4QJFA

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
186
Chain Sequence
b'MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKKKAKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit E'
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
total genus 40
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qjfA02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qjfA01
1HZAA 4J15A 2OQKA 2WB1E 4B3TL 2R7FA 1I94L 1E22A 3GDEA 4IFDI 3HOYG 2PMZE 4YHHQ 4LF7Q 2KENA 4R1JA 4IJHA 4JI5Q 3W1BA 2AMCB 5GADC 4GOPB 1EOVA 1QVCA 1R9TH 4B3ML 1BVSA 3UDXA 4LF4Q 3KLWA 1EYGA 4L5QA 1EFWA 1XMOL 1AE3A 2Z6KA 3CXCA 3H3VI 4EX5A 1YVCA 3KYHC 1HNWL 1Z9FA 3UDIA 3E0EA 1JT8A 4JI2L 4DR4Q 1SFOH 2K5NA 3GTJH 4IO9A 4BY1H 2JA8G 2MO0A 2PQAA 2JA9A 4LF8Q 2JQOA 2MO1A 3K7UC 1IL2A 1J5EL 4EQ5A 3RN2A 1VQ4A 2IT1A 3CMEA 5H1SE 1VQMA 1S72A 2UUAL 3STBC 5M3FH 4JI8Q 1JMCA 4R4QA 4DR2L 3F8TA 1B70B 3B6YA 4TQUS 1N33L 1PH3A 3KDFB 3GTOH 1VQCA 4LUZA 3BZKA 5GROA 5JJIA 1YJNA 2ASBA 1LYLA 2HHHQ 1X6OA 3M85A 1FVIA 4JI4Q 4A3CH 4GKJL 3H15A 3AFPA 1X56A 2JEBI 3K80C 1L2FA 4X64L 4YY3Q 5M5XH 4DR7Q 4PZ6A 5HY6A 2E5LQ 3FKIH 4HJ7A 5M5WH 3NBHB 3RLNA 1JJGA 3OW2A 1DGSA 1XMQQ 4IPCA 1Q81C 4A3DH 1N32Q 4JI1Q 1K8AC 3E9IA 4LF8L 2R7ZH 4BY7H 1GD7A 1MJCA 5GAGC 4K0KL 3AFQA 2N78A 3TEHB 1QVFA 1E3PA 2CFMA 3JAMc 4KHPQ 4YWMA 1EQRA 1UE1A 4YWKA 1SROA 3KF8B 3SGIA 4JG2A 4DV3L 2QGQA 4LFCL 3M3YH 5BR8Q 1IBKQ 5GQOA 1AH9A 1G6PA 3PF5A 4NXNQ 1VQ7A 1WFQA 1FGUA 3AYHB 3ERSX 4DV0L 1GM5A 4JOIC 4B3RQ 1PH5A 2VQEQ 2KCMA 2Y0SG 1E1OA 3CCVA 2I5LX 5LMNQ 1WOCA 4C2MH 5LMUQ 1D7QA 2HHHL 2UU9Q 2UXDL 2PQAB 3HKZG 4LFAQ 4BA2I 1B7YB 3F2BA 1TWHH 2R6GA 1N34L 3MXNB 4X66Q 2HQLA 3K7AH 1VQOA 5C0XG 1PYSB 2JE6I 4APVA 3RN5A 4MNOA 1QVGA 4DR6Q 4TVAB 1KAWA 5IP7H 1XMQL 3M9BA 2NVYH 2UUBL 1U0LA 1N32L 1Y1WG 3I2ZA 3HOUH 1QUQA 3KOJA 3PO2H 2C35B 2VQFL 3EIVA 1WYDA 1YBYA 4GNXC 1HNXL 4KHPL 5IYBH 3RR5A 1VQLA 1Z47A 3T1HL 1MKHA 1PH4A 2YYZA 4DV6Q 4QL5A 5BR8L 1AE2A 4BA1I 3S1NH 1MJEA 4OWXB 4DV1L 2Z0SA 4IFDG 3PCOB 4JBJA 4OWWB 4B3RL 1E1TA 3PUZA 1FL0A 3PIOA 3G4SA 1YNXA 1HJPA 5LMUL 5LMNL 1VCIA 5C4XH 1X3FA 3ULJA 5IYCG 4IOCA 1KC8C 1SMXA 4A3MG 1IBML 4LF6L 3S15H 3PO3H 3E9HA 4DR1L 5JEAJ 2MNAA 4L5SA 2RHQB 3F2DA 3KFUA 4QJFA 3PSIA 3TS0A 1ASYA 1YHQA 3S2DH 2UXBQ 1HNZL 2CWAA 2A19A 3EN2A 3CC2A 4JI3Q 2JA7G 4JI6Q 4YCUA 4GKKQ 1WCMG 4A3JG 5DLQE 4A3GG 2CWPA 4IPHA 4X65L 4LFBQ 2RF4A 2LSSA 4DUYL 2R93H 4BXXG 4HIDA 3M4PA 2NVTH 1YJWA 1VQDA 3J81j 3M4QA 4UY8C 4UP9A 3UDFA 1YJ9A 2MQHA 2YTXA 2Y0SE 4DV2Q 1A8VA 2OQ0A 4IPGA 5IY0A 5FLMH 3HOVH 5K36G 1I50H 1P16A 2NN6I 4AYBG 3CPWA 3HKZE 2VS1A 1EQQA 3TRZA 3I4OA 2EIFA 4JOIA 4DUZL 3CPFA 1Q46A 3G6EA 4PZ7A 3J7ZC 5E7NA 1TXYA 1PH8A 4B3SQ 2EQSA 1JJCB 3U4VA 1QUQB 1HR0W 4P71A 2F52A 4POFA 1QZGA 4PZ8A 1Y1VH 5IYDH 2YTVA 4A76A 1S40A 1K9MC 2JA5H 1YITA 4JI6L 4A93H 1SRUA 4P74A 5C3EH 4JI7L 4BY1G 1HH2P 1PH6A 2JA6H 1V43A 2UUCQ 1K3RA 4KI0A 1SR3A 4DR5Q 1VQJA 1XNRL 3S1RH 1HZCA 1PYBA 1IBLL 3TS2A 1PVOA 2GVAA 4GNXA 4GLAC 4DR3L 3U58A 2JJQA 1EIFA 3TQYA 1NJIC 1FJGL 1L1OA 3M7NA 2K5HA 3S14H 1OXSC 2WFWA 2A8VA 1N36Q 1CSQA 1XNQQ 4A3BH 2B3GA 3G48A 5M3FG 5JJLA 2AWOA 1X54A 4UP7A 1P8LA 2LXKA 1G51A 4YHHL 3CCRA 1LUZA 4JI5L 2N8NA 4LF7L 3K0XA 4O2DA 1GO3E 2I0QA 4QQBX 2VL6A 4GOPC 4NPSA 3I55A 4LUOA 4A4IA 4LF4L 4YWLA 4A3CG 2VY3A 4FDBA 4GLVB 1L0WA 2D0PA 4HJ9A 1XPOA 5GAHC 2F3IA 1NY4A 3FKIG 4DR4L 1X9NA 4A3DG 1D8LA 4RMFA 4BY7G 5FJ8H 4HJ5A 2UUCL 3EBEA 4KLKA 2MFIA 2R7ZG 5C4XG 1KD1C 4WJ4A 4JBKA 1IZ6A 1NMFA 4BBSH 2Q2IA 2KHJA 4ALPA 1HNZQ 2GVBA 3Q8DA 3J81c 4AYBE 3HOXH 4GS3A 1W2BA 5M3MH 4DV7Q 3OYYA 4DV5Q 1Q1EA 1VQPA 2K75A 4JI8L 3RLOA 1SLJA 3TREA 4DAYB 4JV5Q 2BH8A 1X55A 2IX1A 2UXCQ 1X3EA 2HIXA 1UE7A 3I56A 3GO5A 3RZDH 3A5ZB 1Q86C 1XPUA 1WI5A 1K83H 1NTGA 1OTCA 1U5KA 1EUJA 4JI4L 3H0GH 4LW1A 3CCUA 4A3KH 4GNXB 2FXQA 4YY3L 2RCNA 2YU9H 4DR7L 3MEFA 2E5LL 1L1OB 2ZM6Q 1E7ZA 5IP7G 3OTOQ 4A3LH 5FLXc 3VDYA 3HOUG 1A62A 3PO2G 1Y14B 4JI1L 1T9HA 3WWVA 5IE8A 1BBWA 4H02A 5IYBG 1XTDA 2JK8A 2NZHA 3KJOA 1JE5A 3HKSA 4R4IA 1VQ9A 3AQQA 1C9OA 3CCJA 1HR0Q 1KIXA 3AEVA 2F4VQ 3PUXA 2D62A 2LXJA 1HZBA 4A3IH 2HT1A 4XTCS 3T1YQ 1IBKL 2NN6G 4NXNL 5IT9c 4Y52H 1OXUA 3S16H 4JV5L 1IXRA 5EAYA 3CD6A 1VQ6A 2N3SA 2ZTDA 3UDGA 3GTGH 1PH2A 3HOWH 3I4NH 2H5XA 2OTLA 3PO3G 4P73A 4NXMQ 2VQEL 3DM3A 4IPDA 1VQGA 2UU9L 4OX9Q 1YIJA 1V1QA 4R4TA 4LFAL 3CF5A 5ELOA 3M4OH 3CCQA 3FP9A 1VQAA 3BJUA 2R92H 4X66L 1Q82C 1KXLA 2OWOA 5IP9H 4DR6L 1VQFA 3ULLA 4HIKA 4AQYQ 2OCEA 5JEAG 2JEAI 1I5FA 1LM0A 4DV4Q 1I6HH 2R93G 4LWCA 2DGYA 2R7DA 4A3EH 1HR0L 3J80c 1YI2A 3GTPH 4B3TQ 3D31A 3F1ZA 3HFZB 4JCVE 4DV6L 4A3FH 1A63A 3G71A 1CKNA 4MTNA 5FLMG 3A5UA 3HOVG 4B3MQ 3CMAA 1J6QA 3CC7A 3L7ZC 3S1MH 3I4MH 3CCEA 4IOAA 3CP0A 3A74A 4C3IH 3HOZH 1XMOQ 1TWGH 3PUWA 1CSPA 1UEBA 1V9PA 4ME3A 3RNUA 2VUMH 2ZTEA 3K8AA 1GKHA 3KDFA 4JI2Q 1TWFH 2Q2HA 1Y1VG 5IYDG 4OONA 3ER0A 2JA5G 2UXBL 4A93G 1VQKA 5C3EG 3BZCA 2CQOA 5C44H 2RHSB 2IHFA 4BBRH 4JI3L 5M5YH 2ZJPA 4JBWA 4AQYL 5HGQA 3PUYA 4L5RC 1VQNA 4RG1A 1JJ2A 2JA6G 4GKKL 3J7A5 4DAMA 1CKMA 3CC4A 4LFBL 4OXPA 2BH2A 3KJPA 3GTMH 3S24A 2UUAQ 4OWTB 4UP8A 1KRTA 2WAQG 1OXVA 1JB7A 2K14A 2XGTA 4DR2Q 4A3BG 1KQSA 2I5MX 2OTJA 1N33Q 4QY7A 3HOYH 4KHZA 3U4ZA 4DV2L 3NELA 1CUKA 4JC0A 4YCWA 3D0FA 4QIWE 1X65A 5C4JH 4JI0Q 4GKJQ 1YHAA 4DK3C 1G291 1VQBA 4X64Q 2ZJRA 3CCMA 1C7YA 5JJKA 4P75A 2E2HH 4B3SL 4OO1I 3NEMA 5ELNA 4LF9Q 2YTYA 2Q2TA 1Q8KA 3NENA 2K50A 2E8GA 3CQZH 2JA8H 2AWNA 2VNUD 2B29A 1GVPA 3PUVA 5GAEC 3S17H 4K0KQ 1X3GA 4GN5A 5FJ8G 1UE6A 2L15A 1CKNB 4O0AA 1MIUA 4GN4B 1YHBA 3JAMi 2DUDA 4HIMA 4DR5L 3J81i 2BA1A 4BBSG 2ALYB 4DV3Q 2NVQH 4DPGA 4LFCQ 2NZOA 2K52A 2IHEA 3S1QH 2ATWA 3HOXG 2BA0A 1LTLA 4DV0Q 2XTIA 1PFSA 5M3MG 2KHIA 1N36L 1VQ8A 1XNQL 1M90C 1TWCH 1RIPA 4Y7NH 2VW9A 1ASZA 4JI0L 1BBUA 4DNIA 1BKBA 1A0IA 2UXDQ 4R4OA 3UE0A 4PG3A 4HIOA 2QEXA 1N34Q 3KF6A 1KRSA 2K5VA 3ZJYC 2A1AA 4GLXA 4LF9L 3H0GG 4A3KG 1O7IA 2I5HA 2UUBQ 4NB3A 4LF5Q 2IY5B 3IRBA 1NBWA 4A3LG 2VQFQ 1HNXQ 4DKAC 1CKOA 4XIGS 4R4CA 1EIYB 4YCVA 2WAQE 3CW2C 3T1HQ 4JYAQ 4JBMA 2AKWB 1K0RA 2AHOB 4DK6C 2YV5A 1I3QH 4MZ9A 4DV1Q 1VQ5A 4WJ3M 5J3BA 1NMGA 1OXXK 3GTKH 4A3IG 4A75A 2HIVA 2ID0A 1KHIA 2V1CC 3FHWA 3F2CA 1K73C 4GN3B 1IBMQ 1W3SA 5C0XJ 4DV7L 4HJAA 4UPAA 1VS0A 2WB1G 4DV5L 1PA6A 4LF6Q 3CCLA 3GTQH 2D0OA 3HOWG 2PI2A 4DR1Q 3I4NG 2ES2A 2Z6KC 1TWAH 2EXDA 3L0OA 4LNQA 4X62Q 2K4KA 2ZJQA 2UXCL 1VQIA 5AJ3Q 2N49A 1SN8A 1KL9A 1HZ9A 1XJVA 3S2HH 4P72A 1WJJA 1EWIA 1N9WA 4GOPA 4LF5L 1Q1BA 3PV0A 2IX0A 2R92G 4LUVA 5IWAQ 5IP9G 4X65Q 1Y1WH 1XPRA 4DUYQ 3K81C 2ZM6L 4IFDJ 3PIPA 3OTOL 2WP8J 2CKZB 1L1OC 3BU2A 4PMWA 4JYAL 3J80i 3RLFA 4AIMA 3LGJA 1VQHA 3ULPA 1PHJA 3ICEA 3GTLH 4A3EG 1PH7A 3RZOH 3CAMA 2NVXH 2PNHA 2GN5A 1UE5A 4QGUA 1NE3A 1Q12A 2PI2E 2F4VL 4A3FG 3KF6B 1PH1A 1I94Q 1UWVA 4DUZQ 3T1YL 1M1KC 5IYCH 2B63H 3I4MG 4A3MH 1SE8A 3UE1A 2QA4A 3HOZG 4X62L 1YZ6A 2E2JH 4IJLA 3W5OA 3JC66 4POGA 5AJ3L 4NXML 3H3VH 4OO1G 1QZHA 2VUMG 1E24A 4OX9L 1HNWQ 1H95A 1OXTA 1YEZA 3W1GA 4C3JH 2E2IH 4X6AH 2Q2UA 4JI7Q 4L5TA 2KCTA 5C0XI 2JA7H 3CCSA 4HJ8A 1K8GA 5IWAL 2CCZA 3U50C 5C44G 1IYJB 1WCMH 4BBRG 4A3JH 4A3GH 4C3HH 2ZTCA 1XNRQ 3GD7A 3STBD 4AH6A 2VZAA 3L2PA 5LMNW 2B63G 1IBLQ 1PV4A 1RL2A 1S3OA 3A0JA 3DLLA 3I7FA 4DR3Q 4BXXH 1B8AA 2KBNA 3PGZA 4DV4L 1Q7YC 1N8RC 1PH9A 1J5EQ 1FJGQ 3PF4A 1C0AA 1VQEA
chains in the Genus database with same CATH superfamily
4XXEA 1EY8A 2R7FA 4MA0A 1BNZA 1K83B 3E6ZX 2MHVA 5K36H 3HOYG 3BA8A 4V190 3H0GB 4B3ML 2YU9B 3KLWA 2UVWA 5D1PA 2Z6KA 4JI3H 3KYHC 5BN3A 1Z9FA 1JT8A 1K3BC 3GTJH 4IO9A 2JA8G 2KEEA 2JA9A 3H91A 5KEEA 2JEIA 2MO1A 2DY7A 5FO8B 4A3IB 3W3AA 3KHRA 3MXNA 3A8KE 3FPUB 1A9XA 1J5EL 3RMHA 1CQVA 4ME6A 2WB1B 4ED1A 1SAPA 4YR3A 1BF4A 5H1SE 1QNUA 2UUAL 2V5AA 4J9RA 4MIUA 1JMCA 4YHHH 4LF7H 4O3PA 3JAML 4CC6A 4FXGC 1R9TA 1PH3A 4UCTA 2WTFA 4LF4H 3IFDA 1Z2OX 1LYLA 4A2BA 4QWDA 3TBIB 3H15A 3K80C 3G6JB 3PW2A 4J9SA 4DR7Q 1BCPB 3NE5B 2UUCH 4K14A 2W6ZA 1JJGA 1RKNA 2MP1A 4A3DH 4QWAA 4LF8L 1HA6A 2O03A 1IW7C 4LAAA 3R2TA 3AFQA 4K0KL 2PW7A 4YWMA 1EQRA 4JVZA 4IRDA 1CQJB 5KFSA 4YWKA 1HTPA 3WNZA 1N36H 3OUZA 1SROA 4ILWA 3KF8B 3SGIA 4O2AF 3WO1A 4JG2A 2JEFA 4K6DA 5FPRA 3KHGA 1IBKQ 1AH9A 1E4EB 2W71A 3PF5A 3URYA 4WBNF 2ASDA 1WFQA 4DV0L 1GM5A 4CDEC 2VUMB 4YP3A 2FP4B 4B3RQ 3GTOA 2EYOA 2KCMA 2FHTA 3CCVA 4C2MH 4QB4A 2HHHL 2F0FA 2UXDL 3CRKC 1O7YA 1TS5A 5M5YB 1TWHH 3R5XA 1TA8A 3FKIA 3D6WA 1VQOA 3K7AH 5C0XG 1PYSB 3RN5A 5KG0A 4MNOA 4TVAB 1KAWA 3BJYA 2R7ZA 2IMWP 1Y1WG 3A56A 3PIO3 5EQ0A 1RDPD 5CYUA 1HNXL 4AYBB 1HHVA 3G6YA 1YBYA 4KHPL 1VQLA 2VOBA 2K5DA 3N41B 3T1HL 1EZ1A 4DA2A 4J9QA 1ZKOA 2PNRC 5KFAA 1KC7A 5IT9W 2CW0D 2Z0SA 5ELDA 1AZQA 2DJGC 2NN6H 4OWWB 2CH4A 2UXCH 1FL0A 1SFOB 4RB0A 5C6AA 2ZXRA 5LMNL 4ZUJA 1KC8C 2NWGA 3ULJA 2CQYA 4NKLA 4LF6L 1U4PA 3LMLA 3S17B 5DM73 4QJFA 4F7XA 1YHQA 1M0TA 2BQRA 1HNZL 4XQJA 2CWAA 4C3JG 3I12A 1CHPD 3DUZA 3Q22A 3M4IA 1BNCA 4JI3Q 4G57A 5KFVA 2KSWA 3OWFA 4F8MA 1JIHA 1T5XD 2CWPA 4IPHA 4X65L 2RF4A 3JRWA 1XTCD 1HR0H 2D9UA 2N55A 2Z8LA 3MR5A 2KEDA 3M4QA 4HNUA 3UDFA 3GTLA 4J9NA 4IPGA 5IT9E 2UVVA 4EFBA 1WTRA 4RU9A 2F0VA 4O4LF 1I7LA 1KLGD 1S5FD 2PPBC 3HKZE 1LTGD 2PW5A 2VS1A 1EQQA 3BG5A 2HVSA 3CPFA 3G6EA 5ELCA 4PZ7A 5E7NA 1TXYA 1NR2A 4K8IA 4B3SQ 3GIJA 1QUQB 1CTMA 2K33A 2F52A 5KYIA 1QZGA 3GQBA 2VA3A 4UCSA 3CVZA 4OGQC 2YTVA 4DAYA 1S40A 2YRWA 5KFUA 2JA5H 4G3IA 2E2IA 4JI6L 1QG7A 2JA7A 3SE0A 4BY1G 1HH2P 5IGDA 2JA6H 1V43A 2UUCQ 3Q2OA 3HGBA 1CK1A 3PQIA 5DLGA 1QOHA 1PYWD 1EIFA 1L1OA 1GLVA 4RKBA 1N36Q 5C4ZA 3PN1A 4MV8A 2B3GA 4RCNA 5JJLA 4WD3A 3OIQA 4NW2A 4ECQA 5A2QW 1X54A 4FS2A 3NQIA 3S2HB 3ND9A 1PK8A 3DWAA 2KJXA 5J22A 4JI5L 3CCRA 2N8NA 4O2DA 2OF1A 1DYQA 3A54A 4GOPC 1ENCA 1PTOC 4LUOA 1Y1WB 4A4IA 4YWLA 1TS4A 2FMMA 3EQLC 1L0WA 4HJ9A 2D0PA 4ZKCB 5KFHA 4Q8EA 2AQ3B 1XPOA 2EYFA 5GAHC 5D14A 4DR4L 3S1NB 1WVLA 5C1PA 5JVLA 2A73B 2B39A 1R4QB 1UC8A 4RMFA 3EBEA 3H09A 5TSSA 1D6EC 2V58A 4WJ4A 4JBKA 4BBSH 2Q2IA 4ZI7F 4ALPA 3FDTA 3Q8DA 3J81c 3HOXH 2CW7A 4DL5A 2NUCA 3R23A 1B4OA 5FLXL 2G9DA 4DV7Q 4JI0H 2G9HD 2W6OA 1SMYD 2K75A 3TREA 1JXLA 4C3JB 1F2LA 2BH8A 3K5NA 2IX1A 2W6PA 5KT2A 2HDLA 2UXCQ 1E0BA 1E4FT 4G7ZC 1XPUA 4LF9H 1LTID 1K83H 3VPCA 4KY5A 2NVTB 4Q0YA 3K5LA 1V4YA 4IQZA 2RGRA 1TY2A 3H0GH 5JUMA 1AP0A 3K3VA 1SYDA 2RCNA 2YU9H 2F3WA 4Z9CB 3OTOQ 4A3LH 1CT1D 1L0XB 1A62A 2ZXOA 3PO2G 1Y14B 1I50B 5C3XA 5IYBG 3K5IA 2R8JA 4NP5A 2D2CC 1HR0Q 4CBVA 4GZYC 3HXLA 4ED6A 1U9RA 2LXJA 2XGQA 4A3IH 3H6MA 1JOOA 4XTCS 2A6EC 3L3OC 2DWCA 3MWDA 5KFTA 5DG8A 4NXNL 4X3TA 4A93B 5EAYA 5C3EB 3CD6A 2ZTDA 5C4XG 1B3AA 1PH2A 1SYFA 5JVG3 4RNOA 2QILA 1VQGA 4BY1B 4HNVA 1IYUA 2UUBH 1V1QA 4O42A 1A3TA 4ZYSA 2F0MA 5L9XA 5KRUA 5ELOA 3FP9A 3BJUA 4X66L 5F2DA 2YS7A 2Q8TA 5IP9H 4DR6L 3GIKA 1VQFA 4IRCA 5EWEA 3ULLA 3R2IA 5JEAG 2JEAI 1RK6A 5JVDF 4RGMA 1I5FA 3HB9A 1LM0A 3PR4A 2DGYA 2R7DA 5D3IB 3J80c 4HMIA 2P0AA 4DL7A 2KCNA 3HFZB 1IBMH 1EY0A 2F0KA 3H4DA 2FJ2A 5FLMG 3HOVG 4RNNA 2FINB 1JICA 2PN1A 2B2TC 3RB4A 3CCEA 1A15A 3CP0A 3DEPA 2NUAB 4KKUA 1V9PA 4F87A 4OX9H 4OL7A 2XSCA 4EGQA 2VUMH 2ZTEA 3K8AA 2DJFC 4K2LA 3KK7A 4J9LA 3IL8A 5KFRA 1SNPA 1VQKA 1UEAB 3PW5A 3BZCA 2CQOA 4BBRH 4NLGA 5M5YH 4AQYL 5HGQA 1T94A 2F0EA 1F2YA 3J7A5 1EEFD 3MZ5A 2R93A 3BAAA 3ORQA 3MC0B 3VR4A 1BGWA 1I94H 5F9NA 4UP8A 1OXVA 4YAJB 1JB7A 1FGBD 1EY9A 1HTLD 3KLSA 4XQQA 4A3BG 2I5MX 3HOYH 4DV2L 3RFCA 4TKOB 1CUKA 5I2YA 5KFQA 1XMOH 3D0FA 4QIWE 1X65A 5EKIA 1IW7D 4JI0Q 1TWGA 3EROA 1HNWH 1CS0A 1G291 4X64Q 1QILA 4JI7H 1KDBA 3NWSA 1TWFA 5IYZF 2EYLA 2CVRA 4OO1I 1C48A 3NEMA 4LF9Q 3A8JE 1XNRH 1Q8KA 1BCPF 3VR6A 1J8IA 2V4QA 3BG3A 4H0LC 2JA8H 1KNAA 1CZGA 2B29A 3S17H 5GAEC 5H80A 5FJ8G 1FJGH 4ED7A 1CKNB 3S16B 4HIMA 3I4NB 2KECA 2A68C 4CJ2C 1YNJC 2ASJA 4C5CA 2YL2A 1B9NA 1KBLA 1LTLA 5HURA 2XTIA 4E6IA 1XNQL 2YRXA 1TWCH 1RIPA 2PQEA 3WOEA 4F50A 2R92B 1EQVA 4JW0A 4KD4A 1U4LA 3TN2A 3T5KA 1KRSA 3KLRA 2K5VA 3ZJYC 4PV1C 4GLXA 1JLLB 4A3KG 2R7KA 2QDLA 4N9TA 1TR5A 2UUBQ 1CZWA 2IY5B 3IRBA 4JK1C 3EPIA 4A3FB 4DKAC 1HPCA 1CKOA 4XIGS 4R4CA 1EIYB 3I4MB 4DV3H 3MXGA 2AHOB 5JQWA 4IUPA 1BBXC 3Q8PB 5J3BA 1OXXK 2V1CC 2K7VA 3SE7A 4HYKA 4GN3B 1IBMQ 2BQ3A 5C0XJ 3GTQH 4DV5L 4JI4H 3HOWG 3N6RA 2FE3A 2IWHA 5KT5A 3L0OA 4ZRZA 4BWGB 1VQIA 3VMMA 3S2HH 3S1RB 4APMA 5CBAE 1EWIA 4QF4A 5C0XH 4LF5L 3VPBA 2VQFH 1HFNA 2RDFA 1Y1WH 1KJIA 1EIHA 2SOBA 4RB3C 1ZETA 2ZM6L 3QZ7A 2CKZB 4PMWA 3BU2A 1SNMA 4A3BB 4JYAL 1DV2A 1RJPA 3RLFA 5D3DA 5BR8H 2C5CA 3TMEA 1I3QA 4A3EG 4ECUA 3CAMA 2I80A 2RDIA 4EGVA 4JPBW 3OHAA 4G4KA 5CAEB 3GTKA 1EY4A 1R4PB 1UE5A 2EZVA 1ICWA 1Q12A 5M9OA 2JYOA 4QGUA 2E2HB 5KFDA 2VQEH 1I94Q 5ELBA 5JPMC 1EUCB 2EYPA 2X0SA 1I4RA 5EDWA 3T1YL 2UU9H 2EY5A 2X6LA 4RFBA 3C0FB 3K5HA 2RSNA 4XDXA 1EU3A 5KFBA 4LFAH 2QA4A 4C3IG 4X62L 2H1EA 2PMZA 1FD7D 4OO1G 1AFPA 1HNWQ 1H95A 5EKKA 4C3JH 4HSVA 2Q2UA 4V0BA 4JI7Q 1WH2A 3UQ8A 2KCTA 3CHBD 3S1QB 4HJ8A 5C44G 3FPPA 1XNRQ 3GD7A 5C5MA 1WR2A 2W6NA 1RL2A 1S3OA 3I7FA 4Y7NB 1B8AA 5ELEA 3V05A 1FJGQ 1C0AA 2NVXA 2SNMA 1PTOD 4I4TF 1LTAD 3GTPA 5KFKA 2OQKA 2WB1E 4B3TL 3RTXA 1E22A 3GDEA 1SNDA 3VYTA 2LY7A 1JORA 2KENA 4HQ6A 3W1BA 1D2BA 1EOVA 5IGBA 1VAJA 5FO7B 1X32A 1BVSA 1JKJB 2FB9A 5IGFA 4L5QA 1EFWA 1BUVT 3G6XA 1AE3A 4U7CA 4IUQA 5LP6F 1STBA 1YVCA 5LL6X 1N48A 3UDIA 1EYCA 4JI2L 1Y8OB 1WCMA 4MV6A 3HRZC 4BY1H 3N8DA 2PQAA 1EHIA 5I6YA 4RZQA 1QWYA 4C56C 3EYYA 2Y0SB 2A69D 4YIJA 1L2ZA 4EQ5A 1V1OA 1EUDB 4ZAIA 3GTMA 3CMEA 1VQMA 3GTGB 3V6KA 3G7LA 1IKMA 3STBC 2SNSA 3N40P 2FPGB 4ULLA 5KFWA 1JCKB 3ITPA 1N33L 2DIKA 3KDFB 4PWQA 5G3LF 5KFYA 2XC9A 4LUZA 2FLLA 3BDLA 1TS3A 3M85A 4JI4Q 4GKJL 3AFPA 1X56A 4IHJF 1L2FA 2J4XA 5M5XH 3I91A 5HY6A 2E5LQ 3RZOB 2HVQA 4HJ7A 5M5WH 3GTJA 3NBHB 4A3EB 3OW2A 1B9MA 2R7NA 3CQZA 4JI1Q 1K8AC 1V1PA 2W9CA 2BR0A 2QDBA 2N78A 3OHXC 3WOFA 4A3MB 2ZJTA 3LWEA 1OO9B 2E2JB 4RZRA 1Z6HA 1DZ1A 3RUZA 1STNA 5BR8Q 1VQ7A 1PZKD 1FGUA 4BS9A 4FVMA 3S9WA 2W57A 4JOIC 4EQPA 3FMAA 1SJHD 4DL6A 2VQEQ 1D7QA 2I5LX 1WOCA 4PMCA 2DNEA 1O7ZA 1CM9A 2UU9Q 2V4RA 4R8IA 4LFAQ 4BA2I 2F0PA 2RDJA 3MXNB 4Q43A 1QVGA 4GC7A 3PW7A 1RJQA 3MR3A 3A7AB 3N52A 2NVYH 1PFNA 5BPHA 5DQHA 3KOJA 3PO2H 3KALA 4GNXC 5IYBH 3RR5A 1R9TB 1JWSD 4FXDA 2A6HC 3C3LA 1E2VA 1IBKH 1AE2A 4JV5H 4DV1L 1SE2A 2OLSA 1S5CD 1VMCA 4IN3A 4JBJA 1EYZA 4B3RL 3U9TA 4H13C 1GUSA 3G4SA 5C4XH 1S10A 1X3PA 5KNCA 3E9HA 4DR1L 5JEAJ 4KV6A 4FU0A 2MNAA 3TIGA 2AQ2B 1TVXA 2RHQB 1TWHA 3TS0A 1ASYA 4XYLB 3M9MB 2FPPB 2I8CA 4CDFC 2JA7G 2NVQB 4A3GG 3MWMA 1Z7TA 1EY5A 5JEAH 4K5WA 4LFBQ 4L6TB 1T36A 2LSSA 5D65A 4F4YA 1WTHA 4HIDA 1G2SA 2F4VH 2BDOA 4J1MA 3GTOB 4UY8C 1GSHA 1EEID 2LMCB 1YJ9A 1G6ZA 2YTXA 2M00A 1VMPA 4U68A 4H44C 2OQ0A 3KHLA 5IY0A 5FLMH 3HOVH 4FNFA 4QW8A 2VXWA 4CJ0B 4XT1B 3FKIB 4AYBG 3CPWA 3UFXB 1T3NA 2EIFA 4JOIA 2XRSD 4DUZL 1Q46A 3K59A 2R7ZB 3J7ZC 3FRPB 2EQSA 3HBLA 3SK5A 1QE6A 2ZDQA 2A68D 1YNJD 3RGZA 2K6AA 5EWGA 4EGJA 5D1OA 3M3YB 3GIQA 4IR9A 4DV4H 1F9SA 3KHHA 4EEYA 1PH6A 4FBTA 1K3RA 1W6JA 5KT4A 3P20A 3S1RH 4GNXA 2G5DA 1NJIC 2K5HA 2O5IC 4B3MH 2A8VA 4MV9A 4A3BH 5M3FG 4M7EA 2AWOA 3OOCA 4EEQA 5EPJA 5DLFA 2LXKA 1G51A 4YHHL 2XN9C 1LUZA 2GA4B 4LF7L 4ZHQF 3K0XA 1WTVA 1I4HA 3J81L 3NUCA 4B3SH 1S0NA 4NPSA 4LF4L 2VY3A 3PW0A 2IX3A 2JA5A 5LOVF 4IUUA 1BXTA 2F0WA 2F3IA 1EU4A 1DOLA 3BABA 1HA5A 3PR5B 3GTLB 1Z2PX 1PDQA 1D8LA 1YNNC 2JA6A 5FJ8H 2UUCL 2UUAH 1ML0D 4IZ8A 5DEHA 1IZ6A 5KYLA 4Q45A 3J7AK 3I90A 2KHJA 3PO3B 3RB3A 2GVBA 3MFGA 2L5TA 4EVOA 4GS3A 1NR4A 5DNFA 3TZDA 1RD9D 3R8BA 3NHHA 2KUMA 2FJZA 3WO0A 4JI8L 3RLOA 4DAYB 5ISRA 4JV5Q 1DJRD 2E2IB 2E74C 3I70A 4R7RA 4UCRA 4CDDC 3RB6A 3K5OA 2JA7B 1S5DD 4A3GB 2O2LD 1F2ZA 2K05A 1GXDC 1HUMA 1EUJA 1D5MC 2IPKD 4A3KH 2L0CA 4K0KH 1LT6D 2QF7A 5E1FA 4YY3L 1G91A 2EY6A 1SDFA 2K01A 3PZPA 1L1OB 1E7ZA 5IP7G 1BCPC 4DL3A 2FLPA 2QEJC 1ZQ7A 1JWMD 4B9XA 2YW2A 1S0MA 3P75A 3KJOA 2O5JC 3CCJA 1KIXA 3AEVA 1GGOA 2R82A 2F4VQ 2WKDA 1XDNA 2F0HA 4DV7H 4XZ3B 3MFIA 3T5LA 3RBEA 5IT9c 1JQYD 1SE3A 1F9QA 1IXRA 1B50A 1VQ6A 2N3SA 1II3A 3J80L 3GTGH 3HOWH 4P2CB 2H5XA 5EZYF 4P73A 3MFYA 4HR7B 1K83A 4KKTA 3DM3A 4IPDA 1YIJA 3H0GA 4KHVA 4FXKC 3OSOA 1CA5A 4MTDA 3CCQA 2E2DC 3R3OA 4YB8B 4O1NA 1N56A 1KXLA 3OTOH 3LP8A 3T1HH 3R5FA 3KXYT 1A2TA 2OCEA 2VA2A 1E4GT 4DV4Q 5K2MA 1Y8PB 2R93G 4LWCA 2K04A 5M3FB 3QJYA 4CGYB 3X3MA 4A3EH 1HR0L 3GV5B 2F0JA 2K5WA 5C4HA 5DG7A 5HV6A 4ED8A 4UCVA 3C2PA 4JCVE 3SK6A 1W93A 4DV6L 2BE5D 5IGCA 4C5BA 4LF6H 3A5UA 4B3MQ 3CMAA 3K3PA 2HDMA 1HXYD 2F3VA 3A74A 2W8KA 1JR0D 4C3IH 2J7ZA 3OMCA 1CA6A 1ILPA 1ULZA 3RNUA 4OO1H 4JV1A 2JSOA 4ABNA 4L63B 5EWFA 2Q2HA 5IWAH 1GHKA 4X65H 4EBDA 4ZQIA 2AGQA 2UXBL 1KJJA 4A93G 5C3EG 1A3UA 5C44H 2ZJPA 5M3MB 4JBWA 3RF2A 1VQNA 4GKKL 3SVMA 3TP7A 2I87A 3QOJA 2NU8B 4DAMA 1CKMA 3CC4A 2QYZA 1TAEA 4UCUA 2J6UA 3OPOA 2WKCA 3X3NA 5AFWA 4JV2A 1ILQA 3S24A 2UUAQ 4KJNA 2WAQG 1QCBD 5IGGA 2XGTA 3Q6SA 4IR1A 1PTOB 2XCAA 2FMCA 2YS6A 3GV8B 3O13A 2P5ZX 1TU2B 5CV6A 4NDXA 3L9AX 5C4JH 1STAA 1YHAA 4XT3B 4DK3C 3CCMA 1H9KA 2W6QA 4PQXA 4P75A 1KEEA 1RF2D 3T4AC 1JWUD 5ELNA 2YTYA 4Y8VB 2KOLA 1PX2A 1Y1VA 5LXTF 3GQCA 3RV4A 2K50A 1KJQA 3TP5A 1EQTA 2AWNA 2VNUD 4K0KQ 3MFHA 4GN5A 1UE6A 3M9NB 2WACA 1YHBA 4DR5L 1KTKA 2BA1A 2NVQH 4DPGA 3KLSX 5FK9C 2IHEA 2ATWA 2ENBA 3BVMA 3ND8A 2BA0A 3S15B 4DV0Q 4JI5H 1D5XC 2EJGC 5JAVA 2KHIA 2VW9A 1I4GA 2RVLA 1EZ6A 4JI0L 1BKBA 2PZUA 2DNCA 2UXDQ 4X64H 4PG3A 4HIOA 1BQQT 1SSOA 5A2QE 2QEXA 5KFFA 1I6HB 3L4JA 4DR4H 2A6HD 2RGVA 4LF9L 1IYVA 2R93B 2WIIB 1SNCA 4LH7A 3JAMW 1S5ED 1AN8A 1HNXQ 5KT3A 1UNSA 5KFMA 1RHPA 2HJWA 2AQ1B 4YCVA 3CW2C 3T1HQ 1K0RA 2YV5A 3HOZB 2MPMA 4XYQA 1TWGB 4KY6A 1ET9A 3GIPA 1GYFA 4DK1A 1SYGA 3N6XA 1PRTC 1TWFB 2HIVA 2ID0A 1TWCA 1K73C 1B6RA 1QB5D 1PA6A 4LF6Q 2VB2X 4HNTA 2D0OA 3I4NG 2ES2A 1MHWC 4EYHB 2ZJQA 1LTBD 2XWJB 4LSXA 5DGBA 5EBDA 4QWEA 3D4DA 2N49A 2YZGA 1CQFA 1SN8A 1N32H 1XMQH 1WJJA 3OIPA 4GOPA 1BDOA 4UCOA 3MXUA 2IBKA 5DG9A 2ALZA 2R92G 4O3NA 5IWAQ 1KNEA 4X65Q 5L1IA 2WAQB 3S14B 4MHEA 3PIPA 2WP8J 2K5QA 5CA0F 3I73A 3BYYB 3CRLC 3T16A 2B2WC 1VQHA 2K1BA 4B9WA 2NTSA 3ULPA 3GTLH 4NXNH 1PH7A 4M8AA 1D1IA 3BDOA 3T53B 1SCUB 1RODA 2PI2E 3GP7A 4A3FG 1PH1A 5L1LA 5LMUH 3GTQA 1SYBA 1M8AA 4QMGA 3I4MG 3UE1A 4CC5A 1V8QA 4OIJA 1YZ6A 2XVSA 4K5VA 4X66H 4NXML 1T5EA 3Q8SB 4IUTA 1E24A 4OX9L 1OXTA 1KAAA 2E2IH 4X6AH 2AQ4A 4L5TA 2JA7H 4O3SA 2RQXA 1K8GA 3U50C 1BXRA 4A3GH 4F4XA 3L2PA 5LMNW 3A0JA 3DLLA 1F9RA 4FF1A 2B2YC 3PF4A 1VBGA 1EY7A 4FS1A 3K0YA 2EJMA 4HN7A 1S03G 1F77A 1OWTA 2C2RA 2L9HA 3SHLA 4J15A 5FKAC 1I94L 1B53A 4IFDI 3ERQA 4JI5Q 1KDAA 4R1JA 4EBEA 2LFNA 2AMCB 4ZLTF 5GADC 1K0SA 1VF7A 2R85A 1LTRD 5E4XA 2Z9HA 1RYRA 1XMOL 2EY2A 3CXCA 3H20A 3H3VI 1D1KA 1HNWL 2OT2A 1FKAH 3LWUA 4KN7C 3E0EA 2C00A 2R3ZA 4DR4Q 2OEOA 4IZOA 1SFOH 4C1NI 1SEIA 4RAUC 2HVRA 2MO0A 4EQNA 3GTKB 2R8IA 2QKIC 2K32A 4OEMB 5I4DA 2AGPA 4J9OA 1IL2A 2CW8A 2R8KA 2PVPA 2B2WA 4RWSC 3K57A 3RN2A 1VQ4A 1S72A 5BN5A 4UFZA 2PMZB 3DWPA 4QW9A 5M3FH 4KMUC 4R4QA 4DR2L 3VR5A 2BCOA 3M4OB 5GROA 3BZKA 4FP5D 1YJNA 4RB1A 1X6OA 1FVIA 5NUCA 1S9FA 2B2TA 2JEBI 1GUTA 1LT4D 3K6OA 1GHJA 5CV9A 2CHBD 2NVXB 4ECZA 3RLNA 1FNWA 1DGSA 1XMQQ 1N32Q 3GTPB 1GSOA 4UAIA 2BQUA 1MJCA 5GAGC 3RAQA 5FD6A 4C1NK 4HCSA 1QVFA 1D5ZC 2CFMA 3AU7A 1LV9A 1UE1A 4H7BA 1XNQH 4XX0B 3MEHA 4ME5A 2D5DA 4DV3L 4ECWA 2QGQA 4LFCL 1UNNC 1ZEQX 3GLKA 3GV3A 2W7PA 4JV0A 4NXNQ 5KFGA 1HQRD 5CORA 2UVUA 3ETHA 3EVQA 3M9OB 2Y0SG 5LMUQ 1WCMB 5KFCA 3QO2A 2NU9B 1AW7A 3E0JA 4EBCA 3KBGA 1B6SA 1S4ZA 2PQAB 2R6GA 2V4DA 1N34L 1RTNA 4A2AA 2E5LH 4X66Q 2HQLA 5FLXW 4BWSC 1JE4A 4APVA 4DR6Q 2HCIA 5IP7H 3GTMB 4JI1H 1U0LA 5KFPA 3I2ZA 4EYIB 4ZUIA 4RGOS 4CHTB 2VQFL 1LTTD 1MZBA 1WYDA 2WINB 2NU6B 2W9BB 2CH4W 3L4KA 2KQ3A 3ORRA 2F0GA 1PH4A 1BO0A 1DXMA 2YYZA 4DV5H 5BR8L 3S1NH 5KG5A 5EPKA 2XD4A 1K28A 4IFDG 1FR3A 2DN8A 1JDBB 2Z1CA 1E1TA 3PUZA 2EXZA 4RGTA 1H9SA 3PIOA 4G7HC 4KKSA 5IYCG 1X3FA 3GTJB 1SMXA 4A3MG 3S15H 2WDTA 1SJED 3CQZB 1TWAA 1DOMA 4K5XA 3KFUA 2W9CB 3HKZA 2V9WA 2JXMB 3PSIA 3V6JA 1SYEA 2NVYA 3ONAB 5FLXE 4TQRA 2TSSA 2DLNA 4A3JG 5DLQE 1K8OA 2R7LA 3NPPA 3SEBA 1CE8A 4DUYL 1WTXA 2R93H 4BXXG 2NVTH 3M4PA 2VPSA 3LWBA 1YJWA 1EOTA 1Q3LA 4ETSA 3K5MA 3T1YH 4J9PA 1ENAA 2SEBD 4DV2Q 3A55A 4HEDA 2F0LA 1IOWA 1I50H 1PTOF 5I9OA 4A3DB 2B63A 1SE4A 2CW0C 1PH8A 3EPGA 1JC7A 4HSPA 3SK8A 4POFA 3EFXD 4A76A 1STEA 1K9MC 1YITA 4A93H 5C3EH 2O4XA 5JH7F 4LFBH 2DY8A 1K1SA 3Q0AA 4QWBA 3OMGA 1SR3A 1VQJA 1NUCA 3AMUA 1HZCA 4B3TH 1IBLL 2L11A 3TS2A 1NSNS 2GVAA 4DR3L 1STGA 3MWEA 3TQYA 3M7NA 3HZXA 3S14H 2WFWA 1I6UA 3GIIA 1CSQA 4R8UA 1XNQQ 3G8CA 1TWHB 3NP8A 3P7JA 3K7AB 4UP7A 1L0YB 3KAJA 4YQWA 1F9PA 4JI2H 2I0QA 3R5HA 1GUOA 3J7AF 3I55A 4ECXA 4N8FA 1KDCA 4A3CG 3HG9A 3ETJA 4GLVB 1PMRA 4KJOA 4XQNA 2F03A 3FKIG 5ELFA 4DNTB 3H4BA 1PRTD 1DOKA 4Q5VA 1X9NA 1C4QA 5HGTA 4BY7G 4HJ5A 2R7ZG 2J6SA 4KLKA 2J0TD 2MFIA 2A6ED 5DM63 5JJZA 3D4RA 3Q8QB 1NMFA 5J1ZA 3NTIA 4RUAA 4AYBE 1QNKA 2NZ1D 1W2BA 2YYAA 4KN4C 3T56B 3BVZA 2KA7A 3OYYA 4RCOA 4DV5Q 1B3QA 4FYDA 4J9KA 1Q1EA 1VQPA 5I2XA 1SLJA 4ODGA 5KG4A 5L1JA 2I46A 1X55A 1B44D 2A5HA 5COYA 5D1OB 1GUWA 1X3EA 1UE7A 3GO5A 3A5ZB 1Q86C 2NYZD 2VR1A 4A3JB 3LNNA 1OTCA 4MV1A 4J8QA 5IT9L 4GNXB 4DR7L 2IA6A 4E4TA 2ZM6Q 1B04A 1DD2A 1BJTA 3VDYA 3HOUG 4CDCC 4G7OC 5IE8A 1BBWA 2JK8A 2NZHA 1JE5A 3HKSA 4ZK9B 4UHVA 4FF2A 3AQQA 1EWCA 4EG0A 2J9GA 1EL0A 2D62A 5EJWA 4LSAA 2HT1A 3QB3A 1WD1A 3WDNA 3T1YQ 1IBKL 3PIP3 4DL2A 4KTAA 4Y52H 1S0OA 1OXUA 3S16H 4JV5L 2JA5B 2L55A 3VR3A 2SCUB 3OSPA 3UDGA 3I4NH 2OH2A 2RSOA 2FK3A 2OTLA 3PO3G 4C2MA 2JA6B 5KNDA 3SI8A 5KX5F 1AUVA 3CF5A 3M4OH 1SMYC 1VQAA 2R92H 3RAXA 3D8GA 2R87A 2AUKA 2J6TA 1M6VA 3MA2B 5CV4A 5JVH3 4ECYA 1YI2A 3GTPH 4B3TQ 3IN5A 3D31A 1A6XA 3F1ZA 1M4VA 5C5JA 4NMZA 4A3FH 3W2DA 3G71A 1ZXTA 4LMQD 1J6QA 3BYTB 4HTHA 3GTGA 3L7ZC 3I4MH 4IOAA 4FM9A 1UEBA 4ME3A 4BY7B 1G2TA 1GKHA 3KDFA 4JI2Q 3K58A 4LMYA 1AEXA 4QIWA 1KLUD 1Y1VG 5IYDG 1EFID 3MTSA 4OONA 1IHZA 3HOXB 3QZ8A 1HUNA 2RHSB 2IHFA 4JI3L 5A2QL 3TIIA 3PUYA 4JUZA 1TY0A 3NBHA 3SXHA 3V96A 3GIDA 5LA6F 4OXPA 4Q8FA 3KJPA 3GTMH 4RUCA 4KK7A 4DAVA 1KRTA 4DUZH 3QWNA 2K14A 2RDGA 5I9PA 5KT7A 1A3VA 4QY7A 2ZXPA 1N33Q 2XIWA 2VQDA 1FNVA 4ZQ3A 3BVGA 1I6VC 4JC0A 1LT5D 4YCWA 3E5NA 5EOYA 4QWCA 5L1KA 4GKJQ 1TQOA 2NB0A 3DM1A 1VQBA 1ONLA 5JJKA 1C7YA 1S68A 2M9VA 4X3KA 3HOUB 2E2HH 4B3SL 1MGSA 4YBZB 5I6WA 4RAYA 3NENA 2E8GA 3FDSA 3VPDA 2K28A 2GLTA 3CQZH 4DNRB 2PO4A 3PUVA 3E3XA 2Z4IA 3H94A 1X3GA 1J5EH 2L15A 4MAMA 4ZKBB 2N88A 4O0AA 1MIUA 4GN4B 1O80A 2E75C 3JAMi 2DUDA 3J81i 4J0MA 1MBYA 4CJ1B 4DL4A 3M7GA 2NZOA 3GILA 3S1QH 5KG3A 2XCPA 4RNMA 5M3MG 4TQSA 4PMBA 1N36L 5C8YF 2X69A 1M90C 4Y7NH 3S2DB 3KAKA 4MV3A 1ASZA 1BBUA 4HMJA 1A0IA 4R4OA 3UE0A 1QJOA 5J39A 3RIZA 4IWXA 2BOSA 1JX4A 5KFXA 3KF6A 3Q8RB 2AU0A 3OSNA 5F9LA 5T14A 3D4WA 1RTOA 4XYMB 1O7IA 2I5HA 4NB3A 4LF8H 2XWBB 5KFNA 3J7AV 4ECRA 4RHSA 2NTTA 1CQIB 2HQEA 3VYRA 2WAQE 4KD3A 3IG0A 4IALA 4DK6C 2ZDGA 1ENFA 2EY1A 4JI8H 4DV1Q 2L4NA 4M9UA 4DV0H 1IL8A 1O75A 4A75A 1KHIA 4J6HA 1DV1A 4K2KA 1W3SA 4DV7L 4HJAA 1SYXB 2HHHH 1VS0A 1MI2A 1Y1VB 4TSSA 2UXDH 3CCLA 4C5AA 4BBRB 3VYSA 4DR1Q 2GPWA 4LNQA 2EXDA 4YY3H 2K4KA 2UXCL 3C46A 5AJ3Q 2F0SA 5KNBA 1XYIA 5KFEA 1E2WA 2F0TA 1O7LA 1Q1BA 2IX0A 5KFJA 1ZYRC 2YU9A 4LUVA 1HNXH 4KHPH 2FMAA 3C1FA 4IFDJ 3LX0A 3OTOL 3HOYB 1L1OC 4FO2A 3J80i 5IOCA 2JP1A 3FVQA 3NWTA 1PHJA 2WYOA 3RZOH 3BQ1A 3PVXA 1E2ZA 2PNHA 2EYHA 4ZCKA 1ICFB 1AZPA 1K1QA 3QOLA 1NE3A 4IFDH 1MSGA 1PXUA 4YJ3F 5FOBB 4FF3A 1UWVA 2KVMA 5LMNH 5KGUA 4DUZQ 2XCLA 1BR9A 1M1KC 5IYCH 1B33N 2WB1A 3I3CA 5JOBA 2JA8B 4A3MH 3SDZA 1SE8A 5IGEA 3HOZG 2JEGA 4FBUA 2E2JH 3CKIB 3JC66 1HNZH 3H3VH 2V59A 2FLNA 3W1GA 5J2TF 1CFMA 4J9MA 3CCSA 5IWAL 4XYOA 4A3JH 1M0WA 5CC4A 3STBD 3J7YW 2K03A 2VZAA 4IUVA 4RGNA 1TWCB 4BXXH 1HQMC 1FNUA 4DV6H 3PGZA 2R84A 1Q7YC 1N8RC 1J5EQ 2E76C 1M7JA 1VQEA 1I4PA 4EQOA 3NTHA 5CGKA 1HZAA 3RZDB 5IIFA 1VDZA 2EJFC 2PMZE 4YHHQ 4LF7Q 4IJHA 4GOPB 3Q23A 1QVCA 1R9TH 3KF8A 1I4XA 3UDXA 4LF4Q 3QFFA 4DAPA 1EYGA 2UXBH 3P1HA 5EPLA 1E4EA 3KUPA 4DF7A 2F1MA 1NNXA 2ICEC 4EX5A 4JI6H 2VUMA 4QUFA 4GKKH 3E5SA 3MAQA 2BDNA 3Q24A 2K5NA 4WJWA 1XWEA 1C3OA 2WE6A 1BOSA 1DM0B 4RKLA 4LF8Q 3NBIA 2JQOA 1O78A 3K7UC 3GTQB 2PZTA 4WRDA 2YZNA 3JSNA 2C2EA 2LKVA 3VA7A 1ZHQA 3ZYYX 2A74C 1KABA 2IT1A 2NU7B 5BMVF 2GPSA 1WSCA 4Q44A 2L1BA 4AYBA 4JI8Q 1CI3M 5EGTA 3F8TA 1B70B 3B6YA 3DHQA 2X6GA 4TQUS 4WORA 1H9RA 3N42B 3GTOH 1VQCA 5JJIA 1UC9A 5FPOA 3Q1KA 3HEJA 2ASBA 1RJTA 1C30A 2HHHQ 1HRJA 3MR2A 4GC6A 4I7AA 1AN7A 4A3CH 4R8NA 2DZDA 4X64L 3DXJC 4YY3Q 4MV4A 2MJ8A 4O4IF 1SFOA 4PZ6A 1I7NA 2MGSA 3FKIH 4HR7A 3OUUA 4TV8F 4DR5H 2R86A 4IPCA 1Q81C 2R6FA 2EVBA 4BY7H 3E9IA 2R7ZH 4ZOLF 3GV6A 1GD7A 1Q90A 2DPJA 5FD5A 1RCVD 3TEHB 3U9OA 3J81W 1E3PA 2EYJA 2F0IA 3HP3A 3JAMc 4KHPQ 1PRTB 5J2UF 5KT6A 3GIMA 1CHQD 4ECVA 1SYCA 3U9SA 2EOTA 3S1MB 3M4YA 2MUYA 3M3YH 5KFOA 3KTMA 3I72A 5GQOA 2VB3X 3QG1A 1G6PA 3ERSX 3AYHB 3A7LA 4QUCA 2RCFA 1LLRD 2A69C 1PH5A 3D6CA 1W96A 2QK4A 4ED3A 1E1OA 5LMNQ 5EBCA 4MA5A 1JDEA 3TQTA 4IUNA 1H9MA 3BZDB 3HKZG 4ECSA 2ZT9C 1B7YB 3F2BA 1KJ9A 1HNZQ 2NBFA 4LK1C 4UDUC 2JE6I 3JZIA 1AUXA 1N32L 1XMQL 2FKLA 4WFN3 3M9BA 2UUBL 4O3OA 4O3RA 1S5BD 3HOUH 1QUQA 4YR2A 3H40A 4ED0A 2QCPX 2C35B 1F2MA 1LTSD 1STYA 3EIVA 1Z47A 1FYCA 3JAME 2VUGA 1MKHA 1MSHA 2Z4HA 3J81E 4DV6Q 3TQ1A 4QL5A 4BA1I 1MJEA 4OWXB 1LT3D 1RK5A 1U4MA 3PCOB 5EKLA 1B2TA 3DMUA 2AUJD 4DXGA 1YNXA 1HJPA 3NTKA 5LMUL 1VCIA 1Q8IA 4IURA 4IOCA 1IBML 2B63G 3PO3H 4FF4A 2PCFB 4U673 2HUGA 2M05A 1SNQA 4L5SA 4TV9F 3F2DA 3I4LA 4K8JA 5KIXA 1TIID 1UUPA 3S2DH 2R61A 2UXBQ 5T1IA 5CA1F 2ATLA 4DR6H 2A19A 3EN2A 4CKEA 3CC2A 4DGZA 4JI6Q 4YCUA 1VBHA 3F2UA 1STHA 4GKKQ 2RDHA 1WCMG 3RUPA 4C3HG 4L1KA 1Y1WA 1TKWB 3J80W 1ESRA 3FEWX 5A35A 2YCHA 1VQDA 3J81j 2LS01 4N9PA 2FPIB 4UP9A 2MQHA 2B8FA 3C1EA 3NK9A 5LL6b 3TZUA 3OW7A 5KG2A 1WTWA 2Y0SE 1A8VA 5M5XB 5K36G 4O2BF 4NXMH 1P16A 2NN6I 3TRZA 3PW4A 2L12A 5M5WB 5DQIA 3I4OA 5K5PA 4U6PA 2DPIA 1EYAA 4ED2A 2SDFA 4RH6A 4F4ZA 3T13A 1YNND 5C3WA 1WD0A 3U4VA 1JJCB 1HR0W 4MTEA 4P71A 4YR0A 1PLFA 2YZMA 4PZ8A 1Y1VH 1SXTA 5IYDH 1WTQA 2MCTA 4AQYH 1SRUA 4P74A 4JI7L 2B8GA 1I3QB 4KI0A 4DR5Q 1IKLA 1XNRL 1PYBA 3EJIA 1PVOA 3J80E 2R7MA 1H9SB 4GLAC 3U58A 2JJQA 5D8DA 1FJGL 1HCZA 1OXSC 4DV2H 1TWAB 3G48A 3HKZB 1I50A 1RJRA 2F4IA 1KJ8A 3BA9A 3MR6A 2JEJA 1P8LA 1J9OA 1IOVA 2NVYB 2WV6D 1GO3E 4QQBX 2VL6A 1BCPD 2B2VC 3PO2B 2IJ0A 2R8GA 4FDBA 3BDCA 3RD4A 1ZHSA 1WTOA 2W70A 1NY4A 4ID6A 1PFBA 2KCCA 3MHBA 2XNAC 4A3DG 5DGAA 1K8MA 2CQAA 3TP8A 1KD1C 1EY6A 5C4XB 1VKZA 2WAQA 4DR2H 2B63B 2W7OA 2B2YA 5M3MH 2FK1A 5BN4A 1ZYRD 2M2LA 3QIAA 5CR3A 4PNYA 2W8LA 2EE1A 2HIXA 3I56A 4TUYF 4TRDA 3RZDH 2IP4A 1WI5A 3G6VA 1NTGA 4C3HB 1H9JA 2C22A 1U5KA 4JI4L 2HD3A 5E4WC 4LW1A 1PTOH 3CCUA 2FXQA 2OXPA 3MEFA 2E5LL 5FLXc 1EZ8A 3HOVB 4R8UB 4JI1L 2FFKB 1T9HA 4LFCH 3WWVA 4H02A 4M1UB 1JOQA 1Z2NX 1PZID 1XTDA 4IWYA 4R4IA 1X3QA 1VQ9A 2EDGA 1C9OA 3VYUA 3PUXA 1DCZA 1EYDA 1I4QA 1HZBA 3NQTA 2PYKA 5T1GA 2NN6G 1S97A 4HAEA 3V2TA 1JOKA 4IAJA 1N34H 3RB0A 3UI2A 3MWYW 2HCCA 3QR8A 4NXMQ 2VQEL 4RB2C 2TMPA 2UU9L 4OX9Q 2B2VA 2F0QA 1LO5D 4LF5H 4DU9A 1V1PB 4RAZA 4R4TA 4LFAL 3RJ0A 4HCEA 4QCLA 5KFLA 3IAYA 2F0OA 1HFGA 3SR1A 1Q82C 2ZM6H 2B2UC 2OWOA 2C28A 4JYAH 2R8HA 4HIKA 4AQYQ 3A8IE 3FMCA 1PZJD 1I6HH 1VF5C 2IW3A 1SNOA 1Y69U 1XXGA 3JSLA 2XRQD 2RBMA 3F8NA 1W6KA 1GUGA 5KG1A 3BQ0A 1A63A 1CKNA 4MTNA 3R93A 3CC7A 1V51A 4X62H 3S1MH 3HOZH 1XMOQ 4Q0FA 1TWGH 3PUWA 1A2UA 1CSPA 3CU7A 2Q8RE 3VA5A 5KG7A 1TWFH 2AGOA 2IL8A 4DUYH 2R92A 4DFAA 3ER0A 2JA5G 1NCVA 1SBBB 1G8ZD 2I07B 4OIKA 4L5RC 4RG1A 1JJ2A 2JA6G 4X3UA 5CV5A 4I55F 5KG6A 4LFBL 5I47A 2EYMA 1TT2A 4N8X1 2BH2A 4LH6A 4OWTB 5LYJF 4PDBA 3TP6A 4C2MB 5KFZA 4DR2Q 1KQSA 2OTJA 4A3KB 1LABA 4KHZA 3U4ZA 3T51B 2EPBA 4I65A 3NELA 3DWQA 3AB9A 1GJXA 4I7HA 4RHRA 4O4HF 2H4OA 2ZJRA 4YJ2F 2BE5C 1XX8A 4DN4M 4B08A 2KHSA 1IBLH 1TS2A 4DR3H 1UAPA 3V4ZA 1DIKA 1GVPA 2ZDHA 2B2UA 1NAPA 5GONF 5BPFA 1EIGA 1GOZA 1U4RA 1DONA 3T5JA 3BQ2A 3HOWB 1PRTF 2ALYB 4DV3Q 4BBSG 4IRKA 3SK4A 4LFCQ 3PMFA 2K52A 3IFTA 3V6HA 5G3LD 3HOXG 2W9BA 5CBEE 3I8ZA 1N33H 1PFSA 3OHBA 1VQ8A 1PFMA 5KFIA 3KBXA 2XIGA 4QIWB 5FO9B 4CKBA 1B1ZA 4DNIA 1GUNA 4GKJH 4X3SA 4K6LA 3RBDA 3TSSA 5LL6S 2Q8IB 5CV7A 2QW7A 1N34Q 4DLKA 2E2HA 3GV7B 3BS1A 3V4SA 2A1AA 2RA4A 3H0GG 1GSAA 3T5HA 4LF5Q 4RA8A 1NBWA 4L8JA 4A3LG 2VQFQ 4JYAQ 4JBMA 2AKWB 3TINA 4C3IB 1EWHA 3HS0C 1I3QH 4MZ9A 3NGDA 4DK0A 4OHJA 1VQ5A 4WJ3M 1NMGA 3OWEB 4MV7A 3GTKH 4A3IG 2ICIA 3DF7A 3FHWA 3N44B 5C1OA 4KY7A 5JPNC 3F2CA 5CB4F 2JN4A 2F0DA 2WB1G 4UPAA 4LJZC 5DAUA 2PZWA 5C44B 3H3VC 5CV8A 2PI2A 4MN3A 1Y8NB 4OELB 2Z6KC 1TWAH 3DEOA 4X62Q 4DR7H 5CMDA 5IODA 4MTKA 4I50F 4DXFA 5LHY1 1KL9A 1HZ9A 1XJVA 3IKJA 4P72A 3RGXA 2FK2A 4CKCA 2Z6BA 2PBZA 1N9WA 3PV0A 3JRXA 1XPRA 5IP9G 2HGSA 4DUYQ 3K81C 2W9AA 5DQGA 1JB3A 3TDQA 4AIMA 3LGJA 3NSWA 3ICEA 5C4JB 1MD2D 4EFEA 5E3FA 2CZGA 4DV1H 3MXPA 2NVXH 4F4WA 5HBRB 2GN5A 3N43B 4B3RH 2F4VL 3KF6B 2F0UA 3D3RA 3MJFA 2UVRA 2Y0SA 2VPQA 2C9OA 1LACA 2B63H 4DR1H 3NXWA 4S3SA 5KKNB 3MVVA 2W6MA 2XGPA 4IJLA 3W5OA 4POGA 5AJ3L 3VR2A 5L37A 4I7ZC 1QZHA 2VUMG 1ESFA 1C8CA 2C2DA 4F88A 1YEZA 1RYSA 5C0XI 4BBSB 4YAKB 5C5LA 1WTPA 2CCZA 2Q2TA 1IYJB 1WCMH 1SEBD 4BBRG 4C3HH 2ZTCA 3EA6A 4AH6A 2RKSA 3RV3A 1IBLQ 1PV4A 4ECTA 1ET6A 2ASLA 4R9WA 4DR3Q 4O3QA 2KBNA 1PH9A 4DV4L 2F0NA
chains in the Genus database with same CATH topology
1HZAA 4J15A 2OQKA 2WB1E 4B3TL 2R7FA 1I94L 1E22A 3GDEA 4IFDI 3HOYG 2PMZE 4YHHQ 4LF7Q 2KENA 4R1JA 4IJHA 4JI5Q 3W1BA 2AMCB 5GADC 4GOPB 1EOVA 1QVCA 1R9TH 4B3ML 1BVSA 3UDXA 4LF4Q 3KLWA 1EYGA 4L5QA 1EFWA 1XMOL 1AE3A 2Z6KA 3CXCA 3H3VI 4EX5A 1YVCA 3KYHC 1HNWL 1Z9FA 3UDIA 3E0EA 1JT8A 4JI2L 4DR4Q 1SFOH 2K5NA 3GTJH 4IO9A 4BY1H 2JA8G 2MO0A 2PQAA 2JA9A 4LF8Q 2JQOA 2MO1A 3K7UC 1IL2A 1J5EL 4EQ5A 3RN2A 1VQ4A 2IT1A 3CMEA 5H1SE 1VQMA 1S72A 2UUAL 3STBC 5M3FH 4JI8Q 1JMCA 4R4QA 4DR2L 3F8TA 1B70B 3B6YA 4TQUS 1N33L 1PH3A 3KDFB 3GTOH 1VQCA 4LUZA 3BZKA 5GROA 5JJIA 1YJNA 2ASBA 1LYLA 2HHHQ 1X6OA 3M85A 1FVIA 4JI4Q 4A3CH 4GKJL 3H15A 3AFPA 1X56A 2JEBI 3K80C 1L2FA 4X64L 4YY3Q 5M5XH 4DR7Q 4PZ6A 5HY6A 2E5LQ 3FKIH 4HJ7A 5M5WH 3NBHB 3RLNA 1JJGA 3OW2A 1DGSA 1XMQQ 4IPCA 1Q81C 4A3DH 1N32Q 4JI1Q 1K8AC 3E9IA 4LF8L 2R7ZH 4BY7H 1GD7A 1MJCA 5GAGC 4K0KL 3AFQA 2N78A 3TEHB 1QVFA 1E3PA 2CFMA 3JAMc 4KHPQ 4YWMA 1EQRA 1UE1A 4YWKA 1SROA 3KF8B 3SGIA 4JG2A 4DV3L 2QGQA 4LFCL 3M3YH 5BR8Q 1IBKQ 5GQOA 1AH9A 1G6PA 3PF5A 4NXNQ 1VQ7A 1WFQA 1FGUA 3AYHB 3ERSX 4DV0L 1GM5A 4JOIC 4B3RQ 1PH5A 2VQEQ 2KCMA 2Y0SG 1E1OA 3CCVA 2I5LX 5LMNQ 1WOCA 4C2MH 5LMUQ 1D7QA 2HHHL 2UU9Q 2UXDL 2PQAB 3HKZG 4LFAQ 4BA2I 1B7YB 3F2BA 1TWHH 2R6GA 1N34L 3MXNB 4X66Q 2HQLA 3K7AH 1VQOA 5C0XG 1PYSB 2JE6I 4APVA 3RN5A 4MNOA 1QVGA 4DR6Q 4TVAB 1KAWA 5IP7H 1XMQL 3M9BA 2NVYH 2UUBL 1U0LA 1N32L 1Y1WG 3I2ZA 3HOUH 1QUQA 3KOJA 3PO2H 2C35B 2VQFL 3EIVA 1WYDA 1YBYA 4GNXC 1HNXL 4KHPL 5IYBH 3RR5A 1VQLA 1Z47A 3T1HL 1MKHA 1PH4A 2YYZA 4DV6Q 4QL5A 5BR8L 1AE2A 4BA1I 3S1NH 1MJEA 4OWXB 4DV1L 2Z0SA 4IFDG 3PCOB 4JBJA 4OWWB 4B3RL 1E1TA 3PUZA 1FL0A 3PIOA 3G4SA 1YNXA 1HJPA 5LMUL 5LMNL 1VCIA 5C4XH 1X3FA 3ULJA 5IYCG 4IOCA 1KC8C 1SMXA 4A3MG 1IBML 4LF6L 3S15H 3PO3H 3E9HA 4DR1L 5JEAJ 2MNAA 4L5SA 2RHQB 3F2DA 3KFUA 4QJFA 3PSIA 3TS0A 1ASYA 1YHQA 3S2DH 2UXBQ 1HNZL 2CWAA 2A19A 3EN2A 3CC2A 4JI3Q 2JA7G 4JI6Q 4YCUA 4GKKQ 1WCMG 4A3JG 5DLQE 4A3GG 2CWPA 4IPHA 4X65L 4LFBQ 2RF4A 2LSSA 4DUYL 2R93H 4BXXG 4HIDA 3M4PA 2NVTH 1YJWA 1VQDA 3J81j 3M4QA 4UY8C 4UP9A 3UDFA 1YJ9A 2MQHA 2YTXA 2Y0SE 4DV2Q 1A8VA 2OQ0A 4IPGA 5IY0A 5FLMH 3HOVH 5K36G 1I50H 1P16A 2NN6I 4AYBG 3CPWA 3HKZE 2VS1A 1EQQA 3TRZA 3I4OA 2EIFA 4JOIA 4DUZL 3CPFA 1Q46A 3G6EA 4PZ7A 3J7ZC 5E7NA 1TXYA 1PH8A 4B3SQ 2EQSA 1JJCB 3U4VA 1QUQB 1HR0W 4P71A 2F52A 4POFA 1QZGA 4PZ8A 1Y1VH 5IYDH 2YTVA 4A76A 1S40A 1K9MC 2JA5H 1YITA 4JI6L 4A93H 1SRUA 4P74A 5C3EH 4JI7L 4BY1G 1HH2P 1PH6A 2JA6H 1V43A 2UUCQ 1K3RA 4KI0A 1SR3A 4DR5Q 1VQJA 1XNRL 3S1RH 1HZCA 1PYBA 1IBLL 3TS2A 1PVOA 2GVAA 4GNXA 4GLAC 4DR3L 3U58A 2JJQA 1EIFA 3TQYA 1NJIC 1FJGL 1L1OA 3M7NA 2K5HA 3S14H 1OXSC 2WFWA 2A8VA 1N36Q 1CSQA 1XNQQ 4A3BH 2B3GA 3G48A 5M3FG 5JJLA 2AWOA 1X54A 4UP7A 1P8LA 2LXKA 1G51A 4YHHL 3CCRA 1LUZA 4JI5L 2N8NA 4LF7L 3K0XA 4O2DA 1GO3E 2I0QA 4QQBX 2VL6A 4GOPC 4NPSA 3I55A 4LUOA 4A4IA 4LF4L 4YWLA 4A3CG 2VY3A 4FDBA 4GLVB 1L0WA 2D0PA 4HJ9A 1XPOA 5GAHC 2F3IA 1NY4A 3FKIG 4DR4L 1X9NA 4A3DG 1D8LA 4RMFA 4BY7G 5FJ8H 4HJ5A 2UUCL 3EBEA 4KLKA 2MFIA 2R7ZG 5C4XG 1KD1C 4WJ4A 4JBKA 1IZ6A 1NMFA 4BBSH 2Q2IA 2KHJA 4ALPA 1HNZQ 2GVBA 3Q8DA 3J81c 4AYBE 3HOXH 4GS3A 1W2BA 5M3MH 4DV7Q 3OYYA 4DV5Q 1Q1EA 1VQPA 2K75A 4JI8L 3RLOA 1SLJA 3TREA 4DAYB 4JV5Q 2BH8A 1X55A 2IX1A 2UXCQ 1X3EA 2HIXA 1UE7A 3I56A 3GO5A 3RZDH 3A5ZB 1Q86C 1XPUA 1WI5A 1K83H 1NTGA 1OTCA 1U5KA 1EUJA 4JI4L 3H0GH 4LW1A 3CCUA 4A3KH 4GNXB 2FXQA 4YY3L 2RCNA 2YU9H 4DR7L 3MEFA 2E5LL 1L1OB 2ZM6Q 1E7ZA 5IP7G 3OTOQ 4A3LH 5FLXc 3VDYA 3HOUG 1A62A 3PO2G 1Y14B 4JI1L 1T9HA 3WWVA 5IE8A 1BBWA 4H02A 5IYBG 1XTDA 2JK8A 2NZHA 3KJOA 1JE5A 3HKSA 4R4IA 1VQ9A 3AQQA 1C9OA 3CCJA 1HR0Q 1KIXA 3AEVA 2F4VQ 3PUXA 2D62A 2LXJA 1HZBA 4A3IH 2HT1A 4XTCS 3T1YQ 1IBKL 2NN6G 4NXNL 5IT9c 4Y52H 1OXUA 3S16H 4JV5L 1IXRA 5EAYA 3CD6A 1VQ6A 2N3SA 2ZTDA 3UDGA 3GTGH 1PH2A 3HOWH 3I4NH 2H5XA 2OTLA 3PO3G 4P73A 4NXMQ 2VQEL 3DM3A 4IPDA 1VQGA 2UU9L 4OX9Q 1YIJA 1V1QA 4R4TA 4LFAL 3CF5A 5ELOA 3M4OH 3CCQA 3FP9A 1VQAA 3BJUA 2R92H 4X66L 1Q82C 1KXLA 2OWOA 5IP9H 4DR6L 1VQFA 3ULLA 4HIKA 4AQYQ 2OCEA 5JEAG 2JEAI 1I5FA 1LM0A 4DV4Q 1I6HH 2R93G 4LWCA 2DGYA 2R7DA 4A3EH 1HR0L 3J80c 1YI2A 3GTPH 4B3TQ 3D31A 3F1ZA 3HFZB 4JCVE 4DV6L 4A3FH 1A63A 3G71A 1CKNA 4MTNA 5FLMG 3A5UA 3HOVG 4B3MQ 3CMAA 1J6QA 3CC7A 3L7ZC 3S1MH 3I4MH 3CCEA 4IOAA 3CP0A 3A74A 4C3IH 3HOZH 1XMOQ 1TWGH 3PUWA 1CSPA 1UEBA 1V9PA 4ME3A 3RNUA 2VUMH 2ZTEA 3K8AA 1GKHA 3KDFA 4JI2Q 1TWFH 2Q2HA 1Y1VG 5IYDG 4OONA 3ER0A 2JA5G 2UXBL 4A93G 1VQKA 5C3EG 3BZCA 2CQOA 5C44H 2RHSB 2IHFA 4BBRH 4JI3L 5M5YH 2ZJPA 4JBWA 4AQYL 5HGQA 3PUYA 4L5RC 1VQNA 4RG1A 1JJ2A 2JA6G 4GKKL 3J7A5 4DAMA 1CKMA 3CC4A 4LFBL 4OXPA 2BH2A 3KJPA 3GTMH 3S24A 2UUAQ 4OWTB 4UP8A 1KRTA 2WAQG 1OXVA 1JB7A 2K14A 2XGTA 4DR2Q 4A3BG 1KQSA 2I5MX 2OTJA 1N33Q 4QY7A 3HOYH 4KHZA 3U4ZA 4DV2L 3NELA 1CUKA 4JC0A 4YCWA 3D0FA 4QIWE 1X65A 5C4JH 4JI0Q 4GKJQ 1YHAA 4DK3C 1G291 1VQBA 4X64Q 2ZJRA 3CCMA 1C7YA 5JJKA 4P75A 2E2HH 4B3SL 4OO1I 3NEMA 5ELNA 4LF9Q 2YTYA 2Q2TA 1Q8KA 3NENA 2K50A 2E8GA 3CQZH 2JA8H 2AWNA 2VNUD 2B29A 1GVPA 3PUVA 5GAEC 3S17H 4K0KQ 1X3GA 4GN5A 5FJ8G 1UE6A 2L15A 1CKNB 4O0AA 1MIUA 4GN4B 1YHBA 3JAMi 2DUDA 4HIMA 4DR5L 3J81i 2BA1A 4BBSG 2ALYB 4DV3Q 2NVQH 4DPGA 4LFCQ 2NZOA 2K52A 2IHEA 3S1QH 2ATWA 3HOXG 2BA0A 1LTLA 4DV0Q 2XTIA 1PFSA 5M3MG 2KHIA 1N36L 1VQ8A 1XNQL 1M90C 1TWCH 1RIPA 4Y7NH 2VW9A 1ASZA 4JI0L 1BBUA 4DNIA 1BKBA 1A0IA 2UXDQ 4R4OA 3UE0A 4PG3A 4HIOA 2QEXA 1N34Q 3KF6A 1KRSA 2K5VA 3ZJYC 2A1AA 4GLXA 4LF9L 3H0GG 4A3KG 1O7IA 2I5HA 2UUBQ 4NB3A 4LF5Q 2IY5B 3IRBA 1NBWA 4A3LG 2VQFQ 1HNXQ 4DKAC 1CKOA 4XIGS 4R4CA 1EIYB 4YCVA 2WAQE 3CW2C 3T1HQ 4JYAQ 4JBMA 2AKWB 1K0RA 2AHOB 4DK6C 2YV5A 1I3QH 4MZ9A 4DV1Q 1VQ5A 4WJ3M 5J3BA 1NMGA 1OXXK 3GTKH 4A3IG 4A75A 2HIVA 2ID0A 1KHIA 2V1CC 3FHWA 3F2CA 1K73C 4GN3B 1IBMQ 1W3SA 5C0XJ 4DV7L 4HJAA 4UPAA 1VS0A 2WB1G 4DV5L 1PA6A 4LF6Q 3CCLA 3GTQH 2D0OA 3HOWG 2PI2A 4DR1Q 3I4NG 2ES2A 2Z6KC 1TWAH 2EXDA 3L0OA 4LNQA 4X62Q 2K4KA 2ZJQA 2UXCL 1VQIA 5AJ3Q 2N49A 1SN8A 1KL9A 1HZ9A 1XJVA 3S2HH 4P72A 1WJJA 1EWIA 1N9WA 4GOPA 4LF5L 1Q1BA 3PV0A 2IX0A 2R92G 4LUVA 5IWAQ 5IP9G 4X65Q 1Y1WH 1XPRA 4DUYQ 3K81C 2ZM6L 4IFDJ 3PIPA 3OTOL 2WP8J 2CKZB 1L1OC 3BU2A 4PMWA 4JYAL 3J80i 3RLFA 4AIMA 3LGJA 1VQHA 3ULPA 1PHJA 3ICEA 3GTLH 4A3EG 1PH7A 3RZOH 3CAMA 2NVXH 2PNHA 2GN5A 1UE5A 4QGUA 1NE3A 1Q12A 2PI2E 2F4VL 4A3FG 3KF6B 1PH1A 1I94Q 1UWVA 4DUZQ 3T1YL 1M1KC 5IYCH 2B63H 3I4MG 4A3MH 1SE8A 3UE1A 2QA4A 3HOZG 4X62L 1YZ6A 2E2JH 4IJLA 3W5OA 3JC66 4POGA 5AJ3L 4NXML 3H3VH 4OO1G 1QZHA 2VUMG 1E24A 4OX9L 1HNWQ 1H95A 1OXTA 1YEZA 3W1GA 4C3JH 2E2IH 4X6AH 2Q2UA 4JI7Q 4L5TA 2KCTA 5C0XI 2JA7H 3CCSA 4HJ8A 1K8GA 5IWAL 2CCZA 3U50C 5C44G 1IYJB 1WCMH 4BBRG 4A3JH 4A3GH 4C3HH 2ZTCA 1XNRQ 3GD7A 3STBD 4AH6A 2VZAA 3L2PA 5LMNW 2B63G 1IBLQ 1PV4A 1RL2A 1S3OA 3A0JA 3DLLA 3I7FA 4DR3Q 4BXXH 1B8AA 2KBNA 3PGZA 4DV4L 1Q7YC 1N8RC 1PH9A 1J5EQ 1FJGQ 3PF4A 1C0AA 1VQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZA A;  4J15 A;  2OQK A;  2WB1 E;  4B3T L;  2R7F A;  1I94 L;  1E22 A;  3GDE A;  4IFD I;  3HOY G;  2PMZ E;  4YHH Q;  4LF7 Q;  2KEN A;  4R1J A;  4IJH A;  4JI5 Q;  3W1B A;  2AMC B;  5GAD C;  4GOP B;  1EOV A;  1QVC A;  1R9T H;  4B3M L;  1BVS A;  3UDX A;  4LF4 Q;  3KLW A;  1EYG A;  4L5Q A;  1EFW A;  1XMO L;  1AE3 A;  2Z6K A;  3CXC A;  3H3V I;  4EX5 A;  1YVC A;  3KYH C;  1HNW L;  1Z9F A;  3UDI A;  3E0E A;  1JT8 A;  4JI2 L;  4DR4 Q;  1SFO H;  2K5N A;  3GTJ H;  4IO9 A;  4BY1 H;  2JA8 G;  2MO0 A;  2PQA A;  2JA9 A;  4LF8 Q;  2JQO A;  2MO1 A;  3K7U C;  1IL2 A;  1J5E L;  4EQ5 A;  3RN2 A;  1VQ4 A;  2IT1 A;  3CME A;  5H1S E;  1VQM A;  1S72 A;  2UUA L;  3STB C;  5M3F H;  4JI8 Q;  1JMC A;  4R4Q A;  4DR2 L;  3F8T A;  1B70 B;  3B6Y A;  4TQU S;  1N33 L;  1PH3 A;  3KDF B;  3GTO H;  1VQC A;  4LUZ A;  3BZK A;  5GRO A;  5JJI A;  1YJN A;  2ASB A;  1LYL A;  2HHH Q;  1X6O A;  3M85 A;  1FVI A;  4JI4 Q;  4A3C H;  4GKJ L;  3H15 A;  3AFP A;  1X56 A;  2JEB I;  3K80 C;  1L2F A;  4X64 L;  4YY3 Q;  5M5X H;  4DR7 Q;  4PZ6 A;  5HY6 A;  2E5L Q;  3FKI H;  4HJ7 A;  5M5W H;  3NBH B;  3RLN A;  1JJG A;  3OW2 A;  1DGS A;  1XMQ Q;  4IPC A;  1Q81 C;  4A3D H;  1N32 Q;  4JI1 Q;  1K8A C;  3E9I A;  4LF8 L;  2R7Z H;  4BY7 H;  1GD7 A;  1MJC A;  5GAG C;  4K0K L;  3AFQ A;  2N78 A;  3TEH B;  1QVF A;  1E3P A;  2CFM A;  3JAM c;  4KHP Q;  4YWM A;  1EQR A;  1UE1 A;  4YWK A;  1SRO A;  3KF8 B;  3SGI A;  4JG2 A;  4DV3 L;  2QGQ A;  4LFC L;  3M3Y H;  5BR8 Q;  1IBK Q;  5GQO A;  1AH9 A;  1G6P A;  3PF5 A;  4NXN Q;  1VQ7 A;  1WFQ A;  1FGU A;  3AYH B;  3ERS X;  4DV0 L;  1GM5 A;  4JOI C;  4B3R Q;  1PH5 A;  2VQE Q;  2KCM A;  2Y0S G;  1E1O A;  3CCV A;  2I5L X;  5LMN Q;  1WOC A;  4C2M H;  5LMU Q;  1D7Q A;  2HHH L;  2UU9 Q;  2UXD L;  2PQA B;  3HKZ G;  4LFA Q;  4BA2 I;  1B7Y B;  3F2B A;  1TWH H;  2R6G A;  1N34 L;  3MXN B;  4X66 Q;  2HQL A;  3K7A H;  1VQO A;  5C0X G;  1PYS B;  2JE6 I;  4APV A;  3RN5 A;  4MNO A;  1QVG A;  4DR6 Q;  4TVA B;  1KAW A;  5IP7 H;  1XMQ L;  3M9B A;  2NVY H;  2UUB L;  1U0L A;  1N32 L;  1Y1W G;  3I2Z A;  3HOU H;  1QUQ A;  3KOJ A;  3PO2 H;  2C35 B;  2VQF L;  3EIV A;  1WYD A;  1YBY A;  4GNX C;  1HNX L;  4KHP L;  5IYB H;  3RR5 A;  1VQL A;  1Z47 A;  3T1H L;  1MKH A;  1PH4 A;  2YYZ A;  4DV6 Q;  4QL5 A;  5BR8 L;  1AE2 A;  4BA1 I;  3S1N H;  1MJE A;  4OWX B;  4DV1 L;  2Z0S A;  4IFD G;  3PCO B;  4JBJ A;  4OWW B;  4B3R L;  1E1T A;  3PUZ A;  1FL0 A;  3PIO A;  3G4S A;  1YNX A;  1HJP A;  5LMU L;  5LMN L;  1VCI A;  5C4X H;  1X3F A;  3ULJ A;  5IYC G;  4IOC A;  1KC8 C;  1SMX A;  4A3M G;  1IBM L;  4LF6 L;  3S15 H;  3PO3 H;  3E9H A;  4DR1 L;  5JEA J;  2MNA A;  4L5S A;  2RHQ B;  3F2D A;  3KFU A;  4QJF A;  3PSI A;  3TS0 A;  1ASY A;  1YHQ A;  3S2D H;  2UXB Q;  1HNZ L;  2CWA A;  2A19 A;  3EN2 A;  3CC2 A;  4JI3 Q;  2JA7 G;  4JI6 Q;  4YCU A;  4GKK Q;  1WCM G;  4A3J G;  5DLQ E;  4A3G G;  2CWP A;  4IPH A;  4X65 L;  4LFB Q;  2RF4 A;  2LSS A;  4DUY L;  2R93 H;  4BXX G;  4HID A;  3M4P A;  2NVT H;  1YJW A;  1VQD A;  3J81 j;  3M4Q A;  4UY8 C;  4UP9 A;  3UDF A;  1YJ9 A;  2MQH A;  2YTX A;  2Y0S E;  4DV2 Q;  1A8V A;  2OQ0 A;  4IPG A;  5IY0 A;  5FLM H;  3HOV H;  5K36 G;  1I50 H;  1P16 A;  2NN6 I;  4AYB G;  3CPW A;  3HKZ E;  2VS1 A;  1EQQ A;  3TRZ A;  3I4O A;  2EIF A;  4JOI A;  4DUZ L;  3CPF A;  1Q46 A;  3G6E A;  4PZ7 A;  3J7Z C;  5E7N A;  1TXY A;  1PH8 A;  4B3S Q;  2EQS A;  1JJC B;  3U4V A;  1QUQ B;  1HR0 W;  4P71 A;  2F52 A;  4POF A;  1QZG A;  4PZ8 A;  1Y1V H;  5IYD H;  2YTV A;  4A76 A;  1S40 A;  1K9M C;  2JA5 H;  1YIT A;  4JI6 L;  4A93 H;  1SRU A;  4P74 A;  5C3E H;  4JI7 L;  4BY1 G;  1HH2 P;  1PH6 A;  2JA6 H;  1V43 A;  2UUC Q;  1K3R A;  4KI0 A;  1SR3 A;  4DR5 Q;  1VQJ A;  1XNR L;  3S1R H;  1HZC A;  1PYB A;  1IBL L;  3TS2 A;  1PVO A;  2GVA A;  4GNX A;  4GLA C;  4DR3 L;  3U58 A;  2JJQ A;  1EIF A;  3TQY A;  1NJI C;  1FJG L;  1L1O A;  3M7N A;  2K5H A;  3S14 H;  1OXS C;  2WFW A;  2A8V A;  1N36 Q;  1CSQ A;  1XNQ Q;  4A3B H;  2B3G A;  3G48 A;  5M3F G;  5JJL A;  2AWO A;  1X54 A;  4UP7 A;  1P8L A;  2LXK A;  1G51 A;  4YHH L;  3CCR A;  1LUZ A;  4JI5 L;  2N8N A;  4LF7 L;  3K0X A;  4O2D A;  1GO3 E;  2I0Q A;  4QQB X;  2VL6 A;  4GOP C;  4NPS A;  3I55 A;  4LUO A;  4A4I A;  4LF4 L;  4YWL A;  4A3C G;  2VY3 A;  4FDB A;  4GLV B;  1L0W A;  2D0P A;  4HJ9 A;  1XPO A;  5GAH C;  2F3I A;  1NY4 A;  3FKI G;  4DR4 L;  1X9N A;  4A3D G;  1D8L A;  4RMF A;  4BY7 G;  5FJ8 H;  4HJ5 A;  2UUC L;  3EBE A;  4KLK A;  2MFI A;  2R7Z G;  5C4X G;  1KD1 C;  4WJ4 A;  4JBK A;  1IZ6 A;  1NMF A;  4BBS H;  2Q2I A;  2KHJ A;  4ALP A;  1HNZ Q;  2GVB A;  3Q8D A;  3J81 c;  4AYB E;  3HOX H;  4GS3 A;  1W2B A;  5M3M H;  4DV7 Q;  3OYY A;  4DV5 Q;  1Q1E A;  1VQP A;  2K75 A;  4JI8 L;  3RLO A;  1SLJ A;  3TRE A;  4DAY B;  4JV5 Q;  2BH8 A;  1X55 A;  2IX1 A;  2UXC Q;  1X3E A;  2HIX A;  1UE7 A;  3I56 A;  3GO5 A;  3RZD H;  3A5Z B;  1Q86 C;  1XPU A;  1WI5 A;  1K83 H;  1NTG A;  1OTC A;  1U5K A;  1EUJ A;  4JI4 L;  3H0G H;  4LW1 A;  3CCU A;  4A3K H;  4GNX B;  2FXQ A;  4YY3 L;  2RCN A;  2YU9 H;  4DR7 L;  3MEF A;  2E5L L;  1L1O B;  2ZM6 Q;  1E7Z A;  5IP7 G;  3OTO Q;  4A3L H;  5FLX c;  3VDY A;  3HOU G;  1A62 A;  3PO2 G;  1Y14 B;  4JI1 L;  1T9H A;  3WWV A;  5IE8 A;  1BBW A;  4H02 A;  5IYB G;  1XTD A;  2JK8 A;  2NZH A;  3KJO A;  1JE5 A;  3HKS A;  4R4I A;  1VQ9 A;  3AQQ A;  1C9O A;  3CCJ A;  1HR0 Q;  1KIX A;  3AEV A;  2F4V Q;  3PUX A;  2D62 A;  2LXJ A;  1HZB A;  4A3I H;  2HT1 A;  4XTC S;  3T1Y Q;  1IBK L;  2NN6 G;  4NXN L;  5IT9 c;  4Y52 H;  1OXU A;  3S16 H;  4JV5 L;  1IXR A;  5EAY A;  3CD6 A;  1VQ6 A;  2N3S A;  2ZTD A;  3UDG A;  3GTG H;  1PH2 A;  3HOW H;  3I4N H;  2H5X A;  2OTL A;  3PO3 G;  4P73 A;  4NXM Q;  2VQE L;  3DM3 A;  4IPD A;  1VQG A;  2UU9 L;  4OX9 Q;  1YIJ A;  1V1Q A;  4R4T A;  4LFA L;  3CF5 A;  5ELO A;  3M4O H;  3CCQ A;  3FP9 A;  1VQA A;  3BJU A;  2R92 H;  4X66 L;  1Q82 C;  1KXL A;  2OWO A;  5IP9 H;  4DR6 L;  1VQF A;  3ULL A;  4HIK A;  4AQY Q;  2OCE A;  5JEA G;  2JEA I;  1I5F A;  1LM0 A;  4DV4 Q;  1I6H H;  2R93 G;  4LWC A;  2DGY A;  2R7D A;  4A3E H;  1HR0 L;  3J80 c;  1YI2 A;  3GTP H;  4B3T Q;  3D31 A;  3F1Z A;  3HFZ B;  4JCV E;  4DV6 L;  4A3F H;  1A63 A;  3G71 A;  1CKN A;  4MTN A;  5FLM G;  3A5U A;  3HOV G;  4B3M Q;  3CMA A;  1J6Q A;  3CC7 A;  3L7Z C;  3S1M H;  3I4M H;  3CCE A;  4IOA A;  3CP0 A;  3A74 A;  4C3I H;  3HOZ H;  1XMO Q;  1TWG H;  3PUW A;  1CSP A;  1UEB A;  1V9P A;  4ME3 A;  3RNU A;  2VUM H;  2ZTE A;  3K8A A;  1GKH A;  3KDF A;  4JI2 Q;  1TWF H;  2Q2H A;  1Y1V G;  5IYD G;  4OON A;  3ER0 A;  2JA5 G;  2UXB L;  4A93 G;  1VQK A;  5C3E G;  3BZC A;  2CQO A;  5C44 H;  2RHS B;  2IHF A;  4BBR H;  4JI3 L;  5M5Y H;  2ZJP A;  4JBW A;  4AQY L;  5HGQ A;  3PUY A;  4L5R C;  1VQN A;  4RG1 A;  1JJ2 A;  2JA6 G;  4GKK L;  3J7A 5;  4DAM A;  1CKM A;  3CC4 A;  4LFB L;  4OXP A;  2BH2 A;  3KJP A;  3GTM H;  3S24 A;  2UUA Q;  4OWT B;  4UP8 A;  1KRT A;  2WAQ G;  1OXV A;  1JB7 A;  2K14 A;  2XGT A;  4DR2 Q;  4A3B G;  1KQS A;  2I5M X;  2OTJ A;  1N33 Q;  4QY7 A;  3HOY H;  4KHZ A;  3U4Z A;  4DV2 L;  3NEL A;  1CUK A;  4JC0 A;  4YCW A;  3D0F A;  4QIW E;  1X65 A;  5C4J H;  4JI0 Q;  4GKJ Q;  1YHA A;  4DK3 C;  1G29 1;  1VQB A;  4X64 Q;  2ZJR A;  3CCM A;  1C7Y A;  5JJK A;  4P75 A;  2E2H H;  4B3S L;  4OO1 I;  3NEM A;  5ELN A;  4LF9 Q;  2YTY A;  2Q2T A;  1Q8K A;  3NEN A;  2K50 A;  2E8G A;  3CQZ H;  2JA8 H;  2AWN A;  2VNU D;  2B29 A;  1GVP A;  3PUV A;  5GAE C;  3S17 H;  4K0K Q;  1X3G A;  4GN5 A;  5FJ8 G;  1UE6 A;  2L15 A;  1CKN B;  4O0A A;  1MIU A;  4GN4 B;  1YHB A;  3JAM i;  2DUD A;  4HIM A;  4DR5 L;  3J81 i;  2BA1 A;  4BBS G;  2ALY B;  4DV3 Q;  2NVQ H;  4DPG A;  4LFC Q;  2NZO A;  2K52 A;  2IHE A;  3S1Q H;  2ATW A;  3HOX G;  2BA0 A;  1LTL A;  4DV0 Q;  2XTI A;  1PFS A;  5M3M G;  2KHI A;  1N36 L;  1VQ8 A;  1XNQ L;  1M90 C;  1TWC H;  1RIP A;  4Y7N H;  2VW9 A;  1ASZ A;  4JI0 L;  1BBU A;  4DNI A;  1BKB A;  1A0I A;  2UXD Q;  4R4O A;  3UE0 A;  4PG3 A;  4HIO A;  2QEX A;  1N34 Q;  3KF6 A;  1KRS A;  2K5V A;  3ZJY C;  2A1A A;  4GLX A;  4LF9 L;  3H0G G;  4A3K G;  1O7I A;  2I5H A;  2UUB Q;  4NB3 A;  4LF5 Q;  2IY5 B;  3IRB A;  1NBW A;  4A3L G;  2VQF Q;  1HNX Q;  4DKA C;  1CKO A;  4XIG S;  4R4C A;  1EIY B;  4YCV A;  2WAQ E;  3CW2 C;  3T1H Q;  4JYA Q;  4JBM A;  2AKW B;  1K0R A;  2AHO B;  4DK6 C;  2YV5 A;  1I3Q H;  4MZ9 A;  4DV1 Q;  1VQ5 A;  4WJ3 M;  5J3B A;  1NMG A;  1OXX K;  3GTK H;  4A3I G;  4A75 A;  2HIV A;  2ID0 A;  1KHI A;  2V1C C;  3FHW A;  3F2C A;  1K73 C;  4GN3 B;  1IBM Q;  1W3S A;  5C0X J;  4DV7 L;  4HJA A;  4UPA A;  1VS0 A;  2WB1 G;  4DV5 L;  1PA6 A;  4LF6 Q;  3CCL A;  3GTQ H;  2D0O A;  3HOW G;  2PI2 A;  4DR1 Q;  3I4N G;  2ES2 A;  2Z6K C;  1TWA H;  2EXD A;  3L0O A;  4LNQ A;  4X62 Q;  2K4K A;  2ZJQ A;  2UXC L;  1VQI A;  5AJ3 Q;  2N49 A;  1SN8 A;  1KL9 A;  1HZ9 A;  1XJV A;  3S2H H;  4P72 A;  1WJJ A;  1EWI A;  1N9W A;  4GOP A;  4LF5 L;  1Q1B A;  3PV0 A;  2IX0 A;  2R92 G;  4LUV A;  5IWA Q;  5IP9 G;  4X65 Q;  1Y1W H;  1XPR A;  4DUY Q;  3K81 C;  2ZM6 L;  4IFD J;  3PIP A;  3OTO L;  2WP8 J;  2CKZ B;  1L1O C;  3BU2 A;  4PMW A;  4JYA L;  3J80 i;  3RLF A;  4AIM A;  3LGJ A;  1VQH A;  3ULP A;  1PHJ A;  3ICE A;  3GTL H;  4A3E G;  1PH7 A;  3RZO H;  3CAM A;  2NVX H;  2PNH A;  2GN5 A;  1UE5 A;  4QGU A;  1NE3 A;  1Q12 A;  2PI2 E;  2F4V L;  4A3F G;  3KF6 B;  1PH1 A;  1I94 Q;  1UWV A;  4DUZ Q;  3T1Y L;  1M1K C;  5IYC H;  2B63 H;  3I4M G;  4A3M H;  1SE8 A;  3UE1 A;  2QA4 A;  3HOZ G;  4X62 L;  1YZ6 A;  2E2J H;  4IJL A;  3W5O A;  3JC6 6;  4POG A;  5AJ3 L;  4NXM L;  3H3V H;  4OO1 G;  1QZH A;  2VUM G;  1E24 A;  4OX9 L;  1HNW Q;  1H95 A;  1OXT A;  1YEZ A;  3W1G A;  4C3J H;  2E2I H;  4X6A H;  2Q2U A;  4JI7 Q;  4L5T A;  2KCT A;  5C0X I;  2JA7 H;  3CCS A;  4HJ8 A;  1K8G A;  5IWA L;  2CCZ A;  3U50 C;  5C44 G;  1IYJ B;  1WCM H;  4BBR G;  4A3J H;  4A3G H;  4C3H H;  2ZTC A;  1XNR Q;  3GD7 A;  3STB D;  4AH6 A;  2VZA A;  3L2P A;  5LMN W;  2B63 G;  1IBL Q;  1PV4 A;  1RL2 A;  1S3O A;  3A0J A;  3DLL A;  3I7F A;  4DR3 Q;  4BXX H;  1B8A A;  2KBN A;  3PGZ A;  4DV4 L;  1Q7Y C;  1N8R C;  1PH9 A;  1J5E Q;  1FJG Q;  3PF4 A;  1C0A A;  1VQE A; 
#chains in the Genus database with same CATH topology
 4XXE A;  1EY8 A;  2R7F A;  4MA0 A;  1BNZ A;  1K83 B;  3E6Z X;  2MHV A;  5K36 H;  3HOY G;  3BA8 A;  4V19 0;  3H0G B;  4B3M L;  2YU9 B;  3KLW A;  2UVW A;  5D1P A;  2Z6K A;  4JI3 H;  3KYH C;  5BN3 A;  1Z9F A;  1JT8 A;  1K3B C;  3GTJ H;  4IO9 A;  2JA8 G;  2KEE A;  2JA9 A;  3H91 A;  5KEE A;  2JEI A;  2MO1 A;  2DY7 A;  5FO8 B;  4A3I B;  3W3A A;  3KHR A;  3MXN A;  3A8K E;  3FPU B;  1A9X A;  1J5E L;  3RMH A;  1CQV A;  4ME6 A;  2WB1 B;  4ED1 A;  1SAP A;  4YR3 A;  1BF4 A;  5H1S E;  1QNU A;  2UUA L;  2V5A A;  4J9R A;  4MIU A;  1JMC A;  4YHH H;  4LF7 H;  4O3P A;  3JAM L;  4CC6 A;  4FXG C;  1R9T A;  1PH3 A;  4UCT A;  2WTF A;  4LF4 H;  3IFD A;  1Z2O X;  1LYL A;  4A2B A;  4QWD A;  3TBI B;  3H15 A;  3K80 C;  3G6J B;  3PW2 A;  4J9S A;  4DR7 Q;  1BCP B;  3NE5 B;  2UUC H;  4K14 A;  2W6Z A;  1JJG A;  1RKN A;  2MP1 A;  4A3D H;  4QWA A;  4LF8 L;  1HA6 A;  2O03 A;  1IW7 C;  4LAA A;  3R2T A;  3AFQ A;  4K0K L;  2PW7 A;  4YWM A;  1EQR A;  4JVZ A;  4IRD A;  1CQJ B;  5KFS A;  4YWK A;  1HTP A;  3WNZ A;  1N36 H;  3OUZ A;  1SRO A;  4ILW A;  3KF8 B;  3SGI A;  4O2A F;  3WO1 A;  4JG2 A;  2JEF A;  4K6D A;  5FPR A;  3KHG A;  1IBK Q;  1AH9 A;  1E4E B;  2W71 A;  3PF5 A;  3URY A;  4WBN F;  2ASD A;  1WFQ A;  4DV0 L;  1GM5 A;  4CDE C;  2VUM B;  4YP3 A;  2FP4 B;  4B3R Q;  3GTO A;  2EYO A;  2KCM A;  2FHT A;  3CCV A;  4C2M H;  4QB4 A;  2HHH L;  2F0F A;  2UXD L;  3CRK C;  1O7Y A;  1TS5 A;  5M5Y B;  1TWH H;  3R5X A;  1TA8 A;  3FKI A;  3D6W A;  1VQO A;  3K7A H;  5C0X G;  1PYS B;  3RN5 A;  5KG0 A;  4MNO A;  4TVA B;  1KAW A;  3BJY A;  2R7Z A;  2IMW P;  1Y1W G;  3A56 A;  3PIO 3;  5EQ0 A;  1RDP D;  5CYU A;  1HNX L;  4AYB B;  1HHV A;  3G6Y A;  1YBY A;  4KHP L;  1VQL A;  2VOB A;  2K5D A;  3N41 B;  3T1H L;  1EZ1 A;  4DA2 A;  4J9Q A;  1ZKO A;  2PNR C;  5KFA A;  1KC7 A;  5IT9 W;  2CW0 D;  2Z0S A;  5ELD A;  1AZQ A;  2DJG C;  2NN6 H;  4OWW B;  2CH4 A;  2UXC H;  1FL0 A;  1SFO B;  4RB0 A;  5C6A A;  2ZXR A;  5LMN L;  4ZUJ A;  1KC8 C;  2NWG A;  3ULJ A;  2CQY A;  4NKL A;  4LF6 L;  1U4P A;  3LML A;  3S17 B;  5DM7 3;  4QJF A;  4F7X A;  1YHQ A;  1M0T A;  2BQR A;  1HNZ L;  4XQJ A;  2CWA A;  4C3J G;  3I12 A;  1CHP D;  3DUZ A;  3Q22 A;  3M4I A;  1BNC A;  4JI3 Q;  4G57 A;  5KFV A;  2KSW A;  3OWF A;  4F8M A;  1JIH A;  1T5X D;  2CWP A;  4IPH A;  4X65 L;  2RF4 A;  3JRW A;  1XTC D;  1HR0 H;  2D9U A;  2N55 A;  2Z8L A;  3MR5 A;  2KED A;  3M4Q A;  4HNU A;  3UDF A;  3GTL A;  4J9N A;  4IPG A;  5IT9 E;  2UVV A;  4EFB A;  1WTR A;  4RU9 A;  2F0V A;  4O4L F;  1I7L A;  1KLG D;  1S5F D;  2PPB C;  3HKZ E;  1LTG D;  2PW5 A;  2VS1 A;  1EQQ A;  3BG5 A;  2HVS A;  3CPF A;  3G6E A;  5ELC A;  4PZ7 A;  5E7N A;  1TXY A;  1NR2 A;  4K8I A;  4B3S Q;  3GIJ A;  1QUQ B;  1CTM A;  2K33 A;  2F52 A;  5KYI A;  1QZG A;  3GQB A;  2VA3 A;  4UCS A;  3CVZ A;  4OGQ C;  2YTV A;  4DAY A;  1S40 A;  2YRW A;  5KFU A;  2JA5 H;  4G3I A;  2E2I A;  4JI6 L;  1QG7 A;  2JA7 A;  3SE0 A;  4BY1 G;  1HH2 P;  5IGD A;  2JA6 H;  1V43 A;  2UUC Q;  3Q2O A;  3HGB A;  1CK1 A;  3PQI A;  5DLG A;  1QOH A;  1PYW D;  1EIF A;  1L1O A;  1GLV A;  4RKB A;  1N36 Q;  5C4Z A;  3PN1 A;  4MV8 A;  2B3G A;  4RCN A;  5JJL A;  4WD3 A;  3OIQ A;  4NW2 A;  4ECQ A;  5A2Q W;  1X54 A;  4FS2 A;  3NQI A;  3S2H B;  3ND9 A;  1PK8 A;  3DWA A;  2KJX A;  5J22 A;  4JI5 L;  3CCR A;  2N8N A;  4O2D A;  2OF1 A;  1DYQ A;  3A54 A;  4GOP C;  1ENC A;  1PTO C;  4LUO A;  1Y1W B;  4A4I A;  4YWL A;  1TS4 A;  2FMM A;  3EQL C;  1L0W A;  4HJ9 A;  2D0P A;  4ZKC B;  5KFH A;  4Q8E A;  2AQ3 B;  1XPO A;  2EYF A;  5GAH C;  5D14 A;  4DR4 L;  3S1N B;  1WVL A;  5C1P A;  5JVL A;  2A73 B;  2B39 A;  1R4Q B;  1UC8 A;  4RMF A;  3EBE A;  3H09 A;  5TSS A;  1D6E C;  2V58 A;  4WJ4 A;  4JBK A;  4BBS H;  2Q2I A;  4ZI7 F;  4ALP A;  3FDT A;  3Q8D A;  3J81 c;  3HOX H;  2CW7 A;  4DL5 A;  2NUC A;  3R23 A;  1B4O A;  5FLX L;  2G9D A;  4DV7 Q;  4JI0 H;  2G9H D;  2W6O A;  1SMY D;  2K75 A;  3TRE A;  1JXL A;  4C3J B;  1F2L A;  2BH8 A;  3K5N A;  2IX1 A;  2W6P A;  5KT2 A;  2HDL A;  2UXC Q;  1E0B A;  1E4F T;  4G7Z C;  1XPU A;  4LF9 H;  1LTI D;  1K83 H;  3VPC A;  4KY5 A;  2NVT B;  4Q0Y A;  3K5L A;  1V4Y A;  4IQZ A;  2RGR A;  1TY2 A;  3H0G H;  5JUM A;  1AP0 A;  3K3V A;  1SYD A;  2RCN A;  2YU9 H;  2F3W A;  4Z9C B;  3OTO Q;  4A3L H;  1CT1 D;  1L0X B;  1A62 A;  2ZXO A;  3PO2 G;  1Y14 B;  1I50 B;  5C3X A;  5IYB G;  3K5I A;  2R8J A;  4NP5 A;  2D2C C;  1HR0 Q;  4CBV A;  4GZY C;  3HXL A;  4ED6 A;  1U9R A;  2LXJ A;  2XGQ A;  4A3I H;  3H6M A;  1JOO A;  4XTC S;  2A6E C;  3L3O C;  2DWC A;  3MWD A;  5KFT A;  5DG8 A;  4NXN L;  4X3T A;  4A93 B;  5EAY A;  5C3E B;  3CD6 A;  2ZTD A;  5C4X G;  1B3A A;  1PH2 A;  1SYF A;  5JVG 3;  4RNO A;  2QIL A;  1VQG A;  4BY1 B;  4HNV A;  1IYU A;  2UUB H;  1V1Q A;  4O42 A;  1A3T A;  4ZYS A;  2F0M A;  5L9X A;  5KRU A;  5ELO A;  3FP9 A;  3BJU A;  4X66 L;  5F2D A;  2YS7 A;  2Q8T A;  5IP9 H;  4DR6 L;  3GIK A;  1VQF A;  4IRC A;  5EWE A;  3ULL A;  3R2I A;  5JEA G;  2JEA I;  1RK6 A;  5JVD F;  4RGM A;  1I5F A;  3HB9 A;  1LM0 A;  3PR4 A;  2DGY A;  2R7D A;  5D3I B;  3J80 c;  4HMI A;  2P0A A;  4DL7 A;  2KCN A;  3HFZ B;  1IBM H;  1EY0 A;  2F0K A;  3H4D A;  2FJ2 A;  5FLM G;  3HOV G;  4RNN A;  2FIN B;  1JIC A;  2PN1 A;  2B2T C;  3RB4 A;  3CCE A;  1A15 A;  3CP0 A;  3DEP A;  2NUA B;  4KKU A;  1V9P A;  4F87 A;  4OX9 H;  4OL7 A;  2XSC A;  4EGQ A;  2VUM H;  2ZTE A;  3K8A A;  2DJF C;  4K2L A;  3KK7 A;  4J9L A;  3IL8 A;  5KFR A;  1SNP A;  1VQK A;  1UEA B;  3PW5 A;  3BZC A;  2CQO A;  4BBR H;  4NLG A;  5M5Y H;  4AQY L;  5HGQ A;  1T94 A;  2F0E A;  1F2Y A;  3J7A 5;  1EEF D;  3MZ5 A;  2R93 A;  3BAA A;  3ORQ A;  3MC0 B;  3VR4 A;  1BGW A;  1I94 H;  5F9N A;  4UP8 A;  1OXV A;  4YAJ B;  1JB7 A;  1FGB D;  1EY9 A;  1HTL D;  3KLS A;  4XQQ A;  4A3B G;  2I5M X;  3HOY H;  4DV2 L;  3RFC A;  4TKO B;  1CUK A;  5I2Y A;  5KFQ A;  1XMO H;  3D0F A;  4QIW E;  1X65 A;  5EKI A;  1IW7 D;  4JI0 Q;  1TWG A;  3ERO A;  1HNW H;  1CS0 A;  1G29 1;  4X64 Q;  1QIL A;  4JI7 H;  1KDB A;  3NWS A;  1TWF A;  5IYZ F;  2EYL A;  2CVR A;  4OO1 I;  1C48 A;  3NEM A;  4LF9 Q;  3A8J E;  1XNR H;  1Q8K A;  1BCP F;  3VR6 A;  1J8I A;  2V4Q A;  3BG3 A;  4H0L C;  2JA8 H;  1KNA A;  1CZG A;  2B29 A;  3S17 H;  5GAE C;  5H80 A;  5FJ8 G;  1FJG H;  4ED7 A;  1CKN B;  3S16 B;  4HIM A;  3I4N B;  2KEC A;  2A68 C;  4CJ2 C;  1YNJ C;  2ASJ A;  4C5C A;  2YL2 A;  1B9N A;  1KBL A;  1LTL A;  5HUR A;  2XTI A;  4E6I A;  1XNQ L;  2YRX A;  1TWC H;  1RIP A;  2PQE A;  3WOE A;  4F50 A;  2R92 B;  1EQV A;  4JW0 A;  4KD4 A;  1U4L A;  3TN2 A;  3T5K A;  1KRS A;  3KLR A;  2K5V A;  3ZJY C;  4PV1 C;  4GLX A;  1JLL B;  4A3K G;  2R7K A;  2QDL A;  4N9T A;  1TR5 A;  2UUB Q;  1CZW A;  2IY5 B;  3IRB A;  4JK1 C;  3EPI A;  4A3F B;  4DKA C;  1HPC A;  1CKO A;  4XIG S;  4R4C A;  1EIY B;  3I4M B;  4DV3 H;  3MXG A;  2AHO B;  5JQW A;  4IUP A;  1BBX C;  3Q8P B;  5J3B A;  1OXX K;  2V1C C;  2K7V A;  3SE7 A;  4HYK A;  4GN3 B;  1IBM Q;  2BQ3 A;  5C0X J;  3GTQ H;  4DV5 L;  4JI4 H;  3HOW G;  3N6R A;  2FE3 A;  2IWH A;  5KT5 A;  3L0O A;  4ZRZ A;  4BWG B;  1VQI A;  3VMM A;  3S2H H;  3S1R B;  4APM A;  5CBA E;  1EWI A;  4QF4 A;  5C0X H;  4LF5 L;  3VPB A;  2VQF H;  1HFN A;  2RDF A;  1Y1W H;  1KJI A;  1EIH A;  2SOB A;  4RB3 C;  1ZET A;  2ZM6 L;  3QZ7 A;  2CKZ B;  4PMW A;  3BU2 A;  1SNM A;  4A3B B;  4JYA L;  1DV2 A;  1RJP A;  3RLF A;  5D3D A;  5BR8 H;  2C5C A;  3TME A;  1I3Q A;  4A3E G;  4ECU A;  3CAM A;  2I80 A;  2RDI A;  4EGV A;  4JPB W;  3OHA A;  4G4K A;  5CAE B;  3GTK A;  1EY4 A;  1R4P B;  1UE5 A;  2EZV A;  1ICW A;  1Q12 A;  5M9O A;  2JYO A;  4QGU A;  2E2H B;  5KFD A;  2VQE H;  1I94 Q;  5ELB A;  5JPM C;  1EUC B;  2EYP A;  2X0S A;  1I4R A;  5EDW A;  3T1Y L;  2UU9 H;  2EY5 A;  2X6L A;  4RFB A;  3C0F B;  3K5H A;  2RSN A;  4XDX A;  1EU3 A;  5KFB A;  4LFA H;  2QA4 A;  4C3I G;  4X62 L;  2H1E A;  2PMZ A;  1FD7 D;  4OO1 G;  1AFP A;  1HNW Q;  1H95 A;  5EKK A;  4C3J H;  4HSV A;  2Q2U A;  4V0B A;  4JI7 Q;  1WH2 A;  3UQ8 A;  2KCT A;  3CHB D;  3S1Q B;  4HJ8 A;  5C44 G;  3FPP A;  1XNR Q;  3GD7 A;  5C5M A;  1WR2 A;  2W6N A;  1RL2 A;  1S3O A;  3I7F A;  4Y7N B;  1B8A A;  5ELE A;  3V05 A;  1FJG Q;  1C0A A;  2NVX A;  2SNM A;  1PTO D;  4I4T F;  1LTA D;  3GTP A;  5KFK A;  2OQK A;  2WB1 E;  4B3T L;  3RTX A;  1E22 A;  3GDE A;  1SND A;  3VYT A;  2LY7 A;  1JOR A;  2KEN A;  4HQ6 A;  3W1B A;  1D2B A;  1EOV A;  5IGB A;  1VAJ A;  5FO7 B;  1X32 A;  1BVS A;  1JKJ B;  2FB9 A;  5IGF A;  4L5Q A;  1EFW A;  1BUV T;  3G6X A;  1AE3 A;  4U7C A;  4IUQ A;  5LP6 F;  1STB A;  1YVC A;  5LL6 X;  1N48 A;  3UDI A;  1EYC A;  4JI2 L;  1Y8O B;  1WCM A;  4MV6 A;  3HRZ C;  4BY1 H;  3N8D A;  2PQA A;  1EHI A;  5I6Y A;  4RZQ A;  1QWY A;  4C56 C;  3EYY A;  2Y0S B;  2A69 D;  4YIJ A;  1L2Z A;  4EQ5 A;  1V1O A;  1EUD B;  4ZAI A;  3GTM A;  3CME A;  1VQM A;  3GTG B;  3V6K A;  3G7L A;  1IKM A;  3STB C;  2SNS A;  3N40 P;  2FPG B;  4ULL A;  5KFW A;  1JCK B;  3ITP A;  1N33 L;  2DIK A;  3KDF B;  4PWQ A;  5G3L F;  5KFY A;  2XC9 A;  4LUZ A;  2FLL A;  3BDL A;  1TS3 A;  3M85 A;  4JI4 Q;  4GKJ L;  3AFP A;  1X56 A;  4IHJ F;  1L2F A;  2J4X A;  5M5X H;  3I91 A;  5HY6 A;  2E5L Q;  3RZO B;  2HVQ A;  4HJ7 A;  5M5W H;  3GTJ A;  3NBH B;  4A3E B;  3OW2 A;  1B9M A;  2R7N A;  3CQZ A;  4JI1 Q;  1K8A C;  1V1P A;  2W9C A;  2BR0 A;  2QDB A;  2N78 A;  3OHX C;  3WOF A;  4A3M B;  2ZJT A;  3LWE A;  1OO9 B;  2E2J B;  4RZR A;  1Z6H A;  1DZ1 A;  3RUZ A;  1STN A;  5BR8 Q;  1VQ7 A;  1PZK D;  1FGU A;  4BS9 A;  4FVM A;  3S9W A;  2W57 A;  4JOI C;  4EQP A;  3FMA A;  1SJH D;  4DL6 A;  2VQE Q;  1D7Q A;  2I5L X;  1WOC A;  4PMC A;  2DNE A;  1O7Z A;  1CM9 A;  2UU9 Q;  2V4R A;  4R8I A;  4LFA Q;  4BA2 I;  2F0P A;  2RDJ A;  3MXN B;  4Q43 A;  1QVG A;  4GC7 A;  3PW7 A;  1RJQ A;  3MR3 A;  3A7A B;  3N52 A;  2NVY H;  1PFN A;  5BPH A;  5DQH A;  3KOJ A;  3PO2 H;  3KAL A;  4GNX C;  5IYB H;  3RR5 A;  1R9T B;  1JWS D;  4FXD A;  2A6H C;  3C3L A;  1E2V A;  1IBK H;  1AE2 A;  4JV5 H;  4DV1 L;  1SE2 A;  2OLS A;  1S5C D;  1VMC A;  4IN3 A;  4JBJ A;  1EYZ A;  4B3R L;  3U9T A;  4H13 C;  1GUS A;  3G4S A;  5C4X H;  1S10 A;  1X3P A;  5KNC A;  3E9H A;  4DR1 L;  5JEA J;  4KV6 A;  4FU0 A;  2MNA A;  3TIG A;  2AQ2 B;  1TVX A;  2RHQ B;  1TWH A;  3TS0 A;  1ASY A;  4XYL B;  3M9M B;  2FPP B;  2I8C A;  4CDF C;  2JA7 G;  2NVQ B;  4A3G G;  3MWM A;  1Z7T A;  1EY5 A;  5JEA H;  4K5W A;  4LFB Q;  4L6T B;  1T36 A;  2LSS A;  5D65 A;  4F4Y A;  1WTH A;  4HID A;  1G2S A;  2F4V H;  2BDO A;  4J1M A;  3GTO B;  4UY8 C;  1GSH A;  1EEI D;  2LMC B;  1YJ9 A;  1G6Z A;  2YTX A;  2M00 A;  1VMP A;  4U68 A;  4H44 C;  2OQ0 A;  3KHL A;  5IY0 A;  5FLM H;  3HOV H;  4FNF A;  4QW8 A;  2VXW A;  4CJ0 B;  4XT1 B;  3FKI B;  4AYB G;  3CPW A;  3UFX B;  1T3N A;  2EIF A;  4JOI A;  2XRS D;  4DUZ L;  1Q46 A;  3K59 A;  2R7Z B;  3J7Z C;  3FRP B;  2EQS A;  3HBL A;  3SK5 A;  1QE6 A;  2ZDQ A;  2A68 D;  1YNJ D;  3RGZ A;  2K6A A;  5EWG A;  4EGJ A;  5D1O A;  3M3Y B;  3GIQ A;  4IR9 A;  4DV4 H;  1F9S A;  3KHH A;  4EEY A;  1PH6 A;  4FBT A;  1K3R A;  1W6J A;  5KT4 A;  3P20 A;  3S1R H;  4GNX A;  2G5D A;  1NJI C;  2K5H A;  2O5I C;  4B3M H;  2A8V A;  4MV9 A;  4A3B H;  5M3F G;  4M7E A;  2AWO A;  3OOC A;  4EEQ A;  5EPJ A;  5DLF A;  2LXK A;  1G51 A;  4YHH L;  2XN9 C;  1LUZ A;  2GA4 B;  4LF7 L;  4ZHQ F;  3K0X A;  1WTV A;  1I4H A;  3J81 L;  3NUC A;  4B3S H;  1S0N A;  4NPS A;  4LF4 L;  2VY3 A;  3PW0 A;  2IX3 A;  2JA5 A;  5LOV F;  4IUU A;  1BXT A;  2F0W A;  2F3I A;  1EU4 A;  1DOL A;  3BAB A;  1HA5 A;  3PR5 B;  3GTL B;  1Z2P X;  1PDQ A;  1D8L A;  1YNN C;  2JA6 A;  5FJ8 H;  2UUC L;  2UUA H;  1ML0 D;  4IZ8 A;  5DEH A;  1IZ6 A;  5KYL A;  4Q45 A;  3J7A K;  3I90 A;  2KHJ A;  3PO3 B;  3RB3 A;  2GVB A;  3MFG A;  2L5T A;  4EVO A;  4GS3 A;  1NR4 A;  5DNF A;  3TZD A;  1RD9 D;  3R8B A;  3NHH A;  2KUM A;  2FJZ A;  3WO0 A;  4JI8 L;  3RLO A;  4DAY B;  5ISR A;  4JV5 Q;  1DJR D;  2E2I B;  2E74 C;  3I70 A;  4R7R A;  4UCR A;  4CDD C;  3RB6 A;  3K5O A;  2JA7 B;  1S5D D;  4A3G B;  2O2L D;  1F2Z A;  2K05 A;  1GXD C;  1HUM A;  1EUJ A;  1D5M C;  2IPK D;  4A3K H;  2L0C A;  4K0K H;  1LT6 D;  2QF7 A;  5E1F A;  4YY3 L;  1G91 A;  2EY6 A;  1SDF A;  2K01 A;  3PZP A;  1L1O B;  1E7Z A;  5IP7 G;  1BCP C;  4DL3 A;  2FLP A;  2QEJ C;  1ZQ7 A;  1JWM D;  4B9X A;  2YW2 A;  1S0M A;  3P75 A;  3KJO A;  2O5J C;  3CCJ A;  1KIX A;  3AEV A;  1GGO A;  2R82 A;  2F4V Q;  2WKD A;  1XDN A;  2F0H A;  4DV7 H;  4XZ3 B;  3MFI A;  3T5L A;  3RBE A;  5IT9 c;  1JQY D;  1SE3 A;  1F9Q A;  1IXR A;  1B50 A;  1VQ6 A;  2N3S A;  1II3 A;  3J80 L;  3GTG H;  3HOW H;  4P2C B;  2H5X A;  5EZY F;  4P73 A;  3MFY A;  4HR7 B;  1K83 A;  4KKT A;  3DM3 A;  4IPD A;  1YIJ A;  3H0G A;  4KHV A;  4FXK C;  3OSO A;  1CA5 A;  4MTD A;  3CCQ A;  2E2D C;  3R3O A;  4YB8 B;  4O1N A;  1N56 A;  1KXL A;  3OTO H;  3LP8 A;  3T1H H;  3R5F A;  3KXY T;  1A2T A;  2OCE A;  2VA2 A;  1E4G T;  4DV4 Q;  5K2M A;  1Y8P B;  2R93 G;  4LWC A;  2K04 A;  5M3F B;  3QJY A;  4CGY B;  3X3M A;  4A3E H;  1HR0 L;  3GV5 B;  2F0J A;  2K5W A;  5C4H A;  5DG7 A;  5HV6 A;  4ED8 A;  4UCV A;  3C2P A;  4JCV E;  3SK6 A;  1W93 A;  4DV6 L;  2BE5 D;  5IGC A;  4C5B A;  4LF6 H;  3A5U A;  4B3M Q;  3CMA A;  3K3P A;  2HDM A;  1HXY D;  2F3V A;  3A74 A;  2W8K A;  1JR0 D;  4C3I H;  2J7Z A;  3OMC A;  1CA6 A;  1ILP A;  1ULZ A;  3RNU A;  4OO1 H;  4JV1 A;  2JSO A;  4ABN A;  4L63 B;  5EWF A;  2Q2H A;  5IWA H;  1GHK A;  4X65 H;  4EBD A;  4ZQI A;  2AGQ A;  2UXB L;  1KJJ A;  4A93 G;  5C3E G;  1A3U A;  5C44 H;  2ZJP A;  5M3M B;  4JBW A;  3RF2 A;  1VQN A;  4GKK L;  3SVM A;  3TP7 A;  2I87 A;  3QOJ A;  2NU8 B;  4DAM A;  1CKM A;  3CC4 A;  2QYZ A;  1TAE A;  4UCU A;  2J6U A;  3OPO A;  2WKC A;  3X3N A;  5AFW A;  4JV2 A;  1ILQ A;  3S24 A;  2UUA Q;  4KJN A;  2WAQ G;  1QCB D;  5IGG A;  2XGT A;  3Q6S A;  4IR1 A;  1PTO B;  2XCA A;  2FMC A;  2YS6 A;  3GV8 B;  3O13 A;  2P5Z X;  1TU2 B;  5CV6 A;  4NDX A;  3L9A X;  5C4J H;  1STA A;  1YHA A;  4XT3 B;  4DK3 C;  3CCM A;  1H9K A;  2W6Q A;  4PQX A;  4P75 A;  1KEE A;  1RF2 D;  3T4A C;  1JWU D;  5ELN A;  2YTY A;  4Y8V B;  2KOL A;  1PX2 A;  1Y1V A;  5LXT F;  3GQC A;  3RV4 A;  2K50 A;  1KJQ A;  3TP5 A;  1EQT A;  2AWN A;  2VNU D;  4K0K Q;  3MFH A;  4GN5 A;  1UE6 A;  3M9N B;  2WAC A;  1YHB A;  4DR5 L;  1KTK A;  2BA1 A;  2NVQ H;  4DPG A;  3KLS X;  5FK9 C;  2IHE A;  2ATW A;  2ENB A;  3BVM A;  3ND8 A;  2BA0 A;  3S15 B;  4DV0 Q;  4JI5 H;  1D5X C;  2EJG C;  5JAV A;  2KHI A;  2VW9 A;  1I4G A;  2RVL A;  1EZ6 A;  4JI0 L;  1BKB A;  2PZU A;  2DNC A;  2UXD Q;  4X64 H;  4PG3 A;  4HIO A;  1BQQ T;  1SSO A;  5A2Q E;  2QEX A;  5KFF A;  1I6H B;  3L4J A;  4DR4 H;  2A6H D;  2RGV A;  4LF9 L;  1IYV A;  2R93 B;  2WII B;  1SNC A;  4LH7 A;  3JAM W;  1S5E D;  1AN8 A;  1HNX Q;  5KT3 A;  1UNS A;  5KFM A;  1RHP A;  2HJW A;  2AQ1 B;  4YCV A;  3CW2 C;  3T1H Q;  1K0R A;  2YV5 A;  3HOZ B;  2MPM A;  4XYQ A;  1TWG B;  4KY6 A;  1ET9 A;  3GIP A;  1GYF A;  4DK1 A;  1SYG A;  3N6X A;  1PRT C;  1TWF B;  2HIV A;  2ID0 A;  1TWC A;  1K73 C;  1B6R A;  1QB5 D;  1PA6 A;  4LF6 Q;  2VB2 X;  4HNT A;  2D0O A;  3I4N G;  2ES2 A;  1MHW C;  4EYH B;  2ZJQ A;  1LTB D;  2XWJ B;  4LSX A;  5DGB A;  5EBD A;  4QWE A;  3D4D A;  2N49 A;  2YZG A;  1CQF A;  1SN8 A;  1N32 H;  1XMQ H;  1WJJ A;  3OIP A;  4GOP A;  1BDO A;  4UCO A;  3MXU A;  2IBK A;  5DG9 A;  2ALZ A;  2R92 G;  4O3N A;  5IWA Q;  1KNE A;  4X65 Q;  5L1I A;  2WAQ B;  3S14 B;  4MHE A;  3PIP A;  2WP8 J;  2K5Q A;  5CA0 F;  3I73 A;  3BYY B;  3CRL C;  3T16 A;  2B2W C;  1VQH A;  2K1B A;  4B9W A;  2NTS A;  3ULP A;  3GTL H;  4NXN H;  1PH7 A;  4M8A A;  1D1I A;  3BDO A;  3T53 B;  1SCU B;  1ROD A;  2PI2 E;  3GP7 A;  4A3F G;  1PH1 A;  5L1L A;  5LMU H;  3GTQ A;  1SYB A;  1M8A A;  4QMG A;  3I4M G;  3UE1 A;  4CC5 A;  1V8Q A;  4OIJ A;  1YZ6 A;  2XVS A;  4K5V A;  4X66 H;  4NXM L;  1T5E A;  3Q8S B;  4IUT A;  1E24 A;  4OX9 L;  1OXT A;  1KAA A;  2E2I H;  4X6A H;  2AQ4 A;  4L5T A;  2JA7 H;  4O3S A;  2RQX A;  1K8G A;  3U50 C;  1BXR A;  4A3G H;  4F4X A;  3L2P A;  5LMN W;  3A0J A;  3DLL A;  1F9R A;  4FF1 A;  2B2Y C;  3PF4 A;  1VBG A;  1EY7 A;  4FS1 A;  3K0Y A;  2EJM A;  4HN7 A;  1S03 G;  1F77 A;  1OWT A;  2C2R A;  2L9H A;  3SHL A;  4J15 A;  5FKA C;  1I94 L;  1B53 A;  4IFD I;  3ERQ A;  4JI5 Q;  1KDA A;  4R1J A;  4EBE A;  2LFN A;  2AMC B;  4ZLT F;  5GAD C;  1K0S A;  1VF7 A;  2R85 A;  1LTR D;  5E4X A;  2Z9H A;  1RYR A;  1XMO L;  2EY2 A;  3CXC A;  3H20 A;  3H3V I;  1D1K A;  1HNW L;  2OT2 A;  1FKA H;  3LWU A;  4KN7 C;  3E0E A;  2C00 A;  2R3Z A;  4DR4 Q;  2OEO A;  4IZO A;  1SFO H;  4C1N I;  1SEI A;  4RAU C;  2HVR A;  2MO0 A;  4EQN A;  3GTK B;  2R8I A;  2QKI C;  2K32 A;  4OEM B;  5I4D A;  2AGP A;  4J9O A;  1IL2 A;  2CW8 A;  2R8K A;  2PVP A;  2B2W A;  4RWS C;  3K57 A;  3RN2 A;  1VQ4 A;  1S72 A;  5BN5 A;  4UFZ A;  2PMZ B;  3DWP A;  4QW9 A;  5M3F H;  4KMU C;  4R4Q A;  4DR2 L;  3VR5 A;  2BCO A;  3M4O B;  5GRO A;  3BZK A;  4FP5 D;  1YJN A;  4RB1 A;  1X6O A;  1FVI A;  5NUC A;  1S9F A;  2B2T A;  2JEB I;  1GUT A;  1LT4 D;  3K6O A;  1GHJ A;  5CV9 A;  2CHB D;  2NVX B;  4ECZ A;  3RLN A;  1FNW A;  1DGS A;  1XMQ Q;  1N32 Q;  3GTP B;  1GSO A;  4UAI A;  2BQU A;  1MJC A;  5GAG C;  3RAQ A;  5FD6 A;  4C1N K;  4HCS A;  1QVF A;  1D5Z C;  2CFM A;  3AU7 A;  1LV9 A;  1UE1 A;  4H7B A;  1XNQ H;  4XX0 B;  3MEH A;  4ME5 A;  2D5D A;  4DV3 L;  4ECW A;  2QGQ A;  4LFC L;  1UNN C;  1ZEQ X;  3GLK A;  3GV3 A;  2W7P A;  4JV0 A;  4NXN Q;  5KFG A;  1HQR D;  5COR A;  2UVU A;  3ETH A;  3EVQ A;  3M9O B;  2Y0S G;  5LMU Q;  1WCM B;  5KFC A;  3QO2 A;  2NU9 B;  1AW7 A;  3E0J A;  4EBC A;  3KBG A;  1B6S A;  1S4Z A;  2PQA B;  2R6G A;  2V4D A;  1N34 L;  1RTN A;  4A2A A;  2E5L H;  4X66 Q;  2HQL A;  5FLX W;  4BWS C;  1JE4 A;  4APV A;  4DR6 Q;  2HCI A;  5IP7 H;  3GTM B;  4JI1 H;  1U0L A;  5KFP A;  3I2Z A;  4EYI B;  4ZUI A;  4RGO S;  4CHT B;  2VQF L;  1LTT D;  1MZB A;  1WYD A;  2WIN B;  2NU6 B;  2W9B B;  2CH4 W;  3L4K A;  2KQ3 A;  3ORR A;  2F0G A;  1PH4 A;  1BO0 A;  1DXM A;  2YYZ A;  4DV5 H;  5BR8 L;  3S1N H;  5KG5 A;  5EPK A;  2XD4 A;  1K28 A;  4IFD G;  1FR3 A;  2DN8 A;  1JDB B;  2Z1C A;  1E1T A;  3PUZ A;  2EXZ A;  4RGT A;  1H9S A;  3PIO A;  4G7H C;  4KKS A;  5IYC G;  1X3F A;  3GTJ B;  1SMX A;  4A3M G;  3S15 H;  2WDT A;  1SJE D;  3CQZ B;  1TWA A;  1DOM A;  4K5X A;  3KFU A;  2W9C B;  3HKZ A;  2V9W A;  2JXM B;  3PSI A;  3V6J A;  1SYE A;  2NVY A;  3ONA B;  5FLX E;  4TQR A;  2TSS A;  2DLN A;  4A3J G;  5DLQ E;  1K8O A;  2R7L A;  3NPP A;  3SEB A;  1CE8 A;  4DUY L;  1WTX A;  2R93 H;  4BXX G;  2NVT H;  3M4P A;  2VPS A;  3LWB A;  1YJW A;  1EOT A;  1Q3L A;  4ETS A;  3K5M A;  3T1Y H;  4J9P A;  1ENA A;  2SEB D;  4DV2 Q;  3A55 A;  4HED A;  2F0L A;  1IOW A;  1I50 H;  1PTO F;  5I9O A;  4A3D B;  2B63 A;  1SE4 A;  2CW0 C;  1PH8 A;  3EPG A;  1JC7 A;  4HSP A;  3SK8 A;  4POF A;  3EFX D;  4A76 A;  1STE A;  1K9M C;  1YIT A;  4A93 H;  5C3E H;  2O4X A;  5JH7 F;  4LFB H;  2DY8 A;  1K1S A;  3Q0A A;  4QWB A;  3OMG A;  1SR3 A;  1VQJ A;  1NUC A;  3AMU A;  1HZC A;  4B3T H;  1IBL L;  2L11 A;  3TS2 A;  1NSN S;  2GVA A;  4DR3 L;  1STG A;  3MWE A;  3TQY A;  3M7N A;  3HZX A;  3S14 H;  2WFW A;  1I6U A;  3GII A;  1CSQ A;  4R8U A;  1XNQ Q;  3G8C A;  1TWH B;  3NP8 A;  3P7J A;  3K7A B;  4UP7 A;  1L0Y B;  3KAJ A;  4YQW A;  1F9P A;  4JI2 H;  2I0Q A;  3R5H A;  1GUO A;  3J7A F;  3I55 A;  4ECX A;  4N8F A;  1KDC A;  4A3C G;  3HG9 A;  3ETJ A;  4GLV B;  1PMR A;  4KJO A;  4XQN A;  2F03 A;  3FKI G;  5ELF A;  4DNT B;  3H4B A;  1PRT D;  1DOK A;  4Q5V A;  1X9N A;  1C4Q A;  5HGT A;  4BY7 G;  4HJ5 A;  2R7Z G;  2J6S A;  4KLK A;  2J0T D;  2MFI A;  2A6E D;  5DM6 3;  5JJZ A;  3D4R A;  3Q8Q B;  1NMF A;  5J1Z A;  3NTI A;  4RUA A;  4AYB E;  1QNK A;  2NZ1 D;  1W2B A;  2YYA A;  4KN4 C;  3T56 B;  3BVZ A;  2KA7 A;  3OYY A;  4RCO A;  4DV5 Q;  1B3Q A;  4FYD A;  4J9K A;  1Q1E A;  1VQP A;  5I2X A;  1SLJ A;  4ODG A;  5KG4 A;  5L1J A;  2I46 A;  1X55 A;  1B44 D;  2A5H A;  5COY A;  5D1O B;  1GUW A;  1X3E A;  1UE7 A;  3GO5 A;  3A5Z B;  1Q86 C;  2NYZ D;  2VR1 A;  4A3J B;  3LNN A;  1OTC A;  4MV1 A;  4J8Q A;  5IT9 L;  4GNX B;  4DR7 L;  2IA6 A;  4E4T A;  2ZM6 Q;  1B04 A;  1DD2 A;  1BJT A;  3VDY A;  3HOU G;  4CDC C;  4G7O C;  5IE8 A;  1BBW A;  2JK8 A;  2NZH A;  1JE5 A;  3HKS A;  4ZK9 B;  4UHV A;  4FF2 A;  3AQQ A;  1EWC A;  4EG0 A;  2J9G A;  1EL0 A;  2D62 A;  5EJW A;  4LSA A;  2HT1 A;  3QB3 A;  1WD1 A;  3WDN A;  3T1Y Q;  1IBK L;  3PIP 3;  4DL2 A;  4KTA A;  4Y52 H;  1S0O A;  1OXU A;  3S16 H;  4JV5 L;  2JA5 B;  2L55 A;  3VR3 A;  2SCU B;  3OSP A;  3UDG A;  3I4N H;  2OH2 A;  2RSO A;  2FK3 A;  2OTL A;  3PO3 G;  4C2M A;  2JA6 B;  5KND A;  3SI8 A;  5KX5 F;  1AUV A;  3CF5 A;  3M4O H;  1SMY C;  1VQA A;  2R92 H;  3RAX A;  3D8G A;  2R87 A;  2AUK A;  2J6T A;  1M6V A;  3MA2 B;  5CV4 A;  5JVH 3;  4ECY A;  1YI2 A;  3GTP H;  4B3T Q;  3IN5 A;  3D31 A;  1A6X A;  3F1Z A;  1M4V A;  5C5J A;  4NMZ A;  4A3F H;  3W2D A;  3G71 A;  1ZXT A;  4LMQ D;  1J6Q A;  3BYT B;  4HTH A;  3GTG A;  3L7Z C;  3I4M H;  4IOA A;  4FM9 A;  1UEB A;  4ME3 A;  4BY7 B;  1G2T A;  1GKH A;  3KDF A;  4JI2 Q;  3K58 A;  4LMY A;  1AEX A;  4QIW A;  1KLU D;  1Y1V G;  5IYD G;  1EFI D;  3MTS A;  4OON A;  1IHZ A;  3HOX B;  3QZ8 A;  1HUN A;  2RHS B;  2IHF A;  4JI3 L;  5A2Q L;  3TII A;  3PUY A;  4JUZ A;  1TY0 A;  3NBH A;  3SXH A;  3V96 A;  3GID A;  5LA6 F;  4OXP A;  4Q8F A;  3KJP A;  3GTM H;  4RUC A;  4KK7 A;  4DAV A;  1KRT A;  4DUZ H;  3QWN A;  2K14 A;  2RDG A;  5I9P A;  5KT7 A;  1A3V A;  4QY7 A;  2ZXP A;  1N33 Q;  2XIW A;  2VQD A;  1FNV A;  4ZQ3 A;  3BVG A;  1I6V C;  4JC0 A;  1LT5 D;  4YCW A;  3E5N A;  5EOY A;  4QWC A;  5L1K A;  4GKJ Q;  1TQO A;  2NB0 A;  3DM1 A;  1VQB A;  1ONL A;  5JJK A;  1C7Y A;  1S68 A;  2M9V A;  4X3K A;  3HOU B;  2E2H H;  4B3S L;  1MGS A;  4YBZ B;  5I6W A;  4RAY A;  3NEN A;  2E8G A;  3FDS A;  3VPD A;  2K28 A;  2GLT A;  3CQZ H;  4DNR B;  2PO4 A;  3PUV A;  3E3X A;  2Z4I A;  3H94 A;  1X3G A;  1J5E H;  2L15 A;  4MAM A;  4ZKB B;  2N88 A;  4O0A A;  1MIU A;  4GN4 B;  1O80 A;  2E75 C;  3JAM i;  2DUD A;  3J81 i;  4J0M A;  1MBY A;  4CJ1 B;  4DL4 A;  3M7G A;  2NZO A;  3GIL A;  3S1Q H;  5KG3 A;  2XCP A;  4RNM A;  5M3M G;  4TQS A;  4PMB A;  1N36 L;  5C8Y F;  2X69 A;  1M90 C;  4Y7N H;  3S2D B;  3KAK A;  4MV3 A;  1ASZ A;  1BBU A;  4HMJ A;  1A0I A;  4R4O A;  3UE0 A;  1QJO A;  5J39 A;  3RIZ A;  4IWX A;  2BOS A;  1JX4 A;  5KFX A;  3KF6 A;  3Q8R B;  2AU0 A;  3OSN A;  5F9L A;  5T14 A;  3D4W A;  1RTO A;  4XYM B;  1O7I A;  2I5H A;  4NB3 A;  4LF8 H;  2XWB B;  5KFN A;  3J7A V;  4ECR A;  4RHS A;  2NTT A;  1CQI B;  2HQE A;  3VYR A;  2WAQ E;  4KD3 A;  3IG0 A;  4IAL A;  4DK6 C;  2ZDG A;  1ENF A;  2EY1 A;  4JI8 H;  4DV1 Q;  2L4N A;  4M9U A;  4DV0 H;  1IL8 A;  1O75 A;  4A75 A;  1KHI A;  4J6H A;  1DV1 A;  4K2K A;  1W3S A;  4DV7 L;  4HJA A;  1SYX B;  2HHH H;  1VS0 A;  1MI2 A;  1Y1V B;  4TSS A;  2UXD H;  3CCL A;  4C5A A;  4BBR B;  3VYS A;  4DR1 Q;  2GPW A;  4LNQ A;  2EXD A;  4YY3 H;  2K4K A;  2UXC L;  3C46 A;  5AJ3 Q;  2F0S A;  5KNB A;  1XYI A;  5KFE A;  1E2W A;  2F0T A;  1O7L A;  1Q1B A;  2IX0 A;  5KFJ A;  1ZYR C;  2YU9 A;  4LUV A;  1HNX H;  4KHP H;  2FMA A;  3C1F A;  4IFD J;  3LX0 A;  3OTO L;  3HOY B;  1L1O C;  4FO2 A;  3J80 i;  5IOC A;  2JP1 A;  3FVQ A;  3NWT A;  1PHJ A;  2WYO A;  3RZO H;  3BQ1 A;  3PVX A;  1E2Z A;  2PNH A;  2EYH A;  4ZCK A;  1ICF B;  1AZP A;  1K1Q A;  3QOL A;  1NE3 A;  4IFD H;  1MSG A;  1PXU A;  4YJ3 F;  5FOB B;  4FF3 A;  1UWV A;  2KVM A;  5LMN H;  5KGU A;  4DUZ Q;  2XCL A;  1BR9 A;  1M1K C;  5IYC H;  1B33 N;  2WB1 A;  3I3C A;  5JOB A;  2JA8 B;  4A3M H;  3SDZ A;  1SE8 A;  5IGE A;  3HOZ G;  2JEG A;  4FBU A;  2E2J H;  3CKI B;  3JC6 6;  1HNZ H;  3H3V H;  2V59 A;  2FLN A;  3W1G A;  5J2T F;  1CFM A;  4J9M A;  3CCS A;  5IWA L;  4XYO A;  4A3J H;  1M0W A;  5CC4 A;  3STB D;  3J7Y W;  2K03 A;  2VZA A;  4IUV A;  4RGN A;  1TWC B;  4BXX H;  1HQM C;  1FNU A;  4DV6 H;  3PGZ A;  2R84 A;  1Q7Y C;  1N8R C;  1J5E Q;  2E76 C;  1M7J A;  1VQE A;  1I4P A;  4EQO A;  3NTH A;  5CGK A;  1HZA A;  3RZD B;  5IIF A;  1VDZ A;  2EJF C;  2PMZ E;  4YHH Q;  4LF7 Q;  4IJH A;  4GOP B;  3Q23 A;  1QVC A;  1R9T H;  3KF8 A;  1I4X A;  3UDX A;  4LF4 Q;  3QFF A;  4DAP A;  1EYG A;  2UXB H;  3P1H A;  5EPL A;  1E4E A;  3KUP A;  4DF7 A;  2F1M A;  1NNX A;  2ICE C;  4EX5 A;  4JI6 H;  2VUM A;  4QUF A;  4GKK H;  3E5S A;  3MAQ A;  2BDN A;  3Q24 A;  2K5N A;  4WJW A;  1XWE A;  1C3O A;  2WE6 A;  1BOS A;  1DM0 B;  4RKL A;  4LF8 Q;  3NBI A;  2JQO A;  1O78 A;  3K7U C;  3GTQ B;  2PZT A;  4WRD A;  2YZN A;  3JSN A;  2C2E A;  2LKV A;  3VA7 A;  1ZHQ A;  3ZYY X;  2A74 C;  1KAB A;  2IT1 A;  2NU7 B;  5BMV F;  2GPS A;  1WSC A;  4Q44 A;  2L1B A;  4AYB A;  4JI8 Q;  1CI3 M;  5EGT A;  3F8T A;  1B70 B;  3B6Y A;  3DHQ A;  2X6G A;  4TQU S;  4WOR A;  1H9R A;  3N42 B;  3GTO H;  1VQC A;  5JJI A;  1UC9 A;  5FPO A;  3Q1K A;  3HEJ A;  2ASB A;  1RJT A;  1C30 A;  2HHH Q;  1HRJ A;  3MR2 A;  4GC6 A;  4I7A A;  1AN7 A;  4A3C H;  4R8N A;  2DZD A;  4X64 L;  3DXJ C;  4YY3 Q;  4MV4 A;  2MJ8 A;  4O4I F;  1SFO A;  4PZ6 A;  1I7N A;  2MGS A;  3FKI H;  4HR7 A;  3OUU A;  4TV8 F;  4DR5 H;  2R86 A;  4IPC A;  1Q81 C;  2R6F A;  2EVB A;  4BY7 H;  3E9I A;  2R7Z H;  4ZOL F;  3GV6 A;  1GD7 A;  1Q90 A;  2DPJ A;  5FD5 A;  1RCV D;  3TEH B;  3U9O A;  3J81 W;  1E3P A;  2EYJ A;  2F0I A;  3HP3 A;  3JAM c;  4KHP Q;  1PRT B;  5J2U F;  5KT6 A;  3GIM A;  1CHQ D;  4ECV A;  1SYC A;  3U9S A;  2EOT A;  3S1M B;  3M4Y A;  2MUY A;  3M3Y H;  5KFO A;  3KTM A;  3I72 A;  5GQO A;  2VB3 X;  3QG1 A;  1G6P A;  3ERS X;  3AYH B;  3A7L A;  4QUC A;  2RCF A;  1LLR D;  2A69 C;  1PH5 A;  3D6C A;  1W96 A;  2QK4 A;  4ED3 A;  1E1O A;  5LMN Q;  5EBC A;  4MA5 A;  1JDE A;  3TQT A;  4IUN A;  1H9M A;  3BZD B;  3HKZ G;  4ECS A;  2ZT9 C;  1B7Y B;  3F2B A;  1KJ9 A;  1HNZ Q;  2NBF A;  4LK1 C;  4UDU C;  2JE6 I;  3JZI A;  1AUX A;  1N32 L;  1XMQ L;  2FKL A;  4WFN 3;  3M9B A;  2UUB L;  4O3O A;  4O3R A;  1S5B D;  3HOU H;  1QUQ A;  4YR2 A;  3H40 A;  4ED0 A;  2QCP X;  2C35 B;  1F2M A;  1LTS D;  1STY A;  3EIV A;  1Z47 A;  1FYC A;  3JAM E;  2VUG A;  1MKH A;  1MSH A;  2Z4H A;  3J81 E;  4DV6 Q;  3TQ1 A;  4QL5 A;  4BA1 I;  1MJE A;  4OWX B;  1LT3 D;  1RK5 A;  1U4M A;  3PCO B;  5EKL A;  1B2T A;  3DMU A;  2AUJ D;  4DXG A;  1YNX A;  1HJP A;  3NTK A;  5LMU L;  1VCI A;  1Q8I A;  4IUR A;  4IOC A;  1IBM L;  2B63 G;  3PO3 H;  4FF4 A;  2PCF B;  4U67 3;  2HUG A;  2M05 A;  1SNQ A;  4L5S A;  4TV9 F;  3F2D A;  3I4L A;  4K8J A;  5KIX A;  1TII D;  1UUP A;  3S2D H;  2R61 A;  2UXB Q;  5T1I A;  5CA1 F;  2ATL A;  4DR6 H;  2A19 A;  3EN2 A;  4CKE A;  3CC2 A;  4DGZ A;  4JI6 Q;  4YCU A;  1VBH A;  3F2U A;  1STH A;  4GKK Q;  2RDH A;  1WCM G;  3RUP A;  4C3H G;  4L1K A;  1Y1W A;  1TKW B;  3J80 W;  1ESR A;  3FEW X;  5A35 A;  2YCH A;  1VQD A;  3J81 j;  2LS0 1;  4N9P A;  2FPI B;  4UP9 A;  2MQH A;  2B8F A;  3C1E A;  3NK9 A;  5LL6 b;  3TZU A;  3OW7 A;  5KG2 A;  1WTW A;  2Y0S E;  1A8V A;  5M5X B;  5K36 G;  4O2B F;  4NXM H;  1P16 A;  2NN6 I;  3TRZ A;  3PW4 A;  2L12 A;  5M5W B;  5DQI A;  3I4O A;  5K5P A;  4U6P A;  2DPI A;  1EYA A;  4ED2 A;  2SDF A;  4RH6 A;  4F4Z A;  3T13 A;  1YNN D;  5C3W A;  1WD0 A;  3U4V A;  1JJC B;  1HR0 W;  4MTE A;  4P71 A;  4YR0 A;  1PLF A;  2YZM A;  4PZ8 A;  1Y1V H;  1SXT A;  5IYD H;  1WTQ A;  2MCT A;  4AQY H;  1SRU A;  4P74 A;  4JI7 L;  2B8G A;  1I3Q B;  4KI0 A;  4DR5 Q;  1IKL A;  1XNR L;  1PYB A;  3EJI A;  1PVO A;  3J80 E;  2R7M A;  1H9S B;  4GLA C;  3U58 A;  2JJQ A;  5D8D A;  1FJG L;  1HCZ A;  1OXS C;  4DV2 H;  1TWA B;  3G48 A;  3HKZ B;  1I50 A;  1RJR A;  2F4I A;  1KJ8 A;  3BA9 A;  3MR6 A;  2JEJ A;  1P8L A;  1J9O A;  1IOV A;  2NVY B;  2WV6 D;  1GO3 E;  4QQB X;  2VL6 A;  1BCP D;  2B2V C;  3PO2 B;  2IJ0 A;  2R8G A;  4FDB A;  3BDC A;  3RD4 A;  1ZHS A;  1WTO A;  2W70 A;  1NY4 A;  4ID6 A;  1PFB A;  2KCC A;  3MHB A;  2XNA C;  4A3D G;  5DGA A;  1K8M A;  2CQA A;  3TP8 A;  1KD1 C;  1EY6 A;  5C4X B;  1VKZ A;  2WAQ A;  4DR2 H;  2B63 B;  2W7O A;  2B2Y A;  5M3M H;  2FK1 A;  5BN4 A;  1ZYR D;  2M2L A;  3QIA A;  5CR3 A;  4PNY A;  2W8L A;  2EE1 A;  2HIX A;  3I56 A;  4TUY F;  4TRD A;  3RZD H;  2IP4 A;  1WI5 A;  3G6V A;  1NTG A;  4C3H B;  1H9J A;  2C22 A;  1U5K A;  4JI4 L;  2HD3 A;  5E4W C;  4LW1 A;  1PTO H;  3CCU A;  2FXQ A;  2OXP A;  3MEF A;  2E5L L;  5FLX c;  1EZ8 A;  3HOV B;  4R8U B;  4JI1 L;  2FFK B;  1T9H A;  4LFC H;  3WWV A;  4H02 A;  4M1U B;  1JOQ A;  1Z2N X;  1PZI D;  1XTD A;  4IWY A;  4R4I A;  1X3Q A;  1VQ9 A;  2EDG A;  1C9O A;  3VYU A;  3PUX A;  1DCZ A;  1EYD A;  1I4Q A;  1HZB A;  3NQT A;  2PYK A;  5T1G A;  2NN6 G;  1S97 A;  4HAE A;  3V2T A;  1JOK A;  4IAJ A;  1N34 H;  3RB0 A;  3UI2 A;  3MWY W;  2HCC A;  3QR8 A;  4NXM Q;  2VQE L;  4RB2 C;  2TMP A;  2UU9 L;  4OX9 Q;  2B2V A;  2F0Q A;  1LO5 D;  4LF5 H;  4DU9 A;  1V1P B;  4RAZ A;  4R4T A;  4LFA L;  3RJ0 A;  4HCE A;  4QCL A;  5KFL A;  3IAY A;  2F0O A;  1HFG A;  3SR1 A;  1Q82 C;  2ZM6 H;  2B2U C;  2OWO A;  2C28 A;  4JYA H;  2R8H A;  4HIK A;  4AQY Q;  3A8I E;  3FMC A;  1PZJ D;  1I6H H;  1VF5 C;  2IW3 A;  1SNO A;  1Y69 U;  1XXG A;  3JSL A;  2XRQ D;  2RBM A;  3F8N A;  1W6K A;  1GUG A;  5KG1 A;  3BQ0 A;  1A63 A;  1CKN A;  4MTN A;  3R93 A;  3CC7 A;  1V51 A;  4X62 H;  3S1M H;  3HOZ H;  1XMO Q;  4Q0F A;  1TWG H;  3PUW A;  1A2U A;  1CSP A;  3CU7 A;  2Q8R E;  3VA5 A;  5KG7 A;  1TWF H;  2AGO A;  2IL8 A;  4DUY H;  2R92 A;  4DFA A;  3ER0 A;  2JA5 G;  1NCV A;  1SBB B;  1G8Z D;  2I07 B;  4OIK A;  4L5R C;  4RG1 A;  1JJ2 A;  2JA6 G;  4X3U A;  5CV5 A;  4I55 F;  5KG6 A;  4LFB L;  5I47 A;  2EYM A;  1TT2 A;  4N8X 1;  2BH2 A;  4LH6 A;  4OWT B;  5LYJ F;  4PDB A;  3TP6 A;  4C2M B;  5KFZ A;  4DR2 Q;  1KQS A;  2OTJ A;  4A3K B;  1LAB A;  4KHZ A;  3U4Z A;  3T51 B;  2EPB A;  4I65 A;  3NEL A;  3DWQ A;  3AB9 A;  1GJX A;  4I7H A;  4RHR A;  4O4H F;  2H4O A;  2ZJR A;  4YJ2 F;  2BE5 C;  1XX8 A;  4DN4 M;  4B08 A;  2KHS A;  1IBL H;  1TS2 A;  4DR3 H;  1UAP A;  3V4Z A;  1DIK A;  1GVP A;  2ZDH A;  2B2U A;  1NAP A;  5GON F;  5BPF A;  1EIG A;  1GOZ A;  1U4R A;  1DON A;  3T5J A;  3BQ2 A;  3HOW B;  1PRT F;  2ALY B;  4DV3 Q;  4BBS G;  4IRK A;  3SK4 A;  4LFC Q;  3PMF A;  2K52 A;  3IFT A;  3V6H A;  5G3L D;  3HOX G;  2W9B A;  5CBE E;  3I8Z A;  1N33 H;  1PFS A;  3OHB A;  1VQ8 A;  1PFM A;  5KFI A;  3KBX A;  2XIG A;  4QIW B;  5FO9 B;  4CKB A;  1B1Z A;  4DNI A;  1GUN A;  4GKJ H;  4X3S A;  4K6L A;  3RBD A;  3TSS A;  5LL6 S;  2Q8I B;  5CV7 A;  2QW7 A;  1N34 Q;  4DLK A;  2E2H A;  3GV7 B;  3BS1 A;  3V4S A;  2A1A A;  2RA4 A;  3H0G G;  1GSA A;  3T5H A;  4LF5 Q;  4RA8 A;  1NBW A;  4L8J A;  4A3L G;  2VQF Q;  4JYA Q;  4JBM A;  2AKW B;  3TIN A;  4C3I B;  1EWH A;  3HS0 C;  1I3Q H;  4MZ9 A;  3NGD A;  4DK0 A;  4OHJ A;  1VQ5 A;  4WJ3 M;  1NMG A;  3OWE B;  4MV7 A;  3GTK H;  4A3I G;  2ICI A;  3DF7 A;  3FHW A;  3N44 B;  5C1O A;  4KY7 A;  5JPN C;  3F2C A;  5CB4 F;  2JN4 A;  2F0D A;  2WB1 G;  4UPA A;  4LJZ C;  5DAU A;  2PZW A;  5C44 B;  3H3V C;  5CV8 A;  2PI2 A;  4MN3 A;  1Y8N B;  4OEL B;  2Z6K C;  1TWA H;  3DEO A;  4X62 Q;  4DR7 H;  5CMD A;  5IOD A;  4MTK A;  4I50 F;  4DXF A;  5LHY 1;  1KL9 A;  1HZ9 A;  1XJV A;  3IKJ A;  4P72 A;  3RGX A;  2FK2 A;  4CKC A;  2Z6B A;  2PBZ A;  1N9W A;  3PV0 A;  3JRX A;  1XPR A;  5IP9 G;  2HGS A;  4DUY Q;  3K81 C;  2W9A A;  5DQG A;  1JB3 A;  3TDQ A;  4AIM A;  3LGJ A;  3NSW A;  3ICE A;  5C4J B;  1MD2 D;  4EFE A;  5E3F A;  2CZG A;  4DV1 H;  3MXP A;  2NVX H;  4F4W A;  5HBR B;  2GN5 A;  3N43 B;  4B3R H;  2F4V L;  3KF6 B;  2F0U A;  3D3R A;  3MJF A;  2UVR A;  2Y0S A;  2VPQ A;  2C9O A;  1LAC A;  2B63 H;  4DR1 H;  3NXW A;  4S3S A;  5KKN B;  3MVV A;  2W6M A;  2XGP A;  4IJL A;  3W5O A;  4POG A;  5AJ3 L;  3VR2 A;  5L37 A;  4I7Z C;  1QZH A;  2VUM G;  1ESF A;  1C8C A;  2C2D A;  4F88 A;  1YEZ A;  1RYS A;  5C0X I;  4BBS B;  4YAK B;  5C5L A;  1WTP A;  2CCZ A;  2Q2T A;  1IYJ B;  1WCM H;  1SEB D;  4BBR G;  4C3H H;  2ZTC A;  3EA6 A;  4AH6 A;  2RKS A;  3RV3 A;  1IBL Q;  1PV4 A;  4ECT A;  1ET6 A;  2ASL A;  4R9W A;  4DR3 Q;  4O3Q A;  2KBN A;  1PH9 A;  4DV4 L;  2F0N A; 
#chains in the Genus database with same CATH homology
 1HZA A;  4J15 A;  2OQK A;  2WB1 E;  4B3T L;  2R7F A;  1I94 L;  1E22 A;  3GDE A;  4IFD I;  3HOY G;  2PMZ E;  4YHH Q;  4LF7 Q;  2KEN A;  4R1J A;  4IJH A;  4JI5 Q;  3W1B A;  2AMC B;  5GAD C;  4GOP B;  1EOV A;  1QVC A;  1R9T H;  4B3M L;  1BVS A;  3UDX A;  4LF4 Q;  3KLW A;  1EYG A;  4L5Q A;  1EFW A;  1XMO L;  1AE3 A;  2Z6K A;  3CXC A;  3H3V I;  4EX5 A;  1YVC A;  3KYH C;  1HNW L;  1Z9F A;  3UDI A;  3E0E A;  1JT8 A;  4JI2 L;  4DR4 Q;  1SFO H;  2K5N A;  3GTJ H;  4IO9 A;  4BY1 H;  2JA8 G;  2MO0 A;  2PQA A;  2JA9 A;  4LF8 Q;  2JQO A;  2MO1 A;  3K7U C;  1IL2 A;  1J5E L;  4EQ5 A;  3RN2 A;  1VQ4 A;  2IT1 A;  3CME A;  5H1S E;  1VQM A;  1S72 A;  2UUA L;  3STB C;  5M3F H;  4JI8 Q;  1JMC A;  4R4Q A;  4DR2 L;  3F8T A;  1B70 B;  3B6Y A;  4TQU S;  1N33 L;  1PH3 A;  3KDF B;  3GTO H;  1VQC A;  4LUZ A;  3BZK A;  5GRO A;  5JJI A;  1YJN A;  2ASB A;  1LYL A;  2HHH Q;  1X6O A;  3M85 A;  1FVI A;  4JI4 Q;  4A3C H;  4GKJ L;  3H15 A;  3AFP A;  1X56 A;  2JEB I;  3K80 C;  1L2F A;  4X64 L;  4YY3 Q;  5M5X H;  4DR7 Q;  4PZ6 A;  5HY6 A;  2E5L Q;  3FKI H;  4HJ7 A;  5M5W H;  3NBH B;  3RLN A;  1JJG A;  3OW2 A;  1DGS A;  1XMQ Q;  4IPC A;  1Q81 C;  4A3D H;  1N32 Q;  4JI1 Q;  1K8A C;  3E9I A;  4LF8 L;  2R7Z H;  4BY7 H;  1GD7 A;  1MJC A;  5GAG C;  4K0K L;  3AFQ A;  2N78 A;  3TEH B;  1QVF A;  1E3P A;  2CFM A;  3JAM c;  4KHP Q;  4YWM A;  1EQR A;  1UE1 A;  4YWK A;  1SRO A;  3KF8 B;  3SGI A;  4JG2 A;  4DV3 L;  2QGQ A;  4LFC L;  3M3Y H;  5BR8 Q;  1IBK Q;  5GQO A;  1AH9 A;  1G6P A;  3PF5 A;  4NXN Q;  1VQ7 A;  1WFQ A;  1FGU A;  3AYH B;  3ERS X;  4DV0 L;  1GM5 A;  4JOI C;  4B3R Q;  1PH5 A;  2VQE Q;  2KCM A;  2Y0S G;  1E1O A;  3CCV A;  2I5L X;  5LMN Q;  1WOC A;  4C2M H;  5LMU Q;  1D7Q A;  2HHH L;  2UU9 Q;  2UXD L;  2PQA B;  3HKZ G;  4LFA Q;  4BA2 I;  1B7Y B;  3F2B A;  1TWH H;  2R6G A;  1N34 L;  3MXN B;  4X66 Q;  2HQL A;  3K7A H;  1VQO A;  5C0X G;  1PYS B;  2JE6 I;  4APV A;  3RN5 A;  4MNO A;  1QVG A;  4DR6 Q;  4TVA B;  1KAW A;  5IP7 H;  1XMQ L;  3M9B A;  2NVY H;  2UUB L;  1U0L A;  1N32 L;  1Y1W G;  3I2Z A;  3HOU H;  1QUQ A;  3KOJ A;  3PO2 H;  2C35 B;  2VQF L;  3EIV A;  1WYD A;  1YBY A;  4GNX C;  1HNX L;  4KHP L;  5IYB H;  3RR5 A;  1VQL A;  1Z47 A;  3T1H L;  1MKH A;  1PH4 A;  2YYZ A;  4DV6 Q;  4QL5 A;  5BR8 L;  1AE2 A;  4BA1 I;  3S1N H;  1MJE A;  4OWX B;  4DV1 L;  2Z0S A;  4IFD G;  3PCO B;  4JBJ A;  4OWW B;  4B3R L;  1E1T A;  3PUZ A;  1FL0 A;  3PIO A;  3G4S A;  1YNX A;  1HJP A;  5LMU L;  5LMN L;  1VCI A;  5C4X H;  1X3F A;  3ULJ A;  5IYC G;  4IOC A;  1KC8 C;  1SMX A;  4A3M G;  1IBM L;  4LF6 L;  3S15 H;  3PO3 H;  3E9H A;  4DR1 L;  5JEA J;  2MNA A;  4L5S A;  2RHQ B;  3F2D A;  3KFU A;  4QJF A;  3PSI A;  3TS0 A;  1ASY A;  1YHQ A;  3S2D H;  2UXB Q;  1HNZ L;  2CWA A;  2A19 A;  3EN2 A;  3CC2 A;  4JI3 Q;  2JA7 G;  4JI6 Q;  4YCU A;  4GKK Q;  1WCM G;  4A3J G;  5DLQ E;  4A3G G;  2CWP A;  4IPH A;  4X65 L;  4LFB Q;  2RF4 A;  2LSS A;  4DUY L;  2R93 H;  4BXX G;  4HID A;  3M4P A;  2NVT H;  1YJW A;  1VQD A;  3J81 j;  3M4Q A;  4UY8 C;  4UP9 A;  3UDF A;  1YJ9 A;  2MQH A;  2YTX A;  2Y0S E;  4DV2 Q;  1A8V A;  2OQ0 A;  4IPG A;  5IY0 A;  5FLM H;  3HOV H;  5K36 G;  1I50 H;  1P16 A;  2NN6 I;  4AYB G;  3CPW A;  3HKZ E;  2VS1 A;  1EQQ A;  3TRZ A;  3I4O A;  2EIF A;  4JOI A;  4DUZ L;  3CPF A;  1Q46 A;  3G6E A;  4PZ7 A;  3J7Z C;  5E7N A;  1TXY A;  1PH8 A;  4B3S Q;  2EQS A;  1JJC B;  3U4V A;  1QUQ B;  1HR0 W;  4P71 A;  2F52 A;  4POF A;  1QZG A;  4PZ8 A;  1Y1V H;  5IYD H;  2YTV A;  4A76 A;  1S40 A;  1K9M C;  2JA5 H;  1YIT A;  4JI6 L;  4A93 H;  1SRU A;  4P74 A;  5C3E H;  4JI7 L;  4BY1 G;  1HH2 P;  1PH6 A;  2JA6 H;  1V43 A;  2UUC Q;  1K3R A;  4KI0 A;  1SR3 A;  4DR5 Q;  1VQJ A;  1XNR L;  3S1R H;  1HZC A;  1PYB A;  1IBL L;  3TS2 A;  1PVO A;  2GVA A;  4GNX A;  4GLA C;  4DR3 L;  3U58 A;  2JJQ A;  1EIF A;  3TQY A;  1NJI C;  1FJG L;  1L1O A;  3M7N A;  2K5H A;  3S14 H;  1OXS C;  2WFW A;  2A8V A;  1N36 Q;  1CSQ A;  1XNQ Q;  4A3B H;  2B3G A;  3G48 A;  5M3F G;  5JJL A;  2AWO A;  1X54 A;  4UP7 A;  1P8L A;  2LXK A;  1G51 A;  4YHH L;  3CCR A;  1LUZ A;  4JI5 L;  2N8N A;  4LF7 L;  3K0X A;  4O2D A;  1GO3 E;  2I0Q A;  4QQB X;  2VL6 A;  4GOP C;  4NPS A;  3I55 A;  4LUO A;  4A4I A;  4LF4 L;  4YWL A;  4A3C G;  2VY3 A;  4FDB A;  4GLV B;  1L0W A;  2D0P A;  4HJ9 A;  1XPO A;  5GAH C;  2F3I A;  1NY4 A;  3FKI G;  4DR4 L;  1X9N A;  4A3D G;  1D8L A;  4RMF A;  4BY7 G;  5FJ8 H;  4HJ5 A;  2UUC L;  3EBE A;  4KLK A;  2MFI A;  2R7Z G;  5C4X G;  1KD1 C;  4WJ4 A;  4JBK A;  1IZ6 A;  1NMF A;  4BBS H;  2Q2I A;  2KHJ A;  4ALP A;  1HNZ Q;  2GVB A;  3Q8D A;  3J81 c;  4AYB E;  3HOX H;  4GS3 A;  1W2B A;  5M3M H;  4DV7 Q;  3OYY A;  4DV5 Q;  1Q1E A;  1VQP A;  2K75 A;  4JI8 L;  3RLO A;  1SLJ A;  3TRE A;  4DAY B;  4JV5 Q;  2BH8 A;  1X55 A;  2IX1 A;  2UXC Q;  1X3E A;  2HIX A;  1UE7 A;  3I56 A;  3GO5 A;  3RZD H;  3A5Z B;  1Q86 C;  1XPU A;  1WI5 A;  1K83 H;  1NTG A;  1OTC A;  1U5K A;  1EUJ A;  4JI4 L;  3H0G H;  4LW1 A;  3CCU A;  4A3K H;  4GNX B;  2FXQ A;  4YY3 L;  2RCN A;  2YU9 H;  4DR7 L;  3MEF A;  2E5L L;  1L1O B;  2ZM6 Q;  1E7Z A;  5IP7 G;  3OTO Q;  4A3L H;  5FLX c;  3VDY A;  3HOU G;  1A62 A;  3PO2 G;  1Y14 B;  4JI1 L;  1T9H A;  3WWV A;  5IE8 A;  1BBW A;  4H02 A;  5IYB G;  1XTD A;  2JK8 A;  2NZH A;  3KJO A;  1JE5 A;  3HKS A;  4R4I A;  1VQ9 A;  3AQQ A;  1C9O A;  3CCJ A;  1HR0 Q;  1KIX A;  3AEV A;  2F4V Q;  3PUX A;  2D62 A;  2LXJ A;  1HZB A;  4A3I H;  2HT1 A;  4XTC S;  3T1Y Q;  1IBK L;  2NN6 G;  4NXN L;  5IT9 c;  4Y52 H;  1OXU A;  3S16 H;  4JV5 L;  1IXR A;  5EAY A;  3CD6 A;  1VQ6 A;  2N3S A;  2ZTD A;  3UDG A;  3GTG H;  1PH2 A;  3HOW H;  3I4N H;  2H5X A;  2OTL A;  3PO3 G;  4P73 A;  4NXM Q;  2VQE L;  3DM3 A;  4IPD A;  1VQG A;  2UU9 L;  4OX9 Q;  1YIJ A;  1V1Q A;  4R4T A;  4LFA L;  3CF5 A;  5ELO A;  3M4O H;  3CCQ A;  3FP9 A;  1VQA A;  3BJU A;  2R92 H;  4X66 L;  1Q82 C;  1KXL A;  2OWO A;  5IP9 H;  4DR6 L;  1VQF A;  3ULL A;  4HIK A;  4AQY Q;  2OCE A;  5JEA G;  2JEA I;  1I5F A;  1LM0 A;  4DV4 Q;  1I6H H;  2R93 G;  4LWC A;  2DGY A;  2R7D A;  4A3E H;  1HR0 L;  3J80 c;  1YI2 A;  3GTP H;  4B3T Q;  3D31 A;  3F1Z A;  3HFZ B;  4JCV E;  4DV6 L;  4A3F H;  1A63 A;  3G71 A;  1CKN A;  4MTN A;  5FLM G;  3A5U A;  3HOV G;  4B3M Q;  3CMA A;  1J6Q A;  3CC7 A;  3L7Z C;  3S1M H;  3I4M H;  3CCE A;  4IOA A;  3CP0 A;  3A74 A;  4C3I H;  3HOZ H;  1XMO Q;  1TWG H;  3PUW A;  1CSP A;  1UEB A;  1V9P A;  4ME3 A;  3RNU A;  2VUM H;  2ZTE A;  3K8A A;  1GKH A;  3KDF A;  4JI2 Q;  1TWF H;  2Q2H A;  1Y1V G;  5IYD G;  4OON A;  3ER0 A;  2JA5 G;  2UXB L;  4A93 G;  1VQK A;  5C3E G;  3BZC A;  2CQO A;  5C44 H;  2RHS B;  2IHF A;  4BBR H;  4JI3 L;  5M5Y H;  2ZJP A;  4JBW A;  4AQY L;  5HGQ A;  3PUY A;  4L5R C;  1VQN A;  4RG1 A;  1JJ2 A;  2JA6 G;  4GKK L;  3J7A 5;  4DAM A;  1CKM A;  3CC4 A;  4LFB L;  4OXP A;  2BH2 A;  3KJP A;  3GTM H;  3S24 A;  2UUA Q;  4OWT B;  4UP8 A;  1KRT A;  2WAQ G;  1OXV A;  1JB7 A;  2K14 A;  2XGT A;  4DR2 Q;  4A3B G;  1KQS A;  2I5M X;  2OTJ A;  1N33 Q;  4QY7 A;  3HOY H;  4KHZ A;  3U4Z A;  4DV2 L;  3NEL A;  1CUK A;  4JC0 A;  4YCW A;  3D0F A;  4QIW E;  1X65 A;  5C4J H;  4JI0 Q;  4GKJ Q;  1YHA A;  4DK3 C;  1G29 1;  1VQB A;  4X64 Q;  2ZJR A;  3CCM A;  1C7Y A;  5JJK A;  4P75 A;  2E2H H;  4B3S L;  4OO1 I;  3NEM A;  5ELN A;  4LF9 Q;  2YTY A;  2Q2T A;  1Q8K A;  3NEN A;  2K50 A;  2E8G A;  3CQZ H;  2JA8 H;  2AWN A;  2VNU D;  2B29 A;  1GVP A;  3PUV A;  5GAE C;  3S17 H;  4K0K Q;  1X3G A;  4GN5 A;  5FJ8 G;  1UE6 A;  2L15 A;  1CKN B;  4O0A A;  1MIU A;  4GN4 B;  1YHB A;  3JAM i;  2DUD A;  4HIM A;  4DR5 L;  3J81 i;  2BA1 A;  4BBS G;  2ALY B;  4DV3 Q;  2NVQ H;  4DPG A;  4LFC Q;  2NZO A;  2K52 A;  2IHE A;  3S1Q H;  2ATW A;  3HOX G;  2BA0 A;  1LTL A;  4DV0 Q;  2XTI A;  1PFS A;  5M3M G;  2KHI A;  1N36 L;  1VQ8 A;  1XNQ L;  1M90 C;  1TWC H;  1RIP A;  4Y7N H;  2VW9 A;  1ASZ A;  4JI0 L;  1BBU A;  4DNI A;  1BKB A;  1A0I A;  2UXD Q;  4R4O A;  3UE0 A;  4PG3 A;  4HIO A;  2QEX A;  1N34 Q;  3KF6 A;  1KRS A;  2K5V A;  3ZJY C;  2A1A A;  4GLX A;  4LF9 L;  3H0G G;  4A3K G;  1O7I A;  2I5H A;  2UUB Q;  4NB3 A;  4LF5 Q;  2IY5 B;  3IRB A;  1NBW A;  4A3L G;  2VQF Q;  1HNX Q;  4DKA C;  1CKO A;  4XIG S;  4R4C A;  1EIY B;  4YCV A;  2WAQ E;  3CW2 C;  3T1H Q;  4JYA Q;  4JBM A;  2AKW B;  1K0R A;  2AHO B;  4DK6 C;  2YV5 A;  1I3Q H;  4MZ9 A;  4DV1 Q;  1VQ5 A;  4WJ3 M;  5J3B A;  1NMG A;  1OXX K;  3GTK H;  4A3I G;  4A75 A;  2HIV A;  2ID0 A;  1KHI A;  2V1C C;  3FHW A;  3F2C A;  1K73 C;  4GN3 B;  1IBM Q;  1W3S A;  5C0X J;  4DV7 L;  4HJA A;  4UPA A;  1VS0 A;  2WB1 G;  4DV5 L;  1PA6 A;  4LF6 Q;  3CCL A;  3GTQ H;  2D0O A;  3HOW G;  2PI2 A;  4DR1 Q;  3I4N G;  2ES2 A;  2Z6K C;  1TWA H;  2EXD A;  3L0O A;  4LNQ A;  4X62 Q;  2K4K A;  2ZJQ A;  2UXC L;  1VQI A;  5AJ3 Q;  2N49 A;  1SN8 A;  1KL9 A;  1HZ9 A;  1XJV A;  3S2H H;  4P72 A;  1WJJ A;  1EWI A;  1N9W A;  4GOP A;  4LF5 L;  1Q1B A;  3PV0 A;  2IX0 A;  2R92 G;  4LUV A;  5IWA Q;  5IP9 G;  4X65 Q;  1Y1W H;  1XPR A;  4DUY Q;  3K81 C;  2ZM6 L;  4IFD J;  3PIP A;  3OTO L;  2WP8 J;  2CKZ B;  1L1O C;  3BU2 A;  4PMW A;  4JYA L;  3J80 i;  3RLF A;  4AIM A;  3LGJ A;  1VQH A;  3ULP A;  1PHJ A;  3ICE A;  3GTL H;  4A3E G;  1PH7 A;  3RZO H;  3CAM A;  2NVX H;  2PNH A;  2GN5 A;  1UE5 A;  4QGU A;  1NE3 A;  1Q12 A;  2PI2 E;  2F4V L;  4A3F G;  3KF6 B;  1PH1 A;  1I94 Q;  1UWV A;  4DUZ Q;  3T1Y L;  1M1K C;  5IYC H;  2B63 H;  3I4M G;  4A3M H;  1SE8 A;  3UE1 A;  2QA4 A;  3HOZ G;  4X62 L;  1YZ6 A;  2E2J H;  4IJL A;  3W5O A;  3JC6 6;  4POG A;  5AJ3 L;  4NXM L;  3H3V H;  4OO1 G;  1QZH A;  2VUM G;  1E24 A;  4OX9 L;  1HNW Q;  1H95 A;  1OXT A;  1YEZ A;  3W1G A;  4C3J H;  2E2I H;  4X6A H;  2Q2U A;  4JI7 Q;  4L5T A;  2KCT A;  5C0X I;  2JA7 H;  3CCS A;  4HJ8 A;  1K8G A;  5IWA L;  2CCZ A;  3U50 C;  5C44 G;  1IYJ B;  1WCM H;  4BBR G;  4A3J H;  4A3G H;  4C3H H;  2ZTC A;  1XNR Q;  3GD7 A;  3STB D;  4AH6 A;  2VZA A;  3L2P A;  5LMN W;  2B63 G;  1IBL Q;  1PV4 A;  1RL2 A;  1S3O A;  3A0J A;  3DLL A;  3I7F A;  4DR3 Q;  4BXX H;  1B8A A;  2KBN A;  3PGZ A;  4DV4 L;  1Q7Y C;  1N8R C;  1PH9 A;  1J5E Q;  1FJG Q;  3PF4 A;  1C0A A;  1VQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...