4QJFA

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
186
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKKKAKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit E'
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
total genus 40
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qjfA02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qjfA01
4JI7L 4A3FH 1VQGA 2LXKA 4DV3Q 1E1TA 4B3TL 1WCMG 2ID0A 1VQIA 4JI7Q 3CC4A 3J7ZC 4IO9A 1XPOA 1JB7A 4B3TQ 1L2FA 1R9TH 1SLJA 4JYAL 1YEZA 2N78A 4IPGA 2JA8H 3CCUA 1T9HA 2UU9L 4GLVB 1VS0A 3M85A 4A3JG 3CPFA 1XPUA 4JYAQ 5K36G 2UU9Q 1M1KC 1BBUA 2K75A 1VQJA 4DV4L 1X3GA 4GKKL 3RLOA 5GAEC 5C4JH 3U58A 1PA6A 3PSIA 4OX9L 4LF7L 2E8GA 3S17H 4DV4Q 1YITA 4GKKQ 1LYLA 4OX9Q 4QJFA 4LF7Q 4C2MH 4HJ8A 2B29A 2CWPA 3K81C 4KHPL 1X3FA 1YIJA 1K73C 4H02A 1HZ9A 3D31A 2Q2TA 1YJ9A 3MXNB 4KHPQ 2A1AA 1Q81C 1IBLL 3H0GH 4DK6C 2OTJA 3HKZE 4POGA 1VQMA 2HIVA 3I4OA 4JI5L 5FLXc 1IBLQ 3ICEA 4YCUA 2D0PA 4LF4L 4PZ7A 4A3GH 1VQAA 1I5FA 3JC66 4QGUA 4JI5Q 4IJHA 4OO1I 3UDGA 4LF4Q 3KDFA 4A93H 3M4PA 3UDXA 4BY7H 3OTOL 1JJCB 3TRZA 2OQKA 4HJ9A 4UP9A 4YCWA 2BA0A 2ZM6L 3H3VI 3PO2H 5JJKA 2E2HH 2ZJRA 4A3FG 1VQ8A 2OTLA 2R7DA 3H3VH 3AFPA 4AYBG 2ZM6Q 1D7QA 4R4CA 3AYHB 3JAMc 1KRSA 4BA1I 5GROA 1P8LA 3B6YA 4B3ML 2JA9A 2MO1A 1VQOA 3HOXH 1IL2A 1AE3A 2JA8G 3CCEA 4BXXH 1A63A 4B3MQ 1PH4A 2ZTEA 2QA4A 4DV1L 2Q2IA 2CCZA 1N32Q 4JI3L 3M3YH 3GTQH 2R93H 4RG1A 4DV1Q 1V43A 1H95A 4JI3Q 4DR4L 2B63H 1PH1A 4L5RC 5ELOA 3F8TA 4DR4Q 2ZTDA 3F1ZA 3KYHC 1PH6A 1Q82C 5BR8L 5M5XH 3J80c 1WI5A 2KBNA 1OXUA 4IOCA 3HOVH 5E7NA 1EWIA 4UP7A 2XGTA 1PH8A 4BBRG 5M3FH 1SR3A 2KCTA 3H0GG 3K7UC 2DGYA 2IY5B 4MNOA 1QVGA 2NVXH 3EIVA 4GNXC 3ULLA 5HY6A 3CF5A 3CP0A 1VQ6A 4A3GG 4NXNL 1N34L 4BA2I 2WAQE 1G291 3Q8DA 2EQSA 3KF8B 3PCOB 4BY7G 4A93G 1Y1VH 4OO1G 1N34Q 3GD7A 3RLNA 2AHOB 2UXCQ 1ASZA 2JJQA 2E2JH 3PO2G 5JJLA 2AKWB 2XTIA 3CXCA 1FJGL 3S16H 4BBSH 2UUBL 1VQCA 3CW2C 2RF4A 4GN5A 3RNUA 1FJGQ 1QUQA 4IFDI 2PQAA 2IHFA 3HOXG 5IYDH 1QUQB 4TVAB 3CC7A 4BXXG 4AIMA 1EQQA 4KLKA 5JEAG 2PQAB 3PUVA 1AE2A 3TREA 2QEXA 1VQLA 1OXVA 2R93G 1TWAH 1J6QA 1PYBA 1YVCA 1IBML 3CD6A 2HIXA 2VL6A 3DM3A 2B63G 5M5WH 5GAHC 1IBMQ 1I94Q 3TQYA 2Q2UA 1N8RC 4X66L 4GOPC 5LMNW 3ULPA 1Z9FA 3HOVG 2PI2A 1L0WA 4DV0L 4GKJQ 4X66Q 4GN4B 2NN6I 1VQHA 3KJPA 5M3FG 1EUJA 4DV0Q 1OXSC 2JK8A 4JI0L 3ULJA 5IYBH 1X54A 3G4SA 1Q46A 3PIPA 4JI0Q 4J15A 4YHHL 3UE1A 3S14H 2OQ0A 1CSPA 3BU2A 3I4MH 4YHHQ 1W2BA 2MNAA 3ER0A 4DPGA 4OONA 1Y1VG 4JBMA 3A5ZB 4NPSA 1IBKL 1VQ7A 3FP9A 3M4QA 1KQSA 4X6AH 4A3KH 4IPCA 4ALPA 1WYDA 1IBKQ 4BBSG 2B3GA 2CFMA 4A3DH 1K8AC 3KFUA 3D0FA 5C0XJ 1BBWA 2K5VA 2WP8J 2A8VA 2D62A 3MEFA 3S1RH 5EAYA 1PYSB 3DLLA 4HJ7A 3CCLA 1UWVA 3E9HA 5IYDG 3K80C 4O0AA 2OCEA 1HR0W 3GDEA 1NJIC 2I0QA 4L5SA 2YTYA 3PIOA 2WFWA 2KENA 1MJEA 5H1SE 1XTDA 3FKIG 4JOIA 1EFWA 1PFSA 2RHQB 4DKAC 2VW9A 3WWVA 4HIKA 4JCVE 1S40A 1E22A 4DV7L 1N36L 2I5HA 3F2BA 1NMGA 1FGUA 4A3LH 1TWGH 3TEHB 1N36Q 2DUDA 2JA6H 1MJCA 3KOJA 3CCSA 4C3JH 1KC8C 2F4VL 4PMWA 4IFDJ 4BBRH 2NN6G 3CMAA 2F4VQ 5IYBG 4DAMA 4Y52H 3BJUA 3OYYA 1KD1C 3CCMA 1E1OA 1X3EA 1JJGA 2CQOA 4DK3C 1TWCH 5FJ8H 2Z0SA 3I4MG 2ALYB 3UE0A 1Y1WG 1JMCA 4L5QA 2AWNA 4FDBA 4LF6L 4YWMA 3S2HH 4A3KG 1W3SA 3G6EA 4DUYL 3OTOQ 2BH8A 1A0IA 3W5OA 1U0LA 3GO5A 4A76A 1Q7YC 2I5LX 3RLFA 4LF6Q 4A3DG 4DUYQ 4A3MH 2Y0SE 1YHBA 5LMNL 1Q1BA 3S24A 1N33L 1PH9A 1VQ5A 5LMNQ 1N33Q 2GVBA 5LMUL 1PH3A 1UE1A 4R4OA 4LNQA 5LMUQ 1HZAA 2GN5A 2NVTH 4LF5L 1SN8A 3CC2A 3KF6A 4GLXA 1X9NA 3RN2A 1YZ6A 4LF5Q 3F2CA 4YWLA 2VUMH 3GTOH 1YHAA 4A3LG 5GAGC 5IP9H 1A8VA 4P75A 4DR7L 3KF6B 1QVFA 2JA6G 5C0XI 1TXYA 1WOCA 2I5MX 4DR7Q 3PUXA 1L1OA 5BR8Q 2ES2A 1C7YA 3M7NA 2IX1A 1Q8KA 4C3HH 3S2DH 1E3PA 4C3IH 1KXLA 3PF5A 1L1OB 4QIWE 1GO3E 1HNZL 5DLQE 1KHIA 5FJ8G 1XMOL 3GTLH 4EX5A 1HR0L 4LF9L 1I50H 2ZTCA 3BZCA 3SGIA 1XMOQ 4DR6L 3T1YL 4LF9Q 4APVA 4GN3B 1WJJA 1HR0Q 2UUCL 4NXNQ 1YHQA 4A3CH 4DR6Q 2R92H 3T1YQ 3J7A5 2ASBA 1YJWA 1U5KA 1X65A 3I7FA 1KRTA 3T1HL 4A3MG 1Z47A 2UUBQ 4Y7NH 3GTKH 3T1HQ 3PUZA 3PV0A 3EN2A 4QQBX 1P16A 3RZOH 2Y0SG 2VZAA 3J81i 4B3RL 2MQHA 3HOWH 2JEBI 4P71A 2IT1A 1K8GA 1NE3A 4LWCA 1I3QH 3M4OH 4DAYB 3FKIH 4GNXB 3S1NH 5IE8A 5ELNA 4LFBL 1ASYA 3U4VA 2VUMG 1I6HH 2Z6KC 3ZJYC 5IP9G 2CWAA 4LFBQ 3A5UA 3A0JA 1GD7A 2QGQA 1XNQL 1YI2A 3L7ZC 4GS3A 3L2PA 2K5NA 1IXRA 2NZOA 3CMEA 3OW2A 3ERSX 1XNQQ 2ATWA 3LGJA 3M9BA 2KHIA 4JBWA 1QZHA 3RZDH 1IZ6A 3AFQA 4MTNA 3F2DA 4HIOA 1G51A 3NELA 2N49A 1Y14B 4A3IH 1YBYA 1SMXA 1Y1WH 4YWKA 3RR5A 3U50C 1KL9A 4A75A 4DR3L 1BVSA 5M3MH 1K3RA 1MKHA 4A3CG 3FHWA 2R92G 4DR3Q 3NENA 4RMFA 4DR1L 4LF8L 2YTXA 1CUKA 2MFIA 4A3EH 1V9PA 2H5XA 2L15A 4P72A 4DR1Q 1TWFH 3VDYA 4LF8Q 2WB1G 4R4TA 2LSSA 1YJNA 2BA1A 2HT1A 2R7ZH 1SROA 2IHEA 4IFDG 5JJIA 1J5EL 4OWWB 3W1GA 3TS0A 2E2IH 3RN5A 4JBKA 3AEVA 3HOYH 4K0KL 4LUVA 4HIMA 4JI1L 1J5EQ 4B3SL 3HOWG 4K0KQ 2PNHA 2KCMA 3E9IA 4P74A 2HQLA 1VQFA 4OWTB 4JI1Q 4B3SQ 1OXTA 3PO3H 1NBWA 3AQQA 3STBC 4JI2L 4DNIA 3CCQA 3TS2A 4JOIC 2AWOA 2N3SA 2K5HA 4JI2Q 1NTGA 4JC0A 1VCIA 1Q1EA 3KJOA 1Q12A 1Q86C 4A3BH 2VQEL 4UP8A 4AQYL 2YYZA 4WJ4A 4DV7Q 2YTVA 1G6PA 2PI2E 2VQEQ 4AQYQ 1UEBA 1CSQA 1B7YB 1PH7A 2VY3A 4JI4L 1PH5A 1B8AA 1HZCA 4JI4Q 2OWOA 2LXJA 1RL2A 2IX0A 3CCRA 4A3IG 1XMQL 1GM5A 1X56A 4KHZA 1CKMA 1C9OA 1B70B 1LTLA 4IPDA 5HGQA 1E7ZA 4X64L 1XMQQ 1KAWA 3L0OA 2NVYH 1PV4A 3S1QH 4X64Q 1OTCA 5M3MG 3PUWA 4DV2L 4TQUS 1VQNA 1UE7A 4A3EG 4DV2Q 4OWXB 4LW1A 2C35B 4XTCS 4DV6L 5AJ3L 3CPWA 1UE6A 1K9MC 4LFAL 4PZ6A 3JAMi 1D8LA 5C4XH 2EXDA 2RCNA 4DV6Q 5AJ3Q 2R7ZG 3HOZH 4IJLA 4PZ8A 3CQZH 3U4ZA 3HOYG 3BZKA 3STBD 1EOVA 2UXBL 4DUZL 3I4NH 1S3OA 1TWHH 2UXBQ 1EYGA 4DUZQ 5IYCH 3PO3G 4JV5L 4HIDA 1HH2P 3NBHB 3UDFA 2JA7H 4YCVA 4JV5Q 2YV5A 1VQ9A 4HJ5A 5C3EG 4HJAA 1C0AA 4A3BG 2JEAI 2NVQH 1K0RA 1LUZA 2CKZB 2RHSB 3J80i 4DR2L 1CKNA 1K83H 2Q2HA 1LM0A 2GVAA 3KDFB 1PVOA 1VQBA 4DR2Q 2F52A 1S72A 4IPHA 3I55A 3G48A 4NXML 1CKNB 3J81j 2ZJQA 2UUAL 4PG3A 1EQRA 1L1OC 1HZBA 4DR5L 4NXMQ 4LUZA 4OXPA 2UUAQ 1NMFA 2NZHA 4WJ3M 1FL0A 4JI8L 1N32L 2K4KA 1HNWL 4DR5Q 4KI0A 4JI8Q 5C44H 3GTPH 2VNUD 1HNWQ 4JI6L 1HNZQ 4YY3L 4XIGS 1RIPA 3HOUH 4JI6Q 2WB1E 1XPRA 1IYJB 2MO0A 3HKSA 2FXQA 4YY3Q 1KIXA 2JA5H 4BY1H 2UUCQ 1DGSA 4DV5L 2AMCB 3PF4A 5C4XG 4DV5Q 1QZGA 5IT9c 3HOZG 4P73A 5IP7H 5IY0A 2HHHL 2YU9H 5M5YH 1EIFA 2K50A 3I4NG 3HFZB 4NB3A 4GNXA 4R1JA 1VQKA 2HHHQ 4QL5A 2VS1A 4O2DA 2V1CC 3K8AA 1HJPA 4JG2A 5IYCG 5FLMH 2VQFL 4B3RQ 1V1QA 3I2ZA 2JA7G 3HKZG 2VQFQ 2UXCL 4X65L 2ZJPA 3W1BA 1VQPA 2KHJA 4X65Q 1X55A 4MZ9A 4UY8C 5C3EH 1XNRL 4UPAA 3S1MH 4R4IA 3GTJH 2F3IA 1UE5A 1WCMH 1GVPA 2A19A 1VQEA 3K7AH 5C0XG 1XNRQ 1A62A 3E0EA 3A74A 3CCJA 1SE8A 5GADC 4AH6A 1M90C 2EIFA 1MIUA 4JBJA 3K0XA 1EIYB 1QVCA 4A3JH 3J81c 5C44G 3G71A 1PH2A 3CAMA 3GTMH 2E5LL 1E24A 1VQDA 3S15H 1YNXA 3IRBA 1SFOH 1JJ2A 1I94L 3HOUG 2Z6KA 3PGZA 5J3BA 3I56A 1VQ4A 1PHJA 2E5LQ 4IOAA 4BY1G 1JE5A 4GOPA 2JA5G 1X6OA 2K14A 3KLWA 4GKJL 1FVIA 3H15A 2D0OA 1HNXL 5GQOA 2UXDL 4GLAC 1OXXK 4GOPB 1AH9A 1BKBA 1HNXQ 4A4IA 2BH2A 5IP7G 2UXDQ 1JT8A 1XJVA 4LUOA 4EQ5A 1O7IA 2R7FA 4L5TA 4R4QA 1SRUA 3PUYA 5JEAJ 1N9WA 2K52A 1GKHA 3CCVA 2R6GA 1NY4A 5FLMG 3NEMA 4LFCL 4ME3A 4X62L 2JE6I 2N8NA 5IWAL 4POFA 3GTGH 2PMZE 4LFCQ 4AYBE 4X62Q 1WFQA 3EBEA 5IWAQ 1CKOA 2JQOA 3UDIA 4DV3L 2WAQG 4LFAQ 4QY7A
chains in the Genus database with same CATH superfamily
4JI7L 1KNEA 4A3FH 1RF2D 4B3TL 1WCMG 4JI7Q 1H9RA 3CC4A 3T1YH 1JB7A 4B3TQ 1R9TH 1JQYD 3TSSA 1BBXC 3HOXB 3KAJA 1B2TA 2N78A 1ICWA 2G9HD 2JA8H 5IYZF 4ED8A 4O2BF 1VS0A 1EL0A 3BVMA 3M3YB 2F0GA 3NBIA 1T5EA 1LTRD 4DV4L 2XGQA 5GAEC 5EPJA 5C4JH 1B6SA 1IW7D 3GTOB 4DV4Q 2IWHA 1YITA 2EPBA 2XD4A 5M5XB 3QWNA 2YZNA 4YJ2F 3OSPA 4APMA 4KHPL 1EZ6A 1EY6A 1K73C 1HZ9A 1YJ9A 3MXNB 4C3HB 4KHPQ 3S2DB 2A73B 3H0GH 4DK6C 3HKZE 2MCTA 1V51A 2HIVA 4Q0YA 1SSOA 3I4OA 4WD3A 4RAZA 2B2YA 3WOFA 1EYDA 2B2VA 4X3UA 1CE8A 1PX2A 4IUVA 4CKBA 2J0TD 1KJQA 2JP1A 3M4PA 3F2UA 3MAQA 3U9TA 3E0JA 1JJCB 2E2JB 2LFNA 1JOQA 4UP9A 3LWBA 2BA0A 2ZM6L 3H3VI 4TUYF 3V6JA 2E2HH 2V4DA 4LSXA 4AYBG 2ZM6Q 1Y8OB 3J80E 5F2DA 1I4HA 1P8LA 4B3ML 4PWQA 2WIIB 5KFHA 4J9QA 1AE3A 2EJMA 4B3MQ 1PH4A 4A2BA 4YBZB 4JI3L 1RTOA 1MI2A 3FKIB 3GTQH 1JICA 2RDIA 1N56A 1V43A 1H95A 2IBKA 4JI3Q 2B63H 1QILA 4XT1B 1PFBA 4IZOA 5ELOA 5D8DA 4R9WA 3C46A 3K58A 3UFXB 1IOVA 3HOVH 2F0HA 5KFOA 2F3VA 3L4JA 1EWIA 3NE5B 4BBRG 5M3FH 1SR3A 1JKJB 2KCTA 3K7UC 4AQYH 3V96A 1ZHQA 2V58A 1EQVA 2VR1A 1QVGA 1RTNA 3KXYT 1MBYA 2WAQE 1S68A 1Y1VH 3FVQA 3BQ1A 2Z8LA 3GD7A 2AHOB 4A3KB 5L1KA 5EBDA 5JJLA 1DJRD 3CXCA 3S16H 1FJGL 4BBSH 4Q44A 4J6HA 2RF4A 4GN5A 1GUTA 4J9PA 1FJGQ 2N88A 1LT4D 3R2TA 4YQWA 1QUQB 1S5BD 1PZKD 4RCOA 2YZMA 3MEHA 5JEAG 3CKIB 4DV6H 1PDQA 2F0EA 4F4ZA 1KDBA 2R93G 4CC5A 2RGRA 3MVVA 1RJRA 2JA6A 3BG5A 1IBLH 5FO9B 5D1PA 5M5WH 1QJOA 4DUZH 4JI5H 1TS5A 1TQOA 2B2UA 3ND8A 4F88A 4GOPC 1N8RC 5LMNW 4RAYA 1L0WA 2MP1A 3K5LA 4GC6A 2W57A 1SE4A 3PVXA 5KFPA 4K14A 2JK8A 1NCVA 3N6RA 3JAML 2A69C 5IYBH 4DR2H 2CW0C 3S14H 2OQ0A 1VDZA 4K2KA 3BU2A 2KCCA 2E75C 4G7HC 1M4VA 1K8OA 4DXFA 4EYHB 3MFGA 2MNAA 4XQNA 1FNVA 1HQMC 3OOCA 4N8FA 2W8KA 4WORA 4NPSA 1QOHA 4IPCA 4ME5A 1U4MA 4CGYB 1WYDA 4ALPA 1HUNA 2EXZA 2W9AA 3EPGA 1SYXB 1K8AC 3KFUA 3D0FA 1S97A 1NNXA 2Y0SA 4J9NA 5KFCA 2A8VA 2D62A 4LH6A 5CR3A 5EAYA 1PYSB 4OEMB 1UWVA 3E9HA 1DZ1A 2FLPA 3K80C 4ZYSA 2Z6BA 5K2MA 1BCPB 1RD9D 1HR0W 3OW7A 2WFWA 2KENA 4JOIA 2RHQB 2IW3A 4IUQA 3C2PA 3EA6A 1S03G 4HMJA 2WYOA 2PPBC 3H91A 3F2BA 4A3LH 1FGUA 1FNWA 1TWGH 1WD0A 1GSOA 3EYYA 1JC7A 2DUDA 1I6VC 3K3VA 1EY5A 4RA8A 2UXCH 1W6JA 2FLNA 2NN6G 3EFXD 3W2DA 3MR6A 4Y52H 3BJUA 1KD1C 5IGFA 3OHXC 5DNFA 3NTHA 1D2BA 1BF4A 5EWEA 3UE0A 4QIWB 3WOEA 2MUYA 5EJWA 2V9WA 2WB1A 2R92B 3BYTB 3G6EA 3OTOQ 1MSGA 1A0IA 2BH8A 1Q7YC 4A76A 4A3DG 3RLFA 2XN9C 3DWQA 1KDAA 4A3MH 2AQ1B 5LMNL 1Z2NX 3GTKB 2E5LH 2ENBA 1PH9A 1VQ5A 5LMNQ 1HTPA 1PTOB 4O1NA 4O42A 3RZOB 4MV8A 3TMEA 4EG0A 2EE1A 3HOWB 1W96A 5C1PA 4DU9A 4CDDC 2R86A 3M4OB 1HZAA 4RNNA 1LTGD 2GN5A 3KF6A 4GLXA 1AUXA 2L4NA 3RN2A 2BE5C 1M6VA 2ZJTA 3GTOH 3GV7B 2AGPA 1U4PA 2RDFA 3GIDA 3TIGA 2PBZA 5CA0F 1S0MA 5LP6F 1WOCA 5EKKA 4C3JG 2J6UA 2ZDQA 1HA6A 2O4XA 2IX1A 5KFTA 3A8KE 4CBVA 5I9PA 4C3HH 4J1MA 3S2DH 3EQLC 4C3IH 1KXLA 2D5DA 4ULLA 4TSSA 1HNZL 4IHJF 4RNMA 2E2DC 4H44C 4EX5A 1HR0L 1I50H 2ZTCA 3BZCA 4DR6L 5M3MB 5KFBA 5JVDF 1TWFA 4APVA 1HR0Q 1E0BA 2UUCL 4A3CH 2YS6A 4JYAH 4DR6Q 3RIZA 1A2TA 4A3EB 4KJNA 4OIJA 3NWTA 1YJWA 3GV5B 1A3VA 4FBUA 3I7FA 2UUBQ 3D6WA 1M0TA 1DM0B 3OUZA 2EYOA 4IFDH 2XRSD 2V4RA 4ECUA 3BJYA 4LF7H 1P16A 2DY7A 2OT2A 5E4XA 1D1KA 4DAYA 3J81i 4IWXA 3Q8SB 5KNDA 3PO3B 1NE3A 3FKIH 3NP8A 3S1NH 1SNMA 1BUVT 2R3ZA 4QWEA 2R8HA 5C4HA 1SNQA 2A6HD 2EVBA 5IP9G 4F50A 1RYRA 2K5NA 2A6ED 3MTSA 1IXRA 3OW2A 1F2MA 3CMEA 2KHIA 4B9XA 3RZDH 1TAEA 3IAYA 4CKEA 5D1OA 4IURA 3PMFA 3RB0A 5ELDA 3M9OB 1Y14B 1YBYA 2NVYB 3EVQA 3J7AK 1KL9A 4A75A 1QB5D 1V1OA 5COYA 5NUCA 3H3VC 3OIPA 1JOKA 2L5TA 3NENA 3VPBA 4G7OC 3MHBA 5KFDA 1V9PA 2L15A 4P72A 4Q5VA 4DV1H 1AEXA 2F0PA 2CVRA 1TWHA 1SROA 3CQZB 4XZ3B 5JJIA 4OWWB 4L63B 5HBRB 3HOYH 2E2IH 1FD7D 4K0KL 2ASDA 4QWCA 3I4NB 3G8CA 4JI1L 3VR3A 2M05A 3M9NB 4K0KQ 3E9IA 5BR8H 1MSHA 4OWTB 1IKLA 4JI1Q 1B9NA 2JA7B 1GJXA 1JX4A 4DNIA 2R7LA 2YRWA 2K5QA 2NVQB 4A3BH 2VQEL 2C22A 4DV7Q 1G6PA 2EJFC 1XMOH 2VQEQ 4NXNH 2BQUA 5C4ZA 5KT2A 5C5LA 5KFJA 5KRUA 2VA3A 1EEFD 1CQIB 5IT9L 3GTPA 1B8AA 3M4IA 2UVVA 1B44D 3BS1A 4RGMA 2K1BA 3NWSA 4M8AA 1ET9A 1RL2A 3CCRA 1XMQL 4A3IG 4EEQA 3A7AB 3TP5A 4X64L 2WKCA 1O7LA 1UNSA 5JJKA 1PV4A 1E7ZA 1XMQQ 3S1QH 3L0OA 1O75A 3PW0A 4G3IA 2BDOA 4X64Q 2YCHA 1LT3D 2F3WA 3HOUB 3FRPB 3PUWA 1CTMA 4BY1B 2JA5B 4P2CB 4OWXB 4LW1A 4XTCS 4HR7A 5KFUA 1SXTA 4IZ8A 5C4XH 4ZK9B 3N43B 2R7ZG 1EZ1A 4FS1A 1IHZA 5M5YB 3BA8A 1EOVA 2UXBL 2MJ8A 4R8UA 4X66H 2X0SA 2UXBQ 4JV5L 1PZID 5IOCA 4ABNA 3PR4A 2W9CB 2AU0A 4JV5Q 3NQTA 4JI0H 3GTJA 1WCMA 2LS01 2CKZB 2RHSB 3SE7A 2Q2HA 1K83H 3AU7A 4UFZA 2F52A 1CFMA 4I55F 2QDBA 2SEBD 3SK8A 2L55A 3QFFA 1CKNB 2ZJQA 2QILA 3GIKA 1WTHA 2RBMA 1SEIA 2NZHA 1FL0A 1N32L 2FKLA 4KI0A 5C44H 2VNUD 3JRWA 3GTMB 1HCZA 4JI6L 2DPJA 1SFOB 1VMPA 3LWUA 4JI6Q 2WB1E 4X3SA 1XPRA 4RNOA 2FXQA 3ONAB 1AW7A 3X3MA 2FPPB 1TY2A 4DV5L 1TKWB 2V5AA 1G91A 3SHLA 1S5FD 4DV5Q 5FK9C 1QZGA 2EYJA 1HTLD 1ILPA 3HOZG 2EOTA 3DEOA 1E4EA 2Z9HA 3HFZB 3MZ5A 2VUGA 3DUZA 4JVZA 1WH2A 3K8AA 3VPCA 1HJPA 4BS9A 3I4MB 2YYAA 5E1FA 3NUCA 3QOLA 3T5HA 1F2ZA 2KHJA 4AYBA 2NB0A 2IL8A 2CH4W 1X55A 3S9WA 4Y8VB 3UQ8A 2NTSA 4RUAA 4A3FB 4MN3A 3S1MH 2F3IA 1UE5A 4DK1A 5ELEA 5KT6A 4IUNA 3S1RB 4KHVA 1R9TB 2R85A 3BAAA 4LF6H 2P0AA 5GADC 1MIUA 4JBJA 3K0XA 3TZUA 3GIIA 5C6AA 3J81W 5CBAE 5D14A 3G71A 4ZQIA 3M4YA 1DXMA 4X3TA 3S15H 4XQJA 5C4JB 2Z6KA 3JRXA 4IOAA 5KNCA 4GOPA 1X6OA 1EY7A 4GKJL 1FR3A 1EFID 1HNXL 3TQTA 5T14A 3RJ0A 4YAKB 1N48A 4ZHQF 1HNXQ 1ENAA 3Q1KA 3QZ8A 1XJVA 2R7FA 3TDQA 1SRUA 3HKZA 5JEAJ 1XYIA 2R6GA 1OWTA 4X3KA 3NEMA 3MXPA 4NXMH 3GTGH 2BCOA 1CS0A 3KK7A 5IGCA 4TV8F 4EYIB 1GOZA 4DR5H 3UDIA 1XDNA 4DV3L 1JJGA 5CV4A 4LFAQ 5C3EG 1NSNS 2ZT9C 4DV3Q 3RF2A 4LF9H 1VQIA 2Q8IB 4IO9A 1L2FA 3H94A 4K5WA 1C8CA 5LXTF 2R93A 1YEZA 1ET6A 2Y0SB 3SDZA 3I12A 3N8DA 4UCTA 5KT3A 2UU9L 2DJFC 3D8GA 3I4LA 4A3JG 3MA2B 2UU9Q 2EY1A 1IL8A 2GA4B 2X69A 1M1KC 2K75A 1SYFA 3HG9A 4GKKL 4UAIA 1PFNA 4EGVA 3U58A 4OX9L 5KFWA 3RUZA 4GKKQ 1BCPD 3PZPA 4B3RH 4OX9Q 4QJFA 4UCOA 1T94A 4IR1A 3HOVB 2B29A 1V1PB 2AQ3B 2W70A 5I4DA 5M3FB 3G6JB 2NVXA 1PZJD 2Q2TA 3Q0AA 1UUPA 2OTJA 1CM9A 1ONLA 4K5VA 3NPPA 5FLXW 1XNRH 3ICEA 4RFBA 4YR2A 4PZ7A 4A3GH 1VQAA 3JC66 4QGUA 3J81L 3RAQA 4EGJA 3UDGA 3V6KA 1Y1VB 5CV8A 4A93H 3UDXA 2ZDGA 3MJFA 2DPIA 2OQKA 3VR6A 1E2ZA 4NP5A 4FXDA 4YR0A 4BBSB 1CZGA 3WDNA 1VQ8A 2OTLA 2R7DA 1II3A 1C4QA 3L9AX 5IGEA 3H3VH 1H9SB 2CH4A 5KKNB 3EJIA 5KYIA 3JAMc 3BA9A 1ZYRD 3B6YA 5JVLA 1TWAA 1Y8NB 2FK2A 4Q0FA 2K03A 2ZXPA 3CCEA 1GUNA 2ZTEA 3VPDA 2HD3A 4MIUA 1PTOD 2PQEA 4L5RC 5M5WB 4DXGA 2V59A 3BVZA 2NZ1D 4MA0A 3RTXA 3QG1A 2ZTDA 3F1ZA 3TINA 1Q82C 1WI5A 3AB9A 5E7NA 4UCVA 4UP7A 4JI2H 1W6KA 3C3LA 5FKAC 1GUSA 2R7NA 4EQPA 2IY5B 4QW8A 3S14B 3GP7A 1JIHA 1EYCA 1CHQD 3DXJC 3ULLA 5HY6A 3SK4A 3CF5A 3OWFA 3V2TA 5HV6A 1G291 1EYAA 3PCOB 3KF8B 4BY7G 1XX8A 4OO1G 4IRDA 3OUUA 4HCSA 3U9SA 1SNPA 3PO2G 1F9SA 1KAAA 5C3WA 1AZQA 1EEID 3CW2C 2IA6A 1STAA 2M2LA 3RNUA 4DFAA 3RBDA 2K05A 2A5HA 4DV2H 3HOXG 1ZXTA 4BXXG 2NU9B 1CZWA 1EQQA 1RK6A 4KLKA 5K36H 2PQAB 3WNZA 3PUVA 5FLXL 3TREA 2MPMA 1B04A 1UC8A 3M9MB 1OXVA 1J6QA 1CT1D 2OF1A 5CA1F 3OWEB 4ECSA 1YVCA 4RH6A 2HIXA 3DM3A 1RJQA 1SNCA 5GAHC 5EPKA 1L2ZA 1NR2A 2PO4A 2XRQD 1TWGB 3TQYA 1I94Q 2Q2UA 1EY9A 1Z9FA 2PI2A 2HDMA 2I07B 1HHVA 4ED2A 4GN4B 2NN6I 3J7YW 5LA6F 2XWJB 5CAEB 1TWCA 1EUJA 1CQJB 2FK3A 4C3HG 2V4QA 4IUTA 4DAVA 1Q46A 5TSSA 2Z4IA 4YHHL 4F7XA 2PCFB 1CSPA 1AN8A 3VA5A 4YHHQ 3I4MH 5EZYF 1W2BA 3ER0A 3G7LA 1VBGA 1VF7A 3A5ZB 1VQ7A 4ED7A 1KQSA 4ODGA 1KLGD 4JI8H 2PZWA 3BZDB 1EHIA 4ED3A 1HNWH 5J1ZA 4A3MB 2JYOA 2K5VA 5FOBB 3Q24A 1WTQA 1PRTC 3S1RH 2TSSA 1F77A 4HJ7A 4ED6A 5IYDG 1I4RA 3GQCA 4F4WA 2EYLA 4O0AA 4WFN3 2YTYA 3PIOA 4HYKA 4DL2A 2ASJA 3TP6A 3FKIG 3BABA 4HIKA 1A3TA 3WWVA 3ETJA 3VYTA 4QWDA 1E22A 1JDEA 1N36L 2EYPA 3G6VA 3A8JE 2W6NA 1SAPA 2IPKD 4B08A 3TEHB 1N36Q 5IGBA 2W9BA 2JA6H 2NU6B 4HNTA 3KOJA 3MFIA 3OMGA 3R5HA 2VQFH 2IMWP 4X65H 1SNDA 3J7AV 4K6DA 3GTLA 1K3BC 4C3IB 2AUKA 4ED0A 4DAMA 1K1QA 3OYYA 1WD1A 2C2EA 5KFGA 1I50B 1VF5C 2ALYB 4L5QA 1EUDB 2AWNA 2K6AA 5I6WA 3S2HH 4A3KG 3QIAA 1BDOA 4HNUA 4ETSA 2SNMA 1C48A 2R8GA 1SNOA 4ECQA 3JAMW 1Q1BA 3EROA 3S24A 3N6XA 3KTMA 5A2QW 2QDLA 1GYFA 2HGSA 5BMVF 1GHJA 2GVBA 5LMUL 2PYKA 4R4OA 4LNQA 3S1NB 5LMUQ 2KECA 1LT6D 2NVTH 4LF5L 1PMRA 1X9NA 1YZ6A 5CGKA 4LF5Q 4TQRA 4YWLA 4DNTB 3F8NA 3I72A 2R8IA 2KOLA 4LFCH 1TXYA 4RHSA 4X62H 5CV5A 5IWAH 3SI8A 3MWYW 2KQ3A 4IQZA 3RZDB 4O3OA 1B9MA 2O2LD 1E3PA 1Y1WA 3PF5A 3U9OA 1L1OB 4QIWE 1BXTA 1GO3E 1SBBB 2VPSA 1KJIA 3MR2A 1KHIA 1S4ZA 4KKTA 3R93A 5FJ8G 5ELCA 3KHRA 3SGIA 1WVLA 3T1YL 5BPFA 5IODA 3SXHA 4FBTA 3PW2A 3T1YQ 3J7A5 2R7ZA 1WSCA 1QE6A 2F0SA 1U5KA 1X65A 3T1HL 4EFBA 5EDWA 2AUJD 4Y7NH 5DQGA 3T51B 3T1HQ 4IUPA 3HOYB 3PUZA 2E2IB 3PV0A 2XC9A 2R6FA 2M00A 5C8YF 1O80A 2G5DA 2MQHA 5KFIA 4P71A 3LX0A 4LWCA 1E4EB 3G6YA 1SYGA 2VQDA 5AFWA 3JZIA 2PMZA 1AZPA 4JV2A 3J81E 4A3BB 1ASYA 2HJWA 2VUMG 5BN3A 2BOSA 2Z6KC 2UVWA 1H9MA 2CWAA 1XNQL 3QOJA 4LF4H 1YI2A 3L7ZC 3L2PA 3QR8A 1K28A 4QUCA 4UCSA 1XNQQ 3MWEA 4J9KA 2B39A 2F03A 3M9BA 3I70A 1RODA 4JBWA 3OTOH 1IZ6A 4MTNA 4R8NA 1CK1A 1G51A 2PZUA 4H7BA 5A2QL 3NELA 4O4HF 1KTKA 3S1QB 4DF7A 1SMXA 1BVSA 4EVOA 1MKHA 2R92G 4RMFA 4XX0B 4YR3A 2YTXA 1TWFH 3HS0C 3VDYA 1BO0A 5C4XB 4R7RA 2LY7A 4R4TA 2VPQA 2BA1A 2HT1A 2IHEA 4XT3B 4DR4H 3TP7A 1BCPC 1VKZA 2JEIA 2R82A 5D3DA 3HOWG 4KN7C 2DLNA 5KEEA 1NBWA 3AQQA 3HKZB 5LYJF 5KYLA 3TS2A 3QZ7A 4ZKBB 2N3SA 2JSOA 2EYFA 1NTGA 4JC0A 5I47A 2B2TC 1K83B 1YNJD 4AQYL 2YTVA 2PI2E 4AQYQ 1GXDC 3MR5A 1CSQA 1N34H 4QW9A 1B7YB 4WRDA 1A3UA 2DY8A 1F2YA 2RDJA 2N55A 1IYUA 4HMIA 1ENFA 2UUBH 1X56A 4KHZA 1CKMA 4QUFA 5HGQA 5C44B 4IPDA 1ZQ7A 2XWBB 2R93B 2J6SA 1KAWA 3GV3A 5FLXE 1OTCA 5M3MG 4G4KA 2MGSA 1I7LA 4TQUS 1C30A 3I3CA 4A3EG 2K32A 5KFSA 2YU9A 1LTBD 3NGDA 2C35B 4DV6L 5D65A 5J2TF 4JW0A 1UE6A 1TIID 1PTOC 2RCNA 4DV6Q 3PW5A 3CVZA 1IBMH 5KG7A 5I9OA 3STBD 1KJ9A 4DUZL 2F0LA 2KUMA 1YNNC 1TWHH 2K5WA 1EYGA 2JXMB 3R3OA 5IYCH 4DUZQ 3PO3G 4DV0H 3NBHB 5FO8B 2J6TA 2YV5A 4HJ5A 4HJAA 1C0AA 4HEDA 2JEAI 5KFLA 4DR2L 3J80i 3K5IA 2WAQB 5KFNA 1PVOA 4NKLA 1JWSD 4DR2Q 3S1MB 5KX5F 5LL6b 2IJ0A 1S72A 4IPHA 3G48A 4PV1C 3FPPA 5DLFA 5KFVA 2E74C 2HDLA 5C0XH 3J81j 2NU8B 1TVXA 1XTCD 4F4YA 3HP3A 3D4WA 1IKMA 1IBKH 1TS4A 4OXPA 4WJ3M 3T13A 5KG1A 3N41B 2K4KA 4J9OA 3GTPH 2WINB 3MXUA 1HNZQ 3S15B 4EBCA 1STBA 4XIGS 1RIPA 1DV1A 4YJ3F 3RV4A 3H4BA 4RGNA 4K0KH 1GSHA 2UUCQ 1GUOA 5LL6S 4HN7A 1E2VA 3RMHA 4I50F 1ZKOA 5IT9W 4RGOS 5IP7H 1EY8A 4DV7H 5DEHA 3I4NG 4R1JA 1HUMA 4I4TF 2VS1A 1STGA 3URYA 3Q6SA 2KEDA 5FLMH 3SK5A 1SE2A 3I2ZA 3Q23A 2JA7G 3GTGB 1E4GT 2UXCL 1JDBB 2F4VH 1ESRA 3DM1A 5ELFA 2ZJPA 3VYSA 1I7NA 2M9VA 4MZ9A 5C3XA 1TA8A 1Q90A 2RQXA 4UPAA 3GTJH 1WCMH 1GVPA 2A19A 4O3PA 2AQ2B 1KEEA 3E0EA 1CA6A 3A74A 1SE8A 4AH6A 1M90C 2PNRC 1EIYB 4DUYH 1U9RA 4LSAA 3J81c 3ETHA 4O2AF 1PH2A 3KLRA 2E5LL 5EQ0A 1VQDA 3Q8PB 4C2MA 1N33H 3IRBA 3HOUG 1HRJA 3LNNA 3JSNA 2E5LQ 1V4YA 1PHJA 1R4PB 4BY1G 2JA5G 2F0KA 1L0YB 3H15A 2EJGC 1KBLA 2QCPX 2UXDL 1SYEA 1SMYD 2VB2X 2D2CC 1WTOA 2BH2A 1IW7C 2UXDQ 3ERQA 4LUOA 4EQ5A 4R4QA 2ZXRA 1N9WA 2PN1A 3CCVA 4DR7H 1NY4A 4A3GB 1B3QA 5FD6A 2JE6I 2N8NA 4A93B 2PMZE 3D4RA 3NK9A 1TU2B 4XYLB 1SE3A 3EBEA 5FD5A 3GIPA 2O5IC 4B9WA 4QY7A 2RCFA 3GV6A 2ID0A 4JI6H 4K8IA 3J7ZC 1PK8A 4PMBA 4GC7A 2KCNA 2HUGA 1SLJA 3DHQA 4JYAL 3IL8A 2R87A 4ECTA 1MD2D 1T9HA 4GLVB 5JJZA 3M85A 4JYAQ 5K36G 2I46A 1D6EC 1QWYA 2EDGA 1JORA 1VQJA 1X3GA 3PQIA 1PA6A 4LF7L 2F0MA 4DL7A 1LYLA 4LF7Q 1MHWC 1JR0D 1YIJA 4H02A 3BDCA 1ML0D 5CB4F 1Q81C 4ECVA 1ZETA 4LFBH 5JH7F 1HPCA 5LHY1 1VQMA 5FLXc 3JAME 4YCUA 2D0PA 1AUVA 5A2QE 1GSAA 2RSOA 2DNCA 4OO1I 1JWUD 4MTEA 3TRZA 4HJ9A 1TT2A 4YCWA 4RGTA 5EBCA 4A3FG 4MV1A 3OSNA 4R4CA 1U4RA 2NYZD 2B2WC 5KFAA 3TIIA 2Q8RE 3AYHB 3NTIA 3QO2A 5CV9A 2KA7A 3ND9A 3SE0A 3EPIA 2JA9A 3GQBA 2OEOA 4ECXA 1VAJA 2JA8G 3P1HA 2QK4A 4QWBA 4LF8H 5JEAH 2CCZA 2QA4A 3TN2A 2Q2IA 4DV1L 1TR5A 1N32Q 4FS2A 1HNXH 2R93H 1KC7A 4TQSA 4RG1A 4DV1Q 2AGQA 1J5EH 2GPSA 1PH1A 2XCAA 4B3SH 4PDBA 4K8JA 4EBEA 4QMGA 5BR8L 4GZYC 1OXUA 2XGTA 1PH8A 2W6OA 2E76C 3GLKA 4LFAH 3H0GG 2UVUA 3V4SA 2RKSA 5IGDA 2EZVA 2OLSA 1KABA 4H13C 2NVXH 4GNXC 4RZQA 2Z4HA 4J9SA 4NXNL 1Y1WB 4BA2I 4MV6A 3NTKA 3Q8DA 5EGTA 1X3PA 2ALZA 4JI4H 2QF7A 2BDNA 3RLNA 2JJQA 1SYDA 1E2WA 2AKWB 2XTIA 2K01A 4CDEC 4IRCA 5F9NA 3RBEA 1QUQA 4IFDI 3BYYB 1B33N 4IUUA 2IHFA 1UAPA 4GKKH 2K04A 2FINB 2B8FA 4TVAB 3CC7A 1QNKA 4Q8EA 1B53A 1BOSA 1VQLA 3OHAA 2QKIC 1TWAH 1PYBA 1I4XA 2B63G 2W6ZA 4CJ0B 3KALA 1RK5A 4O4IF 2EY2A 3H20A 4X66L 2JA6B 3IFTA 3ULPA 3AMUA 4ZCKA 3HOVG 3A7LA 2XCPA 4GKJQ 4U7CA 4X66Q 1VQHA 3KJPA 2A74C 4UDUC 5M3FG 2FP4B 1OXSC 2NN6H 5EOYA 4JI0L 1GLVA 4EFEA 4KKUA 3PIPA 1CI3M 4JI0Q 4J9MA 4J15A 3UE1A 2QW7A 4RZRA 2ATLA 4DPGA 1Y1VG 4XYQA 1JLLB 4JBMA 3R5FA 1LT5D 3S2HB 5KG6A 1D5ZC 3FP9A 3M4QA 5EWGA 1H9JA 4BBSG 2YRXA 5J2UF 2CFMA 4A3DH 5KT7A 3BVGA 3J80L 4F87A 4KN4C 1BBWA 1ILQA 2WP8J 3HB9A 4YY3H 3MEFA 3DLLA 4FVMA 3C1FA 3P7JA 3GIMA 3VR2A 3H40A 2KSWA 2OCEA 1NJIC 3V6HA 1MJEA 1DONA 4DL5A 4O3NA 1XTDA 2VUMA 2NVTB 1EFWA 3ORRA 1PFSA 4DKAC 5G3LF 4F8MA 2HHHH 2B2TA 1K1SA 1NMGA 1PRTF 3KUPA 3A54A 4LAAA 3MWDA 2ICEC 1WTRA 4LH7A 1STNA 3VR5A 2CW0D 3CCSA 4C3JH 1D5MC 1KC8C 4ID6A 4PMWA 2NU7B 1EWHA 4KY7A 2XIGA 5IYBG 1A6XA 3N44B 5JVG3 2W71A 3GV8B 1C3OA 1E1OA 4QIWA 4NMZA 4DK3C 1TWCH 4IAJA 2R92A 2Z0SA 4ZLTF 2SCUB 1JMCA 3HZXA 4K2LA 4FDBA 2A68D 4DNRB 1S5DD 5KIXA 4LF6L 1STHA 1RDPD 4HSPA 3ORQA 1NUCA 4YWMA 1W3SA 3GTKA 4LF6Q 2I5LX 4HSVA 2WB1B 1EIGA 1YHBA 1SDFA 2WKDA 4Y7NB 3FMCA 3TBIB 4J0MA 1I94H 4C1NK 5KT5A 1I3QA 3HGBA 1ENCA 2W6MA 1EZ8A 3N52A 5JAVA 1I4PA 2NTTA 5BN5A 1J8IA 1PH3A 5JUMA 1SN8A 3K3PA 3PIO3 1AN7A 2IP4A 3R8BA 3F2CA 4A3LG 5GAGC 1LTAD 5IP9H 3DF7A 3KF6B 4KMUC 2IX3A 2BQRA 1PLFA 3I91A 4UCUA 2I5MX 1VMCA 3PUXA 2ES2A 2AGOA 2A6HC 2BQ3A 3KAKA 5JOBA 3K59A 5IT9E 2A6EC 4JI7H 3GTLH 4B3TH 4LF9L 3RD4A 4TRDA 1T36A 1O7ZA 4LF9Q 1X3QA 1LTSD 1STEA 1WJJA 5T1IA 1WTPA 2I87A 5I2XA 4OIKA 2ASBA 1BR9A 1TWFB 1KRTA 4A3MG 1DD2A 3RGXA 2LKVA 4HAEA 1DOMA 3LMLA 1CQFA 4DV4H 3T5KA 5L1LA 4KD3A 3EN2A 3E5NA 5DM63 2VZAA 4B3RL 2JEBI 1SMYC 2IT1A 1K8GA 3SK6A 4LMYA 2QYZA 4KHPH 2VOBA 4HQ6A 4DAYB 5IE8A 4MV3A 5KG2A 4C5BA 3GIQA 5KFMA 5ELNA 4MA5A 3U4VA 4DLKA 2C2RA 1I6HH 5BN4A 4U68A 3A5UA 3A0JA 2QGQA 4KY5A 4GS3A 3T56B 2NZOA 3GILA 2ATWA 3LGJA 3R2IA 4XDXA 1QZHA 3V05A 4G7ZC 1K0SA 4C3IG 3F2DA 2O03A 2NVYA 1UEAB 4CHTB 2ZM6H 1RCVD 1A15A 3BQ0A 4A3IH 1OO9B 2YW2A 5D1OB 1Y1WH 3U50C 4FF1A 4DR3L 1K3RA 3TZDA 1PFMA 4A3CG 4B3MH 2DN8A 2G9DA 2KVMA 4DR3Q 2R8JA 4DR1L 4UHVA 2FE3A 4LMQD 2MFIA 3CQZA 5E4WC 5KG4A 5LMUH 2H5XA 4QCLA 1EIHA 4DR1Q 2RGVA 3T5JA 5GONF 4JI3H 2LSSA 5M9OA 2JEGA 1Y69U 2R7ZH 4IFDG 4WBNF 3W1GA 3K5MA 3RN5A 4JBKA 1NAPA 3AEVA 4L1KA 2JA7A 4HIMA 1TWHB 2KCMA 4P74A 2HQLA 1VQFA 1OXTA 5L1JA 2CZGA 3MC0B 4JI2L 3D6CA 3CCQA 5JPMC 2K33A 3KJOA 2K5HA 4JI2Q 1VCIA 1Q1EA 1Q86C 1Q12A 3PO2B 1BCPF 1LABA 2YYZA 3RGZA 3CHBD 1UEBA 2VB3X 5HGTA 2VY3A 1PH5A 4C56C 4L8JA 2FK1A 2DJGC 5D3IB 1PRTB 2IX0A 2GLTA 1FJGH 2QEJC 3GTPB 1LTLA 1C9OA 3T1HH 2JEFA 1RJPA 2JA5A 3E6ZX 2R8KA 3HEJA 4DV2L 4ILWA 4RKLA 2TMPA 1VQNA 1SEBD 4RB0A 4DV2Q 3RB6A 2HCCA 2F1MA 3OMCA 1EOTA 4PZ6A 4CKCA 2EXDA 3JSLA 3HOZH 4PZ8A 4HR7B 3HOYG 3BZKA 1K8MA 4FXGC 3KLSX 2W9CA 5ISRA 1WTVA 1XNQH 3D4DA 1G2TA 4HIDA 4IWYA 1HH2P 5DG9A 2F0QA 4YCVA 4R8UB 1VQ9A 2KJXA 1PTOF 4A3BG 1LUZA 1B4OA 1HFNA 1CKNA 2X6GA 3FDTA 2W8LA 1LM0A 2GVAA 1WTXA 2B2WA 1LLRD 2F0OA 3GTJB 3I55A 1WCMB 3T53B 5DLGA 3MR3A 2UUAL 4PG3A 1L1OC 1A2UA 1HZBA 1XXGA 3GTMA 2UUAQ 1NMFA 4JI8L 1SFOA 2PZTA 1HNWL 3PR5B 2UVRA 4JI8Q 1HNWQ 4NW2A 2NBFA 2J9GA 2KHSA 2FFKB 4CDFC 5EKIA 4RAUC 3HKSA 1KIXA 5HURA 2P5ZX 1MZBA 4RUCA 4J9LA 1VBHA 2AMCB 3A55A 1WTWA 2ZDHA 3TQ1A 1EU3A 5KFKA 3PF4A 5C4XG 4IALA 5IT9c 2YU9H 1EIFA 4MHEA 2K50A 4NB3A 4GNXA 5IIFA 1VQKA 4QL5A 2XCLA 4O2DA 2V1CC 1IYVA 2VQFL 4E4TA 4DA2A 1SCUB 2RDGA 3DMUA 1GUWA 3PN1A 1Y8PB 3HKZG 2VQFQ 2L12A 1I4GA 4X65L 3W1BA 4N8X1 4J8QA 4U6PA 3ITPA 4X65Q 1CHPD 4XQQA 5C3EH 1R9TA 3TP8A 2EYMA 4AYBB 5DGAA 1J9OA 3SEBA 1LACA 4EEYA 1H9KA 1VQEA 2XSCA 3K7AH 4I65A 4OHJA 2RDHA 5KFZA 3FMAA 1WR2A 5J39A 1I6UA 2L9HA 4LJZC 1QVCA 5CYUA 4A3JH 5C44G 3CAMA 5LMNH 1KJ8A 1JJ2A 1PXUA 1DIKA 1KJJA 3PGZA 3I56A 3KBGA 3SR1A 4FP5D 1JE5A 5DM73 2MHVA 3KLWA 2C00A 3MFYA 4DK0A 4OL7A 3H0GA 3OHBA 1OXXK 4GOPB 4BBRB 1AH9A 3MFHA 3T5LA 1R4QB 1SJHD 4H0LC 1X32A 2L0CA 1L0XB 3PUYA 2HCIA 2J7ZA 4RWSC 3VMMA 2WACA 2OH2A 4LFCL 4ME3A 4X62L 5IWAL 5KG5A 2E2HA 4POFA 1BQQT 2EY6A 4LFCQ 3NHHA 4X62Q 2RSNA 5IWAQ 3KHGA 5JPNC 4EBDA 4O3RA 2JQOA 2VA2A 2WAQG 3K0YA 1DOLA 1HNZH 1VQGA 3NXWA 2LXKA 3N40P 4ED1A 1E1TA 2A68C 1HR0H 4K5XA 4ECRA 3W3AA 4DR6H 1XPOA 2F0TA 1T3NA 2UUCH 4IRKA 2FMMA 2R7MA 3GTQA 1EY4A 4IPGA 4F4XA 3CCUA 2FPGB 1STYA 3Q2OA 4A2AA 1XPUA 3CPFA 2B63A 1T5XD 2NWGA 1AP0A 4S3SA 5C5JA 5L1IA 1BBUA 1ZYRC 1JB3A 1ZEQX 3RLOA 1V1PA 3S17H 3PSIA 2VUMB 2E8GA 3C0FB 1BXRA 2AQ4A 4MTKA 2F0FA 4C2MH 4HJ8A 1ULZA 2CWPA 3K81C 2PW5A 5KFXA 5KFFA 1X3FA 3PW4A 1BGWA 3D31A 2FMCA 5CBEE 1B50A 2A1AA 4DL6A 1ZHSA 1IBLL 4POGA 1JXLA 4JI5L 4HTHA 1Y1VA 1IBLQ 2NVXB 4LF4L 4JI5Q 1I5FA 4IJHA 4LF4Q 2I80A 3KDFA 4BY7H 4DN4M 4RU9A 4OO1H 3OTOL 2Z1CA 1H9SA 3PO2H 2ZJRA 5C5MA 1ICFB 5KG3A 2RA4A 3AFPA 4DGZA 3IN5A 1D7QA 1Q3LA 4QWAA 3KLSA 1KRSA 1GUGA 4BA1I 1ESFA 5GROA 1IL2A 1BNZA 2MO1A 1VQOA 3HOXH 4BXXH 1A63A 4DL3A 3E3XA 1I3QB 2UXDH 4N9PA 1TWAB 3M3YH 5L9XA 4DR4L 4WJWA 5CV6A 2R7KA 3F8TA 4DR4Q 4JI1H 3CRKC 4FF2A 4YAJB 1PH6A 3KYHC 2I8CA 4RB1A 3J80c 5M5XH 4IOCA 3IG0A 2KBNA 3SVMA 1M8AA 2F0NA 1HXYD 3X3NA 5H80A 1O78A 4HCEA 5LOVF 2WV6D 2DGYA 3DEPA 2VQEH 3KF8A 4MNOA 3EIVA 3V4ZA 1UC9A 1KNAA 3CP0A 1VQ6A 4A3GG 1N34L 2EQSA 4A93G 1N34Q 3DWAA 2UXCQ 2YS7A 1ASZA 4KJOA 2E2JH 1XMQH 4A3DB 2UUBL 1VQCA 4X64H 5K5PA 2NUAB 3Q22A 3GIJA 4M7EA 1RYSA 2PQAA 3LP8A 5L37A 3I73A 2W7PA 1DOKA 5IYDH 3I8ZA 1QG7A 4AIMA 1AE2A 2QEXA 1TWGA 3M7GA 1IBML 3CD6A 2F0JA 2VL6A 1G8ZD 4PNYA 3VYUA 2OXPA 2UXBH 1IBMQ 4Q43A 3WO0A 3BDOA 4KTAA 4Z9CB 3J7AF 4DL4A 4KY6A 4JV5H 2H4OA 4RB3C 4DV0L 4OGQC 4C3JB 1GHKA 4DV0Q 2XNAC 3ULJA 1FNUA 1X54A 1LO5D 3G4SA 3BQ2A 1TWCB 2VXWA 4EQNA 4IR9A 3VYRA 5KNBA 2EYHA 3HRZC 4OONA 3HBLA 1SYCA 1IBKL 3G6XA 4X6AH 4A3KH 3T16A 1N32H 1IBKQ 1RKNA 2B3GA 5CORA 5ELBA 1RHPA 5C0XJ 4FO2A 4ECWA 3CCLA 4ECZA 2F0IA 5KT4A 3L4KA 4DV5H 2I0QA 3GDEA 4L5SA 1EUCB 5J22A 5H1SE 4KV6A 1S9FA 1JE4A 2CQAA 2HVSA 3GTOA 3A8IE 1BJTA 4UCRA 2VW9A 3RUPA 1S40A 4JCVE 3OIQA 4DV7L 2O5JC 2K5DA 2I5HA 4FU0A 3MXNA 1FKAH 3T4AC 5DG8A 1MJCA 1UNNC 4IFDJ 2F4VL 1FYCA 2HVQA 3R5XA 4XXEA 4BBRH 3CMAA 4IN3A 2F4VQ 2W9BB 1KDCA 1I50A 5LL6X 3CCMA 1X3EA 4Q45A 2CQOA 1B1ZA 5KFQA 1Z2OX 5FJ8H 3GTLB 2GPWA 2B2YC 5E3FA 3I4MG 1Y1WG 2B2VC 3PIP3 4QB4A 5G3LD 2FJ2A 1PRTD 4KK7A 4DUYL 3W5OA 1U0LA 2FHTA 3GO5A 5DGBA 4DUYQ 1E4FT 2Y0SE 5KG0A 4I7AA 3KHLA 1EWCA 4N9TA 1N33L 5DG7A 2SDFA 4DAPA 4FYDA 3RB3A 3FKIA 3D3RA 1N33Q 1EYZA 2K28A 4GKJH 4L6TB 2LMCB 1UE1A 3Q8RB 2F4IA 1PYWD 4CJ1B 5IGGA 3CC2A 2FMAA 1S0OA 4U673 1I6HB 1EQTA 2VUMH 1YHAA 4E6IA 3J80W 1A8VA 1JWMD 4P75A 4DR7L 2W6PA 1QVFA 2JA6G 2R61A 5C0XI 2YL2A 4DR7Q 1L1OA 5BR8Q 1C7YA 3M7NA 1Q8KA 4QF4A 1QNUA 3BG3A 3RV3A 3C1EA 4DV3H 2X6LA 4A3IB 5DLQE 1XMOL 4RKBA 4YP3A 3N42B 2F0UA 1XMOQ 1RJTA 4ME6A 4NXNQ 4GN3B 1YHQA 2YZGA 3OPOA 1BNCA 2R92H 1D5XC 4M9UA 2UU9H 3MXGA 4TKOB 4J9RA 2NUCA 4C1NI 2E2IA 2D9UA 2C9OA 1Z47A 2ASLA 4RCNA 5JQWA 2R7ZB 1FGBD 3GTKH 5F9LA 3RB4A 4JPBW 4ZUIA 1LTID 3H09A 4OX9H 4O3QA 1PTOH 3RZOH 4QQBX 2CHBD 2DWCA 2Y0SG 2CQYA 3HOWH 1MGSA 4ECYA 1I3QH 4C5CA 3M4OH 4GNXB 4ZQ3A 4BWGB 2CW8A 1CQVA 4LFBL 1B3AA 3ZJYC 4LK1C 4PQXA 3IKJA 4JK1C 4LFBQ 2WE6A 2PMZB 4OELB 1GD7A 4BWSC 2B2UC 1O7YA 4NDXA 5KGUA 3R23A 3RAXA 3BDLA 3ERSX 4ZRZA 2PW7A 2EY5A 1YNJC 3AFQA 1TS3A 1Z7TA 2PVPA 5KFEA 4HIOA 4EQOA 2JA8B 3P20A 2N49A 1HFGA 3I90A 3UI2A 4TV9F 3LWEA 1Z2PX 1JOOA 4YB8B 4KKSA 4YWKA 3RR5A 3KHHA 2SOBA 5M3MH 4KD4A 3DWPA 2F0VA 3FHWA 1CA5A 4CC6A 2JN4A 1S5ED 4LF8L 2XGPA 1CUKA 3H6MA 4A3EH 1D1IA 3PW7A 3FEWX 3FPUB 4LF8Q 2C2DA 2K7VA 2WB1G 5C1OA 1YJNA 4YIJA 3HOZB 2FJZA 4JUZA 1J5EL 3H0GB 1LV9A 3TS0A 3HXLA 4LUVA 1M7JA 1XWEA 1J5EQ 4B3SL 1DYQA 2PNHA 4MV9A 5BPHA 4FM9A 3PO3H 4B3SQ 1K83A 5I2YA 3STBC 2XVSA 4V0BA 4JOIC 3ZYYX 2L11A 1SJED 2AWOA 4LFAL 3IFDA 1G2SA 4MAMA 4WJ4A 5A35A 3VA7A 4UP8A 4V190 3O13A 2A69D 2E2HB 3QB3A 1M0WA 4Q8FA 1U4LA 1PH7A 2DIKA 4M1UB 4JI4L 2HVRA 1S10A 5FPOA 3MWMA 1HZCA 4JI4Q 2OWOA 1A9XA 3Q8QB 2LXJA 2C28A 2DNEA 5DQHA 1GM5A 2L1BA 1B70B 1KLUD 1F9PA 1SYBA 3GTQB 3RFCA 2NVYH 2J4XA 2WDTA 2B63B 5FPRA 4MV7A 4ZI7F 4RHRA 3CRLC 1UE7A 1B6RA 2W7OA 4MV4A 1HQRD 5AJ3L 3CPWA 1JCKB 1K9MC 3JAMi 1D8LA 4FXKC 5AJ3Q 4EGQA 4IJLA 2YU9B 3CQZH 3U4ZA 3NQIA 3NBHA 3I4NH 1Q8IA 1HA5A 1S3OA 4ZOLF 2F0WA 1F9RA 1S0NA 2WTFA 3UDFA 2JA7H 2WAQA 4CDCC 3P75A 5CV7A 2NVQH 1K0RA 1Z6HA 3S16B 5C3EB 2R84A 3KDFB 4YHHH 5EPLA 1VQBA 2HQEA 3L3OC 3FDSA 4JV0A 3K7AB 4NXML 3K5NA 4DR3H 1EQRA 1QCBD 4I7ZC 5JVH3 5CMDA 2FPIB 2H1EA 4DR5L 4NXMQ 4LUZA 4C5AA 4DR1H 2B8GA 1AFPA 2SNSA 4A3JB 4DR5Q 1TY0A 4FF3A 2ZXOA 5FO7B 1I4QA 3K5HA 5T1GA 4PMCA 1W93A 4G57A 4YY3L 3HOUH 2FB9A 1EY0A 1IYJB 2MO0A 3OSOA 4YY3Q 1V8QA 4BY1H 2JA5H 1S5CD 1DGSA 3CU7A 1YNND 1F2LA 4P73A 5IY0A 2HHHL 4K6LA 1N36H 5M5YH 3KBXA 5CC4A 3GTGA 2HHHQ 1NR4A 2BE5D 3K57A 4XYMB 5I6YA 4HNVA 4JG2A 3A56A 5IYCG 4B3RQ 2W6QA 1V1QA 2FLLA 4ZUJA 4FNFA 2BR0A 1VQPA 4UY8C 3K5OA 1DV2A 1XNRL 4R4IA 2DZDA 4MTDA 1XNRQ 4O3SA 2RVLA 5C0XG 1A62A 2ICIA 4CJ2C 3CCJA 4RB2C 2CW7A 2EIFA 1GGOA 5DQIA 2KEEA 2C5CA 4ZAIA 2XIWA 3VR4A 2JEJA 3GTMH 1E24A 4ZKCB 1YNXA 1SFOH 1I94L 3S17B 1VQ4A 5EWFA 5J3BA 2K14A 1DCZA 4C2MB 1FVIA 5DAUA 1TS2A 2D0OA 4I7HA 1G6ZA 3K6OA 5GQOA 4GLAC 4JV1A 5KFRA 3WO1A 1BKBA 1LTTD 4A4IA 3QJYA 4XYOA 5IP7G 1JT8A 4LF5H 1O7IA 4L5TA 4FF4A 2F0DA 4R8IA 2K52A 1GKHA 5FLMG 1EU4A 1IOWA 3NSWA 3H4DA 1F9QA 4BY7B 4O4LF 2UUAH 4NLGA 4AYBE 1WFQA 1CKOA 5EKLA 2Q8TA 3E5SA 5KFYA
chains in the Genus database with same CATH topology
4JI7L 4A3FH 1VQGA 2LXKA 4DV3Q 1E1TA 4B3TL 1WCMG 2ID0A 1VQIA 4JI7Q 3CC4A 3J7ZC 4IO9A 1XPOA 1JB7A 4B3TQ 1L2FA 1R9TH 1SLJA 4JYAL 1YEZA 2N78A 4IPGA 2JA8H 3CCUA 1T9HA 2UU9L 4GLVB 1VS0A 3M85A 4A3JG 3CPFA 1XPUA 4JYAQ 5K36G 2UU9Q 1M1KC 1BBUA 2K75A 1VQJA 4DV4L 1X3GA 4GKKL 3RLOA 5GAEC 5C4JH 3U58A 1PA6A 3PSIA 4OX9L 4LF7L 2E8GA 3S17H 4DV4Q 1YITA 4GKKQ 1LYLA 4OX9Q 4QJFA 4LF7Q 4C2MH 4HJ8A 2B29A 2CWPA 3K81C 4KHPL 1X3FA 1YIJA 1K73C 4H02A 1HZ9A 3D31A 2Q2TA 1YJ9A 3MXNB 4KHPQ 2A1AA 1Q81C 1IBLL 3H0GH 4DK6C 2OTJA 3HKZE 4POGA 1VQMA 2HIVA 3I4OA 4JI5L 5FLXc 1IBLQ 3ICEA 4YCUA 2D0PA 4LF4L 4PZ7A 4A3GH 1VQAA 1I5FA 3JC66 4QGUA 4JI5Q 4IJHA 4OO1I 3UDGA 4LF4Q 3KDFA 4A93H 3M4PA 3UDXA 4BY7H 3OTOL 1JJCB 3TRZA 2OQKA 4HJ9A 4UP9A 4YCWA 2BA0A 2ZM6L 3H3VI 3PO2H 5JJKA 2E2HH 2ZJRA 4A3FG 1VQ8A 2OTLA 2R7DA 3H3VH 3AFPA 4AYBG 2ZM6Q 1D7QA 4R4CA 3AYHB 3JAMc 1KRSA 4BA1I 5GROA 1P8LA 3B6YA 4B3ML 2JA9A 2MO1A 1VQOA 3HOXH 1IL2A 1AE3A 2JA8G 3CCEA 4BXXH 1A63A 4B3MQ 1PH4A 2ZTEA 2QA4A 4DV1L 2Q2IA 2CCZA 1N32Q 4JI3L 3M3YH 3GTQH 2R93H 4RG1A 4DV1Q 1V43A 1H95A 4JI3Q 4DR4L 2B63H 1PH1A 4L5RC 5ELOA 3F8TA 4DR4Q 2ZTDA 3F1ZA 3KYHC 1PH6A 1Q82C 5BR8L 5M5XH 3J80c 1WI5A 2KBNA 1OXUA 4IOCA 3HOVH 5E7NA 1EWIA 4UP7A 2XGTA 1PH8A 4BBRG 5M3FH 1SR3A 2KCTA 3H0GG 3K7UC 2DGYA 2IY5B 4MNOA 1QVGA 2NVXH 3EIVA 4GNXC 3ULLA 5HY6A 3CF5A 3CP0A 1VQ6A 4A3GG 4NXNL 1N34L 4BA2I 2WAQE 1G291 3Q8DA 2EQSA 3KF8B 3PCOB 4BY7G 4A93G 1Y1VH 4OO1G 1N34Q 3GD7A 3RLNA 2AHOB 2UXCQ 1ASZA 2JJQA 2E2JH 3PO2G 5JJLA 2AKWB 2XTIA 3CXCA 1FJGL 3S16H 4BBSH 2UUBL 1VQCA 3CW2C 2RF4A 4GN5A 3RNUA 1FJGQ 1QUQA 4IFDI 2PQAA 2IHFA 3HOXG 5IYDH 1QUQB 4TVAB 3CC7A 4BXXG 4AIMA 1EQQA 4KLKA 5JEAG 2PQAB 3PUVA 1AE2A 3TREA 2QEXA 1VQLA 1OXVA 2R93G 1TWAH 1J6QA 1PYBA 1YVCA 1IBML 3CD6A 2HIXA 2VL6A 3DM3A 2B63G 5M5WH 5GAHC 1IBMQ 1I94Q 3TQYA 2Q2UA 1N8RC 4X66L 4GOPC 5LMNW 3ULPA 1Z9FA 3HOVG 2PI2A 1L0WA 4DV0L 4GKJQ 4X66Q 4GN4B 2NN6I 1VQHA 3KJPA 5M3FG 1EUJA 4DV0Q 1OXSC 2JK8A 4JI0L 3ULJA 5IYBH 1X54A 3G4SA 1Q46A 3PIPA 4JI0Q 4J15A 4YHHL 3UE1A 3S14H 2OQ0A 1CSPA 3BU2A 3I4MH 4YHHQ 1W2BA 2MNAA 3ER0A 4DPGA 4OONA 1Y1VG 4JBMA 3A5ZB 4NPSA 1IBKL 1VQ7A 3FP9A 3M4QA 1KQSA 4X6AH 4A3KH 4IPCA 4ALPA 1WYDA 1IBKQ 4BBSG 2B3GA 2CFMA 4A3DH 1K8AC 3KFUA 3D0FA 5C0XJ 1BBWA 2K5VA 2WP8J 2A8VA 2D62A 3MEFA 3S1RH 5EAYA 1PYSB 3DLLA 4HJ7A 3CCLA 1UWVA 3E9HA 5IYDG 3K80C 4O0AA 2OCEA 1HR0W 3GDEA 1NJIC 2I0QA 4L5SA 2YTYA 3PIOA 2WFWA 2KENA 1MJEA 5H1SE 1XTDA 3FKIG 4JOIA 1EFWA 1PFSA 2RHQB 4DKAC 2VW9A 3WWVA 4HIKA 4JCVE 1S40A 1E22A 4DV7L 1N36L 2I5HA 3F2BA 1NMGA 1FGUA 4A3LH 1TWGH 3TEHB 1N36Q 2DUDA 2JA6H 1MJCA 3KOJA 3CCSA 4C3JH 1KC8C 2F4VL 4PMWA 4IFDJ 4BBRH 2NN6G 3CMAA 2F4VQ 5IYBG 4DAMA 4Y52H 3BJUA 3OYYA 1KD1C 3CCMA 1E1OA 1X3EA 1JJGA 2CQOA 4DK3C 1TWCH 5FJ8H 2Z0SA 3I4MG 2ALYB 3UE0A 1Y1WG 1JMCA 4L5QA 2AWNA 4FDBA 4LF6L 4YWMA 3S2HH 4A3KG 1W3SA 3G6EA 4DUYL 3OTOQ 2BH8A 1A0IA 3W5OA 1U0LA 3GO5A 4A76A 1Q7YC 2I5LX 3RLFA 4LF6Q 4A3DG 4DUYQ 4A3MH 2Y0SE 1YHBA 5LMNL 1Q1BA 3S24A 1N33L 1PH9A 1VQ5A 5LMNQ 1N33Q 2GVBA 5LMUL 1PH3A 1UE1A 4R4OA 4LNQA 5LMUQ 1HZAA 2GN5A 2NVTH 4LF5L 1SN8A 3CC2A 3KF6A 4GLXA 1X9NA 3RN2A 1YZ6A 4LF5Q 3F2CA 4YWLA 2VUMH 3GTOH 1YHAA 4A3LG 5GAGC 5IP9H 1A8VA 4P75A 4DR7L 3KF6B 1QVFA 2JA6G 5C0XI 1TXYA 1WOCA 2I5MX 4DR7Q 3PUXA 1L1OA 5BR8Q 2ES2A 1C7YA 3M7NA 2IX1A 1Q8KA 4C3HH 3S2DH 1E3PA 4C3IH 1KXLA 3PF5A 1L1OB 4QIWE 1GO3E 1HNZL 5DLQE 1KHIA 5FJ8G 1XMOL 3GTLH 4EX5A 1HR0L 4LF9L 1I50H 2ZTCA 3BZCA 3SGIA 1XMOQ 4DR6L 3T1YL 4LF9Q 4APVA 4GN3B 1WJJA 1HR0Q 2UUCL 4NXNQ 1YHQA 4A3CH 4DR6Q 2R92H 3T1YQ 3J7A5 2ASBA 1YJWA 1U5KA 1X65A 3I7FA 1KRTA 3T1HL 4A3MG 1Z47A 2UUBQ 4Y7NH 3GTKH 3T1HQ 3PUZA 3PV0A 3EN2A 4QQBX 1P16A 3RZOH 2Y0SG 2VZAA 3J81i 4B3RL 2MQHA 3HOWH 2JEBI 4P71A 2IT1A 1K8GA 1NE3A 4LWCA 1I3QH 3M4OH 4DAYB 3FKIH 4GNXB 3S1NH 5IE8A 5ELNA 4LFBL 1ASYA 3U4VA 2VUMG 1I6HH 2Z6KC 3ZJYC 5IP9G 2CWAA 4LFBQ 3A5UA 3A0JA 1GD7A 2QGQA 1XNQL 1YI2A 3L7ZC 4GS3A 3L2PA 2K5NA 1IXRA 2NZOA 3CMEA 3OW2A 3ERSX 1XNQQ 2ATWA 3LGJA 3M9BA 2KHIA 4JBWA 1QZHA 3RZDH 1IZ6A 3AFQA 4MTNA 3F2DA 4HIOA 1G51A 3NELA 2N49A 1Y14B 4A3IH 1YBYA 1SMXA 1Y1WH 4YWKA 3RR5A 3U50C 1KL9A 4A75A 4DR3L 1BVSA 5M3MH 1K3RA 1MKHA 4A3CG 3FHWA 2R92G 4DR3Q 3NENA 4RMFA 4DR1L 4LF8L 2YTXA 1CUKA 2MFIA 4A3EH 1V9PA 2H5XA 2L15A 4P72A 4DR1Q 1TWFH 3VDYA 4LF8Q 2WB1G 4R4TA 2LSSA 1YJNA 2BA1A 2HT1A 2R7ZH 1SROA 2IHEA 4IFDG 5JJIA 1J5EL 4OWWB 3W1GA 3TS0A 2E2IH 3RN5A 4JBKA 3AEVA 3HOYH 4K0KL 4LUVA 4HIMA 4JI1L 1J5EQ 4B3SL 3HOWG 4K0KQ 2PNHA 2KCMA 3E9IA 4P74A 2HQLA 1VQFA 4OWTB 4JI1Q 4B3SQ 1OXTA 3PO3H 1NBWA 3AQQA 3STBC 4JI2L 4DNIA 3CCQA 3TS2A 4JOIC 2AWOA 2N3SA 2K5HA 4JI2Q 1NTGA 4JC0A 1VCIA 1Q1EA 3KJOA 1Q12A 1Q86C 4A3BH 2VQEL 4UP8A 4AQYL 2YYZA 4WJ4A 4DV7Q 2YTVA 1G6PA 2PI2E 2VQEQ 4AQYQ 1UEBA 1CSQA 1B7YB 1PH7A 2VY3A 4JI4L 1PH5A 1B8AA 1HZCA 4JI4Q 2OWOA 2LXJA 1RL2A 2IX0A 3CCRA 4A3IG 1XMQL 1GM5A 1X56A 4KHZA 1CKMA 1C9OA 1B70B 1LTLA 4IPDA 5HGQA 1E7ZA 4X64L 1XMQQ 1KAWA 3L0OA 2NVYH 1PV4A 3S1QH 4X64Q 1OTCA 5M3MG 3PUWA 4DV2L 4TQUS 1VQNA 1UE7A 4A3EG 4DV2Q 4OWXB 4LW1A 2C35B 4XTCS 4DV6L 5AJ3L 3CPWA 1UE6A 1K9MC 4LFAL 4PZ6A 3JAMi 1D8LA 5C4XH 2EXDA 2RCNA 4DV6Q 5AJ3Q 2R7ZG 3HOZH 4IJLA 4PZ8A 3CQZH 3U4ZA 3HOYG 3BZKA 3STBD 1EOVA 2UXBL 4DUZL 3I4NH 1S3OA 1TWHH 2UXBQ 1EYGA 4DUZQ 5IYCH 3PO3G 4JV5L 4HIDA 1HH2P 3NBHB 3UDFA 2JA7H 4YCVA 4JV5Q 2YV5A 1VQ9A 4HJ5A 5C3EG 4HJAA 1C0AA 4A3BG 2JEAI 2NVQH 1K0RA 1LUZA 2CKZB 2RHSB 3J80i 4DR2L 1CKNA 1K83H 2Q2HA 1LM0A 2GVAA 3KDFB 1PVOA 1VQBA 4DR2Q 2F52A 1S72A 4IPHA 3I55A 3G48A 4NXML 1CKNB 3J81j 2ZJQA 2UUAL 4PG3A 1EQRA 1L1OC 1HZBA 4DR5L 4NXMQ 4LUZA 4OXPA 2UUAQ 1NMFA 2NZHA 4WJ3M 1FL0A 4JI8L 1N32L 2K4KA 1HNWL 4DR5Q 4KI0A 4JI8Q 5C44H 3GTPH 2VNUD 1HNWQ 4JI6L 1HNZQ 4YY3L 4XIGS 1RIPA 3HOUH 4JI6Q 2WB1E 1XPRA 1IYJB 2MO0A 3HKSA 2FXQA 4YY3Q 1KIXA 2JA5H 4BY1H 2UUCQ 1DGSA 4DV5L 2AMCB 3PF4A 5C4XG 4DV5Q 1QZGA 5IT9c 3HOZG 4P73A 5IP7H 5IY0A 2HHHL 2YU9H 5M5YH 1EIFA 2K50A 3I4NG 3HFZB 4NB3A 4GNXA 4R1JA 1VQKA 2HHHQ 4QL5A 2VS1A 4O2DA 2V1CC 3K8AA 1HJPA 4JG2A 5IYCG 5FLMH 2VQFL 4B3RQ 1V1QA 3I2ZA 2JA7G 3HKZG 2VQFQ 2UXCL 4X65L 2ZJPA 3W1BA 1VQPA 2KHJA 4X65Q 1X55A 4MZ9A 4UY8C 5C3EH 1XNRL 4UPAA 3S1MH 4R4IA 3GTJH 2F3IA 1UE5A 1WCMH 1GVPA 2A19A 1VQEA 3K7AH 5C0XG 1XNRQ 1A62A 3E0EA 3A74A 3CCJA 1SE8A 5GADC 4AH6A 1M90C 2EIFA 1MIUA 4JBJA 3K0XA 1EIYB 1QVCA 4A3JH 3J81c 5C44G 3G71A 1PH2A 3CAMA 3GTMH 2E5LL 1E24A 1VQDA 3S15H 1YNXA 3IRBA 1SFOH 1JJ2A 1I94L 3HOUG 2Z6KA 3PGZA 5J3BA 3I56A 1VQ4A 1PHJA 2E5LQ 4IOAA 4BY1G 1JE5A 4GOPA 2JA5G 1X6OA 2K14A 3KLWA 4GKJL 1FVIA 3H15A 2D0OA 1HNXL 5GQOA 2UXDL 4GLAC 1OXXK 4GOPB 1AH9A 1BKBA 1HNXQ 4A4IA 2BH2A 5IP7G 2UXDQ 1JT8A 1XJVA 4LUOA 4EQ5A 1O7IA 2R7FA 4L5TA 4R4QA 1SRUA 3PUYA 5JEAJ 1N9WA 2K52A 1GKHA 3CCVA 2R6GA 1NY4A 5FLMG 3NEMA 4LFCL 4ME3A 4X62L 2JE6I 2N8NA 5IWAL 4POFA 3GTGH 2PMZE 4LFCQ 4AYBE 4X62Q 1WFQA 3EBEA 5IWAQ 1CKOA 2JQOA 3UDIA 4DV3L 2WAQG 4LFAQ 4QY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 L;  4A3F H;  1VQG A;  2LXK A;  4DV3 Q;  1E1T A;  4B3T L;  1WCM G;  2ID0 A;  1VQI A;  4JI7 Q;  3CC4 A;  3J7Z C;  4IO9 A;  1XPO A;  1JB7 A;  4B3T Q;  1L2F A;  1R9T H;  1SLJ A;  4JYA L;  1YEZ A;  2N78 A;  4IPG A;  2JA8 H;  3CCU A;  1T9H A;  2UU9 L;  4GLV B;  1VS0 A;  3M85 A;  4A3J G;  3CPF A;  1XPU A;  4JYA Q;  5K36 G;  2UU9 Q;  1M1K C;  1BBU A;  2K75 A;  1VQJ A;  4DV4 L;  1X3G A;  4GKK L;  3RLO A;  5GAE C;  5C4J H;  3U58 A;  1PA6 A;  3PSI A;  4OX9 L;  4LF7 L;  2E8G A;  3S17 H;  4DV4 Q;  1YIT A;  4GKK Q;  1LYL A;  4OX9 Q;  4QJF A;  4LF7 Q;  4C2M H;  4HJ8 A;  2B29 A;  2CWP A;  3K81 C;  4KHP L;  1X3F A;  1YIJ A;  1K73 C;  4H02 A;  1HZ9 A;  3D31 A;  2Q2T A;  1YJ9 A;  3MXN B;  4KHP Q;  2A1A A;  1Q81 C;  1IBL L;  3H0G H;  4DK6 C;  2OTJ A;  3HKZ E;  4POG A;  1VQM A;  2HIV A;  3I4O A;  4JI5 L;  5FLX c;  1IBL Q;  3ICE A;  4YCU A;  2D0P A;  4LF4 L;  4PZ7 A;  4A3G H;  1VQA A;  1I5F A;  3JC6 6;  4QGU A;  4JI5 Q;  4IJH A;  4OO1 I;  3UDG A;  4LF4 Q;  3KDF A;  4A93 H;  3M4P A;  3UDX A;  4BY7 H;  3OTO L;  1JJC B;  3TRZ A;  2OQK A;  4HJ9 A;  4UP9 A;  4YCW A;  2BA0 A;  2ZM6 L;  3H3V I;  3PO2 H;  5JJK A;  2E2H H;  2ZJR A;  4A3F G;  1VQ8 A;  2OTL A;  2R7D A;  3H3V H;  3AFP A;  4AYB G;  2ZM6 Q;  1D7Q A;  4R4C A;  3AYH B;  3JAM c;  1KRS A;  4BA1 I;  5GRO A;  1P8L A;  3B6Y A;  4B3M L;  2JA9 A;  2MO1 A;  1VQO A;  3HOX H;  1IL2 A;  1AE3 A;  2JA8 G;  3CCE A;  4BXX H;  1A63 A;  4B3M Q;  1PH4 A;  2ZTE A;  2QA4 A;  4DV1 L;  2Q2I A;  2CCZ A;  1N32 Q;  4JI3 L;  3M3Y H;  3GTQ H;  2R93 H;  4RG1 A;  4DV1 Q;  1V43 A;  1H95 A;  4JI3 Q;  4DR4 L;  2B63 H;  1PH1 A;  4L5R C;  5ELO A;  3F8T A;  4DR4 Q;  2ZTD A;  3F1Z A;  3KYH C;  1PH6 A;  1Q82 C;  5BR8 L;  5M5X H;  3J80 c;  1WI5 A;  2KBN A;  1OXU A;  4IOC A;  3HOV H;  5E7N A;  1EWI A;  4UP7 A;  2XGT A;  1PH8 A;  4BBR G;  5M3F H;  1SR3 A;  2KCT A;  3H0G G;  3K7U C;  2DGY A;  2IY5 B;  4MNO A;  1QVG A;  2NVX H;  3EIV A;  4GNX C;  3ULL A;  5HY6 A;  3CF5 A;  3CP0 A;  1VQ6 A;  4A3G G;  4NXN L;  1N34 L;  4BA2 I;  2WAQ E;  1G29 1;  3Q8D A;  2EQS A;  3KF8 B;  3PCO B;  4BY7 G;  4A93 G;  1Y1V H;  4OO1 G;  1N34 Q;  3GD7 A;  3RLN A;  2AHO B;  2UXC Q;  1ASZ A;  2JJQ A;  2E2J H;  3PO2 G;  5JJL A;  2AKW B;  2XTI A;  3CXC A;  1FJG L;  3S16 H;  4BBS H;  2UUB L;  1VQC A;  3CW2 C;  2RF4 A;  4GN5 A;  3RNU A;  1FJG Q;  1QUQ A;  4IFD I;  2PQA A;  2IHF A;  3HOX G;  5IYD H;  1QUQ B;  4TVA B;  3CC7 A;  4BXX G;  4AIM A;  1EQQ A;  4KLK A;  5JEA G;  2PQA B;  3PUV A;  1AE2 A;  3TRE A;  2QEX A;  1VQL A;  1OXV A;  2R93 G;  1TWA H;  1J6Q A;  1PYB A;  1YVC A;  1IBM L;  3CD6 A;  2HIX A;  2VL6 A;  3DM3 A;  2B63 G;  5M5W H;  5GAH C;  1IBM Q;  1I94 Q;  3TQY A;  2Q2U A;  1N8R C;  4X66 L;  4GOP C;  5LMN W;  3ULP A;  1Z9F A;  3HOV G;  2PI2 A;  1L0W A;  4DV0 L;  4GKJ Q;  4X66 Q;  4GN4 B;  2NN6 I;  1VQH A;  3KJP A;  5M3F G;  1EUJ A;  4DV0 Q;  1OXS C;  2JK8 A;  4JI0 L;  3ULJ A;  5IYB H;  1X54 A;  3G4S A;  1Q46 A;  3PIP A;  4JI0 Q;  4J15 A;  4YHH L;  3UE1 A;  3S14 H;  2OQ0 A;  1CSP A;  3BU2 A;  3I4M H;  4YHH Q;  1W2B A;  2MNA A;  3ER0 A;  4DPG A;  4OON A;  1Y1V G;  4JBM A;  3A5Z B;  4NPS A;  1IBK L;  1VQ7 A;  3FP9 A;  3M4Q A;  1KQS A;  4X6A H;  4A3K H;  4IPC A;  4ALP A;  1WYD A;  1IBK Q;  4BBS G;  2B3G A;  2CFM A;  4A3D H;  1K8A C;  3KFU A;  3D0F A;  5C0X J;  1BBW A;  2K5V A;  2WP8 J;  2A8V A;  2D62 A;  3MEF A;  3S1R H;  5EAY A;  1PYS B;  3DLL A;  4HJ7 A;  3CCL A;  1UWV A;  3E9H A;  5IYD G;  3K80 C;  4O0A A;  2OCE A;  1HR0 W;  3GDE A;  1NJI C;  2I0Q A;  4L5S A;  2YTY A;  3PIO A;  2WFW A;  2KEN A;  1MJE A;  5H1S E;  1XTD A;  3FKI G;  4JOI A;  1EFW A;  1PFS A;  2RHQ B;  4DKA C;  2VW9 A;  3WWV A;  4HIK A;  4JCV E;  1S40 A;  1E22 A;  4DV7 L;  1N36 L;  2I5H A;  3F2B A;  1NMG A;  1FGU A;  4A3L H;  1TWG H;  3TEH B;  1N36 Q;  2DUD A;  2JA6 H;  1MJC A;  3KOJ A;  3CCS A;  4C3J H;  1KC8 C;  2F4V L;  4PMW A;  4IFD J;  4BBR H;  2NN6 G;  3CMA A;  2F4V Q;  5IYB G;  4DAM A;  4Y52 H;  3BJU A;  3OYY A;  1KD1 C;  3CCM A;  1E1O A;  1X3E A;  1JJG A;  2CQO A;  4DK3 C;  1TWC H;  5FJ8 H;  2Z0S A;  3I4M G;  2ALY B;  3UE0 A;  1Y1W G;  1JMC A;  4L5Q A;  2AWN A;  4FDB A;  4LF6 L;  4YWM A;  3S2H H;  4A3K G;  1W3S A;  3G6E A;  4DUY L;  3OTO Q;  2BH8 A;  1A0I A;  3W5O A;  1U0L A;  3GO5 A;  4A76 A;  1Q7Y C;  2I5L X;  3RLF A;  4LF6 Q;  4A3D G;  4DUY Q;  4A3M H;  2Y0S E;  1YHB A;  5LMN L;  1Q1B A;  3S24 A;  1N33 L;  1PH9 A;  1VQ5 A;  5LMN Q;  1N33 Q;  2GVB A;  5LMU L;  1PH3 A;  1UE1 A;  4R4O A;  4LNQ A;  5LMU Q;  1HZA A;  2GN5 A;  2NVT H;  4LF5 L;  1SN8 A;  3CC2 A;  3KF6 A;  4GLX A;  1X9N A;  3RN2 A;  1YZ6 A;  4LF5 Q;  3F2C A;  4YWL A;  2VUM H;  3GTO H;  1YHA A;  4A3L G;  5GAG C;  5IP9 H;  1A8V A;  4P75 A;  4DR7 L;  3KF6 B;  1QVF A;  2JA6 G;  5C0X I;  1TXY A;  1WOC A;  2I5M X;  4DR7 Q;  3PUX A;  1L1O A;  5BR8 Q;  2ES2 A;  1C7Y A;  3M7N A;  2IX1 A;  1Q8K A;  4C3H H;  3S2D H;  1E3P A;  4C3I H;  1KXL A;  3PF5 A;  1L1O B;  4QIW E;  1GO3 E;  1HNZ L;  5DLQ E;  1KHI A;  5FJ8 G;  1XMO L;  3GTL H;  4EX5 A;  1HR0 L;  4LF9 L;  1I50 H;  2ZTC A;  3BZC A;  3SGI A;  1XMO Q;  4DR6 L;  3T1Y L;  4LF9 Q;  4APV A;  4GN3 B;  1WJJ A;  1HR0 Q;  2UUC L;  4NXN Q;  1YHQ A;  4A3C H;  4DR6 Q;  2R92 H;  3T1Y Q;  3J7A 5;  2ASB A;  1YJW A;  1U5K A;  1X65 A;  3I7F A;  1KRT A;  3T1H L;  4A3M G;  1Z47 A;  2UUB Q;  4Y7N H;  3GTK H;  3T1H Q;  3PUZ A;  3PV0 A;  3EN2 A;  4QQB X;  1P16 A;  3RZO H;  2Y0S G;  2VZA A;  3J81 i;  4B3R L;  2MQH A;  3HOW H;  2JEB I;  4P71 A;  2IT1 A;  1K8G A;  1NE3 A;  4LWC A;  1I3Q H;  3M4O H;  4DAY B;  3FKI H;  4GNX B;  3S1N H;  5IE8 A;  5ELN A;  4LFB L;  1ASY A;  3U4V A;  2VUM G;  1I6H H;  2Z6K C;  3ZJY C;  5IP9 G;  2CWA A;  4LFB Q;  3A5U A;  3A0J A;  1GD7 A;  2QGQ A;  1XNQ L;  1YI2 A;  3L7Z C;  4GS3 A;  3L2P A;  2K5N A;  1IXR A;  2NZO A;  3CME A;  3OW2 A;  3ERS X;  1XNQ Q;  2ATW A;  3LGJ A;  3M9B A;  2KHI A;  4JBW A;  1QZH A;  3RZD H;  1IZ6 A;  3AFQ A;  4MTN A;  3F2D A;  4HIO A;  1G51 A;  3NEL A;  2N49 A;  1Y14 B;  4A3I H;  1YBY A;  1SMX A;  1Y1W H;  4YWK A;  3RR5 A;  3U50 C;  1KL9 A;  4A75 A;  4DR3 L;  1BVS A;  5M3M H;  1K3R A;  1MKH A;  4A3C G;  3FHW A;  2R92 G;  4DR3 Q;  3NEN A;  4RMF A;  4DR1 L;  4LF8 L;  2YTX A;  1CUK A;  2MFI A;  4A3E H;  1V9P A;  2H5X A;  2L15 A;  4P72 A;  4DR1 Q;  1TWF H;  3VDY A;  4LF8 Q;  2WB1 G;  4R4T A;  2LSS A;  1YJN A;  2BA1 A;  2HT1 A;  2R7Z H;  1SRO A;  2IHE A;  4IFD G;  5JJI A;  1J5E L;  4OWW B;  3W1G A;  3TS0 A;  2E2I H;  3RN5 A;  4JBK A;  3AEV A;  3HOY H;  4K0K L;  4LUV A;  4HIM A;  4JI1 L;  1J5E Q;  4B3S L;  3HOW G;  4K0K Q;  2PNH A;  2KCM A;  3E9I A;  4P74 A;  2HQL A;  1VQF A;  4OWT B;  4JI1 Q;  4B3S Q;  1OXT A;  3PO3 H;  1NBW A;  3AQQ A;  3STB C;  4JI2 L;  4DNI A;  3CCQ A;  3TS2 A;  4JOI C;  2AWO A;  2N3S A;  2K5H A;  4JI2 Q;  1NTG A;  4JC0 A;  1VCI A;  1Q1E A;  3KJO A;  1Q12 A;  1Q86 C;  4A3B H;  2VQE L;  4UP8 A;  4AQY L;  2YYZ A;  4WJ4 A;  4DV7 Q;  2YTV A;  1G6P A;  2PI2 E;  2VQE Q;  4AQY Q;  1UEB A;  1CSQ A;  1B7Y B;  1PH7 A;  2VY3 A;  4JI4 L;  1PH5 A;  1B8A A;  1HZC A;  4JI4 Q;  2OWO A;  2LXJ A;  1RL2 A;  2IX0 A;  3CCR A;  4A3I G;  1XMQ L;  1GM5 A;  1X56 A;  4KHZ A;  1CKM A;  1C9O A;  1B70 B;  1LTL A;  4IPD A;  5HGQ A;  1E7Z A;  4X64 L;  1XMQ Q;  1KAW A;  3L0O A;  2NVY H;  1PV4 A;  3S1Q H;  4X64 Q;  1OTC A;  5M3M G;  3PUW A;  4DV2 L;  4TQU S;  1VQN A;  1UE7 A;  4A3E G;  4DV2 Q;  4OWX B;  4LW1 A;  2C35 B;  4XTC S;  4DV6 L;  5AJ3 L;  3CPW A;  1UE6 A;  1K9M C;  4LFA L;  4PZ6 A;  3JAM i;  1D8L A;  5C4X H;  2EXD A;  2RCN A;  4DV6 Q;  5AJ3 Q;  2R7Z G;  3HOZ H;  4IJL A;  4PZ8 A;  3CQZ H;  3U4Z A;  3HOY G;  3BZK A;  3STB D;  1EOV A;  2UXB L;  4DUZ L;  3I4N H;  1S3O A;  1TWH H;  2UXB Q;  1EYG A;  4DUZ Q;  5IYC H;  3PO3 G;  4JV5 L;  4HID A;  1HH2 P;  3NBH B;  3UDF A;  2JA7 H;  4YCV A;  4JV5 Q;  2YV5 A;  1VQ9 A;  4HJ5 A;  5C3E G;  4HJA A;  1C0A A;  4A3B G;  2JEA I;  2NVQ H;  1K0R A;  1LUZ A;  2CKZ B;  2RHS B;  3J80 i;  4DR2 L;  1CKN A;  1K83 H;  2Q2H A;  1LM0 A;  2GVA A;  3KDF B;  1PVO A;  1VQB A;  4DR2 Q;  2F52 A;  1S72 A;  4IPH A;  3I55 A;  3G48 A;  4NXM L;  1CKN B;  3J81 j;  2ZJQ A;  2UUA L;  4PG3 A;  1EQR A;  1L1O C;  1HZB A;  4DR5 L;  4NXM Q;  4LUZ A;  4OXP A;  2UUA Q;  1NMF A;  2NZH A;  4WJ3 M;  1FL0 A;  4JI8 L;  1N32 L;  2K4K A;  1HNW L;  4DR5 Q;  4KI0 A;  4JI8 Q;  5C44 H;  3GTP H;  2VNU D;  1HNW Q;  4JI6 L;  1HNZ Q;  4YY3 L;  4XIG S;  1RIP A;  3HOU H;  4JI6 Q;  2WB1 E;  1XPR A;  1IYJ B;  2MO0 A;  3HKS A;  2FXQ A;  4YY3 Q;  1KIX A;  2JA5 H;  4BY1 H;  2UUC Q;  1DGS A;  4DV5 L;  2AMC B;  3PF4 A;  5C4X G;  4DV5 Q;  1QZG A;  5IT9 c;  3HOZ G;  4P73 A;  5IP7 H;  5IY0 A;  2HHH L;  2YU9 H;  5M5Y H;  1EIF A;  2K50 A;  3I4N G;  3HFZ B;  4NB3 A;  4GNX A;  4R1J A;  1VQK A;  2HHH Q;  4QL5 A;  2VS1 A;  4O2D A;  2V1C C;  3K8A A;  1HJP A;  4JG2 A;  5IYC G;  5FLM H;  2VQF L;  4B3R Q;  1V1Q A;  3I2Z A;  2JA7 G;  3HKZ G;  2VQF Q;  2UXC L;  4X65 L;  2ZJP A;  3W1B A;  1VQP A;  2KHJ A;  4X65 Q;  1X55 A;  4MZ9 A;  4UY8 C;  5C3E H;  1XNR L;  4UPA A;  3S1M H;  4R4I A;  3GTJ H;  2F3I A;  1UE5 A;  1WCM H;  1GVP A;  2A19 A;  1VQE A;  3K7A H;  5C0X G;  1XNR Q;  1A62 A;  3E0E A;  3A74 A;  3CCJ A;  1SE8 A;  5GAD C;  4AH6 A;  1M90 C;  2EIF A;  1MIU A;  4JBJ A;  3K0X A;  1EIY B;  1QVC A;  4A3J H;  3J81 c;  5C44 G;  3G71 A;  1PH2 A;  3CAM A;  3GTM H;  2E5L L;  1E24 A;  1VQD A;  3S15 H;  1YNX A;  3IRB A;  1SFO H;  1JJ2 A;  1I94 L;  3HOU G;  2Z6K A;  3PGZ A;  5J3B A;  3I56 A;  1VQ4 A;  1PHJ A;  2E5L Q;  4IOA A;  4BY1 G;  1JE5 A;  4GOP A;  2JA5 G;  1X6O A;  2K14 A;  3KLW A;  4GKJ L;  1FVI A;  3H15 A;  2D0O A;  1HNX L;  5GQO A;  2UXD L;  4GLA C;  1OXX K;  4GOP B;  1AH9 A;  1BKB A;  1HNX Q;  4A4I A;  2BH2 A;  5IP7 G;  2UXD Q;  1JT8 A;  1XJV A;  4LUO A;  4EQ5 A;  1O7I A;  2R7F A;  4L5T A;  4R4Q A;  1SRU A;  3PUY A;  5JEA J;  1N9W A;  2K52 A;  1GKH A;  3CCV A;  2R6G A;  1NY4 A;  5FLM G;  3NEM A;  4LFC L;  4ME3 A;  4X62 L;  2JE6 I;  2N8N A;  5IWA L;  4POF A;  3GTG H;  2PMZ E;  4LFC Q;  4AYB E;  4X62 Q;  1WFQ A;  3EBE A;  5IWA Q;  1CKO A;  2JQO A;  3UDI A;  4DV3 L;  2WAQ G;  4LFA Q;  4QY7 A; 
#chains in the Genus database with same CATH topology
 4JI7 L;  1KNE A;  4A3F H;  1RF2 D;  4B3T L;  1WCM G;  4JI7 Q;  1H9R A;  3CC4 A;  3T1Y H;  1JB7 A;  4B3T Q;  1R9T H;  1JQY D;  3TSS A;  1BBX C;  3HOX B;  3KAJ A;  1B2T A;  2N78 A;  1ICW A;  2G9H D;  2JA8 H;  5IYZ F;  4ED8 A;  4O2B F;  1VS0 A;  1EL0 A;  3BVM A;  3M3Y B;  2F0G A;  3NBI A;  1T5E A;  1LTR D;  4DV4 L;  2XGQ A;  5GAE C;  5EPJ A;  5C4J H;  1B6S A;  1IW7 D;  3GTO B;  4DV4 Q;  2IWH A;  1YIT A;  2EPB A;  2XD4 A;  5M5X B;  3QWN A;  2YZN A;  4YJ2 F;  3OSP A;  4APM A;  4KHP L;  1EZ6 A;  1EY6 A;  1K73 C;  1HZ9 A;  1YJ9 A;  3MXN B;  4C3H B;  4KHP Q;  3S2D B;  2A73 B;  3H0G H;  4DK6 C;  3HKZ E;  2MCT A;  1V51 A;  2HIV A;  4Q0Y A;  1SSO A;  3I4O A;  4WD3 A;  4RAZ A;  2B2Y A;  3WOF A;  1EYD A;  2B2V A;  4X3U A;  1CE8 A;  1PX2 A;  4IUV A;  4CKB A;  2J0T D;  1KJQ A;  2JP1 A;  3M4P A;  3F2U A;  3MAQ A;  3U9T A;  3E0J A;  1JJC B;  2E2J B;  2LFN A;  1JOQ A;  4UP9 A;  3LWB A;  2BA0 A;  2ZM6 L;  3H3V I;  4TUY F;  3V6J A;  2E2H H;  2V4D A;  4LSX A;  4AYB G;  2ZM6 Q;  1Y8O B;  3J80 E;  5F2D A;  1I4H A;  1P8L A;  4B3M L;  4PWQ A;  2WII B;  5KFH A;  4J9Q A;  1AE3 A;  2EJM A;  4B3M Q;  1PH4 A;  4A2B A;  4YBZ B;  4JI3 L;  1RTO A;  1MI2 A;  3FKI B;  3GTQ H;  1JIC A;  2RDI A;  1N56 A;  1V43 A;  1H95 A;  2IBK A;  4JI3 Q;  2B63 H;  1QIL A;  4XT1 B;  1PFB A;  4IZO A;  5ELO A;  5D8D A;  4R9W A;  3C46 A;  3K58 A;  3UFX B;  1IOV A;  3HOV H;  2F0H A;  5KFO A;  2F3V A;  3L4J A;  1EWI A;  3NE5 B;  4BBR G;  5M3F H;  1SR3 A;  1JKJ B;  2KCT A;  3K7U C;  4AQY H;  3V96 A;  1ZHQ A;  2V58 A;  1EQV A;  2VR1 A;  1QVG A;  1RTN A;  3KXY T;  1MBY A;  2WAQ E;  1S68 A;  1Y1V H;  3FVQ A;  3BQ1 A;  2Z8L A;  3GD7 A;  2AHO B;  4A3K B;  5L1K A;  5EBD A;  5JJL A;  1DJR D;  3CXC A;  3S16 H;  1FJG L;  4BBS H;  4Q44 A;  4J6H A;  2RF4 A;  4GN5 A;  1GUT A;  4J9P A;  1FJG Q;  2N88 A;  1LT4 D;  3R2T A;  4YQW A;  1QUQ B;  1S5B D;  1PZK D;  4RCO A;  2YZM A;  3MEH A;  5JEA G;  3CKI B;  4DV6 H;  1PDQ A;  2F0E A;  4F4Z A;  1KDB A;  2R93 G;  4CC5 A;  2RGR A;  3MVV A;  1RJR A;  2JA6 A;  3BG5 A;  1IBL H;  5FO9 B;  5D1P A;  5M5W H;  1QJO A;  4DUZ H;  4JI5 H;  1TS5 A;  1TQO A;  2B2U A;  3ND8 A;  4F88 A;  4GOP C;  1N8R C;  5LMN W;  4RAY A;  1L0W A;  2MP1 A;  3K5L A;  4GC6 A;  2W57 A;  1SE4 A;  3PVX A;  5KFP A;  4K14 A;  2JK8 A;  1NCV A;  3N6R A;  3JAM L;  2A69 C;  5IYB H;  4DR2 H;  2CW0 C;  3S14 H;  2OQ0 A;  1VDZ A;  4K2K A;  3BU2 A;  2KCC A;  2E75 C;  4G7H C;  1M4V A;  1K8O A;  4DXF A;  4EYH B;  3MFG A;  2MNA A;  4XQN A;  1FNV A;  1HQM C;  3OOC A;  4N8F A;  2W8K A;  4WOR A;  4NPS A;  1QOH A;  4IPC A;  4ME5 A;  1U4M A;  4CGY B;  1WYD A;  4ALP A;  1HUN A;  2EXZ A;  2W9A A;  3EPG A;  1SYX B;  1K8A C;  3KFU A;  3D0F A;  1S97 A;  1NNX A;  2Y0S A;  4J9N A;  5KFC A;  2A8V A;  2D62 A;  4LH6 A;  5CR3 A;  5EAY A;  1PYS B;  4OEM B;  1UWV A;  3E9H A;  1DZ1 A;  2FLP A;  3K80 C;  4ZYS A;  2Z6B A;  5K2M A;  1BCP B;  1RD9 D;  1HR0 W;  3OW7 A;  2WFW A;  2KEN A;  4JOI A;  2RHQ B;  2IW3 A;  4IUQ A;  3C2P A;  3EA6 A;  1S03 G;  4HMJ A;  2WYO A;  2PPB C;  3H91 A;  3F2B A;  4A3L H;  1FGU A;  1FNW A;  1TWG H;  1WD0 A;  1GSO A;  3EYY A;  1JC7 A;  2DUD A;  1I6V C;  3K3V A;  1EY5 A;  4RA8 A;  2UXC H;  1W6J A;  2FLN A;  2NN6 G;  3EFX D;  3W2D A;  3MR6 A;  4Y52 H;  3BJU A;  1KD1 C;  5IGF A;  3OHX C;  5DNF A;  3NTH A;  1D2B A;  1BF4 A;  5EWE A;  3UE0 A;  4QIW B;  3WOE A;  2MUY A;  5EJW A;  2V9W A;  2WB1 A;  2R92 B;  3BYT B;  3G6E A;  3OTO Q;  1MSG A;  1A0I A;  2BH8 A;  1Q7Y C;  4A76 A;  4A3D G;  3RLF A;  2XN9 C;  3DWQ A;  1KDA A;  4A3M H;  2AQ1 B;  5LMN L;  1Z2N X;  3GTK B;  2E5L H;  2ENB A;  1PH9 A;  1VQ5 A;  5LMN Q;  1HTP A;  1PTO B;  4O1N A;  4O42 A;  3RZO B;  4MV8 A;  3TME A;  4EG0 A;  2EE1 A;  3HOW B;  1W96 A;  5C1P A;  4DU9 A;  4CDD C;  2R86 A;  3M4O B;  1HZA A;  4RNN A;  1LTG D;  2GN5 A;  3KF6 A;  4GLX A;  1AUX A;  2L4N A;  3RN2 A;  2BE5 C;  1M6V A;  2ZJT A;  3GTO H;  3GV7 B;  2AGP A;  1U4P A;  2RDF A;  3GID A;  3TIG A;  2PBZ A;  5CA0 F;  1S0M A;  5LP6 F;  1WOC A;  5EKK A;  4C3J G;  2J6U A;  2ZDQ A;  1HA6 A;  2O4X A;  2IX1 A;  5KFT A;  3A8K E;  4CBV A;  5I9P A;  4C3H H;  4J1M A;  3S2D H;  3EQL C;  4C3I H;  1KXL A;  2D5D A;  4ULL A;  4TSS A;  1HNZ L;  4IHJ F;  4RNM A;  2E2D C;  4H44 C;  4EX5 A;  1HR0 L;  1I50 H;  2ZTC A;  3BZC A;  4DR6 L;  5M3M B;  5KFB A;  5JVD F;  1TWF A;  4APV A;  1HR0 Q;  1E0B A;  2UUC L;  4A3C H;  2YS6 A;  4JYA H;  4DR6 Q;  3RIZ A;  1A2T A;  4A3E B;  4KJN A;  4OIJ A;  3NWT A;  1YJW A;  3GV5 B;  1A3V A;  4FBU A;  3I7F A;  2UUB Q;  3D6W A;  1M0T A;  1DM0 B;  3OUZ A;  2EYO A;  4IFD H;  2XRS D;  2V4R A;  4ECU A;  3BJY A;  4LF7 H;  1P16 A;  2DY7 A;  2OT2 A;  5E4X A;  1D1K A;  4DAY A;  3J81 i;  4IWX A;  3Q8S B;  5KND A;  3PO3 B;  1NE3 A;  3FKI H;  3NP8 A;  3S1N H;  1SNM A;  1BUV T;  2R3Z A;  4QWE A;  2R8H A;  5C4H A;  1SNQ A;  2A6H D;  2EVB A;  5IP9 G;  4F50 A;  1RYR A;  2K5N A;  2A6E D;  3MTS A;  1IXR A;  3OW2 A;  1F2M A;  3CME A;  2KHI A;  4B9X A;  3RZD H;  1TAE A;  3IAY A;  4CKE A;  5D1O A;  4IUR A;  3PMF A;  3RB0 A;  5ELD A;  3M9O B;  1Y14 B;  1YBY A;  2NVY B;  3EVQ A;  3J7A K;  1KL9 A;  4A75 A;  1QB5 D;  1V1O A;  5COY A;  5NUC A;  3H3V C;  3OIP A;  1JOK A;  2L5T A;  3NEN A;  3VPB A;  4G7O C;  3MHB A;  5KFD A;  1V9P A;  2L15 A;  4P72 A;  4Q5V A;  4DV1 H;  1AEX A;  2F0P A;  2CVR A;  1TWH A;  1SRO A;  3CQZ B;  4XZ3 B;  5JJI A;  4OWW B;  4L63 B;  5HBR B;  3HOY H;  2E2I H;  1FD7 D;  4K0K L;  2ASD A;  4QWC A;  3I4N B;  3G8C A;  4JI1 L;  3VR3 A;  2M05 A;  3M9N B;  4K0K Q;  3E9I A;  5BR8 H;  1MSH A;  4OWT B;  1IKL A;  4JI1 Q;  1B9N A;  2JA7 B;  1GJX A;  1JX4 A;  4DNI A;  2R7L A;  2YRW A;  2K5Q A;  2NVQ B;  4A3B H;  2VQE L;  2C22 A;  4DV7 Q;  1G6P A;  2EJF C;  1XMO H;  2VQE Q;  4NXN H;  2BQU A;  5C4Z A;  5KT2 A;  5C5L A;  5KFJ A;  5KRU A;  2VA3 A;  1EEF D;  1CQI B;  5IT9 L;  3GTP A;  1B8A A;  3M4I A;  2UVV A;  1B44 D;  3BS1 A;  4RGM A;  2K1B A;  3NWS A;  4M8A A;  1ET9 A;  1RL2 A;  3CCR A;  1XMQ L;  4A3I G;  4EEQ A;  3A7A B;  3TP5 A;  4X64 L;  2WKC A;  1O7L A;  1UNS A;  5JJK A;  1PV4 A;  1E7Z A;  1XMQ Q;  3S1Q H;  3L0O A;  1O75 A;  3PW0 A;  4G3I A;  2BDO A;  4X64 Q;  2YCH A;  1LT3 D;  2F3W A;  3HOU B;  3FRP B;  3PUW A;  1CTM A;  4BY1 B;  2JA5 B;  4P2C B;  4OWX B;  4LW1 A;  4XTC S;  4HR7 A;  5KFU A;  1SXT A;  4IZ8 A;  5C4X H;  4ZK9 B;  3N43 B;  2R7Z G;  1EZ1 A;  4FS1 A;  1IHZ A;  5M5Y B;  3BA8 A;  1EOV A;  2UXB L;  2MJ8 A;  4R8U A;  4X66 H;  2X0S A;  2UXB Q;  4JV5 L;  1PZI D;  5IOC A;  4ABN A;  3PR4 A;  2W9C B;  2AU0 A;  4JV5 Q;  3NQT A;  4JI0 H;  3GTJ A;  1WCM A;  2LS0 1;  2CKZ B;  2RHS B;  3SE7 A;  2Q2H A;  1K83 H;  3AU7 A;  4UFZ A;  2F52 A;  1CFM A;  4I55 F;  2QDB A;  2SEB D;  3SK8 A;  2L55 A;  3QFF A;  1CKN B;  2ZJQ A;  2QIL A;  3GIK A;  1WTH A;  2RBM A;  1SEI A;  2NZH A;  1FL0 A;  1N32 L;  2FKL A;  4KI0 A;  5C44 H;  2VNU D;  3JRW A;  3GTM B;  1HCZ A;  4JI6 L;  2DPJ A;  1SFO B;  1VMP A;  3LWU A;  4JI6 Q;  2WB1 E;  4X3S A;  1XPR A;  4RNO A;  2FXQ A;  3ONA B;  1AW7 A;  3X3M A;  2FPP B;  1TY2 A;  4DV5 L;  1TKW B;  2V5A A;  1G91 A;  3SHL A;  1S5F D;  4DV5 Q;  5FK9 C;  1QZG A;  2EYJ A;  1HTL D;  1ILP A;  3HOZ G;  2EOT A;  3DEO A;  1E4E A;  2Z9H A;  3HFZ B;  3MZ5 A;  2VUG A;  3DUZ A;  4JVZ A;  1WH2 A;  3K8A A;  3VPC A;  1HJP A;  4BS9 A;  3I4M B;  2YYA A;  5E1F A;  3NUC A;  3QOL A;  3T5H A;  1F2Z A;  2KHJ A;  4AYB A;  2NB0 A;  2IL8 A;  2CH4 W;  1X55 A;  3S9W A;  4Y8V B;  3UQ8 A;  2NTS A;  4RUA A;  4A3F B;  4MN3 A;  3S1M H;  2F3I A;  1UE5 A;  4DK1 A;  5ELE A;  5KT6 A;  4IUN A;  3S1R B;  4KHV A;  1R9T B;  2R85 A;  3BAA A;  4LF6 H;  2P0A A;  5GAD C;  1MIU A;  4JBJ A;  3K0X A;  3TZU A;  3GII A;  5C6A A;  3J81 W;  5CBA E;  5D14 A;  3G71 A;  4ZQI A;  3M4Y A;  1DXM A;  4X3T A;  3S15 H;  4XQJ A;  5C4J B;  2Z6K A;  3JRX A;  4IOA A;  5KNC A;  4GOP A;  1X6O A;  1EY7 A;  4GKJ L;  1FR3 A;  1EFI D;  1HNX L;  3TQT A;  5T14 A;  3RJ0 A;  4YAK B;  1N48 A;  4ZHQ F;  1HNX Q;  1ENA A;  3Q1K A;  3QZ8 A;  1XJV A;  2R7F A;  3TDQ A;  1SRU A;  3HKZ A;  5JEA J;  1XYI A;  2R6G A;  1OWT A;  4X3K A;  3NEM A;  3MXP A;  4NXM H;  3GTG H;  2BCO A;  1CS0 A;  3KK7 A;  5IGC A;  4TV8 F;  4EYI B;  1GOZ A;  4DR5 H;  3UDI A;  1XDN A;  4DV3 L;  1JJG A;  5CV4 A;  4LFA Q;  5C3E G;  1NSN S;  2ZT9 C;  4DV3 Q;  3RF2 A;  4LF9 H;  1VQI A;  2Q8I B;  4IO9 A;  1L2F A;  3H94 A;  4K5W A;  1C8C A;  5LXT F;  2R93 A;  1YEZ A;  1ET6 A;  2Y0S B;  3SDZ A;  3I12 A;  3N8D A;  4UCT A;  5KT3 A;  2UU9 L;  2DJF C;  3D8G A;  3I4L A;  4A3J G;  3MA2 B;  2UU9 Q;  2EY1 A;  1IL8 A;  2GA4 B;  2X69 A;  1M1K C;  2K75 A;  1SYF A;  3HG9 A;  4GKK L;  4UAI A;  1PFN A;  4EGV A;  3U58 A;  4OX9 L;  5KFW A;  3RUZ A;  4GKK Q;  1BCP D;  3PZP A;  4B3R H;  4OX9 Q;  4QJF A;  4UCO A;  1T94 A;  4IR1 A;  3HOV B;  2B29 A;  1V1P B;  2AQ3 B;  2W70 A;  5I4D A;  5M3F B;  3G6J B;  2NVX A;  1PZJ D;  2Q2T A;  3Q0A A;  1UUP A;  2OTJ A;  1CM9 A;  1ONL A;  4K5V A;  3NPP A;  5FLX W;  1XNR H;  3ICE A;  4RFB A;  4YR2 A;  4PZ7 A;  4A3G H;  1VQA A;  3JC6 6;  4QGU A;  3J81 L;  3RAQ A;  4EGJ A;  3UDG A;  3V6K A;  1Y1V B;  5CV8 A;  4A93 H;  3UDX A;  2ZDG A;  3MJF A;  2DPI A;  2OQK A;  3VR6 A;  1E2Z A;  4NP5 A;  4FXD A;  4YR0 A;  4BBS B;  1CZG A;  3WDN A;  1VQ8 A;  2OTL A;  2R7D A;  1II3 A;  1C4Q A;  3L9A X;  5IGE A;  3H3V H;  1H9S B;  2CH4 A;  5KKN B;  3EJI A;  5KYI A;  3JAM c;  3BA9 A;  1ZYR D;  3B6Y A;  5JVL A;  1TWA A;  1Y8N B;  2FK2 A;  4Q0F A;  2K03 A;  2ZXP A;  3CCE A;  1GUN A;  2ZTE A;  3VPD A;  2HD3 A;  4MIU A;  1PTO D;  2PQE A;  4L5R C;  5M5W B;  4DXG A;  2V59 A;  3BVZ A;  2NZ1 D;  4MA0 A;  3RTX A;  3QG1 A;  2ZTD A;  3F1Z A;  3TIN A;  1Q82 C;  1WI5 A;  3AB9 A;  5E7N A;  4UCV A;  4UP7 A;  4JI2 H;  1W6K A;  3C3L A;  5FKA C;  1GUS A;  2R7N A;  4EQP A;  2IY5 B;  4QW8 A;  3S14 B;  3GP7 A;  1JIH A;  1EYC A;  1CHQ D;  3DXJ C;  3ULL A;  5HY6 A;  3SK4 A;  3CF5 A;  3OWF A;  3V2T A;  5HV6 A;  1G29 1;  1EYA A;  3PCO B;  3KF8 B;  4BY7 G;  1XX8 A;  4OO1 G;  4IRD A;  3OUU A;  4HCS A;  3U9S A;  1SNP A;  3PO2 G;  1F9S A;  1KAA A;  5C3W A;  1AZQ A;  1EEI D;  3CW2 C;  2IA6 A;  1STA A;  2M2L A;  3RNU A;  4DFA A;  3RBD A;  2K05 A;  2A5H A;  4DV2 H;  3HOX G;  1ZXT A;  4BXX G;  2NU9 B;  1CZW A;  1EQQ A;  1RK6 A;  4KLK A;  5K36 H;  2PQA B;  3WNZ A;  3PUV A;  5FLX L;  3TRE A;  2MPM A;  1B04 A;  1UC8 A;  3M9M B;  1OXV A;  1J6Q A;  1CT1 D;  2OF1 A;  5CA1 F;  3OWE B;  4ECS A;  1YVC A;  4RH6 A;  2HIX A;  3DM3 A;  1RJQ A;  1SNC A;  5GAH C;  5EPK A;  1L2Z A;  1NR2 A;  2PO4 A;  2XRQ D;  1TWG B;  3TQY A;  1I94 Q;  2Q2U A;  1EY9 A;  1Z9F A;  2PI2 A;  2HDM A;  2I07 B;  1HHV A;  4ED2 A;  4GN4 B;  2NN6 I;  3J7Y W;  5LA6 F;  2XWJ B;  5CAE B;  1TWC A;  1EUJ A;  1CQJ B;  2FK3 A;  4C3H G;  2V4Q A;  4IUT A;  4DAV A;  1Q46 A;  5TSS A;  2Z4I A;  4YHH L;  4F7X A;  2PCF B;  1CSP A;  1AN8 A;  3VA5 A;  4YHH Q;  3I4M H;  5EZY F;  1W2B A;  3ER0 A;  3G7L A;  1VBG A;  1VF7 A;  3A5Z B;  1VQ7 A;  4ED7 A;  1KQS A;  4ODG A;  1KLG D;  4JI8 H;  2PZW A;  3BZD B;  1EHI A;  4ED3 A;  1HNW H;  5J1Z A;  4A3M B;  2JYO A;  2K5V A;  5FOB B;  3Q24 A;  1WTQ A;  1PRT C;  3S1R H;  2TSS A;  1F77 A;  4HJ7 A;  4ED6 A;  5IYD G;  1I4R A;  3GQC A;  4F4W A;  2EYL A;  4O0A A;  4WFN 3;  2YTY A;  3PIO A;  4HYK A;  4DL2 A;  2ASJ A;  3TP6 A;  3FKI G;  3BAB A;  4HIK A;  1A3T A;  3WWV A;  3ETJ A;  3VYT A;  4QWD A;  1E22 A;  1JDE A;  1N36 L;  2EYP A;  3G6V A;  3A8J E;  2W6N A;  1SAP A;  2IPK D;  4B08 A;  3TEH B;  1N36 Q;  5IGB A;  2W9B A;  2JA6 H;  2NU6 B;  4HNT A;  3KOJ A;  3MFI A;  3OMG A;  3R5H A;  2VQF H;  2IMW P;  4X65 H;  1SND A;  3J7A V;  4K6D A;  3GTL A;  1K3B C;  4C3I B;  2AUK A;  4ED0 A;  4DAM A;  1K1Q A;  3OYY A;  1WD1 A;  2C2E A;  5KFG A;  1I50 B;  1VF5 C;  2ALY B;  4L5Q A;  1EUD B;  2AWN A;  2K6A A;  5I6W A;  3S2H H;  4A3K G;  3QIA A;  1BDO A;  4HNU A;  4ETS A;  2SNM A;  1C48 A;  2R8G A;  1SNO A;  4ECQ A;  3JAM W;  1Q1B A;  3ERO A;  3S24 A;  3N6X A;  3KTM A;  5A2Q W;  2QDL A;  1GYF A;  2HGS A;  5BMV F;  1GHJ A;  2GVB A;  5LMU L;  2PYK A;  4R4O A;  4LNQ A;  3S1N B;  5LMU Q;  2KEC A;  1LT6 D;  2NVT H;  4LF5 L;  1PMR A;  1X9N A;  1YZ6 A;  5CGK A;  4LF5 Q;  4TQR A;  4YWL A;  4DNT B;  3F8N A;  3I72 A;  2R8I A;  2KOL A;  4LFC H;  1TXY A;  4RHS A;  4X62 H;  5CV5 A;  5IWA H;  3SI8 A;  3MWY W;  2KQ3 A;  4IQZ A;  3RZD B;  4O3O A;  1B9M A;  2O2L D;  1E3P A;  1Y1W A;  3PF5 A;  3U9O A;  1L1O B;  4QIW E;  1BXT A;  1GO3 E;  1SBB B;  2VPS A;  1KJI A;  3MR2 A;  1KHI A;  1S4Z A;  4KKT A;  3R93 A;  5FJ8 G;  5ELC A;  3KHR A;  3SGI A;  1WVL A;  3T1Y L;  5BPF A;  5IOD A;  3SXH A;  4FBT A;  3PW2 A;  3T1Y Q;  3J7A 5;  2R7Z A;  1WSC A;  1QE6 A;  2F0S A;  1U5K A;  1X65 A;  3T1H L;  4EFB A;  5EDW A;  2AUJ D;  4Y7N H;  5DQG A;  3T51 B;  3T1H Q;  4IUP A;  3HOY B;  3PUZ A;  2E2I B;  3PV0 A;  2XC9 A;  2R6F A;  2M00 A;  5C8Y F;  1O80 A;  2G5D A;  2MQH A;  5KFI A;  4P71 A;  3LX0 A;  4LWC A;  1E4E B;  3G6Y A;  1SYG A;  2VQD A;  5AFW A;  3JZI A;  2PMZ A;  1AZP A;  4JV2 A;  3J81 E;  4A3B B;  1ASY A;  2HJW A;  2VUM G;  5BN3 A;  2BOS A;  2Z6K C;  2UVW A;  1H9M A;  2CWA A;  1XNQ L;  3QOJ A;  4LF4 H;  1YI2 A;  3L7Z C;  3L2P A;  3QR8 A;  1K28 A;  4QUC A;  4UCS A;  1XNQ Q;  3MWE A;  4J9K A;  2B39 A;  2F03 A;  3M9B A;  3I70 A;  1ROD A;  4JBW A;  3OTO H;  1IZ6 A;  4MTN A;  4R8N A;  1CK1 A;  1G51 A;  2PZU A;  4H7B A;  5A2Q L;  3NEL A;  4O4H F;  1KTK A;  3S1Q B;  4DF7 A;  1SMX A;  1BVS A;  4EVO A;  1MKH A;  2R92 G;  4RMF A;  4XX0 B;  4YR3 A;  2YTX A;  1TWF H;  3HS0 C;  3VDY A;  1BO0 A;  5C4X B;  4R7R A;  2LY7 A;  4R4T A;  2VPQ A;  2BA1 A;  2HT1 A;  2IHE A;  4XT3 B;  4DR4 H;  3TP7 A;  1BCP C;  1VKZ A;  2JEI A;  2R82 A;  5D3D A;  3HOW G;  4KN7 C;  2DLN A;  5KEE A;  1NBW A;  3AQQ A;  3HKZ B;  5LYJ F;  5KYL A;  3TS2 A;  3QZ7 A;  4ZKB B;  2N3S A;  2JSO A;  2EYF A;  1NTG A;  4JC0 A;  5I47 A;  2B2T C;  1K83 B;  1YNJ D;  4AQY L;  2YTV A;  2PI2 E;  4AQY Q;  1GXD C;  3MR5 A;  1CSQ A;  1N34 H;  4QW9 A;  1B7Y B;  4WRD A;  1A3U A;  2DY8 A;  1F2Y A;  2RDJ A;  2N55 A;  1IYU A;  4HMI A;  1ENF A;  2UUB H;  1X56 A;  4KHZ A;  1CKM A;  4QUF A;  5HGQ A;  5C44 B;  4IPD A;  1ZQ7 A;  2XWB B;  2R93 B;  2J6S A;  1KAW A;  3GV3 A;  5FLX E;  1OTC A;  5M3M G;  4G4K A;  2MGS A;  1I7L A;  4TQU S;  1C30 A;  3I3C A;  4A3E G;  2K32 A;  5KFS A;  2YU9 A;  1LTB D;  3NGD A;  2C35 B;  4DV6 L;  5D65 A;  5J2T F;  4JW0 A;  1UE6 A;  1TII D;  1PTO C;  2RCN A;  4DV6 Q;  3PW5 A;  3CVZ A;  1IBM H;  5KG7 A;  5I9O A;  3STB D;  1KJ9 A;  4DUZ L;  2F0L A;  2KUM A;  1YNN C;  1TWH H;  2K5W A;  1EYG A;  2JXM B;  3R3O A;  5IYC H;  4DUZ Q;  3PO3 G;  4DV0 H;  3NBH B;  5FO8 B;  2J6T A;  2YV5 A;  4HJ5 A;  4HJA A;  1C0A A;  4HED A;  2JEA I;  5KFL A;  4DR2 L;  3J80 i;  3K5I A;  2WAQ B;  5KFN A;  1PVO A;  4NKL A;  1JWS D;  4DR2 Q;  3S1M B;  5KX5 F;  5LL6 b;  2IJ0 A;  1S72 A;  4IPH A;  3G48 A;  4PV1 C;  3FPP A;  5DLF A;  5KFV A;  2E74 C;  2HDL A;  5C0X H;  3J81 j;  2NU8 B;  1TVX A;  1XTC D;  4F4Y A;  3HP3 A;  3D4W A;  1IKM A;  1IBK H;  1TS4 A;  4OXP A;  4WJ3 M;  3T13 A;  5KG1 A;  3N41 B;  2K4K A;  4J9O A;  3GTP H;  2WIN B;  3MXU A;  1HNZ Q;  3S15 B;  4EBC A;  1STB A;  4XIG S;  1RIP A;  1DV1 A;  4YJ3 F;  3RV4 A;  3H4B A;  4RGN A;  4K0K H;  1GSH A;  2UUC Q;  1GUO A;  5LL6 S;  4HN7 A;  1E2V A;  3RMH A;  4I50 F;  1ZKO A;  5IT9 W;  4RGO S;  5IP7 H;  1EY8 A;  4DV7 H;  5DEH A;  3I4N G;  4R1J A;  1HUM A;  4I4T F;  2VS1 A;  1STG A;  3URY A;  3Q6S A;  2KED A;  5FLM H;  3SK5 A;  1SE2 A;  3I2Z A;  3Q23 A;  2JA7 G;  3GTG B;  1E4G T;  2UXC L;  1JDB B;  2F4V H;  1ESR A;  3DM1 A;  5ELF A;  2ZJP A;  3VYS A;  1I7N A;  2M9V A;  4MZ9 A;  5C3X A;  1TA8 A;  1Q90 A;  2RQX A;  4UPA A;  3GTJ H;  1WCM H;  1GVP A;  2A19 A;  4O3P A;  2AQ2 B;  1KEE A;  3E0E A;  1CA6 A;  3A74 A;  1SE8 A;  4AH6 A;  1M90 C;  2PNR C;  1EIY B;  4DUY H;  1U9R A;  4LSA A;  3J81 c;  3ETH A;  4O2A F;  1PH2 A;  3KLR A;  2E5L L;  5EQ0 A;  1VQD A;  3Q8P B;  4C2M A;  1N33 H;  3IRB A;  3HOU G;  1HRJ A;  3LNN A;  3JSN A;  2E5L Q;  1V4Y A;  1PHJ A;  1R4P B;  4BY1 G;  2JA5 G;  2F0K A;  1L0Y B;  3H15 A;  2EJG C;  1KBL A;  2QCP X;  2UXD L;  1SYE A;  1SMY D;  2VB2 X;  2D2C C;  1WTO A;  2BH2 A;  1IW7 C;  2UXD Q;  3ERQ A;  4LUO A;  4EQ5 A;  4R4Q A;  2ZXR A;  1N9W A;  2PN1 A;  3CCV A;  4DR7 H;  1NY4 A;  4A3G B;  1B3Q A;  5FD6 A;  2JE6 I;  2N8N A;  4A93 B;  2PMZ E;  3D4R A;  3NK9 A;  1TU2 B;  4XYL B;  1SE3 A;  3EBE A;  5FD5 A;  3GIP A;  2O5I C;  4B9W A;  4QY7 A;  2RCF A;  3GV6 A;  2ID0 A;  4JI6 H;  4K8I A;  3J7Z C;  1PK8 A;  4PMB A;  4GC7 A;  2KCN A;  2HUG A;  1SLJ A;  3DHQ A;  4JYA L;  3IL8 A;  2R87 A;  4ECT A;  1MD2 D;  1T9H A;  4GLV B;  5JJZ A;  3M85 A;  4JYA Q;  5K36 G;  2I46 A;  1D6E C;  1QWY A;  2EDG A;  1JOR A;  1VQJ A;  1X3G A;  3PQI A;  1PA6 A;  4LF7 L;  2F0M A;  4DL7 A;  1LYL A;  4LF7 Q;  1MHW C;  1JR0 D;  1YIJ A;  4H02 A;  3BDC A;  1ML0 D;  5CB4 F;  1Q81 C;  4ECV A;  1ZET A;  4LFB H;  5JH7 F;  1HPC A;  5LHY 1;  1VQM A;  5FLX c;  3JAM E;  4YCU A;  2D0P A;  1AUV A;  5A2Q E;  1GSA A;  2RSO A;  2DNC A;  4OO1 I;  1JWU D;  4MTE A;  3TRZ A;  4HJ9 A;  1TT2 A;  4YCW A;  4RGT A;  5EBC A;  4A3F G;  4MV1 A;  3OSN A;  4R4C A;  1U4R A;  2NYZ D;  2B2W C;  5KFA A;  3TII A;  2Q8R E;  3AYH B;  3NTI A;  3QO2 A;  5CV9 A;  2KA7 A;  3ND9 A;  3SE0 A;  3EPI A;  2JA9 A;  3GQB A;  2OEO A;  4ECX A;  1VAJ A;  2JA8 G;  3P1H A;  2QK4 A;  4QWB A;  4LF8 H;  5JEA H;  2CCZ A;  2QA4 A;  3TN2 A;  2Q2I A;  4DV1 L;  1TR5 A;  1N32 Q;  4FS2 A;  1HNX H;  2R93 H;  1KC7 A;  4TQS A;  4RG1 A;  4DV1 Q;  2AGQ A;  1J5E H;  2GPS A;  1PH1 A;  2XCA A;  4B3S H;  4PDB A;  4K8J A;  4EBE A;  4QMG A;  5BR8 L;  4GZY C;  1OXU A;  2XGT A;  1PH8 A;  2W6O A;  2E76 C;  3GLK A;  4LFA H;  3H0G G;  2UVU A;  3V4S A;  2RKS A;  5IGD A;  2EZV A;  2OLS A;  1KAB A;  4H13 C;  2NVX H;  4GNX C;  4RZQ A;  2Z4H A;  4J9S A;  4NXN L;  1Y1W B;  4BA2 I;  4MV6 A;  3NTK A;  3Q8D A;  5EGT A;  1X3P A;  2ALZ A;  4JI4 H;  2QF7 A;  2BDN A;  3RLN A;  2JJQ A;  1SYD A;  1E2W A;  2AKW B;  2XTI A;  2K01 A;  4CDE C;  4IRC A;  5F9N A;  3RBE A;  1QUQ A;  4IFD I;  3BYY B;  1B33 N;  4IUU A;  2IHF A;  1UAP A;  4GKK H;  2K04 A;  2FIN B;  2B8F A;  4TVA B;  3CC7 A;  1QNK A;  4Q8E A;  1B53 A;  1BOS A;  1VQL A;  3OHA A;  2QKI C;  1TWA H;  1PYB A;  1I4X A;  2B63 G;  2W6Z A;  4CJ0 B;  3KAL A;  1RK5 A;  4O4I F;  2EY2 A;  3H20 A;  4X66 L;  2JA6 B;  3IFT A;  3ULP A;  3AMU A;  4ZCK A;  3HOV G;  3A7L A;  2XCP A;  4GKJ Q;  4U7C A;  4X66 Q;  1VQH A;  3KJP A;  2A74 C;  4UDU C;  5M3F G;  2FP4 B;  1OXS C;  2NN6 H;  5EOY A;  4JI0 L;  1GLV A;  4EFE A;  4KKU A;  3PIP A;  1CI3 M;  4JI0 Q;  4J9M A;  4J15 A;  3UE1 A;  2QW7 A;  4RZR A;  2ATL A;  4DPG A;  1Y1V G;  4XYQ A;  1JLL B;  4JBM A;  3R5F A;  1LT5 D;  3S2H B;  5KG6 A;  1D5Z C;  3FP9 A;  3M4Q A;  5EWG A;  1H9J A;  4BBS G;  2YRX A;  5J2U F;  2CFM A;  4A3D H;  5KT7 A;  3BVG A;  3J80 L;  4F87 A;  4KN4 C;  1BBW A;  1ILQ A;  2WP8 J;  3HB9 A;  4YY3 H;  3MEF A;  3DLL A;  4FVM A;  3C1F A;  3P7J A;  3GIM A;  3VR2 A;  3H40 A;  2KSW A;  2OCE A;  1NJI C;  3V6H A;  1MJE A;  1DON A;  4DL5 A;  4O3N A;  1XTD A;  2VUM A;  2NVT B;  1EFW A;  3ORR A;  1PFS A;  4DKA C;  5G3L F;  4F8M A;  2HHH H;  2B2T A;  1K1S A;  1NMG A;  1PRT F;  3KUP A;  3A54 A;  4LAA A;  3MWD A;  2ICE C;  1WTR A;  4LH7 A;  1STN A;  3VR5 A;  2CW0 D;  3CCS A;  4C3J H;  1D5M C;  1KC8 C;  4ID6 A;  4PMW A;  2NU7 B;  1EWH A;  4KY7 A;  2XIG A;  5IYB G;  1A6X A;  3N44 B;  5JVG 3;  2W71 A;  3GV8 B;  1C3O A;  1E1O A;  4QIW A;  4NMZ A;  4DK3 C;  1TWC H;  4IAJ A;  2R92 A;  2Z0S A;  4ZLT F;  2SCU B;  1JMC A;  3HZX A;  4K2L A;  4FDB A;  2A68 D;  4DNR B;  1S5D D;  5KIX A;  4LF6 L;  1STH A;  1RDP D;  4HSP A;  3ORQ A;  1NUC A;  4YWM A;  1W3S A;  3GTK A;  4LF6 Q;  2I5L X;  4HSV A;  2WB1 B;  1EIG A;  1YHB A;  1SDF A;  2WKD A;  4Y7N B;  3FMC A;  3TBI B;  4J0M A;  1I94 H;  4C1N K;  5KT5 A;  1I3Q A;  3HGB A;  1ENC A;  2W6M A;  1EZ8 A;  3N52 A;  5JAV A;  1I4P A;  2NTT A;  5BN5 A;  1J8I A;  1PH3 A;  5JUM A;  1SN8 A;  3K3P A;  3PIO 3;  1AN7 A;  2IP4 A;  3R8B A;  3F2C A;  4A3L G;  5GAG C;  1LTA D;  5IP9 H;  3DF7 A;  3KF6 B;  4KMU C;  2IX3 A;  2BQR A;  1PLF A;  3I91 A;  4UCU A;  2I5M X;  1VMC A;  3PUX A;  2ES2 A;  2AGO A;  2A6H C;  2BQ3 A;  3KAK A;  5JOB A;  3K59 A;  5IT9 E;  2A6E C;  4JI7 H;  3GTL H;  4B3T H;  4LF9 L;  3RD4 A;  4TRD A;  1T36 A;  1O7Z A;  4LF9 Q;  1X3Q A;  1LTS D;  1STE A;  1WJJ A;  5T1I A;  1WTP A;  2I87 A;  5I2X A;  4OIK A;  2ASB A;  1BR9 A;  1TWF B;  1KRT A;  4A3M G;  1DD2 A;  3RGX A;  2LKV A;  4HAE A;  1DOM A;  3LML A;  1CQF A;  4DV4 H;  3T5K A;  5L1L A;  4KD3 A;  3EN2 A;  3E5N A;  5DM6 3;  2VZA A;  4B3R L;  2JEB I;  1SMY C;  2IT1 A;  1K8G A;  3SK6 A;  4LMY A;  2QYZ A;  4KHP H;  2VOB A;  4HQ6 A;  4DAY B;  5IE8 A;  4MV3 A;  5KG2 A;  4C5B A;  3GIQ A;  5KFM A;  5ELN A;  4MA5 A;  3U4V A;  4DLK A;  2C2R A;  1I6H H;  5BN4 A;  4U68 A;  3A5U A;  3A0J A;  2QGQ A;  4KY5 A;  4GS3 A;  3T56 B;  2NZO A;  3GIL A;  2ATW A;  3LGJ A;  3R2I A;  4XDX A;  1QZH A;  3V05 A;  4G7Z C;  1K0S A;  4C3I G;  3F2D A;  2O03 A;  2NVY A;  1UEA B;  4CHT B;  2ZM6 H;  1RCV D;  1A15 A;  3BQ0 A;  4A3I H;  1OO9 B;  2YW2 A;  5D1O B;  1Y1W H;  3U50 C;  4FF1 A;  4DR3 L;  1K3R A;  3TZD A;  1PFM A;  4A3C G;  4B3M H;  2DN8 A;  2G9D A;  2KVM A;  4DR3 Q;  2R8J A;  4DR1 L;  4UHV A;  2FE3 A;  4LMQ D;  2MFI A;  3CQZ A;  5E4W C;  5KG4 A;  5LMU H;  2H5X A;  4QCL A;  1EIH A;  4DR1 Q;  2RGV A;  3T5J A;  5GON F;  4JI3 H;  2LSS A;  5M9O A;  2JEG A;  1Y69 U;  2R7Z H;  4IFD G;  4WBN F;  3W1G A;  3K5M A;  3RN5 A;  4JBK A;  1NAP A;  3AEV A;  4L1K A;  2JA7 A;  4HIM A;  1TWH B;  2KCM A;  4P74 A;  2HQL A;  1VQF A;  1OXT A;  5L1J A;  2CZG A;  3MC0 B;  4JI2 L;  3D6C A;  3CCQ A;  5JPM C;  2K33 A;  3KJO A;  2K5H A;  4JI2 Q;  1VCI A;  1Q1E A;  1Q86 C;  1Q12 A;  3PO2 B;  1BCP F;  1LAB A;  2YYZ A;  3RGZ A;  3CHB D;  1UEB A;  2VB3 X;  5HGT A;  2VY3 A;  1PH5 A;  4C56 C;  4L8J A;  2FK1 A;  2DJG C;  5D3I B;  1PRT B;  2IX0 A;  2GLT A;  1FJG H;  2QEJ C;  3GTP B;  1LTL A;  1C9O A;  3T1H H;  2JEF A;  1RJP A;  2JA5 A;  3E6Z X;  2R8K A;  3HEJ A;  4DV2 L;  4ILW A;  4RKL A;  2TMP A;  1VQN A;  1SEB D;  4RB0 A;  4DV2 Q;  3RB6 A;  2HCC A;  2F1M A;  3OMC A;  1EOT A;  4PZ6 A;  4CKC A;  2EXD A;  3JSL A;  3HOZ H;  4PZ8 A;  4HR7 B;  3HOY G;  3BZK A;  1K8M A;  4FXG C;  3KLS X;  2W9C A;  5ISR A;  1WTV A;  1XNQ H;  3D4D A;  1G2T A;  4HID A;  4IWY A;  1HH2 P;  5DG9 A;  2F0Q A;  4YCV A;  4R8U B;  1VQ9 A;  2KJX A;  1PTO F;  4A3B G;  1LUZ A;  1B4O A;  1HFN A;  1CKN A;  2X6G A;  3FDT A;  2W8L A;  1LM0 A;  2GVA A;  1WTX A;  2B2W A;  1LLR D;  2F0O A;  3GTJ B;  3I55 A;  1WCM B;  3T53 B;  5DLG A;  3MR3 A;  2UUA L;  4PG3 A;  1L1O C;  1A2U A;  1HZB A;  1XXG A;  3GTM A;  2UUA Q;  1NMF A;  4JI8 L;  1SFO A;  2PZT A;  1HNW L;  3PR5 B;  2UVR A;  4JI8 Q;  1HNW Q;  4NW2 A;  2NBF A;  2J9G A;  2KHS A;  2FFK B;  4CDF C;  5EKI A;  4RAU C;  3HKS A;  1KIX A;  5HUR A;  2P5Z X;  1MZB A;  4RUC A;  4J9L A;  1VBH A;  2AMC B;  3A55 A;  1WTW A;  2ZDH A;  3TQ1 A;  1EU3 A;  5KFK A;  3PF4 A;  5C4X G;  4IAL A;  5IT9 c;  2YU9 H;  1EIF A;  4MHE A;  2K50 A;  4NB3 A;  4GNX A;  5IIF A;  1VQK A;  4QL5 A;  2XCL A;  4O2D A;  2V1C C;  1IYV A;  2VQF L;  4E4T A;  4DA2 A;  1SCU B;  2RDG A;  3DMU A;  1GUW A;  3PN1 A;  1Y8P B;  3HKZ G;  2VQF Q;  2L12 A;  1I4G A;  4X65 L;  3W1B A;  4N8X 1;  4J8Q A;  4U6P A;  3ITP A;  4X65 Q;  1CHP D;  4XQQ A;  5C3E H;  1R9T A;  3TP8 A;  2EYM A;  4AYB B;  5DGA A;  1J9O A;  3SEB A;  1LAC A;  4EEY A;  1H9K A;  1VQE A;  2XSC A;  3K7A H;  4I65 A;  4OHJ A;  2RDH A;  5KFZ A;  3FMA A;  1WR2 A;  5J39 A;  1I6U A;  2L9H A;  4LJZ C;  1QVC A;  5CYU A;  4A3J H;  5C44 G;  3CAM A;  5LMN H;  1KJ8 A;  1JJ2 A;  1PXU A;  1DIK A;  1KJJ A;  3PGZ A;  3I56 A;  3KBG A;  3SR1 A;  4FP5 D;  1JE5 A;  5DM7 3;  2MHV A;  3KLW A;  2C00 A;  3MFY A;  4DK0 A;  4OL7 A;  3H0G A;  3OHB A;  1OXX K;  4GOP B;  4BBR B;  1AH9 A;  3MFH A;  3T5L A;  1R4Q B;  1SJH D;  4H0L C;  1X32 A;  2L0C A;  1L0X B;  3PUY A;  2HCI A;  2J7Z A;  4RWS C;  3VMM A;  2WAC A;  2OH2 A;  4LFC L;  4ME3 A;  4X62 L;  5IWA L;  5KG5 A;  2E2H A;  4POF A;  1BQQ T;  2EY6 A;  4LFC Q;  3NHH A;  4X62 Q;  2RSN A;  5IWA Q;  3KHG A;  5JPN C;  4EBD A;  4O3R A;  2JQO A;  2VA2 A;  2WAQ G;  3K0Y A;  1DOL A;  1HNZ H;  1VQG A;  3NXW A;  2LXK A;  3N40 P;  4ED1 A;  1E1T A;  2A68 C;  1HR0 H;  4K5X A;  4ECR A;  3W3A A;  4DR6 H;  1XPO A;  2F0T A;  1T3N A;  2UUC H;  4IRK A;  2FMM A;  2R7M A;  3GTQ A;  1EY4 A;  4IPG A;  4F4X A;  3CCU A;  2FPG B;  1STY A;  3Q2O A;  4A2A A;  1XPU A;  3CPF A;  2B63 A;  1T5X D;  2NWG A;  1AP0 A;  4S3S A;  5C5J A;  5L1I A;  1BBU A;  1ZYR C;  1JB3 A;  1ZEQ X;  3RLO A;  1V1P A;  3S17 H;  3PSI A;  2VUM B;  2E8G A;  3C0F B;  1BXR A;  2AQ4 A;  4MTK A;  2F0F A;  4C2M H;  4HJ8 A;  1ULZ A;  2CWP A;  3K81 C;  2PW5 A;  5KFX A;  5KFF A;  1X3F A;  3PW4 A;  1BGW A;  3D31 A;  2FMC A;  5CBE E;  1B50 A;  2A1A A;  4DL6 A;  1ZHS A;  1IBL L;  4POG A;  1JXL A;  4JI5 L;  4HTH A;  1Y1V A;  1IBL Q;  2NVX B;  4LF4 L;  4JI5 Q;  1I5F A;  4IJH A;  4LF4 Q;  2I80 A;  3KDF A;  4BY7 H;  4DN4 M;  4RU9 A;  4OO1 H;  3OTO L;  2Z1C A;  1H9S A;  3PO2 H;  2ZJR A;  5C5M A;  1ICF B;  5KG3 A;  2RA4 A;  3AFP A;  4DGZ A;  3IN5 A;  1D7Q A;  1Q3L A;  4QWA A;  3KLS A;  1KRS A;  1GUG A;  4BA1 I;  1ESF A;  5GRO A;  1IL2 A;  1BNZ A;  2MO1 A;  1VQO A;  3HOX H;  4BXX H;  1A63 A;  4DL3 A;  3E3X A;  1I3Q B;  2UXD H;  4N9P A;  1TWA B;  3M3Y H;  5L9X A;  4DR4 L;  4WJW A;  5CV6 A;  2R7K A;  3F8T A;  4DR4 Q;  4JI1 H;  3CRK C;  4FF2 A;  4YAJ B;  1PH6 A;  3KYH C;  2I8C A;  4RB1 A;  3J80 c;  5M5X H;  4IOC A;  3IG0 A;  2KBN A;  3SVM A;  1M8A A;  2F0N A;  1HXY D;  3X3N A;  5H80 A;  1O78 A;  4HCE A;  5LOV F;  2WV6 D;  2DGY A;  3DEP A;  2VQE H;  3KF8 A;  4MNO A;  3EIV A;  3V4Z A;  1UC9 A;  1KNA A;  3CP0 A;  1VQ6 A;  4A3G G;  1N34 L;  2EQS A;  4A93 G;  1N34 Q;  3DWA A;  2UXC Q;  2YS7 A;  1ASZ A;  4KJO A;  2E2J H;  1XMQ H;  4A3D B;  2UUB L;  1VQC A;  4X64 H;  5K5P A;  2NUA B;  3Q22 A;  3GIJ A;  4M7E A;  1RYS A;  2PQA A;  3LP8 A;  5L37 A;  3I73 A;  2W7P A;  1DOK A;  5IYD H;  3I8Z A;  1QG7 A;  4AIM A;  1AE2 A;  2QEX A;  1TWG A;  3M7G A;  1IBM L;  3CD6 A;  2F0J A;  2VL6 A;  1G8Z D;  4PNY A;  3VYU A;  2OXP A;  2UXB H;  1IBM Q;  4Q43 A;  3WO0 A;  3BDO A;  4KTA A;  4Z9C B;  3J7A F;  4DL4 A;  4KY6 A;  4JV5 H;  2H4O A;  4RB3 C;  4DV0 L;  4OGQ C;  4C3J B;  1GHK A;  4DV0 Q;  2XNA C;  3ULJ A;  1FNU A;  1X54 A;  1LO5 D;  3G4S A;  3BQ2 A;  1TWC B;  2VXW A;  4EQN A;  4IR9 A;  3VYR A;  5KNB A;  2EYH A;  3HRZ C;  4OON A;  3HBL A;  1SYC A;  1IBK L;  3G6X A;  4X6A H;  4A3K H;  3T16 A;  1N32 H;  1IBK Q;  1RKN A;  2B3G A;  5COR A;  5ELB A;  1RHP A;  5C0X J;  4FO2 A;  4ECW A;  3CCL A;  4ECZ A;  2F0I A;  5KT4 A;  3L4K A;  4DV5 H;  2I0Q A;  3GDE A;  4L5S A;  1EUC B;  5J22 A;  5H1S E;  4KV6 A;  1S9F A;  1JE4 A;  2CQA A;  2HVS A;  3GTO A;  3A8I E;  1BJT A;  4UCR A;  2VW9 A;  3RUP A;  1S40 A;  4JCV E;  3OIQ A;  4DV7 L;  2O5J C;  2K5D A;  2I5H A;  4FU0 A;  3MXN A;  1FKA H;  3T4A C;  5DG8 A;  1MJC A;  1UNN C;  4IFD J;  2F4V L;  1FYC A;  2HVQ A;  3R5X A;  4XXE A;  4BBR H;  3CMA A;  4IN3 A;  2F4V Q;  2W9B B;  1KDC A;  1I50 A;  5LL6 X;  3CCM A;  1X3E A;  4Q45 A;  2CQO A;  1B1Z A;  5KFQ A;  1Z2O X;  5FJ8 H;  3GTL B;  2GPW A;  2B2Y C;  5E3F A;  3I4M G;  1Y1W G;  2B2V C;  3PIP 3;  4QB4 A;  5G3L D;  2FJ2 A;  1PRT D;  4KK7 A;  4DUY L;  3W5O A;  1U0L A;  2FHT A;  3GO5 A;  5DGB A;  4DUY Q;  1E4F T;  2Y0S E;  5KG0 A;  4I7A A;  3KHL A;  1EWC A;  4N9T A;  1N33 L;  5DG7 A;  2SDF A;  4DAP A;  4FYD A;  3RB3 A;  3FKI A;  3D3R A;  1N33 Q;  1EYZ A;  2K28 A;  4GKJ H;  4L6T B;  2LMC B;  1UE1 A;  3Q8R B;  2F4I A;  1PYW D;  4CJ1 B;  5IGG A;  3CC2 A;  2FMA A;  1S0O A;  4U67 3;  1I6H B;  1EQT A;  2VUM H;  1YHA A;  4E6I A;  3J80 W;  1A8V A;  1JWM D;  4P75 A;  4DR7 L;  2W6P A;  1QVF A;  2JA6 G;  2R61 A;  5C0X I;  2YL2 A;  4DR7 Q;  1L1O A;  5BR8 Q;  1C7Y A;  3M7N A;  1Q8K A;  4QF4 A;  1QNU A;  3BG3 A;  3RV3 A;  3C1E A;  4DV3 H;  2X6L A;  4A3I B;  5DLQ E;  1XMO L;  4RKB A;  4YP3 A;  3N42 B;  2F0U A;  1XMO Q;  1RJT A;  4ME6 A;  4NXN Q;  4GN3 B;  1YHQ A;  2YZG A;  3OPO A;  1BNC A;  2R92 H;  1D5X C;  4M9U A;  2UU9 H;  3MXG A;  4TKO B;  4J9R A;  2NUC A;  4C1N I;  2E2I A;  2D9U A;  2C9O A;  1Z47 A;  2ASL A;  4RCN A;  5JQW A;  2R7Z B;  1FGB D;  3GTK H;  5F9L A;  3RB4 A;  4JPB W;  4ZUI A;  1LTI D;  3H09 A;  4OX9 H;  4O3Q A;  1PTO H;  3RZO H;  4QQB X;  2CHB D;  2DWC A;  2Y0S G;  2CQY A;  3HOW H;  1MGS A;  4ECY A;  1I3Q H;  4C5C A;  3M4O H;  4GNX B;  4ZQ3 A;  4BWG B;  2CW8 A;  1CQV A;  4LFB L;  1B3A A;  3ZJY C;  4LK1 C;  4PQX A;  3IKJ A;  4JK1 C;  4LFB Q;  2WE6 A;  2PMZ B;  4OEL B;  1GD7 A;  4BWS C;  2B2U C;  1O7Y A;  4NDX A;  5KGU A;  3R23 A;  3RAX A;  3BDL A;  3ERS X;  4ZRZ A;  2PW7 A;  2EY5 A;  1YNJ C;  3AFQ A;  1TS3 A;  1Z7T A;  2PVP A;  5KFE A;  4HIO A;  4EQO A;  2JA8 B;  3P20 A;  2N49 A;  1HFG A;  3I90 A;  3UI2 A;  4TV9 F;  3LWE A;  1Z2P X;  1JOO A;  4YB8 B;  4KKS A;  4YWK A;  3RR5 A;  3KHH A;  2SOB A;  5M3M H;  4KD4 A;  3DWP A;  2F0V A;  3FHW A;  1CA5 A;  4CC6 A;  2JN4 A;  1S5E D;  4LF8 L;  2XGP A;  1CUK A;  3H6M A;  4A3E H;  1D1I A;  3PW7 A;  3FEW X;  3FPU B;  4LF8 Q;  2C2D A;  2K7V A;  2WB1 G;  5C1O A;  1YJN A;  4YIJ A;  3HOZ B;  2FJZ A;  4JUZ A;  1J5E L;  3H0G B;  1LV9 A;  3TS0 A;  3HXL A;  4LUV A;  1M7J A;  1XWE A;  1J5E Q;  4B3S L;  1DYQ A;  2PNH A;  4MV9 A;  5BPH A;  4FM9 A;  3PO3 H;  4B3S Q;  1K83 A;  5I2Y A;  3STB C;  2XVS A;  4V0B A;  4JOI C;  3ZYY X;  2L11 A;  1SJE D;  2AWO A;  4LFA L;  3IFD A;  1G2S A;  4MAM A;  4WJ4 A;  5A35 A;  3VA7 A;  4UP8 A;  4V19 0;  3O13 A;  2A69 D;  2E2H B;  3QB3 A;  1M0W A;  4Q8F A;  1U4L A;  1PH7 A;  2DIK A;  4M1U B;  4JI4 L;  2HVR A;  1S10 A;  5FPO A;  3MWM A;  1HZC A;  4JI4 Q;  2OWO A;  1A9X A;  3Q8Q B;  2LXJ A;  2C28 A;  2DNE A;  5DQH A;  1GM5 A;  2L1B A;  1B70 B;  1KLU D;  1F9P A;  1SYB A;  3GTQ B;  3RFC A;  2NVY H;  2J4X A;  2WDT A;  2B63 B;  5FPR A;  4MV7 A;  4ZI7 F;  4RHR A;  3CRL C;  1UE7 A;  1B6R A;  2W7O A;  4MV4 A;  1HQR D;  5AJ3 L;  3CPW A;  1JCK B;  1K9M C;  3JAM i;  1D8L A;  4FXK C;  5AJ3 Q;  4EGQ A;  4IJL A;  2YU9 B;  3CQZ H;  3U4Z A;  3NQI A;  3NBH A;  3I4N H;  1Q8I A;  1HA5 A;  1S3O A;  4ZOL F;  2F0W A;  1F9R A;  1S0N A;  2WTF A;  3UDF A;  2JA7 H;  2WAQ A;  4CDC C;  3P75 A;  5CV7 A;  2NVQ H;  1K0R A;  1Z6H A;  3S16 B;  5C3E B;  2R84 A;  3KDF B;  4YHH H;  5EPL A;  1VQB A;  2HQE A;  3L3O C;  3FDS A;  4JV0 A;  3K7A B;  4NXM L;  3K5N A;  4DR3 H;  1EQR A;  1QCB D;  4I7Z C;  5JVH 3;  5CMD A;  2FPI B;  2H1E A;  4DR5 L;  4NXM Q;  4LUZ A;  4C5A A;  4DR1 H;  2B8G A;  1AFP A;  2SNS A;  4A3J B;  4DR5 Q;  1TY0 A;  4FF3 A;  2ZXO A;  5FO7 B;  1I4Q A;  3K5H A;  5T1G A;  4PMC A;  1W93 A;  4G57 A;  4YY3 L;  3HOU H;  2FB9 A;  1EY0 A;  1IYJ B;  2MO0 A;  3OSO A;  4YY3 Q;  1V8Q A;  4BY1 H;  2JA5 H;  1S5C D;  1DGS A;  3CU7 A;  1YNN D;  1F2L A;  4P73 A;  5IY0 A;  2HHH L;  4K6L A;  1N36 H;  5M5Y H;  3KBX A;  5CC4 A;  3GTG A;  2HHH Q;  1NR4 A;  2BE5 D;  3K57 A;  4XYM B;  5I6Y A;  4HNV A;  4JG2 A;  3A56 A;  5IYC G;  4B3R Q;  2W6Q A;  1V1Q A;  2FLL A;  4ZUJ A;  4FNF A;  2BR0 A;  1VQP A;  4UY8 C;  3K5O A;  1DV2 A;  1XNR L;  4R4I A;  2DZD A;  4MTD A;  1XNR Q;  4O3S A;  2RVL A;  5C0X G;  1A62 A;  2ICI A;  4CJ2 C;  3CCJ A;  4RB2 C;  2CW7 A;  2EIF A;  1GGO A;  5DQI A;  2KEE A;  2C5C A;  4ZAI A;  2XIW A;  3VR4 A;  2JEJ A;  3GTM H;  1E24 A;  4ZKC B;  1YNX A;  1SFO H;  1I94 L;  3S17 B;  1VQ4 A;  5EWF A;  5J3B A;  2K14 A;  1DCZ A;  4C2M B;  1FVI A;  5DAU A;  1TS2 A;  2D0O A;  4I7H A;  1G6Z A;  3K6O A;  5GQO A;  4GLA C;  4JV1 A;  5KFR A;  3WO1 A;  1BKB A;  1LTT D;  4A4I A;  3QJY A;  4XYO A;  5IP7 G;  1JT8 A;  4LF5 H;  1O7I A;  4L5T A;  4FF4 A;  2F0D A;  4R8I A;  2K52 A;  1GKH A;  5FLM G;  1EU4 A;  1IOW A;  3NSW A;  3H4D A;  1F9Q A;  4BY7 B;  4O4L F;  2UUA H;  4NLG A;  4AYB E;  1WFQ A;  1CKO A;  5EKL A;  2Q8T A;  3E5S A;  5KFY A; 
#chains in the Genus database with same CATH homology
 4JI7 L;  4A3F H;  1VQG A;  2LXK A;  4DV3 Q;  1E1T A;  4B3T L;  1WCM G;  2ID0 A;  1VQI A;  4JI7 Q;  3CC4 A;  3J7Z C;  4IO9 A;  1XPO A;  1JB7 A;  4B3T Q;  1L2F A;  1R9T H;  1SLJ A;  4JYA L;  1YEZ A;  2N78 A;  4IPG A;  2JA8 H;  3CCU A;  1T9H A;  2UU9 L;  4GLV B;  1VS0 A;  3M85 A;  4A3J G;  3CPF A;  1XPU A;  4JYA Q;  5K36 G;  2UU9 Q;  1M1K C;  1BBU A;  2K75 A;  1VQJ A;  4DV4 L;  1X3G A;  4GKK L;  3RLO A;  5GAE C;  5C4J H;  3U58 A;  1PA6 A;  3PSI A;  4OX9 L;  4LF7 L;  2E8G A;  3S17 H;  4DV4 Q;  1YIT A;  4GKK Q;  1LYL A;  4OX9 Q;  4QJF A;  4LF7 Q;  4C2M H;  4HJ8 A;  2B29 A;  2CWP A;  3K81 C;  4KHP L;  1X3F A;  1YIJ A;  1K73 C;  4H02 A;  1HZ9 A;  3D31 A;  2Q2T A;  1YJ9 A;  3MXN B;  4KHP Q;  2A1A A;  1Q81 C;  1IBL L;  3H0G H;  4DK6 C;  2OTJ A;  3HKZ E;  4POG A;  1VQM A;  2HIV A;  3I4O A;  4JI5 L;  5FLX c;  1IBL Q;  3ICE A;  4YCU A;  2D0P A;  4LF4 L;  4PZ7 A;  4A3G H;  1VQA A;  1I5F A;  3JC6 6;  4QGU A;  4JI5 Q;  4IJH A;  4OO1 I;  3UDG A;  4LF4 Q;  3KDF A;  4A93 H;  3M4P A;  3UDX A;  4BY7 H;  3OTO L;  1JJC B;  3TRZ A;  2OQK A;  4HJ9 A;  4UP9 A;  4YCW A;  2BA0 A;  2ZM6 L;  3H3V I;  3PO2 H;  5JJK A;  2E2H H;  2ZJR A;  4A3F G;  1VQ8 A;  2OTL A;  2R7D A;  3H3V H;  3AFP A;  4AYB G;  2ZM6 Q;  1D7Q A;  4R4C A;  3AYH B;  3JAM c;  1KRS A;  4BA1 I;  5GRO A;  1P8L A;  3B6Y A;  4B3M L;  2JA9 A;  2MO1 A;  1VQO A;  3HOX H;  1IL2 A;  1AE3 A;  2JA8 G;  3CCE A;  4BXX H;  1A63 A;  4B3M Q;  1PH4 A;  2ZTE A;  2QA4 A;  4DV1 L;  2Q2I A;  2CCZ A;  1N32 Q;  4JI3 L;  3M3Y H;  3GTQ H;  2R93 H;  4RG1 A;  4DV1 Q;  1V43 A;  1H95 A;  4JI3 Q;  4DR4 L;  2B63 H;  1PH1 A;  4L5R C;  5ELO A;  3F8T A;  4DR4 Q;  2ZTD A;  3F1Z A;  3KYH C;  1PH6 A;  1Q82 C;  5BR8 L;  5M5X H;  3J80 c;  1WI5 A;  2KBN A;  1OXU A;  4IOC A;  3HOV H;  5E7N A;  1EWI A;  4UP7 A;  2XGT A;  1PH8 A;  4BBR G;  5M3F H;  1SR3 A;  2KCT A;  3H0G G;  3K7U C;  2DGY A;  2IY5 B;  4MNO A;  1QVG A;  2NVX H;  3EIV A;  4GNX C;  3ULL A;  5HY6 A;  3CF5 A;  3CP0 A;  1VQ6 A;  4A3G G;  4NXN L;  1N34 L;  4BA2 I;  2WAQ E;  1G29 1;  3Q8D A;  2EQS A;  3KF8 B;  3PCO B;  4BY7 G;  4A93 G;  1Y1V H;  4OO1 G;  1N34 Q;  3GD7 A;  3RLN A;  2AHO B;  2UXC Q;  1ASZ A;  2JJQ A;  2E2J H;  3PO2 G;  5JJL A;  2AKW B;  2XTI A;  3CXC A;  1FJG L;  3S16 H;  4BBS H;  2UUB L;  1VQC A;  3CW2 C;  2RF4 A;  4GN5 A;  3RNU A;  1FJG Q;  1QUQ A;  4IFD I;  2PQA A;  2IHF A;  3HOX G;  5IYD H;  1QUQ B;  4TVA B;  3CC7 A;  4BXX G;  4AIM A;  1EQQ A;  4KLK A;  5JEA G;  2PQA B;  3PUV A;  1AE2 A;  3TRE A;  2QEX A;  1VQL A;  1OXV A;  2R93 G;  1TWA H;  1J6Q A;  1PYB A;  1YVC A;  1IBM L;  3CD6 A;  2HIX A;  2VL6 A;  3DM3 A;  2B63 G;  5M5W H;  5GAH C;  1IBM Q;  1I94 Q;  3TQY A;  2Q2U A;  1N8R C;  4X66 L;  4GOP C;  5LMN W;  3ULP A;  1Z9F A;  3HOV G;  2PI2 A;  1L0W A;  4DV0 L;  4GKJ Q;  4X66 Q;  4GN4 B;  2NN6 I;  1VQH A;  3KJP A;  5M3F G;  1EUJ A;  4DV0 Q;  1OXS C;  2JK8 A;  4JI0 L;  3ULJ A;  5IYB H;  1X54 A;  3G4S A;  1Q46 A;  3PIP A;  4JI0 Q;  4J15 A;  4YHH L;  3UE1 A;  3S14 H;  2OQ0 A;  1CSP A;  3BU2 A;  3I4M H;  4YHH Q;  1W2B A;  2MNA A;  3ER0 A;  4DPG A;  4OON A;  1Y1V G;  4JBM A;  3A5Z B;  4NPS A;  1IBK L;  1VQ7 A;  3FP9 A;  3M4Q A;  1KQS A;  4X6A H;  4A3K H;  4IPC A;  4ALP A;  1WYD A;  1IBK Q;  4BBS G;  2B3G A;  2CFM A;  4A3D H;  1K8A C;  3KFU A;  3D0F A;  5C0X J;  1BBW A;  2K5V A;  2WP8 J;  2A8V A;  2D62 A;  3MEF A;  3S1R H;  5EAY A;  1PYS B;  3DLL A;  4HJ7 A;  3CCL A;  1UWV A;  3E9H A;  5IYD G;  3K80 C;  4O0A A;  2OCE A;  1HR0 W;  3GDE A;  1NJI C;  2I0Q A;  4L5S A;  2YTY A;  3PIO A;  2WFW A;  2KEN A;  1MJE A;  5H1S E;  1XTD A;  3FKI G;  4JOI A;  1EFW A;  1PFS A;  2RHQ B;  4DKA C;  2VW9 A;  3WWV A;  4HIK A;  4JCV E;  1S40 A;  1E22 A;  4DV7 L;  1N36 L;  2I5H A;  3F2B A;  1NMG A;  1FGU A;  4A3L H;  1TWG H;  3TEH B;  1N36 Q;  2DUD A;  2JA6 H;  1MJC A;  3KOJ A;  3CCS A;  4C3J H;  1KC8 C;  2F4V L;  4PMW A;  4IFD J;  4BBR H;  2NN6 G;  3CMA A;  2F4V Q;  5IYB G;  4DAM A;  4Y52 H;  3BJU A;  3OYY A;  1KD1 C;  3CCM A;  1E1O A;  1X3E A;  1JJG A;  2CQO A;  4DK3 C;  1TWC H;  5FJ8 H;  2Z0S A;  3I4M G;  2ALY B;  3UE0 A;  1Y1W G;  1JMC A;  4L5Q A;  2AWN A;  4FDB A;  4LF6 L;  4YWM A;  3S2H H;  4A3K G;  1W3S A;  3G6E A;  4DUY L;  3OTO Q;  2BH8 A;  1A0I A;  3W5O A;  1U0L A;  3GO5 A;  4A76 A;  1Q7Y C;  2I5L X;  3RLF A;  4LF6 Q;  4A3D G;  4DUY Q;  4A3M H;  2Y0S E;  1YHB A;  5LMN L;  1Q1B A;  3S24 A;  1N33 L;  1PH9 A;  1VQ5 A;  5LMN Q;  1N33 Q;  2GVB A;  5LMU L;  1PH3 A;  1UE1 A;  4R4O A;  4LNQ A;  5LMU Q;  1HZA A;  2GN5 A;  2NVT H;  4LF5 L;  1SN8 A;  3CC2 A;  3KF6 A;  4GLX A;  1X9N A;  3RN2 A;  1YZ6 A;  4LF5 Q;  3F2C A;  4YWL A;  2VUM H;  3GTO H;  1YHA A;  4A3L G;  5GAG C;  5IP9 H;  1A8V A;  4P75 A;  4DR7 L;  3KF6 B;  1QVF A;  2JA6 G;  5C0X I;  1TXY A;  1WOC A;  2I5M X;  4DR7 Q;  3PUX A;  1L1O A;  5BR8 Q;  2ES2 A;  1C7Y A;  3M7N A;  2IX1 A;  1Q8K A;  4C3H H;  3S2D H;  1E3P A;  4C3I H;  1KXL A;  3PF5 A;  1L1O B;  4QIW E;  1GO3 E;  1HNZ L;  5DLQ E;  1KHI A;  5FJ8 G;  1XMO L;  3GTL H;  4EX5 A;  1HR0 L;  4LF9 L;  1I50 H;  2ZTC A;  3BZC A;  3SGI A;  1XMO Q;  4DR6 L;  3T1Y L;  4LF9 Q;  4APV A;  4GN3 B;  1WJJ A;  1HR0 Q;  2UUC L;  4NXN Q;  1YHQ A;  4A3C H;  4DR6 Q;  2R92 H;  3T1Y Q;  3J7A 5;  2ASB A;  1YJW A;  1U5K A;  1X65 A;  3I7F A;  1KRT A;  3T1H L;  4A3M G;  1Z47 A;  2UUB Q;  4Y7N H;  3GTK H;  3T1H Q;  3PUZ A;  3PV0 A;  3EN2 A;  4QQB X;  1P16 A;  3RZO H;  2Y0S G;  2VZA A;  3J81 i;  4B3R L;  2MQH A;  3HOW H;  2JEB I;  4P71 A;  2IT1 A;  1K8G A;  1NE3 A;  4LWC A;  1I3Q H;  3M4O H;  4DAY B;  3FKI H;  4GNX B;  3S1N H;  5IE8 A;  5ELN A;  4LFB L;  1ASY A;  3U4V A;  2VUM G;  1I6H H;  2Z6K C;  3ZJY C;  5IP9 G;  2CWA A;  4LFB Q;  3A5U A;  3A0J A;  1GD7 A;  2QGQ A;  1XNQ L;  1YI2 A;  3L7Z C;  4GS3 A;  3L2P A;  2K5N A;  1IXR A;  2NZO A;  3CME A;  3OW2 A;  3ERS X;  1XNQ Q;  2ATW A;  3LGJ A;  3M9B A;  2KHI A;  4JBW A;  1QZH A;  3RZD H;  1IZ6 A;  3AFQ A;  4MTN A;  3F2D A;  4HIO A;  1G51 A;  3NEL A;  2N49 A;  1Y14 B;  4A3I H;  1YBY A;  1SMX A;  1Y1W H;  4YWK A;  3RR5 A;  3U50 C;  1KL9 A;  4A75 A;  4DR3 L;  1BVS A;  5M3M H;  1K3R A;  1MKH A;  4A3C G;  3FHW A;  2R92 G;  4DR3 Q;  3NEN A;  4RMF A;  4DR1 L;  4LF8 L;  2YTX A;  1CUK A;  2MFI A;  4A3E H;  1V9P A;  2H5X A;  2L15 A;  4P72 A;  4DR1 Q;  1TWF H;  3VDY A;  4LF8 Q;  2WB1 G;  4R4T A;  2LSS A;  1YJN A;  2BA1 A;  2HT1 A;  2R7Z H;  1SRO A;  2IHE A;  4IFD G;  5JJI A;  1J5E L;  4OWW B;  3W1G A;  3TS0 A;  2E2I H;  3RN5 A;  4JBK A;  3AEV A;  3HOY H;  4K0K L;  4LUV A;  4HIM A;  4JI1 L;  1J5E Q;  4B3S L;  3HOW G;  4K0K Q;  2PNH A;  2KCM A;  3E9I A;  4P74 A;  2HQL A;  1VQF A;  4OWT B;  4JI1 Q;  4B3S Q;  1OXT A;  3PO3 H;  1NBW A;  3AQQ A;  3STB C;  4JI2 L;  4DNI A;  3CCQ A;  3TS2 A;  4JOI C;  2AWO A;  2N3S A;  2K5H A;  4JI2 Q;  1NTG A;  4JC0 A;  1VCI A;  1Q1E A;  3KJO A;  1Q12 A;  1Q86 C;  4A3B H;  2VQE L;  4UP8 A;  4AQY L;  2YYZ A;  4WJ4 A;  4DV7 Q;  2YTV A;  1G6P A;  2PI2 E;  2VQE Q;  4AQY Q;  1UEB A;  1CSQ A;  1B7Y B;  1PH7 A;  2VY3 A;  4JI4 L;  1PH5 A;  1B8A A;  1HZC A;  4JI4 Q;  2OWO A;  2LXJ A;  1RL2 A;  2IX0 A;  3CCR A;  4A3I G;  1XMQ L;  1GM5 A;  1X56 A;  4KHZ A;  1CKM A;  1C9O A;  1B70 B;  1LTL A;  4IPD A;  5HGQ A;  1E7Z A;  4X64 L;  1XMQ Q;  1KAW A;  3L0O A;  2NVY H;  1PV4 A;  3S1Q H;  4X64 Q;  1OTC A;  5M3M G;  3PUW A;  4DV2 L;  4TQU S;  1VQN A;  1UE7 A;  4A3E G;  4DV2 Q;  4OWX B;  4LW1 A;  2C35 B;  4XTC S;  4DV6 L;  5AJ3 L;  3CPW A;  1UE6 A;  1K9M C;  4LFA L;  4PZ6 A;  3JAM i;  1D8L A;  5C4X H;  2EXD A;  2RCN A;  4DV6 Q;  5AJ3 Q;  2R7Z G;  3HOZ H;  4IJL A;  4PZ8 A;  3CQZ H;  3U4Z A;  3HOY G;  3BZK A;  3STB D;  1EOV A;  2UXB L;  4DUZ L;  3I4N H;  1S3O A;  1TWH H;  2UXB Q;  1EYG A;  4DUZ Q;  5IYC H;  3PO3 G;  4JV5 L;  4HID A;  1HH2 P;  3NBH B;  3UDF A;  2JA7 H;  4YCV A;  4JV5 Q;  2YV5 A;  1VQ9 A;  4HJ5 A;  5C3E G;  4HJA A;  1C0A A;  4A3B G;  2JEA I;  2NVQ H;  1K0R A;  1LUZ A;  2CKZ B;  2RHS B;  3J80 i;  4DR2 L;  1CKN A;  1K83 H;  2Q2H A;  1LM0 A;  2GVA A;  3KDF B;  1PVO A;  1VQB A;  4DR2 Q;  2F52 A;  1S72 A;  4IPH A;  3I55 A;  3G48 A;  4NXM L;  1CKN B;  3J81 j;  2ZJQ A;  2UUA L;  4PG3 A;  1EQR A;  1L1O C;  1HZB A;  4DR5 L;  4NXM Q;  4LUZ A;  4OXP A;  2UUA Q;  1NMF A;  2NZH A;  4WJ3 M;  1FL0 A;  4JI8 L;  1N32 L;  2K4K A;  1HNW L;  4DR5 Q;  4KI0 A;  4JI8 Q;  5C44 H;  3GTP H;  2VNU D;  1HNW Q;  4JI6 L;  1HNZ Q;  4YY3 L;  4XIG S;  1RIP A;  3HOU H;  4JI6 Q;  2WB1 E;  1XPR A;  1IYJ B;  2MO0 A;  3HKS A;  2FXQ A;  4YY3 Q;  1KIX A;  2JA5 H;  4BY1 H;  2UUC Q;  1DGS A;  4DV5 L;  2AMC B;  3PF4 A;  5C4X G;  4DV5 Q;  1QZG A;  5IT9 c;  3HOZ G;  4P73 A;  5IP7 H;  5IY0 A;  2HHH L;  2YU9 H;  5M5Y H;  1EIF A;  2K50 A;  3I4N G;  3HFZ B;  4NB3 A;  4GNX A;  4R1J A;  1VQK A;  2HHH Q;  4QL5 A;  2VS1 A;  4O2D A;  2V1C C;  3K8A A;  1HJP A;  4JG2 A;  5IYC G;  5FLM H;  2VQF L;  4B3R Q;  1V1Q A;  3I2Z A;  2JA7 G;  3HKZ G;  2VQF Q;  2UXC L;  4X65 L;  2ZJP A;  3W1B A;  1VQP A;  2KHJ A;  4X65 Q;  1X55 A;  4MZ9 A;  4UY8 C;  5C3E H;  1XNR L;  4UPA A;  3S1M H;  4R4I A;  3GTJ H;  2F3I A;  1UE5 A;  1WCM H;  1GVP A;  2A19 A;  1VQE A;  3K7A H;  5C0X G;  1XNR Q;  1A62 A;  3E0E A;  3A74 A;  3CCJ A;  1SE8 A;  5GAD C;  4AH6 A;  1M90 C;  2EIF A;  1MIU A;  4JBJ A;  3K0X A;  1EIY B;  1QVC A;  4A3J H;  3J81 c;  5C44 G;  3G71 A;  1PH2 A;  3CAM A;  3GTM H;  2E5L L;  1E24 A;  1VQD A;  3S15 H;  1YNX A;  3IRB A;  1SFO H;  1JJ2 A;  1I94 L;  3HOU G;  2Z6K A;  3PGZ A;  5J3B A;  3I56 A;  1VQ4 A;  1PHJ A;  2E5L Q;  4IOA A;  4BY1 G;  1JE5 A;  4GOP A;  2JA5 G;  1X6O A;  2K14 A;  3KLW A;  4GKJ L;  1FVI A;  3H15 A;  2D0O A;  1HNX L;  5GQO A;  2UXD L;  4GLA C;  1OXX K;  4GOP B;  1AH9 A;  1BKB A;  1HNX Q;  4A4I A;  2BH2 A;  5IP7 G;  2UXD Q;  1JT8 A;  1XJV A;  4LUO A;  4EQ5 A;  1O7I A;  2R7F A;  4L5T A;  4R4Q A;  1SRU A;  3PUY A;  5JEA J;  1N9W A;  2K52 A;  1GKH A;  3CCV A;  2R6G A;  1NY4 A;  5FLM G;  3NEM A;  4LFC L;  4ME3 A;  4X62 L;  2JE6 I;  2N8N A;  5IWA L;  4POF A;  3GTG H;  2PMZ E;  4LFC Q;  4AYB E;  4X62 Q;  1WFQ A;  3EBE A;  5IWA Q;  1CKO A;  2JQO A;  3UDI A;  4DV3 L;  2WAQ G;  4LFA Q;  4QY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...