1GO3E

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
184
structure length
177
Chain Sequence
MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPEMYELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSYDPKAIIGKETGKVLEIGDYVRARIVAISLKASKIALTMRQPYLGKLEWIEEEKAKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 39
structure length 177
sequence length 184
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1go3E01
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1go3E02
1YZ6A 4IPHA 5IWAL 1NY4A 1PHJA 2VZAA 1TWFH 3GTPH 1JE5A 2KCMA 2UUCL 2IX0A 5AJ3L 4LFCQ 4NB3A 4FDBA 5LMNW 1YI2A 4IJHA 3GDEA 3ER0A 4HJ8A 4A3DG 2YTYA 2JA6G 3AYHB 3HOZG 1D7QA 2EIFA 2UU9L 2UXCL 3MXNB 5M3MG 4A3IH 2VL6A 2UXDQ 2VUMH 1VQEA 3H3VH 2I5LX 3S16H 1X3GA 1I5FA 1A63A 1N8RC 3ICEA 1PYBA 4DV3L 3F2DA 3HFZB 4X64Q 4JBJA 1EIFA 1WFQA 5FLMH 5C0XG 3CF5A 4Y7NH 4A3FG 2KHJA 1QVFA 2LXJA 1KAWA 3J7ZC 4BY7G 2K50A 1CSQA 4DUZQ 3Q8DA 4LF6Q 5M5WH 3RN5A 1P16A 4UPAA 3F2BA 3GO5A 4DR5Q 1HZCA 3I4NG 1K73C 5GADC 1KXLA 1MJCA 4A3GH 4DV7L 2NN6G 1YVCA 3TS0A 2UXBL 1KHIA 1N33Q 4OX9L 4LF9L 3PF5A 3TRZA 2VS1A 4DR6Q 2ZJRA 5GAEC 2NVTH 2KBNA 4JI4Q 4X65Q 4B3MQ 2PMZE 1QZHA 3G4SA 1XTDA 1SFOH 1U5KA 3J80c 2ZJPA 4IO9A 4A3BH 2IHFA 3CAMA 3KF8B 1VCIA 1PYSB 3JAMc 4TVAB 4JV5Q 2CWAA 4R4OA 2KHIA 3IRBA 5BR8Q 1Q82C 2NVXH 3G48A 2AWOA 4LUZA 1WJJA 3J81i 1VQNA 1B70B 4DR3Q 1B8AA 2E5LQ 3PO3G 1TXYA 2R7FA 2RHSB 2YTVA 3STBC 2BA1A 1YBYA 3UDIA 1C9OA 4LFCL 4C3IH 4LF5Q 4R4QA 2HIVA 4LFAQ 1YITA 4DR4L 1IXRA 2PI2E 1K3RA 5IP9H 5IP7G 3GTLH 4X6AH 4A3JG 4A3LH 5GAGC 4X62Q 1OXVA 4IJLA 2FXQA 2CFMA 3G71A 3OYYA 3LGJA 2CCZA 1J6QA 1XNQQ 4GN3B 1IBLQ 1UWVA 4BXXH 3S17H 4PMWA 2NVYH 4A3BG 4QJFA 1NMFA 1VQ7A 4JI6L 3CW2C 4JI0Q 1U0LA 4BBRH 1MJEA 3KF6B 5JJKA 4DR5L 1PH2A 1AE2A 1V43A 1BBUA 4JI1L 1CKMA 1FJGQ 3KDFB 1NTGA 1L1OB 2QEXA 1N33L 3L2PA 5JJLA 2MFIA 2PNHA 4YWMA 3CCUA 4JBWA 5ELOA 2R92H 2R6GA 4NPSA 1HNZQ 2VNUD 2B29A 1A8VA 3PUVA 3HOUG 4KI0A 2MO0A 2N78A 4X65L 4B3TQ 1XPUA 5E7NA 3CMAA 1HNWQ 3U4VA 4A3CH 3D0FA 1CKNA 1DGSA 3EIVA 4XIGS 3NELA 2QA4A 2K5VA 4A75A 1P8LA 2D62A 3CCQA 1W2BA 1WI5A 3CC7A 4EX5A 4GKJL 4B3RQ 4JV5L 4HIDA 2ZM6Q 5BR8L 1N34Q 1UE1A 1V9PA 4IPDA 4DPGA 2KCTA 4YHHL 4KLKA 4JI2Q 5LMUQ 2AMCB 3PIPA 4DR3L 1VQPA 1UE7A 1ASYA 4LNQA 1JT8A 1S72A 1M90C 1AE3A 1JJGA 4HJ5A 3U4ZA 4DNIA 1WCMG 3I4OA 5GROA 4LF5L 4LFAL 1KL9A 4DV4L 3BZCA 1K83H 1A0IA 2ZTEA 4JCVE 4H02A 3RLNA 5JEAJ 3CD6A 3GTMH 2R7ZG 1Q8KA 3CCJA 1XPRA 3ULPA 1Y1WG 2R93H 4K0KQ 2R92G 2ZTDA 5C44H 2ZTCA 5HY6A 2OTJA 1Q46A 1AH9A 3HOYG 1PH3A 1NJIC 4A3CG 2IY5B 1LTLA 1IBLL 2UUAQ 1VQ8A 1L2FA 2JQOA 3HKZE 4JOIA 2CKZB 4UP7A 1YIJA 4JI0L 4GLXA 1QZGA 1NBWA 3TREA 4HJ7A 1LUZA 3A0JA 1GM5A 4MZ9A 1GD7A 3E9IA 3CXCA 2I0QA 1X54A 4DUYL 1QUQB 2JE6I 3OTOL 4YCVA 1TWGH 1FJGL 2PQAA 3S14H 4GOPA 1Z9FA 3HOXG 2Y0SE 1PH4A 2D0OA 4IFDI 1PH7A 1XMQL 3M7NA 3T1HQ 3UDGA 4A3KH 1HZBA 4B3TL 2OQKA 2JA5H 4WJ4A 1VQJA 2DUDA 4JG2A 4UP8A 4GKKQ 4KHZA 1PH1A 3KOJA 2Z6KA 3W1GA 5IYDH 4HJAA 4B3RL 2L15A 4LWCA 4A3EG 1VQOA 1E1OA 2ID0A 1SRUA 4JC0A 2ZJQA 3PO2G 5IYCG 3KLWA 3ZJYC 2VQEQ 3E9HA 4JI2L 5LMUL 3RLFA 3CP0A 3GTGH 4DAYB 4NXMQ 5C0XJ 2Q2IA 4XTCS 2N3SA 4GOPC 4IOAA 4LFBL 1XPOA 3OW2A 1XNRQ 5ELNA 1X56A 1K9MC 1RIPA 3NEMA 4R4CA 1OXTA 3S24A 1EQQA 3S2DH 1CUKA 1CKOA 4A93H 5C4JH 4LW1A 1SE8A 3CCSA 3AEVA 4BBSH 5FLXc 4YWKA 2RHQB 2I5MX 2A1AA 4POFA 1KIXA 3ULLA 4EQ5A 4ME3A 1YEZA 2QGQA 4BY1H 4NXNQ 4A3IG 1I3QH 3CCVA 2WB1E 2VUMG 3D31A 4DV5L 3BU2A 1H95A 5FLMG 4C2MH 1VQ6A 2HQLA 2H5XA 1O7IA 1TWHH 4DV0Q 2JA8H 2PI2A 4DR1Q 5IYBH 3ERSX 3TQYA 3A5ZB 1K8GA 1PFSA 3STBD 5C0XI 2JA7H 3AFQA 3HKZG 3T1HL 2ATWA 3L7ZC 4A3GG 3M4PA 5EAYA 1HZAA 1QVCA 1A62A 4IPGA 1E3PA 3RZOH 4L5SA 1LM0A 3TS2A 4GKKL 2UXDL 4POGA 2V1CC 4JI5Q 2NN6I 2E2IH 2E2JH 1OXUA 4DAMA 3KJOA 2IT1A 1SROA 4YCUA 4C3JH 4P72A 1VQCA 4X64L 3F2CA 4DV1Q 1IBMQ 2KENA 2VQEL 3K0XA 4LF8Q 4OO1I 3CMEA 4AIMA 4MTNA 1I50H 1RL2A 4DUZL 1XNRL 2NVQH 4LF6L 2NZOA 3K7AH 3EN2A 1EUJA 4X66Q 2K14A 4L5TA 2BH8A 1I94Q 1VQDA 3H0GH 2A19A 1HNXQ 3HKSA 4GS3A 5HGQA 4DR6L 3KF6A 3I2ZA 1PH5A 3L0OA 1JJCB 2LXKA 1BKBA 1QVGA 5IP9G 4QIWE 5LMNQ 4A76A 4JI4L 3HOVH 3I4MH 2JA9A 1L0WA 2Q2TA 4B3ML 2F4VQ 3E0EA 2B63H 4A3LG 4A3MH 3KDFA 3B6YA 1L1OA 2DGYA 4NXNL 4BA2I 3H15A 4R1JA 2YU9H 2ALYB 5DLQE 4UP9A 1VQKA 3M4QA 4JI3Q 1I6HH 4WJ3M 2F52A 1HZ9A 2XGTA 2VW9A 2R7DA 4HJ9A 5M3FH 3NENA 5IY0A 4APVA 4BXXG 1YJWA 3HOWH 1KD1C 2Z0SA 4DV0L 4C3HH 4P73A 4GNXB 4P75A 2E5LL 2BA0A 3AQQA 4BBRG 1K8AC 2C35B 2WB1G 3J7A5 4MNOA 2UUCQ 5AJ3Q 2D0PA 2EQSA 3FKIH 4QY7A 4DK6C 5FJ8H 5C4XH 5C3EH 4AYBE 1MIUA 4DK3C 4X62L 3K81C 3KYHC 3PIOA 5IE8A 4JI5L 3CPWA 1Y1VH 2UUBQ 3GTQH 3J81c 1XNQL 1Z47A 4DV1L 1PA6A 2WFWA 4DV3Q 1J5EQ 3DLLA 4TQUS 2HT1A 3I55A 1N32Q 3UE1A 1PH8A 1E24A 5M5XH 1Q7YC 3K7UC 1EFWA 2BH2A 4HIMA 2IHEA 4BA1I 1VQ5A 3J80i 1X65A 3UDXA 3I56A 1X3EA 3VDYA 1SR3A 1R9TH 1BBWA 4A3DH 2JA6H 4OX9Q 2HHHQ 2N49A 1VQLA 4LF9Q 3S15H 3HOZH 5H1SE 1HNZL 5JJIA 2Q2UA 1X3FA 2Q2HA 4GLVB 1BVSA 4OWTB 5M3MH 1HH2P 3A5UA 2F4VL 1QUQA 2K4KA 4DV6Q 1HNWL 2R93G 3UE0A 5C44G 1IYJB 4JBMA 4QL5A 1YHAA 4JOIC 4OXPA 5J3BA 4JI3L 3K8AA 1X55A 3KJPA 4A3FH 2ZM6L 3CCRA 1KRSA 1N34L 3CC2A 4BY7H 3S1NH 3CC4A 3RLOA 1E22A 4GLAC 4LF7Q 1Q1EA 4P74A 1FL0A 3U50C 1VQFA 2B3GA 3I4NH 2OCEA 1YHBA 1X9NA 1MKHA 1VQMA 1KQSA 1EOVA 2RF4A 3S1RH 1WYDA 2GN5A 1G291 1XJVA 1T9HA 1FGUA 1GVPA 4HIOA 4AQYQ 1Q86C 4DR4Q 1YJ9A 1PH6A 4LUVA 1G6PA 3GD7A 4YCWA 3PF4A 4K0KL 1OTCA 2CQOA 2JJQA 3CCMA 2Z6KC 3FHWA 4JYAQ 2UUBL 4A3KG 3DM3A 2JA5G 2WAQE 4QQBX 1HR0Q 2JEBI 3RR5A 1GKHA 4OONA 4OWWB 4Y52H 1X6OA 1J5EL 2UUAL 2NZHA 3TEHB 3FP9A 4YY3Q 5IYDG 3GTKH 1W3SA 1N32L 5K36G 2E8GA 4AYBG 4QGUA 2WP8J 4JI6Q 2YV5A 1JMCA 3PO3H 2VQFQ 3W1BA 4YWLA 2MQHA 4DKAC 1C0AA 2MNAA 1NE3A 2YTXA 4JI1Q 5IP7H 1G51A 1TWAH 4A3JH 2VY3A 2HHHL 1ASZA 4JI7Q 1N9WA 3UDFA 2XTIA 3EBEA 1N36Q 4A93G 4JI8Q 4OO1G 1GO3E 4DV6L 1E7ZA 1S40A 4B3SQ 4P71A 1PV4A 4BBSG 2GVBA 4PZ7A 3M4OH 4DV2Q 1NMGA 2OTLA 3W5OA 2JK8A 4L5RC 4GKJQ 2Y0SG 4LUOA 2JEAI 4BY1G 2K5HA 1M1KC 4LF7L 4KHPQ 4YHHQ 1D8LA 3CCEA 2E2HH 4NXML 3K80C 1YHQA 3G6EA 1JJ2A 4IPCA 3SGIA 5GAHC 2F3IA 2LSSA 3H3VI 4ALPA 3T1YQ 2K5NA 3AFPA 2JA8G 4AQYL 4GN5A 5IYBG 4DV4Q 1IBKQ 4LF4Q 2JA7G 2N8NA 4A4IA 2ASBA 3HOUH 1PVOA 1IL2A 3M9BA 1Q81C 4JYAL 3PUWA 1Q12A 3JC66 3PUZA 1Q1BA 1UEBA 4O2DA 3A74A 1VQIA 1HR0L 2ES2A 1VQAA 3RZDH 1EIYB 4YY3L 3GTOH 3U58A 3PUYA 4DR2Q 1UE5A 3PCOB 1WOCA 1VQ4A 1B7YB 3BZKA 1XMOQ 2VQFL 4DR7Q 4R4TA 2OQ0A 3RNUA 1K0RA 3BJUA 3CPFA 1YJNA 1WCMH 1OXXK 2WAQG 1HJPA 3I7FA 4O0AA 1VS0A 4DR1L 5IWAQ 4DUYQ 1VQ9A 3CQZH 3MEFA 3OTOQ 2IX1A 2R7ZH 3S1MH 1CKNB 3ULJA 4JBKA 4PG3A 1Y1WH 4JI7L 2A8VA 5GQOA 1EWIA 3H0GG 2EXDA 4J15A 1XMQQ 4JI8L 3M85A 1N36L 1HR0W 4GNXA 4B3SL 1KRTA 3HOYH 1L1OC 3NBHB 4GN4B 1SN8A 1TWCH 4RMFA 2YYZA 5M5YH 4DV2L 2UU9Q 2UXCQ 4PZ6A 3HOVG 1S3OA 3I4MG 3J81j 1SLJA 1SMXA 2B63G 1Y14B 4A3MG 2MO1A 4UY8C 3S1QH 2CWPA 1EYGA 1IBML 4KHPL 4HIKA 4LF8L 1VQGA 4IOCA 2AHOB 4IFDG 4R4IA 5M3FG 2K75A 1V1QA 3PGZA 4LFBQ 4OWXB 3HOWG 4IFDJ 5JEAG 3T1YL 3HOXH 4X66L 1E1TA 3S2HH 1PH9A 1IBKL 4LF4L 4GNXC 3JAMi 1I94L 4L5QA 1HNXL 1OXSC 3PV0A 4DV7Q 2UXBQ 1VQHA 1YNXA 2HIXA 3FKIG 2GVAA 1UE6A 5FJ8G 5C4XG 5LMNL 5C3EG 4RG1A 3GTJH 1C7YA 4AH6A 3CCLA 4A3EH 3RN2A 1VQBA 1EQRA 3PO2H 3F8TA 1Y1VG 3PUXA 5IYCH 5IT9c 4DR2L 2I5HA 2PQAB 4DV5Q 4GOPB 3WWVA 2AKWB 2RCNA 1XMOL 2OWOA 1FVIA 4DR7L 3F1ZA 1JB7A 1KC8C 1IZ6A 4PZ8A 1CSPA 1LYLA 3PSIA 2AWNA 3KFUA 2K52A 3M3YH
chains in the Genus database with same CATH superfamily
1YZ6A 4IPHA 2KCCA 5IWAL 4GC6A 2G9DA 3GTPH 4RGNA 2UVRA 2KCMA 1M4VA 1F9SA 5LMNW 1CA5A 4RKLA 4UCSA 4CDCC 3RB4A 4EQOA 4RHSA 1CHPD 3HOZG 4M9UA 2UU9L 3MXNB 2KA7A 4A3IH 2UXDQ 3FEWX 3H3VH 2I5LX 5KEEA 1I5FA 3ICEA 2N88A 1B44D 3F2DA 4JBJA 1EIFA 5BPHA 1PRTF 4N8FA 1LABA 2KHJA 3R3OA 4XQNA 2LXJA 1STNA 3J7ZC 2ZJTA 3Q8DA 1P16A 4DR5Q 3GLKA 4RB2C 1PTOF 1KXLA 2EOTA 2W57A 5CR3A 3RJ0A 2NN6G 4L6TB 4NLGA 4ZUJA 4FS1A 2R92B 1MSHA 2VS1A 2W6QA 1GUWA 1WCMA 1KJQA 4ZKCB 3SVMA 2NVTH 2DNEA 4JI4Q 3HEJA 1QZHA 2AUJD 1XTDA 4XT3B 1LTBD 2XSCA 3URYA 2IHFA 1N56A 3CAMA 3DWAA 2RBMA 4TVAB 5D3DA 5FPOA 4B3TH 5BR8Q 1Q82C 3MXGA 2AWOA 4LUZA 3C0FB 1VQNA 4ZOLF 2E5LQ 1HXYD 4B3RH 5C3WA 4F7XA 3H6MA 2FINB 3NXWA 4J1MA 1YITA 5CA0F 4FP5D 1V4YA 5IP7G 3Q0AA 3GTLH 5GAGC 1OXVA 3DWPA 1S5ED 2EYPA 2CFMA 2F3VA 3LGJA 4Y8VB 4GN3B 3PO2B 1UWVA 4A3BG 2XCLA 4JI6L 2EYHA 3CW2C 1U0LA 5JJKA 2HCCA 3EJIA 4ZQ3A 1C48A 5KFOA 4ECQA 4TRDA 4QUFA 1TWGB 3OUUA 3NBIA 3SI8A 4DFAA 4RH6A 2DIKA 1EUCB 2A6HD 5ELOA 4Q45A 3KHGA 1HNZQ 3LWUA 3PUVA 2KUMA 2MO0A 4KI0A 4X65L 1TWFA 4LH6A 5I4DA 1HNWQ 4A3CH 5C5JA 5EDWA 1CKNA 3EIVA 1DYQA 2CVRA 3CCQA 1W2BA 4GKJL 1TS4A 2NTTA 4ED2A 3TINA 4HIDA 2ZM6Q 1N34Q 4ZLTF 1UE1A 4IPDA 2L0CA 4DPGA 3JRXA 4U6PA 4XT1B 3RUPA 2F0SA 4DR3L 5LMUQ 1ASYA 3HG9A 1HUMA 3Q2OA 2XRQD 2ZDQA 4LF5L 4DNIA 1DOLA 3OSPA 3BZCA 1A0IA 5JEAJ 5EKIA 3RLNA 4U673 2VQEH 4FM9A 4O3PA 3ULPA 3OIQA 2R93H 3N6XA 5C44H 3VR6A 2KHSA 3X3MA 5CC4A 2RVLA 1ZQ7A 1Q46A 3HOYG 1PH3A 2L11A 2X0SA 5KFUA 1LTLA 3NHHA 1IHZA 2UUAQ 5JH7F 1L2FA 3H3VC 3HKZE 2CKZB 3K3PA 4JI0L 1QZGA 1LTSD 5L37A 1NBWA 3TREA 1BO0A 4HJ7A 2SNMA 3A0JA 1LACA 5KRUA 2EY5A 3E9IA 4X3KA 1SFOA 4DUYL 3V6KA 1QUQB 4ED3A 3KLRA 3A8JE 3F8NA 4GOPA 1Z9FA 3HOXG 1WTXA 4Q8EA 3MFGA 1PH4A 2D0OA 2JEIA 5KFKA 1MBYA 5KT7A 2JA5H 5CA1F 4WJ4A 3TQ1A 1H9JA 5C4HA 4UP8A 4KHZA 3KOJA 2ICIA 3W1GA 3HP3A 3RAQA 2WKDA 2JXMB 1FNWA 1U4PA 2ID0A 4JC0A 2ZJQA 1SNDA 5IYCG 2Z8LA 3ZJYC 3J81L 2MPMA 3RLFA 1I50B 4NXMQ 5C0XJ 1XPOA 3K7AB 1X56A 3X3NA 3KLSX 4DNTB 1STBA 1IBMH 3S2DH 1VBGA 3VYTA 4TKOB 1E4EB 4OO1H 4B9XA 4XX0B 3BA9A 4LW1A 2AQ1B 2F03A 3I12A 2R7KA 4YAJB 4HNUA 2MGSA 1HFGA 4YWKA 2RHQB 2I5MX 4ETSA 4POFA 1KIXA 4EQ5A 2IP4A 1I94H 1RK5A 3N6RA 1YEZA 3C3LA 1Z2PX 1BCPC 4CC6A 4A3IG 2YS7A 2WB1E 5LXTF 4DV5L 4DF7A 3BU2A 4EBCA 5M3FB 5DG7A 4ECUA 2ATLA 1CQJB 2FKLA 2HQLA 2CW0C 2F4VH 4U7CA 2JA8H 5IT9E 1SXTA 1PFSA 4OL7A 3MFHA 1XXGA 3HKZG 1K83B 1NSNS 3OHXC 1UNNC 3MFYA 3M4PA 5EAYA 3W2DA 1STEA 4HSVA 5C6AA 2W71A 3HXLA 3CRLC 4UCRA 3TS2A 2UXDL 4JI5Q 2E2IH 3T5HA 3KJOA 3V2TA 1G6ZA 1SROA 1HPCA 2YZGA 1I4HA 1EWHA 4CKBA 4ZHQF 2L12A 2R8KA 1R4PB 3CMEA 3PR5B 4MTNA 5CV9A 1EWCA 5KFLA 5KYLA 2GA4B 2KEDA 1VQDA 2A19A 3EA6A 1HNXQ 4IUUA 5HGQA 1ET9A 1ICFB 3OMGA 5I9OA 1JJCB 3J7AF 4QIWE 2DY7A 4JI4L 2JA9A 2Q2TA 3GTPA 2K01A 2K6AA 3BQ0A 4RWSC 4HYKA 4FXGC 4A3MH 3B6YA 2DGYA 4WJ3M 3PW7A 5DLQE 1CHQD 3M4QA 5EKLA 1WTQA 1I6HH 2R7LA 1EHIA 3A7LA 5FK9C 2F52A 1AZPA 2R82A 2Z0SA 5JEAH 5CAEB 4C3HH 3BVZA 4GNXB 1EYCA 4P75A 2E5LL 1K8AC 1KBLA 3JAME 2WB1G 4MNOA 5KT4A 1PDQA 4LMYA 4YQWA 4O42A 2F0QA 1HTPA 5FJ8H 4A93B 4LF7H 5C4XH 1K8OA 4AYBE 1O80A 3K81C 1AFPA 3KYHC 3PIOA 2L5TA 3HKZA 1Y1VH 4HTHA 3J81c 3WO0A 2C28A 4EG0A 4DV1L 2B2UC 1F2ZA 2J0TD 3K5MA 3SXHA 1GUGA 2X69A 4LSAA 3I55A 1N32Q 3UE1A 1E24A 1S4ZA 5IIFA 4YP3A 1RYSA 4HIMA 2XRSD 2IHEA 3CRKC 2G5DA 4RNNA 4LSXA 4YAKB 2K33A 1QILA 4QB4A 4C1NI 2AU0A 1JX4A 1X3EA 4MA0A 1SR3A 2WDTA 5BMVF 1JKJB 1B1ZA 4C2MA 4OX9Q 2HHHQ 4LF9Q 1HNZL 2F0MA 4QF4A 1E0BA 5CMDA 1X3FA 5KT6A 1GUOA 2R93G 1HNWL 2RDHA 2L9HA 1T5XD 5C44G 3M4OB 4JBMA 1YHAA 5C0XH 3KTMA 4JI7H 1IYUA 1X55A 1NCVA 2ZM6L 1N34L 4K8IA 2W8LA 1STGA 2C9OA 1FL0A 4G4KA 1VQFA 2MUYA 3T51B 2G9HD 2I87A 3GV3A 4I50F 2GN5A 1G291 1YNNC 1FGUA 1GVPA 4AQYQ 4KHPH 1PH6A 2IWHA 3GD7A 3KBXA 1OTCA 1AN7A 3CCMA 1SCUB 2Z6KC 2WB1A 4JYAQ 3Q1KA 2UUBL 4RZQA 1X3QA 2JA5G 2WAQE 3PW0A 4OWWB 2HVRA 5EKKA 1X6OA 1J5EL 2UUAL 1TQOA 2YU9B 4IZ8A 2NZHA 2VXWA 4YY3Q 5DGBA 1S5BD 3GTKH 4AYBG 1IKMA 1CQIB 2QDBA 3P1HA 5CV8A 4QWAA 5ELEA 4OIJA 2W6PA 4DKAC 5FO7B 3GV8B 1B53A 5C3XA 5A2QE 1G2SA 3FVQA 2HQEA 4B08A 1UUPA 4I55F 1ASZA 1SYCA 5JVDF 3FPUB 2J6SA 2KEEA 4R8NA 4OO1G 3OHBA 2MHVA 3RGXA 1O7YA 1EQVA 5M5YB 1LO5D 2FMMA 3K5OA 3AB9A 1NMGA 1GUSA 4PDBA 2UUCH 3LWBA 3VMMA 2Y0SG 4LUOA 5F9LA 1ZYRD 2R93A 2K5HA 4DL5A 1F2YA 1H9RA 1D8LA 4NXML 4O3QA 5DG9A 3N42B 3SK5A 4JPBW 2UXCH 1EQTA 2EYMA 5JOBA 1CQFA 3S2HB 5KFHA 4HNTA 1HCZA 2JA8G 4LF4Q 5JPNC 3K5IA 4KKUA 2Q8TA 4QIWA 1KJIA 1IL2A 3BG5A 3M9BA 5C8YF 5M3MB 4KTAA 3GTJB 2RA4A 3A74A 1HR0L 1EIYB 4ECXA 4DV7H 3TZUA 5FLXE 3PCOB 1VQ4A 2CW7A 1B7YB 3J80L 1K0RA 3HGBA 3BJUA 3CPFA 3EROA 3GP7A 5BN5A 2W6MA 1WCMH 3RB6A 1DONA 2WAQG 1JQYD 4O0AA 1VS0A 5IWAQ 3CQZH 1WTVA 4JBKA 2A8VA 5GQOA 1EWIA 4IWXA 3NK9A 1HR0W 3M85A 2O5IC 4K5WA 1KRTA 4MV3A 3AMUA 4DV2L 4A3IB 2UU9Q 3LP8A 4PZ6A 1S3OA 3J81j 2B2VC 3DEPA 4A3MG 2MO1A 4DR4H 3S1QH 3J80W 1S0NA 4IOCA 4IURA 2AHOB 4J9RA 4R4IA 1IL8A 5AFWA 1AUXA 3Q8RB 1EU3A 2XVSA 4CKCA 5JEAG 3T1YL 4C3HG 1VF5C 1G91A 2YRXA 1ZXTA 4L5QA 5KFEA 1D6EC 1TWAB 1HNXL 4KJNA 4FVMA 1YNXA 4J9MA 5KFZA 2SDFA 2NVTB 1Q90A 1LTTD 2EYJA 2GVAA 5FJ8G 2ASJA 5C4XG 1BOSA 1Y8PB 1TVXA 2JEFA 1EQRA 4HNVA 5COYA 2FK3A 1Y1VG 4ZCKA 1LTAD 1N33H 3FMAA 4DR6H 1XMOL 3TP5A 4DR7L 3WO1A 2L4NA 4PZ8A 1CSPA 2RSNA 5L1IA 2AWNA 4ECWA 1V8QA 1PHJA 1TWFH 5D14A 1U4RA 3EQLC 5A35A 5LL6X 2SOBA 4JV5H 2F0GA 4FDBA 2C2EA 3GTLB 4IJHA 4DAPA 1CZGA 2WAQA 5JVLA 4J9KA 4HJ8A 3I70A 2ZXRA 1BCPB 1D7QA 3KAJA 2VL6A 1A63A 4LFAH 2XN9C 1K8MA 5EPLA 4DV4H 4IAJA 1VBHA 1ILQA 2I46A 5C0XG 3Q22A 4M1UB 2QDLA 3K5NA 1KAWA 2Z4IA 5DLFA 4RCOA 1A2UA 1CSQA 4DUZQ 3QO2A 3A54A 5M5WH 3KLSA 3F2BA 1IBLH 1B3AA 1K73C 4DL3A 2R7ZB 1MJCA 2V58A 1Y1WB 1WTOA 3TS0A 4OX9L 4LF9L 3PF5A 4CDEC 5GAEC 1X3PA 4RKBA 3N40P 4X65Q 4X3UA 4B3MQ 2PMZE 1FJGH 1SFOH 3J80c 3ND9A 4A3BH 1S68A 1XMQH 4R4OA 3G48A 2W9BB 2UVUA 1B70B 1Y1VA 2FJZA 4DR3Q 5KFMA 3GIMA 1TXYA 2R7FA 1PTOH 2EYLA 2YTVA 4FF4A 1GUTA 2IL8A 1ENFA 5EPKA 4GZYC 4LFCL 4C3IH 4LF5Q 3GQBA 4R4QA 3BAAA 5DNFA 4I7HA 1HRJA 5EPJA 4IUVA 1S97A 5CBEE 5FO8B 4X6AH 1JWUD 4JI2H 4OIKA 4X62Q 1EYZA 2M2LA 2FXQA 3OYYA 4KK7A 5KG3A 1J6QA 2VOBA 2J7ZA 4KKSA 1HQMC 3S17H 3SR1A 2K5DA 1M8AA 3I4LA 1VQ7A 4JI0Q 1A3VA 4RAYA 3C46A 3K57A 5F2DA 1BBUA 5LHY1 1CKMA 1TU2B 3KDFB 1NTGA 2VR1A 1L1OB 1KDBA 2MFIA 3CCUA 4TV8F 2V4DA 1DD2A 1A8VA 2JA5B 2W6ZA 1DV2A 3NTHA 3CMAA 3D0FA 4G7HC 2V4QA 2QA4A 2B2YA 4A75A 2A68C 1D1KA 4AYBB 5T1GA 3CHBD 5JPMC 1SDFA 4YR2A 1H9SA 3T1HH 2Z9HA 4Y7NB 1STYA 3NBHA 4YJ2F 4KLKA 1GSAA 2AMCB 2CH4W 3F2UA 1VQPA 4GKKH 1GGOA 1AE3A 1ESFA 4HJ5A 2K5WA 1WCMG 3I4OA 4XDXA 1JOOA 5DAUA 5GROA 1KL9A 3S2DB 1ILPA 3RBDA 4M7EA 2WIIB 2ZTEA 2FMAA 2HCIA 4H02A 3CD6A 3RFCA 1XPRA 1O7ZA 3T5JA 5FD5A 1B3QA 4FS2A 2XNAC 5EGTA 1EOTA 1XNRH 3I72A 3M9NB 1HTLD 2VA2A 2EJMA 1AH9A 1PFMA 2Y0SB 1BNZA 2IY5B 2NB0A 2PQEA 5KFAA 1VQ8A 4EGVA 4JOIA 4UP7A 3E0JA 3H4BA 4GLXA 2NVXB 1GOZA 4WRDA 2FP4B 1LUZA 2IBKA 4DL4A 2JA8B 5I47A 5D1OA 1LTRD 4NXNH 3OWFA 3S14H 5IOCA 2FHTA 2V9WA 2F0NA 3KALA 4RA8A 4B3TL 1HZBA 4DV0H 1Z7TA 4UCTA 1I4GA 2K05A 2O4XA 4MTDA 4ME6A 2DUDA 1STHA 2E2IB 1PH1A 3I3CA 5IYDH 4B3RL 1VQOA 3G8CA 2C5CA 2W9CB 1T5EA 1T36A 1SRUA 2VQDA 1Z2NX 1PRTC 1Z2OX 2OEOA 4DAYB 4Q8FA 2Q2IA 4XTCS 3OOCA 4GOPC 4IOAA 4R8UB 3OW2A 1RIPA 4HCEA 1XNQH 3NEMA 4R4CA 3V96A 2NVYA 4QW8A 1JWSD 1M7JA 1PTOC 2M00A 1CKOA 4RFBA 3DWQA 1BR9A 5C4JH 1K0SA 2PMZA 3RUZA 4XQQA 4X3SA 1I6VC 1C4QA 3MHBA 2A1AA 4EGJA 3CQZA 3ULLA 4A3MB 4ME3A 1SEIA 2QGQA 4BY1H 1I6HB 4RGOS 3UI2A 5ISRA 5KFDA 3D31A 3NSWA 4FXDA 2C2RA 3O13A 4UCOA 3OUZA 2AGOA 3T53B 4C2MH 2PBZA 3MR6A 2XIGA 1O7IA 2PN1A 1TWHH 1JICA 3H91A 4DR1Q 4DNRB 4K5VA 5IYBH 1BBXC 2JA7H 3STBD 4JI3H 3QB3A 1V1PB 3KF8A 2R61A 4CC5A 4FNFA 4DGZA 1CFMA 3GTMB 3BYTB 1KDCA 1S0OA 1ULZA 1A62A 3SE7A 5KG6A 2R84A 1LM0A 4MHEA 2BQRA 4J0MA 3TP6A 2V1CC 3QR8A 4POGA 2NN6I 1O78A 2RSOA 2E2JH 3VPDA 4YCUA 3R23A 4RNMA 4C3JH 1WTWA 4IR9A 4DV1Q 1NAPA 1SMYC 2VQEL 3K0XA 4LF8Q 2BDNA 1GLVA 4DUZL 2NVQH 3KK7A 4IRDA 2XGPA 1AZQA 1T3NA 2QCPX 1EUJA 2K14A 1I4XA 4L5TA 4CJ0B 2BH8A 3DM1A 1YNJD 3QFFA 1NNXA 1A9XA 4O1NA 4GS3A 4C3IG 3KF6A 3Q6SA 2M05A 3L0OA 4QWDA 4A3KB 1QVGA 4B9WA 2IA6A 3HOVH 4A76A 3NP8A 4B3ML 2R7NA 4OHJA 2B63H 2B2TA 1I7NA 4BA2I 4R1JA 1KEEA 3BVMA 5CV7A 2ZDHA 2BQ3A 3FRPB 4YB8B 3RD4A 4IFDH 2R7DA 5IY0A 3HOWH 4DV6H 3NTKA 3P75A 4O3SA 4P73A 4HQ6A 2I80A 2A69C 2BA0A 3AQQA 2D5DA 2C35B 2W7PA 3J7A5 3TP8A 1SJHD 4RB1A 2UUCQ 1I7LA 4TQSA 2D0PA 3FKIH 3GTGA 5FOBB 1K1SA 4C5AA 1MIUA 4YJ3F 4X62L 4BBSB 5KFCA 2V5AA 2YRWA 1E4FT 2UUBQ 4FF3A 5KFFA 5I2YA 1NR2A 1A15A 2TSSA 4DV3Q 3GTKB 1J5EQ 1PH8A 5C5MA 3NQIA 1SE3A 1EFWA 3SEBA 3VR2A 1VQ5A 1LTGD 3I56A 1I3QA 3FDTA 1CT1D 3VDYA 5I6YA 5E4WC 3RTXA 4JI6H 4ID6A 2EY1A 2JA6H 5L9XA 3U9TA 2VQFH 1DIKA 3A5UA 2Q2HA 3HS0C 1X32A 4OWTB 2F4VL 1HH2P 3JZIA 5KFPA 4PNYA 3RZOB 2FE3A 4QCLA 1IYJB 3MWDA 1EY5A 5J3BA 1KABA 5KGUA 4IUPA 3CCRA 1N36H 4BY7H 4JI8H 3S1NH 3RLOA 5KNCA 4GLAC 4B3SH 1Q1EA 2KCNA 4P74A 1LTID 3L4JA 3U50C 3I4NH 2HJWA 2R86A 1X9NA 1FR3A 1KQSA 3S1RH 1IOWA 4GKJH 1DOMA 2SEBD 2PNRC 4JV0A 3BDCA 3D8GA 1T9HA 1W6JA 4HIOA 3V4ZA 1Q86C 1TS3A 2IPKD 4DR4Q 4LUVA 1G6PA 3PF4A 4J9QA 2CQOA 2JJQA 4JW0A 3FHWA 1D5MC 3I4MB 3DM3A 4ZKBB 4X66H 3H0GA 3IL8A 1HR0Q 2JEBI 3RR5A 3R5HA 1IBKH 1TY0A 3GV7B 5C4ZA 4F50A 5IYDG 2Z4HA 4APMA 4K14A 2YV5A 3TIIA 3PO3H 2NTSA 1WCMB 4YWLA 2KVMA 2VA3A 4DR2H 4JI1Q 3U9OA 1EZ6A 2VY3A 1N9WA 2XTIA 4C56C 5C3EB 4RUCA 5CYUA 2BR0A 3BZDB 1E7ZA 3N41B 1PV4A 4DUYH 5KFSA 4DV2Q 4KKTA 2OTLA 1V51A 1U9RA 2JK8A 3LNNA 4L5RC 1D2BA 2D2CC 3S1QB 4YR3A 3ETJA 5FD6A 4BY1G 3A7AB 4LF7L 2J4XA 2K7VA 4YHHQ 4L63B 3K80C 1YHQA 1EL0A 2FK1A 2FPGB 3GTQA 4EQNA 3MWYW 1RKNA 4IPCA 3SGIA 2EPBA 2LSSA 3H3VI 1RJRA 1OWTA 3DXJC 5KYIA 2RCFA 3T1YQ 3AFPA 4U68A 5IYBG 4DV4Q 3NWTA 2JA7G 1DXMA 3HOZB 4ECYA 5JJZA 4J9SA 3S15B 1FYCA 3PUWA 1OO9B 4J9LA 3PUZA 1VQIA 3RZDH 1GSHA 3MR5A 5FLXL 5F9NA 1R9TA 3CKIB 3U58A 3L4KA 2UXBH 2BE5C 5DG8A 1B50A 4C3JG 1XMOQ 1PZID 2F0EA 4DR7Q 3M9OB 4R4TA 4ABNA 4V0BA 5ELFA 3E5SA 2AQ4A 3I7FA 1SYDA 1ZEQX 4DR1L 1MD2D 1TWFB 1VQ9A 3MEFA 3OTOQ 3S1MH 2IX1A 1CKNB 1ICWA 4PG3A 1F2LA 4JI7L 3PIO3 2A6HC 1ZKOA 4ZRZA 4EFBA 4CBVA 1XMQQ 4DL7A 3MC0B 5KFTA 5KFBA 5FLXW 1L1OC 2NYZD 4GN4B 1JDEA 1S5CD 2ZDGA 1PXUA 3HOVG 2B63G 2JSOA 4LAAA 4P2CB 4K8JA 2R8JA 4KHPL 2OH2A 4LF8L 4IFDG 4K6LA 1ESRA 2UXDH 1EIGA 3RV3A 4L8JA 3HOWG 1D1IA 1E1TA 1PH9A 3JAMi 1CA6A 5EWGA 3KBGA 3R5FA 3D4WA 3JRWA 3ORRA 1VQHA 3U9SA 4F87A 5JUMA 3MR2A 3K6OA 3FKIG 3T16A 1UE6A 2F1MA 1TWHA 4DR5H 1EY9A 1SYBA 1H9MA 4KN7C 1C7YA 1EZ1A 1KLUD 4AH6A 2JA7A 2YZMA 4ED6A 3IKJA 1SFOB 4RU9A 3GIKA 3PO2H 2ICEC 4JK1C 1PRTB 2I5HA 4A3BB 3KHLA 4GOPB 1SNPA 5LP6F 3L9AX 4BS9A 1JB7A 3OSOA 1KC8C 4MA5A 1RHPA 3EPIA 4JI4H 4O2AF 4HR7A 1VMCA 1ML0D 1BDOA 1E2WA 3M3YH 2EZVA 1PTOB 2YCHA 1TS2A 1WTRA 2UUCL 1W6KA 3BDLA 4LFCQ 2QW7A 4NB3A 5BR8H 2E2HA 1YI2A 4EYHB 1U4LA 3ER0A 2E5LH 2JA6G 3AYHB 3D6WA 1EY4A 4UCVA 3D4DA 2EIFA 1F2MA 2UXCL 5IYZF 2Q8IB 1KTKA 1VQEA 2J6UA 5J39A 1IKLA 1N8RC 1PYBA 3RV4A 2HDMA 4DV3L 3S17B 4X64Q 1WFQA 1AEXA 5FLMH 3CF5A 2WACA 4LH7A 2F0UA 1QVFA 1MSGA 3FMCA 5KKNB 3LX0A 4BY7G 3J81E 4PMBA 2B63A 4UPAA 3GTOA 1F9QA 4NW2A 1HA5A 4S3SA 3SK4A 3BS1A 3H09A 5GADC 3I4NG 4DV7L 5HURA 5LL6b 1YVCA 1Q3LA 1KHIA 2E2DC 3M7GA 2KBNA 3UFXB 4F4YA 3HOYB 1JLLB 1AP0A 3W3AA 5BN4A 4ODGA 5HBRB 3G4SA 1WR2A 5LA6F 3IFTA 1U5KA 2EY2A 5KT5A 3FKIA 2ZJPA 4IO9A 1R4QB 1EY6A 2B8FA 1VCIA 1PYSB 2C00A 1HNZH 2CWAA 1TWCA 3RF2A 3J81i 3MR3A 4N9TA 1AW7A 1B8AA 2BDOA 3SHLA 3PO3G 3MXUA 2KJXA 2FLLA 3HOXB 1KC7A 2BA1A 1YBYA 3UDIA 2VPQA 1C9OA 2R85A 1BGWA 1II3A 3A8IE 4DA2A 2HIVA 2HVQA 2ZM6H 4DR4L 1K3RA 3A55A 1DZ1A 1PYWD 3GIDA 5LMUH 1SYEA 4EQPA 4LFBH 4IJLA 1Y8OB 2VPSA 3NTIA 2CCZA 3MVVA 3HBLA 1XNQQ 2RKSA 1QWYA 2JA6A 4PMWA 2NVYH 5KT3A 4QJFA 1NMFA 2W6OA 5KNBA 2BOSA 1MJEA 4BBRH 1B33N 1V43A 3EYYA 1WH2A 2UUAH 1XWEA 3GTPB 2F0OA 4JI1L 1N33L 3VA7A 2J6TA 1EYDA 4YWMA 4JBWA 3SK8A 3OPOA 5EBDA 2RQXA 2R6GA 2WKCA 4NPSA 4ECSA 2B29A 3MJFA 5DM63 2O2LD 2B39A 2N78A 4Q0FA 4B3TQ 1IW7C 1GUNA 1DGSA 1P8LA 1WI5A 4EX5A 4CGYB 4B3RQ 5KG2A 4JV5L 5TSSA 2F0VA 2R6FA 2NU7B 1V9PA 2B2UA 2KCTA 4YHHL 1DV1A 4JVZA 4LNQA 4EBEA 2VUMA 3PIPA 3TP7A 2RDGA 4WJWA 3IN5A 3OWEB 1M90C 3RAXA 1JJGA 3U4ZA 1SSOA 4LFAL 3HKZB 3BQ2A 1BJTA 3J7AK 4DV4L 1K83H 1JB3A 4JCVE 5C4JB 1Q8KA 3CCJA 4PMCA 4NXMH 2R92G 2B2YC 1CQVA 2ZTDA 5E1FA 3MWEA 4OELB 4XYMB 4LF6H 2ZTCA 5HY6A 4ZK9B 2OTJA 3PZPA 1NJIC 5J2UF 2A5HA 3G6VA 2PW7A 4BY1B 1IBLL 4MTEA 2JQOA 3VPBA 3MA2B 2XCAA 4C2MB 5IODA 4DXGA 3DUZA 1LLRD 2F4IA 1GM5A 4MZ9A 4Q0YA 3IG0A 3CXCA 2I0QA 4ED8A 1X54A 1FJGL 3OTOL 1U4MA 2L1BA 2PQAA 1EY7A 2RGVA 4J9NA 2EYOA 2J9GA 1PH7A 2F0FA 1XMQL 3TBIB 3UDGA 4FU0A 2P5ZX 1WVLA 1VQJA 2DN8A 4BWGB 1MZBA 2B2WA 1E2VA 2E2JB 4FF1A 3PQIA 2Z6KA 5C1PA 5L1LA 2EJFC 4HJAA 2L15A 4C3JB 4IRCA 1E1OA 3PO2G 3HRZC 3QZ8A 1KLGD 2VQEQ 1T94A 4JI2L 3GTGH 3MXNA 1CZWA 3SK6A 4JI5H 5ELNA 1EUDB 5BN3A 2WB1B 1HHVA 1SYXB 4DK0A 2W6NA 1V1OA 2LMCB 1OXTA 1EQQA 1CUKA 1FNUA 4A93H 1CI3M 2FLNA 1SE8A 3QIAA 2LFNA 1B9MA 2QILA 3HOVB 1RJPA 4O3NA 1SAPA 2R92A 1I3QH 3RGZA 2IMWP 1H95A 3HOWB 5FLMG 2K1BA 5CV4A 1VQ6A 2NZ1D 4RAZA 5KG4A 1IOVA 4ZQIA 3ERSX 3TQYA 1K8GA 5KFNA 5C0XI 1JC7A 2RGRA 1K3BC 4R9WA 3T1HL 5M9OA 5J1ZA 1HZAA 2V4RA 4FXKC 2R93B 4CJ1B 2XC9A 5C44B 1B04A 4GKKL 5E4XA 5CGKA 4FBUA 1LT6D 2IT1A 4ZUIA 5H80A 4P72A 1VQCA 4X64L 1BXTA 3TN2A 4R8IA 1IBMQ 1SMYD 2KENA 5EBCA 3E5NA 4QIWB 4HSPA 4K0KH 1ET6A 1RL2A 1XNRL 4DN4M 3CVZA 2QEJC 5T14A 5BPFA 3EN2A 5G3LD 4X66Q 1M6VA 1GYFA 4G7ZC 3PW4A 1I94Q 3H0GH 1PLFA 5DGAA 1N32H 4EEYA 5IGBA 1RJQA 2GLTA 2ASLA 2LXKA 4BWSC 2H4OA 2F4VQ 1TWGA 5K2MA 1ZETA 3H20A 4NXNL 1SBBB 2YU9H 2ALYB 4ULLA 4UP9A 2OLSA 1NR4A 2F3WA 1N48A 4OX9H 2HHHH 4LF9H 4BY7B 2VW9A 4HJ9A 3S1NB 4G7OC 1YJWA 2Z1CA 1KD1C 4DV0L 2MCTA 2QF7A 3I4NB 2V59A 3G7LA 3J80E 2A69D 4BBRG 3S1RB 2HGSA 2WYOA 5JQWA 5KG0A 3NGDA 4DK1A 5AJ3Q 2EQSA 4QY7A 1A3UA 2FPIB 1EEFD 2B2TC 1S5FD 3OW7A 4N8X1 5JVG3 3WOEA 4KY6A 3HZXA 3CPWA 3GTQH 2DJGC 1XNQL 4AQYH 4IR1A 1RJTA 1D5XC 1DOKA 3DLLA 1KJ9A 1M0TA 2QKIC 1G8ZD 1Q7YC 5M5XH 3PO3B 5DQGA 2LY7A 2BH2A 4RNOA 2R8HA 4JYAH 3J80i 4QUCA 1X65A 3UDXA 2XD4A 4YY3H 2JEJA 1NUCA 1UC8A 4Q44A 1R9TH 2AGPA 4A3DH 1G2TA 1JIHA 1VQLA 2FPPB 1SNCA 2SCUB 5H1SE 4QWBA 5JJIA 1EFID 5M3MH 1XPUA 3GQCA 2A6EC 3N8DA 3ORQA 1QUQA 4MV8A 1SNOA 4H13C 4ZYSA 4QL5A 4JI3L 3Q8PB 4UDUC 1HA6A 3K8AA 3LWEA 3KJPA 4A3FH 4MV7A 4HEDA 5NUCA 3CC2A 1VDZA 1UC9A 4E4TA 5EWEA 4LF7Q 5C5LA 4CKEA 2WAQB 4J9OA 4C5CA 5HV6A 2PCFB 4RZRA 1BQQT 2OCEA 1YHBA 1MKHA 1VQMA 2PO4A 1DCZA 1EEID 1FD7D 3BA8A 1WYDA 2FMCA 4IUQA 1XJVA 4LJZC 1A2TA 2MJ8A 1PX2A 1YJ9A 1I50A 1RF2D 1PK8A 1WD1A 4ME5A 5K5PA 5EJWA 2PZWA 3RZDB 4QQBX 4LF4H 1GKHA 4Y52H 1E4EA 5ELDA 4TQRA 1BCPD 5T1IA 3TEHB 3FP9A 5DLGA 2KOLA 4CHTB 5LMNH 5IT9L 2CW0D 3W1BA 4MV9A 4C3HB 4XQJA 3FDSA 3S1MB 3KHHA 1C0AA 2MNAA 1NE3A 2YTXA 1G51A 1TWAH 4A3JH 4MV6A 3I91A 4JI7Q 4TUYF 1SEBD 2A74C 5C4XB 5IGFA 4A93G 4IHJF 1GO3E 4DV6L 1RD9D 1S40A 1CS0A 5IWAH 3I90A 2GVBA 4PZ7A 1Y1VB 5EQ0A 4XYOA 3QWNA 2E76C 3V4SA 3ERQA 1K83A 1SE4A 3QG1A 3VYSA 5IT9W 2JEAI 3MEHA 1M1KC 1F9PA 4KHPQ 2E2HH 1ZHSA 3Q23A 2UU9H 2DLNA 1TT2A 1JJ2A 2KSWA 3R2IA 1ENCA 3Q8SB 4GN5A 1B6SA 4MV1A 2F0WA 2ASBA 3HOUH 2YYAA 1XDNA 1XTCD 3VR5A 4IALA 1PZJD 1Q1BA 2ES2A 4EFEA 1VQAA 3GIQA 3GTOH 2BE5D 3PUYA 4EYIB 1UE5A 1WOCA 4UFZA 4YR0A 3BZKA 1MHWC 4EVOA 2VQFL 2OQ0A 3JSLA 5G3LF 3S9WA 5J22A 3M3YB 4O2BF 4ZAIA 3JAML 4EGQA 4IQZA 2R7ZH 3N44B 2IW3A 1Y1WH 4J9PA 3H0GG 2EXDA 4J15A 1N36L 1H9SB 3D6CA 4JI8L 3PW2A 4GNXA 1QOHA 4B3SL 1MGSA 3G6JB 1D5ZC 3NBHB 5KFQA 1TWCH 4MV4A 1CM9A 2UXCQ 3R8BA 2YZNA 1QNKA 3MXPA 1SLJA 1SMXA 5KX5F 5IGGA 2CWPA 1IBML 4KJOA 1VQGA 5KFXA 2WV6D 3JAMW 1EYAA 2K75A 2L55A 3PGZA 4OWXB 4LFBQ 2FB9A 4X66L 5EOYA 1IBKL 4ZI7F 4IRKA 1I94L 1JE4A 3MZ5A 3RB3A 4HMIA 4RGMA 1EZ8A 3PV0A 4DV7Q 2XIWA 1HFNA 5J2TF 4DUZH 2R8IA 5DQHA 3OSNA 2H1EA 3BQ1A 3T5LA 2A73B 2FFKB 3CCLA 4A3EH 4I4TF 3RN2A 3GIIA 1VQBA 3NQTA 5D1OB 3PUXA 4DR2L 1QNUA 4QWEA 5IT9c 4NMZA 4NKLA 3WWVA 2OXPA 2RCNA 2OWOA 4RUAA 3F1ZA 1IZ6A 1SNMA 4Q5VA 1LYLA 4X65H 4M8AA 2ASDA 1AUVA 4B3MH 3KFUA 2K52A 1JOKA 2M9VA 2JP1A 3DHQA 1NY4A 2CHBD 5IGCA 2VZAA 3R93A 3PR4A 1JE5A 1Q8IA 1Z6HA 2IX0A 5AJ3L 1YNND 2W9AA 4ED1A 1FKAH 2X6LA 4MTKA 3ONAB 4ED0A 3PN1A 3GDEA 4G3IA 4A3DG 4XXEA 2YTYA 4DR3H 2JEGA 5D3IB 5M3MG 4E6IA 3BVGA 3VYRA 2VUMH 4G57A 3S16H 4LF5H 1X3GA 3GILA 5FKAC 3HFZB 2NVYB 5I2XA 2C22A 2DJFC 4Y7NH 2DWCA 2YS6A 4X62H 5C1OA 4A3FG 2PMZB 4BBRB 4PWQA 4GC7A 2K50A 4ECVA 4YBZB 4LF6Q 3RN5A 5A2QL 1JWMD 3GO5A 1K28A 3MFIA 1HZCA 4ECRA 2YU9A 4O3RA 3CQZB 3VPCA 4A3GH 3DF7A 2BCOA 2UXBL 1N33Q 3TRZA 4JI0H 2HVSA 1ONLA 4DR6Q 1GXDC 5GONF 2ZJRA 3GV6A 1A6XA 3QOLA 4J6HA 1BCPF 2YL2A 3T5KA 3J81W 3N43B 5KFWA 2ZXOA 4I7ZC 3M4IA 4O3OA 2WE6A 5CV6A 3RIZA 3KF8B 3JAMc 4JV5Q 4MAMA 2NVXH 2KHIA 3IRBA 3GIPA 1UAPA 5A2QW 4LK1C 3N52A 1WJJA 3IFDA 3PMFA 1O75A 1S03G 3E6ZX 2RHSB 3STBC 4O4LF 4KY7A 4LMQD 4JV2A 2NWGA 4LFAQ 2C2DA 2CQYA 1UEAB 1IXRA 2PI2E 4CJ2C 4KD4A 5IP9H 2F0TA 2EDGA 5KFYA 4A3JG 4A3LH 4DLKA 4TV9F 2DY8A 4MN3A 3G71A 4KY5A 1QB5D 2DPIA 3C1FA 1IBLQ 4BXXH 1TR5A 2LS01 1ZHQA 3QJYA 5JVH3 5JAVA 3GTJA 1B9NA 4DXFA 3UQ8A 3KF6B 3KHRA 1J9OA 4DR5L 2CH4A 1PH2A 1AE2A 2YW2A 2F0KA 1RCVD 3OHAA 3K59A 1JCKB 3ND8A 1FJGQ 1YNJC 5KG5A 2XCPA 2R87A 2QEXA 4DV5H 3L2PA 5JJLA 3CU7A 2PNHA 4KN4C 2EYFA 3C1EA 2R92H 2VNUD 4OGQC 1GJXA 3HOUG 1W96A 1L0XB 2SNSA 3D3RA 1IW7D 3FPPA 5E7NA 3U4VA 4XIGS 3NELA 5IGEA 2K5VA 3T4AC 2D62A 3CC7A 4RCNA 5BR8L 2E74C 3GTGB 4RB0A 2UVWA 2EVBA 4JI2Q 5HGTA 1UE7A 1JT8A 5M5WB 3T13A 1B4OA 1S72A 2GPSA 2I8CA 1DJRD 1RODA 3AU7A 3GTMH 2R7ZG 3OMCA 1Y1WG 1WTPA 4K0KQ 4A2AA 2OT2A 3R2TA 3EPGA 2BQUA 5KFJA 4A3CG 1QE6A 1TWAA 1I3QB 5FPRA 3C2PA 1S0MA 3BDOA 3ETHA 4XZ3B 1YIJA 2CW8A 3TZDA 2NU6B 3EVQA 4YIJA 1VAJA 3L3OC 4HAEA 1GD7A 4EEQA 1C8CA 2W8KA 2K04A 4TSSA 1EU4A 2JE6I 1I4RA 4YCVA 1TWGH 1BUVT 5KNDA 2ZXPA 1JDBB 1E4GT 4C3IB 4QWCA 2Y0SE 1B6RA 4IFDI 2R8GA 3M7NA 3T1HQ 1KAAA 3PVXA 4A3KH 1M0WA 5KFRA 2OQKA 4DR1H 2EXZA 4JG2A 3RB0A 1PFNA 4GKKQ 5K36H 1RYRA 1MI2A 2XGQA 4LWCA 4ILWA 4A3EG 1WD0A 3GTLA 1I6UA 4H44C 3VR4A 3KLWA 3E9HA 5LMUL 1RTOA 3CP0A 2N3SA 1I4QA 4LFBL 1XNRQ 2WTFA 2D9UA 3EFXD 1K9MC 3IAYA 5KG1A 4FO2A 3S24A 4DV1H 3H0GB 2FK2A 2W7OA 4LF8H 2B2WC 4H7BA 3BJYA 1TA8A 3OIPA 2F0LA 3CCSA 3AEVA 5I6WA 5FLXc 4BBSH 3KAKA 1JXLA 1Y69U 2AQ3B 2NU8B 3A56A 3LMLA 2R7ZA 1E2ZA 1Y1WA 4NXNQ 3CCVA 3NPPA 2VUMG 2K28A 1SYFA 4JV1A 1CK1A 2KQ3A 1O7LA 3A8KE 2H5XA 1HNWH 4QW9A 4DV0Q 4UCUA 2PI2A 4FBTA 3A5ZB 1GSOA 3AFQA 3K5HA 5ELBA 1SE2A 1C30A 1GHKA 1N34H 3VYUA 1LT4D 2ATWA 3L7ZC 4A3GG 2W9BA 3HB9A 1KNAA 3ZYYX 4HN7A 1QVCA 1BNCA 1PMRA 4IPGA 1E3PA 3RZOH 4L5SA 4F4XA 1A3TA 3T56B 3GTQB 2F0JA 1OXUA 4DAMA 1JORA 4Z9CB 3MWMA 4KMUC 5D65A 1LV9A 3F2CA 2AUKA 2X6GA 4K2LA 4OO1I 1W93A 5M5XB 5ELCA 4AIMA 1I50H 4L1KA 2UUBH 4UHVA 4LF6L 1IYVA 1L2ZA 2NZOA 3K7AH 4DV3H 2WINB 3S14B 1J5EH 2E75C 4PV1C 3TSSA 1R9TB 4A3DB 1EIHA 3HKSA 4DR6L 2HDLA 2CQAA 3I2ZA 1PH5A 3K3VA 1KDAA 4QMGA 3J7YW 4KHVA 1BKBA 4F4WA 5IP9G 1B2TA 2R3ZA 4C1NK 5LMNQ 2QK4A 3I4MH 4A3LG 3KUPA 1L0WA 4Q43A 2FJ2A 3E0EA 5CV5A 3KDFA 1L1OA 5FO9B 3H15A 1VQKA 2A68D 4JI3Q 4A3FB 3PIP3 1CTMA 1SJED 1HZ9A 2XGTA 4RGTA 4DL6A 1S10A 5I9PA 3NENA 5M3FH 4APVA 2JA5A 4BXXG 2TMPA 5DEHA 1CE8A 3NE5B 4AYBA 4PQXA 2O03A 2RDFA 2EJGC 2R7MA 3G6XA 1KNEA 4CDDC 4DK6C 1GHJA 4DU9A 3WDNA 5C3EH 4DK3C 3TDQA 3K5LA 1DM0B 3M9MB 5IE8A 4JI5L 4WORA 1TIID 3M4YA 5E3FA 4R7RA 3WOFA 1Z47A 4NP5A 1PA6A 2WFWA 3KXYT 1PFBA 1LT3D 4TQUS 2HT1A 2K03A 2CZGA 4XYLB 4RB3C 1L0YB 3K7UC 5LL6S 1C3OA 5KG7A 3E3XA 2KECA 2Y0SA 1UNSA 3NWSA 4BA1I 3JSNA 5DQIA 1HR0H 1TWHB 3QOJA 2F0DA 2LKVA 2JA7B 1HQRD 2JN4A 3DMUA 3BYYB 1F77A 2F0PA 4A3JB 2ENBA 2PPBC 1BBWA 2NVXA 3HOZH 1K1QA 2N49A 4RAUC 3S15H 3RMHA 2Q2UA 3SDZA 4GLVB 4KD3A 1BVSA 2A6ED 3R5XA 1J8IA 4HMJA 2K4KA 4DV6Q 4KV6A 3UE0A 4HR7B 2W70A 4JI1H 5KFIA 1H9KA 4I65A 4JOIC 4OXPA 1SYGA 1S5DD 5DM73 1TS5A 3G6YA 5L1KA 1KRSA 4K5XA 4H0LC 3CC4A 2RDJA 1E22A 2MP1A 2E2HB 1PRTD 2HUGA 4C5BA 2E2IA 2NVQB 2B3GA 4DV2H 2EY6A 3BABA 1EOVA 2RF4A 2NN6H 4K6DA 1KJJA 1TAEA 2W9CA 4MIUA 1BXRA 3QZ7A 1PTOD 3HOUB 3V05A 4YHHH 4DAYA 2XWJB 4YCWA 4K0KL 1KJ8A 4R8UA 4EBDA 4ECZA 1EY0A 4OEMB 5L1JA 2I07B 4ED7A 1FGBD 4A3KG 2XWBB 1WSCA 3T1YH 2B63B 4ECTA 3SE0A 4OONA 4DL2A 3GTOB 3Q24A 4F88A 5K36G 4CDFC 1HNXH 5CBAE 1W3SA 1N32L 2E8GA 5CORA 4QGUA 1XYIA 2WP8J 5LOVF 1FNVA 4FYDA 4JI6Q 1I4PA 1JMCA 1RK6A 2VQFQ 2NUCA 2MQHA 5D8DA 1RDPD 3TIGA 4NDXA 2DNCA 3MTSA 1Y8NB 1WTHA 4UAIA 5IP7H 2HHHL 1XMOH 3FKIB 5KFGA 4DR7H 3UDFA 5LYJF 2F0HA 4O4HF 1S9FA 4IWYA 3EBEA 1N36Q 4JI8Q 2Z6BA 4B3SQ 1TWCB 4P71A 4BBSG 3OTOH 1V1PA 3P7JA 3M4OH 3W5OA 1QJOA 3H94A 3GTMA 4GKJQ 3VR3A 1ZYRC 1EY8A 3K0YA 2Q8RE 2FLPA 1JOQA 3H4DA 3PW5A 3CCEA 4N9PA 3G6EA 2AGQA 5GAHC 2OF1A 2F3IA 4ALPA 2K5NA 2PYKA 1VMPA 2IX3A 4AQYL 1XX8A 2VB3X 1IBKQ 2GPWA 2N8NA 2ALZA 4A4IA 1PVOA 2JA6B 5IGDA 4WBNF 1Q81C 4JYAL 3WNZA 1Q12A 3JC66 4O2DA 1UEBA 3MAQA 4A3EB 4F4ZA 5KFVA 2DPJA 4YY3L 4I7AA 2F0IA 2UVVA 4DR2Q 1SNQA 4K2KA 3Q8QB 3V6JA 2O5JC 3DEOA 5D1PA 1STAA 2B2VA 3VA5A 2K32A 3RNUA 1YJNA 1JR0D 1OXXK 1HJPA 5EZYF 4DUYQ 2VB2X 4IN3A 3ULJA 4IZOA 3J7AV 1HUNA 1VKZA 5KT2A 2NUAB 3H40A 1QCBD 4O4IF 2JYOA 2PZUA 1RTNA 3K58A 4V190 3HOYH 2PVPA 1SN8A 3D4RA 4RMFA 2YYZA 5M5YH 3S16B 2VUMB 2RDIA 3I4MG 4LFCH 2N55A 5EWFA 2B8GA 2ZT9C 1Y14B 1AN8A 2IJ0A 2EE1A 2K5QA 4UY8C 1EYGA 3NUCA 4DAVA 2HD3A 4HIKA 4IUNA 4A2BA 3TMEA 4X3TA 5M3FG 1LT5D 2DZDA 5CB4F 1V1QA 4F8MA 3V6HA 4IFDJ 2NU9B 4JUZA 3HOXH 3S2HH 4FF2A 3GTKA 4LF4L 4X64H 3P20A 4GNXC 1PZKD 4A3GB 1TY2A 2P0AA 4IUTA 1F9RA 1OXSC 1ENAA 4RHRA 2UXBQ 3TQTA 2HIXA 3ITPA 5LMNL 5C3EG 3I73A 4RG1A 4XYQA 3GTJH 2VUGA 4WFN3 3GV5B 3BG3A 3I8ZA 5KIXA 3F8TA 2QYZA 5IYCH 3GIJA 2AQ2B 1BF4A 4J8QA 2PQAB 2NBFA 4HCSA 1VF7A 4DV5Q 2AKWB 1FVIA 1QG7A 1TKWB 3PSIA 2PZTA 4WD3A 3RBEA 2PW5A
chains in the Genus database with same CATH topology
1YZ6A 4IPHA 5IWAL 1NY4A 1PHJA 2VZAA 1TWFH 3GTPH 1JE5A 2KCMA 2UUCL 2IX0A 5AJ3L 4LFCQ 4NB3A 4FDBA 5LMNW 1YI2A 4IJHA 3GDEA 3ER0A 4HJ8A 4A3DG 2YTYA 2JA6G 3AYHB 3HOZG 1D7QA 2EIFA 2UU9L 2UXCL 3MXNB 5M3MG 4A3IH 2VL6A 2UXDQ 2VUMH 1VQEA 3H3VH 2I5LX 3S16H 1X3GA 1I5FA 1A63A 1N8RC 3ICEA 1PYBA 4DV3L 3F2DA 3HFZB 4X64Q 4JBJA 1EIFA 1WFQA 5FLMH 5C0XG 3CF5A 4Y7NH 4A3FG 2KHJA 1QVFA 2LXJA 1KAWA 3J7ZC 4BY7G 2K50A 1CSQA 4DUZQ 3Q8DA 4LF6Q 5M5WH 3RN5A 1P16A 4UPAA 3F2BA 3GO5A 4DR5Q 1HZCA 3I4NG 1K73C 5GADC 1KXLA 1MJCA 4A3GH 4DV7L 2NN6G 1YVCA 3TS0A 2UXBL 1KHIA 1N33Q 4OX9L 4LF9L 3PF5A 3TRZA 2VS1A 4DR6Q 2ZJRA 5GAEC 2NVTH 2KBNA 4JI4Q 4X65Q 4B3MQ 2PMZE 1QZHA 3G4SA 1XTDA 1SFOH 1U5KA 3J80c 2ZJPA 4IO9A 4A3BH 2IHFA 3CAMA 3KF8B 1VCIA 1PYSB 3JAMc 4TVAB 4JV5Q 2CWAA 4R4OA 2KHIA 3IRBA 5BR8Q 1Q82C 2NVXH 3G48A 2AWOA 4LUZA 1WJJA 3J81i 1VQNA 1B70B 4DR3Q 1B8AA 2E5LQ 3PO3G 1TXYA 2R7FA 2RHSB 2YTVA 3STBC 2BA1A 1YBYA 3UDIA 1C9OA 4LFCL 4C3IH 4LF5Q 4R4QA 2HIVA 4LFAQ 1YITA 4DR4L 1IXRA 2PI2E 1K3RA 5IP9H 5IP7G 3GTLH 4X6AH 4A3JG 4A3LH 5GAGC 4X62Q 1OXVA 4IJLA 2FXQA 2CFMA 3G71A 3OYYA 3LGJA 2CCZA 1J6QA 1XNQQ 4GN3B 1IBLQ 1UWVA 4BXXH 3S17H 4PMWA 2NVYH 4A3BG 4QJFA 1NMFA 1VQ7A 4JI6L 3CW2C 4JI0Q 1U0LA 4BBRH 1MJEA 3KF6B 5JJKA 4DR5L 1PH2A 1AE2A 1V43A 1BBUA 4JI1L 1CKMA 1FJGQ 3KDFB 1NTGA 1L1OB 2QEXA 1N33L 3L2PA 5JJLA 2MFIA 2PNHA 4YWMA 3CCUA 4JBWA 5ELOA 2R92H 2R6GA 4NPSA 1HNZQ 2VNUD 2B29A 1A8VA 3PUVA 3HOUG 4KI0A 2MO0A 2N78A 4X65L 4B3TQ 1XPUA 5E7NA 3CMAA 1HNWQ 3U4VA 4A3CH 3D0FA 1CKNA 1DGSA 3EIVA 4XIGS 3NELA 2QA4A 2K5VA 4A75A 1P8LA 2D62A 3CCQA 1W2BA 1WI5A 3CC7A 4EX5A 4GKJL 4B3RQ 4JV5L 4HIDA 2ZM6Q 5BR8L 1N34Q 1UE1A 1V9PA 4IPDA 4DPGA 2KCTA 4YHHL 4KLKA 4JI2Q 5LMUQ 2AMCB 3PIPA 4DR3L 1VQPA 1UE7A 1ASYA 4LNQA 1JT8A 1S72A 1M90C 1AE3A 1JJGA 4HJ5A 3U4ZA 4DNIA 1WCMG 3I4OA 5GROA 4LF5L 4LFAL 1KL9A 4DV4L 3BZCA 1K83H 1A0IA 2ZTEA 4JCVE 4H02A 3RLNA 5JEAJ 3CD6A 3GTMH 2R7ZG 1Q8KA 3CCJA 1XPRA 3ULPA 1Y1WG 2R93H 4K0KQ 2R92G 2ZTDA 5C44H 2ZTCA 5HY6A 2OTJA 1Q46A 1AH9A 3HOYG 1PH3A 1NJIC 4A3CG 2IY5B 1LTLA 1IBLL 2UUAQ 1VQ8A 1L2FA 2JQOA 3HKZE 4JOIA 2CKZB 4UP7A 1YIJA 4JI0L 4GLXA 1QZGA 1NBWA 3TREA 4HJ7A 1LUZA 3A0JA 1GM5A 4MZ9A 1GD7A 3E9IA 3CXCA 2I0QA 1X54A 4DUYL 1QUQB 2JE6I 3OTOL 4YCVA 1TWGH 1FJGL 2PQAA 3S14H 4GOPA 1Z9FA 3HOXG 2Y0SE 1PH4A 2D0OA 4IFDI 1PH7A 1XMQL 3M7NA 3T1HQ 3UDGA 4A3KH 1HZBA 4B3TL 2OQKA 2JA5H 4WJ4A 1VQJA 2DUDA 4JG2A 4UP8A 4GKKQ 4KHZA 1PH1A 3KOJA 2Z6KA 3W1GA 5IYDH 4HJAA 4B3RL 2L15A 4LWCA 4A3EG 1VQOA 1E1OA 2ID0A 1SRUA 4JC0A 2ZJQA 3PO2G 5IYCG 3KLWA 3ZJYC 2VQEQ 3E9HA 4JI2L 5LMUL 3RLFA 3CP0A 3GTGH 4DAYB 4NXMQ 5C0XJ 2Q2IA 4XTCS 2N3SA 4GOPC 4IOAA 4LFBL 1XPOA 3OW2A 1XNRQ 5ELNA 1X56A 1K9MC 1RIPA 3NEMA 4R4CA 1OXTA 3S24A 1EQQA 3S2DH 1CUKA 1CKOA 4A93H 5C4JH 4LW1A 1SE8A 3CCSA 3AEVA 4BBSH 5FLXc 4YWKA 2RHQB 2I5MX 2A1AA 4POFA 1KIXA 3ULLA 4EQ5A 4ME3A 1YEZA 2QGQA 4BY1H 4NXNQ 4A3IG 1I3QH 3CCVA 2WB1E 2VUMG 3D31A 4DV5L 3BU2A 1H95A 5FLMG 4C2MH 1VQ6A 2HQLA 2H5XA 1O7IA 1TWHH 4DV0Q 2JA8H 2PI2A 4DR1Q 5IYBH 3ERSX 3TQYA 3A5ZB 1K8GA 1PFSA 3STBD 5C0XI 2JA7H 3AFQA 3HKZG 3T1HL 2ATWA 3L7ZC 4A3GG 3M4PA 5EAYA 1HZAA 1QVCA 1A62A 4IPGA 1E3PA 3RZOH 4L5SA 1LM0A 3TS2A 4GKKL 2UXDL 4POGA 2V1CC 4JI5Q 2NN6I 2E2IH 2E2JH 1OXUA 4DAMA 3KJOA 2IT1A 1SROA 4YCUA 4C3JH 4P72A 1VQCA 4X64L 3F2CA 4DV1Q 1IBMQ 2KENA 2VQEL 3K0XA 4LF8Q 4OO1I 3CMEA 4AIMA 4MTNA 1I50H 1RL2A 4DUZL 1XNRL 2NVQH 4LF6L 2NZOA 3K7AH 3EN2A 1EUJA 4X66Q 2K14A 4L5TA 2BH8A 1I94Q 1VQDA 3H0GH 2A19A 1HNXQ 3HKSA 4GS3A 5HGQA 4DR6L 3KF6A 3I2ZA 1PH5A 3L0OA 1JJCB 2LXKA 1BKBA 1QVGA 5IP9G 4QIWE 5LMNQ 4A76A 4JI4L 3HOVH 3I4MH 2JA9A 1L0WA 2Q2TA 4B3ML 2F4VQ 3E0EA 2B63H 4A3LG 4A3MH 3KDFA 3B6YA 1L1OA 2DGYA 4NXNL 4BA2I 3H15A 4R1JA 2YU9H 2ALYB 5DLQE 4UP9A 1VQKA 3M4QA 4JI3Q 1I6HH 4WJ3M 2F52A 1HZ9A 2XGTA 2VW9A 2R7DA 4HJ9A 5M3FH 3NENA 5IY0A 4APVA 4BXXG 1YJWA 3HOWH 1KD1C 2Z0SA 4DV0L 4C3HH 4P73A 4GNXB 4P75A 2E5LL 2BA0A 3AQQA 4BBRG 1K8AC 2C35B 2WB1G 3J7A5 4MNOA 2UUCQ 5AJ3Q 2D0PA 2EQSA 3FKIH 4QY7A 4DK6C 5FJ8H 5C4XH 5C3EH 4AYBE 1MIUA 4DK3C 4X62L 3K81C 3KYHC 3PIOA 5IE8A 4JI5L 3CPWA 1Y1VH 2UUBQ 3GTQH 3J81c 1XNQL 1Z47A 4DV1L 1PA6A 2WFWA 4DV3Q 1J5EQ 3DLLA 4TQUS 2HT1A 3I55A 1N32Q 3UE1A 1PH8A 1E24A 5M5XH 1Q7YC 3K7UC 1EFWA 2BH2A 4HIMA 2IHEA 4BA1I 1VQ5A 3J80i 1X65A 3UDXA 3I56A 1X3EA 3VDYA 1SR3A 1R9TH 1BBWA 4A3DH 2JA6H 4OX9Q 2HHHQ 2N49A 1VQLA 4LF9Q 3S15H 3HOZH 5H1SE 1HNZL 5JJIA 2Q2UA 1X3FA 2Q2HA 4GLVB 1BVSA 4OWTB 5M3MH 1HH2P 3A5UA 2F4VL 1QUQA 2K4KA 4DV6Q 1HNWL 2R93G 3UE0A 5C44G 1IYJB 4JBMA 4QL5A 1YHAA 4JOIC 4OXPA 5J3BA 4JI3L 3K8AA 1X55A 3KJPA 4A3FH 2ZM6L 3CCRA 1KRSA 1N34L 3CC2A 4BY7H 3S1NH 3CC4A 3RLOA 1E22A 4GLAC 4LF7Q 1Q1EA 4P74A 1FL0A 3U50C 1VQFA 2B3GA 3I4NH 2OCEA 1YHBA 1X9NA 1MKHA 1VQMA 1KQSA 1EOVA 2RF4A 3S1RH 1WYDA 2GN5A 1G291 1XJVA 1T9HA 1FGUA 1GVPA 4HIOA 4AQYQ 1Q86C 4DR4Q 1YJ9A 1PH6A 4LUVA 1G6PA 3GD7A 4YCWA 3PF4A 4K0KL 1OTCA 2CQOA 2JJQA 3CCMA 2Z6KC 3FHWA 4JYAQ 2UUBL 4A3KG 3DM3A 2JA5G 2WAQE 4QQBX 1HR0Q 2JEBI 3RR5A 1GKHA 4OONA 4OWWB 4Y52H 1X6OA 1J5EL 2UUAL 2NZHA 3TEHB 3FP9A 4YY3Q 5IYDG 3GTKH 1W3SA 1N32L 5K36G 2E8GA 4AYBG 4QGUA 2WP8J 4JI6Q 2YV5A 1JMCA 3PO3H 2VQFQ 3W1BA 4YWLA 2MQHA 4DKAC 1C0AA 2MNAA 1NE3A 2YTXA 4JI1Q 5IP7H 1G51A 1TWAH 4A3JH 2VY3A 2HHHL 1ASZA 4JI7Q 1N9WA 3UDFA 2XTIA 3EBEA 1N36Q 4A93G 4JI8Q 4OO1G 1GO3E 4DV6L 1E7ZA 1S40A 4B3SQ 4P71A 1PV4A 4BBSG 2GVBA 4PZ7A 3M4OH 4DV2Q 1NMGA 2OTLA 3W5OA 2JK8A 4L5RC 4GKJQ 2Y0SG 4LUOA 2JEAI 4BY1G 2K5HA 1M1KC 4LF7L 4KHPQ 4YHHQ 1D8LA 3CCEA 2E2HH 4NXML 3K80C 1YHQA 3G6EA 1JJ2A 4IPCA 3SGIA 5GAHC 2F3IA 2LSSA 3H3VI 4ALPA 3T1YQ 2K5NA 3AFPA 2JA8G 4AQYL 4GN5A 5IYBG 4DV4Q 1IBKQ 4LF4Q 2JA7G 2N8NA 4A4IA 2ASBA 3HOUH 1PVOA 1IL2A 3M9BA 1Q81C 4JYAL 3PUWA 1Q12A 3JC66 3PUZA 1Q1BA 1UEBA 4O2DA 3A74A 1VQIA 1HR0L 2ES2A 1VQAA 3RZDH 1EIYB 4YY3L 3GTOH 3U58A 3PUYA 4DR2Q 1UE5A 3PCOB 1WOCA 1VQ4A 1B7YB 3BZKA 1XMOQ 2VQFL 4DR7Q 4R4TA 2OQ0A 3RNUA 1K0RA 3BJUA 3CPFA 1YJNA 1WCMH 1OXXK 2WAQG 1HJPA 3I7FA 4O0AA 1VS0A 4DR1L 5IWAQ 4DUYQ 1VQ9A 3CQZH 3MEFA 3OTOQ 2IX1A 2R7ZH 3S1MH 1CKNB 3ULJA 4JBKA 4PG3A 1Y1WH 4JI7L 2A8VA 5GQOA 1EWIA 3H0GG 2EXDA 4J15A 1XMQQ 4JI8L 3M85A 1N36L 1HR0W 4GNXA 4B3SL 1KRTA 3HOYH 1L1OC 3NBHB 4GN4B 1SN8A 1TWCH 4RMFA 2YYZA 5M5YH 4DV2L 2UU9Q 2UXCQ 4PZ6A 3HOVG 1S3OA 3I4MG 3J81j 1SLJA 1SMXA 2B63G 1Y14B 4A3MG 2MO1A 4UY8C 3S1QH 2CWPA 1EYGA 1IBML 4KHPL 4HIKA 4LF8L 1VQGA 4IOCA 2AHOB 4IFDG 4R4IA 5M3FG 2K75A 1V1QA 3PGZA 4LFBQ 4OWXB 3HOWG 4IFDJ 5JEAG 3T1YL 3HOXH 4X66L 1E1TA 3S2HH 1PH9A 1IBKL 4LF4L 4GNXC 3JAMi 1I94L 4L5QA 1HNXL 1OXSC 3PV0A 4DV7Q 2UXBQ 1VQHA 1YNXA 2HIXA 3FKIG 2GVAA 1UE6A 5FJ8G 5C4XG 5LMNL 5C3EG 4RG1A 3GTJH 1C7YA 4AH6A 3CCLA 4A3EH 3RN2A 1VQBA 1EQRA 3PO2H 3F8TA 1Y1VG 3PUXA 5IYCH 5IT9c 4DR2L 2I5HA 2PQAB 4DV5Q 4GOPB 3WWVA 2AKWB 2RCNA 1XMOL 2OWOA 1FVIA 4DR7L 3F1ZA 1JB7A 1KC8C 1IZ6A 4PZ8A 1CSPA 1LYLA 3PSIA 2AWNA 3KFUA 2K52A 3M3YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ6 A;  4IPH A;  5IWA L;  1NY4 A;  1PHJ A;  2VZA A;  1TWF H;  3GTP H;  1JE5 A;  2KCM A;  2UUC L;  2IX0 A;  5AJ3 L;  4LFC Q;  4NB3 A;  4FDB A;  5LMN W;  1YI2 A;  4IJH A;  3GDE A;  3ER0 A;  4HJ8 A;  4A3D G;  2YTY A;  2JA6 G;  3AYH B;  3HOZ G;  1D7Q A;  2EIF A;  2UU9 L;  2UXC L;  3MXN B;  5M3M G;  4A3I H;  2VL6 A;  2UXD Q;  2VUM H;  1VQE A;  3H3V H;  2I5L X;  3S16 H;  1X3G A;  1I5F A;  1A63 A;  1N8R C;  3ICE A;  1PYB A;  4DV3 L;  3F2D A;  3HFZ B;  4X64 Q;  4JBJ A;  1EIF A;  1WFQ A;  5FLM H;  5C0X G;  3CF5 A;  4Y7N H;  4A3F G;  2KHJ A;  1QVF A;  2LXJ A;  1KAW A;  3J7Z C;  4BY7 G;  2K50 A;  1CSQ A;  4DUZ Q;  3Q8D A;  4LF6 Q;  5M5W H;  3RN5 A;  1P16 A;  4UPA A;  3F2B A;  3GO5 A;  4DR5 Q;  1HZC A;  3I4N G;  1K73 C;  5GAD C;  1KXL A;  1MJC A;  4A3G H;  4DV7 L;  2NN6 G;  1YVC A;  3TS0 A;  2UXB L;  1KHI A;  1N33 Q;  4OX9 L;  4LF9 L;  3PF5 A;  3TRZ A;  2VS1 A;  4DR6 Q;  2ZJR A;  5GAE C;  2NVT H;  2KBN A;  4JI4 Q;  4X65 Q;  4B3M Q;  2PMZ E;  1QZH A;  3G4S A;  1XTD A;  1SFO H;  1U5K A;  3J80 c;  2ZJP A;  4IO9 A;  4A3B H;  2IHF A;  3CAM A;  3KF8 B;  1VCI A;  1PYS B;  3JAM c;  4TVA B;  4JV5 Q;  2CWA A;  4R4O A;  2KHI A;  3IRB A;  5BR8 Q;  1Q82 C;  2NVX H;  3G48 A;  2AWO A;  4LUZ A;  1WJJ A;  3J81 i;  1VQN A;  1B70 B;  4DR3 Q;  1B8A A;  2E5L Q;  3PO3 G;  1TXY A;  2R7F A;  2RHS B;  2YTV A;  3STB C;  2BA1 A;  1YBY A;  3UDI A;  1C9O A;  4LFC L;  4C3I H;  4LF5 Q;  4R4Q A;  2HIV A;  4LFA Q;  1YIT A;  4DR4 L;  1IXR A;  2PI2 E;  1K3R A;  5IP9 H;  5IP7 G;  3GTL H;  4X6A H;  4A3J G;  4A3L H;  5GAG C;  4X62 Q;  1OXV A;  4IJL A;  2FXQ A;  2CFM A;  3G71 A;  3OYY A;  3LGJ A;  2CCZ A;  1J6Q A;  1XNQ Q;  4GN3 B;  1IBL Q;  1UWV A;  4BXX H;  3S17 H;  4PMW A;  2NVY H;  4A3B G;  4QJF A;  1NMF A;  1VQ7 A;  4JI6 L;  3CW2 C;  4JI0 Q;  1U0L A;  4BBR H;  1MJE A;  3KF6 B;  5JJK A;  4DR5 L;  1PH2 A;  1AE2 A;  1V43 A;  1BBU A;  4JI1 L;  1CKM A;  1FJG Q;  3KDF B;  1NTG A;  1L1O B;  2QEX A;  1N33 L;  3L2P A;  5JJL A;  2MFI A;  2PNH A;  4YWM A;  3CCU A;  4JBW A;  5ELO A;  2R92 H;  2R6G A;  4NPS A;  1HNZ Q;  2VNU D;  2B29 A;  1A8V A;  3PUV A;  3HOU G;  4KI0 A;  2MO0 A;  2N78 A;  4X65 L;  4B3T Q;  1XPU A;  5E7N A;  3CMA A;  1HNW Q;  3U4V A;  4A3C H;  3D0F A;  1CKN A;  1DGS A;  3EIV A;  4XIG S;  3NEL A;  2QA4 A;  2K5V A;  4A75 A;  1P8L A;  2D62 A;  3CCQ A;  1W2B A;  1WI5 A;  3CC7 A;  4EX5 A;  4GKJ L;  4B3R Q;  4JV5 L;  4HID A;  2ZM6 Q;  5BR8 L;  1N34 Q;  1UE1 A;  1V9P A;  4IPD A;  4DPG A;  2KCT A;  4YHH L;  4KLK A;  4JI2 Q;  5LMU Q;  2AMC B;  3PIP A;  4DR3 L;  1VQP A;  1UE7 A;  1ASY A;  4LNQ A;  1JT8 A;  1S72 A;  1M90 C;  1AE3 A;  1JJG A;  4HJ5 A;  3U4Z A;  4DNI A;  1WCM G;  3I4O A;  5GRO A;  4LF5 L;  4LFA L;  1KL9 A;  4DV4 L;  3BZC A;  1K83 H;  1A0I A;  2ZTE A;  4JCV E;  4H02 A;  3RLN A;  5JEA J;  3CD6 A;  3GTM H;  2R7Z G;  1Q8K A;  3CCJ A;  1XPR A;  3ULP A;  1Y1W G;  2R93 H;  4K0K Q;  2R92 G;  2ZTD A;  5C44 H;  2ZTC A;  5HY6 A;  2OTJ A;  1Q46 A;  1AH9 A;  3HOY G;  1PH3 A;  1NJI C;  4A3C G;  2IY5 B;  1LTL A;  1IBL L;  2UUA Q;  1VQ8 A;  1L2F A;  2JQO A;  3HKZ E;  4JOI A;  2CKZ B;  4UP7 A;  1YIJ A;  4JI0 L;  4GLX A;  1QZG A;  1NBW A;  3TRE A;  4HJ7 A;  1LUZ A;  3A0J A;  1GM5 A;  4MZ9 A;  1GD7 A;  3E9I A;  3CXC A;  2I0Q A;  1X54 A;  4DUY L;  1QUQ B;  2JE6 I;  3OTO L;  4YCV A;  1TWG H;  1FJG L;  2PQA A;  3S14 H;  4GOP A;  1Z9F A;  3HOX G;  2Y0S E;  1PH4 A;  2D0O A;  4IFD I;  1PH7 A;  1XMQ L;  3M7N A;  3T1H Q;  3UDG A;  4A3K H;  1HZB A;  4B3T L;  2OQK A;  2JA5 H;  4WJ4 A;  1VQJ A;  2DUD A;  4JG2 A;  4UP8 A;  4GKK Q;  4KHZ A;  1PH1 A;  3KOJ A;  2Z6K A;  3W1G A;  5IYD H;  4HJA A;  4B3R L;  2L15 A;  4LWC A;  4A3E G;  1VQO A;  1E1O A;  2ID0 A;  1SRU A;  4JC0 A;  2ZJQ A;  3PO2 G;  5IYC G;  3KLW A;  3ZJY C;  2VQE Q;  3E9H A;  4JI2 L;  5LMU L;  3RLF A;  3CP0 A;  3GTG H;  4DAY B;  4NXM Q;  5C0X J;  2Q2I A;  4XTC S;  2N3S A;  4GOP C;  4IOA A;  4LFB L;  1XPO A;  3OW2 A;  1XNR Q;  5ELN A;  1X56 A;  1K9M C;  1RIP A;  3NEM A;  4R4C A;  1OXT A;  3S24 A;  1EQQ A;  3S2D H;  1CUK A;  1CKO A;  4A93 H;  5C4J H;  4LW1 A;  1SE8 A;  3CCS A;  3AEV A;  4BBS H;  5FLX c;  4YWK A;  2RHQ B;  2I5M X;  2A1A A;  4POF A;  1KIX A;  3ULL A;  4EQ5 A;  4ME3 A;  1YEZ A;  2QGQ A;  4BY1 H;  4NXN Q;  4A3I G;  1I3Q H;  3CCV A;  2WB1 E;  2VUM G;  3D31 A;  4DV5 L;  3BU2 A;  1H95 A;  5FLM G;  4C2M H;  1VQ6 A;  2HQL A;  2H5X A;  1O7I A;  1TWH H;  4DV0 Q;  2JA8 H;  2PI2 A;  4DR1 Q;  5IYB H;  3ERS X;  3TQY A;  3A5Z B;  1K8G A;  1PFS A;  3STB D;  5C0X I;  2JA7 H;  3AFQ A;  3HKZ G;  3T1H L;  2ATW A;  3L7Z C;  4A3G G;  3M4P A;  5EAY A;  1HZA A;  1QVC A;  1A62 A;  4IPG A;  1E3P A;  3RZO H;  4L5S A;  1LM0 A;  3TS2 A;  4GKK L;  2UXD L;  4POG A;  2V1C C;  4JI5 Q;  2NN6 I;  2E2I H;  2E2J H;  1OXU A;  4DAM A;  3KJO A;  2IT1 A;  1SRO A;  4YCU A;  4C3J H;  4P72 A;  1VQC A;  4X64 L;  3F2C A;  4DV1 Q;  1IBM Q;  2KEN A;  2VQE L;  3K0X A;  4LF8 Q;  4OO1 I;  3CME A;  4AIM A;  4MTN A;  1I50 H;  1RL2 A;  4DUZ L;  1XNR L;  2NVQ H;  4LF6 L;  2NZO A;  3K7A H;  3EN2 A;  1EUJ A;  4X66 Q;  2K14 A;  4L5T A;  2BH8 A;  1I94 Q;  1VQD A;  3H0G H;  2A19 A;  1HNX Q;  3HKS A;  4GS3 A;  5HGQ A;  4DR6 L;  3KF6 A;  3I2Z A;  1PH5 A;  3L0O A;  1JJC B;  2LXK A;  1BKB A;  1QVG A;  5IP9 G;  4QIW E;  5LMN Q;  4A76 A;  4JI4 L;  3HOV H;  3I4M H;  2JA9 A;  1L0W A;  2Q2T A;  4B3M L;  2F4V Q;  3E0E A;  2B63 H;  4A3L G;  4A3M H;  3KDF A;  3B6Y A;  1L1O A;  2DGY A;  4NXN L;  4BA2 I;  3H15 A;  4R1J A;  2YU9 H;  2ALY B;  5DLQ E;  4UP9 A;  1VQK A;  3M4Q A;  4JI3 Q;  1I6H H;  4WJ3 M;  2F52 A;  1HZ9 A;  2XGT A;  2VW9 A;  2R7D A;  4HJ9 A;  5M3F H;  3NEN A;  5IY0 A;  4APV A;  4BXX G;  1YJW A;  3HOW H;  1KD1 C;  2Z0S A;  4DV0 L;  4C3H H;  4P73 A;  4GNX B;  4P75 A;  2E5L L;  2BA0 A;  3AQQ A;  4BBR G;  1K8A C;  2C35 B;  2WB1 G;  3J7A 5;  4MNO A;  2UUC Q;  5AJ3 Q;  2D0P A;  2EQS A;  3FKI H;  4QY7 A;  4DK6 C;  5FJ8 H;  5C4X H;  5C3E H;  4AYB E;  1MIU A;  4DK3 C;  4X62 L;  3K81 C;  3KYH C;  3PIO A;  5IE8 A;  4JI5 L;  3CPW A;  1Y1V H;  2UUB Q;  3GTQ H;  3J81 c;  1XNQ L;  1Z47 A;  4DV1 L;  1PA6 A;  2WFW A;  4DV3 Q;  1J5E Q;  3DLL A;  4TQU S;  2HT1 A;  3I55 A;  1N32 Q;  3UE1 A;  1PH8 A;  1E24 A;  5M5X H;  1Q7Y C;  3K7U C;  1EFW A;  2BH2 A;  4HIM A;  2IHE A;  4BA1 I;  1VQ5 A;  3J80 i;  1X65 A;  3UDX A;  3I56 A;  1X3E A;  3VDY A;  1SR3 A;  1R9T H;  1BBW A;  4A3D H;  2JA6 H;  4OX9 Q;  2HHH Q;  2N49 A;  1VQL A;  4LF9 Q;  3S15 H;  3HOZ H;  5H1S E;  1HNZ L;  5JJI A;  2Q2U A;  1X3F A;  2Q2H A;  4GLV B;  1BVS A;  4OWT B;  5M3M H;  1HH2 P;  3A5U A;  2F4V L;  1QUQ A;  2K4K A;  4DV6 Q;  1HNW L;  2R93 G;  3UE0 A;  5C44 G;  1IYJ B;  4JBM A;  4QL5 A;  1YHA A;  4JOI C;  4OXP A;  5J3B A;  4JI3 L;  3K8A A;  1X55 A;  3KJP A;  4A3F H;  2ZM6 L;  3CCR A;  1KRS A;  1N34 L;  3CC2 A;  4BY7 H;  3S1N H;  3CC4 A;  3RLO A;  1E22 A;  4GLA C;  4LF7 Q;  1Q1E A;  4P74 A;  1FL0 A;  3U50 C;  1VQF A;  2B3G A;  3I4N H;  2OCE A;  1YHB A;  1X9N A;  1MKH A;  1VQM A;  1KQS A;  1EOV A;  2RF4 A;  3S1R H;  1WYD A;  2GN5 A;  1G29 1;  1XJV A;  1T9H A;  1FGU A;  1GVP A;  4HIO A;  4AQY Q;  1Q86 C;  4DR4 Q;  1YJ9 A;  1PH6 A;  4LUV A;  1G6P A;  3GD7 A;  4YCW A;  3PF4 A;  4K0K L;  1OTC A;  2CQO A;  2JJQ A;  3CCM A;  2Z6K C;  3FHW A;  4JYA Q;  2UUB L;  4A3K G;  3DM3 A;  2JA5 G;  2WAQ E;  4QQB X;  1HR0 Q;  2JEB I;  3RR5 A;  1GKH A;  4OON A;  4OWW B;  4Y52 H;  1X6O A;  1J5E L;  2UUA L;  2NZH A;  3TEH B;  3FP9 A;  4YY3 Q;  5IYD G;  3GTK H;  1W3S A;  1N32 L;  5K36 G;  2E8G A;  4AYB G;  4QGU A;  2WP8 J;  4JI6 Q;  2YV5 A;  1JMC A;  3PO3 H;  2VQF Q;  3W1B A;  4YWL A;  2MQH A;  4DKA C;  1C0A A;  2MNA A;  1NE3 A;  2YTX A;  4JI1 Q;  5IP7 H;  1G51 A;  1TWA H;  4A3J H;  2VY3 A;  2HHH L;  1ASZ A;  4JI7 Q;  1N9W A;  3UDF A;  2XTI A;  3EBE A;  1N36 Q;  4A93 G;  4JI8 Q;  4OO1 G;  1GO3 E;  4DV6 L;  1E7Z A;  1S40 A;  4B3S Q;  4P71 A;  1PV4 A;  4BBS G;  2GVB A;  4PZ7 A;  3M4O H;  4DV2 Q;  1NMG A;  2OTL A;  3W5O A;  2JK8 A;  4L5R C;  4GKJ Q;  2Y0S G;  4LUO A;  2JEA I;  4BY1 G;  2K5H A;  1M1K C;  4LF7 L;  4KHP Q;  4YHH Q;  1D8L A;  3CCE A;  2E2H H;  4NXM L;  3K80 C;  1YHQ A;  3G6E A;  1JJ2 A;  4IPC A;  3SGI A;  5GAH C;  2F3I A;  2LSS A;  3H3V I;  4ALP A;  3T1Y Q;  2K5N A;  3AFP A;  2JA8 G;  4AQY L;  4GN5 A;  5IYB G;  4DV4 Q;  1IBK Q;  4LF4 Q;  2JA7 G;  2N8N A;  4A4I A;  2ASB A;  3HOU H;  1PVO A;  1IL2 A;  3M9B A;  1Q81 C;  4JYA L;  3PUW A;  1Q12 A;  3JC6 6;  3PUZ A;  1Q1B A;  1UEB A;  4O2D A;  3A74 A;  1VQI A;  1HR0 L;  2ES2 A;  1VQA A;  3RZD H;  1EIY B;  4YY3 L;  3GTO H;  3U58 A;  3PUY A;  4DR2 Q;  1UE5 A;  3PCO B;  1WOC A;  1VQ4 A;  1B7Y B;  3BZK A;  1XMO Q;  2VQF L;  4DR7 Q;  4R4T A;  2OQ0 A;  3RNU A;  1K0R A;  3BJU A;  3CPF A;  1YJN A;  1WCM H;  1OXX K;  2WAQ G;  1HJP A;  3I7F A;  4O0A A;  1VS0 A;  4DR1 L;  5IWA Q;  4DUY Q;  1VQ9 A;  3CQZ H;  3MEF A;  3OTO Q;  2IX1 A;  2R7Z H;  3S1M H;  1CKN B;  3ULJ A;  4JBK A;  4PG3 A;  1Y1W H;  4JI7 L;  2A8V A;  5GQO A;  1EWI A;  3H0G G;  2EXD A;  4J15 A;  1XMQ Q;  4JI8 L;  3M85 A;  1N36 L;  1HR0 W;  4GNX A;  4B3S L;  1KRT A;  3HOY H;  1L1O C;  3NBH B;  4GN4 B;  1SN8 A;  1TWC H;  4RMF A;  2YYZ A;  5M5Y H;  4DV2 L;  2UU9 Q;  2UXC Q;  4PZ6 A;  3HOV G;  1S3O A;  3I4M G;  3J81 j;  1SLJ A;  1SMX A;  2B63 G;  1Y14 B;  4A3M G;  2MO1 A;  4UY8 C;  3S1Q H;  2CWP A;  1EYG A;  1IBM L;  4KHP L;  4HIK A;  4LF8 L;  1VQG A;  4IOC A;  2AHO B;  4IFD G;  4R4I A;  5M3F G;  2K75 A;  1V1Q A;  3PGZ A;  4LFB Q;  4OWX B;  3HOW G;  4IFD J;  5JEA G;  3T1Y L;  3HOX H;  4X66 L;  1E1T A;  3S2H H;  1PH9 A;  1IBK L;  4LF4 L;  4GNX C;  3JAM i;  1I94 L;  4L5Q A;  1HNX L;  1OXS C;  3PV0 A;  4DV7 Q;  2UXB Q;  1VQH A;  1YNX A;  2HIX A;  3FKI G;  2GVA A;  1UE6 A;  5FJ8 G;  5C4X G;  5LMN L;  5C3E G;  4RG1 A;  3GTJ H;  1C7Y A;  4AH6 A;  3CCL A;  4A3E H;  3RN2 A;  1VQB A;  1EQR A;  3PO2 H;  3F8T A;  1Y1V G;  3PUX A;  5IYC H;  5IT9 c;  4DR2 L;  2I5H A;  2PQA B;  4DV5 Q;  4GOP B;  3WWV A;  2AKW B;  2RCN A;  1XMO L;  2OWO A;  1FVI A;  4DR7 L;  3F1Z A;  1JB7 A;  1KC8 C;  1IZ6 A;  4PZ8 A;  1CSP A;  1LYL A;  3PSI A;  2AWN A;  3KFU A;  2K52 A;  3M3Y H; 
#chains in the Genus database with same CATH topology
 1YZ6 A;  4IPH A;  2KCC A;  5IWA L;  4GC6 A;  2G9D A;  3GTP H;  4RGN A;  2UVR A;  2KCM A;  1M4V A;  1F9S A;  5LMN W;  1CA5 A;  4RKL A;  4UCS A;  4CDC C;  3RB4 A;  4EQO A;  4RHS A;  1CHP D;  3HOZ G;  4M9U A;  2UU9 L;  3MXN B;  2KA7 A;  4A3I H;  2UXD Q;  3FEW X;  3H3V H;  2I5L X;  5KEE A;  1I5F A;  3ICE A;  2N88 A;  1B44 D;  3F2D A;  4JBJ A;  1EIF A;  5BPH A;  1PRT F;  4N8F A;  1LAB A;  2KHJ A;  3R3O A;  4XQN A;  2LXJ A;  1STN A;  3J7Z C;  2ZJT A;  3Q8D A;  1P16 A;  4DR5 Q;  3GLK A;  4RB2 C;  1PTO F;  1KXL A;  2EOT A;  2W57 A;  5CR3 A;  3RJ0 A;  2NN6 G;  4L6T B;  4NLG A;  4ZUJ A;  4FS1 A;  2R92 B;  1MSH A;  2VS1 A;  2W6Q A;  1GUW A;  1WCM A;  1KJQ A;  4ZKC B;  3SVM A;  2NVT H;  2DNE A;  4JI4 Q;  3HEJ A;  1QZH A;  2AUJ D;  1XTD A;  4XT3 B;  1LTB D;  2XSC A;  3URY A;  2IHF A;  1N56 A;  3CAM A;  3DWA A;  2RBM A;  4TVA B;  5D3D A;  5FPO A;  4B3T H;  5BR8 Q;  1Q82 C;  3MXG A;  2AWO A;  4LUZ A;  3C0F B;  1VQN A;  4ZOL F;  2E5L Q;  1HXY D;  4B3R H;  5C3W A;  4F7X A;  3H6M A;  2FIN B;  3NXW A;  4J1M A;  1YIT A;  5CA0 F;  4FP5 D;  1V4Y A;  5IP7 G;  3Q0A A;  3GTL H;  5GAG C;  1OXV A;  3DWP A;  1S5E D;  2EYP A;  2CFM A;  2F3V A;  3LGJ A;  4Y8V B;  4GN3 B;  3PO2 B;  1UWV A;  4A3B G;  2XCL A;  4JI6 L;  2EYH A;  3CW2 C;  1U0L A;  5JJK A;  2HCC A;  3EJI A;  4ZQ3 A;  1C48 A;  5KFO A;  4ECQ A;  4TRD A;  4QUF A;  1TWG B;  3OUU A;  3NBI A;  3SI8 A;  4DFA A;  4RH6 A;  2DIK A;  1EUC B;  2A6H D;  5ELO A;  4Q45 A;  3KHG A;  1HNZ Q;  3LWU A;  3PUV A;  2KUM A;  2MO0 A;  4KI0 A;  4X65 L;  1TWF A;  4LH6 A;  5I4D A;  1HNW Q;  4A3C H;  5C5J A;  5EDW A;  1CKN A;  3EIV A;  1DYQ A;  2CVR A;  3CCQ A;  1W2B A;  4GKJ L;  1TS4 A;  2NTT A;  4ED2 A;  3TIN A;  4HID A;  2ZM6 Q;  1N34 Q;  4ZLT F;  1UE1 A;  4IPD A;  2L0C A;  4DPG A;  3JRX A;  4U6P A;  4XT1 B;  3RUP A;  2F0S A;  4DR3 L;  5LMU Q;  1ASY A;  3HG9 A;  1HUM A;  3Q2O A;  2XRQ D;  2ZDQ A;  4LF5 L;  4DNI A;  1DOL A;  3OSP A;  3BZC A;  1A0I A;  5JEA J;  5EKI A;  3RLN A;  4U67 3;  2VQE H;  4FM9 A;  4O3P A;  3ULP A;  3OIQ A;  2R93 H;  3N6X A;  5C44 H;  3VR6 A;  2KHS A;  3X3M A;  5CC4 A;  2RVL A;  1ZQ7 A;  1Q46 A;  3HOY G;  1PH3 A;  2L11 A;  2X0S A;  5KFU A;  1LTL A;  3NHH A;  1IHZ A;  2UUA Q;  5JH7 F;  1L2F A;  3H3V C;  3HKZ E;  2CKZ B;  3K3P A;  4JI0 L;  1QZG A;  1LTS D;  5L37 A;  1NBW A;  3TRE A;  1BO0 A;  4HJ7 A;  2SNM A;  3A0J A;  1LAC A;  5KRU A;  2EY5 A;  3E9I A;  4X3K A;  1SFO A;  4DUY L;  3V6K A;  1QUQ B;  4ED3 A;  3KLR A;  3A8J E;  3F8N A;  4GOP A;  1Z9F A;  3HOX G;  1WTX A;  4Q8E A;  3MFG A;  1PH4 A;  2D0O A;  2JEI A;  5KFK A;  1MBY A;  5KT7 A;  2JA5 H;  5CA1 F;  4WJ4 A;  3TQ1 A;  1H9J A;  5C4H A;  4UP8 A;  4KHZ A;  3KOJ A;  2ICI A;  3W1G A;  3HP3 A;  3RAQ A;  2WKD A;  2JXM B;  1FNW A;  1U4P A;  2ID0 A;  4JC0 A;  2ZJQ A;  1SND A;  5IYC G;  2Z8L A;  3ZJY C;  3J81 L;  2MPM A;  3RLF A;  1I50 B;  4NXM Q;  5C0X J;  1XPO A;  3K7A B;  1X56 A;  3X3N A;  3KLS X;  4DNT B;  1STB A;  1IBM H;  3S2D H;  1VBG A;  3VYT A;  4TKO B;  1E4E B;  4OO1 H;  4B9X A;  4XX0 B;  3BA9 A;  4LW1 A;  2AQ1 B;  2F03 A;  3I12 A;  2R7K A;  4YAJ B;  4HNU A;  2MGS A;  1HFG A;  4YWK A;  2RHQ B;  2I5M X;  4ETS A;  4POF A;  1KIX A;  4EQ5 A;  2IP4 A;  1I94 H;  1RK5 A;  3N6R A;  1YEZ A;  3C3L A;  1Z2P X;  1BCP C;  4CC6 A;  4A3I G;  2YS7 A;  2WB1 E;  5LXT F;  4DV5 L;  4DF7 A;  3BU2 A;  4EBC A;  5M3F B;  5DG7 A;  4ECU A;  2ATL A;  1CQJ B;  2FKL A;  2HQL A;  2CW0 C;  2F4V H;  4U7C A;  2JA8 H;  5IT9 E;  1SXT A;  1PFS A;  4OL7 A;  3MFH A;  1XXG A;  3HKZ G;  1K83 B;  1NSN S;  3OHX C;  1UNN C;  3MFY A;  3M4P A;  5EAY A;  3W2D A;  1STE A;  4HSV A;  5C6A A;  2W71 A;  3HXL A;  3CRL C;  4UCR A;  3TS2 A;  2UXD L;  4JI5 Q;  2E2I H;  3T5H A;  3KJO A;  3V2T A;  1G6Z A;  1SRO A;  1HPC A;  2YZG A;  1I4H A;  1EWH A;  4CKB A;  4ZHQ F;  2L12 A;  2R8K A;  1R4P B;  3CME A;  3PR5 B;  4MTN A;  5CV9 A;  1EWC A;  5KFL A;  5KYL A;  2GA4 B;  2KED A;  1VQD A;  2A19 A;  3EA6 A;  1HNX Q;  4IUU A;  5HGQ A;  1ET9 A;  1ICF B;  3OMG A;  5I9O A;  1JJC B;  3J7A F;  4QIW E;  2DY7 A;  4JI4 L;  2JA9 A;  2Q2T A;  3GTP A;  2K01 A;  2K6A A;  3BQ0 A;  4RWS C;  4HYK A;  4FXG C;  4A3M H;  3B6Y A;  2DGY A;  4WJ3 M;  3PW7 A;  5DLQ E;  1CHQ D;  3M4Q A;  5EKL A;  1WTQ A;  1I6H H;  2R7L A;  1EHI A;  3A7L A;  5FK9 C;  2F52 A;  1AZP A;  2R82 A;  2Z0S A;  5JEA H;  5CAE B;  4C3H H;  3BVZ A;  4GNX B;  1EYC A;  4P75 A;  2E5L L;  1K8A C;  1KBL A;  3JAM E;  2WB1 G;  4MNO A;  5KT4 A;  1PDQ A;  4LMY A;  4YQW A;  4O42 A;  2F0Q A;  1HTP A;  5FJ8 H;  4A93 B;  4LF7 H;  5C4X H;  1K8O A;  4AYB E;  1O80 A;  3K81 C;  1AFP A;  3KYH C;  3PIO A;  2L5T A;  3HKZ A;  1Y1V H;  4HTH A;  3J81 c;  3WO0 A;  2C28 A;  4EG0 A;  4DV1 L;  2B2U C;  1F2Z A;  2J0T D;  3K5M A;  3SXH A;  1GUG A;  2X69 A;  4LSA A;  3I55 A;  1N32 Q;  3UE1 A;  1E24 A;  1S4Z A;  5IIF A;  4YP3 A;  1RYS A;  4HIM A;  2XRS D;  2IHE A;  3CRK C;  2G5D A;  4RNN A;  4LSX A;  4YAK B;  2K33 A;  1QIL A;  4QB4 A;  4C1N I;  2AU0 A;  1JX4 A;  1X3E A;  4MA0 A;  1SR3 A;  2WDT A;  5BMV F;  1JKJ B;  1B1Z A;  4C2M A;  4OX9 Q;  2HHH Q;  4LF9 Q;  1HNZ L;  2F0M A;  4QF4 A;  1E0B A;  5CMD A;  1X3F A;  5KT6 A;  1GUO A;  2R93 G;  1HNW L;  2RDH A;  2L9H A;  1T5X D;  5C44 G;  3M4O B;  4JBM A;  1YHA A;  5C0X H;  3KTM A;  4JI7 H;  1IYU A;  1X55 A;  1NCV A;  2ZM6 L;  1N34 L;  4K8I A;  2W8L A;  1STG A;  2C9O A;  1FL0 A;  4G4K A;  1VQF A;  2MUY A;  3T51 B;  2G9H D;  2I87 A;  3GV3 A;  4I50 F;  2GN5 A;  1G29 1;  1YNN C;  1FGU A;  1GVP A;  4AQY Q;  4KHP H;  1PH6 A;  2IWH A;  3GD7 A;  3KBX A;  1OTC A;  1AN7 A;  3CCM A;  1SCU B;  2Z6K C;  2WB1 A;  4JYA Q;  3Q1K A;  2UUB L;  4RZQ A;  1X3Q A;  2JA5 G;  2WAQ E;  3PW0 A;  4OWW B;  2HVR A;  5EKK A;  1X6O A;  1J5E L;  2UUA L;  1TQO A;  2YU9 B;  4IZ8 A;  2NZH A;  2VXW A;  4YY3 Q;  5DGB A;  1S5B D;  3GTK H;  4AYB G;  1IKM A;  1CQI B;  2QDB A;  3P1H A;  5CV8 A;  4QWA A;  5ELE A;  4OIJ A;  2W6P A;  4DKA C;  5FO7 B;  3GV8 B;  1B53 A;  5C3X A;  5A2Q E;  1G2S A;  3FVQ A;  2HQE A;  4B08 A;  1UUP A;  4I55 F;  1ASZ A;  1SYC A;  5JVD F;  3FPU B;  2J6S A;  2KEE A;  4R8N A;  4OO1 G;  3OHB A;  2MHV A;  3RGX A;  1O7Y A;  1EQV A;  5M5Y B;  1LO5 D;  2FMM A;  3K5O A;  3AB9 A;  1NMG A;  1GUS A;  4PDB A;  2UUC H;  3LWB A;  3VMM A;  2Y0S G;  4LUO A;  5F9L A;  1ZYR D;  2R93 A;  2K5H A;  4DL5 A;  1F2Y A;  1H9R A;  1D8L A;  4NXM L;  4O3Q A;  5DG9 A;  3N42 B;  3SK5 A;  4JPB W;  2UXC H;  1EQT A;  2EYM A;  5JOB A;  1CQF A;  3S2H B;  5KFH A;  4HNT A;  1HCZ A;  2JA8 G;  4LF4 Q;  5JPN C;  3K5I A;  4KKU A;  2Q8T A;  4QIW A;  1KJI A;  1IL2 A;  3BG5 A;  3M9B A;  5C8Y F;  5M3M B;  4KTA A;  3GTJ B;  2RA4 A;  3A74 A;  1HR0 L;  1EIY B;  4ECX A;  4DV7 H;  3TZU A;  5FLX E;  3PCO B;  1VQ4 A;  2CW7 A;  1B7Y B;  3J80 L;  1K0R A;  3HGB A;  3BJU A;  3CPF A;  3ERO A;  3GP7 A;  5BN5 A;  2W6M A;  1WCM H;  3RB6 A;  1DON A;  2WAQ G;  1JQY D;  4O0A A;  1VS0 A;  5IWA Q;  3CQZ H;  1WTV A;  4JBK A;  2A8V A;  5GQO A;  1EWI A;  4IWX A;  3NK9 A;  1HR0 W;  3M85 A;  2O5I C;  4K5W A;  1KRT A;  4MV3 A;  3AMU A;  4DV2 L;  4A3I B;  2UU9 Q;  3LP8 A;  4PZ6 A;  1S3O A;  3J81 j;  2B2V C;  3DEP A;  4A3M G;  2MO1 A;  4DR4 H;  3S1Q H;  3J80 W;  1S0N A;  4IOC A;  4IUR A;  2AHO B;  4J9R A;  4R4I A;  1IL8 A;  5AFW A;  1AUX A;  3Q8R B;  1EU3 A;  2XVS A;  4CKC A;  5JEA G;  3T1Y L;  4C3H G;  1VF5 C;  1G91 A;  2YRX A;  1ZXT A;  4L5Q A;  5KFE A;  1D6E C;  1TWA B;  1HNX L;  4KJN A;  4FVM A;  1YNX A;  4J9M A;  5KFZ A;  2SDF A;  2NVT B;  1Q90 A;  1LTT D;  2EYJ A;  2GVA A;  5FJ8 G;  2ASJ A;  5C4X G;  1BOS A;  1Y8P B;  1TVX A;  2JEF A;  1EQR A;  4HNV A;  5COY A;  2FK3 A;  1Y1V G;  4ZCK A;  1LTA D;  1N33 H;  3FMA A;  4DR6 H;  1XMO L;  3TP5 A;  4DR7 L;  3WO1 A;  2L4N A;  4PZ8 A;  1CSP A;  2RSN A;  5L1I A;  2AWN A;  4ECW A;  1V8Q A;  1PHJ A;  1TWF H;  5D14 A;  1U4R A;  3EQL C;  5A35 A;  5LL6 X;  2SOB A;  4JV5 H;  2F0G A;  4FDB A;  2C2E A;  3GTL B;  4IJH A;  4DAP A;  1CZG A;  2WAQ A;  5JVL A;  4J9K A;  4HJ8 A;  3I70 A;  2ZXR A;  1BCP B;  1D7Q A;  3KAJ A;  2VL6 A;  1A63 A;  4LFA H;  2XN9 C;  1K8M A;  5EPL A;  4DV4 H;  4IAJ A;  1VBH A;  1ILQ A;  2I46 A;  5C0X G;  3Q22 A;  4M1U B;  2QDL A;  3K5N A;  1KAW A;  2Z4I A;  5DLF A;  4RCO A;  1A2U A;  1CSQ A;  4DUZ Q;  3QO2 A;  3A54 A;  5M5W H;  3KLS A;  3F2B A;  1IBL H;  1B3A A;  1K73 C;  4DL3 A;  2R7Z B;  1MJC A;  2V58 A;  1Y1W B;  1WTO A;  3TS0 A;  4OX9 L;  4LF9 L;  3PF5 A;  4CDE C;  5GAE C;  1X3P A;  4RKB A;  3N40 P;  4X65 Q;  4X3U A;  4B3M Q;  2PMZ E;  1FJG H;  1SFO H;  3J80 c;  3ND9 A;  4A3B H;  1S68 A;  1XMQ H;  4R4O A;  3G48 A;  2W9B B;  2UVU A;  1B70 B;  1Y1V A;  2FJZ A;  4DR3 Q;  5KFM A;  3GIM A;  1TXY A;  2R7F A;  1PTO H;  2EYL A;  2YTV A;  4FF4 A;  1GUT A;  2IL8 A;  1ENF A;  5EPK A;  4GZY C;  4LFC L;  4C3I H;  4LF5 Q;  3GQB A;  4R4Q A;  3BAA A;  5DNF A;  4I7H A;  1HRJ A;  5EPJ A;  4IUV A;  1S97 A;  5CBE E;  5FO8 B;  4X6A H;  1JWU D;  4JI2 H;  4OIK A;  4X62 Q;  1EYZ A;  2M2L A;  2FXQ A;  3OYY A;  4KK7 A;  5KG3 A;  1J6Q A;  2VOB A;  2J7Z A;  4KKS A;  1HQM C;  3S17 H;  3SR1 A;  2K5D A;  1M8A A;  3I4L A;  1VQ7 A;  4JI0 Q;  1A3V A;  4RAY A;  3C46 A;  3K57 A;  5F2D A;  1BBU A;  5LHY 1;  1CKM A;  1TU2 B;  3KDF B;  1NTG A;  2VR1 A;  1L1O B;  1KDB A;  2MFI A;  3CCU A;  4TV8 F;  2V4D A;  1DD2 A;  1A8V A;  2JA5 B;  2W6Z A;  1DV2 A;  3NTH A;  3CMA A;  3D0F A;  4G7H C;  2V4Q A;  2QA4 A;  2B2Y A;  4A75 A;  2A68 C;  1D1K A;  4AYB B;  5T1G A;  3CHB D;  5JPM C;  1SDF A;  4YR2 A;  1H9S A;  3T1H H;  2Z9H A;  4Y7N B;  1STY A;  3NBH A;  4YJ2 F;  4KLK A;  1GSA A;  2AMC B;  2CH4 W;  3F2U A;  1VQP A;  4GKK H;  1GGO A;  1AE3 A;  1ESF A;  4HJ5 A;  2K5W A;  1WCM G;  3I4O A;  4XDX A;  1JOO A;  5DAU A;  5GRO A;  1KL9 A;  3S2D B;  1ILP A;  3RBD A;  4M7E A;  2WII B;  2ZTE A;  2FMA A;  2HCI A;  4H02 A;  3CD6 A;  3RFC A;  1XPR A;  1O7Z A;  3T5J A;  5FD5 A;  1B3Q A;  4FS2 A;  2XNA C;  5EGT A;  1EOT A;  1XNR H;  3I72 A;  3M9N B;  1HTL D;  2VA2 A;  2EJM A;  1AH9 A;  1PFM A;  2Y0S B;  1BNZ A;  2IY5 B;  2NB0 A;  2PQE A;  5KFA A;  1VQ8 A;  4EGV A;  4JOI A;  4UP7 A;  3E0J A;  3H4B A;  4GLX A;  2NVX B;  1GOZ A;  4WRD A;  2FP4 B;  1LUZ A;  2IBK A;  4DL4 A;  2JA8 B;  5I47 A;  5D1O A;  1LTR D;  4NXN H;  3OWF A;  3S14 H;  5IOC A;  2FHT A;  2V9W A;  2F0N A;  3KAL A;  4RA8 A;  4B3T L;  1HZB A;  4DV0 H;  1Z7T A;  4UCT A;  1I4G A;  2K05 A;  2O4X A;  4MTD A;  4ME6 A;  2DUD A;  1STH A;  2E2I B;  1PH1 A;  3I3C A;  5IYD H;  4B3R L;  1VQO A;  3G8C A;  2C5C A;  2W9C B;  1T5E A;  1T36 A;  1SRU A;  2VQD A;  1Z2N X;  1PRT C;  1Z2O X;  2OEO A;  4DAY B;  4Q8F A;  2Q2I A;  4XTC S;  3OOC A;  4GOP C;  4IOA A;  4R8U B;  3OW2 A;  1RIP A;  4HCE A;  1XNQ H;  3NEM A;  4R4C A;  3V96 A;  2NVY A;  4QW8 A;  1JWS D;  1M7J A;  1PTO C;  2M00 A;  1CKO A;  4RFB A;  3DWQ A;  1BR9 A;  5C4J H;  1K0S A;  2PMZ A;  3RUZ A;  4XQQ A;  4X3S A;  1I6V C;  1C4Q A;  3MHB A;  2A1A A;  4EGJ A;  3CQZ A;  3ULL A;  4A3M B;  4ME3 A;  1SEI A;  2QGQ A;  4BY1 H;  1I6H B;  4RGO S;  3UI2 A;  5ISR A;  5KFD A;  3D31 A;  3NSW A;  4FXD A;  2C2R A;  3O13 A;  4UCO A;  3OUZ A;  2AGO A;  3T53 B;  4C2M H;  2PBZ A;  3MR6 A;  2XIG A;  1O7I A;  2PN1 A;  1TWH H;  1JIC A;  3H91 A;  4DR1 Q;  4DNR B;  4K5V A;  5IYB H;  1BBX C;  2JA7 H;  3STB D;  4JI3 H;  3QB3 A;  1V1P B;  3KF8 A;  2R61 A;  4CC5 A;  4FNF A;  4DGZ A;  1CFM A;  3GTM B;  3BYT B;  1KDC A;  1S0O A;  1ULZ A;  1A62 A;  3SE7 A;  5KG6 A;  2R84 A;  1LM0 A;  4MHE A;  2BQR A;  4J0M A;  3TP6 A;  2V1C C;  3QR8 A;  4POG A;  2NN6 I;  1O78 A;  2RSO A;  2E2J H;  3VPD A;  4YCU A;  3R23 A;  4RNM A;  4C3J H;  1WTW A;  4IR9 A;  4DV1 Q;  1NAP A;  1SMY C;  2VQE L;  3K0X A;  4LF8 Q;  2BDN A;  1GLV A;  4DUZ L;  2NVQ H;  3KK7 A;  4IRD A;  2XGP A;  1AZQ A;  1T3N A;  2QCP X;  1EUJ A;  2K14 A;  1I4X A;  4L5T A;  4CJ0 B;  2BH8 A;  3DM1 A;  1YNJ D;  3QFF A;  1NNX A;  1A9X A;  4O1N A;  4GS3 A;  4C3I G;  3KF6 A;  3Q6S A;  2M05 A;  3L0O A;  4QWD A;  4A3K B;  1QVG A;  4B9W A;  2IA6 A;  3HOV H;  4A76 A;  3NP8 A;  4B3M L;  2R7N A;  4OHJ A;  2B63 H;  2B2T A;  1I7N A;  4BA2 I;  4R1J A;  1KEE A;  3BVM A;  5CV7 A;  2ZDH A;  2BQ3 A;  3FRP B;  4YB8 B;  3RD4 A;  4IFD H;  2R7D A;  5IY0 A;  3HOW H;  4DV6 H;  3NTK A;  3P75 A;  4O3S A;  4P73 A;  4HQ6 A;  2I80 A;  2A69 C;  2BA0 A;  3AQQ A;  2D5D A;  2C35 B;  2W7P A;  3J7A 5;  3TP8 A;  1SJH D;  4RB1 A;  2UUC Q;  1I7L A;  4TQS A;  2D0P A;  3FKI H;  3GTG A;  5FOB B;  1K1S A;  4C5A A;  1MIU A;  4YJ3 F;  4X62 L;  4BBS B;  5KFC A;  2V5A A;  2YRW A;  1E4F T;  2UUB Q;  4FF3 A;  5KFF A;  5I2Y A;  1NR2 A;  1A15 A;  2TSS A;  4DV3 Q;  3GTK B;  1J5E Q;  1PH8 A;  5C5M A;  3NQI A;  1SE3 A;  1EFW A;  3SEB A;  3VR2 A;  1VQ5 A;  1LTG D;  3I56 A;  1I3Q A;  3FDT A;  1CT1 D;  3VDY A;  5I6Y A;  5E4W C;  3RTX A;  4JI6 H;  4ID6 A;  2EY1 A;  2JA6 H;  5L9X A;  3U9T A;  2VQF H;  1DIK A;  3A5U A;  2Q2H A;  3HS0 C;  1X32 A;  4OWT B;  2F4V L;  1HH2 P;  3JZI A;  5KFP A;  4PNY A;  3RZO B;  2FE3 A;  4QCL A;  1IYJ B;  3MWD A;  1EY5 A;  5J3B A;  1KAB A;  5KGU A;  4IUP A;  3CCR A;  1N36 H;  4BY7 H;  4JI8 H;  3S1N H;  3RLO A;  5KNC A;  4GLA C;  4B3S H;  1Q1E A;  2KCN A;  4P74 A;  1LTI D;  3L4J A;  3U50 C;  3I4N H;  2HJW A;  2R86 A;  1X9N A;  1FR3 A;  1KQS A;  3S1R H;  1IOW A;  4GKJ H;  1DOM A;  2SEB D;  2PNR C;  4JV0 A;  3BDC A;  3D8G A;  1T9H A;  1W6J A;  4HIO A;  3V4Z A;  1Q86 C;  1TS3 A;  2IPK D;  4DR4 Q;  4LUV A;  1G6P A;  3PF4 A;  4J9Q A;  2CQO A;  2JJQ A;  4JW0 A;  3FHW A;  1D5M C;  3I4M B;  3DM3 A;  4ZKB B;  4X66 H;  3H0G A;  3IL8 A;  1HR0 Q;  2JEB I;  3RR5 A;  3R5H A;  1IBK H;  1TY0 A;  3GV7 B;  5C4Z A;  4F50 A;  5IYD G;  2Z4H A;  4APM A;  4K14 A;  2YV5 A;  3TII A;  3PO3 H;  2NTS A;  1WCM B;  4YWL A;  2KVM A;  2VA3 A;  4DR2 H;  4JI1 Q;  3U9O A;  1EZ6 A;  2VY3 A;  1N9W A;  2XTI A;  4C56 C;  5C3E B;  4RUC A;  5CYU A;  2BR0 A;  3BZD B;  1E7Z A;  3N41 B;  1PV4 A;  4DUY H;  5KFS A;  4DV2 Q;  4KKT A;  2OTL A;  1V51 A;  1U9R A;  2JK8 A;  3LNN A;  4L5R C;  1D2B A;  2D2C C;  3S1Q B;  4YR3 A;  3ETJ A;  5FD6 A;  4BY1 G;  3A7A B;  4LF7 L;  2J4X A;  2K7V A;  4YHH Q;  4L63 B;  3K80 C;  1YHQ A;  1EL0 A;  2FK1 A;  2FPG B;  3GTQ A;  4EQN A;  3MWY W;  1RKN A;  4IPC A;  3SGI A;  2EPB A;  2LSS A;  3H3V I;  1RJR A;  1OWT A;  3DXJ C;  5KYI A;  2RCF A;  3T1Y Q;  3AFP A;  4U68 A;  5IYB G;  4DV4 Q;  3NWT A;  2JA7 G;  1DXM A;  3HOZ B;  4ECY A;  5JJZ A;  4J9S A;  3S15 B;  1FYC A;  3PUW A;  1OO9 B;  4J9L A;  3PUZ A;  1VQI A;  3RZD H;  1GSH A;  3MR5 A;  5FLX L;  5F9N A;  1R9T A;  3CKI B;  3U58 A;  3L4K A;  2UXB H;  2BE5 C;  5DG8 A;  1B50 A;  4C3J G;  1XMO Q;  1PZI D;  2F0E A;  4DR7 Q;  3M9O B;  4R4T A;  4ABN A;  4V0B A;  5ELF A;  3E5S A;  2AQ4 A;  3I7F A;  1SYD A;  1ZEQ X;  4DR1 L;  1MD2 D;  1TWF B;  1VQ9 A;  3MEF A;  3OTO Q;  3S1M H;  2IX1 A;  1CKN B;  1ICW A;  4PG3 A;  1F2L A;  4JI7 L;  3PIO 3;  2A6H C;  1ZKO A;  4ZRZ A;  4EFB A;  4CBV A;  1XMQ Q;  4DL7 A;  3MC0 B;  5KFT A;  5KFB A;  5FLX W;  1L1O C;  2NYZ D;  4GN4 B;  1JDE A;  1S5C D;  2ZDG A;  1PXU A;  3HOV G;  2B63 G;  2JSO A;  4LAA A;  4P2C B;  4K8J A;  2R8J A;  4KHP L;  2OH2 A;  4LF8 L;  4IFD G;  4K6L A;  1ESR A;  2UXD H;  1EIG A;  3RV3 A;  4L8J A;  3HOW G;  1D1I A;  1E1T A;  1PH9 A;  3JAM i;  1CA6 A;  5EWG A;  3KBG A;  3R5F A;  3D4W A;  3JRW A;  3ORR A;  1VQH A;  3U9S A;  4F87 A;  5JUM A;  3MR2 A;  3K6O A;  3FKI G;  3T16 A;  1UE6 A;  2F1M A;  1TWH A;  4DR5 H;  1EY9 A;  1SYB A;  1H9M A;  4KN7 C;  1C7Y A;  1EZ1 A;  1KLU D;  4AH6 A;  2JA7 A;  2YZM A;  4ED6 A;  3IKJ A;  1SFO B;  4RU9 A;  3GIK A;  3PO2 H;  2ICE C;  4JK1 C;  1PRT B;  2I5H A;  4A3B B;  3KHL A;  4GOP B;  1SNP A;  5LP6 F;  3L9A X;  4BS9 A;  1JB7 A;  3OSO A;  1KC8 C;  4MA5 A;  1RHP A;  3EPI A;  4JI4 H;  4O2A F;  4HR7 A;  1VMC A;  1ML0 D;  1BDO A;  1E2W A;  3M3Y H;  2EZV A;  1PTO B;  2YCH A;  1TS2 A;  1WTR A;  2UUC L;  1W6K A;  3BDL A;  4LFC Q;  2QW7 A;  4NB3 A;  5BR8 H;  2E2H A;  1YI2 A;  4EYH B;  1U4L A;  3ER0 A;  2E5L H;  2JA6 G;  3AYH B;  3D6W A;  1EY4 A;  4UCV A;  3D4D A;  2EIF A;  1F2M A;  2UXC L;  5IYZ F;  2Q8I B;  1KTK A;  1VQE A;  2J6U A;  5J39 A;  1IKL A;  1N8R C;  1PYB A;  3RV4 A;  2HDM A;  4DV3 L;  3S17 B;  4X64 Q;  1WFQ A;  1AEX A;  5FLM H;  3CF5 A;  2WAC A;  4LH7 A;  2F0U A;  1QVF A;  1MSG A;  3FMC A;  5KKN B;  3LX0 A;  4BY7 G;  3J81 E;  4PMB A;  2B63 A;  4UPA A;  3GTO A;  1F9Q A;  4NW2 A;  1HA5 A;  4S3S A;  3SK4 A;  3BS1 A;  3H09 A;  5GAD C;  3I4N G;  4DV7 L;  5HUR A;  5LL6 b;  1YVC A;  1Q3L A;  1KHI A;  2E2D C;  3M7G A;  2KBN A;  3UFX B;  4F4Y A;  3HOY B;  1JLL B;  1AP0 A;  3W3A A;  5BN4 A;  4ODG A;  5HBR B;  3G4S A;  1WR2 A;  5LA6 F;  3IFT A;  1U5K A;  2EY2 A;  5KT5 A;  3FKI A;  2ZJP A;  4IO9 A;  1R4Q B;  1EY6 A;  2B8F A;  1VCI A;  1PYS B;  2C00 A;  1HNZ H;  2CWA A;  1TWC A;  3RF2 A;  3J81 i;  3MR3 A;  4N9T A;  1AW7 A;  1B8A A;  2BDO A;  3SHL A;  3PO3 G;  3MXU A;  2KJX A;  2FLL A;  3HOX B;  1KC7 A;  2BA1 A;  1YBY A;  3UDI A;  2VPQ A;  1C9O A;  2R85 A;  1BGW A;  1II3 A;  3A8I E;  4DA2 A;  2HIV A;  2HVQ A;  2ZM6 H;  4DR4 L;  1K3R A;  3A55 A;  1DZ1 A;  1PYW D;  3GID A;  5LMU H;  1SYE A;  4EQP A;  4LFB H;  4IJL A;  1Y8O B;  2VPS A;  3NTI A;  2CCZ A;  3MVV A;  3HBL A;  1XNQ Q;  2RKS A;  1QWY A;  2JA6 A;  4PMW A;  2NVY H;  5KT3 A;  4QJF A;  1NMF A;  2W6O A;  5KNB A;  2BOS A;  1MJE A;  4BBR H;  1B33 N;  1V43 A;  3EYY A;  1WH2 A;  2UUA H;  1XWE A;  3GTP B;  2F0O A;  4JI1 L;  1N33 L;  3VA7 A;  2J6T A;  1EYD A;  4YWM A;  4JBW A;  3SK8 A;  3OPO A;  5EBD A;  2RQX A;  2R6G A;  2WKC A;  4NPS A;  4ECS A;  2B29 A;  3MJF A;  5DM6 3;  2O2L D;  2B39 A;  2N78 A;  4Q0F A;  4B3T Q;  1IW7 C;  1GUN A;  1DGS A;  1P8L A;  1WI5 A;  4EX5 A;  4CGY B;  4B3R Q;  5KG2 A;  4JV5 L;  5TSS A;  2F0V A;  2R6F A;  2NU7 B;  1V9P A;  2B2U A;  2KCT A;  4YHH L;  1DV1 A;  4JVZ A;  4LNQ A;  4EBE A;  2VUM A;  3PIP A;  3TP7 A;  2RDG A;  4WJW A;  3IN5 A;  3OWE B;  1M90 C;  3RAX A;  1JJG A;  3U4Z A;  1SSO A;  4LFA L;  3HKZ B;  3BQ2 A;  1BJT A;  3J7A K;  4DV4 L;  1K83 H;  1JB3 A;  4JCV E;  5C4J B;  1Q8K A;  3CCJ A;  4PMC A;  4NXM H;  2R92 G;  2B2Y C;  1CQV A;  2ZTD A;  5E1F A;  3MWE A;  4OEL B;  4XYM B;  4LF6 H;  2ZTC A;  5HY6 A;  4ZK9 B;  2OTJ A;  3PZP A;  1NJI C;  5J2U F;  2A5H A;  3G6V A;  2PW7 A;  4BY1 B;  1IBL L;  4MTE A;  2JQO A;  3VPB A;  3MA2 B;  2XCA A;  4C2M B;  5IOD A;  4DXG A;  3DUZ A;  1LLR D;  2F4I A;  1GM5 A;  4MZ9 A;  4Q0Y A;  3IG0 A;  3CXC A;  2I0Q A;  4ED8 A;  1X54 A;  1FJG L;  3OTO L;  1U4M A;  2L1B A;  2PQA A;  1EY7 A;  2RGV A;  4J9N A;  2EYO A;  2J9G A;  1PH7 A;  2F0F A;  1XMQ L;  3TBI B;  3UDG A;  4FU0 A;  2P5Z X;  1WVL A;  1VQJ A;  2DN8 A;  4BWG B;  1MZB A;  2B2W A;  1E2V A;  2E2J B;  4FF1 A;  3PQI A;  2Z6K A;  5C1P A;  5L1L A;  2EJF C;  4HJA A;  2L15 A;  4C3J B;  4IRC A;  1E1O A;  3PO2 G;  3HRZ C;  3QZ8 A;  1KLG D;  2VQE Q;  1T94 A;  4JI2 L;  3GTG H;  3MXN A;  1CZW A;  3SK6 A;  4JI5 H;  5ELN A;  1EUD B;  5BN3 A;  2WB1 B;  1HHV A;  1SYX B;  4DK0 A;  2W6N A;  1V1O A;  2LMC B;  1OXT A;  1EQQ A;  1CUK A;  1FNU A;  4A93 H;  1CI3 M;  2FLN A;  1SE8 A;  3QIA A;  2LFN A;  1B9M A;  2QIL A;  3HOV B;  1RJP A;  4O3N A;  1SAP A;  2R92 A;  1I3Q H;  3RGZ A;  2IMW P;  1H95 A;  3HOW B;  5FLM G;  2K1B A;  5CV4 A;  1VQ6 A;  2NZ1 D;  4RAZ A;  5KG4 A;  1IOV A;  4ZQI A;  3ERS X;  3TQY A;  1K8G A;  5KFN A;  5C0X I;  1JC7 A;  2RGR A;  1K3B C;  4R9W A;  3T1H L;  5M9O A;  5J1Z A;  1HZA A;  2V4R A;  4FXK C;  2R93 B;  4CJ1 B;  2XC9 A;  5C44 B;  1B04 A;  4GKK L;  5E4X A;  5CGK A;  4FBU A;  1LT6 D;  2IT1 A;  4ZUI A;  5H80 A;  4P72 A;  1VQC A;  4X64 L;  1BXT A;  3TN2 A;  4R8I A;  1IBM Q;  1SMY D;  2KEN A;  5EBC A;  3E5N A;  4QIW B;  4HSP A;  4K0K H;  1ET6 A;  1RL2 A;  1XNR L;  4DN4 M;  3CVZ A;  2QEJ C;  5T14 A;  5BPF A;  3EN2 A;  5G3L D;  4X66 Q;  1M6V A;  1GYF A;  4G7Z C;  3PW4 A;  1I94 Q;  3H0G H;  1PLF A;  5DGA A;  1N32 H;  4EEY A;  5IGB A;  1RJQ A;  2GLT A;  2ASL A;  2LXK A;  4BWS C;  2H4O A;  2F4V Q;  1TWG A;  5K2M A;  1ZET A;  3H20 A;  4NXN L;  1SBB B;  2YU9 H;  2ALY B;  4ULL A;  4UP9 A;  2OLS A;  1NR4 A;  2F3W A;  1N48 A;  4OX9 H;  2HHH H;  4LF9 H;  4BY7 B;  2VW9 A;  4HJ9 A;  3S1N B;  4G7O C;  1YJW A;  2Z1C A;  1KD1 C;  4DV0 L;  2MCT A;  2QF7 A;  3I4N B;  2V59 A;  3G7L A;  3J80 E;  2A69 D;  4BBR G;  3S1R B;  2HGS A;  2WYO A;  5JQW A;  5KG0 A;  3NGD A;  4DK1 A;  5AJ3 Q;  2EQS A;  4QY7 A;  1A3U A;  2FPI B;  1EEF D;  2B2T C;  1S5F D;  3OW7 A;  4N8X 1;  5JVG 3;  3WOE A;  4KY6 A;  3HZX A;  3CPW A;  3GTQ H;  2DJG C;  1XNQ L;  4AQY H;  4IR1 A;  1RJT A;  1D5X C;  1DOK A;  3DLL A;  1KJ9 A;  1M0T A;  2QKI C;  1G8Z D;  1Q7Y C;  5M5X H;  3PO3 B;  5DQG A;  2LY7 A;  2BH2 A;  4RNO A;  2R8H A;  4JYA H;  3J80 i;  4QUC A;  1X65 A;  3UDX A;  2XD4 A;  4YY3 H;  2JEJ A;  1NUC A;  1UC8 A;  4Q44 A;  1R9T H;  2AGP A;  4A3D H;  1G2T A;  1JIH A;  1VQL A;  2FPP B;  1SNC A;  2SCU B;  5H1S E;  4QWB A;  5JJI A;  1EFI D;  5M3M H;  1XPU A;  3GQC A;  2A6E C;  3N8D A;  3ORQ A;  1QUQ A;  4MV8 A;  1SNO A;  4H13 C;  4ZYS A;  4QL5 A;  4JI3 L;  3Q8P B;  4UDU C;  1HA6 A;  3K8A A;  3LWE A;  3KJP A;  4A3F H;  4MV7 A;  4HED A;  5NUC A;  3CC2 A;  1VDZ A;  1UC9 A;  4E4T A;  5EWE A;  4LF7 Q;  5C5L A;  4CKE A;  2WAQ B;  4J9O A;  4C5C A;  5HV6 A;  2PCF B;  4RZR A;  1BQQ T;  2OCE A;  1YHB A;  1MKH A;  1VQM A;  2PO4 A;  1DCZ A;  1EEI D;  1FD7 D;  3BA8 A;  1WYD A;  2FMC A;  4IUQ A;  1XJV A;  4LJZ C;  1A2T A;  2MJ8 A;  1PX2 A;  1YJ9 A;  1I50 A;  1RF2 D;  1PK8 A;  1WD1 A;  4ME5 A;  5K5P A;  5EJW A;  2PZW A;  3RZD B;  4QQB X;  4LF4 H;  1GKH A;  4Y52 H;  1E4E A;  5ELD A;  4TQR A;  1BCP D;  5T1I A;  3TEH B;  3FP9 A;  5DLG A;  2KOL A;  4CHT B;  5LMN H;  5IT9 L;  2CW0 D;  3W1B A;  4MV9 A;  4C3H B;  4XQJ A;  3FDS A;  3S1M B;  3KHH A;  1C0A A;  2MNA A;  1NE3 A;  2YTX A;  1G51 A;  1TWA H;  4A3J H;  4MV6 A;  3I91 A;  4JI7 Q;  4TUY F;  1SEB D;  2A74 C;  5C4X B;  5IGF A;  4A93 G;  4IHJ F;  1GO3 E;  4DV6 L;  1RD9 D;  1S40 A;  1CS0 A;  5IWA H;  3I90 A;  2GVB A;  4PZ7 A;  1Y1V B;  5EQ0 A;  4XYO A;  3QWN A;  2E76 C;  3V4S A;  3ERQ A;  1K83 A;  1SE4 A;  3QG1 A;  3VYS A;  5IT9 W;  2JEA I;  3MEH A;  1M1K C;  1F9P A;  4KHP Q;  2E2H H;  1ZHS A;  3Q23 A;  2UU9 H;  2DLN A;  1TT2 A;  1JJ2 A;  2KSW A;  3R2I A;  1ENC A;  3Q8S B;  4GN5 A;  1B6S A;  4MV1 A;  2F0W A;  2ASB A;  3HOU H;  2YYA A;  1XDN A;  1XTC D;  3VR5 A;  4IAL A;  1PZJ D;  1Q1B A;  2ES2 A;  4EFE A;  1VQA A;  3GIQ A;  3GTO H;  2BE5 D;  3PUY A;  4EYI B;  1UE5 A;  1WOC A;  4UFZ A;  4YR0 A;  3BZK A;  1MHW C;  4EVO A;  2VQF L;  2OQ0 A;  3JSL A;  5G3L F;  3S9W A;  5J22 A;  3M3Y B;  4O2B F;  4ZAI A;  3JAM L;  4EGQ A;  4IQZ A;  2R7Z H;  3N44 B;  2IW3 A;  1Y1W H;  4J9P A;  3H0G G;  2EXD A;  4J15 A;  1N36 L;  1H9S B;  3D6C A;  4JI8 L;  3PW2 A;  4GNX A;  1QOH A;  4B3S L;  1MGS A;  3G6J B;  1D5Z C;  3NBH B;  5KFQ A;  1TWC H;  4MV4 A;  1CM9 A;  2UXC Q;  3R8B A;  2YZN A;  1QNK A;  3MXP A;  1SLJ A;  1SMX A;  5KX5 F;  5IGG A;  2CWP A;  1IBM L;  4KJO A;  1VQG A;  5KFX A;  2WV6 D;  3JAM W;  1EYA A;  2K75 A;  2L55 A;  3PGZ A;  4OWX B;  4LFB Q;  2FB9 A;  4X66 L;  5EOY A;  1IBK L;  4ZI7 F;  4IRK A;  1I94 L;  1JE4 A;  3MZ5 A;  3RB3 A;  4HMI A;  4RGM A;  1EZ8 A;  3PV0 A;  4DV7 Q;  2XIW A;  1HFN A;  5J2T F;  4DUZ H;  2R8I A;  5DQH A;  3OSN A;  2H1E A;  3BQ1 A;  3T5L A;  2A73 B;  2FFK B;  3CCL A;  4A3E H;  4I4T F;  3RN2 A;  3GII A;  1VQB A;  3NQT A;  5D1O B;  3PUX A;  4DR2 L;  1QNU A;  4QWE A;  5IT9 c;  4NMZ A;  4NKL A;  3WWV A;  2OXP A;  2RCN A;  2OWO A;  4RUA A;  3F1Z A;  1IZ6 A;  1SNM A;  4Q5V A;  1LYL A;  4X65 H;  4M8A A;  2ASD A;  1AUV A;  4B3M H;  3KFU A;  2K52 A;  1JOK A;  2M9V A;  2JP1 A;  3DHQ A;  1NY4 A;  2CHB D;  5IGC A;  2VZA A;  3R93 A;  3PR4 A;  1JE5 A;  1Q8I A;  1Z6H A;  2IX0 A;  5AJ3 L;  1YNN D;  2W9A A;  4ED1 A;  1FKA H;  2X6L A;  4MTK A;  3ONA B;  4ED0 A;  3PN1 A;  3GDE A;  4G3I A;  4A3D G;  4XXE A;  2YTY A;  4DR3 H;  2JEG A;  5D3I B;  5M3M G;  4E6I A;  3BVG A;  3VYR A;  2VUM H;  4G57 A;  3S16 H;  4LF5 H;  1X3G A;  3GIL A;  5FKA C;  3HFZ B;  2NVY B;  5I2X A;  2C22 A;  2DJF C;  4Y7N H;  2DWC A;  2YS6 A;  4X62 H;  5C1O A;  4A3F G;  2PMZ B;  4BBR B;  4PWQ A;  4GC7 A;  2K50 A;  4ECV A;  4YBZ B;  4LF6 Q;  3RN5 A;  5A2Q L;  1JWM D;  3GO5 A;  1K28 A;  3MFI A;  1HZC A;  4ECR A;  2YU9 A;  4O3R A;  3CQZ B;  3VPC A;  4A3G H;  3DF7 A;  2BCO A;  2UXB L;  1N33 Q;  3TRZ A;  4JI0 H;  2HVS A;  1ONL A;  4DR6 Q;  1GXD C;  5GON F;  2ZJR A;  3GV6 A;  1A6X A;  3QOL A;  4J6H A;  1BCP F;  2YL2 A;  3T5K A;  3J81 W;  3N43 B;  5KFW A;  2ZXO A;  4I7Z C;  3M4I A;  4O3O A;  2WE6 A;  5CV6 A;  3RIZ A;  3KF8 B;  3JAM c;  4JV5 Q;  4MAM A;  2NVX H;  2KHI A;  3IRB A;  3GIP A;  1UAP A;  5A2Q W;  4LK1 C;  3N52 A;  1WJJ A;  3IFD A;  3PMF A;  1O75 A;  1S03 G;  3E6Z X;  2RHS B;  3STB C;  4O4L F;  4KY7 A;  4LMQ D;  4JV2 A;  2NWG A;  4LFA Q;  2C2D A;  2CQY A;  1UEA B;  1IXR A;  2PI2 E;  4CJ2 C;  4KD4 A;  5IP9 H;  2F0T A;  2EDG A;  5KFY A;  4A3J G;  4A3L H;  4DLK A;  4TV9 F;  2DY8 A;  4MN3 A;  3G71 A;  4KY5 A;  1QB5 D;  2DPI A;  3C1F A;  1IBL Q;  4BXX H;  1TR5 A;  2LS0 1;  1ZHQ A;  3QJY A;  5JVH 3;  5JAV A;  3GTJ A;  1B9N A;  4DXF A;  3UQ8 A;  3KF6 B;  3KHR A;  1J9O A;  4DR5 L;  2CH4 A;  1PH2 A;  1AE2 A;  2YW2 A;  2F0K A;  1RCV D;  3OHA A;  3K59 A;  1JCK B;  3ND8 A;  1FJG Q;  1YNJ C;  5KG5 A;  2XCP A;  2R87 A;  2QEX A;  4DV5 H;  3L2P A;  5JJL A;  3CU7 A;  2PNH A;  4KN4 C;  2EYF A;  3C1E A;  2R92 H;  2VNU D;  4OGQ C;  1GJX A;  3HOU G;  1W96 A;  1L0X B;  2SNS A;  3D3R A;  1IW7 D;  3FPP A;  5E7N A;  3U4V A;  4XIG S;  3NEL A;  5IGE A;  2K5V A;  3T4A C;  2D62 A;  3CC7 A;  4RCN A;  5BR8 L;  2E74 C;  3GTG B;  4RB0 A;  2UVW A;  2EVB A;  4JI2 Q;  5HGT A;  1UE7 A;  1JT8 A;  5M5W B;  3T13 A;  1B4O A;  1S72 A;  2GPS A;  2I8C A;  1DJR D;  1ROD A;  3AU7 A;  3GTM H;  2R7Z G;  3OMC A;  1Y1W G;  1WTP A;  4K0K Q;  4A2A A;  2OT2 A;  3R2T A;  3EPG A;  2BQU A;  5KFJ A;  4A3C G;  1QE6 A;  1TWA A;  1I3Q B;  5FPR A;  3C2P A;  1S0M A;  3BDO A;  3ETH A;  4XZ3 B;  1YIJ A;  2CW8 A;  3TZD A;  2NU6 B;  3EVQ A;  4YIJ A;  1VAJ A;  3L3O C;  4HAE A;  1GD7 A;  4EEQ A;  1C8C A;  2W8K A;  2K04 A;  4TSS A;  1EU4 A;  2JE6 I;  1I4R A;  4YCV A;  1TWG H;  1BUV T;  5KND A;  2ZXP A;  1JDB B;  1E4G T;  4C3I B;  4QWC A;  2Y0S E;  1B6R A;  4IFD I;  2R8G A;  3M7N A;  3T1H Q;  1KAA A;  3PVX A;  4A3K H;  1M0W A;  5KFR A;  2OQK A;  4DR1 H;  2EXZ A;  4JG2 A;  3RB0 A;  1PFN A;  4GKK Q;  5K36 H;  1RYR A;  1MI2 A;  2XGQ A;  4LWC A;  4ILW A;  4A3E G;  1WD0 A;  3GTL A;  1I6U A;  4H44 C;  3VR4 A;  3KLW A;  3E9H A;  5LMU L;  1RTO A;  3CP0 A;  2N3S A;  1I4Q A;  4LFB L;  1XNR Q;  2WTF A;  2D9U A;  3EFX D;  1K9M C;  3IAY A;  5KG1 A;  4FO2 A;  3S24 A;  4DV1 H;  3H0G B;  2FK2 A;  2W7O A;  4LF8 H;  2B2W C;  4H7B A;  3BJY A;  1TA8 A;  3OIP A;  2F0L A;  3CCS A;  3AEV A;  5I6W A;  5FLX c;  4BBS H;  3KAK A;  1JXL A;  1Y69 U;  2AQ3 B;  2NU8 B;  3A56 A;  3LML A;  2R7Z A;  1E2Z A;  1Y1W A;  4NXN Q;  3CCV A;  3NPP A;  2VUM G;  2K28 A;  1SYF A;  4JV1 A;  1CK1 A;  2KQ3 A;  1O7L A;  3A8K E;  2H5X A;  1HNW H;  4QW9 A;  4DV0 Q;  4UCU A;  2PI2 A;  4FBT A;  3A5Z B;  1GSO A;  3AFQ A;  3K5H A;  5ELB A;  1SE2 A;  1C30 A;  1GHK A;  1N34 H;  3VYU A;  1LT4 D;  2ATW A;  3L7Z C;  4A3G G;  2W9B A;  3HB9 A;  1KNA A;  3ZYY X;  4HN7 A;  1QVC A;  1BNC A;  1PMR A;  4IPG A;  1E3P A;  3RZO H;  4L5S A;  4F4X A;  1A3T A;  3T56 B;  3GTQ B;  2F0J A;  1OXU A;  4DAM A;  1JOR A;  4Z9C B;  3MWM A;  4KMU C;  5D65 A;  1LV9 A;  3F2C A;  2AUK A;  2X6G A;  4K2L A;  4OO1 I;  1W93 A;  5M5X B;  5ELC A;  4AIM A;  1I50 H;  4L1K A;  2UUB H;  4UHV A;  4LF6 L;  1IYV A;  1L2Z A;  2NZO A;  3K7A H;  4DV3 H;  2WIN B;  3S14 B;  1J5E H;  2E75 C;  4PV1 C;  3TSS A;  1R9T B;  4A3D B;  1EIH A;  3HKS A;  4DR6 L;  2HDL A;  2CQA A;  3I2Z A;  1PH5 A;  3K3V A;  1KDA A;  4QMG A;  3J7Y W;  4KHV A;  1BKB A;  4F4W A;  5IP9 G;  1B2T A;  2R3Z A;  4C1N K;  5LMN Q;  2QK4 A;  3I4M H;  4A3L G;  3KUP A;  1L0W A;  4Q43 A;  2FJ2 A;  3E0E A;  5CV5 A;  3KDF A;  1L1O A;  5FO9 B;  3H15 A;  1VQK A;  2A68 D;  4JI3 Q;  4A3F B;  3PIP 3;  1CTM A;  1SJE D;  1HZ9 A;  2XGT A;  4RGT A;  4DL6 A;  1S10 A;  5I9P A;  3NEN A;  5M3F H;  4APV A;  2JA5 A;  4BXX G;  2TMP A;  5DEH A;  1CE8 A;  3NE5 B;  4AYB A;  4PQX A;  2O03 A;  2RDF A;  2EJG C;  2R7M A;  3G6X A;  1KNE A;  4CDD C;  4DK6 C;  1GHJ A;  4DU9 A;  3WDN A;  5C3E H;  4DK3 C;  3TDQ A;  3K5L A;  1DM0 B;  3M9M B;  5IE8 A;  4JI5 L;  4WOR A;  1TII D;  3M4Y A;  5E3F A;  4R7R A;  3WOF A;  1Z47 A;  4NP5 A;  1PA6 A;  2WFW A;  3KXY T;  1PFB A;  1LT3 D;  4TQU S;  2HT1 A;  2K03 A;  2CZG A;  4XYL B;  4RB3 C;  1L0Y B;  3K7U C;  5LL6 S;  1C3O A;  5KG7 A;  3E3X A;  2KEC A;  2Y0S A;  1UNS A;  3NWS A;  4BA1 I;  3JSN A;  5DQI A;  1HR0 H;  1TWH B;  3QOJ A;  2F0D A;  2LKV A;  2JA7 B;  1HQR D;  2JN4 A;  3DMU A;  3BYY B;  1F77 A;  2F0P A;  4A3J B;  2ENB A;  2PPB C;  1BBW A;  2NVX A;  3HOZ H;  1K1Q A;  2N49 A;  4RAU C;  3S15 H;  3RMH A;  2Q2U A;  3SDZ A;  4GLV B;  4KD3 A;  1BVS A;  2A6E D;  3R5X A;  1J8I A;  4HMJ A;  2K4K A;  4DV6 Q;  4KV6 A;  3UE0 A;  4HR7 B;  2W70 A;  4JI1 H;  5KFI A;  1H9K A;  4I65 A;  4JOI C;  4OXP A;  1SYG A;  1S5D D;  5DM7 3;  1TS5 A;  3G6Y A;  5L1K A;  1KRS A;  4K5X A;  4H0L C;  3CC4 A;  2RDJ A;  1E22 A;  2MP1 A;  2E2H B;  1PRT D;  2HUG A;  4C5B A;  2E2I A;  2NVQ B;  2B3G A;  4DV2 H;  2EY6 A;  3BAB A;  1EOV A;  2RF4 A;  2NN6 H;  4K6D A;  1KJJ A;  1TAE A;  2W9C A;  4MIU A;  1BXR A;  3QZ7 A;  1PTO D;  3HOU B;  3V05 A;  4YHH H;  4DAY A;  2XWJ B;  4YCW A;  4K0K L;  1KJ8 A;  4R8U A;  4EBD A;  4ECZ A;  1EY0 A;  4OEM B;  5L1J A;  2I07 B;  4ED7 A;  1FGB D;  4A3K G;  2XWB B;  1WSC A;  3T1Y H;  2B63 B;  4ECT A;  3SE0 A;  4OON A;  4DL2 A;  3GTO B;  3Q24 A;  4F88 A;  5K36 G;  4CDF C;  1HNX H;  5CBA E;  1W3S A;  1N32 L;  2E8G A;  5COR A;  4QGU A;  1XYI A;  2WP8 J;  5LOV F;  1FNV A;  4FYD A;  4JI6 Q;  1I4P A;  1JMC A;  1RK6 A;  2VQF Q;  2NUC A;  2MQH A;  5D8D A;  1RDP D;  3TIG A;  4NDX A;  2DNC A;  3MTS A;  1Y8N B;  1WTH A;  4UAI A;  5IP7 H;  2HHH L;  1XMO H;  3FKI B;  5KFG A;  4DR7 H;  3UDF A;  5LYJ F;  2F0H A;  4O4H F;  1S9F A;  4IWY A;  3EBE A;  1N36 Q;  4JI8 Q;  2Z6B A;  4B3S Q;  1TWC B;  4P71 A;  4BBS G;  3OTO H;  1V1P A;  3P7J A;  3M4O H;  3W5O A;  1QJO A;  3H94 A;  3GTM A;  4GKJ Q;  3VR3 A;  1ZYR C;  1EY8 A;  3K0Y A;  2Q8R E;  2FLP A;  1JOQ A;  3H4D A;  3PW5 A;  3CCE A;  4N9P A;  3G6E A;  2AGQ A;  5GAH C;  2OF1 A;  2F3I A;  4ALP A;  2K5N A;  2PYK A;  1VMP A;  2IX3 A;  4AQY L;  1XX8 A;  2VB3 X;  1IBK Q;  2GPW A;  2N8N A;  2ALZ A;  4A4I A;  1PVO A;  2JA6 B;  5IGD A;  4WBN F;  1Q81 C;  4JYA L;  3WNZ A;  1Q12 A;  3JC6 6;  4O2D A;  1UEB A;  3MAQ A;  4A3E B;  4F4Z A;  5KFV A;  2DPJ A;  4YY3 L;  4I7A A;  2F0I A;  2UVV A;  4DR2 Q;  1SNQ A;  4K2K A;  3Q8Q B;  3V6J A;  2O5J C;  3DEO A;  5D1P A;  1STA A;  2B2V A;  3VA5 A;  2K32 A;  3RNU A;  1YJN A;  1JR0 D;  1OXX K;  1HJP A;  5EZY F;  4DUY Q;  2VB2 X;  4IN3 A;  3ULJ A;  4IZO A;  3J7A V;  1HUN A;  1VKZ A;  5KT2 A;  2NUA B;  3H40 A;  1QCB D;  4O4I F;  2JYO A;  2PZU A;  1RTN A;  3K58 A;  4V19 0;  3HOY H;  2PVP A;  1SN8 A;  3D4R A;  4RMF A;  2YYZ A;  5M5Y H;  3S16 B;  2VUM B;  2RDI A;  3I4M G;  4LFC H;  2N55 A;  5EWF A;  2B8G A;  2ZT9 C;  1Y14 B;  1AN8 A;  2IJ0 A;  2EE1 A;  2K5Q A;  4UY8 C;  1EYG A;  3NUC A;  4DAV A;  2HD3 A;  4HIK A;  4IUN A;  4A2B A;  3TME A;  4X3T A;  5M3F G;  1LT5 D;  2DZD A;  5CB4 F;  1V1Q A;  4F8M A;  3V6H A;  4IFD J;  2NU9 B;  4JUZ A;  3HOX H;  3S2H H;  4FF2 A;  3GTK A;  4LF4 L;  4X64 H;  3P20 A;  4GNX C;  1PZK D;  4A3G B;  1TY2 A;  2P0A A;  4IUT A;  1F9R A;  1OXS C;  1ENA A;  4RHR A;  2UXB Q;  3TQT A;  2HIX A;  3ITP A;  5LMN L;  5C3E G;  3I73 A;  4RG1 A;  4XYQ A;  3GTJ H;  2VUG A;  4WFN 3;  3GV5 B;  3BG3 A;  3I8Z A;  5KIX A;  3F8T A;  2QYZ A;  5IYC H;  3GIJ A;  2AQ2 B;  1BF4 A;  4J8Q A;  2PQA B;  2NBF A;  4HCS A;  1VF7 A;  4DV5 Q;  2AKW B;  1FVI A;  1QG7 A;  1TKW B;  3PSI A;  2PZT A;  4WD3 A;  3RBE A;  2PW5 A; 
#chains in the Genus database with same CATH homology
 1YZ6 A;  4IPH A;  5IWA L;  1NY4 A;  1PHJ A;  2VZA A;  1TWF H;  3GTP H;  1JE5 A;  2KCM A;  2UUC L;  2IX0 A;  5AJ3 L;  4LFC Q;  4NB3 A;  4FDB A;  5LMN W;  1YI2 A;  4IJH A;  3GDE A;  3ER0 A;  4HJ8 A;  4A3D G;  2YTY A;  2JA6 G;  3AYH B;  3HOZ G;  1D7Q A;  2EIF A;  2UU9 L;  2UXC L;  3MXN B;  5M3M G;  4A3I H;  2VL6 A;  2UXD Q;  2VUM H;  1VQE A;  3H3V H;  2I5L X;  3S16 H;  1X3G A;  1I5F A;  1A63 A;  1N8R C;  3ICE A;  1PYB A;  4DV3 L;  3F2D A;  3HFZ B;  4X64 Q;  4JBJ A;  1EIF A;  1WFQ A;  5FLM H;  5C0X G;  3CF5 A;  4Y7N H;  4A3F G;  2KHJ A;  1QVF A;  2LXJ A;  1KAW A;  3J7Z C;  4BY7 G;  2K50 A;  1CSQ A;  4DUZ Q;  3Q8D A;  4LF6 Q;  5M5W H;  3RN5 A;  1P16 A;  4UPA A;  3F2B A;  3GO5 A;  4DR5 Q;  1HZC A;  3I4N G;  1K73 C;  5GAD C;  1KXL A;  1MJC A;  4A3G H;  4DV7 L;  2NN6 G;  1YVC A;  3TS0 A;  2UXB L;  1KHI A;  1N33 Q;  4OX9 L;  4LF9 L;  3PF5 A;  3TRZ A;  2VS1 A;  4DR6 Q;  2ZJR A;  5GAE C;  2NVT H;  2KBN A;  4JI4 Q;  4X65 Q;  4B3M Q;  2PMZ E;  1QZH A;  3G4S A;  1XTD A;  1SFO H;  1U5K A;  3J80 c;  2ZJP A;  4IO9 A;  4A3B H;  2IHF A;  3CAM A;  3KF8 B;  1VCI A;  1PYS B;  3JAM c;  4TVA B;  4JV5 Q;  2CWA A;  4R4O A;  2KHI A;  3IRB A;  5BR8 Q;  1Q82 C;  2NVX H;  3G48 A;  2AWO A;  4LUZ A;  1WJJ A;  3J81 i;  1VQN A;  1B70 B;  4DR3 Q;  1B8A A;  2E5L Q;  3PO3 G;  1TXY A;  2R7F A;  2RHS B;  2YTV A;  3STB C;  2BA1 A;  1YBY A;  3UDI A;  1C9O A;  4LFC L;  4C3I H;  4LF5 Q;  4R4Q A;  2HIV A;  4LFA Q;  1YIT A;  4DR4 L;  1IXR A;  2PI2 E;  1K3R A;  5IP9 H;  5IP7 G;  3GTL H;  4X6A H;  4A3J G;  4A3L H;  5GAG C;  4X62 Q;  1OXV A;  4IJL A;  2FXQ A;  2CFM A;  3G71 A;  3OYY A;  3LGJ A;  2CCZ A;  1J6Q A;  1XNQ Q;  4GN3 B;  1IBL Q;  1UWV A;  4BXX H;  3S17 H;  4PMW A;  2NVY H;  4A3B G;  4QJF A;  1NMF A;  1VQ7 A;  4JI6 L;  3CW2 C;  4JI0 Q;  1U0L A;  4BBR H;  1MJE A;  3KF6 B;  5JJK A;  4DR5 L;  1PH2 A;  1AE2 A;  1V43 A;  1BBU A;  4JI1 L;  1CKM A;  1FJG Q;  3KDF B;  1NTG A;  1L1O B;  2QEX A;  1N33 L;  3L2P A;  5JJL A;  2MFI A;  2PNH A;  4YWM A;  3CCU A;  4JBW A;  5ELO A;  2R92 H;  2R6G A;  4NPS A;  1HNZ Q;  2VNU D;  2B29 A;  1A8V A;  3PUV A;  3HOU G;  4KI0 A;  2MO0 A;  2N78 A;  4X65 L;  4B3T Q;  1XPU A;  5E7N A;  3CMA A;  1HNW Q;  3U4V A;  4A3C H;  3D0F A;  1CKN A;  1DGS A;  3EIV A;  4XIG S;  3NEL A;  2QA4 A;  2K5V A;  4A75 A;  1P8L A;  2D62 A;  3CCQ A;  1W2B A;  1WI5 A;  3CC7 A;  4EX5 A;  4GKJ L;  4B3R Q;  4JV5 L;  4HID A;  2ZM6 Q;  5BR8 L;  1N34 Q;  1UE1 A;  1V9P A;  4IPD A;  4DPG A;  2KCT A;  4YHH L;  4KLK A;  4JI2 Q;  5LMU Q;  2AMC B;  3PIP A;  4DR3 L;  1VQP A;  1UE7 A;  1ASY A;  4LNQ A;  1JT8 A;  1S72 A;  1M90 C;  1AE3 A;  1JJG A;  4HJ5 A;  3U4Z A;  4DNI A;  1WCM G;  3I4O A;  5GRO A;  4LF5 L;  4LFA L;  1KL9 A;  4DV4 L;  3BZC A;  1K83 H;  1A0I A;  2ZTE A;  4JCV E;  4H02 A;  3RLN A;  5JEA J;  3CD6 A;  3GTM H;  2R7Z G;  1Q8K A;  3CCJ A;  1XPR A;  3ULP A;  1Y1W G;  2R93 H;  4K0K Q;  2R92 G;  2ZTD A;  5C44 H;  2ZTC A;  5HY6 A;  2OTJ A;  1Q46 A;  1AH9 A;  3HOY G;  1PH3 A;  1NJI C;  4A3C G;  2IY5 B;  1LTL A;  1IBL L;  2UUA Q;  1VQ8 A;  1L2F A;  2JQO A;  3HKZ E;  4JOI A;  2CKZ B;  4UP7 A;  1YIJ A;  4JI0 L;  4GLX A;  1QZG A;  1NBW A;  3TRE A;  4HJ7 A;  1LUZ A;  3A0J A;  1GM5 A;  4MZ9 A;  1GD7 A;  3E9I A;  3CXC A;  2I0Q A;  1X54 A;  4DUY L;  1QUQ B;  2JE6 I;  3OTO L;  4YCV A;  1TWG H;  1FJG L;  2PQA A;  3S14 H;  4GOP A;  1Z9F A;  3HOX G;  2Y0S E;  1PH4 A;  2D0O A;  4IFD I;  1PH7 A;  1XMQ L;  3M7N A;  3T1H Q;  3UDG A;  4A3K H;  1HZB A;  4B3T L;  2OQK A;  2JA5 H;  4WJ4 A;  1VQJ A;  2DUD A;  4JG2 A;  4UP8 A;  4GKK Q;  4KHZ A;  1PH1 A;  3KOJ A;  2Z6K A;  3W1G A;  5IYD H;  4HJA A;  4B3R L;  2L15 A;  4LWC A;  4A3E G;  1VQO A;  1E1O A;  2ID0 A;  1SRU A;  4JC0 A;  2ZJQ A;  3PO2 G;  5IYC G;  3KLW A;  3ZJY C;  2VQE Q;  3E9H A;  4JI2 L;  5LMU L;  3RLF A;  3CP0 A;  3GTG H;  4DAY B;  4NXM Q;  5C0X J;  2Q2I A;  4XTC S;  2N3S A;  4GOP C;  4IOA A;  4LFB L;  1XPO A;  3OW2 A;  1XNR Q;  5ELN A;  1X56 A;  1K9M C;  1RIP A;  3NEM A;  4R4C A;  1OXT A;  3S24 A;  1EQQ A;  3S2D H;  1CUK A;  1CKO A;  4A93 H;  5C4J H;  4LW1 A;  1SE8 A;  3CCS A;  3AEV A;  4BBS H;  5FLX c;  4YWK A;  2RHQ B;  2I5M X;  2A1A A;  4POF A;  1KIX A;  3ULL A;  4EQ5 A;  4ME3 A;  1YEZ A;  2QGQ A;  4BY1 H;  4NXN Q;  4A3I G;  1I3Q H;  3CCV A;  2WB1 E;  2VUM G;  3D31 A;  4DV5 L;  3BU2 A;  1H95 A;  5FLM G;  4C2M H;  1VQ6 A;  2HQL A;  2H5X A;  1O7I A;  1TWH H;  4DV0 Q;  2JA8 H;  2PI2 A;  4DR1 Q;  5IYB H;  3ERS X;  3TQY A;  3A5Z B;  1K8G A;  1PFS A;  3STB D;  5C0X I;  2JA7 H;  3AFQ A;  3HKZ G;  3T1H L;  2ATW A;  3L7Z C;  4A3G G;  3M4P A;  5EAY A;  1HZA A;  1QVC A;  1A62 A;  4IPG A;  1E3P A;  3RZO H;  4L5S A;  1LM0 A;  3TS2 A;  4GKK L;  2UXD L;  4POG A;  2V1C C;  4JI5 Q;  2NN6 I;  2E2I H;  2E2J H;  1OXU A;  4DAM A;  3KJO A;  2IT1 A;  1SRO A;  4YCU A;  4C3J H;  4P72 A;  1VQC A;  4X64 L;  3F2C A;  4DV1 Q;  1IBM Q;  2KEN A;  2VQE L;  3K0X A;  4LF8 Q;  4OO1 I;  3CME A;  4AIM A;  4MTN A;  1I50 H;  1RL2 A;  4DUZ L;  1XNR L;  2NVQ H;  4LF6 L;  2NZO A;  3K7A H;  3EN2 A;  1EUJ A;  4X66 Q;  2K14 A;  4L5T A;  2BH8 A;  1I94 Q;  1VQD A;  3H0G H;  2A19 A;  1HNX Q;  3HKS A;  4GS3 A;  5HGQ A;  4DR6 L;  3KF6 A;  3I2Z A;  1PH5 A;  3L0O A;  1JJC B;  2LXK A;  1BKB A;  1QVG A;  5IP9 G;  4QIW E;  5LMN Q;  4A76 A;  4JI4 L;  3HOV H;  3I4M H;  2JA9 A;  1L0W A;  2Q2T A;  4B3M L;  2F4V Q;  3E0E A;  2B63 H;  4A3L G;  4A3M H;  3KDF A;  3B6Y A;  1L1O A;  2DGY A;  4NXN L;  4BA2 I;  3H15 A;  4R1J A;  2YU9 H;  2ALY B;  5DLQ E;  4UP9 A;  1VQK A;  3M4Q A;  4JI3 Q;  1I6H H;  4WJ3 M;  2F52 A;  1HZ9 A;  2XGT A;  2VW9 A;  2R7D A;  4HJ9 A;  5M3F H;  3NEN A;  5IY0 A;  4APV A;  4BXX G;  1YJW A;  3HOW H;  1KD1 C;  2Z0S A;  4DV0 L;  4C3H H;  4P73 A;  4GNX B;  4P75 A;  2E5L L;  2BA0 A;  3AQQ A;  4BBR G;  1K8A C;  2C35 B;  2WB1 G;  3J7A 5;  4MNO A;  2UUC Q;  5AJ3 Q;  2D0P A;  2EQS A;  3FKI H;  4QY7 A;  4DK6 C;  5FJ8 H;  5C4X H;  5C3E H;  4AYB E;  1MIU A;  4DK3 C;  4X62 L;  3K81 C;  3KYH C;  3PIO A;  5IE8 A;  4JI5 L;  3CPW A;  1Y1V H;  2UUB Q;  3GTQ H;  3J81 c;  1XNQ L;  1Z47 A;  4DV1 L;  1PA6 A;  2WFW A;  4DV3 Q;  1J5E Q;  3DLL A;  4TQU S;  2HT1 A;  3I55 A;  1N32 Q;  3UE1 A;  1PH8 A;  1E24 A;  5M5X H;  1Q7Y C;  3K7U C;  1EFW A;  2BH2 A;  4HIM A;  2IHE A;  4BA1 I;  1VQ5 A;  3J80 i;  1X65 A;  3UDX A;  3I56 A;  1X3E A;  3VDY A;  1SR3 A;  1R9T H;  1BBW A;  4A3D H;  2JA6 H;  4OX9 Q;  2HHH Q;  2N49 A;  1VQL A;  4LF9 Q;  3S15 H;  3HOZ H;  5H1S E;  1HNZ L;  5JJI A;  2Q2U A;  1X3F A;  2Q2H A;  4GLV B;  1BVS A;  4OWT B;  5M3M H;  1HH2 P;  3A5U A;  2F4V L;  1QUQ A;  2K4K A;  4DV6 Q;  1HNW L;  2R93 G;  3UE0 A;  5C44 G;  1IYJ B;  4JBM A;  4QL5 A;  1YHA A;  4JOI C;  4OXP A;  5J3B A;  4JI3 L;  3K8A A;  1X55 A;  3KJP A;  4A3F H;  2ZM6 L;  3CCR A;  1KRS A;  1N34 L;  3CC2 A;  4BY7 H;  3S1N H;  3CC4 A;  3RLO A;  1E22 A;  4GLA C;  4LF7 Q;  1Q1E A;  4P74 A;  1FL0 A;  3U50 C;  1VQF A;  2B3G A;  3I4N H;  2OCE A;  1YHB A;  1X9N A;  1MKH A;  1VQM A;  1KQS A;  1EOV A;  2RF4 A;  3S1R H;  1WYD A;  2GN5 A;  1G29 1;  1XJV A;  1T9H A;  1FGU A;  1GVP A;  4HIO A;  4AQY Q;  1Q86 C;  4DR4 Q;  1YJ9 A;  1PH6 A;  4LUV A;  1G6P A;  3GD7 A;  4YCW A;  3PF4 A;  4K0K L;  1OTC A;  2CQO A;  2JJQ A;  3CCM A;  2Z6K C;  3FHW A;  4JYA Q;  2UUB L;  4A3K G;  3DM3 A;  2JA5 G;  2WAQ E;  4QQB X;  1HR0 Q;  2JEB I;  3RR5 A;  1GKH A;  4OON A;  4OWW B;  4Y52 H;  1X6O A;  1J5E L;  2UUA L;  2NZH A;  3TEH B;  3FP9 A;  4YY3 Q;  5IYD G;  3GTK H;  1W3S A;  1N32 L;  5K36 G;  2E8G A;  4AYB G;  4QGU A;  2WP8 J;  4JI6 Q;  2YV5 A;  1JMC A;  3PO3 H;  2VQF Q;  3W1B A;  4YWL A;  2MQH A;  4DKA C;  1C0A A;  2MNA A;  1NE3 A;  2YTX A;  4JI1 Q;  5IP7 H;  1G51 A;  1TWA H;  4A3J H;  2VY3 A;  2HHH L;  1ASZ A;  4JI7 Q;  1N9W A;  3UDF A;  2XTI A;  3EBE A;  1N36 Q;  4A93 G;  4JI8 Q;  4OO1 G;  1GO3 E;  4DV6 L;  1E7Z A;  1S40 A;  4B3S Q;  4P71 A;  1PV4 A;  4BBS G;  2GVB A;  4PZ7 A;  3M4O H;  4DV2 Q;  1NMG A;  2OTL A;  3W5O A;  2JK8 A;  4L5R C;  4GKJ Q;  2Y0S G;  4LUO A;  2JEA I;  4BY1 G;  2K5H A;  1M1K C;  4LF7 L;  4KHP Q;  4YHH Q;  1D8L A;  3CCE A;  2E2H H;  4NXM L;  3K80 C;  1YHQ A;  3G6E A;  1JJ2 A;  4IPC A;  3SGI A;  5GAH C;  2F3I A;  2LSS A;  3H3V I;  4ALP A;  3T1Y Q;  2K5N A;  3AFP A;  2JA8 G;  4AQY L;  4GN5 A;  5IYB G;  4DV4 Q;  1IBK Q;  4LF4 Q;  2JA7 G;  2N8N A;  4A4I A;  2ASB A;  3HOU H;  1PVO A;  1IL2 A;  3M9B A;  1Q81 C;  4JYA L;  3PUW A;  1Q12 A;  3JC6 6;  3PUZ A;  1Q1B A;  1UEB A;  4O2D A;  3A74 A;  1VQI A;  1HR0 L;  2ES2 A;  1VQA A;  3RZD H;  1EIY B;  4YY3 L;  3GTO H;  3U58 A;  3PUY A;  4DR2 Q;  1UE5 A;  3PCO B;  1WOC A;  1VQ4 A;  1B7Y B;  3BZK A;  1XMO Q;  2VQF L;  4DR7 Q;  4R4T A;  2OQ0 A;  3RNU A;  1K0R A;  3BJU A;  3CPF A;  1YJN A;  1WCM H;  1OXX K;  2WAQ G;  1HJP A;  3I7F A;  4O0A A;  1VS0 A;  4DR1 L;  5IWA Q;  4DUY Q;  1VQ9 A;  3CQZ H;  3MEF A;  3OTO Q;  2IX1 A;  2R7Z H;  3S1M H;  1CKN B;  3ULJ A;  4JBK A;  4PG3 A;  1Y1W H;  4JI7 L;  2A8V A;  5GQO A;  1EWI A;  3H0G G;  2EXD A;  4J15 A;  1XMQ Q;  4JI8 L;  3M85 A;  1N36 L;  1HR0 W;  4GNX A;  4B3S L;  1KRT A;  3HOY H;  1L1O C;  3NBH B;  4GN4 B;  1SN8 A;  1TWC H;  4RMF A;  2YYZ A;  5M5Y H;  4DV2 L;  2UU9 Q;  2UXC Q;  4PZ6 A;  3HOV G;  1S3O A;  3I4M G;  3J81 j;  1SLJ A;  1SMX A;  2B63 G;  1Y14 B;  4A3M G;  2MO1 A;  4UY8 C;  3S1Q H;  2CWP A;  1EYG A;  1IBM L;  4KHP L;  4HIK A;  4LF8 L;  1VQG A;  4IOC A;  2AHO B;  4IFD G;  4R4I A;  5M3F G;  2K75 A;  1V1Q A;  3PGZ A;  4LFB Q;  4OWX B;  3HOW G;  4IFD J;  5JEA G;  3T1Y L;  3HOX H;  4X66 L;  1E1T A;  3S2H H;  1PH9 A;  1IBK L;  4LF4 L;  4GNX C;  3JAM i;  1I94 L;  4L5Q A;  1HNX L;  1OXS C;  3PV0 A;  4DV7 Q;  2UXB Q;  1VQH A;  1YNX A;  2HIX A;  3FKI G;  2GVA A;  1UE6 A;  5FJ8 G;  5C4X G;  5LMN L;  5C3E G;  4RG1 A;  3GTJ H;  1C7Y A;  4AH6 A;  3CCL A;  4A3E H;  3RN2 A;  1VQB A;  1EQR A;  3PO2 H;  3F8T A;  1Y1V G;  3PUX A;  5IYC H;  5IT9 c;  4DR2 L;  2I5H A;  2PQA B;  4DV5 Q;  4GOP B;  3WWV A;  2AKW B;  2RCN A;  1XMO L;  2OWO A;  1FVI A;  4DR7 L;  3F1Z A;  1JB7 A;  1KC8 C;  1IZ6 A;  4PZ8 A;  1CSP A;  1LYL A;  3PSI A;  2AWN A;  3KFU A;  2K52 A;  3M3Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...