3HOXG

Complete rna polymerase ii elongation complex v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoxG01
4HJ9A 1HR0W 3M4PA 4OX9Q 1LUZA 1JMCA 2K5HA 4YHHL 2QEXA 5IP9G 3KDFB 1Y1VH 1I5FA 1D8LA 3L0OA 3CC7A 3RN5A 3IRBA 4DR5Q 1VQ8A 4X6AH 4DUYQ 1N34Q 4KHPQ 1Y1VG 3A74A 4A3CH 4DK6C 3K7UC 3D31A 1PHJA 4FDBA 4RMFA 4BA1I 4HJ8A 2E5LQ 4A3LG 1M90C 1X6OA 1WFQA 2K5VA 2K52A 5ELOA 3CCEA 3WWVA 2K50A 4JI2L 3RR5A 4A3BH 4A3GH 1RIPA 1JT8A 1WOCA 3UDXA 3I2ZA 1XNQQ 2JEAI 4A3KG 1Y1WH 3MXNB 4IO9A 3CC4A 4A3BG 1K8AC 1GVPA 4LF9L 3DLLA 1Y1WG 1AE3A 1QUQA 2ALYB 4XTCS 2HHHQ 1VQCA 1KC8C 2UU9Q 1WI5A 1X9NA 2RF4A 4LNQA 1VS0A 1AE2A 3M85A 1C7YA 2VNUD 5M5XH 1VQNA 1YI2A 3I56A 2CCZA 4R4TA 4BBSG 4POFA 4GNXA 3CCVA 2WAQG 5FLXc 3M7NA 1KRSA 2ZTCA 3HOXG 4R4OA 3VDYA 4DR6Q 5IYDH 4GLAC 4LFAQ 2ZTEA 1OXXK 1GM5A 4LFBQ 1L1OC 3CMEA 1A63A 1V43A 1N32Q 1QZHA 2VZAA 3J7ZC 2GN5A 5IYDG 3F2BA 4OX9L 3W5OA 1SR3A 4JI0Q 2KBNA 1HJPA 3G48A 3PUZA 3CXCA 1C0AA 4A3FG 1VQDA 4IPGA 3CCJA 5K36G 5JJIA 4DR5L 3HOWH 3STBD 4QL5A 4DUYL 3GTGH 2WB1G 3S2HH 5E7NA 1YJWA 1CKNA 4OWTB 3JAMc 4C3HH 1FGUA 1I94Q 1IBLQ 2E5LL 2PMZE 1SMXA 4HJAA 5C3EH 2UXCQ 3FKIH 2Z6KC 3A5ZB 1TWGH 4JBWA 3EIVA 1K73C 1PH3A 5C3EG 2JA7H 4DR3Q 1M1KC 2MQHA 4OWXB 2VUMH 3CAMA 4GN4B 1V1QA 4A76A 1GD7A 1XNQL 2JA6G 2LSSA 4P73A 3NBHB 3K8AA 2AWNA 1Q8KA 3HFZB 4P71A 2VUMG 3PO3H 5IYBH 4IFDJ 2JQOA 2AHOB 2VY3A 3T1YQ 2B29A 3H15A 3TRZA 2HHHL 2I5LX 3J81c 2UU9L 5C4JH 5LMNQ 1TWFH 4A3DH 2YTXA 4GOPB 1R9TH 4PZ8A 2R7ZG 2D0PA 4A3EG 4BBRH 4A3DG 1Q1BA 3PF5A 4JI7Q 4JG2A 4JYAQ 1A8VA 2ZJPA 1PH6A 1PYBA 2N78A 5M3MH 4IFDG 2IHFA 1SE8A 4DR2Q 3CCMA 4DR6L 4LFAL 1G6PA 2VQEL 2HIXA 1Q86C 1MJEA 2Z0SA 2R7DA 1EIYB 3U4VA 3PIPA 4IPCA 3STBC 1QVFA 1N32L 2B63H 3M3YH 3PSIA 4JI0L 1VQBA 1YVCA 3TEHB 2ZJRA 2IY5B 1SLJA 2V1CC 1NJIC 4JI4Q 4Y7NH 4AYBG 3T1HQ 4Y52H 1XNRQ 3UE0A 4L5SA 1IBLL 4P72A 4X65Q 3H3VH 1YNXA 4DAMA 3JAMi 3L2PA 2UXCL 1BVSA 1SFOH 1YHQA 4QQBX 3K0XA 3MEFA 4DR3L 4LF7Q 2JA8H 5BR8Q 4JOIC 4YCVA 3F8TA 4O0AA 4PG3A 2Z6KA 4JC0A 5HY6A 1QUQB 4C2MH 4DUZL 3PF4A 2L15A 3T1YL 1YIJA 1E7ZA 2OQKA 4H02A 1YJNA 3PO2G 1HNXQ 1UE6A 1XMOQ 3NENA 4O2DA 5AJ3Q 4LUVA 5LMNL 1O7IA 3J81i 2Y0SE 4L5QA 4AYBE 3CMAA 1J5EQ 2BA0A 1JJ2A 1FVIA 3HOZH 2I0QA 4QJFA 4B3MQ 4POGA 2NN6I 5GROA 1NY4A 4JI7L 3S2DH 5IWAQ 1NMGA 4NPSA 4R1JA 3J80c 1PH4A 2JA5G 3HOZG 4DR2L 1SRUA 3KF6B 2KENA 1YBYA 2GVAA 1X65A 1Q12A 2OCEA 5JEAJ 1PH7A 5LMUQ 2KHJA 4LF6Q 2LXJA 1XPRA 3HOVH 3DM3A 4KHZA 1QVGA 2K75A 1NMFA 4DV4Q 1XMQQ 4JI4L 1CKOA 1CKNB 4GLXA 3T1HL 3KYHC 1XNRL 1EWIA 5FJ8H 4A3CG 2IHEA 4X65L 1VQLA 1OXTA 3AYHB 4DV5Q 2OWOA 3FHWA 4LUZA 5FLMH 5JEAG 3S16H 4LF7L 1QVCA 4YY3L 5BR8L 5C44H 5GADC 1HZCA 1NBWA 1TWHH 1FJGQ 1HH2P 4X64Q 3F2CA 4A3GG 3PUXA 2OTJA 2H5XA 4GN5A 2KCTA 4JCVE 3PIOA 3BU2A 4DV0Q 5C44G 2K5NA 1WYDA 1IZ6A 1Q46A 1L0WA 1BBUA 4HIMA 1Q82C 3CCLA 4JOIA 2PQAB 2CWPA 1HNXL 5IYCH 4DV1L 1XMOL 2A19A 4EX5A 2WFWA 1PH1A 1ASZA 4JI6Q 2I5HA 1X3GA 4A3MH 1MJCA 1J5EL 2XGTA 2OTLA 1VQFA 3OW2A 2R93H 1U0LA 3AEVA 4B3ML 1I6HH 4PZ7A 4JI5L 3PUYA 1HR0Q 1JE5A 1WJJA 2MNAA 2YTVA 4A75A 4A3MG 3J7A5 4K0KQ 3Q8DA 3TQYA 2R6GA 3CCUA 1OXVA 2YV5A 3B6YA 3J80i 3RNUA 1IBMQ 3KF6A 4JBJA 3UE1A 3BJUA 2F4VQ 2PI2A 4YWMA 1KL9A 3M4QA 4JI3Q 3KOJA 3CF5A 2YYZA 4IJLA 1EOVA 1L1OB 4BY1H 4LF6L 5JJKA 4OONA 2NVYH 3NEMA 3TREA 4A3JH 3PUVA 3RLOA 1N34L 2NVQH 4C3IH 4KHPL 2A1AA 4DV4L 4NXNQ 1H95A 3HOWG 1E1OA 3PCOB 5EAYA 1X56A 5LMNW 2ASBA 3I4MH 4X62Q 2Q2IA 3S15H 2B3GA 1Q7YC 4DV5L 2PNHA 2WAQE 2MO0A 4DV3Q 3I4MG 1LTLA 5DLQE 3FKIG 1U5KA 4DKAC 2JA9A 2JA7G 3HKSA 4J15A 1FJGL 1Q1EA 4LFCQ 1HNZQ 3S14H 4X64L 4DV0L 1KD1C 1N8RC 1HZAA 4BXXH 4DK3C 3GTJH 3PO3G 3I4OA 5IYBG 3S1QH 3GTOH 5IY0A 1OTCA 2PQAA 1VQAA 1GKHA 5HGQA 4JI6L 3RZOH 1E22A 1V9PA 2BH8A 1IYJB 2WB1E 3S24A 3KFUA 2NZOA 4B3TQ 1N9WA 4GKJQ 1UE5A 3BZKA 1VQMA 4GLVB 1HR0L 4IFDI 2VL6A 3KF8B 3OYYA 4BBRG 4AQYQ 3TS2A 2ZTDA 1CSQA 3CP0A 5C0XJ 4K0KL 3ULJA 2K14A 2NZHA 4LFBL 1SROA 5M3MG 4LW1A 4YWLA 1D7QA 1IBML 4X66Q 1VQ7A 4BY7H 5JJLA 3FP9A 2RCNA 1NE3A 2CQOA 5H1SE 1L1OA 2B63G 4BY7G 2Q2UA 4R4CA 1PFSA 3EN2A 1HZ9A 4JI8Q 3S17H 2JEBI 1YZ6A 3BZCA 4NXNL 4APVA 1I94L 4PZ6A 5C0XG 1JB7A 1K83H 4X62L 2YU9H 3PGZA 2CWAA 3M4OH 3HKZG 1VQKA 3CW2C 2ZM6Q 1TXYA 4DV3L 1VQ9A 2ES2A 3K81C 2F52A 4RG1A 1YEZA 2XTIA 3CCRA 1A0IA 1Z9FA 4OXPA 2JA8G 1HNZL 3ERSX 1B70B 4MTNA 2FXQA 3GTKH 3A0JA 2UXDQ 1HNWQ 4YWKA 2CFMA 4DV2Q 1I50H 2MO1A 3I7FA 1XJVA 1PH8A 2UUBQ 2E2IH 1WCMH 3AFQA 3CQZH 4QIWE 3RLNA 1PH5A 1VQEA 3GO5A 4A4IA 1PV4A 2UXBQ 4ME3A 4R4QA 2A8VA 1LM0A 4B3TL 1X54A 4GKJL 4JYAL 4JI2Q 1KAWA 3I4NH 3UDGA 3GD7A 4AQYL 3HKZE 4QGUA 1E1TA 1I3QH 1Z47A 4OO1G 4X66L 4QY7A 4JI1Q 1PA6A 1FL0A 4IOAA 1VQGA 4GNXC 3ULPA 3RN2A 3W1GA 2R92H 3GDEA 2R7FA 4R4IA 4JI8L 4HIKA 1A62A 2F3IA 3CCQA 4HIDA 4A3IH 4L5RC 3HOVG 4GKKQ 1MIUA 3ZJYC 5M3FH 1S72A 3CC2A 3E9HA 5GQOA 2N3SA 2DUDA 2NVXH 5IP7H 3CPFA 2N8NA 2E2JH 5J3BA 3ULLA 5FJ8G 1N36Q 2ZM6L 5IP9H 4IJHA 5IP7G 2PI2E 2ID0A 3E9IA 4LF8Q 1X3FA 4IPHA 1VCIA 2JJQA 4DPGA 5FLMG 4LF4Q 2YTYA 1AH9A 2N49A 3OTOQ 4TQUS 3D0FA 1EYGA 3S1MH 2UXDL 1HNWL 2HQLA 4A3LH 1Q81C 4DV2L 1BBWA 1GO3E 1CSPA 1K0RA 4TVAB 5AJ3L 2UUBL 5GAHC 1B8AA 1NTGA 2BA1A 3EBEA 2LXKA 5IYCG 3KJOA 2VS1A 2QA4A 2UXBL 3G6EA 1KHIA 3SGIA 4GS3A 4A3KH 4DAYB 5IWAL 2R93G 4UY8C 3CCSA 1K9MC 1W3SA 4MNOA 2IX0A 1IXRA 1T9HA 4L5TA 4OWWB 1YITA 1CUKA 4YCWA 5LMUL 4JI1L 2JE6I 4JV5Q 3S1NH 1VQ4A 1UEBA 2VW9A 1YHAA 4BA2I 1EFWA 4BY1G 1XMQL 4GKKL 5IE8A 3ER0A 4A3JG 3JC66 1PVOA 3G71A 1XPUA 2AMCB 3HOXH 4ALPA 1EQRA 1J6QA 1X3EA 1XTDA 2K4KA 1KQSA 1EQQA 2EXDA 2BH2A 2D62A 4WJ3M 3KLWA 2OQ0A 3L7ZC 1S3OA 2VQEQ 1N36L 5IT9c 4DV7Q 4A3FH 3E0EA 4LF8L 4UPAA 4DV6Q 4LWCA 3S1RH 1TWCH 2KCMA 1EUJA 4LF4L 4A93H 3KDFA 1CKMA 3GTQH 2EQSA 3OTOL 4DR7Q 4A93G 4KLKA 4LF5Q 4BXXG 1VQIA 4NB3A 2EIFA 2UUAQ 4UP8A 1Y14B 1YJ9A 4IOCA 3F1ZA 2QGQA 3NELA 3AQQA 2E8GA 3PUWA 2JA6H 3LGJA 3KJPA 3HOYH 1XPOA 1C9OA 4YCUA 4NXMQ 4DUZQ 4HJ5A 4B3SQ 1UE7A 3HOYG 4UP7A 1BKBA 1VQJA 2RHSB 2F4VL 4GOPC 4JI3L 2E2HH 1OXSC 1W2BA 2D0OA 4JV5L 2R7ZH 1N33Q 3HOUH 4A3EH 3CPWA 3AFPA 4DR1Q 1IBKQ 2WP8J 2Q2TA 2UUCQ 3HOUG 5C0XI 2JK8A 2AKWB 3H0GH 4P74A 3J81j 4HJ7A 3K80C 3RLFA 2IX1A 2CKZB 3H3VI 1E24A 4B3RQ 3H0GG 1UWVA 1K3RA 2VQFQ 5GAGC 4IPDA 4DR4Q 4P75A 1L2FA 3RZDH 1X55A 4C3JH 3PV0A 3U4ZA 1IL2A 3K7AH 1VQPA 4YHHQ 1B7YB 4DV7L 1VQHA 1G291 4LUOA 4DV6L 4MZ9A 4LFCL 3GTMH 2KHIA 3U58A 1E3PA 3U50C 3GTLH 1JJGA 1UE1A 2Y0SG 2IT1A 1RL2A 4JBKA 1P16A 1VQ6A 4DR7L 2ATWA 4LF5L 5GAEC 2DGYA 3UDFA 2UUAL 2C35B 1VQOA 1MKHA 1WCMG 5C4XH 3M9BA 1DGSA 1VQ5A 1JJCB 3TS0A 3W1BA 1S40A 1PH2A 4PMWA 5C4XG 4GN3B 1YHBA 1PYSB 2MFIA 4YY3Q 4JBMA 3I4NG 4OO1I 4NXML 2AWOA 4LF9Q 1QZGA 3PO2H 3G4SA 4B3SL 1KRTA 4WJ4A 1KXLA 1LYLA 1HZBA 1TWAH 1SN8A 4AH6A 3F2DA 1ASYA 2Q2HA 3UDIA 4AIMA 4EQ5A 1OXUA 4KI0A 4DV1Q 4HIOA 3ICEA 5ELNA 1N33L 3I55A 2NVTH 1EIFA 4DNIA 1PH9A 2RHQB 4GOPA 4UP9A 4DR1L 2HIVA 2HT1A 4GNXB 1IBKL 4XIGS 2UUCL 2R92G 3CD6A 3GTPH 2JA5H 4JI5Q 1K8GA 4BBSH 4A3IG 2NN6G 1G51A 5M5YH 2ZJQA 4B3RL 5M5WH 5M3FG 1KIXA 2VQFL 2I5MX 1P8LA 2GVBA 3A5UA 4DR4L
chains in the Genus database with same CATH superfamily
3FRPB 4X3KA 1ENAA 1LUZA 4BBSB 4YHHL 2NBFA 2NVXB 2N88A 5M5WB 5KT5A 2F0TA 2HHHH 2NU6B 4TV9F 4X6AH 3KBXA 1Y1VG 3JSNA 5FPRA 1BCPC 3A74A 2FFKB 3SK5A 4DK6C 3OIPA 1PHJA 2E5LQ 4RMFA 4MHEA 2DNEA 1GGOA 2K5VA 1WFQA 4RAZA 1EZ6A 1AUXA 3WWVA 3TP8A 4JI2L 4A3BH 1RIPA 1JT8A 2JEAI 2VQEH 1PLFA 1RK6A 2BQ3A 3CC4A 1K8AC 3J81W 4LF9L 1X3QA 5C8YF 4J9MA 3DLLA 1AE3A 1QUQA 4JI0H 2RF4A 1Y1WB 4TQRA 4KY7A 4IR9A 3R2IA 1VQNA 2B39A 1AP0A 4GNXA 1D5ZC 2RGRA 1U4MA 2WAQG 2MUYA 1BGWA 1CQVA 3TMEA 2GPWA 1F9SA 1SJHD 4R8UB 4R4OA 2ZTEA 3RTXA 2C2DA 1L1OC 3CMEA 3HOXB 1A63A 2BQUA 4DLKA 4NXMH 2GN5A 4DUZH 1W6KA 3W5OA 1TAEA 3J81E 2W57A 3OWEB 4CDFC 2ZDGA 2AGOA 1G6ZA 1C0AA 3KHRA 1TKWB 5JJIA 3CCJA 2RGVA 5LMNH 2F0NA 3STBD 5FO9B 3PMFA 3P20A 5F2DA 3PVXA 3DWQA 5E7NA 3JAMc 4OWTB 1I94Q 2E5LL 3VPCA 1OO9B 5C3EH 1AFPA 1GSOA 1K73C 1PH3A 3S2HB 4DR4H 4A76A 3TIGA 2JEFA 1S5ED 1JQYD 1SE3A 3I90A 4P73A 4ZCKA 1V1OA 2VUMG 3MWMA 4C56C 4FO2A 4RA8A 5EQ0A 5C4JH 2RDIA 3BJYA 3VPDA 4PZ8A 1Y8PB 5IT9L 2V4DA 1F2LA 3C0FB 4JVZA 3J80W 5KT4A 2ZJPA 4IR1A 4ECZA 1H9SB 1SE8A 2RDFA 4BBRB 2R7DA 1EIYB 3STBC 4XYLB 4OEMB 3M3YH 3I91A 3X3MA 3PZPA 1VQBA 4XZ3B 4K6DA 4C3JB 5ISRA 1SLJA 2V1CC 5C0XH 4QIWB 2EY6A 2D5DA 1WTXA 1KAAA 2NU9B 3J80E 4EFBA 1BVSA 1F9RA 3TP5A 1Z2NX 2AQ1B 3GTGA 4J9QA 4C5CA 4I7AA 3K3VA 5BR8Q 3ND8A 3F8TA 4LMQD 4JC0A 3NBHA 3PF4A 5KFZA 1TWGA 1YIJA 3KAJA 3PO2G 2DNCA 3E0JA 1AW7A 1HNXQ 2PZUA 2JA8B 1KTKA 1UE6A 3NENA 4J9RA 4RUAA 4KHPH 3J81i 2Y0SE 4RUCA 2IW3A 1M0TA 1IL8A 2MGSA 3OSOA 4N8X1 1JJ2A 4HCEA 5GONF 1EQTA 4B3MQ 1E4FT 3GTJA 3VYSA 1PFNA 1TWFA 4NPSA 3HOZG 2A69D 3KF8A 1RDPD 3NQIA 4OO1H 3ZYYX 1WVLA 1R9TA 3KF6B 5CGKA 2M2LA 4XYOA 1QG7A 4NLGA 5JVH3 2OCEA 2D9UA 2KCNA 5ELDA 5LMUQ 4DF7A 2LXJA 5EDWA 3HOVH 2MPMA 3DM3A 4KHZA 3MFIA 4JI6H 2QDBA 4DV4Q 1CKOA 1CKNB 2X6LA 4DA2A 2B63A 1IW7D 3KYHC 4ECQA 1ZETA 3TINA 3QIAA 1VQLA 3N44B 4YAJB 4IALA 1TT2A 3M4YA 4EGVA 2KEEA 5JEAG 4K0KH 3S16H 5LL6b 2L4NA 5KRUA 4YY3L 3KUPA 5BR8L 1K83A 3HRZC 4X64Q 2YU9A 4DV0Q 2KCTA 3U9TA 1A9XA 5C44G 1ENFA 1WYDA 1L0WA 1SFOA 3CCLA 5KFVA 1FKAH 2CWPA 1HNXL 5IYCH 4DV1L 3MFYA 1EZ1A 1TWHB 1ASZA 1J9OA 4OL7A 3D3RA 5KGUA 1SXTA 4A3MH 3GTKA 1VQFA 4B3ML 1I6HH 1HR0Q 3PUYA 2L55A 4X3TA 1WCMA 2C00A 4DV3H 2K04A 2R6GA 2YV5A 3J80i 3RNUA 3LP8A 5L1IA 3SK4A 4RB1A 3CF5A 2NU8B 2WKCA 1GYFA 1IW7C 2HD3A 3NWSA 4QB4A 4S3SA 2Q8TA 1HTPA 4DK0A 4BY1H 3T1YH 1M8AA 1QNKA 3TREA 4EGQA 5DLGA 3RLOA 4J9OA 3EPIA 3MEHA 4DV4L 1CQFA 3PCOB 2SNMA 2ASBA 3I4MH 5BPFA 4X62Q 4ZOLF 2XNAC 4B08A 2B3GA 4C3HG 1Q7YC 5ELFA 2PNHA 2F03A 5KFPA 3R23A 3CRLC 3FKIG 3IG0A 1B6SA 1C8CA 4X64L 1AN8A 3MXGA 5CA1F 5C4ZA 4DV0L 1KD1C 2W6PA 4H0LC 1CZWA 3MVVA 3VYRA 3I4OA 1GKHA 4IUQA 3U9OA 3RZOH 5KFAA 1V9PA 3KFUA 2WB1E 3I72A 2W71A 2NZOA 4B3TQ 4GKJQ 2JXMB 1HR0L 4BBRG 2FE3A 1VF5C 1DD2A 3SK6A 3MR5A 2F0OA 2K14A 2NZHA 4LF7H 5FD5A 5KFOA 2R93A 3LWUA 1DM0B 4X66Q 4MA5A 1VQ7A 3JAML 4BY7H 3AMUA 4J9PA 2RCNA 2XIWA 3WO0A 1L1OA 1ET9A 4F4XA 2OF1A 2Z8LA 1PFSA 4R8IA 1HA5A 5DG7A 2C28A 1CHPD 3BDCA 3S17H 2JEBI 1YZ6A 5IGFA 3R5XA 2TSSA 1JR0D 3E3XA 3CKIB 1GHKA 2NVYA 4X62L 5KT7A 3BVZA 5IWAH 3IFTA 2F0GA 2ES2A 2F52A 1V8QA 2XTIA 3PW7A 1XXGA 1LACA 1HHVA 4OXPA 4O3OA 2JA8G 2C9OA 5KFHA 1DV1A 1HNWQ 4LF6H 3NTHA 5KFQA 1I50H 2OXPA 3I7FA 1XJVA 2UUBQ 1GSHA 3QZ7A 3AFQA 4QIWE 3CQZH 1N48A 3A56A 5DG9A 2C2EA 1VQEA 4GKKH 1LTGD 4R4QA 4B3TL 5EPKA 4GKJL 3J7AV 3K5HA 3I4NH 4DV5H 4FP5D 3H4BA 1G8ZD 3V4ZA 1E1TA 2EYJA 1FNUA 4ZHQF 3KHLA 3W3AA 2EY5A 2EY1A 4X66L 4QY7A 5D65A 1STNA 4JI1Q 1SDFA 3FMCA 1A3UA 3ULPA 3O13A 1I3QB 5CV8A 5J39A 3GDEA 3QFFA 3KLSA 4HIKA 5EBCA 2E2DC 2FINB 2NN6H 1MIUA 3CC2A 5GQOA 1MZBA 2DUDA 2N8NA 2PBZA 2Z1CA 3ULLA 3DXJC 5FO8B 3GIKA 4IJHA 4CKEA 2PI2E 2ID0A 1IBMH 4F50A 2W6ZA 1AH9A 2F4VH 2E2JB 4JI3H 1PTOH 5IGEA 3D0FA 3S1MH 1HNWL 3S16B 3M7GA 1GO3E 1MHWC 4G7OC 5AJ3L 2UUBL 2BE5C 1EHIA 2Q8IB 1TY2A 1BUVT 3EBEA 4IZ8A 4AYBA 3SGIA 2HVQA 3I12A 3OIQA 4DAYB 5HV6A 4MN3A 1Z2PX 1K9MC 3TP6A 2IX0A 3DHQA 4L5TA 1T9HA 1I6HB 1YITA 2X69A 1D1KA 2CH4A 4JI1L 2NWGA 3T4AC 4DAVA 2I46A 2KQ3A 2VUGA 2YZGA 3GV5B 1YHAA 2WV6D 1RYSA 4IUNA 1XMQL 5KG0A 5EKKA 3ER0A 3JC66 1XX8A 3OSNA 1LTID 1X3EA 2K4KA 1NCVA 2EXDA 2F0EA 5JOBA 1O75A 4PQXA 4ECRA 2OQ0A 1LTRD 2PYKA 1S3OA 3W2DA 4RB2C 2K28A 1DXMA 2QILA 3S1RH 2UVRA 4IUTA 4UHVA 5DM63 5KFJA 1EWCA 2RKSA 4A93H 3OUZA 4IWXA 5FLXL 1D2BA 1DCZA 1UUPA 1IHZA 4NB3A 2A68C 2UUAQ 4UP8A 2RDGA 1I4HA 1O78A 2YZMA 3GTQB 4DXGA 1K0SA 2QGQA 3MR6A 3AQQA 1JB3A 3PUWA 3RZOB 3LGJA 3R8BA 2I8CA 1KDBA 5KFSA 3G6VA 1K1QA 1KJ8A 4Q8EA 4KJNA 4YHHH 3HB9A 2JA6B 1Z6HA 3R3OA 4GOPC 1KIXA 3RAXA 1OXSC 3HOYB 2D0OA 4Q44A 3PQIA 2UXDH 3OOCA 2HVSA 5CR3A 4DR1Q 2WP8J 2Q2TA 2UUCQ 3HOUG 4TUYF 4M9UA 2UXBH 1S5BD 3RLFA 4A3EB 2PMZA 4I55F 4B3RQ 3H0GG 1UWVA 3QOJA 4JI2H 2VQFQ 5GAGC 4P75A 1PRTB 1U4PA 4NW2A 3RZDH 4LMYA 3BQ0A 3T5LA 5DLFA 3U4ZA 3K7AH 1EY4A 4QF4A 1B7YB 4LF9H 4LUOA 4LFCL 2HVRA 5CV9A 1JICA 1VMPA 1D5MC 3TP7A 3V2TA 3WOEA 3PR4A 1DZ1A 5ELEA 2KECA 2PVPA 3MFHA 3GTMB 2Z4HA 2UUAL 4O2BF 3GTLB 1GHJA 1DGSA 4IZOA 1VQ5A 1JWUD 1GUNA 1ZXTA 3KTMA 3TS0A 1MD2D 5EKIA 1S5FD 5KYIA 4GN3B 2FK3A 2NTTA 1PYSB 2ASDA 4RZRA 3PO2H 1G91A 4ZKCB 4LF4H 1LYLA 4G3IA 3OTOH 4JV2A 4KI0A 5KEEA 4C5AA 4J9SA 5ELNA 5C4HA 4DL7A 4UP9A 4DR1L 2HIVA 2HT1A 5T14A 3NUCA 1SSOA 4GNXB 2UUCL 1TA8A 5FLXW 3K5OA 2F0DA 1BOSA 4EEQA 4JI5Q 1Y69U 4GC6A 4BBSH 4B3RL 5M5WH 3I70A 2VQFL 2I5MX 3H94A 2GVBA 3A5UA 1IKLA 4OELB 4HJ9A 2XN9C 3M4PA 2F0VA 4OX9Q 2K5HA 5ELCA 2QEXA 5IP9G 5M5YB 1HRJA 3KDFB 1I5FA 3L4KA 4ZK9B 5JPNC 3CC7A 3RN5A 1XYIA 5KFLA 2M9VA 4DR5Q 1VQ8A 1BCPF 1XWEA 4DUYQ 1N34Q 1MSHA 3OW7A 1STBA 4FDBA 1Y1VB 1M90C 4JV1A 5FLXE 5JEAH 2LY7A 5KFMA 1Y1WH 3MXNB 1FR3A 4DV6H 3RGZA 2ALYB 4XTCS 2UU9Q 1VQCA 4A3GB 1BO0A 3ND9A 1AE2A 3M85A 3D8GA 4N9PA 1YI2A 3I56A 4U673 2CCZA 3DEOA 2VR1A 3RGXA 3CCVA 1TWAA 2K7VA 1R4PB 2YRXA 4DR6Q 2WAQB 2JP1A 4GLAC 4LFAQ 1SYXB 1OXXK 4LFBQ 3MXPA 5KT3A 3BQ1A 1TIID 1OWTA 1VMCA 1N32Q 3GTPA 3HGBA 1NAPA 5IYDG 4OX9L 3NXWA 1E4GT 3G48A 2V9WA 1JXLA 4LH7A 2ATLA 2FMMA 3R93A 1K3BC 5D3DA 4DR5L 4DUYL 5KG5A 1N33H 3L3OC 3S2HH 3QB3A 5EBDA 4C3HH 1ICWA 5EPLA 2WTFA 2UXCQ 3FKIH 3HOWB 2IBKA 2BDNA 3GTGB 2DIKA 3A5ZB 2FLNA 2ZXOA 3GILA 5I2YA 1KLUD 4GN4B 1V1QA 3C46A 2JA6G 2LSSA 5L1KA 3A7LA 3NBHB 3K8AA 2AWNA 1Q8KA 2K05A 3HFZB 1TWGB 3MR2A 3H15A 2G9HD 2VUMB 2X6GA 2NYZD 2UU9L 1XTCD 2YTXA 2R7LA 4YAKB 2BDOA 3D4RA 3PO3B 4YB8B 4YR3A 1HQMC 3PIP3 2D0PA 4A3EG 1FNVA 4BBRH 4A3DG 3PF5A 4JI7Q 4HMIA 4JYAQ 1TWFB 2ASJA 1A8VA 1PH6A 1PYBA 2V4QA 1NR4A 1R9TB 1TY0A 1G2SA 1ET6A 4DR2Q 4DR6L 1S0MA 3RMHA 4LFAL 4ZYSA 1G6PA 2HIXA 2ALZA 2Z0SA 4YY3H 2ICEC 5EWFA 1N32L 4QWBA 2H4OA 2DJFC 1G2TA 2MHVA 1VAJA 4LJZC 3TEHB 3P75A 4HYKA 4DV1H 1NJIC 4XQQA 2B63B 4Y52H 5T1IA 4O4HF 4MTEA 4FXKC 4ME5A 4X65Q 3H3VH 4YBZB 2EXZA 4B3MH 4KN7C 1TS4A 2EYOA 2UXCL 3D6CA 4RCOA 1L0YB 4KJOA 3HKZB 2JA8H 4KKTA 4F4YA 5D8DA 1ZYRD 2F3VA 1UC9A 4O0AA 1A6XA 4PG3A 2K03A 2O5JC 1BNCA 1LTTD 2L15A 5LOVF 3PW2A 3HP3A 2OQKA 4H02A 5KG6A 2JA7A 5LL6S 4FXGC 1O7IA 3PO2B 4C2MB 4O4IF 3CMAA 5EWEA 1EFID 1J5EQ 2AGPA 2BA0A 3BVMA 1FVIA 4RAUC 1BJTA 1NUCA 1S68A 5GROA 4JI7L 1BNZA 4RHSA 4Q0YA 2UVUA 1ZHQA 4PV1C 4R1JA 3BG3A 1PH4A 2PNRC 3DF7A 2F1MA 1B6RA 4DR2L 2W6NA 3HOZB 2B2UC 1EYZA 2KENA 2GVAA 3BVGA 1X65A 4X64H 5E1FA 4B9XA 1PH7A 1Q90A 3GIJA 1I6UA 4DV0H 2KA7A 2EDGA 1XPRA 4HNTA 3OMGA 2K75A 5CBEE 3C1FA 4ED6A 2F0PA 4ECTA 1BCPB 1SYGA 2IHEA 4A2AA 4X65L 1ZYRC 4HNVA 3AYHB 1HR0H 3WO1A 2LS01 1TVXA 1GOZA 3TSSA 1FJGQ 2QF7A 1TWHH 5GADC 4A3GG 2OTJA 1HH2P 1QCBD 3PUXA 2H5XA 3PIOA 4JCVE 5KG1A 3BU2A 1T5XD 3PW5A 5C5MA 1IZ6A 2J4XA 4HIMA 4JOIA 5C44B 3LWBA 4IN3A 4MTKA 2B2TC 3V96A 4DL2A 1J5EL 1IBLH 2XGTA 1GSAA 3OW2A 1X32A 4M7EA 3AEVA 3UQ8A 4X62H 4TSSA 1PK8A 1K8OA 2MNAA 4A75A 2FJZA 3CQZA 1SYDA 2EOTA 4UCRA 1MSGA 4U68A 3UE1A 1WD1A 3KOJA 4MA0A 4RB0A 3RF2A 2RVLA 1L1OB 5EOYA 4ECYA 4OONA 2RQXA 3BYYB 2PW5A 3C1EA 3MC0B 5KT2A 3RB3A 2A1AA 4NXNQ 3A8IE 3D4DA 4FF3A 3HOWG 1E1OA 1WTWA 1X56A 3V6HA 2NVYB 1M0WA 1KABA 3FVQA 4B3TH 4WFN3 4A3JB 3D4WA 1AZQA 2JEJA 1D1IA 2WAQE 4K14A 2G5DA 1LTLA 5DLQE 5FOBB 5DAUA 4C3HB 3NSWA 4KK7A 3FPPA 4FS1A 4J15A 3FKIB 1FJGL 1HNZQ 4X66H 4FXDA 1LT6D 3EROA 1HZAA 3M9MB 2F4IA 3PO3G 3BABA 1OTCA 1VQAA 4R8NA 5HGQA 4JI4H 4ID6A 1E22A 2DY7A 3TIIA 4ZI7F 1XNRH 3S24A 1JLLB 1EY7A 5JQWA 1PFMA 4WBNF 3GTOB 4APMA 4IFDI 3OYYA 2VXWA 1SE2A 3T5JA 3TS2A 3QZ8A 2ZTDA 4KD3A 3BYTB 3QOLA 1M6VA 3ULJA 4MAMA 5JVLA 2YL2A 2ZDQA 1A3TA 3FP9A 4IRDA 2CQOA 4CDCC 2B63G 1HNWH 2R8HA 4DNTB 1XMOH 2HCIA 4R4CA 4U6PA 3MR3A 4EBEA 1V4YA 4HSVA 4NXNL 4APVA 1I94L 2EPBA 1ZHSA 3PGZA 3HKZG 1RTOA 5C5JA 1PX2A 1SNDA 1Y8OB 2ZM6Q 1TXYA 1IKMA 5KFNA 1JOOA 1KEEA 3CCRA 3BDLA 1Z9FA 3MWDA 1HA6A 5KFCA 4ECVA 2NZ1D 1HNZL 1KBLA 3V6JA 2FXQA 5KFXA 1SMYD 3A8KE 4JI1H 1QWYA 2R8IA 1KLGD 1T94A 5C3XA 1CK1A 1XMQH 1QE6A 3GO5A 4HR7A 1KNEA 2E76C 4ZUIA 2VQDA 3TBIB 2A8VA 3VA5A 2K32A 4I65A 2A73B 5EJWA 1KJJA 3GD7A 3BA9A 1EEFD 3HKZE 4A2BA 5CAEB 1I3QH 4G7HC 2J9GA 1JIHA 5I6WA 1Z47A 2YRWA 1EZ8A 2EJFC 1PA6A 4MV1A 2QW7A 4J1MA 1HTLD 3LX0A 3RN2A 4XQJA 5D1OA 4R4IA 1A62A 4HIDA 3JZIA 4L5RC 3ZJYC 4MV9A 5JUMA 3E9HA 2N3SA 4K5XA 2R92B 3CPFA 2E2JH 5IT9W 5FJ8G 4A3IB 1N36Q 1BBXC 2ZM6L 1SJED 1SMYC 1EU4A 2K5WA 5IP9H 4YIJA 5IP7G 1E4EA 2R7MA 3OHAA 5FLMG 2YTYA 3RB6A 4TQUS 3K5NA 2HQLA 3KLSX 1S10A 5DGBA 1BBWA 1K0RA 1NR2A 1EL0A 2IL8A 3EQLC 1U4RA 3NBIA 3RB0A 1V1PA 5E3FA 2W9BB 2A69C 2BA1A 4ULLA 2Y0SA 2LXKA 3EVQA 4NDXA 2QA4A 2R87A 1Z2OX 1CE8A 2E2IA 2R93G 2A6ED 4UY8C 1IYUA 3CCSA 5IT9E 2ZXPA 2RDHA 1O7LA 2XVSA 4QWCA 1BXTA 3Q0AA 3CU7A 1CUKA 4A3KB 4OWWB 5KT6A 1ZEQX 4LFCH 5BN3A 5LMUL 1DV2A 4JV5Q 4O3QA 2B2UA 3ONAB 2VW9A 4RKBA 2CW0D 4HQ6A 2W6OA 1EFWA 1R4QB 3KK7A 3GIMA 3QO2A 4A3JG 4N8FA 3SE7A 2UUAH 4ALPA 2PMZB 3S1NB 1EQRA 1KQSA 2BH2A 4WJ3M 2D62A 3VR2A 1GUGA 2O5IC 2VQEQ 1N36L 4DV7Q 1S0NA 2MP1A 2NVXA 2KCMA 3CVZA 4YP3A 3BQ2A 3GTQH 2IX3A 3MHBA 3ETJA 4R9WA 2PO4A 2W9CA 4LF5Q 3JRXA 4BXXG 1VBGA 4DGZA 4IOCA 3H6MA 4C1NI 2PZWA 5KNCA 3F1ZA 4RU9A 2JA6H 2K01A 1AZPA 4B3RH 2CW7A 2B2TA 5KIXA 3HOYH 1QNUA 3K6OA 2VQFH 1C9OA 2M00A 4YCUA 4NXMQ 4DUZQ 4HJ5A 3V05A 4O3SA 2RHSB 4ZUJA 5C1PA 1W2BA 4KY5A 2HDLA 1WR2A 3H09A 4JV5L 4A3EH 1MGSA 4DV2H 1KJIA 1Y1WA 4CJ1B 3K5IA 3AFPA 1EY6A 2LKVA 2IPKD 4HCSA 2FPPB 4UCSA 2F0JA 2E2HB 5C0XI 2XCPA 1S4ZA 2AKWB 4EYIB 1EIHA 1SBBB 3HOUB 3N52A 5JPMC 4HEDA 4IHJF 1K3RA 4DR4Q 1L2FA 4R8UA 4QWDA 3H0GB 1F2ZA 1DOMA 3PV0A 1IL2A 1VQPA 4MV8A 4DV7L 2R61A 1G291 1ILPA 3GTMH 1T3NA 1E3PA 3GTLH 3PW0A 1SNOA 1DOLA 1UE1A 1WTRA 4JBKA 1P16A 1VQ6A 4LF5L 2F3WA 5GAEC 2DGYA 4ILWA 1TWCA 1IOWA 2C35B 4O3NA 4RNNA 2F0KA 1WTHA 2WB1A 1CQIB 1L0XB 3W1BA 1PH2A 2KJXA 2KCCA 5C4XG 4Q8FA 1LLRD 1YHBA 1AUVA 2MFIA 2QDLA 4Y8VB 1B3AA 4OO1I 4NXML 2GPSA 2A5HA 3G4SA 1RYRA 3DUZA 2B2VA 5EWGA 1RJQA 4TQSA 2LMCB 4DXFA 1EIFA 4DNIA 4RNOA 4DUYH 4MV6A 5IIFA 3CD6A 4XIGS 1TWAB 2R92G 3HBLA 4XT1B 4MV7A 2EJMA 5KFGA 4G7ZC 4A3IG 3OPOA 2R7ZA 2XGPA 1G51A 5M5YH 2OLSA 2C2RA 3Q6SA 1H9SA 3P1HA 4DR4L 1WSCA 3GTPB 1JORA 1HR0W 2K33A 2LFNA 1JMCA 1HFGA 5I9PA 1JWMD 1Y1VH 4FM9A 2ASLA 2XCLA 3UFXB 1DJRD 2EVBA 3L0OA 3K3PA 3OHBA 2BCOA 3IRBA 4TKOB 1JOKA 4KHPQ 1RJPA 3JAMW 3MFGA 3LMLA 4QIWA 4JUZA 1X6OA 2K52A 4EBDA 2JEGA 4I50F 4EQPA 2K50A 5DM73 3NE5B 2R7NA 4IUVA 4A3GH 2R3ZA 1VDZA 1BXRA 3I2ZA 3WOFA 1XNQQ 4DR6H 4LFAH 4A3KG 1WTPA 2F0QA 2W8KA 3A55A 4IO9A 4A3BG 1PZJD 3M9OB 2C5CA 2AGQA 4IUUA 1B44D 1KC8C 2N55A 1WI5A 4JW0A 1X9NA 4LNQA 5KNDA 1C7YA 2IWHA 4DR7H 3JAME 1IOVA 1ESRA 3T13A 3P7JA 4L63B 2L0CA 2JN4A 3KLRA 4CDEC 4EGJA 5M5XB 1KRSA 2ZTCA 4O4LF 5BN4A 1GM5A 3NK9A 1V43A 1QZHA 2VZAA 3VR6A 2JA5A 3E6ZX 3MTSA 1TR5A 5E4XA 1VQDA 4IPGA 2HJWA 3HEJA 3HOWH 3GTGH 3I4LA 1EUDB 3NP8A 4MIUA 4H7BA 4EEYA 1CKNA 1IBKH 1QILA 5CV6A 2WIIB 2PMZE 1SMXA 4HJAA 1EIGA 3HS0C 1TWGH 4JBWA 3EIVA 4DNRB 2FMCA 5C3EG 4DR3Q 2VUMH 4LK1C 2DLNA 1PRTD 1GD7A 1XNQL 2Z9HA 4P71A 2MJ8A 3PO3H 4IFDJ 4V190 1JDBB 1Z7TA 2AQ2B 2JQOA 2VY3A 4QUFA 3T1YQ 2JA7B 3VMMA 1T5EA 2I5LX 3J81c 1STAA 1S0OA 2FLLA 1TWFH 1I6VC 5EKLA 4GOPB 1R9TH 1Q1BA 2JSOA 4JG2A 4A3DB 1RD9D 4G4KA 4CGYB 2NB0A 1E2ZA 2Z6BA 5A2QL 3RUPA 3CCMA 1Q86C 1EUCB 1QVFA 3QWNA 3U4VA 4IPCA 3PIPA 2B63H 4XDXA 3PSIA 5M3MB 1I4GA 3IFDA 4BS9A 4UAIA 2FLPA 3H91A 2A6HD 2VB3X 3T1HQ 5LXTF 3LWEA 2WKDA 3BA8A 3T5HA 2OEOA 3SR1A 5DG8A 4P72A 1J5EH 4IQZA 2W7OA 1YNXA 1FNWA 4DAMA 3JAMi 3L2PA 4Y7NB 3MWEA 1SFOH 1C4QA 2ZXRA 3J7AK 2WINB 1YHQA 2DWCA 4LF7Q 3MEFA 4DR3L 2R85A 4JOIC 5HURA 4YCVA 4C2MH 2Z6KA 1KNAA 1QUQB 4CBVA 3DMUA 5KG4A 5CORA 3T1YL 1E7ZA 1YJNA 2EY2A 4IRKA 4O2DA 4LUVA 5AFWA 2CVRA 1O80A 4L5QA 2HDMA 5E4WC 2E5LH 4K5WA 3HOZH 1PTOD 2I0QA 4POGA 4F87A 1GLVA 2NN6I 3V6KA 1NY4A 2PW7A 5IWAQ 1NMGA 3J80c 4KY6A 3EYYA 4TV8F 2DPJA 4DU9A 3G6YA 2YS6A 2VA3A 1SRUA 4LAAA 1FJGH 3S2DB 1YBYA 2A6HC 1B4OA 4UDUC 2KHJA 2HUGA 4LF6Q 2GLTA 1HUMA 2J0TD 4O42A 2KUMA 1MBYA 4DFAA 1J8IA 1LV9A 1NMFA 1CTMA 2XCAA 3T1HL 4RAYA 5NUCA 2FMAA 5FJ8H 4A3CG 4XYQA 4J0MA 4PNYA 2DN8A 4DV5Q 3EJIA 2QKIC 3FHWA 2YCHA 4LUZA 5FLMH 4DN4M 4LF7L 1QVCA 4HTHA 5C44H 1HZCA 4ZRZA 5A2QW 2XD4A 1EWHA 1KDCA 3DM1A 2K5NA 2W6QA 1Q82C 1PTOC 1GUTA 2XC9A 1JE4A 1PH1A 2WFWA 4ZAIA 2FPGB 2I5HA 3CRKC 5M9OA 4NXNH 2P5ZX 4I7HA 1I94H 1MJCA 4KTAA 2OTLA 2R93H 4JI5L 3I8ZA 4A3MG 3Q8DA 1ILQA 3B6YA 4RZQA 1IBMQ 1XDNA 3BJUA 1SYFA 2F4VQ 1KL9A 3M4QA 4JI3Q 2SDFA 5A2QE 1HNZH 2YYZA 4KKSA 5KFDA 5JJKA 4LF6L 2NVYH 3NEMA 4A3JH 3SVMA 2NVQH 1N34L 2CQAA 5I4DA 1I3QA 1C30A 1H95A 3Q8RB 4I7ZC 3BDOA 3TQ1A 1S9FA 3L4JA 3FEWX 4O2AF 4K8IA 4C3IB 2D2CC 4DV5L 3I4MG 2MO0A 3OSPA 1U5KA 4DKAC 2EZVA 2JA9A 3N6RA 3HKSA 2JA7G 1V51A 1Q1EA 3ORQA 4P2CB 3S14H 3S15B 1EOTA 4UCOA 4FS2A 4DL3A 3GQBA 4BXXH 4DK3C 1ENCA 2ZDHA 5IYBG 4ECWA 3GTOH 3J7AF 2PQAA 4KHVA 3I3CA 3FDSA 4HR7B 5KFRA 5CMDA 2BH8A 1A2UA 3GTJB 1N9WA 3S1QB 4EVOA 4GLVB 2VL6A 3KF8B 4AQYQ 1W93A 1SEBD 4DAYA 1I4RA 3L9AX 1CSQA 5C0XJ 2ZM6H 2KOLA 2ENBA 1UEAB 4ZLTF 4LFBL 2B2WC 5M3MG 1D7QA 5BR8H 1IBML 5J22A 1S03G 2H1EA 5D3IB 4ECXA 4BY7G 1HNXH 3VA7A 3ITPA 5D14A 3EN2A 1HZ9A 4JI8Q 5DQGA 3RV3A 2C22A 4PZ6A 5KFIA 1VF7A 2CWAA 1VQ9A 1EYAA 3K81C 1K83B 1EQVA 1U9RA 1A0IA 2YU9B 3M4OB 4ED3A 1SFOB 1JDEA 1K28A 1B70B 1S5DD 3ERSX 2UXDQ 1UAPA 5LMUH 3U9SA 2CFMA 1V1PB 1AEXA 4ODGA 1PH5A 4DV4H 1WH2A 4A4IA 1PV4A 3GTKB 4IRCA 2SEBD 2UXBQ 5BPHA 2UVWA 3G7LA 1LM0A 5KNBA 3GTQA 2RSOA 1M4VA 1WCMB 1CFMA 3NQTA 1KAWA 3MXUA 4RGTA 3FDTA 4JI2Q 1SYCA 4AQYL 2J6UA 4U7CA 4C1NK 2RA4A 5IGGA 5KX5F 5L1JA 4CJ2C 2CQYA 2JA6A 3NWTA 3QG1A 2F0LA 1O7ZA 1FL0A 3W1GA 2R92H 2XIGA 3Q8SB 2J6TA 2WACA 4JI8L 1B9NA 1RKNA 2F3IA 3CCQA 4A3IH 3MAQA 1B9MA 2J7ZA 4L1KA 2VPSA 3K59A 4RWSC 5M3FB 3E9IA 4R7RA 4LF8Q 5G3LD 3NTKA 1X3FA 3OUUA 1VCIA 2JJQA 1WTVA 4LF4Q 1M7JA 1BDOA 1ESFA 4QW9A 3GV6A 3OTOQ 4FYDA 1EYGA 2UXDL 4UFZA 2W9CB 2W9AA 2SCUB 4JV5H 1Q81C 1CSPA 3J80L 1JOQA 3GTMA 2RDJA 2UXBL 3G6EA 1E0BA 1KHIA 2RCFA 3GTLA 1A2TA 3DEPA 3OMCA 4GS3A 4A3KH 1I50A 5J2UF 3KHHA 5CA0F 1TQOA 1W3SA 4EQOA 4MNOA 4WORA 2R93B 2XWJB 1IXRA 3SI8A 4DV7H 2EE1A 4YCWA 2JE6I 4ABNA 3S1NH 2I80A 4RB3C 2W70A 3HXLA 4LF5H 1STGA 4HNUA 4DL6A 5IE8A 4CHTB 5CYUA 1XPUA 2AMCB 4C3IG 2PQEA 1J6QA 4GKJH 3TZUA 2NVQB 4PMCA 3KLWA 1FD7D 2EYMA 3L7ZC 5L9XA 1I7NA 2NUCA 1HFNA 1WTQA 3E0EA 4J6HA 4LF8L 4OGQC 4DV6Q 4FF4A 1GJXA 1EEID 4ED8A 4LF4L 3KDFA 3S9WA 2EQSA 5CBAE 3OTOL 1SNQA 4X3UA 3C3LA 3TN2A 5A35A 3GIQA 4JYAL 4A3FB 4A93G 1GUOA 1TWCB 2EIFA 3TDQA 3S14B 1Y1VA 2WB1B 3NTIA 4UCVA 1WTOA 2F0SA 4JK1C 3KXYT 1SYEA 3KJPA 3AB9A 1A15A 4RGMA 4LSXA 3H40A 1XPOA 1RCVD 2L1BA 2B2VC 2L12A 4X3SA 3MXNA 1LTAD 4B3SQ 1BKBA 2BOSA 2E2HH 2DJGC 4YJ3F 3MZ5A 1N33Q 3R2TA 2QCPX 1DOKA 3HOUH 2YYAA 3CPWA 2UUBH 2V5AA 2O4XA 1S5CD 2A74C 2JK8A 3H0GH 3J81j 4HJ7A 3K80C 2R7ZB 2VA2A 2IX1A 1SNCA 1E24A 3H3VI 1H9MA 4F4WA 2F0IA 2XSCA 1CZGA 2IJ0A 2WAQA 1HCZA 5F9LA 5CC4A 1VQHA 3FPUB 4RKLA 5EPJA 3TZDA 4F7XA 4DV6L 2BQRA 1EY5A 1STHA 5KFTA 1FGBD 1JJGA 4WRDA 4XX0B 2Y0SG 4RHRA 1D6EC 4QUCA 2ATWA 4RGOS 2ZT9C 4AYBB 1STYA 1VQOA 1MKHA 1WCMG 4J9NA 3M9BA 3H3VC 1JJCB 4RGNA 2B2YA 4NKLA 3WDNA 1S40A 1QJOA 2E74C 1QOHA 4CC5A 3IKJA 4YY3Q 5C4XB 4JBMA 2AWOA 1QZGA 4K6LA 4B3SL 5CV7A 2UVVA 5KFYA 1KRTA 4WJ4A 5KG2A 3F2DA 1TWAH 1ASYA 1HPCA 5I9OA 2Q2HA 3UDIA 4EQ5A 4DV1Q 2VUMA 2B2WA 1N33L 2OT2A 4K2LA 1PH9A 3SEBA 2F0MA 3GTPH 1TU2B 1CQJB 4C5BA 2NVTB 2KSWA 3CHBD 5M3FG 3OWFA 2K5QA 3E5NA 5J1ZA 4BBSG 5LP6F 3T51B 1GUWA 3N43B 1XNQH 2JA5B 3Q8QB 3KAKA 3RIZA 5KKNB 5KFKA 3F8NA 2QEJC 1YNND 1D8LA 1UNNC 1H9KA 1ML0D 2RBMA 5IODA 2O03A 4Q0FA 3MA2B 1DIKA 2XRQD 4ZQIA 4A3CH 1PMRA 3K7UC 3D31A 1Q8IA 2R8KA 4BA1I 4HJ8A 2HGSA 4A3LG 4Q45A 3PIO3 5ELOA 1BF4A 3CCEA 3N8DA 2K6AA 3RR5A 1WOCA 3UDXA 3SXHA 3HKZA 4DL4A 2F0HA 4M8AA 4OIJA 5K2MA 1GVPA 5FK9C 5LYJF 1I4PA 1PYWD 1Y8NB 1Y1WG 4A3BB 2HHHQ 1SEIA 4QWEA 2EYLA 3BG5A 2HCCA 4Q43A 1VS0A 3RB4A 2VNUD 5M5XH 2QK4A 1NSNS 4FF2A 4GZYC 4C2MA 4R4TA 4POFA 4BWSC 4EG0A 3M7NA 5FLXc 3Q2OA 3C2PA 1F77A 1D5XC 1YNNC 3HOXG 3VDYA 5IYDH 2R8JA 4DR3H 4HAEA 4QMGA 3J7ZC 1T36A 4L8JA 3F2BA 1SR3A 4JI0Q 1LO5D 4XYMB 2KBNA 1HJPA 3PUZA 3N42B 3CXCA 3GIPA 4A3FG 5K36G 2AQ3B 2YW2A 4E6IA 4QL5A 1ZKOA 5CV4A 1HQRD 2WB1G 4DR1H 4O3RA 3IN5A 2A6EC 1YJWA 1IBLQ 3GV7B 2UUCH 1FGUA 4Q5VA 4F8MA 1K8MA 4ED2A 2R7KA 1F2YA 1B50A 2Z6KC 2JA7H 1K1SA 1H9JA 1M1KC 1YNJD 2MQHA 4OWXB 1KDAA 3CAMA 5I47A 4ECSA 1II3A 1Q3LA 5C3EB 1JWSD 2CW0C 4FU0A 5IYBH 3VYTA 4EQNA 2AHOB 3RV4A 4NP5A 2B29A 3TRZA 2HHHL 4PMBA 5LMNQ 3Q23A 4A3DH 2X0SA 3R5FA 3T1HH 2O2LD 2R7ZG 1ZQ7A 3PR5B 4QW8A 5C4JB 5C5LA 3IL8A 3RBDA 2F0WA 4FVMA 4UCUA 2N78A 5M3MH 4IFDG 2IHFA 4PDBA 4ED0A 1LTBD 4ZKBB 2VQEL 1MJEA 2PN1A 3I73A 5JJZA 1HUNA 4BWGB 3H20A 4MV4A 4C3JG 5KG3A 1GUSA 3D6WA 4JI0L 4QCLA 5BMVF 1YVCA 1B33N 4LH6A 2XRSD 5FKAC 2ZJRA 2IY5B 2R82A 4JI4Q 4Y7NH 4AYBG 3M3YB 1XNRQ 2YS7A 2HQEA 2L5TA 1PRTF 1EYDA 1YNJC 3UE0A 1IBLL 4L5SA 2I87A 1SNMA 5FD6A 4JI5H 3A7AB 1JKJB 4K8JA 5JAVA 1RJTA 2B8FA 4IURA 4QQBX 3EA6A 3K0XA 4EYHB 2CH4W 5HY6A 4ECUA 4DUZL 4OHJA 2CZGA 4OX9H 3FKIA 3GP7A 2CW8A 5LL6X 1A3VA 4RCNA 1XMOQ 3SK8A 5AJ3Q 5LMNL 5DQHA 4DR5H 1N34H 1EY9A 2WE6A 2R86A 1W96A 2JEIA 1E2VA 4AYBE 4O1NA 4H44C 3GV8B 4NMZA 4QJFA 5IGDA 4CC6A 3S2DH 2BE5D 3G6JB 4FNFA 3GTOA 2K1BA 4KD4A 2SOBA 2JA5G 1ICFB 2YZNA 3N6XA 3UI2A 1B3QA 2P0AA 2DPIA 2IA6A 1Q12A 5JEAJ 4L6TB 5JVDF 3NHHA 4FF1A 4ETSA 3BAAA 2UU9H 3K57A 1L2ZA 3GIIA 3VPBA 1QVGA 2ICIA 4CJ0B 1XMQQ 4JI4L 4GLXA 1VKZA 1XNRL 1CM9A 1EWIA 3HOVB 5DQIA 2EJGC 2G9DA 5FPOA 2OWOA 2W7PA 5CV5A 2KVMA 1LT4D 3T53B 5H80A 4LFBH 1QB5D 1NBWA 3K0YA 4UCTA 1N32H 3F2CA 1H9RA 1LT3D 1SE4A 4GN5A 2FB9A 2AUJD 1B1ZA 1PTOF 1Q46A 1BBUA 2VB2X 2PQAB 4JI6Q 1XMOL 2A19A 4EX5A 1X3GA 3VR5A 3RFCA 3KBGA 2RSNA 1U0LA 4PZ7A 2JYOA 1F9QA 2UXCH 1JE5A 1WJJA 2YTVA 2A68D 3J7A5 4K0KQ 1PZID 3TQYA 3CCUA 4A3MB 3GLKA 1OXVA 2EYFA 5IGCA 3KF6A 4JBJA 4GC7A 2PI2A 4YWMA 5C3WA 4IJLA 1EOVA 1SAPA 4YJ2F 1EYCA 2K5DA 3PUVA 4J8QA 4KHPL 4C3IH 3GQCA 1CHQD 2AU0A 2AQ4A 5KFUA 3G6XA 1B53A 3Q24A 5EAYA 4BY1B 5LMNW 3DWPA 3Q8PB 4JI7H 2Q2IA 2DZDA 4JYAH 3S15H 2R92A 4RNMA 4DV3Q 2GA4B 4AQYH 3MWYW 3NPPA 4XXEA 1PDQA 4DR2H 3E5SA 2R6FA 3I4MB 5EZYF 5DNFA 5KYLA 1EY8A 2FPIB 4LFCQ 2VPQA 3EPGA 1B04A 5KFFA 3URYA 1N8RC 1JX4A 3GTJH 1SCUB 3S1QH 5KG7A 5IY0A 4JI6L 4MV3A 1TWHA 3HZXA 4JI8H 3ERQA 2M05A 2W9BA 1IYJB 4X65H 1UE5A 3BZKA 1VQMA 3Q22A 1JC7A 3QR8A 1RK5A 1S97A 2FK1A 3CP0A 5KFWA 4IUPA 4K0KL 1SROA 4LW1A 4YWLA 1CT1D 1PXUA 5JJLA 3K5MA 2OH2A 1NE3A 4DAPA 5H1SE 3ETHA 1SYBA 2Q2UA 1EU3A 1RF2D 1W6JA 4XQNA 5KFBA 4BY7B 3BZCA 2B8GA 3SHLA 4LSAA 5C0XG 1PRTC 1K83H 1JB7A 3N40P 5I6YA 2YU9H 5JH7F 3M4OH 1VQKA 1TS2A 3CW2C 3HG9A 3S17B 1KJ9A 4DV3L 4YR0A 1I4QA 3H4DA 4RG1A 2FK2A 5FO7B 1YEZA 1SNPA 4FBUA 1RTNA 5EGTA 1LT5D 4MTNA 3GTKH 3A0JA 4YWKA 1PFBA 4HSPA 4DV2Q 2MO1A 2R8GA 1PH8A 5K5PA 2E2IH 1WCMH 1I7LA 4ZQ3A 3FMAA 3RLNA 4DL5A 1KC7A 3VR3A 4ME3A 4MTDA 1I50B 4CKBA 4WD3A 1X54A 3CQZB 5C6AA 4YR2A 5LHY1 3UDGA 3WNZA 4QGUA 3RUZA 1ULZA 3N41B 3KALA 2EYPA 4LF8H 5TSSA 5D1PA 4OO1G 3T16A 3I4NB 1VBHA 1N56A 2F0FA 1JCKB 1VQGA 4CDDC 4GNXC 4IOAA 2FKLA 2VOBA 2L11A 2L9HA 2R7FA 5J2TF 3M4IA 4GKKQ 3HOVG 1AN7A 1BR9A 4YQWA 3M9NB 2E2HA 5M3FH 1S72A 1RHPA 1STEA 2KHSA 3SE0A 5IP7H 2NVXH 3QJYA 4H13C 2V59A 2BR0A 5J3BA 5DGAA 3Q1KA 1PZKD 3GV3A 3H0GA 3V4SA 4IPHA 4DPGA 5HGTA 1GXDC 2N49A 1O7YA 4KV6A 1C3OA 2IP4A 5IYZF 5L1LA 3T56B 4A3LH 4CKCA 4DV2L 4TVAB 2ZJTA 1RODA 5GAHC 1B8AA 3KHGA 1NTGA 1PTOB 5IGBA 5IYCG 3KJOA 2VS1A 3BS1A 3S1MB 3PN1A 1UC8A 4J9LA 5DEHA 1ONLA 2XWBB 5IWAL 1F9PA 1E2WA 3ORRA 2W6MA 2V58A 2WYOA 4F88A 1DYQA 1EY0A 1NNXA 3NGDA 3TQTA 1X3PA 2NU7B 1RJRA 4ED1A 1VQ4A 1UEBA 2CHBD 4QWAA 2V4RA 4BA2I 2W8LA 3JRWA 4BY1G 1UNSA 4GKKL 1PVOA 3LNNA 3G71A 1TS5A 3HOXH 5G3LF 1B2TA 1XTDA 4TRDA 2Z4IA 1FYCA 4I4TF 1EQQA 4RH6A 5L37A 4F4ZA 1IYVA 3K5LA 2F0UA 4ME6A 4E4TA 2PPBC 2IMWP 4HN7A 4XT3B 4HMJA 4KMUC 5IT9c 2PCFB 4A3FH 4UPAA 4EBCA 4LWCA 5K36H 1TWCH 5IOCA 1EUJA 4B3SH 1CA6A 1CKMA 4KKUA 3K58A 4DR7Q 2QYZA 1CS0A 4KLKA 1VQIA 2B2YC 3S1RB 4N9TA 4FBTA 1Y14B 1YJ9A 4A93B 4RFBA 4DK1A 3J7YW 5T1GA 3IAYA 2WDTA 5CB4F 3RJ0A 3GIDA 3NELA 1CA5A 3BZDB 4PWQA 2E8GA 5ELBA 1LABA 3A54A 2FHTA 4B9WA 5BN5A 5I2XA 4O3PA 4V0BA 2NTSA 2SNSA 4OIKA 1UE7A 3RAQA 2I07B 4KN4C 3HOYG 4UP7A 1VQJA 2F4VL 4JI3L 1KJQA 2XGQA 4K5VA 2R7ZH 5D1OB 2FP4B 1IBKQ 5KFEA 2EYHA 4P74A 4IFDH 3MJFA 2R84A 2Q8RE 2CKZB 5HBRB 3J81L 1E4EB 4JPBW 4IPDA 2TMPA 3SDZA 1X55A 4M1UB 4C3JH 2E75C 4IAJA 4YHHQ 2KEDA 4MZ9A 2KHIA 3R5HA 3VR4A 3U58A 3U50C 3RZDB 4JV0A 2IT1A 1RL2A 2J6SA 3K7AB 1WD0A 4DR7L 4Z9CB 2NUAB 2Y0SB 1BQQT 3RD4A 3UDFA 3JSLA 5C1OA 4ED7A 4K2KA 5C4XH 2AUKA 3RBEA 1BCPD 3PW4A 2E2IB 3OHXC 4PMWA 4J9KA 1N36H 3G8CA 3DWAA 3I4NG 4IWYA 1HXYD 4LF9Q 5COYA 3X3NA 5JVG3 1MI2A 4EFEA 1KXLA 5LA6F 1HZBA 4AH6A 1SN8A 1I4XA 4AIMA 1LTSD 4HIOA 1OXUA 3ICEA 1TS3A 3I55A 2NVTH 1U4LA 2RHQB 1DONA 4GOPA 3T5KA 1IBKL 2DY8A 4G57A 3VYUA 2JA5H 1K8GA 2FJ2A 2NN6G 2PZTA 3A8JE 4WJWA 2ZJQA 5F9NA 1F2MA 3EFXD 1C48A 3F2UA 3AU7A 2MCTA 1OXTA 1P8LA 1CI3M
chains in the Genus database with same CATH topology
4HJ9A 1HR0W 3M4PA 4OX9Q 1LUZA 1JMCA 2K5HA 4YHHL 2QEXA 5IP9G 3KDFB 1Y1VH 1I5FA 1D8LA 3L0OA 3CC7A 3RN5A 3IRBA 4DR5Q 1VQ8A 4X6AH 4DUYQ 1N34Q 4KHPQ 1Y1VG 3A74A 4A3CH 4DK6C 3K7UC 3D31A 1PHJA 4FDBA 4RMFA 4BA1I 4HJ8A 2E5LQ 4A3LG 1M90C 1X6OA 1WFQA 2K5VA 2K52A 5ELOA 3CCEA 3WWVA 2K50A 4JI2L 3RR5A 4A3BH 4A3GH 1RIPA 1JT8A 1WOCA 3UDXA 3I2ZA 1XNQQ 2JEAI 4A3KG 1Y1WH 3MXNB 4IO9A 3CC4A 4A3BG 1K8AC 1GVPA 4LF9L 3DLLA 1Y1WG 1AE3A 1QUQA 2ALYB 4XTCS 2HHHQ 1VQCA 1KC8C 2UU9Q 1WI5A 1X9NA 2RF4A 4LNQA 1VS0A 1AE2A 3M85A 1C7YA 2VNUD 5M5XH 1VQNA 1YI2A 3I56A 2CCZA 4R4TA 4BBSG 4POFA 4GNXA 3CCVA 2WAQG 5FLXc 3M7NA 1KRSA 2ZTCA 3HOXG 4R4OA 3VDYA 4DR6Q 5IYDH 4GLAC 4LFAQ 2ZTEA 1OXXK 1GM5A 4LFBQ 1L1OC 3CMEA 1A63A 1V43A 1N32Q 1QZHA 2VZAA 3J7ZC 2GN5A 5IYDG 3F2BA 4OX9L 3W5OA 1SR3A 4JI0Q 2KBNA 1HJPA 3G48A 3PUZA 3CXCA 1C0AA 4A3FG 1VQDA 4IPGA 3CCJA 5K36G 5JJIA 4DR5L 3HOWH 3STBD 4QL5A 4DUYL 3GTGH 2WB1G 3S2HH 5E7NA 1YJWA 1CKNA 4OWTB 3JAMc 4C3HH 1FGUA 1I94Q 1IBLQ 2E5LL 2PMZE 1SMXA 4HJAA 5C3EH 2UXCQ 3FKIH 2Z6KC 3A5ZB 1TWGH 4JBWA 3EIVA 1K73C 1PH3A 5C3EG 2JA7H 4DR3Q 1M1KC 2MQHA 4OWXB 2VUMH 3CAMA 4GN4B 1V1QA 4A76A 1GD7A 1XNQL 2JA6G 2LSSA 4P73A 3NBHB 3K8AA 2AWNA 1Q8KA 3HFZB 4P71A 2VUMG 3PO3H 5IYBH 4IFDJ 2JQOA 2AHOB 2VY3A 3T1YQ 2B29A 3H15A 3TRZA 2HHHL 2I5LX 3J81c 2UU9L 5C4JH 5LMNQ 1TWFH 4A3DH 2YTXA 4GOPB 1R9TH 4PZ8A 2R7ZG 2D0PA 4A3EG 4BBRH 4A3DG 1Q1BA 3PF5A 4JI7Q 4JG2A 4JYAQ 1A8VA 2ZJPA 1PH6A 1PYBA 2N78A 5M3MH 4IFDG 2IHFA 1SE8A 4DR2Q 3CCMA 4DR6L 4LFAL 1G6PA 2VQEL 2HIXA 1Q86C 1MJEA 2Z0SA 2R7DA 1EIYB 3U4VA 3PIPA 4IPCA 3STBC 1QVFA 1N32L 2B63H 3M3YH 3PSIA 4JI0L 1VQBA 1YVCA 3TEHB 2ZJRA 2IY5B 1SLJA 2V1CC 1NJIC 4JI4Q 4Y7NH 4AYBG 3T1HQ 4Y52H 1XNRQ 3UE0A 4L5SA 1IBLL 4P72A 4X65Q 3H3VH 1YNXA 4DAMA 3JAMi 3L2PA 2UXCL 1BVSA 1SFOH 1YHQA 4QQBX 3K0XA 3MEFA 4DR3L 4LF7Q 2JA8H 5BR8Q 4JOIC 4YCVA 3F8TA 4O0AA 4PG3A 2Z6KA 4JC0A 5HY6A 1QUQB 4C2MH 4DUZL 3PF4A 2L15A 3T1YL 1YIJA 1E7ZA 2OQKA 4H02A 1YJNA 3PO2G 1HNXQ 1UE6A 1XMOQ 3NENA 4O2DA 5AJ3Q 4LUVA 5LMNL 1O7IA 3J81i 2Y0SE 4L5QA 4AYBE 3CMAA 1J5EQ 2BA0A 1JJ2A 1FVIA 3HOZH 2I0QA 4QJFA 4B3MQ 4POGA 2NN6I 5GROA 1NY4A 4JI7L 3S2DH 5IWAQ 1NMGA 4NPSA 4R1JA 3J80c 1PH4A 2JA5G 3HOZG 4DR2L 1SRUA 3KF6B 2KENA 1YBYA 2GVAA 1X65A 1Q12A 2OCEA 5JEAJ 1PH7A 5LMUQ 2KHJA 4LF6Q 2LXJA 1XPRA 3HOVH 3DM3A 4KHZA 1QVGA 2K75A 1NMFA 4DV4Q 1XMQQ 4JI4L 1CKOA 1CKNB 4GLXA 3T1HL 3KYHC 1XNRL 1EWIA 5FJ8H 4A3CG 2IHEA 4X65L 1VQLA 1OXTA 3AYHB 4DV5Q 2OWOA 3FHWA 4LUZA 5FLMH 5JEAG 3S16H 4LF7L 1QVCA 4YY3L 5BR8L 5C44H 5GADC 1HZCA 1NBWA 1TWHH 1FJGQ 1HH2P 4X64Q 3F2CA 4A3GG 3PUXA 2OTJA 2H5XA 4GN5A 2KCTA 4JCVE 3PIOA 3BU2A 4DV0Q 5C44G 2K5NA 1WYDA 1IZ6A 1Q46A 1L0WA 1BBUA 4HIMA 1Q82C 3CCLA 4JOIA 2PQAB 2CWPA 1HNXL 5IYCH 4DV1L 1XMOL 2A19A 4EX5A 2WFWA 1PH1A 1ASZA 4JI6Q 2I5HA 1X3GA 4A3MH 1MJCA 1J5EL 2XGTA 2OTLA 1VQFA 3OW2A 2R93H 1U0LA 3AEVA 4B3ML 1I6HH 4PZ7A 4JI5L 3PUYA 1HR0Q 1JE5A 1WJJA 2MNAA 2YTVA 4A75A 4A3MG 3J7A5 4K0KQ 3Q8DA 3TQYA 2R6GA 3CCUA 1OXVA 2YV5A 3B6YA 3J80i 3RNUA 1IBMQ 3KF6A 4JBJA 3UE1A 3BJUA 2F4VQ 2PI2A 4YWMA 1KL9A 3M4QA 4JI3Q 3KOJA 3CF5A 2YYZA 4IJLA 1EOVA 1L1OB 4BY1H 4LF6L 5JJKA 4OONA 2NVYH 3NEMA 3TREA 4A3JH 3PUVA 3RLOA 1N34L 2NVQH 4C3IH 4KHPL 2A1AA 4DV4L 4NXNQ 1H95A 3HOWG 1E1OA 3PCOB 5EAYA 1X56A 5LMNW 2ASBA 3I4MH 4X62Q 2Q2IA 3S15H 2B3GA 1Q7YC 4DV5L 2PNHA 2WAQE 2MO0A 4DV3Q 3I4MG 1LTLA 5DLQE 3FKIG 1U5KA 4DKAC 2JA9A 2JA7G 3HKSA 4J15A 1FJGL 1Q1EA 4LFCQ 1HNZQ 3S14H 4X64L 4DV0L 1KD1C 1N8RC 1HZAA 4BXXH 4DK3C 3GTJH 3PO3G 3I4OA 5IYBG 3S1QH 3GTOH 5IY0A 1OTCA 2PQAA 1VQAA 1GKHA 5HGQA 4JI6L 3RZOH 1E22A 1V9PA 2BH8A 1IYJB 2WB1E 3S24A 3KFUA 2NZOA 4B3TQ 1N9WA 4GKJQ 1UE5A 3BZKA 1VQMA 4GLVB 1HR0L 4IFDI 2VL6A 3KF8B 3OYYA 4BBRG 4AQYQ 3TS2A 2ZTDA 1CSQA 3CP0A 5C0XJ 4K0KL 3ULJA 2K14A 2NZHA 4LFBL 1SROA 5M3MG 4LW1A 4YWLA 1D7QA 1IBML 4X66Q 1VQ7A 4BY7H 5JJLA 3FP9A 2RCNA 1NE3A 2CQOA 5H1SE 1L1OA 2B63G 4BY7G 2Q2UA 4R4CA 1PFSA 3EN2A 1HZ9A 4JI8Q 3S17H 2JEBI 1YZ6A 3BZCA 4NXNL 4APVA 1I94L 4PZ6A 5C0XG 1JB7A 1K83H 4X62L 2YU9H 3PGZA 2CWAA 3M4OH 3HKZG 1VQKA 3CW2C 2ZM6Q 1TXYA 4DV3L 1VQ9A 2ES2A 3K81C 2F52A 4RG1A 1YEZA 2XTIA 3CCRA 1A0IA 1Z9FA 4OXPA 2JA8G 1HNZL 3ERSX 1B70B 4MTNA 2FXQA 3GTKH 3A0JA 2UXDQ 1HNWQ 4YWKA 2CFMA 4DV2Q 1I50H 2MO1A 3I7FA 1XJVA 1PH8A 2UUBQ 2E2IH 1WCMH 3AFQA 3CQZH 4QIWE 3RLNA 1PH5A 1VQEA 3GO5A 4A4IA 1PV4A 2UXBQ 4ME3A 4R4QA 2A8VA 1LM0A 4B3TL 1X54A 4GKJL 4JYAL 4JI2Q 1KAWA 3I4NH 3UDGA 3GD7A 4AQYL 3HKZE 4QGUA 1E1TA 1I3QH 1Z47A 4OO1G 4X66L 4QY7A 4JI1Q 1PA6A 1FL0A 4IOAA 1VQGA 4GNXC 3ULPA 3RN2A 3W1GA 2R92H 3GDEA 2R7FA 4R4IA 4JI8L 4HIKA 1A62A 2F3IA 3CCQA 4HIDA 4A3IH 4L5RC 3HOVG 4GKKQ 1MIUA 3ZJYC 5M3FH 1S72A 3CC2A 3E9HA 5GQOA 2N3SA 2DUDA 2NVXH 5IP7H 3CPFA 2N8NA 2E2JH 5J3BA 3ULLA 5FJ8G 1N36Q 2ZM6L 5IP9H 4IJHA 5IP7G 2PI2E 2ID0A 3E9IA 4LF8Q 1X3FA 4IPHA 1VCIA 2JJQA 4DPGA 5FLMG 4LF4Q 2YTYA 1AH9A 2N49A 3OTOQ 4TQUS 3D0FA 1EYGA 3S1MH 2UXDL 1HNWL 2HQLA 4A3LH 1Q81C 4DV2L 1BBWA 1GO3E 1CSPA 1K0RA 4TVAB 5AJ3L 2UUBL 5GAHC 1B8AA 1NTGA 2BA1A 3EBEA 2LXKA 5IYCG 3KJOA 2VS1A 2QA4A 2UXBL 3G6EA 1KHIA 3SGIA 4GS3A 4A3KH 4DAYB 5IWAL 2R93G 4UY8C 3CCSA 1K9MC 1W3SA 4MNOA 2IX0A 1IXRA 1T9HA 4L5TA 4OWWB 1YITA 1CUKA 4YCWA 5LMUL 4JI1L 2JE6I 4JV5Q 3S1NH 1VQ4A 1UEBA 2VW9A 1YHAA 4BA2I 1EFWA 4BY1G 1XMQL 4GKKL 5IE8A 3ER0A 4A3JG 3JC66 1PVOA 3G71A 1XPUA 2AMCB 3HOXH 4ALPA 1EQRA 1J6QA 1X3EA 1XTDA 2K4KA 1KQSA 1EQQA 2EXDA 2BH2A 2D62A 4WJ3M 3KLWA 2OQ0A 3L7ZC 1S3OA 2VQEQ 1N36L 5IT9c 4DV7Q 4A3FH 3E0EA 4LF8L 4UPAA 4DV6Q 4LWCA 3S1RH 1TWCH 2KCMA 1EUJA 4LF4L 4A93H 3KDFA 1CKMA 3GTQH 2EQSA 3OTOL 4DR7Q 4A93G 4KLKA 4LF5Q 4BXXG 1VQIA 4NB3A 2EIFA 2UUAQ 4UP8A 1Y14B 1YJ9A 4IOCA 3F1ZA 2QGQA 3NELA 3AQQA 2E8GA 3PUWA 2JA6H 3LGJA 3KJPA 3HOYH 1XPOA 1C9OA 4YCUA 4NXMQ 4DUZQ 4HJ5A 4B3SQ 1UE7A 3HOYG 4UP7A 1BKBA 1VQJA 2RHSB 2F4VL 4GOPC 4JI3L 2E2HH 1OXSC 1W2BA 2D0OA 4JV5L 2R7ZH 1N33Q 3HOUH 4A3EH 3CPWA 3AFPA 4DR1Q 1IBKQ 2WP8J 2Q2TA 2UUCQ 3HOUG 5C0XI 2JK8A 2AKWB 3H0GH 4P74A 3J81j 4HJ7A 3K80C 3RLFA 2IX1A 2CKZB 3H3VI 1E24A 4B3RQ 3H0GG 1UWVA 1K3RA 2VQFQ 5GAGC 4IPDA 4DR4Q 4P75A 1L2FA 3RZDH 1X55A 4C3JH 3PV0A 3U4ZA 1IL2A 3K7AH 1VQPA 4YHHQ 1B7YB 4DV7L 1VQHA 1G291 4LUOA 4DV6L 4MZ9A 4LFCL 3GTMH 2KHIA 3U58A 1E3PA 3U50C 3GTLH 1JJGA 1UE1A 2Y0SG 2IT1A 1RL2A 4JBKA 1P16A 1VQ6A 4DR7L 2ATWA 4LF5L 5GAEC 2DGYA 3UDFA 2UUAL 2C35B 1VQOA 1MKHA 1WCMG 5C4XH 3M9BA 1DGSA 1VQ5A 1JJCB 3TS0A 3W1BA 1S40A 1PH2A 4PMWA 5C4XG 4GN3B 1YHBA 1PYSB 2MFIA 4YY3Q 4JBMA 3I4NG 4OO1I 4NXML 2AWOA 4LF9Q 1QZGA 3PO2H 3G4SA 4B3SL 1KRTA 4WJ4A 1KXLA 1LYLA 1HZBA 1TWAH 1SN8A 4AH6A 3F2DA 1ASYA 2Q2HA 3UDIA 4AIMA 4EQ5A 1OXUA 4KI0A 4DV1Q 4HIOA 3ICEA 5ELNA 1N33L 3I55A 2NVTH 1EIFA 4DNIA 1PH9A 2RHQB 4GOPA 4UP9A 4DR1L 2HIVA 2HT1A 4GNXB 1IBKL 4XIGS 2UUCL 2R92G 3CD6A 3GTPH 2JA5H 4JI5Q 1K8GA 4BBSH 4A3IG 2NN6G 1G51A 5M5YH 2ZJQA 4B3RL 5M5WH 5M3FG 1KIXA 2VQFL 2I5MX 1P8LA 2GVBA 3A5UA 4DR4L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ9 A;  1HR0 W;  3M4P A;  4OX9 Q;  1LUZ A;  1JMC A;  2K5H A;  4YHH L;  2QEX A;  5IP9 G;  3KDF B;  1Y1V H;  1I5F A;  1D8L A;  3L0O A;  3CC7 A;  3RN5 A;  3IRB A;  4DR5 Q;  1VQ8 A;  4X6A H;  4DUY Q;  1N34 Q;  4KHP Q;  1Y1V G;  3A74 A;  4A3C H;  4DK6 C;  3K7U C;  3D31 A;  1PHJ A;  4FDB A;  4RMF A;  4BA1 I;  4HJ8 A;  2E5L Q;  4A3L G;  1M90 C;  1X6O A;  1WFQ A;  2K5V A;  2K52 A;  5ELO A;  3CCE A;  3WWV A;  2K50 A;  4JI2 L;  3RR5 A;  4A3B H;  4A3G H;  1RIP A;  1JT8 A;  1WOC A;  3UDX A;  3I2Z A;  1XNQ Q;  2JEA I;  4A3K G;  1Y1W H;  3MXN B;  4IO9 A;  3CC4 A;  4A3B G;  1K8A C;  1GVP A;  4LF9 L;  3DLL A;  1Y1W G;  1AE3 A;  1QUQ A;  2ALY B;  4XTC S;  2HHH Q;  1VQC A;  1KC8 C;  2UU9 Q;  1WI5 A;  1X9N A;  2RF4 A;  4LNQ A;  1VS0 A;  1AE2 A;  3M85 A;  1C7Y A;  2VNU D;  5M5X H;  1VQN A;  1YI2 A;  3I56 A;  2CCZ A;  4R4T A;  4BBS G;  4POF A;  4GNX A;  3CCV A;  2WAQ G;  5FLX c;  3M7N A;  1KRS A;  2ZTC A;  3HOX G;  4R4O A;  3VDY A;  4DR6 Q;  5IYD H;  4GLA C;  4LFA Q;  2ZTE A;  1OXX K;  1GM5 A;  4LFB Q;  1L1O C;  3CME A;  1A63 A;  1V43 A;  1N32 Q;  1QZH A;  2VZA A;  3J7Z C;  2GN5 A;  5IYD G;  3F2B A;  4OX9 L;  3W5O A;  1SR3 A;  4JI0 Q;  2KBN A;  1HJP A;  3G48 A;  3PUZ A;  3CXC A;  1C0A A;  4A3F G;  1VQD A;  4IPG A;  3CCJ A;  5K36 G;  5JJI A;  4DR5 L;  3HOW H;  3STB D;  4QL5 A;  4DUY L;  3GTG H;  2WB1 G;  3S2H H;  5E7N A;  1YJW A;  1CKN A;  4OWT B;  3JAM c;  4C3H H;  1FGU A;  1I94 Q;  1IBL Q;  2E5L L;  2PMZ E;  1SMX A;  4HJA A;  5C3E H;  2UXC Q;  3FKI H;  2Z6K C;  3A5Z B;  1TWG H;  4JBW A;  3EIV A;  1K73 C;  1PH3 A;  5C3E G;  2JA7 H;  4DR3 Q;  1M1K C;  2MQH A;  4OWX B;  2VUM H;  3CAM A;  4GN4 B;  1V1Q A;  4A76 A;  1GD7 A;  1XNQ L;  2JA6 G;  2LSS A;  4P73 A;  3NBH B;  3K8A A;  2AWN A;  1Q8K A;  3HFZ B;  4P71 A;  2VUM G;  3PO3 H;  5IYB H;  4IFD J;  2JQO A;  2AHO B;  2VY3 A;  3T1Y Q;  2B29 A;  3H15 A;  3TRZ A;  2HHH L;  2I5L X;  3J81 c;  2UU9 L;  5C4J H;  5LMN Q;  1TWF H;  4A3D H;  2YTX A;  4GOP B;  1R9T H;  4PZ8 A;  2R7Z G;  2D0P A;  4A3E G;  4BBR H;  4A3D G;  1Q1B A;  3PF5 A;  4JI7 Q;  4JG2 A;  4JYA Q;  1A8V A;  2ZJP A;  1PH6 A;  1PYB A;  2N78 A;  5M3M H;  4IFD G;  2IHF A;  1SE8 A;  4DR2 Q;  3CCM A;  4DR6 L;  4LFA L;  1G6P A;  2VQE L;  2HIX A;  1Q86 C;  1MJE A;  2Z0S A;  2R7D A;  1EIY B;  3U4V A;  3PIP A;  4IPC A;  3STB C;  1QVF A;  1N32 L;  2B63 H;  3M3Y H;  3PSI A;  4JI0 L;  1VQB A;  1YVC A;  3TEH B;  2ZJR A;  2IY5 B;  1SLJ A;  2V1C C;  1NJI C;  4JI4 Q;  4Y7N H;  4AYB G;  3T1H Q;  4Y52 H;  1XNR Q;  3UE0 A;  4L5S A;  1IBL L;  4P72 A;  4X65 Q;  3H3V H;  1YNX A;  4DAM A;  3JAM i;  3L2P A;  2UXC L;  1BVS A;  1SFO H;  1YHQ A;  4QQB X;  3K0X A;  3MEF A;  4DR3 L;  4LF7 Q;  2JA8 H;  5BR8 Q;  4JOI C;  4YCV A;  3F8T A;  4O0A A;  4PG3 A;  2Z6K A;  4JC0 A;  5HY6 A;  1QUQ B;  4C2M H;  4DUZ L;  3PF4 A;  2L15 A;  3T1Y L;  1YIJ A;  1E7Z A;  2OQK A;  4H02 A;  1YJN A;  3PO2 G;  1HNX Q;  1UE6 A;  1XMO Q;  3NEN A;  4O2D A;  5AJ3 Q;  4LUV A;  5LMN L;  1O7I A;  3J81 i;  2Y0S E;  4L5Q A;  4AYB E;  3CMA A;  1J5E Q;  2BA0 A;  1JJ2 A;  1FVI A;  3HOZ H;  2I0Q A;  4QJF A;  4B3M Q;  4POG A;  2NN6 I;  5GRO A;  1NY4 A;  4JI7 L;  3S2D H;  5IWA Q;  1NMG A;  4NPS A;  4R1J A;  3J80 c;  1PH4 A;  2JA5 G;  3HOZ G;  4DR2 L;  1SRU A;  3KF6 B;  2KEN A;  1YBY A;  2GVA A;  1X65 A;  1Q12 A;  2OCE A;  5JEA J;  1PH7 A;  5LMU Q;  2KHJ A;  4LF6 Q;  2LXJ A;  1XPR A;  3HOV H;  3DM3 A;  4KHZ A;  1QVG A;  2K75 A;  1NMF A;  4DV4 Q;  1XMQ Q;  4JI4 L;  1CKO A;  1CKN B;  4GLX A;  3T1H L;  3KYH C;  1XNR L;  1EWI A;  5FJ8 H;  4A3C G;  2IHE A;  4X65 L;  1VQL A;  1OXT A;  3AYH B;  4DV5 Q;  2OWO A;  3FHW A;  4LUZ A;  5FLM H;  5JEA G;  3S16 H;  4LF7 L;  1QVC A;  4YY3 L;  5BR8 L;  5C44 H;  5GAD C;  1HZC A;  1NBW A;  1TWH H;  1FJG Q;  1HH2 P;  4X64 Q;  3F2C A;  4A3G G;  3PUX A;  2OTJ A;  2H5X A;  4GN5 A;  2KCT A;  4JCV E;  3PIO A;  3BU2 A;  4DV0 Q;  5C44 G;  2K5N A;  1WYD A;  1IZ6 A;  1Q46 A;  1L0W A;  1BBU A;  4HIM A;  1Q82 C;  3CCL A;  4JOI A;  2PQA B;  2CWP A;  1HNX L;  5IYC H;  4DV1 L;  1XMO L;  2A19 A;  4EX5 A;  2WFW A;  1PH1 A;  1ASZ A;  4JI6 Q;  2I5H A;  1X3G A;  4A3M H;  1MJC A;  1J5E L;  2XGT A;  2OTL A;  1VQF A;  3OW2 A;  2R93 H;  1U0L A;  3AEV A;  4B3M L;  1I6H H;  4PZ7 A;  4JI5 L;  3PUY A;  1HR0 Q;  1JE5 A;  1WJJ A;  2MNA A;  2YTV A;  4A75 A;  4A3M G;  3J7A 5;  4K0K Q;  3Q8D A;  3TQY A;  2R6G A;  3CCU A;  1OXV A;  2YV5 A;  3B6Y A;  3J80 i;  3RNU A;  1IBM Q;  3KF6 A;  4JBJ A;  3UE1 A;  3BJU A;  2F4V Q;  2PI2 A;  4YWM A;  1KL9 A;  3M4Q A;  4JI3 Q;  3KOJ A;  3CF5 A;  2YYZ A;  4IJL A;  1EOV A;  1L1O B;  4BY1 H;  4LF6 L;  5JJK A;  4OON A;  2NVY H;  3NEM A;  3TRE A;  4A3J H;  3PUV A;  3RLO A;  1N34 L;  2NVQ H;  4C3I H;  4KHP L;  2A1A A;  4DV4 L;  4NXN Q;  1H95 A;  3HOW G;  1E1O A;  3PCO B;  5EAY A;  1X56 A;  5LMN W;  2ASB A;  3I4M H;  4X62 Q;  2Q2I A;  3S15 H;  2B3G A;  1Q7Y C;  4DV5 L;  2PNH A;  2WAQ E;  2MO0 A;  4DV3 Q;  3I4M G;  1LTL A;  5DLQ E;  3FKI G;  1U5K A;  4DKA C;  2JA9 A;  2JA7 G;  3HKS A;  4J15 A;  1FJG L;  1Q1E A;  4LFC Q;  1HNZ Q;  3S14 H;  4X64 L;  4DV0 L;  1KD1 C;  1N8R C;  1HZA A;  4BXX H;  4DK3 C;  3GTJ H;  3PO3 G;  3I4O A;  5IYB G;  3S1Q H;  3GTO H;  5IY0 A;  1OTC A;  2PQA A;  1VQA A;  1GKH A;  5HGQ A;  4JI6 L;  3RZO H;  1E22 A;  1V9P A;  2BH8 A;  1IYJ B;  2WB1 E;  3S24 A;  3KFU A;  2NZO A;  4B3T Q;  1N9W A;  4GKJ Q;  1UE5 A;  3BZK A;  1VQM A;  4GLV B;  1HR0 L;  4IFD I;  2VL6 A;  3KF8 B;  3OYY A;  4BBR G;  4AQY Q;  3TS2 A;  2ZTD A;  1CSQ A;  3CP0 A;  5C0X J;  4K0K L;  3ULJ A;  2K14 A;  2NZH A;  4LFB L;  1SRO A;  5M3M G;  4LW1 A;  4YWL A;  1D7Q A;  1IBM L;  4X66 Q;  1VQ7 A;  4BY7 H;  5JJL A;  3FP9 A;  2RCN A;  1NE3 A;  2CQO A;  5H1S E;  1L1O A;  2B63 G;  4BY7 G;  2Q2U A;  4R4C A;  1PFS A;  3EN2 A;  1HZ9 A;  4JI8 Q;  3S17 H;  2JEB I;  1YZ6 A;  3BZC A;  4NXN L;  4APV A;  1I94 L;  4PZ6 A;  5C0X G;  1JB7 A;  1K83 H;  4X62 L;  2YU9 H;  3PGZ A;  2CWA A;  3M4O H;  3HKZ G;  1VQK A;  3CW2 C;  2ZM6 Q;  1TXY A;  4DV3 L;  1VQ9 A;  2ES2 A;  3K81 C;  2F52 A;  4RG1 A;  1YEZ A;  2XTI A;  3CCR A;  1A0I A;  1Z9F A;  4OXP A;  2JA8 G;  1HNZ L;  3ERS X;  1B70 B;  4MTN A;  2FXQ A;  3GTK H;  3A0J A;  2UXD Q;  1HNW Q;  4YWK A;  2CFM A;  4DV2 Q;  1I50 H;  2MO1 A;  3I7F A;  1XJV A;  1PH8 A;  2UUB Q;  2E2I H;  1WCM H;  3AFQ A;  3CQZ H;  4QIW E;  3RLN A;  1PH5 A;  1VQE A;  3GO5 A;  4A4I A;  1PV4 A;  2UXB Q;  4ME3 A;  4R4Q A;  2A8V A;  1LM0 A;  4B3T L;  1X54 A;  4GKJ L;  4JYA L;  4JI2 Q;  1KAW A;  3I4N H;  3UDG A;  3GD7 A;  4AQY L;  3HKZ E;  4QGU A;  1E1T A;  1I3Q H;  1Z47 A;  4OO1 G;  4X66 L;  4QY7 A;  4JI1 Q;  1PA6 A;  1FL0 A;  4IOA A;  1VQG A;  4GNX C;  3ULP A;  3RN2 A;  3W1G A;  2R92 H;  3GDE A;  2R7F A;  4R4I A;  4JI8 L;  4HIK A;  1A62 A;  2F3I A;  3CCQ A;  4HID A;  4A3I H;  4L5R C;  3HOV G;  4GKK Q;  1MIU A;  3ZJY C;  5M3F H;  1S72 A;  3CC2 A;  3E9H A;  5GQO A;  2N3S A;  2DUD A;  2NVX H;  5IP7 H;  3CPF A;  2N8N A;  2E2J H;  5J3B A;  3ULL A;  5FJ8 G;  1N36 Q;  2ZM6 L;  5IP9 H;  4IJH A;  5IP7 G;  2PI2 E;  2ID0 A;  3E9I A;  4LF8 Q;  1X3F A;  4IPH A;  1VCI A;  2JJQ A;  4DPG A;  5FLM G;  4LF4 Q;  2YTY A;  1AH9 A;  2N49 A;  3OTO Q;  4TQU S;  3D0F A;  1EYG A;  3S1M H;  2UXD L;  1HNW L;  2HQL A;  4A3L H;  1Q81 C;  4DV2 L;  1BBW A;  1GO3 E;  1CSP A;  1K0R A;  4TVA B;  5AJ3 L;  2UUB L;  5GAH C;  1B8A A;  1NTG A;  2BA1 A;  3EBE A;  2LXK A;  5IYC G;  3KJO A;  2VS1 A;  2QA4 A;  2UXB L;  3G6E A;  1KHI A;  3SGI A;  4GS3 A;  4A3K H;  4DAY B;  5IWA L;  2R93 G;  4UY8 C;  3CCS A;  1K9M C;  1W3S A;  4MNO A;  2IX0 A;  1IXR A;  1T9H A;  4L5T A;  4OWW B;  1YIT A;  1CUK A;  4YCW A;  5LMU L;  4JI1 L;  2JE6 I;  4JV5 Q;  3S1N H;  1VQ4 A;  1UEB A;  2VW9 A;  1YHA A;  4BA2 I;  1EFW A;  4BY1 G;  1XMQ L;  4GKK L;  5IE8 A;  3ER0 A;  4A3J G;  3JC6 6;  1PVO A;  3G71 A;  1XPU A;  2AMC B;  3HOX H;  4ALP A;  1EQR A;  1J6Q A;  1X3E A;  1XTD A;  2K4K A;  1KQS A;  1EQQ A;  2EXD A;  2BH2 A;  2D62 A;  4WJ3 M;  3KLW A;  2OQ0 A;  3L7Z C;  1S3O A;  2VQE Q;  1N36 L;  5IT9 c;  4DV7 Q;  4A3F H;  3E0E A;  4LF8 L;  4UPA A;  4DV6 Q;  4LWC A;  3S1R H;  1TWC H;  2KCM A;  1EUJ A;  4LF4 L;  4A93 H;  3KDF A;  1CKM A;  3GTQ H;  2EQS A;  3OTO L;  4DR7 Q;  4A93 G;  4KLK A;  4LF5 Q;  4BXX G;  1VQI A;  4NB3 A;  2EIF A;  2UUA Q;  4UP8 A;  1Y14 B;  1YJ9 A;  4IOC A;  3F1Z A;  2QGQ A;  3NEL A;  3AQQ A;  2E8G A;  3PUW A;  2JA6 H;  3LGJ A;  3KJP A;  3HOY H;  1XPO A;  1C9O A;  4YCU A;  4NXM Q;  4DUZ Q;  4HJ5 A;  4B3S Q;  1UE7 A;  3HOY G;  4UP7 A;  1BKB A;  1VQJ A;  2RHS B;  2F4V L;  4GOP C;  4JI3 L;  2E2H H;  1OXS C;  1W2B A;  2D0O A;  4JV5 L;  2R7Z H;  1N33 Q;  3HOU H;  4A3E H;  3CPW A;  3AFP A;  4DR1 Q;  1IBK Q;  2WP8 J;  2Q2T A;  2UUC Q;  3HOU G;  5C0X I;  2JK8 A;  2AKW B;  3H0G H;  4P74 A;  3J81 j;  4HJ7 A;  3K80 C;  3RLF A;  2IX1 A;  2CKZ B;  3H3V I;  1E24 A;  4B3R Q;  3H0G G;  1UWV A;  1K3R A;  2VQF Q;  5GAG C;  4IPD A;  4DR4 Q;  4P75 A;  1L2F A;  3RZD H;  1X55 A;  4C3J H;  3PV0 A;  3U4Z A;  1IL2 A;  3K7A H;  1VQP A;  4YHH Q;  1B7Y B;  4DV7 L;  1VQH A;  1G29 1;  4LUO A;  4DV6 L;  4MZ9 A;  4LFC L;  3GTM H;  2KHI A;  3U58 A;  1E3P A;  3U50 C;  3GTL H;  1JJG A;  1UE1 A;  2Y0S G;  2IT1 A;  1RL2 A;  4JBK A;  1P16 A;  1VQ6 A;  4DR7 L;  2ATW A;  4LF5 L;  5GAE C;  2DGY A;  3UDF A;  2UUA L;  2C35 B;  1VQO A;  1MKH A;  1WCM G;  5C4X H;  3M9B A;  1DGS A;  1VQ5 A;  1JJC B;  3TS0 A;  3W1B A;  1S40 A;  1PH2 A;  4PMW A;  5C4X G;  4GN3 B;  1YHB A;  1PYS B;  2MFI A;  4YY3 Q;  4JBM A;  3I4N G;  4OO1 I;  4NXM L;  2AWO A;  4LF9 Q;  1QZG A;  3PO2 H;  3G4S A;  4B3S L;  1KRT A;  4WJ4 A;  1KXL A;  1LYL A;  1HZB A;  1TWA H;  1SN8 A;  4AH6 A;  3F2D A;  1ASY A;  2Q2H A;  3UDI A;  4AIM A;  4EQ5 A;  1OXU A;  4KI0 A;  4DV1 Q;  4HIO A;  3ICE A;  5ELN A;  1N33 L;  3I55 A;  2NVT H;  1EIF A;  4DNI A;  1PH9 A;  2RHQ B;  4GOP A;  4UP9 A;  4DR1 L;  2HIV A;  2HT1 A;  4GNX B;  1IBK L;  4XIG S;  2UUC L;  2R92 G;  3CD6 A;  3GTP H;  2JA5 H;  4JI5 Q;  1K8G A;  4BBS H;  4A3I G;  2NN6 G;  1G51 A;  5M5Y H;  2ZJQ A;  4B3R L;  5M5W H;  5M3F G;  1KIX A;  2VQF L;  2I5M X;  1P8L A;  2GVB A;  3A5U A;  4DR4 L; 
#chains in the Genus database with same CATH topology
 3FRP B;  4X3K A;  1ENA A;  1LUZ A;  4BBS B;  4YHH L;  2NBF A;  2NVX B;  2N88 A;  5M5W B;  5KT5 A;  2F0T A;  2HHH H;  2NU6 B;  4TV9 F;  4X6A H;  3KBX A;  1Y1V G;  3JSN A;  5FPR A;  1BCP C;  3A74 A;  2FFK B;  3SK5 A;  4DK6 C;  3OIP A;  1PHJ A;  2E5L Q;  4RMF A;  4MHE A;  2DNE A;  1GGO A;  2K5V A;  1WFQ A;  4RAZ A;  1EZ6 A;  1AUX A;  3WWV A;  3TP8 A;  4JI2 L;  4A3B H;  1RIP A;  1JT8 A;  2JEA I;  2VQE H;  1PLF A;  1RK6 A;  2BQ3 A;  3CC4 A;  1K8A C;  3J81 W;  4LF9 L;  1X3Q A;  5C8Y F;  4J9M A;  3DLL A;  1AE3 A;  1QUQ A;  4JI0 H;  2RF4 A;  1Y1W B;  4TQR A;  4KY7 A;  4IR9 A;  3R2I A;  1VQN A;  2B39 A;  1AP0 A;  4GNX A;  1D5Z C;  2RGR A;  1U4M A;  2WAQ G;  2MUY A;  1BGW A;  1CQV A;  3TME A;  2GPW A;  1F9S A;  1SJH D;  4R8U B;  4R4O A;  2ZTE A;  3RTX A;  2C2D A;  1L1O C;  3CME A;  3HOX B;  1A63 A;  2BQU A;  4DLK A;  4NXM H;  2GN5 A;  4DUZ H;  1W6K A;  3W5O A;  1TAE A;  3J81 E;  2W57 A;  3OWE B;  4CDF C;  2ZDG A;  2AGO A;  1G6Z A;  1C0A A;  3KHR A;  1TKW B;  5JJI A;  3CCJ A;  2RGV A;  5LMN H;  2F0N A;  3STB D;  5FO9 B;  3PMF A;  3P20 A;  5F2D A;  3PVX A;  3DWQ A;  5E7N A;  3JAM c;  4OWT B;  1I94 Q;  2E5L L;  3VPC A;  1OO9 B;  5C3E H;  1AFP A;  1GSO A;  1K73 C;  1PH3 A;  3S2H B;  4DR4 H;  4A76 A;  3TIG A;  2JEF A;  1S5E D;  1JQY D;  1SE3 A;  3I90 A;  4P73 A;  4ZCK A;  1V1O A;  2VUM G;  3MWM A;  4C56 C;  4FO2 A;  4RA8 A;  5EQ0 A;  5C4J H;  2RDI A;  3BJY A;  3VPD A;  4PZ8 A;  1Y8P B;  5IT9 L;  2V4D A;  1F2L A;  3C0F B;  4JVZ A;  3J80 W;  5KT4 A;  2ZJP A;  4IR1 A;  4ECZ A;  1H9S B;  1SE8 A;  2RDF A;  4BBR B;  2R7D A;  1EIY B;  3STB C;  4XYL B;  4OEM B;  3M3Y H;  3I91 A;  3X3M A;  3PZP A;  1VQB A;  4XZ3 B;  4K6D A;  4C3J B;  5ISR A;  1SLJ A;  2V1C C;  5C0X H;  4QIW B;  2EY6 A;  2D5D A;  1WTX A;  1KAA A;  2NU9 B;  3J80 E;  4EFB A;  1BVS A;  1F9R A;  3TP5 A;  1Z2N X;  2AQ1 B;  3GTG A;  4J9Q A;  4C5C A;  4I7A A;  3K3V A;  5BR8 Q;  3ND8 A;  3F8T A;  4LMQ D;  4JC0 A;  3NBH A;  3PF4 A;  5KFZ A;  1TWG A;  1YIJ A;  3KAJ A;  3PO2 G;  2DNC A;  3E0J A;  1AW7 A;  1HNX Q;  2PZU A;  2JA8 B;  1KTK A;  1UE6 A;  3NEN A;  4J9R A;  4RUA A;  4KHP H;  3J81 i;  2Y0S E;  4RUC A;  2IW3 A;  1M0T A;  1IL8 A;  2MGS A;  3OSO A;  4N8X 1;  1JJ2 A;  4HCE A;  5GON F;  1EQT A;  4B3M Q;  1E4F T;  3GTJ A;  3VYS A;  1PFN A;  1TWF A;  4NPS A;  3HOZ G;  2A69 D;  3KF8 A;  1RDP D;  3NQI A;  4OO1 H;  3ZYY X;  1WVL A;  1R9T A;  3KF6 B;  5CGK A;  2M2L A;  4XYO A;  1QG7 A;  4NLG A;  5JVH 3;  2OCE A;  2D9U A;  2KCN A;  5ELD A;  5LMU Q;  4DF7 A;  2LXJ A;  5EDW A;  3HOV H;  2MPM A;  3DM3 A;  4KHZ A;  3MFI A;  4JI6 H;  2QDB A;  4DV4 Q;  1CKO A;  1CKN B;  2X6L A;  4DA2 A;  2B63 A;  1IW7 D;  3KYH C;  4ECQ A;  1ZET A;  3TIN A;  3QIA A;  1VQL A;  3N44 B;  4YAJ B;  4IAL A;  1TT2 A;  3M4Y A;  4EGV A;  2KEE A;  5JEA G;  4K0K H;  3S16 H;  5LL6 b;  2L4N A;  5KRU A;  4YY3 L;  3KUP A;  5BR8 L;  1K83 A;  3HRZ C;  4X64 Q;  2YU9 A;  4DV0 Q;  2KCT A;  3U9T A;  1A9X A;  5C44 G;  1ENF A;  1WYD A;  1L0W A;  1SFO A;  3CCL A;  5KFV A;  1FKA H;  2CWP A;  1HNX L;  5IYC H;  4DV1 L;  3MFY A;  1EZ1 A;  1TWH B;  1ASZ A;  1J9O A;  4OL7 A;  3D3R A;  5KGU A;  1SXT A;  4A3M H;  3GTK A;  1VQF A;  4B3M L;  1I6H H;  1HR0 Q;  3PUY A;  2L55 A;  4X3T A;  1WCM A;  2C00 A;  4DV3 H;  2K04 A;  2R6G A;  2YV5 A;  3J80 i;  3RNU A;  3LP8 A;  5L1I A;  3SK4 A;  4RB1 A;  3CF5 A;  2NU8 B;  2WKC A;  1GYF A;  1IW7 C;  2HD3 A;  3NWS A;  4QB4 A;  4S3S A;  2Q8T A;  1HTP A;  4DK0 A;  4BY1 H;  3T1Y H;  1M8A A;  1QNK A;  3TRE A;  4EGQ A;  5DLG A;  3RLO A;  4J9O A;  3EPI A;  3MEH A;  4DV4 L;  1CQF A;  3PCO B;  2SNM A;  2ASB A;  3I4M H;  5BPF A;  4X62 Q;  4ZOL F;  2XNA C;  4B08 A;  2B3G A;  4C3H G;  1Q7Y C;  5ELF A;  2PNH A;  2F03 A;  5KFP A;  3R23 A;  3CRL C;  3FKI G;  3IG0 A;  1B6S A;  1C8C A;  4X64 L;  1AN8 A;  3MXG A;  5CA1 F;  5C4Z A;  4DV0 L;  1KD1 C;  2W6P A;  4H0L C;  1CZW A;  3MVV A;  3VYR A;  3I4O A;  1GKH A;  4IUQ A;  3U9O A;  3RZO H;  5KFA A;  1V9P A;  3KFU A;  2WB1 E;  3I72 A;  2W71 A;  2NZO A;  4B3T Q;  4GKJ Q;  2JXM B;  1HR0 L;  4BBR G;  2FE3 A;  1VF5 C;  1DD2 A;  3SK6 A;  3MR5 A;  2F0O A;  2K14 A;  2NZH A;  4LF7 H;  5FD5 A;  5KFO A;  2R93 A;  3LWU A;  1DM0 B;  4X66 Q;  4MA5 A;  1VQ7 A;  3JAM L;  4BY7 H;  3AMU A;  4J9P A;  2RCN A;  2XIW A;  3WO0 A;  1L1O A;  1ET9 A;  4F4X A;  2OF1 A;  2Z8L A;  1PFS A;  4R8I A;  1HA5 A;  5DG7 A;  2C28 A;  1CHP D;  3BDC A;  3S17 H;  2JEB I;  1YZ6 A;  5IGF A;  3R5X A;  2TSS A;  1JR0 D;  3E3X A;  3CKI B;  1GHK A;  2NVY A;  4X62 L;  5KT7 A;  3BVZ A;  5IWA H;  3IFT A;  2F0G A;  2ES2 A;  2F52 A;  1V8Q A;  2XTI A;  3PW7 A;  1XXG A;  1LAC A;  1HHV A;  4OXP A;  4O3O A;  2JA8 G;  2C9O A;  5KFH A;  1DV1 A;  1HNW Q;  4LF6 H;  3NTH A;  5KFQ A;  1I50 H;  2OXP A;  3I7F A;  1XJV A;  2UUB Q;  1GSH A;  3QZ7 A;  3AFQ A;  4QIW E;  3CQZ H;  1N48 A;  3A56 A;  5DG9 A;  2C2E A;  1VQE A;  4GKK H;  1LTG D;  4R4Q A;  4B3T L;  5EPK A;  4GKJ L;  3J7A V;  3K5H A;  3I4N H;  4DV5 H;  4FP5 D;  3H4B A;  1G8Z D;  3V4Z A;  1E1T A;  2EYJ A;  1FNU A;  4ZHQ F;  3KHL A;  3W3A A;  2EY5 A;  2EY1 A;  4X66 L;  4QY7 A;  5D65 A;  1STN A;  4JI1 Q;  1SDF A;  3FMC A;  1A3U A;  3ULP A;  3O13 A;  1I3Q B;  5CV8 A;  5J39 A;  3GDE A;  3QFF A;  3KLS A;  4HIK A;  5EBC A;  2E2D C;  2FIN B;  2NN6 H;  1MIU A;  3CC2 A;  5GQO A;  1MZB A;  2DUD A;  2N8N A;  2PBZ A;  2Z1C A;  3ULL A;  3DXJ C;  5FO8 B;  3GIK A;  4IJH A;  4CKE A;  2PI2 E;  2ID0 A;  1IBM H;  4F50 A;  2W6Z A;  1AH9 A;  2F4V H;  2E2J B;  4JI3 H;  1PTO H;  5IGE A;  3D0F A;  3S1M H;  1HNW L;  3S16 B;  3M7G A;  1GO3 E;  1MHW C;  4G7O C;  5AJ3 L;  2UUB L;  2BE5 C;  1EHI A;  2Q8I B;  1TY2 A;  1BUV T;  3EBE A;  4IZ8 A;  4AYB A;  3SGI A;  2HVQ A;  3I12 A;  3OIQ A;  4DAY B;  5HV6 A;  4MN3 A;  1Z2P X;  1K9M C;  3TP6 A;  2IX0 A;  3DHQ A;  4L5T A;  1T9H A;  1I6H B;  1YIT A;  2X69 A;  1D1K A;  2CH4 A;  4JI1 L;  2NWG A;  3T4A C;  4DAV A;  2I46 A;  2KQ3 A;  2VUG A;  2YZG A;  3GV5 B;  1YHA A;  2WV6 D;  1RYS A;  4IUN A;  1XMQ L;  5KG0 A;  5EKK A;  3ER0 A;  3JC6 6;  1XX8 A;  3OSN A;  1LTI D;  1X3E A;  2K4K A;  1NCV A;  2EXD A;  2F0E A;  5JOB A;  1O75 A;  4PQX A;  4ECR A;  2OQ0 A;  1LTR D;  2PYK A;  1S3O A;  3W2D A;  4RB2 C;  2K28 A;  1DXM A;  2QIL A;  3S1R H;  2UVR A;  4IUT A;  4UHV A;  5DM6 3;  5KFJ A;  1EWC A;  2RKS A;  4A93 H;  3OUZ A;  4IWX A;  5FLX L;  1D2B A;  1DCZ A;  1UUP A;  1IHZ A;  4NB3 A;  2A68 C;  2UUA Q;  4UP8 A;  2RDG A;  1I4H A;  1O78 A;  2YZM A;  3GTQ B;  4DXG A;  1K0S A;  2QGQ A;  3MR6 A;  3AQQ A;  1JB3 A;  3PUW A;  3RZO B;  3LGJ A;  3R8B A;  2I8C A;  1KDB A;  5KFS A;  3G6V A;  1K1Q A;  1KJ8 A;  4Q8E A;  4KJN A;  4YHH H;  3HB9 A;  2JA6 B;  1Z6H A;  3R3O A;  4GOP C;  1KIX A;  3RAX A;  1OXS C;  3HOY B;  2D0O A;  4Q44 A;  3PQI A;  2UXD H;  3OOC A;  2HVS A;  5CR3 A;  4DR1 Q;  2WP8 J;  2Q2T A;  2UUC Q;  3HOU G;  4TUY F;  4M9U A;  2UXB H;  1S5B D;  3RLF A;  4A3E B;  2PMZ A;  4I55 F;  4B3R Q;  3H0G G;  1UWV A;  3QOJ A;  4JI2 H;  2VQF Q;  5GAG C;  4P75 A;  1PRT B;  1U4P A;  4NW2 A;  3RZD H;  4LMY A;  3BQ0 A;  3T5L A;  5DLF A;  3U4Z A;  3K7A H;  1EY4 A;  4QF4 A;  1B7Y B;  4LF9 H;  4LUO A;  4LFC L;  2HVR A;  5CV9 A;  1JIC A;  1VMP A;  1D5M C;  3TP7 A;  3V2T A;  3WOE A;  3PR4 A;  1DZ1 A;  5ELE A;  2KEC A;  2PVP A;  3MFH A;  3GTM B;  2Z4H A;  2UUA L;  4O2B F;  3GTL B;  1GHJ A;  1DGS A;  4IZO A;  1VQ5 A;  1JWU D;  1GUN A;  1ZXT A;  3KTM A;  3TS0 A;  1MD2 D;  5EKI A;  1S5F D;  5KYI A;  4GN3 B;  2FK3 A;  2NTT A;  1PYS B;  2ASD A;  4RZR A;  3PO2 H;  1G91 A;  4ZKC B;  4LF4 H;  1LYL A;  4G3I A;  3OTO H;  4JV2 A;  4KI0 A;  5KEE A;  4C5A A;  4J9S A;  5ELN A;  5C4H A;  4DL7 A;  4UP9 A;  4DR1 L;  2HIV A;  2HT1 A;  5T14 A;  3NUC A;  1SSO A;  4GNX B;  2UUC L;  1TA8 A;  5FLX W;  3K5O A;  2F0D A;  1BOS A;  4EEQ A;  4JI5 Q;  1Y69 U;  4GC6 A;  4BBS H;  4B3R L;  5M5W H;  3I70 A;  2VQF L;  2I5M X;  3H94 A;  2GVB A;  3A5U A;  1IKL A;  4OEL B;  4HJ9 A;  2XN9 C;  3M4P A;  2F0V A;  4OX9 Q;  2K5H A;  5ELC A;  2QEX A;  5IP9 G;  5M5Y B;  1HRJ A;  3KDF B;  1I5F A;  3L4K A;  4ZK9 B;  5JPN C;  3CC7 A;  3RN5 A;  1XYI A;  5KFL A;  2M9V A;  4DR5 Q;  1VQ8 A;  1BCP F;  1XWE A;  4DUY Q;  1N34 Q;  1MSH A;  3OW7 A;  1STB A;  4FDB A;  1Y1V B;  1M90 C;  4JV1 A;  5FLX E;  5JEA H;  2LY7 A;  5KFM A;  1Y1W H;  3MXN B;  1FR3 A;  4DV6 H;  3RGZ A;  2ALY B;  4XTC S;  2UU9 Q;  1VQC A;  4A3G B;  1BO0 A;  3ND9 A;  1AE2 A;  3M85 A;  3D8G A;  4N9P A;  1YI2 A;  3I56 A;  4U67 3;  2CCZ A;  3DEO A;  2VR1 A;  3RGX A;  3CCV A;  1TWA A;  2K7V A;  1R4P B;  2YRX A;  4DR6 Q;  2WAQ B;  2JP1 A;  4GLA C;  4LFA Q;  1SYX B;  1OXX K;  4LFB Q;  3MXP A;  5KT3 A;  3BQ1 A;  1TII D;  1OWT A;  1VMC A;  1N32 Q;  3GTP A;  3HGB A;  1NAP A;  5IYD G;  4OX9 L;  3NXW A;  1E4G T;  3G48 A;  2V9W A;  1JXL A;  4LH7 A;  2ATL A;  2FMM A;  3R93 A;  1K3B C;  5D3D A;  4DR5 L;  4DUY L;  5KG5 A;  1N33 H;  3L3O C;  3S2H H;  3QB3 A;  5EBD A;  4C3H H;  1ICW A;  5EPL A;  2WTF A;  2UXC Q;  3FKI H;  3HOW B;  2IBK A;  2BDN A;  3GTG B;  2DIK A;  3A5Z B;  2FLN A;  2ZXO A;  3GIL A;  5I2Y A;  1KLU D;  4GN4 B;  1V1Q A;  3C46 A;  2JA6 G;  2LSS A;  5L1K A;  3A7L A;  3NBH B;  3K8A A;  2AWN A;  1Q8K A;  2K05 A;  3HFZ B;  1TWG B;  3MR2 A;  3H15 A;  2G9H D;  2VUM B;  2X6G A;  2NYZ D;  2UU9 L;  1XTC D;  2YTX A;  2R7L A;  4YAK B;  2BDO A;  3D4R A;  3PO3 B;  4YB8 B;  4YR3 A;  1HQM C;  3PIP 3;  2D0P A;  4A3E G;  1FNV A;  4BBR H;  4A3D G;  3PF5 A;  4JI7 Q;  4HMI A;  4JYA Q;  1TWF B;  2ASJ A;  1A8V A;  1PH6 A;  1PYB A;  2V4Q A;  1NR4 A;  1R9T B;  1TY0 A;  1G2S A;  1ET6 A;  4DR2 Q;  4DR6 L;  1S0M A;  3RMH A;  4LFA L;  4ZYS A;  1G6P A;  2HIX A;  2ALZ A;  2Z0S A;  4YY3 H;  2ICE C;  5EWF A;  1N32 L;  4QWB A;  2H4O A;  2DJF C;  1G2T A;  2MHV A;  1VAJ A;  4LJZ C;  3TEH B;  3P75 A;  4HYK A;  4DV1 H;  1NJI C;  4XQQ A;  2B63 B;  4Y52 H;  5T1I A;  4O4H F;  4MTE A;  4FXK C;  4ME5 A;  4X65 Q;  3H3V H;  4YBZ B;  2EXZ A;  4B3M H;  4KN7 C;  1TS4 A;  2EYO A;  2UXC L;  3D6C A;  4RCO A;  1L0Y B;  4KJO A;  3HKZ B;  2JA8 H;  4KKT A;  4F4Y A;  5D8D A;  1ZYR D;  2F3V A;  1UC9 A;  4O0A A;  1A6X A;  4PG3 A;  2K03 A;  2O5J C;  1BNC A;  1LTT D;  2L15 A;  5LOV F;  3PW2 A;  3HP3 A;  2OQK A;  4H02 A;  5KG6 A;  2JA7 A;  5LL6 S;  4FXG C;  1O7I A;  3PO2 B;  4C2M B;  4O4I F;  3CMA A;  5EWE A;  1EFI D;  1J5E Q;  2AGP A;  2BA0 A;  3BVM A;  1FVI A;  4RAU C;  1BJT A;  1NUC A;  1S68 A;  5GRO A;  4JI7 L;  1BNZ A;  4RHS A;  4Q0Y A;  2UVU A;  1ZHQ A;  4PV1 C;  4R1J A;  3BG3 A;  1PH4 A;  2PNR C;  3DF7 A;  2F1M A;  1B6R A;  4DR2 L;  2W6N A;  3HOZ B;  2B2U C;  1EYZ A;  2KEN A;  2GVA A;  3BVG A;  1X65 A;  4X64 H;  5E1F A;  4B9X A;  1PH7 A;  1Q90 A;  3GIJ A;  1I6U A;  4DV0 H;  2KA7 A;  2EDG A;  1XPR A;  4HNT A;  3OMG A;  2K75 A;  5CBE E;  3C1F A;  4ED6 A;  2F0P A;  4ECT A;  1BCP B;  1SYG A;  2IHE A;  4A2A A;  4X65 L;  1ZYR C;  4HNV A;  3AYH B;  1HR0 H;  3WO1 A;  2LS0 1;  1TVX A;  1GOZ A;  3TSS A;  1FJG Q;  2QF7 A;  1TWH H;  5GAD C;  4A3G G;  2OTJ A;  1HH2 P;  1QCB D;  3PUX A;  2H5X A;  3PIO A;  4JCV E;  5KG1 A;  3BU2 A;  1T5X D;  3PW5 A;  5C5M A;  1IZ6 A;  2J4X A;  4HIM A;  4JOI A;  5C44 B;  3LWB A;  4IN3 A;  4MTK A;  2B2T C;  3V96 A;  4DL2 A;  1J5E L;  1IBL H;  2XGT A;  1GSA A;  3OW2 A;  1X32 A;  4M7E A;  3AEV A;  3UQ8 A;  4X62 H;  4TSS A;  1PK8 A;  1K8O A;  2MNA A;  4A75 A;  2FJZ A;  3CQZ A;  1SYD A;  2EOT A;  4UCR A;  1MSG A;  4U68 A;  3UE1 A;  1WD1 A;  3KOJ A;  4MA0 A;  4RB0 A;  3RF2 A;  2RVL A;  1L1O B;  5EOY A;  4ECY A;  4OON A;  2RQX A;  3BYY B;  2PW5 A;  3C1E A;  3MC0 B;  5KT2 A;  3RB3 A;  2A1A A;  4NXN Q;  3A8I E;  3D4D A;  4FF3 A;  3HOW G;  1E1O A;  1WTW A;  1X56 A;  3V6H A;  2NVY B;  1M0W A;  1KAB A;  3FVQ A;  4B3T H;  4WFN 3;  4A3J B;  3D4W A;  1AZQ A;  2JEJ A;  1D1I A;  2WAQ E;  4K14 A;  2G5D A;  1LTL A;  5DLQ E;  5FOB B;  5DAU A;  4C3H B;  3NSW A;  4KK7 A;  3FPP A;  4FS1 A;  4J15 A;  3FKI B;  1FJG L;  1HNZ Q;  4X66 H;  4FXD A;  1LT6 D;  3ERO A;  1HZA A;  3M9M B;  2F4I A;  3PO3 G;  3BAB A;  1OTC A;  1VQA A;  4R8N A;  5HGQ A;  4JI4 H;  4ID6 A;  1E22 A;  2DY7 A;  3TII A;  4ZI7 F;  1XNR H;  3S24 A;  1JLL B;  1EY7 A;  5JQW A;  1PFM A;  4WBN F;  3GTO B;  4APM A;  4IFD I;  3OYY A;  2VXW A;  1SE2 A;  3T5J A;  3TS2 A;  3QZ8 A;  2ZTD A;  4KD3 A;  3BYT B;  3QOL A;  1M6V A;  3ULJ A;  4MAM A;  5JVL A;  2YL2 A;  2ZDQ A;  1A3T A;  3FP9 A;  4IRD A;  2CQO A;  4CDC C;  2B63 G;  1HNW H;  2R8H A;  4DNT B;  1XMO H;  2HCI A;  4R4C A;  4U6P A;  3MR3 A;  4EBE A;  1V4Y A;  4HSV A;  4NXN L;  4APV A;  1I94 L;  2EPB A;  1ZHS A;  3PGZ A;  3HKZ G;  1RTO A;  5C5J A;  1PX2 A;  1SND A;  1Y8O B;  2ZM6 Q;  1TXY A;  1IKM A;  5KFN A;  1JOO A;  1KEE A;  3CCR A;  3BDL A;  1Z9F A;  3MWD A;  1HA6 A;  5KFC A;  4ECV A;  2NZ1 D;  1HNZ L;  1KBL A;  3V6J A;  2FXQ A;  5KFX A;  1SMY D;  3A8K E;  4JI1 H;  1QWY A;  2R8I A;  1KLG D;  1T94 A;  5C3X A;  1CK1 A;  1XMQ H;  1QE6 A;  3GO5 A;  4HR7 A;  1KNE A;  2E76 C;  4ZUI A;  2VQD A;  3TBI B;  2A8V A;  3VA5 A;  2K32 A;  4I65 A;  2A73 B;  5EJW A;  1KJJ A;  3GD7 A;  3BA9 A;  1EEF D;  3HKZ E;  4A2B A;  5CAE B;  1I3Q H;  4G7H C;  2J9G A;  1JIH A;  5I6W A;  1Z47 A;  2YRW A;  1EZ8 A;  2EJF C;  1PA6 A;  4MV1 A;  2QW7 A;  4J1M A;  1HTL D;  3LX0 A;  3RN2 A;  4XQJ A;  5D1O A;  4R4I A;  1A62 A;  4HID A;  3JZI A;  4L5R C;  3ZJY C;  4MV9 A;  5JUM A;  3E9H A;  2N3S A;  4K5X A;  2R92 B;  3CPF A;  2E2J H;  5IT9 W;  5FJ8 G;  4A3I B;  1N36 Q;  1BBX C;  2ZM6 L;  1SJE D;  1SMY C;  1EU4 A;  2K5W A;  5IP9 H;  4YIJ A;  5IP7 G;  1E4E A;  2R7M A;  3OHA A;  5FLM G;  2YTY A;  3RB6 A;  4TQU S;  3K5N A;  2HQL A;  3KLS X;  1S10 A;  5DGB A;  1BBW A;  1K0R A;  1NR2 A;  1EL0 A;  2IL8 A;  3EQL C;  1U4R A;  3NBI A;  3RB0 A;  1V1P A;  5E3F A;  2W9B B;  2A69 C;  2BA1 A;  4ULL A;  2Y0S A;  2LXK A;  3EVQ A;  4NDX A;  2QA4 A;  2R87 A;  1Z2O X;  1CE8 A;  2E2I A;  2R93 G;  2A6E D;  4UY8 C;  1IYU A;  3CCS A;  5IT9 E;  2ZXP A;  2RDH A;  1O7L A;  2XVS A;  4QWC A;  1BXT A;  3Q0A A;  3CU7 A;  1CUK A;  4A3K B;  4OWW B;  5KT6 A;  1ZEQ X;  4LFC H;  5BN3 A;  5LMU L;  1DV2 A;  4JV5 Q;  4O3Q A;  2B2U A;  3ONA B;  2VW9 A;  4RKB A;  2CW0 D;  4HQ6 A;  2W6O A;  1EFW A;  1R4Q B;  3KK7 A;  3GIM A;  3QO2 A;  4A3J G;  4N8F A;  3SE7 A;  2UUA H;  4ALP A;  2PMZ B;  3S1N B;  1EQR A;  1KQS A;  2BH2 A;  4WJ3 M;  2D62 A;  3VR2 A;  1GUG A;  2O5I C;  2VQE Q;  1N36 L;  4DV7 Q;  1S0N A;  2MP1 A;  2NVX A;  2KCM A;  3CVZ A;  4YP3 A;  3BQ2 A;  3GTQ H;  2IX3 A;  3MHB A;  3ETJ A;  4R9W A;  2PO4 A;  2W9C A;  4LF5 Q;  3JRX A;  4BXX G;  1VBG A;  4DGZ A;  4IOC A;  3H6M A;  4C1N I;  2PZW A;  5KNC A;  3F1Z A;  4RU9 A;  2JA6 H;  2K01 A;  1AZP A;  4B3R H;  2CW7 A;  2B2T A;  5KIX A;  3HOY H;  1QNU A;  3K6O A;  2VQF H;  1C9O A;  2M00 A;  4YCU A;  4NXM Q;  4DUZ Q;  4HJ5 A;  3V05 A;  4O3S A;  2RHS B;  4ZUJ A;  5C1P A;  1W2B A;  4KY5 A;  2HDL A;  1WR2 A;  3H09 A;  4JV5 L;  4A3E H;  1MGS A;  4DV2 H;  1KJI A;  1Y1W A;  4CJ1 B;  3K5I A;  3AFP A;  1EY6 A;  2LKV A;  2IPK D;  4HCS A;  2FPP B;  4UCS A;  2F0J A;  2E2H B;  5C0X I;  2XCP A;  1S4Z A;  2AKW B;  4EYI B;  1EIH A;  1SBB B;  3HOU B;  3N52 A;  5JPM C;  4HED A;  4IHJ F;  1K3R A;  4DR4 Q;  1L2F A;  4R8U A;  4QWD A;  3H0G B;  1F2Z A;  1DOM A;  3PV0 A;  1IL2 A;  1VQP A;  4MV8 A;  4DV7 L;  2R61 A;  1G29 1;  1ILP A;  3GTM H;  1T3N A;  1E3P A;  3GTL H;  3PW0 A;  1SNO A;  1DOL A;  1UE1 A;  1WTR A;  4JBK A;  1P16 A;  1VQ6 A;  4LF5 L;  2F3W A;  5GAE C;  2DGY A;  4ILW A;  1TWC A;  1IOW A;  2C35 B;  4O3N A;  4RNN A;  2F0K A;  1WTH A;  2WB1 A;  1CQI B;  1L0X B;  3W1B A;  1PH2 A;  2KJX A;  2KCC A;  5C4X G;  4Q8F A;  1LLR D;  1YHB A;  1AUV A;  2MFI A;  2QDL A;  4Y8V B;  1B3A A;  4OO1 I;  4NXM L;  2GPS A;  2A5H A;  3G4S A;  1RYR A;  3DUZ A;  2B2V A;  5EWG A;  1RJQ A;  4TQS A;  2LMC B;  4DXF A;  1EIF A;  4DNI A;  4RNO A;  4DUY H;  4MV6 A;  5IIF A;  3CD6 A;  4XIG S;  1TWA B;  2R92 G;  3HBL A;  4XT1 B;  4MV7 A;  2EJM A;  5KFG A;  4G7Z C;  4A3I G;  3OPO A;  2R7Z A;  2XGP A;  1G51 A;  5M5Y H;  2OLS A;  2C2R A;  3Q6S A;  1H9S A;  3P1H A;  4DR4 L;  1WSC A;  3GTP B;  1JOR A;  1HR0 W;  2K33 A;  2LFN A;  1JMC A;  1HFG A;  5I9P A;  1JWM D;  1Y1V H;  4FM9 A;  2ASL A;  2XCL A;  3UFX B;  1DJR D;  2EVB A;  3L0O A;  3K3P A;  3OHB A;  2BCO A;  3IRB A;  4TKO B;  1JOK A;  4KHP Q;  1RJP A;  3JAM W;  3MFG A;  3LML A;  4QIW A;  4JUZ A;  1X6O A;  2K52 A;  4EBD A;  2JEG A;  4I50 F;  4EQP A;  2K50 A;  5DM7 3;  3NE5 B;  2R7N A;  4IUV A;  4A3G H;  2R3Z A;  1VDZ A;  1BXR A;  3I2Z A;  3WOF A;  1XNQ Q;  4DR6 H;  4LFA H;  4A3K G;  1WTP A;  2F0Q A;  2W8K A;  3A55 A;  4IO9 A;  4A3B G;  1PZJ D;  3M9O B;  2C5C A;  2AGQ A;  4IUU A;  1B44 D;  1KC8 C;  2N55 A;  1WI5 A;  4JW0 A;  1X9N A;  4LNQ A;  5KND A;  1C7Y A;  2IWH A;  4DR7 H;  3JAM E;  1IOV A;  1ESR A;  3T13 A;  3P7J A;  4L63 B;  2L0C A;  2JN4 A;  3KLR A;  4CDE C;  4EGJ A;  5M5X B;  1KRS A;  2ZTC A;  4O4L F;  5BN4 A;  1GM5 A;  3NK9 A;  1V43 A;  1QZH A;  2VZA A;  3VR6 A;  2JA5 A;  3E6Z X;  3MTS A;  1TR5 A;  5E4X A;  1VQD A;  4IPG A;  2HJW A;  3HEJ A;  3HOW H;  3GTG H;  3I4L A;  1EUD B;  3NP8 A;  4MIU A;  4H7B A;  4EEY A;  1CKN A;  1IBK H;  1QIL A;  5CV6 A;  2WII B;  2PMZ E;  1SMX A;  4HJA A;  1EIG A;  3HS0 C;  1TWG H;  4JBW A;  3EIV A;  4DNR B;  2FMC A;  5C3E G;  4DR3 Q;  2VUM H;  4LK1 C;  2DLN A;  1PRT D;  1GD7 A;  1XNQ L;  2Z9H A;  4P71 A;  2MJ8 A;  3PO3 H;  4IFD J;  4V19 0;  1JDB B;  1Z7T A;  2AQ2 B;  2JQO A;  2VY3 A;  4QUF A;  3T1Y Q;  2JA7 B;  3VMM A;  1T5E A;  2I5L X;  3J81 c;  1STA A;  1S0O A;  2FLL A;  1TWF H;  1I6V C;  5EKL A;  4GOP B;  1R9T H;  1Q1B A;  2JSO A;  4JG2 A;  4A3D B;  1RD9 D;  4G4K A;  4CGY B;  2NB0 A;  1E2Z A;  2Z6B A;  5A2Q L;  3RUP A;  3CCM A;  1Q86 C;  1EUC B;  1QVF A;  3QWN A;  3U4V A;  4IPC A;  3PIP A;  2B63 H;  4XDX A;  3PSI A;  5M3M B;  1I4G A;  3IFD A;  4BS9 A;  4UAI A;  2FLP A;  3H91 A;  2A6H D;  2VB3 X;  3T1H Q;  5LXT F;  3LWE A;  2WKD A;  3BA8 A;  3T5H A;  2OEO A;  3SR1 A;  5DG8 A;  4P72 A;  1J5E H;  4IQZ A;  2W7O A;  1YNX A;  1FNW A;  4DAM A;  3JAM i;  3L2P A;  4Y7N B;  3MWE A;  1SFO H;  1C4Q A;  2ZXR A;  3J7A K;  2WIN B;  1YHQ A;  2DWC A;  4LF7 Q;  3MEF A;  4DR3 L;  2R85 A;  4JOI C;  5HUR A;  4YCV A;  4C2M H;  2Z6K A;  1KNA A;  1QUQ B;  4CBV A;  3DMU A;  5KG4 A;  5COR A;  3T1Y L;  1E7Z A;  1YJN A;  2EY2 A;  4IRK A;  4O2D A;  4LUV A;  5AFW A;  2CVR A;  1O80 A;  4L5Q A;  2HDM A;  5E4W C;  2E5L H;  4K5W A;  3HOZ H;  1PTO D;  2I0Q A;  4POG A;  4F87 A;  1GLV A;  2NN6 I;  3V6K A;  1NY4 A;  2PW7 A;  5IWA Q;  1NMG A;  3J80 c;  4KY6 A;  3EYY A;  4TV8 F;  2DPJ A;  4DU9 A;  3G6Y A;  2YS6 A;  2VA3 A;  1SRU A;  4LAA A;  1FJG H;  3S2D B;  1YBY A;  2A6H C;  1B4O A;  4UDU C;  2KHJ A;  2HUG A;  4LF6 Q;  2GLT A;  1HUM A;  2J0T D;  4O42 A;  2KUM A;  1MBY A;  4DFA A;  1J8I A;  1LV9 A;  1NMF A;  1CTM A;  2XCA A;  3T1H L;  4RAY A;  5NUC A;  2FMA A;  5FJ8 H;  4A3C G;  4XYQ A;  4J0M A;  4PNY A;  2DN8 A;  4DV5 Q;  3EJI A;  2QKI C;  3FHW A;  2YCH A;  4LUZ A;  5FLM H;  4DN4 M;  4LF7 L;  1QVC A;  4HTH A;  5C44 H;  1HZC A;  4ZRZ A;  5A2Q W;  2XD4 A;  1EWH A;  1KDC A;  3DM1 A;  2K5N A;  2W6Q A;  1Q82 C;  1PTO C;  1GUT A;  2XC9 A;  1JE4 A;  1PH1 A;  2WFW A;  4ZAI A;  2FPG B;  2I5H A;  3CRK C;  5M9O A;  4NXN H;  2P5Z X;  4I7H A;  1I94 H;  1MJC A;  4KTA A;  2OTL A;  2R93 H;  4JI5 L;  3I8Z A;  4A3M G;  3Q8D A;  1ILQ A;  3B6Y A;  4RZQ A;  1IBM Q;  1XDN A;  3BJU A;  1SYF A;  2F4V Q;  1KL9 A;  3M4Q A;  4JI3 Q;  2SDF A;  5A2Q E;  1HNZ H;  2YYZ A;  4KKS A;  5KFD A;  5JJK A;  4LF6 L;  2NVY H;  3NEM A;  4A3J H;  3SVM A;  2NVQ H;  1N34 L;  2CQA A;  5I4D A;  1I3Q A;  1C30 A;  1H95 A;  3Q8R B;  4I7Z C;  3BDO A;  3TQ1 A;  1S9F A;  3L4J A;  3FEW X;  4O2A F;  4K8I A;  4C3I B;  2D2C C;  4DV5 L;  3I4M G;  2MO0 A;  3OSP A;  1U5K A;  4DKA C;  2EZV A;  2JA9 A;  3N6R A;  3HKS A;  2JA7 G;  1V51 A;  1Q1E A;  3ORQ A;  4P2C B;  3S14 H;  3S15 B;  1EOT A;  4UCO A;  4FS2 A;  4DL3 A;  3GQB A;  4BXX H;  4DK3 C;  1ENC A;  2ZDH A;  5IYB G;  4ECW A;  3GTO H;  3J7A F;  2PQA A;  4KHV A;  3I3C A;  3FDS A;  4HR7 B;  5KFR A;  5CMD A;  2BH8 A;  1A2U A;  3GTJ B;  1N9W A;  3S1Q B;  4EVO A;  4GLV B;  2VL6 A;  3KF8 B;  4AQY Q;  1W93 A;  1SEB D;  4DAY A;  1I4R A;  3L9A X;  1CSQ A;  5C0X J;  2ZM6 H;  2KOL A;  2ENB A;  1UEA B;  4ZLT F;  4LFB L;  2B2W C;  5M3M G;  1D7Q A;  5BR8 H;  1IBM L;  5J22 A;  1S03 G;  2H1E A;  5D3I B;  4ECX A;  4BY7 G;  1HNX H;  3VA7 A;  3ITP A;  5D14 A;  3EN2 A;  1HZ9 A;  4JI8 Q;  5DQG A;  3RV3 A;  2C22 A;  4PZ6 A;  5KFI A;  1VF7 A;  2CWA A;  1VQ9 A;  1EYA A;  3K81 C;  1K83 B;  1EQV A;  1U9R A;  1A0I A;  2YU9 B;  3M4O B;  4ED3 A;  1SFO B;  1JDE A;  1K28 A;  1B70 B;  1S5D D;  3ERS X;  2UXD Q;  1UAP A;  5LMU H;  3U9S A;  2CFM A;  1V1P B;  1AEX A;  4ODG A;  1PH5 A;  4DV4 H;  1WH2 A;  4A4I A;  1PV4 A;  3GTK B;  4IRC A;  2SEB D;  2UXB Q;  5BPH A;  2UVW A;  3G7L A;  1LM0 A;  5KNB A;  3GTQ A;  2RSO A;  1M4V A;  1WCM B;  1CFM A;  3NQT A;  1KAW A;  3MXU A;  4RGT A;  3FDT A;  4JI2 Q;  1SYC A;  4AQY L;  2J6U A;  4U7C A;  4C1N K;  2RA4 A;  5IGG A;  5KX5 F;  5L1J A;  4CJ2 C;  2CQY A;  2JA6 A;  3NWT A;  3QG1 A;  2F0L A;  1O7Z A;  1FL0 A;  3W1G A;  2R92 H;  2XIG A;  3Q8S B;  2J6T A;  2WAC A;  4JI8 L;  1B9N A;  1RKN A;  2F3I A;  3CCQ A;  4A3I H;  3MAQ A;  1B9M A;  2J7Z A;  4L1K A;  2VPS A;  3K59 A;  4RWS C;  5M3F B;  3E9I A;  4R7R A;  4LF8 Q;  5G3L D;  3NTK A;  1X3F A;  3OUU A;  1VCI A;  2JJQ A;  1WTV A;  4LF4 Q;  1M7J A;  1BDO A;  1ESF A;  4QW9 A;  3GV6 A;  3OTO Q;  4FYD A;  1EYG A;  2UXD L;  4UFZ A;  2W9C B;  2W9A A;  2SCU B;  4JV5 H;  1Q81 C;  1CSP A;  3J80 L;  1JOQ A;  3GTM A;  2RDJ A;  2UXB L;  3G6E A;  1E0B A;  1KHI A;  2RCF A;  3GTL A;  1A2T A;  3DEP A;  3OMC A;  4GS3 A;  4A3K H;  1I50 A;  5J2U F;  3KHH A;  5CA0 F;  1TQO A;  1W3S A;  4EQO A;  4MNO A;  4WOR A;  2R93 B;  2XWJ B;  1IXR A;  3SI8 A;  4DV7 H;  2EE1 A;  4YCW A;  2JE6 I;  4ABN A;  3S1N H;  2I80 A;  4RB3 C;  2W70 A;  3HXL A;  4LF5 H;  1STG A;  4HNU A;  4DL6 A;  5IE8 A;  4CHT B;  5CYU A;  1XPU A;  2AMC B;  4C3I G;  2PQE A;  1J6Q A;  4GKJ H;  3TZU A;  2NVQ B;  4PMC A;  3KLW A;  1FD7 D;  2EYM A;  3L7Z C;  5L9X A;  1I7N A;  2NUC A;  1HFN A;  1WTQ A;  3E0E A;  4J6H A;  4LF8 L;  4OGQ C;  4DV6 Q;  4FF4 A;  1GJX A;  1EEI D;  4ED8 A;  4LF4 L;  3KDF A;  3S9W A;  2EQS A;  5CBA E;  3OTO L;  1SNQ A;  4X3U A;  3C3L A;  3TN2 A;  5A35 A;  3GIQ A;  4JYA L;  4A3F B;  4A93 G;  1GUO A;  1TWC B;  2EIF A;  3TDQ A;  3S14 B;  1Y1V A;  2WB1 B;  3NTI A;  4UCV A;  1WTO A;  2F0S A;  4JK1 C;  3KXY T;  1SYE A;  3KJP A;  3AB9 A;  1A15 A;  4RGM A;  4LSX A;  3H40 A;  1XPO A;  1RCV D;  2L1B A;  2B2V C;  2L12 A;  4X3S A;  3MXN A;  1LTA D;  4B3S Q;  1BKB A;  2BOS A;  2E2H H;  2DJG C;  4YJ3 F;  3MZ5 A;  1N33 Q;  3R2T A;  2QCP X;  1DOK A;  3HOU H;  2YYA A;  3CPW A;  2UUB H;  2V5A A;  2O4X A;  1S5C D;  2A74 C;  2JK8 A;  3H0G H;  3J81 j;  4HJ7 A;  3K80 C;  2R7Z B;  2VA2 A;  2IX1 A;  1SNC A;  1E24 A;  3H3V I;  1H9M A;  4F4W A;  2F0I A;  2XSC A;  1CZG A;  2IJ0 A;  2WAQ A;  1HCZ A;  5F9L A;  5CC4 A;  1VQH A;  3FPU B;  4RKL A;  5EPJ A;  3TZD A;  4F7X A;  4DV6 L;  2BQR A;  1EY5 A;  1STH A;  5KFT A;  1FGB D;  1JJG A;  4WRD A;  4XX0 B;  2Y0S G;  4RHR A;  1D6E C;  4QUC A;  2ATW A;  4RGO S;  2ZT9 C;  4AYB B;  1STY A;  1VQO A;  1MKH A;  1WCM G;  4J9N A;  3M9B A;  3H3V C;  1JJC B;  4RGN A;  2B2Y A;  4NKL A;  3WDN A;  1S40 A;  1QJO A;  2E74 C;  1QOH A;  4CC5 A;  3IKJ A;  4YY3 Q;  5C4X B;  4JBM A;  2AWO A;  1QZG A;  4K6L A;  4B3S L;  5CV7 A;  2UVV A;  5KFY A;  1KRT A;  4WJ4 A;  5KG2 A;  3F2D A;  1TWA H;  1ASY A;  1HPC A;  5I9O A;  2Q2H A;  3UDI A;  4EQ5 A;  4DV1 Q;  2VUM A;  2B2W A;  1N33 L;  2OT2 A;  4K2L A;  1PH9 A;  3SEB A;  2F0M A;  3GTP H;  1TU2 B;  1CQJ B;  4C5B A;  2NVT B;  2KSW A;  3CHB D;  5M3F G;  3OWF A;  2K5Q A;  3E5N A;  5J1Z A;  4BBS G;  5LP6 F;  3T51 B;  1GUW A;  3N43 B;  1XNQ H;  2JA5 B;  3Q8Q B;  3KAK A;  3RIZ A;  5KKN B;  5KFK A;  3F8N A;  2QEJ C;  1YNN D;  1D8L A;  1UNN C;  1H9K A;  1ML0 D;  2RBM A;  5IOD A;  2O03 A;  4Q0F A;  3MA2 B;  1DIK A;  2XRQ D;  4ZQI A;  4A3C H;  1PMR A;  3K7U C;  3D31 A;  1Q8I A;  2R8K A;  4BA1 I;  4HJ8 A;  2HGS A;  4A3L G;  4Q45 A;  3PIO 3;  5ELO A;  1BF4 A;  3CCE A;  3N8D A;  2K6A A;  3RR5 A;  1WOC A;  3UDX A;  3SXH A;  3HKZ A;  4DL4 A;  2F0H A;  4M8A A;  4OIJ A;  5K2M A;  1GVP A;  5FK9 C;  5LYJ F;  1I4P A;  1PYW D;  1Y8N B;  1Y1W G;  4A3B B;  2HHH Q;  1SEI A;  4QWE A;  2EYL A;  3BG5 A;  2HCC A;  4Q43 A;  1VS0 A;  3RB4 A;  2VNU D;  5M5X H;  2QK4 A;  1NSN S;  4FF2 A;  4GZY C;  4C2M A;  4R4T A;  4POF A;  4BWS C;  4EG0 A;  3M7N A;  5FLX c;  3Q2O A;  3C2P A;  1F77 A;  1D5X C;  1YNN C;  3HOX G;  3VDY A;  5IYD H;  2R8J A;  4DR3 H;  4HAE A;  4QMG A;  3J7Z C;  1T36 A;  4L8J A;  3F2B A;  1SR3 A;  4JI0 Q;  1LO5 D;  4XYM B;  2KBN A;  1HJP A;  3PUZ A;  3N42 B;  3CXC A;  3GIP A;  4A3F G;  5K36 G;  2AQ3 B;  2YW2 A;  4E6I A;  4QL5 A;  1ZKO A;  5CV4 A;  1HQR D;  2WB1 G;  4DR1 H;  4O3R A;  3IN5 A;  2A6E C;  1YJW A;  1IBL Q;  3GV7 B;  2UUC H;  1FGU A;  4Q5V A;  4F8M A;  1K8M A;  4ED2 A;  2R7K A;  1F2Y A;  1B50 A;  2Z6K C;  2JA7 H;  1K1S A;  1H9J A;  1M1K C;  1YNJ D;  2MQH A;  4OWX B;  1KDA A;  3CAM A;  5I47 A;  4ECS A;  1II3 A;  1Q3L A;  5C3E B;  1JWS D;  2CW0 C;  4FU0 A;  5IYB H;  3VYT A;  4EQN A;  2AHO B;  3RV4 A;  4NP5 A;  2B29 A;  3TRZ A;  2HHH L;  4PMB A;  5LMN Q;  3Q23 A;  4A3D H;  2X0S A;  3R5F A;  3T1H H;  2O2L D;  2R7Z G;  1ZQ7 A;  3PR5 B;  4QW8 A;  5C4J B;  5C5L A;  3IL8 A;  3RBD A;  2F0W A;  4FVM A;  4UCU A;  2N78 A;  5M3M H;  4IFD G;  2IHF A;  4PDB A;  4ED0 A;  1LTB D;  4ZKB B;  2VQE L;  1MJE A;  2PN1 A;  3I73 A;  5JJZ A;  1HUN A;  4BWG B;  3H20 A;  4MV4 A;  4C3J G;  5KG3 A;  1GUS A;  3D6W A;  4JI0 L;  4QCL A;  5BMV F;  1YVC A;  1B33 N;  4LH6 A;  2XRS D;  5FKA C;  2ZJR A;  2IY5 B;  2R82 A;  4JI4 Q;  4Y7N H;  4AYB G;  3M3Y B;  1XNR Q;  2YS7 A;  2HQE A;  2L5T A;  1PRT F;  1EYD A;  1YNJ C;  3UE0 A;  1IBL L;  4L5S A;  2I87 A;  1SNM A;  5FD6 A;  4JI5 H;  3A7A B;  1JKJ B;  4K8J A;  5JAV A;  1RJT A;  2B8F A;  4IUR A;  4QQB X;  3EA6 A;  3K0X A;  4EYH B;  2CH4 W;  5HY6 A;  4ECU A;  4DUZ L;  4OHJ A;  2CZG A;  4OX9 H;  3FKI A;  3GP7 A;  2CW8 A;  5LL6 X;  1A3V A;  4RCN A;  1XMO Q;  3SK8 A;  5AJ3 Q;  5LMN L;  5DQH A;  4DR5 H;  1N34 H;  1EY9 A;  2WE6 A;  2R86 A;  1W96 A;  2JEI A;  1E2V A;  4AYB E;  4O1N A;  4H44 C;  3GV8 B;  4NMZ A;  4QJF A;  5IGD A;  4CC6 A;  3S2D H;  2BE5 D;  3G6J B;  4FNF A;  3GTO A;  2K1B A;  4KD4 A;  2SOB A;  2JA5 G;  1ICF B;  2YZN A;  3N6X A;  3UI2 A;  1B3Q A;  2P0A A;  2DPI A;  2IA6 A;  1Q12 A;  5JEA J;  4L6T B;  5JVD F;  3NHH A;  4FF1 A;  4ETS A;  3BAA A;  2UU9 H;  3K57 A;  1L2Z A;  3GII A;  3VPB A;  1QVG A;  2ICI A;  4CJ0 B;  1XMQ Q;  4JI4 L;  4GLX A;  1VKZ A;  1XNR L;  1CM9 A;  1EWI A;  3HOV B;  5DQI A;  2EJG C;  2G9D A;  5FPO A;  2OWO A;  2W7P A;  5CV5 A;  2KVM A;  1LT4 D;  3T53 B;  5H80 A;  4LFB H;  1QB5 D;  1NBW A;  3K0Y A;  4UCT A;  1N32 H;  3F2C A;  1H9R A;  1LT3 D;  1SE4 A;  4GN5 A;  2FB9 A;  2AUJ D;  1B1Z A;  1PTO F;  1Q46 A;  1BBU A;  2VB2 X;  2PQA B;  4JI6 Q;  1XMO L;  2A19 A;  4EX5 A;  1X3G A;  3VR5 A;  3RFC A;  3KBG A;  2RSN A;  1U0L A;  4PZ7 A;  2JYO A;  1F9Q A;  2UXC H;  1JE5 A;  1WJJ A;  2YTV A;  2A68 D;  3J7A 5;  4K0K Q;  1PZI D;  3TQY A;  3CCU A;  4A3M B;  3GLK A;  1OXV A;  2EYF A;  5IGC A;  3KF6 A;  4JBJ A;  4GC7 A;  2PI2 A;  4YWM A;  5C3W A;  4IJL A;  1EOV A;  1SAP A;  4YJ2 F;  1EYC A;  2K5D A;  3PUV A;  4J8Q A;  4KHP L;  4C3I H;  3GQC A;  1CHQ D;  2AU0 A;  2AQ4 A;  5KFU A;  3G6X A;  1B53 A;  3Q24 A;  5EAY A;  4BY1 B;  5LMN W;  3DWP A;  3Q8P B;  4JI7 H;  2Q2I A;  2DZD A;  4JYA H;  3S15 H;  2R92 A;  4RNM A;  4DV3 Q;  2GA4 B;  4AQY H;  3MWY W;  3NPP A;  4XXE A;  1PDQ A;  4DR2 H;  3E5S A;  2R6F A;  3I4M B;  5EZY F;  5DNF A;  5KYL A;  1EY8 A;  2FPI B;  4LFC Q;  2VPQ A;  3EPG A;  1B04 A;  5KFF A;  3URY A;  1N8R C;  1JX4 A;  3GTJ H;  1SCU B;  3S1Q H;  5KG7 A;  5IY0 A;  4JI6 L;  4MV3 A;  1TWH A;  3HZX A;  4JI8 H;  3ERQ A;  2M05 A;  2W9B A;  1IYJ B;  4X65 H;  1UE5 A;  3BZK A;  1VQM A;  3Q22 A;  1JC7 A;  3QR8 A;  1RK5 A;  1S97 A;  2FK1 A;  3CP0 A;  5KFW A;  4IUP A;  4K0K L;  1SRO A;  4LW1 A;  4YWL A;  1CT1 D;  1PXU A;  5JJL A;  3K5M A;  2OH2 A;  1NE3 A;  4DAP A;  5H1S E;  3ETH A;  1SYB A;  2Q2U A;  1EU3 A;  1RF2 D;  1W6J A;  4XQN A;  5KFB A;  4BY7 B;  3BZC A;  2B8G A;  3SHL A;  4LSA A;  5C0X G;  1PRT C;  1K83 H;  1JB7 A;  3N40 P;  5I6Y A;  2YU9 H;  5JH7 F;  3M4O H;  1VQK A;  1TS2 A;  3CW2 C;  3HG9 A;  3S17 B;  1KJ9 A;  4DV3 L;  4YR0 A;  1I4Q A;  3H4D A;  4RG1 A;  2FK2 A;  5FO7 B;  1YEZ A;  1SNP A;  4FBU A;  1RTN A;  5EGT A;  1LT5 D;  4MTN A;  3GTK H;  3A0J A;  4YWK A;  1PFB A;  4HSP A;  4DV2 Q;  2MO1 A;  2R8G A;  1PH8 A;  5K5P A;  2E2I H;  1WCM H;  1I7L A;  4ZQ3 A;  3FMA A;  3RLN A;  4DL5 A;  1KC7 A;  3VR3 A;  4ME3 A;  4MTD A;  1I50 B;  4CKB A;  4WD3 A;  1X54 A;  3CQZ B;  5C6A A;  4YR2 A;  5LHY 1;  3UDG A;  3WNZ A;  4QGU A;  3RUZ A;  1ULZ A;  3N41 B;  3KAL A;  2EYP A;  4LF8 H;  5TSS A;  5D1P A;  4OO1 G;  3T16 A;  3I4N B;  1VBH A;  1N56 A;  2F0F A;  1JCK B;  1VQG A;  4CDD C;  4GNX C;  4IOA A;  2FKL A;  2VOB A;  2L11 A;  2L9H A;  2R7F A;  5J2T F;  3M4I A;  4GKK Q;  3HOV G;  1AN7 A;  1BR9 A;  4YQW A;  3M9N B;  2E2H A;  5M3F H;  1S72 A;  1RHP A;  1STE A;  2KHS A;  3SE0 A;  5IP7 H;  2NVX H;  3QJY A;  4H13 C;  2V59 A;  2BR0 A;  5J3B A;  5DGA A;  3Q1K A;  1PZK D;  3GV3 A;  3H0G A;  3V4S A;  4IPH A;  4DPG A;  5HGT A;  1GXD C;  2N49 A;  1O7Y A;  4KV6 A;  1C3O A;  2IP4 A;  5IYZ F;  5L1L A;  3T56 B;  4A3L H;  4CKC A;  4DV2 L;  4TVA B;  2ZJT A;  1ROD A;  5GAH C;  1B8A A;  3KHG A;  1NTG A;  1PTO B;  5IGB A;  5IYC G;  3KJO A;  2VS1 A;  3BS1 A;  3S1M B;  3PN1 A;  1UC8 A;  4J9L A;  5DEH A;  1ONL A;  2XWB B;  5IWA L;  1F9P A;  1E2W A;  3ORR A;  2W6M A;  2V58 A;  2WYO A;  4F88 A;  1DYQ A;  1EY0 A;  1NNX A;  3NGD A;  3TQT A;  1X3P A;  2NU7 B;  1RJR A;  4ED1 A;  1VQ4 A;  1UEB A;  2CHB D;  4QWA A;  2V4R A;  4BA2 I;  2W8L A;  3JRW A;  4BY1 G;  1UNS A;  4GKK L;  1PVO A;  3LNN A;  3G71 A;  1TS5 A;  3HOX H;  5G3L F;  1B2T A;  1XTD A;  4TRD A;  2Z4I A;  1FYC A;  4I4T F;  1EQQ A;  4RH6 A;  5L37 A;  4F4Z A;  1IYV A;  3K5L A;  2F0U A;  4ME6 A;  4E4T A;  2PPB C;  2IMW P;  4HN7 A;  4XT3 B;  4HMJ A;  4KMU C;  5IT9 c;  2PCF B;  4A3F H;  4UPA A;  4EBC A;  4LWC A;  5K36 H;  1TWC H;  5IOC A;  1EUJ A;  4B3S H;  1CA6 A;  1CKM A;  4KKU A;  3K58 A;  4DR7 Q;  2QYZ A;  1CS0 A;  4KLK A;  1VQI A;  2B2Y C;  3S1R B;  4N9T A;  4FBT A;  1Y14 B;  1YJ9 A;  4A93 B;  4RFB A;  4DK1 A;  3J7Y W;  5T1G A;  3IAY A;  2WDT A;  5CB4 F;  3RJ0 A;  3GID A;  3NEL A;  1CA5 A;  3BZD B;  4PWQ A;  2E8G A;  5ELB A;  1LAB A;  3A54 A;  2FHT A;  4B9W A;  5BN5 A;  5I2X A;  4O3P A;  4V0B A;  2NTS A;  2SNS A;  4OIK A;  1UE7 A;  3RAQ A;  2I07 B;  4KN4 C;  3HOY G;  4UP7 A;  1VQJ A;  2F4V L;  4JI3 L;  1KJQ A;  2XGQ A;  4K5V A;  2R7Z H;  5D1O B;  2FP4 B;  1IBK Q;  5KFE A;  2EYH A;  4P74 A;  4IFD H;  3MJF A;  2R84 A;  2Q8R E;  2CKZ B;  5HBR B;  3J81 L;  1E4E B;  4JPB W;  4IPD A;  2TMP A;  3SDZ A;  1X55 A;  4M1U B;  4C3J H;  2E75 C;  4IAJ A;  4YHH Q;  2KED A;  4MZ9 A;  2KHI A;  3R5H A;  3VR4 A;  3U58 A;  3U50 C;  3RZD B;  4JV0 A;  2IT1 A;  1RL2 A;  2J6S A;  3K7A B;  1WD0 A;  4DR7 L;  4Z9C B;  2NUA B;  2Y0S B;  1BQQ T;  3RD4 A;  3UDF A;  3JSL A;  5C1O A;  4ED7 A;  4K2K A;  5C4X H;  2AUK A;  3RBE A;  1BCP D;  3PW4 A;  2E2I B;  3OHX C;  4PMW A;  4J9K A;  1N36 H;  3G8C A;  3DWA A;  3I4N G;  4IWY A;  1HXY D;  4LF9 Q;  5COY A;  3X3N A;  5JVG 3;  1MI2 A;  4EFE A;  1KXL A;  5LA6 F;  1HZB A;  4AH6 A;  1SN8 A;  1I4X A;  4AIM A;  1LTS D;  4HIO A;  1OXU A;  3ICE A;  1TS3 A;  3I55 A;  2NVT H;  1U4L A;  2RHQ B;  1DON A;  4GOP A;  3T5K A;  1IBK L;  2DY8 A;  4G57 A;  3VYU A;  2JA5 H;  1K8G A;  2FJ2 A;  2NN6 G;  2PZT A;  3A8J E;  4WJW A;  2ZJQ A;  5F9N A;  1F2M A;  3EFX D;  1C48 A;  3F2U A;  3AU7 A;  2MCT A;  1OXT A;  1P8L A;  1CI3 M; 
#chains in the Genus database with same CATH homology
 4HJ9 A;  1HR0 W;  3M4P A;  4OX9 Q;  1LUZ A;  1JMC A;  2K5H A;  4YHH L;  2QEX A;  5IP9 G;  3KDF B;  1Y1V H;  1I5F A;  1D8L A;  3L0O A;  3CC7 A;  3RN5 A;  3IRB A;  4DR5 Q;  1VQ8 A;  4X6A H;  4DUY Q;  1N34 Q;  4KHP Q;  1Y1V G;  3A74 A;  4A3C H;  4DK6 C;  3K7U C;  3D31 A;  1PHJ A;  4FDB A;  4RMF A;  4BA1 I;  4HJ8 A;  2E5L Q;  4A3L G;  1M90 C;  1X6O A;  1WFQ A;  2K5V A;  2K52 A;  5ELO A;  3CCE A;  3WWV A;  2K50 A;  4JI2 L;  3RR5 A;  4A3B H;  4A3G H;  1RIP A;  1JT8 A;  1WOC A;  3UDX A;  3I2Z A;  1XNQ Q;  2JEA I;  4A3K G;  1Y1W H;  3MXN B;  4IO9 A;  3CC4 A;  4A3B G;  1K8A C;  1GVP A;  4LF9 L;  3DLL A;  1Y1W G;  1AE3 A;  1QUQ A;  2ALY B;  4XTC S;  2HHH Q;  1VQC A;  1KC8 C;  2UU9 Q;  1WI5 A;  1X9N A;  2RF4 A;  4LNQ A;  1VS0 A;  1AE2 A;  3M85 A;  1C7Y A;  2VNU D;  5M5X H;  1VQN A;  1YI2 A;  3I56 A;  2CCZ A;  4R4T A;  4BBS G;  4POF A;  4GNX A;  3CCV A;  2WAQ G;  5FLX c;  3M7N A;  1KRS A;  2ZTC A;  3HOX G;  4R4O A;  3VDY A;  4DR6 Q;  5IYD H;  4GLA C;  4LFA Q;  2ZTE A;  1OXX K;  1GM5 A;  4LFB Q;  1L1O C;  3CME A;  1A63 A;  1V43 A;  1N32 Q;  1QZH A;  2VZA A;  3J7Z C;  2GN5 A;  5IYD G;  3F2B A;  4OX9 L;  3W5O A;  1SR3 A;  4JI0 Q;  2KBN A;  1HJP A;  3G48 A;  3PUZ A;  3CXC A;  1C0A A;  4A3F G;  1VQD A;  4IPG A;  3CCJ A;  5K36 G;  5JJI A;  4DR5 L;  3HOW H;  3STB D;  4QL5 A;  4DUY L;  3GTG H;  2WB1 G;  3S2H H;  5E7N A;  1YJW A;  1CKN A;  4OWT B;  3JAM c;  4C3H H;  1FGU A;  1I94 Q;  1IBL Q;  2E5L L;  2PMZ E;  1SMX A;  4HJA A;  5C3E H;  2UXC Q;  3FKI H;  2Z6K C;  3A5Z B;  1TWG H;  4JBW A;  3EIV A;  1K73 C;  1PH3 A;  5C3E G;  2JA7 H;  4DR3 Q;  1M1K C;  2MQH A;  4OWX B;  2VUM H;  3CAM A;  4GN4 B;  1V1Q A;  4A76 A;  1GD7 A;  1XNQ L;  2JA6 G;  2LSS A;  4P73 A;  3NBH B;  3K8A A;  2AWN A;  1Q8K A;  3HFZ B;  4P71 A;  2VUM G;  3PO3 H;  5IYB H;  4IFD J;  2JQO A;  2AHO B;  2VY3 A;  3T1Y Q;  2B29 A;  3H15 A;  3TRZ A;  2HHH L;  2I5L X;  3J81 c;  2UU9 L;  5C4J H;  5LMN Q;  1TWF H;  4A3D H;  2YTX A;  4GOP B;  1R9T H;  4PZ8 A;  2R7Z G;  2D0P A;  4A3E G;  4BBR H;  4A3D G;  1Q1B A;  3PF5 A;  4JI7 Q;  4JG2 A;  4JYA Q;  1A8V A;  2ZJP A;  1PH6 A;  1PYB A;  2N78 A;  5M3M H;  4IFD G;  2IHF A;  1SE8 A;  4DR2 Q;  3CCM A;  4DR6 L;  4LFA L;  1G6P A;  2VQE L;  2HIX A;  1Q86 C;  1MJE A;  2Z0S A;  2R7D A;  1EIY B;  3U4V A;  3PIP A;  4IPC A;  3STB C;  1QVF A;  1N32 L;  2B63 H;  3M3Y H;  3PSI A;  4JI0 L;  1VQB A;  1YVC A;  3TEH B;  2ZJR A;  2IY5 B;  1SLJ A;  2V1C C;  1NJI C;  4JI4 Q;  4Y7N H;  4AYB G;  3T1H Q;  4Y52 H;  1XNR Q;  3UE0 A;  4L5S A;  1IBL L;  4P72 A;  4X65 Q;  3H3V H;  1YNX A;  4DAM A;  3JAM i;  3L2P A;  2UXC L;  1BVS A;  1SFO H;  1YHQ A;  4QQB X;  3K0X A;  3MEF A;  4DR3 L;  4LF7 Q;  2JA8 H;  5BR8 Q;  4JOI C;  4YCV A;  3F8T A;  4O0A A;  4PG3 A;  2Z6K A;  4JC0 A;  5HY6 A;  1QUQ B;  4C2M H;  4DUZ L;  3PF4 A;  2L15 A;  3T1Y L;  1YIJ A;  1E7Z A;  2OQK A;  4H02 A;  1YJN A;  3PO2 G;  1HNX Q;  1UE6 A;  1XMO Q;  3NEN A;  4O2D A;  5AJ3 Q;  4LUV A;  5LMN L;  1O7I A;  3J81 i;  2Y0S E;  4L5Q A;  4AYB E;  3CMA A;  1J5E Q;  2BA0 A;  1JJ2 A;  1FVI A;  3HOZ H;  2I0Q A;  4QJF A;  4B3M Q;  4POG A;  2NN6 I;  5GRO A;  1NY4 A;  4JI7 L;  3S2D H;  5IWA Q;  1NMG A;  4NPS A;  4R1J A;  3J80 c;  1PH4 A;  2JA5 G;  3HOZ G;  4DR2 L;  1SRU A;  3KF6 B;  2KEN A;  1YBY A;  2GVA A;  1X65 A;  1Q12 A;  2OCE A;  5JEA J;  1PH7 A;  5LMU Q;  2KHJ A;  4LF6 Q;  2LXJ A;  1XPR A;  3HOV H;  3DM3 A;  4KHZ A;  1QVG A;  2K75 A;  1NMF A;  4DV4 Q;  1XMQ Q;  4JI4 L;  1CKO A;  1CKN B;  4GLX A;  3T1H L;  3KYH C;  1XNR L;  1EWI A;  5FJ8 H;  4A3C G;  2IHE A;  4X65 L;  1VQL A;  1OXT A;  3AYH B;  4DV5 Q;  2OWO A;  3FHW A;  4LUZ A;  5FLM H;  5JEA G;  3S16 H;  4LF7 L;  1QVC A;  4YY3 L;  5BR8 L;  5C44 H;  5GAD C;  1HZC A;  1NBW A;  1TWH H;  1FJG Q;  1HH2 P;  4X64 Q;  3F2C A;  4A3G G;  3PUX A;  2OTJ A;  2H5X A;  4GN5 A;  2KCT A;  4JCV E;  3PIO A;  3BU2 A;  4DV0 Q;  5C44 G;  2K5N A;  1WYD A;  1IZ6 A;  1Q46 A;  1L0W A;  1BBU A;  4HIM A;  1Q82 C;  3CCL A;  4JOI A;  2PQA B;  2CWP A;  1HNX L;  5IYC H;  4DV1 L;  1XMO L;  2A19 A;  4EX5 A;  2WFW A;  1PH1 A;  1ASZ A;  4JI6 Q;  2I5H A;  1X3G A;  4A3M H;  1MJC A;  1J5E L;  2XGT A;  2OTL A;  1VQF A;  3OW2 A;  2R93 H;  1U0L A;  3AEV A;  4B3M L;  1I6H H;  4PZ7 A;  4JI5 L;  3PUY A;  1HR0 Q;  1JE5 A;  1WJJ A;  2MNA A;  2YTV A;  4A75 A;  4A3M G;  3J7A 5;  4K0K Q;  3Q8D A;  3TQY A;  2R6G A;  3CCU A;  1OXV A;  2YV5 A;  3B6Y A;  3J80 i;  3RNU A;  1IBM Q;  3KF6 A;  4JBJ A;  3UE1 A;  3BJU A;  2F4V Q;  2PI2 A;  4YWM A;  1KL9 A;  3M4Q A;  4JI3 Q;  3KOJ A;  3CF5 A;  2YYZ A;  4IJL A;  1EOV A;  1L1O B;  4BY1 H;  4LF6 L;  5JJK A;  4OON A;  2NVY H;  3NEM A;  3TRE A;  4A3J H;  3PUV A;  3RLO A;  1N34 L;  2NVQ H;  4C3I H;  4KHP L;  2A1A A;  4DV4 L;  4NXN Q;  1H95 A;  3HOW G;  1E1O A;  3PCO B;  5EAY A;  1X56 A;  5LMN W;  2ASB A;  3I4M H;  4X62 Q;  2Q2I A;  3S15 H;  2B3G A;  1Q7Y C;  4DV5 L;  2PNH A;  2WAQ E;  2MO0 A;  4DV3 Q;  3I4M G;  1LTL A;  5DLQ E;  3FKI G;  1U5K A;  4DKA C;  2JA9 A;  2JA7 G;  3HKS A;  4J15 A;  1FJG L;  1Q1E A;  4LFC Q;  1HNZ Q;  3S14 H;  4X64 L;  4DV0 L;  1KD1 C;  1N8R C;  1HZA A;  4BXX H;  4DK3 C;  3GTJ H;  3PO3 G;  3I4O A;  5IYB G;  3S1Q H;  3GTO H;  5IY0 A;  1OTC A;  2PQA A;  1VQA A;  1GKH A;  5HGQ A;  4JI6 L;  3RZO H;  1E22 A;  1V9P A;  2BH8 A;  1IYJ B;  2WB1 E;  3S24 A;  3KFU A;  2NZO A;  4B3T Q;  1N9W A;  4GKJ Q;  1UE5 A;  3BZK A;  1VQM A;  4GLV B;  1HR0 L;  4IFD I;  2VL6 A;  3KF8 B;  3OYY A;  4BBR G;  4AQY Q;  3TS2 A;  2ZTD A;  1CSQ A;  3CP0 A;  5C0X J;  4K0K L;  3ULJ A;  2K14 A;  2NZH A;  4LFB L;  1SRO A;  5M3M G;  4LW1 A;  4YWL A;  1D7Q A;  1IBM L;  4X66 Q;  1VQ7 A;  4BY7 H;  5JJL A;  3FP9 A;  2RCN A;  1NE3 A;  2CQO A;  5H1S E;  1L1O A;  2B63 G;  4BY7 G;  2Q2U A;  4R4C A;  1PFS A;  3EN2 A;  1HZ9 A;  4JI8 Q;  3S17 H;  2JEB I;  1YZ6 A;  3BZC A;  4NXN L;  4APV A;  1I94 L;  4PZ6 A;  5C0X G;  1JB7 A;  1K83 H;  4X62 L;  2YU9 H;  3PGZ A;  2CWA A;  3M4O H;  3HKZ G;  1VQK A;  3CW2 C;  2ZM6 Q;  1TXY A;  4DV3 L;  1VQ9 A;  2ES2 A;  3K81 C;  2F52 A;  4RG1 A;  1YEZ A;  2XTI A;  3CCR A;  1A0I A;  1Z9F A;  4OXP A;  2JA8 G;  1HNZ L;  3ERS X;  1B70 B;  4MTN A;  2FXQ A;  3GTK H;  3A0J A;  2UXD Q;  1HNW Q;  4YWK A;  2CFM A;  4DV2 Q;  1I50 H;  2MO1 A;  3I7F A;  1XJV A;  1PH8 A;  2UUB Q;  2E2I H;  1WCM H;  3AFQ A;  3CQZ H;  4QIW E;  3RLN A;  1PH5 A;  1VQE A;  3GO5 A;  4A4I A;  1PV4 A;  2UXB Q;  4ME3 A;  4R4Q A;  2A8V A;  1LM0 A;  4B3T L;  1X54 A;  4GKJ L;  4JYA L;  4JI2 Q;  1KAW A;  3I4N H;  3UDG A;  3GD7 A;  4AQY L;  3HKZ E;  4QGU A;  1E1T A;  1I3Q H;  1Z47 A;  4OO1 G;  4X66 L;  4QY7 A;  4JI1 Q;  1PA6 A;  1FL0 A;  4IOA A;  1VQG A;  4GNX C;  3ULP A;  3RN2 A;  3W1G A;  2R92 H;  3GDE A;  2R7F A;  4R4I A;  4JI8 L;  4HIK A;  1A62 A;  2F3I A;  3CCQ A;  4HID A;  4A3I H;  4L5R C;  3HOV G;  4GKK Q;  1MIU A;  3ZJY C;  5M3F H;  1S72 A;  3CC2 A;  3E9H A;  5GQO A;  2N3S A;  2DUD A;  2NVX H;  5IP7 H;  3CPF A;  2N8N A;  2E2J H;  5J3B A;  3ULL A;  5FJ8 G;  1N36 Q;  2ZM6 L;  5IP9 H;  4IJH A;  5IP7 G;  2PI2 E;  2ID0 A;  3E9I A;  4LF8 Q;  1X3F A;  4IPH A;  1VCI A;  2JJQ A;  4DPG A;  5FLM G;  4LF4 Q;  2YTY A;  1AH9 A;  2N49 A;  3OTO Q;  4TQU S;  3D0F A;  1EYG A;  3S1M H;  2UXD L;  1HNW L;  2HQL A;  4A3L H;  1Q81 C;  4DV2 L;  1BBW A;  1GO3 E;  1CSP A;  1K0R A;  4TVA B;  5AJ3 L;  2UUB L;  5GAH C;  1B8A A;  1NTG A;  2BA1 A;  3EBE A;  2LXK A;  5IYC G;  3KJO A;  2VS1 A;  2QA4 A;  2UXB L;  3G6E A;  1KHI A;  3SGI A;  4GS3 A;  4A3K H;  4DAY B;  5IWA L;  2R93 G;  4UY8 C;  3CCS A;  1K9M C;  1W3S A;  4MNO A;  2IX0 A;  1IXR A;  1T9H A;  4L5T A;  4OWW B;  1YIT A;  1CUK A;  4YCW A;  5LMU L;  4JI1 L;  2JE6 I;  4JV5 Q;  3S1N H;  1VQ4 A;  1UEB A;  2VW9 A;  1YHA A;  4BA2 I;  1EFW A;  4BY1 G;  1XMQ L;  4GKK L;  5IE8 A;  3ER0 A;  4A3J G;  3JC6 6;  1PVO A;  3G71 A;  1XPU A;  2AMC B;  3HOX H;  4ALP A;  1EQR A;  1J6Q A;  1X3E A;  1XTD A;  2K4K A;  1KQS A;  1EQQ A;  2EXD A;  2BH2 A;  2D62 A;  4WJ3 M;  3KLW A;  2OQ0 A;  3L7Z C;  1S3O A;  2VQE Q;  1N36 L;  5IT9 c;  4DV7 Q;  4A3F H;  3E0E A;  4LF8 L;  4UPA A;  4DV6 Q;  4LWC A;  3S1R H;  1TWC H;  2KCM A;  1EUJ A;  4LF4 L;  4A93 H;  3KDF A;  1CKM A;  3GTQ H;  2EQS A;  3OTO L;  4DR7 Q;  4A93 G;  4KLK A;  4LF5 Q;  4BXX G;  1VQI A;  4NB3 A;  2EIF A;  2UUA Q;  4UP8 A;  1Y14 B;  1YJ9 A;  4IOC A;  3F1Z A;  2QGQ A;  3NEL A;  3AQQ A;  2E8G A;  3PUW A;  2JA6 H;  3LGJ A;  3KJP A;  3HOY H;  1XPO A;  1C9O A;  4YCU A;  4NXM Q;  4DUZ Q;  4HJ5 A;  4B3S Q;  1UE7 A;  3HOY G;  4UP7 A;  1BKB A;  1VQJ A;  2RHS B;  2F4V L;  4GOP C;  4JI3 L;  2E2H H;  1OXS C;  1W2B A;  2D0O A;  4JV5 L;  2R7Z H;  1N33 Q;  3HOU H;  4A3E H;  3CPW A;  3AFP A;  4DR1 Q;  1IBK Q;  2WP8 J;  2Q2T A;  2UUC Q;  3HOU G;  5C0X I;  2JK8 A;  2AKW B;  3H0G H;  4P74 A;  3J81 j;  4HJ7 A;  3K80 C;  3RLF A;  2IX1 A;  2CKZ B;  3H3V I;  1E24 A;  4B3R Q;  3H0G G;  1UWV A;  1K3R A;  2VQF Q;  5GAG C;  4IPD A;  4DR4 Q;  4P75 A;  1L2F A;  3RZD H;  1X55 A;  4C3J H;  3PV0 A;  3U4Z A;  1IL2 A;  3K7A H;  1VQP A;  4YHH Q;  1B7Y B;  4DV7 L;  1VQH A;  1G29 1;  4LUO A;  4DV6 L;  4MZ9 A;  4LFC L;  3GTM H;  2KHI A;  3U58 A;  1E3P A;  3U50 C;  3GTL H;  1JJG A;  1UE1 A;  2Y0S G;  2IT1 A;  1RL2 A;  4JBK A;  1P16 A;  1VQ6 A;  4DR7 L;  2ATW A;  4LF5 L;  5GAE C;  2DGY A;  3UDF A;  2UUA L;  2C35 B;  1VQO A;  1MKH A;  1WCM G;  5C4X H;  3M9B A;  1DGS A;  1VQ5 A;  1JJC B;  3TS0 A;  3W1B A;  1S40 A;  1PH2 A;  4PMW A;  5C4X G;  4GN3 B;  1YHB A;  1PYS B;  2MFI A;  4YY3 Q;  4JBM A;  3I4N G;  4OO1 I;  4NXM L;  2AWO A;  4LF9 Q;  1QZG A;  3PO2 H;  3G4S A;  4B3S L;  1KRT A;  4WJ4 A;  1KXL A;  1LYL A;  1HZB A;  1TWA H;  1SN8 A;  4AH6 A;  3F2D A;  1ASY A;  2Q2H A;  3UDI A;  4AIM A;  4EQ5 A;  1OXU A;  4KI0 A;  4DV1 Q;  4HIO A;  3ICE A;  5ELN A;  1N33 L;  3I55 A;  2NVT H;  1EIF A;  4DNI A;  1PH9 A;  2RHQ B;  4GOP A;  4UP9 A;  4DR1 L;  2HIV A;  2HT1 A;  4GNX B;  1IBK L;  4XIG S;  2UUC L;  2R92 G;  3CD6 A;  3GTP H;  2JA5 H;  4JI5 Q;  1K8G A;  4BBS H;  4A3I G;  2NN6 G;  1G51 A;  5M5Y H;  2ZJQ A;  4B3R L;  5M5W H;  5M3F G;  1KIX A;  2VQF L;  2I5M X;  1P8L A;  2GVB A;  3A5U A;  4DR4 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...