4WJ4A 1VQGA 4MZ9A 5C3EH 4DV0L 4A3LG 3IRBA 4JC0A 2MO1A 4KLKA 5E7NA 3JAMc 4A3KG 2JA7H 2YU9H 5IYDG 4A3CH 1CKNB 1NBWA 1J5EQ 1X54A 1XNRQ 1JJGA 1QVCA 4DK6C 3PSIA 4PZ7A 4L5RC 1YHAA 1IBML 5IYBH 4LFCQ 2ZJQA 1C7YA 2UXDQ 3KFUA 1L2FA 3EIVA 4QQBX 1PH3A 4QIWE 2JE6I 4LFCL 3I4OA 1WOCA 4GLVB 3M3YH 1UE1A 1XJVA 3S1RH 3K7UC 4BBSG 4L5TA 1YJNA 1VQ8A 1U5KA 5GROA 2D0PA 2JEAI 3BU2A 2MNAA 3F2DA 3PIOA 1JT8A 1Q12A 3BJUA 5IT9c 3A74A 5C4XH 3J80c 2VW9A 4AYBE 3HOWG 3RN2A 3T1HQ 1W2BA 3I4NG 2K52A 2ZTDA 2E8GA 3HKSA 3AYHB 3KF6B 5GADC 1CKNA 1XPUA 1L1OC 3CMAA 4NXNQ 3CW2C 4LWCA 4NB3A 3RN5A 3UDGA 3T1YL 2HHHL 1HJPA 4BXXH 4JBWA 1E1TA 3KJPA 2QA4A 1N34L 4KHPQ 3OTOL 5AJ3L 3S1QH 2CWAA 2VUMG 2VQEQ 4JBMA 3K8AA 1C0AA 2Y0SE 3FHWA 5C0XJ 1N33L 1Q8KA 3F2BA 1KC8C 2VL6A 1I94Q 2OQKA 1X3GA 4YWLA 2YTVA 3I7FA 3RLNA 1OXVA 3GTJH 3S1MH 3PO2G 1SE8A 1IBLL 4NXMQ 4B3SL 1N32L 4OXPA 4LFAQ 4DKAC 5C44H 3NENA 1SR3A 3TQYA 4X66L 1VQCA 5IYBG 2VQEL 3DM3A 1EQRA 4GN5A 5GQOA 5FLMG 4BY1H 4P71A 4ALPA 4JI7L 2UXCL 2IHFA 1Q1EA 1VS0A 2K5VA 1XMOL 1HNWL 4B3MQ 2JJQA 3BZKA 3HKZE 4L5SA 1NY4A 3UDFA 1Y1WH 2ZJRA 1IBLQ 3CF5A 2N49A 1CSQA 3GTKH 1JMCA 1YITA 1FGUA 3F2CA 1NMFA 2CCZA 3J7A5 3K81C 2V1CC 4C3IH 4IJHA 3HFZB 3UDIA 1IBKL 1GO3E 4UP8A 4OO1I 4YCWA 4A3KH 2JA7G 4YHHL 4OWWB 2RCNA 2KHIA 4JBJA 4HJ7A 4DUZL 2UUAL 2OTLA 1E7ZA 2PQAA 3CD6A 1HZCA 1L1OA 2IX1A 1HR0Q 3PO2H 3F8TA 5JJKA 4DR7L 3GTMH 1VQKA 2IT1A 3GTOH 2F4VQ 1V43A 1Y14B 4UPAA 3B6YA 4GNXA 3PF5A 5LMNQ 5FLXc 2ALYB 2UU9Q 4JI4L 4IFDI 2F4VL 5J3BA 2R92G 3ICEA 4O0AA 2HQLA 1YBYA 5M3FG 3ERSX 5JEAG 4DR4L 2E2JH 3S2DH 5GAHC 3A5UA 4DR7Q 3U58A 3H15A 4YWKA 3TREA 3CC7A 1VQ7A 4GNXC 4GKKQ 4LF7Q 2YV5A 4DUYL 5LMNL 2WB1G 1HR0W 4DV3L 3HOUH 1PHJA 4OX9Q 3EN2A 1XNRL 2Q2TA 2GN5A 2WB1E 3K0XA 4XIGS 5BR8Q 4DUYQ 4LUZA 2Z6KC 4MTNA 4A75A 4TVAB 4JI8L 3CCSA 3K7AH 3L0OA 4A3JH 3I4NH 1UE5A 3CCLA 2A8VA 3KLWA 2YYZA 4GKKL 3MXNB 1KQSA 5JJIA 3J7ZC 4DR5Q 1XNQQ 3H3VH 4LF6Q 1KAWA 1BVSA 5IE8A 4A93H 3KDFB 3FP9A 4TQUS 1E1OA 1UWVA 4JI1L 4Y52H 1KRSA 5H1SE 4A3EG 1XPOA 4LF5Q 3HOUG 1TWAH 4KHPL 3S24A 4OWXB 2R93G 5IYCH 1CKOA 4DAYB 4GOPA 1YIJA 1VQEA 4JI5L 4IO9A 4APVA 4POFA 4DV7L 4LFBL 1IBMQ 4PZ8A 1P16A 3U50C 1OXSC 5GAGC 1R9TH 1N33Q 4QJFA 3PV0A 4LF6L 2CQOA 1A8VA 1I94L 4DAMA 4HIKA 2NN6G 1WFQA 3HOZG 5M5WH 2R92H 3OTOQ 5FJ8H 1VQ9A 5C44G 4UY8C 2VNUD 1P8LA 1YZ6A 4IOCA 3W1GA 1TWCH 2OQ0A 2JEBI 1ASYA 1VCIA 4LFAL 1Z47A 5M5XH 1K0RA 1Q82C 2B63G 2H5XA 1Q7YC 2NVQH 2MQHA 2ATWA 2JA6H 4JI6Q 1PH5A 3PF4A 3GO5A 1Z9FA 1YI2A 3I55A 2VQFQ 3FKIH 1LM0A 1YJ9A 1PH4A 3DLLA 2UUCQ 1NJIC 1PH7A 1I5FA 5AJ3Q 1JJ2A 1SLJA 4LF9L 4DR6L 2K50A 1JJCB 3D0FA 2L15A 3BZCA 4X64L 2BA0A 3U4ZA 1JE5A 2EQSA 2GVBA 2BH8A 1D8LA 3RR5A 1C9OA 1MJCA 2OCEA 1HNXQ 2UXBL 1VQMA 1EFWA 1QZHA 1PYBA 2E2HH 3NELA 3PCOB 3L7ZC 4R4OA 3CCVA 4JBKA 5M3MG 5IP7G 1HNXL 2C35B 3Q8DA 1IYJB 4JYAQ 4AH6A 3HOYH 1VQJA 1MKHA 3TRZA 1X3FA 1FVIA 4A3DH 2Z6KA 2JA8H 3HOVG 4DV1Q 4A4IA 2UUAQ 3CCRA 4AYBG 1G51A 1WI5A 3EBEA 1PH1A 4RMFA 3S17H 1OXUA 4A3EH 2JA8G 2K14A 3E9HA 4QL5A 3HOVH 1YEZA 4DV4Q 2JA5G 3CCUA 4JV5L 3STBC 2DGYA 4A76A 1TWHH 4R4CA 1N9WA 1QVFA 1QUQB 2EXDA 3E0EA 3S14H 1NMGA 4FDBA 3JC66 1EWIA 3RZDH 3F1ZA 4IFDG 3CCJA 2ES2A 4JI2L 1OXXK 1X3EA 1A62A 4JI3Q 4LF4Q 3S2HH 2N8NA 3ER0A 3W5OA 4P74A 4DR2Q 1AE3A 1HZ9A 2I5MX 4C2MH 5FJ8G 4DR1L 4AQYL 1KL9A 4NPSA 2UU9L 2PNHA 5JJLA 3ULPA 4P72A 4JI8Q 4DR1Q 4AQYQ 4IPHA 5IP7H 5EAYA 5M3MH 4A3IG 1M1KC 5IYDH 1N36Q 5BR8L 1SROA 2NN6I 4LUVA 1JB7A 2GVAA 1T9HA 2CFMA 4H02A 1N36L 2A1AA 3CC2A 1EQQA 4JI4Q 2R93H 2PMZE 4DR2L 4POGA 4BBRH 4LF5L 2UUBL 1FJGL 4K0KL 3S16H 2AMCB 5LMUQ 2Y0SG 3GTQH 2D0OA 3CC4A 1PFSA 3M4OH 2UUBQ 1FJGQ 4K0KQ 4R4TA 1X65A 5M3FH 2CKZB 3UDXA 1OXTA 2K5HA 5C4JH 1PH2A 2UXDL 1M90C
chains in the Genus database with same CATH superfamily
4YWMA 4PG3A 2XGPA 4GNXB 2HHHQ 1X55A 4EEYA 1VQPA 4Y7NH 5I9PA 1NR4A 2EJMA 5JPNC 3KTMA 3ETHA 1XDNA 1GHKA 5FPOA 2JEIA 1BNZA 3R8BA 2NZ1D 1C8CA 4DV2L 1DV2A 3GP7A 5ELBA 5KFKA 2R92A 2R7FA 4X3UA 2K4KA 4DV4H 1ESFA 1B4OA 3BS1A 1KIXA 3AFPA 1VMCA 3HOVB 4A3BB 4FBTA 5KEEA 5IIFA 4YY3Q 1KJQA 1BBUA 3G4SA 1R4PB 1NTGA 5KFBA 1G91A 4O4HF 3TQTA 3M85A 1ML0D 2HGSA 2YS7A 3RB0A 2KEEA 1Q86C 2VQFL 4ODGA 4X6AH 1K73C 1KJJA 3EQLC 2KCTA 4WJ3M 3PR5B 2JK8A 5IGFA 4NXNL 4O2DA 1F77A 1N8RC 5C1PA 4H13C 3STBD 4Y7NB 4RNOA 3VR3A 2W7PA 2RKSA 3FEWX 3PW7A 5BN4A 2NYZD 3K5NA 2NU9B 2DPIA 1LT4D 1JCKB 4KTAA 2E74C 4DK3C 2K28A 1YHQA 1CK1A 3GTPH 2AUJD 3H40A 2FHTA 3CMEA 5NUCA 4YR3A 2KSWA 5DG8A 4GC7A 1PA6A 3RZOB 4B3SQ 5KFSA 2RHQB 3G71A 4B3TL 3L4KA 3BQ0A 4A3FG 2PQEA 1Y1VG 4RH6A 4JI8H 2LS01 1KHIA 1HH2P 5CAEB 4LJZC 4DL3A 2JN4A 4A3FH 1PH9A 1MZBA 1A0IA 1M4VA 4EG0A 4OO1G 3HZXA 3OYYA 4YR2A 4HNVA 1SNCA 4JI0L 2W6PA 5BMVF 1YNNC 1BNCA 5KT4A 4R8NA 2OWOA 2KCMA 4NKLA 3X3MA 5IGDA 2O5IC 2JA6B 3GV5B 4O3PA 1BKBA 3CXCA 3N6XA 4YCVA 1Z2OX 3KYHC 3C2PA 4J9PA 3GTPB 3MR2A 1QE6A 4RAUC 3T56B 1GUSA 1QB5D 4KN4C 4RB2C 2PMZA 4FBUA 1G291 2B2YC 4Q0FA 1VDZA 4JV5Q 4RA8A 4F88A 3HOWH 4X65Q 4P73A 4IPGA 4DR7H 3D31A 1UAPA 4TQRA 2B2TC 4ED0A 4K6LA 3H3VI 2DZDA 4Q8EA 4A3IH 1KDAA 1NE3A 1AFPA 2HIVA 5KFVA 2R7ZG 1VQ4A 2DNEA 4KK7A 4RWSC 1KD1C 4JV2A 2XTIA 3FMAA 2LXKA 1IOVA 2FMAA 2C9OA 1ICWA 3M7GA 1VBGA 1LT6D 3MAQA 1E2WA 5CV4A 3NBHB 1XNQH 2B29A 4B3RL 2XRQD 3J81c 4BBSB 1V9PA 2AQ3B 2F0IA 2ASBA 3S1NH 4GN3B 2AKWB 4N8X1 4M1UB 1GUOA 1BCPB 3KF8A 4JOIA 4A93G 1Y8OB 4DA2A 1RK6A 3N8DA 2HT1A 1ESRA 2AU0A 5DG9A 1WD0A 3MVVA 4B9XA 3NSWA 4ZI7F 4CDEC 4O3SA 1K9MC 5C4XG 2DIKA 4LH7A 2XWJB 2EYPA 5DAUA 3U9SA 3PIPA 4DV6Q 3BJYA 1LUZA 2IHEA 5JUMA 2F0EA 2I8CA 3RLOA 3TP8A 1Q90A 2SEBD 3GTGB 4MV6A 2FLLA 1RCVD 1WJJA 2UUCL 1IL2A 1XMOQ 3Q8PB 1N34H 2PQAB 1HUMA 4WD3A 4X3KA 4DR6Q 4IJLA 1KEEA 5IGEA 1XXGA 1ZHQA 3GTOA 1Q81C 3TP5A 5M3MB 3S1NB 3KALA 1G6ZA 2WE6A 2IP4A 1K8GA 1K8AC 1T36A 2QDBA 3S17B 2FJ2A 2NZOA 3NWSA 1SMYC 4L1KA 4LF8H 4DFAA 4I7AA 4JYAL 2N78A 1L0WA 1EY6A 3S15B 2RDFA 3KLRA 5LP6F 1EY5A 1AUXA 2ZM6Q 3E5NA 3GTMA 4JG2A 3SK4A 1F2LA 3GQBA 2TMPA 2EYOA 5JQWA 4HIMA 3T53B 3N52A 1CFMA 3H0GB 1JE4A 1D7QA 5LMNW 4A3BH 3WOEA 4IUUA 4C3JH 4YCUA 3I2ZA 4K2KA 4IWXA 1WTXA 5IYCG 2F52A 2NVQB 3TBIB 1GKHA 2WV6D 3M9NB 2HD3A 1S68A 1DM0B 3TS0A 3AEVA 1K8OA 4EQ5A 3GTLH 1GYFA 1IZ6A 2XD4A 4MTKA 2RCFA 5I2XA 2QK4A 2QYZA 2V59A 1WTHA 3M9BA 3KOJA 4YY3H 2E2IB 1I50H 1SSOA 1V51A 2NZHA 2M05A 3CRKC 3V6KA 1OWTA 4HEDA 4JI2Q 1FYCA 2NTSA 4MZ9A 3LWEA 4DV0L 4A3LG 2QF7A 3IG0A 5IOCA 1E4EA 4A3KG 2F3WA 2YU9H 5IYDG 5C0XH 3EROA 1CKNB 3IN5A 1NR2A 1X54A 2EZVA 5HBRB 4Q45A 4IUVA 3PSIA 4PZ7A 4L5RC 3F8NA 1YHAA 4LFCQ 2F0KA 1RTNA 3C3LA 2BDOA 2JA8B 4QIWE 5D3DA 1U4PA 3QWNA 2JA6A 1XJVA 2ZDQA 1B3AA 2YL2A 1EQTA 1YJNA 1VQ8A 1WTVA 1U5KA 4JK1C 2MNAA 3OUUA 1N36H 4Q5VA 4ILWA 4XT3B 1JT8A 1CI3M 3GIQA 4J9KA 2VUMA 2VW9A 1I3QA 3AYHB 4L6TB 2J9GA 3DUZA 4BXXH 2C5CA 1E1TA 4JBWA 5FO7B 3KHRA 1CE8A 1AN8A 3OTOL 1CS0A 2CWAA 4K5VA 2VUMG 4DAYA 1T94A 5KFDA 4JBMA 1N33L 5L1LA 3F2BA 2VL6A 3OPOA 1X3GA 4YWLA 5M5XB 3RLNA 1O7LA 3R5FA 1ZXTA 3GTJH 2MHVA 1SE8A 3MEHA 3PO2G 1IBLL 3HKZA 3JSLA 3V4ZA 1GGOA 2B2UA 4OXPA 4LFAQ 1TS5A 5C44H 2F0QA 1HCZA 4X66L 1VQCA 1EQRA 2EJFC 4GN5A 5CC4A 2W8LA 2UXCL 1DD2A 1BBXC 4YQWA 2IHFA 2XIGA 1VS0A 2K5VA 4B3MQ 2FFKB 3RBEA 2NWGA 4L5SA 3RUPA 3Q23A 5FOBB 3UDFA 1PFBA 5L37A 2ZJRA 1WTOA 2X0SA 3GTKH 3O13A 1PTOH 5KFWA 1NMFA 3A54A 2FPPB 5LL6S 3J7A5 1SAPA 2NU7B 3K81C 3SK8A 4C3IH 1GUTA 3HFZB 3UDIA 4FF3A 4YAKB 2XVSA 1GO3E 2YS6A 4UP8A 1S0MA 3SEBA 2V9WA 2KHIA 4JBJA 4DUZL 4LF7H 1E7ZA 3H3VC 4C3JB 1L1OA 4I65A 1CHPD 5JJKA 3GTMH 3K5MA 2C2RA 2F4VQ 3Q8SB 4GNXA 4HCSA 3H94A 2K05A 5LXTF 2UU9Q 2ASDA 4JI4L 4ZLTF 3AMUA 5F9LA 2XCLA 2QW7A 2Z6BA 3MWMA 4QUCA 1JKJB 1H9RA 1YBYA 3NQTA 3ERSX 2E2JH 2F1MA 5GAHC 3A5UA 3H15A 4FF2A 4YWKA 2RSNA 1WTWA 1KNAA 4DUYL 4DV3L 4ZUJA 2IW3A 4OX9Q 4ETSA 5J39A 1ULZA 2GN5A 2ASLA 4DUYQ 4ECYA 1VF7A 4MTNA 3M4OB 4JPBW 1UE5A 3KLWA 4GKKL 1KQSA 1EWCA 3J7ZC 3J7YW 4RFBA 1XNQQ 2CQAA 5IE8A 2VOBA 2CH4A 1SYFA 4TQUS 5C4HA 4J8QA 1VF5C 5C3EB 2JA7A 5KNCA 2KQ3A 4OWXB 2R93G 4DAYB 2A5HA 1H9KA 4JI5L 4APVA 4POFA 4DV7L 4NXMH 3ONAB 4JI6H 3I90A 5EOYA 1OXSC 1R9TH 1PTOC 4A3GB 3QO2A 3NK9A 3R23A 1KC7A 1KDCA 3PV0A 5E4XA 1RHPA 1A8VA 1EUDB 1TU2B 5M5WH 2F0JA 5KFEA 4YP3A 3WO0A 1CA5A 3MFYA 1ASYA 2F4VH 4ME5A 4LFAL 4FF4A 2FLPA 1HHVA 1I4HA 2NVQH 2CW8A 4DV6H 2MQHA 4JI6Q 3PF4A 1AW7A 2C28A 2V4DA 4C5BA 2IL8A 2HDMA 1Z6HA 3FKIH 3K5OA 2K01A 4DL5A 4XQNA 4A3FB 1VBHA 2QKIC 3RZDB 4IRCA 1I5FA 4C3IG 1CTMA 4LF9L 2NVTB 3OSNA 3U9TA 3DF7A 1H9SB 3BZCA 4IAJA 1L0XB 4P2CB 4DR3H 1MJCA 3VR4A 1EYZA 4PQXA 4I50F 3KXYT 2NUAB 3NELA 3PCOB 4R4OA 4JBKA 2XN9C 5KG1A 3HOYH 4HSVA 4A3DH 2XCPA 4KHVA 4RZRA 2JA8H 2UXCH 3A8IE 2VA3A 1R4QB 1VMPA 3SE7A 2G9DA 4K0KH 1G51A 3QFFA 1WI5A 1TWGA 3T5KA 3J81E 4RMFA 3S17H 4B3SH 4DR2H 3SK6A 2KUMA 2EY5A 1OXUA 4A3EH 3HOVH 2K14A 4DV4Q 3CCUA 3GV3A 4F4WA 4R4CA 5DEHA 5DGAA 1ILQA 1NMGA 2A73B 1EU4A 1NSNS 4DNRB 3A8KE 2ES2A 1X3EA 2UU9H 3S2DB 3PIP3 1AE3A 4C2MH 2I5MX 1I3QB 4KKUA 5FJ8G 4I7HA 1PRTC 4BWGB 3KK7A 1Y69U 2UU9L 1S0NA 2PNHA 5JJLA 1IKMA 2R61A 2L9HA 3E5SA 5EAYA 1TVXA 1M1KC 5IYDH 4IRKA 2J6UA 1JORA 1S10A 4B08A 4A3KB 1PDQA 4WRDA 1JDBB 2GVAA 2CFMA 4H02A 4A2AA 5EWFA 1TY0A 3MFIA 2B8GA 1LTTD 4E6IA 5CYUA 3GTLB 1SYXB 2VB3X 1I4QA 2R7LA 4TKOB 3MZ5A 4LFCH 3M4OH 5D3IB 3URYA 3EVQA 4WJWA 1RYRA 3WO1A 2UXDL 3PUWA 4NDXA 1RJQA 3N6RA 4DR3L 1EZ6A 2RDGA 3OW2A 4QCLA 1WR2A 3BG5A 1VQDA 2I80A 3VPDA 1QZGA 2VY3A 2FKLA 2EPBA 2WAQA 4AYBB 4DR5L 1J6QA 4DV7Q 1RTOA 4LNQA 1B6RA 3GV8B 5CV8A 1UE6A 1C48A 5I6WA 5JVDF 2EYLA 2C2DA 1DCZA 4O2AF 3AB9A 1SMXA 5KFAA 3FKIB 2KHJA 1S3OA 1SYGA 2Q2HA 2CWPA 3GTMB 3G48A 2R3ZA 1UUPA 1ASZA 1VQNA 1B7YB 1EWHA 4I55F 5F9NA 5DGBA 1TA8A 1PYWD 2F3IA 2QDLA 3PVXA 1DGSA 5CMDA 4ECRA 3H0GA 2YRWA 2W6MA 3FVQA 2V4RA 3N40P 5CGKA 5ELDA 5LOVF 5IGCA 2E2JB 2VB2X 3H4DA 2PO4A 2N3SA 2FK1A 4OELB 4PZ6A 4IFDH 3RV4A 3X3NA 2AWOA 2UXBQ 1Q8IA 1X56A 4JI5H 3RB6A 1NUCA 1PXUA 2FLNA 1TWGH 2EIFA 3DWPA 1X32A 3GDEA 1X3QA 1F2MA 1M0WA 1L0YB 3EFXD 3RAQA 3K5HA 4C1NK 4LF8L 4TV9F 3T51B 2W70A 2VZAA 4XTCS 2PMZB 1MD2D 2VUMH 3SVMA 3C1FA 3OUZA 1I4GA 4LF4L 2VA2A 4BXXG 3V6HA 3N41B 1AE2A 3LGJA 2NVYA 2UVVA 3VYTA 4C2MB 1QCBD 2IWHA 4X65L 3G6VA 1VQ5A 4UCTA 3GD7A 4XYLB 1TWGB 4JVZA 1X9NA 4F4XA 1SYCA 1UNSA 3T13A 1F9QA 4DR4Q 1VQHA 4JI4H 3MEFA 1SDFA 1KXLA 1WCMH 1J5EL 1PRTF 1JC7A 3UE0A 4Q8FA 2R87A 2EYHA 1TR5A 3T5HA 4HAEA 1XMQH 4RHRA 5IT9L 2A6EC 2WDTA 4OX9L 3I12A 3BQ1A 4A3DG 2XGQA 2F0PA 1S03G 2LSSA 5IWAQ 2NU6B 2B39A 1U4MA 3NBIA 4EGVA 4DAVA 2NVYB 4C5CA 2ZJPA 2PNRC 1XTDA 4YHHH 1GXDC 1SNQA 2AHOB 2PPBC 1XNQL 5HGQA 4IUQA 2YTYA 3W1BA 3ERQA 4DV5L 4O4LF 1GVPA 2YYAA 5K2MA 3T1HL 2HIXA 2PI2A 3I4MG 3FDSA 1Z2PX 4A3MH 3HBLA 3MJFA 1CKMA 4L5QA 5IT9W 1N34Q 4UP7A 4R4QA 3G6EA 1XMOH 5LMUL 4KN7C 2JSOA 3AFQA 1GM5A 2E5LQ 1E4GT 1K8MA 2R7KA 3UFXB 4ECXA 4RHSA 2VPSA 4X66H 3T1YQ 4G4KA 3TMEA 1J5EH 2W7OA 3PGZA 4C5AA 2Q2IA 3L4JA 4QWAA 4GN4B 4NP5A 1DZ1A 2AQ1B 4YBZB 3OIQA 1WH2A 4QWEA 4AYBA 1CZWA 3V96A 4L63B 2JA7B 4IUPA 1K0SA 4A3GH 5KFNA 4G7OC 1STEA 4MHEA 4LF9Q 4DK1A 3UE1A 2F0GA 5HY6A 2ID0A 2I0QA 3VYUA 4IOAA 1VQAA 4KY7A 4LF4H 5JVH3 2FXQA 2K32A 2D2CC 2LKVA 2Z1CA 2Z9HA 2EVBA 1KNEA 2WKCA 2BDNA 1A9XA 4KKSA 1QUQA 1ET6A 1E3PA 1DONA 4EBEA 2FINB 4ED3A 1I7LA 4HJAA 3GV7B 3PUVA 1TWAB 2V4QA 3S9WA 2ALZA 4WFN3 4DNTB 2MP1A 2DY8A 1ZETA 1WD1A 3GTKA 1T5XD 1YJWA 1U4RA 2B3GA 1XPRA 2NVTH 1SEIA 1UC8A 3RTXA 3HOZH 4LSXA 4LF8Q 4K6DA 2QGQA 5FLMH 2KJXA 3HOXH 1QVGA 1BCPC 2CW0C 4RCOA 2RA4A 3BYTB 1HR0L 3GTPA 4WORA 3S16B 4Q43A 4RB1A 4RUCA 3M3YB 4OWTB 4PWQA 5FLXE 2L55A 1LTLA 1FL0A 4TRDA 1VQ6A 2VQFH 3CCQA 3CAMA 1I50B 1AP0A 1HXYD 5KFHA 2NU8B 4QY7A 3GIKA 1O7ZA 1MIUA 4F4YA 3JSNA 2LXJA 1S5BD 3EJIA 4DV4L 3R5HA 3RF2A 4MA5A 4OEMB 3LNNA 1FNWA 1AEXA 1B04A 5KFLA 3I72A 1D5MC 2W9BB 2MO1A 2EY2A 2IA6A 5E7NA 3VYRA 1BO0A 5M5YB 1BXRA 4MA0A 4J0MA 2JA5A 2ZXOA 1XNRQ 1JJGA 2SCUB 1TS2A 1PX2A 3GV6A 1IBML 5IYBH 3S1MB 4WBNF 1C7YA 2PBZA 1U9RA 2IBKA 4DXGA 3EIVA 4XDXA 4O4IF 2KCNA 2K5QA 3I4OA 1WOCA 1Y8NB 3NXWA 1NCVA 4LFCL 1A3UA 1ET9A 2B2WA 1W6JA 5KIXA 1HUNA 1IYVA 4RKBA 2C00A 4L5TA 4LF5H 3H6MA 5KG3A 1QOHA 1PMRA 4YIJA 4CDDC 3PW0A 2JEJA 3BU2A 5I9OA 2FJZA 3F2DA 1RD9D 5CB4F 2R7MA 5CA0F 5DQGA 5IT9c 1RK5A 1WSCA 5C4XH 4EFEA 2F0DA 5GONF 1RJTA 3M4IA 4LAAA 2YU9A 1EY8A 2K52A 2ZTDA 2E8GA 5GADC 3KF6B 5I2YA 4FM9A 4ME6A 3IAYA 3CW2C 4LWCA 3SDZA 3T1YL 2HHHL 1F2YA 3L3OC 4KHPQ 2ATLA 5AJ3L 3A55A 3S1QH 1KLGD 2K7VA 5DQHA 3EPGA 3K8AA 5A35A 3FHWA 3QJYA 3NHHA 1Q8KA 5KGUA 1I94Q 2E2HB 2GPWA 4RGNA 2YTVA 5CBAE 1OXVA 4FXGC 4R7RA 3MWYW 5BN3A 4HQ6A 1JXLA 2J6SA 1C3OA 2F0SA 1N32L 2H1EA 5KT3A 4ZK9B 2RSOA 1SR3A 2RVLA 1EU3A 1STYA 5KFTA 1PLFA 2VQEL 1A15A 5FLMG 2ZDHA 2IJ0A 5KG0A 4RNNA 1XMOL 1HNXH 2JJQA 4CC5A 3K6OA 1Y1WH 3K59A 3CF5A 5C5LA 2WB1B 1YITA 3T1HH 2F0NA 1SNPA 4DV5H 3TP7A 3HKZB 2EJGC 4K8JA 2MUYA 4A3KH 4YHHL 4J9MA 3Q8RB 3MXGA 2R8GA 4IR9A 1HR0Q 4DN4M 4EVOA 3R2IA 3Q2OA 4DR7L 1SFOA 4UFZA 1VQKA 3RB3A 2C22A 3J81W 3GTOH 1Y14B 4UPAA 1WTRA 4ECZA 3S2HB 5LMNQ 5FLXc 2ALYB 2EYJA 1XYIA 3D4DA 2EOTA 2F4VL 4O3RA 2R92G 4UCVA 2W9CB 3ICEA 5C6AA 3K0YA 5DM73 5M3FG 4MV4A 1I94H 2HVRA 1V8QA 5C1OA 4B9WA 2NVXA 4JUZA 4ZUIA 3I70A 1VQ7A 4DAPA 1SJHD 4ECQA 1HR0W 1QNKA 2BCOA 2KVMA 2WB1G 3HOUH 4GZYC 1TWCA 4JI0H 2BE5D 5G3LD 2ZDGA 3T5JA 5BR8Q 4LUZA 2XNAC 2Z6KC 2ICIA 4DF7A 5KG2A 1EZ8A 2E2DC 2LY7A 2F3VA 3BDCA 3DWQA 4JI8L 3J81L 3CCSA 4A3JH 1G2TA 3CCLA 2A8VA 1DYQA 3GTOB 1KAWA 4EYHB 1BVSA 4B3TH 2G5DA 3FPPA 3KDFB 1E4EB 1TAEA 4DL6A 1E1OA 3RV3A 1Q3LA 1ONLA 4Y52H 5H1SE 5KFUA 1XPOA 4LF5Q 2VR1A 1TWAH 4KHPL 4MTDA 1ILPA 2Q8TA 1CKOA 2DN8A 1YIJA 1KJ8A 1VQEA 3EA6A 2W6NA 4LFBL 4V0BA 3RIZA 4DV3H 2E2IA 4KMUC 1D1IA 1E4FT 3U50C 1KBLA 1N33Q 4QJFA 4J9LA 4ZKBB 4LF6L 4XZ3B 1PTOB 3MR3A 1E2ZA 1WFQA 3OTOQ 5FJ8H 1VQ9A 5C44G 3H91A 3IFDA 3W1GA 2OQ0A 2MJ8A 2B63G 3NUCA 1Q82C 5J22A 2ATWA 2AQ2B 1E0BA 1PH5A 4BBRB 4HR7B 4FS2A 1ZEQX 5KG6A 1YI2A 3NGDA 4DU9A 3BDLA 3I55A 5DLFA 1KTKA 3I4NB 1LM0A 3S14B 2K04A 2UUAH 1NJIC 1PH7A 5KYLA 4DUZH 3MXNA 1JJ2A 1K83B 1EOTA 3Q1KA 1SLJA 3OMCA 2K50A 4DR5H 2DPJA 1DOLA 1JJCB 1QJOA 4RGOS 1IBKH 2GA4B 3OSOA 4X64L 2EQSA 2BH8A 1D8LA 3WDNA 1HNXQ 1M7JA 1EFWA 4Q0YA 2UXDH 1I6HB 3NTHA 2C35B 1HNXL 1IYJB 1WCMB 2PZUA 4J1MA 2R93A 1LTRD 4MV1A 1G8ZD 4A4IA 5C4XB 3PR4A 2V58A 1K1QA 1BCPF 3CCRA 2UUBH 5KKNB 1FJGH 1HFGA 3T4AC 3D6WA 4G57A 1II3A 3N44B 3E9HA 4QL5A 1W96A 1YEZA 4IR1A 2JA5G 4ED7A 4JV5L 4N9TA 3BA8A 1TWHH 1IOWA 5T14A 3TINA 5D65A 2NVXB 1QUQB 2EXDA 1O7YA 1GLVA 1EWIA 1Y8PB 3NTIA 4S3SA 4IFDG 3CCJA 2VQDA 3S2HH 4C3JG 3BQ2A 4HMIA 2WTFA 3ER0A 4DR2Q 5LA6F 3ULPA 4IZ8A 4JI8Q 4G7HC 4O3QA 4IPHA 5IP7H 5M3MH 1STGA 4F87A 1STHA 1JX4A 4KD4A 3QOJA 1LTSD 1TY2A 4LUVA 2NN6I 3BVGA 1PK8A 1F9PA 3TZUA 2CW7A 2R93H 4JI4Q 3CC2A 1EQQA 3NBHA 2O5JC 3P1HA 4POGA 3HS0C 4DL4A 5HGTA 4LF5L 2K5DA 2R6FA 4RB0A 5KT5A 5G3LF 4FXKC 1Y1WB 4EGQA 3GTQH 2D0OA 1PFSA 1FNVA 4DL2A 1X65A 4IURA 1TIID 1IBMH 3I4MB 3ZYYX 3HEJA 2K5HA 4JV0A 5C4JH 3RUZA 2WINB 1EUCB 5CV6A 2MFIA 2Z8LA 3DM1A 1S5ED 1A2UA 4JI5Q 2UXBH 4GC6A 1MGSA 4FVMA 5C3EG 1EY0A 3PUXA 1PVOA 4RKLA 2JA6G 3GIMA 5ELOA 1Y1WG 4DV0H 4C3HG 5KFGA 3GTGA 3ND8A 1JWUD 1SRUA 5K5PA 3GIIA 4U7CA 2NB0A 3SXHA 3AQQA 1UEAB 4P75A 4R1JA 4BBSH 4LFBQ 4X62H 2Z4HA 4UHVA 5IT9E 4A3DB 3R5XA 4EQPA 4HJ5A 2ZXPA 1WCMG 3K57A 4GS3A 4HSPA 3HP3A 2VPQA 2HJWA 1V1OA 3CPWA 1NNXA 4QIWB 2AWNA 5IP9G 4DV2Q 5ISRA 1SN8A 3MXUA 3I3CA 1V4YA 4F50A 4N9PA 1UEBA 4BY7G 5KFZA 1OO9B 4ED8A 2I07B 4IPCA 2DNCA 2YU9B 4EX5A 4IALA 4LF6H 1UE7A 5JH7F 4NXML 4B3ML 3VYSA 1MSGA 2G9HD 3QOLA 3KF8B 5CORA 1HPCA 1YNND 1SFOB 3RGXA 4OONA 2AGOA 3DEOA 3I73A 3QZ8A 1KAAA 1STNA 1PRTB 4DXFA 1ZYRC 1RIPA 4J15A 2RGVA 1AN7A 1BDOA 3VDYA 2R85A 2EYFA 4ED6A 1T5EA 1M0TA 3IL8A 1VQLA 5T1GA 2W57A 1BUVT 2NVXH 3ULLA 3MA2B 3KAJA 3KJOA 3V6JA 2R7ZH 1EFID 1PZID 3UI2A 3CHBD 4XXEA 1WCMA 2HQEA 4B3TQ 1JOKA 2PCFB 4X62Q 2YTXA 1JICA 3GIDA 1H9MA 2FP4B 4C56C 2RHSB 5KFPA 3RB4A 4L8JA 2OF1A 4MNOA 4G7ZC 4FU0A 4GLXA 5IWAL 1SFOH 4JOIC 2KECA 1GD7A 2OXPA 4R8IA 3J7AK 4JI3L 3H0GG 1AUVA 1MJEA 2I5LX 2NVYH 1V1QA 4A3EB 3K3VA 3PO3G 5C44B 1EOVA 4GOPC 2JQOA 2BQ3A 2J0TD 1SXTA 1Z7TA 2JA9A 5EBCA 4BA1I 1KJIA 5IP9H 3J81i 2AUKA 2AGPA 1S72A 1IHZA 3NE5B 5GAEC 4B3RQ 3Q22A 4LF7L 3HXLA 4IPDA 1KLUD 4DNIA 2FPIB 2JXMB 2OEOA 4KHZA 1Y1VH 4RU9A 3S1QB 3DMUA 4HIDA 2RQXA 4IFDJ 2FK2A 2HVSA 4QGUA 3BDOA 1G6PA 4EQOA 4U68A 4E4TA 5COYA 3E3XA 5C0XG 2YRXA 4DV5Q 3IKJA 1VQOA 2PN1A 4X3SA 1I6HH 3BVZA 3AU7A 4UCRA 1A63A 4UCSA 4LSAA 4EBDA 5JAVA 2VS1A 5L1JA 1VQIA 1M6VA 2R86A 2VQEH 2AQ4A 4OX9H 3W3AA 2E5LL 1TWFH 4MAMA 1EIFA 2F0WA 2KBNA 3M4PA 2M2LA 4RZQA 2QEXA 1CHQD 3HG9A 4DR3Q 1VKZA 1PFNA 3I4LA 4PMWA 1OTCA 4J9NA 1K3RA 5EQ0A 1N33H 2R92B 2DY7A 5IYZF 2C2EA 3E9IA 5C5MA 4JI7Q 1LYLA 4HJ8A 2L4NA 1HNWQ 5DLGA 3TDQA 2HHHH 3RJ0A 2FMMA 4MV3A 4DLKA 2FB9A 5IY0A 2VUGA 1B70B 3L2PA 3PUZA 3OHBA 2WP8J 1JWMD 4HIOA 4J9SA 2B63H 4HMJA 1CA6A 3A5ZB 4DV1L 1IBKQ 1VAJA 4DGZA 3KBXA 2E76C 3H09A 1VQFA 1HZBA 1QG7A 1BBWA 2WAQG 4DUZQ 3DWAA 1EYGA 2JA5H 1CSPA 3R2TA 3HOZB 5K36H 1A3TA 2R6GA 3BZDB 1JOOA 1MI2A 3GILA 1Q46A 3RNUA 5A2QW 2H4OA 1S40A 2YW2A 3D6CA 1WVLA 4X64Q 2OTJA 3WNZA 4B3MH 4ECUA 4NLGA 1LTID 3FMCA 2MPMA 1SE2A 5KFMA 3HRZC 3PW4A 5ELCA 5KFFA 2WFWA 1SJED 2W8KA 3RAXA 3GTGH 1SMYD 5C3XA 2P0AA 4EYIB 2I5HA 2KEDA 3I56A 5DQIA 3K5LA 1X6OA 2SDFA 3BVMA 3CP0A 2I87A 4DV3Q 4O2BF 4UP9A 4FF1A 3VR6A 4EEQA 3G6JB 4A3JG 1M8AA 3NTKA 5K36G 2Y0SB 4ED2A 2PYKA 2OH2A 4HNUA 3FRPB 4R4IA 2BH2A 1LTBD 4WJ4A 1VQGA 3OHAA 4QIWA 5H80A 3IRBA 4ECSA 4KLKA 2JA7H 2A69D 1J5EQ 1BR9A 1QVCA 1GSAA 4DK6C 4FYDA 1CZGA 1EY4A 2F0VA 4UAIA 2ZJQA 2UXDQ 3KFUA 3TIIA 1AZPA 1EIHA 3QG1A 2JE6I 3CRLC 4CKCA 4GLVB 4TUYF 5EWEA 1D2BA 3K7UC 4BBSG 3LP8A 5D1OA 3RFCA 4J6HA 4ZQIA 3M4YA 1Q12A 3BJUA 4CBVA 3CVZA 3J80c 2HVQA 4PV1C 4OIKA 1XX8A 4AYBE 3HOWG 4K5WA 3RN2A 1W2BA 2F0TA 4CJ2C 2NTTA 2QILA 5KNDA 3HKSA 1CKNA 1L1OC 3CMAA 1S5CD 2W6QA 4NB3A 4YJ3F 1C30A 5LL6b 1FGBD 4DR1H 4AQYH 3PW2A 5DG7A 4KJOA 2UUCH 1TWAA 4IZOA 2WIIB 4MV8A 1H9JA 5ELEA 3TSSA 2B2TA 2SOBA 4JI2H 2VQEQ 1FNUA 1B44D 5C0XJ 2W9BA 1KC8C 5IGBA 2EDGA 4LK1C 2OQKA 3D4RA 4OO1H 1CQIB 4MN3A 2CVRA 1B1ZA 4B3SL 3NENA 3TQYA 3PO2B 1B53A 2CW0D 2WAQB 3DM3A 1B33N 4ULLA 1W93A 2B63B 4QWBA 4P71A 5I4DA 4I4TF 5HURA 4ALPA 3H4BA 2L0CA 2WACA 1EYCA 4XQQA 5KX5F 1BJTA 3HKZE 1NY4A 2VUMB 2XC9A 2RDHA 5F2DA 1IBLQ 4B3RH 1JLLB 2ZJTA 4BY1B 3TZDA 3F2CA 2B8FA 4X64H 5DNFA 1IW7C 1RKNA 1V1PA 2B2VA 2N55A 2PZTA 4OO1I 4DR6H 1DOMA 1D5ZC 4OWWB 5L9XA 1LTAD 4HJ7A 1CM9A 2UUAL 2OTLA 2PQAA 2EYMA 3PO2H 2IX1A 3E0JA 5KT7A 1IYUA 2L1BA 1V43A 2F4IA 3M9MB 2CHBD 1D5XC 4ED1A 4IRDA 4JI3H 4PDBA 1GUWA 2ENBA 4IFDI 1K1SA 1LACA 5C5JA 4LFAH 5J3BA 4M9UA 5KT2A 2K03A 3S2DH 4ZKCB 5EJWA 3U58A 3TREA 5KRUA 3CC7A 4GKKQ 4XYOA 4GNXC 4A3JB 1B3QA 4DV7H 1PHJA 3MR6A 4NMZA 3BABA 3VMMA 3EN2A 2WB1E 3K0XA 4XIGS 1ENAA 3Q6SA 4IN3A 3A56A 1PTOF 1MBYA 5IODA 4NW2A 4JI1H 1EYAA 2XSCA 2ZT9C 3L0OA 1LTGD 2YYZA 3QB3A 4GKKH 3J80L 2DLNA 4LF6Q 3PIO3 4A93H 3MFHA 5KG7A 3IFTA 2FPGB 1KRSA 1N48A 4A3EG 4QWDA 1XNRH 5D14A 4MTEA 4IO9A 4LMQD 4LH6A 1S4ZA 4PZ8A 1SNDA 2CQOA 1I94L 1U4LA 3HOZG 4EFBA 2NN6G 5KFCA 1IKLA 4OHJA 4UY8C 2VNUD 1P8LA 1YZ6A 2QEJC 3GTLA 2JEBI 3MWDA 1VCIA 1Z47A 5M5XH 1K0RA 5BPFA 2H5XA 1O80A 3RBDA 2QCPX 4ID6A 4OGQC 1Y1WA 3CQZA 2F0FA 4KY5A 2VQFQ 4CDFC 4KD3A 2UVWA 2GPSA 5LL6X 2Q8RE 1YJ9A 1ZQ7A 1I6VC 4KJNA 4PMCA 2JEFA 4O1NA 2K5WA 2Q8IB 1KABA 1A3VA 3L9AX 1CQJB 3D0FA 3R3OA 2O03A 3VA7A 2BA0A 1GSOA 3U4ZA 1JE5A 4H0LC 2GVBA 1L2ZA 3A7LA 4RAZA 3JAME 2UXBL 1QZHA 1PYBA 4BS9A 2E2HH 4HR7A 3CCVA 3K7AB 3L7ZC 1B9NA 4M8AA 3Q8DA 5EDWA 5EKKA 4BY7B 1EIGA 4C2MA 1TQOA 2Z6KA 5FD5A 5FO8B 3C0FB 4FXDA 5FKAC 1JR0D 4AYBG 1PH1A 1I4PA 3QR8A 2LMCB 3HOWB 2WYOA 2IMWP 1RYSA 3T5LA 4H7BA 1H9SA 1QVFA 5KG5A 1J9OA 3E0EA 4FDBA 3JC66 3RZDH 1B2TA 3F1ZA 5I47A 4JI2L 5JEAH 4JI3Q 1A62A 2B2UC 3RMHA 3SI8A 2NN6H 4P74A 4CKEA 1HZ9A 3BA9A 4DR1L 4AQYL 5JVG3 4J9RA 3JAMW 2UVRA 3T1YH 4NPSA 2HCCA 4P72A 3D4WA 2NBFA 3K58A 3G7LA 3KHHA 1N36Q 2M9VA 2RBMA 1KDBA 2EE1A 1QILA 3FPUB 1JB7A 1SROA 3GTQB 2X69A 1T9HA 1N36L 4ZQ3A 4RCNA 5CV9A 3VR5A 4BBRH 4A93B 5EWGA 1EEFD 1SYDA 2PW5A 5C4JB 4K0KL 3S16H 2Z4IA 4HNTA 4IWYA 2W9CA 2Y0SG 1O78A 4K0KQ 2X6GA 3FKIA 2CKZB 3T16A 3UDXA 1OXTA 3CU7A 3G8CA 5L1KA 3HOUB 4QB4A 3PUYA 5JEAJ 3DHQA 4JI1Q 4CGYB 1TS4A 1T3NA 1FR3A 4A3MG 2CZGA 4EBCA 3CKIB 4RGMA 3CCEA 3OWFA 3C46A 1BXTA 1VQBA 1DOKA 4AIMA 4YY3L 1U0LA 2MO0A 3KDFA 2SNSA 3Q8QB 5C0XI 3SGIA 2JA5B 1EQVA 1CUKA 3HOYG 2R8HA 2WAQE 2R7NA 1IXRA 4KI0A 3V2TA 4DV6L 5A2QL 2BR0A 1R9TA 5D1OB 2O4XA 1ZKOA 3ZJYC 3S15H 4LW1A 3U4VA 2R7DA 1K3BC 2L5TA 3OSPA 3CCMA 2KA7A 1DXMA 1EUJA 2SNMA 2J4XA 5FK9C 4CHTB 2KENA 4JI6L 1JWSD 3H20A 1YVCA 1W6KA 4BY7H 3SR1A 4JW0A 4ABNA 2R84A 4KHPH 3ND9A 5LHY1 2R8IA 4A2BA 5LYJF 1DIKA 1TWCB 4KKTA 3GTJA 4MV7A 1N32Q 4JYAH 3MXPA 4ZRZA 2DUDA 4GKJQ 3Q0AA 4FS1A 1JDEA 1HFNA 4A3BG 4YHHQ 1FKAH 4DV1H 1AH9A 1PH8A 2BQUA 4OIJA 4ZCKA 3NP8A 5TSSA 4BBRG 3J81j 3D8GA 4JI0Q 1I6UA 4A3CG 1PV4A 4R8UB 2V5AA 1PYSB 2PZWA 2E2IH 1SYBA 4C3IB 2XCAA 3Q24A 4J9OA 4A3MB 4DUYH 1PH6A 1R9TB 3WWVA 1W3SA 5EKLA 1I3QH 3HOXB 4HN7A 1KRTA 5JVLA 1I4XA 1LLRD 4FP5D 4YR0A 2BE5C 1B50A 5JOBA 3PMFA 3TS2A 3CPFA 3CQZH 5FLXW 1TXYA 3D3RA 3P7JA 5DLQE 1HNZQ 4DL7A 4C3HH 2RGRA 2MCTA 3M4QA 4A3LH 4GLAC 2W9AA 1EEID 1RODA 1LO5D 3EYYA 4IUTA 1S97A 1TS3A 1Y1VB 2D62A 3HB9A 3A0JA 1YNXA 4GOPB 1EL0A 1TT2A 1D6EC 1ENCA 1JQYD 4A3GG 4A3IB 1LV9A 1S5DD 1HRJA 3PO3H 1L1OB 2F0UA 1F9SA 4LUOA 2RF4A 4QWCA 1X3PA 1F9RA 5FPRA 5KFRA 3H0GH 1I4RA 3A8JE 3ULJA 4TV8F 1G2SA 3LWBA 2BA1A 5M5YH 2F0MA 3JAML 1GSHA 2W6ZA 3CQZB 1B8AA 3KF6A 2A6ED 3RZOH 1EIYB 4BA2I 1HNWH 2L11A 3MWEA 3N43B 1YHBA 4MIUA 3HGBA 2PW7A 4JCVE 1XTCD 4LMYA 5T1IA 5ELNA 1Q1BA 2CQYA 2PI2E 3EPIA 2F0HA 3VR2A 2F0OA 1XMQL 4K5XA 1TWFB 4MV9A 3UQ8A 2F0LA 4XX0B 3I4MH 2ZTCA 2J6TA 1XMQQ 4YAJB 3VA5A 3TN2A 5IWAH 2IPKD 2ZXRA 5M5WB 5E4WC 4CKBA 5KFOA 3C1EA 1E22A 2UXCQ 1STBA 1SE3A 3HKZG 5KFIA 3OTOH 3NEMA 2R8KA 4APMA 1BCPD 1JB3A 4HTHA 4DPGA 1RL2A 2A19A 4RG1A 5ELFA 4ZAIA 5C4ZA 3F2UA 4GKJL 3KLSA 2OLSA 3DEPA 1BGWA 3FKIG 4H44C 3GLKA 3OHXC 4DK0A 4ECWA 1PTOD 3J80i 3MFGA 2R7ZA 1A2TA 2ZM6L 1I50A 3K80C 1E24A 1O75A 4G3IA 2FE3A 2YCHA 4X66Q 1EHIA 3NWTA 1ENFA 1O7IA 3TEHB 3JAMi 2IY5B 1J8IA 1RDPD 3RLFA 3M9OB 2Z0SA 1HZAA 3M7NA 2JYOA 4BY1G 4BWSC 1F2ZA 4C1NI 5IGGA 4Q44A 1S9FA 1RJPA 2KHSA 1HNZL 4CC6A 4RB3C 1IL8A 1H95A 1WYDA 2IX0A 2XGTA 2Q2UA 4NXNH 4ME3A 4C3HB 2HCIA 2K75A 2X6LA 3HOXG 1HTLD 3OIPA 4J9QA 4RUAA 4OL7A 3OMGA 1DV1A 5FD6A 2ZTEA 1C4QA 1LT3D 1ZHSA 2RDIA 2MGSA 4HCEA 3S1RB 5EGTA 1NAPA 3JRXA 5JJZA 2R93B 2W71A 3G6XA 4QW8A 3PN1A 1WTPA 2TSSA 2JEGA 4X62L 5M3FB 1S0OA 1K83H 4DV0Q 3PW5A 5D1PA 5KG4A 2K5NA 1MSHA 4HJ9A 1SYEA 2XRSD 4EGJA 5C3EH 3ORQA 5D8DA 4JC0A 1BOSA 1E2VA 1HNZH 3R93A 3JAMc 1HR0H 4X3TA 3I91A 4A3CH 1NBWA 4QF4A 4RAYA 1SNMA 5CA1F 3TP6A 5KYIA 2IX3A 5KNBA 1L2FA 4QQBX 1PH3A 5FLXL 4ZOLF 3M3YH 2AGQA 3RD4A 1UE1A 2ZM6H 3S1RH 4ECVA 2A68C 5GROA 2D0PA 2JEAI 5KT6A 2B2VC 3PIOA 3MR5A 3A74A 2JP1A 2K6AA 3GIJA 3GTQA 1PZKD 2KOLA 1TWHB 3T1HQ 3I4NG 4GKJH 4I7ZC 1CT1D 1I7NA 1XPUA 3BYYB 4NXNQ 4Y8VB 1XWEA 1SBBB 3RN5A 3UDGA 3KHGA 1HJPA 3KJPA 2QA4A 1N34L 1HA5A 3GIPA 3BG3A 3LX0A 5C3WA 2YZNA 4QMGA 2YZGA 2F03A 1C0AA 2Y0SE 4UDUC 3VPBA 3I8ZA 2ASJA 4JV5H 3I7FA 4QUFA 5J2TF 3SE0A 3S1MH 1FD7D 4NXMQ 3MHBA 4DKAC 2E5LH 5IYBG 2M00A 1CQFA 4V190 1PFMA 5KFXA 2BQRA 5GQOA 1TWHA 1RF2D 4PMBA 3W2DA 4BY1H 2XWBB 4JI7L 4YJ2F 5LMUH 5BPHA 2A74C 1Q1EA 1HNWL 1QNUA 1KJ9A 3K5IA 5CR3A 4U6PA 3DXJC 3BZKA 4XYMB 2N49A 1EY7A 1CSQA 5HV6A 1JMCA 4Z9CB 1FGUA 2CCZA 1EZ1A 2V1CC 1B6SA 4IJHA 1PRTD 1IBKL 4HYKA 3J7AV 5J2UF 4YCWA 2JA7G 3KUPA 4LF9H 2RCNA 2XIWA 2ICEC 3U9OA 2A69C 4O3NA 2EY1A 2K33A 2N88A 5KFYA 3CD6A 4F7XA 1HZCA 4M7EA 4K2LA 3F8TA 2IT1A 5M9OA 5EPLA 3B6YA 3PF5A 4RGTA 2E75C 1ZYRD 1JIHA 3N42B 2R8JA 3MC0B 3OOCA 2WB1A 3A7AB 3KLSX 4YB8B 1B9MA 4O0AA 3TQ1A 2HQLA 1SEBD 4DR4L 5JEAG 4DR7Q 1GOZA 4X65H 2J7ZA 2W6OA 4LF7Q 5CV7A 2YV5A 5LMNL 2BOSA 4LFBH 3ITPA 2HUGA 3OW7A 2B2WC 1A6XA 1XNRL 2Q2TA 3HOYB 2FK3A 3ETJA 1STAA 1QWYA 4F4ZA 4A75A 4TVAB 5EPKA 3K7AH 3I4NH 2A6HC 2CH4W 4TQSA 1GUGA 3MXNB 1BF4A 5JJIA 5EZYF 1HQMC 4DR5Q 1YNJC 3H3VH 1UC9A 4UCOA 3TIGA 3KHLA 2RDJA 5AFWA 3FP9A 2E2HA 4RNMA 4JI1L 1UWVA 3KBGA 4EQNA 3HOUG 1CQVA 3S24A 4TSSA 5IYCH 1RJRA 2R7ZB 4O42A 4GOPA 1N56A 5LMNH 1Y1VA 1IBMQ 1P16A 5GAGC 2B63A 4QW9A 2GLTA 2Y0SA 3P20A 3SHLA 4DR4H 1ICFB 4DAMA 4HIKA 2R92H 3JRWA 2R82A 4PNYA 4IOCA 2HDLA 3VPCA 1TWCH 1LT5D 3BAAA 1Q7YC 5I6YA 1IW7D 1LABA 3V4SA 3J80W 2JA6H 1AZQA 4N8FA 4F8MA 3E6ZX 3GO5A 4KY6A 1SE4A 2WKDA 2FMCA 1Z9FA 5L1IA 4R8UA 1MHWC 5J1ZA 1PH4A 3DLLA 2UUCQ 3J7AF 5AJ3Q 1EYDA 4FNFA 2LFNA 3MTSA 4DR6L 2A68D 5DM63 4U673 1TWFA 2PVPA 4DV2H 1V1PB 3GQCA 5EKIA 2L15A 4XT1B 5EBDA 4JV1A 4O3OA 1HTPA 3RR5A 1C9OA 2OCEA 3QZ7A 4UCUA 1VQMA 2DJGC 5CV5A 2P5ZX 3RGZA 5M3MG 5IP7G 2VXWA 5CBEE 4JYAQ 3V05A 4AH6A 1WTQA 3PZPA 1VQJA 1MKHA 2OT2A 1X3FA 1FVIA 3LWUA 3SK5A 3TRZA 3QIAA 3HOVG 1HA6A 3NPPA 4JI7H 4DV1Q 4CJ0B 3J80E 4FO2A 4K8IA 5JPMC 2UUAQ 5E1FA 3EBEA 1SCUB 1K83A 3GTJB 2D9UA 1N32H 1IBLH 5E3FA 1GJXA 2JA8G 1GHJA 1GUNA 3PO3B 1D1KA 5BR8H 3STBC 1JOQA 1EY9A 2DGYA 4KV6A 4A76A 2DWCA 1N9WA 3OWEB 1SNOA 3S14H 2UVUA 5A2QE 1YNJD 4IQZA 1OXXK 4R9WA 4K14A 1HQRD 4LF4Q 3LMLA 3ORRA 2N8NA 2A6HD 3W5OA 2K1BA 4IHJF 2YZMA 4IUNA 4XQJA 2B2YA 1KL9A 3GTKB 3PQIA 4ZYSA 5BN5A 4DR1Q 4AQYQ 1UNNC 4A3IG 3KAKA 5KFQA 5KFJA 3WOFA 1PZJD 4CDCC 4CJ1B 5FO9B 5C8YF 5BR8L 4XYQA 1S5FD 2EY6A 1Z2NX 2A1AA 2L12A 2PMZE 3JZIA 4DR2L 4ECTA 2KCCA 4ZHQF 3NQIA 2UUBL 5EPJA 1FJGL 2AMCB 2EXZA 5LMUQ 3G6YA 2NUCA 1BQQT 3CC4A 2DJFC 1K28A 2I46A 2O2LD 2UUBQ 1FJGQ 3FDTA 3K3PA 4R4TA 5M3FH 3P75A 1DJRD 2D5DA 1PH2A 1TKWB 1M90C
chains in the Genus database with same CATH topology
4YWMA 2MFIA 3PUWA 4PG3A 4JI5Q 4GNXB 2HHHQ 5C3EG 3PUYA 3PUXA 4DR3L 5JEAJ 1X55A 2JA6G 1VQPA 4JI1Q 4Y7NH 1PVOA 5ELOA 3OW2A 1Y1WG 1VQDA 1QZGA 4A3MG 1SRUA 3CCEA 2VY3A 4DV2L 3AQQA 4DR5L 1J6QA 1VQBA 4P75A 4R1JA 4DV7Q 4BBSH 2R7FA 4AIMA 4YY3L 4LNQA 2K4KA 1UE6A 1U0LA 1KIXA 3AFPA 2MO0A 3KDFA 5C0XI 4HJ5A 3SGIA 1WCMG 4YY3Q 4GS3A 1BBUA 1CUKA 3G4SA 1SMXA 1NTGA 3HOYG 2KHJA 1S3OA 2Q2HA 2CWPA 3M85A 3CPWA 2WAQE 3G48A 1ASZA 1IXRA 2AWNA 4KI0A 1Q86C 2VQFL 1VQNA 5IP9G 1B7YB 4DV2Q 4DV6L 4X6AH 1K73C 1SN8A 2F3IA 2KCTA 1DGSA 4WJ3M 3ZJYC 3S15H 2JK8A 4NXNL 1UEBA 4LW1A 4O2DA 4LFBQ 1N8RC 3U4VA 3STBD 4BY7G 2R7DA 3CCMA 1EUJA 4IPCA 4EX5A 2N3SA 1UE7A 2KENA 4PZ6A 4JI6L 4NXML 4B3ML 1YVCA 2AWOA 4BY7H 2UXBQ 1X56A 4DK3C 3KF8B 1YHQA 1TWGH 2EIFA 4OONA 3GTPH 3GDEA 3CMEA 1PA6A 4B3SQ 1N32Q 4GKJQ 2RHQB 2DUDA 3G71A 4B3TL 1RIPA 4A3FG 4J15A 4LF8L 1Y1VG 3VDYA 4A3BG 2VZAA 4YHHQ 4XTCS 2VUMH 1AH9A 1PH8A 1KHIA 1HH2P 4BBRG 3J81j 1VQLA 2NVXH 3ULLA 4LF4L 4JI0Q 3KJOA 4A3FH 1PH9A 4BXXG 1A0IA 1PV4A 2R7ZH 4A3CG 4OO1G 1AE2A 1PYSB 3LGJA 3OYYA 2E2IH 4B3TQ 4JI0L 1PH6A 3WWVA 1W3SA 4X62Q 2YTXA 4X65L 1I3QH 2OWOA 2KCMA 1KRTA 1VQ5A 2RHSB 3GD7A 1BKBA 4MNOA 4YCVA 3CXCA 4GLXA 5IWAL 3KYHC 1SFOH 4JOIC 1X9NA 1GD7A 3TS2A 3CPFA 3CQZH 1TXYA 1HNZQ 5DLQE 4DR4Q 1VQHA 4C3HH 3MEFA 1G291 3H0GG 4JI3L 2I5LX 1MJEA 1KXLA 1WCMH 3M4QA 1J5EL 2NVYH 1V1QA 4GLAC 3UE0A 4JV5Q 4A3LH 3HOWH 4X65Q 4P73A 3PO3G 1EOVA 4IPGA 4OX9L 4GOPC 2JQOA 2D62A 3D31A 4A3DG 2JA9A 3A0JA 4BA1I 2LSSA 5IP9H 1YNXA 5IWAQ 3J81i 4GOPB 1S72A 5GAEC 4B3RQ 4A3GG 3H3VI 4LF7L 4IPDA 4A3IH 2ZJPA 3PO3H 1L1OB 1NE3A 1XTDA 2HIVA 4DNIA 4LUOA 2RF4A 2R7ZG 1VQ4A 4KHZA 2AHOB 1Y1VH 1XNQL 5HGQA 4HIDA 3H0GH 3ULJA 2YTYA 1KD1C 4IFDJ 2XTIA 2LXKA 3W1BA 4DV5L 4QGUA 1GVPA 1G6PA 3T1HL 2HIXA 2PI2A 2BA1A 5M5YH 3I4MG 1A63A 3NBHB 5C0XG 4A3MH 2B29A 1CKMA 4DV5Q 4B3RL 1B8AA 3KF6A 1VQOA 3RZOH 1EIYB 3J81c 1I6HH 4L5QA 4BA2I 1V9PA 4UP7A 4R4QA 3G6EA 1YHBA 5LMUL 1N34Q 2ASBA 3S1NH 4GN3B 2AKWB 2VS1A 3AFQA 4JCVE 4JOIA 1GM5A 1VQIA 2E5LQ 4A93G 5ELNA 1Q1BA 2PI2E 2HT1A 3T1YQ 2E5LL 1TWFH 1XMQL 1EIFA 2KBNA 3M4PA 3I4MH 2ZTCA 2QEXA 3PGZA 4DR3Q 1XMQQ 1K9MC 5C4XG 2Q2IA 3PIPA 4PMWA 1OTCA 4GN4B 1K3RA 4DV6Q 1LUZA 2IHEA 3RLOA 3E9IA 1E22A 4JI7Q 2UXCQ 1LYLA 4HJ8A 3HKZG 1WJJA 1IL2A 2UUCL 4A3GH 1XMOQ 3NEMA 1HNWQ 2PQAB 4LF9Q 4IJLA 4DPGA 4DR6Q 1RL2A 2A19A 4RG1A 3UE1A 5HY6A 2ID0A 5IY0A 1Q81C 2I0QA 4IOAA 1B70B 1VQAA 3PUZA 3L2PA 4GKJL 2WP8J 2FXQA 4HIOA 1K8GA 2B63H 3FKIG 1K8AC 3A5ZB 4DV1L 1IBKQ 2NZOA 3J80i 1VQFA 1QUQA 4JYAL 1E3PA 1HZBA 1BBWA 2WAQG 4DUZQ 2ZM6L 2N78A 1L0WA 1CSPA 1EYGA 3K80C 1E24A 2JA5H 2R6GA 4HJAA 3PUVA 1Q46A 4X66Q 3RNUA 2ZM6Q 4JG2A 1S40A 1O7IA 1YJWA 2NVTH 2B3GA 1XPRA 4X64Q 3TEHB 3JAMi 2OTJA 2IY5B 3HOZH 4HIMA 3RLFA 4LF8Q 2Z0SA 1HZAA 3M7NA 2QGQA 4BY1G 5FLMH 3HOXH 1QVGA 1D7QA 1HR0L 5LMNW 1HNZL 2WFWA 4A3BH 4C3JH 4YCUA 3I2ZA 3GTGH 4OWTB 1H95A 1WYDA 2IX0A 2XGTA 5IYCG 2Q2UA 4ME3A 2F52A 2I5HA 1LTLA 2K75A 1FL0A 3I56A 3HOXG 1VQ6A 3CCQA 1GKHA 1X6OA 3CAMA 3CP0A 4DV3Q 3TS0A 3AEVA 4UP9A 4EQ5A 3GTLH 2ZTEA 4QY7A 1IZ6A 1MIUA 4A3JG 2LXJA 4DV4L 3M9BA 5K36G 3KOJA 4X62L 1I50H 2NZHA 1K83H 4R4IA 4DV0Q 2BH2A 2K5NA 4HJ9A 4JI2Q 4WJ4A 1VQGA 4MZ9A 5C3EH 4DV0L 4A3LG 3IRBA 4JC0A 2MO1A 4KLKA 5E7NA 3JAMc 4A3KG 2JA7H 2YU9H 5IYDG 4A3CH 1CKNB 1NBWA 1J5EQ 1X54A 1XNRQ 1JJGA 1QVCA 4DK6C 3PSIA 4PZ7A 4L5RC 1YHAA 1IBML 5IYBH 4LFCQ 2ZJQA 1C7YA 2UXDQ 3KFUA 1L2FA 3EIVA 4QQBX 1PH3A 4QIWE 2JE6I 4LFCL 3I4OA 1WOCA 4GLVB 3M3YH 1UE1A 1XJVA 3S1RH 3K7UC 4BBSG 4L5TA 1YJNA 1VQ8A 1U5KA 5GROA 2D0PA 2JEAI 3BU2A 2MNAA 3F2DA 3PIOA 1JT8A 1Q12A 3BJUA 5IT9c 3A74A 5C4XH 3J80c 2VW9A 4AYBE 3HOWG 3RN2A 3T1HQ 1W2BA 3I4NG 2K52A 2ZTDA 2E8GA 3HKSA 3AYHB 3KF6B 5GADC 1CKNA 1XPUA 1L1OC 3CMAA 4NXNQ 3CW2C 4LWCA 4NB3A 3RN5A 3UDGA 3T1YL 2HHHL 1HJPA 4BXXH 4JBWA 1E1TA 3KJPA 2QA4A 1N34L 4KHPQ 3OTOL 5AJ3L 3S1QH 2CWAA 2VUMG 2VQEQ 4JBMA 3K8AA 1C0AA 2Y0SE 3FHWA 5C0XJ 1N33L 1Q8KA 3F2BA 1KC8C 2VL6A 1I94Q 2OQKA 1X3GA 4YWLA 2YTVA 3I7FA 3RLNA 1OXVA 3GTJH 3S1MH 3PO2G 1SE8A 1IBLL 4NXMQ 4B3SL 1N32L 4OXPA 4LFAQ 4DKAC 5C44H 3NENA 1SR3A 3TQYA 4X66L 1VQCA 5IYBG 2VQEL 3DM3A 1EQRA 4GN5A 5GQOA 5FLMG 4BY1H 4P71A 4ALPA 4JI7L 2UXCL 2IHFA 1Q1EA 1VS0A 2K5VA 1XMOL 1HNWL 4B3MQ 2JJQA 3BZKA 3HKZE 4L5SA 1NY4A 3UDFA 1Y1WH 2ZJRA 1IBLQ 3CF5A 2N49A 1CSQA 3GTKH 1JMCA 1YITA 1FGUA 3F2CA 1NMFA 2CCZA 3J7A5 3K81C 2V1CC 4C3IH 4IJHA 3HFZB 3UDIA 1IBKL 1GO3E 4UP8A 4OO1I 4YCWA 4A3KH 2JA7G 4YHHL 4OWWB 2RCNA 2KHIA 4JBJA 4HJ7A 4DUZL 2UUAL 2OTLA 1E7ZA 2PQAA 3CD6A 1HZCA 1L1OA 2IX1A 1HR0Q 3PO2H 3F8TA 5JJKA 4DR7L 3GTMH 1VQKA 2IT1A 3GTOH 2F4VQ 1V43A 1Y14B 4UPAA 3B6YA 4GNXA 3PF5A 5LMNQ 5FLXc 2ALYB 2UU9Q 4JI4L 4IFDI 2F4VL 5J3BA 2R92G 3ICEA 4O0AA 2HQLA 1YBYA 5M3FG 3ERSX 5JEAG 4DR4L 2E2JH 3S2DH 5GAHC 3A5UA 4DR7Q 3U58A 3H15A 4YWKA 3TREA 3CC7A 1VQ7A 4GNXC 4GKKQ 4LF7Q 2YV5A 4DUYL 5LMNL 2WB1G 1HR0W 4DV3L 3HOUH 1PHJA 4OX9Q 3EN2A 1XNRL 2Q2TA 2GN5A 2WB1E 3K0XA 4XIGS 5BR8Q 4DUYQ 4LUZA 2Z6KC 4MTNA 4A75A 4TVAB 4JI8L 3CCSA 3K7AH 3L0OA 4A3JH 3I4NH 1UE5A 3CCLA 2A8VA 3KLWA 2YYZA 4GKKL 3MXNB 1KQSA 5JJIA 3J7ZC 4DR5Q 1XNQQ 3H3VH 4LF6Q 1KAWA 1BVSA 5IE8A 4A93H 3KDFB 3FP9A 4TQUS 1E1OA 1UWVA 4JI1L 4Y52H 1KRSA 5H1SE 4A3EG 1XPOA 4LF5Q 3HOUG 1TWAH 4KHPL 3S24A 4OWXB 2R93G 5IYCH 1CKOA 4DAYB 4GOPA 1YIJA 1VQEA 4JI5L 4IO9A 4APVA 4POFA 4DV7L 4LFBL 1IBMQ 4PZ8A 1P16A 3U50C 1OXSC 5GAGC 1R9TH 1N33Q 4QJFA 3PV0A 4LF6L 2CQOA 1A8VA 1I94L 4DAMA 4HIKA 2NN6G 1WFQA 3HOZG 5M5WH 2R92H 3OTOQ 5FJ8H 1VQ9A 5C44G 4UY8C 2VNUD 1P8LA 1YZ6A 4IOCA 3W1GA 1TWCH 2OQ0A 2JEBI 1ASYA 1VCIA 4LFAL 1Z47A 5M5XH 1K0RA 1Q82C 2B63G 2H5XA 1Q7YC 2NVQH 2MQHA 2ATWA 2JA6H 4JI6Q 1PH5A 3PF4A 3GO5A 1Z9FA 1YI2A 3I55A 2VQFQ 3FKIH 1LM0A 1YJ9A 1PH4A 3DLLA 2UUCQ 1NJIC 1PH7A 1I5FA 5AJ3Q 1JJ2A 1SLJA 4LF9L 4DR6L 2K50A 1JJCB 3D0FA 2L15A 3BZCA 4X64L 2BA0A 3U4ZA 1JE5A 2EQSA 2GVBA 2BH8A 1D8LA 3RR5A 1C9OA 1MJCA 2OCEA 1HNXQ 2UXBL 1VQMA 1EFWA 1QZHA 1PYBA 2E2HH 3NELA 3PCOB 3L7ZC 4R4OA 3CCVA 4JBKA 5M3MG 5IP7G 1HNXL 2C35B 3Q8DA 1IYJB 4JYAQ 4AH6A 3HOYH 1VQJA 1MKHA 3TRZA 1X3FA 1FVIA 4A3DH 2Z6KA 2JA8H 3HOVG 4DV1Q 4A4IA 2UUAQ 3CCRA 4AYBG 1G51A 1WI5A 3EBEA 1PH1A 4RMFA 3S17H 1OXUA 4A3EH 2JA8G 2K14A 3E9HA 4QL5A 3HOVH 1YEZA 4DV4Q 2JA5G 3CCUA 4JV5L 3STBC 2DGYA 4A76A 1TWHH 4R4CA 1N9WA 1QVFA 1QUQB 2EXDA 3E0EA 3S14H 1NMGA 4FDBA 3JC66 1EWIA 3RZDH 3F1ZA 4IFDG 3CCJA 2ES2A 4JI2L 1OXXK 1X3EA 1A62A 4JI3Q 4LF4Q 3S2HH 2N8NA 3ER0A 3W5OA 4P74A 4DR2Q 1AE3A 1HZ9A 2I5MX 4C2MH 5FJ8G 4DR1L 4AQYL 1KL9A 4NPSA 2UU9L 2PNHA 5JJLA 3ULPA 4P72A 4JI8Q 4DR1Q 4AQYQ 4IPHA 5IP7H 5EAYA 5M3MH 4A3IG 1M1KC 5IYDH 1N36Q 5BR8L 1SROA 2NN6I 4LUVA 1JB7A 2GVAA 1T9HA 2CFMA 4H02A 1N36L 2A1AA 3CC2A 1EQQA 4JI4Q 2R93H 2PMZE 4DR2L 4POGA 4BBRH 4LF5L 2UUBL 1FJGL 4K0KL 3S16H 2AMCB 5LMUQ 2Y0SG 3GTQH 2D0OA 3CC4A 1PFSA 3M4OH 2UUBQ 1FJGQ 4K0KQ 4R4TA 1X65A 5M3FH 2CKZB 3UDXA 1OXTA 2K5HA 5C4JH 1PH2A 2UXDL 1M90C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWM A;  2MFI A;  3PUW A;  4PG3 A;  4JI5 Q;  4GNX B;  2HHH Q;  5C3E G;  3PUY A;  3PUX A;  4DR3 L;  5JEA J;  1X55 A;  2JA6 G;  1VQP A;  4JI1 Q;  4Y7N H;  1PVO A;  5ELO A;  3OW2 A;  1Y1W G;  1VQD A;  1QZG A;  4A3M G;  1SRU A;  3CCE A;  2VY3 A;  4DV2 L;  3AQQ A;  4DR5 L;  1J6Q A;  1VQB A;  4P75 A;  4R1J A;  4DV7 Q;  4BBS H;  2R7F A;  4AIM A;  4YY3 L;  4LNQ A;  2K4K A;  1UE6 A;  1U0L A;  1KIX A;  3AFP A;  2MO0 A;  3KDF A;  5C0X I;  4HJ5 A;  3SGI A;  1WCM G;  4YY3 Q;  4GS3 A;  1BBU A;  1CUK A;  3G4S A;  1SMX A;  1NTG A;  3HOY G;  2KHJ A;  1S3O A;  2Q2H A;  2CWP A;  3M85 A;  3CPW A;  2WAQ E;  3G48 A;  1ASZ A;  1IXR A;  2AWN A;  4KI0 A;  1Q86 C;  2VQF L;  1VQN A;  5IP9 G;  1B7Y B;  4DV2 Q;  4DV6 L;  4X6A H;  1K73 C;  1SN8 A;  2F3I A;  2KCT A;  1DGS A;  4WJ3 M;  3ZJY C;  3S15 H;  2JK8 A;  4NXN L;  1UEB A;  4LW1 A;  4O2D A;  4LFB Q;  1N8R C;  3U4V A;  3STB D;  4BY7 G;  2R7D A;  3CCM A;  1EUJ A;  4IPC A;  4EX5 A;  2N3S A;  1UE7 A;  2KEN A;  4PZ6 A;  4JI6 L;  4NXM L;  4B3M L;  1YVC A;  2AWO A;  4BY7 H;  2UXB Q;  1X56 A;  4DK3 C;  3KF8 B;  1YHQ A;  1TWG H;  2EIF A;  4OON A;  3GTP H;  3GDE A;  3CME A;  1PA6 A;  4B3S Q;  1N32 Q;  4GKJ Q;  2RHQ B;  2DUD A;  3G71 A;  4B3T L;  1RIP A;  4A3F G;  4J15 A;  4LF8 L;  1Y1V G;  3VDY A;  4A3B G;  2VZA A;  4YHH Q;  4XTC S;  2VUM H;  1AH9 A;  1PH8 A;  1KHI A;  1HH2 P;  4BBR G;  3J81 j;  1VQL A;  2NVX H;  3ULL A;  4LF4 L;  4JI0 Q;  3KJO A;  4A3F H;  1PH9 A;  4BXX G;  1A0I A;  1PV4 A;  2R7Z H;  4A3C G;  4OO1 G;  1AE2 A;  1PYS B;  3LGJ A;  3OYY A;  2E2I H;  4B3T Q;  4JI0 L;  1PH6 A;  3WWV A;  1W3S A;  4X62 Q;  2YTX A;  4X65 L;  1I3Q H;  2OWO A;  2KCM A;  1KRT A;  1VQ5 A;  2RHS B;  3GD7 A;  1BKB A;  4MNO A;  4YCV A;  3CXC A;  4GLX A;  5IWA L;  3KYH C;  1SFO H;  4JOI C;  1X9N A;  1GD7 A;  3TS2 A;  3CPF A;  3CQZ H;  1TXY A;  1HNZ Q;  5DLQ E;  4DR4 Q;  1VQH A;  4C3H H;  3MEF A;  1G29 1;  3H0G G;  4JI3 L;  2I5L X;  1MJE A;  1KXL A;  1WCM H;  3M4Q A;  1J5E L;  2NVY H;  1V1Q A;  4GLA C;  3UE0 A;  4JV5 Q;  4A3L H;  3HOW H;  4X65 Q;  4P73 A;  3PO3 G;  1EOV A;  4IPG A;  4OX9 L;  4GOP C;  2JQO A;  2D62 A;  3D31 A;  4A3D G;  2JA9 A;  3A0J A;  4BA1 I;  2LSS A;  5IP9 H;  1YNX A;  5IWA Q;  3J81 i;  4GOP B;  1S72 A;  5GAE C;  4B3R Q;  4A3G G;  3H3V I;  4LF7 L;  4IPD A;  4A3I H;  2ZJP A;  3PO3 H;  1L1O B;  1NE3 A;  1XTD A;  2HIV A;  4DNI A;  4LUO A;  2RF4 A;  2R7Z G;  1VQ4 A;  4KHZ A;  2AHO B;  1Y1V H;  1XNQ L;  5HGQ A;  4HID A;  3H0G H;  3ULJ A;  2YTY A;  1KD1 C;  4IFD J;  2XTI A;  2LXK A;  3W1B A;  4DV5 L;  4QGU A;  1GVP A;  1G6P A;  3T1H L;  2HIX A;  2PI2 A;  2BA1 A;  5M5Y H;  3I4M G;  1A63 A;  3NBH B;  5C0X G;  4A3M H;  2B29 A;  1CKM A;  4DV5 Q;  4B3R L;  1B8A A;  3KF6 A;  1VQO A;  3RZO H;  1EIY B;  3J81 c;  1I6H H;  4L5Q A;  4BA2 I;  1V9P A;  4UP7 A;  4R4Q A;  3G6E A;  1YHB A;  5LMU L;  1N34 Q;  2ASB A;  3S1N H;  4GN3 B;  2AKW B;  2VS1 A;  3AFQ A;  4JCV E;  4JOI A;  1GM5 A;  1VQI A;  2E5L Q;  4A93 G;  5ELN A;  1Q1B A;  2PI2 E;  2HT1 A;  3T1Y Q;  2E5L L;  1TWF H;  1XMQ L;  1EIF A;  2KBN A;  3M4P A;  3I4M H;  2ZTC A;  2QEX A;  3PGZ A;  4DR3 Q;  1XMQ Q;  1K9M C;  5C4X G;  2Q2I A;  3PIP A;  4PMW A;  1OTC A;  4GN4 B;  1K3R A;  4DV6 Q;  1LUZ A;  2IHE A;  3RLO A;  3E9I A;  1E22 A;  4JI7 Q;  2UXC Q;  1LYL A;  4HJ8 A;  3HKZ G;  1WJJ A;  1IL2 A;  2UUC L;  4A3G H;  1XMO Q;  3NEM A;  1HNW Q;  2PQA B;  4LF9 Q;  4IJL A;  4DPG A;  4DR6 Q;  1RL2 A;  2A19 A;  4RG1 A;  3UE1 A;  5HY6 A;  2ID0 A;  5IY0 A;  1Q81 C;  2I0Q A;  4IOA A;  1B70 B;  1VQA A;  3PUZ A;  3L2P A;  4GKJ L;  2WP8 J;  2FXQ A;  4HIO A;  1K8G A;  2B63 H;  3FKI G;  1K8A C;  3A5Z B;  4DV1 L;  1IBK Q;  2NZO A;  3J80 i;  1VQF A;  1QUQ A;  4JYA L;  1E3P A;  1HZB A;  1BBW A;  2WAQ G;  4DUZ Q;  2ZM6 L;  2N78 A;  1L0W A;  1CSP A;  1EYG A;  3K80 C;  1E24 A;  2JA5 H;  2R6G A;  4HJA A;  3PUV A;  1Q46 A;  4X66 Q;  3RNU A;  2ZM6 Q;  4JG2 A;  1S40 A;  1O7I A;  1YJW A;  2NVT H;  2B3G A;  1XPR A;  4X64 Q;  3TEH B;  3JAM i;  2OTJ A;  2IY5 B;  3HOZ H;  4HIM A;  3RLF A;  4LF8 Q;  2Z0S A;  1HZA A;  3M7N A;  2QGQ A;  4BY1 G;  5FLM H;  3HOX H;  1QVG A;  1D7Q A;  1HR0 L;  5LMN W;  1HNZ L;  2WFW A;  4A3B H;  4C3J H;  4YCU A;  3I2Z A;  3GTG H;  4OWT B;  1H95 A;  1WYD A;  2IX0 A;  2XGT A;  5IYC G;  2Q2U A;  4ME3 A;  2F52 A;  2I5H A;  1LTL A;  2K75 A;  1FL0 A;  3I56 A;  3HOX G;  1VQ6 A;  3CCQ A;  1GKH A;  1X6O A;  3CAM A;  3CP0 A;  4DV3 Q;  3TS0 A;  3AEV A;  4UP9 A;  4EQ5 A;  3GTL H;  2ZTE A;  4QY7 A;  1IZ6 A;  1MIU A;  4A3J G;  2LXJ A;  4DV4 L;  3M9B A;  5K36 G;  3KOJ A;  4X62 L;  1I50 H;  2NZH A;  1K83 H;  4R4I A;  4DV0 Q;  2BH2 A;  2K5N A;  4HJ9 A;  4JI2 Q;  4WJ4 A;  1VQG A;  4MZ9 A;  5C3E H;  4DV0 L;  4A3L G;  3IRB A;  4JC0 A;  2MO1 A;  4KLK A;  5E7N A;  3JAM c;  4A3K G;  2JA7 H;  2YU9 H;  5IYD G;  4A3C H;  1CKN B;  1NBW A;  1J5E Q;  1X54 A;  1XNR Q;  1JJG A;  1QVC A;  4DK6 C;  3PSI A;  4PZ7 A;  4L5R C;  1YHA A;  1IBM L;  5IYB H;  4LFC Q;  2ZJQ A;  1C7Y A;  2UXD Q;  3KFU A;  1L2F A;  3EIV A;  4QQB X;  1PH3 A;  4QIW E;  2JE6 I;  4LFC L;  3I4O A;  1WOC A;  4GLV B;  3M3Y H;  1UE1 A;  1XJV A;  3S1R H;  3K7U C;  4BBS G;  4L5T A;  1YJN A;  1VQ8 A;  1U5K A;  5GRO A;  2D0P A;  2JEA I;  3BU2 A;  2MNA A;  3F2D A;  3PIO A;  1JT8 A;  1Q12 A;  3BJU A;  5IT9 c;  3A74 A;  5C4X H;  3J80 c;  2VW9 A;  4AYB E;  3HOW G;  3RN2 A;  3T1H Q;  1W2B A;  3I4N G;  2K52 A;  2ZTD A;  2E8G A;  3HKS A;  3AYH B;  3KF6 B;  5GAD C;  1CKN A;  1XPU A;  1L1O C;  3CMA A;  4NXN Q;  3CW2 C;  4LWC A;  4NB3 A;  3RN5 A;  3UDG A;  3T1Y L;  2HHH L;  1HJP A;  4BXX H;  4JBW A;  1E1T A;  3KJP A;  2QA4 A;  1N34 L;  4KHP Q;  3OTO L;  5AJ3 L;  3S1Q H;  2CWA A;  2VUM G;  2VQE Q;  4JBM A;  3K8A A;  1C0A A;  2Y0S E;  3FHW A;  5C0X J;  1N33 L;  1Q8K A;  3F2B A;  1KC8 C;  2VL6 A;  1I94 Q;  2OQK A;  1X3G A;  4YWL A;  2YTV A;  3I7F A;  3RLN A;  1OXV A;  3GTJ H;  3S1M H;  3PO2 G;  1SE8 A;  1IBL L;  4NXM Q;  4B3S L;  1N32 L;  4OXP A;  4LFA Q;  4DKA C;  5C44 H;  3NEN A;  1SR3 A;  3TQY A;  4X66 L;  1VQC A;  5IYB G;  2VQE L;  3DM3 A;  1EQR A;  4GN5 A;  5GQO A;  5FLM G;  4BY1 H;  4P71 A;  4ALP A;  4JI7 L;  2UXC L;  2IHF A;  1Q1E A;  1VS0 A;  2K5V A;  1XMO L;  1HNW L;  4B3M Q;  2JJQ A;  3BZK A;  3HKZ E;  4L5S A;  1NY4 A;  3UDF A;  1Y1W H;  2ZJR A;  1IBL Q;  3CF5 A;  2N49 A;  1CSQ A;  3GTK H;  1JMC A;  1YIT A;  1FGU A;  3F2C A;  1NMF A;  2CCZ A;  3J7A 5;  3K81 C;  2V1C C;  4C3I H;  4IJH A;  3HFZ B;  3UDI A;  1IBK L;  1GO3 E;  4UP8 A;  4OO1 I;  4YCW A;  4A3K H;  2JA7 G;  4YHH L;  4OWW B;  2RCN A;  2KHI A;  4JBJ A;  4HJ7 A;  4DUZ L;  2UUA L;  2OTL A;  1E7Z A;  2PQA A;  3CD6 A;  1HZC A;  1L1O A;  2IX1 A;  1HR0 Q;  3PO2 H;  3F8T A;  5JJK A;  4DR7 L;  3GTM H;  1VQK A;  2IT1 A;  3GTO H;  2F4V Q;  1V43 A;  1Y14 B;  4UPA A;  3B6Y A;  4GNX A;  3PF5 A;  5LMN Q;  5FLX c;  2ALY B;  2UU9 Q;  4JI4 L;  4IFD I;  2F4V L;  5J3B A;  2R92 G;  3ICE A;  4O0A A;  2HQL A;  1YBY A;  5M3F G;  3ERS X;  5JEA G;  4DR4 L;  2E2J H;  3S2D H;  5GAH C;  3A5U A;  4DR7 Q;  3U58 A;  3H15 A;  4YWK A;  3TRE A;  3CC7 A;  1VQ7 A;  4GNX C;  4GKK Q;  4LF7 Q;  2YV5 A;  4DUY L;  5LMN L;  2WB1 G;  1HR0 W;  4DV3 L;  3HOU H;  1PHJ A;  4OX9 Q;  3EN2 A;  1XNR L;  2Q2T A;  2GN5 A;  2WB1 E;  3K0X A;  4XIG S;  5BR8 Q;  4DUY Q;  4LUZ A;  2Z6K C;  4MTN A;  4A75 A;  4TVA B;  4JI8 L;  3CCS A;  3K7A H;  3L0O A;  4A3J H;  3I4N H;  1UE5 A;  3CCL A;  2A8V A;  3KLW A;  2YYZ A;  4GKK L;  3MXN B;  1KQS A;  5JJI A;  3J7Z C;  4DR5 Q;  1XNQ Q;  3H3V H;  4LF6 Q;  1KAW A;  1BVS A;  5IE8 A;  4A93 H;  3KDF B;  3FP9 A;  4TQU S;  1E1O A;  1UWV A;  4JI1 L;  4Y52 H;  1KRS A;  5H1S E;  4A3E G;  1XPO A;  4LF5 Q;  3HOU G;  1TWA H;  4KHP L;  3S24 A;  4OWX B;  2R93 G;  5IYC H;  1CKO A;  4DAY B;  4GOP A;  1YIJ A;  1VQE A;  4JI5 L;  4IO9 A;  4APV A;  4POF A;  4DV7 L;  4LFB L;  1IBM Q;  4PZ8 A;  1P16 A;  3U50 C;  1OXS C;  5GAG C;  1R9T H;  1N33 Q;  4QJF A;  3PV0 A;  4LF6 L;  2CQO A;  1A8V A;  1I94 L;  4DAM A;  4HIK A;  2NN6 G;  1WFQ A;  3HOZ G;  5M5W H;  2R92 H;  3OTO Q;  5FJ8 H;  1VQ9 A;  5C44 G;  4UY8 C;  2VNU D;  1P8L A;  1YZ6 A;  4IOC A;  3W1G A;  1TWC H;  2OQ0 A;  2JEB I;  1ASY A;  1VCI A;  4LFA L;  1Z47 A;  5M5X H;  1K0R A;  1Q82 C;  2B63 G;  2H5X A;  1Q7Y C;  2NVQ H;  2MQH A;  2ATW A;  2JA6 H;  4JI6 Q;  1PH5 A;  3PF4 A;  3GO5 A;  1Z9F A;  1YI2 A;  3I55 A;  2VQF Q;  3FKI H;  1LM0 A;  1YJ9 A;  1PH4 A;  3DLL A;  2UUC Q;  1NJI C;  1PH7 A;  1I5F A;  5AJ3 Q;  1JJ2 A;  1SLJ A;  4LF9 L;  4DR6 L;  2K50 A;  1JJC B;  3D0F A;  2L15 A;  3BZC A;  4X64 L;  2BA0 A;  3U4Z A;  1JE5 A;  2EQS A;  2GVB A;  2BH8 A;  1D8L A;  3RR5 A;  1C9O A;  1MJC A;  2OCE A;  1HNX Q;  2UXB L;  1VQM A;  1EFW A;  1QZH A;  1PYB A;  2E2H H;  3NEL A;  3PCO B;  3L7Z C;  4R4O A;  3CCV A;  4JBK A;  5M3M G;  5IP7 G;  1HNX L;  2C35 B;  3Q8D A;  1IYJ B;  4JYA Q;  4AH6 A;  3HOY H;  1VQJ A;  1MKH A;  3TRZ A;  1X3F A;  1FVI A;  4A3D H;  2Z6K A;  2JA8 H;  3HOV G;  4DV1 Q;  4A4I A;  2UUA Q;  3CCR A;  4AYB G;  1G51 A;  1WI5 A;  3EBE A;  1PH1 A;  4RMF A;  3S17 H;  1OXU A;  4A3E H;  2JA8 G;  2K14 A;  3E9H A;  4QL5 A;  3HOV H;  1YEZ A;  4DV4 Q;  2JA5 G;  3CCU A;  4JV5 L;  3STB C;  2DGY A;  4A76 A;  1TWH H;  4R4C A;  1N9W A;  1QVF A;  1QUQ B;  2EXD A;  3E0E A;  3S14 H;  1NMG A;  4FDB A;  3JC6 6;  1EWI A;  3RZD H;  3F1Z A;  4IFD G;  3CCJ A;  2ES2 A;  4JI2 L;  1OXX K;  1X3E A;  1A62 A;  4JI3 Q;  4LF4 Q;  3S2H H;  2N8N A;  3ER0 A;  3W5O A;  4P74 A;  4DR2 Q;  1AE3 A;  1HZ9 A;  2I5M X;  4C2M H;  5FJ8 G;  4DR1 L;  4AQY L;  1KL9 A;  4NPS A;  2UU9 L;  2PNH A;  5JJL A;  3ULP A;  4P72 A;  4JI8 Q;  4DR1 Q;  4AQY Q;  4IPH A;  5IP7 H;  5EAY A;  5M3M H;  4A3I G;  1M1K C;  5IYD H;  1N36 Q;  5BR8 L;  1SRO A;  2NN6 I;  4LUV A;  1JB7 A;  2GVA A;  1T9H A;  2CFM A;  4H02 A;  1N36 L;  2A1A A;  3CC2 A;  1EQQ A;  4JI4 Q;  2R93 H;  2PMZ E;  4DR2 L;  4POG A;  4BBR H;  4LF5 L;  2UUB L;  1FJG L;  4K0K L;  3S16 H;  2AMC B;  5LMU Q;  2Y0S G;  3GTQ H;  2D0O A;  3CC4 A;  1PFS A;  3M4O H;  2UUB Q;  1FJG Q;  4K0K Q;  4R4T A;  1X65 A;  5M3F H;  2CKZ B;  3UDX A;  1OXT A;  2K5H A;  5C4J H;  1PH2 A;  2UXD L;  1M90 C; 
#chains in the Genus database with same CATH topology
 4YWM A;  4PG3 A;  2XGP A;  4GNX B;  2HHH Q;  1X55 A;  4EEY A;  1VQP A;  4Y7N H;  5I9P A;  1NR4 A;  2EJM A;  5JPN C;  3KTM A;  3ETH A;  1XDN A;  1GHK A;  5FPO A;  2JEI A;  1BNZ A;  3R8B A;  2NZ1 D;  1C8C A;  4DV2 L;  1DV2 A;  3GP7 A;  5ELB A;  5KFK A;  2R92 A;  2R7F A;  4X3U A;  2K4K A;  4DV4 H;  1ESF A;  1B4O A;  3BS1 A;  1KIX A;  3AFP A;  1VMC A;  3HOV B;  4A3B B;  4FBT A;  5KEE A;  5IIF A;  4YY3 Q;  1KJQ A;  1BBU A;  3G4S A;  1R4P B;  1NTG A;  5KFB A;  1G91 A;  4O4H F;  3TQT A;  3M85 A;  1ML0 D;  2HGS A;  2YS7 A;  3RB0 A;  2KEE A;  1Q86 C;  2VQF L;  4ODG A;  4X6A H;  1K73 C;  1KJJ A;  3EQL C;  2KCT A;  4WJ3 M;  3PR5 B;  2JK8 A;  5IGF A;  4NXN L;  4O2D A;  1F77 A;  1N8R C;  5C1P A;  4H13 C;  3STB D;  4Y7N B;  4RNO A;  3VR3 A;  2W7P A;  2RKS A;  3FEW X;  3PW7 A;  5BN4 A;  2NYZ D;  3K5N A;  2NU9 B;  2DPI A;  1LT4 D;  1JCK B;  4KTA A;  2E74 C;  4DK3 C;  2K28 A;  1YHQ A;  1CK1 A;  3GTP H;  2AUJ D;  3H40 A;  2FHT A;  3CME A;  5NUC A;  4YR3 A;  2KSW A;  5DG8 A;  4GC7 A;  1PA6 A;  3RZO B;  4B3S Q;  5KFS A;  2RHQ B;  3G71 A;  4B3T L;  3L4K A;  3BQ0 A;  4A3F G;  2PQE A;  1Y1V G;  4RH6 A;  4JI8 H;  2LS0 1;  1KHI A;  1HH2 P;  5CAE B;  4LJZ C;  4DL3 A;  2JN4 A;  4A3F H;  1PH9 A;  1MZB A;  1A0I A;  1M4V A;  4EG0 A;  4OO1 G;  3HZX A;  3OYY A;  4YR2 A;  4HNV A;  1SNC A;  4JI0 L;  2W6P A;  5BMV F;  1YNN C;  1BNC A;  5KT4 A;  4R8N A;  2OWO A;  2KCM A;  4NKL A;  3X3M A;  5IGD A;  2O5I C;  2JA6 B;  3GV5 B;  4O3P A;  1BKB A;  3CXC A;  3N6X A;  4YCV A;  1Z2O X;  3KYH C;  3C2P A;  4J9P A;  3GTP B;  3MR2 A;  1QE6 A;  4RAU C;  3T56 B;  1GUS A;  1QB5 D;  4KN4 C;  4RB2 C;  2PMZ A;  4FBU A;  1G29 1;  2B2Y C;  4Q0F A;  1VDZ A;  4JV5 Q;  4RA8 A;  4F88 A;  3HOW H;  4X65 Q;  4P73 A;  4IPG A;  4DR7 H;  3D31 A;  1UAP A;  4TQR A;  2B2T C;  4ED0 A;  4K6L A;  3H3V I;  2DZD A;  4Q8E A;  4A3I H;  1KDA A;  1NE3 A;  1AFP A;  2HIV A;  5KFV A;  2R7Z G;  1VQ4 A;  2DNE A;  4KK7 A;  4RWS C;  1KD1 C;  4JV2 A;  2XTI A;  3FMA A;  2LXK A;  1IOV A;  2FMA A;  2C9O A;  1ICW A;  3M7G A;  1VBG A;  1LT6 D;  3MAQ A;  1E2W A;  5CV4 A;  3NBH B;  1XNQ H;  2B29 A;  4B3R L;  2XRQ D;  3J81 c;  4BBS B;  1V9P A;  2AQ3 B;  2F0I A;  2ASB A;  3S1N H;  4GN3 B;  2AKW B;  4N8X 1;  4M1U B;  1GUO A;  1BCP B;  3KF8 A;  4JOI A;  4A93 G;  1Y8O B;  4DA2 A;  1RK6 A;  3N8D A;  2HT1 A;  1ESR A;  2AU0 A;  5DG9 A;  1WD0 A;  3MVV A;  4B9X A;  3NSW A;  4ZI7 F;  4CDE C;  4O3S A;  1K9M C;  5C4X G;  2DIK A;  4LH7 A;  2XWJ B;  2EYP A;  5DAU A;  3U9S A;  3PIP A;  4DV6 Q;  3BJY A;  1LUZ A;  2IHE A;  5JUM A;  2F0E A;  2I8C A;  3RLO A;  3TP8 A;  1Q90 A;  2SEB D;  3GTG B;  4MV6 A;  2FLL A;  1RCV D;  1WJJ A;  2UUC L;  1IL2 A;  1XMO Q;  3Q8P B;  1N34 H;  2PQA B;  1HUM A;  4WD3 A;  4X3K A;  4DR6 Q;  4IJL A;  1KEE A;  5IGE A;  1XXG A;  1ZHQ A;  3GTO A;  1Q81 C;  3TP5 A;  5M3M B;  3S1N B;  3KAL A;  1G6Z A;  2WE6 A;  2IP4 A;  1K8G A;  1K8A C;  1T36 A;  2QDB A;  3S17 B;  2FJ2 A;  2NZO A;  3NWS A;  1SMY C;  4L1K A;  4LF8 H;  4DFA A;  4I7A A;  4JYA L;  2N78 A;  1L0W A;  1EY6 A;  3S15 B;  2RDF A;  3KLR A;  5LP6 F;  1EY5 A;  1AUX A;  2ZM6 Q;  3E5N A;  3GTM A;  4JG2 A;  3SK4 A;  1F2L A;  3GQB A;  2TMP A;  2EYO A;  5JQW A;  4HIM A;  3T53 B;  3N52 A;  1CFM A;  3H0G B;  1JE4 A;  1D7Q A;  5LMN W;  4A3B H;  3WOE A;  4IUU A;  4C3J H;  4YCU A;  3I2Z A;  4K2K A;  4IWX A;  1WTX A;  5IYC G;  2F52 A;  2NVQ B;  3TBI B;  1GKH A;  2WV6 D;  3M9N B;  2HD3 A;  1S68 A;  1DM0 B;  3TS0 A;  3AEV A;  1K8O A;  4EQ5 A;  3GTL H;  1GYF A;  1IZ6 A;  2XD4 A;  4MTK A;  2RCF A;  5I2X A;  2QK4 A;  2QYZ A;  2V59 A;  1WTH A;  3M9B A;  3KOJ A;  4YY3 H;  2E2I B;  1I50 H;  1SSO A;  1V51 A;  2NZH A;  2M05 A;  3CRK C;  3V6K A;  1OWT A;  4HED A;  4JI2 Q;  1FYC A;  2NTS A;  4MZ9 A;  3LWE A;  4DV0 L;  4A3L G;  2QF7 A;  3IG0 A;  5IOC A;  1E4E A;  4A3K G;  2F3W A;  2YU9 H;  5IYD G;  5C0X H;  3ERO A;  1CKN B;  3IN5 A;  1NR2 A;  1X54 A;  2EZV A;  5HBR B;  4Q45 A;  4IUV A;  3PSI A;  4PZ7 A;  4L5R C;  3F8N A;  1YHA A;  4LFC Q;  2F0K A;  1RTN A;  3C3L A;  2BDO A;  2JA8 B;  4QIW E;  5D3D A;  1U4P A;  3QWN A;  2JA6 A;  1XJV A;  2ZDQ A;  1B3A A;  2YL2 A;  1EQT A;  1YJN A;  1VQ8 A;  1WTV A;  1U5K A;  4JK1 C;  2MNA A;  3OUU A;  1N36 H;  4Q5V A;  4ILW A;  4XT3 B;  1JT8 A;  1CI3 M;  3GIQ A;  4J9K A;  2VUM A;  2VW9 A;  1I3Q A;  3AYH B;  4L6T B;  2J9G A;  3DUZ A;  4BXX H;  2C5C A;  1E1T A;  4JBW A;  5FO7 B;  3KHR A;  1CE8 A;  1AN8 A;  3OTO L;  1CS0 A;  2CWA A;  4K5V A;  2VUM G;  4DAY A;  1T94 A;  5KFD A;  4JBM A;  1N33 L;  5L1L A;  3F2B A;  2VL6 A;  3OPO A;  1X3G A;  4YWL A;  5M5X B;  3RLN A;  1O7L A;  3R5F A;  1ZXT A;  3GTJ H;  2MHV A;  1SE8 A;  3MEH A;  3PO2 G;  1IBL L;  3HKZ A;  3JSL A;  3V4Z A;  1GGO A;  2B2U A;  4OXP A;  4LFA Q;  1TS5 A;  5C44 H;  2F0Q A;  1HCZ A;  4X66 L;  1VQC A;  1EQR A;  2EJF C;  4GN5 A;  5CC4 A;  2W8L A;  2UXC L;  1DD2 A;  1BBX C;  4YQW A;  2IHF A;  2XIG A;  1VS0 A;  2K5V A;  4B3M Q;  2FFK B;  3RBE A;  2NWG A;  4L5S A;  3RUP A;  3Q23 A;  5FOB B;  3UDF A;  1PFB A;  5L37 A;  2ZJR A;  1WTO A;  2X0S A;  3GTK H;  3O13 A;  1PTO H;  5KFW A;  1NMF A;  3A54 A;  2FPP B;  5LL6 S;  3J7A 5;  1SAP A;  2NU7 B;  3K81 C;  3SK8 A;  4C3I H;  1GUT A;  3HFZ B;  3UDI A;  4FF3 A;  4YAK B;  2XVS A;  1GO3 E;  2YS6 A;  4UP8 A;  1S0M A;  3SEB A;  2V9W A;  2KHI A;  4JBJ A;  4DUZ L;  4LF7 H;  1E7Z A;  3H3V C;  4C3J B;  1L1O A;  4I65 A;  1CHP D;  5JJK A;  3GTM H;  3K5M A;  2C2R A;  2F4V Q;  3Q8S B;  4GNX A;  4HCS A;  3H94 A;  2K05 A;  5LXT F;  2UU9 Q;  2ASD A;  4JI4 L;  4ZLT F;  3AMU A;  5F9L A;  2XCL A;  2QW7 A;  2Z6B A;  3MWM A;  4QUC A;  1JKJ B;  1H9R A;  1YBY A;  3NQT A;  3ERS X;  2E2J H;  2F1M A;  5GAH C;  3A5U A;  3H15 A;  4FF2 A;  4YWK A;  2RSN A;  1WTW A;  1KNA A;  4DUY L;  4DV3 L;  4ZUJ A;  2IW3 A;  4OX9 Q;  4ETS A;  5J39 A;  1ULZ A;  2GN5 A;  2ASL A;  4DUY Q;  4ECY A;  1VF7 A;  4MTN A;  3M4O B;  4JPB W;  1UE5 A;  3KLW A;  4GKK L;  1KQS A;  1EWC A;  3J7Z C;  3J7Y W;  4RFB A;  1XNQ Q;  2CQA A;  5IE8 A;  2VOB A;  2CH4 A;  1SYF A;  4TQU S;  5C4H A;  4J8Q A;  1VF5 C;  5C3E B;  2JA7 A;  5KNC A;  2KQ3 A;  4OWX B;  2R93 G;  4DAY B;  2A5H A;  1H9K A;  4JI5 L;  4APV A;  4POF A;  4DV7 L;  4NXM H;  3ONA B;  4JI6 H;  3I90 A;  5EOY A;  1OXS C;  1R9T H;  1PTO C;  4A3G B;  3QO2 A;  3NK9 A;  3R23 A;  1KC7 A;  1KDC A;  3PV0 A;  5E4X A;  1RHP A;  1A8V A;  1EUD B;  1TU2 B;  5M5W H;  2F0J A;  5KFE A;  4YP3 A;  3WO0 A;  1CA5 A;  3MFY A;  1ASY A;  2F4V H;  4ME5 A;  4LFA L;  4FF4 A;  2FLP A;  1HHV A;  1I4H A;  2NVQ H;  2CW8 A;  4DV6 H;  2MQH A;  4JI6 Q;  3PF4 A;  1AW7 A;  2C28 A;  2V4D A;  4C5B A;  2IL8 A;  2HDM A;  1Z6H A;  3FKI H;  3K5O A;  2K01 A;  4DL5 A;  4XQN A;  4A3F B;  1VBH A;  2QKI C;  3RZD B;  4IRC A;  1I5F A;  4C3I G;  1CTM A;  4LF9 L;  2NVT B;  3OSN A;  3U9T A;  3DF7 A;  1H9S B;  3BZC A;  4IAJ A;  1L0X B;  4P2C B;  4DR3 H;  1MJC A;  3VR4 A;  1EYZ A;  4PQX A;  4I50 F;  3KXY T;  2NUA B;  3NEL A;  3PCO B;  4R4O A;  4JBK A;  2XN9 C;  5KG1 A;  3HOY H;  4HSV A;  4A3D H;  2XCP A;  4KHV A;  4RZR A;  2JA8 H;  2UXC H;  3A8I E;  2VA3 A;  1R4Q B;  1VMP A;  3SE7 A;  2G9D A;  4K0K H;  1G51 A;  3QFF A;  1WI5 A;  1TWG A;  3T5K A;  3J81 E;  4RMF A;  3S17 H;  4B3S H;  4DR2 H;  3SK6 A;  2KUM A;  2EY5 A;  1OXU A;  4A3E H;  3HOV H;  2K14 A;  4DV4 Q;  3CCU A;  3GV3 A;  4F4W A;  4R4C A;  5DEH A;  5DGA A;  1ILQ A;  1NMG A;  2A73 B;  1EU4 A;  1NSN S;  4DNR B;  3A8K E;  2ES2 A;  1X3E A;  2UU9 H;  3S2D B;  3PIP 3;  1AE3 A;  4C2M H;  2I5M X;  1I3Q B;  4KKU A;  5FJ8 G;  4I7H A;  1PRT C;  4BWG B;  3KK7 A;  1Y69 U;  2UU9 L;  1S0N A;  2PNH A;  5JJL A;  1IKM A;  2R61 A;  2L9H A;  3E5S A;  5EAY A;  1TVX A;  1M1K C;  5IYD H;  4IRK A;  2J6U A;  1JOR A;  1S10 A;  4B08 A;  4A3K B;  1PDQ A;  4WRD A;  1JDB B;  2GVA A;  2CFM A;  4H02 A;  4A2A A;  5EWF A;  1TY0 A;  3MFI A;  2B8G A;  1LTT D;  4E6I A;  5CYU A;  3GTL B;  1SYX B;  2VB3 X;  1I4Q A;  2R7L A;  4TKO B;  3MZ5 A;  4LFC H;  3M4O H;  5D3I B;  3URY A;  3EVQ A;  4WJW A;  1RYR A;  3WO1 A;  2UXD L;  3PUW A;  4NDX A;  1RJQ A;  3N6R A;  4DR3 L;  1EZ6 A;  2RDG A;  3OW2 A;  4QCL A;  1WR2 A;  3BG5 A;  1VQD A;  2I80 A;  3VPD A;  1QZG A;  2VY3 A;  2FKL A;  2EPB A;  2WAQ A;  4AYB B;  4DR5 L;  1J6Q A;  4DV7 Q;  1RTO A;  4LNQ A;  1B6R A;  3GV8 B;  5CV8 A;  1UE6 A;  1C48 A;  5I6W A;  5JVD F;  2EYL A;  2C2D A;  1DCZ A;  4O2A F;  3AB9 A;  1SMX A;  5KFA A;  3FKI B;  2KHJ A;  1S3O A;  1SYG A;  2Q2H A;  2CWP A;  3GTM B;  3G48 A;  2R3Z A;  1UUP A;  1ASZ A;  1VQN A;  1B7Y B;  1EWH A;  4I55 F;  5F9N A;  5DGB A;  1TA8 A;  1PYW D;  2F3I A;  2QDL A;  3PVX A;  1DGS A;  5CMD A;  4ECR A;  3H0G A;  2YRW A;  2W6M A;  3FVQ A;  2V4R A;  3N40 P;  5CGK A;  5ELD A;  5LOV F;  5IGC A;  2E2J B;  2VB2 X;  3H4D A;  2PO4 A;  2N3S A;  2FK1 A;  4OEL B;  4PZ6 A;  4IFD H;  3RV4 A;  3X3N A;  2AWO A;  2UXB Q;  1Q8I A;  1X56 A;  4JI5 H;  3RB6 A;  1NUC A;  1PXU A;  2FLN A;  1TWG H;  2EIF A;  3DWP A;  1X32 A;  3GDE A;  1X3Q A;  1F2M A;  1M0W A;  1L0Y B;  3EFX D;  3RAQ A;  3K5H A;  4C1N K;  4LF8 L;  4TV9 F;  3T51 B;  2W70 A;  2VZA A;  4XTC S;  2PMZ B;  1MD2 D;  2VUM H;  3SVM A;  3C1F A;  3OUZ A;  1I4G A;  4LF4 L;  2VA2 A;  4BXX G;  3V6H A;  3N41 B;  1AE2 A;  3LGJ A;  2NVY A;  2UVV A;  3VYT A;  4C2M B;  1QCB D;  2IWH A;  4X65 L;  3G6V A;  1VQ5 A;  4UCT A;  3GD7 A;  4XYL B;  1TWG B;  4JVZ A;  1X9N A;  4F4X A;  1SYC A;  1UNS A;  3T13 A;  1F9Q A;  4DR4 Q;  1VQH A;  4JI4 H;  3MEF A;  1SDF A;  1KXL A;  1WCM H;  1J5E L;  1PRT F;  1JC7 A;  3UE0 A;  4Q8F A;  2R87 A;  2EYH A;  1TR5 A;  3T5H A;  4HAE A;  1XMQ H;  4RHR A;  5IT9 L;  2A6E C;  2WDT A;  4OX9 L;  3I12 A;  3BQ1 A;  4A3D G;  2XGQ A;  2F0P A;  1S03 G;  2LSS A;  5IWA Q;  2NU6 B;  2B39 A;  1U4M A;  3NBI A;  4EGV A;  4DAV A;  2NVY B;  4C5C A;  2ZJP A;  2PNR C;  1XTD A;  4YHH H;  1GXD C;  1SNQ A;  2AHO B;  2PPB C;  1XNQ L;  5HGQ A;  4IUQ A;  2YTY A;  3W1B A;  3ERQ A;  4DV5 L;  4O4L F;  1GVP A;  2YYA A;  5K2M A;  3T1H L;  2HIX A;  2PI2 A;  3I4M G;  3FDS A;  1Z2P X;  4A3M H;  3HBL A;  3MJF A;  1CKM A;  4L5Q A;  5IT9 W;  1N34 Q;  4UP7 A;  4R4Q A;  3G6E A;  1XMO H;  5LMU L;  4KN7 C;  2JSO A;  3AFQ A;  1GM5 A;  2E5L Q;  1E4G T;  1K8M A;  2R7K A;  3UFX B;  4ECX A;  4RHS A;  2VPS A;  4X66 H;  3T1Y Q;  4G4K A;  3TME A;  1J5E H;  2W7O A;  3PGZ A;  4C5A A;  2Q2I A;  3L4J A;  4QWA A;  4GN4 B;  4NP5 A;  1DZ1 A;  2AQ1 B;  4YBZ B;  3OIQ A;  1WH2 A;  4QWE A;  4AYB A;  1CZW A;  3V96 A;  4L63 B;  2JA7 B;  4IUP A;  1K0S A;  4A3G H;  5KFN A;  4G7O C;  1STE A;  4MHE A;  4LF9 Q;  4DK1 A;  3UE1 A;  2F0G A;  5HY6 A;  2ID0 A;  2I0Q A;  3VYU A;  4IOA A;  1VQA A;  4KY7 A;  4LF4 H;  5JVH 3;  2FXQ A;  2K32 A;  2D2C C;  2LKV A;  2Z1C A;  2Z9H A;  2EVB A;  1KNE A;  2WKC A;  2BDN A;  1A9X A;  4KKS A;  1QUQ A;  1ET6 A;  1E3P A;  1DON A;  4EBE A;  2FIN B;  4ED3 A;  1I7L A;  4HJA A;  3GV7 B;  3PUV A;  1TWA B;  2V4Q A;  3S9W A;  2ALZ A;  4WFN 3;  4DNT B;  2MP1 A;  2DY8 A;  1ZET A;  1WD1 A;  3GTK A;  1T5X D;  1YJW A;  1U4R A;  2B3G A;  1XPR A;  2NVT H;  1SEI A;  1UC8 A;  3RTX A;  3HOZ H;  4LSX A;  4LF8 Q;  4K6D A;  2QGQ A;  5FLM H;  2KJX A;  3HOX H;  1QVG A;  1BCP C;  2CW0 C;  4RCO A;  2RA4 A;  3BYT B;  1HR0 L;  3GTP A;  4WOR A;  3S16 B;  4Q43 A;  4RB1 A;  4RUC A;  3M3Y B;  4OWT B;  4PWQ A;  5FLX E;  2L55 A;  1LTL A;  1FL0 A;  4TRD A;  1VQ6 A;  2VQF H;  3CCQ A;  3CAM A;  1I50 B;  1AP0 A;  1HXY D;  5KFH A;  2NU8 B;  4QY7 A;  3GIK A;  1O7Z A;  1MIU A;  4F4Y A;  3JSN A;  2LXJ A;  1S5B D;  3EJI A;  4DV4 L;  3R5H A;  3RF2 A;  4MA5 A;  4OEM B;  3LNN A;  1FNW A;  1AEX A;  1B04 A;  5KFL A;  3I72 A;  1D5M C;  2W9B B;  2MO1 A;  2EY2 A;  2IA6 A;  5E7N A;  3VYR A;  1BO0 A;  5M5Y B;  1BXR A;  4MA0 A;  4J0M A;  2JA5 A;  2ZXO A;  1XNR Q;  1JJG A;  2SCU B;  1TS2 A;  1PX2 A;  3GV6 A;  1IBM L;  5IYB H;  3S1M B;  4WBN F;  1C7Y A;  2PBZ A;  1U9R A;  2IBK A;  4DXG A;  3EIV A;  4XDX A;  4O4I F;  2KCN A;  2K5Q A;  3I4O A;  1WOC A;  1Y8N B;  3NXW A;  1NCV A;  4LFC L;  1A3U A;  1ET9 A;  2B2W A;  1W6J A;  5KIX A;  1HUN A;  1IYV A;  4RKB A;  2C00 A;  4L5T A;  4LF5 H;  3H6M A;  5KG3 A;  1QOH A;  1PMR A;  4YIJ A;  4CDD C;  3PW0 A;  2JEJ A;  3BU2 A;  5I9O A;  2FJZ A;  3F2D A;  1RD9 D;  5CB4 F;  2R7M A;  5CA0 F;  5DQG A;  5IT9 c;  1RK5 A;  1WSC A;  5C4X H;  4EFE A;  2F0D A;  5GON F;  1RJT A;  3M4I A;  4LAA A;  2YU9 A;  1EY8 A;  2K52 A;  2ZTD A;  2E8G A;  5GAD C;  3KF6 B;  5I2Y A;  4FM9 A;  4ME6 A;  3IAY A;  3CW2 C;  4LWC A;  3SDZ A;  3T1Y L;  2HHH L;  1F2Y A;  3L3O C;  4KHP Q;  2ATL A;  5AJ3 L;  3A55 A;  3S1Q H;  1KLG D;  2K7V A;  5DQH A;  3EPG A;  3K8A A;  5A35 A;  3FHW A;  3QJY A;  3NHH A;  1Q8K A;  5KGU A;  1I94 Q;  2E2H B;  2GPW A;  4RGN A;  2YTV A;  5CBA E;  1OXV A;  4FXG C;  4R7R A;  3MWY W;  5BN3 A;  4HQ6 A;  1JXL A;  2J6S A;  1C3O A;  2F0S A;  1N32 L;  2H1E A;  5KT3 A;  4ZK9 B;  2RSO A;  1SR3 A;  2RVL A;  1EU3 A;  1STY A;  5KFT A;  1PLF A;  2VQE L;  1A15 A;  5FLM G;  2ZDH A;  2IJ0 A;  5KG0 A;  4RNN A;  1XMO L;  1HNX H;  2JJQ A;  4CC5 A;  3K6O A;  1Y1W H;  3K59 A;  3CF5 A;  5C5L A;  2WB1 B;  1YIT A;  3T1H H;  2F0N A;  1SNP A;  4DV5 H;  3TP7 A;  3HKZ B;  2EJG C;  4K8J A;  2MUY A;  4A3K H;  4YHH L;  4J9M A;  3Q8R B;  3MXG A;  2R8G A;  4IR9 A;  1HR0 Q;  4DN4 M;  4EVO A;  3R2I A;  3Q2O A;  4DR7 L;  1SFO A;  4UFZ A;  1VQK A;  3RB3 A;  2C22 A;  3J81 W;  3GTO H;  1Y14 B;  4UPA A;  1WTR A;  4ECZ A;  3S2H B;  5LMN Q;  5FLX c;  2ALY B;  2EYJ A;  1XYI A;  3D4D A;  2EOT A;  2F4V L;  4O3R A;  2R92 G;  4UCV A;  2W9C B;  3ICE A;  5C6A A;  3K0Y A;  5DM7 3;  5M3F G;  4MV4 A;  1I94 H;  2HVR A;  1V8Q A;  5C1O A;  4B9W A;  2NVX A;  4JUZ A;  4ZUI A;  3I70 A;  1VQ7 A;  4DAP A;  1SJH D;  4ECQ A;  1HR0 W;  1QNK A;  2BCO A;  2KVM A;  2WB1 G;  3HOU H;  4GZY C;  1TWC A;  4JI0 H;  2BE5 D;  5G3L D;  2ZDG A;  3T5J A;  5BR8 Q;  4LUZ A;  2XNA C;  2Z6K C;  2ICI A;  4DF7 A;  5KG2 A;  1EZ8 A;  2E2D C;  2LY7 A;  2F3V A;  3BDC A;  3DWQ A;  4JI8 L;  3J81 L;  3CCS A;  4A3J H;  1G2T A;  3CCL A;  2A8V A;  1DYQ A;  3GTO B;  1KAW A;  4EYH B;  1BVS A;  4B3T H;  2G5D A;  3FPP A;  3KDF B;  1E4E B;  1TAE A;  4DL6 A;  1E1O A;  3RV3 A;  1Q3L A;  1ONL A;  4Y52 H;  5H1S E;  5KFU A;  1XPO A;  4LF5 Q;  2VR1 A;  1TWA H;  4KHP L;  4MTD A;  1ILP A;  2Q8T A;  1CKO A;  2DN8 A;  1YIJ A;  1KJ8 A;  1VQE A;  3EA6 A;  2W6N A;  4LFB L;  4V0B A;  3RIZ A;  4DV3 H;  2E2I A;  4KMU C;  1D1I A;  1E4F T;  3U50 C;  1KBL A;  1N33 Q;  4QJF A;  4J9L A;  4ZKB B;  4LF6 L;  4XZ3 B;  1PTO B;  3MR3 A;  1E2Z A;  1WFQ A;  3OTO Q;  5FJ8 H;  1VQ9 A;  5C44 G;  3H91 A;  3IFD A;  3W1G A;  2OQ0 A;  2MJ8 A;  2B63 G;  3NUC A;  1Q82 C;  5J22 A;  2ATW A;  2AQ2 B;  1E0B A;  1PH5 A;  4BBR B;  4HR7 B;  4FS2 A;  1ZEQ X;  5KG6 A;  1YI2 A;  3NGD A;  4DU9 A;  3BDL A;  3I55 A;  5DLF A;  1KTK A;  3I4N B;  1LM0 A;  3S14 B;  2K04 A;  2UUA H;  1NJI C;  1PH7 A;  5KYL A;  4DUZ H;  3MXN A;  1JJ2 A;  1K83 B;  1EOT A;  3Q1K A;  1SLJ A;  3OMC A;  2K50 A;  4DR5 H;  2DPJ A;  1DOL A;  1JJC B;  1QJO A;  4RGO S;  1IBK H;  2GA4 B;  3OSO A;  4X64 L;  2EQS A;  2BH8 A;  1D8L A;  3WDN A;  1HNX Q;  1M7J A;  1EFW A;  4Q0Y A;  2UXD H;  1I6H B;  3NTH A;  2C35 B;  1HNX L;  1IYJ B;  1WCM B;  2PZU A;  4J1M A;  2R93 A;  1LTR D;  4MV1 A;  1G8Z D;  4A4I A;  5C4X B;  3PR4 A;  2V58 A;  1K1Q A;  1BCP F;  3CCR A;  2UUB H;  5KKN B;  1FJG H;  1HFG A;  3T4A C;  3D6W A;  4G57 A;  1II3 A;  3N44 B;  3E9H A;  4QL5 A;  1W96 A;  1YEZ A;  4IR1 A;  2JA5 G;  4ED7 A;  4JV5 L;  4N9T A;  3BA8 A;  1TWH H;  1IOW A;  5T14 A;  3TIN A;  5D65 A;  2NVX B;  1QUQ B;  2EXD A;  1O7Y A;  1GLV A;  1EWI A;  1Y8P B;  3NTI A;  4S3S A;  4IFD G;  3CCJ A;  2VQD A;  3S2H H;  4C3J G;  3BQ2 A;  4HMI A;  2WTF A;  3ER0 A;  4DR2 Q;  5LA6 F;  3ULP A;  4IZ8 A;  4JI8 Q;  4G7H C;  4O3Q A;  4IPH A;  5IP7 H;  5M3M H;  1STG A;  4F87 A;  1STH A;  1JX4 A;  4KD4 A;  3QOJ A;  1LTS D;  1TY2 A;  4LUV A;  2NN6 I;  3BVG A;  1PK8 A;  1F9P A;  3TZU A;  2CW7 A;  2R93 H;  4JI4 Q;  3CC2 A;  1EQQ A;  3NBH A;  2O5J C;  3P1H A;  4POG A;  3HS0 C;  4DL4 A;  5HGT A;  4LF5 L;  2K5D A;  2R6F A;  4RB0 A;  5KT5 A;  5G3L F;  4FXK C;  1Y1W B;  4EGQ A;  3GTQ H;  2D0O A;  1PFS A;  1FNV A;  4DL2 A;  1X65 A;  4IUR A;  1TII D;  1IBM H;  3I4M B;  3ZYY X;  3HEJ A;  2K5H A;  4JV0 A;  5C4J H;  3RUZ A;  2WIN B;  1EUC B;  5CV6 A;  2MFI A;  2Z8L A;  3DM1 A;  1S5E D;  1A2U A;  4JI5 Q;  2UXB H;  4GC6 A;  1MGS A;  4FVM A;  5C3E G;  1EY0 A;  3PUX A;  1PVO A;  4RKL A;  2JA6 G;  3GIM A;  5ELO A;  1Y1W G;  4DV0 H;  4C3H G;  5KFG A;  3GTG A;  3ND8 A;  1JWU D;  1SRU A;  5K5P A;  3GII A;  4U7C A;  2NB0 A;  3SXH A;  3AQQ A;  1UEA B;  4P75 A;  4R1J A;  4BBS H;  4LFB Q;  4X62 H;  2Z4H A;  4UHV A;  5IT9 E;  4A3D B;  3R5X A;  4EQP A;  4HJ5 A;  2ZXP A;  1WCM G;  3K57 A;  4GS3 A;  4HSP A;  3HP3 A;  2VPQ A;  2HJW A;  1V1O A;  3CPW A;  1NNX A;  4QIW B;  2AWN A;  5IP9 G;  4DV2 Q;  5ISR A;  1SN8 A;  3MXU A;  3I3C A;  1V4Y A;  4F50 A;  4N9P A;  1UEB A;  4BY7 G;  5KFZ A;  1OO9 B;  4ED8 A;  2I07 B;  4IPC A;  2DNC A;  2YU9 B;  4EX5 A;  4IAL A;  4LF6 H;  1UE7 A;  5JH7 F;  4NXM L;  4B3M L;  3VYS A;  1MSG A;  2G9H D;  3QOL A;  3KF8 B;  5COR A;  1HPC A;  1YNN D;  1SFO B;  3RGX A;  4OON A;  2AGO A;  3DEO A;  3I73 A;  3QZ8 A;  1KAA A;  1STN A;  1PRT B;  4DXF A;  1ZYR C;  1RIP A;  4J15 A;  2RGV A;  1AN7 A;  1BDO A;  3VDY A;  2R85 A;  2EYF A;  4ED6 A;  1T5E A;  1M0T A;  3IL8 A;  1VQL A;  5T1G A;  2W57 A;  1BUV T;  2NVX H;  3ULL A;  3MA2 B;  3KAJ A;  3KJO A;  3V6J A;  2R7Z H;  1EFI D;  1PZI D;  3UI2 A;  3CHB D;  4XXE A;  1WCM A;  2HQE A;  4B3T Q;  1JOK A;  2PCF B;  4X62 Q;  2YTX A;  1JIC A;  3GID A;  1H9M A;  2FP4 B;  4C56 C;  2RHS B;  5KFP A;  3RB4 A;  4L8J A;  2OF1 A;  4MNO A;  4G7Z C;  4FU0 A;  4GLX A;  5IWA L;  1SFO H;  4JOI C;  2KEC A;  1GD7 A;  2OXP A;  4R8I A;  3J7A K;  4JI3 L;  3H0G G;  1AUV A;  1MJE A;  2I5L X;  2NVY H;  1V1Q A;  4A3E B;  3K3V A;  3PO3 G;  5C44 B;  1EOV A;  4GOP C;  2JQO A;  2BQ3 A;  2J0T D;  1SXT A;  1Z7T A;  2JA9 A;  5EBC A;  4BA1 I;  1KJI A;  5IP9 H;  3J81 i;  2AUK A;  2AGP A;  1S72 A;  1IHZ A;  3NE5 B;  5GAE C;  4B3R Q;  3Q22 A;  4LF7 L;  3HXL A;  4IPD A;  1KLU D;  4DNI A;  2FPI B;  2JXM B;  2OEO A;  4KHZ A;  1Y1V H;  4RU9 A;  3S1Q B;  3DMU A;  4HID A;  2RQX A;  4IFD J;  2FK2 A;  2HVS A;  4QGU A;  3BDO A;  1G6P A;  4EQO A;  4U68 A;  4E4T A;  5COY A;  3E3X A;  5C0X G;  2YRX A;  4DV5 Q;  3IKJ A;  1VQO A;  2PN1 A;  4X3S A;  1I6H H;  3BVZ A;  3AU7 A;  4UCR A;  1A63 A;  4UCS A;  4LSA A;  4EBD A;  5JAV A;  2VS1 A;  5L1J A;  1VQI A;  1M6V A;  2R86 A;  2VQE H;  2AQ4 A;  4OX9 H;  3W3A A;  2E5L L;  1TWF H;  4MAM A;  1EIF A;  2F0W A;  2KBN A;  3M4P A;  2M2L A;  4RZQ A;  2QEX A;  1CHQ D;  3HG9 A;  4DR3 Q;  1VKZ A;  1PFN A;  3I4L A;  4PMW A;  1OTC A;  4J9N A;  1K3R A;  5EQ0 A;  1N33 H;  2R92 B;  2DY7 A;  5IYZ F;  2C2E A;  3E9I A;  5C5M A;  4JI7 Q;  1LYL A;  4HJ8 A;  2L4N A;  1HNW Q;  5DLG A;  3TDQ A;  2HHH H;  3RJ0 A;  2FMM A;  4MV3 A;  4DLK A;  2FB9 A;  5IY0 A;  2VUG A;  1B70 B;  3L2P A;  3PUZ A;  3OHB A;  2WP8 J;  1JWM D;  4HIO A;  4J9S A;  2B63 H;  4HMJ A;  1CA6 A;  3A5Z B;  4DV1 L;  1IBK Q;  1VAJ A;  4DGZ A;  3KBX A;  2E76 C;  3H09 A;  1VQF A;  1HZB A;  1QG7 A;  1BBW A;  2WAQ G;  4DUZ Q;  3DWA A;  1EYG A;  2JA5 H;  1CSP A;  3R2T A;  3HOZ B;  5K36 H;  1A3T A;  2R6G A;  3BZD B;  1JOO A;  1MI2 A;  3GIL A;  1Q46 A;  3RNU A;  5A2Q W;  2H4O A;  1S40 A;  2YW2 A;  3D6C A;  1WVL A;  4X64 Q;  2OTJ A;  3WNZ A;  4B3M H;  4ECU A;  4NLG A;  1LTI D;  3FMC A;  2MPM A;  1SE2 A;  5KFM A;  3HRZ C;  3PW4 A;  5ELC A;  5KFF A;  2WFW A;  1SJE D;  2W8K A;  3RAX A;  3GTG H;  1SMY D;  5C3X A;  2P0A A;  4EYI B;  2I5H A;  2KED A;  3I56 A;  5DQI A;  3K5L A;  1X6O A;  2SDF A;  3BVM A;  3CP0 A;  2I87 A;  4DV3 Q;  4O2B F;  4UP9 A;  4FF1 A;  3VR6 A;  4EEQ A;  3G6J B;  4A3J G;  1M8A A;  3NTK A;  5K36 G;  2Y0S B;  4ED2 A;  2PYK A;  2OH2 A;  4HNU A;  3FRP B;  4R4I A;  2BH2 A;  1LTB D;  4WJ4 A;  1VQG A;  3OHA A;  4QIW A;  5H80 A;  3IRB A;  4ECS A;  4KLK A;  2JA7 H;  2A69 D;  1J5E Q;  1BR9 A;  1QVC A;  1GSA A;  4DK6 C;  4FYD A;  1CZG A;  1EY4 A;  2F0V A;  4UAI A;  2ZJQ A;  2UXD Q;  3KFU A;  3TII A;  1AZP A;  1EIH A;  3QG1 A;  2JE6 I;  3CRL C;  4CKC A;  4GLV B;  4TUY F;  5EWE A;  1D2B A;  3K7U C;  4BBS G;  3LP8 A;  5D1O A;  3RFC A;  4J6H A;  4ZQI A;  3M4Y A;  1Q12 A;  3BJU A;  4CBV A;  3CVZ A;  3J80 c;  2HVQ A;  4PV1 C;  4OIK A;  1XX8 A;  4AYB E;  3HOW G;  4K5W A;  3RN2 A;  1W2B A;  2F0T A;  4CJ2 C;  2NTT A;  2QIL A;  5KND A;  3HKS A;  1CKN A;  1L1O C;  3CMA A;  1S5C D;  2W6Q A;  4NB3 A;  4YJ3 F;  1C30 A;  5LL6 b;  1FGB D;  4DR1 H;  4AQY H;  3PW2 A;  5DG7 A;  4KJO A;  2UUC H;  1TWA A;  4IZO A;  2WII B;  4MV8 A;  1H9J A;  5ELE A;  3TSS A;  2B2T A;  2SOB A;  4JI2 H;  2VQE Q;  1FNU A;  1B44 D;  5C0X J;  2W9B A;  1KC8 C;  5IGB A;  2EDG A;  4LK1 C;  2OQK A;  3D4R A;  4OO1 H;  1CQI B;  4MN3 A;  2CVR A;  1B1Z A;  4B3S L;  3NEN A;  3TQY A;  3PO2 B;  1B53 A;  2CW0 D;  2WAQ B;  3DM3 A;  1B33 N;  4ULL A;  1W93 A;  2B63 B;  4QWB A;  4P71 A;  5I4D A;  4I4T F;  5HUR A;  4ALP A;  3H4B A;  2L0C A;  2WAC A;  1EYC A;  4XQQ A;  5KX5 F;  1BJT A;  3HKZ E;  1NY4 A;  2VUM B;  2XC9 A;  2RDH A;  5F2D A;  1IBL Q;  4B3R H;  1JLL B;  2ZJT A;  4BY1 B;  3TZD A;  3F2C A;  2B8F A;  4X64 H;  5DNF A;  1IW7 C;  1RKN A;  1V1P A;  2B2V A;  2N55 A;  2PZT A;  4OO1 I;  4DR6 H;  1DOM A;  1D5Z C;  4OWW B;  5L9X A;  1LTA D;  4HJ7 A;  1CM9 A;  2UUA L;  2OTL A;  2PQA A;  2EYM A;  3PO2 H;  2IX1 A;  3E0J A;  5KT7 A;  1IYU A;  2L1B A;  1V43 A;  2F4I A;  3M9M B;  2CHB D;  1D5X C;  4ED1 A;  4IRD A;  4JI3 H;  4PDB A;  1GUW A;  2ENB A;  4IFD I;  1K1S A;  1LAC A;  5C5J A;  4LFA H;  5J3B A;  4M9U A;  5KT2 A;  2K03 A;  3S2D H;  4ZKC B;  5EJW A;  3U58 A;  3TRE A;  5KRU A;  3CC7 A;  4GKK Q;  4XYO A;  4GNX C;  4A3J B;  1B3Q A;  4DV7 H;  1PHJ A;  3MR6 A;  4NMZ A;  3BAB A;  3VMM A;  3EN2 A;  2WB1 E;  3K0X A;  4XIG S;  1ENA A;  3Q6S A;  4IN3 A;  3A56 A;  1PTO F;  1MBY A;  5IOD A;  4NW2 A;  4JI1 H;  1EYA A;  2XSC A;  2ZT9 C;  3L0O A;  1LTG D;  2YYZ A;  3QB3 A;  4GKK H;  3J80 L;  2DLN A;  4LF6 Q;  3PIO 3;  4A93 H;  3MFH A;  5KG7 A;  3IFT A;  2FPG B;  1KRS A;  1N48 A;  4A3E G;  4QWD A;  1XNR H;  5D14 A;  4MTE A;  4IO9 A;  4LMQ D;  4LH6 A;  1S4Z A;  4PZ8 A;  1SND A;  2CQO A;  1I94 L;  1U4L A;  3HOZ G;  4EFB A;  2NN6 G;  5KFC A;  1IKL A;  4OHJ A;  4UY8 C;  2VNU D;  1P8L A;  1YZ6 A;  2QEJ C;  3GTL A;  2JEB I;  3MWD A;  1VCI A;  1Z47 A;  5M5X H;  1K0R A;  5BPF A;  2H5X A;  1O80 A;  3RBD A;  2QCP X;  4ID6 A;  4OGQ C;  1Y1W A;  3CQZ A;  2F0F A;  4KY5 A;  2VQF Q;  4CDF C;  4KD3 A;  2UVW A;  2GPS A;  5LL6 X;  2Q8R E;  1YJ9 A;  1ZQ7 A;  1I6V C;  4KJN A;  4PMC A;  2JEF A;  4O1N A;  2K5W A;  2Q8I B;  1KAB A;  1A3V A;  3L9A X;  1CQJ B;  3D0F A;  3R3O A;  2O03 A;  3VA7 A;  2BA0 A;  1GSO A;  3U4Z A;  1JE5 A;  4H0L C;  2GVB A;  1L2Z A;  3A7L A;  4RAZ A;  3JAM E;  2UXB L;  1QZH A;  1PYB A;  4BS9 A;  2E2H H;  4HR7 A;  3CCV A;  3K7A B;  3L7Z C;  1B9N A;  4M8A A;  3Q8D A;  5EDW A;  5EKK A;  4BY7 B;  1EIG A;  4C2M A;  1TQO A;  2Z6K A;  5FD5 A;  5FO8 B;  3C0F B;  4FXD A;  5FKA C;  1JR0 D;  4AYB G;  1PH1 A;  1I4P A;  3QR8 A;  2LMC B;  3HOW B;  2WYO A;  2IMW P;  1RYS A;  3T5L A;  4H7B A;  1H9S A;  1QVF A;  5KG5 A;  1J9O A;  3E0E A;  4FDB A;  3JC6 6;  3RZD H;  1B2T A;  3F1Z A;  5I47 A;  4JI2 L;  5JEA H;  4JI3 Q;  1A62 A;  2B2U C;  3RMH A;  3SI8 A;  2NN6 H;  4P74 A;  4CKE A;  1HZ9 A;  3BA9 A;  4DR1 L;  4AQY L;  5JVG 3;  4J9R A;  3JAM W;  2UVR A;  3T1Y H;  4NPS A;  2HCC A;  4P72 A;  3D4W A;  2NBF A;  3K58 A;  3G7L A;  3KHH A;  1N36 Q;  2M9V A;  2RBM A;  1KDB A;  2EE1 A;  1QIL A;  3FPU B;  1JB7 A;  1SRO A;  3GTQ B;  2X69 A;  1T9H A;  1N36 L;  4ZQ3 A;  4RCN A;  5CV9 A;  3VR5 A;  4BBR H;  4A93 B;  5EWG A;  1EEF D;  1SYD A;  2PW5 A;  5C4J B;  4K0K L;  3S16 H;  2Z4I A;  4HNT A;  4IWY A;  2W9C A;  2Y0S G;  1O78 A;  4K0K Q;  2X6G A;  3FKI A;  2CKZ B;  3T16 A;  3UDX A;  1OXT A;  3CU7 A;  3G8C A;  5L1K A;  3HOU B;  4QB4 A;  3PUY A;  5JEA J;  3DHQ A;  4JI1 Q;  4CGY B;  1TS4 A;  1T3N A;  1FR3 A;  4A3M G;  2CZG A;  4EBC A;  3CKI B;  4RGM A;  3CCE A;  3OWF A;  3C46 A;  1BXT A;  1VQB A;  1DOK A;  4AIM A;  4YY3 L;  1U0L A;  2MO0 A;  3KDF A;  2SNS A;  3Q8Q B;  5C0X I;  3SGI A;  2JA5 B;  1EQV A;  1CUK A;  3HOY G;  2R8H A;  2WAQ E;  2R7N A;  1IXR A;  4KI0 A;  3V2T A;  4DV6 L;  5A2Q L;  2BR0 A;  1R9T A;  5D1O B;  2O4X A;  1ZKO A;  3ZJY C;  3S15 H;  4LW1 A;  3U4V A;  2R7D A;  1K3B C;  2L5T A;  3OSP A;  3CCM A;  2KA7 A;  1DXM A;  1EUJ A;  2SNM A;  2J4X A;  5FK9 C;  4CHT B;  2KEN A;  4JI6 L;  1JWS D;  3H20 A;  1YVC A;  1W6K A;  4BY7 H;  3SR1 A;  4JW0 A;  4ABN A;  2R84 A;  4KHP H;  3ND9 A;  5LHY 1;  2R8I A;  4A2B A;  5LYJ F;  1DIK A;  1TWC B;  4KKT A;  3GTJ A;  4MV7 A;  1N32 Q;  4JYA H;  3MXP A;  4ZRZ A;  2DUD A;  4GKJ Q;  3Q0A A;  4FS1 A;  1JDE A;  1HFN A;  4A3B G;  4YHH Q;  1FKA H;  4DV1 H;  1AH9 A;  1PH8 A;  2BQU A;  4OIJ A;  4ZCK A;  3NP8 A;  5TSS A;  4BBR G;  3J81 j;  3D8G A;  4JI0 Q;  1I6U A;  4A3C G;  1PV4 A;  4R8U B;  2V5A A;  1PYS B;  2PZW A;  2E2I H;  1SYB A;  4C3I B;  2XCA A;  3Q24 A;  4J9O A;  4A3M B;  4DUY H;  1PH6 A;  1R9T B;  3WWV A;  1W3S A;  5EKL A;  1I3Q H;  3HOX B;  4HN7 A;  1KRT A;  5JVL A;  1I4X A;  1LLR D;  4FP5 D;  4YR0 A;  2BE5 C;  1B50 A;  5JOB A;  3PMF A;  3TS2 A;  3CPF A;  3CQZ H;  5FLX W;  1TXY A;  3D3R A;  3P7J A;  5DLQ E;  1HNZ Q;  4DL7 A;  4C3H H;  2RGR A;  2MCT A;  3M4Q A;  4A3L H;  4GLA C;  2W9A A;  1EEI D;  1ROD A;  1LO5 D;  3EYY A;  4IUT A;  1S97 A;  1TS3 A;  1Y1V B;  2D62 A;  3HB9 A;  3A0J A;  1YNX A;  4GOP B;  1EL0 A;  1TT2 A;  1D6E C;  1ENC A;  1JQY D;  4A3G G;  4A3I B;  1LV9 A;  1S5D D;  1HRJ A;  3PO3 H;  1L1O B;  2F0U A;  1F9S A;  4LUO A;  2RF4 A;  4QWC A;  1X3P A;  1F9R A;  5FPR A;  5KFR A;  3H0G H;  1I4R A;  3A8J E;  3ULJ A;  4TV8 F;  1G2S A;  3LWB A;  2BA1 A;  5M5Y H;  2F0M A;  3JAM L;  1GSH A;  2W6Z A;  3CQZ B;  1B8A A;  3KF6 A;  2A6E D;  3RZO H;  1EIY B;  4BA2 I;  1HNW H;  2L11 A;  3MWE A;  3N43 B;  1YHB A;  4MIU A;  3HGB A;  2PW7 A;  4JCV E;  1XTC D;  4LMY A;  5T1I A;  5ELN A;  1Q1B A;  2CQY A;  2PI2 E;  3EPI A;  2F0H A;  3VR2 A;  2F0O A;  1XMQ L;  4K5X A;  1TWF B;  4MV9 A;  3UQ8 A;  2F0L A;  4XX0 B;  3I4M H;  2ZTC A;  2J6T A;  1XMQ Q;  4YAJ B;  3VA5 A;  3TN2 A;  5IWA H;  2IPK D;  2ZXR A;  5M5W B;  5E4W C;  4CKB A;  5KFO A;  3C1E A;  1E22 A;  2UXC Q;  1STB A;  1SE3 A;  3HKZ G;  5KFI A;  3OTO H;  3NEM A;  2R8K A;  4APM A;  1BCP D;  1JB3 A;  4HTH A;  4DPG A;  1RL2 A;  2A19 A;  4RG1 A;  5ELF A;  4ZAI A;  5C4Z A;  3F2U A;  4GKJ L;  3KLS A;  2OLS A;  3DEP A;  1BGW A;  3FKI G;  4H44 C;  3GLK A;  3OHX C;  4DK0 A;  4ECW A;  1PTO D;  3J80 i;  3MFG A;  2R7Z A;  1A2T A;  2ZM6 L;  1I50 A;  3K80 C;  1E24 A;  1O75 A;  4G3I A;  2FE3 A;  2YCH A;  4X66 Q;  1EHI A;  3NWT A;  1ENF A;  1O7I A;  3TEH B;  3JAM i;  2IY5 B;  1J8I A;  1RDP D;  3RLF A;  3M9O B;  2Z0S A;  1HZA A;  3M7N A;  2JYO A;  4BY1 G;  4BWS C;  1F2Z A;  4C1N I;  5IGG A;  4Q44 A;  1S9F A;  1RJP A;  2KHS A;  1HNZ L;  4CC6 A;  4RB3 C;  1IL8 A;  1H95 A;  1WYD A;  2IX0 A;  2XGT A;  2Q2U A;  4NXN H;  4ME3 A;  4C3H B;  2HCI A;  2K75 A;  2X6L A;  3HOX G;  1HTL D;  3OIP A;  4J9Q A;  4RUA A;  4OL7 A;  3OMG A;  1DV1 A;  5FD6 A;  2ZTE A;  1C4Q A;  1LT3 D;  1ZHS A;  2RDI A;  2MGS A;  4HCE A;  3S1R B;  5EGT A;  1NAP A;  3JRX A;  5JJZ A;  2R93 B;  2W71 A;  3G6X A;  4QW8 A;  3PN1 A;  1WTP A;  2TSS A;  2JEG A;  4X62 L;  5M3F B;  1S0O A;  1K83 H;  4DV0 Q;  3PW5 A;  5D1P A;  5KG4 A;  2K5N A;  1MSH A;  4HJ9 A;  1SYE A;  2XRS D;  4EGJ A;  5C3E H;  3ORQ A;  5D8D A;  4JC0 A;  1BOS A;  1E2V A;  1HNZ H;  3R93 A;  3JAM c;  1HR0 H;  4X3T A;  3I91 A;  4A3C H;  1NBW A;  4QF4 A;  4RAY A;  1SNM A;  5CA1 F;  3TP6 A;  5KYI A;  2IX3 A;  5KNB A;  1L2F A;  4QQB X;  1PH3 A;  5FLX L;  4ZOL F;  3M3Y H;  2AGQ A;  3RD4 A;  1UE1 A;  2ZM6 H;  3S1R H;  4ECV A;  2A68 C;  5GRO A;  2D0P A;  2JEA I;  5KT6 A;  2B2V C;  3PIO A;  3MR5 A;  3A74 A;  2JP1 A;  2K6A A;  3GIJ A;  3GTQ A;  1PZK D;  2KOL A;  1TWH B;  3T1H Q;  3I4N G;  4GKJ H;  4I7Z C;  1CT1 D;  1I7N A;  1XPU A;  3BYY B;  4NXN Q;  4Y8V B;  1XWE A;  1SBB B;  3RN5 A;  3UDG A;  3KHG A;  1HJP A;  3KJP A;  2QA4 A;  1N34 L;  1HA5 A;  3GIP A;  3BG3 A;  3LX0 A;  5C3W A;  2YZN A;  4QMG A;  2YZG A;  2F03 A;  1C0A A;  2Y0S E;  4UDU C;  3VPB A;  3I8Z A;  2ASJ A;  4JV5 H;  3I7F A;  4QUF A;  5J2T F;  3SE0 A;  3S1M H;  1FD7 D;  4NXM Q;  3MHB A;  4DKA C;  2E5L H;  5IYB G;  2M00 A;  1CQF A;  4V19 0;  1PFM A;  5KFX A;  2BQR A;  5GQO A;  1TWH A;  1RF2 D;  4PMB A;  3W2D A;  4BY1 H;  2XWB B;  4JI7 L;  4YJ2 F;  5LMU H;  5BPH A;  2A74 C;  1Q1E A;  1HNW L;  1QNU A;  1KJ9 A;  3K5I A;  5CR3 A;  4U6P A;  3DXJ C;  3BZK A;  4XYM B;  2N49 A;  1EY7 A;  1CSQ A;  5HV6 A;  1JMC A;  4Z9C B;  1FGU A;  2CCZ A;  1EZ1 A;  2V1C C;  1B6S A;  4IJH A;  1PRT D;  1IBK L;  4HYK A;  3J7A V;  5J2U F;  4YCW A;  2JA7 G;  3KUP A;  4LF9 H;  2RCN A;  2XIW A;  2ICE C;  3U9O A;  2A69 C;  4O3N A;  2EY1 A;  2K33 A;  2N88 A;  5KFY A;  3CD6 A;  4F7X A;  1HZC A;  4M7E A;  4K2L A;  3F8T A;  2IT1 A;  5M9O A;  5EPL A;  3B6Y A;  3PF5 A;  4RGT A;  2E75 C;  1ZYR D;  1JIH A;  3N42 B;  2R8J A;  3MC0 B;  3OOC A;  2WB1 A;  3A7A B;  3KLS X;  4YB8 B;  1B9M A;  4O0A A;  3TQ1 A;  2HQL A;  1SEB D;  4DR4 L;  5JEA G;  4DR7 Q;  1GOZ A;  4X65 H;  2J7Z A;  2W6O A;  4LF7 Q;  5CV7 A;  2YV5 A;  5LMN L;  2BOS A;  4LFB H;  3ITP A;  2HUG A;  3OW7 A;  2B2W C;  1A6X A;  1XNR L;  2Q2T A;  3HOY B;  2FK3 A;  3ETJ A;  1STA A;  1QWY A;  4F4Z A;  4A75 A;  4TVA B;  5EPK A;  3K7A H;  3I4N H;  2A6H C;  2CH4 W;  4TQS A;  1GUG A;  3MXN B;  1BF4 A;  5JJI A;  5EZY F;  1HQM C;  4DR5 Q;  1YNJ C;  3H3V H;  1UC9 A;  4UCO A;  3TIG A;  3KHL A;  2RDJ A;  5AFW A;  3FP9 A;  2E2H A;  4RNM A;  4JI1 L;  1UWV A;  3KBG A;  4EQN A;  3HOU G;  1CQV A;  3S24 A;  4TSS A;  5IYC H;  1RJR A;  2R7Z B;  4O42 A;  4GOP A;  1N56 A;  5LMN H;  1Y1V A;  1IBM Q;  1P16 A;  5GAG C;  2B63 A;  4QW9 A;  2GLT A;  2Y0S A;  3P20 A;  3SHL A;  4DR4 H;  1ICF B;  4DAM A;  4HIK A;  2R92 H;  3JRW A;  2R82 A;  4PNY A;  4IOC A;  2HDL A;  3VPC A;  1TWC H;  1LT5 D;  3BAA A;  1Q7Y C;  5I6Y A;  1IW7 D;  1LAB A;  3V4S A;  3J80 W;  2JA6 H;  1AZQ A;  4N8F A;  4F8M A;  3E6Z X;  3GO5 A;  4KY6 A;  1SE4 A;  2WKD A;  2FMC A;  1Z9F A;  5L1I A;  4R8U A;  1MHW C;  5J1Z A;  1PH4 A;  3DLL A;  2UUC Q;  3J7A F;  5AJ3 Q;  1EYD A;  4FNF A;  2LFN A;  3MTS A;  4DR6 L;  2A68 D;  5DM6 3;  4U67 3;  1TWF A;  2PVP A;  4DV2 H;  1V1P B;  3GQC A;  5EKI A;  2L15 A;  4XT1 B;  5EBD A;  4JV1 A;  4O3O A;  1HTP A;  3RR5 A;  1C9O A;  2OCE A;  3QZ7 A;  4UCU A;  1VQM A;  2DJG C;  5CV5 A;  2P5Z X;  3RGZ A;  5M3M G;  5IP7 G;  2VXW A;  5CBE E;  4JYA Q;  3V05 A;  4AH6 A;  1WTQ A;  3PZP A;  1VQJ A;  1MKH A;  2OT2 A;  1X3F A;  1FVI A;  3LWU A;  3SK5 A;  3TRZ A;  3QIA A;  3HOV G;  1HA6 A;  3NPP A;  4JI7 H;  4DV1 Q;  4CJ0 B;  3J80 E;  4FO2 A;  4K8I A;  5JPM C;  2UUA Q;  5E1F A;  3EBE A;  1SCU B;  1K83 A;  3GTJ B;  2D9U A;  1N32 H;  1IBL H;  5E3F A;  1GJX A;  2JA8 G;  1GHJ A;  1GUN A;  3PO3 B;  1D1K A;  5BR8 H;  3STB C;  1JOQ A;  1EY9 A;  2DGY A;  4KV6 A;  4A76 A;  2DWC A;  1N9W A;  3OWE B;  1SNO A;  3S14 H;  2UVU A;  5A2Q E;  1YNJ D;  4IQZ A;  1OXX K;  4R9W A;  4K14 A;  1HQR D;  4LF4 Q;  3LML A;  3ORR A;  2N8N A;  2A6H D;  3W5O A;  2K1B A;  4IHJ F;  2YZM A;  4IUN A;  4XQJ A;  2B2Y A;  1KL9 A;  3GTK B;  3PQI A;  4ZYS A;  5BN5 A;  4DR1 Q;  4AQY Q;  1UNN C;  4A3I G;  3KAK A;  5KFQ A;  5KFJ A;  3WOF A;  1PZJ D;  4CDC C;  4CJ1 B;  5FO9 B;  5C8Y F;  5BR8 L;  4XYQ A;  1S5F D;  2EY6 A;  1Z2N X;  2A1A A;  2L12 A;  2PMZ E;  3JZI A;  4DR2 L;  4ECT A;  2KCC A;  4ZHQ F;  3NQI A;  2UUB L;  5EPJ A;  1FJG L;  2AMC B;  2EXZ A;  5LMU Q;  3G6Y A;  2NUC A;  1BQQ T;  3CC4 A;  2DJF C;  1K28 A;  2I46 A;  2O2L D;  2UUB Q;  1FJG Q;  3FDT A;  3K3P A;  4R4T A;  5M3F H;  3P75 A;  1DJR D;  2D5D A;  1PH2 A;  1TKW B;  1M90 C; 
#chains in the Genus database with same CATH homology
 4YWM A;  2MFI A;  3PUW A;  4PG3 A;  4JI5 Q;  4GNX B;  2HHH Q;  5C3E G;  3PUY A;  3PUX A;  4DR3 L;  5JEA J;  1X55 A;  2JA6 G;  1VQP A;  4JI1 Q;  4Y7N H;  1PVO A;  5ELO A;  3OW2 A;  1Y1W G;  1VQD A;  1QZG A;  4A3M G;  1SRU A;  3CCE A;  2VY3 A;  4DV2 L;  3AQQ A;  4DR5 L;  1J6Q A;  1VQB A;  4P75 A;  4R1J A;  4DV7 Q;  4BBS H;  2R7F A;  4AIM A;  4YY3 L;  4LNQ A;  2K4K A;  1UE6 A;  1U0L A;  1KIX A;  3AFP A;  2MO0 A;  3KDF A;  5C0X I;  4HJ5 A;  3SGI A;  1WCM G;  4YY3 Q;  4GS3 A;  1BBU A;  1CUK A;  3G4S A;  1SMX A;  1NTG A;  3HOY G;  2KHJ A;  1S3O A;  2Q2H A;  2CWP A;  3M85 A;  3CPW A;  2WAQ E;  3G48 A;  1ASZ A;  1IXR A;  2AWN A;  4KI0 A;  1Q86 C;  2VQF L;  1VQN A;  5IP9 G;  1B7Y B;  4DV2 Q;  4DV6 L;  4X6A H;  1K73 C;  1SN8 A;  2F3I A;  2KCT A;  1DGS A;  4WJ3 M;  3ZJY C;  3S15 H;  2JK8 A;  4NXN L;  1UEB A;  4LW1 A;  4O2D A;  4LFB Q;  1N8R C;  3U4V A;  3STB D;  4BY7 G;  2R7D A;  3CCM A;  1EUJ A;  4IPC A;  4EX5 A;  2N3S A;  1UE7 A;  2KEN A;  4PZ6 A;  4JI6 L;  4NXM L;  4B3M L;  1YVC A;  2AWO A;  4BY7 H;  2UXB Q;  1X56 A;  4DK3 C;  3KF8 B;  1YHQ A;  1TWG H;  2EIF A;  4OON A;  3GTP H;  3GDE A;  3CME A;  1PA6 A;  4B3S Q;  1N32 Q;  4GKJ Q;  2RHQ B;  2DUD A;  3G71 A;  4B3T L;  1RIP A;  4A3F G;  4J15 A;  4LF8 L;  1Y1V G;  3VDY A;  4A3B G;  2VZA A;  4YHH Q;  4XTC S;  2VUM H;  1AH9 A;  1PH8 A;  1KHI A;  1HH2 P;  4BBR G;  3J81 j;  1VQL A;  2NVX H;  3ULL A;  4LF4 L;  4JI0 Q;  3KJO A;  4A3F H;  1PH9 A;  4BXX G;  1A0I A;  1PV4 A;  2R7Z H;  4A3C G;  4OO1 G;  1AE2 A;  1PYS B;  3LGJ A;  3OYY A;  2E2I H;  4B3T Q;  4JI0 L;  1PH6 A;  3WWV A;  1W3S A;  4X62 Q;  2YTX A;  4X65 L;  1I3Q H;  2OWO A;  2KCM A;  1KRT A;  1VQ5 A;  2RHS B;  3GD7 A;  1BKB A;  4MNO A;  4YCV A;  3CXC A;  4GLX A;  5IWA L;  3KYH C;  1SFO H;  4JOI C;  1X9N A;  1GD7 A;  3TS2 A;  3CPF A;  3CQZ H;  1TXY A;  1HNZ Q;  5DLQ E;  4DR4 Q;  1VQH A;  4C3H H;  3MEF A;  1G29 1;  3H0G G;  4JI3 L;  2I5L X;  1MJE A;  1KXL A;  1WCM H;  3M4Q A;  1J5E L;  2NVY H;  1V1Q A;  4GLA C;  3UE0 A;  4JV5 Q;  4A3L H;  3HOW H;  4X65 Q;  4P73 A;  3PO3 G;  1EOV A;  4IPG A;  4OX9 L;  4GOP C;  2JQO A;  2D62 A;  3D31 A;  4A3D G;  2JA9 A;  3A0J A;  4BA1 I;  2LSS A;  5IP9 H;  1YNX A;  5IWA Q;  3J81 i;  4GOP B;  1S72 A;  5GAE C;  4B3R Q;  4A3G G;  3H3V I;  4LF7 L;  4IPD A;  4A3I H;  2ZJP A;  3PO3 H;  1L1O B;  1NE3 A;  1XTD A;  2HIV A;  4DNI A;  4LUO A;  2RF4 A;  2R7Z G;  1VQ4 A;  4KHZ A;  2AHO B;  1Y1V H;  1XNQ L;  5HGQ A;  4HID A;  3H0G H;  3ULJ A;  2YTY A;  1KD1 C;  4IFD J;  2XTI A;  2LXK A;  3W1B A;  4DV5 L;  4QGU A;  1GVP A;  1G6P A;  3T1H L;  2HIX A;  2PI2 A;  2BA1 A;  5M5Y H;  3I4M G;  1A63 A;  3NBH B;  5C0X G;  4A3M H;  2B29 A;  1CKM A;  4DV5 Q;  4B3R L;  1B8A A;  3KF6 A;  1VQO A;  3RZO H;  1EIY B;  3J81 c;  1I6H H;  4L5Q A;  4BA2 I;  1V9P A;  4UP7 A;  4R4Q A;  3G6E A;  1YHB A;  5LMU L;  1N34 Q;  2ASB A;  3S1N H;  4GN3 B;  2AKW B;  2VS1 A;  3AFQ A;  4JCV E;  4JOI A;  1GM5 A;  1VQI A;  2E5L Q;  4A93 G;  5ELN A;  1Q1B A;  2PI2 E;  2HT1 A;  3T1Y Q;  2E5L L;  1TWF H;  1XMQ L;  1EIF A;  2KBN A;  3M4P A;  3I4M H;  2ZTC A;  2QEX A;  3PGZ A;  4DR3 Q;  1XMQ Q;  1K9M C;  5C4X G;  2Q2I A;  3PIP A;  4PMW A;  1OTC A;  4GN4 B;  1K3R A;  4DV6 Q;  1LUZ A;  2IHE A;  3RLO A;  3E9I A;  1E22 A;  4JI7 Q;  2UXC Q;  1LYL A;  4HJ8 A;  3HKZ G;  1WJJ A;  1IL2 A;  2UUC L;  4A3G H;  1XMO Q;  3NEM A;  1HNW Q;  2PQA B;  4LF9 Q;  4IJL A;  4DPG A;  4DR6 Q;  1RL2 A;  2A19 A;  4RG1 A;  3UE1 A;  5HY6 A;  2ID0 A;  5IY0 A;  1Q81 C;  2I0Q A;  4IOA A;  1B70 B;  1VQA A;  3PUZ A;  3L2P A;  4GKJ L;  2WP8 J;  2FXQ A;  4HIO A;  1K8G A;  2B63 H;  3FKI G;  1K8A C;  3A5Z B;  4DV1 L;  1IBK Q;  2NZO A;  3J80 i;  1VQF A;  1QUQ A;  4JYA L;  1E3P A;  1HZB A;  1BBW A;  2WAQ G;  4DUZ Q;  2ZM6 L;  2N78 A;  1L0W A;  1CSP A;  1EYG A;  3K80 C;  1E24 A;  2JA5 H;  2R6G A;  4HJA A;  3PUV A;  1Q46 A;  4X66 Q;  3RNU A;  2ZM6 Q;  4JG2 A;  1S40 A;  1O7I A;  1YJW A;  2NVT H;  2B3G A;  1XPR A;  4X64 Q;  3TEH B;  3JAM i;  2OTJ A;  2IY5 B;  3HOZ H;  4HIM A;  3RLF A;  4LF8 Q;  2Z0S A;  1HZA A;  3M7N A;  2QGQ A;  4BY1 G;  5FLM H;  3HOX H;  1QVG A;  1D7Q A;  1HR0 L;  5LMN W;  1HNZ L;  2WFW A;  4A3B H;  4C3J H;  4YCU A;  3I2Z A;  3GTG H;  4OWT B;  1H95 A;  1WYD A;  2IX0 A;  2XGT A;  5IYC G;  2Q2U A;  4ME3 A;  2F52 A;  2I5H A;  1LTL A;  2K75 A;  1FL0 A;  3I56 A;  3HOX G;  1VQ6 A;  3CCQ A;  1GKH A;  1X6O A;  3CAM A;  3CP0 A;  4DV3 Q;  3TS0 A;  3AEV A;  4UP9 A;  4EQ5 A;  3GTL H;  2ZTE A;  4QY7 A;  1IZ6 A;  1MIU A;  4A3J G;  2LXJ A;  4DV4 L;  3M9B A;  5K36 G;  3KOJ A;  4X62 L;  1I50 H;  2NZH A;  1K83 H;  4R4I A;  4DV0 Q;  2BH2 A;  2K5N A;  4HJ9 A;  4JI2 Q;  4WJ4 A;  1VQG A;  4MZ9 A;  5C3E H;  4DV0 L;  4A3L G;  3IRB A;  4JC0 A;  2MO1 A;  4KLK A;  5E7N A;  3JAM c;  4A3K G;  2JA7 H;  2YU9 H;  5IYD G;  4A3C H;  1CKN B;  1NBW A;  1J5E Q;  1X54 A;  1XNR Q;  1JJG A;  1QVC A;  4DK6 C;  3PSI A;  4PZ7 A;  4L5R C;  1YHA A;  1IBM L;  5IYB H;  4LFC Q;  2ZJQ A;  1C7Y A;  2UXD Q;  3KFU A;  1L2F A;  3EIV A;  4QQB X;  1PH3 A;  4QIW E;  2JE6 I;  4LFC L;  3I4O A;  1WOC A;  4GLV B;  3M3Y H;  1UE1 A;  1XJV A;  3S1R H;  3K7U C;  4BBS G;  4L5T A;  1YJN A;  1VQ8 A;  1U5K A;  5GRO A;  2D0P A;  2JEA I;  3BU2 A;  2MNA A;  3F2D A;  3PIO A;  1JT8 A;  1Q12 A;  3BJU A;  5IT9 c;  3A74 A;  5C4X H;  3J80 c;  2VW9 A;  4AYB E;  3HOW G;  3RN2 A;  3T1H Q;  1W2B A;  3I4N G;  2K52 A;  2ZTD A;  2E8G A;  3HKS A;  3AYH B;  3KF6 B;  5GAD C;  1CKN A;  1XPU A;  1L1O C;  3CMA A;  4NXN Q;  3CW2 C;  4LWC A;  4NB3 A;  3RN5 A;  3UDG A;  3T1Y L;  2HHH L;  1HJP A;  4BXX H;  4JBW A;  1E1T A;  3KJP A;  2QA4 A;  1N34 L;  4KHP Q;  3OTO L;  5AJ3 L;  3S1Q H;  2CWA A;  2VUM G;  2VQE Q;  4JBM A;  3K8A A;  1C0A A;  2Y0S E;  3FHW A;  5C0X J;  1N33 L;  1Q8K A;  3F2B A;  1KC8 C;  2VL6 A;  1I94 Q;  2OQK A;  1X3G A;  4YWL A;  2YTV A;  3I7F A;  3RLN A;  1OXV A;  3GTJ H;  3S1M H;  3PO2 G;  1SE8 A;  1IBL L;  4NXM Q;  4B3S L;  1N32 L;  4OXP A;  4LFA Q;  4DKA C;  5C44 H;  3NEN A;  1SR3 A;  3TQY A;  4X66 L;  1VQC A;  5IYB G;  2VQE L;  3DM3 A;  1EQR A;  4GN5 A;  5GQO A;  5FLM G;  4BY1 H;  4P71 A;  4ALP A;  4JI7 L;  2UXC L;  2IHF A;  1Q1E A;  1VS0 A;  2K5V A;  1XMO L;  1HNW L;  4B3M Q;  2JJQ A;  3BZK A;  3HKZ E;  4L5S A;  1NY4 A;  3UDF A;  1Y1W H;  2ZJR A;  1IBL Q;  3CF5 A;  2N49 A;  1CSQ A;  3GTK H;  1JMC A;  1YIT A;  1FGU A;  3F2C A;  1NMF A;  2CCZ A;  3J7A 5;  3K81 C;  2V1C C;  4C3I H;  4IJH A;  3HFZ B;  3UDI A;  1IBK L;  1GO3 E;  4UP8 A;  4OO1 I;  4YCW A;  4A3K H;  2JA7 G;  4YHH L;  4OWW B;  2RCN A;  2KHI A;  4JBJ A;  4HJ7 A;  4DUZ L;  2UUA L;  2OTL A;  1E7Z A;  2PQA A;  3CD6 A;  1HZC A;  1L1O A;  2IX1 A;  1HR0 Q;  3PO2 H;  3F8T A;  5JJK A;  4DR7 L;  3GTM H;  1VQK A;  2IT1 A;  3GTO H;  2F4V Q;  1V43 A;  1Y14 B;  4UPA A;  3B6Y A;  4GNX A;  3PF5 A;  5LMN Q;  5FLX c;  2ALY B;  2UU9 Q;  4JI4 L;  4IFD I;  2F4V L;  5J3B A;  2R92 G;  3ICE A;  4O0A A;  2HQL A;  1YBY A;  5M3F G;  3ERS X;  5JEA G;  4DR4 L;  2E2J H;  3S2D H;  5GAH C;  3A5U A;  4DR7 Q;  3U58 A;  3H15 A;  4YWK A;  3TRE A;  3CC7 A;  1VQ7 A;  4GNX C;  4GKK Q;  4LF7 Q;  2YV5 A;  4DUY L;  5LMN L;  2WB1 G;  1HR0 W;  4DV3 L;  3HOU H;  1PHJ A;  4OX9 Q;  3EN2 A;  1XNR L;  2Q2T A;  2GN5 A;  2WB1 E;  3K0X A;  4XIG S;  5BR8 Q;  4DUY Q;  4LUZ A;  2Z6K C;  4MTN A;  4A75 A;  4TVA B;  4JI8 L;  3CCS A;  3K7A H;  3L0O A;  4A3J H;  3I4N H;  1UE5 A;  3CCL A;  2A8V A;  3KLW A;  2YYZ A;  4GKK L;  3MXN B;  1KQS A;  5JJI A;  3J7Z C;  4DR5 Q;  1XNQ Q;  3H3V H;  4LF6 Q;  1KAW A;  1BVS A;  5IE8 A;  4A93 H;  3KDF B;  3FP9 A;  4TQU S;  1E1O A;  1UWV A;  4JI1 L;  4Y52 H;  1KRS A;  5H1S E;  4A3E G;  1XPO A;  4LF5 Q;  3HOU G;  1TWA H;  4KHP L;  3S24 A;  4OWX B;  2R93 G;  5IYC H;  1CKO A;  4DAY B;  4GOP A;  1YIJ A;  1VQE A;  4JI5 L;  4IO9 A;  4APV A;  4POF A;  4DV7 L;  4LFB L;  1IBM Q;  4PZ8 A;  1P16 A;  3U50 C;  1OXS C;  5GAG C;  1R9T H;  1N33 Q;  4QJF A;  3PV0 A;  4LF6 L;  2CQO A;  1A8V A;  1I94 L;  4DAM A;  4HIK A;  2NN6 G;  1WFQ A;  3HOZ G;  5M5W H;  2R92 H;  3OTO Q;  5FJ8 H;  1VQ9 A;  5C44 G;  4UY8 C;  2VNU D;  1P8L A;  1YZ6 A;  4IOC A;  3W1G A;  1TWC H;  2OQ0 A;  2JEB I;  1ASY A;  1VCI A;  4LFA L;  1Z47 A;  5M5X H;  1K0R A;  1Q82 C;  2B63 G;  2H5X A;  1Q7Y C;  2NVQ H;  2MQH A;  2ATW A;  2JA6 H;  4JI6 Q;  1PH5 A;  3PF4 A;  3GO5 A;  1Z9F A;  1YI2 A;  3I55 A;  2VQF Q;  3FKI H;  1LM0 A;  1YJ9 A;  1PH4 A;  3DLL A;  2UUC Q;  1NJI C;  1PH7 A;  1I5F A;  5AJ3 Q;  1JJ2 A;  1SLJ A;  4LF9 L;  4DR6 L;  2K50 A;  1JJC B;  3D0F A;  2L15 A;  3BZC A;  4X64 L;  2BA0 A;  3U4Z A;  1JE5 A;  2EQS A;  2GVB A;  2BH8 A;  1D8L A;  3RR5 A;  1C9O A;  1MJC A;  2OCE A;  1HNX Q;  2UXB L;  1VQM A;  1EFW A;  1QZH A;  1PYB A;  2E2H H;  3NEL A;  3PCO B;  3L7Z C;  4R4O A;  3CCV A;  4JBK A;  5M3M G;  5IP7 G;  1HNX L;  2C35 B;  3Q8D A;  1IYJ B;  4JYA Q;  4AH6 A;  3HOY H;  1VQJ A;  1MKH A;  3TRZ A;  1X3F A;  1FVI A;  4A3D H;  2Z6K A;  2JA8 H;  3HOV G;  4DV1 Q;  4A4I A;  2UUA Q;  3CCR A;  4AYB G;  1G51 A;  1WI5 A;  3EBE A;  1PH1 A;  4RMF A;  3S17 H;  1OXU A;  4A3E H;  2JA8 G;  2K14 A;  3E9H A;  4QL5 A;  3HOV H;  1YEZ A;  4DV4 Q;  2JA5 G;  3CCU A;  4JV5 L;  3STB C;  2DGY A;  4A76 A;  1TWH H;  4R4C A;  1N9W A;  1QVF A;  1QUQ B;  2EXD A;  3E0E A;  3S14 H;  1NMG A;  4FDB A;  3JC6 6;  1EWI A;  3RZD H;  3F1Z A;  4IFD G;  3CCJ A;  2ES2 A;  4JI2 L;  1OXX K;  1X3E A;  1A62 A;  4JI3 Q;  4LF4 Q;  3S2H H;  2N8N A;  3ER0 A;  3W5O A;  4P74 A;  4DR2 Q;  1AE3 A;  1HZ9 A;  2I5M X;  4C2M H;  5FJ8 G;  4DR1 L;  4AQY L;  1KL9 A;  4NPS A;  2UU9 L;  2PNH A;  5JJL A;  3ULP A;  4P72 A;  4JI8 Q;  4DR1 Q;  4AQY Q;  4IPH A;  5IP7 H;  5EAY A;  5M3M H;  4A3I G;  1M1K C;  5IYD H;  1N36 Q;  5BR8 L;  1SRO A;  2NN6 I;  4LUV A;  1JB7 A;  2GVA A;  1T9H A;  2CFM A;  4H02 A;  1N36 L;  2A1A A;  3CC2 A;  1EQQ A;  4JI4 Q;  2R93 H;  2PMZ E;  4DR2 L;  4POG A;  4BBR H;  4LF5 L;  2UUB L;  1FJG L;  4K0K L;  3S16 H;  2AMC B;  5LMU Q;  2Y0S G;  3GTQ H;  2D0O A;  3CC4 A;  1PFS A;  3M4O H;  2UUB Q;  1FJG Q;  4K0K Q;  4R4T A;  1X65 A;  5M3F H;  2CKZ B;  3UDX A;  1OXT A;  2K5H A;  5C4J H;  1PH2 A;  2UXD L;  1M90 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...