4QJFA

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
186
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKKKAKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase, subunit E'
total genus 40
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qjfA02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qjfA01
4DV0Q 1XNQQ 1WFQA 1EYGA 4DPGA 1IBMQ 2OQKA 4KHZA 3OYYA 2HT1A 3KYHC 3J81j 1PYBA 2ZM6Q 4DV1Q 3W1BA 4UP7A 3I4MH 1NTGA 1EQRA 1OXXK 2ZJPA 1AE2A 4IPGA 2K50A 3ICEA 5IYDG 2QA4A 3HOWG 4A3BG 4BY1H 4GKJQ 2PQAA 3H0GG 4DUZQ 2L15A 2R7FA 2OQ0A 2BA0A 5JJIA 2VZAA 2HHHL 4R1JA 3CCEA 4GOPC 5FJ8H 2JEBI 4A4IA 1VQAA 3I4NG 4A93H 1P8LA 1UE5A 4IOCA 4JI5Q 3JAMi 2EXDA 1N34Q 2A8VA 2ZM6L 1TWGH 4DV1L 3HOYH 2B3GA 3GDEA 4H02A 3CMEA 4DAYB 3CAMA 4DKAC 3CC7A 1YIJA 2JA7H 1W3SA 2WP8J 2JA8G 4B3RL 4YWLA 2NZHA 3TRZA 2DGYA 5GROA 3D31A 3IRBA 4BA2I 2XTIA 4L5QA 1VQ7A 2LSSA 2IY5B 3AFPA 3S1MH 4YWMA 1XTDA 2XGTA 4BBRG 4DV2L 4IFDJ 4QL5A 1X3EA 5IYCH 1HNWQ 1N33Q 2V1CC 2N3SA 3H15A 3G6EA 1U0LA 4DV7Q 4JYAL 3GTKH 4A3LH 1I6HH 1CKNB 3HOVH 1TWCH 2R92G 2MNAA 3S1RH 2UU9Q 4NXNL 4R4TA 5FLXc 4P75A 2YV5A 4C3JH 5C0XI 5C0XG 3PO3H 4UY8C 1QUQA 4LF9L 3S2HH 1VQGA 1Q46A 1ASYA 4YY3Q 4B3RQ 1OTCA 1VQ4A 1IYJB 4BXXH 3H0GH 1Q1EA 3RN5A 1VQOA 1VCIA 4JYAQ 1G51A 3KDFB 4A3KG 1K3RA 2HIXA 3A5UA 5M3FH 4DV2Q 4DR1L 1YITA 2R7ZH 4X66Q 4JI6L 2B63H 3FP9A 1GVPA 1XNRQ 3FKIH 4NPSA 2IX0A 1D7QA 3GTGH 5H1SE 4LFCQ 2JA5G 1EWIA 1FVIA 3K7UC 3VDYA 4LF6Q 1I5FA 1QZHA 5E7NA 4JI4L 4DR4L 3J7ZC 3K81C 2Y0SE 2K5NA 2N78A 2KHJA 1IZ6A 4POFA 3I7FA 1PV4A 3MXNB 2KBNA 1WOCA 4QJFA 2Q2IA 2IX1A 3UE1A 5FJ8G 5ELNA 4C3HH 3T1YQ 1DGSA 4A3DG 4A3EG 5JJLA 1FL0A 4IO9A 4DUYQ 2VQFQ 1B70B 4HIDA 1HZCA 4LUOA 3UDXA 1J5EL 4GLAC 1TXYA 2UXBL 5K36G 1OXTA 1B7YB 2OTJA 1N36L 4JBMA 1P16A 1X55A 1C9OA 4GKJL 3PO2G 1EFWA 1SFOH 1PYSB 4R4CA 3TREA 1YJNA 1PH6A 1KHIA 1NJIC 3U4ZA 5IWAL 1Q82C 4DV5L 1N8RC 1Y1WG 4AQYQ 3CC4A 3S2DH 4KHPQ 4PG3A 3T1YL 4AYBE 3NBHB 4JOIA 4A3GH 4DV6L 1LUZA 1O7IA 1AE3A 2JA7G 3S15H 1TWAH 1CKOA 3CW2C 3KDFA 3RNUA 3TS0A 2JEAI 5C4JH 2WB1E 1HR0W 3S14H 4K0KL 3KF6B 1HZ9A 3KF8B 1IBLQ 2OTLA 3M3YH 4RMFA 1CSPA 1I94L 2PI2A 4R4QA 1IBKL 3PUZA 4NB3A 1BBWA 1VQHA 2JQOA 3E9IA 1S40A 3ER0A 5C0XJ 3H3VI 3I2ZA 3L2PA 2I5HA 2GN5A 2F3IA 3HKZE 3EBEA 4LF5L 1Z9FA 3RLNA 2QEXA 3CCRA 1EOVA 3U58A 4OO1G 4OO1I 2K75A 5IYDH 4KHPL 2GVAA 1A62A 2UXDL 2ATWA 1JE5A 3J81c 1Q1BA 1Q81C 2B29A 4IJLA 3FKIG 1CKMA 4L5RC 1YZ6A 2Q2HA 3I4OA 1UWVA 4DV0L 4A3MH 2NN6G 2NN6I 1KD1C 4NXML 2HQLA 2UXCL 1HZAA 4K0KQ 1UE1A 4DV7L 1S72A 1AH9A 4AYBG 3W5OA 5ELOA 4X62Q 4APVA 4HJ8A 5J3BA 1YJ9A 4JI1Q 1PHJA 2ZTDA 4AQYL 4TQUS 4UP8A 5IP7H 3K8AA 4JV5Q 4C2MH 5LMNQ 1L1OC 4LFAQ 4JBKA 2KCMA 3Q8DA 5JEAG 4BBSH 1XMQL 1MIUA 2E2IH 4A93G 4LNQA 3PO3G 4OWTB 1HNZL 5C4XG 1J5EQ 3J80i 4L5TA 2UXCQ 3K80C 3HKZG 3ULPA 1VQ5A 3PF5A 1N34L 2JK8A 4HJ5A 4DR7L 1XMOL 1FJGL 2F4VL 1N32L 5FLMG 5LMNW 2YU9H 5IYBG 3CPWA 4DV4Q 1E1OA 1A0IA 2R6GA 5IP7G 3S1QH 3RN2A 1LYLA 1YHBA 3MEFA 4A3MG 5HY6A 4HJ7A 3HOUH 3CP0A 1VQLA 4IOAA 1KQSA 4YCWA 4B3MQ 4P74A 1N33L 4DR4Q 2VUMH 1PFSA 3GTLH 3E9HA 1MJCA 4OONA 1SE8A 4PZ7A 4GOPA 1QVCA 5HGQA 4BXXG 4A3EH 1D8LA 1XMQQ 3BJUA 2MFIA 2A19A 4TVAB 4A3KH 1IBKQ 1RL2A 2UU9L 1HH2P 1GM5A 3CD6A 1XJVA 4A3IH 3HOZG 1L2FA 2BH8A 2VY3A 5M3MG 2NVXH 5C44H 1VQKA 1SROA 3LGJA 2JA9A 4IPDA 1LTLA 4XIGS 5C3EH 4YY3L 1YJWA 1LM0A 1PH2A 1XNQL 4JC0A 3G48A 4JG2A 5BR8L 1PVOA 4X65L 2ZJQA 4B3ML 1WJJA 4BY1G 1VQCA 2E5LL 1UE7A 3PSIA 3A5ZB 4GLXA 2AKWB 1NE3A 3J80c 1PA6A 4HIMA 3PV0A 2ZJRA 2I0QA 1JJ2A 4JI5L 3GTQH 3M4OH 3BZCA 5GAEC 4GKKQ 1C7YA 1VQ8A 2HIVA 1YNXA 2K4KA 1Q8KA 3KJPA 2CQOA 3CCUA 4LF6L 2YYZA 4EX5A 3RZOH 3D0FA 4R4IA 4A3JH 5AJ3L 2R93G 4ME3A 2ZTCA 4PMWA 4P71A 1G291 4PZ6A 5GAGC 4B3SL 5BR8Q 3BU2A 1K8GA 4A3FG 3HOVG 2MO1A 2ID0A 5JEAJ 4OX9L 4A3JG 1OXSC 1X6OA 4IPCA 4X64Q 4DUYL 2RHQB 4A75A 1GKHA 5LMUL 3EIVA 1KIXA 2F52A 1BVSA 1JMCA 1K9MC 1Z47A 3NELA 4DK3C 4GNXC 1HNXQ 4JI8Q 1BKBA 1YHQA 1EUJA 4RG1A 2JA6H 2RCNA 3BZKA 1IXRA 1HR0Q 2H5XA 3NEMA 2DUDA 2R7ZG 4BA1I 4YCUA 4X64L 3A0JA 2VQFL 1WCMG 1MJEA 3DM3A 3HOUG 1QVFA 2WFWA 4OX9Q 1UE6A 4X66L 4JI6Q 2FXQA 4A3CH 1IBML 2UUCL 4DR5Q 2UUAL 2Z6KC 3CQZH 4C3IH 1Y1VG 2VQEQ 2K52A 2K14A 3F2CA 1NY4A 4JI3Q 3F8TA 3M85A 3JC66 4JI4Q 2OCEA 3OW2A 2UXDQ 4JI0Q 4X6AH 1VQDA 2R7DA 1VQFA 1EQQA 1C0AA 1T9HA 3FHWA 3ULJA 2R92H 5M5YH 3I4MG 3AFQA 4NXMQ 2I5MX 2JJQA 1XNRL 1YHAA 2ASBA 4GNXB 3GTPH 1Q7YC 1VQPA 3I56A 3GTOH 1L0WA 1NMFA 3PF4A 4L5SA 1I94Q 2B63G 4IJHA 3A74A 2Z6KA 3EN2A 2JA6G 3CCSA 1YBYA 1SMXA 1HJPA 3ERSX 1VQMA 4LF8L 2NZOA 2Q2UA 3J7A5 4ALPA 3GTMH 4DR6Q 4JI3L 1CUKA 2RHSB 4MNOA 3TS2A 3L0OA 4PZ8A 3RZDH 3T1HL 1TWFH 4YWKA 5LMNL 5IYBH 4DV6Q 3UDFA 1VQBA 2I5LX 4JOIC 2PQAB 3F2DA 3CCMA 2Y0SG 1JJGA 2VL6A 1JT8A 1N36Q 3OTOL 5C44G 1HZBA 2E5LQ 3S17H 1CSQA 1E7ZA 3G4SA 1JJCB 3U4VA 3W1GA 3RR5A 4DR6L 1KAWA 3KJOA 5IWAQ 1HNXL 3KF6A 2NVTH 1TWHH 1MKHA 1VQJA 1K83H 1A8VA 2PNHA 3PUVA 4DV4L 4DUZL 2AWOA 1NBWA 3PIOA 3U50C 2CKZB 3F2BA 3RLOA 3M7NA 4MZ9A 3KLWA 4GN3B 1A63A 3HFZB 1KXLA 1WCMH 4FDBA 1QZGA 4LF7Q 4QQBX 3G71A 2YTXA 1WYDA 4WJ4A 5GQOA 2N8NA 2E2HH 2OWOA 1VS0A 1HNZQ 1V43A 5IT9c 1KL9A 2JE6I 4LUVA 4KLKA 5EAYA 4B3SQ 1GO3E 3SGIA 4JBJA 5C4XH 4DV3Q 2NVQH 3DLLA 3K0XA 1XPRA 4GNXA 3S24A 1VQ9A 4JI7L 1PH5A 3I4NH 1QUQB 4P72A 1PH7A 2BH2A 4KI0A 4JI1L 3TEHB 5C3EG 3H3VH 1H95A 4JV5L 5JJKA 4BBSG 3GO5A 2VNUD 1V9PA 4QIWE 4X65Q 4O0AA 1X54A 4DR3Q 1G6PA 4LF7L 2MO0A 1N9WA 2E8GA 2E2JH 4OWWB 2D0OA 1Q12A 1M1KC 3E0EA 5GADC 4BBRH 2MQHA 1VQIA 1M90C 2CCZA 1K8AC 4A3CG 4YCVA 2K5VA 4J15A 2ALYB 1KC8C 4DR7Q 3CXCA 2JA5H 5GAHC 4DR5L 2AMCB 2UUAQ 4LF4Q 3KOJA 1IL2A 3PCOB 3ZJYC 2WB1G 1W2BA 2AHOB 1JB7A 4Y52H 2IT1A 2PMZE 1YI2A 2CWAA 3UDIA 4LFAL 1FGUA 4JCVE 3WWVA 1HNWL 3M4QA 4DV5Q 1NMGA 3TQYA 3PGZA 4BY7H 2QGQA 1R9TH 2A1AA 2PI2E 3F1ZA 2UUBL 4JI2Q 4QGUA 1I50H 1YVCA 4O2DA 4P73A 2WAQE 4A76A 4POGA 3I55A 4WJ3M 4YHHQ 4A3LG 2EQSA 3HKSA 4BY7G 4A3IG 3HOZH 4LF9Q 1BBUA 2Z0SA 4GOPB 3M4PA 1ASZA 5IY0A 1X9NA 1I3QH 3GTJH 3J81i 3STBD 2Q2TA 4GN4B 2BA1A 4LF4L 1Y14B 1SR3A 1FJGQ 2ZTEA 2F4VQ 1N32Q 1E1TA 3KFUA 3B6YA 1Y1WH 5IP9G 1PH9A 3CCJA 1E22A 1PH1A 4UP9A 1OXUA 3ULLA 2IHEA 2VS1A 5M3FG 4OXPA 4GS3A 2EIFA 1J6QA 4LFCL 5IP9H 5FLMH 2VW9A 3PO2H 1VQEA 2KCTA 2KHIA 5M5XH 1E24A 1L1OB 1UEBA 4GLVB 4AIMA 3CCVA 2IHFA 2GVBA 2VQEL 1SN8A 3UDGA 1XPOA 4DK6C 4X62L 4EQ5A 4R4OA 3CCLA 2CFMA 4LFBQ 2LXKA 2WAQG 4HJ9A 2YTYA 4GN5A 3PUXA 1EIYB 4A3FH 4LUZA 3AQQA 2HHHQ 4LW1A 1VQNA 3PUYA 3RLFA 3S16H 2UXBQ 1L1OA 3CPFA 1K0RA 4AH6A 1X3FA 4YHHL 3S1NH 4LF8Q 4DR2L 4B3TQ 1CKNA 2C35B 3JAMc 1S3OA 3STBC 3PIPA 2VUMG 4A3GG 4GKKL 1B8AA 1QVGA 3CC2A 3HOWH 1RIPA 4IPHA 4JI7Q 4HIOA 1XPUA 2K5HA 1VQ6A 3AEVA 1OXVA 4JI8L 1SRUA 3HOYG 2JA8H 5M5WH 3T1HQ 4DV3L 1XMOQ 3M9BA 4QY7A 5AJ3Q 1YEZA 2NVYH 3PUWA 1GD7A 1X3GA 2LXJA 2N49A 1X56A 3HOXH 1K73C 4LWCA 1PH3A 1PH4A 4OWXB 5IE8A 4IFDI 4HJAA 1Q86C 4IFDG 2RF4A 4LFBL 2AWNA 3OTOQ 3NENA 3CMAA 1IBLL 2CWPA 1KRTA 4Y7NH 4HIKA 4DR1Q 4DAMA 1SLJA 1V1QA 3GD7A 4DNIA 3CCQA 4DR3L 4NXNQ 4DR2Q 2UUCQ 4B3TL 2YTVA 3L7ZC 4XTCS 4A3DH 2D0PA 5M3MH 2R93H 4JBWA 3AYHB 1E3PA 1X65A 5LMUQ 3CF5A 2KENA 4LF5Q 1PH8A 3HOXG 1U5KA 4A3BH 1WI5A 3K7AH 4UPAA 1KRSA 4JI0L 1EIFA 2D62A 1HR0L 1Y1VH 4MTNA 5DLQE 3UE0A 5IYCG 2ES2A 4JI2L 2UUBQ
chains in the Genus database with same CATH superfamily
4DV0Q 1WFQA 3I73A 1IBMQ 4KHZA 3KHRA 3OYYA 3KYHC 2ZM6Q 4DV1Q 3W1BA 4TUYF 1ET6A 1EQRA 3K0YA 1CQIB 1AE2A 1YNND 1PTOH 3HOWG 4BY1H 2PQAA 3QWNA 3H0GG 2PN1A 4HAEA 5DG9A 4G7OC 1XMQH 5M5WB 5CV8A 1Z2NX 3BA9A 5JH7F 2XWBB 4EGVA 2DLNA 3VPBA 4IURA 3CCEA 3NUCA 1WD0A 1LV9A 1Z7TA 1Y8OB 4A4IA 1P8LA 5IT9L 3HZXA 1DV2A 2KUMA 3RB0A 2EXDA 2A8VA 3PZPA 4JI6H 1TWGH 3ND8A 4ULLA 3HOYH 4H02A 4Q0YA 3NTIA 1YIJA 3CAMA 4DKAC 2F0GA 4ZUJA 5C5MA 2HVSA 2DGYA 2BE5C 1KAAA 4L5QA 2IY5B 3MA2B 5C5LA 2XGTA 4GKJH 4IFDJ 5IYCH 2EY1A 4NLGA 4B3TH 2HJWA 4A3LH 3GTKH 2YU9A 2PBZA 5L1IA 2A68D 3C3LA 4RUAA 4DL3A 1TWCH 4A3DB 2MNAA 2UU9Q 1TWGB 5JUMA 4NXNL 3TQ1A 2H4OA 3TP8A 2G9DA 5FLXc 4P75A 5C0XI 5C0XG 4UY8C 1Q46A 1RKNA 4YY3Q 4UCTA 1VQ4A 1IYJB 2R7ZA 2FHTA 1A3UA 4HMJA 1EY0A 1VCIA 2JA7A 3KDFB 2F0UA 1PTOF 5M3FH 1CQJB 2AQ1B 3C46A 2B63H 1XNRQ 1V1PA 4HNVA 4Q43A 3LNNA 4NMZA 5H1SE 3H20A 2JA5G 4ECRA 4IALA 5KFVA 5E7NA 3K59A 2K5NA 2N78A 5DM63 3OWFA 1IZ6A 1ICFB 1ZEQX 3RMHA 4LK1C 5L1KA 3UE1A 4XXEA 3BABA 3T1YQ 1Q8IA 1DGSA 4A3DG 2B63B 5IT9E 1B04A 2F0LA 2VQFQ 1HZCA 1AN7A 3SHLA 4CC6A 4GLAC 5K36G 2UXBL 1N36L 4KKTA 5FO8B 1C9OA 2R86A 1XXGA 1PYSB 2O2LD 4R4CA 1JKJB 2VUGA 4QWAA 2AQ3B 3U4ZA 1Q82C 3U9TA 1FD7D 4OGQC 5K5PA 4ZYSA 3CC4A 4KHPQ 2LFNA 3K5HA 5LA6F 4AYBE 5FPOA 5KG3A 2A69C 4DV6L 2FPPB 5JVLA 4G57A 2FJ2A 5DAUA 5C4JH 3EROA 4K0KL 4UFZA 2C2DA 3KF6B 2OTLA 1IBLQ 3GTLA 2JP1A 1QNUA 3U9SA 2R7ZB 2X0SA 3GTQB 4YQWA 2KOLA 2VQDA 1QE6A 2SNSA 3E9IA 3ER0A 4IZ8A 2V4QA 1L0XB 5C0XJ 4E4TA 5KFBA 1JWUD 3BQ2A 3GTJA 5EWEA 2QEXA 4QW9A 4O2AF 1Q90A 3KF8A 2P0AA 2UXDL 2W7OA 3KK7A 5KFWA 2ATWA 1HXYD 1QG7A 1Q81C 2B29A 4O3OA 1STHA 4IJLA 4B08A 4L5RC 1YZ6A 1UWVA 2NN6G 2NN6I 3I4MB 2HGSA 1C30A 1HZAA 2O03A 4DV7L 1RTNA 1AH9A 4AYBG 3H4BA 5ELOA 2E2DC 2B63A 4N9TA 2ZTDA 3K5MA 3V6JA 1WCMA 2F0JA 1XDNA 4CJ1B 5KG1A 3HOUB 4ZKBB 1T94A 4GKKH 1KNEA 3R5HA 1JIHA 1IKMA 4J6HA 1XMQL 4MA0A 2E2IH 1UNNC 3PO3G 5T14A 4CGYB 3VR3A 4X66H 1HNZL 1O7YA 3NBIA 3GV3A 2HVRA 4K8JA 4FXKC 3VR2A 4MV8A 2UXCQ 4ODGA 5CV7A 1UUPA 1N34L 4HJ5A 5EJWA 2F4VL 3RZOB 3BDCA 5FLMG 3HB9A 3QR8A 3QIAA 3HOUH 4CKCA 1KQSA 1II3A 4P74A 4DR4Q 1B3AA 2R8KA 1PFSA 4IR9A 4PZ7A 3HG9A 1D8LA 3S1RB 4ETSA 1EZ6A 2HDLA 3NWTA 3OHXC 3TP6A 4A3EB 1HH2P 1MI2A 4A3IH 4LF4H 2Q8TA 2VY3A 5M3MG 2PZWA 5C44H 1VQKA 1SROA 1K1QA 1KLUD 2JA9A 3N43B 4IPDA 1PH2A 4U7CA 5C3EH 2PMZA 1YJWA 1NAPA 1XNQL 4JC0A 4QWEA 1PLFA 4X65L 3A54A 2ZJQA 4B3ML 1WJJA 4BY1G 1VQCA 1KABA 1IL8A 1UE7A 1GUTA 3PSIA 1WVLA 1ZHQA 4J9KA 1NE3A 3L3OC 2PW5A 5KNBA 3M4OH 4TV9F 2M2LA 4P2CB 3I4NB 3WDNA 1PXUA 5CV9A 5E4WC 3KJPA 2CQOA 2YYZA 3E5NA 1S5DD 5EPKA 1RK6A 4XT3B 4EBCA 3D0FA 4R4IA 4A3JH 2R93G 2ZTCA 4RKLA 4C3HB 3G6XA 2B2TC 4PZ6A 5GAGC 4B3SL 1EQTA 4A3FG 3UQ8A 2XGQA 4I4TF 3MFHA 1JQYD 3GTGA 3M4OB 1TWAB 1KC7A 1KBLA 1GKHA 1KIXA 3EIVA 2MHVA 2A6HC 4KY6A 4JV0A 3HOYB 2C5CA 1Z47A 4C5CA 5A35A 2DY8A 1U9RA 1YHQA 2UVUA 5KKNB 1AFPA 1JORA 1TWHA 2YZGA 1M8AA 2J6TA 4KV6A 2DUDA 1PRTB 2R7ZG 4BA1I 3BYTB 3CHBD 2E75C 1TS5A 4IN3A 1QVFA 1UE6A 3MEHA 4X66L 4JI6Q 5IGFA 2AGPA 4DR5Q 3CQZH 2QYZA 1G8ZD 2W9CA 3LX0A 5KG6A 2R8IA 2H1EA 2YU9B 5E3FA 3CRKC 2UXDQ 4X6AH 1EQQA 3C1FA 2L55A 4IZOA 4EG0A 4JI7H 3ULJA 5M5YH 3I4MG 1S68A 1RCVD 3OMCA 3RFCA 1VQPA 1Y8PB 2C00A 4DK0A 4JI2L 1K1SA 3AB9A 1I94Q 1B44D 3A74A 2FJZA 2ZDGA 3EN2A 3MVVA 3GTPA 4JVZA 1YBYA 3OOCA 4JI3H 1C8CA 2LS01 5BR8H 2Q2UA 3NWSA 2ALZA 4K5XA 1BBXC 1BXTA 2B2YC 2CH4W 3T4AC 5FKAC 3RZDH 3T1HL 1Y1WB 2PYKA 4QWCA 4JOIC 5KYIA 5BN4A 1WTPA 1N36Q 2E5LQ 1EUCB 5IIFA 3J7AV 2R8JA 3G4SA 3U4VA 4KD3A 3SE0A 3KJOA 3KF6A 2XWJB 1VQJA 4XYLB 3IKJA 3PUVA 4RB0A 4DV4L 4DUZL 3FMAA 3PIOA 1DOKA 1PMRA 3U50C 4EFBA 2W7PA 1I6UA 4IRKA 5I2XA 4MZ9A 5DGBA 4Q44A 1WCMH 3SVMA 4LF7Q 5LYJF 4KTAA 5EWFA 4DV0H 5M3MB 2JE6I 3TIGA 3FKIB 5DM73 1JOQA 1E2WA 1XPRA 3CKIB 1VQ9A 2WIIB 4XDXA 1PH5A 4JI7L 4FM9A 1GUWA 3MR3A 3TEHB 2WKCA 1JDEA 5KFDA 2EJGC 1H95A 3M9OB 2NVYA 3V2TA 4JV5L 2KECA 5F2DA 3H4DA 4J9RA 3RAQA 1DCZA 2VNUD 1KJ8A 4DXFA 1EUDB 5KFAA 1RHPA 4DR3Q 1A3TA 3GTQA 1B50A 5KFFA 2E2JH 2FINB 4OWWB 2WYOA 1J5EH 4A3CG 3TMEA 2CCZA 2W6OA 1B6SA 3M9NB 1KC8C 2R93B 4A2BA 5GAHC 2UUAQ 2W9BA 1IL2A 5TSSA 4GC7A 1JB7A 2IT1A 5KIXA 3VA7A 4A3FB 3JRWA 4JCVE 1O7LA 2R87A 1PRTD 4DV5Q 3MR2A 4ECVA 1R4QB 1CZGA 3PGZA 2V9WA 3F1ZA 4YJ2F 4E6IA 4O2DA 3T5KA 4P73A 4K14A 3C2PA 4WJ3M 4CKEA 4A3LG 2EQSA 3HKSA 4ZUIA 4BY7G 5C6AA 2K6AA 5DEHA 2Z0SA 3NK9A 5J22A 1ASZA 2PPBC 5T1GA 1X9NA 2RSOA 2XRSD 4L6TB 1S9FA 4J9QA 4HMIA 3STBD 4EQNA 1IKLA 2BA1A 3H91A 2JA6B 1O75A 1H9JA 1K28A 2F4VQ 1JE4A 3KAKA 1E1TA 4ED0A 1E22A 2UUCH 4Y7NB 2EJMA 4HJAA 5M3FG 5D1PA 1J6QA 5LMNH 5JJZA 3N41B 3PO2H 1W6KA 4YR3A 1VQEA 4JYAH 5FD6A 2QDLA 1PFMA 2YS7A 1CM9A 4LH7A 4GLVB 1EOTA 3R2IA 5C44B 2VB3X 4OL7A 5CR3A 3UDGA 5IODA 4X62L 4R4OA 2DZDA 3CCLA 4RWSC 1O78A 2LXKA 4AQYH 4GN5A 3TBIB 5KFUA 5JVG3 3ORRA 4ECWA 2DJFC 4RA8A 3PUYA 2UXBQ 4BY7B 1K0RA 2R61A 2HVQA 5LHY1 4YHHL 2W6QA 3DMUA 3N42B 2VUMG 5I2YA 1I4GA 1S3OA 3STBC 2G9HD 4A3GG 1K0SA 5L37A 1QVGA 1RIPA 1CQFA 4IPHA 2QDBA 2K5HA 2FK3A 3K58A 2FPGB 2R85A 1IW7D 1TVXA 3T1HQ 4DV3L 5CC4A 3NBHA 5I6YA 5AJ3Q 4JI0H 1GD7A 2N49A 3DEOA 2DPJA 5IE8A 3D3RA 2RF4A 4PQXA 2UXCH 3NENA 1IBLL 4HIKA 2W6NA 3Q8SB 3CCQA 4DR2Q 1AW7A 3L7ZC 2LMCB 4TQSA 2D2CC 3QG1A 2A73B 2VB2X 4O3NA 1E3PA 1X65A 1FJGH 1N32H 4LF5Q 1AP0A 2C2RA 1BOSA 3SK6A 2D62A 5DLQE 2UVWA 2UUBQ 1F2MA 3FEWX 3T5HA 1EYGA 3R2TA 2OQKA 3J81j 5I6WA 1BF4A 2L12A 4LSAA 3I4MH 1NTGA 3D4DA 2ZJPA 4K5VA 3SEBA 1Q3LA 2K33A 3JSNA 3ICEA 1CS0A 1SJED 2EVBA 1SBBB 4J9MA 4X3TA 3T56B 5J2TF 2FMMA 1I50A 2X69A 2BA0A 4H44C 2R7KA 2PW7A 4FBUA 1SYGA 3PR5B 4GC6A 2VZAA 1ZQ7A 4F7XA 2RDIA 4IUPA 1UE5A 1HUMA 3WOFA 5KFMA 2FLNA 2ZM6L 4DV1L 5KT7A 3NHHA 3A7AB 2JA7H 3CC7A 5CGKA 3EPIA 1F2YA 1W3SA 4B3RL 2R92A 4YWLA 3A8IE 1STYA 5GROA 1WR2A 2IWHA 3RZDB 2KA7A 3BVGA 2BQ3A 4ED1A 2LSSA 3Q2OA 4YWMA 3MXPA 1S4ZA 2CH4A 2PCFB 2N3SA 2NN6H 3SK4A 1U0LA 3PIP3 3IAYA 4NXMH 1I6HH 5KFLA 1KJ9A 3WO0A 2R92G 3OIPA 3S1RH 3T1YH 4R4TA 4QIWA 3ERQA 4C3JH 3S2HH 4RAZA 1QUQA 5KYLA 4ED3A 4ECYA 2VQEH 1ASYA 2CHBD 1VBGA 5K2MA 2F0FA 3H0GH 4H7BA 1Q1EA 5M3FB 5C3EB 4YIJA 1WCMB 2PO4A 3LWUA 4I7HA 5E1FA 2FK2A 1YITA 4KN7C 3FP9A 1GVPA 2QILA 3FKIH 2IX0A 3GTGH 1K83A 4QUFA 1DM0B 2Z9HA 1FVIA 2QEJC 3S2HB 2WINB 4LF6Q 4ID6A 2HCCA 4ZAIA 1PYWD 4JI8H 4S3SA 1SFOB 3J7ZC 3I12A 1ZYRD 2KHJA 3GQBA 4POFA 4JV1A 3I7FA 1PV4A 2R7NA 3MXNB 2KBNA 1WOCA 2IX1A 2VUMB 2K5DA 5FJ8G 5BMVF 5ELNA 4MTEA 4X3KA 4C3HH 3KHLA 1PRTC 4RFBA 1A3VA 1FL0A 4KY5A 4UCRA 1RF2D 1SYCA 1GHJA 4LUOA 2NU6B 1S5FD 2D5DA 1TXYA 3BDLA 3NGDA 3TP5A 1TS2A 1M0WA 3SI8A 4J9OA 1P16A 4GKJL 3QJYA 1PTOB 3PO2G 1SFOH 3MWYW 1E4EB 1UC9A 1KHIA 3DUZA 5IWAL 3NE5B 5BN5A 4JI4H 3PN1A 3S2DH 1X3QA 3T1YL 2I8CA 5CAEB 2OXPA 3J80W 4HSVA 3I3CA 1SJHD 4A3GH 4IAJA 3W2DA 2W8KA 3RB6A 2R93A 1K3BC 1A9XA 3KDFA 1CKOA 2JEAI 5CB4F 3AMUA 2WB1E 1HR0W 5LXTF 3NSWA 3VPDA 1STBA 3PUZA 1TS3A 3TDQA 5C4XB 1S0MA 1BBWA 1VQHA 1HR0H 1S40A 5KFXA 3HKZB 1KEEA 2K04A 3L2PA 1A2TA 1LTBD 3MWDA 3HKZE 3BG3A 1EZ8A 1EOVA 4OO1G 4OO1I 1BCPF 2FMCA 1F2ZA 2K75A 5IYDH 3RV4A 4MIUA 4DV3H 2RDGA 4IUQA 1HA6A 1LTAD 4IWYA 1CKMA 3I4OA 4A3MH 1TWCB 1PRTF 4K0KQ 3GLKA 3PO2B 3CRLC 1EY4A 3EJIA 1BJTA 4YHHH 2YRWA 2RDHA 1ESFA 2XN9C 1PDQA 4JI2H 4G7HC 4APVA 1SE3A 3OW7A 5J3BA 1YJ9A 4JI1Q 2F0NA 3F2UA 4AQYL 3ND9A 4OO1H 4CC5A 1I4QA 3NQTA 5LMNQ 2RGRA 1L1OC 1EYAA 4LFAQ 4ZOLF 4WRDA 2YL2A 2KCMA 3Q8DA 1R9TB 5JEAG 4BBSH 2XIWA 4JV2A 3VR4A 4LNQA 4OWTB 1VMCA 5C4XG 5C4JB 5T1IA 3RV3A 2AQ4A 3ULPA 3HKZG 2YZNA 3OWEB 3U9OA 4DNRB 1VQ5A 4XQNA 1FJGL 1N32L 4X65H 1A0IA 2R6GA 1QWYA 3JAMW 5C3XA 4HJ7A 5KFSA 3E6ZX 2ZT9C 5C4ZA 3E9HA 5EPLA 1MJCA 3D6WA 1TY2A 3GTPB 4GOPA 4U68A 2XCPA 4A3EH 3RGXA 1XMQQ 1PFBA 2XSCA 3BJUA 3D8GA 2A19A 4L1KA 4A3KH 1AEXA 5BPHA 2EOTA 2EXZA 1NR2A 4ECQA 2UU9L 2GPSA 4JK1C 1ZXTA 3CD6A 1IYUA 3HOZG 3R8BA 1TQOA 3H6MA 2EZVA 2NVXH 2DN8A 1CA6A 4TV8F 3LGJA 1ZHSA 3PF4A 4YY3L 2Z8LA 4JG2A 2BCOA 5BR8L 3VPCA 1PVOA 4EBDA 3MFGA 2ICIA 3N40P 1Y1WA 5JOBA 4KJNA 4DL6A 3J80c 2YCHA 3GTQH 2WDTA 4JI5L 4LFAH 5DQHA 1YNXA 3PW4A 4C5AA 3TZDA 4K2KA 4RCOA 3RZOH 3GIKA 2V59A 1KDAA 3GV8B 5HGTA 1HNXH 1MSGA 3A56A 4G4KA 4PMWA 3ITPA 3KTMA 5G3LD 3BU2A 5JEAJ 4V190 4LF7H 2FB9A 3G6VA 4A3JG 3BVZA 3KBGA 3KUPA 3URYA 5C0XH 4F87A 4MHEA 2F52A 1JMCA 2UUBH 3S9WA 1K9MC 3NELA 4DK3C 3RB3A 2SNMA 4CKBA 4KD4A 1HNWH 1BKBA 1V1OA 4IUVA 3EVQA 4FF4A 5EQ0A 1G2TA 4RG1A 2GPWA 2JA6H 4MV3A 3NTHA 1RDPD 3BZKA 1IXRA 1HR0Q 2L5TA 3NEMA 3FVQA 3VYSA 3S14B 2F0SA 4YJ3F 3DM3A 2B8GA 4M7EA 1EQVA 2WFWA 4OX9Q 3RTXA 3V4SA 1I4RA 2IPKD 3OPOA 4RAUC 4A3CH 2Y0SB 2YW2A 3BQ1A 1FNVA 1TKWB 2NVTB 4C3IH 1KDBA 4C3JB 3F2CA 3KHHA 2JA5B 5KT2A 2EE1A 4JI3Q 3F8TA 3M85A 3JC66 4JI4Q 2OCEA 4N8FA 4ZRZA 1LLRD 2KEEA 4JI0Q 5L1LA 3T1HH 1VQDA 2R7DA 4OHJA 1T9HA 3ORQA 1W96A 3FHWA 1TWAA 2IW3A 4A3JB 1V51A 1XNRL 2W9CB 4PV1C 4GNXB 1TT2A 1I7LA 4J9NA 4FO2A 2R7LA 2UXBH 4L5SA 2B63G 2ZDQA 1RYRA 1ET9A 2Z6KA 3IFTA 1H9SB 1VQMA 1EL0A 2NZOA 4EQOA 4LSXA 4ALPA 1JC7A 2PZTA 4DR6Q 5EOYA 2RHSB 5KFRA 4JI5H 4QMGA 3TS2A 4IRCA 4YWKA 4LMYA 2LKVA 3BQ0A 1TY0A 1UEAB 1QOHA 2WE6A 5LMUH 1TWFB 3G6YA 1EY7A 5I47A 2Y0SG 2W8LA 4ME5A 2W9AA 2JYOA 3S17H 4R8UB 1Y1VA 3BAAA 5C3WA 4A2AA 2GLTA 1E2VA 2R7MA 2W71A 4UCUA 1A8VA 3GIJA 2Q8IB 2PNHA 1WTWA 2AWOA 2B2TA 3P75A 2Y0SA 2CKZB 4H13C 4HCEA 3M7NA 3KLWA 4GN3B 2FKLA 3RB4A 1A63A 3IG0A 1QZGA 4O4IF 2YTXA 1WYDA 1HHVA 4IQZA 2OWOA 1VS0A 3HOZB 1V43A 5IT9c 4LUVA 3HXLA 4Q0FA 1GO3E 5KG0A 5C4XH 4ECTA 3K3PA 3CU7A 3DLLA 1F2LA 3K0XA 4RGTA 2IBKA 1ILPA 4GNXA 3T16A 4P72A 1PH7A 2WKDA 4KI0A 1STAA 4AYBB 4QW8A 2NU8B 1O7ZA 1JLLB 1EY6A 2QW7A 2HD3A 5EBDA 1RJRA 1LT3D 3GO5A 3DF7A 3DXJC 3NTKA 1SDFA 2RDJA 1V9PA 2BE5D 4CJ0B 4X65Q 3OTOH 3K5NA 4LF7L 3GP7A 1N9WA 2E8GA 4Q45A 2WTFA 2RA4A 1R4PB 1M1KC 4V0BA 4C1NK 4BBRH 2MQHA 1SXTA 1K8AC 1RK5A 4J15A 3CXCA 4ZI7F 4YP3A 2AMCB 4LF4Q 3KOJA 3PCOB 2WB1G 1W2BA 4J8QA 1SNMA 4L63B 2PMZE 4XYQA 4CDEC 2CWAA 3UDIA 2NTTA 1YI2A 1FGUA 4LFAL 3WWVA 1KJQA 4LF8H 1NMGA 3J81E 4EFEA 2QGQA 1R9TH 5EWGA 4RB3C 4Q8EA 2A1AA 2PI2E 2V58A 4NW2A 2GA4B 4JI2Q 1I50H 1YVCA 4POGA 5KG4A 4A76A 3I55A 4YHHQ 3HOWB 4BBRB 4K0KH 4A3IG 5JAVA 3Q1KA 1BBUA 4GOPB 4YR2A 1JR0D 2BDOA 4X3UA 1HFGA 2Q2TA 2W57A 3N8DA 5F9LA 2V4RA 1FJGQ 4R8IA 1N32Q 5KG2A 5KFPA 3KFUA 1Y1WH 4RNOA 5IP9G 4J9PA 2NBFA 4I65A 1PH1A 1N36H 2OLSA 4UCOA 2VS1A 3OUZA 5FD5A 3N6RA 2OT2A 1CHQD 1F9PA 4GS3A 5FLMH 3R93A 2VW9A 1A6XA 4DL5A 3GTOB 2KCTA 1DZ1A 2NYZD 2WB1B 2J7ZA 1KTKA 1XPOA 3CCVA 4QWBA 1SN8A 2B2WA 4DK6C 4HCSA 4DN4M 1XTCD 2CFMA 4C2MB 2WAQG 3HOXB 2R82A 3PUXA 4A3FH 2HHHQ 4C3IG 4LW1A 2NUAB 2CQYA 3S16H 1I94H 5H80A 2L4NA 1C48A 4DV7H 4DFAA 1G2SA 1B8AA 4NDXA 2FLPA 5KFNA 4JI7Q 1S0OA 1XPUA 1KNAA 3AEVA 1OXVA 4JI8L 3HOYG 2B8FA 5ELFA 5A2QW 2UXDH 3PUWA 1RTOA 2NUCA 2NVYH 5E4XA 3HOXH 2R8GA 1TS4A 4IUNA 1TWHB 5IYZF 4IR1A 1Q86C 1QB5D 2L1BA 1EU3A 3NXWA 1XX8A 2CWPA 1KRTA 4HNTA 2K5WA 4Y7NH 5KG7A 4DR1Q 4IHJF 2MUYA 4DNIA 4IUUA 4KHPH 2RKSA 2UUCQ 4B3TL 1ILQA 4A3DH 2UVRA 3J81L 2R93H 2F4VH 3CF5A 2KENA 4FS2A 3HOXG 4DV6H 3DWAA 4DR7L 1D5MC 4RB1A 1GUNA 1VMPA 1HR0L 1LTRD 2B2WC 1SFOA 2F0VA 2L11A 2X6GA 1VF5C 1BCPD 1HNZH 1I4XA 2J6SA 2OH2A 1ML0D 2NZ1D 3K5IA 1QCBD 1G91A 2VR1A 2IL8A 3G6JB 2MPMA 3G8CA 2IJ0A 1PYBA 5IGEA 3F8NA 5FPRA 1OXXK 2EDGA 2RCFA 1TIID 4HTHA 4IPGA 5KT5A 4J9LA 5IYDG 1A15A 1E2ZA 3H40A 2ZXRA 5IWAH 2R7FA 2OQ0A 1CE8A 1NNXA 1SCUB 1SNDA 2HHHL 1EY9A 4GOPC 1WH2A 3QB3A 5NUCA 2KCCA 3IN5A 3GTOA 4KMUC 2JA5A 4A93B 1ENAA 3J7AF 2B3GA 2SDFA 5DG8A 3CMEA 3TINA 4DAYB 1SSOA 4YAJB 2WP8J 2JA8G 1MBYA 2F0WA 2NZHA 3MXUA 3PW7A 2UU9H 1DYQA 2XTIA 1VQ7A 3AFPA 1I6HB 3A7LA 2ICEC 4BBRG 4DV2L 5F9NA 4QF4A 2V1CC 3NPPA 1N33Q 3G6EA 4DV7Q 1WTOA 2L9HA 4JYAL 3HOVH 1QNKA 1ENFA 4ZKCB 2HHHH 3E5SA 3PO3H 3H94A 4LF9L 2YYAA 1SYFA 1HFNA 1M4VA 5D1OA 1OTCA 5FK9C 1BDOA 4F4XA 1SAPA 3K3VA 3RN5A 3G7LA 4A3KG 4IFDH 1V1PB 5JPMC 3A5UA 1CI3M 1WTXA 4X66Q 4JI6L 3BDOA 2R6FA 4DR2H 1PZKD 1CHPD 4LFCQ 1TU2B 1YNJD 1EWIA 3VYUA 3Q24A 4L8JA 1H9MA 4QB4A 5KNDA 1I5FA 3Q23A 1BO0A 4DR4L 4B3RH 2Y0SE 3W3AA 1HTLD 3BS1A 5KT6A 2ZM6H 4DV1H 2UVVA 2XVSA 1C3OA 2PZUA 2IA6A 2R84A 1GUGA 4M8AA 2X6LA 4A3EG 1RJTA 1B70B 4HIDA 2ASDA 1J5EL 4M9UA 1B7YB 2OTJA 4HSPA 1BUVT 2BQRA 2V5AA 1X55A 3C0FB 2F1MA 3LMLA 2A6HD 2B2VC 1EFID 3J7YW 1N8RC 4DV5L 3MTSA 4R7RA 4AQYQ 3ETHA 3N6XA 4ED7A 2JEGA 4NXNH 5J39A 1U4RA 2J0TD 1AE3A 2V4DA 4LJZC 1STGA 3S15H 1TWAH 3CW2C 3RNUA 2E2HB 5KGUA 3S14H 1BQQT 5DG7A 5LL6b 1PTOC 4RMFA 5I9PA 2PI2A 1I94L 1IBKL 5ELEA 3V6KA 2XGPA 5KFGA 3M3YB 2JQOA 4I7AA 3I91A 4KY7A 2L0CA 1OO9B 5EKIA 4C3HG 3H3VI 3I2ZA 4JW0A 2VUMA 2MCTA 2I5HA 2GN5A 2F3IA 3EBEA 4LF5L 3RLNA 4RZQA 2WACA 5CV4A 3CCRA 3U58A 4KHPL 1DV1A 1A62A 4A3MB 4EYIB 1PFNA 1JE5A 5CMDA 1Q1BA 5FLXL 3Q8QB 3E3XA 1CFMA 2Q2HA 4J1MA 3CQZB 1IHZA 2R8HA 2UXCL 1ENCA 4NP5A 1UE1A 5DQIA 3T51B 2NB0A 4F4YA 2F4IA 3GV5B 2DPIA 1DD2A 4JPBW 3W5OA 4X62Q 2MGSA 1DXMA 1ONLA 2SEBD 1PHJA 1D1KA 4UP8A 4JV5Q 4C2MH 1SEIA 3S2DB 3RBDA 3VR5A 4JBKA 2UUAH 1MIUA 4A93G 1EEFD 2C9OA 4RH6A 3WO1A 4CDDC 3Q0AA 1J9OA 1J5EQ 3J80i 2EYLA 1BCPB 4L5TA 4JV5H 3GTKB 2K5QA 3AU7A 4N8X1 4X62H 2QCPX 3S1QH 3RN2A 3MEFA 3QFFA 4A3MG 3PR4A 3TQTA 4IOAA 4YCWA 1N33L 2VUMH 4BWSC 4OONA 3MC0B 1ZYRC 1ZETA 5HGQA 4BXXG 3EYYA 4M1UB 2MFIA 4TVAB 1IBKQ 2BOSA 1TWGA 1GYFA 1RL2A 3EQLC 3SDZA 4IRDA 3WNZA 3QOJA 4DU9A 5LP6F 4JUZA 1L2FA 2BH8A 4FXGC 3IL8A 4DR7H 4F4ZA 3RF2A 1LT4D 5EDWA 4B9WA 2FLLA 2KVMA 4DF7A 2EY5A 4MA5A 2I46A 1KLGD 4R9WA 5EPJA 2E5LL 1C4QA 1D5XC 1S5ED 2A6EC 3A5ZB 4GLXA 4BBSB 4LFCH 3SK8A 1PA6A 3M4YA 4HIMA 3PV0A 1WTVA 2E5LH 3BZCA 4HNUA 5GAEC 4GKKQ 1C7YA 1VQ8A 5DGAA 2HIVA 2K4KA 2A68C 4LF6L 1B2TA 2ZXPA 4I50F 4QWDA 1GGOA 2E2IA 5KFQA 2Z1CA 2E2JB 3GIDA 1K8MA 5BR8Q 1K8GA 5CORA 5HBRB 2ID0A 3K5LA 5LOVF 4LH6A 3GILA 5KFCA 4J9SA 1IBMH 1OXSC 1X6OA 5KX5F 3PW5A 4IPCA 1S5CD 1SYEA 4X64Q 2RHQB 4DUYL 5LMUL 3I8ZA 4AYBA 1BVSA 4GNXC 1HNXQ 2CZGA 1BXRA 1N33H 4MV6A 1K8OA 1PK8A 2RCNA 1FNWA 3QZ8A 4I7ZC 1AZQA 3CVZA 4YCUA 1EHIA 2J6UA 5KFEA 5EBCA 2VQFL 1WCMG 1IBLH 2MP1A 1BNCA 3HOUG 4EQPA 5L9XA 2FXQA 1IBML 3GTKA 2UUAL 1Y1VG 3PO3B 3HRZC 2K52A 2K14A 1EU4A 1NY4A 3OW2A 2Z4HA 2JSOA 3GTMB 2W6ZA 3MXNA 4ED2A 1M6VA 2CW8A 2R92H 4O2BF 5JQWA 3AFQA 3X3MA 4DAVA 1ZKOA 1D6EC 2AUKA 3GTPH 4B3SH 1Q7YC 2VOBA 4XYMB 3OSNA 3KXYT 2VQFH 4IJHA 2E2IB 4WFN3 1EZ1A 3EPGA 2AUJD 2JA6G 3CCSA 1I7NA 1HRJA 1HQMC 1SMXA 3ERSX 4LF8L 1DIKA 2AGOA 3J7A5 3GTMH 1UC8A 2A6ED 2HUGA 4LAAA 3MAQA 1PX2A 1XYIA 4ECZA 1CUKA 4F4WA 3L0OA 4PZ8A 1TWFH 3GIIA 5LMNL 5IYBH 4DV6Q 3S1MB 3UDFA 1VQBA 2I5LX 2PQAB 3CCMA 1XNRH 2WB1A 1M0TA 3OTOL 5C44G 1WTRA 4J0MA 5C1OA 1CSQA 4K5WA 1JDBB 4DR1H 1JJCB 4DR6L 1KAWA 5IWAQ 1HNXL 2NVTH 3OUUA 1XWEA 3KBXA 4FP5D 3VR6A 1K83H 4YR0A 5EKLA 1AN8A 3F2BA 3DWQA 1RYSA 3HS0C 4DL7A 2A74C 4HN7A 3HFZB 1NR4A 2O5IC 1KXLA 1GOZA 5KFIA 1U4PA 4WJ4A 2EYPA 2N8NA 5GQOA 2E2HH 2ASLA 3T5JA 1HNZQ 5LL6S 4DA2A 1KL9A 4EYHB 4B3SQ 3M7GA 1RD9D 5IT9W 3GV7B 3SGIA 4JBJA 2NVQH 4DV3Q 2KSWA 3I4NH 2VXWA 1SYDA 1CZWA 1E4GT 1F9QA 2B2VA 4OIJA 1JWSD 4ECSA 1EIHA 2EYHA 4DR4H 4IUTA 2FMAA 5KFHA 3TN2A 5JEAH 4BBSG 3R23A 5CBAE 4RAYA 1MHWC 4PWQA 4KN4C 1X54A 2FK1A 2MO0A 1DOLA 4MTDA 4ZCKA 1Q12A 3SXHA 1Y69U 2DY7A 1VQIA 1M90C 3H3VC 1VAJA 2ALYB 4ZQ3A 4RB2C 5DLFA 2JA5H 1GSAA 4DR5L 1RJQA 3OSOA 4RU9A 3ZJYC 1JB3A 4Y52H 4PNYA 3TQYA 2NU7B 3RUZA 2RGVA 2KCNA 4DXGA 1L0YB 4X64H 4N9PA 2Q8RE 3OHAA 4TKOB 4B3MH 4EVOA 1LABA 3HOZH 4UDUC 3Q22A 4LF9Q 1GUOA 3O13A 4DV4H 5IY0A 1JX4A 2D9UA 1I3QH 1SMYD 4GN4B 3S1QB 4FBTA 5KFJA 5A2QE 4RZRA 1Z6HA 2ZTEA 4LF6H 3B6YA 3CCJA 4I55F 3ULLA 4OXPA 4LFCL 2EIFA 2K7VA 3T13A 5IP9H 5D8DA 1W93A 4CJ2C 2AQ2B 1I3QB 2NVXA 3VMMA 5M5XH 1E24A 3NQIA 1L1OB 1STEA 3DWPA 3LWEA 4AIMA 2GVBA 5KEEA 3QO2A 2VQEL 1G6ZA 3LP8A 4F50A 3TZUA 1CTMA 4FF2A 2AGQA 4Q5VA 4LFBQ 1EIYB 1EYZA 3C1EA 4UAIA 1IBKH 1SYBA 2B39A 1VQNA 2DIKA 1HQRD 4UCSA 3CPFA 5KNCA 4AH6A 2E74C 4LF8Q 4DR2L 1CKNA 2C35B 2CW0C 1JT8A 3PIPA 2JEFA 3CC2A 1Z2OX 3HOWH 4H0LC 4DK1A 4ED8A 3JSLA 2CW0D 4TRDA 3HEJA 1VQ6A 3TP7A 3NP8A 5M5WH 4R8NA 1XMOQ 2J9GA 2W6PA 4DL4A 5C8YF 1K73C 3RBEA 4A3BB 4LWCA 1PH3A 4IFDI 4IFDG 5D1OB 1EYDA 2AWNA 3OTOQ 3CMAA 1HUNA 1GUSA 3J80L 1SLJA 4O3SA 1B33N 4KHVA 1T5EA 3I4LA 4DR3L 2YTVA 5C1PA 3KLSA 2K01A 4XTCS 2I80A 5M3MH 2VA3A 4JBWA 3HKZA 1SE2A 5LMUQ 5AFWA 1PTOD 4RGMA 1LTID 4A3BH 4UPAA 1JJGA 1LTGD 1EIFA 5DLGA 2BQUA 1Y1VH 4MTNA 2EYOA 5IYCG 2MJ8A 2ES2A 2TSSA 1SNPA 2F03A 1XNQQ 1TWCA 2Z6BA 4DPGA 1SMYC 3PQIA 2HT1A 3P1HA 4ECUA 2E76C 3PMFA 3MJFA 4UP7A 5IGGA 2CVRA 4ED6A 2JEIA 2K50A 2I07B 2QA4A 3N52A 4A3BG 4GKJQ 1TWFA 5C4HA 3VYRA 4DUZQ 3V05A 4LF5H 2L15A 3BG5A 4BY1B 2NVYB 2PMZB 3OHBA 3D4WA 1R9TA 1EY8A 5JJIA 4K2LA 4R1JA 2TMPA 4EBEA 2O5JC 5FJ8H 1FKAH 2JEBI 4HR7A 4WJWA 1VQAA 3I4NG 4A93H 1F9RA 4PMCA 4O3QA 4IOCA 1GSOA 4JI5Q 3JAMi 1N34Q 4DGZA 1F9SA 3GDEA 5LL6X 4MAMA 4G3IA 1YNJC 3J81W 3KALA 3RAXA 3FMCA 3TRZA 4RUCA 1NUCA 2XIGA 2M05A 3D31A 3IRBA 4BA2I 3CQZA 5EKKA 1BCPC 1EEID 2K1BA 1JCKB 4K6LA 4LMQD 1IOVA 1PZJD 4X3SA 3S1MH 2FP4B 5KFTA 1XTDA 2JEJA 5FO7B 5D65A 1HNWQ 4QL5A 1X3EA 3S16B 1RODA 3H15A 3E0JA 3JAML 4MN3A 4Q8FA 4RHSA 1CKNB 1EWHA 2QF7A 2JA6A 2XNAC 2YV5A 2A5HA 5CA0F 1B53A 1VQGA 5KRUA 1T3NA 4QIWB 4FYDA 3ZYYX 1KDCA 2HCIA 4B3RQ 3Q8PB 1N34H 3OIQA 1JOKA 3FDTA 5JPNC 4BXXH 3MR6A 4HYKA 5IGDA 5GONF 1VQOA 3RJ0A 5J2UF 4JYAQ 1G51A 2I87A 2BR0A 2EYMA 1K3RA 1B6RA 2HIXA 4EGJA 1Z2PX 4O4HF 2B2UA 5D3DA 4DV2Q 4MV1A 3BVMA 4DR1L 2R7ZH 4DAYA 5FLXE 3H0GA 3MWEA 4MV9A 5IGBA 3H09A 4NPSA 4RGNA 3K57A 2N55A 1D7QA 3KLRA 3JZIA 1S03G 3HGBA 2JXMB 2F0MA 3K7UC 2ENBA 3VDYA 4WBNF 5HURA 1QZHA 3FPUB 3J80E 4JI4L 4EEQA 1D1IA 3K81C 4FS1A 4CDCC 2C2EA 4PMBA 4QJFA 2Q2IA 2XD4A 5KFKA 1EY5A 2EYFA 2M00A 3GQCA 3SK5A 5JJLA 4IO9A 4C5BA 4DUYQ 4CBVA 4KKUA 1EYCA 1SYXB 3UDXA 1OXTA 3L9AX 3RGZA 4JBMA 3HOVB 2ZDHA 3UI2A 1H9RA 4A3IB 3UFXB 1EFWA 1B9MA 1FR3A 2EYJA 3TREA 4XYOA 2KQ3A 1LT6D 1YJNA 1PH6A 1NJIC 4ZHQF 1Y1WG 4XX0B 2CQAA 3S15B 2EY2A 4PG3A 2YRXA 1TAEA 1UNSA 3A55A 3NBHB 4JOIA 4QCLA 2JA7G 1O7IA 1LUZA 3X3NA 1W6JA 2A69D 3TS0A 2F0TA 4HR7B 4FF1A 1JWMD 3MFYA 4YB8B 5IOCA 2IP4A 3JRXA 1HZ9A 3KF8B 4DR3H 3M3YH 3OSPA 4RNMA 1CSPA 4XQJA 4R4QA 4NB3A 2N88A 3PIO3 1T36A 2ASJA 3DM1A 1IYVA 1DOMA 5A2QL 1GLVA 4C56C 4ECXA 1Z9FA 2NVXB 1I3QA 2GVAA 2NWGA 5BPFA 4XQQA 1LO5D 3J81c 1VDZA 3DHQA 2WAQB 3HBLA 4U6PA 3FKIG 1T5XD 1KD1C 4C3IB 4DV0L 1NCVA 4NXML 3SE7A 4DUYH 2HQLA 2OEOA 4LFBH 1MGSA 3A8KE 5I9OA 2O4XA 1S72A 3RUPA 5M5XB 1ULZA 1Y8NB 4C1NI 3FPPA 4HJ8A 2EPBA 4FNFA 2VPSA 2JA7B 4TQUS 5IP7H 3K8AA 1AUVA 3LWBA 5ELCA 1VBHA 1HA5A 1QJOA 1SNQA 3RIZA 4FU0A 2FE3A 4O3PA 4R8UA 4C3JG 3TSSA 4HQ6A 3T53B 3PW0A 1B4OA 3K80C 4JI1H 3PF5A 1DJRD 2JK8A 4ZK9B 2JN4A 1XMOL 1D5ZC 3FRPB 5IYBG 3CPWA 5LMNW 1E1OA 4RKBA 4DV4Q 5IP7G 2EJFC 2YU9H 4Y8VB 4O3RA 1LYLA 1YHBA 1JXLA 1I6VC 5HY6A 1KJJA 5KFYA 3CP0A 1VQLA 1N56A 4B3MQ 2K05A 3GTLH 3QZ7A 2RQXA 2VPQA 1SE8A 2DJGC 5KG5A 1STNA 3S17B 1QVCA 1LACA 2FFKB 4APMA 3I70A 3V6HA 5FLXW 4O1NA 1AUXA 4HEDA 2EY6A 3BYYB 4RCNA 1GM5A 3ONAB 3Q6SA 1XJVA 4B9XA 3N44B 2J4XA 1X3PA 3GTGB 2F0EA 4YAKB 4XIGS 1LTLA 5JVDF 1LM0A 4OEMB 3G48A 1CT1D 2B2YA 4DR5H 1BNZA 2AKWB 3V4ZA 1IOWA 2I0QA 2ZJRA 3EFXD 1JJ2A 2K03A 3M9MB 2DNCA 3BA8A 3PVXA 1MZBA 1Q8KA 3JAME 5G3LF 3CCUA 5K36H 4EX5A 4DUZH 1O80A 1UAPA 2JA8B 1B3QA 4O42A 4XZ3B 5AJ3L 3L4JA 4ME3A 2NU9B 2C22A 4P71A 1U4MA 1G291 2WAQA 4DLKA 2K32A 5FOBB 3HOVG 4WD3A 2PVPA 2MO1A 4OX9L 4A3GB 5COYA 4A75A 1AZPA 2QKIC 3MXGA 4TSSA 4JI8Q 1D2BA 1JOOA 5KT4A 2F0KA 3K5OA 4F88A 1EUJA 3K7AB 2G5DA 5KFZA 1BGWA 2XC9A 4MV7A 4PDBA 2H5XA 2YS6A 4DL2A 4CDFC 3A0JA 4X64L 1S10A 4A3KB 1MJEA 1CA5A 1PZID 2UUCL 1YNNC 3R5FA 2F0DA 2Z6KC 3TIIA 2PNRC 5CBEE 2VQEQ 5DNFA 1V4YA 2ATLA 3I72A 3EA6A 2IMWP 4FF3A 1C0AA 1VQFA 2PQEA 3MHBA 4NXMQ 4RNNA 1MSHA 2I5MX 2JJQA 2ASBA 1YHAA 2P5ZX 2DWCA 4ZQIA 3BJYA 2LY7A 1L2ZA 1KJIA 2RDFA 3IFDA 3I56A 4QUCA 3GTOH 5M5YB 5ELBA 1L0WA 1NMFA 5CA1F 3D4RA 1LT5D 1GSHA 1B9NA 1JICA 4MTKA 5KFOA 4OELB 1HJPA 1H9SA 1M7JA 4JI3L 4MNOA 5EZYF 1I4PA 1CQVA 1H9KA 3I90A 1OWTA 3F2DA 2B2UC 1GHKA 2VL6A 1SNOA 1S5BD 1I50B 2FPIB 1HZBA 2XCLA 3Q8RB 1I4HA 2AU0A 3GTMA 1E7ZA 3W1GA 3RR5A 1DONA 1TWHH 1MKHA 5JVH3 4XT1B 1ESRA 2BDNA 3FKIA 4DR6H 1NBWA 4RGOS 5EGTA 1N48A 3RLOA 4KK7A 3V96A 5ISRA 2OF1A 4LF9H 4FXDA 4FDBA 1EIGA 2RSNA 4QQBX 3G71A 1HCZA 1TA8A 2R92B 2CW7A 1FGBD 2F0PA 4DAPA 4KLKA 5EAYA 5L1JA 4CHTB 5CYUA 2VA2A 4YBZB 4Z9CB 2DNEA 2F3VA 3S24A 3PW2A 2C28A 1QUQB 4EEYA 4MV4A 2BH2A 5C5JA 4JI1L 5C3EG 3H3VH 3OMGA 1NSNS 5JJKA 3GIQA 3VA5A 4EGQA 5D3IB 2SCUB 4QIWE 2W70A 1EWCA 4O0AA 1G6PA 5HV6A 4OX9H 3M4IA 4KKSA 3BZDB 5IGCA 2D0OA 1RJPA 2ZXOA 4ME6A 3E0EA 5GADC 2XRQD 4YCVA 3MZ5A 2K5VA 2F0IA 2KJXA 5BN3A 2KEDA 4DR7Q 1LTTD 4NKLA 5KT3A 3VYTA 1GJXA 3GIMA 4DNTB 1TR5A 3R5XA 2AHOB 1K83B 1CK1A 3M4QA 1HNWL 4KJOA 5CV5A 3KLSX 4BY7H 3L4KA 2UUBL 1HPCA 4QGUA 4WORA 2WAQE 2SOBA 3FDSA 3MWMA 4TQRA 1XNQH 1SEBD 1FNUA 3M4PA 1MD2D 3GTJH 2R3ZA 1SE4A 3J81i 2XCAA 2RVLA 2WV6D 4K8IA 4LF4L 1Y14B 4O4LF 4DV5H 1SR3A 3J7AK 5I4DA 3SR1A 1PH9A 1WD1A 3GTLB 4UCVA 1E4EA 4UP9A 1OXUA 2IHEA 4ILWA 2KHSA 1B1ZA 3GTJB 1J8IA 2KHIA 2HQEA 3GV6A 4ABNA 3P7JA 3ETJA 1UEBA 2K28A 2IHFA 5FO9B 4C2MA 4YY3H 1XMOH 4EQ5A 3KAJA 4UHVA 3DEPA 4HJ9A 1WTHA 2YTYA 1SNCA 3MR5A 4LUZA 3AQQA 3GIPA 1F77A 2ZJTA 3RLFA 4IWXA 1HTPA 1L1OA 2RBMA 1X32A 4K6DA 1X3FA 4G7ZC 2F0OA 1QILA 3R3OA 1IW7C 4BWGB 5ELDA 2HDMA 4B3TQ 3S1NH 3JAMc 1BR9A 4GKKL 1WSCA 5DQGA 3A8JE 2NVQB 2W6MA 4HIOA 5J1ZA 2QK4A 1A2UA 1VF7A 4RHRA 1SRUA 2IX3A 3KHGA 3M9BA 4QY7A 3WOEA 1YEZA 4F8MA 2JA8H 1S97A 1X3GA 2LXJA 1PH4A 1X56A 1VKZA 2YZMA 3H0GB 4OWXB 2F0HA 3K6OA 5M9OA 2M9VA 2NTSA 4OIKA 1U4LA 4LFBL 3MFIA 1V8QA 3S1NB 2Z4IA 1S0NA 5D14A 1E4FT 3QOLA 1ICWA 1V1QA 3GD7A 4DAMA 1LTSD 4NXNQ 1FYCA 2E2HA 2D0PA 4U673 3RD4A 4DV2H 2F3WA 3AYHB 3T5LA 1Y1VB 4BS9A 4FVMA 3P20A 2F0QA 4ZLTF 1WTQA 1U5KA 1PH8A 1GXDC 3K7AH 1WI5A 1E0BA 1KRSA 3D6CA 4JI0L 4GZYC 3UE0A 5CV6A 2W9BB 3HP3A
chains in the Genus database with same CATH topology
4DV0Q 1XNQQ 1WFQA 1EYGA 4DPGA 1IBMQ 2OQKA 4KHZA 3OYYA 2HT1A 3KYHC 3J81j 1PYBA 2ZM6Q 4DV1Q 3W1BA 4UP7A 3I4MH 1NTGA 1EQRA 1OXXK 2ZJPA 1AE2A 4IPGA 2K50A 3ICEA 5IYDG 2QA4A 3HOWG 4A3BG 4BY1H 4GKJQ 2PQAA 3H0GG 4DUZQ 2L15A 2R7FA 2OQ0A 2BA0A 5JJIA 2VZAA 2HHHL 4R1JA 3CCEA 4GOPC 5FJ8H 2JEBI 4A4IA 1VQAA 3I4NG 4A93H 1P8LA 1UE5A 4IOCA 4JI5Q 3JAMi 2EXDA 1N34Q 2A8VA 2ZM6L 1TWGH 4DV1L 3HOYH 2B3GA 3GDEA 4H02A 3CMEA 4DAYB 3CAMA 4DKAC 3CC7A 1YIJA 2JA7H 1W3SA 2WP8J 2JA8G 4B3RL 4YWLA 2NZHA 3TRZA 2DGYA 5GROA 3D31A 3IRBA 4BA2I 2XTIA 4L5QA 1VQ7A 2LSSA 2IY5B 3AFPA 3S1MH 4YWMA 1XTDA 2XGTA 4BBRG 4DV2L 4IFDJ 4QL5A 1X3EA 5IYCH 1HNWQ 1N33Q 2V1CC 2N3SA 3H15A 3G6EA 1U0LA 4DV7Q 4JYAL 3GTKH 4A3LH 1I6HH 1CKNB 3HOVH 1TWCH 2R92G 2MNAA 3S1RH 2UU9Q 4NXNL 4R4TA 5FLXc 4P75A 2YV5A 4C3JH 5C0XI 5C0XG 3PO3H 4UY8C 1QUQA 4LF9L 3S2HH 1VQGA 1Q46A 1ASYA 4YY3Q 4B3RQ 1OTCA 1VQ4A 1IYJB 4BXXH 3H0GH 1Q1EA 3RN5A 1VQOA 1VCIA 4JYAQ 1G51A 3KDFB 4A3KG 1K3RA 2HIXA 3A5UA 5M3FH 4DV2Q 4DR1L 1YITA 2R7ZH 4X66Q 4JI6L 2B63H 3FP9A 1GVPA 1XNRQ 3FKIH 4NPSA 2IX0A 1D7QA 3GTGH 5H1SE 4LFCQ 2JA5G 1EWIA 1FVIA 3K7UC 3VDYA 4LF6Q 1I5FA 1QZHA 5E7NA 4JI4L 4DR4L 3J7ZC 3K81C 2Y0SE 2K5NA 2N78A 2KHJA 1IZ6A 4POFA 3I7FA 1PV4A 3MXNB 2KBNA 1WOCA 4QJFA 2Q2IA 2IX1A 3UE1A 5FJ8G 5ELNA 4C3HH 3T1YQ 1DGSA 4A3DG 4A3EG 5JJLA 1FL0A 4IO9A 4DUYQ 2VQFQ 1B70B 4HIDA 1HZCA 4LUOA 3UDXA 1J5EL 4GLAC 1TXYA 2UXBL 5K36G 1OXTA 1B7YB 2OTJA 1N36L 4JBMA 1P16A 1X55A 1C9OA 4GKJL 3PO2G 1EFWA 1SFOH 1PYSB 4R4CA 3TREA 1YJNA 1PH6A 1KHIA 1NJIC 3U4ZA 5IWAL 1Q82C 4DV5L 1N8RC 1Y1WG 4AQYQ 3CC4A 3S2DH 4KHPQ 4PG3A 3T1YL 4AYBE 3NBHB 4JOIA 4A3GH 4DV6L 1LUZA 1O7IA 1AE3A 2JA7G 3S15H 1TWAH 1CKOA 3CW2C 3KDFA 3RNUA 3TS0A 2JEAI 5C4JH 2WB1E 1HR0W 3S14H 4K0KL 3KF6B 1HZ9A 3KF8B 1IBLQ 2OTLA 3M3YH 4RMFA 1CSPA 1I94L 2PI2A 4R4QA 1IBKL 3PUZA 4NB3A 1BBWA 1VQHA 2JQOA 3E9IA 1S40A 3ER0A 5C0XJ 3H3VI 3I2ZA 3L2PA 2I5HA 2GN5A 2F3IA 3HKZE 3EBEA 4LF5L 1Z9FA 3RLNA 2QEXA 3CCRA 1EOVA 3U58A 4OO1G 4OO1I 2K75A 5IYDH 4KHPL 2GVAA 1A62A 2UXDL 2ATWA 1JE5A 3J81c 1Q1BA 1Q81C 2B29A 4IJLA 3FKIG 1CKMA 4L5RC 1YZ6A 2Q2HA 3I4OA 1UWVA 4DV0L 4A3MH 2NN6G 2NN6I 1KD1C 4NXML 2HQLA 2UXCL 1HZAA 4K0KQ 1UE1A 4DV7L 1S72A 1AH9A 4AYBG 3W5OA 5ELOA 4X62Q 4APVA 4HJ8A 5J3BA 1YJ9A 4JI1Q 1PHJA 2ZTDA 4AQYL 4TQUS 4UP8A 5IP7H 3K8AA 4JV5Q 4C2MH 5LMNQ 1L1OC 4LFAQ 4JBKA 2KCMA 3Q8DA 5JEAG 4BBSH 1XMQL 1MIUA 2E2IH 4A93G 4LNQA 3PO3G 4OWTB 1HNZL 5C4XG 1J5EQ 3J80i 4L5TA 2UXCQ 3K80C 3HKZG 3ULPA 1VQ5A 3PF5A 1N34L 2JK8A 4HJ5A 4DR7L 1XMOL 1FJGL 2F4VL 1N32L 5FLMG 5LMNW 2YU9H 5IYBG 3CPWA 4DV4Q 1E1OA 1A0IA 2R6GA 5IP7G 3S1QH 3RN2A 1LYLA 1YHBA 3MEFA 4A3MG 5HY6A 4HJ7A 3HOUH 3CP0A 1VQLA 4IOAA 1KQSA 4YCWA 4B3MQ 4P74A 1N33L 4DR4Q 2VUMH 1PFSA 3GTLH 3E9HA 1MJCA 4OONA 1SE8A 4PZ7A 4GOPA 1QVCA 5HGQA 4BXXG 4A3EH 1D8LA 1XMQQ 3BJUA 2MFIA 2A19A 4TVAB 4A3KH 1IBKQ 1RL2A 2UU9L 1HH2P 1GM5A 3CD6A 1XJVA 4A3IH 3HOZG 1L2FA 2BH8A 2VY3A 5M3MG 2NVXH 5C44H 1VQKA 1SROA 3LGJA 2JA9A 4IPDA 1LTLA 4XIGS 5C3EH 4YY3L 1YJWA 1LM0A 1PH2A 1XNQL 4JC0A 3G48A 4JG2A 5BR8L 1PVOA 4X65L 2ZJQA 4B3ML 1WJJA 4BY1G 1VQCA 2E5LL 1UE7A 3PSIA 3A5ZB 4GLXA 2AKWB 1NE3A 3J80c 1PA6A 4HIMA 3PV0A 2ZJRA 2I0QA 1JJ2A 4JI5L 3GTQH 3M4OH 3BZCA 5GAEC 4GKKQ 1C7YA 1VQ8A 2HIVA 1YNXA 2K4KA 1Q8KA 3KJPA 2CQOA 3CCUA 4LF6L 2YYZA 4EX5A 3RZOH 3D0FA 4R4IA 4A3JH 5AJ3L 2R93G 4ME3A 2ZTCA 4PMWA 4P71A 1G291 4PZ6A 5GAGC 4B3SL 5BR8Q 3BU2A 1K8GA 4A3FG 3HOVG 2MO1A 2ID0A 5JEAJ 4OX9L 4A3JG 1OXSC 1X6OA 4IPCA 4X64Q 4DUYL 2RHQB 4A75A 1GKHA 5LMUL 3EIVA 1KIXA 2F52A 1BVSA 1JMCA 1K9MC 1Z47A 3NELA 4DK3C 4GNXC 1HNXQ 4JI8Q 1BKBA 1YHQA 1EUJA 4RG1A 2JA6H 2RCNA 3BZKA 1IXRA 1HR0Q 2H5XA 3NEMA 2DUDA 2R7ZG 4BA1I 4YCUA 4X64L 3A0JA 2VQFL 1WCMG 1MJEA 3DM3A 3HOUG 1QVFA 2WFWA 4OX9Q 1UE6A 4X66L 4JI6Q 2FXQA 4A3CH 1IBML 2UUCL 4DR5Q 2UUAL 2Z6KC 3CQZH 4C3IH 1Y1VG 2VQEQ 2K52A 2K14A 3F2CA 1NY4A 4JI3Q 3F8TA 3M85A 3JC66 4JI4Q 2OCEA 3OW2A 2UXDQ 4JI0Q 4X6AH 1VQDA 2R7DA 1VQFA 1EQQA 1C0AA 1T9HA 3FHWA 3ULJA 2R92H 5M5YH 3I4MG 3AFQA 4NXMQ 2I5MX 2JJQA 1XNRL 1YHAA 2ASBA 4GNXB 3GTPH 1Q7YC 1VQPA 3I56A 3GTOH 1L0WA 1NMFA 3PF4A 4L5SA 1I94Q 2B63G 4IJHA 3A74A 2Z6KA 3EN2A 2JA6G 3CCSA 1YBYA 1SMXA 1HJPA 3ERSX 1VQMA 4LF8L 2NZOA 2Q2UA 3J7A5 4ALPA 3GTMH 4DR6Q 4JI3L 1CUKA 2RHSB 4MNOA 3TS2A 3L0OA 4PZ8A 3RZDH 3T1HL 1TWFH 4YWKA 5LMNL 5IYBH 4DV6Q 3UDFA 1VQBA 2I5LX 4JOIC 2PQAB 3F2DA 3CCMA 2Y0SG 1JJGA 2VL6A 1JT8A 1N36Q 3OTOL 5C44G 1HZBA 2E5LQ 3S17H 1CSQA 1E7ZA 3G4SA 1JJCB 3U4VA 3W1GA 3RR5A 4DR6L 1KAWA 3KJOA 5IWAQ 1HNXL 3KF6A 2NVTH 1TWHH 1MKHA 1VQJA 1K83H 1A8VA 2PNHA 3PUVA 4DV4L 4DUZL 2AWOA 1NBWA 3PIOA 3U50C 2CKZB 3F2BA 3RLOA 3M7NA 4MZ9A 3KLWA 4GN3B 1A63A 3HFZB 1KXLA 1WCMH 4FDBA 1QZGA 4LF7Q 4QQBX 3G71A 2YTXA 1WYDA 4WJ4A 5GQOA 2N8NA 2E2HH 2OWOA 1VS0A 1HNZQ 1V43A 5IT9c 1KL9A 2JE6I 4LUVA 4KLKA 5EAYA 4B3SQ 1GO3E 3SGIA 4JBJA 5C4XH 4DV3Q 2NVQH 3DLLA 3K0XA 1XPRA 4GNXA 3S24A 1VQ9A 4JI7L 1PH5A 3I4NH 1QUQB 4P72A 1PH7A 2BH2A 4KI0A 4JI1L 3TEHB 5C3EG 3H3VH 1H95A 4JV5L 5JJKA 4BBSG 3GO5A 2VNUD 1V9PA 4QIWE 4X65Q 4O0AA 1X54A 4DR3Q 1G6PA 4LF7L 2MO0A 1N9WA 2E8GA 2E2JH 4OWWB 2D0OA 1Q12A 1M1KC 3E0EA 5GADC 4BBRH 2MQHA 1VQIA 1M90C 2CCZA 1K8AC 4A3CG 4YCVA 2K5VA 4J15A 2ALYB 1KC8C 4DR7Q 3CXCA 2JA5H 5GAHC 4DR5L 2AMCB 2UUAQ 4LF4Q 3KOJA 1IL2A 3PCOB 3ZJYC 2WB1G 1W2BA 2AHOB 1JB7A 4Y52H 2IT1A 2PMZE 1YI2A 2CWAA 3UDIA 4LFAL 1FGUA 4JCVE 3WWVA 1HNWL 3M4QA 4DV5Q 1NMGA 3TQYA 3PGZA 4BY7H 2QGQA 1R9TH 2A1AA 2PI2E 3F1ZA 2UUBL 4JI2Q 4QGUA 1I50H 1YVCA 4O2DA 4P73A 2WAQE 4A76A 4POGA 3I55A 4WJ3M 4YHHQ 4A3LG 2EQSA 3HKSA 4BY7G 4A3IG 3HOZH 4LF9Q 1BBUA 2Z0SA 4GOPB 3M4PA 1ASZA 5IY0A 1X9NA 1I3QH 3GTJH 3J81i 3STBD 2Q2TA 4GN4B 2BA1A 4LF4L 1Y14B 1SR3A 1FJGQ 2ZTEA 2F4VQ 1N32Q 1E1TA 3KFUA 3B6YA 1Y1WH 5IP9G 1PH9A 3CCJA 1E22A 1PH1A 4UP9A 1OXUA 3ULLA 2IHEA 2VS1A 5M3FG 4OXPA 4GS3A 2EIFA 1J6QA 4LFCL 5IP9H 5FLMH 2VW9A 3PO2H 1VQEA 2KCTA 2KHIA 5M5XH 1E24A 1L1OB 1UEBA 4GLVB 4AIMA 3CCVA 2IHFA 2GVBA 2VQEL 1SN8A 3UDGA 1XPOA 4DK6C 4X62L 4EQ5A 4R4OA 3CCLA 2CFMA 4LFBQ 2LXKA 2WAQG 4HJ9A 2YTYA 4GN5A 3PUXA 1EIYB 4A3FH 4LUZA 3AQQA 2HHHQ 4LW1A 1VQNA 3PUYA 3RLFA 3S16H 2UXBQ 1L1OA 3CPFA 1K0RA 4AH6A 1X3FA 4YHHL 3S1NH 4LF8Q 4DR2L 4B3TQ 1CKNA 2C35B 3JAMc 1S3OA 3STBC 3PIPA 2VUMG 4A3GG 4GKKL 1B8AA 1QVGA 3CC2A 3HOWH 1RIPA 4IPHA 4JI7Q 4HIOA 1XPUA 2K5HA 1VQ6A 3AEVA 1OXVA 4JI8L 1SRUA 3HOYG 2JA8H 5M5WH 3T1HQ 4DV3L 1XMOQ 3M9BA 4QY7A 5AJ3Q 1YEZA 2NVYH 3PUWA 1GD7A 1X3GA 2LXJA 2N49A 1X56A 3HOXH 1K73C 4LWCA 1PH3A 1PH4A 4OWXB 5IE8A 4IFDI 4HJAA 1Q86C 4IFDG 2RF4A 4LFBL 2AWNA 3OTOQ 3NENA 3CMAA 1IBLL 2CWPA 1KRTA 4Y7NH 4HIKA 4DR1Q 4DAMA 1SLJA 1V1QA 3GD7A 4DNIA 3CCQA 4DR3L 4NXNQ 4DR2Q 2UUCQ 4B3TL 2YTVA 3L7ZC 4XTCS 4A3DH 2D0PA 5M3MH 2R93H 4JBWA 3AYHB 1E3PA 1X65A 5LMUQ 3CF5A 2KENA 4LF5Q 1PH8A 3HOXG 1U5KA 4A3BH 1WI5A 3K7AH 4UPAA 1KRSA 4JI0L 1EIFA 2D62A 1HR0L 1Y1VH 4MTNA 5DLQE 3UE0A 5IYCG 2ES2A 4JI2L 2UUBQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 Q;  1XNQ Q;  1WFQ A;  1EYG A;  4DPG A;  1IBM Q;  2OQK A;  4KHZ A;  3OYY A;  2HT1 A;  3KYH C;  3J81 j;  1PYB A;  2ZM6 Q;  4DV1 Q;  3W1B A;  4UP7 A;  3I4M H;  1NTG A;  1EQR A;  1OXX K;  2ZJP A;  1AE2 A;  4IPG A;  2K50 A;  3ICE A;  5IYD G;  2QA4 A;  3HOW G;  4A3B G;  4BY1 H;  4GKJ Q;  2PQA A;  3H0G G;  4DUZ Q;  2L15 A;  2R7F A;  2OQ0 A;  2BA0 A;  5JJI A;  2VZA A;  2HHH L;  4R1J A;  3CCE A;  4GOP C;  5FJ8 H;  2JEB I;  4A4I A;  1VQA A;  3I4N G;  4A93 H;  1P8L A;  1UE5 A;  4IOC A;  4JI5 Q;  3JAM i;  2EXD A;  1N34 Q;  2A8V A;  2ZM6 L;  1TWG H;  4DV1 L;  3HOY H;  2B3G A;  3GDE A;  4H02 A;  3CME A;  4DAY B;  3CAM A;  4DKA C;  3CC7 A;  1YIJ A;  2JA7 H;  1W3S A;  2WP8 J;  2JA8 G;  4B3R L;  4YWL A;  2NZH A;  3TRZ A;  2DGY A;  5GRO A;  3D31 A;  3IRB A;  4BA2 I;  2XTI A;  4L5Q A;  1VQ7 A;  2LSS A;  2IY5 B;  3AFP A;  3S1M H;  4YWM A;  1XTD A;  2XGT A;  4BBR G;  4DV2 L;  4IFD J;  4QL5 A;  1X3E A;  5IYC H;  1HNW Q;  1N33 Q;  2V1C C;  2N3S A;  3H15 A;  3G6E A;  1U0L A;  4DV7 Q;  4JYA L;  3GTK H;  4A3L H;  1I6H H;  1CKN B;  3HOV H;  1TWC H;  2R92 G;  2MNA A;  3S1R H;  2UU9 Q;  4NXN L;  4R4T A;  5FLX c;  4P75 A;  2YV5 A;  4C3J H;  5C0X I;  5C0X G;  3PO3 H;  4UY8 C;  1QUQ A;  4LF9 L;  3S2H H;  1VQG A;  1Q46 A;  1ASY A;  4YY3 Q;  4B3R Q;  1OTC A;  1VQ4 A;  1IYJ B;  4BXX H;  3H0G H;  1Q1E A;  3RN5 A;  1VQO A;  1VCI A;  4JYA Q;  1G51 A;  3KDF B;  4A3K G;  1K3R A;  2HIX A;  3A5U A;  5M3F H;  4DV2 Q;  4DR1 L;  1YIT A;  2R7Z H;  4X66 Q;  4JI6 L;  2B63 H;  3FP9 A;  1GVP A;  1XNR Q;  3FKI H;  4NPS A;  2IX0 A;  1D7Q A;  3GTG H;  5H1S E;  4LFC Q;  2JA5 G;  1EWI A;  1FVI A;  3K7U C;  3VDY A;  4LF6 Q;  1I5F A;  1QZH A;  5E7N A;  4JI4 L;  4DR4 L;  3J7Z C;  3K81 C;  2Y0S E;  2K5N A;  2N78 A;  2KHJ A;  1IZ6 A;  4POF A;  3I7F A;  1PV4 A;  3MXN B;  2KBN A;  1WOC A;  4QJF A;  2Q2I A;  2IX1 A;  3UE1 A;  5FJ8 G;  5ELN A;  4C3H H;  3T1Y Q;  1DGS A;  4A3D G;  4A3E G;  5JJL A;  1FL0 A;  4IO9 A;  4DUY Q;  2VQF Q;  1B70 B;  4HID A;  1HZC A;  4LUO A;  3UDX A;  1J5E L;  4GLA C;  1TXY A;  2UXB L;  5K36 G;  1OXT A;  1B7Y B;  2OTJ A;  1N36 L;  4JBM A;  1P16 A;  1X55 A;  1C9O A;  4GKJ L;  3PO2 G;  1EFW A;  1SFO H;  1PYS B;  4R4C A;  3TRE A;  1YJN A;  1PH6 A;  1KHI A;  1NJI C;  3U4Z A;  5IWA L;  1Q82 C;  4DV5 L;  1N8R C;  1Y1W G;  4AQY Q;  3CC4 A;  3S2D H;  4KHP Q;  4PG3 A;  3T1Y L;  4AYB E;  3NBH B;  4JOI A;  4A3G H;  4DV6 L;  1LUZ A;  1O7I A;  1AE3 A;  2JA7 G;  3S15 H;  1TWA H;  1CKO A;  3CW2 C;  3KDF A;  3RNU A;  3TS0 A;  2JEA I;  5C4J H;  2WB1 E;  1HR0 W;  3S14 H;  4K0K L;  3KF6 B;  1HZ9 A;  3KF8 B;  1IBL Q;  2OTL A;  3M3Y H;  4RMF A;  1CSP A;  1I94 L;  2PI2 A;  4R4Q A;  1IBK L;  3PUZ A;  4NB3 A;  1BBW A;  1VQH A;  2JQO A;  3E9I A;  1S40 A;  3ER0 A;  5C0X J;  3H3V I;  3I2Z A;  3L2P A;  2I5H A;  2GN5 A;  2F3I A;  3HKZ E;  3EBE A;  4LF5 L;  1Z9F A;  3RLN A;  2QEX A;  3CCR A;  1EOV A;  3U58 A;  4OO1 G;  4OO1 I;  2K75 A;  5IYD H;  4KHP L;  2GVA A;  1A62 A;  2UXD L;  2ATW A;  1JE5 A;  3J81 c;  1Q1B A;  1Q81 C;  2B29 A;  4IJL A;  3FKI G;  1CKM A;  4L5R C;  1YZ6 A;  2Q2H A;  3I4O A;  1UWV A;  4DV0 L;  4A3M H;  2NN6 G;  2NN6 I;  1KD1 C;  4NXM L;  2HQL A;  2UXC L;  1HZA A;  4K0K Q;  1UE1 A;  4DV7 L;  1S72 A;  1AH9 A;  4AYB G;  3W5O A;  5ELO A;  4X62 Q;  4APV A;  4HJ8 A;  5J3B A;  1YJ9 A;  4JI1 Q;  1PHJ A;  2ZTD A;  4AQY L;  4TQU S;  4UP8 A;  5IP7 H;  3K8A A;  4JV5 Q;  4C2M H;  5LMN Q;  1L1O C;  4LFA Q;  4JBK A;  2KCM A;  3Q8D A;  5JEA G;  4BBS H;  1XMQ L;  1MIU A;  2E2I H;  4A93 G;  4LNQ A;  3PO3 G;  4OWT B;  1HNZ L;  5C4X G;  1J5E Q;  3J80 i;  4L5T A;  2UXC Q;  3K80 C;  3HKZ G;  3ULP A;  1VQ5 A;  3PF5 A;  1N34 L;  2JK8 A;  4HJ5 A;  4DR7 L;  1XMO L;  1FJG L;  2F4V L;  1N32 L;  5FLM G;  5LMN W;  2YU9 H;  5IYB G;  3CPW A;  4DV4 Q;  1E1O A;  1A0I A;  2R6G A;  5IP7 G;  3S1Q H;  3RN2 A;  1LYL A;  1YHB A;  3MEF A;  4A3M G;  5HY6 A;  4HJ7 A;  3HOU H;  3CP0 A;  1VQL A;  4IOA A;  1KQS A;  4YCW A;  4B3M Q;  4P74 A;  1N33 L;  4DR4 Q;  2VUM H;  1PFS A;  3GTL H;  3E9H A;  1MJC A;  4OON A;  1SE8 A;  4PZ7 A;  4GOP A;  1QVC A;  5HGQ A;  4BXX G;  4A3E H;  1D8L A;  1XMQ Q;  3BJU A;  2MFI A;  2A19 A;  4TVA B;  4A3K H;  1IBK Q;  1RL2 A;  2UU9 L;  1HH2 P;  1GM5 A;  3CD6 A;  1XJV A;  4A3I H;  3HOZ G;  1L2F A;  2BH8 A;  2VY3 A;  5M3M G;  2NVX H;  5C44 H;  1VQK A;  1SRO A;  3LGJ A;  2JA9 A;  4IPD A;  1LTL A;  4XIG S;  5C3E H;  4YY3 L;  1YJW A;  1LM0 A;  1PH2 A;  1XNQ L;  4JC0 A;  3G48 A;  4JG2 A;  5BR8 L;  1PVO A;  4X65 L;  2ZJQ A;  4B3M L;  1WJJ A;  4BY1 G;  1VQC A;  2E5L L;  1UE7 A;  3PSI A;  3A5Z B;  4GLX A;  2AKW B;  1NE3 A;  3J80 c;  1PA6 A;  4HIM A;  3PV0 A;  2ZJR A;  2I0Q A;  1JJ2 A;  4JI5 L;  3GTQ H;  3M4O H;  3BZC A;  5GAE C;  4GKK Q;  1C7Y A;  1VQ8 A;  2HIV A;  1YNX A;  2K4K A;  1Q8K A;  3KJP A;  2CQO A;  3CCU A;  4LF6 L;  2YYZ A;  4EX5 A;  3RZO H;  3D0F A;  4R4I A;  4A3J H;  5AJ3 L;  2R93 G;  4ME3 A;  2ZTC A;  4PMW A;  4P71 A;  1G29 1;  4PZ6 A;  5GAG C;  4B3S L;  5BR8 Q;  3BU2 A;  1K8G A;  4A3F G;  3HOV G;  2MO1 A;  2ID0 A;  5JEA J;  4OX9 L;  4A3J G;  1OXS C;  1X6O A;  4IPC A;  4X64 Q;  4DUY L;  2RHQ B;  4A75 A;  1GKH A;  5LMU L;  3EIV A;  1KIX A;  2F52 A;  1BVS A;  1JMC A;  1K9M C;  1Z47 A;  3NEL A;  4DK3 C;  4GNX C;  1HNX Q;  4JI8 Q;  1BKB A;  1YHQ A;  1EUJ A;  4RG1 A;  2JA6 H;  2RCN A;  3BZK A;  1IXR A;  1HR0 Q;  2H5X A;  3NEM A;  2DUD A;  2R7Z G;  4BA1 I;  4YCU A;  4X64 L;  3A0J A;  2VQF L;  1WCM G;  1MJE A;  3DM3 A;  3HOU G;  1QVF A;  2WFW A;  4OX9 Q;  1UE6 A;  4X66 L;  4JI6 Q;  2FXQ A;  4A3C H;  1IBM L;  2UUC L;  4DR5 Q;  2UUA L;  2Z6K C;  3CQZ H;  4C3I H;  1Y1V G;  2VQE Q;  2K52 A;  2K14 A;  3F2C A;  1NY4 A;  4JI3 Q;  3F8T A;  3M85 A;  3JC6 6;  4JI4 Q;  2OCE A;  3OW2 A;  2UXD Q;  4JI0 Q;  4X6A H;  1VQD A;  2R7D A;  1VQF A;  1EQQ A;  1C0A A;  1T9H A;  3FHW A;  3ULJ A;  2R92 H;  5M5Y H;  3I4M G;  3AFQ A;  4NXM Q;  2I5M X;  2JJQ A;  1XNR L;  1YHA A;  2ASB A;  4GNX B;  3GTP H;  1Q7Y C;  1VQP A;  3I56 A;  3GTO H;  1L0W A;  1NMF A;  3PF4 A;  4L5S A;  1I94 Q;  2B63 G;  4IJH A;  3A74 A;  2Z6K A;  3EN2 A;  2JA6 G;  3CCS A;  1YBY A;  1SMX A;  1HJP A;  3ERS X;  1VQM A;  4LF8 L;  2NZO A;  2Q2U A;  3J7A 5;  4ALP A;  3GTM H;  4DR6 Q;  4JI3 L;  1CUK A;  2RHS B;  4MNO A;  3TS2 A;  3L0O A;  4PZ8 A;  3RZD H;  3T1H L;  1TWF H;  4YWK A;  5LMN L;  5IYB H;  4DV6 Q;  3UDF A;  1VQB A;  2I5L X;  4JOI C;  2PQA B;  3F2D A;  3CCM A;  2Y0S G;  1JJG A;  2VL6 A;  1JT8 A;  1N36 Q;  3OTO L;  5C44 G;  1HZB A;  2E5L Q;  3S17 H;  1CSQ A;  1E7Z A;  3G4S A;  1JJC B;  3U4V A;  3W1G A;  3RR5 A;  4DR6 L;  1KAW A;  3KJO A;  5IWA Q;  1HNX L;  3KF6 A;  2NVT H;  1TWH H;  1MKH A;  1VQJ A;  1K83 H;  1A8V A;  2PNH A;  3PUV A;  4DV4 L;  4DUZ L;  2AWO A;  1NBW A;  3PIO A;  3U50 C;  2CKZ B;  3F2B A;  3RLO A;  3M7N A;  4MZ9 A;  3KLW A;  4GN3 B;  1A63 A;  3HFZ B;  1KXL A;  1WCM H;  4FDB A;  1QZG A;  4LF7 Q;  4QQB X;  3G71 A;  2YTX A;  1WYD A;  4WJ4 A;  5GQO A;  2N8N A;  2E2H H;  2OWO A;  1VS0 A;  1HNZ Q;  1V43 A;  5IT9 c;  1KL9 A;  2JE6 I;  4LUV A;  4KLK A;  5EAY A;  4B3S Q;  1GO3 E;  3SGI A;  4JBJ A;  5C4X H;  4DV3 Q;  2NVQ H;  3DLL A;  3K0X A;  1XPR A;  4GNX A;  3S24 A;  1VQ9 A;  4JI7 L;  1PH5 A;  3I4N H;  1QUQ B;  4P72 A;  1PH7 A;  2BH2 A;  4KI0 A;  4JI1 L;  3TEH B;  5C3E G;  3H3V H;  1H95 A;  4JV5 L;  5JJK A;  4BBS G;  3GO5 A;  2VNU D;  1V9P A;  4QIW E;  4X65 Q;  4O0A A;  1X54 A;  4DR3 Q;  1G6P A;  4LF7 L;  2MO0 A;  1N9W A;  2E8G A;  2E2J H;  4OWW B;  2D0O A;  1Q12 A;  1M1K C;  3E0E A;  5GAD C;  4BBR H;  2MQH A;  1VQI A;  1M90 C;  2CCZ A;  1K8A C;  4A3C G;  4YCV A;  2K5V A;  4J15 A;  2ALY B;  1KC8 C;  4DR7 Q;  3CXC A;  2JA5 H;  5GAH C;  4DR5 L;  2AMC B;  2UUA Q;  4LF4 Q;  3KOJ A;  1IL2 A;  3PCO B;  3ZJY C;  2WB1 G;  1W2B A;  2AHO B;  1JB7 A;  4Y52 H;  2IT1 A;  2PMZ E;  1YI2 A;  2CWA A;  3UDI A;  4LFA L;  1FGU A;  4JCV E;  3WWV A;  1HNW L;  3M4Q A;  4DV5 Q;  1NMG A;  3TQY A;  3PGZ A;  4BY7 H;  2QGQ A;  1R9T H;  2A1A A;  2PI2 E;  3F1Z A;  2UUB L;  4JI2 Q;  4QGU A;  1I50 H;  1YVC A;  4O2D A;  4P73 A;  2WAQ E;  4A76 A;  4POG A;  3I55 A;  4WJ3 M;  4YHH Q;  4A3L G;  2EQS A;  3HKS A;  4BY7 G;  4A3I G;  3HOZ H;  4LF9 Q;  1BBU A;  2Z0S A;  4GOP B;  3M4P A;  1ASZ A;  5IY0 A;  1X9N A;  1I3Q H;  3GTJ H;  3J81 i;  3STB D;  2Q2T A;  4GN4 B;  2BA1 A;  4LF4 L;  1Y14 B;  1SR3 A;  1FJG Q;  2ZTE A;  2F4V Q;  1N32 Q;  1E1T A;  3KFU A;  3B6Y A;  1Y1W H;  5IP9 G;  1PH9 A;  3CCJ A;  1E22 A;  1PH1 A;  4UP9 A;  1OXU A;  3ULL A;  2IHE A;  2VS1 A;  5M3F G;  4OXP A;  4GS3 A;  2EIF A;  1J6Q A;  4LFC L;  5IP9 H;  5FLM H;  2VW9 A;  3PO2 H;  1VQE A;  2KCT A;  2KHI A;  5M5X H;  1E24 A;  1L1O B;  1UEB A;  4GLV B;  4AIM A;  3CCV A;  2IHF A;  2GVB A;  2VQE L;  1SN8 A;  3UDG A;  1XPO A;  4DK6 C;  4X62 L;  4EQ5 A;  4R4O A;  3CCL A;  2CFM A;  4LFB Q;  2LXK A;  2WAQ G;  4HJ9 A;  2YTY A;  4GN5 A;  3PUX A;  1EIY B;  4A3F H;  4LUZ A;  3AQQ A;  2HHH Q;  4LW1 A;  1VQN A;  3PUY A;  3RLF A;  3S16 H;  2UXB Q;  1L1O A;  3CPF A;  1K0R A;  4AH6 A;  1X3F A;  4YHH L;  3S1N H;  4LF8 Q;  4DR2 L;  4B3T Q;  1CKN A;  2C35 B;  3JAM c;  1S3O A;  3STB C;  3PIP A;  2VUM G;  4A3G G;  4GKK L;  1B8A A;  1QVG A;  3CC2 A;  3HOW H;  1RIP A;  4IPH A;  4JI7 Q;  4HIO A;  1XPU A;  2K5H A;  1VQ6 A;  3AEV A;  1OXV A;  4JI8 L;  1SRU A;  3HOY G;  2JA8 H;  5M5W H;  3T1H Q;  4DV3 L;  1XMO Q;  3M9B A;  4QY7 A;  5AJ3 Q;  1YEZ A;  2NVY H;  3PUW A;  1GD7 A;  1X3G A;  2LXJ A;  2N49 A;  1X56 A;  3HOX H;  1K73 C;  4LWC A;  1PH3 A;  1PH4 A;  4OWX B;  5IE8 A;  4IFD I;  4HJA A;  1Q86 C;  4IFD G;  2RF4 A;  4LFB L;  2AWN A;  3OTO Q;  3NEN A;  3CMA A;  1IBL L;  2CWP A;  1KRT A;  4Y7N H;  4HIK A;  4DR1 Q;  4DAM A;  1SLJ A;  1V1Q A;  3GD7 A;  4DNI A;  3CCQ A;  4DR3 L;  4NXN Q;  4DR2 Q;  2UUC Q;  4B3T L;  2YTV A;  3L7Z C;  4XTC S;  4A3D H;  2D0P A;  5M3M H;  2R93 H;  4JBW A;  3AYH B;  1E3P A;  1X65 A;  5LMU Q;  3CF5 A;  2KEN A;  4LF5 Q;  1PH8 A;  3HOX G;  1U5K A;  4A3B H;  1WI5 A;  3K7A H;  4UPA A;  1KRS A;  4JI0 L;  1EIF A;  2D62 A;  1HR0 L;  1Y1V H;  4MTN A;  5DLQ E;  3UE0 A;  5IYC G;  2ES2 A;  4JI2 L;  2UUB Q; 
#chains in the Genus database with same CATH topology
 4DV0 Q;  1WFQ A;  3I73 A;  1IBM Q;  4KHZ A;  3KHR A;  3OYY A;  3KYH C;  2ZM6 Q;  4DV1 Q;  3W1B A;  4TUY F;  1ET6 A;  1EQR A;  3K0Y A;  1CQI B;  1AE2 A;  1YNN D;  1PTO H;  3HOW G;  4BY1 H;  2PQA A;  3QWN A;  3H0G G;  2PN1 A;  4HAE A;  5DG9 A;  4G7O C;  1XMQ H;  5M5W B;  5CV8 A;  1Z2N X;  3BA9 A;  5JH7 F;  2XWB B;  4EGV A;  2DLN A;  3VPB A;  4IUR A;  3CCE A;  3NUC A;  1WD0 A;  1LV9 A;  1Z7T A;  1Y8O B;  4A4I A;  1P8L A;  5IT9 L;  3HZX A;  1DV2 A;  2KUM A;  3RB0 A;  2EXD A;  2A8V A;  3PZP A;  4JI6 H;  1TWG H;  3ND8 A;  4ULL A;  3HOY H;  4H02 A;  4Q0Y A;  3NTI A;  1YIJ A;  3CAM A;  4DKA C;  2F0G A;  4ZUJ A;  5C5M A;  2HVS A;  2DGY A;  2BE5 C;  1KAA A;  4L5Q A;  2IY5 B;  3MA2 B;  5C5L A;  2XGT A;  4GKJ H;  4IFD J;  5IYC H;  2EY1 A;  4NLG A;  4B3T H;  2HJW A;  4A3L H;  3GTK H;  2YU9 A;  2PBZ A;  5L1I A;  2A68 D;  3C3L A;  4RUA A;  4DL3 A;  1TWC H;  4A3D B;  2MNA A;  2UU9 Q;  1TWG B;  5JUM A;  4NXN L;  3TQ1 A;  2H4O A;  3TP8 A;  2G9D A;  5FLX c;  4P75 A;  5C0X I;  5C0X G;  4UY8 C;  1Q46 A;  1RKN A;  4YY3 Q;  4UCT A;  1VQ4 A;  1IYJ B;  2R7Z A;  2FHT A;  1A3U A;  4HMJ A;  1EY0 A;  1VCI A;  2JA7 A;  3KDF B;  2F0U A;  1PTO F;  5M3F H;  1CQJ B;  2AQ1 B;  3C46 A;  2B63 H;  1XNR Q;  1V1P A;  4HNV A;  4Q43 A;  3LNN A;  4NMZ A;  5H1S E;  3H20 A;  2JA5 G;  4ECR A;  4IAL A;  5KFV A;  5E7N A;  3K59 A;  2K5N A;  2N78 A;  5DM6 3;  3OWF A;  1IZ6 A;  1ICF B;  1ZEQ X;  3RMH A;  4LK1 C;  5L1K A;  3UE1 A;  4XXE A;  3BAB A;  3T1Y Q;  1Q8I A;  1DGS A;  4A3D G;  2B63 B;  5IT9 E;  1B04 A;  2F0L A;  2VQF Q;  1HZC A;  1AN7 A;  3SHL A;  4CC6 A;  4GLA C;  5K36 G;  2UXB L;  1N36 L;  4KKT A;  5FO8 B;  1C9O A;  2R86 A;  1XXG A;  1PYS B;  2O2L D;  4R4C A;  1JKJ B;  2VUG A;  4QWA A;  2AQ3 B;  3U4Z A;  1Q82 C;  3U9T A;  1FD7 D;  4OGQ C;  5K5P A;  4ZYS A;  3CC4 A;  4KHP Q;  2LFN A;  3K5H A;  5LA6 F;  4AYB E;  5FPO A;  5KG3 A;  2A69 C;  4DV6 L;  2FPP B;  5JVL A;  4G57 A;  2FJ2 A;  5DAU A;  5C4J H;  3ERO A;  4K0K L;  4UFZ A;  2C2D A;  3KF6 B;  2OTL A;  1IBL Q;  3GTL A;  2JP1 A;  1QNU A;  3U9S A;  2R7Z B;  2X0S A;  3GTQ B;  4YQW A;  2KOL A;  2VQD A;  1QE6 A;  2SNS A;  3E9I A;  3ER0 A;  4IZ8 A;  2V4Q A;  1L0X B;  5C0X J;  4E4T A;  5KFB A;  1JWU D;  3BQ2 A;  3GTJ A;  5EWE A;  2QEX A;  4QW9 A;  4O2A F;  1Q90 A;  3KF8 A;  2P0A A;  2UXD L;  2W7O A;  3KK7 A;  5KFW A;  2ATW A;  1HXY D;  1QG7 A;  1Q81 C;  2B29 A;  4O3O A;  1STH A;  4IJL A;  4B08 A;  4L5R C;  1YZ6 A;  1UWV A;  2NN6 G;  2NN6 I;  3I4M B;  2HGS A;  1C30 A;  1HZA A;  2O03 A;  4DV7 L;  1RTN A;  1AH9 A;  4AYB G;  3H4B A;  5ELO A;  2E2D C;  2B63 A;  4N9T A;  2ZTD A;  3K5M A;  3V6J A;  1WCM A;  2F0J A;  1XDN A;  4CJ1 B;  5KG1 A;  3HOU B;  4ZKB B;  1T94 A;  4GKK H;  1KNE A;  3R5H A;  1JIH A;  1IKM A;  4J6H A;  1XMQ L;  4MA0 A;  2E2I H;  1UNN C;  3PO3 G;  5T14 A;  4CGY B;  3VR3 A;  4X66 H;  1HNZ L;  1O7Y A;  3NBI A;  3GV3 A;  2HVR A;  4K8J A;  4FXK C;  3VR2 A;  4MV8 A;  2UXC Q;  4ODG A;  5CV7 A;  1UUP A;  1N34 L;  4HJ5 A;  5EJW A;  2F4V L;  3RZO B;  3BDC A;  5FLM G;  3HB9 A;  3QR8 A;  3QIA A;  3HOU H;  4CKC A;  1KQS A;  1II3 A;  4P74 A;  4DR4 Q;  1B3A A;  2R8K A;  1PFS A;  4IR9 A;  4PZ7 A;  3HG9 A;  1D8L A;  3S1R B;  4ETS A;  1EZ6 A;  2HDL A;  3NWT A;  3OHX C;  3TP6 A;  4A3E B;  1HH2 P;  1MI2 A;  4A3I H;  4LF4 H;  2Q8T A;  2VY3 A;  5M3M G;  2PZW A;  5C44 H;  1VQK A;  1SRO A;  1K1Q A;  1KLU D;  2JA9 A;  3N43 B;  4IPD A;  1PH2 A;  4U7C A;  5C3E H;  2PMZ A;  1YJW A;  1NAP A;  1XNQ L;  4JC0 A;  4QWE A;  1PLF A;  4X65 L;  3A54 A;  2ZJQ A;  4B3M L;  1WJJ A;  4BY1 G;  1VQC A;  1KAB A;  1IL8 A;  1UE7 A;  1GUT A;  3PSI A;  1WVL A;  1ZHQ A;  4J9K A;  1NE3 A;  3L3O C;  2PW5 A;  5KNB A;  3M4O H;  4TV9 F;  2M2L A;  4P2C B;  3I4N B;  3WDN A;  1PXU A;  5CV9 A;  5E4W C;  3KJP A;  2CQO A;  2YYZ A;  3E5N A;  1S5D D;  5EPK A;  1RK6 A;  4XT3 B;  4EBC A;  3D0F A;  4R4I A;  4A3J H;  2R93 G;  2ZTC A;  4RKL A;  4C3H B;  3G6X A;  2B2T C;  4PZ6 A;  5GAG C;  4B3S L;  1EQT A;  4A3F G;  3UQ8 A;  2XGQ A;  4I4T F;  3MFH A;  1JQY D;  3GTG A;  3M4O B;  1TWA B;  1KC7 A;  1KBL A;  1GKH A;  1KIX A;  3EIV A;  2MHV A;  2A6H C;  4KY6 A;  4JV0 A;  3HOY B;  2C5C A;  1Z47 A;  4C5C A;  5A35 A;  2DY8 A;  1U9R A;  1YHQ A;  2UVU A;  5KKN B;  1AFP A;  1JOR A;  1TWH A;  2YZG A;  1M8A A;  2J6T A;  4KV6 A;  2DUD A;  1PRT B;  2R7Z G;  4BA1 I;  3BYT B;  3CHB D;  2E75 C;  1TS5 A;  4IN3 A;  1QVF A;  1UE6 A;  3MEH A;  4X66 L;  4JI6 Q;  5IGF A;  2AGP A;  4DR5 Q;  3CQZ H;  2QYZ A;  1G8Z D;  2W9C A;  3LX0 A;  5KG6 A;  2R8I A;  2H1E A;  2YU9 B;  5E3F A;  3CRK C;  2UXD Q;  4X6A H;  1EQQ A;  3C1F A;  2L55 A;  4IZO A;  4EG0 A;  4JI7 H;  3ULJ A;  5M5Y H;  3I4M G;  1S68 A;  1RCV D;  3OMC A;  3RFC A;  1VQP A;  1Y8P B;  2C00 A;  4DK0 A;  4JI2 L;  1K1S A;  3AB9 A;  1I94 Q;  1B44 D;  3A74 A;  2FJZ A;  2ZDG A;  3EN2 A;  3MVV A;  3GTP A;  4JVZ A;  1YBY A;  3OOC A;  4JI3 H;  1C8C A;  2LS0 1;  5BR8 H;  2Q2U A;  3NWS A;  2ALZ A;  4K5X A;  1BBX C;  1BXT A;  2B2Y C;  2CH4 W;  3T4A C;  5FKA C;  3RZD H;  3T1H L;  1Y1W B;  2PYK A;  4QWC A;  4JOI C;  5KYI A;  5BN4 A;  1WTP A;  1N36 Q;  2E5L Q;  1EUC B;  5IIF A;  3J7A V;  2R8J A;  3G4S A;  3U4V A;  4KD3 A;  3SE0 A;  3KJO A;  3KF6 A;  2XWJ B;  1VQJ A;  4XYL B;  3IKJ A;  3PUV A;  4RB0 A;  4DV4 L;  4DUZ L;  3FMA A;  3PIO A;  1DOK A;  1PMR A;  3U50 C;  4EFB A;  2W7P A;  1I6U A;  4IRK A;  5I2X A;  4MZ9 A;  5DGB A;  4Q44 A;  1WCM H;  3SVM A;  4LF7 Q;  5LYJ F;  4KTA A;  5EWF A;  4DV0 H;  5M3M B;  2JE6 I;  3TIG A;  3FKI B;  5DM7 3;  1JOQ A;  1E2W A;  1XPR A;  3CKI B;  1VQ9 A;  2WII B;  4XDX A;  1PH5 A;  4JI7 L;  4FM9 A;  1GUW A;  3MR3 A;  3TEH B;  2WKC A;  1JDE A;  5KFD A;  2EJG C;  1H95 A;  3M9O B;  2NVY A;  3V2T A;  4JV5 L;  2KEC A;  5F2D A;  3H4D A;  4J9R A;  3RAQ A;  1DCZ A;  2VNU D;  1KJ8 A;  4DXF A;  1EUD B;  5KFA A;  1RHP A;  4DR3 Q;  1A3T A;  3GTQ A;  1B50 A;  5KFF A;  2E2J H;  2FIN B;  4OWW B;  2WYO A;  1J5E H;  4A3C G;  3TME A;  2CCZ A;  2W6O A;  1B6S A;  3M9N B;  1KC8 C;  2R93 B;  4A2B A;  5GAH C;  2UUA Q;  2W9B A;  1IL2 A;  5TSS A;  4GC7 A;  1JB7 A;  2IT1 A;  5KIX A;  3VA7 A;  4A3F B;  3JRW A;  4JCV E;  1O7L A;  2R87 A;  1PRT D;  4DV5 Q;  3MR2 A;  4ECV A;  1R4Q B;  1CZG A;  3PGZ A;  2V9W A;  3F1Z A;  4YJ2 F;  4E6I A;  4O2D A;  3T5K A;  4P73 A;  4K14 A;  3C2P A;  4WJ3 M;  4CKE A;  4A3L G;  2EQS A;  3HKS A;  4ZUI A;  4BY7 G;  5C6A A;  2K6A A;  5DEH A;  2Z0S A;  3NK9 A;  5J22 A;  1ASZ A;  2PPB C;  5T1G A;  1X9N A;  2RSO A;  2XRS D;  4L6T B;  1S9F A;  4J9Q A;  4HMI A;  3STB D;  4EQN A;  1IKL A;  2BA1 A;  3H91 A;  2JA6 B;  1O75 A;  1H9J A;  1K28 A;  2F4V Q;  1JE4 A;  3KAK A;  1E1T A;  4ED0 A;  1E22 A;  2UUC H;  4Y7N B;  2EJM A;  4HJA A;  5M3F G;  5D1P A;  1J6Q A;  5LMN H;  5JJZ A;  3N41 B;  3PO2 H;  1W6K A;  4YR3 A;  1VQE A;  4JYA H;  5FD6 A;  2QDL A;  1PFM A;  2YS7 A;  1CM9 A;  4LH7 A;  4GLV B;  1EOT A;  3R2I A;  5C44 B;  2VB3 X;  4OL7 A;  5CR3 A;  3UDG A;  5IOD A;  4X62 L;  4R4O A;  2DZD A;  3CCL A;  4RWS C;  1O78 A;  2LXK A;  4AQY H;  4GN5 A;  3TBI B;  5KFU A;  5JVG 3;  3ORR A;  4ECW A;  2DJF C;  4RA8 A;  3PUY A;  2UXB Q;  4BY7 B;  1K0R A;  2R61 A;  2HVQ A;  5LHY 1;  4YHH L;  2W6Q A;  3DMU A;  3N42 B;  2VUM G;  5I2Y A;  1I4G A;  1S3O A;  3STB C;  2G9H D;  4A3G G;  1K0S A;  5L37 A;  1QVG A;  1RIP A;  1CQF A;  4IPH A;  2QDB A;  2K5H A;  2FK3 A;  3K58 A;  2FPG B;  2R85 A;  1IW7 D;  1TVX A;  3T1H Q;  4DV3 L;  5CC4 A;  3NBH A;  5I6Y A;  5AJ3 Q;  4JI0 H;  1GD7 A;  2N49 A;  3DEO A;  2DPJ A;  5IE8 A;  3D3R A;  2RF4 A;  4PQX A;  2UXC H;  3NEN A;  1IBL L;  4HIK A;  2W6N A;  3Q8S B;  3CCQ A;  4DR2 Q;  1AW7 A;  3L7Z C;  2LMC B;  4TQS A;  2D2C C;  3QG1 A;  2A73 B;  2VB2 X;  4O3N A;  1E3P A;  1X65 A;  1FJG H;  1N32 H;  4LF5 Q;  1AP0 A;  2C2R A;  1BOS A;  3SK6 A;  2D62 A;  5DLQ E;  2UVW A;  2UUB Q;  1F2M A;  3FEW X;  3T5H A;  1EYG A;  3R2T A;  2OQK A;  3J81 j;  5I6W A;  1BF4 A;  2L12 A;  4LSA A;  3I4M H;  1NTG A;  3D4D A;  2ZJP A;  4K5V A;  3SEB A;  1Q3L A;  2K33 A;  3JSN A;  3ICE A;  1CS0 A;  1SJE D;  2EVB A;  1SBB B;  4J9M A;  4X3T A;  3T56 B;  5J2T F;  2FMM A;  1I50 A;  2X69 A;  2BA0 A;  4H44 C;  2R7K A;  2PW7 A;  4FBU A;  1SYG A;  3PR5 B;  4GC6 A;  2VZA A;  1ZQ7 A;  4F7X A;  2RDI A;  4IUP A;  1UE5 A;  1HUM A;  3WOF A;  5KFM A;  2FLN A;  2ZM6 L;  4DV1 L;  5KT7 A;  3NHH A;  3A7A B;  2JA7 H;  3CC7 A;  5CGK A;  3EPI A;  1F2Y A;  1W3S A;  4B3R L;  2R92 A;  4YWL A;  3A8I E;  1STY A;  5GRO A;  1WR2 A;  2IWH A;  3RZD B;  2KA7 A;  3BVG A;  2BQ3 A;  4ED1 A;  2LSS A;  3Q2O A;  4YWM A;  3MXP A;  1S4Z A;  2CH4 A;  2PCF B;  2N3S A;  2NN6 H;  3SK4 A;  1U0L A;  3PIP 3;  3IAY A;  4NXM H;  1I6H H;  5KFL A;  1KJ9 A;  3WO0 A;  2R92 G;  3OIP A;  3S1R H;  3T1Y H;  4R4T A;  4QIW A;  3ERQ A;  4C3J H;  3S2H H;  4RAZ A;  1QUQ A;  5KYL A;  4ED3 A;  4ECY A;  2VQE H;  1ASY A;  2CHB D;  1VBG A;  5K2M A;  2F0F A;  3H0G H;  4H7B A;  1Q1E A;  5M3F B;  5C3E B;  4YIJ A;  1WCM B;  2PO4 A;  3LWU A;  4I7H A;  5E1F A;  2FK2 A;  1YIT A;  4KN7 C;  3FP9 A;  1GVP A;  2QIL A;  3FKI H;  2IX0 A;  3GTG H;  1K83 A;  4QUF A;  1DM0 B;  2Z9H A;  1FVI A;  2QEJ C;  3S2H B;  2WIN B;  4LF6 Q;  4ID6 A;  2HCC A;  4ZAI A;  1PYW D;  4JI8 H;  4S3S A;  1SFO B;  3J7Z C;  3I12 A;  1ZYR D;  2KHJ A;  3GQB A;  4POF A;  4JV1 A;  3I7F A;  1PV4 A;  2R7N A;  3MXN B;  2KBN A;  1WOC A;  2IX1 A;  2VUM B;  2K5D A;  5FJ8 G;  5BMV F;  5ELN A;  4MTE A;  4X3K A;  4C3H H;  3KHL A;  1PRT C;  4RFB A;  1A3V A;  1FL0 A;  4KY5 A;  4UCR A;  1RF2 D;  1SYC A;  1GHJ A;  4LUO A;  2NU6 B;  1S5F D;  2D5D A;  1TXY A;  3BDL A;  3NGD A;  3TP5 A;  1TS2 A;  1M0W A;  3SI8 A;  4J9O A;  1P16 A;  4GKJ L;  3QJY A;  1PTO B;  3PO2 G;  1SFO H;  3MWY W;  1E4E B;  1UC9 A;  1KHI A;  3DUZ A;  5IWA L;  3NE5 B;  5BN5 A;  4JI4 H;  3PN1 A;  3S2D H;  1X3Q A;  3T1Y L;  2I8C A;  5CAE B;  2OXP A;  3J80 W;  4HSV A;  3I3C A;  1SJH D;  4A3G H;  4IAJ A;  3W2D A;  2W8K A;  3RB6 A;  2R93 A;  1K3B C;  1A9X A;  3KDF A;  1CKO A;  2JEA I;  5CB4 F;  3AMU A;  2WB1 E;  1HR0 W;  5LXT F;  3NSW A;  3VPD A;  1STB A;  3PUZ A;  1TS3 A;  3TDQ A;  5C4X B;  1S0M A;  1BBW A;  1VQH A;  1HR0 H;  1S40 A;  5KFX A;  3HKZ B;  1KEE A;  2K04 A;  3L2P A;  1A2T A;  1LTB D;  3MWD A;  3HKZ E;  3BG3 A;  1EZ8 A;  1EOV A;  4OO1 G;  4OO1 I;  1BCP F;  2FMC A;  1F2Z A;  2K75 A;  5IYD H;  3RV4 A;  4MIU A;  4DV3 H;  2RDG A;  4IUQ A;  1HA6 A;  1LTA D;  4IWY A;  1CKM A;  3I4O A;  4A3M H;  1TWC B;  1PRT F;  4K0K Q;  3GLK A;  3PO2 B;  3CRL C;  1EY4 A;  3EJI A;  1BJT A;  4YHH H;  2YRW A;  2RDH A;  1ESF A;  2XN9 C;  1PDQ A;  4JI2 H;  4G7H C;  4APV A;  1SE3 A;  3OW7 A;  5J3B A;  1YJ9 A;  4JI1 Q;  2F0N A;  3F2U A;  4AQY L;  3ND9 A;  4OO1 H;  4CC5 A;  1I4Q A;  3NQT A;  5LMN Q;  2RGR A;  1L1O C;  1EYA A;  4LFA Q;  4ZOL F;  4WRD A;  2YL2 A;  2KCM A;  3Q8D A;  1R9T B;  5JEA G;  4BBS H;  2XIW A;  4JV2 A;  3VR4 A;  4LNQ A;  4OWT B;  1VMC A;  5C4X G;  5C4J B;  5T1I A;  3RV3 A;  2AQ4 A;  3ULP A;  3HKZ G;  2YZN A;  3OWE B;  3U9O A;  4DNR B;  1VQ5 A;  4XQN A;  1FJG L;  1N32 L;  4X65 H;  1A0I A;  2R6G A;  1QWY A;  3JAM W;  5C3X A;  4HJ7 A;  5KFS A;  3E6Z X;  2ZT9 C;  5C4Z A;  3E9H A;  5EPL A;  1MJC A;  3D6W A;  1TY2 A;  3GTP B;  4GOP A;  4U68 A;  2XCP A;  4A3E H;  3RGX A;  1XMQ Q;  1PFB A;  2XSC A;  3BJU A;  3D8G A;  2A19 A;  4L1K A;  4A3K H;  1AEX A;  5BPH A;  2EOT A;  2EXZ A;  1NR2 A;  4ECQ A;  2UU9 L;  2GPS A;  4JK1 C;  1ZXT A;  3CD6 A;  1IYU A;  3HOZ G;  3R8B A;  1TQO A;  3H6M A;  2EZV A;  2NVX H;  2DN8 A;  1CA6 A;  4TV8 F;  3LGJ A;  1ZHS A;  3PF4 A;  4YY3 L;  2Z8L A;  4JG2 A;  2BCO A;  5BR8 L;  3VPC A;  1PVO A;  4EBD A;  3MFG A;  2ICI A;  3N40 P;  1Y1W A;  5JOB A;  4KJN A;  4DL6 A;  3J80 c;  2YCH A;  3GTQ H;  2WDT A;  4JI5 L;  4LFA H;  5DQH A;  1YNX A;  3PW4 A;  4C5A A;  3TZD A;  4K2K A;  4RCO A;  3RZO H;  3GIK A;  2V59 A;  1KDA A;  3GV8 B;  5HGT A;  1HNX H;  1MSG A;  3A56 A;  4G4K A;  4PMW A;  3ITP A;  3KTM A;  5G3L D;  3BU2 A;  5JEA J;  4V19 0;  4LF7 H;  2FB9 A;  3G6V A;  4A3J G;  3BVZ A;  3KBG A;  3KUP A;  3URY A;  5C0X H;  4F87 A;  4MHE A;  2F52 A;  1JMC A;  2UUB H;  3S9W A;  1K9M C;  3NEL A;  4DK3 C;  3RB3 A;  2SNM A;  4CKB A;  4KD4 A;  1HNW H;  1BKB A;  1V1O A;  4IUV A;  3EVQ A;  4FF4 A;  5EQ0 A;  1G2T A;  4RG1 A;  2GPW A;  2JA6 H;  4MV3 A;  3NTH A;  1RDP D;  3BZK A;  1IXR A;  1HR0 Q;  2L5T A;  3NEM A;  3FVQ A;  3VYS A;  3S14 B;  2F0S A;  4YJ3 F;  3DM3 A;  2B8G A;  4M7E A;  1EQV A;  2WFW A;  4OX9 Q;  3RTX A;  3V4S A;  1I4R A;  2IPK D;  3OPO A;  4RAU C;  4A3C H;  2Y0S B;  2YW2 A;  3BQ1 A;  1FNV A;  1TKW B;  2NVT B;  4C3I H;  1KDB A;  4C3J B;  3F2C A;  3KHH A;  2JA5 B;  5KT2 A;  2EE1 A;  4JI3 Q;  3F8T A;  3M85 A;  3JC6 6;  4JI4 Q;  2OCE A;  4N8F A;  4ZRZ A;  1LLR D;  2KEE A;  4JI0 Q;  5L1L A;  3T1H H;  1VQD A;  2R7D A;  4OHJ A;  1T9H A;  3ORQ A;  1W96 A;  3FHW A;  1TWA A;  2IW3 A;  4A3J B;  1V51 A;  1XNR L;  2W9C B;  4PV1 C;  4GNX B;  1TT2 A;  1I7L A;  4J9N A;  4FO2 A;  2R7L A;  2UXB H;  4L5S A;  2B63 G;  2ZDQ A;  1RYR A;  1ET9 A;  2Z6K A;  3IFT A;  1H9S B;  1VQM A;  1EL0 A;  2NZO A;  4EQO A;  4LSX A;  4ALP A;  1JC7 A;  2PZT A;  4DR6 Q;  5EOY A;  2RHS B;  5KFR A;  4JI5 H;  4QMG A;  3TS2 A;  4IRC A;  4YWK A;  4LMY A;  2LKV A;  3BQ0 A;  1TY0 A;  1UEA B;  1QOH A;  2WE6 A;  5LMU H;  1TWF B;  3G6Y A;  1EY7 A;  5I47 A;  2Y0S G;  2W8L A;  4ME5 A;  2W9A A;  2JYO A;  3S17 H;  4R8U B;  1Y1V A;  3BAA A;  5C3W A;  4A2A A;  2GLT A;  1E2V A;  2R7M A;  2W71 A;  4UCU A;  1A8V A;  3GIJ A;  2Q8I B;  2PNH A;  1WTW A;  2AWO A;  2B2T A;  3P75 A;  2Y0S A;  2CKZ B;  4H13 C;  4HCE A;  3M7N A;  3KLW A;  4GN3 B;  2FKL A;  3RB4 A;  1A63 A;  3IG0 A;  1QZG A;  4O4I F;  2YTX A;  1WYD A;  1HHV A;  4IQZ A;  2OWO A;  1VS0 A;  3HOZ B;  1V43 A;  5IT9 c;  4LUV A;  3HXL A;  4Q0F A;  1GO3 E;  5KG0 A;  5C4X H;  4ECT A;  3K3P A;  3CU7 A;  3DLL A;  1F2L A;  3K0X A;  4RGT A;  2IBK A;  1ILP A;  4GNX A;  3T16 A;  4P72 A;  1PH7 A;  2WKD A;  4KI0 A;  1STA A;  4AYB B;  4QW8 A;  2NU8 B;  1O7Z A;  1JLL B;  1EY6 A;  2QW7 A;  2HD3 A;  5EBD A;  1RJR A;  1LT3 D;  3GO5 A;  3DF7 A;  3DXJ C;  3NTK A;  1SDF A;  2RDJ A;  1V9P A;  2BE5 D;  4CJ0 B;  4X65 Q;  3OTO H;  3K5N A;  4LF7 L;  3GP7 A;  1N9W A;  2E8G A;  4Q45 A;  2WTF A;  2RA4 A;  1R4P B;  1M1K C;  4V0B A;  4C1N K;  4BBR H;  2MQH A;  1SXT A;  1K8A C;  1RK5 A;  4J15 A;  3CXC A;  4ZI7 F;  4YP3 A;  2AMC B;  4LF4 Q;  3KOJ A;  3PCO B;  2WB1 G;  1W2B A;  4J8Q A;  1SNM A;  4L63 B;  2PMZ E;  4XYQ A;  4CDE C;  2CWA A;  3UDI A;  2NTT A;  1YI2 A;  1FGU A;  4LFA L;  3WWV A;  1KJQ A;  4LF8 H;  1NMG A;  3J81 E;  4EFE A;  2QGQ A;  1R9T H;  5EWG A;  4RB3 C;  4Q8E A;  2A1A A;  2PI2 E;  2V58 A;  4NW2 A;  2GA4 B;  4JI2 Q;  1I50 H;  1YVC A;  4POG A;  5KG4 A;  4A76 A;  3I55 A;  4YHH Q;  3HOW B;  4BBR B;  4K0K H;  4A3I G;  5JAV A;  3Q1K A;  1BBU A;  4GOP B;  4YR2 A;  1JR0 D;  2BDO A;  4X3U A;  1HFG A;  2Q2T A;  2W57 A;  3N8D A;  5F9L A;  2V4R A;  1FJG Q;  4R8I A;  1N32 Q;  5KG2 A;  5KFP A;  3KFU A;  1Y1W H;  4RNO A;  5IP9 G;  4J9P A;  2NBF A;  4I65 A;  1PH1 A;  1N36 H;  2OLS A;  4UCO A;  2VS1 A;  3OUZ A;  5FD5 A;  3N6R A;  2OT2 A;  1CHQ D;  1F9P A;  4GS3 A;  5FLM H;  3R93 A;  2VW9 A;  1A6X A;  4DL5 A;  3GTO B;  2KCT A;  1DZ1 A;  2NYZ D;  2WB1 B;  2J7Z A;  1KTK A;  1XPO A;  3CCV A;  4QWB A;  1SN8 A;  2B2W A;  4DK6 C;  4HCS A;  4DN4 M;  1XTC D;  2CFM A;  4C2M B;  2WAQ G;  3HOX B;  2R82 A;  3PUX A;  4A3F H;  2HHH Q;  4C3I G;  4LW1 A;  2NUA B;  2CQY A;  3S16 H;  1I94 H;  5H80 A;  2L4N A;  1C48 A;  4DV7 H;  4DFA A;  1G2S A;  1B8A A;  4NDX A;  2FLP A;  5KFN A;  4JI7 Q;  1S0O A;  1XPU A;  1KNA A;  3AEV A;  1OXV A;  4JI8 L;  3HOY G;  2B8F A;  5ELF A;  5A2Q W;  2UXD H;  3PUW A;  1RTO A;  2NUC A;  2NVY H;  5E4X A;  3HOX H;  2R8G A;  1TS4 A;  4IUN A;  1TWH B;  5IYZ F;  4IR1 A;  1Q86 C;  1QB5 D;  2L1B A;  1EU3 A;  3NXW A;  1XX8 A;  2CWP A;  1KRT A;  4HNT A;  2K5W A;  4Y7N H;  5KG7 A;  4DR1 Q;  4IHJ F;  2MUY A;  4DNI A;  4IUU A;  4KHP H;  2RKS A;  2UUC Q;  4B3T L;  1ILQ A;  4A3D H;  2UVR A;  3J81 L;  2R93 H;  2F4V H;  3CF5 A;  2KEN A;  4FS2 A;  3HOX G;  4DV6 H;  3DWA A;  4DR7 L;  1D5M C;  4RB1 A;  1GUN A;  1VMP A;  1HR0 L;  1LTR D;  2B2W C;  1SFO A;  2F0V A;  2L11 A;  2X6G A;  1VF5 C;  1BCP D;  1HNZ H;  1I4X A;  2J6S A;  2OH2 A;  1ML0 D;  2NZ1 D;  3K5I A;  1QCB D;  1G91 A;  2VR1 A;  2IL8 A;  3G6J B;  2MPM A;  3G8C A;  2IJ0 A;  1PYB A;  5IGE A;  3F8N A;  5FPR A;  1OXX K;  2EDG A;  2RCF A;  1TII D;  4HTH A;  4IPG A;  5KT5 A;  4J9L A;  5IYD G;  1A15 A;  1E2Z A;  3H40 A;  2ZXR A;  5IWA H;  2R7F A;  2OQ0 A;  1CE8 A;  1NNX A;  1SCU B;  1SND A;  2HHH L;  1EY9 A;  4GOP C;  1WH2 A;  3QB3 A;  5NUC A;  2KCC A;  3IN5 A;  3GTO A;  4KMU C;  2JA5 A;  4A93 B;  1ENA A;  3J7A F;  2B3G A;  2SDF A;  5DG8 A;  3CME A;  3TIN A;  4DAY B;  1SSO A;  4YAJ B;  2WP8 J;  2JA8 G;  1MBY A;  2F0W A;  2NZH A;  3MXU A;  3PW7 A;  2UU9 H;  1DYQ A;  2XTI A;  1VQ7 A;  3AFP A;  1I6H B;  3A7L A;  2ICE C;  4BBR G;  4DV2 L;  5F9N A;  4QF4 A;  2V1C C;  3NPP A;  1N33 Q;  3G6E A;  4DV7 Q;  1WTO A;  2L9H A;  4JYA L;  3HOV H;  1QNK A;  1ENF A;  4ZKC B;  2HHH H;  3E5S A;  3PO3 H;  3H94 A;  4LF9 L;  2YYA A;  1SYF A;  1HFN A;  1M4V A;  5D1O A;  1OTC A;  5FK9 C;  1BDO A;  4F4X A;  1SAP A;  3K3V A;  3RN5 A;  3G7L A;  4A3K G;  4IFD H;  1V1P B;  5JPM C;  3A5U A;  1CI3 M;  1WTX A;  4X66 Q;  4JI6 L;  3BDO A;  2R6F A;  4DR2 H;  1PZK D;  1CHP D;  4LFC Q;  1TU2 B;  1YNJ D;  1EWI A;  3VYU A;  3Q24 A;  4L8J A;  1H9M A;  4QB4 A;  5KND A;  1I5F A;  3Q23 A;  1BO0 A;  4DR4 L;  4B3R H;  2Y0S E;  3W3A A;  1HTL D;  3BS1 A;  5KT6 A;  2ZM6 H;  4DV1 H;  2UVV A;  2XVS A;  1C3O A;  2PZU A;  2IA6 A;  2R84 A;  1GUG A;  4M8A A;  2X6L A;  4A3E G;  1RJT A;  1B70 B;  4HID A;  2ASD A;  1J5E L;  4M9U A;  1B7Y B;  2OTJ A;  4HSP A;  1BUV T;  2BQR A;  2V5A A;  1X55 A;  3C0F B;  2F1M A;  3LML A;  2A6H D;  2B2V C;  1EFI D;  3J7Y W;  1N8R C;  4DV5 L;  3MTS A;  4R7R A;  4AQY Q;  3ETH A;  3N6X A;  4ED7 A;  2JEG A;  4NXN H;  5J39 A;  1U4R A;  2J0T D;  1AE3 A;  2V4D A;  4LJZ C;  1STG A;  3S15 H;  1TWA H;  3CW2 C;  3RNU A;  2E2H B;  5KGU A;  3S14 H;  1BQQ T;  5DG7 A;  5LL6 b;  1PTO C;  4RMF A;  5I9P A;  2PI2 A;  1I94 L;  1IBK L;  5ELE A;  3V6K A;  2XGP A;  5KFG A;  3M3Y B;  2JQO A;  4I7A A;  3I91 A;  4KY7 A;  2L0C A;  1OO9 B;  5EKI A;  4C3H G;  3H3V I;  3I2Z A;  4JW0 A;  2VUM A;  2MCT A;  2I5H A;  2GN5 A;  2F3I A;  3EBE A;  4LF5 L;  3RLN A;  4RZQ A;  2WAC A;  5CV4 A;  3CCR A;  3U58 A;  4KHP L;  1DV1 A;  1A62 A;  4A3M B;  4EYI B;  1PFN A;  1JE5 A;  5CMD A;  1Q1B A;  5FLX L;  3Q8Q B;  3E3X A;  1CFM A;  2Q2H A;  4J1M A;  3CQZ B;  1IHZ A;  2R8H A;  2UXC L;  1ENC A;  4NP5 A;  1UE1 A;  5DQI A;  3T51 B;  2NB0 A;  4F4Y A;  2F4I A;  3GV5 B;  2DPI A;  1DD2 A;  4JPB W;  3W5O A;  4X62 Q;  2MGS A;  1DXM A;  1ONL A;  2SEB D;  1PHJ A;  1D1K A;  4UP8 A;  4JV5 Q;  4C2M H;  1SEI A;  3S2D B;  3RBD A;  3VR5 A;  4JBK A;  2UUA H;  1MIU A;  4A93 G;  1EEF D;  2C9O A;  4RH6 A;  3WO1 A;  4CDD C;  3Q0A A;  1J9O A;  1J5E Q;  3J80 i;  2EYL A;  1BCP B;  4L5T A;  4JV5 H;  3GTK B;  2K5Q A;  3AU7 A;  4N8X 1;  4X62 H;  2QCP X;  3S1Q H;  3RN2 A;  3MEF A;  3QFF A;  4A3M G;  3PR4 A;  3TQT A;  4IOA A;  4YCW A;  1N33 L;  2VUM H;  4BWS C;  4OON A;  3MC0 B;  1ZYR C;  1ZET A;  5HGQ A;  4BXX G;  3EYY A;  4M1U B;  2MFI A;  4TVA B;  1IBK Q;  2BOS A;  1TWG A;  1GYF A;  1RL2 A;  3EQL C;  3SDZ A;  4IRD A;  3WNZ A;  3QOJ A;  4DU9 A;  5LP6 F;  4JUZ A;  1L2F A;  2BH8 A;  4FXG C;  3IL8 A;  4DR7 H;  4F4Z A;  3RF2 A;  1LT4 D;  5EDW A;  4B9W A;  2FLL A;  2KVM A;  4DF7 A;  2EY5 A;  4MA5 A;  2I46 A;  1KLG D;  4R9W A;  5EPJ A;  2E5L L;  1C4Q A;  1D5X C;  1S5E D;  2A6E C;  3A5Z B;  4GLX A;  4BBS B;  4LFC H;  3SK8 A;  1PA6 A;  3M4Y A;  4HIM A;  3PV0 A;  1WTV A;  2E5L H;  3BZC A;  4HNU A;  5GAE C;  4GKK Q;  1C7Y A;  1VQ8 A;  5DGA A;  2HIV A;  2K4K A;  2A68 C;  4LF6 L;  1B2T A;  2ZXP A;  4I50 F;  4QWD A;  1GGO A;  2E2I A;  5KFQ A;  2Z1C A;  2E2J B;  3GID A;  1K8M A;  5BR8 Q;  1K8G A;  5COR A;  5HBR B;  2ID0 A;  3K5L A;  5LOV F;  4LH6 A;  3GIL A;  5KFC A;  4J9S A;  1IBM H;  1OXS C;  1X6O A;  5KX5 F;  3PW5 A;  4IPC A;  1S5C D;  1SYE A;  4X64 Q;  2RHQ B;  4DUY L;  5LMU L;  3I8Z A;  4AYB A;  1BVS A;  4GNX C;  1HNX Q;  2CZG A;  1BXR A;  1N33 H;  4MV6 A;  1K8O A;  1PK8 A;  2RCN A;  1FNW A;  3QZ8 A;  4I7Z C;  1AZQ A;  3CVZ A;  4YCU A;  1EHI A;  2J6U A;  5KFE A;  5EBC A;  2VQF L;  1WCM G;  1IBL H;  2MP1 A;  1BNC A;  3HOU G;  4EQP A;  5L9X A;  2FXQ A;  1IBM L;  3GTK A;  2UUA L;  1Y1V G;  3PO3 B;  3HRZ C;  2K52 A;  2K14 A;  1EU4 A;  1NY4 A;  3OW2 A;  2Z4H A;  2JSO A;  3GTM B;  2W6Z A;  3MXN A;  4ED2 A;  1M6V A;  2CW8 A;  2R92 H;  4O2B F;  5JQW A;  3AFQ A;  3X3M A;  4DAV A;  1ZKO A;  1D6E C;  2AUK A;  3GTP H;  4B3S H;  1Q7Y C;  2VOB A;  4XYM B;  3OSN A;  3KXY T;  2VQF H;  4IJH A;  2E2I B;  4WFN 3;  1EZ1 A;  3EPG A;  2AUJ D;  2JA6 G;  3CCS A;  1I7N A;  1HRJ A;  1HQM C;  1SMX A;  3ERS X;  4LF8 L;  1DIK A;  2AGO A;  3J7A 5;  3GTM H;  1UC8 A;  2A6E D;  2HUG A;  4LAA A;  3MAQ A;  1PX2 A;  1XYI A;  4ECZ A;  1CUK A;  4F4W A;  3L0O A;  4PZ8 A;  1TWF H;  3GII A;  5LMN L;  5IYB H;  4DV6 Q;  3S1M B;  3UDF A;  1VQB A;  2I5L X;  2PQA B;  3CCM A;  1XNR H;  2WB1 A;  1M0T A;  3OTO L;  5C44 G;  1WTR A;  4J0M A;  5C1O A;  1CSQ A;  4K5W A;  1JDB B;  4DR1 H;  1JJC B;  4DR6 L;  1KAW A;  5IWA Q;  1HNX L;  2NVT H;  3OUU A;  1XWE A;  3KBX A;  4FP5 D;  3VR6 A;  1K83 H;  4YR0 A;  5EKL A;  1AN8 A;  3F2B A;  3DWQ A;  1RYS A;  3HS0 C;  4DL7 A;  2A74 C;  4HN7 A;  3HFZ B;  1NR4 A;  2O5I C;  1KXL A;  1GOZ A;  5KFI A;  1U4P A;  4WJ4 A;  2EYP A;  2N8N A;  5GQO A;  2E2H H;  2ASL A;  3T5J A;  1HNZ Q;  5LL6 S;  4DA2 A;  1KL9 A;  4EYH B;  4B3S Q;  3M7G A;  1RD9 D;  5IT9 W;  3GV7 B;  3SGI A;  4JBJ A;  2NVQ H;  4DV3 Q;  2KSW A;  3I4N H;  2VXW A;  1SYD A;  1CZW A;  1E4G T;  1F9Q A;  2B2V A;  4OIJ A;  1JWS D;  4ECS A;  1EIH A;  2EYH A;  4DR4 H;  4IUT A;  2FMA A;  5KFH A;  3TN2 A;  5JEA H;  4BBS G;  3R23 A;  5CBA E;  4RAY A;  1MHW C;  4PWQ A;  4KN4 C;  1X54 A;  2FK1 A;  2MO0 A;  1DOL A;  4MTD A;  4ZCK A;  1Q12 A;  3SXH A;  1Y69 U;  2DY7 A;  1VQI A;  1M90 C;  3H3V C;  1VAJ A;  2ALY B;  4ZQ3 A;  4RB2 C;  5DLF A;  2JA5 H;  1GSA A;  4DR5 L;  1RJQ A;  3OSO A;  4RU9 A;  3ZJY C;  1JB3 A;  4Y52 H;  4PNY A;  3TQY A;  2NU7 B;  3RUZ A;  2RGV A;  2KCN A;  4DXG A;  1L0Y B;  4X64 H;  4N9P A;  2Q8R E;  3OHA A;  4TKO B;  4B3M H;  4EVO A;  1LAB A;  3HOZ H;  4UDU C;  3Q22 A;  4LF9 Q;  1GUO A;  3O13 A;  4DV4 H;  5IY0 A;  1JX4 A;  2D9U A;  1I3Q H;  1SMY D;  4GN4 B;  3S1Q B;  4FBT A;  5KFJ A;  5A2Q E;  4RZR A;  1Z6H A;  2ZTE A;  4LF6 H;  3B6Y A;  3CCJ A;  4I55 F;  3ULL A;  4OXP A;  4LFC L;  2EIF A;  2K7V A;  3T13 A;  5IP9 H;  5D8D A;  1W93 A;  4CJ2 C;  2AQ2 B;  1I3Q B;  2NVX A;  3VMM A;  5M5X H;  1E24 A;  3NQI A;  1L1O B;  1STE A;  3DWP A;  3LWE A;  4AIM A;  2GVB A;  5KEE A;  3QO2 A;  2VQE L;  1G6Z A;  3LP8 A;  4F50 A;  3TZU A;  1CTM A;  4FF2 A;  2AGQ A;  4Q5V A;  4LFB Q;  1EIY B;  1EYZ A;  3C1E A;  4UAI A;  1IBK H;  1SYB A;  2B39 A;  1VQN A;  2DIK A;  1HQR D;  4UCS A;  3CPF A;  5KNC A;  4AH6 A;  2E74 C;  4LF8 Q;  4DR2 L;  1CKN A;  2C35 B;  2CW0 C;  1JT8 A;  3PIP A;  2JEF A;  3CC2 A;  1Z2O X;  3HOW H;  4H0L C;  4DK1 A;  4ED8 A;  3JSL A;  2CW0 D;  4TRD A;  3HEJ A;  1VQ6 A;  3TP7 A;  3NP8 A;  5M5W H;  4R8N A;  1XMO Q;  2J9G A;  2W6P A;  4DL4 A;  5C8Y F;  1K73 C;  3RBE A;  4A3B B;  4LWC A;  1PH3 A;  4IFD I;  4IFD G;  5D1O B;  1EYD A;  2AWN A;  3OTO Q;  3CMA A;  1HUN A;  1GUS A;  3J80 L;  1SLJ A;  4O3S A;  1B33 N;  4KHV A;  1T5E A;  3I4L A;  4DR3 L;  2YTV A;  5C1P A;  3KLS A;  2K01 A;  4XTC S;  2I80 A;  5M3M H;  2VA3 A;  4JBW A;  3HKZ A;  1SE2 A;  5LMU Q;  5AFW A;  1PTO D;  4RGM A;  1LTI D;  4A3B H;  4UPA A;  1JJG A;  1LTG D;  1EIF A;  5DLG A;  2BQU A;  1Y1V H;  4MTN A;  2EYO A;  5IYC G;  2MJ8 A;  2ES2 A;  2TSS A;  1SNP A;  2F03 A;  1XNQ Q;  1TWC A;  2Z6B A;  4DPG A;  1SMY C;  3PQI A;  2HT1 A;  3P1H A;  4ECU A;  2E76 C;  3PMF A;  3MJF A;  4UP7 A;  5IGG A;  2CVR A;  4ED6 A;  2JEI A;  2K50 A;  2I07 B;  2QA4 A;  3N52 A;  4A3B G;  4GKJ Q;  1TWF A;  5C4H A;  3VYR A;  4DUZ Q;  3V05 A;  4LF5 H;  2L15 A;  3BG5 A;  4BY1 B;  2NVY B;  2PMZ B;  3OHB A;  3D4W A;  1R9T A;  1EY8 A;  5JJI A;  4K2L A;  4R1J A;  2TMP A;  4EBE A;  2O5J C;  5FJ8 H;  1FKA H;  2JEB I;  4HR7 A;  4WJW A;  1VQA A;  3I4N G;  4A93 H;  1F9R A;  4PMC A;  4O3Q A;  4IOC A;  1GSO A;  4JI5 Q;  3JAM i;  1N34 Q;  4DGZ A;  1F9S A;  3GDE A;  5LL6 X;  4MAM A;  4G3I A;  1YNJ C;  3J81 W;  3KAL A;  3RAX A;  3FMC A;  3TRZ A;  4RUC A;  1NUC A;  2XIG A;  2M05 A;  3D31 A;  3IRB A;  4BA2 I;  3CQZ A;  5EKK A;  1BCP C;  1EEI D;  2K1B A;  1JCK B;  4K6L A;  4LMQ D;  1IOV A;  1PZJ D;  4X3S A;  3S1M H;  2FP4 B;  5KFT A;  1XTD A;  2JEJ A;  5FO7 B;  5D65 A;  1HNW Q;  4QL5 A;  1X3E A;  3S16 B;  1ROD A;  3H15 A;  3E0J A;  3JAM L;  4MN3 A;  4Q8F A;  4RHS A;  1CKN B;  1EWH A;  2QF7 A;  2JA6 A;  2XNA C;  2YV5 A;  2A5H A;  5CA0 F;  1B53 A;  1VQG A;  5KRU A;  1T3N A;  4QIW B;  4FYD A;  3ZYY X;  1KDC A;  2HCI A;  4B3R Q;  3Q8P B;  1N34 H;  3OIQ A;  1JOK A;  3FDT A;  5JPN C;  4BXX H;  3MR6 A;  4HYK A;  5IGD A;  5GON F;  1VQO A;  3RJ0 A;  5J2U F;  4JYA Q;  1G51 A;  2I87 A;  2BR0 A;  2EYM A;  1K3R A;  1B6R A;  2HIX A;  4EGJ A;  1Z2P X;  4O4H F;  2B2U A;  5D3D A;  4DV2 Q;  4MV1 A;  3BVM A;  4DR1 L;  2R7Z H;  4DAY A;  5FLX E;  3H0G A;  3MWE A;  4MV9 A;  5IGB A;  3H09 A;  4NPS A;  4RGN A;  3K57 A;  2N55 A;  1D7Q A;  3KLR A;  3JZI A;  1S03 G;  3HGB A;  2JXM B;  2F0M A;  3K7U C;  2ENB A;  3VDY A;  4WBN F;  5HUR A;  1QZH A;  3FPU B;  3J80 E;  4JI4 L;  4EEQ A;  1D1I A;  3K81 C;  4FS1 A;  4CDC C;  2C2E A;  4PMB A;  4QJF A;  2Q2I A;  2XD4 A;  5KFK A;  1EY5 A;  2EYF A;  2M00 A;  3GQC A;  3SK5 A;  5JJL A;  4IO9 A;  4C5B A;  4DUY Q;  4CBV A;  4KKU A;  1EYC A;  1SYX B;  3UDX A;  1OXT A;  3L9A X;  3RGZ A;  4JBM A;  3HOV B;  2ZDH A;  3UI2 A;  1H9R A;  4A3I B;  3UFX B;  1EFW A;  1B9M A;  1FR3 A;  2EYJ A;  3TRE A;  4XYO A;  2KQ3 A;  1LT6 D;  1YJN A;  1PH6 A;  1NJI C;  4ZHQ F;  1Y1W G;  4XX0 B;  2CQA A;  3S15 B;  2EY2 A;  4PG3 A;  2YRX A;  1TAE A;  1UNS A;  3A55 A;  3NBH B;  4JOI A;  4QCL A;  2JA7 G;  1O7I A;  1LUZ A;  3X3N A;  1W6J A;  2A69 D;  3TS0 A;  2F0T A;  4HR7 B;  4FF1 A;  1JWM D;  3MFY A;  4YB8 B;  5IOC A;  2IP4 A;  3JRX A;  1HZ9 A;  3KF8 B;  4DR3 H;  3M3Y H;  3OSP A;  4RNM A;  1CSP A;  4XQJ A;  4R4Q A;  4NB3 A;  2N88 A;  3PIO 3;  1T36 A;  2ASJ A;  3DM1 A;  1IYV A;  1DOM A;  5A2Q L;  1GLV A;  4C56 C;  4ECX A;  1Z9F A;  2NVX B;  1I3Q A;  2GVA A;  2NWG A;  5BPF A;  4XQQ A;  1LO5 D;  3J81 c;  1VDZ A;  3DHQ A;  2WAQ B;  3HBL A;  4U6P A;  3FKI G;  1T5X D;  1KD1 C;  4C3I B;  4DV0 L;  1NCV A;  4NXM L;  3SE7 A;  4DUY H;  2HQL A;  2OEO A;  4LFB H;  1MGS A;  3A8K E;  5I9O A;  2O4X A;  1S72 A;  3RUP A;  5M5X B;  1ULZ A;  1Y8N B;  4C1N I;  3FPP A;  4HJ8 A;  2EPB A;  4FNF A;  2VPS A;  2JA7 B;  4TQU S;  5IP7 H;  3K8A A;  1AUV A;  3LWB A;  5ELC A;  1VBH A;  1HA5 A;  1QJO A;  1SNQ A;  3RIZ A;  4FU0 A;  2FE3 A;  4O3P A;  4R8U A;  4C3J G;  3TSS A;  4HQ6 A;  3T53 B;  3PW0 A;  1B4O A;  3K80 C;  4JI1 H;  3PF5 A;  1DJR D;  2JK8 A;  4ZK9 B;  2JN4 A;  1XMO L;  1D5Z C;  3FRP B;  5IYB G;  3CPW A;  5LMN W;  1E1O A;  4RKB A;  4DV4 Q;  5IP7 G;  2EJF C;  2YU9 H;  4Y8V B;  4O3R A;  1LYL A;  1YHB A;  1JXL A;  1I6V C;  5HY6 A;  1KJJ A;  5KFY A;  3CP0 A;  1VQL A;  1N56 A;  4B3M Q;  2K05 A;  3GTL H;  3QZ7 A;  2RQX A;  2VPQ A;  1SE8 A;  2DJG C;  5KG5 A;  1STN A;  3S17 B;  1QVC A;  1LAC A;  2FFK B;  4APM A;  3I70 A;  3V6H A;  5FLX W;  4O1N A;  1AUX A;  4HED A;  2EY6 A;  3BYY B;  4RCN A;  1GM5 A;  3ONA B;  3Q6S A;  1XJV A;  4B9X A;  3N44 B;  2J4X A;  1X3P A;  3GTG B;  2F0E A;  4YAK B;  4XIG S;  1LTL A;  5JVD F;  1LM0 A;  4OEM B;  3G48 A;  1CT1 D;  2B2Y A;  4DR5 H;  1BNZ A;  2AKW B;  3V4Z A;  1IOW A;  2I0Q A;  2ZJR A;  3EFX D;  1JJ2 A;  2K03 A;  3M9M B;  2DNC A;  3BA8 A;  3PVX A;  1MZB A;  1Q8K A;  3JAM E;  5G3L F;  3CCU A;  5K36 H;  4EX5 A;  4DUZ H;  1O80 A;  1UAP A;  2JA8 B;  1B3Q A;  4O42 A;  4XZ3 B;  5AJ3 L;  3L4J A;  4ME3 A;  2NU9 B;  2C22 A;  4P71 A;  1U4M A;  1G29 1;  2WAQ A;  4DLK A;  2K32 A;  5FOB B;  3HOV G;  4WD3 A;  2PVP A;  2MO1 A;  4OX9 L;  4A3G B;  5COY A;  4A75 A;  1AZP A;  2QKI C;  3MXG A;  4TSS A;  4JI8 Q;  1D2B A;  1JOO A;  5KT4 A;  2F0K A;  3K5O A;  4F88 A;  1EUJ A;  3K7A B;  2G5D A;  5KFZ A;  1BGW A;  2XC9 A;  4MV7 A;  4PDB A;  2H5X A;  2YS6 A;  4DL2 A;  4CDF C;  3A0J A;  4X64 L;  1S10 A;  4A3K B;  1MJE A;  1CA5 A;  1PZI D;  2UUC L;  1YNN C;  3R5F A;  2F0D A;  2Z6K C;  3TII A;  2PNR C;  5CBE E;  2VQE Q;  5DNF A;  1V4Y A;  2ATL A;  3I72 A;  3EA6 A;  2IMW P;  4FF3 A;  1C0A A;  1VQF A;  2PQE A;  3MHB A;  4NXM Q;  4RNN A;  1MSH A;  2I5M X;  2JJQ A;  2ASB A;  1YHA A;  2P5Z X;  2DWC A;  4ZQI A;  3BJY A;  2LY7 A;  1L2Z A;  1KJI A;  2RDF A;  3IFD A;  3I56 A;  4QUC A;  3GTO H;  5M5Y B;  5ELB A;  1L0W A;  1NMF A;  5CA1 F;  3D4R A;  1LT5 D;  1GSH A;  1B9N A;  1JIC A;  4MTK A;  5KFO A;  4OEL B;  1HJP A;  1H9S A;  1M7J A;  4JI3 L;  4MNO A;  5EZY F;  1I4P A;  1CQV A;  1H9K A;  3I90 A;  1OWT A;  3F2D A;  2B2U C;  1GHK A;  2VL6 A;  1SNO A;  1S5B D;  1I50 B;  2FPI B;  1HZB A;  2XCL A;  3Q8R B;  1I4H A;  2AU0 A;  3GTM A;  1E7Z A;  3W1G A;  3RR5 A;  1DON A;  1TWH H;  1MKH A;  5JVH 3;  4XT1 B;  1ESR A;  2BDN A;  3FKI A;  4DR6 H;  1NBW A;  4RGO S;  5EGT A;  1N48 A;  3RLO A;  4KK7 A;  3V96 A;  5ISR A;  2OF1 A;  4LF9 H;  4FXD A;  4FDB A;  1EIG A;  2RSN A;  4QQB X;  3G71 A;  1HCZ A;  1TA8 A;  2R92 B;  2CW7 A;  1FGB D;  2F0P A;  4DAP A;  4KLK A;  5EAY A;  5L1J A;  4CHT B;  5CYU A;  2VA2 A;  4YBZ B;  4Z9C B;  2DNE A;  2F3V A;  3S24 A;  3PW2 A;  2C28 A;  1QUQ B;  4EEY A;  4MV4 A;  2BH2 A;  5C5J A;  4JI1 L;  5C3E G;  3H3V H;  3OMG A;  1NSN S;  5JJK A;  3GIQ A;  3VA5 A;  4EGQ A;  5D3I B;  2SCU B;  4QIW E;  2W70 A;  1EWC A;  4O0A A;  1G6P A;  5HV6 A;  4OX9 H;  3M4I A;  4KKS A;  3BZD B;  5IGC A;  2D0O A;  1RJP A;  2ZXO A;  4ME6 A;  3E0E A;  5GAD C;  2XRQ D;  4YCV A;  3MZ5 A;  2K5V A;  2F0I A;  2KJX A;  5BN3 A;  2KED A;  4DR7 Q;  1LTT D;  4NKL A;  5KT3 A;  3VYT A;  1GJX A;  3GIM A;  4DNT B;  1TR5 A;  3R5X A;  2AHO B;  1K83 B;  1CK1 A;  3M4Q A;  1HNW L;  4KJO A;  5CV5 A;  3KLS X;  4BY7 H;  3L4K A;  2UUB L;  1HPC A;  4QGU A;  4WOR A;  2WAQ E;  2SOB A;  3FDS A;  3MWM A;  4TQR A;  1XNQ H;  1SEB D;  1FNU A;  3M4P A;  1MD2 D;  3GTJ H;  2R3Z A;  1SE4 A;  3J81 i;  2XCA A;  2RVL A;  2WV6 D;  4K8I A;  4LF4 L;  1Y14 B;  4O4L F;  4DV5 H;  1SR3 A;  3J7A K;  5I4D A;  3SR1 A;  1PH9 A;  1WD1 A;  3GTL B;  4UCV A;  1E4E A;  4UP9 A;  1OXU A;  2IHE A;  4ILW A;  2KHS A;  1B1Z A;  3GTJ B;  1J8I A;  2KHI A;  2HQE A;  3GV6 A;  4ABN A;  3P7J A;  3ETJ A;  1UEB A;  2K28 A;  2IHF A;  5FO9 B;  4C2M A;  4YY3 H;  1XMO H;  4EQ5 A;  3KAJ A;  4UHV A;  3DEP A;  4HJ9 A;  1WTH A;  2YTY A;  1SNC A;  3MR5 A;  4LUZ A;  3AQQ A;  3GIP A;  1F77 A;  2ZJT A;  3RLF A;  4IWX A;  1HTP A;  1L1O A;  2RBM A;  1X32 A;  4K6D A;  1X3F A;  4G7Z C;  2F0O A;  1QIL A;  3R3O A;  1IW7 C;  4BWG B;  5ELD A;  2HDM A;  4B3T Q;  3S1N H;  3JAM c;  1BR9 A;  4GKK L;  1WSC A;  5DQG A;  3A8J E;  2NVQ B;  2W6M A;  4HIO A;  5J1Z A;  2QK4 A;  1A2U A;  1VF7 A;  4RHR A;  1SRU A;  2IX3 A;  3KHG A;  3M9B A;  4QY7 A;  3WOE A;  1YEZ A;  4F8M A;  2JA8 H;  1S97 A;  1X3G A;  2LXJ A;  1PH4 A;  1X56 A;  1VKZ A;  2YZM A;  3H0G B;  4OWX B;  2F0H A;  3K6O A;  5M9O A;  2M9V A;  2NTS A;  4OIK A;  1U4L A;  4LFB L;  3MFI A;  1V8Q A;  3S1N B;  2Z4I A;  1S0N A;  5D14 A;  1E4F T;  3QOL A;  1ICW A;  1V1Q A;  3GD7 A;  4DAM A;  1LTS D;  4NXN Q;  1FYC A;  2E2H A;  2D0P A;  4U67 3;  3RD4 A;  4DV2 H;  2F3W A;  3AYH B;  3T5L A;  1Y1V B;  4BS9 A;  4FVM A;  3P20 A;  2F0Q A;  4ZLT F;  1WTQ A;  1U5K A;  1PH8 A;  1GXD C;  3K7A H;  1WI5 A;  1E0B A;  1KRS A;  3D6C A;  4JI0 L;  4GZY C;  3UE0 A;  5CV6 A;  2W9B B;  3HP3 A; 
#chains in the Genus database with same CATH homology
 4DV0 Q;  1XNQ Q;  1WFQ A;  1EYG A;  4DPG A;  1IBM Q;  2OQK A;  4KHZ A;  3OYY A;  2HT1 A;  3KYH C;  3J81 j;  1PYB A;  2ZM6 Q;  4DV1 Q;  3W1B A;  4UP7 A;  3I4M H;  1NTG A;  1EQR A;  1OXX K;  2ZJP A;  1AE2 A;  4IPG A;  2K50 A;  3ICE A;  5IYD G;  2QA4 A;  3HOW G;  4A3B G;  4BY1 H;  4GKJ Q;  2PQA A;  3H0G G;  4DUZ Q;  2L15 A;  2R7F A;  2OQ0 A;  2BA0 A;  5JJI A;  2VZA A;  2HHH L;  4R1J A;  3CCE A;  4GOP C;  5FJ8 H;  2JEB I;  4A4I A;  1VQA A;  3I4N G;  4A93 H;  1P8L A;  1UE5 A;  4IOC A;  4JI5 Q;  3JAM i;  2EXD A;  1N34 Q;  2A8V A;  2ZM6 L;  1TWG H;  4DV1 L;  3HOY H;  2B3G A;  3GDE A;  4H02 A;  3CME A;  4DAY B;  3CAM A;  4DKA C;  3CC7 A;  1YIJ A;  2JA7 H;  1W3S A;  2WP8 J;  2JA8 G;  4B3R L;  4YWL A;  2NZH A;  3TRZ A;  2DGY A;  5GRO A;  3D31 A;  3IRB A;  4BA2 I;  2XTI A;  4L5Q A;  1VQ7 A;  2LSS A;  2IY5 B;  3AFP A;  3S1M H;  4YWM A;  1XTD A;  2XGT A;  4BBR G;  4DV2 L;  4IFD J;  4QL5 A;  1X3E A;  5IYC H;  1HNW Q;  1N33 Q;  2V1C C;  2N3S A;  3H15 A;  3G6E A;  1U0L A;  4DV7 Q;  4JYA L;  3GTK H;  4A3L H;  1I6H H;  1CKN B;  3HOV H;  1TWC H;  2R92 G;  2MNA A;  3S1R H;  2UU9 Q;  4NXN L;  4R4T A;  5FLX c;  4P75 A;  2YV5 A;  4C3J H;  5C0X I;  5C0X G;  3PO3 H;  4UY8 C;  1QUQ A;  4LF9 L;  3S2H H;  1VQG A;  1Q46 A;  1ASY A;  4YY3 Q;  4B3R Q;  1OTC A;  1VQ4 A;  1IYJ B;  4BXX H;  3H0G H;  1Q1E A;  3RN5 A;  1VQO A;  1VCI A;  4JYA Q;  1G51 A;  3KDF B;  4A3K G;  1K3R A;  2HIX A;  3A5U A;  5M3F H;  4DV2 Q;  4DR1 L;  1YIT A;  2R7Z H;  4X66 Q;  4JI6 L;  2B63 H;  3FP9 A;  1GVP A;  1XNR Q;  3FKI H;  4NPS A;  2IX0 A;  1D7Q A;  3GTG H;  5H1S E;  4LFC Q;  2JA5 G;  1EWI A;  1FVI A;  3K7U C;  3VDY A;  4LF6 Q;  1I5F A;  1QZH A;  5E7N A;  4JI4 L;  4DR4 L;  3J7Z C;  3K81 C;  2Y0S E;  2K5N A;  2N78 A;  2KHJ A;  1IZ6 A;  4POF A;  3I7F A;  1PV4 A;  3MXN B;  2KBN A;  1WOC A;  4QJF A;  2Q2I A;  2IX1 A;  3UE1 A;  5FJ8 G;  5ELN A;  4C3H H;  3T1Y Q;  1DGS A;  4A3D G;  4A3E G;  5JJL A;  1FL0 A;  4IO9 A;  4DUY Q;  2VQF Q;  1B70 B;  4HID A;  1HZC A;  4LUO A;  3UDX A;  1J5E L;  4GLA C;  1TXY A;  2UXB L;  5K36 G;  1OXT A;  1B7Y B;  2OTJ A;  1N36 L;  4JBM A;  1P16 A;  1X55 A;  1C9O A;  4GKJ L;  3PO2 G;  1EFW A;  1SFO H;  1PYS B;  4R4C A;  3TRE A;  1YJN A;  1PH6 A;  1KHI A;  1NJI C;  3U4Z A;  5IWA L;  1Q82 C;  4DV5 L;  1N8R C;  1Y1W G;  4AQY Q;  3CC4 A;  3S2D H;  4KHP Q;  4PG3 A;  3T1Y L;  4AYB E;  3NBH B;  4JOI A;  4A3G H;  4DV6 L;  1LUZ A;  1O7I A;  1AE3 A;  2JA7 G;  3S15 H;  1TWA H;  1CKO A;  3CW2 C;  3KDF A;  3RNU A;  3TS0 A;  2JEA I;  5C4J H;  2WB1 E;  1HR0 W;  3S14 H;  4K0K L;  3KF6 B;  1HZ9 A;  3KF8 B;  1IBL Q;  2OTL A;  3M3Y H;  4RMF A;  1CSP A;  1I94 L;  2PI2 A;  4R4Q A;  1IBK L;  3PUZ A;  4NB3 A;  1BBW A;  1VQH A;  2JQO A;  3E9I A;  1S40 A;  3ER0 A;  5C0X J;  3H3V I;  3I2Z A;  3L2P A;  2I5H A;  2GN5 A;  2F3I A;  3HKZ E;  3EBE A;  4LF5 L;  1Z9F A;  3RLN A;  2QEX A;  3CCR A;  1EOV A;  3U58 A;  4OO1 G;  4OO1 I;  2K75 A;  5IYD H;  4KHP L;  2GVA A;  1A62 A;  2UXD L;  2ATW A;  1JE5 A;  3J81 c;  1Q1B A;  1Q81 C;  2B29 A;  4IJL A;  3FKI G;  1CKM A;  4L5R C;  1YZ6 A;  2Q2H A;  3I4O A;  1UWV A;  4DV0 L;  4A3M H;  2NN6 G;  2NN6 I;  1KD1 C;  4NXM L;  2HQL A;  2UXC L;  1HZA A;  4K0K Q;  1UE1 A;  4DV7 L;  1S72 A;  1AH9 A;  4AYB G;  3W5O A;  5ELO A;  4X62 Q;  4APV A;  4HJ8 A;  5J3B A;  1YJ9 A;  4JI1 Q;  1PHJ A;  2ZTD A;  4AQY L;  4TQU S;  4UP8 A;  5IP7 H;  3K8A A;  4JV5 Q;  4C2M H;  5LMN Q;  1L1O C;  4LFA Q;  4JBK A;  2KCM A;  3Q8D A;  5JEA G;  4BBS H;  1XMQ L;  1MIU A;  2E2I H;  4A93 G;  4LNQ A;  3PO3 G;  4OWT B;  1HNZ L;  5C4X G;  1J5E Q;  3J80 i;  4L5T A;  2UXC Q;  3K80 C;  3HKZ G;  3ULP A;  1VQ5 A;  3PF5 A;  1N34 L;  2JK8 A;  4HJ5 A;  4DR7 L;  1XMO L;  1FJG L;  2F4V L;  1N32 L;  5FLM G;  5LMN W;  2YU9 H;  5IYB G;  3CPW A;  4DV4 Q;  1E1O A;  1A0I A;  2R6G A;  5IP7 G;  3S1Q H;  3RN2 A;  1LYL A;  1YHB A;  3MEF A;  4A3M G;  5HY6 A;  4HJ7 A;  3HOU H;  3CP0 A;  1VQL A;  4IOA A;  1KQS A;  4YCW A;  4B3M Q;  4P74 A;  1N33 L;  4DR4 Q;  2VUM H;  1PFS A;  3GTL H;  3E9H A;  1MJC A;  4OON A;  1SE8 A;  4PZ7 A;  4GOP A;  1QVC A;  5HGQ A;  4BXX G;  4A3E H;  1D8L A;  1XMQ Q;  3BJU A;  2MFI A;  2A19 A;  4TVA B;  4A3K H;  1IBK Q;  1RL2 A;  2UU9 L;  1HH2 P;  1GM5 A;  3CD6 A;  1XJV A;  4A3I H;  3HOZ G;  1L2F A;  2BH8 A;  2VY3 A;  5M3M G;  2NVX H;  5C44 H;  1VQK A;  1SRO A;  3LGJ A;  2JA9 A;  4IPD A;  1LTL A;  4XIG S;  5C3E H;  4YY3 L;  1YJW A;  1LM0 A;  1PH2 A;  1XNQ L;  4JC0 A;  3G48 A;  4JG2 A;  5BR8 L;  1PVO A;  4X65 L;  2ZJQ A;  4B3M L;  1WJJ A;  4BY1 G;  1VQC A;  2E5L L;  1UE7 A;  3PSI A;  3A5Z B;  4GLX A;  2AKW B;  1NE3 A;  3J80 c;  1PA6 A;  4HIM A;  3PV0 A;  2ZJR A;  2I0Q A;  1JJ2 A;  4JI5 L;  3GTQ H;  3M4O H;  3BZC A;  5GAE C;  4GKK Q;  1C7Y A;  1VQ8 A;  2HIV A;  1YNX A;  2K4K A;  1Q8K A;  3KJP A;  2CQO A;  3CCU A;  4LF6 L;  2YYZ A;  4EX5 A;  3RZO H;  3D0F A;  4R4I A;  4A3J H;  5AJ3 L;  2R93 G;  4ME3 A;  2ZTC A;  4PMW A;  4P71 A;  1G29 1;  4PZ6 A;  5GAG C;  4B3S L;  5BR8 Q;  3BU2 A;  1K8G A;  4A3F G;  3HOV G;  2MO1 A;  2ID0 A;  5JEA J;  4OX9 L;  4A3J G;  1OXS C;  1X6O A;  4IPC A;  4X64 Q;  4DUY L;  2RHQ B;  4A75 A;  1GKH A;  5LMU L;  3EIV A;  1KIX A;  2F52 A;  1BVS A;  1JMC A;  1K9M C;  1Z47 A;  3NEL A;  4DK3 C;  4GNX C;  1HNX Q;  4JI8 Q;  1BKB A;  1YHQ A;  1EUJ A;  4RG1 A;  2JA6 H;  2RCN A;  3BZK A;  1IXR A;  1HR0 Q;  2H5X A;  3NEM A;  2DUD A;  2R7Z G;  4BA1 I;  4YCU A;  4X64 L;  3A0J A;  2VQF L;  1WCM G;  1MJE A;  3DM3 A;  3HOU G;  1QVF A;  2WFW A;  4OX9 Q;  1UE6 A;  4X66 L;  4JI6 Q;  2FXQ A;  4A3C H;  1IBM L;  2UUC L;  4DR5 Q;  2UUA L;  2Z6K C;  3CQZ H;  4C3I H;  1Y1V G;  2VQE Q;  2K52 A;  2K14 A;  3F2C A;  1NY4 A;  4JI3 Q;  3F8T A;  3M85 A;  3JC6 6;  4JI4 Q;  2OCE A;  3OW2 A;  2UXD Q;  4JI0 Q;  4X6A H;  1VQD A;  2R7D A;  1VQF A;  1EQQ A;  1C0A A;  1T9H A;  3FHW A;  3ULJ A;  2R92 H;  5M5Y H;  3I4M G;  3AFQ A;  4NXM Q;  2I5M X;  2JJQ A;  1XNR L;  1YHA A;  2ASB A;  4GNX B;  3GTP H;  1Q7Y C;  1VQP A;  3I56 A;  3GTO H;  1L0W A;  1NMF A;  3PF4 A;  4L5S A;  1I94 Q;  2B63 G;  4IJH A;  3A74 A;  2Z6K A;  3EN2 A;  2JA6 G;  3CCS A;  1YBY A;  1SMX A;  1HJP A;  3ERS X;  1VQM A;  4LF8 L;  2NZO A;  2Q2U A;  3J7A 5;  4ALP A;  3GTM H;  4DR6 Q;  4JI3 L;  1CUK A;  2RHS B;  4MNO A;  3TS2 A;  3L0O A;  4PZ8 A;  3RZD H;  3T1H L;  1TWF H;  4YWK A;  5LMN L;  5IYB H;  4DV6 Q;  3UDF A;  1VQB A;  2I5L X;  4JOI C;  2PQA B;  3F2D A;  3CCM A;  2Y0S G;  1JJG A;  2VL6 A;  1JT8 A;  1N36 Q;  3OTO L;  5C44 G;  1HZB A;  2E5L Q;  3S17 H;  1CSQ A;  1E7Z A;  3G4S A;  1JJC B;  3U4V A;  3W1G A;  3RR5 A;  4DR6 L;  1KAW A;  3KJO A;  5IWA Q;  1HNX L;  3KF6 A;  2NVT H;  1TWH H;  1MKH A;  1VQJ A;  1K83 H;  1A8V A;  2PNH A;  3PUV A;  4DV4 L;  4DUZ L;  2AWO A;  1NBW A;  3PIO A;  3U50 C;  2CKZ B;  3F2B A;  3RLO A;  3M7N A;  4MZ9 A;  3KLW A;  4GN3 B;  1A63 A;  3HFZ B;  1KXL A;  1WCM H;  4FDB A;  1QZG A;  4LF7 Q;  4QQB X;  3G71 A;  2YTX A;  1WYD A;  4WJ4 A;  5GQO A;  2N8N A;  2E2H H;  2OWO A;  1VS0 A;  1HNZ Q;  1V43 A;  5IT9 c;  1KL9 A;  2JE6 I;  4LUV A;  4KLK A;  5EAY A;  4B3S Q;  1GO3 E;  3SGI A;  4JBJ A;  5C4X H;  4DV3 Q;  2NVQ H;  3DLL A;  3K0X A;  1XPR A;  4GNX A;  3S24 A;  1VQ9 A;  4JI7 L;  1PH5 A;  3I4N H;  1QUQ B;  4P72 A;  1PH7 A;  2BH2 A;  4KI0 A;  4JI1 L;  3TEH B;  5C3E G;  3H3V H;  1H95 A;  4JV5 L;  5JJK A;  4BBS G;  3GO5 A;  2VNU D;  1V9P A;  4QIW E;  4X65 Q;  4O0A A;  1X54 A;  4DR3 Q;  1G6P A;  4LF7 L;  2MO0 A;  1N9W A;  2E8G A;  2E2J H;  4OWW B;  2D0O A;  1Q12 A;  1M1K C;  3E0E A;  5GAD C;  4BBR H;  2MQH A;  1VQI A;  1M90 C;  2CCZ A;  1K8A C;  4A3C G;  4YCV A;  2K5V A;  4J15 A;  2ALY B;  1KC8 C;  4DR7 Q;  3CXC A;  2JA5 H;  5GAH C;  4DR5 L;  2AMC B;  2UUA Q;  4LF4 Q;  3KOJ A;  1IL2 A;  3PCO B;  3ZJY C;  2WB1 G;  1W2B A;  2AHO B;  1JB7 A;  4Y52 H;  2IT1 A;  2PMZ E;  1YI2 A;  2CWA A;  3UDI A;  4LFA L;  1FGU A;  4JCV E;  3WWV A;  1HNW L;  3M4Q A;  4DV5 Q;  1NMG A;  3TQY A;  3PGZ A;  4BY7 H;  2QGQ A;  1R9T H;  2A1A A;  2PI2 E;  3F1Z A;  2UUB L;  4JI2 Q;  4QGU A;  1I50 H;  1YVC A;  4O2D A;  4P73 A;  2WAQ E;  4A76 A;  4POG A;  3I55 A;  4WJ3 M;  4YHH Q;  4A3L G;  2EQS A;  3HKS A;  4BY7 G;  4A3I G;  3HOZ H;  4LF9 Q;  1BBU A;  2Z0S A;  4GOP B;  3M4P A;  1ASZ A;  5IY0 A;  1X9N A;  1I3Q H;  3GTJ H;  3J81 i;  3STB D;  2Q2T A;  4GN4 B;  2BA1 A;  4LF4 L;  1Y14 B;  1SR3 A;  1FJG Q;  2ZTE A;  2F4V Q;  1N32 Q;  1E1T A;  3KFU A;  3B6Y A;  1Y1W H;  5IP9 G;  1PH9 A;  3CCJ A;  1E22 A;  1PH1 A;  4UP9 A;  1OXU A;  3ULL A;  2IHE A;  2VS1 A;  5M3F G;  4OXP A;  4GS3 A;  2EIF A;  1J6Q A;  4LFC L;  5IP9 H;  5FLM H;  2VW9 A;  3PO2 H;  1VQE A;  2KCT A;  2KHI A;  5M5X H;  1E24 A;  1L1O B;  1UEB A;  4GLV B;  4AIM A;  3CCV A;  2IHF A;  2GVB A;  2VQE L;  1SN8 A;  3UDG A;  1XPO A;  4DK6 C;  4X62 L;  4EQ5 A;  4R4O A;  3CCL A;  2CFM A;  4LFB Q;  2LXK A;  2WAQ G;  4HJ9 A;  2YTY A;  4GN5 A;  3PUX A;  1EIY B;  4A3F H;  4LUZ A;  3AQQ A;  2HHH Q;  4LW1 A;  1VQN A;  3PUY A;  3RLF A;  3S16 H;  2UXB Q;  1L1O A;  3CPF A;  1K0R A;  4AH6 A;  1X3F A;  4YHH L;  3S1N H;  4LF8 Q;  4DR2 L;  4B3T Q;  1CKN A;  2C35 B;  3JAM c;  1S3O A;  3STB C;  3PIP A;  2VUM G;  4A3G G;  4GKK L;  1B8A A;  1QVG A;  3CC2 A;  3HOW H;  1RIP A;  4IPH A;  4JI7 Q;  4HIO A;  1XPU A;  2K5H A;  1VQ6 A;  3AEV A;  1OXV A;  4JI8 L;  1SRU A;  3HOY G;  2JA8 H;  5M5W H;  3T1H Q;  4DV3 L;  1XMO Q;  3M9B A;  4QY7 A;  5AJ3 Q;  1YEZ A;  2NVY H;  3PUW A;  1GD7 A;  1X3G A;  2LXJ A;  2N49 A;  1X56 A;  3HOX H;  1K73 C;  4LWC A;  1PH3 A;  1PH4 A;  4OWX B;  5IE8 A;  4IFD I;  4HJA A;  1Q86 C;  4IFD G;  2RF4 A;  4LFB L;  2AWN A;  3OTO Q;  3NEN A;  3CMA A;  1IBL L;  2CWP A;  1KRT A;  4Y7N H;  4HIK A;  4DR1 Q;  4DAM A;  1SLJ A;  1V1Q A;  3GD7 A;  4DNI A;  3CCQ A;  4DR3 L;  4NXN Q;  4DR2 Q;  2UUC Q;  4B3T L;  2YTV A;  3L7Z C;  4XTC S;  4A3D H;  2D0P A;  5M3M H;  2R93 H;  4JBW A;  3AYH B;  1E3P A;  1X65 A;  5LMU Q;  3CF5 A;  2KEN A;  4LF5 Q;  1PH8 A;  3HOX G;  1U5K A;  4A3B H;  1WI5 A;  3K7A H;  4UPA A;  1KRS A;  4JI0 L;  1EIF A;  2D62 A;  1HR0 L;  1Y1V H;  4MTN A;  5DLQ E;  3UE0 A;  5IYC G;  2ES2 A;  4JI2 L;  2UUB Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...