5C44G

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c44G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c44G01
3OTOQ 4BXXH 3CPFA 2ZJQA 4LF6Q 2UUCQ 4HIOA 4JI6L 2JA9A 5IP7G 1VQ7A 4BBRG 2VQEQ 1SROA 5EAYA 3T1HQ 1PA6A 4JBMA 3HKSA 3CCJA 1R9TH 1KRSA 1P8LA 4FDBA 2KENA 1X3FA 4LFAL 4DV3L 1YZ6A 3RR5A 2F4VL 1NMFA 1YJ9A 1BBWA 2D0OA 4J15A 3I4MG 2QA4A 2NVXH 2N3SA 2PQAB 3KF8B 3BZKA 1M90C 2V1CC 2JA8G 3I4NH 4JI3Q 3S17H 2KCMA 4OWWB 1VQ4A 1KQSA 4BA1I 3S15H 3CCVA 2NVTH 2NZOA 3K80C 4O0AA 3S2HH 4JYAL 4BBSG 2A19A 4LFBL 2UXCQ 1YHAA 5M5XH 4DR2L 1NY4A 4DR5Q 2PNHA 2UXBQ 2I5LX 4R4IA 4LF8Q 1G6PA 1IZ6A 2K5NA 1BBUA 4DV4L 2JQOA 4TQUS 5IYDG 1YIJA 2GVAA 1PH7A 2K4KA 4KHZA 4HIMA 3HOVH 3J81i 1HNZQ 4UP7A 3L0OA 2OWOA 2NVQH 2RF4A 5J3BA 1XMQQ 1SFOH 4HJ5A 4GKKL 1LUZA 2LXKA 4PZ8A 4OWXB 2OTLA 2AMCB 5FLXc 5LMUL 3UDXA 1YBYA 2KHJA 4WJ4A 1LTLA 2JA7G 4B3TQ 4A3EH 1N32L 4JBWA 1B70B 1M1KC 2RHSB 4YWMA 3CXCA 4JOIC 3PUWA 3F2CA 4DNIA 2JA6H 3J81c 2UUBL 1NJIC 2FXQA 5IT9c 3KF6A 1Q86C 3D0FA 2E5LL 2WB1E 4R4OA 4A3BH 1JE5A 4IPHA 3DM3A 2Q2TA 3I7FA 4IOAA 2N78A 5FLMH 2ZM6L 1CSPA 4L5RC 2QGQA 2D62A 5M5WH 1CKNB 1QVCA 4LNQA 4LF4L 2L15A 1Q46A 1V43A 1TWFH 2Q2HA 1IXRA 1VQ5A 3PIPA 3HOWG 2AWOA 3ULJA 1VQMA 5IYBG 1P16A 3S1QH 1CUKA 4GKJQ 1A63A 4JI4L 1PHJA 1S40A 4A3JG 3PO3G 1HNWQ 3PO2H 3CP0A 3KDFA 5C3EH 3KJOA 4LF7L 2B63G 4GNXA 1O7IA 3CCEA 2WB1G 1K9MC 1U0LA 2NN6I 1XJVA 1FJGQ 1IYJB 1XPUA 2KCTA 1VQEA 2MO0A 3PGZA 5IWAL 3T1YQ 4X64L 1I94Q 2UUAQ 3UE1A 4JI7Q 3AEVA 3AFQA 1PH8A 4A3DH 4DV0Q 2EIFA 3M9BA 1XMOQ 1IL2A 3PSIA 1EUJA 1Y1VG 4A3KG 1VQKA 4JI5Q 1G291 4B3RL 3TREA 4AH6A 1X9NA 2VUMH 3K7AH 4DR4L 2WAQE 3F2BA 5C44G 1SE8A 3OTOL 5C4XH 2KHIA 4A3MH 2CCZA 4A3GG 4LF6L 1JJCB 4DUZL 2VW9A 1QVGA 2H5XA 2UUCL 2JE6I 4GOPA 2BA0A 3FKIG 1J6QA 1V1QA 3GDEA 4X66L 3PV0A 2VQEL 4KHPQ 4QL5A 1OXVA 3T1HL 5M3FG 1FVIA 1SMXA 3I56A 4DV7Q 1VQJA 5C0XJ 2CWAA 1VQOA 2HHHQ 4BY1G 1KL9A 1NMGA 5JJKA 2N8NA 4MNOA 5BR8Q 1FGUA 1WYDA 4A3FH 1Q81C 3H3VI 2R92G 4A3LH 3UDIA 3D31A 3JAMc 5IYCG 1L1OB 4JG2A 2I5HA 2PI2A 4P74A 4A3IH 1X54A 2Q2UA 4JV5Q 3U50C 3CCRA 3TS0A 1PH6A 1YVCA 4C3IH 1A0IA 2VNUD 1C9OA 5AJ3Q 4DV2Q 1TWHH 1XNRQ 4DR7Q 3UDFA 3MXNB 3EN2A 1KRTA 5IP9G 2MQHA 1MIUA 3M3YH 3GTKH 1WI5A 5IP7H 4JBKA 1YEZA 3A5UA 1GO3E 3HOXG 4C3JH 3CMEA 1S72A 3J81j 2UXCL 3TS2A 3G71A 4DR5L 3A0JA 4LFCQ 1H95A 1E7ZA 3UE0A 2Y0SE 3F2DA 2Z0SA 5ELNA 4NPSA 2PQAA 2I5MX 4DR6Q 1X56A 2IX0A 3U4VA 1VQLA 3HKZE 4MTNA 3I4MH 2NZHA 2VS1A 2WFWA 4YWKA 4X6AH 2HIXA 4YWLA 5LMNL 1YJWA 2EQSA 1TWGH 1IBKQ 5FJ8G 1BKBA 4C3HH 2AWNA 1X3EA 1HNZL 2K52A 1HR0W 2ASBA 4A93G 3H3VH 3PF4A 4DUYL 4OX9Q 1XMQL 1HNXL 4EQ5A 1XNQQ 2HT1A 3TEHB 3S14H 3FHWA 2NVYH 3W1BA 3CAMA 4NXNQ 1X65A 4OWTB 2R7ZG 4B3TL 3K0XA 3EBEA 4UPAA 1VQCA 2Y0SG 4PG3A 1N36Q 1EYGA 1VQ6A 4BXXG 4DV5Q 1VCIA 1VQBA 3K7UC 1HZ9A 1KIXA 5GROA 3RNUA 4X62Q 3HKZG 4KLKA 4X65Q 5IYDH 3J7ZC 1K8AC 4UY8C 4IO9A 2BH2A 4XIGS 3S1RH 4AQYQ 1PYBA 1Q1EA 1N8RC 2R93H 2YTYA 1YNXA 3GTMH 4QY7A 4L5SA 1PH5A 4LF5Q 2WP8J 1VQNA 3HOYG 1LM0A 3PUZA 2IHFA 4NXMQ 2CWPA 2A1AA 4IFDG 2MFIA 4JI1L 4XTCS 2JA7H 4DK3C 4GKJL 2DGYA 3HOUG 3H15A 3I4NG 1HNWL 4HIKA 1K73C 1VQPA 2IT1A 3CW2C 4PMWA 4DR3L 4JI6Q 5IY0A 5JJLA 4LUOA 4OXPA 1FJGL 1CKNA 2R7DA 2ALYB 4KI0A 1KC8C 1I94L 1C7YA 3T1YL 1Q82C 2UUAL 3E0EA 5C0XG 3W5OA 4L5QA 4JI7L 1QVFA 4NB3A 3I2ZA 4DV0L 1XMOL 1B8AA 4DV3Q 1OXUA 4UP8A 1HR0Q 2F4VQ 4BY7H 2LXJA 4AIMA 1EIYB 3ULPA 1VQFA 3I55A 4K0KL 4QJFA 3HOWH 4HJ8A 5IYBH 1XPRA 3S16H 1Y1WG 4H02A 4WJ3M 3HOVG 2RHQB 4A3JH 1EQQA 3PO3H 4AYBE 5GAHC 4RMFA 5JJIA 2B63H 1QUQB 4O2DA 1XTDA 1E1TA 3TQYA 2JA5H 5M5YH 2BH8A 4JI2Q 3HFZB 4C2MH 4DV7L 1SLJA 2HHHL 4DV6Q 3CCMA 4IPCA 1V9PA 2UU9Q 4GS3A 3WWVA 1HJPA 1X6OA 3S24A 2XGTA 1G51A 4QGUA 2VZAA 5ELOA 2E2IH 2RCNA 2MNAA 1IBLQ 4JV5L 2ID0A 4A3BG 1EIFA 1Q8KA 2JK8A 3J7A5 3GD7A 4IFDJ 5AJ3L 2VL6A 1Z47A 5FLMG 4AYBG 5C44H 4DV2L 1XNRL 4DR7L 4GNXC 5JEAJ 4GLXA 3PF5A 4JBJA 2YTVA 4A3CG 3FKIH 1B7YB 1UE7A 5DLQE 4IOCA 4B3MQ 4YY3Q 5M3FH 2GVBA 3JAMi 2CKZB 4R4QA 2QEXA 4LFCL 3CPWA 3M7NA 4POFA 1L1OA 4PZ7A 2E2HH 4BY1H 1KXLA 3BZCA 4P72A 3CCQA 2R92H 1X55A 3H0GG 1Q1BA 5IYCH 1VQDA 2YV5A 4YCUA 2A8VA 1PVOA 1PH4A 4GN3B 3STBD 2K14A 1IBKL 3AFPA 3GTOH 4P71A 4JCVE 3W1GA 1NE3A 1WCMG 2BA1A 3HOZG 4GOPC 3NENA 1WFQA 2R6GA 2YTXA 4OX9L 1I50H 4LF9Q 2WAQG 1SN8A 2ES2A 1XNQL 2K5HA 3Q8DA 3HOXH 1MKHA 4JI3L 1HH2P 1OXTA 3PUXA 4NXNL 2Z6KA 2ZTCA 1Q7YC 2VQFQ 2VUMG 4MZ9A 1OXSC 4GLAC 4B3SQ 2CQOA 3B6YA 4LUVA 1N36L 4POGA 4BBRH 4BA2I 4A3MG 1W3SA 1MJCA 4DV5L 1K0RA 3E9HA 3CCSA 5H1SE 4LF7Q 4X62L 1I3QH 1YI2A 2JEBI 4JC0A 4YCVA 1J5EQ 3ULLA 3GTQH 2UXBL 1ASYA 1I6HH 1LYLA 4GN4B 4IJHA 4L5TA 4LF8L 3ICEA 3NELA 4IFDI 4AQYL 5FJ8H 1PH1A 4DR1Q 1IBMQ 1QZGA 1A62A 1K8GA 4APVA 4DV1Q 4LF5L 1EQRA 3K8AA 1L0WA 5LMNW 4NXML 1N34Q 2JA8H 3EIVA 2ZTEA 1U5KA 1UWVA 2CFMA 3FP9A 4A3LG 1D8LA 3DLLA 2R7ZH 1JJGA 1SR3A 2ZJPA 2XTIA 2MO1A 1YITA 4R4TA 1KHIA 3RLFA 3M85A 4DUZQ 5C0XI 4DAYB 4X66Q 3K81C 3RLNA 3KOJA 5M3MG 4EX5A 5GQOA 2K50A 2PMZE 3CQZH 3CC7A 1PYSB 4JI0Q 4YHHQ 1PH2A 1EWIA 3G6EA 4JI8Q 3GO5A 1N33Q 2OCEA 2ZJRA 3HOYH 1HR0L 4GN5A 1K3RA 1RIPA 4LUZA 1Y14B 3F8TA 1AE3A 3IRBA 5HGQA 3M4PA 2D0PA 3HOUH 3GTJH 2HIVA 2B29A 3BU2A 1D7QA 2JJQA 1Z9FA 2YYZA 3RZOH 2UXDQ 3CCLA 1GM5A 5JEAG 2YU9H 4JI2L 5K36G 3S1MH 1HZAA 3L7ZC 5E7NA 3RN2A 1JJ2A 3S2DH 4DV6L 4OO1G 4Y52H 1X3GA 1GVPA 4ALPA 2UU9L 3SGIA 2I0QA 3STBC 1PV4A 1JMCA 1PFSA 4GLVB 4A4IA 1AE2A 2JEAI 2HQLA 1IBLL 4P75A 2OQ0A 3VDYA 1NTGA 1YJNA 1QUQA 3LGJA 5LMNQ 4LFAQ 4R4CA 5GAGC 1Y1WH 1AH9A 1RL2A 4JOIA 4JI5L 2R93G 1WOCA 3ZJYC 4DUYQ 1EOVA 1HNXQ 1ASZA 4B3ML 2K5VA 1CKOA 2IHEA 4YY3L 1I5FA 3L2PA 1A8VA 1UE1A 1FL0A 4KHPL 2Q2IA 2KBNA 3NBHB 4JYAQ 2E2JH 4ME3A 4LFBQ 4LWCA 4DR2Q 4A3EG 2IX1A 1PH3A 4QIWE 2VY3A 1YHBA 2F3IA 5BR8L 3GTPH 2JA6G 3I4OA 1C0AA 4P73A 1Y1VH 3CF5A 4DV4Q 4A3KH 3U4ZA 4UP9A 3OW2A 1XPOA 2B3GA 3JC66 4LF9L 4A3CH 3GTGH 3PUVA 2C35B 1S3OA 4BY7G 1KD1C 3ERSX 4A3GH 2ZTDA 1W2BA 1E1OA 3KF6B 3J80i 1TWCH 2VQFL 4JI1Q 1VQ8A 4B3SL 3PIOA 3KFUA 3E9IA 4GKKQ 3KLWA 3KJPA 4HJ7A 3CMAA 1L2FA 1KAWA 1T9HA 2LSSA 3AYHB 3MEFA 5LMUQ 1EFWA 1TXYA 4DAMA 4DR3Q 3H0GH 3TRZA 1HZBA 1N32Q 1OXXK 1J5EL 2JA5G 3S1NH 1DGSA 4TVAB 1WJJA 3PO2G 4YCWA 4IJLA 2DUDA 3A74A 1E24A 5C3EG 3G4SA 4DR6L 4DR1L 1Q12A 2F52A 1SRUA 1WCMH 2PI2E 3J80c 1IBML 2UUBQ 3HOZH 4QQBX 3BJUA 2E5LQ 4DV1L 5HY6A 5GADC 1CSQA 3KDFB 3NEMA 1N34L 1CKMA 1E3PA 1QZHA 1BVSA 2ZM6Q 4GNXB 4HJ9A 3M4OH 4RG1A 2ATWA 1UEBA 1L1OC 2GN5A 4HIDA 4K0KQ 2OTJA 5IP9H 3RLOA 4A3DG 3CD6A 1VS0A 3G48A 4A76A 4LF4Q 1VQ9A 1VQGA 4DK6C 1JB7A 1K83H 2EXDA 4LW1A 5IE8A 1JT8A 1NBWA 3F1ZA 4JI4Q 2AHOB 5C4XG 2AKWB 1TWAH 4PZ6A 1UE6A 1VQHA 4JI0L 4YHHL 4X65L 5C4JH 3OYYA 1UE5A 3CC2A 4JI8L 4Y7NH 3AQQA 1N33L 3A5ZB 1OTCA 1PH9A 2N49A 2E8GA 3PCOB 4BBSH 2Z6KC 5GAEC 4GOPB 5IWAQ 4A93H 2IY5B 1VQAA 4X64Q 3GTLH 4IPDA 4OONA 1VQIA 2R7FA 3CCUA 3M4QA 2OQKA 1GKHA 4A75A 3U58A 4A3FG 2K75A 2NN6G 3UDGA 3CC4A 3ER0A 1GD7A 3RZDH 4DPGA 3PUYA 1YHQA 4A3IG 4OO1I 4B3RQ 2UXDL 1HZCA 4DKAC 3RN5A 4R1JA 1MJEA 4HJAA 4DR4Q 3KYHC 1E22A 4IPGA 1N9WA 5M3MH
chains in the Genus database with same CATH superfamily
3OTOQ 2KQ3A 3JSNA 2QCPX 4HIOA 3N40P 1S5FD 2VQEQ 1ZQ7A 1FGBD 1LV9A 4HYKA 3HKSA 3CCJA 2P0AA 2FJZA 1R9TH 2EY5A 4FDBA 5EZYF 4ED1A 5E4XA 1X3FA 4A3FB 1FNWA 4DV3L 3Q1KA 1I50B 1BBWA 2D0OA 2F4IA 3I4MG 3KTMA 1BNCA 2VQDA 3KBGA 3R5FA 1YNJD 2NVXH 5JEAH 1STYA 3IFTA 1AN7A 4JI3Q 3K3VA 1STHA 2SCUB 2KCMA 4OWWB 1SYCA 3I72A 1I7NA 3S15H 3K5OA 3OUZA 4J9QA 1CQVA 4RB3C 3E3XA 3K80C 4JYAL 2A19A 5KFXA 4WRDA 2UXCQ 1YHAA 4J9RA 4DR2L 4DR5Q 5I4DA 4LF8Q 4DL6A 2KJXA 2PMZA 1IZ6A 2K5NA 4LAAA 2JQOA 1YIJA 1SYXB 1SE2A 1VF7A 2K4KA 1SNQA 4KHZA 1X3QA 2BQUA 3VYSA 3KHLA 1RYRA 2RF4A 2FPPB 3RV3A 1XMQQ 3NWSA 4ZRZA 4HJ5A 4HR7A 5DLGA 4LFBH 3QIAA 3UDXA 4WJ4A 3R3OA 2UU9H 4B3TQ 2R93A 1PZJD 3GIPA 3D3RA 4QB4A 3CXCA 1CK1A 5FKAC 2KUMA 5DG8A 3F2CA 4DNIA 4RWSC 3RD4A 2UVWA 2JA7A 1F2LA 4IURA 1SFOA 1LABA 3PW4A 1JE5A 1PTOC 1Y69U 2Q2TA 3I7FA 2N78A 3TIGA 4N9TA 1NCVA 2D62A 2QGQA 3V96A 3LWUA 1MSHA 3A8IE 1O7LA 4X3UA 5LMUH 3UQ8A 2L15A 4LMQD 1EYAA 5IGBA 4C5CA 2LKVA 2JA6A 3ETJA 2F0EA 4ECRA 1P16A 3HRZC 2WACA 3LWEA 4J9NA 3HZXA 2L55A 3S2DB 3KDFA 5C3EH 4CBVA 2KEEA 2TSSA 3M9MB 3D4DA 3MTSA 3K59A 2AQ3B 2NN6I 1XJVA 3KHHA 2KCTA 4QUFA 5IWAL 1TWFA 4OL7A 3T1YQ 2B63A 4JK1C 3AEVA 5KRUA 2FPGB 1R4QB 2HUGA 2VQFH 1Y1VG 4B3RL 3TREA 4DR4L 1CM9A 4A3JB 5C44G 4A3GG 4IUQA 5C4XH 4A3MH 1VKZA 2VW9A 1VAJA 2JE6I 1V1QA 2W6OA 2KOLA 4C2MB 5M3FG 2C00A 4X64H 1SMXA 3I56A 5C0XJ 5KFOA 3PZPA 4MNOA 3FKIA 1HA6A 1N34H 5BR8Q 1BNZA 1Q81C 3ORRA 1T3NA 5IYCG 1L1OB 4JG2A 2PI2A 1B53A 1X54A 2E2HA 3U50C 2W6ZA 5BN4A 5CV8A 5JUMA 1XWEA 4LF6H 1C9OA 2EY6A 1PRTD 4DR7Q 4X66H 1VBHA 2A73B 3MXNB 3EN2A 3MR5A 3T1HH 3M3YH 5IP7H 4Y8VB 2FHTA 2Z9HA 1YEZA 3HOXG 3CMEA 3OSNA 3GTOA 3J81j 1J9OA 2K1BA 4BY1B 1N33H 2V9WA 4J6HA 3R93A 3J7AV 2IWHA 4NPSA 2PQAA 2R92B 5J1ZA 1X56A 2IX0A 4KMUC 2EE1A 3GIQA 3DF7A 5KFAA 2W9CA 2HQEA 2B2WA 2NZHA 2VS1A 2GA4B 4Q45A 5I47A 3NSWA 4F87A 3MJFA 5FD6A 1W96A 3BG5A 1HNXL 3TEHB 4RGMA 1TR5A 2R7ZG 4M7EA 3K0XA 3GIJA 2AGQA 5T1GA 1VQCA 3MC0B 1N36Q 4R9WA 2AGOA 2TMPA 4YR0A 4BXXG 1VQBA 4IN3A 1KIXA 5A35A 4B08A 4C1NI 4X62Q 5LMNH 3GTQB 5IYDH 2ICIA 1A9XA 1AZPA 4IUTA 3S1RH 1Q1EA 3ERQA 4DXGA 2R93H 4DL7A 3MVVA 4L5SA 1SNDA 4LF5Q 1VQNA 5CV4A 5KFGA 1PFBA 1EIHA 3H3VC 2MFIA 1UNNC 4DXFA 5KG6A 5BPHA 4IWXA 2JA7H 2CW7A 2XRSD 3HOUG 3H15A 3I4NG 2VUGA 1DJRD 1HNWL 5KG7A 4DR2H 3MXUA 4UCOA 2NU7B 5GONF 4DA2A 5CA1F 4HMJA 2BE5D 4LUOA 1KBLA 1CKNA 4FXKC 1ZHQA 2K7VA 2ALYB 1G6ZA 3KHRA 5EWGA 1HQMC 1R9TB 2AGPA 1T5XD 5KT2A 5KFNA 4JI7L 4L5QA 4ECTA 1EEID 3CVZA 4DV0L 1B8AA 1WD0A 4DV3Q 4TRDA 2R7LA 2IA6A 3ULPA 2FK3A 1ESFA 1UNSA 2NVXB 3AMUA 2RHQB 2ZXRA 5A2QE 1EQQA 3PO3H 4LH7A 4DR3H 3S15B 4AYBE 2NU9B 5GAHC 2PN1A 5JJIA 1ILPA 2IMWP 2B63H 1VMCA 4O2DA 1E1TA 3Q2OA 3OMCA 2W6QA 2BH8A 1HPCA 3CRLC 4O3SA 1VDZA 4DV6Q 2BDOA 3BAAA 2EYPA 3EYYA 3ORQA 3HP3A 3S24A 1DV2A 3EVQA 4QGUA 2HJWA 3DHQA 2E2IH 4EG0A 4GC7A 2HDLA 2ID0A 2EY2A 4OELB 3J7A5 2WB1A 3GD7A 4OGQC 4RGTA 1A15A 5FLMG 4AYBG 3FPPA 4GNXC 3PF5A 2JP1A 3FKIH 1AN8A 4O3OA 1WTPA 3EJIA 4ECXA 5DM63 2WYOA 2D5DA 2GVBA 5KG2A 3JAMi 2CKZB 4R4QA 1L0YB 3TQTA 2XRQD 5KFDA 4J9OA 4POFA 2E2HH 2RBMA 3J81L 5KG1A 2J6UA 4F50A 2C28A 3C46A 1TWCA 4ED7A 2R8GA 2YV5A 3D4WA 4RAYA 1IBKL 4K6LA 3AFPA 5C4ZA 3GTOH 5COYA 2F0SA 2XN9C 3W1GA 1WCMG 5TSSA 4EBCA 4DR4H 1WFQA 2LS01 3GTGB 2WAQG 2ES2A 1XYIA 3Q8DA 2F0TA 4O3RA 1E2WA 3A8KE 4ECZA 2Z6KA 2VUMG 4B3SQ 2EYHA 5JAVA 2CQOA 4LUVA 4O4HF 2QILA 2DJFC 4DV5L 3E9HA 3G6JB 2K33A 2SEBD 5ELDA 1SEBD 2JEBI 2IJ0A 2UXBL 4IRKA 1B3QA 1I6HH 4KHVA 1LYLA 4GN4B 3ICEA 1JWSD 3NELA 4AQYL 1PH1A 2B2TC 2A69C 4DR1Q 3SK6A 3GV6A 3HOZB 1QZGA 1GJXA 4I4TF 2UVRA 3RGXA 3TP7A 3MR2A 5EPKA 4NXNH 4NXML 2XVSA 2YRWA 4A3LG 4XYOA 1TT2A 2F1MA 4K5XA 1D8LA 1BOSA 1TA8A 1KJ9A 3SEBA 1BDOA 4A3MB 3KUPA 1MGSA 1KHIA 2L5TA 3TZUA 3M85A 4ZUJA 4QCLA 3GTLA 1I6UA 3K81C 1I7LA 3KOJA 3T13A 1V1OA 3JRWA 2K50A 2CW8A 4JI0Q 4YHHQ 1PH2A 1GSOA 3E5SA 3G6EA 4QWDA 2FP4B 2Y0SA 3RMHA 1WSCA 2ZJRA 3HOYH 4RU9A 1HR0L 4XQJA 5IGDA 4GN5A 1K3RA 1RIPA 4UCSA 1Y14B 1PZKD 5HGQA 2R84A 3BU2A 5KFSA 4NDXA 4RFBA 3RZOH 3M3YB 3QO2A 3BZDB 1GM5A 3D6WA 4JI2L 4R8IA 2FMMA 3L7ZC 5E7NA 3IFDA 3RN2A 1EUCB 4OO1G 1UC9A 1EZ1A 5FPRA 1X3GA 2L4NA 4LK1C 4FS1A 1BXTA 2HGSA 1TKWB 5CYUA 1YJNA 2O2LD 1B3AA 5HBRB 1QUQA 2YZMA 1SE4A 4XQQA 2YU9A 1AH9A 5KT6A 2FINB 2A74C 2B8FA 2FFKB 2HVRA 1HNWH 4ZKCB 1HNXQ 4B3ML 3S17B 2K5VA 3V4ZA 1H9KA 2PMZB 1SJED 3W2DA 5JVH3 1SYGA 1U4PA 3JZIA 2ASJA 1RJPA 4DL5A 1JQYD 2AQ2B 2E2JH 1Y1WA 4ZQ3A 1IBLH 2N88A 2K6AA 2NBFA 5KG4A 4HR7B 4QIWE 2F3IA 4JI5H 4K2KA 3MR6A 1JOKA 4HTHA 3MWDA 3I4OA 5CV5A 2R93B 2A6EC 4P73A 3ZYYX 4A3KH 1J8IA 1NR4A 3KALA 4YY3H 3RB6A 3VR3A 4J9SA 4LF9L 4A3CH 5BPFA 3PUVA 4EBEA 2PVPA 2B2YA 1JR0D 3VYTA 3KLSA 4KHPH 1TWCH 3PIOA 1SFOB 3R5XA 5DLFA 5KT4A 1PRTF 3CMAA 1KAWA 1T9HA 3AYHB 3MEFA 4DFAA 1EFWA 1II3A 4DL3A 4MV6A 4DU9A 2JA5G 1CTMA 1DOMA 3OW7A 3J81W 2FK1A 4UFZA 3TP6A 3A74A 2JA6B 1E24A 2F52A 1QNUA 2K05A 3GV7B 4DV1L 1SBBB 2HD3A 3PR5B 1SYBA 3KDFB 4NMZA 1KJJA 1E3PA 2Q8TA 4I50F 2ZM6Q 3M4OH 1UEBA 3M9OB 5L1IA 3MHBA 3RLOA 3D6CA 2R7KA 1CT1D 4A76A 4LF4Q 1TWFB 1VQ9A 4IZ8A 2LMCB 3M7GA 2EXDA 5IIFA 5KFMA 2Q8IB 1JT8A 4QWEA 2Z8LA 5DEHA 3F1ZA 5JVLA 3WDNA 2D2CC 3SE7A 1KNAA 3QWNA 1TU2B 1IOWA 1VQHA 4MV7A 5DQHA 1IBKH 3C1FA 5CV9A 4Y7NH 1RK5A 1LTID 4BBSH 5EOYA 2MHVA 3T5LA 3BQ2A 3GTLH 4OONA 4F88A 3CCUA 3U58A 1GKHA 2E76C 4A3FG 2W9AA 1CS0A 1BGWA 1GD7A 3FDSA 4OO1I 1T36A 4A3IG 2F0UA 1HZCA 3RN5A 1WR2A 2ZT9C 4HJAA 3KYHC 4DV5H 2PO4A 1E22A 4XXEA 1N9WA 5CGKA 2NB0A 4X65H 2IBKA 3VR2A 2E2HB 2R7MA 4UCUA 4AQYH 4MTKA 5EAYA 1S0OA 4C1NK 4UCRA 2I80A 3NUCA 2F0OA 1P8LA 3J80E 1B4OA 4NXMH 2KENA 4CDCC 1AUVA 1NMFA 1Z7TA 3RUPA 5FOBB 1ZHSA 1YJ9A 1LTRD 3EA6A 3SR1A 2QA4A 4CKBA 2N3SA 2PQAB 1M90C 1TWHB 1CQJB 4A2AA 1SXTA 1S5DD 4UAIA 1VQ4A 2W9CB 4BA1I 2R8IA 4C5BA 2NVTH 2NZOA 4ZI7F 4C3JB 4O0AA 1EY4A 4KTAA 4TSSA 1MI2A 4LFBL 1TIID 5M5XH 1NY4A 2CVRA 5I6WA 5FPOA 2CW0D 4EVOA 2PNHA 2UXBQ 1HR0H 2F4VH 1RD9D 4G7OC 3WNZA 4TQUS 5IODA 4EBDA 4L6TB 4HNUA 2VPSA 3S9WA 4C3HB 4HIMA 3CHBD 1HNZQ 2OWOA 3H91A 5KG0A 2VOBA 2K01A 4RKBA 5KNDA 1A3UA 1O78A 1STEA 4EYIB 2NVYB 4OWXB 2AMCB 5KYIA 5LMUL 2KHJA 2DIKA 3HGBA 2OH2A 1ONLA 3L9AX 1CI3M 3DWAA 4XQNA 4A3EH 1G2TA 1N32L 4JBWA 3N44B 3L3OC 3QB3A 1JORA 2RHSB 4JOIC 3PUWA 3J81c 2UUBL 2FXQA 1WTQA 3KF6A 4HEDA 4WORA 5JQWA 4FBUA 3NQTA 4A3BH 1WH2A 5L9XA 4U7CA 4IOAA 5KKNB 2V59A 1BQQT 5IGFA 4L5RC 4ECQA 2K5WA 1G91A 5M5WH 1EY6A 3Q23A 1CKNB 2XIGA 1S10A 3RZOB 4XT1B 4LSXA 1IXRA 4G3IA 1VQ5A 3PIPA 3S1QH 1VQMA 1A63A 2DY7A 5IYBG 4GKJQ 5EWFA 1PHJA 4A3JG 3H09A 2O5IC 3PO2H 1SNOA 1EYDA 4DN4M 1U0LA 1FJGQ 1DONA 5KFPA 4FVMA 4YJ3F 2MO0A 3PGZA 1I94Q 4CKEA 4X64L 3GV3A 3R5HA 4IRCA 3CKIB 4KN7C 3AFQA 4A3DH 1XMOQ 2FMCA 1B2TA 4UCVA 1BCPB 1EY0A 1JLLB 4RNNA 1S97A 1GYFA 2BQ3A 3I3CA 4AH6A 3HOWB 4JI4H 4RKLA 2G9HD 4I7ZC 3QR8A 3SE0A 3F2BA 1E4EA 1MHWC 1MZBA 2W6NA 2CCZA 3BA9A 1FNVA 4XDXA 4LF6L 1A6XA 2UUCL 1WTXA 2R82A 4X66L 2MPMA 2WB1B 2CW0C 2XCLA 4RHSA 4QL5A 2E2JB 3T1HL 3U9OA 1FVIA 4IWYA 1DXMA 3RGZA 2KCCA 1VQJA 2CWAA 1M0WA 2YZNA 2VPQA 4BY1G 1HHVA 1NMGA 3G6YA 2N8NA 3BDCA 2F03A 1FGUA 2N55A 4HCSA 2NN6H 3H3VI 2R92G 4A3KB 3AU7A 3JAMc 2RDJA 4JV5Q 3BABA 3PIO3 1EHIA 3TS0A 1PH6A 1PTOD 4DUZH 5AJ3Q 1IKLA 3FRPB 3WO1A 1TWCB 1XNRQ 2KSWA 1F9RA 1EZ6A 4QUCA 2EY1A 4H13C 4Q8FA 4ZKBB 3G7LA 3TS2A 5KFBA 3A0JA 1FYCA 4S3SA 5EBDA 4LFCQ 1H95A 1XDNA 3UE0A 2OEOA 5FD5A 2Z0SA 2JXMB 2XSCA 4CJ0B 3NP8A 2I5MX 3DMUA 3U4VA 3VA7A 3HS0C 3TMEA 3I4MH 1EY7A 3OWFA 3GLKA 3LWBA 2HIXA 4YWLA 5LMNL 2EQSA 3GV8B 2UVUA 2XD4A 1X3EA 1I3QA 5JPMC 5KIXA 4EQ5A 1S5CD 3QJYA 1XNQQ 3S14H 1CHQD 4FF3A 3W1BA 5KNCA 4RH6A 4DAVA 4I7HA 5CBEE 1EYGA 3K7UC 1TVXA 1F2YA 1ZKOA 3K57A 4IO9A 2BH2A 2GPSA 4DUYH 4ID6A 1XMQH 1N8RC 1YNXA 1PH5A 2A5HA 1LM0A 2IHFA 5DG7A 4B3TH 1IKMA 1I4GA 1S5ED 3RUZA 2R87A 3QOJA 2Y0SB 2DGYA 1JWUD 1JICA 3PMFA 1G2SA 1CHPD 2EDGA 1M6VA 3Q22A 2FKLA 4PMWA 2M00A 4DR3L 4N8FA 2IX3A 4FU0A 4KI0A 2MJ8A 3GTJA 4WFN3 1C7YA 4FF1A 2UUAL 3T4AC 1N56A 3LX0A 2L0CA 5I6YA 5C0XG 1QVFA 2EYLA 1OXUA 4UP8A 2R86A 1EU4A 3MFHA 2FMAA 3SK5A 3M4IA 4O4LF 1XPRA 3S16H 4FS2A 4WJ3M 5HURA 2W9BA 4KJOA 1N32H 1EY5A 3KAKA 1QUQB 3PW7A 5DQIA 2YU9B 5ELBA 2QW7A 2UUBH 3QOLA 4DV7L 1K8MA 5M5XB 1SLJA 2HHHL 3CCMA 1GUGA 1STBA 5KGUA 2UU9Q 2PZWA 4GS3A 3H94A 1PRTB 1X6OA 1V1PA 2VXWA 4K0KH 3NHHA 2RCNA 5KG5A 1A2TA 1NAPA 2OXPA 2KCNA 1Q8KA 1Y1WB 4YBZB 3J7AF 4DV2L 2VL6A 2E2DC 5C44H 2V4RA 1BCPC 2F0NA 4B9XA 5JEAJ 4BS9A 4JBJA 3VR6A 5DLQE 1FD7D 3PQIA 3GTPA 5M3FH 4QMGA 5NUCA 1EU3A 1S5BD 4A3EB 2JN4A 2E2IA 4F4WA 4Q8EA 3BZCA 1RK6A 2JYOA 4C5AA 4F7XA 3F8NA 4YJ2F 3OIPA 2HVSA 1RCVD 5IYCH 4A3BB 1PVOA 1OO9B 1QWYA 3HXLA 4ED0A 4DR7H 3STBD 2K14A 2R7NA 4JCVE 3HOZG 4ECUA 4GOPC 4JV1A 4OX9L 1SN8A 5E3FA 3HOXH 1MKHA 4RGNA 2UUCH 3NTHA 1OXTA 3I90A 4NXNL 2ZTCA 2IW3A 2VQFQ 3S1QB 1UAPA 1WCMA 5L1KA 2EPBA 4X3SA 4KN4C 4J9LA 4BBRH 4BA2I 2WAQA 4J1MA 4A3MG 3CCSA 3N8DA 2H4OA 3H0GB 5H1SE 1I3QH 5D3DA 2A68D 4JC0A 3ULLA 5KT3A 1GLVA 1ASYA 4IJHA 1LTTD 1LTSD 3R2TA 2JEIA 3CU7A 5M9OA 4A3DB 1JX4A 1H9RA 1WTOA 5LMNW 3SDZA 1N34Q 2JA8H 2CFMA 1N36H 2R7ZH 5CBAE 4ECVA 3OIQA 1AW7A 2HDMA 4XYQA 4EFEA 5IGEA 2W8KA 1I4XA 5C0XI 4X66Q 1D5MC 4KD3A 4RB1A 1BO0A 5KFHA 2PMZE 5KFIA 4O4IF 3CQZH 3T5HA 2IL8A 1EWIA 2F0VA 4JI8Q 1OWTA 4NKLA 4IRDA 1N33Q 2OCEA 2W70A 3G6VA 1V51A 4OEMB 3HKZA 5JVDF 3IRBA 3HOUH 3Q8RB 3GTJH 2EXZA 1ZYRD 1D7QA 4YR2A 2UXDQ 4RZQA 5KFRA 4Q43A 5M3MB 4M8AA 3BVMA 2RSOA 5K36G 1ICWA 3S1MH 4O3NA 1HZAA 3Q8PB 3VYUA 1GVPA 3SGIA 5G3LD 2I0QA 3STBC 1PV4A 1F9SA 1PFSA 1AE2A 5KX5F 2HQLA 4KY7A 1IBLL 1ML0D 1NTGA 5DNFA 1KLUD 1XX8A 2FLLA 3LGJA 2K32A 5LMNQ 4R4CA 4N8X1 4ZAIA 4JI5L 2A69D 2R93G 1RODA 4R8UA 4BWSC 2PW7A 2R3ZA 3VPDA 2B2UC 1CKOA 2IHEA 4YY3L 3J7YW 5HGTA 3L2PA 5D8DA 2X69A 2K04A 2RDIA 2A68C 1QCBD 4MV8A 4M1UB 4KHPL 4Q44A 3I12A 4I65A 1EYCA 4J9PA 2NUCA 4JYAQ 3SVMA 5KYLA 3V4SA 1LT4D 2UUAH 4ZCKA 4DR2Q 2IX1A 1D1KA 2RDGA 5EPLA 1F2MA 3GTPH 3X3NA 2JA6G 1SEIA 5FK9C 1C0AA 1RF2D 1LTAD 1ZEQX 2F0WA 4MA5A 2B3GA 3JC66 3OPOA 5C1PA 1SYDA 2ZXOA 3W3AA 2C35B 1B9MA 2C9OA 1W2BA 3J80i 3KF6B 1KJIA 1B1ZA 3LMLA 4Q0YA 4EEQA 1PTOF 3MXGA 2PQEA 2RDFA 4DV7H 4HJ7A 2HHHH 5IOCA 5CV7A 4DR3Q 2H1EA 1OXXK 5D65A 3SK4A 1J5EL 3S1NH 5KFKA 4TVAB 3MWMA 3RBDA 2DUDA 3G4SA 3RBEA 1IBML 4QQBX 1WCMH 2F0FA 2PI2E 2B8GA 4DV2H 1SNCA 5HY6A 1GXDC 1ZYRC 3RB0A 1BVSA 3SXHA 4HJ9A 4FM9A 1L1OC 3S16B 5IP9H 1IL8A 3KXYT 2X6LA 1VS0A 3G48A 1LT5D 2XIWA 4DK6C 3GILA 1K83H 5IE8A 5JVG3 1NBWA 4ZLTF 4DR6H 5EKLA 5FO8B 1AP0A 3PW5A 2AKWB 5C3EB 5C5LA 4PZ6A 3TZDA 4X65L 4RB0A 1B6RA 3CC2A 1RDPD 1E4EB 1EUDB 2E74C 3DXJC 3A5ZB 1PH9A 3A54A 3F2UA 2E8GA 1G8ZD 3I91A 4OX9H 3WOFA 5IWAQ 4A93H 2IY5B 1LACA 1GUNA 4DAYA 2K75A 3CC4A 3ER0A 1S4ZA 3RZDH 4WD3A 4DPGA 3PUYA 1YHQA 2A6ED 2K5DA 4B3RQ 5J2UF 1MJEA 3QG1A 1EWCA 4DR4Q 1LT6D 4IPGA 3BVZA 5C4XB 2XNAC 4JI0H 2ZJQA 1AFPA 4ED2A 1O7ZA 2VB3X 2J7ZA 4JPBW 1SROA 3T56B 3TP5A 4C3JG 1PA6A 4MA0A 3N42B 4RNMA 3OSOA 1HFGA 3V6KA 3SK8A 3GTKA 3JAML 4PMCA 4LFAL 1Q8IA 4FXDA 3K5NA 1KNEA 2F4VL 1T5EA 3E0JA 4IFDH 4J15A 5AFWA 3BG3A 2ZDQA 2CH4A 2CQAA 1X32A 1U9RA 4C3HG 4JI6H 5HV6A 1KQSA 4O42A 4OO1H 1B04A 1FNUA 4BBRB 1F9PA 2QF7A 3S2HH 1EWHA 2I8CA 1GSHA 1TWGA 2B39A 4PV1C 3P7JA 4DL4A 1C3OA 4K8IA 5D1PA 2KVMA 3KAJA 5J2TF 3D8GA 2I5LX 2X0SA 1PTOH 3KK7A 3NBIA 3V6JA 1QJOA 3FVQA 1N48A 4DV4L 4CC5A 2GVAA 1PH7A 5I2YA 4J9MA 2JA8B 2QYZA 3NBHA 3HOVH 2NVQH 4UP7A 1E2VA 4ZQIA 1AEXA 5J3BA 1JDBB 4L8JA 4GKKL 2X6GA 1LUZA 4PZ8A 5EGTA 5FLXc 1YBYA 3JSLA 2C5CA 2F0DA 1ZETA 1DOKA 3R8BA 4YWMA 1EIGA 1KC7A 1ZXTA 4CC6A 3FMAA 3D0FA 5D1OA 2E5LL 1CA6A 3H4BA 2WB1E 4R4OA 4ETSA 2GPWA 3S1RB 5CV6A 2FPIB 4TUYF 4DK0A 5ISRA 4IUUA 4K6DA 1KABA 3BQ1A 3GTJB 4GC6A 2RCFA 1V43A 5CA0F 3CRKC 4ZHQF 4FF4A 2JA7B 2YZGA 3HOWG 2AWOA 3ULJA 2W8LA 1CUKA 3VR5A 5DGAA 4JI4L 1I4QA 3S1MB 1HNWQ 1LO5D 5C1OA 3CP0A 2O5JC 3KJOA 2XCPA 5L1JA 4H7BA 4NW2A 2YRXA 1SJHD 1O7IA 4GNXA 4V190 4KKTA 2WB1G 5CAEB 3DEPA 1V8QA 2ZM6H 2W9BB 1Y8PB 1XPUA 2O4XA 4RA8A 1VQEA 3ND8A 3GV5B 3UE1A 4CHTB 3GQBA 4EFBA 4IUVA 4JI7Q 4LF4H 1PH8A 4LMYA 4DV0Q 2EIFA 3M9BA 1IL2A 3RAQA 5KFQA 3IG0A 1EUJA 1VQKA 4A3KG 4JI5Q 3NTIA 1G291 1K8OA 2EZVA 4PMBA 3PO3B 1V1PB 5EJWA 2Z1CA 3OTOL 3K3PA 4LF7H 2FB9A 3L4JA 1J5EH 4DUZL 1QVGA 2B63B 2H5XA 3BA8A 3GDEA 4KHPQ 2Z4HA 3PV0A 2VQEL 3V6HA 2DZDA 4ED8A 1OXVA 3H20A 1IBMH 1KJQA 1XTCD 3J81E 1KDBA 1WD1A 2V5AA 2YL2A 1RYSA 3H40A 5JJKA 1QILA 4IR9A 3GTPB 4F8MA 3ITPA 4K14A 3T51B 1WYDA 4A3FH 1K1SA 2E2IB 2ZJTA 4A3IH 1TAEA 4P74A 1FKAH 4CDDC 4XZ3B 4C3IH 1A0IA 1EOTA 2B2VC 2K5QA 5DG9A 3UDFA 2R92A 2B2TA 4FF2A 3FKIB 2MUYA 1KRTA 3GTKH 1Z2PX 1S72A 5BMVF 5I9OA 2UXCL 4HAEA 3G71A 4DR5L 3NXWA 5LHY1 1DYQA 3S1NB 1JDEA 2YYAA 2XC9A 2Y0SE 5ELNA 2FLNA 3BDOA 3KF8A 1F9QA 1HTPA 1WCMB 3KBXA 1VQLA 3VPBA 4YR3A 2WFWA 4X6AH 1DZ1A 1YJWA 3GTOB 3JAMW 1TWGH 1IBKQ 2DWCA 5FJ8G 2O03A 5EBCA 2ASBA 2K52A 1HR0W 3H3VH 4JW0A 4DUYL 4JUZA 1XMQL 2I87A 2R6FA 4DLKA 2HT1A 3GTQA 3UI2A 1KJ8A 4O1NA 4ODGA 3CAMA 2JEFA 5DAUA 2W71A 4B3TL 3EBEA 2Y0SG 1JE4A 4RNOA 3I4LA 4DV5Q 1CA5A 1HZ9A 5GROA 4CDFC 3RNUA 1Z2NX 3L4KA 3RV4A 4X65Q 4LFAH 1ESRA 4I55F 2BQRA 3J7ZC 3EFXD 1I6HB 1H9SA 4K5WA 4FO2A 4UY8C 2MCTA 4A93B 4AQYQ 2C22A 4MAMA 2SDFA 3JAME 4LSAA 1STNA 5F2DA 3K6OA 4NXMQ 2A1AA 1QG7A 1EL0A 1A3TA 4XTCS 5C5JA 3QZ7A 1KAAA 1K3BC 5EPJA 2A6HC 4HIKA 3JRXA 3HKZB 2DPIA 5JJLA 5I9PA 5K5PA 4DV4H 2Z6BA 1KC8C 2F0MA 4X3KA 5KFWA 3EROA 3T1YL 2R8KA 3E0EA 2C2EA 4R7RA 1TY0A 3IKJA 3HOYB 3I2ZA 4JI1H 2F4VQ 1HR0Q 4BY7H 2LXJA 1EIYB 1TY2A 1VQFA 4GKKH 3I55A 1HUMA 4K0KL 4U6PA 4HJ8A 5IYBH 3EPIA 1Y1WG 4H02A 2D9UA 4A3JH 3VPCA 1IW7C 4PQXA 4Z9CB 1FJGH 3GIDA 3S2HB 1XTDA 3BQ0A 5M5YH 4C2MH 4JI2Q 3HFZB 4F4ZA 1ILQA 1I4RA 4R8NA 4R8UB 2E5LH 4MTDA 5I2XA 5D3IB 1PTOB 2PW5A 3N52A 5CMDA 3WWVA 4IAJA 2L1BA 1HJPA 1TS4A 2XGTA 4DF7A 2HCIA 3TN2A 3T5JA 2VZAA 1S03G 5ELOA 5KFYA 1FR3A 1GUOA 4A3BG 5KFCA 1EIFA 5T1IA 3C0FB 3HOVB 2NVQB 1Z47A 3KLRA 4OIKA 3T16A 4DR7L 1IOVA 4XYLB 3HB9A 1R4PB 3AB9A 4GLXA 4QWCA 2F0QA 2EOTA 2K03A 1QB5D 4B3MQ 1UE7A 5KFVA 3U9SA 3R2IA 3TINA 4YAKB 2QEXA 3U9TA 1Y1VA 3CPWA 4EGJA 3Q8SB 2WINB 1GHJA 4BY1H 4QW8A 3GTGA 5IT9L 2V58A 1H9JA 4P72A 3CCQA 4JV5H 2R92H 2G5DA 3H0GG 2EJMA 1Q1BA 2YS7A 1V4YA 1XNRH 1C30A 2PYKA 2NTSA 1NE3A 1D1IA 4EQNA 3NENA 3OTOH 4LF9Q 3PN1A 4RAZA 5CB4F 1HH2P 3K5MA 5LYJF 3OHBA 2VQEH 1OXSC 4GLAC 5IGCA 4YB8B 1N36L 2W7PA 3J7AK 1HCZA 3FMCA 1MJCA 1D2BA 5LOVF 4X62L 2YS6A 1YI2A 4YCVA 3GTQH 1CZGA 4MV9A 4L5TA 4L63B 2F3WA 1EY9A 1A62A 1EQTA 3H4DA 4JI3H 4APVA 4DV1Q 4LF5L 3K8AA 1L0WA 3EIVA 1UWVA 2W6PA 3M4OB 1TWAA 2PNRC 3DWQA 4ULLA 3DLLA 1JJGA 1UUPA 4U68A 2KEDA 4MIUA 2XTIA 2UXCH 5KT5A 4DR5H 2MO1A 4M9UA 4R4TA 1BCPD 4DUZQ 2E75C 2J6TA 2B2WC 3I73A 4DAYB 4LF8H 1HA5A 4MHEA 5M3MG 1HUNA 4RCNA 3MR3A 1EYZA 3LP8A 2R7ZA 2F0LA 2RVLA 2SNMA 4Y7NB 1O75A 2ENBA 1KEEA 5BN5A 4BBSB 2J4XA 4A3IB 3GTLB 4LUZA 3MFIA 5KFFA 4C3IB 2NU6B 2PPBC 4APMA 1AE3A 3M4PA 2D0PA 4K8JA 5FO9B 1LTBD 2B29A 1PK8A 2YYZA 1Z9FA 2EYMA 3CQZA 1TS5A 3GTKB 2C2DA 1A2UA 3CCLA 4TQSA 2NYZD 5JEAG 1UEAB 2L9HA 1WTVA 4LH6A 2F3VA 1XXGA 1NUCA 1ENAA 3BJYA 4DV6L 5BN3A 4Y52H 1MBYA 5C0XH 1S9FA 4DNTB 2AQ1B 5IGGA 3Q24A 1JMCA 1EY8A 4FNFA 4HN7A 2P5ZX 5ELEA 2JEAI 3GIMA 4P75A 5EKKA 4MV1A 1TWGB 4G57A 4OHJA 5GAGC 4K2LA 2FJ2A 3NPPA 4JOIA 3N41B 1E0BA 1WOCA 2AUKA 5A2QL 3ZJYC 4DUYQ 3VMMA 1EOVA 1B9NA 1BF4A 1UE1A 2NVTB 3A8JE 1FL0A 1QE6A 4RUCA 2KBNA 3NBHB 1VF5C 2RA4A 1Z6HA 3T1YH 4ME3A 5ELFA 4LWCA 4LFBQ 3ETHA 5ELCA 1PH3A 1PZID 1YHBA 1UC8A 1ET9A 2M9VA 1Y1VH 3CF5A 2HVQA 4ECSA 5L37A 3TSSA 2JSOA 3OW2A 2AU0A 1W6KA 2I07B 3GTGH 1SNMA 4EYHB 1KD1C 3ERSX 4A3GH 3T53B 2ZTDA 3T5KA 1E1OA 1VQ8A 1F2ZA 2WKDA 4H44C 4B3SL 5FLXL 5D1OB 3E9IA 5J22A 3KLWA 3MAQA 3MA2B 1L2FA 2XGQA 2LSSA 2FLPA 4MN3A 5LMUQ 1NNXA 4DAMA 4AYBA 3G6XA 3BYYB 5BR8H 2JEGA 1N32Q 1C48A 2FK2A 1WJJA 4YCWA 5IT9W 5C3EG 4DR6L 4DR1L 1Q12A 2UUBQ 3Q8QB 3HOZH 3P1HA 1CFMA 1YNJC 2OF1A 1CSQA 1RJQA 1D5XC 4BY7B 1CKMA 1QNKA 1Q90A 3P20A 4HSVA 4GNXB 5M5WB 2W7OA 2WKCA 4RG1A 3URYA 2GN5A 4B9WA 4K0KQ 4A2BA 3PIP3 1Y8NB 3CD6A 3ND9A 3MWEA 5EKIA 2J9GA 3GP7A 1VQGA 2WDTA 1JB7A 1WTWA 5M5YB 3PO2B 2AHOB 5C4XG 3D4RA 1M7JA 2DLNA 4WBNF 1TWAH 3VYRA 4JI0L 4YHHL 2CQYA 1H9MA 5C4JH 5IT9E 1M8AA 3OYYA 1UE5A 2VUMA 1F77A 2IPKD 4ZK9B 2N49A 4QWBA 3PCOB 1X3PA 2WE6A 2Z6KC 2OT2A 5GAEC 4IR1A 1L2ZA 3TP8A 4X64Q 3Q0AA 1T94A 4IPDA 1K83A 1VQIA 2R7FA 1CQFA 3M4QA 3X3MA 4E4TA 3RAXA 1B44D 1IYVA 4MV3A 4R1JA 4NLGA 3RLNA 4G7HC 5LXTF 1JXLA 3MXPA 4X62H 4BXXH 3CPFA 4BWGB 4LF6Q 4CKCA 2NZ1D 5FO7B 2UUCQ 3QZ8A 4JI6L 4E6IA 4JI8H 2JA9A 5IP7G 1VQ7A 4BBRG 1RTNA 1GSAA 4IZOA 4J9KA 1I4HA 2BCOA 5JJZA 3T1HQ 4JBMA 4FP5D 1TWHA 2QDLA 1KRSA 4LF5H 3V05A 1C8CA 5C8YF 3RTXA 3IN5A 1Q3LA 2UXDH 2R61A 1YZ6A 3RR5A 2SNSA 1YNND 5E1FA 2QK4A 4XX0B 3S17H 3KF8B 3BZKA 4X3TA 2V1CC 2JA8G 3I4NH 1B33N 1WTRA 5K36H 3OOCA 3CCVA 3A56A 1CE8A 2IP4A 4RB2C 2QKIC 1ENCA 4YQWA 1JOQA 2L11A 4DV3H 1DIKA 3NQIA 1RTOA 1E2ZA 4R4IA 3SHLA 3DEOA 3I8ZA 1G6PA 2PZTA 2W6MA 2NVYA 1BBUA 4FYDA 3OSPA 5IYDG 3I4MB 1GUSA 4RAUC 3C1EA 2RDHA 1W93A 4HSPA 4Q0FA 3J81i 2DPJA 3L0OA 1BUVT 4TV8F 1H9SB 3S14B 5KFZA 5A2QW 4JYAH 1SFOH 5IYZF 3LNNA 2LXKA 4KD4A 2OTLA 4DV6H 4UCTA 4IHJF 1LTLA 2JA7G 1B50A 3GTMA 1B70B 1M1KC 4JV2A 2WIIB 3TIIA 2JA6H 1NJIC 1O7YA 5IT9c 1Q86C 1SCUB 5T14A 2GLTA 4IPHA 2ZDGA 3DM3A 1PRTC 5FLMH 2ZM6L 1CSPA 1RKNA 1HRJA 5C5MA 1QVCA 4LNQA 4F4YA 3NTKA 4LF4L 1Q46A 4P2CB 5KFTA 1TWFH 2Q2HA 1S0NA 5FLXW 4DL2A 1S40A 2RKSA 3PO3G 1LTGD 2RGVA 5KNBA 4LF7L 3HBLA 2B63G 3CCEA 2PCFB 4NP5A 1K9MC 2B2YC 3TBIB 1IYJB 1GHKA 4HMIA 1TS2A 2VR1A 3NE5B 2WV6D 2RGRA 4UHVA 2UUAQ 3IAYA 3C2PA 1HTLD 4QIWA 1W6JA 1YNNC 3RFCA 2JA5A 2XGPA 3PSIA 1PLFA 3E6ZX 1JWMD 4CGYB 5KFUA 4B3SH 1X9NA 2VUMH 2CHBD 3K7AH 4ME6A 5C3WA 2WAQE 1C4QA 2M2LA 4N9PA 2UVVA 1SE8A 3VR4A 2KHIA 5FLXE 4PWQA 4RUAA 4Q5VA 1JJCB 1K0SA 4GOPA 1I6VC 2BA0A 1J6QA 3FKIG 5CR3A 1S68A 5K2MA 5LA6F 5IWAH 4DR1H 1BCPF 4DV7Q 3RIZA 3WOEA 1ICFB 1DOLA 1VQOA 2HHHQ 1KL9A 1A3VA 1DV1A 2J0TD 3MFYA 4B3RH 1Y1VB 4A3LH 3UDIA 3D31A 1JC7A 3K5HA 3FDTA 2F0GA 2I5HA 3HEJA 2Q2UA 3FEWX 4L1KA 5JH7F 3CCRA 1D6EC 1YVCA 2VNUD 3MWYW 1HFNA 5C44B 4A3GB 2ZDHA 4DV2Q 2PBZA 1TWHH 1AZQA 1LLRD 2MQHA 1MIUA 5IP9G 2BE5C 2OLSA 1WI5A 4JBKA 3QFFA 3A5UA 1GO3E 5M3FB 4C3JH 4YHHH 1SNPA 5J39A 2NUAB 3GIKA 3K5LA 1I50A 1E7ZA 2VA3A 1Y8OB 2XWJB 3J80L 3TQ1A 3F2DA 2ATLA 2VB2X 3I70A 4YIJA 4DR6Q 1KDAA 2QDBA 1KTKA 1BR9A 2JEJA 1JOOA 3HKZE 4MTNA 4YWKA 2DY8A 2XWBB 1BKBA 4C3HH 2AWNA 1HNZL 4A93G 3OWEB 3PF4A 4OX9Q 3PVXA 2DJGC 4CDEC 3N43B 3PR4A 4IUNA 3HOXB 3FHWA 4WJWA 1GUWA 2NVYH 1M0TA 2ASLA 1GUTA 4NXNQ 1X65A 4OWTB 4RCOA 4UPAA 4PG3A 1VQ6A 5D14A 4ME5A 3C3LA 2EJFC 1TWAB 1VCIA 4EGQA 1I3QB 5C4JB 3HKZG 4KLKA 3BYTB 1TQOA 1K8AC 1BXRA 4XIGS 1SDFA 2V4QA 1PYBA 1HNXH 2YTYA 3KHGA 3GTMH 4ED6A 4QY7A 2WP8J 3HOYG 3PUZA 1ET6A 4DAPA 2CWPA 5KEEA 4IFDG 2R7ZB 4JI1L 2EJGC 4DK3C 4EQPA 4GKJL 1SMYD 4ECWA 1BBXC 2NTTA 1MSGA 1K73C 1VQPA 2IT1A 3RJ0A 3CW2C 2ASDA 2CZGA 4JI6Q 5IY0A 3DUZA 4OXPA 5KT7A 3NK9A 2I46A 1FJGL 1WTHA 2B2UA 2R7DA 4O2BF 1JIHA 3RF2A 1CZWA 3CQZB 1GGOA 3R23A 4YAJB 1I94L 4MV4A 1Q82C 4KJNA 4RGOS 1RHPA 4QF4A 3W5OA 4HCEA 4NB3A 1XMOL 3IL8A 2BDNA 4AIMA 1IYUA 4QJFA 2F0PA 3HOWH 3HOUB 4H0LC 2XCAA 3I4NB 4V0BA 1PX2A 3HOVG 2NWGA 1DM0B 2F0IA 4RMFA 3OHAA 3RB4A 3TQYA 2SOBA 2JA5H 1K28A 2AQ4A 3TDQA 2FE3A 1E4FT 1PXUA 5DM73 4JI7H 5KFJA 4DV0H 4IPCA 1V9PA 3M9NB 3N6XA 2ZXPA 3RB3A 2YCHA 1G51A 2MNAA 1IBLQ 4JV5L 4JVZA 2JK8A 1O80A 4IFDJ 4C2MA 5AJ3L 1XNRL 2EVBA 3K5IA 1LT3D 3V2TA 2EYJA 2YTVA 4UDUC 2KHSA 1B7YB 4IOCA 4A3CG 5F9LA 3UFXB 1K1QA 4YY3Q 4XYMB 1U4RA 2DN8A 2MP1A 1AUXA 4G4KA 4PNYA 1RJTA 4LFCL 3M7NA 1L1OA 2L12A 4PZ7A 1KXLA 1NSNS 1DCZA 2A6HD 1HXYD 3WO0A 4QWAA 1X55A 2M05A 4CJ2C 1VQDA 3MXNA 4YCUA 3ONAB 2A8VA 3K58A 2LY7A 4GN3B 1WVLA 1PH4A 3GQCA 1EFID 4P71A 4XT3B 4AYBB 2CH4W 2BA1A 3BVGA 4OIJA 2R85A 2R6GA 2YTXA 3H0GA 1I50H 1SMYC 1XNQL 2K5HA 1KDCA 4JI3L 1JCKB 3PUXA 1NR2A 2DNCA 4EQOA 1Q7YC 1JKJB 3A7AB 2RSNA 4MZ9A 5F9NA 4FBTA 3B6YA 4ED3A 4KKSA 4IALA 4POGA 2RQXA 1W3SA 1K0RA 5C3XA 4ZOLF 1IW7D 4LF7Q 2ALZA 2Z4IA 1J5EQ 5KFLA 3K0YA 1KLGD 4LF8L 1PDQA 3Q6SA 3J80W 4IFDI 3P75A 5FJ8H 1IBMQ 3NWTA 1SYFA 5JOBA 1K8GA 2F0HA 5G3LF 2WAQB 1ULZA 3DWPA 1EQRA 2BOSA 4BBSG 1U5KA 2ZTEA 3FP9A 2VUMB 1MD2D 2QEJC 3K7AB 1SR3A 1STAA 4C3IG 2ZJPA 4QW9A 3NGDA 1YITA 4RZRA 4TV9F 1K83B 3RLFA 2UXBH 5C4HA 5LL6X 4EX5A 1GOZA 5GQOA 5EQ0A 3MFGA 3N6RA 3CC7A 1PYSB 3DM1A 4G7ZC 4I7AA 3KLSX 3EPGA 3GO5A 2MGSA 4K5VA 1HNZH 4IQZA 1EZ8A 4EEYA 5LL6b 1CQIB 3F8TA 3H6MA 5JPNC 3RZDB 2HIVA 2JJQA 3HG9A 4KV6A 4FXGC 5H80A 5DQGA 1R9TA 4ABNA 4F4XA 3A7LA 2YU9H 4KK7A 4ZYSA 3VA5A 4JV0A 4ECYA 1IHZA 1JJ2A 3S2DH 2EYFA 4O2AF 4ALPA 4RHRA 2UU9L 2NVXA 3GIIA 2R8JA 2Q8RE 4GLVB 4A4IA 4U673 4KY6A 2EYOA 2OQ0A 3VDYA 4DGZA 2LFNA 3PW0A 4LFAQ 4IUPA 1Y1WH 1M4VA 2BR0A 1RL2A 1PFNA 1L0XB 1PYWD 4ILWA 4GKJH 3MEHA 5LL6S 4CJ1B 1BJTA 4JI2H 1ASZA 4KY5A 1I5FA 5KG3A 1A8VA 1STGA 4DNRB 1U4LA 3O13A 4C56C 3M4YA 1SYEA 2Q2IA 1I94H 5CORA 4YP3A 5LP6F 3PW2A 4A3EG 1SSOA 2AUJD 3MZ5A 1XMOH 2VY3A 5BR8L 3SI8A 1TS3A 2C2RA 4DK1A 4GZYC 4DV4Q 4B3MH 3GTMB 1D5ZC 3U4ZA 4UP9A 1XPOA 4O3PA 4J0MA 3OMGA 2V4DA 1S3OA 4BY7G 3KFUA 2VQFL 4TKOB 4JI1Q 2DNEA 1E4GT 5C6AA 3EQLC 4GKKQ 1DD2A 3KJPA 3OUUA 2WTFA 2K28A 2ICEC 1TXYA 4PDBA 4KKUA 5EWEA 3H0GH 3TRZA 1HZBA 2NU8B 3E5NA 3FPUB 1DGSA 4LJZC 3PO2G 5L1LA 4IJLA 2W57A 2KECA 4LF9H 1SRUA 3J80c 2J6SA 2F0JA 1SE3A 3BJUA 2E5LQ 1EQVA 1ENFA 5GADC 3A55A 3NEMA 1N34L 1B6SA 1QZHA 1HQRD 2ATWA 2OTJA 4HIDA 4A3DG 1EEFD 2PZUA 4ZUIA 4HNVA 4LFCH 1I4PA 1S0MA 4HQ6A 1U4MA 1VBGA 4QIWB 4LW1A 4EGVA 3BS1A 2JA5B 4JI4Q 5E4WC 5DGBA 2B2VA 2G9DA 4TQRA 2HCCA 5KFEA 1QOHA 2R8HA 1UE6A 1RJRA 1PMRA 4DV1H 4J8QA 4JI8L 1N33L 3AQQA 1JB3A 1OTCA 4GOPB 5EDWA 1VQAA 1XNQH 3G8CA 2OQKA 4A75A 4MTEA 2YW2A 2NN6G 3UDGA 1PFMA 1SAPA 2UXDL 4DKAC 2KA7A 3OHXC 2F0KA 3BDLA 4O3QA 1VMPA 4HNTA 2VA2A 5CC4A 1Z2OX 5M3MH
chains in the Genus database with same CATH topology
3OTOQ 4BXXH 3CPFA 2ZJQA 4LF6Q 2UUCQ 4HIOA 4JI6L 2JA9A 5IP7G 1VQ7A 4BBRG 2VQEQ 1SROA 5EAYA 3T1HQ 1PA6A 4JBMA 3HKSA 3CCJA 1R9TH 1KRSA 1P8LA 4FDBA 2KENA 1X3FA 4LFAL 4DV3L 1YZ6A 3RR5A 2F4VL 1NMFA 1YJ9A 1BBWA 2D0OA 4J15A 3I4MG 2QA4A 2NVXH 2N3SA 2PQAB 3KF8B 3BZKA 1M90C 2V1CC 2JA8G 3I4NH 4JI3Q 3S17H 2KCMA 4OWWB 1VQ4A 1KQSA 4BA1I 3S15H 3CCVA 2NVTH 2NZOA 3K80C 4O0AA 3S2HH 4JYAL 4BBSG 2A19A 4LFBL 2UXCQ 1YHAA 5M5XH 4DR2L 1NY4A 4DR5Q 2PNHA 2UXBQ 2I5LX 4R4IA 4LF8Q 1G6PA 1IZ6A 2K5NA 1BBUA 4DV4L 2JQOA 4TQUS 5IYDG 1YIJA 2GVAA 1PH7A 2K4KA 4KHZA 4HIMA 3HOVH 3J81i 1HNZQ 4UP7A 3L0OA 2OWOA 2NVQH 2RF4A 5J3BA 1XMQQ 1SFOH 4HJ5A 4GKKL 1LUZA 2LXKA 4PZ8A 4OWXB 2OTLA 2AMCB 5FLXc 5LMUL 3UDXA 1YBYA 2KHJA 4WJ4A 1LTLA 2JA7G 4B3TQ 4A3EH 1N32L 4JBWA 1B70B 1M1KC 2RHSB 4YWMA 3CXCA 4JOIC 3PUWA 3F2CA 4DNIA 2JA6H 3J81c 2UUBL 1NJIC 2FXQA 5IT9c 3KF6A 1Q86C 3D0FA 2E5LL 2WB1E 4R4OA 4A3BH 1JE5A 4IPHA 3DM3A 2Q2TA 3I7FA 4IOAA 2N78A 5FLMH 2ZM6L 1CSPA 4L5RC 2QGQA 2D62A 5M5WH 1CKNB 1QVCA 4LNQA 4LF4L 2L15A 1Q46A 1V43A 1TWFH 2Q2HA 1IXRA 1VQ5A 3PIPA 3HOWG 2AWOA 3ULJA 1VQMA 5IYBG 1P16A 3S1QH 1CUKA 4GKJQ 1A63A 4JI4L 1PHJA 1S40A 4A3JG 3PO3G 1HNWQ 3PO2H 3CP0A 3KDFA 5C3EH 3KJOA 4LF7L 2B63G 4GNXA 1O7IA 3CCEA 2WB1G 1K9MC 1U0LA 2NN6I 1XJVA 1FJGQ 1IYJB 1XPUA 2KCTA 1VQEA 2MO0A 3PGZA 5IWAL 3T1YQ 4X64L 1I94Q 2UUAQ 3UE1A 4JI7Q 3AEVA 3AFQA 1PH8A 4A3DH 4DV0Q 2EIFA 3M9BA 1XMOQ 1IL2A 3PSIA 1EUJA 1Y1VG 4A3KG 1VQKA 4JI5Q 1G291 4B3RL 3TREA 4AH6A 1X9NA 2VUMH 3K7AH 4DR4L 2WAQE 3F2BA 5C44G 1SE8A 3OTOL 5C4XH 2KHIA 4A3MH 2CCZA 4A3GG 4LF6L 1JJCB 4DUZL 2VW9A 1QVGA 2H5XA 2UUCL 2JE6I 4GOPA 2BA0A 3FKIG 1J6QA 1V1QA 3GDEA 4X66L 3PV0A 2VQEL 4KHPQ 4QL5A 1OXVA 3T1HL 5M3FG 1FVIA 1SMXA 3I56A 4DV7Q 1VQJA 5C0XJ 2CWAA 1VQOA 2HHHQ 4BY1G 1KL9A 1NMGA 5JJKA 2N8NA 4MNOA 5BR8Q 1FGUA 1WYDA 4A3FH 1Q81C 3H3VI 2R92G 4A3LH 3UDIA 3D31A 3JAMc 5IYCG 1L1OB 4JG2A 2I5HA 2PI2A 4P74A 4A3IH 1X54A 2Q2UA 4JV5Q 3U50C 3CCRA 3TS0A 1PH6A 1YVCA 4C3IH 1A0IA 2VNUD 1C9OA 5AJ3Q 4DV2Q 1TWHH 1XNRQ 4DR7Q 3UDFA 3MXNB 3EN2A 1KRTA 5IP9G 2MQHA 1MIUA 3M3YH 3GTKH 1WI5A 5IP7H 4JBKA 1YEZA 3A5UA 1GO3E 3HOXG 4C3JH 3CMEA 1S72A 3J81j 2UXCL 3TS2A 3G71A 4DR5L 3A0JA 4LFCQ 1H95A 1E7ZA 3UE0A 2Y0SE 3F2DA 2Z0SA 5ELNA 4NPSA 2PQAA 2I5MX 4DR6Q 1X56A 2IX0A 3U4VA 1VQLA 3HKZE 4MTNA 3I4MH 2NZHA 2VS1A 2WFWA 4YWKA 4X6AH 2HIXA 4YWLA 5LMNL 1YJWA 2EQSA 1TWGH 1IBKQ 5FJ8G 1BKBA 4C3HH 2AWNA 1X3EA 1HNZL 2K52A 1HR0W 2ASBA 4A93G 3H3VH 3PF4A 4DUYL 4OX9Q 1XMQL 1HNXL 4EQ5A 1XNQQ 2HT1A 3TEHB 3S14H 3FHWA 2NVYH 3W1BA 3CAMA 4NXNQ 1X65A 4OWTB 2R7ZG 4B3TL 3K0XA 3EBEA 4UPAA 1VQCA 2Y0SG 4PG3A 1N36Q 1EYGA 1VQ6A 4BXXG 4DV5Q 1VCIA 1VQBA 3K7UC 1HZ9A 1KIXA 5GROA 3RNUA 4X62Q 3HKZG 4KLKA 4X65Q 5IYDH 3J7ZC 1K8AC 4UY8C 4IO9A 2BH2A 4XIGS 3S1RH 4AQYQ 1PYBA 1Q1EA 1N8RC 2R93H 2YTYA 1YNXA 3GTMH 4QY7A 4L5SA 1PH5A 4LF5Q 2WP8J 1VQNA 3HOYG 1LM0A 3PUZA 2IHFA 4NXMQ 2CWPA 2A1AA 4IFDG 2MFIA 4JI1L 4XTCS 2JA7H 4DK3C 4GKJL 2DGYA 3HOUG 3H15A 3I4NG 1HNWL 4HIKA 1K73C 1VQPA 2IT1A 3CW2C 4PMWA 4DR3L 4JI6Q 5IY0A 5JJLA 4LUOA 4OXPA 1FJGL 1CKNA 2R7DA 2ALYB 4KI0A 1KC8C 1I94L 1C7YA 3T1YL 1Q82C 2UUAL 3E0EA 5C0XG 3W5OA 4L5QA 4JI7L 1QVFA 4NB3A 3I2ZA 4DV0L 1XMOL 1B8AA 4DV3Q 1OXUA 4UP8A 1HR0Q 2F4VQ 4BY7H 2LXJA 4AIMA 1EIYB 3ULPA 1VQFA 3I55A 4K0KL 4QJFA 3HOWH 4HJ8A 5IYBH 1XPRA 3S16H 1Y1WG 4H02A 4WJ3M 3HOVG 2RHQB 4A3JH 1EQQA 3PO3H 4AYBE 5GAHC 4RMFA 5JJIA 2B63H 1QUQB 4O2DA 1XTDA 1E1TA 3TQYA 2JA5H 5M5YH 2BH8A 4JI2Q 3HFZB 4C2MH 4DV7L 1SLJA 2HHHL 4DV6Q 3CCMA 4IPCA 1V9PA 2UU9Q 4GS3A 3WWVA 1HJPA 1X6OA 3S24A 2XGTA 1G51A 4QGUA 2VZAA 5ELOA 2E2IH 2RCNA 2MNAA 1IBLQ 4JV5L 2ID0A 4A3BG 1EIFA 1Q8KA 2JK8A 3J7A5 3GD7A 4IFDJ 5AJ3L 2VL6A 1Z47A 5FLMG 4AYBG 5C44H 4DV2L 1XNRL 4DR7L 4GNXC 5JEAJ 4GLXA 3PF5A 4JBJA 2YTVA 4A3CG 3FKIH 1B7YB 1UE7A 5DLQE 4IOCA 4B3MQ 4YY3Q 5M3FH 2GVBA 3JAMi 2CKZB 4R4QA 2QEXA 4LFCL 3CPWA 3M7NA 4POFA 1L1OA 4PZ7A 2E2HH 4BY1H 1KXLA 3BZCA 4P72A 3CCQA 2R92H 1X55A 3H0GG 1Q1BA 5IYCH 1VQDA 2YV5A 4YCUA 2A8VA 1PVOA 1PH4A 4GN3B 3STBD 2K14A 1IBKL 3AFPA 3GTOH 4P71A 4JCVE 3W1GA 1NE3A 1WCMG 2BA1A 3HOZG 4GOPC 3NENA 1WFQA 2R6GA 2YTXA 4OX9L 1I50H 4LF9Q 2WAQG 1SN8A 2ES2A 1XNQL 2K5HA 3Q8DA 3HOXH 1MKHA 4JI3L 1HH2P 1OXTA 3PUXA 4NXNL 2Z6KA 2ZTCA 1Q7YC 2VQFQ 2VUMG 4MZ9A 1OXSC 4GLAC 4B3SQ 2CQOA 3B6YA 4LUVA 1N36L 4POGA 4BBRH 4BA2I 4A3MG 1W3SA 1MJCA 4DV5L 1K0RA 3E9HA 3CCSA 5H1SE 4LF7Q 4X62L 1I3QH 1YI2A 2JEBI 4JC0A 4YCVA 1J5EQ 3ULLA 3GTQH 2UXBL 1ASYA 1I6HH 1LYLA 4GN4B 4IJHA 4L5TA 4LF8L 3ICEA 3NELA 4IFDI 4AQYL 5FJ8H 1PH1A 4DR1Q 1IBMQ 1QZGA 1A62A 1K8GA 4APVA 4DV1Q 4LF5L 1EQRA 3K8AA 1L0WA 5LMNW 4NXML 1N34Q 2JA8H 3EIVA 2ZTEA 1U5KA 1UWVA 2CFMA 3FP9A 4A3LG 1D8LA 3DLLA 2R7ZH 1JJGA 1SR3A 2ZJPA 2XTIA 2MO1A 1YITA 4R4TA 1KHIA 3RLFA 3M85A 4DUZQ 5C0XI 4DAYB 4X66Q 3K81C 3RLNA 3KOJA 5M3MG 4EX5A 5GQOA 2K50A 2PMZE 3CQZH 3CC7A 1PYSB 4JI0Q 4YHHQ 1PH2A 1EWIA 3G6EA 4JI8Q 3GO5A 1N33Q 2OCEA 2ZJRA 3HOYH 1HR0L 4GN5A 1K3RA 1RIPA 4LUZA 1Y14B 3F8TA 1AE3A 3IRBA 5HGQA 3M4PA 2D0PA 3HOUH 3GTJH 2HIVA 2B29A 3BU2A 1D7QA 2JJQA 1Z9FA 2YYZA 3RZOH 2UXDQ 3CCLA 1GM5A 5JEAG 2YU9H 4JI2L 5K36G 3S1MH 1HZAA 3L7ZC 5E7NA 3RN2A 1JJ2A 3S2DH 4DV6L 4OO1G 4Y52H 1X3GA 1GVPA 4ALPA 2UU9L 3SGIA 2I0QA 3STBC 1PV4A 1JMCA 1PFSA 4GLVB 4A4IA 1AE2A 2JEAI 2HQLA 1IBLL 4P75A 2OQ0A 3VDYA 1NTGA 1YJNA 1QUQA 3LGJA 5LMNQ 4LFAQ 4R4CA 5GAGC 1Y1WH 1AH9A 1RL2A 4JOIA 4JI5L 2R93G 1WOCA 3ZJYC 4DUYQ 1EOVA 1HNXQ 1ASZA 4B3ML 2K5VA 1CKOA 2IHEA 4YY3L 1I5FA 3L2PA 1A8VA 1UE1A 1FL0A 4KHPL 2Q2IA 2KBNA 3NBHB 4JYAQ 2E2JH 4ME3A 4LFBQ 4LWCA 4DR2Q 4A3EG 2IX1A 1PH3A 4QIWE 2VY3A 1YHBA 2F3IA 5BR8L 3GTPH 2JA6G 3I4OA 1C0AA 4P73A 1Y1VH 3CF5A 4DV4Q 4A3KH 3U4ZA 4UP9A 3OW2A 1XPOA 2B3GA 3JC66 4LF9L 4A3CH 3GTGH 3PUVA 2C35B 1S3OA 4BY7G 1KD1C 3ERSX 4A3GH 2ZTDA 1W2BA 1E1OA 3KF6B 3J80i 1TWCH 2VQFL 4JI1Q 1VQ8A 4B3SL 3PIOA 3KFUA 3E9IA 4GKKQ 3KLWA 3KJPA 4HJ7A 3CMAA 1L2FA 1KAWA 1T9HA 2LSSA 3AYHB 3MEFA 5LMUQ 1EFWA 1TXYA 4DAMA 4DR3Q 3H0GH 3TRZA 1HZBA 1N32Q 1OXXK 1J5EL 2JA5G 3S1NH 1DGSA 4TVAB 1WJJA 3PO2G 4YCWA 4IJLA 2DUDA 3A74A 1E24A 5C3EG 3G4SA 4DR6L 4DR1L 1Q12A 2F52A 1SRUA 1WCMH 2PI2E 3J80c 1IBML 2UUBQ 3HOZH 4QQBX 3BJUA 2E5LQ 4DV1L 5HY6A 5GADC 1CSQA 3KDFB 3NEMA 1N34L 1CKMA 1E3PA 1QZHA 1BVSA 2ZM6Q 4GNXB 4HJ9A 3M4OH 4RG1A 2ATWA 1UEBA 1L1OC 2GN5A 4HIDA 4K0KQ 2OTJA 5IP9H 3RLOA 4A3DG 3CD6A 1VS0A 3G48A 4A76A 4LF4Q 1VQ9A 1VQGA 4DK6C 1JB7A 1K83H 2EXDA 4LW1A 5IE8A 1JT8A 1NBWA 3F1ZA 4JI4Q 2AHOB 5C4XG 2AKWB 1TWAH 4PZ6A 1UE6A 1VQHA 4JI0L 4YHHL 4X65L 5C4JH 3OYYA 1UE5A 3CC2A 4JI8L 4Y7NH 3AQQA 1N33L 3A5ZB 1OTCA 1PH9A 2N49A 2E8GA 3PCOB 4BBSH 2Z6KC 5GAEC 4GOPB 5IWAQ 4A93H 2IY5B 1VQAA 4X64Q 3GTLH 4IPDA 4OONA 1VQIA 2R7FA 3CCUA 3M4QA 2OQKA 1GKHA 4A75A 3U58A 4A3FG 2K75A 2NN6G 3UDGA 3CC4A 3ER0A 1GD7A 3RZDH 4DPGA 3PUYA 1YHQA 4A3IG 4OO1I 4B3RQ 2UXDL 1HZCA 4DKAC 3RN5A 4R1JA 1MJEA 4HJAA 4DR4Q 3KYHC 1E22A 4IPGA 1N9WA 5M3MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO Q;  4BXX H;  3CPF A;  2ZJQ A;  4LF6 Q;  2UUC Q;  4HIO A;  4JI6 L;  2JA9 A;  5IP7 G;  1VQ7 A;  4BBR G;  2VQE Q;  1SRO A;  5EAY A;  3T1H Q;  1PA6 A;  4JBM A;  3HKS A;  3CCJ A;  1R9T H;  1KRS A;  1P8L A;  4FDB A;  2KEN A;  1X3F A;  4LFA L;  4DV3 L;  1YZ6 A;  3RR5 A;  2F4V L;  1NMF A;  1YJ9 A;  1BBW A;  2D0O A;  4J15 A;  3I4M G;  2QA4 A;  2NVX H;  2N3S A;  2PQA B;  3KF8 B;  3BZK A;  1M90 C;  2V1C C;  2JA8 G;  3I4N H;  4JI3 Q;  3S17 H;  2KCM A;  4OWW B;  1VQ4 A;  1KQS A;  4BA1 I;  3S15 H;  3CCV A;  2NVT H;  2NZO A;  3K80 C;  4O0A A;  3S2H H;  4JYA L;  4BBS G;  2A19 A;  4LFB L;  2UXC Q;  1YHA A;  5M5X H;  4DR2 L;  1NY4 A;  4DR5 Q;  2PNH A;  2UXB Q;  2I5L X;  4R4I A;  4LF8 Q;  1G6P A;  1IZ6 A;  2K5N A;  1BBU A;  4DV4 L;  2JQO A;  4TQU S;  5IYD G;  1YIJ A;  2GVA A;  1PH7 A;  2K4K A;  4KHZ A;  4HIM A;  3HOV H;  3J81 i;  1HNZ Q;  4UP7 A;  3L0O A;  2OWO A;  2NVQ H;  2RF4 A;  5J3B A;  1XMQ Q;  1SFO H;  4HJ5 A;  4GKK L;  1LUZ A;  2LXK A;  4PZ8 A;  4OWX B;  2OTL A;  2AMC B;  5FLX c;  5LMU L;  3UDX A;  1YBY A;  2KHJ A;  4WJ4 A;  1LTL A;  2JA7 G;  4B3T Q;  4A3E H;  1N32 L;  4JBW A;  1B70 B;  1M1K C;  2RHS B;  4YWM A;  3CXC A;  4JOI C;  3PUW A;  3F2C A;  4DNI A;  2JA6 H;  3J81 c;  2UUB L;  1NJI C;  2FXQ A;  5IT9 c;  3KF6 A;  1Q86 C;  3D0F A;  2E5L L;  2WB1 E;  4R4O A;  4A3B H;  1JE5 A;  4IPH A;  3DM3 A;  2Q2T A;  3I7F A;  4IOA A;  2N78 A;  5FLM H;  2ZM6 L;  1CSP A;  4L5R C;  2QGQ A;  2D62 A;  5M5W H;  1CKN B;  1QVC A;  4LNQ A;  4LF4 L;  2L15 A;  1Q46 A;  1V43 A;  1TWF H;  2Q2H A;  1IXR A;  1VQ5 A;  3PIP A;  3HOW G;  2AWO A;  3ULJ A;  1VQM A;  5IYB G;  1P16 A;  3S1Q H;  1CUK A;  4GKJ Q;  1A63 A;  4JI4 L;  1PHJ A;  1S40 A;  4A3J G;  3PO3 G;  1HNW Q;  3PO2 H;  3CP0 A;  3KDF A;  5C3E H;  3KJO A;  4LF7 L;  2B63 G;  4GNX A;  1O7I A;  3CCE A;  2WB1 G;  1K9M C;  1U0L A;  2NN6 I;  1XJV A;  1FJG Q;  1IYJ B;  1XPU A;  2KCT A;  1VQE A;  2MO0 A;  3PGZ A;  5IWA L;  3T1Y Q;  4X64 L;  1I94 Q;  2UUA Q;  3UE1 A;  4JI7 Q;  3AEV A;  3AFQ A;  1PH8 A;  4A3D H;  4DV0 Q;  2EIF A;  3M9B A;  1XMO Q;  1IL2 A;  3PSI A;  1EUJ A;  1Y1V G;  4A3K G;  1VQK A;  4JI5 Q;  1G29 1;  4B3R L;  3TRE A;  4AH6 A;  1X9N A;  2VUM H;  3K7A H;  4DR4 L;  2WAQ E;  3F2B A;  5C44 G;  1SE8 A;  3OTO L;  5C4X H;  2KHI A;  4A3M H;  2CCZ A;  4A3G G;  4LF6 L;  1JJC B;  4DUZ L;  2VW9 A;  1QVG A;  2H5X A;  2UUC L;  2JE6 I;  4GOP A;  2BA0 A;  3FKI G;  1J6Q A;  1V1Q A;  3GDE A;  4X66 L;  3PV0 A;  2VQE L;  4KHP Q;  4QL5 A;  1OXV A;  3T1H L;  5M3F G;  1FVI A;  1SMX A;  3I56 A;  4DV7 Q;  1VQJ A;  5C0X J;  2CWA A;  1VQO A;  2HHH Q;  4BY1 G;  1KL9 A;  1NMG A;  5JJK A;  2N8N A;  4MNO A;  5BR8 Q;  1FGU A;  1WYD A;  4A3F H;  1Q81 C;  3H3V I;  2R92 G;  4A3L H;  3UDI A;  3D31 A;  3JAM c;  5IYC G;  1L1O B;  4JG2 A;  2I5H A;  2PI2 A;  4P74 A;  4A3I H;  1X54 A;  2Q2U A;  4JV5 Q;  3U50 C;  3CCR A;  3TS0 A;  1PH6 A;  1YVC A;  4C3I H;  1A0I A;  2VNU D;  1C9O A;  5AJ3 Q;  4DV2 Q;  1TWH H;  1XNR Q;  4DR7 Q;  3UDF A;  3MXN B;  3EN2 A;  1KRT A;  5IP9 G;  2MQH A;  1MIU A;  3M3Y H;  3GTK H;  1WI5 A;  5IP7 H;  4JBK A;  1YEZ A;  3A5U A;  1GO3 E;  3HOX G;  4C3J H;  3CME A;  1S72 A;  3J81 j;  2UXC L;  3TS2 A;  3G71 A;  4DR5 L;  3A0J A;  4LFC Q;  1H95 A;  1E7Z A;  3UE0 A;  2Y0S E;  3F2D A;  2Z0S A;  5ELN A;  4NPS A;  2PQA A;  2I5M X;  4DR6 Q;  1X56 A;  2IX0 A;  3U4V A;  1VQL A;  3HKZ E;  4MTN A;  3I4M H;  2NZH A;  2VS1 A;  2WFW A;  4YWK A;  4X6A H;  2HIX A;  4YWL A;  5LMN L;  1YJW A;  2EQS A;  1TWG H;  1IBK Q;  5FJ8 G;  1BKB A;  4C3H H;  2AWN A;  1X3E A;  1HNZ L;  2K52 A;  1HR0 W;  2ASB A;  4A93 G;  3H3V H;  3PF4 A;  4DUY L;  4OX9 Q;  1XMQ L;  1HNX L;  4EQ5 A;  1XNQ Q;  2HT1 A;  3TEH B;  3S14 H;  3FHW A;  2NVY H;  3W1B A;  3CAM A;  4NXN Q;  1X65 A;  4OWT B;  2R7Z G;  4B3T L;  3K0X A;  3EBE A;  4UPA A;  1VQC A;  2Y0S G;  4PG3 A;  1N36 Q;  1EYG A;  1VQ6 A;  4BXX G;  4DV5 Q;  1VCI A;  1VQB A;  3K7U C;  1HZ9 A;  1KIX A;  5GRO A;  3RNU A;  4X62 Q;  3HKZ G;  4KLK A;  4X65 Q;  5IYD H;  3J7Z C;  1K8A C;  4UY8 C;  4IO9 A;  2BH2 A;  4XIG S;  3S1R H;  4AQY Q;  1PYB A;  1Q1E A;  1N8R C;  2R93 H;  2YTY A;  1YNX A;  3GTM H;  4QY7 A;  4L5S A;  1PH5 A;  4LF5 Q;  2WP8 J;  1VQN A;  3HOY G;  1LM0 A;  3PUZ A;  2IHF A;  4NXM Q;  2CWP A;  2A1A A;  4IFD G;  2MFI A;  4JI1 L;  4XTC S;  2JA7 H;  4DK3 C;  4GKJ L;  2DGY A;  3HOU G;  3H15 A;  3I4N G;  1HNW L;  4HIK A;  1K73 C;  1VQP A;  2IT1 A;  3CW2 C;  4PMW A;  4DR3 L;  4JI6 Q;  5IY0 A;  5JJL A;  4LUO A;  4OXP A;  1FJG L;  1CKN A;  2R7D A;  2ALY B;  4KI0 A;  1KC8 C;  1I94 L;  1C7Y A;  3T1Y L;  1Q82 C;  2UUA L;  3E0E A;  5C0X G;  3W5O A;  4L5Q A;  4JI7 L;  1QVF A;  4NB3 A;  3I2Z A;  4DV0 L;  1XMO L;  1B8A A;  4DV3 Q;  1OXU A;  4UP8 A;  1HR0 Q;  2F4V Q;  4BY7 H;  2LXJ A;  4AIM A;  1EIY B;  3ULP A;  1VQF A;  3I55 A;  4K0K L;  4QJF A;  3HOW H;  4HJ8 A;  5IYB H;  1XPR A;  3S16 H;  1Y1W G;  4H02 A;  4WJ3 M;  3HOV G;  2RHQ B;  4A3J H;  1EQQ A;  3PO3 H;  4AYB E;  5GAH C;  4RMF A;  5JJI A;  2B63 H;  1QUQ B;  4O2D A;  1XTD A;  1E1T A;  3TQY A;  2JA5 H;  5M5Y H;  2BH8 A;  4JI2 Q;  3HFZ B;  4C2M H;  4DV7 L;  1SLJ A;  2HHH L;  4DV6 Q;  3CCM A;  4IPC A;  1V9P A;  2UU9 Q;  4GS3 A;  3WWV A;  1HJP A;  1X6O A;  3S24 A;  2XGT A;  1G51 A;  4QGU A;  2VZA A;  5ELO A;  2E2I H;  2RCN A;  2MNA A;  1IBL Q;  4JV5 L;  2ID0 A;  4A3B G;  1EIF A;  1Q8K A;  2JK8 A;  3J7A 5;  3GD7 A;  4IFD J;  5AJ3 L;  2VL6 A;  1Z47 A;  5FLM G;  4AYB G;  5C44 H;  4DV2 L;  1XNR L;  4DR7 L;  4GNX C;  5JEA J;  4GLX A;  3PF5 A;  4JBJ A;  2YTV A;  4A3C G;  3FKI H;  1B7Y B;  1UE7 A;  5DLQ E;  4IOC A;  4B3M Q;  4YY3 Q;  5M3F H;  2GVB A;  3JAM i;  2CKZ B;  4R4Q A;  2QEX A;  4LFC L;  3CPW A;  3M7N A;  4POF A;  1L1O A;  4PZ7 A;  2E2H H;  4BY1 H;  1KXL A;  3BZC A;  4P72 A;  3CCQ A;  2R92 H;  1X55 A;  3H0G G;  1Q1B A;  5IYC H;  1VQD A;  2YV5 A;  4YCU A;  2A8V A;  1PVO A;  1PH4 A;  4GN3 B;  3STB D;  2K14 A;  1IBK L;  3AFP A;  3GTO H;  4P71 A;  4JCV E;  3W1G A;  1NE3 A;  1WCM G;  2BA1 A;  3HOZ G;  4GOP C;  3NEN A;  1WFQ A;  2R6G A;  2YTX A;  4OX9 L;  1I50 H;  4LF9 Q;  2WAQ G;  1SN8 A;  2ES2 A;  1XNQ L;  2K5H A;  3Q8D A;  3HOX H;  1MKH A;  4JI3 L;  1HH2 P;  1OXT A;  3PUX A;  4NXN L;  2Z6K A;  2ZTC A;  1Q7Y C;  2VQF Q;  2VUM G;  4MZ9 A;  1OXS C;  4GLA C;  4B3S Q;  2CQO A;  3B6Y A;  4LUV A;  1N36 L;  4POG A;  4BBR H;  4BA2 I;  4A3M G;  1W3S A;  1MJC A;  4DV5 L;  1K0R A;  3E9H A;  3CCS A;  5H1S E;  4LF7 Q;  4X62 L;  1I3Q H;  1YI2 A;  2JEB I;  4JC0 A;  4YCV A;  1J5E Q;  3ULL A;  3GTQ H;  2UXB L;  1ASY A;  1I6H H;  1LYL A;  4GN4 B;  4IJH A;  4L5T A;  4LF8 L;  3ICE A;  3NEL A;  4IFD I;  4AQY L;  5FJ8 H;  1PH1 A;  4DR1 Q;  1IBM Q;  1QZG A;  1A62 A;  1K8G A;  4APV A;  4DV1 Q;  4LF5 L;  1EQR A;  3K8A A;  1L0W A;  5LMN W;  4NXM L;  1N34 Q;  2JA8 H;  3EIV A;  2ZTE A;  1U5K A;  1UWV A;  2CFM A;  3FP9 A;  4A3L G;  1D8L A;  3DLL A;  2R7Z H;  1JJG A;  1SR3 A;  2ZJP A;  2XTI A;  2MO1 A;  1YIT A;  4R4T A;  1KHI A;  3RLF A;  3M85 A;  4DUZ Q;  5C0X I;  4DAY B;  4X66 Q;  3K81 C;  3RLN A;  3KOJ A;  5M3M G;  4EX5 A;  5GQO A;  2K50 A;  2PMZ E;  3CQZ H;  3CC7 A;  1PYS B;  4JI0 Q;  4YHH Q;  1PH2 A;  1EWI A;  3G6E A;  4JI8 Q;  3GO5 A;  1N33 Q;  2OCE A;  2ZJR A;  3HOY H;  1HR0 L;  4GN5 A;  1K3R A;  1RIP A;  4LUZ A;  1Y14 B;  3F8T A;  1AE3 A;  3IRB A;  5HGQ A;  3M4P A;  2D0P A;  3HOU H;  3GTJ H;  2HIV A;  2B29 A;  3BU2 A;  1D7Q A;  2JJQ A;  1Z9F A;  2YYZ A;  3RZO H;  2UXD Q;  3CCL A;  1GM5 A;  5JEA G;  2YU9 H;  4JI2 L;  5K36 G;  3S1M H;  1HZA A;  3L7Z C;  5E7N A;  3RN2 A;  1JJ2 A;  3S2D H;  4DV6 L;  4OO1 G;  4Y52 H;  1X3G A;  1GVP A;  4ALP A;  2UU9 L;  3SGI A;  2I0Q A;  3STB C;  1PV4 A;  1JMC A;  1PFS A;  4GLV B;  4A4I A;  1AE2 A;  2JEA I;  2HQL A;  1IBL L;  4P75 A;  2OQ0 A;  3VDY A;  1NTG A;  1YJN A;  1QUQ A;  3LGJ A;  5LMN Q;  4LFA Q;  4R4C A;  5GAG C;  1Y1W H;  1AH9 A;  1RL2 A;  4JOI A;  4JI5 L;  2R93 G;  1WOC A;  3ZJY C;  4DUY Q;  1EOV A;  1HNX Q;  1ASZ A;  4B3M L;  2K5V A;  1CKO A;  2IHE A;  4YY3 L;  1I5F A;  3L2P A;  1A8V A;  1UE1 A;  1FL0 A;  4KHP L;  2Q2I A;  2KBN A;  3NBH B;  4JYA Q;  2E2J H;  4ME3 A;  4LFB Q;  4LWC A;  4DR2 Q;  4A3E G;  2IX1 A;  1PH3 A;  4QIW E;  2VY3 A;  1YHB A;  2F3I A;  5BR8 L;  3GTP H;  2JA6 G;  3I4O A;  1C0A A;  4P73 A;  1Y1V H;  3CF5 A;  4DV4 Q;  4A3K H;  3U4Z A;  4UP9 A;  3OW2 A;  1XPO A;  2B3G A;  3JC6 6;  4LF9 L;  4A3C H;  3GTG H;  3PUV A;  2C35 B;  1S3O A;  4BY7 G;  1KD1 C;  3ERS X;  4A3G H;  2ZTD A;  1W2B A;  1E1O A;  3KF6 B;  3J80 i;  1TWC H;  2VQF L;  4JI1 Q;  1VQ8 A;  4B3S L;  3PIO A;  3KFU A;  3E9I A;  4GKK Q;  3KLW A;  3KJP A;  4HJ7 A;  3CMA A;  1L2F A;  1KAW A;  1T9H A;  2LSS A;  3AYH B;  3MEF A;  5LMU Q;  1EFW A;  1TXY A;  4DAM A;  4DR3 Q;  3H0G H;  3TRZ A;  1HZB A;  1N32 Q;  1OXX K;  1J5E L;  2JA5 G;  3S1N H;  1DGS A;  4TVA B;  1WJJ A;  3PO2 G;  4YCW A;  4IJL A;  2DUD A;  3A74 A;  1E24 A;  5C3E G;  3G4S A;  4DR6 L;  4DR1 L;  1Q12 A;  2F52 A;  1SRU A;  1WCM H;  2PI2 E;  3J80 c;  1IBM L;  2UUB Q;  3HOZ H;  4QQB X;  3BJU A;  2E5L Q;  4DV1 L;  5HY6 A;  5GAD C;  1CSQ A;  3KDF B;  3NEM A;  1N34 L;  1CKM A;  1E3P A;  1QZH A;  1BVS A;  2ZM6 Q;  4GNX B;  4HJ9 A;  3M4O H;  4RG1 A;  2ATW A;  1UEB A;  1L1O C;  2GN5 A;  4HID A;  4K0K Q;  2OTJ A;  5IP9 H;  3RLO A;  4A3D G;  3CD6 A;  1VS0 A;  3G48 A;  4A76 A;  4LF4 Q;  1VQ9 A;  1VQG A;  4DK6 C;  1JB7 A;  1K83 H;  2EXD A;  4LW1 A;  5IE8 A;  1JT8 A;  1NBW A;  3F1Z A;  4JI4 Q;  2AHO B;  5C4X G;  2AKW B;  1TWA H;  4PZ6 A;  1UE6 A;  1VQH A;  4JI0 L;  4YHH L;  4X65 L;  5C4J H;  3OYY A;  1UE5 A;  3CC2 A;  4JI8 L;  4Y7N H;  3AQQ A;  1N33 L;  3A5Z B;  1OTC A;  1PH9 A;  2N49 A;  2E8G A;  3PCO B;  4BBS H;  2Z6K C;  5GAE C;  4GOP B;  5IWA Q;  4A93 H;  2IY5 B;  1VQA A;  4X64 Q;  3GTL H;  4IPD A;  4OON A;  1VQI A;  2R7F A;  3CCU A;  3M4Q A;  2OQK A;  1GKH A;  4A75 A;  3U58 A;  4A3F G;  2K75 A;  2NN6 G;  3UDG A;  3CC4 A;  3ER0 A;  1GD7 A;  3RZD H;  4DPG A;  3PUY A;  1YHQ A;  4A3I G;  4OO1 I;  4B3R Q;  2UXD L;  1HZC A;  4DKA C;  3RN5 A;  4R1J A;  1MJE A;  4HJA A;  4DR4 Q;  3KYH C;  1E22 A;  4IPG A;  1N9W A;  5M3M H; 
#chains in the Genus database with same CATH topology
 3OTO Q;  2KQ3 A;  3JSN A;  2QCP X;  4HIO A;  3N40 P;  1S5F D;  2VQE Q;  1ZQ7 A;  1FGB D;  1LV9 A;  4HYK A;  3HKS A;  3CCJ A;  2P0A A;  2FJZ A;  1R9T H;  2EY5 A;  4FDB A;  5EZY F;  4ED1 A;  5E4X A;  1X3F A;  4A3F B;  1FNW A;  4DV3 L;  3Q1K A;  1I50 B;  1BBW A;  2D0O A;  2F4I A;  3I4M G;  3KTM A;  1BNC A;  2VQD A;  3KBG A;  3R5F A;  1YNJ D;  2NVX H;  5JEA H;  1STY A;  3IFT A;  1AN7 A;  4JI3 Q;  3K3V A;  1STH A;  2SCU B;  2KCM A;  4OWW B;  1SYC A;  3I72 A;  1I7N A;  3S15 H;  3K5O A;  3OUZ A;  4J9Q A;  1CQV A;  4RB3 C;  3E3X A;  3K80 C;  4JYA L;  2A19 A;  5KFX A;  4WRD A;  2UXC Q;  1YHA A;  4J9R A;  4DR2 L;  4DR5 Q;  5I4D A;  4LF8 Q;  4DL6 A;  2KJX A;  2PMZ A;  1IZ6 A;  2K5N A;  4LAA A;  2JQO A;  1YIJ A;  1SYX B;  1SE2 A;  1VF7 A;  2K4K A;  1SNQ A;  4KHZ A;  1X3Q A;  2BQU A;  3VYS A;  3KHL A;  1RYR A;  2RF4 A;  2FPP B;  3RV3 A;  1XMQ Q;  3NWS A;  4ZRZ A;  4HJ5 A;  4HR7 A;  5DLG A;  4LFB H;  3QIA A;  3UDX A;  4WJ4 A;  3R3O A;  2UU9 H;  4B3T Q;  2R93 A;  1PZJ D;  3GIP A;  3D3R A;  4QB4 A;  3CXC A;  1CK1 A;  5FKA C;  2KUM A;  5DG8 A;  3F2C A;  4DNI A;  4RWS C;  3RD4 A;  2UVW A;  2JA7 A;  1F2L A;  4IUR A;  1SFO A;  1LAB A;  3PW4 A;  1JE5 A;  1PTO C;  1Y69 U;  2Q2T A;  3I7F A;  2N78 A;  3TIG A;  4N9T A;  1NCV A;  2D62 A;  2QGQ A;  3V96 A;  3LWU A;  1MSH A;  3A8I E;  1O7L A;  4X3U A;  5LMU H;  3UQ8 A;  2L15 A;  4LMQ D;  1EYA A;  5IGB A;  4C5C A;  2LKV A;  2JA6 A;  3ETJ A;  2F0E A;  4ECR A;  1P16 A;  3HRZ C;  2WAC A;  3LWE A;  4J9N A;  3HZX A;  2L55 A;  3S2D B;  3KDF A;  5C3E H;  4CBV A;  2KEE A;  2TSS A;  3M9M B;  3D4D A;  3MTS A;  3K59 A;  2AQ3 B;  2NN6 I;  1XJV A;  3KHH A;  2KCT A;  4QUF A;  5IWA L;  1TWF A;  4OL7 A;  3T1Y Q;  2B63 A;  4JK1 C;  3AEV A;  5KRU A;  2FPG B;  1R4Q B;  2HUG A;  2VQF H;  1Y1V G;  4B3R L;  3TRE A;  4DR4 L;  1CM9 A;  4A3J B;  5C44 G;  4A3G G;  4IUQ A;  5C4X H;  4A3M H;  1VKZ A;  2VW9 A;  1VAJ A;  2JE6 I;  1V1Q A;  2W6O A;  2KOL A;  4C2M B;  5M3F G;  2C00 A;  4X64 H;  1SMX A;  3I56 A;  5C0X J;  5KFO A;  3PZP A;  4MNO A;  3FKI A;  1HA6 A;  1N34 H;  5BR8 Q;  1BNZ A;  1Q81 C;  3ORR A;  1T3N A;  5IYC G;  1L1O B;  4JG2 A;  2PI2 A;  1B53 A;  1X54 A;  2E2H A;  3U50 C;  2W6Z A;  5BN4 A;  5CV8 A;  5JUM A;  1XWE A;  4LF6 H;  1C9O A;  2EY6 A;  1PRT D;  4DR7 Q;  4X66 H;  1VBH A;  2A73 B;  3MXN B;  3EN2 A;  3MR5 A;  3T1H H;  3M3Y H;  5IP7 H;  4Y8V B;  2FHT A;  2Z9H A;  1YEZ A;  3HOX G;  3CME A;  3OSN A;  3GTO A;  3J81 j;  1J9O A;  2K1B A;  4BY1 B;  1N33 H;  2V9W A;  4J6H A;  3R93 A;  3J7A V;  2IWH A;  4NPS A;  2PQA A;  2R92 B;  5J1Z A;  1X56 A;  2IX0 A;  4KMU C;  2EE1 A;  3GIQ A;  3DF7 A;  5KFA A;  2W9C A;  2HQE A;  2B2W A;  2NZH A;  2VS1 A;  2GA4 B;  4Q45 A;  5I47 A;  3NSW A;  4F87 A;  3MJF A;  5FD6 A;  1W96 A;  3BG5 A;  1HNX L;  3TEH B;  4RGM A;  1TR5 A;  2R7Z G;  4M7E A;  3K0X A;  3GIJ A;  2AGQ A;  5T1G A;  1VQC A;  3MC0 B;  1N36 Q;  4R9W A;  2AGO A;  2TMP A;  4YR0 A;  4BXX G;  1VQB A;  4IN3 A;  1KIX A;  5A35 A;  4B08 A;  4C1N I;  4X62 Q;  5LMN H;  3GTQ B;  5IYD H;  2ICI A;  1A9X A;  1AZP A;  4IUT A;  3S1R H;  1Q1E A;  3ERQ A;  4DXG A;  2R93 H;  4DL7 A;  3MVV A;  4L5S A;  1SND A;  4LF5 Q;  1VQN A;  5CV4 A;  5KFG A;  1PFB A;  1EIH A;  3H3V C;  2MFI A;  1UNN C;  4DXF A;  5KG6 A;  5BPH A;  4IWX A;  2JA7 H;  2CW7 A;  2XRS D;  3HOU G;  3H15 A;  3I4N G;  2VUG A;  1DJR D;  1HNW L;  5KG7 A;  4DR2 H;  3MXU A;  4UCO A;  2NU7 B;  5GON F;  4DA2 A;  5CA1 F;  4HMJ A;  2BE5 D;  4LUO A;  1KBL A;  1CKN A;  4FXK C;  1ZHQ A;  2K7V A;  2ALY B;  1G6Z A;  3KHR A;  5EWG A;  1HQM C;  1R9T B;  2AGP A;  1T5X D;  5KT2 A;  5KFN A;  4JI7 L;  4L5Q A;  4ECT A;  1EEI D;  3CVZ A;  4DV0 L;  1B8A A;  1WD0 A;  4DV3 Q;  4TRD A;  2R7L A;  2IA6 A;  3ULP A;  2FK3 A;  1ESF A;  1UNS A;  2NVX B;  3AMU A;  2RHQ B;  2ZXR A;  5A2Q E;  1EQQ A;  3PO3 H;  4LH7 A;  4DR3 H;  3S15 B;  4AYB E;  2NU9 B;  5GAH C;  2PN1 A;  5JJI A;  1ILP A;  2IMW P;  2B63 H;  1VMC A;  4O2D A;  1E1T A;  3Q2O A;  3OMC A;  2W6Q A;  2BH8 A;  1HPC A;  3CRL C;  4O3S A;  1VDZ A;  4DV6 Q;  2BDO A;  3BAA A;  2EYP A;  3EYY A;  3ORQ A;  3HP3 A;  3S24 A;  1DV2 A;  3EVQ A;  4QGU A;  2HJW A;  3DHQ A;  2E2I H;  4EG0 A;  4GC7 A;  2HDL A;  2ID0 A;  2EY2 A;  4OEL B;  3J7A 5;  2WB1 A;  3GD7 A;  4OGQ C;  4RGT A;  1A15 A;  5FLM G;  4AYB G;  3FPP A;  4GNX C;  3PF5 A;  2JP1 A;  3FKI H;  1AN8 A;  4O3O A;  1WTP A;  3EJI A;  4ECX A;  5DM6 3;  2WYO A;  2D5D A;  2GVB A;  5KG2 A;  3JAM i;  2CKZ B;  4R4Q A;  1L0Y B;  3TQT A;  2XRQ D;  5KFD A;  4J9O A;  4POF A;  2E2H H;  2RBM A;  3J81 L;  5KG1 A;  2J6U A;  4F50 A;  2C28 A;  3C46 A;  1TWC A;  4ED7 A;  2R8G A;  2YV5 A;  3D4W A;  4RAY A;  1IBK L;  4K6L A;  3AFP A;  5C4Z A;  3GTO H;  5COY A;  2F0S A;  2XN9 C;  3W1G A;  1WCM G;  5TSS A;  4EBC A;  4DR4 H;  1WFQ A;  2LS0 1;  3GTG B;  2WAQ G;  2ES2 A;  1XYI A;  3Q8D A;  2F0T A;  4O3R A;  1E2W A;  3A8K E;  4ECZ A;  2Z6K A;  2VUM G;  4B3S Q;  2EYH A;  5JAV A;  2CQO A;  4LUV A;  4O4H F;  2QIL A;  2DJF C;  4DV5 L;  3E9H A;  3G6J B;  2K33 A;  2SEB D;  5ELD A;  1SEB D;  2JEB I;  2IJ0 A;  2UXB L;  4IRK A;  1B3Q A;  1I6H H;  4KHV A;  1LYL A;  4GN4 B;  3ICE A;  1JWS D;  3NEL A;  4AQY L;  1PH1 A;  2B2T C;  2A69 C;  4DR1 Q;  3SK6 A;  3GV6 A;  3HOZ B;  1QZG A;  1GJX A;  4I4T F;  2UVR A;  3RGX A;  3TP7 A;  3MR2 A;  5EPK A;  4NXN H;  4NXM L;  2XVS A;  2YRW A;  4A3L G;  4XYO A;  1TT2 A;  2F1M A;  4K5X A;  1D8L A;  1BOS A;  1TA8 A;  1KJ9 A;  3SEB A;  1BDO A;  4A3M B;  3KUP A;  1MGS A;  1KHI A;  2L5T A;  3TZU A;  3M85 A;  4ZUJ A;  4QCL A;  3GTL A;  1I6U A;  3K81 C;  1I7L A;  3KOJ A;  3T13 A;  1V1O A;  3JRW A;  2K50 A;  2CW8 A;  4JI0 Q;  4YHH Q;  1PH2 A;  1GSO A;  3E5S A;  3G6E A;  4QWD A;  2FP4 B;  2Y0S A;  3RMH A;  1WSC A;  2ZJR A;  3HOY H;  4RU9 A;  1HR0 L;  4XQJ A;  5IGD A;  4GN5 A;  1K3R A;  1RIP A;  4UCS A;  1Y14 B;  1PZK D;  5HGQ A;  2R84 A;  3BU2 A;  5KFS A;  4NDX A;  4RFB A;  3RZO H;  3M3Y B;  3QO2 A;  3BZD B;  1GM5 A;  3D6W A;  4JI2 L;  4R8I A;  2FMM A;  3L7Z C;  5E7N A;  3IFD A;  3RN2 A;  1EUC B;  4OO1 G;  1UC9 A;  1EZ1 A;  5FPR A;  1X3G A;  2L4N A;  4LK1 C;  4FS1 A;  1BXT A;  2HGS A;  1TKW B;  5CYU A;  1YJN A;  2O2L D;  1B3A A;  5HBR B;  1QUQ A;  2YZM A;  1SE4 A;  4XQQ A;  2YU9 A;  1AH9 A;  5KT6 A;  2FIN B;  2A74 C;  2B8F A;  2FFK B;  2HVR A;  1HNW H;  4ZKC B;  1HNX Q;  4B3M L;  3S17 B;  2K5V A;  3V4Z A;  1H9K A;  2PMZ B;  1SJE D;  3W2D A;  5JVH 3;  1SYG A;  1U4P A;  3JZI A;  2ASJ A;  1RJP A;  4DL5 A;  1JQY D;  2AQ2 B;  2E2J H;  1Y1W A;  4ZQ3 A;  1IBL H;  2N88 A;  2K6A A;  2NBF A;  5KG4 A;  4HR7 B;  4QIW E;  2F3I A;  4JI5 H;  4K2K A;  3MR6 A;  1JOK A;  4HTH A;  3MWD A;  3I4O A;  5CV5 A;  2R93 B;  2A6E C;  4P73 A;  3ZYY X;  4A3K H;  1J8I A;  1NR4 A;  3KAL A;  4YY3 H;  3RB6 A;  3VR3 A;  4J9S A;  4LF9 L;  4A3C H;  5BPF A;  3PUV A;  4EBE A;  2PVP A;  2B2Y A;  1JR0 D;  3VYT A;  3KLS A;  4KHP H;  1TWC H;  3PIO A;  1SFO B;  3R5X A;  5DLF A;  5KT4 A;  1PRT F;  3CMA A;  1KAW A;  1T9H A;  3AYH B;  3MEF A;  4DFA A;  1EFW A;  1II3 A;  4DL3 A;  4MV6 A;  4DU9 A;  2JA5 G;  1CTM A;  1DOM A;  3OW7 A;  3J81 W;  2FK1 A;  4UFZ A;  3TP6 A;  3A74 A;  2JA6 B;  1E24 A;  2F52 A;  1QNU A;  2K05 A;  3GV7 B;  4DV1 L;  1SBB B;  2HD3 A;  3PR5 B;  1SYB A;  3KDF B;  4NMZ A;  1KJJ A;  1E3P A;  2Q8T A;  4I50 F;  2ZM6 Q;  3M4O H;  1UEB A;  3M9O B;  5L1I A;  3MHB A;  3RLO A;  3D6C A;  2R7K A;  1CT1 D;  4A76 A;  4LF4 Q;  1TWF B;  1VQ9 A;  4IZ8 A;  2LMC B;  3M7G A;  2EXD A;  5IIF A;  5KFM A;  2Q8I B;  1JT8 A;  4QWE A;  2Z8L A;  5DEH A;  3F1Z A;  5JVL A;  3WDN A;  2D2C C;  3SE7 A;  1KNA A;  3QWN A;  1TU2 B;  1IOW A;  1VQH A;  4MV7 A;  5DQH A;  1IBK H;  3C1F A;  5CV9 A;  4Y7N H;  1RK5 A;  1LTI D;  4BBS H;  5EOY A;  2MHV A;  3T5L A;  3BQ2 A;  3GTL H;  4OON A;  4F88 A;  3CCU A;  3U58 A;  1GKH A;  2E76 C;  4A3F G;  2W9A A;  1CS0 A;  1BGW A;  1GD7 A;  3FDS A;  4OO1 I;  1T36 A;  4A3I G;  2F0U A;  1HZC A;  3RN5 A;  1WR2 A;  2ZT9 C;  4HJA A;  3KYH C;  4DV5 H;  2PO4 A;  1E22 A;  4XXE A;  1N9W A;  5CGK A;  2NB0 A;  4X65 H;  2IBK A;  3VR2 A;  2E2H B;  2R7M A;  4UCU A;  4AQY H;  4MTK A;  5EAY A;  1S0O A;  4C1N K;  4UCR A;  2I80 A;  3NUC A;  2F0O A;  1P8L A;  3J80 E;  1B4O A;  4NXM H;  2KEN A;  4CDC C;  1AUV A;  1NMF A;  1Z7T A;  3RUP A;  5FOB B;  1ZHS A;  1YJ9 A;  1LTR D;  3EA6 A;  3SR1 A;  2QA4 A;  4CKB A;  2N3S A;  2PQA B;  1M90 C;  1TWH B;  1CQJ B;  4A2A A;  1SXT A;  1S5D D;  4UAI A;  1VQ4 A;  2W9C B;  4BA1 I;  2R8I A;  4C5B A;  2NVT H;  2NZO A;  4ZI7 F;  4C3J B;  4O0A A;  1EY4 A;  4KTA A;  4TSS A;  1MI2 A;  4LFB L;  1TII D;  5M5X H;  1NY4 A;  2CVR A;  5I6W A;  5FPO A;  2CW0 D;  4EVO A;  2PNH A;  2UXB Q;  1HR0 H;  2F4V H;  1RD9 D;  4G7O C;  3WNZ A;  4TQU S;  5IOD A;  4EBD A;  4L6T B;  4HNU A;  2VPS A;  3S9W A;  4C3H B;  4HIM A;  3CHB D;  1HNZ Q;  2OWO A;  3H91 A;  5KG0 A;  2VOB A;  2K01 A;  4RKB A;  5KND A;  1A3U A;  1O78 A;  1STE A;  4EYI B;  2NVY B;  4OWX B;  2AMC B;  5KYI A;  5LMU L;  2KHJ A;  2DIK A;  3HGB A;  2OH2 A;  1ONL A;  3L9A X;  1CI3 M;  3DWA A;  4XQN A;  4A3E H;  1G2T A;  1N32 L;  4JBW A;  3N44 B;  3L3O C;  3QB3 A;  1JOR A;  2RHS B;  4JOI C;  3PUW A;  3J81 c;  2UUB L;  2FXQ A;  1WTQ A;  3KF6 A;  4HED A;  4WOR A;  5JQW A;  4FBU A;  3NQT A;  4A3B H;  1WH2 A;  5L9X A;  4U7C A;  4IOA A;  5KKN B;  2V59 A;  1BQQ T;  5IGF A;  4L5R C;  4ECQ A;  2K5W A;  1G91 A;  5M5W H;  1EY6 A;  3Q23 A;  1CKN B;  2XIG A;  1S10 A;  3RZO B;  4XT1 B;  4LSX A;  1IXR A;  4G3I A;  1VQ5 A;  3PIP A;  3S1Q H;  1VQM A;  1A63 A;  2DY7 A;  5IYB G;  4GKJ Q;  5EWF A;  1PHJ A;  4A3J G;  3H09 A;  2O5I C;  3PO2 H;  1SNO A;  1EYD A;  4DN4 M;  1U0L A;  1FJG Q;  1DON A;  5KFP A;  4FVM A;  4YJ3 F;  2MO0 A;  3PGZ A;  1I94 Q;  4CKE A;  4X64 L;  3GV3 A;  3R5H A;  4IRC A;  3CKI B;  4KN7 C;  3AFQ A;  4A3D H;  1XMO Q;  2FMC A;  1B2T A;  4UCV A;  1BCP B;  1EY0 A;  1JLL B;  4RNN A;  1S97 A;  1GYF A;  2BQ3 A;  3I3C A;  4AH6 A;  3HOW B;  4JI4 H;  4RKL A;  2G9H D;  4I7Z C;  3QR8 A;  3SE0 A;  3F2B A;  1E4E A;  1MHW C;  1MZB A;  2W6N A;  2CCZ A;  3BA9 A;  1FNV A;  4XDX A;  4LF6 L;  1A6X A;  2UUC L;  1WTX A;  2R82 A;  4X66 L;  2MPM A;  2WB1 B;  2CW0 C;  2XCL A;  4RHS A;  4QL5 A;  2E2J B;  3T1H L;  3U9O A;  1FVI A;  4IWY A;  1DXM A;  3RGZ A;  2KCC A;  1VQJ A;  2CWA A;  1M0W A;  2YZN A;  2VPQ A;  4BY1 G;  1HHV A;  1NMG A;  3G6Y A;  2N8N A;  3BDC A;  2F03 A;  1FGU A;  2N55 A;  4HCS A;  2NN6 H;  3H3V I;  2R92 G;  4A3K B;  3AU7 A;  3JAM c;  2RDJ A;  4JV5 Q;  3BAB A;  3PIO 3;  1EHI A;  3TS0 A;  1PH6 A;  1PTO D;  4DUZ H;  5AJ3 Q;  1IKL A;  3FRP B;  3WO1 A;  1TWC B;  1XNR Q;  2KSW A;  1F9R A;  1EZ6 A;  4QUC A;  2EY1 A;  4H13 C;  4Q8F A;  4ZKB B;  3G7L A;  3TS2 A;  5KFB A;  3A0J A;  1FYC A;  4S3S A;  5EBD A;  4LFC Q;  1H95 A;  1XDN A;  3UE0 A;  2OEO A;  5FD5 A;  2Z0S A;  2JXM B;  2XSC A;  4CJ0 B;  3NP8 A;  2I5M X;  3DMU A;  3U4V A;  3VA7 A;  3HS0 C;  3TME A;  3I4M H;  1EY7 A;  3OWF A;  3GLK A;  3LWB A;  2HIX A;  4YWL A;  5LMN L;  2EQS A;  3GV8 B;  2UVU A;  2XD4 A;  1X3E A;  1I3Q A;  5JPM C;  5KIX A;  4EQ5 A;  1S5C D;  3QJY A;  1XNQ Q;  3S14 H;  1CHQ D;  4FF3 A;  3W1B A;  5KNC A;  4RH6 A;  4DAV A;  4I7H A;  5CBE E;  1EYG A;  3K7U C;  1TVX A;  1F2Y A;  1ZKO A;  3K57 A;  4IO9 A;  2BH2 A;  2GPS A;  4DUY H;  4ID6 A;  1XMQ H;  1N8R C;  1YNX A;  1PH5 A;  2A5H A;  1LM0 A;  2IHF A;  5DG7 A;  4B3T H;  1IKM A;  1I4G A;  1S5E D;  3RUZ A;  2R87 A;  3QOJ A;  2Y0S B;  2DGY A;  1JWU D;  1JIC A;  3PMF A;  1G2S A;  1CHP D;  2EDG A;  1M6V A;  3Q22 A;  2FKL A;  4PMW A;  2M00 A;  4DR3 L;  4N8F A;  2IX3 A;  4FU0 A;  4KI0 A;  2MJ8 A;  3GTJ A;  4WFN 3;  1C7Y A;  4FF1 A;  2UUA L;  3T4A C;  1N56 A;  3LX0 A;  2L0C A;  5I6Y A;  5C0X G;  1QVF A;  2EYL A;  1OXU A;  4UP8 A;  2R86 A;  1EU4 A;  3MFH A;  2FMA A;  3SK5 A;  3M4I A;  4O4L F;  1XPR A;  3S16 H;  4FS2 A;  4WJ3 M;  5HUR A;  2W9B A;  4KJO A;  1N32 H;  1EY5 A;  3KAK A;  1QUQ B;  3PW7 A;  5DQI A;  2YU9 B;  5ELB A;  2QW7 A;  2UUB H;  3QOL A;  4DV7 L;  1K8M A;  5M5X B;  1SLJ A;  2HHH L;  3CCM A;  1GUG A;  1STB A;  5KGU A;  2UU9 Q;  2PZW A;  4GS3 A;  3H94 A;  1PRT B;  1X6O A;  1V1P A;  2VXW A;  4K0K H;  3NHH A;  2RCN A;  5KG5 A;  1A2T A;  1NAP A;  2OXP A;  2KCN A;  1Q8K A;  1Y1W B;  4YBZ B;  3J7A F;  4DV2 L;  2VL6 A;  2E2D C;  5C44 H;  2V4R A;  1BCP C;  2F0N A;  4B9X A;  5JEA J;  4BS9 A;  4JBJ A;  3VR6 A;  5DLQ E;  1FD7 D;  3PQI A;  3GTP A;  5M3F H;  4QMG A;  5NUC A;  1EU3 A;  1S5B D;  4A3E B;  2JN4 A;  2E2I A;  4F4W A;  4Q8E A;  3BZC A;  1RK6 A;  2JYO A;  4C5A A;  4F7X A;  3F8N A;  4YJ2 F;  3OIP A;  2HVS A;  1RCV D;  5IYC H;  4A3B B;  1PVO A;  1OO9 B;  1QWY A;  3HXL A;  4ED0 A;  4DR7 H;  3STB D;  2K14 A;  2R7N A;  4JCV E;  3HOZ G;  4ECU A;  4GOP C;  4JV1 A;  4OX9 L;  1SN8 A;  5E3F A;  3HOX H;  1MKH A;  4RGN A;  2UUC H;  3NTH A;  1OXT A;  3I90 A;  4NXN L;  2ZTC A;  2IW3 A;  2VQF Q;  3S1Q B;  1UAP A;  1WCM A;  5L1K A;  2EPB A;  4X3S A;  4KN4 C;  4J9L A;  4BBR H;  4BA2 I;  2WAQ A;  4J1M A;  4A3M G;  3CCS A;  3N8D A;  2H4O A;  3H0G B;  5H1S E;  1I3Q H;  5D3D A;  2A68 D;  4JC0 A;  3ULL A;  5KT3 A;  1GLV A;  1ASY A;  4IJH A;  1LTT D;  1LTS D;  3R2T A;  2JEI A;  3CU7 A;  5M9O A;  4A3D B;  1JX4 A;  1H9R A;  1WTO A;  5LMN W;  3SDZ A;  1N34 Q;  2JA8 H;  2CFM A;  1N36 H;  2R7Z H;  5CBA E;  4ECV A;  3OIQ A;  1AW7 A;  2HDM A;  4XYQ A;  4EFE A;  5IGE A;  2W8K A;  1I4X A;  5C0X I;  4X66 Q;  1D5M C;  4KD3 A;  4RB1 A;  1BO0 A;  5KFH A;  2PMZ E;  5KFI A;  4O4I F;  3CQZ H;  3T5H A;  2IL8 A;  1EWI A;  2F0V A;  4JI8 Q;  1OWT A;  4NKL A;  4IRD A;  1N33 Q;  2OCE A;  2W70 A;  3G6V A;  1V51 A;  4OEM B;  3HKZ A;  5JVD F;  3IRB A;  3HOU H;  3Q8R B;  3GTJ H;  2EXZ A;  1ZYR D;  1D7Q A;  4YR2 A;  2UXD Q;  4RZQ A;  5KFR A;  4Q43 A;  5M3M B;  4M8A A;  3BVM A;  2RSO A;  5K36 G;  1ICW A;  3S1M H;  4O3N A;  1HZA A;  3Q8P B;  3VYU A;  1GVP A;  3SGI A;  5G3L D;  2I0Q A;  3STB C;  1PV4 A;  1F9S A;  1PFS A;  1AE2 A;  5KX5 F;  2HQL A;  4KY7 A;  1IBL L;  1ML0 D;  1NTG A;  5DNF A;  1KLU D;  1XX8 A;  2FLL A;  3LGJ A;  2K32 A;  5LMN Q;  4R4C A;  4N8X 1;  4ZAI A;  4JI5 L;  2A69 D;  2R93 G;  1ROD A;  4R8U A;  4BWS C;  2PW7 A;  2R3Z A;  3VPD A;  2B2U C;  1CKO A;  2IHE A;  4YY3 L;  3J7Y W;  5HGT A;  3L2P A;  5D8D A;  2X69 A;  2K04 A;  2RDI A;  2A68 C;  1QCB D;  4MV8 A;  4M1U B;  4KHP L;  4Q44 A;  3I12 A;  4I65 A;  1EYC A;  4J9P A;  2NUC A;  4JYA Q;  3SVM A;  5KYL A;  3V4S A;  1LT4 D;  2UUA H;  4ZCK A;  4DR2 Q;  2IX1 A;  1D1K A;  2RDG A;  5EPL A;  1F2M A;  3GTP H;  3X3N A;  2JA6 G;  1SEI A;  5FK9 C;  1C0A A;  1RF2 D;  1LTA D;  1ZEQ X;  2F0W A;  4MA5 A;  2B3G A;  3JC6 6;  3OPO A;  5C1P A;  1SYD A;  2ZXO A;  3W3A A;  2C35 B;  1B9M A;  2C9O A;  1W2B A;  3J80 i;  3KF6 B;  1KJI A;  1B1Z A;  3LML A;  4Q0Y A;  4EEQ A;  1PTO F;  3MXG A;  2PQE A;  2RDF A;  4DV7 H;  4HJ7 A;  2HHH H;  5IOC A;  5CV7 A;  4DR3 Q;  2H1E A;  1OXX K;  5D65 A;  3SK4 A;  1J5E L;  3S1N H;  5KFK A;  4TVA B;  3MWM A;  3RBD A;  2DUD A;  3G4S A;  3RBE A;  1IBM L;  4QQB X;  1WCM H;  2F0F A;  2PI2 E;  2B8G A;  4DV2 H;  1SNC A;  5HY6 A;  1GXD C;  1ZYR C;  3RB0 A;  1BVS A;  3SXH A;  4HJ9 A;  4FM9 A;  1L1O C;  3S16 B;  5IP9 H;  1IL8 A;  3KXY T;  2X6L A;  1VS0 A;  3G48 A;  1LT5 D;  2XIW A;  4DK6 C;  3GIL A;  1K83 H;  5IE8 A;  5JVG 3;  1NBW A;  4ZLT F;  4DR6 H;  5EKL A;  5FO8 B;  1AP0 A;  3PW5 A;  2AKW B;  5C3E B;  5C5L A;  4PZ6 A;  3TZD A;  4X65 L;  4RB0 A;  1B6R A;  3CC2 A;  1RDP D;  1E4E B;  1EUD B;  2E74 C;  3DXJ C;  3A5Z B;  1PH9 A;  3A54 A;  3F2U A;  2E8G A;  1G8Z D;  3I91 A;  4OX9 H;  3WOF A;  5IWA Q;  4A93 H;  2IY5 B;  1LAC A;  1GUN A;  4DAY A;  2K75 A;  3CC4 A;  3ER0 A;  1S4Z A;  3RZD H;  4WD3 A;  4DPG A;  3PUY A;  1YHQ A;  2A6E D;  2K5D A;  4B3R Q;  5J2U F;  1MJE A;  3QG1 A;  1EWC A;  4DR4 Q;  1LT6 D;  4IPG A;  3BVZ A;  5C4X B;  2XNA C;  4JI0 H;  2ZJQ A;  1AFP A;  4ED2 A;  1O7Z A;  2VB3 X;  2J7Z A;  4JPB W;  1SRO A;  3T56 B;  3TP5 A;  4C3J G;  1PA6 A;  4MA0 A;  3N42 B;  4RNM A;  3OSO A;  1HFG A;  3V6K A;  3SK8 A;  3GTK A;  3JAM L;  4PMC A;  4LFA L;  1Q8I A;  4FXD A;  3K5N A;  1KNE A;  2F4V L;  1T5E A;  3E0J A;  4IFD H;  4J15 A;  5AFW A;  3BG3 A;  2ZDQ A;  2CH4 A;  2CQA A;  1X32 A;  1U9R A;  4C3H G;  4JI6 H;  5HV6 A;  1KQS A;  4O42 A;  4OO1 H;  1B04 A;  1FNU A;  4BBR B;  1F9P A;  2QF7 A;  3S2H H;  1EWH A;  2I8C A;  1GSH A;  1TWG A;  2B39 A;  4PV1 C;  3P7J A;  4DL4 A;  1C3O A;  4K8I A;  5D1P A;  2KVM A;  3KAJ A;  5J2T F;  3D8G A;  2I5L X;  2X0S A;  1PTO H;  3KK7 A;  3NBI A;  3V6J A;  1QJO A;  3FVQ A;  1N48 A;  4DV4 L;  4CC5 A;  2GVA A;  1PH7 A;  5I2Y A;  4J9M A;  2JA8 B;  2QYZ A;  3NBH A;  3HOV H;  2NVQ H;  4UP7 A;  1E2V A;  4ZQI A;  1AEX A;  5J3B A;  1JDB B;  4L8J A;  4GKK L;  2X6G A;  1LUZ A;  4PZ8 A;  5EGT A;  5FLX c;  1YBY A;  3JSL A;  2C5C A;  2F0D A;  1ZET A;  1DOK A;  3R8B A;  4YWM A;  1EIG A;  1KC7 A;  1ZXT A;  4CC6 A;  3FMA A;  3D0F A;  5D1O A;  2E5L L;  1CA6 A;  3H4B A;  2WB1 E;  4R4O A;  4ETS A;  2GPW A;  3S1R B;  5CV6 A;  2FPI B;  4TUY F;  4DK0 A;  5ISR A;  4IUU A;  4K6D A;  1KAB A;  3BQ1 A;  3GTJ B;  4GC6 A;  2RCF A;  1V43 A;  5CA0 F;  3CRK C;  4ZHQ F;  4FF4 A;  2JA7 B;  2YZG A;  3HOW G;  2AWO A;  3ULJ A;  2W8L A;  1CUK A;  3VR5 A;  5DGA A;  4JI4 L;  1I4Q A;  3S1M B;  1HNW Q;  1LO5 D;  5C1O A;  3CP0 A;  2O5J C;  3KJO A;  2XCP A;  5L1J A;  4H7B A;  4NW2 A;  2YRX A;  1SJH D;  1O7I A;  4GNX A;  4V19 0;  4KKT A;  2WB1 G;  5CAE B;  3DEP A;  1V8Q A;  2ZM6 H;  2W9B B;  1Y8P B;  1XPU A;  2O4X A;  4RA8 A;  1VQE A;  3ND8 A;  3GV5 B;  3UE1 A;  4CHT B;  3GQB A;  4EFB A;  4IUV A;  4JI7 Q;  4LF4 H;  1PH8 A;  4LMY A;  4DV0 Q;  2EIF A;  3M9B A;  1IL2 A;  3RAQ A;  5KFQ A;  3IG0 A;  1EUJ A;  1VQK A;  4A3K G;  4JI5 Q;  3NTI A;  1G29 1;  1K8O A;  2EZV A;  4PMB A;  3PO3 B;  1V1P B;  5EJW A;  2Z1C A;  3OTO L;  3K3P A;  4LF7 H;  2FB9 A;  3L4J A;  1J5E H;  4DUZ L;  1QVG A;  2B63 B;  2H5X A;  3BA8 A;  3GDE A;  4KHP Q;  2Z4H A;  3PV0 A;  2VQE L;  3V6H A;  2DZD A;  4ED8 A;  1OXV A;  3H20 A;  1IBM H;  1KJQ A;  1XTC D;  3J81 E;  1KDB A;  1WD1 A;  2V5A A;  2YL2 A;  1RYS A;  3H40 A;  5JJK A;  1QIL A;  4IR9 A;  3GTP B;  4F8M A;  3ITP A;  4K14 A;  3T51 B;  1WYD A;  4A3F H;  1K1S A;  2E2I B;  2ZJT A;  4A3I H;  1TAE A;  4P74 A;  1FKA H;  4CDD C;  4XZ3 B;  4C3I H;  1A0I A;  1EOT A;  2B2V C;  2K5Q A;  5DG9 A;  3UDF A;  2R92 A;  2B2T A;  4FF2 A;  3FKI B;  2MUY A;  1KRT A;  3GTK H;  1Z2P X;  1S72 A;  5BMV F;  5I9O A;  2UXC L;  4HAE A;  3G71 A;  4DR5 L;  3NXW A;  5LHY 1;  1DYQ A;  3S1N B;  1JDE A;  2YYA A;  2XC9 A;  2Y0S E;  5ELN A;  2FLN A;  3BDO A;  3KF8 A;  1F9Q A;  1HTP A;  1WCM B;  3KBX A;  1VQL A;  3VPB A;  4YR3 A;  2WFW A;  4X6A H;  1DZ1 A;  1YJW A;  3GTO B;  3JAM W;  1TWG H;  1IBK Q;  2DWC A;  5FJ8 G;  2O03 A;  5EBC A;  2ASB A;  2K52 A;  1HR0 W;  3H3V H;  4JW0 A;  4DUY L;  4JUZ A;  1XMQ L;  2I87 A;  2R6F A;  4DLK A;  2HT1 A;  3GTQ A;  3UI2 A;  1KJ8 A;  4O1N A;  4ODG A;  3CAM A;  2JEF A;  5DAU A;  2W71 A;  4B3T L;  3EBE A;  2Y0S G;  1JE4 A;  4RNO A;  3I4L A;  4DV5 Q;  1CA5 A;  1HZ9 A;  5GRO A;  4CDF C;  3RNU A;  1Z2N X;  3L4K A;  3RV4 A;  4X65 Q;  4LFA H;  1ESR A;  4I55 F;  2BQR A;  3J7Z C;  3EFX D;  1I6H B;  1H9S A;  4K5W A;  4FO2 A;  4UY8 C;  2MCT A;  4A93 B;  4AQY Q;  2C22 A;  4MAM A;  2SDF A;  3JAM E;  4LSA A;  1STN A;  5F2D A;  3K6O A;  4NXM Q;  2A1A A;  1QG7 A;  1EL0 A;  1A3T A;  4XTC S;  5C5J A;  3QZ7 A;  1KAA A;  1K3B C;  5EPJ A;  2A6H C;  4HIK A;  3JRX A;  3HKZ B;  2DPI A;  5JJL A;  5I9P A;  5K5P A;  4DV4 H;  2Z6B A;  1KC8 C;  2F0M A;  4X3K A;  5KFW A;  3ERO A;  3T1Y L;  2R8K A;  3E0E A;  2C2E A;  4R7R A;  1TY0 A;  3IKJ A;  3HOY B;  3I2Z A;  4JI1 H;  2F4V Q;  1HR0 Q;  4BY7 H;  2LXJ A;  1EIY B;  1TY2 A;  1VQF A;  4GKK H;  3I55 A;  1HUM A;  4K0K L;  4U6P A;  4HJ8 A;  5IYB H;  3EPI A;  1Y1W G;  4H02 A;  2D9U A;  4A3J H;  3VPC A;  1IW7 C;  4PQX A;  4Z9C B;  1FJG H;  3GID A;  3S2H B;  1XTD A;  3BQ0 A;  5M5Y H;  4C2M H;  4JI2 Q;  3HFZ B;  4F4Z A;  1ILQ A;  1I4R A;  4R8N A;  4R8U B;  2E5L H;  4MTD A;  5I2X A;  5D3I B;  1PTO B;  2PW5 A;  3N52 A;  5CMD A;  3WWV A;  4IAJ A;  2L1B A;  1HJP A;  1TS4 A;  2XGT A;  4DF7 A;  2HCI A;  3TN2 A;  3T5J A;  2VZA A;  1S03 G;  5ELO A;  5KFY A;  1FR3 A;  1GUO A;  4A3B G;  5KFC A;  1EIF A;  5T1I A;  3C0F B;  3HOV B;  2NVQ B;  1Z47 A;  3KLR A;  4OIK A;  3T16 A;  4DR7 L;  1IOV A;  4XYL B;  3HB9 A;  1R4P B;  3AB9 A;  4GLX A;  4QWC A;  2F0Q A;  2EOT A;  2K03 A;  1QB5 D;  4B3M Q;  1UE7 A;  5KFV A;  3U9S A;  3R2I A;  3TIN A;  4YAK B;  2QEX A;  3U9T A;  1Y1V A;  3CPW A;  4EGJ A;  3Q8S B;  2WIN B;  1GHJ A;  4BY1 H;  4QW8 A;  3GTG A;  5IT9 L;  2V58 A;  1H9J A;  4P72 A;  3CCQ A;  4JV5 H;  2R92 H;  2G5D A;  3H0G G;  2EJM A;  1Q1B A;  2YS7 A;  1V4Y A;  1XNR H;  1C30 A;  2PYK A;  2NTS A;  1NE3 A;  1D1I A;  4EQN A;  3NEN A;  3OTO H;  4LF9 Q;  3PN1 A;  4RAZ A;  5CB4 F;  1HH2 P;  3K5M A;  5LYJ F;  3OHB A;  2VQE H;  1OXS C;  4GLA C;  5IGC A;  4YB8 B;  1N36 L;  2W7P A;  3J7A K;  1HCZ A;  3FMC A;  1MJC A;  1D2B A;  5LOV F;  4X62 L;  2YS6 A;  1YI2 A;  4YCV A;  3GTQ H;  1CZG A;  4MV9 A;  4L5T A;  4L63 B;  2F3W A;  1EY9 A;  1A62 A;  1EQT A;  3H4D A;  4JI3 H;  4APV A;  4DV1 Q;  4LF5 L;  3K8A A;  1L0W A;  3EIV A;  1UWV A;  2W6P A;  3M4O B;  1TWA A;  2PNR C;  3DWQ A;  4ULL A;  3DLL A;  1JJG A;  1UUP A;  4U68 A;  2KED A;  4MIU A;  2XTI A;  2UXC H;  5KT5 A;  4DR5 H;  2MO1 A;  4M9U A;  4R4T A;  1BCP D;  4DUZ Q;  2E75 C;  2J6T A;  2B2W C;  3I73 A;  4DAY B;  4LF8 H;  1HA5 A;  4MHE A;  5M3M G;  1HUN A;  4RCN A;  3MR3 A;  1EYZ A;  3LP8 A;  2R7Z A;  2F0L A;  2RVL A;  2SNM A;  4Y7N B;  1O75 A;  2ENB A;  1KEE A;  5BN5 A;  4BBS B;  2J4X A;  4A3I B;  3GTL B;  4LUZ A;  3MFI A;  5KFF A;  4C3I B;  2NU6 B;  2PPB C;  4APM A;  1AE3 A;  3M4P A;  2D0P A;  4K8J A;  5FO9 B;  1LTB D;  2B29 A;  1PK8 A;  2YYZ A;  1Z9F A;  2EYM A;  3CQZ A;  1TS5 A;  3GTK B;  2C2D A;  1A2U A;  3CCL A;  4TQS A;  2NYZ D;  5JEA G;  1UEA B;  2L9H A;  1WTV A;  4LH6 A;  2F3V A;  1XXG A;  1NUC A;  1ENA A;  3BJY A;  4DV6 L;  5BN3 A;  4Y52 H;  1MBY A;  5C0X H;  1S9F A;  4DNT B;  2AQ1 B;  5IGG A;  3Q24 A;  1JMC A;  1EY8 A;  4FNF A;  4HN7 A;  2P5Z X;  5ELE A;  2JEA I;  3GIM A;  4P75 A;  5EKK A;  4MV1 A;  1TWG B;  4G57 A;  4OHJ A;  5GAG C;  4K2L A;  2FJ2 A;  3NPP A;  4JOI A;  3N41 B;  1E0B A;  1WOC A;  2AUK A;  5A2Q L;  3ZJY C;  4DUY Q;  3VMM A;  1EOV A;  1B9N A;  1BF4 A;  1UE1 A;  2NVT B;  3A8J E;  1FL0 A;  1QE6 A;  4RUC A;  2KBN A;  3NBH B;  1VF5 C;  2RA4 A;  1Z6H A;  3T1Y H;  4ME3 A;  5ELF A;  4LWC A;  4LFB Q;  3ETH A;  5ELC A;  1PH3 A;  1PZI D;  1YHB A;  1UC8 A;  1ET9 A;  2M9V A;  1Y1V H;  3CF5 A;  2HVQ A;  4ECS A;  5L37 A;  3TSS A;  2JSO A;  3OW2 A;  2AU0 A;  1W6K A;  2I07 B;  3GTG H;  1SNM A;  4EYH B;  1KD1 C;  3ERS X;  4A3G H;  3T53 B;  2ZTD A;  3T5K A;  1E1O A;  1VQ8 A;  1F2Z A;  2WKD A;  4H44 C;  4B3S L;  5FLX L;  5D1O B;  3E9I A;  5J22 A;  3KLW A;  3MAQ A;  3MA2 B;  1L2F A;  2XGQ A;  2LSS A;  2FLP A;  4MN3 A;  5LMU Q;  1NNX A;  4DAM A;  4AYB A;  3G6X A;  3BYY B;  5BR8 H;  2JEG A;  1N32 Q;  1C48 A;  2FK2 A;  1WJJ A;  4YCW A;  5IT9 W;  5C3E G;  4DR6 L;  4DR1 L;  1Q12 A;  2UUB Q;  3Q8Q B;  3HOZ H;  3P1H A;  1CFM A;  1YNJ C;  2OF1 A;  1CSQ A;  1RJQ A;  1D5X C;  4BY7 B;  1CKM A;  1QNK A;  1Q90 A;  3P20 A;  4HSV A;  4GNX B;  5M5W B;  2W7O A;  2WKC A;  4RG1 A;  3URY A;  2GN5 A;  4B9W A;  4K0K Q;  4A2B A;  3PIP 3;  1Y8N B;  3CD6 A;  3ND9 A;  3MWE A;  5EKI A;  2J9G A;  3GP7 A;  1VQG A;  2WDT A;  1JB7 A;  1WTW A;  5M5Y B;  3PO2 B;  2AHO B;  5C4X G;  3D4R A;  1M7J A;  2DLN A;  4WBN F;  1TWA H;  3VYR A;  4JI0 L;  4YHH L;  2CQY A;  1H9M A;  5C4J H;  5IT9 E;  1M8A A;  3OYY A;  1UE5 A;  2VUM A;  1F77 A;  2IPK D;  4ZK9 B;  2N49 A;  4QWB A;  3PCO B;  1X3P A;  2WE6 A;  2Z6K C;  2OT2 A;  5GAE C;  4IR1 A;  1L2Z A;  3TP8 A;  4X64 Q;  3Q0A A;  1T94 A;  4IPD A;  1K83 A;  1VQI A;  2R7F A;  1CQF A;  3M4Q A;  3X3M A;  4E4T A;  3RAX A;  1B44 D;  1IYV A;  4MV3 A;  4R1J A;  4NLG A;  3RLN A;  4G7H C;  5LXT F;  1JXL A;  3MXP A;  4X62 H;  4BXX H;  3CPF A;  4BWG B;  4LF6 Q;  4CKC A;  2NZ1 D;  5FO7 B;  2UUC Q;  3QZ8 A;  4JI6 L;  4E6I A;  4JI8 H;  2JA9 A;  5IP7 G;  1VQ7 A;  4BBR G;  1RTN A;  1GSA A;  4IZO A;  4J9K A;  1I4H A;  2BCO A;  5JJZ A;  3T1H Q;  4JBM A;  4FP5 D;  1TWH A;  2QDL A;  1KRS A;  4LF5 H;  3V05 A;  1C8C A;  5C8Y F;  3RTX A;  3IN5 A;  1Q3L A;  2UXD H;  2R61 A;  1YZ6 A;  3RR5 A;  2SNS A;  1YNN D;  5E1F A;  2QK4 A;  4XX0 B;  3S17 H;  3KF8 B;  3BZK A;  4X3T A;  2V1C C;  2JA8 G;  3I4N H;  1B33 N;  1WTR A;  5K36 H;  3OOC A;  3CCV A;  3A56 A;  1CE8 A;  2IP4 A;  4RB2 C;  2QKI C;  1ENC A;  4YQW A;  1JOQ A;  2L11 A;  4DV3 H;  1DIK A;  3NQI A;  1RTO A;  1E2Z A;  4R4I A;  3SHL A;  3DEO A;  3I8Z A;  1G6P A;  2PZT A;  2W6M A;  2NVY A;  1BBU A;  4FYD A;  3OSP A;  5IYD G;  3I4M B;  1GUS A;  4RAU C;  3C1E A;  2RDH A;  1W93 A;  4HSP A;  4Q0F A;  3J81 i;  2DPJ A;  3L0O A;  1BUV T;  4TV8 F;  1H9S B;  3S14 B;  5KFZ A;  5A2Q W;  4JYA H;  1SFO H;  5IYZ F;  3LNN A;  2LXK A;  4KD4 A;  2OTL A;  4DV6 H;  4UCT A;  4IHJ F;  1LTL A;  2JA7 G;  1B50 A;  3GTM A;  1B70 B;  1M1K C;  4JV2 A;  2WII B;  3TII A;  2JA6 H;  1NJI C;  1O7Y A;  5IT9 c;  1Q86 C;  1SCU B;  5T14 A;  2GLT A;  4IPH A;  2ZDG A;  3DM3 A;  1PRT C;  5FLM H;  2ZM6 L;  1CSP A;  1RKN A;  1HRJ A;  5C5M A;  1QVC A;  4LNQ A;  4F4Y A;  3NTK A;  4LF4 L;  1Q46 A;  4P2C B;  5KFT A;  1TWF H;  2Q2H A;  1S0N A;  5FLX W;  4DL2 A;  1S40 A;  2RKS A;  3PO3 G;  1LTG D;  2RGV A;  5KNB A;  4LF7 L;  3HBL A;  2B63 G;  3CCE A;  2PCF B;  4NP5 A;  1K9M C;  2B2Y C;  3TBI B;  1IYJ B;  1GHK A;  4HMI A;  1TS2 A;  2VR1 A;  3NE5 B;  2WV6 D;  2RGR A;  4UHV A;  2UUA Q;  3IAY A;  3C2P A;  1HTL D;  4QIW A;  1W6J A;  1YNN C;  3RFC A;  2JA5 A;  2XGP A;  3PSI A;  1PLF A;  3E6Z X;  1JWM D;  4CGY B;  5KFU A;  4B3S H;  1X9N A;  2VUM H;  2CHB D;  3K7A H;  4ME6 A;  5C3W A;  2WAQ E;  1C4Q A;  2M2L A;  4N9P A;  2UVV A;  1SE8 A;  3VR4 A;  2KHI A;  5FLX E;  4PWQ A;  4RUA A;  4Q5V A;  1JJC B;  1K0S A;  4GOP A;  1I6V C;  2BA0 A;  1J6Q A;  3FKI G;  5CR3 A;  1S68 A;  5K2M A;  5LA6 F;  5IWA H;  4DR1 H;  1BCP F;  4DV7 Q;  3RIZ A;  3WOE A;  1ICF B;  1DOL A;  1VQO A;  2HHH Q;  1KL9 A;  1A3V A;  1DV1 A;  2J0T D;  3MFY A;  4B3R H;  1Y1V B;  4A3L H;  3UDI A;  3D31 A;  1JC7 A;  3K5H A;  3FDT A;  2F0G A;  2I5H A;  3HEJ A;  2Q2U A;  3FEW X;  4L1K A;  5JH7 F;  3CCR A;  1D6E C;  1YVC A;  2VNU D;  3MWY W;  1HFN A;  5C44 B;  4A3G B;  2ZDH A;  4DV2 Q;  2PBZ A;  1TWH H;  1AZQ A;  1LLR D;  2MQH A;  1MIU A;  5IP9 G;  2BE5 C;  2OLS A;  1WI5 A;  4JBK A;  3QFF A;  3A5U A;  1GO3 E;  5M3F B;  4C3J H;  4YHH H;  1SNP A;  5J39 A;  2NUA B;  3GIK A;  3K5L A;  1I50 A;  1E7Z A;  2VA3 A;  1Y8O B;  2XWJ B;  3J80 L;  3TQ1 A;  3F2D A;  2ATL A;  2VB2 X;  3I70 A;  4YIJ A;  4DR6 Q;  1KDA A;  2QDB A;  1KTK A;  1BR9 A;  2JEJ A;  1JOO A;  3HKZ E;  4MTN A;  4YWK A;  2DY8 A;  2XWB B;  1BKB A;  4C3H H;  2AWN A;  1HNZ L;  4A93 G;  3OWE B;  3PF4 A;  4OX9 Q;  3PVX A;  2DJG C;  4CDE C;  3N43 B;  3PR4 A;  4IUN A;  3HOX B;  3FHW A;  4WJW A;  1GUW A;  2NVY H;  1M0T A;  2ASL A;  1GUT A;  4NXN Q;  1X65 A;  4OWT B;  4RCO A;  4UPA A;  4PG3 A;  1VQ6 A;  5D14 A;  4ME5 A;  3C3L A;  2EJF C;  1TWA B;  1VCI A;  4EGQ A;  1I3Q B;  5C4J B;  3HKZ G;  4KLK A;  3BYT B;  1TQO A;  1K8A C;  1BXR A;  4XIG S;  1SDF A;  2V4Q A;  1PYB A;  1HNX H;  2YTY A;  3KHG A;  3GTM H;  4ED6 A;  4QY7 A;  2WP8 J;  3HOY G;  3PUZ A;  1ET6 A;  4DAP A;  2CWP A;  5KEE A;  4IFD G;  2R7Z B;  4JI1 L;  2EJG C;  4DK3 C;  4EQP A;  4GKJ L;  1SMY D;  4ECW A;  1BBX C;  2NTT A;  1MSG A;  1K73 C;  1VQP A;  2IT1 A;  3RJ0 A;  3CW2 C;  2ASD A;  2CZG A;  4JI6 Q;  5IY0 A;  3DUZ A;  4OXP A;  5KT7 A;  3NK9 A;  2I46 A;  1FJG L;  1WTH A;  2B2U A;  2R7D A;  4O2B F;  1JIH A;  3RF2 A;  1CZW A;  3CQZ B;  1GGO A;  3R23 A;  4YAJ B;  1I94 L;  4MV4 A;  1Q82 C;  4KJN A;  4RGO S;  1RHP A;  4QF4 A;  3W5O A;  4HCE A;  4NB3 A;  1XMO L;  3IL8 A;  2BDN A;  4AIM A;  1IYU A;  4QJF A;  2F0P A;  3HOW H;  3HOU B;  4H0L C;  2XCA A;  3I4N B;  4V0B A;  1PX2 A;  3HOV G;  2NWG A;  1DM0 B;  2F0I A;  4RMF A;  3OHA A;  3RB4 A;  3TQY A;  2SOB A;  2JA5 H;  1K28 A;  2AQ4 A;  3TDQ A;  2FE3 A;  1E4F T;  1PXU A;  5DM7 3;  4JI7 H;  5KFJ A;  4DV0 H;  4IPC A;  1V9P A;  3M9N B;  3N6X A;  2ZXP A;  3RB3 A;  2YCH A;  1G51 A;  2MNA A;  1IBL Q;  4JV5 L;  4JVZ A;  2JK8 A;  1O80 A;  4IFD J;  4C2M A;  5AJ3 L;  1XNR L;  2EVB A;  3K5I A;  1LT3 D;  3V2T A;  2EYJ A;  2YTV A;  4UDU C;  2KHS A;  1B7Y B;  4IOC A;  4A3C G;  5F9L A;  3UFX B;  1K1Q A;  4YY3 Q;  4XYM B;  1U4R A;  2DN8 A;  2MP1 A;  1AUX A;  4G4K A;  4PNY A;  1RJT A;  4LFC L;  3M7N A;  1L1O A;  2L12 A;  4PZ7 A;  1KXL A;  1NSN S;  1DCZ A;  2A6H D;  1HXY D;  3WO0 A;  4QWA A;  1X55 A;  2M05 A;  4CJ2 C;  1VQD A;  3MXN A;  4YCU A;  3ONA B;  2A8V A;  3K58 A;  2LY7 A;  4GN3 B;  1WVL A;  1PH4 A;  3GQC A;  1EFI D;  4P71 A;  4XT3 B;  4AYB B;  2CH4 W;  2BA1 A;  3BVG A;  4OIJ A;  2R85 A;  2R6G A;  2YTX A;  3H0G A;  1I50 H;  1SMY C;  1XNQ L;  2K5H A;  1KDC A;  4JI3 L;  1JCK B;  3PUX A;  1NR2 A;  2DNC A;  4EQO A;  1Q7Y C;  1JKJ B;  3A7A B;  2RSN A;  4MZ9 A;  5F9N A;  4FBT A;  3B6Y A;  4ED3 A;  4KKS A;  4IAL A;  4POG A;  2RQX A;  1W3S A;  1K0R A;  5C3X A;  4ZOL F;  1IW7 D;  4LF7 Q;  2ALZ A;  2Z4I A;  1J5E Q;  5KFL A;  3K0Y A;  1KLG D;  4LF8 L;  1PDQ A;  3Q6S A;  3J80 W;  4IFD I;  3P75 A;  5FJ8 H;  1IBM Q;  3NWT A;  1SYF A;  5JOB A;  1K8G A;  2F0H A;  5G3L F;  2WAQ B;  1ULZ A;  3DWP A;  1EQR A;  2BOS A;  4BBS G;  1U5K A;  2ZTE A;  3FP9 A;  2VUM B;  1MD2 D;  2QEJ C;  3K7A B;  1SR3 A;  1STA A;  4C3I G;  2ZJP A;  4QW9 A;  3NGD A;  1YIT A;  4RZR A;  4TV9 F;  1K83 B;  3RLF A;  2UXB H;  5C4H A;  5LL6 X;  4EX5 A;  1GOZ A;  5GQO A;  5EQ0 A;  3MFG A;  3N6R A;  3CC7 A;  1PYS B;  3DM1 A;  4G7Z C;  4I7A A;  3KLS X;  3EPG A;  3GO5 A;  2MGS A;  4K5V A;  1HNZ H;  4IQZ A;  1EZ8 A;  4EEY A;  5LL6 b;  1CQI B;  3F8T A;  3H6M A;  5JPN C;  3RZD B;  2HIV A;  2JJQ A;  3HG9 A;  4KV6 A;  4FXG C;  5H80 A;  5DQG A;  1R9T A;  4ABN A;  4F4X A;  3A7L A;  2YU9 H;  4KK7 A;  4ZYS A;  3VA5 A;  4JV0 A;  4ECY A;  1IHZ A;  1JJ2 A;  3S2D H;  2EYF A;  4O2A F;  4ALP A;  4RHR A;  2UU9 L;  2NVX A;  3GII A;  2R8J A;  2Q8R E;  4GLV B;  4A4I A;  4U67 3;  4KY6 A;  2EYO A;  2OQ0 A;  3VDY A;  4DGZ A;  2LFN A;  3PW0 A;  4LFA Q;  4IUP A;  1Y1W H;  1M4V A;  2BR0 A;  1RL2 A;  1PFN A;  1L0X B;  1PYW D;  4ILW A;  4GKJ H;  3MEH A;  5LL6 S;  4CJ1 B;  1BJT A;  4JI2 H;  1ASZ A;  4KY5 A;  1I5F A;  5KG3 A;  1A8V A;  1STG A;  4DNR B;  1U4L A;  3O13 A;  4C56 C;  3M4Y A;  1SYE A;  2Q2I A;  1I94 H;  5COR A;  4YP3 A;  5LP6 F;  3PW2 A;  4A3E G;  1SSO A;  2AUJ D;  3MZ5 A;  1XMO H;  2VY3 A;  5BR8 L;  3SI8 A;  1TS3 A;  2C2R A;  4DK1 A;  4GZY C;  4DV4 Q;  4B3M H;  3GTM B;  1D5Z C;  3U4Z A;  4UP9 A;  1XPO A;  4O3P A;  4J0M A;  3OMG A;  2V4D A;  1S3O A;  4BY7 G;  3KFU A;  2VQF L;  4TKO B;  4JI1 Q;  2DNE A;  1E4G T;  5C6A A;  3EQL C;  4GKK Q;  1DD2 A;  3KJP A;  3OUU A;  2WTF A;  2K28 A;  2ICE C;  1TXY A;  4PDB A;  4KKU A;  5EWE A;  3H0G H;  3TRZ A;  1HZB A;  2NU8 B;  3E5N A;  3FPU B;  1DGS A;  4LJZ C;  3PO2 G;  5L1L A;  4IJL A;  2W57 A;  2KEC A;  4LF9 H;  1SRU A;  3J80 c;  2J6S A;  2F0J A;  1SE3 A;  3BJU A;  2E5L Q;  1EQV A;  1ENF A;  5GAD C;  3A55 A;  3NEM A;  1N34 L;  1B6S A;  1QZH A;  1HQR D;  2ATW A;  2OTJ A;  4HID A;  4A3D G;  1EEF D;  2PZU A;  4ZUI A;  4HNV A;  4LFC H;  1I4P A;  1S0M A;  4HQ6 A;  1U4M A;  1VBG A;  4QIW B;  4LW1 A;  4EGV A;  3BS1 A;  2JA5 B;  4JI4 Q;  5E4W C;  5DGB A;  2B2V A;  2G9D A;  4TQR A;  2HCC A;  5KFE A;  1QOH A;  2R8H A;  1UE6 A;  1RJR A;  1PMR A;  4DV1 H;  4J8Q A;  4JI8 L;  1N33 L;  3AQQ A;  1JB3 A;  1OTC A;  4GOP B;  5EDW A;  1VQA A;  1XNQ H;  3G8C A;  2OQK A;  4A75 A;  4MTE A;  2YW2 A;  2NN6 G;  3UDG A;  1PFM A;  1SAP A;  2UXD L;  4DKA C;  2KA7 A;  3OHX C;  2F0K A;  3BDL A;  4O3Q A;  1VMP A;  4HNT A;  2VA2 A;  5CC4 A;  1Z2O X;  5M3M H; 
#chains in the Genus database with same CATH homology
 3OTO Q;  4BXX H;  3CPF A;  2ZJQ A;  4LF6 Q;  2UUC Q;  4HIO A;  4JI6 L;  2JA9 A;  5IP7 G;  1VQ7 A;  4BBR G;  2VQE Q;  1SRO A;  5EAY A;  3T1H Q;  1PA6 A;  4JBM A;  3HKS A;  3CCJ A;  1R9T H;  1KRS A;  1P8L A;  4FDB A;  2KEN A;  1X3F A;  4LFA L;  4DV3 L;  1YZ6 A;  3RR5 A;  2F4V L;  1NMF A;  1YJ9 A;  1BBW A;  2D0O A;  4J15 A;  3I4M G;  2QA4 A;  2NVX H;  2N3S A;  2PQA B;  3KF8 B;  3BZK A;  1M90 C;  2V1C C;  2JA8 G;  3I4N H;  4JI3 Q;  3S17 H;  2KCM A;  4OWW B;  1VQ4 A;  1KQS A;  4BA1 I;  3S15 H;  3CCV A;  2NVT H;  2NZO A;  3K80 C;  4O0A A;  3S2H H;  4JYA L;  4BBS G;  2A19 A;  4LFB L;  2UXC Q;  1YHA A;  5M5X H;  4DR2 L;  1NY4 A;  4DR5 Q;  2PNH A;  2UXB Q;  2I5L X;  4R4I A;  4LF8 Q;  1G6P A;  1IZ6 A;  2K5N A;  1BBU A;  4DV4 L;  2JQO A;  4TQU S;  5IYD G;  1YIJ A;  2GVA A;  1PH7 A;  2K4K A;  4KHZ A;  4HIM A;  3HOV H;  3J81 i;  1HNZ Q;  4UP7 A;  3L0O A;  2OWO A;  2NVQ H;  2RF4 A;  5J3B A;  1XMQ Q;  1SFO H;  4HJ5 A;  4GKK L;  1LUZ A;  2LXK A;  4PZ8 A;  4OWX B;  2OTL A;  2AMC B;  5FLX c;  5LMU L;  3UDX A;  1YBY A;  2KHJ A;  4WJ4 A;  1LTL A;  2JA7 G;  4B3T Q;  4A3E H;  1N32 L;  4JBW A;  1B70 B;  1M1K C;  2RHS B;  4YWM A;  3CXC A;  4JOI C;  3PUW A;  3F2C A;  4DNI A;  2JA6 H;  3J81 c;  2UUB L;  1NJI C;  2FXQ A;  5IT9 c;  3KF6 A;  1Q86 C;  3D0F A;  2E5L L;  2WB1 E;  4R4O A;  4A3B H;  1JE5 A;  4IPH A;  3DM3 A;  2Q2T A;  3I7F A;  4IOA A;  2N78 A;  5FLM H;  2ZM6 L;  1CSP A;  4L5R C;  2QGQ A;  2D62 A;  5M5W H;  1CKN B;  1QVC A;  4LNQ A;  4LF4 L;  2L15 A;  1Q46 A;  1V43 A;  1TWF H;  2Q2H A;  1IXR A;  1VQ5 A;  3PIP A;  3HOW G;  2AWO A;  3ULJ A;  1VQM A;  5IYB G;  1P16 A;  3S1Q H;  1CUK A;  4GKJ Q;  1A63 A;  4JI4 L;  1PHJ A;  1S40 A;  4A3J G;  3PO3 G;  1HNW Q;  3PO2 H;  3CP0 A;  3KDF A;  5C3E H;  3KJO A;  4LF7 L;  2B63 G;  4GNX A;  1O7I A;  3CCE A;  2WB1 G;  1K9M C;  1U0L A;  2NN6 I;  1XJV A;  1FJG Q;  1IYJ B;  1XPU A;  2KCT A;  1VQE A;  2MO0 A;  3PGZ A;  5IWA L;  3T1Y Q;  4X64 L;  1I94 Q;  2UUA Q;  3UE1 A;  4JI7 Q;  3AEV A;  3AFQ A;  1PH8 A;  4A3D H;  4DV0 Q;  2EIF A;  3M9B A;  1XMO Q;  1IL2 A;  3PSI A;  1EUJ A;  1Y1V G;  4A3K G;  1VQK A;  4JI5 Q;  1G29 1;  4B3R L;  3TRE A;  4AH6 A;  1X9N A;  2VUM H;  3K7A H;  4DR4 L;  2WAQ E;  3F2B A;  5C44 G;  1SE8 A;  3OTO L;  5C4X H;  2KHI A;  4A3M H;  2CCZ A;  4A3G G;  4LF6 L;  1JJC B;  4DUZ L;  2VW9 A;  1QVG A;  2H5X A;  2UUC L;  2JE6 I;  4GOP A;  2BA0 A;  3FKI G;  1J6Q A;  1V1Q A;  3GDE A;  4X66 L;  3PV0 A;  2VQE L;  4KHP Q;  4QL5 A;  1OXV A;  3T1H L;  5M3F G;  1FVI A;  1SMX A;  3I56 A;  4DV7 Q;  1VQJ A;  5C0X J;  2CWA A;  1VQO A;  2HHH Q;  4BY1 G;  1KL9 A;  1NMG A;  5JJK A;  2N8N A;  4MNO A;  5BR8 Q;  1FGU A;  1WYD A;  4A3F H;  1Q81 C;  3H3V I;  2R92 G;  4A3L H;  3UDI A;  3D31 A;  3JAM c;  5IYC G;  1L1O B;  4JG2 A;  2I5H A;  2PI2 A;  4P74 A;  4A3I H;  1X54 A;  2Q2U A;  4JV5 Q;  3U50 C;  3CCR A;  3TS0 A;  1PH6 A;  1YVC A;  4C3I H;  1A0I A;  2VNU D;  1C9O A;  5AJ3 Q;  4DV2 Q;  1TWH H;  1XNR Q;  4DR7 Q;  3UDF A;  3MXN B;  3EN2 A;  1KRT A;  5IP9 G;  2MQH A;  1MIU A;  3M3Y H;  3GTK H;  1WI5 A;  5IP7 H;  4JBK A;  1YEZ A;  3A5U A;  1GO3 E;  3HOX G;  4C3J H;  3CME A;  1S72 A;  3J81 j;  2UXC L;  3TS2 A;  3G71 A;  4DR5 L;  3A0J A;  4LFC Q;  1H95 A;  1E7Z A;  3UE0 A;  2Y0S E;  3F2D A;  2Z0S A;  5ELN A;  4NPS A;  2PQA A;  2I5M X;  4DR6 Q;  1X56 A;  2IX0 A;  3U4V A;  1VQL A;  3HKZ E;  4MTN A;  3I4M H;  2NZH A;  2VS1 A;  2WFW A;  4YWK A;  4X6A H;  2HIX A;  4YWL A;  5LMN L;  1YJW A;  2EQS A;  1TWG H;  1IBK Q;  5FJ8 G;  1BKB A;  4C3H H;  2AWN A;  1X3E A;  1HNZ L;  2K52 A;  1HR0 W;  2ASB A;  4A93 G;  3H3V H;  3PF4 A;  4DUY L;  4OX9 Q;  1XMQ L;  1HNX L;  4EQ5 A;  1XNQ Q;  2HT1 A;  3TEH B;  3S14 H;  3FHW A;  2NVY H;  3W1B A;  3CAM A;  4NXN Q;  1X65 A;  4OWT B;  2R7Z G;  4B3T L;  3K0X A;  3EBE A;  4UPA A;  1VQC A;  2Y0S G;  4PG3 A;  1N36 Q;  1EYG A;  1VQ6 A;  4BXX G;  4DV5 Q;  1VCI A;  1VQB A;  3K7U C;  1HZ9 A;  1KIX A;  5GRO A;  3RNU A;  4X62 Q;  3HKZ G;  4KLK A;  4X65 Q;  5IYD H;  3J7Z C;  1K8A C;  4UY8 C;  4IO9 A;  2BH2 A;  4XIG S;  3S1R H;  4AQY Q;  1PYB A;  1Q1E A;  1N8R C;  2R93 H;  2YTY A;  1YNX A;  3GTM H;  4QY7 A;  4L5S A;  1PH5 A;  4LF5 Q;  2WP8 J;  1VQN A;  3HOY G;  1LM0 A;  3PUZ A;  2IHF A;  4NXM Q;  2CWP A;  2A1A A;  4IFD G;  2MFI A;  4JI1 L;  4XTC S;  2JA7 H;  4DK3 C;  4GKJ L;  2DGY A;  3HOU G;  3H15 A;  3I4N G;  1HNW L;  4HIK A;  1K73 C;  1VQP A;  2IT1 A;  3CW2 C;  4PMW A;  4DR3 L;  4JI6 Q;  5IY0 A;  5JJL A;  4LUO A;  4OXP A;  1FJG L;  1CKN A;  2R7D A;  2ALY B;  4KI0 A;  1KC8 C;  1I94 L;  1C7Y A;  3T1Y L;  1Q82 C;  2UUA L;  3E0E A;  5C0X G;  3W5O A;  4L5Q A;  4JI7 L;  1QVF A;  4NB3 A;  3I2Z A;  4DV0 L;  1XMO L;  1B8A A;  4DV3 Q;  1OXU A;  4UP8 A;  1HR0 Q;  2F4V Q;  4BY7 H;  2LXJ A;  4AIM A;  1EIY B;  3ULP A;  1VQF A;  3I55 A;  4K0K L;  4QJF A;  3HOW H;  4HJ8 A;  5IYB H;  1XPR A;  3S16 H;  1Y1W G;  4H02 A;  4WJ3 M;  3HOV G;  2RHQ B;  4A3J H;  1EQQ A;  3PO3 H;  4AYB E;  5GAH C;  4RMF A;  5JJI A;  2B63 H;  1QUQ B;  4O2D A;  1XTD A;  1E1T A;  3TQY A;  2JA5 H;  5M5Y H;  2BH8 A;  4JI2 Q;  3HFZ B;  4C2M H;  4DV7 L;  1SLJ A;  2HHH L;  4DV6 Q;  3CCM A;  4IPC A;  1V9P A;  2UU9 Q;  4GS3 A;  3WWV A;  1HJP A;  1X6O A;  3S24 A;  2XGT A;  1G51 A;  4QGU A;  2VZA A;  5ELO A;  2E2I H;  2RCN A;  2MNA A;  1IBL Q;  4JV5 L;  2ID0 A;  4A3B G;  1EIF A;  1Q8K A;  2JK8 A;  3J7A 5;  3GD7 A;  4IFD J;  5AJ3 L;  2VL6 A;  1Z47 A;  5FLM G;  4AYB G;  5C44 H;  4DV2 L;  1XNR L;  4DR7 L;  4GNX C;  5JEA J;  4GLX A;  3PF5 A;  4JBJ A;  2YTV A;  4A3C G;  3FKI H;  1B7Y B;  1UE7 A;  5DLQ E;  4IOC A;  4B3M Q;  4YY3 Q;  5M3F H;  2GVB A;  3JAM i;  2CKZ B;  4R4Q A;  2QEX A;  4LFC L;  3CPW A;  3M7N A;  4POF A;  1L1O A;  4PZ7 A;  2E2H H;  4BY1 H;  1KXL A;  3BZC A;  4P72 A;  3CCQ A;  2R92 H;  1X55 A;  3H0G G;  1Q1B A;  5IYC H;  1VQD A;  2YV5 A;  4YCU A;  2A8V A;  1PVO A;  1PH4 A;  4GN3 B;  3STB D;  2K14 A;  1IBK L;  3AFP A;  3GTO H;  4P71 A;  4JCV E;  3W1G A;  1NE3 A;  1WCM G;  2BA1 A;  3HOZ G;  4GOP C;  3NEN A;  1WFQ A;  2R6G A;  2YTX A;  4OX9 L;  1I50 H;  4LF9 Q;  2WAQ G;  1SN8 A;  2ES2 A;  1XNQ L;  2K5H A;  3Q8D A;  3HOX H;  1MKH A;  4JI3 L;  1HH2 P;  1OXT A;  3PUX A;  4NXN L;  2Z6K A;  2ZTC A;  1Q7Y C;  2VQF Q;  2VUM G;  4MZ9 A;  1OXS C;  4GLA C;  4B3S Q;  2CQO A;  3B6Y A;  4LUV A;  1N36 L;  4POG A;  4BBR H;  4BA2 I;  4A3M G;  1W3S A;  1MJC A;  4DV5 L;  1K0R A;  3E9H A;  3CCS A;  5H1S E;  4LF7 Q;  4X62 L;  1I3Q H;  1YI2 A;  2JEB I;  4JC0 A;  4YCV A;  1J5E Q;  3ULL A;  3GTQ H;  2UXB L;  1ASY A;  1I6H H;  1LYL A;  4GN4 B;  4IJH A;  4L5T A;  4LF8 L;  3ICE A;  3NEL A;  4IFD I;  4AQY L;  5FJ8 H;  1PH1 A;  4DR1 Q;  1IBM Q;  1QZG A;  1A62 A;  1K8G A;  4APV A;  4DV1 Q;  4LF5 L;  1EQR A;  3K8A A;  1L0W A;  5LMN W;  4NXM L;  1N34 Q;  2JA8 H;  3EIV A;  2ZTE A;  1U5K A;  1UWV A;  2CFM A;  3FP9 A;  4A3L G;  1D8L A;  3DLL A;  2R7Z H;  1JJG A;  1SR3 A;  2ZJP A;  2XTI A;  2MO1 A;  1YIT A;  4R4T A;  1KHI A;  3RLF A;  3M85 A;  4DUZ Q;  5C0X I;  4DAY B;  4X66 Q;  3K81 C;  3RLN A;  3KOJ A;  5M3M G;  4EX5 A;  5GQO A;  2K50 A;  2PMZ E;  3CQZ H;  3CC7 A;  1PYS B;  4JI0 Q;  4YHH Q;  1PH2 A;  1EWI A;  3G6E A;  4JI8 Q;  3GO5 A;  1N33 Q;  2OCE A;  2ZJR A;  3HOY H;  1HR0 L;  4GN5 A;  1K3R A;  1RIP A;  4LUZ A;  1Y14 B;  3F8T A;  1AE3 A;  3IRB A;  5HGQ A;  3M4P A;  2D0P A;  3HOU H;  3GTJ H;  2HIV A;  2B29 A;  3BU2 A;  1D7Q A;  2JJQ A;  1Z9F A;  2YYZ A;  3RZO H;  2UXD Q;  3CCL A;  1GM5 A;  5JEA G;  2YU9 H;  4JI2 L;  5K36 G;  3S1M H;  1HZA A;  3L7Z C;  5E7N A;  3RN2 A;  1JJ2 A;  3S2D H;  4DV6 L;  4OO1 G;  4Y52 H;  1X3G A;  1GVP A;  4ALP A;  2UU9 L;  3SGI A;  2I0Q A;  3STB C;  1PV4 A;  1JMC A;  1PFS A;  4GLV B;  4A4I A;  1AE2 A;  2JEA I;  2HQL A;  1IBL L;  4P75 A;  2OQ0 A;  3VDY A;  1NTG A;  1YJN A;  1QUQ A;  3LGJ A;  5LMN Q;  4LFA Q;  4R4C A;  5GAG C;  1Y1W H;  1AH9 A;  1RL2 A;  4JOI A;  4JI5 L;  2R93 G;  1WOC A;  3ZJY C;  4DUY Q;  1EOV A;  1HNX Q;  1ASZ A;  4B3M L;  2K5V A;  1CKO A;  2IHE A;  4YY3 L;  1I5F A;  3L2P A;  1A8V A;  1UE1 A;  1FL0 A;  4KHP L;  2Q2I A;  2KBN A;  3NBH B;  4JYA Q;  2E2J H;  4ME3 A;  4LFB Q;  4LWC A;  4DR2 Q;  4A3E G;  2IX1 A;  1PH3 A;  4QIW E;  2VY3 A;  1YHB A;  2F3I A;  5BR8 L;  3GTP H;  2JA6 G;  3I4O A;  1C0A A;  4P73 A;  1Y1V H;  3CF5 A;  4DV4 Q;  4A3K H;  3U4Z A;  4UP9 A;  3OW2 A;  1XPO A;  2B3G A;  3JC6 6;  4LF9 L;  4A3C H;  3GTG H;  3PUV A;  2C35 B;  1S3O A;  4BY7 G;  1KD1 C;  3ERS X;  4A3G H;  2ZTD A;  1W2B A;  1E1O A;  3KF6 B;  3J80 i;  1TWC H;  2VQF L;  4JI1 Q;  1VQ8 A;  4B3S L;  3PIO A;  3KFU A;  3E9I A;  4GKK Q;  3KLW A;  3KJP A;  4HJ7 A;  3CMA A;  1L2F A;  1KAW A;  1T9H A;  2LSS A;  3AYH B;  3MEF A;  5LMU Q;  1EFW A;  1TXY A;  4DAM A;  4DR3 Q;  3H0G H;  3TRZ A;  1HZB A;  1N32 Q;  1OXX K;  1J5E L;  2JA5 G;  3S1N H;  1DGS A;  4TVA B;  1WJJ A;  3PO2 G;  4YCW A;  4IJL A;  2DUD A;  3A74 A;  1E24 A;  5C3E G;  3G4S A;  4DR6 L;  4DR1 L;  1Q12 A;  2F52 A;  1SRU A;  1WCM H;  2PI2 E;  3J80 c;  1IBM L;  2UUB Q;  3HOZ H;  4QQB X;  3BJU A;  2E5L Q;  4DV1 L;  5HY6 A;  5GAD C;  1CSQ A;  3KDF B;  3NEM A;  1N34 L;  1CKM A;  1E3P A;  1QZH A;  1BVS A;  2ZM6 Q;  4GNX B;  4HJ9 A;  3M4O H;  4RG1 A;  2ATW A;  1UEB A;  1L1O C;  2GN5 A;  4HID A;  4K0K Q;  2OTJ A;  5IP9 H;  3RLO A;  4A3D G;  3CD6 A;  1VS0 A;  3G48 A;  4A76 A;  4LF4 Q;  1VQ9 A;  1VQG A;  4DK6 C;  1JB7 A;  1K83 H;  2EXD A;  4LW1 A;  5IE8 A;  1JT8 A;  1NBW A;  3F1Z A;  4JI4 Q;  2AHO B;  5C4X G;  2AKW B;  1TWA H;  4PZ6 A;  1UE6 A;  1VQH A;  4JI0 L;  4YHH L;  4X65 L;  5C4J H;  3OYY A;  1UE5 A;  3CC2 A;  4JI8 L;  4Y7N H;  3AQQ A;  1N33 L;  3A5Z B;  1OTC A;  1PH9 A;  2N49 A;  2E8G A;  3PCO B;  4BBS H;  2Z6K C;  5GAE C;  4GOP B;  5IWA Q;  4A93 H;  2IY5 B;  1VQA A;  4X64 Q;  3GTL H;  4IPD A;  4OON A;  1VQI A;  2R7F A;  3CCU A;  3M4Q A;  2OQK A;  1GKH A;  4A75 A;  3U58 A;  4A3F G;  2K75 A;  2NN6 G;  3UDG A;  3CC4 A;  3ER0 A;  1GD7 A;  3RZD H;  4DPG A;  3PUY A;  1YHQ A;  4A3I G;  4OO1 I;  4B3R Q;  2UXD L;  1HZC A;  4DKA C;  3RN5 A;  4R1J A;  1MJE A;  4HJA A;  4DR4 Q;  3KYH C;  1E22 A;  4IPG A;  1N9W A;  5M3M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...