5C44G

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c44G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c44G01
3STBD 1SROA 4C2MH 2NZHA 3W1GA 3TQYA 4C3HH 3HOXG 3PCOB 1G6PA 3I4MG 3M4QA 3ERSX 4PG3A 4DV1Q 1KC8C 2KCMA 3G71A 2HIVA 3J81j 3CMEA 4A3KH 2VUMG 1RIPA 4IFDI 3T1HL 4Y52H 1CSQA 4DV5L 4A3LH 4DR6Q 1Z47A 5C3EG 3S2DH 2KBNA 4P74A 1JT8A 1FL0A 4B3SL 3ULPA 2AKWB 5M5WH 4NXMQ 2F52A 2I0QA 4YWMA 2UUAQ 3CF5A 1HH2P 2N49A 1JJ2A 1UEBA 4R4IA 1LUZA 1S40A 3IRBA 1Y1WH 3RNUA 4LF7Q 2GVBA 2E2HH 4LF8Q 4LUZA 1WCMH 4DV4L 1IBKQ 5LMUQ 4DV7L 1YITA 4DV0L 2N8NA 1K3RA 3H0GH 4JBJA 3CCJA 4JI8Q 2BH2A 4DV4Q 4R4QA 1EOVA 2Q2UA 2UXBL 2AHOB 1NE3A 2NN6G 5GADC 4GKKQ 4IO9A 2ASBA 3UDIA 4BY7H 1MJEA 3CXCA 4JI2Q 3TS0A 1FJGQ 3PUVA 4OX9Q 1A0IA 1X55A 3W1BA 3J81i 2DGYA 1B8AA 4DAYB 3E9HA 2OWOA 2Q2TA 5M5YH 1VQPA 1MJCA 1PHJA 4EQ5A 3BZKA 3SGIA 5FLXc 4LF4L 3I4NH 3S1QH 2UXDL 2IHEA 4X62Q 3RN5A 1GO3E 4O0AA 5BR8Q 4GOPA 3CCVA 3RN2A 4DV0Q 3VDYA 1K8GA 1N33L 1UE7A 3ICEA 4JI8L 1CKNA 3CPWA 4EX5A 1X54A 2K5HA 3KDFB 3OW2A 4JBMA 4JI0L 3GTGH 3CCSA 1N9WA 3H0GG 4LF5Q 3M4PA 1X3EA 3KLWA 3UDFA 1OXSC 5C3EH 2I5LX 3K7UC 3HOZH 5JJKA 5IP7H 1N34Q 4GOPC 3PIOA 1UE6A 1PH8A 4B3SQ 5IYDH 3PF4A 2CCZA 4X6AH 3S1NH 3E0EA 5C44H 5LMNQ 1PFSA 3NBHB 2VL6A 4QY7A 5EAYA 1XMOQ 3J7A5 3F2BA 3EIVA 4KHZA 3F2DA 1YHQA 4GLVB 3J7ZC 3PSIA 3S15H 2E2JH 3AFQA 4HJ7A 2ZTEA 4X66L 3J80i 1VQ7A 3HOVH 1U5KA 3H3VH 1SLJA 2RCNA 1VQDA 3BZCA 1BBUA 2JA7G 2AWNA 5IWAQ 1Y1VH 3E9IA 5M3MG 3EN2A 2UU9Q 2JE6I 3GTLH 2JA6H 1D8LA 4IJHA 4DR1Q 1V43A 5GROA 2YTVA 1E3PA 4X65Q 4A3MH 3T1HQ 3S14H 4DUZQ 1BBWA 2JQOA 1Q7YC 1XPUA 1J5EL 4B3ML 3HOYH 1QZHA 4HJAA 2LSSA 4L5QA 1XPOA 1VQ4A 1HNZQ 2E5LQ 4OXPA 1J5EQ 4HIOA 1A62A 1EWIA 5IYCH 4GKJQ 1CKOA 1IBLL 4YY3L 3U58A 1OXXK 1VQJA 1YEZA 4AH6A 4JV5Q 3TS2A 1L1OC 5IWAL 5C0XJ 1O7IA 1SN8A 2Q2IA 3S1MH 2PI2A 4LFBQ 2R7DA 2UU9L 3I4MH 4DK6C 1TXYA 1PH4A 4NPSA 1AE3A 1K83H 5C0XI 4JI1L 3NELA 1KIXA 2R7ZH 5IYBG 3UDXA 2K75A 4A3DH 4A3CH 3H3VI 4QJFA 1YNXA 2VQFL 2R92G 3MXNB 1XNQL 3HOUG 1KAWA 3HOWH 2VQFQ 1U0LA 3STBC 2K14A 1TWGH 2GN5A 3CMAA 1QVFA 5FJ8G 2OQ0A 5IYDG 4BY7G 4QL5A 3CCUA 4OONA 1OXVA 2RHSB 2I5HA 1Q12A 1VQBA 3HFZB 4A3CG 2VNUD 1SE8A 3RR5A 1B70B 1I5FA 1A8VA 2UUCL 1YBYA 1CKMA 2VQEQ 2ZJRA 4DV6Q 2UXBQ 1EIFA 4OWTB 4LFCL 1EQQA 4X66Q 4MNOA 1N33Q 1WFQA 4A93H 2YTYA 2PI2E 2VQEL 4IOAA 2B29A 4J15A 4DAMA 3J81c 4LFCQ 2Z6KA 5AJ3Q 2E8GA 1VCIA 4JI4Q 1A63A 1JMCA 2KCTA 1VQIA 5IYCG 3F8TA 1OTCA 2JA9A 1Q46A 2K50A 1YVCA 1BVSA 2D62A 3PV0A 3NEMA 5HGQA 1P16A 1XNRQ 1PH2A 5JEAJ 2QEXA 4GNXA 4JI6Q 1EIYB 4DR4Q 1VQFA 1JJGA 4JI2L 1IZ6A 2C35B 4L5TA 2Q2HA 4UP8A 1JE5A 3W5OA 4JI7L 4B3MQ 4GKJL 4OO1G 3GDEA 3I55A 5M3FH 1QZGA 1IBMQ 3KOJA 2K5VA 5AJ3L 1XJVA 4GN5A 1I94L 4NXNQ 4JOIC 1FVIA 3I2ZA 2K4KA 4NB3A 4LW1A 4TQUS 3A0JA 3A74A 3L0OA 1I94Q 2YV5A 5FLMH 4A3FG 4LFBL 4AYBE 1UE1A 2A19A 1VQKA 4A3DG 2MQHA 3RZOH 1HZCA 4LF4Q 2WB1E 5ELNA 4GNXC 2JA5H 4QIWE 1YIJA 5C44G 2R6GA 4YCVA 1MKHA 4TVAB 2EIFA 2MO0A 1XNQQ 1VQAA 2R7FA 2WAQE 2Y0SG 4JI4L 4A75A 4JYAQ 2XGTA 1W3SA 2EXDA 1NJIC 2CKZB 1VQHA 3T1YL 2K52A 5IP7G 1XMQL 3F2CA 1N36Q 4DNIA 3CP0A 4YCWA 4DR5L 4JG2A 2NVYH 4JI3Q 1KHIA 4JCVE 4P73A 3AEVA 2OQKA 1SR3A 4R4OA 3KJOA 1RL2A 2IX0A 2UUCQ 4LF6L 4K0KQ 4A3GG 3AFPA 1P8LA 3FKIH 3WWVA 1GD7A 1PH1A 1HZBA 3TRZA 2R92H 2PQAB 2JA6G 1K0RA 4FDBA 2KHJA 4DK3C 1GM5A 1KQSA 5C4XH 4HJ9A 2JA7H 4YWLA 2YU9H 4BA2I 2H5XA 3A5ZB 1PYBA 3K0XA 4DV3Q 3CC4A 3K80C 4JI5Q 3PGZA 4B3RQ 2QA4A 4LF9L 2JEAI 2MO1A 1HR0W 2ATWA 4DPGA 4IPHA 2F4VQ 4KHPL 1Y1WG 3CD6A 3HOYG 1I6HH 1ASZA 5GAGC 2R93G 1CUKA 1X6OA 1PH3A 2ZJQA 1N8RC 3GTKH 4NXNL 2NVXH 4A3MG 2AMCB 2CFMA 3HKSA 1JJCB 2WFWA 4POFA 1PV4A 1NMGA 1YHBA 3NENA 4H02A 4DV3L 2D0PA 1CKNB 5IP9G 4PMWA 4JBWA 3I56A 3KDFA 3CCMA 4OWXB 2UUAL 2QGQA 4DR4L 3TREA 4DR1L 3GO5A 4GLXA 2MFIA 3G48A 1YJNA 1HZAA 4DUZL 4XIGS 4L5SA 3G4SA 3GTQH 4A3IH 2OTJA 3ULLA 2IY5B 4KHPQ 3S16H 2E2IH 4LF6Q 1VQGA 1WYDA 4R4CA 3JAMi 1GKHA 2UUBQ 3I4NG 4K0KL 1HJPA 4A3EH 2RF4A 3EBEA 2ZJPA 4JBKA 1I3QH 1VQCA 3HKZG 4YWKA 3D31A 1KL9A 1VS0A 4YY3Q 1R9TH 4A3IG 1IBML 4GN4B 1V1QA 4BA1I 2N3SA 1IL2A 1GVPA 3I4OA 3B6YA 3OYYA 5M5XH 3CCLA 4DR7L 1KRTA 3CCEA 1LM0A 2JEBI 4LF7L 2WP8J 3PO2G 3HOZG 4UP9A 3CQZH 2VZAA 2UXDQ 4DV2Q 4JI6L 1B7YB 1WCMG 4RG1A 1L1OB 4UY8C 1IBLQ 1E1OA 4LUVA 4WJ4A 3Q8DA 2R93H 3BU2A 4OX9L 4GLAC 1YZ6A 4JI3L 1UE5A 1MIUA 4AYBG 4LF5L 1PH6A 2LXJA 3PO2H 2HIXA 4IFDJ 1WI5A 1D7QA 4P75A 5J3BA 3GTJH 3KF6B 2OCEA 4A3KG 4ME3A 4JI7Q 3I7FA 3S2HH 3OTOL 2ALYB 3HOXH 5JJLA 2F4VL 4B3TL 4WJ3M 1QUQA 3AQQA 3S24A 1XNRL 1X65A 2ID0A 1YJ9A 5C4XG 5IP9H 4PZ6A 5HY6A 2Z0SA 1PA6A 4GS3A 1Q8KA 3M3YH 1SMXA 4R4TA 3M4OH 4JI5L 1X9NA 4B3RL 1XMQQ 3FKIG 4O2DA 1KD1C 1T9HA 3CW2C 1FJGL 1Q1BA 3ZJYC 4HIKA 3M7NA 1H95A 1PYSB 5IE8A 4QQBX 1AE2A 4BBSG 2FXQA 3CCRA 5LMNL 1IYJB 1XMOL 4IPGA 1XPRA 1QVCA 2Z6KC 5E7NA 5IT9c 1X56A 3RLOA 4A3LG 3PF5A 4APVA 4B3TQ 3HKZE 2K5NA 3L7ZC 4A3BH 1L1OA 4P71A 4ALPA 1KRSA 1W2BA 3FHWA 2VUMH 1VQ8A 5K36G 2JK8A 2HT1A 2B3GA 4XTCS 1N32L 1HNXL 4DR6L 3A5UA 3U4ZA 1NY4A 3RLFA 1HNZL 3T1YQ 2E5LL 4GOPB 2JA5G 4BXXH 2NN6I 1N36L 1PVOA 1K8AC 3K81C 4A3EG 4LFAQ 1WJJA 3DLLA 2I5MX 1Q82C 1K73C 1OXTA 4PZ7A 1VQLA 1EFWA 3H15A 4X65L 2BH8A 1Y14B 2IHFA 1VQ6A 5JJIA 2YYZA 4A3JG 1S72A 1IBKL 1TWCH 3MEFA 3BJUA 5JEAG 1M1KC 2IX1A 1QUQB 4DR2Q 4AQYQ 4LNQA 5M3FG 3GTMH 4KI0A 2ZM6L 3K8AA 4BBRG 3CPFA 3UDGA 4DR2L 4GN3B 4AQYL 1EYGA 1AH9A 3DM3A 4GNXB 4JV5L 1YHAA 2EQSA 3M9BA 3GTPH 3LGJA 1HR0L 2BA1A 3TEHB 4JI0Q 3PO3H 4DV5Q 3D0FA 2B63G 1WOCA 3KYHC 4UPAA 1TWAH 4MTNA 4UP7A 4Y7NH 2A8VA 2A1AA 4RMFA 2LXKA 1G51A 3S1RH 4OWWB 3J80c 5GAEC 2D0OA 2PNHA 4DV2L 1J6QA 1SRUA 1N32Q 4A3FH 2UXCQ 5IY0A 4R1JA 1X3FA 3KF8B 1VQMA 3CC2A 3S17H 2HHHL 5LMNW 3PO3G 1TWFH 1KXLA 1VQ5A 1HNWL 4DR7Q 1X3GA 2BA0A 3ER0A 2RHQB 4JOIA 4A4IA 4GKKL 2ZTCA 1JB7A 1NBWA 4LF9Q 1E1TA 3AYHB 4POGA 4MZ9A 1M90C 1Q1EA 4IOCA 4X64L 5FLMG 3PIPA 1PH9A 4A3GH 4OO1I 1NMFA 3GTOH 2N78A 1XTDA 1C9OA 3FP9A 3RZDH 1EQRA 4A76A 4HIMA 2JA8G 3U4VA 3HOUH 3KF6A 4JYAL 1E7ZA 2UUBL 2YTXA 3CC7A 1SFOH 1HNXQ 4DUYQ 2UXCL 2PMZE 1DGSA 2AWOA 1QVGA 4IJLA 1Q81C 2L15A 2VW9A 4DR3L 3PUYA 3PUWA 2PQAA 3UE0A 3CAMA 1LYLA 4A93G 4LFAL 1CSPA 4X64Q 2NVTH 3PUXA 3JAMc 1PH5A 5GAHC 1FGUA 4A3BG 2HQLA 5BR8L 1ASYA 4IPDA 2ZM6Q 3G6EA 1VQEA 4LF8L 1L2FA 4DV6L 1C7YA 2VS1A 2JA8H 4BY1H 3PUZA 3RLNA 2CQOA 2IT1A 2OTLA 4HJ8A 3KJPA 4DR3Q 3ULJA 4NXML 4L5RC 4C3JH 2MNAA 4HIDA 1N34L 1VQ9A 4YHHQ 1Q86C 2F3IA 1Y1VG 1NTGA 5M3MH 1VQOA 4AIMA 4YHHL 4BY1G 2CWPA 4JI1Q 3HOWG 1OXUA 2DUDA 2KENA 2ZTDA 3K7AH 4YCUA 3HOVG 2ES2A 5H1SE 1S3OA 5C0XG 1HR0Q 3U50C 1TWHH 2NVQH 1I50H 1YJWA 3GD7A 1VQNA 1HNWQ 4IPCA 2R7ZG 4P72A 3M85A 1K9MC 4JC0A 5C4JH 2XTIA 1PH7A 3F1ZA 1IXRA 3KFUA 2B63H 3UE1A 1HZ9A 4C3IH 1C0AA 2WAQG 2Y0SE 3JC66 3L2PA 3CCQA 4DKAC 2NZOA 4X62L 2KHIA 4BBRH 2VY3A 4KLKA 5DLQE 1UWVA 4QGUA 4DV1L 2WB1G 5FJ8H 5LMUL 4DV7Q 4BBSH 1BKBA 4DUYL 1Z9FA 1LTLA 2CWAA 5ELOA 1E24A 4A3JH 1V9PA 2V1CC 1YI2A 4HJ5A 4PZ8A 1E22A 4LUOA 4BXXG 1EUJA 2HHHQ 5GQOA 3OTOQ 1G291 1L0WA 4LWCA 4DR5Q 2GVAA 2JJQA 4IFDG 5IYBH
chains in the Genus database with same CATH superfamily
1F2YA 3STBD 2YRXA 4JI5H 1BCPC 4C2MH 4FF4A 2UUBH 1SYBA 2NZHA 3TQYA 2W9CA 1K8OA 3HG9A 4PG3A 2PZTA 5KFPA 4UCSA 3S1MB 1FR3A 2KJXA 2F0FA 5CBEE 4HNTA 4DV5L 5LMUH 4DR6Q 4ECUA 2KBNA 2HVSA 4B3SL 1ESFA 4RAUC 3ULPA 2F52A 5M3MB 4YWMA 2LY7A 4RU9A 1UEBA 2L1BA 4BWGB 5I2XA 4FP5D 4R4IA 1RJPA 1JORA 2UXDH 1SMYC 1X3PA 3IRBA 2HJWA 1YITA 4HCSA 1B53A 2JA6B 4ED8A 2BH2A 1E4EA 3JAML 1TWHA 2UXBL 4I65A 5T1GA 1XTCD 1EQVA 1NE3A 4ED3A 4K5XA 2YU9A 4AYBA 4JI2Q 1FJGQ 1Y8PB 4G7OC 1A0IA 2O2LD 3CU7A 3W1BA 2DGYA 1S4ZA 4LSAA 3E9HA 4MA5A 1I94H 2Q2TA 4CC6A 1VQPA 1EY4A 4LF4L 5FLXc 3S1QH 1HTPA 2IHEA 4RCNA 1N34H 1GO3E 5BPFA 4G7HC 4FXKC 1U4LA 4DV0Q 1M0WA 1UC8A 4JI8L 3GTGH 4ECYA 3KDFB 3OW2A 1HNXH 3KLSA 3CCSA 1MBYA 1N9WA 3H0GG 3H4DA 1B9NA 2EYFA 1E4GT 1X3EA 4DR4H 3RB3A 1OXSC 1BR9A 3I4MB 3HOZH 5JJKA 1Z2PX 1PH8A 3MR3A 3PF4A 5KYIA 2IPKD 2ASLA 5IT9W 4XDXA 2MJ8A 1WTVA 1XMOQ 2RBMA 3NBHB 4QY7A 3EIVA 5C4JB 2ZM6H 2AQ4A 3TP8A 1HHVA 4ZI7F 3S15H 3AFQA 1RHPA 1TS3A 3IG0A 4YBZB 1KJJA 3HOVH 5EPKA 3BZCA 2KSWA 4N9TA 2DY7A 3KBGA 5I47A 4FU0A 2JE6I 3HOXB 3KF8A 3R2IA 4HQ6A 3D4DA 5GROA 3S14H 1L0XB 4CJ0B 1XPUA 4JI3H 1J5EL 3UI2A 2F0KA 2F4VH 4P2CB 2LSSA 1EZ1A 1XPOA 1S0OA 1CS0A 1VQ4A 1EWIA 1EY8A 3U58A 1VQJA 2A68C 4JVZA 2JA7A 4KN4C 2X0SA 1EOTA 1SN8A 4TRDA 3M9NB 2J6SA 2UU9L 3I4MH 3HOZB 1C30A 1M0TA 4MTDA 1LV9A 4H7BA 2R7ZH 2DLNA 1I50A 5KT2A 4F4XA 5JVLA 5CV9A 2WIIB 4A3CH 1LT6D 4QJFA 4BS9A 1WVLA 4LF6H 2VQFL 3GTMA 2FPGB 3MXNB 1XNQL 4RNNA 3PR5B 1KAWA 3HOWH 2VQFQ 1D6EC 3S15B 2JEIA 1QVFA 1F2LA 3BQ0A 5IYDG 3EROA 5BN5A 4M7EA 2VNUD 1Q12A 3C1EA 1AW7A 3KHGA 1B70B 1I5FA 1PRTB 2UUCL 3GQBA 2VQEQ 3QIAA 1V51A 4IOAA 3GQCA 4LK1C 2EVBA 2PZUA 3LWBA 2Z6KA 5AJ3Q 2E8GA 5G3LF 1SCUB 4JI4Q 1HRJA 4QIWA 4ECXA 2KCTA 1I3QA 3F8TA 2KVMA 1A3TA 2JA9A 1Q46A 3D3RA 3LP8A 3HGBA 5KFMA 1ESRA 4X66H 2PW7A 4KD4A 4I7HA 2B2TA 4K8IA 2EXZA 1IZ6A 2VUGA 4UP8A 4UCRA 4CDEC 1JE5A 4R8NA 4IURA 4A3EB 1CZGA 2PMZB 5AJ3L 3V4SA 4EBDA 2A6HD 4C2MB 1IHZA 3I2ZA 1KDBA 3R23A 4TQUS 2F0HA 2L0CA 4XYLB 3GV3A 4KKUA 2YV5A 2FFKB 4A3FG 2E76C 4JI6H 3EJIA 5CV5A 5C5LA 2A19A 2B2UC 4LF4Q 2WB1E 5ELNA 3RBEA 3I3CA 2CQAA 2L55A 5C44G 2R6GA 1RKNA 1B9MA 1XNQQ 5CV8A 1IW7D 4A75A 2XGTA 3G6XA 3C2PA 1EEID 4DK0A 2K52A 2IJ0A 1CQFA 3A7AB 1TWGA 2IP4A 3F2CA 4FS2A 2R93A 4A3BB 4DR5L 1KJ9A 4DL6A 4JG2A 4JCVE 3AEVA 1II3A 3VR3A 1RL2A 2IX0A 4OIJA 1PH1A 2W6NA 1C48A 3PMFA 2KHJA 1KQSA 2LKVA 4C2MA 4ECSA 4S3SA 3SE0A 2FJ2A 4JI5Q 4M1UB 2QA4A 1S97A 2C00A 2MO1A 4RAYA 1K83A 1HR0W 1IKLA 1ET6A 1DV2A 4UCVA 1NR2A 1NCVA 5IGFA 2VA3A 2F4VQ 4KD3A 1JLLB 1VMCA 1Y1WG 4OGQC 3QZ7A 1TWAB 1HNZH 4O2AF 2JEJA 4A3MG 1I6VC 1JJCB 4BY7H 5KFLA 3QJYA 3NENA 3K5NA 3UQ8A 5JQWA 4PMWA 4LJZC 1F9RA 3NK9A 2UUAL 4QWAA 3HZXA 4LF9H 5A2QE 3TREA 4GLXA 3GO5A 3Q22A 2MFIA 3G48A 2R85A 4OHJA 4ED2A 1F9SA 2B2YA 1FNVA 2NUCA 4R4CA 3JAMi 4PQXA 4LF6Q 3I4NG 4K0KL 2ZDHA 1HXYD 4ED0A 4CBVA 1HA6A 2ZJPA 4EBCA 1VQCA 3PIO3 4YY3Q 1R9TH 3FDSA 4IWXA 4A3IG 1IBML 2N3SA 4FBUA 1GVPA 1EY0A 1FNUA 3OYYA 5M5XH 2W8KA 3PO2G 2DNCA 1EY5A 1V1PB 4DV2Q 2M2LA 2FPIB 5FPOA 5IYZF 2B8FA 3Q6SA 1L1OB 4UY8C 1RJTA 1E1OA 1B3QA 1XWEA 5KG4A 3MXUA 3M4YA 1WCMA 2SDFA 2EE1A 1UE5A 4AYBG 4LF5L 3GIJA 1LTTD 2YYAA 1PH6A 5DM73 1D7QA 2CZGA 3OHXC 2PCFB 5E1FA 3MWMA 2OCEA 3S16B 2KEEA 4EQPA 2NVXB 3DEOA 1D1KA 2ALYB 1STHA 3AQQA 1YJ9A 4J9MA 5C4XG 2YZNA 5HY6A 1PA6A 1AZPA 2V4QA 4J0MA 3N41B 4B3RL 1X9NA 3L4KA 1KD1C 2SNMA 4RA8A 5IE8A 4HNUA 2FXQA 3CCRA 1XMOL 1IYJB 3VYUA 2CQYA 3HKZB 4DA2A 1QVCA 2Z6KC 2EYLA 4K8JA 5E7NA 3WOEA 3ZYYX 5CGKA 3RIZA 2EYPA 1OWTA 3PF5A 4APVA 5LYJF 4EYHB 2WACA 1KJIA 5K36G 3WNZA 3E3XA 2HT1A 2NU6B 4ED6A 5IOCA 1SJHD 3OSPA 1NY4A 3RLFA 2E5LL 2Z8LA 4EGQA 3LWUA 4LFBH 1TKWB 2FJZA 5KT7A 1PDQA 2D5DA 1GUTA 2R93B 1V4YA 2VOBA 5HV6A 3K81C 2BE5D 3W2DA 4A3EG 4QWEA 2I5MX 1Q82C 3GILA 1S10A 1Y14B 3VYSA 2MPMA 4A3JG 1S72A 1SFOB 2B2WA 3BJUA 5JEAG 3GTJA 3Q8QB 5FKAC 4DR2Q 1BXTA 4KI0A 3GTMH 3K8AA 3DUZA 3ORRA 2Y0SB 4DR2L 1AH9A 1S9FA 1YHAA 3NQIA 3FMCA 1HR0L 2DJFC 3TEHB 3PO3H 1Z2NX 1WOCA 5BMVF 1TWAH 2IL8A 4U673 2VB2X 1FGBD 4IWYA 2LXKA 3OUZA 1G51A 2UXBH 2XCLA 3DWQA 2YU9B 4DV4H 2UXCQ 4RZRA 3V6KA 3CC2A 3K7AB 1E2WA 4IUVA 3PO3G 4CC5A 3MEHA 1VQ5A 4FBTA 2HDLA 1ENFA 2TSSA 3GLKA 2F1MA 2R92B 1NBWA 4MZ9A 3GV6A 4IOCA 2E2IA 5FLMG 3PIPA 4EVOA 1O75A 1ZYRC 3GTOH 4DL4A 2N78A 1HCZA 4RGOS 3GIPA 4LH6A 1MGSA 4IRDA 4L1KA 4KK7A 4PNYA 4RGMA 1C8CA 4J1MA 2QYZA 2BCOA 2UUBL 2M05A 2YTXA 2UXCL 4MV8A 1FD7D 1QVGA 1SDFA 3R8BA 2VW9A 4DR3L 4BBSB 1N48A 3PUWA 2PQAA 3UE0A 1T3NA 2FLLA 3K5OA 2YS7A 5D3DA 1ICFB 1AEXA 3JAMc 4A3MB 5GAHC 1FGUA 1O7YA 4ZK9B 5EKKA 5LMNH 1QJOA 1PLFA 2HQLA 5BR8L 1U4MA 2VUMB 2A6ED 1YNNC 1L2FA 3WOFA 1AP0A 4RB3C 2R8IA 1TAEA 3FKIB 2VS1A 2F3WA 1V1OA 3TP6A 2JA8H 3PUZA 2F0TA 5KFVA 3EQLC 2G5DA 2FLPA 2P5ZX 4L5RC 1N34L 2RSOA 2AGQA 2NTTA 1W96A 2DN8A 2UU9H 1SXTA 2W7PA 1JOKA 1RD9D 4BY1G 2SCUB 4JI1Q 1OXUA 3S17B 4ECZA 4YCUA 1IOWA 5H1SE 2DPJA 5DNFA 4CHTB 1YJWA 2NVQH 4A3GB 3D4RA 1HNWQ 2HD3A 4IPCA 1K9MC 3MXGA 4I55F 2E2HA 2XTIA 4JV5H 2B39A 1IXRA 5I4DA 4C3IH 2WAQG 3CCQA 3HOUB 3E5NA 2NZOA 4NKLA 2W57A 3HEJA 4BBRH 2VY3A 4KLKA 4FF2A 2UUCH 4DV1L 2R7MA 3M9MB 2F0PA 3NGDA 4DUYL 1QNKA 2CWAA 1YI2A 3V4ZA 2V1CC 3F8NA 1E22A 5KFTA 2HHHQ 1DOMA 2JA8B 5LL6b 1L0WA 1Q8IA 4DR6H 3ND8A 4DR5Q 2GVAA 2C5CA 2WKDA 3DM1A 3SXHA 2A6EC 4Q5VA 3SHLA 5C6AA 4WORA 3GIIA 2DY8A 5KRUA 3HOXG 3PCOB 3S14B 2UVRA 2EJMA 3NPPA 1TY0A 3G71A 3BS1A 2D2CC 4N8FA 1EYAA 2RDFA 4ZCKA 3C0FB 4C5AA 4A3LH 5KG3A 4Q8FA 1Z47A 3S2DH 4P74A 1JT8A 1ML0D 2Y0SA 1FL0A 3D8GA 4JV2A 3MWYW 4NXMQ 2R7ZB 2EPBA 1I50B 2UUAQ 1JWMD 2N49A 2WKCA 4IRCA 1GUNA 3NWTA 3GTGA 1IYUA 5KFRA 1Y1WH 2E2HH 4LUZA 1WCMH 2QW7A 5IGGA 1IBKQ 5KT6A 5KFCA 2C22A 4DV4Q 4R4QA 1CQVA 2Q2UA 2AHOB 1E4FT 3RAXA 5GADC 3A8KE 1VBHA 4IO9A 3UDIA 1T5EA 2RA4A 1MJEA 1QILA 3TS0A 3BQ1A 5FOBB 1X55A 1ZXTA 2FMAA 2J7ZA 1SYCA 3QB3A 4GC7A 1N33H 2PO4A 5KEEA 1B3AA 5M5YH 1PHJA 4FXGC 2V58A 5A2QL 3TSSA 3MAQA 3I4NH 1PX2A 2XD4A 2WV6D 2K5WA 3T56B 3RN2A 4EQNA 3J81L 2R7NA 3CPWA 4JBMA 3DEPA 3HS0C 1SNCA 1XMQH 1B33N 5KFHA 3KLWA 4L6TB 2ENBA 3UDFA 2I5LX 4O2BF 4K2KA 1N36H 1N34Q 2F0NA 4B3MH 1UE6A 4ID6A 4IZOA 5HBRB 2B63B 5BPHA 3Q8RB 3GV7B 2CCZA 1BOSA 4X6AH 3S1NH 3E0EA 2F0OA 3R93A 5LMNQ 5EAYA 2ZXRA 4KHZA 3X3NA 4GLVB 3H4BA 1EFID 3GTMB 2SNSA 2ZTEA 3RV3A 4LF4H 4ECWA 1K3BC 4IRKA 1LTBD 3EFXD 4UHVA 3TIIA 4YR0A 1Y1VH 3E9IA 5M3MG 5EDWA 2UU9Q 2SEBD 3T51B 3GTLH 2X6LA 2JA6H 1XNRL 4IJHA 4R9WA 4DR1Q 2YTVA 2NZ1D 1BBWA 2JQOA 5KG1A 4BY1B 2FMCA 2Z1CA 1Q7YC 4DGZA 1UUPA 1O78A 5DQIA 3SK4A 4YB8B 4DLKA 4OXPA 1J5EQ 1E2VA 3SK6A 1A2UA 3MR5A 3BVMA 1CKOA 1IBLL 5CBAE 2N55A 4LMYA 1OXXK 1YEZA 1H9SB 3KHHA 3TS2A 1L1OC 2XIWA 3S1MH 1WTWA 4J9OA 1SE3A 2R7DA 1N56A 2KUMA 1TXYA 2RDHA 4NPSA 1B6SA 2W9BA 1KIXA 5DLFA 1O7LA 4NP5A 1L2ZA 2HGSA 5DM63 4LF7H 4LF8H 3TP5A 4IR1A 1U0LA 3STBC 2GN5A 3CMAA 2OQ0A 1BDOA 2RHSB 5A2QW 3HFZB 1DM0B 1BCPB 5LXTF 3K0YA 3RR5A 5A35A 5JUMA 1YBYA 1CKMA 4KV6A 4C3IG 2ZJRA 4OWTB 4FF1A 1RJQA 1WFQA 5DQGA 3GTPB 2PI2E 3F2UA 2VQEL 5KFKA 4UAIA 4J15A 3C46A 4O3OA 1H9KA 1CHPD 3FPPA 2BQUA 4IR9A 3NP8A 4RUCA 2KA7A 1TU2B 2D62A 4HSPA 5HGQA 1WH2A 1MD2D 1ZHQA 4XXEA 1MZBA 2V4RA 2SOBA 2I07B 2L9HA 4GNXA 2QEXA 1R9TB 2F0WA 4JI6Q 1EIYB 4DR4Q 4IUUA 2O03A 1JJGA 4JI2L 4OO1H 2Q2HA 3W5OA 4JI7L 5KKNB 2UVWA 3HRZC 1CK1A 2K5VA 1I94L 4GN5A 4UDUC 4NXNQ 2F3VA 1BCPF 2JYOA 3K59A 3GP7A 3ONAB 1GSHA 4Q45A 3HKZA 4ULLA 5NUCA 1VQKA 5DEHA 2F0GA 2MQHA 3NTHA 3QWNA 4A3DG 1ZETA 3KHRA 4RGNA 3FRPB 1GJXA 3MFYA 4YCVA 1GYFA 4FYDA 1MKHA 1TWAA 3GTQB 3BQ2A 1VQAA 2Y0SG 1SSOA 2EXDA 3GTKB 1VQHA 1PMRA 3T1YL 1BQQT 1XMQL 3P1HA 4DNIA 4FF3A 3BA8A 4RB1A 3CQZA 3TDQA 2NVYH 1R4PB 3TMEA 2W70A 4P73A 2V5AA 1SR3A 1EY9A 4R4OA 3KJOA 1I4XA 1LT3D 3AFPA 4DF7A 1R9TA 2XNAC 3FKIH 1GD7A 3TRZA 4EGJA 2R92H 1K0RA 1SJED 2FKLA 1NAPA 1FKAH 5EWEA 1DJRD 2YU9H 3DWAA 2YCHA 1KJ8A 4BA2I 3I4LA 1PYBA 3K0XA 2AGPA 3PGZA 2JEAI 2W71A 3UFXB 3URYA 3MVVA 1CQIB 2AGOA 2L12A 2B2YC 3WDNA 3EVQA 3BZDB 1UAPA 5IT9L 3CD6A 3HOYG 2KCNA 2R86A 1X6OA 5HGTA 2ZJQA 5K36H 5CAEB 4UFZA 1Y1VA 4O1NA 5JVH3 2W8LA 1G2TA 4J9SA 4RHSA 2C2RA 3HKSA 2K7VA 4GKJL 1SFOA 4DR7H 4KKTA 3KDFA 3I73A 5EKIA 4H44C 3J80E 4DUZL 1ICWA 4L5SA 3GTQH 2X69A 5EJWA 2IY5B 1WR2A 2HVQA 3NTIA 4EEYA 2UUBQ 1WYDA 3T5JA 5C3XA 4A3EH 3RFCA 3K5LA 3D4WA 4C3JB 4JBKA 4V0BA 4QWCA 1I3QH 4IUTA 3D31A 4DUYH 1ZKOA 1IL2A 4BXXH 4GN4B 4BA1I 2XCAA 3B6YA 3CCLA 1KRTA 4FM9A 2JEBI 3I70A 1EUDB 3J80L 2LFNA 1VDZA 1CQJB 4EBEA 1SNDA 4TSSA 2UXDQ 4R8IA 4A3KB 2RQXA 4YP3A 4RG1A 3N40P 5L1KA 1PFBA 3VR6A 3SE7A 4EEQA 3MR2A 1U4PA 4OX9L 1Y1VB 4GLAC 5EWGA 5DAUA 3KXYT 5JPMC 4M9UA 2LXJA 2CW0C 3NXWA 1WI5A 4IFDJ 2QK4A 1XNRH 3KF6B 1I4HA 4A3KG 2JXMB 4JI7Q 2K28A 4JYAH 3I7FA 1UNSA 5KIXA 3IN5A 4B3TL 4WJ3M 4Y7NB 3S24A 1YNJD 1K8MA 4PZ6A 2Z0SA 1RJRA 3R5FA 4GS3A 4R4TA 4UCOA 1T9HA 1Q1BA 5I6YA 4ZUIA 3M7NA 3PO3B 3MHBA 1JCKB 2VUMA 3BG3A 1HA5A 5KFBA 3T1HH 3GV5B 1DD2A 4MV6A 1X56A 3RLOA 3N8DA 3K5MA 4IUPA 4B3TQ 1EIHA 3L7ZC 3KTMA 1KAAA 4O4LF 2VUMH 2NU7B 2XWBB 1VQ8A 3RUZA 2JK8A 5LL6S 5IODA 1B44D 2OF1A 2B2WC 1HNZL 2JA5G 3QFFA 3T1YQ 4GOPB 4J9PA 3T5KA 2WAQA 2BOSA 3CQZB 5JVG3 3DLLA 3X3MA 1K73C 5C4ZA 3CHBD 1VQLA 1EFWA 2ICIA 4X65L 2BH8A 5FO7B 5IGCA 2IHFA 1PZID 3RAQA 1TVXA 4DXGA 4A3IB 3MEFA 2IX1A 1DZ1A 4IUQA 2K32A 4XQJA 4AQYQ 2E2HB 5M3FG 4X3SA 1B04A 2RDIA 1STNA 1CA6A 4DN4M 4DUZH 1A15A 4GN3B 4NW2A 2B2VA 3DM3A 2R7ZA 2EQSA 3M9BA 3J80W 2BA1A 2F0UA 4JI0Q 2B63G 3GTGB 4TV9F 4EFEA 1SYGA 4ECTA 1A6XA 4O3NA 4Y7NH 2A8VA 4RMFA 3TIGA 5M3FB 3S1RH 3S1QB 1QCBD 3LWEA 2A74C 2D0OA 4DV2L 1N32Q 2R84A 2YL2A 4KY6A 4HMIA 2JN4A 5IY0A 4R1JA 3MJFA 3KF8B 1VQMA 4C3HG 4BWSC 4N9PA 2XSCA 1TS4A 3NBIA 1I6UA 4JI2H 1X3GA 4GKKL 2RCFA 1EUCB 2ZTCA 2DWCA 5KFIA 3AYHB 4NMZA 5KG5A 5JOBA 2GA4B 1PTOH 2IW3A 1PH9A 4OO1I 1NMFA 3ETHA 1JDEA 4YQWA 2UUAH 3QOJA 4HIMA 3BG5A 5C1OA 3HOUH 1IBMH 4I50F 4YIJA 3DF7A 3KUPA 1SFOH 1HNXQ 5DQHA 2AWOA 3LNNA 2K1BA 1Q81C 4V190 4YJ3F 3CAMA 1LYLA 3H0GB 1LTID 5IGBA 1E4EB 4X64Q 2RDGA 1KBLA 1PH5A 5KFDA 4EQOA 1XMOH 2Z4IA 4IPDA 4RB2C 1IW7C 3H3VC 1KDCA 2ZM6Q 3G6EA 4LF8L 3HOYB 1ZYRD 1EWCA 3S1NB 2PNRC 3RLNA 3OIQA 2IT1A 3TQ1A 4HJ8A 2HDMA 2B2TC 4C3JH 1IYVA 4XYQA 2F03A 4NDXA 1VQ9A 1Q86C 1B1ZA 1Y1VG 5M3MH 2QDLA 4AIMA 4YHHL 3WO0A 1UEAB 3HOWG 2DUDA 1QE6A 1K1SA 3G8CA 2E74C 1GUWA 4JUZA 2NVYA 1VF7A 1S3OA 2OXPA 3U50C 1TWHH 2F4IA 1VQNA 2FK2A 4DV3H 1TIID 3NBHA 5EKLA 1EU3A 2I87A 2BE5C 3BDOA 2VQDA 3PZPA 4PDBA 3QOLA 2B2UA 3KFUA 1Z2OX 3UE1A 3R2TA 2ZXOA 1IOVA 4NLGA 2IX3A 2H4OA 2W9BB 4DKAC 4FS1A 4X62L 4ZUJA 2DZDA 2KHIA 4K0KH 5DLQE 1UWVA 2ZDGA 5HURA 2JP1A 1JOQA 2CH4W 2EYJA 1PRTD 4DR1H 1E24A 2DNEA 4HJ5A 4LUOA 2RGVA 2O5JC 1JE4A 5GQOA 3OTOQ 1G291 2R82A 2PQEA 3N52A 3H40A 2OLSA 4B3RH 1JB3A 2UXCH 1SROA 2C2DA 4DFAA 1QWYA 3W1GA 4C3HH 2AUKA 4KMUC 3I4MG 3Q8PB 4DV1Q 3U9SA 3RMHA 4RUAA 2KCMA 2HIVA 3CMEA 2ALZA 1UNNC 2VUMG 1RIPA 1BNZA 4IFDI 4R7RA 2HHHH 1PK8A 1RCVD 3T5LA 5KGUA 2AKWB 5M5WH 5GONF 4PWQA 4QW9A 3RV4A 3CF5A 1JKJB 3SR1A 5I9OA 3JRXA 1ZEQX 4KJOA 4I7AA 4C3HB 1LUZA 2A68D 3C3LA 1S40A 4ZLTF 4LF7Q 4LF8Q 4RNOA 3VPCA 3HOWB 4DV4L 4DK1A 2D9UA 3E6ZX 5DG7A 1B6RA 2N8NA 4WRDA 1K3RA 1WTPA 4JBJA 3CCJA 4JI8Q 4NXMH 1PRTF 1EOVA 4J9QA 3IAYA 5KG6A 4GKKQ 4C3IB 3TZUA 3OUUA 2G9DA 1S0NA 4J6HA 3IFDA 3PUVA 4DV6H 2DJGC 1B8AA 1O80A 2XGPA 3G6JB 5D8DA 1MJCA 3SGIA 5KG0A 3A8JE 1ZHSA 4X62Q 5BR8Q 4JV1A 3SEBA 4U68A 1GUGA 1UE7A 4QIWB 1PTOC 1CKNA 5KFGA 2K5HA 4JI0L 3GTKA 3WO1A 4G4KA 2VPQA 3HB9A 1O7ZA 1ENAA 3K7UC 5IP7H 2J6TA 1BUVT 4G57A 1F9QA 2ZDQA 2UVVA 3Q23A 3T53B 1WSCA 2H1EA 5C44H 1PFSA 4X3UA 3VR4A 4YR2A 1TWFB 5F9NA 5L1JA 3PN1A 1E0BA 3G6YA 3RB6A 3F2DA 3J7ZC 2E2JH 4TQRA 5KNCA 1LABA 4X66L 4XQNA 1AUXA 3EYYA 3H3VH 4O4HF 1SLJA 3BYTB 1VQDA 2R6FA 2R8HA 1WTXA 3NTKA 1BBUA 2EOTA 2JA7G 5ELDA 3JAME 5IWAQ 2EY5A 1D5ZC 3PW4A 3EN2A 2NUAB 1MHWC 4DL2A 1D8LA 4DNRB 1V43A 3M4IA 1E3PA 5KNBA 4X65Q 1BBXC 4DUZQ 5EBDA 1VMPA 3AB9A 4XQQA 5KT4A 5FLXE 3GTLB 3RF2A 4C56C 2LMCB 3HOYH 4HJAA 1KTKA 5KFWA 1J9OA 1JC7A 2R3ZA 1KNAA 1PXUA 3AU7A 4K5VA 4A93B 3PW7A 1HNZQ 1SBBB 4HIOA 3MFHA 1SNPA 2X6GA 4GKJQ 5C1PA 2Q8RE 1XXGA 3HBLA 4AH6A 3NE5B 5C0XJ 4LFBQ 2W6MA 5BN3A 5C3WA 1STEA 5JH7F 4X3TA 4DAPA 5C0XI 4JI1L 3NELA 1G91A 2I80A 5LOVF 4IZ8A 3UDXA 2W6QA 2K75A 2CVRA 5KNDA 3H3VI 1CT1D 3OOCA 2R92G 3HOUG 1U4RA 3DHQA 5D3IB 5JVDF 4MTKA 4HSVA 1KDAA 2EJGC 4MIUA 4MV4A 1IBKH 1TWGH 4QMGA 3NWSA 5LL6X 5FJ8G 1GSOA 4WD3A 5J39A 2L5TA 3OWFA 4BY7G 4QL5A 2R61A 1OXVA 4OONA 2I5HA 1VQBA 4A3CG 5JPNC 3QG1A 1S5BD 1PV4A 4DV1H 3RD4A 1A8VA 2RVLA 2FLNA 3V05A 4DV2H 1WTRA 5EPLA 2UXBQ 1EQQA 5M5YB 4MNOA 1N33Q 2O4XA 1CZWA 2B29A 4DAMA 3HXLA 3J81c 4LFCQ 2F0LA 4KHPH 2K04A 4B9XA 1E2ZA 1JMCA 1PZKD 1OTCA 1ENCA 2A69C 4I4TF 1YVCA 5T14A 4QUCA 4Z9CB 4NXNH 1P16A 3MZ5A 4K14A 1RTNA 3K6OA 3OMGA 2GPSA 5ISRA 3CVZA 1AZQA 1R4QB 4PMBA 3L3OC 2XRQD 1S5ED 3RGXA 4C5BA 3H6MA 4B3MQ 1F77A 4B3SH 4OO1G 1AFPA 1K1QA 3I55A 1ET9A 5M3FH 3S1RB 1QZGA 5DG9A 3H20A 1NNXA 4JOIC 1JWSD 3I91A 4K6DA 3L0OA 3A0JA 1I94Q 5M5XB 2PYKA 5FLMH 4IALA 4AYBE 3SK5A 1UE1A 5FPRA 2GPWA 4X62H 2PBZA 5L1IA 2C2EA 4C5CA 1WCMB 3RGZA 4F88A 2JA5H 1A2TA 4QIWE 1Z7TA 3A55A 5F2DA 1YIJA 1HR0H 2R92A 5E3FA 2MO0A 1T5XD 4Q43A 4JYAQ 5I6WA 1W3SA 1NJIC 3KHLA 1Y1WA 3R5HA 1F9PA 2EYHA 1S68A 4DR3H 5CV6A 5L9XA 4RFBA 3FPUB 3V2TA 2EDGA 5FLXW 3NHHA 5IGEA 4YHHH 4MV9A 4KN7C 4LF6L 4K0KQ 2XVSA 1HPCA 4A3GG 1P8LA 3QO2A 3WWVA 3RJ0A 1HZBA 3LX0A 4N8X1 2PQAB 1SYFA 4DL7A 5CV7A 1GM5A 2G9HD 3TBIB 1KABA 3KLRA 4MV1A 3J81W 5J2TF 2ASJA 1HNWH 3A5ZB 1ILQA 5COYA 4B3RQ 1TA8A 2NN6H 4LF9L 4XX0B 5JAVA 5M9OA 2ATWA 3T1YH 3P20A 4IPHA 1DONA 1T36A 2FK1A 4FO2A 2K5QA 4KHPL 2R93G 1I6HH 1ASZA 5GAGC 4MTEA 1CUKA 4WFN3 1PH3A 4UCTA 2EYMA 1OO9B 1N8RC 4HMJA 5FK9C 2QEJC 4NXNL 1KLUD 5EGTA 5CA0F 1XDNA 3JRWA 2WFWA 5IYDH 4JK1C 3I56A 3CCMA 5DGBA 2PZWA 4OWXB 4DR4L 2L11A 1A3VA 4DR1L 1YJNA 2DIKA 1HZAA 3C1FA 4XIGS 1L0YB 3G4SA 1G6PA 2E2IH 1U9RA 5C8YF 1HJPA 2I46A 3KAKA 5EPJA 3EBEA 1JXLA 3BVZA 3HKZG 2A69D 2ZXPA 4YWKA 1KL9A 1VS0A 4GZYC 5CV4A 1V1QA 3H0GA 3I4OA 4DR7L 2MUYA 2HCCA 3OPOA 4OELB 3CCEA 2WP8J 1D5MC 2CW8A 5EBCA 2NWGA 3P75A 1Y8OB 3N43B 1LO5D 2JA5B 2VQEH 4JI6L 4KY5A 1B7YB 4XT3B 5EOYA 4QWDA 2NBFA 1D1IA 4H0LC 2EZVA 5D1PA 4WJ4A 4LUVA 2NTSA 3Q8DA 2PN1A 3BU2A 4F4WA 2NB0A 3J7AF 5KG2A 1SE4A 1G8ZD 5ELFA 4RWSC 4JI3L 3Q0AA 1M7JA 2V9WA 1XYIA 3TP7A 3J81E 3PO2H 4MA0A 3GTJH 4ME3A 4ED7A 1H9RA 1LTSD 1PFMA 4QW8A 5JJLA 2F4VL 2FPPB 1I4QA 2NVYB 1HUNA 1X65A 2ID0A 1STGA 1SMYD 5IP9H 2ZJTA 1Q8KA 3M3YH 1EZ6A 4JI5L 1XMQQ 3FKIG 1FNWA 1HUMA 3ZJYC 4HIKA 3N6XA 4LF5H 1PYSB 3I4NB 4QQBX 2XIGA 1AE2A 2F0IA 4BBSG 3OHAA 4X65H 4IPGA 4QF4A 4MV3A 2IBKA 1T94A 4A3LG 3FVQA 2B2VC 4A3BH 3S2DB 1S5CD 4P71A 1KRSA 5KX5F 2WB1A 2B3GA 2Z4HA 1HNXL 1WD0A 3A5UA 3U4ZA 2VXWA 1RK6A 4HNVA 1I4RA 2EYOA 4DNTB 5FLXL 5JJZA 3Q2OA 1TT2A 2NN6I 3DWPA 1Y1WB 1PVOA 1K8AC 4LFAQ 1WJJA 2OT2A 4F87A 4YJ2F 4B3TH 4PZ7A 3H15A 3M9OB 3ERQA 3O13A 3PQIA 1VQ6A 1M4VA 5KFUA 1C3OA 2YYZA 1IBKL 5F9LA 4JI0H 5D1OA 5KFSA 4I7ZC 4LNQA 5H80A 3BDLA 4ZOLF 3EPGA 2KEDA 4BBRG 5E4WC 2VQFH 3CPFA 1EYGA 3MXPA 3U9OA 4GNXB 2E2JB 3GTPH 1KLGD 1JDBB 3EPIA 1H9JA 2R87A 2P0AA 4ED1A 2WTFA 5KYLA 5I9PA 2Z9HA 5KFJA 3OSOA 4MTNA 2PMZA 4AQYH 4TKOB 2LS01 2A1AA 5FO9B 3G6VA 1VF5C 4OWWB 3J80c 1SYDA 2PNHA 3RB0A 2K05A 4A3FH 4ILWA 3JSNA 1X3FA 2WINB 1JOOA 4FVMA 1V1PA 4RKLA 1CA5A 2HHHL 3S17H 2FK3A 3MWEA 4ECRA 2EY1A 1HNWL 3K5IA 1DOLA 3ER0A 2BA0A 2K03A 4A4IA 1EYZA 2R8GA 3VPDA 1JB7A 4LF9Q 4POGA 1Q90A 2F0VA 1JIHA 2YW2A 3N42B 1Q1EA 3IKJA 4HYKA 2N88A 4X64L 3J7AV 3MTSA 2CH4A 3V96A 2HUGA 2PPBC 1KEEA 1XTDA 5IGDA 3K58A 3RZDH 1EQRA 1LTAD 2R7KA 4A76A 2JA8G 4ZAIA 4RH6A 5D1OB 1E7ZA 3IL8A 2R8KA 5KFYA 3CC7A 1BCPD 1DGSA 4RB0A 1Y69U 1GGOA 2XC9A 1EQTA 1SYEA 4IJLA 1S5FD 2L15A 2UVUA 4A93G 2J9GA 5CYUA 1VBGA 1TY2A 5G3LD 3VR5A 2BQ3A 4LFAL 4GKKH 1HFGA 1CSPA 1TR5A 3Q8SB 3DMUA 1TWFA 1RODA 1PRTC 5C4XB 4JW0A 4A2AA 1LT4D 1TQOA 4DV6L 1BF4A 4CJ2C 2WYOA 1SNQA 4LMQD 4BY1H 1SEIA 5BN4A 4ZQ3A 4DR3Q 1EWHA 2NYZD 1WTHA 4NXML 4RGTA 5CA1F 1EEFD 4H13C 2Q8TA 4YHHQ 4CDFC 3NUCA 5C4HA 3GTPA 1VQOA 5FD5A 2AUJD 3M4OB 2AU0A 2TMPA 4UCUA 2YZGA 5E4XA 4JV0A 3T4AC 3K7AH 2W6OA 3GIQA 4Q8EA 2ES2A 4O42A 5C0XG 3Q1KA 2B63A 1SAPA 3KALA 3GD7A 3N44B 3PR4A 3CKIB 2R7ZG 4P72A 1J5EH 5C4JH 1PH7A 2B63H 3FMAA 1C0AA 2Y0SE 1SNMA 3JC66 3VA5A 5KFXA 3VPBA 4ZKCB 4CGYB 1Q3LA 4QGUA 5LA6F 1TS2A 5FJ8H 5LMUL 4DV7Q 4DV5H 4L8JA 4BBSH 4IUNA 4X3KA 3V6HA 2VA2A 1LTLA 1V9PA 4PZ8A 2F0DA 2ASDA 1EUJA 4ETSA 4CKEA 2O5IC 1N32H 3I72A 4K6LA 4IFDG 1SE2A 5IYBH 2R7LA 4TUYF 5CR3A 3GTOB 4HCEA 4PV1C 3PW0A 1DYQA 3KAJA 3M4QA 3ERSX 2A5HA 1KC8C 2XRSD 3J81j 4A3KH 2OH2A 4J9KA 3T1HL 4Y52H 1CSQA 5KG7A 3T16A 3OTOH 3SDZA 5C3EG 2NVXA 2BDOA 2FB9A 5TSSA 3R3OA 4JI8H 1DCZA 1AN7A 4KKSA 3H09A 2FINB 1HH2P 1JJ2A 2GLTA 1H9MA 4DV3L 3ND9A 1DXMA 2R93H 2F0MA 3RNUA 2GVBA 4EG0A 2BDNA 3ITPA 3G7LA 5LMUQ 2F0QA 4DV7L 4DV0L 3VYTA 2QILA 3H0GH 3VYRA 4A3DB 5KT3A 1D5XC 2NN6G 4R8UB 3MC0B 2ASBA 3J7AK 1Z6HA 3CXCA 2CW0D 1GOZA 2KQ3A 4OX9Q 2WDTA 3J81i 5KT5A 4DAYB 2OWOA 3CRKC 2IMWP 1SNOA 4EQ5A 3BZKA 2W7OA 5LHY1 2UXDL 3E0JA 3OMCA 2WE6A 2V59A 2CHBD 4ZQIA 1LT5D 3RN5A 2YS6A 4JI4H 2A73B 4O0AA 1S5DD 4GOPA 4MHEA 3BDCA 2F0JA 3CCVA 3VDYA 1K8GA 5C44B 2KECA 1N33L 3JAMW 1LACA 3ICEA 4EX5A 1X54A 5C3EB 1CE8A 3NSWA 3RBDA 4RCOA 1IBLH 2MP1A 4HAEA 1M6VA 4LF5Q 4MN3A 3M4PA 2XWJB 1D2BA 5C3EH 1RF2D 3AMUA 4GOPC 3PIOA 4B3SQ 3JSLA 4O3PA 2MGSA 5CB4F 2AQ2B 4DXFA 4DV0H 1BGWA 3KBXA 3J7A5 2YZMA 2NU9B 2VL6A 1LTGD 4OEMB 3F2BA 5IWAH 4JI7H 5DGAA 2CW7A 4EYIB 1YHQA 5FO8B 4IFDH 3CRLC 3PSIA 4G3IA 1K28A 4HJ7A 5L37A 1WTQA 3JZIA 4HR7B 3J80i 1VQ7A 4CJ1B 1U5KA 3RZOB 2RCNA 1VAJA 3Q24A 5DLGA 3K57A 2AWNA 4XYMB 5EWFA 1CHQD 1W6JA 5KFEA 1YNND 3GTQA 4Q0YA 4A3MH 4TV8F 2W6ZA 3T1HQ 1GUSA 1V8QA 1DIKA 4EFBA 1STBA 5KFOA 4B3ML 4OL7A 1QNUA 1QZHA 3K5HA 4L5QA 1CFMA 2E5LQ 3A7LA 1A62A 5IYCH 4YY3L 4JV5Q 5EZYF 2M9VA 4YAKB 1RK5A 4CKCA 3BYYB 5IWAL 1O7IA 2Q2IA 2BQRA 2PI2A 1PTOF 2FE3A 4DK6C 2NU8B 1PH4A 1PYWD 2K33A 1AE3A 1K83H 3GV8B 5IYBG 2YRWA 3OSNA 4A3DH 3NQTA 2JSOA 2VB3X 1YNXA 4LSXA 3MWDA 3A56A 1RYRA 2K14A 3TINA 3K3PA 3FKIA 3FEWX 4O3SA 3CCUA 4F7XA 2E75C 1SE8A 4WBNF 4J9NA 2HQEA 1TWCB 2BR0A 2W9CB 4DV6Q 2QDBA 3A8IE 3PW2A 1EIFA 4LFCL 4HEDA 4IQZA 4X66Q 3S2HB 4A93H 2YTYA 3A54A 1WTOA 3P7JA 1IL8A 1MSHA 1VCIA 1HQMC 1A63A 3QR8A 1VQIA 5IYCG 2JA7B 2K50A 4G7ZC 2A6HC 2MHVA 5DG8A 1BVSA 3PV0A 3TN2A 2PVPA 3NEMA 4U7CA 5L1LA 1XNRQ 2M00A 4K2LA 3BABA 3MFIA 1ONLA 1PH2A 5J2UF 5JEAJ 4Q0FA 1VQFA 3MFGA 4LAAA 2C35B 4L5TA 1B50A 3GDEA 1EU4A 1IBMQ 3KOJA 2J0TD 1XJVA 3T5HA 1S0MA 1I7LA 4U6PA 1FVIA 4AYBB 2K4KA 4NB3A 4LW1A 1EL0A 2XCPA 3A74A 1M8AA 2QCPX 2MCTA 1I6HB 4DAYA 4LFBL 5IT9E 1G2SA 4QB4A 4E4TA 3RZOH 1HZCA 4X64H 2XGQA 2RGRA 1K0SA 4DU9A 4GNXC 1W6KA 2WB1B 2EJFC 4TVAB 2EIFA 1A9XA 4JI4L 2R7FA 2WAQE 4BBRB 2E2IB 4EGVA 1HQRD 2C9OA 2CKZB 3W3AA 2HVRA 5IP7G 1S03G 1N36Q 1TS5A 1IKMA 3PIP3 3CP0A 3OWEB 4A3JB 1JWUD 1I3QB 4YCWA 4MAMA 2IWHA 3U9TA 4O3RA 3HP3A 1KHIA 4JI3Q 4ME5A 2OQKA 2Z6BA 2UUCQ 4F50A 1JQYD 2PW5A 1H9SA 1VKZA 1W93A 4RKBA 4ODGA 2JA6G 4YAJB 4FDBA 5KFQA 1SEBD 4KY7A 4DK3C 2F0SA 5C4XH 1BJTA 4C1NK 1Y8NB 4J9RA 2XN9C 2VPSA 4HJ9A 2JA7H 4YWLA 4A3FB 2H5XA 1EYDA 1WD1A 3CC4A 3RTXA 4DV3Q 2J6UA 3K80C 1C4QA 4HN7A 4K5WA 1BXRA 2DPIA 2JEGA 3KLSX 3I8ZA 3BVGA 4DPGA 2JA5A 4XT1B 1LTRD 2EY6A 3RUPA 1MSGA 1G6ZA 2WAQB 1EY6A 2E5LH 3RZDB 3K3VA 3TZDA 5KFZA 1ZQ7A 2ATLA 5T1IA 3GTKH 2W9AA 1BO0A 1X3QA 3QZ8A 2NVXH 5KFAA 2AMCB 2CFMA 4POFA 2I0QA 3S16H 3BAAA 3VR2A 1NMGA 1YHBA 4H02A 1PZJD 3T13A 2D0PA 1CKNB 4CDDC 4QUFA 4JBWA 5IP9G 4CDCC 3GIDA 2QGQA 4QCLA 2OTJA 1CTMA 5LP6F 4A3IH 4LFCH 2AQ1B 3ULLA 1QB5D 4KHPQ 1VQGA 1GKHA 1NUCA 3I90A 3V6JA 2RF4A 4OX9H 3MXNA 4Q44A 3N6RA 1LM0A 5FD6A 4LF7L 3HOZG 4UP9A 3CQZH 2VZAA 1PTOD 4F4YA 1NSNS 2QKIC 1WCMG 3DXJC 3HOVB 1TWCA 1IBLQ 1B4OA 1XX8A 5M5WB 4O3QA 5D14A 2RKSA 1YZ6A 4APMA 4ZHQF 1MIUA 2EY2A 1FJGH 2HIXA 4L63B 4P75A 5J3BA 5C0XH 1B2TA 1AN8A 1TWGB 4F8MA 4B9WA 1JICA 3S2HH 3OTOL 3HOXH 4KJNA 1QUQA 2KOLA 4XZ3B 2J4XA 3M4OH 1SMXA 4J8QA 5C5MA 4C3JG 4O2DA 3CW2C 1FJGL 3D6WA 3M7GA 1H95A 1I4PA 2VR1A 4KHVA 5LMNL 2FMMA 3E5SA 1J8IA 2ICEC 1XPRA 2B8GA 5IT9c 4CKBA 4XYOA 4DAVA 4LFAH 2RDJA 1PFNA 2K5NA 3HKZE 3PW5A 1L1OA 1STYA 5EQ0A 4ALPA 1K83B 1W2BA 3FHWA 4GC6A 1EIGA 5ELBA 4FNFA 4XTCS 1N32L 1RYSA 5J22A 4DR6L 2V4DA 5KFFA 3BA9A 3KK7A 1N36L 1NR4A 3PO2B 1ILPA 2K5DA 1UC9A 1FYCA 1OXTA 4MV7A 2KCCA 1HTLD 4QWBA 1EHIA 4O4IF 5CMDA 5JJIA 1STAA 1TWCH 1EYCA 1M1KC 4ECQA 4C1NI 1QUQB 5K2MA 5ELEA 3EA6A 2FP4B 4FXDA 1CI3M 2ZM6L 1SYXB 3UDGA 2ZT9C 4KTAA 4AQYL 3SK8A 2JEFA 4JV5L 1GHKA 1A3UA 1JX4A 1RTOA 3LGJA 2Q8IB 4DV5Q 4DV7H 3D0FA 3KYHC 4RZQA 3SI8A 4UPAA 4DL5A 1AUVA 4DR2H 4ECVA 4UP7A 3M3YB 1KJQA 3PVXA 4B08A 3GIKA 4IHJF 2W6PA 5K5PA 1EZ8A 4HTHA 1PTOB 1BNCA 4YY3H 5GAEC 3GIMA 1J6QA 1SRUA 3IFTA 1ULZA 4IAJA 1LLRD 4ZYSA 4DL3A 1JR0D 3D6CA 2C28A 4IN3A 4A2BA 5LMNW 4RNMA 1TWFH 2KHSA 1KXLA 4DR7Q 2RHQB 4JOIA 3BJYA 3OIPA 3GTLA 1GSAA 1E1TA 2L4NA 4ABNA 1M90C 1GXDC 4A3GH 2NVQB 3H91A 1C9OA 3FP9A 3S9WA 2I8CA 4F4ZA 5BR8H 4RHRA 3U4VA 1YNJC 3KF6A 4JYAL 4DUYQ 2PMZE 4TQSA 3PUYA 1GHJA 5KFNA 1HFNA 3L9AX 3I12A 1MI2A 2NVTH 3PUXA 4BY7B 1KNEA 2HCIA 5I2YA 4A3BG 3VA7A 3H94A 1ASYA 2OEOA 4LH7A 5J1ZA 1VQEA 3J7YW 2K6AA 5ELCA 4HR7A 3MR6A 1C7YA 3MA2B 1I7NA 3LMLA 2CQOA 3SVMA 2OTLA 3KJPA 3ORQA 1QG7A 3ULJA 2MNAA 4HIDA 4Y8VB 3FDTA 5CORA 1GLVA 3R5XA 2F0EA 2F3IA 4YR3A 1NTGA 4E6IA 1X32A 3GTOA 1CM9A 5JEAH 1QOHA 2CWPA 5CC4A 2KENA 2ZTDA 3HOVG 1KC7A 1HR0Q 4M8AA 2RSNA 4ZKBB 1I50H 1XNQH 3OW7A 1DOKA 3ETJA 3M85A 4JPBW 3GTJB 1F2ZA 4ZRZA 1F2MA 4GKJH 4JC0A 3RB4A 1RDPD 3F1ZA 4RAZA 3TQTA 4JI1H 2R8JA 1HZ9A 5C5JA 2FHTA 5IIFA 3VMMA 1DV1A 4OIKA 3L2PA 2IA6A 2E2DC 4PMCA 2NVTB 4DR5H 2JA6A 1TWHB 2AQ3B 2WB1G 2QF7A 4R8UA 1BKBA 5D65A 1Z9FA 5ELOA 1GUOA 4A3JH 5AFWA 3L4JA 4WJWA 1EY7A 4J9LA 4BXXG 1I4GA 3OHBA 4ME6A 4LWCA 2K01A 2JJQA
chains in the Genus database with same CATH topology
3STBD 1SROA 4C2MH 2NZHA 3W1GA 3TQYA 4C3HH 3HOXG 3PCOB 1G6PA 3I4MG 3M4QA 3ERSX 4PG3A 4DV1Q 1KC8C 2KCMA 3G71A 2HIVA 3J81j 3CMEA 4A3KH 2VUMG 1RIPA 4IFDI 3T1HL 4Y52H 1CSQA 4DV5L 4A3LH 4DR6Q 1Z47A 5C3EG 3S2DH 2KBNA 4P74A 1JT8A 1FL0A 4B3SL 3ULPA 2AKWB 5M5WH 4NXMQ 2F52A 2I0QA 4YWMA 2UUAQ 3CF5A 1HH2P 2N49A 1JJ2A 1UEBA 4R4IA 1LUZA 1S40A 3IRBA 1Y1WH 3RNUA 4LF7Q 2GVBA 2E2HH 4LF8Q 4LUZA 1WCMH 4DV4L 1IBKQ 5LMUQ 4DV7L 1YITA 4DV0L 2N8NA 1K3RA 3H0GH 4JBJA 3CCJA 4JI8Q 2BH2A 4DV4Q 4R4QA 1EOVA 2Q2UA 2UXBL 2AHOB 1NE3A 2NN6G 5GADC 4GKKQ 4IO9A 2ASBA 3UDIA 4BY7H 1MJEA 3CXCA 4JI2Q 3TS0A 1FJGQ 3PUVA 4OX9Q 1A0IA 1X55A 3W1BA 3J81i 2DGYA 1B8AA 4DAYB 3E9HA 2OWOA 2Q2TA 5M5YH 1VQPA 1MJCA 1PHJA 4EQ5A 3BZKA 3SGIA 5FLXc 4LF4L 3I4NH 3S1QH 2UXDL 2IHEA 4X62Q 3RN5A 1GO3E 4O0AA 5BR8Q 4GOPA 3CCVA 3RN2A 4DV0Q 3VDYA 1K8GA 1N33L 1UE7A 3ICEA 4JI8L 1CKNA 3CPWA 4EX5A 1X54A 2K5HA 3KDFB 3OW2A 4JBMA 4JI0L 3GTGH 3CCSA 1N9WA 3H0GG 4LF5Q 3M4PA 1X3EA 3KLWA 3UDFA 1OXSC 5C3EH 2I5LX 3K7UC 3HOZH 5JJKA 5IP7H 1N34Q 4GOPC 3PIOA 1UE6A 1PH8A 4B3SQ 5IYDH 3PF4A 2CCZA 4X6AH 3S1NH 3E0EA 5C44H 5LMNQ 1PFSA 3NBHB 2VL6A 4QY7A 5EAYA 1XMOQ 3J7A5 3F2BA 3EIVA 4KHZA 3F2DA 1YHQA 4GLVB 3J7ZC 3PSIA 3S15H 2E2JH 3AFQA 4HJ7A 2ZTEA 4X66L 3J80i 1VQ7A 3HOVH 1U5KA 3H3VH 1SLJA 2RCNA 1VQDA 3BZCA 1BBUA 2JA7G 2AWNA 5IWAQ 1Y1VH 3E9IA 5M3MG 3EN2A 2UU9Q 2JE6I 3GTLH 2JA6H 1D8LA 4IJHA 4DR1Q 1V43A 5GROA 2YTVA 1E3PA 4X65Q 4A3MH 3T1HQ 3S14H 4DUZQ 1BBWA 2JQOA 1Q7YC 1XPUA 1J5EL 4B3ML 3HOYH 1QZHA 4HJAA 2LSSA 4L5QA 1XPOA 1VQ4A 1HNZQ 2E5LQ 4OXPA 1J5EQ 4HIOA 1A62A 1EWIA 5IYCH 4GKJQ 1CKOA 1IBLL 4YY3L 3U58A 1OXXK 1VQJA 1YEZA 4AH6A 4JV5Q 3TS2A 1L1OC 5IWAL 5C0XJ 1O7IA 1SN8A 2Q2IA 3S1MH 2PI2A 4LFBQ 2R7DA 2UU9L 3I4MH 4DK6C 1TXYA 1PH4A 4NPSA 1AE3A 1K83H 5C0XI 4JI1L 3NELA 1KIXA 2R7ZH 5IYBG 3UDXA 2K75A 4A3DH 4A3CH 3H3VI 4QJFA 1YNXA 2VQFL 2R92G 3MXNB 1XNQL 3HOUG 1KAWA 3HOWH 2VQFQ 1U0LA 3STBC 2K14A 1TWGH 2GN5A 3CMAA 1QVFA 5FJ8G 2OQ0A 5IYDG 4BY7G 4QL5A 3CCUA 4OONA 1OXVA 2RHSB 2I5HA 1Q12A 1VQBA 3HFZB 4A3CG 2VNUD 1SE8A 3RR5A 1B70B 1I5FA 1A8VA 2UUCL 1YBYA 1CKMA 2VQEQ 2ZJRA 4DV6Q 2UXBQ 1EIFA 4OWTB 4LFCL 1EQQA 4X66Q 4MNOA 1N33Q 1WFQA 4A93H 2YTYA 2PI2E 2VQEL 4IOAA 2B29A 4J15A 4DAMA 3J81c 4LFCQ 2Z6KA 5AJ3Q 2E8GA 1VCIA 4JI4Q 1A63A 1JMCA 2KCTA 1VQIA 5IYCG 3F8TA 1OTCA 2JA9A 1Q46A 2K50A 1YVCA 1BVSA 2D62A 3PV0A 3NEMA 5HGQA 1P16A 1XNRQ 1PH2A 5JEAJ 2QEXA 4GNXA 4JI6Q 1EIYB 4DR4Q 1VQFA 1JJGA 4JI2L 1IZ6A 2C35B 4L5TA 2Q2HA 4UP8A 1JE5A 3W5OA 4JI7L 4B3MQ 4GKJL 4OO1G 3GDEA 3I55A 5M3FH 1QZGA 1IBMQ 3KOJA 2K5VA 5AJ3L 1XJVA 4GN5A 1I94L 4NXNQ 4JOIC 1FVIA 3I2ZA 2K4KA 4NB3A 4LW1A 4TQUS 3A0JA 3A74A 3L0OA 1I94Q 2YV5A 5FLMH 4A3FG 4LFBL 4AYBE 1UE1A 2A19A 1VQKA 4A3DG 2MQHA 3RZOH 1HZCA 4LF4Q 2WB1E 5ELNA 4GNXC 2JA5H 4QIWE 1YIJA 5C44G 2R6GA 4YCVA 1MKHA 4TVAB 2EIFA 2MO0A 1XNQQ 1VQAA 2R7FA 2WAQE 2Y0SG 4JI4L 4A75A 4JYAQ 2XGTA 1W3SA 2EXDA 1NJIC 2CKZB 1VQHA 3T1YL 2K52A 5IP7G 1XMQL 3F2CA 1N36Q 4DNIA 3CP0A 4YCWA 4DR5L 4JG2A 2NVYH 4JI3Q 1KHIA 4JCVE 4P73A 3AEVA 2OQKA 1SR3A 4R4OA 3KJOA 1RL2A 2IX0A 2UUCQ 4LF6L 4K0KQ 4A3GG 3AFPA 1P8LA 3FKIH 3WWVA 1GD7A 1PH1A 1HZBA 3TRZA 2R92H 2PQAB 2JA6G 1K0RA 4FDBA 2KHJA 4DK3C 1GM5A 1KQSA 5C4XH 4HJ9A 2JA7H 4YWLA 2YU9H 4BA2I 2H5XA 3A5ZB 1PYBA 3K0XA 4DV3Q 3CC4A 3K80C 4JI5Q 3PGZA 4B3RQ 2QA4A 4LF9L 2JEAI 2MO1A 1HR0W 2ATWA 4DPGA 4IPHA 2F4VQ 4KHPL 1Y1WG 3CD6A 3HOYG 1I6HH 1ASZA 5GAGC 2R93G 1CUKA 1X6OA 1PH3A 2ZJQA 1N8RC 3GTKH 4NXNL 2NVXH 4A3MG 2AMCB 2CFMA 3HKSA 1JJCB 2WFWA 4POFA 1PV4A 1NMGA 1YHBA 3NENA 4H02A 4DV3L 2D0PA 1CKNB 5IP9G 4PMWA 4JBWA 3I56A 3KDFA 3CCMA 4OWXB 2UUAL 2QGQA 4DR4L 3TREA 4DR1L 3GO5A 4GLXA 2MFIA 3G48A 1YJNA 1HZAA 4DUZL 4XIGS 4L5SA 3G4SA 3GTQH 4A3IH 2OTJA 3ULLA 2IY5B 4KHPQ 3S16H 2E2IH 4LF6Q 1VQGA 1WYDA 4R4CA 3JAMi 1GKHA 2UUBQ 3I4NG 4K0KL 1HJPA 4A3EH 2RF4A 3EBEA 2ZJPA 4JBKA 1I3QH 1VQCA 3HKZG 4YWKA 3D31A 1KL9A 1VS0A 4YY3Q 1R9TH 4A3IG 1IBML 4GN4B 1V1QA 4BA1I 2N3SA 1IL2A 1GVPA 3I4OA 3B6YA 3OYYA 5M5XH 3CCLA 4DR7L 1KRTA 3CCEA 1LM0A 2JEBI 4LF7L 2WP8J 3PO2G 3HOZG 4UP9A 3CQZH 2VZAA 2UXDQ 4DV2Q 4JI6L 1B7YB 1WCMG 4RG1A 1L1OB 4UY8C 1IBLQ 1E1OA 4LUVA 4WJ4A 3Q8DA 2R93H 3BU2A 4OX9L 4GLAC 1YZ6A 4JI3L 1UE5A 1MIUA 4AYBG 4LF5L 1PH6A 2LXJA 3PO2H 2HIXA 4IFDJ 1WI5A 1D7QA 4P75A 5J3BA 3GTJH 3KF6B 2OCEA 4A3KG 4ME3A 4JI7Q 3I7FA 3S2HH 3OTOL 2ALYB 3HOXH 5JJLA 2F4VL 4B3TL 4WJ3M 1QUQA 3AQQA 3S24A 1XNRL 1X65A 2ID0A 1YJ9A 5C4XG 5IP9H 4PZ6A 5HY6A 2Z0SA 1PA6A 4GS3A 1Q8KA 3M3YH 1SMXA 4R4TA 3M4OH 4JI5L 1X9NA 4B3RL 1XMQQ 3FKIG 4O2DA 1KD1C 1T9HA 3CW2C 1FJGL 1Q1BA 3ZJYC 4HIKA 3M7NA 1H95A 1PYSB 5IE8A 4QQBX 1AE2A 4BBSG 2FXQA 3CCRA 5LMNL 1IYJB 1XMOL 4IPGA 1XPRA 1QVCA 2Z6KC 5E7NA 5IT9c 1X56A 3RLOA 4A3LG 3PF5A 4APVA 4B3TQ 3HKZE 2K5NA 3L7ZC 4A3BH 1L1OA 4P71A 4ALPA 1KRSA 1W2BA 3FHWA 2VUMH 1VQ8A 5K36G 2JK8A 2HT1A 2B3GA 4XTCS 1N32L 1HNXL 4DR6L 3A5UA 3U4ZA 1NY4A 3RLFA 1HNZL 3T1YQ 2E5LL 4GOPB 2JA5G 4BXXH 2NN6I 1N36L 1PVOA 1K8AC 3K81C 4A3EG 4LFAQ 1WJJA 3DLLA 2I5MX 1Q82C 1K73C 1OXTA 4PZ7A 1VQLA 1EFWA 3H15A 4X65L 2BH8A 1Y14B 2IHFA 1VQ6A 5JJIA 2YYZA 4A3JG 1S72A 1IBKL 1TWCH 3MEFA 3BJUA 5JEAG 1M1KC 2IX1A 1QUQB 4DR2Q 4AQYQ 4LNQA 5M3FG 3GTMH 4KI0A 2ZM6L 3K8AA 4BBRG 3CPFA 3UDGA 4DR2L 4GN3B 4AQYL 1EYGA 1AH9A 3DM3A 4GNXB 4JV5L 1YHAA 2EQSA 3M9BA 3GTPH 3LGJA 1HR0L 2BA1A 3TEHB 4JI0Q 3PO3H 4DV5Q 3D0FA 2B63G 1WOCA 3KYHC 4UPAA 1TWAH 4MTNA 4UP7A 4Y7NH 2A8VA 2A1AA 4RMFA 2LXKA 1G51A 3S1RH 4OWWB 3J80c 5GAEC 2D0OA 2PNHA 4DV2L 1J6QA 1SRUA 1N32Q 4A3FH 2UXCQ 5IY0A 4R1JA 1X3FA 3KF8B 1VQMA 3CC2A 3S17H 2HHHL 5LMNW 3PO3G 1TWFH 1KXLA 1VQ5A 1HNWL 4DR7Q 1X3GA 2BA0A 3ER0A 2RHQB 4JOIA 4A4IA 4GKKL 2ZTCA 1JB7A 1NBWA 4LF9Q 1E1TA 3AYHB 4POGA 4MZ9A 1M90C 1Q1EA 4IOCA 4X64L 5FLMG 3PIPA 1PH9A 4A3GH 4OO1I 1NMFA 3GTOH 2N78A 1XTDA 1C9OA 3FP9A 3RZDH 1EQRA 4A76A 4HIMA 2JA8G 3U4VA 3HOUH 3KF6A 4JYAL 1E7ZA 2UUBL 2YTXA 3CC7A 1SFOH 1HNXQ 4DUYQ 2UXCL 2PMZE 1DGSA 2AWOA 1QVGA 4IJLA 1Q81C 2L15A 2VW9A 4DR3L 3PUYA 3PUWA 2PQAA 3UE0A 3CAMA 1LYLA 4A93G 4LFAL 1CSPA 4X64Q 2NVTH 3PUXA 3JAMc 1PH5A 5GAHC 1FGUA 4A3BG 2HQLA 5BR8L 1ASYA 4IPDA 2ZM6Q 3G6EA 1VQEA 4LF8L 1L2FA 4DV6L 1C7YA 2VS1A 2JA8H 4BY1H 3PUZA 3RLNA 2CQOA 2IT1A 2OTLA 4HJ8A 3KJPA 4DR3Q 3ULJA 4NXML 4L5RC 4C3JH 2MNAA 4HIDA 1N34L 1VQ9A 4YHHQ 1Q86C 2F3IA 1Y1VG 1NTGA 5M3MH 1VQOA 4AIMA 4YHHL 4BY1G 2CWPA 4JI1Q 3HOWG 1OXUA 2DUDA 2KENA 2ZTDA 3K7AH 4YCUA 3HOVG 2ES2A 5H1SE 1S3OA 5C0XG 1HR0Q 3U50C 1TWHH 2NVQH 1I50H 1YJWA 3GD7A 1VQNA 1HNWQ 4IPCA 2R7ZG 4P72A 3M85A 1K9MC 4JC0A 5C4JH 2XTIA 1PH7A 3F1ZA 1IXRA 3KFUA 2B63H 3UE1A 1HZ9A 4C3IH 1C0AA 2WAQG 2Y0SE 3JC66 3L2PA 3CCQA 4DKAC 2NZOA 4X62L 2KHIA 4BBRH 2VY3A 4KLKA 5DLQE 1UWVA 4QGUA 4DV1L 2WB1G 5FJ8H 5LMUL 4DV7Q 4BBSH 1BKBA 4DUYL 1Z9FA 1LTLA 2CWAA 5ELOA 1E24A 4A3JH 1V9PA 2V1CC 1YI2A 4HJ5A 4PZ8A 1E22A 4LUOA 4BXXG 1EUJA 2HHHQ 5GQOA 3OTOQ 1G291 1L0WA 4LWCA 4DR5Q 2GVAA 2JJQA 4IFDG 5IYBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STB D;  1SRO A;  4C2M H;  2NZH A;  3W1G A;  3TQY A;  4C3H H;  3HOX G;  3PCO B;  1G6P A;  3I4M G;  3M4Q A;  3ERS X;  4PG3 A;  4DV1 Q;  1KC8 C;  2KCM A;  3G71 A;  2HIV A;  3J81 j;  3CME A;  4A3K H;  2VUM G;  1RIP A;  4IFD I;  3T1H L;  4Y52 H;  1CSQ A;  4DV5 L;  4A3L H;  4DR6 Q;  1Z47 A;  5C3E G;  3S2D H;  2KBN A;  4P74 A;  1JT8 A;  1FL0 A;  4B3S L;  3ULP A;  2AKW B;  5M5W H;  4NXM Q;  2F52 A;  2I0Q A;  4YWM A;  2UUA Q;  3CF5 A;  1HH2 P;  2N49 A;  1JJ2 A;  1UEB A;  4R4I A;  1LUZ A;  1S40 A;  3IRB A;  1Y1W H;  3RNU A;  4LF7 Q;  2GVB A;  2E2H H;  4LF8 Q;  4LUZ A;  1WCM H;  4DV4 L;  1IBK Q;  5LMU Q;  4DV7 L;  1YIT A;  4DV0 L;  2N8N A;  1K3R A;  3H0G H;  4JBJ A;  3CCJ A;  4JI8 Q;  2BH2 A;  4DV4 Q;  4R4Q A;  1EOV A;  2Q2U A;  2UXB L;  2AHO B;  1NE3 A;  2NN6 G;  5GAD C;  4GKK Q;  4IO9 A;  2ASB A;  3UDI A;  4BY7 H;  1MJE A;  3CXC A;  4JI2 Q;  3TS0 A;  1FJG Q;  3PUV A;  4OX9 Q;  1A0I A;  1X55 A;  3W1B A;  3J81 i;  2DGY A;  1B8A A;  4DAY B;  3E9H A;  2OWO A;  2Q2T A;  5M5Y H;  1VQP A;  1MJC A;  1PHJ A;  4EQ5 A;  3BZK A;  3SGI A;  5FLX c;  4LF4 L;  3I4N H;  3S1Q H;  2UXD L;  2IHE A;  4X62 Q;  3RN5 A;  1GO3 E;  4O0A A;  5BR8 Q;  4GOP A;  3CCV A;  3RN2 A;  4DV0 Q;  3VDY A;  1K8G A;  1N33 L;  1UE7 A;  3ICE A;  4JI8 L;  1CKN A;  3CPW A;  4EX5 A;  1X54 A;  2K5H A;  3KDF B;  3OW2 A;  4JBM A;  4JI0 L;  3GTG H;  3CCS A;  1N9W A;  3H0G G;  4LF5 Q;  3M4P A;  1X3E A;  3KLW A;  3UDF A;  1OXS C;  5C3E H;  2I5L X;  3K7U C;  3HOZ H;  5JJK A;  5IP7 H;  1N34 Q;  4GOP C;  3PIO A;  1UE6 A;  1PH8 A;  4B3S Q;  5IYD H;  3PF4 A;  2CCZ A;  4X6A H;  3S1N H;  3E0E A;  5C44 H;  5LMN Q;  1PFS A;  3NBH B;  2VL6 A;  4QY7 A;  5EAY A;  1XMO Q;  3J7A 5;  3F2B A;  3EIV A;  4KHZ A;  3F2D A;  1YHQ A;  4GLV B;  3J7Z C;  3PSI A;  3S15 H;  2E2J H;  3AFQ A;  4HJ7 A;  2ZTE A;  4X66 L;  3J80 i;  1VQ7 A;  3HOV H;  1U5K A;  3H3V H;  1SLJ A;  2RCN A;  1VQD A;  3BZC A;  1BBU A;  2JA7 G;  2AWN A;  5IWA Q;  1Y1V H;  3E9I A;  5M3M G;  3EN2 A;  2UU9 Q;  2JE6 I;  3GTL H;  2JA6 H;  1D8L A;  4IJH A;  4DR1 Q;  1V43 A;  5GRO A;  2YTV A;  1E3P A;  4X65 Q;  4A3M H;  3T1H Q;  3S14 H;  4DUZ Q;  1BBW A;  2JQO A;  1Q7Y C;  1XPU A;  1J5E L;  4B3M L;  3HOY H;  1QZH A;  4HJA A;  2LSS A;  4L5Q A;  1XPO A;  1VQ4 A;  1HNZ Q;  2E5L Q;  4OXP A;  1J5E Q;  4HIO A;  1A62 A;  1EWI A;  5IYC H;  4GKJ Q;  1CKO A;  1IBL L;  4YY3 L;  3U58 A;  1OXX K;  1VQJ A;  1YEZ A;  4AH6 A;  4JV5 Q;  3TS2 A;  1L1O C;  5IWA L;  5C0X J;  1O7I A;  1SN8 A;  2Q2I A;  3S1M H;  2PI2 A;  4LFB Q;  2R7D A;  2UU9 L;  3I4M H;  4DK6 C;  1TXY A;  1PH4 A;  4NPS A;  1AE3 A;  1K83 H;  5C0X I;  4JI1 L;  3NEL A;  1KIX A;  2R7Z H;  5IYB G;  3UDX A;  2K75 A;  4A3D H;  4A3C H;  3H3V I;  4QJF A;  1YNX A;  2VQF L;  2R92 G;  3MXN B;  1XNQ L;  3HOU G;  1KAW A;  3HOW H;  2VQF Q;  1U0L A;  3STB C;  2K14 A;  1TWG H;  2GN5 A;  3CMA A;  1QVF A;  5FJ8 G;  2OQ0 A;  5IYD G;  4BY7 G;  4QL5 A;  3CCU A;  4OON A;  1OXV A;  2RHS B;  2I5H A;  1Q12 A;  1VQB A;  3HFZ B;  4A3C G;  2VNU D;  1SE8 A;  3RR5 A;  1B70 B;  1I5F A;  1A8V A;  2UUC L;  1YBY A;  1CKM A;  2VQE Q;  2ZJR A;  4DV6 Q;  2UXB Q;  1EIF A;  4OWT B;  4LFC L;  1EQQ A;  4X66 Q;  4MNO A;  1N33 Q;  1WFQ A;  4A93 H;  2YTY A;  2PI2 E;  2VQE L;  4IOA A;  2B29 A;  4J15 A;  4DAM A;  3J81 c;  4LFC Q;  2Z6K A;  5AJ3 Q;  2E8G A;  1VCI A;  4JI4 Q;  1A63 A;  1JMC A;  2KCT A;  1VQI A;  5IYC G;  3F8T A;  1OTC A;  2JA9 A;  1Q46 A;  2K50 A;  1YVC A;  1BVS A;  2D62 A;  3PV0 A;  3NEM A;  5HGQ A;  1P16 A;  1XNR Q;  1PH2 A;  5JEA J;  2QEX A;  4GNX A;  4JI6 Q;  1EIY B;  4DR4 Q;  1VQF A;  1JJG A;  4JI2 L;  1IZ6 A;  2C35 B;  4L5T A;  2Q2H A;  4UP8 A;  1JE5 A;  3W5O A;  4JI7 L;  4B3M Q;  4GKJ L;  4OO1 G;  3GDE A;  3I55 A;  5M3F H;  1QZG A;  1IBM Q;  3KOJ A;  2K5V A;  5AJ3 L;  1XJV A;  4GN5 A;  1I94 L;  4NXN Q;  4JOI C;  1FVI A;  3I2Z A;  2K4K A;  4NB3 A;  4LW1 A;  4TQU S;  3A0J A;  3A74 A;  3L0O A;  1I94 Q;  2YV5 A;  5FLM H;  4A3F G;  4LFB L;  4AYB E;  1UE1 A;  2A19 A;  1VQK A;  4A3D G;  2MQH A;  3RZO H;  1HZC A;  4LF4 Q;  2WB1 E;  5ELN A;  4GNX C;  2JA5 H;  4QIW E;  1YIJ A;  5C44 G;  2R6G A;  4YCV A;  1MKH A;  4TVA B;  2EIF A;  2MO0 A;  1XNQ Q;  1VQA A;  2R7F A;  2WAQ E;  2Y0S G;  4JI4 L;  4A75 A;  4JYA Q;  2XGT A;  1W3S A;  2EXD A;  1NJI C;  2CKZ B;  1VQH A;  3T1Y L;  2K52 A;  5IP7 G;  1XMQ L;  3F2C A;  1N36 Q;  4DNI A;  3CP0 A;  4YCW A;  4DR5 L;  4JG2 A;  2NVY H;  4JI3 Q;  1KHI A;  4JCV E;  4P73 A;  3AEV A;  2OQK A;  1SR3 A;  4R4O A;  3KJO A;  1RL2 A;  2IX0 A;  2UUC Q;  4LF6 L;  4K0K Q;  4A3G G;  3AFP A;  1P8L A;  3FKI H;  3WWV A;  1GD7 A;  1PH1 A;  1HZB A;  3TRZ A;  2R92 H;  2PQA B;  2JA6 G;  1K0R A;  4FDB A;  2KHJ A;  4DK3 C;  1GM5 A;  1KQS A;  5C4X H;  4HJ9 A;  2JA7 H;  4YWL A;  2YU9 H;  4BA2 I;  2H5X A;  3A5Z B;  1PYB A;  3K0X A;  4DV3 Q;  3CC4 A;  3K80 C;  4JI5 Q;  3PGZ A;  4B3R Q;  2QA4 A;  4LF9 L;  2JEA I;  2MO1 A;  1HR0 W;  2ATW A;  4DPG A;  4IPH A;  2F4V Q;  4KHP L;  1Y1W G;  3CD6 A;  3HOY G;  1I6H H;  1ASZ A;  5GAG C;  2R93 G;  1CUK A;  1X6O A;  1PH3 A;  2ZJQ A;  1N8R C;  3GTK H;  4NXN L;  2NVX H;  4A3M G;  2AMC B;  2CFM A;  3HKS A;  1JJC B;  2WFW A;  4POF A;  1PV4 A;  1NMG A;  1YHB A;  3NEN A;  4H02 A;  4DV3 L;  2D0P A;  1CKN B;  5IP9 G;  4PMW A;  4JBW A;  3I56 A;  3KDF A;  3CCM A;  4OWX B;  2UUA L;  2QGQ A;  4DR4 L;  3TRE A;  4DR1 L;  3GO5 A;  4GLX A;  2MFI A;  3G48 A;  1YJN A;  1HZA A;  4DUZ L;  4XIG S;  4L5S A;  3G4S A;  3GTQ H;  4A3I H;  2OTJ A;  3ULL A;  2IY5 B;  4KHP Q;  3S16 H;  2E2I H;  4LF6 Q;  1VQG A;  1WYD A;  4R4C A;  3JAM i;  1GKH A;  2UUB Q;  3I4N G;  4K0K L;  1HJP A;  4A3E H;  2RF4 A;  3EBE A;  2ZJP A;  4JBK A;  1I3Q H;  1VQC A;  3HKZ G;  4YWK A;  3D31 A;  1KL9 A;  1VS0 A;  4YY3 Q;  1R9T H;  4A3I G;  1IBM L;  4GN4 B;  1V1Q A;  4BA1 I;  2N3S A;  1IL2 A;  1GVP A;  3I4O A;  3B6Y A;  3OYY A;  5M5X H;  3CCL A;  4DR7 L;  1KRT A;  3CCE A;  1LM0 A;  2JEB I;  4LF7 L;  2WP8 J;  3PO2 G;  3HOZ G;  4UP9 A;  3CQZ H;  2VZA A;  2UXD Q;  4DV2 Q;  4JI6 L;  1B7Y B;  1WCM G;  4RG1 A;  1L1O B;  4UY8 C;  1IBL Q;  1E1O A;  4LUV A;  4WJ4 A;  3Q8D A;  2R93 H;  3BU2 A;  4OX9 L;  4GLA C;  1YZ6 A;  4JI3 L;  1UE5 A;  1MIU A;  4AYB G;  4LF5 L;  1PH6 A;  2LXJ A;  3PO2 H;  2HIX A;  4IFD J;  1WI5 A;  1D7Q A;  4P75 A;  5J3B A;  3GTJ H;  3KF6 B;  2OCE A;  4A3K G;  4ME3 A;  4JI7 Q;  3I7F A;  3S2H H;  3OTO L;  2ALY B;  3HOX H;  5JJL A;  2F4V L;  4B3T L;  4WJ3 M;  1QUQ A;  3AQQ A;  3S24 A;  1XNR L;  1X65 A;  2ID0 A;  1YJ9 A;  5C4X G;  5IP9 H;  4PZ6 A;  5HY6 A;  2Z0S A;  1PA6 A;  4GS3 A;  1Q8K A;  3M3Y H;  1SMX A;  4R4T A;  3M4O H;  4JI5 L;  1X9N A;  4B3R L;  1XMQ Q;  3FKI G;  4O2D A;  1KD1 C;  1T9H A;  3CW2 C;  1FJG L;  1Q1B A;  3ZJY C;  4HIK A;  3M7N A;  1H95 A;  1PYS B;  5IE8 A;  4QQB X;  1AE2 A;  4BBS G;  2FXQ A;  3CCR A;  5LMN L;  1IYJ B;  1XMO L;  4IPG A;  1XPR A;  1QVC A;  2Z6K C;  5E7N A;  5IT9 c;  1X56 A;  3RLO A;  4A3L G;  3PF5 A;  4APV A;  4B3T Q;  3HKZ E;  2K5N A;  3L7Z C;  4A3B H;  1L1O A;  4P71 A;  4ALP A;  1KRS A;  1W2B A;  3FHW A;  2VUM H;  1VQ8 A;  5K36 G;  2JK8 A;  2HT1 A;  2B3G A;  4XTC S;  1N32 L;  1HNX L;  4DR6 L;  3A5U A;  3U4Z A;  1NY4 A;  3RLF A;  1HNZ L;  3T1Y Q;  2E5L L;  4GOP B;  2JA5 G;  4BXX H;  2NN6 I;  1N36 L;  1PVO A;  1K8A C;  3K81 C;  4A3E G;  4LFA Q;  1WJJ A;  3DLL A;  2I5M X;  1Q82 C;  1K73 C;  1OXT A;  4PZ7 A;  1VQL A;  1EFW A;  3H15 A;  4X65 L;  2BH8 A;  1Y14 B;  2IHF A;  1VQ6 A;  5JJI A;  2YYZ A;  4A3J G;  1S72 A;  1IBK L;  1TWC H;  3MEF A;  3BJU A;  5JEA G;  1M1K C;  2IX1 A;  1QUQ B;  4DR2 Q;  4AQY Q;  4LNQ A;  5M3F G;  3GTM H;  4KI0 A;  2ZM6 L;  3K8A A;  4BBR G;  3CPF A;  3UDG A;  4DR2 L;  4GN3 B;  4AQY L;  1EYG A;  1AH9 A;  3DM3 A;  4GNX B;  4JV5 L;  1YHA A;  2EQS A;  3M9B A;  3GTP H;  3LGJ A;  1HR0 L;  2BA1 A;  3TEH B;  4JI0 Q;  3PO3 H;  4DV5 Q;  3D0F A;  2B63 G;  1WOC A;  3KYH C;  4UPA A;  1TWA H;  4MTN A;  4UP7 A;  4Y7N H;  2A8V A;  2A1A A;  4RMF A;  2LXK A;  1G51 A;  3S1R H;  4OWW B;  3J80 c;  5GAE C;  2D0O A;  2PNH A;  4DV2 L;  1J6Q A;  1SRU A;  1N32 Q;  4A3F H;  2UXC Q;  5IY0 A;  4R1J A;  1X3F A;  3KF8 B;  1VQM A;  3CC2 A;  3S17 H;  2HHH L;  5LMN W;  3PO3 G;  1TWF H;  1KXL A;  1VQ5 A;  1HNW L;  4DR7 Q;  1X3G A;  2BA0 A;  3ER0 A;  2RHQ B;  4JOI A;  4A4I A;  4GKK L;  2ZTC A;  1JB7 A;  1NBW A;  4LF9 Q;  1E1T A;  3AYH B;  4POG A;  4MZ9 A;  1M90 C;  1Q1E A;  4IOC A;  4X64 L;  5FLM G;  3PIP A;  1PH9 A;  4A3G H;  4OO1 I;  1NMF A;  3GTO H;  2N78 A;  1XTD A;  1C9O A;  3FP9 A;  3RZD H;  1EQR A;  4A76 A;  4HIM A;  2JA8 G;  3U4V A;  3HOU H;  3KF6 A;  4JYA L;  1E7Z A;  2UUB L;  2YTX A;  3CC7 A;  1SFO H;  1HNX Q;  4DUY Q;  2UXC L;  2PMZ E;  1DGS A;  2AWO A;  1QVG A;  4IJL A;  1Q81 C;  2L15 A;  2VW9 A;  4DR3 L;  3PUY A;  3PUW A;  2PQA A;  3UE0 A;  3CAM A;  1LYL A;  4A93 G;  4LFA L;  1CSP A;  4X64 Q;  2NVT H;  3PUX A;  3JAM c;  1PH5 A;  5GAH C;  1FGU A;  4A3B G;  2HQL A;  5BR8 L;  1ASY A;  4IPD A;  2ZM6 Q;  3G6E A;  1VQE A;  4LF8 L;  1L2F A;  4DV6 L;  1C7Y A;  2VS1 A;  2JA8 H;  4BY1 H;  3PUZ A;  3RLN A;  2CQO A;  2IT1 A;  2OTL A;  4HJ8 A;  3KJP A;  4DR3 Q;  3ULJ A;  4NXM L;  4L5R C;  4C3J H;  2MNA A;  4HID A;  1N34 L;  1VQ9 A;  4YHH Q;  1Q86 C;  2F3I A;  1Y1V G;  1NTG A;  5M3M H;  1VQO A;  4AIM A;  4YHH L;  4BY1 G;  2CWP A;  4JI1 Q;  3HOW G;  1OXU A;  2DUD A;  2KEN A;  2ZTD A;  3K7A H;  4YCU A;  3HOV G;  2ES2 A;  5H1S E;  1S3O A;  5C0X G;  1HR0 Q;  3U50 C;  1TWH H;  2NVQ H;  1I50 H;  1YJW A;  3GD7 A;  1VQN A;  1HNW Q;  4IPC A;  2R7Z G;  4P72 A;  3M85 A;  1K9M C;  4JC0 A;  5C4J H;  2XTI A;  1PH7 A;  3F1Z A;  1IXR A;  3KFU A;  2B63 H;  3UE1 A;  1HZ9 A;  4C3I H;  1C0A A;  2WAQ G;  2Y0S E;  3JC6 6;  3L2P A;  3CCQ A;  4DKA C;  2NZO A;  4X62 L;  2KHI A;  4BBR H;  2VY3 A;  4KLK A;  5DLQ E;  1UWV A;  4QGU A;  4DV1 L;  2WB1 G;  5FJ8 H;  5LMU L;  4DV7 Q;  4BBS H;  1BKB A;  4DUY L;  1Z9F A;  1LTL A;  2CWA A;  5ELO A;  1E24 A;  4A3J H;  1V9P A;  2V1C C;  1YI2 A;  4HJ5 A;  4PZ8 A;  1E22 A;  4LUO A;  4BXX G;  1EUJ A;  2HHH Q;  5GQO A;  3OTO Q;  1G29 1;  1L0W A;  4LWC A;  4DR5 Q;  2GVA A;  2JJQ A;  4IFD G;  5IYB H; 
#chains in the Genus database with same CATH topology
 1F2Y A;  3STB D;  2YRX A;  4JI5 H;  1BCP C;  4C2M H;  4FF4 A;  2UUB H;  1SYB A;  2NZH A;  3TQY A;  2W9C A;  1K8O A;  3HG9 A;  4PG3 A;  2PZT A;  5KFP A;  4UCS A;  3S1M B;  1FR3 A;  2KJX A;  2F0F A;  5CBE E;  4HNT A;  4DV5 L;  5LMU H;  4DR6 Q;  4ECU A;  2KBN A;  2HVS A;  4B3S L;  1ESF A;  4RAU C;  3ULP A;  2F52 A;  5M3M B;  4YWM A;  2LY7 A;  4RU9 A;  1UEB A;  2L1B A;  4BWG B;  5I2X A;  4FP5 D;  4R4I A;  1RJP A;  1JOR A;  2UXD H;  1SMY C;  1X3P A;  3IRB A;  2HJW A;  1YIT A;  4HCS A;  1B53 A;  2JA6 B;  4ED8 A;  2BH2 A;  1E4E A;  3JAM L;  1TWH A;  2UXB L;  4I65 A;  5T1G A;  1XTC D;  1EQV A;  1NE3 A;  4ED3 A;  4K5X A;  2YU9 A;  4AYB A;  4JI2 Q;  1FJG Q;  1Y8P B;  4G7O C;  1A0I A;  2O2L D;  3CU7 A;  3W1B A;  2DGY A;  1S4Z A;  4LSA A;  3E9H A;  4MA5 A;  1I94 H;  2Q2T A;  4CC6 A;  1VQP A;  1EY4 A;  4LF4 L;  5FLX c;  3S1Q H;  1HTP A;  2IHE A;  4RCN A;  1N34 H;  1GO3 E;  5BPF A;  4G7H C;  4FXK C;  1U4L A;  4DV0 Q;  1M0W A;  1UC8 A;  4JI8 L;  3GTG H;  4ECY A;  3KDF B;  3OW2 A;  1HNX H;  3KLS A;  3CCS A;  1MBY A;  1N9W A;  3H0G G;  3H4D A;  1B9N A;  2EYF A;  1E4G T;  1X3E A;  4DR4 H;  3RB3 A;  1OXS C;  1BR9 A;  3I4M B;  3HOZ H;  5JJK A;  1Z2P X;  1PH8 A;  3MR3 A;  3PF4 A;  5KYI A;  2IPK D;  2ASL A;  5IT9 W;  4XDX A;  2MJ8 A;  1WTV A;  1XMO Q;  2RBM A;  3NBH B;  4QY7 A;  3EIV A;  5C4J B;  2ZM6 H;  2AQ4 A;  3TP8 A;  1HHV A;  4ZI7 F;  3S15 H;  3AFQ A;  1RHP A;  1TS3 A;  3IG0 A;  4YBZ B;  1KJJ A;  3HOV H;  5EPK A;  3BZC A;  2KSW A;  4N9T A;  2DY7 A;  3KBG A;  5I47 A;  4FU0 A;  2JE6 I;  3HOX B;  3KF8 A;  3R2I A;  4HQ6 A;  3D4D A;  5GRO A;  3S14 H;  1L0X B;  4CJ0 B;  1XPU A;  4JI3 H;  1J5E L;  3UI2 A;  2F0K A;  2F4V H;  4P2C B;  2LSS A;  1EZ1 A;  1XPO A;  1S0O A;  1CS0 A;  1VQ4 A;  1EWI A;  1EY8 A;  3U58 A;  1VQJ A;  2A68 C;  4JVZ A;  2JA7 A;  4KN4 C;  2X0S A;  1EOT A;  1SN8 A;  4TRD A;  3M9N B;  2J6S A;  2UU9 L;  3I4M H;  3HOZ B;  1C30 A;  1M0T A;  4MTD A;  1LV9 A;  4H7B A;  2R7Z H;  2DLN A;  1I50 A;  5KT2 A;  4F4X A;  5JVL A;  5CV9 A;  2WII B;  4A3C H;  1LT6 D;  4QJF A;  4BS9 A;  1WVL A;  4LF6 H;  2VQF L;  3GTM A;  2FPG B;  3MXN B;  1XNQ L;  4RNN A;  3PR5 B;  1KAW A;  3HOW H;  2VQF Q;  1D6E C;  3S15 B;  2JEI A;  1QVF A;  1F2L A;  3BQ0 A;  5IYD G;  3ERO A;  5BN5 A;  4M7E A;  2VNU D;  1Q12 A;  3C1E A;  1AW7 A;  3KHG A;  1B70 B;  1I5F A;  1PRT B;  2UUC L;  3GQB A;  2VQE Q;  3QIA A;  1V51 A;  4IOA A;  3GQC A;  4LK1 C;  2EVB A;  2PZU A;  3LWB A;  2Z6K A;  5AJ3 Q;  2E8G A;  5G3L F;  1SCU B;  4JI4 Q;  1HRJ A;  4QIW A;  4ECX A;  2KCT A;  1I3Q A;  3F8T A;  2KVM A;  1A3T A;  2JA9 A;  1Q46 A;  3D3R A;  3LP8 A;  3HGB A;  5KFM A;  1ESR A;  4X66 H;  2PW7 A;  4KD4 A;  4I7H A;  2B2T A;  4K8I A;  2EXZ A;  1IZ6 A;  2VUG A;  4UP8 A;  4UCR A;  4CDE C;  1JE5 A;  4R8N A;  4IUR A;  4A3E B;  1CZG A;  2PMZ B;  5AJ3 L;  3V4S A;  4EBD A;  2A6H D;  4C2M B;  1IHZ A;  3I2Z A;  1KDB A;  3R23 A;  4TQU S;  2F0H A;  2L0C A;  4XYL B;  3GV3 A;  4KKU A;  2YV5 A;  2FFK B;  4A3F G;  2E76 C;  4JI6 H;  3EJI A;  5CV5 A;  5C5L A;  2A19 A;  2B2U C;  4LF4 Q;  2WB1 E;  5ELN A;  3RBE A;  3I3C A;  2CQA A;  2L55 A;  5C44 G;  2R6G A;  1RKN A;  1B9M A;  1XNQ Q;  5CV8 A;  1IW7 D;  4A75 A;  2XGT A;  3G6X A;  3C2P A;  1EEI D;  4DK0 A;  2K52 A;  2IJ0 A;  1CQF A;  3A7A B;  1TWG A;  2IP4 A;  3F2C A;  4FS2 A;  2R93 A;  4A3B B;  4DR5 L;  1KJ9 A;  4DL6 A;  4JG2 A;  4JCV E;  3AEV A;  1II3 A;  3VR3 A;  1RL2 A;  2IX0 A;  4OIJ A;  1PH1 A;  2W6N A;  1C48 A;  3PMF A;  2KHJ A;  1KQS A;  2LKV A;  4C2M A;  4ECS A;  4S3S A;  3SE0 A;  2FJ2 A;  4JI5 Q;  4M1U B;  2QA4 A;  1S97 A;  2C00 A;  2MO1 A;  4RAY A;  1K83 A;  1HR0 W;  1IKL A;  1ET6 A;  1DV2 A;  4UCV A;  1NR2 A;  1NCV A;  5IGF A;  2VA3 A;  2F4V Q;  4KD3 A;  1JLL B;  1VMC A;  1Y1W G;  4OGQ C;  3QZ7 A;  1TWA B;  1HNZ H;  4O2A F;  2JEJ A;  4A3M G;  1I6V C;  1JJC B;  4BY7 H;  5KFL A;  3QJY A;  3NEN A;  3K5N A;  3UQ8 A;  5JQW A;  4PMW A;  4LJZ C;  1F9R A;  3NK9 A;  2UUA L;  4QWA A;  3HZX A;  4LF9 H;  5A2Q E;  3TRE A;  4GLX A;  3GO5 A;  3Q22 A;  2MFI A;  3G48 A;  2R85 A;  4OHJ A;  4ED2 A;  1F9S A;  2B2Y A;  1FNV A;  2NUC A;  4R4C A;  3JAM i;  4PQX A;  4LF6 Q;  3I4N G;  4K0K L;  2ZDH A;  1HXY D;  4ED0 A;  4CBV A;  1HA6 A;  2ZJP A;  4EBC A;  1VQC A;  3PIO 3;  4YY3 Q;  1R9T H;  3FDS A;  4IWX A;  4A3I G;  1IBM L;  2N3S A;  4FBU A;  1GVP A;  1EY0 A;  1FNU A;  3OYY A;  5M5X H;  2W8K A;  3PO2 G;  2DNC A;  1EY5 A;  1V1P B;  4DV2 Q;  2M2L A;  2FPI B;  5FPO A;  5IYZ F;  2B8F A;  3Q6S A;  1L1O B;  4UY8 C;  1RJT A;  1E1O A;  1B3Q A;  1XWE A;  5KG4 A;  3MXU A;  3M4Y A;  1WCM A;  2SDF A;  2EE1 A;  1UE5 A;  4AYB G;  4LF5 L;  3GIJ A;  1LTT D;  2YYA A;  1PH6 A;  5DM7 3;  1D7Q A;  2CZG A;  3OHX C;  2PCF B;  5E1F A;  3MWM A;  2OCE A;  3S16 B;  2KEE A;  4EQP A;  2NVX B;  3DEO A;  1D1K A;  2ALY B;  1STH A;  3AQQ A;  1YJ9 A;  4J9M A;  5C4X G;  2YZN A;  5HY6 A;  1PA6 A;  1AZP A;  2V4Q A;  4J0M A;  3N41 B;  4B3R L;  1X9N A;  3L4K A;  1KD1 C;  2SNM A;  4RA8 A;  5IE8 A;  4HNU A;  2FXQ A;  3CCR A;  1XMO L;  1IYJ B;  3VYU A;  2CQY A;  3HKZ B;  4DA2 A;  1QVC A;  2Z6K C;  2EYL A;  4K8J A;  5E7N A;  3WOE A;  3ZYY X;  5CGK A;  3RIZ A;  2EYP A;  1OWT A;  3PF5 A;  4APV A;  5LYJ F;  4EYH B;  2WAC A;  1KJI A;  5K36 G;  3WNZ A;  3E3X A;  2HT1 A;  2NU6 B;  4ED6 A;  5IOC A;  1SJH D;  3OSP A;  1NY4 A;  3RLF A;  2E5L L;  2Z8L A;  4EGQ A;  3LWU A;  4LFB H;  1TKW B;  2FJZ A;  5KT7 A;  1PDQ A;  2D5D A;  1GUT A;  2R93 B;  1V4Y A;  2VOB A;  5HV6 A;  3K81 C;  2BE5 D;  3W2D A;  4A3E G;  4QWE A;  2I5M X;  1Q82 C;  3GIL A;  1S10 A;  1Y14 B;  3VYS A;  2MPM A;  4A3J G;  1S72 A;  1SFO B;  2B2W A;  3BJU A;  5JEA G;  3GTJ A;  3Q8Q B;  5FKA C;  4DR2 Q;  1BXT A;  4KI0 A;  3GTM H;  3K8A A;  3DUZ A;  3ORR A;  2Y0S B;  4DR2 L;  1AH9 A;  1S9F A;  1YHA A;  3NQI A;  3FMC A;  1HR0 L;  2DJF C;  3TEH B;  3PO3 H;  1Z2N X;  1WOC A;  5BMV F;  1TWA H;  2IL8 A;  4U67 3;  2VB2 X;  1FGB D;  4IWY A;  2LXK A;  3OUZ A;  1G51 A;  2UXB H;  2XCL A;  3DWQ A;  2YU9 B;  4DV4 H;  2UXC Q;  4RZR A;  3V6K A;  3CC2 A;  3K7A B;  1E2W A;  4IUV A;  3PO3 G;  4CC5 A;  3MEH A;  1VQ5 A;  4FBT A;  2HDL A;  1ENF A;  2TSS A;  3GLK A;  2F1M A;  2R92 B;  1NBW A;  4MZ9 A;  3GV6 A;  4IOC A;  2E2I A;  5FLM G;  3PIP A;  4EVO A;  1O75 A;  1ZYR C;  3GTO H;  4DL4 A;  2N78 A;  1HCZ A;  4RGO S;  3GIP A;  4LH6 A;  1MGS A;  4IRD A;  4L1K A;  4KK7 A;  4PNY A;  4RGM A;  1C8C A;  4J1M A;  2QYZ A;  2BCO A;  2UUB L;  2M05 A;  2YTX A;  2UXC L;  4MV8 A;  1FD7 D;  1QVG A;  1SDF A;  3R8B A;  2VW9 A;  4DR3 L;  4BBS B;  1N48 A;  3PUW A;  2PQA A;  3UE0 A;  1T3N A;  2FLL A;  3K5O A;  2YS7 A;  5D3D A;  1ICF B;  1AEX A;  3JAM c;  4A3M B;  5GAH C;  1FGU A;  1O7Y A;  4ZK9 B;  5EKK A;  5LMN H;  1QJO A;  1PLF A;  2HQL A;  5BR8 L;  1U4M A;  2VUM B;  2A6E D;  1YNN C;  1L2F A;  3WOF A;  1AP0 A;  4RB3 C;  2R8I A;  1TAE A;  3FKI B;  2VS1 A;  2F3W A;  1V1O A;  3TP6 A;  2JA8 H;  3PUZ A;  2F0T A;  5KFV A;  3EQL C;  2G5D A;  2FLP A;  2P5Z X;  4L5R C;  1N34 L;  2RSO A;  2AGQ A;  2NTT A;  1W96 A;  2DN8 A;  2UU9 H;  1SXT A;  2W7P A;  1JOK A;  1RD9 D;  4BY1 G;  2SCU B;  4JI1 Q;  1OXU A;  3S17 B;  4ECZ A;  4YCU A;  1IOW A;  5H1S E;  2DPJ A;  5DNF A;  4CHT B;  1YJW A;  2NVQ H;  4A3G B;  3D4R A;  1HNW Q;  2HD3 A;  4IPC A;  1K9M C;  3MXG A;  4I55 F;  2E2H A;  2XTI A;  4JV5 H;  2B39 A;  1IXR A;  5I4D A;  4C3I H;  2WAQ G;  3CCQ A;  3HOU B;  3E5N A;  2NZO A;  4NKL A;  2W57 A;  3HEJ A;  4BBR H;  2VY3 A;  4KLK A;  4FF2 A;  2UUC H;  4DV1 L;  2R7M A;  3M9M B;  2F0P A;  3NGD A;  4DUY L;  1QNK A;  2CWA A;  1YI2 A;  3V4Z A;  2V1C C;  3F8N A;  1E22 A;  5KFT A;  2HHH Q;  1DOM A;  2JA8 B;  5LL6 b;  1L0W A;  1Q8I A;  4DR6 H;  3ND8 A;  4DR5 Q;  2GVA A;  2C5C A;  2WKD A;  3DM1 A;  3SXH A;  2A6E C;  4Q5V A;  3SHL A;  5C6A A;  4WOR A;  3GII A;  2DY8 A;  5KRU A;  3HOX G;  3PCO B;  3S14 B;  2UVR A;  2EJM A;  3NPP A;  1TY0 A;  3G71 A;  3BS1 A;  2D2C C;  4N8F A;  1EYA A;  2RDF A;  4ZCK A;  3C0F B;  4C5A A;  4A3L H;  5KG3 A;  4Q8F A;  1Z47 A;  3S2D H;  4P74 A;  1JT8 A;  1ML0 D;  2Y0S A;  1FL0 A;  3D8G A;  4JV2 A;  3MWY W;  4NXM Q;  2R7Z B;  2EPB A;  1I50 B;  2UUA Q;  1JWM D;  2N49 A;  2WKC A;  4IRC A;  1GUN A;  3NWT A;  3GTG A;  1IYU A;  5KFR A;  1Y1W H;  2E2H H;  4LUZ A;  1WCM H;  2QW7 A;  5IGG A;  1IBK Q;  5KT6 A;  5KFC A;  2C22 A;  4DV4 Q;  4R4Q A;  1CQV A;  2Q2U A;  2AHO B;  1E4F T;  3RAX A;  5GAD C;  3A8K E;  1VBH A;  4IO9 A;  3UDI A;  1T5E A;  2RA4 A;  1MJE A;  1QIL A;  3TS0 A;  3BQ1 A;  5FOB B;  1X55 A;  1ZXT A;  2FMA A;  2J7Z A;  1SYC A;  3QB3 A;  4GC7 A;  1N33 H;  2PO4 A;  5KEE A;  1B3A A;  5M5Y H;  1PHJ A;  4FXG C;  2V58 A;  5A2Q L;  3TSS A;  3MAQ A;  3I4N H;  1PX2 A;  2XD4 A;  2WV6 D;  2K5W A;  3T56 B;  3RN2 A;  4EQN A;  3J81 L;  2R7N A;  3CPW A;  4JBM A;  3DEP A;  3HS0 C;  1SNC A;  1XMQ H;  1B33 N;  5KFH A;  3KLW A;  4L6T B;  2ENB A;  3UDF A;  2I5L X;  4O2B F;  4K2K A;  1N36 H;  1N34 Q;  2F0N A;  4B3M H;  1UE6 A;  4ID6 A;  4IZO A;  5HBR B;  2B63 B;  5BPH A;  3Q8R B;  3GV7 B;  2CCZ A;  1BOS A;  4X6A H;  3S1N H;  3E0E A;  2F0O A;  3R93 A;  5LMN Q;  5EAY A;  2ZXR A;  4KHZ A;  3X3N A;  4GLV B;  3H4B A;  1EFI D;  3GTM B;  2SNS A;  2ZTE A;  3RV3 A;  4LF4 H;  4ECW A;  1K3B C;  4IRK A;  1LTB D;  3EFX D;  4UHV A;  3TII A;  4YR0 A;  1Y1V H;  3E9I A;  5M3M G;  5EDW A;  2UU9 Q;  2SEB D;  3T51 B;  3GTL H;  2X6L A;  2JA6 H;  1XNR L;  4IJH A;  4R9W A;  4DR1 Q;  2YTV A;  2NZ1 D;  1BBW A;  2JQO A;  5KG1 A;  4BY1 B;  2FMC A;  2Z1C A;  1Q7Y C;  4DGZ A;  1UUP A;  1O78 A;  5DQI A;  3SK4 A;  4YB8 B;  4DLK A;  4OXP A;  1J5E Q;  1E2V A;  3SK6 A;  1A2U A;  3MR5 A;  3BVM A;  1CKO A;  1IBL L;  5CBA E;  2N55 A;  4LMY A;  1OXX K;  1YEZ A;  1H9S B;  3KHH A;  3TS2 A;  1L1O C;  2XIW A;  3S1M H;  1WTW A;  4J9O A;  1SE3 A;  2R7D A;  1N56 A;  2KUM A;  1TXY A;  2RDH A;  4NPS A;  1B6S A;  2W9B A;  1KIX A;  5DLF A;  1O7L A;  4NP5 A;  1L2Z A;  2HGS A;  5DM6 3;  4LF7 H;  4LF8 H;  3TP5 A;  4IR1 A;  1U0L A;  3STB C;  2GN5 A;  3CMA A;  2OQ0 A;  1BDO A;  2RHS B;  5A2Q W;  3HFZ B;  1DM0 B;  1BCP B;  5LXT F;  3K0Y A;  3RR5 A;  5A35 A;  5JUM A;  1YBY A;  1CKM A;  4KV6 A;  4C3I G;  2ZJR A;  4OWT B;  4FF1 A;  1RJQ A;  1WFQ A;  5DQG A;  3GTP B;  2PI2 E;  3F2U A;  2VQE L;  5KFK A;  4UAI A;  4J15 A;  3C46 A;  4O3O A;  1H9K A;  1CHP D;  3FPP A;  2BQU A;  4IR9 A;  3NP8 A;  4RUC A;  2KA7 A;  1TU2 B;  2D62 A;  4HSP A;  5HGQ A;  1WH2 A;  1MD2 D;  1ZHQ A;  4XXE A;  1MZB A;  2V4R A;  2SOB A;  2I07 B;  2L9H A;  4GNX A;  2QEX A;  1R9T B;  2F0W A;  4JI6 Q;  1EIY B;  4DR4 Q;  4IUU A;  2O03 A;  1JJG A;  4JI2 L;  4OO1 H;  2Q2H A;  3W5O A;  4JI7 L;  5KKN B;  2UVW A;  3HRZ C;  1CK1 A;  2K5V A;  1I94 L;  4GN5 A;  4UDU C;  4NXN Q;  2F3V A;  1BCP F;  2JYO A;  3K59 A;  3GP7 A;  3ONA B;  1GSH A;  4Q45 A;  3HKZ A;  4ULL A;  5NUC A;  1VQK A;  5DEH A;  2F0G A;  2MQH A;  3NTH A;  3QWN A;  4A3D G;  1ZET A;  3KHR A;  4RGN A;  3FRP B;  1GJX A;  3MFY A;  4YCV A;  1GYF A;  4FYD A;  1MKH A;  1TWA A;  3GTQ B;  3BQ2 A;  1VQA A;  2Y0S G;  1SSO A;  2EXD A;  3GTK B;  1VQH A;  1PMR A;  3T1Y L;  1BQQ T;  1XMQ L;  3P1H A;  4DNI A;  4FF3 A;  3BA8 A;  4RB1 A;  3CQZ A;  3TDQ A;  2NVY H;  1R4P B;  3TME A;  2W70 A;  4P73 A;  2V5A A;  1SR3 A;  1EY9 A;  4R4O A;  3KJO A;  1I4X A;  1LT3 D;  3AFP A;  4DF7 A;  1R9T A;  2XNA C;  3FKI H;  1GD7 A;  3TRZ A;  4EGJ A;  2R92 H;  1K0R A;  1SJE D;  2FKL A;  1NAP A;  1FKA H;  5EWE A;  1DJR D;  2YU9 H;  3DWA A;  2YCH A;  1KJ8 A;  4BA2 I;  3I4L A;  1PYB A;  3K0X A;  2AGP A;  3PGZ A;  2JEA I;  2W71 A;  3UFX B;  3URY A;  3MVV A;  1CQI B;  2AGO A;  2L12 A;  2B2Y C;  3WDN A;  3EVQ A;  3BZD B;  1UAP A;  5IT9 L;  3CD6 A;  3HOY G;  2KCN A;  2R86 A;  1X6O A;  5HGT A;  2ZJQ A;  5K36 H;  5CAE B;  4UFZ A;  1Y1V A;  4O1N A;  5JVH 3;  2W8L A;  1G2T A;  4J9S A;  4RHS A;  2C2R A;  3HKS A;  2K7V A;  4GKJ L;  1SFO A;  4DR7 H;  4KKT A;  3KDF A;  3I73 A;  5EKI A;  4H44 C;  3J80 E;  4DUZ L;  1ICW A;  4L5S A;  3GTQ H;  2X69 A;  5EJW A;  2IY5 B;  1WR2 A;  2HVQ A;  3NTI A;  4EEY A;  2UUB Q;  1WYD A;  3T5J A;  5C3X A;  4A3E H;  3RFC A;  3K5L A;  3D4W A;  4C3J B;  4JBK A;  4V0B A;  4QWC A;  1I3Q H;  4IUT A;  3D31 A;  4DUY H;  1ZKO A;  1IL2 A;  4BXX H;  4GN4 B;  4BA1 I;  2XCA A;  3B6Y A;  3CCL A;  1KRT A;  4FM9 A;  2JEB I;  3I70 A;  1EUD B;  3J80 L;  2LFN A;  1VDZ A;  1CQJ B;  4EBE A;  1SND A;  4TSS A;  2UXD Q;  4R8I A;  4A3K B;  2RQX A;  4YP3 A;  4RG1 A;  3N40 P;  5L1K A;  1PFB A;  3VR6 A;  3SE7 A;  4EEQ A;  3MR2 A;  1U4P A;  4OX9 L;  1Y1V B;  4GLA C;  5EWG A;  5DAU A;  3KXY T;  5JPM C;  4M9U A;  2LXJ A;  2CW0 C;  3NXW A;  1WI5 A;  4IFD J;  2QK4 A;  1XNR H;  3KF6 B;  1I4H A;  4A3K G;  2JXM B;  4JI7 Q;  2K28 A;  4JYA H;  3I7F A;  1UNS A;  5KIX A;  3IN5 A;  4B3T L;  4WJ3 M;  4Y7N B;  3S24 A;  1YNJ D;  1K8M A;  4PZ6 A;  2Z0S A;  1RJR A;  3R5F A;  4GS3 A;  4R4T A;  4UCO A;  1T9H A;  1Q1B A;  5I6Y A;  4ZUI A;  3M7N A;  3PO3 B;  3MHB A;  1JCK B;  2VUM A;  3BG3 A;  1HA5 A;  5KFB A;  3T1H H;  3GV5 B;  1DD2 A;  4MV6 A;  1X56 A;  3RLO A;  3N8D A;  3K5M A;  4IUP A;  4B3T Q;  1EIH A;  3L7Z C;  3KTM A;  1KAA A;  4O4L F;  2VUM H;  2NU7 B;  2XWB B;  1VQ8 A;  3RUZ A;  2JK8 A;  5LL6 S;  5IOD A;  1B44 D;  2OF1 A;  2B2W C;  1HNZ L;  2JA5 G;  3QFF A;  3T1Y Q;  4GOP B;  4J9P A;  3T5K A;  2WAQ A;  2BOS A;  3CQZ B;  5JVG 3;  3DLL A;  3X3M A;  1K73 C;  5C4Z A;  3CHB D;  1VQL A;  1EFW A;  2ICI A;  4X65 L;  2BH8 A;  5FO7 B;  5IGC A;  2IHF A;  1PZI D;  3RAQ A;  1TVX A;  4DXG A;  4A3I B;  3MEF A;  2IX1 A;  1DZ1 A;  4IUQ A;  2K32 A;  4XQJ A;  4AQY Q;  2E2H B;  5M3F G;  4X3S A;  1B04 A;  2RDI A;  1STN A;  1CA6 A;  4DN4 M;  4DUZ H;  1A15 A;  4GN3 B;  4NW2 A;  2B2V A;  3DM3 A;  2R7Z A;  2EQS A;  3M9B A;  3J80 W;  2BA1 A;  2F0U A;  4JI0 Q;  2B63 G;  3GTG B;  4TV9 F;  4EFE A;  1SYG A;  4ECT A;  1A6X A;  4O3N A;  4Y7N H;  2A8V A;  4RMF A;  3TIG A;  5M3F B;  3S1R H;  3S1Q B;  1QCB D;  3LWE A;  2A74 C;  2D0O A;  4DV2 L;  1N32 Q;  2R84 A;  2YL2 A;  4KY6 A;  4HMI A;  2JN4 A;  5IY0 A;  4R1J A;  3MJF A;  3KF8 B;  1VQM A;  4C3H G;  4BWS C;  4N9P A;  2XSC A;  1TS4 A;  3NBI A;  1I6U A;  4JI2 H;  1X3G A;  4GKK L;  2RCF A;  1EUC B;  2ZTC A;  2DWC A;  5KFI A;  3AYH B;  4NMZ A;  5KG5 A;  5JOB A;  2GA4 B;  1PTO H;  2IW3 A;  1PH9 A;  4OO1 I;  1NMF A;  3ETH A;  1JDE A;  4YQW A;  2UUA H;  3QOJ A;  4HIM A;  3BG5 A;  5C1O A;  3HOU H;  1IBM H;  4I50 F;  4YIJ A;  3DF7 A;  3KUP A;  1SFO H;  1HNX Q;  5DQH A;  2AWO A;  3LNN A;  2K1B A;  1Q81 C;  4V19 0;  4YJ3 F;  3CAM A;  1LYL A;  3H0G B;  1LTI D;  5IGB A;  1E4E B;  4X64 Q;  2RDG A;  1KBL A;  1PH5 A;  5KFD A;  4EQO A;  1XMO H;  2Z4I A;  4IPD A;  4RB2 C;  1IW7 C;  3H3V C;  1KDC A;  2ZM6 Q;  3G6E A;  4LF8 L;  3HOY B;  1ZYR D;  1EWC A;  3S1N B;  2PNR C;  3RLN A;  3OIQ A;  2IT1 A;  3TQ1 A;  4HJ8 A;  2HDM A;  2B2T C;  4C3J H;  1IYV A;  4XYQ A;  2F03 A;  4NDX A;  1VQ9 A;  1Q86 C;  1B1Z A;  1Y1V G;  5M3M H;  2QDL A;  4AIM A;  4YHH L;  3WO0 A;  1UEA B;  3HOW G;  2DUD A;  1QE6 A;  1K1S A;  3G8C A;  2E74 C;  1GUW A;  4JUZ A;  2NVY A;  1VF7 A;  1S3O A;  2OXP A;  3U50 C;  1TWH H;  2F4I A;  1VQN A;  2FK2 A;  4DV3 H;  1TII D;  3NBH A;  5EKL A;  1EU3 A;  2I87 A;  2BE5 C;  3BDO A;  2VQD A;  3PZP A;  4PDB A;  3QOL A;  2B2U A;  3KFU A;  1Z2O X;  3UE1 A;  3R2T A;  2ZXO A;  1IOV A;  4NLG A;  2IX3 A;  2H4O A;  2W9B B;  4DKA C;  4FS1 A;  4X62 L;  4ZUJ A;  2DZD A;  2KHI A;  4K0K H;  5DLQ E;  1UWV A;  2ZDG A;  5HUR A;  2JP1 A;  1JOQ A;  2CH4 W;  2EYJ A;  1PRT D;  4DR1 H;  1E24 A;  2DNE A;  4HJ5 A;  4LUO A;  2RGV A;  2O5J C;  1JE4 A;  5GQO A;  3OTO Q;  1G29 1;  2R82 A;  2PQE A;  3N52 A;  3H40 A;  2OLS A;  4B3R H;  1JB3 A;  2UXC H;  1SRO A;  2C2D A;  4DFA A;  1QWY A;  3W1G A;  4C3H H;  2AUK A;  4KMU C;  3I4M G;  3Q8P B;  4DV1 Q;  3U9S A;  3RMH A;  4RUA A;  2KCM A;  2HIV A;  3CME A;  2ALZ A;  1UNN C;  2VUM G;  1RIP A;  1BNZ A;  4IFD I;  4R7R A;  2HHH H;  1PK8 A;  1RCV D;  3T5L A;  5KGU A;  2AKW B;  5M5W H;  5GON F;  4PWQ A;  4QW9 A;  3RV4 A;  3CF5 A;  1JKJ B;  3SR1 A;  5I9O A;  3JRX A;  1ZEQ X;  4KJO A;  4I7A A;  4C3H B;  1LUZ A;  2A68 D;  3C3L A;  1S40 A;  4ZLT F;  4LF7 Q;  4LF8 Q;  4RNO A;  3VPC A;  3HOW B;  4DV4 L;  4DK1 A;  2D9U A;  3E6Z X;  5DG7 A;  1B6R A;  2N8N A;  4WRD A;  1K3R A;  1WTP A;  4JBJ A;  3CCJ A;  4JI8 Q;  4NXM H;  1PRT F;  1EOV A;  4J9Q A;  3IAY A;  5KG6 A;  4GKK Q;  4C3I B;  3TZU A;  3OUU A;  2G9D A;  1S0N A;  4J6H A;  3IFD A;  3PUV A;  4DV6 H;  2DJG C;  1B8A A;  1O80 A;  2XGP A;  3G6J B;  5D8D A;  1MJC A;  3SGI A;  5KG0 A;  3A8J E;  1ZHS A;  4X62 Q;  5BR8 Q;  4JV1 A;  3SEB A;  4U68 A;  1GUG A;  1UE7 A;  4QIW B;  1PTO C;  1CKN A;  5KFG A;  2K5H A;  4JI0 L;  3GTK A;  3WO1 A;  4G4K A;  2VPQ A;  3HB9 A;  1O7Z A;  1ENA A;  3K7U C;  5IP7 H;  2J6T A;  1BUV T;  4G57 A;  1F9Q A;  2ZDQ A;  2UVV A;  3Q23 A;  3T53 B;  1WSC A;  2H1E A;  5C44 H;  1PFS A;  4X3U A;  3VR4 A;  4YR2 A;  1TWF B;  5F9N A;  5L1J A;  3PN1 A;  1E0B A;  3G6Y A;  3RB6 A;  3F2D A;  3J7Z C;  2E2J H;  4TQR A;  5KNC A;  1LAB A;  4X66 L;  4XQN A;  1AUX A;  3EYY A;  3H3V H;  4O4H F;  1SLJ A;  3BYT B;  1VQD A;  2R6F A;  2R8H A;  1WTX A;  3NTK A;  1BBU A;  2EOT A;  2JA7 G;  5ELD A;  3JAM E;  5IWA Q;  2EY5 A;  1D5Z C;  3PW4 A;  3EN2 A;  2NUA B;  1MHW C;  4DL2 A;  1D8L A;  4DNR B;  1V43 A;  3M4I A;  1E3P A;  5KNB A;  4X65 Q;  1BBX C;  4DUZ Q;  5EBD A;  1VMP A;  3AB9 A;  4XQQ A;  5KT4 A;  5FLX E;  3GTL B;  3RF2 A;  4C56 C;  2LMC B;  3HOY H;  4HJA A;  1KTK A;  5KFW A;  1J9O A;  1JC7 A;  2R3Z A;  1KNA A;  1PXU A;  3AU7 A;  4K5V A;  4A93 B;  3PW7 A;  1HNZ Q;  1SBB B;  4HIO A;  3MFH A;  1SNP A;  2X6G A;  4GKJ Q;  5C1P A;  2Q8R E;  1XXG A;  3HBL A;  4AH6 A;  3NE5 B;  5C0X J;  4LFB Q;  2W6M A;  5BN3 A;  5C3W A;  1STE A;  5JH7 F;  4X3T A;  4DAP A;  5C0X I;  4JI1 L;  3NEL A;  1G91 A;  2I80 A;  5LOV F;  4IZ8 A;  3UDX A;  2W6Q A;  2K75 A;  2CVR A;  5KND A;  3H3V I;  1CT1 D;  3OOC A;  2R92 G;  3HOU G;  1U4R A;  3DHQ A;  5D3I B;  5JVD F;  4MTK A;  4HSV A;  1KDA A;  2EJG C;  4MIU A;  4MV4 A;  1IBK H;  1TWG H;  4QMG A;  3NWS A;  5LL6 X;  5FJ8 G;  1GSO A;  4WD3 A;  5J39 A;  2L5T A;  3OWF A;  4BY7 G;  4QL5 A;  2R61 A;  1OXV A;  4OON A;  2I5H A;  1VQB A;  4A3C G;  5JPN C;  3QG1 A;  1S5B D;  1PV4 A;  4DV1 H;  3RD4 A;  1A8V A;  2RVL A;  2FLN A;  3V05 A;  4DV2 H;  1WTR A;  5EPL A;  2UXB Q;  1EQQ A;  5M5Y B;  4MNO A;  1N33 Q;  2O4X A;  1CZW A;  2B29 A;  4DAM A;  3HXL A;  3J81 c;  4LFC Q;  2F0L A;  4KHP H;  2K04 A;  4B9X A;  1E2Z A;  1JMC A;  1PZK D;  1OTC A;  1ENC A;  2A69 C;  4I4T F;  1YVC A;  5T14 A;  4QUC A;  4Z9C B;  4NXN H;  1P16 A;  3MZ5 A;  4K14 A;  1RTN A;  3K6O A;  3OMG A;  2GPS A;  5ISR A;  3CVZ A;  1AZQ A;  1R4Q B;  4PMB A;  3L3O C;  2XRQ D;  1S5E D;  3RGX A;  4C5B A;  3H6M A;  4B3M Q;  1F77 A;  4B3S H;  4OO1 G;  1AFP A;  1K1Q A;  3I55 A;  1ET9 A;  5M3F H;  3S1R B;  1QZG A;  5DG9 A;  3H20 A;  1NNX A;  4JOI C;  1JWS D;  3I91 A;  4K6D A;  3L0O A;  3A0J A;  1I94 Q;  5M5X B;  2PYK A;  5FLM H;  4IAL A;  4AYB E;  3SK5 A;  1UE1 A;  5FPR A;  2GPW A;  4X62 H;  2PBZ A;  5L1I A;  2C2E A;  4C5C A;  1WCM B;  3RGZ A;  4F88 A;  2JA5 H;  1A2T A;  4QIW E;  1Z7T A;  3A55 A;  5F2D A;  1YIJ A;  1HR0 H;  2R92 A;  5E3F A;  2MO0 A;  1T5X D;  4Q43 A;  4JYA Q;  5I6W A;  1W3S A;  1NJI C;  3KHL A;  1Y1W A;  3R5H A;  1F9P A;  2EYH A;  1S68 A;  4DR3 H;  5CV6 A;  5L9X A;  4RFB A;  3FPU B;  3V2T A;  2EDG A;  5FLX W;  3NHH A;  5IGE A;  4YHH H;  4MV9 A;  4KN7 C;  4LF6 L;  4K0K Q;  2XVS A;  1HPC A;  4A3G G;  1P8L A;  3QO2 A;  3WWV A;  3RJ0 A;  1HZB A;  3LX0 A;  4N8X 1;  2PQA B;  1SYF A;  4DL7 A;  5CV7 A;  1GM5 A;  2G9H D;  3TBI B;  1KAB A;  3KLR A;  4MV1 A;  3J81 W;  5J2T F;  2ASJ A;  1HNW H;  3A5Z B;  1ILQ A;  5COY A;  4B3R Q;  1TA8 A;  2NN6 H;  4LF9 L;  4XX0 B;  5JAV A;  5M9O A;  2ATW A;  3T1Y H;  3P20 A;  4IPH A;  1DON A;  1T36 A;  2FK1 A;  4FO2 A;  2K5Q A;  4KHP L;  2R93 G;  1I6H H;  1ASZ A;  5GAG C;  4MTE A;  1CUK A;  4WFN 3;  1PH3 A;  4UCT A;  2EYM A;  1OO9 B;  1N8R C;  4HMJ A;  5FK9 C;  2QEJ C;  4NXN L;  1KLU D;  5EGT A;  5CA0 F;  1XDN A;  3JRW A;  2WFW A;  5IYD H;  4JK1 C;  3I56 A;  3CCM A;  5DGB A;  2PZW A;  4OWX B;  4DR4 L;  2L11 A;  1A3V A;  4DR1 L;  1YJN A;  2DIK A;  1HZA A;  3C1F A;  4XIG S;  1L0Y B;  3G4S A;  1G6P A;  2E2I H;  1U9R A;  5C8Y F;  1HJP A;  2I46 A;  3KAK A;  5EPJ A;  3EBE A;  1JXL A;  3BVZ A;  3HKZ G;  2A69 D;  2ZXP A;  4YWK A;  1KL9 A;  1VS0 A;  4GZY C;  5CV4 A;  1V1Q A;  3H0G A;  3I4O A;  4DR7 L;  2MUY A;  2HCC A;  3OPO A;  4OEL B;  3CCE A;  2WP8 J;  1D5M C;  2CW8 A;  5EBC A;  2NWG A;  3P75 A;  1Y8O B;  3N43 B;  1LO5 D;  2JA5 B;  2VQE H;  4JI6 L;  4KY5 A;  1B7Y B;  4XT3 B;  5EOY A;  4QWD A;  2NBF A;  1D1I A;  4H0L C;  2EZV A;  5D1P A;  4WJ4 A;  4LUV A;  2NTS A;  3Q8D A;  2PN1 A;  3BU2 A;  4F4W A;  2NB0 A;  3J7A F;  5KG2 A;  1SE4 A;  1G8Z D;  5ELF A;  4RWS C;  4JI3 L;  3Q0A A;  1M7J A;  2V9W A;  1XYI A;  3TP7 A;  3J81 E;  3PO2 H;  4MA0 A;  3GTJ H;  4ME3 A;  4ED7 A;  1H9R A;  1LTS D;  1PFM A;  4QW8 A;  5JJL A;  2F4V L;  2FPP B;  1I4Q A;  2NVY B;  1HUN A;  1X65 A;  2ID0 A;  1STG A;  1SMY D;  5IP9 H;  2ZJT A;  1Q8K A;  3M3Y H;  1EZ6 A;  4JI5 L;  1XMQ Q;  3FKI G;  1FNW A;  1HUM A;  3ZJY C;  4HIK A;  3N6X A;  4LF5 H;  1PYS B;  3I4N B;  4QQB X;  2XIG A;  1AE2 A;  2F0I A;  4BBS G;  3OHA A;  4X65 H;  4IPG A;  4QF4 A;  4MV3 A;  2IBK A;  1T94 A;  4A3L G;  3FVQ A;  2B2V C;  4A3B H;  3S2D B;  1S5C D;  4P71 A;  1KRS A;  5KX5 F;  2WB1 A;  2B3G A;  2Z4H A;  1HNX L;  1WD0 A;  3A5U A;  3U4Z A;  2VXW A;  1RK6 A;  4HNV A;  1I4R A;  2EYO A;  4DNT B;  5FLX L;  5JJZ A;  3Q2O A;  1TT2 A;  2NN6 I;  3DWP A;  1Y1W B;  1PVO A;  1K8A C;  4LFA Q;  1WJJ A;  2OT2 A;  4F87 A;  4YJ2 F;  4B3T H;  4PZ7 A;  3H15 A;  3M9O B;  3ERQ A;  3O13 A;  3PQI A;  1VQ6 A;  1M4V A;  5KFU A;  1C3O A;  2YYZ A;  1IBK L;  5F9L A;  4JI0 H;  5D1O A;  5KFS A;  4I7Z C;  4LNQ A;  5H80 A;  3BDL A;  4ZOL F;  3EPG A;  2KED A;  4BBR G;  5E4W C;  2VQF H;  3CPF A;  1EYG A;  3MXP A;  3U9O A;  4GNX B;  2E2J B;  3GTP H;  1KLG D;  1JDB B;  3EPI A;  1H9J A;  2R87 A;  2P0A A;  4ED1 A;  2WTF A;  5KYL A;  5I9P A;  2Z9H A;  5KFJ A;  3OSO A;  4MTN A;  2PMZ A;  4AQY H;  4TKO B;  2LS0 1;  2A1A A;  5FO9 B;  3G6V A;  1VF5 C;  4OWW B;  3J80 c;  1SYD A;  2PNH A;  3RB0 A;  2K05 A;  4A3F H;  4ILW A;  3JSN A;  1X3F A;  2WIN B;  1JOO A;  4FVM A;  1V1P A;  4RKL A;  1CA5 A;  2HHH L;  3S17 H;  2FK3 A;  3MWE A;  4ECR A;  2EY1 A;  1HNW L;  3K5I A;  1DOL A;  3ER0 A;  2BA0 A;  2K03 A;  4A4I A;  1EYZ A;  2R8G A;  3VPD A;  1JB7 A;  4LF9 Q;  4POG A;  1Q90 A;  2F0V A;  1JIH A;  2YW2 A;  3N42 B;  1Q1E A;  3IKJ A;  4HYK A;  2N88 A;  4X64 L;  3J7A V;  3MTS A;  2CH4 A;  3V96 A;  2HUG A;  2PPB C;  1KEE A;  1XTD A;  5IGD A;  3K58 A;  3RZD H;  1EQR A;  1LTA D;  2R7K A;  4A76 A;  2JA8 G;  4ZAI A;  4RH6 A;  5D1O B;  1E7Z A;  3IL8 A;  2R8K A;  5KFY A;  3CC7 A;  1BCP D;  1DGS A;  4RB0 A;  1Y69 U;  1GGO A;  2XC9 A;  1EQT A;  1SYE A;  4IJL A;  1S5F D;  2L15 A;  2UVU A;  4A93 G;  2J9G A;  5CYU A;  1VBG A;  1TY2 A;  5G3L D;  3VR5 A;  2BQ3 A;  4LFA L;  4GKK H;  1HFG A;  1CSP A;  1TR5 A;  3Q8S B;  3DMU A;  1TWF A;  1ROD A;  1PRT C;  5C4X B;  4JW0 A;  4A2A A;  1LT4 D;  1TQO A;  4DV6 L;  1BF4 A;  4CJ2 C;  2WYO A;  1SNQ A;  4LMQ D;  4BY1 H;  1SEI A;  5BN4 A;  4ZQ3 A;  4DR3 Q;  1EWH A;  2NYZ D;  1WTH A;  4NXM L;  4RGT A;  5CA1 F;  1EEF D;  4H13 C;  2Q8T A;  4YHH Q;  4CDF C;  3NUC A;  5C4H A;  3GTP A;  1VQO A;  5FD5 A;  2AUJ D;  3M4O B;  2AU0 A;  2TMP A;  4UCU A;  2YZG A;  5E4X A;  4JV0 A;  3T4A C;  3K7A H;  2W6O A;  3GIQ A;  4Q8E A;  2ES2 A;  4O42 A;  5C0X G;  3Q1K A;  2B63 A;  1SAP A;  3KAL A;  3GD7 A;  3N44 B;  3PR4 A;  3CKI B;  2R7Z G;  4P72 A;  1J5E H;  5C4J H;  1PH7 A;  2B63 H;  3FMA A;  1C0A A;  2Y0S E;  1SNM A;  3JC6 6;  3VA5 A;  5KFX A;  3VPB A;  4ZKC B;  4CGY B;  1Q3L A;  4QGU A;  5LA6 F;  1TS2 A;  5FJ8 H;  5LMU L;  4DV7 Q;  4DV5 H;  4L8J A;  4BBS H;  4IUN A;  4X3K A;  3V6H A;  2VA2 A;  1LTL A;  1V9P A;  4PZ8 A;  2F0D A;  2ASD A;  1EUJ A;  4ETS A;  4CKE A;  2O5I C;  1N32 H;  3I72 A;  4K6L A;  4IFD G;  1SE2 A;  5IYB H;  2R7L A;  4TUY F;  5CR3 A;  3GTO B;  4HCE A;  4PV1 C;  3PW0 A;  1DYQ A;  3KAJ A;  3M4Q A;  3ERS X;  2A5H A;  1KC8 C;  2XRS D;  3J81 j;  4A3K H;  2OH2 A;  4J9K A;  3T1H L;  4Y52 H;  1CSQ A;  5KG7 A;  3T16 A;  3OTO H;  3SDZ A;  5C3E G;  2NVX A;  2BDO A;  2FB9 A;  5TSS A;  3R3O A;  4JI8 H;  1DCZ A;  1AN7 A;  4KKS A;  3H09 A;  2FIN B;  1HH2 P;  1JJ2 A;  2GLT A;  1H9M A;  4DV3 L;  3ND9 A;  1DXM A;  2R93 H;  2F0M A;  3RNU A;  2GVB A;  4EG0 A;  2BDN A;  3ITP A;  3G7L A;  5LMU Q;  2F0Q A;  4DV7 L;  4DV0 L;  3VYT A;  2QIL A;  3H0G H;  3VYR A;  4A3D B;  5KT3 A;  1D5X C;  2NN6 G;  4R8U B;  3MC0 B;  2ASB A;  3J7A K;  1Z6H A;  3CXC A;  2CW0 D;  1GOZ A;  2KQ3 A;  4OX9 Q;  2WDT A;  3J81 i;  5KT5 A;  4DAY B;  2OWO A;  3CRK C;  2IMW P;  1SNO A;  4EQ5 A;  3BZK A;  2W7O A;  5LHY 1;  2UXD L;  3E0J A;  3OMC A;  2WE6 A;  2V59 A;  2CHB D;  4ZQI A;  1LT5 D;  3RN5 A;  2YS6 A;  4JI4 H;  2A73 B;  4O0A A;  1S5D D;  4GOP A;  4MHE A;  3BDC A;  2F0J A;  3CCV A;  3VDY A;  1K8G A;  5C44 B;  2KEC A;  1N33 L;  3JAM W;  1LAC A;  3ICE A;  4EX5 A;  1X54 A;  5C3E B;  1CE8 A;  3NSW A;  3RBD A;  4RCO A;  1IBL H;  2MP1 A;  4HAE A;  1M6V A;  4LF5 Q;  4MN3 A;  3M4P A;  2XWJ B;  1D2B A;  5C3E H;  1RF2 D;  3AMU A;  4GOP C;  3PIO A;  4B3S Q;  3JSL A;  4O3P A;  2MGS A;  5CB4 F;  2AQ2 B;  4DXF A;  4DV0 H;  1BGW A;  3KBX A;  3J7A 5;  2YZM A;  2NU9 B;  2VL6 A;  1LTG D;  4OEM B;  3F2B A;  5IWA H;  4JI7 H;  5DGA A;  2CW7 A;  4EYI B;  1YHQ A;  5FO8 B;  4IFD H;  3CRL C;  3PSI A;  4G3I A;  1K28 A;  4HJ7 A;  5L37 A;  1WTQ A;  3JZI A;  4HR7 B;  3J80 i;  1VQ7 A;  4CJ1 B;  1U5K A;  3RZO B;  2RCN A;  1VAJ A;  3Q24 A;  5DLG A;  3K57 A;  2AWN A;  4XYM B;  5EWF A;  1CHQ D;  1W6J A;  5KFE A;  1YNN D;  3GTQ A;  4Q0Y A;  4A3M H;  4TV8 F;  2W6Z A;  3T1H Q;  1GUS A;  1V8Q A;  1DIK A;  4EFB A;  1STB A;  5KFO A;  4B3M L;  4OL7 A;  1QNU A;  1QZH A;  3K5H A;  4L5Q A;  1CFM A;  2E5L Q;  3A7L A;  1A62 A;  5IYC H;  4YY3 L;  4JV5 Q;  5EZY F;  2M9V A;  4YAK B;  1RK5 A;  4CKC A;  3BYY B;  5IWA L;  1O7I A;  2Q2I A;  2BQR A;  2PI2 A;  1PTO F;  2FE3 A;  4DK6 C;  2NU8 B;  1PH4 A;  1PYW D;  2K33 A;  1AE3 A;  1K83 H;  3GV8 B;  5IYB G;  2YRW A;  3OSN A;  4A3D H;  3NQT A;  2JSO A;  2VB3 X;  1YNX A;  4LSX A;  3MWD A;  3A56 A;  1RYR A;  2K14 A;  3TIN A;  3K3P A;  3FKI A;  3FEW X;  4O3S A;  3CCU A;  4F7X A;  2E75 C;  1SE8 A;  4WBN F;  4J9N A;  2HQE A;  1TWC B;  2BR0 A;  2W9C B;  4DV6 Q;  2QDB A;  3A8I E;  3PW2 A;  1EIF A;  4LFC L;  4HED A;  4IQZ A;  4X66 Q;  3S2H B;  4A93 H;  2YTY A;  3A54 A;  1WTO A;  3P7J A;  1IL8 A;  1MSH A;  1VCI A;  1HQM C;  1A63 A;  3QR8 A;  1VQI A;  5IYC G;  2JA7 B;  2K50 A;  4G7Z C;  2A6H C;  2MHV A;  5DG8 A;  1BVS A;  3PV0 A;  3TN2 A;  2PVP A;  3NEM A;  4U7C A;  5L1L A;  1XNR Q;  2M00 A;  4K2L A;  3BAB A;  3MFI A;  1ONL A;  1PH2 A;  5J2U F;  5JEA J;  4Q0F A;  1VQF A;  3MFG A;  4LAA A;  2C35 B;  4L5T A;  1B50 A;  3GDE A;  1EU4 A;  1IBM Q;  3KOJ A;  2J0T D;  1XJV A;  3T5H A;  1S0M A;  1I7L A;  4U6P A;  1FVI A;  4AYB B;  2K4K A;  4NB3 A;  4LW1 A;  1EL0 A;  2XCP A;  3A74 A;  1M8A A;  2QCP X;  2MCT A;  1I6H B;  4DAY A;  4LFB L;  5IT9 E;  1G2S A;  4QB4 A;  4E4T A;  3RZO H;  1HZC A;  4X64 H;  2XGQ A;  2RGR A;  1K0S A;  4DU9 A;  4GNX C;  1W6K A;  2WB1 B;  2EJF C;  4TVA B;  2EIF A;  1A9X A;  4JI4 L;  2R7F A;  2WAQ E;  4BBR B;  2E2I B;  4EGV A;  1HQR D;  2C9O A;  2CKZ B;  3W3A A;  2HVR A;  5IP7 G;  1S03 G;  1N36 Q;  1TS5 A;  1IKM A;  3PIP 3;  3CP0 A;  3OWE B;  4A3J B;  1JWU D;  1I3Q B;  4YCW A;  4MAM A;  2IWH A;  3U9T A;  4O3R A;  3HP3 A;  1KHI A;  4JI3 Q;  4ME5 A;  2OQK A;  2Z6B A;  2UUC Q;  4F50 A;  1JQY D;  2PW5 A;  1H9S A;  1VKZ A;  1W93 A;  4RKB A;  4ODG A;  2JA6 G;  4YAJ B;  4FDB A;  5KFQ A;  1SEB D;  4KY7 A;  4DK3 C;  2F0S A;  5C4X H;  1BJT A;  4C1N K;  1Y8N B;  4J9R A;  2XN9 C;  2VPS A;  4HJ9 A;  2JA7 H;  4YWL A;  4A3F B;  2H5X A;  1EYD A;  1WD1 A;  3CC4 A;  3RTX A;  4DV3 Q;  2J6U A;  3K80 C;  1C4Q A;  4HN7 A;  4K5W A;  1BXR A;  2DPI A;  2JEG A;  3KLS X;  3I8Z A;  3BVG A;  4DPG A;  2JA5 A;  4XT1 B;  1LTR D;  2EY6 A;  3RUP A;  1MSG A;  1G6Z A;  2WAQ B;  1EY6 A;  2E5L H;  3RZD B;  3K3V A;  3TZD A;  5KFZ A;  1ZQ7 A;  2ATL A;  5T1I A;  3GTK H;  2W9A A;  1BO0 A;  1X3Q A;  3QZ8 A;  2NVX H;  5KFA A;  2AMC B;  2CFM A;  4POF A;  2I0Q A;  3S16 H;  3BAA A;  3VR2 A;  1NMG A;  1YHB A;  4H02 A;  1PZJ D;  3T13 A;  2D0P A;  1CKN B;  4CDD C;  4QUF A;  4JBW A;  5IP9 G;  4CDC C;  3GID A;  2QGQ A;  4QCL A;  2OTJ A;  1CTM A;  5LP6 F;  4A3I H;  4LFC H;  2AQ1 B;  3ULL A;  1QB5 D;  4KHP Q;  1VQG A;  1GKH A;  1NUC A;  3I90 A;  3V6J A;  2RF4 A;  4OX9 H;  3MXN A;  4Q44 A;  3N6R A;  1LM0 A;  5FD6 A;  4LF7 L;  3HOZ G;  4UP9 A;  3CQZ H;  2VZA A;  1PTO D;  4F4Y A;  1NSN S;  2QKI C;  1WCM G;  3DXJ C;  3HOV B;  1TWC A;  1IBL Q;  1B4O A;  1XX8 A;  5M5W B;  4O3Q A;  5D14 A;  2RKS A;  1YZ6 A;  4APM A;  4ZHQ F;  1MIU A;  2EY2 A;  1FJG H;  2HIX A;  4L63 B;  4P75 A;  5J3B A;  5C0X H;  1B2T A;  1AN8 A;  1TWG B;  4F8M A;  4B9W A;  1JIC A;  3S2H H;  3OTO L;  3HOX H;  4KJN A;  1QUQ A;  2KOL A;  4XZ3 B;  2J4X A;  3M4O H;  1SMX A;  4J8Q A;  5C5M A;  4C3J G;  4O2D A;  3CW2 C;  1FJG L;  3D6W A;  3M7G A;  1H95 A;  1I4P A;  2VR1 A;  4KHV A;  5LMN L;  2FMM A;  3E5S A;  1J8I A;  2ICE C;  1XPR A;  2B8G A;  5IT9 c;  4CKB A;  4XYO A;  4DAV A;  4LFA H;  2RDJ A;  1PFN A;  2K5N A;  3HKZ E;  3PW5 A;  1L1O A;  1STY A;  5EQ0 A;  4ALP A;  1K83 B;  1W2B A;  3FHW A;  4GC6 A;  1EIG A;  5ELB A;  4FNF A;  4XTC S;  1N32 L;  1RYS A;  5J22 A;  4DR6 L;  2V4D A;  5KFF A;  3BA9 A;  3KK7 A;  1N36 L;  1NR4 A;  3PO2 B;  1ILP A;  2K5D A;  1UC9 A;  1FYC A;  1OXT A;  4MV7 A;  2KCC A;  1HTL D;  4QWB A;  1EHI A;  4O4I F;  5CMD A;  5JJI A;  1STA A;  1TWC H;  1EYC A;  1M1K C;  4ECQ A;  4C1N I;  1QUQ B;  5K2M A;  5ELE A;  3EA6 A;  2FP4 B;  4FXD A;  1CI3 M;  2ZM6 L;  1SYX B;  3UDG A;  2ZT9 C;  4KTA A;  4AQY L;  3SK8 A;  2JEF A;  4JV5 L;  1GHK A;  1A3U A;  1JX4 A;  1RTO A;  3LGJ A;  2Q8I B;  4DV5 Q;  4DV7 H;  3D0F A;  3KYH C;  4RZQ A;  3SI8 A;  4UPA A;  4DL5 A;  1AUV A;  4DR2 H;  4ECV A;  4UP7 A;  3M3Y B;  1KJQ A;  3PVX A;  4B08 A;  3GIK A;  4IHJ F;  2W6P A;  5K5P A;  1EZ8 A;  4HTH A;  1PTO B;  1BNC A;  4YY3 H;  5GAE C;  3GIM A;  1J6Q A;  1SRU A;  3IFT A;  1ULZ A;  4IAJ A;  1LLR D;  4ZYS A;  4DL3 A;  1JR0 D;  3D6C A;  2C28 A;  4IN3 A;  4A2B A;  5LMN W;  4RNM A;  1TWF H;  2KHS A;  1KXL A;  4DR7 Q;  2RHQ B;  4JOI A;  3BJY A;  3OIP A;  3GTL A;  1GSA A;  1E1T A;  2L4N A;  4ABN A;  1M90 C;  1GXD C;  4A3G H;  2NVQ B;  3H91 A;  1C9O A;  3FP9 A;  3S9W A;  2I8C A;  4F4Z A;  5BR8 H;  4RHR A;  3U4V A;  1YNJ C;  3KF6 A;  4JYA L;  4DUY Q;  2PMZ E;  4TQS A;  3PUY A;  1GHJ A;  5KFN A;  1HFN A;  3L9A X;  3I12 A;  1MI2 A;  2NVT H;  3PUX A;  4BY7 B;  1KNE A;  2HCI A;  5I2Y A;  4A3B G;  3VA7 A;  3H94 A;  1ASY A;  2OEO A;  4LH7 A;  5J1Z A;  1VQE A;  3J7Y W;  2K6A A;  5ELC A;  4HR7 A;  3MR6 A;  1C7Y A;  3MA2 B;  1I7N A;  3LML A;  2CQO A;  3SVM A;  2OTL A;  3KJP A;  3ORQ A;  1QG7 A;  3ULJ A;  2MNA A;  4HID A;  4Y8V B;  3FDT A;  5COR A;  1GLV A;  3R5X A;  2F0E A;  2F3I A;  4YR3 A;  1NTG A;  4E6I A;  1X32 A;  3GTO A;  1CM9 A;  5JEA H;  1QOH A;  2CWP A;  5CC4 A;  2KEN A;  2ZTD A;  3HOV G;  1KC7 A;  1HR0 Q;  4M8A A;  2RSN A;  4ZKB B;  1I50 H;  1XNQ H;  3OW7 A;  1DOK A;  3ETJ A;  3M85 A;  4JPB W;  3GTJ B;  1F2Z A;  4ZRZ A;  1F2M A;  4GKJ H;  4JC0 A;  3RB4 A;  1RDP D;  3F1Z A;  4RAZ A;  3TQT A;  4JI1 H;  2R8J A;  1HZ9 A;  5C5J A;  2FHT A;  5IIF A;  3VMM A;  1DV1 A;  4OIK A;  3L2P A;  2IA6 A;  2E2D C;  4PMC A;  2NVT B;  4DR5 H;  2JA6 A;  1TWH B;  2AQ3 B;  2WB1 G;  2QF7 A;  4R8U A;  1BKB A;  5D65 A;  1Z9F A;  5ELO A;  1GUO A;  4A3J H;  5AFW A;  3L4J A;  4WJW A;  1EY7 A;  4J9L A;  4BXX G;  1I4G A;  3OHB A;  4ME6 A;  4LWC A;  2K01 A;  2JJQ A; 
#chains in the Genus database with same CATH homology
 3STB D;  1SRO A;  4C2M H;  2NZH A;  3W1G A;  3TQY A;  4C3H H;  3HOX G;  3PCO B;  1G6P A;  3I4M G;  3M4Q A;  3ERS X;  4PG3 A;  4DV1 Q;  1KC8 C;  2KCM A;  3G71 A;  2HIV A;  3J81 j;  3CME A;  4A3K H;  2VUM G;  1RIP A;  4IFD I;  3T1H L;  4Y52 H;  1CSQ A;  4DV5 L;  4A3L H;  4DR6 Q;  1Z47 A;  5C3E G;  3S2D H;  2KBN A;  4P74 A;  1JT8 A;  1FL0 A;  4B3S L;  3ULP A;  2AKW B;  5M5W H;  4NXM Q;  2F52 A;  2I0Q A;  4YWM A;  2UUA Q;  3CF5 A;  1HH2 P;  2N49 A;  1JJ2 A;  1UEB A;  4R4I A;  1LUZ A;  1S40 A;  3IRB A;  1Y1W H;  3RNU A;  4LF7 Q;  2GVB A;  2E2H H;  4LF8 Q;  4LUZ A;  1WCM H;  4DV4 L;  1IBK Q;  5LMU Q;  4DV7 L;  1YIT A;  4DV0 L;  2N8N A;  1K3R A;  3H0G H;  4JBJ A;  3CCJ A;  4JI8 Q;  2BH2 A;  4DV4 Q;  4R4Q A;  1EOV A;  2Q2U A;  2UXB L;  2AHO B;  1NE3 A;  2NN6 G;  5GAD C;  4GKK Q;  4IO9 A;  2ASB A;  3UDI A;  4BY7 H;  1MJE A;  3CXC A;  4JI2 Q;  3TS0 A;  1FJG Q;  3PUV A;  4OX9 Q;  1A0I A;  1X55 A;  3W1B A;  3J81 i;  2DGY A;  1B8A A;  4DAY B;  3E9H A;  2OWO A;  2Q2T A;  5M5Y H;  1VQP A;  1MJC A;  1PHJ A;  4EQ5 A;  3BZK A;  3SGI A;  5FLX c;  4LF4 L;  3I4N H;  3S1Q H;  2UXD L;  2IHE A;  4X62 Q;  3RN5 A;  1GO3 E;  4O0A A;  5BR8 Q;  4GOP A;  3CCV A;  3RN2 A;  4DV0 Q;  3VDY A;  1K8G A;  1N33 L;  1UE7 A;  3ICE A;  4JI8 L;  1CKN A;  3CPW A;  4EX5 A;  1X54 A;  2K5H A;  3KDF B;  3OW2 A;  4JBM A;  4JI0 L;  3GTG H;  3CCS A;  1N9W A;  3H0G G;  4LF5 Q;  3M4P A;  1X3E A;  3KLW A;  3UDF A;  1OXS C;  5C3E H;  2I5L X;  3K7U C;  3HOZ H;  5JJK A;  5IP7 H;  1N34 Q;  4GOP C;  3PIO A;  1UE6 A;  1PH8 A;  4B3S Q;  5IYD H;  3PF4 A;  2CCZ A;  4X6A H;  3S1N H;  3E0E A;  5C44 H;  5LMN Q;  1PFS A;  3NBH B;  2VL6 A;  4QY7 A;  5EAY A;  1XMO Q;  3J7A 5;  3F2B A;  3EIV A;  4KHZ A;  3F2D A;  1YHQ A;  4GLV B;  3J7Z C;  3PSI A;  3S15 H;  2E2J H;  3AFQ A;  4HJ7 A;  2ZTE A;  4X66 L;  3J80 i;  1VQ7 A;  3HOV H;  1U5K A;  3H3V H;  1SLJ A;  2RCN A;  1VQD A;  3BZC A;  1BBU A;  2JA7 G;  2AWN A;  5IWA Q;  1Y1V H;  3E9I A;  5M3M G;  3EN2 A;  2UU9 Q;  2JE6 I;  3GTL H;  2JA6 H;  1D8L A;  4IJH A;  4DR1 Q;  1V43 A;  5GRO A;  2YTV A;  1E3P A;  4X65 Q;  4A3M H;  3T1H Q;  3S14 H;  4DUZ Q;  1BBW A;  2JQO A;  1Q7Y C;  1XPU A;  1J5E L;  4B3M L;  3HOY H;  1QZH A;  4HJA A;  2LSS A;  4L5Q A;  1XPO A;  1VQ4 A;  1HNZ Q;  2E5L Q;  4OXP A;  1J5E Q;  4HIO A;  1A62 A;  1EWI A;  5IYC H;  4GKJ Q;  1CKO A;  1IBL L;  4YY3 L;  3U58 A;  1OXX K;  1VQJ A;  1YEZ A;  4AH6 A;  4JV5 Q;  3TS2 A;  1L1O C;  5IWA L;  5C0X J;  1O7I A;  1SN8 A;  2Q2I A;  3S1M H;  2PI2 A;  4LFB Q;  2R7D A;  2UU9 L;  3I4M H;  4DK6 C;  1TXY A;  1PH4 A;  4NPS A;  1AE3 A;  1K83 H;  5C0X I;  4JI1 L;  3NEL A;  1KIX A;  2R7Z H;  5IYB G;  3UDX A;  2K75 A;  4A3D H;  4A3C H;  3H3V I;  4QJF A;  1YNX A;  2VQF L;  2R92 G;  3MXN B;  1XNQ L;  3HOU G;  1KAW A;  3HOW H;  2VQF Q;  1U0L A;  3STB C;  2K14 A;  1TWG H;  2GN5 A;  3CMA A;  1QVF A;  5FJ8 G;  2OQ0 A;  5IYD G;  4BY7 G;  4QL5 A;  3CCU A;  4OON A;  1OXV A;  2RHS B;  2I5H A;  1Q12 A;  1VQB A;  3HFZ B;  4A3C G;  2VNU D;  1SE8 A;  3RR5 A;  1B70 B;  1I5F A;  1A8V A;  2UUC L;  1YBY A;  1CKM A;  2VQE Q;  2ZJR A;  4DV6 Q;  2UXB Q;  1EIF A;  4OWT B;  4LFC L;  1EQQ A;  4X66 Q;  4MNO A;  1N33 Q;  1WFQ A;  4A93 H;  2YTY A;  2PI2 E;  2VQE L;  4IOA A;  2B29 A;  4J15 A;  4DAM A;  3J81 c;  4LFC Q;  2Z6K A;  5AJ3 Q;  2E8G A;  1VCI A;  4JI4 Q;  1A63 A;  1JMC A;  2KCT A;  1VQI A;  5IYC G;  3F8T A;  1OTC A;  2JA9 A;  1Q46 A;  2K50 A;  1YVC A;  1BVS A;  2D62 A;  3PV0 A;  3NEM A;  5HGQ A;  1P16 A;  1XNR Q;  1PH2 A;  5JEA J;  2QEX A;  4GNX A;  4JI6 Q;  1EIY B;  4DR4 Q;  1VQF A;  1JJG A;  4JI2 L;  1IZ6 A;  2C35 B;  4L5T A;  2Q2H A;  4UP8 A;  1JE5 A;  3W5O A;  4JI7 L;  4B3M Q;  4GKJ L;  4OO1 G;  3GDE A;  3I55 A;  5M3F H;  1QZG A;  1IBM Q;  3KOJ A;  2K5V A;  5AJ3 L;  1XJV A;  4GN5 A;  1I94 L;  4NXN Q;  4JOI C;  1FVI A;  3I2Z A;  2K4K A;  4NB3 A;  4LW1 A;  4TQU S;  3A0J A;  3A74 A;  3L0O A;  1I94 Q;  2YV5 A;  5FLM H;  4A3F G;  4LFB L;  4AYB E;  1UE1 A;  2A19 A;  1VQK A;  4A3D G;  2MQH A;  3RZO H;  1HZC A;  4LF4 Q;  2WB1 E;  5ELN A;  4GNX C;  2JA5 H;  4QIW E;  1YIJ A;  5C44 G;  2R6G A;  4YCV A;  1MKH A;  4TVA B;  2EIF A;  2MO0 A;  1XNQ Q;  1VQA A;  2R7F A;  2WAQ E;  2Y0S G;  4JI4 L;  4A75 A;  4JYA Q;  2XGT A;  1W3S A;  2EXD A;  1NJI C;  2CKZ B;  1VQH A;  3T1Y L;  2K52 A;  5IP7 G;  1XMQ L;  3F2C A;  1N36 Q;  4DNI A;  3CP0 A;  4YCW A;  4DR5 L;  4JG2 A;  2NVY H;  4JI3 Q;  1KHI A;  4JCV E;  4P73 A;  3AEV A;  2OQK A;  1SR3 A;  4R4O A;  3KJO A;  1RL2 A;  2IX0 A;  2UUC Q;  4LF6 L;  4K0K Q;  4A3G G;  3AFP A;  1P8L A;  3FKI H;  3WWV A;  1GD7 A;  1PH1 A;  1HZB A;  3TRZ A;  2R92 H;  2PQA B;  2JA6 G;  1K0R A;  4FDB A;  2KHJ A;  4DK3 C;  1GM5 A;  1KQS A;  5C4X H;  4HJ9 A;  2JA7 H;  4YWL A;  2YU9 H;  4BA2 I;  2H5X A;  3A5Z B;  1PYB A;  3K0X A;  4DV3 Q;  3CC4 A;  3K80 C;  4JI5 Q;  3PGZ A;  4B3R Q;  2QA4 A;  4LF9 L;  2JEA I;  2MO1 A;  1HR0 W;  2ATW A;  4DPG A;  4IPH A;  2F4V Q;  4KHP L;  1Y1W G;  3CD6 A;  3HOY G;  1I6H H;  1ASZ A;  5GAG C;  2R93 G;  1CUK A;  1X6O A;  1PH3 A;  2ZJQ A;  1N8R C;  3GTK H;  4NXN L;  2NVX H;  4A3M G;  2AMC B;  2CFM A;  3HKS A;  1JJC B;  2WFW A;  4POF A;  1PV4 A;  1NMG A;  1YHB A;  3NEN A;  4H02 A;  4DV3 L;  2D0P A;  1CKN B;  5IP9 G;  4PMW A;  4JBW A;  3I56 A;  3KDF A;  3CCM A;  4OWX B;  2UUA L;  2QGQ A;  4DR4 L;  3TRE A;  4DR1 L;  3GO5 A;  4GLX A;  2MFI A;  3G48 A;  1YJN A;  1HZA A;  4DUZ L;  4XIG S;  4L5S A;  3G4S A;  3GTQ H;  4A3I H;  2OTJ A;  3ULL A;  2IY5 B;  4KHP Q;  3S16 H;  2E2I H;  4LF6 Q;  1VQG A;  1WYD A;  4R4C A;  3JAM i;  1GKH A;  2UUB Q;  3I4N G;  4K0K L;  1HJP A;  4A3E H;  2RF4 A;  3EBE A;  2ZJP A;  4JBK A;  1I3Q H;  1VQC A;  3HKZ G;  4YWK A;  3D31 A;  1KL9 A;  1VS0 A;  4YY3 Q;  1R9T H;  4A3I G;  1IBM L;  4GN4 B;  1V1Q A;  4BA1 I;  2N3S A;  1IL2 A;  1GVP A;  3I4O A;  3B6Y A;  3OYY A;  5M5X H;  3CCL A;  4DR7 L;  1KRT A;  3CCE A;  1LM0 A;  2JEB I;  4LF7 L;  2WP8 J;  3PO2 G;  3HOZ G;  4UP9 A;  3CQZ H;  2VZA A;  2UXD Q;  4DV2 Q;  4JI6 L;  1B7Y B;  1WCM G;  4RG1 A;  1L1O B;  4UY8 C;  1IBL Q;  1E1O A;  4LUV A;  4WJ4 A;  3Q8D A;  2R93 H;  3BU2 A;  4OX9 L;  4GLA C;  1YZ6 A;  4JI3 L;  1UE5 A;  1MIU A;  4AYB G;  4LF5 L;  1PH6 A;  2LXJ A;  3PO2 H;  2HIX A;  4IFD J;  1WI5 A;  1D7Q A;  4P75 A;  5J3B A;  3GTJ H;  3KF6 B;  2OCE A;  4A3K G;  4ME3 A;  4JI7 Q;  3I7F A;  3S2H H;  3OTO L;  2ALY B;  3HOX H;  5JJL A;  2F4V L;  4B3T L;  4WJ3 M;  1QUQ A;  3AQQ A;  3S24 A;  1XNR L;  1X65 A;  2ID0 A;  1YJ9 A;  5C4X G;  5IP9 H;  4PZ6 A;  5HY6 A;  2Z0S A;  1PA6 A;  4GS3 A;  1Q8K A;  3M3Y H;  1SMX A;  4R4T A;  3M4O H;  4JI5 L;  1X9N A;  4B3R L;  1XMQ Q;  3FKI G;  4O2D A;  1KD1 C;  1T9H A;  3CW2 C;  1FJG L;  1Q1B A;  3ZJY C;  4HIK A;  3M7N A;  1H95 A;  1PYS B;  5IE8 A;  4QQB X;  1AE2 A;  4BBS G;  2FXQ A;  3CCR A;  5LMN L;  1IYJ B;  1XMO L;  4IPG A;  1XPR A;  1QVC A;  2Z6K C;  5E7N A;  5IT9 c;  1X56 A;  3RLO A;  4A3L G;  3PF5 A;  4APV A;  4B3T Q;  3HKZ E;  2K5N A;  3L7Z C;  4A3B H;  1L1O A;  4P71 A;  4ALP A;  1KRS A;  1W2B A;  3FHW A;  2VUM H;  1VQ8 A;  5K36 G;  2JK8 A;  2HT1 A;  2B3G A;  4XTC S;  1N32 L;  1HNX L;  4DR6 L;  3A5U A;  3U4Z A;  1NY4 A;  3RLF A;  1HNZ L;  3T1Y Q;  2E5L L;  4GOP B;  2JA5 G;  4BXX H;  2NN6 I;  1N36 L;  1PVO A;  1K8A C;  3K81 C;  4A3E G;  4LFA Q;  1WJJ A;  3DLL A;  2I5M X;  1Q82 C;  1K73 C;  1OXT A;  4PZ7 A;  1VQL A;  1EFW A;  3H15 A;  4X65 L;  2BH8 A;  1Y14 B;  2IHF A;  1VQ6 A;  5JJI A;  2YYZ A;  4A3J G;  1S72 A;  1IBK L;  1TWC H;  3MEF A;  3BJU A;  5JEA G;  1M1K C;  2IX1 A;  1QUQ B;  4DR2 Q;  4AQY Q;  4LNQ A;  5M3F G;  3GTM H;  4KI0 A;  2ZM6 L;  3K8A A;  4BBR G;  3CPF A;  3UDG A;  4DR2 L;  4GN3 B;  4AQY L;  1EYG A;  1AH9 A;  3DM3 A;  4GNX B;  4JV5 L;  1YHA A;  2EQS A;  3M9B A;  3GTP H;  3LGJ A;  1HR0 L;  2BA1 A;  3TEH B;  4JI0 Q;  3PO3 H;  4DV5 Q;  3D0F A;  2B63 G;  1WOC A;  3KYH C;  4UPA A;  1TWA H;  4MTN A;  4UP7 A;  4Y7N H;  2A8V A;  2A1A A;  4RMF A;  2LXK A;  1G51 A;  3S1R H;  4OWW B;  3J80 c;  5GAE C;  2D0O A;  2PNH A;  4DV2 L;  1J6Q A;  1SRU A;  1N32 Q;  4A3F H;  2UXC Q;  5IY0 A;  4R1J A;  1X3F A;  3KF8 B;  1VQM A;  3CC2 A;  3S17 H;  2HHH L;  5LMN W;  3PO3 G;  1TWF H;  1KXL A;  1VQ5 A;  1HNW L;  4DR7 Q;  1X3G A;  2BA0 A;  3ER0 A;  2RHQ B;  4JOI A;  4A4I A;  4GKK L;  2ZTC A;  1JB7 A;  1NBW A;  4LF9 Q;  1E1T A;  3AYH B;  4POG A;  4MZ9 A;  1M90 C;  1Q1E A;  4IOC A;  4X64 L;  5FLM G;  3PIP A;  1PH9 A;  4A3G H;  4OO1 I;  1NMF A;  3GTO H;  2N78 A;  1XTD A;  1C9O A;  3FP9 A;  3RZD H;  1EQR A;  4A76 A;  4HIM A;  2JA8 G;  3U4V A;  3HOU H;  3KF6 A;  4JYA L;  1E7Z A;  2UUB L;  2YTX A;  3CC7 A;  1SFO H;  1HNX Q;  4DUY Q;  2UXC L;  2PMZ E;  1DGS A;  2AWO A;  1QVG A;  4IJL A;  1Q81 C;  2L15 A;  2VW9 A;  4DR3 L;  3PUY A;  3PUW A;  2PQA A;  3UE0 A;  3CAM A;  1LYL A;  4A93 G;  4LFA L;  1CSP A;  4X64 Q;  2NVT H;  3PUX A;  3JAM c;  1PH5 A;  5GAH C;  1FGU A;  4A3B G;  2HQL A;  5BR8 L;  1ASY A;  4IPD A;  2ZM6 Q;  3G6E A;  1VQE A;  4LF8 L;  1L2F A;  4DV6 L;  1C7Y A;  2VS1 A;  2JA8 H;  4BY1 H;  3PUZ A;  3RLN A;  2CQO A;  2IT1 A;  2OTL A;  4HJ8 A;  3KJP A;  4DR3 Q;  3ULJ A;  4NXM L;  4L5R C;  4C3J H;  2MNA A;  4HID A;  1N34 L;  1VQ9 A;  4YHH Q;  1Q86 C;  2F3I A;  1Y1V G;  1NTG A;  5M3M H;  1VQO A;  4AIM A;  4YHH L;  4BY1 G;  2CWP A;  4JI1 Q;  3HOW G;  1OXU A;  2DUD A;  2KEN A;  2ZTD A;  3K7A H;  4YCU A;  3HOV G;  2ES2 A;  5H1S E;  1S3O A;  5C0X G;  1HR0 Q;  3U50 C;  1TWH H;  2NVQ H;  1I50 H;  1YJW A;  3GD7 A;  1VQN A;  1HNW Q;  4IPC A;  2R7Z G;  4P72 A;  3M85 A;  1K9M C;  4JC0 A;  5C4J H;  2XTI A;  1PH7 A;  3F1Z A;  1IXR A;  3KFU A;  2B63 H;  3UE1 A;  1HZ9 A;  4C3I H;  1C0A A;  2WAQ G;  2Y0S E;  3JC6 6;  3L2P A;  3CCQ A;  4DKA C;  2NZO A;  4X62 L;  2KHI A;  4BBR H;  2VY3 A;  4KLK A;  5DLQ E;  1UWV A;  4QGU A;  4DV1 L;  2WB1 G;  5FJ8 H;  5LMU L;  4DV7 Q;  4BBS H;  1BKB A;  4DUY L;  1Z9F A;  1LTL A;  2CWA A;  5ELO A;  1E24 A;  4A3J H;  1V9P A;  2V1C C;  1YI2 A;  4HJ5 A;  4PZ8 A;  1E22 A;  4LUO A;  4BXX G;  1EUJ A;  2HHH Q;  5GQO A;  3OTO Q;  1G29 1;  1L0W A;  4LWC A;  4DR5 Q;  2GVA A;  2JJQ A;  4IFD G;  5IYB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...