1GO3E

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
184
structure length
177
Chain Sequence
b'MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPEMYELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSYDPKAIIGKETGKVLEIGDYVRARIVAISLKASKIALTMRQPYLGKLEWIEEEKAKKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 39
structure length 177
sequence length 184
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1go3E01
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1go3E02
3H0GH 4X66Q 1HZ9A 2PQAA 4PG3A 4B3RL 2YTVA 3Q8DA 3STBD 1BBUA 1LUZA 2N8NA 5JEAJ 4X64L 1YZ6A 2AWNA 2JEAI 1XMOL 5JJKA 4BBRG 4QGUA 1NMGA 2Q2UA 3M4OH 1YHQA 1N36Q 3M7NA 3UDGA 4HJ5A 2QEXA 5DLQE 4DK3C 2VS1A 1VQOA 1KRSA 1N9WA 4L5TA 2K75A 1XMQL 4LNQA 1HNWL 4Y52H 1HZBA 4IFDG 4MNOA 4TVAB 1VQ7A 1VCIA 2R93G 3KDFA 4DUZL 2RHQB 3UDXA 3T1HQ 4DR4Q 4A3JH 1X3FA 3PUYA 2K52A 4C3JH 4B3MQ 2RF4A 4DK6C 1QUQB 3GTJH 1TWHH 1JMCA 4X65L 1PVOA 2IX1A 1HZCA 1RIPA 2BH8A 3TEHB 3RNUA 2Z6KC 3PV0A 1S3OA 2UU9Q 1FJGL 4KHPL 4JV5L 4DAMA 2JQOA 1MIUA 1VQGA 4P75A 3RZOH 3KF8B 3HKSA 5M3FG 4JI4Q 4R4CA 4B3SQ 4C2MH 5HGQA 3L7ZC 1OXXK 1HNZL 5C44H 2F52A 2EXDA 2KHIA 2QGQA 3K8AA 3U4VA 4DV2L 1PYSB 1NY4A 1SROA 4IPDA 2AMCB 3W1BA 1MKHA 1G6PA 4DR2L 4DV3Q 3I4OA 4TQUS 4X62L 2ZJPA 4DR6L 1CSPA 2OTLA 3SGIA 4HIMA 3PO3H 1S40A 1A63A 3I2ZA 3I4NH 1CKNB 3ULLA 1IBMQ 1EYGA 1VQ8A 1YBYA 2R92H 3MEFA 2E5LQ 4LWCA 4POFA 4POGA 5IYCG 4A93H 1Y1VG 2HIXA 3BU2A 4RMFA 4DV7L 4J15A 4JC0A 4JI1L 4LF7L 1Y1WH 4OX9L 4WJ3M 2JJQA 3GTPH 1YHAA 2AWOA 2CWPA 4KLKA 2ZJRA 3J80i 2AHOB 1L1OA 2JA7G 1X54A 2XTIA 3PCOB 3HOVH 1JJGA 3BJUA 1O7IA 3K81C 1N32Q 4A3CG 3D0FA 1I6HH 4AQYQ 1UEBA 2PNHA 1T9HA 4FDBA 4NXNL 1K8GA 1P8LA 2HQLA 4K0KQ 3KFUA 3OTOQ 3M9BA 2VUMG 3S1NH 4DV0L 3PUXA 4BBSG 5K36G 5FLMH 1K9MC 3BZCA 3A74A 4BA2I 1XNQQ 2BA1A 3CMEA 1LM0A 4HIDA 1XMOQ 5LMUL 2HHHL 2CQOA 3RR5A 4HIOA 4A3FH 1EFWA 4YY3L 4A3EG 4LFAQ 4GNXA 4JI5Q 1PFSA 3HOYG 2KCTA 3H3VH 1QVGA 1PH7A 4QIWE 1EIYB 3HOZG 4DR7L 2OQKA 2I5HA 3PO2G 4LF9L 5IYDG 4OWWB 2N49A 4BY1G 3RLOA 2K5VA 4GS3A 4JI8Q 1SN8A 4L5QA 4R1JA 3NBHB 3DLLA 3NEMA 2Q2TA 4GKKL 5C0XG 3G4SA 1V9PA 5LMNW 1VQ6A 4JI7L 5HY6A 1C7YA 1MJEA 4O2DA 3BZKA 2UUCL 4DV5Q 1PH1A 2UUAL 1K73C 1L1OC 1I5FA 3I4MG 1B7YB 2B63H 4DV6L 4GOPA 2R7FA 3EN2A 1I3QH 1IBLL 1IXRA 1IBKQ 1TWAH 4DAYB 3CCUA 4LF5L 4IPGA 3J7ZC 2MO1A 1CKOA 1ASZA 1FGUA 5IWAQ 4C3HH 3U58A 4A3GH 2OTJA 1HR0Q 5M3MG 1K0RA 1V43A 2VW9A 3CC2A 2YV5A 1XPRA 5AJ3L 4JI6L 4JBJA 4P73A 1YI2A 1Q1EA 1SMXA 1XNRL 1TWCH 4A3KH 2BH2A 1PH9A 4LF4L 4DV1L 4A3DH 4LFCQ 5ELNA 2CFMA 4YCUA 1I94Q 3J81i 3UE1A 4GNXC 2YTYA 2ZJQA 3HOUG 3PF5A 1WCMG 3AFQA 3K0XA 2ZM6Q 3IRBA 1QVCA 2A1AA 1GM5A 1VQEA 1VS0A 4JYAL 1Q81C 1H95A 1GVPA 5GQOA 3PUWA 1UWVA 4BXXG 3ZJYC 4R4IA 4OO1I 3HOWH 1N34L 1N33Q 1BKBA 4LUZA 1HNXL 3M4PA 2HT1A 2VNUD 3A0JA 2NVXH 1YJNA 2JA6H 4GLAC 2VQEL 4JOIA 2JA5G 4BY7G 2UXBQ 2UXDL 3S15H 3S14H 3K7AH 4JI3Q 3DM3A 4GOPC 4C3IH 2DGYA 5GAGC 1UE1A 3PO2H 5BR8L 4DR5Q 1J5EL 4ME3A 4LF6L 4P72A 4DV4Q 2A19A 5GAEC 3WWVA 3CMAA 1QZHA 5C3EG 3M85A 3L0OA 3GTOH 4UP8A 4DR3L 2VQFQ 3JAMi 1XPOA 4GKJL 5LMNQ 2LXJA 3FKIG 4OO1G 4BBRH 2N78A 3OW2A 1YJWA 3HKZG 3CPFA 3H15A 1SFOH 2CCZA 4NXMQ 3OYYA 2OQ0A 4DR7Q 2KHJA 3KF6B 1YIJA 3GTKH 3CQZH 2R93H 1W2BA 1Q46A 4APVA 2F4VL 4B3TQ 4BA1I 4YHHL 3S1MH 4JCVE 3F8TA 1YHBA 4LUOA 1WYDA 1PA6A 1M90C 1E1TA 1KQSA 3FHWA 3I55A 2CWAA 2UUAQ 2I5MX 3E9HA 4JI2Q 1HR0W 1LYLA 2B29A 1Q1BA 3K80C 3A5UA 1D7QA 4L5SA 5M3FH 3T1YL 5FJ8H 1HJPA 4UPAA 3L2PA 5JEAG 4LF8Q 5M5XH 3RN2A 2IY5B 4NB3A 4DUYQ 4DR1L 3TRZA 1E24A 1B70B 1RL2A 1X3GA 2K14A 5ELOA 4A3MG 4JI0L 2NVQH 2CKZB 4A3LG 4LFBL 2UUBQ 1QVFA 5C4XH 3CCJA 1G51A 2WAQG 1PH4A 1D8LA 2H5XA 3FP9A 3J81j 2R6GA 4A3IH 1PHJA 2E2JH 4X66L 2JA8G 4IO9A 4PZ8A 1AE2A 3HKZE 3ER0A 1P16A 2PQAB 3KLWA 3CCSA 1VQLA 2GVAA 2NVYH 4B3RQ 4JBKA 4JG2A 1VQDA 1OXSC 1X6OA 2VL6A 4KHZA 4X64Q 3ULPA 1N36L 4EQ5A 1PV4A 3S2DH 1V1QA 1AE3A 2Q2IA 2D0OA 2NVTH 1UE7A 3M3YH 3HOXG 3RZDH 1VQFA 1G291 5IYCH 2NN6I 2GVBA 1Y1VH 4X6AH 2K5HA 1XJVA 4R4OA 2I0QA 1XMQQ 1Q12A 1NBWA 5J3BA 2WP8J 2NZOA 3T1HL 4DR4L 1HNWQ 2I5LX 3KDFB 1TXYA 2ZTCA 5M5WH 1VQMA 4B3ML 1X3EA 4DUZQ 1VQ4A 2JA7H 1QUQA 4A3BG 1W3SA 2Y0SG 2HIVA 4QY7A 1PH5A 4A3CH 5JJIA 1EOVA 1E22A 2ATWA 4X65Q 4YCWA 1YITA 2IHEA 1VQNA 5IP9G 1A8VA 2VUMH 4A4IA 1VQPA 1FJGQ 4BBSH 4JV5Q 4JI4L 4KHPQ 1WOCA 4B3SL 3S1QH 3UE0A 3EIVA 3JC66 2WAQE 5GADC 4A3GG 2NN6G 3PUVA 4YWKA 5IYBG 3J81c 4GKJQ 3CW2C 1HNZQ 4L5RC 2JEBI 2RCNA 4DV2Q 4A3EH 1WFQA 3KF6A 4DV3L 3GTQH 5IP7G 1UE6A 3AYHB 3HOYH 1X65A 1U5KA 3H0GG 2E2IH 4ALPA 4DR2Q 3TS0A 3HOZH 3GTLH 1Y14B 4X62Q 1IBML 4DR6Q 1CKNA 3E9IA 3G48A 4MTNA 2F4VQ 5IYDH 1OTCA 1GKHA 3CCEA 2AKWB 3CCMA 4BY1H 2DUDA 2E5LL 2L15A 3CD6A 2N3SA 1YNXA 2EIFA 1A62A 2PI2E 3AQQA 5EAYA 3RN5A 1K8AC 1ASYA 2YU9H 2Y0SE 2Z6KA 1JE5A 4GN3B 3RLNA 3ICEA 1B8AA 3F1ZA 3CXCA 1OXUA 3PF4A 1Q86C 3GO5A 4DV7Q 1YEZA 4IJHA 5IT9c 1CUKA 3G71A 4JI1Q 4IOCA 4LF7Q 4IFDJ 4OX9Q 2MNAA 4IJLA 4HJ8A 4A3JG 1N32L 3EBEA 1L1OB 2VZAA 1EWIA 1WI5A 4AQYL 1N8RC 4IFDI 5FLXc 3KJOA 2MQHA 4WJ4A 3I7FA 4K0KL 3OTOL 4HIKA 3CF5A 5GROA 1VQIA 4GLXA 3NELA 4NXNQ 2FXQA 5M3MH 3AEVA 1XTDA 1UE5A 2ZTEA 3MXNB 3I56A 1K83H 4DV0Q 2KCMA 4LW1A 4DNIA 5H1SE 3J7A5 1JB7A 3U50C 3CCRA 1XNQL 1KAWA 1Q7YC 4DKAC 1PYBA 2PMZE 2ES2A 2YYZA 4QJFA 4OXPA 4IPHA 5C44G 2KBNA 2PI2A 1TWGH 4XIGS 4LFAL 3HOUH 4JI5L 4AYBG 1VQ9A 1E1OA 2K5NA 3M4QA 1Z47A 1WCMH 2WB1G 5LMUQ 1EIFA 1L2FA 1PH8A 2HHHQ 4YY3Q 4GNXB 1SLJA 1KIXA 1J6QA 2YTXA 2LSSA 1KRTA 1KL9A 3PO3G 2C35B 1EUJA 3CAMA 4HJ9A 3CP0A 4JI8L 3I4NG 1VQAA 2Z0SA 4BXXH 1BBWA 4LF9Q 2R92G 2UXCL 1VQHA 4YWLA 3J80c 4OONA 4GKKQ 4A93G 1GO3E 1C9OA 3K7UC 3UDIA 5GAHC 2LXKA 4JBWA 5IE8A 4DV5L 2K4KA 2JA5H 4JI7Q 1SE8A 4BY7H 4QQBX 1Y1WG 4R4QA 5FJ8G 3KJPA 2UUCQ 3UDFA 1IBKL 1QZGA 3CC4A 4GOPB 3CCLA 3HOVG 1A0IA 4DV6Q 3F2DA 3H3VI 3ERSX 4DPGA 5IWAL 1IBLQ 1C0AA 2K50A 5C0XJ 5C3EH 2JE6I 2D0PA 3W1GA 4LF5Q 5C4XG 4A75A 1HR0L 3TQYA 1R9TH 4A3IG 2E8GA 3CCVA 1E3PA 2VY3A 4JOIC 3FKIH 2IX0A 3TREA 2F3IA 1IYJB 2IT1A 1VQBA 4HJAA 3PUZA 2ALYB 5FLMG 3G6EA 1X9NA 4AYBE 2QA4A 4A76A 3GTGH 3S16H 5AJ3Q 5C4JH 2WB1E 4MZ9A 4JI6Q 1XNRQ 1CSQA 2Q2HA 3RLFA 4LFCL 1CKMA 4KI0A 3CPWA 1I94L 4XTCS 1IZ6A 3VDYA 4LF4Q 4DV1Q 2ASBA 4GN5A 3S2HH 1Q8KA 1SRUA 2JA9A 3STBC 4EX5A 3PIOA 4A3FG 3LGJA 1Q82C 1IL2A 4PZ6A 1S72A 1KXLA 2ZM6L 1JJ2A 1PH3A 1EQQA 3GD7A 4RG1A 3TS2A 4GN4B 4NPSA 3W5OA 4JYAQ 1U0LA 1OXTA 1N33L 1Z9FA 4O0AA 1VQJA 2A8VA 3S24A 4QL5A 3CCQA 2OWOA 1N34Q 3F2CA 4GLVB 1HNXQ 4UY8C 2UXBL 3GDEA 2D62A 4Y7NH 3S1RH 4HJ7A 2XGTA 4JI3L 4A3LH 5IY0A 4A3MH 3E0EA 1GD7A 4UP9A 2VQEQ 2UU9L 5C0XI 2WFWA 2UXDQ 4PZ7A 1TWFH 4DR5L 2MFIA 1VQCA 2IHFA 1L0WA 2B63G 2JA8H 1X55A 2MO0A 1MJCA 4DV4L 4YCVA 1YVCA 1HZAA 4OWXB 5BR8Q 2VQFL 1J5EQ 4LF6Q 2NZHA 2BA0A 5LMNL 1XPUA 4LUVA 2RHSB 4DR3Q 1EQRA 3GTMH 1NMFA 1KD1C 1JJCB 4P74A 1AH9A 4NXML 4OWTB 2KENA 3B6YA 4AH6A 3HOXH 1KHIA 3AFPA 2E2HH 1FL0A 4A3KG 1BVSA 3KOJA 3CC7A 3PSIA 1HH2P 3S17H 1YJ9A 1NTGA 4JBMA 3F2BA 4B3TL 1I50H 4A3DG 2UXCQ 2R7DA 5E7NA 1LTLA 3KYHC 3NENA 4R4TA 3HFZB 2R7ZH 1PH2A 3A5ZB 4YHHQ 4A3BH 2GN5A 3U4ZA 1E7ZA 4IPCA 4JI2L 1KC8C 1NE3A 4PMWA 2ZTDA 1X56A 5IP9H 1FVIA 3D31A 5M5YH 2B3GA 1VQKA 3PGZA 4P71A 1M1KC 3HOWG 4LF8L 1JT8A 3I4MH 4UP7A 4DUYL 2R7ZG 3T1YQ 1PH6A 2EQSA 2OCEA 1K3RA 2ID0A 3ULJA 5IYBH 5JJLA 4IOAA 4YWMA 2JA6G 2UUBL 1SR3A 1OXVA 4DR1Q 3JAMc 1WJJA 1NJIC 4JI0Q 4AIMA 1DGSA 1VQ5A 4LFBQ 5IP7H 4H02A 2JK8A 2V1CC 3PIPA
chains in the Genus database with same CATH superfamily
3MXPA 4X66Q 1HZ9A 2DWCA 4LFAH 3Q8DA 1LUZA 5D8DA 1A9XA 3I3CA 1LTBD 4DXFA 1YZ6A 4BS9A 2JEAI 1XMOL 1NMGA 1N36Q 4G7ZC 3M7NA 2N55A 3VR2A 4ED8A 4DK3C 2VS1A 3NTHA 4L5TA 2VQDA 3MFHA 2C2DA 1HNWL 4LNQA 5KGUA 2PPBC 4ME5A 1O80A 1VQ7A 1VCIA 2B63A 2FJZA 2EYMA 4DUZL 5KT2A 2E75C 2HGSA 4A3JH 3PUYA 2K52A 3V2TA 4B3MQ 2RF4A 4DK6C 1QUQB 3GTJH 4X65L 4L6TB 1KTKA 3TEHB 3RNUA 2PQEA 1JKJB 4J9OA 5KFSA 2HCIA 2J7ZA 1HHVA 1FNUA 4DL2A 3PQIA 2JQOA 1TWCA 1MIUA 1UAPA 2FK2A 2G9HD 1HR0H 4R4CA 4C2MH 1S68A 2XSCA 3BQ1A 3MFYA 1I7LA 3C1FA 5C5MA 2KHIA 2QGQA 3K8AA 3BG5A 4PWQA 2NVYB 5EWEA 5KT7A 2NWGA 2RQXA 5KFMA 3WOFA 2CH4A 3NBIA 4DR2L 3I4OA 2ZJPA 1I4HA 5KFTA 1CSPA 2F0JA 3PO3H 3I2ZA 1CI3M 4UHVA 1Y1VB 4ED0A 4CDDC 2X6GA 2F0FA 3A8JE 3LNNA 4IZOA 3RUPA 4DF7A 4F87A 4LWCA 5FLXL 2W6NA 4MV4A 4UCTA 2HIXA 4DV7L 4JC0A 4JI1L 4IR1A 1XYIA 2JJQA 4HYKA 3T53B 3WOEA 3MXGA 2JA7G 2AHOB 1L1OA 2VUMB 4MV1A 4J0MA 2XTIA 3HOVH 1RJTA 3OWFA 2WIIB 3BJUA 3K81C 3GTOA 4FYDA 4QWAA 1WTXA 4A3CG 1I6HH 1UEBA 4DR5H 2J6SA 2HQLA 4K0KQ 1LTTD 3MXNA 1HTLD 3BG3A 5K36G 4DV0L 3M9OB 5FLMH 2VQFH 2WB1A 3EFXD 3CQZA 2E2IB 2A6EC 2BA1A 3CMEA 3HOZB 2W70A 1LM0A 4HIDA 4R8UA 3SEBA 3H4DA 2R92A 5L1KA 1D5XC 4JI5Q 1N48A 1KJ9A 2KCTA 3H3VH 4B3TH 1EIYB 4ZKBB 4DR7L 2NVTB 5COYA 4ETSA 4ZI7F 1XX8A 3PO2G 4ECVA 2N49A 4BY1G 2K28A 1ONLA 3I4MB 1KNAA 5D65A 4JI2H 1DOMA 2Q2TA 4TQRA 5LMNW 1VQ6A 4YB8B 5HY6A 1EUCB 2UUCL 1T5XD 2SNSA 4DUYH 3PIO3 3E5SA 2B8GA 4F8MA 4RNOA 1K83B 2FLLA 4LF5L 2IP4A 2MO1A 5IWAQ 4C3HH 1KLUD 1LACA 2OTJA 1QNUA 4O3OA 1K0RA 2YV5A 2QDLA 1SJED 3HOUB 1ZXTA 4JBJA 4P73A 1JLLB 1IW7C 4X3UA 1ET9A 4WORA 2I46A 1XMOH 1RJQA 1JXLA 4A3DH 4LFCQ 3VMMA 2CFMA 1O7YA 4YCUA 1I94Q 2R86A 5F9NA 3UE1A 2KSWA 2QDBA 1DJRD 2JEJA 1WCMG 1QE6A 1HNWH 3AFQA 1MSGA 2B2VC 2ZM6Q 1GUTA 4DUZH 5TSSA 1GVPA 1KABA 4DGZA 1LT3D 3NTKA 4OO1I 4X65H 1I4GA 1ESRA 4ED3A 1SYFA 1N33Q 1HNXL 1FR3A 3FPPA 5CORA 3TQ1A 1RTOA 4ZAIA 2K04A 2KCCA 5C3EB 2UXBQ 4XQJA 1EOTA 1EQTA 3DM3A 3VR3A 4GOPC 3OHXC 4Q8FA 3FKIB 4YAJB 1UE1A 3HGBA 1RTNA 3HKZB 3S16B 2A19A 5GAEC 3CMAA 1LTSD 3M85A 2CH4W 4Q8EA 4YJ3F 3G6XA 4DR2H 3K0YA 2LXJA 4CHTB 4BBRH 2N78A 3OW2A 2MCTA 1Y8NB 1B3QA 4DNTB 4WBNF 2KHJA 3KF6B 4PNYA 3GIMA 1B4OA 2Z4HA 2R93H 5IT9E 2B2WC 4YHHL 5D1OA 1SYEA 2JYOA 1EWCA 3F8TA 4IUVA 2UVVA 4DV7H 3RAQA 4JI1H 3VYUA 5KEEA 1M90C 1E1TA 1LT4D 2CWAA 1HCZA 1NAPA 1SSOA 4CBVA 4RH6A 2XVSA 1IBLH 3RGXA 3K5OA 3A5UA 5KFQA 1SE4A 2MP1A 5M3FH 3T1YL 1TWFB 5FJ8H 1Y69U 2NU7B 3TINA 4CKBA 4DV0H 5FO7B 1B70B 2K14A 5ELOA 5FPOA 4LFBL 1B2TA 1QVFA 3CCJA 2CW0C 2WAQG 2QYZA 3FP9A 3HS0C 3GTMB 4X66L 2JA8G 5NUCA 1AE2A 3HKZE 2HDLA 1S5CD 2V59A 2O2LD 2JEGA 4JBKA 5HGTA 5JVDF 1MSHA 2VL6A 1X6OA 3ULPA 1N36L 4DR7H 4A2AA 2Q2IA 5JUMA 1T3NA 2FPGB 3PW7A 5IYCH 1M4VA 2Y0SB 2GVBA 2ZDHA 2K5HA 5CAEB 2W71A 1II3A 5BMVF 1H9MA 1XMQQ 1NBWA 5J3BA 2WP8J 2NZOA 5IGCA 3PVXA 3Q8RB 2I5LX 4B3ML 2PZWA 1QUQA 3BVGA 1PDQA 4A3BG 1JCKB 1W3SA 2GLTA 1CK1A 2UUCH 4QY7A 3D6CA 5JJIA 1LT5D 3IKJA 1E22A 1YITA 2IHEA 1E2ZA 1PRTC 1VQNA 5IP9G 1VQPA 4KHPQ 5G3LD 4LF5H 1WOCA 3E6ZX 5T1IA 4CJ2C 1SNCA 5GADC 1LTID 4A3GG 4UFZA 1FD7D 4ECWA 1X3QA 5KG5A 2JEBI 3PR5B 5IIFA 1WFQA 3Q22A 1EY9A 4CKCA 1VMPA 3AYHB 2EZVA 3HOYH 1X65A 3RV4A 1N56A 4IRDA 1TU2B 1U5KA 4LK1C 3M4OB 2SCUB 2BQRA 4X62Q 4V190 4DR6Q 1Y1VA 3E9IA 5IYDH 1OTCA 3ERQA 2F0EA 5JH7F 4O1NA 2PO4A 3TP5A 1RJPA 1TS5A 1B53A 5JJZA 4TQSA 5EDWA 1K8AC 4NKLA 1A62A 4CC5A 4RHRA 4ED6A 3A7LA 1U4RA 2Y0SE 1JE5A 3RLNA 3PF4A 1B8AA 3DMUA 1OXUA 1Q86C 3QOLA 1YEZA 5KFUA 4IJHA 4KD3A 1HNXH 4IOCA 2HQEA 1C8CA 2VUMA 2BOSA 4OX9Q 4MV8A 4HJ8A 3UQ8A 2VZAA 4C3JG 1SYGA 3C1EA 2F0IA 5FLXc 2EY5A 2DY8A 2CW0D 4K0KL 1WTWA 3CF5A 3H91A 1VQIA 5GROA 4NXNQ 4NP5A 2FXQA 3AEVA 2CZGA 2W9AA 2R8GA 1SCUB 3I56A 2ZTEA 5DAUA 4K6LA 4AYBB 2KCMA 4LW1A 2EPBA 3CCRA 1S5DD 2FPPB 3GV8B 1Q7YC 4QW8A 2E2IA 5C44G 2F1MA 2KBNA 2F0PA 4JI5L 2GA4B 3M4QA 2F0NA 5LMUQ 2WB1G 1T36A 1EQVA 2E2DC 4YY3Q 1BCPB 1SLJA 3RJ0A 1J6QA 1IOVA 2A6HD 1M6VA 1JE4A 4MV3A 4YHHH 1H9JA 1E2VA 4A93B 5J2UF 4M8AA 1VQAA 1K28A 2R92G 4RGMA 4ZUIA 3GTPB 3MWDA 2W6ZA 4J9RA 1ML0D 1TY0A 4OONA 4FBUA 1PRTD 4RZRA 3KXYT 4GKKQ 5LA6F 1GHKA 1GO3E 1C9OA 3UDIA 2LXKA 4EEYA 2JA5H 4JI7Q 1SE8A 4QQBX 2MJ8A 1HUNA 3T1YH 4R4QA 1S0OA 3KJPA 3CKIB 3S1NB 4K8IA 1K83A 3TP8A 3CCLA 2ZXOA 1MBYA 4DV6Q 5FK9C 5IWAL 4LFBH 5C0XJ 2Z4IA 5FO9B 1R9TH 4A3IG 2ZDGA 3J7YW 1EYDA 1ZEQX 2IPKD 5CV7A 4X66H 4JOIC 4OO1H 2EOTA 2F3IA 3G6EA 4A3FB 4AYBE 1NR2A 2QA4A 3GQBA 5C4JH 2FPIB 4O4IF 1O78A 3A54A 4LFCL 3CPWA 1N36H 1I94L 4DV1Q 3SK8A 3OHBA 3STBC 4EX5A 3PIOA 2D9UA 1S72A 1F2YA 2ZM6L 1KC7A 1PH3A 3G6VA 2GPWA 1EQQA 3RAXA 5C1PA 5J1ZA 3K3VA 3JRWA 3D4WA 1EFID 4GN4B 3L4JA 4B3MH 2J6TA 1BQQT 1D5MC 4EFBA 2CW8A 1N33L 2YS7A 3G6YA 4O0AA 4G4KA 2C28A 2B63B 3D6WA 3CCQA 4RCOA 4GLVB 1CFMA 2UXBL 2V58A 1C30A 1XXGA 4CGYB 4Y7NH 5KFYA 3S1RH 1AW7A 2XGTA 3FDTA 1AN8A 4UP9A 3SVMA 5C0XI 3FKIA 4PZ7A 2MFIA 2IHFA 3NPPA 3HKZA 1QWYA 3TMEA 1ZHSA 2O5JC 4OWXB 5BR8Q 2AQ1B 1J5EQ 1D1IA 3K5NA 3L4KA 5D3DA 4HTHA 1AEXA 4LUVA 2EYLA 4DR3Q 4GC6A 4CJ1B 2PBZA 4IUUA 2KENA 2K6AA 3B6YA 4AH6A 2E2HH 1KHIA 3I4LA 4A3KG 2PNRC 3PSIA 3S17H 3BAAA 3LWBA 1YJ9A 2PZTA 5I6YA 2UXCQ 4E4TA 2R7ZH 1PH2A 5I2YA 2PW5A 1YNJC 5L37A 4E6IA 3U4ZA 1FKAH 2EJMA 1NE3A 2ZTDA 1SNDA 3E5NA 2OH2A 3M9MB 1KDAA 3S15B 2B3GA 2M05A 3T56B 1VQKA 4P71A 4K0KH 3VPCA 5I2XA 4C5CA 3P7JA 4DLKA 2BDNA 2DJFC 3PN1A 2JA6G 1WH2A 1OXVA 4DR1Q 2KOLA 3HXLA 1NJIC 3GTMA 4AIMA 3AU7A 3NTIA 5IP7H 2I07B 1C48A 2V1CC 3H0GH 5KFLA 4PQXA 2R84A 2W7OA 4JI5H 3STBD 1BBUA 2N8NA 2TSSA 3C2PA 3MFIA 3BDCA 2AWNA 3GTKB 2VXWA 4QGUA 3W3AA 2Q2UA 1AUXA 2R8KA 1YHQA 3DWQA 1SMYD 4HJ5A 2QEXA 1N9WA 2R7MA 2AUJD 2K75A 3T51B 1XMQL 4Y52H 2FP4B 1SNMA 2WTFA 3G8CA 5EOYA 3OWEB 3T1HQ 2CHBD 3OSPA 1X3FA 4WRDA 3OIPA 4I50F 5KFRA 1TWHH 1PVOA 1R9TB 5M5XB 2BH8A 1MD2D 4KHPL 2Z6KC 3PV0A 2UU9Q 3C0FB 4Q0FA 1CQIB 5IWAH 4P75A 5C4JB 3RZOH 3HKSA 4JI4Q 4O3RA 3TQTA 5CR3A 5C4HA 2CVRA 1GHJA 3KHLA 1W6JA 2X6LA 2P0AA 3KK7A 1NUCA 1NY4A 3KUPA 2AMCB 4ME6A 4LFCH 1MKHA 1SEIA 1I94H 2E74C 4TQUS 4X62L 4DR6L 2OTLA 3N6RA 1UUPA 3SGIA 3RZDB 2IW3A 2FK3A 3I4NH 5KNDA 1CKNB 3ULLA 1IBMQ 1EYGA 2ZM6H 4F4XA 4CDFC 1YBYA 1YNJD 1JIHA 3MEFA 4ZQIA 3RGZA 1UEAB 2KQ3A 4PDBA 4ZCKA 2EY6A 2E5LQ 5M5WB 1ZYRC 3A55A 4POGA 5DG9A 1Y1VG 4RMFA 3BU2A 1N33H 3SDZA 1QG7A 2J9GA 1Y1WH 4OX9L 4WJ3M 4LMYA 1F2ZA 2Q8TA 2ZJRA 2UXBH 1WTHA 1CT1D 1X54A 1NCVA 3PCOB 4BBSB 5IGEA 2EE1A 4IQZA 4NXNL 4DL5A 3Q24A 3NP8A 1K8GA 3TP6A 1E0BA 3KFUA 3OTOQ 2VUMG 3QWNA 4A3EB 4BWGB 1SNPA 2X69A 3MJFA 3A74A 2RDIA 4ECRA 4BA2I 1R4QB 2D5DA 5DLFA 1WD1A 2R7ZB 5LMUL 3J80E 4HIOA 2WKCA 1EFWA 5F9LA 4YY3L 3IFTA 4FS2A 1PTOB 2IBKA 5A2QL 2A74C 1QVGA 1B9NA 3HOZG 2F0OA 2XNAC 2YU9B 2OQKA 3BDLA 2I5HA 4I7ZC 4J8QA 4OWWB 3RLOA 1JQYD 4JI8Q 3GTPA 3T5LA 3NBHB 4GKKL 2KCNA 5C0XG 5IGBA 2XD4A 4J9PA 4JI7L 5ISRA 1C7YA 1S97A 2FLNA 1VBGA 4L8JA 2UUAL 1L1OC 1I5FA 2QF7A 3I4MG 1B7YB 5M3MB 4DV6L 1L2ZA 2F0DA 3BJYA 3BZDB 1I3QH 2TMPA 1IBKQ 4IPGA 1IOWA 1FGUA 1CM9A 5KT6A 3K6OA 4IRCA 1PXUA 2JSOA 1TY2A 2VW9A 1TWGB 4EGJA 2W8LA 3R93A 5KYLA 1YI2A 2XGQA 1SMXA 3QIAA 3X3MA 3FVQA 3KBXA 2BH2A 5EKLA 2QCPX 5JQWA 2RGRA 4ZKCB 4DV1L 2PCFB 2C00A 2L55A 5BPHA 5ELNA 2VB2X 1Q90A 3AMUA 2R6FA 3HOUG 2HJWA 2YL2A 2F0KA 3V05A 1D2BA 1E4EB 3R2TA 4I65A 3QJYA 1TWHB 1XMQH 4RNMA 1PRTF 4X3KA 2B2YA 1S0NA 1GM5A 3K5HA 1DIKA 2EYFA 3K58A 4BY7B 3ZJYC 5KFHA 4G3IA 3HOWH 3H09A 1YNNC 1BKBA 3FMCA 4KHPH 1F9RA 3A0JA 2NVXH 3H6MA 1TA8A 3J81E 1RD9D 3T5KA 1K1SA 3S14H 3K7AH 3P20A 4C3IH 5KG1A 5GAGC 5LXTF 5KG0A 3IL8A 4K5WA 2AGOA 3PO2H 3F2UA 5BR8L 1J5EL 1F9PA 3GTGB 3HB9A 2J0TD 2MGSA 4DV4Q 2AGQA 5C3EG 3W2DA 3L0OA 4DR3L 4YR0A 4J9SA 1UC9A 1WR2A 5L1IA 3FKIG 4X62H 4DR6H 3S2HB 5T1GA 5LHY1 1Z2NX 2KEEA 1D6EC 3HKZG 4DK0A 5IYZF 1STHA 4NXMQ 3RIZA 4EQNA 4RB1A 4APMA 1YIJA 1W2BA 3S1MH 4BA1I 2B8FA 4JCVE 5KFWA 1I4QA 1A2TA 1L0YB 1YHBA 2F0WA 3BVMA 5I6WA 1JICA 1HRJA 3M4IA 3R5XA 3R23A 4OX9H 3Q1KA 2XIWA 3JAME 1GOZA 4O4HF 1HQMC 3I55A 1FGBD 1GYFA 4A3MB 1GSHA 3K80C 2M2LA 3L3OC 4FNFA 3NK9A 3JSNA 4FXGC 3L2PA 3KLSX 4YJ2F 4DR1L 1WTRA 1X3GA 3GIPA 1MGSA 4A3LG 2NVQH 4KJOA 3FMAA 2UUBQ 5C4XH 1G51A 1PH4A 2E2JH 2MUYA 2PW7A 5KNBA 3HOXB 1I4RA 3ER0A 3N44B 5LMUH 2PQAB 3GIIA 4YY3H 3GTKA 4JG2A 1S5BD 3R2IA 3ETJA 1I50B 2L12A 4X64Q 5H80A 1PV4A 1AE3A 3M3YH 1STBA 4A2BA 1J8IA 5C8YF 4X6AH 1GLVA 1CHQD 3T1HL 4GKKH 2K03A 4MIUA 1VQMA 2ZTCA 1B3AA 2JA7H 4JI7H 2Y0SG 4OIKA 4A3CH 1R9TA 2UUAH 2F0LA 1STGA 4N9PA 3Q8PB 1EOVA 3BYYB 1M0WA 2L4NA 5C6AA 2ATWA 3RUZA 2OF1A 4DV6H 3NXWA 2RSOA 1LTRD 4IFDJ 3GP7A 1FJGQ 5K36H 3KALA 3V6HA 4JI4L 4RNNA 2NBFA 1AZPA 4ED2A 4IUNA 2F4IA 5F2DA 2NN6G 3PUVA 2PMZB 4IALA 1IKMA 1GSOA 5IYBG 4GKJQ 3EQLC 3MZ5A 3CW2C 4ID6A 4L5RC 2RCNA 4DV2Q 4ECTA 4DA2A 3GTQH 4DV1H 2DNEA 3V4SA 1Z6HA 1CQFA 1ZKOA 1CE8A 3GTLH 1IBML 4RKLA 1CKNA 3G48A 3DWAA 5FO8B 2F4VQ 4M9UA 3CCMA 2RBMA 4BY1H 3HOWB 1QOHA 3D4RA 2E5LL 4H7BA 1ILPA 3V6JA 1BF4A 4FBTA 3OSOA 2EYJA 3Q6SA 2N3SA 4A3JB 4U7CA 2UVWA 4G57A 1ASYA 4HSVA 3GTJB 4GN3B 1S10A 3K7AB 1JWMD 3GO5A 3T13A 5IT9c 4LF7Q 3N8DA 2MNAA 2L5TA 1GSAA 5HBRB 2B2UA 1ZQ7A 2BR0A 4RB3C 1EWIA 1N8RC 1PYWD 2FE3A 4IFDI 2AU0A 4HMIA 4DAPA 2MQHA 4C2MB 4WJ4A 4DNRB 1T94A 3OTOL 4GLXA 5BR8H 1J5EH 4RKBA 2E2HA 5KG4A 3TN2A 4DR3H 1JB7A 2J6UA 5T14A 5JOBA 2PMZE 2ES2A 2A6ED 2YYZA 4IPHA 2R7ZA 3PO3B 4UCUA 2K33A 2H1EA 2HVQA 4AYBG 1VQ9A 2RDFA 1WCMH 4OEMB 3H20A 1PH8A 4IAJA 4GNXB 2YU9A 1KJ8A 1EUJA 3CP0A 4JI8L 2AQ4A 4LF9Q 3N43B 1VQHA 4YWLA 4M1UB 3NBHA 1RKNA 2IMWP 1TIID 2ICEC 1PMRA 5KFAA 3HZXA 3HOVB 4A93G 1W93A 5GAHC 2I8CA 4JBWA 5IE8A 1I6HB 2GPSA 5C4XB 3NE5B 4RGOS 5FJ8G 2E2JB 4MA5A 2BQUA 4B9WA 3UDFA 1IBKL 4X3SA 4I7AA 1SJHD 4DR1H 1BCPF 5FKAC 1A0IA 3F2DA 3ERSX 1H9KA 4DPGA 1C0AA 3GLKA 1RF2D 3TQYA 4PMCA 4KKSA 1HFGA 3CCVA 4C5AA 5EWFA 1TWGA 2VY3A 3KTMA 3TREA 5KFZA 2IX0A 3E3XA 3H40A 1SFOH 4A76A 1RJRA 3MVVA 1IW7D 5AJ3Q 4MZ9A 1CSQA 2O03A 3RLFA 1H9RA 1BNZA 1E4GT 4O2BF 4LF4Q 2FJ2A 3DF7A 2Z6BA 1SRUA 4A3FG 1IL2A 1E4EA 1TWHA 3CRLC 1K1QA 3GD7A 4XX0B 5FPRA 2WV6D 5DM63 4RGNA 3P1HA 3TS2A 1CZGA 3C46A 2YW2A 3T1HH 2SNMA 1ET6A 2W6MA 4JYAQ 2A69C 2VPSA 3CHBD 3OPOA 3BDOA 1RCVD 2F0QA 3ZYYX 2A8VA 4IWXA 4HCEA 3F2CA 3TZUA 2VUGA 1B1ZA 4XYMB 4JI4H 5CBEE 5IY0A 3E0EA 1GD7A 4C3HB 2VQEQ 4GC7A 2UXDQ 2L1BA 2WFWA 3J80W 2B63G 5I4DA 2JA8H 4DV4L 1MJCA 4DXGA 3GTGA 2YZNA 4O3PA 4TUYF 3BVZA 4LH6A 3G7LA 4FXKC 4A3DB 1B9MA 4IUTA 4CJ0B 1JJCB 5LYJF 1AH9A 4HAEA 4NXML 4OWTB 1I4PA 1IBMH 1LTGD 3AFPA 1Y1WA 2E5LH 3IG0A 1NTGA 5L1JA 3PW0A 1I4XA 1S03G 2R7DA 5E7NA 1LTLA 3KYHC 3RFCA 2WINB 1S5ED 2FMAA 4A3BH 4JV2A 5KG3A 3DEOA 4IPCA 1KC8C 1X56A 3KHGA 4KN4C 2HD3A 5IP9H 2NB0A 4DL6A 5DGAA 5M5YH 1GUOA 2AUKA 4RB2C 5CGKA 4UP7A 5J39A 5EGTA 3OTOH 3LMLA 2OCEA 2ID0A 3EJIA 5JJLA 1EZ6A 4O4LF 2UUBL 1SR3A 2L0CA 3FEWX 4KJNA 5EQ0A 3V6KA 4JI0Q 1EYCA 1DGSA 1J9OA 2F3WA 5I9PA 4BBRB 2G9DA 4NMZA 3O13A 2VOBA 4PG3A 2PQAA 2WE6A 1ICFB 5JEAJ 3M7GA 1AP0A 4X64L 1I50A 5IGDA 4Q43A 5JJKA 2R93B 3OOCA 1SAPA 3T4AC 5E4WC 4XZ3B 2ASDA 1A2UA 2EDGA 3KHRA 4YP3A 5DLQE 5JAVA 4JI8H 1KRSA 2XIGA 4KHVA 4H44C 1U9RA 1EHIA 1EU4A 4NW2A 4IFDG 4MNOA 2AQ3B 3WDNA 3RB6A 3J81W 5KFCA 2RHQB 3UDXA 3OW7A 4DR4Q 4U673 2M9VA 4C3JH 2RKSA 5M3FB 1JMCA 3NQTA 1JB3A 1CHPD 1EY5A 2QKIC 4MV9A 2F0HA 1IBKH 1FJGL 4ZOLF 4DAMA 1PZKD 1HQRD 3KF8B 4TKOB 5L1LA 2ZXPA 2PMZA 4ED1A 5HGQA 3EA6A 3WO1A 5C44H 5C4ZA 2FB9A 3U4VA 4DV2L 4ECSA 4JUZA 1PYSB 4IPDA 3W1BA 4KY5A 4QW9A 4QIWB 1EEFD 1V51A 4K6DA 4TV9F 3GV7B 3KLSA 1S40A 2M00A 3JAMW 5HURA 1VQ8A 5ELCA 1TT2A 2R92H 3BQ2A 3RB4A 5ELEA 2NVXA 2CQAA 5JPMC 1Z2OX 4POFA 3GTJA 1BO0A 3U9SA 2PVPA 2DNCA 4LF7L 2K5DA 3PMFA 2OT2A 4FF2A 1YHAA 2AWOA 2CWPA 4KLKA 5IGFA 1JJGA 1EYZA 3RMHA 4C2MA 3D0FA 5LL6b 4O3NA 2PNHA 3T16A 2IX3A 1ZHQA 1T9HA 4FDBA 1RDPD 3OMCA 2YS6A 4DV4H 4I4TF 4H0LC 4RAYA 3PUXA 4BBSG 1K9MC 3BZCA 4DL4A 1TS2A 3HOYB 2QW7A 3QZ7A 5DQHA 1XNQQ 5JVG3 4NXMH 4M7EA 1XMOQ 1RK6A 1F2MA 2DPIA 2CQOA 3RR5A 4XYLB 2R8JA 4A3EG 4GNXA 4UCVA 2I80A 3NGDA 2R87A 3LWEA 4QIWE 4WD3A 2Q8RE 4LF9L 3HG9A 4GS3A 4L5QA 5EWGA 3NEMA 3GV6A 2SDFA 3RF2A 1MJEA 4H13C 4XYQA 3NHHA 4DV5Q 3MAQA 1PH1A 1K73C 5KFVA 4V0BA 5ELFA 4DFAA 3GQCA 2R7FA 3EN2A 5CA0F 4FP5D 1IXRA 1BNCA 1TWAH 4HMJA 4DAYB 3CCUA 2R8HA 2UUBH 3J7ZC 1JOQA 1CKOA 1IYVA 1STYA 3K5MA 1BOSA 1EIHA 4UCOA 4ZK9B 2W6QA 4FO2A 5M3MG 1KEEA 1XPRA 5AJ3L 3JRXA 1JDBB 4QCLA 4A3KH 4X64H 3SK5A 1PH9A 2B2TA 4LF4L 4Q44A 2KHSA 2YTYA 1BCPC 4J9NA 5A35A 1Q8IA 3NWTA 2L9HA 4F4YA 2F0VA 4XQQA 3Q8SB 1Z7TA 2W9CA 5FOBB 1VQEA 4L1KA 4JPBW 2XCPA 1RODA 3GILA 4K5XA 4JYAL 5LL6S 1OWTA 1A15A 5GQOA 4MA0A 1UWVA 1EEID 4BXXG 2JA5B 4R4IA 4R8NA 1GXDC 1K8OA 4LUZA 4CDCC 2HT1A 2VPQA 3VPDA 1EY6A 2VNUD 1FJGH 4QMGA 2NUAB 2JA6H 4GLAC 2VQEL 4JOIA 2F0UA 4BY7G 1LT6D 1RK5A 2UXDL 4KY7A 4EBDA 4JI3Q 3OIQA 2DGYA 3R3OA 1ILQA 3HP3A 1DD2A 2FK1A 3GTLA 4MTEA 4DV2H 4P72A 3WWVA 1QZHA 4J6HA 2K01A 4UP8A 4ECXA 3ONAB 1XPOA 5LMNQ 1VAJA 3QG1A 1SYCA 4EFEA 3DM1A 1YJWA 4L63B 3TIGA 1BR9A 1XTCD 3CPFA 3H15A 4RFBA 2OQ0A 4XQNA 4DR7Q 2YRXA 4ABNA 3ND9A 4MTKA 2R85A 3GV3A 4RUAA 1Q46A 4JV1A 5BN4A 5IT9L 4RZQA 3CRKC 3F8NA 1WYDA 3KAJA 4LF7H 4EVOA 4K14A 1PA6A 5GONF 2KA7A 1KQSA 1VBHA 3EVQA 1HR0W 2UVRA 4Y7NB 3GIQA 1DCZA 3S1RB 1LYLA 4O3SA 1Q1BA 3MWYW 4LSAA 1JX4A 1HJPA 2F3VA 4UPAA 2V4RA 3BQ0A 4K2KA 5JEAG 4LF8Q 3KBGA 5KFFA 2IY5B 4NB3A 4YIJA 3TRZA 4J9MA 1E24A 1RL2A 4JI0L 5DG7A 4A3MG 1WCMA 4F4ZA 4ODGA 4QWDA 2H5XA 1BXTA 2R6GA 3MXUA 3N42B 4GZYC 2ZT9C 2E2HB 1EIGA 1P16A 3KLWA 3CCSA 1BCPD 2GVAA 2RDHA 1VQLA 2NVYH 5JVH3 3S17B 4B3RQ 1PK8A 3WO0A 1OXSC 2R93A 2VA3A 4OGQC 3KLRA 5CV8A 4EQ5A 2D0OA 4O3QA 1CQVA 3HOXG 1R4PB 1VQFA 5E4XA 3KHHA 4LF9H 2NN6I 4TRDA 1Y1VH 1FNWA 4UCSA 1EY7A 4DR4L 4FXDA 2K32A 5CYUA 3KDFB 4WJWA 1XDNA 1TWAB 1X3EA 5KT5A 4J1MA 5KKNB 1JOOA 3U9OA 5KFEA 1PFBA 4YCWA 2HVSA 1DZ1A 2VUMH 4JV5Q 3R5HA 3KF8A 3EIVA 3JC66 1RYSA 3TDQA 4MAMA 4YWKA 1VF5C 2K1BA 2EJGC 3H0GB 5D3IB 2I87A 2ENBA 3J81c 1RHPA 1AN7A 1EUDB 3QFFA 1HNZQ 4U6PA 5IODA 1KNEA 1UE6A 4LF4H 4QIWA 2FFKB 4OELB 2E2IH 4ALPA 4JK1C 3TS0A 1EYAA 3HOZH 5LP6F 4IZ8A 1GKHA 5CV6A 3RD4A 2AKWB 5CBAE 3CCEA 1BJTA 3MR6A 4UAIA 3RTXA 2L15A 4EYIB 4KD4A 5C0XH 3QO2A 1ZYRD 1YNXA 2NVTH 5EAYA 4EBEA 4JYAH 2FLPA 3A8IE 1EU3A 2Z6KA 5FD6A 3ICEA 4EQOA 3CXCA 3SI8A 2O4XA 1HXYD 3G71A 1CUKA 1WTPA 1K8MA 4A3JG 4ECQA 3HBLA 3Q0AA 2VQEH 1Y8PB 3RZOB 5EBDA 2UXDH 3KJOA 2W7PA 2OLSA 3I7FA 1B6SA 3RV3A 4YAKB 1TR5A 2C22A 2KUMA 5CB4F 3GIJA 4B9XA 1XTDA 1UE5A 3VYRA 2R82A 1K83H 4DNIA 3J7A5 5E3FA 3U50C 5KIXA 1XNQL 2IL8A 5HV6A 2V4QA 3DHQA 1PYBA 3SE0A 2C2RA 1EL0A 1H9SB 2PI2A 4XIGS 5ELBA 5J22A 3I4NB 5CV5A 3HOUH 1BXRA 2FINB 2RCFA 1E1OA 2L11A 3EYYA 2HHHQ 4J9LA 1EIFA 1E2WA 3MFGA 1F9SA 2MHVA 1KIXA 2YTXA 1KRTA 2QEJC 2A5HA 1KL9A 3PO3G 4O42A 2PZUA 5DGBA 4EQPA 1TS3A 3FDSA 1BBWA 5DQIA 1Y1WB 2UXCL 3V96A 3JZIA 4YBZB 3VYSA 1C3OA 1UC8A 4N9TA 4KK7A 4DV5L 1STAA 4HNUA 2F0MA 2YZGA 2BCOA 3D4DA 5LOVF 5DNFA 2B2UC 1F77A 4KN7C 4X3TA 3V4ZA 3ETHA 1QZGA 1LO5D 4DAYA 4GOPB 3HOVG 3HEJA 2XCLA 4JI0H 4ULLA 1IBLQ 2K50A 2LMCB 5C3EH 5C4XG 4QWEA 1ICWA 4NXNH 4EGVA 2J4XA 4K5VA 4ZLTF 1E3PA 1SXTA 2F0SA 2OEOA 3FKIH 2RA4A 4HEDA 4F7XA 1IYJB 2YCHA 1VQBA 1W6KA 5FLMG 2ALYB 1X9NA 2W6OA 3S16H 5FD5A 1KAAA 4JI6Q 5FLXW 5BN5A 1XNRQ 2FMCA 2Q2HA 4HR7B 4K2LA 4JW0A 3UFXB 3ITPA 1CKMA 4KI0A 1PLFA 4XTCS 1KDBA 1IZ6A 1PTOC 1ENCA 5AFWA 1TAEA 4EG0A 3LGJA 3MTSA 1KXLA 4PZ6A 1JJ2A 2RDGA 3M4YA 2NUCA 2QILA 1SDFA 4QUCA 4DR4H 1V4YA 5C1OA 2A68C 2JA5A 4RA8A 1OXTA 1T5EA 2RSNA 2ASJA 1YNND 1VQJA 4NLGA 3S24A 4QL5A 2R7NA 2OWOA 4P2CB 1I3QB 1EY4A 1N34Q 1ESFA 4UY8C 3GV5B 1A3TA 4OL7A 4JI3L 4A3LH 4FM9A 1NR4A 4HCSA 3EPIA 2UU9L 5C5JA 3NWSA 1TWFH 1U4MA 1MZBA 1VQCA 4DL7A 1X55A 2MO0A 3R5FA 4J9KA 4YCVA 2OXPA 1UNSA 3MEHA 1HZAA 4LF6Q 2RVLA 2EYOA 5LMNL 4C3HG 1GGOA 5C3WA 1XPUA 2DPJA 1SBBB 2NTTA 2RHSB 1EQRA 4XYOA 3GTMH 2K5WA 1KD1C 4XDXA 5KG6A 4ED7A 3MWMA 1FL0A 1BVSA 3KOJA 3CC7A 4XXEA 2F03A 4EEQA 4LJZC 3K5LA 4Y8VB 4JBMA 4A3DG 3F2BA 3S9WA 4WFN3 4FS1A 3TP7A 3NENA 3KAKA 1TQOA 5JVLA 2GN5A 4C1NI 1E7ZA 2DLNA 2NVXB 4QUFA 1HTPA 1O7LA 4IRKA 1FVIA 3D31A 3PW5A 3S14B 1PRTB 2F0GA 3K57A 2BE5C 1G91A 4C3IB 2ZDQA 4LF8L 3PW2A 1G8ZD 1K3BC 3PO2B 2NN6H 3NQIA 2F0TA 2H4OA 2EQSA 1K3RA 1CZWA 3VR4A 5IYBH 1JWSD 2W8KA 2DIKA 1SE2A 5D14A 1WJJA 1KJJA 1XNQH 4C5BA 1CA6A 4EYHB 1KJIA 3OUUA 1HPCA 3MR2A 3PIPA 1F2LA 2HVRA 3LP8A 1PTOD 4B3RL 2YTVA 3I72A 1GUGA 1DYQA 1PZID 2KECA 2UVUA 4BBRG 3I91A 3I12A 5KFNA 3M4OH 3S1MB 1MI2A 3UDGA 1VQOA 2A68D 4FF1A 4DAVA 5KFIA 2UXCH 1HZBA 2SEBD 2LS01 4TVAB 1X32A 2R93G 3KDFA 1TWAA 2XN9C 2W9BB 1O7ZA 4OHJA 4DV5H 1GUWA 3PZPA 3TSSA 1HZCA 1RIPA 1WSCA 1HA6A 4JV5L 1S3OA 1V1PB 2R61A 2NVQB 1VQGA 2IWHA 5M3FG 1DOLA 1LLRD 3OSNA 4B3SQ 4YQWA 3I73A 3H0GA 3L7ZC 1OXXK 3N52A 2LFNA 1HNZL 2F52A 2EXDA 2JEFA 3N6XA 3DEPA 4FF3A 2RGVA 3JSLA 1S9FA 1SROA 1PFNA 1SE3A 1GUSA 2XGPA 1G6PA 1EY8A 4DV3Q 1NSNS 3M3YB 4IURA 4HIMA 4ZQ3A 1A63A 4N8X1 2R7KA 2ZJTA 3Q23A 3VR6A 1TS4A 4FF4A 1G2TA 4JV0A 2JA7B 1G6ZA 2JA6A 4TV8F 5IYCG 3N40P 4A93H 2R7LA 2PYKA 4C1NK 4J15A 3H94A 2BE5D 2W9CB 3GTPH 5EKKA 3J80i 5EPKA 5CV4A 1JDEA 5CA1F 4DL3A 4JI3H 1O7IA 1N32Q 4IN3A 4AQYQ 4LH7A 2UU9H 3SXHA 2CW7A 3UI2A 3OMGA 1P8LA 4NDXA 1IKLA 4UCRA 3M9BA 3S1NH 3C3LA 1VMCA 1CS0A 2XCAA 3GTQB 5LMNH 4ZYSA 1UNNC 1IYUA 1H9SA 3GTLB 2HHHL 4A3FH 3J80L 1B50A 3R8BA 1DXMA 4BY1B 4LFAQ 4G7HC 5A2QE 1PFSA 3HOYG 4BWSC 1D5ZC 1B44D 2A6HC 4RWSC 1PH7A 3K3PA 3DUZA 2B2VA 2X0SA 4HNTA 1Q3LA 5IYDG 2V5AA 2JN4A 5EPJA 2K5VA 4XT1B 1SN8A 5EZYF 4B08A 4R1JA 3DLLA 3GIDA 3G4SA 3H4BA 1V9PA 3MC0B 1KBLA 3DWPA 1HA5A 1ZETA 4O2DA 3BZKA 1EZ8A 5C5LA 4LF8H 4KV6A 2YYAA 1SYXB 2EXZA 2B63H 4GOPA 2EVBA 2MPMA 2W6PA 1IBLL 5DQGA 4DK1A 1K0SA 3LWUA 2NVYA 2JEIA 1SNOA 2ZXRA 3PW4A 1ASZA 3U58A 2E76C 4A3GH 2LY7A 1KJQA 1HR0Q 1V43A 3CC2A 3BABA 3QB3A 3CVZA 4JI6L 5CC4A 5EPLA 5JPNC 1JORA 1XNRL 4B3RH 1BGWA 1Q1EA 4RGTA 1WCMB 4HR7A 1TWCH 3PR4A 5KX5F 3EPGA 4CDEC 2PN1A 2AGPA 3J81i 1FNVA 4GNXC 1AUVA 2ZJQA 3PF5A 1XWEA 2B2WA 3D8GA 3I70A 3K5IA 5KFPA 3K0XA 3IRBA 2Q8IB 1QVCA 2A1AA 2D2CC 4QB4A 1VS0A 1H95A 1Q81C 2N88A 5CMDA 3PUWA 1VF7A 3SR1A 3IFDA 2A69D 5KFDA 1E4FT 1N34L 3M4PA 1I3QA 4JV5H 5KFJA 1YJNA 5ELDA 1TVXA 4OIJA 2JA5G 3J81L 3S15H 1B04A 4MV7A 1FYCA 3BA8A 3RB3A 1ULZA 1SFOB 1HNZH 1Z2PX 2XWJB 3Q2OA 4DR5Q 1U4PA 4ME3A 1LV9A 4LF6L 4RU9A 1S5FD 2WACA 1I6UA 3GTOH 2VQFQ 1IL8A 3JAMi 4GKJL 2NU6B 4OO1G 2R8IA 5KFBA 3H3VC 2CCZA 4U68A 5BN3A 4KY6A 3OYYA 2B2TC 3J7AK 5DLGA 1LTAD 3D3RA 2G5DA 4IFDH 3VR5A 3CQZH 3GTKH 1M7JA 2F4VL 4APVA 4B3TQ 1JC7A 5BPFA 2O5IC 1DONA 1QCBD 2K7VA 4LUOA 1B33N 3BA9A 4Z9CB 1GUNA 2NU8B 1EY0A 5FLXE 1G2SA 3FHWA 1PZJD 3JAML 2UUAQ 4KMUC 2I5MX 3E9HA 4JI2Q 2DZDA 1S0MA 2W57A 1V1OA 2EJFC 2B29A 4HSPA 4Q45A 2C2EA 2WAQB 4L5SA 2XWBB 2JA8B 4ECUA 3I8ZA 5M5XH 3RN2A 4DUYQ 2HUGA 1I6VC 3QOJA 1BBXC 1QJOA 2CKZB 4KTAA 3DXJC 1D8LA 3J81j 1PHJA 4A3IH 1OO9B 1SEBD 4EGQA 4IO9A 2VA2A 4PZ8A 3MR3A 1JOKA 2A73B 1RYRA 2HHHH 2Z8LA 4RHSA 3T5JA 1VQDA 4KHZA 3BYTB 2YRWA 3S2DH 1V1QA 2SOBA 1UE7A 1SMYC 3A8KE 3RZDH 4RB0A 1G291 4A3BB 5J2TF 5C3XA 1XJVA 4R4OA 2I0QA 1HNWQ 1Q12A 2W9BA 1AZQA 1TXYA 5M5WH 2R7ZG 5M5YB 4DUZQ 1QB5D 1VQ4A 3A56A 5L9XA 4IUPA 1WD0A 3LX0A 2HIVA 1PH5A 1W96A 4A3GB 4X65Q 2ICIA 1V1PA 5M9OA 1D7QA 1A8VA 5DG8A 1ENAA 1JWUD 4A4IA 4BBSH 3ORQA 5KFXA 3J7AV 3ORRA 1SNQA 1TWCB 5I9OA 4B3SL 3S1QH 3UE0A 2WAQE 3RBEA 5E1FA 2FHTA 1PTOF 4KKTA 1EZ1A 3MWEA 5IOCA 2Z9HA 5KFOA 4JI6H 1XNRH 3OUZA 3SE7A 1VKZA 4MN3A 4A3EH 3KF6A 4DV3L 5IP7G 2VB3X 4MTDA 2V4DA 3H0GG 4LAAA 4DR2Q 1A6XA 3N41B 1Y14B 1JR0D 2FMMA 2K5QA 4MTNA 5K5PA 3J7AF 2WDTA 1WVLA 2FKLA 3P75A 4MV6A 4CC6A 1X3PA 2DUDA 1PTOH 4ECYA 3VYTA 4HNVA 2RDJA 4IR9A 3IN5A 2JA7A 3CD6A 2EIFA 2PI2E 3AQQA 1Y8OB 4C3JB 2BDOA 3RN5A 1CA5A 2YU9H 5KT3A 3MR5A 5KFGA 4JVZA 2P5ZX 2K05A 4LMQD 3URYA 3F1ZA 3BS1A 1WTVA 1GJXA 3SHLA 1TWFA 4DV7Q 1N34H 4JI1Q 5KT4A 5KRUA 4IJLA 1N32L 2NTSA 3EBEA 1L1OB 4RAUC 4N8FA 1WI5A 4AQYL 3GTOB 4RUCA 4CKEA 5KYIA 4UDUC 2XC9A 3I90A 1CTMA 4HIKA 2EY1A 3VPBA 5C44B 3NELA 4G7OC 5M3MH 2ASLA 4LF6H 1D1KA 3MXNB 1PFMA 1WTQA 3GTQA 1QILA 5EJWA 4DV0Q 2WB1B 5H1SE 2KVMA 2ATLA 4DU9A 1B6RA 4GKJH 1KAWA 2DJGC 3VA5A 4DKAC 3CQZB 2QK4A 4IUQA 4QJFA 4OXPA 1TWGH 4HN7A 3X3NA 3IAYA 4LFAL 4R8UB 1A3UA 2Y0SA 2K5NA 1DV1A 2EYHA 1Z47A 2IX1A 3MA2B 1L2FA 1A3VA 2R92B 4C56C 1STNA 2HCCA 2LSSA 2F4VH 5CV9A 2CQYA 3RB0A 5KG2A 2C35B 4O2AF 3CAMA 3I4NG 4HJ9A 4BXXH 2Z0SA 5D1PA 5K2MA 2DY7A 1LABA 4PMBA 4I55F 1IHZA 4Q5VA 3J80c 3QZ8A 3Q8QB 3K7UC 4ECZA 2B2YC 2EY2A 3PIP3 4EBCA 2K4KA 3G6JB 4BY7H 3RBDA 4KKUA 1Y1WG 4A3IB 3SK6A 1VDZA 2UUCQ 1SYDA 1QNKA 3CC4A 2B39A 3TZDA 3H3VI 3K59A 1O75A 2JE6I 2D0PA 3W1GA 4LF5Q 4A75A 1S4ZA 5EBCA 1HR0L 2HDMA 2E8GA 5IT9W 5EKIA 3S2DB 4ZRZA 4I7HA 1TKWB 2IT1A 4HJAA 3PUZA 4RAZA 3GTGH 2WB1E 3FPUB 2BQ3A 1NNXA 4Q0YA 1U4LA 2IA6A 2KJXA 3VDYA 5DM73 2ASBA 4GN5A 3S2HH 1Q8KA 2JA9A 4QWBA 1Q82C 1MHWC 3SK4A 4K8JA 4HQ6A 1EWHA 4IWYA 1DOKA 4R7RA 3VA7A 4J9QA 4RG1A 2R3ZA 4ZUJA 4R9WA 5G3LF 4LSXA 3GIKA 3QR8A 4NPSA 3W5OA 1M0TA 1U0LA 3S1QB 4YR2A 4F4WA 3EROA 1Z9FA 3NUCA 1KLGD 2C9OA 2ALZA 5KG7A 2LKVA 5JEAH 2YZMA 1STEA 4QF4A 1HNXQ 3GDEA 2D62A 4AYBA 2DN8A 3MHBA 4HJ7A 1WTOA 4FU0A 3FRPB 4B3SH 4A3MH 2C5CA 4F88A 2Z1CA 4DR5L 1SFOA 1L0WA 3TIIA 5A2QW 1YVCA 2IJ0A 2NYZD 2VQFL 4A3KB 1I7NA 2NZHA 2BA0A 1DV2A 4DV3H 1DM0B 2AQ2B 2XRSD 3A7AB 5I47A 1CQJB 4IHJF 1NMFA 1ENFA 4P74A 3TBIB 4XT3B 3E0JA 3HOXH 5KNCA 3HRZC 5DEHA 1L0XB 3AB9A 1HH2P 4DN4M 1BUVT 4YR3A 2WYOA 1C4QA 4F50A 4B3TL 1I50H 3M9NB 1BDOA 4MHEA 2VR1A 3OHAA 4R4TA 3CU7A 3HFZB 4ILWA 1AFPA 5D1OB 3A5ZB 3T5HA 4YHHQ 1PX2A 2KEDA 4QWCA 4ZHQF 4JI2L 2JP1A 4RCNA 4PMWA 1N32H 2JA6B 2XRQD 4PV1C 4AQYH 1HUMA 2JXMB 2WKDA 2WAQA 3NSWA 1SYBA 3ND8A 3PGZA 5LL6X 1M1KC 2NZ1D 3HOWG 5IGGA 1JT8A 1KDCA 3L9AX 3I4MH 4DUYL 2V9WA 4TSSA 3T1YQ 1PH6A 2EYPA 3ULJA 1F9QA 4IOAA 4YWMA 4FVMA 3U9TA 3JAMc 5KFKA 1M8AA 4C3IG 1VQ5A 4LFBQ 1HFNA 2NU9B 4R8IA 4H02A 3WNZA 2JK8A 1V8QA 4S3SA
chains in the Genus database with same CATH topology
3H0GH 4X66Q 1HZ9A 2PQAA 4PG3A 4B3RL 2YTVA 3Q8DA 3STBD 1BBUA 1LUZA 2N8NA 5JEAJ 4X64L 1YZ6A 2AWNA 2JEAI 1XMOL 5JJKA 4BBRG 4QGUA 1NMGA 2Q2UA 3M4OH 1YHQA 1N36Q 3M7NA 3UDGA 4HJ5A 2QEXA 5DLQE 4DK3C 2VS1A 1VQOA 1KRSA 1N9WA 4L5TA 2K75A 1XMQL 4LNQA 1HNWL 4Y52H 1HZBA 4IFDG 4MNOA 4TVAB 1VQ7A 1VCIA 2R93G 3KDFA 4DUZL 2RHQB 3UDXA 3T1HQ 4DR4Q 4A3JH 1X3FA 3PUYA 2K52A 4C3JH 4B3MQ 2RF4A 4DK6C 1QUQB 3GTJH 1TWHH 1JMCA 4X65L 1PVOA 2IX1A 1HZCA 1RIPA 2BH8A 3TEHB 3RNUA 2Z6KC 3PV0A 1S3OA 2UU9Q 1FJGL 4KHPL 4JV5L 4DAMA 2JQOA 1MIUA 1VQGA 4P75A 3RZOH 3KF8B 3HKSA 5M3FG 4JI4Q 4R4CA 4B3SQ 4C2MH 5HGQA 3L7ZC 1OXXK 1HNZL 5C44H 2F52A 2EXDA 2KHIA 2QGQA 3K8AA 3U4VA 4DV2L 1PYSB 1NY4A 1SROA 4IPDA 2AMCB 3W1BA 1MKHA 1G6PA 4DR2L 4DV3Q 3I4OA 4TQUS 4X62L 2ZJPA 4DR6L 1CSPA 2OTLA 3SGIA 4HIMA 3PO3H 1S40A 1A63A 3I2ZA 3I4NH 1CKNB 3ULLA 1IBMQ 1EYGA 1VQ8A 1YBYA 2R92H 3MEFA 2E5LQ 4LWCA 4POFA 4POGA 5IYCG 4A93H 1Y1VG 2HIXA 3BU2A 4RMFA 4DV7L 4J15A 4JC0A 4JI1L 4LF7L 1Y1WH 4OX9L 4WJ3M 2JJQA 3GTPH 1YHAA 2AWOA 2CWPA 4KLKA 2ZJRA 3J80i 2AHOB 1L1OA 2JA7G 1X54A 2XTIA 3PCOB 3HOVH 1JJGA 3BJUA 1O7IA 3K81C 1N32Q 4A3CG 3D0FA 1I6HH 4AQYQ 1UEBA 2PNHA 1T9HA 4FDBA 4NXNL 1K8GA 1P8LA 2HQLA 4K0KQ 3KFUA 3OTOQ 3M9BA 2VUMG 3S1NH 4DV0L 3PUXA 4BBSG 5K36G 5FLMH 1K9MC 3BZCA 3A74A 4BA2I 1XNQQ 2BA1A 3CMEA 1LM0A 4HIDA 1XMOQ 5LMUL 2HHHL 2CQOA 3RR5A 4HIOA 4A3FH 1EFWA 4YY3L 4A3EG 4LFAQ 4GNXA 4JI5Q 1PFSA 3HOYG 2KCTA 3H3VH 1QVGA 1PH7A 4QIWE 1EIYB 3HOZG 4DR7L 2OQKA 2I5HA 3PO2G 4LF9L 5IYDG 4OWWB 2N49A 4BY1G 3RLOA 2K5VA 4GS3A 4JI8Q 1SN8A 4L5QA 4R1JA 3NBHB 3DLLA 3NEMA 2Q2TA 4GKKL 5C0XG 3G4SA 1V9PA 5LMNW 1VQ6A 4JI7L 5HY6A 1C7YA 1MJEA 4O2DA 3BZKA 2UUCL 4DV5Q 1PH1A 2UUAL 1K73C 1L1OC 1I5FA 3I4MG 1B7YB 2B63H 4DV6L 4GOPA 2R7FA 3EN2A 1I3QH 1IBLL 1IXRA 1IBKQ 1TWAH 4DAYB 3CCUA 4LF5L 4IPGA 3J7ZC 2MO1A 1CKOA 1ASZA 1FGUA 5IWAQ 4C3HH 3U58A 4A3GH 2OTJA 1HR0Q 5M3MG 1K0RA 1V43A 2VW9A 3CC2A 2YV5A 1XPRA 5AJ3L 4JI6L 4JBJA 4P73A 1YI2A 1Q1EA 1SMXA 1XNRL 1TWCH 4A3KH 2BH2A 1PH9A 4LF4L 4DV1L 4A3DH 4LFCQ 5ELNA 2CFMA 4YCUA 1I94Q 3J81i 3UE1A 4GNXC 2YTYA 2ZJQA 3HOUG 3PF5A 1WCMG 3AFQA 3K0XA 2ZM6Q 3IRBA 1QVCA 2A1AA 1GM5A 1VQEA 1VS0A 4JYAL 1Q81C 1H95A 1GVPA 5GQOA 3PUWA 1UWVA 4BXXG 3ZJYC 4R4IA 4OO1I 3HOWH 1N34L 1N33Q 1BKBA 4LUZA 1HNXL 3M4PA 2HT1A 2VNUD 3A0JA 2NVXH 1YJNA 2JA6H 4GLAC 2VQEL 4JOIA 2JA5G 4BY7G 2UXBQ 2UXDL 3S15H 3S14H 3K7AH 4JI3Q 3DM3A 4GOPC 4C3IH 2DGYA 5GAGC 1UE1A 3PO2H 5BR8L 4DR5Q 1J5EL 4ME3A 4LF6L 4P72A 4DV4Q 2A19A 5GAEC 3WWVA 3CMAA 1QZHA 5C3EG 3M85A 3L0OA 3GTOH 4UP8A 4DR3L 2VQFQ 3JAMi 1XPOA 4GKJL 5LMNQ 2LXJA 3FKIG 4OO1G 4BBRH 2N78A 3OW2A 1YJWA 3HKZG 3CPFA 3H15A 1SFOH 2CCZA 4NXMQ 3OYYA 2OQ0A 4DR7Q 2KHJA 3KF6B 1YIJA 3GTKH 3CQZH 2R93H 1W2BA 1Q46A 4APVA 2F4VL 4B3TQ 4BA1I 4YHHL 3S1MH 4JCVE 3F8TA 1YHBA 4LUOA 1WYDA 1PA6A 1M90C 1E1TA 1KQSA 3FHWA 3I55A 2CWAA 2UUAQ 2I5MX 3E9HA 4JI2Q 1HR0W 1LYLA 2B29A 1Q1BA 3K80C 3A5UA 1D7QA 4L5SA 5M3FH 3T1YL 5FJ8H 1HJPA 4UPAA 3L2PA 5JEAG 4LF8Q 5M5XH 3RN2A 2IY5B 4NB3A 4DUYQ 4DR1L 3TRZA 1E24A 1B70B 1RL2A 1X3GA 2K14A 5ELOA 4A3MG 4JI0L 2NVQH 2CKZB 4A3LG 4LFBL 2UUBQ 1QVFA 5C4XH 3CCJA 1G51A 2WAQG 1PH4A 1D8LA 2H5XA 3FP9A 3J81j 2R6GA 4A3IH 1PHJA 2E2JH 4X66L 2JA8G 4IO9A 4PZ8A 1AE2A 3HKZE 3ER0A 1P16A 2PQAB 3KLWA 3CCSA 1VQLA 2GVAA 2NVYH 4B3RQ 4JBKA 4JG2A 1VQDA 1OXSC 1X6OA 2VL6A 4KHZA 4X64Q 3ULPA 1N36L 4EQ5A 1PV4A 3S2DH 1V1QA 1AE3A 2Q2IA 2D0OA 2NVTH 1UE7A 3M3YH 3HOXG 3RZDH 1VQFA 1G291 5IYCH 2NN6I 2GVBA 1Y1VH 4X6AH 2K5HA 1XJVA 4R4OA 2I0QA 1XMQQ 1Q12A 1NBWA 5J3BA 2WP8J 2NZOA 3T1HL 4DR4L 1HNWQ 2I5LX 3KDFB 1TXYA 2ZTCA 5M5WH 1VQMA 4B3ML 1X3EA 4DUZQ 1VQ4A 2JA7H 1QUQA 4A3BG 1W3SA 2Y0SG 2HIVA 4QY7A 1PH5A 4A3CH 5JJIA 1EOVA 1E22A 2ATWA 4X65Q 4YCWA 1YITA 2IHEA 1VQNA 5IP9G 1A8VA 2VUMH 4A4IA 1VQPA 1FJGQ 4BBSH 4JV5Q 4JI4L 4KHPQ 1WOCA 4B3SL 3S1QH 3UE0A 3EIVA 3JC66 2WAQE 5GADC 4A3GG 2NN6G 3PUVA 4YWKA 5IYBG 3J81c 4GKJQ 3CW2C 1HNZQ 4L5RC 2JEBI 2RCNA 4DV2Q 4A3EH 1WFQA 3KF6A 4DV3L 3GTQH 5IP7G 1UE6A 3AYHB 3HOYH 1X65A 1U5KA 3H0GG 2E2IH 4ALPA 4DR2Q 3TS0A 3HOZH 3GTLH 1Y14B 4X62Q 1IBML 4DR6Q 1CKNA 3E9IA 3G48A 4MTNA 2F4VQ 5IYDH 1OTCA 1GKHA 3CCEA 2AKWB 3CCMA 4BY1H 2DUDA 2E5LL 2L15A 3CD6A 2N3SA 1YNXA 2EIFA 1A62A 2PI2E 3AQQA 5EAYA 3RN5A 1K8AC 1ASYA 2YU9H 2Y0SE 2Z6KA 1JE5A 4GN3B 3RLNA 3ICEA 1B8AA 3F1ZA 3CXCA 1OXUA 3PF4A 1Q86C 3GO5A 4DV7Q 1YEZA 4IJHA 5IT9c 1CUKA 3G71A 4JI1Q 4IOCA 4LF7Q 4IFDJ 4OX9Q 2MNAA 4IJLA 4HJ8A 4A3JG 1N32L 3EBEA 1L1OB 2VZAA 1EWIA 1WI5A 4AQYL 1N8RC 4IFDI 5FLXc 3KJOA 2MQHA 4WJ4A 3I7FA 4K0KL 3OTOL 4HIKA 3CF5A 5GROA 1VQIA 4GLXA 3NELA 4NXNQ 2FXQA 5M3MH 3AEVA 1XTDA 1UE5A 2ZTEA 3MXNB 3I56A 1K83H 4DV0Q 2KCMA 4LW1A 4DNIA 5H1SE 3J7A5 1JB7A 3U50C 3CCRA 1XNQL 1KAWA 1Q7YC 4DKAC 1PYBA 2PMZE 2ES2A 2YYZA 4QJFA 4OXPA 4IPHA 5C44G 2KBNA 2PI2A 1TWGH 4XIGS 4LFAL 3HOUH 4JI5L 4AYBG 1VQ9A 1E1OA 2K5NA 3M4QA 1Z47A 1WCMH 2WB1G 5LMUQ 1EIFA 1L2FA 1PH8A 2HHHQ 4YY3Q 4GNXB 1SLJA 1KIXA 1J6QA 2YTXA 2LSSA 1KRTA 1KL9A 3PO3G 2C35B 1EUJA 3CAMA 4HJ9A 3CP0A 4JI8L 3I4NG 1VQAA 2Z0SA 4BXXH 1BBWA 4LF9Q 2R92G 2UXCL 1VQHA 4YWLA 3J80c 4OONA 4GKKQ 4A93G 1GO3E 1C9OA 3K7UC 3UDIA 5GAHC 2LXKA 4JBWA 5IE8A 4DV5L 2K4KA 2JA5H 4JI7Q 1SE8A 4BY7H 4QQBX 1Y1WG 4R4QA 5FJ8G 3KJPA 2UUCQ 3UDFA 1IBKL 1QZGA 3CC4A 4GOPB 3CCLA 3HOVG 1A0IA 4DV6Q 3F2DA 3H3VI 3ERSX 4DPGA 5IWAL 1IBLQ 1C0AA 2K50A 5C0XJ 5C3EH 2JE6I 2D0PA 3W1GA 4LF5Q 5C4XG 4A75A 1HR0L 3TQYA 1R9TH 4A3IG 2E8GA 3CCVA 1E3PA 2VY3A 4JOIC 3FKIH 2IX0A 3TREA 2F3IA 1IYJB 2IT1A 1VQBA 4HJAA 3PUZA 2ALYB 5FLMG 3G6EA 1X9NA 4AYBE 2QA4A 4A76A 3GTGH 3S16H 5AJ3Q 5C4JH 2WB1E 4MZ9A 4JI6Q 1XNRQ 1CSQA 2Q2HA 3RLFA 4LFCL 1CKMA 4KI0A 3CPWA 1I94L 4XTCS 1IZ6A 3VDYA 4LF4Q 4DV1Q 2ASBA 4GN5A 3S2HH 1Q8KA 1SRUA 2JA9A 3STBC 4EX5A 3PIOA 4A3FG 3LGJA 1Q82C 1IL2A 4PZ6A 1S72A 1KXLA 2ZM6L 1JJ2A 1PH3A 1EQQA 3GD7A 4RG1A 3TS2A 4GN4B 4NPSA 3W5OA 4JYAQ 1U0LA 1OXTA 1N33L 1Z9FA 4O0AA 1VQJA 2A8VA 3S24A 4QL5A 3CCQA 2OWOA 1N34Q 3F2CA 4GLVB 1HNXQ 4UY8C 2UXBL 3GDEA 2D62A 4Y7NH 3S1RH 4HJ7A 2XGTA 4JI3L 4A3LH 5IY0A 4A3MH 3E0EA 1GD7A 4UP9A 2VQEQ 2UU9L 5C0XI 2WFWA 2UXDQ 4PZ7A 1TWFH 4DR5L 2MFIA 1VQCA 2IHFA 1L0WA 2B63G 2JA8H 1X55A 2MO0A 1MJCA 4DV4L 4YCVA 1YVCA 1HZAA 4OWXB 5BR8Q 2VQFL 1J5EQ 4LF6Q 2NZHA 2BA0A 5LMNL 1XPUA 4LUVA 2RHSB 4DR3Q 1EQRA 3GTMH 1NMFA 1KD1C 1JJCB 4P74A 1AH9A 4NXML 4OWTB 2KENA 3B6YA 4AH6A 3HOXH 1KHIA 3AFPA 2E2HH 1FL0A 4A3KG 1BVSA 3KOJA 3CC7A 3PSIA 1HH2P 3S17H 1YJ9A 1NTGA 4JBMA 3F2BA 4B3TL 1I50H 4A3DG 2UXCQ 2R7DA 5E7NA 1LTLA 3KYHC 3NENA 4R4TA 3HFZB 2R7ZH 1PH2A 3A5ZB 4YHHQ 4A3BH 2GN5A 3U4ZA 1E7ZA 4IPCA 4JI2L 1KC8C 1NE3A 4PMWA 2ZTDA 1X56A 5IP9H 1FVIA 3D31A 5M5YH 2B3GA 1VQKA 3PGZA 4P71A 1M1KC 3HOWG 4LF8L 1JT8A 3I4MH 4UP7A 4DUYL 2R7ZG 3T1YQ 1PH6A 2EQSA 2OCEA 1K3RA 2ID0A 3ULJA 5IYBH 5JJLA 4IOAA 4YWMA 2JA6G 2UUBL 1SR3A 1OXVA 4DR1Q 3JAMc 1WJJA 1NJIC 4JI0Q 4AIMA 1DGSA 1VQ5A 4LFBQ 5IP7H 4H02A 2JK8A 2V1CC 3PIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G H;  4X66 Q;  1HZ9 A;  2PQA A;  4PG3 A;  4B3R L;  2YTV A;  3Q8D A;  3STB D;  1BBU A;  1LUZ A;  2N8N A;  5JEA J;  4X64 L;  1YZ6 A;  2AWN A;  2JEA I;  1XMO L;  5JJK A;  4BBR G;  4QGU A;  1NMG A;  2Q2U A;  3M4O H;  1YHQ A;  1N36 Q;  3M7N A;  3UDG A;  4HJ5 A;  2QEX A;  5DLQ E;  4DK3 C;  2VS1 A;  1VQO A;  1KRS A;  1N9W A;  4L5T A;  2K75 A;  1XMQ L;  4LNQ A;  1HNW L;  4Y52 H;  1HZB A;  4IFD G;  4MNO A;  4TVA B;  1VQ7 A;  1VCI A;  2R93 G;  3KDF A;  4DUZ L;  2RHQ B;  3UDX A;  3T1H Q;  4DR4 Q;  4A3J H;  1X3F A;  3PUY A;  2K52 A;  4C3J H;  4B3M Q;  2RF4 A;  4DK6 C;  1QUQ B;  3GTJ H;  1TWH H;  1JMC A;  4X65 L;  1PVO A;  2IX1 A;  1HZC A;  1RIP A;  2BH8 A;  3TEH B;  3RNU A;  2Z6K C;  3PV0 A;  1S3O A;  2UU9 Q;  1FJG L;  4KHP L;  4JV5 L;  4DAM A;  2JQO A;  1MIU A;  1VQG A;  4P75 A;  3RZO H;  3KF8 B;  3HKS A;  5M3F G;  4JI4 Q;  4R4C A;  4B3S Q;  4C2M H;  5HGQ A;  3L7Z C;  1OXX K;  1HNZ L;  5C44 H;  2F52 A;  2EXD A;  2KHI A;  2QGQ A;  3K8A A;  3U4V A;  4DV2 L;  1PYS B;  1NY4 A;  1SRO A;  4IPD A;  2AMC B;  3W1B A;  1MKH A;  1G6P A;  4DR2 L;  4DV3 Q;  3I4O A;  4TQU S;  4X62 L;  2ZJP A;  4DR6 L;  1CSP A;  2OTL A;  3SGI A;  4HIM A;  3PO3 H;  1S40 A;  1A63 A;  3I2Z A;  3I4N H;  1CKN B;  3ULL A;  1IBM Q;  1EYG A;  1VQ8 A;  1YBY A;  2R92 H;  3MEF A;  2E5L Q;  4LWC A;  4POF A;  4POG A;  5IYC G;  4A93 H;  1Y1V G;  2HIX A;  3BU2 A;  4RMF A;  4DV7 L;  4J15 A;  4JC0 A;  4JI1 L;  4LF7 L;  1Y1W H;  4OX9 L;  4WJ3 M;  2JJQ A;  3GTP H;  1YHA A;  2AWO A;  2CWP A;  4KLK A;  2ZJR A;  3J80 i;  2AHO B;  1L1O A;  2JA7 G;  1X54 A;  2XTI A;  3PCO B;  3HOV H;  1JJG A;  3BJU A;  1O7I A;  3K81 C;  1N32 Q;  4A3C G;  3D0F A;  1I6H H;  4AQY Q;  1UEB A;  2PNH A;  1T9H A;  4FDB A;  4NXN L;  1K8G A;  1P8L A;  2HQL A;  4K0K Q;  3KFU A;  3OTO Q;  3M9B A;  2VUM G;  3S1N H;  4DV0 L;  3PUX A;  4BBS G;  5K36 G;  5FLM H;  1K9M C;  3BZC A;  3A74 A;  4BA2 I;  1XNQ Q;  2BA1 A;  3CME A;  1LM0 A;  4HID A;  1XMO Q;  5LMU L;  2HHH L;  2CQO A;  3RR5 A;  4HIO A;  4A3F H;  1EFW A;  4YY3 L;  4A3E G;  4LFA Q;  4GNX A;  4JI5 Q;  1PFS A;  3HOY G;  2KCT A;  3H3V H;  1QVG A;  1PH7 A;  4QIW E;  1EIY B;  3HOZ G;  4DR7 L;  2OQK A;  2I5H A;  3PO2 G;  4LF9 L;  5IYD G;  4OWW B;  2N49 A;  4BY1 G;  3RLO A;  2K5V A;  4GS3 A;  4JI8 Q;  1SN8 A;  4L5Q A;  4R1J A;  3NBH B;  3DLL A;  3NEM A;  2Q2T A;  4GKK L;  5C0X G;  3G4S A;  1V9P A;  5LMN W;  1VQ6 A;  4JI7 L;  5HY6 A;  1C7Y A;  1MJE A;  4O2D A;  3BZK A;  2UUC L;  4DV5 Q;  1PH1 A;  2UUA L;  1K73 C;  1L1O C;  1I5F A;  3I4M G;  1B7Y B;  2B63 H;  4DV6 L;  4GOP A;  2R7F A;  3EN2 A;  1I3Q H;  1IBL L;  1IXR A;  1IBK Q;  1TWA H;  4DAY B;  3CCU A;  4LF5 L;  4IPG A;  3J7Z C;  2MO1 A;  1CKO A;  1ASZ A;  1FGU A;  5IWA Q;  4C3H H;  3U58 A;  4A3G H;  2OTJ A;  1HR0 Q;  5M3M G;  1K0R A;  1V43 A;  2VW9 A;  3CC2 A;  2YV5 A;  1XPR A;  5AJ3 L;  4JI6 L;  4JBJ A;  4P73 A;  1YI2 A;  1Q1E A;  1SMX A;  1XNR L;  1TWC H;  4A3K H;  2BH2 A;  1PH9 A;  4LF4 L;  4DV1 L;  4A3D H;  4LFC Q;  5ELN A;  2CFM A;  4YCU A;  1I94 Q;  3J81 i;  3UE1 A;  4GNX C;  2YTY A;  2ZJQ A;  3HOU G;  3PF5 A;  1WCM G;  3AFQ A;  3K0X A;  2ZM6 Q;  3IRB A;  1QVC A;  2A1A A;  1GM5 A;  1VQE A;  1VS0 A;  4JYA L;  1Q81 C;  1H95 A;  1GVP A;  5GQO A;  3PUW A;  1UWV A;  4BXX G;  3ZJY C;  4R4I A;  4OO1 I;  3HOW H;  1N34 L;  1N33 Q;  1BKB A;  4LUZ A;  1HNX L;  3M4P A;  2HT1 A;  2VNU D;  3A0J A;  2NVX H;  1YJN A;  2JA6 H;  4GLA C;  2VQE L;  4JOI A;  2JA5 G;  4BY7 G;  2UXB Q;  2UXD L;  3S15 H;  3S14 H;  3K7A H;  4JI3 Q;  3DM3 A;  4GOP C;  4C3I H;  2DGY A;  5GAG C;  1UE1 A;  3PO2 H;  5BR8 L;  4DR5 Q;  1J5E L;  4ME3 A;  4LF6 L;  4P72 A;  4DV4 Q;  2A19 A;  5GAE C;  3WWV A;  3CMA A;  1QZH A;  5C3E G;  3M85 A;  3L0O A;  3GTO H;  4UP8 A;  4DR3 L;  2VQF Q;  3JAM i;  1XPO A;  4GKJ L;  5LMN Q;  2LXJ A;  3FKI G;  4OO1 G;  4BBR H;  2N78 A;  3OW2 A;  1YJW A;  3HKZ G;  3CPF A;  3H15 A;  1SFO H;  2CCZ A;  4NXM Q;  3OYY A;  2OQ0 A;  4DR7 Q;  2KHJ A;  3KF6 B;  1YIJ A;  3GTK H;  3CQZ H;  2R93 H;  1W2B A;  1Q46 A;  4APV A;  2F4V L;  4B3T Q;  4BA1 I;  4YHH L;  3S1M H;  4JCV E;  3F8T A;  1YHB A;  4LUO A;  1WYD A;  1PA6 A;  1M90 C;  1E1T A;  1KQS A;  3FHW A;  3I55 A;  2CWA A;  2UUA Q;  2I5M X;  3E9H A;  4JI2 Q;  1HR0 W;  1LYL A;  2B29 A;  1Q1B A;  3K80 C;  3A5U A;  1D7Q A;  4L5S A;  5M3F H;  3T1Y L;  5FJ8 H;  1HJP A;  4UPA A;  3L2P A;  5JEA G;  4LF8 Q;  5M5X H;  3RN2 A;  2IY5 B;  4NB3 A;  4DUY Q;  4DR1 L;  3TRZ A;  1E24 A;  1B70 B;  1RL2 A;  1X3G A;  2K14 A;  5ELO A;  4A3M G;  4JI0 L;  2NVQ H;  2CKZ B;  4A3L G;  4LFB L;  2UUB Q;  1QVF A;  5C4X H;  3CCJ A;  1G51 A;  2WAQ G;  1PH4 A;  1D8L A;  2H5X A;  3FP9 A;  3J81 j;  2R6G A;  4A3I H;  1PHJ A;  2E2J H;  4X66 L;  2JA8 G;  4IO9 A;  4PZ8 A;  1AE2 A;  3HKZ E;  3ER0 A;  1P16 A;  2PQA B;  3KLW A;  3CCS A;  1VQL A;  2GVA A;  2NVY H;  4B3R Q;  4JBK A;  4JG2 A;  1VQD A;  1OXS C;  1X6O A;  2VL6 A;  4KHZ A;  4X64 Q;  3ULP A;  1N36 L;  4EQ5 A;  1PV4 A;  3S2D H;  1V1Q A;  1AE3 A;  2Q2I A;  2D0O A;  2NVT H;  1UE7 A;  3M3Y H;  3HOX G;  3RZD H;  1VQF A;  1G29 1;  5IYC H;  2NN6 I;  2GVB A;  1Y1V H;  4X6A H;  2K5H A;  1XJV A;  4R4O A;  2I0Q A;  1XMQ Q;  1Q12 A;  1NBW A;  5J3B A;  2WP8 J;  2NZO A;  3T1H L;  4DR4 L;  1HNW Q;  2I5L X;  3KDF B;  1TXY A;  2ZTC A;  5M5W H;  1VQM A;  4B3M L;  1X3E A;  4DUZ Q;  1VQ4 A;  2JA7 H;  1QUQ A;  4A3B G;  1W3S A;  2Y0S G;  2HIV A;  4QY7 A;  1PH5 A;  4A3C H;  5JJI A;  1EOV A;  1E22 A;  2ATW A;  4X65 Q;  4YCW A;  1YIT A;  2IHE A;  1VQN A;  5IP9 G;  1A8V A;  2VUM H;  4A4I A;  1VQP A;  1FJG Q;  4BBS H;  4JV5 Q;  4JI4 L;  4KHP Q;  1WOC A;  4B3S L;  3S1Q H;  3UE0 A;  3EIV A;  3JC6 6;  2WAQ E;  5GAD C;  4A3G G;  2NN6 G;  3PUV A;  4YWK A;  5IYB G;  3J81 c;  4GKJ Q;  3CW2 C;  1HNZ Q;  4L5R C;  2JEB I;  2RCN A;  4DV2 Q;  4A3E H;  1WFQ A;  3KF6 A;  4DV3 L;  3GTQ H;  5IP7 G;  1UE6 A;  3AYH B;  3HOY H;  1X65 A;  1U5K A;  3H0G G;  2E2I H;  4ALP A;  4DR2 Q;  3TS0 A;  3HOZ H;  3GTL H;  1Y14 B;  4X62 Q;  1IBM L;  4DR6 Q;  1CKN A;  3E9I A;  3G48 A;  4MTN A;  2F4V Q;  5IYD H;  1OTC A;  1GKH A;  3CCE A;  2AKW B;  3CCM A;  4BY1 H;  2DUD A;  2E5L L;  2L15 A;  3CD6 A;  2N3S A;  1YNX A;  2EIF A;  1A62 A;  2PI2 E;  3AQQ A;  5EAY A;  3RN5 A;  1K8A C;  1ASY A;  2YU9 H;  2Y0S E;  2Z6K A;  1JE5 A;  4GN3 B;  3RLN A;  3ICE A;  1B8A A;  3F1Z A;  3CXC A;  1OXU A;  3PF4 A;  1Q86 C;  3GO5 A;  4DV7 Q;  1YEZ A;  4IJH A;  5IT9 c;  1CUK A;  3G71 A;  4JI1 Q;  4IOC A;  4LF7 Q;  4IFD J;  4OX9 Q;  2MNA A;  4IJL A;  4HJ8 A;  4A3J G;  1N32 L;  3EBE A;  1L1O B;  2VZA A;  1EWI A;  1WI5 A;  4AQY L;  1N8R C;  4IFD I;  5FLX c;  3KJO A;  2MQH A;  4WJ4 A;  3I7F A;  4K0K L;  3OTO L;  4HIK A;  3CF5 A;  5GRO A;  1VQI A;  4GLX A;  3NEL A;  4NXN Q;  2FXQ A;  5M3M H;  3AEV A;  1XTD A;  1UE5 A;  2ZTE A;  3MXN B;  3I56 A;  1K83 H;  4DV0 Q;  2KCM A;  4LW1 A;  4DNI A;  5H1S E;  3J7A 5;  1JB7 A;  3U50 C;  3CCR A;  1XNQ L;  1KAW A;  1Q7Y C;  4DKA C;  1PYB A;  2PMZ E;  2ES2 A;  2YYZ A;  4QJF A;  4OXP A;  4IPH A;  5C44 G;  2KBN A;  2PI2 A;  1TWG H;  4XIG S;  4LFA L;  3HOU H;  4JI5 L;  4AYB G;  1VQ9 A;  1E1O A;  2K5N A;  3M4Q A;  1Z47 A;  1WCM H;  2WB1 G;  5LMU Q;  1EIF A;  1L2F A;  1PH8 A;  2HHH Q;  4YY3 Q;  4GNX B;  1SLJ A;  1KIX A;  1J6Q A;  2YTX A;  2LSS A;  1KRT A;  1KL9 A;  3PO3 G;  2C35 B;  1EUJ A;  3CAM A;  4HJ9 A;  3CP0 A;  4JI8 L;  3I4N G;  1VQA A;  2Z0S A;  4BXX H;  1BBW A;  4LF9 Q;  2R92 G;  2UXC L;  1VQH A;  4YWL A;  3J80 c;  4OON A;  4GKK Q;  4A93 G;  1GO3 E;  1C9O A;  3K7U C;  3UDI A;  5GAH C;  2LXK A;  4JBW A;  5IE8 A;  4DV5 L;  2K4K A;  2JA5 H;  4JI7 Q;  1SE8 A;  4BY7 H;  4QQB X;  1Y1W G;  4R4Q A;  5FJ8 G;  3KJP A;  2UUC Q;  3UDF A;  1IBK L;  1QZG A;  3CC4 A;  4GOP B;  3CCL A;  3HOV G;  1A0I A;  4DV6 Q;  3F2D A;  3H3V I;  3ERS X;  4DPG A;  5IWA L;  1IBL Q;  1C0A A;  2K50 A;  5C0X J;  5C3E H;  2JE6 I;  2D0P A;  3W1G A;  4LF5 Q;  5C4X G;  4A75 A;  1HR0 L;  3TQY A;  1R9T H;  4A3I G;  2E8G A;  3CCV A;  1E3P A;  2VY3 A;  4JOI C;  3FKI H;  2IX0 A;  3TRE A;  2F3I A;  1IYJ B;  2IT1 A;  1VQB A;  4HJA A;  3PUZ A;  2ALY B;  5FLM G;  3G6E A;  1X9N A;  4AYB E;  2QA4 A;  4A76 A;  3GTG H;  3S16 H;  5AJ3 Q;  5C4J H;  2WB1 E;  4MZ9 A;  4JI6 Q;  1XNR Q;  1CSQ A;  2Q2H A;  3RLF A;  4LFC L;  1CKM A;  4KI0 A;  3CPW A;  1I94 L;  4XTC S;  1IZ6 A;  3VDY A;  4LF4 Q;  4DV1 Q;  2ASB A;  4GN5 A;  3S2H H;  1Q8K A;  1SRU A;  2JA9 A;  3STB C;  4EX5 A;  3PIO A;  4A3F G;  3LGJ A;  1Q82 C;  1IL2 A;  4PZ6 A;  1S72 A;  1KXL A;  2ZM6 L;  1JJ2 A;  1PH3 A;  1EQQ A;  3GD7 A;  4RG1 A;  3TS2 A;  4GN4 B;  4NPS A;  3W5O A;  4JYA Q;  1U0L A;  1OXT A;  1N33 L;  1Z9F A;  4O0A A;  1VQJ A;  2A8V A;  3S24 A;  4QL5 A;  3CCQ A;  2OWO A;  1N34 Q;  3F2C A;  4GLV B;  1HNX Q;  4UY8 C;  2UXB L;  3GDE A;  2D62 A;  4Y7N H;  3S1R H;  4HJ7 A;  2XGT A;  4JI3 L;  4A3L H;  5IY0 A;  4A3M H;  3E0E A;  1GD7 A;  4UP9 A;  2VQE Q;  2UU9 L;  5C0X I;  2WFW A;  2UXD Q;  4PZ7 A;  1TWF H;  4DR5 L;  2MFI A;  1VQC A;  2IHF A;  1L0W A;  2B63 G;  2JA8 H;  1X55 A;  2MO0 A;  1MJC A;  4DV4 L;  4YCV A;  1YVC A;  1HZA A;  4OWX B;  5BR8 Q;  2VQF L;  1J5E Q;  4LF6 Q;  2NZH A;  2BA0 A;  5LMN L;  1XPU A;  4LUV A;  2RHS B;  4DR3 Q;  1EQR A;  3GTM H;  1NMF A;  1KD1 C;  1JJC B;  4P74 A;  1AH9 A;  4NXM L;  4OWT B;  2KEN A;  3B6Y A;  4AH6 A;  3HOX H;  1KHI A;  3AFP A;  2E2H H;  1FL0 A;  4A3K G;  1BVS A;  3KOJ A;  3CC7 A;  3PSI A;  1HH2 P;  3S17 H;  1YJ9 A;  1NTG A;  4JBM A;  3F2B A;  4B3T L;  1I50 H;  4A3D G;  2UXC Q;  2R7D A;  5E7N A;  1LTL A;  3KYH C;  3NEN A;  4R4T A;  3HFZ B;  2R7Z H;  1PH2 A;  3A5Z B;  4YHH Q;  4A3B H;  2GN5 A;  3U4Z A;  1E7Z A;  4IPC A;  4JI2 L;  1KC8 C;  1NE3 A;  4PMW A;  2ZTD A;  1X56 A;  5IP9 H;  1FVI A;  3D31 A;  5M5Y H;  2B3G A;  1VQK A;  3PGZ A;  4P71 A;  1M1K C;  3HOW G;  4LF8 L;  1JT8 A;  3I4M H;  4UP7 A;  4DUY L;  2R7Z G;  3T1Y Q;  1PH6 A;  2EQS A;  2OCE A;  1K3R A;  2ID0 A;  3ULJ A;  5IYB H;  5JJL A;  4IOA A;  4YWM A;  2JA6 G;  2UUB L;  1SR3 A;  1OXV A;  4DR1 Q;  3JAM c;  1WJJ A;  1NJI C;  4JI0 Q;  4AIM A;  1DGS A;  1VQ5 A;  4LFB Q;  5IP7 H;  4H02 A;  2JK8 A;  2V1C C;  3PIP A; 
#chains in the Genus database with same CATH topology
 3MXP A;  4X66 Q;  1HZ9 A;  2DWC A;  4LFA H;  3Q8D A;  1LUZ A;  5D8D A;  1A9X A;  3I3C A;  1LTB D;  4DXF A;  1YZ6 A;  4BS9 A;  2JEA I;  1XMO L;  1NMG A;  1N36 Q;  4G7Z C;  3M7N A;  2N55 A;  3VR2 A;  4ED8 A;  4DK3 C;  2VS1 A;  3NTH A;  4L5T A;  2VQD A;  3MFH A;  2C2D A;  1HNW L;  4LNQ A;  5KGU A;  2PPB C;  4ME5 A;  1O80 A;  1VQ7 A;  1VCI A;  2B63 A;  2FJZ A;  2EYM A;  4DUZ L;  5KT2 A;  2E75 C;  2HGS A;  4A3J H;  3PUY A;  2K52 A;  3V2T A;  4B3M Q;  2RF4 A;  4DK6 C;  1QUQ B;  3GTJ H;  4X65 L;  4L6T B;  1KTK A;  3TEH B;  3RNU A;  2PQE A;  1JKJ B;  4J9O A;  5KFS A;  2HCI A;  2J7Z A;  1HHV A;  1FNU A;  4DL2 A;  3PQI A;  2JQO A;  1TWC A;  1MIU A;  1UAP A;  2FK2 A;  2G9H D;  1HR0 H;  4R4C A;  4C2M H;  1S68 A;  2XSC A;  3BQ1 A;  3MFY A;  1I7L A;  3C1F A;  5C5M A;  2KHI A;  2QGQ A;  3K8A A;  3BG5 A;  4PWQ A;  2NVY B;  5EWE A;  5KT7 A;  2NWG A;  2RQX A;  5KFM A;  3WOF A;  2CH4 A;  3NBI A;  4DR2 L;  3I4O A;  2ZJP A;  1I4H A;  5KFT A;  1CSP A;  2F0J A;  3PO3 H;  3I2Z A;  1CI3 M;  4UHV A;  1Y1V B;  4ED0 A;  4CDD C;  2X6G A;  2F0F A;  3A8J E;  3LNN A;  4IZO A;  3RUP A;  4DF7 A;  4F87 A;  4LWC A;  5FLX L;  2W6N A;  4MV4 A;  4UCT A;  2HIX A;  4DV7 L;  4JC0 A;  4JI1 L;  4IR1 A;  1XYI A;  2JJQ A;  4HYK A;  3T53 B;  3WOE A;  3MXG A;  2JA7 G;  2AHO B;  1L1O A;  2VUM B;  4MV1 A;  4J0M A;  2XTI A;  3HOV H;  1RJT A;  3OWF A;  2WII B;  3BJU A;  3K81 C;  3GTO A;  4FYD A;  4QWA A;  1WTX A;  4A3C G;  1I6H H;  1UEB A;  4DR5 H;  2J6S A;  2HQL A;  4K0K Q;  1LTT D;  3MXN A;  1HTL D;  3BG3 A;  5K36 G;  4DV0 L;  3M9O B;  5FLM H;  2VQF H;  2WB1 A;  3EFX D;  3CQZ A;  2E2I B;  2A6E C;  2BA1 A;  3CME A;  3HOZ B;  2W70 A;  1LM0 A;  4HID A;  4R8U A;  3SEB A;  3H4D A;  2R92 A;  5L1K A;  1D5X C;  4JI5 Q;  1N48 A;  1KJ9 A;  2KCT A;  3H3V H;  4B3T H;  1EIY B;  4ZKB B;  4DR7 L;  2NVT B;  5COY A;  4ETS A;  4ZI7 F;  1XX8 A;  3PO2 G;  4ECV A;  2N49 A;  4BY1 G;  2K28 A;  1ONL A;  3I4M B;  1KNA A;  5D65 A;  4JI2 H;  1DOM A;  2Q2T A;  4TQR A;  5LMN W;  1VQ6 A;  4YB8 B;  5HY6 A;  1EUC B;  2UUC L;  1T5X D;  2SNS A;  4DUY H;  3PIO 3;  3E5S A;  2B8G A;  4F8M A;  4RNO A;  1K83 B;  2FLL A;  4LF5 L;  2IP4 A;  2MO1 A;  5IWA Q;  4C3H H;  1KLU D;  1LAC A;  2OTJ A;  1QNU A;  4O3O A;  1K0R A;  2YV5 A;  2QDL A;  1SJE D;  3HOU B;  1ZXT A;  4JBJ A;  4P73 A;  1JLL B;  1IW7 C;  4X3U A;  1ET9 A;  4WOR A;  2I46 A;  1XMO H;  1RJQ A;  1JXL A;  4A3D H;  4LFC Q;  3VMM A;  2CFM A;  1O7Y A;  4YCU A;  1I94 Q;  2R86 A;  5F9N A;  3UE1 A;  2KSW A;  2QDB A;  1DJR D;  2JEJ A;  1WCM G;  1QE6 A;  1HNW H;  3AFQ A;  1MSG A;  2B2V C;  2ZM6 Q;  1GUT A;  4DUZ H;  5TSS A;  1GVP A;  1KAB A;  4DGZ A;  1LT3 D;  3NTK A;  4OO1 I;  4X65 H;  1I4G A;  1ESR A;  4ED3 A;  1SYF A;  1N33 Q;  1HNX L;  1FR3 A;  3FPP A;  5COR A;  3TQ1 A;  1RTO A;  4ZAI A;  2K04 A;  2KCC A;  5C3E B;  2UXB Q;  4XQJ A;  1EOT A;  1EQT A;  3DM3 A;  3VR3 A;  4GOP C;  3OHX C;  4Q8F A;  3FKI B;  4YAJ B;  1UE1 A;  3HGB A;  1RTN A;  3HKZ B;  3S16 B;  2A19 A;  5GAE C;  3CMA A;  1LTS D;  3M85 A;  2CH4 W;  4Q8E A;  4YJ3 F;  3G6X A;  4DR2 H;  3K0Y A;  2LXJ A;  4CHT B;  4BBR H;  2N78 A;  3OW2 A;  2MCT A;  1Y8N B;  1B3Q A;  4DNT B;  4WBN F;  2KHJ A;  3KF6 B;  4PNY A;  3GIM A;  1B4O A;  2Z4H A;  2R93 H;  5IT9 E;  2B2W C;  4YHH L;  5D1O A;  1SYE A;  2JYO A;  1EWC A;  3F8T A;  4IUV A;  2UVV A;  4DV7 H;  3RAQ A;  4JI1 H;  3VYU A;  5KEE A;  1M90 C;  1E1T A;  1LT4 D;  2CWA A;  1HCZ A;  1NAP A;  1SSO A;  4CBV A;  4RH6 A;  2XVS A;  1IBL H;  3RGX A;  3K5O A;  3A5U A;  5KFQ A;  1SE4 A;  2MP1 A;  5M3F H;  3T1Y L;  1TWF B;  5FJ8 H;  1Y69 U;  2NU7 B;  3TIN A;  4CKB A;  4DV0 H;  5FO7 B;  1B70 B;  2K14 A;  5ELO A;  5FPO A;  4LFB L;  1B2T A;  1QVF A;  3CCJ A;  2CW0 C;  2WAQ G;  2QYZ A;  3FP9 A;  3HS0 C;  3GTM B;  4X66 L;  2JA8 G;  5NUC A;  1AE2 A;  3HKZ E;  2HDL A;  1S5C D;  2V59 A;  2O2L D;  2JEG A;  4JBK A;  5HGT A;  5JVD F;  1MSH A;  2VL6 A;  1X6O A;  3ULP A;  1N36 L;  4DR7 H;  4A2A A;  2Q2I A;  5JUM A;  1T3N A;  2FPG B;  3PW7 A;  5IYC H;  1M4V A;  2Y0S B;  2GVB A;  2ZDH A;  2K5H A;  5CAE B;  2W71 A;  1II3 A;  5BMV F;  1H9M A;  1XMQ Q;  1NBW A;  5J3B A;  2WP8 J;  2NZO A;  5IGC A;  3PVX A;  3Q8R B;  2I5L X;  4B3M L;  2PZW A;  1QUQ A;  3BVG A;  1PDQ A;  4A3B G;  1JCK B;  1W3S A;  2GLT A;  1CK1 A;  2UUC H;  4QY7 A;  3D6C A;  5JJI A;  1LT5 D;  3IKJ A;  1E22 A;  1YIT A;  2IHE A;  1E2Z A;  1PRT C;  1VQN A;  5IP9 G;  1VQP A;  4KHP Q;  5G3L D;  4LF5 H;  1WOC A;  3E6Z X;  5T1I A;  4CJ2 C;  1SNC A;  5GAD C;  1LTI D;  4A3G G;  4UFZ A;  1FD7 D;  4ECW A;  1X3Q A;  5KG5 A;  2JEB I;  3PR5 B;  5IIF A;  1WFQ A;  3Q22 A;  1EY9 A;  4CKC A;  1VMP A;  3AYH B;  2EZV A;  3HOY H;  1X65 A;  3RV4 A;  1N56 A;  4IRD A;  1TU2 B;  1U5K A;  4LK1 C;  3M4O B;  2SCU B;  2BQR A;  4X62 Q;  4V19 0;  4DR6 Q;  1Y1V A;  3E9I A;  5IYD H;  1OTC A;  3ERQ A;  2F0E A;  5JH7 F;  4O1N A;  2PO4 A;  3TP5 A;  1RJP A;  1TS5 A;  1B53 A;  5JJZ A;  4TQS A;  5EDW A;  1K8A C;  4NKL A;  1A62 A;  4CC5 A;  4RHR A;  4ED6 A;  3A7L A;  1U4R A;  2Y0S E;  1JE5 A;  3RLN A;  3PF4 A;  1B8A A;  3DMU A;  1OXU A;  1Q86 C;  3QOL A;  1YEZ A;  5KFU A;  4IJH A;  4KD3 A;  1HNX H;  4IOC A;  2HQE A;  1C8C A;  2VUM A;  2BOS A;  4OX9 Q;  4MV8 A;  4HJ8 A;  3UQ8 A;  2VZA A;  4C3J G;  1SYG A;  3C1E A;  2F0I A;  5FLX c;  2EY5 A;  2DY8 A;  2CW0 D;  4K0K L;  1WTW A;  3CF5 A;  3H91 A;  1VQI A;  5GRO A;  4NXN Q;  4NP5 A;  2FXQ A;  3AEV A;  2CZG A;  2W9A A;  2R8G A;  1SCU B;  3I56 A;  2ZTE A;  5DAU A;  4K6L A;  4AYB B;  2KCM A;  4LW1 A;  2EPB A;  3CCR A;  1S5D D;  2FPP B;  3GV8 B;  1Q7Y C;  4QW8 A;  2E2I A;  5C44 G;  2F1M A;  2KBN A;  2F0P A;  4JI5 L;  2GA4 B;  3M4Q A;  2F0N A;  5LMU Q;  2WB1 G;  1T36 A;  1EQV A;  2E2D C;  4YY3 Q;  1BCP B;  1SLJ A;  3RJ0 A;  1J6Q A;  1IOV A;  2A6H D;  1M6V A;  1JE4 A;  4MV3 A;  4YHH H;  1H9J A;  1E2V A;  4A93 B;  5J2U F;  4M8A A;  1VQA A;  1K28 A;  2R92 G;  4RGM A;  4ZUI A;  3GTP B;  3MWD A;  2W6Z A;  4J9R A;  1ML0 D;  1TY0 A;  4OON A;  4FBU A;  1PRT D;  4RZR A;  3KXY T;  4GKK Q;  5LA6 F;  1GHK A;  1GO3 E;  1C9O A;  3UDI A;  2LXK A;  4EEY A;  2JA5 H;  4JI7 Q;  1SE8 A;  4QQB X;  2MJ8 A;  1HUN A;  3T1Y H;  4R4Q A;  1S0O A;  3KJP A;  3CKI B;  3S1N B;  4K8I A;  1K83 A;  3TP8 A;  3CCL A;  2ZXO A;  1MBY A;  4DV6 Q;  5FK9 C;  5IWA L;  4LFB H;  5C0X J;  2Z4I A;  5FO9 B;  1R9T H;  4A3I G;  2ZDG A;  3J7Y W;  1EYD A;  1ZEQ X;  2IPK D;  5CV7 A;  4X66 H;  4JOI C;  4OO1 H;  2EOT A;  2F3I A;  3G6E A;  4A3F B;  4AYB E;  1NR2 A;  2QA4 A;  3GQB A;  5C4J H;  2FPI B;  4O4I F;  1O78 A;  3A54 A;  4LFC L;  3CPW A;  1N36 H;  1I94 L;  4DV1 Q;  3SK8 A;  3OHB A;  3STB C;  4EX5 A;  3PIO A;  2D9U A;  1S72 A;  1F2Y A;  2ZM6 L;  1KC7 A;  1PH3 A;  3G6V A;  2GPW A;  1EQQ A;  3RAX A;  5C1P A;  5J1Z A;  3K3V A;  3JRW A;  3D4W A;  1EFI D;  4GN4 B;  3L4J A;  4B3M H;  2J6T A;  1BQQ T;  1D5M C;  4EFB A;  2CW8 A;  1N33 L;  2YS7 A;  3G6Y A;  4O0A A;  4G4K A;  2C28 A;  2B63 B;  3D6W A;  3CCQ A;  4RCO A;  4GLV B;  1CFM A;  2UXB L;  2V58 A;  1C30 A;  1XXG A;  4CGY B;  4Y7N H;  5KFY A;  3S1R H;  1AW7 A;  2XGT A;  3FDT A;  1AN8 A;  4UP9 A;  3SVM A;  5C0X I;  3FKI A;  4PZ7 A;  2MFI A;  2IHF A;  3NPP A;  3HKZ A;  1QWY A;  3TME A;  1ZHS A;  2O5J C;  4OWX B;  5BR8 Q;  2AQ1 B;  1J5E Q;  1D1I A;  3K5N A;  3L4K A;  5D3D A;  4HTH A;  1AEX A;  4LUV A;  2EYL A;  4DR3 Q;  4GC6 A;  4CJ1 B;  2PBZ A;  4IUU A;  2KEN A;  2K6A A;  3B6Y A;  4AH6 A;  2E2H H;  1KHI A;  3I4L A;  4A3K G;  2PNR C;  3PSI A;  3S17 H;  3BAA A;  3LWB A;  1YJ9 A;  2PZT A;  5I6Y A;  2UXC Q;  4E4T A;  2R7Z H;  1PH2 A;  5I2Y A;  2PW5 A;  1YNJ C;  5L37 A;  4E6I A;  3U4Z A;  1FKA H;  2EJM A;  1NE3 A;  2ZTD A;  1SND A;  3E5N A;  2OH2 A;  3M9M B;  1KDA A;  3S15 B;  2B3G A;  2M05 A;  3T56 B;  1VQK A;  4P71 A;  4K0K H;  3VPC A;  5I2X A;  4C5C A;  3P7J A;  4DLK A;  2BDN A;  2DJF C;  3PN1 A;  2JA6 G;  1WH2 A;  1OXV A;  4DR1 Q;  2KOL A;  3HXL A;  1NJI C;  3GTM A;  4AIM A;  3AU7 A;  3NTI A;  5IP7 H;  2I07 B;  1C48 A;  2V1C C;  3H0G H;  5KFL A;  4PQX A;  2R84 A;  2W7O A;  4JI5 H;  3STB D;  1BBU A;  2N8N A;  2TSS A;  3C2P A;  3MFI A;  3BDC A;  2AWN A;  3GTK B;  2VXW A;  4QGU A;  3W3A A;  2Q2U A;  1AUX A;  2R8K A;  1YHQ A;  3DWQ A;  1SMY D;  4HJ5 A;  2QEX A;  1N9W A;  2R7M A;  2AUJ D;  2K75 A;  3T51 B;  1XMQ L;  4Y52 H;  2FP4 B;  1SNM A;  2WTF A;  3G8C A;  5EOY A;  3OWE B;  3T1H Q;  2CHB D;  3OSP A;  1X3F A;  4WRD A;  3OIP A;  4I50 F;  5KFR A;  1TWH H;  1PVO A;  1R9T B;  5M5X B;  2BH8 A;  1MD2 D;  4KHP L;  2Z6K C;  3PV0 A;  2UU9 Q;  3C0F B;  4Q0F A;  1CQI B;  5IWA H;  4P75 A;  5C4J B;  3RZO H;  3HKS A;  4JI4 Q;  4O3R A;  3TQT A;  5CR3 A;  5C4H A;  2CVR A;  1GHJ A;  3KHL A;  1W6J A;  2X6L A;  2P0A A;  3KK7 A;  1NUC A;  1NY4 A;  3KUP A;  2AMC B;  4ME6 A;  4LFC H;  1MKH A;  1SEI A;  1I94 H;  2E74 C;  4TQU S;  4X62 L;  4DR6 L;  2OTL A;  3N6R A;  1UUP A;  3SGI A;  3RZD B;  2IW3 A;  2FK3 A;  3I4N H;  5KND A;  1CKN B;  3ULL A;  1IBM Q;  1EYG A;  2ZM6 H;  4F4X A;  4CDF C;  1YBY A;  1YNJ D;  1JIH A;  3MEF A;  4ZQI A;  3RGZ A;  1UEA B;  2KQ3 A;  4PDB A;  4ZCK A;  2EY6 A;  2E5L Q;  5M5W B;  1ZYR C;  3A55 A;  4POG A;  5DG9 A;  1Y1V G;  4RMF A;  3BU2 A;  1N33 H;  3SDZ A;  1QG7 A;  2J9G A;  1Y1W H;  4OX9 L;  4WJ3 M;  4LMY A;  1F2Z A;  2Q8T A;  2ZJR A;  2UXB H;  1WTH A;  1CT1 D;  1X54 A;  1NCV A;  3PCO B;  4BBS B;  5IGE A;  2EE1 A;  4IQZ A;  4NXN L;  4DL5 A;  3Q24 A;  3NP8 A;  1K8G A;  3TP6 A;  1E0B A;  3KFU A;  3OTO Q;  2VUM G;  3QWN A;  4A3E B;  4BWG B;  1SNP A;  2X69 A;  3MJF A;  3A74 A;  2RDI A;  4ECR A;  4BA2 I;  1R4Q B;  2D5D A;  5DLF A;  1WD1 A;  2R7Z B;  5LMU L;  3J80 E;  4HIO A;  2WKC A;  1EFW A;  5F9L A;  4YY3 L;  3IFT A;  4FS2 A;  1PTO B;  2IBK A;  5A2Q L;  2A74 C;  1QVG A;  1B9N A;  3HOZ G;  2F0O A;  2XNA C;  2YU9 B;  2OQK A;  3BDL A;  2I5H A;  4I7Z C;  4J8Q A;  4OWW B;  3RLO A;  1JQY D;  4JI8 Q;  3GTP A;  3T5L A;  3NBH B;  4GKK L;  2KCN A;  5C0X G;  5IGB A;  2XD4 A;  4J9P A;  4JI7 L;  5ISR A;  1C7Y A;  1S97 A;  2FLN A;  1VBG A;  4L8J A;  2UUA L;  1L1O C;  1I5F A;  2QF7 A;  3I4M G;  1B7Y B;  5M3M B;  4DV6 L;  1L2Z A;  2F0D A;  3BJY A;  3BZD B;  1I3Q H;  2TMP A;  1IBK Q;  4IPG A;  1IOW A;  1FGU A;  1CM9 A;  5KT6 A;  3K6O A;  4IRC A;  1PXU A;  2JSO A;  1TY2 A;  2VW9 A;  1TWG B;  4EGJ A;  2W8L A;  3R93 A;  5KYL A;  1YI2 A;  2XGQ A;  1SMX A;  3QIA A;  3X3M A;  3FVQ A;  3KBX A;  2BH2 A;  5EKL A;  2QCP X;  5JQW A;  2RGR A;  4ZKC B;  4DV1 L;  2PCF B;  2C00 A;  2L55 A;  5BPH A;  5ELN A;  2VB2 X;  1Q90 A;  3AMU A;  2R6F A;  3HOU G;  2HJW A;  2YL2 A;  2F0K A;  3V05 A;  1D2B A;  1E4E B;  3R2T A;  4I65 A;  3QJY A;  1TWH B;  1XMQ H;  4RNM A;  1PRT F;  4X3K A;  2B2Y A;  1S0N A;  1GM5 A;  3K5H A;  1DIK A;  2EYF A;  3K58 A;  4BY7 B;  3ZJY C;  5KFH A;  4G3I A;  3HOW H;  3H09 A;  1YNN C;  1BKB A;  3FMC A;  4KHP H;  1F9R A;  3A0J A;  2NVX H;  3H6M A;  1TA8 A;  3J81 E;  1RD9 D;  3T5K A;  1K1S A;  3S14 H;  3K7A H;  3P20 A;  4C3I H;  5KG1 A;  5GAG C;  5LXT F;  5KG0 A;  3IL8 A;  4K5W A;  2AGO A;  3PO2 H;  3F2U A;  5BR8 L;  1J5E L;  1F9P A;  3GTG B;  3HB9 A;  2J0T D;  2MGS A;  4DV4 Q;  2AGQ A;  5C3E G;  3W2D A;  3L0O A;  4DR3 L;  4YR0 A;  4J9S A;  1UC9 A;  1WR2 A;  5L1I A;  3FKI G;  4X62 H;  4DR6 H;  3S2H B;  5T1G A;  5LHY 1;  1Z2N X;  2KEE A;  1D6E C;  3HKZ G;  4DK0 A;  5IYZ F;  1STH A;  4NXM Q;  3RIZ A;  4EQN A;  4RB1 A;  4APM A;  1YIJ A;  1W2B A;  3S1M H;  4BA1 I;  2B8F A;  4JCV E;  5KFW A;  1I4Q A;  1A2T A;  1L0Y B;  1YHB A;  2F0W A;  3BVM A;  5I6W A;  1JIC A;  1HRJ A;  3M4I A;  3R5X A;  3R23 A;  4OX9 H;  3Q1K A;  2XIW A;  3JAM E;  1GOZ A;  4O4H F;  1HQM C;  3I55 A;  1FGB D;  1GYF A;  4A3M B;  1GSH A;  3K80 C;  2M2L A;  3L3O C;  4FNF A;  3NK9 A;  3JSN A;  4FXG C;  3L2P A;  3KLS X;  4YJ2 F;  4DR1 L;  1WTR A;  1X3G A;  3GIP A;  1MGS A;  4A3L G;  2NVQ H;  4KJO A;  3FMA A;  2UUB Q;  5C4X H;  1G51 A;  1PH4 A;  2E2J H;  2MUY A;  2PW7 A;  5KNB A;  3HOX B;  1I4R A;  3ER0 A;  3N44 B;  5LMU H;  2PQA B;  3GII A;  4YY3 H;  3GTK A;  4JG2 A;  1S5B D;  3R2I A;  3ETJ A;  1I50 B;  2L12 A;  4X64 Q;  5H80 A;  1PV4 A;  1AE3 A;  3M3Y H;  1STB A;  4A2B A;  1J8I A;  5C8Y F;  4X6A H;  1GLV A;  1CHQ D;  3T1H L;  4GKK H;  2K03 A;  4MIU A;  1VQM A;  2ZTC A;  1B3A A;  2JA7 H;  4JI7 H;  2Y0S G;  4OIK A;  4A3C H;  1R9T A;  2UUA H;  2F0L A;  1STG A;  4N9P A;  3Q8P B;  1EOV A;  3BYY B;  1M0W A;  2L4N A;  5C6A A;  2ATW A;  3RUZ A;  2OF1 A;  4DV6 H;  3NXW A;  2RSO A;  1LTR D;  4IFD J;  3GP7 A;  1FJG Q;  5K36 H;  3KAL A;  3V6H A;  4JI4 L;  4RNN A;  2NBF A;  1AZP A;  4ED2 A;  4IUN A;  2F4I A;  5F2D A;  2NN6 G;  3PUV A;  2PMZ B;  4IAL A;  1IKM A;  1GSO A;  5IYB G;  4GKJ Q;  3EQL C;  3MZ5 A;  3CW2 C;  4ID6 A;  4L5R C;  2RCN A;  4DV2 Q;  4ECT A;  4DA2 A;  3GTQ H;  4DV1 H;  2DNE A;  3V4S A;  1Z6H A;  1CQF A;  1ZKO A;  1CE8 A;  3GTL H;  1IBM L;  4RKL A;  1CKN A;  3G48 A;  3DWA A;  5FO8 B;  2F4V Q;  4M9U A;  3CCM A;  2RBM A;  4BY1 H;  3HOW B;  1QOH A;  3D4R A;  2E5L L;  4H7B A;  1ILP A;  3V6J A;  1BF4 A;  4FBT A;  3OSO A;  2EYJ A;  3Q6S A;  2N3S A;  4A3J B;  4U7C A;  2UVW A;  4G57 A;  1ASY A;  4HSV A;  3GTJ B;  4GN3 B;  1S10 A;  3K7A B;  1JWM D;  3GO5 A;  3T13 A;  5IT9 c;  4LF7 Q;  3N8D A;  2MNA A;  2L5T A;  1GSA A;  5HBR B;  2B2U A;  1ZQ7 A;  2BR0 A;  4RB3 C;  1EWI A;  1N8R C;  1PYW D;  2FE3 A;  4IFD I;  2AU0 A;  4HMI A;  4DAP A;  2MQH A;  4C2M B;  4WJ4 A;  4DNR B;  1T94 A;  3OTO L;  4GLX A;  5BR8 H;  1J5E H;  4RKB A;  2E2H A;  5KG4 A;  3TN2 A;  4DR3 H;  1JB7 A;  2J6U A;  5T14 A;  5JOB A;  2PMZ E;  2ES2 A;  2A6E D;  2YYZ A;  4IPH A;  2R7Z A;  3PO3 B;  4UCU A;  2K33 A;  2H1E A;  2HVQ A;  4AYB G;  1VQ9 A;  2RDF A;  1WCM H;  4OEM B;  3H20 A;  1PH8 A;  4IAJ A;  4GNX B;  2YU9 A;  1KJ8 A;  1EUJ A;  3CP0 A;  4JI8 L;  2AQ4 A;  4LF9 Q;  3N43 B;  1VQH A;  4YWL A;  4M1U B;  3NBH A;  1RKN A;  2IMW P;  1TII D;  2ICE C;  1PMR A;  5KFA A;  3HZX A;  3HOV B;  4A93 G;  1W93 A;  5GAH C;  2I8C A;  4JBW A;  5IE8 A;  1I6H B;  2GPS A;  5C4X B;  3NE5 B;  4RGO S;  5FJ8 G;  2E2J B;  4MA5 A;  2BQU A;  4B9W A;  3UDF A;  1IBK L;  4X3S A;  4I7A A;  1SJH D;  4DR1 H;  1BCP F;  5FKA C;  1A0I A;  3F2D A;  3ERS X;  1H9K A;  4DPG A;  1C0A A;  3GLK A;  1RF2 D;  3TQY A;  4PMC A;  4KKS A;  1HFG A;  3CCV A;  4C5A A;  5EWF A;  1TWG A;  2VY3 A;  3KTM A;  3TRE A;  5KFZ A;  2IX0 A;  3E3X A;  3H40 A;  1SFO H;  4A76 A;  1RJR A;  3MVV A;  1IW7 D;  5AJ3 Q;  4MZ9 A;  1CSQ A;  2O03 A;  3RLF A;  1H9R A;  1BNZ A;  1E4G T;  4O2B F;  4LF4 Q;  2FJ2 A;  3DF7 A;  2Z6B A;  1SRU A;  4A3F G;  1IL2 A;  1E4E A;  1TWH A;  3CRL C;  1K1Q A;  3GD7 A;  4XX0 B;  5FPR A;  2WV6 D;  5DM6 3;  4RGN A;  3P1H A;  3TS2 A;  1CZG A;  3C46 A;  2YW2 A;  3T1H H;  2SNM A;  1ET6 A;  2W6M A;  4JYA Q;  2A69 C;  2VPS A;  3CHB D;  3OPO A;  3BDO A;  1RCV D;  2F0Q A;  3ZYY X;  2A8V A;  4IWX A;  4HCE A;  3F2C A;  3TZU A;  2VUG A;  1B1Z A;  4XYM B;  4JI4 H;  5CBE E;  5IY0 A;  3E0E A;  1GD7 A;  4C3H B;  2VQE Q;  4GC7 A;  2UXD Q;  2L1B A;  2WFW A;  3J80 W;  2B63 G;  5I4D A;  2JA8 H;  4DV4 L;  1MJC A;  4DXG A;  3GTG A;  2YZN A;  4O3P A;  4TUY F;  3BVZ A;  4LH6 A;  3G7L A;  4FXK C;  4A3D B;  1B9M A;  4IUT A;  4CJ0 B;  1JJC B;  5LYJ F;  1AH9 A;  4HAE A;  4NXM L;  4OWT B;  1I4P A;  1IBM H;  1LTG D;  3AFP A;  1Y1W A;  2E5L H;  3IG0 A;  1NTG A;  5L1J A;  3PW0 A;  1I4X A;  1S03 G;  2R7D A;  5E7N A;  1LTL A;  3KYH C;  3RFC A;  2WIN B;  1S5E D;  2FMA A;  4A3B H;  4JV2 A;  5KG3 A;  3DEO A;  4IPC A;  1KC8 C;  1X56 A;  3KHG A;  4KN4 C;  2HD3 A;  5IP9 H;  2NB0 A;  4DL6 A;  5DGA A;  5M5Y H;  1GUO A;  2AUK A;  4RB2 C;  5CGK A;  4UP7 A;  5J39 A;  5EGT A;  3OTO H;  3LML A;  2OCE A;  2ID0 A;  3EJI A;  5JJL A;  1EZ6 A;  4O4L F;  2UUB L;  1SR3 A;  2L0C A;  3FEW X;  4KJN A;  5EQ0 A;  3V6K A;  4JI0 Q;  1EYC A;  1DGS A;  1J9O A;  2F3W A;  5I9P A;  4BBR B;  2G9D A;  4NMZ A;  3O13 A;  2VOB A;  4PG3 A;  2PQA A;  2WE6 A;  1ICF B;  5JEA J;  3M7G A;  1AP0 A;  4X64 L;  1I50 A;  5IGD A;  4Q43 A;  5JJK A;  2R93 B;  3OOC A;  1SAP A;  3T4A C;  5E4W C;  4XZ3 B;  2ASD A;  1A2U A;  2EDG A;  3KHR A;  4YP3 A;  5DLQ E;  5JAV A;  4JI8 H;  1KRS A;  2XIG A;  4KHV A;  4H44 C;  1U9R A;  1EHI A;  1EU4 A;  4NW2 A;  4IFD G;  4MNO A;  2AQ3 B;  3WDN A;  3RB6 A;  3J81 W;  5KFC A;  2RHQ B;  3UDX A;  3OW7 A;  4DR4 Q;  4U67 3;  2M9V A;  4C3J H;  2RKS A;  5M3F B;  1JMC A;  3NQT A;  1JB3 A;  1CHP D;  1EY5 A;  2QKI C;  4MV9 A;  2F0H A;  1IBK H;  1FJG L;  4ZOL F;  4DAM A;  1PZK D;  1HQR D;  3KF8 B;  4TKO B;  5L1L A;  2ZXP A;  2PMZ A;  4ED1 A;  5HGQ A;  3EA6 A;  3WO1 A;  5C44 H;  5C4Z A;  2FB9 A;  3U4V A;  4DV2 L;  4ECS A;  4JUZ A;  1PYS B;  4IPD A;  3W1B A;  4KY5 A;  4QW9 A;  4QIW B;  1EEF D;  1V51 A;  4K6D A;  4TV9 F;  3GV7 B;  3KLS A;  1S40 A;  2M00 A;  3JAM W;  5HUR A;  1VQ8 A;  5ELC A;  1TT2 A;  2R92 H;  3BQ2 A;  3RB4 A;  5ELE A;  2NVX A;  2CQA A;  5JPM C;  1Z2O X;  4POF A;  3GTJ A;  1BO0 A;  3U9S A;  2PVP A;  2DNC A;  4LF7 L;  2K5D A;  3PMF A;  2OT2 A;  4FF2 A;  1YHA A;  2AWO A;  2CWP A;  4KLK A;  5IGF A;  1JJG A;  1EYZ A;  3RMH A;  4C2M A;  3D0F A;  5LL6 b;  4O3N A;  2PNH A;  3T16 A;  2IX3 A;  1ZHQ A;  1T9H A;  4FDB A;  1RDP D;  3OMC A;  2YS6 A;  4DV4 H;  4I4T F;  4H0L C;  4RAY A;  3PUX A;  4BBS G;  1K9M C;  3BZC A;  4DL4 A;  1TS2 A;  3HOY B;  2QW7 A;  3QZ7 A;  5DQH A;  1XNQ Q;  5JVG 3;  4NXM H;  4M7E A;  1XMO Q;  1RK6 A;  1F2M A;  2DPI A;  2CQO A;  3RR5 A;  4XYL B;  2R8J A;  4A3E G;  4GNX A;  4UCV A;  2I80 A;  3NGD A;  2R87 A;  3LWE A;  4QIW E;  4WD3 A;  2Q8R E;  4LF9 L;  3HG9 A;  4GS3 A;  4L5Q A;  5EWG A;  3NEM A;  3GV6 A;  2SDF A;  3RF2 A;  1MJE A;  4H13 C;  4XYQ A;  3NHH A;  4DV5 Q;  3MAQ A;  1PH1 A;  1K73 C;  5KFV A;  4V0B A;  5ELF A;  4DFA A;  3GQC A;  2R7F A;  3EN2 A;  5CA0 F;  4FP5 D;  1IXR A;  1BNC A;  1TWA H;  4HMJ A;  4DAY B;  3CCU A;  2R8H A;  2UUB H;  3J7Z C;  1JOQ A;  1CKO A;  1IYV A;  1STY A;  3K5M A;  1BOS A;  1EIH A;  4UCO A;  4ZK9 B;  2W6Q A;  4FO2 A;  5M3M G;  1KEE A;  1XPR A;  5AJ3 L;  3JRX A;  1JDB B;  4QCL A;  4A3K H;  4X64 H;  3SK5 A;  1PH9 A;  2B2T A;  4LF4 L;  4Q44 A;  2KHS A;  2YTY A;  1BCP C;  4J9N A;  5A35 A;  1Q8I A;  3NWT A;  2L9H A;  4F4Y A;  2F0V A;  4XQQ A;  3Q8S B;  1Z7T A;  2W9C A;  5FOB B;  1VQE A;  4L1K A;  4JPB W;  2XCP A;  1ROD A;  3GIL A;  4K5X A;  4JYA L;  5LL6 S;  1OWT A;  1A15 A;  5GQO A;  4MA0 A;  1UWV A;  1EEI D;  4BXX G;  2JA5 B;  4R4I A;  4R8N A;  1GXD C;  1K8O A;  4LUZ A;  4CDC C;  2HT1 A;  2VPQ A;  3VPD A;  1EY6 A;  2VNU D;  1FJG H;  4QMG A;  2NUA B;  2JA6 H;  4GLA C;  2VQE L;  4JOI A;  2F0U A;  4BY7 G;  1LT6 D;  1RK5 A;  2UXD L;  4KY7 A;  4EBD A;  4JI3 Q;  3OIQ A;  2DGY A;  3R3O A;  1ILQ A;  3HP3 A;  1DD2 A;  2FK1 A;  3GTL A;  4MTE A;  4DV2 H;  4P72 A;  3WWV A;  1QZH A;  4J6H A;  2K01 A;  4UP8 A;  4ECX A;  3ONA B;  1XPO A;  5LMN Q;  1VAJ A;  3QG1 A;  1SYC A;  4EFE A;  3DM1 A;  1YJW A;  4L63 B;  3TIG A;  1BR9 A;  1XTC D;  3CPF A;  3H15 A;  4RFB A;  2OQ0 A;  4XQN A;  4DR7 Q;  2YRX A;  4ABN A;  3ND9 A;  4MTK A;  2R85 A;  3GV3 A;  4RUA A;  1Q46 A;  4JV1 A;  5BN4 A;  5IT9 L;  4RZQ A;  3CRK C;  3F8N A;  1WYD A;  3KAJ A;  4LF7 H;  4EVO A;  4K14 A;  1PA6 A;  5GON F;  2KA7 A;  1KQS A;  1VBH A;  3EVQ A;  1HR0 W;  2UVR A;  4Y7N B;  3GIQ A;  1DCZ A;  3S1R B;  1LYL A;  4O3S A;  1Q1B A;  3MWY W;  4LSA A;  1JX4 A;  1HJP A;  2F3V A;  4UPA A;  2V4R A;  3BQ0 A;  4K2K A;  5JEA G;  4LF8 Q;  3KBG A;  5KFF A;  2IY5 B;  4NB3 A;  4YIJ A;  3TRZ A;  4J9M A;  1E24 A;  1RL2 A;  4JI0 L;  5DG7 A;  4A3M G;  1WCM A;  4F4Z A;  4ODG A;  4QWD A;  2H5X A;  1BXT A;  2R6G A;  3MXU A;  3N42 B;  4GZY C;  2ZT9 C;  2E2H B;  1EIG A;  1P16 A;  3KLW A;  3CCS A;  1BCP D;  2GVA A;  2RDH A;  1VQL A;  2NVY H;  5JVH 3;  3S17 B;  4B3R Q;  1PK8 A;  3WO0 A;  1OXS C;  2R93 A;  2VA3 A;  4OGQ C;  3KLR A;  5CV8 A;  4EQ5 A;  2D0O A;  4O3Q A;  1CQV A;  3HOX G;  1R4P B;  1VQF A;  5E4X A;  3KHH A;  4LF9 H;  2NN6 I;  4TRD A;  1Y1V H;  1FNW A;  4UCS A;  1EY7 A;  4DR4 L;  4FXD A;  2K32 A;  5CYU A;  3KDF B;  4WJW A;  1XDN A;  1TWA B;  1X3E A;  5KT5 A;  4J1M A;  5KKN B;  1JOO A;  3U9O A;  5KFE A;  1PFB A;  4YCW A;  2HVS A;  1DZ1 A;  2VUM H;  4JV5 Q;  3R5H A;  3KF8 A;  3EIV A;  3JC6 6;  1RYS A;  3TDQ A;  4MAM A;  4YWK A;  1VF5 C;  2K1B A;  2EJG C;  3H0G B;  5D3I B;  2I87 A;  2ENB A;  3J81 c;  1RHP A;  1AN7 A;  1EUD B;  3QFF A;  1HNZ Q;  4U6P A;  5IOD A;  1KNE A;  1UE6 A;  4LF4 H;  4QIW A;  2FFK B;  4OEL B;  2E2I H;  4ALP A;  4JK1 C;  3TS0 A;  1EYA A;  3HOZ H;  5LP6 F;  4IZ8 A;  1GKH A;  5CV6 A;  3RD4 A;  2AKW B;  5CBA E;  3CCE A;  1BJT A;  3MR6 A;  4UAI A;  3RTX A;  2L15 A;  4EYI B;  4KD4 A;  5C0X H;  3QO2 A;  1ZYR D;  1YNX A;  2NVT H;  5EAY A;  4EBE A;  4JYA H;  2FLP A;  3A8I E;  1EU3 A;  2Z6K A;  5FD6 A;  3ICE A;  4EQO A;  3CXC A;  3SI8 A;  2O4X A;  1HXY D;  3G71 A;  1CUK A;  1WTP A;  1K8M A;  4A3J G;  4ECQ A;  3HBL A;  3Q0A A;  2VQE H;  1Y8P B;  3RZO B;  5EBD A;  2UXD H;  3KJO A;  2W7P A;  2OLS A;  3I7F A;  1B6S A;  3RV3 A;  4YAK B;  1TR5 A;  2C22 A;  2KUM A;  5CB4 F;  3GIJ A;  4B9X A;  1XTD A;  1UE5 A;  3VYR A;  2R82 A;  1K83 H;  4DNI A;  3J7A 5;  5E3F A;  3U50 C;  5KIX A;  1XNQ L;  2IL8 A;  5HV6 A;  2V4Q A;  3DHQ A;  1PYB A;  3SE0 A;  2C2R A;  1EL0 A;  1H9S B;  2PI2 A;  4XIG S;  5ELB A;  5J22 A;  3I4N B;  5CV5 A;  3HOU H;  1BXR A;  2FIN B;  2RCF A;  1E1O A;  2L11 A;  3EYY A;  2HHH Q;  4J9L A;  1EIF A;  1E2W A;  3MFG A;  1F9S A;  2MHV A;  1KIX A;  2YTX A;  1KRT A;  2QEJ C;  2A5H A;  1KL9 A;  3PO3 G;  4O42 A;  2PZU A;  5DGB A;  4EQP A;  1TS3 A;  3FDS A;  1BBW A;  5DQI A;  1Y1W B;  2UXC L;  3V96 A;  3JZI A;  4YBZ B;  3VYS A;  1C3O A;  1UC8 A;  4N9T A;  4KK7 A;  4DV5 L;  1STA A;  4HNU A;  2F0M A;  2YZG A;  2BCO A;  3D4D A;  5LOV F;  5DNF A;  2B2U C;  1F77 A;  4KN7 C;  4X3T A;  3V4Z A;  3ETH A;  1QZG A;  1LO5 D;  4DAY A;  4GOP B;  3HOV G;  3HEJ A;  2XCL A;  4JI0 H;  4ULL A;  1IBL Q;  2K50 A;  2LMC B;  5C3E H;  5C4X G;  4QWE A;  1ICW A;  4NXN H;  4EGV A;  2J4X A;  4K5V A;  4ZLT F;  1E3P A;  1SXT A;  2F0S A;  2OEO A;  3FKI H;  2RA4 A;  4HED A;  4F7X A;  1IYJ B;  2YCH A;  1VQB A;  1W6K A;  5FLM G;  2ALY B;  1X9N A;  2W6O A;  3S16 H;  5FD5 A;  1KAA A;  4JI6 Q;  5FLX W;  5BN5 A;  1XNR Q;  2FMC A;  2Q2H A;  4HR7 B;  4K2L A;  4JW0 A;  3UFX B;  3ITP A;  1CKM A;  4KI0 A;  1PLF A;  4XTC S;  1KDB A;  1IZ6 A;  1PTO C;  1ENC A;  5AFW A;  1TAE A;  4EG0 A;  3LGJ A;  3MTS A;  1KXL A;  4PZ6 A;  1JJ2 A;  2RDG A;  3M4Y A;  2NUC A;  2QIL A;  1SDF A;  4QUC A;  4DR4 H;  1V4Y A;  5C1O A;  2A68 C;  2JA5 A;  4RA8 A;  1OXT A;  1T5E A;  2RSN A;  2ASJ A;  1YNN D;  1VQJ A;  4NLG A;  3S24 A;  4QL5 A;  2R7N A;  2OWO A;  4P2C B;  1I3Q B;  1EY4 A;  1N34 Q;  1ESF A;  4UY8 C;  3GV5 B;  1A3T A;  4OL7 A;  4JI3 L;  4A3L H;  4FM9 A;  1NR4 A;  4HCS A;  3EPI A;  2UU9 L;  5C5J A;  3NWS A;  1TWF H;  1U4M A;  1MZB A;  1VQC A;  4DL7 A;  1X55 A;  2MO0 A;  3R5F A;  4J9K A;  4YCV A;  2OXP A;  1UNS A;  3MEH A;  1HZA A;  4LF6 Q;  2RVL A;  2EYO A;  5LMN L;  4C3H G;  1GGO A;  5C3W A;  1XPU A;  2DPJ A;  1SBB B;  2NTT A;  2RHS B;  1EQR A;  4XYO A;  3GTM H;  2K5W A;  1KD1 C;  4XDX A;  5KG6 A;  4ED7 A;  3MWM A;  1FL0 A;  1BVS A;  3KOJ A;  3CC7 A;  4XXE A;  2F03 A;  4EEQ A;  4LJZ C;  3K5L A;  4Y8V B;  4JBM A;  4A3D G;  3F2B A;  3S9W A;  4WFN 3;  4FS1 A;  3TP7 A;  3NEN A;  3KAK A;  1TQO A;  5JVL A;  2GN5 A;  4C1N I;  1E7Z A;  2DLN A;  2NVX B;  4QUF A;  1HTP A;  1O7L A;  4IRK A;  1FVI A;  3D31 A;  3PW5 A;  3S14 B;  1PRT B;  2F0G A;  3K57 A;  2BE5 C;  1G91 A;  4C3I B;  2ZDQ A;  4LF8 L;  3PW2 A;  1G8Z D;  1K3B C;  3PO2 B;  2NN6 H;  3NQI A;  2F0T A;  2H4O A;  2EQS A;  1K3R A;  1CZW A;  3VR4 A;  5IYB H;  1JWS D;  2W8K A;  2DIK A;  1SE2 A;  5D14 A;  1WJJ A;  1KJJ A;  1XNQ H;  4C5B A;  1CA6 A;  4EYH B;  1KJI A;  3OUU A;  1HPC A;  3MR2 A;  3PIP A;  1F2L A;  2HVR A;  3LP8 A;  1PTO D;  4B3R L;  2YTV A;  3I72 A;  1GUG A;  1DYQ A;  1PZI D;  2KEC A;  2UVU A;  4BBR G;  3I91 A;  3I12 A;  5KFN A;  3M4O H;  3S1M B;  1MI2 A;  3UDG A;  1VQO A;  2A68 D;  4FF1 A;  4DAV A;  5KFI A;  2UXC H;  1HZB A;  2SEB D;  2LS0 1;  4TVA B;  1X32 A;  2R93 G;  3KDF A;  1TWA A;  2XN9 C;  2W9B B;  1O7Z A;  4OHJ A;  4DV5 H;  1GUW A;  3PZP A;  3TSS A;  1HZC A;  1RIP A;  1WSC A;  1HA6 A;  4JV5 L;  1S3O A;  1V1P B;  2R61 A;  2NVQ B;  1VQG A;  2IWH A;  5M3F G;  1DOL A;  1LLR D;  3OSN A;  4B3S Q;  4YQW A;  3I73 A;  3H0G A;  3L7Z C;  1OXX K;  3N52 A;  2LFN A;  1HNZ L;  2F52 A;  2EXD A;  2JEF A;  3N6X A;  3DEP A;  4FF3 A;  2RGV A;  3JSL A;  1S9F A;  1SRO A;  1PFN A;  1SE3 A;  1GUS A;  2XGP A;  1G6P A;  1EY8 A;  4DV3 Q;  1NSN S;  3M3Y B;  4IUR A;  4HIM A;  4ZQ3 A;  1A63 A;  4N8X 1;  2R7K A;  2ZJT A;  3Q23 A;  3VR6 A;  1TS4 A;  4FF4 A;  1G2T A;  4JV0 A;  2JA7 B;  1G6Z A;  2JA6 A;  4TV8 F;  5IYC G;  3N40 P;  4A93 H;  2R7L A;  2PYK A;  4C1N K;  4J15 A;  3H94 A;  2BE5 D;  2W9C B;  3GTP H;  5EKK A;  3J80 i;  5EPK A;  5CV4 A;  1JDE A;  5CA1 F;  4DL3 A;  4JI3 H;  1O7I A;  1N32 Q;  4IN3 A;  4AQY Q;  4LH7 A;  2UU9 H;  3SXH A;  2CW7 A;  3UI2 A;  3OMG A;  1P8L A;  4NDX A;  1IKL A;  4UCR A;  3M9B A;  3S1N H;  3C3L A;  1VMC A;  1CS0 A;  2XCA A;  3GTQ B;  5LMN H;  4ZYS A;  1UNN C;  1IYU A;  1H9S A;  3GTL B;  2HHH L;  4A3F H;  3J80 L;  1B50 A;  3R8B A;  1DXM A;  4BY1 B;  4LFA Q;  4G7H C;  5A2Q E;  1PFS A;  3HOY G;  4BWS C;  1D5Z C;  1B44 D;  2A6H C;  4RWS C;  1PH7 A;  3K3P A;  3DUZ A;  2B2V A;  2X0S A;  4HNT A;  1Q3L A;  5IYD G;  2V5A A;  2JN4 A;  5EPJ A;  2K5V A;  4XT1 B;  1SN8 A;  5EZY F;  4B08 A;  4R1J A;  3DLL A;  3GID A;  3G4S A;  3H4B A;  1V9P A;  3MC0 B;  1KBL A;  3DWP A;  1HA5 A;  1ZET A;  4O2D A;  3BZK A;  1EZ8 A;  5C5L A;  4LF8 H;  4KV6 A;  2YYA A;  1SYX B;  2EXZ A;  2B63 H;  4GOP A;  2EVB A;  2MPM A;  2W6P A;  1IBL L;  5DQG A;  4DK1 A;  1K0S A;  3LWU A;  2NVY A;  2JEI A;  1SNO A;  2ZXR A;  3PW4 A;  1ASZ A;  3U58 A;  2E76 C;  4A3G H;  2LY7 A;  1KJQ A;  1HR0 Q;  1V43 A;  3CC2 A;  3BAB A;  3QB3 A;  3CVZ A;  4JI6 L;  5CC4 A;  5EPL A;  5JPN C;  1JOR A;  1XNR L;  4B3R H;  1BGW A;  1Q1E A;  4RGT A;  1WCM B;  4HR7 A;  1TWC H;  3PR4 A;  5KX5 F;  3EPG A;  4CDE C;  2PN1 A;  2AGP A;  3J81 i;  1FNV A;  4GNX C;  1AUV A;  2ZJQ A;  3PF5 A;  1XWE A;  2B2W A;  3D8G A;  3I70 A;  3K5I A;  5KFP A;  3K0X A;  3IRB A;  2Q8I B;  1QVC A;  2A1A A;  2D2C C;  4QB4 A;  1VS0 A;  1H95 A;  1Q81 C;  2N88 A;  5CMD A;  3PUW A;  1VF7 A;  3SR1 A;  3IFD A;  2A69 D;  5KFD A;  1E4F T;  1N34 L;  3M4P A;  1I3Q A;  4JV5 H;  5KFJ A;  1YJN A;  5ELD A;  1TVX A;  4OIJ A;  2JA5 G;  3J81 L;  3S15 H;  1B04 A;  4MV7 A;  1FYC A;  3BA8 A;  3RB3 A;  1ULZ A;  1SFO B;  1HNZ H;  1Z2P X;  2XWJ B;  3Q2O A;  4DR5 Q;  1U4P A;  4ME3 A;  1LV9 A;  4LF6 L;  4RU9 A;  1S5F D;  2WAC A;  1I6U A;  3GTO H;  2VQF Q;  1IL8 A;  3JAM i;  4GKJ L;  2NU6 B;  4OO1 G;  2R8I A;  5KFB A;  3H3V C;  2CCZ A;  4U68 A;  5BN3 A;  4KY6 A;  3OYY A;  2B2T C;  3J7A K;  5DLG A;  1LTA D;  3D3R A;  2G5D A;  4IFD H;  3VR5 A;  3CQZ H;  3GTK H;  1M7J A;  2F4V L;  4APV A;  4B3T Q;  1JC7 A;  5BPF A;  2O5I C;  1DON A;  1QCB D;  2K7V A;  4LUO A;  1B33 N;  3BA9 A;  4Z9C B;  1GUN A;  2NU8 B;  1EY0 A;  5FLX E;  1G2S A;  3FHW A;  1PZJ D;  3JAM L;  2UUA Q;  4KMU C;  2I5M X;  3E9H A;  4JI2 Q;  2DZD A;  1S0M A;  2W57 A;  1V1O A;  2EJF C;  2B29 A;  4HSP A;  4Q45 A;  2C2E A;  2WAQ B;  4L5S A;  2XWB B;  2JA8 B;  4ECU A;  3I8Z A;  5M5X H;  3RN2 A;  4DUY Q;  2HUG A;  1I6V C;  3QOJ A;  1BBX C;  1QJO A;  2CKZ B;  4KTA A;  3DXJ C;  1D8L A;  3J81 j;  1PHJ A;  4A3I H;  1OO9 B;  1SEB D;  4EGQ A;  4IO9 A;  2VA2 A;  4PZ8 A;  3MR3 A;  1JOK A;  2A73 B;  1RYR A;  2HHH H;  2Z8L A;  4RHS A;  3T5J A;  1VQD A;  4KHZ A;  3BYT B;  2YRW A;  3S2D H;  1V1Q A;  2SOB A;  1UE7 A;  1SMY C;  3A8K E;  3RZD H;  4RB0 A;  1G29 1;  4A3B B;  5J2T F;  5C3X A;  1XJV A;  4R4O A;  2I0Q A;  1HNW Q;  1Q12 A;  2W9B A;  1AZQ A;  1TXY A;  5M5W H;  2R7Z G;  5M5Y B;  4DUZ Q;  1QB5 D;  1VQ4 A;  3A56 A;  5L9X A;  4IUP A;  1WD0 A;  3LX0 A;  2HIV A;  1PH5 A;  1W96 A;  4A3G B;  4X65 Q;  2ICI A;  1V1P A;  5M9O A;  1D7Q A;  1A8V A;  5DG8 A;  1ENA A;  1JWU D;  4A4I A;  4BBS H;  3ORQ A;  5KFX A;  3J7A V;  3ORR A;  1SNQ A;  1TWC B;  5I9O A;  4B3S L;  3S1Q H;  3UE0 A;  2WAQ E;  3RBE A;  5E1F A;  2FHT A;  1PTO F;  4KKT A;  1EZ1 A;  3MWE A;  5IOC A;  2Z9H A;  5KFO A;  4JI6 H;  1XNR H;  3OUZ A;  3SE7 A;  1VKZ A;  4MN3 A;  4A3E H;  3KF6 A;  4DV3 L;  5IP7 G;  2VB3 X;  4MTD A;  2V4D A;  3H0G G;  4LAA A;  4DR2 Q;  1A6X A;  3N41 B;  1Y14 B;  1JR0 D;  2FMM A;  2K5Q A;  4MTN A;  5K5P A;  3J7A F;  2WDT A;  1WVL A;  2FKL A;  3P75 A;  4MV6 A;  4CC6 A;  1X3P A;  2DUD A;  1PTO H;  4ECY A;  3VYT A;  4HNV A;  2RDJ A;  4IR9 A;  3IN5 A;  2JA7 A;  3CD6 A;  2EIF A;  2PI2 E;  3AQQ A;  1Y8O B;  4C3J B;  2BDO A;  3RN5 A;  1CA5 A;  2YU9 H;  5KT3 A;  3MR5 A;  5KFG A;  4JVZ A;  2P5Z X;  2K05 A;  4LMQ D;  3URY A;  3F1Z A;  3BS1 A;  1WTV A;  1GJX A;  3SHL A;  1TWF A;  4DV7 Q;  1N34 H;  4JI1 Q;  5KT4 A;  5KRU A;  4IJL A;  1N32 L;  2NTS A;  3EBE A;  1L1O B;  4RAU C;  4N8F A;  1WI5 A;  4AQY L;  3GTO B;  4RUC A;  4CKE A;  5KYI A;  4UDU C;  2XC9 A;  3I90 A;  1CTM A;  4HIK A;  2EY1 A;  3VPB A;  5C44 B;  3NEL A;  4G7O C;  5M3M H;  2ASL A;  4LF6 H;  1D1K A;  3MXN B;  1PFM A;  1WTQ A;  3GTQ A;  1QIL A;  5EJW A;  4DV0 Q;  2WB1 B;  5H1S E;  2KVM A;  2ATL A;  4DU9 A;  1B6R A;  4GKJ H;  1KAW A;  2DJG C;  3VA5 A;  4DKA C;  3CQZ B;  2QK4 A;  4IUQ A;  4QJF A;  4OXP A;  1TWG H;  4HN7 A;  3X3N A;  3IAY A;  4LFA L;  4R8U B;  1A3U A;  2Y0S A;  2K5N A;  1DV1 A;  2EYH A;  1Z47 A;  2IX1 A;  3MA2 B;  1L2F A;  1A3V A;  2R92 B;  4C56 C;  1STN A;  2HCC A;  2LSS A;  2F4V H;  5CV9 A;  2CQY A;  3RB0 A;  5KG2 A;  2C35 B;  4O2A F;  3CAM A;  3I4N G;  4HJ9 A;  4BXX H;  2Z0S A;  5D1P A;  5K2M A;  2DY7 A;  1LAB A;  4PMB A;  4I55 F;  1IHZ A;  4Q5V A;  3J80 c;  3QZ8 A;  3Q8Q B;  3K7U C;  4ECZ A;  2B2Y C;  2EY2 A;  3PIP 3;  4EBC A;  2K4K A;  3G6J B;  4BY7 H;  3RBD A;  4KKU A;  1Y1W G;  4A3I B;  3SK6 A;  1VDZ A;  2UUC Q;  1SYD A;  1QNK A;  3CC4 A;  2B39 A;  3TZD A;  3H3V I;  3K59 A;  1O75 A;  2JE6 I;  2D0P A;  3W1G A;  4LF5 Q;  4A75 A;  1S4Z A;  5EBC A;  1HR0 L;  2HDM A;  2E8G A;  5IT9 W;  5EKI A;  3S2D B;  4ZRZ A;  4I7H A;  1TKW B;  2IT1 A;  4HJA A;  3PUZ A;  4RAZ A;  3GTG H;  2WB1 E;  3FPU B;  2BQ3 A;  1NNX A;  4Q0Y A;  1U4L A;  2IA6 A;  2KJX A;  3VDY A;  5DM7 3;  2ASB A;  4GN5 A;  3S2H H;  1Q8K A;  2JA9 A;  4QWB A;  1Q82 C;  1MHW C;  3SK4 A;  4K8J A;  4HQ6 A;  1EWH A;  4IWY A;  1DOK A;  4R7R A;  3VA7 A;  4J9Q A;  4RG1 A;  2R3Z A;  4ZUJ A;  4R9W A;  5G3L F;  4LSX A;  3GIK A;  3QR8 A;  4NPS A;  3W5O A;  1M0T A;  1U0L A;  3S1Q B;  4YR2 A;  4F4W A;  3ERO A;  1Z9F A;  3NUC A;  1KLG D;  2C9O A;  2ALZ A;  5KG7 A;  2LKV A;  5JEA H;  2YZM A;  1STE A;  4QF4 A;  1HNX Q;  3GDE A;  2D62 A;  4AYB A;  2DN8 A;  3MHB A;  4HJ7 A;  1WTO A;  4FU0 A;  3FRP B;  4B3S H;  4A3M H;  2C5C A;  4F88 A;  2Z1C A;  4DR5 L;  1SFO A;  1L0W A;  3TII A;  5A2Q W;  1YVC A;  2IJ0 A;  2NYZ D;  2VQF L;  4A3K B;  1I7N A;  2NZH A;  2BA0 A;  1DV2 A;  4DV3 H;  1DM0 B;  2AQ2 B;  2XRS D;  3A7A B;  5I47 A;  1CQJ B;  4IHJ F;  1NMF A;  1ENF A;  4P74 A;  3TBI B;  4XT3 B;  3E0J A;  3HOX H;  5KNC A;  3HRZ C;  5DEH A;  1L0X B;  3AB9 A;  1HH2 P;  4DN4 M;  1BUV T;  4YR3 A;  2WYO A;  1C4Q A;  4F50 A;  4B3T L;  1I50 H;  3M9N B;  1BDO A;  4MHE A;  2VR1 A;  3OHA A;  4R4T A;  3CU7 A;  3HFZ B;  4ILW A;  1AFP A;  5D1O B;  3A5Z B;  3T5H A;  4YHH Q;  1PX2 A;  2KED A;  4QWC A;  4ZHQ F;  4JI2 L;  2JP1 A;  4RCN A;  4PMW A;  1N32 H;  2JA6 B;  2XRQ D;  4PV1 C;  4AQY H;  1HUM A;  2JXM B;  2WKD A;  2WAQ A;  3NSW A;  1SYB A;  3ND8 A;  3PGZ A;  5LL6 X;  1M1K C;  2NZ1 D;  3HOW G;  5IGG A;  1JT8 A;  1KDC A;  3L9A X;  3I4M H;  4DUY L;  2V9W A;  4TSS A;  3T1Y Q;  1PH6 A;  2EYP A;  3ULJ A;  1F9Q A;  4IOA A;  4YWM A;  4FVM A;  3U9T A;  3JAM c;  5KFK A;  1M8A A;  4C3I G;  1VQ5 A;  4LFB Q;  1HFN A;  2NU9 B;  4R8I A;  4H02 A;  3WNZ A;  2JK8 A;  1V8Q A;  4S3S A; 
#chains in the Genus database with same CATH homology
 3H0G H;  4X66 Q;  1HZ9 A;  2PQA A;  4PG3 A;  4B3R L;  2YTV A;  3Q8D A;  3STB D;  1BBU A;  1LUZ A;  2N8N A;  5JEA J;  4X64 L;  1YZ6 A;  2AWN A;  2JEA I;  1XMO L;  5JJK A;  4BBR G;  4QGU A;  1NMG A;  2Q2U A;  3M4O H;  1YHQ A;  1N36 Q;  3M7N A;  3UDG A;  4HJ5 A;  2QEX A;  5DLQ E;  4DK3 C;  2VS1 A;  1VQO A;  1KRS A;  1N9W A;  4L5T A;  2K75 A;  1XMQ L;  4LNQ A;  1HNW L;  4Y52 H;  1HZB A;  4IFD G;  4MNO A;  4TVA B;  1VQ7 A;  1VCI A;  2R93 G;  3KDF A;  4DUZ L;  2RHQ B;  3UDX A;  3T1H Q;  4DR4 Q;  4A3J H;  1X3F A;  3PUY A;  2K52 A;  4C3J H;  4B3M Q;  2RF4 A;  4DK6 C;  1QUQ B;  3GTJ H;  1TWH H;  1JMC A;  4X65 L;  1PVO A;  2IX1 A;  1HZC A;  1RIP A;  2BH8 A;  3TEH B;  3RNU A;  2Z6K C;  3PV0 A;  1S3O A;  2UU9 Q;  1FJG L;  4KHP L;  4JV5 L;  4DAM A;  2JQO A;  1MIU A;  1VQG A;  4P75 A;  3RZO H;  3KF8 B;  3HKS A;  5M3F G;  4JI4 Q;  4R4C A;  4B3S Q;  4C2M H;  5HGQ A;  3L7Z C;  1OXX K;  1HNZ L;  5C44 H;  2F52 A;  2EXD A;  2KHI A;  2QGQ A;  3K8A A;  3U4V A;  4DV2 L;  1PYS B;  1NY4 A;  1SRO A;  4IPD A;  2AMC B;  3W1B A;  1MKH A;  1G6P A;  4DR2 L;  4DV3 Q;  3I4O A;  4TQU S;  4X62 L;  2ZJP A;  4DR6 L;  1CSP A;  2OTL A;  3SGI A;  4HIM A;  3PO3 H;  1S40 A;  1A63 A;  3I2Z A;  3I4N H;  1CKN B;  3ULL A;  1IBM Q;  1EYG A;  1VQ8 A;  1YBY A;  2R92 H;  3MEF A;  2E5L Q;  4LWC A;  4POF A;  4POG A;  5IYC G;  4A93 H;  1Y1V G;  2HIX A;  3BU2 A;  4RMF A;  4DV7 L;  4J15 A;  4JC0 A;  4JI1 L;  4LF7 L;  1Y1W H;  4OX9 L;  4WJ3 M;  2JJQ A;  3GTP H;  1YHA A;  2AWO A;  2CWP A;  4KLK A;  2ZJR A;  3J80 i;  2AHO B;  1L1O A;  2JA7 G;  1X54 A;  2XTI A;  3PCO B;  3HOV H;  1JJG A;  3BJU A;  1O7I A;  3K81 C;  1N32 Q;  4A3C G;  3D0F A;  1I6H H;  4AQY Q;  1UEB A;  2PNH A;  1T9H A;  4FDB A;  4NXN L;  1K8G A;  1P8L A;  2HQL A;  4K0K Q;  3KFU A;  3OTO Q;  3M9B A;  2VUM G;  3S1N H;  4DV0 L;  3PUX A;  4BBS G;  5K36 G;  5FLM H;  1K9M C;  3BZC A;  3A74 A;  4BA2 I;  1XNQ Q;  2BA1 A;  3CME A;  1LM0 A;  4HID A;  1XMO Q;  5LMU L;  2HHH L;  2CQO A;  3RR5 A;  4HIO A;  4A3F H;  1EFW A;  4YY3 L;  4A3E G;  4LFA Q;  4GNX A;  4JI5 Q;  1PFS A;  3HOY G;  2KCT A;  3H3V H;  1QVG A;  1PH7 A;  4QIW E;  1EIY B;  3HOZ G;  4DR7 L;  2OQK A;  2I5H A;  3PO2 G;  4LF9 L;  5IYD G;  4OWW B;  2N49 A;  4BY1 G;  3RLO A;  2K5V A;  4GS3 A;  4JI8 Q;  1SN8 A;  4L5Q A;  4R1J A;  3NBH B;  3DLL A;  3NEM A;  2Q2T A;  4GKK L;  5C0X G;  3G4S A;  1V9P A;  5LMN W;  1VQ6 A;  4JI7 L;  5HY6 A;  1C7Y A;  1MJE A;  4O2D A;  3BZK A;  2UUC L;  4DV5 Q;  1PH1 A;  2UUA L;  1K73 C;  1L1O C;  1I5F A;  3I4M G;  1B7Y B;  2B63 H;  4DV6 L;  4GOP A;  2R7F A;  3EN2 A;  1I3Q H;  1IBL L;  1IXR A;  1IBK Q;  1TWA H;  4DAY B;  3CCU A;  4LF5 L;  4IPG A;  3J7Z C;  2MO1 A;  1CKO A;  1ASZ A;  1FGU A;  5IWA Q;  4C3H H;  3U58 A;  4A3G H;  2OTJ A;  1HR0 Q;  5M3M G;  1K0R A;  1V43 A;  2VW9 A;  3CC2 A;  2YV5 A;  1XPR A;  5AJ3 L;  4JI6 L;  4JBJ A;  4P73 A;  1YI2 A;  1Q1E A;  1SMX A;  1XNR L;  1TWC H;  4A3K H;  2BH2 A;  1PH9 A;  4LF4 L;  4DV1 L;  4A3D H;  4LFC Q;  5ELN A;  2CFM A;  4YCU A;  1I94 Q;  3J81 i;  3UE1 A;  4GNX C;  2YTY A;  2ZJQ A;  3HOU G;  3PF5 A;  1WCM G;  3AFQ A;  3K0X A;  2ZM6 Q;  3IRB A;  1QVC A;  2A1A A;  1GM5 A;  1VQE A;  1VS0 A;  4JYA L;  1Q81 C;  1H95 A;  1GVP A;  5GQO A;  3PUW A;  1UWV A;  4BXX G;  3ZJY C;  4R4I A;  4OO1 I;  3HOW H;  1N34 L;  1N33 Q;  1BKB A;  4LUZ A;  1HNX L;  3M4P A;  2HT1 A;  2VNU D;  3A0J A;  2NVX H;  1YJN A;  2JA6 H;  4GLA C;  2VQE L;  4JOI A;  2JA5 G;  4BY7 G;  2UXB Q;  2UXD L;  3S15 H;  3S14 H;  3K7A H;  4JI3 Q;  3DM3 A;  4GOP C;  4C3I H;  2DGY A;  5GAG C;  1UE1 A;  3PO2 H;  5BR8 L;  4DR5 Q;  1J5E L;  4ME3 A;  4LF6 L;  4P72 A;  4DV4 Q;  2A19 A;  5GAE C;  3WWV A;  3CMA A;  1QZH A;  5C3E G;  3M85 A;  3L0O A;  3GTO H;  4UP8 A;  4DR3 L;  2VQF Q;  3JAM i;  1XPO A;  4GKJ L;  5LMN Q;  2LXJ A;  3FKI G;  4OO1 G;  4BBR H;  2N78 A;  3OW2 A;  1YJW A;  3HKZ G;  3CPF A;  3H15 A;  1SFO H;  2CCZ A;  4NXM Q;  3OYY A;  2OQ0 A;  4DR7 Q;  2KHJ A;  3KF6 B;  1YIJ A;  3GTK H;  3CQZ H;  2R93 H;  1W2B A;  1Q46 A;  4APV A;  2F4V L;  4B3T Q;  4BA1 I;  4YHH L;  3S1M H;  4JCV E;  3F8T A;  1YHB A;  4LUO A;  1WYD A;  1PA6 A;  1M90 C;  1E1T A;  1KQS A;  3FHW A;  3I55 A;  2CWA A;  2UUA Q;  2I5M X;  3E9H A;  4JI2 Q;  1HR0 W;  1LYL A;  2B29 A;  1Q1B A;  3K80 C;  3A5U A;  1D7Q A;  4L5S A;  5M3F H;  3T1Y L;  5FJ8 H;  1HJP A;  4UPA A;  3L2P A;  5JEA G;  4LF8 Q;  5M5X H;  3RN2 A;  2IY5 B;  4NB3 A;  4DUY Q;  4DR1 L;  3TRZ A;  1E24 A;  1B70 B;  1RL2 A;  1X3G A;  2K14 A;  5ELO A;  4A3M G;  4JI0 L;  2NVQ H;  2CKZ B;  4A3L G;  4LFB L;  2UUB Q;  1QVF A;  5C4X H;  3CCJ A;  1G51 A;  2WAQ G;  1PH4 A;  1D8L A;  2H5X A;  3FP9 A;  3J81 j;  2R6G A;  4A3I H;  1PHJ A;  2E2J H;  4X66 L;  2JA8 G;  4IO9 A;  4PZ8 A;  1AE2 A;  3HKZ E;  3ER0 A;  1P16 A;  2PQA B;  3KLW A;  3CCS A;  1VQL A;  2GVA A;  2NVY H;  4B3R Q;  4JBK A;  4JG2 A;  1VQD A;  1OXS C;  1X6O A;  2VL6 A;  4KHZ A;  4X64 Q;  3ULP A;  1N36 L;  4EQ5 A;  1PV4 A;  3S2D H;  1V1Q A;  1AE3 A;  2Q2I A;  2D0O A;  2NVT H;  1UE7 A;  3M3Y H;  3HOX G;  3RZD H;  1VQF A;  1G29 1;  5IYC H;  2NN6 I;  2GVB A;  1Y1V H;  4X6A H;  2K5H A;  1XJV A;  4R4O A;  2I0Q A;  1XMQ Q;  1Q12 A;  1NBW A;  5J3B A;  2WP8 J;  2NZO A;  3T1H L;  4DR4 L;  1HNW Q;  2I5L X;  3KDF B;  1TXY A;  2ZTC A;  5M5W H;  1VQM A;  4B3M L;  1X3E A;  4DUZ Q;  1VQ4 A;  2JA7 H;  1QUQ A;  4A3B G;  1W3S A;  2Y0S G;  2HIV A;  4QY7 A;  1PH5 A;  4A3C H;  5JJI A;  1EOV A;  1E22 A;  2ATW A;  4X65 Q;  4YCW A;  1YIT A;  2IHE A;  1VQN A;  5IP9 G;  1A8V A;  2VUM H;  4A4I A;  1VQP A;  1FJG Q;  4BBS H;  4JV5 Q;  4JI4 L;  4KHP Q;  1WOC A;  4B3S L;  3S1Q H;  3UE0 A;  3EIV A;  3JC6 6;  2WAQ E;  5GAD C;  4A3G G;  2NN6 G;  3PUV A;  4YWK A;  5IYB G;  3J81 c;  4GKJ Q;  3CW2 C;  1HNZ Q;  4L5R C;  2JEB I;  2RCN A;  4DV2 Q;  4A3E H;  1WFQ A;  3KF6 A;  4DV3 L;  3GTQ H;  5IP7 G;  1UE6 A;  3AYH B;  3HOY H;  1X65 A;  1U5K A;  3H0G G;  2E2I H;  4ALP A;  4DR2 Q;  3TS0 A;  3HOZ H;  3GTL H;  1Y14 B;  4X62 Q;  1IBM L;  4DR6 Q;  1CKN A;  3E9I A;  3G48 A;  4MTN A;  2F4V Q;  5IYD H;  1OTC A;  1GKH A;  3CCE A;  2AKW B;  3CCM A;  4BY1 H;  2DUD A;  2E5L L;  2L15 A;  3CD6 A;  2N3S A;  1YNX A;  2EIF A;  1A62 A;  2PI2 E;  3AQQ A;  5EAY A;  3RN5 A;  1K8A C;  1ASY A;  2YU9 H;  2Y0S E;  2Z6K A;  1JE5 A;  4GN3 B;  3RLN A;  3ICE A;  1B8A A;  3F1Z A;  3CXC A;  1OXU A;  3PF4 A;  1Q86 C;  3GO5 A;  4DV7 Q;  1YEZ A;  4IJH A;  5IT9 c;  1CUK A;  3G71 A;  4JI1 Q;  4IOC A;  4LF7 Q;  4IFD J;  4OX9 Q;  2MNA A;  4IJL A;  4HJ8 A;  4A3J G;  1N32 L;  3EBE A;  1L1O B;  2VZA A;  1EWI A;  1WI5 A;  4AQY L;  1N8R C;  4IFD I;  5FLX c;  3KJO A;  2MQH A;  4WJ4 A;  3I7F A;  4K0K L;  3OTO L;  4HIK A;  3CF5 A;  5GRO A;  1VQI A;  4GLX A;  3NEL A;  4NXN Q;  2FXQ A;  5M3M H;  3AEV A;  1XTD A;  1UE5 A;  2ZTE A;  3MXN B;  3I56 A;  1K83 H;  4DV0 Q;  2KCM A;  4LW1 A;  4DNI A;  5H1S E;  3J7A 5;  1JB7 A;  3U50 C;  3CCR A;  1XNQ L;  1KAW A;  1Q7Y C;  4DKA C;  1PYB A;  2PMZ E;  2ES2 A;  2YYZ A;  4QJF A;  4OXP A;  4IPH A;  5C44 G;  2KBN A;  2PI2 A;  1TWG H;  4XIG S;  4LFA L;  3HOU H;  4JI5 L;  4AYB G;  1VQ9 A;  1E1O A;  2K5N A;  3M4Q A;  1Z47 A;  1WCM H;  2WB1 G;  5LMU Q;  1EIF A;  1L2F A;  1PH8 A;  2HHH Q;  4YY3 Q;  4GNX B;  1SLJ A;  1KIX A;  1J6Q A;  2YTX A;  2LSS A;  1KRT A;  1KL9 A;  3PO3 G;  2C35 B;  1EUJ A;  3CAM A;  4HJ9 A;  3CP0 A;  4JI8 L;  3I4N G;  1VQA A;  2Z0S A;  4BXX H;  1BBW A;  4LF9 Q;  2R92 G;  2UXC L;  1VQH A;  4YWL A;  3J80 c;  4OON A;  4GKK Q;  4A93 G;  1GO3 E;  1C9O A;  3K7U C;  3UDI A;  5GAH C;  2LXK A;  4JBW A;  5IE8 A;  4DV5 L;  2K4K A;  2JA5 H;  4JI7 Q;  1SE8 A;  4BY7 H;  4QQB X;  1Y1W G;  4R4Q A;  5FJ8 G;  3KJP A;  2UUC Q;  3UDF A;  1IBK L;  1QZG A;  3CC4 A;  4GOP B;  3CCL A;  3HOV G;  1A0I A;  4DV6 Q;  3F2D A;  3H3V I;  3ERS X;  4DPG A;  5IWA L;  1IBL Q;  1C0A A;  2K50 A;  5C0X J;  5C3E H;  2JE6 I;  2D0P A;  3W1G A;  4LF5 Q;  5C4X G;  4A75 A;  1HR0 L;  3TQY A;  1R9T H;  4A3I G;  2E8G A;  3CCV A;  1E3P A;  2VY3 A;  4JOI C;  3FKI H;  2IX0 A;  3TRE A;  2F3I A;  1IYJ B;  2IT1 A;  1VQB A;  4HJA A;  3PUZ A;  2ALY B;  5FLM G;  3G6E A;  1X9N A;  4AYB E;  2QA4 A;  4A76 A;  3GTG H;  3S16 H;  5AJ3 Q;  5C4J H;  2WB1 E;  4MZ9 A;  4JI6 Q;  1XNR Q;  1CSQ A;  2Q2H A;  3RLF A;  4LFC L;  1CKM A;  4KI0 A;  3CPW A;  1I94 L;  4XTC S;  1IZ6 A;  3VDY A;  4LF4 Q;  4DV1 Q;  2ASB A;  4GN5 A;  3S2H H;  1Q8K A;  1SRU A;  2JA9 A;  3STB C;  4EX5 A;  3PIO A;  4A3F G;  3LGJ A;  1Q82 C;  1IL2 A;  4PZ6 A;  1S72 A;  1KXL A;  2ZM6 L;  1JJ2 A;  1PH3 A;  1EQQ A;  3GD7 A;  4RG1 A;  3TS2 A;  4GN4 B;  4NPS A;  3W5O A;  4JYA Q;  1U0L A;  1OXT A;  1N33 L;  1Z9F A;  4O0A A;  1VQJ A;  2A8V A;  3S24 A;  4QL5 A;  3CCQ A;  2OWO A;  1N34 Q;  3F2C A;  4GLV B;  1HNX Q;  4UY8 C;  2UXB L;  3GDE A;  2D62 A;  4Y7N H;  3S1R H;  4HJ7 A;  2XGT A;  4JI3 L;  4A3L H;  5IY0 A;  4A3M H;  3E0E A;  1GD7 A;  4UP9 A;  2VQE Q;  2UU9 L;  5C0X I;  2WFW A;  2UXD Q;  4PZ7 A;  1TWF H;  4DR5 L;  2MFI A;  1VQC A;  2IHF A;  1L0W A;  2B63 G;  2JA8 H;  1X55 A;  2MO0 A;  1MJC A;  4DV4 L;  4YCV A;  1YVC A;  1HZA A;  4OWX B;  5BR8 Q;  2VQF L;  1J5E Q;  4LF6 Q;  2NZH A;  2BA0 A;  5LMN L;  1XPU A;  4LUV A;  2RHS B;  4DR3 Q;  1EQR A;  3GTM H;  1NMF A;  1KD1 C;  1JJC B;  4P74 A;  1AH9 A;  4NXM L;  4OWT B;  2KEN A;  3B6Y A;  4AH6 A;  3HOX H;  1KHI A;  3AFP A;  2E2H H;  1FL0 A;  4A3K G;  1BVS A;  3KOJ A;  3CC7 A;  3PSI A;  1HH2 P;  3S17 H;  1YJ9 A;  1NTG A;  4JBM A;  3F2B A;  4B3T L;  1I50 H;  4A3D G;  2UXC Q;  2R7D A;  5E7N A;  1LTL A;  3KYH C;  3NEN A;  4R4T A;  3HFZ B;  2R7Z H;  1PH2 A;  3A5Z B;  4YHH Q;  4A3B H;  2GN5 A;  3U4Z A;  1E7Z A;  4IPC A;  4JI2 L;  1KC8 C;  1NE3 A;  4PMW A;  2ZTD A;  1X56 A;  5IP9 H;  1FVI A;  3D31 A;  5M5Y H;  2B3G A;  1VQK A;  3PGZ A;  4P71 A;  1M1K C;  3HOW G;  4LF8 L;  1JT8 A;  3I4M H;  4UP7 A;  4DUY L;  2R7Z G;  3T1Y Q;  1PH6 A;  2EQS A;  2OCE A;  1K3R A;  2ID0 A;  3ULJ A;  5IYB H;  5JJL A;  4IOA A;  4YWM A;  2JA6 G;  2UUB L;  1SR3 A;  1OXV A;  4DR1 Q;  3JAM c;  1WJJ A;  1NJI C;  4JI0 Q;  4AIM A;  1DGS A;  1VQ5 A;  4LFB Q;  5IP7 H;  4H02 A;  2JK8 A;  2V1C C;  3PIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...