4QJFA

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
186
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKKKAKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase, subunit E'
total genus 40
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qjfA02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qjfA01
4FDBA 2IHFA 5C3EH 4A3EG 2JE6I 4KLKA 2K5NA 4P75A 2QEXA 2JA8G 4B3ML 5GADC 1EIFA 1LM0A 4A3CH 3S16H 3KF6B 2B29A 2I0QA 4JI1L 1FGUA 2K5VA 4DV1Q 2KHIA 4JI1Q 4DV1L 3UE1A 1KL9A 3UE0A 2ZTCA 2R7FA 2RCNA 2YV5A 1KD1C 4DR1L 1I3QH 4LF5Q 4YWLA 4DR1Q 1HR0W 1UE5A 4ALPA 4IPCA 4A3GH 3OYYA 2UU9L 1VQHA 3DLLA 1Y1WG 3D31A 4A76A 4YY3Q 1X9NA 1EFWA 1NTGA 1VQFA 3FKIH 3L2PA 2OQKA 4DAMA 4DV6Q 1ASYA 3AFPA 4JBWA 4YWKA 3VDYA 2E2HH 4OWXB 3HFZB 4YCVA 5IT9c 4LF7Q 2ZJRA 1A0IA 4C3IH 2WFWA 3F8TA 4RG1A 1C7YA 2HHHL 3HOVH 1FJGQ 4JI8L 3DM3A 3M4PA 1U5KA 2NZHA 3M4QA 4A93G 4OONA 4DR3Q 1MJCA 2OQ0A 5GQOA 1Y14B 2WB1G 4BA1I 4GOPA 1AE2A 3U58A 3HOXH 4L5SA 4BBSH 2JQOA 2Y0SE 4IOAA 3G48A 2JA9A 4OWTB 4DKAC 1BKBA 2VQEL 3U4VA 4GLXA 3MEFA 3S17H 2R93H 5JJKA 3TQYA 3RZOH 2K4KA 3A74A 1PHJA 2KCMA 1K8GA 2KHJA 4X64Q 1EQQA 1L1OB 1X55A 3W5OA 4DR4Q 1XTDA 2CWPA 1TWGH 3KDFA 3CMEA 3PO3G 2VUMH 4BA2I 1YVCA 3E9IA 3FP9A 3KF6A 1YHBA 4A3LG 5HGQA 1P8LA 2A8VA 4JCVE 1CKNB 4BY1H 5FJ8H 1YJNA 3GTKH 4C3HH 3KJOA 3H3VH 4JG2A 1UE1A 4DV4L 3PF5A 3T1YL 1J6QA 4DNIA 3S2HH 1VQKA 3HKZG 1QVCA 3S24A 1S40A 3H3VI 4GNXA 5FLXc 3E9HA 1IZ6A 4X65L 4JI4Q 1SE8A 1LTLA 4X65Q 4LF6Q 1PH5A 5IYCH 4NXML 2PI2E 2RHSB 4R4OA 3RZDH 4GKJQ 1YJ9A 1VQCA 2AMCB 4HJ5A 1FJGL 1S72A 1N36L 2D62A 1W2BA 1YJWA 1CUKA 1G291 1Q1EA 1J5EQ 2D0PA 3FKIG 4B3TQ 3HOWG 2R92H 1PV4A 5HY6A 2UUBL 1NBWA 1QZGA 1XJVA 2E5LQ 1BVSA 1B8AA 1I94L 4X64L 5FLMG 5C0XG 3I4MH 1MKHA 3HOYH 3CMAA 3RNUA 2EXDA 1M1KC 1KHIA 3RLOA 2MFIA 3SGIA 3ZJYC 3CCSA 2NN6G 3CCEA 2ID0A 4QJFA 2KBNA 2NN6I 4LWCA 5C3EG 1HZAA 3STBD 4A3EH 1PH3A 4HJ7A 1Q46A 3NEMA 4JV5L 3ULJA 3CCVA 1QVFA 2Q2UA 3PV0A 4EQ5A 1CSPA 3GDEA 2R7DA 4Y52H 4GN4B 1WFQA 3F2CA 4DV0Q 1FL0A 3AEVA 1NE3A 2CKZB 2H5XA 2ES2A 2WAQG 3EIVA 2LXJA 4KI0A 3S1NH 3L0OA 4UP8A 1SROA 1E22A 1WJJA 2BA1A 3TS2A 3CCMA 1L0WA 1N9WA 1IXRA 4X62L 2NVQH 4P72A 2Q2TA 3B6YA 1Q82C 1N32L 1C9OA 5IY0A 3OTOQ 1XNQL 4AIMA 5M3FG 1K3RA 1K73C 3S1RH 1JT8A 2PNHA 2UUAQ 4LF6L 1IBML 2HQLA 4IPDA 1YNXA 5AJ3Q 1E1TA 3D0FA 5IYBG 5JJLA 1WYDA 2N3SA 2N78A 3CF5A 3PCOB 1N36Q 3J81c 2K52A 2NZOA 3CCUA 1PYSB 4C3JH 5M3MH 5LMNW 1D7QA 3HOYG 2N8NA 2OTLA 4LFAQ 3KOJA 1XPUA 3PUXA 1PVOA 2AKWB 2UUBQ 2PI2A 3F1ZA 5C0XJ 3OW2A 5IE8A 1QUQA 5LMNL 4IO9A 3PSIA 4L5RC 4OXPA 2CCZA 3T1HQ 2BH2A 1YI2A 1K9MC 1Z47A 2IT1A 2IX0A 3BU2A 3HOWH 1KRTA 3PUYA 1HR0Q 4DR6Q 1B70B 4MNOA 1LUZA 4JI7Q 4GLVB 5J3BA 4IOCA 2Z6KC 1XMOL 1L2FA 4JYAQ 4K0KL 1DGSA 1WCMH 3J7ZC 2B3GA 1PH1A 3ULLA 3RN2A 2JA6H 5C4XG 3GTLH 4AYBE 5IYCG 1HNXL 3RN5A 5EAYA 4APVA 4JI8Q 1SLJA 1QZHA 3ERSX 2IX1A 4KHPL 1UE7A 1HZBA 4YHHQ 2UXCQ 1IBKL 5IP7H 2OWOA 4A3JG 4NB3A 1Q12A 3J80c 5JJIA 4J15A 3GTPH 3UDIA 5FJ8G 4GKKQ 2AWOA 3GTMH 1GD7A 1HH2P 1A62A 1TWHH 1N32Q 4JBJA 4PZ8A 3CP0A 3I4NG 2K50A 1B7YB 3JAMc 3RLNA 3I4OA 4DR4L 2UXBL 1X3GA 3UDXA 1HNZQ 3ER0A 3F2BA 4LF9L 1PH8A 5FLMH 4DV3L 2HIVA 5K36G 2FXQA 1HNWQ 3PO2G 3K7AH 5ELNA 4DR5L 4DUYL 1TWAH 2K14A 4IPGA 1YIJA 4GLAC 4JOIA 4B3SQ 2ZTEA 1E7ZA 4BY7H 4X62Q 1CSQA 4YWMA 4HIDA 3MXNB 1VQOA 3GTGH 1H95A 1V1QA 1EQRA 3GTQH 4A3FH 4A3IG 1NJIC 1HZCA 2E8GA 4GN5A 1PFSA 1VQDA 2YTYA 1AH9A 1KIXA 3I7FA 1HNWL 3AFQA 1Q8KA 1I5FA 1IBMQ 2LXKA 4IFDI 1SFOH 4WJ3M 3CC2A 3NENA 5C44G 1C0AA 4C2MH 3CPFA 3EBEA 1VQEA 2F3IA 1OXSC 4QL5A 3A5ZB 2IHEA 3CW2C 5JEAJ 2ZM6L 4A3GG 2CFMA 2GVBA 2PQAB 2MO1A 3EN2A 4BY1G 4NXMQ 5IP9H 2QGQA 1TWFH 1VQ4A 2JA7H 4X6AH 4QIWE 2YU9H 1NY4A 4NXNQ 2ALYB 4YCUA 3CD6A 1XNRQ 1OXVA 1J5EL 3KLWA 1GO3E 1Z9FA 3PUZA 4LUVA 4HJ9A 1PH4A 1A63A 4DUZL 2JA8H 2F4VQ 1EUJA 1OXTA 4QY7A 2JA6G 1I6HH 1WCMG 3AYHB 2ZJPA 4DUYQ 1SN8A 1QVGA 3GO5A 2RHQB 4JI5Q 1X6OA 3K0XA 2JEAI 2Q2HA 3CCLA 2BA0A 4PMWA 4P71A 3HOZG 1BBWA 4BBSG 4DR6L 2UXBQ 1CKMA 4MZ9A 4JI6L 4JBMA 4UP9A 4X66L 3CCQA 4DV2Q 2NVYH 3GTOH 4JI6Q 4KHPQ 4IPHA 4AQYQ 3UDFA 1PH6A 4QGUA 3TRZA 1PH2A 1I94Q 4A3IH 5H1SE 1GVPA 3HOVG 2VZAA 1E1OA 2OCEA 5M5XH 2B63G 2ZTDA 3M4OH 4JOIC 4BBRH 2JJQA 5E7NA 3M85A 4B3TL 1VCIA 1KAWA 4L5QA 1G51A 4JYAL 3KDFB 4O0AA 1N34Q 2UXDL 1KQSA 3F2DA 1Y1VH 1IYJB 4GKJL 4XTCS 4A4IA 1VQ8A 3S1MH 4BBRG 1RL2A 2EQSA 4POFA 1XMQL 2UU9Q 2A1AA 4JBKA 4JI7L 3K7UC 4GNXB 1A8VA 1X3FA 4LUOA 2ZM6Q 1EYGA 4GOPB 1HR0L 2V1CC 1E3PA 4A75A 2ATWA 4DR2Q 4OX9L 2DGYA 1O7IA 1S3OA 3LGJA 1T9HA 2L15A 3HKZE 4DV5L 1PH7A 4NXNL 4LF7L 1Q86C 4PZ6A 4R4QA 3I4NH 2R7ZG 1G6PA 4IJHA 1U0LA 5DLQE 1W3SA 1TWCH 2JEBI 5ELOA 2VW9A 1MIUA 5M5WH 4PZ7A 2D0OA 4IJLA 3OTOL 4A3MH 1JB7A 3NELA 4IFDG 3TS0A 2WAQE 1ASZA 4JI3L 3W1BA 2Z6KA 3I55A 2Q2IA 2NVXH 4A3JH 3J80i 5AJ3L 4LF5L 4DPGA 2MQHA 2WB1E 4B3SL 1EOVA 1L1OC 5C4XH 5LMUQ 1VQMA 2RF4A 4DK6C 5LMUL 2I5MX 2VUMG 2XTIA 3JAMi 1Q7YC 4A3DH 1E24A 1NMFA 2EIFA 3STBC 4JI3Q 4B3RL 3K80C 4O2DA 3S15H 1K0RA 2E5LL 2PQAA 4H02A 2HHHQ 5JEAG 3E0EA 4LW1A 1WOCA 2JA5G 1VQAA 1SRUA 4DR7L 4JI0L 4B3MQ 4DAYB 5IYBH 3PUVA 2Z0SA 4YY3L 1X3EA 4MTNA 4A93H 1JJCB 1VQ7A 3I56A 4OO1G 1VQJA 2CWAA 1K83H 4JC0A 3BZCA 4A3FG 3CQZH 1IBLQ 1N33L 4TQUS 3L7ZC 1X54A 2JA5H 2B63H 1UE6A 3NBHB 1XMQQ 2E2JH 3CCJA 1N8RC 3H15A 4DV7Q 3JC66 1FVIA 1IBKQ 4YHHL 4K0KQ 1Y1WH 4DV2L 5C0XI 3CC4A 1JJGA 3UDGA 2VQFL 4P73A 1HNXQ 5BR8L 4HIOA 4GS3A 2HIXA 1VQ5A 3PO3H 1V43A 5C4JH 4LF8Q 1CKOA 1PA6A 1GM5A 1X56A 2MO0A 1Q81C 4JI4L 4A3KG 1N34L 2UXDQ 1JJ2A 4AQYL 3G4SA 4LFBL 2UXCL 2R93G 2A19A 3CPWA 2R6GA 4RMFA 4TVAB 1EWIA 2C35B 5IP7G 3HOXG 1YEZA 3BJUA 2VQEQ 1KC8C 1UEBA 1L1OA 2ZJQA 3J81j 4LNQA 4JI0Q 2HT1A 3RR5A 4LF8L 4DR3L 3A0JA 3CCRA 4A3MG 1SR3A 3K81C 4HIKA 3RLFA 1VQNA 1HJPA 3G6EA 5GROA 2Y0SG 4Y7NH 1XMOQ 1WI5A 4X66Q 2F4VL 3I4MG 2KENA 1GKHA 3KF8B 4DUZQ 4UY8C 4BXXH 3U4ZA 3HKSA 1VQLA 3T1HL 1NMGA 3ULPA 1SMXA 3Q8DA 4R1JA 4R4TA 3J81i 4GNXC 3H0GG 2R92G 2CQOA 5IYDH 3CAMA 1R9TH 4BY7G 1VQPA 3PO2H 1YBYA 5IWAQ 4OWWB 1N33Q 4DK3C 1YZ6A 3PF4A 1JMCA 5IWAL 2AHOB 1KXLA 1X65A 5M3MG 1Y1VG 4A3BH 4DR5Q 2PMZE 2OTJA 2QA4A 4NPSA 4AH6A 3J7A5 1BBUA 4JI2L 1V9PA 2ASBA 4DV0L 2K75A 4DV6L 1HNZL 4LF9Q 4R4CA 3KJPA 3PIOA 5M3FH 4DR2L 2YYZA 4OX9Q 4HIMA 4JV5Q 1YHAA 1JE5A 4UP7A 2E2IH 3HOZH 3M3YH 3W1GA 2VNUD 4A3LH 4POGA 4A3KH 2DUDA 1OXUA 3PIPA 4LUZA 2YTVA 4DV3Q 3HOUH 2IY5B 1CKNA 4GOPC 4L5TA 2N49A 4LFBQ 2XGTA 2WP8J 3M9BA 3I2ZA 2VY3A 1EIYB 5GAEC 4KHZA 3CXCA 2GN5A 3HOUG 1XPOA 5IYDG 4P74A 2JK8A 3GD7A 4ME3A 3TREA 4JI2Q 5GAHC 1VQ9A 3KFUA 3IRBA 3S1QH 5IP9G 3BZKA 1MJEA 2JA7G 2VQFQ 1K8AC 4YCWA 4LFCL 3FHWA 4DV5Q 3M7NA 4LF4L 5LMNQ 2K5HA 2VS1A 4DV4Q 2I5LX 1AE3A 1KRSA 2VL6A 5M5YH 5C44H 4GKKL 2YTXA 4QQBX 4OO1I 1YITA 2KCTA 1M90C 4UPAA 5GAGC 1OTCA 2LSSA 1PYBA 4WJ4A 4A3BG 5BR8Q 1Q1BA 3WWVA 2UUCQ 4LFCQ 1I50H 3T1YQ 2F52A 3PUWA 3S2DH 4A3DG 2UUCL 1RIPA 1VQGA 1UWVA 3H0GH 4A3CG 1XNRL 4IFDJ 1LYLA 4EX5A 4DR7Q 2AWNA 1IBLL 4PG3A 2MNAA 1HZ9A 1VQIA 2BH8A 1XNQQ 4HJ8A 3CC7A 4B3RQ 4R4IA 3U50C 1OXXK 2I5HA 3ICEA 2GVAA 1YHQA 4LF4Q 1TXYA 1XPRA 2NVTH 1QUQB 1D8LA 3TEHB 4AYBG 4XIGS 4BXXG 1PH9A 3S14H 1IL2A 4DV7L 1VQBA 4HJAA 3PGZA 3A5UA 3GTJH 3K8AA 4LFAL 2UUAL 3AQQA 3G71A 1VQ6A 4GN3B 4JI5L 1P16A 2R7ZH 1VS0A 3KYHC
chains in the Genus database with same CATH superfamily
2EXZA 3OWFA 4ZLTF 2A5HA 3NTIA 3J81E 3R5XA 4O4HF 1JDBB 5GADC 2AUKA 2FPGB 3S16H 3KF6B 5KFMA 1ENFA 2KHIA 4DV1L 4RB3C 4G4KA 1MSGA 4YQWA 3UE0A 2I07B 1X3PA 5JVG3 4DR1L 3QB3A 1UE5A 1STYA 2FLPA 2NTTA 4IPCA 2UU9L 3BYTB 1NTGA 1NR4A 4DV6Q 2CQYA 1EY8A 4EBCA 5IT9W 2IW3A 4JBWA 3VDYA 3K3PA 4OWXB 2KECA 5IT9c 3H94A 3J7YW 4EVOA 5KFJA 3TP5A 2WFWA 1G6ZA 2R3ZA 3TIGA 2R93B 1U5KA 1U4LA 4OEMB 4DR3Q 1W6KA 4K14A 3VYTA 4DUYH 5C5LA 4BA1I 1Y14B 3U58A 3DWQA 5IYDH 1AE2A 1MZBA 2A6ED 2Y0SE 4OWTB 5JJKA 2R84A 3U4VA 2R93H 2K4KA 1ESFA 1FD7D 5EBCA 4X64Q 4KD3A 3W5OA 1SBBB 1XTDA 4DXGA 5HV6A 4AQYH 3UI2A 3CMEA 4BA2I 2VA3A 1WTWA 1YVCA 5C1PA 2JP1A 1P8LA 2EYPA 2J4XA 1CKNB 5C6AA 2FHTA 4DN4M 3H3VH 4C2MA 5M3MB 5KFYA 3GIPA 1RCVD 5HGTA 1ZYRC 1QVCA 3S24A 3H3VI 4GNXA 4JVZA 4X65L 2YU9B 1SE8A 5COYA 2FPIB 1SNOA 4J9KA 1LTLA 4X65Q 1PH5A 5IYCH 1ZEQX 4O2BF 4R4OA 5T14A 4HJ5A 1FJGL 5KFFA 5A2QE 4O4IF 1W2BA 3D3RA 2OH2A 2CW0C 3D4DA 5F9NA 2VB2X 3W3AA 5D1OA 5JAVA 3T53B 4B3TQ 4HNVA 1K3BC 2R92H 5HY6A 4XQJA 2UUBL 4G7HC 1B8AA 1I94L 4R8UB 2L5TA 2NVYB 2C2DA 3OHXC 2YYAA 1K83B 1BF4A 1W96A 1N48A 1M1KC 5C4JB 2AQ3B 3M4OB 2ID0A 1HUNA 2KBNA 5F2DA 4B3SH 3NSWA 4HJ7A 1QB5D 2GPWA 4M1UB 4JV5L 1QE6A 3CCVA 4C5CA 4YR0A 1F2LA 2R7DA 2ZXRA 4JI6H 4GN4B 4OGQC 1FL0A 1NE3A 2CKZB 1B44D 3EIVA 4MTKA 3S1NH 4HSPA 1HA6A 1SROA 3HB9A 1IYVA 5BMVF 1SAPA 4HCSA 3PVXA 3MA2B 2F03A 4P72A 1Q82C 3QOLA 1N32L 1C9OA 5JQWA 4AIMA 1K3RA 2PNHA 4ECVA 4LF6L 1IBML 3TN2A 2W6PA 3Q0AA 1E1TA 4B3RH 2N78A 3PCOB 1QOHA 1VKZA 3J81c 3T5KA 5DQGA 1HTPA 3CCUA 2NUCA 5K2MA 1F2ZA 3HOYG 2UVRA 3PUXA 1S10A 3MXUA 1EY7A 4ECWA 1O80A 2VOBA 3ORQA 4FF3A 4K8JA 4DAPA 4IO9A 2JA8B 4JI2H 3ND9A 5C3WA 1K9MC 3BU2A 2IX0A 3ETHA 1C48A 1EEID 3TSSA 4DR6Q 1B70B 4MNOA 4JI7Q 2A69C 5J3BA 4JYAQ 3ONAB 4J9NA 5KYLA 3S16B 3RN2A 2FMAA 3GTLH 4KHVA 3TZDA 2F0PA 4QW8A 5IYCG 3BYYB 3RN5A 4APVA 2AUJD 5D3IB 4DUZH 2QYZA 1Y8OB 3I12A 4KHPL 4S3SA 1IBKL 3V96A 3H0GA 3R2IA 3HOZB 3I4MB 1Q12A 1TS3A 3V4ZA 3HKZA 5CBEE 5FJ8G 1R9TA 3KAKA 3GTMH 1TA8A 4CC5A 3DWPA 1A62A 3TP8A 2DNEA 4Y8VB 3RLNA 3I4OA 4B08A 2UXBL 1Y8PB 3UDXA 5L37A 5LA6F 1RJQA 1PH8A 5K36G 1STHA 4DL7A 3K7AH 2KQ3A 5ELNA 4DR5L 4DUYL 4JOIA 4B3SQ 1EUCB 3EA6A 5TSSA 4X62Q 3GTGH 4BY7H 4DR6H 1V1QA 1EQRA 3K7AB 4A3FH 4EEQA 1VQDA 2RA4A 1AH9A 2M9VA 5C44B 1HNWL 2K04A 4DA2A 2F0FA 1IBMQ 3GTGB 3OTOH 2LXKA 3VR2A 3G6XA 4KTAA 3NENA 3SR1A 5C44G 4A3FB 4LFBH 4C2MH 4PMCA 2B2UC 4FNFA 3EBEA 4QB4A 5FPRA 4KJNA 2FK2A 2SNMA 2ZXPA 3SDZA 4TV9F 3BA8A 3CW2C 3DF7A 3J7AK 2GVBA 4HR7B 2R8GA 3Q8RB 2QGQA 4RHSA 1K8OA 5A35A 4YY3H 4KKSA 4YJ2F 2ALYB 1DXMA 2QF7A 3QJYA 1OXVA 4LF9H 3PUZA 3DUZA 1PH4A 4DUZL 1K1QA 2YL2A 1F9SA 3N52A 4HN7A 1WCMG 3AYHB 2ZJPA 1QVGA 1D6EC 3GO5A 5FOBB 3N40P 1B4OA 1BR9A 1SE4A 2Q2HA 1Y8NB 1WCMA 2HDMA 3HOZG 4ILWA 3PZPA 3BA9A 4MZ9A 5KFOA 1TY0A 4DV2Q 4UCUA 4JV1A 3BVMA 2A74C 3GTOH 1PX2A 4AQYQ 3UDFA 1PH6A 4KY7A 1QNUA 4F7XA 4EEYA 3NXWA 4A3IH 1WD0A 2FE3A 4ZQ3A 5M5XH 3M4OH 1EUDB 5KFVA 1AZPA 4B3TL 4JYAL 3GQCA 1PTOD 2UXDL 2W6QA 3PIP3 5FO9B 3F2DA 4KK7A 3D6WA 4XDXA 2K5DA 2SDFA 3V2TA 4IRCA 2FB9A 3OSPA 4XTCS 4XXEA 3PW0A 1SYBA 1EHIA 3NE5B 1RL2A 2EQSA 3PMFA 3S1NB 2R7ZA 2A1AA 1I4PA 2AQ1B 3RGZA 4FYDA 1HR0L 1PRTB 3RIZA 5DQHA 4A75A 3M9OB 1IBLH 2DGYA 3WO0A 4DV5L 4PWQA 1NR2A 2DNCA 2YRWA 2PNRC 4R4QA 4DK1A 4HSVA 1G6PA 2XIGA 4JPBW 2W70A 2FLNA 3GV5B 4IALA 1TWCH 5I6YA 2SOBA 2VW9A 1MIUA 4A3MH 4PZ7A 3EROA 4TRDA 3TS0A 1SFOB 4JI3L 4J8QA 3MR2A 2AGQA 2OLSA 3SK5A 1VMCA 2NVXH 4FXGC 5AJ3L 4MV4A 5ELBA 5KFEA 3VMMA 2WB1E 2XIWA 4B3SL 1EOVA 1L1OC 1RF2D 4A3DB 2V58A 5LMUQ 2WYOA 1RTOA 3MHBA 5D14A 3V6JA 2I5MX 2VUMG 2NVXB 4IZOA 3EPIA 4UCOA 3A55A 1HQMC 1JR0D 4HMJA 4GC6A 3BS1A 2YU9A 1NMFA 1RK5A 5H80A 4QWBA 3K80C 2UXCH 4N8X1 3S15H 1K0RA 4XT1B 2E5LL 5JEAG 3E0EA 2LS01 2FK3A 5FLXE 5KNDA 4Q5VA 2OXPA 1DM0B 2JA5B 1FKAH 5IYBH 5D1OB 1GXDC 4RAUC 1ZHQA 1JJCB 1VQ7A 4L63B 5C3EB 1TY2A 1IBLQ 4TQUS 5I9OA 1XMQQ 2VQEH 1SNQA 3PR5B 5ISRA 3QO2A 4DV7Q 4DAVA 4XX0B 1ENCA 2F3VA 2W71A 4DV2L 5I9PA 3CC4A 3TIIA 5LMNH 3HP3A 3DHQA 5BR8L 4HIOA 1EZ6A 2W9BA 1JQYD 4QWCA 3IFTA 3J80W 5J2TF 1A9XA 1V43A 1PA6A 1GM5A 1Q81C 1V1PB 1KABA 1U4MA 4EGQA 1N34L 3MFHA 2XCAA 1SE3A 2UXCL 4LH7A 1MBYA 5E4WC 4TVAB 3P75A 1AFPA 1EWIA 5KG1A 3QOJA 5IP7G 1YEZA 1KC7A 3GIMA 5I4DA 4LNQA 5KFKA 4JW0A 3KHRA 1JE4A 2HT1A 1F2YA 4LF8L 4ME6A 3A0JA 2W8LA 3TP6A 4J9QA 1IKLA 2B2YC 5GROA 2Y0SG 4Y7NH 1SDFA 2KENA 3KF8B 4BXXH 2ICEC 1EYDA 3HKSA 2RDIA 4B9WA 3BVZA 5CMDA 3T1HL 3GIIA 1NMGA 4NXMH 3VR3A 2R92G 3RAQA 2JEJA 2MUYA 1PRTD 2R8IA 1YBYA 2RDJA 3K58A 4DV5H 4OWWB 1VF5C 2A69D 2L9HA 4RB0A 1EY6A 5KFCA 3I4LA 3LWEA 2JA6B 2QA4A 4NPSA 1BBUA 4C3JG 2F0QA 2ASBA 2FP4B 4DV6L 3QWNA 4WRDA 5L9XA 5C1OA 1F9RA 4A3KB 2DIKA 5M3FH 2YYZA 4HIMA 1D1KA 1JE5A 2E2IH 2NVYA 1CT1D 4CKCA 4DR2H 3M3YH 2AU0A 2IWHA 4FF1A 4A3KH 4WBNF 2H4OA 1OXUA 4LUZA 2YTVA 1BOSA 3D6CA 2WP8J 3M3YB 1IBKH 5KG0A 1EZ1A 4CDFC 2D9UA 4HTHA 5DGAA 2L1BA 1HPCA 4X3UA 3N42B 4MHEA 4JI2Q 3FEWX 4H13C 2W7OA 4DF7A 2EPBA 1IKMA 4YCWA 4DV5Q 3RBEA 3D4RA 5T1GA 3KBXA 3OIQA 4GC7A 1EY4A 2VS1A 5T1IA 2VL6A 2I46A 5KNCA 5KG2A 1M90C 2KCTA 2DWCA 2F0UA 3I4NB 1GUNA 2VB3X 2RDFA 5BR8Q 4PNYA 2F0DA 1Q1BA 4LFCQ 4MV8A 5EWFA 2V59A 1XNRL 4EX5A 3V6HA 1GLVA 2B2UA 1HZ9A 3WOEA 4FF2A 2K05A 3CC7A 4O2AF 2FJZA 4R4IA 2MCTA 2AQ2B 3ICEA 1KLGD 3OPOA 4LF4Q 4K6LA 4BXXG 3NQIA 3TEHB 4XIGS 3MVVA 3SEBA 2W6MA 4I7HA 2IJ0A 3S14H 2PMZA 2UVUA 1HNXH 1ILQA 2ALZA 1H9SB 4LFAL 2UUAL 1DV1A 1S5ED 3TP7A 3S14B 4RB1A 5KFAA 3HGBA 2IHFA 5C3EH 4A3EG 4ZHQF 2DPJA 1GUWA 1I3QB 2B8GA 1CZGA 1EIFA 2J7ZA 3CKIB 1RKNA 3WDNA 1QILA 2W9AA 1I50A 1HHVA 5FD6A 3DEPA 5IGFA 1R4QB 1QCBD 2L0CA 3LNNA 4KJOA 1X32A 4F50A 4DR1Q 2YZMA 2CHBD 1IW7C 1IOWA 3OYYA 4ED0A 4A76A 1T5XD 5NUCA 3AFPA 2P5ZX 4YWKA 3TBIB 3I72A 2E2HH 1FGBD 2F3WA 3HOVH 3MWYW 4RG1A 1C7YA 2HHHL 1HTLD 1TR5A 1FJGQ 1LO5D 4RA8A 1MJCA 3R2TA 4U673 5DQIA 5GQOA 4L5SA 4HNUA 3NWSA 4QCLA 2JQOA 4IOAA 3G48A 3WO1A 4DKAC 3S17H 1BKBA 5JEAH 4F8MA 3A74A 5CV9A 1PHJA 2F0LA 1K8GA 4LMYA 2KHJA 1EQQA 1IW7D 1L1OB 3AU7A 1CE8A 3I73A 3OUZA 2L4NA 4CGYB 2VUMH 2RVLA 3E9IA 3M4YA 1SFOA 5JOBA 5DM63 4JCVE 2SNSA 2R7NA 4DV4L 1TWGB 4RGTA 4YR2A 1J6QA 4DNIA 2BDOA 2A6HD 2CH4W 2JA7A 3PW5A 3P20A 3GTKB 4UHVA 2NWGA 5CV5A 5FO8B 1C8CA 1F9PA 1I6UA 1RJRA 1UEAB 3RZDH 1YJ9A 1VQCA 4GKJQ 2C2RA 5IIFA 1N36L 3S9WA 1SYDA 1G291 2H1EA 2B2VC 3MXNA 1SNCA 2O5IC 1T3NA 1PTOB 4A2BA 2KCCA 2F0NA 4LMQD 2RKSA 2F0TA 5EPLA 1B3AA 1M0TA 1CQVA 4IRKA 1PTOH 1WVLA 3KAJA 5C0XG 4DV3H 1MKHA 2QKIC 3CMAA 4LSXA 2EXDA 4ECYA 3RLOA 5DLGA 3ZJYC 3CCEA 3MWEA 1EZ8A 2NN6I 1PH3A 1HZAA 5EBDA 4QUFA 2Z6BA 1Q46A 2E76C 5IGBA 4LF5H 3ULJA 3URYA 1CTMA 4K6DA 2Q2UA 1QVFA 4EQ5A 3GDEA 2RQXA 1STNA 2QILA 3GV7B 2HHHH 1WFQA 4DV0Q 5FLXW 3C1FA 3AEVA 1E4EB 3ERQA 2WAQG 3K5LA 1YNND 5CV8A 2BQ3A 4KI0A 3L0OA 3E5NA 3V05A 1L0WA 1ULZA 2ASDA 2I8CA 3SK4A 3CRKC 4MTDA 1B50A 1S97A 1VBHA 2YW2A 1XNQL 1V8QA 5EOYA 3K3VA 4C56C 2HQLA 3QIAA 2MJ8A 2RCFA 5BN4A 5IYBG 2N3SA 3CF5A 2HVSA 3S1RB 1TWFA 3BG5A 4C3JH 4RAYA 2F0KA 5KFRA 4UFZA 1JORA 2OTLA 4LFAQ 5LMUH 1JB3A 3K5HA 2XGQA 1PFNA 2PI2A 3F1ZA 2UUBQ 4ZCKA 3BDOA 5FK9C 5IE8A 5IWAH 3T1HQ 2R61A 1YI2A 2IT1A 1I6HB 1N56A 1LUZA 3IN5A 2Z6KC 1BCPF 4EQOA 4A3BB 1SEBD 3MXPA 5LXTF 4WORA 3J7ZC 1PH1A 5IGCA 3GTGA 4AYBE 2I87A 1SXTA 5EAYA 2R92B 3PW4A 1HNZH 2HCIA 1SLJA 4ULLA 4JI8Q 3ERSX 3SHLA 4K0KH 3NTKA 2E2DC 5ELFA 3W2DA 1UE7A 1HZBA 4YHHQ 5EQ0A 2XSCA 4K5VA 4ZKBB 4A3JG 2OWOA 2HCCA 3J80c 1WTOA 4J15A 3JRXA 4PV1C 3FMCA 5KT4A 2JEIA 1E2VA 2AWOA 1DONA 2K32A 1JDEA 5DNFA 3GV6A 1N32Q 1GSOA 4MIUA 4JBJA 1E4FT 5KX5F 2K50A 4LF9L 4OIKA 3ER0A 3F2BA 2XNAC 3N6RA 3A54A 1S68A 4QWAA 4FXKC 2FXQA 1HNWQ 3FVQA 1UNNC 3PO2G 4KN7C 4GLAC 4UCRA 5KT2A 2ZTEA 3L3OC 4OX9H 4YWMA 3MXNB 3K5OA 3IAYA 3BVGA 4J9LA 4H7BA 4I4TF 1QNKA 4NLGA 4I65A 4TUYF 5DGBA 1E2ZA 2YTYA 3I7FA 1I5FA 4ECSA 1SFOH 3FDTA 3CC2A 4U6PA 1A3UA 1I4RA 4A3JB 5JH7F 2G9HD 3TDQA 1VQEA 2F3IA 5I6WA 4NDXA 4QL5A 5LHY1 2VQDA 1LACA 2IHEA 1J5EH 2RSNA 4A3GG 4NXMQ 3G7LA 2YZGA 2JA7H 3GTJB 1W93A 3MWMA 4DK0A 4NXNQ 3SE7A 2KJXA 2R7ZB 1J5EL 2PO4A 1Q3LA 1BCPD 1Z9FA 4HJ9A 2HQEA 3RUPA 2JA8H 1OXTA 4QY7A 5M9OA 2EYOA 1RYRA 4UAIA 3I3CA 3MTSA 1X6OA 1OWTA 2JEAI 3DMUA 2BA0A 2N88A 4P71A 4BBSG 1CKMA 4I55F 4JI6L 3CCQA 1KJJA 4ZKCB 1JWMD 2ENBA 4JI6Q 4IPHA 2SCUB 4B9XA 1JOKA 4QGUA 1GUSA 1PH2A 1GVPA 3HOVG 4WD3A 1E1OA 2OCEA 2B63G 1B6RA 2W9CA 4RZQA 5KFHA 4C3IB 2W6NA 2TMPA 4LF4H 4O1NA 2FPPB 4TV8F 2L55A 2KA7A 2RBMA 2PZTA 1C30A 1SNMA 3PW2A 4ECZA 4RKBA 4F4YA 4GKJL 3NP8A 2D2CC 3S1QB 4HEDA 1GHJA 2PYKA 2HDLA 3K7UC 1G2TA 4GNXB 4JK1C 4LUOA 2ZM6Q 2HJWA 1E3PA 5CYUA 3WNZA 4ECUA 2B8FA 1UUPA 1PH7A 1T9HA 5BN5A 4Q45A 1KDAA 1Q86C 4PZ6A 4R8IA 4R8UA 1QJOA 3KLSX 1JXLA 1ZHSA 3NGDA 4LAAA 4DFAA 4IJHA 1U0LA 1EY9A 5M5WH 1S0NA 3J81L 4IFDG 1ZKOA 1Q90A 3W1BA 4G3IA 2Z6KA 4EBEA 2W9BB 4DPGA 2MQHA 4ODGA 2E2HA 4LSAA 5LMUL 2X69A 4IUPA 1E24A 5HBRB 4O2DA 2HHHQ 2PQAA 4H02A 1CK1A 4LW1A 5KG4A 1I4XA 1VQAA 4IN3A 4EYIB 1U4RA 2E74C 4JI0L 2XCPA 4B3MQ 1SJHD 1UNSA 4DAYB 2JN4A 2Z0SA 1AN7A 4YY3L 1I4QA 1X3EA 4MTNA 4A93H 2Q8IB 3N41B 3LMLA 3T16A 3I56A 4OO1G 1VQJA 2CWAA 4YBZB 2IBKA 3CQZH 1N33L 2F4IA 3FMAA 3RB3A 4RZRA 1UE6A 2E2JH 2FMMA 2B2TC 3CCJA 1N8RC 3JC66 1F77A 1BUVT 5CA1F 4YHHL 3FPPA 2WAQB 4G57A 5C0XI 1BJTA 1TWHB 2VQFL 1VBGA 4QUCA 3OWEB 4GS3A 4ED7A 4RNMA 1KJQA 3NQTA 3BDLA 1X56A 2MO0A 4CJ1B 4GKJH 4ED8A 4A3KG 4ECRA 4O42A 1E4EA 5I2XA 2XWBB 2UXDQ 3G4SA 2R6GA 4RMFA 2KVMA 4U7CA 2VQEQ 4M7EA 1HQRD 1XDNA 3RF2A 2X0SA 4YIJA 3HOXB 1LTGD 1I4HA 3BG3A 2YS7A 3T1HH 5A2QL 4DR3L 3OSNA 1NAPA 1VDZA 4HIKA 3K81C 4ZYSA 3BQ1A 4G7OC 3I4MG 2F4VL 4JI8H 4DUZQ 4UY8C 4RNOA 2NVQB 1S5BD 1VQLA 3K6OA 4N9PA 3ULPA 4IUVA 1Z2PX 3EVQA 3Q8DA 4R1JA 2JA7B 2FKLA 3H0GG 4BY1B 5IGEA 2W7PA 1E2WA 3A8IE 1R9TH 1VQPA 2F0GA 3PO2H 4FS2A 3R8BA 1YZ6A 5CORA 2IP4A 2AHOB 5E3FA 3H40A 1Y1VG 4CDDC 5KFUA 4IUUA 2OTJA 3GTLB 4AH6A 3J7A5 4JI2L 2XWJB 4DV0L 3H91A 1HNZL 2J9GA 4IR1A 2UXDH 2BCOA 1BNZA 3HOWB 3SK6A 1SYGA 1YHAA 3PR4A 1RK6A 1HNWH 1SNPA 3H09A 4ZI7F 2IA6A 1PLFA 4A3LH 2EJGC 1DYQA 3VR5A 4POGA 1V1OA 2DUDA 2HUGA 4A3GB 2C2EA 2M05A 1IOVA 2XGTA 3ETJA 1BGWA 2K01A 1STEA 2PMZB 2FMCA 3CXCA 3HOUG 4EBDA 4ME3A 2PW5A 3TREA 5GAHC 3I70A 3KFUA 2R86A 3J81W 3KK7A 4DL5A 3BZKA 3NPPA 2ZJTA 1SYEA 3M7NA 4LF4L 1TS4A 4RCNA 1K8MA 3C0FB 4GKKL 3JAME 5C44H 3TQTA 4OO1I 2F0WA 1U4PA 2V5AA 5KFZA 1WTQA 3IFDA 2DLNA 4L1KA 2EYJA 1EQVA 1R4PB 2NYZD 1DIKA 4CHTB 2UUCQ 5JUMA 1PFBA 3S2DH 1RIPA 1UWVA 4A3CG 1I7NA 4DR7Q 1PRTF 1Z2NX 1XNQQ 4HJ8A 3H20A 1E0BA 4F4ZA 1TWHA 2DY7A 1EU4A 2WV6D 1YHQA 1CHPD 1TXYA 2NVTH 4C5AA 5KG5A 5EWGA 2R6FA 4X62H 5IYZF 2BE5C 4MN3A 1VQBA 2G5DA 1C3OA 4LJZC 3PGZA 3SK8A 5CV6A 3MFIA 4IUNA 3GTJH 3R3OA 5EPJA 3G71A 2C9OA 4JI5L 4O3NA 1YITA 2EOTA 3KYHC 1S5FD 4O3OA 4LF7H 2B2TA 2R92A 4KLKA 2K5NA 3T4AC 4B3ML 1K83A 4A3CH 4CJ2C 4KKUA 2B29A 1RJTA 4JI1L 5JJZA 2I0QA 4ETSA 2E2IB 1NSNS 3UE1A 1KL9A 1N36H 2RGRA 2ZTCA 2R7FA 2RCNA 1Z7TA 3OMCA 1TWGA 5LOVF 1Y1WB 3MR3A 1CZWA 1HR0W 3VPDA 4ALPA 3VYRA 1KNEA 3GP7A 1Y1WG 1WH2A 3M9NB 3DXJC 5IGGA 5A2QW 1VQFA 1KDBA 3L2PA 2OQKA 1ASYA 3S1MB 3HFZB 4YCVA 1DCZA 3JZIA 3HS0C 5KFDA 2J6UA 2ZJRA 1A0IA 1JLLB 4C3IH 1LTTD 3F8TA 2TSSA 1SCUB 3Q8PB 1GYFA 1XX8A 4F87A 5KFIA 2DJFC 4A93G 2NZHA 3M4QA 4OONA 4MAMA 3RFCA 2CH4A 2OQ0A 5KFXA 2WB1G 5EKLA 4KMUC 3M4IA 5C5JA 3HOXH 1M6VA 1D5MC 1RJPA 3RV4A 3H4BA 3K57A 4GLXA 2VQEL 1EYCA 3TQYA 1AW7A 3GTQB 4QMGA 4FU0A 1X55A 4DR4Q 2A6HC 2CWPA 3KDFA 5KFBA 2JA5A 2ZDQA 1K28A 3G6YA 1YHBA 1CQJB 3GIJA 5IOCA 5DAUA 5HGQA 2YZNA 2A8VA 4BY1H 5FJ8H 4X66H 4C3HH 4M8AA 1UE1A 3PF5A 2K28A 1EOTA 3S2HH 4ED3A 2E5LH 3HKZG 2NN6H 1S40A 1DOKA 3A7LA 4L6TB 5FLXc 1Y1VA 5KFSA 3E9HA 1VMPA 1BNCA 4LF6Q 3N6XA 4QIWB 4TKOB 5IT9E 2PBZA 2AMCB 5EJWA 2D62A 1CUKA 2VR1A 1Q1EA 1J5EQ 2D0PA 2B2WC 3Q1KA 4DR3H 1O7LA 3GLKA 3HKZB 4PQXA 2R7MA 1NBWA 3KLSA 1XJVA 2WB1B 2WE6A 4ME5A 1BVSA 2VUMA 1IHZA 4X64L 3HOUB 3GTOB 1KNAA 5FLMG 4A93B 3HOYH 1GSHA 1ET6A 1KHIA 4R7RA 3SGIA 1GJXA 1BCPC 3U9SA 1RODA 1BXRA 4JI5H 4NMZA 2J6TA 4LWCA 3VA7A 4YAKB 3FKIB 5J1ZA 2VQFH 4YAJB 1CSPA 2G9DA 4ABNA 2B2WA 4Y52H 2WKDA 5G3LD 4EQNA 3T5JA 4M9UA 4EG0A 3KLRA 4MA5A 2ES2A 1LT3D 2LXJA 5FD5A 4X65H 1S5CD 3TINA 3NBHA 1QWYA 5KNBA 1SJED 4UP8A 1EL0A 1E22A 2BA1A 1ZYRD 4MV1A 2F0MA 1N9WA 1IXRA 1U9RA 5KT5A 2AQ4A 4RU9A 2Q2TA 3CQZA 4J9PA 1UC9A 3OTOQ 1IBMH 1K73C 5M3FG 1JT8A 1TWCB 3OIPA 1XTCD 3OMGA 4AYBB 5AJ3Q 1Y1WA 3RJ0A 3RV3A 4LF8H 5JJLA 1WYDA 3JAMW 3RB0A 1LTAD 2ZT9C 4U68A 5C5MA 2Q8TA 4X64H 5LMNW 1D7QA 2N8NA 2PVPA 3KOJA 1XPUA 2NU6B 2AKWB 4C5BA 1V4YA 1X3QA 2DN8A 5LMNL 2BH2A 1WCMB 3I8ZA 3PSIA 2CCZA 1PVOA 3KHHA 4FP5D 3AB9A 3WOFA 1KRTA 1HR0Q 2MPMA 1HFNA 3RZDB 1G8ZD 3N8DA 4IOCA 1L2FA 4K0KL 1JOOA 1WCMH 5D8DA 1EWHA 5C4XG 2B3GA 4ECQA 3ULLA 5I2YA 1TT2A 1E4GT 4HCEA 1QZHA 1RDPD 2VXWA 2IX1A 2B63B 4DR1H 3GTMB 1RYSA 5IP7H 4MTEA 5DG7A 4NB3A 4Q0FA 3BABA 3UDIA 3DEOA 4GKKQ 3VPBA 2BOSA 1GD7A 1S5DD 1HH2P 1V1PA 4PZ8A 3CP0A 1B7YB 3SI8A 4CC6A 4J0MA 4Q8EA 3MC0B 4V0BA 4BY7B 5FLMH 2UVWA 1HRJA 3RMHA 1AZQA 3E0JA 1TWAH 2M00A 4KY6A 4E6IA 4TSSA 2XC9A 1S0MA 1ONLA 1E7ZA 1SMYC 3E3XA 5AFWA 2AGOA 1CSQA 4CBVA 3BAAA 1H95A 5BPHA 3Q8QB 1TS5A 3GTQH 3KF8A 1HZCA 2E8GA 2QW7A 1H9RA 3VYSA 1KIXA 4Q8FA 3AFQA 1Q8KA 2W9CB 1TS2A 2XVSA 4WJ3M 4YB8B 4EFEA 3NK9A 2NVXA 2UUCH 1STBA 4X3TA 3A5ZB 4RGNA 1ET9A 2P0AA 2CFMA 1AEXA 5IP9H 1VQ4A 4X6AH 4DV6H 1AN8A 3T51B 2YU9H 4C3HG 2J6SA 2E75C 3CD6A 4I50F 4QWEA 3KLWA 2HGSA 1DOLA 5C4HA 4LUVA 4MV6A 1A63A 2F4VQ 1I6HH 4EYHB 4DUYQ 2O4XA 2RHQB 4K5XA 4EGJA 1KDCA 3E5SA 3K0XA 1DV2A 2RGVA 4DV7H 3UFXB 1L2ZA 3CCLA 4CDCC 5KGUA 1BBWA 2UXBQ 4JUZA 4KHPQ 5E4XA 3QFFA 2NVYH 2E2IA 4ZAIA 3HEJA 1I94Q 1LTRD 2W6OA 3RUZA 2R8HA 4C3IG 4F4XA 4ECXA 4IWXA 2ZTDA 4J9OA 3VPCA 4JOIC 1JCKB 1L0YB 5DM73 3C1EA 3HOVB 1GUTA 3HRZC 3MFYA 5KT6A 4RB2C 1KAWA 1HCZA 1G51A 4I7AA 3MR5A 2KEEA 4O0AA 2Y0SB 1T5EA 2DPIA 1ICWA 1KQSA 4ZOLF 4BBSB 2QDBA 4KKTA 4UDUC 5CR3A 1VQ8A 2CW8A 3S17B 1ML0D 2EJMA 2F0EA 3S1MH 2GLTA 2UU9Q 4JBKA 4UCTA 5JVDF 4JI7L 1X3FA 2O03A 4APMA 1IYUA 1TWAA 2V1CC 2UVVA 3OHBA 3A56A 2ATWA 3LGJA 1O7IA 1S3OA 2WACA 2L15A 1XXGA 3HKZE 2PZWA 4H44C 5E1FA 4LFAH 4LF7L 5ELCA 4FF4A 3I4NH 2R7ZG 1CFMA 1FNWA 4J6HA 3OTOL 1DJRD 3NELA 3DM1A 1JB7A 2Z1CA 2XRSD 2R7ZH 4RNNA 5KIXA 3HXLA 3T56B 2Q2IA 3Q23A 4A3JH 3J80i 4LF5L 4DR5H 2NZ1D 1ZXTA 5C4XH 3HBLA 1NNXA 1SE2A 4EQPA 2IX3A 3QR8A 5FO7B 1Q8IA 1H9SA 3A8KE 2EY1A 1Q7YC 1JX4A 5BN3A 2R8JA 1B33N 4A3DH 2EY5A 3CVZA 2A68D 2X6GA 4GZYC 4HR7A 1II3A 1B6SA 2JA5G 2BE5D 4DV0H 1SRUA 3GV3A 4Q43A 4DR7L 3PUVA 3I90A 3G8CA 1N32H 5EKKA 3BQ0A 4YP3A 2QCPX 4R9WA 4UCSA 4ED1A 2XCLA 4JC0A 4C1NK 3PQIA 5IGDA 4A3FG 2B63H 1CA5A 3QZ7A 1X54A 2JA5H 1I4GA 4KHPH 2NU7B 4PDBA 1S4ZA 1PZJD 4A3EB 1FYCA 3H15A 1JC7A 1FVIA 1IBKQ 4K0KQ 5KG6A 3J80E 2FFKB 1JJGA 5GONF 3UDGA 2EZVA 2EJFC 4K8IA 4HQ6A 1HFGA 3FKIA 2IMWP 1F2MA 2KHSA 2R7KA 1KEEA 1UC8A 5K5PA 4LF8Q 5C4JH 1AUVA 1CKOA 1FR3A 1UAPA 1ZETA 3GILA 3H4DA 1JJ2A 2R93G 4LFBL 4XZ3B 2A19A 2UU9H 4L5RC 4X3KA 2O5JC 2C35B 4RH6A 3HOXG 4JYAH 1UEBA 1PFMA 2NBFA 1HA5A 1L1OA 2ZJQA 3J81j 4IAJA 5KG3A 3T5HA 3GTQA 3MJFA 4FM9A 4JI0Q 4RUCA 2JXMB 4RHRA 5FLXL 3CCRA 1SR3A 4A3MG 2PCFB 4IZ8A 3RLFA 1HJPA 5LL6X 2MP1A 3G6EA 1XMOQ 1WI5A 4X66Q 4K5WA 1A2UA 4O3RA 1TWCA 1WSCA 5M5WB 1A3TA 4JV0A 1SMXA 3BZDB 4ZRZA 2KOLA 2C22A 3IL8A 5CA0F 4R4TA 2CQOA 4NXNH 1D2BA 1T94A 4ID6A 2KSWA 5IWAQ 1H9JA 3PF4A 4QWDA 4DK3C 2O2LD 3MZ5A 5J22A 5DEHA 3KBGA 3N43B 4O3QA 1XMOH 2OEOA 4A3BH 3FPUB 4DR5Q 4HNTA 2PMZE 5D1PA 3OHAA 1A6XA 5CGKA 5EDWA 2K75A 1LTSD 2HD3A 4ZUIA 4R4CA 4QW9A 3KJPA 4DR2L 4OX9Q 1N34H 1B9MA 4H0LC 4JV5Q 1J8IA 1SMYD 3GTOA 2EYMA 3EFXD 3W1GA 2VNUD 2B63A 3J7AF 5M5XB 1I94H 2IY5B 5ELDA 3PIPA 2K7VA 4DV3Q 2K33A 3A7AB 2N49A 2NU8B 2F0OA 1B04A 4Q44A 1FJGH 4FS1A 3M9BA 2B39A 3C3LA 1MSHA 3I2ZA 2VY3A 1JWUD 1C4QA 2PQEA 4KHZA 1EIYB 2PPBC 3VR4A 5IYDG 4P74A 2JK8A 3GD7A 1RTNA 5EKIA 1J9OA 2JA7G 1SNDA 4WFN3 1PZID 3OUUA 3QZ8A 4O3SA 2VQFQ 4LFCL 1PTOF 2R7LA 1SYFA 3NTHA 4O3PA 4FO2A 1TQOA 4B3TH 5LMNQ 3M7GA 2K5HA 4DR4H 2I5LX 1KRSA 5M5YH 2YTXA 2C5CA 5KFNA 4DV1H 5GAGC 2LSSA 1PYBA 1EIGA 4XQNA 1G91A 4A3BG 5M5YB 2LKVA 2N55A 4A3DG 1EYAA 3PUWA 4MV3A 2UUCL 1VQGA 3H0GH 2NU9B 1LYLA 3GTKA 4OIJA 1RD9D 4PG3A 4KN4C 2MNAA 1PK8A 1TIID 1VQIA 3S2HB 3PN1A 4B3RQ 3U50C 3IKJA 2GVAA 4PMBA 5K36H 2M2LA 1D8LA 4AYBG 1R9TB 2JSOA 1PH9A 1SEIA 1IL2A 3S15B 4DV7L 4HJAA 1BXTA 3NHHA 2WINB 3AQQA 5EPKA 4YJ3F 2JEFA 4GN3B 3FRPB 4WJWA 1IBLL 3KTMA 4FDBA 1IL8A 1SYXB 5KG7A 1B1ZA 3TQ1A 2JE6I 4P75A 2JA8G 3LWBA 2QEXA 4R8NA 1LM0A 1LABA 2EDGA 1FGUA 2K5VA 4DV1Q 3K59A 1OO9B 4JI1Q 4CKBA 2XN9C 2AGPA 2F0HA 2OT2A 2Z9HA 3HOYB 4BS9A 2IL8A 2YV5A 1KD1C 4LF5Q 1I3QH 4YWLA 2VPSA 1NUCA 5L1IA 5JPNC 2ICIA 3D8GA 4G7ZC 1LT6D 4A3GH 4ZK9B 4RGMA 1VQHA 3DLLA 1GHKA 3D31A 1X9NA 4YY3Q 1EFWA 3FKIH 4DAMA 1KBLA 3ITPA 3LX0A 4OO1H 4LF7Q 1LTBD 4DLKA 2ASLA 5IODA 2R82A 1XWEA 1CQFA 4JI7H 1B2TA 4OL7A 3F8NA 2V4DA 1JIHA 4JI8L 3KXYT 2F4VH 3DM3A 2E2HB 3M4PA 5EGTA 3IG0A 2CW0D 5BPFA 3EJIA 4GOPA 4BBSH 2BR0A 1AUXA 4XYOA 2JA9A 1ESRA 1W6JA 3MEFA 5KRUA 3RZOH 3O13A 5CC4A 4KD4A 4Y7NB 2KCMA 3MAQA 5CAEB 2C28A 1TWGH 3PO3G 3A8JE 3EYYA 1QG7A 4DAYA 3FP9A 3KF6A 4A3LG 3KHGA 4KV6A 4IFDJ 1YNNC 1YJNA 3GTKH 3KJOA 4JG2A 4IFDH 4XYMB 1EY0A 3T1YL 4IUTA 5BR8H 1GSAA 1VQKA 3NWTA 2RDHA 1IZ6A 3TMEA 2JYOA 2NVTB 4JI4Q 2WAQA 4MV7A 3L4JA 4NXML 2PI2E 2RHSB 5C3XA 5HURA 1S72A 4I7ZC 4NKLA 1YJWA 5M3FB 1PRTC 1TU2B 2R93A 3FKIG 3HOWG 4X3SA 4JI0H 4Q0YA 1PV4A 5KKNB 1ZQ7A 2PZUA 1B53A 1QZGA 4AYBA 4QF4A 2E5LQ 2BQUA 2UXBH 4F88A 3GQBA 3RB4A 1I6VC 3I4MH 3X3MA 1FNVA 2K03A 3RNUA 3GTPA 3SE0A 1I3QA 2MFIA 4EGVA 3CCSA 2R85A 2NN6G 1CS0A 4QJFA 5C3EG 4A3EH 3STBD 2V4QA 2QDLA 3NEMA 3RTXA 4B3MH 2V4RA 1YNJC 3HZXA 3PV0A 4NP5A 4UCVA 4DV2H 4DL4A 1KLUD 5JVLA 1TWAB 2B2VA 3F2CA 4ZUJA 4DU9A 2H5XA 1M7JA 2YS6A 5EWEA 3BJYA 5KEEA 2KUMA 3TS2A 5L1JA 1WJJA 4F4WA 3R93A 3CCMA 1STGA 3Q6SA 3CHBD 4X62L 2NVQH 3PW7A 3M9MB 3T1YH 3B6YA 1M0WA 5FKAC 3GTLA 4IUQA 5IY0A 3K5NA 1VF7A 2Q8RE 1PXUA 3P1HA 4CKEA 3S1RH 5KFGA 3RGXA 2UUBH 2UUAQ 4RWSC 1PMRA 5CV7A 4IPDA 1YNXA 2MHVA 3PO2B 2DZDA 3D0FA 4ZQIA 4K2LA 1N36Q 2IPKD 2K52A 2NZOA 4YR3A 4C3HB 1PYSB 2Z4IA 3LWUA 5M3MH 3VYUA 5KFPA 4DL6A 2K6AA 5KYIA 1M8AA 4J1MA 4IRDA 1S03G 2WKCA 5C0XJ 3OW2A 4NW2A 1QUQA 5JPMC 2WTFA 3GIQA 2NB0A 4OXPA 3C2PA 1Z47A 4DNTB 4GKKH 3HOWH 3PUYA 5KFQA 2SEBD 1TKWB 5KFTA 1ENAA 4GLVB 1XMOL 1DGSA 1EEFD 1PTOC 3MWDA 2DY8A 2JA6H 2BQRA 2Z4HA 1HNXL 1BDOA 4HYKA 3KUPA 1WTXA 2A73B 4JV5H 2UXCQ 3D4WA 1D1IA 3KHLA 4DXFA 1XMQH 4DR7H 2V9WA 5IT9L 5JJIA 3GTPH 5KT7A 4LFCH 1LT5D 3KALA 1TWHH 3AMUA 3I4NG 4DR4L 3V4SA 3JAMc 1X3GA 1HNZQ 2R8KA 2K5QA 3VA5A 5DLFA 4DV3L 3NBIA 2HIVA 4FXDA 3MFGA 3GV8B 5CBAE 2K14A 4IPGA 1YIJA 1A15A 1JWSD 4LF6H 4HIDA 1VQOA 1WTHA 1BO0A 2WIIB 4BWSC 2PW7A 4IR9A 1CHQD 3JAML 1WTPA 1NJIC 4A3IG 4LH6A 3X3NA 3JSLA 1VAJA 2EE1A 4GN5A 1PFSA 4A3MB 2VA2A 4IFDI 2L12A 1CI3M 1C0AA 2R87A 3CPFA 4IURA 3N44B 5FPOA 1OXSC 1K0SA 4LK1C 2EY6A 5KFLA 2ZM6L 5JEAJ 2PQAB 2MO1A 3EN2A 3H0GB 4BY1G 1TWFH 4QIWE 1H9KA 1B3QA 3L9AX 4IHJF 1NY4A 2DJGC 4YCUA 1XNRQ 1Z6HA 4N9TA 5C4ZA 3DWAA 1AP0A 2ZM6H 1GO3E 1TWFB 5F9LA 2JA6G 1EUJA 3VR6A 3U9TA 2KCNA 4BWGB 1SN8A 4JI5Q 2EYLA 4J9SA 3T13A 3U9OA 3PIO3 4PMWA 2W6ZA 4DR6L 4FBTA 5C8YF 2FINB 4UP9A 4X66L 4JBMA 4N8FA 3G6VA 4ED2A 4DL2A 3TRZA 1O75A 4V190 1L0XB 1M4VA 5H1SE 4YHHH 2VZAA 4DNRB 3E6ZX 4HMIA 2ZDHA 1O7ZA 4A2AA 4BBRH 1B9NA 3OOCA 2JJQA 1NCVA 5E7NA 3M85A 5KT3A 4JV2A 1VCIA 4L5QA 3KDFB 3QG1A 1EWCA 1N34Q 3Q2OA 1Y1VH 4RUAA 2ATLA 4RFBA 5J39A 4BBRB 4QIWA 1IYJB 5KFWA 4TQRA 4JI4H 3GIDA 3JRWA 4CJ0B 2EVBA 4A4IA 4BBRG 1CQIB 1XMQL 4POFA 3CRLC 3J7AV 1EQTA 5J2UF 1ICFB 3V6KA 3H6MA 1Y1VB 1A8VA 2F0VA 1EYGA 3Q8SB 2YRXA 4GOPB 1Y69U 1RHPA 4DR2Q 4OX9L 3R5FA 1ILPA 2WB1A 4DL3A 4NXNL 3RB6A 1STAA 4RGOS 3T5LA 1BQQT 1DZ1A 5DLQE 1W3SA 2JEBI 5ELOA 5L1KA 2D0OA 4IJLA 1I50B 5EZYF 3RD4A 2WAQE 3S2DB 2LFNA 3K5MA 1PZKD 1ASZA 4OHJA 2ZXOA 1G2SA 1TVXA 4XQQA 4C2MB 1TAEA 4MA0A 1GGOA 3HG9A 2VUMB 1S9FA 1VQMA 5LL6b 2WDTA 2RF4A 3G6JB 4DK6C 2B2YA 1H9MA 3BQ2A 4OELB 1XYIA 2XTIA 1PDQA 3JAMi 5DG9A 2NUAB 1Z2OX 3STBC 2EIFA 4JI3Q 1XNRH 4B3RL 1EY5A 2A6EC 1WOCA 1LV9A 1A3VA 1YNJD 2RDGA 4J9RA 3GTJA 2OF1A 1F9QA 4FVMA 1WTVA 2EYFA 1JOQA 3ORRA 3OW7A 3OSOA 4IQZA 3Q24A 1K83H 3FDSA 3BZCA 3L4KA 3L7ZC 2GPSA 3NBHB 3ZYYX 2VUGA 2HVQA 4DGZA 3SXHA 3BDCA 1HXYD 3GTPB 1KJ8A 4A3IB 3PO3B 3CQZB 1Y1WH 4XYLB 1N33H 5D3DA 2E2JB 4P73A 4DV4H 1HNXQ 3R5HA 2HIXA 1VQ5A 3C46A 1DD2A 3PO3H 4RKLA 3Q22A 1SSOA 1EU3A 4P2CB 2EYHA 4JI1H 4JI4L 5I47A 2LMCB 1KTKA 1LLRD 4AQYL 1WTRA 2Z8LA 1LT4D 3CPWA 1GUOA 2LY7A 2XRQD 1KC8C 3BJUA 4CDEC 1HR0H 1KJ9A 3TZUA 4KY5A 3RR5A 1DOMA 1VQNA 2W57A 3JSNA 2QK4A 2F0IA 1EYZA 2CZGA 5C0XH 1GKHA 3U4ZA 1EFID 3GIKA 4RCOA 2YCHA 4GNXC 3J81i 2I80A 2J0TD 4Z9CB 5L1LA 2ZDGA 3CAMA 2JEGA 4BY7G 5DG8A 5C4XB 1D5ZC 5D65A 3GTMA 1N33Q 1KXLA 2PN1A 1JMCA 5IWAL 3NUCA 1X65A 2QEJC 4XT3B 5M3MG 1HUMA 3R23A 5JVH3 4C3JB 3SVMA 2HVRA 2D5DA 1V9PA 1D5XC 4LF9Q 4IWYA 3MXGA 3PIOA 2NTSA 1O7YA 3LP8A 4UP7A 3HOZH 3P7JA 2RSOA 2UUAH 2K5WA 2W8KA 1KJIA 2FJ2A 1XNQH 2F0SA 1A2TA 1MHWC 3UQ8A 4ECTA 2F1MA 5CV4A 3HOUH 5LYJF 1CKNA 4GOPC 4L5TA 4LFBQ 1I7LA 2KEDA 3CU7A 3RAXA 1WD1A 4C1NI 2F0JA 5GAEC 2GN5A 5G3LF 2FK1A 1XPOA 3EQLC 1GUGA 2X6LA 1VQ9A 4TQSA 3IRBA 3S1QH 3K5IA 5IP9G 2CQAA 1MJEA 1K8AC 4J9MA 3FHWA 1KAAA 1BBXC 1EIHA 3MEHA 4RAZA 1WR2A 4DV4Q 1AE3A 4QQBX 2XD4A 2JA6A 1BCPB 2CW7A 4UPAA 1OTCA 3RZOB 2K1BA 4WJ4A 3MR6A 1S0OA 2XGPA 4XYQA 1JICA 2L11A 4K2KA 1T36A 3EPGA 5LL6S 3WWVA 4MV9A 1MI2A 1I50H 3K0YA 2BDNA 2F52A 3T1YQ 1PYWD 2FLLA 3RBDA 4E4TA 1SYCA 4EFBA 1CA6A 1MD2D 2ASJA 2AWNA 5CB4F 4ED6A 1V51A 3H3VC 5LP6F 2BH8A 2CVRA 2GA4B 4HAEA 1O78A 3F2UA 1OXXK 2I5HA 2MGSA 1CM9A 2EY2A 1XPRA 1QUQB 1K1SA 1GOZA 5ELEA 4JI3H 3ND8A 4FBUA 3A5UA 2Y0SA 2A68C 1JKJB 1MGSA 3K8AA 4L8JA 4O4LF 3I91A 3J80L 1VQ6A 2C00A 1FNUA 1P16A 1LTID 2VPQA 1VS0A 3I55A
chains in the Genus database with same CATH topology
4FDBA 2IHFA 5C3EH 4A3EG 2JE6I 4KLKA 2K5NA 4P75A 2QEXA 2JA8G 4B3ML 5GADC 1EIFA 1LM0A 4A3CH 3S16H 3KF6B 2B29A 2I0QA 4JI1L 1FGUA 2K5VA 4DV1Q 2KHIA 4JI1Q 4DV1L 3UE1A 1KL9A 3UE0A 2ZTCA 2R7FA 2RCNA 2YV5A 1KD1C 4DR1L 1I3QH 4LF5Q 4YWLA 4DR1Q 1HR0W 1UE5A 4ALPA 4IPCA 4A3GH 3OYYA 2UU9L 1VQHA 3DLLA 1Y1WG 3D31A 4A76A 4YY3Q 1X9NA 1EFWA 1NTGA 1VQFA 3FKIH 3L2PA 2OQKA 4DAMA 4DV6Q 1ASYA 3AFPA 4JBWA 4YWKA 3VDYA 2E2HH 4OWXB 3HFZB 4YCVA 5IT9c 4LF7Q 2ZJRA 1A0IA 4C3IH 2WFWA 3F8TA 4RG1A 1C7YA 2HHHL 3HOVH 1FJGQ 4JI8L 3DM3A 3M4PA 1U5KA 2NZHA 3M4QA 4A93G 4OONA 4DR3Q 1MJCA 2OQ0A 5GQOA 1Y14B 2WB1G 4BA1I 4GOPA 1AE2A 3U58A 3HOXH 4L5SA 4BBSH 2JQOA 2Y0SE 4IOAA 3G48A 2JA9A 4OWTB 4DKAC 1BKBA 2VQEL 3U4VA 4GLXA 3MEFA 3S17H 2R93H 5JJKA 3TQYA 3RZOH 2K4KA 3A74A 1PHJA 2KCMA 1K8GA 2KHJA 4X64Q 1EQQA 1L1OB 1X55A 3W5OA 4DR4Q 1XTDA 2CWPA 1TWGH 3KDFA 3CMEA 3PO3G 2VUMH 4BA2I 1YVCA 3E9IA 3FP9A 3KF6A 1YHBA 4A3LG 5HGQA 1P8LA 2A8VA 4JCVE 1CKNB 4BY1H 5FJ8H 1YJNA 3GTKH 4C3HH 3KJOA 3H3VH 4JG2A 1UE1A 4DV4L 3PF5A 3T1YL 1J6QA 4DNIA 3S2HH 1VQKA 3HKZG 1QVCA 3S24A 1S40A 3H3VI 4GNXA 5FLXc 3E9HA 1IZ6A 4X65L 4JI4Q 1SE8A 1LTLA 4X65Q 4LF6Q 1PH5A 5IYCH 4NXML 2PI2E 2RHSB 4R4OA 3RZDH 4GKJQ 1YJ9A 1VQCA 2AMCB 4HJ5A 1FJGL 1S72A 1N36L 2D62A 1W2BA 1YJWA 1CUKA 1G291 1Q1EA 1J5EQ 2D0PA 3FKIG 4B3TQ 3HOWG 2R92H 1PV4A 5HY6A 2UUBL 1NBWA 1QZGA 1XJVA 2E5LQ 1BVSA 1B8AA 1I94L 4X64L 5FLMG 5C0XG 3I4MH 1MKHA 3HOYH 3CMAA 3RNUA 2EXDA 1M1KC 1KHIA 3RLOA 2MFIA 3SGIA 3ZJYC 3CCSA 2NN6G 3CCEA 2ID0A 4QJFA 2KBNA 2NN6I 4LWCA 5C3EG 1HZAA 3STBD 4A3EH 1PH3A 4HJ7A 1Q46A 3NEMA 4JV5L 3ULJA 3CCVA 1QVFA 2Q2UA 3PV0A 4EQ5A 1CSPA 3GDEA 2R7DA 4Y52H 4GN4B 1WFQA 3F2CA 4DV0Q 1FL0A 3AEVA 1NE3A 2CKZB 2H5XA 2ES2A 2WAQG 3EIVA 2LXJA 4KI0A 3S1NH 3L0OA 4UP8A 1SROA 1E22A 1WJJA 2BA1A 3TS2A 3CCMA 1L0WA 1N9WA 1IXRA 4X62L 2NVQH 4P72A 2Q2TA 3B6YA 1Q82C 1N32L 1C9OA 5IY0A 3OTOQ 1XNQL 4AIMA 5M3FG 1K3RA 1K73C 3S1RH 1JT8A 2PNHA 2UUAQ 4LF6L 1IBML 2HQLA 4IPDA 1YNXA 5AJ3Q 1E1TA 3D0FA 5IYBG 5JJLA 1WYDA 2N3SA 2N78A 3CF5A 3PCOB 1N36Q 3J81c 2K52A 2NZOA 3CCUA 1PYSB 4C3JH 5M3MH 5LMNW 1D7QA 3HOYG 2N8NA 2OTLA 4LFAQ 3KOJA 1XPUA 3PUXA 1PVOA 2AKWB 2UUBQ 2PI2A 3F1ZA 5C0XJ 3OW2A 5IE8A 1QUQA 5LMNL 4IO9A 3PSIA 4L5RC 4OXPA 2CCZA 3T1HQ 2BH2A 1YI2A 1K9MC 1Z47A 2IT1A 2IX0A 3BU2A 3HOWH 1KRTA 3PUYA 1HR0Q 4DR6Q 1B70B 4MNOA 1LUZA 4JI7Q 4GLVB 5J3BA 4IOCA 2Z6KC 1XMOL 1L2FA 4JYAQ 4K0KL 1DGSA 1WCMH 3J7ZC 2B3GA 1PH1A 3ULLA 3RN2A 2JA6H 5C4XG 3GTLH 4AYBE 5IYCG 1HNXL 3RN5A 5EAYA 4APVA 4JI8Q 1SLJA 1QZHA 3ERSX 2IX1A 4KHPL 1UE7A 1HZBA 4YHHQ 2UXCQ 1IBKL 5IP7H 2OWOA 4A3JG 4NB3A 1Q12A 3J80c 5JJIA 4J15A 3GTPH 3UDIA 5FJ8G 4GKKQ 2AWOA 3GTMH 1GD7A 1HH2P 1A62A 1TWHH 1N32Q 4JBJA 4PZ8A 3CP0A 3I4NG 2K50A 1B7YB 3JAMc 3RLNA 3I4OA 4DR4L 2UXBL 1X3GA 3UDXA 1HNZQ 3ER0A 3F2BA 4LF9L 1PH8A 5FLMH 4DV3L 2HIVA 5K36G 2FXQA 1HNWQ 3PO2G 3K7AH 5ELNA 4DR5L 4DUYL 1TWAH 2K14A 4IPGA 1YIJA 4GLAC 4JOIA 4B3SQ 2ZTEA 1E7ZA 4BY7H 4X62Q 1CSQA 4YWMA 4HIDA 3MXNB 1VQOA 3GTGH 1H95A 1V1QA 1EQRA 3GTQH 4A3FH 4A3IG 1NJIC 1HZCA 2E8GA 4GN5A 1PFSA 1VQDA 2YTYA 1AH9A 1KIXA 3I7FA 1HNWL 3AFQA 1Q8KA 1I5FA 1IBMQ 2LXKA 4IFDI 1SFOH 4WJ3M 3CC2A 3NENA 5C44G 1C0AA 4C2MH 3CPFA 3EBEA 1VQEA 2F3IA 1OXSC 4QL5A 3A5ZB 2IHEA 3CW2C 5JEAJ 2ZM6L 4A3GG 2CFMA 2GVBA 2PQAB 2MO1A 3EN2A 4BY1G 4NXMQ 5IP9H 2QGQA 1TWFH 1VQ4A 2JA7H 4X6AH 4QIWE 2YU9H 1NY4A 4NXNQ 2ALYB 4YCUA 3CD6A 1XNRQ 1OXVA 1J5EL 3KLWA 1GO3E 1Z9FA 3PUZA 4LUVA 4HJ9A 1PH4A 1A63A 4DUZL 2JA8H 2F4VQ 1EUJA 1OXTA 4QY7A 2JA6G 1I6HH 1WCMG 3AYHB 2ZJPA 4DUYQ 1SN8A 1QVGA 3GO5A 2RHQB 4JI5Q 1X6OA 3K0XA 2JEAI 2Q2HA 3CCLA 2BA0A 4PMWA 4P71A 3HOZG 1BBWA 4BBSG 4DR6L 2UXBQ 1CKMA 4MZ9A 4JI6L 4JBMA 4UP9A 4X66L 3CCQA 4DV2Q 2NVYH 3GTOH 4JI6Q 4KHPQ 4IPHA 4AQYQ 3UDFA 1PH6A 4QGUA 3TRZA 1PH2A 1I94Q 4A3IH 5H1SE 1GVPA 3HOVG 2VZAA 1E1OA 2OCEA 5M5XH 2B63G 2ZTDA 3M4OH 4JOIC 4BBRH 2JJQA 5E7NA 3M85A 4B3TL 1VCIA 1KAWA 4L5QA 1G51A 4JYAL 3KDFB 4O0AA 1N34Q 2UXDL 1KQSA 3F2DA 1Y1VH 1IYJB 4GKJL 4XTCS 4A4IA 1VQ8A 3S1MH 4BBRG 1RL2A 2EQSA 4POFA 1XMQL 2UU9Q 2A1AA 4JBKA 4JI7L 3K7UC 4GNXB 1A8VA 1X3FA 4LUOA 2ZM6Q 1EYGA 4GOPB 1HR0L 2V1CC 1E3PA 4A75A 2ATWA 4DR2Q 4OX9L 2DGYA 1O7IA 1S3OA 3LGJA 1T9HA 2L15A 3HKZE 4DV5L 1PH7A 4NXNL 4LF7L 1Q86C 4PZ6A 4R4QA 3I4NH 2R7ZG 1G6PA 4IJHA 1U0LA 5DLQE 1W3SA 1TWCH 2JEBI 5ELOA 2VW9A 1MIUA 5M5WH 4PZ7A 2D0OA 4IJLA 3OTOL 4A3MH 1JB7A 3NELA 4IFDG 3TS0A 2WAQE 1ASZA 4JI3L 3W1BA 2Z6KA 3I55A 2Q2IA 2NVXH 4A3JH 3J80i 5AJ3L 4LF5L 4DPGA 2MQHA 2WB1E 4B3SL 1EOVA 1L1OC 5C4XH 5LMUQ 1VQMA 2RF4A 4DK6C 5LMUL 2I5MX 2VUMG 2XTIA 3JAMi 1Q7YC 4A3DH 1E24A 1NMFA 2EIFA 3STBC 4JI3Q 4B3RL 3K80C 4O2DA 3S15H 1K0RA 2E5LL 2PQAA 4H02A 2HHHQ 5JEAG 3E0EA 4LW1A 1WOCA 2JA5G 1VQAA 1SRUA 4DR7L 4JI0L 4B3MQ 4DAYB 5IYBH 3PUVA 2Z0SA 4YY3L 1X3EA 4MTNA 4A93H 1JJCB 1VQ7A 3I56A 4OO1G 1VQJA 2CWAA 1K83H 4JC0A 3BZCA 4A3FG 3CQZH 1IBLQ 1N33L 4TQUS 3L7ZC 1X54A 2JA5H 2B63H 1UE6A 3NBHB 1XMQQ 2E2JH 3CCJA 1N8RC 3H15A 4DV7Q 3JC66 1FVIA 1IBKQ 4YHHL 4K0KQ 1Y1WH 4DV2L 5C0XI 3CC4A 1JJGA 3UDGA 2VQFL 4P73A 1HNXQ 5BR8L 4HIOA 4GS3A 2HIXA 1VQ5A 3PO3H 1V43A 5C4JH 4LF8Q 1CKOA 1PA6A 1GM5A 1X56A 2MO0A 1Q81C 4JI4L 4A3KG 1N34L 2UXDQ 1JJ2A 4AQYL 3G4SA 4LFBL 2UXCL 2R93G 2A19A 3CPWA 2R6GA 4RMFA 4TVAB 1EWIA 2C35B 5IP7G 3HOXG 1YEZA 3BJUA 2VQEQ 1KC8C 1UEBA 1L1OA 2ZJQA 3J81j 4LNQA 4JI0Q 2HT1A 3RR5A 4LF8L 4DR3L 3A0JA 3CCRA 4A3MG 1SR3A 3K81C 4HIKA 3RLFA 1VQNA 1HJPA 3G6EA 5GROA 2Y0SG 4Y7NH 1XMOQ 1WI5A 4X66Q 2F4VL 3I4MG 2KENA 1GKHA 3KF8B 4DUZQ 4UY8C 4BXXH 3U4ZA 3HKSA 1VQLA 3T1HL 1NMGA 3ULPA 1SMXA 3Q8DA 4R1JA 4R4TA 3J81i 4GNXC 3H0GG 2R92G 2CQOA 5IYDH 3CAMA 1R9TH 4BY7G 1VQPA 3PO2H 1YBYA 5IWAQ 4OWWB 1N33Q 4DK3C 1YZ6A 3PF4A 1JMCA 5IWAL 2AHOB 1KXLA 1X65A 5M3MG 1Y1VG 4A3BH 4DR5Q 2PMZE 2OTJA 2QA4A 4NPSA 4AH6A 3J7A5 1BBUA 4JI2L 1V9PA 2ASBA 4DV0L 2K75A 4DV6L 1HNZL 4LF9Q 4R4CA 3KJPA 3PIOA 5M3FH 4DR2L 2YYZA 4OX9Q 4HIMA 4JV5Q 1YHAA 1JE5A 4UP7A 2E2IH 3HOZH 3M3YH 3W1GA 2VNUD 4A3LH 4POGA 4A3KH 2DUDA 1OXUA 3PIPA 4LUZA 2YTVA 4DV3Q 3HOUH 2IY5B 1CKNA 4GOPC 4L5TA 2N49A 4LFBQ 2XGTA 2WP8J 3M9BA 3I2ZA 2VY3A 1EIYB 5GAEC 4KHZA 3CXCA 2GN5A 3HOUG 1XPOA 5IYDG 4P74A 2JK8A 3GD7A 4ME3A 3TREA 4JI2Q 5GAHC 1VQ9A 3KFUA 3IRBA 3S1QH 5IP9G 3BZKA 1MJEA 2JA7G 2VQFQ 1K8AC 4YCWA 4LFCL 3FHWA 4DV5Q 3M7NA 4LF4L 5LMNQ 2K5HA 2VS1A 4DV4Q 2I5LX 1AE3A 1KRSA 2VL6A 5M5YH 5C44H 4GKKL 2YTXA 4QQBX 4OO1I 1YITA 2KCTA 1M90C 4UPAA 5GAGC 1OTCA 2LSSA 1PYBA 4WJ4A 4A3BG 5BR8Q 1Q1BA 3WWVA 2UUCQ 4LFCQ 1I50H 3T1YQ 2F52A 3PUWA 3S2DH 4A3DG 2UUCL 1RIPA 1VQGA 1UWVA 3H0GH 4A3CG 1XNRL 4IFDJ 1LYLA 4EX5A 4DR7Q 2AWNA 1IBLL 4PG3A 2MNAA 1HZ9A 1VQIA 2BH8A 1XNQQ 4HJ8A 3CC7A 4B3RQ 4R4IA 3U50C 1OXXK 2I5HA 3ICEA 2GVAA 1YHQA 4LF4Q 1TXYA 1XPRA 2NVTH 1QUQB 1D8LA 3TEHB 4AYBG 4XIGS 4BXXG 1PH9A 3S14H 1IL2A 4DV7L 1VQBA 4HJAA 3PGZA 3A5UA 3GTJH 3K8AA 4LFAL 2UUAL 3AQQA 3G71A 1VQ6A 4GN3B 4JI5L 1P16A 2R7ZH 1VS0A 3KYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FDB A;  2IHF A;  5C3E H;  4A3E G;  2JE6 I;  4KLK A;  2K5N A;  4P75 A;  2QEX A;  2JA8 G;  4B3M L;  5GAD C;  1EIF A;  1LM0 A;  4A3C H;  3S16 H;  3KF6 B;  2B29 A;  2I0Q A;  4JI1 L;  1FGU A;  2K5V A;  4DV1 Q;  2KHI A;  4JI1 Q;  4DV1 L;  3UE1 A;  1KL9 A;  3UE0 A;  2ZTC A;  2R7F A;  2RCN A;  2YV5 A;  1KD1 C;  4DR1 L;  1I3Q H;  4LF5 Q;  4YWL A;  4DR1 Q;  1HR0 W;  1UE5 A;  4ALP A;  4IPC A;  4A3G H;  3OYY A;  2UU9 L;  1VQH A;  3DLL A;  1Y1W G;  3D31 A;  4A76 A;  4YY3 Q;  1X9N A;  1EFW A;  1NTG A;  1VQF A;  3FKI H;  3L2P A;  2OQK A;  4DAM A;  4DV6 Q;  1ASY A;  3AFP A;  4JBW A;  4YWK A;  3VDY A;  2E2H H;  4OWX B;  3HFZ B;  4YCV A;  5IT9 c;  4LF7 Q;  2ZJR A;  1A0I A;  4C3I H;  2WFW A;  3F8T A;  4RG1 A;  1C7Y A;  2HHH L;  3HOV H;  1FJG Q;  4JI8 L;  3DM3 A;  3M4P A;  1U5K A;  2NZH A;  3M4Q A;  4A93 G;  4OON A;  4DR3 Q;  1MJC A;  2OQ0 A;  5GQO A;  1Y14 B;  2WB1 G;  4BA1 I;  4GOP A;  1AE2 A;  3U58 A;  3HOX H;  4L5S A;  4BBS H;  2JQO A;  2Y0S E;  4IOA A;  3G48 A;  2JA9 A;  4OWT B;  4DKA C;  1BKB A;  2VQE L;  3U4V A;  4GLX A;  3MEF A;  3S17 H;  2R93 H;  5JJK A;  3TQY A;  3RZO H;  2K4K A;  3A74 A;  1PHJ A;  2KCM A;  1K8G A;  2KHJ A;  4X64 Q;  1EQQ A;  1L1O B;  1X55 A;  3W5O A;  4DR4 Q;  1XTD A;  2CWP A;  1TWG H;  3KDF A;  3CME A;  3PO3 G;  2VUM H;  4BA2 I;  1YVC A;  3E9I A;  3FP9 A;  3KF6 A;  1YHB A;  4A3L G;  5HGQ A;  1P8L A;  2A8V A;  4JCV E;  1CKN B;  4BY1 H;  5FJ8 H;  1YJN A;  3GTK H;  4C3H H;  3KJO A;  3H3V H;  4JG2 A;  1UE1 A;  4DV4 L;  3PF5 A;  3T1Y L;  1J6Q A;  4DNI A;  3S2H H;  1VQK A;  3HKZ G;  1QVC A;  3S24 A;  1S40 A;  3H3V I;  4GNX A;  5FLX c;  3E9H A;  1IZ6 A;  4X65 L;  4JI4 Q;  1SE8 A;  1LTL A;  4X65 Q;  4LF6 Q;  1PH5 A;  5IYC H;  4NXM L;  2PI2 E;  2RHS B;  4R4O A;  3RZD H;  4GKJ Q;  1YJ9 A;  1VQC A;  2AMC B;  4HJ5 A;  1FJG L;  1S72 A;  1N36 L;  2D62 A;  1W2B A;  1YJW A;  1CUK A;  1G29 1;  1Q1E A;  1J5E Q;  2D0P A;  3FKI G;  4B3T Q;  3HOW G;  2R92 H;  1PV4 A;  5HY6 A;  2UUB L;  1NBW A;  1QZG A;  1XJV A;  2E5L Q;  1BVS A;  1B8A A;  1I94 L;  4X64 L;  5FLM G;  5C0X G;  3I4M H;  1MKH A;  3HOY H;  3CMA A;  3RNU A;  2EXD A;  1M1K C;  1KHI A;  3RLO A;  2MFI A;  3SGI A;  3ZJY C;  3CCS A;  2NN6 G;  3CCE A;  2ID0 A;  4QJF A;  2KBN A;  2NN6 I;  4LWC A;  5C3E G;  1HZA A;  3STB D;  4A3E H;  1PH3 A;  4HJ7 A;  1Q46 A;  3NEM A;  4JV5 L;  3ULJ A;  3CCV A;  1QVF A;  2Q2U A;  3PV0 A;  4EQ5 A;  1CSP A;  3GDE A;  2R7D A;  4Y52 H;  4GN4 B;  1WFQ A;  3F2C A;  4DV0 Q;  1FL0 A;  3AEV A;  1NE3 A;  2CKZ B;  2H5X A;  2ES2 A;  2WAQ G;  3EIV A;  2LXJ A;  4KI0 A;  3S1N H;  3L0O A;  4UP8 A;  1SRO A;  1E22 A;  1WJJ A;  2BA1 A;  3TS2 A;  3CCM A;  1L0W A;  1N9W A;  1IXR A;  4X62 L;  2NVQ H;  4P72 A;  2Q2T A;  3B6Y A;  1Q82 C;  1N32 L;  1C9O A;  5IY0 A;  3OTO Q;  1XNQ L;  4AIM A;  5M3F G;  1K3R A;  1K73 C;  3S1R H;  1JT8 A;  2PNH A;  2UUA Q;  4LF6 L;  1IBM L;  2HQL A;  4IPD A;  1YNX A;  5AJ3 Q;  1E1T A;  3D0F A;  5IYB G;  5JJL A;  1WYD A;  2N3S A;  2N78 A;  3CF5 A;  3PCO B;  1N36 Q;  3J81 c;  2K52 A;  2NZO A;  3CCU A;  1PYS B;  4C3J H;  5M3M H;  5LMN W;  1D7Q A;  3HOY G;  2N8N A;  2OTL A;  4LFA Q;  3KOJ A;  1XPU A;  3PUX A;  1PVO A;  2AKW B;  2UUB Q;  2PI2 A;  3F1Z A;  5C0X J;  3OW2 A;  5IE8 A;  1QUQ A;  5LMN L;  4IO9 A;  3PSI A;  4L5R C;  4OXP A;  2CCZ A;  3T1H Q;  2BH2 A;  1YI2 A;  1K9M C;  1Z47 A;  2IT1 A;  2IX0 A;  3BU2 A;  3HOW H;  1KRT A;  3PUY A;  1HR0 Q;  4DR6 Q;  1B70 B;  4MNO A;  1LUZ A;  4JI7 Q;  4GLV B;  5J3B A;  4IOC A;  2Z6K C;  1XMO L;  1L2F A;  4JYA Q;  4K0K L;  1DGS A;  1WCM H;  3J7Z C;  2B3G A;  1PH1 A;  3ULL A;  3RN2 A;  2JA6 H;  5C4X G;  3GTL H;  4AYB E;  5IYC G;  1HNX L;  3RN5 A;  5EAY A;  4APV A;  4JI8 Q;  1SLJ A;  1QZH A;  3ERS X;  2IX1 A;  4KHP L;  1UE7 A;  1HZB A;  4YHH Q;  2UXC Q;  1IBK L;  5IP7 H;  2OWO A;  4A3J G;  4NB3 A;  1Q12 A;  3J80 c;  5JJI A;  4J15 A;  3GTP H;  3UDI A;  5FJ8 G;  4GKK Q;  2AWO A;  3GTM H;  1GD7 A;  1HH2 P;  1A62 A;  1TWH H;  1N32 Q;  4JBJ A;  4PZ8 A;  3CP0 A;  3I4N G;  2K50 A;  1B7Y B;  3JAM c;  3RLN A;  3I4O A;  4DR4 L;  2UXB L;  1X3G A;  3UDX A;  1HNZ Q;  3ER0 A;  3F2B A;  4LF9 L;  1PH8 A;  5FLM H;  4DV3 L;  2HIV A;  5K36 G;  2FXQ A;  1HNW Q;  3PO2 G;  3K7A H;  5ELN A;  4DR5 L;  4DUY L;  1TWA H;  2K14 A;  4IPG A;  1YIJ A;  4GLA C;  4JOI A;  4B3S Q;  2ZTE A;  1E7Z A;  4BY7 H;  4X62 Q;  1CSQ A;  4YWM A;  4HID A;  3MXN B;  1VQO A;  3GTG H;  1H95 A;  1V1Q A;  1EQR A;  3GTQ H;  4A3F H;  4A3I G;  1NJI C;  1HZC A;  2E8G A;  4GN5 A;  1PFS A;  1VQD A;  2YTY A;  1AH9 A;  1KIX A;  3I7F A;  1HNW L;  3AFQ A;  1Q8K A;  1I5F A;  1IBM Q;  2LXK A;  4IFD I;  1SFO H;  4WJ3 M;  3CC2 A;  3NEN A;  5C44 G;  1C0A A;  4C2M H;  3CPF A;  3EBE A;  1VQE A;  2F3I A;  1OXS C;  4QL5 A;  3A5Z B;  2IHE A;  3CW2 C;  5JEA J;  2ZM6 L;  4A3G G;  2CFM A;  2GVB A;  2PQA B;  2MO1 A;  3EN2 A;  4BY1 G;  4NXM Q;  5IP9 H;  2QGQ A;  1TWF H;  1VQ4 A;  2JA7 H;  4X6A H;  4QIW E;  2YU9 H;  1NY4 A;  4NXN Q;  2ALY B;  4YCU A;  3CD6 A;  1XNR Q;  1OXV A;  1J5E L;  3KLW A;  1GO3 E;  1Z9F A;  3PUZ A;  4LUV A;  4HJ9 A;  1PH4 A;  1A63 A;  4DUZ L;  2JA8 H;  2F4V Q;  1EUJ A;  1OXT A;  4QY7 A;  2JA6 G;  1I6H H;  1WCM G;  3AYH B;  2ZJP A;  4DUY Q;  1SN8 A;  1QVG A;  3GO5 A;  2RHQ B;  4JI5 Q;  1X6O A;  3K0X A;  2JEA I;  2Q2H A;  3CCL A;  2BA0 A;  4PMW A;  4P71 A;  3HOZ G;  1BBW A;  4BBS G;  4DR6 L;  2UXB Q;  1CKM A;  4MZ9 A;  4JI6 L;  4JBM A;  4UP9 A;  4X66 L;  3CCQ A;  4DV2 Q;  2NVY H;  3GTO H;  4JI6 Q;  4KHP Q;  4IPH A;  4AQY Q;  3UDF A;  1PH6 A;  4QGU A;  3TRZ A;  1PH2 A;  1I94 Q;  4A3I H;  5H1S E;  1GVP A;  3HOV G;  2VZA A;  1E1O A;  2OCE A;  5M5X H;  2B63 G;  2ZTD A;  3M4O H;  4JOI C;  4BBR H;  2JJQ A;  5E7N A;  3M85 A;  4B3T L;  1VCI A;  1KAW A;  4L5Q A;  1G51 A;  4JYA L;  3KDF B;  4O0A A;  1N34 Q;  2UXD L;  1KQS A;  3F2D A;  1Y1V H;  1IYJ B;  4GKJ L;  4XTC S;  4A4I A;  1VQ8 A;  3S1M H;  4BBR G;  1RL2 A;  2EQS A;  4POF A;  1XMQ L;  2UU9 Q;  2A1A A;  4JBK A;  4JI7 L;  3K7U C;  4GNX B;  1A8V A;  1X3F A;  4LUO A;  2ZM6 Q;  1EYG A;  4GOP B;  1HR0 L;  2V1C C;  1E3P A;  4A75 A;  2ATW A;  4DR2 Q;  4OX9 L;  2DGY A;  1O7I A;  1S3O A;  3LGJ A;  1T9H A;  2L15 A;  3HKZ E;  4DV5 L;  1PH7 A;  4NXN L;  4LF7 L;  1Q86 C;  4PZ6 A;  4R4Q A;  3I4N H;  2R7Z G;  1G6P A;  4IJH A;  1U0L A;  5DLQ E;  1W3S A;  1TWC H;  2JEB I;  5ELO A;  2VW9 A;  1MIU A;  5M5W H;  4PZ7 A;  2D0O A;  4IJL A;  3OTO L;  4A3M H;  1JB7 A;  3NEL A;  4IFD G;  3TS0 A;  2WAQ E;  1ASZ A;  4JI3 L;  3W1B A;  2Z6K A;  3I55 A;  2Q2I A;  2NVX H;  4A3J H;  3J80 i;  5AJ3 L;  4LF5 L;  4DPG A;  2MQH A;  2WB1 E;  4B3S L;  1EOV A;  1L1O C;  5C4X H;  5LMU Q;  1VQM A;  2RF4 A;  4DK6 C;  5LMU L;  2I5M X;  2VUM G;  2XTI A;  3JAM i;  1Q7Y C;  4A3D H;  1E24 A;  1NMF A;  2EIF A;  3STB C;  4JI3 Q;  4B3R L;  3K80 C;  4O2D A;  3S15 H;  1K0R A;  2E5L L;  2PQA A;  4H02 A;  2HHH Q;  5JEA G;  3E0E A;  4LW1 A;  1WOC A;  2JA5 G;  1VQA A;  1SRU A;  4DR7 L;  4JI0 L;  4B3M Q;  4DAY B;  5IYB H;  3PUV A;  2Z0S A;  4YY3 L;  1X3E A;  4MTN A;  4A93 H;  1JJC B;  1VQ7 A;  3I56 A;  4OO1 G;  1VQJ A;  2CWA A;  1K83 H;  4JC0 A;  3BZC A;  4A3F G;  3CQZ H;  1IBL Q;  1N33 L;  4TQU S;  3L7Z C;  1X54 A;  2JA5 H;  2B63 H;  1UE6 A;  3NBH B;  1XMQ Q;  2E2J H;  3CCJ A;  1N8R C;  3H15 A;  4DV7 Q;  3JC6 6;  1FVI A;  1IBK Q;  4YHH L;  4K0K Q;  1Y1W H;  4DV2 L;  5C0X I;  3CC4 A;  1JJG A;  3UDG A;  2VQF L;  4P73 A;  1HNX Q;  5BR8 L;  4HIO A;  4GS3 A;  2HIX A;  1VQ5 A;  3PO3 H;  1V43 A;  5C4J H;  4LF8 Q;  1CKO A;  1PA6 A;  1GM5 A;  1X56 A;  2MO0 A;  1Q81 C;  4JI4 L;  4A3K G;  1N34 L;  2UXD Q;  1JJ2 A;  4AQY L;  3G4S A;  4LFB L;  2UXC L;  2R93 G;  2A19 A;  3CPW A;  2R6G A;  4RMF A;  4TVA B;  1EWI A;  2C35 B;  5IP7 G;  3HOX G;  1YEZ A;  3BJU A;  2VQE Q;  1KC8 C;  1UEB A;  1L1O A;  2ZJQ A;  3J81 j;  4LNQ A;  4JI0 Q;  2HT1 A;  3RR5 A;  4LF8 L;  4DR3 L;  3A0J A;  3CCR A;  4A3M G;  1SR3 A;  3K81 C;  4HIK A;  3RLF A;  1VQN A;  1HJP A;  3G6E A;  5GRO A;  2Y0S G;  4Y7N H;  1XMO Q;  1WI5 A;  4X66 Q;  2F4V L;  3I4M G;  2KEN A;  1GKH A;  3KF8 B;  4DUZ Q;  4UY8 C;  4BXX H;  3U4Z A;  3HKS A;  1VQL A;  3T1H L;  1NMG A;  3ULP A;  1SMX A;  3Q8D A;  4R1J A;  4R4T A;  3J81 i;  4GNX C;  3H0G G;  2R92 G;  2CQO A;  5IYD H;  3CAM A;  1R9T H;  4BY7 G;  1VQP A;  3PO2 H;  1YBY A;  5IWA Q;  4OWW B;  1N33 Q;  4DK3 C;  1YZ6 A;  3PF4 A;  1JMC A;  5IWA L;  2AHO B;  1KXL A;  1X65 A;  5M3M G;  1Y1V G;  4A3B H;  4DR5 Q;  2PMZ E;  2OTJ A;  2QA4 A;  4NPS A;  4AH6 A;  3J7A 5;  1BBU A;  4JI2 L;  1V9P A;  2ASB A;  4DV0 L;  2K75 A;  4DV6 L;  1HNZ L;  4LF9 Q;  4R4C A;  3KJP A;  3PIO A;  5M3F H;  4DR2 L;  2YYZ A;  4OX9 Q;  4HIM A;  4JV5 Q;  1YHA A;  1JE5 A;  4UP7 A;  2E2I H;  3HOZ H;  3M3Y H;  3W1G A;  2VNU D;  4A3L H;  4POG A;  4A3K H;  2DUD A;  1OXU A;  3PIP A;  4LUZ A;  2YTV A;  4DV3 Q;  3HOU H;  2IY5 B;  1CKN A;  4GOP C;  4L5T A;  2N49 A;  4LFB Q;  2XGT A;  2WP8 J;  3M9B A;  3I2Z A;  2VY3 A;  1EIY B;  5GAE C;  4KHZ A;  3CXC A;  2GN5 A;  3HOU G;  1XPO A;  5IYD G;  4P74 A;  2JK8 A;  3GD7 A;  4ME3 A;  3TRE A;  4JI2 Q;  5GAH C;  1VQ9 A;  3KFU A;  3IRB A;  3S1Q H;  5IP9 G;  3BZK A;  1MJE A;  2JA7 G;  2VQF Q;  1K8A C;  4YCW A;  4LFC L;  3FHW A;  4DV5 Q;  3M7N A;  4LF4 L;  5LMN Q;  2K5H A;  2VS1 A;  4DV4 Q;  2I5L X;  1AE3 A;  1KRS A;  2VL6 A;  5M5Y H;  5C44 H;  4GKK L;  2YTX A;  4QQB X;  4OO1 I;  1YIT A;  2KCT A;  1M90 C;  4UPA A;  5GAG C;  1OTC A;  2LSS A;  1PYB A;  4WJ4 A;  4A3B G;  5BR8 Q;  1Q1B A;  3WWV A;  2UUC Q;  4LFC Q;  1I50 H;  3T1Y Q;  2F52 A;  3PUW A;  3S2D H;  4A3D G;  2UUC L;  1RIP A;  1VQG A;  1UWV A;  3H0G H;  4A3C G;  1XNR L;  4IFD J;  1LYL A;  4EX5 A;  4DR7 Q;  2AWN A;  1IBL L;  4PG3 A;  2MNA A;  1HZ9 A;  1VQI A;  2BH8 A;  1XNQ Q;  4HJ8 A;  3CC7 A;  4B3R Q;  4R4I A;  3U50 C;  1OXX K;  2I5H A;  3ICE A;  2GVA A;  1YHQ A;  4LF4 Q;  1TXY A;  1XPR A;  2NVT H;  1QUQ B;  1D8L A;  3TEH B;  4AYB G;  4XIG S;  4BXX G;  1PH9 A;  3S14 H;  1IL2 A;  4DV7 L;  1VQB A;  4HJA A;  3PGZ A;  3A5U A;  3GTJ H;  3K8A A;  4LFA L;  2UUA L;  3AQQ A;  3G71 A;  1VQ6 A;  4GN3 B;  4JI5 L;  1P16 A;  2R7Z H;  1VS0 A;  3KYH C; 
#chains in the Genus database with same CATH topology
 2EXZ A;  3OWF A;  4ZLT F;  2A5H A;  3NTI A;  3J81 E;  3R5X A;  4O4H F;  1JDB B;  5GAD C;  2AUK A;  2FPG B;  3S16 H;  3KF6 B;  5KFM A;  1ENF A;  2KHI A;  4DV1 L;  4RB3 C;  4G4K A;  1MSG A;  4YQW A;  3UE0 A;  2I07 B;  1X3P A;  5JVG 3;  4DR1 L;  3QB3 A;  1UE5 A;  1STY A;  2FLP A;  2NTT A;  4IPC A;  2UU9 L;  3BYT B;  1NTG A;  1NR4 A;  4DV6 Q;  2CQY A;  1EY8 A;  4EBC A;  5IT9 W;  2IW3 A;  4JBW A;  3VDY A;  3K3P A;  4OWX B;  2KEC A;  5IT9 c;  3H94 A;  3J7Y W;  4EVO A;  5KFJ A;  3TP5 A;  2WFW A;  1G6Z A;  2R3Z A;  3TIG A;  2R93 B;  1U5K A;  1U4L A;  4OEM B;  4DR3 Q;  1W6K A;  4K14 A;  3VYT A;  4DUY H;  5C5L A;  4BA1 I;  1Y14 B;  3U58 A;  3DWQ A;  5IYD H;  1AE2 A;  1MZB A;  2A6E D;  2Y0S E;  4OWT B;  5JJK A;  2R84 A;  3U4V A;  2R93 H;  2K4K A;  1ESF A;  1FD7 D;  5EBC A;  4X64 Q;  4KD3 A;  3W5O A;  1SBB B;  1XTD A;  4DXG A;  5HV6 A;  4AQY H;  3UI2 A;  3CME A;  4BA2 I;  2VA3 A;  1WTW A;  1YVC A;  5C1P A;  2JP1 A;  1P8L A;  2EYP A;  2J4X A;  1CKN B;  5C6A A;  2FHT A;  4DN4 M;  3H3V H;  4C2M A;  5M3M B;  5KFY A;  3GIP A;  1RCV D;  5HGT A;  1ZYR C;  1QVC A;  3S24 A;  3H3V I;  4GNX A;  4JVZ A;  4X65 L;  2YU9 B;  1SE8 A;  5COY A;  2FPI B;  1SNO A;  4J9K A;  1LTL A;  4X65 Q;  1PH5 A;  5IYC H;  1ZEQ X;  4O2B F;  4R4O A;  5T14 A;  4HJ5 A;  1FJG L;  5KFF A;  5A2Q E;  4O4I F;  1W2B A;  3D3R A;  2OH2 A;  2CW0 C;  3D4D A;  5F9N A;  2VB2 X;  3W3A A;  5D1O A;  5JAV A;  3T53 B;  4B3T Q;  4HNV A;  1K3B C;  2R92 H;  5HY6 A;  4XQJ A;  2UUB L;  4G7H C;  1B8A A;  1I94 L;  4R8U B;  2L5T A;  2NVY B;  2C2D A;  3OHX C;  2YYA A;  1K83 B;  1BF4 A;  1W96 A;  1N48 A;  1M1K C;  5C4J B;  2AQ3 B;  3M4O B;  2ID0 A;  1HUN A;  2KBN A;  5F2D A;  4B3S H;  3NSW A;  4HJ7 A;  1QB5 D;  2GPW A;  4M1U B;  4JV5 L;  1QE6 A;  3CCV A;  4C5C A;  4YR0 A;  1F2L A;  2R7D A;  2ZXR A;  4JI6 H;  4GN4 B;  4OGQ C;  1FL0 A;  1NE3 A;  2CKZ B;  1B44 D;  3EIV A;  4MTK A;  3S1N H;  4HSP A;  1HA6 A;  1SRO A;  3HB9 A;  1IYV A;  5BMV F;  1SAP A;  4HCS A;  3PVX A;  3MA2 B;  2F03 A;  4P72 A;  1Q82 C;  3QOL A;  1N32 L;  1C9O A;  5JQW A;  4AIM A;  1K3R A;  2PNH A;  4ECV A;  4LF6 L;  1IBM L;  3TN2 A;  2W6P A;  3Q0A A;  1E1T A;  4B3R H;  2N78 A;  3PCO B;  1QOH A;  1VKZ A;  3J81 c;  3T5K A;  5DQG A;  1HTP A;  3CCU A;  2NUC A;  5K2M A;  1F2Z A;  3HOY G;  2UVR A;  3PUX A;  1S10 A;  3MXU A;  1EY7 A;  4ECW A;  1O80 A;  2VOB A;  3ORQ A;  4FF3 A;  4K8J A;  4DAP A;  4IO9 A;  2JA8 B;  4JI2 H;  3ND9 A;  5C3W A;  1K9M C;  3BU2 A;  2IX0 A;  3ETH A;  1C48 A;  1EEI D;  3TSS A;  4DR6 Q;  1B70 B;  4MNO A;  4JI7 Q;  2A69 C;  5J3B A;  4JYA Q;  3ONA B;  4J9N A;  5KYL A;  3S16 B;  3RN2 A;  2FMA A;  3GTL H;  4KHV A;  3TZD A;  2F0P A;  4QW8 A;  5IYC G;  3BYY B;  3RN5 A;  4APV A;  2AUJ D;  5D3I B;  4DUZ H;  2QYZ A;  1Y8O B;  3I12 A;  4KHP L;  4S3S A;  1IBK L;  3V96 A;  3H0G A;  3R2I A;  3HOZ B;  3I4M B;  1Q12 A;  1TS3 A;  3V4Z A;  3HKZ A;  5CBE E;  5FJ8 G;  1R9T A;  3KAK A;  3GTM H;  1TA8 A;  4CC5 A;  3DWP A;  1A62 A;  3TP8 A;  2DNE A;  4Y8V B;  3RLN A;  3I4O A;  4B08 A;  2UXB L;  1Y8P B;  3UDX A;  5L37 A;  5LA6 F;  1RJQ A;  1PH8 A;  5K36 G;  1STH A;  4DL7 A;  3K7A H;  2KQ3 A;  5ELN A;  4DR5 L;  4DUY L;  4JOI A;  4B3S Q;  1EUC B;  3EA6 A;  5TSS A;  4X62 Q;  3GTG H;  4BY7 H;  4DR6 H;  1V1Q A;  1EQR A;  3K7A B;  4A3F H;  4EEQ A;  1VQD A;  2RA4 A;  1AH9 A;  2M9V A;  5C44 B;  1HNW L;  2K04 A;  4DA2 A;  2F0F A;  1IBM Q;  3GTG B;  3OTO H;  2LXK A;  3VR2 A;  3G6X A;  4KTA A;  3NEN A;  3SR1 A;  5C44 G;  4A3F B;  4LFB H;  4C2M H;  4PMC A;  2B2U C;  4FNF A;  3EBE A;  4QB4 A;  5FPR A;  4KJN A;  2FK2 A;  2SNM A;  2ZXP A;  3SDZ A;  4TV9 F;  3BA8 A;  3CW2 C;  3DF7 A;  3J7A K;  2GVB A;  4HR7 B;  2R8G A;  3Q8R B;  2QGQ A;  4RHS A;  1K8O A;  5A35 A;  4YY3 H;  4KKS A;  4YJ2 F;  2ALY B;  1DXM A;  2QF7 A;  3QJY A;  1OXV A;  4LF9 H;  3PUZ A;  3DUZ A;  1PH4 A;  4DUZ L;  1K1Q A;  2YL2 A;  1F9S A;  3N52 A;  4HN7 A;  1WCM G;  3AYH B;  2ZJP A;  1QVG A;  1D6E C;  3GO5 A;  5FOB B;  3N40 P;  1B4O A;  1BR9 A;  1SE4 A;  2Q2H A;  1Y8N B;  1WCM A;  2HDM A;  3HOZ G;  4ILW A;  3PZP A;  3BA9 A;  4MZ9 A;  5KFO A;  1TY0 A;  4DV2 Q;  4UCU A;  4JV1 A;  3BVM A;  2A74 C;  3GTO H;  1PX2 A;  4AQY Q;  3UDF A;  1PH6 A;  4KY7 A;  1QNU A;  4F7X A;  4EEY A;  3NXW A;  4A3I H;  1WD0 A;  2FE3 A;  4ZQ3 A;  5M5X H;  3M4O H;  1EUD B;  5KFV A;  1AZP A;  4B3T L;  4JYA L;  3GQC A;  1PTO D;  2UXD L;  2W6Q A;  3PIP 3;  5FO9 B;  3F2D A;  4KK7 A;  3D6W A;  4XDX A;  2K5D A;  2SDF A;  3V2T A;  4IRC A;  2FB9 A;  3OSP A;  4XTC S;  4XXE A;  3PW0 A;  1SYB A;  1EHI A;  3NE5 B;  1RL2 A;  2EQS A;  3PMF A;  3S1N B;  2R7Z A;  2A1A A;  1I4P A;  2AQ1 B;  3RGZ A;  4FYD A;  1HR0 L;  1PRT B;  3RIZ A;  5DQH A;  4A75 A;  3M9O B;  1IBL H;  2DGY A;  3WO0 A;  4DV5 L;  4PWQ A;  1NR2 A;  2DNC A;  2YRW A;  2PNR C;  4R4Q A;  4DK1 A;  4HSV A;  1G6P A;  2XIG A;  4JPB W;  2W70 A;  2FLN A;  3GV5 B;  4IAL A;  1TWC H;  5I6Y A;  2SOB A;  2VW9 A;  1MIU A;  4A3M H;  4PZ7 A;  3ERO A;  4TRD A;  3TS0 A;  1SFO B;  4JI3 L;  4J8Q A;  3MR2 A;  2AGQ A;  2OLS A;  3SK5 A;  1VMC A;  2NVX H;  4FXG C;  5AJ3 L;  4MV4 A;  5ELB A;  5KFE A;  3VMM A;  2WB1 E;  2XIW A;  4B3S L;  1EOV A;  1L1O C;  1RF2 D;  4A3D B;  2V58 A;  5LMU Q;  2WYO A;  1RTO A;  3MHB A;  5D14 A;  3V6J A;  2I5M X;  2VUM G;  2NVX B;  4IZO A;  3EPI A;  4UCO A;  3A55 A;  1HQM C;  1JR0 D;  4HMJ A;  4GC6 A;  3BS1 A;  2YU9 A;  1NMF A;  1RK5 A;  5H80 A;  4QWB A;  3K80 C;  2UXC H;  4N8X 1;  3S15 H;  1K0R A;  4XT1 B;  2E5L L;  5JEA G;  3E0E A;  2LS0 1;  2FK3 A;  5FLX E;  5KND A;  4Q5V A;  2OXP A;  1DM0 B;  2JA5 B;  1FKA H;  5IYB H;  5D1O B;  1GXD C;  4RAU C;  1ZHQ A;  1JJC B;  1VQ7 A;  4L63 B;  5C3E B;  1TY2 A;  1IBL Q;  4TQU S;  5I9O A;  1XMQ Q;  2VQE H;  1SNQ A;  3PR5 B;  5ISR A;  3QO2 A;  4DV7 Q;  4DAV A;  4XX0 B;  1ENC A;  2F3V A;  2W71 A;  4DV2 L;  5I9P A;  3CC4 A;  3TII A;  5LMN H;  3HP3 A;  3DHQ A;  5BR8 L;  4HIO A;  1EZ6 A;  2W9B A;  1JQY D;  4QWC A;  3IFT A;  3J80 W;  5J2T F;  1A9X A;  1V43 A;  1PA6 A;  1GM5 A;  1Q81 C;  1V1P B;  1KAB A;  1U4M A;  4EGQ A;  1N34 L;  3MFH A;  2XCA A;  1SE3 A;  2UXC L;  4LH7 A;  1MBY A;  5E4W C;  4TVA B;  3P75 A;  1AFP A;  1EWI A;  5KG1 A;  3QOJ A;  5IP7 G;  1YEZ A;  1KC7 A;  3GIM A;  5I4D A;  4LNQ A;  5KFK A;  4JW0 A;  3KHR A;  1JE4 A;  2HT1 A;  1F2Y A;  4LF8 L;  4ME6 A;  3A0J A;  2W8L A;  3TP6 A;  4J9Q A;  1IKL A;  2B2Y C;  5GRO A;  2Y0S G;  4Y7N H;  1SDF A;  2KEN A;  3KF8 B;  4BXX H;  2ICE C;  1EYD A;  3HKS A;  2RDI A;  4B9W A;  3BVZ A;  5CMD A;  3T1H L;  3GII A;  1NMG A;  4NXM H;  3VR3 A;  2R92 G;  3RAQ A;  2JEJ A;  2MUY A;  1PRT D;  2R8I A;  1YBY A;  2RDJ A;  3K58 A;  4DV5 H;  4OWW B;  1VF5 C;  2A69 D;  2L9H A;  4RB0 A;  1EY6 A;  5KFC A;  3I4L A;  3LWE A;  2JA6 B;  2QA4 A;  4NPS A;  1BBU A;  4C3J G;  2F0Q A;  2ASB A;  2FP4 B;  4DV6 L;  3QWN A;  4WRD A;  5L9X A;  5C1O A;  1F9R A;  4A3K B;  2DIK A;  5M3F H;  2YYZ A;  4HIM A;  1D1K A;  1JE5 A;  2E2I H;  2NVY A;  1CT1 D;  4CKC A;  4DR2 H;  3M3Y H;  2AU0 A;  2IWH A;  4FF1 A;  4A3K H;  4WBN F;  2H4O A;  1OXU A;  4LUZ A;  2YTV A;  1BOS A;  3D6C A;  2WP8 J;  3M3Y B;  1IBK H;  5KG0 A;  1EZ1 A;  4CDF C;  2D9U A;  4HTH A;  5DGA A;  2L1B A;  1HPC A;  4X3U A;  3N42 B;  4MHE A;  4JI2 Q;  3FEW X;  4H13 C;  2W7O A;  4DF7 A;  2EPB A;  1IKM A;  4YCW A;  4DV5 Q;  3RBE A;  3D4R A;  5T1G A;  3KBX A;  3OIQ A;  4GC7 A;  1EY4 A;  2VS1 A;  5T1I A;  2VL6 A;  2I46 A;  5KNC A;  5KG2 A;  1M90 C;  2KCT A;  2DWC A;  2F0U A;  3I4N B;  1GUN A;  2VB3 X;  2RDF A;  5BR8 Q;  4PNY A;  2F0D A;  1Q1B A;  4LFC Q;  4MV8 A;  5EWF A;  2V59 A;  1XNR L;  4EX5 A;  3V6H A;  1GLV A;  2B2U A;  1HZ9 A;  3WOE A;  4FF2 A;  2K05 A;  3CC7 A;  4O2A F;  2FJZ A;  4R4I A;  2MCT A;  2AQ2 B;  3ICE A;  1KLG D;  3OPO A;  4LF4 Q;  4K6L A;  4BXX G;  3NQI A;  3TEH B;  4XIG S;  3MVV A;  3SEB A;  2W6M A;  4I7H A;  2IJ0 A;  3S14 H;  2PMZ A;  2UVU A;  1HNX H;  1ILQ A;  2ALZ A;  1H9S B;  4LFA L;  2UUA L;  1DV1 A;  1S5E D;  3TP7 A;  3S14 B;  4RB1 A;  5KFA A;  3HGB A;  2IHF A;  5C3E H;  4A3E G;  4ZHQ F;  2DPJ A;  1GUW A;  1I3Q B;  2B8G A;  1CZG A;  1EIF A;  2J7Z A;  3CKI B;  1RKN A;  3WDN A;  1QIL A;  2W9A A;  1I50 A;  1HHV A;  5FD6 A;  3DEP A;  5IGF A;  1R4Q B;  1QCB D;  2L0C A;  3LNN A;  4KJO A;  1X32 A;  4F50 A;  4DR1 Q;  2YZM A;  2CHB D;  1IW7 C;  1IOW A;  3OYY A;  4ED0 A;  4A76 A;  1T5X D;  5NUC A;  3AFP A;  2P5Z X;  4YWK A;  3TBI B;  3I72 A;  2E2H H;  1FGB D;  2F3W A;  3HOV H;  3MWY W;  4RG1 A;  1C7Y A;  2HHH L;  1HTL D;  1TR5 A;  1FJG Q;  1LO5 D;  4RA8 A;  1MJC A;  3R2T A;  4U67 3;  5DQI A;  5GQO A;  4L5S A;  4HNU A;  3NWS A;  4QCL A;  2JQO A;  4IOA A;  3G48 A;  3WO1 A;  4DKA C;  3S17 H;  1BKB A;  5JEA H;  4F8M A;  3A74 A;  5CV9 A;  1PHJ A;  2F0L A;  1K8G A;  4LMY A;  2KHJ A;  1EQQ A;  1IW7 D;  1L1O B;  3AU7 A;  1CE8 A;  3I73 A;  3OUZ A;  2L4N A;  4CGY B;  2VUM H;  2RVL A;  3E9I A;  3M4Y A;  1SFO A;  5JOB A;  5DM6 3;  4JCV E;  2SNS A;  2R7N A;  4DV4 L;  1TWG B;  4RGT A;  4YR2 A;  1J6Q A;  4DNI A;  2BDO A;  2A6H D;  2CH4 W;  2JA7 A;  3PW5 A;  3P20 A;  3GTK B;  4UHV A;  2NWG A;  5CV5 A;  5FO8 B;  1C8C A;  1F9P A;  1I6U A;  1RJR A;  1UEA B;  3RZD H;  1YJ9 A;  1VQC A;  4GKJ Q;  2C2R A;  5IIF A;  1N36 L;  3S9W A;  1SYD A;  1G29 1;  2H1E A;  2B2V C;  3MXN A;  1SNC A;  2O5I C;  1T3N A;  1PTO B;  4A2B A;  2KCC A;  2F0N A;  4LMQ D;  2RKS A;  2F0T A;  5EPL A;  1B3A A;  1M0T A;  1CQV A;  4IRK A;  1PTO H;  1WVL A;  3KAJ A;  5C0X G;  4DV3 H;  1MKH A;  2QKI C;  3CMA A;  4LSX A;  2EXD A;  4ECY A;  3RLO A;  5DLG A;  3ZJY C;  3CCE A;  3MWE A;  1EZ8 A;  2NN6 I;  1PH3 A;  1HZA A;  5EBD A;  4QUF A;  2Z6B A;  1Q46 A;  2E76 C;  5IGB A;  4LF5 H;  3ULJ A;  3URY A;  1CTM A;  4K6D A;  2Q2U A;  1QVF A;  4EQ5 A;  3GDE A;  2RQX A;  1STN A;  2QIL A;  3GV7 B;  2HHH H;  1WFQ A;  4DV0 Q;  5FLX W;  3C1F A;  3AEV A;  1E4E B;  3ERQ A;  2WAQ G;  3K5L A;  1YNN D;  5CV8 A;  2BQ3 A;  4KI0 A;  3L0O A;  3E5N A;  3V05 A;  1L0W A;  1ULZ A;  2ASD A;  2I8C A;  3SK4 A;  3CRK C;  4MTD A;  1B50 A;  1S97 A;  1VBH A;  2YW2 A;  1XNQ L;  1V8Q A;  5EOY A;  3K3V A;  4C56 C;  2HQL A;  3QIA A;  2MJ8 A;  2RCF A;  5BN4 A;  5IYB G;  2N3S A;  3CF5 A;  2HVS A;  3S1R B;  1TWF A;  3BG5 A;  4C3J H;  4RAY A;  2F0K A;  5KFR A;  4UFZ A;  1JOR A;  2OTL A;  4LFA Q;  5LMU H;  1JB3 A;  3K5H A;  2XGQ A;  1PFN A;  2PI2 A;  3F1Z A;  2UUB Q;  4ZCK A;  3BDO A;  5FK9 C;  5IE8 A;  5IWA H;  3T1H Q;  2R61 A;  1YI2 A;  2IT1 A;  1I6H B;  1N56 A;  1LUZ A;  3IN5 A;  2Z6K C;  1BCP F;  4EQO A;  4A3B B;  1SEB D;  3MXP A;  5LXT F;  4WOR A;  3J7Z C;  1PH1 A;  5IGC A;  3GTG A;  4AYB E;  2I87 A;  1SXT A;  5EAY A;  2R92 B;  3PW4 A;  1HNZ H;  2HCI A;  1SLJ A;  4ULL A;  4JI8 Q;  3ERS X;  3SHL A;  4K0K H;  3NTK A;  2E2D C;  5ELF A;  3W2D A;  1UE7 A;  1HZB A;  4YHH Q;  5EQ0 A;  2XSC A;  4K5V A;  4ZKB B;  4A3J G;  2OWO A;  2HCC A;  3J80 c;  1WTO A;  4J15 A;  3JRX A;  4PV1 C;  3FMC A;  5KT4 A;  2JEI A;  1E2V A;  2AWO A;  1DON A;  2K32 A;  1JDE A;  5DNF A;  3GV6 A;  1N32 Q;  1GSO A;  4MIU A;  4JBJ A;  1E4F T;  5KX5 F;  2K50 A;  4LF9 L;  4OIK A;  3ER0 A;  3F2B A;  2XNA C;  3N6R A;  3A54 A;  1S68 A;  4QWA A;  4FXK C;  2FXQ A;  1HNW Q;  3FVQ A;  1UNN C;  3PO2 G;  4KN7 C;  4GLA C;  4UCR A;  5KT2 A;  2ZTE A;  3L3O C;  4OX9 H;  4YWM A;  3MXN B;  3K5O A;  3IAY A;  3BVG A;  4J9L A;  4H7B A;  4I4T F;  1QNK A;  4NLG A;  4I65 A;  4TUY F;  5DGB A;  1E2Z A;  2YTY A;  3I7F A;  1I5F A;  4ECS A;  1SFO H;  3FDT A;  3CC2 A;  4U6P A;  1A3U A;  1I4R A;  4A3J B;  5JH7 F;  2G9H D;  3TDQ A;  1VQE A;  2F3I A;  5I6W A;  4NDX A;  4QL5 A;  5LHY 1;  2VQD A;  1LAC A;  2IHE A;  1J5E H;  2RSN A;  4A3G G;  4NXM Q;  3G7L A;  2YZG A;  2JA7 H;  3GTJ B;  1W93 A;  3MWM A;  4DK0 A;  4NXN Q;  3SE7 A;  2KJX A;  2R7Z B;  1J5E L;  2PO4 A;  1Q3L A;  1BCP D;  1Z9F A;  4HJ9 A;  2HQE A;  3RUP A;  2JA8 H;  1OXT A;  4QY7 A;  5M9O A;  2EYO A;  1RYR A;  4UAI A;  3I3C A;  3MTS A;  1X6O A;  1OWT A;  2JEA I;  3DMU A;  2BA0 A;  2N88 A;  4P71 A;  4BBS G;  1CKM A;  4I55 F;  4JI6 L;  3CCQ A;  1KJJ A;  4ZKC B;  1JWM D;  2ENB A;  4JI6 Q;  4IPH A;  2SCU B;  4B9X A;  1JOK A;  4QGU A;  1GUS A;  1PH2 A;  1GVP A;  3HOV G;  4WD3 A;  1E1O A;  2OCE A;  2B63 G;  1B6R A;  2W9C A;  4RZQ A;  5KFH A;  4C3I B;  2W6N A;  2TMP A;  4LF4 H;  4O1N A;  2FPP B;  4TV8 F;  2L55 A;  2KA7 A;  2RBM A;  2PZT A;  1C30 A;  1SNM A;  3PW2 A;  4ECZ A;  4RKB A;  4F4Y A;  4GKJ L;  3NP8 A;  2D2C C;  3S1Q B;  4HED A;  1GHJ A;  2PYK A;  2HDL A;  3K7U C;  1G2T A;  4GNX B;  4JK1 C;  4LUO A;  2ZM6 Q;  2HJW A;  1E3P A;  5CYU A;  3WNZ A;  4ECU A;  2B8F A;  1UUP A;  1PH7 A;  1T9H A;  5BN5 A;  4Q45 A;  1KDA A;  1Q86 C;  4PZ6 A;  4R8I A;  4R8U A;  1QJO A;  3KLS X;  1JXL A;  1ZHS A;  3NGD A;  4LAA A;  4DFA A;  4IJH A;  1U0L A;  1EY9 A;  5M5W H;  1S0N A;  3J81 L;  4IFD G;  1ZKO A;  1Q90 A;  3W1B A;  4G3I A;  2Z6K A;  4EBE A;  2W9B B;  4DPG A;  2MQH A;  4ODG A;  2E2H A;  4LSA A;  5LMU L;  2X69 A;  4IUP A;  1E24 A;  5HBR B;  4O2D A;  2HHH Q;  2PQA A;  4H02 A;  1CK1 A;  4LW1 A;  5KG4 A;  1I4X A;  1VQA A;  4IN3 A;  4EYI B;  1U4R A;  2E74 C;  4JI0 L;  2XCP A;  4B3M Q;  1SJH D;  1UNS A;  4DAY B;  2JN4 A;  2Z0S A;  1AN7 A;  4YY3 L;  1I4Q A;  1X3E A;  4MTN A;  4A93 H;  2Q8I B;  3N41 B;  3LML A;  3T16 A;  3I56 A;  4OO1 G;  1VQJ A;  2CWA A;  4YBZ B;  2IBK A;  3CQZ H;  1N33 L;  2F4I A;  3FMA A;  3RB3 A;  4RZR A;  1UE6 A;  2E2J H;  2FMM A;  2B2T C;  3CCJ A;  1N8R C;  3JC6 6;  1F77 A;  1BUV T;  5CA1 F;  4YHH L;  3FPP A;  2WAQ B;  4G57 A;  5C0X I;  1BJT A;  1TWH B;  2VQF L;  1VBG A;  4QUC A;  3OWE B;  4GS3 A;  4ED7 A;  4RNM A;  1KJQ A;  3NQT A;  3BDL A;  1X56 A;  2MO0 A;  4CJ1 B;  4GKJ H;  4ED8 A;  4A3K G;  4ECR A;  4O42 A;  1E4E A;  5I2X A;  2XWB B;  2UXD Q;  3G4S A;  2R6G A;  4RMF A;  2KVM A;  4U7C A;  2VQE Q;  4M7E A;  1HQR D;  1XDN A;  3RF2 A;  2X0S A;  4YIJ A;  3HOX B;  1LTG D;  1I4H A;  3BG3 A;  2YS7 A;  3T1H H;  5A2Q L;  4DR3 L;  3OSN A;  1NAP A;  1VDZ A;  4HIK A;  3K81 C;  4ZYS A;  3BQ1 A;  4G7O C;  3I4M G;  2F4V L;  4JI8 H;  4DUZ Q;  4UY8 C;  4RNO A;  2NVQ B;  1S5B D;  1VQL A;  3K6O A;  4N9P A;  3ULP A;  4IUV A;  1Z2P X;  3EVQ A;  3Q8D A;  4R1J A;  2JA7 B;  2FKL A;  3H0G G;  4BY1 B;  5IGE A;  2W7P A;  1E2W A;  3A8I E;  1R9T H;  1VQP A;  2F0G A;  3PO2 H;  4FS2 A;  3R8B A;  1YZ6 A;  5COR A;  2IP4 A;  2AHO B;  5E3F A;  3H40 A;  1Y1V G;  4CDD C;  5KFU A;  4IUU A;  2OTJ A;  3GTL B;  4AH6 A;  3J7A 5;  4JI2 L;  2XWJ B;  4DV0 L;  3H91 A;  1HNZ L;  2J9G A;  4IR1 A;  2UXD H;  2BCO A;  1BNZ A;  3HOW B;  3SK6 A;  1SYG A;  1YHA A;  3PR4 A;  1RK6 A;  1HNW H;  1SNP A;  3H09 A;  4ZI7 F;  2IA6 A;  1PLF A;  4A3L H;  2EJG C;  1DYQ A;  3VR5 A;  4POG A;  1V1O A;  2DUD A;  2HUG A;  4A3G B;  2C2E A;  2M05 A;  1IOV A;  2XGT A;  3ETJ A;  1BGW A;  2K01 A;  1STE A;  2PMZ B;  2FMC A;  3CXC A;  3HOU G;  4EBD A;  4ME3 A;  2PW5 A;  3TRE A;  5GAH C;  3I70 A;  3KFU A;  2R86 A;  3J81 W;  3KK7 A;  4DL5 A;  3BZK A;  3NPP A;  2ZJT A;  1SYE A;  3M7N A;  4LF4 L;  1TS4 A;  4RCN A;  1K8M A;  3C0F B;  4GKK L;  3JAM E;  5C44 H;  3TQT A;  4OO1 I;  2F0W A;  1U4P A;  2V5A A;  5KFZ A;  1WTQ A;  3IFD A;  2DLN A;  4L1K A;  2EYJ A;  1EQV A;  1R4P B;  2NYZ D;  1DIK A;  4CHT B;  2UUC Q;  5JUM A;  1PFB A;  3S2D H;  1RIP A;  1UWV A;  4A3C G;  1I7N A;  4DR7 Q;  1PRT F;  1Z2N X;  1XNQ Q;  4HJ8 A;  3H20 A;  1E0B A;  4F4Z A;  1TWH A;  2DY7 A;  1EU4 A;  2WV6 D;  1YHQ A;  1CHP D;  1TXY A;  2NVT H;  4C5A A;  5KG5 A;  5EWG A;  2R6F A;  4X62 H;  5IYZ F;  2BE5 C;  4MN3 A;  1VQB A;  2G5D A;  1C3O A;  4LJZ C;  3PGZ A;  3SK8 A;  5CV6 A;  3MFI A;  4IUN A;  3GTJ H;  3R3O A;  5EPJ A;  3G71 A;  2C9O A;  4JI5 L;  4O3N A;  1YIT A;  2EOT A;  3KYH C;  1S5F D;  4O3O A;  4LF7 H;  2B2T A;  2R92 A;  4KLK A;  2K5N A;  3T4A C;  4B3M L;  1K83 A;  4A3C H;  4CJ2 C;  4KKU A;  2B29 A;  1RJT A;  4JI1 L;  5JJZ A;  2I0Q A;  4ETS A;  2E2I B;  1NSN S;  3UE1 A;  1KL9 A;  1N36 H;  2RGR A;  2ZTC A;  2R7F A;  2RCN A;  1Z7T A;  3OMC A;  1TWG A;  5LOV F;  1Y1W B;  3MR3 A;  1CZW A;  1HR0 W;  3VPD A;  4ALP A;  3VYR A;  1KNE A;  3GP7 A;  1Y1W G;  1WH2 A;  3M9N B;  3DXJ C;  5IGG A;  5A2Q W;  1VQF A;  1KDB A;  3L2P A;  2OQK A;  1ASY A;  3S1M B;  3HFZ B;  4YCV A;  1DCZ A;  3JZI A;  3HS0 C;  5KFD A;  2J6U A;  2ZJR A;  1A0I A;  1JLL B;  4C3I H;  1LTT D;  3F8T A;  2TSS A;  1SCU B;  3Q8P B;  1GYF A;  1XX8 A;  4F87 A;  5KFI A;  2DJF C;  4A93 G;  2NZH A;  3M4Q A;  4OON A;  4MAM A;  3RFC A;  2CH4 A;  2OQ0 A;  5KFX A;  2WB1 G;  5EKL A;  4KMU C;  3M4I A;  5C5J A;  3HOX H;  1M6V A;  1D5M C;  1RJP A;  3RV4 A;  3H4B A;  3K57 A;  4GLX A;  2VQE L;  1EYC A;  3TQY A;  1AW7 A;  3GTQ B;  4QMG A;  4FU0 A;  1X55 A;  4DR4 Q;  2A6H C;  2CWP A;  3KDF A;  5KFB A;  2JA5 A;  2ZDQ A;  1K28 A;  3G6Y A;  1YHB A;  1CQJ B;  3GIJ A;  5IOC A;  5DAU A;  5HGQ A;  2YZN A;  2A8V A;  4BY1 H;  5FJ8 H;  4X66 H;  4C3H H;  4M8A A;  1UE1 A;  3PF5 A;  2K28 A;  1EOT A;  3S2H H;  4ED3 A;  2E5L H;  3HKZ G;  2NN6 H;  1S40 A;  1DOK A;  3A7L A;  4L6T B;  5FLX c;  1Y1V A;  5KFS A;  3E9H A;  1VMP A;  1BNC A;  4LF6 Q;  3N6X A;  4QIW B;  4TKO B;  5IT9 E;  2PBZ A;  2AMC B;  5EJW A;  2D62 A;  1CUK A;  2VR1 A;  1Q1E A;  1J5E Q;  2D0P A;  2B2W C;  3Q1K A;  4DR3 H;  1O7L A;  3GLK A;  3HKZ B;  4PQX A;  2R7M A;  1NBW A;  3KLS A;  1XJV A;  2WB1 B;  2WE6 A;  4ME5 A;  1BVS A;  2VUM A;  1IHZ A;  4X64 L;  3HOU B;  3GTO B;  1KNA A;  5FLM G;  4A93 B;  3HOY H;  1GSH A;  1ET6 A;  1KHI A;  4R7R A;  3SGI A;  1GJX A;  1BCP C;  3U9S A;  1ROD A;  1BXR A;  4JI5 H;  4NMZ A;  2J6T A;  4LWC A;  3VA7 A;  4YAK B;  3FKI B;  5J1Z A;  2VQF H;  4YAJ B;  1CSP A;  2G9D A;  4ABN A;  2B2W A;  4Y52 H;  2WKD A;  5G3L D;  4EQN A;  3T5J A;  4M9U A;  4EG0 A;  3KLR A;  4MA5 A;  2ES2 A;  1LT3 D;  2LXJ A;  5FD5 A;  4X65 H;  1S5C D;  3TIN A;  3NBH A;  1QWY A;  5KNB A;  1SJE D;  4UP8 A;  1EL0 A;  1E22 A;  2BA1 A;  1ZYR D;  4MV1 A;  2F0M A;  1N9W A;  1IXR A;  1U9R A;  5KT5 A;  2AQ4 A;  4RU9 A;  2Q2T A;  3CQZ A;  4J9P A;  1UC9 A;  3OTO Q;  1IBM H;  1K73 C;  5M3F G;  1JT8 A;  1TWC B;  3OIP A;  1XTC D;  3OMG A;  4AYB B;  5AJ3 Q;  1Y1W A;  3RJ0 A;  3RV3 A;  4LF8 H;  5JJL A;  1WYD A;  3JAM W;  3RB0 A;  1LTA D;  2ZT9 C;  4U68 A;  5C5M A;  2Q8T A;  4X64 H;  5LMN W;  1D7Q A;  2N8N A;  2PVP A;  3KOJ A;  1XPU A;  2NU6 B;  2AKW B;  4C5B A;  1V4Y A;  1X3Q A;  2DN8 A;  5LMN L;  2BH2 A;  1WCM B;  3I8Z A;  3PSI A;  2CCZ A;  1PVO A;  3KHH A;  4FP5 D;  3AB9 A;  3WOF A;  1KRT A;  1HR0 Q;  2MPM A;  1HFN A;  3RZD B;  1G8Z D;  3N8D A;  4IOC A;  1L2F A;  4K0K L;  1JOO A;  1WCM H;  5D8D A;  1EWH A;  5C4X G;  2B3G A;  4ECQ A;  3ULL A;  5I2Y A;  1TT2 A;  1E4G T;  4HCE A;  1QZH A;  1RDP D;  2VXW A;  2IX1 A;  2B63 B;  4DR1 H;  3GTM B;  1RYS A;  5IP7 H;  4MTE A;  5DG7 A;  4NB3 A;  4Q0F A;  3BAB A;  3UDI A;  3DEO A;  4GKK Q;  3VPB A;  2BOS A;  1GD7 A;  1S5D D;  1HH2 P;  1V1P A;  4PZ8 A;  3CP0 A;  1B7Y B;  3SI8 A;  4CC6 A;  4J0M A;  4Q8E A;  3MC0 B;  4V0B A;  4BY7 B;  5FLM H;  2UVW A;  1HRJ A;  3RMH A;  1AZQ A;  3E0J A;  1TWA H;  2M00 A;  4KY6 A;  4E6I A;  4TSS A;  2XC9 A;  1S0M A;  1ONL A;  1E7Z A;  1SMY C;  3E3X A;  5AFW A;  2AGO A;  1CSQ A;  4CBV A;  3BAA A;  1H95 A;  5BPH A;  3Q8Q B;  1TS5 A;  3GTQ H;  3KF8 A;  1HZC A;  2E8G A;  2QW7 A;  1H9R A;  3VYS A;  1KIX A;  4Q8F A;  3AFQ A;  1Q8K A;  2W9C B;  1TS2 A;  2XVS A;  4WJ3 M;  4YB8 B;  4EFE A;  3NK9 A;  2NVX A;  2UUC H;  1STB A;  4X3T A;  3A5Z B;  4RGN A;  1ET9 A;  2P0A A;  2CFM A;  1AEX A;  5IP9 H;  1VQ4 A;  4X6A H;  4DV6 H;  1AN8 A;  3T51 B;  2YU9 H;  4C3H G;  2J6S A;  2E75 C;  3CD6 A;  4I50 F;  4QWE A;  3KLW A;  2HGS A;  1DOL A;  5C4H A;  4LUV A;  4MV6 A;  1A63 A;  2F4V Q;  1I6H H;  4EYH B;  4DUY Q;  2O4X A;  2RHQ B;  4K5X A;  4EGJ A;  1KDC A;  3E5S A;  3K0X A;  1DV2 A;  2RGV A;  4DV7 H;  3UFX B;  1L2Z A;  3CCL A;  4CDC C;  5KGU A;  1BBW A;  2UXB Q;  4JUZ A;  4KHP Q;  5E4X A;  3QFF A;  2NVY H;  2E2I A;  4ZAI A;  3HEJ A;  1I94 Q;  1LTR D;  2W6O A;  3RUZ A;  2R8H A;  4C3I G;  4F4X A;  4ECX A;  4IWX A;  2ZTD A;  4J9O A;  3VPC A;  4JOI C;  1JCK B;  1L0Y B;  5DM7 3;  3C1E A;  3HOV B;  1GUT A;  3HRZ C;  3MFY A;  5KT6 A;  4RB2 C;  1KAW A;  1HCZ A;  1G51 A;  4I7A A;  3MR5 A;  2KEE A;  4O0A A;  2Y0S B;  1T5E A;  2DPI A;  1ICW A;  1KQS A;  4ZOL F;  4BBS B;  2QDB A;  4KKT A;  4UDU C;  5CR3 A;  1VQ8 A;  2CW8 A;  3S17 B;  1ML0 D;  2EJM A;  2F0E A;  3S1M H;  2GLT A;  2UU9 Q;  4JBK A;  4UCT A;  5JVD F;  4JI7 L;  1X3F A;  2O03 A;  4APM A;  1IYU A;  1TWA A;  2V1C C;  2UVV A;  3OHB A;  3A56 A;  2ATW A;  3LGJ A;  1O7I A;  1S3O A;  2WAC A;  2L15 A;  1XXG A;  3HKZ E;  2PZW A;  4H44 C;  5E1F A;  4LFA H;  4LF7 L;  5ELC A;  4FF4 A;  3I4N H;  2R7Z G;  1CFM A;  1FNW A;  4J6H A;  3OTO L;  1DJR D;  3NEL A;  3DM1 A;  1JB7 A;  2Z1C A;  2XRS D;  2R7Z H;  4RNN A;  5KIX A;  3HXL A;  3T56 B;  2Q2I A;  3Q23 A;  4A3J H;  3J80 i;  4LF5 L;  4DR5 H;  2NZ1 D;  1ZXT A;  5C4X H;  3HBL A;  1NNX A;  1SE2 A;  4EQP A;  2IX3 A;  3QR8 A;  5FO7 B;  1Q8I A;  1H9S A;  3A8K E;  2EY1 A;  1Q7Y C;  1JX4 A;  5BN3 A;  2R8J A;  1B33 N;  4A3D H;  2EY5 A;  3CVZ A;  2A68 D;  2X6G A;  4GZY C;  4HR7 A;  1II3 A;  1B6S A;  2JA5 G;  2BE5 D;  4DV0 H;  1SRU A;  3GV3 A;  4Q43 A;  4DR7 L;  3PUV A;  3I90 A;  3G8C A;  1N32 H;  5EKK A;  3BQ0 A;  4YP3 A;  2QCP X;  4R9W A;  4UCS A;  4ED1 A;  2XCL A;  4JC0 A;  4C1N K;  3PQI A;  5IGD A;  4A3F G;  2B63 H;  1CA5 A;  3QZ7 A;  1X54 A;  2JA5 H;  1I4G A;  4KHP H;  2NU7 B;  4PDB A;  1S4Z A;  1PZJ D;  4A3E B;  1FYC A;  3H15 A;  1JC7 A;  1FVI A;  1IBK Q;  4K0K Q;  5KG6 A;  3J80 E;  2FFK B;  1JJG A;  5GON F;  3UDG A;  2EZV A;  2EJF C;  4K8I A;  4HQ6 A;  1HFG A;  3FKI A;  2IMW P;  1F2M A;  2KHS A;  2R7K A;  1KEE A;  1UC8 A;  5K5P A;  4LF8 Q;  5C4J H;  1AUV A;  1CKO A;  1FR3 A;  1UAP A;  1ZET A;  3GIL A;  3H4D A;  1JJ2 A;  2R93 G;  4LFB L;  4XZ3 B;  2A19 A;  2UU9 H;  4L5R C;  4X3K A;  2O5J C;  2C35 B;  4RH6 A;  3HOX G;  4JYA H;  1UEB A;  1PFM A;  2NBF A;  1HA5 A;  1L1O A;  2ZJQ A;  3J81 j;  4IAJ A;  5KG3 A;  3T5H A;  3GTQ A;  3MJF A;  4FM9 A;  4JI0 Q;  4RUC A;  2JXM B;  4RHR A;  5FLX L;  3CCR A;  1SR3 A;  4A3M G;  2PCF B;  4IZ8 A;  3RLF A;  1HJP A;  5LL6 X;  2MP1 A;  3G6E A;  1XMO Q;  1WI5 A;  4X66 Q;  4K5W A;  1A2U A;  4O3R A;  1TWC A;  1WSC A;  5M5W B;  1A3T A;  4JV0 A;  1SMX A;  3BZD B;  4ZRZ A;  2KOL A;  2C22 A;  3IL8 A;  5CA0 F;  4R4T A;  2CQO A;  4NXN H;  1D2B A;  1T94 A;  4ID6 A;  2KSW A;  5IWA Q;  1H9J A;  3PF4 A;  4QWD A;  4DK3 C;  2O2L D;  3MZ5 A;  5J22 A;  5DEH A;  3KBG A;  3N43 B;  4O3Q A;  1XMO H;  2OEO A;  4A3B H;  3FPU B;  4DR5 Q;  4HNT A;  2PMZ E;  5D1P A;  3OHA A;  1A6X A;  5CGK A;  5EDW A;  2K75 A;  1LTS D;  2HD3 A;  4ZUI A;  4R4C A;  4QW9 A;  3KJP A;  4DR2 L;  4OX9 Q;  1N34 H;  1B9M A;  4H0L C;  4JV5 Q;  1J8I A;  1SMY D;  3GTO A;  2EYM A;  3EFX D;  3W1G A;  2VNU D;  2B63 A;  3J7A F;  5M5X B;  1I94 H;  2IY5 B;  5ELD A;  3PIP A;  2K7V A;  4DV3 Q;  2K33 A;  3A7A B;  2N49 A;  2NU8 B;  2F0O A;  1B04 A;  4Q44 A;  1FJG H;  4FS1 A;  3M9B A;  2B39 A;  3C3L A;  1MSH A;  3I2Z A;  2VY3 A;  1JWU D;  1C4Q A;  2PQE A;  4KHZ A;  1EIY B;  2PPB C;  3VR4 A;  5IYD G;  4P74 A;  2JK8 A;  3GD7 A;  1RTN A;  5EKI A;  1J9O A;  2JA7 G;  1SND A;  4WFN 3;  1PZI D;  3OUU A;  3QZ8 A;  4O3S A;  2VQF Q;  4LFC L;  1PTO F;  2R7L A;  1SYF A;  3NTH A;  4O3P A;  4FO2 A;  1TQO A;  4B3T H;  5LMN Q;  3M7G A;  2K5H A;  4DR4 H;  2I5L X;  1KRS A;  5M5Y H;  2YTX A;  2C5C A;  5KFN A;  4DV1 H;  5GAG C;  2LSS A;  1PYB A;  1EIG A;  4XQN A;  1G91 A;  4A3B G;  5M5Y B;  2LKV A;  2N55 A;  4A3D G;  1EYA A;  3PUW A;  4MV3 A;  2UUC L;  1VQG A;  3H0G H;  2NU9 B;  1LYL A;  3GTK A;  4OIJ A;  1RD9 D;  4PG3 A;  4KN4 C;  2MNA A;  1PK8 A;  1TII D;  1VQI A;  3S2H B;  3PN1 A;  4B3R Q;  3U50 C;  3IKJ A;  2GVA A;  4PMB A;  5K36 H;  2M2L A;  1D8L A;  4AYB G;  1R9T B;  2JSO A;  1PH9 A;  1SEI A;  1IL2 A;  3S15 B;  4DV7 L;  4HJA A;  1BXT A;  3NHH A;  2WIN B;  3AQQ A;  5EPK A;  4YJ3 F;  2JEF A;  4GN3 B;  3FRP B;  4WJW A;  1IBL L;  3KTM A;  4FDB A;  1IL8 A;  1SYX B;  5KG7 A;  1B1Z A;  3TQ1 A;  2JE6 I;  4P75 A;  2JA8 G;  3LWB A;  2QEX A;  4R8N A;  1LM0 A;  1LAB A;  2EDG A;  1FGU A;  2K5V A;  4DV1 Q;  3K59 A;  1OO9 B;  4JI1 Q;  4CKB A;  2XN9 C;  2AGP A;  2F0H A;  2OT2 A;  2Z9H A;  3HOY B;  4BS9 A;  2IL8 A;  2YV5 A;  1KD1 C;  4LF5 Q;  1I3Q H;  4YWL A;  2VPS A;  1NUC A;  5L1I A;  5JPN C;  2ICI A;  3D8G A;  4G7Z C;  1LT6 D;  4A3G H;  4ZK9 B;  4RGM A;  1VQH A;  3DLL A;  1GHK A;  3D31 A;  1X9N A;  4YY3 Q;  1EFW A;  3FKI H;  4DAM A;  1KBL A;  3ITP A;  3LX0 A;  4OO1 H;  4LF7 Q;  1LTB D;  4DLK A;  2ASL A;  5IOD A;  2R82 A;  1XWE A;  1CQF A;  4JI7 H;  1B2T A;  4OL7 A;  3F8N A;  2V4D A;  1JIH A;  4JI8 L;  3KXY T;  2F4V H;  3DM3 A;  2E2H B;  3M4P A;  5EGT A;  3IG0 A;  2CW0 D;  5BPF A;  3EJI A;  4GOP A;  4BBS H;  2BR0 A;  1AUX A;  4XYO A;  2JA9 A;  1ESR A;  1W6J A;  3MEF A;  5KRU A;  3RZO H;  3O13 A;  5CC4 A;  4KD4 A;  4Y7N B;  2KCM A;  3MAQ A;  5CAE B;  2C28 A;  1TWG H;  3PO3 G;  3A8J E;  3EYY A;  1QG7 A;  4DAY A;  3FP9 A;  3KF6 A;  4A3L G;  3KHG A;  4KV6 A;  4IFD J;  1YNN C;  1YJN A;  3GTK H;  3KJO A;  4JG2 A;  4IFD H;  4XYM B;  1EY0 A;  3T1Y L;  4IUT A;  5BR8 H;  1GSA A;  1VQK A;  3NWT A;  2RDH A;  1IZ6 A;  3TME A;  2JYO A;  2NVT B;  4JI4 Q;  2WAQ A;  4MV7 A;  3L4J A;  4NXM L;  2PI2 E;  2RHS B;  5C3X A;  5HUR A;  1S72 A;  4I7Z C;  4NKL A;  1YJW A;  5M3F B;  1PRT C;  1TU2 B;  2R93 A;  3FKI G;  3HOW G;  4X3S A;  4JI0 H;  4Q0Y A;  1PV4 A;  5KKN B;  1ZQ7 A;  2PZU A;  1B53 A;  1QZG A;  4AYB A;  4QF4 A;  2E5L Q;  2BQU A;  2UXB H;  4F88 A;  3GQB A;  3RB4 A;  1I6V C;  3I4M H;  3X3M A;  1FNV A;  2K03 A;  3RNU A;  3GTP A;  3SE0 A;  1I3Q A;  2MFI A;  4EGV A;  3CCS A;  2R85 A;  2NN6 G;  1CS0 A;  4QJF A;  5C3E G;  4A3E H;  3STB D;  2V4Q A;  2QDL A;  3NEM A;  3RTX A;  4B3M H;  2V4R A;  1YNJ C;  3HZX A;  3PV0 A;  4NP5 A;  4UCV A;  4DV2 H;  4DL4 A;  1KLU D;  5JVL A;  1TWA B;  2B2V A;  3F2C A;  4ZUJ A;  4DU9 A;  2H5X A;  1M7J A;  2YS6 A;  5EWE A;  3BJY A;  5KEE A;  2KUM A;  3TS2 A;  5L1J A;  1WJJ A;  4F4W A;  3R93 A;  3CCM A;  1STG A;  3Q6S A;  3CHB D;  4X62 L;  2NVQ H;  3PW7 A;  3M9M B;  3T1Y H;  3B6Y A;  1M0W A;  5FKA C;  3GTL A;  4IUQ A;  5IY0 A;  3K5N A;  1VF7 A;  2Q8R E;  1PXU A;  3P1H A;  4CKE A;  3S1R H;  5KFG A;  3RGX A;  2UUB H;  2UUA Q;  4RWS C;  1PMR A;  5CV7 A;  4IPD A;  1YNX A;  2MHV A;  3PO2 B;  2DZD A;  3D0F A;  4ZQI A;  4K2L A;  1N36 Q;  2IPK D;  2K52 A;  2NZO A;  4YR3 A;  4C3H B;  1PYS B;  2Z4I A;  3LWU A;  5M3M H;  3VYU A;  5KFP A;  4DL6 A;  2K6A A;  5KYI A;  1M8A A;  4J1M A;  4IRD A;  1S03 G;  2WKC A;  5C0X J;  3OW2 A;  4NW2 A;  1QUQ A;  5JPM C;  2WTF A;  3GIQ A;  2NB0 A;  4OXP A;  3C2P A;  1Z47 A;  4DNT B;  4GKK H;  3HOW H;  3PUY A;  5KFQ A;  2SEB D;  1TKW B;  5KFT A;  1ENA A;  4GLV B;  1XMO L;  1DGS A;  1EEF D;  1PTO C;  3MWD A;  2DY8 A;  2JA6 H;  2BQR A;  2Z4H A;  1HNX L;  1BDO A;  4HYK A;  3KUP A;  1WTX A;  2A73 B;  4JV5 H;  2UXC Q;  3D4W A;  1D1I A;  3KHL A;  4DXF A;  1XMQ H;  4DR7 H;  2V9W A;  5IT9 L;  5JJI A;  3GTP H;  5KT7 A;  4LFC H;  1LT5 D;  3KAL A;  1TWH H;  3AMU A;  3I4N G;  4DR4 L;  3V4S A;  3JAM c;  1X3G A;  1HNZ Q;  2R8K A;  2K5Q A;  3VA5 A;  5DLF A;  4DV3 L;  3NBI A;  2HIV A;  4FXD A;  3MFG A;  3GV8 B;  5CBA E;  2K14 A;  4IPG A;  1YIJ A;  1A15 A;  1JWS D;  4LF6 H;  4HID A;  1VQO A;  1WTH A;  1BO0 A;  2WII B;  4BWS C;  2PW7 A;  4IR9 A;  1CHQ D;  3JAM L;  1WTP A;  1NJI C;  4A3I G;  4LH6 A;  3X3N A;  3JSL A;  1VAJ A;  2EE1 A;  4GN5 A;  1PFS A;  4A3M B;  2VA2 A;  4IFD I;  2L12 A;  1CI3 M;  1C0A A;  2R87 A;  3CPF A;  4IUR A;  3N44 B;  5FPO A;  1OXS C;  1K0S A;  4LK1 C;  2EY6 A;  5KFL A;  2ZM6 L;  5JEA J;  2PQA B;  2MO1 A;  3EN2 A;  3H0G B;  4BY1 G;  1TWF H;  4QIW E;  1H9K A;  1B3Q A;  3L9A X;  4IHJ F;  1NY4 A;  2DJG C;  4YCU A;  1XNR Q;  1Z6H A;  4N9T A;  5C4Z A;  3DWA A;  1AP0 A;  2ZM6 H;  1GO3 E;  1TWF B;  5F9L A;  2JA6 G;  1EUJ A;  3VR6 A;  3U9T A;  2KCN A;  4BWG B;  1SN8 A;  4JI5 Q;  2EYL A;  4J9S A;  3T13 A;  3U9O A;  3PIO 3;  4PMW A;  2W6Z A;  4DR6 L;  4FBT A;  5C8Y F;  2FIN B;  4UP9 A;  4X66 L;  4JBM A;  4N8F A;  3G6V A;  4ED2 A;  4DL2 A;  3TRZ A;  1O75 A;  4V19 0;  1L0X B;  1M4V A;  5H1S E;  4YHH H;  2VZA A;  4DNR B;  3E6Z X;  4HMI A;  2ZDH A;  1O7Z A;  4A2A A;  4BBR H;  1B9N A;  3OOC A;  2JJQ A;  1NCV A;  5E7N A;  3M85 A;  5KT3 A;  4JV2 A;  1VCI A;  4L5Q A;  3KDF B;  3QG1 A;  1EWC A;  1N34 Q;  3Q2O A;  1Y1V H;  4RUA A;  2ATL A;  4RFB A;  5J39 A;  4BBR B;  4QIW A;  1IYJ B;  5KFW A;  4TQR A;  4JI4 H;  3GID A;  3JRW A;  4CJ0 B;  2EVB A;  4A4I A;  4BBR G;  1CQI B;  1XMQ L;  4POF A;  3CRL C;  3J7A V;  1EQT A;  5J2U F;  1ICF B;  3V6K A;  3H6M A;  1Y1V B;  1A8V A;  2F0V A;  1EYG A;  3Q8S B;  2YRX A;  4GOP B;  1Y69 U;  1RHP A;  4DR2 Q;  4OX9 L;  3R5F A;  1ILP A;  2WB1 A;  4DL3 A;  4NXN L;  3RB6 A;  1STA A;  4RGO S;  3T5L A;  1BQQ T;  1DZ1 A;  5DLQ E;  1W3S A;  2JEB I;  5ELO A;  5L1K A;  2D0O A;  4IJL A;  1I50 B;  5EZY F;  3RD4 A;  2WAQ E;  3S2D B;  2LFN A;  3K5M A;  1PZK D;  1ASZ A;  4OHJ A;  2ZXO A;  1G2S A;  1TVX A;  4XQQ A;  4C2M B;  1TAE A;  4MA0 A;  1GGO A;  3HG9 A;  2VUM B;  1S9F A;  1VQM A;  5LL6 b;  2WDT A;  2RF4 A;  3G6J B;  4DK6 C;  2B2Y A;  1H9M A;  3BQ2 A;  4OEL B;  1XYI A;  2XTI A;  1PDQ A;  3JAM i;  5DG9 A;  2NUA B;  1Z2O X;  3STB C;  2EIF A;  4JI3 Q;  1XNR H;  4B3R L;  1EY5 A;  2A6E C;  1WOC A;  1LV9 A;  1A3V A;  1YNJ D;  2RDG A;  4J9R A;  3GTJ A;  2OF1 A;  1F9Q A;  4FVM A;  1WTV A;  2EYF A;  1JOQ A;  3ORR A;  3OW7 A;  3OSO A;  4IQZ A;  3Q24 A;  1K83 H;  3FDS A;  3BZC A;  3L4K A;  3L7Z C;  2GPS A;  3NBH B;  3ZYY X;  2VUG A;  2HVQ A;  4DGZ A;  3SXH A;  3BDC A;  1HXY D;  3GTP B;  1KJ8 A;  4A3I B;  3PO3 B;  3CQZ B;  1Y1W H;  4XYL B;  1N33 H;  5D3D A;  2E2J B;  4P73 A;  4DV4 H;  1HNX Q;  3R5H A;  2HIX A;  1VQ5 A;  3C46 A;  1DD2 A;  3PO3 H;  4RKL A;  3Q22 A;  1SSO A;  1EU3 A;  4P2C B;  2EYH A;  4JI1 H;  4JI4 L;  5I47 A;  2LMC B;  1KTK A;  1LLR D;  4AQY L;  1WTR A;  2Z8L A;  1LT4 D;  3CPW A;  1GUO A;  2LY7 A;  2XRQ D;  1KC8 C;  3BJU A;  4CDE C;  1HR0 H;  1KJ9 A;  3TZU A;  4KY5 A;  3RR5 A;  1DOM A;  1VQN A;  2W57 A;  3JSN A;  2QK4 A;  2F0I A;  1EYZ A;  2CZG A;  5C0X H;  1GKH A;  3U4Z A;  1EFI D;  3GIK A;  4RCO A;  2YCH A;  4GNX C;  3J81 i;  2I80 A;  2J0T D;  4Z9C B;  5L1L A;  2ZDG A;  3CAM A;  2JEG A;  4BY7 G;  5DG8 A;  5C4X B;  1D5Z C;  5D65 A;  3GTM A;  1N33 Q;  1KXL A;  2PN1 A;  1JMC A;  5IWA L;  3NUC A;  1X65 A;  2QEJ C;  4XT3 B;  5M3M G;  1HUM A;  3R23 A;  5JVH 3;  4C3J B;  3SVM A;  2HVR A;  2D5D A;  1V9P A;  1D5X C;  4LF9 Q;  4IWY A;  3MXG A;  3PIO A;  2NTS A;  1O7Y A;  3LP8 A;  4UP7 A;  3HOZ H;  3P7J A;  2RSO A;  2UUA H;  2K5W A;  2W8K A;  1KJI A;  2FJ2 A;  1XNQ H;  2F0S A;  1A2T A;  1MHW C;  3UQ8 A;  4ECT A;  2F1M A;  5CV4 A;  3HOU H;  5LYJ F;  1CKN A;  4GOP C;  4L5T A;  4LFB Q;  1I7L A;  2KED A;  3CU7 A;  3RAX A;  1WD1 A;  4C1N I;  2F0J A;  5GAE C;  2GN5 A;  5G3L F;  2FK1 A;  1XPO A;  3EQL C;  1GUG A;  2X6L A;  1VQ9 A;  4TQS A;  3IRB A;  3S1Q H;  3K5I A;  5IP9 G;  2CQA A;  1MJE A;  1K8A C;  4J9M A;  3FHW A;  1KAA A;  1BBX C;  1EIH A;  3MEH A;  4RAZ A;  1WR2 A;  4DV4 Q;  1AE3 A;  4QQB X;  2XD4 A;  2JA6 A;  1BCP B;  2CW7 A;  4UPA A;  1OTC A;  3RZO B;  2K1B A;  4WJ4 A;  3MR6 A;  1S0O A;  2XGP A;  4XYQ A;  1JIC A;  2L11 A;  4K2K A;  1T36 A;  3EPG A;  5LL6 S;  3WWV A;  4MV9 A;  1MI2 A;  1I50 H;  3K0Y A;  2BDN A;  2F52 A;  3T1Y Q;  1PYW D;  2FLL A;  3RBD A;  4E4T A;  1SYC A;  4EFB A;  1CA6 A;  1MD2 D;  2ASJ A;  2AWN A;  5CB4 F;  4ED6 A;  1V51 A;  3H3V C;  5LP6 F;  2BH8 A;  2CVR A;  2GA4 B;  4HAE A;  1O78 A;  3F2U A;  1OXX K;  2I5H A;  2MGS A;  1CM9 A;  2EY2 A;  1XPR A;  1QUQ B;  1K1S A;  1GOZ A;  5ELE A;  4JI3 H;  3ND8 A;  4FBU A;  3A5U A;  2Y0S A;  2A68 C;  1JKJ B;  1MGS A;  3K8A A;  4L8J A;  4O4L F;  3I91 A;  3J80 L;  1VQ6 A;  2C00 A;  1FNU A;  1P16 A;  1LTI D;  2VPQ A;  1VS0 A;  3I55 A; 
#chains in the Genus database with same CATH homology
 4FDB A;  2IHF A;  5C3E H;  4A3E G;  2JE6 I;  4KLK A;  2K5N A;  4P75 A;  2QEX A;  2JA8 G;  4B3M L;  5GAD C;  1EIF A;  1LM0 A;  4A3C H;  3S16 H;  3KF6 B;  2B29 A;  2I0Q A;  4JI1 L;  1FGU A;  2K5V A;  4DV1 Q;  2KHI A;  4JI1 Q;  4DV1 L;  3UE1 A;  1KL9 A;  3UE0 A;  2ZTC A;  2R7F A;  2RCN A;  2YV5 A;  1KD1 C;  4DR1 L;  1I3Q H;  4LF5 Q;  4YWL A;  4DR1 Q;  1HR0 W;  1UE5 A;  4ALP A;  4IPC A;  4A3G H;  3OYY A;  2UU9 L;  1VQH A;  3DLL A;  1Y1W G;  3D31 A;  4A76 A;  4YY3 Q;  1X9N A;  1EFW A;  1NTG A;  1VQF A;  3FKI H;  3L2P A;  2OQK A;  4DAM A;  4DV6 Q;  1ASY A;  3AFP A;  4JBW A;  4YWK A;  3VDY A;  2E2H H;  4OWX B;  3HFZ B;  4YCV A;  5IT9 c;  4LF7 Q;  2ZJR A;  1A0I A;  4C3I H;  2WFW A;  3F8T A;  4RG1 A;  1C7Y A;  2HHH L;  3HOV H;  1FJG Q;  4JI8 L;  3DM3 A;  3M4P A;  1U5K A;  2NZH A;  3M4Q A;  4A93 G;  4OON A;  4DR3 Q;  1MJC A;  2OQ0 A;  5GQO A;  1Y14 B;  2WB1 G;  4BA1 I;  4GOP A;  1AE2 A;  3U58 A;  3HOX H;  4L5S A;  4BBS H;  2JQO A;  2Y0S E;  4IOA A;  3G48 A;  2JA9 A;  4OWT B;  4DKA C;  1BKB A;  2VQE L;  3U4V A;  4GLX A;  3MEF A;  3S17 H;  2R93 H;  5JJK A;  3TQY A;  3RZO H;  2K4K A;  3A74 A;  1PHJ A;  2KCM A;  1K8G A;  2KHJ A;  4X64 Q;  1EQQ A;  1L1O B;  1X55 A;  3W5O A;  4DR4 Q;  1XTD A;  2CWP A;  1TWG H;  3KDF A;  3CME A;  3PO3 G;  2VUM H;  4BA2 I;  1YVC A;  3E9I A;  3FP9 A;  3KF6 A;  1YHB A;  4A3L G;  5HGQ A;  1P8L A;  2A8V A;  4JCV E;  1CKN B;  4BY1 H;  5FJ8 H;  1YJN A;  3GTK H;  4C3H H;  3KJO A;  3H3V H;  4JG2 A;  1UE1 A;  4DV4 L;  3PF5 A;  3T1Y L;  1J6Q A;  4DNI A;  3S2H H;  1VQK A;  3HKZ G;  1QVC A;  3S24 A;  1S40 A;  3H3V I;  4GNX A;  5FLX c;  3E9H A;  1IZ6 A;  4X65 L;  4JI4 Q;  1SE8 A;  1LTL A;  4X65 Q;  4LF6 Q;  1PH5 A;  5IYC H;  4NXM L;  2PI2 E;  2RHS B;  4R4O A;  3RZD H;  4GKJ Q;  1YJ9 A;  1VQC A;  2AMC B;  4HJ5 A;  1FJG L;  1S72 A;  1N36 L;  2D62 A;  1W2B A;  1YJW A;  1CUK A;  1G29 1;  1Q1E A;  1J5E Q;  2D0P A;  3FKI G;  4B3T Q;  3HOW G;  2R92 H;  1PV4 A;  5HY6 A;  2UUB L;  1NBW A;  1QZG A;  1XJV A;  2E5L Q;  1BVS A;  1B8A A;  1I94 L;  4X64 L;  5FLM G;  5C0X G;  3I4M H;  1MKH A;  3HOY H;  3CMA A;  3RNU A;  2EXD A;  1M1K C;  1KHI A;  3RLO A;  2MFI A;  3SGI A;  3ZJY C;  3CCS A;  2NN6 G;  3CCE A;  2ID0 A;  4QJF A;  2KBN A;  2NN6 I;  4LWC A;  5C3E G;  1HZA A;  3STB D;  4A3E H;  1PH3 A;  4HJ7 A;  1Q46 A;  3NEM A;  4JV5 L;  3ULJ A;  3CCV A;  1QVF A;  2Q2U A;  3PV0 A;  4EQ5 A;  1CSP A;  3GDE A;  2R7D A;  4Y52 H;  4GN4 B;  1WFQ A;  3F2C A;  4DV0 Q;  1FL0 A;  3AEV A;  1NE3 A;  2CKZ B;  2H5X A;  2ES2 A;  2WAQ G;  3EIV A;  2LXJ A;  4KI0 A;  3S1N H;  3L0O A;  4UP8 A;  1SRO A;  1E22 A;  1WJJ A;  2BA1 A;  3TS2 A;  3CCM A;  1L0W A;  1N9W A;  1IXR A;  4X62 L;  2NVQ H;  4P72 A;  2Q2T A;  3B6Y A;  1Q82 C;  1N32 L;  1C9O A;  5IY0 A;  3OTO Q;  1XNQ L;  4AIM A;  5M3F G;  1K3R A;  1K73 C;  3S1R H;  1JT8 A;  2PNH A;  2UUA Q;  4LF6 L;  1IBM L;  2HQL A;  4IPD A;  1YNX A;  5AJ3 Q;  1E1T A;  3D0F A;  5IYB G;  5JJL A;  1WYD A;  2N3S A;  2N78 A;  3CF5 A;  3PCO B;  1N36 Q;  3J81 c;  2K52 A;  2NZO A;  3CCU A;  1PYS B;  4C3J H;  5M3M H;  5LMN W;  1D7Q A;  3HOY G;  2N8N A;  2OTL A;  4LFA Q;  3KOJ A;  1XPU A;  3PUX A;  1PVO A;  2AKW B;  2UUB Q;  2PI2 A;  3F1Z A;  5C0X J;  3OW2 A;  5IE8 A;  1QUQ A;  5LMN L;  4IO9 A;  3PSI A;  4L5R C;  4OXP A;  2CCZ A;  3T1H Q;  2BH2 A;  1YI2 A;  1K9M C;  1Z47 A;  2IT1 A;  2IX0 A;  3BU2 A;  3HOW H;  1KRT A;  3PUY A;  1HR0 Q;  4DR6 Q;  1B70 B;  4MNO A;  1LUZ A;  4JI7 Q;  4GLV B;  5J3B A;  4IOC A;  2Z6K C;  1XMO L;  1L2F A;  4JYA Q;  4K0K L;  1DGS A;  1WCM H;  3J7Z C;  2B3G A;  1PH1 A;  3ULL A;  3RN2 A;  2JA6 H;  5C4X G;  3GTL H;  4AYB E;  5IYC G;  1HNX L;  3RN5 A;  5EAY A;  4APV A;  4JI8 Q;  1SLJ A;  1QZH A;  3ERS X;  2IX1 A;  4KHP L;  1UE7 A;  1HZB A;  4YHH Q;  2UXC Q;  1IBK L;  5IP7 H;  2OWO A;  4A3J G;  4NB3 A;  1Q12 A;  3J80 c;  5JJI A;  4J15 A;  3GTP H;  3UDI A;  5FJ8 G;  4GKK Q;  2AWO A;  3GTM H;  1GD7 A;  1HH2 P;  1A62 A;  1TWH H;  1N32 Q;  4JBJ A;  4PZ8 A;  3CP0 A;  3I4N G;  2K50 A;  1B7Y B;  3JAM c;  3RLN A;  3I4O A;  4DR4 L;  2UXB L;  1X3G A;  3UDX A;  1HNZ Q;  3ER0 A;  3F2B A;  4LF9 L;  1PH8 A;  5FLM H;  4DV3 L;  2HIV A;  5K36 G;  2FXQ A;  1HNW Q;  3PO2 G;  3K7A H;  5ELN A;  4DR5 L;  4DUY L;  1TWA H;  2K14 A;  4IPG A;  1YIJ A;  4GLA C;  4JOI A;  4B3S Q;  2ZTE A;  1E7Z A;  4BY7 H;  4X62 Q;  1CSQ A;  4YWM A;  4HID A;  3MXN B;  1VQO A;  3GTG H;  1H95 A;  1V1Q A;  1EQR A;  3GTQ H;  4A3F H;  4A3I G;  1NJI C;  1HZC A;  2E8G A;  4GN5 A;  1PFS A;  1VQD A;  2YTY A;  1AH9 A;  1KIX A;  3I7F A;  1HNW L;  3AFQ A;  1Q8K A;  1I5F A;  1IBM Q;  2LXK A;  4IFD I;  1SFO H;  4WJ3 M;  3CC2 A;  3NEN A;  5C44 G;  1C0A A;  4C2M H;  3CPF A;  3EBE A;  1VQE A;  2F3I A;  1OXS C;  4QL5 A;  3A5Z B;  2IHE A;  3CW2 C;  5JEA J;  2ZM6 L;  4A3G G;  2CFM A;  2GVB A;  2PQA B;  2MO1 A;  3EN2 A;  4BY1 G;  4NXM Q;  5IP9 H;  2QGQ A;  1TWF H;  1VQ4 A;  2JA7 H;  4X6A H;  4QIW E;  2YU9 H;  1NY4 A;  4NXN Q;  2ALY B;  4YCU A;  3CD6 A;  1XNR Q;  1OXV A;  1J5E L;  3KLW A;  1GO3 E;  1Z9F A;  3PUZ A;  4LUV A;  4HJ9 A;  1PH4 A;  1A63 A;  4DUZ L;  2JA8 H;  2F4V Q;  1EUJ A;  1OXT A;  4QY7 A;  2JA6 G;  1I6H H;  1WCM G;  3AYH B;  2ZJP A;  4DUY Q;  1SN8 A;  1QVG A;  3GO5 A;  2RHQ B;  4JI5 Q;  1X6O A;  3K0X A;  2JEA I;  2Q2H A;  3CCL A;  2BA0 A;  4PMW A;  4P71 A;  3HOZ G;  1BBW A;  4BBS G;  4DR6 L;  2UXB Q;  1CKM A;  4MZ9 A;  4JI6 L;  4JBM A;  4UP9 A;  4X66 L;  3CCQ A;  4DV2 Q;  2NVY H;  3GTO H;  4JI6 Q;  4KHP Q;  4IPH A;  4AQY Q;  3UDF A;  1PH6 A;  4QGU A;  3TRZ A;  1PH2 A;  1I94 Q;  4A3I H;  5H1S E;  1GVP A;  3HOV G;  2VZA A;  1E1O A;  2OCE A;  5M5X H;  2B63 G;  2ZTD A;  3M4O H;  4JOI C;  4BBR H;  2JJQ A;  5E7N A;  3M85 A;  4B3T L;  1VCI A;  1KAW A;  4L5Q A;  1G51 A;  4JYA L;  3KDF B;  4O0A A;  1N34 Q;  2UXD L;  1KQS A;  3F2D A;  1Y1V H;  1IYJ B;  4GKJ L;  4XTC S;  4A4I A;  1VQ8 A;  3S1M H;  4BBR G;  1RL2 A;  2EQS A;  4POF A;  1XMQ L;  2UU9 Q;  2A1A A;  4JBK A;  4JI7 L;  3K7U C;  4GNX B;  1A8V A;  1X3F A;  4LUO A;  2ZM6 Q;  1EYG A;  4GOP B;  1HR0 L;  2V1C C;  1E3P A;  4A75 A;  2ATW A;  4DR2 Q;  4OX9 L;  2DGY A;  1O7I A;  1S3O A;  3LGJ A;  1T9H A;  2L15 A;  3HKZ E;  4DV5 L;  1PH7 A;  4NXN L;  4LF7 L;  1Q86 C;  4PZ6 A;  4R4Q A;  3I4N H;  2R7Z G;  1G6P A;  4IJH A;  1U0L A;  5DLQ E;  1W3S A;  1TWC H;  2JEB I;  5ELO A;  2VW9 A;  1MIU A;  5M5W H;  4PZ7 A;  2D0O A;  4IJL A;  3OTO L;  4A3M H;  1JB7 A;  3NEL A;  4IFD G;  3TS0 A;  2WAQ E;  1ASZ A;  4JI3 L;  3W1B A;  2Z6K A;  3I55 A;  2Q2I A;  2NVX H;  4A3J H;  3J80 i;  5AJ3 L;  4LF5 L;  4DPG A;  2MQH A;  2WB1 E;  4B3S L;  1EOV A;  1L1O C;  5C4X H;  5LMU Q;  1VQM A;  2RF4 A;  4DK6 C;  5LMU L;  2I5M X;  2VUM G;  2XTI A;  3JAM i;  1Q7Y C;  4A3D H;  1E24 A;  1NMF A;  2EIF A;  3STB C;  4JI3 Q;  4B3R L;  3K80 C;  4O2D A;  3S15 H;  1K0R A;  2E5L L;  2PQA A;  4H02 A;  2HHH Q;  5JEA G;  3E0E A;  4LW1 A;  1WOC A;  2JA5 G;  1VQA A;  1SRU A;  4DR7 L;  4JI0 L;  4B3M Q;  4DAY B;  5IYB H;  3PUV A;  2Z0S A;  4YY3 L;  1X3E A;  4MTN A;  4A93 H;  1JJC B;  1VQ7 A;  3I56 A;  4OO1 G;  1VQJ A;  2CWA A;  1K83 H;  4JC0 A;  3BZC A;  4A3F G;  3CQZ H;  1IBL Q;  1N33 L;  4TQU S;  3L7Z C;  1X54 A;  2JA5 H;  2B63 H;  1UE6 A;  3NBH B;  1XMQ Q;  2E2J H;  3CCJ A;  1N8R C;  3H15 A;  4DV7 Q;  3JC6 6;  1FVI A;  1IBK Q;  4YHH L;  4K0K Q;  1Y1W H;  4DV2 L;  5C0X I;  3CC4 A;  1JJG A;  3UDG A;  2VQF L;  4P73 A;  1HNX Q;  5BR8 L;  4HIO A;  4GS3 A;  2HIX A;  1VQ5 A;  3PO3 H;  1V43 A;  5C4J H;  4LF8 Q;  1CKO A;  1PA6 A;  1GM5 A;  1X56 A;  2MO0 A;  1Q81 C;  4JI4 L;  4A3K G;  1N34 L;  2UXD Q;  1JJ2 A;  4AQY L;  3G4S A;  4LFB L;  2UXC L;  2R93 G;  2A19 A;  3CPW A;  2R6G A;  4RMF A;  4TVA B;  1EWI A;  2C35 B;  5IP7 G;  3HOX G;  1YEZ A;  3BJU A;  2VQE Q;  1KC8 C;  1UEB A;  1L1O A;  2ZJQ A;  3J81 j;  4LNQ A;  4JI0 Q;  2HT1 A;  3RR5 A;  4LF8 L;  4DR3 L;  3A0J A;  3CCR A;  4A3M G;  1SR3 A;  3K81 C;  4HIK A;  3RLF A;  1VQN A;  1HJP A;  3G6E A;  5GRO A;  2Y0S G;  4Y7N H;  1XMO Q;  1WI5 A;  4X66 Q;  2F4V L;  3I4M G;  2KEN A;  1GKH A;  3KF8 B;  4DUZ Q;  4UY8 C;  4BXX H;  3U4Z A;  3HKS A;  1VQL A;  3T1H L;  1NMG A;  3ULP A;  1SMX A;  3Q8D A;  4R1J A;  4R4T A;  3J81 i;  4GNX C;  3H0G G;  2R92 G;  2CQO A;  5IYD H;  3CAM A;  1R9T H;  4BY7 G;  1VQP A;  3PO2 H;  1YBY A;  5IWA Q;  4OWW B;  1N33 Q;  4DK3 C;  1YZ6 A;  3PF4 A;  1JMC A;  5IWA L;  2AHO B;  1KXL A;  1X65 A;  5M3M G;  1Y1V G;  4A3B H;  4DR5 Q;  2PMZ E;  2OTJ A;  2QA4 A;  4NPS A;  4AH6 A;  3J7A 5;  1BBU A;  4JI2 L;  1V9P A;  2ASB A;  4DV0 L;  2K75 A;  4DV6 L;  1HNZ L;  4LF9 Q;  4R4C A;  3KJP A;  3PIO A;  5M3F H;  4DR2 L;  2YYZ A;  4OX9 Q;  4HIM A;  4JV5 Q;  1YHA A;  1JE5 A;  4UP7 A;  2E2I H;  3HOZ H;  3M3Y H;  3W1G A;  2VNU D;  4A3L H;  4POG A;  4A3K H;  2DUD A;  1OXU A;  3PIP A;  4LUZ A;  2YTV A;  4DV3 Q;  3HOU H;  2IY5 B;  1CKN A;  4GOP C;  4L5T A;  2N49 A;  4LFB Q;  2XGT A;  2WP8 J;  3M9B A;  3I2Z A;  2VY3 A;  1EIY B;  5GAE C;  4KHZ A;  3CXC A;  2GN5 A;  3HOU G;  1XPO A;  5IYD G;  4P74 A;  2JK8 A;  3GD7 A;  4ME3 A;  3TRE A;  4JI2 Q;  5GAH C;  1VQ9 A;  3KFU A;  3IRB A;  3S1Q H;  5IP9 G;  3BZK A;  1MJE A;  2JA7 G;  2VQF Q;  1K8A C;  4YCW A;  4LFC L;  3FHW A;  4DV5 Q;  3M7N A;  4LF4 L;  5LMN Q;  2K5H A;  2VS1 A;  4DV4 Q;  2I5L X;  1AE3 A;  1KRS A;  2VL6 A;  5M5Y H;  5C44 H;  4GKK L;  2YTX A;  4QQB X;  4OO1 I;  1YIT A;  2KCT A;  1M90 C;  4UPA A;  5GAG C;  1OTC A;  2LSS A;  1PYB A;  4WJ4 A;  4A3B G;  5BR8 Q;  1Q1B A;  3WWV A;  2UUC Q;  4LFC Q;  1I50 H;  3T1Y Q;  2F52 A;  3PUW A;  3S2D H;  4A3D G;  2UUC L;  1RIP A;  1VQG A;  1UWV A;  3H0G H;  4A3C G;  1XNR L;  4IFD J;  1LYL A;  4EX5 A;  4DR7 Q;  2AWN A;  1IBL L;  4PG3 A;  2MNA A;  1HZ9 A;  1VQI A;  2BH8 A;  1XNQ Q;  4HJ8 A;  3CC7 A;  4B3R Q;  4R4I A;  3U50 C;  1OXX K;  2I5H A;  3ICE A;  2GVA A;  1YHQ A;  4LF4 Q;  1TXY A;  1XPR A;  2NVT H;  1QUQ B;  1D8L A;  3TEH B;  4AYB G;  4XIG S;  4BXX G;  1PH9 A;  3S14 H;  1IL2 A;  4DV7 L;  1VQB A;  4HJA A;  3PGZ A;  3A5U A;  3GTJ H;  3K8A A;  4LFA L;  2UUA L;  3AQQ A;  3G71 A;  1VQ6 A;  4GN3 B;  4JI5 L;  1P16 A;  2R7Z H;  1VS0 A;  3KYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...