4QJFA

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
186
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKKKAKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase, subunit E'
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
total genus 40
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qjfA02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qjfA01
2EXDA 2H5XA 2UUAQ 1VCIA 2UUCL 4JYAL 2KCTA 2YV5A 4YCVA 3TS0A 1N34Q 1KAWA 2VQFQ 2B63H 4DR1Q 3J7A5 2CQOA 1WCMG 4QQBX 4K0KL 2QEXA 1VQJA 1GM5A 1VQ7A 3A74A 3CC2A 4IO9A 2VNUD 1NBWA 3K80C 2YYZA 4LUZA 3CCLA 4GLAC 4JG2A 4L5QA 4IJLA 3HKSA 3ER0A 3HOWG 3S14H 1N32L 5M5YH 1W2BA 1S40A 1VQPA 1PH8A 1HNXQ 3CAMA 1KD1C 1KIXA 3K81C 4JI5L 2JEBI 4B3RL 1MKHA 1L1OB 3KFUA 2OQ0A 1HZCA 4R4TA 5C0XG 3BU2A 3CC7A 4IFDJ 4DR5L 4A3CH 4HIKA 3ULPA 4R4IA 4A3JG 4BXXH 3CF5A 1P16A 1J6QA 4APVA 3L7ZC 1B8AA 1D7QA 3I55A 1HNZL 1WFQA 1PH2A 2UXDQ 1X6OA 2K5VA 3IRBA 3UDIA 1Y14B 2N3SA 2PNHA 1DGSA 3RLNA 2Y0SE 2B29A 4BY1G 2MO1A 1FVIA 3PO3G 3S24A 4A3LG 3PIOA 4LUOA 1KL9A 1VQFA 2F3IA 4GOPB 2D0OA 3G4SA 3MXNB 2XGTA 4B3SL 1IBKL 2OQKA 2NVQH 3I4MG 1CSQA 1MIUA 2ZM6L 4DV2Q 4HIOA 1Y1WH 4JBKA 1HNWQ 1A63A 2CWPA 3G6EA 2EQSA 1EWIA 4DV3Q 1EQRA 3CMEA 1Z47A 2JK8A 1YI2A 1GVPA 3U4VA 1R9TH 4LF6Q 3A5UA 3GO5A 3GTJH 2QA4A 2C35B 2KBNA 3ULJA 4DK3C 5M3FG 1X3GA 1XJVA 4LF5Q 4LF9Q 3M4PA 4KLKA 5LMUQ 2OTLA 3DM3A 4GN3B 4UPAA 3S1QH 2R7ZG 4LWCA 4BBRG 3CPFA 2DUDA 1VQ4A 2UUBQ 2CFMA 5FJ8H 4QIWE 1SR3A 3J81j 4B3TL 1C0AA 4X6AH 2NVYH 4AYBE 2D62A 1YZ6A 1IBLL 1HZ9A 3HKZG 1EFWA 1IZ6A 1QUQA 3I56A 3UE0A 4DV4L 3S16H 1X9NA 1TWCH 3J81i 4MZ9A 4A3KG 1L0WA 5C3EH 2ALYB 1QVGA 1BVSA 4X64Q 3Q8DA 1TWGH 4AQYL 1L1OC 4DR2L 3CCQA 3CCVA 3EIVA 5GAHC 2R92H 2UXBQ 3J80c 4KHPQ 4JC0A 2ASBA 3NEMA 4ME3A 4NB3A 3BZCA 5BR8Q 4JOIA 3J7ZC 1J5EL 1GKHA 4TQUS 1EYGA 5JJLA 5C4JH 3T1YL 1A8VA 2IHEA 4IFDI 2JA6G 1JMCA 3AFQA 5IP9G 1K9MC 1YHQA 5JJKA 4GS3A 4GKKL 1VQ5A 4QL5A 4YY3L 4PZ8A 1NY4A 4A93H 4GOPC 4UP7A 1SMXA 5LMNQ 1I94L 4JI6Q 4DV5Q 2OTJA 3BJUA 5FLMG 4A3FH 1UE5A 3STBC 3E9HA 1SFOH 3GTGH 1FL0A 1EIFA 4OWXB 2HT1A 5IYBH 1X65A 3JAMi 4A3MH 1CKOA 2Z0SA 1VQ6A 3H3VI 2K4KA 4LFBL 1XPUA 3H15A 4BBSG 3F2CA 4DUYQ 1BBWA 4HJ7A 1KC8C 2BH2A 1JB7A 3OTOQ 3CC4A 3CD6A 5IE8A 3CW2C 4HJAA 3ULLA 2N78A 4A3IG 3CQZH 1MJEA 2LSSA 5IP7G 3S1MH 4YWLA 3WWVA 1YJNA 4JBJA 2GVBA 5IY0A 1E24A 1WCMH 2HQLA 1Q8KA 2KHJA 1LM0A 3F8TA 3PCOB 3CPWA 3RN5A 3TEHB 1XMOL 4JI4L 4JOIC 2FXQA 2K5NA 1I6HH 4JBMA 3PV0A 2D0PA 1VQNA 2GN5A 3HOWH 4GKJL 1CSPA 1E1OA 2DGYA 5IYCG 2JA9A 4X66L 4Y7NH 5ELOA 1SN8A 2PI2E 4LW1A 2F4VQ 3L2PA 1XNRQ 3A5ZB 1T9HA 1NJIC 4LFCL 3E9IA 2JA8G 2JQOA 4A3JH 2ZTCA 3UE1A 4GNXB 3I4NG 1VQIA 1VQ8A 3RZOH 2JJQA 3E0EA 2ES2A 1PV4A 2RCNA 1E7ZA 4ALPA 1JJ2A 3S1NH 1N34L 5GQOA 1OXXK 3KDFB 2CWAA 3G48A 4IPDA 2VS1A 3PF4A 4LFAQ 4X62Q 4BY1H 4P75A 3TQYA 4DKAC 3FKIH 3STBD 5GAGC 3PO3H 4BY7G 4A3LH 1PFSA 1IBMQ 1P8LA 1UE1A 4LF8L 4OONA 1Q12A 2BA1A 2WAQE 3DLLA 3HOYG 3I4MH 3W5OA 4IFDG 4YWKA 4P72A 1YIJA 3HOUH 4OWWB 3D0FA 5FLXc 3T1HQ 1VQGA 4PZ7A 3PIPA 2IY5B 2L15A 3HKZE 4LF7Q 1QZHA 5M3FH 2RF4A 3PUXA 3KJPA 2UUCQ 4J15A 2Q2IA 3PUVA 2ZTDA 4IPCA 1AE2A 2RHQB 5M5XH 3W1BA 2VQEQ 1Q81C 1KQSA 3ERSX 1VQDA 2AWNA 4BBRH 1ASZA 2R7ZH 1KXLA 2NN6I 3KOJA 3NELA 4NPSA 1AH9A 1L1OA 1Y1VG 4UY8C 3CP0A 4DUZQ 3RNUA 5IWAQ 4DV1Q 1VQBA 1YJ9A 2UXCL 3AYHB 1UE6A 4NXNL 1LUZA 4OX9L 3GTLH 4A3KH 4TVAB 1FGUA 3M4QA 4XIGS 2NVTH 4DV2L 2Q2UA 4L5RC 4LF4L 1HNWL 4DV3L 1Q1EA 1Q7YC 4LF6L 3A0JA 4GNXC 1ASYA 2HIXA 2E5LL 4B3ML 4LF9L 2MQHA 4DR4L 4NXMQ 4YWMA 1TWHH 1HNZQ 2MFIA 1Q1BA 4GOPA 4OXPA 1Q86C 2JA6H 3ZJYC 5IP9H 4R4OA 1Z9FA 2ZJQA 1LTLA 1JJCB 5IYDG 4X65L 2N49A 1EIYB 1HJPA 3PUZA 1OTCA 3GTMH 2RHSB 1N36L 1IYJB 4B3SQ 3M9BA 4GLXA 1IBKQ 3GTKH 1YJWA 1D8LA 2AHOB 3AFPA 3MEFA 1UE7A 5JEAJ 4R1JA 3U50C 4X64L 5FLMH 2ZJRA 3F1ZA 2IT1A 3K8AA 4HIDA 4PZ6A 1PHJA 2PQAB 5BR8L 4BBSH 2VZAA 2JA7G 1C9OA 4XTCS 3AEVA 4A3EG 4A3IH 5C44G 1PYSB 3GTOH 5IP7H 4C3JH 3HOXG 1K3RA 3RR5A 1VQMA 1GD7A 2CKZB 2EIFA 1PYBA 2K52A 4GLVB 3S1RH 3H0GG 2Q2TA 1IBLQ 3PGZA 5C4XG 4DV4Q 2K14A 1HZBA 2N8NA 3PUWA 5AJ3Q 2YTVA 4JI2L 3KF6B 4A4IA 2YTYA 3I7FA 1NMGA 5LMNL 1U5KA 4DV5L 4JI6L 2A8VA 2VY3A 3M4OH 1NMFA 5IYCH 4JI1L 3J81c 4AQYQ 4DR3L 2NVXH 4JI8L 1FJGL 2E2IH 1UWVA 2LXKA 1N33Q 4P71A 4A76A 2IX0A 4KI0A 2NN6G 3M85A 1PH9A 4YHHQ 2OWOA 5HY6A 4DUYL 4HJ5A 2JA8H 1J5EQ 1OXTA 1OXSC 3OTOL 3G71A 2HIVA 3I4NH 2OCEA 3T1YQ 5DLQE 3RN2A 1XMQL 4DV0L 2KCMA 3TS2A 2KENA 4JV5L 1TXYA 4QJFA 4DV6Q 3L0OA 2JEAI 4L5SA 2HHHL 4GN5A 5ELNA 3PF5A 2MNAA 4DR6L 3S2HH 4YY3Q 4JI3Q 4GKKQ 5K36G 4A3DG 4O2DA 3S2DH 4IPGA 1A0IA 4BY7H 1OXVA 1B7YB 1VS0A 3OW2A 4DV7Q 1XNQQ 1V1QA 1I94Q 1AE3A 1I50H 1N9WA 3LGJA 1G51A 2WP8J 3HOYH 1PH7A 1HR0L 4JI0Q 1YVCA 2F4VL 1A62A 1I5FA 1XNRL 5HGQA 4A3GG 4LFBQ 1Q82C 3KYHC 2BH8A 1CKNB 3K7AH 2VUMG 3HOZG 4RG1A 1KHIA 2UUAL 4QY7A 1HH2P 1EQQA 3CCEA 3EN2A 4AH6A 4JI7Q 4PMWA 2K75A 1SLJA 2VQFL 5H1SE 2VW9A 1L2FA 1WOCA 3NENA 4DR1L 2WB1G 4C2MH 1GO3E 3PO2G 1Y1VH 5M3MG 4LUVA 4HIMA 2BA0A 1CUKA 3H3VH 1H95A 2I5MX 4GNXA 4A3FG 3UDFA 4GKJQ 1TWAH 1E22A 1QVFA 4Y52H 4HJ9A 3I2ZA 1HNXL 1Q46A 4EQ5A 5IT9c 2YTXA 4LNQA 1JJGA 3B6YA 3KDFA 1BKBA 3CMAA 3GTQH 3PUYA 4KHZA 2LXJA 1PH1A 4DR7Q 3GTPH 3HOVG 3KJOA 4LF7L 4MNOA 2R6GA 3EBEA 4R4QA 1PH6A 4P73A 2R93G 1W3SA 1NTGA 2VQEL 4JYAQ 2UXDL 1XTDA 4H02A 5J3BA 2MO0A 1NE3A 4K0KQ 3RZDH 4DUZL 5IYDH 3CCUA 1M1KC 5IWAL 5GAEC 4DV1L 2IX1A 2Z6KC 1B70B 3U4ZA 1JE5A 3GD7A 4OO1I 4LF8Q 1N32Q 1S3OA 2E2HH 1WI5A 2GVAA 4AIMA 2NZHA 4JI5Q 1V43A 2ZJPA 3CCRA 4B3RQ 1E1TA 3JC66 4UP9A 5C0XJ 2AMCB 4JBWA 4A3BG 4DR5Q 1PH4A 2R7DA 2JA5H 1X56A 1RIPA 2AKWB 4BA1I 1VQOA 2PMZE 1I3QH 2JA5G 4NXML 2JA7H 3M7NA 5GROA 4LF5L 2F52A 2Q2HA 4POFA 4A3EH 5LMUL 1K83H 5C44H 2B3GA 2B63G 2UXBL 2V1CC 2PI2A 3HOXH 3TRZA 2A1AA 2UUBL 1PVOA 2KHIA 3FKIG 3TREA 3H0GH 4EX5A 3GDEA 3ICEA 2UXCQ 1E3PA 5C4XH 2E2JH 4NXNQ 1K73C 1U0LA 3KF8B 3W1GA 1XPRA 4OX9Q 5M5WH 4GN4B 1VQEA 1X54A 5JEAG 4DPGA 3J80i 4LF4Q 3CCJA 3HOUG 2ZM6Q 3UDXA 1SROA 4A3CG 3F2DA 1QUQB 4KHPL 4YCUA 2YU9H 4DAYB 4BXXG 1YHBA 2E5LQ 2WAQG 4IPHA 4B3MQ 4DR4Q 3NBHB 4IOCA 1CKMA 3M3YH 2A19A 3RLOA 1YHAA 1VQLA 3KLWA 4WJ3M 3K7UC 1PH5A 1IXRA 4B3TQ 1VQ9A 3I4OA 1PH3A 2NZOA 4X65Q 1K8GA 3S17H 1VQCA 1X3FA 3CCMA 4A3DH 1JT8A 1KRSA 2I5HA 2PQAA 5AJ3L 1N36Q 3CCSA 1S72A 1G291 1TWFH 2I0QA 4RMFA 3VDYA 4QGUA 3PSIA 4OWTB 4YCWA 1IL2A 1G6PA 2Y0SG 3U58A 1N33L 5GADC 4DR2Q 1VQHA 1Y1WG 1O7IA 4R4CA 3UDGA 1V9PA 1C7YA 4A3GH 4YHHL 4DNIA 2WB1E 5EAYA 2UU9Q 5JJIA 2UU9L 1WYDA 3SGIA 4C3IH 2VUMH 3HOZH 4L5TA 3KF6A 4JCVE 2ID0A 4OO1G 2ATWA 4DV6L 2K50A 5C0XI 5FJ8G 2E8GA 2IHFA 1QVCA 3K0XA 3S15H 4JI3L 4HJ8A 3PO2H 5M3MH 1XPOA 4JI2Q 1N8RC 4DV7L 1OXUA 1EOVA 1YEZA 3HFZB 1XNQL 2K5HA 3CXCA 2QGQA 1YBYA 4WJ4A 5C3EG 4MTNA 5LMNW 4JI1Q 4DR3Q 4JI8Q 1FJGQ 4JI0L 4BA2I 3D31A 4AYBG 1PA6A 1K8AC 1MJCA 2R92G 1QZGA 4O0AA 1VQKA 2AWOA 2XTIA 1X55A 3JAMc 4POGA 3HOVH 4IOAA 1HZAA 3OYYA 1KRTA 1XMQQ 2Z6KA 4DV0Q 4JV5Q 3RLFA 1EUJA 4DK6C 4JI7L 4FDBA 4A75A 2R93H 3AQQA 1SE8A 2HHHQ 2JE6I 4DR6Q 4LFAL 3F2BA 4JI4Q 1SRUA 1VQAA 4X62L 1XMOQ 4UP8A 4C3HH 4A93G 1IBML 1M90C 2VL6A 1CKNA 1WJJA 1K0RA 2ZTEA 1X3EA 1HR0Q 2WFWA 3FP9A 4DAMA 4X66Q 2R7FA 5E7NA 1HR0W 5IYBG 4A3MG 1LYLA 4IJHA 4A3BH 4DR7L 1RL2A 4P74A 2CCZA 4LFCQ 1UEBA 3T1HL 2I5LX 1BBUA 3BZKA 4PG3A 1YITA 1YNXA 3FHWA
chains in the Genus database with same CATH superfamily
2B2YA 5LMNH 2BOSA 4DV5H 4JYAL 1G2SA 5IT9E 1DCZA 4DR1Q 3J7A5 3HOYB 4K0KL 4JPBW 2E75C 3P7JA 1GUSA 5D65A 1HRJA 2VNUD 3K80C 1I4RA 1I4HA 2YYZA 5KYLA 3HKSA 3ER0A 3K7AB 1JKJB 5CV8A 1HNXQ 5JEAH 1KIXA 4J9OA 3K81C 4FBUA 2JEBI 1MKHA 3FDTA 3WOEA 3BU2A 5DGAA 2NYZD 5ELFA 5TSSA 2K6AA 2CVRA 4HIKA 1E2WA 5JVG3 3CF5A 1P16A 1WTOA 4TKOB 1B8AA 3OOCA 3I55A 2O4XA 1Y14B 1TWAB 2PNHA 3RLNA 2Y0SE 4GC6A 5ELBA 4L63B 5C4ZA 3PIOA 4FXDA 4CKBA 1KL9A 4RNMA 1G91A 3BG5A 1A2TA 2D0OA 4B3SL 1EY0A 1ZYRD 2OQKA 3TDQA 2NVQH 4YJ3F 2AGQA 3G6JB 2DY7A 4JBKA 4KV6A 4H13C 4C5AA 1EQRA 4DL4A 4X3UA 1BGWA 5IYZF 3V6KA 4O4LF 2XC9A 3GTJH 4MV8A 5M3FG 4LF9Q 3GQCA 2EYPA 2VA3A 4KLKA 4CDCC 2OTLA 1CZGA 4F4ZA 3M9NB 2UXBQ 2R7ZG 1TQOA 1GUGA 2E2HB 4X6AH 1PZKD 3OHXC 4HR7B 3M7GA 4MN3A 5HURA 4DV4L 1K28A 4ZOLF 5JH7F 2SDFA 4LF7H 2WDTA 3L9AX 1I3QB 1L0WA 5C3EH 2ALYB 3HKZA 2RSOA 1BVSA 4X64Q 3FEWX 1TWGH 4A3EB 1L1OC 2UXDH 4Q5VA 5GAHC 4F50A 3J7ZC 1S68A 3BZCA 4JOIA 4DV1H 5JJLA 2RDIA 2E2JB 4XX0B 3GV5B 2IHEA 3TP7A 4HNUA 5C1OA 1JMCA 3R2IA 3AFQA 4J9PA 1I4GA 1YHQA 3EA6A 4FF4A 4IAJA 3RV3A 4IZOA 1S0MA 4GOPC 3SR1A 2PMZA 5LMNQ 4DV5Q 4KY6A 5FLMG 1NR4A 3M3YB 1FL0A 1EIFA 3MFYA 4OWXB 3GTKA 1KTKA 3KTMA 2V4QA 3RMHA 4G4KA 2BH2A 3A7LA 1S5BD 3E6ZX 3QOLA 3CC4A 2K5WA 3CW2C 2R87A 1SXTA 4RA8A 3T56B 2R7KA 1H9SA 1QE6A 2KUMA 2GVBA 4JBJA 3MR6A 2HQLA 4JI4L 1EEFD 2B2VA 1XMOL 4JOIC 4KHPH 1GSAA 1I6VC 2GN5A 1CQIB 3EROA 1CSPA 4Y7NH 1PMRA 1SN8A 1E4FT 3MXUA 4LW1A 4DL6A 5C0XH 3A5ZB 3RB6A 3O13A 4LFCL 2ZTCA 1G2TA 2HDMA 4MHEA 5CA1F 2RCNA 5ELEA 3MZ5A 5JVLA 2CWAA 1PTOH 3GTGB 1WTXA 4LFAQ 3X3NA 1JORA 4FS1A 4X62Q 2D2CC 4R8UA 3RAQA 1PFSA 3NXWA 2B8FA 3BABA 4UCVA 2EYLA 3HOVB 3C1FA 1MSHA 2F0OA 3QWNA 3S9WA 4DV6H 2FB9A 5BPFA 5J2TF 5JVDF 1GOZA 5I2YA 4YY3H 2YL2A 4PZ7A 3PIPA 4LF7Q 4DV7H 4ULLA 1SDFA 2RF4A 2BQ3A 5LHY1 4ZUJA 2Q2IA 2NB0A 3VPBA 4O3PA 5M5XH 1KQSA 3W1BA 4ECYA 1B6SA 4XQNA 3KOJA 2A6EC 3J7AF 1M8AA 1Y1VG 1MSGA 4C3HG 4EVOA 3RNUA 3DEPA 2L55A 4DV1Q 3ORRA 4U6PA 3ITPA 3ERQA 4TVAB 1E0BA 5CMDA 3QB3A 1G8ZD 5JJZA 3SDZA 1WTVA 4L5RC 4DNTB 2B63B 3E0JA 4DV3L 1Q1EA 4LF6L 4GNXC 3LWEA 2SOBA 2R8IA 1TAEA 3BA9A 3TQTA 1IBMH 1TY0A 4B08A 1DOLA 2QK4A 5KG5A 1Q1BA 1TR5A 3H20A 1B50A 2JA6H 3MWYW 5EGTA 4R4OA 2YZGA 1LLRD 5IYDG 4O42A 3KAJA 5EWGA 1EIYB 2OLSA 4DR7H 1HJPA 1MI2A 2H1EA 1N36L 1IYJB 5LXTF 2WAQB 2N88A 1YJWA 5JEAJ 5BN3A 3AFPA 4PMCA 2IT1A 4BBRB 2XGPA 4G7OC 4RKBA 1PK8A 2RGVA 1HPCA 4BBSH 2A6ED 2JA7G 4UCOA 4XTCS 2V4DA 4UCRA 4MTEA 1Y8OB 5T1IA 4NDXA 2K52A 1IBLQ 1Y1WB 5C4XG 2GLTA 5KNBA 2K14A 1R4QB 1LABA 3SHLA 2YTVA 5AJ3Q 3TP5A 4CHTB 3I7FA 4KD4A 1R9TB 2KOLA 1SNPA 2GA4B 4HEDA 4UCSA 4AQYQ 3V2TA 1FKAH 4JI8L 1FJGL 3TQ1A 1UWVA 3K57A 5CV5A 4MV1A 4RKLA 1TA8A 1AUXA 1PH9A 1UC9A 5HY6A 2MP1A 2ICEC 4ZYSA 3KHRA 5CA0F 3I4NH 2F0JA 4CKEA 1EUCB 5DM73 2V59A 4EFBA 4NXNH 2F0WA 3CVZA 3TS2A 4Q0FA 4NLGA 2LMCB 3NWSA 3GTKB 2E74C 5EKLA 4DV6Q 2XN9C 1KNEA 3L0OA 3M4IA 4IRCA 2V4RA 4QIWB 5ELNA 4YP3A 4YY3Q 3S2DH 2KEEA 3OW2A 3D3RA 4DV7Q 5EKIA 4ED2A 1EFID 1N9WA 4O4HF 5KG4A 2Z6BA 3EQLC 1U4RA 4NW2A 2IJ0A 2EDGA 1XNRL 1EYZA 2ZJTA 4A3GG 2K32A 4F8MA 4QWAA 2R6FA 1F9RA 4P2CB 2XCLA 2NUAB 3JSLA 4X3TA 2KEDA 4K5VA 4A93B 3PW7A 2EVBA 1HTPA 5L9XA 1EQQA 3U9SA 1KJ9A 1CT1D 1LACA 1SLJA 2HUGA 4QB4A 4PMWA 2A73B 5D3DA 2VUMA 3FMAA 2WB1G 4C2MH 1SFOB 4RUCA 5I4DA 3PO2G 5M3MG 2XWBB 4HIMA 1KJJA 4XYQA 1B04A 4EEYA 1BNZA 1STNA 4J9MA 3T1YH 2W9CB 4HJ9A 3I2ZA 3RTXA 5KG0A 1VF7A 1PRTC 1AP0A 3CQZB 3T5HA 5KG6A 1BKBA 1JE4A 4DR7Q 4GKKH 1ML0D 3GTPH 4CDEC 3PR4A 3PR5B 2HCIA 3EBEA 1PH6A 4P73A 1W3SA 4N8FA 2FK1A 1JCKB 1ZEQX 1D5ZC 2RKSA 4HMJA 4DUZL 4ZQIA 2JEJA 3Q0AA 5IWAL 2IX1A 1RK6A 2R82A 3UI2A 4LFBH 2E76C 5KNDA 5KFGA 3U4ZA 1JDEA 2FMMA 5KGUA 4OO1I 4UDUC 1XMQH 5CBAE 1WI5A 4IUPA 4AIMA 3S1NB 1V43A 2ZJPA 5DEHA 4UP9A 5C0XJ 2HHHH 3T16A 5E3FA 4PDBA 2R7DA 2JA5H 4FF2A 2FINB 1MD2D 1FNWA 2WTFA 2EY6A 2PMZE 1VDZA 3WOFA 2F52A 1NUCA 2BE5C 3R5FA 5LMUL 2JA5A 3HOXH 4M9UA 2A1AA 2J4XA 2PQEA 2EJMA 4EFEA 5AFWA 2C22A 3H0GH 5D1PA 4LMYA 1PRTD 2KCNA 2UXCQ 3BDOA 3K5LA 4NXNQ 4J9KA 1WTHA 1I7LA 1QB5D 3OSNA 2UUAH 2L1BA 5I6YA 1N34H 3E5SA 3J80i 2FPPB 3CCJA 4IR1A 1HUMA 1KBLA 2R7ZB 3T5JA 4A3CG 1QUQB 3RZDB 2YU9H 3ONAB 3IAYA 2E5LQ 3GP7A 1CHPD 3NBHB 4IOCA 2K33A 1SEBD 4IUVA 1Z2PX 3FPPA 2J6UA 5D14A 3KLWA 4WJ3M 3K7UC 4U673 1VQ9A 2WE6A 3JAML 1K8GA 3R23A 1JOKA 1WVLA 5K36H 3DXJC 1KRSA 1CQJB 2DN8A 3CCSA 4FU0A 3NSWA 4QGUA 3VDYA 4OWTB 1IL2A 1ET6A 2W70A 3C3LA 1TWHB 1B4OA 2BQUA 2BE5D 1NSNS 1EL0A 2Y0SA 4DNIA 1UEAB 5KFDA 2JEFA 3Q23A 1WYDA 3HOZH 4C3IH 4L5TA 3VR5A 4OO1G 3GTJA 2K50A 2VPQA 5FJ8G 2F0PA 4FP5D 2E8GA 2IHFA 1QVCA 4DV2H 1RTNA 5FO7B 4UFZA 1V4YA 1N8RC 4FS2A 4IR9A 1OXUA 2QF7A 4EG0A 2KVMA 4O2AF 4B3MH 4LF5H 2QGQA 4WJ4A 4DR4H 4A2AA 3GTMA 5JAVA 1YNND 4JI0L 4RCOA 4AYBG 3BG3A 4HSVA 3GTOB 2QDLA 2R92G 1M0TA 1QZGA 1TWGA 2PCFB 3S1RB 4X65H 1U4PA 4ED6A 3FMCA 3JAMc 4IOAA 1HZAA 3OYYA 1KRTA 1XMQQ 4JV2A 4JV5Q 3RLFA 2R93H 3H09A 3N8DA 2DZDA 1ESRA 3AQQA 3M4OB 1SE8A 1BJTA 1PFMA 2HHHQ 2JE6I 5L1JA 2C2DA 4DXFA 5KFNA 3F2BA 1ZETA 3NQTA 1W93A 3N6RA 4LJZC 1QG7A 2XWJB 4QWDA 2VL6A 5J22A 4G7ZC 4DA2A 3D6WA 5C8YF 2CH4W 3WNZA 1LYLA 1BCPB 4ED1A 4P74A 2CCZA 1DV2A 2I5LX 1YNXA 1HQMC 3T13A 4JI2H 1Z2NX 2EXDA 2B8GA 1SE2A 2UUAQ 1VCIA 2UUCL 2YV5A 1I50B 3TS0A 1N34Q 3H40A 4JI1H 5J2UF 3A8JE 4DR3H 2W57A 4QQBX 1VQ7A 1VQJA 1GM5A 3CC2A 2W6PA 1M6VA 3VR2A 1I4XA 1NBWA 4RFBA 1STEA 1SMYC 3NTHA 4DUYH 4JG2A 4L5QA 1V8QA 4IJLA 3OTOH 2VUGA 1Q3LA 2JP1A 1N32L 3G8CA 2ZDGA 5KNCA 1VQPA 1PH8A 5D1OA 3CAMA 1KD1C 5CV6A 4DV0H 4JI5L 4TSSA 4B3RL 1PFNA 4IFDJ 2OQ0A 4FM9A 4DL5A 2O2LD 1DYQA 4DR5L 4DR6H 2A6HC 3DWQA 3ULPA 2M05A 5KFVA 1Y1VB 4APVA 4ECUA 4C3HB 4YJ2F 1LT4D 1HNZL 1WFQA 1X6OA 4OHJA 1RJQA 3UDIA 3J80L 2N3SA 1HR0H 2K04A 2B29A 5ELCA 4BY1G 2F4VH 2Q8RE 1F77A 1WSCA 1EWHA 2VXWA 1IW7C 4A3LG 4A3BB 1GSHA 3GTQB 1BCPF 1G6ZA 4FBTA 3G4SA 3BZDB 1XWEA 1IBKL 3JRXA 1M4VA 1STYA 2KCCA 1KEEA 2AQ1B 2ZM6L 4DV2Q 3AMUA 1C8CA 1EY4A 1A3VA 5KT4A 1GHJA 5KFHA 4DR1H 2EQSA 1EWIA 2NBFA 3RV4A 3HS0C 4EGJA 1BR9A 2IMWP 1Z47A 1YI2A 1DIKA 1GVPA 3U4VA 3T5KA 3PZPA 2RDJA 3A5UA 2C35B 2B2WC 4LF5Q 2EY2A 1XJVA 1H95A 3KF8A 2YS7A 3M4PA 1SMYD 2R84A 1TVXA 4L8JA 4LH6A 3S1QH 1KJ8A 4BBRG 1VQ4A 3CPFA 1EQTA 2DUDA 4A2BA 4TUYF 5KX5F 3RB0A 1HZ9A 3HKZG 1LTGD 1LT6D 1EFWA 2FK3A 2ZDHA 3S16H 3G6XA 4DAYA 3J81i 2A6HD 1PX2A 4YAKB 5KFAA 4OIKA 2JA7B 1QVGA 4J8QA 2VQEH 4G7HC 1SYGA 2DPJA 4CJ2C 1K83B 4DR2L 5KT2A 1SNDA 2GPWA 3CCVA 3EIVA 2Z1CA 3J80c 1K8OA 1PYWD 4ME3A 4YR3A 1GKHA 1EYGA 1IW7D 4RCNA 3J7AK 2R85A 5T14A 4M1UB 4LK1C 2NVQB 1L2ZA 1S0OA 2R7MA 1O80A 1GXDC 4N9TA 4QL5A 3JAMW 4IRKA 2JA6A 3P75A 4PZ8A 1NY4A 1SMXA 3P1HA 2EYHA 1I94L 2W9BA 1UE5A 3STBC 3ZYYX 4R8NA 3LWBA 2HT1A 4A3MH 1CE8A 2Z0SA 3H3VI 2MHVA 4IUTA 4KJOA 1XPUA 5IGEA 4HJ7A 4DUYQ 1BBWA 2XNAC 3S17B 4DN4M 4ECWA 3NWTA 3OTOQ 4X3KA 3CD6A 5IE8A 3MFIA 4B3SH 4HJAA 4A3IG 2N78A 1TWFB 5CV9A 3S1MH 4C3JG 4YWLA 3WWVA 1YJNA 1E24A 1WCMH 1HTLD 2KHJA 3PCOB 3F8TA 4O3OA 4B9WA 2Z9HA 4K8IA 3QOJA 3QFFA 4A3GB 1I6HH 3PV0A 1PXUA 2LS01 1PTOD 4JK1C 1VQNA 3HOWH 1O7YA 4H44C 2QKIC 5IYCG 2JA9A 4X66L 3VA5A 4J9SA 1T5EA 2F4VQ 1EIHA 3MJFA 1ONLA 1AUVA 5K5PA 2JA8G 3N40P 2JQOA 2WB1B 4A3JH 3UE1A 4DV4H 1VQIA 5M3MB 3PO2B 4MV4A 3WO0A 4DK0A 1VQ8A 5JVH3 2JJQA 2EXZA 1HQRD 5ELDA 3MAQA 3SE7A 1OXXK 3KDFB 4IUNA 3GIDA 3OIQA 4IPDA 1S5DD 2VS1A 3BDCA 1ESFA 5LP6F 4OEMB 3STBD 3PO3H 4BY7G 3A7AB 5CAEB 2HVRA 2F0QA 2Z4IA 4LF8L 1Q12A 1S5CD 2G5DA 3DLLA 3I4MH 2VOBA 5C3XA 1EWCA 2RQXA 1YIJA 4JVZA 3ORQA 4OWWB 5FLXc 3T1HQ 1QILA 1JDBB 1VQGA 3GIMA 4XQJA 1VBHA 1QZHA 4MTDA 1RYRA 1XNQH 4LMQD 2XD4A 4ED8A 3PUVA 4IPCA 2VQEQ 4RZQA 3OMGA 3ERSX 2J6TA 1KXLA 2NN6I 3NELA 2ASLA 1L1OA 2NUCA 3T5LA 3RD4A 3RIZA 4FO2A 4TQRA 2HD3A 1YJ9A 4PV1C 4C2MA 3MFHA 2B2TC 4O1NA 4RHRA 4ZK9B 4OX9L 4A3KH 4J9LA 5FO8B 4C5BA 4RAZA 3QR8A 2NVTH 5DQGA 1SJED 5JOBA 5KFUA 1F9PA 3FVQA 4LFAH 3A0JA 4J1MA 4X62H 1ASYA 3RGXA 5KT7A 3J81L 5HBRB 4LF9L 1NAPA 4M8AA 1E4EA 5EWEA 1JWMD 3GTPA 1N48A 4GOPA 3MXNA 5M5YB 1DOKA 3ZJYC 4CDFC 5IP9H 3J80W 1LTLA 1JJCB 2PZWA 2ZT9C 2K5QA 4OL7A 3URYA 4MV3A 1TS3A 3PUZA 4RAUC 3GTMH 2RHSB 1O78A 4B3SQ 1CS0A 3M9BA 5KFOA 2ZXPA 3U50C 3MEFA 4X64L 4R1JA 4ZQ3A 3KXYT 2ZJRA 2TMPA 3K8AA 5M5XB 2TSSA 3G6VA 1R4PB 4PZ6A 2F0MA 4RH6A 5KFTA 1M7JA 2G9DA 5C6AA 5DG8A 2VZAA 2JN4A 5IGDA 3VR4A 1LTRD 4JUZA 1KDCA 4DAPA 5C44G 3W2DA 3K58A 1SYFA 5IP7H 3GIJA 1K3RA 3RR5A 3QG1A 1EY9A 1GD7A 1PYBA 1A3TA 5KFIA 2OH2A 3KLSX 1K1QA 3PGZA 1PTOF 2F0KA 4DV4Q 3SK5A 2FLNA 1EY6A 3KF6B 5LMNL 3H0GA 3RAXA 4DV5L 2VY3A 1NMFA 3J81c 2PZTA 2NVXH 2E2IH 2LXKA 4IQZA 2FPGB 3I4LA 4P71A 3DWPA 2IX0A 1II3A 2NWGA 4A76A 4WBNF 2NN6G 3M85A 2KHSA 2OWOA 1U4LA 3QJYA 2NVYB 1NR2A 2HIVA 4LSAA 5IT9L 5CGKA 2YU9A 1TWCB 1SYEA 2NU7B 1S10A 1TXYA 1JB3A 2IW3A 3TIGA 4L1KA 2I80A 2MNAA 4AYBB 3C2PA 3GIPA 4A3DG 4O2DA 3K5MA 1WTQA 2R92B 1A0IA 1OXVA 1B7YB 1VS0A 4C1NI 4BBSB 1XNQQ 2L4NA 1G51A 5C4JB 3HOYH 1EUDB 3SI8A 4NP5A 1QCBD 5HGTA 4B3TH 4ZHQF 3KLSA 1IBLH 2BH8A 2JSOA 1CKNB 3K7AH 1ZXTA 2VUMG 4RG1A 2IL8A 5KEEA 4EGVA 3CCEA 3EN2A 4AH6A 1NCVA 4AQYH 4FYDA 2VQFL 5H1SE 1XYIA 1L2FA 3NENA 4I50F 1GO3E 2L12A 3C0FB 4Z9CB 1B6RA 4LUVA 2PN1A 4IWYA 2UU9H 2ASDA 2V58A 4GNXA 3UDFA 1TWAH 1E22A 1HXYD 5IT9c 4LNQA 1IYUA 2RDGA 3QZ7A 3X3MA 4KKSA 5F9LA 1B3QA 3S2DB 4LF7L 4K6DA 1UUPA 2DNCA 2R6GA 2R8KA 1H9MA 2UXDL 1GLVA 1FJGH 5FPOA 1NE3A 5LA6F 2R93A 4KD3A 1S4ZA 3QO2A 3CCUA 1M1KC 4O2BF 4DV1L 1EZ8A 5D3IB 2X6GA 1JE5A 1JICA 4Y8VB 1L0YB 5GONF 1BO0A 1S3OA 2E2HH 3RZOB 1Y8PB 3F2UA 1TIID 3FRPB 1BNCA 1Q90A 1PDQA 3VR6A 4A3BG 1F2ZA 4BY1B 1RIPA 1ENCA 1I3QH 2JA5G 2XIGA 2ENBA 3U9OA 3GLKA 4POFA 2Q2HA 4A3EH 1KNAA 3NE5B 2B3GA 1QJOA 5KG1A 3TRZA 1S03G 2UUBL 3TREA 2EJGC 4EX5A 4ZKBB 2CW0C 2E2JH 1K73C 3SK6A 1XPRA 3FKIA 2B2UA 4GN4B 2JXMB 1X54A 5JEAG 4RUAA 2SCUB 5C1PA 5KT6A 4B9XA 1SROA 3BQ0A 2MPMA 4KHPL 2H4OA 3BYYB 4YCUA 4KJNA 2F03A 4IPHA 4ME6A 3KUPA 3VPDA 3HKZB 1CKMA 3M3YH 3LX0A 1M0WA 4TRDA 1IXRA 5EQ0A 3PN1A 4B3TQ 1CA6A 2BCOA 3GIQA 2F0EA 1VQCA 1X3FA 1JT8A 3LMLA 2PQAA 5AJ3L 2WACA 1N36Q 2EE1A 1D1IA 1S72A 1G291 2I0QA 4RMFA 2OT2A 3RUZA 2Y0SG 2NZ1D 2Q8IB 4E4TA 1SYBA 3GTLA 2L5TA 1VQHA 3UDGA 3CHBD 1V9PA 3T4AC 4QUFA 3EYYA 3TN2A 1T5XD 2GPSA 2UU9Q 2B2UC 2PMZB 2UXCH 2C2EA 3OWFA 1LV9A 4IZ8A 5KG3A 4JCVE 2CW0D 2ID0A 2ATWA 4DV6L 5C0XI 1EU3A 1XTCD 3IFTA 3K0XA 1HNWH 2EY5A 1DJRD 3RGZA 3Q24A 3FPUB 4DV7L 1EOVA 1YEZA 2IBKA 1XX8A 3K0YA 2E5LH 1YBYA 2K7VA 1H9SB 3Q22A 5C3EG 4MTNA 3DEOA 5LMNW 4JI8Q 1FJGQ 3HGBA 4BA2I 4A3IB 1K8AC 1AZQA 2XRQD 3TZUA 4O0AA 4C3JB 4IFDH 3FDSA 1J8IA 2IPKD 2XTIA 3A54A 2RDFA 4MA0A 2Q8TA 4POGA 3HOVH 2F1MA 2HCCA 2FK2A 1SAPA 4OELB 4CGYB 5IT9W 4A75A 3K59A 3DMUA 1ZHQA 3GILA 2KQ3A 1EZ6A 1ICFB 4Q43A 4BS9A 3NTIA 2AQ4A 3JSNA 4LSXA 4EEQA 5BR8H 1IBML 5KFLA 2JA8B 1M90C 5FD6A 1WJJA 1Q8IA 2R7FA 3GV6A 3F8NA 1OO9B 4R8UB 4DL2A 4IJHA 4DR7L 1K8MA 4ECSA 3TMEA 3PIO3 5LYJF 1HA5A 4C1NK 2QYZA 4IURA 1LT3D 3FHWA 5CYUA 4BY7B 5EPJA 5JUMA 4EYHB 1RDPD 4JI6H 3Q6SA 1CTMA 1SBBB 4YCVA 3KAKA 5K2MA 4KY5A 1WTPA 2B63H 2W9AA 2CQOA 1KABA 3MC0B 2QEXA 5EWFA 1NNXA 4ED7A 1E2VA 3OHAA 4TV8F 3K5OA 4LUZA 1WCMA 4GLAC 4RGOS 3S14H 4DGZA 1W2BA 3GV3A 2FJZA 3BJYA 1DONA 2WV6D 2XCAA 4JV5H 4EQNA 1BDOA 2DIKA 1HZCA 5C0XG 3CC7A 2DWCA 2KSWA 2XCPA 1SNMA 3D4WA 2FP4B 1JWSD 3H6MA 3IKJA 4BXXH 1J6QA 5A2QE 4MV7A 1D7QA 1PH2A 3OMCA 1IHZA 2X6LA 5EPLA 1DGSA 4L6TB 1GUTA 3IL8A 3M9MB 2MO1A 1FVIA 5I2XA 3I91A 1EY8A 1T36A 3L4KA 4LUOA 4C5CA 2DNEA 1RK5A 4F4XA 1WR2A 2F3IA 5KFEA 2W6OA 3M9OB 4J9QA 1MIUA 1KJIA 5DNFA 3TIIA 1T94A 4PQXA 1A63A 4HIOA 1Y1WH 1HNWQ 3G6EA 3BQ2A 4V0BA 2WKCA 3CMEA 2RDHA 1R9TH 2EYMA 2X0SA 2QA4A 3GO5A 4WD3A 5KFXA 2KBNA 2BDOA 3ULJA 4DK3C 3MR2A 5LMUQ 1Z6HA 4IUUA 5EJWA 3DM3A 4UPAA 1O7LA 4QIWE 1TT2A 4ABNA 2K1BA 3I56A 4XXEA 2EYJA 4MZ9A 1RD9D 1LTAD 2R61A 2UUCH 1AFPA 3BYTB 3Q8DA 2J0TD 1H9KA 5C44B 3MVVA 1WH2A 1K0SA 2ASBA 2LKVA 5BR8Q 1J5EL 5KIXA 4TQUS 5BPHA 4BWGB 3T1YL 1W96A 1V1PA 5M5WB 4IFDI 2JA6G 3RB3A 3MWEA 2F3WA 5C5LA 2FKLA 2YZMA 4GS3A 4GKKL 3VA7A 1VQ5A 5KFKA 4RNOA 4XYMB 4ECZA 4J0MA 3SVMA 2F0GA 4A93H 1BXTA 1AW7A 4NXMH 4JI6Q 4A3FH 3T51B 1PRTB 1SFOH 3G6YA 3I3CA 5IYBH 3SK8A 5KFYA 1C4QA 1D2BA 4KMUC 4LFBL 2NU9B 2PW7A 3F2CA 3PQIA 4BBSG 1ENAA 1KC8C 4M7EA 2MGSA 4CJ0B 4A3DB 4UHVA 4DK1A 3R93A 2V9WA 1MJEA 3CQZH 5CV7A 1CHQD 2LSSA 1IBKH 4DL7A 4F4YA 4OIJA 1GYFA 4KKTA 4HAEA 1CI3M 1Q8KA 3RN5A 3TEHB 5KFQA 4JBMA 3PIP3 1AN7A 4GKJL 1E1OA 1FGBD 2DGYA 5L1KA 1KLGD 1CM9A 2NU6B 2VUMB 5ELOA 2R86A 3L2PA 1U9RA 1T9HA 2K01A 2QW7A 1DV1A 1J9OA 2YCHA 2IP4A 3OUUA 3MEHA 4O4IF 3Q8QB 3E9IA 2NVXA 2E2IA 3I4NG 3HB9A 2EYFA 3AB9A 2K28A 1EY7A 4ID6A 1RJPA 3S1NH 1E7ZA 4ME5A 4ALPA 1N34L 5GQOA 5KFSA 2M2LA 1S0NA 3G48A 1O7ZA 1N33H 2ZXOA 2C2RA 3PF4A 1PRTF 4P75A 3TQYA 4DKAC 3FKIH 5GAGC 4HCEA 4YHHH 2J6SA 3ND8A 4CBVA 4RAYA 1UE1A 2EOTA 3VYSA 4Q44A 3I12A 2BA1A 1WD0A 2B2WA 3K5IA 4EGQA 3W5OA 4IFDG 1SCUB 3LWUA 4P72A 3HOUH 3V05A 3TP6A 1WTWA 1DZ1A 4JI3H 5CB4F 1MZBA 4K5XA 2E2DC 2LY7A 2L15A 2M9VA 1VBGA 5M3FH 1D5MC 3OSOA 2UUCQ 4J15A 4ZLTF 2ZTDA 2QDBA 1YNJC 2RHQB 2R7ZH 4UAIA 2AWNA 2NU8B 4NPSA 1AH9A 4UY8C 2I87A 3EPIA 3CP0A 4K5WA 4EBEA 1F2LA 3NQIA 3HZXA 4ECQA 2WKDA 3AYHB 1UE6A 2XIWA 3MA2B 1LUZA 4QCLA 3PVXA 3GTLH 4IWXA 2OXPA 3M4QA 2JA5B 3VYUA 5BN4A 4I4TF 2AGOA 4JI7H 1SEIA 4DV2L 3HEJA 2Q2UA 1STAA 5EBCA 4LF4L 1TWAA 4TQSA 4WRDA 5BMVF 2PPBC 2DPIA 2I8CA 1D6EC 4UCTA 2HIXA 4U68A 4B3ML 5CR3A 2MQHA 4DR4L 4NXMQ 1VKZA 4YWMA 1TWHH 1HNZQ 1HFGA 2YZNA 2A68C 1VMCA 5C5JA 1Z9FA 2SNSA 3Q8SB 4X65L 1QNKA 4HQ6A 2N49A 4I7ZC 1OTCA 5J1ZA 3T1HH 4GC7A 3H4BA 1A9XA 5KFFA 4GLXA 1IBKQ 2PW5A 2AHOB 5FLMH 1FR3A 1UE7A 2ZJQA 4JYAH 4DNRB 4HIDA 4R8IA 1ILPA 3F1ZA 3N43B 2WINB 1B2TA 1PHJA 2E2HA 4K0KH 4HR7A 1YNJD 2R8HA 4ZRZA 4QMGA 3VYTA 4K14A 3VYRA 4YAJB 2R7LA 1C3OA 5CORA 5HV6A 4EYIB 2P0AA 3N6XA 3GTOH 1I3QA 3HOXG 1VQMA 2Y0SB 2EIFA 2Q2TA 3S1RH 3H0GG 4PNYA 2QCPX 1B53A 1HZBA 4JI2L 1QNUA 3VMMA 2YTYA 1NMGA 1U5KA 3GTJB 3M4OH 3OPOA 4JI1L 5M9OA 4DR3L 5I9PA 3K5HA 2C5CA 1WD1A 1N33Q 2L9HA 4CDDC 5CC4A 1CA5A 1RJRA 1B1ZA 3OW7A 4YHHQ 4DUYL 2A68D 3H91A 4HJ5A 1EYAA 1ICWA 3OTOL 3JRWA 3GTMB 1SJHD 4I65A 5DLQE 4LAAA 4DV0L 3UQ8A 2KENA 1BF4A 1T3NA 4RGMA 4IHJF 4KKUA 4QJFA 5C3EB 3MFGA 4GN5A 1TWGB 5DAUA 5FLXL 4IN3A 3PF5A 4DR6L 4JI3Q 3S2HH 5KFBA 5K36G 3K5NA 3KHLA 4IPGA 4IUQA 1V1QA 1I94Q 1I50H 3LGJA 3E3XA 1PZJD 3U9TA 2JEIA 4K2KA 1HR0L 1YVCA 2F4VL 1A62A 2P5ZX 2EPBA 1LTTD 2RBMA 1Q82C 1N56A 3C1EA 1BQQT 5KYIA 3HOZG 4J6HA 4C3IG 3OUZA 2F0NA 2B2TA 4IALA 1HH2P 4JI7Q 2EJFC 1DXMA 2K75A 2N55A 3DUZA 2VW9A 5G3LD 4DR1L 2FHTA 1Y1VH 1E2ZA 1OWTA 1CUKA 3SXHA 2ASJA 1RYSA 1B9NA 2I5MX 4I7AA 4A3FG 3NTKA 5KFPA 4Y52H 3PW4A 1HNXL 1Q46A 1LTSD 2YTXA 1JJGA 4XYOA 4ZAIA 3CMAA 4F4WA 1EOTA 1B44D 4KHZA 3GTQH 3GTGA 3KHHA 2OF1A 4J9NA 1GUNA 3KJOA 3SK4A 3A8IE 4QWCA 5I9OA 5D1OB 2R93G 2VQEL 1NTGA 2BQRA 4JYAQ 2R8GA 3EVQA 4Y7NB 4MV9A 1XDNA 2MO0A 2PBZA 2DJFC 4K0KQ 4XQQA 2UVUA 1ET9A 4PMBA 5IYDH 3JZIA 4FNFA 3PW2A 5GAEC 1IL8A 2Z6KC 2V5AA 5KFRA 5KFCA 4LF8Q 4MV6A 2PZUA 2GVAA 5KFMA 5EBDA 2NZHA 3CCRA 1SYDA 3JC66 1TU2B 2F0UA 2L11A 4MA5A 2HVSA 1PTOB 4JI4H 5IOCA 1XMOH 1X56A 3Q8RB 2AKWB 4ED0A 3HBLA 3RBEA 4ED3A 1JWUD 3M7NA 2W71A 2JA7H 4I7HA 1XXGA 1D5XC 3RJ0A 1K83H 1IYVA 4QW8A 4APMA 5DQHA 2UXBL 4BWSC 2PI2A 3V4SA 1PVOA 3FKIG 3I73A 3GDEA 3K6OA 2AQ3B 2B63A 5CBEE 5C4XH 2B2YC 2F4IA 4LFCH 3KF8B 2O03A 4XDXA 4OX9Q 3RFCA 5E4XA 1DD2A 2VQFH 3HOUG 1GHKA 3L3OC 3UDXA 5IGGA 1UNSA 3F2DA 3OSPA 3DM1A 4DAYB 1GJXA 1YHBA 2EYOA 3EPGA 2VB3X 3HG9A 2KJXA 3GIIA 3RLOA 2WAQA 1YHAA 2A5HA 1VQLA 3ETJA 2JEGA 3W3AA 2HGSA 2NZOA 1UC8A 3S17H 2F0HA 1Z2OX 3IFDA 2C28A 1TWFH 5JPMC 1K1SA 3PSIA 1G6PA 2K03A 2NTTA 4YCWA 4ZUIA 5DGBA 2D9UA 4FXGC 3BA8A 5GADC 2C9OA 4ETSA 4R9WA 2JA6B 2ZDQA 2XGQA 4A3GH 2WB1E 5LL6b 5EAYA 1Y1WA 3A55A 5IGCA 5KFJA 2W9BB 1SYCA 5G3LF 1EYDA 2W8KA 1R9TA 1V51A 5DLFA 1KC7A 2HQEA 5KG2A 4QF4A 3S15H 2FPIB 1MGSA 3PO2H 5M3MH 1X32A 4DV3H 1DOMA 5A35A 4LF6H 4RGNA 1XNQL 3HFZB 2K5HA 3CXCA 1H9RA 2YRWA 3LP8A 1S97A 4FF3A 2L0CA 1MJCA 2UUBH 3IG0A 2UVWA 1PFBA 3SEBA 1VQKA 4QIWA 1X55A 1SSOA 4DU9A 3AU7A 4RNNA 4ZI7F 1WTRA 1N36H 4DK6C 2CW8A 2SEBD 4LFAL 1STHA 4JI4Q 4X62L 3KBGA 1JLLB 5FLXW 1XMOQ 3DWAA 4DFAA 4UP8A 1A3UA 4RWSC 3I4NB 1K0RA 2ZTEA 1X3EA 2WFWA 3FP9A 4DAMA 2SNMA 5E7NA 4RB3C 3PW5A 1HR0W 4A3MG 4H0LC 2A74C 1JIHA 3EJIA 3V96A 1SFOA 4KTAA 4LFCQ 1BBUA 3BZKA 1GUWA 1YITA 3KBXA 4WORA 1I6UA 2H5XA 3A8KE 2KCTA 1KAWA 2VQFQ 2W9CA 4JI8H 3J7YW 1WCMG 3CQZA 3A74A 3MR5A 3OIPA 4IO9A 3CCLA 2FLPA 3HOWG 4MIUA 4H7BA 5M5YH 4Q45A 1S40A 3BVZA 5EOYA 4YB8B 2B2VC 3NGDA 1L1OB 3KFUA 4R4TA 1JXLA 2BDNA 4A3CH 4R4IA 4C2MB 4A3JG 1CFMA 4HCSA 1VAJA 4Q0YA 1F2MA 1EQVA 1EYCA 3L7ZC 1H9JA 1Y8NB 4CJ1B 2Z4HA 2UXDQ 4HYKA 3IRBA 2K5VA 3SE0A 4KHVA 3NPPA 4F87A 1XNRH 3PO3G 3C46A 3S24A 3R8BA 1E4EB 3TZDA 3V4ZA 4J9RA 1SYXB 1VQFA 3GTPB 4GOPB 3MXNB 2XGTA 4MAMA 3I4MG 1CSQA 3P20A 5EZYF 2CWPA 2WYOA 3TINA 4DV3Q 3HP3A 2JK8A 4LF6Q 2AU0A 1PH5A 2JEAI 4O3RA 4C56C 2XVSA 1X3GA 5FO9B 4HMIA 5E1FA 1D1KA 1STGA 2XSCA 4MTKA 5F2DA 4GN3B 3S14B 4OO1H 3J81W 4LWCA 5L1LA 4PWQA 2UUBQ 2CFMA 5FJ8H 3J81j 1SR3A 4B3TL 1C0AA 2NVYH 4AYBE 2D62A 2CW7A 1YZ6A 2YRXA 2BR0A 1IBLL 2R7ZA 2QILA 1IZ6A 1QUQA 1SE3A 3UE0A 1KJQA 1UNNC 1X9NA 1BUVT 1TWCH 4A3KG 3NBHA 1LT5D 4DAVA 4AQYL 1GSOA 4JW0A 2W6ZA 3CCQA 2R92H 4KHPQ 3HOXB 4JC0A 4XYLB 4DUZH 3NEMA 2UU9L 4NB3A 3H0GB 4NMZA 1O75A 5IWAH 3H3VC 5KFWA 5C4JH 1A8VA 2MUYA 3NBIA 1C30A 3E5NA 5IP9G 4ECVA 1B3AA 1TWHA 1K9MC 4O3SA 5JJKA 1HUNA 4YY3L 2VQDA 2YU9B 4NKLA 4UP7A 3I8ZA 2OTJA 3BJUA 1B33N 5LMUH 4G57A 2F0TA 3E9HA 3R3OA 3GTGH 3JAMi 1X65A 2ATLA 1CKOA 1VQ6A 1SNCA 2R7NA 4YR2A 2K4KA 3H15A 2M00A 2HJWA 3BAAA 1RCVD 4YBZB 1JB7A 2F0VA 2CHBD 3ULLA 4XT1B 3MHBA 1B9MA 3KK7A 2X69A 1KAAA 5IP7G 1A6XA 4I55F 3CRLC 5IY0A 3CPWA 1LM0A 4ZKCB 3GTOA 2G9HD 2ZXRA 3NK9A 4KY7A 2FXQA 2K5NA 4EBCA 4HNTA 3JAME 2D0PA 2RSNA 2WIIB 1RJTA 3ND9A 4E6IA 4RHSA 1Z7TA 3HOZB 4C3IB 2PI2E 5FOBB 1ENFA 1XNRQ 4QWEA 2PYKA 3N41B 1U4MA 1NJIC 4CC5A 2ICIA 2F0LA 4GNXB 5KG7A 3GIKA 3TSSA 4JV0A 2KA7A 1Y69U 2RA4A 3RZOH 4HNVA 3E0EA 2ES2A 1K3BC 1PV4A 1JJ2A 3KALA 4XT3B 5LL6S 4A3FB 2W7PA 2IWHA 1MHWC 4BY1H 1LTID 4A3LH 1BBXC 1IBMQ 1J5EH 1P8LA 4F88A 3TBIB 1RF2D 3MXPA 4OONA 2WAQE 3HOYG 1I4PA 2W6QA 2R93B 1I50A 4YWKA 1JX4A 1FYCA 3Q1KA 3NUCA 2MCTA 3H4DA 3D0FA 2CZGA 2J9GA 1W6JA 2IY5B 2F0DA 3HKZE 1ULZA 1CQFA 3PUXA 3KJPA 4RB1A 1Q81C 3KHGA 1AE2A 2W8LA 4BBRH 1VQDA 1ASZA 1FD7D 4CC6A 4JI0H 5IGBA 1ZQ7A 4DUZQ 1I4QA 2J7ZA 5IWAQ 2UXCL 1VQBA 5IIFA 1S5FD 3PMFA 4NXNL 2FLLA 1Y1VA 3A56A 3D4RA 3G7LA 5FPRA 2VPSA 5KT3A 1FGUA 1AN8A 1DM0B 5DLGA 4XIGS 1HNWL 4WFN3 2PVPA 3GV7B 3D4DA 4YIJA 1BCPC 3V6HA 2VB2X 1Q7YC 2FJ2A 3FKIB 2E5LL 3GTQA 1UAPA 4EBDA 2IA6A 4GKJH 1ZHSA 4LH7A 2MFIA 1MBYA 4OXPA 2F0IA 1RKNA 1Q86C 1HCZA 2LFNA 2VA2A 5IGFA 5C4HA 3VPCA 3HOUB 3TP8A 2ALZA 2YW2A 5D8DA 1SNOA 4XZ3B 5CV4A 4RB0A 1IKLA 5M3FB 3GTKH 3DF7A 1D8LA 5DG9A 1V1OA 3BS1A 2AUKA 4YQWA 5I47A 2PQAB 1QWYA 1YNNC 5BR8L 5LL6X 2HVQA 4V190 1EZ1A 1C9OA 2FMCA 3MXGA 3AEVA 1W6KA 4A3EG 5F9NA 5EDWA 5J39A 3GTLB 4A3IH 3NP8A 1N32H 1PYSB 2I07B 4QW9A 1LTBD 2JA7A 4C3JH 3CRKC 3DHQA 4JI5H 1ZKOA 2CKZB 4B3RH 4GLVB 3BVMA 3J80E 1K83A 5FK9C 4DR5H 5EPKA 3PUWA 2N8NA 2R3ZA 5DM63 5LOVF 3GQBA 1BCPD 4A4IA 4K2LA 4UCUA 2F3VA 4JI6L 1TKWB 2A8VA 2YYAA 4CKCA 1JOOA 3MWDA 4RZRA 5IYCH 1HNZH 4O3QA 5IODA 1HHVA 2DJGC 1IOVA 4X3SA 4KI0A 4FVMA 3S1QB 3MWMA 2A69C 2B39A 2JA8H 4N9PA 1J5EQ 1OXTA 5C3WA 1OXSC 1ILQA 3G71A 2OCEA 3T1YQ 4U7CA 3RN2A 3S16B 1TS5A 1XMQL 4JV5L 2KCMA 5L37A 2DY8A 1F2YA 2FFKB 4LF4H 4L5SA 2OEOA 2HHHL 2ZM6H 4YR0A 3VR3A 4GKKQ 2O5JC 4KK7A 5ISRA 2CQAA 4QUCA 4BY7H 3L4JA 2RGRA 2W6NA 5C5MA 3MTSA 1AE3A 3CU7A 2IX3A 2WP8J 5NUCA 1EU4A 1TS2A 1PH7A 4FF1A 4JI0Q 1TWFA 2W6MA 1E4GT 1I5FA 1LO5D 3BQ1A 5HGQA 4LFBQ 3KYHC 1TS4A 5A2QL 4Q8EA 3R2TA 3RBDA 3M4YA 5KT5A 1KHIA 1STBA 4QY7A 2UUAL 1A2UA 1FNUA 1WOCA 1BOSA 2FMAA 4DR2H 3BDLA 3V6JA 4A3MB 1GUOA 4EQOA 2BA0A 2RCFA 3H3VH 5JPNC 2A69D 2WB1A 1CZWA 3I72A 4WJWA 4GKJQ 1AZPA 2PNRC 4KN4C 1QVFA 4EQ5A 2FE3A 1S9FA 3B6YA 3KDFA 1RTOA 3S1MB 2AQ2B 3PUYA 3S2HB 3QIAA 2LXJA 1PH1A 1EY5A 1WCMB 4ZCKA 3N42B 5KFZA 3HOVG 2JYOA 4MNOA 1I6HB 1L0XB 4R4QA 5H80A 1I94H 3HXLA 3HOWB 4HSPA 1XTDA 4H02A 5J3BA 3OHBA 2NTSA 2UVRA 4S3SA 1EHIA 2UVVA 3RUPA 3RZDH 1CK1A 5FLXE 4DXGA 1AEXA 3I70A 4RB2C 1B70B 1VF5C 3GD7A 4HTHA 2D5DA 1EEID 4DF7A 4A3JB 1N32Q 4JI5Q 2YS6A 4B3RQ 2HDLA 1E1TA 4QWBA 2AMCB 4JBWA 4EQPA 2EZVA 1FNVA 4DR5Q 1PH4A 3D8GA 4K8JA 4BA1I 1VQOA 3PO3B 3MR3A 4ODGA 5KRUA 4NXML 5GROA 4LF5L 3RB4A 4FXKC 1S5ED 4DLKA 1F9SA 5C44H 4ECRA 1KLUD 3I90A 1RHPA 2MJ8A 4KN7C 2B63G 4X66H 2V1CC 4ECXA 3Q2OA 3I4MB 3KLRA 5I6WA 2KHIA 4GZYC 3ICEA 2I46A 1E3PA 5FD5A 1U0LA 3W1GA 2O5IC 5M5WH 2CQYA 1VQEA 3WDNA 4DPGA 4LF4Q 4K6LA 2Z8LA 3D6CA 5T1GA 2ZM6Q 4DL3A 2NN6H 4BXXG 1SNQA 1A15A 2XRSD 1RODA 2WAQG 4B3MQ 4DR4Q 2A19A 3R5XA 3LNNA 4LF8H 1HNXH 4A3KB 2RVLA 4OGQC 3H94A 1C48A 4RU9A 3I4OA 1PH3A 4X65Q 2NVTB 1VMPA 3K3PA 1X3PA 3N52A 4N8X1 3CCMA 5E4WC 4A3DH 2CH4A 2I5HA 1KDAA 1V1PB 2QEJC 5JQWA 2K5DA 1I7NA 2C00A 5BN5A 3WO1A 1PZID 1SE4A 3EFXD 3T53B 3U58A 2W7OA 1N33L 4DR2Q 3OWEB 1Y1WG 1O7IA 4R4CA 1HFNA 5KKNB 1PTOC 3HRZC 1C7YA 4YHHL 4O3NA 5DG7A 4ECTA 2AGPA 5C4XB 5JJIA 1BXRA 2VUMH 3SGIA 4TV9F 3KF6A 3J81E 4OX9H 3QZ8A 4ILWA 3RF2A 4F7XA 4JI3L 4HJ8A 2R8JA 1XPOA 5FKAC 4JI2Q 1X3QA 2KECA 4RGTA 4IRDA 2NVYA 1JQYD 5DQIA 5COYA 3GV8B 4LF9H 4HN7A 2VR1A 4JI1Q 4Q8FA 3PW0A 4DR3Q 1JR0D 2EY1A 3UFXB 1TWCA 3D31A 1PA6A 2UXBH 1IKMA 4G3IA 2AWOA 2DLNA 4AYBA 3IN5A 2F0SA 1GGOA 2R92A 5EKKA 5L1IA 1TY2A 4JV1A 2Z6KA 4DV0Q 3Q8PB 3R5HA 1EUJA 4JI7L 4FDBA 2F0FA 1KDBA 4R7RA 4X64H 1JOQA 1HA6A 2NVXB 3ETHA 4DR6Q 2E2IB 1SRUA 1VQAA 2AUJD 1IOWA 3J7AV 4C3HH 4A93G 3K3VA 1CKNA 1QOHA 3NHHA 1JC7A 1EIGA 1HR0Q 4X66Q 1PLFA 5IYBG 2K05A 3BVGA 3N44B 3S15B 4A3BH 1RL2A 1F9QA 1ZYRC 1UEBA 3T1HL 5A2QW 3CKIB 4PG3A 1CQVA 2PO4A
chains in the Genus database with same CATH topology
2EXDA 2H5XA 2UUAQ 1VCIA 2UUCL 4JYAL 2KCTA 2YV5A 4YCVA 3TS0A 1N34Q 1KAWA 2VQFQ 2B63H 4DR1Q 3J7A5 2CQOA 1WCMG 4QQBX 4K0KL 2QEXA 1VQJA 1GM5A 1VQ7A 3A74A 3CC2A 4IO9A 2VNUD 1NBWA 3K80C 2YYZA 4LUZA 3CCLA 4GLAC 4JG2A 4L5QA 4IJLA 3HKSA 3ER0A 3HOWG 3S14H 1N32L 5M5YH 1W2BA 1S40A 1VQPA 1PH8A 1HNXQ 3CAMA 1KD1C 1KIXA 3K81C 4JI5L 2JEBI 4B3RL 1MKHA 1L1OB 3KFUA 2OQ0A 1HZCA 4R4TA 5C0XG 3BU2A 3CC7A 4IFDJ 4DR5L 4A3CH 4HIKA 3ULPA 4R4IA 4A3JG 4BXXH 3CF5A 1P16A 1J6QA 4APVA 3L7ZC 1B8AA 1D7QA 3I55A 1HNZL 1WFQA 1PH2A 2UXDQ 1X6OA 2K5VA 3IRBA 3UDIA 1Y14B 2N3SA 2PNHA 1DGSA 3RLNA 2Y0SE 2B29A 4BY1G 2MO1A 1FVIA 3PO3G 3S24A 4A3LG 3PIOA 4LUOA 1KL9A 1VQFA 2F3IA 4GOPB 2D0OA 3G4SA 3MXNB 2XGTA 4B3SL 1IBKL 2OQKA 2NVQH 3I4MG 1CSQA 1MIUA 2ZM6L 4DV2Q 4HIOA 1Y1WH 4JBKA 1HNWQ 1A63A 2CWPA 3G6EA 2EQSA 1EWIA 4DV3Q 1EQRA 3CMEA 1Z47A 2JK8A 1YI2A 1GVPA 3U4VA 1R9TH 4LF6Q 3A5UA 3GO5A 3GTJH 2QA4A 2C35B 2KBNA 3ULJA 4DK3C 5M3FG 1X3GA 1XJVA 4LF5Q 4LF9Q 3M4PA 4KLKA 5LMUQ 2OTLA 3DM3A 4GN3B 4UPAA 3S1QH 2R7ZG 4LWCA 4BBRG 3CPFA 2DUDA 1VQ4A 2UUBQ 2CFMA 5FJ8H 4QIWE 1SR3A 3J81j 4B3TL 1C0AA 4X6AH 2NVYH 4AYBE 2D62A 1YZ6A 1IBLL 1HZ9A 3HKZG 1EFWA 1IZ6A 1QUQA 3I56A 3UE0A 4DV4L 3S16H 1X9NA 1TWCH 3J81i 4MZ9A 4A3KG 1L0WA 5C3EH 2ALYB 1QVGA 1BVSA 4X64Q 3Q8DA 1TWGH 4AQYL 1L1OC 4DR2L 3CCQA 3CCVA 3EIVA 5GAHC 2R92H 2UXBQ 3J80c 4KHPQ 4JC0A 2ASBA 3NEMA 4ME3A 4NB3A 3BZCA 5BR8Q 4JOIA 3J7ZC 1J5EL 1GKHA 4TQUS 1EYGA 5JJLA 5C4JH 3T1YL 1A8VA 2IHEA 4IFDI 2JA6G 1JMCA 3AFQA 5IP9G 1K9MC 1YHQA 5JJKA 4GS3A 4GKKL 1VQ5A 4QL5A 4YY3L 4PZ8A 1NY4A 4A93H 4GOPC 4UP7A 1SMXA 5LMNQ 1I94L 4JI6Q 4DV5Q 2OTJA 3BJUA 5FLMG 4A3FH 1UE5A 3STBC 3E9HA 1SFOH 3GTGH 1FL0A 1EIFA 4OWXB 2HT1A 5IYBH 1X65A 3JAMi 4A3MH 1CKOA 2Z0SA 1VQ6A 3H3VI 2K4KA 4LFBL 1XPUA 3H15A 4BBSG 3F2CA 4DUYQ 1BBWA 4HJ7A 1KC8C 2BH2A 1JB7A 3OTOQ 3CC4A 3CD6A 5IE8A 3CW2C 4HJAA 3ULLA 2N78A 4A3IG 3CQZH 1MJEA 2LSSA 5IP7G 3S1MH 4YWLA 3WWVA 1YJNA 4JBJA 2GVBA 5IY0A 1E24A 1WCMH 2HQLA 1Q8KA 2KHJA 1LM0A 3F8TA 3PCOB 3CPWA 3RN5A 3TEHB 1XMOL 4JI4L 4JOIC 2FXQA 2K5NA 1I6HH 4JBMA 3PV0A 2D0PA 1VQNA 2GN5A 3HOWH 4GKJL 1CSPA 1E1OA 2DGYA 5IYCG 2JA9A 4X66L 4Y7NH 5ELOA 1SN8A 2PI2E 4LW1A 2F4VQ 3L2PA 1XNRQ 3A5ZB 1T9HA 1NJIC 4LFCL 3E9IA 2JA8G 2JQOA 4A3JH 2ZTCA 3UE1A 4GNXB 3I4NG 1VQIA 1VQ8A 3RZOH 2JJQA 3E0EA 2ES2A 1PV4A 2RCNA 1E7ZA 4ALPA 1JJ2A 3S1NH 1N34L 5GQOA 1OXXK 3KDFB 2CWAA 3G48A 4IPDA 2VS1A 3PF4A 4LFAQ 4X62Q 4BY1H 4P75A 3TQYA 4DKAC 3FKIH 3STBD 5GAGC 3PO3H 4BY7G 4A3LH 1PFSA 1IBMQ 1P8LA 1UE1A 4LF8L 4OONA 1Q12A 2BA1A 2WAQE 3DLLA 3HOYG 3I4MH 3W5OA 4IFDG 4YWKA 4P72A 1YIJA 3HOUH 4OWWB 3D0FA 5FLXc 3T1HQ 1VQGA 4PZ7A 3PIPA 2IY5B 2L15A 3HKZE 4LF7Q 1QZHA 5M3FH 2RF4A 3PUXA 3KJPA 2UUCQ 4J15A 2Q2IA 3PUVA 2ZTDA 4IPCA 1AE2A 2RHQB 5M5XH 3W1BA 2VQEQ 1Q81C 1KQSA 3ERSX 1VQDA 2AWNA 4BBRH 1ASZA 2R7ZH 1KXLA 2NN6I 3KOJA 3NELA 4NPSA 1AH9A 1L1OA 1Y1VG 4UY8C 3CP0A 4DUZQ 3RNUA 5IWAQ 4DV1Q 1VQBA 1YJ9A 2UXCL 3AYHB 1UE6A 4NXNL 1LUZA 4OX9L 3GTLH 4A3KH 4TVAB 1FGUA 3M4QA 4XIGS 2NVTH 4DV2L 2Q2UA 4L5RC 4LF4L 1HNWL 4DV3L 1Q1EA 1Q7YC 4LF6L 3A0JA 4GNXC 1ASYA 2HIXA 2E5LL 4B3ML 4LF9L 2MQHA 4DR4L 4NXMQ 4YWMA 1TWHH 1HNZQ 2MFIA 1Q1BA 4GOPA 4OXPA 1Q86C 2JA6H 3ZJYC 5IP9H 4R4OA 1Z9FA 2ZJQA 1LTLA 1JJCB 5IYDG 4X65L 2N49A 1EIYB 1HJPA 3PUZA 1OTCA 3GTMH 2RHSB 1N36L 1IYJB 4B3SQ 3M9BA 4GLXA 1IBKQ 3GTKH 1YJWA 1D8LA 2AHOB 3AFPA 3MEFA 1UE7A 5JEAJ 4R1JA 3U50C 4X64L 5FLMH 2ZJRA 3F1ZA 2IT1A 3K8AA 4HIDA 4PZ6A 1PHJA 2PQAB 5BR8L 4BBSH 2VZAA 2JA7G 1C9OA 4XTCS 3AEVA 4A3EG 4A3IH 5C44G 1PYSB 3GTOH 5IP7H 4C3JH 3HOXG 1K3RA 3RR5A 1VQMA 1GD7A 2CKZB 2EIFA 1PYBA 2K52A 4GLVB 3S1RH 3H0GG 2Q2TA 1IBLQ 3PGZA 5C4XG 4DV4Q 2K14A 1HZBA 2N8NA 3PUWA 5AJ3Q 2YTVA 4JI2L 3KF6B 4A4IA 2YTYA 3I7FA 1NMGA 5LMNL 1U5KA 4DV5L 4JI6L 2A8VA 2VY3A 3M4OH 1NMFA 5IYCH 4JI1L 3J81c 4AQYQ 4DR3L 2NVXH 4JI8L 1FJGL 2E2IH 1UWVA 2LXKA 1N33Q 4P71A 4A76A 2IX0A 4KI0A 2NN6G 3M85A 1PH9A 4YHHQ 2OWOA 5HY6A 4DUYL 4HJ5A 2JA8H 1J5EQ 1OXTA 1OXSC 3OTOL 3G71A 2HIVA 3I4NH 2OCEA 3T1YQ 5DLQE 3RN2A 1XMQL 4DV0L 2KCMA 3TS2A 2KENA 4JV5L 1TXYA 4QJFA 4DV6Q 3L0OA 2JEAI 4L5SA 2HHHL 4GN5A 5ELNA 3PF5A 2MNAA 4DR6L 3S2HH 4YY3Q 4JI3Q 4GKKQ 5K36G 4A3DG 4O2DA 3S2DH 4IPGA 1A0IA 4BY7H 1OXVA 1B7YB 1VS0A 3OW2A 4DV7Q 1XNQQ 1V1QA 1I94Q 1AE3A 1I50H 1N9WA 3LGJA 1G51A 2WP8J 3HOYH 1PH7A 1HR0L 4JI0Q 1YVCA 2F4VL 1A62A 1I5FA 1XNRL 5HGQA 4A3GG 4LFBQ 1Q82C 3KYHC 2BH8A 1CKNB 3K7AH 2VUMG 3HOZG 4RG1A 1KHIA 2UUAL 4QY7A 1HH2P 1EQQA 3CCEA 3EN2A 4AH6A 4JI7Q 4PMWA 2K75A 1SLJA 2VQFL 5H1SE 2VW9A 1L2FA 1WOCA 3NENA 4DR1L 2WB1G 4C2MH 1GO3E 3PO2G 1Y1VH 5M3MG 4LUVA 4HIMA 2BA0A 1CUKA 3H3VH 1H95A 2I5MX 4GNXA 4A3FG 3UDFA 4GKJQ 1TWAH 1E22A 1QVFA 4Y52H 4HJ9A 3I2ZA 1HNXL 1Q46A 4EQ5A 5IT9c 2YTXA 4LNQA 1JJGA 3B6YA 3KDFA 1BKBA 3CMAA 3GTQH 3PUYA 4KHZA 2LXJA 1PH1A 4DR7Q 3GTPH 3HOVG 3KJOA 4LF7L 4MNOA 2R6GA 3EBEA 4R4QA 1PH6A 4P73A 2R93G 1W3SA 1NTGA 2VQEL 4JYAQ 2UXDL 1XTDA 4H02A 5J3BA 2MO0A 1NE3A 4K0KQ 3RZDH 4DUZL 5IYDH 3CCUA 1M1KC 5IWAL 5GAEC 4DV1L 2IX1A 2Z6KC 1B70B 3U4ZA 1JE5A 3GD7A 4OO1I 4LF8Q 1N32Q 1S3OA 2E2HH 1WI5A 2GVAA 4AIMA 2NZHA 4JI5Q 1V43A 2ZJPA 3CCRA 4B3RQ 1E1TA 3JC66 4UP9A 5C0XJ 2AMCB 4JBWA 4A3BG 4DR5Q 1PH4A 2R7DA 2JA5H 1X56A 1RIPA 2AKWB 4BA1I 1VQOA 2PMZE 1I3QH 2JA5G 4NXML 2JA7H 3M7NA 5GROA 4LF5L 2F52A 2Q2HA 4POFA 4A3EH 5LMUL 1K83H 5C44H 2B3GA 2B63G 2UXBL 2V1CC 2PI2A 3HOXH 3TRZA 2A1AA 2UUBL 1PVOA 2KHIA 3FKIG 3TREA 3H0GH 4EX5A 3GDEA 3ICEA 2UXCQ 1E3PA 5C4XH 2E2JH 4NXNQ 1K73C 1U0LA 3KF8B 3W1GA 1XPRA 4OX9Q 5M5WH 4GN4B 1VQEA 1X54A 5JEAG 4DPGA 3J80i 4LF4Q 3CCJA 3HOUG 2ZM6Q 3UDXA 1SROA 4A3CG 3F2DA 1QUQB 4KHPL 4YCUA 2YU9H 4DAYB 4BXXG 1YHBA 2E5LQ 2WAQG 4IPHA 4B3MQ 4DR4Q 3NBHB 4IOCA 1CKMA 3M3YH 2A19A 3RLOA 1YHAA 1VQLA 3KLWA 4WJ3M 3K7UC 1PH5A 1IXRA 4B3TQ 1VQ9A 3I4OA 1PH3A 2NZOA 4X65Q 1K8GA 3S17H 1VQCA 1X3FA 3CCMA 4A3DH 1JT8A 1KRSA 2I5HA 2PQAA 5AJ3L 1N36Q 3CCSA 1S72A 1G291 1TWFH 2I0QA 4RMFA 3VDYA 4QGUA 3PSIA 4OWTB 4YCWA 1IL2A 1G6PA 2Y0SG 3U58A 1N33L 5GADC 4DR2Q 1VQHA 1Y1WG 1O7IA 4R4CA 3UDGA 1V9PA 1C7YA 4A3GH 4YHHL 4DNIA 2WB1E 5EAYA 2UU9Q 5JJIA 2UU9L 1WYDA 3SGIA 4C3IH 2VUMH 3HOZH 4L5TA 3KF6A 4JCVE 2ID0A 4OO1G 2ATWA 4DV6L 2K50A 5C0XI 5FJ8G 2E8GA 2IHFA 1QVCA 3K0XA 3S15H 4JI3L 4HJ8A 3PO2H 5M3MH 1XPOA 4JI2Q 1N8RC 4DV7L 1OXUA 1EOVA 1YEZA 3HFZB 1XNQL 2K5HA 3CXCA 2QGQA 1YBYA 4WJ4A 5C3EG 4MTNA 5LMNW 4JI1Q 4DR3Q 4JI8Q 1FJGQ 4JI0L 4BA2I 3D31A 4AYBG 1PA6A 1K8AC 1MJCA 2R92G 1QZGA 4O0AA 1VQKA 2AWOA 2XTIA 1X55A 3JAMc 4POGA 3HOVH 4IOAA 1HZAA 3OYYA 1KRTA 1XMQQ 2Z6KA 4DV0Q 4JV5Q 3RLFA 1EUJA 4DK6C 4JI7L 4FDBA 4A75A 2R93H 3AQQA 1SE8A 2HHHQ 2JE6I 4DR6Q 4LFAL 3F2BA 4JI4Q 1SRUA 1VQAA 4X62L 1XMOQ 4UP8A 4C3HH 4A93G 1IBML 1M90C 2VL6A 1CKNA 1WJJA 1K0RA 2ZTEA 1X3EA 1HR0Q 2WFWA 3FP9A 4DAMA 4X66Q 2R7FA 5E7NA 1HR0W 5IYBG 4A3MG 1LYLA 4IJHA 4A3BH 4DR7L 1RL2A 4P74A 2CCZA 4LFCQ 1UEBA 3T1HL 2I5LX 1BBUA 3BZKA 4PG3A 1YITA 1YNXA 3FHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXD A;  2H5X A;  2UUA Q;  1VCI A;  2UUC L;  4JYA L;  2KCT A;  2YV5 A;  4YCV A;  3TS0 A;  1N34 Q;  1KAW A;  2VQF Q;  2B63 H;  4DR1 Q;  3J7A 5;  2CQO A;  1WCM G;  4QQB X;  4K0K L;  2QEX A;  1VQJ A;  1GM5 A;  1VQ7 A;  3A74 A;  3CC2 A;  4IO9 A;  2VNU D;  1NBW A;  3K80 C;  2YYZ A;  4LUZ A;  3CCL A;  4GLA C;  4JG2 A;  4L5Q A;  4IJL A;  3HKS A;  3ER0 A;  3HOW G;  3S14 H;  1N32 L;  5M5Y H;  1W2B A;  1S40 A;  1VQP A;  1PH8 A;  1HNX Q;  3CAM A;  1KD1 C;  1KIX A;  3K81 C;  4JI5 L;  2JEB I;  4B3R L;  1MKH A;  1L1O B;  3KFU A;  2OQ0 A;  1HZC A;  4R4T A;  5C0X G;  3BU2 A;  3CC7 A;  4IFD J;  4DR5 L;  4A3C H;  4HIK A;  3ULP A;  4R4I A;  4A3J G;  4BXX H;  3CF5 A;  1P16 A;  1J6Q A;  4APV A;  3L7Z C;  1B8A A;  1D7Q A;  3I55 A;  1HNZ L;  1WFQ A;  1PH2 A;  2UXD Q;  1X6O A;  2K5V A;  3IRB A;  3UDI A;  1Y14 B;  2N3S A;  2PNH A;  1DGS A;  3RLN A;  2Y0S E;  2B29 A;  4BY1 G;  2MO1 A;  1FVI A;  3PO3 G;  3S24 A;  4A3L G;  3PIO A;  4LUO A;  1KL9 A;  1VQF A;  2F3I A;  4GOP B;  2D0O A;  3G4S A;  3MXN B;  2XGT A;  4B3S L;  1IBK L;  2OQK A;  2NVQ H;  3I4M G;  1CSQ A;  1MIU A;  2ZM6 L;  4DV2 Q;  4HIO A;  1Y1W H;  4JBK A;  1HNW Q;  1A63 A;  2CWP A;  3G6E A;  2EQS A;  1EWI A;  4DV3 Q;  1EQR A;  3CME A;  1Z47 A;  2JK8 A;  1YI2 A;  1GVP A;  3U4V A;  1R9T H;  4LF6 Q;  3A5U A;  3GO5 A;  3GTJ H;  2QA4 A;  2C35 B;  2KBN A;  3ULJ A;  4DK3 C;  5M3F G;  1X3G A;  1XJV A;  4LF5 Q;  4LF9 Q;  3M4P A;  4KLK A;  5LMU Q;  2OTL A;  3DM3 A;  4GN3 B;  4UPA A;  3S1Q H;  2R7Z G;  4LWC A;  4BBR G;  3CPF A;  2DUD A;  1VQ4 A;  2UUB Q;  2CFM A;  5FJ8 H;  4QIW E;  1SR3 A;  3J81 j;  4B3T L;  1C0A A;  4X6A H;  2NVY H;  4AYB E;  2D62 A;  1YZ6 A;  1IBL L;  1HZ9 A;  3HKZ G;  1EFW A;  1IZ6 A;  1QUQ A;  3I56 A;  3UE0 A;  4DV4 L;  3S16 H;  1X9N A;  1TWC H;  3J81 i;  4MZ9 A;  4A3K G;  1L0W A;  5C3E H;  2ALY B;  1QVG A;  1BVS A;  4X64 Q;  3Q8D A;  1TWG H;  4AQY L;  1L1O C;  4DR2 L;  3CCQ A;  3CCV A;  3EIV A;  5GAH C;  2R92 H;  2UXB Q;  3J80 c;  4KHP Q;  4JC0 A;  2ASB A;  3NEM A;  4ME3 A;  4NB3 A;  3BZC A;  5BR8 Q;  4JOI A;  3J7Z C;  1J5E L;  1GKH A;  4TQU S;  1EYG A;  5JJL A;  5C4J H;  3T1Y L;  1A8V A;  2IHE A;  4IFD I;  2JA6 G;  1JMC A;  3AFQ A;  5IP9 G;  1K9M C;  1YHQ A;  5JJK A;  4GS3 A;  4GKK L;  1VQ5 A;  4QL5 A;  4YY3 L;  4PZ8 A;  1NY4 A;  4A93 H;  4GOP C;  4UP7 A;  1SMX A;  5LMN Q;  1I94 L;  4JI6 Q;  4DV5 Q;  2OTJ A;  3BJU A;  5FLM G;  4A3F H;  1UE5 A;  3STB C;  3E9H A;  1SFO H;  3GTG H;  1FL0 A;  1EIF A;  4OWX B;  2HT1 A;  5IYB H;  1X65 A;  3JAM i;  4A3M H;  1CKO A;  2Z0S A;  1VQ6 A;  3H3V I;  2K4K A;  4LFB L;  1XPU A;  3H15 A;  4BBS G;  3F2C A;  4DUY Q;  1BBW A;  4HJ7 A;  1KC8 C;  2BH2 A;  1JB7 A;  3OTO Q;  3CC4 A;  3CD6 A;  5IE8 A;  3CW2 C;  4HJA A;  3ULL A;  2N78 A;  4A3I G;  3CQZ H;  1MJE A;  2LSS A;  5IP7 G;  3S1M H;  4YWL A;  3WWV A;  1YJN A;  4JBJ A;  2GVB A;  5IY0 A;  1E24 A;  1WCM H;  2HQL A;  1Q8K A;  2KHJ A;  1LM0 A;  3F8T A;  3PCO B;  3CPW A;  3RN5 A;  3TEH B;  1XMO L;  4JI4 L;  4JOI C;  2FXQ A;  2K5N A;  1I6H H;  4JBM A;  3PV0 A;  2D0P A;  1VQN A;  2GN5 A;  3HOW H;  4GKJ L;  1CSP A;  1E1O A;  2DGY A;  5IYC G;  2JA9 A;  4X66 L;  4Y7N H;  5ELO A;  1SN8 A;  2PI2 E;  4LW1 A;  2F4V Q;  3L2P A;  1XNR Q;  3A5Z B;  1T9H A;  1NJI C;  4LFC L;  3E9I A;  2JA8 G;  2JQO A;  4A3J H;  2ZTC A;  3UE1 A;  4GNX B;  3I4N G;  1VQI A;  1VQ8 A;  3RZO H;  2JJQ A;  3E0E A;  2ES2 A;  1PV4 A;  2RCN A;  1E7Z A;  4ALP A;  1JJ2 A;  3S1N H;  1N34 L;  5GQO A;  1OXX K;  3KDF B;  2CWA A;  3G48 A;  4IPD A;  2VS1 A;  3PF4 A;  4LFA Q;  4X62 Q;  4BY1 H;  4P75 A;  3TQY A;  4DKA C;  3FKI H;  3STB D;  5GAG C;  3PO3 H;  4BY7 G;  4A3L H;  1PFS A;  1IBM Q;  1P8L A;  1UE1 A;  4LF8 L;  4OON A;  1Q12 A;  2BA1 A;  2WAQ E;  3DLL A;  3HOY G;  3I4M H;  3W5O A;  4IFD G;  4YWK A;  4P72 A;  1YIJ A;  3HOU H;  4OWW B;  3D0F A;  5FLX c;  3T1H Q;  1VQG A;  4PZ7 A;  3PIP A;  2IY5 B;  2L15 A;  3HKZ E;  4LF7 Q;  1QZH A;  5M3F H;  2RF4 A;  3PUX A;  3KJP A;  2UUC Q;  4J15 A;  2Q2I A;  3PUV A;  2ZTD A;  4IPC A;  1AE2 A;  2RHQ B;  5M5X H;  3W1B A;  2VQE Q;  1Q81 C;  1KQS A;  3ERS X;  1VQD A;  2AWN A;  4BBR H;  1ASZ A;  2R7Z H;  1KXL A;  2NN6 I;  3KOJ A;  3NEL A;  4NPS A;  1AH9 A;  1L1O A;  1Y1V G;  4UY8 C;  3CP0 A;  4DUZ Q;  3RNU A;  5IWA Q;  4DV1 Q;  1VQB A;  1YJ9 A;  2UXC L;  3AYH B;  1UE6 A;  4NXN L;  1LUZ A;  4OX9 L;  3GTL H;  4A3K H;  4TVA B;  1FGU A;  3M4Q A;  4XIG S;  2NVT H;  4DV2 L;  2Q2U A;  4L5R C;  4LF4 L;  1HNW L;  4DV3 L;  1Q1E A;  1Q7Y C;  4LF6 L;  3A0J A;  4GNX C;  1ASY A;  2HIX A;  2E5L L;  4B3M L;  4LF9 L;  2MQH A;  4DR4 L;  4NXM Q;  4YWM A;  1TWH H;  1HNZ Q;  2MFI A;  1Q1B A;  4GOP A;  4OXP A;  1Q86 C;  2JA6 H;  3ZJY C;  5IP9 H;  4R4O A;  1Z9F A;  2ZJQ A;  1LTL A;  1JJC B;  5IYD G;  4X65 L;  2N49 A;  1EIY B;  1HJP A;  3PUZ A;  1OTC A;  3GTM H;  2RHS B;  1N36 L;  1IYJ B;  4B3S Q;  3M9B A;  4GLX A;  1IBK Q;  3GTK H;  1YJW A;  1D8L A;  2AHO B;  3AFP A;  3MEF A;  1UE7 A;  5JEA J;  4R1J A;  3U50 C;  4X64 L;  5FLM H;  2ZJR A;  3F1Z A;  2IT1 A;  3K8A A;  4HID A;  4PZ6 A;  1PHJ A;  2PQA B;  5BR8 L;  4BBS H;  2VZA A;  2JA7 G;  1C9O A;  4XTC S;  3AEV A;  4A3E G;  4A3I H;  5C44 G;  1PYS B;  3GTO H;  5IP7 H;  4C3J H;  3HOX G;  1K3R A;  3RR5 A;  1VQM A;  1GD7 A;  2CKZ B;  2EIF A;  1PYB A;  2K52 A;  4GLV B;  3S1R H;  3H0G G;  2Q2T A;  1IBL Q;  3PGZ A;  5C4X G;  4DV4 Q;  2K14 A;  1HZB A;  2N8N A;  3PUW A;  5AJ3 Q;  2YTV A;  4JI2 L;  3KF6 B;  4A4I A;  2YTY A;  3I7F A;  1NMG A;  5LMN L;  1U5K A;  4DV5 L;  4JI6 L;  2A8V A;  2VY3 A;  3M4O H;  1NMF A;  5IYC H;  4JI1 L;  3J81 c;  4AQY Q;  4DR3 L;  2NVX H;  4JI8 L;  1FJG L;  2E2I H;  1UWV A;  2LXK A;  1N33 Q;  4P71 A;  4A76 A;  2IX0 A;  4KI0 A;  2NN6 G;  3M85 A;  1PH9 A;  4YHH Q;  2OWO A;  5HY6 A;  4DUY L;  4HJ5 A;  2JA8 H;  1J5E Q;  1OXT A;  1OXS C;  3OTO L;  3G71 A;  2HIV A;  3I4N H;  2OCE A;  3T1Y Q;  5DLQ E;  3RN2 A;  1XMQ L;  4DV0 L;  2KCM A;  3TS2 A;  2KEN A;  4JV5 L;  1TXY A;  4QJF A;  4DV6 Q;  3L0O A;  2JEA I;  4L5S A;  2HHH L;  4GN5 A;  5ELN A;  3PF5 A;  2MNA A;  4DR6 L;  3S2H H;  4YY3 Q;  4JI3 Q;  4GKK Q;  5K36 G;  4A3D G;  4O2D A;  3S2D H;  4IPG A;  1A0I A;  4BY7 H;  1OXV A;  1B7Y B;  1VS0 A;  3OW2 A;  4DV7 Q;  1XNQ Q;  1V1Q A;  1I94 Q;  1AE3 A;  1I50 H;  1N9W A;  3LGJ A;  1G51 A;  2WP8 J;  3HOY H;  1PH7 A;  1HR0 L;  4JI0 Q;  1YVC A;  2F4V L;  1A62 A;  1I5F A;  1XNR L;  5HGQ A;  4A3G G;  4LFB Q;  1Q82 C;  3KYH C;  2BH8 A;  1CKN B;  3K7A H;  2VUM G;  3HOZ G;  4RG1 A;  1KHI A;  2UUA L;  4QY7 A;  1HH2 P;  1EQQ A;  3CCE A;  3EN2 A;  4AH6 A;  4JI7 Q;  4PMW A;  2K75 A;  1SLJ A;  2VQF L;  5H1S E;  2VW9 A;  1L2F A;  1WOC A;  3NEN A;  4DR1 L;  2WB1 G;  4C2M H;  1GO3 E;  3PO2 G;  1Y1V H;  5M3M G;  4LUV A;  4HIM A;  2BA0 A;  1CUK A;  3H3V H;  1H95 A;  2I5M X;  4GNX A;  4A3F G;  3UDF A;  4GKJ Q;  1TWA H;  1E22 A;  1QVF A;  4Y52 H;  4HJ9 A;  3I2Z A;  1HNX L;  1Q46 A;  4EQ5 A;  5IT9 c;  2YTX A;  4LNQ A;  1JJG A;  3B6Y A;  3KDF A;  1BKB A;  3CMA A;  3GTQ H;  3PUY A;  4KHZ A;  2LXJ A;  1PH1 A;  4DR7 Q;  3GTP H;  3HOV G;  3KJO A;  4LF7 L;  4MNO A;  2R6G A;  3EBE A;  4R4Q A;  1PH6 A;  4P73 A;  2R93 G;  1W3S A;  1NTG A;  2VQE L;  4JYA Q;  2UXD L;  1XTD A;  4H02 A;  5J3B A;  2MO0 A;  1NE3 A;  4K0K Q;  3RZD H;  4DUZ L;  5IYD H;  3CCU A;  1M1K C;  5IWA L;  5GAE C;  4DV1 L;  2IX1 A;  2Z6K C;  1B70 B;  3U4Z A;  1JE5 A;  3GD7 A;  4OO1 I;  4LF8 Q;  1N32 Q;  1S3O A;  2E2H H;  1WI5 A;  2GVA A;  4AIM A;  2NZH A;  4JI5 Q;  1V43 A;  2ZJP A;  3CCR A;  4B3R Q;  1E1T A;  3JC6 6;  4UP9 A;  5C0X J;  2AMC B;  4JBW A;  4A3B G;  4DR5 Q;  1PH4 A;  2R7D A;  2JA5 H;  1X56 A;  1RIP A;  2AKW B;  4BA1 I;  1VQO A;  2PMZ E;  1I3Q H;  2JA5 G;  4NXM L;  2JA7 H;  3M7N A;  5GRO A;  4LF5 L;  2F52 A;  2Q2H A;  4POF A;  4A3E H;  5LMU L;  1K83 H;  5C44 H;  2B3G A;  2B63 G;  2UXB L;  2V1C C;  2PI2 A;  3HOX H;  3TRZ A;  2A1A A;  2UUB L;  1PVO A;  2KHI A;  3FKI G;  3TRE A;  3H0G H;  4EX5 A;  3GDE A;  3ICE A;  2UXC Q;  1E3P A;  5C4X H;  2E2J H;  4NXN Q;  1K73 C;  1U0L A;  3KF8 B;  3W1G A;  1XPR A;  4OX9 Q;  5M5W H;  4GN4 B;  1VQE A;  1X54 A;  5JEA G;  4DPG A;  3J80 i;  4LF4 Q;  3CCJ A;  3HOU G;  2ZM6 Q;  3UDX A;  1SRO A;  4A3C G;  3F2D A;  1QUQ B;  4KHP L;  4YCU A;  2YU9 H;  4DAY B;  4BXX G;  1YHB A;  2E5L Q;  2WAQ G;  4IPH A;  4B3M Q;  4DR4 Q;  3NBH B;  4IOC A;  1CKM A;  3M3Y H;  2A19 A;  3RLO A;  1YHA A;  1VQL A;  3KLW A;  4WJ3 M;  3K7U C;  1PH5 A;  1IXR A;  4B3T Q;  1VQ9 A;  3I4O A;  1PH3 A;  2NZO A;  4X65 Q;  1K8G A;  3S17 H;  1VQC A;  1X3F A;  3CCM A;  4A3D H;  1JT8 A;  1KRS A;  2I5H A;  2PQA A;  5AJ3 L;  1N36 Q;  3CCS A;  1S72 A;  1G29 1;  1TWF H;  2I0Q A;  4RMF A;  3VDY A;  4QGU A;  3PSI A;  4OWT B;  4YCW A;  1IL2 A;  1G6P A;  2Y0S G;  3U58 A;  1N33 L;  5GAD C;  4DR2 Q;  1VQH A;  1Y1W G;  1O7I A;  4R4C A;  3UDG A;  1V9P A;  1C7Y A;  4A3G H;  4YHH L;  4DNI A;  2WB1 E;  5EAY A;  2UU9 Q;  5JJI A;  2UU9 L;  1WYD A;  3SGI A;  4C3I H;  2VUM H;  3HOZ H;  4L5T A;  3KF6 A;  4JCV E;  2ID0 A;  4OO1 G;  2ATW A;  4DV6 L;  2K50 A;  5C0X I;  5FJ8 G;  2E8G A;  2IHF A;  1QVC A;  3K0X A;  3S15 H;  4JI3 L;  4HJ8 A;  3PO2 H;  5M3M H;  1XPO A;  4JI2 Q;  1N8R C;  4DV7 L;  1OXU A;  1EOV A;  1YEZ A;  3HFZ B;  1XNQ L;  2K5H A;  3CXC A;  2QGQ A;  1YBY A;  4WJ4 A;  5C3E G;  4MTN A;  5LMN W;  4JI1 Q;  4DR3 Q;  4JI8 Q;  1FJG Q;  4JI0 L;  4BA2 I;  3D31 A;  4AYB G;  1PA6 A;  1K8A C;  1MJC A;  2R92 G;  1QZG A;  4O0A A;  1VQK A;  2AWO A;  2XTI A;  1X55 A;  3JAM c;  4POG A;  3HOV H;  4IOA A;  1HZA A;  3OYY A;  1KRT A;  1XMQ Q;  2Z6K A;  4DV0 Q;  4JV5 Q;  3RLF A;  1EUJ A;  4DK6 C;  4JI7 L;  4FDB A;  4A75 A;  2R93 H;  3AQQ A;  1SE8 A;  2HHH Q;  2JE6 I;  4DR6 Q;  4LFA L;  3F2B A;  4JI4 Q;  1SRU A;  1VQA A;  4X62 L;  1XMO Q;  4UP8 A;  4C3H H;  4A93 G;  1IBM L;  1M90 C;  2VL6 A;  1CKN A;  1WJJ A;  1K0R A;  2ZTE A;  1X3E A;  1HR0 Q;  2WFW A;  3FP9 A;  4DAM A;  4X66 Q;  2R7F A;  5E7N A;  1HR0 W;  5IYB G;  4A3M G;  1LYL A;  4IJH A;  4A3B H;  4DR7 L;  1RL2 A;  4P74 A;  2CCZ A;  4LFC Q;  1UEB A;  3T1H L;  2I5L X;  1BBU A;  3BZK A;  4PG3 A;  1YIT A;  1YNX A;  3FHW A; 
#chains in the Genus database with same CATH topology
 2B2Y A;  5LMN H;  2BOS A;  4DV5 H;  4JYA L;  1G2S A;  5IT9 E;  1DCZ A;  4DR1 Q;  3J7A 5;  3HOY B;  4K0K L;  4JPB W;  2E75 C;  3P7J A;  1GUS A;  5D65 A;  1HRJ A;  2VNU D;  3K80 C;  1I4R A;  1I4H A;  2YYZ A;  5KYL A;  3HKS A;  3ER0 A;  3K7A B;  1JKJ B;  5CV8 A;  1HNX Q;  5JEA H;  1KIX A;  4J9O A;  3K81 C;  4FBU A;  2JEB I;  1MKH A;  3FDT A;  3WOE A;  3BU2 A;  5DGA A;  2NYZ D;  5ELF A;  5TSS A;  2K6A A;  2CVR A;  4HIK A;  1E2W A;  5JVG 3;  3CF5 A;  1P16 A;  1WTO A;  4TKO B;  1B8A A;  3OOC A;  3I55 A;  2O4X A;  1Y14 B;  1TWA B;  2PNH A;  3RLN A;  2Y0S E;  4GC6 A;  5ELB A;  4L63 B;  5C4Z A;  3PIO A;  4FXD A;  4CKB A;  1KL9 A;  4RNM A;  1G91 A;  3BG5 A;  1A2T A;  2D0O A;  4B3S L;  1EY0 A;  1ZYR D;  2OQK A;  3TDQ A;  2NVQ H;  4YJ3 F;  2AGQ A;  3G6J B;  2DY7 A;  4JBK A;  4KV6 A;  4H13 C;  4C5A A;  1EQR A;  4DL4 A;  4X3U A;  1BGW A;  5IYZ F;  3V6K A;  4O4L F;  2XC9 A;  3GTJ H;  4MV8 A;  5M3F G;  4LF9 Q;  3GQC A;  2EYP A;  2VA3 A;  4KLK A;  4CDC C;  2OTL A;  1CZG A;  4F4Z A;  3M9N B;  2UXB Q;  2R7Z G;  1TQO A;  1GUG A;  2E2H B;  4X6A H;  1PZK D;  3OHX C;  4HR7 B;  3M7G A;  4MN3 A;  5HUR A;  4DV4 L;  1K28 A;  4ZOL F;  5JH7 F;  2SDF A;  4LF7 H;  2WDT A;  3L9A X;  1I3Q B;  1L0W A;  5C3E H;  2ALY B;  3HKZ A;  2RSO A;  1BVS A;  4X64 Q;  3FEW X;  1TWG H;  4A3E B;  1L1O C;  2UXD H;  4Q5V A;  5GAH C;  4F50 A;  3J7Z C;  1S68 A;  3BZC A;  4JOI A;  4DV1 H;  5JJL A;  2RDI A;  2E2J B;  4XX0 B;  3GV5 B;  2IHE A;  3TP7 A;  4HNU A;  5C1O A;  1JMC A;  3R2I A;  3AFQ A;  4J9P A;  1I4G A;  1YHQ A;  3EA6 A;  4FF4 A;  4IAJ A;  3RV3 A;  4IZO A;  1S0M A;  4GOP C;  3SR1 A;  2PMZ A;  5LMN Q;  4DV5 Q;  4KY6 A;  5FLM G;  1NR4 A;  3M3Y B;  1FL0 A;  1EIF A;  3MFY A;  4OWX B;  3GTK A;  1KTK A;  3KTM A;  2V4Q A;  3RMH A;  4G4K A;  2BH2 A;  3A7L A;  1S5B D;  3E6Z X;  3QOL A;  3CC4 A;  2K5W A;  3CW2 C;  2R87 A;  1SXT A;  4RA8 A;  3T56 B;  2R7K A;  1H9S A;  1QE6 A;  2KUM A;  2GVB A;  4JBJ A;  3MR6 A;  2HQL A;  4JI4 L;  1EEF D;  2B2V A;  1XMO L;  4JOI C;  4KHP H;  1GSA A;  1I6V C;  2GN5 A;  1CQI B;  3ERO A;  1CSP A;  4Y7N H;  1PMR A;  1SN8 A;  1E4F T;  3MXU A;  4LW1 A;  4DL6 A;  5C0X H;  3A5Z B;  3RB6 A;  3O13 A;  4LFC L;  2ZTC A;  1G2T A;  2HDM A;  4MHE A;  5CA1 F;  2RCN A;  5ELE A;  3MZ5 A;  5JVL A;  2CWA A;  1PTO H;  3GTG B;  1WTX A;  4LFA Q;  3X3N A;  1JOR A;  4FS1 A;  4X62 Q;  2D2C C;  4R8U A;  3RAQ A;  1PFS A;  3NXW A;  2B8F A;  3BAB A;  4UCV A;  2EYL A;  3HOV B;  3C1F A;  1MSH A;  2F0O A;  3QWN A;  3S9W A;  4DV6 H;  2FB9 A;  5BPF A;  5J2T F;  5JVD F;  1GOZ A;  5I2Y A;  4YY3 H;  2YL2 A;  4PZ7 A;  3PIP A;  4LF7 Q;  4DV7 H;  4ULL A;  1SDF A;  2RF4 A;  2BQ3 A;  5LHY 1;  4ZUJ A;  2Q2I A;  2NB0 A;  3VPB A;  4O3P A;  5M5X H;  1KQS A;  3W1B A;  4ECY A;  1B6S A;  4XQN A;  3KOJ A;  2A6E C;  3J7A F;  1M8A A;  1Y1V G;  1MSG A;  4C3H G;  4EVO A;  3RNU A;  3DEP A;  2L55 A;  4DV1 Q;  3ORR A;  4U6P A;  3ITP A;  3ERQ A;  4TVA B;  1E0B A;  5CMD A;  3QB3 A;  1G8Z D;  5JJZ A;  3SDZ A;  1WTV A;  4L5R C;  4DNT B;  2B63 B;  3E0J A;  4DV3 L;  1Q1E A;  4LF6 L;  4GNX C;  3LWE A;  2SOB A;  2R8I A;  1TAE A;  3BA9 A;  3TQT A;  1IBM H;  1TY0 A;  4B08 A;  1DOL A;  2QK4 A;  5KG5 A;  1Q1B A;  1TR5 A;  3H20 A;  1B50 A;  2JA6 H;  3MWY W;  5EGT A;  4R4O A;  2YZG A;  1LLR D;  5IYD G;  4O42 A;  3KAJ A;  5EWG A;  1EIY B;  2OLS A;  4DR7 H;  1HJP A;  1MI2 A;  2H1E A;  1N36 L;  1IYJ B;  5LXT F;  2WAQ B;  2N88 A;  1YJW A;  5JEA J;  5BN3 A;  3AFP A;  4PMC A;  2IT1 A;  4BBR B;  2XGP A;  4G7O C;  4RKB A;  1PK8 A;  2RGV A;  1HPC A;  4BBS H;  2A6E D;  2JA7 G;  4UCO A;  4XTC S;  2V4D A;  4UCR A;  4MTE A;  1Y8O B;  5T1I A;  4NDX A;  2K52 A;  1IBL Q;  1Y1W B;  5C4X G;  2GLT A;  5KNB A;  2K14 A;  1R4Q B;  1LAB A;  3SHL A;  2YTV A;  5AJ3 Q;  3TP5 A;  4CHT B;  3I7F A;  4KD4 A;  1R9T B;  2KOL A;  1SNP A;  2GA4 B;  4HED A;  4UCS A;  4AQY Q;  3V2T A;  1FKA H;  4JI8 L;  1FJG L;  3TQ1 A;  1UWV A;  3K57 A;  5CV5 A;  4MV1 A;  4RKL A;  1TA8 A;  1AUX A;  1PH9 A;  1UC9 A;  5HY6 A;  2MP1 A;  2ICE C;  4ZYS A;  3KHR A;  5CA0 F;  3I4N H;  2F0J A;  4CKE A;  1EUC B;  5DM7 3;  2V59 A;  4EFB A;  4NXN H;  2F0W A;  3CVZ A;  3TS2 A;  4Q0F A;  4NLG A;  2LMC B;  3NWS A;  3GTK B;  2E74 C;  5EKL A;  4DV6 Q;  2XN9 C;  1KNE A;  3L0O A;  3M4I A;  4IRC A;  2V4R A;  4QIW B;  5ELN A;  4YP3 A;  4YY3 Q;  3S2D H;  2KEE A;  3OW2 A;  3D3R A;  4DV7 Q;  5EKI A;  4ED2 A;  1EFI D;  1N9W A;  4O4H F;  5KG4 A;  2Z6B A;  3EQL C;  1U4R A;  4NW2 A;  2IJ0 A;  2EDG A;  1XNR L;  1EYZ A;  2ZJT A;  4A3G G;  2K32 A;  4F8M A;  4QWA A;  2R6F A;  1F9R A;  4P2C B;  2XCL A;  2NUA B;  3JSL A;  4X3T A;  2KED A;  4K5V A;  4A93 B;  3PW7 A;  2EVB A;  1HTP A;  5L9X A;  1EQQ A;  3U9S A;  1KJ9 A;  1CT1 D;  1LAC A;  1SLJ A;  2HUG A;  4QB4 A;  4PMW A;  2A73 B;  5D3D A;  2VUM A;  3FMA A;  2WB1 G;  4C2M H;  1SFO B;  4RUC A;  5I4D A;  3PO2 G;  5M3M G;  2XWB B;  4HIM A;  1KJJ A;  4XYQ A;  1B04 A;  4EEY A;  1BNZ A;  1STN A;  4J9M A;  3T1Y H;  2W9C B;  4HJ9 A;  3I2Z A;  3RTX A;  5KG0 A;  1VF7 A;  1PRT C;  1AP0 A;  3CQZ B;  3T5H A;  5KG6 A;  1BKB A;  1JE4 A;  4DR7 Q;  4GKK H;  1ML0 D;  3GTP H;  4CDE C;  3PR4 A;  3PR5 B;  2HCI A;  3EBE A;  1PH6 A;  4P73 A;  1W3S A;  4N8F A;  2FK1 A;  1JCK B;  1ZEQ X;  1D5Z C;  2RKS A;  4HMJ A;  4DUZ L;  4ZQI A;  2JEJ A;  3Q0A A;  5IWA L;  2IX1 A;  1RK6 A;  2R82 A;  3UI2 A;  4LFB H;  2E76 C;  5KND A;  5KFG A;  3U4Z A;  1JDE A;  2FMM A;  5KGU A;  4OO1 I;  4UDU C;  1XMQ H;  5CBA E;  1WI5 A;  4IUP A;  4AIM A;  3S1N B;  1V43 A;  2ZJP A;  5DEH A;  4UP9 A;  5C0X J;  2HHH H;  3T16 A;  5E3F A;  4PDB A;  2R7D A;  2JA5 H;  4FF2 A;  2FIN B;  1MD2 D;  1FNW A;  2WTF A;  2EY6 A;  2PMZ E;  1VDZ A;  3WOF A;  2F52 A;  1NUC A;  2BE5 C;  3R5F A;  5LMU L;  2JA5 A;  3HOX H;  4M9U A;  2A1A A;  2J4X A;  2PQE A;  2EJM A;  4EFE A;  5AFW A;  2C22 A;  3H0G H;  5D1P A;  4LMY A;  1PRT D;  2KCN A;  2UXC Q;  3BDO A;  3K5L A;  4NXN Q;  4J9K A;  1WTH A;  1I7L A;  1QB5 D;  3OSN A;  2UUA H;  2L1B A;  5I6Y A;  1N34 H;  3E5S A;  3J80 i;  2FPP B;  3CCJ A;  4IR1 A;  1HUM A;  1KBL A;  2R7Z B;  3T5J A;  4A3C G;  1QUQ B;  3RZD B;  2YU9 H;  3ONA B;  3IAY A;  2E5L Q;  3GP7 A;  1CHP D;  3NBH B;  4IOC A;  2K33 A;  1SEB D;  4IUV A;  1Z2P X;  3FPP A;  2J6U A;  5D14 A;  3KLW A;  4WJ3 M;  3K7U C;  4U67 3;  1VQ9 A;  2WE6 A;  3JAM L;  1K8G A;  3R23 A;  1JOK A;  1WVL A;  5K36 H;  3DXJ C;  1KRS A;  1CQJ B;  2DN8 A;  3CCS A;  4FU0 A;  3NSW A;  4QGU A;  3VDY A;  4OWT B;  1IL2 A;  1ET6 A;  2W70 A;  3C3L A;  1TWH B;  1B4O A;  2BQU A;  2BE5 D;  1NSN S;  1EL0 A;  2Y0S A;  4DNI A;  1UEA B;  5KFD A;  2JEF A;  3Q23 A;  1WYD A;  3HOZ H;  4C3I H;  4L5T A;  3VR5 A;  4OO1 G;  3GTJ A;  2K50 A;  2VPQ A;  5FJ8 G;  2F0P A;  4FP5 D;  2E8G A;  2IHF A;  1QVC A;  4DV2 H;  1RTN A;  5FO7 B;  4UFZ A;  1V4Y A;  1N8R C;  4FS2 A;  4IR9 A;  1OXU A;  2QF7 A;  4EG0 A;  2KVM A;  4O2A F;  4B3M H;  4LF5 H;  2QGQ A;  4WJ4 A;  4DR4 H;  4A2A A;  3GTM A;  5JAV A;  1YNN D;  4JI0 L;  4RCO A;  4AYB G;  3BG3 A;  4HSV A;  3GTO B;  2QDL A;  2R92 G;  1M0T A;  1QZG A;  1TWG A;  2PCF B;  3S1R B;  4X65 H;  1U4P A;  4ED6 A;  3FMC A;  3JAM c;  4IOA A;  1HZA A;  3OYY A;  1KRT A;  1XMQ Q;  4JV2 A;  4JV5 Q;  3RLF A;  2R93 H;  3H09 A;  3N8D A;  2DZD A;  1ESR A;  3AQQ A;  3M4O B;  1SE8 A;  1BJT A;  1PFM A;  2HHH Q;  2JE6 I;  5L1J A;  2C2D A;  4DXF A;  5KFN A;  3F2B A;  1ZET A;  3NQT A;  1W93 A;  3N6R A;  4LJZ C;  1QG7 A;  2XWJ B;  4QWD A;  2VL6 A;  5J22 A;  4G7Z C;  4DA2 A;  3D6W A;  5C8Y F;  2CH4 W;  3WNZ A;  1LYL A;  1BCP B;  4ED1 A;  4P74 A;  2CCZ A;  1DV2 A;  2I5L X;  1YNX A;  1HQM C;  3T13 A;  4JI2 H;  1Z2N X;  2EXD A;  2B8G A;  1SE2 A;  2UUA Q;  1VCI A;  2UUC L;  2YV5 A;  1I50 B;  3TS0 A;  1N34 Q;  3H40 A;  4JI1 H;  5J2U F;  3A8J E;  4DR3 H;  2W57 A;  4QQB X;  1VQ7 A;  1VQJ A;  1GM5 A;  3CC2 A;  2W6P A;  1M6V A;  3VR2 A;  1I4X A;  1NBW A;  4RFB A;  1STE A;  1SMY C;  3NTH A;  4DUY H;  4JG2 A;  4L5Q A;  1V8Q A;  4IJL A;  3OTO H;  2VUG A;  1Q3L A;  2JP1 A;  1N32 L;  3G8C A;  2ZDG A;  5KNC A;  1VQP A;  1PH8 A;  5D1O A;  3CAM A;  1KD1 C;  5CV6 A;  4DV0 H;  4JI5 L;  4TSS A;  4B3R L;  1PFN A;  4IFD J;  2OQ0 A;  4FM9 A;  4DL5 A;  2O2L D;  1DYQ A;  4DR5 L;  4DR6 H;  2A6H C;  3DWQ A;  3ULP A;  2M05 A;  5KFV A;  1Y1V B;  4APV A;  4ECU A;  4C3H B;  4YJ2 F;  1LT4 D;  1HNZ L;  1WFQ A;  1X6O A;  4OHJ A;  1RJQ A;  3UDI A;  3J80 L;  2N3S A;  1HR0 H;  2K04 A;  2B29 A;  5ELC A;  4BY1 G;  2F4V H;  2Q8R E;  1F77 A;  1WSC A;  1EWH A;  2VXW A;  1IW7 C;  4A3L G;  4A3B B;  1GSH A;  3GTQ B;  1BCP F;  1G6Z A;  4FBT A;  3G4S A;  3BZD B;  1XWE A;  1IBK L;  3JRX A;  1M4V A;  1STY A;  2KCC A;  1KEE A;  2AQ1 B;  2ZM6 L;  4DV2 Q;  3AMU A;  1C8C A;  1EY4 A;  1A3V A;  5KT4 A;  1GHJ A;  5KFH A;  4DR1 H;  2EQS A;  1EWI A;  2NBF A;  3RV4 A;  3HS0 C;  4EGJ A;  1BR9 A;  2IMW P;  1Z47 A;  1YI2 A;  1DIK A;  1GVP A;  3U4V A;  3T5K A;  3PZP A;  2RDJ A;  3A5U A;  2C35 B;  2B2W C;  4LF5 Q;  2EY2 A;  1XJV A;  1H95 A;  3KF8 A;  2YS7 A;  3M4P A;  1SMY D;  2R84 A;  1TVX A;  4L8J A;  4LH6 A;  3S1Q H;  1KJ8 A;  4BBR G;  1VQ4 A;  3CPF A;  1EQT A;  2DUD A;  4A2B A;  4TUY F;  5KX5 F;  3RB0 A;  1HZ9 A;  3HKZ G;  1LTG D;  1LT6 D;  1EFW A;  2FK3 A;  2ZDH A;  3S16 H;  3G6X A;  4DAY A;  3J81 i;  2A6H D;  1PX2 A;  4YAK B;  5KFA A;  4OIK A;  2JA7 B;  1QVG A;  4J8Q A;  2VQE H;  4G7H C;  1SYG A;  2DPJ A;  4CJ2 C;  1K83 B;  4DR2 L;  5KT2 A;  1SND A;  2GPW A;  3CCV A;  3EIV A;  2Z1C A;  3J80 c;  1K8O A;  1PYW D;  4ME3 A;  4YR3 A;  1GKH A;  1EYG A;  1IW7 D;  4RCN A;  3J7A K;  2R85 A;  5T14 A;  4M1U B;  4LK1 C;  2NVQ B;  1L2Z A;  1S0O A;  2R7M A;  1O80 A;  1GXD C;  4N9T A;  4QL5 A;  3JAM W;  4IRK A;  2JA6 A;  3P75 A;  4PZ8 A;  1NY4 A;  1SMX A;  3P1H A;  2EYH A;  1I94 L;  2W9B A;  1UE5 A;  3STB C;  3ZYY X;  4R8N A;  3LWB A;  2HT1 A;  4A3M H;  1CE8 A;  2Z0S A;  3H3V I;  2MHV A;  4IUT A;  4KJO A;  1XPU A;  5IGE A;  4HJ7 A;  4DUY Q;  1BBW A;  2XNA C;  3S17 B;  4DN4 M;  4ECW A;  3NWT A;  3OTO Q;  4X3K A;  3CD6 A;  5IE8 A;  3MFI A;  4B3S H;  4HJA A;  4A3I G;  2N78 A;  1TWF B;  5CV9 A;  3S1M H;  4C3J G;  4YWL A;  3WWV A;  1YJN A;  1E24 A;  1WCM H;  1HTL D;  2KHJ A;  3PCO B;  3F8T A;  4O3O A;  4B9W A;  2Z9H A;  4K8I A;  3QOJ A;  3QFF A;  4A3G B;  1I6H H;  3PV0 A;  1PXU A;  2LS0 1;  1PTO D;  4JK1 C;  1VQN A;  3HOW H;  1O7Y A;  4H44 C;  2QKI C;  5IYC G;  2JA9 A;  4X66 L;  3VA5 A;  4J9S A;  1T5E A;  2F4V Q;  1EIH A;  3MJF A;  1ONL A;  1AUV A;  5K5P A;  2JA8 G;  3N40 P;  2JQO A;  2WB1 B;  4A3J H;  3UE1 A;  4DV4 H;  1VQI A;  5M3M B;  3PO2 B;  4MV4 A;  3WO0 A;  4DK0 A;  1VQ8 A;  5JVH 3;  2JJQ A;  2EXZ A;  1HQR D;  5ELD A;  3MAQ A;  3SE7 A;  1OXX K;  3KDF B;  4IUN A;  3GID A;  3OIQ A;  4IPD A;  1S5D D;  2VS1 A;  3BDC A;  1ESF A;  5LP6 F;  4OEM B;  3STB D;  3PO3 H;  4BY7 G;  3A7A B;  5CAE B;  2HVR A;  2F0Q A;  2Z4I A;  4LF8 L;  1Q12 A;  1S5C D;  2G5D A;  3DLL A;  3I4M H;  2VOB A;  5C3X A;  1EWC A;  2RQX A;  1YIJ A;  4JVZ A;  3ORQ A;  4OWW B;  5FLX c;  3T1H Q;  1QIL A;  1JDB B;  1VQG A;  3GIM A;  4XQJ A;  1VBH A;  1QZH A;  4MTD A;  1RYR A;  1XNQ H;  4LMQ D;  2XD4 A;  4ED8 A;  3PUV A;  4IPC A;  2VQE Q;  4RZQ A;  3OMG A;  3ERS X;  2J6T A;  1KXL A;  2NN6 I;  3NEL A;  2ASL A;  1L1O A;  2NUC A;  3T5L A;  3RD4 A;  3RIZ A;  4FO2 A;  4TQR A;  2HD3 A;  1YJ9 A;  4PV1 C;  4C2M A;  3MFH A;  2B2T C;  4O1N A;  4RHR A;  4ZK9 B;  4OX9 L;  4A3K H;  4J9L A;  5FO8 B;  4C5B A;  4RAZ A;  3QR8 A;  2NVT H;  5DQG A;  1SJE D;  5JOB A;  5KFU A;  1F9P A;  3FVQ A;  4LFA H;  3A0J A;  4J1M A;  4X62 H;  1ASY A;  3RGX A;  5KT7 A;  3J81 L;  5HBR B;  4LF9 L;  1NAP A;  4M8A A;  1E4E A;  5EWE A;  1JWM D;  3GTP A;  1N48 A;  4GOP A;  3MXN A;  5M5Y B;  1DOK A;  3ZJY C;  4CDF C;  5IP9 H;  3J80 W;  1LTL A;  1JJC B;  2PZW A;  2ZT9 C;  2K5Q A;  4OL7 A;  3URY A;  4MV3 A;  1TS3 A;  3PUZ A;  4RAU C;  3GTM H;  2RHS B;  1O78 A;  4B3S Q;  1CS0 A;  3M9B A;  5KFO A;  2ZXP A;  3U50 C;  3MEF A;  4X64 L;  4R1J A;  4ZQ3 A;  3KXY T;  2ZJR A;  2TMP A;  3K8A A;  5M5X B;  2TSS A;  3G6V A;  1R4P B;  4PZ6 A;  2F0M A;  4RH6 A;  5KFT A;  1M7J A;  2G9D A;  5C6A A;  5DG8 A;  2VZA A;  2JN4 A;  5IGD A;  3VR4 A;  1LTR D;  4JUZ A;  1KDC A;  4DAP A;  5C44 G;  3W2D A;  3K58 A;  1SYF A;  5IP7 H;  3GIJ A;  1K3R A;  3RR5 A;  3QG1 A;  1EY9 A;  1GD7 A;  1PYB A;  1A3T A;  5KFI A;  2OH2 A;  3KLS X;  1K1Q A;  3PGZ A;  1PTO F;  2F0K A;  4DV4 Q;  3SK5 A;  2FLN A;  1EY6 A;  3KF6 B;  5LMN L;  3H0G A;  3RAX A;  4DV5 L;  2VY3 A;  1NMF A;  3J81 c;  2PZT A;  2NVX H;  2E2I H;  2LXK A;  4IQZ A;  2FPG B;  3I4L A;  4P71 A;  3DWP A;  2IX0 A;  1II3 A;  2NWG A;  4A76 A;  4WBN F;  2NN6 G;  3M85 A;  2KHS A;  2OWO A;  1U4L A;  3QJY A;  2NVY B;  1NR2 A;  2HIV A;  4LSA A;  5IT9 L;  5CGK A;  2YU9 A;  1TWC B;  1SYE A;  2NU7 B;  1S10 A;  1TXY A;  1JB3 A;  2IW3 A;  3TIG A;  4L1K A;  2I80 A;  2MNA A;  4AYB B;  3C2P A;  3GIP A;  4A3D G;  4O2D A;  3K5M A;  1WTQ A;  2R92 B;  1A0I A;  1OXV A;  1B7Y B;  1VS0 A;  4C1N I;  4BBS B;  1XNQ Q;  2L4N A;  1G51 A;  5C4J B;  3HOY H;  1EUD B;  3SI8 A;  4NP5 A;  1QCB D;  5HGT A;  4B3T H;  4ZHQ F;  3KLS A;  1IBL H;  2BH8 A;  2JSO A;  1CKN B;  3K7A H;  1ZXT A;  2VUM G;  4RG1 A;  2IL8 A;  5KEE A;  4EGV A;  3CCE A;  3EN2 A;  4AH6 A;  1NCV A;  4AQY H;  4FYD A;  2VQF L;  5H1S E;  1XYI A;  1L2F A;  3NEN A;  4I50 F;  1GO3 E;  2L12 A;  3C0F B;  4Z9C B;  1B6R A;  4LUV A;  2PN1 A;  4IWY A;  2UU9 H;  2ASD A;  2V58 A;  4GNX A;  3UDF A;  1TWA H;  1E22 A;  1HXY D;  5IT9 c;  4LNQ A;  1IYU A;  2RDG A;  3QZ7 A;  3X3M A;  4KKS A;  5F9L A;  1B3Q A;  3S2D B;  4LF7 L;  4K6D A;  1UUP A;  2DNC A;  2R6G A;  2R8K A;  1H9M A;  2UXD L;  1GLV A;  1FJG H;  5FPO A;  1NE3 A;  5LA6 F;  2R93 A;  4KD3 A;  1S4Z A;  3QO2 A;  3CCU A;  1M1K C;  4O2B F;  4DV1 L;  1EZ8 A;  5D3I B;  2X6G A;  1JE5 A;  1JIC A;  4Y8V B;  1L0Y B;  5GON F;  1BO0 A;  1S3O A;  2E2H H;  3RZO B;  1Y8P B;  3F2U A;  1TII D;  3FRP B;  1BNC A;  1Q90 A;  1PDQ A;  3VR6 A;  4A3B G;  1F2Z A;  4BY1 B;  1RIP A;  1ENC A;  1I3Q H;  2JA5 G;  2XIG A;  2ENB A;  3U9O A;  3GLK A;  4POF A;  2Q2H A;  4A3E H;  1KNA A;  3NE5 B;  2B3G A;  1QJO A;  5KG1 A;  3TRZ A;  1S03 G;  2UUB L;  3TRE A;  2EJG C;  4EX5 A;  4ZKB B;  2CW0 C;  2E2J H;  1K73 C;  3SK6 A;  1XPR A;  3FKI A;  2B2U A;  4GN4 B;  2JXM B;  1X54 A;  5JEA G;  4RUA A;  2SCU B;  5C1P A;  5KT6 A;  4B9X A;  1SRO A;  3BQ0 A;  2MPM A;  4KHP L;  2H4O A;  3BYY B;  4YCU A;  4KJN A;  2F03 A;  4IPH A;  4ME6 A;  3KUP A;  3VPD A;  3HKZ B;  1CKM A;  3M3Y H;  3LX0 A;  1M0W A;  4TRD A;  1IXR A;  5EQ0 A;  3PN1 A;  4B3T Q;  1CA6 A;  2BCO A;  3GIQ A;  2F0E A;  1VQC A;  1X3F A;  1JT8 A;  3LML A;  2PQA A;  5AJ3 L;  2WAC A;  1N36 Q;  2EE1 A;  1D1I A;  1S72 A;  1G29 1;  2I0Q A;  4RMF A;  2OT2 A;  3RUZ A;  2Y0S G;  2NZ1 D;  2Q8I B;  4E4T A;  1SYB A;  3GTL A;  2L5T A;  1VQH A;  3UDG A;  3CHB D;  1V9P A;  3T4A C;  4QUF A;  3EYY A;  3TN2 A;  1T5X D;  2GPS A;  2UU9 Q;  2B2U C;  2PMZ B;  2UXC H;  2C2E A;  3OWF A;  1LV9 A;  4IZ8 A;  5KG3 A;  4JCV E;  2CW0 D;  2ID0 A;  2ATW A;  4DV6 L;  5C0X I;  1EU3 A;  1XTC D;  3IFT A;  3K0X A;  1HNW H;  2EY5 A;  1DJR D;  3RGZ A;  3Q24 A;  3FPU B;  4DV7 L;  1EOV A;  1YEZ A;  2IBK A;  1XX8 A;  3K0Y A;  2E5L H;  1YBY A;  2K7V A;  1H9S B;  3Q22 A;  5C3E G;  4MTN A;  3DEO A;  5LMN W;  4JI8 Q;  1FJG Q;  3HGB A;  4BA2 I;  4A3I B;  1K8A C;  1AZQ A;  2XRQ D;  3TZU A;  4O0A A;  4C3J B;  4IFD H;  3FDS A;  1J8I A;  2IPK D;  2XTI A;  3A54 A;  2RDF A;  4MA0 A;  2Q8T A;  4POG A;  3HOV H;  2F1M A;  2HCC A;  2FK2 A;  1SAP A;  4OEL B;  4CGY B;  5IT9 W;  4A75 A;  3K59 A;  3DMU A;  1ZHQ A;  3GIL A;  2KQ3 A;  1EZ6 A;  1ICF B;  4Q43 A;  4BS9 A;  3NTI A;  2AQ4 A;  3JSN A;  4LSX A;  4EEQ A;  5BR8 H;  1IBM L;  5KFL A;  2JA8 B;  1M90 C;  5FD6 A;  1WJJ A;  1Q8I A;  2R7F A;  3GV6 A;  3F8N A;  1OO9 B;  4R8U B;  4DL2 A;  4IJH A;  4DR7 L;  1K8M A;  4ECS A;  3TME A;  3PIO 3;  5LYJ F;  1HA5 A;  4C1N K;  2QYZ A;  4IUR A;  1LT3 D;  3FHW A;  5CYU A;  4BY7 B;  5EPJ A;  5JUM A;  4EYH B;  1RDP D;  4JI6 H;  3Q6S A;  1CTM A;  1SBB B;  4YCV A;  3KAK A;  5K2M A;  4KY5 A;  1WTP A;  2B63 H;  2W9A A;  2CQO A;  1KAB A;  3MC0 B;  2QEX A;  5EWF A;  1NNX A;  4ED7 A;  1E2V A;  3OHA A;  4TV8 F;  3K5O A;  4LUZ A;  1WCM A;  4GLA C;  4RGO S;  3S14 H;  4DGZ A;  1W2B A;  3GV3 A;  2FJZ A;  3BJY A;  1DON A;  2WV6 D;  2XCA A;  4JV5 H;  4EQN A;  1BDO A;  2DIK A;  1HZC A;  5C0X G;  3CC7 A;  2DWC A;  2KSW A;  2XCP A;  1SNM A;  3D4W A;  2FP4 B;  1JWS D;  3H6M A;  3IKJ A;  4BXX H;  1J6Q A;  5A2Q E;  4MV7 A;  1D7Q A;  1PH2 A;  3OMC A;  1IHZ A;  2X6L A;  5EPL A;  1DGS A;  4L6T B;  1GUT A;  3IL8 A;  3M9M B;  2MO1 A;  1FVI A;  5I2X A;  3I91 A;  1EY8 A;  1T36 A;  3L4K A;  4LUO A;  4C5C A;  2DNE A;  1RK5 A;  4F4X A;  1WR2 A;  2F3I A;  5KFE A;  2W6O A;  3M9O B;  4J9Q A;  1MIU A;  1KJI A;  5DNF A;  3TII A;  1T94 A;  4PQX A;  1A63 A;  4HIO A;  1Y1W H;  1HNW Q;  3G6E A;  3BQ2 A;  4V0B A;  2WKC A;  3CME A;  2RDH A;  1R9T H;  2EYM A;  2X0S A;  2QA4 A;  3GO5 A;  4WD3 A;  5KFX A;  2KBN A;  2BDO A;  3ULJ A;  4DK3 C;  3MR2 A;  5LMU Q;  1Z6H A;  4IUU A;  5EJW A;  3DM3 A;  4UPA A;  1O7L A;  4QIW E;  1TT2 A;  4ABN A;  2K1B A;  3I56 A;  4XXE A;  2EYJ A;  4MZ9 A;  1RD9 D;  1LTA D;  2R61 A;  2UUC H;  1AFP A;  3BYT B;  3Q8D A;  2J0T D;  1H9K A;  5C44 B;  3MVV A;  1WH2 A;  1K0S A;  2ASB A;  2LKV A;  5BR8 Q;  1J5E L;  5KIX A;  4TQU S;  5BPH A;  4BWG B;  3T1Y L;  1W96 A;  1V1P A;  5M5W B;  4IFD I;  2JA6 G;  3RB3 A;  3MWE A;  2F3W A;  5C5L A;  2FKL A;  2YZM A;  4GS3 A;  4GKK L;  3VA7 A;  1VQ5 A;  5KFK A;  4RNO A;  4XYM B;  4ECZ A;  4J0M A;  3SVM A;  2F0G A;  4A93 H;  1BXT A;  1AW7 A;  4NXM H;  4JI6 Q;  4A3F H;  3T51 B;  1PRT B;  1SFO H;  3G6Y A;  3I3C A;  5IYB H;  3SK8 A;  5KFY A;  1C4Q A;  1D2B A;  4KMU C;  4LFB L;  2NU9 B;  2PW7 A;  3F2C A;  3PQI A;  4BBS G;  1ENA A;  1KC8 C;  4M7E A;  2MGS A;  4CJ0 B;  4A3D B;  4UHV A;  4DK1 A;  3R93 A;  2V9W A;  1MJE A;  3CQZ H;  5CV7 A;  1CHQ D;  2LSS A;  1IBK H;  4DL7 A;  4F4Y A;  4OIJ A;  1GYF A;  4KKT A;  4HAE A;  1CI3 M;  1Q8K A;  3RN5 A;  3TEH B;  5KFQ A;  4JBM A;  3PIP 3;  1AN7 A;  4GKJ L;  1E1O A;  1FGB D;  2DGY A;  5L1K A;  1KLG D;  1CM9 A;  2NU6 B;  2VUM B;  5ELO A;  2R86 A;  3L2P A;  1U9R A;  1T9H A;  2K01 A;  2QW7 A;  1DV1 A;  1J9O A;  2YCH A;  2IP4 A;  3OUU A;  3MEH A;  4O4I F;  3Q8Q B;  3E9I A;  2NVX A;  2E2I A;  3I4N G;  3HB9 A;  2EYF A;  3AB9 A;  2K28 A;  1EY7 A;  4ID6 A;  1RJP A;  3S1N H;  1E7Z A;  4ME5 A;  4ALP A;  1N34 L;  5GQO A;  5KFS A;  2M2L A;  1S0N A;  3G48 A;  1O7Z A;  1N33 H;  2ZXO A;  2C2R A;  3PF4 A;  1PRT F;  4P75 A;  3TQY A;  4DKA C;  3FKI H;  5GAG C;  4HCE A;  4YHH H;  2J6S A;  3ND8 A;  4CBV A;  4RAY A;  1UE1 A;  2EOT A;  3VYS A;  4Q44 A;  3I12 A;  2BA1 A;  1WD0 A;  2B2W A;  3K5I A;  4EGQ A;  3W5O A;  4IFD G;  1SCU B;  3LWU A;  4P72 A;  3HOU H;  3V05 A;  3TP6 A;  1WTW A;  1DZ1 A;  4JI3 H;  5CB4 F;  1MZB A;  4K5X A;  2E2D C;  2LY7 A;  2L15 A;  2M9V A;  1VBG A;  5M3F H;  1D5M C;  3OSO A;  2UUC Q;  4J15 A;  4ZLT F;  2ZTD A;  2QDB A;  1YNJ C;  2RHQ B;  2R7Z H;  4UAI A;  2AWN A;  2NU8 B;  4NPS A;  1AH9 A;  4UY8 C;  2I87 A;  3EPI A;  3CP0 A;  4K5W A;  4EBE A;  1F2L A;  3NQI A;  3HZX A;  4ECQ A;  2WKD A;  3AYH B;  1UE6 A;  2XIW A;  3MA2 B;  1LUZ A;  4QCL A;  3PVX A;  3GTL H;  4IWX A;  2OXP A;  3M4Q A;  2JA5 B;  3VYU A;  5BN4 A;  4I4T F;  2AGO A;  4JI7 H;  1SEI A;  4DV2 L;  3HEJ A;  2Q2U A;  1STA A;  5EBC A;  4LF4 L;  1TWA A;  4TQS A;  4WRD A;  5BMV F;  2PPB C;  2DPI A;  2I8C A;  1D6E C;  4UCT A;  2HIX A;  4U68 A;  4B3M L;  5CR3 A;  2MQH A;  4DR4 L;  4NXM Q;  1VKZ A;  4YWM A;  1TWH H;  1HNZ Q;  1HFG A;  2YZN A;  2A68 C;  1VMC A;  5C5J A;  1Z9F A;  2SNS A;  3Q8S B;  4X65 L;  1QNK A;  4HQ6 A;  2N49 A;  4I7Z C;  1OTC A;  5J1Z A;  3T1H H;  4GC7 A;  3H4B A;  1A9X A;  5KFF A;  4GLX A;  1IBK Q;  2PW5 A;  2AHO B;  5FLM H;  1FR3 A;  1UE7 A;  2ZJQ A;  4JYA H;  4DNR B;  4HID A;  4R8I A;  1ILP A;  3F1Z A;  3N43 B;  2WIN B;  1B2T A;  1PHJ A;  2E2H A;  4K0K H;  4HR7 A;  1YNJ D;  2R8H A;  4ZRZ A;  4QMG A;  3VYT A;  4K14 A;  3VYR A;  4YAJ B;  2R7L A;  1C3O A;  5COR A;  5HV6 A;  4EYI B;  2P0A A;  3N6X A;  3GTO H;  1I3Q A;  3HOX G;  1VQM A;  2Y0S B;  2EIF A;  2Q2T A;  3S1R H;  3H0G G;  4PNY A;  2QCP X;  1B53 A;  1HZB A;  4JI2 L;  1QNU A;  3VMM A;  2YTY A;  1NMG A;  1U5K A;  3GTJ B;  3M4O H;  3OPO A;  4JI1 L;  5M9O A;  4DR3 L;  5I9P A;  3K5H A;  2C5C A;  1WD1 A;  1N33 Q;  2L9H A;  4CDD C;  5CC4 A;  1CA5 A;  1RJR A;  1B1Z A;  3OW7 A;  4YHH Q;  4DUY L;  2A68 D;  3H91 A;  4HJ5 A;  1EYA A;  1ICW A;  3OTO L;  3JRW A;  3GTM B;  1SJH D;  4I65 A;  5DLQ E;  4LAA A;  4DV0 L;  3UQ8 A;  2KEN A;  1BF4 A;  1T3N A;  4RGM A;  4IHJ F;  4KKU A;  4QJF A;  5C3E B;  3MFG A;  4GN5 A;  1TWG B;  5DAU A;  5FLX L;  4IN3 A;  3PF5 A;  4DR6 L;  4JI3 Q;  3S2H H;  5KFB A;  5K36 G;  3K5N A;  3KHL A;  4IPG A;  4IUQ A;  1V1Q A;  1I94 Q;  1I50 H;  3LGJ A;  3E3X A;  1PZJ D;  3U9T A;  2JEI A;  4K2K A;  1HR0 L;  1YVC A;  2F4V L;  1A62 A;  2P5Z X;  2EPB A;  1LTT D;  2RBM A;  1Q82 C;  1N56 A;  3C1E A;  1BQQ T;  5KYI A;  3HOZ G;  4J6H A;  4C3I G;  3OUZ A;  2F0N A;  2B2T A;  4IAL A;  1HH2 P;  4JI7 Q;  2EJF C;  1DXM A;  2K75 A;  2N55 A;  3DUZ A;  2VW9 A;  5G3L D;  4DR1 L;  2FHT A;  1Y1V H;  1E2Z A;  1OWT A;  1CUK A;  3SXH A;  2ASJ A;  1RYS A;  1B9N A;  2I5M X;  4I7A A;  4A3F G;  3NTK A;  5KFP A;  4Y52 H;  3PW4 A;  1HNX L;  1Q46 A;  1LTS D;  2YTX A;  1JJG A;  4XYO A;  4ZAI A;  3CMA A;  4F4W A;  1EOT A;  1B44 D;  4KHZ A;  3GTQ H;  3GTG A;  3KHH A;  2OF1 A;  4J9N A;  1GUN A;  3KJO A;  3SK4 A;  3A8I E;  4QWC A;  5I9O A;  5D1O B;  2R93 G;  2VQE L;  1NTG A;  2BQR A;  4JYA Q;  2R8G A;  3EVQ A;  4Y7N B;  4MV9 A;  1XDN A;  2MO0 A;  2PBZ A;  2DJF C;  4K0K Q;  4XQQ A;  2UVU A;  1ET9 A;  4PMB A;  5IYD H;  3JZI A;  4FNF A;  3PW2 A;  5GAE C;  1IL8 A;  2Z6K C;  2V5A A;  5KFR A;  5KFC A;  4LF8 Q;  4MV6 A;  2PZU A;  2GVA A;  5KFM A;  5EBD A;  2NZH A;  3CCR A;  1SYD A;  3JC6 6;  1TU2 B;  2F0U A;  2L11 A;  4MA5 A;  2HVS A;  1PTO B;  4JI4 H;  5IOC A;  1XMO H;  1X56 A;  3Q8R B;  2AKW B;  4ED0 A;  3HBL A;  3RBE A;  4ED3 A;  1JWU D;  3M7N A;  2W71 A;  2JA7 H;  4I7H A;  1XXG A;  1D5X C;  3RJ0 A;  1K83 H;  1IYV A;  4QW8 A;  4APM A;  5DQH A;  2UXB L;  4BWS C;  2PI2 A;  3V4S A;  1PVO A;  3FKI G;  3I73 A;  3GDE A;  3K6O A;  2AQ3 B;  2B63 A;  5CBE E;  5C4X H;  2B2Y C;  2F4I A;  4LFC H;  3KF8 B;  2O03 A;  4XDX A;  4OX9 Q;  3RFC A;  5E4X A;  1DD2 A;  2VQF H;  3HOU G;  1GHK A;  3L3O C;  3UDX A;  5IGG A;  1UNS A;  3F2D A;  3OSP A;  3DM1 A;  4DAY B;  1GJX A;  1YHB A;  2EYO A;  3EPG A;  2VB3 X;  3HG9 A;  2KJX A;  3GII A;  3RLO A;  2WAQ A;  1YHA A;  2A5H A;  1VQL A;  3ETJ A;  2JEG A;  3W3A A;  2HGS A;  2NZO A;  1UC8 A;  3S17 H;  2F0H A;  1Z2O X;  3IFD A;  2C28 A;  1TWF H;  5JPM C;  1K1S A;  3PSI A;  1G6P A;  2K03 A;  2NTT A;  4YCW A;  4ZUI A;  5DGB A;  2D9U A;  4FXG C;  3BA8 A;  5GAD C;  2C9O A;  4ETS A;  4R9W A;  2JA6 B;  2ZDQ A;  2XGQ A;  4A3G H;  2WB1 E;  5LL6 b;  5EAY A;  1Y1W A;  3A55 A;  5IGC A;  5KFJ A;  2W9B B;  1SYC A;  5G3L F;  1EYD A;  2W8K A;  1R9T A;  1V51 A;  5DLF A;  1KC7 A;  2HQE A;  5KG2 A;  4QF4 A;  3S15 H;  2FPI B;  1MGS A;  3PO2 H;  5M3M H;  1X32 A;  4DV3 H;  1DOM A;  5A35 A;  4LF6 H;  4RGN A;  1XNQ L;  3HFZ B;  2K5H A;  3CXC A;  1H9R A;  2YRW A;  3LP8 A;  1S97 A;  4FF3 A;  2L0C A;  1MJC A;  2UUB H;  3IG0 A;  2UVW A;  1PFB A;  3SEB A;  1VQK A;  4QIW A;  1X55 A;  1SSO A;  4DU9 A;  3AU7 A;  4RNN A;  4ZI7 F;  1WTR A;  1N36 H;  4DK6 C;  2CW8 A;  2SEB D;  4LFA L;  1STH A;  4JI4 Q;  4X62 L;  3KBG A;  1JLL B;  5FLX W;  1XMO Q;  3DWA A;  4DFA A;  4UP8 A;  1A3U A;  4RWS C;  3I4N B;  1K0R A;  2ZTE A;  1X3E A;  2WFW A;  3FP9 A;  4DAM A;  2SNM A;  5E7N A;  4RB3 C;  3PW5 A;  1HR0 W;  4A3M G;  4H0L C;  2A74 C;  1JIH A;  3EJI A;  3V96 A;  1SFO A;  4KTA A;  4LFC Q;  1BBU A;  3BZK A;  1GUW A;  1YIT A;  3KBX A;  4WOR A;  1I6U A;  2H5X A;  3A8K E;  2KCT A;  1KAW A;  2VQF Q;  2W9C A;  4JI8 H;  3J7Y W;  1WCM G;  3CQZ A;  3A74 A;  3MR5 A;  3OIP A;  4IO9 A;  3CCL A;  2FLP A;  3HOW G;  4MIU A;  4H7B A;  5M5Y H;  4Q45 A;  1S40 A;  3BVZ A;  5EOY A;  4YB8 B;  2B2V C;  3NGD A;  1L1O B;  3KFU A;  4R4T A;  1JXL A;  2BDN A;  4A3C H;  4R4I A;  4C2M B;  4A3J G;  1CFM A;  4HCS A;  1VAJ A;  4Q0Y A;  1F2M A;  1EQV A;  1EYC A;  3L7Z C;  1H9J A;  1Y8N B;  4CJ1 B;  2Z4H A;  2UXD Q;  4HYK A;  3IRB A;  2K5V A;  3SE0 A;  4KHV A;  3NPP A;  4F87 A;  1XNR H;  3PO3 G;  3C46 A;  3S24 A;  3R8B A;  1E4E B;  3TZD A;  3V4Z A;  4J9R A;  1SYX B;  1VQF A;  3GTP B;  4GOP B;  3MXN B;  2XGT A;  4MAM A;  3I4M G;  1CSQ A;  3P20 A;  5EZY F;  2CWP A;  2WYO A;  3TIN A;  4DV3 Q;  3HP3 A;  2JK8 A;  4LF6 Q;  2AU0 A;  1PH5 A;  2JEA I;  4O3R A;  4C56 C;  2XVS A;  1X3G A;  5FO9 B;  4HMI A;  5E1F A;  1D1K A;  1STG A;  2XSC A;  4MTK A;  5F2D A;  4GN3 B;  3S14 B;  4OO1 H;  3J81 W;  4LWC A;  5L1L A;  4PWQ A;  2UUB Q;  2CFM A;  5FJ8 H;  3J81 j;  1SR3 A;  4B3T L;  1C0A A;  2NVY H;  4AYB E;  2D62 A;  2CW7 A;  1YZ6 A;  2YRX A;  2BR0 A;  1IBL L;  2R7Z A;  2QIL A;  1IZ6 A;  1QUQ A;  1SE3 A;  3UE0 A;  1KJQ A;  1UNN C;  1X9N A;  1BUV T;  1TWC H;  4A3K G;  3NBH A;  1LT5 D;  4DAV A;  4AQY L;  1GSO A;  4JW0 A;  2W6Z A;  3CCQ A;  2R92 H;  4KHP Q;  3HOX B;  4JC0 A;  4XYL B;  4DUZ H;  3NEM A;  2UU9 L;  4NB3 A;  3H0G B;  4NMZ A;  1O75 A;  5IWA H;  3H3V C;  5KFW A;  5C4J H;  1A8V A;  2MUY A;  3NBI A;  1C30 A;  3E5N A;  5IP9 G;  4ECV A;  1B3A A;  1TWH A;  1K9M C;  4O3S A;  5JJK A;  1HUN A;  4YY3 L;  2VQD A;  2YU9 B;  4NKL A;  4UP7 A;  3I8Z A;  2OTJ A;  3BJU A;  1B33 N;  5LMU H;  4G57 A;  2F0T A;  3E9H A;  3R3O A;  3GTG H;  3JAM i;  1X65 A;  2ATL A;  1CKO A;  1VQ6 A;  1SNC A;  2R7N A;  4YR2 A;  2K4K A;  3H15 A;  2M00 A;  2HJW A;  3BAA A;  1RCV D;  4YBZ B;  1JB7 A;  2F0V A;  2CHB D;  3ULL A;  4XT1 B;  3MHB A;  1B9M A;  3KK7 A;  2X69 A;  1KAA A;  5IP7 G;  1A6X A;  4I55 F;  3CRL C;  5IY0 A;  3CPW A;  1LM0 A;  4ZKC B;  3GTO A;  2G9H D;  2ZXR A;  3NK9 A;  4KY7 A;  2FXQ A;  2K5N A;  4EBC A;  4HNT A;  3JAM E;  2D0P A;  2RSN A;  2WII B;  1RJT A;  3ND9 A;  4E6I A;  4RHS A;  1Z7T A;  3HOZ B;  4C3I B;  2PI2 E;  5FOB B;  1ENF A;  1XNR Q;  4QWE A;  2PYK A;  3N41 B;  1U4M A;  1NJI C;  4CC5 A;  2ICI A;  2F0L A;  4GNX B;  5KG7 A;  3GIK A;  3TSS A;  4JV0 A;  2KA7 A;  1Y69 U;  2RA4 A;  3RZO H;  4HNV A;  3E0E A;  2ES2 A;  1K3B C;  1PV4 A;  1JJ2 A;  3KAL A;  4XT3 B;  5LL6 S;  4A3F B;  2W7P A;  2IWH A;  1MHW C;  4BY1 H;  1LTI D;  4A3L H;  1BBX C;  1IBM Q;  1J5E H;  1P8L A;  4F88 A;  3TBI B;  1RF2 D;  3MXP A;  4OON A;  2WAQ E;  3HOY G;  1I4P A;  2W6Q A;  2R93 B;  1I50 A;  4YWK A;  1JX4 A;  1FYC A;  3Q1K A;  3NUC A;  2MCT A;  3H4D A;  3D0F A;  2CZG A;  2J9G A;  1W6J A;  2IY5 B;  2F0D A;  3HKZ E;  1ULZ A;  1CQF A;  3PUX A;  3KJP A;  4RB1 A;  1Q81 C;  3KHG A;  1AE2 A;  2W8L A;  4BBR H;  1VQD A;  1ASZ A;  1FD7 D;  4CC6 A;  4JI0 H;  5IGB A;  1ZQ7 A;  4DUZ Q;  1I4Q A;  2J7Z A;  5IWA Q;  2UXC L;  1VQB A;  5IIF A;  1S5F D;  3PMF A;  4NXN L;  2FLL A;  1Y1V A;  3A56 A;  3D4R A;  3G7L A;  5FPR A;  2VPS A;  5KT3 A;  1FGU A;  1AN8 A;  1DM0 B;  5DLG A;  4XIG S;  1HNW L;  4WFN 3;  2PVP A;  3GV7 B;  3D4D A;  4YIJ A;  1BCP C;  3V6H A;  2VB2 X;  1Q7Y C;  2FJ2 A;  3FKI B;  2E5L L;  3GTQ A;  1UAP A;  4EBD A;  2IA6 A;  4GKJ H;  1ZHS A;  4LH7 A;  2MFI A;  1MBY A;  4OXP A;  2F0I A;  1RKN A;  1Q86 C;  1HCZ A;  2LFN A;  2VA2 A;  5IGF A;  5C4H A;  3VPC A;  3HOU B;  3TP8 A;  2ALZ A;  2YW2 A;  5D8D A;  1SNO A;  4XZ3 B;  5CV4 A;  4RB0 A;  1IKL A;  5M3F B;  3GTK H;  3DF7 A;  1D8L A;  5DG9 A;  1V1O A;  3BS1 A;  2AUK A;  4YQW A;  5I47 A;  2PQA B;  1QWY A;  1YNN C;  5BR8 L;  5LL6 X;  2HVQ A;  4V19 0;  1EZ1 A;  1C9O A;  2FMC A;  3MXG A;  3AEV A;  1W6K A;  4A3E G;  5F9N A;  5EDW A;  5J39 A;  3GTL B;  4A3I H;  3NP8 A;  1N32 H;  1PYS B;  2I07 B;  4QW9 A;  1LTB D;  2JA7 A;  4C3J H;  3CRK C;  3DHQ A;  4JI5 H;  1ZKO A;  2CKZ B;  4B3R H;  4GLV B;  3BVM A;  3J80 E;  1K83 A;  5FK9 C;  4DR5 H;  5EPK A;  3PUW A;  2N8N A;  2R3Z A;  5DM6 3;  5LOV F;  3GQB A;  1BCP D;  4A4I A;  4K2L A;  4UCU A;  2F3V A;  4JI6 L;  1TKW B;  2A8V A;  2YYA A;  4CKC A;  1JOO A;  3MWD A;  4RZR A;  5IYC H;  1HNZ H;  4O3Q A;  5IOD A;  1HHV A;  2DJG C;  1IOV A;  4X3S A;  4KI0 A;  4FVM A;  3S1Q B;  3MWM A;  2A69 C;  2B39 A;  2JA8 H;  4N9P A;  1J5E Q;  1OXT A;  5C3W A;  1OXS C;  1ILQ A;  3G71 A;  2OCE A;  3T1Y Q;  4U7C A;  3RN2 A;  3S16 B;  1TS5 A;  1XMQ L;  4JV5 L;  2KCM A;  5L37 A;  2DY8 A;  1F2Y A;  2FFK B;  4LF4 H;  4L5S A;  2OEO A;  2HHH L;  2ZM6 H;  4YR0 A;  3VR3 A;  4GKK Q;  2O5J C;  4KK7 A;  5ISR A;  2CQA A;  4QUC A;  4BY7 H;  3L4J A;  2RGR A;  2W6N A;  5C5M A;  3MTS A;  1AE3 A;  3CU7 A;  2IX3 A;  2WP8 J;  5NUC A;  1EU4 A;  1TS2 A;  1PH7 A;  4FF1 A;  4JI0 Q;  1TWF A;  2W6M A;  1E4G T;  1I5F A;  1LO5 D;  3BQ1 A;  5HGQ A;  4LFB Q;  3KYH C;  1TS4 A;  5A2Q L;  4Q8E A;  3R2T A;  3RBD A;  3M4Y A;  5KT5 A;  1KHI A;  1STB A;  4QY7 A;  2UUA L;  1A2U A;  1FNU A;  1WOC A;  1BOS A;  2FMA A;  4DR2 H;  3BDL A;  3V6J A;  4A3M B;  1GUO A;  4EQO A;  2BA0 A;  2RCF A;  3H3V H;  5JPN C;  2A69 D;  2WB1 A;  1CZW A;  3I72 A;  4WJW A;  4GKJ Q;  1AZP A;  2PNR C;  4KN4 C;  1QVF A;  4EQ5 A;  2FE3 A;  1S9F A;  3B6Y A;  3KDF A;  1RTO A;  3S1M B;  2AQ2 B;  3PUY A;  3S2H B;  3QIA A;  2LXJ A;  1PH1 A;  1EY5 A;  1WCM B;  4ZCK A;  3N42 B;  5KFZ A;  3HOV G;  2JYO A;  4MNO A;  1I6H B;  1L0X B;  4R4Q A;  5H80 A;  1I94 H;  3HXL A;  3HOW B;  4HSP A;  1XTD A;  4H02 A;  5J3B A;  3OHB A;  2NTS A;  2UVR A;  4S3S A;  1EHI A;  2UVV A;  3RUP A;  3RZD H;  1CK1 A;  5FLX E;  4DXG A;  1AEX A;  3I70 A;  4RB2 C;  1B70 B;  1VF5 C;  3GD7 A;  4HTH A;  2D5D A;  1EEI D;  4DF7 A;  4A3J B;  1N32 Q;  4JI5 Q;  2YS6 A;  4B3R Q;  2HDL A;  1E1T A;  4QWB A;  2AMC B;  4JBW A;  4EQP A;  2EZV A;  1FNV A;  4DR5 Q;  1PH4 A;  3D8G A;  4K8J A;  4BA1 I;  1VQO A;  3PO3 B;  3MR3 A;  4ODG A;  5KRU A;  4NXM L;  5GRO A;  4LF5 L;  3RB4 A;  4FXK C;  1S5E D;  4DLK A;  1F9S A;  5C44 H;  4ECR A;  1KLU D;  3I90 A;  1RHP A;  2MJ8 A;  4KN7 C;  2B63 G;  4X66 H;  2V1C C;  4ECX A;  3Q2O A;  3I4M B;  3KLR A;  5I6W A;  2KHI A;  4GZY C;  3ICE A;  2I46 A;  1E3P A;  5FD5 A;  1U0L A;  3W1G A;  2O5I C;  5M5W H;  2CQY A;  1VQE A;  3WDN A;  4DPG A;  4LF4 Q;  4K6L A;  2Z8L A;  3D6C A;  5T1G A;  2ZM6 Q;  4DL3 A;  2NN6 H;  4BXX G;  1SNQ A;  1A15 A;  2XRS D;  1ROD A;  2WAQ G;  4B3M Q;  4DR4 Q;  2A19 A;  3R5X A;  3LNN A;  4LF8 H;  1HNX H;  4A3K B;  2RVL A;  4OGQ C;  3H94 A;  1C48 A;  4RU9 A;  3I4O A;  1PH3 A;  4X65 Q;  2NVT B;  1VMP A;  3K3P A;  1X3P A;  3N52 A;  4N8X 1;  3CCM A;  5E4W C;  4A3D H;  2CH4 A;  2I5H A;  1KDA A;  1V1P B;  2QEJ C;  5JQW A;  2K5D A;  1I7N A;  2C00 A;  5BN5 A;  3WO1 A;  1PZI D;  1SE4 A;  3EFX D;  3T53 B;  3U58 A;  2W7O A;  1N33 L;  4DR2 Q;  3OWE B;  1Y1W G;  1O7I A;  4R4C A;  1HFN A;  5KKN B;  1PTO C;  3HRZ C;  1C7Y A;  4YHH L;  4O3N A;  5DG7 A;  4ECT A;  2AGP A;  5C4X B;  5JJI A;  1BXR A;  2VUM H;  3SGI A;  4TV9 F;  3KF6 A;  3J81 E;  4OX9 H;  3QZ8 A;  4ILW A;  3RF2 A;  4F7X A;  4JI3 L;  4HJ8 A;  2R8J A;  1XPO A;  5FKA C;  4JI2 Q;  1X3Q A;  2KEC A;  4RGT A;  4IRD A;  2NVY A;  1JQY D;  5DQI A;  5COY A;  3GV8 B;  4LF9 H;  4HN7 A;  2VR1 A;  4JI1 Q;  4Q8F A;  3PW0 A;  4DR3 Q;  1JR0 D;  2EY1 A;  3UFX B;  1TWC A;  3D31 A;  1PA6 A;  2UXB H;  1IKM A;  4G3I A;  2AWO A;  2DLN A;  4AYB A;  3IN5 A;  2F0S A;  1GGO A;  2R92 A;  5EKK A;  5L1I A;  1TY2 A;  4JV1 A;  2Z6K A;  4DV0 Q;  3Q8P B;  3R5H A;  1EUJ A;  4JI7 L;  4FDB A;  2F0F A;  1KDB A;  4R7R A;  4X64 H;  1JOQ A;  1HA6 A;  2NVX B;  3ETH A;  4DR6 Q;  2E2I B;  1SRU A;  1VQA A;  2AUJ D;  1IOW A;  3J7A V;  4C3H H;  4A93 G;  3K3V A;  1CKN A;  1QOH A;  3NHH A;  1JC7 A;  1EIG A;  1HR0 Q;  4X66 Q;  1PLF A;  5IYB G;  2K05 A;  3BVG A;  3N44 B;  3S15 B;  4A3B H;  1RL2 A;  1F9Q A;  1ZYR C;  1UEB A;  3T1H L;  5A2Q W;  3CKI B;  4PG3 A;  1CQV A;  2PO4 A; 
#chains in the Genus database with same CATH homology
 2EXD A;  2H5X A;  2UUA Q;  1VCI A;  2UUC L;  4JYA L;  2KCT A;  2YV5 A;  4YCV A;  3TS0 A;  1N34 Q;  1KAW A;  2VQF Q;  2B63 H;  4DR1 Q;  3J7A 5;  2CQO A;  1WCM G;  4QQB X;  4K0K L;  2QEX A;  1VQJ A;  1GM5 A;  1VQ7 A;  3A74 A;  3CC2 A;  4IO9 A;  2VNU D;  1NBW A;  3K80 C;  2YYZ A;  4LUZ A;  3CCL A;  4GLA C;  4JG2 A;  4L5Q A;  4IJL A;  3HKS A;  3ER0 A;  3HOW G;  3S14 H;  1N32 L;  5M5Y H;  1W2B A;  1S40 A;  1VQP A;  1PH8 A;  1HNX Q;  3CAM A;  1KD1 C;  1KIX A;  3K81 C;  4JI5 L;  2JEB I;  4B3R L;  1MKH A;  1L1O B;  3KFU A;  2OQ0 A;  1HZC A;  4R4T A;  5C0X G;  3BU2 A;  3CC7 A;  4IFD J;  4DR5 L;  4A3C H;  4HIK A;  3ULP A;  4R4I A;  4A3J G;  4BXX H;  3CF5 A;  1P16 A;  1J6Q A;  4APV A;  3L7Z C;  1B8A A;  1D7Q A;  3I55 A;  1HNZ L;  1WFQ A;  1PH2 A;  2UXD Q;  1X6O A;  2K5V A;  3IRB A;  3UDI A;  1Y14 B;  2N3S A;  2PNH A;  1DGS A;  3RLN A;  2Y0S E;  2B29 A;  4BY1 G;  2MO1 A;  1FVI A;  3PO3 G;  3S24 A;  4A3L G;  3PIO A;  4LUO A;  1KL9 A;  1VQF A;  2F3I A;  4GOP B;  2D0O A;  3G4S A;  3MXN B;  2XGT A;  4B3S L;  1IBK L;  2OQK A;  2NVQ H;  3I4M G;  1CSQ A;  1MIU A;  2ZM6 L;  4DV2 Q;  4HIO A;  1Y1W H;  4JBK A;  1HNW Q;  1A63 A;  2CWP A;  3G6E A;  2EQS A;  1EWI A;  4DV3 Q;  1EQR A;  3CME A;  1Z47 A;  2JK8 A;  1YI2 A;  1GVP A;  3U4V A;  1R9T H;  4LF6 Q;  3A5U A;  3GO5 A;  3GTJ H;  2QA4 A;  2C35 B;  2KBN A;  3ULJ A;  4DK3 C;  5M3F G;  1X3G A;  1XJV A;  4LF5 Q;  4LF9 Q;  3M4P A;  4KLK A;  5LMU Q;  2OTL A;  3DM3 A;  4GN3 B;  4UPA A;  3S1Q H;  2R7Z G;  4LWC A;  4BBR G;  3CPF A;  2DUD A;  1VQ4 A;  2UUB Q;  2CFM A;  5FJ8 H;  4QIW E;  1SR3 A;  3J81 j;  4B3T L;  1C0A A;  4X6A H;  2NVY H;  4AYB E;  2D62 A;  1YZ6 A;  1IBL L;  1HZ9 A;  3HKZ G;  1EFW A;  1IZ6 A;  1QUQ A;  3I56 A;  3UE0 A;  4DV4 L;  3S16 H;  1X9N A;  1TWC H;  3J81 i;  4MZ9 A;  4A3K G;  1L0W A;  5C3E H;  2ALY B;  1QVG A;  1BVS A;  4X64 Q;  3Q8D A;  1TWG H;  4AQY L;  1L1O C;  4DR2 L;  3CCQ A;  3CCV A;  3EIV A;  5GAH C;  2R92 H;  2UXB Q;  3J80 c;  4KHP Q;  4JC0 A;  2ASB A;  3NEM A;  4ME3 A;  4NB3 A;  3BZC A;  5BR8 Q;  4JOI A;  3J7Z C;  1J5E L;  1GKH A;  4TQU S;  1EYG A;  5JJL A;  5C4J H;  3T1Y L;  1A8V A;  2IHE A;  4IFD I;  2JA6 G;  1JMC A;  3AFQ A;  5IP9 G;  1K9M C;  1YHQ A;  5JJK A;  4GS3 A;  4GKK L;  1VQ5 A;  4QL5 A;  4YY3 L;  4PZ8 A;  1NY4 A;  4A93 H;  4GOP C;  4UP7 A;  1SMX A;  5LMN Q;  1I94 L;  4JI6 Q;  4DV5 Q;  2OTJ A;  3BJU A;  5FLM G;  4A3F H;  1UE5 A;  3STB C;  3E9H A;  1SFO H;  3GTG H;  1FL0 A;  1EIF A;  4OWX B;  2HT1 A;  5IYB H;  1X65 A;  3JAM i;  4A3M H;  1CKO A;  2Z0S A;  1VQ6 A;  3H3V I;  2K4K A;  4LFB L;  1XPU A;  3H15 A;  4BBS G;  3F2C A;  4DUY Q;  1BBW A;  4HJ7 A;  1KC8 C;  2BH2 A;  1JB7 A;  3OTO Q;  3CC4 A;  3CD6 A;  5IE8 A;  3CW2 C;  4HJA A;  3ULL A;  2N78 A;  4A3I G;  3CQZ H;  1MJE A;  2LSS A;  5IP7 G;  3S1M H;  4YWL A;  3WWV A;  1YJN A;  4JBJ A;  2GVB A;  5IY0 A;  1E24 A;  1WCM H;  2HQL A;  1Q8K A;  2KHJ A;  1LM0 A;  3F8T A;  3PCO B;  3CPW A;  3RN5 A;  3TEH B;  1XMO L;  4JI4 L;  4JOI C;  2FXQ A;  2K5N A;  1I6H H;  4JBM A;  3PV0 A;  2D0P A;  1VQN A;  2GN5 A;  3HOW H;  4GKJ L;  1CSP A;  1E1O A;  2DGY A;  5IYC G;  2JA9 A;  4X66 L;  4Y7N H;  5ELO A;  1SN8 A;  2PI2 E;  4LW1 A;  2F4V Q;  3L2P A;  1XNR Q;  3A5Z B;  1T9H A;  1NJI C;  4LFC L;  3E9I A;  2JA8 G;  2JQO A;  4A3J H;  2ZTC A;  3UE1 A;  4GNX B;  3I4N G;  1VQI A;  1VQ8 A;  3RZO H;  2JJQ A;  3E0E A;  2ES2 A;  1PV4 A;  2RCN A;  1E7Z A;  4ALP A;  1JJ2 A;  3S1N H;  1N34 L;  5GQO A;  1OXX K;  3KDF B;  2CWA A;  3G48 A;  4IPD A;  2VS1 A;  3PF4 A;  4LFA Q;  4X62 Q;  4BY1 H;  4P75 A;  3TQY A;  4DKA C;  3FKI H;  3STB D;  5GAG C;  3PO3 H;  4BY7 G;  4A3L H;  1PFS A;  1IBM Q;  1P8L A;  1UE1 A;  4LF8 L;  4OON A;  1Q12 A;  2BA1 A;  2WAQ E;  3DLL A;  3HOY G;  3I4M H;  3W5O A;  4IFD G;  4YWK A;  4P72 A;  1YIJ A;  3HOU H;  4OWW B;  3D0F A;  5FLX c;  3T1H Q;  1VQG A;  4PZ7 A;  3PIP A;  2IY5 B;  2L15 A;  3HKZ E;  4LF7 Q;  1QZH A;  5M3F H;  2RF4 A;  3PUX A;  3KJP A;  2UUC Q;  4J15 A;  2Q2I A;  3PUV A;  2ZTD A;  4IPC A;  1AE2 A;  2RHQ B;  5M5X H;  3W1B A;  2VQE Q;  1Q81 C;  1KQS A;  3ERS X;  1VQD A;  2AWN A;  4BBR H;  1ASZ A;  2R7Z H;  1KXL A;  2NN6 I;  3KOJ A;  3NEL A;  4NPS A;  1AH9 A;  1L1O A;  1Y1V G;  4UY8 C;  3CP0 A;  4DUZ Q;  3RNU A;  5IWA Q;  4DV1 Q;  1VQB A;  1YJ9 A;  2UXC L;  3AYH B;  1UE6 A;  4NXN L;  1LUZ A;  4OX9 L;  3GTL H;  4A3K H;  4TVA B;  1FGU A;  3M4Q A;  4XIG S;  2NVT H;  4DV2 L;  2Q2U A;  4L5R C;  4LF4 L;  1HNW L;  4DV3 L;  1Q1E A;  1Q7Y C;  4LF6 L;  3A0J A;  4GNX C;  1ASY A;  2HIX A;  2E5L L;  4B3M L;  4LF9 L;  2MQH A;  4DR4 L;  4NXM Q;  4YWM A;  1TWH H;  1HNZ Q;  2MFI A;  1Q1B A;  4GOP A;  4OXP A;  1Q86 C;  2JA6 H;  3ZJY C;  5IP9 H;  4R4O A;  1Z9F A;  2ZJQ A;  1LTL A;  1JJC B;  5IYD G;  4X65 L;  2N49 A;  1EIY B;  1HJP A;  3PUZ A;  1OTC A;  3GTM H;  2RHS B;  1N36 L;  1IYJ B;  4B3S Q;  3M9B A;  4GLX A;  1IBK Q;  3GTK H;  1YJW A;  1D8L A;  2AHO B;  3AFP A;  3MEF A;  1UE7 A;  5JEA J;  4R1J A;  3U50 C;  4X64 L;  5FLM H;  2ZJR A;  3F1Z A;  2IT1 A;  3K8A A;  4HID A;  4PZ6 A;  1PHJ A;  2PQA B;  5BR8 L;  4BBS H;  2VZA A;  2JA7 G;  1C9O A;  4XTC S;  3AEV A;  4A3E G;  4A3I H;  5C44 G;  1PYS B;  3GTO H;  5IP7 H;  4C3J H;  3HOX G;  1K3R A;  3RR5 A;  1VQM A;  1GD7 A;  2CKZ B;  2EIF A;  1PYB A;  2K52 A;  4GLV B;  3S1R H;  3H0G G;  2Q2T A;  1IBL Q;  3PGZ A;  5C4X G;  4DV4 Q;  2K14 A;  1HZB A;  2N8N A;  3PUW A;  5AJ3 Q;  2YTV A;  4JI2 L;  3KF6 B;  4A4I A;  2YTY A;  3I7F A;  1NMG A;  5LMN L;  1U5K A;  4DV5 L;  4JI6 L;  2A8V A;  2VY3 A;  3M4O H;  1NMF A;  5IYC H;  4JI1 L;  3J81 c;  4AQY Q;  4DR3 L;  2NVX H;  4JI8 L;  1FJG L;  2E2I H;  1UWV A;  2LXK A;  1N33 Q;  4P71 A;  4A76 A;  2IX0 A;  4KI0 A;  2NN6 G;  3M85 A;  1PH9 A;  4YHH Q;  2OWO A;  5HY6 A;  4DUY L;  4HJ5 A;  2JA8 H;  1J5E Q;  1OXT A;  1OXS C;  3OTO L;  3G71 A;  2HIV A;  3I4N H;  2OCE A;  3T1Y Q;  5DLQ E;  3RN2 A;  1XMQ L;  4DV0 L;  2KCM A;  3TS2 A;  2KEN A;  4JV5 L;  1TXY A;  4QJF A;  4DV6 Q;  3L0O A;  2JEA I;  4L5S A;  2HHH L;  4GN5 A;  5ELN A;  3PF5 A;  2MNA A;  4DR6 L;  3S2H H;  4YY3 Q;  4JI3 Q;  4GKK Q;  5K36 G;  4A3D G;  4O2D A;  3S2D H;  4IPG A;  1A0I A;  4BY7 H;  1OXV A;  1B7Y B;  1VS0 A;  3OW2 A;  4DV7 Q;  1XNQ Q;  1V1Q A;  1I94 Q;  1AE3 A;  1I50 H;  1N9W A;  3LGJ A;  1G51 A;  2WP8 J;  3HOY H;  1PH7 A;  1HR0 L;  4JI0 Q;  1YVC A;  2F4V L;  1A62 A;  1I5F A;  1XNR L;  5HGQ A;  4A3G G;  4LFB Q;  1Q82 C;  3KYH C;  2BH8 A;  1CKN B;  3K7A H;  2VUM G;  3HOZ G;  4RG1 A;  1KHI A;  2UUA L;  4QY7 A;  1HH2 P;  1EQQ A;  3CCE A;  3EN2 A;  4AH6 A;  4JI7 Q;  4PMW A;  2K75 A;  1SLJ A;  2VQF L;  5H1S E;  2VW9 A;  1L2F A;  1WOC A;  3NEN A;  4DR1 L;  2WB1 G;  4C2M H;  1GO3 E;  3PO2 G;  1Y1V H;  5M3M G;  4LUV A;  4HIM A;  2BA0 A;  1CUK A;  3H3V H;  1H95 A;  2I5M X;  4GNX A;  4A3F G;  3UDF A;  4GKJ Q;  1TWA H;  1E22 A;  1QVF A;  4Y52 H;  4HJ9 A;  3I2Z A;  1HNX L;  1Q46 A;  4EQ5 A;  5IT9 c;  2YTX A;  4LNQ A;  1JJG A;  3B6Y A;  3KDF A;  1BKB A;  3CMA A;  3GTQ H;  3PUY A;  4KHZ A;  2LXJ A;  1PH1 A;  4DR7 Q;  3GTP H;  3HOV G;  3KJO A;  4LF7 L;  4MNO A;  2R6G A;  3EBE A;  4R4Q A;  1PH6 A;  4P73 A;  2R93 G;  1W3S A;  1NTG A;  2VQE L;  4JYA Q;  2UXD L;  1XTD A;  4H02 A;  5J3B A;  2MO0 A;  1NE3 A;  4K0K Q;  3RZD H;  4DUZ L;  5IYD H;  3CCU A;  1M1K C;  5IWA L;  5GAE C;  4DV1 L;  2IX1 A;  2Z6K C;  1B70 B;  3U4Z A;  1JE5 A;  3GD7 A;  4OO1 I;  4LF8 Q;  1N32 Q;  1S3O A;  2E2H H;  1WI5 A;  2GVA A;  4AIM A;  2NZH A;  4JI5 Q;  1V43 A;  2ZJP A;  3CCR A;  4B3R Q;  1E1T A;  3JC6 6;  4UP9 A;  5C0X J;  2AMC B;  4JBW A;  4A3B G;  4DR5 Q;  1PH4 A;  2R7D A;  2JA5 H;  1X56 A;  1RIP A;  2AKW B;  4BA1 I;  1VQO A;  2PMZ E;  1I3Q H;  2JA5 G;  4NXM L;  2JA7 H;  3M7N A;  5GRO A;  4LF5 L;  2F52 A;  2Q2H A;  4POF A;  4A3E H;  5LMU L;  1K83 H;  5C44 H;  2B3G A;  2B63 G;  2UXB L;  2V1C C;  2PI2 A;  3HOX H;  3TRZ A;  2A1A A;  2UUB L;  1PVO A;  2KHI A;  3FKI G;  3TRE A;  3H0G H;  4EX5 A;  3GDE A;  3ICE A;  2UXC Q;  1E3P A;  5C4X H;  2E2J H;  4NXN Q;  1K73 C;  1U0L A;  3KF8 B;  3W1G A;  1XPR A;  4OX9 Q;  5M5W H;  4GN4 B;  1VQE A;  1X54 A;  5JEA G;  4DPG A;  3J80 i;  4LF4 Q;  3CCJ A;  3HOU G;  2ZM6 Q;  3UDX A;  1SRO A;  4A3C G;  3F2D A;  1QUQ B;  4KHP L;  4YCU A;  2YU9 H;  4DAY B;  4BXX G;  1YHB A;  2E5L Q;  2WAQ G;  4IPH A;  4B3M Q;  4DR4 Q;  3NBH B;  4IOC A;  1CKM A;  3M3Y H;  2A19 A;  3RLO A;  1YHA A;  1VQL A;  3KLW A;  4WJ3 M;  3K7U C;  1PH5 A;  1IXR A;  4B3T Q;  1VQ9 A;  3I4O A;  1PH3 A;  2NZO A;  4X65 Q;  1K8G A;  3S17 H;  1VQC A;  1X3F A;  3CCM A;  4A3D H;  1JT8 A;  1KRS A;  2I5H A;  2PQA A;  5AJ3 L;  1N36 Q;  3CCS A;  1S72 A;  1G29 1;  1TWF H;  2I0Q A;  4RMF A;  3VDY A;  4QGU A;  3PSI A;  4OWT B;  4YCW A;  1IL2 A;  1G6P A;  2Y0S G;  3U58 A;  1N33 L;  5GAD C;  4DR2 Q;  1VQH A;  1Y1W G;  1O7I A;  4R4C A;  3UDG A;  1V9P A;  1C7Y A;  4A3G H;  4YHH L;  4DNI A;  2WB1 E;  5EAY A;  2UU9 Q;  5JJI A;  2UU9 L;  1WYD A;  3SGI A;  4C3I H;  2VUM H;  3HOZ H;  4L5T A;  3KF6 A;  4JCV E;  2ID0 A;  4OO1 G;  2ATW A;  4DV6 L;  2K50 A;  5C0X I;  5FJ8 G;  2E8G A;  2IHF A;  1QVC A;  3K0X A;  3S15 H;  4JI3 L;  4HJ8 A;  3PO2 H;  5M3M H;  1XPO A;  4JI2 Q;  1N8R C;  4DV7 L;  1OXU A;  1EOV A;  1YEZ A;  3HFZ B;  1XNQ L;  2K5H A;  3CXC A;  2QGQ A;  1YBY A;  4WJ4 A;  5C3E G;  4MTN A;  5LMN W;  4JI1 Q;  4DR3 Q;  4JI8 Q;  1FJG Q;  4JI0 L;  4BA2 I;  3D31 A;  4AYB G;  1PA6 A;  1K8A C;  1MJC A;  2R92 G;  1QZG A;  4O0A A;  1VQK A;  2AWO A;  2XTI A;  1X55 A;  3JAM c;  4POG A;  3HOV H;  4IOA A;  1HZA A;  3OYY A;  1KRT A;  1XMQ Q;  2Z6K A;  4DV0 Q;  4JV5 Q;  3RLF A;  1EUJ A;  4DK6 C;  4JI7 L;  4FDB A;  4A75 A;  2R93 H;  3AQQ A;  1SE8 A;  2HHH Q;  2JE6 I;  4DR6 Q;  4LFA L;  3F2B A;  4JI4 Q;  1SRU A;  1VQA A;  4X62 L;  1XMO Q;  4UP8 A;  4C3H H;  4A93 G;  1IBM L;  1M90 C;  2VL6 A;  1CKN A;  1WJJ A;  1K0R A;  2ZTE A;  1X3E A;  1HR0 Q;  2WFW A;  3FP9 A;  4DAM A;  4X66 Q;  2R7F A;  5E7N A;  1HR0 W;  5IYB G;  4A3M G;  1LYL A;  4IJH A;  4A3B H;  4DR7 L;  1RL2 A;  4P74 A;  2CCZ A;  4LFC Q;  1UEB A;  3T1H L;  2I5L X;  1BBU A;  3BZK A;  4PG3 A;  1YIT A;  1YNX A;  3FHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...