3HOXG

Complete rna polymerase ii elongation complex v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoxG01
4GLXA 2K14A 2K5VA 1PVOA 3CD6A 4EQ5A 2MFIA 4RG1A 3HOUH 4K0KL 5C0XJ 4GS3A 3M7NA 1AH9A 1K0RA 1N36L 1XNQQ 1G51A 3AFQA 2BA0A 3BZCA 3D31A 3IRBA 1XMOL 4JV5L 1PH2A 2K50A 2R7ZH 3CCLA 2CQOA 4YWLA 3DLLA 1KHIA 3MEFA 4DKAC 1IBKL 1LM0A 4NB3A 1OXTA 2AWNA 1NJIC 1J6QA 4IO9A 5C44G 3M4QA 4A93H 3L0OA 3HOXH 1XPOA 1VQDA 1CKMA 1YNXA 1N8RC 4IPDA 2N78A 4LF9Q 4X66L 4A3LH 2UXBQ 5GADC 1VQBA 2VY3A 1HR0L 1KL9A 3E9HA 2JE6I 1VQHA 1QUQB 2ZTCA 1I3QH 4GN5A 4YHHL 1K9MC 1NMGA 3BU2A 1Y1VG 3CCEA 2QEXA 3KF8B 1XJVA 2YYZA 1PHJA 1KIXA 2ZM6Q 3ULLA 1HR0W 1QVFA 4JI1Q 3HOUG 3F2CA 2IT1A 4IPCA 2OQ0A 3LGJA 3CCUA 4BY1H 3F2DA 4R1JA 3GDEA 3J80c 2DUDA 1I94L 3GTPH 2UXDL 4X65Q 4DR4L 3J7ZC 2K4KA 1AE3A 1EOVA 3PF4A 2ZJRA 3T1HQ 4AYBG 4LF4L 4DV0L 4OX9L 4A93G 2CWAA 1HZCA 3HOXG 2R7DA 3CCRA 3HKZE 5ELOA 1SLJA 4DR3L 1E7ZA 3H15A 1KD1C 3K80C 5C3EH 1B70B 4A3LG 1MKHA 4DUZQ 3D0FA 4DV1L 2BH8A 2WFWA 3W1BA 2MO0A 3CCJA 3EIVA 4DK6C 4ME3A 4OWWB 1V9PA 4XTCS 4R4TA 3ULJA 3OW2A 4P74A 3GTJH 3GTOH 2PI2E 3KLWA 5FLMH 1LTLA 2VQEQ 1YIJA 4L5TA 2F3IA 1H95A 2PMZE 4BY1G 1GVPA 1QZHA 1XNQL 1Z9FA 4QQBX 2QA4A 3F8TA 2JQOA 1MJCA 5GQOA 4JOIA 1A0IA 1IXRA 4OXPA 5IT9c 2I5MX 2XTIA 5C4XH 5IYBH 1PH5A 1X3FA 1YEZA 4B3SQ 4X6AH 2I5LX 2NN6G 2NN6I 4P72A 4HJ5A 1VQ9A 2IHFA 2D0PA 4IPHA 5IE8A 4GLVB 3STBC 2VZAA 1Q1BA 3HFZB 5C3EG 4DV5Q 1S72A 2AHOB 4LF9L 4IOAA 4KI0A 2UXBL 3ZJYC 3A0JA 1K8AC 2BA1A 3FHWA 4DPGA 3RN5A 1UE6A 1Q86C 3Q8DA 1Q8KA 4KLKA 4C3JH 5JEAG 3S1MH 2Q2HA 4P73A 4R4QA 3PUYA 4P75A 5E7NA 4DV4L 2HHHQ 4NXML 3S15H 1PYBA 3HKZG 4C2MH 5GAGC 1RIPA 1FVIA 2LXKA 2MO1A 2NVYH 5FLMG 3PGZA 3CMAA 1C7YA 4L5QA 1VQMA 4JI4Q 5JJIA 1HJPA 4JI1L 1RL2A 5J3BA 2GVAA 2R6GA 1K73C 2FXQA 2QGQA 2V1CC 2F52A 2PQAB 4J15A 4H02A 4JCVE 4GOPB 4KHPQ 3K8AA 1YHBA 4NPSA 4X65L 2RF4A 3CCSA 3CF5A 5C4XG 1AE2A 2Z6KC 4BBRH 3EN2A 1U5KA 2UXDQ 1XNRQ 3M4PA 2VUMH 1VS0A 3STBD 1BVSA 4GLAC 4LF4Q 3JC66 1Q82C 1N9WA 3BZKA 5IYCH 1G6PA 4A75A 1D8LA 5ELNA 5JJKA 4DUZL 4DR3Q 1X56A 3ULPA 3PSIA 1I5FA 2UU9Q 1V43A 3RR5A 4DNIA 2ASBA 1C0AA 1SE8A 4PMWA 1CKOA 2RHQB 4OONA 5BR8Q 3MXNB 1L1OC 4B3TQ 2VL6A 5C0XG 1TWHH 4IJLA 5C0XI 4A3EG 5FJ8H 3M9BA 1Q1EA 1C9OA 2VQEL 4YY3Q 1XPRA 2ES2A 4POFA 1WCMG 2YTXA 4X62Q 1EYGA 1D7QA 1JT8A 1X54A 1O7IA 1UWVA 5IYDG 1P16A 1TWAH 4DAYB 1PH3A 2HT1A 2I5HA 5DLQE 3A5UA 2Q2TA 4YWMA 1HNXQ 3I2ZA 4IFDJ 4LUOA 2YU9H 3KFUA 4R4IA 2OQKA 4BBRG 4UPAA 4B3SL 2B3GA 3TRZA 3NENA 1TWGH 3JAMc 3NEMA 1G291 2VUMG 1A63A 4BY7H 4HIDA 5IYCG 4A3FG 1HZ9A 4JYAQ 2JA7H 4DK3C 4DV5L 2IX1A 2CFMA 2IHEA 4JI2Q 5M5YH 1WYDA 3RZOH 2Y0SG 5EAYA 1Q12A 3H0GH 1HNWQ 4LWCA 3PF5A 3ICEA 4WJ4A 1K8GA 1M90C 4JC0A 1PH9A 4HJAA 3PO2H 1TXYA 2HHHL 1P8LA 3PO3H 2AMCB 2PI2A 4DV4Q 1PH4A 2PQAA 5FJ8G 3FKIH 4NXMQ 2RCNA 2ZTEA 3K81C 4GOPA 4JI4L 5M3MH 2IY5B 5K36G 4DR1Q 2K5NA 3PUWA 2E2JH 3GTMH 1PFSA 4PZ6A 2Q2UA 3HOYH 1I50H 1PYSB 3AFPA 3PUZA 1X9NA 1EQQA 1FJGQ 1ASYA 3KJPA 1VCIA 4KHPL 1S40A 4BA2I 1PH7A 2Z0SA 3AEVA 3CC7A 4O0AA 3OYYA 3BJUA 1VQCA 4DR6Q 2A8VA 1XNRL 4P71A 3UDXA 2YTVA 4BBSH 4BY7G 2VW9A 1ASZA 2JA7G 4A3IH 5LMNQ 1E22A 3I55A 1L2FA 4B3MQ 3M4OH 4A3BG 1SROA 4QL5A 3H0GG 4APVA 3G4SA 2UU9L 2ZJQA 1BBUA 1UE7A 3GTLH 1IL2A 1A8VA 3J80i 4JBWA 2LXJA 3PO3G 1IYJB 3PO2G 5BR8L 4HIOA 4A3DG 3PIOA 4B3TL 2Q2IA 3M85A 3FKIG 4AQYQ 1YZ6A 2YV5A 2CWPA 3RLNA 2UUCQ 3I4MH 4YY3L 4OWXB 3WWVA 2R7FA 5M3MG 4X62L 2C35B 3RNUA 4B3RQ 1N32Q 3M3YH 2GVBA 3TS0A 1SMXA 4X64L 4XIGS 3HOYG 4A3CH 4LUVA 4DR2Q 1HNXL 4DV3Q 3GO5A 2HQLA 3KF6A 1YI2A 1VQ6A 3GTKH 1S3OA 3KDFB 4JI6Q 1UE5A 1WFQA 3S24A 1E1OA 4KHZA 4BBSG 1SFOH 5GROA 1TWFH 2K52A 3ERSX 2ZTDA 3HOZH 4LF5Q 4RMFA 1OXSC 5FLXc 4JYAL 2HIVA 5IWAQ 4A3IG 1Y1WH 4OWTB 4JI2L 1QVGA 3KOJA 1W3SA 2D0OA 2A1AA 3G6EA 4GN3B 2I0QA 1HNWL 1EQRA 4LNQA 3K7AH 4GNXA 1MJEA 4PZ7A 5HGQA 4EX5A 3J81c 5C4JH 4DR7Q 1NMFA 1PA6A 3PV0A 3I4MG 1WJJA 2E2HH 4UY8C 2UUAQ 1FGUA 1YHQA 4A3EH 1J5EL 4GKJQ 1R9TH 4A4IA 1SR3A 4DR1L 5IP9G 1X55A 1XTDA 4A3CG 1WCMH 1Q46A 3AQQA 4UP7A 3UDFA 4TQUS 1L0WA 1B8AA 3SGIA 4DR5Q 1SRUA 4BA1I 1HZAA 2KHIA 4DV7Q 5IYDH 2NVTH 1FJGL 4MTNA 2H5XA 1E3PA 4LFAQ 2BH2A 4PG3A 1GO3E 4YWKA 1NTGA 3G71A 1LYLA 3GTQH 2R92H 4DR6L 4POGA 1JJCB 2KHJA 3S2HH 1K83H 1CSPA 3PCOB 1XMQQ 3HOZG 2XGTA 3AYHB 3CW2C 1HH2P 1HZBA 4HJ7A 1Y1WG 2MQHA 1UEBA 1KC8C 4L5RC 4A3FH 5LMNL 1IZ6A 1KQSA 4B3ML 3U50C 4JI0Q 3CCVA 2OWOA 5M5WH 3CC2A 1IBLQ 3CCMA 3UE1A 1GD7A 4QY7A 2OCEA 4AQYL 2UUCL 2E8GA 3E9IA 1TWCH 2ALYB 3CPFA 5LMNW 3U4VA 4HIMA 3NBHB 3HOWG 4IFDI 1VQ7A 3TQYA 3KDFA 5H1SE 1M1KC 4A3GH 4B3RL 1OXVA 1N32L 1CKNB 4LW1A 4A3KG 4JOIC 1UE1A 1VQ8A 4DR2L 2JA8H 1EFWA 3TREA 4DV3L 4LFBQ 4X64Q 3G48A 4GKKQ 2R93H 2JEAI 4JI6L 4JI3Q 3CMEA 4TVAB 2R92G 2JJQA 4A76A 4Y52H 1GKHA 4MNOA 1KRTA 1PH8A 4LF5L 3KYHC 4UP8A 3DM3A 2NZHA 5IWAL 3K7UC 2VQFQ 4LFCQ 3KF6B 4JBJA 1XPUA 2JA5G 3U58A 4MZ9A 4R4OA 1JB7A 4BXXG 1N33Q 1VQLA 1VQ5A 5M3FH 2VS1A 3W1GA 3TS2A 2CKZB 4A3BH 2UXCQ 3CPWA 3HOVG 4DR7L 2AKWB 1YJNA 4A3DH 1PH1A 4AYBE 1KAWA 3JAMi 2UUAL 4GKJL 1KRSA 1NY4A 2B63H 4A3GG 1JJ2A 4IJHA 3H3VH 4DR5L 4C3IH 5JJLA 2JA8G 3PUXA 5LMUQ 4GNXB 4FDBA 4DV7L 1VQOA 1L1OB 4JI7Q 2KENA 3RLOA 1YJWA 4A3MH 2R93G 3L7ZC 4LFAL 4C3HH 2EQSA 4HJ8A 1Y14B 2HIXA 2JEBI 5AJ3Q 3S16H 3HKSA 2A19A 2YTYA 1VQ4A 1XMQL 1I6HH 1E1TA 4R4CA 2KCTA 5HY6A 2K75A 2DGYA 1X6OA 1E24A 2RHSB 2EXDA 1IBMQ 1CSQA 3GTGH 4JI0L 5M3FG 3I4NH 3TEHB 2ID0A 1CKNA 1DGSA 4IPGA 1WI5A 1IBLL 2E5LQ 3I56A 1YJ9A 1EIYB 2UUBQ 4DV6Q 3W5OA 3CXCA 2OTJA 3NELA 2JK8A 4LF7Q 1N34Q 3S1NH 2B63G 1HNZQ 1K3RA 2KCMA 1VQNA 4L5SA 4A3JH 2F4VL 2R7ZG 3RLFA 3H3VI 3L2PA 5IP9H 1J5EQ 4JI8Q 3ER0A 4LFBL 2WB1E 3F1ZA 4UP9A 1GM5A 2K5HA 3RN2A 4A3MG 3I4OA 5GAEC 4QIWE 4AIMA 4LF6Q 3VDYA 3T1YQ 3S2DH 4JI3L 1YITA 3B6YA 3OTOQ 4JI5Q 3K0XA 3PUVA 4DV2Q 2Z6KA 4JG2A 2IX0A 2LSSA 4AH6A 1T9HA 4DUYQ 1PV4A 3CCQA 3I7FA 2NZOA 4HIKA 2VQFL 4PZ8A 4LFCL 3CC4A 3CAMA 4NXNQ 4LF8Q 1N33L 3FP9A 3I4NG 4LUZA 2UXCL 2PNHA 1MIUA 1OXXK 4GN4B 4GOPC 4IFDG 1EUJA 3S1QH 1U0LA 2MNAA 1B7YB 2CCZA 3U4ZA 1VQEA 1KXLA 1YBYA 2WP8J 1L1OA 1BKBA 4K0KQ 4JBKA 4A3JG 1N36Q 1XMOQ 1FL0A 4JV5Q 2B29A 1VQIA 4O2DA 3HOWH 2EIFA 5LMUL 1EWIA 2ZJPA 2WAQE 1Q81C 2L15A 1YVCA 4A3KH 1IBKQ 4JI7L 2NVXH 1QVCA 3S1RH 1A62A 1X3GA 1QUQA 2ATWA 3J81i 1VQFA 5AJ3L 5M5XH 5IP7H 3PIPA 2N49A 2AWOA 1OXUA 2WB1G 3CQZH 3UE0A 4X66Q 3F2BA 3CP0A 1Q7YC 1NE3A 1OTCA 2E2IH 2NVQH 1X65A 2N3SA 4QJFA 1HR0Q 1VQAA 1IBML 2VNUD 1VQJA 4YCVA 4IOCA 4WJ3M 4YHHQ 1JMCA 2JA5H 4BXXH 2KBNA 4ALPA 2E5LL 3S17H 2JA6H 2UUBL 1JE5A 2ZM6L 4DV6L 5JEAJ 3UDGA 3E0EA 1QZGA 3HOVH 4LF7L 1N34L 1SN8A 1HNZL 3EBEA 4GKKL 3S14H 3A74A 4YCWA 1JJGA 2GN5A 2D62A 2JA9A 3GD7A 3KJOA 1VQKA 4YCUA 2F4VQ 2OTLA 3RZDH 1WOCA 1V1QA 4DAMA 3A5ZB 4JI8L 5IY0A 1BBWA 5IYBG 1Z47A 5GAHC 4QGUA 4Y7NH 2Y0SE 1PH6A 1I94Q 4DR4Q 3T1HL 4LF6L 1EIFA 3T1YL 3J81j 4JI5L 3OTOL 4DV0Q 4OX9Q 5C44H 4DV2L 1NBWA 1CUKA 5IP7G 1W2BA 1LUZA 2WAQG 4DUYL 1X3EA 4DV1Q 3J7A5 4JBMA 1VQPA 4GNXC 4NXNL 1YHAA 3UDIA 4HJ9A 4LF8L 1VQGA 4OO1G 4OO1I 2N8NA 2JA6G 1Y1VH
chains in the Genus database with same CATH superfamily
4GLXA 3N41B 2F0KA 2EY6A 4RG1A 3HOUH 5C0XJ 3M7NA 1K0RA 1N36L 3T56B 3GILA 4DR2H 4JV5L 2X6GA 1FD7D 3IRBA 3TIGA 2F3WA 3TN2A 1V1PB 4FF3A 2R7ZH 4YWLA 2QDLA 1KHIA 4HR7A 4DKAC 1I6UA 1OXTA 3OSOA 3KLRA 4HSPA 1L0XB 2AWNA 1J6QA 4IO9A 3RIZA 3M4QA 4O1NA 1YNXA 5EZYF 2A5HA 1D5XC 1TA8A 4LF9Q 3H40A 4A3LH 4YQWA 5KG7A 1RCVD 4RGNA 2DLNA 1KL9A 3GLKA 2EJFC 4GN5A 4YHHL 2R82A 4MV8A 4DN4M 1ICFB 4RU9A 1QILA 4MA0A 4PWQA 3LNNA 1IW7D 1ESFA 1YNJC 2NVXA 5HV6A 2DPJA 2B2YC 1XJVA 1PHJA 1PX2A 4MAMA 2YS7A 3MJFA 1QVFA 4JI1Q 1RJQA 3K0YA 2K03A 3LGJA 4DV7H 3QZ7A 3F2DA 3R5FA 2NU9B 2K28A 5KFUA 1K83A 2DUDA 1I94L 1HUMA 4HMIA 5I6WA 4DR4L 5BN4A 4RGOS 1EOVA 1PFMA 4S3SA 2ZJRA 3N52A 1XMQH 4DV0L 2JA5A 2CWAA 3P20A 3HOXG 2NN6H 2R7DA 3P1HA 4DR3L 1E7ZA 3K80C 5C3EH 2BH8A 2RBMA 3W1BA 3CCJA 4ZK9B 4YIJA 4ME3A 3PMFA 1V9PA 4XTCS 3TMEA 5JPNC 3M9NB 3OW2A 3GTJH 3F2UA 1YIJA 2JYOA 3S1NB 5EPJA 4BY1G 1GVPA 4LH7A 1XNQL 4LFBH 2R87A 3LWUA 1WTXA 2R85A 1WTVA 1M4VA 1PK8A 5IT9c 2EYOA 2XTIA 1PH5A 4X6AH 5J2TF 4DL5A 4FS1A 4UCOA 3STBC 2VZAA 4DNRB 1VKZA 5EKLA 2AHOB 5E1FA 1N33H 3A0JA 2BA1A 3KF8A 1SYCA 5KFXA 1Q86C 1DM0B 5JEAG 5FD6A 2IBKA 3PQIA 5BN3A 4UHVA 2HHHQ 5GAGC 3HZXA 2MO1A 2NVYH 4Q44A 2TSSA 1I4RA 2L4NA 2F0VA 2EXZA 3H09A 4ED0A 3WDNA 2FXQA 2WIIB 2PQAB 3D4DA 4GZYC 2F0MA 4KHPQ 3K8AA 4M9UA 2RF4A 1SXTA 2Z6KC 2QYZA 4BBRH 2XVSA 3GTGA 5DQGA 3STBD 4F4XA 1NCVA 3K5IA 1N9WA 3BZKA 2HDMA 5J2UF 1EWHA 1FKAH 1B1ZA 4C3JB 1X56A 1EQVA 1I5FA 1V43A 2N55A 3RB0A 4CC6A 3T5KA 2ICEC 3MXNB 3BG5A 2SEBD 2VL6A 1X32A 5C0XG 5JVH3 3M9BA 1CT1D 1CI3M 2L12A 4POFA 1D7QA 5L9XA 5DGBA 1JT8A 5LXTF 1O7IA 1UWVA 4HNTA 1P16A 4DAYB 2Q2TA 1QNUA 4NKLA 4YWMA 1HNXQ 4RUAA 4IALA 2NTSA 3T1HH 1GSOA 4LF6H 5I2YA 3NK9A 1IYVA 4JI5H 1IHZA 4DV2H 5KFIA 1EZ8A 2B3GA 3I91A 3JAMc 1ZYRD 3NEMA 4BY7H 4HIDA 2LMCB 5IYCG 3K5LA 4A3FG 1K0SA 5JPMC 4JYAQ 5F9NA 2RDJA 4DV5L 2R7NA 2Y0SB 4Z9CB 3RZOH 5M5YH 1H9RA 2X0SA 1WYDA 2KCCA 4HQ6A 4LF8H 4LK1C 5EAYA 3H0GH 1HNWQ 1DXMA 1X3PA 3IG0A 1M90C 1G2SA 2JXMB 3PO3H 4ECZA 3AMUA 1FNVA 1P8LA 2AMCB 1PRTD 4Q43A 1N36H 4JV5H 4YR3A 5K36G 4IRDA 1J8IA 4FXGC 4MN3A 1X9NA 3RV4A 3RV3A 2O5JC 3GIKA 5EBDA 4BA2I 1D1KA 3EPGA 3KAJA 3CC7A 4O0AA 2G9DA 5KFQA 4DR6Q 4JV0A 3Q23A 3UDXA 2K32A 4BBSH 4CJ0B 1KAAA 1SYEA 2JA7G 4HCSA 2GA4B 4ULLA 2XCPA 4A3IH 3NBHA 4ECVA 2GPSA 4YHHH 1SROA 4APVA 3JSLA 4CKCA 2UU9L 1S68A 1BBUA 2AQ2B 3C0FB 5CV5A 1IL2A 1C3OA 2LXJA 3PO2G 3E5SA 3MTSA 3PIOA 4B3TL 3Q8SB 2Q2IA 2BCOA 4ZKBB 2CWPA 4YY3L 4Q0FA 3CRLC 5KFYA 4QWBA 4U7CA 3RD4A 1VMPA 2R8GA 2XNAC 3TP6A 4X64L 1CHPD 3HOYG 1I94H 4BWSC 2NU7B 2MGSA 4DV3Q 1W6KA 4DR4H 5CV6A 3X3MA 3GTPB 4EYIB 5GONF 4K2LA 3GTKH 4FXDA 3L9AX 3H4BA 4RZQA 4DV0H 4EBCA 3MZ5A 4ZUJA 3S24A 1PZJD 4DR3H 5KG2A 4RMFA 2QCPX 4I4TF 3PVXA 3T16A 4HMJA 3M4OB 3QFFA 1EL0A 4OGQC 2R8JA 5IT9W 1TY0A 4JI2L 3BZDB 2A1AA 4ECYA 5IT9E 4LNQA 4GNXA 1MJEA 1PTOB 4EX5A 4DR7Q 2NUAB 3HKZB 4RFBA 1PA6A 3I4MG 1OWTA 1XNQH 1R9TH 1EYZA 1TY2A 1SR3A 4C1NK 3DM1A 5IP9G 1HA6A 5KYIA 4QQBX 3E0JA 1F2YA 1H9MA 4UP7A 1B8AA 1S5ED 1C4QA 2JA7A 2NVTH 1GLVA 5H80A 2H5XA 4LFAQ 2FMCA 3VMMA 1A2TA 4YWKA 2A69C 5G3LF 5C4XB 1T36A 4DU9A 4POGA 3BVGA 3PCOB 5BN5A 5BMVF 1F9PA 5KYLA 4ZQ3A 4HJ7A 1Y1WG 1UEBA 4A3FH 2GPWA 4V190 1IZ6A 4RNOA 3OIQA 1BCPC 2NU8B 4WRDA 4GC7A 3GTMA 3S1MB 4J9NA 4YBZB 1I50A 1SE2A 3BYTB 3CCMA 3UE1A 4RKLA 4ZQIA 2OCEA 1BF4A 4LH6A 2FE3A 2K01A 4NMZA 2ALYB 4IFDI 1WCMB 4G57A 4FU0A 5H1SE 1M1KC 4B3RL 3BDCA 1OXVA 1VBGA 3RAXA 4A3KG 2ICIA 1UE1A 4J9SA 2OH2A 4QUCA 4XYLB 5CV8A 2F0FA 2R93H 2CVRA 2KSWA 3SK4A 2PYKA 2PBZA 4RB0A 3GTLA 1T5XD 3BA9A 5FPRA 4L8JA 4IURA 4Y52H 1B53A 2VUMB 1SNDA 1PH8A 4DL6A 3BQ2A 4LF5L 1B2TA 2PN1A 1E2WA 2I46A 4UP8A 3WO0A 4JBJA 1S0MA 3GTOA 3U58A 1JB7A 2DPIA 5DQIA 3N43B 2C5CA 1UUPA 2RDGA 4J1MA 3JAMW 3K5MA 2UXCQ 3MXUA 1YNNC 5KNDA 4K8JA 3TS2A 3CPWA 3HOVG 1TWHB 1E2VA 3JAME 5EWFA 1A9XA 1PH1A 4CDEC 4M8AA 3JAMi 4GKJL 5BPHA 4TQRA 1JJ2A 3ZYYX 2C9OA 1TWAB 4DR5L 5JJLA 2EYMA 2YU9B 1VQOA 4CC5A 1Y1WA 2UVVA 1YJWA 5EWGA 4GC6A 1PLFA 1LT5D 2NB0A 1B4OA 2JEBI 4HJ8A 2LKVA 5J22A 1BBXC 4LMYA 1TWGB 3HKSA 1VQ4A 2K5QA 3KLSA 2KEDA 4R4CA 2KCTA 5HY6A 2DGYA 3I4LA 2R6FA 4DFAA 2PZTA 2SNSA 1CSQA 3C2PA 1F2MA 5M3FG 1DGSA 5EPKA 1WI5A 4I65A 2UUBQ 3WOFA 1E4FT 1RYRA 2OTJA 4LF7Q 1ILQA 1N34Q 2B2UC 2KQ3A 3NSWA 3S1NH 1ILPA 5M3MB 3FDSA 1K3RA 4IRCA 3K5NA 5I47A 4JK1C 2EZVA 3L2PA 5IP9H 4LSXA 4UP9A 4OIKA 3MC0B 1JOKA 3ERQA 2RGVA 2I87A 4C3HG 2W57A 3RUZA 4AIMA 1BNZA 1NUCA 3ORQA 4DK1A 4H0LC 3PUVA 2A6EC 1R4QB 3T53B 4AH6A 2HVQA 2W9CB 5DAUA 1XXGA 2FKLA 3I7FA 4MV4A 1TWCA 2UU9H 4LFCL 5IGCA 3CAMA 3MVVA 4NXNQ 3FP9A 4B3TH 5JUMA 2RDIA 3T5HA 2MNAA 4YY3H 1H9KA 4Q8FA 2A74C 5KGUA 1GUWA 1HTLD 1BKBA 2EE1A 4JW0A 4X64H 2KOLA 5C8YF 1MI2A 4X3TA 3M4IA 4GKKH 4CDDC 3I12A 2DJGC 4RUCA 5CR3A 5LMUL 1GSHA 1Q81C 4A3KH 1IBKQ 1QVCA 4K2KA 1TAEA 3JZIA 1X3GA 2W6ZA 5EJWA 1BQQT 4R9WA 5AJ3L 3RBDA 5HBRB 1TWFB 5IP7H 4HR7B 3HOZB 4JI2H 4CGYB 2VB3X 2Z1CA 4UAIA 5K2MA 3QO2A 2HD3A 4UCTA 1IBML 4WJ3M 4YCVA 3MAQA 4IOCA 1C8CA 4QWEA 1JMCA 2IMWP 3K7AB 3SK6A 3K3PA 3H6MA 2E5LL 5C4JB 1IKLA 1ZKOA 4DV6L 2E75C 2WKCA 2CW0C 3HOVH 2EY1A 1HNZL 3EBEA 3HOWB 4QWAA 5ELDA 5KFLA 4OL7A 2F0TA 3A74A 1VQKA 2F4VQ 1QCBD 1WR2A 1WOCA 5IY0A 3A5ZB 3DXJC 4G4KA 1BBWA 5IYBG 1RD9D 4F87A 3BQ0A 3GTQB 5KKNB 1ZETA 4OX9Q 1NBWA 1CUKA 1K83B 4MV1A 2PZUA 1LUZA 4O4HF 4DUYL 5CAEB 2B2TA 2F0EA 1WTQA 4DV1Q 2Q8IB 3G8CA 1VQPA 4GNXC 2JA5B 5KFZA 1FNWA 5KT5A 3PR4A 4NW2A 1WTWA 5KFVA 4KN4C 4JUZA 2PVPA 4TQSA 3HRZC 1Y1VH 4XQQA 2K14A 2K33A 1B6RA 4RAUC 3FDTA 3NP8A 3RGZA 1JOOA 4B3RH 1PFBA 3S14B 4EQOA 1J5EH 4EQ5A 4K0KL 4GS3A 2O5IC 3BZCA 3AFQA 2BA0A 3D31A 1PZKD 3OOCA 1XMOL 5CC4A 1PH2A 2K50A 4FBTA 2JA8B 4U68A 2CQOA 1EZ6A 3DLLA 3LMLA 5KX5F 2YYAA 3MEFA 5CA1F 2MHVA 1HRJA 2XIGA 5F2DA 1CTMA 2I80A 5KFJA 5C44G 1STGA 4LF5H 2YZMA 1VF5C 5EBCA 1XPOA 4ED6A 1VQDA 2DZDA 4IPDA 2N78A 4X66L 1MSHA 4I7AA 5EPLA 1VQBA 2VY3A 5GADC 1HR0L 5KFOA 2JE6I 3TINA 1VQHA 1DONA 2EYPA 3V96A 4GKJH 2PZWA 2EY2A 3SR1A 3KF8B 2AUKA 1KIXA 2ZM6Q 3ULLA 1HR0W 2R7KA 3HOUG 3OSNA 4DR5H 3F2CA 1ET9A 2R92A 4R1JA 2F4IA 1V4YA 2AGOA 1EUCB 3CQZA 3GDEA 5KT2A 2DWCA 3GTPH 2E2IA 2IL8A 1GHKA 2K4KA 5E4XA 3R5XA 1AE3A 4IUUA 1HQRD 3BA8A 5AFWA 1STAA 3S16B 3QWNA 3CCRA 1KD1C 3TZUA 3H15A 1I6HB 5KFEA 1B70B 4A3LG 2MUYA 4I7ZC 4RHSA 1B6SA 4KJNA 3E5NA 4FF1A 1HHVA 3GTGB 3EIVA 5TSSA 3T5JA 1GXDC 1TVXA 3I4NB 1PTOH 4FM9A 4ILWA 4IUQA 2W7OA 2MJ8A 2FINB 1LTLA 5FLMH 3JRXA 2W9BB 4L5TA 4ETSA 1M7JA 2PMZE 4A3JB 3H94A 2YL2A 3F8TA 5A2QL 1GJXA 2LFNA 3NXWA 4R8IA 1B04A 1MJCA 2W8LA 2F0QA 2K5DA 4ID6A 1A0IA 1IXRA 4OXPA 3NHHA 5L37A 2I5MX 5C4XH 5IYBH 1Z7TA 1X3FA 4B3SQ 4NLGA 2I5LX 2NN6G 1Z2NX 4HJ5A 1V51A 2YZNA 5A2QW 4LFCH 1PRTF 4GLVB 2SDFA 1Q1BA 3HFZB 5C3EG 1S72A 1K1QA 1STBA 2UXBL 3ZJYC 5A2QE 4QIWB 2WE6A 2BR0A 1WTRA 3S1MH 2Q2HA 2R7ZA 4R4QA 3PUYA 4P75A 5FO8B 4C2MH 1STEA 4IWYA 3PGZA 2L11A 4DLKA 1SMYD 1GGOA 3G6XA 1PMRA 1S0OA 4LJZC 5LMUH 1EYAA 4J15A 4JCVE 4ZAIA 3H20A 4X65L 4TUYF 3IAYA 3ONAB 4CHTB 1I4XA 2UXDQ 2MP1A 1U5KA 4CDFC 1XNRQ 1M0WA 4KN7C 1PFNA 3M4PA 4X3SA 1EIGA 2VUMH 5A35A 1BVSA 4ABNA 3VR4A 2WAQB 5KNBA 3C3LA 1IBMH 4DUZL 5HGTA 2RCFA 2I07B 4DL2A 2F0GA 2E5LH 5BR8Q 2CHBD 3OPOA 4DV6H 1TWHH 5C0XI 4MV9A 3WNZA 1HNZH 1E4GT 1C9OA 2F0OA 2VQEL 2V4RA 4X62Q 2FLLA 2YTXA 4Q0YA 1KBLA 1X54A 1IW7C 1TWAH 2I5HA 5DLQE 3OUZA 2ALZA 5L1KA 2FJ2A 4UCVA 4LUOA 2YU9H 4J8QA 3RBEA 2K6AA 4R4IA 2O2LD 1ZHQA 1GUSA 1C30A 2WB1A 4F4WA 3NTKA 4BBRG 4MV7A 2V4DA 3TRZA 3NENA 1TWGH 3OHXC 4DUYH 1EEFD 1G291 2VA3A 1CQVA 3GTJA 3EA6A 1AFPA 2ZDQA 4ME6A 1EUDB 3EJIA 3JRWA 4LWCA 3PF5A 3V4SA 4WJ4A 2L0CA 1K8GA 4J9LA 3RB3A 4OEMB 4K0KH 2RCNA 2WACA 3K81C 4GOPA 4JI4L 2DY7A 1CZWA 1XMOH 5M3MH 2PMZA 2K5NA 5LHY1 2Q2UA 3FMAA 3AFPA 4CJ2C 4QW8A 1FJGQ 1ASYA 3RFCA 1PH7A 1CQJB 3IFDA 5KIXA 1HCZA 2X69A 3OYYA 2HVRA 4A93B 4AYBB 4P71A 2B2TC 1ICWA 2FP4B 4J0MA 4BY7G 4X66H 4U6PA 3KUPA 2NVYA 2MPMA 1ASZA 1HR0H 1EY9A 5DM73 1L2FA 5DG8A 1Q3LA 3H0GG 4WORA 3ETHA 3PO3G 1HXYD 1IYJB 1SNCA 2D5DA 3LWEA 2G9HD 4N8FA 3AU7A 4AQYQ 3G6YA 1UC8A 1ESRA 3T4AC 4R8UB 4YJ3F 2EPBA 2E2JB 4ME5A 3RNUA 5IYZF 1TS4A 3VYTA 1SMXA 4XIGS 3SK8A 2N88A 4DR2Q 2GLTA 3GO5A 2HQLA 1MD2D 1BCPF 3U9SA 4Q5VA 1VQ6A 4IR1A 1UE5A 1E1OA 4KHZA 5FLXL 1M8AA 2F3VA 4EQPA 4BBSG 1LV9A 4IN3A 1TWFH 2K52A 3HOZH 3MFIA 3A8KE 4U673 1OXSC 1EU4A 1CA5A 4A3IG 2R84A 4OWTB 3S9WA 3HP3A 4ZOLF 4J9PA 2NBFA 5FLXW 2HCIA 3K7AH 1AUVA 2VXWA 4PZ7A 3QOJA 5C4JH 4ZRZA 1KJIA 1RJRA 3GTOB 4UY8C 4DR1L 1I7NA 4FF4A 4YB8B 3UDFA 4TQUS 1PTOD 2F0HA 4ECQA 4DV7Q 2KHIA 1KJJA 2SNMA 1JR0D 4ED2A 1E3PA 5CV4A 4IZ8A 3GIIA 2BH2A 3H0GA 3G71A 4XQNA 1LYLA 4EQNA 3GTQH 2KHJA 4J9RA 1K83H 3GV5B 1CSPA 1Y8OB 1XMQQ 1I3QA 1HNWH 2UXBH 3AYHB 1HZBA 1KC8C 1ZYRC 4L5RC 5LMNL 4ED1A 4B3ML 5I6YA 1BXRA 4RKBA 5D3IB 4JI0Q 2EDGA 1WVLA 3CC2A 4MHEA 1GD7A 4A3EB 4N9TA 3ETJA 2UUCL 2E8GA 5LMNW 1SE3A 4E4TA 1UNSA 4MTEA 3AB9A 1VQ7A 3KDFA 1N32L 1EYDA 1EY7A 1PRTC 2RSNA 2C00A 5T1GA 1VQ8A 2JA8H 2DN8A 3QB3A 2DY8A 1EFWA 4LFBQ 3BABA 5KG3A 2B2UA 1GSAA 4X65H 5FOBB 3G48A 3VPCA 2J4XA 4KMUC 2E74C 4JI6L 1RK5A 1TIID 4HNUA 5LYJF 3M7GA 1F2LA 2FPPB 5CMDA 5LL6S 4MNOA 4DUZH 5IGGA 5E3FA 2VQFQ 5IWAL 3K7UC 4TV9F 3KF6B 4F8MA 1SEIA 1A3VA 5M5WB 1N33Q 4XXEA 4IRKA 5D1PA 1WTHA 1HFGA 3V6KA 1SDFA 2G5DA 2VQEH 1TWCB 4OHJA 1CA6A 3GTKA 4ZUIA 4AYBE 2UUAL 1I6VC 2BQUA 4IJHA 3H3VH 2R7MA 1BGWA 3PUXA 1HQMC 1JOQA 2KENA 3P75A 2J6TA 2R93G 4MV6A 2HIXA 2IA6A 3S16H 1MSGA 1I6HH 2NUCA 1E1TA 4NDXA 5KG0A 1R9TA 1ENFA 1TS3A 1ZXTA 2H1EA 1CE8A 4A3BB 3BAAA 3KTMA 3GQCA 3GTGH 2ASDA 3I4NH 2B8GA 4HCEA 3TEHB 4MA5A 4A3DB 1IBLL 1JQYD 2EVBA 4JI4H 3W5OA 3FKIB 3CXCA 3N42B 3NELA 5CV7A 2JK8A 2EOTA 2KCMA 4MTKA 1HPCA 3LX0A 4KTAA 3SDZA 4A3JH 4L5SA 2F4VL 3MR2A 3PW4A 4LFAH 2B2WA 2A73B 1RK6A 4EGQA 1GUNA 3ER0A 1GM5A 2VUGA 1TS5A 3I4OA 4GKKL 4LF6Q 1IOVA 4JI3L 1YITA 2WYOA 2RA4A 3B6YA 3OTOQ 4JI5Q 4DV2Q 2XD4A 2IPKD 4OIJA 3Q2OA 2TMPA 2F0UA 2W7PA 3K5OA 4PZ8A 1MGSA 3C46A 4LF8Q 1W96A 2XCAA 1QJOA 4LUZA 2P0AA 1MIUA 2V4QA 4GOPC 3S1QH 2CCZA 1B7YB 3U4ZA 1VQEA 2F03A 2R93A 4XT3B 4ECWA 3D6WA 4JBKA 3EFXD 1N36Q 4JV5Q 1SEBD 3PR5B 1VQIA 2EIFA 3S2DB 4RNMA 3OSPA 4JI7L 5EQ0A 3QZ8A 3I3CA 1IOWA 5DGAA 1BDOA 1A62A 3OMCA 5ELEA 1VBHA 1ZEQX 1VQFA 1LTGD 1SFOB 2SOBA 1ULZA 4IUPA 4DAVA 3PW0A 2N49A 2AWOA 1OTCA 1Q7YC 1S5DD 1NE3A 2Z8LA 2VR1A 2N3SA 4FVMA 1B3AA 1S5BD 2VPSA 2JEFA 1VQJA 2JN4A 3DWPA 4YHHQ 1JKJB 4OO1H 4RAYA 2CZGA 1T5EA 1XDNA 2JA6H 1H9SB 1JE5A 2ZM6L 2RSOA 3UDGA 4DR1H 3T51B 1JB3A 4LSAA 2JEIA 2QKIC 4YCWA 2GN5A 2D62A 3GD7A 4B08A 4YCUA 4ECXA 5GAHC 1F9QA 1UAPA 1J5EL 4JI8L 1PH6A 1I94Q 1Z47A 4QGUA 2M05A 2Y0SE 3R8BA 4DR4Q 4UFZA 1L0YB 1SNPA 3T1YL 3J81j 2R92B 2AQ4A 4DV0Q 2K5WA 2I8CA 3KHLA 3CQZB 1N48A 5IP7G 5LMNH 4B3MH 1X3EA 1LTID 5I4DA 4UCRA 4X3KA 4C3JG 5BPFA 4Y8VB 5JVDF 4JBMA 5EOYA 4YR2A 4IR9A 4XYOA 4R7RA 2FFKB 3KXYT 2W6OA 4JV2A 1JDEA 4M1UB 1N34H 2UUCH 3NWTA 3K57A 4G7HC 2K5VA 1PVOA 1N32H 2IWHA 3NTHA 3CD6A 2FB9A 1K3BC 4A3GB 1XNQQ 1G51A 4MV3A 3MFHA 2W6NA 1JWSD 1RHPA 5KFGA 4JI6H 2RGRA 2IW3A 3GV3A 3TIIA 4XX0B 4EGJA 1NJIC 1JCKB 4A93H 1U9RA 4QF4A 3I72A 3L0OA 1PRTB 1G6ZA 4NXNH 5IWAH 1CKMA 5KFSA 4J9QA 4B9XA 3C1EA 3RB6A 4H44C 1JLLB 2E2HA 5FO7B 1B9NA 1QUQB 1EFID 2F0IA 1XTCD 2ZTCA 1SYFA 3WOEA 1A6XA 4N8X1 1Y1VG 2UUAH 1LABA 2NZ1D 3CCEA 2Q8RE 4ED7A 2AUJD 4I50F 3OMGA 5KG4A 2B63B 2R7ZB 3BVZA 3J80L 3CCUA 3NBIA 3A7AB 4C3IB 5KFBA 2ZDGA 2UXDL 5KT4A 4JVZA 4A3MB 4O3QA 3EQLC 4F7XA 2FLNA 3J80W 1W6JA 3MXNA 1HZCA 3FPUB 2VPQA 4KKUA 5C5JA 3HKZE 5ELOA 1SLJA 3J80E 3KHHA 1QOHA 1TKWB 3D0FA 3RGXA 4DAYA 1IBLH 3QOLA 3W3AA 3R2IA 4R4TA 5KFNA 1F77A 4P74A 1WD1A 4ZHQF 1SJED 2XN9C 1FR3A 3KLWA 1I4HA 3GTOH 2F4VH 4O2BF 2BE5D 2F3IA 2FK1A 3RTXA 1H95A 5FK9C 3Q24A 1QZHA 1Z9FA 4K14A 1UNNC 2FLPA 2JQOA 3VYSA 5GQOA 4JI3H 2J6UA 1K8OA 3I90A 3OUUA 1KABA 3UFXB 3Q22A 5IGEA 5J1ZA 3D8GA 2BOSA 2NN6I 4P72A 1VQ9A 1Y1VA 2IHFA 2PW5A 5IE8A 5IIFA 2WB1B 4R8NA 4PQXA 4DV5Q 4IOAA 4LF9L 1VAJA 3FHWA 4DPGA 1UE6A 3Q8DA 1Q8KA 4C3JH 2RDFA 5E7NA 4P73A 3GTJB 1BUVT 1U4MA 1PYBA 3HKZG 3SE0A 5IGDA 3ND9A 1FVIA 3CMAA 2XCLA 4O3NA 5FLMG 1C7YA 3HEJA 4J9OA 1GYFA 2JEGA 5D3DA 2B8FA 2F0WA 1EY6A 1VQMA 1AZQA 2B2WC 2Z4HA 3RJ0A 1HJPA 4JI1L 1RODA 1RL2A 2CH4W 5J3BA 5D1OA 5KRUA 1PYWD 2DJFC 2BQ3A 4EBDA 4JI7H 2M2LA 2V1CC 2F52A 3BG3A 1S03G 3N6XA 4GOPB 1YHBA 4NPSA 1CZGA 1U4RA 3CF5A 2NVXB 4ECTA 5C4XG 1AE2A 2R61A 3S1RB 1D5MC 2F0NA 1SNOA 5DLGA 1K8MA 2ZXOA 5M5XB 1VS0A 2KHSA 3KK7A 4GLAC 3JC66 2IX3A 1Q82C 4LF4Q 2FMAA 3BQ1A 1N56A 5KG1A 1HUNA 3GIJA 3VR2A 5ELNA 4HN7A 4PV1C 3GIMA 3ULPA 3VPBA 3PSIA 2UU9Q 3BYYB 3RR5A 4DNIA 2ASBA 1SE8A 1C0AA 4PMWA 1CKOA 1B44D 2RHQB 3HS0C 3MWEA 4FF2A 2ZM6H 1L2ZA 3V6HA 4B3TQ 3Q8RB 3GTPA 5DLFA 5FJ8H 1E4EA 1XPRA 4YY3Q 1G91A 1WCMG 1EYGA 3V4ZA 3TSSA 2ZXPA 3R93A 2RQXA 5IYDG 1PH3A 2HT1A 3SE7A 4JI8H 4UCUA 1GUOA 3I2ZA 2J0TD 1BCPB 3CHBD 3KFUA 2W8KA 3T1YH 4Y7NB 4HEDA 3X3NA 1KEEA 2W6PA 1LTBD 2VUMG 1A63A 4PDBA 1FYCA 3HKZA 1TQOA 3HGBA 1HZ9A 1SAPA 5T1IA 2PCFB 4C5CA 4EEQA 3OWEB 4JI2Q 2H4OA 3CU7A 1LTAD 3MXPA 3CVZA 4L1KA 4M7EA 1LLRD 2HHHL 1X3QA 4DV4Q 4NXMQ 4YAKB 1EOTA 3FKIH 3GIPA 1J9OA 5CORA 1G8ZD 4J9KA 2IY5B 1EU3A 1BOSA 1H9JA 2OLSA 3VYRA 3GV7B 1RKNA 1PFSA 4PZ6A 1Q8IA 3PUZA 1KLGD 1AEXA 3SK5A 1EQQA 1T3NA 3M9OB 1VCIA 4KHPL 4PMBA 1EY5A 2K7VA 3G6VA 1LT4D 3UQ8A 1DCZA 2Z0SA 3AEVA 3EVQA 3BJUA 1O7LA 3NQIA 1BO0A 1QG7A 2YTVA 3HOXB 4C2MA 4G3IA 3RZOB 5CB4F 1E22A 3I55A 3LP8A 3M4OH 4QL5A 3A7LA 3PN1A 1DOLA 5KG5A 1I3QB 4HIOA 2IJ0A 3MWMA 2RKSA 2YV5A 3GIDA 3DUZA 3PZPA 5FD5A 2ZDHA 4OWXB 5M3MG 2C35B 4B3RQ 2KVMA 4A2BA 1QE6A 4BY1B 4A3CH 2EYLA 3FVQA 4O3OA 1SMYC 3R3OA 1HNXL 5DQHA 3PW5A 2UXDH 1JICA 3RUPA 2AU0A 1C48A 4O3PA 4C56C 3KHRA 1CFMA 1S3OA 3KDFB 2R8HA 1DD2A 1WFQA 3OW7A 2QK4A 1SFOH 1WH2A 2KUMA 3ERSX 1TWHA 2ZTDA 3KHGA 4LF5Q 1CS0A 4L63B 5FLXc 4JYAL 1SYGA 1QVGA 3KOJA 3TBIB 1W3SA 2KCNA 4DXGA 4RCOA 3J81L 1WTOA 4TRDA 3G6EA 2I0QA 2PPBC 1STYA 1HNWL 4RNNA 5KFPA 2L5TA 1SBBB 4JV1A 2YU9A 5EDWA 3R2TA 5HGQA 4APMA 1OO9B 4TV8F 1IL8A 1DOKA 3Q0AA 4GKJQ 1YHQA 1DYQA 4FP5D 4A4IA 3F8NA 3N6RA 3J81W 1AP0A 1TWGA 1WCMH 4DR5Q 1LACA 1QB5D 1L0WA 5KEEA 1SRUA 5IYDH 1HZAA 1S4ZA 5LL6X 3GTKB 3TP8A 3QIAA 4ZCKA 1WTPA 2J7ZA 3TQTA 2AQ1B 4PG3A 5DEHA 4DXFA 1NTGA 5KFTA 2R92H 4DR6L 3URYA 2A68D 3FEWX 1F9RA 1JJCB 3A8IE 1ENCA 1O75A 3HOZG 2B39A 4LF9H 2XGTA 1ZHSA 2XGQA 3CW2C 1HH2P 5C5MA 1GUTA 4H13C 3W2DA 2OWOA 3S15B 2HJWA 4B9WA 2KEEA 4QY7A 4JI1H 1LT3D 3E9IA 3CPFA 4NP5A 4EVOA 3NBHB 3HOWG 5D65A 3DEOA 4TSSA 4QMGA 4A3GH 4QUFA 2FPIB 3V05A 2W9CA 4DV3L 1SJHD 4FYDA 4HSVA 1JE4A 1AZPA 1D1IA 3TQ1A 1EYCA 1VDZA 5C1OA 4A76A 2W6MA 3K6OA 1UEAB 1VF7A 4A3FB 1JIHA 3MA2B 2NZHA 5LA6F 4LFCQ 4UDUC 2JA5G 4BXXG 1CQFA 5DNFA 1MBYA 2F0LA 2F0JA 1RTNA 5EGTA 1VQ5A 1VQLA 2VS1A 3W1GA 4IAJA 5JOBA 2XSCA 4YR0A 4MTDA 4EGVA 4DR7L 3PW2A 4I55F 1I4GA 1TS2A 4CJ1B 5IGBA 2C2DA 1KAWA 2WV6D 2B63H 1NY4A 1SYXB 3IFTA 1TWFA 3E3XA 4C3IH 2JA8G 2Z4IA 5LMUQ 4GNXB 4FDBA 2R93B 4XYMB 4N9PA 1Z6HA 3RLOA 4C5BA 3KBXA 4A3MH 3L7ZC 2Z6BA 4LFAL 2EQSA 1S5CD 3I70A 5KFCA 5ELBA 1Y14B 1B9MA 5T14A 4X3UA 5AJ3Q 4IZOA 3EPIA 2A19A 1W93A 3PW7A 1AN8A 3A56A 3L4KA 4LMQD 3HG9A 2QDBA 2JA7B 2XWJB 1X6OA 1JXLA 3IN5A 1E24A 2RHSB 1IBMQ 4ODGA 2HHHH 4KD4A 1Q90A 3OIPA 4E6IA 4IPGA 1CKNA 3PIP3 2E5LQ 2PW7A 3PO2B 5JJKA 3I56A 1SNQA 1FNUA 3IKJA 4DV6Q 2YW2A 4RHRA 2D2CC 4ECSA 2AGQA 1DOMA 3GTQA 1HNZQ 1EIHA 1SYBA 3E6ZX 4WD3A 1GHJA 3RLFA 3EYYA 1CK1A 1LO5D 3GTMB 2R7LA 4KHPH 3HOYB 1I50B 4EFBA 1LTRD 3R23A 2K5HA 3RN2A 4QIWE 1PTOC 3VDYA 3DWQA 3K0XA 4ZLTF 3FRPB 4IUVA 2R86A 2F0DA 4JG2A 3K5HA 2HCCA 2LSSA 2V5AA 2BDOA 1UC9A 1T9HA 4DUYQ 4JI0H 5KFFA 3TZDA 3CCQA 2F0SA 3MWYW 2FHTA 2EJMA 1NAPA 2X6LA 1YNJD 5FPOA 1MHWC 3GTLB 1PDQA 3I4NG 1STNA 2K05A 2UXCL 2PNHA 1OXXK 4GN4B 5CBEE 3BS1A 4ECUA 2E76C 4QWDA 1KDBA 1KXLA 3WO1A 1YBYA 2WP8J 1L1OA 2PQEA 2EYHA 5ISRA 3I4MB 1M0TA 5FLXE 1Y69U 5KT3A 4K0KQ 5LL6b 4A3JG 5C4ZA 3GIQA 2C2RA 1I4PA 2KJXA 1XMOQ 3M3YB 2XC9A 1HNXH 4O2DA 3HOWH 2P5ZX 2NU6B 2WAQE 1YVCA 4Q45A 1D5ZC 2NVXH 5KFMA 3Q8PB 3S1RH 3J7AF 1RDPD 2VQFH 1GUGA 5M5XH 3J7YW 3RAQA 4JYAH 4EBEA 3NUCA 1FGBD 1OXUA 4X66Q 4KK7A 3F2BA 3CP0A 4G7ZC 1Y1WB 4DL4A 1HR0Q 1VQAA 2VNUD 2F1MA 2L9HA 1SYDA 2JA5H 4BXXH 2KBNA 3FMCA 4ZKCB 3SVMA 1WSCA 4RAZA 4TKOB 2UUBL 5KFDA 1DJRD 2QEJC 1QZGA 2E2HB 5I2XA 4LF7L 1N34L 4KY7A 4XDXA 3VYUA 3S14H 2JA9A 3BDLA 4A3KB 1KTKA 3T13A 1S97A 1V1QA 2BDNA 4DAMA 4Y7NH 4DR6H 2V9WA 5COYA 2DNCA 3S2HB 1JDBB 1TT2A 2FK2A 1W2BA 4KV6A 2WAQG 3BVMA 5DM63 2W9BA 2KECA 4DF7A 4NXNL 2CQAA 3A55A 5C5LA 5C4HA 4HJ9A 4QWCA 1VQGA 4OO1G 2K1BA 3VR3A 3DEPA 5L1JA 4O4LF 3EROA 2JA6G 3HOVB 2W6QA 1KJ9A 3T5LA 2XRQD 2MFIA 1AH9A 1JWMD 3V2TA 1LTSD 4DV3H 4RGMA 3D4RA 2Q8TA 3VR5A 3MFGA 3OTOH 3CCLA 1DV1A 2FK3A 2C22A 1IBKL 4QIWA 1LM0A 4NB3A 2OF1A 4DL3A 5KFRA 3HOXH 1N8RC 4XT1B 2UXBQ 1B50A 2ATLA 4F4YA 5C3WA 3DF7A 1BXTA 2F0PA 3E9HA 4FNFA 2BQRA 2CW7A 4DR7H 1I3QH 1Y1VB 1K9MC 1NMGA 5M3FB 3G6JB 3BU2A 4XZ3B 5M9OA 1D2BA 3BJYA 4BS9A 2R8KA 4IQZA 3RF2A 2QEXA 2CW8A 4EYHB 1EQTA 2K04A 2YYZA 3TP5A 4DK0A 2IT1A 4IPCA 2OQ0A 4BY1H 3KAKA 1KJQA 2NYZD 1M6VA 5CA0F 3NPPA 5JJZA 2WAQA 3J80c 4X65Q 5D1OB 3J7ZC 4C3HB 1ZQ7A 4F88A 5KFHA 1IKMA 2JEJA 3PF4A 3T1HQ 4A93G 4AYBG 4LF4L 1CHQD 3QG1A 4OX9L 2HGSA 4O3SA 3D4WA 1BNCA 1E2ZA 1KJ8A 2JA6A 3M9MB 3HXLA 1MZBA 1EEID 4CBVA 1MKHA 4DUZQ 2LY7A 4DV1L 2WFWA 2XGPA 2MO0A 4IHJF 3DWAA 4V0BA 4DK6C 5JEAH 1XX8A 5IGFA 4OWWB 5HURA 5J39A 4O3RA 3ULJA 4BWGB 1V1PA 2PI2E 1JC7A 3IL8A 4DA2A 2VQEQ 4PMCA 1RYSA 2UVUA 2OXPA 1RJTA 2QA4A 1V1OA 3Q6SA 5JVLA 5IT9L 1E4EB 3V6JA 5KFKA 3KBGA 1TU2B 4JOIA 5LOVF 2OEOA 1HTPA 1KC7A 3ORRA 4C5AA 1YEZA 1BR9A 1I7LA 5CGKA 3A54A 2D0PA 4IPHA 2HQEA 4KI0A 4K8IA 3HBLA 1K8AC 3K58A 2UXCH 4C1NI 3RN5A 3MR3A 2O4XA 4KLKA 2V59A 1JX4A 4DV4L 4NXML 3S15H 5C0XH 1RIPA 1ENAA 1K28A 2LXKA 5ELFA 4L5QA 4JI4Q 5JJIA 3MR5A 4AYBA 1O7YA 2GVAA 2R6GA 1K73C 2ENBA 2QGQA 2IP4A 3VA5A 4ZYSA 4F50A 4H02A 2HVSA 3I8ZA 2DNEA 4J9MA 3CCSA 3EN2A 4KJOA 4MIUA 2WKDA 2ZXRA 1RTOA 2VOBA 1G6PA 5IYCH 1GOZA 1T94A 4R8UA 4A75A 1D8LA 1BJTA 2NVQB 5NUCA 1A2UA 1QWYA 3SHLA 4DR3Q 2E2IB 1CQIB 3DMUA 4C2MB 4OONA 1JWUD 2UUBH 5JQWA 1L1OC 1Z2PX 4IJLA 4A3EG 4EFEA 1V8QA 3S17B 4LF7H 1Q1EA 2ES2A 4K6DA 1KLUD 4K5WA 5K36H 2FJZA 4QCLA 1EY4A 3A5UA 2L1BA 1E0BA 4IFDJ 2VQDA 2A69D 3PIO3 3RZDB 5DG7A 5CYUA 1JORA 2OQKA 3JAML 4UPAA 4B3SL 5C44B 1BCPD 3P7JA 2JA7H 4DK3C 2IX1A 3H3VC 2CFMA 2IHEA 1EZ1A 5D8DA 2Y0SG 1Q12A 3SXHA 3ICEA 4H7BA 2W71A 3RB4A 4JC0A 1PH9A 2NTTA 4HJAA 1TXYA 3PO2H 2PI2A 1PH4A 1Y8NB 2PQAA 5FJ8G 2HUGA 2ZTEA 5CV9A 1ONLA 2VB2X 5KT6A 3U9OA 4DR1Q 3HOUB 3PUWA 2XWBB 3DHQA 2E2JH 3GTMH 1LTTD 5KFAA 3HOYH 2BE5C 1IBKH 1I50H 1PYSB 4WFN3 4EG0A 1SNMA 1KDCA 4KKSA 3KJPA 1S40A 1TR5A 4O2AF 3KALA 1VQCA 5F9LA 4DV5H 2A8VA 1XNRL 3FPPA 4HYKA 4IWXA 2VW9A 1CM9A 1O80A 1IYUA 1WD0A 1EWCA 5LMNQ 1YNND 3QJYA 2RDHA 4B3MQ 1HFNA 4A3BG 3G4SA 2ZJQA 1UE7A 3GTLH 2EYJA 3GV6A 1A8VA 3J80i 1DV2A 4JBWA 4A3DG 5BR8L 3M4YA 3M85A 3FKIG 5KNCA 1YZ6A 1O7ZA 2UUCQ 3I4MH 3RLNA 1AW7A 2YS6A 5I9PA 3WWVA 2R7FA 4X62L 4CKBA 5JH7F 1N32Q 2R3ZA 4DAPA 3M3YH 2LS01 2GVBA 1II3A 1NSNS 3TS0A 1S10A 4RCNA 4LUVA 5KG6A 3VPDA 5EKKA 3KF6A 1YI2A 4Q8EA 2CQYA 5EWEA 4LF4H 4JI6Q 2YRXA 4OX9H 2Y0SA 3N8DA 1DZ1A 2PNRC 1ET6A 3Q1KA 2B2VA 5GROA 1I4QA 1S9FA 1EY8A 4DV1H 1KDAA 2HIVA 5IWAQ 5C3EB 1Y1WH 2D9UA 2D0OA 5EKIA 2J6SA 4GN3B 3N40P 3MR6A 1EQRA 1A3TA 4L6TB 2DIKA 3J81c 4LAAA 4RB1A 1NMFA 3PV0A 1WJJA 2E2HH 2UUAQ 1LT6D 1FGUA 4HAEA 4A3EH 1NNXA 1U4LA 1X55A 1XTDA 5DG9A 4A3CG 2C28A 1Q46A 3AQQA 4JPBW 3SGIA 1D6EC 4BA1I 2ASJA 2QW7A 4PNYA 1FJGL 1U4PA 4MTNA 2A6ED 3O13A 4KY5A 1GO3E 5JVG3 2SCUB 2PMZB 2RVLA 3S2HH 1XWEA 4IUTA 4UCSA 5LP6F 4YP3A 3FKIA 3N44B 2MQHA 1R4PB 3QR8A 4IUNA 1KQSA 4DV4H 4NXMH 3U50C 2FPGB 1Y8PB 1NR2A 3L3OC 3CCVA 4P2CB 5M5WH 1IBLQ 2NVYB 4AQYL 3L4JA 4HIMA 4IFDG 1TWCH 3U4VA 3TQYA 3RMHA 1A3UA 2VA2A 2B2YA 1CKNB 4LW1A 1F2ZA 2AGPA 4JOIC 1ML0D 4DR2L 3TREA 4X64Q 3A8JE 4GKKQ 2JEAI 2QILA 4JI3Q 4KHVA 4RGTA 3CMEA 4TVAB 4BBRB 2R92G 1SCUB 3VA7A 2JJQA 1XYIA 2V58A 1GKHA 1KRTA 2O03A 4FO2A 4G7OC 3KYHC 3NE5B 2A6HC 3DM3A 4K5VA 1XPUA 1K1SA 1KNAA 4ZI7F 1PXUA 4J6HA 2EYFA 4MZ9A 4R4OA 5D14A 2W9AA 1EY0A 1SE4A 2KA7A 5M3FH 2CW0D 4A3BH 2EY5A 2CKZB 5KT7A 4YJ2F 1PTOF 2AKWB 3UI2A 1YJNA 2OT2A 4CKEA 4A3DH 2WDTA 2ASLA 3TDQA 1KRSA 2ZJTA 4A3GG 4A2AA 1SFOA 2JSOA 1O78A 1NR4A 4DV7L 1L1OB 4JI7Q 3ND8A 4B3SH 4C3HH 3NGDA 2EJGC 5IODA 1DIKA 2FMMA 3ITPA 4FXKC 3VR6A 2YTYA 5IOCA 4BY7B 3Q8QB 1XMQL 1H9SA 2A6HD 3OHBA 2L55A 4XQJA 5L1LA 3J7AK 1A15A 2K75A 3D6CA 5M5YB 4FBUA 4RH6A 2R8IA 3I73A 2EXDA 3GQBA 3H0GB 5G3LD 4JI0L 1WCMA 2W70A 3BDOA 3HB9A 2NWGA 3LWBA 3H4DA 4WJWA 3PO3B 4DNTB 2ID0A 3TP7A 1YJ9A 1EIYB 2M9VA 4RB2C 4ED8A 1Z2OX 1PZID 5JAVA 2B63G 2R7ZG 1VQNA 5CBAE 3CRKC 3H3VI 4C3IG 2ZT9C 1J5EQ 4JI8Q 4LFBL 4ECRA 2VUMA 4EEYA 2WB1E 3F1ZA 4RB3C 2CH4A 4OELB 4A3MG 5GAEC 3S2DH 3MWDA 1XNRH 3T1YQ 1B33N 4K6LA 3J7AV 4RZRA 3GP7A 2Z6KA 4O42A 2IX0A 1HA5A 4BBSB 3OHAA 4DL7A 1F9SA 2A68C 1PV4A 4FS2A 4HIKA 2NZOA 2VQFL 4A3IB 3CC4A 3K3VA 3SEBA 3R5HA 1QNKA 1S0NA 2PO4A 5BR8H 1N33L 1S5FD 1TWAA 3JSNA 1EUJA 3G7LA 1U0LA 4XYQA 4X62H 3D3RA 5ELCA 4O4IF 2M00A 3OWFA 2WINB 4QB4A 4DGZA 4IFDH 1FL0A 4ED3A 2B29A 4I7HA 4RA8A 3C1FA 1EWIA 2ZJPA 4QW9A 2L15A 3J81E 1G2TA 2HDLA 1QUQA 4K5XA 5C3XA 3J81i 2ATWA 4WBNF 2UVWA 2C2EA 2JP1A 3MFYA 3PIPA 3MHBA 3MXGA 1VMCA 3NQTA 1RJPA 2WB1G 2XRSD 3CQZH 3U9TA 4HTHA 5L1IA 5E4WC 3UE0A 2UVRA 2NVQH 2E2IH 5KFWA 1X65A 4QJFA 3GV8B 5FO9B 2B63A 3K59A 4KY6A 2YZGA 4KD3A 3S1QB 4YAJB 4ALPA 2XIWA 3S17H 1AUXA 4HNVA 1STHA 5JEAJ 1SSOA 3SI8A 3E0EA 3NTIA 1SN8A 5FKAC 1R9TB 1AN7A 1RF2D 2MCTA 5C6AA 3NWSA 1JJGA 1B3QA 2QF7A 2YCHA 3KJOA 1FJGH 2OTLA 3RZDH 2Z9HA 5K5PA 2NVTB 3T1HL 4RWSC 4LF6L 1EIFA 2B2VC 4JI5L 3OTOL 2J9GA 2YRWA 5C44H 4DV2L 1KNEA 4CDCC 2WTFA 3H91A 3KLSX 2AQ3B 2E2DC 1EHIA 5C1PA 3J7A5 3CKIB 4KKTA 4F4ZA 1YHAA 3UDIA 4LF8L 3MEHA 4OO1I 2JA6B 4AQYH 2N8NA 5I9OA
chains in the Genus database with same CATH topology
4GLXA 2K14A 2K5VA 1PVOA 3CD6A 4EQ5A 2MFIA 4RG1A 3HOUH 4K0KL 5C0XJ 4GS3A 3M7NA 1AH9A 1K0RA 1N36L 1XNQQ 1G51A 3AFQA 2BA0A 3BZCA 3D31A 3IRBA 1XMOL 4JV5L 1PH2A 2K50A 2R7ZH 3CCLA 2CQOA 4YWLA 3DLLA 1KHIA 3MEFA 4DKAC 1IBKL 1LM0A 4NB3A 1OXTA 2AWNA 1NJIC 1J6QA 4IO9A 5C44G 3M4QA 4A93H 3L0OA 3HOXH 1XPOA 1VQDA 1CKMA 1YNXA 1N8RC 4IPDA 2N78A 4LF9Q 4X66L 4A3LH 2UXBQ 5GADC 1VQBA 2VY3A 1HR0L 1KL9A 3E9HA 2JE6I 1VQHA 1QUQB 2ZTCA 1I3QH 4GN5A 4YHHL 1K9MC 1NMGA 3BU2A 1Y1VG 3CCEA 2QEXA 3KF8B 1XJVA 2YYZA 1PHJA 1KIXA 2ZM6Q 3ULLA 1HR0W 1QVFA 4JI1Q 3HOUG 3F2CA 2IT1A 4IPCA 2OQ0A 3LGJA 3CCUA 4BY1H 3F2DA 4R1JA 3GDEA 3J80c 2DUDA 1I94L 3GTPH 2UXDL 4X65Q 4DR4L 3J7ZC 2K4KA 1AE3A 1EOVA 3PF4A 2ZJRA 3T1HQ 4AYBG 4LF4L 4DV0L 4OX9L 4A93G 2CWAA 1HZCA 3HOXG 2R7DA 3CCRA 3HKZE 5ELOA 1SLJA 4DR3L 1E7ZA 3H15A 1KD1C 3K80C 5C3EH 1B70B 4A3LG 1MKHA 4DUZQ 3D0FA 4DV1L 2BH8A 2WFWA 3W1BA 2MO0A 3CCJA 3EIVA 4DK6C 4ME3A 4OWWB 1V9PA 4XTCS 4R4TA 3ULJA 3OW2A 4P74A 3GTJH 3GTOH 2PI2E 3KLWA 5FLMH 1LTLA 2VQEQ 1YIJA 4L5TA 2F3IA 1H95A 2PMZE 4BY1G 1GVPA 1QZHA 1XNQL 1Z9FA 4QQBX 2QA4A 3F8TA 2JQOA 1MJCA 5GQOA 4JOIA 1A0IA 1IXRA 4OXPA 5IT9c 2I5MX 2XTIA 5C4XH 5IYBH 1PH5A 1X3FA 1YEZA 4B3SQ 4X6AH 2I5LX 2NN6G 2NN6I 4P72A 4HJ5A 1VQ9A 2IHFA 2D0PA 4IPHA 5IE8A 4GLVB 3STBC 2VZAA 1Q1BA 3HFZB 5C3EG 4DV5Q 1S72A 2AHOB 4LF9L 4IOAA 4KI0A 2UXBL 3ZJYC 3A0JA 1K8AC 2BA1A 3FHWA 4DPGA 3RN5A 1UE6A 1Q86C 3Q8DA 1Q8KA 4KLKA 4C3JH 5JEAG 3S1MH 2Q2HA 4P73A 4R4QA 3PUYA 4P75A 5E7NA 4DV4L 2HHHQ 4NXML 3S15H 1PYBA 3HKZG 4C2MH 5GAGC 1RIPA 1FVIA 2LXKA 2MO1A 2NVYH 5FLMG 3PGZA 3CMAA 1C7YA 4L5QA 1VQMA 4JI4Q 5JJIA 1HJPA 4JI1L 1RL2A 5J3BA 2GVAA 2R6GA 1K73C 2FXQA 2QGQA 2V1CC 2F52A 2PQAB 4J15A 4H02A 4JCVE 4GOPB 4KHPQ 3K8AA 1YHBA 4NPSA 4X65L 2RF4A 3CCSA 3CF5A 5C4XG 1AE2A 2Z6KC 4BBRH 3EN2A 1U5KA 2UXDQ 1XNRQ 3M4PA 2VUMH 1VS0A 3STBD 1BVSA 4GLAC 4LF4Q 3JC66 1Q82C 1N9WA 3BZKA 5IYCH 1G6PA 4A75A 1D8LA 5ELNA 5JJKA 4DUZL 4DR3Q 1X56A 3ULPA 3PSIA 1I5FA 2UU9Q 1V43A 3RR5A 4DNIA 2ASBA 1C0AA 1SE8A 4PMWA 1CKOA 2RHQB 4OONA 5BR8Q 3MXNB 1L1OC 4B3TQ 2VL6A 5C0XG 1TWHH 4IJLA 5C0XI 4A3EG 5FJ8H 3M9BA 1Q1EA 1C9OA 2VQEL 4YY3Q 1XPRA 2ES2A 4POFA 1WCMG 2YTXA 4X62Q 1EYGA 1D7QA 1JT8A 1X54A 1O7IA 1UWVA 5IYDG 1P16A 1TWAH 4DAYB 1PH3A 2HT1A 2I5HA 5DLQE 3A5UA 2Q2TA 4YWMA 1HNXQ 3I2ZA 4IFDJ 4LUOA 2YU9H 3KFUA 4R4IA 2OQKA 4BBRG 4UPAA 4B3SL 2B3GA 3TRZA 3NENA 1TWGH 3JAMc 3NEMA 1G291 2VUMG 1A63A 4BY7H 4HIDA 5IYCG 4A3FG 1HZ9A 4JYAQ 2JA7H 4DK3C 4DV5L 2IX1A 2CFMA 2IHEA 4JI2Q 5M5YH 1WYDA 3RZOH 2Y0SG 5EAYA 1Q12A 3H0GH 1HNWQ 4LWCA 3PF5A 3ICEA 4WJ4A 1K8GA 1M90C 4JC0A 1PH9A 4HJAA 3PO2H 1TXYA 2HHHL 1P8LA 3PO3H 2AMCB 2PI2A 4DV4Q 1PH4A 2PQAA 5FJ8G 3FKIH 4NXMQ 2RCNA 2ZTEA 3K81C 4GOPA 4JI4L 5M3MH 2IY5B 5K36G 4DR1Q 2K5NA 3PUWA 2E2JH 3GTMH 1PFSA 4PZ6A 2Q2UA 3HOYH 1I50H 1PYSB 3AFPA 3PUZA 1X9NA 1EQQA 1FJGQ 1ASYA 3KJPA 1VCIA 4KHPL 1S40A 4BA2I 1PH7A 2Z0SA 3AEVA 3CC7A 4O0AA 3OYYA 3BJUA 1VQCA 4DR6Q 2A8VA 1XNRL 4P71A 3UDXA 2YTVA 4BBSH 4BY7G 2VW9A 1ASZA 2JA7G 4A3IH 5LMNQ 1E22A 3I55A 1L2FA 4B3MQ 3M4OH 4A3BG 1SROA 4QL5A 3H0GG 4APVA 3G4SA 2UU9L 2ZJQA 1BBUA 1UE7A 3GTLH 1IL2A 1A8VA 3J80i 4JBWA 2LXJA 3PO3G 1IYJB 3PO2G 5BR8L 4HIOA 4A3DG 3PIOA 4B3TL 2Q2IA 3M85A 3FKIG 4AQYQ 1YZ6A 2YV5A 2CWPA 3RLNA 2UUCQ 3I4MH 4YY3L 4OWXB 3WWVA 2R7FA 5M3MG 4X62L 2C35B 3RNUA 4B3RQ 1N32Q 3M3YH 2GVBA 3TS0A 1SMXA 4X64L 4XIGS 3HOYG 4A3CH 4LUVA 4DR2Q 1HNXL 4DV3Q 3GO5A 2HQLA 3KF6A 1YI2A 1VQ6A 3GTKH 1S3OA 3KDFB 4JI6Q 1UE5A 1WFQA 3S24A 1E1OA 4KHZA 4BBSG 1SFOH 5GROA 1TWFH 2K52A 3ERSX 2ZTDA 3HOZH 4LF5Q 4RMFA 1OXSC 5FLXc 4JYAL 2HIVA 5IWAQ 4A3IG 1Y1WH 4OWTB 4JI2L 1QVGA 3KOJA 1W3SA 2D0OA 2A1AA 3G6EA 4GN3B 2I0QA 1HNWL 1EQRA 4LNQA 3K7AH 4GNXA 1MJEA 4PZ7A 5HGQA 4EX5A 3J81c 5C4JH 4DR7Q 1NMFA 1PA6A 3PV0A 3I4MG 1WJJA 2E2HH 4UY8C 2UUAQ 1FGUA 1YHQA 4A3EH 1J5EL 4GKJQ 1R9TH 4A4IA 1SR3A 4DR1L 5IP9G 1X55A 1XTDA 4A3CG 1WCMH 1Q46A 3AQQA 4UP7A 3UDFA 4TQUS 1L0WA 1B8AA 3SGIA 4DR5Q 1SRUA 4BA1I 1HZAA 2KHIA 4DV7Q 5IYDH 2NVTH 1FJGL 4MTNA 2H5XA 1E3PA 4LFAQ 2BH2A 4PG3A 1GO3E 4YWKA 1NTGA 3G71A 1LYLA 3GTQH 2R92H 4DR6L 4POGA 1JJCB 2KHJA 3S2HH 1K83H 1CSPA 3PCOB 1XMQQ 3HOZG 2XGTA 3AYHB 3CW2C 1HH2P 1HZBA 4HJ7A 1Y1WG 2MQHA 1UEBA 1KC8C 4L5RC 4A3FH 5LMNL 1IZ6A 1KQSA 4B3ML 3U50C 4JI0Q 3CCVA 2OWOA 5M5WH 3CC2A 1IBLQ 3CCMA 3UE1A 1GD7A 4QY7A 2OCEA 4AQYL 2UUCL 2E8GA 3E9IA 1TWCH 2ALYB 3CPFA 5LMNW 3U4VA 4HIMA 3NBHB 3HOWG 4IFDI 1VQ7A 3TQYA 3KDFA 5H1SE 1M1KC 4A3GH 4B3RL 1OXVA 1N32L 1CKNB 4LW1A 4A3KG 4JOIC 1UE1A 1VQ8A 4DR2L 2JA8H 1EFWA 3TREA 4DV3L 4LFBQ 4X64Q 3G48A 4GKKQ 2R93H 2JEAI 4JI6L 4JI3Q 3CMEA 4TVAB 2R92G 2JJQA 4A76A 4Y52H 1GKHA 4MNOA 1KRTA 1PH8A 4LF5L 3KYHC 4UP8A 3DM3A 2NZHA 5IWAL 3K7UC 2VQFQ 4LFCQ 3KF6B 4JBJA 1XPUA 2JA5G 3U58A 4MZ9A 4R4OA 1JB7A 4BXXG 1N33Q 1VQLA 1VQ5A 5M3FH 2VS1A 3W1GA 3TS2A 2CKZB 4A3BH 2UXCQ 3CPWA 3HOVG 4DR7L 2AKWB 1YJNA 4A3DH 1PH1A 4AYBE 1KAWA 3JAMi 2UUAL 4GKJL 1KRSA 1NY4A 2B63H 4A3GG 1JJ2A 4IJHA 3H3VH 4DR5L 4C3IH 5JJLA 2JA8G 3PUXA 5LMUQ 4GNXB 4FDBA 4DV7L 1VQOA 1L1OB 4JI7Q 2KENA 3RLOA 1YJWA 4A3MH 2R93G 3L7ZC 4LFAL 4C3HH 2EQSA 4HJ8A 1Y14B 2HIXA 2JEBI 5AJ3Q 3S16H 3HKSA 2A19A 2YTYA 1VQ4A 1XMQL 1I6HH 1E1TA 4R4CA 2KCTA 5HY6A 2K75A 2DGYA 1X6OA 1E24A 2RHSB 2EXDA 1IBMQ 1CSQA 3GTGH 4JI0L 5M3FG 3I4NH 3TEHB 2ID0A 1CKNA 1DGSA 4IPGA 1WI5A 1IBLL 2E5LQ 3I56A 1YJ9A 1EIYB 2UUBQ 4DV6Q 3W5OA 3CXCA 2OTJA 3NELA 2JK8A 4LF7Q 1N34Q 3S1NH 2B63G 1HNZQ 1K3RA 2KCMA 1VQNA 4L5SA 4A3JH 2F4VL 2R7ZG 3RLFA 3H3VI 3L2PA 5IP9H 1J5EQ 4JI8Q 3ER0A 4LFBL 2WB1E 3F1ZA 4UP9A 1GM5A 2K5HA 3RN2A 4A3MG 3I4OA 5GAEC 4QIWE 4AIMA 4LF6Q 3VDYA 3T1YQ 3S2DH 4JI3L 1YITA 3B6YA 3OTOQ 4JI5Q 3K0XA 3PUVA 4DV2Q 2Z6KA 4JG2A 2IX0A 2LSSA 4AH6A 1T9HA 4DUYQ 1PV4A 3CCQA 3I7FA 2NZOA 4HIKA 2VQFL 4PZ8A 4LFCL 3CC4A 3CAMA 4NXNQ 4LF8Q 1N33L 3FP9A 3I4NG 4LUZA 2UXCL 2PNHA 1MIUA 1OXXK 4GN4B 4GOPC 4IFDG 1EUJA 3S1QH 1U0LA 2MNAA 1B7YB 2CCZA 3U4ZA 1VQEA 1KXLA 1YBYA 2WP8J 1L1OA 1BKBA 4K0KQ 4JBKA 4A3JG 1N36Q 1XMOQ 1FL0A 4JV5Q 2B29A 1VQIA 4O2DA 3HOWH 2EIFA 5LMUL 1EWIA 2ZJPA 2WAQE 1Q81C 2L15A 1YVCA 4A3KH 1IBKQ 4JI7L 2NVXH 1QVCA 3S1RH 1A62A 1X3GA 1QUQA 2ATWA 3J81i 1VQFA 5AJ3L 5M5XH 5IP7H 3PIPA 2N49A 2AWOA 1OXUA 2WB1G 3CQZH 3UE0A 4X66Q 3F2BA 3CP0A 1Q7YC 1NE3A 1OTCA 2E2IH 2NVQH 1X65A 2N3SA 4QJFA 1HR0Q 1VQAA 1IBML 2VNUD 1VQJA 4YCVA 4IOCA 4WJ3M 4YHHQ 1JMCA 2JA5H 4BXXH 2KBNA 4ALPA 2E5LL 3S17H 2JA6H 2UUBL 1JE5A 2ZM6L 4DV6L 5JEAJ 3UDGA 3E0EA 1QZGA 3HOVH 4LF7L 1N34L 1SN8A 1HNZL 3EBEA 4GKKL 3S14H 3A74A 4YCWA 1JJGA 2GN5A 2D62A 2JA9A 3GD7A 3KJOA 1VQKA 4YCUA 2F4VQ 2OTLA 3RZDH 1WOCA 1V1QA 4DAMA 3A5ZB 4JI8L 5IY0A 1BBWA 5IYBG 1Z47A 5GAHC 4QGUA 4Y7NH 2Y0SE 1PH6A 1I94Q 4DR4Q 3T1HL 4LF6L 1EIFA 3T1YL 3J81j 4JI5L 3OTOL 4DV0Q 4OX9Q 5C44H 4DV2L 1NBWA 1CUKA 5IP7G 1W2BA 1LUZA 2WAQG 4DUYL 1X3EA 4DV1Q 3J7A5 4JBMA 1VQPA 4GNXC 4NXNL 1YHAA 3UDIA 4HJ9A 4LF8L 1VQGA 4OO1G 4OO1I 2N8NA 2JA6G 1Y1VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLX A;  2K14 A;  2K5V A;  1PVO A;  3CD6 A;  4EQ5 A;  2MFI A;  4RG1 A;  3HOU H;  4K0K L;  5C0X J;  4GS3 A;  3M7N A;  1AH9 A;  1K0R A;  1N36 L;  1XNQ Q;  1G51 A;  3AFQ A;  2BA0 A;  3BZC A;  3D31 A;  3IRB A;  1XMO L;  4JV5 L;  1PH2 A;  2K50 A;  2R7Z H;  3CCL A;  2CQO A;  4YWL A;  3DLL A;  1KHI A;  3MEF A;  4DKA C;  1IBK L;  1LM0 A;  4NB3 A;  1OXT A;  2AWN A;  1NJI C;  1J6Q A;  4IO9 A;  5C44 G;  3M4Q A;  4A93 H;  3L0O A;  3HOX H;  1XPO A;  1VQD A;  1CKM A;  1YNX A;  1N8R C;  4IPD A;  2N78 A;  4LF9 Q;  4X66 L;  4A3L H;  2UXB Q;  5GAD C;  1VQB A;  2VY3 A;  1HR0 L;  1KL9 A;  3E9H A;  2JE6 I;  1VQH A;  1QUQ B;  2ZTC A;  1I3Q H;  4GN5 A;  4YHH L;  1K9M C;  1NMG A;  3BU2 A;  1Y1V G;  3CCE A;  2QEX A;  3KF8 B;  1XJV A;  2YYZ A;  1PHJ A;  1KIX A;  2ZM6 Q;  3ULL A;  1HR0 W;  1QVF A;  4JI1 Q;  3HOU G;  3F2C A;  2IT1 A;  4IPC A;  2OQ0 A;  3LGJ A;  3CCU A;  4BY1 H;  3F2D A;  4R1J A;  3GDE A;  3J80 c;  2DUD A;  1I94 L;  3GTP H;  2UXD L;  4X65 Q;  4DR4 L;  3J7Z C;  2K4K A;  1AE3 A;  1EOV A;  3PF4 A;  2ZJR A;  3T1H Q;  4AYB G;  4LF4 L;  4DV0 L;  4OX9 L;  4A93 G;  2CWA A;  1HZC A;  3HOX G;  2R7D A;  3CCR A;  3HKZ E;  5ELO A;  1SLJ A;  4DR3 L;  1E7Z A;  3H15 A;  1KD1 C;  3K80 C;  5C3E H;  1B70 B;  4A3L G;  1MKH A;  4DUZ Q;  3D0F A;  4DV1 L;  2BH8 A;  2WFW A;  3W1B A;  2MO0 A;  3CCJ A;  3EIV A;  4DK6 C;  4ME3 A;  4OWW B;  1V9P A;  4XTC S;  4R4T A;  3ULJ A;  3OW2 A;  4P74 A;  3GTJ H;  3GTO H;  2PI2 E;  3KLW A;  5FLM H;  1LTL A;  2VQE Q;  1YIJ A;  4L5T A;  2F3I A;  1H95 A;  2PMZ E;  4BY1 G;  1GVP A;  1QZH A;  1XNQ L;  1Z9F A;  4QQB X;  2QA4 A;  3F8T A;  2JQO A;  1MJC A;  5GQO A;  4JOI A;  1A0I A;  1IXR A;  4OXP A;  5IT9 c;  2I5M X;  2XTI A;  5C4X H;  5IYB H;  1PH5 A;  1X3F A;  1YEZ A;  4B3S Q;  4X6A H;  2I5L X;  2NN6 G;  2NN6 I;  4P72 A;  4HJ5 A;  1VQ9 A;  2IHF A;  2D0P A;  4IPH A;  5IE8 A;  4GLV B;  3STB C;  2VZA A;  1Q1B A;  3HFZ B;  5C3E G;  4DV5 Q;  1S72 A;  2AHO B;  4LF9 L;  4IOA A;  4KI0 A;  2UXB L;  3ZJY C;  3A0J A;  1K8A C;  2BA1 A;  3FHW A;  4DPG A;  3RN5 A;  1UE6 A;  1Q86 C;  3Q8D A;  1Q8K A;  4KLK A;  4C3J H;  5JEA G;  3S1M H;  2Q2H A;  4P73 A;  4R4Q A;  3PUY A;  4P75 A;  5E7N A;  4DV4 L;  2HHH Q;  4NXM L;  3S15 H;  1PYB A;  3HKZ G;  4C2M H;  5GAG C;  1RIP A;  1FVI A;  2LXK A;  2MO1 A;  2NVY H;  5FLM G;  3PGZ A;  3CMA A;  1C7Y A;  4L5Q A;  1VQM A;  4JI4 Q;  5JJI A;  1HJP A;  4JI1 L;  1RL2 A;  5J3B A;  2GVA A;  2R6G A;  1K73 C;  2FXQ A;  2QGQ A;  2V1C C;  2F52 A;  2PQA B;  4J15 A;  4H02 A;  4JCV E;  4GOP B;  4KHP Q;  3K8A A;  1YHB A;  4NPS A;  4X65 L;  2RF4 A;  3CCS A;  3CF5 A;  5C4X G;  1AE2 A;  2Z6K C;  4BBR H;  3EN2 A;  1U5K A;  2UXD Q;  1XNR Q;  3M4P A;  2VUM H;  1VS0 A;  3STB D;  1BVS A;  4GLA C;  4LF4 Q;  3JC6 6;  1Q82 C;  1N9W A;  3BZK A;  5IYC H;  1G6P A;  4A75 A;  1D8L A;  5ELN A;  5JJK A;  4DUZ L;  4DR3 Q;  1X56 A;  3ULP A;  3PSI A;  1I5F A;  2UU9 Q;  1V43 A;  3RR5 A;  4DNI A;  2ASB A;  1C0A A;  1SE8 A;  4PMW A;  1CKO A;  2RHQ B;  4OON A;  5BR8 Q;  3MXN B;  1L1O C;  4B3T Q;  2VL6 A;  5C0X G;  1TWH H;  4IJL A;  5C0X I;  4A3E G;  5FJ8 H;  3M9B A;  1Q1E A;  1C9O A;  2VQE L;  4YY3 Q;  1XPR A;  2ES2 A;  4POF A;  1WCM G;  2YTX A;  4X62 Q;  1EYG A;  1D7Q A;  1JT8 A;  1X54 A;  1O7I A;  1UWV A;  5IYD G;  1P16 A;  1TWA H;  4DAY B;  1PH3 A;  2HT1 A;  2I5H A;  5DLQ E;  3A5U A;  2Q2T A;  4YWM A;  1HNX Q;  3I2Z A;  4IFD J;  4LUO A;  2YU9 H;  3KFU A;  4R4I A;  2OQK A;  4BBR G;  4UPA A;  4B3S L;  2B3G A;  3TRZ A;  3NEN A;  1TWG H;  3JAM c;  3NEM A;  1G29 1;  2VUM G;  1A63 A;  4BY7 H;  4HID A;  5IYC G;  4A3F G;  1HZ9 A;  4JYA Q;  2JA7 H;  4DK3 C;  4DV5 L;  2IX1 A;  2CFM A;  2IHE A;  4JI2 Q;  5M5Y H;  1WYD A;  3RZO H;  2Y0S G;  5EAY A;  1Q12 A;  3H0G H;  1HNW Q;  4LWC A;  3PF5 A;  3ICE A;  4WJ4 A;  1K8G A;  1M90 C;  4JC0 A;  1PH9 A;  4HJA A;  3PO2 H;  1TXY A;  2HHH L;  1P8L A;  3PO3 H;  2AMC B;  2PI2 A;  4DV4 Q;  1PH4 A;  2PQA A;  5FJ8 G;  3FKI H;  4NXM Q;  2RCN A;  2ZTE A;  3K81 C;  4GOP A;  4JI4 L;  5M3M H;  2IY5 B;  5K36 G;  4DR1 Q;  2K5N A;  3PUW A;  2E2J H;  3GTM H;  1PFS A;  4PZ6 A;  2Q2U A;  3HOY H;  1I50 H;  1PYS B;  3AFP A;  3PUZ A;  1X9N A;  1EQQ A;  1FJG Q;  1ASY A;  3KJP A;  1VCI A;  4KHP L;  1S40 A;  4BA2 I;  1PH7 A;  2Z0S A;  3AEV A;  3CC7 A;  4O0A A;  3OYY A;  3BJU A;  1VQC A;  4DR6 Q;  2A8V A;  1XNR L;  4P71 A;  3UDX A;  2YTV A;  4BBS H;  4BY7 G;  2VW9 A;  1ASZ A;  2JA7 G;  4A3I H;  5LMN Q;  1E22 A;  3I55 A;  1L2F A;  4B3M Q;  3M4O H;  4A3B G;  1SRO A;  4QL5 A;  3H0G G;  4APV A;  3G4S A;  2UU9 L;  2ZJQ A;  1BBU A;  1UE7 A;  3GTL H;  1IL2 A;  1A8V A;  3J80 i;  4JBW A;  2LXJ A;  3PO3 G;  1IYJ B;  3PO2 G;  5BR8 L;  4HIO A;  4A3D G;  3PIO A;  4B3T L;  2Q2I A;  3M85 A;  3FKI G;  4AQY Q;  1YZ6 A;  2YV5 A;  2CWP A;  3RLN A;  2UUC Q;  3I4M H;  4YY3 L;  4OWX B;  3WWV A;  2R7F A;  5M3M G;  4X62 L;  2C35 B;  3RNU A;  4B3R Q;  1N32 Q;  3M3Y H;  2GVB A;  3TS0 A;  1SMX A;  4X64 L;  4XIG S;  3HOY G;  4A3C H;  4LUV A;  4DR2 Q;  1HNX L;  4DV3 Q;  3GO5 A;  2HQL A;  3KF6 A;  1YI2 A;  1VQ6 A;  3GTK H;  1S3O A;  3KDF B;  4JI6 Q;  1UE5 A;  1WFQ A;  3S24 A;  1E1O A;  4KHZ A;  4BBS G;  1SFO H;  5GRO A;  1TWF H;  2K52 A;  3ERS X;  2ZTD A;  3HOZ H;  4LF5 Q;  4RMF A;  1OXS C;  5FLX c;  4JYA L;  2HIV A;  5IWA Q;  4A3I G;  1Y1W H;  4OWT B;  4JI2 L;  1QVG A;  3KOJ A;  1W3S A;  2D0O A;  2A1A A;  3G6E A;  4GN3 B;  2I0Q A;  1HNW L;  1EQR A;  4LNQ A;  3K7A H;  4GNX A;  1MJE A;  4PZ7 A;  5HGQ A;  4EX5 A;  3J81 c;  5C4J H;  4DR7 Q;  1NMF A;  1PA6 A;  3PV0 A;  3I4M G;  1WJJ A;  2E2H H;  4UY8 C;  2UUA Q;  1FGU A;  1YHQ A;  4A3E H;  1J5E L;  4GKJ Q;  1R9T H;  4A4I A;  1SR3 A;  4DR1 L;  5IP9 G;  1X55 A;  1XTD A;  4A3C G;  1WCM H;  1Q46 A;  3AQQ A;  4UP7 A;  3UDF A;  4TQU S;  1L0W A;  1B8A A;  3SGI A;  4DR5 Q;  1SRU A;  4BA1 I;  1HZA A;  2KHI A;  4DV7 Q;  5IYD H;  2NVT H;  1FJG L;  4MTN A;  2H5X A;  1E3P A;  4LFA Q;  2BH2 A;  4PG3 A;  1GO3 E;  4YWK A;  1NTG A;  3G71 A;  1LYL A;  3GTQ H;  2R92 H;  4DR6 L;  4POG A;  1JJC B;  2KHJ A;  3S2H H;  1K83 H;  1CSP A;  3PCO B;  1XMQ Q;  3HOZ G;  2XGT A;  3AYH B;  3CW2 C;  1HH2 P;  1HZB A;  4HJ7 A;  1Y1W G;  2MQH A;  1UEB A;  1KC8 C;  4L5R C;  4A3F H;  5LMN L;  1IZ6 A;  1KQS A;  4B3M L;  3U50 C;  4JI0 Q;  3CCV A;  2OWO A;  5M5W H;  3CC2 A;  1IBL Q;  3CCM A;  3UE1 A;  1GD7 A;  4QY7 A;  2OCE A;  4AQY L;  2UUC L;  2E8G A;  3E9I A;  1TWC H;  2ALY B;  3CPF A;  5LMN W;  3U4V A;  4HIM A;  3NBH B;  3HOW G;  4IFD I;  1VQ7 A;  3TQY A;  3KDF A;  5H1S E;  1M1K C;  4A3G H;  4B3R L;  1OXV A;  1N32 L;  1CKN B;  4LW1 A;  4A3K G;  4JOI C;  1UE1 A;  1VQ8 A;  4DR2 L;  2JA8 H;  1EFW A;  3TRE A;  4DV3 L;  4LFB Q;  4X64 Q;  3G48 A;  4GKK Q;  2R93 H;  2JEA I;  4JI6 L;  4JI3 Q;  3CME A;  4TVA B;  2R92 G;  2JJQ A;  4A76 A;  4Y52 H;  1GKH A;  4MNO A;  1KRT A;  1PH8 A;  4LF5 L;  3KYH C;  4UP8 A;  3DM3 A;  2NZH A;  5IWA L;  3K7U C;  2VQF Q;  4LFC Q;  3KF6 B;  4JBJ A;  1XPU A;  2JA5 G;  3U58 A;  4MZ9 A;  4R4O A;  1JB7 A;  4BXX G;  1N33 Q;  1VQL A;  1VQ5 A;  5M3F H;  2VS1 A;  3W1G A;  3TS2 A;  2CKZ B;  4A3B H;  2UXC Q;  3CPW A;  3HOV G;  4DR7 L;  2AKW B;  1YJN A;  4A3D H;  1PH1 A;  4AYB E;  1KAW A;  3JAM i;  2UUA L;  4GKJ L;  1KRS A;  1NY4 A;  2B63 H;  4A3G G;  1JJ2 A;  4IJH A;  3H3V H;  4DR5 L;  4C3I H;  5JJL A;  2JA8 G;  3PUX A;  5LMU Q;  4GNX B;  4FDB A;  4DV7 L;  1VQO A;  1L1O B;  4JI7 Q;  2KEN A;  3RLO A;  1YJW A;  4A3M H;  2R93 G;  3L7Z C;  4LFA L;  4C3H H;  2EQS A;  4HJ8 A;  1Y14 B;  2HIX A;  2JEB I;  5AJ3 Q;  3S16 H;  3HKS A;  2A19 A;  2YTY A;  1VQ4 A;  1XMQ L;  1I6H H;  1E1T A;  4R4C A;  2KCT A;  5HY6 A;  2K75 A;  2DGY A;  1X6O A;  1E24 A;  2RHS B;  2EXD A;  1IBM Q;  1CSQ A;  3GTG H;  4JI0 L;  5M3F G;  3I4N H;  3TEH B;  2ID0 A;  1CKN A;  1DGS A;  4IPG A;  1WI5 A;  1IBL L;  2E5L Q;  3I56 A;  1YJ9 A;  1EIY B;  2UUB Q;  4DV6 Q;  3W5O A;  3CXC A;  2OTJ A;  3NEL A;  2JK8 A;  4LF7 Q;  1N34 Q;  3S1N H;  2B63 G;  1HNZ Q;  1K3R A;  2KCM A;  1VQN A;  4L5S A;  4A3J H;  2F4V L;  2R7Z G;  3RLF A;  3H3V I;  3L2P A;  5IP9 H;  1J5E Q;  4JI8 Q;  3ER0 A;  4LFB L;  2WB1 E;  3F1Z A;  4UP9 A;  1GM5 A;  2K5H A;  3RN2 A;  4A3M G;  3I4O A;  5GAE C;  4QIW E;  4AIM A;  4LF6 Q;  3VDY A;  3T1Y Q;  3S2D H;  4JI3 L;  1YIT A;  3B6Y A;  3OTO Q;  4JI5 Q;  3K0X A;  3PUV A;  4DV2 Q;  2Z6K A;  4JG2 A;  2IX0 A;  2LSS A;  4AH6 A;  1T9H A;  4DUY Q;  1PV4 A;  3CCQ A;  3I7F A;  2NZO A;  4HIK A;  2VQF L;  4PZ8 A;  4LFC L;  3CC4 A;  3CAM A;  4NXN Q;  4LF8 Q;  1N33 L;  3FP9 A;  3I4N G;  4LUZ A;  2UXC L;  2PNH A;  1MIU A;  1OXX K;  4GN4 B;  4GOP C;  4IFD G;  1EUJ A;  3S1Q H;  1U0L A;  2MNA A;  1B7Y B;  2CCZ A;  3U4Z A;  1VQE A;  1KXL A;  1YBY A;  2WP8 J;  1L1O A;  1BKB A;  4K0K Q;  4JBK A;  4A3J G;  1N36 Q;  1XMO Q;  1FL0 A;  4JV5 Q;  2B29 A;  1VQI A;  4O2D A;  3HOW H;  2EIF A;  5LMU L;  1EWI A;  2ZJP A;  2WAQ E;  1Q81 C;  2L15 A;  1YVC A;  4A3K H;  1IBK Q;  4JI7 L;  2NVX H;  1QVC A;  3S1R H;  1A62 A;  1X3G A;  1QUQ A;  2ATW A;  3J81 i;  1VQF A;  5AJ3 L;  5M5X H;  5IP7 H;  3PIP A;  2N49 A;  2AWO A;  1OXU A;  2WB1 G;  3CQZ H;  3UE0 A;  4X66 Q;  3F2B A;  3CP0 A;  1Q7Y C;  1NE3 A;  1OTC A;  2E2I H;  2NVQ H;  1X65 A;  2N3S A;  4QJF A;  1HR0 Q;  1VQA A;  1IBM L;  2VNU D;  1VQJ A;  4YCV A;  4IOC A;  4WJ3 M;  4YHH Q;  1JMC A;  2JA5 H;  4BXX H;  2KBN A;  4ALP A;  2E5L L;  3S17 H;  2JA6 H;  2UUB L;  1JE5 A;  2ZM6 L;  4DV6 L;  5JEA J;  3UDG A;  3E0E A;  1QZG A;  3HOV H;  4LF7 L;  1N34 L;  1SN8 A;  1HNZ L;  3EBE A;  4GKK L;  3S14 H;  3A74 A;  4YCW A;  1JJG A;  2GN5 A;  2D62 A;  2JA9 A;  3GD7 A;  3KJO A;  1VQK A;  4YCU A;  2F4V Q;  2OTL A;  3RZD H;  1WOC A;  1V1Q A;  4DAM A;  3A5Z B;  4JI8 L;  5IY0 A;  1BBW A;  5IYB G;  1Z47 A;  5GAH C;  4QGU A;  4Y7N H;  2Y0S E;  1PH6 A;  1I94 Q;  4DR4 Q;  3T1H L;  4LF6 L;  1EIF A;  3T1Y L;  3J81 j;  4JI5 L;  3OTO L;  4DV0 Q;  4OX9 Q;  5C44 H;  4DV2 L;  1NBW A;  1CUK A;  5IP7 G;  1W2B A;  1LUZ A;  2WAQ G;  4DUY L;  1X3E A;  4DV1 Q;  3J7A 5;  4JBM A;  1VQP A;  4GNX C;  4NXN L;  1YHA A;  3UDI A;  4HJ9 A;  4LF8 L;  1VQG A;  4OO1 G;  4OO1 I;  2N8N A;  2JA6 G;  1Y1V H; 
#chains in the Genus database with same CATH topology
 4GLX A;  3N41 B;  2F0K A;  2EY6 A;  4RG1 A;  3HOU H;  5C0X J;  3M7N A;  1K0R A;  1N36 L;  3T56 B;  3GIL A;  4DR2 H;  4JV5 L;  2X6G A;  1FD7 D;  3IRB A;  3TIG A;  2F3W A;  3TN2 A;  1V1P B;  4FF3 A;  2R7Z H;  4YWL A;  2QDL A;  1KHI A;  4HR7 A;  4DKA C;  1I6U A;  1OXT A;  3OSO A;  3KLR A;  4HSP A;  1L0X B;  2AWN A;  1J6Q A;  4IO9 A;  3RIZ A;  3M4Q A;  4O1N A;  1YNX A;  5EZY F;  2A5H A;  1D5X C;  1TA8 A;  4LF9 Q;  3H40 A;  4A3L H;  4YQW A;  5KG7 A;  1RCV D;  4RGN A;  2DLN A;  1KL9 A;  3GLK A;  2EJF C;  4GN5 A;  4YHH L;  2R82 A;  4MV8 A;  4DN4 M;  1ICF B;  4RU9 A;  1QIL A;  4MA0 A;  4PWQ A;  3LNN A;  1IW7 D;  1ESF A;  1YNJ C;  2NVX A;  5HV6 A;  2DPJ A;  2B2Y C;  1XJV A;  1PHJ A;  1PX2 A;  4MAM A;  2YS7 A;  3MJF A;  1QVF A;  4JI1 Q;  1RJQ A;  3K0Y A;  2K03 A;  3LGJ A;  4DV7 H;  3QZ7 A;  3F2D A;  3R5F A;  2NU9 B;  2K28 A;  5KFU A;  1K83 A;  2DUD A;  1I94 L;  1HUM A;  4HMI A;  5I6W A;  4DR4 L;  5BN4 A;  4RGO S;  1EOV A;  1PFM A;  4S3S A;  2ZJR A;  3N52 A;  1XMQ H;  4DV0 L;  2JA5 A;  2CWA A;  3P20 A;  3HOX G;  2NN6 H;  2R7D A;  3P1H A;  4DR3 L;  1E7Z A;  3K80 C;  5C3E H;  2BH8 A;  2RBM A;  3W1B A;  3CCJ A;  4ZK9 B;  4YIJ A;  4ME3 A;  3PMF A;  1V9P A;  4XTC S;  3TME A;  5JPN C;  3M9N B;  3OW2 A;  3GTJ H;  3F2U A;  1YIJ A;  2JYO A;  3S1N B;  5EPJ A;  4BY1 G;  1GVP A;  4LH7 A;  1XNQ L;  4LFB H;  2R87 A;  3LWU A;  1WTX A;  2R85 A;  1WTV A;  1M4V A;  1PK8 A;  5IT9 c;  2EYO A;  2XTI A;  1PH5 A;  4X6A H;  5J2T F;  4DL5 A;  4FS1 A;  4UCO A;  3STB C;  2VZA A;  4DNR B;  1VKZ A;  5EKL A;  2AHO B;  5E1F A;  1N33 H;  3A0J A;  2BA1 A;  3KF8 A;  1SYC A;  5KFX A;  1Q86 C;  1DM0 B;  5JEA G;  5FD6 A;  2IBK A;  3PQI A;  5BN3 A;  4UHV A;  2HHH Q;  5GAG C;  3HZX A;  2MO1 A;  2NVY H;  4Q44 A;  2TSS A;  1I4R A;  2L4N A;  2F0V A;  2EXZ A;  3H09 A;  4ED0 A;  3WDN A;  2FXQ A;  2WII B;  2PQA B;  3D4D A;  4GZY C;  2F0M A;  4KHP Q;  3K8A A;  4M9U A;  2RF4 A;  1SXT A;  2Z6K C;  2QYZ A;  4BBR H;  2XVS A;  3GTG A;  5DQG A;  3STB D;  4F4X A;  1NCV A;  3K5I A;  1N9W A;  3BZK A;  2HDM A;  5J2U F;  1EWH A;  1FKA H;  1B1Z A;  4C3J B;  1X56 A;  1EQV A;  1I5F A;  1V43 A;  2N55 A;  3RB0 A;  4CC6 A;  3T5K A;  2ICE C;  3MXN B;  3BG5 A;  2SEB D;  2VL6 A;  1X32 A;  5C0X G;  5JVH 3;  3M9B A;  1CT1 D;  1CI3 M;  2L12 A;  4POF A;  1D7Q A;  5L9X A;  5DGB A;  1JT8 A;  5LXT F;  1O7I A;  1UWV A;  4HNT A;  1P16 A;  4DAY B;  2Q2T A;  1QNU A;  4NKL A;  4YWM A;  1HNX Q;  4RUA A;  4IAL A;  2NTS A;  3T1H H;  1GSO A;  4LF6 H;  5I2Y A;  3NK9 A;  1IYV A;  4JI5 H;  1IHZ A;  4DV2 H;  5KFI A;  1EZ8 A;  2B3G A;  3I91 A;  3JAM c;  1ZYR D;  3NEM A;  4BY7 H;  4HID A;  2LMC B;  5IYC G;  3K5L A;  4A3F G;  1K0S A;  5JPM C;  4JYA Q;  5F9N A;  2RDJ A;  4DV5 L;  2R7N A;  2Y0S B;  4Z9C B;  3RZO H;  5M5Y H;  1H9R A;  2X0S A;  1WYD A;  2KCC A;  4HQ6 A;  4LF8 H;  4LK1 C;  5EAY A;  3H0G H;  1HNW Q;  1DXM A;  1X3P A;  3IG0 A;  1M90 C;  1G2S A;  2JXM B;  3PO3 H;  4ECZ A;  3AMU A;  1FNV A;  1P8L A;  2AMC B;  1PRT D;  4Q43 A;  1N36 H;  4JV5 H;  4YR3 A;  5K36 G;  4IRD A;  1J8I A;  4FXG C;  4MN3 A;  1X9N A;  3RV4 A;  3RV3 A;  2O5J C;  3GIK A;  5EBD A;  4BA2 I;  1D1K A;  3EPG A;  3KAJ A;  3CC7 A;  4O0A A;  2G9D A;  5KFQ A;  4DR6 Q;  4JV0 A;  3Q23 A;  3UDX A;  2K32 A;  4BBS H;  4CJ0 B;  1KAA A;  1SYE A;  2JA7 G;  4HCS A;  2GA4 B;  4ULL A;  2XCP A;  4A3I H;  3NBH A;  4ECV A;  2GPS A;  4YHH H;  1SRO A;  4APV A;  3JSL A;  4CKC A;  2UU9 L;  1S68 A;  1BBU A;  2AQ2 B;  3C0F B;  5CV5 A;  1IL2 A;  1C3O A;  2LXJ A;  3PO2 G;  3E5S A;  3MTS A;  3PIO A;  4B3T L;  3Q8S B;  2Q2I A;  2BCO A;  4ZKB B;  2CWP A;  4YY3 L;  4Q0F A;  3CRL C;  5KFY A;  4QWB A;  4U7C A;  3RD4 A;  1VMP A;  2R8G A;  2XNA C;  3TP6 A;  4X64 L;  1CHP D;  3HOY G;  1I94 H;  4BWS C;  2NU7 B;  2MGS A;  4DV3 Q;  1W6K A;  4DR4 H;  5CV6 A;  3X3M A;  3GTP B;  4EYI B;  5GON F;  4K2L A;  3GTK H;  4FXD A;  3L9A X;  3H4B A;  4RZQ A;  4DV0 H;  4EBC A;  3MZ5 A;  4ZUJ A;  3S24 A;  1PZJ D;  4DR3 H;  5KG2 A;  4RMF A;  2QCP X;  4I4T F;  3PVX A;  3T16 A;  4HMJ A;  3M4O B;  3QFF A;  1EL0 A;  4OGQ C;  2R8J A;  5IT9 W;  1TY0 A;  4JI2 L;  3BZD B;  2A1A A;  4ECY A;  5IT9 E;  4LNQ A;  4GNX A;  1MJE A;  1PTO B;  4EX5 A;  4DR7 Q;  2NUA B;  3HKZ B;  4RFB A;  1PA6 A;  3I4M G;  1OWT A;  1XNQ H;  1R9T H;  1EYZ A;  1TY2 A;  1SR3 A;  4C1N K;  3DM1 A;  5IP9 G;  1HA6 A;  5KYI A;  4QQB X;  3E0J A;  1F2Y A;  1H9M A;  4UP7 A;  1B8A A;  1S5E D;  1C4Q A;  2JA7 A;  2NVT H;  1GLV A;  5H80 A;  2H5X A;  4LFA Q;  2FMC A;  3VMM A;  1A2T A;  4YWK A;  2A69 C;  5G3L F;  5C4X B;  1T36 A;  4DU9 A;  4POG A;  3BVG A;  3PCO B;  5BN5 A;  5BMV F;  1F9P A;  5KYL A;  4ZQ3 A;  4HJ7 A;  1Y1W G;  1UEB A;  4A3F H;  2GPW A;  4V19 0;  1IZ6 A;  4RNO A;  3OIQ A;  1BCP C;  2NU8 B;  4WRD A;  4GC7 A;  3GTM A;  3S1M B;  4J9N A;  4YBZ B;  1I50 A;  1SE2 A;  3BYT B;  3CCM A;  3UE1 A;  4RKL A;  4ZQI A;  2OCE A;  1BF4 A;  4LH6 A;  2FE3 A;  2K01 A;  4NMZ A;  2ALY B;  4IFD I;  1WCM B;  4G57 A;  4FU0 A;  5H1S E;  1M1K C;  4B3R L;  3BDC A;  1OXV A;  1VBG A;  3RAX A;  4A3K G;  2ICI A;  1UE1 A;  4J9S A;  2OH2 A;  4QUC A;  4XYL B;  5CV8 A;  2F0F A;  2R93 H;  2CVR A;  2KSW A;  3SK4 A;  2PYK A;  2PBZ A;  4RB0 A;  3GTL A;  1T5X D;  3BA9 A;  5FPR A;  4L8J A;  4IUR A;  4Y52 H;  1B53 A;  2VUM B;  1SND A;  1PH8 A;  4DL6 A;  3BQ2 A;  4LF5 L;  1B2T A;  2PN1 A;  1E2W A;  2I46 A;  4UP8 A;  3WO0 A;  4JBJ A;  1S0M A;  3GTO A;  3U58 A;  1JB7 A;  2DPI A;  5DQI A;  3N43 B;  2C5C A;  1UUP A;  2RDG A;  4J1M A;  3JAM W;  3K5M A;  2UXC Q;  3MXU A;  1YNN C;  5KND A;  4K8J A;  3TS2 A;  3CPW A;  3HOV G;  1TWH B;  1E2V A;  3JAM E;  5EWF A;  1A9X A;  1PH1 A;  4CDE C;  4M8A A;  3JAM i;  4GKJ L;  5BPH A;  4TQR A;  1JJ2 A;  3ZYY X;  2C9O A;  1TWA B;  4DR5 L;  5JJL A;  2EYM A;  2YU9 B;  1VQO A;  4CC5 A;  1Y1W A;  2UVV A;  1YJW A;  5EWG A;  4GC6 A;  1PLF A;  1LT5 D;  2NB0 A;  1B4O A;  2JEB I;  4HJ8 A;  2LKV A;  5J22 A;  1BBX C;  4LMY A;  1TWG B;  3HKS A;  1VQ4 A;  2K5Q A;  3KLS A;  2KED A;  4R4C A;  2KCT A;  5HY6 A;  2DGY A;  3I4L A;  2R6F A;  4DFA A;  2PZT A;  2SNS A;  1CSQ A;  3C2P A;  1F2M A;  5M3F G;  1DGS A;  5EPK A;  1WI5 A;  4I65 A;  2UUB Q;  3WOF A;  1E4F T;  1RYR A;  2OTJ A;  4LF7 Q;  1ILQ A;  1N34 Q;  2B2U C;  2KQ3 A;  3NSW A;  3S1N H;  1ILP A;  5M3M B;  3FDS A;  1K3R A;  4IRC A;  3K5N A;  5I47 A;  4JK1 C;  2EZV A;  3L2P A;  5IP9 H;  4LSX A;  4UP9 A;  4OIK A;  3MC0 B;  1JOK A;  3ERQ A;  2RGV A;  2I87 A;  4C3H G;  2W57 A;  3RUZ A;  4AIM A;  1BNZ A;  1NUC A;  3ORQ A;  4DK1 A;  4H0L C;  3PUV A;  2A6E C;  1R4Q B;  3T53 B;  4AH6 A;  2HVQ A;  2W9C B;  5DAU A;  1XXG A;  2FKL A;  3I7F A;  4MV4 A;  1TWC A;  2UU9 H;  4LFC L;  5IGC A;  3CAM A;  3MVV A;  4NXN Q;  3FP9 A;  4B3T H;  5JUM A;  2RDI A;  3T5H A;  2MNA A;  4YY3 H;  1H9K A;  4Q8F A;  2A74 C;  5KGU A;  1GUW A;  1HTL D;  1BKB A;  2EE1 A;  4JW0 A;  4X64 H;  2KOL A;  5C8Y F;  1MI2 A;  4X3T A;  3M4I A;  4GKK H;  4CDD C;  3I12 A;  2DJG C;  4RUC A;  5CR3 A;  5LMU L;  1GSH A;  1Q81 C;  4A3K H;  1IBK Q;  1QVC A;  4K2K A;  1TAE A;  3JZI A;  1X3G A;  2W6Z A;  5EJW A;  1BQQ T;  4R9W A;  5AJ3 L;  3RBD A;  5HBR B;  1TWF B;  5IP7 H;  4HR7 B;  3HOZ B;  4JI2 H;  4CGY B;  2VB3 X;  2Z1C A;  4UAI A;  5K2M A;  3QO2 A;  2HD3 A;  4UCT A;  1IBM L;  4WJ3 M;  4YCV A;  3MAQ A;  4IOC A;  1C8C A;  4QWE A;  1JMC A;  2IMW P;  3K7A B;  3SK6 A;  3K3P A;  3H6M A;  2E5L L;  5C4J B;  1IKL A;  1ZKO A;  4DV6 L;  2E75 C;  2WKC A;  2CW0 C;  3HOV H;  2EY1 A;  1HNZ L;  3EBE A;  3HOW B;  4QWA A;  5ELD A;  5KFL A;  4OL7 A;  2F0T A;  3A74 A;  1VQK A;  2F4V Q;  1QCB D;  1WR2 A;  1WOC A;  5IY0 A;  3A5Z B;  3DXJ C;  4G4K A;  1BBW A;  5IYB G;  1RD9 D;  4F87 A;  3BQ0 A;  3GTQ B;  5KKN B;  1ZET A;  4OX9 Q;  1NBW A;  1CUK A;  1K83 B;  4MV1 A;  2PZU A;  1LUZ A;  4O4H F;  4DUY L;  5CAE B;  2B2T A;  2F0E A;  1WTQ A;  4DV1 Q;  2Q8I B;  3G8C A;  1VQP A;  4GNX C;  2JA5 B;  5KFZ A;  1FNW A;  5KT5 A;  3PR4 A;  4NW2 A;  1WTW A;  5KFV A;  4KN4 C;  4JUZ A;  2PVP A;  4TQS A;  3HRZ C;  1Y1V H;  4XQQ A;  2K14 A;  2K33 A;  1B6R A;  4RAU C;  3FDT A;  3NP8 A;  3RGZ A;  1JOO A;  4B3R H;  1PFB A;  3S14 B;  4EQO A;  1J5E H;  4EQ5 A;  4K0K L;  4GS3 A;  2O5I C;  3BZC A;  3AFQ A;  2BA0 A;  3D31 A;  1PZK D;  3OOC A;  1XMO L;  5CC4 A;  1PH2 A;  2K50 A;  4FBT A;  2JA8 B;  4U68 A;  2CQO A;  1EZ6 A;  3DLL A;  3LML A;  5KX5 F;  2YYA A;  3MEF A;  5CA1 F;  2MHV A;  1HRJ A;  2XIG A;  5F2D A;  1CTM A;  2I80 A;  5KFJ A;  5C44 G;  1STG A;  4LF5 H;  2YZM A;  1VF5 C;  5EBC A;  1XPO A;  4ED6 A;  1VQD A;  2DZD A;  4IPD A;  2N78 A;  4X66 L;  1MSH A;  4I7A A;  5EPL A;  1VQB A;  2VY3 A;  5GAD C;  1HR0 L;  5KFO A;  2JE6 I;  3TIN A;  1VQH A;  1DON A;  2EYP A;  3V96 A;  4GKJ H;  2PZW A;  2EY2 A;  3SR1 A;  3KF8 B;  2AUK A;  1KIX A;  2ZM6 Q;  3ULL A;  1HR0 W;  2R7K A;  3HOU G;  3OSN A;  4DR5 H;  3F2C A;  1ET9 A;  2R92 A;  4R1J A;  2F4I A;  1V4Y A;  2AGO A;  1EUC B;  3CQZ A;  3GDE A;  5KT2 A;  2DWC A;  3GTP H;  2E2I A;  2IL8 A;  1GHK A;  2K4K A;  5E4X A;  3R5X A;  1AE3 A;  4IUU A;  1HQR D;  3BA8 A;  5AFW A;  1STA A;  3S16 B;  3QWN A;  3CCR A;  1KD1 C;  3TZU A;  3H15 A;  1I6H B;  5KFE A;  1B70 B;  4A3L G;  2MUY A;  4I7Z C;  4RHS A;  1B6S A;  4KJN A;  3E5N A;  4FF1 A;  1HHV A;  3GTG B;  3EIV A;  5TSS A;  3T5J A;  1GXD C;  1TVX A;  3I4N B;  1PTO H;  4FM9 A;  4ILW A;  4IUQ A;  2W7O A;  2MJ8 A;  2FIN B;  1LTL A;  5FLM H;  3JRX A;  2W9B B;  4L5T A;  4ETS A;  1M7J A;  2PMZ E;  4A3J B;  3H94 A;  2YL2 A;  3F8T A;  5A2Q L;  1GJX A;  2LFN A;  3NXW A;  4R8I A;  1B04 A;  1MJC A;  2W8L A;  2F0Q A;  2K5D A;  4ID6 A;  1A0I A;  1IXR A;  4OXP A;  3NHH A;  5L37 A;  2I5M X;  5C4X H;  5IYB H;  1Z7T A;  1X3F A;  4B3S Q;  4NLG A;  2I5L X;  2NN6 G;  1Z2N X;  4HJ5 A;  1V51 A;  2YZN A;  5A2Q W;  4LFC H;  1PRT F;  4GLV B;  2SDF A;  1Q1B A;  3HFZ B;  5C3E G;  1S72 A;  1K1Q A;  1STB A;  2UXB L;  3ZJY C;  5A2Q E;  4QIW B;  2WE6 A;  2BR0 A;  1WTR A;  3S1M H;  2Q2H A;  2R7Z A;  4R4Q A;  3PUY A;  4P75 A;  5FO8 B;  4C2M H;  1STE A;  4IWY A;  3PGZ A;  2L11 A;  4DLK A;  1SMY D;  1GGO A;  3G6X A;  1PMR A;  1S0O A;  4LJZ C;  5LMU H;  1EYA A;  4J15 A;  4JCV E;  4ZAI A;  3H20 A;  4X65 L;  4TUY F;  3IAY A;  3ONA B;  4CHT B;  1I4X A;  2UXD Q;  2MP1 A;  1U5K A;  4CDF C;  1XNR Q;  1M0W A;  4KN7 C;  1PFN A;  3M4P A;  4X3S A;  1EIG A;  2VUM H;  5A35 A;  1BVS A;  4ABN A;  3VR4 A;  2WAQ B;  5KNB A;  3C3L A;  1IBM H;  4DUZ L;  5HGT A;  2RCF A;  2I07 B;  4DL2 A;  2F0G A;  2E5L H;  5BR8 Q;  2CHB D;  3OPO A;  4DV6 H;  1TWH H;  5C0X I;  4MV9 A;  3WNZ A;  1HNZ H;  1E4G T;  1C9O A;  2F0O A;  2VQE L;  2V4R A;  4X62 Q;  2FLL A;  2YTX A;  4Q0Y A;  1KBL A;  1X54 A;  1IW7 C;  1TWA H;  2I5H A;  5DLQ E;  3OUZ A;  2ALZ A;  5L1K A;  2FJ2 A;  4UCV A;  4LUO A;  2YU9 H;  4J8Q A;  3RBE A;  2K6A A;  4R4I A;  2O2L D;  1ZHQ A;  1GUS A;  1C30 A;  2WB1 A;  4F4W A;  3NTK A;  4BBR G;  4MV7 A;  2V4D A;  3TRZ A;  3NEN A;  1TWG H;  3OHX C;  4DUY H;  1EEF D;  1G29 1;  2VA3 A;  1CQV A;  3GTJ A;  3EA6 A;  1AFP A;  2ZDQ A;  4ME6 A;  1EUD B;  3EJI A;  3JRW A;  4LWC A;  3PF5 A;  3V4S A;  4WJ4 A;  2L0C A;  1K8G A;  4J9L A;  3RB3 A;  4OEM B;  4K0K H;  2RCN A;  2WAC A;  3K81 C;  4GOP A;  4JI4 L;  2DY7 A;  1CZW A;  1XMO H;  5M3M H;  2PMZ A;  2K5N A;  5LHY 1;  2Q2U A;  3FMA A;  3AFP A;  4CJ2 C;  4QW8 A;  1FJG Q;  1ASY A;  3RFC A;  1PH7 A;  1CQJ B;  3IFD A;  5KIX A;  1HCZ A;  2X69 A;  3OYY A;  2HVR A;  4A93 B;  4AYB B;  4P71 A;  2B2T C;  1ICW A;  2FP4 B;  4J0M A;  4BY7 G;  4X66 H;  4U6P A;  3KUP A;  2NVY A;  2MPM A;  1ASZ A;  1HR0 H;  1EY9 A;  5DM7 3;  1L2F A;  5DG8 A;  1Q3L A;  3H0G G;  4WOR A;  3ETH A;  3PO3 G;  1HXY D;  1IYJ B;  1SNC A;  2D5D A;  3LWE A;  2G9H D;  4N8F A;  3AU7 A;  4AQY Q;  3G6Y A;  1UC8 A;  1ESR A;  3T4A C;  4R8U B;  4YJ3 F;  2EPB A;  2E2J B;  4ME5 A;  3RNU A;  5IYZ F;  1TS4 A;  3VYT A;  1SMX A;  4XIG S;  3SK8 A;  2N88 A;  4DR2 Q;  2GLT A;  3GO5 A;  2HQL A;  1MD2 D;  1BCP F;  3U9S A;  4Q5V A;  1VQ6 A;  4IR1 A;  1UE5 A;  1E1O A;  4KHZ A;  5FLX L;  1M8A A;  2F3V A;  4EQP A;  4BBS G;  1LV9 A;  4IN3 A;  1TWF H;  2K52 A;  3HOZ H;  3MFI A;  3A8K E;  4U67 3;  1OXS C;  1EU4 A;  1CA5 A;  4A3I G;  2R84 A;  4OWT B;  3S9W A;  3HP3 A;  4ZOL F;  4J9P A;  2NBF A;  5FLX W;  2HCI A;  3K7A H;  1AUV A;  2VXW A;  4PZ7 A;  3QOJ A;  5C4J H;  4ZRZ A;  1KJI A;  1RJR A;  3GTO B;  4UY8 C;  4DR1 L;  1I7N A;  4FF4 A;  4YB8 B;  3UDF A;  4TQU S;  1PTO D;  2F0H A;  4ECQ A;  4DV7 Q;  2KHI A;  1KJJ A;  2SNM A;  1JR0 D;  4ED2 A;  1E3P A;  5CV4 A;  4IZ8 A;  3GII A;  2BH2 A;  3H0G A;  3G71 A;  4XQN A;  1LYL A;  4EQN A;  3GTQ H;  2KHJ A;  4J9R A;  1K83 H;  3GV5 B;  1CSP A;  1Y8O B;  1XMQ Q;  1I3Q A;  1HNW H;  2UXB H;  3AYH B;  1HZB A;  1KC8 C;  1ZYR C;  4L5R C;  5LMN L;  4ED1 A;  4B3M L;  5I6Y A;  1BXR A;  4RKB A;  5D3I B;  4JI0 Q;  2EDG A;  1WVL A;  3CC2 A;  4MHE A;  1GD7 A;  4A3E B;  4N9T A;  3ETJ A;  2UUC L;  2E8G A;  5LMN W;  1SE3 A;  4E4T A;  1UNS A;  4MTE A;  3AB9 A;  1VQ7 A;  3KDF A;  1N32 L;  1EYD A;  1EY7 A;  1PRT C;  2RSN A;  2C00 A;  5T1G A;  1VQ8 A;  2JA8 H;  2DN8 A;  3QB3 A;  2DY8 A;  1EFW A;  4LFB Q;  3BAB A;  5KG3 A;  2B2U A;  1GSA A;  4X65 H;  5FOB B;  3G48 A;  3VPC A;  2J4X A;  4KMU C;  2E74 C;  4JI6 L;  1RK5 A;  1TII D;  4HNU A;  5LYJ F;  3M7G A;  1F2L A;  2FPP B;  5CMD A;  5LL6 S;  4MNO A;  4DUZ H;  5IGG A;  5E3F A;  2VQF Q;  5IWA L;  3K7U C;  4TV9 F;  3KF6 B;  4F8M A;  1SEI A;  1A3V A;  5M5W B;  1N33 Q;  4XXE A;  4IRK A;  5D1P A;  1WTH A;  1HFG A;  3V6K A;  1SDF A;  2G5D A;  2VQE H;  1TWC B;  4OHJ A;  1CA6 A;  3GTK A;  4ZUI A;  4AYB E;  2UUA L;  1I6V C;  2BQU A;  4IJH A;  3H3V H;  2R7M A;  1BGW A;  3PUX A;  1HQM C;  1JOQ A;  2KEN A;  3P75 A;  2J6T A;  2R93 G;  4MV6 A;  2HIX A;  2IA6 A;  3S16 H;  1MSG A;  1I6H H;  2NUC A;  1E1T A;  4NDX A;  5KG0 A;  1R9T A;  1ENF A;  1TS3 A;  1ZXT A;  2H1E A;  1CE8 A;  4A3B B;  3BAA A;  3KTM A;  3GQC A;  3GTG H;  2ASD A;  3I4N H;  2B8G A;  4HCE A;  3TEH B;  4MA5 A;  4A3D B;  1IBL L;  1JQY D;  2EVB A;  4JI4 H;  3W5O A;  3FKI B;  3CXC A;  3N42 B;  3NEL A;  5CV7 A;  2JK8 A;  2EOT A;  2KCM A;  4MTK A;  1HPC A;  3LX0 A;  4KTA A;  3SDZ A;  4A3J H;  4L5S A;  2F4V L;  3MR2 A;  3PW4 A;  4LFA H;  2B2W A;  2A73 B;  1RK6 A;  4EGQ A;  1GUN A;  3ER0 A;  1GM5 A;  2VUG A;  1TS5 A;  3I4O A;  4GKK L;  4LF6 Q;  1IOV A;  4JI3 L;  1YIT A;  2WYO A;  2RA4 A;  3B6Y A;  3OTO Q;  4JI5 Q;  4DV2 Q;  2XD4 A;  2IPK D;  4OIJ A;  3Q2O A;  2TMP A;  2F0U A;  2W7P A;  3K5O A;  4PZ8 A;  1MGS A;  3C46 A;  4LF8 Q;  1W96 A;  2XCA A;  1QJO A;  4LUZ A;  2P0A A;  1MIU A;  2V4Q A;  4GOP C;  3S1Q H;  2CCZ A;  1B7Y B;  3U4Z A;  1VQE A;  2F03 A;  2R93 A;  4XT3 B;  4ECW A;  3D6W A;  4JBK A;  3EFX D;  1N36 Q;  4JV5 Q;  1SEB D;  3PR5 B;  1VQI A;  2EIF A;  3S2D B;  4RNM A;  3OSP A;  4JI7 L;  5EQ0 A;  3QZ8 A;  3I3C A;  1IOW A;  5DGA A;  1BDO A;  1A62 A;  3OMC A;  5ELE A;  1VBH A;  1ZEQ X;  1VQF A;  1LTG D;  1SFO B;  2SOB A;  1ULZ A;  4IUP A;  4DAV A;  3PW0 A;  2N49 A;  2AWO A;  1OTC A;  1Q7Y C;  1S5D D;  1NE3 A;  2Z8L A;  2VR1 A;  2N3S A;  4FVM A;  1B3A A;  1S5B D;  2VPS A;  2JEF A;  1VQJ A;  2JN4 A;  3DWP A;  4YHH Q;  1JKJ B;  4OO1 H;  4RAY A;  2CZG A;  1T5E A;  1XDN A;  2JA6 H;  1H9S B;  1JE5 A;  2ZM6 L;  2RSO A;  3UDG A;  4DR1 H;  3T51 B;  1JB3 A;  4LSA A;  2JEI A;  2QKI C;  4YCW A;  2GN5 A;  2D62 A;  3GD7 A;  4B08 A;  4YCU A;  4ECX A;  5GAH C;  1F9Q A;  1UAP A;  1J5E L;  4JI8 L;  1PH6 A;  1I94 Q;  1Z47 A;  4QGU A;  2M05 A;  2Y0S E;  3R8B A;  4DR4 Q;  4UFZ A;  1L0Y B;  1SNP A;  3T1Y L;  3J81 j;  2R92 B;  2AQ4 A;  4DV0 Q;  2K5W A;  2I8C A;  3KHL A;  3CQZ B;  1N48 A;  5IP7 G;  5LMN H;  4B3M H;  1X3E A;  1LTI D;  5I4D A;  4UCR A;  4X3K A;  4C3J G;  5BPF A;  4Y8V B;  5JVD F;  4JBM A;  5EOY A;  4YR2 A;  4IR9 A;  4XYO A;  4R7R A;  2FFK B;  3KXY T;  2W6O A;  4JV2 A;  1JDE A;  4M1U B;  1N34 H;  2UUC H;  3NWT A;  3K57 A;  4G7H C;  2K5V A;  1PVO A;  1N32 H;  2IWH A;  3NTH A;  3CD6 A;  2FB9 A;  1K3B C;  4A3G B;  1XNQ Q;  1G51 A;  4MV3 A;  3MFH A;  2W6N A;  1JWS D;  1RHP A;  5KFG A;  4JI6 H;  2RGR A;  2IW3 A;  3GV3 A;  3TII A;  4XX0 B;  4EGJ A;  1NJI C;  1JCK B;  4A93 H;  1U9R A;  4QF4 A;  3I72 A;  3L0O A;  1PRT B;  1G6Z A;  4NXN H;  5IWA H;  1CKM A;  5KFS A;  4J9Q A;  4B9X A;  3C1E A;  3RB6 A;  4H44 C;  1JLL B;  2E2H A;  5FO7 B;  1B9N A;  1QUQ B;  1EFI D;  2F0I A;  1XTC D;  2ZTC A;  1SYF A;  3WOE A;  1A6X A;  4N8X 1;  1Y1V G;  2UUA H;  1LAB A;  2NZ1 D;  3CCE A;  2Q8R E;  4ED7 A;  2AUJ D;  4I50 F;  3OMG A;  5KG4 A;  2B63 B;  2R7Z B;  3BVZ A;  3J80 L;  3CCU A;  3NBI A;  3A7A B;  4C3I B;  5KFB A;  2ZDG A;  2UXD L;  5KT4 A;  4JVZ A;  4A3M B;  4O3Q A;  3EQL C;  4F7X A;  2FLN A;  3J80 W;  1W6J A;  3MXN A;  1HZC A;  3FPU B;  2VPQ A;  4KKU A;  5C5J A;  3HKZ E;  5ELO A;  1SLJ A;  3J80 E;  3KHH A;  1QOH A;  1TKW B;  3D0F A;  3RGX A;  4DAY A;  1IBL H;  3QOL A;  3W3A A;  3R2I A;  4R4T A;  5KFN A;  1F77 A;  4P74 A;  1WD1 A;  4ZHQ F;  1SJE D;  2XN9 C;  1FR3 A;  3KLW A;  1I4H A;  3GTO H;  2F4V H;  4O2B F;  2BE5 D;  2F3I A;  2FK1 A;  3RTX A;  1H95 A;  5FK9 C;  3Q24 A;  1QZH A;  1Z9F A;  4K14 A;  1UNN C;  2FLP A;  2JQO A;  3VYS A;  5GQO A;  4JI3 H;  2J6U A;  1K8O A;  3I90 A;  3OUU A;  1KAB A;  3UFX B;  3Q22 A;  5IGE A;  5J1Z A;  3D8G A;  2BOS A;  2NN6 I;  4P72 A;  1VQ9 A;  1Y1V A;  2IHF A;  2PW5 A;  5IE8 A;  5IIF A;  2WB1 B;  4R8N A;  4PQX A;  4DV5 Q;  4IOA A;  4LF9 L;  1VAJ A;  3FHW A;  4DPG A;  1UE6 A;  3Q8D A;  1Q8K A;  4C3J H;  2RDF A;  5E7N A;  4P73 A;  3GTJ B;  1BUV T;  1U4M A;  1PYB A;  3HKZ G;  3SE0 A;  5IGD A;  3ND9 A;  1FVI A;  3CMA A;  2XCL A;  4O3N A;  5FLM G;  1C7Y A;  3HEJ A;  4J9O A;  1GYF A;  2JEG A;  5D3D A;  2B8F A;  2F0W A;  1EY6 A;  1VQM A;  1AZQ A;  2B2W C;  2Z4H A;  3RJ0 A;  1HJP A;  4JI1 L;  1ROD A;  1RL2 A;  2CH4 W;  5J3B A;  5D1O A;  5KRU A;  1PYW D;  2DJF C;  2BQ3 A;  4EBD A;  4JI7 H;  2M2L A;  2V1C C;  2F52 A;  3BG3 A;  1S03 G;  3N6X A;  4GOP B;  1YHB A;  4NPS A;  1CZG A;  1U4R A;  3CF5 A;  2NVX B;  4ECT A;  5C4X G;  1AE2 A;  2R61 A;  3S1R B;  1D5M C;  2F0N A;  1SNO A;  5DLG A;  1K8M A;  2ZXO A;  5M5X B;  1VS0 A;  2KHS A;  3KK7 A;  4GLA C;  3JC6 6;  2IX3 A;  1Q82 C;  4LF4 Q;  2FMA A;  3BQ1 A;  1N56 A;  5KG1 A;  1HUN A;  3GIJ A;  3VR2 A;  5ELN A;  4HN7 A;  4PV1 C;  3GIM A;  3ULP A;  3VPB A;  3PSI A;  2UU9 Q;  3BYY B;  3RR5 A;  4DNI A;  2ASB A;  1SE8 A;  1C0A A;  4PMW A;  1CKO A;  1B44 D;  2RHQ B;  3HS0 C;  3MWE A;  4FF2 A;  2ZM6 H;  1L2Z A;  3V6H A;  4B3T Q;  3Q8R B;  3GTP A;  5DLF A;  5FJ8 H;  1E4E A;  1XPR A;  4YY3 Q;  1G91 A;  1WCM G;  1EYG A;  3V4Z A;  3TSS A;  2ZXP A;  3R93 A;  2RQX A;  5IYD G;  1PH3 A;  2HT1 A;  3SE7 A;  4JI8 H;  4UCU A;  1GUO A;  3I2Z A;  2J0T D;  1BCP B;  3CHB D;  3KFU A;  2W8K A;  3T1Y H;  4Y7N B;  4HED A;  3X3N A;  1KEE A;  2W6P A;  1LTB D;  2VUM G;  1A63 A;  4PDB A;  1FYC A;  3HKZ A;  1TQO A;  3HGB A;  1HZ9 A;  1SAP A;  5T1I A;  2PCF B;  4C5C A;  4EEQ A;  3OWE B;  4JI2 Q;  2H4O A;  3CU7 A;  1LTA D;  3MXP A;  3CVZ A;  4L1K A;  4M7E A;  1LLR D;  2HHH L;  1X3Q A;  4DV4 Q;  4NXM Q;  4YAK B;  1EOT A;  3FKI H;  3GIP A;  1J9O A;  5COR A;  1G8Z D;  4J9K A;  2IY5 B;  1EU3 A;  1BOS A;  1H9J A;  2OLS A;  3VYR A;  3GV7 B;  1RKN A;  1PFS A;  4PZ6 A;  1Q8I A;  3PUZ A;  1KLG D;  1AEX A;  3SK5 A;  1EQQ A;  1T3N A;  3M9O B;  1VCI A;  4KHP L;  4PMB A;  1EY5 A;  2K7V A;  3G6V A;  1LT4 D;  3UQ8 A;  1DCZ A;  2Z0S A;  3AEV A;  3EVQ A;  3BJU A;  1O7L A;  3NQI A;  1BO0 A;  1QG7 A;  2YTV A;  3HOX B;  4C2M A;  4G3I A;  3RZO B;  5CB4 F;  1E22 A;  3I55 A;  3LP8 A;  3M4O H;  4QL5 A;  3A7L A;  3PN1 A;  1DOL A;  5KG5 A;  1I3Q B;  4HIO A;  2IJ0 A;  3MWM A;  2RKS A;  2YV5 A;  3GID A;  3DUZ A;  3PZP A;  5FD5 A;  2ZDH A;  4OWX B;  5M3M G;  2C35 B;  4B3R Q;  2KVM A;  4A2B A;  1QE6 A;  4BY1 B;  4A3C H;  2EYL A;  3FVQ A;  4O3O A;  1SMY C;  3R3O A;  1HNX L;  5DQH A;  3PW5 A;  2UXD H;  1JIC A;  3RUP A;  2AU0 A;  1C48 A;  4O3P A;  4C56 C;  3KHR A;  1CFM A;  1S3O A;  3KDF B;  2R8H A;  1DD2 A;  1WFQ A;  3OW7 A;  2QK4 A;  1SFO H;  1WH2 A;  2KUM A;  3ERS X;  1TWH A;  2ZTD A;  3KHG A;  4LF5 Q;  1CS0 A;  4L63 B;  5FLX c;  4JYA L;  1SYG A;  1QVG A;  3KOJ A;  3TBI B;  1W3S A;  2KCN A;  4DXG A;  4RCO A;  3J81 L;  1WTO A;  4TRD A;  3G6E A;  2I0Q A;  2PPB C;  1STY A;  1HNW L;  4RNN A;  5KFP A;  2L5T A;  1SBB B;  4JV1 A;  2YU9 A;  5EDW A;  3R2T A;  5HGQ A;  4APM A;  1OO9 B;  4TV8 F;  1IL8 A;  1DOK A;  3Q0A A;  4GKJ Q;  1YHQ A;  1DYQ A;  4FP5 D;  4A4I A;  3F8N A;  3N6R A;  3J81 W;  1AP0 A;  1TWG A;  1WCM H;  4DR5 Q;  1LAC A;  1QB5 D;  1L0W A;  5KEE A;  1SRU A;  5IYD H;  1HZA A;  1S4Z A;  5LL6 X;  3GTK B;  3TP8 A;  3QIA A;  4ZCK A;  1WTP A;  2J7Z A;  3TQT A;  2AQ1 B;  4PG3 A;  5DEH A;  4DXF A;  1NTG A;  5KFT A;  2R92 H;  4DR6 L;  3URY A;  2A68 D;  3FEW X;  1F9R A;  1JJC B;  3A8I E;  1ENC A;  1O75 A;  3HOZ G;  2B39 A;  4LF9 H;  2XGT A;  1ZHS A;  2XGQ A;  3CW2 C;  1HH2 P;  5C5M A;  1GUT A;  4H13 C;  3W2D A;  2OWO A;  3S15 B;  2HJW A;  4B9W A;  2KEE A;  4QY7 A;  4JI1 H;  1LT3 D;  3E9I A;  3CPF A;  4NP5 A;  4EVO A;  3NBH B;  3HOW G;  5D65 A;  3DEO A;  4TSS A;  4QMG A;  4A3G H;  4QUF A;  2FPI B;  3V05 A;  2W9C A;  4DV3 L;  1SJH D;  4FYD A;  4HSV A;  1JE4 A;  1AZP A;  1D1I A;  3TQ1 A;  1EYC A;  1VDZ A;  5C1O A;  4A76 A;  2W6M A;  3K6O A;  1UEA B;  1VF7 A;  4A3F B;  1JIH A;  3MA2 B;  2NZH A;  5LA6 F;  4LFC Q;  4UDU C;  2JA5 G;  4BXX G;  1CQF A;  5DNF A;  1MBY A;  2F0L A;  2F0J A;  1RTN A;  5EGT A;  1VQ5 A;  1VQL A;  2VS1 A;  3W1G A;  4IAJ A;  5JOB A;  2XSC A;  4YR0 A;  4MTD A;  4EGV A;  4DR7 L;  3PW2 A;  4I55 F;  1I4G A;  1TS2 A;  4CJ1 B;  5IGB A;  2C2D A;  1KAW A;  2WV6 D;  2B63 H;  1NY4 A;  1SYX B;  3IFT A;  1TWF A;  3E3X A;  4C3I H;  2JA8 G;  2Z4I A;  5LMU Q;  4GNX B;  4FDB A;  2R93 B;  4XYM B;  4N9P A;  1Z6H A;  3RLO A;  4C5B A;  3KBX A;  4A3M H;  3L7Z C;  2Z6B A;  4LFA L;  2EQS A;  1S5C D;  3I70 A;  5KFC A;  5ELB A;  1Y14 B;  1B9M A;  5T14 A;  4X3U A;  5AJ3 Q;  4IZO A;  3EPI A;  2A19 A;  1W93 A;  3PW7 A;  1AN8 A;  3A56 A;  3L4K A;  4LMQ D;  3HG9 A;  2QDB A;  2JA7 B;  2XWJ B;  1X6O A;  1JXL A;  3IN5 A;  1E24 A;  2RHS B;  1IBM Q;  4ODG A;  2HHH H;  4KD4 A;  1Q90 A;  3OIP A;  4E6I A;  4IPG A;  1CKN A;  3PIP 3;  2E5L Q;  2PW7 A;  3PO2 B;  5JJK A;  3I56 A;  1SNQ A;  1FNU A;  3IKJ A;  4DV6 Q;  2YW2 A;  4RHR A;  2D2C C;  4ECS A;  2AGQ A;  1DOM A;  3GTQ A;  1HNZ Q;  1EIH A;  1SYB A;  3E6Z X;  4WD3 A;  1GHJ A;  3RLF A;  3EYY A;  1CK1 A;  1LO5 D;  3GTM B;  2R7L A;  4KHP H;  3HOY B;  1I50 B;  4EFB A;  1LTR D;  3R23 A;  2K5H A;  3RN2 A;  4QIW E;  1PTO C;  3VDY A;  3DWQ A;  3K0X A;  4ZLT F;  3FRP B;  4IUV A;  2R86 A;  2F0D A;  4JG2 A;  3K5H A;  2HCC A;  2LSS A;  2V5A A;  2BDO A;  1UC9 A;  1T9H A;  4DUY Q;  4JI0 H;  5KFF A;  3TZD A;  3CCQ A;  2F0S A;  3MWY W;  2FHT A;  2EJM A;  1NAP A;  2X6L A;  1YNJ D;  5FPO A;  1MHW C;  3GTL B;  1PDQ A;  3I4N G;  1STN A;  2K05 A;  2UXC L;  2PNH A;  1OXX K;  4GN4 B;  5CBE E;  3BS1 A;  4ECU A;  2E76 C;  4QWD A;  1KDB A;  1KXL A;  3WO1 A;  1YBY A;  2WP8 J;  1L1O A;  2PQE A;  2EYH A;  5ISR A;  3I4M B;  1M0T A;  5FLX E;  1Y69 U;  5KT3 A;  4K0K Q;  5LL6 b;  4A3J G;  5C4Z A;  3GIQ A;  2C2R A;  1I4P A;  2KJX A;  1XMO Q;  3M3Y B;  2XC9 A;  1HNX H;  4O2D A;  3HOW H;  2P5Z X;  2NU6 B;  2WAQ E;  1YVC A;  4Q45 A;  1D5Z C;  2NVX H;  5KFM A;  3Q8P B;  3S1R H;  3J7A F;  1RDP D;  2VQF H;  1GUG A;  5M5X H;  3J7Y W;  3RAQ A;  4JYA H;  4EBE A;  3NUC A;  1FGB D;  1OXU A;  4X66 Q;  4KK7 A;  3F2B A;  3CP0 A;  4G7Z C;  1Y1W B;  4DL4 A;  1HR0 Q;  1VQA A;  2VNU D;  2F1M A;  2L9H A;  1SYD A;  2JA5 H;  4BXX H;  2KBN A;  3FMC A;  4ZKC B;  3SVM A;  1WSC A;  4RAZ A;  4TKO B;  2UUB L;  5KFD A;  1DJR D;  2QEJ C;  1QZG A;  2E2H B;  5I2X A;  4LF7 L;  1N34 L;  4KY7 A;  4XDX A;  3VYU A;  3S14 H;  2JA9 A;  3BDL A;  4A3K B;  1KTK A;  3T13 A;  1S97 A;  1V1Q A;  2BDN A;  4DAM A;  4Y7N H;  4DR6 H;  2V9W A;  5COY A;  2DNC A;  3S2H B;  1JDB B;  1TT2 A;  2FK2 A;  1W2B A;  4KV6 A;  2WAQ G;  3BVM A;  5DM6 3;  2W9B A;  2KEC A;  4DF7 A;  4NXN L;  2CQA A;  3A55 A;  5C5L A;  5C4H A;  4HJ9 A;  4QWC A;  1VQG A;  4OO1 G;  2K1B A;  3VR3 A;  3DEP A;  5L1J A;  4O4L F;  3ERO A;  2JA6 G;  3HOV B;  2W6Q A;  1KJ9 A;  3T5L A;  2XRQ D;  2MFI A;  1AH9 A;  1JWM D;  3V2T A;  1LTS D;  4DV3 H;  4RGM A;  3D4R A;  2Q8T A;  3VR5 A;  3MFG A;  3OTO H;  3CCL A;  1DV1 A;  2FK3 A;  2C22 A;  1IBK L;  4QIW A;  1LM0 A;  4NB3 A;  2OF1 A;  4DL3 A;  5KFR A;  3HOX H;  1N8R C;  4XT1 B;  2UXB Q;  1B50 A;  2ATL A;  4F4Y A;  5C3W A;  3DF7 A;  1BXT A;  2F0P A;  3E9H A;  4FNF A;  2BQR A;  2CW7 A;  4DR7 H;  1I3Q H;  1Y1V B;  1K9M C;  1NMG A;  5M3F B;  3G6J B;  3BU2 A;  4XZ3 B;  5M9O A;  1D2B A;  3BJY A;  4BS9 A;  2R8K A;  4IQZ A;  3RF2 A;  2QEX A;  2CW8 A;  4EYH B;  1EQT A;  2K04 A;  2YYZ A;  3TP5 A;  4DK0 A;  2IT1 A;  4IPC A;  2OQ0 A;  4BY1 H;  3KAK A;  1KJQ A;  2NYZ D;  1M6V A;  5CA0 F;  3NPP A;  5JJZ A;  2WAQ A;  3J80 c;  4X65 Q;  5D1O B;  3J7Z C;  4C3H B;  1ZQ7 A;  4F88 A;  5KFH A;  1IKM A;  2JEJ A;  3PF4 A;  3T1H Q;  4A93 G;  4AYB G;  4LF4 L;  1CHQ D;  3QG1 A;  4OX9 L;  2HGS A;  4O3S A;  3D4W A;  1BNC A;  1E2Z A;  1KJ8 A;  2JA6 A;  3M9M B;  3HXL A;  1MZB A;  1EEI D;  4CBV A;  1MKH A;  4DUZ Q;  2LY7 A;  4DV1 L;  2WFW A;  2XGP A;  2MO0 A;  4IHJ F;  3DWA A;  4V0B A;  4DK6 C;  5JEA H;  1XX8 A;  5IGF A;  4OWW B;  5HUR A;  5J39 A;  4O3R A;  3ULJ A;  4BWG B;  1V1P A;  2PI2 E;  1JC7 A;  3IL8 A;  4DA2 A;  2VQE Q;  4PMC A;  1RYS A;  2UVU A;  2OXP A;  1RJT A;  2QA4 A;  1V1O A;  3Q6S A;  5JVL A;  5IT9 L;  1E4E B;  3V6J A;  5KFK A;  3KBG A;  1TU2 B;  4JOI A;  5LOV F;  2OEO A;  1HTP A;  1KC7 A;  3ORR A;  4C5A A;  1YEZ A;  1BR9 A;  1I7L A;  5CGK A;  3A54 A;  2D0P A;  4IPH A;  2HQE A;  4KI0 A;  4K8I A;  3HBL A;  1K8A C;  3K58 A;  2UXC H;  4C1N I;  3RN5 A;  3MR3 A;  2O4X A;  4KLK A;  2V59 A;  1JX4 A;  4DV4 L;  4NXM L;  3S15 H;  5C0X H;  1RIP A;  1ENA A;  1K28 A;  2LXK A;  5ELF A;  4L5Q A;  4JI4 Q;  5JJI A;  3MR5 A;  4AYB A;  1O7Y A;  2GVA A;  2R6G A;  1K73 C;  2ENB A;  2QGQ A;  2IP4 A;  3VA5 A;  4ZYS A;  4F50 A;  4H02 A;  2HVS A;  3I8Z A;  2DNE A;  4J9M A;  3CCS A;  3EN2 A;  4KJO A;  4MIU A;  2WKD A;  2ZXR A;  1RTO A;  2VOB A;  1G6P A;  5IYC H;  1GOZ A;  1T94 A;  4R8U A;  4A75 A;  1D8L A;  1BJT A;  2NVQ B;  5NUC A;  1A2U A;  1QWY A;  3SHL A;  4DR3 Q;  2E2I B;  1CQI B;  3DMU A;  4C2M B;  4OON A;  1JWU D;  2UUB H;  5JQW A;  1L1O C;  1Z2P X;  4IJL A;  4A3E G;  4EFE A;  1V8Q A;  3S17 B;  4LF7 H;  1Q1E A;  2ES2 A;  4K6D A;  1KLU D;  4K5W A;  5K36 H;  2FJZ A;  4QCL A;  1EY4 A;  3A5U A;  2L1B A;  1E0B A;  4IFD J;  2VQD A;  2A69 D;  3PIO 3;  3RZD B;  5DG7 A;  5CYU A;  1JOR A;  2OQK A;  3JAM L;  4UPA A;  4B3S L;  5C44 B;  1BCP D;  3P7J A;  2JA7 H;  4DK3 C;  2IX1 A;  3H3V C;  2CFM A;  2IHE A;  1EZ1 A;  5D8D A;  2Y0S G;  1Q12 A;  3SXH A;  3ICE A;  4H7B A;  2W71 A;  3RB4 A;  4JC0 A;  1PH9 A;  2NTT A;  4HJA A;  1TXY A;  3PO2 H;  2PI2 A;  1PH4 A;  1Y8N B;  2PQA A;  5FJ8 G;  2HUG A;  2ZTE A;  5CV9 A;  1ONL A;  2VB2 X;  5KT6 A;  3U9O A;  4DR1 Q;  3HOU B;  3PUW A;  2XWB B;  3DHQ A;  2E2J H;  3GTM H;  1LTT D;  5KFA A;  3HOY H;  2BE5 C;  1IBK H;  1I50 H;  1PYS B;  4WFN 3;  4EG0 A;  1SNM A;  1KDC A;  4KKS A;  3KJP A;  1S40 A;  1TR5 A;  4O2A F;  3KAL A;  1VQC A;  5F9L A;  4DV5 H;  2A8V A;  1XNR L;  3FPP A;  4HYK A;  4IWX A;  2VW9 A;  1CM9 A;  1O80 A;  1IYU A;  1WD0 A;  1EWC A;  5LMN Q;  1YNN D;  3QJY A;  2RDH A;  4B3M Q;  1HFN A;  4A3B G;  3G4S A;  2ZJQ A;  1UE7 A;  3GTL H;  2EYJ A;  3GV6 A;  1A8V A;  3J80 i;  1DV2 A;  4JBW A;  4A3D G;  5BR8 L;  3M4Y A;  3M85 A;  3FKI G;  5KNC A;  1YZ6 A;  1O7Z A;  2UUC Q;  3I4M H;  3RLN A;  1AW7 A;  2YS6 A;  5I9P A;  3WWV A;  2R7F A;  4X62 L;  4CKB A;  5JH7 F;  1N32 Q;  2R3Z A;  4DAP A;  3M3Y H;  2LS0 1;  2GVB A;  1II3 A;  1NSN S;  3TS0 A;  1S10 A;  4RCN A;  4LUV A;  5KG6 A;  3VPD A;  5EKK A;  3KF6 A;  1YI2 A;  4Q8E A;  2CQY A;  5EWE A;  4LF4 H;  4JI6 Q;  2YRX A;  4OX9 H;  2Y0S A;  3N8D A;  1DZ1 A;  2PNR C;  1ET6 A;  3Q1K A;  2B2V A;  5GRO A;  1I4Q A;  1S9F A;  1EY8 A;  4DV1 H;  1KDA A;  2HIV A;  5IWA Q;  5C3E B;  1Y1W H;  2D9U A;  2D0O A;  5EKI A;  2J6S A;  4GN3 B;  3N40 P;  3MR6 A;  1EQR A;  1A3T A;  4L6T B;  2DIK A;  3J81 c;  4LAA A;  4RB1 A;  1NMF A;  3PV0 A;  1WJJ A;  2E2H H;  2UUA Q;  1LT6 D;  1FGU A;  4HAE A;  4A3E H;  1NNX A;  1U4L A;  1X55 A;  1XTD A;  5DG9 A;  4A3C G;  2C28 A;  1Q46 A;  3AQQ A;  4JPB W;  3SGI A;  1D6E C;  4BA1 I;  2ASJ A;  2QW7 A;  4PNY A;  1FJG L;  1U4P A;  4MTN A;  2A6E D;  3O13 A;  4KY5 A;  1GO3 E;  5JVG 3;  2SCU B;  2PMZ B;  2RVL A;  3S2H H;  1XWE A;  4IUT A;  4UCS A;  5LP6 F;  4YP3 A;  3FKI A;  3N44 B;  2MQH A;  1R4P B;  3QR8 A;  4IUN A;  1KQS A;  4DV4 H;  4NXM H;  3U50 C;  2FPG B;  1Y8P B;  1NR2 A;  3L3O C;  3CCV A;  4P2C B;  5M5W H;  1IBL Q;  2NVY B;  4AQY L;  3L4J A;  4HIM A;  4IFD G;  1TWC H;  3U4V A;  3TQY A;  3RMH A;  1A3U A;  2VA2 A;  2B2Y A;  1CKN B;  4LW1 A;  1F2Z A;  2AGP A;  4JOI C;  1ML0 D;  4DR2 L;  3TRE A;  4X64 Q;  3A8J E;  4GKK Q;  2JEA I;  2QIL A;  4JI3 Q;  4KHV A;  4RGT A;  3CME A;  4TVA B;  4BBR B;  2R92 G;  1SCU B;  3VA7 A;  2JJQ A;  1XYI A;  2V58 A;  1GKH A;  1KRT A;  2O03 A;  4FO2 A;  4G7O C;  3KYH C;  3NE5 B;  2A6H C;  3DM3 A;  4K5V A;  1XPU A;  1K1S A;  1KNA A;  4ZI7 F;  1PXU A;  4J6H A;  2EYF A;  4MZ9 A;  4R4O A;  5D14 A;  2W9A A;  1EY0 A;  1SE4 A;  2KA7 A;  5M3F H;  2CW0 D;  4A3B H;  2EY5 A;  2CKZ B;  5KT7 A;  4YJ2 F;  1PTO F;  2AKW B;  3UI2 A;  1YJN A;  2OT2 A;  4CKE A;  4A3D H;  2WDT A;  2ASL A;  3TDQ A;  1KRS A;  2ZJT A;  4A3G G;  4A2A A;  1SFO A;  2JSO A;  1O78 A;  1NR4 A;  4DV7 L;  1L1O B;  4JI7 Q;  3ND8 A;  4B3S H;  4C3H H;  3NGD A;  2EJG C;  5IOD A;  1DIK A;  2FMM A;  3ITP A;  4FXK C;  3VR6 A;  2YTY A;  5IOC A;  4BY7 B;  3Q8Q B;  1XMQ L;  1H9S A;  2A6H D;  3OHB A;  2L55 A;  4XQJ A;  5L1L A;  3J7A K;  1A15 A;  2K75 A;  3D6C A;  5M5Y B;  4FBU A;  4RH6 A;  2R8I A;  3I73 A;  2EXD A;  3GQB A;  3H0G B;  5G3L D;  4JI0 L;  1WCM A;  2W70 A;  3BDO A;  3HB9 A;  2NWG A;  3LWB A;  3H4D A;  4WJW A;  3PO3 B;  4DNT B;  2ID0 A;  3TP7 A;  1YJ9 A;  1EIY B;  2M9V A;  4RB2 C;  4ED8 A;  1Z2O X;  1PZI D;  5JAV A;  2B63 G;  2R7Z G;  1VQN A;  5CBA E;  3CRK C;  3H3V I;  4C3I G;  2ZT9 C;  1J5E Q;  4JI8 Q;  4LFB L;  4ECR A;  2VUM A;  4EEY A;  2WB1 E;  3F1Z A;  4RB3 C;  2CH4 A;  4OEL B;  4A3M G;  5GAE C;  3S2D H;  3MWD A;  1XNR H;  3T1Y Q;  1B33 N;  4K6L A;  3J7A V;  4RZR A;  3GP7 A;  2Z6K A;  4O42 A;  2IX0 A;  1HA5 A;  4BBS B;  3OHA A;  4DL7 A;  1F9S A;  2A68 C;  1PV4 A;  4FS2 A;  4HIK A;  2NZO A;  2VQF L;  4A3I B;  3CC4 A;  3K3V A;  3SEB A;  3R5H A;  1QNK A;  1S0N A;  2PO4 A;  5BR8 H;  1N33 L;  1S5F D;  1TWA A;  3JSN A;  1EUJ A;  3G7L A;  1U0L A;  4XYQ A;  4X62 H;  3D3R A;  5ELC A;  4O4I F;  2M00 A;  3OWF A;  2WIN B;  4QB4 A;  4DGZ A;  4IFD H;  1FL0 A;  4ED3 A;  2B29 A;  4I7H A;  4RA8 A;  3C1F A;  1EWI A;  2ZJP A;  4QW9 A;  2L15 A;  3J81 E;  1G2T A;  2HDL A;  1QUQ A;  4K5X A;  5C3X A;  3J81 i;  2ATW A;  4WBN F;  2UVW A;  2C2E A;  2JP1 A;  3MFY A;  3PIP A;  3MHB A;  3MXG A;  1VMC A;  3NQT A;  1RJP A;  2WB1 G;  2XRS D;  3CQZ H;  3U9T A;  4HTH A;  5L1I A;  5E4W C;  3UE0 A;  2UVR A;  2NVQ H;  2E2I H;  5KFW A;  1X65 A;  4QJF A;  3GV8 B;  5FO9 B;  2B63 A;  3K59 A;  4KY6 A;  2YZG A;  4KD3 A;  3S1Q B;  4YAJ B;  4ALP A;  2XIW A;  3S17 H;  1AUX A;  4HNV A;  1STH A;  5JEA J;  1SSO A;  3SI8 A;  3E0E A;  3NTI A;  1SN8 A;  5FKA C;  1R9T B;  1AN7 A;  1RF2 D;  2MCT A;  5C6A A;  3NWS A;  1JJG A;  1B3Q A;  2QF7 A;  2YCH A;  3KJO A;  1FJG H;  2OTL A;  3RZD H;  2Z9H A;  5K5P A;  2NVT B;  3T1H L;  4RWS C;  4LF6 L;  1EIF A;  2B2V C;  4JI5 L;  3OTO L;  2J9G A;  2YRW A;  5C44 H;  4DV2 L;  1KNE A;  4CDC C;  2WTF A;  3H91 A;  3KLS X;  2AQ3 B;  2E2D C;  1EHI A;  5C1P A;  3J7A 5;  3CKI B;  4KKT A;  4F4Z A;  1YHA A;  3UDI A;  4LF8 L;  3MEH A;  4OO1 I;  2JA6 B;  4AQY H;  2N8N A;  5I9O A; 
#chains in the Genus database with same CATH homology
 4GLX A;  2K14 A;  2K5V A;  1PVO A;  3CD6 A;  4EQ5 A;  2MFI A;  4RG1 A;  3HOU H;  4K0K L;  5C0X J;  4GS3 A;  3M7N A;  1AH9 A;  1K0R A;  1N36 L;  1XNQ Q;  1G51 A;  3AFQ A;  2BA0 A;  3BZC A;  3D31 A;  3IRB A;  1XMO L;  4JV5 L;  1PH2 A;  2K50 A;  2R7Z H;  3CCL A;  2CQO A;  4YWL A;  3DLL A;  1KHI A;  3MEF A;  4DKA C;  1IBK L;  1LM0 A;  4NB3 A;  1OXT A;  2AWN A;  1NJI C;  1J6Q A;  4IO9 A;  5C44 G;  3M4Q A;  4A93 H;  3L0O A;  3HOX H;  1XPO A;  1VQD A;  1CKM A;  1YNX A;  1N8R C;  4IPD A;  2N78 A;  4LF9 Q;  4X66 L;  4A3L H;  2UXB Q;  5GAD C;  1VQB A;  2VY3 A;  1HR0 L;  1KL9 A;  3E9H A;  2JE6 I;  1VQH A;  1QUQ B;  2ZTC A;  1I3Q H;  4GN5 A;  4YHH L;  1K9M C;  1NMG A;  3BU2 A;  1Y1V G;  3CCE A;  2QEX A;  3KF8 B;  1XJV A;  2YYZ A;  1PHJ A;  1KIX A;  2ZM6 Q;  3ULL A;  1HR0 W;  1QVF A;  4JI1 Q;  3HOU G;  3F2C A;  2IT1 A;  4IPC A;  2OQ0 A;  3LGJ A;  3CCU A;  4BY1 H;  3F2D A;  4R1J A;  3GDE A;  3J80 c;  2DUD A;  1I94 L;  3GTP H;  2UXD L;  4X65 Q;  4DR4 L;  3J7Z C;  2K4K A;  1AE3 A;  1EOV A;  3PF4 A;  2ZJR A;  3T1H Q;  4AYB G;  4LF4 L;  4DV0 L;  4OX9 L;  4A93 G;  2CWA A;  1HZC A;  3HOX G;  2R7D A;  3CCR A;  3HKZ E;  5ELO A;  1SLJ A;  4DR3 L;  1E7Z A;  3H15 A;  1KD1 C;  3K80 C;  5C3E H;  1B70 B;  4A3L G;  1MKH A;  4DUZ Q;  3D0F A;  4DV1 L;  2BH8 A;  2WFW A;  3W1B A;  2MO0 A;  3CCJ A;  3EIV A;  4DK6 C;  4ME3 A;  4OWW B;  1V9P A;  4XTC S;  4R4T A;  3ULJ A;  3OW2 A;  4P74 A;  3GTJ H;  3GTO H;  2PI2 E;  3KLW A;  5FLM H;  1LTL A;  2VQE Q;  1YIJ A;  4L5T A;  2F3I A;  1H95 A;  2PMZ E;  4BY1 G;  1GVP A;  1QZH A;  1XNQ L;  1Z9F A;  4QQB X;  2QA4 A;  3F8T A;  2JQO A;  1MJC A;  5GQO A;  4JOI A;  1A0I A;  1IXR A;  4OXP A;  5IT9 c;  2I5M X;  2XTI A;  5C4X H;  5IYB H;  1PH5 A;  1X3F A;  1YEZ A;  4B3S Q;  4X6A H;  2I5L X;  2NN6 G;  2NN6 I;  4P72 A;  4HJ5 A;  1VQ9 A;  2IHF A;  2D0P A;  4IPH A;  5IE8 A;  4GLV B;  3STB C;  2VZA A;  1Q1B A;  3HFZ B;  5C3E G;  4DV5 Q;  1S72 A;  2AHO B;  4LF9 L;  4IOA A;  4KI0 A;  2UXB L;  3ZJY C;  3A0J A;  1K8A C;  2BA1 A;  3FHW A;  4DPG A;  3RN5 A;  1UE6 A;  1Q86 C;  3Q8D A;  1Q8K A;  4KLK A;  4C3J H;  5JEA G;  3S1M H;  2Q2H A;  4P73 A;  4R4Q A;  3PUY A;  4P75 A;  5E7N A;  4DV4 L;  2HHH Q;  4NXM L;  3S15 H;  1PYB A;  3HKZ G;  4C2M H;  5GAG C;  1RIP A;  1FVI A;  2LXK A;  2MO1 A;  2NVY H;  5FLM G;  3PGZ A;  3CMA A;  1C7Y A;  4L5Q A;  1VQM A;  4JI4 Q;  5JJI A;  1HJP A;  4JI1 L;  1RL2 A;  5J3B A;  2GVA A;  2R6G A;  1K73 C;  2FXQ A;  2QGQ A;  2V1C C;  2F52 A;  2PQA B;  4J15 A;  4H02 A;  4JCV E;  4GOP B;  4KHP Q;  3K8A A;  1YHB A;  4NPS A;  4X65 L;  2RF4 A;  3CCS A;  3CF5 A;  5C4X G;  1AE2 A;  2Z6K C;  4BBR H;  3EN2 A;  1U5K A;  2UXD Q;  1XNR Q;  3M4P A;  2VUM H;  1VS0 A;  3STB D;  1BVS A;  4GLA C;  4LF4 Q;  3JC6 6;  1Q82 C;  1N9W A;  3BZK A;  5IYC H;  1G6P A;  4A75 A;  1D8L A;  5ELN A;  5JJK A;  4DUZ L;  4DR3 Q;  1X56 A;  3ULP A;  3PSI A;  1I5F A;  2UU9 Q;  1V43 A;  3RR5 A;  4DNI A;  2ASB A;  1C0A A;  1SE8 A;  4PMW A;  1CKO A;  2RHQ B;  4OON A;  5BR8 Q;  3MXN B;  1L1O C;  4B3T Q;  2VL6 A;  5C0X G;  1TWH H;  4IJL A;  5C0X I;  4A3E G;  5FJ8 H;  3M9B A;  1Q1E A;  1C9O A;  2VQE L;  4YY3 Q;  1XPR A;  2ES2 A;  4POF A;  1WCM G;  2YTX A;  4X62 Q;  1EYG A;  1D7Q A;  1JT8 A;  1X54 A;  1O7I A;  1UWV A;  5IYD G;  1P16 A;  1TWA H;  4DAY B;  1PH3 A;  2HT1 A;  2I5H A;  5DLQ E;  3A5U A;  2Q2T A;  4YWM A;  1HNX Q;  3I2Z A;  4IFD J;  4LUO A;  2YU9 H;  3KFU A;  4R4I A;  2OQK A;  4BBR G;  4UPA A;  4B3S L;  2B3G A;  3TRZ A;  3NEN A;  1TWG H;  3JAM c;  3NEM A;  1G29 1;  2VUM G;  1A63 A;  4BY7 H;  4HID A;  5IYC G;  4A3F G;  1HZ9 A;  4JYA Q;  2JA7 H;  4DK3 C;  4DV5 L;  2IX1 A;  2CFM A;  2IHE A;  4JI2 Q;  5M5Y H;  1WYD A;  3RZO H;  2Y0S G;  5EAY A;  1Q12 A;  3H0G H;  1HNW Q;  4LWC A;  3PF5 A;  3ICE A;  4WJ4 A;  1K8G A;  1M90 C;  4JC0 A;  1PH9 A;  4HJA A;  3PO2 H;  1TXY A;  2HHH L;  1P8L A;  3PO3 H;  2AMC B;  2PI2 A;  4DV4 Q;  1PH4 A;  2PQA A;  5FJ8 G;  3FKI H;  4NXM Q;  2RCN A;  2ZTE A;  3K81 C;  4GOP A;  4JI4 L;  5M3M H;  2IY5 B;  5K36 G;  4DR1 Q;  2K5N A;  3PUW A;  2E2J H;  3GTM H;  1PFS A;  4PZ6 A;  2Q2U A;  3HOY H;  1I50 H;  1PYS B;  3AFP A;  3PUZ A;  1X9N A;  1EQQ A;  1FJG Q;  1ASY A;  3KJP A;  1VCI A;  4KHP L;  1S40 A;  4BA2 I;  1PH7 A;  2Z0S A;  3AEV A;  3CC7 A;  4O0A A;  3OYY A;  3BJU A;  1VQC A;  4DR6 Q;  2A8V A;  1XNR L;  4P71 A;  3UDX A;  2YTV A;  4BBS H;  4BY7 G;  2VW9 A;  1ASZ A;  2JA7 G;  4A3I H;  5LMN Q;  1E22 A;  3I55 A;  1L2F A;  4B3M Q;  3M4O H;  4A3B G;  1SRO A;  4QL5 A;  3H0G G;  4APV A;  3G4S A;  2UU9 L;  2ZJQ A;  1BBU A;  1UE7 A;  3GTL H;  1IL2 A;  1A8V A;  3J80 i;  4JBW A;  2LXJ A;  3PO3 G;  1IYJ B;  3PO2 G;  5BR8 L;  4HIO A;  4A3D G;  3PIO A;  4B3T L;  2Q2I A;  3M85 A;  3FKI G;  4AQY Q;  1YZ6 A;  2YV5 A;  2CWP A;  3RLN A;  2UUC Q;  3I4M H;  4YY3 L;  4OWX B;  3WWV A;  2R7F A;  5M3M G;  4X62 L;  2C35 B;  3RNU A;  4B3R Q;  1N32 Q;  3M3Y H;  2GVB A;  3TS0 A;  1SMX A;  4X64 L;  4XIG S;  3HOY G;  4A3C H;  4LUV A;  4DR2 Q;  1HNX L;  4DV3 Q;  3GO5 A;  2HQL A;  3KF6 A;  1YI2 A;  1VQ6 A;  3GTK H;  1S3O A;  3KDF B;  4JI6 Q;  1UE5 A;  1WFQ A;  3S24 A;  1E1O A;  4KHZ A;  4BBS G;  1SFO H;  5GRO A;  1TWF H;  2K52 A;  3ERS X;  2ZTD A;  3HOZ H;  4LF5 Q;  4RMF A;  1OXS C;  5FLX c;  4JYA L;  2HIV A;  5IWA Q;  4A3I G;  1Y1W H;  4OWT B;  4JI2 L;  1QVG A;  3KOJ A;  1W3S A;  2D0O A;  2A1A A;  3G6E A;  4GN3 B;  2I0Q A;  1HNW L;  1EQR A;  4LNQ A;  3K7A H;  4GNX A;  1MJE A;  4PZ7 A;  5HGQ A;  4EX5 A;  3J81 c;  5C4J H;  4DR7 Q;  1NMF A;  1PA6 A;  3PV0 A;  3I4M G;  1WJJ A;  2E2H H;  4UY8 C;  2UUA Q;  1FGU A;  1YHQ A;  4A3E H;  1J5E L;  4GKJ Q;  1R9T H;  4A4I A;  1SR3 A;  4DR1 L;  5IP9 G;  1X55 A;  1XTD A;  4A3C G;  1WCM H;  1Q46 A;  3AQQ A;  4UP7 A;  3UDF A;  4TQU S;  1L0W A;  1B8A A;  3SGI A;  4DR5 Q;  1SRU A;  4BA1 I;  1HZA A;  2KHI A;  4DV7 Q;  5IYD H;  2NVT H;  1FJG L;  4MTN A;  2H5X A;  1E3P A;  4LFA Q;  2BH2 A;  4PG3 A;  1GO3 E;  4YWK A;  1NTG A;  3G71 A;  1LYL A;  3GTQ H;  2R92 H;  4DR6 L;  4POG A;  1JJC B;  2KHJ A;  3S2H H;  1K83 H;  1CSP A;  3PCO B;  1XMQ Q;  3HOZ G;  2XGT A;  3AYH B;  3CW2 C;  1HH2 P;  1HZB A;  4HJ7 A;  1Y1W G;  2MQH A;  1UEB A;  1KC8 C;  4L5R C;  4A3F H;  5LMN L;  1IZ6 A;  1KQS A;  4B3M L;  3U50 C;  4JI0 Q;  3CCV A;  2OWO A;  5M5W H;  3CC2 A;  1IBL Q;  3CCM A;  3UE1 A;  1GD7 A;  4QY7 A;  2OCE A;  4AQY L;  2UUC L;  2E8G A;  3E9I A;  1TWC H;  2ALY B;  3CPF A;  5LMN W;  3U4V A;  4HIM A;  3NBH B;  3HOW G;  4IFD I;  1VQ7 A;  3TQY A;  3KDF A;  5H1S E;  1M1K C;  4A3G H;  4B3R L;  1OXV A;  1N32 L;  1CKN B;  4LW1 A;  4A3K G;  4JOI C;  1UE1 A;  1VQ8 A;  4DR2 L;  2JA8 H;  1EFW A;  3TRE A;  4DV3 L;  4LFB Q;  4X64 Q;  3G48 A;  4GKK Q;  2R93 H;  2JEA I;  4JI6 L;  4JI3 Q;  3CME A;  4TVA B;  2R92 G;  2JJQ A;  4A76 A;  4Y52 H;  1GKH A;  4MNO A;  1KRT A;  1PH8 A;  4LF5 L;  3KYH C;  4UP8 A;  3DM3 A;  2NZH A;  5IWA L;  3K7U C;  2VQF Q;  4LFC Q;  3KF6 B;  4JBJ A;  1XPU A;  2JA5 G;  3U58 A;  4MZ9 A;  4R4O A;  1JB7 A;  4BXX G;  1N33 Q;  1VQL A;  1VQ5 A;  5M3F H;  2VS1 A;  3W1G A;  3TS2 A;  2CKZ B;  4A3B H;  2UXC Q;  3CPW A;  3HOV G;  4DR7 L;  2AKW B;  1YJN A;  4A3D H;  1PH1 A;  4AYB E;  1KAW A;  3JAM i;  2UUA L;  4GKJ L;  1KRS A;  1NY4 A;  2B63 H;  4A3G G;  1JJ2 A;  4IJH A;  3H3V H;  4DR5 L;  4C3I H;  5JJL A;  2JA8 G;  3PUX A;  5LMU Q;  4GNX B;  4FDB A;  4DV7 L;  1VQO A;  1L1O B;  4JI7 Q;  2KEN A;  3RLO A;  1YJW A;  4A3M H;  2R93 G;  3L7Z C;  4LFA L;  4C3H H;  2EQS A;  4HJ8 A;  1Y14 B;  2HIX A;  2JEB I;  5AJ3 Q;  3S16 H;  3HKS A;  2A19 A;  2YTY A;  1VQ4 A;  1XMQ L;  1I6H H;  1E1T A;  4R4C A;  2KCT A;  5HY6 A;  2K75 A;  2DGY A;  1X6O A;  1E24 A;  2RHS B;  2EXD A;  1IBM Q;  1CSQ A;  3GTG H;  4JI0 L;  5M3F G;  3I4N H;  3TEH B;  2ID0 A;  1CKN A;  1DGS A;  4IPG A;  1WI5 A;  1IBL L;  2E5L Q;  3I56 A;  1YJ9 A;  1EIY B;  2UUB Q;  4DV6 Q;  3W5O A;  3CXC A;  2OTJ A;  3NEL A;  2JK8 A;  4LF7 Q;  1N34 Q;  3S1N H;  2B63 G;  1HNZ Q;  1K3R A;  2KCM A;  1VQN A;  4L5S A;  4A3J H;  2F4V L;  2R7Z G;  3RLF A;  3H3V I;  3L2P A;  5IP9 H;  1J5E Q;  4JI8 Q;  3ER0 A;  4LFB L;  2WB1 E;  3F1Z A;  4UP9 A;  1GM5 A;  2K5H A;  3RN2 A;  4A3M G;  3I4O A;  5GAE C;  4QIW E;  4AIM A;  4LF6 Q;  3VDY A;  3T1Y Q;  3S2D H;  4JI3 L;  1YIT A;  3B6Y A;  3OTO Q;  4JI5 Q;  3K0X A;  3PUV A;  4DV2 Q;  2Z6K A;  4JG2 A;  2IX0 A;  2LSS A;  4AH6 A;  1T9H A;  4DUY Q;  1PV4 A;  3CCQ A;  3I7F A;  2NZO A;  4HIK A;  2VQF L;  4PZ8 A;  4LFC L;  3CC4 A;  3CAM A;  4NXN Q;  4LF8 Q;  1N33 L;  3FP9 A;  3I4N G;  4LUZ A;  2UXC L;  2PNH A;  1MIU A;  1OXX K;  4GN4 B;  4GOP C;  4IFD G;  1EUJ A;  3S1Q H;  1U0L A;  2MNA A;  1B7Y B;  2CCZ A;  3U4Z A;  1VQE A;  1KXL A;  1YBY A;  2WP8 J;  1L1O A;  1BKB A;  4K0K Q;  4JBK A;  4A3J G;  1N36 Q;  1XMO Q;  1FL0 A;  4JV5 Q;  2B29 A;  1VQI A;  4O2D A;  3HOW H;  2EIF A;  5LMU L;  1EWI A;  2ZJP A;  2WAQ E;  1Q81 C;  2L15 A;  1YVC A;  4A3K H;  1IBK Q;  4JI7 L;  2NVX H;  1QVC A;  3S1R H;  1A62 A;  1X3G A;  1QUQ A;  2ATW A;  3J81 i;  1VQF A;  5AJ3 L;  5M5X H;  5IP7 H;  3PIP A;  2N49 A;  2AWO A;  1OXU A;  2WB1 G;  3CQZ H;  3UE0 A;  4X66 Q;  3F2B A;  3CP0 A;  1Q7Y C;  1NE3 A;  1OTC A;  2E2I H;  2NVQ H;  1X65 A;  2N3S A;  4QJF A;  1HR0 Q;  1VQA A;  1IBM L;  2VNU D;  1VQJ A;  4YCV A;  4IOC A;  4WJ3 M;  4YHH Q;  1JMC A;  2JA5 H;  4BXX H;  2KBN A;  4ALP A;  2E5L L;  3S17 H;  2JA6 H;  2UUB L;  1JE5 A;  2ZM6 L;  4DV6 L;  5JEA J;  3UDG A;  3E0E A;  1QZG A;  3HOV H;  4LF7 L;  1N34 L;  1SN8 A;  1HNZ L;  3EBE A;  4GKK L;  3S14 H;  3A74 A;  4YCW A;  1JJG A;  2GN5 A;  2D62 A;  2JA9 A;  3GD7 A;  3KJO A;  1VQK A;  4YCU A;  2F4V Q;  2OTL A;  3RZD H;  1WOC A;  1V1Q A;  4DAM A;  3A5Z B;  4JI8 L;  5IY0 A;  1BBW A;  5IYB G;  1Z47 A;  5GAH C;  4QGU A;  4Y7N H;  2Y0S E;  1PH6 A;  1I94 Q;  4DR4 Q;  3T1H L;  4LF6 L;  1EIF A;  3T1Y L;  3J81 j;  4JI5 L;  3OTO L;  4DV0 Q;  4OX9 Q;  5C44 H;  4DV2 L;  1NBW A;  1CUK A;  5IP7 G;  1W2B A;  1LUZ A;  2WAQ G;  4DUY L;  1X3E A;  4DV1 Q;  3J7A 5;  4JBM A;  1VQP A;  4GNX C;  4NXN L;  1YHA A;  3UDI A;  4HJ9 A;  4LF8 L;  1VQG A;  4OO1 G;  4OO1 I;  2N8N A;  2JA6 G;  1Y1V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...