3HOXG

Complete rna polymerase ii elongation complex v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoxG01
1E1TA 4LFAL 1MKHA 1LUZA 5AJ3L 3TS0A 4MTNA 1A0IA 3CCUA 4DR7L 2AHOB 2WFWA 3M85A 1XMQL 1HR0W 3GTMH 4YCWA 1WCMG 4R1JA 1YI2A 3PV0A 3W1BA 4B3TQ 1FVIA 1Y1VG 3OW2A 4PZ7A 1E22A 3E9HA 1Y1WG 4A3KG 1QVFA 1I6HH 4AH6A 2ZM6L 3CMAA 1VQHA 2VS1A 5JEAJ 5FLMG 3JAMc 4A3JG 4B3SL 2R92G 5IP9H 3TEHB 2IT1A 3BZCA 3F2BA 1EYGA 2C35B 2HT1A 4OONA 3BJUA 1K73C 2CWAA 4JC0A 4AYBG 1XMQQ 4R4CA 4MZ9A 4A3BH 1TWGH 3RLOA 5M3FG 3CW2C 4L5TA 3DLLA 3CCJA 4C2MH 3HFZB 4L5SA 1E24A 1VQJA 3A74A 3F2DA 1PH2A 2F3IA 2JE6I 2UU9Q 1D7QA 1XPRA 3L2PA 4ALPA 1XMOQ 1QVGA 1IBML 4DR1Q 3HOUG 2ZM6Q 4DR4Q 3F8TA 1HNZQ 1PH8A 1HZBA 1PH5A 1RL2A 4DV0Q 4KHZA 2A1AA 2IHEA 2UUCQ 4JI6L 1K3RA 2VY3A 2YTXA 3CCMA 2A19A 4BY1G 3U58A 4LF6L 1WFQA 3S1QH 1HNWL 1X55A 4GS3A 2R7DA 4DAYB 1WYDA 2AWNA 2R6GA 5H1SE 2NN6I 4DV3Q 4APVA 4C3IH 1PH9A 1CUKA 4XTCS 4JI8Q 5LMNW 4O2DA 3S14H 2KHJA 1N32Q 2LXJA 2H5XA 4LUOA 1VQ8A 5FJ8G 3PF5A 4GLAC 5IP9G 5GADC 2UUBL 2WB1G 4Y52H 4RG1A 4DV6L 1KRSA 3HOXG 1K9MC 2AWOA 3OTOL 4PG3A 1HNXQ 2ID0A 4AIMA 2E8GA 1VQ9A 2Q2UA 2R7ZH 4X6AH 4DR1L 3CCLA 1NJIC 4X62Q 3HOWH 3I55A 1M1KC 4JG2A 2Y0SE 3G4SA 1V9PA 5FJ8H 4IFDG 4JI6Q 2JA6G 5GROA 4L5RC 4GNXB 3CPWA 1KHIA 2PMZE 2Z6KA 1J6QA 4R4IA 4JI5L 1TWFH 2MO1A 4NXNQ 4NPSA 3H3VH 4LF7Q 1HNWQ 1C0AA 2Y0SG 5C44H 4A3DH 4JV5Q 4QY7A 2N49A 4X64L 1HH2P 4PMWA 1Q86C 4DKAC 3ICEA 2RF4A 1EIYB 2UUAQ 3F1ZA 1OTCA 4LFBQ 2BH8A 3PCOB 2UUBQ 4GLVB 4GKKQ 4KI0A 1HZCA 4BBRG 4DV2L 1PH3A 2F4VL 3OTOQ 3RZOH 1L0WA 1I3QH 4JI2Q 3HOZG 2NZHA 4GLXA 3M4PA 5M5XH 1UE1A 4DV4Q 1FJGL 1JB7A 2NVTH 2Q2HA 3CCQA 1Z9FA 3GTJH 3RN5A 4LF4L 2K5VA 5IP7G 5M3MG 2VL6A 2WAQG 3DM3A 3TS2A 4YWLA 4OXPA 4R4TA 4X66L 1EFWA 3S24A 5FLXc 1OXTA 3GTPH 1HR0Q 3KF6B 2UUAL 1IBLQ 3F2CA 4DK3C 2LSSA 2MQHA 3G48A 4LFBL 2B3GA 1X6OA 3A0JA 4PZ6A 4DV1Q 1NE3A 4LF9L 1V43A 2F4VQ 4K0KL 2UXDQ 1IL2A 1K83H 1IBKQ 4JI2L 5ELNA 3KJOA 4QIWE 1YJ9A 2JEAI 1H95A 3HOYH 3J81j 1M90C 4JI3Q 3KF6A 1BVSA 4HJAA 1FGUA 1VQ6A 3J7ZC 3S1RH 4FDBA 1WI5A 4POFA 1KQSA 1VQFA 4DUYQ 1Z47A 4GNXA 1Q81C 2JJQA 4P71A 4BY1H 2GVBA 1U5KA 4X66Q 1PV4A 1VQGA 4XIGS 2PI2A 1VQKA 1TXYA 3I4OA 5LMNL 1VQMA 3HOUH 3H3VI 2KENA 1XNRQ 3AQQA 3AYHB 3PO3H 1VCIA 2BH2A 4DV1L 1Y1VH 4HJ9A 2WP8J 1VQPA 1HZAA 2YYZA 4LF5Q 4JBWA 1YVCA 1IBKL 4JBMA 4POGA 3KOJA 3EBEA 4JYAQ 3ULLA 2R93H 4HJ8A 4B3RQ 4J15A 2EXDA 1GVPA 5IY0A 4PZ8A 2XTIA 4P72A 1VQIA 1HZ9A 2MFIA 3U4ZA 4DUYL 3S16H 1K8GA 4QQBX 1SMXA 1YIJA 3M7NA 3STBC 4BBRH 1O7IA 2OWOA 3RLNA 1KAWA 3E0EA 3M4OH 2ALYB 2OQKA 3L0OA 3PUYA 4GKJL 1V1QA 4RMFA 3JAMi 4DR2Q 2I5LX 5C0XG 2YTVA 1XNQQ 1CKOA 3CQZH 2JEBI 2JA8G 3PO2H 4A3EH 2V1CC 1VQ7A 1P16A 2HIXA 3M3YH 2IX1A 3BZKA 2OCEA 4LF5L 2PNHA 3EN2A 3KF8B 1GM5A 4OX9L 1I5FA 1PYSB 1W3SA 2ZTCA 3Q8DA 1L1OC 4O0AA 1XPOA 1CSPA 1GD7A 3GDEA 2GVAA 3PIPA 3I4MH 4HJ7A 3ERSX 3UE1A 4JI0L 4P75A 3CCVA 4BY7G 1UEBA 2N8NA 3CP0A 4A93G 4LFAQ 5M3MH 4JI1L 3PIOA 3J80i 5JJLA 4LF8L 3I7FA 2BA0A 1Q8KA 4A3IG 1YHQA 5ELOA 5BR8L 1J5EL 4A3LG 3IRBA 1PHJA 2WB1E 1C9OA 3PUXA 2WAQE 3ER0A 1L1OB 1OXSC 2FXQA 1S40A 4DNIA 4DAMA 4JI4Q 3EIVA 4GKJQ 1YITA 1XNQL 2AKWB 1EUJA 5FLMH 2I0QA 4DR6L 3D31A 4B3TL 3GTOH 2Z0SA 5GAHC 2N3SA 1N36Q 1EQRA 1A62A 1SE8A 2K52A 2K75A 1W2BA 4UPAA 1N34L 1IZ6A 2CKZB 2ZJPA 4JBKA 2OTJA 4AQYQ 4NXML 1Y1WH 5K36G 1YJNA 5LMUQ 1L1OA 3W5OA 1GKHA 4IFDI 3I4MG 5IYCG 1Y14B 2MNAA 3UDGA 1MJCA 4JI0Q 1NBWA 2K4KA 3KFUA 4IOAA 3CPFA 4LNQA 3PF4A 2KCTA 1VS0A 1S72A 2JA6H 1PVOA 3NEMA 1Q82C 4P73A 4DR5L 5C4JH 3S2HH 3I2ZA 5BR8Q 4A3IH 1I94Q 1XTDA 1NY4A 2RHQB 4DK6C 3TREA 1B70B 2JA7G 3CC4A 3S1MH 4A3BG 3KJPA 3RNUA 4A3MG 3W1GA 1KL9A 5GQOA 2PQAA 4Y7NH 2B63H 2UXBL 2MO0A 3FHWA 4IJLA 4JCVE 3I4NH 3GO5A 3RZDH 1N34Q 2VUMH 1PFSA 1X3GA 1YHAA 4YWMA 5LMUL 3UE0A 1QZHA 2JA9A 3D0FA 4HIMA 4DR4L 2UXCQ 4H02A 2DUDA 2QEXA 4DUZL 2PQAB 1SRUA 2R7FA 1JJCB 2UUCL 5HGQA 1BBWA 3HKZE 3CXCA 4LF6Q 1MIUA 4OWTB 4HJ5A 4A76A 1I94L 2HQLA 4A3CH 3HOVH 1X65A 3PUVA 2R93G 2JK8A 5C3EG 4DV3L 1PA6A 1ASZA 1OXXK 1NMGA 3K81C 3CAMA 2A8VA 2JA8H 1IXRA 5JEAG 2HHHL 1P8LA 1C7YA 2UXBQ 1N33L 1N9WA 3CCSA 4DV6Q 4HIOA 4KHPL 1A63A 5JJKA 3HOXH 2DGYA 1VQBA 4TQUS 1X3EA 1HNXL 5M5YH 1VQ5A 2D62A 4KLKA 1K0RA 3B6YA 3FKIH 3BU2A 2E5LQ 3GTQH 4OWWB 1VQCA 2L15A 5IT9c 2CCZA 3HOYG 3FP9A 4A3MH 1DGSA 2Q2IA 5GAGC 1WCMH 4DUZQ 4B3SQ 2IY5B 4A93H 4A3EG 4A3JH 4AYBE 2I5MX 2R92H 4QL5A 2CFMA 4DV7Q 2XGTA 2Z6KC 4TVAB 4JI5Q 1G291 1R9TH 3WWVA 5JJIA 5C0XI 4LF4Q 1IYJB 4GN3B 2K5NA 1Q7YC 3ZJYC 4IPHA 1A8VA 1BKBA 1LTLA 3S17H 3T1YL 3UDIA 1CKMA 4EX5A 1GO3E 3G71A 4JI7L 1B8AA 2NN6G 5IYDG 3TQYA 1L2FA 4C3JH 2HHHQ 5DLQE 1UE7A 1XPUA 4GKKL 3K0XA 1N33Q 4KHPQ 4MNOA 4DPGA 2UU9L 1JJGA 3TRZA 2HIVA 3NELA 4IOCA 5C44G 4A3DG 1XMOL 2E5LL 4QGUA 1IBMQ 2NVXH 1Q1EA 1HJPA 3L7ZC 5C4XG 1TWHH 1HNZL 1D8LA 4JOIC 1FJGQ 4DV0L 5IYDH 4OWXB 1CKNB 3AFPA 3KDFB 2LXKA 1AH9A 1SFOH 1UE5A 2AMCB 1UE6A 1AE3A 3GD7A 1NMFA 1FL0A 4DV7L 3KLWA 4LWCA 3M4QA 3J81c 1KRTA 3CMEA 4HIDA 2ES2A 2ZJQA 2JQOA 2OQ0A 4DV5Q 2JA5G 2EQSA 3PGZA 1G6PA 4OO1G 4JI8L 3T1YQ 5C0XJ 1KC8C 1N32L 3K80C 4JI7Q 4YHHQ 1E1OA 3NBHB 4A3GG 4EQ5A 4IFDJ 3MXNB 2VQFL 1KXLA 4HIKA 2NVQH 3J80c 2ZJRA 3AFQA 2B29A 3ULJA 5EAYA 4BBSH 1Q12A 2JA7H 2R7ZG 4DR3L 1U0LA 4JOIA 4GN5A 5C4XH 4X62L 4A75A 4JBJA 1S3OA 2ZTEA 1UWVA 1OXUA 4LUVA 4QJFA 4YY3L 4UY8C 2QGQA 3CD6A 2NZOA 4NXNL 3RLFA 4GOPA 1YZ6A 2YTYA 4LF7L 3HOVG 1KD1C 3HOZH 1VQEA 3PSIA 4JV5L 3PUWA 4DV5L 1QZGA 2IHFA 5IYBG 4X64Q 2N78A 5IYCH 1XNRL 1X3FA 3PO3G 1QVCA 1JE5A 1X56A 4C3HH 4YHHL 3CF5A 4IJHA 2E2JH 3H15A 2ZTDA 1RIPA 2VQFQ 4DV2Q 1JT8A 4WJ4A 2KBNA 1VQDA 4JYAL 4L5QA 2PI2E 2YV5A 2JA5H 3NENA 5C3EH 2QA4A 4IPCA 1SN8A 4DV4L 1VQNA 4DR3Q 1YJWA 3CCRA 4A3GH 5IP7H 4UP9A 1CKNA 3KDFA 1E3PA 4X65L 2YU9H 3CCEA 4YY3Q 1ASYA 2VZAA 1K8AC 3JC66 5E7NA 4GOPC 3A5ZB 1SROA 4GN4B 1T9HA 2F52A 3T1HQ 2CQOA 4BBSG 3CC7A 1YEZA 3HKZG 3A5UA 4DR2L 1MJEA 5HY6A 1HR0L 1IBLL 1I50H 1VQOA 3GTKH 4YCVA 1CSQA 1JMCA 2VQEL 4LF9Q 1PH6A 3I4NG 4ME3A 1TWCH 3SGIA 1JJ2A 4K0KQ 2UXDL 1QUQA 3GTGH 2RHSB 2K5HA 1YBYA 1BBUA 1SR3A 3J7A5 3E9IA 4JI3L 4LW1A 2CWPA 3J81i 3OYYA 3GTLH 4BY7H 4A4IA 3H0GG 3PO2G 5M5WH 4A3FH 1EWIA 4X65Q 3CC2A 4R4OA 4JI1Q 4GNXC 5IWAL 4LF8Q 4B3MQ 2VUMG 4R4QA 5J3BA 4GOPB 1WOCA 1J5EQ 4A3CG 4LUZA 4A3LH 4P74A 3T1HL 2KHIA 4BA2I 1EQQA 5LMNQ 2OTLA 4IPDA 3HOWG 4JI4L 2BA1A 3LGJA 2I5HA 2VW9A 1XJVA 3PUZA 3STBD 1PH1A 5M3FH 2GN5A 3U50C 4DR6Q 2VQEQ 1Q46A 5GAEC 1OXVA 1N36L 4IO9A 1PH7A 3FKIG 2IX0A 4AQYL 4NXMQ 2VNUD 4B3RL 1AE2A 4IPGA 1PYBA 4UP8A 1N8RC 4BXXH 2D0PA 3S15H 3VDYA 4NB3A 2ATWA 4LFCL 4A3FG 1LYLA 3UDXA 3RN2A 2ASBA 5AJ3Q 4UP7A 5IWAQ 2D0OA 4DR5Q 3K8AA 1B7YB 4B3ML 1KIXA 1VQ4A 1X9NA 3ULPA 3M9BA 4DR7Q 3AEVA 3G6EA 1NTGA 1WJJA 3KYHC 5IE8A 2RCNA 5IYBH 4YCUA 1EIFA 1X54A 1YHBA 1G51A 2NVYH 3K7UC 2Q2TA 1E7ZA 3S2DH 3H0GH 4OO1I 3K7AH 1VQAA 3RR5A 2B63G 2K14A 3S1NH 1VQLA 1QUQB 3HKSA 1EOVA 1LM0A 3UDFA 2E2IH 4OX9Q 2KCMA 1SLJA 4A3KH 2E2HH 2EIFA 1Q1BA 1YNXA 3U4VA 4BA1I 3MEFA 4BXXG 2UXCL 3I56A 4WJ3M 4YWKA 1TWAH 4LFCQ 1PH4A 2K50A
chains in the Genus database with same CATH superfamily
4LFAL 1MKHA 4HEDA 4JI1H 4FP5D 5AJ3L 4DV1H 1IW7D 2LMCB 4KY5A 2PYKA 5KT2A 4DR7L 4ECUA 2KEDA 3HP3A 3IKJA 4M1UB 4C5CA 2E76C 1XMQL 3QG1A 2JSOA 1T5EA 2KA7A 1G2SA 3GTMH 2GPWA 4RNMA 2FLLA 1GGOA 1TWCA 3W1BA 2BQRA 1NSNS 2SCUB 2R7KA 1S5BD 1QWYA 4CJ1B 1D5MC 2YZGA 4J9QA 2UXDH 1I50B 2A69C 1BUVT 1FD7D 3E9HA 4ECVA 1RK6A 3C2PA 2PVPA 2YCHA 5FLMG 3JAMc 5ELEA 2L4NA 5EPJA 1ZHSA 3F2BA 2IW3A 1EYGA 3ERQA 2HT1A 3SVMA 1KNAA 3I8ZA 4X3TA 1K73C 4J9LA 3EJIA 1STHA 4MHEA 4UCVA 5COYA 4J9KA 2EY1A 4MZ9A 1TWGH 4A3BH 1GSAA 4YBZB 4L5TA 3DLLA 1E2ZA 3CCJA 5D3IB 2PMZB 2PCFB 1E24A 2HJWA 1PH2A 2ZJTA 1STYA 1J8IA 4HMIA 3RV3A 1AEXA 5D1OA 3HOUG 5FPRA 1I6UA 1DXMA 3GIIA 2F3VA 3PW7A 1RL2A 3MFYA 4KHZA 2UUCQ 2PMZA 4BY1G 3ONAB 1WFQA 3S1QH 1X55A 3GTJB 1SEBD 2AWNA 1IOVA 4C5BA 4DV3Q 1PH9A 2R93H 5DM63 1CUKA 5EZYF 2K04A 4O2DA 4RB1A 3GTGA 1I3QB 3OMCA 3PF5A 5LYJF 4DL3A 4RUCA 1HTPA 2FMCA 4DV6L 2R7ZB 4FF2A 4P2CB 1SYDA 2AWOA 1HNXQ 2F03A 3QR8A 1YNNC 2PW5A 4AIMA 4H13C 1VQ9A 3GV6A 4O3PA 4JV2A 4DR1L 3NQTA 3HOWH 4X62Q 4C3JB 5IGCA 4ZI7F 1AN7A 1I3QA 1N32H 3TINA 1KJJA 4DV6H 1VMCA 2I87A 1UEAB 1JB3A 3CPWA 1KHIA 5HBRB 5FO7B 1TT2A 4QWEA 2LS01 4JI5L 1IYUA 1IHZA 4DV7H 3GILA 2J6TA 4OIKA 4XX0B 4PMWA 5L37A 3RMHA 4C3HG 4LFBQ 1C8CA 2FINB 1TA8A 2BH8A 4JV0A 5CA0F 4A3MB 2F0KA 3R5FA 3FPPA 3RUPA 4IZOA 1CZGA 4NXNH 3GLKA 4JI2Q 4GLXA 5M5XH 4DV4Q 3QO2A 3EROA 4JI7H 1EHIA 2Q2HA 4O3NA 1PTOD 4EBEA 3FMCA 3RN5A 2JEIA 2WAQG 2UVVA 5KFQA 1EIGA 4XT3B 5HGTA 1OXTA 2CW7A 1C48A 5FPOA 1NCVA 5CORA 2JXMB 1Y1VA 4RHSA 5HV6A 4AYBB 2MQHA 4DK3C 4MV9A 1GUNA 2B3GA 4PZ6A 2YYAA 4DV1Q 1NE3A 1K83A 2UUBH 1SEIA 1V43A 2F4VQ 4K0KL 2V5AA 2D2CC 2M9VA 1UNSA 4FS1A 1BOSA 4JI2L 4J9RA 1EIHA 1H95A 4QIWE 1PRTB 3J81j 4C3IG 4JI3Q 4DV0H 1BVSA 2W7PA 4AYBA 4O42A 1I4XA 2KJXA 3R2IA 4X3KA 1KQSA 1ZKOA 2Y0SB 4ZQIA 5J2UF 2C2RA 1R9TB 2W71A 4QUFA 2B8GA 2JJQA 1U5KA 2M00A 1RHPA 4BWSC 4J6HA 3UQ8A 1VQKA 3RV4A 1XMQH 2CW0C 5DQIA 3LWBA 3DWAA 3H3VI 1YNJC 4PMBA 3PO3H 1EY0A 1VCIA 2BH2A 4DV1L 2ENBA 1Y1VH 4ZUJA 3V6JA 2PNRC 1VQPA 3GTMA 2YYZA 4POGA 4JBMA 4JYAQ 3KOJA 5G3LD 4HJ8A 1EY8A 3L4KA 4J15A 1IKMA 3P20A 5IY0A 5C5LA 4QW9A 4UCOA 1BCPC 5FD5A 4ECRA 3U4ZA 1K8GA 2NVYB 5FK9C 3Q6SA 3STBC 2FB9A 2BE5C 2OWOA 2WE6A 2JA6B 1HNXH 4H0LC 1LT4D 1PYWD 4ID6A 4GKJL 3L3OC 4RMFA 4DR2Q 2I5LX 1M0TA 2KCCA 2ZXOA 3CQZH 4DV3H 1STBA 2HIXA 3M3YH 3GTOB 1GUTA 1BF4A 3EN2A 3KF8B 3KLSA 1GM5A 1I5FA 1PYSB 1L1OC 1QCBD 5I6YA 3H40A 3PIPA 2ICIA 5JVG3 4P75A 3NUCA 3CCVA 1Z2PX 3T5LA 1ENCA 3CP0A 3T4AC 3C3LA 2J7ZA 3SK6A 2R87A 1WTXA 2ZDQA 3I7FA 4IRDA 2C22A 4LH7A 5BR8H 3U9TA 1SE2A 1D5XC 1PHJA 1EOTA 2WB1E 1C9OA 3PUXA 5KT5A 2FXQA 1TIID 3EIVA 2RDJA 2Z6BA 1XNQL 4QUCA 4F50A 2AKWB 5FLXE 4WORA 1Y1WB 4DR6L 5IWAH 3D31A 3GTOH 1V1PB 3PR5B 2E2HA 3VYTA 1W2BA 4Q44A 4UPAA 4JBKA 1IZ6A 2R7LA 1N48A 2IMWP 2QEJC 3OSOA 5CGKA 2FLPA 3M7GA 3H0GB 3I4MG 2XIWA 5IYCG 1WTOA 1BCPF 2W6PA 4JI0Q 3KFUA 1NBWA 2A74C 2H4OA 5FKAC 1VS0A 2KCTA 1S72A 3RJ0A 5KFKA 1V1PA 2MGSA 5F9NA 4ZOLF 4WFN3 3H0GA 4FNFA 1KDCA 1SNQA 4A3BG 4A3MG 3WOEA 3OHXC 4X65H 2UXBL 4O3QA 4JCVE 3R5HA 3SK4A 1N34Q 2VUMH 1YHAA 2KOLA 3KTMA 2Z4HA 2RDHA 2B2YC 3MXGA 4LSXA 3T1HH 1QZHA 2JA9A 4M8AA 3K3VA 4FF1A 2DUDA 1QB5D 3QFFA 5KFOA 4C3JG 5HGQA 3H4BA 4FXDA 2R93A 1RJTA 2IPKD 2YU9B 4YP3A 2KUMA 2NBFA 2VOBA 3HOVH 4QWDA 3Q8RB 2R93G 4DV3L 3NGDA 4RKBA 3M9OB 1OXXK 5JAVA 4MTKA 3Q0AA 2JA5B 2A8VA 3VPCA 5EWEA 4UCTA 2WINB 1N33L 1E2WA 4G7ZC 3HOXH 2DGYA 1HNXL 1X3EA 4DR3H 3B6YA 3GTQH 2W9AA 4Q45A 4GC6A 3DWPA 1VQCA 2L15A 4MV8A 1MI2A 4HR7A 2JA5A 4IQZA 4A93H 2R92H 1ESRA 2B2VA 4DL2A 4YQWA 1AUVA 2CH4W 4TVAB 1EZ6A 4K8IA 1R9TH 5JJIA 4DV4H 5C0XI 1Q7YC 4GN3B 2K5NA 2IX3A 1IOWA 4IR1A 1KJIA 5I9PA 4ED6A 4EX5A 5LP6F 1SJHD 1B8AA 2NN6G 4R9WA 5IYDG 5EKIA 1EZ8A 1L2FA 4C3JH 5JJZA 3RAQA 1UE7A 3PO3B 2AGOA 1Q3LA 2XSCA 4MNOA 2OH2A 4APMA 5JVDF 5KYLA 1VKZA 4QIWA 1KJ9A 5CV9A 3NHHA 1Q1EA 3L7ZC 1TWHH 2EJMA 1D8LA 2RA4A 1HNZL 1JOKA 1FJGQ 4DV0L 2NN6H 5IYDH 3KDFB 3AFPA 1V1OA 2BCOA 3SK8A 1UE5A 5KRUA 4QWCA 5C3EB 1CA5A 1EL0A 4HIDA 2FJ2A 1S68A 3CKIB 3T1YQ 4EQNA 5M5XB 4JI7Q 2EYPA 5D3DA 3NBHB 5DLFA 1WTWA 3MXNB 2VQFL 1KXLA 5K2MA 4HIKA 2R8GA 2B63A 2WTFA 1LABA 2D5DA 2KSWA 1Q12A 3BZDB 2JA7H 1RTNA 2R7ZG 1Z2NX 3A56A 5DM73 5EBCA 4F4ZA 3ORQA 5C44B 3C1FA 4A3DB 1UWVA 4LUVA 3HB9A 4YY3L 3A7LA 5C4XB 4CKEA 4RKLA 1RJQA 1FNUA 2NZOA 4NXNL 3KLRA 2MP1A 3RLFA 2FKLA 2HQEA 3D8GA 4LF7L 3HOVG 1PTOF 1VQEA 3PQIA 3I70A 2SOBA 2A73B 4RCNA 5J1ZA 1ZQ7A 4FU0A 4I50F 5F9LA 3CF5A 4QWBA 1OWTA 4IJHA 5D8DA 2BDOA 2NVXA 2ZTDA 4R8UA 2KBNA 5KFIA 2YV5A 3VMMA 5C3EH 1SN8A 3HG9A 3CCEA 4FF3A 4YY3Q 3NE5B 4MAMA 4GOPC 1F2YA 4JW0A 3T1HQ 3K5IA 4EQPA 5C4JB 4BBSG 3CC7A 4O4IF 2B2TA 1KEEA 5FLXL 4RNOA 1YEZA 3A5UA 1EEID 4KY7A 5HY6A 5M9OA 1I50H 2RKSA 1JMCA 4ME3A 3U9SA 2DIKA 2ZXRA 4K0KQ 3S17B 3GTGH 3G7LA 2Z8LA 2KVMA 3GTLH 4BY7H 4DFAA 1U9RA 2XVSA 3H0GG 3PO2G 5L1KA 4YAKB 1EWIA 1JICA 4JI1Q 3GV7B 3VPDA 3ND9A 4GOPB 4RGTA 2HCCA 1J5EQ 1H9KA 4B9XA 3H09A 1GJXA 1F2MA 2TMPA 4IPDA 5LMNQ 3HOWG 3K57A 3Q23A 2BA1A 4EYHB 1SCUB 2VW9A 1XJVA 4H7BA 1LACA 2FK3A 1Q46A 3HZXA 3HXLA 5KFZA 4Q8EA 2B2UC 1JKJB 1B9NA 1AE2A 3NWTA 4K2KA 3S15H 1CQIB 1LYLA 3OIPA 2NZ1D 5IWAQ 3T51B 1B7YB 1NUCA 1X9NA 4DR7Q 3Q24A 1F9RA 5JUMA 3AEVA 1NTGA 5IE8A 3HRZC 1I6VC 3D6CA 1NR2A 2L55A 3H0GH 2CQAA 4CDCC 2UVRA 2EXZA 5I4DA 5DNFA 3D6WA 5M3FB 2K33A 1B3AA 4A3KH 2EIFA 4BA1I 4LFAH 2UXCL 3WO1A 4YWKA 4LFCQ 2EYFA 2DN8A 4J9SA 1LUZA 1TWAB 3HOUB 3I4LA 4MA0A 2AHOB 2WFWA 3M85A 2WYOA 4G7OC 4BY1B 2O2LD 1HR0W 2MCTA 3R2TA 4YCWA 3MAQA 1EQTA 3GTGB 1RJRA 1QNUA 4IUPA 4B3TQ 1YNND 3MA2B 3SR1A 1E22A 2X69A 4A2AA 2XRQD 2ZM6L 5JEAJ 5LL6X 4PQXA 4C5AA 4B3SL 1Q8IA 2R92G 3GTPB 4AQYH 4K6DA 3K6OA 3BJUA 1GSHA 3MFIA 2KEEA 2CWAA 4MV7A 4RCOA 1B6RA 3TIIA 1I4HA 4AYBG 4CJ2C 1XMQQ 4R4CA 1PFMA 3RLOA 5KGUA 2CZGA 4JI4H 5EGTA 4K5XA 2QW7A 4IUVA 1CQFA 1CT1D 1S0OA 3DHQA 1XWEA 4L5SA 3VR5A 2UU9Q 4XT1B 1D7QA 2L9HA 1RCVD 5LMNH 2P0AA 4RB2C 3VYUA 3IFDA 1HZBA 3I90A 4DV0Q 1PH5A 3SE7A 4JI3H 2A1AA 2IHEA 3QOJA 3GV5B 2F0FA 3G6YA 4KK7A 4NKLA 3GQCA 4LF7H 1K8OA 1Y8OB 1PK8A 2R7DA 4X64H 2R6GA 1D5ZC 3Q2OA 5LMNW 4YAJB 1N32Q 4QWAA 2QF7A 4Q0YA 1Y1VB 1R4QB 4DR2H 1O7LA 1VAJA 1PLFA 4ED7A 1H9JA 2UUAH 2WV6D 1E4FT 2E8GA 4ZHQF 2Q2UA 4X6AH 4MV3A 5KG2A 4FBUA 2HDLA 2O4XA 3I55A 1T5XD 3OPOA 1LTTD 3TDQA 3G4SA 4IFDG 2RDIA 3UFXB 3N52A 3VR3A 3I12A 5J22A 2NWGA 3MR3A 2PMZE 4NXNQ 1J6QA 5E3FA 3G6XA 2J0TD 5E4WC 4TRDA 4LF7Q 4O4LF 2BR0A 2Y0SG 4JV5Q 2AQ4A 1ICFB 4KHVA 4FS2A 1HH2P 1TU2B 3T56B 4DKAC 3ICEA 2EPBA 1EIYB 3F1ZA 1IKLA 1I7LA 3PCOB 2UUBQ 5C1PA 4GKKQ 3R3OA 1HZCA 1JCKB 3NK9A 4YJ2F 4HSVA 1W6KA 4XYOA 1BXTA 3BQ1A 4KN4C 2F0WA 4HNUA 3H20A 2NVTH 3DF7A 2F0NA 1HHVA 2L0CA 4YWLA 3MWMA 2R84A 2A6HC 1A3TA 5KFHA 1M6VA 4OXPA 1MSGA 4R4TA 4X66L 1HA6A 4NW2A 4DAYA 3BG5A 4QMGA 1BR9A 1B9MA 2OT2A 3OTOH 1X6OA 3HOXB 4LF9L 1HA5A 1S0NA 2R7ZA 4LF4H 2K1BA 1K83H 4DL7A 3EYYA 3KF8A 2R61A 4O1NA 5ELNA 1AP0A 3U9OA 1GUOA 1M90C 5KFFA 3MHBA 1DD2A 1HFNA 4RNNA 3I3CA 1HNWH 1VQ6A 4LF6H 3K58A 1WI5A 4KMUC 1S5CD 1VQFA 4GNXA 2E5LH 3S1MB 1Q81C 4TV8F 2W8KA 3PW2A 1PV4A 2DY8A 1SNPA 1TXYA 2C2EA 1VQMA 4EGJA 2J4XA 1MZBA 2W6MA 1H9RA 2N55A 1MHWC 1FYCA 5CYUA 5KG3A 1Y1WA 4XXEA 2W9CA 4HJ9A 2E2HB 2C28A 3S14B 1O78A 4JBWA 1YVCA 1IBKL 2PPBC 2Z1CA 3BQ0A 3ULLA 2F0EA 3OUUA 1TAEA 3FEWX 4PZ8A 4OELB 2DNEA 2F0DA 2J6SA 3HOVB 3S2HB 4FBTA 4DUYL 1EWCA 1SMXA 2FJZA 1XX8A 4ZAIA 5LL6b 2WIIB 2HVRA 1ONLA 4BS9A 2B2TC 3MC0B 2V4DA 3PUYA 1V1QA 4J1MA 2QCPX 3NBIA 5C0XG 3JAML 2YTVA 1ET6A 2K5WA 3PO2H 2JA8G 1V51A 3S15B 4WRDA 4E4TA 1VQ7A 3I4MB 1P16A 3HBLA 2IX1A 2OCEA 5FO9B 2IBKA 1WR2A 4O0AA 2GVAA 3QB3A 4HJ7A 3ERSX 2VUMA 1XNQH 4BY7G 2BOSA 1EYZA 2IWHA 2Y0SA 1CQJB 1XTCD 3J80i 1PTOB 3NQIA 2BA0A 1Q8KA 1YHQA 5ELOA 5BR8L 1D2BA 3RFCA 4A3LG 3KHRA 2Z4IA 3ER0A 1L1OB 1OXSC 2AQ3B 2WAQE 4GKJQ 3OSNA 4DAMA 4DLKA 5BMVF 3I4NB 1I4QA 4FF4A 5E4XA 1EUJA 3KXYT 4YR3A 2I0QA 5JQWA 1GOZA 4B3TL 3GTLB 4ETSA 2Z0SA 1LTSD 1BCPD 2N3SA 1JE4A 2K52A 2K75A 3D3RA 3FRPB 2JEAI 2OTJA 2ZJPA 2WB1A 1QOHA 4IAJA 2B2YA 1Y1WH 4KD4A 5LMUQ 1Y14B 2MNAA 3K59A 3UDGA 1MJCA 3MWDA 4IURA 3D4WA 1Q90A 4IOAA 5A2QL 2AU0A 3NEMA 1Q82C 4P73A 4NXMH 5C4JH 2JA6A 2VXWA 2WAQA 4UFZA 1I94Q 1XTDA 1NY4A 2R3ZA 4DK6C 1Z6HA 3RNUA 3PZPA 2FMMA 3BABA 5GQOA 4U68A 1UC8A 2PQAA 4Y7NH 2B63H 5A2QE 1HTLD 3FHWA 3I4NH 3UI2A 1Y69U 4YWMA 1CZWA 5LMUL 3PIP3 3R5XA 3D0FA 5FLXW 3PW5A 4H02A 4B9WA 4DUZL 3M4OB 2UUCL 5IYZF 2YS7A 1KTKA 3HKZE 1OO9B 4F7XA 2PZTA 1A9XA 4LF6Q 1MIUA 3S16B 4HJ5A 4HMJA 2OXPA 1I94L 4A3CH 1X65A 3MTSA 1JOOA 1ASZA 1A3VA 1QJOA 5ELDA 1E4GT 3NBHA 2HHHL 2NU8B 2JA7B 1N9WA 3MXNA 3CCSA 4DV6Q 4JI2H 1VQBA 1T94A 5M5YH 4TV9F 4KLKA 4K0KH 3FKIH 4OWWB 1MGSA 3FP9A 4V0BA 1I4RA 2Q2IA 5F2DA 5GAGC 1WCMH 3KHLA 4DUZQ 4B3SQ 2IY5B 4AYBE 2I5MX 4QL5A 4BY7B 3KLSX 4DV7Q 3VA7A 2R92A 3GIPA 1EEFD 2X6GA 4LF4Q 4I7AA 4A3GB 1PZKD 4I4TF 4IPHA 1A8VA 1F9PA 4TQRA 3T1YL 1RYSA 3A8JE 2RDGA 2IA6A 4JYAH 4JI7L 4O2BF 4DU9A 3TQYA 4QCLA 5FD6A 2HHHQ 3KHGA 2UVWA 4DPGA 1V4YA 4R8UB 2XIGA 2HIVA 2F0OA 4HN7A 1HUNA 2WKDA 5D1PA 4MTEA 1XMOL 4JV5H 4QGUA 2NVXH 1JDEA 1HJPA 3K5NA 3RBEA 5DG9A 5IODA 4YR2A 2FPIB 1EY9A 1AW7A 1CKNB 1JOQA 2LXKA 4DK1A 1SFOH 2R93B 1AE3A 4DV7L 3NTIA 3V96A 3KLWA 4JI5H 4LWCA 2YU9A 2KHSA 3CMEA 5CV5A 4G7HC 2JQOA 2JA5G 4DV5Q 3KK7A 1G6PA 4JI8L 1N32L 2HGSA 5ELCA 3O13A 4YHHQ 2RBMA 4J0MA 4DR1H 1B04A 3AB9A 2GPSA 4FVMA 3J7AF 2NVQH 3AFQA 4JI8H 5KFNA 2B29A 3WDNA 4BBSH 5T14A 1U0LA 4JOIA 4GN5A 4LF8H 1MSHA 1M0WA 4PWQA 2W57A 1OXUA 1M8AA 1CHPD 1CHQD 3K5MA 4RB3C 4NP5A 1A15A 4A3JB 1D1KA 4GOPA 3BVGA 3MJFA 1KD1C 3HOZH 1ENFA 4ECXA 1BXRA 4JV5L 2I80A 3PUWA 4DV5L 1XMOH 1QZGA 2R8HA 1PMRA 5IYBG 1U4RA 3IG0A 5DLGA 5J2TF 3PN1A 1S9FA 1QVCA 2KQ3A 1GHJA 1N56A 3GV8B 4ZQ3A 2VQFQ 2K03A 4DV2Q 4WJ4A 4JYAL 3GIQA 2JA8B 2PI2E 3MWYW 1S4ZA 2JA5H 1K1SA 2FPPB 4IPCA 1VQNA 4XYLB 3GTQA 4CDEC 2NYZD 1YJWA 3QOLA 5DGBA 3CHBD 1E3PA 4R8NA 3IN5A 2DNCA 4TQSA 4IR9A 1VF5C 2BE5D 3A5ZB 5DG7A 1SROA 2F52A 1DONA 3RBDA 2M05A 1F77A 3LWUA 1IBLL 4EBDA 4JVZA 4YCVA 3JRXA 4LF9Q 1BNCA 1PH6A 3I4NG 1EUDB 4GC7A 2HHHH 3SGIA 4O4HF 1JJ2A 2UXDL 2B63B 3MXPA 2B2UA 1YBYA 4DK0A 4KD3A 3W2DA 1I94H 3OYYA 4U7CA 3TP5A 2F0MA 2OEOA 1B6SA 1TY2A 4A3FH 2YZMA 1IBMH 4X65Q 3FDTA 4R4OA 4GNXC 3RUZA 1BQQT 1TWAA 4LF8Q 2VUMG 4DUZH 2EZVA 1WOCA 4DR7H 2JEFA 2UVUA 1TS4A 3IL8A 3OHAA 1EQVA 4F4WA 1S5DD 4BA2I 2OTLA 3KBGA 5JPMC 3J7YW 2E74C 2I5HA 1PH1A 3PUZA 3KALA 3RAXA 5M3FH 2GN5A 4DR6Q 2VQEQ 5GAEC 3JAMW 3HKZB 1N36L 3FDSA 5LA6F 4IO9A 5KFCA 5LOVF 3FKIG 2IX0A 3J81L 4EFBA 1HXYD 2EY6A 1PYBA 3ZYYX 1N8RC 1RK5A 3VDYA 3UDXA 1KJQA 2XWBB 3HKZA 4Q5VA 3GQBA 1S5FD 1WD1A 3G6EA 5DQHA 3KYHC 1WJJA 5CBEE 2RCNA 3KAJA 4YR0A 3K7UC 1YHBA 2W6ZA 5I2YA 4LFCH 2JP1A 3K7AH 1VQAA 5EKKA 3LMLA 2B63G 5KIXA 4B3TH 1ILPA 1STNA 3EFXD 3HKSA 1EOVA 2E2IH 3DEPA 1JQYD 2KCMA 3J80L 2B2WA 3MZ5A 2F1MA 3VPBA 3EPGA 3U4VA 5CV4A 1B4OA 4K6LA 4XQQA 2FMAA 1E1TA 3RTXA 1C30A 3C1EA 4MTNA 3CU7A 5C4HA 1CQVA 5M5WB 1KLGD 5D65A 3BYYB 1H9SA 1LTAD 4OO1H 2WDTA 5DAUA 3Q8QB 1WCMG 1CM9A 1RJPA 4UCUA 1YI2A 1A2TA 1QG7A 3W3AA 1GUSA 1FVIA 4CKBA 4DN4M 4RB0A 1PFBA 3HOYB 3VYRA 4EBCA 5E1FA 1BNZA 1Y1WG 4B3MH 3V6HA 1ZYRC 4A3KG 3VR2A 2VQEH 1QVFA 4HNVA 4MV4A 1I6HH 4AH6A 2E2JB 3PW0A 2VS1A 1HR0H 1PX2A 3DMUA 4A3JG 2NU7B 4NMZA 5IP9H 4B3RH 3BZCA 4Y8VB 1B33N 1A3UA 4OONA 1J9OA 3RB4A 1RODA 5D1OB 3CRKC 3JAME 2F0VA 2EYLA 4HNTA 5M3FG 2W9BB 2VB3X 3CW2C 3T16A 5BN4A 1WSCA 3H94A 3HFZB 4ME5A 2R6FA 3OMGA 1LTGD 1TS3A 5CB4F 4ALPA 3GTKB 4RFBA 1QVGA 4DR1Q 3GP7A 4YHHH 3F8TA 1HNZQ 2VA3A 3N42B 1PH8A 3HOZB 2W9BA 3TIGA 2F4VH 4JI6L 1VBHA 1JC7A 3CCMA 3U58A 4LF6L 1FR3A 4GS3A 1B3QA 1HNWL 3GTKA 4DAYB 1WYDA 1ILQA 4C3IH 1PDQA 2KHJA 1I4PA 2H5XA 4LUOA 4X62H 5FJ8G 4PNYA 4HQ6A 4RUAA 5DGAA 1RF2D 4O2AF 4Y52H 5I9OA 3A54A 1KRSA 5C1OA 3HOXG 4Q43A 1K9MC 1DYQA 3OTOL 2VB2X 3EQLC 4MIUA 2R7ZH 5KT4A 3VA5A 3CCLA 1NJIC 4JPBW 4X66H 4OHJA 1M1KC 3NTHA 5C4ZA 4MV6A 2Y0SE 1V9PA 4L5RC 4GNXB 4ECTA 1NAPA 1TWFH 2MO1A 2TSSA 1HNWQ 1PRTD 4K2LA 3BS1A 5C44H 4A3DH 2NVTB 4QY7A 4K8JA 1Q86C 3J7AV 3V6KA 2RF4A 4BBSB 1OTCA 1KAAA 4IUTA 1IW7C 5BPFA 3TSSA 4GLVB 3X3NA 2W9CB 4JI6H 4JK1C 4BBRG 3MXUA 4DV2L 1PH3A 2F4VL 2AQ1B 1I3QH 4G4KA 3NPPA 3HOZG 4N8X1 2EY2A 4GKKH 3M4PA 1B53A 1UE1A 5EBDA 4ECYA 3FMAA 1Z9FA 2QK4A 2K5VA 3F8NA 3TS2A 2BQ3A 1TWFB 4KJNA 1DJRD 1SSOA 2XRSD 2EYMA 1E2VA 3RZOB 3MR6A 1O7YA 1HR0Q 2UUAL 1IBLQ 3F2CA 2QYZA 3T13A 2LSSA 4LFBL 2F0JA 4KKUA 5JEAH 3A0JA 4Z9CB 1S10A 4CGYB 4UCRA 5KFVA 1IL2A 1IBKQ 4KHPH 2ATLA 3KJOA 1YJ9A 1CTMA 1R4PB 5KFJA 2V4QA 5KNDA 4HJAA 1FGUA 3J7ZC 4O3SA 1QE6A 4FDBA 4POFA 1JIHA 4ED0A 4DUYQ 4P71A 4BY1H 2GVBA 4X66Q 2UU9H 1DCZA 1VQGA 2G9HD 4CJ0B 4XIGS 2PI2A 4PV1C 1EFID 5LMNL 3HOUH 2NU9B 2KENA 4RGNA 3AQQA 3AYHB 2L1BA 3OIQA 4IFDH 2RVLA 2WP8J 3X3MA 3G6VA 4OIJA 1E4EA 2WB1B 4FXGC 3EBEA 1B2TA 2EYHA 4XQJA 1KLUD 2IL8A 2VQDA 1FKAH 3E0JA 2W7OA 5EQ0A 1GVPA 2JN4A 4C1NI 1AZQA 3VR6A 2FP4B 3PMFA 4OGQC 4P72A 3H3VC 1HZ9A 5CAEB 3S16H 4QQBX 1EU4A 4J9OA 1YIJA 3M7NA 4B3SH 4BBRH 1O7IA 4XQNA 1SNOA 3I73A 4BWGB 3E0EA 4DR5H 3M4OH 1SYCA 4KN7C 3L0OA 4F88A 3NWSA 3D4DA 3OWEB 3JAMi 4HCEA 3E3XA 5BPHA 4DNTB 3QZ8A 1CKOA 2E2IB 4C1NK 3AMUA 3BZKA 5FO8B 2O5JC 1MD2D 4Y7NB 3R93A 2ZTCA 1BO0A 1XPOA 3I4MH 4PDBA 3UE1A 4A3EB 2N8NA 4DR4H 4A93G 5M3MH 3ITPA 1SNCA 2A69D 1X32A 1I6HB 4RZRA 4ECWA 2RDFA 1D1IA 2GLTA 3CQZA 5JPNC 2P5ZX 1S40A 1RYRA 4TKOB 4JI4Q 3VR4A 1YITA 1FNVA 1A2UA 4JI0H 4J9PA 4XDXA 2XD4A 5GAHC 1UNNC 1EQRA 1SE8A 5J39A 4OX9H 1N34L 2VR1A 4LF5H 3CQZB 4AQYQ 5K36G 1YJNA 2PO4A 4IFDI 4M7EA 2NU6B 2VUGA 3URYA 3CRLC 4CC5A 3PF4A 2JA6H 1JR0D 3F2UA 4QF4A 3J80E 5EPLA 3I2ZA 4A3IH 2VA2A 5ELFA 1N34H 3V2TA 1STEA 1K28A 4EG0A 1G8ZD 3TREA 2ZDGA 3CC4A 4RWSC 3KJPA 4ECZA 3W1GA 1KL9A 2FK2A 4X3SA 4IUUA 1HPCA 4IJLA 3PIO3 3GO5A 3RZDH 1HQRD 5CA1F 2ASJA 4S3SA 1LTID 4FYDA 1KC7A 4RAYA 2B2WC 3V4ZA 2XWJB 3TZUA 4HIMA 4DR4L 2UXCQ 4FM9A 2JEGA 1SRUA 2R7FA 1JJCB 1BBWA 1HUMA 3DWQA 3MVVA 4OWTB 4A76A 4M9UA 5KG5A 3RIZA 5KFSA 4DV5H 3G8CA 5C3EG 2HVQA 1NR4A 4X3UA 1E0BA 3K81C 3CAMA 2JA8H 2K6AA 3QWNA 1K1QA 4DAVA 4UHVA 5LHY1 5JEAG 1ML0D 3SK5A 1C7YA 3RB0A 1DV2A 2XNAC 4HIOA 2DJGC 5JJKA 1ESFA 5ISRA 2E5LQ 2JEJA 1NNXA 3Q8SB 1DGSA 3KHHA 1ZETA 2W6QA 3KUPA 5KKNB 2CFMA 5IOCA 2XGTA 1STAA 2Z6KC 4IRCA 4JI5Q 1EYDA 1G291 2WAQB 3WWVA 1STGA 2W6NA 1LTLA 3S17H 3UDIA 2HD3A 2YZNA 1GO3E 3G71A 3T5JA 1FJGH 4ZCKA 1GLVA 3MWEA 4IALA 3TZDA 1LLRD 5EDWA 4ZUIA 3L4JA 1BBXC 1JJGA 1QNKA 2UU9L 3TRZA 4IOCA 5C44G 4A3DG 2PBZA 1IBMQ 4JOIC 3SEBA 1TY0A 3TP8A 1SFOA 1Z2OX 3BDLA 4OWXB 4ED2A 1UE6A 2FK1A 1NMFA 2L5TA 1I7NA 3M4QA 3J81c 1KRTA 2MJ8A 2ES2A 2EVBA 2ZJQA 3J80W 2KCNA 2EQSA 2R7MA 4OO1G 1Z7TA 3ETHA 5C0XJ 4LFBH 4C56C 1KDBA 5C0XH 1S97A 1PRTF 4JUZA 3FKIA 3CVZA 4ZRZA 1TWGA 4IFDJ 2I07B 2R82A 2HDMA 3H4DA 3BQ2A 1HCZA 5EOYA 4IUQA 1SBBB 1UUPA 1I4GA 4DAPA 1ULZA 5C4XH 2ZTEA 1TWGB 3QJYA 2W6OA 3Q1KA 3J7AK 3BYTB 2QGQA 2R92B 1YZ6A 2YTYA 1EZ1A 4K14A 3PSIA 2SNSA 2IHFA 2N78A 1XYIA 1XNRL 1X3FA 5M5YB 1W93A 1JE5A 1ET9A 1X56A 3SHLA 4LSAA 1SYBA 3M4YA 4ZKBB 2E2JH 2UUCH 1RIPA 5CR3A 1SNDA 3NXWA 1VQDA 4HTHA 4L5QA 2I8CA 4IN3A 4DV4L 4MA5A 5KFPA 3CCRA 1O75A 3ORRA 4UP9A 1CKNA 4RGMA 5I47A 1ASYA 4DXGA 2VZAA 4ILWA 2R7NA 5E7NA 4J9MA 2B8FA 4GN4B 2RGRA 4A3IB 1PZJD 3QIAA 1PRTC 3HKZG 3K5LA 1VMPA 5IGBA 3GTKH 1N33H 2QDBA 1CSQA 2J9GA 1TWCH 1QUQA 3ND8A 2RHSB 2J6UA 1BBUA 3E5SA 1SR3A 3J7A5 3E9IA 3J81i 1SYGA 4LW1A 3Q22A 1LO5D 1JLLB 4A4IA 1WTHA 4TUYF 1DM0B 5M5WH 1EY6A 3CC2A 3FPUB 1PTOC 4N8FA 4DGZA 5AFWA 2FLNA 1JWUD 2DJFC 2X6LA 1H9MA 4LUZA 4ULLA 3S9WA 4A3CG 4P74A 3T1HL 2KHIA 1SE4A 4L63B 3LGJA 2DLNA 1CE8A 1T3NA 3STBD 4RA8A 1KBLA 3U50C 4NLGA 2LKVA 4LMQD 5EPKA 1OXVA 1G2TA 4L6TB 2Z9HA 5KT6A 3PW4A 3Q8PB 2AUJD 5KFXA 3OOCA 4NXMQ 3T53B 4B3RL 4Q8FA 5CC4A 4UP8A 3R8BA 2VPQA 4F4YA 2BQUA 2HUGA 2ATWA 2ASBA 5AJ3Q 4UP7A 1W96A 4FO2A 4B3ML 1KIXA 1WH2A 3GIMA 1JX4A 3ULPA 3A7AB 2EYOA 3E6ZX 1AZPA 5IYBH 4YCUA 5KFBA 1Y8PB 1RKNA 2F4IA 1E7ZA 3S2DH 3V05A 4OO1I 3RR5A 3BDOA 2V59A 2C2DA 3S1NH 1VQLA 2IP4A 1L0YB 4XZ3B 1AUXA 3GIDA 1EWHA 1LM0A 4H44C 2F0LA 4IWYA 2QILA 3HGBA 1SLJA 2FHTA 2K05A 1ZYRD 3AU7A 2E2HH 4BXXG 1YNXA 3MEFA 3BAAA 3NTKA 1GYFA 1LT5D 1GXDC 2NTTA 2RCFA 2K50A 5KFMA 3I91A 1IYVA 2W70A 3TS0A 1U4PA 1A0IA 3CCUA 1CFMA 3N44B 3EPIA 2OLSA 3GTJA 4ODGA 1GUWA 4O3RA 2G9DA 4K5VA 4DL4A 4IHJF 4R1JA 3PV0A 3R23A 3LNNA 3WO0A 1Y1VG 5CV8A 3GTPA 3OW2A 4PZ7A 2Q8TA 1SMYD 4ECSA 1GUGA 2K28A 2RSOA 3CMAA 2RQXA 4K5WA 2HCIA 1DIKA 1VQHA 4R7RA 4CC6A 1EUCB 1ZHQA 1HRJA 1DOMA 3TEHB 2IT1A 2CQYA 2FPGB 4LF9H 1ICWA 1DZ1A 4CBVA 2V58A 2C35B 2G5DA 2CVRA 3BA8A 5KG1A 3BVZA 2SNMA 3MR2A 1N36H 4JC0A 4LJZC 3H6MA 3M3YB 1TS2A 2OF1A 3TBIB 5IGEA 1CA6A 5EWGA 3GIJA 4JV1A 4C2MH 3A74A 1VQJA 3F2DA 2F3IA 2JE6I 1UAPA 5C3XA 1PZID 3RF2A 5KG7A 1XPRA 2JYOA 3L2PA 1XMOQ 3KBXA 4V190 1IBML 4ED3A 2ASLA 4BBRB 2ZM6Q 4DR4Q 4NDXA 1S0MA 2EOTA 4DA2A 2YRXA 1XNRH 3KAKA 1KNEA 1K3RA 2VY3A 2YTXA 2ZXPA 2A19A 2ALZA 5NUCA 2R8KA 2AQ2B 4MTDA 5H1SE 2NN6I 1AN8A 4APVA 3S14H 4XTCS 4JI8Q 1TWCB 1IBLH 5KFRA 2LXJA 1VQ8A 2DWCA 4GLAC 5IP9G 5GADC 2UUBL 1K83B 2WB1G 1JWSD 4RG1A 5IT9E 2D9UA 5C8YF 1G91A 4PG3A 1I50A 4RU9A 2ID0A 3TQTA 5EWFA 2MHVA 3VYSA 1EY4A 3V4SA 4JG2A 5FJ8H 4JI6Q 2AUKA 4HSPA 5GROA 2JA6G 3TP7A 1WTQA 1DOLA 2Z6KA 4R4IA 3H3VH 1C0AA 1EY7A 4NPSA 1B44D 3K5OA 2N49A 4X64L 1WTRA 2UUAQ 4C2MA 3C0FB 2V9WA 3EA6A 3TQ1A 2CH4A 1ZXTA 4L8JA 2A6ED 1TS5A 4LH6A 4KI0A 3BG3A 4EQOA 3OTOQ 3RZOH 1LT3D 1L0WA 2EY5A 2NZHA 4RAUC 4C2MB 1FJGL 1U4LA 1JB7A 5T1GA 3JRWA 5DEHA 3CCQA 3GTJH 2A68D 2C9OA 5IGFA 5M3MG 2VL6A 3DM3A 5IP7G 2O03A 1WTPA 4YB8B 4KY6A 2DPIA 2NVYA 2R8JA 1SYEA 3LP8A 4HYKA 1MBYA 1SXTA 1EFWA 3S24A 2L11A 5FLXc 2I46A 3P7JA 1EU3A 2CW0D 3SE0A 2YL2A 3BA9A 3OUZA 3GTPH 1BGWA 2CHBD 3KF6B 1K0SA 3G48A 2E2IA 1LV9A 2H1EA 3M9NB 5CMDA 1V8QA 2UXDQ 2O5IC 3GTOA 4EGQA 4ECQA 5ELBA 5D14A 1C3OA 2MPMA 3RZDB 2RSNA 3DM1A 3HOYH 3KF6A 3K5HA 3S1RH 1B1ZA 1Z47A 3OW7A 4KJOA 3HOWB 2XCLA 3QZ7A 3PVXA 4EEYA 1LTBD 5K36H 4A93B 5IT9L 2KECA 2QDLA 5KFDA 3I4OA 1WCMB 1XNRQ 4EFEA 1L0XB 4ABNA 3IFTA 1WD0A 3T1YH 3A55A 5I6WA 1VBGA 3SI8A 1HZAA 1K3BC 4LF5Q 4I7ZC 2UXCH 5IIFA 5IT9W 3NSWA 4B3RQ 1WCMA 1SE3A 2EXDA 4XYQA 2XTIA 3G6JB 1VQIA 2GA4B 1C4QA 4G57A 2MFIA 1TWFA 2XGQA 3RLNA 1F2LA 4PMCA 4YIJA 1KAWA 4KTAA 2ALYB 2OQKA 1VDZA 2DPJA 4DNRB 1WTVA 3L9AX 1LT6D 4UAIA 2VPSA 1XNQQ 1DOKA 2JEBI 4ZLTF 4FXKC 1X3QA 4A3EH 2PQEA 2V1CC 5K5PA 1B50A 5KFGA 5H80A 4LF5L 2PNHA 4OX9L 3ETJA 1W3SA 3K7AB 1F9QA 3Q8DA 1IL8A 2RGVA 2W8LA 1CSPA 1GD7A 2F0QA 3GDEA 5CBAE 3DUZA 3E5NA 4JI0L 3NP8A 2ZDHA 2XN9C 1UEBA 4LFAQ 2YW2A 4JI1L 3PIOA 5JJLA 5LMUH 1R9TA 4LF8L 1SMYC 4A3IG 4ZK9B 1J5EL 5GONF 3IRBA 2MUYA 2A5HA 1CI3M 2VUMB 4DNIA 4ED8A 2K01A 1EY5A 2LFNA 5FLMH 5I2XA 4MN3A 4O3OA 1N36Q 3GTMB 1A62A 4HAEA 1E4EB 2L12A 2CKZB 3PO2B 3FVQA 1JDBB 4NXML 4IWXA 2PN1A 1L1OA 3W5OA 1GKHA 3H91A 5BN3A 3IAYA 1GSOA 2K4KA 1XDNA 4ME6A 3GIKA 3CPFA 3MFGA 4LNQA 3WNZA 4EEQA 1PVOA 1HQMC 3GTLA 2ZT9C 4DR5L 3K0YA 5KG6A 1JXLA 2F0IA 3S2HH 5C5MA 5BR8Q 3J81W 2A6HD 4A3FB 2F0GA 2F0PA 3DEOA 3TP6A 2RHQB 1B70B 2ICEC 5FOBB 2JA7G 3S1MH 2FE3A 5C5JA 3MR5A 2B39A 1EYCA 1ZEQX 1RDPD 1S5ED 2MO0A 4CKCA 4A2BA 4IUNA 4ZYSA 3RD4A 1RD9D 3RB3A 1F2ZA 3MEHA 1PFSA 1X3GA 5KNCA 1JORA 3RGXA 3UE0A 1O7ZA 3OSPA 2EYJA 3P1HA 5IGDA 4G3IA 1U4MA 2QEXA 1T36A 2PQAB 1WVLA 5L1LA 4LMYA 3CXCA 4YJ3F 1Y8NB 3T5KA 5BN5A 2WKCA 4RHRA 3S1RB 2HQLA 4ZKCB 1EYAA 2N88A 3M9MB 3PUVA 2ASDA 2JK8A 1PA6A 1XXGA 5LL6S 2FFKB 3PR4A 2XCAA 1NMGA 2XCPA 4DL6A 1IXRA 4YY3H 4CHTB 1P8LA 2UXBQ 1LTRD 1KDAA 4KHPL 1A63A 4ED1A 1VQ5A 4TQUS 4C3HB 5JVH3 2D62A 1K0RA 3I72A 3BU2A 4DUYH 1D6EC 2DY7A 5A35A 5IT9c 3N6XA 2CCZA 3HOYG 3JSLA 4MV1A 4A3MH 4LK1C 1KABA 5L9XA 4HCSA 3OWFA 2VQFH 1QILA 2F0SA 4RH6A 4A3EG 4A3JH 2JA7A 2SEBD 2Q8IB 1IBKH 1RTOA 1L2ZA 3BJYA 1IYJB 2F3WA 4IRKA 3ZJYC 5EKLA 1BKBA 1HFGA 1CKMA 5HURA 1AFPA 1II3A 5DLQE 1XPUA 5KG0A 4GKKL 3K0XA 2K32A 4N9TA 1N33Q 4KHPQ 2NVXB 1FNWA 5KFAA 4IZ8A 4DV2H 1TVXA 3NELA 4CDFC 4F8MA 5KG4A 1HNZH 2E5LL 5C4XG 3M4IA 2XGPA 5LXTF 2M2LA 3A8IE 3JSNA 2BDNA 2B2VC 1AH9A 3RB6A 2AMCB 4C3IB 5C3WA 4B08A 3GD7A 4CDDC 1FL0A 3N40P 1GHKA 3BDCA 3N43B 1YNJD 4LF4L 1A6XA 3S1QB 1JWMD 2OQ0A 3PGZA 1SYFA 3TMEA 4L1KA 1KC8C 1SDFA 3K80C 2NTSA 2R8IA 4DF7A 2F0HA 5L1JA 1E1OA 4A3GG 3K3PA 4WD3A 4EQ5A 3RGZA 5C6AA 2YRWA 3J80c 4OL7A 2ZJRA 1SYXB 2V4RA 3ULJA 2PZUA 5EAYA 2A6EC 5KFUA 1CS0A 2K7VA 4HR7B 5DG8A 4DR3L 4X62L 3SXHA 4A75A 4JBJA 1S3OA 3LWEA 2R85A 2R86A 2F0TA 4QJFA 3GV3A 4UY8C 3CD6A 4KV6A 2NUAB 2F0UA 5KFTA 3JZIA 4RAZA 1DV1A 1K8MA 2A68C 2NVQB 4X64Q 2PW7A 5IYCH 2LY7A 4Q0FA 5CV7A 1F9SA 3PO3G 3GTQB 2XC9A 3BVMA 4QW8A 4C3HH 4YHHL 3T5HA 1BJTA 4WBNF 5DQGA 3H15A 1JT8A 1TWHA 2K5QA 4QIWB 2E2DC 4J8QA 3NENA 2EJGC 1UC9A 3MFHA 2QA4A 4DR3Q 1CK1A 1SFOB 2CW8A 4A3GH 1W6JA 5IP7H 3KDFA 1BCPB 5KNBA 4X65L 2YU9H 2X0SA 1SJED 4I55F 5KFEA 2UXBH 5KFLA 1K8AC 1TWHB 3DXJC 3JC66 2YS6A 4EYIB 1FGBD 4GZYC 1T9HA 2EJFC 2NUCA 1KJ8A 1M7JA 5KT7A 2CQOA 4KKSA 5JH7F 3D4RA 4DR2L 1MJEA 1BDOA 4U673 1HR0L 2DZDA 5A2QW 4U6PA 5EJWA 1VQOA 3FKIB 5G3LF 5KFYA 2VQEL 5KX5F 2NB0A 4KKTA 5CV6A 2QKIC 4A3KB 3N41B 1TKWB 3HEJA 2K5HA 3SDZA 4JI3L 2CWPA 4RZQA 3N6RA 4LAAA 4RGOS 5IWAL 4DR6H 3HS0C 4B3MQ 4F4XA 4R8IA 4R4QA 5J3BA 2EDGA 5JVLA 4A3LH 5L1IA 1EQQA 5KEEA 5JOBA 1PTOH 2Q8RE 4UDUC 4EGVA 4JI4L 3EVQA 1O80A 1X3PA 4DXFA 4WJWA 2AGPA 3C46A 1SAPA 5IGGA 4A3BB 4DL5A 1PH7A 1PFNA 3OHBA 2E75C 4QB4A 4AQYL 3N8DA 1TR5A 2SDFA 4E6IA 2VNUD 3S2DB 3J81E 4IPGA 4BXXH 4TSSA 2D0PA 4N9PA 2WACA 4NB3A 4LFCL 5KFWA 4A3FG 2ZM6H 4J9NA 4OEMB 3TN2A 3RN2A 4EVOA 4XYMB 2D0OA 5KYIA 3K8AA 3A8KE 4DR5Q 1TQOA 4F87A 1VQ4A 2AGQA 3P75A 1ENAA 3M9BA 5M3MB 2C00A 4GKJH 3WOFA 1VF7A 4I65A 1EIFA 1X54A 2NVYH 1G51A 1PXUA 2Q2TA 4UCSA 1S03G 5T1IA 2PZWA 4I7HA 5KT3A 1G6ZA 3LX0A 2K14A 1M4VA 1SNMA 2IJ0A 1QUQB 5TSSA 3S1NB 2HVSA 2K5DA 4OX9Q 3UDFA 1H9SB 2EE1A 1Q1BA 2C5CA 3I56A 4WJ3M 1J5EH 1TWAH 1PH4A
chains in the Genus database with same CATH topology
1E1TA 4LFAL 1MKHA 1LUZA 5AJ3L 3TS0A 4MTNA 1A0IA 3CCUA 4DR7L 2AHOB 2WFWA 3M85A 1XMQL 1HR0W 3GTMH 4YCWA 1WCMG 4R1JA 1YI2A 3PV0A 3W1BA 4B3TQ 1FVIA 1Y1VG 3OW2A 4PZ7A 1E22A 3E9HA 1Y1WG 4A3KG 1QVFA 1I6HH 4AH6A 2ZM6L 3CMAA 1VQHA 2VS1A 5JEAJ 5FLMG 3JAMc 4A3JG 4B3SL 2R92G 5IP9H 3TEHB 2IT1A 3BZCA 3F2BA 1EYGA 2C35B 2HT1A 4OONA 3BJUA 1K73C 2CWAA 4JC0A 4AYBG 1XMQQ 4R4CA 4MZ9A 4A3BH 1TWGH 3RLOA 5M3FG 3CW2C 4L5TA 3DLLA 3CCJA 4C2MH 3HFZB 4L5SA 1E24A 1VQJA 3A74A 3F2DA 1PH2A 2F3IA 2JE6I 2UU9Q 1D7QA 1XPRA 3L2PA 4ALPA 1XMOQ 1QVGA 1IBML 4DR1Q 3HOUG 2ZM6Q 4DR4Q 3F8TA 1HNZQ 1PH8A 1HZBA 1PH5A 1RL2A 4DV0Q 4KHZA 2A1AA 2IHEA 2UUCQ 4JI6L 1K3RA 2VY3A 2YTXA 3CCMA 2A19A 4BY1G 3U58A 4LF6L 1WFQA 3S1QH 1HNWL 1X55A 4GS3A 2R7DA 4DAYB 1WYDA 2AWNA 2R6GA 5H1SE 2NN6I 4DV3Q 4APVA 4C3IH 1PH9A 1CUKA 4XTCS 4JI8Q 5LMNW 4O2DA 3S14H 2KHJA 1N32Q 2LXJA 2H5XA 4LUOA 1VQ8A 5FJ8G 3PF5A 4GLAC 5IP9G 5GADC 2UUBL 2WB1G 4Y52H 4RG1A 4DV6L 1KRSA 3HOXG 1K9MC 2AWOA 3OTOL 4PG3A 1HNXQ 2ID0A 4AIMA 2E8GA 1VQ9A 2Q2UA 2R7ZH 4X6AH 4DR1L 3CCLA 1NJIC 4X62Q 3HOWH 3I55A 1M1KC 4JG2A 2Y0SE 3G4SA 1V9PA 5FJ8H 4IFDG 4JI6Q 2JA6G 5GROA 4L5RC 4GNXB 3CPWA 1KHIA 2PMZE 2Z6KA 1J6QA 4R4IA 4JI5L 1TWFH 2MO1A 4NXNQ 4NPSA 3H3VH 4LF7Q 1HNWQ 1C0AA 2Y0SG 5C44H 4A3DH 4JV5Q 4QY7A 2N49A 4X64L 1HH2P 4PMWA 1Q86C 4DKAC 3ICEA 2RF4A 1EIYB 2UUAQ 3F1ZA 1OTCA 4LFBQ 2BH8A 3PCOB 2UUBQ 4GLVB 4GKKQ 4KI0A 1HZCA 4BBRG 4DV2L 1PH3A 2F4VL 3OTOQ 3RZOH 1L0WA 1I3QH 4JI2Q 3HOZG 2NZHA 4GLXA 3M4PA 5M5XH 1UE1A 4DV4Q 1FJGL 1JB7A 2NVTH 2Q2HA 3CCQA 1Z9FA 3GTJH 3RN5A 4LF4L 2K5VA 5IP7G 5M3MG 2VL6A 2WAQG 3DM3A 3TS2A 4YWLA 4OXPA 4R4TA 4X66L 1EFWA 3S24A 5FLXc 1OXTA 3GTPH 1HR0Q 3KF6B 2UUAL 1IBLQ 3F2CA 4DK3C 2LSSA 2MQHA 3G48A 4LFBL 2B3GA 1X6OA 3A0JA 4PZ6A 4DV1Q 1NE3A 4LF9L 1V43A 2F4VQ 4K0KL 2UXDQ 1IL2A 1K83H 1IBKQ 4JI2L 5ELNA 3KJOA 4QIWE 1YJ9A 2JEAI 1H95A 3HOYH 3J81j 1M90C 4JI3Q 3KF6A 1BVSA 4HJAA 1FGUA 1VQ6A 3J7ZC 3S1RH 4FDBA 1WI5A 4POFA 1KQSA 1VQFA 4DUYQ 1Z47A 4GNXA 1Q81C 2JJQA 4P71A 4BY1H 2GVBA 1U5KA 4X66Q 1PV4A 1VQGA 4XIGS 2PI2A 1VQKA 1TXYA 3I4OA 5LMNL 1VQMA 3HOUH 3H3VI 2KENA 1XNRQ 3AQQA 3AYHB 3PO3H 1VCIA 2BH2A 4DV1L 1Y1VH 4HJ9A 2WP8J 1VQPA 1HZAA 2YYZA 4LF5Q 4JBWA 1YVCA 1IBKL 4JBMA 4POGA 3KOJA 3EBEA 4JYAQ 3ULLA 2R93H 4HJ8A 4B3RQ 4J15A 2EXDA 1GVPA 5IY0A 4PZ8A 2XTIA 4P72A 1VQIA 1HZ9A 2MFIA 3U4ZA 4DUYL 3S16H 1K8GA 4QQBX 1SMXA 1YIJA 3M7NA 3STBC 4BBRH 1O7IA 2OWOA 3RLNA 1KAWA 3E0EA 3M4OH 2ALYB 2OQKA 3L0OA 3PUYA 4GKJL 1V1QA 4RMFA 3JAMi 4DR2Q 2I5LX 5C0XG 2YTVA 1XNQQ 1CKOA 3CQZH 2JEBI 2JA8G 3PO2H 4A3EH 2V1CC 1VQ7A 1P16A 2HIXA 3M3YH 2IX1A 3BZKA 2OCEA 4LF5L 2PNHA 3EN2A 3KF8B 1GM5A 4OX9L 1I5FA 1PYSB 1W3SA 2ZTCA 3Q8DA 1L1OC 4O0AA 1XPOA 1CSPA 1GD7A 3GDEA 2GVAA 3PIPA 3I4MH 4HJ7A 3ERSX 3UE1A 4JI0L 4P75A 3CCVA 4BY7G 1UEBA 2N8NA 3CP0A 4A93G 4LFAQ 5M3MH 4JI1L 3PIOA 3J80i 5JJLA 4LF8L 3I7FA 2BA0A 1Q8KA 4A3IG 1YHQA 5ELOA 5BR8L 1J5EL 4A3LG 3IRBA 1PHJA 2WB1E 1C9OA 3PUXA 2WAQE 3ER0A 1L1OB 1OXSC 2FXQA 1S40A 4DNIA 4DAMA 4JI4Q 3EIVA 4GKJQ 1YITA 1XNQL 2AKWB 1EUJA 5FLMH 2I0QA 4DR6L 3D31A 4B3TL 3GTOH 2Z0SA 5GAHC 2N3SA 1N36Q 1EQRA 1A62A 1SE8A 2K52A 2K75A 1W2BA 4UPAA 1N34L 1IZ6A 2CKZB 2ZJPA 4JBKA 2OTJA 4AQYQ 4NXML 1Y1WH 5K36G 1YJNA 5LMUQ 1L1OA 3W5OA 1GKHA 4IFDI 3I4MG 5IYCG 1Y14B 2MNAA 3UDGA 1MJCA 4JI0Q 1NBWA 2K4KA 3KFUA 4IOAA 3CPFA 4LNQA 3PF4A 2KCTA 1VS0A 1S72A 2JA6H 1PVOA 3NEMA 1Q82C 4P73A 4DR5L 5C4JH 3S2HH 3I2ZA 5BR8Q 4A3IH 1I94Q 1XTDA 1NY4A 2RHQB 4DK6C 3TREA 1B70B 2JA7G 3CC4A 3S1MH 4A3BG 3KJPA 3RNUA 4A3MG 3W1GA 1KL9A 5GQOA 2PQAA 4Y7NH 2B63H 2UXBL 2MO0A 3FHWA 4IJLA 4JCVE 3I4NH 3GO5A 3RZDH 1N34Q 2VUMH 1PFSA 1X3GA 1YHAA 4YWMA 5LMUL 3UE0A 1QZHA 2JA9A 3D0FA 4HIMA 4DR4L 2UXCQ 4H02A 2DUDA 2QEXA 4DUZL 2PQAB 1SRUA 2R7FA 1JJCB 2UUCL 5HGQA 1BBWA 3HKZE 3CXCA 4LF6Q 1MIUA 4OWTB 4HJ5A 4A76A 1I94L 2HQLA 4A3CH 3HOVH 1X65A 3PUVA 2R93G 2JK8A 5C3EG 4DV3L 1PA6A 1ASZA 1OXXK 1NMGA 3K81C 3CAMA 2A8VA 2JA8H 1IXRA 5JEAG 2HHHL 1P8LA 1C7YA 2UXBQ 1N33L 1N9WA 3CCSA 4DV6Q 4HIOA 4KHPL 1A63A 5JJKA 3HOXH 2DGYA 1VQBA 4TQUS 1X3EA 1HNXL 5M5YH 1VQ5A 2D62A 4KLKA 1K0RA 3B6YA 3FKIH 3BU2A 2E5LQ 3GTQH 4OWWB 1VQCA 2L15A 5IT9c 2CCZA 3HOYG 3FP9A 4A3MH 1DGSA 2Q2IA 5GAGC 1WCMH 4DUZQ 4B3SQ 2IY5B 4A93H 4A3EG 4A3JH 4AYBE 2I5MX 2R92H 4QL5A 2CFMA 4DV7Q 2XGTA 2Z6KC 4TVAB 4JI5Q 1G291 1R9TH 3WWVA 5JJIA 5C0XI 4LF4Q 1IYJB 4GN3B 2K5NA 1Q7YC 3ZJYC 4IPHA 1A8VA 1BKBA 1LTLA 3S17H 3T1YL 3UDIA 1CKMA 4EX5A 1GO3E 3G71A 4JI7L 1B8AA 2NN6G 5IYDG 3TQYA 1L2FA 4C3JH 2HHHQ 5DLQE 1UE7A 1XPUA 4GKKL 3K0XA 1N33Q 4KHPQ 4MNOA 4DPGA 2UU9L 1JJGA 3TRZA 2HIVA 3NELA 4IOCA 5C44G 4A3DG 1XMOL 2E5LL 4QGUA 1IBMQ 2NVXH 1Q1EA 1HJPA 3L7ZC 5C4XG 1TWHH 1HNZL 1D8LA 4JOIC 1FJGQ 4DV0L 5IYDH 4OWXB 1CKNB 3AFPA 3KDFB 2LXKA 1AH9A 1SFOH 1UE5A 2AMCB 1UE6A 1AE3A 3GD7A 1NMFA 1FL0A 4DV7L 3KLWA 4LWCA 3M4QA 3J81c 1KRTA 3CMEA 4HIDA 2ES2A 2ZJQA 2JQOA 2OQ0A 4DV5Q 2JA5G 2EQSA 3PGZA 1G6PA 4OO1G 4JI8L 3T1YQ 5C0XJ 1KC8C 1N32L 3K80C 4JI7Q 4YHHQ 1E1OA 3NBHB 4A3GG 4EQ5A 4IFDJ 3MXNB 2VQFL 1KXLA 4HIKA 2NVQH 3J80c 2ZJRA 3AFQA 2B29A 3ULJA 5EAYA 4BBSH 1Q12A 2JA7H 2R7ZG 4DR3L 1U0LA 4JOIA 4GN5A 5C4XH 4X62L 4A75A 4JBJA 1S3OA 2ZTEA 1UWVA 1OXUA 4LUVA 4QJFA 4YY3L 4UY8C 2QGQA 3CD6A 2NZOA 4NXNL 3RLFA 4GOPA 1YZ6A 2YTYA 4LF7L 3HOVG 1KD1C 3HOZH 1VQEA 3PSIA 4JV5L 3PUWA 4DV5L 1QZGA 2IHFA 5IYBG 4X64Q 2N78A 5IYCH 1XNRL 1X3FA 3PO3G 1QVCA 1JE5A 1X56A 4C3HH 4YHHL 3CF5A 4IJHA 2E2JH 3H15A 2ZTDA 1RIPA 2VQFQ 4DV2Q 1JT8A 4WJ4A 2KBNA 1VQDA 4JYAL 4L5QA 2PI2E 2YV5A 2JA5H 3NENA 5C3EH 2QA4A 4IPCA 1SN8A 4DV4L 1VQNA 4DR3Q 1YJWA 3CCRA 4A3GH 5IP7H 4UP9A 1CKNA 3KDFA 1E3PA 4X65L 2YU9H 3CCEA 4YY3Q 1ASYA 2VZAA 1K8AC 3JC66 5E7NA 4GOPC 3A5ZB 1SROA 4GN4B 1T9HA 2F52A 3T1HQ 2CQOA 4BBSG 3CC7A 1YEZA 3HKZG 3A5UA 4DR2L 1MJEA 5HY6A 1HR0L 1IBLL 1I50H 1VQOA 3GTKH 4YCVA 1CSQA 1JMCA 2VQEL 4LF9Q 1PH6A 3I4NG 4ME3A 1TWCH 3SGIA 1JJ2A 4K0KQ 2UXDL 1QUQA 3GTGH 2RHSB 2K5HA 1YBYA 1BBUA 1SR3A 3J7A5 3E9IA 4JI3L 4LW1A 2CWPA 3J81i 3OYYA 3GTLH 4BY7H 4A4IA 3H0GG 3PO2G 5M5WH 4A3FH 1EWIA 4X65Q 3CC2A 4R4OA 4JI1Q 4GNXC 5IWAL 4LF8Q 4B3MQ 2VUMG 4R4QA 5J3BA 4GOPB 1WOCA 1J5EQ 4A3CG 4LUZA 4A3LH 4P74A 3T1HL 2KHIA 4BA2I 1EQQA 5LMNQ 2OTLA 4IPDA 3HOWG 4JI4L 2BA1A 3LGJA 2I5HA 2VW9A 1XJVA 3PUZA 3STBD 1PH1A 5M3FH 2GN5A 3U50C 4DR6Q 2VQEQ 1Q46A 5GAEC 1OXVA 1N36L 4IO9A 1PH7A 3FKIG 2IX0A 4AQYL 4NXMQ 2VNUD 4B3RL 1AE2A 4IPGA 1PYBA 4UP8A 1N8RC 4BXXH 2D0PA 3S15H 3VDYA 4NB3A 2ATWA 4LFCL 4A3FG 1LYLA 3UDXA 3RN2A 2ASBA 5AJ3Q 4UP7A 5IWAQ 2D0OA 4DR5Q 3K8AA 1B7YB 4B3ML 1KIXA 1VQ4A 1X9NA 3ULPA 3M9BA 4DR7Q 3AEVA 3G6EA 1NTGA 1WJJA 3KYHC 5IE8A 2RCNA 5IYBH 4YCUA 1EIFA 1X54A 1YHBA 1G51A 2NVYH 3K7UC 2Q2TA 1E7ZA 3S2DH 3H0GH 4OO1I 3K7AH 1VQAA 3RR5A 2B63G 2K14A 3S1NH 1VQLA 1QUQB 3HKSA 1EOVA 1LM0A 3UDFA 2E2IH 4OX9Q 2KCMA 1SLJA 4A3KH 2E2HH 2EIFA 1Q1BA 1YNXA 3U4VA 4BA1I 3MEFA 4BXXG 2UXCL 3I56A 4WJ3M 4YWKA 1TWAH 4LFCQ 1PH4A 2K50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1T A;  4LFA L;  1MKH A;  1LUZ A;  5AJ3 L;  3TS0 A;  4MTN A;  1A0I A;  3CCU A;  4DR7 L;  2AHO B;  2WFW A;  3M85 A;  1XMQ L;  1HR0 W;  3GTM H;  4YCW A;  1WCM G;  4R1J A;  1YI2 A;  3PV0 A;  3W1B A;  4B3T Q;  1FVI A;  1Y1V G;  3OW2 A;  4PZ7 A;  1E22 A;  3E9H A;  1Y1W G;  4A3K G;  1QVF A;  1I6H H;  4AH6 A;  2ZM6 L;  3CMA A;  1VQH A;  2VS1 A;  5JEA J;  5FLM G;  3JAM c;  4A3J G;  4B3S L;  2R92 G;  5IP9 H;  3TEH B;  2IT1 A;  3BZC A;  3F2B A;  1EYG A;  2C35 B;  2HT1 A;  4OON A;  3BJU A;  1K73 C;  2CWA A;  4JC0 A;  4AYB G;  1XMQ Q;  4R4C A;  4MZ9 A;  4A3B H;  1TWG H;  3RLO A;  5M3F G;  3CW2 C;  4L5T A;  3DLL A;  3CCJ A;  4C2M H;  3HFZ B;  4L5S A;  1E24 A;  1VQJ A;  3A74 A;  3F2D A;  1PH2 A;  2F3I A;  2JE6 I;  2UU9 Q;  1D7Q A;  1XPR A;  3L2P A;  4ALP A;  1XMO Q;  1QVG A;  1IBM L;  4DR1 Q;  3HOU G;  2ZM6 Q;  4DR4 Q;  3F8T A;  1HNZ Q;  1PH8 A;  1HZB A;  1PH5 A;  1RL2 A;  4DV0 Q;  4KHZ A;  2A1A A;  2IHE A;  2UUC Q;  4JI6 L;  1K3R A;  2VY3 A;  2YTX A;  3CCM A;  2A19 A;  4BY1 G;  3U58 A;  4LF6 L;  1WFQ A;  3S1Q H;  1HNW L;  1X55 A;  4GS3 A;  2R7D A;  4DAY B;  1WYD A;  2AWN A;  2R6G A;  5H1S E;  2NN6 I;  4DV3 Q;  4APV A;  4C3I H;  1PH9 A;  1CUK A;  4XTC S;  4JI8 Q;  5LMN W;  4O2D A;  3S14 H;  2KHJ A;  1N32 Q;  2LXJ A;  2H5X A;  4LUO A;  1VQ8 A;  5FJ8 G;  3PF5 A;  4GLA C;  5IP9 G;  5GAD C;  2UUB L;  2WB1 G;  4Y52 H;  4RG1 A;  4DV6 L;  1KRS A;  3HOX G;  1K9M C;  2AWO A;  3OTO L;  4PG3 A;  1HNX Q;  2ID0 A;  4AIM A;  2E8G A;  1VQ9 A;  2Q2U A;  2R7Z H;  4X6A H;  4DR1 L;  3CCL A;  1NJI C;  4X62 Q;  3HOW H;  3I55 A;  1M1K C;  4JG2 A;  2Y0S E;  3G4S A;  1V9P A;  5FJ8 H;  4IFD G;  4JI6 Q;  2JA6 G;  5GRO A;  4L5R C;  4GNX B;  3CPW A;  1KHI A;  2PMZ E;  2Z6K A;  1J6Q A;  4R4I A;  4JI5 L;  1TWF H;  2MO1 A;  4NXN Q;  4NPS A;  3H3V H;  4LF7 Q;  1HNW Q;  1C0A A;  2Y0S G;  5C44 H;  4A3D H;  4JV5 Q;  4QY7 A;  2N49 A;  4X64 L;  1HH2 P;  4PMW A;  1Q86 C;  4DKA C;  3ICE A;  2RF4 A;  1EIY B;  2UUA Q;  3F1Z A;  1OTC A;  4LFB Q;  2BH8 A;  3PCO B;  2UUB Q;  4GLV B;  4GKK Q;  4KI0 A;  1HZC A;  4BBR G;  4DV2 L;  1PH3 A;  2F4V L;  3OTO Q;  3RZO H;  1L0W A;  1I3Q H;  4JI2 Q;  3HOZ G;  2NZH A;  4GLX A;  3M4P A;  5M5X H;  1UE1 A;  4DV4 Q;  1FJG L;  1JB7 A;  2NVT H;  2Q2H A;  3CCQ A;  1Z9F A;  3GTJ H;  3RN5 A;  4LF4 L;  2K5V A;  5IP7 G;  5M3M G;  2VL6 A;  2WAQ G;  3DM3 A;  3TS2 A;  4YWL A;  4OXP A;  4R4T A;  4X66 L;  1EFW A;  3S24 A;  5FLX c;  1OXT A;  3GTP H;  1HR0 Q;  3KF6 B;  2UUA L;  1IBL Q;  3F2C A;  4DK3 C;  2LSS A;  2MQH A;  3G48 A;  4LFB L;  2B3G A;  1X6O A;  3A0J A;  4PZ6 A;  4DV1 Q;  1NE3 A;  4LF9 L;  1V43 A;  2F4V Q;  4K0K L;  2UXD Q;  1IL2 A;  1K83 H;  1IBK Q;  4JI2 L;  5ELN A;  3KJO A;  4QIW E;  1YJ9 A;  2JEA I;  1H95 A;  3HOY H;  3J81 j;  1M90 C;  4JI3 Q;  3KF6 A;  1BVS A;  4HJA A;  1FGU A;  1VQ6 A;  3J7Z C;  3S1R H;  4FDB A;  1WI5 A;  4POF A;  1KQS A;  1VQF A;  4DUY Q;  1Z47 A;  4GNX A;  1Q81 C;  2JJQ A;  4P71 A;  4BY1 H;  2GVB A;  1U5K A;  4X66 Q;  1PV4 A;  1VQG A;  4XIG S;  2PI2 A;  1VQK A;  1TXY A;  3I4O A;  5LMN L;  1VQM A;  3HOU H;  3H3V I;  2KEN A;  1XNR Q;  3AQQ A;  3AYH B;  3PO3 H;  1VCI A;  2BH2 A;  4DV1 L;  1Y1V H;  4HJ9 A;  2WP8 J;  1VQP A;  1HZA A;  2YYZ A;  4LF5 Q;  4JBW A;  1YVC A;  1IBK L;  4JBM A;  4POG A;  3KOJ A;  3EBE A;  4JYA Q;  3ULL A;  2R93 H;  4HJ8 A;  4B3R Q;  4J15 A;  2EXD A;  1GVP A;  5IY0 A;  4PZ8 A;  2XTI A;  4P72 A;  1VQI A;  1HZ9 A;  2MFI A;  3U4Z A;  4DUY L;  3S16 H;  1K8G A;  4QQB X;  1SMX A;  1YIJ A;  3M7N A;  3STB C;  4BBR H;  1O7I A;  2OWO A;  3RLN A;  1KAW A;  3E0E A;  3M4O H;  2ALY B;  2OQK A;  3L0O A;  3PUY A;  4GKJ L;  1V1Q A;  4RMF A;  3JAM i;  4DR2 Q;  2I5L X;  5C0X G;  2YTV A;  1XNQ Q;  1CKO A;  3CQZ H;  2JEB I;  2JA8 G;  3PO2 H;  4A3E H;  2V1C C;  1VQ7 A;  1P16 A;  2HIX A;  3M3Y H;  2IX1 A;  3BZK A;  2OCE A;  4LF5 L;  2PNH A;  3EN2 A;  3KF8 B;  1GM5 A;  4OX9 L;  1I5F A;  1PYS B;  1W3S A;  2ZTC A;  3Q8D A;  1L1O C;  4O0A A;  1XPO A;  1CSP A;  1GD7 A;  3GDE A;  2GVA A;  3PIP A;  3I4M H;  4HJ7 A;  3ERS X;  3UE1 A;  4JI0 L;  4P75 A;  3CCV A;  4BY7 G;  1UEB A;  2N8N A;  3CP0 A;  4A93 G;  4LFA Q;  5M3M H;  4JI1 L;  3PIO A;  3J80 i;  5JJL A;  4LF8 L;  3I7F A;  2BA0 A;  1Q8K A;  4A3I G;  1YHQ A;  5ELO A;  5BR8 L;  1J5E L;  4A3L G;  3IRB A;  1PHJ A;  2WB1 E;  1C9O A;  3PUX A;  2WAQ E;  3ER0 A;  1L1O B;  1OXS C;  2FXQ A;  1S40 A;  4DNI A;  4DAM A;  4JI4 Q;  3EIV A;  4GKJ Q;  1YIT A;  1XNQ L;  2AKW B;  1EUJ A;  5FLM H;  2I0Q A;  4DR6 L;  3D31 A;  4B3T L;  3GTO H;  2Z0S A;  5GAH C;  2N3S A;  1N36 Q;  1EQR A;  1A62 A;  1SE8 A;  2K52 A;  2K75 A;  1W2B A;  4UPA A;  1N34 L;  1IZ6 A;  2CKZ B;  2ZJP A;  4JBK A;  2OTJ A;  4AQY Q;  4NXM L;  1Y1W H;  5K36 G;  1YJN A;  5LMU Q;  1L1O A;  3W5O A;  1GKH A;  4IFD I;  3I4M G;  5IYC G;  1Y14 B;  2MNA A;  3UDG A;  1MJC A;  4JI0 Q;  1NBW A;  2K4K A;  3KFU A;  4IOA A;  3CPF A;  4LNQ A;  3PF4 A;  2KCT A;  1VS0 A;  1S72 A;  2JA6 H;  1PVO A;  3NEM A;  1Q82 C;  4P73 A;  4DR5 L;  5C4J H;  3S2H H;  3I2Z A;  5BR8 Q;  4A3I H;  1I94 Q;  1XTD A;  1NY4 A;  2RHQ B;  4DK6 C;  3TRE A;  1B70 B;  2JA7 G;  3CC4 A;  3S1M H;  4A3B G;  3KJP A;  3RNU A;  4A3M G;  3W1G A;  1KL9 A;  5GQO A;  2PQA A;  4Y7N H;  2B63 H;  2UXB L;  2MO0 A;  3FHW A;  4IJL A;  4JCV E;  3I4N H;  3GO5 A;  3RZD H;  1N34 Q;  2VUM H;  1PFS A;  1X3G A;  1YHA A;  4YWM A;  5LMU L;  3UE0 A;  1QZH A;  2JA9 A;  3D0F A;  4HIM A;  4DR4 L;  2UXC Q;  4H02 A;  2DUD A;  2QEX A;  4DUZ L;  2PQA B;  1SRU A;  2R7F A;  1JJC B;  2UUC L;  5HGQ A;  1BBW A;  3HKZ E;  3CXC A;  4LF6 Q;  1MIU A;  4OWT B;  4HJ5 A;  4A76 A;  1I94 L;  2HQL A;  4A3C H;  3HOV H;  1X65 A;  3PUV A;  2R93 G;  2JK8 A;  5C3E G;  4DV3 L;  1PA6 A;  1ASZ A;  1OXX K;  1NMG A;  3K81 C;  3CAM A;  2A8V A;  2JA8 H;  1IXR A;  5JEA G;  2HHH L;  1P8L A;  1C7Y A;  2UXB Q;  1N33 L;  1N9W A;  3CCS A;  4DV6 Q;  4HIO A;  4KHP L;  1A63 A;  5JJK A;  3HOX H;  2DGY A;  1VQB A;  4TQU S;  1X3E A;  1HNX L;  5M5Y H;  1VQ5 A;  2D62 A;  4KLK A;  1K0R A;  3B6Y A;  3FKI H;  3BU2 A;  2E5L Q;  3GTQ H;  4OWW B;  1VQC A;  2L15 A;  5IT9 c;  2CCZ A;  3HOY G;  3FP9 A;  4A3M H;  1DGS A;  2Q2I A;  5GAG C;  1WCM H;  4DUZ Q;  4B3S Q;  2IY5 B;  4A93 H;  4A3E G;  4A3J H;  4AYB E;  2I5M X;  2R92 H;  4QL5 A;  2CFM A;  4DV7 Q;  2XGT A;  2Z6K C;  4TVA B;  4JI5 Q;  1G29 1;  1R9T H;  3WWV A;  5JJI A;  5C0X I;  4LF4 Q;  1IYJ B;  4GN3 B;  2K5N A;  1Q7Y C;  3ZJY C;  4IPH A;  1A8V A;  1BKB A;  1LTL A;  3S17 H;  3T1Y L;  3UDI A;  1CKM A;  4EX5 A;  1GO3 E;  3G71 A;  4JI7 L;  1B8A A;  2NN6 G;  5IYD G;  3TQY A;  1L2F A;  4C3J H;  2HHH Q;  5DLQ E;  1UE7 A;  1XPU A;  4GKK L;  3K0X A;  1N33 Q;  4KHP Q;  4MNO A;  4DPG A;  2UU9 L;  1JJG A;  3TRZ A;  2HIV A;  3NEL A;  4IOC A;  5C44 G;  4A3D G;  1XMO L;  2E5L L;  4QGU A;  1IBM Q;  2NVX H;  1Q1E A;  1HJP A;  3L7Z C;  5C4X G;  1TWH H;  1HNZ L;  1D8L A;  4JOI C;  1FJG Q;  4DV0 L;  5IYD H;  4OWX B;  1CKN B;  3AFP A;  3KDF B;  2LXK A;  1AH9 A;  1SFO H;  1UE5 A;  2AMC B;  1UE6 A;  1AE3 A;  3GD7 A;  1NMF A;  1FL0 A;  4DV7 L;  3KLW A;  4LWC A;  3M4Q A;  3J81 c;  1KRT A;  3CME A;  4HID A;  2ES2 A;  2ZJQ A;  2JQO A;  2OQ0 A;  4DV5 Q;  2JA5 G;  2EQS A;  3PGZ A;  1G6P A;  4OO1 G;  4JI8 L;  3T1Y Q;  5C0X J;  1KC8 C;  1N32 L;  3K80 C;  4JI7 Q;  4YHH Q;  1E1O A;  3NBH B;  4A3G G;  4EQ5 A;  4IFD J;  3MXN B;  2VQF L;  1KXL A;  4HIK A;  2NVQ H;  3J80 c;  2ZJR A;  3AFQ A;  2B29 A;  3ULJ A;  5EAY A;  4BBS H;  1Q12 A;  2JA7 H;  2R7Z G;  4DR3 L;  1U0L A;  4JOI A;  4GN5 A;  5C4X H;  4X62 L;  4A75 A;  4JBJ A;  1S3O A;  2ZTE A;  1UWV A;  1OXU A;  4LUV A;  4QJF A;  4YY3 L;  4UY8 C;  2QGQ A;  3CD6 A;  2NZO A;  4NXN L;  3RLF A;  4GOP A;  1YZ6 A;  2YTY A;  4LF7 L;  3HOV G;  1KD1 C;  3HOZ H;  1VQE A;  3PSI A;  4JV5 L;  3PUW A;  4DV5 L;  1QZG A;  2IHF A;  5IYB G;  4X64 Q;  2N78 A;  5IYC H;  1XNR L;  1X3F A;  3PO3 G;  1QVC A;  1JE5 A;  1X56 A;  4C3H H;  4YHH L;  3CF5 A;  4IJH A;  2E2J H;  3H15 A;  2ZTD A;  1RIP A;  2VQF Q;  4DV2 Q;  1JT8 A;  4WJ4 A;  2KBN A;  1VQD A;  4JYA L;  4L5Q A;  2PI2 E;  2YV5 A;  2JA5 H;  3NEN A;  5C3E H;  2QA4 A;  4IPC A;  1SN8 A;  4DV4 L;  1VQN A;  4DR3 Q;  1YJW A;  3CCR A;  4A3G H;  5IP7 H;  4UP9 A;  1CKN A;  3KDF A;  1E3P A;  4X65 L;  2YU9 H;  3CCE A;  4YY3 Q;  1ASY A;  2VZA A;  1K8A C;  3JC6 6;  5E7N A;  4GOP C;  3A5Z B;  1SRO A;  4GN4 B;  1T9H A;  2F52 A;  3T1H Q;  2CQO A;  4BBS G;  3CC7 A;  1YEZ A;  3HKZ G;  3A5U A;  4DR2 L;  1MJE A;  5HY6 A;  1HR0 L;  1IBL L;  1I50 H;  1VQO A;  3GTK H;  4YCV A;  1CSQ A;  1JMC A;  2VQE L;  4LF9 Q;  1PH6 A;  3I4N G;  4ME3 A;  1TWC H;  3SGI A;  1JJ2 A;  4K0K Q;  2UXD L;  1QUQ A;  3GTG H;  2RHS B;  2K5H A;  1YBY A;  1BBU A;  1SR3 A;  3J7A 5;  3E9I A;  4JI3 L;  4LW1 A;  2CWP A;  3J81 i;  3OYY A;  3GTL H;  4BY7 H;  4A4I A;  3H0G G;  3PO2 G;  5M5W H;  4A3F H;  1EWI A;  4X65 Q;  3CC2 A;  4R4O A;  4JI1 Q;  4GNX C;  5IWA L;  4LF8 Q;  4B3M Q;  2VUM G;  4R4Q A;  5J3B A;  4GOP B;  1WOC A;  1J5E Q;  4A3C G;  4LUZ A;  4A3L H;  4P74 A;  3T1H L;  2KHI A;  4BA2 I;  1EQQ A;  5LMN Q;  2OTL A;  4IPD A;  3HOW G;  4JI4 L;  2BA1 A;  3LGJ A;  2I5H A;  2VW9 A;  1XJV A;  3PUZ A;  3STB D;  1PH1 A;  5M3F H;  2GN5 A;  3U50 C;  4DR6 Q;  2VQE Q;  1Q46 A;  5GAE C;  1OXV A;  1N36 L;  4IO9 A;  1PH7 A;  3FKI G;  2IX0 A;  4AQY L;  4NXM Q;  2VNU D;  4B3R L;  1AE2 A;  4IPG A;  1PYB A;  4UP8 A;  1N8R C;  4BXX H;  2D0P A;  3S15 H;  3VDY A;  4NB3 A;  2ATW A;  4LFC L;  4A3F G;  1LYL A;  3UDX A;  3RN2 A;  2ASB A;  5AJ3 Q;  4UP7 A;  5IWA Q;  2D0O A;  4DR5 Q;  3K8A A;  1B7Y B;  4B3M L;  1KIX A;  1VQ4 A;  1X9N A;  3ULP A;  3M9B A;  4DR7 Q;  3AEV A;  3G6E A;  1NTG A;  1WJJ A;  3KYH C;  5IE8 A;  2RCN A;  5IYB H;  4YCU A;  1EIF A;  1X54 A;  1YHB A;  1G51 A;  2NVY H;  3K7U C;  2Q2T A;  1E7Z A;  3S2D H;  3H0G H;  4OO1 I;  3K7A H;  1VQA A;  3RR5 A;  2B63 G;  2K14 A;  3S1N H;  1VQL A;  1QUQ B;  3HKS A;  1EOV A;  1LM0 A;  3UDF A;  2E2I H;  4OX9 Q;  2KCM A;  1SLJ A;  4A3K H;  2E2H H;  2EIF A;  1Q1B A;  1YNX A;  3U4V A;  4BA1 I;  3MEF A;  4BXX G;  2UXC L;  3I56 A;  4WJ3 M;  4YWK A;  1TWA H;  4LFC Q;  1PH4 A;  2K50 A; 
#chains in the Genus database with same CATH topology
 4LFA L;  1MKH A;  4HED A;  4JI1 H;  4FP5 D;  5AJ3 L;  4DV1 H;  1IW7 D;  2LMC B;  4KY5 A;  2PYK A;  5KT2 A;  4DR7 L;  4ECU A;  2KED A;  3HP3 A;  3IKJ A;  4M1U B;  4C5C A;  2E76 C;  1XMQ L;  3QG1 A;  2JSO A;  1T5E A;  2KA7 A;  1G2S A;  3GTM H;  2GPW A;  4RNM A;  2FLL A;  1GGO A;  1TWC A;  3W1B A;  2BQR A;  1NSN S;  2SCU B;  2R7K A;  1S5B D;  1QWY A;  4CJ1 B;  1D5M C;  2YZG A;  4J9Q A;  2UXD H;  1I50 B;  2A69 C;  1BUV T;  1FD7 D;  3E9H A;  4ECV A;  1RK6 A;  3C2P A;  2PVP A;  2YCH A;  5FLM G;  3JAM c;  5ELE A;  2L4N A;  5EPJ A;  1ZHS A;  3F2B A;  2IW3 A;  1EYG A;  3ERQ A;  2HT1 A;  3SVM A;  1KNA A;  3I8Z A;  4X3T A;  1K73 C;  4J9L A;  3EJI A;  1STH A;  4MHE A;  4UCV A;  5COY A;  4J9K A;  2EY1 A;  4MZ9 A;  1TWG H;  4A3B H;  1GSA A;  4YBZ B;  4L5T A;  3DLL A;  1E2Z A;  3CCJ A;  5D3I B;  2PMZ B;  2PCF B;  1E24 A;  2HJW A;  1PH2 A;  2ZJT A;  1STY A;  1J8I A;  4HMI A;  3RV3 A;  1AEX A;  5D1O A;  3HOU G;  5FPR A;  1I6U A;  1DXM A;  3GII A;  2F3V A;  3PW7 A;  1RL2 A;  3MFY A;  4KHZ A;  2UUC Q;  2PMZ A;  4BY1 G;  3ONA B;  1WFQ A;  3S1Q H;  1X55 A;  3GTJ B;  1SEB D;  2AWN A;  1IOV A;  4C5B A;  4DV3 Q;  1PH9 A;  2R93 H;  5DM6 3;  1CUK A;  5EZY F;  2K04 A;  4O2D A;  4RB1 A;  3GTG A;  1I3Q B;  3OMC A;  3PF5 A;  5LYJ F;  4DL3 A;  4RUC A;  1HTP A;  2FMC A;  4DV6 L;  2R7Z B;  4FF2 A;  4P2C B;  1SYD A;  2AWO A;  1HNX Q;  2F03 A;  3QR8 A;  1YNN C;  2PW5 A;  4AIM A;  4H13 C;  1VQ9 A;  3GV6 A;  4O3P A;  4JV2 A;  4DR1 L;  3NQT A;  3HOW H;  4X62 Q;  4C3J B;  5IGC A;  4ZI7 F;  1AN7 A;  1I3Q A;  1N32 H;  3TIN A;  1KJJ A;  4DV6 H;  1VMC A;  2I87 A;  1UEA B;  1JB3 A;  3CPW A;  1KHI A;  5HBR B;  5FO7 B;  1TT2 A;  4QWE A;  2LS0 1;  4JI5 L;  1IYU A;  1IHZ A;  4DV7 H;  3GIL A;  2J6T A;  4OIK A;  4XX0 B;  4PMW A;  5L37 A;  3RMH A;  4C3H G;  4LFB Q;  1C8C A;  2FIN B;  1TA8 A;  2BH8 A;  4JV0 A;  5CA0 F;  4A3M B;  2F0K A;  3R5F A;  3FPP A;  3RUP A;  4IZO A;  1CZG A;  4NXN H;  3GLK A;  4JI2 Q;  4GLX A;  5M5X H;  4DV4 Q;  3QO2 A;  3ERO A;  4JI7 H;  1EHI A;  2Q2H A;  4O3N A;  1PTO D;  4EBE A;  3FMC A;  3RN5 A;  2JEI A;  2WAQ G;  2UVV A;  5KFQ A;  1EIG A;  4XT3 B;  5HGT A;  1OXT A;  2CW7 A;  1C48 A;  5FPO A;  1NCV A;  5COR A;  2JXM B;  1Y1V A;  4RHS A;  5HV6 A;  4AYB B;  2MQH A;  4DK3 C;  4MV9 A;  1GUN A;  2B3G A;  4PZ6 A;  2YYA A;  4DV1 Q;  1NE3 A;  1K83 A;  2UUB H;  1SEI A;  1V43 A;  2F4V Q;  4K0K L;  2V5A A;  2D2C C;  2M9V A;  1UNS A;  4FS1 A;  1BOS A;  4JI2 L;  4J9R A;  1EIH A;  1H95 A;  4QIW E;  1PRT B;  3J81 j;  4C3I G;  4JI3 Q;  4DV0 H;  1BVS A;  2W7P A;  4AYB A;  4O42 A;  1I4X A;  2KJX A;  3R2I A;  4X3K A;  1KQS A;  1ZKO A;  2Y0S B;  4ZQI A;  5J2U F;  2C2R A;  1R9T B;  2W71 A;  4QUF A;  2B8G A;  2JJQ A;  1U5K A;  2M00 A;  1RHP A;  4BWS C;  4J6H A;  3UQ8 A;  1VQK A;  3RV4 A;  1XMQ H;  2CW0 C;  5DQI A;  3LWB A;  3DWA A;  3H3V I;  1YNJ C;  4PMB A;  3PO3 H;  1EY0 A;  1VCI A;  2BH2 A;  4DV1 L;  2ENB A;  1Y1V H;  4ZUJ A;  3V6J A;  2PNR C;  1VQP A;  3GTM A;  2YYZ A;  4POG A;  4JBM A;  4JYA Q;  3KOJ A;  5G3L D;  4HJ8 A;  1EY8 A;  3L4K A;  4J15 A;  1IKM A;  3P20 A;  5IY0 A;  5C5L A;  4QW9 A;  4UCO A;  1BCP C;  5FD5 A;  4ECR A;  3U4Z A;  1K8G A;  2NVY B;  5FK9 C;  3Q6S A;  3STB C;  2FB9 A;  2BE5 C;  2OWO A;  2WE6 A;  2JA6 B;  1HNX H;  4H0L C;  1LT4 D;  1PYW D;  4ID6 A;  4GKJ L;  3L3O C;  4RMF A;  4DR2 Q;  2I5L X;  1M0T A;  2KCC A;  2ZXO A;  3CQZ H;  4DV3 H;  1STB A;  2HIX A;  3M3Y H;  3GTO B;  1GUT A;  1BF4 A;  3EN2 A;  3KF8 B;  3KLS A;  1GM5 A;  1I5F A;  1PYS B;  1L1O C;  1QCB D;  5I6Y A;  3H40 A;  3PIP A;  2ICI A;  5JVG 3;  4P75 A;  3NUC A;  3CCV A;  1Z2P X;  3T5L A;  1ENC A;  3CP0 A;  3T4A C;  3C3L A;  2J7Z A;  3SK6 A;  2R87 A;  1WTX A;  2ZDQ A;  3I7F A;  4IRD A;  2C22 A;  4LH7 A;  5BR8 H;  3U9T A;  1SE2 A;  1D5X C;  1PHJ A;  1EOT A;  2WB1 E;  1C9O A;  3PUX A;  5KT5 A;  2FXQ A;  1TII D;  3EIV A;  2RDJ A;  2Z6B A;  1XNQ L;  4QUC A;  4F50 A;  2AKW B;  5FLX E;  4WOR A;  1Y1W B;  4DR6 L;  5IWA H;  3D31 A;  3GTO H;  1V1P B;  3PR5 B;  2E2H A;  3VYT A;  1W2B A;  4Q44 A;  4UPA A;  4JBK A;  1IZ6 A;  2R7L A;  1N48 A;  2IMW P;  2QEJ C;  3OSO A;  5CGK A;  2FLP A;  3M7G A;  3H0G B;  3I4M G;  2XIW A;  5IYC G;  1WTO A;  1BCP F;  2W6P A;  4JI0 Q;  3KFU A;  1NBW A;  2A74 C;  2H4O A;  5FKA C;  1VS0 A;  2KCT A;  1S72 A;  3RJ0 A;  5KFK A;  1V1P A;  2MGS A;  5F9N A;  4ZOL F;  4WFN 3;  3H0G A;  4FNF A;  1KDC A;  1SNQ A;  4A3B G;  4A3M G;  3WOE A;  3OHX C;  4X65 H;  2UXB L;  4O3Q A;  4JCV E;  3R5H A;  3SK4 A;  1N34 Q;  2VUM H;  1YHA A;  2KOL A;  3KTM A;  2Z4H A;  2RDH A;  2B2Y C;  3MXG A;  4LSX A;  3T1H H;  1QZH A;  2JA9 A;  4M8A A;  3K3V A;  4FF1 A;  2DUD A;  1QB5 D;  3QFF A;  5KFO A;  4C3J G;  5HGQ A;  3H4B A;  4FXD A;  2R93 A;  1RJT A;  2IPK D;  2YU9 B;  4YP3 A;  2KUM A;  2NBF A;  2VOB A;  3HOV H;  4QWD A;  3Q8R B;  2R93 G;  4DV3 L;  3NGD A;  4RKB A;  3M9O B;  1OXX K;  5JAV A;  4MTK A;  3Q0A A;  2JA5 B;  2A8V A;  3VPC A;  5EWE A;  4UCT A;  2WIN B;  1N33 L;  1E2W A;  4G7Z C;  3HOX H;  2DGY A;  1HNX L;  1X3E A;  4DR3 H;  3B6Y A;  3GTQ H;  2W9A A;  4Q45 A;  4GC6 A;  3DWP A;  1VQC A;  2L15 A;  4MV8 A;  1MI2 A;  4HR7 A;  2JA5 A;  4IQZ A;  4A93 H;  2R92 H;  1ESR A;  2B2V A;  4DL2 A;  4YQW A;  1AUV A;  2CH4 W;  4TVA B;  1EZ6 A;  4K8I A;  1R9T H;  5JJI A;  4DV4 H;  5C0X I;  1Q7Y C;  4GN3 B;  2K5N A;  2IX3 A;  1IOW A;  4IR1 A;  1KJI A;  5I9P A;  4ED6 A;  4EX5 A;  5LP6 F;  1SJH D;  1B8A A;  2NN6 G;  4R9W A;  5IYD G;  5EKI A;  1EZ8 A;  1L2F A;  4C3J H;  5JJZ A;  3RAQ A;  1UE7 A;  3PO3 B;  2AGO A;  1Q3L A;  2XSC A;  4MNO A;  2OH2 A;  4APM A;  5JVD F;  5KYL A;  1VKZ A;  4QIW A;  1KJ9 A;  5CV9 A;  3NHH A;  1Q1E A;  3L7Z C;  1TWH H;  2EJM A;  1D8L A;  2RA4 A;  1HNZ L;  1JOK A;  1FJG Q;  4DV0 L;  2NN6 H;  5IYD H;  3KDF B;  3AFP A;  1V1O A;  2BCO A;  3SK8 A;  1UE5 A;  5KRU A;  4QWC A;  5C3E B;  1CA5 A;  1EL0 A;  4HID A;  2FJ2 A;  1S68 A;  3CKI B;  3T1Y Q;  4EQN A;  5M5X B;  4JI7 Q;  2EYP A;  5D3D A;  3NBH B;  5DLF A;  1WTW A;  3MXN B;  2VQF L;  1KXL A;  5K2M A;  4HIK A;  2R8G A;  2B63 A;  2WTF A;  1LAB A;  2D5D A;  2KSW A;  1Q12 A;  3BZD B;  2JA7 H;  1RTN A;  2R7Z G;  1Z2N X;  3A56 A;  5DM7 3;  5EBC A;  4F4Z A;  3ORQ A;  5C44 B;  3C1F A;  4A3D B;  1UWV A;  4LUV A;  3HB9 A;  4YY3 L;  3A7L A;  5C4X B;  4CKE A;  4RKL A;  1RJQ A;  1FNU A;  2NZO A;  4NXN L;  3KLR A;  2MP1 A;  3RLF A;  2FKL A;  2HQE A;  3D8G A;  4LF7 L;  3HOV G;  1PTO F;  1VQE A;  3PQI A;  3I70 A;  2SOB A;  2A73 B;  4RCN A;  5J1Z A;  1ZQ7 A;  4FU0 A;  4I50 F;  5F9L A;  3CF5 A;  4QWB A;  1OWT A;  4IJH A;  5D8D A;  2BDO A;  2NVX A;  2ZTD A;  4R8U A;  2KBN A;  5KFI A;  2YV5 A;  3VMM A;  5C3E H;  1SN8 A;  3HG9 A;  3CCE A;  4FF3 A;  4YY3 Q;  3NE5 B;  4MAM A;  4GOP C;  1F2Y A;  4JW0 A;  3T1H Q;  3K5I A;  4EQP A;  5C4J B;  4BBS G;  3CC7 A;  4O4I F;  2B2T A;  1KEE A;  5FLX L;  4RNO A;  1YEZ A;  3A5U A;  1EEI D;  4KY7 A;  5HY6 A;  5M9O A;  1I50 H;  2RKS A;  1JMC A;  4ME3 A;  3U9S A;  2DIK A;  2ZXR A;  4K0K Q;  3S17 B;  3GTG H;  3G7L A;  2Z8L A;  2KVM A;  3GTL H;  4BY7 H;  4DFA A;  1U9R A;  2XVS A;  3H0G G;  3PO2 G;  5L1K A;  4YAK B;  1EWI A;  1JIC A;  4JI1 Q;  3GV7 B;  3VPD A;  3ND9 A;  4GOP B;  4RGT A;  2HCC A;  1J5E Q;  1H9K A;  4B9X A;  3H09 A;  1GJX A;  1F2M A;  2TMP A;  4IPD A;  5LMN Q;  3HOW G;  3K57 A;  3Q23 A;  2BA1 A;  4EYH B;  1SCU B;  2VW9 A;  1XJV A;  4H7B A;  1LAC A;  2FK3 A;  1Q46 A;  3HZX A;  3HXL A;  5KFZ A;  4Q8E A;  2B2U C;  1JKJ B;  1B9N A;  1AE2 A;  3NWT A;  4K2K A;  3S15 H;  1CQI B;  1LYL A;  3OIP A;  2NZ1 D;  5IWA Q;  3T51 B;  1B7Y B;  1NUC A;  1X9N A;  4DR7 Q;  3Q24 A;  1F9R A;  5JUM A;  3AEV A;  1NTG A;  5IE8 A;  3HRZ C;  1I6V C;  3D6C A;  1NR2 A;  2L55 A;  3H0G H;  2CQA A;  4CDC C;  2UVR A;  2EXZ A;  5I4D A;  5DNF A;  3D6W A;  5M3F B;  2K33 A;  1B3A A;  4A3K H;  2EIF A;  4BA1 I;  4LFA H;  2UXC L;  3WO1 A;  4YWK A;  4LFC Q;  2EYF A;  2DN8 A;  4J9S A;  1LUZ A;  1TWA B;  3HOU B;  3I4L A;  4MA0 A;  2AHO B;  2WFW A;  3M85 A;  2WYO A;  4G7O C;  4BY1 B;  2O2L D;  1HR0 W;  2MCT A;  3R2T A;  4YCW A;  3MAQ A;  1EQT A;  3GTG B;  1RJR A;  1QNU A;  4IUP A;  4B3T Q;  1YNN D;  3MA2 B;  3SR1 A;  1E22 A;  2X69 A;  4A2A A;  2XRQ D;  2ZM6 L;  5JEA J;  5LL6 X;  4PQX A;  4C5A A;  4B3S L;  1Q8I A;  2R92 G;  3GTP B;  4AQY H;  4K6D A;  3K6O A;  3BJU A;  1GSH A;  3MFI A;  2KEE A;  2CWA A;  4MV7 A;  4RCO A;  1B6R A;  3TII A;  1I4H A;  4AYB G;  4CJ2 C;  1XMQ Q;  4R4C A;  1PFM A;  3RLO A;  5KGU A;  2CZG A;  4JI4 H;  5EGT A;  4K5X A;  2QW7 A;  4IUV A;  1CQF A;  1CT1 D;  1S0O A;  3DHQ A;  1XWE A;  4L5S A;  3VR5 A;  2UU9 Q;  4XT1 B;  1D7Q A;  2L9H A;  1RCV D;  5LMN H;  2P0A A;  4RB2 C;  3VYU A;  3IFD A;  1HZB A;  3I90 A;  4DV0 Q;  1PH5 A;  3SE7 A;  4JI3 H;  2A1A A;  2IHE A;  3QOJ A;  3GV5 B;  2F0F A;  3G6Y A;  4KK7 A;  4NKL A;  3GQC A;  4LF7 H;  1K8O A;  1Y8O B;  1PK8 A;  2R7D A;  4X64 H;  2R6G A;  1D5Z C;  3Q2O A;  5LMN W;  4YAJ B;  1N32 Q;  4QWA A;  2QF7 A;  4Q0Y A;  1Y1V B;  1R4Q B;  4DR2 H;  1O7L A;  1VAJ A;  1PLF A;  4ED7 A;  1H9J A;  2UUA H;  2WV6 D;  1E4F T;  2E8G A;  4ZHQ F;  2Q2U A;  4X6A H;  4MV3 A;  5KG2 A;  4FBU A;  2HDL A;  2O4X A;  3I55 A;  1T5X D;  3OPO A;  1LTT D;  3TDQ A;  3G4S A;  4IFD G;  2RDI A;  3UFX B;  3N52 A;  3VR3 A;  3I12 A;  5J22 A;  2NWG A;  3MR3 A;  2PMZ E;  4NXN Q;  1J6Q A;  5E3F A;  3G6X A;  2J0T D;  5E4W C;  4TRD A;  4LF7 Q;  4O4L F;  2BR0 A;  2Y0S G;  4JV5 Q;  2AQ4 A;  1ICF B;  4KHV A;  4FS2 A;  1HH2 P;  1TU2 B;  3T56 B;  4DKA C;  3ICE A;  2EPB A;  1EIY B;  3F1Z A;  1IKL A;  1I7L A;  3PCO B;  2UUB Q;  5C1P A;  4GKK Q;  3R3O A;  1HZC A;  1JCK B;  3NK9 A;  4YJ2 F;  4HSV A;  1W6K A;  4XYO A;  1BXT A;  3BQ1 A;  4KN4 C;  2F0W A;  4HNU A;  3H20 A;  2NVT H;  3DF7 A;  2F0N A;  1HHV A;  2L0C A;  4YWL A;  3MWM A;  2R84 A;  2A6H C;  1A3T A;  5KFH A;  1M6V A;  4OXP A;  1MSG A;  4R4T A;  4X66 L;  1HA6 A;  4NW2 A;  4DAY A;  3BG5 A;  4QMG A;  1BR9 A;  1B9M A;  2OT2 A;  3OTO H;  1X6O A;  3HOX B;  4LF9 L;  1HA5 A;  1S0N A;  2R7Z A;  4LF4 H;  2K1B A;  1K83 H;  4DL7 A;  3EYY A;  3KF8 A;  2R61 A;  4O1N A;  5ELN A;  1AP0 A;  3U9O A;  1GUO A;  1M90 C;  5KFF A;  3MHB A;  1DD2 A;  1HFN A;  4RNN A;  3I3C A;  1HNW H;  1VQ6 A;  4LF6 H;  3K58 A;  1WI5 A;  4KMU C;  1S5C D;  1VQF A;  4GNX A;  2E5L H;  3S1M B;  1Q81 C;  4TV8 F;  2W8K A;  3PW2 A;  1PV4 A;  2DY8 A;  1SNP A;  1TXY A;  2C2E A;  1VQM A;  4EGJ A;  2J4X A;  1MZB A;  2W6M A;  1H9R A;  2N55 A;  1MHW C;  1FYC A;  5CYU A;  5KG3 A;  1Y1W A;  4XXE A;  2W9C A;  4HJ9 A;  2E2H B;  2C28 A;  3S14 B;  1O78 A;  4JBW A;  1YVC A;  1IBK L;  2PPB C;  2Z1C A;  3BQ0 A;  3ULL A;  2F0E A;  3OUU A;  1TAE A;  3FEW X;  4PZ8 A;  4OEL B;  2DNE A;  2F0D A;  2J6S A;  3HOV B;  3S2H B;  4FBT A;  4DUY L;  1EWC A;  1SMX A;  2FJZ A;  1XX8 A;  4ZAI A;  5LL6 b;  2WII B;  2HVR A;  1ONL A;  4BS9 A;  2B2T C;  3MC0 B;  2V4D A;  3PUY A;  1V1Q A;  4J1M A;  2QCP X;  3NBI A;  5C0X G;  3JAM L;  2YTV A;  1ET6 A;  2K5W A;  3PO2 H;  2JA8 G;  1V51 A;  3S15 B;  4WRD A;  4E4T A;  1VQ7 A;  3I4M B;  1P16 A;  3HBL A;  2IX1 A;  2OCE A;  5FO9 B;  2IBK A;  1WR2 A;  4O0A A;  2GVA A;  3QB3 A;  4HJ7 A;  3ERS X;  2VUM A;  1XNQ H;  4BY7 G;  2BOS A;  1EYZ A;  2IWH A;  2Y0S A;  1CQJ B;  1XTC D;  3J80 i;  1PTO B;  3NQI A;  2BA0 A;  1Q8K A;  1YHQ A;  5ELO A;  5BR8 L;  1D2B A;  3RFC A;  4A3L G;  3KHR A;  2Z4I A;  3ER0 A;  1L1O B;  1OXS C;  2AQ3 B;  2WAQ E;  4GKJ Q;  3OSN A;  4DAM A;  4DLK A;  5BMV F;  3I4N B;  1I4Q A;  4FF4 A;  5E4X A;  1EUJ A;  3KXY T;  4YR3 A;  2I0Q A;  5JQW A;  1GOZ A;  4B3T L;  3GTL B;  4ETS A;  2Z0S A;  1LTS D;  1BCP D;  2N3S A;  1JE4 A;  2K52 A;  2K75 A;  3D3R A;  3FRP B;  2JEA I;  2OTJ A;  2ZJP A;  2WB1 A;  1QOH A;  4IAJ A;  2B2Y A;  1Y1W H;  4KD4 A;  5LMU Q;  1Y14 B;  2MNA A;  3K59 A;  3UDG A;  1MJC A;  3MWD A;  4IUR A;  3D4W A;  1Q90 A;  4IOA A;  5A2Q L;  2AU0 A;  3NEM A;  1Q82 C;  4P73 A;  4NXM H;  5C4J H;  2JA6 A;  2VXW A;  2WAQ A;  4UFZ A;  1I94 Q;  1XTD A;  1NY4 A;  2R3Z A;  4DK6 C;  1Z6H A;  3RNU A;  3PZP A;  2FMM A;  3BAB A;  5GQO A;  4U68 A;  1UC8 A;  2PQA A;  4Y7N H;  2B63 H;  5A2Q E;  1HTL D;  3FHW A;  3I4N H;  3UI2 A;  1Y69 U;  4YWM A;  1CZW A;  5LMU L;  3PIP 3;  3R5X A;  3D0F A;  5FLX W;  3PW5 A;  4H02 A;  4B9W A;  4DUZ L;  3M4O B;  2UUC L;  5IYZ F;  2YS7 A;  1KTK A;  3HKZ E;  1OO9 B;  4F7X A;  2PZT A;  1A9X A;  4LF6 Q;  1MIU A;  3S16 B;  4HJ5 A;  4HMJ A;  2OXP A;  1I94 L;  4A3C H;  1X65 A;  3MTS A;  1JOO A;  1ASZ A;  1A3V A;  1QJO A;  5ELD A;  1E4G T;  3NBH A;  2HHH L;  2NU8 B;  2JA7 B;  1N9W A;  3MXN A;  3CCS A;  4DV6 Q;  4JI2 H;  1VQB A;  1T94 A;  5M5Y H;  4TV9 F;  4KLK A;  4K0K H;  3FKI H;  4OWW B;  1MGS A;  3FP9 A;  4V0B A;  1I4R A;  2Q2I A;  5F2D A;  5GAG C;  1WCM H;  3KHL A;  4DUZ Q;  4B3S Q;  2IY5 B;  4AYB E;  2I5M X;  4QL5 A;  4BY7 B;  3KLS X;  4DV7 Q;  3VA7 A;  2R92 A;  3GIP A;  1EEF D;  2X6G A;  4LF4 Q;  4I7A A;  4A3G B;  1PZK D;  4I4T F;  4IPH A;  1A8V A;  1F9P A;  4TQR A;  3T1Y L;  1RYS A;  3A8J E;  2RDG A;  2IA6 A;  4JYA H;  4JI7 L;  4O2B F;  4DU9 A;  3TQY A;  4QCL A;  5FD6 A;  2HHH Q;  3KHG A;  2UVW A;  4DPG A;  1V4Y A;  4R8U B;  2XIG A;  2HIV A;  2F0O A;  4HN7 A;  1HUN A;  2WKD A;  5D1P A;  4MTE A;  1XMO L;  4JV5 H;  4QGU A;  2NVX H;  1JDE A;  1HJP A;  3K5N A;  3RBE A;  5DG9 A;  5IOD A;  4YR2 A;  2FPI B;  1EY9 A;  1AW7 A;  1CKN B;  1JOQ A;  2LXK A;  4DK1 A;  1SFO H;  2R93 B;  1AE3 A;  4DV7 L;  3NTI A;  3V96 A;  3KLW A;  4JI5 H;  4LWC A;  2YU9 A;  2KHS A;  3CME A;  5CV5 A;  4G7H C;  2JQO A;  2JA5 G;  4DV5 Q;  3KK7 A;  1G6P A;  4JI8 L;  1N32 L;  2HGS A;  5ELC A;  3O13 A;  4YHH Q;  2RBM A;  4J0M A;  4DR1 H;  1B04 A;  3AB9 A;  2GPS A;  4FVM A;  3J7A F;  2NVQ H;  3AFQ A;  4JI8 H;  5KFN A;  2B29 A;  3WDN A;  4BBS H;  5T14 A;  1U0L A;  4JOI A;  4GN5 A;  4LF8 H;  1MSH A;  1M0W A;  4PWQ A;  2W57 A;  1OXU A;  1M8A A;  1CHP D;  1CHQ D;  3K5M A;  4RB3 C;  4NP5 A;  1A15 A;  4A3J B;  1D1K A;  4GOP A;  3BVG A;  3MJF A;  1KD1 C;  3HOZ H;  1ENF A;  4ECX A;  1BXR A;  4JV5 L;  2I80 A;  3PUW A;  4DV5 L;  1XMO H;  1QZG A;  2R8H A;  1PMR A;  5IYB G;  1U4R A;  3IG0 A;  5DLG A;  5J2T F;  3PN1 A;  1S9F A;  1QVC A;  2KQ3 A;  1GHJ A;  1N56 A;  3GV8 B;  4ZQ3 A;  2VQF Q;  2K03 A;  4DV2 Q;  4WJ4 A;  4JYA L;  3GIQ A;  2JA8 B;  2PI2 E;  3MWY W;  1S4Z A;  2JA5 H;  1K1S A;  2FPP B;  4IPC A;  1VQN A;  4XYL B;  3GTQ A;  4CDE C;  2NYZ D;  1YJW A;  3QOL A;  5DGB A;  3CHB D;  1E3P A;  4R8N A;  3IN5 A;  2DNC A;  4TQS A;  4IR9 A;  1VF5 C;  2BE5 D;  3A5Z B;  5DG7 A;  1SRO A;  2F52 A;  1DON A;  3RBD A;  2M05 A;  1F77 A;  3LWU A;  1IBL L;  4EBD A;  4JVZ A;  4YCV A;  3JRX A;  4LF9 Q;  1BNC A;  1PH6 A;  3I4N G;  1EUD B;  4GC7 A;  2HHH H;  3SGI A;  4O4H F;  1JJ2 A;  2UXD L;  2B63 B;  3MXP A;  2B2U A;  1YBY A;  4DK0 A;  4KD3 A;  3W2D A;  1I94 H;  3OYY A;  4U7C A;  3TP5 A;  2F0M A;  2OEO A;  1B6S A;  1TY2 A;  4A3F H;  2YZM A;  1IBM H;  4X65 Q;  3FDT A;  4R4O A;  4GNX C;  3RUZ A;  1BQQ T;  1TWA A;  4LF8 Q;  2VUM G;  4DUZ H;  2EZV A;  1WOC A;  4DR7 H;  2JEF A;  2UVU A;  1TS4 A;  3IL8 A;  3OHA A;  1EQV A;  4F4W A;  1S5D D;  4BA2 I;  2OTL A;  3KBG A;  5JPM C;  3J7Y W;  2E74 C;  2I5H A;  1PH1 A;  3PUZ A;  3KAL A;  3RAX A;  5M3F H;  2GN5 A;  4DR6 Q;  2VQE Q;  5GAE C;  3JAM W;  3HKZ B;  1N36 L;  3FDS A;  5LA6 F;  4IO9 A;  5KFC A;  5LOV F;  3FKI G;  2IX0 A;  3J81 L;  4EFB A;  1HXY D;  2EY6 A;  1PYB A;  3ZYY X;  1N8R C;  1RK5 A;  3VDY A;  3UDX A;  1KJQ A;  2XWB B;  3HKZ A;  4Q5V A;  3GQB A;  1S5F D;  1WD1 A;  3G6E A;  5DQH A;  3KYH C;  1WJJ A;  5CBE E;  2RCN A;  3KAJ A;  4YR0 A;  3K7U C;  1YHB A;  2W6Z A;  5I2Y A;  4LFC H;  2JP1 A;  3K7A H;  1VQA A;  5EKK A;  3LML A;  2B63 G;  5KIX A;  4B3T H;  1ILP A;  1STN A;  3EFX D;  3HKS A;  1EOV A;  2E2I H;  3DEP A;  1JQY D;  2KCM A;  3J80 L;  2B2W A;  3MZ5 A;  2F1M A;  3VPB A;  3EPG A;  3U4V A;  5CV4 A;  1B4O A;  4K6L A;  4XQQ A;  2FMA A;  1E1T A;  3RTX A;  1C30 A;  3C1E A;  4MTN A;  3CU7 A;  5C4H A;  1CQV A;  5M5W B;  1KLG D;  5D65 A;  3BYY B;  1H9S A;  1LTA D;  4OO1 H;  2WDT A;  5DAU A;  3Q8Q B;  1WCM G;  1CM9 A;  1RJP A;  4UCU A;  1YI2 A;  1A2T A;  1QG7 A;  3W3A A;  1GUS A;  1FVI A;  4CKB A;  4DN4 M;  4RB0 A;  1PFB A;  3HOY B;  3VYR A;  4EBC A;  5E1F A;  1BNZ A;  1Y1W G;  4B3M H;  3V6H A;  1ZYR C;  4A3K G;  3VR2 A;  2VQE H;  1QVF A;  4HNV A;  4MV4 A;  1I6H H;  4AH6 A;  2E2J B;  3PW0 A;  2VS1 A;  1HR0 H;  1PX2 A;  3DMU A;  4A3J G;  2NU7 B;  4NMZ A;  5IP9 H;  4B3R H;  3BZC A;  4Y8V B;  1B33 N;  1A3U A;  4OON A;  1J9O A;  3RB4 A;  1ROD A;  5D1O B;  3CRK C;  3JAM E;  2F0V A;  2EYL A;  4HNT A;  5M3F G;  2W9B B;  2VB3 X;  3CW2 C;  3T16 A;  5BN4 A;  1WSC A;  3H94 A;  3HFZ B;  4ME5 A;  2R6F A;  3OMG A;  1LTG D;  1TS3 A;  5CB4 F;  4ALP A;  3GTK B;  4RFB A;  1QVG A;  4DR1 Q;  3GP7 A;  4YHH H;  3F8T A;  1HNZ Q;  2VA3 A;  3N42 B;  1PH8 A;  3HOZ B;  2W9B A;  3TIG A;  2F4V H;  4JI6 L;  1VBH A;  1JC7 A;  3CCM A;  3U58 A;  4LF6 L;  1FR3 A;  4GS3 A;  1B3Q A;  1HNW L;  3GTK A;  4DAY B;  1WYD A;  1ILQ A;  4C3I H;  1PDQ A;  2KHJ A;  1I4P A;  2H5X A;  4LUO A;  4X62 H;  5FJ8 G;  4PNY A;  4HQ6 A;  4RUA A;  5DGA A;  1RF2 D;  4O2A F;  4Y52 H;  5I9O A;  3A54 A;  1KRS A;  5C1O A;  3HOX G;  4Q43 A;  1K9M C;  1DYQ A;  3OTO L;  2VB2 X;  3EQL C;  4MIU A;  2R7Z H;  5KT4 A;  3VA5 A;  3CCL A;  1NJI C;  4JPB W;  4X66 H;  4OHJ A;  1M1K C;  3NTH A;  5C4Z A;  4MV6 A;  2Y0S E;  1V9P A;  4L5R C;  4GNX B;  4ECT A;  1NAP A;  1TWF H;  2MO1 A;  2TSS A;  1HNW Q;  1PRT D;  4K2L A;  3BS1 A;  5C44 H;  4A3D H;  2NVT B;  4QY7 A;  4K8J A;  1Q86 C;  3J7A V;  3V6K A;  2RF4 A;  4BBS B;  1OTC A;  1KAA A;  4IUT A;  1IW7 C;  5BPF A;  3TSS A;  4GLV B;  3X3N A;  2W9C B;  4JI6 H;  4JK1 C;  4BBR G;  3MXU A;  4DV2 L;  1PH3 A;  2F4V L;  2AQ1 B;  1I3Q H;  4G4K A;  3NPP A;  3HOZ G;  4N8X 1;  2EY2 A;  4GKK H;  3M4P A;  1B53 A;  1UE1 A;  5EBD A;  4ECY A;  3FMA A;  1Z9F A;  2QK4 A;  2K5V A;  3F8N A;  3TS2 A;  2BQ3 A;  1TWF B;  4KJN A;  1DJR D;  1SSO A;  2XRS D;  2EYM A;  1E2V A;  3RZO B;  3MR6 A;  1O7Y A;  1HR0 Q;  2UUA L;  1IBL Q;  3F2C A;  2QYZ A;  3T13 A;  2LSS A;  4LFB L;  2F0J A;  4KKU A;  5JEA H;  3A0J A;  4Z9C B;  1S10 A;  4CGY B;  4UCR A;  5KFV A;  1IL2 A;  1IBK Q;  4KHP H;  2ATL A;  3KJO A;  1YJ9 A;  1CTM A;  1R4P B;  5KFJ A;  2V4Q A;  5KND A;  4HJA A;  1FGU A;  3J7Z C;  4O3S A;  1QE6 A;  4FDB A;  4POF A;  1JIH A;  4ED0 A;  4DUY Q;  4P71 A;  4BY1 H;  2GVB A;  4X66 Q;  2UU9 H;  1DCZ A;  1VQG A;  2G9H D;  4CJ0 B;  4XIG S;  2PI2 A;  4PV1 C;  1EFI D;  5LMN L;  3HOU H;  2NU9 B;  2KEN A;  4RGN A;  3AQQ A;  3AYH B;  2L1B A;  3OIQ A;  4IFD H;  2RVL A;  2WP8 J;  3X3M A;  3G6V A;  4OIJ A;  1E4E A;  2WB1 B;  4FXG C;  3EBE A;  1B2T A;  2EYH A;  4XQJ A;  1KLU D;  2IL8 A;  2VQD A;  1FKA H;  3E0J A;  2W7O A;  5EQ0 A;  1GVP A;  2JN4 A;  4C1N I;  1AZQ A;  3VR6 A;  2FP4 B;  3PMF A;  4OGQ C;  4P72 A;  3H3V C;  1HZ9 A;  5CAE B;  3S16 H;  4QQB X;  1EU4 A;  4J9O A;  1YIJ A;  3M7N A;  4B3S H;  4BBR H;  1O7I A;  4XQN A;  1SNO A;  3I73 A;  4BWG B;  3E0E A;  4DR5 H;  3M4O H;  1SYC A;  4KN7 C;  3L0O A;  4F88 A;  3NWS A;  3D4D A;  3OWE B;  3JAM i;  4HCE A;  3E3X A;  5BPH A;  4DNT B;  3QZ8 A;  1CKO A;  2E2I B;  4C1N K;  3AMU A;  3BZK A;  5FO8 B;  2O5J C;  1MD2 D;  4Y7N B;  3R93 A;  2ZTC A;  1BO0 A;  1XPO A;  3I4M H;  4PDB A;  3UE1 A;  4A3E B;  2N8N A;  4DR4 H;  4A93 G;  5M3M H;  3ITP A;  1SNC A;  2A69 D;  1X32 A;  1I6H B;  4RZR A;  4ECW A;  2RDF A;  1D1I A;  2GLT A;  3CQZ A;  5JPN C;  2P5Z X;  1S40 A;  1RYR A;  4TKO B;  4JI4 Q;  3VR4 A;  1YIT A;  1FNV A;  1A2U A;  4JI0 H;  4J9P A;  4XDX A;  2XD4 A;  5GAH C;  1UNN C;  1EQR A;  1SE8 A;  5J39 A;  4OX9 H;  1N34 L;  2VR1 A;  4LF5 H;  3CQZ B;  4AQY Q;  5K36 G;  1YJN A;  2PO4 A;  4IFD I;  4M7E A;  2NU6 B;  2VUG A;  3URY A;  3CRL C;  4CC5 A;  3PF4 A;  2JA6 H;  1JR0 D;  3F2U A;  4QF4 A;  3J80 E;  5EPL A;  3I2Z A;  4A3I H;  2VA2 A;  5ELF A;  1N34 H;  3V2T A;  1STE A;  1K28 A;  4EG0 A;  1G8Z D;  3TRE A;  2ZDG A;  3CC4 A;  4RWS C;  3KJP A;  4ECZ A;  3W1G A;  1KL9 A;  2FK2 A;  4X3S A;  4IUU A;  1HPC A;  4IJL A;  3PIO 3;  3GO5 A;  3RZD H;  1HQR D;  5CA1 F;  2ASJ A;  4S3S A;  1LTI D;  4FYD A;  1KC7 A;  4RAY A;  2B2W C;  3V4Z A;  2XWJ B;  3TZU A;  4HIM A;  4DR4 L;  2UXC Q;  4FM9 A;  2JEG A;  1SRU A;  2R7F A;  1JJC B;  1BBW A;  1HUM A;  3DWQ A;  3MVV A;  4OWT B;  4A76 A;  4M9U A;  5KG5 A;  3RIZ A;  5KFS A;  4DV5 H;  3G8C A;  5C3E G;  2HVQ A;  1NR4 A;  4X3U A;  1E0B A;  3K81 C;  3CAM A;  2JA8 H;  2K6A A;  3QWN A;  1K1Q A;  4DAV A;  4UHV A;  5LHY 1;  5JEA G;  1ML0 D;  3SK5 A;  1C7Y A;  3RB0 A;  1DV2 A;  2XNA C;  4HIO A;  2DJG C;  5JJK A;  1ESF A;  5ISR A;  2E5L Q;  2JEJ A;  1NNX A;  3Q8S B;  1DGS A;  3KHH A;  1ZET A;  2W6Q A;  3KUP A;  5KKN B;  2CFM A;  5IOC A;  2XGT A;  1STA A;  2Z6K C;  4IRC A;  4JI5 Q;  1EYD A;  1G29 1;  2WAQ B;  3WWV A;  1STG A;  2W6N A;  1LTL A;  3S17 H;  3UDI A;  2HD3 A;  2YZN A;  1GO3 E;  3G71 A;  3T5J A;  1FJG H;  4ZCK A;  1GLV A;  3MWE A;  4IAL A;  3TZD A;  1LLR D;  5EDW A;  4ZUI A;  3L4J A;  1BBX C;  1JJG A;  1QNK A;  2UU9 L;  3TRZ A;  4IOC A;  5C44 G;  4A3D G;  2PBZ A;  1IBM Q;  4JOI C;  3SEB A;  1TY0 A;  3TP8 A;  1SFO A;  1Z2O X;  3BDL A;  4OWX B;  4ED2 A;  1UE6 A;  2FK1 A;  1NMF A;  2L5T A;  1I7N A;  3M4Q A;  3J81 c;  1KRT A;  2MJ8 A;  2ES2 A;  2EVB A;  2ZJQ A;  3J80 W;  2KCN A;  2EQS A;  2R7M A;  4OO1 G;  1Z7T A;  3ETH A;  5C0X J;  4LFB H;  4C56 C;  1KDB A;  5C0X H;  1S97 A;  1PRT F;  4JUZ A;  3FKI A;  3CVZ A;  4ZRZ A;  1TWG A;  4IFD J;  2I07 B;  2R82 A;  2HDM A;  3H4D A;  3BQ2 A;  1HCZ A;  5EOY A;  4IUQ A;  1SBB B;  1UUP A;  1I4G A;  4DAP A;  1ULZ A;  5C4X H;  2ZTE A;  1TWG B;  3QJY A;  2W6O A;  3Q1K A;  3J7A K;  3BYT B;  2QGQ A;  2R92 B;  1YZ6 A;  2YTY A;  1EZ1 A;  4K14 A;  3PSI A;  2SNS A;  2IHF A;  2N78 A;  1XYI A;  1XNR L;  1X3F A;  5M5Y B;  1W93 A;  1JE5 A;  1ET9 A;  1X56 A;  3SHL A;  4LSA A;  1SYB A;  3M4Y A;  4ZKB B;  2E2J H;  2UUC H;  1RIP A;  5CR3 A;  1SND A;  3NXW A;  1VQD A;  4HTH A;  4L5Q A;  2I8C A;  4IN3 A;  4DV4 L;  4MA5 A;  5KFP A;  3CCR A;  1O75 A;  3ORR A;  4UP9 A;  1CKN A;  4RGM A;  5I47 A;  1ASY A;  4DXG A;  2VZA A;  4ILW A;  2R7N A;  5E7N A;  4J9M A;  2B8F A;  4GN4 B;  2RGR A;  4A3I B;  1PZJ D;  3QIA A;  1PRT C;  3HKZ G;  3K5L A;  1VMP A;  5IGB A;  3GTK H;  1N33 H;  2QDB A;  1CSQ A;  2J9G A;  1TWC H;  1QUQ A;  3ND8 A;  2RHS B;  2J6U A;  1BBU A;  3E5S A;  1SR3 A;  3J7A 5;  3E9I A;  3J81 i;  1SYG A;  4LW1 A;  3Q22 A;  1LO5 D;  1JLL B;  4A4I A;  1WTH A;  4TUY F;  1DM0 B;  5M5W H;  1EY6 A;  3CC2 A;  3FPU B;  1PTO C;  4N8F A;  4DGZ A;  5AFW A;  2FLN A;  1JWU D;  2DJF C;  2X6L A;  1H9M A;  4LUZ A;  4ULL A;  3S9W A;  4A3C G;  4P74 A;  3T1H L;  2KHI A;  1SE4 A;  4L63 B;  3LGJ A;  2DLN A;  1CE8 A;  1T3N A;  3STB D;  4RA8 A;  1KBL A;  3U50 C;  4NLG A;  2LKV A;  4LMQ D;  5EPK A;  1OXV A;  1G2T A;  4L6T B;  2Z9H A;  5KT6 A;  3PW4 A;  3Q8P B;  2AUJ D;  5KFX A;  3OOC A;  4NXM Q;  3T53 B;  4B3R L;  4Q8F A;  5CC4 A;  4UP8 A;  3R8B A;  2VPQ A;  4F4Y A;  2BQU A;  2HUG A;  2ATW A;  2ASB A;  5AJ3 Q;  4UP7 A;  1W96 A;  4FO2 A;  4B3M L;  1KIX A;  1WH2 A;  3GIM A;  1JX4 A;  3ULP A;  3A7A B;  2EYO A;  3E6Z X;  1AZP A;  5IYB H;  4YCU A;  5KFB A;  1Y8P B;  1RKN A;  2F4I A;  1E7Z A;  3S2D H;  3V05 A;  4OO1 I;  3RR5 A;  3BDO A;  2V59 A;  2C2D A;  3S1N H;  1VQL A;  2IP4 A;  1L0Y B;  4XZ3 B;  1AUX A;  3GID A;  1EWH A;  1LM0 A;  4H44 C;  2F0L A;  4IWY A;  2QIL A;  3HGB A;  1SLJ A;  2FHT A;  2K05 A;  1ZYR D;  3AU7 A;  2E2H H;  4BXX G;  1YNX A;  3MEF A;  3BAA A;  3NTK A;  1GYF A;  1LT5 D;  1GXD C;  2NTT A;  2RCF A;  2K50 A;  5KFM A;  3I91 A;  1IYV A;  2W70 A;  3TS0 A;  1U4P A;  1A0I A;  3CCU A;  1CFM A;  3N44 B;  3EPI A;  2OLS A;  3GTJ A;  4ODG A;  1GUW A;  4O3R A;  2G9D A;  4K5V A;  4DL4 A;  4IHJ F;  4R1J A;  3PV0 A;  3R23 A;  3LNN A;  3WO0 A;  1Y1V G;  5CV8 A;  3GTP A;  3OW2 A;  4PZ7 A;  2Q8T A;  1SMY D;  4ECS A;  1GUG A;  2K28 A;  2RSO A;  3CMA A;  2RQX A;  4K5W A;  2HCI A;  1DIK A;  1VQH A;  4R7R A;  4CC6 A;  1EUC B;  1ZHQ A;  1HRJ A;  1DOM A;  3TEH B;  2IT1 A;  2CQY A;  2FPG B;  4LF9 H;  1ICW A;  1DZ1 A;  4CBV A;  2V58 A;  2C35 B;  2G5D A;  2CVR A;  3BA8 A;  5KG1 A;  3BVZ A;  2SNM A;  3MR2 A;  1N36 H;  4JC0 A;  4LJZ C;  3H6M A;  3M3Y B;  1TS2 A;  2OF1 A;  3TBI B;  5IGE A;  1CA6 A;  5EWG A;  3GIJ A;  4JV1 A;  4C2M H;  3A74 A;  1VQJ A;  3F2D A;  2F3I A;  2JE6 I;  1UAP A;  5C3X A;  1PZI D;  3RF2 A;  5KG7 A;  1XPR A;  2JYO A;  3L2P A;  1XMO Q;  3KBX A;  4V19 0;  1IBM L;  4ED3 A;  2ASL A;  4BBR B;  2ZM6 Q;  4DR4 Q;  4NDX A;  1S0M A;  2EOT A;  4DA2 A;  2YRX A;  1XNR H;  3KAK A;  1KNE A;  1K3R A;  2VY3 A;  2YTX A;  2ZXP A;  2A19 A;  2ALZ A;  5NUC A;  2R8K A;  2AQ2 B;  4MTD A;  5H1S E;  2NN6 I;  1AN8 A;  4APV A;  3S14 H;  4XTC S;  4JI8 Q;  1TWC B;  1IBL H;  5KFR A;  2LXJ A;  1VQ8 A;  2DWC A;  4GLA C;  5IP9 G;  5GAD C;  2UUB L;  1K83 B;  2WB1 G;  1JWS D;  4RG1 A;  5IT9 E;  2D9U A;  5C8Y F;  1G91 A;  4PG3 A;  1I50 A;  4RU9 A;  2ID0 A;  3TQT A;  5EWF A;  2MHV A;  3VYS A;  1EY4 A;  3V4S A;  4JG2 A;  5FJ8 H;  4JI6 Q;  2AUK A;  4HSP A;  5GRO A;  2JA6 G;  3TP7 A;  1WTQ A;  1DOL A;  2Z6K A;  4R4I A;  3H3V H;  1C0A A;  1EY7 A;  4NPS A;  1B44 D;  3K5O A;  2N49 A;  4X64 L;  1WTR A;  2UUA Q;  4C2M A;  3C0F B;  2V9W A;  3EA6 A;  3TQ1 A;  2CH4 A;  1ZXT A;  4L8J A;  2A6E D;  1TS5 A;  4LH6 A;  4KI0 A;  3BG3 A;  4EQO A;  3OTO Q;  3RZO H;  1LT3 D;  1L0W A;  2EY5 A;  2NZH A;  4RAU C;  4C2M B;  1FJG L;  1U4L A;  1JB7 A;  5T1G A;  3JRW A;  5DEH A;  3CCQ A;  3GTJ H;  2A68 D;  2C9O A;  5IGF A;  5M3M G;  2VL6 A;  3DM3 A;  5IP7 G;  2O03 A;  1WTP A;  4YB8 B;  4KY6 A;  2DPI A;  2NVY A;  2R8J A;  1SYE A;  3LP8 A;  4HYK A;  1MBY A;  1SXT A;  1EFW A;  3S24 A;  2L11 A;  5FLX c;  2I46 A;  3P7J A;  1EU3 A;  2CW0 D;  3SE0 A;  2YL2 A;  3BA9 A;  3OUZ A;  3GTP H;  1BGW A;  2CHB D;  3KF6 B;  1K0S A;  3G48 A;  2E2I A;  1LV9 A;  2H1E A;  3M9N B;  5CMD A;  1V8Q A;  2UXD Q;  2O5I C;  3GTO A;  4EGQ A;  4ECQ A;  5ELB A;  5D14 A;  1C3O A;  2MPM A;  3RZD B;  2RSN A;  3DM1 A;  3HOY H;  3KF6 A;  3K5H A;  3S1R H;  1B1Z A;  1Z47 A;  3OW7 A;  4KJO A;  3HOW B;  2XCL A;  3QZ7 A;  3PVX A;  4EEY A;  1LTB D;  5K36 H;  4A93 B;  5IT9 L;  2KEC A;  2QDL A;  5KFD A;  3I4O A;  1WCM B;  1XNR Q;  4EFE A;  1L0X B;  4ABN A;  3IFT A;  1WD0 A;  3T1Y H;  3A55 A;  5I6W A;  1VBG A;  3SI8 A;  1HZA A;  1K3B C;  4LF5 Q;  4I7Z C;  2UXC H;  5IIF A;  5IT9 W;  3NSW A;  4B3R Q;  1WCM A;  1SE3 A;  2EXD A;  4XYQ A;  2XTI A;  3G6J B;  1VQI A;  2GA4 B;  1C4Q A;  4G57 A;  2MFI A;  1TWF A;  2XGQ A;  3RLN A;  1F2L A;  4PMC A;  4YIJ A;  1KAW A;  4KTA A;  2ALY B;  2OQK A;  1VDZ A;  2DPJ A;  4DNR B;  1WTV A;  3L9A X;  1LT6 D;  4UAI A;  2VPS A;  1XNQ Q;  1DOK A;  2JEB I;  4ZLT F;  4FXK C;  1X3Q A;  4A3E H;  2PQE A;  2V1C C;  5K5P A;  1B50 A;  5KFG A;  5H80 A;  4LF5 L;  2PNH A;  4OX9 L;  3ETJ A;  1W3S A;  3K7A B;  1F9Q A;  3Q8D A;  1IL8 A;  2RGV A;  2W8L A;  1CSP A;  1GD7 A;  2F0Q A;  3GDE A;  5CBA E;  3DUZ A;  3E5N A;  4JI0 L;  3NP8 A;  2ZDH A;  2XN9 C;  1UEB A;  4LFA Q;  2YW2 A;  4JI1 L;  3PIO A;  5JJL A;  5LMU H;  1R9T A;  4LF8 L;  1SMY C;  4A3I G;  4ZK9 B;  1J5E L;  5GON F;  3IRB A;  2MUY A;  2A5H A;  1CI3 M;  2VUM B;  4DNI A;  4ED8 A;  2K01 A;  1EY5 A;  2LFN A;  5FLM H;  5I2X A;  4MN3 A;  4O3O A;  1N36 Q;  3GTM B;  1A62 A;  4HAE A;  1E4E B;  2L12 A;  2CKZ B;  3PO2 B;  3FVQ A;  1JDB B;  4NXM L;  4IWX A;  2PN1 A;  1L1O A;  3W5O A;  1GKH A;  3H91 A;  5BN3 A;  3IAY A;  1GSO A;  2K4K A;  1XDN A;  4ME6 A;  3GIK A;  3CPF A;  3MFG A;  4LNQ A;  3WNZ A;  4EEQ A;  1PVO A;  1HQM C;  3GTL A;  2ZT9 C;  4DR5 L;  3K0Y A;  5KG6 A;  1JXL A;  2F0I A;  3S2H H;  5C5M A;  5BR8 Q;  3J81 W;  2A6H D;  4A3F B;  2F0G A;  2F0P A;  3DEO A;  3TP6 A;  2RHQ B;  1B70 B;  2ICE C;  5FOB B;  2JA7 G;  3S1M H;  2FE3 A;  5C5J A;  3MR5 A;  2B39 A;  1EYC A;  1ZEQ X;  1RDP D;  1S5E D;  2MO0 A;  4CKC A;  4A2B A;  4IUN A;  4ZYS A;  3RD4 A;  1RD9 D;  3RB3 A;  1F2Z A;  3MEH A;  1PFS A;  1X3G A;  5KNC A;  1JOR A;  3RGX A;  3UE0 A;  1O7Z A;  3OSP A;  2EYJ A;  3P1H A;  5IGD A;  4G3I A;  1U4M A;  2QEX A;  1T36 A;  2PQA B;  1WVL A;  5L1L A;  4LMY A;  3CXC A;  4YJ3 F;  1Y8N B;  3T5K A;  5BN5 A;  2WKC A;  4RHR A;  3S1R B;  2HQL A;  4ZKC B;  1EYA A;  2N88 A;  3M9M B;  3PUV A;  2ASD A;  2JK8 A;  1PA6 A;  1XXG A;  5LL6 S;  2FFK B;  3PR4 A;  2XCA A;  1NMG A;  2XCP A;  4DL6 A;  1IXR A;  4YY3 H;  4CHT B;  1P8L A;  2UXB Q;  1LTR D;  1KDA A;  4KHP L;  1A63 A;  4ED1 A;  1VQ5 A;  4TQU S;  4C3H B;  5JVH 3;  2D62 A;  1K0R A;  3I72 A;  3BU2 A;  4DUY H;  1D6E C;  2DY7 A;  5A35 A;  5IT9 c;  3N6X A;  2CCZ A;  3HOY G;  3JSL A;  4MV1 A;  4A3M H;  4LK1 C;  1KAB A;  5L9X A;  4HCS A;  3OWF A;  2VQF H;  1QIL A;  2F0S A;  4RH6 A;  4A3E G;  4A3J H;  2JA7 A;  2SEB D;  2Q8I B;  1IBK H;  1RTO A;  1L2Z A;  3BJY A;  1IYJ B;  2F3W A;  4IRK A;  3ZJY C;  5EKL A;  1BKB A;  1HFG A;  1CKM A;  5HUR A;  1AFP A;  1II3 A;  5DLQ E;  1XPU A;  5KG0 A;  4GKK L;  3K0X A;  2K32 A;  4N9T A;  1N33 Q;  4KHP Q;  2NVX B;  1FNW A;  5KFA A;  4IZ8 A;  4DV2 H;  1TVX A;  3NEL A;  4CDF C;  4F8M A;  5KG4 A;  1HNZ H;  2E5L L;  5C4X G;  3M4I A;  2XGP A;  5LXT F;  2M2L A;  3A8I E;  3JSN A;  2BDN A;  2B2V C;  1AH9 A;  3RB6 A;  2AMC B;  4C3I B;  5C3W A;  4B08 A;  3GD7 A;  4CDD C;  1FL0 A;  3N40 P;  1GHK A;  3BDC A;  3N43 B;  1YNJ D;  4LF4 L;  1A6X A;  3S1Q B;  1JWM D;  2OQ0 A;  3PGZ A;  1SYF A;  3TME A;  4L1K A;  1KC8 C;  1SDF A;  3K80 C;  2NTS A;  2R8I A;  4DF7 A;  2F0H A;  5L1J A;  1E1O A;  4A3G G;  3K3P A;  4WD3 A;  4EQ5 A;  3RGZ A;  5C6A A;  2YRW A;  3J80 c;  4OL7 A;  2ZJR A;  1SYX B;  2V4R A;  3ULJ A;  2PZU A;  5EAY A;  2A6E C;  5KFU A;  1CS0 A;  2K7V A;  4HR7 B;  5DG8 A;  4DR3 L;  4X62 L;  3SXH A;  4A75 A;  4JBJ A;  1S3O A;  3LWE A;  2R85 A;  2R86 A;  2F0T A;  4QJF A;  3GV3 A;  4UY8 C;  3CD6 A;  4KV6 A;  2NUA B;  2F0U A;  5KFT A;  3JZI A;  4RAZ A;  1DV1 A;  1K8M A;  2A68 C;  2NVQ B;  4X64 Q;  2PW7 A;  5IYC H;  2LY7 A;  4Q0F A;  5CV7 A;  1F9S A;  3PO3 G;  3GTQ B;  2XC9 A;  3BVM A;  4QW8 A;  4C3H H;  4YHH L;  3T5H A;  1BJT A;  4WBN F;  5DQG A;  3H15 A;  1JT8 A;  1TWH A;  2K5Q A;  4QIW B;  2E2D C;  4J8Q A;  3NEN A;  2EJG C;  1UC9 A;  3MFH A;  2QA4 A;  4DR3 Q;  1CK1 A;  1SFO B;  2CW8 A;  4A3G H;  1W6J A;  5IP7 H;  3KDF A;  1BCP B;  5KNB A;  4X65 L;  2YU9 H;  2X0S A;  1SJE D;  4I55 F;  5KFE A;  2UXB H;  5KFL A;  1K8A C;  1TWH B;  3DXJ C;  3JC6 6;  2YS6 A;  4EYI B;  1FGB D;  4GZY C;  1T9H A;  2EJF C;  2NUC A;  1KJ8 A;  1M7J A;  5KT7 A;  2CQO A;  4KKS A;  5JH7 F;  3D4R A;  4DR2 L;  1MJE A;  1BDO A;  4U67 3;  1HR0 L;  2DZD A;  5A2Q W;  4U6P A;  5EJW A;  1VQO A;  3FKI B;  5G3L F;  5KFY A;  2VQE L;  5KX5 F;  2NB0 A;  4KKT A;  5CV6 A;  2QKI C;  4A3K B;  3N41 B;  1TKW B;  3HEJ A;  2K5H A;  3SDZ A;  4JI3 L;  2CWP A;  4RZQ A;  3N6R A;  4LAA A;  4RGO S;  5IWA L;  4DR6 H;  3HS0 C;  4B3M Q;  4F4X A;  4R8I A;  4R4Q A;  5J3B A;  2EDG A;  5JVL A;  4A3L H;  5L1I A;  1EQQ A;  5KEE A;  5JOB A;  1PTO H;  2Q8R E;  4UDU C;  4EGV A;  4JI4 L;  3EVQ A;  1O80 A;  1X3P A;  4DXF A;  4WJW A;  2AGP A;  3C46 A;  1SAP A;  5IGG A;  4A3B B;  4DL5 A;  1PH7 A;  1PFN A;  3OHB A;  2E75 C;  4QB4 A;  4AQY L;  3N8D A;  1TR5 A;  2SDF A;  4E6I A;  2VNU D;  3S2D B;  3J81 E;  4IPG A;  4BXX H;  4TSS A;  2D0P A;  4N9P A;  2WAC A;  4NB3 A;  4LFC L;  5KFW A;  4A3F G;  2ZM6 H;  4J9N A;  4OEM B;  3TN2 A;  3RN2 A;  4EVO A;  4XYM B;  2D0O A;  5KYI A;  3K8A A;  3A8K E;  4DR5 Q;  1TQO A;  4F87 A;  1VQ4 A;  2AGQ A;  3P75 A;  1ENA A;  3M9B A;  5M3M B;  2C00 A;  4GKJ H;  3WOF A;  1VF7 A;  4I65 A;  1EIF A;  1X54 A;  2NVY H;  1G51 A;  1PXU A;  2Q2T A;  4UCS A;  1S03 G;  5T1I A;  2PZW A;  4I7H A;  5KT3 A;  1G6Z A;  3LX0 A;  2K14 A;  1M4V A;  1SNM A;  2IJ0 A;  1QUQ B;  5TSS A;  3S1N B;  2HVS A;  2K5D A;  4OX9 Q;  3UDF A;  1H9S B;  2EE1 A;  1Q1B A;  2C5C A;  3I56 A;  4WJ3 M;  1J5E H;  1TWA H;  1PH4 A; 
#chains in the Genus database with same CATH homology
 1E1T A;  4LFA L;  1MKH A;  1LUZ A;  5AJ3 L;  3TS0 A;  4MTN A;  1A0I A;  3CCU A;  4DR7 L;  2AHO B;  2WFW A;  3M85 A;  1XMQ L;  1HR0 W;  3GTM H;  4YCW A;  1WCM G;  4R1J A;  1YI2 A;  3PV0 A;  3W1B A;  4B3T Q;  1FVI A;  1Y1V G;  3OW2 A;  4PZ7 A;  1E22 A;  3E9H A;  1Y1W G;  4A3K G;  1QVF A;  1I6H H;  4AH6 A;  2ZM6 L;  3CMA A;  1VQH A;  2VS1 A;  5JEA J;  5FLM G;  3JAM c;  4A3J G;  4B3S L;  2R92 G;  5IP9 H;  3TEH B;  2IT1 A;  3BZC A;  3F2B A;  1EYG A;  2C35 B;  2HT1 A;  4OON A;  3BJU A;  1K73 C;  2CWA A;  4JC0 A;  4AYB G;  1XMQ Q;  4R4C A;  4MZ9 A;  4A3B H;  1TWG H;  3RLO A;  5M3F G;  3CW2 C;  4L5T A;  3DLL A;  3CCJ A;  4C2M H;  3HFZ B;  4L5S A;  1E24 A;  1VQJ A;  3A74 A;  3F2D A;  1PH2 A;  2F3I A;  2JE6 I;  2UU9 Q;  1D7Q A;  1XPR A;  3L2P A;  4ALP A;  1XMO Q;  1QVG A;  1IBM L;  4DR1 Q;  3HOU G;  2ZM6 Q;  4DR4 Q;  3F8T A;  1HNZ Q;  1PH8 A;  1HZB A;  1PH5 A;  1RL2 A;  4DV0 Q;  4KHZ A;  2A1A A;  2IHE A;  2UUC Q;  4JI6 L;  1K3R A;  2VY3 A;  2YTX A;  3CCM A;  2A19 A;  4BY1 G;  3U58 A;  4LF6 L;  1WFQ A;  3S1Q H;  1HNW L;  1X55 A;  4GS3 A;  2R7D A;  4DAY B;  1WYD A;  2AWN A;  2R6G A;  5H1S E;  2NN6 I;  4DV3 Q;  4APV A;  4C3I H;  1PH9 A;  1CUK A;  4XTC S;  4JI8 Q;  5LMN W;  4O2D A;  3S14 H;  2KHJ A;  1N32 Q;  2LXJ A;  2H5X A;  4LUO A;  1VQ8 A;  5FJ8 G;  3PF5 A;  4GLA C;  5IP9 G;  5GAD C;  2UUB L;  2WB1 G;  4Y52 H;  4RG1 A;  4DV6 L;  1KRS A;  3HOX G;  1K9M C;  2AWO A;  3OTO L;  4PG3 A;  1HNX Q;  2ID0 A;  4AIM A;  2E8G A;  1VQ9 A;  2Q2U A;  2R7Z H;  4X6A H;  4DR1 L;  3CCL A;  1NJI C;  4X62 Q;  3HOW H;  3I55 A;  1M1K C;  4JG2 A;  2Y0S E;  3G4S A;  1V9P A;  5FJ8 H;  4IFD G;  4JI6 Q;  2JA6 G;  5GRO A;  4L5R C;  4GNX B;  3CPW A;  1KHI A;  2PMZ E;  2Z6K A;  1J6Q A;  4R4I A;  4JI5 L;  1TWF H;  2MO1 A;  4NXN Q;  4NPS A;  3H3V H;  4LF7 Q;  1HNW Q;  1C0A A;  2Y0S G;  5C44 H;  4A3D H;  4JV5 Q;  4QY7 A;  2N49 A;  4X64 L;  1HH2 P;  4PMW A;  1Q86 C;  4DKA C;  3ICE A;  2RF4 A;  1EIY B;  2UUA Q;  3F1Z A;  1OTC A;  4LFB Q;  2BH8 A;  3PCO B;  2UUB Q;  4GLV B;  4GKK Q;  4KI0 A;  1HZC A;  4BBR G;  4DV2 L;  1PH3 A;  2F4V L;  3OTO Q;  3RZO H;  1L0W A;  1I3Q H;  4JI2 Q;  3HOZ G;  2NZH A;  4GLX A;  3M4P A;  5M5X H;  1UE1 A;  4DV4 Q;  1FJG L;  1JB7 A;  2NVT H;  2Q2H A;  3CCQ A;  1Z9F A;  3GTJ H;  3RN5 A;  4LF4 L;  2K5V A;  5IP7 G;  5M3M G;  2VL6 A;  2WAQ G;  3DM3 A;  3TS2 A;  4YWL A;  4OXP A;  4R4T A;  4X66 L;  1EFW A;  3S24 A;  5FLX c;  1OXT A;  3GTP H;  1HR0 Q;  3KF6 B;  2UUA L;  1IBL Q;  3F2C A;  4DK3 C;  2LSS A;  2MQH A;  3G48 A;  4LFB L;  2B3G A;  1X6O A;  3A0J A;  4PZ6 A;  4DV1 Q;  1NE3 A;  4LF9 L;  1V43 A;  2F4V Q;  4K0K L;  2UXD Q;  1IL2 A;  1K83 H;  1IBK Q;  4JI2 L;  5ELN A;  3KJO A;  4QIW E;  1YJ9 A;  2JEA I;  1H95 A;  3HOY H;  3J81 j;  1M90 C;  4JI3 Q;  3KF6 A;  1BVS A;  4HJA A;  1FGU A;  1VQ6 A;  3J7Z C;  3S1R H;  4FDB A;  1WI5 A;  4POF A;  1KQS A;  1VQF A;  4DUY Q;  1Z47 A;  4GNX A;  1Q81 C;  2JJQ A;  4P71 A;  4BY1 H;  2GVB A;  1U5K A;  4X66 Q;  1PV4 A;  1VQG A;  4XIG S;  2PI2 A;  1VQK A;  1TXY A;  3I4O A;  5LMN L;  1VQM A;  3HOU H;  3H3V I;  2KEN A;  1XNR Q;  3AQQ A;  3AYH B;  3PO3 H;  1VCI A;  2BH2 A;  4DV1 L;  1Y1V H;  4HJ9 A;  2WP8 J;  1VQP A;  1HZA A;  2YYZ A;  4LF5 Q;  4JBW A;  1YVC A;  1IBK L;  4JBM A;  4POG A;  3KOJ A;  3EBE A;  4JYA Q;  3ULL A;  2R93 H;  4HJ8 A;  4B3R Q;  4J15 A;  2EXD A;  1GVP A;  5IY0 A;  4PZ8 A;  2XTI A;  4P72 A;  1VQI A;  1HZ9 A;  2MFI A;  3U4Z A;  4DUY L;  3S16 H;  1K8G A;  4QQB X;  1SMX A;  1YIJ A;  3M7N A;  3STB C;  4BBR H;  1O7I A;  2OWO A;  3RLN A;  1KAW A;  3E0E A;  3M4O H;  2ALY B;  2OQK A;  3L0O A;  3PUY A;  4GKJ L;  1V1Q A;  4RMF A;  3JAM i;  4DR2 Q;  2I5L X;  5C0X G;  2YTV A;  1XNQ Q;  1CKO A;  3CQZ H;  2JEB I;  2JA8 G;  3PO2 H;  4A3E H;  2V1C C;  1VQ7 A;  1P16 A;  2HIX A;  3M3Y H;  2IX1 A;  3BZK A;  2OCE A;  4LF5 L;  2PNH A;  3EN2 A;  3KF8 B;  1GM5 A;  4OX9 L;  1I5F A;  1PYS B;  1W3S A;  2ZTC A;  3Q8D A;  1L1O C;  4O0A A;  1XPO A;  1CSP A;  1GD7 A;  3GDE A;  2GVA A;  3PIP A;  3I4M H;  4HJ7 A;  3ERS X;  3UE1 A;  4JI0 L;  4P75 A;  3CCV A;  4BY7 G;  1UEB A;  2N8N A;  3CP0 A;  4A93 G;  4LFA Q;  5M3M H;  4JI1 L;  3PIO A;  3J80 i;  5JJL A;  4LF8 L;  3I7F A;  2BA0 A;  1Q8K A;  4A3I G;  1YHQ A;  5ELO A;  5BR8 L;  1J5E L;  4A3L G;  3IRB A;  1PHJ A;  2WB1 E;  1C9O A;  3PUX A;  2WAQ E;  3ER0 A;  1L1O B;  1OXS C;  2FXQ A;  1S40 A;  4DNI A;  4DAM A;  4JI4 Q;  3EIV A;  4GKJ Q;  1YIT A;  1XNQ L;  2AKW B;  1EUJ A;  5FLM H;  2I0Q A;  4DR6 L;  3D31 A;  4B3T L;  3GTO H;  2Z0S A;  5GAH C;  2N3S A;  1N36 Q;  1EQR A;  1A62 A;  1SE8 A;  2K52 A;  2K75 A;  1W2B A;  4UPA A;  1N34 L;  1IZ6 A;  2CKZ B;  2ZJP A;  4JBK A;  2OTJ A;  4AQY Q;  4NXM L;  1Y1W H;  5K36 G;  1YJN A;  5LMU Q;  1L1O A;  3W5O A;  1GKH A;  4IFD I;  3I4M G;  5IYC G;  1Y14 B;  2MNA A;  3UDG A;  1MJC A;  4JI0 Q;  1NBW A;  2K4K A;  3KFU A;  4IOA A;  3CPF A;  4LNQ A;  3PF4 A;  2KCT A;  1VS0 A;  1S72 A;  2JA6 H;  1PVO A;  3NEM A;  1Q82 C;  4P73 A;  4DR5 L;  5C4J H;  3S2H H;  3I2Z A;  5BR8 Q;  4A3I H;  1I94 Q;  1XTD A;  1NY4 A;  2RHQ B;  4DK6 C;  3TRE A;  1B70 B;  2JA7 G;  3CC4 A;  3S1M H;  4A3B G;  3KJP A;  3RNU A;  4A3M G;  3W1G A;  1KL9 A;  5GQO A;  2PQA A;  4Y7N H;  2B63 H;  2UXB L;  2MO0 A;  3FHW A;  4IJL A;  4JCV E;  3I4N H;  3GO5 A;  3RZD H;  1N34 Q;  2VUM H;  1PFS A;  1X3G A;  1YHA A;  4YWM A;  5LMU L;  3UE0 A;  1QZH A;  2JA9 A;  3D0F A;  4HIM A;  4DR4 L;  2UXC Q;  4H02 A;  2DUD A;  2QEX A;  4DUZ L;  2PQA B;  1SRU A;  2R7F A;  1JJC B;  2UUC L;  5HGQ A;  1BBW A;  3HKZ E;  3CXC A;  4LF6 Q;  1MIU A;  4OWT B;  4HJ5 A;  4A76 A;  1I94 L;  2HQL A;  4A3C H;  3HOV H;  1X65 A;  3PUV A;  2R93 G;  2JK8 A;  5C3E G;  4DV3 L;  1PA6 A;  1ASZ A;  1OXX K;  1NMG A;  3K81 C;  3CAM A;  2A8V A;  2JA8 H;  1IXR A;  5JEA G;  2HHH L;  1P8L A;  1C7Y A;  2UXB Q;  1N33 L;  1N9W A;  3CCS A;  4DV6 Q;  4HIO A;  4KHP L;  1A63 A;  5JJK A;  3HOX H;  2DGY A;  1VQB A;  4TQU S;  1X3E A;  1HNX L;  5M5Y H;  1VQ5 A;  2D62 A;  4KLK A;  1K0R A;  3B6Y A;  3FKI H;  3BU2 A;  2E5L Q;  3GTQ H;  4OWW B;  1VQC A;  2L15 A;  5IT9 c;  2CCZ A;  3HOY G;  3FP9 A;  4A3M H;  1DGS A;  2Q2I A;  5GAG C;  1WCM H;  4DUZ Q;  4B3S Q;  2IY5 B;  4A93 H;  4A3E G;  4A3J H;  4AYB E;  2I5M X;  2R92 H;  4QL5 A;  2CFM A;  4DV7 Q;  2XGT A;  2Z6K C;  4TVA B;  4JI5 Q;  1G29 1;  1R9T H;  3WWV A;  5JJI A;  5C0X I;  4LF4 Q;  1IYJ B;  4GN3 B;  2K5N A;  1Q7Y C;  3ZJY C;  4IPH A;  1A8V A;  1BKB A;  1LTL A;  3S17 H;  3T1Y L;  3UDI A;  1CKM A;  4EX5 A;  1GO3 E;  3G71 A;  4JI7 L;  1B8A A;  2NN6 G;  5IYD G;  3TQY A;  1L2F A;  4C3J H;  2HHH Q;  5DLQ E;  1UE7 A;  1XPU A;  4GKK L;  3K0X A;  1N33 Q;  4KHP Q;  4MNO A;  4DPG A;  2UU9 L;  1JJG A;  3TRZ A;  2HIV A;  3NEL A;  4IOC A;  5C44 G;  4A3D G;  1XMO L;  2E5L L;  4QGU A;  1IBM Q;  2NVX H;  1Q1E A;  1HJP A;  3L7Z C;  5C4X G;  1TWH H;  1HNZ L;  1D8L A;  4JOI C;  1FJG Q;  4DV0 L;  5IYD H;  4OWX B;  1CKN B;  3AFP A;  3KDF B;  2LXK A;  1AH9 A;  1SFO H;  1UE5 A;  2AMC B;  1UE6 A;  1AE3 A;  3GD7 A;  1NMF A;  1FL0 A;  4DV7 L;  3KLW A;  4LWC A;  3M4Q A;  3J81 c;  1KRT A;  3CME A;  4HID A;  2ES2 A;  2ZJQ A;  2JQO A;  2OQ0 A;  4DV5 Q;  2JA5 G;  2EQS A;  3PGZ A;  1G6P A;  4OO1 G;  4JI8 L;  3T1Y Q;  5C0X J;  1KC8 C;  1N32 L;  3K80 C;  4JI7 Q;  4YHH Q;  1E1O A;  3NBH B;  4A3G G;  4EQ5 A;  4IFD J;  3MXN B;  2VQF L;  1KXL A;  4HIK A;  2NVQ H;  3J80 c;  2ZJR A;  3AFQ A;  2B29 A;  3ULJ A;  5EAY A;  4BBS H;  1Q12 A;  2JA7 H;  2R7Z G;  4DR3 L;  1U0L A;  4JOI A;  4GN5 A;  5C4X H;  4X62 L;  4A75 A;  4JBJ A;  1S3O A;  2ZTE A;  1UWV A;  1OXU A;  4LUV A;  4QJF A;  4YY3 L;  4UY8 C;  2QGQ A;  3CD6 A;  2NZO A;  4NXN L;  3RLF A;  4GOP A;  1YZ6 A;  2YTY A;  4LF7 L;  3HOV G;  1KD1 C;  3HOZ H;  1VQE A;  3PSI A;  4JV5 L;  3PUW A;  4DV5 L;  1QZG A;  2IHF A;  5IYB G;  4X64 Q;  2N78 A;  5IYC H;  1XNR L;  1X3F A;  3PO3 G;  1QVC A;  1JE5 A;  1X56 A;  4C3H H;  4YHH L;  3CF5 A;  4IJH A;  2E2J H;  3H15 A;  2ZTD A;  1RIP A;  2VQF Q;  4DV2 Q;  1JT8 A;  4WJ4 A;  2KBN A;  1VQD A;  4JYA L;  4L5Q A;  2PI2 E;  2YV5 A;  2JA5 H;  3NEN A;  5C3E H;  2QA4 A;  4IPC A;  1SN8 A;  4DV4 L;  1VQN A;  4DR3 Q;  1YJW A;  3CCR A;  4A3G H;  5IP7 H;  4UP9 A;  1CKN A;  3KDF A;  1E3P A;  4X65 L;  2YU9 H;  3CCE A;  4YY3 Q;  1ASY A;  2VZA A;  1K8A C;  3JC6 6;  5E7N A;  4GOP C;  3A5Z B;  1SRO A;  4GN4 B;  1T9H A;  2F52 A;  3T1H Q;  2CQO A;  4BBS G;  3CC7 A;  1YEZ A;  3HKZ G;  3A5U A;  4DR2 L;  1MJE A;  5HY6 A;  1HR0 L;  1IBL L;  1I50 H;  1VQO A;  3GTK H;  4YCV A;  1CSQ A;  1JMC A;  2VQE L;  4LF9 Q;  1PH6 A;  3I4N G;  4ME3 A;  1TWC H;  3SGI A;  1JJ2 A;  4K0K Q;  2UXD L;  1QUQ A;  3GTG H;  2RHS B;  2K5H A;  1YBY A;  1BBU A;  1SR3 A;  3J7A 5;  3E9I A;  4JI3 L;  4LW1 A;  2CWP A;  3J81 i;  3OYY A;  3GTL H;  4BY7 H;  4A4I A;  3H0G G;  3PO2 G;  5M5W H;  4A3F H;  1EWI A;  4X65 Q;  3CC2 A;  4R4O A;  4JI1 Q;  4GNX C;  5IWA L;  4LF8 Q;  4B3M Q;  2VUM G;  4R4Q A;  5J3B A;  4GOP B;  1WOC A;  1J5E Q;  4A3C G;  4LUZ A;  4A3L H;  4P74 A;  3T1H L;  2KHI A;  4BA2 I;  1EQQ A;  5LMN Q;  2OTL A;  4IPD A;  3HOW G;  4JI4 L;  2BA1 A;  3LGJ A;  2I5H A;  2VW9 A;  1XJV A;  3PUZ A;  3STB D;  1PH1 A;  5M3F H;  2GN5 A;  3U50 C;  4DR6 Q;  2VQE Q;  1Q46 A;  5GAE C;  1OXV A;  1N36 L;  4IO9 A;  1PH7 A;  3FKI G;  2IX0 A;  4AQY L;  4NXM Q;  2VNU D;  4B3R L;  1AE2 A;  4IPG A;  1PYB A;  4UP8 A;  1N8R C;  4BXX H;  2D0P A;  3S15 H;  3VDY A;  4NB3 A;  2ATW A;  4LFC L;  4A3F G;  1LYL A;  3UDX A;  3RN2 A;  2ASB A;  5AJ3 Q;  4UP7 A;  5IWA Q;  2D0O A;  4DR5 Q;  3K8A A;  1B7Y B;  4B3M L;  1KIX A;  1VQ4 A;  1X9N A;  3ULP A;  3M9B A;  4DR7 Q;  3AEV A;  3G6E A;  1NTG A;  1WJJ A;  3KYH C;  5IE8 A;  2RCN A;  5IYB H;  4YCU A;  1EIF A;  1X54 A;  1YHB A;  1G51 A;  2NVY H;  3K7U C;  2Q2T A;  1E7Z A;  3S2D H;  3H0G H;  4OO1 I;  3K7A H;  1VQA A;  3RR5 A;  2B63 G;  2K14 A;  3S1N H;  1VQL A;  1QUQ B;  3HKS A;  1EOV A;  1LM0 A;  3UDF A;  2E2I H;  4OX9 Q;  2KCM A;  1SLJ A;  4A3K H;  2E2H H;  2EIF A;  1Q1B A;  1YNX A;  3U4V A;  4BA1 I;  3MEF A;  4BXX G;  2UXC L;  3I56 A;  4WJ3 M;  4YWK A;  1TWA H;  4LFC Q;  1PH4 A;  2K50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...