3HOXG

Complete rna polymerase ii elongation complex v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoxG01
3BU2A 3GO5A 4UY8C 4LF8L 1Q82C 1MJEA 4A3JG 3TEHB 2KHJA 4HJAA 4DUZQ 1E24A 4OWTB 3HOUH 4LFCL 3ULPA 2I0QA 1VQ6A 1HZBA 1Q86C 4JI5Q 3U50C 4DR1Q 1TXYA 2VS1A 3EIVA 5IYDG 2VUMG 4LF7Q 2E2HH 3RLOA 1XNQL 3T1HQ 2YU9H 5HGQA 1PV4A 3HOWH 3RZOH 3PSIA 5AJ3Q 3BZCA 5IYCG 2UXBL 2PQAB 1PH5A 1AE3A 3AFQA 4HJ5A 1MKHA 4C3JH 1CKNB 2WFWA 1SFOH 2YTXA 2N3SA 1PH9A 1X3GA 3KYHC 1IYJB 3NENA 4UP9A 3PUZA 1A63A 2R93H 2WB1G 5IT9c 1UWVA 1VQOA 1VQLA 5IP7G 1TWCH 1I5FA 1VS0A 3GD7A 4GLXA 1KXLA 4A75A 2H5XA 2WAQG 1JMCA 2NVYH 4DR4L 2UXCQ 2Q2TA 3HFZB 2JE6I 2LXJA 2IHFA 4DR2L 5E7NA 4PG3A 1IBKL 4HJ9A 2N78A 4DUYL 3KF8B 4A3DH 3OTOL 1VQ4A 1GM5A 5JEAJ 4HIOA 3ICEA 4JYAQ 4JI8Q 1S3OA 1CKNA 4QL5A 3B6YA 1NJIC 3FKIH 5GAEC 2VQFQ 1IBLQ 2VNUD 3GTMH 3S1NH 3K7AH 4DK3C 2B29A 1P8LA 4WJ3M 2IT1A 1ASYA 3CCEA 3GTJH 1GO3E 2ATWA 5FJ8G 1YIJA 4KHPL 3CCUA 1KHIA 1KRTA 3EN2A 4EQ5A 2F4VL 4Y7NH 5GROA 3KDFA 4A3KH 1HNWL 4LW1A 4B3SQ 4JI1L 1L0WA 4L5QA 1K8AC 2NVTH 1JT8A 5C4JH 3E0EA 3CMAA 4DV4Q 4GNXB 3OW2A 1PH4A 4BY1H 1WCMH 3GTPH 4DPGA 3HOZG 2OCEA 1VQAA 1N8RC 2JA8G 1E1OA 4OWXB 2RCNA 1Z47A 5FLMH 1PH2A 3TRZA 1K3RA 4J15A 1XPUA 2IY5B 2PI2A 2PI2E 3PIPA 4IOAA 2OTLA 2LSSA 2UUBL 4DV0Q 1JE5A 1WOCA 2ALYB 2F52A 4BXXH 3CPWA 3S2DH 1VQCA 1B8AA 4YY3L 3A74A 3F2DA 1M1KC 2RHSB 4B3MQ 5GAHC 4L5SA 2K5HA 5C3EH 2B63H 4LF5Q 3H0GG 4GLAC 4R4QA 3T1YL 1XMOQ 1Z9FA 2K5NA 4DV3Q 2ZM6Q 2GVAA 1LM0A 1NMFA 4IPGA 3HOVG 1JJ2A 3H3VH 4BY7G 4DKAC 4LF4Q 5M3FG 2ZJQA 1CKMA 3E9HA 4AIMA 3AQQA 3J81i 3UDXA 2UU9Q 2ZTEA 4DV1Q 4JOIA 1YEZA 3U58A 1GD7A 1L1OC 1VQ8A 3U4VA 1BKBA 4A3EG 3GTKH 3GDEA 2QA4A 4AQYQ 4GLVB 1W2BA 4YWLA 4DR3Q 2WB1E 4JYAL 2E8GA 3SGIA 2XTIA 4R4CA 2WAQE 1DGSA 3UE1A 2ID0A 2VQFL 1XMQL 2HHHQ 2XGTA 1X65A 1YZ6A 3CMEA 5IWAQ 2JA7H 3DLLA 3J7ZC 4PMWA 2JK8A 1HR0Q 3RNUA 3L0OA 2YYZA 1VQ7A 1KC8C 2CWAA 2K75A 4HIKA 4IPCA 1V9PA 2UUCL 1W3SA 4OO1I 2ZTCA 1OXVA 3I56A 4A3IH 4YWKA 3FHWA 1Y1WH 1YBYA 4X65Q 1Q81C 2HT1A 3HOUG 5C44H 4HJ8A 4POGA 3KFUA 4GKJL 1PYBA 3E9IA 1VQDA 2IHEA 4A4IA 4DV2Q 3G4SA 1N33L 2NZHA 5JJKA 4BA2I 3H3VI 4X64L 3GTOH 1N36Q 4K0KQ 3CC7A 2MNAA 3AFPA 3BJUA 3PUWA 2JA5H 2FXQA 4O2DA 1FVIA 1Q12A 3S14H 3HOXH 2UXDL 4LUVA 3PGZA 4A93H 1XTDA 4DV7Q 2R93G 4JV5Q 1G6PA 3KOJA 4FDBA 3RR5A 1NTGA 5LMUL 2E5LL 4XTCS 5C0XJ 1JJCB 1CUKA 2ZM6L 1X3EA 4AYBG 2VQEQ 4A3FH 4DR7Q 4JC0A 5JJLA 1SRUA 3HKSA 2CWPA 4YHHL 4LFAQ 1VQPA 2OQ0A 4B3TQ 1GVPA 1Q1BA 2AHOB 2JA9A 1S40A 4JI4Q 4R4OA 3STBD 3VDYA 2Z6KC 4RG1A 1VQ5A 1O7IA 1J5EQ 4GKKL 1BBUA 4GS3A 5BR8Q 1BVSA 2R92G 4DR3L 5FLXc 3M3YH 4PZ6A 2BH8A 1VQMA 3K81C 2NN6G 4DR6Q 1G291 2HHHL 4DV5Q 1GKHA 1EUJA 4B3RL 2R6GA 5IWAL 3PO2G 2OTJA 1YJ9A 1E1TA 2D62A 3KDFB 3F2CA 3M85A 3TQYA 3W5OA 4A3KG 3RZDH 1QUQA 3UDIA 2VW9A 1XNRQ 1VCIA 2Z0SA 4QGUA 1UE1A 2AMCB 3A5ZB 1AE2A 1X6OA 2UUAQ 3I4MG 4Y52H 4JI0L 2JA6H 2CKZB 1YVCA 5M5WH 4C3HH 1X3FA 2A1AA 4X65L 4PZ7A 4A3JH 1PH6A 3ERSX 4YCWA 1Y1VH 3D0FA 1JB7A 3TREA 1OXUA 4LNQA 2AWNA 4JI7L 4LF6L 1AH9A 5IP9H 4UPAA 4GN5A 3G71A 1P16A 2ASBA 4DR5L 3I4NG 4JI2Q 3PUVA 1N36L 4LF9Q 4JI3L 1KL9A 5JEAG 3AYHB 3ULLA 4DV6Q 4P71A 4QJFA 1C7YA 2KBNA 5IYDH 1L2FA 4IFDI 3F2BA 2IX0A 1K9MC 4JI6L 4JBWA 1WYDA 1PH3A 1FL0A 2B63G 5C4XG 1T9HA 3M4QA 4LFBQ 1N34Q 3K0XA 3CF5A 4GKJQ 4JV5L 3HOYG 3CPFA 2EQSA 2R7ZG 3FP9A 3F1ZA 1K83H 4DUZL 4NXNQ 3PUYA 3HOZH 2AKWB 3PO3H 4JI5L 3RLNA 4OX9Q 4DR7L 4DR1L 1A62A 1X55A 3A5UA 4H02A 4LF7L 1EWIA 4GN4B 1N9WA 3T1HL 4LFAL 3CQZH 4B3TL 5IP7H 2MFIA 5AJ3L 4IOCA 3KJPA 4R4TA 2E2IH 4BA1I 3PUXA 3LGJA 1HH2P 1J5EL 1L1OA 3CCSA 4C3IH 2F3IA 3M9BA 5EAYA 4L5RC 1CSPA 4UP7A 1YJNA 3HKZG 1KRSA 1KD1C 4AYBE 4A3BG 2YV5A 1PVOA 4X62Q 3J81j 2AWOA 3L2PA 2UXCL 4IPHA 4MZ9A 2Y0SG 1VQGA 4BBSH 3U4ZA 2KCMA 1IBMQ 3W1BA 4DNIA 2R7DA 1HJPA 4A3MG 1Q8KA 3STBC 4MNOA 2I5HA 1X9NA 4P74A 1PH8A 4A3IG 5FJ8H 2UUAL 2HQLA 1YHAA 1A8VA 5H1SE 3CXCA 5LMNQ 4JI6Q 3M4OH 2QEXA 4YCVA 2VZAA 4KLKA 2MQHA 5GQOA 1UE6A 4JI8L 5IE8A 2Q2IA 2ZJPA 1U0LA 1I3QH 1UE7A 1M90C 4LF8Q 1VQNA 2BH2A 3DM3A 4BBRG 1NMGA 1EQRA 2CQOA 1VQBA 1VQJA 3ZJYC 2HIXA 1EYGA 1IBLL 3JAMc 2CCZA 4A3CH 4LFCQ 3J7A5 5IYBG 5M3MG 4DAYB 1PYSB 1QZHA 4JI2L 1VQ9A 3S1MH 2JA8H 5J3BA 2ZTDA 3L7ZC 3K7UC 4YWMA 1LUZA 4B3SL 3CCQA 1HNXQ 4IFDJ 1E3PA 4LWCA 5HY6A 4LFBL 1N34L 4DV4L 4A3FG 4C2MH 2HIVA 5DLQE 5K36G 2PNHA 3GTGH 1PA6A 1YHBA 1MIUA 4GNXC 1YJWA 2QGQA 4X6AH 4OX9L 3GTLH 3CCMA 2I5MX 3HOWG 1QVFA 4QQBX 3H0GH 2D0OA 1KAWA 1WFQA 3JC66 4DV0L 4BY7H 4HIDA 4OONA 5M3FH 2Z6KA 1X54A 1XJVA 4B3ML 4WJ4A 3TS0A 2DGYA 1TWFH 3CP0A 2N8NA 4ME3A 4LF5L 4A3EH 1XMOL 1TWAH 1I6HH 4DV3L 3KLWA 4X62L 1OXTA 4IJHA 4JBJA 4AH6A 3K80C 1I94Q 4JBKA 1QUQB 3UE0A 1KQSA 4LF4L 2R7FA 4R1JA 4GOPC 3MXNB 1UE5A 1PH7A 1Q1EA 3PV0A 4A3DG 1FJGQ 1ASZA 4KHPQ 1Q46A 2UU9L 1TWHH 4DV1L 2JA6G 4A3LH 3W1GA 2F4VQ 4EX5A 3S16H 2A19A 4XIGS 3RLFA 5C0XG 1HNWQ 1PFSA 3UDFA 4AQYL 1YHQA 3FKIG 2ZJRA 3HKZE 4JI1Q 2IX1A 1Y1VG 4LUOA 1K73C 2A8VA 3RN2A 1SN8A 1HR0W 1V43A 5IP9G 1E22A 2K5VA 3G6EA 3TS2A 3S1QH 4X66Q 2BA0A 4POFA 2E2JH 2Y0SE 1VQHA 2D0PA 5GAGC 3NBHB 1B7YB 3GTQH 1UEBA 1EOVA 3KF6B 1HR0L 4A3GH 4KI0A 1Y14B 2V1CC 2KHIA 4A76A 1TWGH 1S72A 2BA1A 2Q2HA 2UUBQ 1B70B 4BY1G 1N32Q 1HNXL 1WCMG 2OQKA 3M4PA 1VQIA 1K8GA 1QZGA 1HNZQ 4YY3Q 2JQOA 3PO3G 2JJQA 3F8TA 3ULJA 1C9OA 4NPSA 5FLMG 4DK6C 1PH1A 4DV2L 3T1YQ 1SE8A 4RMFA 2I5LX 4K0KL 3A0JA 2B3GA 1EIYB 3I55A 2MO0A 3CD6A 2NZOA 4BXXG 3KF6A 1SR3A 1L1OB 2VUMH 2EIFA 4ALPA 2NVQH 4OO1G 2MO1A 4TVAB 3Q8DA 5C3EG 1RL2A 1QVCA 2K14A 1VQKA 4DV7L 5IYCH 2YTYA 1CSQA 2PQAA 1OXSC 2K52A 2C35B 3G48A 1HZAA 2VQEL 1SROA 2WP8J 1XMQQ 4P75A 1I94L 1IL2A 2R92H 4BBSG 3I4OA 4P72A 1OTCA 5JJIA 5M5XH 1PHJA 4JI4L 1FJGL 4NXMQ 4LUZA 3PO2H 3ER0A 2JEBI 4PZ8A 3PIOA 2OWOA 2GVBA 1JJGA 3CCVA 2NVXH 4IPDA 1HZ9A 4DAMA 1YNXA 1IXRA 2GN5A 5BR8L 5ELNA 2UUCQ 2JA7G 4A3CG 3I4MH 4DR6L 4QY7A 4DV5L 3CCRA 1IZ6A 4X66L 1MJCA 3PF5A 1EFWA 3WWVA 3CAMA 3UDGA 1N33Q 3NELA 4P73A 4X64Q 1XPOA 1XNRL 2CFMA 1SMXA 3NEMA 4L5TA 1K0RA 1Y1WG 3I4NH 3PF4A 1H95A 1N32L 5C44G 3EBEA 4HJ7A 3KJOA 3AEVA 3J81c 2ES2A 1BBWA 2UXDQ 1HNZL 2EXDA 1A0IA 3CC4A 3K8AA 4MTNA 3D31A 5C0XI 1KIXA 1D8LA 1FGUA 3CC2A 5LMUQ 1WJJA 5C4XH 2E5LQ 4GKKQ 4GNXA 4IO9A 4GOPB 2JA5G 2R7ZH 2NN6I 1EQQA 3HOYH 4UP8A 4O0AA 3S1RH 4LF9L 1D7QA 4DV6L 1XNQQ 3S2HH 4YHHQ 1OXXK 1I50H 3HOXG 1J6QA 3I7FA 3S15H 4TQUS 4A93G 2UXBQ 4JCVE 4OWWB 5M5YH 2KENA 1HZCA 4HIMA 1V1QA 3JAMi 1QVGA 4JBMA 1NY4A 3I2ZA 1WI5A 2K4KA 2RHQB 4GN3B 5GADC 4NXNL 2K50A 4R4IA 1VQEA 2RF4A 2DUDA 3CW2C 5IY0A 3J80c 2JEAI 4B3RQ 4IJLA 4DR4Q 4A3BH 5ELOA 4IFDG 2PMZE 4A3LG 4GOPA 1LYLA 1R9TH 4DR2Q 3MEFA 3IRBA 4NXML 3HOVH 4QIWE 1C0AA 1IBKQ 3RN5A 3M7NA 3H15A 4JOIC 3CCJA 1LTLA 3S24A 4DUYQ 1EIFA 2KCTA 2YTVA 3OTOQ 1NBWA 2L15A 4A3MH 1SLJA 4JI0Q 4JG2A 1VQFA 1YI2A 1YITA 4NB3A 3S17H 2N49A 1RIPA 2VY3A 3J80i 1U5KA 3BZKA 1Q7YC 3CCLA 3PCOB 4A3GG 4KHZA 1CKOA 1XPRA 4JI7Q 2LXKA 1G51A 4LF6Q 4BBRH 5LMNW 4YCUA 4DR5Q 4OXPA 1NE3A 1IBML 2VL6A 4JI3Q 1X56A 2Q2UA 5IYBH 5M3MH 1E7ZA 3OYYA 5LMNL 4APVA
chains in the Genus database with same CATH superfamily
5FLXW 4K8IA 4V0BA 4LF8L 1Q82C 1A2TA 1PZID 4ECQA 4JI3H 2KHJA 2XWBB 5EGTA 5C6AA 1E24A 4C5AA 4IUTA 3HOUH 4LFCL 4JI5Q 1Q86C 3VPBA 2VS1A 2VUMG 4F4ZA 2FK1A 3TIIA 2F0QA 3T1HQ 2YU9H 4ILWA 5HGQA 3E6ZX 1Z7TA 3GLKA 4ED7A 4JV5H 3E3XA 4CBVA 3PSIA 5AJ3Q 3K5OA 4QUCA 3RJ0A 3KHHA 3BA8A 2BCOA 4HJ5A 4C3JH 4DR7H 3I12A 2RDJA 3EJIA 1SYCA 1A63A 2R93H 2WB1G 4K5WA 4GLXA 4ZI7F 4HSVA 2C9OA 2FJ2A 2W9CA 1JX4A 4DR4L 2JE6I 4DR2L 2A6HD 5E7NA 4DL3A 1KDAA 4C3IG 1M7JA 5BMVF 4DNRB 4HJ9A 3D3RA 1K28A 1KNEA 1AUXA 1EYZA 4B08A 5JEAJ 2UXCH 2N55A 1HFNA 5C0XH 1S3OA 2RBMA 1K1SA 2KCNA 3HXLA 5E3FA 4K5XA 1G2TA 5EKLA 1D5ZC 1GSAA 3PIO3 3GTMH 2VNUD 2CQYA 4YB8B 5M5WB 1P8LA 1TY0A 4DL7A 1DV2A 3Q6SA 2B2YA 1GO3E 1HXYD 1DOLA 3FKIB 5FJ8G 3EA6A 3SK5A 4KHPL 2FPPB 3EPGA 4JI8H 3VYRA 3EN2A 1UC8A 4YR3A 5GROA 4HCSA 1F9SA 2QILA 3K0YA 4L5QA 1GHJA 5IODA 1JT8A 1GUTA 1TIID 4RCNA 4DL5A 2P5ZX 4IRDA 5K2MA 3C3LA 3RTXA 2OCEA 3DHQA 1KLGD 2JA8G 1ENAA 2RCNA 1VF7A 1PFMA 1KJJA 1PH2A 5FLMH 3TRZA 3W3AA 2GPWA 1K8OA 1V1PB 2PI2A 2PI2E 4IOAA 1GHKA 1N34H 1SYGA 1WOCA 5L37A 1J9OA 5JEAH 5CV4A 4OX9H 3S2DH 2VB2X 1VQCA 1M1KC 3MWEA 4B3MQ 3C2PA 2JP1A 2K5HA 2V4RA 5C3EH 3MAQA 1XMOQ 1GGOA 1D1KA 3MJFA 2ZM6Q 4QIWB 1KDCA 1JJ2A 4KTAA 4B9XA 3I72A 2FINB 1MHWC 5M3FG 1AN8A 5KT3A 5JJZA 4K5VA 1LV9A 1B3QA 3UDXA 2UU9Q 4H7BA 4JOIA 3FDSA 3U58A 3TQTA 3PMFA 1VQ8A 4DV3H 1BKBA 2K1BA 3K5MA 5KKNB 4AQYQ 4UCUA 1BNZA 2FHTA 3Q22A 1TT2A 3A8KE 4C5CA 2E8GA 1FNUA 2JN4A 2HHHQ 2JA7H 3DLLA 2W6QA 1Z2PX 4PMWA 2PVPA 4O3RA 1CZGA 3RNUA 1ZXTA 1XX8A 3MTSA 3HOZB 3BYTB 4HIKA 3NGDA 3GIPA 2I8CA 3DUZA 2MCTA 2Z4HA 3I56A 4YWKA 3FHWA 4QCLA 1YBYA 4X65Q 3KAKA 2CW7A 3L4JA 1JOOA 4HJ8A 4C1NI 4HMIA 1VQDA 1HQRD 4DV2Q 3F2UA 1HPCA 2LY7A 1N33L 1W96A 2FPGB 3H3VI 2I87A 1HNXH 1I6UA 1B3AA 3CC7A 3PUWA 4O2DA 3GTLB 4IUVA 3S14H 1CT1D 2RDFA 2ZXOA 3MWMA 4JV5Q 4BY7B 3KOJA 5LMUL 2P0AA 1I4QA 1CE8A 3HOXB 5I6YA 2SCUB 3CU7A 3OUZA 4DR7Q 3OUUA 4JC0A 5JJLA 3G8CA 4A3EB 3OSPA 1BCPC 1JDEA 4EG0A 1S40A 4RG1A 2VQEH 1EY9A 4J1MA 2XSCA 3H0GA 4DR3L 2BH8A 1NCVA 2NN6G 3S16B 5EBCA 1R9TA 4DR6Q 1B9NA 3T13A 1EUJA 4F50A 4TQRA 5IWAL 4ZYSA 1SYDA 4TUYF 1TU2B 2HUGA 4MTDA 3RZDH 2VW9A 3UDIA 4I7AA 3EPIA 1F77A 3TP8A 4QGUA 2E2JB 3MXNA 4V190 3A5ZB 5E1FA 2B2TA 1T94A 1XDNA 4UCRA 2CKZB 4OIKA 1TWGB 4PZ7A 3WO0A 1D1IA 3RV4A 1XNRH 1YNJD 1OXUA 4UCTA 5LP6F 5KFOA 4JI7L 3V6KA 4LF6L 1AH9A 4UPAA 4GN5A 4F4WA 3PUVA 2TSSA 2D9UA 1GJXA 3AYHB 4P71A 4QJFA 3NHHA 1CQIB 3ETJA 2PW7A 3KXYT 1O7LA 2B2TC 1VAJA 4JBWA 1WYDA 1PH3A 5BPHA 1FL0A 2B2WC 3OHXC 4UCVA 4AYBB 1O75A 2OH2A 4DL6A 2AGQA 1N34Q 3HOYG 3CPFA 2I46A 2BR0A 2K5WA 1K83H 1STBA 1HQMC 1AUVA 2MP1A 5DLFA 4RAUC 2AQ2B 4JI5L 3RLNA 4OX9Q 2A69D 3PO3H 4EGJA 4EGQA 3A5UA 2EYFA 4M8AA 3T1HL 1N9WA 1CA6A 3MR2A 2B8FA 4B3TL 2W9AA 3KHLA 3UFXB 1DM0B 5AJ3L 5FD6A 3KJPA 2RDIA 4MV4A 3LGJA 3V2TA 2IMWP 3BS1A 1L1OA 3MR3A 4C3IH 2K28A 2WAQB 3RV3A 4XQNA 2C2DA 5EWEA 5CBEE 2KA7A 2VA3A 2YV5A 4NXMH 5J1ZA 2RGRA 3QZ7A 5KX5F 1VQGA 3RAXA 4FYDA 2R7DA 3K5LA 4A3MG 3STBC 4FS1A 1TKWB 1PH8A 5FJ8H 5H1SE 1A8VA 3I73A 4RH6A 3UI2A 3CXCA 3QIAA 1DXMA 2LS01 2IY5B 1UE7A 2B2UA 2BH2A 3GTJA 5FO9B 3DM3A 5BPFA 1ULZA 1KAAA 4GZYC 3JAMc 2DZDA 4A3CH 4L1KA 3FMAA 5KG0A 5LMNH 1UC9A 1PYSB 4OGQC 1VQ9A 2JA8H 5J3BA 1K1QA 2C28A 5C4XB 4FXDA 1JXLA 3T5JA 4LF8H 1LUZA 2M9VA 3BDCA 1WCMA 2Z1CA 1HNXQ 4LFCH 1M8AA 2W6MA 4HEDA 4L6TB 4ULLA 3KLRA 4A3FG 1MBYA 5DLQE 2O4XA 3GTGH 5K36G 4MTEA 3SVMA 1MIUA 1YJWA 4X6AH 4RB2C 3HOWG 1EU4A 4YIJA 2W9BA 4DAYA 1KABA 1HA5A 1S5DD 2K05A 3HKZB 4KN4C 5M3FH 5KFWA 2B63A 2Z6KA 1GUSA 5IGCA 3EYYA 2QCPX 2R7ZA 3KBGA 4B3ML 3HOVB 3V6HA 4DR4H 2I07B 2RSNA 2NWGA 1XMOL 4DR2H 1TWAH 5D65A 2BDNA 4IJHA 2MPMA 4JBJA 3K80C 3S17B 1QUQB 3UE0A 3BVMA 1KQSA 1ZYRD 3AU7A 4GOPC 2F0EA 2QF7A 1RK6A 5DQGA 1PH7A 3PV0A 4JI0H 1ASZA 1CHQD 2UU9L 2SNMA 2JA6G 2F4VQ 4ID6A 3UDFA 4AQYL 1J8IA 1PK8A 1RF2D 4R8IA 5M3MB 1V43A 4KHPH 5IP9G 1SE2A 3S1QH 3DWPA 2K5QA 1C4QA 1HFGA 4EYIB 2Y0SA 1XWEA 2Y0SE 3GTQH 3BVGA 1B7YB 5F2DA 3R8BA 1ET9A 1A6XA 4J9RA 2V1CC 4A76A 3HOUB 2Q2HA 2C2RA 2Q8IB 2UUBQ 3LP8A 4YJ3F 4RHSA 4DUZH 2YU9B 5J39A 1VQIA 3MEHA 3OIQA 5C5MA 1K8GA 1V4YA 1PZKD 3G6XA 4YY3Q 2R7LA 2JJQA 2DPIA 3F8TA 3X3NA 1C9OA 4DV2L 5EPJA 4C3JB 1SE8A 5JPMC 4F88A 2DJGC 4BXXG 2R93B 3KF6A 2A68C 1SR3A 1DJRD 4I65A 4JVZA 2EIFA 3EROA 1I7LA 5CAEB 5KFMA 3H4BA 1RL2A 5IYCH 4GC6A 4PWQA 3MR5A 2E2HA 1OXSC 2K52A 1I7NA 3A55A 5EQ0A 4BBSG 2DLNA 1GSHA 3I4OA 4P72A 5CV7A 1OTCA 3A54A 4ME5A 5A35A 4RGMA 4NXMQ 2R84A 4NLGA 2XNAC 1TY2A 3GTMB 4HNTA 2JEBI 4HCEA 1SBBB 3CCVA 2NVXH 1IBLH 1JWSD 1IXRA 4YBZB 5D1OA 5LOVF 3OIPA 4IURA 2W6ZA 4ZOLF 3J81L 1AZPA 4DR6L 4X66L 4ECSA 3VYUA 1MJCA 3N52A 3PF5A 1KC7A 1EFWA 3ORQA 3CAMA 4FF2A 2R7KA 4WJWA 5KG3A 3EQLC 4EYHB 4YAJB 3DWQA 1DD2A 3M9MB 1S0NA 4CJ2C 5F9NA 4L5TA 1Y1WG 4ZHQF 3FKIA 2K33A 4HJ7A 4FS2A 5E4XA 1N33H 1BBWA 2L1BA 1A0IA 3K8AA 2JSOA 3D31A 1KIXA 1D8LA 4KMUC 4IUUA 2E5LQ 4CGYB 3QB3A 3S2DB 4DV0H 3HOYH 5C3XA 2RA4A 5IGFA 1Z6HA 4CJ1B 5C3EB 3S2HH 2M2LA 3IG0A 5F9LA 4I7HA 2HVSA 3S15H 4A93G 1V1PA 3J80E 5EWFA 3T51B 3JAMi 4JBMA 3I2ZA 4XYMB 3BVZA 4RGOS 1QE6A 2MUYA 3RUPA 5JPNC 5KFUA 5DG8A 1VQEA 3WOFA 1IL8A 2CH4A 1DOMA 2DUDA 1SE3A 5IY0A 3KK7A 5ISRA 3BQ1A 1QCBD 2AQ3B 3H91A 4DR4Q 2PMZE 1JWMD 3DM1A 4DR2Q 2ICEC 2KOLA 1SE4A 3IRBA 4QIWE 4QIWA 4DR3H 2JA7B 1H9MA 3J7AV 3KBXA 2YTVA 5KYLA 4F87A 4A3MH 3H09A 5IWAH 2R61A 1OO9B 1YITA 4JI0Q 4PDBA 5ELBA 1IW7D 2VY3A 3GQBA 1Q7YC 4G7OC 1ZEQX 1XPRA 4J8QA 1EEID 3QWNA 2JEFA 4OXPA 3JSNA 4HSPA 1X56A 1QNUA 2Q2UA 4C3HG 2IA6A 1E7ZA 4A3JG 1PTOD 3K6OA 1I4GA 4JI7H 2WKCA 4LF6H 5LYJF 4UY8C 1Y8PB 1MJEA 4WFN3 3L9AX 4MV6A 2WIIB 3S14B 1BJTA 4HJAA 4DUZQ 4UFZA 4ZUJA 5DM73 2KEEA 1SNDA 3A8JE 4DR1Q 3EIVA 5IT9L 5IYDG 5K36H 4LF7Q 1PV4A 3HOWH 2C5CA 1G91A 3H20A 4I55F 3I4LA 2IPKD 1YNNC 1PH5A 1AE3A 5KYIA 3SE0A 1MKHA 4JI5H 1CKNB 3GTLA 2YTXA 2X69A 1AEXA 1PH9A 3T1HH 1X3GA 3GTOA 1QG7A 4B3TH 3NENA 1PFBA 4UP9A 3PUZA 2PZWA 3WNZA 2B2VA 1UWVA 4ED8A 1TWCH 1SYBA 5A2QE 4IAJA 1KXLA 3NQIA 4A75A 2X0SA 2NVYH 5IGGA 4RAYA 1EWHA 3A56A 4M9UA 4PG3A 1IBKL 4CKEA 5KFBA 5JVG3 1VQ4A 3KAJA 2W7OA 4IWXA 4HIOA 3D4RA 2WDTA 3GQCA 2AGPA 2B2VC 4Q43A 4QL5A 1NJIC 1U4MA 2F0OA 5GAEC 2YRXA 1IBLQ 3S1NH 3RAQA 3K7AH 5GONF 2B29A 4EQNA 5KG6A 2IT1A 1EYDA 1EL0A 5KG7A 2ATWA 1YIJA 5I47A 3MR6A 4RA8A 4O3OA 1BQQT 2ZXPA 5ELCA 2F4VL 4XX0B 3NUCA 4Y7NH 4LH7A 4A3KH 3VMMA 4LW1A 1QB5D 2NTTA 3QJYA 4ZKBB 3OMGA 3GV3A 2LKVA 4ODGA 1JOQA 5KFQA 4FVMA 3E0EA 4DFAA 1PXUA 3OW2A 2F0FA 3GTPH 4ZUIA 1PFNA 1TWGA 1E1OA 2EYPA 1XYIA 1Z47A 3MFYA 3P75A 1K3RA 2RGVA 3Q0AA 1K83B 2DNCA 3PO3B 3VR5A 3V4ZA 2UUBL 3WDNA 4DV0Q 5NUCA 4BXXH 3SXHA 4YY3L 3F2DA 2EJMA 2RHSB 3RBEA 1M0WA 3H0GG 4GLAC 4DF7A 2J7ZA 4UCOA 4AYBA 2Q8TA 4C3IB 2GVAA 5KG4A 4KKSA 3H3VH 1SJED 1Q3LA 2L55A 4B3MH 2ZJQA 1CKMA 4AIMA 3I8ZA 5KIXA 5KFSA 1S5CD 1XMOH 4ZAIA 2E75C 1A3TA 4DR3Q 3CQZA 1G2SA 2VQFL 2XTIA 2WAQA 2WAQE 1I4PA 2ID0A 4O42A 3K58A 1CTMA 1X65A 2OTJA 1YZ6A 3BG3A 5IWAQ 4EGVA 4RGNA 3HP3A 2XCPA 3I90A 1HR0Q 3CKIB 2HD3A 1VQ7A 1F2YA 3SEBA 1RTNA 5KNCA 4APMA 4IPCA 2JA8B 3KLSA 1JR0D 1OXVA 1Y1WH 2OLSA 1Q81C 4F4YA 5KEEA 4POGA 4JUZA 2AUJD 5KFYA 2YZNA 4A4IA 5CMDA 3GTGB 3MFGA 1BF4A 3ERQA 1SYFA 5C5LA 4K0KQ 3OMCA 2FXQA 3CVZA 5FPRA 4DV2H 4RKBA 4H0LC 2PO4A 3PR4A 4A93H 4DV7Q 1G6PA 3SE7A 4FDBA 1NTGA 5M3FB 3KHRA 2E5LL 4XTCS 5C0XJ 5FLXL 1X3EA 3HKSA 1W6KA 1VQPA 4B3TQ 1TWAB 1Q1BA 4TV9F 1T5XD 1V1OA 1RHPA 4C2MA 4WD3A 1HTLD 5C8YF 4YJ2F 2J4XA 4F4XA 1BBUA 4GS3A 3HKZA 2R92G 3M3YH 2V4QA 4DV5Q 4FXGC 5D3IB 3A7LA 3C1EA 1YJ9A 3KDFB 3M85A 3W5OA 3S1QB 4A2AA 1QUQA 1NSNS 2VQDA 2Z0SA 4XYQA 3GTQB 4DR6H 2AMCB 4X66H 3I4MG 4JI0L 5EKKA 4C3HH 2DIKA 4A3JH 1MI2A 1PTOF 1PH6A 5CYUA 4YCWA 1Y1VH 1JB7A 3Q2OA 1ESRA 1SYXB 5COYA 4TV8F 3G71A 1LTBD 2FLLA 1N36L 3ULLA 2EY5A 3DXJC 5IYDH 4IFDI 5JVDF 3O13A 4XYOA 1K9MC 1E4EA 2B63G 1A15A 1T9HA 3M4QA 2R85A 1TS5A 3K0XA 4YP3A 2ASJA 2R7ZG 1EHIA 3K5NA 4DUZL 1UAPA 4TQSA 2CW0D 4DR1L 1A62A 1X55A 1B50A 4LF7L 5EKIA 4KY7A 1VMCA 4RGTA 5KG2A 4KKTA 5I9PA 4MV3A 3PW5A 3R3OA 5AFWA 4IOCA 4IWYA 2EPBA 2KJXA 5KT6A 2R93A 2CVRA 3CCSA 1SDFA 4OO1H 5EAYA 4L5RC 1CSPA 1KRSA 1KD1C 2EOTA 2NVXB 2ZT9C 4A3BG 1E4FT 1EY0A 3TN2A 2MHVA 4IPHA 1QNKA 1RYRA 3U9TA 2RKSA 2Y0SG 4CDDC 1E2WA 4MHEA 3TP5A 4DNIA 1IBMQ 2KHSA 4FBUA 1Q8KA 4NP5A 4MNOA 3JAME 4CC5A 1X9NA 4P74A 4A3IG 2UUAL 2HQLA 1YHAA 2QW7A 4QWDA 3M4OH 2R8HA 2R8GA 3GTMA 4YCVA 2VZAA 4KLKA 3VR6A 2MQHA 5GQOA 3Q24A 3OPOA 2ZJPA 4U673 4I4TF 1KEEA 4BBRG 2CQOA 1IBLL 1VQBA 3ZJYC 3J80W 1S4ZA 5L1JA 4YR0A 4F8MA 1PRTF 3V4SA 1QZHA 3N6RA 2AGOA 2EYMA 4JI2L 3S1MH 2ZTDA 3LX0A 3K7UC 1RTOA 3J80L 4YWMA 1A3VA 5BN4A 3HOYB 3HEJA 4KJNA 2CH4W 4NMZA 3BZDB 2VXWA 1MSGA 3S2HB 4Q0YA 4G3IA 4LFBL 2EVBA 3S15B 2NTSA 2HIVA 2VPQA 1C48A 1OWTA 1YNJC 4GNXC 4CDFC 3CCMA 3H0GH 5LHY1 3N8DA 2F0UA 5KFXA 3LWBA 1KAWA 4GKKH 3JC66 4ECRA 4K2KA 1R4QB 1KJIA 4DV0L 2HVQA 4HIDA 4PMCA 1X54A 2EE1A 1HHVA 4WJ4A 2W70A 2DGYA 1TWFH 3CP0A 3E0JA 2N8NA 5DQIA 2GPSA 4N8FA 1I6HH 1IBKH 4X62L 2LMCB 4AH6A 2A69C 4A3MB 4J6HA 5J22A 4J9LA 2DY8A 2HDLA 2R7FA 4R1JA 1UE5A 5KFVA 1Q46A 5D1PA 1TWHH 4KJOA 3GIKA 4A3LH 2PW5A 2C00A 4IZOA 5EOYA 3J7AK 3RLFA 1V8QA 3VA5A 3FKIG 2IX1A 3RB0A 2I80A 3GIQA 4EEYA 4DR5H 1HR0W 1LTID 2W8KA 4DXGA 1E22A 1F2MA 1ONLA 2K5VA 4X66Q 2O2LD 5CA1F 1S5FD 2F4VH 4POFA 1FD7D 1ZETA 3NBHB 1HR0L 4A3GH 1Y14B 1EZ8A 3WOEA 2QYZA 5A2QW 1C3OA 1B70B 1B04A 2L12A 1SYEA 2OQKA 3T16A 3HOWB 2B2WA 2GLTA 3QR8A 5FO7B 3ULJA 4NPSA 4DK6C 4MAMA 3T1YQ 2A73B 4H13C 1X3QA 2YZGA 2UUBH 3AB9A 5HBRB 2R6FA 4K0KL 3A0JA 2B3GA 4YY3H 2MO0A 3OSOA 2NZOA 4CDCC 4LH6A 4IR1A 2VUMH 1TWCB 2NVQH 4ALPA 3C46A 4UAIA 3R23A 2NVYB 1Z2OX 1XXGA 2V58A 3JZIA 4CJ0B 1QVCA 4DV7L 4XQJA 1QOHA 2CZGA 1KNAA 1W6JA 2C35B 3G48A 3PIP3 1XMQQ 2R92H 1IL2A 3TQ1A 2XN9C 4MV1A 1N56A 1KLUD 1SFOA 1IKLA 1FJGL 3S1NB 3K7AB 3PIOA 4R7RA 3R5HA 2VQFH 4IPDA 4NW2A 2VB3X 5ELNA 2UUCQ 3PO2B 1MZBA 1B1ZA 4IHJF 1ESFA 4X3KA 4Y7NB 3I4MH 5EJWA 2F0JA 4Q5VA 4A3KB 4DV5L 1JICA 1IZ6A 3CCRA 4R8NA 4XT3B 2G9DA 1STYA 3WWVA 2IP4A 3UDGA 1ZYRC 4B3SH 3NELA 3GTPB 1XPOA 2EYJA 3QOJA 3NEMA 4IALA 3PF4A 4DV4H 1H95A 1WTVA 2QKIC 4KK7A 3J81c 2ES2A 2UXDQ 1HNZL 5DGBA 1HCZA 1A9XA 2K7VA 4MTNA 1QVFA 5C0XI 2W57A 1JE4A 1FGUA 1CFMA 1STEA 1WJJA 5DM63 2M05A 2XCLA 3K3PA 2JA5G 2R7ZH 3Q8QB 3S1RH 5DG9A 1D7QA 1F2LA 1C30A 2UU9H 3GILA 3SK4A 4YHHQ 1OXXK 4RB3C 3FDTA 1I50H 3HOXG 3K59A 1J6QA 4TQUS 1AW7A 2F0IA 1K83A 2E5LH 5M5YH 1HUMA 1B53A 2KENA 5KFHA 3TZUA 2E2DC 4GKKQ 2XRQD 2RHQB 4MTKA 2XRSD 5GADC 1NR4A 3EFXD 2K50A 1KBLA 4M7EA 4JW0A 4JV1A 1ILQA 3CW2C 3NSWA 4B3RQ 1XTCD 4O2AF 3GIJA 1NR2A 4RAZA 1N48A 3HG9A 4A3BH 4IFDG 5CV9A 3BDOA 4GOPA 1LYLA 3HB9A 2KUMA 1C0AA 1IBKQ 3RN5A 4ECYA 3CCJA 1LT6D 3I70A 1NBWA 2Z6BA 4PMBA 2GA4B 2N49A 3BZKA 4QF4A 3CCLA 2F4IA 2G9HD 1CKOA 1S5ED 3CRLC 2XIGA 4IUPA 2LXKA 1Y1WB 2R8IA 1G51A 1RJQA 4BBRH 3D4DA 2K03A 4YCUA 4DR5Q 1WTWA 1IBML 3NBIA 1BR9A 5D3DA 4KD4A 4YQWA 3OYYA 1JC7A 1EEFD 4APVA 4DK0A 1NUCA 1TVXA 2BQUA 1JQYD 3BU2A 2K32A 1N36H 3TEHB 5J2TF 3RB4A 1PTOH 4OWTB 1BXTA 1EY4A 2R8KA 3ULPA 4A93B 3U50C 2HJWA 2VA2A 2E2HH 4OEMB 1XNQL 3GP7A 2FB9A 3RZOH 2V9WA 2UXBL 3GTGA 3MHBA 5BN3A 4L8JA 2EDGA 2F0VA 2K5DA 4LMYA 4DR1H 2EXZA 1WR2A 4LF7H 2X6LA 4N8X1 3S9WA 1IYJB 5IT9c 5IP7G 1I5FA 1VS0A 3GD7A 2H5XA 2WAQG 2Q8RE 1JMCA 3M3YB 1L0XB 3E5NA 2Q2TA 3HFZB 5L1LA 2IHFA 1F9RA 3HGBA 1SEIA 1A3UA 1SXTA 2N78A 3NXWA 4Q45A 2JEJA 4ECZA 1JCKB 1S03G 3OTOL 1I4RA 1JB3A 1KDBA 4Q8EA 1GM5A 2W8LA 5KNBA 4QW8A 2K04A 5IGEA 1RKNA 2NUCA 3FKIH 2VQFQ 2ZDQA 5EZYF 4U7CA 2NN6H 1NNXA 4X3SA 4HTHA 4C3HB 1LLRD 5LL6X 5FO8B 4A3JB 1ASYA 2UUAH 2FKLA 3OHAA 5DLGA 1Y1VB 3CCUA 4PV1C 4QB4A 4IN3A 5T1IA 1IOWA 3VR4A 3H6MA 3KDFA 5KFAA 5HGTA 2SNSA 4B3SQ 4UCSA 3GV7B 3GTQA 1IW7C 2J0TD 3LWEA 4GNXB 4JI2H 4DV4Q 1PH4A 2D5DA 4LF9H 4DPGA 4PNYA 5D8DA 4OWXB 5FK9C 3RBDA 3SHLA 4J15A 4LFBH 3PIPA 2HGSA 2OTLA 3NTHA 2AUKA 2Z9HA 1PTOC 2F52A 4MV8A 3V6JA 4MA5A 1IKMA 2E76C 1F9PA 4LF5Q 3T1YL 3JAMW 4R4QA 3G7LA 2K5NA 2ENBA 3QG1A 3N6XA 1LM0A 1NMFA 3HOVG 5I6WA 4Q0FA 3L3OC 3J81i 3E9HA 3AQQA 4DU9A 3ORRA 4DL4A 2ZTEA 4DV1Q 1ILPA 1JIHA 3U4VA 4X62H 3GTKH 2O5JC 1H9SB 1W2BA 4YWLA 2IW3A 4JYAL 3VYSA 5KFTA 3SGIA 1XMQL 4MIUA 4R4CA 1VDZA 3UE1A 3M4OB 4RZQA 2XGTA 4ZQ3A 3PW2A 1SNCA 1HUNA 2NVXA 4O3PA 1DONA 2YYZA 4RUAA 1S68A 4CKBA 3NTKA 2K75A 2YRWA 3JSLA 3S1MB 2UUCL 1W3SA 2AQ4A 4DXFA 2CHBD 1HR0H 4ED6A 3HOUG 2EJFC 3SK8A 4R8UB 1PYBA 3E9IA 2IHEA 5JVH3 1MGSA 2NZHA 1VF5C 4BA2I 5JJKA 5JQWA 3GTOH 1N36Q 1F2ZA 2MNAA 3AFPA 2JA5H 3C0FB 4CKCA 4RZRA 3OSNA 4C3JG 5FD5A 1BGWA 3HOXH 2UXDL 1AFPA 2R93G 1WTQA 1PRTC 3RR5A 4K0KH 1EQVA 5BN5A 1D6EC 1CUKA 4A3FH 2R82A 5FPOA 1PX2A 1TWFB 1SRUA 3A7AB 4RCOA 2RCFA 5C4ZA 4YHHL 2IWHA 1ZHQA 2FE3A 2OQ0A 1EOTA 1GVPA 1I6HB 2AHOB 4DV7H 4IRKA 4JI4Q 1Y69U 1GUOA 4IFDH 3VDYA 1JOKA 3AMUA 4EFBA 4GKKL 2J6UA 1BVSA 1CHPD 1TWHB 5FLXc 2L5TA 5KFGA 1G291 4RHRA 1FJGH 1GKHA 4FF3A 4B3RL 2R6GA 2WV6D 1HNWH 3G6YA 1E1TA 1PYWD 3TQYA 4JI1H 4ZRZA 1VBGA 1EFID 1AE2A 1LT5D 1X6OA 2Z8LA 2UUAQ 4A3GB 4Y52H 2FK3A 5EWGA 2JA6H 3RZDB 5C1PA 1YVCA 4DN4M 5EDWA 4OELB 4J9OA 3TREA 1SMYC 4LNQA 2OF1A 1LTAD 3BJYA 3CHBD 5IP9H 2ASBA 1H9KA 1P16A 4DR5L 3I4NG 4JI2Q 1DYQA 4LF9Q 5JEAG 1HNZH 3NBHA 1FYCA 2KBNA 2SEBD 3NE5B 5CV6A 2IX0A 1BNCA 5CV5A 4H44C 4J9QA 4CHTB 2QDBA 2VPSA 4LFBQ 4WORA 2VUMB 1PRTD 3CF5A 4GKJQ 2NVQB 2EQSA 2HQEA 1EYAA 4NXNQ 3PUYA 1IOVA 5KFEA 1STAA 1SNPA 3MXGA 4IUNA 3VYTA 4E6IA 5DQHA 5KFFA 4DAVA 4Q8FA 4H02A 3KALA 1EWIA 4LFAL 3CQZH 5IP7H 3FEWX 2R92B 2NYZD 3PW7A 4R4TA 5I9OA 1M0TA 2R7MA 2E2IH 1RDPD 3PUXA 1EIGA 2WB1B 3ZYYX 4UHVA 3KLSX 1WTOA 1J5EL 1VBHA 3M9BA 2F0LA 4KHVA 2NVYA 4UP7A 1YJNA 4O4HF 4AYBE 4QWEA 1PVOA 1ENCA 2TMPA 4X62Q 3J81j 1BUVT 3L2PA 2UVWA 4J9MA 2FLNA 4MZ9A 3PQIA 3I4MB 2RVLA 4RWSC 1D5XC 3MZ5A 4BBSH 2KCMA 5G3LD 3W1BA 3P1HA 4LK1C 2NU6B 4G7HC 1S97A 4JI6Q 3K57A 2UVVA 3BG5A 3SI8A 4KKUA 1UE6A 1VQNA 2MGSA 4FF4A 1U0LA 1I3QH 3IFTA 3VR2A 3IAYA 4RUCA 1IBMH 1NMGA 1EQRA 1SMYD 1VQJA 2CCZA 1EYGA 2JEIA 4KN7C 4K2LA 3J7A5 5IYBG 4DAYB 2WINB 5KG1A 1SAPA 2EZVA 4B3SL 1Y8NB 3S1RB 3CCQA 3Q8PB 1E3PA 5HY6A 3BA9A 2F0MA 1I50B 4IZ8A 2G5DA 4ZK9B 1JWUD 4DV4L 4C2MH 1EY5A 3PW0A 1XNQH 2PNHA 5EPKA 1PA6A 5M5YB 1O7ZA 4EBDA 2QGQA 3R5XA 2K6AA 2I5MX 2EJGC 4ECTA 2UXBH 2L0CA 4QQBX 2CW8A 1U4PA 2DJFC 2VOBA 3VA7A 3ETHA 1LT4D 5KG5A 1PLFA 3RD4A 4A3BB 1XJVA 2FLPA 3TS0A 3PR5B 2XVSA 4ME3A 4LF5L 2V5AA 3KLWA 2CW0C 1HRJA 1KTKA 1CQVA 4JBKA 5DG7A 3PZPA 2WACA 2WTFA 1C8CA 1EU3A 3OTOH 2B39A 1Q1EA 1EUDB 5KFLA 2PQEA 1FJGQ 4A3DG 4O3SA 4MV9A 4DV1L 3W1GA 2XD4A 5T14A 4BBRB 1HNWQ 1PFSA 1YHQA 3H3VC 1T36A 2ZJRA 3HKZE 4JI1Q 4O4LF 4CDEC 3R93A 2KSWA 5LA6F 4EFEA 2A8VA 1X3PA 3RN2A 4U68A 3SR1A 4F7XA 1RJRA 1HTPA 3G6EA 3N44B 1B33N 5GAGC 1UEBA 1EOVA 2KQ3A 3KF6B 3RIZA 1JDBB 2EY6A 2KHIA 1PTOB 1Y1WA 5KT4A 4E4TA 4BY1G 2E2HB 1WCMG 3M4PA 1S0MA 3RZOB 1QZGA 1HNZQ 2JQOA 3PO3G 1PH1A 1GLVA 2UVUA 3HZXA 4I7ZC 4BS9A 4RMFA 2I5LX 1WD0A 3E5SA 2DWCA 2DN8A 1II3A 2H1EA 1EIYB 5HURA 2BDOA 1CZWA 1GUWA 4DK1A 2MO1A 5D1OB 4JPBW 1DV1A 4TVAB 3T1YH 1BBXC 3Q8DA 4ED0A 2A6ED 3OOCA 2YS7A 3GIDA 2BQ3A 3OWEB 4P2CB 4XT1B 2YU9A 1EYCA 1RJTA 3QZ8A 2WP8J 4P75A 1I94L 4LMQD 5ELDA 2JYOA 5JJIA 5M5XH 3M7GA 3MFIA 4JI4L 5IYZF 3LMLA 4LUZA 4JYAH 3ER0A 1JJGA 1T3NA 4RB1A 2D2CC 1LTSD 2FMAA 1XMQH 1HZ9A 5IOCA 3KUPA 1CQJB 4MA0A 1CS0A 4FBTA 1SJHD 1CA5A 5IGDA 4A3CG 3RFCA 4QY7A 2SDFA 2F3VA 1G6ZA 1SNMA 4X3TA 1Y8OB 2DNEA 3J81E 2B2YC 4J9SA 2UUCH 4X64Q 4RU9A 2CFMA 1X32A 3I4NH 4DV5H 1N32L 4Z9CB 3ND9A 5C44G 1Y1VA 1DOKA 3EBEA 2KVMA 2F03A 1PRTB 3AEVA 3VPDA 4YAKB 3KHGA 4XQQA 1FKAH 4O3QA 2EY2A 3H94A 3CC4A 4NDXA 3CC2A 4KD3A 3TP7A 4N9PA 4A2BA 4MV7A 1VMPA 2PMZB 2ZDGA 4GNXA 4IO9A 4RB0A 1EQQA 4O0AA 4LF9L 3LNNA 1JORA 2UXDH 1XNQQ 3MFHA 2XGQA 1TS2A 2FPIB 3I7FA 4IQZA 2UXBQ 2NZ1D 4JCVE 4OWWB 1EUCB 1WTPA 4HIMA 1QVGA 4GKJL 1NY4A 2K4KA 4GN3B 3RB6A 4NXNL 4LF4H 4YHHH 4FXKC 4O4IF 1B6RA 5HV6A 2ALZA 1B4OA 1TS3A 3GTKB 2RF4A 2IL8A 2JEAI 4OHJA 1RK5A 2A74C 2FP4B 3MXPA 1ENFA 1R9TH 1SCUB 2AU0A 3ITPA 3OW7A 3OHBA 3ND8A 4WRDA 3H15A 4JOIC 4MN3A 1LTRD 1GUNA 1LTLA 3S24A 1H9JA 2C22A 3QO2A 1EIFA 1EY7A 3CRKC 1I4XA 1STHA 2KCTA 5G3LF 2L11A 3OTOQ 4HNUA 4B3RH 3RUZA 1VQFA 1YI2A 4NB3A 2XGPA 1RIPA 3J80i 1U4LA 1U5KA 2MJ8A 2NU9B 1H9SA 4KHZA 1ZQ7A 4ABNA 4FP5D 1B44D 3R5FA 1NE3A 2V59A 2NU7B 4QW9A 4JI3Q 2BQRA 5IYBH 2K01A 2KCCA 4HMJA 4JI6L 3GTOB 3T5KA 1UNSA 2JA7A 3GO5A 2JA5B 2JEGA 2I0QA 3NWSA 1HZBA 4HR7B 1VQ6A 4FF1A 1CK1A 1TXYA 3C1FA 2BOSA 4G7ZC 4R8UA 3RLOA 4ECUA 5DAUA 4A3FB 5IT9E 2XWJB 2FJZA 2NU8B 3BZCA 2ASLA 3NP8A 5IYCG 2PQAB 4M1UB 4BWGB 5IGBA 3AFQA 5KT7A 4DNTB 2WFWA 1SFOH 2N3SA 4ZCKA 1AN7A 5A2QL 3KYHC 4LFAH 1EY8A 4BWSC 1LABA 1VQOA 1VQLA 5I4DA 1H9RA 5CA0F 5KFCA 1VKZA 2PZTA 2R86A 2UXCQ 2IBKA 3DWAA 1J5EH 3BQ0A 2LXJA 5M9OA 5BR8H 1TWFA 1M4VA 2EY1A 4DUYL 2W6PA 3KF8B 4LSAA 4A3DH 4J9NA 4NKLA 5T1GA 2YZMA 3ICEA 3D6CA 1ZKOA 4JYAQ 4JI8Q 1AP0A 4LSXA 1CKNA 3B6YA 3MWYW 5FOBB 2JA6B 3DF7A 1TWHA 2ICIA 1STGA 4DK3C 4WJ3M 1CQFA 4HYKA 4FO2A 2F0WA 3CCEA 3GTJH 1KHIA 1KRTA 4EQ5A 3H40A 4IR9A 1HNWL 5CBAE 2EYHA 4J9KA 4JI1L 2X6GA 3T56B 1L0WA 1K8AC 2NVTH 1O78A 4YR2A 5C4JH 4BY1H 3CMAA 3T5HA 1WCMH 4DV6H 3HOZG 1E2ZA 1N8RC 1VQAA 1TQOA 1CM9A 1BO0A 4KY5A 1XPUA 5DEHA 1BCPD 1QILA 2LSSA 1JE5A 2ALYB 3Q23A 3CQZB 1JLLB 3CPWA 4XZ3B 1LTGD 5JUMA 1B8AA 1U4RA 3A74A 5GAHC 4LAAA 2OXPA 2E2IB 2B63H 4K8JA 1SEBD 1Z9FA 1K0SA 4DV3Q 4QWAA 2VUMA 4Q44A 3TSSA 1RCVD 3FVQA 4IPGA 4BY7G 3BYYB 1KJQA 5EPLA 4DKAC 3M9NB 4LF4Q 1WSCA 4IUQA 1B9MA 5C4HA 4DL2A 4LF5H 2V4DA 5JOBA 1EWCA 1YEZA 2YL2A 1GD7A 1L1OC 3HBLA 4A3EG 1B2TA 4BBSB 3GDEA 2QA4A 2R92A 4GLVB 5KFPA 2HCIA 4G4KA 2WB1E 2WB1A 4DLKA 4FM9A 4QUFA 4U6PA 1DGSA 1NAPA 2C2EA 4DV1H 3CMEA 2IX3A 2F1MA 3J7ZC 1WTHA 1I3QB 2JK8A 2OEOA 2RQXA 3DMUA 3RF2A 3L0OA 4TRDA 1KC8C 2XCAA 2CWAA 2AQ1B 5J2UF 2IJ0A 1V9PA 1LO5D 1LACA 4OO1I 2ZTCA 4A3IH 2M00A 2HT1A 1BDOA 2B2UC 3I3CA 4FNFA 4ZLTF 1WH2A 1D5MC 5C44H 3KFUA 4RFBA 1EQTA 3K5HA 1DCZA 2W71A 2W6OA 3G4SA 5L1KA 3FMCA 3RB3A 4X64L 4C2MB 3I91A 3G6VA 1ZHSA 3BJUA 1Q90A 2YW2A 4K14A 1FVIA 4LJZC 1Q12A 1U9RA 5CV8A 3WO1A 2J6TA 4B9WA 5I2YA 3IN5A 4LUVA 2EYLA 3PGZA 1K3BC 5JAVA 2PBZA 1XTDA 3TINA 3BQ2A 3W2DA 5KFRA 2W9CB 1I50A 1JJCB 1K8MA 2ZM6L 2VQEQ 4AYBG 1E4GT 4K6DA 3FPUB 1GOZA 2CWPA 5FLXE 4LFAQ 2R87A 2JA9A 3TDQA 3D8GA 4R4OA 1GYFA 3STBD 5H80A 2Z6KC 5KNDA 1VQ5A 1O7IA 5EBDA 1GUGA 1GSOA 1J5EQ 3MC0B 2PN1A 1I94H 3TZDA 5BR8Q 5CC4A 4PZ6A 1FNVA 1VQMA 3K81C 4ETSA 4HNVA 4JI4H 4C5BA 2HHHL 2F0PA 4CC6A 3PO2G 3RGZA 3P7JA 3T5LA 2D62A 4Y8VB 3F2CA 2QDLA 3ONAB 3SK6A 4A3KG 2W7PA 1XNRQ 1IYVA 1VCIA 1E4EB 1TWAA 1UE1A 2RSOA 2R3ZA 2F0SA 1Q8IA 5M5WH 3MVVA 1X3FA 4FU0A 2A1AA 4X65L 1EY6A 2CQAA 3ERSX 1WTXA 4ME6A 1FR3A 3D0FA 2OT2A 2PPBC 2AWNA 1A2UA 1N32H 3LWUA 4JI3L 1KL9A 4DV6Q 1WD1A 3QFFA 4HQ6A 3UQ8A 2RDGA 1C7YA 1L2FA 2PZUA 3F2BA 1LT3D 4JV0A 4X3UA 1WTRA 5C4XG 5CB4F 2HDMA 4JV5L 2HVRA 5LL6S 3FP9A 3F1ZA 2VR1A 4DA2A 2AKWB 4ECXA 4DR7L 1EIHA 2NB0A 2BE5C 4GN4B 3Q8RB 4GC7A 3NK9A 3HS0C 2MFIA 4GKJH 5L1IA 5K5PA 4NXNH 4BA1I 5M5XB 3J81W 1HH2P 1AZQA 4EQPA 2F3IA 3T4AC 4OL7A 3HKZG 2F0NA 4I50F 1UUPA 1SSOA 2AWOA 2UXCL 2KEDA 4DGZA 5KFNA 4QWBA 3JAML 3U4ZA 5KFKA 2ZDHA 2KECA 2QK4A 1HJPA 2F0GA 2Z4IA 2I5HA 3MWDA 2DY7A 2F0TA 3G6JB 3BABA 5ELFA 1TR5A 5LMNQ 2XC9A 2QEXA 3JRWA 4JI8L 5IE8A 3M4IA 1I6VC 1ML0D 2Q2IA 4LF8Q 5IIFA 3FPPA 1M90C 3I4NB 4RNMA 1KJ9A 1DZ1A 2HIXA 3TBIB 1PZJD 4J0MA 5KT2A 4LFCQ 2O03A 4JI6H 5M3MG 3HOZH 5LL6b 1BCPB 1TAEA 1S0OA 3L7ZC 3OWFA 5JVLA 2FMMA 2A68D 4K6LA 4ED3A 3VPCA 5LMUH 1RJPA 2YYAA 2PNRC 3JRXA 1BOSA 1BCPF 4IFDJ 4LWCA 4WBNF 4XXEA 3M9OB 1N34L 3Q8SB 4PQXA 4O1NA 4EQOA 3TMEA 1PMRA 1YHBA 4OX9L 4OIJA 3GTLH 2BE5D 3N40P 4O2BF 2D0OA 1S5BD 2PMZA 1WFQA 4J9PA 3L4KA 3M4YA 4O3NA 4BY7H 2L4NA 3BAAA 4OONA 3H0GB 4N9TA 4ZKCB 1R9TB 1QJOA 4A3EH 1V51A 1O7YA 4JV2A 4DV3L 1OXTA 3U9SA 4G57A 1I94Q 3GV6A 1IHZA 4DUYH 4LF4L 3MXNB 2YS6A 3GTKA 3GIIA 2FMCA 2NUAB 4KHPQ 5CGKA 4EX5A 3S16H 2A19A 4XIGS 5C0XG 3HRZC 5KRUA 3K3VA 5KT5A 1Y1VG 1L0YB 4LUOA 1K73C 1DIKA 1SN8A 5D14A 1KJ8A 2YCHA 5IT9W 3N41B 3TS2A 3D6WA 2BA0A 4L63B 2E2JH 1VQHA 2D0PA 5JH7F 4QMGA 4KI0A 5DNFA 3N42B 1RD9D 3NTIA 4QWCA 1TWGH 2ZXRA 1S72A 1EZ1A 1G8ZD 2BA1A 2E74C 1GXDC 1N32Q 3IKJA 5KGUA 1HNXL 1B6SA 1D2BA 4HN7A 3J7YW 2XIWA 1HA6A 2O5IC 1IYUA 2J6SA 4ED1A 5FLMG 2ASDA 2JA5A 2F0DA 4XDXA 1SFOB 1S9FA 1SNOA 2F3WA 4DAPA 3V96A 3TP6A 4ECVA 3V05A 4EEQA 3EVQA 3I55A 3CD6A 4HAEA 4HR7A 3MXUA 1L1OB 3DEPA 4OO1G 5DGAA 3D4WA 4IRCA 1JKJB 2WE6A 1O80A 5KFZA 3TIGA 2FFKB 5C3EG 2W6NA 2K14A 1MSHA 1VQKA 4RKLA 1UNNC 4ECWA 5I2XA 2YTYA 1CSQA 2PQAA 3J7AF 3N43B 1HZAA 2H4OA 4KY6A 3RMHA 4A3DB 2VQEL 1SROA 1TA8A 3SDZA 3A8IE 1PHJA 3PO2H 4PZ8A 3PW4A 2OWOA 2GVBA 4C1NK 2ATLA 4EBCA 3X3MA 4DAMA 3GTJB 1TWCA 1YNXA 1UEAB 2GN5A 2A5HA 1I4HA 2NBFA 4EVOA 5BR8L 2FK2A 3Q1KA 3RGXA 3KF8A 2JA7G 3P20A 1BXRA 2R8JA 5L9XA 4TKOB 1F9QA 4UDUC 2RDHA 1STNA 3K5IA 2NVTB 2VUGA 3U9OA 1N33Q 4ZQIA 1M6VA 5C4JB 4BY1B 2ZJTA 2DPJA 2R7NA 4P73A 1WCMB 2JA6A 1XNRL 4RNNA 3QOLA 4ED2A 2B8GA 1ICFB 1RODA 1FGBD 1SMXA 1K0RA 5ELEA 1ET6A 1YNND 2F0KA 5CORA 5LXTF 1Z2NX 3KJOA 2QEJC 2EXDA 2F0HA 3FRPB 4X64H 4S3SA 3DEOA 4JK1C 5C4XH 5LMUQ 1E2VA 3KTMA 3VR3A 4GOPB 1RYSA 4RNOA 2NN6I 2W9BB 2UVRA 4UP8A 3R2IA 4DV6L 2WKDA 3MA2B 2B63B 3PVXA 2EYOA 4KV6A 5TSSA 5C3WA 3GIMA 3NQTA 1S10A 2JXMB 2R7ZB 3GTPA 4XYLB 3BDLA 3R2TA 3URYA 2ZM6H 1HZCA 4L5SA 1V1QA 4C56C 3GV5B 1PDQA 3PN1A 1CI3M 1WI5A 5KFIA 1LTTD 2N88A 3F8NA 1TS4A 3IFDA 4R4IA 5CR3A 5KFDA 1E0BA 2PCFB 5C1OA 3J80c 2E2IA 1L2ZA 1W93A 4IJLA 5ELOA 4EBEA 4A3LG 4AQYH 3MEFA 5FKAC 4NXML 2A6HC 3HOVH 3M7NA 2L9HA 5C5JA 3GV8B 3IL8A 5E4WC 1QWYA 4DUYQ 4TSSA 2HHHH 3H4DA 2A6EC 2L15A 1SLJA 2J9GA 4JG2A 3S17H 3T53B 1FNWA 4R9WA 2HCCA 2SOBA 2Y0SB 1T5EA 2LFNA 3PCOB 4A3GG 1ICWA 2PYKA 4JI7Q 4A3IB 1EZ6A 4LF6Q 5KFJA 1WVLA 3NWTA 5C44B 5LMNW 2WYOA 2VL6A 4X65H 1R4PB 1MD2D 5M3MH 1I3QA 3NPPA 5LMNL 1SNQA
chains in the Genus database with same CATH topology
3BU2A 3GO5A 4UY8C 4LF8L 1Q82C 1MJEA 4A3JG 3TEHB 2KHJA 4HJAA 4DUZQ 1E24A 4OWTB 3HOUH 4LFCL 3ULPA 2I0QA 1VQ6A 1HZBA 1Q86C 4JI5Q 3U50C 4DR1Q 1TXYA 2VS1A 3EIVA 5IYDG 2VUMG 4LF7Q 2E2HH 3RLOA 1XNQL 3T1HQ 2YU9H 5HGQA 1PV4A 3HOWH 3RZOH 3PSIA 5AJ3Q 3BZCA 5IYCG 2UXBL 2PQAB 1PH5A 1AE3A 3AFQA 4HJ5A 1MKHA 4C3JH 1CKNB 2WFWA 1SFOH 2YTXA 2N3SA 1PH9A 1X3GA 3KYHC 1IYJB 3NENA 4UP9A 3PUZA 1A63A 2R93H 2WB1G 5IT9c 1UWVA 1VQOA 1VQLA 5IP7G 1TWCH 1I5FA 1VS0A 3GD7A 4GLXA 1KXLA 4A75A 2H5XA 2WAQG 1JMCA 2NVYH 4DR4L 2UXCQ 2Q2TA 3HFZB 2JE6I 2LXJA 2IHFA 4DR2L 5E7NA 4PG3A 1IBKL 4HJ9A 2N78A 4DUYL 3KF8B 4A3DH 3OTOL 1VQ4A 1GM5A 5JEAJ 4HIOA 3ICEA 4JYAQ 4JI8Q 1S3OA 1CKNA 4QL5A 3B6YA 1NJIC 3FKIH 5GAEC 2VQFQ 1IBLQ 2VNUD 3GTMH 3S1NH 3K7AH 4DK3C 2B29A 1P8LA 4WJ3M 2IT1A 1ASYA 3CCEA 3GTJH 1GO3E 2ATWA 5FJ8G 1YIJA 4KHPL 3CCUA 1KHIA 1KRTA 3EN2A 4EQ5A 2F4VL 4Y7NH 5GROA 3KDFA 4A3KH 1HNWL 4LW1A 4B3SQ 4JI1L 1L0WA 4L5QA 1K8AC 2NVTH 1JT8A 5C4JH 3E0EA 3CMAA 4DV4Q 4GNXB 3OW2A 1PH4A 4BY1H 1WCMH 3GTPH 4DPGA 3HOZG 2OCEA 1VQAA 1N8RC 2JA8G 1E1OA 4OWXB 2RCNA 1Z47A 5FLMH 1PH2A 3TRZA 1K3RA 4J15A 1XPUA 2IY5B 2PI2A 2PI2E 3PIPA 4IOAA 2OTLA 2LSSA 2UUBL 4DV0Q 1JE5A 1WOCA 2ALYB 2F52A 4BXXH 3CPWA 3S2DH 1VQCA 1B8AA 4YY3L 3A74A 3F2DA 1M1KC 2RHSB 4B3MQ 5GAHC 4L5SA 2K5HA 5C3EH 2B63H 4LF5Q 3H0GG 4GLAC 4R4QA 3T1YL 1XMOQ 1Z9FA 2K5NA 4DV3Q 2ZM6Q 2GVAA 1LM0A 1NMFA 4IPGA 3HOVG 1JJ2A 3H3VH 4BY7G 4DKAC 4LF4Q 5M3FG 2ZJQA 1CKMA 3E9HA 4AIMA 3AQQA 3J81i 3UDXA 2UU9Q 2ZTEA 4DV1Q 4JOIA 1YEZA 3U58A 1GD7A 1L1OC 1VQ8A 3U4VA 1BKBA 4A3EG 3GTKH 3GDEA 2QA4A 4AQYQ 4GLVB 1W2BA 4YWLA 4DR3Q 2WB1E 4JYAL 2E8GA 3SGIA 2XTIA 4R4CA 2WAQE 1DGSA 3UE1A 2ID0A 2VQFL 1XMQL 2HHHQ 2XGTA 1X65A 1YZ6A 3CMEA 5IWAQ 2JA7H 3DLLA 3J7ZC 4PMWA 2JK8A 1HR0Q 3RNUA 3L0OA 2YYZA 1VQ7A 1KC8C 2CWAA 2K75A 4HIKA 4IPCA 1V9PA 2UUCL 1W3SA 4OO1I 2ZTCA 1OXVA 3I56A 4A3IH 4YWKA 3FHWA 1Y1WH 1YBYA 4X65Q 1Q81C 2HT1A 3HOUG 5C44H 4HJ8A 4POGA 3KFUA 4GKJL 1PYBA 3E9IA 1VQDA 2IHEA 4A4IA 4DV2Q 3G4SA 1N33L 2NZHA 5JJKA 4BA2I 3H3VI 4X64L 3GTOH 1N36Q 4K0KQ 3CC7A 2MNAA 3AFPA 3BJUA 3PUWA 2JA5H 2FXQA 4O2DA 1FVIA 1Q12A 3S14H 3HOXH 2UXDL 4LUVA 3PGZA 4A93H 1XTDA 4DV7Q 2R93G 4JV5Q 1G6PA 3KOJA 4FDBA 3RR5A 1NTGA 5LMUL 2E5LL 4XTCS 5C0XJ 1JJCB 1CUKA 2ZM6L 1X3EA 4AYBG 2VQEQ 4A3FH 4DR7Q 4JC0A 5JJLA 1SRUA 3HKSA 2CWPA 4YHHL 4LFAQ 1VQPA 2OQ0A 4B3TQ 1GVPA 1Q1BA 2AHOB 2JA9A 1S40A 4JI4Q 4R4OA 3STBD 3VDYA 2Z6KC 4RG1A 1VQ5A 1O7IA 1J5EQ 4GKKL 1BBUA 4GS3A 5BR8Q 1BVSA 2R92G 4DR3L 5FLXc 3M3YH 4PZ6A 2BH8A 1VQMA 3K81C 2NN6G 4DR6Q 1G291 2HHHL 4DV5Q 1GKHA 1EUJA 4B3RL 2R6GA 5IWAL 3PO2G 2OTJA 1YJ9A 1E1TA 2D62A 3KDFB 3F2CA 3M85A 3TQYA 3W5OA 4A3KG 3RZDH 1QUQA 3UDIA 2VW9A 1XNRQ 1VCIA 2Z0SA 4QGUA 1UE1A 2AMCB 3A5ZB 1AE2A 1X6OA 2UUAQ 3I4MG 4Y52H 4JI0L 2JA6H 2CKZB 1YVCA 5M5WH 4C3HH 1X3FA 2A1AA 4X65L 4PZ7A 4A3JH 1PH6A 3ERSX 4YCWA 1Y1VH 3D0FA 1JB7A 3TREA 1OXUA 4LNQA 2AWNA 4JI7L 4LF6L 1AH9A 5IP9H 4UPAA 4GN5A 3G71A 1P16A 2ASBA 4DR5L 3I4NG 4JI2Q 3PUVA 1N36L 4LF9Q 4JI3L 1KL9A 5JEAG 3AYHB 3ULLA 4DV6Q 4P71A 4QJFA 1C7YA 2KBNA 5IYDH 1L2FA 4IFDI 3F2BA 2IX0A 1K9MC 4JI6L 4JBWA 1WYDA 1PH3A 1FL0A 2B63G 5C4XG 1T9HA 3M4QA 4LFBQ 1N34Q 3K0XA 3CF5A 4GKJQ 4JV5L 3HOYG 3CPFA 2EQSA 2R7ZG 3FP9A 3F1ZA 1K83H 4DUZL 4NXNQ 3PUYA 3HOZH 2AKWB 3PO3H 4JI5L 3RLNA 4OX9Q 4DR7L 4DR1L 1A62A 1X55A 3A5UA 4H02A 4LF7L 1EWIA 4GN4B 1N9WA 3T1HL 4LFAL 3CQZH 4B3TL 5IP7H 2MFIA 5AJ3L 4IOCA 3KJPA 4R4TA 2E2IH 4BA1I 3PUXA 3LGJA 1HH2P 1J5EL 1L1OA 3CCSA 4C3IH 2F3IA 3M9BA 5EAYA 4L5RC 1CSPA 4UP7A 1YJNA 3HKZG 1KRSA 1KD1C 4AYBE 4A3BG 2YV5A 1PVOA 4X62Q 3J81j 2AWOA 3L2PA 2UXCL 4IPHA 4MZ9A 2Y0SG 1VQGA 4BBSH 3U4ZA 2KCMA 1IBMQ 3W1BA 4DNIA 2R7DA 1HJPA 4A3MG 1Q8KA 3STBC 4MNOA 2I5HA 1X9NA 4P74A 1PH8A 4A3IG 5FJ8H 2UUAL 2HQLA 1YHAA 1A8VA 5H1SE 3CXCA 5LMNQ 4JI6Q 3M4OH 2QEXA 4YCVA 2VZAA 4KLKA 2MQHA 5GQOA 1UE6A 4JI8L 5IE8A 2Q2IA 2ZJPA 1U0LA 1I3QH 1UE7A 1M90C 4LF8Q 1VQNA 2BH2A 3DM3A 4BBRG 1NMGA 1EQRA 2CQOA 1VQBA 1VQJA 3ZJYC 2HIXA 1EYGA 1IBLL 3JAMc 2CCZA 4A3CH 4LFCQ 3J7A5 5IYBG 5M3MG 4DAYB 1PYSB 1QZHA 4JI2L 1VQ9A 3S1MH 2JA8H 5J3BA 2ZTDA 3L7ZC 3K7UC 4YWMA 1LUZA 4B3SL 3CCQA 1HNXQ 4IFDJ 1E3PA 4LWCA 5HY6A 4LFBL 1N34L 4DV4L 4A3FG 4C2MH 2HIVA 5DLQE 5K36G 2PNHA 3GTGH 1PA6A 1YHBA 1MIUA 4GNXC 1YJWA 2QGQA 4X6AH 4OX9L 3GTLH 3CCMA 2I5MX 3HOWG 1QVFA 4QQBX 3H0GH 2D0OA 1KAWA 1WFQA 3JC66 4DV0L 4BY7H 4HIDA 4OONA 5M3FH 2Z6KA 1X54A 1XJVA 4B3ML 4WJ4A 3TS0A 2DGYA 1TWFH 3CP0A 2N8NA 4ME3A 4LF5L 4A3EH 1XMOL 1TWAH 1I6HH 4DV3L 3KLWA 4X62L 1OXTA 4IJHA 4JBJA 4AH6A 3K80C 1I94Q 4JBKA 1QUQB 3UE0A 1KQSA 4LF4L 2R7FA 4R1JA 4GOPC 3MXNB 1UE5A 1PH7A 1Q1EA 3PV0A 4A3DG 1FJGQ 1ASZA 4KHPQ 1Q46A 2UU9L 1TWHH 4DV1L 2JA6G 4A3LH 3W1GA 2F4VQ 4EX5A 3S16H 2A19A 4XIGS 3RLFA 5C0XG 1HNWQ 1PFSA 3UDFA 4AQYL 1YHQA 3FKIG 2ZJRA 3HKZE 4JI1Q 2IX1A 1Y1VG 4LUOA 1K73C 2A8VA 3RN2A 1SN8A 1HR0W 1V43A 5IP9G 1E22A 2K5VA 3G6EA 3TS2A 3S1QH 4X66Q 2BA0A 4POFA 2E2JH 2Y0SE 1VQHA 2D0PA 5GAGC 3NBHB 1B7YB 3GTQH 1UEBA 1EOVA 3KF6B 1HR0L 4A3GH 4KI0A 1Y14B 2V1CC 2KHIA 4A76A 1TWGH 1S72A 2BA1A 2Q2HA 2UUBQ 1B70B 4BY1G 1N32Q 1HNXL 1WCMG 2OQKA 3M4PA 1VQIA 1K8GA 1QZGA 1HNZQ 4YY3Q 2JQOA 3PO3G 2JJQA 3F8TA 3ULJA 1C9OA 4NPSA 5FLMG 4DK6C 1PH1A 4DV2L 3T1YQ 1SE8A 4RMFA 2I5LX 4K0KL 3A0JA 2B3GA 1EIYB 3I55A 2MO0A 3CD6A 2NZOA 4BXXG 3KF6A 1SR3A 1L1OB 2VUMH 2EIFA 4ALPA 2NVQH 4OO1G 2MO1A 4TVAB 3Q8DA 5C3EG 1RL2A 1QVCA 2K14A 1VQKA 4DV7L 5IYCH 2YTYA 1CSQA 2PQAA 1OXSC 2K52A 2C35B 3G48A 1HZAA 2VQEL 1SROA 2WP8J 1XMQQ 4P75A 1I94L 1IL2A 2R92H 4BBSG 3I4OA 4P72A 1OTCA 5JJIA 5M5XH 1PHJA 4JI4L 1FJGL 4NXMQ 4LUZA 3PO2H 3ER0A 2JEBI 4PZ8A 3PIOA 2OWOA 2GVBA 1JJGA 3CCVA 2NVXH 4IPDA 1HZ9A 4DAMA 1YNXA 1IXRA 2GN5A 5BR8L 5ELNA 2UUCQ 2JA7G 4A3CG 3I4MH 4DR6L 4QY7A 4DV5L 3CCRA 1IZ6A 4X66L 1MJCA 3PF5A 1EFWA 3WWVA 3CAMA 3UDGA 1N33Q 3NELA 4P73A 4X64Q 1XPOA 1XNRL 2CFMA 1SMXA 3NEMA 4L5TA 1K0RA 1Y1WG 3I4NH 3PF4A 1H95A 1N32L 5C44G 3EBEA 4HJ7A 3KJOA 3AEVA 3J81c 2ES2A 1BBWA 2UXDQ 1HNZL 2EXDA 1A0IA 3CC4A 3K8AA 4MTNA 3D31A 5C0XI 1KIXA 1D8LA 1FGUA 3CC2A 5LMUQ 1WJJA 5C4XH 2E5LQ 4GKKQ 4GNXA 4IO9A 4GOPB 2JA5G 2R7ZH 2NN6I 1EQQA 3HOYH 4UP8A 4O0AA 3S1RH 4LF9L 1D7QA 4DV6L 1XNQQ 3S2HH 4YHHQ 1OXXK 1I50H 3HOXG 1J6QA 3I7FA 3S15H 4TQUS 4A93G 2UXBQ 4JCVE 4OWWB 5M5YH 2KENA 1HZCA 4HIMA 1V1QA 3JAMi 1QVGA 4JBMA 1NY4A 3I2ZA 1WI5A 2K4KA 2RHQB 4GN3B 5GADC 4NXNL 2K50A 4R4IA 1VQEA 2RF4A 2DUDA 3CW2C 5IY0A 3J80c 2JEAI 4B3RQ 4IJLA 4DR4Q 4A3BH 5ELOA 4IFDG 2PMZE 4A3LG 4GOPA 1LYLA 1R9TH 4DR2Q 3MEFA 3IRBA 4NXML 3HOVH 4QIWE 1C0AA 1IBKQ 3RN5A 3M7NA 3H15A 4JOIC 3CCJA 1LTLA 3S24A 4DUYQ 1EIFA 2KCTA 2YTVA 3OTOQ 1NBWA 2L15A 4A3MH 1SLJA 4JI0Q 4JG2A 1VQFA 1YI2A 1YITA 4NB3A 3S17H 2N49A 1RIPA 2VY3A 3J80i 1U5KA 3BZKA 1Q7YC 3CCLA 3PCOB 4A3GG 4KHZA 1CKOA 1XPRA 4JI7Q 2LXKA 1G51A 4LF6Q 4BBRH 5LMNW 4YCUA 4DR5Q 4OXPA 1NE3A 1IBML 2VL6A 4JI3Q 1X56A 2Q2UA 5IYBH 5M3MH 1E7ZA 3OYYA 5LMNL 4APVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU2 A;  3GO5 A;  4UY8 C;  4LF8 L;  1Q82 C;  1MJE A;  4A3J G;  3TEH B;  2KHJ A;  4HJA A;  4DUZ Q;  1E24 A;  4OWT B;  3HOU H;  4LFC L;  3ULP A;  2I0Q A;  1VQ6 A;  1HZB A;  1Q86 C;  4JI5 Q;  3U50 C;  4DR1 Q;  1TXY A;  2VS1 A;  3EIV A;  5IYD G;  2VUM G;  4LF7 Q;  2E2H H;  3RLO A;  1XNQ L;  3T1H Q;  2YU9 H;  5HGQ A;  1PV4 A;  3HOW H;  3RZO H;  3PSI A;  5AJ3 Q;  3BZC A;  5IYC G;  2UXB L;  2PQA B;  1PH5 A;  1AE3 A;  3AFQ A;  4HJ5 A;  1MKH A;  4C3J H;  1CKN B;  2WFW A;  1SFO H;  2YTX A;  2N3S A;  1PH9 A;  1X3G A;  3KYH C;  1IYJ B;  3NEN A;  4UP9 A;  3PUZ A;  1A63 A;  2R93 H;  2WB1 G;  5IT9 c;  1UWV A;  1VQO A;  1VQL A;  5IP7 G;  1TWC H;  1I5F A;  1VS0 A;  3GD7 A;  4GLX A;  1KXL A;  4A75 A;  2H5X A;  2WAQ G;  1JMC A;  2NVY H;  4DR4 L;  2UXC Q;  2Q2T A;  3HFZ B;  2JE6 I;  2LXJ A;  2IHF A;  4DR2 L;  5E7N A;  4PG3 A;  1IBK L;  4HJ9 A;  2N78 A;  4DUY L;  3KF8 B;  4A3D H;  3OTO L;  1VQ4 A;  1GM5 A;  5JEA J;  4HIO A;  3ICE A;  4JYA Q;  4JI8 Q;  1S3O A;  1CKN A;  4QL5 A;  3B6Y A;  1NJI C;  3FKI H;  5GAE C;  2VQF Q;  1IBL Q;  2VNU D;  3GTM H;  3S1N H;  3K7A H;  4DK3 C;  2B29 A;  1P8L A;  4WJ3 M;  2IT1 A;  1ASY A;  3CCE A;  3GTJ H;  1GO3 E;  2ATW A;  5FJ8 G;  1YIJ A;  4KHP L;  3CCU A;  1KHI A;  1KRT A;  3EN2 A;  4EQ5 A;  2F4V L;  4Y7N H;  5GRO A;  3KDF A;  4A3K H;  1HNW L;  4LW1 A;  4B3S Q;  4JI1 L;  1L0W A;  4L5Q A;  1K8A C;  2NVT H;  1JT8 A;  5C4J H;  3E0E A;  3CMA A;  4DV4 Q;  4GNX B;  3OW2 A;  1PH4 A;  4BY1 H;  1WCM H;  3GTP H;  4DPG A;  3HOZ G;  2OCE A;  1VQA A;  1N8R C;  2JA8 G;  1E1O A;  4OWX B;  2RCN A;  1Z47 A;  5FLM H;  1PH2 A;  3TRZ A;  1K3R A;  4J15 A;  1XPU A;  2IY5 B;  2PI2 A;  2PI2 E;  3PIP A;  4IOA A;  2OTL A;  2LSS A;  2UUB L;  4DV0 Q;  1JE5 A;  1WOC A;  2ALY B;  2F52 A;  4BXX H;  3CPW A;  3S2D H;  1VQC A;  1B8A A;  4YY3 L;  3A74 A;  3F2D A;  1M1K C;  2RHS B;  4B3M Q;  5GAH C;  4L5S A;  2K5H A;  5C3E H;  2B63 H;  4LF5 Q;  3H0G G;  4GLA C;  4R4Q A;  3T1Y L;  1XMO Q;  1Z9F A;  2K5N A;  4DV3 Q;  2ZM6 Q;  2GVA A;  1LM0 A;  1NMF A;  4IPG A;  3HOV G;  1JJ2 A;  3H3V H;  4BY7 G;  4DKA C;  4LF4 Q;  5M3F G;  2ZJQ A;  1CKM A;  3E9H A;  4AIM A;  3AQQ A;  3J81 i;  3UDX A;  2UU9 Q;  2ZTE A;  4DV1 Q;  4JOI A;  1YEZ A;  3U58 A;  1GD7 A;  1L1O C;  1VQ8 A;  3U4V A;  1BKB A;  4A3E G;  3GTK H;  3GDE A;  2QA4 A;  4AQY Q;  4GLV B;  1W2B A;  4YWL A;  4DR3 Q;  2WB1 E;  4JYA L;  2E8G A;  3SGI A;  2XTI A;  4R4C A;  2WAQ E;  1DGS A;  3UE1 A;  2ID0 A;  2VQF L;  1XMQ L;  2HHH Q;  2XGT A;  1X65 A;  1YZ6 A;  3CME A;  5IWA Q;  2JA7 H;  3DLL A;  3J7Z C;  4PMW A;  2JK8 A;  1HR0 Q;  3RNU A;  3L0O A;  2YYZ A;  1VQ7 A;  1KC8 C;  2CWA A;  2K75 A;  4HIK A;  4IPC A;  1V9P A;  2UUC L;  1W3S A;  4OO1 I;  2ZTC A;  1OXV A;  3I56 A;  4A3I H;  4YWK A;  3FHW A;  1Y1W H;  1YBY A;  4X65 Q;  1Q81 C;  2HT1 A;  3HOU G;  5C44 H;  4HJ8 A;  4POG A;  3KFU A;  4GKJ L;  1PYB A;  3E9I A;  1VQD A;  2IHE A;  4A4I A;  4DV2 Q;  3G4S A;  1N33 L;  2NZH A;  5JJK A;  4BA2 I;  3H3V I;  4X64 L;  3GTO H;  1N36 Q;  4K0K Q;  3CC7 A;  2MNA A;  3AFP A;  3BJU A;  3PUW A;  2JA5 H;  2FXQ A;  4O2D A;  1FVI A;  1Q12 A;  3S14 H;  3HOX H;  2UXD L;  4LUV A;  3PGZ A;  4A93 H;  1XTD A;  4DV7 Q;  2R93 G;  4JV5 Q;  1G6P A;  3KOJ A;  4FDB A;  3RR5 A;  1NTG A;  5LMU L;  2E5L L;  4XTC S;  5C0X J;  1JJC B;  1CUK A;  2ZM6 L;  1X3E A;  4AYB G;  2VQE Q;  4A3F H;  4DR7 Q;  4JC0 A;  5JJL A;  1SRU A;  3HKS A;  2CWP A;  4YHH L;  4LFA Q;  1VQP A;  2OQ0 A;  4B3T Q;  1GVP A;  1Q1B A;  2AHO B;  2JA9 A;  1S40 A;  4JI4 Q;  4R4O A;  3STB D;  3VDY A;  2Z6K C;  4RG1 A;  1VQ5 A;  1O7I A;  1J5E Q;  4GKK L;  1BBU A;  4GS3 A;  5BR8 Q;  1BVS A;  2R92 G;  4DR3 L;  5FLX c;  3M3Y H;  4PZ6 A;  2BH8 A;  1VQM A;  3K81 C;  2NN6 G;  4DR6 Q;  1G29 1;  2HHH L;  4DV5 Q;  1GKH A;  1EUJ A;  4B3R L;  2R6G A;  5IWA L;  3PO2 G;  2OTJ A;  1YJ9 A;  1E1T A;  2D62 A;  3KDF B;  3F2C A;  3M85 A;  3TQY A;  3W5O A;  4A3K G;  3RZD H;  1QUQ A;  3UDI A;  2VW9 A;  1XNR Q;  1VCI A;  2Z0S A;  4QGU A;  1UE1 A;  2AMC B;  3A5Z B;  1AE2 A;  1X6O A;  2UUA Q;  3I4M G;  4Y52 H;  4JI0 L;  2JA6 H;  2CKZ B;  1YVC A;  5M5W H;  4C3H H;  1X3F A;  2A1A A;  4X65 L;  4PZ7 A;  4A3J H;  1PH6 A;  3ERS X;  4YCW A;  1Y1V H;  3D0F A;  1JB7 A;  3TRE A;  1OXU A;  4LNQ A;  2AWN A;  4JI7 L;  4LF6 L;  1AH9 A;  5IP9 H;  4UPA A;  4GN5 A;  3G71 A;  1P16 A;  2ASB A;  4DR5 L;  3I4N G;  4JI2 Q;  3PUV A;  1N36 L;  4LF9 Q;  4JI3 L;  1KL9 A;  5JEA G;  3AYH B;  3ULL A;  4DV6 Q;  4P71 A;  4QJF A;  1C7Y A;  2KBN A;  5IYD H;  1L2F A;  4IFD I;  3F2B A;  2IX0 A;  1K9M C;  4JI6 L;  4JBW A;  1WYD A;  1PH3 A;  1FL0 A;  2B63 G;  5C4X G;  1T9H A;  3M4Q A;  4LFB Q;  1N34 Q;  3K0X A;  3CF5 A;  4GKJ Q;  4JV5 L;  3HOY G;  3CPF A;  2EQS A;  2R7Z G;  3FP9 A;  3F1Z A;  1K83 H;  4DUZ L;  4NXN Q;  3PUY A;  3HOZ H;  2AKW B;  3PO3 H;  4JI5 L;  3RLN A;  4OX9 Q;  4DR7 L;  4DR1 L;  1A62 A;  1X55 A;  3A5U A;  4H02 A;  4LF7 L;  1EWI A;  4GN4 B;  1N9W A;  3T1H L;  4LFA L;  3CQZ H;  4B3T L;  5IP7 H;  2MFI A;  5AJ3 L;  4IOC A;  3KJP A;  4R4T A;  2E2I H;  4BA1 I;  3PUX A;  3LGJ A;  1HH2 P;  1J5E L;  1L1O A;  3CCS A;  4C3I H;  2F3I A;  3M9B A;  5EAY A;  4L5R C;  1CSP A;  4UP7 A;  1YJN A;  3HKZ G;  1KRS A;  1KD1 C;  4AYB E;  4A3B G;  2YV5 A;  1PVO A;  4X62 Q;  3J81 j;  2AWO A;  3L2P A;  2UXC L;  4IPH A;  4MZ9 A;  2Y0S G;  1VQG A;  4BBS H;  3U4Z A;  2KCM A;  1IBM Q;  3W1B A;  4DNI A;  2R7D A;  1HJP A;  4A3M G;  1Q8K A;  3STB C;  4MNO A;  2I5H A;  1X9N A;  4P74 A;  1PH8 A;  4A3I G;  5FJ8 H;  2UUA L;  2HQL A;  1YHA A;  1A8V A;  5H1S E;  3CXC A;  5LMN Q;  4JI6 Q;  3M4O H;  2QEX A;  4YCV A;  2VZA A;  4KLK A;  2MQH A;  5GQO A;  1UE6 A;  4JI8 L;  5IE8 A;  2Q2I A;  2ZJP A;  1U0L A;  1I3Q H;  1UE7 A;  1M90 C;  4LF8 Q;  1VQN A;  2BH2 A;  3DM3 A;  4BBR G;  1NMG A;  1EQR A;  2CQO A;  1VQB A;  1VQJ A;  3ZJY C;  2HIX A;  1EYG A;  1IBL L;  3JAM c;  2CCZ A;  4A3C H;  4LFC Q;  3J7A 5;  5IYB G;  5M3M G;  4DAY B;  1PYS B;  1QZH A;  4JI2 L;  1VQ9 A;  3S1M H;  2JA8 H;  5J3B A;  2ZTD A;  3L7Z C;  3K7U C;  4YWM A;  1LUZ A;  4B3S L;  3CCQ A;  1HNX Q;  4IFD J;  1E3P A;  4LWC A;  5HY6 A;  4LFB L;  1N34 L;  4DV4 L;  4A3F G;  4C2M H;  2HIV A;  5DLQ E;  5K36 G;  2PNH A;  3GTG H;  1PA6 A;  1YHB A;  1MIU A;  4GNX C;  1YJW A;  2QGQ A;  4X6A H;  4OX9 L;  3GTL H;  3CCM A;  2I5M X;  3HOW G;  1QVF A;  4QQB X;  3H0G H;  2D0O A;  1KAW A;  1WFQ A;  3JC6 6;  4DV0 L;  4BY7 H;  4HID A;  4OON A;  5M3F H;  2Z6K A;  1X54 A;  1XJV A;  4B3M L;  4WJ4 A;  3TS0 A;  2DGY A;  1TWF H;  3CP0 A;  2N8N A;  4ME3 A;  4LF5 L;  4A3E H;  1XMO L;  1TWA H;  1I6H H;  4DV3 L;  3KLW A;  4X62 L;  1OXT A;  4IJH A;  4JBJ A;  4AH6 A;  3K80 C;  1I94 Q;  4JBK A;  1QUQ B;  3UE0 A;  1KQS A;  4LF4 L;  2R7F A;  4R1J A;  4GOP C;  3MXN B;  1UE5 A;  1PH7 A;  1Q1E A;  3PV0 A;  4A3D G;  1FJG Q;  1ASZ A;  4KHP Q;  1Q46 A;  2UU9 L;  1TWH H;  4DV1 L;  2JA6 G;  4A3L H;  3W1G A;  2F4V Q;  4EX5 A;  3S16 H;  2A19 A;  4XIG S;  3RLF A;  5C0X G;  1HNW Q;  1PFS A;  3UDF A;  4AQY L;  1YHQ A;  3FKI G;  2ZJR A;  3HKZ E;  4JI1 Q;  2IX1 A;  1Y1V G;  4LUO A;  1K73 C;  2A8V A;  3RN2 A;  1SN8 A;  1HR0 W;  1V43 A;  5IP9 G;  1E22 A;  2K5V A;  3G6E A;  3TS2 A;  3S1Q H;  4X66 Q;  2BA0 A;  4POF A;  2E2J H;  2Y0S E;  1VQH A;  2D0P A;  5GAG C;  3NBH B;  1B7Y B;  3GTQ H;  1UEB A;  1EOV A;  3KF6 B;  1HR0 L;  4A3G H;  4KI0 A;  1Y14 B;  2V1C C;  2KHI A;  4A76 A;  1TWG H;  1S72 A;  2BA1 A;  2Q2H A;  2UUB Q;  1B70 B;  4BY1 G;  1N32 Q;  1HNX L;  1WCM G;  2OQK A;  3M4P A;  1VQI A;  1K8G A;  1QZG A;  1HNZ Q;  4YY3 Q;  2JQO A;  3PO3 G;  2JJQ A;  3F8T A;  3ULJ A;  1C9O A;  4NPS A;  5FLM G;  4DK6 C;  1PH1 A;  4DV2 L;  3T1Y Q;  1SE8 A;  4RMF A;  2I5L X;  4K0K L;  3A0J A;  2B3G A;  1EIY B;  3I55 A;  2MO0 A;  3CD6 A;  2NZO A;  4BXX G;  3KF6 A;  1SR3 A;  1L1O B;  2VUM H;  2EIF A;  4ALP A;  2NVQ H;  4OO1 G;  2MO1 A;  4TVA B;  3Q8D A;  5C3E G;  1RL2 A;  1QVC A;  2K14 A;  1VQK A;  4DV7 L;  5IYC H;  2YTY A;  1CSQ A;  2PQA A;  1OXS C;  2K52 A;  2C35 B;  3G48 A;  1HZA A;  2VQE L;  1SRO A;  2WP8 J;  1XMQ Q;  4P75 A;  1I94 L;  1IL2 A;  2R92 H;  4BBS G;  3I4O A;  4P72 A;  1OTC A;  5JJI A;  5M5X H;  1PHJ A;  4JI4 L;  1FJG L;  4NXM Q;  4LUZ A;  3PO2 H;  3ER0 A;  2JEB I;  4PZ8 A;  3PIO A;  2OWO A;  2GVB A;  1JJG A;  3CCV A;  2NVX H;  4IPD A;  1HZ9 A;  4DAM A;  1YNX A;  1IXR A;  2GN5 A;  5BR8 L;  5ELN A;  2UUC Q;  2JA7 G;  4A3C G;  3I4M H;  4DR6 L;  4QY7 A;  4DV5 L;  3CCR A;  1IZ6 A;  4X66 L;  1MJC A;  3PF5 A;  1EFW A;  3WWV A;  3CAM A;  3UDG A;  1N33 Q;  3NEL A;  4P73 A;  4X64 Q;  1XPO A;  1XNR L;  2CFM A;  1SMX A;  3NEM A;  4L5T A;  1K0R A;  1Y1W G;  3I4N H;  3PF4 A;  1H95 A;  1N32 L;  5C44 G;  3EBE A;  4HJ7 A;  3KJO A;  3AEV A;  3J81 c;  2ES2 A;  1BBW A;  2UXD Q;  1HNZ L;  2EXD A;  1A0I A;  3CC4 A;  3K8A A;  4MTN A;  3D31 A;  5C0X I;  1KIX A;  1D8L A;  1FGU A;  3CC2 A;  5LMU Q;  1WJJ A;  5C4X H;  2E5L Q;  4GKK Q;  4GNX A;  4IO9 A;  4GOP B;  2JA5 G;  2R7Z H;  2NN6 I;  1EQQ A;  3HOY H;  4UP8 A;  4O0A A;  3S1R H;  4LF9 L;  1D7Q A;  4DV6 L;  1XNQ Q;  3S2H H;  4YHH Q;  1OXX K;  1I50 H;  3HOX G;  1J6Q A;  3I7F A;  3S15 H;  4TQU S;  4A93 G;  2UXB Q;  4JCV E;  4OWW B;  5M5Y H;  2KEN A;  1HZC A;  4HIM A;  1V1Q A;  3JAM i;  1QVG A;  4JBM A;  1NY4 A;  3I2Z A;  1WI5 A;  2K4K A;  2RHQ B;  4GN3 B;  5GAD C;  4NXN L;  2K50 A;  4R4I A;  1VQE A;  2RF4 A;  2DUD A;  3CW2 C;  5IY0 A;  3J80 c;  2JEA I;  4B3R Q;  4IJL A;  4DR4 Q;  4A3B H;  5ELO A;  4IFD G;  2PMZ E;  4A3L G;  4GOP A;  1LYL A;  1R9T H;  4DR2 Q;  3MEF A;  3IRB A;  4NXM L;  3HOV H;  4QIW E;  1C0A A;  1IBK Q;  3RN5 A;  3M7N A;  3H15 A;  4JOI C;  3CCJ A;  1LTL A;  3S24 A;  4DUY Q;  1EIF A;  2KCT A;  2YTV A;  3OTO Q;  1NBW A;  2L15 A;  4A3M H;  1SLJ A;  4JI0 Q;  4JG2 A;  1VQF A;  1YI2 A;  1YIT A;  4NB3 A;  3S17 H;  2N49 A;  1RIP A;  2VY3 A;  3J80 i;  1U5K A;  3BZK A;  1Q7Y C;  3CCL A;  3PCO B;  4A3G G;  4KHZ A;  1CKO A;  1XPR A;  4JI7 Q;  2LXK A;  1G51 A;  4LF6 Q;  4BBR H;  5LMN W;  4YCU A;  4DR5 Q;  4OXP A;  1NE3 A;  1IBM L;  2VL6 A;  4JI3 Q;  1X56 A;  2Q2U A;  5IYB H;  5M3M H;  1E7Z A;  3OYY A;  5LMN L;  4APV A; 
#chains in the Genus database with same CATH topology
 5FLX W;  4K8I A;  4V0B A;  4LF8 L;  1Q82 C;  1A2T A;  1PZI D;  4ECQ A;  4JI3 H;  2KHJ A;  2XWB B;  5EGT A;  5C6A A;  1E24 A;  4C5A A;  4IUT A;  3HOU H;  4LFC L;  4JI5 Q;  1Q86 C;  3VPB A;  2VS1 A;  2VUM G;  4F4Z A;  2FK1 A;  3TII A;  2F0Q A;  3T1H Q;  2YU9 H;  4ILW A;  5HGQ A;  3E6Z X;  1Z7T A;  3GLK A;  4ED7 A;  4JV5 H;  3E3X A;  4CBV A;  3PSI A;  5AJ3 Q;  3K5O A;  4QUC A;  3RJ0 A;  3KHH A;  3BA8 A;  2BCO A;  4HJ5 A;  4C3J H;  4DR7 H;  3I12 A;  2RDJ A;  3EJI A;  1SYC A;  1A63 A;  2R93 H;  2WB1 G;  4K5W A;  4GLX A;  4ZI7 F;  4HSV A;  2C9O A;  2FJ2 A;  2W9C A;  1JX4 A;  4DR4 L;  2JE6 I;  4DR2 L;  2A6H D;  5E7N A;  4DL3 A;  1KDA A;  4C3I G;  1M7J A;  5BMV F;  4DNR B;  4HJ9 A;  3D3R A;  1K28 A;  1KNE A;  1AUX A;  1EYZ A;  4B08 A;  5JEA J;  2UXC H;  2N55 A;  1HFN A;  5C0X H;  1S3O A;  2RBM A;  1K1S A;  2KCN A;  3HXL A;  5E3F A;  4K5X A;  1G2T A;  5EKL A;  1D5Z C;  1GSA A;  3PIO 3;  3GTM H;  2VNU D;  2CQY A;  4YB8 B;  5M5W B;  1P8L A;  1TY0 A;  4DL7 A;  1DV2 A;  3Q6S A;  2B2Y A;  1GO3 E;  1HXY D;  1DOL A;  3FKI B;  5FJ8 G;  3EA6 A;  3SK5 A;  4KHP L;  2FPP B;  3EPG A;  4JI8 H;  3VYR A;  3EN2 A;  1UC8 A;  4YR3 A;  5GRO A;  4HCS A;  1F9S A;  2QIL A;  3K0Y A;  4L5Q A;  1GHJ A;  5IOD A;  1JT8 A;  1GUT A;  1TII D;  4RCN A;  4DL5 A;  2P5Z X;  4IRD A;  5K2M A;  3C3L A;  3RTX A;  2OCE A;  3DHQ A;  1KLG D;  2JA8 G;  1ENA A;  2RCN A;  1VF7 A;  1PFM A;  1KJJ A;  1PH2 A;  5FLM H;  3TRZ A;  3W3A A;  2GPW A;  1K8O A;  1V1P B;  2PI2 A;  2PI2 E;  4IOA A;  1GHK A;  1N34 H;  1SYG A;  1WOC A;  5L37 A;  1J9O A;  5JEA H;  5CV4 A;  4OX9 H;  3S2D H;  2VB2 X;  1VQC A;  1M1K C;  3MWE A;  4B3M Q;  3C2P A;  2JP1 A;  2K5H A;  2V4R A;  5C3E H;  3MAQ A;  1XMO Q;  1GGO A;  1D1K A;  3MJF A;  2ZM6 Q;  4QIW B;  1KDC A;  1JJ2 A;  4KTA A;  4B9X A;  3I72 A;  2FIN B;  1MHW C;  5M3F G;  1AN8 A;  5KT3 A;  5JJZ A;  4K5V A;  1LV9 A;  1B3Q A;  3UDX A;  2UU9 Q;  4H7B A;  4JOI A;  3FDS A;  3U58 A;  3TQT A;  3PMF A;  1VQ8 A;  4DV3 H;  1BKB A;  2K1B A;  3K5M A;  5KKN B;  4AQY Q;  4UCU A;  1BNZ A;  2FHT A;  3Q22 A;  1TT2 A;  3A8K E;  4C5C A;  2E8G A;  1FNU A;  2JN4 A;  2HHH Q;  2JA7 H;  3DLL A;  2W6Q A;  1Z2P X;  4PMW A;  2PVP A;  4O3R A;  1CZG A;  3RNU A;  1ZXT A;  1XX8 A;  3MTS A;  3HOZ B;  3BYT B;  4HIK A;  3NGD A;  3GIP A;  2I8C A;  3DUZ A;  2MCT A;  2Z4H A;  3I56 A;  4YWK A;  3FHW A;  4QCL A;  1YBY A;  4X65 Q;  3KAK A;  2CW7 A;  3L4J A;  1JOO A;  4HJ8 A;  4C1N I;  4HMI A;  1VQD A;  1HQR D;  4DV2 Q;  3F2U A;  1HPC A;  2LY7 A;  1N33 L;  1W96 A;  2FPG B;  3H3V I;  2I87 A;  1HNX H;  1I6U A;  1B3A A;  3CC7 A;  3PUW A;  4O2D A;  3GTL B;  4IUV A;  3S14 H;  1CT1 D;  2RDF A;  2ZXO A;  3MWM A;  4JV5 Q;  4BY7 B;  3KOJ A;  5LMU L;  2P0A A;  1I4Q A;  1CE8 A;  3HOX B;  5I6Y A;  2SCU B;  3CU7 A;  3OUZ A;  4DR7 Q;  3OUU A;  4JC0 A;  5JJL A;  3G8C A;  4A3E B;  3OSP A;  1BCP C;  1JDE A;  4EG0 A;  1S40 A;  4RG1 A;  2VQE H;  1EY9 A;  4J1M A;  2XSC A;  3H0G A;  4DR3 L;  2BH8 A;  1NCV A;  2NN6 G;  3S16 B;  5EBC A;  1R9T A;  4DR6 Q;  1B9N A;  3T13 A;  1EUJ A;  4F50 A;  4TQR A;  5IWA L;  4ZYS A;  1SYD A;  4TUY F;  1TU2 B;  2HUG A;  4MTD A;  3RZD H;  2VW9 A;  3UDI A;  4I7A A;  3EPI A;  1F77 A;  3TP8 A;  4QGU A;  2E2J B;  3MXN A;  4V19 0;  3A5Z B;  5E1F A;  2B2T A;  1T94 A;  1XDN A;  4UCR A;  2CKZ B;  4OIK A;  1TWG B;  4PZ7 A;  3WO0 A;  1D1I A;  3RV4 A;  1XNR H;  1YNJ D;  1OXU A;  4UCT A;  5LP6 F;  5KFO A;  4JI7 L;  3V6K A;  4LF6 L;  1AH9 A;  4UPA A;  4GN5 A;  4F4W A;  3PUV A;  2TSS A;  2D9U A;  1GJX A;  3AYH B;  4P71 A;  4QJF A;  3NHH A;  1CQI B;  3ETJ A;  2PW7 A;  3KXY T;  1O7L A;  2B2T C;  1VAJ A;  4JBW A;  1WYD A;  1PH3 A;  5BPH A;  1FL0 A;  2B2W C;  3OHX C;  4UCV A;  4AYB B;  1O75 A;  2OH2 A;  4DL6 A;  2AGQ A;  1N34 Q;  3HOY G;  3CPF A;  2I46 A;  2BR0 A;  2K5W A;  1K83 H;  1STB A;  1HQM C;  1AUV A;  2MP1 A;  5DLF A;  4RAU C;  2AQ2 B;  4JI5 L;  3RLN A;  4OX9 Q;  2A69 D;  3PO3 H;  4EGJ A;  4EGQ A;  3A5U A;  2EYF A;  4M8A A;  3T1H L;  1N9W A;  1CA6 A;  3MR2 A;  2B8F A;  4B3T L;  2W9A A;  3KHL A;  3UFX B;  1DM0 B;  5AJ3 L;  5FD6 A;  3KJP A;  2RDI A;  4MV4 A;  3LGJ A;  3V2T A;  2IMW P;  3BS1 A;  1L1O A;  3MR3 A;  4C3I H;  2K28 A;  2WAQ B;  3RV3 A;  4XQN A;  2C2D A;  5EWE A;  5CBE E;  2KA7 A;  2VA3 A;  2YV5 A;  4NXM H;  5J1Z A;  2RGR A;  3QZ7 A;  5KX5 F;  1VQG A;  3RAX A;  4FYD A;  2R7D A;  3K5L A;  4A3M G;  3STB C;  4FS1 A;  1TKW B;  1PH8 A;  5FJ8 H;  5H1S E;  1A8V A;  3I73 A;  4RH6 A;  3UI2 A;  3CXC A;  3QIA A;  1DXM A;  2LS0 1;  2IY5 B;  1UE7 A;  2B2U A;  2BH2 A;  3GTJ A;  5FO9 B;  3DM3 A;  5BPF A;  1ULZ A;  1KAA A;  4GZY C;  3JAM c;  2DZD A;  4A3C H;  4L1K A;  3FMA A;  5KG0 A;  5LMN H;  1UC9 A;  1PYS B;  4OGQ C;  1VQ9 A;  2JA8 H;  5J3B A;  1K1Q A;  2C28 A;  5C4X B;  4FXD A;  1JXL A;  3T5J A;  4LF8 H;  1LUZ A;  2M9V A;  3BDC A;  1WCM A;  2Z1C A;  1HNX Q;  4LFC H;  1M8A A;  2W6M A;  4HED A;  4L6T B;  4ULL A;  3KLR A;  4A3F G;  1MBY A;  5DLQ E;  2O4X A;  3GTG H;  5K36 G;  4MTE A;  3SVM A;  1MIU A;  1YJW A;  4X6A H;  4RB2 C;  3HOW G;  1EU4 A;  4YIJ A;  2W9B A;  4DAY A;  1KAB A;  1HA5 A;  1S5D D;  2K05 A;  3HKZ B;  4KN4 C;  5M3F H;  5KFW A;  2B63 A;  2Z6K A;  1GUS A;  5IGC A;  3EYY A;  2QCP X;  2R7Z A;  3KBG A;  4B3M L;  3HOV B;  3V6H A;  4DR4 H;  2I07 B;  2RSN A;  2NWG A;  1XMO L;  4DR2 H;  1TWA H;  5D65 A;  2BDN A;  4IJH A;  2MPM A;  4JBJ A;  3K80 C;  3S17 B;  1QUQ B;  3UE0 A;  3BVM A;  1KQS A;  1ZYR D;  3AU7 A;  4GOP C;  2F0E A;  2QF7 A;  1RK6 A;  5DQG A;  1PH7 A;  3PV0 A;  4JI0 H;  1ASZ A;  1CHQ D;  2UU9 L;  2SNM A;  2JA6 G;  2F4V Q;  4ID6 A;  3UDF A;  4AQY L;  1J8I A;  1PK8 A;  1RF2 D;  4R8I A;  5M3M B;  1V43 A;  4KHP H;  5IP9 G;  1SE2 A;  3S1Q H;  3DWP A;  2K5Q A;  1C4Q A;  1HFG A;  4EYI B;  2Y0S A;  1XWE A;  2Y0S E;  3GTQ H;  3BVG A;  1B7Y B;  5F2D A;  3R8B A;  1ET9 A;  1A6X A;  4J9R A;  2V1C C;  4A76 A;  3HOU B;  2Q2H A;  2C2R A;  2Q8I B;  2UUB Q;  3LP8 A;  4YJ3 F;  4RHS A;  4DUZ H;  2YU9 B;  5J39 A;  1VQI A;  3MEH A;  3OIQ A;  5C5M A;  1K8G A;  1V4Y A;  1PZK D;  3G6X A;  4YY3 Q;  2R7L A;  2JJQ A;  2DPI A;  3F8T A;  3X3N A;  1C9O A;  4DV2 L;  5EPJ A;  4C3J B;  1SE8 A;  5JPM C;  4F88 A;  2DJG C;  4BXX G;  2R93 B;  3KF6 A;  2A68 C;  1SR3 A;  1DJR D;  4I65 A;  4JVZ A;  2EIF A;  3ERO A;  1I7L A;  5CAE B;  5KFM A;  3H4B A;  1RL2 A;  5IYC H;  4GC6 A;  4PWQ A;  3MR5 A;  2E2H A;  1OXS C;  2K52 A;  1I7N A;  3A55 A;  5EQ0 A;  4BBS G;  2DLN A;  1GSH A;  3I4O A;  4P72 A;  5CV7 A;  1OTC A;  3A54 A;  4ME5 A;  5A35 A;  4RGM A;  4NXM Q;  2R84 A;  4NLG A;  2XNA C;  1TY2 A;  3GTM B;  4HNT A;  2JEB I;  4HCE A;  1SBB B;  3CCV A;  2NVX H;  1IBL H;  1JWS D;  1IXR A;  4YBZ B;  5D1O A;  5LOV F;  3OIP A;  4IUR A;  2W6Z A;  4ZOL F;  3J81 L;  1AZP A;  4DR6 L;  4X66 L;  4ECS A;  3VYU A;  1MJC A;  3N52 A;  3PF5 A;  1KC7 A;  1EFW A;  3ORQ A;  3CAM A;  4FF2 A;  2R7K A;  4WJW A;  5KG3 A;  3EQL C;  4EYH B;  4YAJ B;  3DWQ A;  1DD2 A;  3M9M B;  1S0N A;  4CJ2 C;  5F9N A;  4L5T A;  1Y1W G;  4ZHQ F;  3FKI A;  2K33 A;  4HJ7 A;  4FS2 A;  5E4X A;  1N33 H;  1BBW A;  2L1B A;  1A0I A;  3K8A A;  2JSO A;  3D31 A;  1KIX A;  1D8L A;  4KMU C;  4IUU A;  2E5L Q;  4CGY B;  3QB3 A;  3S2D B;  4DV0 H;  3HOY H;  5C3X A;  2RA4 A;  5IGF A;  1Z6H A;  4CJ1 B;  5C3E B;  3S2H H;  2M2L A;  3IG0 A;  5F9L A;  4I7H A;  2HVS A;  3S15 H;  4A93 G;  1V1P A;  3J80 E;  5EWF A;  3T51 B;  3JAM i;  4JBM A;  3I2Z A;  4XYM B;  3BVZ A;  4RGO S;  1QE6 A;  2MUY A;  3RUP A;  5JPN C;  5KFU A;  5DG8 A;  1VQE A;  3WOF A;  1IL8 A;  2CH4 A;  1DOM A;  2DUD A;  1SE3 A;  5IY0 A;  3KK7 A;  5ISR A;  3BQ1 A;  1QCB D;  2AQ3 B;  3H91 A;  4DR4 Q;  2PMZ E;  1JWM D;  3DM1 A;  4DR2 Q;  2ICE C;  2KOL A;  1SE4 A;  3IRB A;  4QIW E;  4QIW A;  4DR3 H;  2JA7 B;  1H9M A;  3J7A V;  3KBX A;  2YTV A;  5KYL A;  4F87 A;  4A3M H;  3H09 A;  5IWA H;  2R61 A;  1OO9 B;  1YIT A;  4JI0 Q;  4PDB A;  5ELB A;  1IW7 D;  2VY3 A;  3GQB A;  1Q7Y C;  4G7O C;  1ZEQ X;  1XPR A;  4J8Q A;  1EEI D;  3QWN A;  2JEF A;  4OXP A;  3JSN A;  4HSP A;  1X56 A;  1QNU A;  2Q2U A;  4C3H G;  2IA6 A;  1E7Z A;  4A3J G;  1PTO D;  3K6O A;  1I4G A;  4JI7 H;  2WKC A;  4LF6 H;  5LYJ F;  4UY8 C;  1Y8P B;  1MJE A;  4WFN 3;  3L9A X;  4MV6 A;  2WII B;  3S14 B;  1BJT A;  4HJA A;  4DUZ Q;  4UFZ A;  4ZUJ A;  5DM7 3;  2KEE A;  1SND A;  3A8J E;  4DR1 Q;  3EIV A;  5IT9 L;  5IYD G;  5K36 H;  4LF7 Q;  1PV4 A;  3HOW H;  2C5C A;  1G91 A;  3H20 A;  4I55 F;  3I4L A;  2IPK D;  1YNN C;  1PH5 A;  1AE3 A;  5KYI A;  3SE0 A;  1MKH A;  4JI5 H;  1CKN B;  3GTL A;  2YTX A;  2X69 A;  1AEX A;  1PH9 A;  3T1H H;  1X3G A;  3GTO A;  1QG7 A;  4B3T H;  3NEN A;  1PFB A;  4UP9 A;  3PUZ A;  2PZW A;  3WNZ A;  2B2V A;  1UWV A;  4ED8 A;  1TWC H;  1SYB A;  5A2Q E;  4IAJ A;  1KXL A;  3NQI A;  4A75 A;  2X0S A;  2NVY H;  5IGG A;  4RAY A;  1EWH A;  3A56 A;  4M9U A;  4PG3 A;  1IBK L;  4CKE A;  5KFB A;  5JVG 3;  1VQ4 A;  3KAJ A;  2W7O A;  4IWX A;  4HIO A;  3D4R A;  2WDT A;  3GQC A;  2AGP A;  2B2V C;  4Q43 A;  4QL5 A;  1NJI C;  1U4M A;  2F0O A;  5GAE C;  2YRX A;  1IBL Q;  3S1N H;  3RAQ A;  3K7A H;  5GON F;  2B29 A;  4EQN A;  5KG6 A;  2IT1 A;  1EYD A;  1EL0 A;  5KG7 A;  2ATW A;  1YIJ A;  5I47 A;  3MR6 A;  4RA8 A;  4O3O A;  1BQQ T;  2ZXP A;  5ELC A;  2F4V L;  4XX0 B;  3NUC A;  4Y7N H;  4LH7 A;  4A3K H;  3VMM A;  4LW1 A;  1QB5 D;  2NTT A;  3QJY A;  4ZKB B;  3OMG A;  3GV3 A;  2LKV A;  4ODG A;  1JOQ A;  5KFQ A;  4FVM A;  3E0E A;  4DFA A;  1PXU A;  3OW2 A;  2F0F A;  3GTP H;  4ZUI A;  1PFN A;  1TWG A;  1E1O A;  2EYP A;  1XYI A;  1Z47 A;  3MFY A;  3P75 A;  1K3R A;  2RGV A;  3Q0A A;  1K83 B;  2DNC A;  3PO3 B;  3VR5 A;  3V4Z A;  2UUB L;  3WDN A;  4DV0 Q;  5NUC A;  4BXX H;  3SXH A;  4YY3 L;  3F2D A;  2EJM A;  2RHS B;  3RBE A;  1M0W A;  3H0G G;  4GLA C;  4DF7 A;  2J7Z A;  4UCO A;  4AYB A;  2Q8T A;  4C3I B;  2GVA A;  5KG4 A;  4KKS A;  3H3V H;  1SJE D;  1Q3L A;  2L55 A;  4B3M H;  2ZJQ A;  1CKM A;  4AIM A;  3I8Z A;  5KIX A;  5KFS A;  1S5C D;  1XMO H;  4ZAI A;  2E75 C;  1A3T A;  4DR3 Q;  3CQZ A;  1G2S A;  2VQF L;  2XTI A;  2WAQ A;  2WAQ E;  1I4P A;  2ID0 A;  4O42 A;  3K58 A;  1CTM A;  1X65 A;  2OTJ A;  1YZ6 A;  3BG3 A;  5IWA Q;  4EGV A;  4RGN A;  3HP3 A;  2XCP A;  3I90 A;  1HR0 Q;  3CKI B;  2HD3 A;  1VQ7 A;  1F2Y A;  3SEB A;  1RTN A;  5KNC A;  4APM A;  4IPC A;  2JA8 B;  3KLS A;  1JR0 D;  1OXV A;  1Y1W H;  2OLS A;  1Q81 C;  4F4Y A;  5KEE A;  4POG A;  4JUZ A;  2AUJ D;  5KFY A;  2YZN A;  4A4I A;  5CMD A;  3GTG B;  3MFG A;  1BF4 A;  3ERQ A;  1SYF A;  5C5L A;  4K0K Q;  3OMC A;  2FXQ A;  3CVZ A;  5FPR A;  4DV2 H;  4RKB A;  4H0L C;  2PO4 A;  3PR4 A;  4A93 H;  4DV7 Q;  1G6P A;  3SE7 A;  4FDB A;  1NTG A;  5M3F B;  3KHR A;  2E5L L;  4XTC S;  5C0X J;  5FLX L;  1X3E A;  3HKS A;  1W6K A;  1VQP A;  4B3T Q;  1TWA B;  1Q1B A;  4TV9 F;  1T5X D;  1V1O A;  1RHP A;  4C2M A;  4WD3 A;  1HTL D;  5C8Y F;  4YJ2 F;  2J4X A;  4F4X A;  1BBU A;  4GS3 A;  3HKZ A;  2R92 G;  3M3Y H;  2V4Q A;  4DV5 Q;  4FXG C;  5D3I B;  3A7L A;  3C1E A;  1YJ9 A;  3KDF B;  3M85 A;  3W5O A;  3S1Q B;  4A2A A;  1QUQ A;  1NSN S;  2VQD A;  2Z0S A;  4XYQ A;  3GTQ B;  4DR6 H;  2AMC B;  4X66 H;  3I4M G;  4JI0 L;  5EKK A;  4C3H H;  2DIK A;  4A3J H;  1MI2 A;  1PTO F;  1PH6 A;  5CYU A;  4YCW A;  1Y1V H;  1JB7 A;  3Q2O A;  1ESR A;  1SYX B;  5COY A;  4TV8 F;  3G71 A;  1LTB D;  2FLL A;  1N36 L;  3ULL A;  2EY5 A;  3DXJ C;  5IYD H;  4IFD I;  5JVD F;  3O13 A;  4XYO A;  1K9M C;  1E4E A;  2B63 G;  1A15 A;  1T9H A;  3M4Q A;  2R85 A;  1TS5 A;  3K0X A;  4YP3 A;  2ASJ A;  2R7Z G;  1EHI A;  3K5N A;  4DUZ L;  1UAP A;  4TQS A;  2CW0 D;  4DR1 L;  1A62 A;  1X55 A;  1B50 A;  4LF7 L;  5EKI A;  4KY7 A;  1VMC A;  4RGT A;  5KG2 A;  4KKT A;  5I9P A;  4MV3 A;  3PW5 A;  3R3O A;  5AFW A;  4IOC A;  4IWY A;  2EPB A;  2KJX A;  5KT6 A;  2R93 A;  2CVR A;  3CCS A;  1SDF A;  4OO1 H;  5EAY A;  4L5R C;  1CSP A;  1KRS A;  1KD1 C;  2EOT A;  2NVX B;  2ZT9 C;  4A3B G;  1E4F T;  1EY0 A;  3TN2 A;  2MHV A;  4IPH A;  1QNK A;  1RYR A;  3U9T A;  2RKS A;  2Y0S G;  4CDD C;  1E2W A;  4MHE A;  3TP5 A;  4DNI A;  1IBM Q;  2KHS A;  4FBU A;  1Q8K A;  4NP5 A;  4MNO A;  3JAM E;  4CC5 A;  1X9N A;  4P74 A;  4A3I G;  2UUA L;  2HQL A;  1YHA A;  2QW7 A;  4QWD A;  3M4O H;  2R8H A;  2R8G A;  3GTM A;  4YCV A;  2VZA A;  4KLK A;  3VR6 A;  2MQH A;  5GQO A;  3Q24 A;  3OPO A;  2ZJP A;  4U67 3;  4I4T F;  1KEE A;  4BBR G;  2CQO A;  1IBL L;  1VQB A;  3ZJY C;  3J80 W;  1S4Z A;  5L1J A;  4YR0 A;  4F8M A;  1PRT F;  3V4S A;  1QZH A;  3N6R A;  2AGO A;  2EYM A;  4JI2 L;  3S1M H;  2ZTD A;  3LX0 A;  3K7U C;  1RTO A;  3J80 L;  4YWM A;  1A3V A;  5BN4 A;  3HOY B;  3HEJ A;  4KJN A;  2CH4 W;  4NMZ A;  3BZD B;  2VXW A;  1MSG A;  3S2H B;  4Q0Y A;  4G3I A;  4LFB L;  2EVB A;  3S15 B;  2NTS A;  2HIV A;  2VPQ A;  1C48 A;  1OWT A;  1YNJ C;  4GNX C;  4CDF C;  3CCM A;  3H0G H;  5LHY 1;  3N8D A;  2F0U A;  5KFX A;  3LWB A;  1KAW A;  4GKK H;  3JC6 6;  4ECR A;  4K2K A;  1R4Q B;  1KJI A;  4DV0 L;  2HVQ A;  4HID A;  4PMC A;  1X54 A;  2EE1 A;  1HHV A;  4WJ4 A;  2W70 A;  2DGY A;  1TWF H;  3CP0 A;  3E0J A;  2N8N A;  5DQI A;  2GPS A;  4N8F A;  1I6H H;  1IBK H;  4X62 L;  2LMC B;  4AH6 A;  2A69 C;  4A3M B;  4J6H A;  5J22 A;  4J9L A;  2DY8 A;  2HDL A;  2R7F A;  4R1J A;  1UE5 A;  5KFV A;  1Q46 A;  5D1P A;  1TWH H;  4KJO A;  3GIK A;  4A3L H;  2PW5 A;  2C00 A;  4IZO A;  5EOY A;  3J7A K;  3RLF A;  1V8Q A;  3VA5 A;  3FKI G;  2IX1 A;  3RB0 A;  2I80 A;  3GIQ A;  4EEY A;  4DR5 H;  1HR0 W;  1LTI D;  2W8K A;  4DXG A;  1E22 A;  1F2M A;  1ONL A;  2K5V A;  4X66 Q;  2O2L D;  5CA1 F;  1S5F D;  2F4V H;  4POF A;  1FD7 D;  1ZET A;  3NBH B;  1HR0 L;  4A3G H;  1Y14 B;  1EZ8 A;  3WOE A;  2QYZ A;  5A2Q W;  1C3O A;  1B70 B;  1B04 A;  2L12 A;  1SYE A;  2OQK A;  3T16 A;  3HOW B;  2B2W A;  2GLT A;  3QR8 A;  5FO7 B;  3ULJ A;  4NPS A;  4DK6 C;  4MAM A;  3T1Y Q;  2A73 B;  4H13 C;  1X3Q A;  2YZG A;  2UUB H;  3AB9 A;  5HBR B;  2R6F A;  4K0K L;  3A0J A;  2B3G A;  4YY3 H;  2MO0 A;  3OSO A;  2NZO A;  4CDC C;  4LH6 A;  4IR1 A;  2VUM H;  1TWC B;  2NVQ H;  4ALP A;  3C46 A;  4UAI A;  3R23 A;  2NVY B;  1Z2O X;  1XXG A;  2V58 A;  3JZI A;  4CJ0 B;  1QVC A;  4DV7 L;  4XQJ A;  1QOH A;  2CZG A;  1KNA A;  1W6J A;  2C35 B;  3G48 A;  3PIP 3;  1XMQ Q;  2R92 H;  1IL2 A;  3TQ1 A;  2XN9 C;  4MV1 A;  1N56 A;  1KLU D;  1SFO A;  1IKL A;  1FJG L;  3S1N B;  3K7A B;  3PIO A;  4R7R A;  3R5H A;  2VQF H;  4IPD A;  4NW2 A;  2VB3 X;  5ELN A;  2UUC Q;  3PO2 B;  1MZB A;  1B1Z A;  4IHJ F;  1ESF A;  4X3K A;  4Y7N B;  3I4M H;  5EJW A;  2F0J A;  4Q5V A;  4A3K B;  4DV5 L;  1JIC A;  1IZ6 A;  3CCR A;  4R8N A;  4XT3 B;  2G9D A;  1STY A;  3WWV A;  2IP4 A;  3UDG A;  1ZYR C;  4B3S H;  3NEL A;  3GTP B;  1XPO A;  2EYJ A;  3QOJ A;  3NEM A;  4IAL A;  3PF4 A;  4DV4 H;  1H95 A;  1WTV A;  2QKI C;  4KK7 A;  3J81 c;  2ES2 A;  2UXD Q;  1HNZ L;  5DGB A;  1HCZ A;  1A9X A;  2K7V A;  4MTN A;  1QVF A;  5C0X I;  2W57 A;  1JE4 A;  1FGU A;  1CFM A;  1STE A;  1WJJ A;  5DM6 3;  2M05 A;  2XCL A;  3K3P A;  2JA5 G;  2R7Z H;  3Q8Q B;  3S1R H;  5DG9 A;  1D7Q A;  1F2L A;  1C30 A;  2UU9 H;  3GIL A;  3SK4 A;  4YHH Q;  1OXX K;  4RB3 C;  3FDT A;  1I50 H;  3HOX G;  3K59 A;  1J6Q A;  4TQU S;  1AW7 A;  2F0I A;  1K83 A;  2E5L H;  5M5Y H;  1HUM A;  1B53 A;  2KEN A;  5KFH A;  3TZU A;  2E2D C;  4GKK Q;  2XRQ D;  2RHQ B;  4MTK A;  2XRS D;  5GAD C;  1NR4 A;  3EFX D;  2K50 A;  1KBL A;  4M7E A;  4JW0 A;  4JV1 A;  1ILQ A;  3CW2 C;  3NSW A;  4B3R Q;  1XTC D;  4O2A F;  3GIJ A;  1NR2 A;  4RAZ A;  1N48 A;  3HG9 A;  4A3B H;  4IFD G;  5CV9 A;  3BDO A;  4GOP A;  1LYL A;  3HB9 A;  2KUM A;  1C0A A;  1IBK Q;  3RN5 A;  4ECY A;  3CCJ A;  1LT6 D;  3I70 A;  1NBW A;  2Z6B A;  4PMB A;  2GA4 B;  2N49 A;  3BZK A;  4QF4 A;  3CCL A;  2F4I A;  2G9H D;  1CKO A;  1S5E D;  3CRL C;  2XIG A;  4IUP A;  2LXK A;  1Y1W B;  2R8I A;  1G51 A;  1RJQ A;  4BBR H;  3D4D A;  2K03 A;  4YCU A;  4DR5 Q;  1WTW A;  1IBM L;  3NBI A;  1BR9 A;  5D3D A;  4KD4 A;  4YQW A;  3OYY A;  1JC7 A;  1EEF D;  4APV A;  4DK0 A;  1NUC A;  1TVX A;  2BQU A;  1JQY D;  3BU2 A;  2K32 A;  1N36 H;  3TEH B;  5J2T F;  3RB4 A;  1PTO H;  4OWT B;  1BXT A;  1EY4 A;  2R8K A;  3ULP A;  4A93 B;  3U50 C;  2HJW A;  2VA2 A;  2E2H H;  4OEM B;  1XNQ L;  3GP7 A;  2FB9 A;  3RZO H;  2V9W A;  2UXB L;  3GTG A;  3MHB A;  5BN3 A;  4L8J A;  2EDG A;  2F0V A;  2K5D A;  4LMY A;  4DR1 H;  2EXZ A;  1WR2 A;  4LF7 H;  2X6L A;  4N8X 1;  3S9W A;  1IYJ B;  5IT9 c;  5IP7 G;  1I5F A;  1VS0 A;  3GD7 A;  2H5X A;  2WAQ G;  2Q8R E;  1JMC A;  3M3Y B;  1L0X B;  3E5N A;  2Q2T A;  3HFZ B;  5L1L A;  2IHF A;  1F9R A;  3HGB A;  1SEI A;  1A3U A;  1SXT A;  2N78 A;  3NXW A;  4Q45 A;  2JEJ A;  4ECZ A;  1JCK B;  1S03 G;  3OTO L;  1I4R A;  1JB3 A;  1KDB A;  4Q8E A;  1GM5 A;  2W8L A;  5KNB A;  4QW8 A;  2K04 A;  5IGE A;  1RKN A;  2NUC A;  3FKI H;  2VQF Q;  2ZDQ A;  5EZY F;  4U7C A;  2NN6 H;  1NNX A;  4X3S A;  4HTH A;  4C3H B;  1LLR D;  5LL6 X;  5FO8 B;  4A3J B;  1ASY A;  2UUA H;  2FKL A;  3OHA A;  5DLG A;  1Y1V B;  3CCU A;  4PV1 C;  4QB4 A;  4IN3 A;  5T1I A;  1IOW A;  3VR4 A;  3H6M A;  3KDF A;  5KFA A;  5HGT A;  2SNS A;  4B3S Q;  4UCS A;  3GV7 B;  3GTQ A;  1IW7 C;  2J0T D;  3LWE A;  4GNX B;  4JI2 H;  4DV4 Q;  1PH4 A;  2D5D A;  4LF9 H;  4DPG A;  4PNY A;  5D8D A;  4OWX B;  5FK9 C;  3RBD A;  3SHL A;  4J15 A;  4LFB H;  3PIP A;  2HGS A;  2OTL A;  3NTH A;  2AUK A;  2Z9H A;  1PTO C;  2F52 A;  4MV8 A;  3V6J A;  4MA5 A;  1IKM A;  2E76 C;  1F9P A;  4LF5 Q;  3T1Y L;  3JAM W;  4R4Q A;  3G7L A;  2K5N A;  2ENB A;  3QG1 A;  3N6X A;  1LM0 A;  1NMF A;  3HOV G;  5I6W A;  4Q0F A;  3L3O C;  3J81 i;  3E9H A;  3AQQ A;  4DU9 A;  3ORR A;  4DL4 A;  2ZTE A;  4DV1 Q;  1ILP A;  1JIH A;  3U4V A;  4X62 H;  3GTK H;  2O5J C;  1H9S B;  1W2B A;  4YWL A;  2IW3 A;  4JYA L;  3VYS A;  5KFT A;  3SGI A;  1XMQ L;  4MIU A;  4R4C A;  1VDZ A;  3UE1 A;  3M4O B;  4RZQ A;  2XGT A;  4ZQ3 A;  3PW2 A;  1SNC A;  1HUN A;  2NVX A;  4O3P A;  1DON A;  2YYZ A;  4RUA A;  1S68 A;  4CKB A;  3NTK A;  2K75 A;  2YRW A;  3JSL A;  3S1M B;  2UUC L;  1W3S A;  2AQ4 A;  4DXF A;  2CHB D;  1HR0 H;  4ED6 A;  3HOU G;  2EJF C;  3SK8 A;  4R8U B;  1PYB A;  3E9I A;  2IHE A;  5JVH 3;  1MGS A;  2NZH A;  1VF5 C;  4BA2 I;  5JJK A;  5JQW A;  3GTO H;  1N36 Q;  1F2Z A;  2MNA A;  3AFP A;  2JA5 H;  3C0F B;  4CKC A;  4RZR A;  3OSN A;  4C3J G;  5FD5 A;  1BGW A;  3HOX H;  2UXD L;  1AFP A;  2R93 G;  1WTQ A;  1PRT C;  3RR5 A;  4K0K H;  1EQV A;  5BN5 A;  1D6E C;  1CUK A;  4A3F H;  2R82 A;  5FPO A;  1PX2 A;  1TWF B;  1SRU A;  3A7A B;  4RCO A;  2RCF A;  5C4Z A;  4YHH L;  2IWH A;  1ZHQ A;  2FE3 A;  2OQ0 A;  1EOT A;  1GVP A;  1I6H B;  2AHO B;  4DV7 H;  4IRK A;  4JI4 Q;  1Y69 U;  1GUO A;  4IFD H;  3VDY A;  1JOK A;  3AMU A;  4EFB A;  4GKK L;  2J6U A;  1BVS A;  1CHP D;  1TWH B;  5FLX c;  2L5T A;  5KFG A;  1G29 1;  4RHR A;  1FJG H;  1GKH A;  4FF3 A;  4B3R L;  2R6G A;  2WV6 D;  1HNW H;  3G6Y A;  1E1T A;  1PYW D;  3TQY A;  4JI1 H;  4ZRZ A;  1VBG A;  1EFI D;  1AE2 A;  1LT5 D;  1X6O A;  2Z8L A;  2UUA Q;  4A3G B;  4Y52 H;  2FK3 A;  5EWG A;  2JA6 H;  3RZD B;  5C1P A;  1YVC A;  4DN4 M;  5EDW A;  4OEL B;  4J9O A;  3TRE A;  1SMY C;  4LNQ A;  2OF1 A;  1LTA D;  3BJY A;  3CHB D;  5IP9 H;  2ASB A;  1H9K A;  1P16 A;  4DR5 L;  3I4N G;  4JI2 Q;  1DYQ A;  4LF9 Q;  5JEA G;  1HNZ H;  3NBH A;  1FYC A;  2KBN A;  2SEB D;  3NE5 B;  5CV6 A;  2IX0 A;  1BNC A;  5CV5 A;  4H44 C;  4J9Q A;  4CHT B;  2QDB A;  2VPS A;  4LFB Q;  4WOR A;  2VUM B;  1PRT D;  3CF5 A;  4GKJ Q;  2NVQ B;  2EQS A;  2HQE A;  1EYA A;  4NXN Q;  3PUY A;  1IOV A;  5KFE A;  1STA A;  1SNP A;  3MXG A;  4IUN A;  3VYT A;  4E6I A;  5DQH A;  5KFF A;  4DAV A;  4Q8F A;  4H02 A;  3KAL A;  1EWI A;  4LFA L;  3CQZ H;  5IP7 H;  3FEW X;  2R92 B;  2NYZ D;  3PW7 A;  4R4T A;  5I9O A;  1M0T A;  2R7M A;  2E2I H;  1RDP D;  3PUX A;  1EIG A;  2WB1 B;  3ZYY X;  4UHV A;  3KLS X;  1WTO A;  1J5E L;  1VBH A;  3M9B A;  2F0L A;  4KHV A;  2NVY A;  4UP7 A;  1YJN A;  4O4H F;  4AYB E;  4QWE A;  1PVO A;  1ENC A;  2TMP A;  4X62 Q;  3J81 j;  1BUV T;  3L2P A;  2UVW A;  4J9M A;  2FLN A;  4MZ9 A;  3PQI A;  3I4M B;  2RVL A;  4RWS C;  1D5X C;  3MZ5 A;  4BBS H;  2KCM A;  5G3L D;  3W1B A;  3P1H A;  4LK1 C;  2NU6 B;  4G7H C;  1S97 A;  4JI6 Q;  3K57 A;  2UVV A;  3BG5 A;  3SI8 A;  4KKU A;  1UE6 A;  1VQN A;  2MGS A;  4FF4 A;  1U0L A;  1I3Q H;  3IFT A;  3VR2 A;  3IAY A;  4RUC A;  1IBM H;  1NMG A;  1EQR A;  1SMY D;  1VQJ A;  2CCZ A;  1EYG A;  2JEI A;  4KN7 C;  4K2L A;  3J7A 5;  5IYB G;  4DAY B;  2WIN B;  5KG1 A;  1SAP A;  2EZV A;  4B3S L;  1Y8N B;  3S1R B;  3CCQ A;  3Q8P B;  1E3P A;  5HY6 A;  3BA9 A;  2F0M A;  1I50 B;  4IZ8 A;  2G5D A;  4ZK9 B;  1JWU D;  4DV4 L;  4C2M H;  1EY5 A;  3PW0 A;  1XNQ H;  2PNH A;  5EPK A;  1PA6 A;  5M5Y B;  1O7Z A;  4EBD A;  2QGQ A;  3R5X A;  2K6A A;  2I5M X;  2EJG C;  4ECT A;  2UXB H;  2L0C A;  4QQB X;  2CW8 A;  1U4P A;  2DJF C;  2VOB A;  3VA7 A;  3ETH A;  1LT4 D;  5KG5 A;  1PLF A;  3RD4 A;  4A3B B;  1XJV A;  2FLP A;  3TS0 A;  3PR5 B;  2XVS A;  4ME3 A;  4LF5 L;  2V5A A;  3KLW A;  2CW0 C;  1HRJ A;  1KTK A;  1CQV A;  4JBK A;  5DG7 A;  3PZP A;  2WAC A;  2WTF A;  1C8C A;  1EU3 A;  3OTO H;  2B39 A;  1Q1E A;  1EUD B;  5KFL A;  2PQE A;  1FJG Q;  4A3D G;  4O3S A;  4MV9 A;  4DV1 L;  3W1G A;  2XD4 A;  5T14 A;  4BBR B;  1HNW Q;  1PFS A;  1YHQ A;  3H3V C;  1T36 A;  2ZJR A;  3HKZ E;  4JI1 Q;  4O4L F;  4CDE C;  3R93 A;  2KSW A;  5LA6 F;  4EFE A;  2A8V A;  1X3P A;  3RN2 A;  4U68 A;  3SR1 A;  4F7X A;  1RJR A;  1HTP A;  3G6E A;  3N44 B;  1B33 N;  5GAG C;  1UEB A;  1EOV A;  2KQ3 A;  3KF6 B;  3RIZ A;  1JDB B;  2EY6 A;  2KHI A;  1PTO B;  1Y1W A;  5KT4 A;  4E4T A;  4BY1 G;  2E2H B;  1WCM G;  3M4P A;  1S0M A;  3RZO B;  1QZG A;  1HNZ Q;  2JQO A;  3PO3 G;  1PH1 A;  1GLV A;  2UVU A;  3HZX A;  4I7Z C;  4BS9 A;  4RMF A;  2I5L X;  1WD0 A;  3E5S A;  2DWC A;  2DN8 A;  1II3 A;  2H1E A;  1EIY B;  5HUR A;  2BDO A;  1CZW A;  1GUW A;  4DK1 A;  2MO1 A;  5D1O B;  4JPB W;  1DV1 A;  4TVA B;  3T1Y H;  1BBX C;  3Q8D A;  4ED0 A;  2A6E D;  3OOC A;  2YS7 A;  3GID A;  2BQ3 A;  3OWE B;  4P2C B;  4XT1 B;  2YU9 A;  1EYC A;  1RJT A;  3QZ8 A;  2WP8 J;  4P75 A;  1I94 L;  4LMQ D;  5ELD A;  2JYO A;  5JJI A;  5M5X H;  3M7G A;  3MFI A;  4JI4 L;  5IYZ F;  3LML A;  4LUZ A;  4JYA H;  3ER0 A;  1JJG A;  1T3N A;  4RB1 A;  2D2C C;  1LTS D;  2FMA A;  1XMQ H;  1HZ9 A;  5IOC A;  3KUP A;  1CQJ B;  4MA0 A;  1CS0 A;  4FBT A;  1SJH D;  1CA5 A;  5IGD A;  4A3C G;  3RFC A;  4QY7 A;  2SDF A;  2F3V A;  1G6Z A;  1SNM A;  4X3T A;  1Y8O B;  2DNE A;  3J81 E;  2B2Y C;  4J9S A;  2UUC H;  4X64 Q;  4RU9 A;  2CFM A;  1X32 A;  3I4N H;  4DV5 H;  1N32 L;  4Z9C B;  3ND9 A;  5C44 G;  1Y1V A;  1DOK A;  3EBE A;  2KVM A;  2F03 A;  1PRT B;  3AEV A;  3VPD A;  4YAK B;  3KHG A;  4XQQ A;  1FKA H;  4O3Q A;  2EY2 A;  3H94 A;  3CC4 A;  4NDX A;  3CC2 A;  4KD3 A;  3TP7 A;  4N9P A;  4A2B A;  4MV7 A;  1VMP A;  2PMZ B;  2ZDG A;  4GNX A;  4IO9 A;  4RB0 A;  1EQQ A;  4O0A A;  4LF9 L;  3LNN A;  1JOR A;  2UXD H;  1XNQ Q;  3MFH A;  2XGQ A;  1TS2 A;  2FPI B;  3I7F A;  4IQZ A;  2UXB Q;  2NZ1 D;  4JCV E;  4OWW B;  1EUC B;  1WTP A;  4HIM A;  1QVG A;  4GKJ L;  1NY4 A;  2K4K A;  4GN3 B;  3RB6 A;  4NXN L;  4LF4 H;  4YHH H;  4FXK C;  4O4I F;  1B6R A;  5HV6 A;  2ALZ A;  1B4O A;  1TS3 A;  3GTK B;  2RF4 A;  2IL8 A;  2JEA I;  4OHJ A;  1RK5 A;  2A74 C;  2FP4 B;  3MXP A;  1ENF A;  1R9T H;  1SCU B;  2AU0 A;  3ITP A;  3OW7 A;  3OHB A;  3ND8 A;  4WRD A;  3H15 A;  4JOI C;  4MN3 A;  1LTR D;  1GUN A;  1LTL A;  3S24 A;  1H9J A;  2C22 A;  3QO2 A;  1EIF A;  1EY7 A;  3CRK C;  1I4X A;  1STH A;  2KCT A;  5G3L F;  2L11 A;  3OTO Q;  4HNU A;  4B3R H;  3RUZ A;  1VQF A;  1YI2 A;  4NB3 A;  2XGP A;  1RIP A;  3J80 i;  1U4L A;  1U5K A;  2MJ8 A;  2NU9 B;  1H9S A;  4KHZ A;  1ZQ7 A;  4ABN A;  4FP5 D;  1B44 D;  3R5F A;  1NE3 A;  2V59 A;  2NU7 B;  4QW9 A;  4JI3 Q;  2BQR A;  5IYB H;  2K01 A;  2KCC A;  4HMJ A;  4JI6 L;  3GTO B;  3T5K A;  1UNS A;  2JA7 A;  3GO5 A;  2JA5 B;  2JEG A;  2I0Q A;  3NWS A;  1HZB A;  4HR7 B;  1VQ6 A;  4FF1 A;  1CK1 A;  1TXY A;  3C1F A;  2BOS A;  4G7Z C;  4R8U A;  3RLO A;  4ECU A;  5DAU A;  4A3F B;  5IT9 E;  2XWJ B;  2FJZ A;  2NU8 B;  3BZC A;  2ASL A;  3NP8 A;  5IYC G;  2PQA B;  4M1U B;  4BWG B;  5IGB A;  3AFQ A;  5KT7 A;  4DNT B;  2WFW A;  1SFO H;  2N3S A;  4ZCK A;  1AN7 A;  5A2Q L;  3KYH C;  4LFA H;  1EY8 A;  4BWS C;  1LAB A;  1VQO A;  1VQL A;  5I4D A;  1H9R A;  5CA0 F;  5KFC A;  1VKZ A;  2PZT A;  2R86 A;  2UXC Q;  2IBK A;  3DWA A;  1J5E H;  3BQ0 A;  2LXJ A;  5M9O A;  5BR8 H;  1TWF A;  1M4V A;  2EY1 A;  4DUY L;  2W6P A;  3KF8 B;  4LSA A;  4A3D H;  4J9N A;  4NKL A;  5T1G A;  2YZM A;  3ICE A;  3D6C A;  1ZKO A;  4JYA Q;  4JI8 Q;  1AP0 A;  4LSX A;  1CKN A;  3B6Y A;  3MWY W;  5FOB B;  2JA6 B;  3DF7 A;  1TWH A;  2ICI A;  1STG A;  4DK3 C;  4WJ3 M;  1CQF A;  4HYK A;  4FO2 A;  2F0W A;  3CCE A;  3GTJ H;  1KHI A;  1KRT A;  4EQ5 A;  3H40 A;  4IR9 A;  1HNW L;  5CBA E;  2EYH A;  4J9K A;  4JI1 L;  2X6G A;  3T56 B;  1L0W A;  1K8A C;  2NVT H;  1O78 A;  4YR2 A;  5C4J H;  4BY1 H;  3CMA A;  3T5H A;  1WCM H;  4DV6 H;  3HOZ G;  1E2Z A;  1N8R C;  1VQA A;  1TQO A;  1CM9 A;  1BO0 A;  4KY5 A;  1XPU A;  5DEH A;  1BCP D;  1QIL A;  2LSS A;  1JE5 A;  2ALY B;  3Q23 A;  3CQZ B;  1JLL B;  3CPW A;  4XZ3 B;  1LTG D;  5JUM A;  1B8A A;  1U4R A;  3A74 A;  5GAH C;  4LAA A;  2OXP A;  2E2I B;  2B63 H;  4K8J A;  1SEB D;  1Z9F A;  1K0S A;  4DV3 Q;  4QWA A;  2VUM A;  4Q44 A;  3TSS A;  1RCV D;  3FVQ A;  4IPG A;  4BY7 G;  3BYY B;  1KJQ A;  5EPL A;  4DKA C;  3M9N B;  4LF4 Q;  1WSC A;  4IUQ A;  1B9M A;  5C4H A;  4DL2 A;  4LF5 H;  2V4D A;  5JOB A;  1EWC A;  1YEZ A;  2YL2 A;  1GD7 A;  1L1O C;  3HBL A;  4A3E G;  1B2T A;  4BBS B;  3GDE A;  2QA4 A;  2R92 A;  4GLV B;  5KFP A;  2HCI A;  4G4K A;  2WB1 E;  2WB1 A;  4DLK A;  4FM9 A;  4QUF A;  4U6P A;  1DGS A;  1NAP A;  2C2E A;  4DV1 H;  3CME A;  2IX3 A;  2F1M A;  3J7Z C;  1WTH A;  1I3Q B;  2JK8 A;  2OEO A;  2RQX A;  3DMU A;  3RF2 A;  3L0O A;  4TRD A;  1KC8 C;  2XCA A;  2CWA A;  2AQ1 B;  5J2U F;  2IJ0 A;  1V9P A;  1LO5 D;  1LAC A;  4OO1 I;  2ZTC A;  4A3I H;  2M00 A;  2HT1 A;  1BDO A;  2B2U C;  3I3C A;  4FNF A;  4ZLT F;  1WH2 A;  1D5M C;  5C44 H;  3KFU A;  4RFB A;  1EQT A;  3K5H A;  1DCZ A;  2W71 A;  2W6O A;  3G4S A;  5L1K A;  3FMC A;  3RB3 A;  4X64 L;  4C2M B;  3I91 A;  3G6V A;  1ZHS A;  3BJU A;  1Q90 A;  2YW2 A;  4K14 A;  1FVI A;  4LJZ C;  1Q12 A;  1U9R A;  5CV8 A;  3WO1 A;  2J6T A;  4B9W A;  5I2Y A;  3IN5 A;  4LUV A;  2EYL A;  3PGZ A;  1K3B C;  5JAV A;  2PBZ A;  1XTD A;  3TIN A;  3BQ2 A;  3W2D A;  5KFR A;  2W9C B;  1I50 A;  1JJC B;  1K8M A;  2ZM6 L;  2VQE Q;  4AYB G;  1E4G T;  4K6D A;  3FPU B;  1GOZ A;  2CWP A;  5FLX E;  4LFA Q;  2R87 A;  2JA9 A;  3TDQ A;  3D8G A;  4R4O A;  1GYF A;  3STB D;  5H80 A;  2Z6K C;  5KND A;  1VQ5 A;  1O7I A;  5EBD A;  1GUG A;  1GSO A;  1J5E Q;  3MC0 B;  2PN1 A;  1I94 H;  3TZD A;  5BR8 Q;  5CC4 A;  4PZ6 A;  1FNV A;  1VQM A;  3K81 C;  4ETS A;  4HNV A;  4JI4 H;  4C5B A;  2HHH L;  2F0P A;  4CC6 A;  3PO2 G;  3RGZ A;  3P7J A;  3T5L A;  2D62 A;  4Y8V B;  3F2C A;  2QDL A;  3ONA B;  3SK6 A;  4A3K G;  2W7P A;  1XNR Q;  1IYV A;  1VCI A;  1E4E B;  1TWA A;  1UE1 A;  2RSO A;  2R3Z A;  2F0S A;  1Q8I A;  5M5W H;  3MVV A;  1X3F A;  4FU0 A;  2A1A A;  4X65 L;  1EY6 A;  2CQA A;  3ERS X;  1WTX A;  4ME6 A;  1FR3 A;  3D0F A;  2OT2 A;  2PPB C;  2AWN A;  1A2U A;  1N32 H;  3LWU A;  4JI3 L;  1KL9 A;  4DV6 Q;  1WD1 A;  3QFF A;  4HQ6 A;  3UQ8 A;  2RDG A;  1C7Y A;  1L2F A;  2PZU A;  3F2B A;  1LT3 D;  4JV0 A;  4X3U A;  1WTR A;  5C4X G;  5CB4 F;  2HDM A;  4JV5 L;  2HVR A;  5LL6 S;  3FP9 A;  3F1Z A;  2VR1 A;  4DA2 A;  2AKW B;  4ECX A;  4DR7 L;  1EIH A;  2NB0 A;  2BE5 C;  4GN4 B;  3Q8R B;  4GC7 A;  3NK9 A;  3HS0 C;  2MFI A;  4GKJ H;  5L1I A;  5K5P A;  4NXN H;  4BA1 I;  5M5X B;  3J81 W;  1HH2 P;  1AZQ A;  4EQP A;  2F3I A;  3T4A C;  4OL7 A;  3HKZ G;  2F0N A;  4I50 F;  1UUP A;  1SSO A;  2AWO A;  2UXC L;  2KED A;  4DGZ A;  5KFN A;  4QWB A;  3JAM L;  3U4Z A;  5KFK A;  2ZDH A;  2KEC A;  2QK4 A;  1HJP A;  2F0G A;  2Z4I A;  2I5H A;  3MWD A;  2DY7 A;  2F0T A;  3G6J B;  3BAB A;  5ELF A;  1TR5 A;  5LMN Q;  2XC9 A;  2QEX A;  3JRW A;  4JI8 L;  5IE8 A;  3M4I A;  1I6V C;  1ML0 D;  2Q2I A;  4LF8 Q;  5IIF A;  3FPP A;  1M90 C;  3I4N B;  4RNM A;  1KJ9 A;  1DZ1 A;  2HIX A;  3TBI B;  1PZJ D;  4J0M A;  5KT2 A;  4LFC Q;  2O03 A;  4JI6 H;  5M3M G;  3HOZ H;  5LL6 b;  1BCP B;  1TAE A;  1S0O A;  3L7Z C;  3OWF A;  5JVL A;  2FMM A;  2A68 D;  4K6L A;  4ED3 A;  3VPC A;  5LMU H;  1RJP A;  2YYA A;  2PNR C;  3JRX A;  1BOS A;  1BCP F;  4IFD J;  4LWC A;  4WBN F;  4XXE A;  3M9O B;  1N34 L;  3Q8S B;  4PQX A;  4O1N A;  4EQO A;  3TME A;  1PMR A;  1YHB A;  4OX9 L;  4OIJ A;  3GTL H;  2BE5 D;  3N40 P;  4O2B F;  2D0O A;  1S5B D;  2PMZ A;  1WFQ A;  4J9P A;  3L4K A;  3M4Y A;  4O3N A;  4BY7 H;  2L4N A;  3BAA A;  4OON A;  3H0G B;  4N9T A;  4ZKC B;  1R9T B;  1QJO A;  4A3E H;  1V51 A;  1O7Y A;  4JV2 A;  4DV3 L;  1OXT A;  3U9S A;  4G57 A;  1I94 Q;  3GV6 A;  1IHZ A;  4DUY H;  4LF4 L;  3MXN B;  2YS6 A;  3GTK A;  3GII A;  2FMC A;  2NUA B;  4KHP Q;  5CGK A;  4EX5 A;  3S16 H;  2A19 A;  4XIG S;  5C0X G;  3HRZ C;  5KRU A;  3K3V A;  5KT5 A;  1Y1V G;  1L0Y B;  4LUO A;  1K73 C;  1DIK A;  1SN8 A;  5D14 A;  1KJ8 A;  2YCH A;  5IT9 W;  3N41 B;  3TS2 A;  3D6W A;  2BA0 A;  4L63 B;  2E2J H;  1VQH A;  2D0P A;  5JH7 F;  4QMG A;  4KI0 A;  5DNF A;  3N42 B;  1RD9 D;  3NTI A;  4QWC A;  1TWG H;  2ZXR A;  1S72 A;  1EZ1 A;  1G8Z D;  2BA1 A;  2E74 C;  1GXD C;  1N32 Q;  3IKJ A;  5KGU A;  1HNX L;  1B6S A;  1D2B A;  4HN7 A;  3J7Y W;  2XIW A;  1HA6 A;  2O5I C;  1IYU A;  2J6S A;  4ED1 A;  5FLM G;  2ASD A;  2JA5 A;  2F0D A;  4XDX A;  1SFO B;  1S9F A;  1SNO A;  2F3W A;  4DAP A;  3V96 A;  3TP6 A;  4ECV A;  3V05 A;  4EEQ A;  3EVQ A;  3I55 A;  3CD6 A;  4HAE A;  4HR7 A;  3MXU A;  1L1O B;  3DEP A;  4OO1 G;  5DGA A;  3D4W A;  4IRC A;  1JKJ B;  2WE6 A;  1O80 A;  5KFZ A;  3TIG A;  2FFK B;  5C3E G;  2W6N A;  2K14 A;  1MSH A;  1VQK A;  4RKL A;  1UNN C;  4ECW A;  5I2X A;  2YTY A;  1CSQ A;  2PQA A;  3J7A F;  3N43 B;  1HZA A;  2H4O A;  4KY6 A;  3RMH A;  4A3D B;  2VQE L;  1SRO A;  1TA8 A;  3SDZ A;  3A8I E;  1PHJ A;  3PO2 H;  4PZ8 A;  3PW4 A;  2OWO A;  2GVB A;  4C1N K;  2ATL A;  4EBC A;  3X3M A;  4DAM A;  3GTJ B;  1TWC A;  1YNX A;  1UEA B;  2GN5 A;  2A5H A;  1I4H A;  2NBF A;  4EVO A;  5BR8 L;  2FK2 A;  3Q1K A;  3RGX A;  3KF8 A;  2JA7 G;  3P20 A;  1BXR A;  2R8J A;  5L9X A;  4TKO B;  1F9Q A;  4UDU C;  2RDH A;  1STN A;  3K5I A;  2NVT B;  2VUG A;  3U9O A;  1N33 Q;  4ZQI A;  1M6V A;  5C4J B;  4BY1 B;  2ZJT A;  2DPJ A;  2R7N A;  4P73 A;  1WCM B;  2JA6 A;  1XNR L;  4RNN A;  3QOL A;  4ED2 A;  2B8G A;  1ICF B;  1ROD A;  1FGB D;  1SMX A;  1K0R A;  5ELE A;  1ET6 A;  1YNN D;  2F0K A;  5COR A;  5LXT F;  1Z2N X;  3KJO A;  2QEJ C;  2EXD A;  2F0H A;  3FRP B;  4X64 H;  4S3S A;  3DEO A;  4JK1 C;  5C4X H;  5LMU Q;  1E2V A;  3KTM A;  3VR3 A;  4GOP B;  1RYS A;  4RNO A;  2NN6 I;  2W9B B;  2UVR A;  4UP8 A;  3R2I A;  4DV6 L;  2WKD A;  3MA2 B;  2B63 B;  3PVX A;  2EYO A;  4KV6 A;  5TSS A;  5C3W A;  3GIM A;  3NQT A;  1S10 A;  2JXM B;  2R7Z B;  3GTP A;  4XYL B;  3BDL A;  3R2T A;  3URY A;  2ZM6 H;  1HZC A;  4L5S A;  1V1Q A;  4C56 C;  3GV5 B;  1PDQ A;  3PN1 A;  1CI3 M;  1WI5 A;  5KFI A;  1LTT D;  2N88 A;  3F8N A;  1TS4 A;  3IFD A;  4R4I A;  5CR3 A;  5KFD A;  1E0B A;  2PCF B;  5C1O A;  3J80 c;  2E2I A;  1L2Z A;  1W93 A;  4IJL A;  5ELO A;  4EBE A;  4A3L G;  4AQY H;  3MEF A;  5FKA C;  4NXM L;  2A6H C;  3HOV H;  3M7N A;  2L9H A;  5C5J A;  3GV8 B;  3IL8 A;  5E4W C;  1QWY A;  4DUY Q;  4TSS A;  2HHH H;  3H4D A;  2A6E C;  2L15 A;  1SLJ A;  2J9G A;  4JG2 A;  3S17 H;  3T53 B;  1FNW A;  4R9W A;  2HCC A;  2SOB A;  2Y0S B;  1T5E A;  2LFN A;  3PCO B;  4A3G G;  1ICW A;  2PYK A;  4JI7 Q;  4A3I B;  1EZ6 A;  4LF6 Q;  5KFJ A;  1WVL A;  3NWT A;  5C44 B;  5LMN W;  2WYO A;  2VL6 A;  4X65 H;  1R4P B;  1MD2 D;  5M3M H;  1I3Q A;  3NPP A;  5LMN L;  1SNQ A; 
#chains in the Genus database with same CATH homology
 3BU2 A;  3GO5 A;  4UY8 C;  4LF8 L;  1Q82 C;  1MJE A;  4A3J G;  3TEH B;  2KHJ A;  4HJA A;  4DUZ Q;  1E24 A;  4OWT B;  3HOU H;  4LFC L;  3ULP A;  2I0Q A;  1VQ6 A;  1HZB A;  1Q86 C;  4JI5 Q;  3U50 C;  4DR1 Q;  1TXY A;  2VS1 A;  3EIV A;  5IYD G;  2VUM G;  4LF7 Q;  2E2H H;  3RLO A;  1XNQ L;  3T1H Q;  2YU9 H;  5HGQ A;  1PV4 A;  3HOW H;  3RZO H;  3PSI A;  5AJ3 Q;  3BZC A;  5IYC G;  2UXB L;  2PQA B;  1PH5 A;  1AE3 A;  3AFQ A;  4HJ5 A;  1MKH A;  4C3J H;  1CKN B;  2WFW A;  1SFO H;  2YTX A;  2N3S A;  1PH9 A;  1X3G A;  3KYH C;  1IYJ B;  3NEN A;  4UP9 A;  3PUZ A;  1A63 A;  2R93 H;  2WB1 G;  5IT9 c;  1UWV A;  1VQO A;  1VQL A;  5IP7 G;  1TWC H;  1I5F A;  1VS0 A;  3GD7 A;  4GLX A;  1KXL A;  4A75 A;  2H5X A;  2WAQ G;  1JMC A;  2NVY H;  4DR4 L;  2UXC Q;  2Q2T A;  3HFZ B;  2JE6 I;  2LXJ A;  2IHF A;  4DR2 L;  5E7N A;  4PG3 A;  1IBK L;  4HJ9 A;  2N78 A;  4DUY L;  3KF8 B;  4A3D H;  3OTO L;  1VQ4 A;  1GM5 A;  5JEA J;  4HIO A;  3ICE A;  4JYA Q;  4JI8 Q;  1S3O A;  1CKN A;  4QL5 A;  3B6Y A;  1NJI C;  3FKI H;  5GAE C;  2VQF Q;  1IBL Q;  2VNU D;  3GTM H;  3S1N H;  3K7A H;  4DK3 C;  2B29 A;  1P8L A;  4WJ3 M;  2IT1 A;  1ASY A;  3CCE A;  3GTJ H;  1GO3 E;  2ATW A;  5FJ8 G;  1YIJ A;  4KHP L;  3CCU A;  1KHI A;  1KRT A;  3EN2 A;  4EQ5 A;  2F4V L;  4Y7N H;  5GRO A;  3KDF A;  4A3K H;  1HNW L;  4LW1 A;  4B3S Q;  4JI1 L;  1L0W A;  4L5Q A;  1K8A C;  2NVT H;  1JT8 A;  5C4J H;  3E0E A;  3CMA A;  4DV4 Q;  4GNX B;  3OW2 A;  1PH4 A;  4BY1 H;  1WCM H;  3GTP H;  4DPG A;  3HOZ G;  2OCE A;  1VQA A;  1N8R C;  2JA8 G;  1E1O A;  4OWX B;  2RCN A;  1Z47 A;  5FLM H;  1PH2 A;  3TRZ A;  1K3R A;  4J15 A;  1XPU A;  2IY5 B;  2PI2 A;  2PI2 E;  3PIP A;  4IOA A;  2OTL A;  2LSS A;  2UUB L;  4DV0 Q;  1JE5 A;  1WOC A;  2ALY B;  2F52 A;  4BXX H;  3CPW A;  3S2D H;  1VQC A;  1B8A A;  4YY3 L;  3A74 A;  3F2D A;  1M1K C;  2RHS B;  4B3M Q;  5GAH C;  4L5S A;  2K5H A;  5C3E H;  2B63 H;  4LF5 Q;  3H0G G;  4GLA C;  4R4Q A;  3T1Y L;  1XMO Q;  1Z9F A;  2K5N A;  4DV3 Q;  2ZM6 Q;  2GVA A;  1LM0 A;  1NMF A;  4IPG A;  3HOV G;  1JJ2 A;  3H3V H;  4BY7 G;  4DKA C;  4LF4 Q;  5M3F G;  2ZJQ A;  1CKM A;  3E9H A;  4AIM A;  3AQQ A;  3J81 i;  3UDX A;  2UU9 Q;  2ZTE A;  4DV1 Q;  4JOI A;  1YEZ A;  3U58 A;  1GD7 A;  1L1O C;  1VQ8 A;  3U4V A;  1BKB A;  4A3E G;  3GTK H;  3GDE A;  2QA4 A;  4AQY Q;  4GLV B;  1W2B A;  4YWL A;  4DR3 Q;  2WB1 E;  4JYA L;  2E8G A;  3SGI A;  2XTI A;  4R4C A;  2WAQ E;  1DGS A;  3UE1 A;  2ID0 A;  2VQF L;  1XMQ L;  2HHH Q;  2XGT A;  1X65 A;  1YZ6 A;  3CME A;  5IWA Q;  2JA7 H;  3DLL A;  3J7Z C;  4PMW A;  2JK8 A;  1HR0 Q;  3RNU A;  3L0O A;  2YYZ A;  1VQ7 A;  1KC8 C;  2CWA A;  2K75 A;  4HIK A;  4IPC A;  1V9P A;  2UUC L;  1W3S A;  4OO1 I;  2ZTC A;  1OXV A;  3I56 A;  4A3I H;  4YWK A;  3FHW A;  1Y1W H;  1YBY A;  4X65 Q;  1Q81 C;  2HT1 A;  3HOU G;  5C44 H;  4HJ8 A;  4POG A;  3KFU A;  4GKJ L;  1PYB A;  3E9I A;  1VQD A;  2IHE A;  4A4I A;  4DV2 Q;  3G4S A;  1N33 L;  2NZH A;  5JJK A;  4BA2 I;  3H3V I;  4X64 L;  3GTO H;  1N36 Q;  4K0K Q;  3CC7 A;  2MNA A;  3AFP A;  3BJU A;  3PUW A;  2JA5 H;  2FXQ A;  4O2D A;  1FVI A;  1Q12 A;  3S14 H;  3HOX H;  2UXD L;  4LUV A;  3PGZ A;  4A93 H;  1XTD A;  4DV7 Q;  2R93 G;  4JV5 Q;  1G6P A;  3KOJ A;  4FDB A;  3RR5 A;  1NTG A;  5LMU L;  2E5L L;  4XTC S;  5C0X J;  1JJC B;  1CUK A;  2ZM6 L;  1X3E A;  4AYB G;  2VQE Q;  4A3F H;  4DR7 Q;  4JC0 A;  5JJL A;  1SRU A;  3HKS A;  2CWP A;  4YHH L;  4LFA Q;  1VQP A;  2OQ0 A;  4B3T Q;  1GVP A;  1Q1B A;  2AHO B;  2JA9 A;  1S40 A;  4JI4 Q;  4R4O A;  3STB D;  3VDY A;  2Z6K C;  4RG1 A;  1VQ5 A;  1O7I A;  1J5E Q;  4GKK L;  1BBU A;  4GS3 A;  5BR8 Q;  1BVS A;  2R92 G;  4DR3 L;  5FLX c;  3M3Y H;  4PZ6 A;  2BH8 A;  1VQM A;  3K81 C;  2NN6 G;  4DR6 Q;  1G29 1;  2HHH L;  4DV5 Q;  1GKH A;  1EUJ A;  4B3R L;  2R6G A;  5IWA L;  3PO2 G;  2OTJ A;  1YJ9 A;  1E1T A;  2D62 A;  3KDF B;  3F2C A;  3M85 A;  3TQY A;  3W5O A;  4A3K G;  3RZD H;  1QUQ A;  3UDI A;  2VW9 A;  1XNR Q;  1VCI A;  2Z0S A;  4QGU A;  1UE1 A;  2AMC B;  3A5Z B;  1AE2 A;  1X6O A;  2UUA Q;  3I4M G;  4Y52 H;  4JI0 L;  2JA6 H;  2CKZ B;  1YVC A;  5M5W H;  4C3H H;  1X3F A;  2A1A A;  4X65 L;  4PZ7 A;  4A3J H;  1PH6 A;  3ERS X;  4YCW A;  1Y1V H;  3D0F A;  1JB7 A;  3TRE A;  1OXU A;  4LNQ A;  2AWN A;  4JI7 L;  4LF6 L;  1AH9 A;  5IP9 H;  4UPA A;  4GN5 A;  3G71 A;  1P16 A;  2ASB A;  4DR5 L;  3I4N G;  4JI2 Q;  3PUV A;  1N36 L;  4LF9 Q;  4JI3 L;  1KL9 A;  5JEA G;  3AYH B;  3ULL A;  4DV6 Q;  4P71 A;  4QJF A;  1C7Y A;  2KBN A;  5IYD H;  1L2F A;  4IFD I;  3F2B A;  2IX0 A;  1K9M C;  4JI6 L;  4JBW A;  1WYD A;  1PH3 A;  1FL0 A;  2B63 G;  5C4X G;  1T9H A;  3M4Q A;  4LFB Q;  1N34 Q;  3K0X A;  3CF5 A;  4GKJ Q;  4JV5 L;  3HOY G;  3CPF A;  2EQS A;  2R7Z G;  3FP9 A;  3F1Z A;  1K83 H;  4DUZ L;  4NXN Q;  3PUY A;  3HOZ H;  2AKW B;  3PO3 H;  4JI5 L;  3RLN A;  4OX9 Q;  4DR7 L;  4DR1 L;  1A62 A;  1X55 A;  3A5U A;  4H02 A;  4LF7 L;  1EWI A;  4GN4 B;  1N9W A;  3T1H L;  4LFA L;  3CQZ H;  4B3T L;  5IP7 H;  2MFI A;  5AJ3 L;  4IOC A;  3KJP A;  4R4T A;  2E2I H;  4BA1 I;  3PUX A;  3LGJ A;  1HH2 P;  1J5E L;  1L1O A;  3CCS A;  4C3I H;  2F3I A;  3M9B A;  5EAY A;  4L5R C;  1CSP A;  4UP7 A;  1YJN A;  3HKZ G;  1KRS A;  1KD1 C;  4AYB E;  4A3B G;  2YV5 A;  1PVO A;  4X62 Q;  3J81 j;  2AWO A;  3L2P A;  2UXC L;  4IPH A;  4MZ9 A;  2Y0S G;  1VQG A;  4BBS H;  3U4Z A;  2KCM A;  1IBM Q;  3W1B A;  4DNI A;  2R7D A;  1HJP A;  4A3M G;  1Q8K A;  3STB C;  4MNO A;  2I5H A;  1X9N A;  4P74 A;  1PH8 A;  4A3I G;  5FJ8 H;  2UUA L;  2HQL A;  1YHA A;  1A8V A;  5H1S E;  3CXC A;  5LMN Q;  4JI6 Q;  3M4O H;  2QEX A;  4YCV A;  2VZA A;  4KLK A;  2MQH A;  5GQO A;  1UE6 A;  4JI8 L;  5IE8 A;  2Q2I A;  2ZJP A;  1U0L A;  1I3Q H;  1UE7 A;  1M90 C;  4LF8 Q;  1VQN A;  2BH2 A;  3DM3 A;  4BBR G;  1NMG A;  1EQR A;  2CQO A;  1VQB A;  1VQJ A;  3ZJY C;  2HIX A;  1EYG A;  1IBL L;  3JAM c;  2CCZ A;  4A3C H;  4LFC Q;  3J7A 5;  5IYB G;  5M3M G;  4DAY B;  1PYS B;  1QZH A;  4JI2 L;  1VQ9 A;  3S1M H;  2JA8 H;  5J3B A;  2ZTD A;  3L7Z C;  3K7U C;  4YWM A;  1LUZ A;  4B3S L;  3CCQ A;  1HNX Q;  4IFD J;  1E3P A;  4LWC A;  5HY6 A;  4LFB L;  1N34 L;  4DV4 L;  4A3F G;  4C2M H;  2HIV A;  5DLQ E;  5K36 G;  2PNH A;  3GTG H;  1PA6 A;  1YHB A;  1MIU A;  4GNX C;  1YJW A;  2QGQ A;  4X6A H;  4OX9 L;  3GTL H;  3CCM A;  2I5M X;  3HOW G;  1QVF A;  4QQB X;  3H0G H;  2D0O A;  1KAW A;  1WFQ A;  3JC6 6;  4DV0 L;  4BY7 H;  4HID A;  4OON A;  5M3F H;  2Z6K A;  1X54 A;  1XJV A;  4B3M L;  4WJ4 A;  3TS0 A;  2DGY A;  1TWF H;  3CP0 A;  2N8N A;  4ME3 A;  4LF5 L;  4A3E H;  1XMO L;  1TWA H;  1I6H H;  4DV3 L;  3KLW A;  4X62 L;  1OXT A;  4IJH A;  4JBJ A;  4AH6 A;  3K80 C;  1I94 Q;  4JBK A;  1QUQ B;  3UE0 A;  1KQS A;  4LF4 L;  2R7F A;  4R1J A;  4GOP C;  3MXN B;  1UE5 A;  1PH7 A;  1Q1E A;  3PV0 A;  4A3D G;  1FJG Q;  1ASZ A;  4KHP Q;  1Q46 A;  2UU9 L;  1TWH H;  4DV1 L;  2JA6 G;  4A3L H;  3W1G A;  2F4V Q;  4EX5 A;  3S16 H;  2A19 A;  4XIG S;  3RLF A;  5C0X G;  1HNW Q;  1PFS A;  3UDF A;  4AQY L;  1YHQ A;  3FKI G;  2ZJR A;  3HKZ E;  4JI1 Q;  2IX1 A;  1Y1V G;  4LUO A;  1K73 C;  2A8V A;  3RN2 A;  1SN8 A;  1HR0 W;  1V43 A;  5IP9 G;  1E22 A;  2K5V A;  3G6E A;  3TS2 A;  3S1Q H;  4X66 Q;  2BA0 A;  4POF A;  2E2J H;  2Y0S E;  1VQH A;  2D0P A;  5GAG C;  3NBH B;  1B7Y B;  3GTQ H;  1UEB A;  1EOV A;  3KF6 B;  1HR0 L;  4A3G H;  4KI0 A;  1Y14 B;  2V1C C;  2KHI A;  4A76 A;  1TWG H;  1S72 A;  2BA1 A;  2Q2H A;  2UUB Q;  1B70 B;  4BY1 G;  1N32 Q;  1HNX L;  1WCM G;  2OQK A;  3M4P A;  1VQI A;  1K8G A;  1QZG A;  1HNZ Q;  4YY3 Q;  2JQO A;  3PO3 G;  2JJQ A;  3F8T A;  3ULJ A;  1C9O A;  4NPS A;  5FLM G;  4DK6 C;  1PH1 A;  4DV2 L;  3T1Y Q;  1SE8 A;  4RMF A;  2I5L X;  4K0K L;  3A0J A;  2B3G A;  1EIY B;  3I55 A;  2MO0 A;  3CD6 A;  2NZO A;  4BXX G;  3KF6 A;  1SR3 A;  1L1O B;  2VUM H;  2EIF A;  4ALP A;  2NVQ H;  4OO1 G;  2MO1 A;  4TVA B;  3Q8D A;  5C3E G;  1RL2 A;  1QVC A;  2K14 A;  1VQK A;  4DV7 L;  5IYC H;  2YTY A;  1CSQ A;  2PQA A;  1OXS C;  2K52 A;  2C35 B;  3G48 A;  1HZA A;  2VQE L;  1SRO A;  2WP8 J;  1XMQ Q;  4P75 A;  1I94 L;  1IL2 A;  2R92 H;  4BBS G;  3I4O A;  4P72 A;  1OTC A;  5JJI A;  5M5X H;  1PHJ A;  4JI4 L;  1FJG L;  4NXM Q;  4LUZ A;  3PO2 H;  3ER0 A;  2JEB I;  4PZ8 A;  3PIO A;  2OWO A;  2GVB A;  1JJG A;  3CCV A;  2NVX H;  4IPD A;  1HZ9 A;  4DAM A;  1YNX A;  1IXR A;  2GN5 A;  5BR8 L;  5ELN A;  2UUC Q;  2JA7 G;  4A3C G;  3I4M H;  4DR6 L;  4QY7 A;  4DV5 L;  3CCR A;  1IZ6 A;  4X66 L;  1MJC A;  3PF5 A;  1EFW A;  3WWV A;  3CAM A;  3UDG A;  1N33 Q;  3NEL A;  4P73 A;  4X64 Q;  1XPO A;  1XNR L;  2CFM A;  1SMX A;  3NEM A;  4L5T A;  1K0R A;  1Y1W G;  3I4N H;  3PF4 A;  1H95 A;  1N32 L;  5C44 G;  3EBE A;  4HJ7 A;  3KJO A;  3AEV A;  3J81 c;  2ES2 A;  1BBW A;  2UXD Q;  1HNZ L;  2EXD A;  1A0I A;  3CC4 A;  3K8A A;  4MTN A;  3D31 A;  5C0X I;  1KIX A;  1D8L A;  1FGU A;  3CC2 A;  5LMU Q;  1WJJ A;  5C4X H;  2E5L Q;  4GKK Q;  4GNX A;  4IO9 A;  4GOP B;  2JA5 G;  2R7Z H;  2NN6 I;  1EQQ A;  3HOY H;  4UP8 A;  4O0A A;  3S1R H;  4LF9 L;  1D7Q A;  4DV6 L;  1XNQ Q;  3S2H H;  4YHH Q;  1OXX K;  1I50 H;  3HOX G;  1J6Q A;  3I7F A;  3S15 H;  4TQU S;  4A93 G;  2UXB Q;  4JCV E;  4OWW B;  5M5Y H;  2KEN A;  1HZC A;  4HIM A;  1V1Q A;  3JAM i;  1QVG A;  4JBM A;  1NY4 A;  3I2Z A;  1WI5 A;  2K4K A;  2RHQ B;  4GN3 B;  5GAD C;  4NXN L;  2K50 A;  4R4I A;  1VQE A;  2RF4 A;  2DUD A;  3CW2 C;  5IY0 A;  3J80 c;  2JEA I;  4B3R Q;  4IJL A;  4DR4 Q;  4A3B H;  5ELO A;  4IFD G;  2PMZ E;  4A3L G;  4GOP A;  1LYL A;  1R9T H;  4DR2 Q;  3MEF A;  3IRB A;  4NXM L;  3HOV H;  4QIW E;  1C0A A;  1IBK Q;  3RN5 A;  3M7N A;  3H15 A;  4JOI C;  3CCJ A;  1LTL A;  3S24 A;  4DUY Q;  1EIF A;  2KCT A;  2YTV A;  3OTO Q;  1NBW A;  2L15 A;  4A3M H;  1SLJ A;  4JI0 Q;  4JG2 A;  1VQF A;  1YI2 A;  1YIT A;  4NB3 A;  3S17 H;  2N49 A;  1RIP A;  2VY3 A;  3J80 i;  1U5K A;  3BZK A;  1Q7Y C;  3CCL A;  3PCO B;  4A3G G;  4KHZ A;  1CKO A;  1XPR A;  4JI7 Q;  2LXK A;  1G51 A;  4LF6 Q;  4BBR H;  5LMN W;  4YCU A;  4DR5 Q;  4OXP A;  1NE3 A;  1IBM L;  2VL6 A;  4JI3 Q;  1X56 A;  2Q2U A;  5IYB H;  5M3M H;  1E7Z A;  3OYY A;  5LMN L;  4APV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...