4QJFA

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
186
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKKKAKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase, subunit E'
total genus 40
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qjfA02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qjfA01
1YI2A 4A3CH 1EIYB 2NVTH 1PYSB 4X65Q 4LF6Q 2LXJA 2ZTDA 1HNXL 2GVAA 1N33Q 4JI5Q 4IPGA 3K8AA 3PO3H 4BA1I 4GLXA 1Y1WH 4DR5L 2JJQA 1Q12A 4MZ9A 1WJJA 1VQCA 2ZTEA 3A5UA 4YWLA 3HOWH 2JA5H 2MNAA 3U58A 2VW9A 1OXTA 4DV4L 4DPGA 4H02A 1ASZA 5LMUL 4DV5L 1XJVA 1VS0A 2E5LQ 2XGTA 2CCZA 3I4NH 4GKKL 3KLWA 2CFMA 1UWVA 3J7ZC 4LF9Q 1LTLA 3HOVG 3J80c 1UE5A 1AE3A 2DUDA 1N32Q 4A3JH 4LF7L 2BA1A 2UXCL 1UE6A 3CC7A 1E3PA 3KF6B 1IBKL 2I0QA 2OWOA 5FLMH 1Q82C 1VQLA 2ES2A 2ALYB 3BZCA 1HH2P 4GKJQ 4PG3A 2E2HH 3S16H 1BBWA 1A0IA 4POGA 4UP9A 1VQ9A 1TWAH 1QZGA 4JCVE 1HNWL 4B3SL 1IXRA 2UUCL 5C0XG 1SMXA 4A3KG 4DV3L 4B3RL 1I5FA 4YHHL 4LFBQ 2UU9L 2YTXA 2ID0A 3CD6A 1B8AA 4BY7G 1JJCB 4R4IA 4LF7Q 3CC2A 2IHEA 3GD7A 2UXDL 1A8VA 4NB3A 4DV0L 2RCNA 2K5VA 1Z9FA 1MKHA 3CP0A 3S2DH 3UE1A 3S1RH 2E8GA 5IYCG 2QEXA 1M90C 4DR2L 2N8NA 1K8GA 3HOVH 4BXXG 1I94Q 4TQUS 1FJGQ 2OCEA 1G6PA 3KYHC 2NZHA 3S15H 1YJNA 3KDFB 3CCVA 3G71A 5M3MH 4Y7NH 4J15A 4B3TQ 4LF4Q 2NVYH 4P73A 4JYAL 1Q1BA 4LUZA 3AFPA 3RNUA 2EQSA 5BR8L 4C3JH 3MEFA 2D0PA 4PMWA 4GNXA 4A3BH 5IP7G 3GTOH 1XTDA 4GLVB 1SRUA 3RLNA 4QL5A 3NEMA 3M4OH 3I4MG 5LMUQ 4DV5Q 3FHWA 1N34Q 2E5LL 4GOPA 2UXCQ 3HOUH 1BBUA 1L2FA 1C9OA 4JOIA 5ELNA 5C44G 4B3MQ 1FJGL 2JA6H 1VQDA 4NXNQ 4IOAA 5K36G 1CKMA 4PZ8A 3CMAA 1I3QH 4BY7H 1PYBA 1PH7A 3M4QA 3PF5A 4YCUA 2UUCQ 2VQFL 5IYBG 5IP9H 3HOYG 1HZAA 2R93G 3RR5A 2JQOA 3H0GH 1VQGA 4X65L 4RG1A 2F52A 4AQYQ 4FDBA 4GN3B 4DK6C 4OX9Q 4UP8A 3CC4A 1X3FA 3LGJA 1WFQA 1N32L 3T1YL 3S1NH 4B3RQ 4LFBL 5IYDH 2F4VL 1TWCH 2R7FA 3I4OA 3U50C 5M3FH 2OTLA 3K7AH 1AH9A 1W3SA 3TREA 4GKJL 3TRZA 2WB1E 3KFUA 5LMNQ 3TQYA 4OWTB 4A3EH 3RZDH 1I94L 3M85A 1Q46A 2K50A 2PNHA 4EQ5A 3RN5A 2WB1G 3EBEA 2PI2E 4GLAC 1SFOH 1VQIA 3ZJYC 4LFCQ 1EFWA 5HY6A 1XMOL 4NXML 2YTYA 2YTVA 4KHZA 1VQBA 4IFDI 1VQAA 1E7ZA 3W5OA 1AE2A 1PH8A 4K0KL 1MJEA 2QGQA 4DUYQ 4B3TL 3M9BA 4LF4L 2RHSB 4LFAL 1OXVA 4JOIC 4GNXC 1OXUA 2Q2TA 4A3IH 2ZM6L 3RZOH 5IYBH 4HIDA 4A75A 4DR2Q 1X6OA 1V9PA 2I5LX 2OQ0A 4HIOA 1KIXA 4DR6Q 4IFDJ 3J81c 4QJFA 2CWPA 3KDFA 1EUJA 1VQEA 5JEAG 2K52A 5E7NA 5C44H 4DR3Q 4LW1A 4DV0Q 4JI6Q 3UDXA 4B3ML 3BZKA 4JI7L 1V1QA 2JA9A 3PIOA 4OX9L 1HZCA 2UUBL 1TWFH 1X54A 1VQ7A 3HOYH 3J7A5 1JJ2A 2JE6I 1HNZL 3KOJA 4BBRG 4BBRH 1WI5A 1E1TA 1VCIA 3NELA 1PH3A 2VQEQ 2PI2A 4O2DA 2RHQB 3CCMA 3RLFA 2BA0A 1YHBA 5EAYA 3J81j 3G48A 5GADC 1C0AA 4A3GG 1G291 4QY7A 2Y0SG 2K4KA 4DV2Q 1NJIC 1LUZA 3AQQA 3PIPA 2ASBA 4DR1Q 3ICEA 2PQAA 5C0XI 1NY4A 1PH9A 1XNRL 3GTQH 2F3IA 3CMEA 4BBSH 1VQOA 4X6AH 3BU2A 4L5QA 1CKOA 2I5MX 5C0XJ 3KF8B 1VQPA 4HJ7A 1T9HA 3F2BA 1PFSA 2D62A 2VQEL 4JG2A 4A3IG 1IYJB 4DR7Q 4A3FH 4A3LG 4A93H 3G4SA 4JI8Q 1EOVA 4DKAC 3OTOL 3T1YQ 2MO1A 1S40A 1UE1A 3UDFA 3EN2A 3HOXG 2NN6G 1G51A 4DR4L 1VQFA 1L0WA 3WWVA 2R7ZH 1B7YB 1I50H 1YNXA 2ZJPA 4DR1L 4OO1G 2N49A 4AQYL 2VUMH 5LMNL 2VUMG 5AJ3L 3S1QH 4YY3Q 4A76A 4KHPL 5JJKA 3KJPA 3AEVA 4DUYL 1L1OA 1PHJA 1K8AC 1Q86C 3CCQA 4DR7L 4JI6L 3S17H 3ULLA 2N78A 2F4VQ 2JA7G 2JA8H 3TS2A 3GTJH 1QZHA 3GTGH 3CCLA 5IWAQ 4BXXH 5M3FG 4AYBG 4LUOA 1KRTA 1O7IA 4HJ9A 1CSQA 1NTGA 3T1HL 3K0XA 1BVSA 2HHHQ 4K0KQ 1TXYA 4IJLA 5C3EH 1Y1VH 2WAQG 3A0JA 2AWOA 4R4TA 4AYBE 4L5SA 4JI7Q 4LF9L 3F1ZA 5IY0A 1E22A 3CPFA 5JJLA 4DUZQ 3H15A 2IY5B 1QUQB 2MO0A 4R4OA 1YEZA 3FKIH 3STBC 5IP7H 1IBKQ 4RMFA 5GAHC 1L1OB 2AKWB 1SN8A 3A74A 3MXNB 4JBKA 4YWMA 3CPWA 1WCMG 4PZ6A 2HT1A 3JAMi 1YBYA 2Q2UA 4BBSG 4PZ7A 2OTJA 2NVQH 4DR6L 1JT8A 4WJ4A 5DLQE 3RN2A 1FL0A 1K83H 1P8LA 5J3BA 2K5HA 1OXXK 1Y1WG 4DV7L 2Q2IA 1XPUA 1J5EQ 4HIKA 4JV5Q 2ZJQA 2I5HA 4LUVA 2PMZE 2OQKA 3PSIA 1X55A 4DR4Q 3STBD 2LSSA 3B6YA 1Q8KA 5C4XH 2Z6KC 3PF4A 3CCRA 1L1OC 1EWIA 4DV4Q 1KC8C 1C7YA 1YHAA 3PO2G 5JEAJ 2UUAQ 3NENA 1QVGA 3E9IA 3JC66 4HIMA 3BJUA 5GAEC 2B63G 3L2PA 2VZAA 5M5YH 4UY8C 3U4ZA 1XMQQ 1CUKA 1TWGH 1IZ6A 2Y0SE 1VQKA 2CKZB 1UE7A 1SR3A 5HGQA 4QGUA 4A3MG 4DV3Q 3FP9A 4A3MH 3HKZE 4DR3L 3SGIA 4C2MH 1IL2A 4LWCA 4JI1Q 4JI3L 5H1SE 1N8RC 4GN5A 4R4QA 5AJ3Q 1HNXQ 2MFIA 4HJAA 1YJWA 1N33L 2R7ZG 4A3DH 4BA2I 3K81C 1VQNA 5FJ8G 1HNZQ 2AWNA 2GVBA 1Q7YC 2ATWA 1YIJA 4OO1I 2YV5A 1TWHH 1XMQL 3E9HA 3CF5A 1EQQA 1VQHA 3HFZB 2UU9Q 1NBWA 2QA4A 4KI0A 1FGUA 1PV4A 1X3EA 3D31A 4DV6L 3I4MH 2IHFA 2VQFQ 3I56A 4JI0Q 1MIUA 3PUXA 1GD7A 4DAYB 3S14H 4DAMA 3AFQA 4YY3L 3HOWG 4KHPQ 1E1OA 5FLXc 4JBJA 1OXSC 2BH2A 3J81i 4A3GH 1J5EL 1MJCA 1V43A 3GDEA 3W1GA 3JAMc 2H5XA 1PH6A 1HJPA 5IWAL 2JA7H 3M3YH 1Y14B 2Z6KA 1NMGA 1WYDA 5C4JH 3M7NA 1K3RA 2JA5G 4X66Q 1Q1EA 5GROA 3PUVA 4BY1H 1HNWQ 3HKSA 1JE5A 2ZTCA 1Q81C 1PH2A 1LM0A 2K75A 3IRBA 1JMCA 1K73C 2R92H 3H0GG 3GTPH 4JYAQ 4LFCL 4XTCS 4A3CG 1GM5A 3OYYA 2KENA 4A3JG 1HZBA 4OXPA 3A5ZB 1N34L 5FJ8H 3F2DA 4L5RC 1YVCA 2IX0A 3U4VA 3RLOA 2WP8J 1RIPA 4JI1L 5LMNW 4DV1Q 2HIVA 4JI3Q 3I7FA 4X66L 2K14A 1PH5A 2IT1A 2L15A 3D0FA 1QUQA 2KHJA 1LYLA 3TS0A 1N36L 3PUZA 1KL9A 1B70B 4O0AA 4OONA 4MNOA 1VQMA 1S72A 2KCTA 4JI2Q 4IFDG 4UPAA 2KCMA 2ZM6Q 4XIGS 3T1HQ 2WFWA 4YCWA 2LXKA 1SROA 4X64Q 2A1AA 3H3VH 4Y52H 3CCUA 4GN4B 1VQ4A 3J80i 2A8VA 3G6EA 1BKBA 1X3GA 3CW2C 4EX5A 4DV7Q 4YWKA 3CCJA 4LF8Q 4JI0L 2UXBQ 3DLLA 3PUYA 4TVAB 1D8LA 1Y1VG 1WOCA 4MTNA 1KQSA 1IBMQ 2NN6I 2Z0SA 4QIWE 3DM3A 1OTCA 1FVIA 2JA6G 4R4CA 2MQHA 3Q8DA 4GNXB 3UDGA 2UUBQ 3UE0A 4DV6Q 2FXQA 1VQ5A 5C4XG 1XNQL 4UP7A 3I4NG 2XTIA 4X64L 2ZJRA 4JBWA 4GOPC 5FLMG 4C3HH 2BH8A 3S2HH 4GS3A 2B29A 3H3VI 4LF8L 4GOPB 1XMOQ 4NXMQ 2PQAB 1YJ9A 3AYHB 3E0EA 1JJGA 4X62L 4A3BG 3I2ZA 1CKNA 3L7ZC 4QQBX 4A3FG 4JV5L 1IBLL 4A3LH 3F8TA 2R93H 4R1JA 3L0OA 2JK8A 1RL2A 2NZOA 1PVOA 2EIFA 4IOCA 1NE3A 1K9MC 4JI4Q 1XNQQ 1YZ6A 1P16A 1VQ6A 1S3OA 2GN5A 4P74A 4LFAQ 5M5WH 5JJIA 4A93G 1VQJA 4HJ5A 1QVFA 4WJ3M 3GTKH 3KF6A 4DR5Q 4KLKA 4JI8L 1N9WA 3OTOQ 2UUAL 4IO9A 1U0LA 2YU9H 1X9NA 1H95A 3OW2A 1J6QA 4P72A 4JBMA 2HIXA 1EYGA 5IE8A 2N3SA 2VS1A 1QVCA 3HKZG 3M4PA 1HR0L 1IBLQ 1X65A 3NBHB 4ME3A 3ULPA 1A62A 4JI5L 4P75A 2E2JH 4IPHA 1GO3E 2EXDA 4DK3C 5GAGC 3CCSA 3S1MH 1Z47A 2HQLA 2R7DA 3PV0A 4JC0A 4DV2L 3VDYA 2JA8G 1IBML 1W2BA 1YITA 3F2CA 3K80C 1EIFA 3HOUG 1A63A 2R92G 3PCOB 1JB7A 1ASYA 2IX1A 3ULJA 2UXBL 2JEAI 2AMCB 3ERSX 3PGZA 3S24A 2B63H 1KXLA 1HR0Q 1CSPA 2JEBI 4OWWB 2R6GA 5IP9G 4AH6A 1PA6A 4BY1G 1KD1C 4AIMA 3EIVA 4LF6L 4DUZL 2VNUD 2V1CC 5BR8Q 2A19A 1XPOA 1E24A 3FKIG 4GKKQ 2DGYA 3CCEA 4DV1L 2KBNA 4IPCA 3CQZH 1KRSA 1GVPA 2AHOB 3GTMH 1I6HH 4POFA 3CAMA 2C35B 3W1BA 3CXCA 1X56A 4LF5Q 1M1KC 2KHIA 4C3IH 5IYCH 1NMFA 2RF4A 5GQOA 4JI2L 3PO3G 3PUWA 4LNQA 3UDIA 1YHQA 1K0RA 5M5XH 5IYDG 2NVXH 2WAQE 5C3EG 4L5TA 1KHIA 4OWXB 1EQRA 1D7QA 1KAWA 4JI4L 1SE8A 5M3MG 3GO5A 2UXDQ 1HZ9A 2HHHL 1DGSA 1CKNB 2Q2HA 1R9TH 1XPRA 1VQ8A 4IJHA 3GTLH 4A3EG 2VL6A 4HJ8A 3PO2H 2K5NA 3K7UC 5ELOA 4APVA 1XNRQ 4YHHQ 4LF5L 4A4IA 4A3KH 2D0OA 1PH1A 1N36Q 4NPSA 1UEBA 3HOZG 2CQOA 3HOZH 2B3GA 4B3SQ 1HR0W 1SLJA 1PH4A 2VY3A 4DNIA 2CWAA 4NXNL 2YYZA 2E2IH 3KJOA 1GKHA 5IT9c 3HOXH 4ALPA 1U5KA 4IPDA 4P71A 3TEHB 4A3DG 4X62Q 3ER0A 3I55A 1WCMH 4YCVA
chains in the Genus database with same CATH superfamily
4A3CH 1EZ8A 1EIYB 2FPPB 1R9TA 4LF6Q 4X65Q 3PO3B 3GTLA 2GVAA 4JI5Q 4BA1I 2ZXOA 1EQVA 1WJJA 1VQCA 2ZTEA 1D1KA 1RHPA 3JAMW 5LOVF 3HOWH 2O2LD 4B9WA 2JA5H 4RNNA 1GYFA 3W2DA 4DV4L 4H02A 1ASZA 2E5LQ 3I4NH 2XGTA 4TRDA 3URYA 4ZK9B 1DXMA 2CFMA 3HOVG 5M5WB 1HNWH 2QCPX 1UE5A 4X66H 1N32Q 1EIGA 2OEOA 4MA0A 1N36H 4NW2A 4A3JH 2UXCL 4EGQA 2WB1A 2OWOA 2HHHH 3BVMA 5FLMH 4GC7A 4GKKH 3BZCA 3KF8A 5KNBA 3S16H 1BBWA 1ZETA 4POGA 2HJWA 1HNWL 1QZGA 1LT3D 4B08A 4QIWB 2UUCL 4DV3L 4XX0B 2C22A 4EFBA 1IYVA 1RK5A 1LTBD 3MFYA 3OWFA 4BY7G 1JJCB 4IAJA 3QB3A 3CC2A 4PWQA 2C28A 2B8FA 4UAIA 1CA5A 2AQ2B 3CP0A 1PXUA 4ILWA 4WD3A 5D3IB 1EZ6A 4LF8H 2QEXA 3V05A 3SK4A 3RZOB 3E5NA 5D1OA 2XGQA 1I4GA 2KVMA 3S2HB 1FJGQ 3KYHC 1YJNA 3CCVA 2OXPA 4Y7NH 4P73A 1Q1BA 2UVVA 3AFPA 1S0MA 2EQSA 1LABA 2D0PA 5L37A 4A3BH 2I8CA 3GTOH 1XTDA 2A5HA 5DAUA 1CQIB 3I4MG 2UXCQ 4CDFC 3HOUH 5HURA 4R9WA 5KFOA 1RK6A 4B3MQ 2JA6H 3J7AV 1S5DD 4NXNQ 1CKMA 3PR4A 3R8BA 2SEBD 4BY7H 4G7ZC 1C8CA 3KALA 1JOOA 3A8IE 4YCUA 2UUCQ 2VQFL 1FNUA 5I9PA 5IP9H 5IYBG 3PMFA 5J2UF 3GTKA 3KBGA 1EY0A 2F52A 1STBA 1STNA 4RGMA 2XRQD 2MGSA 3BS1A 1M4VA 1K0SA 4F50A 1SNCA 4B3RQ 5CYUA 3MXGA 2F4VL 4JI3H 4JV2A 5J2TF 1PYWD 4X3KA 5M3FH 2DZDA 2UXDH 4CKCA 3QR8A 4IHJF 3W3AA 1TWAB 3TREA 3TRZA 4HSPA 2WB1E 4DUZH 4A3BB 3PR5B 5JVG3 4ED3A 4A3EH 3FMCA 3RZDH 1I94L 2P5ZX 1IHZA 4EQ5A 3GTOB 5L1IA 1SE3A 3R5XA 2YTYA 3FDSA 2YTVA 4KHZA 4CJ0B 1VQAA 1N56A 3RBDA 4R8UB 4J1MA 1PRTB 5KG0A 2QGQA 4DUYQ 4B3TL 4JI7H 1NAPA 1OXUA 1CTMA 1K28A 2KA7A 3DMUA 5IYBH 4FF2A 2XCAA 3VR2A 1STYA 4A75A 1GXDC 3JRXA 1NR4A 3H4DA 2OQ0A 3H40A 3MHBA 4HIOA 1AW7A 5M5XB 4IFDJ 2JEGA 2F3WA 5KFHA 1VQEA 5CMDA 2F0LA 2HGSA 5KG3A 1RODA 4DR3Q 4LW1A 1CHQD 4DV0Q 5C1PA 4JI6Q 1E4EB 3WO0A 1WR2A 5CBEE 1V1QA 3PIOA 4YAKB 4L8JA 2C2RA 4UHVA 2HD3A 1RD9D 3H91A 1VQ7A 1ESFA 1JJ2A 2JE6I 1V1PA 2VPSA 4LK1C 3NELA 3NBHA 3EQLC 3SDZA 5KIXA 4O2DA 4DV3H 3RLFA 4ECRA 1AUVA 3GTJB 1ZHQA 1G291 4QY7A 2YRXA 1TS3A 4DV2Q 2NVYB 4KJOA 3J81W 4DR1Q 4KN7C 1PH9A 3TN2A 2B2VA 2VXWA 2MHVA 2NWGA 3RUPA 4X6AH 3GTJA 1J5EH 5CBAE 3S14B 3KF8B 4PV1C 3X3NA 3Q23A 1JDBB 4HJ7A 1EY4A 1PFSA 4IUVA 2W57A 5D1PA 4HEDA 2VQDA 3VA7A 4KHVA 4A93H 3M9NB 3OTOL 2DJGC 4DKAC 4MTEA 2MO1A 4RB1A 4JI6H 2NN6G 1I50B 3TQ1A 3WWVA 3MWDA 1B7YB 1I4XA 4DR1L 3KHLA 1WD0A 2VUMH 2VUMG 5ELEA 4XZ3B 5BR8H 4YY3Q 1B04A 3OHAA 3KJPA 5KFTA 1L1OA 1K8AC 3CCQA 4EQPA 2K6AA 4JI6L 2N78A 2E5LH 4NDXA 5KFBA 4DXGA 3TS2A 4ED6A 3GTJH 3GTGH 3MFIA 4B3RH 1S0NA 4I4TF 4LUOA 3LX0A 1KRTA 4C5BA 2BDOA 1NTGA 2K01A 5E4XA 2Z6BA 1TXYA 4JPBW 1Y1VH 3A0JA 3ORRA 2AWOA 1JWSD 3K5HA 5KFUA 1XTCD 3CPFA 2K5WA 5CV9A 1XWEA 1PFBA 2MO0A 3IFTA 1F9RA 1B4OA 5IP7H 4EYHB 3GQBA 4LFBH 5C5JA 4DV7H 2CQAA 3R5FA 2VUGA 1L1OB 5C4ZA 5F9NA 3CPWA 2XC9A 5CV5A 4J0MA 4KD3A 1SYEA 4BBSG 2WYOA 2OF1A 3MAQA 4DR6L 3K3PA 2V59A 3RF2A 5CA0F 1HA6A 1K83H 1YNJC 3NPPA 3G8CA 3GTMB 4DV7L 2ASLA 2Q2IA 1XPUA 4LJZC 4ZYSA 1QE6A 2ZJQA 3FMAA 2IMWP 2NYZD 4FXKC 3STBD 2LSSA 3EFXD 4DR4Q 4F88A 2YW2A 1LO5D 2Z6KC 3OMGA 5KFXA 2X0SA 4IR9A 1L1OC 1EWIA 1XDNA 2EYFA 2RSNA 2J6TA 5D3DA 4IRKA 3VR6A 4DF7A 5GAEC 3EYYA 1QCBD 5K36H 2Y0SE 1C3OA 3VR4A 5F2DA 2QK4A 4XYMB 2YYAA 2WAQB 4Q8FA 2OT2A 3PW5A 3OHXC 4JI3L 1TAEA 3TP5A 4RUCA 4ECYA 2MFIA 4HJAA 1YJWA 4CJ2C 1N33L 1SJHD 2R7ZG 2K33A 3K81C 2M9VA 1VQNA 4F4WA 4GKJH 3D4WA 1HNZQ 1UNNC 1EY5A 3LP8A 2AGOA 3A56A 1X3QA 1FGUA 4KI0A 1TWCB 1GUWA 2VQFQ 2B2TA 4DAYB 4K6LA 3VYRA 1E1OA 4A3FB 1OXSC 4EBEA 1MJCA 1B2TA 3GDEA 3JRWA 4QIWA 2MPMA 3JAMc 2H4OA 4ZI7F 1PH6A 5FLXE 5ELFA 3LWBA 5C4JH 3M7NA 4IRCA 4J9QA 1BXTA 2XSCA 1SSOA 1HFGA 4DK1A 4DR5H 3M7GA 2K75A 3GLKA 2Y0SB 4EYIB 3H0GG 3HG9A 1SYCA 1TS2A 5KGUA 4O2BF 1N34L 5FJ8H 5DQGA 2IX0A 3GIIA 4ZRZA 1RIPA 4JI1L 2FINB 2FK1A 2CHBD 3HGBA 3D0FA 1LYLA 3HKZB 3PUZA 2I07B 4OONA 1S72A 2FLNA 4MNOA 2KCTA 4Q0FA 4MIUA 2HVSA 2XIGA 2A1AA 3HEJA 4C1NI 4NXNH 1S0OA 4GN4B 1JWMD 3J80i 1IW7D 3T56B 2A8VA 1X3GA 3CW2C 4EX5A 2GLTA 3CCJA 4TUYF 2EJGC 1KJ9A 4IALA 4NMZA 3DM3A 4GNXB 4RGOS 3UDGA 4ID6A 3UE0A 2RKSA 3A55A 2E2JB 3MC0B 1B1ZA 3PIP3 3UQ8A 4X64L 4GOPC 5KFMA 5FLMG 2AQ4A 1KDCA 2WKCA 4YP3A 2AQ1B 1PLFA 5L1KA 3BA9A 3T5KA 3GTQA 5M5YB 1DIKA 2B29A 4LF8L 1E2ZA 5DGBA 4DV1H 2EJFC 3S15B 1XMOQ 4JI8H 3NXWA 3F8TA 3V4ZA 3L0OA 2F1MA 3KAKA 1W6JA 1HUNA 5LYJF 4IOCA 1TQOA 1K9MC 1XNQQ 4J9RA 4ULLA 2ENBA 2Z9HA 2GN5A 4LFAQ 1I7LA 5JJIA 3GTKH 1SNMA 4X3SA 4A2AA 4JI8L 1N9WA 1NCVA 2X69A 1STEA 3I73A 1X9NA 4UCOA 4RH6A 5IE8A 2YL2A 3TBIB 3MR2A 3HKZG 2R8GA 1CM9A 1HR0L 1X65A 3Q6SA 5J39A 1W96A 3GTPB 1A62A 2ZXPA 4JI5L 2E2JH 1BNCA 5GAGC 4LMQD 4JC0A 3MXPA 4DV2L 1RJRA 4Q43A 3NQIA 4DV0H 3P7JA 1WVLA 3KXYT 1SYXB 3HOUG 2LKVA 1BGWA 1UEAB 3SVMA 1Z2NX 4J9NA 4P2CB 3E0JA 3S24A 3C3LA 2W6ZA 3L3OC 1HR0Q 1CSPA 2VUMB 3T4AC 4AH6A 4I50F 1KD1C 1BCPF 1EWHA 1ICWA 3EIVA 4G4KA 2UVUA 1K1SA 4K5WA 2KHSA 2VNUD 1T5XD 1E24A 4RFBA 1KRSA 1GVPA 3MWYW 3IL8A 1I6HH 2C35B 3W1BA 1VF7A 3MXNA 3J81L 1PTOF 3QG1A 2KHIA 4KY7A 4JI2L 1NMFA 1A3TA 1KABA 5GQOA 3PO3G 4LNQA 4XT3B 1PTOH 4RCNA 2NVXH 1AEXA 2WAQE 1FJGH 1KHIA 1PTOD 1KAWA 2A6ED 2I87A 1DGSA 1L0XB 4HCSA 2R7ZB 3K5NA 4A3KB 5KFAA 2J6UA 4JI2H 3RUZA 3K7UC 4KY6A 1XNRQ 3CVZA 2BQUA 2WDTA 2Z4IA 2D0OA 5KFFA 3HOZG 5A2QW 4JVZA 1VMPA 3TIIA 1E2VA 1BBXC 1PH4A 1D2BA 5CA1F 3QJYA 1LT6D 5CGKA 1KNAA 1TY2A 2C9OA 1IBMH 4NXNL 3NWSA 3A7LA 3F2UA 1TWGA 2B2UA 2FMAA 4ZCKA 3OSNA 4C5AA 4Y7NB 4H44C 4EFEA 5KT3A 2JP1A 4HN7A 4IPDA 4IFDH 4P71A 3TEHB 4A3DG 4ZUIA 4X62Q 3C46A 3I55A 1SNOA 4NLGA 4MV6A 2NVTH 2DNCA 1PYSB 1T36A 2MCTA 1HFNA 2ZTDA 1HA5A 1HNXL 3A8KE 3KHHA 2R7ZA 1XNQH 1U4LA 2JJQA 1Q12A 4ZUJA 5A2QL 3Q24A 4LAAA 3A5UA 1SJED 4FNFA 2DPIA 2F0NA 4LMYA 1W6KA 4FU0A 5T1IA 2VW9A 5LL6X 2CCZA 3WNZA 3KLWA 1D5XC 1UWVA 2Q8IB 5I2YA 3J7ZC 5JVH3 1NR2A 3OIQA 4JV5H 2PZTA 4ETSA 3BZDB 3BQ2A 2H1EA 2XD4A 2DUDA 1Y69U 5BN5A 2ASDA 2XCLA 2BA1A 1IBKL 5C5MA 2JA8B 1HH2P 2UUAH 5CAEB 2E2HH 4F4ZA 3HP3A 1TWAH 2F4IA 4JCVE 4K14A 3V4SA 1B3AA 1IXRA 3S1MB 2XN9C 3WO1A 4B3RL 2CW0C 1VKZA 1DD2A 1HR0H 2XRSD 4KK7A 3CD6A 1B8AA 3I12A 4LF7Q 1HPCA 2MUYA 3GD7A 5FPOA 1RTNA 5KG7A 3BDLA 2EVBA 3TSSA 2RGRA 1Y8NB 4NB3A 4DV0L 4OGQC 2EJMA 3CHBD 4RCOA 5C3WA 3BG5A 4ECXA 5DLFA 3CKIB 2F03A 1K83A 3S1RH 4ME5A 2HQEA 1C30A 1U4MA 2N8NA 1A6XA 4MV1A 3RIZA 1E0BA 5I6YA 4TQUS 3WDNA 4DFAA 2NZHA 1ET9A 1AFPA 3G6YA 2KEEA 3QFFA 3TP7A 4EBCA 4B3TQ 1IW7C 3GIJA 1FGBD 3RNUA 4C3JH 3K5LA 4PMWA 4EEQA 2R7MA 4CDCC 5IP7G 4X3UA 4GLVB 4XQNA 4DL4A 2CVRA 3M4OH 2E5LL 3FHWA 4KKSA 1G8ZD 1BBUA 4C3HG 1HTLD 2K04A 4JOIA 5C44G 3RGXA 4IOAA 3IAYA 4PZ8A 5LP6F 2CW7A 3T1HH 1PYBA 3M4QA 3PF5A 1UNSA 3RR5A 3SE0A 4X65L 4AQYQ 4FDBA 2QKIC 1JE4A 4GN3B 4DK6C 4UP8A 3CC4A 3DF7A 3LGJA 1PZID 2DY8A 4J9OA 3E6ZX 2NU6B 4ZOLF 2F0QA 3S1NH 4RU9A 4A93B 3GV6A 5JJZA 2R6FA 3SI8A 3U50C 1KNEA 1Y1VA 4FF4A 1LLRD 4G3IA 5IGDA 1RYSA 5LMNQ 3TQYA 4F8MA 4U6PA 3M85A 3C0FB 1Q46A 4IRDA 3NTIA 4ODGA 4GLAC 1LV9A 1SFOH 2JN4A 4LFCQ 3OUUA 3LMLA 4M9UA 3T5HA 1XMOL 2JA5B 5HBRB 4WRDA 4HAEA 3I4NB 1GUNA 4C3IB 1I50A 3VYUA 2Z8LA 1MJEA 2L1BA 4GNXC 1O7YA 5ELBA 3GV3A 1D5ZC 1WTWA 3RAQA 1X6OA 1V9PA 5HGTA 1H9JA 1MGSA 1WTOA 3J81c 4QJFA 2CWPA 3KDFA 1L0YB 5LL6S 4ME6A 4O3SA 4LF7H 2I46A 1LACA 1WCMA 4B3TH 3BVZA 1S68A 4BS9A 3FEWX 1TS5A 2UUBL 5CV4A 3N43B 1KDBA 1SE2A 1X54A 2PZWA 4UDUC 2F0HA 3J7A5 2Q8TA 2DLNA 3H0GA 3DWQA 1UAPA 4BBRG 1PX2A 1VCIA 1O7ZA 1ZXTA 5KFRA 5FLXW 3EJIA 1FNVA 2EYJA 2BA0A 4RHSA 1YHBA 5EAYA 4J9KA 3J81j 5C6AA 1CS0A 1NJIC 5KRUA 2A6EC 1LUZA 2QEJC 5KG5A 1STAA 1LTGD 5C3EB 1XNRL 2CH4W 3CMEA 1V1OA 5ELCA 1CKOA 2I5MX 2RDFA 5KFGA 2NVXB 2KCNA 3F2BA 2D62A 4A3IG 4JG2A 3MR5A 5LMUH 4DV5H 4NXMH 3T1YQ 1Q90A 1UE1A 3HKZA 3UDFA 3EN2A 2R93A 1G51A 3AB9A 2Z4HA 2R7ZH 3R2TA 2B8GA 1YNXA 2ZJPA 4RA8A 5CV8A 3S1QH 5L9XA 4DUYL 1PHJA 1Q86C 5KG4A 3S17H 5T14A 2EE1A 1FNWA 4JI1H 2F4VQ 2EY5A 2JA7G 2EYHA 4MV4A 4B3SH 1EIHA 3CCLA 5IWAQ 3NHHA 4MTKA 2K32A 2SCUB 4AYBG 3U9OA 1O7IA 2OH2A 1DYQA 3T1HL 2HHHQ 4FVMA 1BVSA 4OX9H 4IJLA 5C3EH 2RQXA 4R4TA 1K3BC 1TU2B 4MTDA 4LF9L 4ECUA 4A3EB 3RZDB 3F1ZA 1E22A 5JJLA 4MV9A 2N88A 2A6HC 5M3FB 1JOQA 1WTXA 2ICEC 4YBZB 2J6SA 1EYDA 2MP1A 3BAAA 1EWCA 4RMFA 1JCKB 2ZT9C 2Z1CA 5DG9A 3A74A 1Z6HA 4YWMA 2W9BB 4YR3A 3BJYA 2Q2UA 4PZ7A 2NVQH 1MHWC 3SK6A 3OMCA 1HTPA 2K5HA 4FP5D 2F0KA 3HOXB 2X6LA 4RB3C 2R3ZA 4FBTA 2PMZE 2OQKA 5EPKA 3PSIA 3CRLC 4O4IF 3B6YA 1U9RA 4Y8VB 5C4XH 1G2TA 1PZKD 2ASJA 1KC8C 5K2MA 4CHTB 5EDWA 1O75A 5KFWA 1BR9A 2B63G 3L2PA 4FF3A 2VZAA 3VMMA 5LXTF 3U4ZA 3PW2A 2VA3A 1EY8A 4EVOA 2R8IA 1Z7TA 2PCFB 5JAVA 5KFPA 3H4BA 4B9XA 4PMCA 3TZUA 5HGQA 4QGUA 4A3MG 4A3MH 2F0OA 1IL2A 4ECTA 3GTMA 4NKLA 3MR3A 4B3MH 1N8RC 1I4QA 5KFEA 2W8KA 1IKMA 4A3DH 2EYLA 2QILA 3I72A 2FPIB 5EWGA 4K2LA 2GVBA 4U68A 1Q7YC 4FF1A 1EYCA 2JYOA 1XMQL 1EYZA 3H6MA 4E4TA 3I4MH 1PV4A 4QCLA 2IHFA 3A7AB 5KT2A 3PUXA 3S14H 4IUTA 4YY3L 4I65A 3HOWG 1VF5C 5FLXc 4JBJA 4L63B 2BH2A 3D3RA 2L12A 3EA6A 4YAJB 5JPNC 1S10A 2F3VA 1A9XA 3W1GA 4I55F 3PW4A 3E3XA 1HJPA 3M3YH 4TQRA 4BY1B 1Y14B 3KK7A 2Z6KA 1WYDA 1SFOA 2A68C 2K05A 2E2IA 1Q1EA 3PW7A 2F0VA 1V51A 4YY3H 3PUVA 5KG2A 3NTKA 1HNWQ 2DIKA 5KFJA 2ZTCA 1TS4A 4HMJA 5KEEA 4RWSC 3IRBA 1BO0A 1Y1VB 1JMCA 1K73C 2PW7A 2FLPA 4KKUA 4O3OA 3GTPH 2SDFA 1EY6A 4LFCL 1GM5A 5C8YF 3D6WA 2KENA 4DUYH 4OXPA 1GUOA 4L5RC 3T51B 3RLOA 2WP8J 2PPBC 4DV1Q 2EDGA 2HIVA 1PH5A 2IT1A 2L15A 1N36L 3TS0A 1EHIA 1VQMA 1B70B 3FKIA 5FKAC 1M6VA 4XIGS 4XT1B 2WFWA 2LXKA 1SROA 1KLUD 5CV6A 1VQ4A 1BCPC 1SFOB 2CW8A 3G6VA 2XWBB 1F9PA 4DV7Q 3ZYYX 2UXBQ 3TQTA 2DWCA 1NUCA 3DLLA 1GJXA 2B2TC 1WOCA 1B9MA 2KCCA 4QIWE 2V58A 2YCHA 4Q5VA 1OTCA 2IBKA 3JSNA 2UUBQ 1ESRA 2KQ3A 2FXQA 5DM63 1VQ5A 4MAMA 4UP7A 5J1ZA 5FOBB 3OSPA 1BOSA 3N44B 1IL8A 4MV7A 5EBCA 4LF6H 2BH8A 3S2HH 2BDNA 1CHPD 1Y1WB 1SAPA 3K7AB 4NP5A 2VPQA 3AYHB 3QIAA 3T13A 2NUAB 5JVDF 2NU9B 4K5VA 3JAML 2JK8A 3I91A 1RL2A 5JQWA 1X3PA 2EIFA 4JI4Q 1NE3A 1SCUB 2NVXA 1BF4A 4ECSA 4FS2A 1N48A 3KF6A 4DR5Q 4BY7B 4KLKA 3I90A 1SNPA 1JICA 4K8JA 1HQMC 3OW2A 4P72A 1FR3A 4JBMA 3HXLA 3KHGA 2K1BA 2ZDHA 1EYGA 3X3MA 4ED7A 1LTID 1IYUA 4HMIA 4ME3A 4P75A 1STHA 4DK3C 1GO3E 1Q8IA 2DN8A 4FO2A 5JPMC 3GV7B 2R7DA 3PV0A 3VDYA 3F2CA 1PFMA 2JA6A 1SBBB 4DGZA 3PO2B 2PYKA 1JB7A 4TSSA 1ASYA 4YR0A 2ICIA 4R8UA 2AMCB 2EOTA 1VBGA 3PGZA 3Q8RB 2EY2A 5FO8B 4KMUC 1JKJB 3P20A 1CZWA 3ERQA 2JEBI 4OWWB 3S2DB 1PA6A 4FYDA 4O4LF 3U9TA 4AIMA 2XIWA 5C4JB 2L4NA 3IKJA 5IOCA 2V1CC 3S17B 1QJOA 1SMYC 3FKIG 3ITPA 2DGYA 5CB4F 2D2CC 2KBNA 1B44D 1EY7A 3KTMA 1WCMB 3H94A 3ND9A 3CAMA 3K57A 3BQ0A 4LF5Q 2JEJA 4X62H 2RF4A 3A54A 1YHQA 5KNCA 5M5XH 1TA8A 1GHKA 4L5TA 1E4GT 2QF7A 1T94A 1SE8A 5M3MG 4CKEA 1CKNB 1R9TH 1XYIA 1VQ8A 3GTLH 1F2YA 3Q22A 3PO2H 5I9OA 3J7AK 5ELOA 4APVA 3Q1KA 2ATLA 4LF5L 3VA5A 1PH1A 2UUCH 3R2IA 3IN5A 1N36Q 1N32H 2CQOA 3HOZH 2B3GA 2V5AA 4JI4H 2B2WC 2R8JA 2VY3A 4S3SA 2YU9B 4XQQA 2YYZA 2E2IH 1JOKA 1H9RA 1SYFA 3J81E 3KJOA 1S5ED 5I6WA 5IT9c 3HOXH 5E4WC 4ALPA 4DL5A 3RB0A 3T5LA 4XYLB 3AU7A 5DNFA 1JXLA 2V4DA 1WCMH 1PK8A 3GIMA 1YI2A 3RAXA 2FLLA 4CKBA 3DWAA 2QW7A 2E2DC 1TKWB 4LSAA 4IPGA 2EZVA 3K8AA 4H7BA 3PO3H 4GLXA 4TQSA 4F7XA 4G57A 2R82A 4F4XA 3TINA 1SDFA 4YWLA 1EYAA 5FLXL 3FRPB 3BVGA 1OXTA 1WTPA 4DPGA 2WB1B 3TIGA 1VS0A 2SOBA 1LTLA 1ZYRD 2WKDA 4H13C 1T5EA 1AE3A 2R7KA 2R87A 4EEYA 2R92B 3LWEA 5IT9E 4IWXA 3NWTA 3SR1A 1E3PA 1S5FD 2KECA 2I0QA 1KJJA 4UCUA 2ALYB 2W7PA 5EGTA 1EOTA 3OOCA 3GTGB 4GKJQ 5C1OA 2CH4A 1WTVA 2PQEA 4TV9F 4UP9A 1VQ9A 3HBLA 1DM0B 5IODA 3BG3A 4JI0H 4JV1A 3QWNA 3A8JE 2JXMB 5KT5A 1I5FA 1R4PB 1TWFB 4YHHL 3HOYB 5FPRA 2UU9L 2YTXA 3LWUA 5HV6A 5I2XA 4HNVA 1S03G 1TVXA 5NUCA 1A2UA 3N6XA 4ZLTF 2FJ2A 2UXDL 1A8VA 2SNSA 1XNRH 2K5VA 1DJRD 4C2MB 1Z9FA 3K59A 1JDEA 4ED8A 3UE1A 5IGBA 2E8GA 5IYCG 2L55A 1HNXH 1K8GA 3IG0A 1GOZA 2B2YA 3HOVH 1SYDA 1I94Q 2MJ8A 1II3A 4DN4M 3R23A 3G71A 5M3MH 3FVQA 2W9BA 4J9PA 4LF4Q 4JYAL 4DL6A 4LUZA 5EPJA 2NB0A 4K0KH 4QMGA 4GNXA 4DV4H 1K8MA 1WH2A 1SRUA 3RLNA 4QL5A 2IX3A 3G6XA 3ETJA 5LMUQ 4DV5Q 4A3GB 4M7EA 1BXRA 4DU9A 1C4QA 5CR3A 2D9UA 1L2FA 1C9OA 2RSOA 4QF4A 1FJGL 1ZQ7A 4LSXA 3MFHA 5K36G 1JQYD 3CMAA 2J9GA 4QWBA 5C3XA 4Q0YA 1LT5D 2R93G 3C1EA 3QO2A 3D4DA 1VQGA 3M9MB 4RG1A 1ENAA 2LMCB 1TWHA 4N8X1 1B6SA 3NGDA 5DEHA 2BE5C 2K28A 4WFN3 1WFQA 2W8LA 3T1YL 4LFBL 3BDOA 4RZQA 1TWCH 3SK5A 1M0WA 2V9WA 2EY6A 4M8AA 2OTLA 3NK9A 3K7AH 1AH9A 2B63B 3K58A 3V6KA 2FK2A 3KFUA 1ONLA 4OWTB 1F9SA 4U673 3HB9A 3RN5A 4YJ2F 1PRTC 2PI2E 1VQIA 3CRKC 3MXUA 3ZJYC 1EFWA 5KT4A 2A74C 4NXML 3TP6A 3GP7A 3V2TA 5D14A 1VQBA 1WD1A 4IFDI 1E7ZA 1J9OA 4XDXA 2FE3A 2WV6D 2TSSA 1QG7A 1PH8A 1A15A 3M9BA 1OXVA 4JOIC 2Q2TA 4A3IH 3RV3A 3AMUA 1IOWA 4HIDA 3NE5B 2JEIA 4KJNA 4DR2Q 2I5LX 4ED2A 1YNND 4LF5H 1B53A 2HUGA 4RKBA 3QOLA 1ET6A 2K52A 1BJTA 3KBXA 5KT7A 3OIPA 4G7OC 4JI7L 2RDGA 2AU0A 1IBKH 1HZCA 3RBEA 2RVLA 4MHEA 1HNZL 1Y8OB 3KOJA 1QNKA 4BBRH 3TMEA 1PH3A 1JIHA 3NSWA 3H09A 2VQEQ 2R86A 4CC6A 4RUAA 2R8KA 2RHQB 3CCMA 5KFDA 3G48A 5GADC 1C0AA 2OLSA 3E5SA 4L1KA 4DLKA 3V6HA 2B63A 2F0SA 1TWFA 3VR5A 3ICEA 3VPBA 2O5JC 2O03A 4XQJA 1DOLA 2F3IA 3J80E 4QW9A 1VQOA 4TKOB 3GTGA 2IJ0A 1VQPA 4C3JG 1T9HA 3N41B 4DR7Q 4GC6A 2VQEL 5C5LA 1IYJB 4A3LG 1E4FT 4JI8Q 1XMOH 3R5HA 2PW5A 4I7HA 3GV8B 2XCPA 5IIFA 1I50H 1G6ZA 4OO1G 2N49A 3QOJA 4KD4A 4AQYL 5LMNL 1JORA 4OELB 3T5JA 2VB3X 2CW0D 3K6OA 4A3DB 3MVVA 4DR7L 3D6CA 2K03A 4O3QA 5JOBA 1TY0A 2F0TA 4KTAA 1GHJA 4R8NA 2F0DA 5FD5A 4HJ9A 1CSQA 5IT9W 3Q0AA 4J6HA 1CE8A 4K0KQ 2KSWA 4L5SA 4AYBE 4WBNF 2C00A 1KJQA 2G5DA 4DR1H 1HNZH 3N42B 5KFNA 4X65H 4PMBA 2FPGB 1ZYRC 3MFGA 1KTKA 4DUZQ 3GILA 3SE7A 1JX4A 4I7AA 3D4RA 4YIJA 5H80A 4R4OA 2IA6A 3STBC 3M3YB 1H9KA 4O3PA 3K0YA 4QWEA 5EZYF 3FDTA 2E2HA 1SN8A 4JBKA 2HVQA 4OHJA 3OUZA 1WCMG 4PZ6A 1PTOC 2IP4A 3JAMi 3HRZC 2J0TD 1YBYA 4K8IA 1ULZA 4HQ6A 4ABNA 2OTJA 1JT8A 3CQZA 2IL8A 5DLQE 2VQEH 4C3IG 1TWHB 1P8LA 1S5CD 1OXXK 4ZAIA 1K83B 1J5EQ 4DR4H 4JV5Q 1CQFA 2NN6H 4LUVA 2F0IA 1EEFD 1G2SA 2YZGA 3PF4A 2NVYA 5A2QE 4KHPH 2O4XA 3O13A 3PO2G 2JA6B 2UUAQ 2YZNA 2ZM6H 2Y0SA 1LTRD 2F0JA 1CUKA 3G7LA 2FB9A 2NU7B 1QB5D 1BCPB 1HRJA 1YNJD 1SR3A 1GSHA 1CT1D 4DV3Q 3FP9A 4DR3L 3BA8A 3SGIA 4C2MH 4JI1Q 3PQIA 4RHRA 5H1SE 3JSLA 4R4QA 1HNXQ 5AJ3Q 4AYBB 4CDEC 4RB2C 1GLVA 4DA2A 2BQ3A 4QB4A 1ICFB 4BA2I 3RTXA 3KLSX 4QUFA 5FJ8G 4O42A 4YR2A 3ORQA 1YIJA 1AZQA 2YV5A 1TWHH 3R93A 3CF5A 2NZ1D 2QA4A 1IKLA 4C2MA 2A68D 4OL7A 4DV6L 3D31A 1B6RA 1CQJB 2F0GA 2FFKB 4EBDA 5I4DA 1MIUA 1WTHA 4OO1H 4KHPQ 2ZDGA 1K8OA 1U4PA 1DZ1A 2KUMA 2NVTB 4A3GH 1J5EL 1V43A 1LTTD 4EQNA 2BE5D 1D6EC 2JA7H 5IWAL 1JWUD 2FP4B 4HR7B 1EEID 1NMGA 4V190 3N8DA 3GTOA 1ZEQX 5GROA 1NNXA 4YJ3F 1BDOA 3DXJC 1JE5A 2R61A 1SNDA 1Q81C 3GV5B 3C1FA 3PW0A 1LM0A 1MD2D 2RDJA 2A73B 1Q3LA 1A3VA 3RB3A 2HCCA 2GPWA 1XXGA 1GSAA 1GSOA 1OO9B 3TZDA 4A3JG 4FXDA 2ZDQA 4RAZA 3H20A 3F2DA 1ENCA 4RB0A 1YVCA 3V6JA 4RGTA 5LMNW 4JI3Q 2R8HA 4ZQ3A 2K14A 2W9CA 5AFWA 4IR1A 2KHJA 5DQIA 1KL9A 4O0AA 3N52A 4HCEA 2ZJTA 2ZXRA 4UPAA 4YCWA 1LTSD 4X64Q 3H3VH 1R4QB 1F2LA 3JAME 3CCUA 2QYZA 4CDDC 1BKBA 5BMVF 1ZHSA 4YWKA 4LF8Q 2F0UA 5KFSA 3PUYA 5KFQA 1D8LA 1H9MA 1Y1VG 1KQSA 2UXBH 3NUCA 1DV2A 2JA6G 1CZGA 3Q8DA 1JC7A 5IGCA 3IFDA 5C4XG 4ECZA 1XNQL 1WTRA 3I4NG 2XTIA 2L9HA 4R7RA 2ZJRA 4JBWA 2KOLA 3RB4A 4C3HH 5LMNH 4RNMA 4DR6H 4GS3A 3H3VI 3OWEB 1ENFA 4GOPB 5D1OB 2PQAB 1YJ9A 5C4XB 3RB6A 3E0EA 3HOWB 4DR7H 1JJGA 1H9SA 3L7ZC 1CKNA 2E74C 4A3FG 4JV5L 2R7NA 4R1JA 1NSNS 2NZOA 1SEIA 1PVOA 2PMZB 2WAQA 1P16A 3DM1A 1S3OA 2FK3A 4P74A 5M5WH 4A93G 1IOVA 2BCOA 4FS1A 1QVFA 1FD7D 4WJ3M 3QZ8A 2B39A 5F9LA 2Q8RE 3OTOQ 2UUAL 1U0LA 2YU9H 1O80A 1H95A 3NBIA 1J6QA 3RD4A 5IGEA 1G91A 1M0TA 5IGGA 1IBLH 1VMCA 2VS1A 4O3NA 1QVCA 2XVSA 4Q8EA 1SEBD 2M2LA 2RCFA 4ED1A 3NBHB 4EQOA 2WTFA 2EXDA 3CCSA 2LFNA 2F0MA 1Z47A 4DL7A 4A3JB 2TMPA 1GUTA 5BPHA 4C3HB 1UC9A 3OW7A 1PMRA 5D65A 3M4YA 2R92G 5KYIA 2UXBL 5GONF 3T1YH 3M9OB 1KXLA 5KNDA 1SNQA 3RV4A 2R6GA 4APMA 4IURA 4TV8F 5BN4A 1W93A 1Z2PX 4F87A 4DUZL 1KJIA 5BR8Q 5D8DA 1C48A 2YZMA 4DV1L 3SXHA 1TT2A 3GTMH 4FBUA 1E4EA 2FHTA 3CXCA 4BBSB 1EFID 5J22A 1BUVT 4C3IH 1I6HB 1Z2OX 4LH7A 4BWGB 3PUWA 3UDIA 2A69D 1HCZA 1PFNA 3T16A 5DQHA 5CC4A 3FPUB 4JI4L 2UXCH 2D5DA 3HOUB 2UXDQ 4C56C 2Q2HA 3K5OA 4IJHA 2YU9A 4A3EG 4O4HF 2VL6A 4HJ8A 1FYCA 4Q45A 1RJPA 4YHHQ 1I6UA 1Y1WA 3NTHA 4A4IA 3FPPA 2EY1A 4A3KH 4Z9CB 3Q8SB 1U4RA 4U7CA 4J9SA 2PZUA 1L2ZA 4NPSA 1UEBA 2VA2A 2WINB 4DV6H 4J9MA 4EGVA 4B3SQ 2F4VH 2GPSA 1SLJA 2A69C 3F8NA 1DONA 2E76C 1GKHA 5JH7F 1U5KA 3PVXA 3VR3A 5EQ0A 3ER0A 4YCVA 3D8GA 2LXJA 2L11A 4XYQA 1WTQA 1N33Q 3K5IA 1Y1WH 4DR5L 4MZ9A 4L6TB 4IQZA 3OHBA 4FXGC 3FKIB 4DK0A 3HS0C 2AUJD 2MNAA 3U58A 1O78A 4O2AF 1V1PB 5LMUL 4QUCA 4DV5L 1XJVA 4GKKL 5KFVA 4IWYA 3RGZA 4LF9Q 5JUMA 5G3LF 3J80c 3PIO3 1B3QA 5KFYA 5COYA 1BCPD 4IUUA 4RNOA 4LF7L 2AUKA 3TP8A 4MV8A 4ECQA 1F2MA 2UU9H 1UE6A 3CC7A 5G3LD 2BOSA 3KF6B 3EROA 1J8IA 4DNTB 5E1FA 1Q82C 1VQLA 2ES2A 4PG3A 1A0IA 5EOYA 2WE6A 1MZBA 5KYLA 4XXEA 5DG7A 4B3SL 2SNMA 1SMXA 5FO7B 5C0XG 4A3KG 5KG1A 4LFBQ 4N9PA 1O7LA 2EXZA 3MWMA 2ID0A 1B9NA 4JI5H 4R4IA 4K6DA 2IHEA 2VOBA 2G9HD 3EPIA 2RCNA 1QNUA 3P1HA 1EZ1A 4JYAH 1MKHA 4MN3A 3H0GB 3S2DH 3GIQA 4UCTA 4YHHH 3SEBA 2FMCA 1M90C 1PDQA 4DR2L 4DL2A 1F2ZA 5IT9L 4ED0A 4BXXG 1RYRA 1G6PA 2OCEA 1Y8PB 3S15H 3KDFB 3S9WA 4C3JB 1CQVA 4J15A 1ILPA 2NVYH 4HSVA 2RGVA 3KAJA 5KFKA 4DNRB 5BR8L 3MEFA 4CC5A 4LF4H 5KG6A 3NEMA 3GTKB 5L1LA 3R3OA 1KC7A 1N34Q 4GOPA 1ILQA 1R9TB 3GTLB 5ELNA 2RA4A 1UUPA 1VQDA 4RAUC 1CI3M 1I3QH 1PH7A 5DLGA 5FO9B 3HOYG 4DV2H 1HZAA 1I7NA 2JQOA 3H0GH 3U9SA 3Q2OA 5LHY1 1QILA 4QWCA 4OX9Q 1X3FA 4OEMB 2JEFA 2E2IB 1N32L 2WACA 2W6NA 5C44B 3L4KA 5IYDH 1I6VC 1SMYD 2W70A 3MTSA 1I4HA 2R7FA 2K7VA 2HDMA 3I4OA 1BNZA 1EU4A 2IW3A 4ECVA 2DY7A 3S16B 1W3SA 4GZYC 4GKJL 2BR0A 4BWSC 1RDPD 4DAPA 2W6OA 2ALZA 1I3QA 1AP0A 2B2YC 2K50A 2PNHA 2W9CB 3PZPA 2WB1G 2L0CA 3EBEA 2K5QA 3BYTB 4ZKCB 5HY6A 3OTOH 1SE4A 5DM73 3W5OA 1AE2A 1LT4D 1JLLB 1UC8A 3GIKA 5E3FA 1PRTF 5LL6b 3DWPA 4K0KL 4ZHQF 1PTOB 4IN3A 4LF4L 4JYAQ 2RHSB 4LFAL 3GQCA 3RZOH 2ZM6L 2F0EA 2F0PA 1PRTD 4KY5A 4X3TA 1DOMA 1KIXA 4DR6Q 1EUJA 5JEAG 5E7NA 5C0XH 1EQTA 5C44H 3J7AF 1I4PA 2NTSA 3EPGA 5EKKA 1F9QA 3UDXA 4B3ML 2JA7A 3BZKA 1MSHA 2L5TA 2JA9A 4UCSA 4OX9L 2R93B 4IZ8A 1TWFH 2M00A 2X6GA 5C4HA 3HOYH 2R84A 4XYOA 2NTTA 3TDQA 1WI5A 1E1TA 3I8ZA 3MEHA 4HTHA 2O5IC 1M7JA 2PI2A 3G6JB 3J7YW 2EYMA 3QZ7A 2YS7A 2PMZA 1A3UA 3RJ0A 1BQQT 4WORA 1SYBA 4E6IA 4JUZA 3VPCA 4A3GG 1DCZA 5M3MB 1KAAA 2Y0SG 2K4KA 2UUBH 2DJFC 1KJ8A 3AQQA 3PIPA 2ASBA 3LNNA 2PQAA 2R7LA 5C0XI 1NY4A 1S4ZA 2RBMA 3GTQH 4BBSH 2BQRA 3BU2A 4CJ1B 4L5QA 1I94H 5C0XJ 1CK1A 4A3FH 1D1IA 3KLRA 3WOFA 1EOVA 3G4SA 1S40A 5KFZA 4K2KA 2B2UC 3NP8A 3HOXG 4DR4L 3KHRA 3BDCA 3UI2A 1VQFA 1L0WA 2IWHA 1TWAA 2KEDA 3S1QB 2PN1A 4HNTA 4LFAH 5AJ3L 5ISRA 4A76A 4KHPL 2A6HD 5JJKA 1DOKA 3AEVA 2EPBA 3ULLA 2JA8H 1EU3A 1QZHA 1SXTA 3CQZB 4ECWA 4BXXH 3MJFA 3OPOA 5M3FG 3J80L 3Q8QB 4AQYH 4DR3H 3K0XA 1S9FA 2KJXA 2WAQG 5CV7A 2VQFH 2E2HB 4JI7Q 1N33H 3NQTA 5IY0A 4RZRA 1VDZA 2DNEA 1TWGB 2VB2X 4N8FA 3H15A 4N9TA 1M8AA 3HZXA 4PNYA 2IY5B 5EWFA 2IPKD 1QUQB 1YEZA 3FKIH 1IBKQ 5GAHC 2UVWA 4EG0A 2XGPA 2AKWB 3ETHA 3MXNB 3WOEA 4ZQIA 5M9OA 4UCVA 4X64H 2HT1A 3VPDA 2B2VC 5KFLA 5IYZF 4MA5A 1TR5A 4WJ4A 3RN2A 1FL0A 5J3BA 2K5DA 5EBDA 1RJTA 2E75C 3BQ1A 4C1NK 5EKLA 1Y1WG 1VAJA 4O1NA 1MSGA 1S5BD 3L4JA 1AN8A 4HIKA 3ONAB 5EJWA 5ELDA 2I5HA 4CBVA 1KEEA 1HQRD 1X55A 4QWDA 2DPJA 1Q8KA 1AZPA 3CCRA 1C7YA 4DV4Q 1YHAA 5JEAJ 2NU8B 3NENA 3K3VA 1QVGA 3E9IA 3JC66 4HIMA 3BJUA 4HYKA 1E2WA 1DV1A 3MA2B 5M5YH 4UY8C 2HCIA 1XMQQ 4AYBA 1TWGH 1VBHA 1IZ6A 3KUPA 1D5MC 1MBYA 1VQKA 2C2EA 5KT6A 4R8IA 3N6RA 2CKZB 1UE7A 1V4YA 3K5MA 4PQXA 3ND8A 2GA4B 3HKZE 5BN3A 4BBRB 4LWCA 1K1QA 3RFCA 4GN5A 4IZOA 3DHQA 3DUZA 4G7HC 5A35A 5KFIA 4EGJA 4PDBA 4KKTA 2AWNA 2ATWA 4OO1I 2CQYA 4HNUA 2HVRA 3E9HA 1EQQA 1VQHA 2CZGA 2JA5A 3HFZB 2UU9Q 1NBWA 5KKNB 1X3EA 4IUQA 3GTPA 5JEAH 3I56A 4CGYB 4JI0Q 4H0LC 3I4MB 1GD7A 1GGOA 4DAMA 3AFQA 3VYSA 2F0WA 3I4LA 3I70A 3T53B 3V96A 1H9SB 3J81i 5L1JA 2EYOA 1YNNC 2UVRA 2N55A 2W6QA 4FM9A 4OIKA 4LFCH 2H5XA 5FD6A 1V8QA 2EYPA 1EL0A 3OSOA 1K3RA 2JA5G 4X66Q 1OWTA 1I3QB 2VR1A 4LH6A 3UFXB 1A2TA 4RKLA 4BY1H 3HKSA 4DXFA 2NUCA 1PH2A 1CA6A 2J4XA 5KFCA 4JK1C 1TIID 2R92H 4KN4C 1PZJD 2M05A 2QDBA 4XTCS 4A3CG 5IWAH 3OYYA 4RAYA 2W71A 1HZBA 4JW0A 3A5ZB 3RMHA 3MWEA 1KLGD 5LA6F 3U4VA 3I7FA 4X66L 3BABA 1QUQA 4K5XA 4IFDG 4JI2Q 2KCMA 2LS01 2ZM6Q 3MR6A 3T1HQ 5TSSA 4Y52H 3MZ5A 4KV6A 2W9AA 3DEOA 3M4IA 1RJQA 3G6EA 5EPLA 2LY7A 2WIIB 4M1UB 4JI0L 1B33N 2J7ZA 3H3VC 4TVAB 4MTNA 1IBMQ 1I4RA 2NN6I 2AGQA 2Z0SA 1XX8A 1FVIA 1STGA 4R4CA 1CFMA 2MQHA 3CU7A 3L9AX 4DV6Q 1B50A 3HOVB 4Q44A 1X32A 3PN1A 2NBFA 2AGPA 4WJWA 2AQ3B 1EUCB 1HHVA 3GIPA 1HUMA 1QWYA 1SYGA 4HR7A 2V4QA 4F4YA 3SHLA 2RDHA 3Q8PB 4DR2H 4NXMQ 2B2WA 2JSOA 3SK8A 4X62L 4A3BG 3I2ZA 4QQBX 3KLSA 4A3LH 1IBLL 2R93H 2W6MA 1S97A 1YZ6A 1VQ6A 2FJZA 4C5CA 1EY9A 1RCVD 4IUPA 1EUDB 1VQJA 4HJ5A 4J8QA 2PVPA 4IO9A 2PO4A 4LF9H 5K5PA 3BYYB 2RDIA 1GUGA 1T3NA 2HIXA 4JV0A 2N3SA 4YB8B 3M4PA 1HXYD 4OIJA 2C5CA 4DAYA 1WSCA 1IBLQ 5I47A 3GTQB 5IGFA 3ULPA 1TWCA 4UFZA 3JZIA 4DL3A 4IPHA 3S1MH 5KX5F 2HQLA 2XWJB 2JA8G 1RTOA 1IBML 1W2BA 5EKIA 1YITA 2YS6A 1QOHA 3K80C 1RKNA 1ZKOA 1EIFA 4IUNA 2JA7B 1A63A 5CORA 2G9DA 3PCOB 2IX1A 2I80A 3ULJA 5BPFA 2JEAI 3ERSX 3GIDA 2B63H 4I7ZC 1F77A 5IP9G 1RF2D 4UCRA 4BY1G 4O3RA 4LF6L 2A19A 1XPOA 2NVQB 2R92A 4QWAA 4GKKQ 3CCEA 2P0AA 4IPCA 2W7OA 3CQZH 2AHOB 4POFA 4A3IB 1X56A 3S1RB 1AUXA 2R85A 1M1KC 2F0FA 5IYCH 5FK9C 5T1GA 3I3CA 4DAVA 4A2BA 1K0RA 5IYDG 2W6PA 1LTAD 2QDLA 5C3EG 2PNRC 5DG8A 1KBLA 5DGAA 4OWXB 1EQRA 2C2DA 1D7QA 1JR0D 4YQWA 3GO5A 1HZ9A 2HHHL 1AN7A 1XPRA 2YRWA 2HDLA 2FKLA 5EWEA 1FKAH 1JB3A 1N34H 2K5NA 3C2PA 1GUSA 2PBZA 3N40P 4MV3A 3HOZB 2FMMA 3VYTA 1XMQH 4A3MB 3M4OB 3DEPA 3EVQA 1HR0W 3P75A 4J9LA 2V4RA 4RGNA 1MI2A 4DNIA 2CWAA 2XNAC 4QW8A 4ZKBB 1KDAA 4V0BA 3S1NB 5JVLA 1ML0D 3J80W 2VUMA
chains in the Genus database with same CATH topology
1YI2A 4A3CH 1EIYB 2NVTH 1PYSB 4X65Q 4LF6Q 2LXJA 2ZTDA 1HNXL 2GVAA 1N33Q 4JI5Q 4IPGA 3K8AA 3PO3H 4BA1I 4GLXA 1Y1WH 4DR5L 2JJQA 1Q12A 4MZ9A 1WJJA 1VQCA 2ZTEA 3A5UA 4YWLA 3HOWH 2JA5H 2MNAA 3U58A 2VW9A 1OXTA 4DV4L 4DPGA 4H02A 1ASZA 5LMUL 4DV5L 1XJVA 1VS0A 2E5LQ 2XGTA 2CCZA 3I4NH 4GKKL 3KLWA 2CFMA 1UWVA 3J7ZC 4LF9Q 1LTLA 3HOVG 3J80c 1UE5A 1AE3A 2DUDA 1N32Q 4A3JH 4LF7L 2BA1A 2UXCL 1UE6A 3CC7A 1E3PA 3KF6B 1IBKL 2I0QA 2OWOA 5FLMH 1Q82C 1VQLA 2ES2A 2ALYB 3BZCA 1HH2P 4GKJQ 4PG3A 2E2HH 3S16H 1BBWA 1A0IA 4POGA 4UP9A 1VQ9A 1TWAH 1QZGA 4JCVE 1HNWL 4B3SL 1IXRA 2UUCL 5C0XG 1SMXA 4A3KG 4DV3L 4B3RL 1I5FA 4YHHL 4LFBQ 2UU9L 2YTXA 2ID0A 3CD6A 1B8AA 4BY7G 1JJCB 4R4IA 4LF7Q 3CC2A 2IHEA 3GD7A 2UXDL 1A8VA 4NB3A 4DV0L 2RCNA 2K5VA 1Z9FA 1MKHA 3CP0A 3S2DH 3UE1A 3S1RH 2E8GA 5IYCG 2QEXA 1M90C 4DR2L 2N8NA 1K8GA 3HOVH 4BXXG 1I94Q 4TQUS 1FJGQ 2OCEA 1G6PA 3KYHC 2NZHA 3S15H 1YJNA 3KDFB 3CCVA 3G71A 5M3MH 4Y7NH 4J15A 4B3TQ 4LF4Q 2NVYH 4P73A 4JYAL 1Q1BA 4LUZA 3AFPA 3RNUA 2EQSA 5BR8L 4C3JH 3MEFA 2D0PA 4PMWA 4GNXA 4A3BH 5IP7G 3GTOH 1XTDA 4GLVB 1SRUA 3RLNA 4QL5A 3NEMA 3M4OH 3I4MG 5LMUQ 4DV5Q 3FHWA 1N34Q 2E5LL 4GOPA 2UXCQ 3HOUH 1BBUA 1L2FA 1C9OA 4JOIA 5ELNA 5C44G 4B3MQ 1FJGL 2JA6H 1VQDA 4NXNQ 4IOAA 5K36G 1CKMA 4PZ8A 3CMAA 1I3QH 4BY7H 1PYBA 1PH7A 3M4QA 3PF5A 4YCUA 2UUCQ 2VQFL 5IYBG 5IP9H 3HOYG 1HZAA 2R93G 3RR5A 2JQOA 3H0GH 1VQGA 4X65L 4RG1A 2F52A 4AQYQ 4FDBA 4GN3B 4DK6C 4OX9Q 4UP8A 3CC4A 1X3FA 3LGJA 1WFQA 1N32L 3T1YL 3S1NH 4B3RQ 4LFBL 5IYDH 2F4VL 1TWCH 2R7FA 3I4OA 3U50C 5M3FH 2OTLA 3K7AH 1AH9A 1W3SA 3TREA 4GKJL 3TRZA 2WB1E 3KFUA 5LMNQ 3TQYA 4OWTB 4A3EH 3RZDH 1I94L 3M85A 1Q46A 2K50A 2PNHA 4EQ5A 3RN5A 2WB1G 3EBEA 2PI2E 4GLAC 1SFOH 1VQIA 3ZJYC 4LFCQ 1EFWA 5HY6A 1XMOL 4NXML 2YTYA 2YTVA 4KHZA 1VQBA 4IFDI 1VQAA 1E7ZA 3W5OA 1AE2A 1PH8A 4K0KL 1MJEA 2QGQA 4DUYQ 4B3TL 3M9BA 4LF4L 2RHSB 4LFAL 1OXVA 4JOIC 4GNXC 1OXUA 2Q2TA 4A3IH 2ZM6L 3RZOH 5IYBH 4HIDA 4A75A 4DR2Q 1X6OA 1V9PA 2I5LX 2OQ0A 4HIOA 1KIXA 4DR6Q 4IFDJ 3J81c 4QJFA 2CWPA 3KDFA 1EUJA 1VQEA 5JEAG 2K52A 5E7NA 5C44H 4DR3Q 4LW1A 4DV0Q 4JI6Q 3UDXA 4B3ML 3BZKA 4JI7L 1V1QA 2JA9A 3PIOA 4OX9L 1HZCA 2UUBL 1TWFH 1X54A 1VQ7A 3HOYH 3J7A5 1JJ2A 2JE6I 1HNZL 3KOJA 4BBRG 4BBRH 1WI5A 1E1TA 1VCIA 3NELA 1PH3A 2VQEQ 2PI2A 4O2DA 2RHQB 3CCMA 3RLFA 2BA0A 1YHBA 5EAYA 3J81j 3G48A 5GADC 1C0AA 4A3GG 1G291 4QY7A 2Y0SG 2K4KA 4DV2Q 1NJIC 1LUZA 3AQQA 3PIPA 2ASBA 4DR1Q 3ICEA 2PQAA 5C0XI 1NY4A 1PH9A 1XNRL 3GTQH 2F3IA 3CMEA 4BBSH 1VQOA 4X6AH 3BU2A 4L5QA 1CKOA 2I5MX 5C0XJ 3KF8B 1VQPA 4HJ7A 1T9HA 3F2BA 1PFSA 2D62A 2VQEL 4JG2A 4A3IG 1IYJB 4DR7Q 4A3FH 4A3LG 4A93H 3G4SA 4JI8Q 1EOVA 4DKAC 3OTOL 3T1YQ 2MO1A 1S40A 1UE1A 3UDFA 3EN2A 3HOXG 2NN6G 1G51A 4DR4L 1VQFA 1L0WA 3WWVA 2R7ZH 1B7YB 1I50H 1YNXA 2ZJPA 4DR1L 4OO1G 2N49A 4AQYL 2VUMH 5LMNL 2VUMG 5AJ3L 3S1QH 4YY3Q 4A76A 4KHPL 5JJKA 3KJPA 3AEVA 4DUYL 1L1OA 1PHJA 1K8AC 1Q86C 3CCQA 4DR7L 4JI6L 3S17H 3ULLA 2N78A 2F4VQ 2JA7G 2JA8H 3TS2A 3GTJH 1QZHA 3GTGH 3CCLA 5IWAQ 4BXXH 5M3FG 4AYBG 4LUOA 1KRTA 1O7IA 4HJ9A 1CSQA 1NTGA 3T1HL 3K0XA 1BVSA 2HHHQ 4K0KQ 1TXYA 4IJLA 5C3EH 1Y1VH 2WAQG 3A0JA 2AWOA 4R4TA 4AYBE 4L5SA 4JI7Q 4LF9L 3F1ZA 5IY0A 1E22A 3CPFA 5JJLA 4DUZQ 3H15A 2IY5B 1QUQB 2MO0A 4R4OA 1YEZA 3FKIH 3STBC 5IP7H 1IBKQ 4RMFA 5GAHC 1L1OB 2AKWB 1SN8A 3A74A 3MXNB 4JBKA 4YWMA 3CPWA 1WCMG 4PZ6A 2HT1A 3JAMi 1YBYA 2Q2UA 4BBSG 4PZ7A 2OTJA 2NVQH 4DR6L 1JT8A 4WJ4A 5DLQE 3RN2A 1FL0A 1K83H 1P8LA 5J3BA 2K5HA 1OXXK 1Y1WG 4DV7L 2Q2IA 1XPUA 1J5EQ 4HIKA 4JV5Q 2ZJQA 2I5HA 4LUVA 2PMZE 2OQKA 3PSIA 1X55A 4DR4Q 3STBD 2LSSA 3B6YA 1Q8KA 5C4XH 2Z6KC 3PF4A 3CCRA 1L1OC 1EWIA 4DV4Q 1KC8C 1C7YA 1YHAA 3PO2G 5JEAJ 2UUAQ 3NENA 1QVGA 3E9IA 3JC66 4HIMA 3BJUA 5GAEC 2B63G 3L2PA 2VZAA 5M5YH 4UY8C 3U4ZA 1XMQQ 1CUKA 1TWGH 1IZ6A 2Y0SE 1VQKA 2CKZB 1UE7A 1SR3A 5HGQA 4QGUA 4A3MG 4DV3Q 3FP9A 4A3MH 3HKZE 4DR3L 3SGIA 4C2MH 1IL2A 4LWCA 4JI1Q 4JI3L 5H1SE 1N8RC 4GN5A 4R4QA 5AJ3Q 1HNXQ 2MFIA 4HJAA 1YJWA 1N33L 2R7ZG 4A3DH 4BA2I 3K81C 1VQNA 5FJ8G 1HNZQ 2AWNA 2GVBA 1Q7YC 2ATWA 1YIJA 4OO1I 2YV5A 1TWHH 1XMQL 3E9HA 3CF5A 1EQQA 1VQHA 3HFZB 2UU9Q 1NBWA 2QA4A 4KI0A 1FGUA 1PV4A 1X3EA 3D31A 4DV6L 3I4MH 2IHFA 2VQFQ 3I56A 4JI0Q 1MIUA 3PUXA 1GD7A 4DAYB 3S14H 4DAMA 3AFQA 4YY3L 3HOWG 4KHPQ 1E1OA 5FLXc 4JBJA 1OXSC 2BH2A 3J81i 4A3GH 1J5EL 1MJCA 1V43A 3GDEA 3W1GA 3JAMc 2H5XA 1PH6A 1HJPA 5IWAL 2JA7H 3M3YH 1Y14B 2Z6KA 1NMGA 1WYDA 5C4JH 3M7NA 1K3RA 2JA5G 4X66Q 1Q1EA 5GROA 3PUVA 4BY1H 1HNWQ 3HKSA 1JE5A 2ZTCA 1Q81C 1PH2A 1LM0A 2K75A 3IRBA 1JMCA 1K73C 2R92H 3H0GG 3GTPH 4JYAQ 4LFCL 4XTCS 4A3CG 1GM5A 3OYYA 2KENA 4A3JG 1HZBA 4OXPA 3A5ZB 1N34L 5FJ8H 3F2DA 4L5RC 1YVCA 2IX0A 3U4VA 3RLOA 2WP8J 1RIPA 4JI1L 5LMNW 4DV1Q 2HIVA 4JI3Q 3I7FA 4X66L 2K14A 1PH5A 2IT1A 2L15A 3D0FA 1QUQA 2KHJA 1LYLA 3TS0A 1N36L 3PUZA 1KL9A 1B70B 4O0AA 4OONA 4MNOA 1VQMA 1S72A 2KCTA 4JI2Q 4IFDG 4UPAA 2KCMA 2ZM6Q 4XIGS 3T1HQ 2WFWA 4YCWA 2LXKA 1SROA 4X64Q 2A1AA 3H3VH 4Y52H 3CCUA 4GN4B 1VQ4A 3J80i 2A8VA 3G6EA 1BKBA 1X3GA 3CW2C 4EX5A 4DV7Q 4YWKA 3CCJA 4LF8Q 4JI0L 2UXBQ 3DLLA 3PUYA 4TVAB 1D8LA 1Y1VG 1WOCA 4MTNA 1KQSA 1IBMQ 2NN6I 2Z0SA 4QIWE 3DM3A 1OTCA 1FVIA 2JA6G 4R4CA 2MQHA 3Q8DA 4GNXB 3UDGA 2UUBQ 3UE0A 4DV6Q 2FXQA 1VQ5A 5C4XG 1XNQL 4UP7A 3I4NG 2XTIA 4X64L 2ZJRA 4JBWA 4GOPC 5FLMG 4C3HH 2BH8A 3S2HH 4GS3A 2B29A 3H3VI 4LF8L 4GOPB 1XMOQ 4NXMQ 2PQAB 1YJ9A 3AYHB 3E0EA 1JJGA 4X62L 4A3BG 3I2ZA 1CKNA 3L7ZC 4QQBX 4A3FG 4JV5L 1IBLL 4A3LH 3F8TA 2R93H 4R1JA 3L0OA 2JK8A 1RL2A 2NZOA 1PVOA 2EIFA 4IOCA 1NE3A 1K9MC 4JI4Q 1XNQQ 1YZ6A 1P16A 1VQ6A 1S3OA 2GN5A 4P74A 4LFAQ 5M5WH 5JJIA 4A93G 1VQJA 4HJ5A 1QVFA 4WJ3M 3GTKH 3KF6A 4DR5Q 4KLKA 4JI8L 1N9WA 3OTOQ 2UUAL 4IO9A 1U0LA 2YU9H 1X9NA 1H95A 3OW2A 1J6QA 4P72A 4JBMA 2HIXA 1EYGA 5IE8A 2N3SA 2VS1A 1QVCA 3HKZG 3M4PA 1HR0L 1IBLQ 1X65A 3NBHB 4ME3A 3ULPA 1A62A 4JI5L 4P75A 2E2JH 4IPHA 1GO3E 2EXDA 4DK3C 5GAGC 3CCSA 3S1MH 1Z47A 2HQLA 2R7DA 3PV0A 4JC0A 4DV2L 3VDYA 2JA8G 1IBML 1W2BA 1YITA 3F2CA 3K80C 1EIFA 3HOUG 1A63A 2R92G 3PCOB 1JB7A 1ASYA 2IX1A 3ULJA 2UXBL 2JEAI 2AMCB 3ERSX 3PGZA 3S24A 2B63H 1KXLA 1HR0Q 1CSPA 2JEBI 4OWWB 2R6GA 5IP9G 4AH6A 1PA6A 4BY1G 1KD1C 4AIMA 3EIVA 4LF6L 4DUZL 2VNUD 2V1CC 5BR8Q 2A19A 1XPOA 1E24A 3FKIG 4GKKQ 2DGYA 3CCEA 4DV1L 2KBNA 4IPCA 3CQZH 1KRSA 1GVPA 2AHOB 3GTMH 1I6HH 4POFA 3CAMA 2C35B 3W1BA 3CXCA 1X56A 4LF5Q 1M1KC 2KHIA 4C3IH 5IYCH 1NMFA 2RF4A 5GQOA 4JI2L 3PO3G 3PUWA 4LNQA 3UDIA 1YHQA 1K0RA 5M5XH 5IYDG 2NVXH 2WAQE 5C3EG 4L5TA 1KHIA 4OWXB 1EQRA 1D7QA 1KAWA 4JI4L 1SE8A 5M3MG 3GO5A 2UXDQ 1HZ9A 2HHHL 1DGSA 1CKNB 2Q2HA 1R9TH 1XPRA 1VQ8A 4IJHA 3GTLH 4A3EG 2VL6A 4HJ8A 3PO2H 2K5NA 3K7UC 5ELOA 4APVA 1XNRQ 4YHHQ 4LF5L 4A4IA 4A3KH 2D0OA 1PH1A 1N36Q 4NPSA 1UEBA 3HOZG 2CQOA 3HOZH 2B3GA 4B3SQ 1HR0W 1SLJA 1PH4A 2VY3A 4DNIA 2CWAA 4NXNL 2YYZA 2E2IH 3KJOA 1GKHA 5IT9c 3HOXH 4ALPA 1U5KA 4IPDA 4P71A 3TEHB 4A3DG 4X62Q 3ER0A 3I55A 1WCMH 4YCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 A;  4A3C H;  1EIY B;  2NVT H;  1PYS B;  4X65 Q;  4LF6 Q;  2LXJ A;  2ZTD A;  1HNX L;  2GVA A;  1N33 Q;  4JI5 Q;  4IPG A;  3K8A A;  3PO3 H;  4BA1 I;  4GLX A;  1Y1W H;  4DR5 L;  2JJQ A;  1Q12 A;  4MZ9 A;  1WJJ A;  1VQC A;  2ZTE A;  3A5U A;  4YWL A;  3HOW H;  2JA5 H;  2MNA A;  3U58 A;  2VW9 A;  1OXT A;  4DV4 L;  4DPG A;  4H02 A;  1ASZ A;  5LMU L;  4DV5 L;  1XJV A;  1VS0 A;  2E5L Q;  2XGT A;  2CCZ A;  3I4N H;  4GKK L;  3KLW A;  2CFM A;  1UWV A;  3J7Z C;  4LF9 Q;  1LTL A;  3HOV G;  3J80 c;  1UE5 A;  1AE3 A;  2DUD A;  1N32 Q;  4A3J H;  4LF7 L;  2BA1 A;  2UXC L;  1UE6 A;  3CC7 A;  1E3P A;  3KF6 B;  1IBK L;  2I0Q A;  2OWO A;  5FLM H;  1Q82 C;  1VQL A;  2ES2 A;  2ALY B;  3BZC A;  1HH2 P;  4GKJ Q;  4PG3 A;  2E2H H;  3S16 H;  1BBW A;  1A0I A;  4POG A;  4UP9 A;  1VQ9 A;  1TWA H;  1QZG A;  4JCV E;  1HNW L;  4B3S L;  1IXR A;  2UUC L;  5C0X G;  1SMX A;  4A3K G;  4DV3 L;  4B3R L;  1I5F A;  4YHH L;  4LFB Q;  2UU9 L;  2YTX A;  2ID0 A;  3CD6 A;  1B8A A;  4BY7 G;  1JJC B;  4R4I A;  4LF7 Q;  3CC2 A;  2IHE A;  3GD7 A;  2UXD L;  1A8V A;  4NB3 A;  4DV0 L;  2RCN A;  2K5V A;  1Z9F A;  1MKH A;  3CP0 A;  3S2D H;  3UE1 A;  3S1R H;  2E8G A;  5IYC G;  2QEX A;  1M90 C;  4DR2 L;  2N8N A;  1K8G A;  3HOV H;  4BXX G;  1I94 Q;  4TQU S;  1FJG Q;  2OCE A;  1G6P A;  3KYH C;  2NZH A;  3S15 H;  1YJN A;  3KDF B;  3CCV A;  3G71 A;  5M3M H;  4Y7N H;  4J15 A;  4B3T Q;  4LF4 Q;  2NVY H;  4P73 A;  4JYA L;  1Q1B A;  4LUZ A;  3AFP A;  3RNU A;  2EQS A;  5BR8 L;  4C3J H;  3MEF A;  2D0P A;  4PMW A;  4GNX A;  4A3B H;  5IP7 G;  3GTO H;  1XTD A;  4GLV B;  1SRU A;  3RLN A;  4QL5 A;  3NEM A;  3M4O H;  3I4M G;  5LMU Q;  4DV5 Q;  3FHW A;  1N34 Q;  2E5L L;  4GOP A;  2UXC Q;  3HOU H;  1BBU A;  1L2F A;  1C9O A;  4JOI A;  5ELN A;  5C44 G;  4B3M Q;  1FJG L;  2JA6 H;  1VQD A;  4NXN Q;  4IOA A;  5K36 G;  1CKM A;  4PZ8 A;  3CMA A;  1I3Q H;  4BY7 H;  1PYB A;  1PH7 A;  3M4Q A;  3PF5 A;  4YCU A;  2UUC Q;  2VQF L;  5IYB G;  5IP9 H;  3HOY G;  1HZA A;  2R93 G;  3RR5 A;  2JQO A;  3H0G H;  1VQG A;  4X65 L;  4RG1 A;  2F52 A;  4AQY Q;  4FDB A;  4GN3 B;  4DK6 C;  4OX9 Q;  4UP8 A;  3CC4 A;  1X3F A;  3LGJ A;  1WFQ A;  1N32 L;  3T1Y L;  3S1N H;  4B3R Q;  4LFB L;  5IYD H;  2F4V L;  1TWC H;  2R7F A;  3I4O A;  3U50 C;  5M3F H;  2OTL A;  3K7A H;  1AH9 A;  1W3S A;  3TRE A;  4GKJ L;  3TRZ A;  2WB1 E;  3KFU A;  5LMN Q;  3TQY A;  4OWT B;  4A3E H;  3RZD H;  1I94 L;  3M85 A;  1Q46 A;  2K50 A;  2PNH A;  4EQ5 A;  3RN5 A;  2WB1 G;  3EBE A;  2PI2 E;  4GLA C;  1SFO H;  1VQI A;  3ZJY C;  4LFC Q;  1EFW A;  5HY6 A;  1XMO L;  4NXM L;  2YTY A;  2YTV A;  4KHZ A;  1VQB A;  4IFD I;  1VQA A;  1E7Z A;  3W5O A;  1AE2 A;  1PH8 A;  4K0K L;  1MJE A;  2QGQ A;  4DUY Q;  4B3T L;  3M9B A;  4LF4 L;  2RHS B;  4LFA L;  1OXV A;  4JOI C;  4GNX C;  1OXU A;  2Q2T A;  4A3I H;  2ZM6 L;  3RZO H;  5IYB H;  4HID A;  4A75 A;  4DR2 Q;  1X6O A;  1V9P A;  2I5L X;  2OQ0 A;  4HIO A;  1KIX A;  4DR6 Q;  4IFD J;  3J81 c;  4QJF A;  2CWP A;  3KDF A;  1EUJ A;  1VQE A;  5JEA G;  2K52 A;  5E7N A;  5C44 H;  4DR3 Q;  4LW1 A;  4DV0 Q;  4JI6 Q;  3UDX A;  4B3M L;  3BZK A;  4JI7 L;  1V1Q A;  2JA9 A;  3PIO A;  4OX9 L;  1HZC A;  2UUB L;  1TWF H;  1X54 A;  1VQ7 A;  3HOY H;  3J7A 5;  1JJ2 A;  2JE6 I;  1HNZ L;  3KOJ A;  4BBR G;  4BBR H;  1WI5 A;  1E1T A;  1VCI A;  3NEL A;  1PH3 A;  2VQE Q;  2PI2 A;  4O2D A;  2RHQ B;  3CCM A;  3RLF A;  2BA0 A;  1YHB A;  5EAY A;  3J81 j;  3G48 A;  5GAD C;  1C0A A;  4A3G G;  1G29 1;  4QY7 A;  2Y0S G;  2K4K A;  4DV2 Q;  1NJI C;  1LUZ A;  3AQQ A;  3PIP A;  2ASB A;  4DR1 Q;  3ICE A;  2PQA A;  5C0X I;  1NY4 A;  1PH9 A;  1XNR L;  3GTQ H;  2F3I A;  3CME A;  4BBS H;  1VQO A;  4X6A H;  3BU2 A;  4L5Q A;  1CKO A;  2I5M X;  5C0X J;  3KF8 B;  1VQP A;  4HJ7 A;  1T9H A;  3F2B A;  1PFS A;  2D62 A;  2VQE L;  4JG2 A;  4A3I G;  1IYJ B;  4DR7 Q;  4A3F H;  4A3L G;  4A93 H;  3G4S A;  4JI8 Q;  1EOV A;  4DKA C;  3OTO L;  3T1Y Q;  2MO1 A;  1S40 A;  1UE1 A;  3UDF A;  3EN2 A;  3HOX G;  2NN6 G;  1G51 A;  4DR4 L;  1VQF A;  1L0W A;  3WWV A;  2R7Z H;  1B7Y B;  1I50 H;  1YNX A;  2ZJP A;  4DR1 L;  4OO1 G;  2N49 A;  4AQY L;  2VUM H;  5LMN L;  2VUM G;  5AJ3 L;  3S1Q H;  4YY3 Q;  4A76 A;  4KHP L;  5JJK A;  3KJP A;  3AEV A;  4DUY L;  1L1O A;  1PHJ A;  1K8A C;  1Q86 C;  3CCQ A;  4DR7 L;  4JI6 L;  3S17 H;  3ULL A;  2N78 A;  2F4V Q;  2JA7 G;  2JA8 H;  3TS2 A;  3GTJ H;  1QZH A;  3GTG H;  3CCL A;  5IWA Q;  4BXX H;  5M3F G;  4AYB G;  4LUO A;  1KRT A;  1O7I A;  4HJ9 A;  1CSQ A;  1NTG A;  3T1H L;  3K0X A;  1BVS A;  2HHH Q;  4K0K Q;  1TXY A;  4IJL A;  5C3E H;  1Y1V H;  2WAQ G;  3A0J A;  2AWO A;  4R4T A;  4AYB E;  4L5S A;  4JI7 Q;  4LF9 L;  3F1Z A;  5IY0 A;  1E22 A;  3CPF A;  5JJL A;  4DUZ Q;  3H15 A;  2IY5 B;  1QUQ B;  2MO0 A;  4R4O A;  1YEZ A;  3FKI H;  3STB C;  5IP7 H;  1IBK Q;  4RMF A;  5GAH C;  1L1O B;  2AKW B;  1SN8 A;  3A74 A;  3MXN B;  4JBK A;  4YWM A;  3CPW A;  1WCM G;  4PZ6 A;  2HT1 A;  3JAM i;  1YBY A;  2Q2U A;  4BBS G;  4PZ7 A;  2OTJ A;  2NVQ H;  4DR6 L;  1JT8 A;  4WJ4 A;  5DLQ E;  3RN2 A;  1FL0 A;  1K83 H;  1P8L A;  5J3B A;  2K5H A;  1OXX K;  1Y1W G;  4DV7 L;  2Q2I A;  1XPU A;  1J5E Q;  4HIK A;  4JV5 Q;  2ZJQ A;  2I5H A;  4LUV A;  2PMZ E;  2OQK A;  3PSI A;  1X55 A;  4DR4 Q;  3STB D;  2LSS A;  3B6Y A;  1Q8K A;  5C4X H;  2Z6K C;  3PF4 A;  3CCR A;  1L1O C;  1EWI A;  4DV4 Q;  1KC8 C;  1C7Y A;  1YHA A;  3PO2 G;  5JEA J;  2UUA Q;  3NEN A;  1QVG A;  3E9I A;  3JC6 6;  4HIM A;  3BJU A;  5GAE C;  2B63 G;  3L2P A;  2VZA A;  5M5Y H;  4UY8 C;  3U4Z A;  1XMQ Q;  1CUK A;  1TWG H;  1IZ6 A;  2Y0S E;  1VQK A;  2CKZ B;  1UE7 A;  1SR3 A;  5HGQ A;  4QGU A;  4A3M G;  4DV3 Q;  3FP9 A;  4A3M H;  3HKZ E;  4DR3 L;  3SGI A;  4C2M H;  1IL2 A;  4LWC A;  4JI1 Q;  4JI3 L;  5H1S E;  1N8R C;  4GN5 A;  4R4Q A;  5AJ3 Q;  1HNX Q;  2MFI A;  4HJA A;  1YJW A;  1N33 L;  2R7Z G;  4A3D H;  4BA2 I;  3K81 C;  1VQN A;  5FJ8 G;  1HNZ Q;  2AWN A;  2GVB A;  1Q7Y C;  2ATW A;  1YIJ A;  4OO1 I;  2YV5 A;  1TWH H;  1XMQ L;  3E9H A;  3CF5 A;  1EQQ A;  1VQH A;  3HFZ B;  2UU9 Q;  1NBW A;  2QA4 A;  4KI0 A;  1FGU A;  1PV4 A;  1X3E A;  3D31 A;  4DV6 L;  3I4M H;  2IHF A;  2VQF Q;  3I56 A;  4JI0 Q;  1MIU A;  3PUX A;  1GD7 A;  4DAY B;  3S14 H;  4DAM A;  3AFQ A;  4YY3 L;  3HOW G;  4KHP Q;  1E1O A;  5FLX c;  4JBJ A;  1OXS C;  2BH2 A;  3J81 i;  4A3G H;  1J5E L;  1MJC A;  1V43 A;  3GDE A;  3W1G A;  3JAM c;  2H5X A;  1PH6 A;  1HJP A;  5IWA L;  2JA7 H;  3M3Y H;  1Y14 B;  2Z6K A;  1NMG A;  1WYD A;  5C4J H;  3M7N A;  1K3R A;  2JA5 G;  4X66 Q;  1Q1E A;  5GRO A;  3PUV A;  4BY1 H;  1HNW Q;  3HKS A;  1JE5 A;  2ZTC A;  1Q81 C;  1PH2 A;  1LM0 A;  2K75 A;  3IRB A;  1JMC A;  1K73 C;  2R92 H;  3H0G G;  3GTP H;  4JYA Q;  4LFC L;  4XTC S;  4A3C G;  1GM5 A;  3OYY A;  2KEN A;  4A3J G;  1HZB A;  4OXP A;  3A5Z B;  1N34 L;  5FJ8 H;  3F2D A;  4L5R C;  1YVC A;  2IX0 A;  3U4V A;  3RLO A;  2WP8 J;  1RIP A;  4JI1 L;  5LMN W;  4DV1 Q;  2HIV A;  4JI3 Q;  3I7F A;  4X66 L;  2K14 A;  1PH5 A;  2IT1 A;  2L15 A;  3D0F A;  1QUQ A;  2KHJ A;  1LYL A;  3TS0 A;  1N36 L;  3PUZ A;  1KL9 A;  1B70 B;  4O0A A;  4OON A;  4MNO A;  1VQM A;  1S72 A;  2KCT A;  4JI2 Q;  4IFD G;  4UPA A;  2KCM A;  2ZM6 Q;  4XIG S;  3T1H Q;  2WFW A;  4YCW A;  2LXK A;  1SRO A;  4X64 Q;  2A1A A;  3H3V H;  4Y52 H;  3CCU A;  4GN4 B;  1VQ4 A;  3J80 i;  2A8V A;  3G6E A;  1BKB A;  1X3G A;  3CW2 C;  4EX5 A;  4DV7 Q;  4YWK A;  3CCJ A;  4LF8 Q;  4JI0 L;  2UXB Q;  3DLL A;  3PUY A;  4TVA B;  1D8L A;  1Y1V G;  1WOC A;  4MTN A;  1KQS A;  1IBM Q;  2NN6 I;  2Z0S A;  4QIW E;  3DM3 A;  1OTC A;  1FVI A;  2JA6 G;  4R4C A;  2MQH A;  3Q8D A;  4GNX B;  3UDG A;  2UUB Q;  3UE0 A;  4DV6 Q;  2FXQ A;  1VQ5 A;  5C4X G;  1XNQ L;  4UP7 A;  3I4N G;  2XTI A;  4X64 L;  2ZJR A;  4JBW A;  4GOP C;  5FLM G;  4C3H H;  2BH8 A;  3S2H H;  4GS3 A;  2B29 A;  3H3V I;  4LF8 L;  4GOP B;  1XMO Q;  4NXM Q;  2PQA B;  1YJ9 A;  3AYH B;  3E0E A;  1JJG A;  4X62 L;  4A3B G;  3I2Z A;  1CKN A;  3L7Z C;  4QQB X;  4A3F G;  4JV5 L;  1IBL L;  4A3L H;  3F8T A;  2R93 H;  4R1J A;  3L0O A;  2JK8 A;  1RL2 A;  2NZO A;  1PVO A;  2EIF A;  4IOC A;  1NE3 A;  1K9M C;  4JI4 Q;  1XNQ Q;  1YZ6 A;  1P16 A;  1VQ6 A;  1S3O A;  2GN5 A;  4P74 A;  4LFA Q;  5M5W H;  5JJI A;  4A93 G;  1VQJ A;  4HJ5 A;  1QVF A;  4WJ3 M;  3GTK H;  3KF6 A;  4DR5 Q;  4KLK A;  4JI8 L;  1N9W A;  3OTO Q;  2UUA L;  4IO9 A;  1U0L A;  2YU9 H;  1X9N A;  1H95 A;  3OW2 A;  1J6Q A;  4P72 A;  4JBM A;  2HIX A;  1EYG A;  5IE8 A;  2N3S A;  2VS1 A;  1QVC A;  3HKZ G;  3M4P A;  1HR0 L;  1IBL Q;  1X65 A;  3NBH B;  4ME3 A;  3ULP A;  1A62 A;  4JI5 L;  4P75 A;  2E2J H;  4IPH A;  1GO3 E;  2EXD A;  4DK3 C;  5GAG C;  3CCS A;  3S1M H;  1Z47 A;  2HQL A;  2R7D A;  3PV0 A;  4JC0 A;  4DV2 L;  3VDY A;  2JA8 G;  1IBM L;  1W2B A;  1YIT A;  3F2C A;  3K80 C;  1EIF A;  3HOU G;  1A63 A;  2R92 G;  3PCO B;  1JB7 A;  1ASY A;  2IX1 A;  3ULJ A;  2UXB L;  2JEA I;  2AMC B;  3ERS X;  3PGZ A;  3S24 A;  2B63 H;  1KXL A;  1HR0 Q;  1CSP A;  2JEB I;  4OWW B;  2R6G A;  5IP9 G;  4AH6 A;  1PA6 A;  4BY1 G;  1KD1 C;  4AIM A;  3EIV A;  4LF6 L;  4DUZ L;  2VNU D;  2V1C C;  5BR8 Q;  2A19 A;  1XPO A;  1E24 A;  3FKI G;  4GKK Q;  2DGY A;  3CCE A;  4DV1 L;  2KBN A;  4IPC A;  3CQZ H;  1KRS A;  1GVP A;  2AHO B;  3GTM H;  1I6H H;  4POF A;  3CAM A;  2C35 B;  3W1B A;  3CXC A;  1X56 A;  4LF5 Q;  1M1K C;  2KHI A;  4C3I H;  5IYC H;  1NMF A;  2RF4 A;  5GQO A;  4JI2 L;  3PO3 G;  3PUW A;  4LNQ A;  3UDI A;  1YHQ A;  1K0R A;  5M5X H;  5IYD G;  2NVX H;  2WAQ E;  5C3E G;  4L5T A;  1KHI A;  4OWX B;  1EQR A;  1D7Q A;  1KAW A;  4JI4 L;  1SE8 A;  5M3M G;  3GO5 A;  2UXD Q;  1HZ9 A;  2HHH L;  1DGS A;  1CKN B;  2Q2H A;  1R9T H;  1XPR A;  1VQ8 A;  4IJH A;  3GTL H;  4A3E G;  2VL6 A;  4HJ8 A;  3PO2 H;  2K5N A;  3K7U C;  5ELO A;  4APV A;  1XNR Q;  4YHH Q;  4LF5 L;  4A4I A;  4A3K H;  2D0O A;  1PH1 A;  1N36 Q;  4NPS A;  1UEB A;  3HOZ G;  2CQO A;  3HOZ H;  2B3G A;  4B3S Q;  1HR0 W;  1SLJ A;  1PH4 A;  2VY3 A;  4DNI A;  2CWA A;  4NXN L;  2YYZ A;  2E2I H;  3KJO A;  1GKH A;  5IT9 c;  3HOX H;  4ALP A;  1U5K A;  4IPD A;  4P71 A;  3TEH B;  4A3D G;  4X62 Q;  3ER0 A;  3I55 A;  1WCM H;  4YCV A; 
#chains in the Genus database with same CATH topology
 4A3C H;  1EZ8 A;  1EIY B;  2FPP B;  1R9T A;  4LF6 Q;  4X65 Q;  3PO3 B;  3GTL A;  2GVA A;  4JI5 Q;  4BA1 I;  2ZXO A;  1EQV A;  1WJJ A;  1VQC A;  2ZTE A;  1D1K A;  1RHP A;  3JAM W;  5LOV F;  3HOW H;  2O2L D;  4B9W A;  2JA5 H;  4RNN A;  1GYF A;  3W2D A;  4DV4 L;  4H02 A;  1ASZ A;  2E5L Q;  3I4N H;  2XGT A;  4TRD A;  3URY A;  4ZK9 B;  1DXM A;  2CFM A;  3HOV G;  5M5W B;  1HNW H;  2QCP X;  1UE5 A;  4X66 H;  1N32 Q;  1EIG A;  2OEO A;  4MA0 A;  1N36 H;  4NW2 A;  4A3J H;  2UXC L;  4EGQ A;  2WB1 A;  2OWO A;  2HHH H;  3BVM A;  5FLM H;  4GC7 A;  4GKK H;  3BZC A;  3KF8 A;  5KNB A;  3S16 H;  1BBW A;  1ZET A;  4POG A;  2HJW A;  1HNW L;  1QZG A;  1LT3 D;  4B08 A;  4QIW B;  2UUC L;  4DV3 L;  4XX0 B;  2C22 A;  4EFB A;  1IYV A;  1RK5 A;  1LTB D;  3MFY A;  3OWF A;  4BY7 G;  1JJC B;  4IAJ A;  3QB3 A;  3CC2 A;  4PWQ A;  2C28 A;  2B8F A;  4UAI A;  1CA5 A;  2AQ2 B;  3CP0 A;  1PXU A;  4ILW A;  4WD3 A;  5D3I B;  1EZ6 A;  4LF8 H;  2QEX A;  3V05 A;  3SK4 A;  3RZO B;  3E5N A;  5D1O A;  2XGQ A;  1I4G A;  2KVM A;  3S2H B;  1FJG Q;  3KYH C;  1YJN A;  3CCV A;  2OXP A;  4Y7N H;  4P73 A;  1Q1B A;  2UVV A;  3AFP A;  1S0M A;  2EQS A;  1LAB A;  2D0P A;  5L37 A;  4A3B H;  2I8C A;  3GTO H;  1XTD A;  2A5H A;  5DAU A;  1CQI B;  3I4M G;  2UXC Q;  4CDF C;  3HOU H;  5HUR A;  4R9W A;  5KFO A;  1RK6 A;  4B3M Q;  2JA6 H;  3J7A V;  1S5D D;  4NXN Q;  1CKM A;  3PR4 A;  3R8B A;  2SEB D;  4BY7 H;  4G7Z C;  1C8C A;  3KAL A;  1JOO A;  3A8I E;  4YCU A;  2UUC Q;  2VQF L;  1FNU A;  5I9P A;  5IP9 H;  5IYB G;  3PMF A;  5J2U F;  3GTK A;  3KBG A;  1EY0 A;  2F52 A;  1STB A;  1STN A;  4RGM A;  2XRQ D;  2MGS A;  3BS1 A;  1M4V A;  1K0S A;  4F50 A;  1SNC A;  4B3R Q;  5CYU A;  3MXG A;  2F4V L;  4JI3 H;  4JV2 A;  5J2T F;  1PYW D;  4X3K A;  5M3F H;  2DZD A;  2UXD H;  4CKC A;  3QR8 A;  4IHJ F;  3W3A A;  1TWA B;  3TRE A;  3TRZ A;  4HSP A;  2WB1 E;  4DUZ H;  4A3B B;  3PR5 B;  5JVG 3;  4ED3 A;  4A3E H;  3FMC A;  3RZD H;  1I94 L;  2P5Z X;  1IHZ A;  4EQ5 A;  3GTO B;  5L1I A;  1SE3 A;  3R5X A;  2YTY A;  3FDS A;  2YTV A;  4KHZ A;  4CJ0 B;  1VQA A;  1N56 A;  3RBD A;  4R8U B;  4J1M A;  1PRT B;  5KG0 A;  2QGQ A;  4DUY Q;  4B3T L;  4JI7 H;  1NAP A;  1OXU A;  1CTM A;  1K28 A;  2KA7 A;  3DMU A;  5IYB H;  4FF2 A;  2XCA A;  3VR2 A;  1STY A;  4A75 A;  1GXD C;  3JRX A;  1NR4 A;  3H4D A;  2OQ0 A;  3H40 A;  3MHB A;  4HIO A;  1AW7 A;  5M5X B;  4IFD J;  2JEG A;  2F3W A;  5KFH A;  1VQE A;  5CMD A;  2F0L A;  2HGS A;  5KG3 A;  1ROD A;  4DR3 Q;  4LW1 A;  1CHQ D;  4DV0 Q;  5C1P A;  4JI6 Q;  1E4E B;  3WO0 A;  1WR2 A;  5CBE E;  1V1Q A;  3PIO A;  4YAK B;  4L8J A;  2C2R A;  4UHV A;  2HD3 A;  1RD9 D;  3H91 A;  1VQ7 A;  1ESF A;  1JJ2 A;  2JE6 I;  1V1P A;  2VPS A;  4LK1 C;  3NEL A;  3NBH A;  3EQL C;  3SDZ A;  5KIX A;  4O2D A;  4DV3 H;  3RLF A;  4ECR A;  1AUV A;  3GTJ B;  1ZHQ A;  1G29 1;  4QY7 A;  2YRX A;  1TS3 A;  4DV2 Q;  2NVY B;  4KJO A;  3J81 W;  4DR1 Q;  4KN7 C;  1PH9 A;  3TN2 A;  2B2V A;  2VXW A;  2MHV A;  2NWG A;  3RUP A;  4X6A H;  3GTJ A;  1J5E H;  5CBA E;  3S14 B;  3KF8 B;  4PV1 C;  3X3N A;  3Q23 A;  1JDB B;  4HJ7 A;  1EY4 A;  1PFS A;  4IUV A;  2W57 A;  5D1P A;  4HED A;  2VQD A;  3VA7 A;  4KHV A;  4A93 H;  3M9N B;  3OTO L;  2DJG C;  4DKA C;  4MTE A;  2MO1 A;  4RB1 A;  4JI6 H;  2NN6 G;  1I50 B;  3TQ1 A;  3WWV A;  3MWD A;  1B7Y B;  1I4X A;  4DR1 L;  3KHL A;  1WD0 A;  2VUM H;  2VUM G;  5ELE A;  4XZ3 B;  5BR8 H;  4YY3 Q;  1B04 A;  3OHA A;  3KJP A;  5KFT A;  1L1O A;  1K8A C;  3CCQ A;  4EQP A;  2K6A A;  4JI6 L;  2N78 A;  2E5L H;  4NDX A;  5KFB A;  4DXG A;  3TS2 A;  4ED6 A;  3GTJ H;  3GTG H;  3MFI A;  4B3R H;  1S0N A;  4I4T F;  4LUO A;  3LX0 A;  1KRT A;  4C5B A;  2BDO A;  1NTG A;  2K01 A;  5E4X A;  2Z6B A;  1TXY A;  4JPB W;  1Y1V H;  3A0J A;  3ORR A;  2AWO A;  1JWS D;  3K5H A;  5KFU A;  1XTC D;  3CPF A;  2K5W A;  5CV9 A;  1XWE A;  1PFB A;  2MO0 A;  3IFT A;  1F9R A;  1B4O A;  5IP7 H;  4EYH B;  3GQB A;  4LFB H;  5C5J A;  4DV7 H;  2CQA A;  3R5F A;  2VUG A;  1L1O B;  5C4Z A;  5F9N A;  3CPW A;  2XC9 A;  5CV5 A;  4J0M A;  4KD3 A;  1SYE A;  4BBS G;  2WYO A;  2OF1 A;  3MAQ A;  4DR6 L;  3K3P A;  2V59 A;  3RF2 A;  5CA0 F;  1HA6 A;  1K83 H;  1YNJ C;  3NPP A;  3G8C A;  3GTM B;  4DV7 L;  2ASL A;  2Q2I A;  1XPU A;  4LJZ C;  4ZYS A;  1QE6 A;  2ZJQ A;  3FMA A;  2IMW P;  2NYZ D;  4FXK C;  3STB D;  2LSS A;  3EFX D;  4DR4 Q;  4F88 A;  2YW2 A;  1LO5 D;  2Z6K C;  3OMG A;  5KFX A;  2X0S A;  4IR9 A;  1L1O C;  1EWI A;  1XDN A;  2EYF A;  2RSN A;  2J6T A;  5D3D A;  4IRK A;  3VR6 A;  4DF7 A;  5GAE C;  3EYY A;  1QCB D;  5K36 H;  2Y0S E;  1C3O A;  3VR4 A;  5F2D A;  2QK4 A;  4XYM B;  2YYA A;  2WAQ B;  4Q8F A;  2OT2 A;  3PW5 A;  3OHX C;  4JI3 L;  1TAE A;  3TP5 A;  4RUC A;  4ECY A;  2MFI A;  4HJA A;  1YJW A;  4CJ2 C;  1N33 L;  1SJH D;  2R7Z G;  2K33 A;  3K81 C;  2M9V A;  1VQN A;  4F4W A;  4GKJ H;  3D4W A;  1HNZ Q;  1UNN C;  1EY5 A;  3LP8 A;  2AGO A;  3A56 A;  1X3Q A;  1FGU A;  4KI0 A;  1TWC B;  1GUW A;  2VQF Q;  2B2T A;  4DAY B;  4K6L A;  3VYR A;  1E1O A;  4A3F B;  1OXS C;  4EBE A;  1MJC A;  1B2T A;  3GDE A;  3JRW A;  4QIW A;  2MPM A;  3JAM c;  2H4O A;  4ZI7 F;  1PH6 A;  5FLX E;  5ELF A;  3LWB A;  5C4J H;  3M7N A;  4IRC A;  4J9Q A;  1BXT A;  2XSC A;  1SSO A;  1HFG A;  4DK1 A;  4DR5 H;  3M7G A;  2K75 A;  3GLK A;  2Y0S B;  4EYI B;  3H0G G;  3HG9 A;  1SYC A;  1TS2 A;  5KGU A;  4O2B F;  1N34 L;  5FJ8 H;  5DQG A;  2IX0 A;  3GII A;  4ZRZ A;  1RIP A;  4JI1 L;  2FIN B;  2FK1 A;  2CHB D;  3HGB A;  3D0F A;  1LYL A;  3HKZ B;  3PUZ A;  2I07 B;  4OON A;  1S72 A;  2FLN A;  4MNO A;  2KCT A;  4Q0F A;  4MIU A;  2HVS A;  2XIG A;  2A1A A;  3HEJ A;  4C1N I;  4NXN H;  1S0O A;  4GN4 B;  1JWM D;  3J80 i;  1IW7 D;  3T56 B;  2A8V A;  1X3G A;  3CW2 C;  4EX5 A;  2GLT A;  3CCJ A;  4TUY F;  2EJG C;  1KJ9 A;  4IAL A;  4NMZ A;  3DM3 A;  4GNX B;  4RGO S;  3UDG A;  4ID6 A;  3UE0 A;  2RKS A;  3A55 A;  2E2J B;  3MC0 B;  1B1Z A;  3PIP 3;  3UQ8 A;  4X64 L;  4GOP C;  5KFM A;  5FLM G;  2AQ4 A;  1KDC A;  2WKC A;  4YP3 A;  2AQ1 B;  1PLF A;  5L1K A;  3BA9 A;  3T5K A;  3GTQ A;  5M5Y B;  1DIK A;  2B29 A;  4LF8 L;  1E2Z A;  5DGB A;  4DV1 H;  2EJF C;  3S15 B;  1XMO Q;  4JI8 H;  3NXW A;  3F8T A;  3V4Z A;  3L0O A;  2F1M A;  3KAK A;  1W6J A;  1HUN A;  5LYJ F;  4IOC A;  1TQO A;  1K9M C;  1XNQ Q;  4J9R A;  4ULL A;  2ENB A;  2Z9H A;  2GN5 A;  4LFA Q;  1I7L A;  5JJI A;  3GTK H;  1SNM A;  4X3S A;  4A2A A;  4JI8 L;  1N9W A;  1NCV A;  2X69 A;  1STE A;  3I73 A;  1X9N A;  4UCO A;  4RH6 A;  5IE8 A;  2YL2 A;  3TBI B;  3MR2 A;  3HKZ G;  2R8G A;  1CM9 A;  1HR0 L;  1X65 A;  3Q6S A;  5J39 A;  1W96 A;  3GTP B;  1A62 A;  2ZXP A;  4JI5 L;  2E2J H;  1BNC A;  5GAG C;  4LMQ D;  4JC0 A;  3MXP A;  4DV2 L;  1RJR A;  4Q43 A;  3NQI A;  4DV0 H;  3P7J A;  1WVL A;  3KXY T;  1SYX B;  3HOU G;  2LKV A;  1BGW A;  1UEA B;  3SVM A;  1Z2N X;  4J9N A;  4P2C B;  3E0J A;  3S24 A;  3C3L A;  2W6Z A;  3L3O C;  1HR0 Q;  1CSP A;  2VUM B;  3T4A C;  4AH6 A;  4I50 F;  1KD1 C;  1BCP F;  1EWH A;  1ICW A;  3EIV A;  4G4K A;  2UVU A;  1K1S A;  4K5W A;  2KHS A;  2VNU D;  1T5X D;  1E24 A;  4RFB A;  1KRS A;  1GVP A;  3MWY W;  3IL8 A;  1I6H H;  2C35 B;  3W1B A;  1VF7 A;  3MXN A;  3J81 L;  1PTO F;  3QG1 A;  2KHI A;  4KY7 A;  4JI2 L;  1NMF A;  1A3T A;  1KAB A;  5GQO A;  3PO3 G;  4LNQ A;  4XT3 B;  1PTO H;  4RCN A;  2NVX H;  1AEX A;  2WAQ E;  1FJG H;  1KHI A;  1PTO D;  1KAW A;  2A6E D;  2I87 A;  1DGS A;  1L0X B;  4HCS A;  2R7Z B;  3K5N A;  4A3K B;  5KFA A;  2J6U A;  4JI2 H;  3RUZ A;  3K7U C;  4KY6 A;  1XNR Q;  3CVZ A;  2BQU A;  2WDT A;  2Z4I A;  2D0O A;  5KFF A;  3HOZ G;  5A2Q W;  4JVZ A;  1VMP A;  3TII A;  1E2V A;  1BBX C;  1PH4 A;  1D2B A;  5CA1 F;  3QJY A;  1LT6 D;  5CGK A;  1KNA A;  1TY2 A;  2C9O A;  1IBM H;  4NXN L;  3NWS A;  3A7L A;  3F2U A;  1TWG A;  2B2U A;  2FMA A;  4ZCK A;  3OSN A;  4C5A A;  4Y7N B;  4H44 C;  4EFE A;  5KT3 A;  2JP1 A;  4HN7 A;  4IPD A;  4IFD H;  4P71 A;  3TEH B;  4A3D G;  4ZUI A;  4X62 Q;  3C46 A;  3I55 A;  1SNO A;  4NLG A;  4MV6 A;  2NVT H;  2DNC A;  1PYS B;  1T36 A;  2MCT A;  1HFN A;  2ZTD A;  1HA5 A;  1HNX L;  3A8K E;  3KHH A;  2R7Z A;  1XNQ H;  1U4L A;  2JJQ A;  1Q12 A;  4ZUJ A;  5A2Q L;  3Q24 A;  4LAA A;  3A5U A;  1SJE D;  4FNF A;  2DPI A;  2F0N A;  4LMY A;  1W6K A;  4FU0 A;  5T1I A;  2VW9 A;  5LL6 X;  2CCZ A;  3WNZ A;  3KLW A;  1D5X C;  1UWV A;  2Q8I B;  5I2Y A;  3J7Z C;  5JVH 3;  1NR2 A;  3OIQ A;  4JV5 H;  2PZT A;  4ETS A;  3BZD B;  3BQ2 A;  2H1E A;  2XD4 A;  2DUD A;  1Y69 U;  5BN5 A;  2ASD A;  2XCL A;  2BA1 A;  1IBK L;  5C5M A;  2JA8 B;  1HH2 P;  2UUA H;  5CAE B;  2E2H H;  4F4Z A;  3HP3 A;  1TWA H;  2F4I A;  4JCV E;  4K14 A;  3V4S A;  1B3A A;  1IXR A;  3S1M B;  2XN9 C;  3WO1 A;  4B3R L;  2CW0 C;  1VKZ A;  1DD2 A;  1HR0 H;  2XRS D;  4KK7 A;  3CD6 A;  1B8A A;  3I12 A;  4LF7 Q;  1HPC A;  2MUY A;  3GD7 A;  5FPO A;  1RTN A;  5KG7 A;  3BDL A;  2EVB A;  3TSS A;  2RGR A;  1Y8N B;  4NB3 A;  4DV0 L;  4OGQ C;  2EJM A;  3CHB D;  4RCO A;  5C3W A;  3BG5 A;  4ECX A;  5DLF A;  3CKI B;  2F03 A;  1K83 A;  3S1R H;  4ME5 A;  2HQE A;  1C30 A;  1U4M A;  2N8N A;  1A6X A;  4MV1 A;  3RIZ A;  1E0B A;  5I6Y A;  4TQU S;  3WDN A;  4DFA A;  2NZH A;  1ET9 A;  1AFP A;  3G6Y A;  2KEE A;  3QFF A;  3TP7 A;  4EBC A;  4B3T Q;  1IW7 C;  3GIJ A;  1FGB D;  3RNU A;  4C3J H;  3K5L A;  4PMW A;  4EEQ A;  2R7M A;  4CDC C;  5IP7 G;  4X3U A;  4GLV B;  4XQN A;  4DL4 A;  2CVR A;  3M4O H;  2E5L L;  3FHW A;  4KKS A;  1G8Z D;  1BBU A;  4C3H G;  1HTL D;  2K04 A;  4JOI A;  5C44 G;  3RGX A;  4IOA A;  3IAY A;  4PZ8 A;  5LP6 F;  2CW7 A;  3T1H H;  1PYB A;  3M4Q A;  3PF5 A;  1UNS A;  3RR5 A;  3SE0 A;  4X65 L;  4AQY Q;  4FDB A;  2QKI C;  1JE4 A;  4GN3 B;  4DK6 C;  4UP8 A;  3CC4 A;  3DF7 A;  3LGJ A;  1PZI D;  2DY8 A;  4J9O A;  3E6Z X;  2NU6 B;  4ZOL F;  2F0Q A;  3S1N H;  4RU9 A;  4A93 B;  3GV6 A;  5JJZ A;  2R6F A;  3SI8 A;  3U50 C;  1KNE A;  1Y1V A;  4FF4 A;  1LLR D;  4G3I A;  5IGD A;  1RYS A;  5LMN Q;  3TQY A;  4F8M A;  4U6P A;  3M85 A;  3C0F B;  1Q46 A;  4IRD A;  3NTI A;  4ODG A;  4GLA C;  1LV9 A;  1SFO H;  2JN4 A;  4LFC Q;  3OUU A;  3LML A;  4M9U A;  3T5H A;  1XMO L;  2JA5 B;  5HBR B;  4WRD A;  4HAE A;  3I4N B;  1GUN A;  4C3I B;  1I50 A;  3VYU A;  2Z8L A;  1MJE A;  2L1B A;  4GNX C;  1O7Y A;  5ELB A;  3GV3 A;  1D5Z C;  1WTW A;  3RAQ A;  1X6O A;  1V9P A;  5HGT A;  1H9J A;  1MGS A;  1WTO A;  3J81 c;  4QJF A;  2CWP A;  3KDF A;  1L0Y B;  5LL6 S;  4ME6 A;  4O3S A;  4LF7 H;  2I46 A;  1LAC A;  1WCM A;  4B3T H;  3BVZ A;  1S68 A;  4BS9 A;  3FEW X;  1TS5 A;  2UUB L;  5CV4 A;  3N43 B;  1KDB A;  1SE2 A;  1X54 A;  2PZW A;  4UDU C;  2F0H A;  3J7A 5;  2Q8T A;  2DLN A;  3H0G A;  3DWQ A;  1UAP A;  4BBR G;  1PX2 A;  1VCI A;  1O7Z A;  1ZXT A;  5KFR A;  5FLX W;  3EJI A;  1FNV A;  2EYJ A;  2BA0 A;  4RHS A;  1YHB A;  5EAY A;  4J9K A;  3J81 j;  5C6A A;  1CS0 A;  1NJI C;  5KRU A;  2A6E C;  1LUZ A;  2QEJ C;  5KG5 A;  1STA A;  1LTG D;  5C3E B;  1XNR L;  2CH4 W;  3CME A;  1V1O A;  5ELC A;  1CKO A;  2I5M X;  2RDF A;  5KFG A;  2NVX B;  2KCN A;  3F2B A;  2D62 A;  4A3I G;  4JG2 A;  3MR5 A;  5LMU H;  4DV5 H;  4NXM H;  3T1Y Q;  1Q90 A;  1UE1 A;  3HKZ A;  3UDF A;  3EN2 A;  2R93 A;  1G51 A;  3AB9 A;  2Z4H A;  2R7Z H;  3R2T A;  2B8G A;  1YNX A;  2ZJP A;  4RA8 A;  5CV8 A;  3S1Q H;  5L9X A;  4DUY L;  1PHJ A;  1Q86 C;  5KG4 A;  3S17 H;  5T14 A;  2EE1 A;  1FNW A;  4JI1 H;  2F4V Q;  2EY5 A;  2JA7 G;  2EYH A;  4MV4 A;  4B3S H;  1EIH A;  3CCL A;  5IWA Q;  3NHH A;  4MTK A;  2K32 A;  2SCU B;  4AYB G;  3U9O A;  1O7I A;  2OH2 A;  1DYQ A;  3T1H L;  2HHH Q;  4FVM A;  1BVS A;  4OX9 H;  4IJL A;  5C3E H;  2RQX A;  4R4T A;  1K3B C;  1TU2 B;  4MTD A;  4LF9 L;  4ECU A;  4A3E B;  3RZD B;  3F1Z A;  1E22 A;  5JJL A;  4MV9 A;  2N88 A;  2A6H C;  5M3F B;  1JOQ A;  1WTX A;  2ICE C;  4YBZ B;  2J6S A;  1EYD A;  2MP1 A;  3BAA A;  1EWC A;  4RMF A;  1JCK B;  2ZT9 C;  2Z1C A;  5DG9 A;  3A74 A;  1Z6H A;  4YWM A;  2W9B B;  4YR3 A;  3BJY A;  2Q2U A;  4PZ7 A;  2NVQ H;  1MHW C;  3SK6 A;  3OMC A;  1HTP A;  2K5H A;  4FP5 D;  2F0K A;  3HOX B;  2X6L A;  4RB3 C;  2R3Z A;  4FBT A;  2PMZ E;  2OQK A;  5EPK A;  3PSI A;  3CRL C;  4O4I F;  3B6Y A;  1U9R A;  4Y8V B;  5C4X H;  1G2T A;  1PZK D;  2ASJ A;  1KC8 C;  5K2M A;  4CHT B;  5EDW A;  1O75 A;  5KFW A;  1BR9 A;  2B63 G;  3L2P A;  4FF3 A;  2VZA A;  3VMM A;  5LXT F;  3U4Z A;  3PW2 A;  2VA3 A;  1EY8 A;  4EVO A;  2R8I A;  1Z7T A;  2PCF B;  5JAV A;  5KFP A;  3H4B A;  4B9X A;  4PMC A;  3TZU A;  5HGQ A;  4QGU A;  4A3M G;  4A3M H;  2F0O A;  1IL2 A;  4ECT A;  3GTM A;  4NKL A;  3MR3 A;  4B3M H;  1N8R C;  1I4Q A;  5KFE A;  2W8K A;  1IKM A;  4A3D H;  2EYL A;  2QIL A;  3I72 A;  2FPI B;  5EWG A;  4K2L A;  2GVB A;  4U68 A;  1Q7Y C;  4FF1 A;  1EYC A;  2JYO A;  1XMQ L;  1EYZ A;  3H6M A;  4E4T A;  3I4M H;  1PV4 A;  4QCL A;  2IHF A;  3A7A B;  5KT2 A;  3PUX A;  3S14 H;  4IUT A;  4YY3 L;  4I65 A;  3HOW G;  1VF5 C;  5FLX c;  4JBJ A;  4L63 B;  2BH2 A;  3D3R A;  2L12 A;  3EA6 A;  4YAJ B;  5JPN C;  1S10 A;  2F3V A;  1A9X A;  3W1G A;  4I55 F;  3PW4 A;  3E3X A;  1HJP A;  3M3Y H;  4TQR A;  4BY1 B;  1Y14 B;  3KK7 A;  2Z6K A;  1WYD A;  1SFO A;  2A68 C;  2K05 A;  2E2I A;  1Q1E A;  3PW7 A;  2F0V A;  1V51 A;  4YY3 H;  3PUV A;  5KG2 A;  3NTK A;  1HNW Q;  2DIK A;  5KFJ A;  2ZTC A;  1TS4 A;  4HMJ A;  5KEE A;  4RWS C;  3IRB A;  1BO0 A;  1Y1V B;  1JMC A;  1K73 C;  2PW7 A;  2FLP A;  4KKU A;  4O3O A;  3GTP H;  2SDF A;  1EY6 A;  4LFC L;  1GM5 A;  5C8Y F;  3D6W A;  2KEN A;  4DUY H;  4OXP A;  1GUO A;  4L5R C;  3T51 B;  3RLO A;  2WP8 J;  2PPB C;  4DV1 Q;  2EDG A;  2HIV A;  1PH5 A;  2IT1 A;  2L15 A;  1N36 L;  3TS0 A;  1EHI A;  1VQM A;  1B70 B;  3FKI A;  5FKA C;  1M6V A;  4XIG S;  4XT1 B;  2WFW A;  2LXK A;  1SRO A;  1KLU D;  5CV6 A;  1VQ4 A;  1BCP C;  1SFO B;  2CW8 A;  3G6V A;  2XWB B;  1F9P A;  4DV7 Q;  3ZYY X;  2UXB Q;  3TQT A;  2DWC A;  1NUC A;  3DLL A;  1GJX A;  2B2T C;  1WOC A;  1B9M A;  2KCC A;  4QIW E;  2V58 A;  2YCH A;  4Q5V A;  1OTC A;  2IBK A;  3JSN A;  2UUB Q;  1ESR A;  2KQ3 A;  2FXQ A;  5DM6 3;  1VQ5 A;  4MAM A;  4UP7 A;  5J1Z A;  5FOB B;  3OSP A;  1BOS A;  3N44 B;  1IL8 A;  4MV7 A;  5EBC A;  4LF6 H;  2BH8 A;  3S2H H;  2BDN A;  1CHP D;  1Y1W B;  1SAP A;  3K7A B;  4NP5 A;  2VPQ A;  3AYH B;  3QIA A;  3T13 A;  2NUA B;  5JVD F;  2NU9 B;  4K5V A;  3JAM L;  2JK8 A;  3I91 A;  1RL2 A;  5JQW A;  1X3P A;  2EIF A;  4JI4 Q;  1NE3 A;  1SCU B;  2NVX A;  1BF4 A;  4ECS A;  4FS2 A;  1N48 A;  3KF6 A;  4DR5 Q;  4BY7 B;  4KLK A;  3I90 A;  1SNP A;  1JIC A;  4K8J A;  1HQM C;  3OW2 A;  4P72 A;  1FR3 A;  4JBM A;  3HXL A;  3KHG A;  2K1B A;  2ZDH A;  1EYG A;  3X3M A;  4ED7 A;  1LTI D;  1IYU A;  4HMI A;  4ME3 A;  4P75 A;  1STH A;  4DK3 C;  1GO3 E;  1Q8I A;  2DN8 A;  4FO2 A;  5JPM C;  3GV7 B;  2R7D A;  3PV0 A;  3VDY A;  3F2C A;  1PFM A;  2JA6 A;  1SBB B;  4DGZ A;  3PO2 B;  2PYK A;  1JB7 A;  4TSS A;  1ASY A;  4YR0 A;  2ICI A;  4R8U A;  2AMC B;  2EOT A;  1VBG A;  3PGZ A;  3Q8R B;  2EY2 A;  5FO8 B;  4KMU C;  1JKJ B;  3P20 A;  1CZW A;  3ERQ A;  2JEB I;  4OWW B;  3S2D B;  1PA6 A;  4FYD A;  4O4L F;  3U9T A;  4AIM A;  2XIW A;  5C4J B;  2L4N A;  3IKJ A;  5IOC A;  2V1C C;  3S17 B;  1QJO A;  1SMY C;  3FKI G;  3ITP A;  2DGY A;  5CB4 F;  2D2C C;  2KBN A;  1B44 D;  1EY7 A;  3KTM A;  1WCM B;  3H94 A;  3ND9 A;  3CAM A;  3K57 A;  3BQ0 A;  4LF5 Q;  2JEJ A;  4X62 H;  2RF4 A;  3A54 A;  1YHQ A;  5KNC A;  5M5X H;  1TA8 A;  1GHK A;  4L5T A;  1E4G T;  2QF7 A;  1T94 A;  1SE8 A;  5M3M G;  4CKE A;  1CKN B;  1R9T H;  1XYI A;  1VQ8 A;  3GTL H;  1F2Y A;  3Q22 A;  3PO2 H;  5I9O A;  3J7A K;  5ELO A;  4APV A;  3Q1K A;  2ATL A;  4LF5 L;  3VA5 A;  1PH1 A;  2UUC H;  3R2I A;  3IN5 A;  1N36 Q;  1N32 H;  2CQO A;  3HOZ H;  2B3G A;  2V5A A;  4JI4 H;  2B2W C;  2R8J A;  2VY3 A;  4S3S A;  2YU9 B;  4XQQ A;  2YYZ A;  2E2I H;  1JOK A;  1H9R A;  1SYF A;  3J81 E;  3KJO A;  1S5E D;  5I6W A;  5IT9 c;  3HOX H;  5E4W C;  4ALP A;  4DL5 A;  3RB0 A;  3T5L A;  4XYL B;  3AU7 A;  5DNF A;  1JXL A;  2V4D A;  1WCM H;  1PK8 A;  3GIM A;  1YI2 A;  3RAX A;  2FLL A;  4CKB A;  3DWA A;  2QW7 A;  2E2D C;  1TKW B;  4LSA A;  4IPG A;  2EZV A;  3K8A A;  4H7B A;  3PO3 H;  4GLX A;  4TQS A;  4F7X A;  4G57 A;  2R82 A;  4F4X A;  3TIN A;  1SDF A;  4YWL A;  1EYA A;  5FLX L;  3FRP B;  3BVG A;  1OXT A;  1WTP A;  4DPG A;  2WB1 B;  3TIG A;  1VS0 A;  2SOB A;  1LTL A;  1ZYR D;  2WKD A;  4H13 C;  1T5E A;  1AE3 A;  2R7K A;  2R87 A;  4EEY A;  2R92 B;  3LWE A;  5IT9 E;  4IWX A;  3NWT A;  3SR1 A;  1E3P A;  1S5F D;  2KEC A;  2I0Q A;  1KJJ A;  4UCU A;  2ALY B;  2W7P A;  5EGT A;  1EOT A;  3OOC A;  3GTG B;  4GKJ Q;  5C1O A;  2CH4 A;  1WTV A;  2PQE A;  4TV9 F;  4UP9 A;  1VQ9 A;  3HBL A;  1DM0 B;  5IOD A;  3BG3 A;  4JI0 H;  4JV1 A;  3QWN A;  3A8J E;  2JXM B;  5KT5 A;  1I5F A;  1R4P B;  1TWF B;  4YHH L;  3HOY B;  5FPR A;  2UU9 L;  2YTX A;  3LWU A;  5HV6 A;  5I2X A;  4HNV A;  1S03 G;  1TVX A;  5NUC A;  1A2U A;  3N6X A;  4ZLT F;  2FJ2 A;  2UXD L;  1A8V A;  2SNS A;  1XNR H;  2K5V A;  1DJR D;  4C2M B;  1Z9F A;  3K59 A;  1JDE A;  4ED8 A;  3UE1 A;  5IGB A;  2E8G A;  5IYC G;  2L55 A;  1HNX H;  1K8G A;  3IG0 A;  1GOZ A;  2B2Y A;  3HOV H;  1SYD A;  1I94 Q;  2MJ8 A;  1II3 A;  4DN4 M;  3R23 A;  3G71 A;  5M3M H;  3FVQ A;  2W9B A;  4J9P A;  4LF4 Q;  4JYA L;  4DL6 A;  4LUZ A;  5EPJ A;  2NB0 A;  4K0K H;  4QMG A;  4GNX A;  4DV4 H;  1K8M A;  1WH2 A;  1SRU A;  3RLN A;  4QL5 A;  2IX3 A;  3G6X A;  3ETJ A;  5LMU Q;  4DV5 Q;  4A3G B;  4M7E A;  1BXR A;  4DU9 A;  1C4Q A;  5CR3 A;  2D9U A;  1L2F A;  1C9O A;  2RSO A;  4QF4 A;  1FJG L;  1ZQ7 A;  4LSX A;  3MFH A;  5K36 G;  1JQY D;  3CMA A;  2J9G A;  4QWB A;  5C3X A;  4Q0Y A;  1LT5 D;  2R93 G;  3C1E A;  3QO2 A;  3D4D A;  1VQG A;  3M9M B;  4RG1 A;  1ENA A;  2LMC B;  1TWH A;  4N8X 1;  1B6S A;  3NGD A;  5DEH A;  2BE5 C;  2K28 A;  4WFN 3;  1WFQ A;  2W8L A;  3T1Y L;  4LFB L;  3BDO A;  4RZQ A;  1TWC H;  3SK5 A;  1M0W A;  2V9W A;  2EY6 A;  4M8A A;  2OTL A;  3NK9 A;  3K7A H;  1AH9 A;  2B63 B;  3K58 A;  3V6K A;  2FK2 A;  3KFU A;  1ONL A;  4OWT B;  1F9S A;  4U67 3;  3HB9 A;  3RN5 A;  4YJ2 F;  1PRT C;  2PI2 E;  1VQI A;  3CRK C;  3MXU A;  3ZJY C;  1EFW A;  5KT4 A;  2A74 C;  4NXM L;  3TP6 A;  3GP7 A;  3V2T A;  5D14 A;  1VQB A;  1WD1 A;  4IFD I;  1E7Z A;  1J9O A;  4XDX A;  2FE3 A;  2WV6 D;  2TSS A;  1QG7 A;  1PH8 A;  1A15 A;  3M9B A;  1OXV A;  4JOI C;  2Q2T A;  4A3I H;  3RV3 A;  3AMU A;  1IOW A;  4HID A;  3NE5 B;  2JEI A;  4KJN A;  4DR2 Q;  2I5L X;  4ED2 A;  1YNN D;  4LF5 H;  1B53 A;  2HUG A;  4RKB A;  3QOL A;  1ET6 A;  2K52 A;  1BJT A;  3KBX A;  5KT7 A;  3OIP A;  4G7O C;  4JI7 L;  2RDG A;  2AU0 A;  1IBK H;  1HZC A;  3RBE A;  2RVL A;  4MHE A;  1HNZ L;  1Y8O B;  3KOJ A;  1QNK A;  4BBR H;  3TME A;  1PH3 A;  1JIH A;  3NSW A;  3H09 A;  2VQE Q;  2R86 A;  4CC6 A;  4RUA A;  2R8K A;  2RHQ B;  3CCM A;  5KFD A;  3G48 A;  5GAD C;  1C0A A;  2OLS A;  3E5S A;  4L1K A;  4DLK A;  3V6H A;  2B63 A;  2F0S A;  1TWF A;  3VR5 A;  3ICE A;  3VPB A;  2O5J C;  2O03 A;  4XQJ A;  1DOL A;  2F3I A;  3J80 E;  4QW9 A;  1VQO A;  4TKO B;  3GTG A;  2IJ0 A;  1VQP A;  4C3J G;  1T9H A;  3N41 B;  4DR7 Q;  4GC6 A;  2VQE L;  5C5L A;  1IYJ B;  4A3L G;  1E4F T;  4JI8 Q;  1XMO H;  3R5H A;  2PW5 A;  4I7H A;  3GV8 B;  2XCP A;  5IIF A;  1I50 H;  1G6Z A;  4OO1 G;  2N49 A;  3QOJ A;  4KD4 A;  4AQY L;  5LMN L;  1JOR A;  4OEL B;  3T5J A;  2VB3 X;  2CW0 D;  3K6O A;  4A3D B;  3MVV A;  4DR7 L;  3D6C A;  2K03 A;  4O3Q A;  5JOB A;  1TY0 A;  2F0T A;  4KTA A;  1GHJ A;  4R8N A;  2F0D A;  5FD5 A;  4HJ9 A;  1CSQ A;  5IT9 W;  3Q0A A;  4J6H A;  1CE8 A;  4K0K Q;  2KSW A;  4L5S A;  4AYB E;  4WBN F;  2C00 A;  1KJQ A;  2G5D A;  4DR1 H;  1HNZ H;  3N42 B;  5KFN A;  4X65 H;  4PMB A;  2FPG B;  1ZYR C;  3MFG A;  1KTK A;  4DUZ Q;  3GIL A;  3SE7 A;  1JX4 A;  4I7A A;  3D4R A;  4YIJ A;  5H80 A;  4R4O A;  2IA6 A;  3STB C;  3M3Y B;  1H9K A;  4O3P A;  3K0Y A;  4QWE A;  5EZY F;  3FDT A;  2E2H A;  1SN8 A;  4JBK A;  2HVQ A;  4OHJ A;  3OUZ A;  1WCM G;  4PZ6 A;  1PTO C;  2IP4 A;  3JAM i;  3HRZ C;  2J0T D;  1YBY A;  4K8I A;  1ULZ A;  4HQ6 A;  4ABN A;  2OTJ A;  1JT8 A;  3CQZ A;  2IL8 A;  5DLQ E;  2VQE H;  4C3I G;  1TWH B;  1P8L A;  1S5C D;  1OXX K;  4ZAI A;  1K83 B;  1J5E Q;  4DR4 H;  4JV5 Q;  1CQF A;  2NN6 H;  4LUV A;  2F0I A;  1EEF D;  1G2S A;  2YZG A;  3PF4 A;  2NVY A;  5A2Q E;  4KHP H;  2O4X A;  3O13 A;  3PO2 G;  2JA6 B;  2UUA Q;  2YZN A;  2ZM6 H;  2Y0S A;  1LTR D;  2F0J A;  1CUK A;  3G7L A;  2FB9 A;  2NU7 B;  1QB5 D;  1BCP B;  1HRJ A;  1YNJ D;  1SR3 A;  1GSH A;  1CT1 D;  4DV3 Q;  3FP9 A;  4DR3 L;  3BA8 A;  3SGI A;  4C2M H;  4JI1 Q;  3PQI A;  4RHR A;  5H1S E;  3JSL A;  4R4Q A;  1HNX Q;  5AJ3 Q;  4AYB B;  4CDE C;  4RB2 C;  1GLV A;  4DA2 A;  2BQ3 A;  4QB4 A;  1ICF B;  4BA2 I;  3RTX A;  3KLS X;  4QUF A;  5FJ8 G;  4O42 A;  4YR2 A;  3ORQ A;  1YIJ A;  1AZQ A;  2YV5 A;  1TWH H;  3R93 A;  3CF5 A;  2NZ1 D;  2QA4 A;  1IKL A;  4C2M A;  2A68 D;  4OL7 A;  4DV6 L;  3D31 A;  1B6R A;  1CQJ B;  2F0G A;  2FFK B;  4EBD A;  5I4D A;  1MIU A;  1WTH A;  4OO1 H;  4KHP Q;  2ZDG A;  1K8O A;  1U4P A;  1DZ1 A;  2KUM A;  2NVT B;  4A3G H;  1J5E L;  1V43 A;  1LTT D;  4EQN A;  2BE5 D;  1D6E C;  2JA7 H;  5IWA L;  1JWU D;  2FP4 B;  4HR7 B;  1EEI D;  1NMG A;  4V19 0;  3N8D A;  3GTO A;  1ZEQ X;  5GRO A;  1NNX A;  4YJ3 F;  1BDO A;  3DXJ C;  1JE5 A;  2R61 A;  1SND A;  1Q81 C;  3GV5 B;  3C1F A;  3PW0 A;  1LM0 A;  1MD2 D;  2RDJ A;  2A73 B;  1Q3L A;  1A3V A;  3RB3 A;  2HCC A;  2GPW A;  1XXG A;  1GSA A;  1GSO A;  1OO9 B;  3TZD A;  4A3J G;  4FXD A;  2ZDQ A;  4RAZ A;  3H20 A;  3F2D A;  1ENC A;  4RB0 A;  1YVC A;  3V6J A;  4RGT A;  5LMN W;  4JI3 Q;  2R8H A;  4ZQ3 A;  2K14 A;  2W9C A;  5AFW A;  4IR1 A;  2KHJ A;  5DQI A;  1KL9 A;  4O0A A;  3N52 A;  4HCE A;  2ZJT A;  2ZXR A;  4UPA A;  4YCW A;  1LTS D;  4X64 Q;  3H3V H;  1R4Q B;  1F2L A;  3JAM E;  3CCU A;  2QYZ A;  4CDD C;  1BKB A;  5BMV F;  1ZHS A;  4YWK A;  4LF8 Q;  2F0U A;  5KFS A;  3PUY A;  5KFQ A;  1D8L A;  1H9M A;  1Y1V G;  1KQS A;  2UXB H;  3NUC A;  1DV2 A;  2JA6 G;  1CZG A;  3Q8D A;  1JC7 A;  5IGC A;  3IFD A;  5C4X G;  4ECZ A;  1XNQ L;  1WTR A;  3I4N G;  2XTI A;  2L9H A;  4R7R A;  2ZJR A;  4JBW A;  2KOL A;  3RB4 A;  4C3H H;  5LMN H;  4RNM A;  4DR6 H;  4GS3 A;  3H3V I;  3OWE B;  1ENF A;  4GOP B;  5D1O B;  2PQA B;  1YJ9 A;  5C4X B;  3RB6 A;  3E0E A;  3HOW B;  4DR7 H;  1JJG A;  1H9S A;  3L7Z C;  1CKN A;  2E74 C;  4A3F G;  4JV5 L;  2R7N A;  4R1J A;  1NSN S;  2NZO A;  1SEI A;  1PVO A;  2PMZ B;  2WAQ A;  1P16 A;  3DM1 A;  1S3O A;  2FK3 A;  4P74 A;  5M5W H;  4A93 G;  1IOV A;  2BCO A;  4FS1 A;  1QVF A;  1FD7 D;  4WJ3 M;  3QZ8 A;  2B39 A;  5F9L A;  2Q8R E;  3OTO Q;  2UUA L;  1U0L A;  2YU9 H;  1O80 A;  1H95 A;  3NBI A;  1J6Q A;  3RD4 A;  5IGE A;  1G91 A;  1M0T A;  5IGG A;  1IBL H;  1VMC A;  2VS1 A;  4O3N A;  1QVC A;  2XVS A;  4Q8E A;  1SEB D;  2M2L A;  2RCF A;  4ED1 A;  3NBH B;  4EQO A;  2WTF A;  2EXD A;  3CCS A;  2LFN A;  2F0M A;  1Z47 A;  4DL7 A;  4A3J B;  2TMP A;  1GUT A;  5BPH A;  4C3H B;  1UC9 A;  3OW7 A;  1PMR A;  5D65 A;  3M4Y A;  2R92 G;  5KYI A;  2UXB L;  5GON F;  3T1Y H;  3M9O B;  1KXL A;  5KND A;  1SNQ A;  3RV4 A;  2R6G A;  4APM A;  4IUR A;  4TV8 F;  5BN4 A;  1W93 A;  1Z2P X;  4F87 A;  4DUZ L;  1KJI A;  5BR8 Q;  5D8D A;  1C48 A;  2YZM A;  4DV1 L;  3SXH A;  1TT2 A;  3GTM H;  4FBU A;  1E4E A;  2FHT A;  3CXC A;  4BBS B;  1EFI D;  5J22 A;  1BUV T;  4C3I H;  1I6H B;  1Z2O X;  4LH7 A;  4BWG B;  3PUW A;  3UDI A;  2A69 D;  1HCZ A;  1PFN A;  3T16 A;  5DQH A;  5CC4 A;  3FPU B;  4JI4 L;  2UXC H;  2D5D A;  3HOU B;  2UXD Q;  4C56 C;  2Q2H A;  3K5O A;  4IJH A;  2YU9 A;  4A3E G;  4O4H F;  2VL6 A;  4HJ8 A;  1FYC A;  4Q45 A;  1RJP A;  4YHH Q;  1I6U A;  1Y1W A;  3NTH A;  4A4I A;  3FPP A;  2EY1 A;  4A3K H;  4Z9C B;  3Q8S B;  1U4R A;  4U7C A;  4J9S A;  2PZU A;  1L2Z A;  4NPS A;  1UEB A;  2VA2 A;  2WIN B;  4DV6 H;  4J9M A;  4EGV A;  4B3S Q;  2F4V H;  2GPS A;  1SLJ A;  2A69 C;  3F8N A;  1DON A;  2E76 C;  1GKH A;  5JH7 F;  1U5K A;  3PVX A;  3VR3 A;  5EQ0 A;  3ER0 A;  4YCV A;  3D8G A;  2LXJ A;  2L11 A;  4XYQ A;  1WTQ A;  1N33 Q;  3K5I A;  1Y1W H;  4DR5 L;  4MZ9 A;  4L6T B;  4IQZ A;  3OHB A;  4FXG C;  3FKI B;  4DK0 A;  3HS0 C;  2AUJ D;  2MNA A;  3U58 A;  1O78 A;  4O2A F;  1V1P B;  5LMU L;  4QUC A;  4DV5 L;  1XJV A;  4GKK L;  5KFV A;  4IWY A;  3RGZ A;  4LF9 Q;  5JUM A;  5G3L F;  3J80 c;  3PIO 3;  1B3Q A;  5KFY A;  5COY A;  1BCP D;  4IUU A;  4RNO A;  4LF7 L;  2AUK A;  3TP8 A;  4MV8 A;  4ECQ A;  1F2M A;  2UU9 H;  1UE6 A;  3CC7 A;  5G3L D;  2BOS A;  3KF6 B;  3ERO A;  1J8I A;  4DNT B;  5E1F A;  1Q82 C;  1VQL A;  2ES2 A;  4PG3 A;  1A0I A;  5EOY A;  2WE6 A;  1MZB A;  5KYL A;  4XXE A;  5DG7 A;  4B3S L;  2SNM A;  1SMX A;  5FO7 B;  5C0X G;  4A3K G;  5KG1 A;  4LFB Q;  4N9P A;  1O7L A;  2EXZ A;  3MWM A;  2ID0 A;  1B9N A;  4JI5 H;  4R4I A;  4K6D A;  2IHE A;  2VOB A;  2G9H D;  3EPI A;  2RCN A;  1QNU A;  3P1H A;  1EZ1 A;  4JYA H;  1MKH A;  4MN3 A;  3H0G B;  3S2D H;  3GIQ A;  4UCT A;  4YHH H;  3SEB A;  2FMC A;  1M90 C;  1PDQ A;  4DR2 L;  4DL2 A;  1F2Z A;  5IT9 L;  4ED0 A;  4BXX G;  1RYR A;  1G6P A;  2OCE A;  1Y8P B;  3S15 H;  3KDF B;  3S9W A;  4C3J B;  1CQV A;  4J15 A;  1ILP A;  2NVY H;  4HSV A;  2RGV A;  3KAJ A;  5KFK A;  4DNR B;  5BR8 L;  3MEF A;  4CC5 A;  4LF4 H;  5KG6 A;  3NEM A;  3GTK B;  5L1L A;  3R3O A;  1KC7 A;  1N34 Q;  4GOP A;  1ILQ A;  1R9T B;  3GTL B;  5ELN A;  2RA4 A;  1UUP A;  1VQD A;  4RAU C;  1CI3 M;  1I3Q H;  1PH7 A;  5DLG A;  5FO9 B;  3HOY G;  4DV2 H;  1HZA A;  1I7N A;  2JQO A;  3H0G H;  3U9S A;  3Q2O A;  5LHY 1;  1QIL A;  4QWC A;  4OX9 Q;  1X3F A;  4OEM B;  2JEF A;  2E2I B;  1N32 L;  2WAC A;  2W6N A;  5C44 B;  3L4K A;  5IYD H;  1I6V C;  1SMY D;  2W70 A;  3MTS A;  1I4H A;  2R7F A;  2K7V A;  2HDM A;  3I4O A;  1BNZ A;  1EU4 A;  2IW3 A;  4ECV A;  2DY7 A;  3S16 B;  1W3S A;  4GZY C;  4GKJ L;  2BR0 A;  4BWS C;  1RDP D;  4DAP A;  2W6O A;  2ALZ A;  1I3Q A;  1AP0 A;  2B2Y C;  2K50 A;  2PNH A;  2W9C B;  3PZP A;  2WB1 G;  2L0C A;  3EBE A;  2K5Q A;  3BYT B;  4ZKC B;  5HY6 A;  3OTO H;  1SE4 A;  5DM7 3;  3W5O A;  1AE2 A;  1LT4 D;  1JLL B;  1UC8 A;  3GIK A;  5E3F A;  1PRT F;  5LL6 b;  3DWP A;  4K0K L;  4ZHQ F;  1PTO B;  4IN3 A;  4LF4 L;  4JYA Q;  2RHS B;  4LFA L;  3GQC A;  3RZO H;  2ZM6 L;  2F0E A;  2F0P A;  1PRT D;  4KY5 A;  4X3T A;  1DOM A;  1KIX A;  4DR6 Q;  1EUJ A;  5JEA G;  5E7N A;  5C0X H;  1EQT A;  5C44 H;  3J7A F;  1I4P A;  2NTS A;  3EPG A;  5EKK A;  1F9Q A;  3UDX A;  4B3M L;  2JA7 A;  3BZK A;  1MSH A;  2L5T A;  2JA9 A;  4UCS A;  4OX9 L;  2R93 B;  4IZ8 A;  1TWF H;  2M00 A;  2X6G A;  5C4H A;  3HOY H;  2R84 A;  4XYO A;  2NTT A;  3TDQ A;  1WI5 A;  1E1T A;  3I8Z A;  3MEH A;  4HTH A;  2O5I C;  1M7J A;  2PI2 A;  3G6J B;  3J7Y W;  2EYM A;  3QZ7 A;  2YS7 A;  2PMZ A;  1A3U A;  3RJ0 A;  1BQQ T;  4WOR A;  1SYB A;  4E6I A;  4JUZ A;  3VPC A;  4A3G G;  1DCZ A;  5M3M B;  1KAA A;  2Y0S G;  2K4K A;  2UUB H;  2DJF C;  1KJ8 A;  3AQQ A;  3PIP A;  2ASB A;  3LNN A;  2PQA A;  2R7L A;  5C0X I;  1NY4 A;  1S4Z A;  2RBM A;  3GTQ H;  4BBS H;  2BQR A;  3BU2 A;  4CJ1 B;  4L5Q A;  1I94 H;  5C0X J;  1CK1 A;  4A3F H;  1D1I A;  3KLR A;  3WOF A;  1EOV A;  3G4S A;  1S40 A;  5KFZ A;  4K2K A;  2B2U C;  3NP8 A;  3HOX G;  4DR4 L;  3KHR A;  3BDC A;  3UI2 A;  1VQF A;  1L0W A;  2IWH A;  1TWA A;  2KED A;  3S1Q B;  2PN1 A;  4HNT A;  4LFA H;  5AJ3 L;  5ISR A;  4A76 A;  4KHP L;  2A6H D;  5JJK A;  1DOK A;  3AEV A;  2EPB A;  3ULL A;  2JA8 H;  1EU3 A;  1QZH A;  1SXT A;  3CQZ B;  4ECW A;  4BXX H;  3MJF A;  3OPO A;  5M3F G;  3J80 L;  3Q8Q B;  4AQY H;  4DR3 H;  3K0X A;  1S9F A;  2KJX A;  2WAQ G;  5CV7 A;  2VQF H;  2E2H B;  4JI7 Q;  1N33 H;  3NQT A;  5IY0 A;  4RZR A;  1VDZ A;  2DNE A;  1TWG B;  2VB2 X;  4N8F A;  3H15 A;  4N9T A;  1M8A A;  3HZX A;  4PNY A;  2IY5 B;  5EWF A;  2IPK D;  1QUQ B;  1YEZ A;  3FKI H;  1IBK Q;  5GAH C;  2UVW A;  4EG0 A;  2XGP A;  2AKW B;  3ETH A;  3MXN B;  3WOE A;  4ZQI A;  5M9O A;  4UCV A;  4X64 H;  2HT1 A;  3VPD A;  2B2V C;  5KFL A;  5IYZ F;  4MA5 A;  1TR5 A;  4WJ4 A;  3RN2 A;  1FL0 A;  5J3B A;  2K5D A;  5EBD A;  1RJT A;  2E75 C;  3BQ1 A;  4C1N K;  5EKL A;  1Y1W G;  1VAJ A;  4O1N A;  1MSG A;  1S5B D;  3L4J A;  1AN8 A;  4HIK A;  3ONA B;  5EJW A;  5ELD A;  2I5H A;  4CBV A;  1KEE A;  1HQR D;  1X55 A;  4QWD A;  2DPJ A;  1Q8K A;  1AZP A;  3CCR A;  1C7Y A;  4DV4 Q;  1YHA A;  5JEA J;  2NU8 B;  3NEN A;  3K3V A;  1QVG A;  3E9I A;  3JC6 6;  4HIM A;  3BJU A;  4HYK A;  1E2W A;  1DV1 A;  3MA2 B;  5M5Y H;  4UY8 C;  2HCI A;  1XMQ Q;  4AYB A;  1TWG H;  1VBH A;  1IZ6 A;  3KUP A;  1D5M C;  1MBY A;  1VQK A;  2C2E A;  5KT6 A;  4R8I A;  3N6R A;  2CKZ B;  1UE7 A;  1V4Y A;  3K5M A;  4PQX A;  3ND8 A;  2GA4 B;  3HKZ E;  5BN3 A;  4BBR B;  4LWC A;  1K1Q A;  3RFC A;  4GN5 A;  4IZO A;  3DHQ A;  3DUZ A;  4G7H C;  5A35 A;  5KFI A;  4EGJ A;  4PDB A;  4KKT A;  2AWN A;  2ATW A;  4OO1 I;  2CQY A;  4HNU A;  2HVR A;  3E9H A;  1EQQ A;  1VQH A;  2CZG A;  2JA5 A;  3HFZ B;  2UU9 Q;  1NBW A;  5KKN B;  1X3E A;  4IUQ A;  3GTP A;  5JEA H;  3I56 A;  4CGY B;  4JI0 Q;  4H0L C;  3I4M B;  1GD7 A;  1GGO A;  4DAM A;  3AFQ A;  3VYS A;  2F0W A;  3I4L A;  3I70 A;  3T53 B;  3V96 A;  1H9S B;  3J81 i;  5L1J A;  2EYO A;  1YNN C;  2UVR A;  2N55 A;  2W6Q A;  4FM9 A;  4OIK A;  4LFC H;  2H5X A;  5FD6 A;  1V8Q A;  2EYP A;  1EL0 A;  3OSO A;  1K3R A;  2JA5 G;  4X66 Q;  1OWT A;  1I3Q B;  2VR1 A;  4LH6 A;  3UFX B;  1A2T A;  4RKL A;  4BY1 H;  3HKS A;  4DXF A;  2NUC A;  1PH2 A;  1CA6 A;  2J4X A;  5KFC A;  4JK1 C;  1TII D;  2R92 H;  4KN4 C;  1PZJ D;  2M05 A;  2QDB A;  4XTC S;  4A3C G;  5IWA H;  3OYY A;  4RAY A;  2W71 A;  1HZB A;  4JW0 A;  3A5Z B;  3RMH A;  3MWE A;  1KLG D;  5LA6 F;  3U4V A;  3I7F A;  4X66 L;  3BAB A;  1QUQ A;  4K5X A;  4IFD G;  4JI2 Q;  2KCM A;  2LS0 1;  2ZM6 Q;  3MR6 A;  3T1H Q;  5TSS A;  4Y52 H;  3MZ5 A;  4KV6 A;  2W9A A;  3DEO A;  3M4I A;  1RJQ A;  3G6E A;  5EPL A;  2LY7 A;  2WII B;  4M1U B;  4JI0 L;  1B33 N;  2J7Z A;  3H3V C;  4TVA B;  4MTN A;  1IBM Q;  1I4R A;  2NN6 I;  2AGQ A;  2Z0S A;  1XX8 A;  1FVI A;  1STG A;  4R4C A;  1CFM A;  2MQH A;  3CU7 A;  3L9A X;  4DV6 Q;  1B50 A;  3HOV B;  4Q44 A;  1X32 A;  3PN1 A;  2NBF A;  2AGP A;  4WJW A;  2AQ3 B;  1EUC B;  1HHV A;  3GIP A;  1HUM A;  1QWY A;  1SYG A;  4HR7 A;  2V4Q A;  4F4Y A;  3SHL A;  2RDH A;  3Q8P B;  4DR2 H;  4NXM Q;  2B2W A;  2JSO A;  3SK8 A;  4X62 L;  4A3B G;  3I2Z A;  4QQB X;  3KLS A;  4A3L H;  1IBL L;  2R93 H;  2W6M A;  1S97 A;  1YZ6 A;  1VQ6 A;  2FJZ A;  4C5C A;  1EY9 A;  1RCV D;  4IUP A;  1EUD B;  1VQJ A;  4HJ5 A;  4J8Q A;  2PVP A;  4IO9 A;  2PO4 A;  4LF9 H;  5K5P A;  3BYY B;  2RDI A;  1GUG A;  1T3N A;  2HIX A;  4JV0 A;  2N3S A;  4YB8 B;  3M4P A;  1HXY D;  4OIJ A;  2C5C A;  4DAY A;  1WSC A;  1IBL Q;  5I47 A;  3GTQ B;  5IGF A;  3ULP A;  1TWC A;  4UFZ A;  3JZI A;  4DL3 A;  4IPH A;  3S1M H;  5KX5 F;  2HQL A;  2XWJ B;  2JA8 G;  1RTO A;  1IBM L;  1W2B A;  5EKI A;  1YIT A;  2YS6 A;  1QOH A;  3K80 C;  1RKN A;  1ZKO A;  1EIF A;  4IUN A;  2JA7 B;  1A63 A;  5COR A;  2G9D A;  3PCO B;  2IX1 A;  2I80 A;  3ULJ A;  5BPF A;  2JEA I;  3ERS X;  3GID A;  2B63 H;  4I7Z C;  1F77 A;  5IP9 G;  1RF2 D;  4UCR A;  4BY1 G;  4O3R A;  4LF6 L;  2A19 A;  1XPO A;  2NVQ B;  2R92 A;  4QWA A;  4GKK Q;  3CCE A;  2P0A A;  4IPC A;  2W7O A;  3CQZ H;  2AHO B;  4POF A;  4A3I B;  1X56 A;  3S1R B;  1AUX A;  2R85 A;  1M1K C;  2F0F A;  5IYC H;  5FK9 C;  5T1G A;  3I3C A;  4DAV A;  4A2B A;  1K0R A;  5IYD G;  2W6P A;  1LTA D;  2QDL A;  5C3E G;  2PNR C;  5DG8 A;  1KBL A;  5DGA A;  4OWX B;  1EQR A;  2C2D A;  1D7Q A;  1JR0 D;  4YQW A;  3GO5 A;  1HZ9 A;  2HHH L;  1AN7 A;  1XPR A;  2YRW A;  2HDL A;  2FKL A;  5EWE A;  1FKA H;  1JB3 A;  1N34 H;  2K5N A;  3C2P A;  1GUS A;  2PBZ A;  3N40 P;  4MV3 A;  3HOZ B;  2FMM A;  3VYT A;  1XMQ H;  4A3M B;  3M4O B;  3DEP A;  3EVQ A;  1HR0 W;  3P75 A;  4J9L A;  2V4R A;  4RGN A;  1MI2 A;  4DNI A;  2CWA A;  2XNA C;  4QW8 A;  4ZKB B;  1KDA A;  4V0B A;  3S1N B;  5JVL A;  1ML0 D;  3J80 W;  2VUM A; 
#chains in the Genus database with same CATH homology
 1YI2 A;  4A3C H;  1EIY B;  2NVT H;  1PYS B;  4X65 Q;  4LF6 Q;  2LXJ A;  2ZTD A;  1HNX L;  2GVA A;  1N33 Q;  4JI5 Q;  4IPG A;  3K8A A;  3PO3 H;  4BA1 I;  4GLX A;  1Y1W H;  4DR5 L;  2JJQ A;  1Q12 A;  4MZ9 A;  1WJJ A;  1VQC A;  2ZTE A;  3A5U A;  4YWL A;  3HOW H;  2JA5 H;  2MNA A;  3U58 A;  2VW9 A;  1OXT A;  4DV4 L;  4DPG A;  4H02 A;  1ASZ A;  5LMU L;  4DV5 L;  1XJV A;  1VS0 A;  2E5L Q;  2XGT A;  2CCZ A;  3I4N H;  4GKK L;  3KLW A;  2CFM A;  1UWV A;  3J7Z C;  4LF9 Q;  1LTL A;  3HOV G;  3J80 c;  1UE5 A;  1AE3 A;  2DUD A;  1N32 Q;  4A3J H;  4LF7 L;  2BA1 A;  2UXC L;  1UE6 A;  3CC7 A;  1E3P A;  3KF6 B;  1IBK L;  2I0Q A;  2OWO A;  5FLM H;  1Q82 C;  1VQL A;  2ES2 A;  2ALY B;  3BZC A;  1HH2 P;  4GKJ Q;  4PG3 A;  2E2H H;  3S16 H;  1BBW A;  1A0I A;  4POG A;  4UP9 A;  1VQ9 A;  1TWA H;  1QZG A;  4JCV E;  1HNW L;  4B3S L;  1IXR A;  2UUC L;  5C0X G;  1SMX A;  4A3K G;  4DV3 L;  4B3R L;  1I5F A;  4YHH L;  4LFB Q;  2UU9 L;  2YTX A;  2ID0 A;  3CD6 A;  1B8A A;  4BY7 G;  1JJC B;  4R4I A;  4LF7 Q;  3CC2 A;  2IHE A;  3GD7 A;  2UXD L;  1A8V A;  4NB3 A;  4DV0 L;  2RCN A;  2K5V A;  1Z9F A;  1MKH A;  3CP0 A;  3S2D H;  3UE1 A;  3S1R H;  2E8G A;  5IYC G;  2QEX A;  1M90 C;  4DR2 L;  2N8N A;  1K8G A;  3HOV H;  4BXX G;  1I94 Q;  4TQU S;  1FJG Q;  2OCE A;  1G6P A;  3KYH C;  2NZH A;  3S15 H;  1YJN A;  3KDF B;  3CCV A;  3G71 A;  5M3M H;  4Y7N H;  4J15 A;  4B3T Q;  4LF4 Q;  2NVY H;  4P73 A;  4JYA L;  1Q1B A;  4LUZ A;  3AFP A;  3RNU A;  2EQS A;  5BR8 L;  4C3J H;  3MEF A;  2D0P A;  4PMW A;  4GNX A;  4A3B H;  5IP7 G;  3GTO H;  1XTD A;  4GLV B;  1SRU A;  3RLN A;  4QL5 A;  3NEM A;  3M4O H;  3I4M G;  5LMU Q;  4DV5 Q;  3FHW A;  1N34 Q;  2E5L L;  4GOP A;  2UXC Q;  3HOU H;  1BBU A;  1L2F A;  1C9O A;  4JOI A;  5ELN A;  5C44 G;  4B3M Q;  1FJG L;  2JA6 H;  1VQD A;  4NXN Q;  4IOA A;  5K36 G;  1CKM A;  4PZ8 A;  3CMA A;  1I3Q H;  4BY7 H;  1PYB A;  1PH7 A;  3M4Q A;  3PF5 A;  4YCU A;  2UUC Q;  2VQF L;  5IYB G;  5IP9 H;  3HOY G;  1HZA A;  2R93 G;  3RR5 A;  2JQO A;  3H0G H;  1VQG A;  4X65 L;  4RG1 A;  2F52 A;  4AQY Q;  4FDB A;  4GN3 B;  4DK6 C;  4OX9 Q;  4UP8 A;  3CC4 A;  1X3F A;  3LGJ A;  1WFQ A;  1N32 L;  3T1Y L;  3S1N H;  4B3R Q;  4LFB L;  5IYD H;  2F4V L;  1TWC H;  2R7F A;  3I4O A;  3U50 C;  5M3F H;  2OTL A;  3K7A H;  1AH9 A;  1W3S A;  3TRE A;  4GKJ L;  3TRZ A;  2WB1 E;  3KFU A;  5LMN Q;  3TQY A;  4OWT B;  4A3E H;  3RZD H;  1I94 L;  3M85 A;  1Q46 A;  2K50 A;  2PNH A;  4EQ5 A;  3RN5 A;  2WB1 G;  3EBE A;  2PI2 E;  4GLA C;  1SFO H;  1VQI A;  3ZJY C;  4LFC Q;  1EFW A;  5HY6 A;  1XMO L;  4NXM L;  2YTY A;  2YTV A;  4KHZ A;  1VQB A;  4IFD I;  1VQA A;  1E7Z A;  3W5O A;  1AE2 A;  1PH8 A;  4K0K L;  1MJE A;  2QGQ A;  4DUY Q;  4B3T L;  3M9B A;  4LF4 L;  2RHS B;  4LFA L;  1OXV A;  4JOI C;  4GNX C;  1OXU A;  2Q2T A;  4A3I H;  2ZM6 L;  3RZO H;  5IYB H;  4HID A;  4A75 A;  4DR2 Q;  1X6O A;  1V9P A;  2I5L X;  2OQ0 A;  4HIO A;  1KIX A;  4DR6 Q;  4IFD J;  3J81 c;  4QJF A;  2CWP A;  3KDF A;  1EUJ A;  1VQE A;  5JEA G;  2K52 A;  5E7N A;  5C44 H;  4DR3 Q;  4LW1 A;  4DV0 Q;  4JI6 Q;  3UDX A;  4B3M L;  3BZK A;  4JI7 L;  1V1Q A;  2JA9 A;  3PIO A;  4OX9 L;  1HZC A;  2UUB L;  1TWF H;  1X54 A;  1VQ7 A;  3HOY H;  3J7A 5;  1JJ2 A;  2JE6 I;  1HNZ L;  3KOJ A;  4BBR G;  4BBR H;  1WI5 A;  1E1T A;  1VCI A;  3NEL A;  1PH3 A;  2VQE Q;  2PI2 A;  4O2D A;  2RHQ B;  3CCM A;  3RLF A;  2BA0 A;  1YHB A;  5EAY A;  3J81 j;  3G48 A;  5GAD C;  1C0A A;  4A3G G;  1G29 1;  4QY7 A;  2Y0S G;  2K4K A;  4DV2 Q;  1NJI C;  1LUZ A;  3AQQ A;  3PIP A;  2ASB A;  4DR1 Q;  3ICE A;  2PQA A;  5C0X I;  1NY4 A;  1PH9 A;  1XNR L;  3GTQ H;  2F3I A;  3CME A;  4BBS H;  1VQO A;  4X6A H;  3BU2 A;  4L5Q A;  1CKO A;  2I5M X;  5C0X J;  3KF8 B;  1VQP A;  4HJ7 A;  1T9H A;  3F2B A;  1PFS A;  2D62 A;  2VQE L;  4JG2 A;  4A3I G;  1IYJ B;  4DR7 Q;  4A3F H;  4A3L G;  4A93 H;  3G4S A;  4JI8 Q;  1EOV A;  4DKA C;  3OTO L;  3T1Y Q;  2MO1 A;  1S40 A;  1UE1 A;  3UDF A;  3EN2 A;  3HOX G;  2NN6 G;  1G51 A;  4DR4 L;  1VQF A;  1L0W A;  3WWV A;  2R7Z H;  1B7Y B;  1I50 H;  1YNX A;  2ZJP A;  4DR1 L;  4OO1 G;  2N49 A;  4AQY L;  2VUM H;  5LMN L;  2VUM G;  5AJ3 L;  3S1Q H;  4YY3 Q;  4A76 A;  4KHP L;  5JJK A;  3KJP A;  3AEV A;  4DUY L;  1L1O A;  1PHJ A;  1K8A C;  1Q86 C;  3CCQ A;  4DR7 L;  4JI6 L;  3S17 H;  3ULL A;  2N78 A;  2F4V Q;  2JA7 G;  2JA8 H;  3TS2 A;  3GTJ H;  1QZH A;  3GTG H;  3CCL A;  5IWA Q;  4BXX H;  5M3F G;  4AYB G;  4LUO A;  1KRT A;  1O7I A;  4HJ9 A;  1CSQ A;  1NTG A;  3T1H L;  3K0X A;  1BVS A;  2HHH Q;  4K0K Q;  1TXY A;  4IJL A;  5C3E H;  1Y1V H;  2WAQ G;  3A0J A;  2AWO A;  4R4T A;  4AYB E;  4L5S A;  4JI7 Q;  4LF9 L;  3F1Z A;  5IY0 A;  1E22 A;  3CPF A;  5JJL A;  4DUZ Q;  3H15 A;  2IY5 B;  1QUQ B;  2MO0 A;  4R4O A;  1YEZ A;  3FKI H;  3STB C;  5IP7 H;  1IBK Q;  4RMF A;  5GAH C;  1L1O B;  2AKW B;  1SN8 A;  3A74 A;  3MXN B;  4JBK A;  4YWM A;  3CPW A;  1WCM G;  4PZ6 A;  2HT1 A;  3JAM i;  1YBY A;  2Q2U A;  4BBS G;  4PZ7 A;  2OTJ A;  2NVQ H;  4DR6 L;  1JT8 A;  4WJ4 A;  5DLQ E;  3RN2 A;  1FL0 A;  1K83 H;  1P8L A;  5J3B A;  2K5H A;  1OXX K;  1Y1W G;  4DV7 L;  2Q2I A;  1XPU A;  1J5E Q;  4HIK A;  4JV5 Q;  2ZJQ A;  2I5H A;  4LUV A;  2PMZ E;  2OQK A;  3PSI A;  1X55 A;  4DR4 Q;  3STB D;  2LSS A;  3B6Y A;  1Q8K A;  5C4X H;  2Z6K C;  3PF4 A;  3CCR A;  1L1O C;  1EWI A;  4DV4 Q;  1KC8 C;  1C7Y A;  1YHA A;  3PO2 G;  5JEA J;  2UUA Q;  3NEN A;  1QVG A;  3E9I A;  3JC6 6;  4HIM A;  3BJU A;  5GAE C;  2B63 G;  3L2P A;  2VZA A;  5M5Y H;  4UY8 C;  3U4Z A;  1XMQ Q;  1CUK A;  1TWG H;  1IZ6 A;  2Y0S E;  1VQK A;  2CKZ B;  1UE7 A;  1SR3 A;  5HGQ A;  4QGU A;  4A3M G;  4DV3 Q;  3FP9 A;  4A3M H;  3HKZ E;  4DR3 L;  3SGI A;  4C2M H;  1IL2 A;  4LWC A;  4JI1 Q;  4JI3 L;  5H1S E;  1N8R C;  4GN5 A;  4R4Q A;  5AJ3 Q;  1HNX Q;  2MFI A;  4HJA A;  1YJW A;  1N33 L;  2R7Z G;  4A3D H;  4BA2 I;  3K81 C;  1VQN A;  5FJ8 G;  1HNZ Q;  2AWN A;  2GVB A;  1Q7Y C;  2ATW A;  1YIJ A;  4OO1 I;  2YV5 A;  1TWH H;  1XMQ L;  3E9H A;  3CF5 A;  1EQQ A;  1VQH A;  3HFZ B;  2UU9 Q;  1NBW A;  2QA4 A;  4KI0 A;  1FGU A;  1PV4 A;  1X3E A;  3D31 A;  4DV6 L;  3I4M H;  2IHF A;  2VQF Q;  3I56 A;  4JI0 Q;  1MIU A;  3PUX A;  1GD7 A;  4DAY B;  3S14 H;  4DAM A;  3AFQ A;  4YY3 L;  3HOW G;  4KHP Q;  1E1O A;  5FLX c;  4JBJ A;  1OXS C;  2BH2 A;  3J81 i;  4A3G H;  1J5E L;  1MJC A;  1V43 A;  3GDE A;  3W1G A;  3JAM c;  2H5X A;  1PH6 A;  1HJP A;  5IWA L;  2JA7 H;  3M3Y H;  1Y14 B;  2Z6K A;  1NMG A;  1WYD A;  5C4J H;  3M7N A;  1K3R A;  2JA5 G;  4X66 Q;  1Q1E A;  5GRO A;  3PUV A;  4BY1 H;  1HNW Q;  3HKS A;  1JE5 A;  2ZTC A;  1Q81 C;  1PH2 A;  1LM0 A;  2K75 A;  3IRB A;  1JMC A;  1K73 C;  2R92 H;  3H0G G;  3GTP H;  4JYA Q;  4LFC L;  4XTC S;  4A3C G;  1GM5 A;  3OYY A;  2KEN A;  4A3J G;  1HZB A;  4OXP A;  3A5Z B;  1N34 L;  5FJ8 H;  3F2D A;  4L5R C;  1YVC A;  2IX0 A;  3U4V A;  3RLO A;  2WP8 J;  1RIP A;  4JI1 L;  5LMN W;  4DV1 Q;  2HIV A;  4JI3 Q;  3I7F A;  4X66 L;  2K14 A;  1PH5 A;  2IT1 A;  2L15 A;  3D0F A;  1QUQ A;  2KHJ A;  1LYL A;  3TS0 A;  1N36 L;  3PUZ A;  1KL9 A;  1B70 B;  4O0A A;  4OON A;  4MNO A;  1VQM A;  1S72 A;  2KCT A;  4JI2 Q;  4IFD G;  4UPA A;  2KCM A;  2ZM6 Q;  4XIG S;  3T1H Q;  2WFW A;  4YCW A;  2LXK A;  1SRO A;  4X64 Q;  2A1A A;  3H3V H;  4Y52 H;  3CCU A;  4GN4 B;  1VQ4 A;  3J80 i;  2A8V A;  3G6E A;  1BKB A;  1X3G A;  3CW2 C;  4EX5 A;  4DV7 Q;  4YWK A;  3CCJ A;  4LF8 Q;  4JI0 L;  2UXB Q;  3DLL A;  3PUY A;  4TVA B;  1D8L A;  1Y1V G;  1WOC A;  4MTN A;  1KQS A;  1IBM Q;  2NN6 I;  2Z0S A;  4QIW E;  3DM3 A;  1OTC A;  1FVI A;  2JA6 G;  4R4C A;  2MQH A;  3Q8D A;  4GNX B;  3UDG A;  2UUB Q;  3UE0 A;  4DV6 Q;  2FXQ A;  1VQ5 A;  5C4X G;  1XNQ L;  4UP7 A;  3I4N G;  2XTI A;  4X64 L;  2ZJR A;  4JBW A;  4GOP C;  5FLM G;  4C3H H;  2BH8 A;  3S2H H;  4GS3 A;  2B29 A;  3H3V I;  4LF8 L;  4GOP B;  1XMO Q;  4NXM Q;  2PQA B;  1YJ9 A;  3AYH B;  3E0E A;  1JJG A;  4X62 L;  4A3B G;  3I2Z A;  1CKN A;  3L7Z C;  4QQB X;  4A3F G;  4JV5 L;  1IBL L;  4A3L H;  3F8T A;  2R93 H;  4R1J A;  3L0O A;  2JK8 A;  1RL2 A;  2NZO A;  1PVO A;  2EIF A;  4IOC A;  1NE3 A;  1K9M C;  4JI4 Q;  1XNQ Q;  1YZ6 A;  1P16 A;  1VQ6 A;  1S3O A;  2GN5 A;  4P74 A;  4LFA Q;  5M5W H;  5JJI A;  4A93 G;  1VQJ A;  4HJ5 A;  1QVF A;  4WJ3 M;  3GTK H;  3KF6 A;  4DR5 Q;  4KLK A;  4JI8 L;  1N9W A;  3OTO Q;  2UUA L;  4IO9 A;  1U0L A;  2YU9 H;  1X9N A;  1H95 A;  3OW2 A;  1J6Q A;  4P72 A;  4JBM A;  2HIX A;  1EYG A;  5IE8 A;  2N3S A;  2VS1 A;  1QVC A;  3HKZ G;  3M4P A;  1HR0 L;  1IBL Q;  1X65 A;  3NBH B;  4ME3 A;  3ULP A;  1A62 A;  4JI5 L;  4P75 A;  2E2J H;  4IPH A;  1GO3 E;  2EXD A;  4DK3 C;  5GAG C;  3CCS A;  3S1M H;  1Z47 A;  2HQL A;  2R7D A;  3PV0 A;  4JC0 A;  4DV2 L;  3VDY A;  2JA8 G;  1IBM L;  1W2B A;  1YIT A;  3F2C A;  3K80 C;  1EIF A;  3HOU G;  1A63 A;  2R92 G;  3PCO B;  1JB7 A;  1ASY A;  2IX1 A;  3ULJ A;  2UXB L;  2JEA I;  2AMC B;  3ERS X;  3PGZ A;  3S24 A;  2B63 H;  1KXL A;  1HR0 Q;  1CSP A;  2JEB I;  4OWW B;  2R6G A;  5IP9 G;  4AH6 A;  1PA6 A;  4BY1 G;  1KD1 C;  4AIM A;  3EIV A;  4LF6 L;  4DUZ L;  2VNU D;  2V1C C;  5BR8 Q;  2A19 A;  1XPO A;  1E24 A;  3FKI G;  4GKK Q;  2DGY A;  3CCE A;  4DV1 L;  2KBN A;  4IPC A;  3CQZ H;  1KRS A;  1GVP A;  2AHO B;  3GTM H;  1I6H H;  4POF A;  3CAM A;  2C35 B;  3W1B A;  3CXC A;  1X56 A;  4LF5 Q;  1M1K C;  2KHI A;  4C3I H;  5IYC H;  1NMF A;  2RF4 A;  5GQO A;  4JI2 L;  3PO3 G;  3PUW A;  4LNQ A;  3UDI A;  1YHQ A;  1K0R A;  5M5X H;  5IYD G;  2NVX H;  2WAQ E;  5C3E G;  4L5T A;  1KHI A;  4OWX B;  1EQR A;  1D7Q A;  1KAW A;  4JI4 L;  1SE8 A;  5M3M G;  3GO5 A;  2UXD Q;  1HZ9 A;  2HHH L;  1DGS A;  1CKN B;  2Q2H A;  1R9T H;  1XPR A;  1VQ8 A;  4IJH A;  3GTL H;  4A3E G;  2VL6 A;  4HJ8 A;  3PO2 H;  2K5N A;  3K7U C;  5ELO A;  4APV A;  1XNR Q;  4YHH Q;  4LF5 L;  4A4I A;  4A3K H;  2D0O A;  1PH1 A;  1N36 Q;  4NPS A;  1UEB A;  3HOZ G;  2CQO A;  3HOZ H;  2B3G A;  4B3S Q;  1HR0 W;  1SLJ A;  1PH4 A;  2VY3 A;  4DNI A;  2CWA A;  4NXN L;  2YYZ A;  2E2I H;  3KJO A;  1GKH A;  5IT9 c;  3HOX H;  4ALP A;  1U5K A;  4IPD A;  4P71 A;  3TEH B;  4A3D G;  4X62 Q;  3ER0 A;  3I55 A;  1WCM H;  4YCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...