3HOXG

Complete rna polymerase ii elongation complex v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoxG01
1C9OA 4DNIA 2BA1A 4LFBL 4DR6Q 4LUVA 1TWHH 1B7YB 2VY3A 4IPGA 3PO3H 1JJCB 3E9IA 3J80i 4X62Q 5C44H 4GNXB 4JOIC 2K5NA 5GAEC 3K81C 1IBKQ 3PUYA 4BBRH 3GTKH 2KHJA 1X3EA 4LFAL 3KDFA 3CXCA 2NVQH 1NY4A 2Q2TA 4BBRG 1Z47A 3HOUG 4YHHL 5H1SE 3I4NG 4IOAA 4NXMQ 1HH2P 1E22A 1QVGA 4UP7A 4GN3B 3UE0A 2D0PA 2N3SA 1IYJB 2E8GA 3S1NH 4JV5Q 1YHQA 4HJAA 2UUAL 1SLJA 4GLXA 1UE5A 3H3VI 2VL6A 1SRUA 1XMQL 4DR5Q 1VQJA 4LF8L 3CP0A 1IBMQ 2NZHA 4C3IH 1DGSA 1YJWA 3G6EA 2VZAA 4C3HH 3BZCA 5AJ3L 1N34L 1XNRL 3RLOA 2QGQA 1A0IA 1V9PA 3A0JA 3BU2A 1RL2A 4YWKA 5FLMH 1PH5A 4L5SA 3ICEA 3S2DH 1OXVA 4OX9L 1GM5A 4EX5A 2HIXA 1Q46A 3A5ZB 3I2ZA 5LMNW 1PV4A 1E24A 1WFQA 3PUXA 3J81c 1S3OA 3PUVA 4QIWE 2RHQB 1CKNB 4DV6L 3TRZA 1YBYA 4AH6A 1AE3A 1O7IA 2NN6I 2VUMG 3HOXG 1YHAA 2Z6KA 4LFBQ 3H15A 4IFDJ 3UDFA 4DKAC 3G48A 1I94L 1WI5A 2MNAA 3CC7A 4EQ5A 4HIMA 1QZGA 4DV4L 4P72A 3TEHB 4YY3L 2I5MX 4LF9Q 1FGUA 4JI0L 1EIFA 1ASZA 2CQOA 2UUBQ 3TQYA 2UXBL 1KAWA 1CKOA 3D0FA 5EAYA 4JI1L 3CAMA 4IPCA 2HHHL 1CSQA 2VUMH 3CCMA 4BXXH 1VQEA 4DV1Q 3WWVA 2LXJA 2H5XA 1KXLA 2I5LX 3JAMc 3CCUA 2JA8H 1V43A 4PMWA 4DR4L 3F2DA 1VS0A 2OCEA 4LFCL 1N36Q 3S2HH 5LMNL 3U4ZA 3UE1A 4QQBX 1VQGA 4BY1G 2JE6I 3E9HA 2Z0SA 2UXCQ 2KBNA 1TXYA 3M4PA 1C7YA 4A3LG 5M5XH 1WJJA 4BA1I 1VQAA 5ELOA 4MNOA 4IFDI 4UY8C 2EXDA 4B3RL 1P16A 4J15A 2IX0A 4A3EH 1X9NA 5FLXc 4JI7Q 4GS3A 1PH9A 4DV5L 1G51A 4A93H 2YTYA 3TREA 4X62L 1J6QA 2GVBA 1W3SA 2F52A 2OQKA 1X3GA 3J81i 3CCSA 1OXSC 1VQOA 1N32L 1FJGL 2ID0A 4GNXC 4JI3L 1IBKL 2UUCL 2JK8A 5IP7G 3S17H 1HZAA 4LFAQ 1E7ZA 1GKHA 1SMXA 1Z9FA 2NVXH 4LF4L 3PO2H 2LSSA 5ELNA 4JI2L 4JI0Q 1CUKA 1Q81C 1J5EL 1X6OA 4HIOA 4QY7A 3KF6B 4OWTB 1XPOA 4LF6Q 3DLLA 1TWCH 4KHZA 3D31A 3PUZA 4A3IG 1K8AC 1X56A 1KRTA 1JB7A 4A3DH 4LF5Q 1WCMG 4BY7G 5LMUL 1UWVA 3HOZG 2MO0A 4AQYQ 3GTGH 2R92H 2R6GA 4POFA 1Y1VH 2WAQE 4DK6C 1V1QA 3ULLA 3GTJH 3EN2A 3CPFA 3NEMA 2B3GA 4P73A 1M90C 2UXCL 5AJ3Q 1N34Q 2ZM6Q 4DR1L 2Q2UA 2ZTCA 3Q8DA 5JJKA 3HKZG 3NELA 3H0GG 2HIVA 4DV3L 3PCOB 3I4MG 3M85A 1K83H 2OQ0A 3HOZH 4GKJQ 3CCQA 3EIVA 1CKNA 4HIDA 4JI5L 3M4QA 4GOPA 4X66L 4JI7L 1JMCA 5C4XG 4LNQA 3PV0A 3GD7A 3CCEA 1NJIC 3ZJYC 4DV7Q 1SE8A 2KHIA 1A62A 3PIPA 4DV2Q 4A3CG 2JA7H 4DUYQ 2ATWA 1EIYB 1SROA 5JEAG 1N32Q 3I4NH 1XNQL 1QVCA 1BBUA 1B70B 2GVAA 3J7ZC 4A76A 1VQNA 3M4OH 4A93G 1BVSA 5JJIA 1OXTA 2UXBQ 2ASBA 4LUZA 2B63H 1E1OA 1HNWQ 1A8VA 4O0AA 2A1AA 1U0LA 3OTOQ 4A3CH 4L5RC 1NBWA 5IYBH 3KYHC 4DR4Q 3L0OA 2R93G 2C35B 1VQLA 4BY1H 4LF5L 4A4IA 4LF7L 4AQYL 5M3FH 3S16H 2R93H 2VS1A 3K7UC 2F4VQ 2NVYH 4LWCA 5GADC 1M1KC 1K8GA 4JI4L 1D8LA 2Y0SG 4APVA 2OTLA 5IP9G 4NXNQ 5BR8Q 2WFWA 4P71A 2R7DA 3PF5A 3RR5A 3H0GH 1KD1C 4X65Q 5DLQE 2ZJRA 1A63A 4R4OA 2B63G 4K0KQ 4DAYB 1Q1BA 3AQQA 3KF8B 4IJLA 5C0XI 2UU9L 4B3SL 3ER0A 4JI8L 4A3EG 1QUQB 4JCVE 3HOYG 4BBSG 1W2BA 2K4KA 4FDBA 2R7FA 4IO9A 3CCLA 2CWPA 1OXUA 4PZ8A 4OWWB 4KLKA 5C4XH 1UE7A 3UDIA 1YVCA 2K52A 2YYZA 5IYCG 5HGQA 1VQFA 1VQMA 5M5WH 5IT9c 4YWLA 4A3LH 3LGJA 1IBLL 5IYDH 2PI2E 4GNXA 1PVOA 1LTLA 4TVAB 4AYBG 1L1OC 4DV0Q 2R7ZG 3HOYH 2I0QA 4BBSH 3CD6A 1HNWL 1Q1EA 5IE8A 2WB1E 3JC66 1YJ9A 2HT1A 3AYHB 1IXRA 1Q12A 2KCTA 1GD7A 1VQ7A 2E5LL 3T1HQ 3CC2A 3PF4A 3GTMH 3L7ZC 2MQHA 3E0EA 1JJ2A 2UUAQ 1GVPA 3CCRA 3M3YH 1AH9A 5C3EH 1XMQQ 2R92G 3KLWA 4L5TA 4ALPA 3PGZA 1C0AA 3CQZH 1FVIA 5M3FG 2VQFQ 5C0XG 3F2CA 2JJQA 2N78A 4R4QA 1PH4A 1JJGA 3FP9A 1K73C 4YWMA 3GO5A 4GOPB 3T1YQ 3HOUH 3M7NA 3STBD 2JA6G 3S15H 5GQOA 4K0KL 1JE5A 2XTIA 3RN5A 4GLAC 4JYAQ 1WYDA 2UXDL 5GAHC 2IY5B 4DV2L 4IPDA 2QEXA 1NE3A 1BKBA 4GN5A 5C0XJ 2OWOA 2AMCB 4JC0A 2KCMA 4BXXG 5C44G 1G291 2V1CC 3U50C 4DUZL 4A3JH 1HR0Q 4HJ7A 4BA2I 2ZJPA 2AWOA 4X6AH 3J80c 1MJCA 4DAMA 1PFSA 2PQAA 3STBC 1JT8A 2MFIA 2JA6H 4A3DG 2KENA 2NN6G 1S40A 3U4VA 2UUBL 1B8AA 1VQ4A 1HZCA 4JV5L 2WP8J 2R7ZH 1VQBA 2E2IH 2JQOA 1HNZQ 4QGUA 4JBKA 2RCNA 1L0WA 2MO1A 2RHSB 3OW2A 4JBMA 4LF7Q 2ES2A 1X65A 3HOWH 1RIPA 3RLFA 1S72A 3AFQA 4JBJA 4AYBE 1WOCA 5C3EG 3RZDH 1PH2A 3CPWA 3A74A 1E3PA 1SR3A 5IWAQ 1MJEA 1KC8C 3PIOA 3A5UA 1Y1WG 4B3MQ 4A3GH 4OX9Q 5IP9H 4JI6L 1EOVA 2BH8A 1VQ5A 4B3RQ 3RLNA 2N49A 3KDFB 4DV6Q 4R4TA 1X55A 2PI2A 4R4IA 1VQIA 2PMZE 2E2JH 4A3MG 1Q86C 1FL0A 1PH7A 3F2BA 2XGTA 2IX1A 2CFMA 4R4CA 2EIFA 1I5FA 4LF9L 1UEBA 4LW1A 4YHHQ 1P8LA 3PO2G 1NMGA 1H95A 1CKMA 1N9WA 2IT1A 4WJ3M 3UDXA 2YV5A 2VW9A 4DUZQ 2HQLA 2L15A 4A3JG 1PH3A 1N33L 3G4SA 1VQHA 1KQSA 3HOVG 3DM3A 2JA8G 4IOCA 4JI1Q 5FLMG 2HHHQ 1E1TA 1KL9A 1HR0W 4GKKQ 3NBHB 1Q8KA 3W1GA 4B3TL 1EWIA 3GTLH 1PYSB 1J5EQ 4DR5L 1VQKA 4GN4B 1HJPA 5LMNQ 3ULPA 3CCVA 2PNHA 1VCIA 1Y1VG 4A3FH 4A3KG 4OONA 2K14A 5M3MG 2ZTEA 1XJVA 4NB3A 4PZ6A 1K0RA 4RMFA 3KF6A 4YCWA 4OWXB 1K9MC 5LMUQ 2NZOA 3KJPA 2BA0A 4A3MH 1VQPA 3CCJA 5IYDG 2AWNA 4DR7L 3HKSA 4DK3C 4DR2Q 4KHPQ 4WJ4A 2VQFL 5IP7H 3FKIG 3F1ZA 3S14H 4IJHA 5IWAL 3GTQH 4B3ML 2K5VA 3GDEA 1I94Q 1XTDA 4OO1I 3T1YL 1UE6A 3I4OA 4JI6Q 3I55A 3CMEA 4DV4Q 4IFDG 2CWAA 4YY3Q 1VQDA 1YI2A 5IY0A 4JYAL 1FJGQ 3S24A 4JI5Q 2FXQA 4MTNA 2YTVA 3NENA 1WCMH 3HKZE 3CW2C 4DV7L 5GAGC 1I6HH 3OYYA 3CMAA 2AKWB 3CF5A 4PZ7A 3K8AA 4DV1L 1U5KA 1L1OB 2ALYB 4GLVB 2JEBI 1HZ9A 4OXPA 4JI2Q 1IZ6A 3K80C 4HJ9A 3HFZB 4LFCQ 3GTPH 4LF6L 1X54A 3SGIA 3RN2A 2B29A 3S1RH 5JEAJ 1Y1WH 1HNZL 2BH2A 4A3GG 3UDGA 4RG1A 5FJ8H 1XMOQ 2GN5A 2YU9H 3RZOH 4ME3A 4HJ5A 3K0XA 2A19A 2JA9A 3JAMi 4HIKA 3MEFA 2K5HA 3S1QH 1I3QH 1YZ6A 3TS2A 4DV3Q 4DR3L 4C3JH 4QL5A 1SN8A 2YTXA 2CCZA 4POGA 4DR7Q 4GKJL 4X64L 2E2HH 4BY7H 1TWFH 4DR2L 4DV5Q 4DPGA 1IL2A 4KHPL 1L2FA 3FHWA 4OO1G 3PO3G 4NXNL 1YNXA 1HNXL 2CKZB 1PH8A 2JEAI 1KHIA 1OXXK 2VQEL 3MXNB 4P75A 3TS0A 2F3IA 1SFOH 4JG2A 4X65L 3B6YA 2JA5H 4X66Q 2UUCQ 4JI3Q 4LF4Q 4R1JA 4H02A 4QJFA 1Q7YC 1XNQQ 5J3BA 2UU9Q 4PG3A 4UP9A 4B3SQ 2WAQG 1YHBA 1YIJA 4UP8A 1N33Q 2NVTH 4GOPC 2IHEA 1EQQA 1QUQA 1Q82C 1YJNA 4KI0A 1PH6A 2A8VA 1VQ6A 2K75A 3CC4A 4GKKL 4XTCS 2Q2IA 4B3TQ 4A3BG 1VQCA 3BJUA 4A3IH 1N8RC 3K7AH 1EFWA 4HJ8A 1QVFA 4MZ9A 1NTGA 3I7FA 4IPHA 2ZM6L 4DR1Q 4LF8Q 1K3RA 2F4VL 3HOXH 3PSIA 1KIXA 2ZJQA 2Y0SE 1PHJA 4LUOA 2K50A 5HY6A 1XNRQ 5M3MH 2AHOB 5C4JH 3T1HL 4NPSA 1Y14B 1GO3E 3ERSX 3VDYA 3F8TA 5M5YH 1XPRA 4DR3Q 1LM0A 2VNUD 1LYLA 5IYBG 1TWAH 5BR8L 4X64Q 5JJLA 4DR6L 3HOVH 3KJOA 3KOJA 1VQ8A 4DUYL 1T9HA 1HNXQ 3S1MH 3I56A 1XPUA 2VQEQ 1KRSA 4TQUS 4Y7NH 4YCVA 4JI8Q 3AEVA 1X3FA 3ULJA 5E7NA 5GROA 1R9TH 1ASYA 1CSPA 2N8NA 3H3VH 2Z6KC 1YEZA 2I5HA 4JOIA 3W1BA 2JA7G 4P74A 2UXDQ 2JA5G 1IBLQ 1NMFA 2IHFA 5K36G 1UE1A 4XIGS 1L1OA 4NXML 2OTJA 4Y52H 3OTOL 2Q2HA 2RF4A 2WB1G 3BZKA 3W5OA 5IYCH 1HR0L 4A75A 4AIMA 1PA6A 1EYGA 1LUZA 2D62A 4UPAA 4A3FG 4A3KH 3J7A5 4DV0L 3AFPA 1TWGH 2D0OA 4A3BH 1EQRA 3L2PA 1OTCA 4C2MH 1PYBA 3G71A 3U58A 1N36L 2PQAB 1XMOL 1IBML 3PUWA 4JI4Q 2ZTDA 3HOWG 1VQ9A 3GTOH 2QA4A 2E5LQ 4O2DA 3IRBA 1HZBA 5FJ8G 1YITA 1AE2A 3KFUA 3RNUA 3FKIH 4L5QA 1PH1A 1BBWA 1QZHA 2EQSA 1EUJA 2LXKA 1I50H 3M9BA 4YCUA 2DGYA 1D7QA 4JBWA 2DUDA 1MKHA 1MIUA 3J81j 1G6PA 3EBEA 3I4MH
chains in the Genus database with same CATH superfamily
2MHVA 1H9SB 1TWHH 5C5LA 4X62Q 1I3QB 4JOIC 1G2TA 3PUYA 4BBRH 2B2YC 2CW0D 1TA8A 2H1EA 2XN9C 2NVQH 4DK0A 2Q2TA 2FMMA 2NVXA 5KG6A 4EBEA 4J8QA 2JA5B 1I50A 1TWFB 4IHJF 4PDBA 2NBFA 1AW7A 4JV5Q 3V2TA 2UUAL 4GLXA 3IAYA 1D5XC 1EZ6A 4OX9H 3RBEA 4LF8L 5CC4A 5KT4A 3VYRA 3D3RA 3RZDB 2A69D 1N34L 1XNRL 3MJFA 3RLOA 3U9SA 1K3BC 1M6VA 4L5SA 1B04A 1IYVA 1F9RA 3J81W 1OXVA 4EX5A 4QWBA 1PV4A 3S2DB 1WFQA 5CV7A 4DV6L 4ECQA 1O7IA 1U4PA 2NN6I 2YYAA 1KJ9A 5BR8H 4ECSA 2HVSA 2F3VA 5KFSA 4DKAC 1U4LA 4UAIA 4X65H 4EQ5A 1EUCB 3KLSA 4DV4L 3BG3A 4P72A 1GGOA 1ULZA 3KLSX 5ELDA 5KG7A 4EYIB 2WTFA 1ASZA 4RAZA 2JA7A 1S68A 3TQYA 2W6ZA 1CKOA 3E0JA 4IPCA 1CSQA 2B2VC 4RGMA 4HSVA 3CCMA 4DV1Q 3OMGA 1DV1A 2BCOA 3I91A 3T4AC 2F0MA 4DR4L 3H40A 4LFCL 3S2HH 2W7OA 1N36Q 2QDLA 3P75A 3RFCA 4DUZH 4KK7A 4UFZA 1RJRA 2KBNA 2OXPA 4JUZA 3P20A 5FD5A 1Z2PX 1WJJA 2KCCA 2PNRC 4BA1I 2KEEA 1V1OA 4I7AA 2EXDA 4K8JA 5BN4A 1BUVT 2IX0A 1Y1WA 5EWGA 1QE6A 2I07B 1PH9A 3A8JE 3TREA 5C3EB 2GVBA 3CCSA 4LFCH 1I6HB 2CHBD 1IBKL 5DQGA 3S17H 2ENBA 4LFAQ 3NGDA 4LMYA 3KTMA 4JI2L 1SEBD 2L11A 1CUKA 1X6OA 4F7XA 1PRTB 1K8MA 2NU6B 3DLLA 1FKAH 1JB3A 3D31A 4MA0A 1I50B 1KRTA 4O42A 1SNOA 3HOZG 2MO0A 5D1OB 3GIJA 1GJXA 3RV3A 1Y1VH 2WAQE 3CPFA 2JEGA 2H4OA 2RQXA 1EZ1A 5AJ3Q 2ZM6Q 5JJKA 3HKZG 4LAAA 4L1KA 4YJ2F 3QZ7A 4N8FA 4FBTA 3NELA 2G9DA 2R7MA 5KFFA 2HIVA 5EBDA 4DV3L 2UU9H 3FKIA 2LFNA 2OQ0A 2FK1A 2B2UC 2MUYA 4HIDA 4V0BA 1MSGA 4JI5L 4GOPA 3QO2A 5IT9L 1JMCA 1H9KA 4JI7L 5AFWA 3J7AV 3ZJYC 1QJOA 4C3HB 1A62A 1VAJA 4DV5H 3OPOA 2A6EC 3CVZA 4DL7A 1B70B 2K04A 5JJIA 1RHPA 1VQNA 3Q2OA 1EY7A 4A3GB 2B2WC 2UXBQ 2CW8A 3Q8QB 4O1NA 4LUZA 2B63H 2N55A 2PYKA 4O0AA 1WTWA 2A1AA 2K5QA 2M2LA 1BF4A 3OHBA 1X32A 2V4QA 2R93G 1QILA 1SMYD 2K33A 2SEBD 4DAPA 3OWEB 4YAJB 4A4IA 2DZDA 2E2DC 2F0VA 2VS1A 3LMLA 5KFHA 2XGQA 1T5XD 4LWCA 2DY7A 4R9WA 4JI4L 3TMEA 1D8LA 2F1MA 4XXEA 2OTLA 5IP9G 1MD2D 3RR5A 4EGQA 3VR2A 3GIQA 1WTHA 2M00A 1KD1C 5DLQE 2ZJRA 4OIJA 1A63A 4FXGC 4K0KQ 3AQQA 1S5FD 3KF8B 1DIKA 2UU9L 4ECZA 4O3RA 4MA5A 2AQ2B 1W2BA 4JW0A 3G6XA 3KLRA 4FP5D 4IO9A 4DR3H 2CWPA 1OXUA 4OWWB 3OHAA 5C4XH 2B2VA 5LHY1 5IYCG 1VQFA 4ZUJA 5IT9c 5KFNA 3ORQA 2YRWA 4JV0A 3K5HA 1IBLL 5IYDH 1DOMA 2RDFA 2HVQA 2XNAC 2NB0A 2R7ZG 2F0WA 4O4IF 1PTOD 3KBGA 1Q1EA 5IE8A 4ECWA 3JC66 1YJ9A 1AFPA 1TR5A 2PCFB 3MWMA 1IXRA 3KUPA 1GD7A 1VQ7A 3KHRA 3NE5B 2PVPA 4OGQC 2Z6BA 2RDJA 3BVMA 5IGGA 3M3YH 4G7OC 3CCRA 1AH9A 2F0DA 5C3EH 4DR6H 4NLGA 3GIDA 1A3VA 2GPWA 3NWSA 1KJ8A 4RZRA 3TIIA 1NR2A 1TWCB 1FVIA 3S17B 2I87A 2VQFQ 4JPBW 1E2VA 1PH4A 1WD1A 3T5JA 1Q3LA 3RB0A 3T1YQ 2W9CA 2JA6G 4K0KL 5GQOA 1JE5A 2D5DA 2IW3A 3RN5A 1N48A 5JVLA 2DLNA 4K2KA 2AMCB 4JC0A 2IBKA 1EYZA 1ZHQA 4HJ7A 1I4GA 3HOZB 3NTIA 4X6AH 3C0FB 3FMCA 5LYJF 2PQAA 3STBC 1JT8A 1IBMH 4A3DG 2KENA 1VBHA 2HCCA 1STGA 4Q5VA 2R7ZH 1VQBA 1IBKH 1F77A 2O5IC 2WE6A 3HP3A 3RUZA 1HNZQ 3A54A 4J6HA 5JJZA 4QIWB 3Q8RB 3S1NB 5CV6A 1JX4A 5T14A 4B08A 1SJED 3AFQA 4JBJA 2KSWA 1FNUA 3T16A 5C3EG 2R8GA 3CPWA 3A74A 3I90A 1I3QA 5E1FA 2CW7A 1KC8C 4A3GH 4ABNA 4IR9A 3H09A 5IP9H 1EOVA 4GC6A 4ZQIA 2R8KA 4B3RQ 4UCOA 2N49A 4DV6Q 3S16B 2HGSA 4R4TA 2PI2A 5C5JA 2DNEA 2JEFA 2EYOA 2VB3X 2R7ZA 4A3MG 1CI3M 2B8GA 1FL0A 1PH7A 1BXTA 2CFMA 5DG9A 4LW1A 2KJXA 4G7HC 4HNVA 1M4VA 3PO2G 3RF2A 4IAJA 2YZMA 1TWAB 1HUMA 3JRWA 1A9XA 3MVVA 1HQRD 3G4SA 2RVLA 1G6ZA 3DM3A 4JV1A 2O2LD 3HB9A 4Q8EA 3W1GA 4B3TL 1GSHA 1S0MA 5I4DA 4DR5L 2FPIB 1HJPA 5LMNQ 2K03A 1EOTA 1EQVA 3PIP3 5JQWA 4PZ6A 3N43B 2A6HC 4ILWA 4OWXB 3RMHA 1K9MC 2K7VA 5LMUQ 1VQPA 5IYDG 2AWNA 1LTAD 1WSCA 4BBSB 4EQNA 2J6SA 2E5LH 3S14H 3SVMA 4IJHA 3GIMA 1JOOA 4C2MB 2UXCH 3RB4A 2K5VA 1B33N 3I4OA 5LP6F 4IFDG 3I72A 2YS7A 5D1PA 1VQDA 1FJGQ 4DK1A 2A6ED 1EHIA 4K5XA 1GUWA 5GAGC 2C00A 1I4RA 2AKWB 2ICEC 1TS2A 4GLVB 3EROA 4LK1C 1LTBD 3GTPH 1ET6A 2F0SA 3RN2A 2FMCA 2YZGA 2FHTA 3S1RH 4A3GG 3D4WA 3BDCA 4PMCA 4NP5A 4RG1A 3R23A 4HJ5A 2ZXPA 4RGNA 3J81L 2FPPB 5KG5A 1Y1WB 3T5KA 3PO3B 4RNMA 2K5HA 4FF4A 3V96A 2Z4IA 1SYCA 2B63A 2DJFC 2JA6B 3TS2A 4UCTA 4TSSA 4OIKA 4FF2A 4POGA 2NUCA 3BDOA 4DV2H 4LF5H 4GKJL 4O3SA 3LNNA 4C5BA 2L4NA 3H3VC 4IZ8A 2PPBC 1EYCA 5EPJA 1Q8IA 2K5WA 1OXXK 4P75A 2F3IA 1SFOH 2UUCQ 4XYQA 1DOLA 3B6YA 4KHVA 4X66Q 4JI3Q 3SR1A 2R7ZB 2BQ3A 2UVUA 4R1JA 5DEHA 5D8DA 1GSAA 2VOBA 2EXZA 4XYLB 1TWAA 3KBXA 1KC7A 1ENAA 1YIJA 5D1OA 1Q82C 3KHGA 4ED0A 1QUQA 2ICIA 1VQ6A 2A8VA 3RIZA 1SNMA 2F0QA 2VXWA 3KHLA 2A73B 2JXMB 4GKKL 2WAQA 1SCUB 1K83A 1VQCA 3BJUA 3K7AH 4MZ9A 4XT1B 1SNQA 1HTPA 5J2UF 2F4VL 3HOXH 1KIXA 1PFNA 1HTLD 2NU9B 1PHJA 1HNWH 4B3MH 5HY6A 3T1HL 5C4JH 4M9UA 4NPSA 5F9LA 3VDYA 2FJ2A 3F8TA 1I7NA 5M5YH 2C2DA 3Q8SB 2M9VA 5LOVF 4E4TA 1LYLA 1K0SA 4DR4H 1TWAH 5KFXA 4C2MA 3VR3A 5DLFA 3HOVH 1EYAA 5NUCA 4APMA 1S10A 2EDGA 3QZ8A 1VQ8A 3SDZA 1HNXQ 5HBRB 3I56A 1KLUD 1KABA 2JA8B 4YCVA 5KFTA 5M5WB 1X3FA 1R9TH 5GROA 5CV9A 2N8NA 3SK4A 2Z6KC 3I4LA 1NMFA 3A55A 5DGAA 4A3KB 4JVZA 2RF4A 3GV3A 1HR0L 4A75A 1PA6A 1EYGA 3H20A 2D62A 4LFAH 4YR3A 3GTOB 5L1IA 1EQRA 4DN4M 5L9XA 3G6YA 4C2MH 4DL6A 3A8KE 1XMOL 2R8JA 1ONLA 3RGZA 5CBAE 4XQNA 1DJRD 2JA6A 1PH1A 2EY1A 1YNJC 4JYAH 2OEOA 1QZHA 4KKSA 5IT9W 3EVQA 4Q43A 2DGYA 3A56A 2DUDA 1UNSA 3CRLC 2FP4B 3T1HH 2B2TC 2K6AA 1RYRA 3EBEA 5KFRA 3SK5A 3HKZB 4LUVA 1B7YB 4ZYSA 3J80i 5C44H 5KT6A 3K81C 3TQTA 4HAEA 4L6TB 3GV8B 3E6ZX 4PV1C 1JOKA 1X3EA 2W9BA 1SBBB 5CORA 2E2HB 3TQ1A 3BQ2A 5JPMC 3KDFA 3CXCA 1EY5A 3VR5A 5DM73 1V51A 2WIIB 1S0NA 4BBRG 4CHTB 2IA6A 4J9KA 5GONF 3NP8A 2V58A 1O7LA 1ZEQX 1HH2P 2VB2X 4QWCA 3PW2A 4GN3B 5C0XH 2N3SA 1JWSD 1S03G 3BQ0A 1YHQA 1TWCA 1HR0H 1SLJA 3GP7A 3ZYYX 1HFGA 1UE5A 1SRUA 1XMQL 4RKBA 2RDIA 3RAXA 3CP0A 4IN3A 2NZHA 4C3IH 1YJWA 3BZCA 2FJZA 2AGQA 5KFLA 3BU2A 1PH5A 2L0CA 4OX9L 3J81c 4QIWE 5EPKA 1BCPB 3F8NA 3NHHA 1DYQA 2VUMG 2NU7B 2FK3A 2BE5D 1H9MA 3OOCA 3I12A 1YHAA 2Z6KA 4IFDJ 3G48A 1I94L 1WI5A 2MNAA 1DV2A 1HQMC 3RBDA 1BGWA 3X3MA 1DZ1A 4YY3L 1IOWA 3R5HA 3DWPA 5KT2A 2I5MX 1C48A 1SYBA 4CDEC 1FYCA 1FGUA 1ILPA 3Q8PB 2UXBL 4JI1L 2HHHL 5KFIA 3K6OA 3JAMW 1EL0A 5M5YB 1VQEA 1K1SA 2LXJA 2H5XA 5JAVA 3GTOA 3ND9A 4U68A 3VA7A 3F2DA 2O4XA 3U4ZA 3UE1A 4QQBX 4ECVA 1VQGA 1JKJB 4QUCA 5DQHA 1NCVA 3M4PA 4JI6H 4YY3H 2BQRA 1F2YA 1VQAA 4EBCA 4IFDI 3PW5A 2BOSA 1TWGB 4J9NA 4J15A 2ZT9C 4A3EH 3Q24A 1U4MA 4JI7Q 2I8CA 3GTJA 2XD4A 3HEJA 4P2CB 5CMDA 1JC7A 4E6IA 4A93H 2BDNA 5BN3A 3JAML 2YTYA 1B6SA 3J81i 1J6QA 3GTOH 1W3SA 1X3GA 5JEAH 1N32L 1FJGL 2ID0A 2MCTA 3PN1A 3T1YH 1HZAA 4KMUC 1EY6A 4HNUA 4ECRA 1E7ZA 1GKHA 1SMXA 1Z9FA 2G9HD 5EPLA 1KDBA 2ZDGA 3LWEA 1S5CD 2KQ3A 4EGVA 1Q81C 1J5EL 4HIOA 3IL8A 1C30A 4QY7A 2E2IA 1XPOA 4LF6Q 3BVGA 4ZCKA 4KHZA 1K8OA 2K1BA 4F4WA 3MFYA 1GOZA 5CV5A 3K0YA 1SEIA 3P1HA 1UWVA 2J6UA 1E4GT 2R6GA 2CQYA 3HRZC 3GTJH 1Q86C 3EN2A 4P73A 3NEMA 2B3GA 5D3IB 4ED8A 1QNUA 1TT2A 2RKSA 2F0HA 2AQ1B 3URYA 3IKJA 3NSWA 4ME5A 1CK1A 1K83H 1BDOA 2EZVA 1CKNA 1JWUD 3EIVA 3QWNA 4ZLTF 5C4XG 2PW5A 1CS0A 4Q45A 2W70A 2KHIA 5DM63 4IUNA 1TS3A 3PIPA 4A3CG 2RSOA 4DUYQ 1IKMA 2ALZA 4DR7H 3N6XA 1SROA 5JEAG 1N32Q 4DV6H 1PFMA 2GVAA 4MV4A 3G6JB 5C6AA 2EYMA 3G8CA 1WVLA 5C3XA 4HEDA 4UCRA 3UFXB 1MI2A 4I50F 4DR5H 1U0LA 1S4ZA 5CV8A 4A3CH 4KY7A 1GSOA 4MV7A 2A69C 3KXYT 1NBWA 5CA1F 3HXLA 3TZDA 3KYHC 3DXJC 1PTOH 1R4QB 3N40P 1B9NA 1ZXTA 4X64H 4RGTA 5M3FH 1TAEA 2R93H 1LTSD 2FPGB 5CAEB 2F4VQ 5GADC 2VUMB 3BYTB 2Y0SG 4V190 2HQEA 4NXNQ 2VA3A 2EY2A 2WFWA 4P71A 1BNZA 4IUTA 4KN4C 1HHVA 2YW2A 5LMUH 5I6YA 5KFQA 1ZKOA 3D6CA 4FXDA 1EYDA 4ECYA 1LLRD 2JP1A 1D1IA 1ZETA 1ICFB 1LTTD 1STHA 2B2TA 4JI8L 1QUQB 4JCVE 3GTLB 2R7FA 2R7NA 5K36H 4PZ8A 3J7YW 2VPQA 4CGYB 4TV9F 1UE7A 2HUGA 1SNCA 3VR4A 1FJGH 2R93A 1A6XA 1YNJD 4A3MB 2PI2E 4CBVA 5C8YF 1LTLA 4TVAB 1B50A 4DV0Q 5LXTF 3HOYH 2I0QA 1HNWL 3NBHA 4RU9A 1XWEA 3TBIB 1Q12A 3L3OC 1JE4A 2X69A 4R8IA 2NVXB 2XIWA 3E0EA 1JJ2A 3CQZB 1VKZA 2R92G 4L5TA 1PXUA 4X62H 1C0AA 2MGSA 4WORA 3TIGA 1XX8A 5E3FA 1UNNC 3J80E 4JI4H 1K73C 2NYZD 1VF7A 2JN4A 2R92B 3GO5A 3HOUH 3M7NA 3STBD 1SJHD 4OO1H 1W6KA 1WYDA 1WTPA 2IY5B 4DV2L 4IPDA 2QEXA 4JI0H 2OWOA 1E0BA 1LT4D 5ELEA 2P0AA 3DEOA 2DPJA 1A15A 1EY0A 2KCMA 4JV5H 4BA2I 2F0NA 3QJYA 5KFWA 5FOBB 2DY8A 2ZJPA 2AWOA 2XC9A 3J80c 3EFXD 4DAMA 1PFSA 2MFIA 1SXTA 4ECXA 1X3PA 3BS1A 1S40A 1HZCA 1GXDC 1X3QA 3SE0A 3UI2A 3DF7A 2JA7B 1F2LA 4IWXA 1I6VC 4JBMA 2NZ1D 5KT5A 1TWHA 1B3AA 2ES2A 3L4JA 4Q44A 4HCSA 4KD3A 1S72A 3NTKA 4MIUA 1NR4A 2KVMA 3MR2A 1E3PA 1SNPA 2F0LA 2DPIA 3PIOA 3A5UA 4RHRA 1Y1WG 4B3MQ 1A3TA 2NVTB 4RB2C 1JR0D 1SSOA 2BH8A 2E2JB 3RLNA 2J0TD 3Q0AA 1M0WA 4F4XA 4HTHA 2TSSA 5KFAA 2F0OA 4DV1H 1ENFA 1WTVA 3F2BA 2IX1A 4R4CA 5JVG3 2MPMA 1H95A 1HNXH 1CKMA 3UDXA 2R93B 3TINA 1N33L 3QG1A 4DUZQ 2HQLA 4S3SA 3C2PA 5FO8B 3HOVG 1LO5D 1T94A 4CDDC 1G91A 4JI1Q 2HHHQ 5FKAC 1E1TA 4LFBH 1BBXC 5JUMA 3P7JA 4QW8A 4GN4B 4J9LA 3CCVA 1Y1VG 1UC9A 4A3FH 1WH2A 4X3UA 4O3OA 3H4DA 3RB3A 1XJVA 3BAAA 3H91A 4NB3A 2W6NA 4PWQA 4YCWA 3KAKA 3CQZA 4MV6A 5L37A 2BDOA 3CCJA 4CJ2C 5T1IA 4WJ4A 3MFHA 5IP7H 5IT9E 1AZPA 4Y8VB 5COYA 2WV6D 3GTKA 3GTQH 4B3ML 2R92A 2PO4A 1XTDA 3M9MB 2PZTA 3EYYA 3QB3A 3L4KA 1LTRD 4WD3A 4JYAL 2FLNA 3FMAA 3FKIB 1JLLB 2YS6A 1WCMH 4MN3A 3CW2C 4DV7L 3MWYW 4O2AF 3OYYA 3PQIA 3CF5A 1F9QA 4PZ7A 4DV1L 3H4BA 1U5KA 3BA8A 1L1OB 1J8IA 3GILA 2V4RA 2ALYB 2JEBI 1HZ9A 4JI2Q 5DLGA 1IZ6A 3K80C 3OWFA 1MBYA 4HJ9A 3S15B 3PO2B 1ICWA 3FRPB 5H80A 3V6HA 4X3KA 4LF6L 3SGIA 4FVMA 4J1MA 1D1KA 1EIGA 5FJ8H 1XMOQ 2GN5A 2YU9H 1KJQA 2F0KA 5E4XA 1TWGA 2JA9A 4HIKA 3M9NB 4BS9A 3S1QH 1I3QH 4ZKBB 2F0GA 4KV6A 4DR3L 5EQ0A 2GPSA 1IL2A 4DV5Q 1FGBD 4OO1G 2WYOA 2QYZA 4WJWA 5KNBA 4KJOA 1HNXL 2CKZB 1IHZA 2JEAI 2B8FA 1KHIA 3MXNB 2JA5H 4X65L 4LH7A 4X3TA 4YR0A 1A2UA 1PDQA 1PK8A 1L0YB 1Q7YC 2VQDA 4IZOA 1SFOB 5BPHA 4FU0A 4B3SQ 5HGTA 1CTMA 2OLSA 4G57A 5IGEA 3Q22A 1KLGD 5ELBA 5KIXA 4ZI7F 2IHEA 4ZOLF 3OSPA 1PZID 2K75A 4FF1A 3LP8A 3CC4A 2XRSD 4XTCS 5D14A 4HQ6A 4KKTA 1HUNA 1O80A 3QOJA 3SXHA 4A3IH 3MAQA 2J9GA 4LSAA 2AU0A 2ZM6L 2EPBA 1F2MA 3K7AB 4LF8Q 4K0KH 2O03A 1O7YA 1XNRQ 3KAJA 2AGPA 2R61A 1GO3E 3ERSX 1Z2OX 3OTOH 1PMRA 1TY0A 2EJGC 4DR3Q 2VNUD 4IQZA 4CKEA 3VMMA 4XYOA 5IGFA 1STNA 1LABA 3DHQA 1PZJD 3L9AX 3SK6A 3X3NA 5FLXE 3HOVB 4TQUS 3NUCA 3AEVA 2XSCA 1PTOF 4AYBB 1ASYA 3H3VH 4A3FB 1CSPA 2KCNA 4GKKH 4P74A 3FVQA 2V59A 1WTRA 2IHFA 1AUVA 4NXML 3GTPA 3OTOL 2Q2HA 3W5OA 1RDPD 2A74C 4AIMA 1RCVD 5KFJA 3H6MA 4RHSA 3RTXA 4Z9CB 4A3KH 3J7A5 4DV0L 2VUMA 3I8ZA 4WFN3 4A3BH 3L2PA 2VPSA 2VQFH 3U58A 1PYBA 1N36L 3K3VA 4EBDA 2MJ8A 4ZUIA 3BYYB 3EJIA 2Q8IB 4ODGA 4O3QA 3IRBA 3KFUA 5FJ8G 1YITA 1AE2A 3FKIH 2EOTA 4L5QA 4G7ZC 1RKNA 4EQOA 3SK8A 3C1FA 2EQSA 5TSSA 1EZ8A 2QF7A 3GQBA 3T53B 4YCUA 2ZDQA 3D6WA 2ZDHA 1MKHA 5BN5A 4G4KA 3J81j 4JI5H 3RZOB 3I4MH 1C9OA 3MZ5A 4DNIA 3MXNA 3U9TA 2VY3A 5IWAH 3E9IA 4K5VA 4GNXB 4DAVA 1ZYRD 1BNCA 2K5NA 5GAEC 1IBKQ 4XZ3B 3GTKH 4RCOA 4LFAL 2XVSA 2UVWA 4B9WA 1Z47A 3HOUG 4EFBA 4YHHL 5H1SE 3I4NG 4NXMQ 4K14A 1E22A 1QVGA 1EY8A 4UP7A 3UE0A 4C5AA 2D0PA 5FPRA 5KFBA 1IYJB 2E8GA 3OUUA 3S1NH 1DONA 4HJAA 1JDEA 3E5SA 2W6OA 5KYLA 3H3VI 3I4NB 1BOSA 4DR5Q 1VQJA 3M4OB 1DD2A 2Z9HA 3VYUA 1PX2A 2BR0A 3G6EA 4C3HH 5AJ3L 3IN5A 2DIKA 4G3IA 2F0JA 3K5OA 1B6RA 1A0IA 1V9PA 4YWKA 3ICEA 2A5HA 4C3IB 5FLMH 3HOWB 4XYMB 1MGSA 1GM5A 2HIXA 1CHQD 4DXFA 3I2ZA 1IOVA 1W96A 5LMNW 3N8DA 3GV7B 1JOQA 1U4RA 4KY5A 3PUVA 3S9WA 1XNQH 2JSOA 1YBYA 4AH6A 4X3SA 4ZKCB 1R9TA 2GLTA 5KG0A 4R7RA 3HBLA 3W2DA 3EA6A 4HIMA 1M0TA 3TEHB 3TP7A 5K2MA 1V8QA 2L1BA 4HR7B 3T5HA 2ASLA 5ISRA 2CQOA 4TQRA 2UUBQ 1KAWA 2HDMA 5EAYA 1IKLA 2FB9A 3CAMA 3SE7A 1KDCA 4BXXH 3WWVA 2SOBA 4A2AA 4U673 2I5LX 2EYHA 3CCUA 1I4HA 1DXMA 4Y7NB 4DLKA 4YHHH 2YZNA 3NQIA 4LSXA 1VS0A 2OCEA 5A35A 2R6FA 5LMNL 4BY1G 2JE6I 4MV8A 3D4DA 2UXCQ 3ND8A 3T56B 4A3LG 1RJQA 3OMCA 1HXYD 1J5EH 5C4XB 5ELOA 4TUYF 1CFMA 2VQEH 3OSNA 1JQYD 1RJTA 1B1ZA 5FLXc 2EJMA 1Y1VA 2XCLA 1EEID 1IBLH 4IALA 1VQOA 2OQKA 1RD9D 1G2SA 1DM0B 2F52A 1WTQA 2FK2A 1OXSC 4YJ3F 4A3BB 4YP3A 4GNXC 4MTDA 3WOEA 2JK8A 5IP7G 4FBUA 4LF4L 2KUMA 3J81E 1YNNC 1I94H 5ELNA 2AQ4A 4JI0Q 5FK9C 3MC0B 1S5ED 4OWTB 1TWCH 1B44D 3PUZA 1K8AC 2JA5A 1JB7A 4GC7A 4A3DH 4LF5Q 1WCMG 5CR3A 1V1PA 3GTGH 4HCEA 4OL7A 3I4MB 1I4PA 4DK6C 1KTKA 1V1QA 3ULLA 4J9QA 2NVQB 3R2IA 2UXCL 1N34Q 4DR1L 2Q2UA 2UUCH 2ZTCA 3Q8DA 4JI3H 4EQPA 1ZQ7A 4PMBA 2LS01 5DNFA 1ZYRC 3PCOB 3I4MG 4C3HG 3M85A 3HOZH 4GKJQ 4CC6A 4QWDA 3R2TA 2PMZB 4I65A 1Q90A 3TZUA 2W9CB 3PV0A 1II3A 2SCUB 1E2WA 1E4EB 4O4LF 5C3WA 4NDXA 5DG7A 2WINB 5FO9B 2ATWA 1JICA 3I4NH 4OEMB 1QVCA 1BBUA 3M4OH 1CE8A 4A93G 3MTSA 1KAAA 1HNWQ 2CH4A 2N88A 2I80A 4DXGA 1HCZA 2RGRA 3HG9A 4LF4H 5I47A 5BPFA 4L5RC 4BWGB 4DR4Q 3L0OA 3TN2A 4LF5L 2HHHH 1JIHA 4JI1H 1N33H 2WDTA 3S16H 2Z4HA 2EVBA 4DF7A 3K7UC 1ILQA 1M1KC 1K8GA 1HA6A 3KHHA 4B3TH 3VPBA 2VA2A 2QILA 4APVA 3PR5B 1EY9A 3JRXA 4C5CA 5M3MB 1EQTA 1KBLA 2J6TA 3PW4A 4BWSC 1GLVA 5EDWA 4K2LA 2RGVA 4ME6A 4R4OA 3MXUA 3IFTA 2I46A 4DAYB 1JORA 2D9UA 3VYSA 3QR8A 3NXWA 5A2QW 4LF9H 3M7GA 1STEA 3ER0A 4BBSG 2F0IA 3CCLA 2XWBB 1WR2A 1SE3A 2XWJB 1EEFD 2F0FA 3CRKC 3Q6SA 3UDIA 1KEEA 2K52A 4WRDA 4K8IA 1Z2NX 4IRCA 1O78A 4IUPA 4ED7A 2CH4W 3DUZA 1L1OC 1TS5A 5KFDA 4BBSH 1NSNS 5CA0F 3DWQA 5JVH3 3VYTA 1STYA 4Q0FA 3S14B 3AYHB 5HURA 2B2UA 3WNZA 2UXDH 2KCTA 4JI2H 1S97A 2EYLA 2E5LL 3T1HQ 3CC2A 2C22A 3GTMH 3L7ZC 2MQHA 4Q0YA 2UUAQ 2E76C 1AP0A 2W9AA 3J7AK 5KRUA 1AEXA 3KLWA 1PRTD 4DGZA 4ALPA 3CQZH 5M3FG 5C0XG 3F2CA 2F4IA 4DL4A 2JJQA 4R4QA 5C5MA 1TQOA 3R8BA 4HMJA 1JJGA 2PMZA 4YWMA 4GOPB 2MP1A 5M9OA 3TSSA 2XTIA 3GTPB 4C1NK 3GTQA 4GLAC 4MHEA 3HZXA 2UXDL 3HOUB 5GAHC 4A3DB 2FLPA 1BKBA 1BCPC 5C0XJ 1I6UA 2UVVA 2LKVA 2K05A 3K5NA 5C44G 1HR0Q 3U50C 4DUZL 2L9HA 3GTMA 5FO7B 1Y8NB 1WCMA 2C5CA 1SE4A 3R93A 4K6LA 2JA6H 4F8MA 4C1NI 1WD0A 2NN6G 3U4VA 5KFYA 1VQ4A 2Z1CA 2WP8J 1I4QA 3PW0A 2EYJA 3LWBA 2JQOA 4QGUA 2Y0SB 3OHXC 4JBKA 2RCNA 4HYKA 4ED6A 2AUKA 3OW2A 2RHSB 4LF7Q 5C4ZA 5BMVF 3RLFA 2B63B 1UUPA 1WOCA 3RZDH 4LF8H 1FD7D 1SR3A 4HMIA 5IWAQ 3Q1KA 4DL2A 2IL8A 4RH6A 4DV7H 4OX9Q 2NTTA 4F4YA 2CVRA 4DAYA 1CT1D 3HGBA 4HN7A 1RF2D 3T13A 5KNCA 1VQ5A 1ZHSA 4RB1A 3KF8A 2JYOA 1OWTA 1X55A 4RAYA 1VQIA 2PMZE 2E2JH 1S5BD 2XGTA 4LF9L 1I5FA 1JXLA 1QNKA 1UEBA 2DN8A 3NTHA 2ZXOA 1P8LA 3LWUA 2NTSA 1N9WA 3R3OA 4WJ3M 5C4HA 2L15A 5EKIA 5EKLA 1KQSA 1VQHA 2RDHA 2W8KA 4IOCA 5FLMG 4GKKQ 2WAQB 1Q8KA 3MR3A 1EWIA 5KFMA 5KFKA 1PYSB 1T5EA 1SYGA 5IIFA 2PNHA 2WB1B 2ZTEA 3OIPA 2E74C 3N42B 4RMFA 4N8X1 3KF6A 4JI7H 4N9PA 3S2HB 3SHLA 3KALA 1U9RA 3KJPA 2IPKD 4QW9A 2K5DA 3N44B 4DR7L 4DR2Q 4A3EB 4KHPQ 5IODA 2VQFL 1F9PA 1N36H 4O3PA 1S9FA 5IWAL 1QOHA 3BABA 2IP4A 3T1YL 3BA9A 3C1EA 3I55A 3CMEA 4DV4Q 1A3UA 3M3YB 1YI2A 5KG1A 3OUZA 4YB8B 3FDSA 3O13A 4JI5Q 5IYZF 2EE1A 4RAUC 2K01A 2EYPA 4R8NA 5KGUA 1I6HH 3D4RA 5KFGA 1WCMB 4XDXA 2AUJD 3BZDB 2R7KA 1HRJA 2RSNA 1SE2A 3HFZB 4LFCQ 2EY6A 2HD3A 3WDNA 5LL6S 5EZYF 4UCSA 1XMQH 2B29A 1HNZL 5JEAJ 2BH2A 4ED2A 3NPPA 4NXMH 3UDGA 2XIGA 4ME3A 3UQ8A 2A19A 4CKCA 3I73A 4KD4A 3MEFA 4H13C 4RCNA 3K57A 4M8AA 1NAPA 5I6WA 1Y1VB 2R8IA 1TS4A 4FNFA 3QFFA 4C3JH 4HNTA 1CZGA 2YTXA 4JK1C 2WKDA 4DR7Q 3A8IE 2D2CC 4DUYH 2E2HH 4EEYA 4DR2L 4UHVA 4DPGA 1RYSA 4KHPL 1L2FA 4DNRB 3PO3G 5EBCA 3T51B 3GV5B 5KFCA 1H9JA 4JG2A 1YNND 4RUAA 3DEPA 2QW7A 3DWAA 1XNQQ 3V6JA 3TP5A 2W6PA 2UU9Q 4MV1A 4UP9A 3MR6A 4DL5A 4RNOA 1GHKA 2W9BB 2A68D 1V1PB 3NK9A 1PH6A 1BR9A 3H94A 3GTLA 4DNTB 2XCAA 5KT7A 5KEEA 3OW7A 4TV8F 4J0MA 2C2EA 4J9RA 4NXNH 4R8UA 1N8RC 4QWEA 1EFWA 4HJ8A 1QVFA 3EPIA 2HVRA 3MFIA 2E75C 1NTGA 3FPPA 3I7FA 4IPHA 5D3DA 4EVOA 5KFPA 2UXBH 1K3RA 2ZJQA 3PSIA 3TP6A 5JH7F 2A6HD 2R85A 2AHOB 2R8HA 4H44C 5KKNB 3PW7A 1E4EA 1XPRA 4FXKC 5CB4F 1GYFA 1CQIB 5LL6X 1CQFA 5JJLA 4ED3A 4QCLA 4F4ZA 3W3AA 4EYHB 3RB6A 4C3IG 3S1MH 5JVDF 1XPUA 1BCPD 2VQEQ 2QCPX 4JI8Q 4EFEA 4UCUA 1B53A 1GUTA 2I5HA 4JOIA 5KFVA 2JA5G 1IBLQ 1IL8A 5K36G 1UE1A 4KKUA 4XIGS 2OTJA 4Y52H 4H7BA 1L2ZA 1LUZA 2C28A 5HV6A 5L1KA 1SMYC 4UPAA 4YIJA 1QB5D 1WTOA 3AFPA 1TWGH 1EWCA 2D0OA 2G5DA 3PMFA 3G71A 1IBML 4JI4Q 3HOWG 2QK4A 5G3LD 2QA4A 2A68C 5EJWA 3ORRA 3VPDA 1HZBA 3IG0A 2HJWA 1T36A 3J80W 2KECA 4NW2A 1EUJA 2LXKA 1D7QA 3V6KA 1TWHB 1MIUA 3DM1A 3R5FA 1B4OA 1O7ZA 1G6PA 3QOLA 3R5XA 5EWFA 4TRDA 2BA1A 4LFBL 4DR6Q 4F88A 4IPGA 3PO3H 1JJCB 4GKJH 4TQSA 1LTID 1I7LA 5KNDA 5J39A 1AUXA 2X6GA 4YR2A 2KHJA 2AGOA 3V4ZA 5F2DA 1C8CA 1GUSA 1NY4A 1DCZA 2VR1A 4I55F 4IOAA 3GV6A 2CQAA 1QG7A 3J80L 2F0EA 3ITPA 5IOCA 1K83B 1UC8A 4IWYA 5J2TF 4R8UB 4GZYC 1NNXA 4F50A 1VDZA 4RNNA 4DV3H 1STBA 2VL6A 1LTGD 2NVYA 3K3PA 2EYFA 1IBMQ 1MHWC 1C4QA 4CC5A 1DGSA 4NKLA 3GTGA 2VZAA 2PZUA 4L63B 2QGQA 2C9OA 3H0GA 4M7EA 4MTKA 3A0JA 3S2DH 1RL2A 1IW7C 1HNZH 1Q46A 3A5ZB 1E24A 3PUXA 5ELCA 1S3OA 2X0SA 2RHQB 1CKNB 2R86A 3TRZA 5IGDA 1JWMD 1AE3A 2FE3A 5A2QE 3LX0A 3HOXG 4LFBQ 3H15A 1B2TA 3UDFA 4EEQA 3CC7A 5C4JB 1O75A 2L12A 1QZGA 1G8ZD 1PTOB 2FFKB 1FR3A 4LF9Q 4JI0L 1EIFA 4DU9A 4KJNA 4ETSA 3D0FA 1K1QA 4QIWA 4FS2A 2VUMH 4FO2A 4DR1H 3ETHA 2SDFA 4XQJA 3MHBA 1D5ZC 5FPOA 1KXLA 2NWGA 1EIHA 3JAMc 4O2BF 2EJFC 1CHPD 1V43A 4PMWA 2JA8H 4RA8A 1HPCA 4CDFC 3V4SA 3E9HA 2Z0SA 3DMUA 1TXYA 1C7YA 1Z6HA 2B39A 5M5XH 2YRXA 1Y8OB 1JDBB 1EFID 5LMNH 3MA2B 4MNOA 4B3RL 4UY8C 5L1LA 5CV4A 1W93A 1P16A 1X9NA 1F2ZA 2TMPA 4GS3A 1K28A 3BDLA 3HKZA 4DV5L 4IUUA 4J9MA 3D8GA 3MXPA 1G51A 4L8JA 4YQWA 2QEJC 4X62L 1LT3D 1N56A 2K32A 2ASJA 4KTAA 3ONAB 4JI3L 2UUCL 2R87A 2UVRA 2F0PA 1GUOA 2NVXH 1PLFA 1XMOH 3BJYA 2LY7A 2LSSA 3PO2H 1KJIA 1RJPA 2LMCB 1AN7A 5DG8A 2WB1A 2YL2A 4OELB 1BQQT 3KF6B 5C1OA 1GUNA 2W6QA 4A3IG 1S5DD 4MV3A 1X56A 5C44B 3TDQA 2YU9B 2EY5A 1HFNA 4BY7G 3EQLC 4U6PA 5LMUL 3GIKA 2AQ3B 4AQYQ 2R92H 4POFA 3FDTA 4A3JB 2XGPA 4IFDH 1ET9A 1M90C 3GTGB 3RUPA 3OSOA 4NMZA 3NWTA 3H0GG 2B2YA 5CGKA 3JAME 4B9XA 4LF7H 3GLKA 4FF3A 4B3SH 1TKWB 1QCBD 1UAPA 3CCQA 5KYIA 2V9WA 3BQ1A 1RODA 3M4QA 4X66L 2WACA 3CCEA 3GD7A 4LNQA 5KFZA 1NJIC 2XRQD 4ZK9B 1LV9A 4DV7Q 1SE8A 5EKKA 4CJ0B 3PIO3 4DV2Q 2OF1A 1XTCD 4RZQA 2JA7H 1EWHA 1EIYB 5EGTA 1PRTC 3AU7A 5KT3A 2KOLA 2B2WA 2K28A 3K59A 4A76A 1XNQL 3J7ZC 1BVSA 2FLLA 1OXTA 2ASBA 1E1OA 4RKLA 2YCHA 1A8VA 4X66H 4I4TF 1XNRH 4AYBA 2RCFA 1XYIA 3RV4A 3OTOQ 2ZJTA 1S0OA 5IGBA 1BXRA 2XCPA 5IYBH 5IGCA 3RJ0A 2C35B 1VQLA 1J9OA 2W8LA 1VF5C 1MSHA 2IJ0A 2ZXRA 4LF7L 4AQYL 1KJJA 4YBZB 4XX0B 2NUAB 4C56C 2RDGA 4RUCA 4IURA 2ASDA 4LH6A 4ID6A 2NVYH 4DFAA 3ETJA 2F0TA 3HOXB 1VBGA 4WBNF 2W57A 5JPNC 5BR8Q 3PF5A 2R7DA 3RGXA 3H0GH 1WTXA 5FLXW 5K5PA 2PBZA 2VUGA 4X65Q 3A7LA 1PYWD 5G3LF 2B63G 2R82A 1Q1BA 4DR2H 4QUFA 1HA5A 1GUGA 2FKLA 4KHPH 4IJLA 5C0XI 4B3SL 4LMQD 4A3EG 1D2BA 3HOYG 5LL6b 1OO9B 2K4KA 5KFUA 4FDBA 1KNEA 3I3CA 4KLKA 1I4XA 2KEDA 3U9OA 1M7JA 1MZBA 1YVCA 3VR6A 4DV4H 2YYZA 2R3ZA 5HGQA 3WO0A 3FEWX 1VQMA 5M5WH 3WO1A 4YWLA 4A3LH 3LGJA 2BE5C 2JEIA 5M5XB 4GNXA 1SDFA 1ESFA 1PVOA 4AYBG 2OH2A 4UDUC 3CD6A 4FS1A 4A93B 4XQQA 2WB1E 2HT1A 3QIAA 2YU9A 4F87A 1BCPF 4ZRZA 2GA4B 3IFDA 5T1GA 3PF4A 3ERQA 2P5ZX 2L55A 3V05A 1GVPA 5DGBA 1XMQQ 1RTOA 3VA5A 1L0XB 4A2BA 3PGZA 4I7HA 2N78A 1NUCA 4ZQ3A 5CBEE 3FP9A 4MAMA 1KDAA 1SYXB 1TU2B 3T5LA 3S15H 4QMGA 3E5NA 3FPUB 3GIIA 5I9PA 4JYAQ 1LACA 2CW0C 1NE3A 4GN5A 2V5AA 2SNMA 3K5LA 2PW7A 4BXXG 1G291 2V1CC 4BY7B 5JOBA 4A3JH 4IRDA 3BG5A 1SYFA 1MJCA 3S1QB 1M8AA 4J9SA 1SNDA 2UUBL 4J9PA 1B8AA 4ECUA 4IRKA 4JV5L 2RA4A 2E2IH 2OT2A 1E4FT 2FMAA 2ZM6H 1STAA 5DQIA 3MWEA 1AN8A 1L0WA 2MO1A 4QF4A 5KFOA 1SYDA 1X65A 4RFBA 1RIPA 3HOWH 4CKBA 4AYBE 5FD6A 4I7ZC 1FNVA 2M05A 4MV9A 1PH2A 2IWHA 1MJEA 1RTNA 4H0LC 2Q8RE 4JI6L 2UUBH 4IR1A 3JZIA 2E2HA 3K58A 3KDFB 5KFEA 5M3FB 4R4IA 1EU4A 4RWSC 1E2ZA 4K5WA 2W6MA 4A3IB 1Y8PB 2EIFA 5ELFA 1SFOA 1CA5A 1ENCA 4YHHQ 1NMGA 1TIID 2IT1A 3WOFA 2SNSA 5CYUA 3SEBA 1EU3A 5LA6F 2YV5A 2VW9A 4A3JG 2NVYB 1PH3A 4JI8H 2HDLA 4ECTA 2JA8G 1KL9A 4M1UB 1HR0W 1IYUA 3NBHB 3CHBD 4CJ1B 3GTLH 1J5EQ 1XXGA 1VQKA 3H0GB 3ULPA 4OHJA 4ED1A 1VCIA 1R4PB 4A3KG 4EG0A 1W6JA 4OONA 2K14A 5M3MG 1K0RA 1Y69U 5KG3A 2F03A 2NZOA 5EOYA 2BA0A 4A3MH 2Q8TA 1CQJB 3AMUA 3MWDA 3HKSA 4DK3C 2R84A 3HOYB 5L1JA 3A7AB 4KN7C 1VMCA 2V4DA 3J7AF 1ML0D 2L5TA 3RD4A 3FKIG 3F1ZA 1T3NA 1H9RA 3E3XA 5E4WC 1VMPA 5A2QL 3VPCA 5I9OA 3BVZA 4LJZC 2QDBA 3F2UA 1B3QA 3GDEA 3N52A 5J1ZA 1I94Q 4OO1I 1UE6A 2PQEA 4JI6Q 2CWAA 4YY3Q 5IY0A 3S24A 3GIPA 2FXQA 4MTNA 2YTVA 3KK7A 1LT6D 3NENA 3CKIB 3HKZE 5I2YA 4K6DA 3CMAA 3NQTA 3K8AA 3RAQA 1A2TA 2W71A 4BY1B 2BQUA 4OXPA 3MR5A 4PQXA 1LT5D 5I2XA 1N34H 3S1RB 1CM9A 2C2RA 2F0UA 5DAUA 2FINB 1AZQA 2JEJA 1X54A 4XT3B 2J7ZA 2KA7A 1Y1WH 4BBRB 3HS0C 3RZOH 1JCKB 1ESRA 1TY2A 4FM9A 3K0XA 4C3JG 3JAMi 5C1PA 3G6VA 4LF6H 3PZPA 1YZ6A 3GTJB 4PNYA 4DV3Q 3C3LA 3TP8A 2KHSA 4QL5A 3GTKB 4RB0A 1SN8A 4MTEA 2CCZA 4X64L 4BY7H 1TWFH 3M9OB 3N41B 4C3JB 3FHWA 3MEHA 4FYDA 5KG2A 4RB3C 4NXNL 1YNXA 4Q8FA 4IUVA 1KNAA 1PH8A 3G7LA 2VQEL 3TS0A 1H9SA 2WKCA 4EGJA 2CZGA 4LF4Q 2QKIC 1UEAB 4QB4A 2E2IB 2NU8B 4H02A 4QJFA 3EPGA 4ULLA 3JSLA 4J9OA 5J3BA 4PG3A 4ZHQF 2WAQG 2W7PA 1TVXA 4O4HF 1YHBA 1QWYA 4UP8A 2X6LA 1N33Q 2NVTH 4GOPC 1EQQA 1YJNA 4KI0A 5KG4A 1IW7D 3PR4A 2R7LA 2HCIA 5F9NA 2Q2IA 4B3TQ 4A3BG 3M4IA 4DA2A 1TWFA 3OIQA 1N32H 4TKOB 1PTOC 1SYEA 4DR1Q 1CQVA 2Y0SE 4LUOA 2K50A 3MFGA 3K5MA 2RBMA 5M3MH 2NN6H 2IMWP 3K5IA 1PZKD 1Y14B 3C46A 5KX5F 1D6EC 4RGOS 4B3RH 4DL3A 1PRTF 3CU7A 1LM0A 3AB9A 5IYBG 5BR8L 4X64Q 1RK5A 3Q23A 4DR6L 3KJOA 1B9MA 3KOJA 2F4VH 4DUYL 1T9HA 1R9TB 1CZWA 1KRSA 4KY6A 4Y7NH 1SAPA 3S1MB 1FNWA 4QWAA 1C3OA 3MXGA 1GHJA 3ULJA 2DNCA 5E7NA 4ZAIA 4CDCC 1CA6A 4JV2A 1V4YA 3SI8A 1YEZA 2JA7G 3W1BA 2UXDQ 2PZWA 1EUDB 3M4YA 4HR7A 1F9SA 1L1OA 3GTQB 2WB1G 5FLXL 1Z7TA 2DJGC 3BZKA 5IYCH 4UCVA 1BO0A 2J4XA 2UUAH 1EY4A 4A3FG 5D65A 5EWEA 4HSPA 3GTMB 4N9TA 4O3NA 1OTCA 2F3WA 4U7CA 3NBIA 2PQAB 1BJTA 3PUWA 2DWCA 2ZTDA 1VQ9A 2E5LQ 3PVXA 4O2DA 3GQCA 4DV0H 4IUQA 4YAKB 3RNUA 4AQYH 1D5MC 1BBWA 1I50H 3I70A 3M9BA 2IX3A 2Y0SA 2ATLA 3N6RA 4JBWA 1RK6A 1PFBA 2Z8LA 3JSNA 5J22A 2O5JC 1XDNA 4BY1H 2PN1A 1DOKA
chains in the Genus database with same CATH topology
1C9OA 4DNIA 2BA1A 4LFBL 4DR6Q 4LUVA 1TWHH 1B7YB 2VY3A 4IPGA 3PO3H 1JJCB 3E9IA 3J80i 4X62Q 5C44H 4GNXB 4JOIC 2K5NA 5GAEC 3K81C 1IBKQ 3PUYA 4BBRH 3GTKH 2KHJA 1X3EA 4LFAL 3KDFA 3CXCA 2NVQH 1NY4A 2Q2TA 4BBRG 1Z47A 3HOUG 4YHHL 5H1SE 3I4NG 4IOAA 4NXMQ 1HH2P 1E22A 1QVGA 4UP7A 4GN3B 3UE0A 2D0PA 2N3SA 1IYJB 2E8GA 3S1NH 4JV5Q 1YHQA 4HJAA 2UUAL 1SLJA 4GLXA 1UE5A 3H3VI 2VL6A 1SRUA 1XMQL 4DR5Q 1VQJA 4LF8L 3CP0A 1IBMQ 2NZHA 4C3IH 1DGSA 1YJWA 3G6EA 2VZAA 4C3HH 3BZCA 5AJ3L 1N34L 1XNRL 3RLOA 2QGQA 1A0IA 1V9PA 3A0JA 3BU2A 1RL2A 4YWKA 5FLMH 1PH5A 4L5SA 3ICEA 3S2DH 1OXVA 4OX9L 1GM5A 4EX5A 2HIXA 1Q46A 3A5ZB 3I2ZA 5LMNW 1PV4A 1E24A 1WFQA 3PUXA 3J81c 1S3OA 3PUVA 4QIWE 2RHQB 1CKNB 4DV6L 3TRZA 1YBYA 4AH6A 1AE3A 1O7IA 2NN6I 2VUMG 3HOXG 1YHAA 2Z6KA 4LFBQ 3H15A 4IFDJ 3UDFA 4DKAC 3G48A 1I94L 1WI5A 2MNAA 3CC7A 4EQ5A 4HIMA 1QZGA 4DV4L 4P72A 3TEHB 4YY3L 2I5MX 4LF9Q 1FGUA 4JI0L 1EIFA 1ASZA 2CQOA 2UUBQ 3TQYA 2UXBL 1KAWA 1CKOA 3D0FA 5EAYA 4JI1L 3CAMA 4IPCA 2HHHL 1CSQA 2VUMH 3CCMA 4BXXH 1VQEA 4DV1Q 3WWVA 2LXJA 2H5XA 1KXLA 2I5LX 3JAMc 3CCUA 2JA8H 1V43A 4PMWA 4DR4L 3F2DA 1VS0A 2OCEA 4LFCL 1N36Q 3S2HH 5LMNL 3U4ZA 3UE1A 4QQBX 1VQGA 4BY1G 2JE6I 3E9HA 2Z0SA 2UXCQ 2KBNA 1TXYA 3M4PA 1C7YA 4A3LG 5M5XH 1WJJA 4BA1I 1VQAA 5ELOA 4MNOA 4IFDI 4UY8C 2EXDA 4B3RL 1P16A 4J15A 2IX0A 4A3EH 1X9NA 5FLXc 4JI7Q 4GS3A 1PH9A 4DV5L 1G51A 4A93H 2YTYA 3TREA 4X62L 1J6QA 2GVBA 1W3SA 2F52A 2OQKA 1X3GA 3J81i 3CCSA 1OXSC 1VQOA 1N32L 1FJGL 2ID0A 4GNXC 4JI3L 1IBKL 2UUCL 2JK8A 5IP7G 3S17H 1HZAA 4LFAQ 1E7ZA 1GKHA 1SMXA 1Z9FA 2NVXH 4LF4L 3PO2H 2LSSA 5ELNA 4JI2L 4JI0Q 1CUKA 1Q81C 1J5EL 1X6OA 4HIOA 4QY7A 3KF6B 4OWTB 1XPOA 4LF6Q 3DLLA 1TWCH 4KHZA 3D31A 3PUZA 4A3IG 1K8AC 1X56A 1KRTA 1JB7A 4A3DH 4LF5Q 1WCMG 4BY7G 5LMUL 1UWVA 3HOZG 2MO0A 4AQYQ 3GTGH 2R92H 2R6GA 4POFA 1Y1VH 2WAQE 4DK6C 1V1QA 3ULLA 3GTJH 3EN2A 3CPFA 3NEMA 2B3GA 4P73A 1M90C 2UXCL 5AJ3Q 1N34Q 2ZM6Q 4DR1L 2Q2UA 2ZTCA 3Q8DA 5JJKA 3HKZG 3NELA 3H0GG 2HIVA 4DV3L 3PCOB 3I4MG 3M85A 1K83H 2OQ0A 3HOZH 4GKJQ 3CCQA 3EIVA 1CKNA 4HIDA 4JI5L 3M4QA 4GOPA 4X66L 4JI7L 1JMCA 5C4XG 4LNQA 3PV0A 3GD7A 3CCEA 1NJIC 3ZJYC 4DV7Q 1SE8A 2KHIA 1A62A 3PIPA 4DV2Q 4A3CG 2JA7H 4DUYQ 2ATWA 1EIYB 1SROA 5JEAG 1N32Q 3I4NH 1XNQL 1QVCA 1BBUA 1B70B 2GVAA 3J7ZC 4A76A 1VQNA 3M4OH 4A93G 1BVSA 5JJIA 1OXTA 2UXBQ 2ASBA 4LUZA 2B63H 1E1OA 1HNWQ 1A8VA 4O0AA 2A1AA 1U0LA 3OTOQ 4A3CH 4L5RC 1NBWA 5IYBH 3KYHC 4DR4Q 3L0OA 2R93G 2C35B 1VQLA 4BY1H 4LF5L 4A4IA 4LF7L 4AQYL 5M3FH 3S16H 2R93H 2VS1A 3K7UC 2F4VQ 2NVYH 4LWCA 5GADC 1M1KC 1K8GA 4JI4L 1D8LA 2Y0SG 4APVA 2OTLA 5IP9G 4NXNQ 5BR8Q 2WFWA 4P71A 2R7DA 3PF5A 3RR5A 3H0GH 1KD1C 4X65Q 5DLQE 2ZJRA 1A63A 4R4OA 2B63G 4K0KQ 4DAYB 1Q1BA 3AQQA 3KF8B 4IJLA 5C0XI 2UU9L 4B3SL 3ER0A 4JI8L 4A3EG 1QUQB 4JCVE 3HOYG 4BBSG 1W2BA 2K4KA 4FDBA 2R7FA 4IO9A 3CCLA 2CWPA 1OXUA 4PZ8A 4OWWB 4KLKA 5C4XH 1UE7A 3UDIA 1YVCA 2K52A 2YYZA 5IYCG 5HGQA 1VQFA 1VQMA 5M5WH 5IT9c 4YWLA 4A3LH 3LGJA 1IBLL 5IYDH 2PI2E 4GNXA 1PVOA 1LTLA 4TVAB 4AYBG 1L1OC 4DV0Q 2R7ZG 3HOYH 2I0QA 4BBSH 3CD6A 1HNWL 1Q1EA 5IE8A 2WB1E 3JC66 1YJ9A 2HT1A 3AYHB 1IXRA 1Q12A 2KCTA 1GD7A 1VQ7A 2E5LL 3T1HQ 3CC2A 3PF4A 3GTMH 3L7ZC 2MQHA 3E0EA 1JJ2A 2UUAQ 1GVPA 3CCRA 3M3YH 1AH9A 5C3EH 1XMQQ 2R92G 3KLWA 4L5TA 4ALPA 3PGZA 1C0AA 3CQZH 1FVIA 5M3FG 2VQFQ 5C0XG 3F2CA 2JJQA 2N78A 4R4QA 1PH4A 1JJGA 3FP9A 1K73C 4YWMA 3GO5A 4GOPB 3T1YQ 3HOUH 3M7NA 3STBD 2JA6G 3S15H 5GQOA 4K0KL 1JE5A 2XTIA 3RN5A 4GLAC 4JYAQ 1WYDA 2UXDL 5GAHC 2IY5B 4DV2L 4IPDA 2QEXA 1NE3A 1BKBA 4GN5A 5C0XJ 2OWOA 2AMCB 4JC0A 2KCMA 4BXXG 5C44G 1G291 2V1CC 3U50C 4DUZL 4A3JH 1HR0Q 4HJ7A 4BA2I 2ZJPA 2AWOA 4X6AH 3J80c 1MJCA 4DAMA 1PFSA 2PQAA 3STBC 1JT8A 2MFIA 2JA6H 4A3DG 2KENA 2NN6G 1S40A 3U4VA 2UUBL 1B8AA 1VQ4A 1HZCA 4JV5L 2WP8J 2R7ZH 1VQBA 2E2IH 2JQOA 1HNZQ 4QGUA 4JBKA 2RCNA 1L0WA 2MO1A 2RHSB 3OW2A 4JBMA 4LF7Q 2ES2A 1X65A 3HOWH 1RIPA 3RLFA 1S72A 3AFQA 4JBJA 4AYBE 1WOCA 5C3EG 3RZDH 1PH2A 3CPWA 3A74A 1E3PA 1SR3A 5IWAQ 1MJEA 1KC8C 3PIOA 3A5UA 1Y1WG 4B3MQ 4A3GH 4OX9Q 5IP9H 4JI6L 1EOVA 2BH8A 1VQ5A 4B3RQ 3RLNA 2N49A 3KDFB 4DV6Q 4R4TA 1X55A 2PI2A 4R4IA 1VQIA 2PMZE 2E2JH 4A3MG 1Q86C 1FL0A 1PH7A 3F2BA 2XGTA 2IX1A 2CFMA 4R4CA 2EIFA 1I5FA 4LF9L 1UEBA 4LW1A 4YHHQ 1P8LA 3PO2G 1NMGA 1H95A 1CKMA 1N9WA 2IT1A 4WJ3M 3UDXA 2YV5A 2VW9A 4DUZQ 2HQLA 2L15A 4A3JG 1PH3A 1N33L 3G4SA 1VQHA 1KQSA 3HOVG 3DM3A 2JA8G 4IOCA 4JI1Q 5FLMG 2HHHQ 1E1TA 1KL9A 1HR0W 4GKKQ 3NBHB 1Q8KA 3W1GA 4B3TL 1EWIA 3GTLH 1PYSB 1J5EQ 4DR5L 1VQKA 4GN4B 1HJPA 5LMNQ 3ULPA 3CCVA 2PNHA 1VCIA 1Y1VG 4A3FH 4A3KG 4OONA 2K14A 5M3MG 2ZTEA 1XJVA 4NB3A 4PZ6A 1K0RA 4RMFA 3KF6A 4YCWA 4OWXB 1K9MC 5LMUQ 2NZOA 3KJPA 2BA0A 4A3MH 1VQPA 3CCJA 5IYDG 2AWNA 4DR7L 3HKSA 4DK3C 4DR2Q 4KHPQ 4WJ4A 2VQFL 5IP7H 3FKIG 3F1ZA 3S14H 4IJHA 5IWAL 3GTQH 4B3ML 2K5VA 3GDEA 1I94Q 1XTDA 4OO1I 3T1YL 1UE6A 3I4OA 4JI6Q 3I55A 3CMEA 4DV4Q 4IFDG 2CWAA 4YY3Q 1VQDA 1YI2A 5IY0A 4JYAL 1FJGQ 3S24A 4JI5Q 2FXQA 4MTNA 2YTVA 3NENA 1WCMH 3HKZE 3CW2C 4DV7L 5GAGC 1I6HH 3OYYA 3CMAA 2AKWB 3CF5A 4PZ7A 3K8AA 4DV1L 1U5KA 1L1OB 2ALYB 4GLVB 2JEBI 1HZ9A 4OXPA 4JI2Q 1IZ6A 3K80C 4HJ9A 3HFZB 4LFCQ 3GTPH 4LF6L 1X54A 3SGIA 3RN2A 2B29A 3S1RH 5JEAJ 1Y1WH 1HNZL 2BH2A 4A3GG 3UDGA 4RG1A 5FJ8H 1XMOQ 2GN5A 2YU9H 3RZOH 4ME3A 4HJ5A 3K0XA 2A19A 2JA9A 3JAMi 4HIKA 3MEFA 2K5HA 3S1QH 1I3QH 1YZ6A 3TS2A 4DV3Q 4DR3L 4C3JH 4QL5A 1SN8A 2YTXA 2CCZA 4POGA 4DR7Q 4GKJL 4X64L 2E2HH 4BY7H 1TWFH 4DR2L 4DV5Q 4DPGA 1IL2A 4KHPL 1L2FA 3FHWA 4OO1G 3PO3G 4NXNL 1YNXA 1HNXL 2CKZB 1PH8A 2JEAI 1KHIA 1OXXK 2VQEL 3MXNB 4P75A 3TS0A 2F3IA 1SFOH 4JG2A 4X65L 3B6YA 2JA5H 4X66Q 2UUCQ 4JI3Q 4LF4Q 4R1JA 4H02A 4QJFA 1Q7YC 1XNQQ 5J3BA 2UU9Q 4PG3A 4UP9A 4B3SQ 2WAQG 1YHBA 1YIJA 4UP8A 1N33Q 2NVTH 4GOPC 2IHEA 1EQQA 1QUQA 1Q82C 1YJNA 4KI0A 1PH6A 2A8VA 1VQ6A 2K75A 3CC4A 4GKKL 4XTCS 2Q2IA 4B3TQ 4A3BG 1VQCA 3BJUA 4A3IH 1N8RC 3K7AH 1EFWA 4HJ8A 1QVFA 4MZ9A 1NTGA 3I7FA 4IPHA 2ZM6L 4DR1Q 4LF8Q 1K3RA 2F4VL 3HOXH 3PSIA 1KIXA 2ZJQA 2Y0SE 1PHJA 4LUOA 2K50A 5HY6A 1XNRQ 5M3MH 2AHOB 5C4JH 3T1HL 4NPSA 1Y14B 1GO3E 3ERSX 3VDYA 3F8TA 5M5YH 1XPRA 4DR3Q 1LM0A 2VNUD 1LYLA 5IYBG 1TWAH 5BR8L 4X64Q 5JJLA 4DR6L 3HOVH 3KJOA 3KOJA 1VQ8A 4DUYL 1T9HA 1HNXQ 3S1MH 3I56A 1XPUA 2VQEQ 1KRSA 4TQUS 4Y7NH 4YCVA 4JI8Q 3AEVA 1X3FA 3ULJA 5E7NA 5GROA 1R9TH 1ASYA 1CSPA 2N8NA 3H3VH 2Z6KC 1YEZA 2I5HA 4JOIA 3W1BA 2JA7G 4P74A 2UXDQ 2JA5G 1IBLQ 1NMFA 2IHFA 5K36G 1UE1A 4XIGS 1L1OA 4NXML 2OTJA 4Y52H 3OTOL 2Q2HA 2RF4A 2WB1G 3BZKA 3W5OA 5IYCH 1HR0L 4A75A 4AIMA 1PA6A 1EYGA 1LUZA 2D62A 4UPAA 4A3FG 4A3KH 3J7A5 4DV0L 3AFPA 1TWGH 2D0OA 4A3BH 1EQRA 3L2PA 1OTCA 4C2MH 1PYBA 3G71A 3U58A 1N36L 2PQAB 1XMOL 1IBML 3PUWA 4JI4Q 2ZTDA 3HOWG 1VQ9A 3GTOH 2QA4A 2E5LQ 4O2DA 3IRBA 1HZBA 5FJ8G 1YITA 1AE2A 3KFUA 3RNUA 3FKIH 4L5QA 1PH1A 1BBWA 1QZHA 2EQSA 1EUJA 2LXKA 1I50H 3M9BA 4YCUA 2DGYA 1D7QA 4JBWA 2DUDA 1MKHA 1MIUA 3J81j 1G6PA 3EBEA 3I4MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9O A;  4DNI A;  2BA1 A;  4LFB L;  4DR6 Q;  4LUV A;  1TWH H;  1B7Y B;  2VY3 A;  4IPG A;  3PO3 H;  1JJC B;  3E9I A;  3J80 i;  4X62 Q;  5C44 H;  4GNX B;  4JOI C;  2K5N A;  5GAE C;  3K81 C;  1IBK Q;  3PUY A;  4BBR H;  3GTK H;  2KHJ A;  1X3E A;  4LFA L;  3KDF A;  3CXC A;  2NVQ H;  1NY4 A;  2Q2T A;  4BBR G;  1Z47 A;  3HOU G;  4YHH L;  5H1S E;  3I4N G;  4IOA A;  4NXM Q;  1HH2 P;  1E22 A;  1QVG A;  4UP7 A;  4GN3 B;  3UE0 A;  2D0P A;  2N3S A;  1IYJ B;  2E8G A;  3S1N H;  4JV5 Q;  1YHQ A;  4HJA A;  2UUA L;  1SLJ A;  4GLX A;  1UE5 A;  3H3V I;  2VL6 A;  1SRU A;  1XMQ L;  4DR5 Q;  1VQJ A;  4LF8 L;  3CP0 A;  1IBM Q;  2NZH A;  4C3I H;  1DGS A;  1YJW A;  3G6E A;  2VZA A;  4C3H H;  3BZC A;  5AJ3 L;  1N34 L;  1XNR L;  3RLO A;  2QGQ A;  1A0I A;  1V9P A;  3A0J A;  3BU2 A;  1RL2 A;  4YWK A;  5FLM H;  1PH5 A;  4L5S A;  3ICE A;  3S2D H;  1OXV A;  4OX9 L;  1GM5 A;  4EX5 A;  2HIX A;  1Q46 A;  3A5Z B;  3I2Z A;  5LMN W;  1PV4 A;  1E24 A;  1WFQ A;  3PUX A;  3J81 c;  1S3O A;  3PUV A;  4QIW E;  2RHQ B;  1CKN B;  4DV6 L;  3TRZ A;  1YBY A;  4AH6 A;  1AE3 A;  1O7I A;  2NN6 I;  2VUM G;  3HOX G;  1YHA A;  2Z6K A;  4LFB Q;  3H15 A;  4IFD J;  3UDF A;  4DKA C;  3G48 A;  1I94 L;  1WI5 A;  2MNA A;  3CC7 A;  4EQ5 A;  4HIM A;  1QZG A;  4DV4 L;  4P72 A;  3TEH B;  4YY3 L;  2I5M X;  4LF9 Q;  1FGU A;  4JI0 L;  1EIF A;  1ASZ A;  2CQO A;  2UUB Q;  3TQY A;  2UXB L;  1KAW A;  1CKO A;  3D0F A;  5EAY A;  4JI1 L;  3CAM A;  4IPC A;  2HHH L;  1CSQ A;  2VUM H;  3CCM A;  4BXX H;  1VQE A;  4DV1 Q;  3WWV A;  2LXJ A;  2H5X A;  1KXL A;  2I5L X;  3JAM c;  3CCU A;  2JA8 H;  1V43 A;  4PMW A;  4DR4 L;  3F2D A;  1VS0 A;  2OCE A;  4LFC L;  1N36 Q;  3S2H H;  5LMN L;  3U4Z A;  3UE1 A;  4QQB X;  1VQG A;  4BY1 G;  2JE6 I;  3E9H A;  2Z0S A;  2UXC Q;  2KBN A;  1TXY A;  3M4P A;  1C7Y A;  4A3L G;  5M5X H;  1WJJ A;  4BA1 I;  1VQA A;  5ELO A;  4MNO A;  4IFD I;  4UY8 C;  2EXD A;  4B3R L;  1P16 A;  4J15 A;  2IX0 A;  4A3E H;  1X9N A;  5FLX c;  4JI7 Q;  4GS3 A;  1PH9 A;  4DV5 L;  1G51 A;  4A93 H;  2YTY A;  3TRE A;  4X62 L;  1J6Q A;  2GVB A;  1W3S A;  2F52 A;  2OQK A;  1X3G A;  3J81 i;  3CCS A;  1OXS C;  1VQO A;  1N32 L;  1FJG L;  2ID0 A;  4GNX C;  4JI3 L;  1IBK L;  2UUC L;  2JK8 A;  5IP7 G;  3S17 H;  1HZA A;  4LFA Q;  1E7Z A;  1GKH A;  1SMX A;  1Z9F A;  2NVX H;  4LF4 L;  3PO2 H;  2LSS A;  5ELN A;  4JI2 L;  4JI0 Q;  1CUK A;  1Q81 C;  1J5E L;  1X6O A;  4HIO A;  4QY7 A;  3KF6 B;  4OWT B;  1XPO A;  4LF6 Q;  3DLL A;  1TWC H;  4KHZ A;  3D31 A;  3PUZ A;  4A3I G;  1K8A C;  1X56 A;  1KRT A;  1JB7 A;  4A3D H;  4LF5 Q;  1WCM G;  4BY7 G;  5LMU L;  1UWV A;  3HOZ G;  2MO0 A;  4AQY Q;  3GTG H;  2R92 H;  2R6G A;  4POF A;  1Y1V H;  2WAQ E;  4DK6 C;  1V1Q A;  3ULL A;  3GTJ H;  3EN2 A;  3CPF A;  3NEM A;  2B3G A;  4P73 A;  1M90 C;  2UXC L;  5AJ3 Q;  1N34 Q;  2ZM6 Q;  4DR1 L;  2Q2U A;  2ZTC A;  3Q8D A;  5JJK A;  3HKZ G;  3NEL A;  3H0G G;  2HIV A;  4DV3 L;  3PCO B;  3I4M G;  3M85 A;  1K83 H;  2OQ0 A;  3HOZ H;  4GKJ Q;  3CCQ A;  3EIV A;  1CKN A;  4HID A;  4JI5 L;  3M4Q A;  4GOP A;  4X66 L;  4JI7 L;  1JMC A;  5C4X G;  4LNQ A;  3PV0 A;  3GD7 A;  3CCE A;  1NJI C;  3ZJY C;  4DV7 Q;  1SE8 A;  2KHI A;  1A62 A;  3PIP A;  4DV2 Q;  4A3C G;  2JA7 H;  4DUY Q;  2ATW A;  1EIY B;  1SRO A;  5JEA G;  1N32 Q;  3I4N H;  1XNQ L;  1QVC A;  1BBU A;  1B70 B;  2GVA A;  3J7Z C;  4A76 A;  1VQN A;  3M4O H;  4A93 G;  1BVS A;  5JJI A;  1OXT A;  2UXB Q;  2ASB A;  4LUZ A;  2B63 H;  1E1O A;  1HNW Q;  1A8V A;  4O0A A;  2A1A A;  1U0L A;  3OTO Q;  4A3C H;  4L5R C;  1NBW A;  5IYB H;  3KYH C;  4DR4 Q;  3L0O A;  2R93 G;  2C35 B;  1VQL A;  4BY1 H;  4LF5 L;  4A4I A;  4LF7 L;  4AQY L;  5M3F H;  3S16 H;  2R93 H;  2VS1 A;  3K7U C;  2F4V Q;  2NVY H;  4LWC A;  5GAD C;  1M1K C;  1K8G A;  4JI4 L;  1D8L A;  2Y0S G;  4APV A;  2OTL A;  5IP9 G;  4NXN Q;  5BR8 Q;  2WFW A;  4P71 A;  2R7D A;  3PF5 A;  3RR5 A;  3H0G H;  1KD1 C;  4X65 Q;  5DLQ E;  2ZJR A;  1A63 A;  4R4O A;  2B63 G;  4K0K Q;  4DAY B;  1Q1B A;  3AQQ A;  3KF8 B;  4IJL A;  5C0X I;  2UU9 L;  4B3S L;  3ER0 A;  4JI8 L;  4A3E G;  1QUQ B;  4JCV E;  3HOY G;  4BBS G;  1W2B A;  2K4K A;  4FDB A;  2R7F A;  4IO9 A;  3CCL A;  2CWP A;  1OXU A;  4PZ8 A;  4OWW B;  4KLK A;  5C4X H;  1UE7 A;  3UDI A;  1YVC A;  2K52 A;  2YYZ A;  5IYC G;  5HGQ A;  1VQF A;  1VQM A;  5M5W H;  5IT9 c;  4YWL A;  4A3L H;  3LGJ A;  1IBL L;  5IYD H;  2PI2 E;  4GNX A;  1PVO A;  1LTL A;  4TVA B;  4AYB G;  1L1O C;  4DV0 Q;  2R7Z G;  3HOY H;  2I0Q A;  4BBS H;  3CD6 A;  1HNW L;  1Q1E A;  5IE8 A;  2WB1 E;  3JC6 6;  1YJ9 A;  2HT1 A;  3AYH B;  1IXR A;  1Q12 A;  2KCT A;  1GD7 A;  1VQ7 A;  2E5L L;  3T1H Q;  3CC2 A;  3PF4 A;  3GTM H;  3L7Z C;  2MQH A;  3E0E A;  1JJ2 A;  2UUA Q;  1GVP A;  3CCR A;  3M3Y H;  1AH9 A;  5C3E H;  1XMQ Q;  2R92 G;  3KLW A;  4L5T A;  4ALP A;  3PGZ A;  1C0A A;  3CQZ H;  1FVI A;  5M3F G;  2VQF Q;  5C0X G;  3F2C A;  2JJQ A;  2N78 A;  4R4Q A;  1PH4 A;  1JJG A;  3FP9 A;  1K73 C;  4YWM A;  3GO5 A;  4GOP B;  3T1Y Q;  3HOU H;  3M7N A;  3STB D;  2JA6 G;  3S15 H;  5GQO A;  4K0K L;  1JE5 A;  2XTI A;  3RN5 A;  4GLA C;  4JYA Q;  1WYD A;  2UXD L;  5GAH C;  2IY5 B;  4DV2 L;  4IPD A;  2QEX A;  1NE3 A;  1BKB A;  4GN5 A;  5C0X J;  2OWO A;  2AMC B;  4JC0 A;  2KCM A;  4BXX G;  5C44 G;  1G29 1;  2V1C C;  3U50 C;  4DUZ L;  4A3J H;  1HR0 Q;  4HJ7 A;  4BA2 I;  2ZJP A;  2AWO A;  4X6A H;  3J80 c;  1MJC A;  4DAM A;  1PFS A;  2PQA A;  3STB C;  1JT8 A;  2MFI A;  2JA6 H;  4A3D G;  2KEN A;  2NN6 G;  1S40 A;  3U4V A;  2UUB L;  1B8A A;  1VQ4 A;  1HZC A;  4JV5 L;  2WP8 J;  2R7Z H;  1VQB A;  2E2I H;  2JQO A;  1HNZ Q;  4QGU A;  4JBK A;  2RCN A;  1L0W A;  2MO1 A;  2RHS B;  3OW2 A;  4JBM A;  4LF7 Q;  2ES2 A;  1X65 A;  3HOW H;  1RIP A;  3RLF A;  1S72 A;  3AFQ A;  4JBJ A;  4AYB E;  1WOC A;  5C3E G;  3RZD H;  1PH2 A;  3CPW A;  3A74 A;  1E3P A;  1SR3 A;  5IWA Q;  1MJE A;  1KC8 C;  3PIO A;  3A5U A;  1Y1W G;  4B3M Q;  4A3G H;  4OX9 Q;  5IP9 H;  4JI6 L;  1EOV A;  2BH8 A;  1VQ5 A;  4B3R Q;  3RLN A;  2N49 A;  3KDF B;  4DV6 Q;  4R4T A;  1X55 A;  2PI2 A;  4R4I A;  1VQI A;  2PMZ E;  2E2J H;  4A3M G;  1Q86 C;  1FL0 A;  1PH7 A;  3F2B A;  2XGT A;  2IX1 A;  2CFM A;  4R4C A;  2EIF A;  1I5F A;  4LF9 L;  1UEB A;  4LW1 A;  4YHH Q;  1P8L A;  3PO2 G;  1NMG A;  1H95 A;  1CKM A;  1N9W A;  2IT1 A;  4WJ3 M;  3UDX A;  2YV5 A;  2VW9 A;  4DUZ Q;  2HQL A;  2L15 A;  4A3J G;  1PH3 A;  1N33 L;  3G4S A;  1VQH A;  1KQS A;  3HOV G;  3DM3 A;  2JA8 G;  4IOC A;  4JI1 Q;  5FLM G;  2HHH Q;  1E1T A;  1KL9 A;  1HR0 W;  4GKK Q;  3NBH B;  1Q8K A;  3W1G A;  4B3T L;  1EWI A;  3GTL H;  1PYS B;  1J5E Q;  4DR5 L;  1VQK A;  4GN4 B;  1HJP A;  5LMN Q;  3ULP A;  3CCV A;  2PNH A;  1VCI A;  1Y1V G;  4A3F H;  4A3K G;  4OON A;  2K14 A;  5M3M G;  2ZTE A;  1XJV A;  4NB3 A;  4PZ6 A;  1K0R A;  4RMF A;  3KF6 A;  4YCW A;  4OWX B;  1K9M C;  5LMU Q;  2NZO A;  3KJP A;  2BA0 A;  4A3M H;  1VQP A;  3CCJ A;  5IYD G;  2AWN A;  4DR7 L;  3HKS A;  4DK3 C;  4DR2 Q;  4KHP Q;  4WJ4 A;  2VQF L;  5IP7 H;  3FKI G;  3F1Z A;  3S14 H;  4IJH A;  5IWA L;  3GTQ H;  4B3M L;  2K5V A;  3GDE A;  1I94 Q;  1XTD A;  4OO1 I;  3T1Y L;  1UE6 A;  3I4O A;  4JI6 Q;  3I55 A;  3CME A;  4DV4 Q;  4IFD G;  2CWA A;  4YY3 Q;  1VQD A;  1YI2 A;  5IY0 A;  4JYA L;  1FJG Q;  3S24 A;  4JI5 Q;  2FXQ A;  4MTN A;  2YTV A;  3NEN A;  1WCM H;  3HKZ E;  3CW2 C;  4DV7 L;  5GAG C;  1I6H H;  3OYY A;  3CMA A;  2AKW B;  3CF5 A;  4PZ7 A;  3K8A A;  4DV1 L;  1U5K A;  1L1O B;  2ALY B;  4GLV B;  2JEB I;  1HZ9 A;  4OXP A;  4JI2 Q;  1IZ6 A;  3K80 C;  4HJ9 A;  3HFZ B;  4LFC Q;  3GTP H;  4LF6 L;  1X54 A;  3SGI A;  3RN2 A;  2B29 A;  3S1R H;  5JEA J;  1Y1W H;  1HNZ L;  2BH2 A;  4A3G G;  3UDG A;  4RG1 A;  5FJ8 H;  1XMO Q;  2GN5 A;  2YU9 H;  3RZO H;  4ME3 A;  4HJ5 A;  3K0X A;  2A19 A;  2JA9 A;  3JAM i;  4HIK A;  3MEF A;  2K5H A;  3S1Q H;  1I3Q H;  1YZ6 A;  3TS2 A;  4DV3 Q;  4DR3 L;  4C3J H;  4QL5 A;  1SN8 A;  2YTX A;  2CCZ A;  4POG A;  4DR7 Q;  4GKJ L;  4X64 L;  2E2H H;  4BY7 H;  1TWF H;  4DR2 L;  4DV5 Q;  4DPG A;  1IL2 A;  4KHP L;  1L2F A;  3FHW A;  4OO1 G;  3PO3 G;  4NXN L;  1YNX A;  1HNX L;  2CKZ B;  1PH8 A;  2JEA I;  1KHI A;  1OXX K;  2VQE L;  3MXN B;  4P75 A;  3TS0 A;  2F3I A;  1SFO H;  4JG2 A;  4X65 L;  3B6Y A;  2JA5 H;  4X66 Q;  2UUC Q;  4JI3 Q;  4LF4 Q;  4R1J A;  4H02 A;  4QJF A;  1Q7Y C;  1XNQ Q;  5J3B A;  2UU9 Q;  4PG3 A;  4UP9 A;  4B3S Q;  2WAQ G;  1YHB A;  1YIJ A;  4UP8 A;  1N33 Q;  2NVT H;  4GOP C;  2IHE A;  1EQQ A;  1QUQ A;  1Q82 C;  1YJN A;  4KI0 A;  1PH6 A;  2A8V A;  1VQ6 A;  2K75 A;  3CC4 A;  4GKK L;  4XTC S;  2Q2I A;  4B3T Q;  4A3B G;  1VQC A;  3BJU A;  4A3I H;  1N8R C;  3K7A H;  1EFW A;  4HJ8 A;  1QVF A;  4MZ9 A;  1NTG A;  3I7F A;  4IPH A;  2ZM6 L;  4DR1 Q;  4LF8 Q;  1K3R A;  2F4V L;  3HOX H;  3PSI A;  1KIX A;  2ZJQ A;  2Y0S E;  1PHJ A;  4LUO A;  2K50 A;  5HY6 A;  1XNR Q;  5M3M H;  2AHO B;  5C4J H;  3T1H L;  4NPS A;  1Y14 B;  1GO3 E;  3ERS X;  3VDY A;  3F8T A;  5M5Y H;  1XPR A;  4DR3 Q;  1LM0 A;  2VNU D;  1LYL A;  5IYB G;  1TWA H;  5BR8 L;  4X64 Q;  5JJL A;  4DR6 L;  3HOV H;  3KJO A;  3KOJ A;  1VQ8 A;  4DUY L;  1T9H A;  1HNX Q;  3S1M H;  3I56 A;  1XPU A;  2VQE Q;  1KRS A;  4TQU S;  4Y7N H;  4YCV A;  4JI8 Q;  3AEV A;  1X3F A;  3ULJ A;  5E7N A;  5GRO A;  1R9T H;  1ASY A;  1CSP A;  2N8N A;  3H3V H;  2Z6K C;  1YEZ A;  2I5H A;  4JOI A;  3W1B A;  2JA7 G;  4P74 A;  2UXD Q;  2JA5 G;  1IBL Q;  1NMF A;  2IHF A;  5K36 G;  1UE1 A;  4XIG S;  1L1O A;  4NXM L;  2OTJ A;  4Y52 H;  3OTO L;  2Q2H A;  2RF4 A;  2WB1 G;  3BZK A;  3W5O A;  5IYC H;  1HR0 L;  4A75 A;  4AIM A;  1PA6 A;  1EYG A;  1LUZ A;  2D62 A;  4UPA A;  4A3F G;  4A3K H;  3J7A 5;  4DV0 L;  3AFP A;  1TWG H;  2D0O A;  4A3B H;  1EQR A;  3L2P A;  1OTC A;  4C2M H;  1PYB A;  3G71 A;  3U58 A;  1N36 L;  2PQA B;  1XMO L;  1IBM L;  3PUW A;  4JI4 Q;  2ZTD A;  3HOW G;  1VQ9 A;  3GTO H;  2QA4 A;  2E5L Q;  4O2D A;  3IRB A;  1HZB A;  5FJ8 G;  1YIT A;  1AE2 A;  3KFU A;  3RNU A;  3FKI H;  4L5Q A;  1PH1 A;  1BBW A;  1QZH A;  2EQS A;  1EUJ A;  2LXK A;  1I50 H;  3M9B A;  4YCU A;  2DGY A;  1D7Q A;  4JBW A;  2DUD A;  1MKH A;  1MIU A;  3J81 j;  1G6P A;  3EBE A;  3I4M H; 
#chains in the Genus database with same CATH topology
 2MHV A;  1H9S B;  1TWH H;  5C5L A;  4X62 Q;  1I3Q B;  4JOI C;  1G2T A;  3PUY A;  4BBR H;  2B2Y C;  2CW0 D;  1TA8 A;  2H1E A;  2XN9 C;  2NVQ H;  4DK0 A;  2Q2T A;  2FMM A;  2NVX A;  5KG6 A;  4EBE A;  4J8Q A;  2JA5 B;  1I50 A;  1TWF B;  4IHJ F;  4PDB A;  2NBF A;  1AW7 A;  4JV5 Q;  3V2T A;  2UUA L;  4GLX A;  3IAY A;  1D5X C;  1EZ6 A;  4OX9 H;  3RBE A;  4LF8 L;  5CC4 A;  5KT4 A;  3VYR A;  3D3R A;  3RZD B;  2A69 D;  1N34 L;  1XNR L;  3MJF A;  3RLO A;  3U9S A;  1K3B C;  1M6V A;  4L5S A;  1B04 A;  1IYV A;  1F9R A;  3J81 W;  1OXV A;  4EX5 A;  4QWB A;  1PV4 A;  3S2D B;  1WFQ A;  5CV7 A;  4DV6 L;  4ECQ A;  1O7I A;  1U4P A;  2NN6 I;  2YYA A;  1KJ9 A;  5BR8 H;  4ECS A;  2HVS A;  2F3V A;  5KFS A;  4DKA C;  1U4L A;  4UAI A;  4X65 H;  4EQ5 A;  1EUC B;  3KLS A;  4DV4 L;  3BG3 A;  4P72 A;  1GGO A;  1ULZ A;  3KLS X;  5ELD A;  5KG7 A;  4EYI B;  2WTF A;  1ASZ A;  4RAZ A;  2JA7 A;  1S68 A;  3TQY A;  2W6Z A;  1CKO A;  3E0J A;  4IPC A;  1CSQ A;  2B2V C;  4RGM A;  4HSV A;  3CCM A;  4DV1 Q;  3OMG A;  1DV1 A;  2BCO A;  3I91 A;  3T4A C;  2F0M A;  4DR4 L;  3H40 A;  4LFC L;  3S2H H;  2W7O A;  1N36 Q;  2QDL A;  3P75 A;  3RFC A;  4DUZ H;  4KK7 A;  4UFZ A;  1RJR A;  2KBN A;  2OXP A;  4JUZ A;  3P20 A;  5FD5 A;  1Z2P X;  1WJJ A;  2KCC A;  2PNR C;  4BA1 I;  2KEE A;  1V1O A;  4I7A A;  2EXD A;  4K8J A;  5BN4 A;  1BUV T;  2IX0 A;  1Y1W A;  5EWG A;  1QE6 A;  2I07 B;  1PH9 A;  3A8J E;  3TRE A;  5C3E B;  2GVB A;  3CCS A;  4LFC H;  1I6H B;  2CHB D;  1IBK L;  5DQG A;  3S17 H;  2ENB A;  4LFA Q;  3NGD A;  4LMY A;  3KTM A;  4JI2 L;  1SEB D;  2L11 A;  1CUK A;  1X6O A;  4F7X A;  1PRT B;  1K8M A;  2NU6 B;  3DLL A;  1FKA H;  1JB3 A;  3D31 A;  4MA0 A;  1I50 B;  1KRT A;  4O42 A;  1SNO A;  3HOZ G;  2MO0 A;  5D1O B;  3GIJ A;  1GJX A;  3RV3 A;  1Y1V H;  2WAQ E;  3CPF A;  2JEG A;  2H4O A;  2RQX A;  1EZ1 A;  5AJ3 Q;  2ZM6 Q;  5JJK A;  3HKZ G;  4LAA A;  4L1K A;  4YJ2 F;  3QZ7 A;  4N8F A;  4FBT A;  3NEL A;  2G9D A;  2R7M A;  5KFF A;  2HIV A;  5EBD A;  4DV3 L;  2UU9 H;  3FKI A;  2LFN A;  2OQ0 A;  2FK1 A;  2B2U C;  2MUY A;  4HID A;  4V0B A;  1MSG A;  4JI5 L;  4GOP A;  3QO2 A;  5IT9 L;  1JMC A;  1H9K A;  4JI7 L;  5AFW A;  3J7A V;  3ZJY C;  1QJO A;  4C3H B;  1A62 A;  1VAJ A;  4DV5 H;  3OPO A;  2A6E C;  3CVZ A;  4DL7 A;  1B70 B;  2K04 A;  5JJI A;  1RHP A;  1VQN A;  3Q2O A;  1EY7 A;  4A3G B;  2B2W C;  2UXB Q;  2CW8 A;  3Q8Q B;  4O1N A;  4LUZ A;  2B63 H;  2N55 A;  2PYK A;  4O0A A;  1WTW A;  2A1A A;  2K5Q A;  2M2L A;  1BF4 A;  3OHB A;  1X32 A;  2V4Q A;  2R93 G;  1QIL A;  1SMY D;  2K33 A;  2SEB D;  4DAP A;  3OWE B;  4YAJ B;  4A4I A;  2DZD A;  2E2D C;  2F0V A;  2VS1 A;  3LML A;  5KFH A;  2XGQ A;  1T5X D;  4LWC A;  2DY7 A;  4R9W A;  4JI4 L;  3TME A;  1D8L A;  2F1M A;  4XXE A;  2OTL A;  5IP9 G;  1MD2 D;  3RR5 A;  4EGQ A;  3VR2 A;  3GIQ A;  1WTH A;  2M00 A;  1KD1 C;  5DLQ E;  2ZJR A;  4OIJ A;  1A63 A;  4FXG C;  4K0K Q;  3AQQ A;  1S5F D;  3KF8 B;  1DIK A;  2UU9 L;  4ECZ A;  4O3R A;  4MA5 A;  2AQ2 B;  1W2B A;  4JW0 A;  3G6X A;  3KLR A;  4FP5 D;  4IO9 A;  4DR3 H;  2CWP A;  1OXU A;  4OWW B;  3OHA A;  5C4X H;  2B2V A;  5LHY 1;  5IYC G;  1VQF A;  4ZUJ A;  5IT9 c;  5KFN A;  3ORQ A;  2YRW A;  4JV0 A;  3K5H A;  1IBL L;  5IYD H;  1DOM A;  2RDF A;  2HVQ A;  2XNA C;  2NB0 A;  2R7Z G;  2F0W A;  4O4I F;  1PTO D;  3KBG A;  1Q1E A;  5IE8 A;  4ECW A;  3JC6 6;  1YJ9 A;  1AFP A;  1TR5 A;  2PCF B;  3MWM A;  1IXR A;  3KUP A;  1GD7 A;  1VQ7 A;  3KHR A;  3NE5 B;  2PVP A;  4OGQ C;  2Z6B A;  2RDJ A;  3BVM A;  5IGG A;  3M3Y H;  4G7O C;  3CCR A;  1AH9 A;  2F0D A;  5C3E H;  4DR6 H;  4NLG A;  3GID A;  1A3V A;  2GPW A;  3NWS A;  1KJ8 A;  4RZR A;  3TII A;  1NR2 A;  1TWC B;  1FVI A;  3S17 B;  2I87 A;  2VQF Q;  4JPB W;  1E2V A;  1PH4 A;  1WD1 A;  3T5J A;  1Q3L A;  3RB0 A;  3T1Y Q;  2W9C A;  2JA6 G;  4K0K L;  5GQO A;  1JE5 A;  2D5D A;  2IW3 A;  3RN5 A;  1N48 A;  5JVL A;  2DLN A;  4K2K A;  2AMC B;  4JC0 A;  2IBK A;  1EYZ A;  1ZHQ A;  4HJ7 A;  1I4G A;  3HOZ B;  3NTI A;  4X6A H;  3C0F B;  3FMC A;  5LYJ F;  2PQA A;  3STB C;  1JT8 A;  1IBM H;  4A3D G;  2KEN A;  1VBH A;  2HCC A;  1STG A;  4Q5V A;  2R7Z H;  1VQB A;  1IBK H;  1F77 A;  2O5I C;  2WE6 A;  3HP3 A;  3RUZ A;  1HNZ Q;  3A54 A;  4J6H A;  5JJZ A;  4QIW B;  3Q8R B;  3S1N B;  5CV6 A;  1JX4 A;  5T14 A;  4B08 A;  1SJE D;  3AFQ A;  4JBJ A;  2KSW A;  1FNU A;  3T16 A;  5C3E G;  2R8G A;  3CPW A;  3A74 A;  3I90 A;  1I3Q A;  5E1F A;  2CW7 A;  1KC8 C;  4A3G H;  4ABN A;  4IR9 A;  3H09 A;  5IP9 H;  1EOV A;  4GC6 A;  4ZQI A;  2R8K A;  4B3R Q;  4UCO A;  2N49 A;  4DV6 Q;  3S16 B;  2HGS A;  4R4T A;  2PI2 A;  5C5J A;  2DNE A;  2JEF A;  2EYO A;  2VB3 X;  2R7Z A;  4A3M G;  1CI3 M;  2B8G A;  1FL0 A;  1PH7 A;  1BXT A;  2CFM A;  5DG9 A;  4LW1 A;  2KJX A;  4G7H C;  4HNV A;  1M4V A;  3PO2 G;  3RF2 A;  4IAJ A;  2YZM A;  1TWA B;  1HUM A;  3JRW A;  1A9X A;  3MVV A;  1HQR D;  3G4S A;  2RVL A;  1G6Z A;  3DM3 A;  4JV1 A;  2O2L D;  3HB9 A;  4Q8E A;  3W1G A;  4B3T L;  1GSH A;  1S0M A;  5I4D A;  4DR5 L;  2FPI B;  1HJP A;  5LMN Q;  2K03 A;  1EOT A;  1EQV A;  3PIP 3;  5JQW A;  4PZ6 A;  3N43 B;  2A6H C;  4ILW A;  4OWX B;  3RMH A;  1K9M C;  2K7V A;  5LMU Q;  1VQP A;  5IYD G;  2AWN A;  1LTA D;  1WSC A;  4BBS B;  4EQN A;  2J6S A;  2E5L H;  3S14 H;  3SVM A;  4IJH A;  3GIM A;  1JOO A;  4C2M B;  2UXC H;  3RB4 A;  2K5V A;  1B33 N;  3I4O A;  5LP6 F;  4IFD G;  3I72 A;  2YS7 A;  5D1P A;  1VQD A;  1FJG Q;  4DK1 A;  2A6E D;  1EHI A;  4K5X A;  1GUW A;  5GAG C;  2C00 A;  1I4R A;  2AKW B;  2ICE C;  1TS2 A;  4GLV B;  3ERO A;  4LK1 C;  1LTB D;  3GTP H;  1ET6 A;  2F0S A;  3RN2 A;  2FMC A;  2YZG A;  2FHT A;  3S1R H;  4A3G G;  3D4W A;  3BDC A;  4PMC A;  4NP5 A;  4RG1 A;  3R23 A;  4HJ5 A;  2ZXP A;  4RGN A;  3J81 L;  2FPP B;  5KG5 A;  1Y1W B;  3T5K A;  3PO3 B;  4RNM A;  2K5H A;  4FF4 A;  3V96 A;  2Z4I A;  1SYC A;  2B63 A;  2DJF C;  2JA6 B;  3TS2 A;  4UCT A;  4TSS A;  4OIK A;  4FF2 A;  4POG A;  2NUC A;  3BDO A;  4DV2 H;  4LF5 H;  4GKJ L;  4O3S A;  3LNN A;  4C5B A;  2L4N A;  3H3V C;  4IZ8 A;  2PPB C;  1EYC A;  5EPJ A;  1Q8I A;  2K5W A;  1OXX K;  4P75 A;  2F3I A;  1SFO H;  2UUC Q;  4XYQ A;  1DOL A;  3B6Y A;  4KHV A;  4X66 Q;  4JI3 Q;  3SR1 A;  2R7Z B;  2BQ3 A;  2UVU A;  4R1J A;  5DEH A;  5D8D A;  1GSA A;  2VOB A;  2EXZ A;  4XYL B;  1TWA A;  3KBX A;  1KC7 A;  1ENA A;  1YIJ A;  5D1O A;  1Q82 C;  3KHG A;  4ED0 A;  1QUQ A;  2ICI A;  1VQ6 A;  2A8V A;  3RIZ A;  1SNM A;  2F0Q A;  2VXW A;  3KHL A;  2A73 B;  2JXM B;  4GKK L;  2WAQ A;  1SCU B;  1K83 A;  1VQC A;  3BJU A;  3K7A H;  4MZ9 A;  4XT1 B;  1SNQ A;  1HTP A;  5J2U F;  2F4V L;  3HOX H;  1KIX A;  1PFN A;  1HTL D;  2NU9 B;  1PHJ A;  1HNW H;  4B3M H;  5HY6 A;  3T1H L;  5C4J H;  4M9U A;  4NPS A;  5F9L A;  3VDY A;  2FJ2 A;  3F8T A;  1I7N A;  5M5Y H;  2C2D A;  3Q8S B;  2M9V A;  5LOV F;  4E4T A;  1LYL A;  1K0S A;  4DR4 H;  1TWA H;  5KFX A;  4C2M A;  3VR3 A;  5DLF A;  3HOV H;  1EYA A;  5NUC A;  4APM A;  1S10 A;  2EDG A;  3QZ8 A;  1VQ8 A;  3SDZ A;  1HNX Q;  5HBR B;  3I56 A;  1KLU D;  1KAB A;  2JA8 B;  4YCV A;  5KFT A;  5M5W B;  1X3F A;  1R9T H;  5GRO A;  5CV9 A;  2N8N A;  3SK4 A;  2Z6K C;  3I4L A;  1NMF A;  3A55 A;  5DGA A;  4A3K B;  4JVZ A;  2RF4 A;  3GV3 A;  1HR0 L;  4A75 A;  1PA6 A;  1EYG A;  3H20 A;  2D62 A;  4LFA H;  4YR3 A;  3GTO B;  5L1I A;  1EQR A;  4DN4 M;  5L9X A;  3G6Y A;  4C2M H;  4DL6 A;  3A8K E;  1XMO L;  2R8J A;  1ONL A;  3RGZ A;  5CBA E;  4XQN A;  1DJR D;  2JA6 A;  1PH1 A;  2EY1 A;  1YNJ C;  4JYA H;  2OEO A;  1QZH A;  4KKS A;  5IT9 W;  3EVQ A;  4Q43 A;  2DGY A;  3A56 A;  2DUD A;  1UNS A;  3CRL C;  2FP4 B;  3T1H H;  2B2T C;  2K6A A;  1RYR A;  3EBE A;  5KFR A;  3SK5 A;  3HKZ B;  4LUV A;  1B7Y B;  4ZYS A;  3J80 i;  5C44 H;  5KT6 A;  3K81 C;  3TQT A;  4HAE A;  4L6T B;  3GV8 B;  3E6Z X;  4PV1 C;  1JOK A;  1X3E A;  2W9B A;  1SBB B;  5COR A;  2E2H B;  3TQ1 A;  3BQ2 A;  5JPM C;  3KDF A;  3CXC A;  1EY5 A;  3VR5 A;  5DM7 3;  1V51 A;  2WII B;  1S0N A;  4BBR G;  4CHT B;  2IA6 A;  4J9K A;  5GON F;  3NP8 A;  2V58 A;  1O7L A;  1ZEQ X;  1HH2 P;  2VB2 X;  4QWC A;  3PW2 A;  4GN3 B;  5C0X H;  2N3S A;  1JWS D;  1S03 G;  3BQ0 A;  1YHQ A;  1TWC A;  1HR0 H;  1SLJ A;  3GP7 A;  3ZYY X;  1HFG A;  1UE5 A;  1SRU A;  1XMQ L;  4RKB A;  2RDI A;  3RAX A;  3CP0 A;  4IN3 A;  2NZH A;  4C3I H;  1YJW A;  3BZC A;  2FJZ A;  2AGQ A;  5KFL A;  3BU2 A;  1PH5 A;  2L0C A;  4OX9 L;  3J81 c;  4QIW E;  5EPK A;  1BCP B;  3F8N A;  3NHH A;  1DYQ A;  2VUM G;  2NU7 B;  2FK3 A;  2BE5 D;  1H9M A;  3OOC A;  3I12 A;  1YHA A;  2Z6K A;  4IFD J;  3G48 A;  1I94 L;  1WI5 A;  2MNA A;  1DV2 A;  1HQM C;  3RBD A;  1BGW A;  3X3M A;  1DZ1 A;  4YY3 L;  1IOW A;  3R5H A;  3DWP A;  5KT2 A;  2I5M X;  1C48 A;  1SYB A;  4CDE C;  1FYC A;  1FGU A;  1ILP A;  3Q8P B;  2UXB L;  4JI1 L;  2HHH L;  5KFI A;  3K6O A;  3JAM W;  1EL0 A;  5M5Y B;  1VQE A;  1K1S A;  2LXJ A;  2H5X A;  5JAV A;  3GTO A;  3ND9 A;  4U68 A;  3VA7 A;  3F2D A;  2O4X A;  3U4Z A;  3UE1 A;  4QQB X;  4ECV A;  1VQG A;  1JKJ B;  4QUC A;  5DQH A;  1NCV A;  3M4P A;  4JI6 H;  4YY3 H;  2BQR A;  1F2Y A;  1VQA A;  4EBC A;  4IFD I;  3PW5 A;  2BOS A;  1TWG B;  4J9N A;  4J15 A;  2ZT9 C;  4A3E H;  3Q24 A;  1U4M A;  4JI7 Q;  2I8C A;  3GTJ A;  2XD4 A;  3HEJ A;  4P2C B;  5CMD A;  1JC7 A;  4E6I A;  4A93 H;  2BDN A;  5BN3 A;  3JAM L;  2YTY A;  1B6S A;  3J81 i;  1J6Q A;  3GTO H;  1W3S A;  1X3G A;  5JEA H;  1N32 L;  1FJG L;  2ID0 A;  2MCT A;  3PN1 A;  3T1Y H;  1HZA A;  4KMU C;  1EY6 A;  4HNU A;  4ECR A;  1E7Z A;  1GKH A;  1SMX A;  1Z9F A;  2G9H D;  5EPL A;  1KDB A;  2ZDG A;  3LWE A;  1S5C D;  2KQ3 A;  4EGV A;  1Q81 C;  1J5E L;  4HIO A;  3IL8 A;  1C30 A;  4QY7 A;  2E2I A;  1XPO A;  4LF6 Q;  3BVG A;  4ZCK A;  4KHZ A;  1K8O A;  2K1B A;  4F4W A;  3MFY A;  1GOZ A;  5CV5 A;  3K0Y A;  1SEI A;  3P1H A;  1UWV A;  2J6U A;  1E4G T;  2R6G A;  2CQY A;  3HRZ C;  3GTJ H;  1Q86 C;  3EN2 A;  4P73 A;  3NEM A;  2B3G A;  5D3I B;  4ED8 A;  1QNU A;  1TT2 A;  2RKS A;  2F0H A;  2AQ1 B;  3URY A;  3IKJ A;  3NSW A;  4ME5 A;  1CK1 A;  1K83 H;  1BDO A;  2EZV A;  1CKN A;  1JWU D;  3EIV A;  3QWN A;  4ZLT F;  5C4X G;  2PW5 A;  1CS0 A;  4Q45 A;  2W70 A;  2KHI A;  5DM6 3;  4IUN A;  1TS3 A;  3PIP A;  4A3C G;  2RSO A;  4DUY Q;  1IKM A;  2ALZ A;  4DR7 H;  3N6X A;  1SRO A;  5JEA G;  1N32 Q;  4DV6 H;  1PFM A;  2GVA A;  4MV4 A;  3G6J B;  5C6A A;  2EYM A;  3G8C A;  1WVL A;  5C3X A;  4HED A;  4UCR A;  3UFX B;  1MI2 A;  4I50 F;  4DR5 H;  1U0L A;  1S4Z A;  5CV8 A;  4A3C H;  4KY7 A;  1GSO A;  4MV7 A;  2A69 C;  3KXY T;  1NBW A;  5CA1 F;  3HXL A;  3TZD A;  3KYH C;  3DXJ C;  1PTO H;  1R4Q B;  3N40 P;  1B9N A;  1ZXT A;  4X64 H;  4RGT A;  5M3F H;  1TAE A;  2R93 H;  1LTS D;  2FPG B;  5CAE B;  2F4V Q;  5GAD C;  2VUM B;  3BYT B;  2Y0S G;  4V19 0;  2HQE A;  4NXN Q;  2VA3 A;  2EY2 A;  2WFW A;  4P71 A;  1BNZ A;  4IUT A;  4KN4 C;  1HHV A;  2YW2 A;  5LMU H;  5I6Y A;  5KFQ A;  1ZKO A;  3D6C A;  4FXD A;  1EYD A;  4ECY A;  1LLR D;  2JP1 A;  1D1I A;  1ZET A;  1ICF B;  1LTT D;  1STH A;  2B2T A;  4JI8 L;  1QUQ B;  4JCV E;  3GTL B;  2R7F A;  2R7N A;  5K36 H;  4PZ8 A;  3J7Y W;  2VPQ A;  4CGY B;  4TV9 F;  1UE7 A;  2HUG A;  1SNC A;  3VR4 A;  1FJG H;  2R93 A;  1A6X A;  1YNJ D;  4A3M B;  2PI2 E;  4CBV A;  5C8Y F;  1LTL A;  4TVA B;  1B50 A;  4DV0 Q;  5LXT F;  3HOY H;  2I0Q A;  1HNW L;  3NBH A;  4RU9 A;  1XWE A;  3TBI B;  1Q12 A;  3L3O C;  1JE4 A;  2X69 A;  4R8I A;  2NVX B;  2XIW A;  3E0E A;  1JJ2 A;  3CQZ B;  1VKZ A;  2R92 G;  4L5T A;  1PXU A;  4X62 H;  1C0A A;  2MGS A;  4WOR A;  3TIG A;  1XX8 A;  5E3F A;  1UNN C;  3J80 E;  4JI4 H;  1K73 C;  2NYZ D;  1VF7 A;  2JN4 A;  2R92 B;  3GO5 A;  3HOU H;  3M7N A;  3STB D;  1SJH D;  4OO1 H;  1W6K A;  1WYD A;  1WTP A;  2IY5 B;  4DV2 L;  4IPD A;  2QEX A;  4JI0 H;  2OWO A;  1E0B A;  1LT4 D;  5ELE A;  2P0A A;  3DEO A;  2DPJ A;  1A15 A;  1EY0 A;  2KCM A;  4JV5 H;  4BA2 I;  2F0N A;  3QJY A;  5KFW A;  5FOB B;  2DY8 A;  2ZJP A;  2AWO A;  2XC9 A;  3J80 c;  3EFX D;  4DAM A;  1PFS A;  2MFI A;  1SXT A;  4ECX A;  1X3P A;  3BS1 A;  1S40 A;  1HZC A;  1GXD C;  1X3Q A;  3SE0 A;  3UI2 A;  3DF7 A;  2JA7 B;  1F2L A;  4IWX A;  1I6V C;  4JBM A;  2NZ1 D;  5KT5 A;  1TWH A;  1B3A A;  2ES2 A;  3L4J A;  4Q44 A;  4HCS A;  4KD3 A;  1S72 A;  3NTK A;  4MIU A;  1NR4 A;  2KVM A;  3MR2 A;  1E3P A;  1SNP A;  2F0L A;  2DPI A;  3PIO A;  3A5U A;  4RHR A;  1Y1W G;  4B3M Q;  1A3T A;  2NVT B;  4RB2 C;  1JR0 D;  1SSO A;  2BH8 A;  2E2J B;  3RLN A;  2J0T D;  3Q0A A;  1M0W A;  4F4X A;  4HTH A;  2TSS A;  5KFA A;  2F0O A;  4DV1 H;  1ENF A;  1WTV A;  3F2B A;  2IX1 A;  4R4C A;  5JVG 3;  2MPM A;  1H95 A;  1HNX H;  1CKM A;  3UDX A;  2R93 B;  3TIN A;  1N33 L;  3QG1 A;  4DUZ Q;  2HQL A;  4S3S A;  3C2P A;  5FO8 B;  3HOV G;  1LO5 D;  1T94 A;  4CDD C;  1G91 A;  4JI1 Q;  2HHH Q;  5FKA C;  1E1T A;  4LFB H;  1BBX C;  5JUM A;  3P7J A;  4QW8 A;  4GN4 B;  4J9L A;  3CCV A;  1Y1V G;  1UC9 A;  4A3F H;  1WH2 A;  4X3U A;  4O3O A;  3H4D A;  3RB3 A;  1XJV A;  3BAA A;  3H91 A;  4NB3 A;  2W6N A;  4PWQ A;  4YCW A;  3KAK A;  3CQZ A;  4MV6 A;  5L37 A;  2BDO A;  3CCJ A;  4CJ2 C;  5T1I A;  4WJ4 A;  3MFH A;  5IP7 H;  5IT9 E;  1AZP A;  4Y8V B;  5COY A;  2WV6 D;  3GTK A;  3GTQ H;  4B3M L;  2R92 A;  2PO4 A;  1XTD A;  3M9M B;  2PZT A;  3EYY A;  3QB3 A;  3L4K A;  1LTR D;  4WD3 A;  4JYA L;  2FLN A;  3FMA A;  3FKI B;  1JLL B;  2YS6 A;  1WCM H;  4MN3 A;  3CW2 C;  4DV7 L;  3MWY W;  4O2A F;  3OYY A;  3PQI A;  3CF5 A;  1F9Q A;  4PZ7 A;  4DV1 L;  3H4B A;  1U5K A;  3BA8 A;  1L1O B;  1J8I A;  3GIL A;  2V4R A;  2ALY B;  2JEB I;  1HZ9 A;  4JI2 Q;  5DLG A;  1IZ6 A;  3K80 C;  3OWF A;  1MBY A;  4HJ9 A;  3S15 B;  3PO2 B;  1ICW A;  3FRP B;  5H80 A;  3V6H A;  4X3K A;  4LF6 L;  3SGI A;  4FVM A;  4J1M A;  1D1K A;  1EIG A;  5FJ8 H;  1XMO Q;  2GN5 A;  2YU9 H;  1KJQ A;  2F0K A;  5E4X A;  1TWG A;  2JA9 A;  4HIK A;  3M9N B;  4BS9 A;  3S1Q H;  1I3Q H;  4ZKB B;  2F0G A;  4KV6 A;  4DR3 L;  5EQ0 A;  2GPS A;  1IL2 A;  4DV5 Q;  1FGB D;  4OO1 G;  2WYO A;  2QYZ A;  4WJW A;  5KNB A;  4KJO A;  1HNX L;  2CKZ B;  1IHZ A;  2JEA I;  2B8F A;  1KHI A;  3MXN B;  2JA5 H;  4X65 L;  4LH7 A;  4X3T A;  4YR0 A;  1A2U A;  1PDQ A;  1PK8 A;  1L0Y B;  1Q7Y C;  2VQD A;  4IZO A;  1SFO B;  5BPH A;  4FU0 A;  4B3S Q;  5HGT A;  1CTM A;  2OLS A;  4G57 A;  5IGE A;  3Q22 A;  1KLG D;  5ELB A;  5KIX A;  4ZI7 F;  2IHE A;  4ZOL F;  3OSP A;  1PZI D;  2K75 A;  4FF1 A;  3LP8 A;  3CC4 A;  2XRS D;  4XTC S;  5D14 A;  4HQ6 A;  4KKT A;  1HUN A;  1O80 A;  3QOJ A;  3SXH A;  4A3I H;  3MAQ A;  2J9G A;  4LSA A;  2AU0 A;  2ZM6 L;  2EPB A;  1F2M A;  3K7A B;  4LF8 Q;  4K0K H;  2O03 A;  1O7Y A;  1XNR Q;  3KAJ A;  2AGP A;  2R61 A;  1GO3 E;  3ERS X;  1Z2O X;  3OTO H;  1PMR A;  1TY0 A;  2EJG C;  4DR3 Q;  2VNU D;  4IQZ A;  4CKE A;  3VMM A;  4XYO A;  5IGF A;  1STN A;  1LAB A;  3DHQ A;  1PZJ D;  3L9A X;  3SK6 A;  3X3N A;  5FLX E;  3HOV B;  4TQU S;  3NUC A;  3AEV A;  2XSC A;  1PTO F;  4AYB B;  1ASY A;  3H3V H;  4A3F B;  1CSP A;  2KCN A;  4GKK H;  4P74 A;  3FVQ A;  2V59 A;  1WTR A;  2IHF A;  1AUV A;  4NXM L;  3GTP A;  3OTO L;  2Q2H A;  3W5O A;  1RDP D;  2A74 C;  4AIM A;  1RCV D;  5KFJ A;  3H6M A;  4RHS A;  3RTX A;  4Z9C B;  4A3K H;  3J7A 5;  4DV0 L;  2VUM A;  3I8Z A;  4WFN 3;  4A3B H;  3L2P A;  2VPS A;  2VQF H;  3U58 A;  1PYB A;  1N36 L;  3K3V A;  4EBD A;  2MJ8 A;  4ZUI A;  3BYY B;  3EJI A;  2Q8I B;  4ODG A;  4O3Q A;  3IRB A;  3KFU A;  5FJ8 G;  1YIT A;  1AE2 A;  3FKI H;  2EOT A;  4L5Q A;  4G7Z C;  1RKN A;  4EQO A;  3SK8 A;  3C1F A;  2EQS A;  5TSS A;  1EZ8 A;  2QF7 A;  3GQB A;  3T53 B;  4YCU A;  2ZDQ A;  3D6W A;  2ZDH A;  1MKH A;  5BN5 A;  4G4K A;  3J81 j;  4JI5 H;  3RZO B;  3I4M H;  1C9O A;  3MZ5 A;  4DNI A;  3MXN A;  3U9T A;  2VY3 A;  5IWA H;  3E9I A;  4K5V A;  4GNX B;  4DAV A;  1ZYR D;  1BNC A;  2K5N A;  5GAE C;  1IBK Q;  4XZ3 B;  3GTK H;  4RCO A;  4LFA L;  2XVS A;  2UVW A;  4B9W A;  1Z47 A;  3HOU G;  4EFB A;  4YHH L;  5H1S E;  3I4N G;  4NXM Q;  4K14 A;  1E22 A;  1QVG A;  1EY8 A;  4UP7 A;  3UE0 A;  4C5A A;  2D0P A;  5FPR A;  5KFB A;  1IYJ B;  2E8G A;  3OUU A;  3S1N H;  1DON A;  4HJA A;  1JDE A;  3E5S A;  2W6O A;  5KYL A;  3H3V I;  3I4N B;  1BOS A;  4DR5 Q;  1VQJ A;  3M4O B;  1DD2 A;  2Z9H A;  3VYU A;  1PX2 A;  2BR0 A;  3G6E A;  4C3H H;  5AJ3 L;  3IN5 A;  2DIK A;  4G3I A;  2F0J A;  3K5O A;  1B6R A;  1A0I A;  1V9P A;  4YWK A;  3ICE A;  2A5H A;  4C3I B;  5FLM H;  3HOW B;  4XYM B;  1MGS A;  1GM5 A;  2HIX A;  1CHQ D;  4DXF A;  3I2Z A;  1IOV A;  1W96 A;  5LMN W;  3N8D A;  3GV7 B;  1JOQ A;  1U4R A;  4KY5 A;  3PUV A;  3S9W A;  1XNQ H;  2JSO A;  1YBY A;  4AH6 A;  4X3S A;  4ZKC B;  1R9T A;  2GLT A;  5KG0 A;  4R7R A;  3HBL A;  3W2D A;  3EA6 A;  4HIM A;  1M0T A;  3TEH B;  3TP7 A;  5K2M A;  1V8Q A;  2L1B A;  4HR7 B;  3T5H A;  2ASL A;  5ISR A;  2CQO A;  4TQR A;  2UUB Q;  1KAW A;  2HDM A;  5EAY A;  1IKL A;  2FB9 A;  3CAM A;  3SE7 A;  1KDC A;  4BXX H;  3WWV A;  2SOB A;  4A2A A;  4U67 3;  2I5L X;  2EYH A;  3CCU A;  1I4H A;  1DXM A;  4Y7N B;  4DLK A;  4YHH H;  2YZN A;  3NQI A;  4LSX A;  1VS0 A;  2OCE A;  5A35 A;  2R6F A;  5LMN L;  4BY1 G;  2JE6 I;  4MV8 A;  3D4D A;  2UXC Q;  3ND8 A;  3T56 B;  4A3L G;  1RJQ A;  3OMC A;  1HXY D;  1J5E H;  5C4X B;  5ELO A;  4TUY F;  1CFM A;  2VQE H;  3OSN A;  1JQY D;  1RJT A;  1B1Z A;  5FLX c;  2EJM A;  1Y1V A;  2XCL A;  1EEI D;  1IBL H;  4IAL A;  1VQO A;  2OQK A;  1RD9 D;  1G2S A;  1DM0 B;  2F52 A;  1WTQ A;  2FK2 A;  1OXS C;  4YJ3 F;  4A3B B;  4YP3 A;  4GNX C;  4MTD A;  3WOE A;  2JK8 A;  5IP7 G;  4FBU A;  4LF4 L;  2KUM A;  3J81 E;  1YNN C;  1I94 H;  5ELN A;  2AQ4 A;  4JI0 Q;  5FK9 C;  3MC0 B;  1S5E D;  4OWT B;  1TWC H;  1B44 D;  3PUZ A;  1K8A C;  2JA5 A;  1JB7 A;  4GC7 A;  4A3D H;  4LF5 Q;  1WCM G;  5CR3 A;  1V1P A;  3GTG H;  4HCE A;  4OL7 A;  3I4M B;  1I4P A;  4DK6 C;  1KTK A;  1V1Q A;  3ULL A;  4J9Q A;  2NVQ B;  3R2I A;  2UXC L;  1N34 Q;  4DR1 L;  2Q2U A;  2UUC H;  2ZTC A;  3Q8D A;  4JI3 H;  4EQP A;  1ZQ7 A;  4PMB A;  2LS0 1;  5DNF A;  1ZYR C;  3PCO B;  3I4M G;  4C3H G;  3M85 A;  3HOZ H;  4GKJ Q;  4CC6 A;  4QWD A;  3R2T A;  2PMZ B;  4I65 A;  1Q90 A;  3TZU A;  2W9C B;  3PV0 A;  1II3 A;  2SCU B;  1E2W A;  1E4E B;  4O4L F;  5C3W A;  4NDX A;  5DG7 A;  2WIN B;  5FO9 B;  2ATW A;  1JIC A;  3I4N H;  4OEM B;  1QVC A;  1BBU A;  3M4O H;  1CE8 A;  4A93 G;  3MTS A;  1KAA A;  1HNW Q;  2CH4 A;  2N88 A;  2I80 A;  4DXG A;  1HCZ A;  2RGR A;  3HG9 A;  4LF4 H;  5I47 A;  5BPF A;  4L5R C;  4BWG B;  4DR4 Q;  3L0O A;  3TN2 A;  4LF5 L;  2HHH H;  1JIH A;  4JI1 H;  1N33 H;  2WDT A;  3S16 H;  2Z4H A;  2EVB A;  4DF7 A;  3K7U C;  1ILQ A;  1M1K C;  1K8G A;  1HA6 A;  3KHH A;  4B3T H;  3VPB A;  2VA2 A;  2QIL A;  4APV A;  3PR5 B;  1EY9 A;  3JRX A;  4C5C A;  5M3M B;  1EQT A;  1KBL A;  2J6T A;  3PW4 A;  4BWS C;  1GLV A;  5EDW A;  4K2L A;  2RGV A;  4ME6 A;  4R4O A;  3MXU A;  3IFT A;  2I46 A;  4DAY B;  1JOR A;  2D9U A;  3VYS A;  3QR8 A;  3NXW A;  5A2Q W;  4LF9 H;  3M7G A;  1STE A;  3ER0 A;  4BBS G;  2F0I A;  3CCL A;  2XWB B;  1WR2 A;  1SE3 A;  2XWJ B;  1EEF D;  2F0F A;  3CRK C;  3Q6S A;  3UDI A;  1KEE A;  2K52 A;  4WRD A;  4K8I A;  1Z2N X;  4IRC A;  1O78 A;  4IUP A;  4ED7 A;  2CH4 W;  3DUZ A;  1L1O C;  1TS5 A;  5KFD A;  4BBS H;  1NSN S;  5CA0 F;  3DWQ A;  5JVH 3;  3VYT A;  1STY A;  4Q0F A;  3S14 B;  3AYH B;  5HUR A;  2B2U A;  3WNZ A;  2UXD H;  2KCT A;  4JI2 H;  1S97 A;  2EYL A;  2E5L L;  3T1H Q;  3CC2 A;  2C22 A;  3GTM H;  3L7Z C;  2MQH A;  4Q0Y A;  2UUA Q;  2E76 C;  1AP0 A;  2W9A A;  3J7A K;  5KRU A;  1AEX A;  3KLW A;  1PRT D;  4DGZ A;  4ALP A;  3CQZ H;  5M3F G;  5C0X G;  3F2C A;  2F4I A;  4DL4 A;  2JJQ A;  4R4Q A;  5C5M A;  1TQO A;  3R8B A;  4HMJ A;  1JJG A;  2PMZ A;  4YWM A;  4GOP B;  2MP1 A;  5M9O A;  3TSS A;  2XTI A;  3GTP B;  4C1N K;  3GTQ A;  4GLA C;  4MHE A;  3HZX A;  2UXD L;  3HOU B;  5GAH C;  4A3D B;  2FLP A;  1BKB A;  1BCP C;  5C0X J;  1I6U A;  2UVV A;  2LKV A;  2K05 A;  3K5N A;  5C44 G;  1HR0 Q;  3U50 C;  4DUZ L;  2L9H A;  3GTM A;  5FO7 B;  1Y8N B;  1WCM A;  2C5C A;  1SE4 A;  3R93 A;  4K6L A;  2JA6 H;  4F8M A;  4C1N I;  1WD0 A;  2NN6 G;  3U4V A;  5KFY A;  1VQ4 A;  2Z1C A;  2WP8 J;  1I4Q A;  3PW0 A;  2EYJ A;  3LWB A;  2JQO A;  4QGU A;  2Y0S B;  3OHX C;  4JBK A;  2RCN A;  4HYK A;  4ED6 A;  2AUK A;  3OW2 A;  2RHS B;  4LF7 Q;  5C4Z A;  5BMV F;  3RLF A;  2B63 B;  1UUP A;  1WOC A;  3RZD H;  4LF8 H;  1FD7 D;  1SR3 A;  4HMI A;  5IWA Q;  3Q1K A;  4DL2 A;  2IL8 A;  4RH6 A;  4DV7 H;  4OX9 Q;  2NTT A;  4F4Y A;  2CVR A;  4DAY A;  1CT1 D;  3HGB A;  4HN7 A;  1RF2 D;  3T13 A;  5KNC A;  1VQ5 A;  1ZHS A;  4RB1 A;  3KF8 A;  2JYO A;  1OWT A;  1X55 A;  4RAY A;  1VQI A;  2PMZ E;  2E2J H;  1S5B D;  2XGT A;  4LF9 L;  1I5F A;  1JXL A;  1QNK A;  1UEB A;  2DN8 A;  3NTH A;  2ZXO A;  1P8L A;  3LWU A;  2NTS A;  1N9W A;  3R3O A;  4WJ3 M;  5C4H A;  2L15 A;  5EKI A;  5EKL A;  1KQS A;  1VQH A;  2RDH A;  2W8K A;  4IOC A;  5FLM G;  4GKK Q;  2WAQ B;  1Q8K A;  3MR3 A;  1EWI A;  5KFM A;  5KFK A;  1PYS B;  1T5E A;  1SYG A;  5IIF A;  2PNH A;  2WB1 B;  2ZTE A;  3OIP A;  2E74 C;  3N42 B;  4RMF A;  4N8X 1;  3KF6 A;  4JI7 H;  4N9P A;  3S2H B;  3SHL A;  3KAL A;  1U9R A;  3KJP A;  2IPK D;  4QW9 A;  2K5D A;  3N44 B;  4DR7 L;  4DR2 Q;  4A3E B;  4KHP Q;  5IOD A;  2VQF L;  1F9P A;  1N36 H;  4O3P A;  1S9F A;  5IWA L;  1QOH A;  3BAB A;  2IP4 A;  3T1Y L;  3BA9 A;  3C1E A;  3I55 A;  3CME A;  4DV4 Q;  1A3U A;  3M3Y B;  1YI2 A;  5KG1 A;  3OUZ A;  4YB8 B;  3FDS A;  3O13 A;  4JI5 Q;  5IYZ F;  2EE1 A;  4RAU C;  2K01 A;  2EYP A;  4R8N A;  5KGU A;  1I6H H;  3D4R A;  5KFG A;  1WCM B;  4XDX A;  2AUJ D;  3BZD B;  2R7K A;  1HRJ A;  2RSN A;  1SE2 A;  3HFZ B;  4LFC Q;  2EY6 A;  2HD3 A;  3WDN A;  5LL6 S;  5EZY F;  4UCS A;  1XMQ H;  2B29 A;  1HNZ L;  5JEA J;  2BH2 A;  4ED2 A;  3NPP A;  4NXM H;  3UDG A;  2XIG A;  4ME3 A;  3UQ8 A;  2A19 A;  4CKC A;  3I73 A;  4KD4 A;  3MEF A;  4H13 C;  4RCN A;  3K57 A;  4M8A A;  1NAP A;  5I6W A;  1Y1V B;  2R8I A;  1TS4 A;  4FNF A;  3QFF A;  4C3J H;  4HNT A;  1CZG A;  2YTX A;  4JK1 C;  2WKD A;  4DR7 Q;  3A8I E;  2D2C C;  4DUY H;  2E2H H;  4EEY A;  4DR2 L;  4UHV A;  4DPG A;  1RYS A;  4KHP L;  1L2F A;  4DNR B;  3PO3 G;  5EBC A;  3T51 B;  3GV5 B;  5KFC A;  1H9J A;  4JG2 A;  1YNN D;  4RUA A;  3DEP A;  2QW7 A;  3DWA A;  1XNQ Q;  3V6J A;  3TP5 A;  2W6P A;  2UU9 Q;  4MV1 A;  4UP9 A;  3MR6 A;  4DL5 A;  4RNO A;  1GHK A;  2W9B B;  2A68 D;  1V1P B;  3NK9 A;  1PH6 A;  1BR9 A;  3H94 A;  3GTL A;  4DNT B;  2XCA A;  5KT7 A;  5KEE A;  3OW7 A;  4TV8 F;  4J0M A;  2C2E A;  4J9R A;  4NXN H;  4R8U A;  1N8R C;  4QWE A;  1EFW A;  4HJ8 A;  1QVF A;  3EPI A;  2HVR A;  3MFI A;  2E75 C;  1NTG A;  3FPP A;  3I7F A;  4IPH A;  5D3D A;  4EVO A;  5KFP A;  2UXB H;  1K3R A;  2ZJQ A;  3PSI A;  3TP6 A;  5JH7 F;  2A6H D;  2R85 A;  2AHO B;  2R8H A;  4H44 C;  5KKN B;  3PW7 A;  1E4E A;  1XPR A;  4FXK C;  5CB4 F;  1GYF A;  1CQI B;  5LL6 X;  1CQF A;  5JJL A;  4ED3 A;  4QCL A;  4F4Z A;  3W3A A;  4EYH B;  3RB6 A;  4C3I G;  3S1M H;  5JVD F;  1XPU A;  1BCP D;  2VQE Q;  2QCP X;  4JI8 Q;  4EFE A;  4UCU A;  1B53 A;  1GUT A;  2I5H A;  4JOI A;  5KFV A;  2JA5 G;  1IBL Q;  1IL8 A;  5K36 G;  1UE1 A;  4KKU A;  4XIG S;  2OTJ A;  4Y52 H;  4H7B A;  1L2Z A;  1LUZ A;  2C28 A;  5HV6 A;  5L1K A;  1SMY C;  4UPA A;  4YIJ A;  1QB5 D;  1WTO A;  3AFP A;  1TWG H;  1EWC A;  2D0O A;  2G5D A;  3PMF A;  3G71 A;  1IBM L;  4JI4 Q;  3HOW G;  2QK4 A;  5G3L D;  2QA4 A;  2A68 C;  5EJW A;  3ORR A;  3VPD A;  1HZB A;  3IG0 A;  2HJW A;  1T36 A;  3J80 W;  2KEC A;  4NW2 A;  1EUJ A;  2LXK A;  1D7Q A;  3V6K A;  1TWH B;  1MIU A;  3DM1 A;  3R5F A;  1B4O A;  1O7Z A;  1G6P A;  3QOL A;  3R5X A;  5EWF A;  4TRD A;  2BA1 A;  4LFB L;  4DR6 Q;  4F88 A;  4IPG A;  3PO3 H;  1JJC B;  4GKJ H;  4TQS A;  1LTI D;  1I7L A;  5KND A;  5J39 A;  1AUX A;  2X6G A;  4YR2 A;  2KHJ A;  2AGO A;  3V4Z A;  5F2D A;  1C8C A;  1GUS A;  1NY4 A;  1DCZ A;  2VR1 A;  4I55 F;  4IOA A;  3GV6 A;  2CQA A;  1QG7 A;  3J80 L;  2F0E A;  3ITP A;  5IOC A;  1K83 B;  1UC8 A;  4IWY A;  5J2T F;  4R8U B;  4GZY C;  1NNX A;  4F50 A;  1VDZ A;  4RNN A;  4DV3 H;  1STB A;  2VL6 A;  1LTG D;  2NVY A;  3K3P A;  2EYF A;  1IBM Q;  1MHW C;  1C4Q A;  4CC5 A;  1DGS A;  4NKL A;  3GTG A;  2VZA A;  2PZU A;  4L63 B;  2QGQ A;  2C9O A;  3H0G A;  4M7E A;  4MTK A;  3A0J A;  3S2D H;  1RL2 A;  1IW7 C;  1HNZ H;  1Q46 A;  3A5Z B;  1E24 A;  3PUX A;  5ELC A;  1S3O A;  2X0S A;  2RHQ B;  1CKN B;  2R86 A;  3TRZ A;  5IGD A;  1JWM D;  1AE3 A;  2FE3 A;  5A2Q E;  3LX0 A;  3HOX G;  4LFB Q;  3H15 A;  1B2T A;  3UDF A;  4EEQ A;  3CC7 A;  5C4J B;  1O75 A;  2L12 A;  1QZG A;  1G8Z D;  1PTO B;  2FFK B;  1FR3 A;  4LF9 Q;  4JI0 L;  1EIF A;  4DU9 A;  4KJN A;  4ETS A;  3D0F A;  1K1Q A;  4QIW A;  4FS2 A;  2VUM H;  4FO2 A;  4DR1 H;  3ETH A;  2SDF A;  4XQJ A;  3MHB A;  1D5Z C;  5FPO A;  1KXL A;  2NWG A;  1EIH A;  3JAM c;  4O2B F;  2EJF C;  1CHP D;  1V43 A;  4PMW A;  2JA8 H;  4RA8 A;  1HPC A;  4CDF C;  3V4S A;  3E9H A;  2Z0S A;  3DMU A;  1TXY A;  1C7Y A;  1Z6H A;  2B39 A;  5M5X H;  2YRX A;  1Y8O B;  1JDB B;  1EFI D;  5LMN H;  3MA2 B;  4MNO A;  4B3R L;  4UY8 C;  5L1L A;  5CV4 A;  1W93 A;  1P16 A;  1X9N A;  1F2Z A;  2TMP A;  4GS3 A;  1K28 A;  3BDL A;  3HKZ A;  4DV5 L;  4IUU A;  4J9M A;  3D8G A;  3MXP A;  1G51 A;  4L8J A;  4YQW A;  2QEJ C;  4X62 L;  1LT3 D;  1N56 A;  2K32 A;  2ASJ A;  4KTA A;  3ONA B;  4JI3 L;  2UUC L;  2R87 A;  2UVR A;  2F0P A;  1GUO A;  2NVX H;  1PLF A;  1XMO H;  3BJY A;  2LY7 A;  2LSS A;  3PO2 H;  1KJI A;  1RJP A;  2LMC B;  1AN7 A;  5DG8 A;  2WB1 A;  2YL2 A;  4OEL B;  1BQQ T;  3KF6 B;  5C1O A;  1GUN A;  2W6Q A;  4A3I G;  1S5D D;  4MV3 A;  1X56 A;  5C44 B;  3TDQ A;  2YU9 B;  2EY5 A;  1HFN A;  4BY7 G;  3EQL C;  4U6P A;  5LMU L;  3GIK A;  2AQ3 B;  4AQY Q;  2R92 H;  4POF A;  3FDT A;  4A3J B;  2XGP A;  4IFD H;  1ET9 A;  1M90 C;  3GTG B;  3RUP A;  3OSO A;  4NMZ A;  3NWT A;  3H0G G;  2B2Y A;  5CGK A;  3JAM E;  4B9X A;  4LF7 H;  3GLK A;  4FF3 A;  4B3S H;  1TKW B;  1QCB D;  1UAP A;  3CCQ A;  5KYI A;  2V9W A;  3BQ1 A;  1ROD A;  3M4Q A;  4X66 L;  2WAC A;  3CCE A;  3GD7 A;  4LNQ A;  5KFZ A;  1NJI C;  2XRQ D;  4ZK9 B;  1LV9 A;  4DV7 Q;  1SE8 A;  5EKK A;  4CJ0 B;  3PIO 3;  4DV2 Q;  2OF1 A;  1XTC D;  4RZQ A;  2JA7 H;  1EWH A;  1EIY B;  5EGT A;  1PRT C;  3AU7 A;  5KT3 A;  2KOL A;  2B2W A;  2K28 A;  3K59 A;  4A76 A;  1XNQ L;  3J7Z C;  1BVS A;  2FLL A;  1OXT A;  2ASB A;  1E1O A;  4RKL A;  2YCH A;  1A8V A;  4X66 H;  4I4T F;  1XNR H;  4AYB A;  2RCF A;  1XYI A;  3RV4 A;  3OTO Q;  2ZJT A;  1S0O A;  5IGB A;  1BXR A;  2XCP A;  5IYB H;  5IGC A;  3RJ0 A;  2C35 B;  1VQL A;  1J9O A;  2W8L A;  1VF5 C;  1MSH A;  2IJ0 A;  2ZXR A;  4LF7 L;  4AQY L;  1KJJ A;  4YBZ B;  4XX0 B;  2NUA B;  4C56 C;  2RDG A;  4RUC A;  4IUR A;  2ASD A;  4LH6 A;  4ID6 A;  2NVY H;  4DFA A;  3ETJ A;  2F0T A;  3HOX B;  1VBG A;  4WBN F;  2W57 A;  5JPN C;  5BR8 Q;  3PF5 A;  2R7D A;  3RGX A;  3H0G H;  1WTX A;  5FLX W;  5K5P A;  2PBZ A;  2VUG A;  4X65 Q;  3A7L A;  1PYW D;  5G3L F;  2B63 G;  2R82 A;  1Q1B A;  4DR2 H;  4QUF A;  1HA5 A;  1GUG A;  2FKL A;  4KHP H;  4IJL A;  5C0X I;  4B3S L;  4LMQ D;  4A3E G;  1D2B A;  3HOY G;  5LL6 b;  1OO9 B;  2K4K A;  5KFU A;  4FDB A;  1KNE A;  3I3C A;  4KLK A;  1I4X A;  2KED A;  3U9O A;  1M7J A;  1MZB A;  1YVC A;  3VR6 A;  4DV4 H;  2YYZ A;  2R3Z A;  5HGQ A;  3WO0 A;  3FEW X;  1VQM A;  5M5W H;  3WO1 A;  4YWL A;  4A3L H;  3LGJ A;  2BE5 C;  2JEI A;  5M5X B;  4GNX A;  1SDF A;  1ESF A;  1PVO A;  4AYB G;  2OH2 A;  4UDU C;  3CD6 A;  4FS1 A;  4A93 B;  4XQQ A;  2WB1 E;  2HT1 A;  3QIA A;  2YU9 A;  4F87 A;  1BCP F;  4ZRZ A;  2GA4 B;  3IFD A;  5T1G A;  3PF4 A;  3ERQ A;  2P5Z X;  2L55 A;  3V05 A;  1GVP A;  5DGB A;  1XMQ Q;  1RTO A;  3VA5 A;  1L0X B;  4A2B A;  3PGZ A;  4I7H A;  2N78 A;  1NUC A;  4ZQ3 A;  5CBE E;  3FP9 A;  4MAM A;  1KDA A;  1SYX B;  1TU2 B;  3T5L A;  3S15 H;  4QMG A;  3E5N A;  3FPU B;  3GII A;  5I9P A;  4JYA Q;  1LAC A;  2CW0 C;  1NE3 A;  4GN5 A;  2V5A A;  2SNM A;  3K5L A;  2PW7 A;  4BXX G;  1G29 1;  2V1C C;  4BY7 B;  5JOB A;  4A3J H;  4IRD A;  3BG5 A;  1SYF A;  1MJC A;  3S1Q B;  1M8A A;  4J9S A;  1SND A;  2UUB L;  4J9P A;  1B8A A;  4ECU A;  4IRK A;  4JV5 L;  2RA4 A;  2E2I H;  2OT2 A;  1E4F T;  2FMA A;  2ZM6 H;  1STA A;  5DQI A;  3MWE A;  1AN8 A;  1L0W A;  2MO1 A;  4QF4 A;  5KFO A;  1SYD A;  1X65 A;  4RFB A;  1RIP A;  3HOW H;  4CKB A;  4AYB E;  5FD6 A;  4I7Z C;  1FNV A;  2M05 A;  4MV9 A;  1PH2 A;  2IWH A;  1MJE A;  1RTN A;  4H0L C;  2Q8R E;  4JI6 L;  2UUB H;  4IR1 A;  3JZI A;  2E2H A;  3K58 A;  3KDF B;  5KFE A;  5M3F B;  4R4I A;  1EU4 A;  4RWS C;  1E2Z A;  4K5W A;  2W6M A;  4A3I B;  1Y8P B;  2EIF A;  5ELF A;  1SFO A;  1CA5 A;  1ENC A;  4YHH Q;  1NMG A;  1TII D;  2IT1 A;  3WOF A;  2SNS A;  5CYU A;  3SEB A;  1EU3 A;  5LA6 F;  2YV5 A;  2VW9 A;  4A3J G;  2NVY B;  1PH3 A;  4JI8 H;  2HDL A;  4ECT A;  2JA8 G;  1KL9 A;  4M1U B;  1HR0 W;  1IYU A;  3NBH B;  3CHB D;  4CJ1 B;  3GTL H;  1J5E Q;  1XXG A;  1VQK A;  3H0G B;  3ULP A;  4OHJ A;  4ED1 A;  1VCI A;  1R4P B;  4A3K G;  4EG0 A;  1W6J A;  4OON A;  2K14 A;  5M3M G;  1K0R A;  1Y69 U;  5KG3 A;  2F03 A;  2NZO A;  5EOY A;  2BA0 A;  4A3M H;  2Q8T A;  1CQJ B;  3AMU A;  3MWD A;  3HKS A;  4DK3 C;  2R84 A;  3HOY B;  5L1J A;  3A7A B;  4KN7 C;  1VMC A;  2V4D A;  3J7A F;  1ML0 D;  2L5T A;  3RD4 A;  3FKI G;  3F1Z A;  1T3N A;  1H9R A;  3E3X A;  5E4W C;  1VMP A;  5A2Q L;  3VPC A;  5I9O A;  3BVZ A;  4LJZ C;  2QDB A;  3F2U A;  1B3Q A;  3GDE A;  3N52 A;  5J1Z A;  1I94 Q;  4OO1 I;  1UE6 A;  2PQE A;  4JI6 Q;  2CWA A;  4YY3 Q;  5IY0 A;  3S24 A;  3GIP A;  2FXQ A;  4MTN A;  2YTV A;  3KK7 A;  1LT6 D;  3NEN A;  3CKI B;  3HKZ E;  5I2Y A;  4K6D A;  3CMA A;  3NQT A;  3K8A A;  3RAQ A;  1A2T A;  2W71 A;  4BY1 B;  2BQU A;  4OXP A;  3MR5 A;  4PQX A;  1LT5 D;  5I2X A;  1N34 H;  3S1R B;  1CM9 A;  2C2R A;  2F0U A;  5DAU A;  2FIN B;  1AZQ A;  2JEJ A;  1X54 A;  4XT3 B;  2J7Z A;  2KA7 A;  1Y1W H;  4BBR B;  3HS0 C;  3RZO H;  1JCK B;  1ESR A;  1TY2 A;  4FM9 A;  3K0X A;  4C3J G;  3JAM i;  5C1P A;  3G6V A;  4LF6 H;  3PZP A;  1YZ6 A;  3GTJ B;  4PNY A;  4DV3 Q;  3C3L A;  3TP8 A;  2KHS A;  4QL5 A;  3GTK B;  4RB0 A;  1SN8 A;  4MTE A;  2CCZ A;  4X64 L;  4BY7 H;  1TWF H;  3M9O B;  3N41 B;  4C3J B;  3FHW A;  3MEH A;  4FYD A;  5KG2 A;  4RB3 C;  4NXN L;  1YNX A;  4Q8F A;  4IUV A;  1KNA A;  1PH8 A;  3G7L A;  2VQE L;  3TS0 A;  1H9S A;  2WKC A;  4EGJ A;  2CZG A;  4LF4 Q;  2QKI C;  1UEA B;  4QB4 A;  2E2I B;  2NU8 B;  4H02 A;  4QJF A;  3EPG A;  4ULL A;  3JSL A;  4J9O A;  5J3B A;  4PG3 A;  4ZHQ F;  2WAQ G;  2W7P A;  1TVX A;  4O4H F;  1YHB A;  1QWY A;  4UP8 A;  2X6L A;  1N33 Q;  2NVT H;  4GOP C;  1EQQ A;  1YJN A;  4KI0 A;  5KG4 A;  1IW7 D;  3PR4 A;  2R7L A;  2HCI A;  5F9N A;  2Q2I A;  4B3T Q;  4A3B G;  3M4I A;  4DA2 A;  1TWF A;  3OIQ A;  1N32 H;  4TKO B;  1PTO C;  1SYE A;  4DR1 Q;  1CQV A;  2Y0S E;  4LUO A;  2K50 A;  3MFG A;  3K5M A;  2RBM A;  5M3M H;  2NN6 H;  2IMW P;  3K5I A;  1PZK D;  1Y14 B;  3C46 A;  5KX5 F;  1D6E C;  4RGO S;  4B3R H;  4DL3 A;  1PRT F;  3CU7 A;  1LM0 A;  3AB9 A;  5IYB G;  5BR8 L;  4X64 Q;  1RK5 A;  3Q23 A;  4DR6 L;  3KJO A;  1B9M A;  3KOJ A;  2F4V H;  4DUY L;  1T9H A;  1R9T B;  1CZW A;  1KRS A;  4KY6 A;  4Y7N H;  1SAP A;  3S1M B;  1FNW A;  4QWA A;  1C3O A;  3MXG A;  1GHJ A;  3ULJ A;  2DNC A;  5E7N A;  4ZAI A;  4CDC C;  1CA6 A;  4JV2 A;  1V4Y A;  3SI8 A;  1YEZ A;  2JA7 G;  3W1B A;  2UXD Q;  2PZW A;  1EUD B;  3M4Y A;  4HR7 A;  1F9S A;  1L1O A;  3GTQ B;  2WB1 G;  5FLX L;  1Z7T A;  2DJG C;  3BZK A;  5IYC H;  4UCV A;  1BO0 A;  2J4X A;  2UUA H;  1EY4 A;  4A3F G;  5D65 A;  5EWE A;  4HSP A;  3GTM B;  4N9T A;  4O3N A;  1OTC A;  2F3W A;  4U7C A;  3NBI A;  2PQA B;  1BJT A;  3PUW A;  2DWC A;  2ZTD A;  1VQ9 A;  2E5L Q;  3PVX A;  4O2D A;  3GQC A;  4DV0 H;  4IUQ A;  4YAK B;  3RNU A;  4AQY H;  1D5M C;  1BBW A;  1I50 H;  3I70 A;  3M9B A;  2IX3 A;  2Y0S A;  2ATL A;  3N6R A;  4JBW A;  1RK6 A;  1PFB A;  2Z8L A;  3JSN A;  5J22 A;  2O5J C;  1XDN A;  4BY1 H;  2PN1 A;  1DOK A; 
#chains in the Genus database with same CATH homology
 1C9O A;  4DNI A;  2BA1 A;  4LFB L;  4DR6 Q;  4LUV A;  1TWH H;  1B7Y B;  2VY3 A;  4IPG A;  3PO3 H;  1JJC B;  3E9I A;  3J80 i;  4X62 Q;  5C44 H;  4GNX B;  4JOI C;  2K5N A;  5GAE C;  3K81 C;  1IBK Q;  3PUY A;  4BBR H;  3GTK H;  2KHJ A;  1X3E A;  4LFA L;  3KDF A;  3CXC A;  2NVQ H;  1NY4 A;  2Q2T A;  4BBR G;  1Z47 A;  3HOU G;  4YHH L;  5H1S E;  3I4N G;  4IOA A;  4NXM Q;  1HH2 P;  1E22 A;  1QVG A;  4UP7 A;  4GN3 B;  3UE0 A;  2D0P A;  2N3S A;  1IYJ B;  2E8G A;  3S1N H;  4JV5 Q;  1YHQ A;  4HJA A;  2UUA L;  1SLJ A;  4GLX A;  1UE5 A;  3H3V I;  2VL6 A;  1SRU A;  1XMQ L;  4DR5 Q;  1VQJ A;  4LF8 L;  3CP0 A;  1IBM Q;  2NZH A;  4C3I H;  1DGS A;  1YJW A;  3G6E A;  2VZA A;  4C3H H;  3BZC A;  5AJ3 L;  1N34 L;  1XNR L;  3RLO A;  2QGQ A;  1A0I A;  1V9P A;  3A0J A;  3BU2 A;  1RL2 A;  4YWK A;  5FLM H;  1PH5 A;  4L5S A;  3ICE A;  3S2D H;  1OXV A;  4OX9 L;  1GM5 A;  4EX5 A;  2HIX A;  1Q46 A;  3A5Z B;  3I2Z A;  5LMN W;  1PV4 A;  1E24 A;  1WFQ A;  3PUX A;  3J81 c;  1S3O A;  3PUV A;  4QIW E;  2RHQ B;  1CKN B;  4DV6 L;  3TRZ A;  1YBY A;  4AH6 A;  1AE3 A;  1O7I A;  2NN6 I;  2VUM G;  3HOX G;  1YHA A;  2Z6K A;  4LFB Q;  3H15 A;  4IFD J;  3UDF A;  4DKA C;  3G48 A;  1I94 L;  1WI5 A;  2MNA A;  3CC7 A;  4EQ5 A;  4HIM A;  1QZG A;  4DV4 L;  4P72 A;  3TEH B;  4YY3 L;  2I5M X;  4LF9 Q;  1FGU A;  4JI0 L;  1EIF A;  1ASZ A;  2CQO A;  2UUB Q;  3TQY A;  2UXB L;  1KAW A;  1CKO A;  3D0F A;  5EAY A;  4JI1 L;  3CAM A;  4IPC A;  2HHH L;  1CSQ A;  2VUM H;  3CCM A;  4BXX H;  1VQE A;  4DV1 Q;  3WWV A;  2LXJ A;  2H5X A;  1KXL A;  2I5L X;  3JAM c;  3CCU A;  2JA8 H;  1V43 A;  4PMW A;  4DR4 L;  3F2D A;  1VS0 A;  2OCE A;  4LFC L;  1N36 Q;  3S2H H;  5LMN L;  3U4Z A;  3UE1 A;  4QQB X;  1VQG A;  4BY1 G;  2JE6 I;  3E9H A;  2Z0S A;  2UXC Q;  2KBN A;  1TXY A;  3M4P A;  1C7Y A;  4A3L G;  5M5X H;  1WJJ A;  4BA1 I;  1VQA A;  5ELO A;  4MNO A;  4IFD I;  4UY8 C;  2EXD A;  4B3R L;  1P16 A;  4J15 A;  2IX0 A;  4A3E H;  1X9N A;  5FLX c;  4JI7 Q;  4GS3 A;  1PH9 A;  4DV5 L;  1G51 A;  4A93 H;  2YTY A;  3TRE A;  4X62 L;  1J6Q A;  2GVB A;  1W3S A;  2F52 A;  2OQK A;  1X3G A;  3J81 i;  3CCS A;  1OXS C;  1VQO A;  1N32 L;  1FJG L;  2ID0 A;  4GNX C;  4JI3 L;  1IBK L;  2UUC L;  2JK8 A;  5IP7 G;  3S17 H;  1HZA A;  4LFA Q;  1E7Z A;  1GKH A;  1SMX A;  1Z9F A;  2NVX H;  4LF4 L;  3PO2 H;  2LSS A;  5ELN A;  4JI2 L;  4JI0 Q;  1CUK A;  1Q81 C;  1J5E L;  1X6O A;  4HIO A;  4QY7 A;  3KF6 B;  4OWT B;  1XPO A;  4LF6 Q;  3DLL A;  1TWC H;  4KHZ A;  3D31 A;  3PUZ A;  4A3I G;  1K8A C;  1X56 A;  1KRT A;  1JB7 A;  4A3D H;  4LF5 Q;  1WCM G;  4BY7 G;  5LMU L;  1UWV A;  3HOZ G;  2MO0 A;  4AQY Q;  3GTG H;  2R92 H;  2R6G A;  4POF A;  1Y1V H;  2WAQ E;  4DK6 C;  1V1Q A;  3ULL A;  3GTJ H;  3EN2 A;  3CPF A;  3NEM A;  2B3G A;  4P73 A;  1M90 C;  2UXC L;  5AJ3 Q;  1N34 Q;  2ZM6 Q;  4DR1 L;  2Q2U A;  2ZTC A;  3Q8D A;  5JJK A;  3HKZ G;  3NEL A;  3H0G G;  2HIV A;  4DV3 L;  3PCO B;  3I4M G;  3M85 A;  1K83 H;  2OQ0 A;  3HOZ H;  4GKJ Q;  3CCQ A;  3EIV A;  1CKN A;  4HID A;  4JI5 L;  3M4Q A;  4GOP A;  4X66 L;  4JI7 L;  1JMC A;  5C4X G;  4LNQ A;  3PV0 A;  3GD7 A;  3CCE A;  1NJI C;  3ZJY C;  4DV7 Q;  1SE8 A;  2KHI A;  1A62 A;  3PIP A;  4DV2 Q;  4A3C G;  2JA7 H;  4DUY Q;  2ATW A;  1EIY B;  1SRO A;  5JEA G;  1N32 Q;  3I4N H;  1XNQ L;  1QVC A;  1BBU A;  1B70 B;  2GVA A;  3J7Z C;  4A76 A;  1VQN A;  3M4O H;  4A93 G;  1BVS A;  5JJI A;  1OXT A;  2UXB Q;  2ASB A;  4LUZ A;  2B63 H;  1E1O A;  1HNW Q;  1A8V A;  4O0A A;  2A1A A;  1U0L A;  3OTO Q;  4A3C H;  4L5R C;  1NBW A;  5IYB H;  3KYH C;  4DR4 Q;  3L0O A;  2R93 G;  2C35 B;  1VQL A;  4BY1 H;  4LF5 L;  4A4I A;  4LF7 L;  4AQY L;  5M3F H;  3S16 H;  2R93 H;  2VS1 A;  3K7U C;  2F4V Q;  2NVY H;  4LWC A;  5GAD C;  1M1K C;  1K8G A;  4JI4 L;  1D8L A;  2Y0S G;  4APV A;  2OTL A;  5IP9 G;  4NXN Q;  5BR8 Q;  2WFW A;  4P71 A;  2R7D A;  3PF5 A;  3RR5 A;  3H0G H;  1KD1 C;  4X65 Q;  5DLQ E;  2ZJR A;  1A63 A;  4R4O A;  2B63 G;  4K0K Q;  4DAY B;  1Q1B A;  3AQQ A;  3KF8 B;  4IJL A;  5C0X I;  2UU9 L;  4B3S L;  3ER0 A;  4JI8 L;  4A3E G;  1QUQ B;  4JCV E;  3HOY G;  4BBS G;  1W2B A;  2K4K A;  4FDB A;  2R7F A;  4IO9 A;  3CCL A;  2CWP A;  1OXU A;  4PZ8 A;  4OWW B;  4KLK A;  5C4X H;  1UE7 A;  3UDI A;  1YVC A;  2K52 A;  2YYZ A;  5IYC G;  5HGQ A;  1VQF A;  1VQM A;  5M5W H;  5IT9 c;  4YWL A;  4A3L H;  3LGJ A;  1IBL L;  5IYD H;  2PI2 E;  4GNX A;  1PVO A;  1LTL A;  4TVA B;  4AYB G;  1L1O C;  4DV0 Q;  2R7Z G;  3HOY H;  2I0Q A;  4BBS H;  3CD6 A;  1HNW L;  1Q1E A;  5IE8 A;  2WB1 E;  3JC6 6;  1YJ9 A;  2HT1 A;  3AYH B;  1IXR A;  1Q12 A;  2KCT A;  1GD7 A;  1VQ7 A;  2E5L L;  3T1H Q;  3CC2 A;  3PF4 A;  3GTM H;  3L7Z C;  2MQH A;  3E0E A;  1JJ2 A;  2UUA Q;  1GVP A;  3CCR A;  3M3Y H;  1AH9 A;  5C3E H;  1XMQ Q;  2R92 G;  3KLW A;  4L5T A;  4ALP A;  3PGZ A;  1C0A A;  3CQZ H;  1FVI A;  5M3F G;  2VQF Q;  5C0X G;  3F2C A;  2JJQ A;  2N78 A;  4R4Q A;  1PH4 A;  1JJG A;  3FP9 A;  1K73 C;  4YWM A;  3GO5 A;  4GOP B;  3T1Y Q;  3HOU H;  3M7N A;  3STB D;  2JA6 G;  3S15 H;  5GQO A;  4K0K L;  1JE5 A;  2XTI A;  3RN5 A;  4GLA C;  4JYA Q;  1WYD A;  2UXD L;  5GAH C;  2IY5 B;  4DV2 L;  4IPD A;  2QEX A;  1NE3 A;  1BKB A;  4GN5 A;  5C0X J;  2OWO A;  2AMC B;  4JC0 A;  2KCM A;  4BXX G;  5C44 G;  1G29 1;  2V1C C;  3U50 C;  4DUZ L;  4A3J H;  1HR0 Q;  4HJ7 A;  4BA2 I;  2ZJP A;  2AWO A;  4X6A H;  3J80 c;  1MJC A;  4DAM A;  1PFS A;  2PQA A;  3STB C;  1JT8 A;  2MFI A;  2JA6 H;  4A3D G;  2KEN A;  2NN6 G;  1S40 A;  3U4V A;  2UUB L;  1B8A A;  1VQ4 A;  1HZC A;  4JV5 L;  2WP8 J;  2R7Z H;  1VQB A;  2E2I H;  2JQO A;  1HNZ Q;  4QGU A;  4JBK A;  2RCN A;  1L0W A;  2MO1 A;  2RHS B;  3OW2 A;  4JBM A;  4LF7 Q;  2ES2 A;  1X65 A;  3HOW H;  1RIP A;  3RLF A;  1S72 A;  3AFQ A;  4JBJ A;  4AYB E;  1WOC A;  5C3E G;  3RZD H;  1PH2 A;  3CPW A;  3A74 A;  1E3P A;  1SR3 A;  5IWA Q;  1MJE A;  1KC8 C;  3PIO A;  3A5U A;  1Y1W G;  4B3M Q;  4A3G H;  4OX9 Q;  5IP9 H;  4JI6 L;  1EOV A;  2BH8 A;  1VQ5 A;  4B3R Q;  3RLN A;  2N49 A;  3KDF B;  4DV6 Q;  4R4T A;  1X55 A;  2PI2 A;  4R4I A;  1VQI A;  2PMZ E;  2E2J H;  4A3M G;  1Q86 C;  1FL0 A;  1PH7 A;  3F2B A;  2XGT A;  2IX1 A;  2CFM A;  4R4C A;  2EIF A;  1I5F A;  4LF9 L;  1UEB A;  4LW1 A;  4YHH Q;  1P8L A;  3PO2 G;  1NMG A;  1H95 A;  1CKM A;  1N9W A;  2IT1 A;  4WJ3 M;  3UDX A;  2YV5 A;  2VW9 A;  4DUZ Q;  2HQL A;  2L15 A;  4A3J G;  1PH3 A;  1N33 L;  3G4S A;  1VQH A;  1KQS A;  3HOV G;  3DM3 A;  2JA8 G;  4IOC A;  4JI1 Q;  5FLM G;  2HHH Q;  1E1T A;  1KL9 A;  1HR0 W;  4GKK Q;  3NBH B;  1Q8K A;  3W1G A;  4B3T L;  1EWI A;  3GTL H;  1PYS B;  1J5E Q;  4DR5 L;  1VQK A;  4GN4 B;  1HJP A;  5LMN Q;  3ULP A;  3CCV A;  2PNH A;  1VCI A;  1Y1V G;  4A3F H;  4A3K G;  4OON A;  2K14 A;  5M3M G;  2ZTE A;  1XJV A;  4NB3 A;  4PZ6 A;  1K0R A;  4RMF A;  3KF6 A;  4YCW A;  4OWX B;  1K9M C;  5LMU Q;  2NZO A;  3KJP A;  2BA0 A;  4A3M H;  1VQP A;  3CCJ A;  5IYD G;  2AWN A;  4DR7 L;  3HKS A;  4DK3 C;  4DR2 Q;  4KHP Q;  4WJ4 A;  2VQF L;  5IP7 H;  3FKI G;  3F1Z A;  3S14 H;  4IJH A;  5IWA L;  3GTQ H;  4B3M L;  2K5V A;  3GDE A;  1I94 Q;  1XTD A;  4OO1 I;  3T1Y L;  1UE6 A;  3I4O A;  4JI6 Q;  3I55 A;  3CME A;  4DV4 Q;  4IFD G;  2CWA A;  4YY3 Q;  1VQD A;  1YI2 A;  5IY0 A;  4JYA L;  1FJG Q;  3S24 A;  4JI5 Q;  2FXQ A;  4MTN A;  2YTV A;  3NEN A;  1WCM H;  3HKZ E;  3CW2 C;  4DV7 L;  5GAG C;  1I6H H;  3OYY A;  3CMA A;  2AKW B;  3CF5 A;  4PZ7 A;  3K8A A;  4DV1 L;  1U5K A;  1L1O B;  2ALY B;  4GLV B;  2JEB I;  1HZ9 A;  4OXP A;  4JI2 Q;  1IZ6 A;  3K80 C;  4HJ9 A;  3HFZ B;  4LFC Q;  3GTP H;  4LF6 L;  1X54 A;  3SGI A;  3RN2 A;  2B29 A;  3S1R H;  5JEA J;  1Y1W H;  1HNZ L;  2BH2 A;  4A3G G;  3UDG A;  4RG1 A;  5FJ8 H;  1XMO Q;  2GN5 A;  2YU9 H;  3RZO H;  4ME3 A;  4HJ5 A;  3K0X A;  2A19 A;  2JA9 A;  3JAM i;  4HIK A;  3MEF A;  2K5H A;  3S1Q H;  1I3Q H;  1YZ6 A;  3TS2 A;  4DV3 Q;  4DR3 L;  4C3J H;  4QL5 A;  1SN8 A;  2YTX A;  2CCZ A;  4POG A;  4DR7 Q;  4GKJ L;  4X64 L;  2E2H H;  4BY7 H;  1TWF H;  4DR2 L;  4DV5 Q;  4DPG A;  1IL2 A;  4KHP L;  1L2F A;  3FHW A;  4OO1 G;  3PO3 G;  4NXN L;  1YNX A;  1HNX L;  2CKZ B;  1PH8 A;  2JEA I;  1KHI A;  1OXX K;  2VQE L;  3MXN B;  4P75 A;  3TS0 A;  2F3I A;  1SFO H;  4JG2 A;  4X65 L;  3B6Y A;  2JA5 H;  4X66 Q;  2UUC Q;  4JI3 Q;  4LF4 Q;  4R1J A;  4H02 A;  4QJF A;  1Q7Y C;  1XNQ Q;  5J3B A;  2UU9 Q;  4PG3 A;  4UP9 A;  4B3S Q;  2WAQ G;  1YHB A;  1YIJ A;  4UP8 A;  1N33 Q;  2NVT H;  4GOP C;  2IHE A;  1EQQ A;  1QUQ A;  1Q82 C;  1YJN A;  4KI0 A;  1PH6 A;  2A8V A;  1VQ6 A;  2K75 A;  3CC4 A;  4GKK L;  4XTC S;  2Q2I A;  4B3T Q;  4A3B G;  1VQC A;  3BJU A;  4A3I H;  1N8R C;  3K7A H;  1EFW A;  4HJ8 A;  1QVF A;  4MZ9 A;  1NTG A;  3I7F A;  4IPH A;  2ZM6 L;  4DR1 Q;  4LF8 Q;  1K3R A;  2F4V L;  3HOX H;  3PSI A;  1KIX A;  2ZJQ A;  2Y0S E;  1PHJ A;  4LUO A;  2K50 A;  5HY6 A;  1XNR Q;  5M3M H;  2AHO B;  5C4J H;  3T1H L;  4NPS A;  1Y14 B;  1GO3 E;  3ERS X;  3VDY A;  3F8T A;  5M5Y H;  1XPR A;  4DR3 Q;  1LM0 A;  2VNU D;  1LYL A;  5IYB G;  1TWA H;  5BR8 L;  4X64 Q;  5JJL A;  4DR6 L;  3HOV H;  3KJO A;  3KOJ A;  1VQ8 A;  4DUY L;  1T9H A;  1HNX Q;  3S1M H;  3I56 A;  1XPU A;  2VQE Q;  1KRS A;  4TQU S;  4Y7N H;  4YCV A;  4JI8 Q;  3AEV A;  1X3F A;  3ULJ A;  5E7N A;  5GRO A;  1R9T H;  1ASY A;  1CSP A;  2N8N A;  3H3V H;  2Z6K C;  1YEZ A;  2I5H A;  4JOI A;  3W1B A;  2JA7 G;  4P74 A;  2UXD Q;  2JA5 G;  1IBL Q;  1NMF A;  2IHF A;  5K36 G;  1UE1 A;  4XIG S;  1L1O A;  4NXM L;  2OTJ A;  4Y52 H;  3OTO L;  2Q2H A;  2RF4 A;  2WB1 G;  3BZK A;  3W5O A;  5IYC H;  1HR0 L;  4A75 A;  4AIM A;  1PA6 A;  1EYG A;  1LUZ A;  2D62 A;  4UPA A;  4A3F G;  4A3K H;  3J7A 5;  4DV0 L;  3AFP A;  1TWG H;  2D0O A;  4A3B H;  1EQR A;  3L2P A;  1OTC A;  4C2M H;  1PYB A;  3G71 A;  3U58 A;  1N36 L;  2PQA B;  1XMO L;  1IBM L;  3PUW A;  4JI4 Q;  2ZTD A;  3HOW G;  1VQ9 A;  3GTO H;  2QA4 A;  2E5L Q;  4O2D A;  3IRB A;  1HZB A;  5FJ8 G;  1YIT A;  1AE2 A;  3KFU A;  3RNU A;  3FKI H;  4L5Q A;  1PH1 A;  1BBW A;  1QZH A;  2EQS A;  1EUJ A;  2LXK A;  1I50 H;  3M9B A;  4YCU A;  2DGY A;  1D7Q A;  4JBW A;  2DUD A;  1MKH A;  1MIU A;  3J81 j;  1G6P A;  3EBE A;  3I4M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...