3HOXG

Complete rna polymerase ii elongation complex v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoxG01
4X62Q 4GOPA 4TQUS 4NXNL 2N49A 1K9MC 2N3SA 4JG2A 4LF8Q 4C3HH 1AE2A 5IYDH 4DR6Q 3A5ZB 4IPHA 4X6AH 3PUXA 4R4TA 3KLWA 4JI3Q 2VQEL 3CCSA 4UY8C 1EUJA 1X3EA 4GLXA 3RLFA 1FL0A 4DV1Q 2R93G 1A62A 4R4CA 1N36Q 4DUZQ 1HNXQ 4A3CH 4HIMA 4KI0A 5C44G 1VQ7A 4DV0L 4LF9L 1TWHH 3CPFA 2HIVA 2VNUD 2KCMA 1BBWA 2ZJRA 4UP7A 1V43A 5IP9H 3G71A 1N34L 1H95A 2ZM6Q 3TRZA 2UXCL 4R1JA 2R7DA 3S15H 1PH3A 3A0JA 1NY4A 4JI4L 3J80c 1PH5A 1PH6A 3BZKA 4IJHA 1VQPA 2NZHA 4QGUA 4YHHL 3KFUA 5J3BA 3FKIG 1X54A 3NENA 4IPCA 1MJEA 5M3FH 1GM5A 1QVFA 4BA1I 5FJ8G 4GKJL 3HOXH 3UDXA 1EOVA 4MZ9A 4TVAB 4XIGS 3GO5A 4POGA 1BVSA 4PZ8A 1E1OA 3PSIA 1N33L 4A3JG 2I5HA 3H0GG 1XJVA 3L7ZC 1WCMG 4BY7G 4DR2Q 1SE8A 1SR3A 4LF7L 1NJIC 5JEAG 1OXTA 3VDYA 1YJNA 2NVTH 1G6PA 3OTOL 5JEAJ 1VQCA 4A3LG 1V1QA 2CCZA 2CWPA 4Y7NH 2Q2TA 2UXBL 2K4KA 2MFIA 3CCJA 1KIXA 2WAQG 4PG3A 1MKHA 5C0XG 2ALYB 1Q86C 1N36L 1CUKA 2JA6H 3GTGH 1BKBA 3T1HQ 1Q1EA 2UUBL 1KD1C 1Q12A 4LF9Q 4DR3Q 1S40A 4LFBQ 2K50A 3RZDH 1X3FA 4QJFA 1LTLA 3KYHC 4YWKA 2DUDA 3HOWH 2VW9A 2WP8J 1WOCA 3GTQH 4A3KG 4A4IA 4IJLA 1YVCA 1L0WA 3CCLA 4YHHQ 5IYBG 1YZ6A 2MO0A 3M4OH 1D8LA 1BBUA 1CKNA 4DV5L 4JI7L 2UXDQ 4LW1A 4WJ4A 1OXXK 2WAQE 4L5QA 1YHBA 1X56A 4C3JH 1YI2A 1IBKL 2UU9L 1VQ6A 2YV5A 1P8LA 3NEMA 2OTLA 3SGIA 1K8GA 4EQ5A 3CC7A 4YY3Q 1EYGA 4A3DH 4A3GH 2F4VL 4Y52H 5LMNW 4DR5Q 3D31A 2VQFL 5C4XH 4A3MH 2WB1E 5IE8A 3AYHB 2RHSB 2V1CC 2JJQA 4BA2I 1K73C 1VQ8A 2YTXA 2PI2A 1PHJA 1MIUA 3TEHB 4JBWA 2E2HH 1PH2A 2DGYA 2UXBQ 1XMOQ 4GN5A 4KLKA 2EQSA 2HIXA 3GD7A 1YHAA 4DR4Q 4IFDJ 4JI6Q 4A3EH 3DM3A 3I7FA 4MTNA 3RLNA 5M5WH 1E1TA 4DV7Q 5IP7G 2NZOA 2VS1A 4A3EG 2B63H 5LMUQ 1IBLL 3HOYH 1I6HH 4B3SL 2IT1A 3OW2A 1RIPA 1X9NA 4B3ML 3PO3H 1QUQB 3S14H 4DV3L 1Q46A 2OQ0A 3LGJA 4DUYQ 2YYZA 3I4OA 4JI8Q 1LM0A 4UP9A 4UPAA 3JAMi 4HIOA 1NTGA 2PNHA 3M3YH 2UXDL 2IX0A 4DV6L 3CMEA 4DPGA 3TS0A 4JI2L 4JI1L 3TQYA 5AJ3L 4GNXC 4X64L 4JCVE 3HOUG 2KHIA 2F52A 1SROA 2HHHQ 5GQOA 1VQ5A 5K36G 5IYCG 2IHEA 3ZJYC 3BJUA 1AH9A 2D62A 4LF8L 2E2IH 4DK6C 3I55A 1OTCA 3S1QH 1FJGQ 1TWCH 1L1OA 1Y1VG 5H1SE 3OYYA 3UE0A 1J5EQ 4JI3L 3HOXG 2Q2HA 1IXRA 1RL2A 4B3TQ 2YU9H 1U0LA 1YHQA 2MQHA 4ME3A 3HOVG 1VQHA 4DNIA 5FLXc 1JT8A 3HOZG 4OX9L 3G48A 3J81i 5LMNQ 1YJ9A 2OTJA 5GADC 3IRBA 2YTVA 5IP9G 1L1OB 4DAMA 3K8AA 3K81C 5IWAL 1FGUA 3HOYG 5IP7H 2B63G 3PUWA 4IOCA 2BA1A 2I5LX 5DLQE 3CD6A 1KAWA 4OWTB 4DV3Q 4H02A 4OO1G 4OWXB 2VY3A 1KC8C 4A3LH 1NMFA 4YCUA 1CKOA 1VQAA 2JEAI 3RNUA 1VQJA 1JB7A 4QY7A 3PF4A 1VQFA 4X65L 3STBC 1HR0L 1CSQA 3UE1A 1UWVA 1N32L 4X66Q 3M85A 2JA7G 3M7NA 3K7AH 4DUZL 2N8NA 4JI0Q 1EFWA 2A8VA 1HR0W 4DR2L 4DV2Q 4LF7Q 1VQGA 5JJIA 2IY5B 3TREA 5BR8L 3E9IA 3FKIH 3GTOH 3OTOQ 3M4QA 2F3IA 1HNZL 4AYBG 4A3BG 1ASZA 1E24A 1I3QH 2WB1G 1CKNB 1Y14B 2XGTA 1QZGA 4LF6L 1IZ6A 1UEBA 2JK8A 3I56A 3A5UA 3PO2H 1FVIA 3HFZB 1R9TH 1PH1A 3I4MG 2UUBQ 4NXMQ 2VUMH 4GN4B 2R6GA 1TXYA 1WI5A 4J15A 2UUAQ 4PZ6A 5GAHC 3EBEA 4PMWA 1XPUA 4A3FG 3PGZA 2QEXA 1YIJA 3KJOA 3JAMc 2K14A 1A8VA 4KHPL 4P72A 4O0AA 2KBNA 1KRSA 3F2DA 1A0IA 4A93G 3STBD 2I5MX 5ELOA 2CWAA 5M5XH 2ASBA 2UU9Q 1HR0Q 4DAYB 4DV4Q 3ULLA 1PV4A 1QZHA 3PIPA 4X66L 2Z6KA 4DR1L 3DLLA 3U58A 1XTDA 4C3IH 1E7ZA 4A75A 4JI0L 3PO2G 3T1HL 1PA6A 2JE6I 2R92H 4DR7Q 4A3JH 4DR3L 3M4PA 2R92G 5IYCH 4LFBL 3CC4A 1HNZQ 2Q2IA 5GAGC 1LYLA 4PZ7A 2GN5A 1B8AA 3HOUH 2B29A 4LF6Q 3E0EA 1Q1BA 1PYBA 1EQRA 3W1BA 3AQQA 1EQQA 4JI5Q 2HT1A 4APVA 4WJ3M 3PUZA 4UP8A 3EN2A 4JI6L 1P16A 2JA8H 2E5LL 2IX1A 2YTYA 2JA7H 4BXXH 5GAEC 3CQZH 2XTIA 2ZTDA 3L0OA 4RG1A 3UDIA 2AKWB 2JA9A 1CKMA 1YEZA 5HY6A 4DV7L 1VQ4A 1IBKQ 1IBLQ 1K0RA 1D7QA 4A76A 4JOIA 3PO3G 1B70B 2ZM6L 2AWNA 5M3MG 1VQBA 2A1AA 2D0OA 2UXCQ 4GS3A 1ASYA 1TWFH 2EIFA 1X55A 4O2DA 4X62L 4K0KL 1K3RA 2PMZE 3CCQA 4LF4Q 3ER0A 1VQEA 1XNQQ 1VQMA 1EIFA 1GVPA 3FHWA 3RN2A 2OWOA 2ATWA 4X64Q 3MXNB 1HZ9A 2AMCB 4IO9A 5C3EG 4GOPB 3KOJA 1TWGH 3W1GA 1QUQA 2OQKA 1YITA 4R4QA 5GROA 1SLJA 3RN5A 2BH2A 1LUZA 4MNOA 1XMQL 4DR7L 3T1YQ 3BZCA 2PQAB 1JE5A 3F1ZA 3K80C 4A3MG 2JEBI 1C0AA 4GLVB 3J81j 4A3DG 1C9OA 1IL2A 4A3GG 2ZJQA 2Y0SG 4AIMA 5M5YH 4JI5L 3D0FA 4AYBE 2R7ZG 4OONA 1UE5A 4C2MH 1O7IA 3K0XA 2NN6I 4LF5Q 2R7FA 3A74A 1HH2P 3J7A5 3S1NH 4IFDI 1Q8KA 1W3SA 3CMAA 3J7ZC 3J80i 2K5NA 3AFPA 4JV5L 4A3IH 1EIYB 2Z6KC 2VL6A 2GVBA 3GTJH 2K5VA 2NVXH 3PUYA 4P74A 4JI7Q 4P73A 1FJGL 2C35B 3S2DH 2RCNA 1KRTA 1UE1A 2IHFA 4GNXB 1XNQL 3G4SA 3S24A 2WFWA 1I94L 3RLOA 4YY3L 4AQYL 1VQOA 4POFA 3F8TA 5C0XI 3U4ZA 2VQFQ 4NXNQ 3I4NH 4JBKA 2LSSA 3K7UC 4OX9Q 1Y1VH 3I4MH 1JJGA 5IY0A 1J6QA 2CKZB 2MO1A 2AWOA 1Z47A 1PVOA 2VQEQ 4HJ7A 3GTLH 5EAYA 2Z0SA 1VCIA 1Y1WH 4A3BH 4BBSH 1SN8A 2RF4A 4B3RQ 1PFSA 3J81c 5C4XG 2KCTA 1HNXL 1HJPA 3CCMA 2E8GA 5M3FG 1JJ2A 4BY1G 2JA5H 4DV0Q 2K52A 2I0QA 1W2BA 1XNRQ 1YBYA 3KF6B 4BBRH 2L15A 5LMUL 4RMFA 4B3SQ 1V9PA 2CFMA 1JMCA 3JC66 4JV5Q 4GOPC 2HQLA 2NVYH 4AH6A 1I50H 3MEFA 4DKAC 1B7YB 3L2PA 1VQNA 3CC2A 1QVCA 5FLMG 2BH8A 1E3PA 3HOWG 1A63A 5JJLA 1U5KA 1PH4A 2NVQH 3AEVA 2JQOA 2E2JH 1M1KC 3RR5A 4QL5A 2A19A 5IT9c 3CCEA 1KXLA 4YWLA 4LUOA 1UE7A 3S1RH 1N33Q 1XPRA 1GKHA 3CCUA 1L1OC 2ZJPA 4L5TA 4P71A 4HJ8A 2JA5G 1NBWA 1OXSC 2UUAL 1NE3A 4LFCL 2K75A 1N9WA 2ZTCA 2PI2E 4B3MQ 1IBML 1MJCA 1Y1WG 4BBSG 4HIKA 1G291 4DUYL 1VQLA 1SFOH 2E5LQ 4IPDA 2Y0SE 4GLAC 3F2BA 4OWWB 2GVAA 1X65A 1K83H 1KQSA 3GTKH 3M9BA 2VZAA 5IYBH 4GKJQ 1XNRL 3UDFA 3CP0A 3I4NG 1KHIA 2ES2A 1YNXA 3PV0A 5AJ3Q 4A3KH 3CCRA 4LUZA 1PH7A 1PYSB 3ICEA 3NELA 1DGSA 1C7YA 5C4JH 2OCEA 4A93H 3S17H 5C3EH 3KDFB 4JC0A 3CXCA 3KF6A 2H5XA 4XTCS 1Z9FA 4QIWE 4DV5Q 3ULPA 1YJWA 3PF5A 4LF4L 1J5EL 4JYAL 4X65Q 4HIDA 3GTPH 2UUCQ 3H3VH 3TS2A 4LUVA 2K5HA 4DK3C 4B3TL 2F4VQ 3S16H 5C44H 3AFQA 2KENA 1UE6A 4IOAA 4LNQA 4A3CG 2KHJA 5FLMH 3CAMA 4R4OA 2R93H 3GDEA 4P75A 3T1YL 3I2ZA 5M3MH 1OXUA 5ELNA 1HZAA 1NMGA 2RHQB 4NB3A 2EXDA 1WCMH 1OXVA 1S3OA 4LFCQ 2R7ZH 3ERSX 3GTMH 4BBRG 4HJ9A 1L2FA 1XMOL 1VQDA 5IYDG 2AHOB 4HJAA 1IBMQ 4GKKQ 1HNWL 5JJKA 2LXKA 2N78A 1K8AC 2JA8G 3CF5A 4BY1H 4LFAQ 1TWAH 1X6OA 2CQOA 4JBJA 4YWMA 1KL9A 1IYJB 4K0KQ 4L5RC 4YCVA 3FP9A 1GO3E 1S72A 4YCWA 3U4VA 4FDBA 1VQ9A 3NBHB 1SRUA 2B3GA 1N32Q 3PCOB 4LWCA 3S1MH 4OO1I 1WYDA 1Q82C 3E9HA 4DR5L 1HZBA 3CW2C 1WFQA 4NPSA 1M90C 3CCVA 4KHPQ 3B6YA 4KHZA 4DV2L 2LXJA 1XPOA 3HKZG 2MNAA 5BR8Q 1XMQQ 4DR6L 3BU2A 3U50C 3W5OA 4JYAQ 1AE3A 2BA0A 4JI2Q 3PUVA 4DV4L 5C0XJ 1I94Q 2UUCL 3H15A 1PH8A 4GN3B 4DV1L 2Q2UA 3S2HH 2ID0A 1EWIA 1T9HA 1QVGA 1X3GA 1PH9A 4DR4L 4QQBX 4HJ5A 4OXPA 4NXML 1HZCA 1VS0A 2JA6G 1SMXA 4IPGA 2D0PA 1G51A 4A3FH 1Q7YC 4LF5L 3H3VI 3HOZH 4BXXG 1VQKA 4A3IG 1GD7A 1Q81C 3F2CA 3UDGA 3HOVH 1N34Q 3ULJA 3KJPA 3EIVA 3HKZE 4JI4Q 4GKKL 1VQIA 2VUMG 4B3RL 1HNWQ 1N8RC 2QGQA 5HGQA 4LFAL 3RZOH 4ALPA 4JI8L 4JBMA 4BY7H 5LMNL 3H0GH 4R4IA 3PIOA 2QA4A 4IFDG 3KF8B 4JOIC 1I5FA 4GNXA 4DV6Q 2FXQA 4EX5A 2PQAA 4L5SA 1CSPA 1E22A 1JJCB 3Q8DA 2NN6G 2ZTEA 3KDFA 1WJJA 5E7NA 4JI1Q 5IWAQ 3CPWA 3G6EA 5FJ8H 4DR1Q 4AQYQ 3WWVA 2HHHL 3HKSA
chains in the Genus database with same CATH superfamily
4C3HH 1AE2A 1T5EA 5M5YB 1TS3A 3A5ZB 2B2UC 4IPHA 5KT6A 4DXFA 4ZQIA 4X62H 2VQEL 3CCSA 4UY8C 3DMUA 4ME5A 1G2TA 4LAAA 1FL0A 1A3VA 1HXYD 1ZYRC 4DV1Q 2W9BA 1A62A 2R93A 1F2ZA 1K1QA 1RODA 3HOWB 1TWHH 2WV6D 4DL3A 4BS9A 1S9FA 3H4BA 1EY5A 2QDBA 2DY7A 3J7AK 1V43A 2B8GA 1N34L 1H95A 2ZM6Q 2HDLA 2ALZA 1JR0D 4LH7A 5JUMA 3S15H 3A0JA 5DEHA 3BDOA 1PH6A 3BZKA 1CI3M 4IJHA 4HCSA 4YHHL 2YU9B 3KFUA 1HTPA 1YNND 5J3BA 1B2TA 3FKIG 5M3FH 1GM5A 4GKJL 1EOVA 4BY7B 1I7NA 4QF4A 4TVAB 4POGA 3RZOB 3IFTA 4PZ8A 4YY3H 2L12A 2ASJA 2I5HA 1A3UA 5IIFA 2UUAH 5EPKA 2W6ZA 4LF7L 2A5HA 2WE6A 5DGBA 3Q0AA 4BY1B 2R87A 5FLXE 4Y7NH 3ND9A 5C4XB 3MXUA 5CR3A 4YR2A 2FJZA 3GIIA 4Q8FA 2ZDQA 2KUMA 4RUAA 4LF9Q 1EZ8A 3K7AB 3M9OB 4LF7H 3DWPA 1GUOA 2K50A 2W8LA 4DN4M 1F9PA 4YWKA 2DUDA 3HOWH 2UXDH 4DK0A 2WP8J 3GTQH 4M8AA 1UC9A 2NTTA 2IA6A 3EQLC 3CCLA 3MXNA 3GTKA 2EDGA 1YZ6A 2MO0A 1R4QB 2AQ1B 2G9HD 3M4OH 2E2HB 3EYYA 4DV5L 4JI7L 2B2TC 1EIHA 4LW1A 1BF4A 4KK7A 3M9MB 3GV3A 1YHBA 5HGTA 2KEEA 3G6YA 3NEMA 1RCVD 2BDOA 4Q45A 1O7ZA 1TWAB 4ED6A 4A3DH 2F4VL 3D31A 1Q3LA 2VQFL 1R4PB 2WB1E 4K2KA 2H4OA 3AYHB 5KG0A 4MTDA 3PO3B 2RSOA 1VQ8A 2DJGC 1FGBD 1DIKA 4JBWA 2E2HH 3QWNA 5M5XB 5KX5F 3S1NB 2D5DA 3GTPB 4YJ2F 4OO1H 4DL5A 4MTNA 3JRXA 2VS1A 2M00A 3H0GB 2NVYA 5CV4A 1HQMC 4EGJA 1N36H 4MIUA 3OWEB 1X9NA 4L1KA 4RU9A 1HFGA 1QUQB 3R8BA 1Q46A 4DUYQ 2YYZA 3WO0A 2W8KA 3U9OA 3M3YH 2UXDL 1RKNA 3JAMW 1U4RA 5DM73 1IKMA 3AB9A 5C8YF 2W9CA 1N33H 4GNXC 2YS7A 1FYCA 5KFOA 1VQ5A 4DAPA 4QUFA 5K36G 3N8DA 2IHEA 4J9LA 2MPMA 2E2IH 1EUDB 4ECRA 1SFOA 1L1OA 4MAMA 5J39A 2Q2HA 2B39A 4ZK9B 3P7JA 2YU9H 3FKIB 2HGSA 1Q90A 1TWHB 4C1NK 5BN4A 2C00A 5CYUA 5FLXc 2RDJA 1STEA 3EA6A 5KFQA 1YJ9A 4JV2A 2K6AA 5GADC 2HVQA 4OL7A 4JI1H 2DN8A 3K81C 1FGUA 3GIJA 4A3FB 3P20A 2R86A 2RVLA 2BA1A 2BOSA 4DV3Q 4H02A 4OO1G 4OWXB 1L0XB 1NMFA 1B44D 3KBGA 2SCUB 1CKOA 1I4RA 3RNUA 2RKSA 3PF4A 1SNMA 3M4IA 3N43B 4J9PA 2ATLA 1JCKB 2VQFH 3UE1A 1JX4A 5KEEA 3QZ8A 3MTSA 4X66Q 3BG3A 3K7AH 2N8NA 2A8VA 4J9MA 1SJHD 4LF7Q 1F77A 3J81L 4F4YA 4LF9H 3OTOQ 3M4QA 1F9QA 4A3BG 5C1PA 3GQBA 1CKNB 3I4MB 1Y14B 1RK5A 2F0WA 4I65A 1IZ6A 3BQ2A 1PFNA 4XYOA 2J6UA 3I56A 2K01A 4NXMQ 4IUVA 1SYXB 1TXYA 4FF1A 1WI5A 3GQCA 2UUAQ 1UNSA 4PZ6A 3EBEA 3HKZB 1FNWA 2D9UA 3E5SA 1JOKA 3UI2A 2ASBA 3QOLA 5ELOA 3TP5A 4APMA 2UU9Q 3OMCA 2BDNA 1KEEA 1HR0Q 4IUPA 1F9RA 2Z9HA 3PIPA 2JA8B 2B2YC 1PTOH 4X66L 4F8MA 2OF1A 4DAVA 1WVLA 4X64H 1EWHA 2EVBA 3PO2G 4NDXA 2JE6I 3JAME 3ZYYX 4FM9A 4LFBL 3CC4A 4FF3A 5GAGC 2XWBB 2EZVA 3E0EA 1Q1BA 1EQQA 3LP8A 4MHEA 5CAEB 4RH6A 1I6HB 3H6MA 3PUZA 4UP8A 2JA8H 1XYIA 4IUTA 2E5LL 3LWUA 5JJZA 2CW0D 2AKWB 1IBKQ 1TWGA 1XX8A 4A76A 1B70B 4G7HC 5M3MG 5KFVA 1LT4D 2D0OA 3PW5A 4HR7A 3BVGA 1ASYA 4FU0A 1TWFH 1PTOC 5KFRA 4X62L 1KJQA 3HKZA 2Z4IA 1PFMA 4DNTB 2L0CA 2IP4A 1BJTA 1U4PA 3NBIA 1EOTA 2EYHA 2ATWA 1TY0A 2DWCA 4TQRA 1EY9A 3KOJA 4RGMA 1T36A 5KFSA 2OQKA 5GROA 4QMGA 1DOKA 3E6ZX 2CW7A 4IR1A 2JP1A 4LJZC 4O3OA 1NR2A 3D3RA 5LL6b 1HNZH 4ED2A 4A3DG 4HNTA 4NMZA 1RJPA 1B3AA 2DLNA 3KHLA 5F2DA 4JI5L 3D0FA 2W9AA 2B8FA 1I4PA 3MHBA 5C4ZA 4BBSB 4U6PA 3CHBD 3A74A 1HH2P 3J7A5 3S1NH 5LXTF 4OX9H 1CA5A 1SMYC 1T5XD 3J7ZC 2WTFA 3J80i 4A3IH 2XGPA 4IRDA 1PRTD 3NBHA 3W3AA 4JI7Q 1RK6A 1FJGL 3S2DH 1KNAA 2IHFA 3BVMA 5DAUA 4L63B 4AQYL 2YZNA 1VQOA 1PLFA 2L4NA 4POFA 1QB5D 3TINA 1TQOA 4NXMH 2VQFQ 1Y1VH 2NU6B 2A6EC 2A6ED 2AWOA 2E2IB 1PVOA 3HP3A 4HJ7A 3GTLH 4FVMA 3DHQA 1Y1WH 5DG8A 2XWJB 4DF7A 3J81c 4I7ZC 5I2XA 1B4OA 2KCTA 1HJPA 5C3WA 5M3FG 1VKZA 2FPPB 5KFBA 5J2UF 4IUNA 2I0QA 1W2BA 1YBYA 3KF6B 1CM9A 3H3VC 2VPSA 1FR3A 4A3JB 2FPIB 4O3NA 4EEYA 2HQLA 3U9SA 4AH6A 1I50H 2ZM6H 5DNFA 3VPBA 1VQNA 1GSOA 3MR6A 3H0GA 4LF4H 1SYDA 4UHVA 4GC6A 4QWBA 4KJNA 5ELDA 2JQOA 1M1KC 3RR5A 3RAXA 1LTGD 3S1RH 1XPRA 3L9AX 4IALA 1ZHQA 2ZJPA 4L5TA 4H44C 3H20A 1NBWA 1DXMA 2BCOA 4LFCL 2K75A 5H80A 2PI2E 2ZXRA 5EJWA 5BPFA 4GZYC 1DD2A 4KD3A 2KQ3A 4HIKA 1G291 2V9WA 2DNEA 4J6HA 1STHA 5ELBA 2E5LQ 2HHHH 2GVAA 1X65A 1K83H 4JW0A 3GTKH 1E4FT 1TWFA 1KHIA 4ECWA 2E2HA 3PV0A 1EYZA 3CCRA 1V1PB 4YR0A 4LF8H 2BE5C 2EY2A 3NELA 4B3SH 3RD4A 5KFGA 2V4QA 2OCEA 3KDFB 4JC0A 3KF6A 4FP5D 2H5XA 1A9XA 4DR1H 2ZDGA 3PF5A 5BN5A 1J5EL 1L0YB 4HIDA 3TS2A 2K5HA 2F4VQ 3C1EA 1UE6A 3RZDB 2EOTA 2F0SA 5BMVF 4Y7NB 3CAMA 3GDEA 4V0BA 2Z4HA 5M3MH 5JVH3 5IGEA 2R84A 1NR4A 2J9GA 4LFCQ 2R7ZH 3Q23A 3GTMH 4BBRG 1VQDA 5IYDG 4HJAA 5CV7A 1GSHA 1UEAB 2OH2A 2LXKA 2JA8G 4YAKB 3K5MA 4BY1H 5EQ0A 1X6OA 2HUGA 2FLPA 1IW7D 3K0YA 5KFUA 3HOUB 1D5ZC 4YCVA 1IOVA 4N8X1 5D3IB 1GO3E 3RV4A 3Q6SA 5KT3A 4YCWA 4JI0H 2QYZA 3NBHB 1VMPA 2YU9A 1MBYA 3Q8RB 4LWCA 3S1MH 3ETJA 5BR8H 4X66H 4DR5L 1WFQA 1J8IA 3W2DA 4E4TA 5EPJA 2FMAA 2AGPA 3SK4A 2Q8RE 4DV2L 4RZRA 3L3OC 1TWFB 1EQVA 2MNAA 3EPIA 4DR6L 3BU2A 3IL8A 4E6IA 3DWQA 1V51A 1AE3A 2F0EA 1EYDA 1I94Q 5KNCA 4OHJA 3IN5A 4L6TB 2W9BB 3S2HH 1T9HA 4DR4L 5FD6A 4ECUA 1WTQA 3BQ1A 1VS0A 3TN2A 4WBNF 1LTTD 1VQKA 1GD7A 3F2CA 1Z6HA 1DONA 4EFEA 2XRQD 2J4XA 1N8RC 4ALPA 1EY6A 1SNOA 3ETHA 3G6JB 4IFDG 3KF8B 2HDMA 1TVXA 5KFHA 2PQAA 1ILQA 1CSPA 1I50A 1E22A 2F0JA 3S1RB 4FS2A 5E7NA 1AW7A 1WJJA 3KDFA 5T1GA 4JI1Q 5IWAQ 4DR1Q 3WWVA 2HHHL 2FP4B 3TP6A 5KG7A 4RGOS 4X62Q 4GOPA 4TQUS 4NXNL 1K9MC 2XCAA 2N3SA 4JG2A 4CJ2C 4LF8Q 2W71A 4OEMB 4DR6Q 2YS6A 4HEDA 1RYSA 4X6AH 3PUXA 1EUJA 1Y1WA 1X3EA 4HTHA 3V6HA 2R93G 5DGAA 2W57A 3KLSX 1N36Q 3GV6A 4QWDA 1HNXQ 4F4XA 4A3CH 4YBZB 3KTMA 5JQWA 3CPFA 4MN3A 2KEDA 3N42B 2VNUD 1S68A 4J0MA 1BBWA 2I07B 2KECA 3MR2A 3G71A 2R6FA 1TS5A 2UXCL 5KNDA 4O3SA 4JI4L 1EHIA 2VOBA 1WCMB 2PZUA 4KHVA 2DPJA 2WACA 3RGZA 4QGUA 4EBEA 3GV7B 2R3ZA 4X3UA 2EYFA 4IPCA 3NENA 3KK7A 2R8GA 1QVFA 4BA1I 5FJ8G 3VR4A 3J7YW 3BYTB 2EY6A 3OHBA 1PX2A 4UCUA 1K83A 4YJ3F 1N33L 1JIHA 3H0GG 3VMMA 4FS1A 3L7ZC 1WCMG 4DR2Q 1GLVA 5JEAG 1SMYD 3VDYA 3G7LA 1TWGB 3MXGA 1X3QA 5JEAJ 4A3LG 1V1QA 2EYPA 2UU9H 4ODGA 4C3HB 4RHRA 3A56A 1TS2A 3FVQA 2ALYB 1N36L 1CUKA 3BS1A 4IQZA 1Q1EA 4ECTA 1S40A 1EU4A 2K5QA 5L1JA 5KYLA 1A6XA 1M4VA 1X3FA 4QJFA 1LTLA 3KYHC 3BABA 4JYAH 3SDZA 4R8UB 2XGQA 2RA4A 2QCPX 4I7AA 2DIKA 1D8LA 2R7NA 4DXGA 4L5QA 2WAQE 2R61A 4C3JH 1SYBA 1KNEA 1IBKL 1PXUA 1SNPA 1K8GA 2FKLA 4J9QA 1BDOA 1I3QA 2I80A 4DV2H 3TIIA 2C28A 5IE8A 4CDCC 2V1CC 4BA2I 3IG0A 4QWEA 1PHJA 2P0AA 1EUCB 1BGWA 1PDQA 2DGYA 1PH2A 5KFEA 2V5AA 5KT7A 1H9RA 4GN5A 3Q8QB 1HPCA 3A7AB 1SEBD 4XXEA 3J7AF 1M0WA 1D1IA 1TWHA 4RB0A 1YHAA 3UFXB 4JI6Q 4A3EH 2W6NA 3SEBA 3I7FA 3HG9A 5CBAE 1E1TA 2BR0A 5DQIA 1JOOA 2B63H 4A3EG 1I6HH 5KYIA 2NWGA 5LMUQ 2ZT9C 4B3SL 1WTHA 2IT1A 5EKKA 1CA6A 3EVQA 3PO3H 4B3ML 4LSXA 1EYAA 3I4OA 4UPAA 4UCSA 1NTGA 4UCRA 2PNHA 3E3XA 4IUQA 3CMEA 4KMUC 2YYAA 3TS0A 1SJED 3NQIA 4ABNA 4X64L 4JCVE 3HOUG 2KHIA 5EWGA 2M05A 2A68C 2HHHQ 5CB4F 2EXZA 5KG1A 3MZ5A 1H9SA 1E2VA 2F0DA 3JAML 1HNXH 1AH9A 4LF8L 3S1QH 4CHTB 3CVZA 1EEFD 3BVZA 3N52A 4N8FA 1FJGQ 3J81W 4F4ZA 5H1SE 3UE0A 1EU3A 2QDLA 3GTPA 5IT9W 4RGTA 1BQQT 1YHQA 3RB6A 2EPBA 1LO5D 4ZUJA 3RAQA 1JT8A 4IUUA 1MI2A 5I6YA 3J81i 1GXDC 4ULLA 1TU2B 3AU7A 5D14A 3Q1KA 5IYZF 1W93A 1R9TB 1B33N 4IZ8A 1KLUD 3MC0B 4DAMA 1S5DD 2F0FA 2IX3A 5IP7H 2NVTB 3PUWA 2I5LX 3GILA 2SOBA 3CD6A 1KAWA 4OWTB 4TQSA 2VQEH 4CKEA 1KC8C 4A3LH 2O5JC 4YCUA 4BWGB 2JEAI 4EGVA 1JB7A 1WD1A 2RBMA 3LWEA 3A8IE 3TSSA 4IRKA 1VQFA 4X65L 2R85A 4ECQA 1UWVA 5CGKA 1ZXTA 1HTLD 2R8HA 4MV9A 1HHVA 4QIWB 4DV0H 4O2AF 1EY7A 3M7NA 5KFFA 1FNVA 4DUZL 4A3BB 5JAVA 1RJRA 4DV2Q 5JJIA 2IY5B 1GUGA 1ILPA 1EL0A 1JC7A 4AYBG 5KNBA 2XGTA 4ED3A 2DNCA 4LF6L 1XMQH 3HOZB 2RDFA 1CHQD 3TMEA 3HFZB 1TWCA 2XCPA 5K5PA 2QF7A 2VUMH 4HSVA 2CQYA 2R6GA 5A2QW 2RGRA 4MTEA 2I8CA 1IYVA 5GAHC 1ENCA 3C0FB 1XPUA 3V4ZA 3VR3A 3JAMc 1ESRA 1O7LA 1GOZA 1U9RA 2F3VA 1STBA 2GLTA 4P72A 1RJQA 2KBNA 1KRSA 2I5MX 1ET9A 4K8IA 1A2UA 4DAYB 3ULLA 4DV4Q 1QZHA 1PV4A 1S03G 1NAPA 3GIDA 2RDHA 3DLLA 1TS4A 1E7ZA 4QUCA 3MWMA 4Q44A 2AQ3B 4JI0L 1ZETA 3T1HL 3JZIA 1PA6A 1SEIA 1MZBA 4DR7Q 4A3JH 1WSCA 2R92G 4ZKCB 5EBDA 1HNZQ 3S14B 4DUZH 2GN5A 4MV1A 5I4DA 1RHPA 3EPGA 2K5DA 3LX0A 4LF6Q 1EQRA 1JXLA 3RTXA 2NTSA 4APVA 5M3FB 4WJ3M 1XXGA 3EN2A 3BG5A 2IX1A 3QO2A 5GAEC 3CQZH 1WTPA 3L0OA 1UAPA 3NE5B 4RGNA 4DV7L 1CKMA 1YEZA 4RCOA 5ELFA 1V4YA 1SFOB 2UXCQ 2AWNA 2A1AA 1B9NA 3G8CA 5IWAH 2EIFA 1X3PA 1X55A 1YNJD 4O2DA 3RB0A 5LMUH 5L1IA 4U68A 1G91A 2R8JA 1LTSD 3CCQA 5KGUA 1GJXA 1VQMA 1GVPA 3A7LA 4K6DA 2AQ4A 3MXNB 3GTKB 3FPPA 1HZ9A 4A93B 2AMCB 4IO9A 4GOPB 4MV3A 5KFIA 1LACA 1QUQA 4R4QA 3T5JA 1PTOB 1SLJA 3RN5A 2BH2A 2VUGA 1LUZA 1XMQL 4LF6H 3H94A 2HCIA 2PQAB 3OW7A 5EKLA 3RUZA 2JEBI 4A3MG 1C0AA 5KRUA 5K2MA 1NCVA 1DYQA 4ED1A 3PR4A 3J81j 5E4WC 1C9OA 1IL2A 5EWEA 4A3GG 4AIMA 1I94H 1I3QB 2R7ZG 4JI2H 3D4RA 4UCTA 1B3QA 3S16B 5C1OA 1HNWH 5G3LF 4RUCA 5D1PA 3D4DA 4IFDI 4C1NI 1W3SA 3MFGA 4TV8F 1HR0H 4KHPH 4IURA 3PMFA 3ORQA 4RCNA 3R5HA 1Y8OB 3Q24A 1KBLA 4QWCA 2VL6A 1DCZA 1EY0A 2GVBA 2VB2X 2WKCA 2NVXH 3PUYA 1FKAH 1CQJB 1A15A 1G8ZD 2RCNA 4GNXB 1JWUD 3DUZA 3VYUA 3RFCA 1TA8A 5FLXL 2WFWA 4YY3L 4G7OC 1VF7A 1Z2NX 4LFCH 2F0UA 5EKIA 3HOXB 4JBKA 1CQFA 1PZKD 1JJGA 3FMAA 5EPLA 1Z2OX 2W70A 3L4KA 3S1QB 4KV6A 4DV3H 3GTQA 1W96A 1IOWA 5LA6F 2Z0SA 1VCIA 1S0NA 5F9LA 5IOCA 1SN8A 3NTKA 1PFSA 3OHAA 2FK1A 1HNXL 1F2MA 2E8GA 4DFAA 1WTRA 4PMBA 5CA1F 5D3DA 4DV0Q 5C5JA 4R8IA 1XNRQ 5D65A 5LMUL 2L15A 3RV3A 4RMFA 1Y1VB 2CFMA 3I4LA 1JMCA 4DKAC 3L2PA 3WNZA 1F9SA 5FLMG 1JWMD 4I50F 2B2VC 2F4IA 4JPBW 4RWSC 3GIKA 2L55A 1CHPD 1PH4A 2WAQA 1IW7C 1MSHA 4ZAIA 2A19A 2CQAA 2RCFA 4RAUC 5IT9c 4FXDA 5L1LA 1H9MA 1N33Q 4MA0A 2MHVA 2EYJA 2FLLA 3E0JA 1F2LA 4P71A 2JN4A 3CU7A 3FDTA 5KKNB 3ONAB 4TSSA 4IWYA 1LTAD 5FPOA 5L1KA 1OO9B 3HZXA 1J5EH 1N9WA 5J22A 3NXWA 4WD3A 1IBML 1Y1WG 4DUYL 3TBIB 1C30A 1VQLA 2AGQA 1SFOH 2Y0SE 4GLAC 5FKAC 4NW2A 4OWWB 1DV1A 2VR1A 2VZAA 5IYBH 1XNRL 3UDFA 1SNDA 3A8JE 2ES2A 4MV7A 5F9NA 3T53B 3SR1A 4J8QA 4A3KH 3F8NA 4JI4H 2M2LA 3PW0A 5KFMA 3ICEA 2PPBC 1C7YA 5C4JH 1BCPC 3D8GA 5C3EH 4MV6A 1X32A 5JPMC 4JYAL 3T51B 4K8JA 4Z9CB 4X65Q 1BUVT 4I7HA 5FLXW 1HA6A 3H3VH 4XQNA 4B3TL 3S16H 5EOYA 4EYIB 3T56B 4DR7H 2RSNA 4A3CG 4GC7A 2KHJA 3ORRA 5FOBB 3HOVB 5KG5A 2R93H 2PMZB 4P75A 4PDBA 5KG2A 2Z6BA 3I2ZA 5ELNA 4G57A 2RHQB 1DJRD 2PYKA 2F0OA 3H91A 3J80L 3RBDA 3ERSX 4KY5A 4O1NA 1IBMQ 1AZQA 1RTOA 1K83B 5JJKA 3CF5A 4LFAQ 2AUKA 1KL9A 2Z8LA 4CGYB 5KFLA 4DR3H 4IN3A 4XT1B 4LMYA 2IMWP 3U4VA 1SRUA 1JORA 1N32Q 3PCOB 4IFDH 1F2YA 3E9HA 4HN7A 4NPSA 1ZHSA 4KHPQ 3R23A 2TSSA 5KFXA 3IAYA 1Y1VA 3HXLA 4EBCA 5C44B 5C4JB 2BA0A 4DV4L 4ILWA 1I6UA 2AQ2B 3F2UA 4DV1L 2A69C 2DZDA 1EWIA 1QVGA 4QQBX 4MV4A 4J9KA 4OXPA 4NXML 4CC6A 1SMXA 4IPGA 2D0PA 1G51A 2JA6A 3UDGA 1N34Q 3ULJA 2PMZA 1STGA 5C5LA 1HNWQ 4ECYA 2QGQA 1HFNA 4LFAL 1ENFA 5J1ZA 3RZOH 5GONF 4JBMA 4I55F 4OGQC 3H0GH 1I50B 2QA4A 5T14A 1I5FA 5CV6A 4GNXA 2KVMA 4EX5A 4L5SA 4RKLA 2C2EA 2XC9A 2K7VA 4JVZA 1LTBD 3VPDA 1K8OA 4AQYQ 4B3MH 4RA8A 5FJ8H 1QJOA 2NVQB 5NUCA 2N49A 2O5IC 5EZYF 1SYEA 5IYDH 2FK3A 2L9HA 4S3SA 3L4JA 4JK1C 4JI3Q 1LLRD 1AP0A 1QWYA 2PQEA 3I91A 4GLXA 3OSPA 2VUMB 3H40A 1JLLB 1WTXA 4R4CA 1KDBA 4DUZQ 3VPCA 5BN3A 1B1ZA 1VQ7A 3GTQB 3DEPA 4LF9L 3DF7A 3ITPA 4K5XA 4C3IB 2KCMA 4XZ3B 1CFMA 4HNUA 5IP9H 4R1JA 1HRJA 1PH3A 3MJFA 3K6OA 2Q8TA 2FPGB 3SVMA 1Y8NB 1PH5A 1XNRH 1VQPA 2NZHA 3FDSA 3TZDA 1AFPA 3Q2OA 3HOXH 3NWTA 3UDXA 4MZ9A 4XIGS 4HMJA 4DLKA 1BO0A 2QILA 1E1OA 3PSIA 3V05A 1HA5A 4B9WA 2KA7A 1EQTA 2FHTA 2QK4A 1SSOA 2R8IA 1RTNA 3EROA 2NVTH 3OTOL 1CT1D 1G2SA 2W6PA 3J80W 1VQCA 3ND8A 2CCZA 4ED7A 1U4LA 2CWPA 1DV2A 4YR3A 4WRDA 2SNMA 1MKHA 5C0XG 4X3TA 4P2CB 1BKBA 1GUTA 3T1HQ 2JA5A 3DM1A 1QILA 4K14A 4DR3Q 1I7LA 3NTIA 3RZDH 2V4DA 2VA3A 2K33A 1WOCA 1RDPD 3SK8A 4MTKA 4A3KG 1YVCA 4YHHQ 5IYBG 4FYDA 4HAEA 1M0TA 1S0OA 5JVDF 1CKNA 2AU0A 2UXDQ 4WJ4A 1OXXK 2FFKB 2UU9L 2RDIA 3GV8B 4O2BF 2YV5A 4HMIA 5K36H 3SGIA 1EYGA 2DPIA 3CC7A 2L1BA 5ISRA 3N41B 2KHSA 3NGDA 2IWHA 2PVPA 4KKTA 3HBLA 1IBMH 2RHSB 2P5ZX 3GTGA 3JSLA 3PQIA 2WYOA 1WD0A 1MIUA 3TEHB 2N88A 1UC8A 2Y0SA 4HCEA 3VYSA 2ICEC 4KLKA 2EQSA 4LK1C 4IRCA 2HIXA 3RJ0A 3EJIA 4A3KB 1BR9A 3RLNA 2NB0A 2PO4A 4A2AA 4IZOA 3RMHA 3GP7A 2KCCA 3HOYH 1IBLL 4ECZA 2JEJA 1JDEA 4EQNA 3OSNA 5CV5A 4UCVA 2LY7A 3S14H 4DV3L 2OQ0A 3I73A 4HIOA 1KJ9A 1V8QA 4FO2A 1AUXA 2YZMA 3GTMB 3RBEA 2EJFC 1QCBD 2Z1CA 1AEXA 4DV6L 4DPGA 1I4HA 5DG9A 4JI2L 5DQGA 2G5DA 3TQYA 4B08A 3FRPB 5AJ3L 3LMLA 1SROA 5GQOA 5IYCG 4CBVA 3BJUA 2PZTA 3I55A 3MA2B 1IL8A 1TWCH 3GIPA 2VPQA 2JEIA 2W6QA 4JI3L 4H13C 5CMDA 1MGSA 4B3TQ 3KAKA 5A35A 1U0LA 2GPWA 1I4QA 4DNRB 2UXBH 2MQHA 1VQHA 5KG4A 5LYJF 1VMCA 3A8KE 2E2JB 2LMCB 3S15B 3DWAA 3K5LA 5LMNQ 4I4TF 4JI5H 3LNNA 2OTJA 1KLGD 2R7MA 2R7LA 2YTVA 1AZPA 3V4SA 3T4AC 2G9DA 3K8AA 3HOYG 5IWAL 4FNFA 1N56A 5DLQE 3T13A 3OPOA 4F87A 1C8CA 3MEHA 4G4KA 5FO8B 3TIGA 1VQAA 3BYYB 1VQJA 3RF2A 4QY7A 4H7BA 4FF2A 3STBC 1HR0L 1CSQA 5EWFA 3VA5A 1MD2D 1N32L 2J7ZA 4TUYF 3M85A 5KFYA 3PW7A 2B2YA 4WORA 3GTJA 1TWAA 3C1FA 2FK2A 3TREA 1NSNS 3E9IA 1XTCD 3FKIH 5BR8L 2FMCA 3LWBA 2OLSA 1ICFB 1TWCB 2XVSA 1UEBA 2JK8A 3A5UA 3PO2H 1FVIA 4DK1A 1R9TH 1PH1A 2K32A 1SDFA 1KJJA 1Y69U 2H1EA 1WTOA 4RB2C 4RAZA 2DY8A 2QW7A 1SE3A 2KOLA 2K1BA 4PMWA 2JA5B 1AN8A 1JDBB 2OEOA 3K5NA 2CW8A 3HB9A 1H9SB 4A3FG 3E5NA 3PGZA 2QEXA 1YIJA 3KJOA 2W6MA 1VBHA 2X0SA 4RNOA 4K2LA 1CS0A 3PVXA 2KJXA 1A0IA 1CTMA 3STBD 5M5XH 2CWAA 4C3HG 5C0XH 4FXGC 4RNMA 5KT2A 1EWCA 2ZXOA 1VDZA 2Z6KA 4C3IH 1YNJC 4Q8EA 4ID6A 3SHLA 4MA5A 3I12A 1PZID 5LOVF 2B2UA 2R92H 5JVG3 4RAYA 2IPKD 1E2WA 5IYCH 3WOFA 1KDCA 2YW2A 2XN9C 4PZ7A 1B8AA 5L9XA 1O80A 2CVRA 2IL8A 1PRTF 3W1BA 3AQQA 4JI5Q 2HT1A 1AN7A 5LMNH 2BQ3A 3SI8A 4M9UA 1S5FD 2YTYA 1L2ZA 2XTIA 2ZTDA 1D7QA 3HS0C 1IBLQ 2IJ0A 4GKJH 3V6KA 2ZM6L 1PRTB 4K5WA 4GS3A 3OUZA 4EBDA 4J9OA 5IGGA 4K0KL 2PMZE 3MVVA 5C3XA 3R5FA 4LF4Q 2SDFA 3ER0A 1CK1A 4N9PA 4JI6H 1EIFA 1KABA 4CKCA 2OWOA 1O75A 3SE7A 3GIMA 2F0VA 1STAA 3MXPA 4MNOA 1DM0B 2C22A 3BZCA 1IYUA 4GLVB 3GTJB 2BQUA 2Y0SG 3X3NA 4C3JB 1ZYRD 4OELB 1SXTA 4AYBE 5D8DA 4ECSA 3K0XA 1Y1WB 3S9WA 3J81E 2R7FA 1LT6D 1XMOH 1CZWA 2WDTA 5KFJA 5L37A 1Q8KA 1LTID 1DZ1A 3CMAA 3UQ8A 5I9PA 4F4WA 3AFPA 4QW9A 1E4EA 1B9MA 3PW2A 3VR6A 5HURA 3D6WA 4EGQA 2Z6KC 4TKOB 4ZCKA 3C46A 2B2TA 2I46A 3A54A 1NNXA 4J9SA 1SBBB 4KN4C 4P74A 4AYBA 2C35B 1KAAA 1KRTA 2B2VA 4QCLA 1S5CD 3G4SA 4ECVA 3S24A 1I94L 3RLOA 2NYZD 2F0PA 2K5WA 3KLRA 3F8TA 5C0XI 1PTOF 3U4ZA 3I4NH 2V59A 3K7UC 3NK9A 3QR8A 4OX9Q 1XWEA 4ETSA 3HGBA 1J6QA 4DR2H 2CKZB 2MO1A 1Z47A 2VQEQ 1SNCA 3IKJA 4A3BH 1PZJD 4BBSH 2RQXA 2F0KA 2RF4A 3K3PA 2W7OA 2HVSA 2MJ8A 5D1OA 1BXRA 2C2RA 4IHJF 1JJ2A 1ZKOA 3KUPA 2EE1A 3JRWA 1H9JA 2W9CB 2JA5H 2SNSA 5FO9B 2K52A 3Q22A 1JWSD 1S5BD 1D6EC 3JC66 2NVYH 5TSSA 3MEFA 1B7YB 3VYRA 3WDNA 3CC2A 5DM63 1QVCA 4N9TA 2YRWA 2BH8A 1E3PA 1EZ1A 3HOWG 1A63A 1QNKA 2HQEA 3KF8A 5JJLA 2CH4A 1QE6A 4CJ0B 4DGZA 4QL5A 4DV5H 3CCEA 4M1UB 1KXLA 5FK9C 1A2TA 1UE7A 3GTOA 1RF2D 4XQQA 1GKHA 2A73B 3CCUA 1WH2A 4QB4A 3NQTA 1CE8A 1IBKH 3QJYA 3J7AV 4HJ8A 2MUYA 2CZGA 3GLKA 2FMMA 2KCNA 4JI8H 1OXSC 5LL6S 4B3MQ 2L5TA 1MJCA 2D2CC 2E75C 2E5LH 3H4DA 2RGVA 1UNNC 4YIJA 3F2BA 1KQSA 3M9BA 2PW7A 2R82A 2ZXPA 4ZI7F 4JI3H 3NSWA 4LUZA 2J6SA 5IGBA 3CRKC 1WR2A 4JV5H 4EQOA 4KN7C 1DGSA 1V1PA 3MWDA 3EFXD 4A93H 3S17H 1JICA 4A3IB 3TQ1A 3TZUA 4DV5Q 4XTCS 3ULPA 3S2HB 4EYHB 4LF4L 2BQRA 1O7YA 4ZRZA 5ELCA 2UUCQ 4C5CA 4DK3C 5E3FA 1WTVA 2KENA 1XDNA 4LNQA 5COYA 5FLMH 5KFKA 5KFWA 1OXUA 1HZAA 1NMGA 1N34H 1WCMH 1OXVA 5C6AA 4UCOA 2AHOB 4GKKQ 1S0MA 1Z2PX 3URYA 1K8AC 1VAJA 5HV6A 2OXPA 4LH6A 5KT4A 4JBJA 5KFDA 3QB3A 2MGSA 1BNZA 4L5RC 4HYKA 2E74C 3FP9A 1RD9D 4FDBA 2F0LA 4RZQA 4KD4A 1WYDA 2FB9A 5JH7F 2PCFB 1TKWB 3CW2C 3QZ7A 1M90C 1S10A 3B6YA 4DL7A 1HUMA 4KHZA 2K04A 4C3IG 1S4ZA 1XMQQ 1ZEQX 3W5OA 4PWQA 3I72A 2NBFA 3R2IA 5HBRB 4JI2Q 3PUVA 1II3A 5C0XJ 2UUCL 4DL6A 2EY1A 1PH8A 4GN3B 3NTHA 2HCCA 2Q2UA 4BBRB 2CHBD 4X3KA 1PH9A 4HQ6A 1KC7A 1S5ED 3K58A 4ZYSA 4A3FH 4LF5L 3H3VI 3HOZH 4ZKBB 4BXXG 3N44B 5JVLA 1Q81C 4WFN3 3HOVH 3FMCA 4O3QA 4JI4Q 4GKKL 1VQIA 3GTOB 2A69D 1A3TA 4JI8L 3T5LA 5LMNL 2PN1A 2FE3A 4R4IA 3PIOA 2WKDA 4JOIC 2FXQA 2EYOA 4AYBB 3J80E 2GPSA 2NN6G 2X6GA 2Q8IB 3CPWA 5KT5A 1BCPD 3HKSA 3K59A 5DG7A 4HR7B 1IKLA 2F03A 2EYLA 5I47A 2C5CA 4L8JA 4TV9F 2F0NA 3R3OA 4R4TA 2VXWA 1DOLA 1SYGA 3KLWA 3BA9A 1JKJB 1J9OA 3RLFA 1M6VA 3V2TA 3BAAA 4KKUA 1JQYD 3TP8A 4C2MA 2WAQB 4HIMA 4KI0A 4DV7H 5C44G 2E2IA 4DV0L 1D5XC 1JB3A 1CQIB 2HIVA 1R9TA 1RJTA 4RB1A 2ZJRA 1KJIA 4UP7A 1AUVA 2YZGA 3TRZA 4JV1A 2R7DA 1T3NA 1NY4A 5IT9L 4B9XA 3J80c 3G6VA 2ZDHA 1D5MC 1TAEA 2A74C 1X54A 1MJEA 4XDXA 1E2ZA 1PMRA 4FF4A 3KLSA 1B6RA 2X6LA 2ICIA 3GO5A 1GUSA 1BVSA 2BE5D 3ERQA 4A3JG 2VB3X 1XJVA 2E2DC 3PIO3 1Q8IA 5C4HA 4BY7G 2NUAB 5CV8A 1SE8A 1SR3A 3VYTA 1NJIC 2LFNA 1OXTA 1YJNA 5I2YA 5FPRA 3MWEA 2HD3A 2PBZA 2F0GA 2Q2TA 2UXBL 2K4KA 2MFIA 3CCJA 1KIXA 2WAQG 4PG3A 3P1HA 1Q86C 5D1OB 2JA6H 1SYCA 3GTGH 2PNRC 2UUBL 3D4WA 3S1MB 1KD1C 1Q12A 4LFBQ 2N55A 1STNA 3R2TA 2VW9A 4UDUC 2CH4W 4A4IA 4IJLA 2A68D 1L0WA 5IGFA 4XYQA 2JYOA 3VA7A 5KFCA 4YAJB 1GUNA 3RIZA 2HVRA 2JSOA 1BBUA 2F0MA 1X56A 1YI2A 3OWFA 3T16A 1VQ6A 5EGTA 1SE4A 1P8LA 2OTLA 4O3PA 4ZOLF 4A3GH 4EQ5A 4MV8A 1CZGA 4YY3Q 4Y52H 5LMNW 4Q0FA 4DR5Q 4JV0A 3MFHA 1GYFA 4A3MH 5C4XH 2FINB 4QW8A 3OUUA 2JJQA 1K73C 2YTXA 2PI2A 4J1MA 4H0LC 4C5BA 4EEQA 3S17B 2UXBQ 3N40P 5KFZA 1XMOQ 1PYWD 2F0TA 3BQ0A 2F1MA 5M9OA 3MR3A 3GD7A 4DR4Q 4O3RA 3K57A 4IFDJ 1XNQH 3DM3A 5M5WH 5A2QE 1BOSA 2VQDA 4O4LF 4QWAA 4DV7Q 5IP7G 1SAPA 2NZOA 3WO1A 3AMUA 4FXKC 2A6HC 1NUCA 2O2LD 2K05A 3OW2A 4YB8B 1HCZA 1RIPA 1GSAA 2TMPA 3I70A 4G7ZC 3LGJA 2X69A 2ASLA 4JI8Q 1LM0A 4UP9A 3JAMi 3R5XA 5KG6A 3FEWX 1M7JA 3M7GA 4B3TH 2IX0A 5KIXA 4Q5VA 4DUYH 3GTMA 2NZ1D 2V4RA 4PMCA 4JI1L 5I6WA 4HNVA 1FJGH 4KY7A 2F52A 2NN6H 4KKSA 1PRTC 3M4OB 5CA0F 3ZJYC 4G3IA 2D62A 4XYLB 1LT5D 4DK6C 1OTCA 5BPHA 5KFNA 4J9RA 3SK5A 5IT9E 3C3LA 1Y1VG 3M4YA 1J5EQ 3OYYA 3QG1A 3HOXG 2J0TD 3R93A 1IXRA 3TDQA 4EVOA 1RL2A 2YL2A 1STYA 1LABA 1D2BA 3HOVG 1D1KA 4ME3A 4DNIA 2KSWA 2J6TA 3FKIA 2JEGA 3HOZG 4OX9L 3G48A 1QG7A 4DAYA 4C5AA 4AQYH 3IRBA 5IP9G 1L1OB 2O03A 2B63G 3V6JA 3RB4A 4IOCA 3OIQA 2B63A 4DR4H 4XYMB 2XRSD 2VY3A 1ET6A 2JXMB 2V58A 2SEBD 2F0QA 4KJOA 3C2PA 2JA7G 3I3CA 2EJGC 5J2TF 3GTLB 4CDDC 1EFWA 4JI0Q 1HR0W 3OMGA 4DR2L 4DR5H 1W6KA 1VQGA 2A6HD 5DLFA 2GA4B 1FD7D 3V96A 4XQJA 3GTOH 3MR5A 4K6LA 3TQTA 2F3IA 1HNZL 4LFAH 1ASZA 1E24A 1I3QH 2WB1G 3I4NB 1K28A 2XIWA 2XNAC 4XT3B 5IGDA 1QZGA 3GTLA 4C3JG 3BDLA 5CBEE 4QIWA 1JOQA 4NXNH 1O78A 3I4MG 4O4HF 2UUBQ 2MP1A 4YQWA 4GN4B 1TIID 4A3DB 4J15A 2EYMA 1N32H 4ZHQF 1E0BA 4LFBH 1BXTA 4U673 4JI7H 2B63B 1ML0D 2K14A 1A8VA 5JPNC 4CDEC 4KHPL 4O0AA 3RUPA 2LKVA 5KFAA 1E4GT 3U9TA 3F2DA 2NVXA 4A93G 1TY2A 1BNCA 3BJYA 1YNNC 3MFYA 4DR1L 1LTRD 1MHWC 1XTDA 1PTOD 5M5WB 3U58A 2YRXA 4A75A 4C56C 5CC4A 2YCHA 3BDCA 4R7RA 1HUNA 4ECXA 2NVYB 4DR3L 3M4PA 2CW0C 4EFBA 2Q2IA 3PO2B 5FO7B 1LYLA 1FNUA 3HOUH 4DV1H 2B29A 1PYBA 3OSOA 3M3YB 1IBLH 4UFZA 3VR2A 4JI6L 1P16A 3MAQA 2JA7H 4BXXH 3UDIA 4RG1A 2JA9A 3GTGB 5HY6A 1DOMA 2NVXB 1VQ4A 4OIJA 1K0RA 4JOIA 3PO3G 4FBUA 1C3OA 1VQBA 4C2MB 1MSGA 4ME6A 1PFBA 4CC5A 2W7PA 3DXJC 1TR5A 1K3RA 4RKBA 4DL4A 4A2BA 4YP3A 3KXYT 1IHZA 4JUZA 1VQEA 1XNQQ 5AFWA 3I8ZA 5FD5A 2XIGA 2FJ2A 2OT2A 3FHWA 3RN2A 4X64Q 3Q8PB 2M9VA 5C3EG 4NKLA 1OWTA 1TWGH 3OHXC 3W1GA 2JEFA 2WINB 5ELEA 1YITA 3N6XA 2K28A 4LSAA 1JE4A 4DR7L 4BWSC 2FLNA 3T1YQ 3K80C 1JE5A 3F1ZA 3KBXA 4DR6H 3RB3A 4R8NA 4PNYA 3PR5B 2ZJTA 2ZJQA 3G6XA 2R7ZA 2R93B 5M5YH 3BZDB 4K5VA 3SK6A 3NUCA 3KAJA 4OONA 3K5OA 1UE5A 2VUMA 2W6OA 2ENBA 4C2MH 1O7IA 1KTKA 2NN6I 4LF5Q 2Y0SB 4XX0B 2NU9B 1VBGA 2UVRA 4J9NA 2O4XA 3A55A 1KJ8A 2XCLA 4Q43A 2UUBH 2NU7B 2UVVA 4DU9A 2K5NA 1QNUA 4JV5L 1SYFA 1K3BC 5C3EB 1EIYB 3O13A 4R8UA 1RYRA 3H09A 3GTJH 2K5VA 3KHHA 4B3RH 4P73A 1PK8A 1UE1A 2XSCA 1XNQL 2EY5A 2R8KA 5IGCA 2VA2A 3PW4A 4EG0A 3OIPA 3HOYB 2RDGA 1C48A 1W6JA 1U4MA 4NXNQ 3PN1A 4IAJA 4RB3C 3I4MH 2LSSA 5JEAH 1ZQ7A 1EIGA 5IY0A 1V1OA 3P75A 4IR9A 4WJWA 1LT3D 1ULZA 3DEOA 4OIKA 2PZWA 5EAYA 3OTOH 3KHRA 3VR5A 2F4VH 3CKIB 4B3RQ 1G6ZA 3N6RA 1ESFA 5C4XG 4ZQ3A 3CCMA 1SE2A 4X65H 4BY1G 5EDWA 3OOCA 1B53A 2C9OA 5CV9A 4BBRH 4F88A 4B3SQ 2R7KA 2NU8B 1V9PA 4JV5Q 2IW3A 4KY6A 1LV9A 3S2DB 4GOPC 4ED8A 2EJMA 1WCMA 2F0IA 3K5IA 1GHJA 4CDFC 4HSPA 5LP6F 2R92A 4PQXA 3BA8A 3D6CA 3TP7A 3RGXA 4EQPA 5LL6X 1U5KA 4CKBA 2B2WC 2NVQH 3AEVA 2QEJC 2I87A 4DL2A 4R9WA 2E2JH 2UXCH 3T1YH 4X3SA 4YWLA 4LUOA 1B04A 2JA7A 2WB1B 1L1OC 1E4EB 4PV1C 1M8AA 3SE0A 5A2QL 3SXHA 4NP5A 1WTWA 2JA5G 1K1SA 2UUAL 4ED0A 1NE3A 1GUWA 1K8MA 1B50A 3CQZB 1K0SA 2ZTCA 2F3WA 4O42A 2JA7B 2WB1A 4BBSG 1EZ6A 2HJWA 3NP8A 4DV6H 3KHGA 4IPDA 3JSNA 1HQRD 4U7CA 3FPUB 5E4XA 1BCPB 4GKJQ 3QIAA 3I4NG 3CP0A 2ASDA 1C4QA 1I4GA 1YNXA 5AJ3Q 5KG3A 4F7XA 1PH7A 1PYSB 1GHKA 1EEID 1Y8PB 5IODA 5M3MB 4DV4H 4RFBA 3CRLC 2LS01 1Z7TA 2K03A 1EY8A 3CXCA 4Y8VB 1BCPF 1G6PA 1Z9FA 4QIWE 3GIQA 1YJWA 5DLGA 2XD4A 3GTPH 3KALA 4LUVA 3Q8SB 4NLGA 1ONLA 5C44H 3AFQA 4IOAA 5KFPA 4V190 3GV5B 4TRDA 4R4OA 1EY4A 1ENAA 5C5MA 3T1YL 3K3VA 5T1IA 4RHSA 4YHHH 4NB3A 2EXDA 2JA6B 1N48A 1S3OA 1I6VC 1H9KA 4HJ9A 5CORA 1L2FA 1XMOL 1SNQA 1HNWL 2E76C 2N78A 4LMQD 4UAIA 3HEJA 1TWAH 4YWMA 2CQOA 3NPPA 2IBKA 4CJ1B 1IYJB 4K0KQ 5EBCA 3NHHA 4K0KH 1VF5C 1S72A 4RNNA 3T1HH 4ZLTF 1VQ9A 1CQVA 2B3GA 2R92B 3T5KA 2C2DA 2F0HA 4OO1I 1Q82C 2B2WA 3WOEA 1HZBA 4FBTA 1QOHA 3I90A 3CCVA 2NUCA 2LXJA 1XPOA 3HKZG 5G3LD 5BR8Q 3U50C 4JYAQ 3IFDA 1S97A 4A3EB 3PIP3 5E1FA 1B6SA 3H15A 3HRZC 4F50A 1TT2A 4ZUIA 2QKIC 3X3MA 2ID0A 2R7ZB 2AGOA 1KDAA 1X3GA 5DQHA 3CQZA 1ICWA 4HJ5A 1HZCA 2JA6G 4A3GB 4GKKH 1Q7YC 3K5HA 4KTAA 1SCUB 4IWXA 4A3IG 2AUJD 1GGOA 5KFTA 4A3MB 1BBXC 2MCTA 3KJPA 3MWYW 3EIVA 5JOBA 3HKZE 3M9NB 4B3RL 2VUMG 4LF5H 4Q0YA 2UVUA 2WIIB 4DA2A 3QOJA 5HGQA 1T94A 4M7EA 4BY7H 1I4XA 3QFFA 2UUCH 4DV6Q 2DJFC 1EYCA 3T5HA 2UVWA 4O4IF 5LHY1 3Q8DA 3PZPA 1EFID 2ZTEA 3MFIA 3G6EA 2L11A 3NWSA 1UUPA 1JJCB 2PW5A 5I9OA
chains in the Genus database with same CATH topology
4X62Q 4GOPA 4TQUS 4NXNL 2N49A 1K9MC 2N3SA 4JG2A 4LF8Q 4C3HH 1AE2A 5IYDH 4DR6Q 3A5ZB 4IPHA 4X6AH 3PUXA 4R4TA 3KLWA 4JI3Q 2VQEL 3CCSA 4UY8C 1EUJA 1X3EA 4GLXA 3RLFA 1FL0A 4DV1Q 2R93G 1A62A 4R4CA 1N36Q 4DUZQ 1HNXQ 4A3CH 4HIMA 4KI0A 5C44G 1VQ7A 4DV0L 4LF9L 1TWHH 3CPFA 2HIVA 2VNUD 2KCMA 1BBWA 2ZJRA 4UP7A 1V43A 5IP9H 3G71A 1N34L 1H95A 2ZM6Q 3TRZA 2UXCL 4R1JA 2R7DA 3S15H 1PH3A 3A0JA 1NY4A 4JI4L 3J80c 1PH5A 1PH6A 3BZKA 4IJHA 1VQPA 2NZHA 4QGUA 4YHHL 3KFUA 5J3BA 3FKIG 1X54A 3NENA 4IPCA 1MJEA 5M3FH 1GM5A 1QVFA 4BA1I 5FJ8G 4GKJL 3HOXH 3UDXA 1EOVA 4MZ9A 4TVAB 4XIGS 3GO5A 4POGA 1BVSA 4PZ8A 1E1OA 3PSIA 1N33L 4A3JG 2I5HA 3H0GG 1XJVA 3L7ZC 1WCMG 4BY7G 4DR2Q 1SE8A 1SR3A 4LF7L 1NJIC 5JEAG 1OXTA 3VDYA 1YJNA 2NVTH 1G6PA 3OTOL 5JEAJ 1VQCA 4A3LG 1V1QA 2CCZA 2CWPA 4Y7NH 2Q2TA 2UXBL 2K4KA 2MFIA 3CCJA 1KIXA 2WAQG 4PG3A 1MKHA 5C0XG 2ALYB 1Q86C 1N36L 1CUKA 2JA6H 3GTGH 1BKBA 3T1HQ 1Q1EA 2UUBL 1KD1C 1Q12A 4LF9Q 4DR3Q 1S40A 4LFBQ 2K50A 3RZDH 1X3FA 4QJFA 1LTLA 3KYHC 4YWKA 2DUDA 3HOWH 2VW9A 2WP8J 1WOCA 3GTQH 4A3KG 4A4IA 4IJLA 1YVCA 1L0WA 3CCLA 4YHHQ 5IYBG 1YZ6A 2MO0A 3M4OH 1D8LA 1BBUA 1CKNA 4DV5L 4JI7L 2UXDQ 4LW1A 4WJ4A 1OXXK 2WAQE 4L5QA 1YHBA 1X56A 4C3JH 1YI2A 1IBKL 2UU9L 1VQ6A 2YV5A 1P8LA 3NEMA 2OTLA 3SGIA 1K8GA 4EQ5A 3CC7A 4YY3Q 1EYGA 4A3DH 4A3GH 2F4VL 4Y52H 5LMNW 4DR5Q 3D31A 2VQFL 5C4XH 4A3MH 2WB1E 5IE8A 3AYHB 2RHSB 2V1CC 2JJQA 4BA2I 1K73C 1VQ8A 2YTXA 2PI2A 1PHJA 1MIUA 3TEHB 4JBWA 2E2HH 1PH2A 2DGYA 2UXBQ 1XMOQ 4GN5A 4KLKA 2EQSA 2HIXA 3GD7A 1YHAA 4DR4Q 4IFDJ 4JI6Q 4A3EH 3DM3A 3I7FA 4MTNA 3RLNA 5M5WH 1E1TA 4DV7Q 5IP7G 2NZOA 2VS1A 4A3EG 2B63H 5LMUQ 1IBLL 3HOYH 1I6HH 4B3SL 2IT1A 3OW2A 1RIPA 1X9NA 4B3ML 3PO3H 1QUQB 3S14H 4DV3L 1Q46A 2OQ0A 3LGJA 4DUYQ 2YYZA 3I4OA 4JI8Q 1LM0A 4UP9A 4UPAA 3JAMi 4HIOA 1NTGA 2PNHA 3M3YH 2UXDL 2IX0A 4DV6L 3CMEA 4DPGA 3TS0A 4JI2L 4JI1L 3TQYA 5AJ3L 4GNXC 4X64L 4JCVE 3HOUG 2KHIA 2F52A 1SROA 2HHHQ 5GQOA 1VQ5A 5K36G 5IYCG 2IHEA 3ZJYC 3BJUA 1AH9A 2D62A 4LF8L 2E2IH 4DK6C 3I55A 1OTCA 3S1QH 1FJGQ 1TWCH 1L1OA 1Y1VG 5H1SE 3OYYA 3UE0A 1J5EQ 4JI3L 3HOXG 2Q2HA 1IXRA 1RL2A 4B3TQ 2YU9H 1U0LA 1YHQA 2MQHA 4ME3A 3HOVG 1VQHA 4DNIA 5FLXc 1JT8A 3HOZG 4OX9L 3G48A 3J81i 5LMNQ 1YJ9A 2OTJA 5GADC 3IRBA 2YTVA 5IP9G 1L1OB 4DAMA 3K8AA 3K81C 5IWAL 1FGUA 3HOYG 5IP7H 2B63G 3PUWA 4IOCA 2BA1A 2I5LX 5DLQE 3CD6A 1KAWA 4OWTB 4DV3Q 4H02A 4OO1G 4OWXB 2VY3A 1KC8C 4A3LH 1NMFA 4YCUA 1CKOA 1VQAA 2JEAI 3RNUA 1VQJA 1JB7A 4QY7A 3PF4A 1VQFA 4X65L 3STBC 1HR0L 1CSQA 3UE1A 1UWVA 1N32L 4X66Q 3M85A 2JA7G 3M7NA 3K7AH 4DUZL 2N8NA 4JI0Q 1EFWA 2A8VA 1HR0W 4DR2L 4DV2Q 4LF7Q 1VQGA 5JJIA 2IY5B 3TREA 5BR8L 3E9IA 3FKIH 3GTOH 3OTOQ 3M4QA 2F3IA 1HNZL 4AYBG 4A3BG 1ASZA 1E24A 1I3QH 2WB1G 1CKNB 1Y14B 2XGTA 1QZGA 4LF6L 1IZ6A 1UEBA 2JK8A 3I56A 3A5UA 3PO2H 1FVIA 3HFZB 1R9TH 1PH1A 3I4MG 2UUBQ 4NXMQ 2VUMH 4GN4B 2R6GA 1TXYA 1WI5A 4J15A 2UUAQ 4PZ6A 5GAHC 3EBEA 4PMWA 1XPUA 4A3FG 3PGZA 2QEXA 1YIJA 3KJOA 3JAMc 2K14A 1A8VA 4KHPL 4P72A 4O0AA 2KBNA 1KRSA 3F2DA 1A0IA 4A93G 3STBD 2I5MX 5ELOA 2CWAA 5M5XH 2ASBA 2UU9Q 1HR0Q 4DAYB 4DV4Q 3ULLA 1PV4A 1QZHA 3PIPA 4X66L 2Z6KA 4DR1L 3DLLA 3U58A 1XTDA 4C3IH 1E7ZA 4A75A 4JI0L 3PO2G 3T1HL 1PA6A 2JE6I 2R92H 4DR7Q 4A3JH 4DR3L 3M4PA 2R92G 5IYCH 4LFBL 3CC4A 1HNZQ 2Q2IA 5GAGC 1LYLA 4PZ7A 2GN5A 1B8AA 3HOUH 2B29A 4LF6Q 3E0EA 1Q1BA 1PYBA 1EQRA 3W1BA 3AQQA 1EQQA 4JI5Q 2HT1A 4APVA 4WJ3M 3PUZA 4UP8A 3EN2A 4JI6L 1P16A 2JA8H 2E5LL 2IX1A 2YTYA 2JA7H 4BXXH 5GAEC 3CQZH 2XTIA 2ZTDA 3L0OA 4RG1A 3UDIA 2AKWB 2JA9A 1CKMA 1YEZA 5HY6A 4DV7L 1VQ4A 1IBKQ 1IBLQ 1K0RA 1D7QA 4A76A 4JOIA 3PO3G 1B70B 2ZM6L 2AWNA 5M3MG 1VQBA 2A1AA 2D0OA 2UXCQ 4GS3A 1ASYA 1TWFH 2EIFA 1X55A 4O2DA 4X62L 4K0KL 1K3RA 2PMZE 3CCQA 4LF4Q 3ER0A 1VQEA 1XNQQ 1VQMA 1EIFA 1GVPA 3FHWA 3RN2A 2OWOA 2ATWA 4X64Q 3MXNB 1HZ9A 2AMCB 4IO9A 5C3EG 4GOPB 3KOJA 1TWGH 3W1GA 1QUQA 2OQKA 1YITA 4R4QA 5GROA 1SLJA 3RN5A 2BH2A 1LUZA 4MNOA 1XMQL 4DR7L 3T1YQ 3BZCA 2PQAB 1JE5A 3F1ZA 3K80C 4A3MG 2JEBI 1C0AA 4GLVB 3J81j 4A3DG 1C9OA 1IL2A 4A3GG 2ZJQA 2Y0SG 4AIMA 5M5YH 4JI5L 3D0FA 4AYBE 2R7ZG 4OONA 1UE5A 4C2MH 1O7IA 3K0XA 2NN6I 4LF5Q 2R7FA 3A74A 1HH2P 3J7A5 3S1NH 4IFDI 1Q8KA 1W3SA 3CMAA 3J7ZC 3J80i 2K5NA 3AFPA 4JV5L 4A3IH 1EIYB 2Z6KC 2VL6A 2GVBA 3GTJH 2K5VA 2NVXH 3PUYA 4P74A 4JI7Q 4P73A 1FJGL 2C35B 3S2DH 2RCNA 1KRTA 1UE1A 2IHFA 4GNXB 1XNQL 3G4SA 3S24A 2WFWA 1I94L 3RLOA 4YY3L 4AQYL 1VQOA 4POFA 3F8TA 5C0XI 3U4ZA 2VQFQ 4NXNQ 3I4NH 4JBKA 2LSSA 3K7UC 4OX9Q 1Y1VH 3I4MH 1JJGA 5IY0A 1J6QA 2CKZB 2MO1A 2AWOA 1Z47A 1PVOA 2VQEQ 4HJ7A 3GTLH 5EAYA 2Z0SA 1VCIA 1Y1WH 4A3BH 4BBSH 1SN8A 2RF4A 4B3RQ 1PFSA 3J81c 5C4XG 2KCTA 1HNXL 1HJPA 3CCMA 2E8GA 5M3FG 1JJ2A 4BY1G 2JA5H 4DV0Q 2K52A 2I0QA 1W2BA 1XNRQ 1YBYA 3KF6B 4BBRH 2L15A 5LMUL 4RMFA 4B3SQ 1V9PA 2CFMA 1JMCA 3JC66 4JV5Q 4GOPC 2HQLA 2NVYH 4AH6A 1I50H 3MEFA 4DKAC 1B7YB 3L2PA 1VQNA 3CC2A 1QVCA 5FLMG 2BH8A 1E3PA 3HOWG 1A63A 5JJLA 1U5KA 1PH4A 2NVQH 3AEVA 2JQOA 2E2JH 1M1KC 3RR5A 4QL5A 2A19A 5IT9c 3CCEA 1KXLA 4YWLA 4LUOA 1UE7A 3S1RH 1N33Q 1XPRA 1GKHA 3CCUA 1L1OC 2ZJPA 4L5TA 4P71A 4HJ8A 2JA5G 1NBWA 1OXSC 2UUAL 1NE3A 4LFCL 2K75A 1N9WA 2ZTCA 2PI2E 4B3MQ 1IBML 1MJCA 1Y1WG 4BBSG 4HIKA 1G291 4DUYL 1VQLA 1SFOH 2E5LQ 4IPDA 2Y0SE 4GLAC 3F2BA 4OWWB 2GVAA 1X65A 1K83H 1KQSA 3GTKH 3M9BA 2VZAA 5IYBH 4GKJQ 1XNRL 3UDFA 3CP0A 3I4NG 1KHIA 2ES2A 1YNXA 3PV0A 5AJ3Q 4A3KH 3CCRA 4LUZA 1PH7A 1PYSB 3ICEA 3NELA 1DGSA 1C7YA 5C4JH 2OCEA 4A93H 3S17H 5C3EH 3KDFB 4JC0A 3CXCA 3KF6A 2H5XA 4XTCS 1Z9FA 4QIWE 4DV5Q 3ULPA 1YJWA 3PF5A 4LF4L 1J5EL 4JYAL 4X65Q 4HIDA 3GTPH 2UUCQ 3H3VH 3TS2A 4LUVA 2K5HA 4DK3C 4B3TL 2F4VQ 3S16H 5C44H 3AFQA 2KENA 1UE6A 4IOAA 4LNQA 4A3CG 2KHJA 5FLMH 3CAMA 4R4OA 2R93H 3GDEA 4P75A 3T1YL 3I2ZA 5M3MH 1OXUA 5ELNA 1HZAA 1NMGA 2RHQB 4NB3A 2EXDA 1WCMH 1OXVA 1S3OA 4LFCQ 2R7ZH 3ERSX 3GTMH 4BBRG 4HJ9A 1L2FA 1XMOL 1VQDA 5IYDG 2AHOB 4HJAA 1IBMQ 4GKKQ 1HNWL 5JJKA 2LXKA 2N78A 1K8AC 2JA8G 3CF5A 4BY1H 4LFAQ 1TWAH 1X6OA 2CQOA 4JBJA 4YWMA 1KL9A 1IYJB 4K0KQ 4L5RC 4YCVA 3FP9A 1GO3E 1S72A 4YCWA 3U4VA 4FDBA 1VQ9A 3NBHB 1SRUA 2B3GA 1N32Q 3PCOB 4LWCA 3S1MH 4OO1I 1WYDA 1Q82C 3E9HA 4DR5L 1HZBA 3CW2C 1WFQA 4NPSA 1M90C 3CCVA 4KHPQ 3B6YA 4KHZA 4DV2L 2LXJA 1XPOA 3HKZG 2MNAA 5BR8Q 1XMQQ 4DR6L 3BU2A 3U50C 3W5OA 4JYAQ 1AE3A 2BA0A 4JI2Q 3PUVA 4DV4L 5C0XJ 1I94Q 2UUCL 3H15A 1PH8A 4GN3B 4DV1L 2Q2UA 3S2HH 2ID0A 1EWIA 1T9HA 1QVGA 1X3GA 1PH9A 4DR4L 4QQBX 4HJ5A 4OXPA 4NXML 1HZCA 1VS0A 2JA6G 1SMXA 4IPGA 2D0PA 1G51A 4A3FH 1Q7YC 4LF5L 3H3VI 3HOZH 4BXXG 1VQKA 4A3IG 1GD7A 1Q81C 3F2CA 3UDGA 3HOVH 1N34Q 3ULJA 3KJPA 3EIVA 3HKZE 4JI4Q 4GKKL 1VQIA 2VUMG 4B3RL 1HNWQ 1N8RC 2QGQA 5HGQA 4LFAL 3RZOH 4ALPA 4JI8L 4JBMA 4BY7H 5LMNL 3H0GH 4R4IA 3PIOA 2QA4A 4IFDG 3KF8B 4JOIC 1I5FA 4GNXA 4DV6Q 2FXQA 4EX5A 2PQAA 4L5SA 1CSPA 1E22A 1JJCB 3Q8DA 2NN6G 2ZTEA 3KDFA 1WJJA 5E7NA 4JI1Q 5IWAQ 3CPWA 3G6EA 5FJ8H 4DR1Q 4AQYQ 3WWVA 2HHHL 3HKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 Q;  4GOP A;  4TQU S;  4NXN L;  2N49 A;  1K9M C;  2N3S A;  4JG2 A;  4LF8 Q;  4C3H H;  1AE2 A;  5IYD H;  4DR6 Q;  3A5Z B;  4IPH A;  4X6A H;  3PUX A;  4R4T A;  3KLW A;  4JI3 Q;  2VQE L;  3CCS A;  4UY8 C;  1EUJ A;  1X3E A;  4GLX A;  3RLF A;  1FL0 A;  4DV1 Q;  2R93 G;  1A62 A;  4R4C A;  1N36 Q;  4DUZ Q;  1HNX Q;  4A3C H;  4HIM A;  4KI0 A;  5C44 G;  1VQ7 A;  4DV0 L;  4LF9 L;  1TWH H;  3CPF A;  2HIV A;  2VNU D;  2KCM A;  1BBW A;  2ZJR A;  4UP7 A;  1V43 A;  5IP9 H;  3G71 A;  1N34 L;  1H95 A;  2ZM6 Q;  3TRZ A;  2UXC L;  4R1J A;  2R7D A;  3S15 H;  1PH3 A;  3A0J A;  1NY4 A;  4JI4 L;  3J80 c;  1PH5 A;  1PH6 A;  3BZK A;  4IJH A;  1VQP A;  2NZH A;  4QGU A;  4YHH L;  3KFU A;  5J3B A;  3FKI G;  1X54 A;  3NEN A;  4IPC A;  1MJE A;  5M3F H;  1GM5 A;  1QVF A;  4BA1 I;  5FJ8 G;  4GKJ L;  3HOX H;  3UDX A;  1EOV A;  4MZ9 A;  4TVA B;  4XIG S;  3GO5 A;  4POG A;  1BVS A;  4PZ8 A;  1E1O A;  3PSI A;  1N33 L;  4A3J G;  2I5H A;  3H0G G;  1XJV A;  3L7Z C;  1WCM G;  4BY7 G;  4DR2 Q;  1SE8 A;  1SR3 A;  4LF7 L;  1NJI C;  5JEA G;  1OXT A;  3VDY A;  1YJN A;  2NVT H;  1G6P A;  3OTO L;  5JEA J;  1VQC A;  4A3L G;  1V1Q A;  2CCZ A;  2CWP A;  4Y7N H;  2Q2T A;  2UXB L;  2K4K A;  2MFI A;  3CCJ A;  1KIX A;  2WAQ G;  4PG3 A;  1MKH A;  5C0X G;  2ALY B;  1Q86 C;  1N36 L;  1CUK A;  2JA6 H;  3GTG H;  1BKB A;  3T1H Q;  1Q1E A;  2UUB L;  1KD1 C;  1Q12 A;  4LF9 Q;  4DR3 Q;  1S40 A;  4LFB Q;  2K50 A;  3RZD H;  1X3F A;  4QJF A;  1LTL A;  3KYH C;  4YWK A;  2DUD A;  3HOW H;  2VW9 A;  2WP8 J;  1WOC A;  3GTQ H;  4A3K G;  4A4I A;  4IJL A;  1YVC A;  1L0W A;  3CCL A;  4YHH Q;  5IYB G;  1YZ6 A;  2MO0 A;  3M4O H;  1D8L A;  1BBU A;  1CKN A;  4DV5 L;  4JI7 L;  2UXD Q;  4LW1 A;  4WJ4 A;  1OXX K;  2WAQ E;  4L5Q A;  1YHB A;  1X56 A;  4C3J H;  1YI2 A;  1IBK L;  2UU9 L;  1VQ6 A;  2YV5 A;  1P8L A;  3NEM A;  2OTL A;  3SGI A;  1K8G A;  4EQ5 A;  3CC7 A;  4YY3 Q;  1EYG A;  4A3D H;  4A3G H;  2F4V L;  4Y52 H;  5LMN W;  4DR5 Q;  3D31 A;  2VQF L;  5C4X H;  4A3M H;  2WB1 E;  5IE8 A;  3AYH B;  2RHS B;  2V1C C;  2JJQ A;  4BA2 I;  1K73 C;  1VQ8 A;  2YTX A;  2PI2 A;  1PHJ A;  1MIU A;  3TEH B;  4JBW A;  2E2H H;  1PH2 A;  2DGY A;  2UXB Q;  1XMO Q;  4GN5 A;  4KLK A;  2EQS A;  2HIX A;  3GD7 A;  1YHA A;  4DR4 Q;  4IFD J;  4JI6 Q;  4A3E H;  3DM3 A;  3I7F A;  4MTN A;  3RLN A;  5M5W H;  1E1T A;  4DV7 Q;  5IP7 G;  2NZO A;  2VS1 A;  4A3E G;  2B63 H;  5LMU Q;  1IBL L;  3HOY H;  1I6H H;  4B3S L;  2IT1 A;  3OW2 A;  1RIP A;  1X9N A;  4B3M L;  3PO3 H;  1QUQ B;  3S14 H;  4DV3 L;  1Q46 A;  2OQ0 A;  3LGJ A;  4DUY Q;  2YYZ A;  3I4O A;  4JI8 Q;  1LM0 A;  4UP9 A;  4UPA A;  3JAM i;  4HIO A;  1NTG A;  2PNH A;  3M3Y H;  2UXD L;  2IX0 A;  4DV6 L;  3CME A;  4DPG A;  3TS0 A;  4JI2 L;  4JI1 L;  3TQY A;  5AJ3 L;  4GNX C;  4X64 L;  4JCV E;  3HOU G;  2KHI A;  2F52 A;  1SRO A;  2HHH Q;  5GQO A;  1VQ5 A;  5K36 G;  5IYC G;  2IHE A;  3ZJY C;  3BJU A;  1AH9 A;  2D62 A;  4LF8 L;  2E2I H;  4DK6 C;  3I55 A;  1OTC A;  3S1Q H;  1FJG Q;  1TWC H;  1L1O A;  1Y1V G;  5H1S E;  3OYY A;  3UE0 A;  1J5E Q;  4JI3 L;  3HOX G;  2Q2H A;  1IXR A;  1RL2 A;  4B3T Q;  2YU9 H;  1U0L A;  1YHQ A;  2MQH A;  4ME3 A;  3HOV G;  1VQH A;  4DNI A;  5FLX c;  1JT8 A;  3HOZ G;  4OX9 L;  3G48 A;  3J81 i;  5LMN Q;  1YJ9 A;  2OTJ A;  5GAD C;  3IRB A;  2YTV A;  5IP9 G;  1L1O B;  4DAM A;  3K8A A;  3K81 C;  5IWA L;  1FGU A;  3HOY G;  5IP7 H;  2B63 G;  3PUW A;  4IOC A;  2BA1 A;  2I5L X;  5DLQ E;  3CD6 A;  1KAW A;  4OWT B;  4DV3 Q;  4H02 A;  4OO1 G;  4OWX B;  2VY3 A;  1KC8 C;  4A3L H;  1NMF A;  4YCU A;  1CKO A;  1VQA A;  2JEA I;  3RNU A;  1VQJ A;  1JB7 A;  4QY7 A;  3PF4 A;  1VQF A;  4X65 L;  3STB C;  1HR0 L;  1CSQ A;  3UE1 A;  1UWV A;  1N32 L;  4X66 Q;  3M85 A;  2JA7 G;  3M7N A;  3K7A H;  4DUZ L;  2N8N A;  4JI0 Q;  1EFW A;  2A8V A;  1HR0 W;  4DR2 L;  4DV2 Q;  4LF7 Q;  1VQG A;  5JJI A;  2IY5 B;  3TRE A;  5BR8 L;  3E9I A;  3FKI H;  3GTO H;  3OTO Q;  3M4Q A;  2F3I A;  1HNZ L;  4AYB G;  4A3B G;  1ASZ A;  1E24 A;  1I3Q H;  2WB1 G;  1CKN B;  1Y14 B;  2XGT A;  1QZG A;  4LF6 L;  1IZ6 A;  1UEB A;  2JK8 A;  3I56 A;  3A5U A;  3PO2 H;  1FVI A;  3HFZ B;  1R9T H;  1PH1 A;  3I4M G;  2UUB Q;  4NXM Q;  2VUM H;  4GN4 B;  2R6G A;  1TXY A;  1WI5 A;  4J15 A;  2UUA Q;  4PZ6 A;  5GAH C;  3EBE A;  4PMW A;  1XPU A;  4A3F G;  3PGZ A;  2QEX A;  1YIJ A;  3KJO A;  3JAM c;  2K14 A;  1A8V A;  4KHP L;  4P72 A;  4O0A A;  2KBN A;  1KRS A;  3F2D A;  1A0I A;  4A93 G;  3STB D;  2I5M X;  5ELO A;  2CWA A;  5M5X H;  2ASB A;  2UU9 Q;  1HR0 Q;  4DAY B;  4DV4 Q;  3ULL A;  1PV4 A;  1QZH A;  3PIP A;  4X66 L;  2Z6K A;  4DR1 L;  3DLL A;  3U58 A;  1XTD A;  4C3I H;  1E7Z A;  4A75 A;  4JI0 L;  3PO2 G;  3T1H L;  1PA6 A;  2JE6 I;  2R92 H;  4DR7 Q;  4A3J H;  4DR3 L;  3M4P A;  2R92 G;  5IYC H;  4LFB L;  3CC4 A;  1HNZ Q;  2Q2I A;  5GAG C;  1LYL A;  4PZ7 A;  2GN5 A;  1B8A A;  3HOU H;  2B29 A;  4LF6 Q;  3E0E A;  1Q1B A;  1PYB A;  1EQR A;  3W1B A;  3AQQ A;  1EQQ A;  4JI5 Q;  2HT1 A;  4APV A;  4WJ3 M;  3PUZ A;  4UP8 A;  3EN2 A;  4JI6 L;  1P16 A;  2JA8 H;  2E5L L;  2IX1 A;  2YTY A;  2JA7 H;  4BXX H;  5GAE C;  3CQZ H;  2XTI A;  2ZTD A;  3L0O A;  4RG1 A;  3UDI A;  2AKW B;  2JA9 A;  1CKM A;  1YEZ A;  5HY6 A;  4DV7 L;  1VQ4 A;  1IBK Q;  1IBL Q;  1K0R A;  1D7Q A;  4A76 A;  4JOI A;  3PO3 G;  1B70 B;  2ZM6 L;  2AWN A;  5M3M G;  1VQB A;  2A1A A;  2D0O A;  2UXC Q;  4GS3 A;  1ASY A;  1TWF H;  2EIF A;  1X55 A;  4O2D A;  4X62 L;  4K0K L;  1K3R A;  2PMZ E;  3CCQ A;  4LF4 Q;  3ER0 A;  1VQE A;  1XNQ Q;  1VQM A;  1EIF A;  1GVP A;  3FHW A;  3RN2 A;  2OWO A;  2ATW A;  4X64 Q;  3MXN B;  1HZ9 A;  2AMC B;  4IO9 A;  5C3E G;  4GOP B;  3KOJ A;  1TWG H;  3W1G A;  1QUQ A;  2OQK A;  1YIT A;  4R4Q A;  5GRO A;  1SLJ A;  3RN5 A;  2BH2 A;  1LUZ A;  4MNO A;  1XMQ L;  4DR7 L;  3T1Y Q;  3BZC A;  2PQA B;  1JE5 A;  3F1Z A;  3K80 C;  4A3M G;  2JEB I;  1C0A A;  4GLV B;  3J81 j;  4A3D G;  1C9O A;  1IL2 A;  4A3G G;  2ZJQ A;  2Y0S G;  4AIM A;  5M5Y H;  4JI5 L;  3D0F A;  4AYB E;  2R7Z G;  4OON A;  1UE5 A;  4C2M H;  1O7I A;  3K0X A;  2NN6 I;  4LF5 Q;  2R7F A;  3A74 A;  1HH2 P;  3J7A 5;  3S1N H;  4IFD I;  1Q8K A;  1W3S A;  3CMA A;  3J7Z C;  3J80 i;  2K5N A;  3AFP A;  4JV5 L;  4A3I H;  1EIY B;  2Z6K C;  2VL6 A;  2GVB A;  3GTJ H;  2K5V A;  2NVX H;  3PUY A;  4P74 A;  4JI7 Q;  4P73 A;  1FJG L;  2C35 B;  3S2D H;  2RCN A;  1KRT A;  1UE1 A;  2IHF A;  4GNX B;  1XNQ L;  3G4S A;  3S24 A;  2WFW A;  1I94 L;  3RLO A;  4YY3 L;  4AQY L;  1VQO A;  4POF A;  3F8T A;  5C0X I;  3U4Z A;  2VQF Q;  4NXN Q;  3I4N H;  4JBK A;  2LSS A;  3K7U C;  4OX9 Q;  1Y1V H;  3I4M H;  1JJG A;  5IY0 A;  1J6Q A;  2CKZ B;  2MO1 A;  2AWO A;  1Z47 A;  1PVO A;  2VQE Q;  4HJ7 A;  3GTL H;  5EAY A;  2Z0S A;  1VCI A;  1Y1W H;  4A3B H;  4BBS H;  1SN8 A;  2RF4 A;  4B3R Q;  1PFS A;  3J81 c;  5C4X G;  2KCT A;  1HNX L;  1HJP A;  3CCM A;  2E8G A;  5M3F G;  1JJ2 A;  4BY1 G;  2JA5 H;  4DV0 Q;  2K52 A;  2I0Q A;  1W2B A;  1XNR Q;  1YBY A;  3KF6 B;  4BBR H;  2L15 A;  5LMU L;  4RMF A;  4B3S Q;  1V9P A;  2CFM A;  1JMC A;  3JC6 6;  4JV5 Q;  4GOP C;  2HQL A;  2NVY H;  4AH6 A;  1I50 H;  3MEF A;  4DKA C;  1B7Y B;  3L2P A;  1VQN A;  3CC2 A;  1QVC A;  5FLM G;  2BH8 A;  1E3P A;  3HOW G;  1A63 A;  5JJL A;  1U5K A;  1PH4 A;  2NVQ H;  3AEV A;  2JQO A;  2E2J H;  1M1K C;  3RR5 A;  4QL5 A;  2A19 A;  5IT9 c;  3CCE A;  1KXL A;  4YWL A;  4LUO A;  1UE7 A;  3S1R H;  1N33 Q;  1XPR A;  1GKH A;  3CCU A;  1L1O C;  2ZJP A;  4L5T A;  4P71 A;  4HJ8 A;  2JA5 G;  1NBW A;  1OXS C;  2UUA L;  1NE3 A;  4LFC L;  2K75 A;  1N9W A;  2ZTC A;  2PI2 E;  4B3M Q;  1IBM L;  1MJC A;  1Y1W G;  4BBS G;  4HIK A;  1G29 1;  4DUY L;  1VQL A;  1SFO H;  2E5L Q;  4IPD A;  2Y0S E;  4GLA C;  3F2B A;  4OWW B;  2GVA A;  1X65 A;  1K83 H;  1KQS A;  3GTK H;  3M9B A;  2VZA A;  5IYB H;  4GKJ Q;  1XNR L;  3UDF A;  3CP0 A;  3I4N G;  1KHI A;  2ES2 A;  1YNX A;  3PV0 A;  5AJ3 Q;  4A3K H;  3CCR A;  4LUZ A;  1PH7 A;  1PYS B;  3ICE A;  3NEL A;  1DGS A;  1C7Y A;  5C4J H;  2OCE A;  4A93 H;  3S17 H;  5C3E H;  3KDF B;  4JC0 A;  3CXC A;  3KF6 A;  2H5X A;  4XTC S;  1Z9F A;  4QIW E;  4DV5 Q;  3ULP A;  1YJW A;  3PF5 A;  4LF4 L;  1J5E L;  4JYA L;  4X65 Q;  4HID A;  3GTP H;  2UUC Q;  3H3V H;  3TS2 A;  4LUV A;  2K5H A;  4DK3 C;  4B3T L;  2F4V Q;  3S16 H;  5C44 H;  3AFQ A;  2KEN A;  1UE6 A;  4IOA A;  4LNQ A;  4A3C G;  2KHJ A;  5FLM H;  3CAM A;  4R4O A;  2R93 H;  3GDE A;  4P75 A;  3T1Y L;  3I2Z A;  5M3M H;  1OXU A;  5ELN A;  1HZA A;  1NMG A;  2RHQ B;  4NB3 A;  2EXD A;  1WCM H;  1OXV A;  1S3O A;  4LFC Q;  2R7Z H;  3ERS X;  3GTM H;  4BBR G;  4HJ9 A;  1L2F A;  1XMO L;  1VQD A;  5IYD G;  2AHO B;  4HJA A;  1IBM Q;  4GKK Q;  1HNW L;  5JJK A;  2LXK A;  2N78 A;  1K8A C;  2JA8 G;  3CF5 A;  4BY1 H;  4LFA Q;  1TWA H;  1X6O A;  2CQO A;  4JBJ A;  4YWM A;  1KL9 A;  1IYJ B;  4K0K Q;  4L5R C;  4YCV A;  3FP9 A;  1GO3 E;  1S72 A;  4YCW A;  3U4V A;  4FDB A;  1VQ9 A;  3NBH B;  1SRU A;  2B3G A;  1N32 Q;  3PCO B;  4LWC A;  3S1M H;  4OO1 I;  1WYD A;  1Q82 C;  3E9H A;  4DR5 L;  1HZB A;  3CW2 C;  1WFQ A;  4NPS A;  1M90 C;  3CCV A;  4KHP Q;  3B6Y A;  4KHZ A;  4DV2 L;  2LXJ A;  1XPO A;  3HKZ G;  2MNA A;  5BR8 Q;  1XMQ Q;  4DR6 L;  3BU2 A;  3U50 C;  3W5O A;  4JYA Q;  1AE3 A;  2BA0 A;  4JI2 Q;  3PUV A;  4DV4 L;  5C0X J;  1I94 Q;  2UUC L;  3H15 A;  1PH8 A;  4GN3 B;  4DV1 L;  2Q2U A;  3S2H H;  2ID0 A;  1EWI A;  1T9H A;  1QVG A;  1X3G A;  1PH9 A;  4DR4 L;  4QQB X;  4HJ5 A;  4OXP A;  4NXM L;  1HZC A;  1VS0 A;  2JA6 G;  1SMX A;  4IPG A;  2D0P A;  1G51 A;  4A3F H;  1Q7Y C;  4LF5 L;  3H3V I;  3HOZ H;  4BXX G;  1VQK A;  4A3I G;  1GD7 A;  1Q81 C;  3F2C A;  3UDG A;  3HOV H;  1N34 Q;  3ULJ A;  3KJP A;  3EIV A;  3HKZ E;  4JI4 Q;  4GKK L;  1VQI A;  2VUM G;  4B3R L;  1HNW Q;  1N8R C;  2QGQ A;  5HGQ A;  4LFA L;  3RZO H;  4ALP A;  4JI8 L;  4JBM A;  4BY7 H;  5LMN L;  3H0G H;  4R4I A;  3PIO A;  2QA4 A;  4IFD G;  3KF8 B;  4JOI C;  1I5F A;  4GNX A;  4DV6 Q;  2FXQ A;  4EX5 A;  2PQA A;  4L5S A;  1CSP A;  1E22 A;  1JJC B;  3Q8D A;  2NN6 G;  2ZTE A;  3KDF A;  1WJJ A;  5E7N A;  4JI1 Q;  5IWA Q;  3CPW A;  3G6E A;  5FJ8 H;  4DR1 Q;  4AQY Q;  3WWV A;  2HHH L;  3HKS A; 
#chains in the Genus database with same CATH topology
 4C3H H;  1AE2 A;  1T5E A;  5M5Y B;  1TS3 A;  3A5Z B;  2B2U C;  4IPH A;  5KT6 A;  4DXF A;  4ZQI A;  4X62 H;  2VQE L;  3CCS A;  4UY8 C;  3DMU A;  4ME5 A;  1G2T A;  4LAA A;  1FL0 A;  1A3V A;  1HXY D;  1ZYR C;  4DV1 Q;  2W9B A;  1A62 A;  2R93 A;  1F2Z A;  1K1Q A;  1ROD A;  3HOW B;  1TWH H;  2WV6 D;  4DL3 A;  4BS9 A;  1S9F A;  3H4B A;  1EY5 A;  2QDB A;  2DY7 A;  3J7A K;  1V43 A;  2B8G A;  1N34 L;  1H95 A;  2ZM6 Q;  2HDL A;  2ALZ A;  1JR0 D;  4LH7 A;  5JUM A;  3S15 H;  3A0J A;  5DEH A;  3BDO A;  1PH6 A;  3BZK A;  1CI3 M;  4IJH A;  4HCS A;  4YHH L;  2YU9 B;  3KFU A;  1HTP A;  1YNN D;  5J3B A;  1B2T A;  3FKI G;  5M3F H;  1GM5 A;  4GKJ L;  1EOV A;  4BY7 B;  1I7N A;  4QF4 A;  4TVA B;  4POG A;  3RZO B;  3IFT A;  4PZ8 A;  4YY3 H;  2L12 A;  2ASJ A;  2I5H A;  1A3U A;  5IIF A;  2UUA H;  5EPK A;  2W6Z A;  4LF7 L;  2A5H A;  2WE6 A;  5DGB A;  3Q0A A;  4BY1 B;  2R87 A;  5FLX E;  4Y7N H;  3ND9 A;  5C4X B;  3MXU A;  5CR3 A;  4YR2 A;  2FJZ A;  3GII A;  4Q8F A;  2ZDQ A;  2KUM A;  4RUA A;  4LF9 Q;  1EZ8 A;  3K7A B;  3M9O B;  4LF7 H;  3DWP A;  1GUO A;  2K50 A;  2W8L A;  4DN4 M;  1F9P A;  4YWK A;  2DUD A;  3HOW H;  2UXD H;  4DK0 A;  2WP8 J;  3GTQ H;  4M8A A;  1UC9 A;  2NTT A;  2IA6 A;  3EQL C;  3CCL A;  3MXN A;  3GTK A;  2EDG A;  1YZ6 A;  2MO0 A;  1R4Q B;  2AQ1 B;  2G9H D;  3M4O H;  2E2H B;  3EYY A;  4DV5 L;  4JI7 L;  2B2T C;  1EIH A;  4LW1 A;  1BF4 A;  4KK7 A;  3M9M B;  3GV3 A;  1YHB A;  5HGT A;  2KEE A;  3G6Y A;  3NEM A;  1RCV D;  2BDO A;  4Q45 A;  1O7Z A;  1TWA B;  4ED6 A;  4A3D H;  2F4V L;  3D31 A;  1Q3L A;  2VQF L;  1R4P B;  2WB1 E;  4K2K A;  2H4O A;  3AYH B;  5KG0 A;  4MTD A;  3PO3 B;  2RSO A;  1VQ8 A;  2DJG C;  1FGB D;  1DIK A;  4JBW A;  2E2H H;  3QWN A;  5M5X B;  5KX5 F;  3S1N B;  2D5D A;  3GTP B;  4YJ2 F;  4OO1 H;  4DL5 A;  4MTN A;  3JRX A;  2VS1 A;  2M00 A;  3H0G B;  2NVY A;  5CV4 A;  1HQM C;  4EGJ A;  1N36 H;  4MIU A;  3OWE B;  1X9N A;  4L1K A;  4RU9 A;  1HFG A;  1QUQ B;  3R8B A;  1Q46 A;  4DUY Q;  2YYZ A;  3WO0 A;  2W8K A;  3U9O A;  3M3Y H;  2UXD L;  1RKN A;  3JAM W;  1U4R A;  5DM7 3;  1IKM A;  3AB9 A;  5C8Y F;  2W9C A;  1N33 H;  4GNX C;  2YS7 A;  1FYC A;  5KFO A;  1VQ5 A;  4DAP A;  4QUF A;  5K36 G;  3N8D A;  2IHE A;  4J9L A;  2MPM A;  2E2I H;  1EUD B;  4ECR A;  1SFO A;  1L1O A;  4MAM A;  5J39 A;  2Q2H A;  2B39 A;  4ZK9 B;  3P7J A;  2YU9 H;  3FKI B;  2HGS A;  1Q90 A;  1TWH B;  4C1N K;  5BN4 A;  2C00 A;  5CYU A;  5FLX c;  2RDJ A;  1STE A;  3EA6 A;  5KFQ A;  1YJ9 A;  4JV2 A;  2K6A A;  5GAD C;  2HVQ A;  4OL7 A;  4JI1 H;  2DN8 A;  3K81 C;  1FGU A;  3GIJ A;  4A3F B;  3P20 A;  2R86 A;  2RVL A;  2BA1 A;  2BOS A;  4DV3 Q;  4H02 A;  4OO1 G;  4OWX B;  1L0X B;  1NMF A;  1B44 D;  3KBG A;  2SCU B;  1CKO A;  1I4R A;  3RNU A;  2RKS A;  3PF4 A;  1SNM A;  3M4I A;  3N43 B;  4J9P A;  2ATL A;  1JCK B;  2VQF H;  3UE1 A;  1JX4 A;  5KEE A;  3QZ8 A;  3MTS A;  4X66 Q;  3BG3 A;  3K7A H;  2N8N A;  2A8V A;  4J9M A;  1SJH D;  4LF7 Q;  1F77 A;  3J81 L;  4F4Y A;  4LF9 H;  3OTO Q;  3M4Q A;  1F9Q A;  4A3B G;  5C1P A;  3GQB A;  1CKN B;  3I4M B;  1Y14 B;  1RK5 A;  2F0W A;  4I65 A;  1IZ6 A;  3BQ2 A;  1PFN A;  4XYO A;  2J6U A;  3I56 A;  2K01 A;  4NXM Q;  4IUV A;  1SYX B;  1TXY A;  4FF1 A;  1WI5 A;  3GQC A;  2UUA Q;  1UNS A;  4PZ6 A;  3EBE A;  3HKZ B;  1FNW A;  2D9U A;  3E5S A;  1JOK A;  3UI2 A;  2ASB A;  3QOL A;  5ELO A;  3TP5 A;  4APM A;  2UU9 Q;  3OMC A;  2BDN A;  1KEE A;  1HR0 Q;  4IUP A;  1F9R A;  2Z9H A;  3PIP A;  2JA8 B;  2B2Y C;  1PTO H;  4X66 L;  4F8M A;  2OF1 A;  4DAV A;  1WVL A;  4X64 H;  1EWH A;  2EVB A;  3PO2 G;  4NDX A;  2JE6 I;  3JAM E;  3ZYY X;  4FM9 A;  4LFB L;  3CC4 A;  4FF3 A;  5GAG C;  2XWB B;  2EZV A;  3E0E A;  1Q1B A;  1EQQ A;  3LP8 A;  4MHE A;  5CAE B;  4RH6 A;  1I6H B;  3H6M A;  3PUZ A;  4UP8 A;  2JA8 H;  1XYI A;  4IUT A;  2E5L L;  3LWU A;  5JJZ A;  2CW0 D;  2AKW B;  1IBK Q;  1TWG A;  1XX8 A;  4A76 A;  1B70 B;  4G7H C;  5M3M G;  5KFV A;  1LT4 D;  2D0O A;  3PW5 A;  4HR7 A;  3BVG A;  1ASY A;  4FU0 A;  1TWF H;  1PTO C;  5KFR A;  4X62 L;  1KJQ A;  3HKZ A;  2Z4I A;  1PFM A;  4DNT B;  2L0C A;  2IP4 A;  1BJT A;  1U4P A;  3NBI A;  1EOT A;  2EYH A;  2ATW A;  1TY0 A;  2DWC A;  4TQR A;  1EY9 A;  3KOJ A;  4RGM A;  1T36 A;  5KFS A;  2OQK A;  5GRO A;  4QMG A;  1DOK A;  3E6Z X;  2CW7 A;  4IR1 A;  2JP1 A;  4LJZ C;  4O3O A;  1NR2 A;  3D3R A;  5LL6 b;  1HNZ H;  4ED2 A;  4A3D G;  4HNT A;  4NMZ A;  1RJP A;  1B3A A;  2DLN A;  3KHL A;  5F2D A;  4JI5 L;  3D0F A;  2W9A A;  2B8F A;  1I4P A;  3MHB A;  5C4Z A;  4BBS B;  4U6P A;  3CHB D;  3A74 A;  1HH2 P;  3J7A 5;  3S1N H;  5LXT F;  4OX9 H;  1CA5 A;  1SMY C;  1T5X D;  3J7Z C;  2WTF A;  3J80 i;  4A3I H;  2XGP A;  4IRD A;  1PRT D;  3NBH A;  3W3A A;  4JI7 Q;  1RK6 A;  1FJG L;  3S2D H;  1KNA A;  2IHF A;  3BVM A;  5DAU A;  4L63 B;  4AQY L;  2YZN A;  1VQO A;  1PLF A;  2L4N A;  4POF A;  1QB5 D;  3TIN A;  1TQO A;  4NXM H;  2VQF Q;  1Y1V H;  2NU6 B;  2A6E C;  2A6E D;  2AWO A;  2E2I B;  1PVO A;  3HP3 A;  4HJ7 A;  3GTL H;  4FVM A;  3DHQ A;  1Y1W H;  5DG8 A;  2XWJ B;  4DF7 A;  3J81 c;  4I7Z C;  5I2X A;  1B4O A;  2KCT A;  1HJP A;  5C3W A;  5M3F G;  1VKZ A;  2FPP B;  5KFB A;  5J2U F;  4IUN A;  2I0Q A;  1W2B A;  1YBY A;  3KF6 B;  1CM9 A;  3H3V C;  2VPS A;  1FR3 A;  4A3J B;  2FPI B;  4O3N A;  4EEY A;  2HQL A;  3U9S A;  4AH6 A;  1I50 H;  2ZM6 H;  5DNF A;  3VPB A;  1VQN A;  1GSO A;  3MR6 A;  3H0G A;  4LF4 H;  1SYD A;  4UHV A;  4GC6 A;  4QWB A;  4KJN A;  5ELD A;  2JQO A;  1M1K C;  3RR5 A;  3RAX A;  1LTG D;  3S1R H;  1XPR A;  3L9A X;  4IAL A;  1ZHQ A;  2ZJP A;  4L5T A;  4H44 C;  3H20 A;  1NBW A;  1DXM A;  2BCO A;  4LFC L;  2K75 A;  5H80 A;  2PI2 E;  2ZXR A;  5EJW A;  5BPF A;  4GZY C;  1DD2 A;  4KD3 A;  2KQ3 A;  4HIK A;  1G29 1;  2V9W A;  2DNE A;  4J6H A;  1STH A;  5ELB A;  2E5L Q;  2HHH H;  2GVA A;  1X65 A;  1K83 H;  4JW0 A;  3GTK H;  1E4F T;  1TWF A;  1KHI A;  4ECW A;  2E2H A;  3PV0 A;  1EYZ A;  3CCR A;  1V1P B;  4YR0 A;  4LF8 H;  2BE5 C;  2EY2 A;  3NEL A;  4B3S H;  3RD4 A;  5KFG A;  2V4Q A;  2OCE A;  3KDF B;  4JC0 A;  3KF6 A;  4FP5 D;  2H5X A;  1A9X A;  4DR1 H;  2ZDG A;  3PF5 A;  5BN5 A;  1J5E L;  1L0Y B;  4HID A;  3TS2 A;  2K5H A;  2F4V Q;  3C1E A;  1UE6 A;  3RZD B;  2EOT A;  2F0S A;  5BMV F;  4Y7N B;  3CAM A;  3GDE A;  4V0B A;  2Z4H A;  5M3M H;  5JVH 3;  5IGE A;  2R84 A;  1NR4 A;  2J9G A;  4LFC Q;  2R7Z H;  3Q23 A;  3GTM H;  4BBR G;  1VQD A;  5IYD G;  4HJA A;  5CV7 A;  1GSH A;  1UEA B;  2OH2 A;  2LXK A;  2JA8 G;  4YAK B;  3K5M A;  4BY1 H;  5EQ0 A;  1X6O A;  2HUG A;  2FLP A;  1IW7 D;  3K0Y A;  5KFU A;  3HOU B;  1D5Z C;  4YCV A;  1IOV A;  4N8X 1;  5D3I B;  1GO3 E;  3RV4 A;  3Q6S A;  5KT3 A;  4YCW A;  4JI0 H;  2QYZ A;  3NBH B;  1VMP A;  2YU9 A;  1MBY A;  3Q8R B;  4LWC A;  3S1M H;  3ETJ A;  5BR8 H;  4X66 H;  4DR5 L;  1WFQ A;  1J8I A;  3W2D A;  4E4T A;  5EPJ A;  2FMA A;  2AGP A;  3SK4 A;  2Q8R E;  4DV2 L;  4RZR A;  3L3O C;  1TWF B;  1EQV A;  2MNA A;  3EPI A;  4DR6 L;  3BU2 A;  3IL8 A;  4E6I A;  3DWQ A;  1V51 A;  1AE3 A;  2F0E A;  1EYD A;  1I94 Q;  5KNC A;  4OHJ A;  3IN5 A;  4L6T B;  2W9B B;  3S2H H;  1T9H A;  4DR4 L;  5FD6 A;  4ECU A;  1WTQ A;  3BQ1 A;  1VS0 A;  3TN2 A;  4WBN F;  1LTT D;  1VQK A;  1GD7 A;  3F2C A;  1Z6H A;  1DON A;  4EFE A;  2XRQ D;  2J4X A;  1N8R C;  4ALP A;  1EY6 A;  1SNO A;  3ETH A;  3G6J B;  4IFD G;  3KF8 B;  2HDM A;  1TVX A;  5KFH A;  2PQA A;  1ILQ A;  1CSP A;  1I50 A;  1E22 A;  2F0J A;  3S1R B;  4FS2 A;  5E7N A;  1AW7 A;  1WJJ A;  3KDF A;  5T1G A;  4JI1 Q;  5IWA Q;  4DR1 Q;  3WWV A;  2HHH L;  2FP4 B;  3TP6 A;  5KG7 A;  4RGO S;  4X62 Q;  4GOP A;  4TQU S;  4NXN L;  1K9M C;  2XCA A;  2N3S A;  4JG2 A;  4CJ2 C;  4LF8 Q;  2W71 A;  4OEM B;  4DR6 Q;  2YS6 A;  4HED A;  1RYS A;  4X6A H;  3PUX A;  1EUJ A;  1Y1W A;  1X3E A;  4HTH A;  3V6H A;  2R93 G;  5DGA A;  2W57 A;  3KLS X;  1N36 Q;  3GV6 A;  4QWD A;  1HNX Q;  4F4X A;  4A3C H;  4YBZ B;  3KTM A;  5JQW A;  3CPF A;  4MN3 A;  2KED A;  3N42 B;  2VNU D;  1S68 A;  4J0M A;  1BBW A;  2I07 B;  2KEC A;  3MR2 A;  3G71 A;  2R6F A;  1TS5 A;  2UXC L;  5KND A;  4O3S A;  4JI4 L;  1EHI A;  2VOB A;  1WCM B;  2PZU A;  4KHV A;  2DPJ A;  2WAC A;  3RGZ A;  4QGU A;  4EBE A;  3GV7 B;  2R3Z A;  4X3U A;  2EYF A;  4IPC A;  3NEN A;  3KK7 A;  2R8G A;  1QVF A;  4BA1 I;  5FJ8 G;  3VR4 A;  3J7Y W;  3BYT B;  2EY6 A;  3OHB A;  1PX2 A;  4UCU A;  1K83 A;  4YJ3 F;  1N33 L;  1JIH A;  3H0G G;  3VMM A;  4FS1 A;  3L7Z C;  1WCM G;  4DR2 Q;  1GLV A;  5JEA G;  1SMY D;  3VDY A;  3G7L A;  1TWG B;  3MXG A;  1X3Q A;  5JEA J;  4A3L G;  1V1Q A;  2EYP A;  2UU9 H;  4ODG A;  4C3H B;  4RHR A;  3A56 A;  1TS2 A;  3FVQ A;  2ALY B;  1N36 L;  1CUK A;  3BS1 A;  4IQZ A;  1Q1E A;  4ECT A;  1S40 A;  1EU4 A;  2K5Q A;  5L1J A;  5KYL A;  1A6X A;  1M4V A;  1X3F A;  4QJF A;  1LTL A;  3KYH C;  3BAB A;  4JYA H;  3SDZ A;  4R8U B;  2XGQ A;  2RA4 A;  2QCP X;  4I7A A;  2DIK A;  1D8L A;  2R7N A;  4DXG A;  4L5Q A;  2WAQ E;  2R61 A;  4C3J H;  1SYB A;  1KNE A;  1IBK L;  1PXU A;  1SNP A;  1K8G A;  2FKL A;  4J9Q A;  1BDO A;  1I3Q A;  2I80 A;  4DV2 H;  3TII A;  2C28 A;  5IE8 A;  4CDC C;  2V1C C;  4BA2 I;  3IG0 A;  4QWE A;  1PHJ A;  2P0A A;  1EUC B;  1BGW A;  1PDQ A;  2DGY A;  1PH2 A;  5KFE A;  2V5A A;  5KT7 A;  1H9R A;  4GN5 A;  3Q8Q B;  1HPC A;  3A7A B;  1SEB D;  4XXE A;  3J7A F;  1M0W A;  1D1I A;  1TWH A;  4RB0 A;  1YHA A;  3UFX B;  4JI6 Q;  4A3E H;  2W6N A;  3SEB A;  3I7F A;  3HG9 A;  5CBA E;  1E1T A;  2BR0 A;  5DQI A;  1JOO A;  2B63 H;  4A3E G;  1I6H H;  5KYI A;  2NWG A;  5LMU Q;  2ZT9 C;  4B3S L;  1WTH A;  2IT1 A;  5EKK A;  1CA6 A;  3EVQ A;  3PO3 H;  4B3M L;  4LSX A;  1EYA A;  3I4O A;  4UPA A;  4UCS A;  1NTG A;  4UCR A;  2PNH A;  3E3X A;  4IUQ A;  3CME A;  4KMU C;  2YYA A;  3TS0 A;  1SJE D;  3NQI A;  4ABN A;  4X64 L;  4JCV E;  3HOU G;  2KHI A;  5EWG A;  2M05 A;  2A68 C;  2HHH Q;  5CB4 F;  2EXZ A;  5KG1 A;  3MZ5 A;  1H9S A;  1E2V A;  2F0D A;  3JAM L;  1HNX H;  1AH9 A;  4LF8 L;  3S1Q H;  4CHT B;  3CVZ A;  1EEF D;  3BVZ A;  3N52 A;  4N8F A;  1FJG Q;  3J81 W;  4F4Z A;  5H1S E;  3UE0 A;  1EU3 A;  2QDL A;  3GTP A;  5IT9 W;  4RGT A;  1BQQ T;  1YHQ A;  3RB6 A;  2EPB A;  1LO5 D;  4ZUJ A;  3RAQ A;  1JT8 A;  4IUU A;  1MI2 A;  5I6Y A;  3J81 i;  1GXD C;  4ULL A;  1TU2 B;  3AU7 A;  5D14 A;  3Q1K A;  5IYZ F;  1W93 A;  1R9T B;  1B33 N;  4IZ8 A;  1KLU D;  3MC0 B;  4DAM A;  1S5D D;  2F0F A;  2IX3 A;  5IP7 H;  2NVT B;  3PUW A;  2I5L X;  3GIL A;  2SOB A;  3CD6 A;  1KAW A;  4OWT B;  4TQS A;  2VQE H;  4CKE A;  1KC8 C;  4A3L H;  2O5J C;  4YCU A;  4BWG B;  2JEA I;  4EGV A;  1JB7 A;  1WD1 A;  2RBM A;  3LWE A;  3A8I E;  3TSS A;  4IRK A;  1VQF A;  4X65 L;  2R85 A;  4ECQ A;  1UWV A;  5CGK A;  1ZXT A;  1HTL D;  2R8H A;  4MV9 A;  1HHV A;  4QIW B;  4DV0 H;  4O2A F;  1EY7 A;  3M7N A;  5KFF A;  1FNV A;  4DUZ L;  4A3B B;  5JAV A;  1RJR A;  4DV2 Q;  5JJI A;  2IY5 B;  1GUG A;  1ILP A;  1EL0 A;  1JC7 A;  4AYB G;  5KNB A;  2XGT A;  4ED3 A;  2DNC A;  4LF6 L;  1XMQ H;  3HOZ B;  2RDF A;  1CHQ D;  3TME A;  3HFZ B;  1TWC A;  2XCP A;  5K5P A;  2QF7 A;  2VUM H;  4HSV A;  2CQY A;  2R6G A;  5A2Q W;  2RGR A;  4MTE A;  2I8C A;  1IYV A;  5GAH C;  1ENC A;  3C0F B;  1XPU A;  3V4Z A;  3VR3 A;  3JAM c;  1ESR A;  1O7L A;  1GOZ A;  1U9R A;  2F3V A;  1STB A;  2GLT A;  4P72 A;  1RJQ A;  2KBN A;  1KRS A;  2I5M X;  1ET9 A;  4K8I A;  1A2U A;  4DAY B;  3ULL A;  4DV4 Q;  1QZH A;  1PV4 A;  1S03 G;  1NAP A;  3GID A;  2RDH A;  3DLL A;  1TS4 A;  1E7Z A;  4QUC A;  3MWM A;  4Q44 A;  2AQ3 B;  4JI0 L;  1ZET A;  3T1H L;  3JZI A;  1PA6 A;  1SEI A;  1MZB A;  4DR7 Q;  4A3J H;  1WSC A;  2R92 G;  4ZKC B;  5EBD A;  1HNZ Q;  3S14 B;  4DUZ H;  2GN5 A;  4MV1 A;  5I4D A;  1RHP A;  3EPG A;  2K5D A;  3LX0 A;  4LF6 Q;  1EQR A;  1JXL A;  3RTX A;  2NTS A;  4APV A;  5M3F B;  4WJ3 M;  1XXG A;  3EN2 A;  3BG5 A;  2IX1 A;  3QO2 A;  5GAE C;  3CQZ H;  1WTP A;  3L0O A;  1UAP A;  3NE5 B;  4RGN A;  4DV7 L;  1CKM A;  1YEZ A;  4RCO A;  5ELF A;  1V4Y A;  1SFO B;  2UXC Q;  2AWN A;  2A1A A;  1B9N A;  3G8C A;  5IWA H;  2EIF A;  1X3P A;  1X55 A;  1YNJ D;  4O2D A;  3RB0 A;  5LMU H;  5L1I A;  4U68 A;  1G91 A;  2R8J A;  1LTS D;  3CCQ A;  5KGU A;  1GJX A;  1VQM A;  1GVP A;  3A7L A;  4K6D A;  2AQ4 A;  3MXN B;  3GTK B;  3FPP A;  1HZ9 A;  4A93 B;  2AMC B;  4IO9 A;  4GOP B;  4MV3 A;  5KFI A;  1LAC A;  1QUQ A;  4R4Q A;  3T5J A;  1PTO B;  1SLJ A;  3RN5 A;  2BH2 A;  2VUG A;  1LUZ A;  1XMQ L;  4LF6 H;  3H94 A;  2HCI A;  2PQA B;  3OW7 A;  5EKL A;  3RUZ A;  2JEB I;  4A3M G;  1C0A A;  5KRU A;  5K2M A;  1NCV A;  1DYQ A;  4ED1 A;  3PR4 A;  3J81 j;  5E4W C;  1C9O A;  1IL2 A;  5EWE A;  4A3G G;  4AIM A;  1I94 H;  1I3Q B;  2R7Z G;  4JI2 H;  3D4R A;  4UCT A;  1B3Q A;  3S16 B;  5C1O A;  1HNW H;  5G3L F;  4RUC A;  5D1P A;  3D4D A;  4IFD I;  4C1N I;  1W3S A;  3MFG A;  4TV8 F;  1HR0 H;  4KHP H;  4IUR A;  3PMF A;  3ORQ A;  4RCN A;  3R5H A;  1Y8O B;  3Q24 A;  1KBL A;  4QWC A;  2VL6 A;  1DCZ A;  1EY0 A;  2GVB A;  2VB2 X;  2WKC A;  2NVX H;  3PUY A;  1FKA H;  1CQJ B;  1A15 A;  1G8Z D;  2RCN A;  4GNX B;  1JWU D;  3DUZ A;  3VYU A;  3RFC A;  1TA8 A;  5FLX L;  2WFW A;  4YY3 L;  4G7O C;  1VF7 A;  1Z2N X;  4LFC H;  2F0U A;  5EKI A;  3HOX B;  4JBK A;  1CQF A;  1PZK D;  1JJG A;  3FMA A;  5EPL A;  1Z2O X;  2W70 A;  3L4K A;  3S1Q B;  4KV6 A;  4DV3 H;  3GTQ A;  1W96 A;  1IOW A;  5LA6 F;  2Z0S A;  1VCI A;  1S0N A;  5F9L A;  5IOC A;  1SN8 A;  3NTK A;  1PFS A;  3OHA A;  2FK1 A;  1HNX L;  1F2M A;  2E8G A;  4DFA A;  1WTR A;  4PMB A;  5CA1 F;  5D3D A;  4DV0 Q;  5C5J A;  4R8I A;  1XNR Q;  5D65 A;  5LMU L;  2L15 A;  3RV3 A;  4RMF A;  1Y1V B;  2CFM A;  3I4L A;  1JMC A;  4DKA C;  3L2P A;  3WNZ A;  1F9S A;  5FLM G;  1JWM D;  4I50 F;  2B2V C;  2F4I A;  4JPB W;  4RWS C;  3GIK A;  2L55 A;  1CHP D;  1PH4 A;  2WAQ A;  1IW7 C;  1MSH A;  4ZAI A;  2A19 A;  2CQA A;  2RCF A;  4RAU C;  5IT9 c;  4FXD A;  5L1L A;  1H9M A;  1N33 Q;  4MA0 A;  2MHV A;  2EYJ A;  2FLL A;  3E0J A;  1F2L A;  4P71 A;  2JN4 A;  3CU7 A;  3FDT A;  5KKN B;  3ONA B;  4TSS A;  4IWY A;  1LTA D;  5FPO A;  5L1K A;  1OO9 B;  3HZX A;  1J5E H;  1N9W A;  5J22 A;  3NXW A;  4WD3 A;  1IBM L;  1Y1W G;  4DUY L;  3TBI B;  1C30 A;  1VQL A;  2AGQ A;  1SFO H;  2Y0S E;  4GLA C;  5FKA C;  4NW2 A;  4OWW B;  1DV1 A;  2VR1 A;  2VZA A;  5IYB H;  1XNR L;  3UDF A;  1SND A;  3A8J E;  2ES2 A;  4MV7 A;  5F9N A;  3T53 B;  3SR1 A;  4J8Q A;  4A3K H;  3F8N A;  4JI4 H;  2M2L A;  3PW0 A;  5KFM A;  3ICE A;  2PPB C;  1C7Y A;  5C4J H;  1BCP C;  3D8G A;  5C3E H;  4MV6 A;  1X32 A;  5JPM C;  4JYA L;  3T51 B;  4K8J A;  4Z9C B;  4X65 Q;  1BUV T;  4I7H A;  5FLX W;  1HA6 A;  3H3V H;  4XQN A;  4B3T L;  3S16 H;  5EOY A;  4EYI B;  3T56 B;  4DR7 H;  2RSN A;  4A3C G;  4GC7 A;  2KHJ A;  3ORR A;  5FOB B;  3HOV B;  5KG5 A;  2R93 H;  2PMZ B;  4P75 A;  4PDB A;  5KG2 A;  2Z6B A;  3I2Z A;  5ELN A;  4G57 A;  2RHQ B;  1DJR D;  2PYK A;  2F0O A;  3H91 A;  3J80 L;  3RBD A;  3ERS X;  4KY5 A;  4O1N A;  1IBM Q;  1AZQ A;  1RTO A;  1K83 B;  5JJK A;  3CF5 A;  4LFA Q;  2AUK A;  1KL9 A;  2Z8L A;  4CGY B;  5KFL A;  4DR3 H;  4IN3 A;  4XT1 B;  4LMY A;  2IMW P;  3U4V A;  1SRU A;  1JOR A;  1N32 Q;  3PCO B;  4IFD H;  1F2Y A;  3E9H A;  4HN7 A;  4NPS A;  1ZHS A;  4KHP Q;  3R23 A;  2TSS A;  5KFX A;  3IAY A;  1Y1V A;  3HXL A;  4EBC A;  5C44 B;  5C4J B;  2BA0 A;  4DV4 L;  4ILW A;  1I6U A;  2AQ2 B;  3F2U A;  4DV1 L;  2A69 C;  2DZD A;  1EWI A;  1QVG A;  4QQB X;  4MV4 A;  4J9K A;  4OXP A;  4NXM L;  4CC6 A;  1SMX A;  4IPG A;  2D0P A;  1G51 A;  2JA6 A;  3UDG A;  1N34 Q;  3ULJ A;  2PMZ A;  1STG A;  5C5L A;  1HNW Q;  4ECY A;  2QGQ A;  1HFN A;  4LFA L;  1ENF A;  5J1Z A;  3RZO H;  5GON F;  4JBM A;  4I55 F;  4OGQ C;  3H0G H;  1I50 B;  2QA4 A;  5T14 A;  1I5F A;  5CV6 A;  4GNX A;  2KVM A;  4EX5 A;  4L5S A;  4RKL A;  2C2E A;  2XC9 A;  2K7V A;  4JVZ A;  1LTB D;  3VPD A;  1K8O A;  4AQY Q;  4B3M H;  4RA8 A;  5FJ8 H;  1QJO A;  2NVQ B;  5NUC A;  2N49 A;  2O5I C;  5EZY F;  1SYE A;  5IYD H;  2FK3 A;  2L9H A;  4S3S A;  3L4J A;  4JK1 C;  4JI3 Q;  1LLR D;  1AP0 A;  1QWY A;  2PQE A;  3I91 A;  4GLX A;  3OSP A;  2VUM B;  3H40 A;  1JLL B;  1WTX A;  4R4C A;  1KDB A;  4DUZ Q;  3VPC A;  5BN3 A;  1B1Z A;  1VQ7 A;  3GTQ B;  3DEP A;  4LF9 L;  3DF7 A;  3ITP A;  4K5X A;  4C3I B;  2KCM A;  4XZ3 B;  1CFM A;  4HNU A;  5IP9 H;  4R1J A;  1HRJ A;  1PH3 A;  3MJF A;  3K6O A;  2Q8T A;  2FPG B;  3SVM A;  1Y8N B;  1PH5 A;  1XNR H;  1VQP A;  2NZH A;  3FDS A;  3TZD A;  1AFP A;  3Q2O A;  3HOX H;  3NWT A;  3UDX A;  4MZ9 A;  4XIG S;  4HMJ A;  4DLK A;  1BO0 A;  2QIL A;  1E1O A;  3PSI A;  3V05 A;  1HA5 A;  4B9W A;  2KA7 A;  1EQT A;  2FHT A;  2QK4 A;  1SSO A;  2R8I A;  1RTN A;  3ERO A;  2NVT H;  3OTO L;  1CT1 D;  1G2S A;  2W6P A;  3J80 W;  1VQC A;  3ND8 A;  2CCZ A;  4ED7 A;  1U4L A;  2CWP A;  1DV2 A;  4YR3 A;  4WRD A;  2SNM A;  1MKH A;  5C0X G;  4X3T A;  4P2C B;  1BKB A;  1GUT A;  3T1H Q;  2JA5 A;  3DM1 A;  1QIL A;  4K14 A;  4DR3 Q;  1I7L A;  3NTI A;  3RZD H;  2V4D A;  2VA3 A;  2K33 A;  1WOC A;  1RDP D;  3SK8 A;  4MTK A;  4A3K G;  1YVC A;  4YHH Q;  5IYB G;  4FYD A;  4HAE A;  1M0T A;  1S0O A;  5JVD F;  1CKN A;  2AU0 A;  2UXD Q;  4WJ4 A;  1OXX K;  2FFK B;  2UU9 L;  2RDI A;  3GV8 B;  4O2B F;  2YV5 A;  4HMI A;  5K36 H;  3SGI A;  1EYG A;  2DPI A;  3CC7 A;  2L1B A;  5ISR A;  3N41 B;  2KHS A;  3NGD A;  2IWH A;  2PVP A;  4KKT A;  3HBL A;  1IBM H;  2RHS B;  2P5Z X;  3GTG A;  3JSL A;  3PQI A;  2WYO A;  1WD0 A;  1MIU A;  3TEH B;  2N88 A;  1UC8 A;  2Y0S A;  4HCE A;  3VYS A;  2ICE C;  4KLK A;  2EQS A;  4LK1 C;  4IRC A;  2HIX A;  3RJ0 A;  3EJI A;  4A3K B;  1BR9 A;  3RLN A;  2NB0 A;  2PO4 A;  4A2A A;  4IZO A;  3RMH A;  3GP7 A;  2KCC A;  3HOY H;  1IBL L;  4ECZ A;  2JEJ A;  1JDE A;  4EQN A;  3OSN A;  5CV5 A;  4UCV A;  2LY7 A;  3S14 H;  4DV3 L;  2OQ0 A;  3I73 A;  4HIO A;  1KJ9 A;  1V8Q A;  4FO2 A;  1AUX A;  2YZM A;  3GTM B;  3RBE A;  2EJF C;  1QCB D;  2Z1C A;  1AEX A;  4DV6 L;  4DPG A;  1I4H A;  5DG9 A;  4JI2 L;  5DQG A;  2G5D A;  3TQY A;  4B08 A;  3FRP B;  5AJ3 L;  3LML A;  1SRO A;  5GQO A;  5IYC G;  4CBV A;  3BJU A;  2PZT A;  3I55 A;  3MA2 B;  1IL8 A;  1TWC H;  3GIP A;  2VPQ A;  2JEI A;  2W6Q A;  4JI3 L;  4H13 C;  5CMD A;  1MGS A;  4B3T Q;  3KAK A;  5A35 A;  1U0L A;  2GPW A;  1I4Q A;  4DNR B;  2UXB H;  2MQH A;  1VQH A;  5KG4 A;  5LYJ F;  1VMC A;  3A8K E;  2E2J B;  2LMC B;  3S15 B;  3DWA A;  3K5L A;  5LMN Q;  4I4T F;  4JI5 H;  3LNN A;  2OTJ A;  1KLG D;  2R7M A;  2R7L A;  2YTV A;  1AZP A;  3V4S A;  3T4A C;  2G9D A;  3K8A A;  3HOY G;  5IWA L;  4FNF A;  1N56 A;  5DLQ E;  3T13 A;  3OPO A;  4F87 A;  1C8C A;  3MEH A;  4G4K A;  5FO8 B;  3TIG A;  1VQA A;  3BYY B;  1VQJ A;  3RF2 A;  4QY7 A;  4H7B A;  4FF2 A;  3STB C;  1HR0 L;  1CSQ A;  5EWF A;  3VA5 A;  1MD2 D;  1N32 L;  2J7Z A;  4TUY F;  3M85 A;  5KFY A;  3PW7 A;  2B2Y A;  4WOR A;  3GTJ A;  1TWA A;  3C1F A;  2FK2 A;  3TRE A;  1NSN S;  3E9I A;  1XTC D;  3FKI H;  5BR8 L;  2FMC A;  3LWB A;  2OLS A;  1ICF B;  1TWC B;  2XVS A;  1UEB A;  2JK8 A;  3A5U A;  3PO2 H;  1FVI A;  4DK1 A;  1R9T H;  1PH1 A;  2K32 A;  1SDF A;  1KJJ A;  1Y69 U;  2H1E A;  1WTO A;  4RB2 C;  4RAZ A;  2DY8 A;  2QW7 A;  1SE3 A;  2KOL A;  2K1B A;  4PMW A;  2JA5 B;  1AN8 A;  1JDB B;  2OEO A;  3K5N A;  2CW8 A;  3HB9 A;  1H9S B;  4A3F G;  3E5N A;  3PGZ A;  2QEX A;  1YIJ A;  3KJO A;  2W6M A;  1VBH A;  2X0S A;  4RNO A;  4K2L A;  1CS0 A;  3PVX A;  2KJX A;  1A0I A;  1CTM A;  3STB D;  5M5X H;  2CWA A;  4C3H G;  5C0X H;  4FXG C;  4RNM A;  5KT2 A;  1EWC A;  2ZXO A;  1VDZ A;  2Z6K A;  4C3I H;  1YNJ C;  4Q8E A;  4ID6 A;  3SHL A;  4MA5 A;  3I12 A;  1PZI D;  5LOV F;  2B2U A;  2R92 H;  5JVG 3;  4RAY A;  2IPK D;  1E2W A;  5IYC H;  3WOF A;  1KDC A;  2YW2 A;  2XN9 C;  4PZ7 A;  1B8A A;  5L9X A;  1O80 A;  2CVR A;  2IL8 A;  1PRT F;  3W1B A;  3AQQ A;  4JI5 Q;  2HT1 A;  1AN7 A;  5LMN H;  2BQ3 A;  3SI8 A;  4M9U A;  1S5F D;  2YTY A;  1L2Z A;  2XTI A;  2ZTD A;  1D7Q A;  3HS0 C;  1IBL Q;  2IJ0 A;  4GKJ H;  3V6K A;  2ZM6 L;  1PRT B;  4K5W A;  4GS3 A;  3OUZ A;  4EBD A;  4J9O A;  5IGG A;  4K0K L;  2PMZ E;  3MVV A;  5C3X A;  3R5F A;  4LF4 Q;  2SDF A;  3ER0 A;  1CK1 A;  4N9P A;  4JI6 H;  1EIF A;  1KAB A;  4CKC A;  2OWO A;  1O75 A;  3SE7 A;  3GIM A;  2F0V A;  1STA A;  3MXP A;  4MNO A;  1DM0 B;  2C22 A;  3BZC A;  1IYU A;  4GLV B;  3GTJ B;  2BQU A;  2Y0S G;  3X3N A;  4C3J B;  1ZYR D;  4OEL B;  1SXT A;  4AYB E;  5D8D A;  4ECS A;  3K0X A;  1Y1W B;  3S9W A;  3J81 E;  2R7F A;  1LT6 D;  1XMO H;  1CZW A;  2WDT A;  5KFJ A;  5L37 A;  1Q8K A;  1LTI D;  1DZ1 A;  3CMA A;  3UQ8 A;  5I9P A;  4F4W A;  3AFP A;  4QW9 A;  1E4E A;  1B9M A;  3PW2 A;  3VR6 A;  5HUR A;  3D6W A;  4EGQ A;  2Z6K C;  4TKO B;  4ZCK A;  3C46 A;  2B2T A;  2I46 A;  3A54 A;  1NNX A;  4J9S A;  1SBB B;  4KN4 C;  4P74 A;  4AYB A;  2C35 B;  1KAA A;  1KRT A;  2B2V A;  4QCL A;  1S5C D;  3G4S A;  4ECV A;  3S24 A;  1I94 L;  3RLO A;  2NYZ D;  2F0P A;  2K5W A;  3KLR A;  3F8T A;  5C0X I;  1PTO F;  3U4Z A;  3I4N H;  2V59 A;  3K7U C;  3NK9 A;  3QR8 A;  4OX9 Q;  1XWE A;  4ETS A;  3HGB A;  1J6Q A;  4DR2 H;  2CKZ B;  2MO1 A;  1Z47 A;  2VQE Q;  1SNC A;  3IKJ A;  4A3B H;  1PZJ D;  4BBS H;  2RQX A;  2F0K A;  2RF4 A;  3K3P A;  2W7O A;  2HVS A;  2MJ8 A;  5D1O A;  1BXR A;  2C2R A;  4IHJ F;  1JJ2 A;  1ZKO A;  3KUP A;  2EE1 A;  3JRW A;  1H9J A;  2W9C B;  2JA5 H;  2SNS A;  5FO9 B;  2K52 A;  3Q22 A;  1JWS D;  1S5B D;  1D6E C;  3JC6 6;  2NVY H;  5TSS A;  3MEF A;  1B7Y B;  3VYR A;  3WDN A;  3CC2 A;  5DM6 3;  1QVC A;  4N9T A;  2YRW A;  2BH8 A;  1E3P A;  1EZ1 A;  3HOW G;  1A63 A;  1QNK A;  2HQE A;  3KF8 A;  5JJL A;  2CH4 A;  1QE6 A;  4CJ0 B;  4DGZ A;  4QL5 A;  4DV5 H;  3CCE A;  4M1U B;  1KXL A;  5FK9 C;  1A2T A;  1UE7 A;  3GTO A;  1RF2 D;  4XQQ A;  1GKH A;  2A73 B;  3CCU A;  1WH2 A;  4QB4 A;  3NQT A;  1CE8 A;  1IBK H;  3QJY A;  3J7A V;  4HJ8 A;  2MUY A;  2CZG A;  3GLK A;  2FMM A;  2KCN A;  4JI8 H;  1OXS C;  5LL6 S;  4B3M Q;  2L5T A;  1MJC A;  2D2C C;  2E75 C;  2E5L H;  3H4D A;  2RGV A;  1UNN C;  4YIJ A;  3F2B A;  1KQS A;  3M9B A;  2PW7 A;  2R82 A;  2ZXP A;  4ZI7 F;  4JI3 H;  3NSW A;  4LUZ A;  2J6S A;  5IGB A;  3CRK C;  1WR2 A;  4JV5 H;  4EQO A;  4KN7 C;  1DGS A;  1V1P A;  3MWD A;  3EFX D;  4A93 H;  3S17 H;  1JIC A;  4A3I B;  3TQ1 A;  3TZU A;  4DV5 Q;  4XTC S;  3ULP A;  3S2H B;  4EYH B;  4LF4 L;  2BQR A;  1O7Y A;  4ZRZ A;  5ELC A;  2UUC Q;  4C5C A;  4DK3 C;  5E3F A;  1WTV A;  2KEN A;  1XDN A;  4LNQ A;  5COY A;  5FLM H;  5KFK A;  5KFW A;  1OXU A;  1HZA A;  1NMG A;  1N34 H;  1WCM H;  1OXV A;  5C6A A;  4UCO A;  2AHO B;  4GKK Q;  1S0M A;  1Z2P X;  3URY A;  1K8A C;  1VAJ A;  5HV6 A;  2OXP A;  4LH6 A;  5KT4 A;  4JBJ A;  5KFD A;  3QB3 A;  2MGS A;  1BNZ A;  4L5R C;  4HYK A;  2E74 C;  3FP9 A;  1RD9 D;  4FDB A;  2F0L A;  4RZQ A;  4KD4 A;  1WYD A;  2FB9 A;  5JH7 F;  2PCF B;  1TKW B;  3CW2 C;  3QZ7 A;  1M90 C;  1S10 A;  3B6Y A;  4DL7 A;  1HUM A;  4KHZ A;  2K04 A;  4C3I G;  1S4Z A;  1XMQ Q;  1ZEQ X;  3W5O A;  4PWQ A;  3I72 A;  2NBF A;  3R2I A;  5HBR B;  4JI2 Q;  3PUV A;  1II3 A;  5C0X J;  2UUC L;  4DL6 A;  2EY1 A;  1PH8 A;  4GN3 B;  3NTH A;  2HCC A;  2Q2U A;  4BBR B;  2CHB D;  4X3K A;  1PH9 A;  4HQ6 A;  1KC7 A;  1S5E D;  3K58 A;  4ZYS A;  4A3F H;  4LF5 L;  3H3V I;  3HOZ H;  4ZKB B;  4BXX G;  3N44 B;  5JVL A;  1Q81 C;  4WFN 3;  3HOV H;  3FMC A;  4O3Q A;  4JI4 Q;  4GKK L;  1VQI A;  3GTO B;  2A69 D;  1A3T A;  4JI8 L;  3T5L A;  5LMN L;  2PN1 A;  2FE3 A;  4R4I A;  3PIO A;  2WKD A;  4JOI C;  2FXQ A;  2EYO A;  4AYB B;  3J80 E;  2GPS A;  2NN6 G;  2X6G A;  2Q8I B;  3CPW A;  5KT5 A;  1BCP D;  3HKS A;  3K59 A;  5DG7 A;  4HR7 B;  1IKL A;  2F03 A;  2EYL A;  5I47 A;  2C5C A;  4L8J A;  4TV9 F;  2F0N A;  3R3O A;  4R4T A;  2VXW A;  1DOL A;  1SYG A;  3KLW A;  3BA9 A;  1JKJ B;  1J9O A;  3RLF A;  1M6V A;  3V2T A;  3BAA A;  4KKU A;  1JQY D;  3TP8 A;  4C2M A;  2WAQ B;  4HIM A;  4KI0 A;  4DV7 H;  5C44 G;  2E2I A;  4DV0 L;  1D5X C;  1JB3 A;  1CQI B;  2HIV A;  1R9T A;  1RJT A;  4RB1 A;  2ZJR A;  1KJI A;  4UP7 A;  1AUV A;  2YZG A;  3TRZ A;  4JV1 A;  2R7D A;  1T3N A;  1NY4 A;  5IT9 L;  4B9X A;  3J80 c;  3G6V A;  2ZDH A;  1D5M C;  1TAE A;  2A74 C;  1X54 A;  1MJE A;  4XDX A;  1E2Z A;  1PMR A;  4FF4 A;  3KLS A;  1B6R A;  2X6L A;  2ICI A;  3GO5 A;  1GUS A;  1BVS A;  2BE5 D;  3ERQ A;  4A3J G;  2VB3 X;  1XJV A;  2E2D C;  3PIO 3;  1Q8I A;  5C4H A;  4BY7 G;  2NUA B;  5CV8 A;  1SE8 A;  1SR3 A;  3VYT A;  1NJI C;  2LFN A;  1OXT A;  1YJN A;  5I2Y A;  5FPR A;  3MWE A;  2HD3 A;  2PBZ A;  2F0G A;  2Q2T A;  2UXB L;  2K4K A;  2MFI A;  3CCJ A;  1KIX A;  2WAQ G;  4PG3 A;  3P1H A;  1Q86 C;  5D1O B;  2JA6 H;  1SYC A;  3GTG H;  2PNR C;  2UUB L;  3D4W A;  3S1M B;  1KD1 C;  1Q12 A;  4LFB Q;  2N55 A;  1STN A;  3R2T A;  2VW9 A;  4UDU C;  2CH4 W;  4A4I A;  4IJL A;  2A68 D;  1L0W A;  5IGF A;  4XYQ A;  2JYO A;  3VA7 A;  5KFC A;  4YAJ B;  1GUN A;  3RIZ A;  2HVR A;  2JSO A;  1BBU A;  2F0M A;  1X56 A;  1YI2 A;  3OWF A;  3T16 A;  1VQ6 A;  5EGT A;  1SE4 A;  1P8L A;  2OTL A;  4O3P A;  4ZOL F;  4A3G H;  4EQ5 A;  4MV8 A;  1CZG A;  4YY3 Q;  4Y52 H;  5LMN W;  4Q0F A;  4DR5 Q;  4JV0 A;  3MFH A;  1GYF A;  4A3M H;  5C4X H;  2FIN B;  4QW8 A;  3OUU A;  2JJQ A;  1K73 C;  2YTX A;  2PI2 A;  4J1M A;  4H0L C;  4C5B A;  4EEQ A;  3S17 B;  2UXB Q;  3N40 P;  5KFZ A;  1XMO Q;  1PYW D;  2F0T A;  3BQ0 A;  2F1M A;  5M9O A;  3MR3 A;  3GD7 A;  4DR4 Q;  4O3R A;  3K57 A;  4IFD J;  1XNQ H;  3DM3 A;  5M5W H;  5A2Q E;  1BOS A;  2VQD A;  4O4L F;  4QWA A;  4DV7 Q;  5IP7 G;  1SAP A;  2NZO A;  3WO1 A;  3AMU A;  4FXK C;  2A6H C;  1NUC A;  2O2L D;  2K05 A;  3OW2 A;  4YB8 B;  1HCZ A;  1RIP A;  1GSA A;  2TMP A;  3I70 A;  4G7Z C;  3LGJ A;  2X69 A;  2ASL A;  4JI8 Q;  1LM0 A;  4UP9 A;  3JAM i;  3R5X A;  5KG6 A;  3FEW X;  1M7J A;  3M7G A;  4B3T H;  2IX0 A;  5KIX A;  4Q5V A;  4DUY H;  3GTM A;  2NZ1 D;  2V4R A;  4PMC A;  4JI1 L;  5I6W A;  4HNV A;  1FJG H;  4KY7 A;  2F52 A;  2NN6 H;  4KKS A;  1PRT C;  3M4O B;  5CA0 F;  3ZJY C;  4G3I A;  2D62 A;  4XYL B;  1LT5 D;  4DK6 C;  1OTC A;  5BPH A;  5KFN A;  4J9R A;  3SK5 A;  5IT9 E;  3C3L A;  1Y1V G;  3M4Y A;  1J5E Q;  3OYY A;  3QG1 A;  3HOX G;  2J0T D;  3R93 A;  1IXR A;  3TDQ A;  4EVO A;  1RL2 A;  2YL2 A;  1STY A;  1LAB A;  1D2B A;  3HOV G;  1D1K A;  4ME3 A;  4DNI A;  2KSW A;  2J6T A;  3FKI A;  2JEG A;  3HOZ G;  4OX9 L;  3G48 A;  1QG7 A;  4DAY A;  4C5A A;  4AQY H;  3IRB A;  5IP9 G;  1L1O B;  2O03 A;  2B63 G;  3V6J A;  3RB4 A;  4IOC A;  3OIQ A;  2B63 A;  4DR4 H;  4XYM B;  2XRS D;  2VY3 A;  1ET6 A;  2JXM B;  2V58 A;  2SEB D;  2F0Q A;  4KJO A;  3C2P A;  2JA7 G;  3I3C A;  2EJG C;  5J2T F;  3GTL B;  4CDD C;  1EFW A;  4JI0 Q;  1HR0 W;  3OMG A;  4DR2 L;  4DR5 H;  1W6K A;  1VQG A;  2A6H D;  5DLF A;  2GA4 B;  1FD7 D;  3V96 A;  4XQJ A;  3GTO H;  3MR5 A;  4K6L A;  3TQT A;  2F3I A;  1HNZ L;  4LFA H;  1ASZ A;  1E24 A;  1I3Q H;  2WB1 G;  3I4N B;  1K28 A;  2XIW A;  2XNA C;  4XT3 B;  5IGD A;  1QZG A;  3GTL A;  4C3J G;  3BDL A;  5CBE E;  4QIW A;  1JOQ A;  4NXN H;  1O78 A;  3I4M G;  4O4H F;  2UUB Q;  2MP1 A;  4YQW A;  4GN4 B;  1TII D;  4A3D B;  4J15 A;  2EYM A;  1N32 H;  4ZHQ F;  1E0B A;  4LFB H;  1BXT A;  4U67 3;  4JI7 H;  2B63 B;  1ML0 D;  2K14 A;  1A8V A;  5JPN C;  4CDE C;  4KHP L;  4O0A A;  3RUP A;  2LKV A;  5KFA A;  1E4G T;  3U9T A;  3F2D A;  2NVX A;  4A93 G;  1TY2 A;  1BNC A;  3BJY A;  1YNN C;  3MFY A;  4DR1 L;  1LTR D;  1MHW C;  1XTD A;  1PTO D;  5M5W B;  3U58 A;  2YRX A;  4A75 A;  4C56 C;  5CC4 A;  2YCH A;  3BDC A;  4R7R A;  1HUN A;  4ECX A;  2NVY B;  4DR3 L;  3M4P A;  2CW0 C;  4EFB A;  2Q2I A;  3PO2 B;  5FO7 B;  1LYL A;  1FNU A;  3HOU H;  4DV1 H;  2B29 A;  1PYB A;  3OSO A;  3M3Y B;  1IBL H;  4UFZ A;  3VR2 A;  4JI6 L;  1P16 A;  3MAQ A;  2JA7 H;  4BXX H;  3UDI A;  4RG1 A;  2JA9 A;  3GTG B;  5HY6 A;  1DOM A;  2NVX B;  1VQ4 A;  4OIJ A;  1K0R A;  4JOI A;  3PO3 G;  4FBU A;  1C3O A;  1VQB A;  4C2M B;  1MSG A;  4ME6 A;  1PFB A;  4CC5 A;  2W7P A;  3DXJ C;  1TR5 A;  1K3R A;  4RKB A;  4DL4 A;  4A2B A;  4YP3 A;  3KXY T;  1IHZ A;  4JUZ A;  1VQE A;  1XNQ Q;  5AFW A;  3I8Z A;  5FD5 A;  2XIG A;  2FJ2 A;  2OT2 A;  3FHW A;  3RN2 A;  4X64 Q;  3Q8P B;  2M9V A;  5C3E G;  4NKL A;  1OWT A;  1TWG H;  3OHX C;  3W1G A;  2JEF A;  2WIN B;  5ELE A;  1YIT A;  3N6X A;  2K28 A;  4LSA A;  1JE4 A;  4DR7 L;  4BWS C;  2FLN A;  3T1Y Q;  3K80 C;  1JE5 A;  3F1Z A;  3KBX A;  4DR6 H;  3RB3 A;  4R8N A;  4PNY A;  3PR5 B;  2ZJT A;  2ZJQ A;  3G6X A;  2R7Z A;  2R93 B;  5M5Y H;  3BZD B;  4K5V A;  3SK6 A;  3NUC A;  3KAJ A;  4OON A;  3K5O A;  1UE5 A;  2VUM A;  2W6O A;  2ENB A;  4C2M H;  1O7I A;  1KTK A;  2NN6 I;  4LF5 Q;  2Y0S B;  4XX0 B;  2NU9 B;  1VBG A;  2UVR A;  4J9N A;  2O4X A;  3A55 A;  1KJ8 A;  2XCL A;  4Q43 A;  2UUB H;  2NU7 B;  2UVV A;  4DU9 A;  2K5N A;  1QNU A;  4JV5 L;  1SYF A;  1K3B C;  5C3E B;  1EIY B;  3O13 A;  4R8U A;  1RYR A;  3H09 A;  3GTJ H;  2K5V A;  3KHH A;  4B3R H;  4P73 A;  1PK8 A;  1UE1 A;  2XSC A;  1XNQ L;  2EY5 A;  2R8K A;  5IGC A;  2VA2 A;  3PW4 A;  4EG0 A;  3OIP A;  3HOY B;  2RDG A;  1C48 A;  1W6J A;  1U4M A;  4NXN Q;  3PN1 A;  4IAJ A;  4RB3 C;  3I4M H;  2LSS A;  5JEA H;  1ZQ7 A;  1EIG A;  5IY0 A;  1V1O A;  3P75 A;  4IR9 A;  4WJW A;  1LT3 D;  1ULZ A;  3DEO A;  4OIK A;  2PZW A;  5EAY A;  3OTO H;  3KHR A;  3VR5 A;  2F4V H;  3CKI B;  4B3R Q;  1G6Z A;  3N6R A;  1ESF A;  5C4X G;  4ZQ3 A;  3CCM A;  1SE2 A;  4X65 H;  4BY1 G;  5EDW A;  3OOC A;  1B53 A;  2C9O A;  5CV9 A;  4BBR H;  4F88 A;  4B3S Q;  2R7K A;  2NU8 B;  1V9P A;  4JV5 Q;  2IW3 A;  4KY6 A;  1LV9 A;  3S2D B;  4GOP C;  4ED8 A;  2EJM A;  1WCM A;  2F0I A;  3K5I A;  1GHJ A;  4CDF C;  4HSP A;  5LP6 F;  2R92 A;  4PQX A;  3BA8 A;  3D6C A;  3TP7 A;  3RGX A;  4EQP A;  5LL6 X;  1U5K A;  4CKB A;  2B2W C;  2NVQ H;  3AEV A;  2QEJ C;  2I87 A;  4DL2 A;  4R9W A;  2E2J H;  2UXC H;  3T1Y H;  4X3S A;  4YWL A;  4LUO A;  1B04 A;  2JA7 A;  2WB1 B;  1L1O C;  1E4E B;  4PV1 C;  1M8A A;  3SE0 A;  5A2Q L;  3SXH A;  4NP5 A;  1WTW A;  2JA5 G;  1K1S A;  2UUA L;  4ED0 A;  1NE3 A;  1GUW A;  1K8M A;  1B50 A;  3CQZ B;  1K0S A;  2ZTC A;  2F3W A;  4O42 A;  2JA7 B;  2WB1 A;  4BBS G;  1EZ6 A;  2HJW A;  3NP8 A;  4DV6 H;  3KHG A;  4IPD A;  3JSN A;  1HQR D;  4U7C A;  3FPU B;  5E4X A;  1BCP B;  4GKJ Q;  3QIA A;  3I4N G;  3CP0 A;  2ASD A;  1C4Q A;  1I4G A;  1YNX A;  5AJ3 Q;  5KG3 A;  4F7X A;  1PH7 A;  1PYS B;  1GHK A;  1EEI D;  1Y8P B;  5IOD A;  5M3M B;  4DV4 H;  4RFB A;  3CRL C;  2LS0 1;  1Z7T A;  2K03 A;  1EY8 A;  3CXC A;  4Y8V B;  1BCP F;  1G6P A;  1Z9F A;  4QIW E;  3GIQ A;  1YJW A;  5DLG A;  2XD4 A;  3GTP H;  3KAL A;  4LUV A;  3Q8S B;  4NLG A;  1ONL A;  5C44 H;  3AFQ A;  4IOA A;  5KFP A;  4V19 0;  3GV5 B;  4TRD A;  4R4O A;  1EY4 A;  1ENA A;  5C5M A;  3T1Y L;  3K3V A;  5T1I A;  4RHS A;  4YHH H;  4NB3 A;  2EXD A;  2JA6 B;  1N48 A;  1S3O A;  1I6V C;  1H9K A;  4HJ9 A;  5COR A;  1L2F A;  1XMO L;  1SNQ A;  1HNW L;  2E76 C;  2N78 A;  4LMQ D;  4UAI A;  3HEJ A;  1TWA H;  4YWM A;  2CQO A;  3NPP A;  2IBK A;  4CJ1 B;  1IYJ B;  4K0K Q;  5EBC A;  3NHH A;  4K0K H;  1VF5 C;  1S72 A;  4RNN A;  3T1H H;  4ZLT F;  1VQ9 A;  1CQV A;  2B3G A;  2R92 B;  3T5K A;  2C2D A;  2F0H A;  4OO1 I;  1Q82 C;  2B2W A;  3WOE A;  1HZB A;  4FBT A;  1QOH A;  3I90 A;  3CCV A;  2NUC A;  2LXJ A;  1XPO A;  3HKZ G;  5G3L D;  5BR8 Q;  3U50 C;  4JYA Q;  3IFD A;  1S97 A;  4A3E B;  3PIP 3;  5E1F A;  1B6S A;  3H15 A;  3HRZ C;  4F50 A;  1TT2 A;  4ZUI A;  2QKI C;  3X3M A;  2ID0 A;  2R7Z B;  2AGO A;  1KDA A;  1X3G A;  5DQH A;  3CQZ A;  1ICW A;  4HJ5 A;  1HZC A;  2JA6 G;  4A3G B;  4GKK H;  1Q7Y C;  3K5H A;  4KTA A;  1SCU B;  4IWX A;  4A3I G;  2AUJ D;  1GGO A;  5KFT A;  4A3M B;  1BBX C;  2MCT A;  3KJP A;  3MWY W;  3EIV A;  5JOB A;  3HKZ E;  3M9N B;  4B3R L;  2VUM G;  4LF5 H;  4Q0Y A;  2UVU A;  2WII B;  4DA2 A;  3QOJ A;  5HGQ A;  1T94 A;  4M7E A;  4BY7 H;  1I4X A;  3QFF A;  2UUC H;  4DV6 Q;  2DJF C;  1EYC A;  3T5H A;  2UVW A;  4O4I F;  5LHY 1;  3Q8D A;  3PZP A;  1EFI D;  2ZTE A;  3MFI A;  3G6E A;  2L11 A;  3NWS A;  1UUP A;  1JJC B;  2PW5 A;  5I9O A; 
#chains in the Genus database with same CATH homology
 4X62 Q;  4GOP A;  4TQU S;  4NXN L;  2N49 A;  1K9M C;  2N3S A;  4JG2 A;  4LF8 Q;  4C3H H;  1AE2 A;  5IYD H;  4DR6 Q;  3A5Z B;  4IPH A;  4X6A H;  3PUX A;  4R4T A;  3KLW A;  4JI3 Q;  2VQE L;  3CCS A;  4UY8 C;  1EUJ A;  1X3E A;  4GLX A;  3RLF A;  1FL0 A;  4DV1 Q;  2R93 G;  1A62 A;  4R4C A;  1N36 Q;  4DUZ Q;  1HNX Q;  4A3C H;  4HIM A;  4KI0 A;  5C44 G;  1VQ7 A;  4DV0 L;  4LF9 L;  1TWH H;  3CPF A;  2HIV A;  2VNU D;  2KCM A;  1BBW A;  2ZJR A;  4UP7 A;  1V43 A;  5IP9 H;  3G71 A;  1N34 L;  1H95 A;  2ZM6 Q;  3TRZ A;  2UXC L;  4R1J A;  2R7D A;  3S15 H;  1PH3 A;  3A0J A;  1NY4 A;  4JI4 L;  3J80 c;  1PH5 A;  1PH6 A;  3BZK A;  4IJH A;  1VQP A;  2NZH A;  4QGU A;  4YHH L;  3KFU A;  5J3B A;  3FKI G;  1X54 A;  3NEN A;  4IPC A;  1MJE A;  5M3F H;  1GM5 A;  1QVF A;  4BA1 I;  5FJ8 G;  4GKJ L;  3HOX H;  3UDX A;  1EOV A;  4MZ9 A;  4TVA B;  4XIG S;  3GO5 A;  4POG A;  1BVS A;  4PZ8 A;  1E1O A;  3PSI A;  1N33 L;  4A3J G;  2I5H A;  3H0G G;  1XJV A;  3L7Z C;  1WCM G;  4BY7 G;  4DR2 Q;  1SE8 A;  1SR3 A;  4LF7 L;  1NJI C;  5JEA G;  1OXT A;  3VDY A;  1YJN A;  2NVT H;  1G6P A;  3OTO L;  5JEA J;  1VQC A;  4A3L G;  1V1Q A;  2CCZ A;  2CWP A;  4Y7N H;  2Q2T A;  2UXB L;  2K4K A;  2MFI A;  3CCJ A;  1KIX A;  2WAQ G;  4PG3 A;  1MKH A;  5C0X G;  2ALY B;  1Q86 C;  1N36 L;  1CUK A;  2JA6 H;  3GTG H;  1BKB A;  3T1H Q;  1Q1E A;  2UUB L;  1KD1 C;  1Q12 A;  4LF9 Q;  4DR3 Q;  1S40 A;  4LFB Q;  2K50 A;  3RZD H;  1X3F A;  4QJF A;  1LTL A;  3KYH C;  4YWK A;  2DUD A;  3HOW H;  2VW9 A;  2WP8 J;  1WOC A;  3GTQ H;  4A3K G;  4A4I A;  4IJL A;  1YVC A;  1L0W A;  3CCL A;  4YHH Q;  5IYB G;  1YZ6 A;  2MO0 A;  3M4O H;  1D8L A;  1BBU A;  1CKN A;  4DV5 L;  4JI7 L;  2UXD Q;  4LW1 A;  4WJ4 A;  1OXX K;  2WAQ E;  4L5Q A;  1YHB A;  1X56 A;  4C3J H;  1YI2 A;  1IBK L;  2UU9 L;  1VQ6 A;  2YV5 A;  1P8L A;  3NEM A;  2OTL A;  3SGI A;  1K8G A;  4EQ5 A;  3CC7 A;  4YY3 Q;  1EYG A;  4A3D H;  4A3G H;  2F4V L;  4Y52 H;  5LMN W;  4DR5 Q;  3D31 A;  2VQF L;  5C4X H;  4A3M H;  2WB1 E;  5IE8 A;  3AYH B;  2RHS B;  2V1C C;  2JJQ A;  4BA2 I;  1K73 C;  1VQ8 A;  2YTX A;  2PI2 A;  1PHJ A;  1MIU A;  3TEH B;  4JBW A;  2E2H H;  1PH2 A;  2DGY A;  2UXB Q;  1XMO Q;  4GN5 A;  4KLK A;  2EQS A;  2HIX A;  3GD7 A;  1YHA A;  4DR4 Q;  4IFD J;  4JI6 Q;  4A3E H;  3DM3 A;  3I7F A;  4MTN A;  3RLN A;  5M5W H;  1E1T A;  4DV7 Q;  5IP7 G;  2NZO A;  2VS1 A;  4A3E G;  2B63 H;  5LMU Q;  1IBL L;  3HOY H;  1I6H H;  4B3S L;  2IT1 A;  3OW2 A;  1RIP A;  1X9N A;  4B3M L;  3PO3 H;  1QUQ B;  3S14 H;  4DV3 L;  1Q46 A;  2OQ0 A;  3LGJ A;  4DUY Q;  2YYZ A;  3I4O A;  4JI8 Q;  1LM0 A;  4UP9 A;  4UPA A;  3JAM i;  4HIO A;  1NTG A;  2PNH A;  3M3Y H;  2UXD L;  2IX0 A;  4DV6 L;  3CME A;  4DPG A;  3TS0 A;  4JI2 L;  4JI1 L;  3TQY A;  5AJ3 L;  4GNX C;  4X64 L;  4JCV E;  3HOU G;  2KHI A;  2F52 A;  1SRO A;  2HHH Q;  5GQO A;  1VQ5 A;  5K36 G;  5IYC G;  2IHE A;  3ZJY C;  3BJU A;  1AH9 A;  2D62 A;  4LF8 L;  2E2I H;  4DK6 C;  3I55 A;  1OTC A;  3S1Q H;  1FJG Q;  1TWC H;  1L1O A;  1Y1V G;  5H1S E;  3OYY A;  3UE0 A;  1J5E Q;  4JI3 L;  3HOX G;  2Q2H A;  1IXR A;  1RL2 A;  4B3T Q;  2YU9 H;  1U0L A;  1YHQ A;  2MQH A;  4ME3 A;  3HOV G;  1VQH A;  4DNI A;  5FLX c;  1JT8 A;  3HOZ G;  4OX9 L;  3G48 A;  3J81 i;  5LMN Q;  1YJ9 A;  2OTJ A;  5GAD C;  3IRB A;  2YTV A;  5IP9 G;  1L1O B;  4DAM A;  3K8A A;  3K81 C;  5IWA L;  1FGU A;  3HOY G;  5IP7 H;  2B63 G;  3PUW A;  4IOC A;  2BA1 A;  2I5L X;  5DLQ E;  3CD6 A;  1KAW A;  4OWT B;  4DV3 Q;  4H02 A;  4OO1 G;  4OWX B;  2VY3 A;  1KC8 C;  4A3L H;  1NMF A;  4YCU A;  1CKO A;  1VQA A;  2JEA I;  3RNU A;  1VQJ A;  1JB7 A;  4QY7 A;  3PF4 A;  1VQF A;  4X65 L;  3STB C;  1HR0 L;  1CSQ A;  3UE1 A;  1UWV A;  1N32 L;  4X66 Q;  3M85 A;  2JA7 G;  3M7N A;  3K7A H;  4DUZ L;  2N8N A;  4JI0 Q;  1EFW A;  2A8V A;  1HR0 W;  4DR2 L;  4DV2 Q;  4LF7 Q;  1VQG A;  5JJI A;  2IY5 B;  3TRE A;  5BR8 L;  3E9I A;  3FKI H;  3GTO H;  3OTO Q;  3M4Q A;  2F3I A;  1HNZ L;  4AYB G;  4A3B G;  1ASZ A;  1E24 A;  1I3Q H;  2WB1 G;  1CKN B;  1Y14 B;  2XGT A;  1QZG A;  4LF6 L;  1IZ6 A;  1UEB A;  2JK8 A;  3I56 A;  3A5U A;  3PO2 H;  1FVI A;  3HFZ B;  1R9T H;  1PH1 A;  3I4M G;  2UUB Q;  4NXM Q;  2VUM H;  4GN4 B;  2R6G A;  1TXY A;  1WI5 A;  4J15 A;  2UUA Q;  4PZ6 A;  5GAH C;  3EBE A;  4PMW A;  1XPU A;  4A3F G;  3PGZ A;  2QEX A;  1YIJ A;  3KJO A;  3JAM c;  2K14 A;  1A8V A;  4KHP L;  4P72 A;  4O0A A;  2KBN A;  1KRS A;  3F2D A;  1A0I A;  4A93 G;  3STB D;  2I5M X;  5ELO A;  2CWA A;  5M5X H;  2ASB A;  2UU9 Q;  1HR0 Q;  4DAY B;  4DV4 Q;  3ULL A;  1PV4 A;  1QZH A;  3PIP A;  4X66 L;  2Z6K A;  4DR1 L;  3DLL A;  3U58 A;  1XTD A;  4C3I H;  1E7Z A;  4A75 A;  4JI0 L;  3PO2 G;  3T1H L;  1PA6 A;  2JE6 I;  2R92 H;  4DR7 Q;  4A3J H;  4DR3 L;  3M4P A;  2R92 G;  5IYC H;  4LFB L;  3CC4 A;  1HNZ Q;  2Q2I A;  5GAG C;  1LYL A;  4PZ7 A;  2GN5 A;  1B8A A;  3HOU H;  2B29 A;  4LF6 Q;  3E0E A;  1Q1B A;  1PYB A;  1EQR A;  3W1B A;  3AQQ A;  1EQQ A;  4JI5 Q;  2HT1 A;  4APV A;  4WJ3 M;  3PUZ A;  4UP8 A;  3EN2 A;  4JI6 L;  1P16 A;  2JA8 H;  2E5L L;  2IX1 A;  2YTY A;  2JA7 H;  4BXX H;  5GAE C;  3CQZ H;  2XTI A;  2ZTD A;  3L0O A;  4RG1 A;  3UDI A;  2AKW B;  2JA9 A;  1CKM A;  1YEZ A;  5HY6 A;  4DV7 L;  1VQ4 A;  1IBK Q;  1IBL Q;  1K0R A;  1D7Q A;  4A76 A;  4JOI A;  3PO3 G;  1B70 B;  2ZM6 L;  2AWN A;  5M3M G;  1VQB A;  2A1A A;  2D0O A;  2UXC Q;  4GS3 A;  1ASY A;  1TWF H;  2EIF A;  1X55 A;  4O2D A;  4X62 L;  4K0K L;  1K3R A;  2PMZ E;  3CCQ A;  4LF4 Q;  3ER0 A;  1VQE A;  1XNQ Q;  1VQM A;  1EIF A;  1GVP A;  3FHW A;  3RN2 A;  2OWO A;  2ATW A;  4X64 Q;  3MXN B;  1HZ9 A;  2AMC B;  4IO9 A;  5C3E G;  4GOP B;  3KOJ A;  1TWG H;  3W1G A;  1QUQ A;  2OQK A;  1YIT A;  4R4Q A;  5GRO A;  1SLJ A;  3RN5 A;  2BH2 A;  1LUZ A;  4MNO A;  1XMQ L;  4DR7 L;  3T1Y Q;  3BZC A;  2PQA B;  1JE5 A;  3F1Z A;  3K80 C;  4A3M G;  2JEB I;  1C0A A;  4GLV B;  3J81 j;  4A3D G;  1C9O A;  1IL2 A;  4A3G G;  2ZJQ A;  2Y0S G;  4AIM A;  5M5Y H;  4JI5 L;  3D0F A;  4AYB E;  2R7Z G;  4OON A;  1UE5 A;  4C2M H;  1O7I A;  3K0X A;  2NN6 I;  4LF5 Q;  2R7F A;  3A74 A;  1HH2 P;  3J7A 5;  3S1N H;  4IFD I;  1Q8K A;  1W3S A;  3CMA A;  3J7Z C;  3J80 i;  2K5N A;  3AFP A;  4JV5 L;  4A3I H;  1EIY B;  2Z6K C;  2VL6 A;  2GVB A;  3GTJ H;  2K5V A;  2NVX H;  3PUY A;  4P74 A;  4JI7 Q;  4P73 A;  1FJG L;  2C35 B;  3S2D H;  2RCN A;  1KRT A;  1UE1 A;  2IHF A;  4GNX B;  1XNQ L;  3G4S A;  3S24 A;  2WFW A;  1I94 L;  3RLO A;  4YY3 L;  4AQY L;  1VQO A;  4POF A;  3F8T A;  5C0X I;  3U4Z A;  2VQF Q;  4NXN Q;  3I4N H;  4JBK A;  2LSS A;  3K7U C;  4OX9 Q;  1Y1V H;  3I4M H;  1JJG A;  5IY0 A;  1J6Q A;  2CKZ B;  2MO1 A;  2AWO A;  1Z47 A;  1PVO A;  2VQE Q;  4HJ7 A;  3GTL H;  5EAY A;  2Z0S A;  1VCI A;  1Y1W H;  4A3B H;  4BBS H;  1SN8 A;  2RF4 A;  4B3R Q;  1PFS A;  3J81 c;  5C4X G;  2KCT A;  1HNX L;  1HJP A;  3CCM A;  2E8G A;  5M3F G;  1JJ2 A;  4BY1 G;  2JA5 H;  4DV0 Q;  2K52 A;  2I0Q A;  1W2B A;  1XNR Q;  1YBY A;  3KF6 B;  4BBR H;  2L15 A;  5LMU L;  4RMF A;  4B3S Q;  1V9P A;  2CFM A;  1JMC A;  3JC6 6;  4JV5 Q;  4GOP C;  2HQL A;  2NVY H;  4AH6 A;  1I50 H;  3MEF A;  4DKA C;  1B7Y B;  3L2P A;  1VQN A;  3CC2 A;  1QVC A;  5FLM G;  2BH8 A;  1E3P A;  3HOW G;  1A63 A;  5JJL A;  1U5K A;  1PH4 A;  2NVQ H;  3AEV A;  2JQO A;  2E2J H;  1M1K C;  3RR5 A;  4QL5 A;  2A19 A;  5IT9 c;  3CCE A;  1KXL A;  4YWL A;  4LUO A;  1UE7 A;  3S1R H;  1N33 Q;  1XPR A;  1GKH A;  3CCU A;  1L1O C;  2ZJP A;  4L5T A;  4P71 A;  4HJ8 A;  2JA5 G;  1NBW A;  1OXS C;  2UUA L;  1NE3 A;  4LFC L;  2K75 A;  1N9W A;  2ZTC A;  2PI2 E;  4B3M Q;  1IBM L;  1MJC A;  1Y1W G;  4BBS G;  4HIK A;  1G29 1;  4DUY L;  1VQL A;  1SFO H;  2E5L Q;  4IPD A;  2Y0S E;  4GLA C;  3F2B A;  4OWW B;  2GVA A;  1X65 A;  1K83 H;  1KQS A;  3GTK H;  3M9B A;  2VZA A;  5IYB H;  4GKJ Q;  1XNR L;  3UDF A;  3CP0 A;  3I4N G;  1KHI A;  2ES2 A;  1YNX A;  3PV0 A;  5AJ3 Q;  4A3K H;  3CCR A;  4LUZ A;  1PH7 A;  1PYS B;  3ICE A;  3NEL A;  1DGS A;  1C7Y A;  5C4J H;  2OCE A;  4A93 H;  3S17 H;  5C3E H;  3KDF B;  4JC0 A;  3CXC A;  3KF6 A;  2H5X A;  4XTC S;  1Z9F A;  4QIW E;  4DV5 Q;  3ULP A;  1YJW A;  3PF5 A;  4LF4 L;  1J5E L;  4JYA L;  4X65 Q;  4HID A;  3GTP H;  2UUC Q;  3H3V H;  3TS2 A;  4LUV A;  2K5H A;  4DK3 C;  4B3T L;  2F4V Q;  3S16 H;  5C44 H;  3AFQ A;  2KEN A;  1UE6 A;  4IOA A;  4LNQ A;  4A3C G;  2KHJ A;  5FLM H;  3CAM A;  4R4O A;  2R93 H;  3GDE A;  4P75 A;  3T1Y L;  3I2Z A;  5M3M H;  1OXU A;  5ELN A;  1HZA A;  1NMG A;  2RHQ B;  4NB3 A;  2EXD A;  1WCM H;  1OXV A;  1S3O A;  4LFC Q;  2R7Z H;  3ERS X;  3GTM H;  4BBR G;  4HJ9 A;  1L2F A;  1XMO L;  1VQD A;  5IYD G;  2AHO B;  4HJA A;  1IBM Q;  4GKK Q;  1HNW L;  5JJK A;  2LXK A;  2N78 A;  1K8A C;  2JA8 G;  3CF5 A;  4BY1 H;  4LFA Q;  1TWA H;  1X6O A;  2CQO A;  4JBJ A;  4YWM A;  1KL9 A;  1IYJ B;  4K0K Q;  4L5R C;  4YCV A;  3FP9 A;  1GO3 E;  1S72 A;  4YCW A;  3U4V A;  4FDB A;  1VQ9 A;  3NBH B;  1SRU A;  2B3G A;  1N32 Q;  3PCO B;  4LWC A;  3S1M H;  4OO1 I;  1WYD A;  1Q82 C;  3E9H A;  4DR5 L;  1HZB A;  3CW2 C;  1WFQ A;  4NPS A;  1M90 C;  3CCV A;  4KHP Q;  3B6Y A;  4KHZ A;  4DV2 L;  2LXJ A;  1XPO A;  3HKZ G;  2MNA A;  5BR8 Q;  1XMQ Q;  4DR6 L;  3BU2 A;  3U50 C;  3W5O A;  4JYA Q;  1AE3 A;  2BA0 A;  4JI2 Q;  3PUV A;  4DV4 L;  5C0X J;  1I94 Q;  2UUC L;  3H15 A;  1PH8 A;  4GN3 B;  4DV1 L;  2Q2U A;  3S2H H;  2ID0 A;  1EWI A;  1T9H A;  1QVG A;  1X3G A;  1PH9 A;  4DR4 L;  4QQB X;  4HJ5 A;  4OXP A;  4NXM L;  1HZC A;  1VS0 A;  2JA6 G;  1SMX A;  4IPG A;  2D0P A;  1G51 A;  4A3F H;  1Q7Y C;  4LF5 L;  3H3V I;  3HOZ H;  4BXX G;  1VQK A;  4A3I G;  1GD7 A;  1Q81 C;  3F2C A;  3UDG A;  3HOV H;  1N34 Q;  3ULJ A;  3KJP A;  3EIV A;  3HKZ E;  4JI4 Q;  4GKK L;  1VQI A;  2VUM G;  4B3R L;  1HNW Q;  1N8R C;  2QGQ A;  5HGQ A;  4LFA L;  3RZO H;  4ALP A;  4JI8 L;  4JBM A;  4BY7 H;  5LMN L;  3H0G H;  4R4I A;  3PIO A;  2QA4 A;  4IFD G;  3KF8 B;  4JOI C;  1I5F A;  4GNX A;  4DV6 Q;  2FXQ A;  4EX5 A;  2PQA A;  4L5S A;  1CSP A;  1E22 A;  1JJC B;  3Q8D A;  2NN6 G;  2ZTE A;  3KDF A;  1WJJ A;  5E7N A;  4JI1 Q;  5IWA Q;  3CPW A;  3G6E A;  5FJ8 H;  4DR1 Q;  4AQY Q;  3WWV A;  2HHH L;  3HKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...