1GO3E

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
184
structure length
177
Chain Sequence
MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPEMYELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSYDPKAIIGKETGKVLEIGDYVRARIVAISLKASKIALTMRQPYLGKLEWIEEEKAKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
total genus 39
structure length 177
sequence length 184
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1go3E01
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1go3E02
3HOYG 2AMCB 3UDFA 4A93G 1K9MC 4LF4L 4BBRG 3L0OA 1U5KA 3I4MH 1JE5A 3ULLA 3PUVA 2JA7G 5IYDH 1VQ9A 4JG2A 1WYDA 4BY1H 1B70B 4B3SQ 1C0AA 2VUMH 5H1SE 1B7YB 4L5RC 5DLQE 4LUVA 2VZAA 4TQUS 3RR5A 4DV1Q 2WB1E 3RZOH 2XTIA 2EQSA 2VQEL 1L1OC 4B3TQ 4NXNQ 2HQLA 2CWAA 1PYBA 4R4OA 4RG1A 3J81i 3KJOA 4BY1G 2UXBQ 1WCMH 4DNIA 1XNRQ 1KXLA 4DUZL 1E1TA 3GTQH 4A3KG 5C44H 4EX5A 4JI6L 1JB7A 1D7QA 4AYBG 4A93H 3IRBA 4JV5L 5M5XH 1J5EQ 3PIPA 4C3IH 4BY7H 1YIJA 2OQ0A 3CF5A 3TQYA 5IYDG 1SN8A 2GN5A 1IBLL 3KFUA 3M4OH 4DR6Q 5LMNL 4IFDJ 2I5HA 2CQOA 4A3CH 1BBWA 3NENA 2ZJPA 4WJ4A 2KCMA 4DV5Q 3K80C 1TXYA 2NZHA 2KENA 1QVFA 1MIUA 3PO2H 4X66L 1VQDA 2D0OA 1VQPA 2KHIA 1A63A 2KCTA 4X64L 3S24A 1CKNA 2EIFA 4GNXB 3PO3H 3E0EA 3J80c 1PA6A 3A0JA 3FHWA 4IJHA 1KAWA 4HJAA 1A62A 3F2DA 2RCNA 1QUQB 2CKZB 2RHSB 2K5VA 1GD7A 4GN5A 1K0RA 4A3DH 4LF8Q 1HNWL 1UE7A 1YHBA 2B63H 1N9WA 1N34L 1LTLA 4DV5L 3A74A 1EUJA 2VNUD 1CKOA 4IOCA 1XPRA 2UUCL 4KHPL 4QQBX 2RHQB 4P75A 1KHIA 2OWOA 2F52A 1OXVA 2ZM6L 4AIMA 2B3GA 4DV6Q 3CCLA 2C35B 4C3JH 4A3CG 4GN4B 4P72A 1N32Q 3CAMA 4IOAA 3M4QA 3PCOB 5IP9H 4DK6C 4DKAC 4A3KH 4GLAC 3PO3G 1XNQQ 3S2DH 1FGUA 1CKMA 4PZ6A 4GKJL 4OO1I 4LF6Q 1N36Q 1BBUA 1C7YA 2Q2UA 2F4VL 1P16A 1PHJA 3PGZA 4A3JH 1C9OA 4LFAL 3KJPA 3F8TA 4B3RL 1NY4A 4DR2Q 3CMAA 4DR7Q 1I6HH 4YHHQ 5JJIA 4KI0A 4JI1L 1XJVA 1E24A 2Y0SG 1CSPA 3S16H 1VQGA 1KC8C 2MO1A 4A4IA 2IHEA 4K0KQ 1XNRL 1AE2A 4A3EG 4LF5L 2R7ZH 5C4JH 3L2PA 1JJGA 4DAYB 1VQFA 3BU2A 1FJGQ 2VY3A 3PUZA 4LF6L 4IFDG 1VQBA 1HNZL 3M9BA 1UWVA 2BH8A 5JJLA 2ZJQA 2K4KA 3CC2A 1VCIA 4IPGA 3Q8DA 4GN3B 2CFMA 5GADC 1E7ZA 4PZ7A 1E1OA 3PUYA 4EQ5A 1HZAA 2PMZE 3HKSA 3G6EA 2PQAB 4DV0Q 2ASBA 2UXCQ 3HOXH 1VQKA 1GVPA 3F1ZA 1YJ9A 2IX0A 3PIOA 4X66Q 4DR5Q 4JOIA 1YEZA 1UEBA 1I5FA 1VQCA 2L15A 3RN2A 2RF4A 1XNQL 4XTCS 5ELOA 4YY3L 1Q86C 3EIVA 3T1HQ 3S14H 1N36L 1U0LA 1YBYA 3HOXG 2JA8H 4O0AA 3CCQA 2OTLA 2JA6H 2JEBI 4X6AH 3DM3A 2CCZA 2R7ZG 1YHAA 4KHZA 4JI8Q 3NEMA 1PH8A 4A3FH 5FLMG 1M1KC 2JA8G 1NE3A 2NZOA 5GQOA 4X65L 4DR4Q 1DGSA 4JI2L 3GTOH 3S1MH 2E8GA 4BBRH 1IBKQ 4C3HH 2E2JH 1Q12A 3H0GG 2BA0A 4DPGA 2UXBL 2ZM6Q 4HJ5A 1TWCH 2VS1A 4PG3A 4YY3Q 4R1JA 4A3BH 4LUOA 1N33Q 4KLKA 3BJUA 2A8VA 1X55A 1IYJB 1S40A 1HNZQ 3CD6A 3HOUH 4JV5Q 4NB3A 3S1NH 4B3SL 4GLXA 4J15A 5GAEC 1OXSC 5M5WH 2K14A 5BR8L 4DK3C 1IBLQ 4DR6L 2K5NA 1HNWQ 3AFQA 2YTXA 5HGQA 1CSQA 4DV0L 4LFBL 3KF8B 4HIKA 3KDFB 2H5XA 3UE0A 1BKBA 2D0PA 3PUWA 1PH6A 4YWMA 1VQLA 4B3MQ 4FDBA 2MFIA 2F4VQ 4DV2Q 4WJ3M 4P71A 2WP8J 4JI7Q 3I2ZA 2WAQG 2DGYA 3AYHB 4LFCQ 5IYCH 4BA2I 2Q2IA 1MKHA 3M85A 4JI4Q 3PO2G 3K7UC 3H0GH 5LMUL 1V1QA 2NVQH 4JBKA 1QVCA 5IP9G 3STBC 1W2BA 5EAYA 1KD1C 3RN5A 4Y52H 1K83H 3H3VH 3U50C 1RL2A 3TEHB 4A3MG 1VQ8A 3HOZG 2EXDA 2VUMG 2R6GA 4JI3Q 4LF9L 2UUBL 1IBKL 3GTPH 3CQZH 2JA7H 4B3RQ 4GKKL 3J80i 4PZ8A 5C4XG 4X62Q 2Q2HA 5M5YH 3J7A5 1IBMQ 2Q2TA 3GO5A 1PH9A 4L5SA 1G51A 3CMEA 3STBD 2HIXA 2YYZA 4A76A 3S1QH 1K3RA 4L5QA 1OXTA 4MNOA 3FKIH 4JI4L 1Z9FA 2NN6I 2PI2E 2KHJA 1N8RC 1HJPA 3GTMH 4A3MH 4AYBE 3F2BA 2UUAQ 4YCWA 4HJ8A 1KRTA 2UUCQ 3I4MG 5HY6A 3PV0A 3SGIA 1L1OA 1CKNB 4DR2L 4AQYQ 4JCVE 4QL5A 3MEFA 1PH7A 4POGA 5ELNA 3ULJA 2PNHA 2FXQA 2N78A 3EBEA 2VQEQ 3UE1A 1Y1WH 1HR0Q 1IBML 4OWWB 2UU9L 3T1YQ 5JJKA 1JT8A 4JBWA 3F2CA 1VQAA 3FP9A 1H95A 1Y1WG 1EWIA 1SFOH 3EN2A 2E2HH 1HNXQ 3M3YH 3VDYA 5M3FG 3PF4A 1PH4A 1EQRA 2ES2A 4IJLA 2YV5A 3M7NA 2YTYA 5M3MG 5K36G 4LF9Q 2JA9A 1S3OA 4UP9A 4R4TA 3DLLA 1HH2P 5C4XH 1J5EL 3L7ZC 4LFAQ 3I56A 1XPOA 1Q81C 4C2MH 3D31A 5AJ3L 4JC0A 4P74A 1PVOA 1UE5A 1TWAH 4A3FG 1ASYA 1I94L 2VW9A 4DUYL 1WOCA 1HR0L 1OXUA 5LMNW 1X65A 1YVCA 2MNAA 3MXNB 2D62A 3BZKA 1YHQA 2JEAI 1Q46A 5J3BA 4JI7L 4QGUA 2GVAA 1R9TH 1IZ6A 3GDEA 1IL2A 4MZ9A 4GLVB 4A3EH 2AHOB 4XIGS 3S1RH 1I3QH 4JOIC 1L2FA 5GAGC 1QZGA 1PV4A 1OXXK 2LXJA 2JE6I 2ZJRA 3ULPA 2ZTDA 3K81C 4NPSA 4JI8L 4OXPA 3CP0A 1HR0W 1XMOL 4A3DG 2IY5B 1HZ9A 2AWNA 1I94Q 2UU9Q 2B29A 2VL6A 2HIVA 2JK8A 5C3EH 2A1AA 2ID0A 3UDGA 4A3LG 1WCMG 1YNXA 2PI2A 3KF6A 4YCUA 3J81j 5C0XJ 2E2IH 4GKKQ 4OONA 1UE6A 4A3IH 1LM0A 4LFCL 4APVA 4DR1Q 1K73C 4UP7A 5IYBH 4DV6L 1VQ5A 1X9NA 3S2HH 1MJCA 2N8NA 2BA1A 3HFZB 3CCSA 1EFWA 2OTJA 4A3LH 4LW1A 1WJJA 3JAMi 2JA6G 2UXDL 1YI2A 1GO3E 2MO0A 4YWLA 1G6PA 4DV3Q 5IWAQ 1JMCA 1YZ6A 5FLMH 2WFWA 4X65Q 4DR4L 4DAMA 4YWKA 3S15H 4HIDA 1QZHA 2WAQE 1FVIA 2JJQA 3GTJH 3U58A 1QUQA 1V9PA 3ZJYC 4GOPB 2JA5H 4JI0L 1P8LA 3GTLH 3AFPA 4JI6Q 3UDXA 4AQYL 4A3IG 3HOZH 1GKHA 2NVYH 5C3EG 1XPUA 4GNXA 5IT9c 2UXCL 4BBSG 3H15A 5C0XI 3UDIA 4NXMQ 2BH2A 2ALYB 3JAMc 4DR5L 5BR8Q 4OO1G 5C0XG 2WB1G 3CPFA 4BY7G 5E7NA 4LFBQ 2I5MX 4RMFA 4HJ9A 1GM5A 1AH9A 1HZCA 1D8LA 1EQQA 2UUAL 2K52A 3FKIG 1T9HA 4OWTB 4DV2L 4HIOA 3S17H 5AJ3Q 2F3IA 2YTVA 1Q7YC 3NBHB 1QVGA 4A3GG 1KIXA 3K8AA 3RLFA 4DV4L 3ERSX 2K50A 4DR3Q 3JC66 4P73A 1HZBA 2I0QA 4LF7Q 4A3GH 1Q1EA 2QEXA 1KRSA 1W3SA 1N32L 1WFQA 1G291 4LWCA 2XGTA 4A3BG 5IP7G 3B6YA 2QGQA 1E22A 5C44G 4DV7Q 3TS0A 3HOUG 1YITA 1I50H 1LUZA 4IFDI 4QJFA 1VQMA 2B63G 3W1GA 3CPWA 4GKJQ 2UXDQ 3W5OA 3OW2A 2R93G 1VQ4A 3U4VA 4GNXC 1EOVA 4QIWE 2HHHL 2R92H 4OX9Q 1Y1VG 4OWXB 2AWOA 2LSSA 5M3MH 1VQ6A 4Y7NH 3I4NH 1L1OB 2NVXH 1XTDA 4DR7L 3AQQA 1TWGH 3GTKH 1L0WA 4DR3L 3KOJA 4R4CA 1SMXA 3RLNA 3U4ZA 2K5HA 1Q1BA 4JI2Q 4JBJA 4LF7L 4BXXH 4TVAB 3I55A 4ALPA 2ZTCA 1M90C 2E5LL 3CCEA 3I4NG 4DUZQ 4GOPA 1MJEA 3I4OA 3HOYH 1VQ7A 3A5UA 1A0IA 2HT1A 1N33L 2Z6KC 2N49A 1Z47A 1VQHA 4UP8A 5GROA 3E9HA 1FJGL 3TS2A 3ICEA 3TREA 2N3SA 1VS0A 1NJIC 3CC7A 1X6OA 4DV3L 3GD7A 3WWVA 3OYYA 3CW2C 2Y0SE 1N34Q 3OTOQ 1JJ2A 5FJ8G 4JI3L 2YU9H 3M4PA 1NTGA 2R93H 1X3EA 1XMQL 5JEAJ 2NVTH 4X64Q 1VQEA 1Y1VH 1SE8A 2AKWB 2R7FA 3G4SA 3CCUA 4DR1L 1YJWA 1CUKA 1EYGA 1EIFA 1A8VA 3KYHC 4IPHA 1PH3A 4UY8C 1EIYB 3T1HL 2HHHQ 1AE3A 5LMUQ 4OX9L 1PFSA 3HKZE 3PSIA 3HOWH 4UPAA 3CCJA 1UE1A 1KQSA 5IWAL 2Z6KA 2QA4A 4DV1L 1PH5A 4HJ7A 1PH2A 1Y14B 3KLWA 4LUZA 2PQAA 1RIPA 3OTOL 4A3JG 3K0XA 5GAHC 5M3FH 2UUBQ 3HOVH 1LYLA 4H02A 1K8AC 3NELA 3HKZG 3RNUA 4KHPQ 5IP7H 3W1BA 4JI0Q 2OQKA 4DV4Q 4GS3A 4X62L 1YJNA 1VQOA 1VQIA 1IXRA 1SROA 1SRUA 1TWFH 2VQFL 4JI5Q 4BBSH 1Q8KA 4IPCA 1X56A 3LGJA 5FJ8H 1NMFA 3CXCA 1SR3A 4HIMA 4K0KL 1FL0A 3E9IA 4BA1I 1PYSB 1NBWA 1NMGA 3CCVA 3RZDH 4IO9A 1HNXL 3I7FA 1JJCB 1E3PA 4A75A 1XMOQ 1K8GA 1ASZA 1VQNA 5IE8A 4LF8L 3D0FA 1O7IA 2Z0SA 2GVBA 3BZCA 4LF4Q 5IYBG 2LXKA 5FLXc 3HOWG 4POFA 3TRZA 2DUDA 4R4QA 1XMQQ 2IHFA 2I5LX 1KL9A 4O2DA 2CWPA 2JQOA 4PMWA 1BVSA 1TWHH 1X3GA 4YHHL 1OTCA 2K75A 3G48A 5IY0A 3CCMA 2ATWA 2A19A 2MQHA 3HOVG 2OCEA 2KBNA 4JYAL 3AEVA 4GOPC 4JBMA 1PH1A 4L5TA 1SLJA 3T1YL 4DUYQ 4JI5L 2VQFQ 4NXNL 2ZTEA 3A5ZB 4R4IA 4ME3A 2JA5G 3CC4A 4NXML 2IX1A 4DV7L 3J7ZC 3CCRA 3RLOA 3KDFA 1X54A 4AH6A 1V43A 4B3ML 2NN6G 2R92G 3GTGH 3G71A 4QY7A 1B8AA 4MTNA 3PUXA 3PF5A 4YCVA 4LNQA 5LMNQ 2R7DA 1WI5A 5IYCG 4JYAQ 2IT1A 1X3FA 4JI1Q 1Q82C 2V1CC 4B3TL 4BXXG 3KF6B 1J6QA 3H3VI 3K7AH 2E5LQ 3ER0A 5JEAG 1VQJA 1S72A 4IPDA 3J81c 4LF5Q
chains in the Genus database with same CATH superfamily
3HOYG 2AMCB 2VUMA 4IRCA 1T94A 4LF4L 1FD7D 2D2CC 1IBMH 5KFJA 3WO0A 1CHQD 1PMRA 3N41B 4V0BA 4DXFA 2Z8LA 1F2ZA 4JG2A 4BY1H 1C0AA 2PZWA 2VUMH 5H1SE 3NTIA 1J5EH 1KJ8A 4XQJA 4H0LC 1TWAB 2WB1E 5C3XA 2G9HD 4HNTA 1K83A 4C2MA 2HQLA 4R4OA 3J81i 2TSSA 2ZT9C 4DNIA 4WORA 1XNRQ 4EEQA 1BNZA 4UAIA 1KC7A 5M5XH 1J5EQ 1E4FT 3RJ0A 3CF5A 5FLXW 1YNND 5LMNL 4TKOB 4EG0A 2ATLA 4WJ4A 4ZRZA 3M9OB 1QVFA 5C4XB 1MIUA 5KFZA 3PO2H 4X66L 4S3SA 2D0OA 4KD3A 2KHIA 3S24A 2I87A 2QKIC 2Q8TA 5KFLA 1PA6A 4HJAA 1FGBD 1QUQB 1LT3D 3Q8QB 1D5ZC 2RHSB 1WTQA 2B2UA 1ET6A 3M9MB 2RGVA 1GD7A 3VA7A 4DNTB 2EJGC 1K0RA 1VF7A 4LF8Q 1SYEA 2B63H 5K2MA 1ICFB 1LTLA 1KJIA 1TY0A 3LWBA 5IGGA 2O5IC 3PO3B 2IMWP 1CQVA 3A74A 2VNUD 3BYYB 1DIKA 4ETSA 3N52A 1UNSA 1STBA 5CV6A 4QQBX 4P75A 4GC6A 4FF3A 2PNRC 3BA9A 5JAVA 4AIMA 5FLXL 5ELEA 3K58A 2YS6A 4GN4B 2PPBC 1RK5A 1DZ1A 3Q8SB 5KT7A 2FJZA 1H9MA 4DK1A 1PK8A 4J9NA 3OUUA 1TKWB 4DA2A 1IL8A 3OIQA 4LF6Q 1N36Q 4JI2H 2V5AA 3G6YA 1TA8A 3F8TA 3Q6SA 3I73A 1C4QA 4B3RL 2R8HA 1BXRA 1TT2A 4RUCA 1QB5D 4KI0A 4JI1L 1IYUA 2YCHA 5T1GA 3S1NB 4ED6A 3OWFA 1XNRL 2K5QA 1SEBD 2A73B 2ZXOA 3L2PA 1G2TA 4C3HG 5JVG3 2NVTB 5DQIA 2PCFB 1I4QA 5JJLA 2Y0SB 2WACA 1D1KA 2E74C 3Q8DA 2CFMA 1PTOD 4CJ0B 3H0GA 3HOZG 3WO1A 3TRZA 2UXCQ 3IG0A 2PMZE 3RF2A 4ECSA 3HOXH 2FMCA 5D14A 2JA8B 4J0MA 1BO0A 1YJ9A 5HBRB 2IX0A 4JOIA 1M0WA 1YEZA 1UEBA 1VQCA 4XT3B 3D4DA 3RN2A 1XYIA 3R93A 1AZQA 2M2LA 1S68A 2JA5A 3MJFA 5KFFA 2BQ3A 2L12A 3HOXG 3CCQA 2JEBI 2I07B 1BDOA 3DF7A 2R7LA 2IL8A 4BS9A 2NZOA 1PTOB 4X65H 4LMYA 1TWCA 5JPMC 4O2AF 4C3HH 2EYFA 2E2JH 1Q12A 5T14A 2UXBL 3QOLA 4YAJB 1IOWA 4QIWA 1TWCH 4YY3Q 2HVSA 4DNRB 2EY1A 4LUOA 3CD6A 3BJUA 2LS01 1X55A 1IYJB 3EA6A 3AB9A 4HSVA 1S40A 3HOUH 2HGSA 4C5AA 3S1NH 4KMUC 3FEWX 3EJIA 3GP7A 1JOOA 1RJTA 2K5NA 5HGQA 3H0GB 4J9KA 4DV0L 2F0UA 3KDFB 4J1MA 3UE0A 2D0PA 3P7JA 4YWMA 1VQLA 4Y8VB 3MHBA 2WP8J 4IALA 3GTPB 1HFGA 2WAQG 3AYHB 5IYCH 3LX0A 1L2ZA 5HURA 4JI4Q 4HQ6A 5GONF 3PO2G 5KG4A 3VYUA 1S5DD 2ZM6H 2NVQH 2LFNA 5IP9G 3CQZA 2V4QA 1E2ZA 2JA7A 2NVYB 3RN5A 1PFBA 1CE8A 1K83H 2HJWA 3U50C 3TEHB 1EYAA 1LT4D 4MV9A 4RCOA 4UCOA 1DCZA 2UUBL 4EEYA 2ZDQA 5J39A 3W2DA 3CQZH 3DM1A 5JPNC 4FF2A 2JA7H 1GJXA 5CV5A 1CQJB 4DLKA 3SE7A 5LMUH 5LMNH 3J80i 3NQIA 1W6KA 4C3HB 2E2JB 1AN7A 4RZRA 4A2AA 4O3SA 2Q2TA 1KLGD 4QF4A 3AMUA 4L5SA 3H3VC 1DD2A 2FPGB 4I4TF 4A76A 3Q8PB 2CH4A 3FKIH 2A74C 2NN6I 4IUVA 4AYBE 2UUAQ 3HXLA 4PDBA 2AQ3B 3MXUA 4HJ8A 2HVQA 2R8KA 1SNDA 3FKIA 2GA4B 1CKNB 1FNWA 4CC5A 3T1HH 4WRDA 4QL5A 3HBLA 3WDNA 3VR5A 1PH7A 5ELNA 2PNHA 1Y1WH 3UE1A 1IBML 1S9FA 4ZCKA 4LF4H 4CJ2C 1H95A 1SFOH 4OEMB 2IWHA 1MZBA 5M9OA 4UFZA 2YV5A 2YTYA 3TDQA 1LLRD 1HH2P 5C4XH 5D8DA 2KA7A 1XPOA 1JR0D 1SBBB 3IL8A 5AJ3L 1IHZA 2P5ZX 1A3UA 1JC7A 1TWAH 3MAQA 5KFOA 3GIJA 1FJGH 4NP5A 2IP4A 3OSOA 3OHBA 2EE1A 1GYFA 3GTQA 1UUPA 1I94L 5DGBA 2VW9A 4DUYL 5EQ0A 5KFUA 3SDZA 3V96A 1YVCA 3MXNB 3K5NA 2D62A 3BZKA 3A56A 3U9SA 5C6AA 1B6SA 3G7LA 1CK1A 5FPRA 3GDEA 1B53A 4DV7H 4B3TH 1WCMB 3NTKA 2AHOB 2W9CA 4JOIC 4Q0FA 4ZUIA 3D4RA 3KBGA 1V1PB 4Q44A 3KBXA 2ASDA 2LXJA 1M8AA 2JE6I 3H91A 5KRUA 4OGQC 1QNUA 3ULPA 5LA6F 3QR8A 2X0SA 3CP0A 2IY5B 2IA6A 2VQEH 2FP4B 4L63B 2B29A 2VL6A 2ID0A 4RHSA 3KF6A 3R2TA 4DL6A 3TP7A 3K5LA 4IWXA 3QO2A 1DV1A 4MV3A 4LFCL 1JLLB 3S15B 5HV6A 5IYBH 4QMGA 1VQ5A 3L4JA 3S2HH 5JVH3 3S2DB 4YJ3F 1MJCA 4ED1A 4KKUA 2BA1A 5CYUA 4O3OA 3UQ8A 2RDFA 5KFQA 4LW1A 3VYSA 1B1ZA 1YI2A 4X64H 5KX5F 3OSPA 1F9RA 3CKIB 4DR4L 4HYKA 3HS0C 1SNCA 3S15H 2C2EA 3BS1A 3U58A 4GOPB 1AFPA 2JA5H 4TUYF 2A6HC 2UVVA 5C3EG 2ZDHA 4F88A 4ECXA 2UUCH 3BZDB 5C0XI 1VF5C 3JAMc 2RSNA 4DR5L 3N8DA 4ZKBB 4HSPA 5LP6F 2YU9A 2B8FA 3NQTA 1AH9A 1HZCA 3GLKA 2K52A 3FKIG 4ME5A 4OWTB 4DV2L 4A3IB 3S17H 5AJ3Q 1DXMA 1QVGA 5C4ZA 5FD6A 1KIXA 3K8AA 4DV4L 2XWJB 3ERSX 4FNFA 2R7ZA 3JC66 4P73A 1I50A 3M4YA 1TS3A 1HZBA 4FP5D 4A3GH 5C3WA 5FO9B 1N34H 1W3SA 2Y0SA 2SNMA 5DG8A 3KHRA 4IRKA 4RH6A 2SEBD 3HOUG 2K6AA 2B63G 3SE0A 4XYLB 4CKEA 4GNXC 2K04A 2NTSA 3FRPB 4OWXB 4DR3H 2QCPX 4EBEA 1SYDA 1TWGH 3QOJA 4IWYA 4R4CA 3JAME 2K5HA 3V2TA 3KF8A 2W57A 4RB0A 1ZQ7A 2BDOA 4EFBA 5LYJF 4YR0A 1M90C 3I4NG 2QYZA 2XIGA 1GOZA 4ULLA 4DUZQ 4ECRA 3C1FA 5ELBA 3GTMB 3A8IE 3D4WA 1N33L 2L5TA 2N49A 3C1EA 1IYVA 3MVVA 5E1FA 3GV3A 2R8IA 4JYAH 5C5JA 3K7AB 1VS0A 1X6OA 1Y69U 2PZTA 1EYCA 1U4RA 2IW3A 1SDFA 4B08A 3OTOQ 1N34Q 4ECWA 4JI3L 1PDQA 1VBGA 2R93H 4DV3H 1EOTA 4FS2A 2BR0A 5KNBA 2W9BB 2AKWB 2N88A 1AW7A 3G4SA 3CQZB 4DR1L 2JA7B 4XYQA 4ILWA 1A8VA 1EIYB 2B2WA 5F9NA 1AE3A 1RJRA 1DM0B 2B2VA 2F4IA 4RGTA 4UPAA 3N6XA 4B3MH 4EGJA 2QA4A 2DLNA 2NVXB 2DPIA 5E4WC 5C4HA 5M5YB 2FE3A 3KLWA 4A3JG 2HDLA 3K0XA 1BJTA 4I7ZC 4KHPQ 5IP7H 4JI0Q 4EQOA 5IODA 4AYBA 5FK9C 3Q22A 4DV4Q 1AUXA 5FO8B 4V190 5EJWA 4ECZA 1SROA 5K5PA 3S16B 2VQFL 5KFEA 3T51B 3TBIB 4IPCA 3CXCA 2M00A 5JH7F 3C2PA 4BA1I 1IBKH 1NMGA 1N32H 4XQQA 1E3PA 2EJFC 2DIKA 3TSSA 3BZCA 1CQFA 1TR5A 2LXKA 5C5MA 2CW7A 2DUDA 4R4QA 2M9VA 3P75A 1C48A 5CMDA 1E4GT 3JSNA 3T5LA 2JQOA 1BVSA 2ATWA 2MQHA 1LO5D 2MUYA 2SCUB 4JYAL 4JI4L 4C3JG 1SLJA 4G4KA 3T1YL 4R4IA 3MXGA 3RBDA 3CC4A 5FOBB 2W9AA 3J7ZC 1TIID 1GUSA 2A6ED 3RLOA 2SNSA 3Q24A 4AH6A 1V43A 1O7ZA 4RAYA 4WBNF 5CV8A 3NGDA 1NSNS 1YNNC 5BR8H 2NN6G 1Y8PB 1N56A 4JI8H 3GTGH 3OHXC 3G71A 2QF7A 5FO7B 3WOEA 3PUXA 4OIJA 2ZDGA 1EY8A 3JAML 2FKLA 1E4EB 2K28A 4B3TL 2PW5A 2V1CC 1OO9B 5KT3A 4DV1H 4O4LF 3H3VI 5KFYA 5DGAA 1VQJA 1DOMA 3TZUA 2JEIA 5EBCA 1S5FD 2J6SA 4KV6A 2R92B 3UDFA 2AQ2B 1K9MC 2WAQA 1I4HA 1BUVT 4BBRG 4M1UB 4K5XA 1JE5A 3ULLA 4IFDH 4ZQ3A 3PUVA 1BXTA 4F87A 2JA7G 5IYDH 1VQ9A 1EUDB 2V58A 2J6UA 2WINB 5T1IA 1F77A 3K57A 5DLQE 4KY6A 3RB3A 4DV1Q 2R3ZA 2XTIA 2EQSA 1SE3A 4DV2H 2VQEL 1HCZA 2V59A 2CWAA 5IGFA 4RG1A 4BY1G 4IR1A 3BAAA 1MHWC 4NKLA 4DUZL 5D3DA 4A3KG 1RYSA 2B2VC 5EPKA 3SEBA 1D7QA 2R8GA 3IRBA 4RFBA 4JV5L 4KK7A 1LACA 4BY7H 3JSLA 4LAAA 2ZXRA 5DG9A 3TQYA 5IYDG 5JQWA 3M4OH 3J81W 2OT2A 2CH4W 2CQOA 5ELDA 4A3CH 1LTTD 3SVMA 5DAUA 4DV5Q 4NXMH 2KENA 1CZGA 1TS4A 3FPUB 5D1OB 2FHTA 4NXNH 4DU9A 1VQDA 2RCFA 2W9BA 4X64L 4GNXB 5C1OA 5AFWA 3GQCA 3E0EA 1WTXA 1UNNC 1ZETA 3A0JA 3FHWA 4IJHA 4YQWA 1KAWA 1JWSD 5FD5A 4O3RA 1NAPA 3F2DA 4QWEA 4IN3A 4DV6H 4C5CA 1O75A 4GN5A 1AEXA 4C3JB 1SFOA 1HNWL 2M05A 3GTLA 1IKLA 1VAJA 2V9WA 1JIHA 2PO4A 1EUJA 2FB9A 2UUCL 3TQTA 1Q8IA 1RHPA 1TWAA 4DV6Q 1ZXTA 5E4XA 3CCLA 3GIIA 4C3JH 3KUPA 3EPGA 4DKAC 2J0TD 4R9WA 4DR5H 2LKVA 3PO3G 1CZWA 3GV6A 1QILA 1SYFA 3MFIA 1XNQQ 4RGNA 1FGUA 1CKMA 5EKIA 5CA1F 1BBUA 4Q8EA 1PHJA 3PGZA 3KJPA 1I6HH 3CMAA 2C2DA 5KKNB 3HP3A 3OOCA 1STYA 1A2UA 2W8KA 1E24A 2AU0A 1TWFB 3S16H 5JJZA 1VQGA 1KC8C 2VUMB 4K0KQ 2X6LA 2IHEA 4GC7A 4ED8A 4A2BA 1JOKA 2R7ZH 3K59A 5C4JH 4RA8A 1STEA 4DAYB 3OUZA 2XRSD 4HMIA 3PUZA 3N43B 3M9BA 1RD9D 4AYBB 4DR2H 3MZ5A 4ED7A 4GN3B 1ONLA 5EBDA 1PRTF 1HZAA 3G6EA 2I46A 3EYYA 1O80A 5L9XA 1VQKA 2B63A 3ORRA 3PIOA 1F2LA 4DR5Q 1TWGA 5KFSA 2FK3A 1D6EC 4RUAA 1XNQL 5ELOA 3URYA 5A2QL 4PMBA 1QCBD 1U0LA 3J7AV 2OTLA 3CHBD 1HQRD 1YHAA 3K5IA 4KHZA 4JI8Q 1PH8A 4J6HA 1M1KC 5KT4A 2JA8G 1XXGA 1KJQA 1SYXB 1GLVA 5GQOA 1K0SA 1SSOA 2YZGA 4DR4Q 1DGSA 3DHQA 4IUUA 3GTOH 3S1MH 1DOLA 4KHVA 1IBKQ 2BA0A 5KFGA 1BCPD 1AZPA 1EFID 1J8IA 1VBHA 1QNKA 4R1JA 1N33Q 2AGPA 3VPCA 1JDBB 4JV5Q 4CKBA 2R87A 5KFAA 4NB3A 4K8JA 1ESFA 3RZDB 2B8GA 2YW2A 4DK3C 3I4LA 1HNWQ 2YTXA 3KLRA 1EY0A 4HIKA 2H5XA 4WFN3 1PH6A 4Q45A 1FR3A 4MAMA 4FDBA 2MFIA 2F4VQ 4J9PA 3KTMA 2Q8RE 2RDJA 5J2TF 5I4DA 1YNJD 2DGYA 1KDCA 1MKHA 5I2XA 1KBLA 1R4QB 4YHHH 2F03A 3PW4A 4CBVA 5CC4A 1XX8A 4QB4A 1KD1C 3H3VH 1V8QA 4A3MG 4ABNA 2NUCA 4QWAA 2VUMG 2R6GA 2YRWA 4JI1H 3TZDA 1IBKL 3TIIA 3I72A 4K0KH 3V05A 1DOKA 1BCPB 2CW0D 2QEJC 3UI2A 4X62Q 3IFTA 4EGQA 2EYOA 1SNQA 2R6FA 3GO5A 5CV7A 5KIXA 3STBD 1ULZA 4MNOA 4DV0H 3GTLB 2R93A 2VOBA 4CGYB 2I8CA 2PI2E 2KHJA 1CI3M 2YZMA 4E4TA 3F2BA 1Y1WA 1H9RA 1Q3LA 3HB9A 4J9LA 4RNNA 3WOFA 5JJKA 4IUPA 4FU0A 4BY7B 4A3FB 1K28A 3VA5A 3F2CA 5KFTA 3FP9A 3RB4A 1EWIA 1KABA 2AQ1B 3EN2A 2CHBD 3PF4A 2ES2A 3M7NA 4IJLA 2OF1A 2YZNA 2JA9A 1CTMA 3DLLA 4R4TA 3GTJA 1J5EL 1I50B 3L7ZC 4DF7A 3I56A 1X3QA 2F0LA 1Q81C 3PW0A 4P74A 4Z9CB 3RZOB 1UE5A 1LTGD 4JVZA 1LTRD 2C9OA 3U9OA 3A54A 2F0VA 5IGBA 2YL2A 1WOCA 1HR0L 1OXUA 5LMNW 3MR5A 1NR2A 2F4VH 1H9KA 1UEAB 2MNAA 2JEAI 1K8OA 1Q46A 4JI7L 1A6XA 5KFVA 1IL2A 2HCCA 4MZ9A 3NUCA 1KAAA 3AU7A 3S1RH 2XGQA 1EL0A 4TSSA 1CFMA 4BWSC 1PZJD 1L2FA 4I65A 1QZGA 5KG2A 2ZJRA 2HD3A 2F0MA 2ZTDA 3K81C 4NPSA 2XSCA 4OXPA 4JI8L 2C5CA 5KEEA 1HR0W 5CAEB 1I94Q 2UU9Q 2HIVA 1JJGA 1DV2A 1WCMG 2VUGA 4UCVA 4A3MB 1UE6A 1R4PB 5C8YF 2SOBA 4A3IH 1LM0A 2E2DC 1K73C 2VPSA 1HNZH 1PRTC 3PIO3 4UP7A 1SFOB 4ZI7F 3RD4A 3QZ7A 4TQSA 5L37A 4E6IA 1FKAH 2N8NA 2VB2X 2OTJA 2F0DA 4A3LH 2BQRA 1CA6A 3JAMi 3GTKA 2JA6G 3N42B 1B04A 4DV3Q 1WTPA 2NZ1D 1YZ6A 1T36A 1EY6A 4DAMA 4YWKA 3GTGB 4HMJA 4I55F 4RGMA 5LOVF 1PRTD 1RF2D 3ZYYX 4RWSC 4HIDA 2AGQA 4G7OC 3ZJYC 1P8LA 3FKIB 2EZVA 4AQYL 4A3IG 3OPOA 2Z4IA 2UXCL 3A8JE 3TIGA 4BBSG 4NXMQ 4DV5H 3IAYA 3RV4A 3KALA 2RQXA 3EPIA 3NK9A 5BR8Q 4RKLA 5C0XG 2H4OA 3S1RB 1EU4A 2G5DA 4XQNA 4R8UA 1D2BA 1G6ZA 2F0NA 2IPKD 1Q7YC 4A3GG 3GV8B 2K50A 4DXGA 3R5FA 3ONAB 2B2YA 3RB6A 3BQ1A 1KRSA 1JORA 2XGTA 2J7ZA 3TS0A 5EKLA 2E2IA 1YITA 2WTFA 1I4GA 3NBIA 1VQMA 1XMOH 1H9JA 4ID6A 3CPWA 4IRDA 3M7GA 2YS7A 3U4VA 4ED3A 4QIWE 2L55A 2JEFA 2E75C 2LSSA 3HG9A 3P1HA 5I47A 5BN4A 2NVXH 2PZUA 1CS0A 4WD3A 1XDNA 5E3FA 4DR3L 1FNUA 1Q1BA 2FLPA 1I4RA 3I55A 3KAKA 2CW0C 2ZTCA 4GOPA 3I4OA 3HOYH 2R7KA 3NTHA 3JRXA 2HT1A 1VQHA 5GROA 2B2TA 3E9HA 5CGKA 3T16A 1NJIC 3CC7A 4DV3L 3DEOA 1STAA 5G3LD 3WWVA 3OYYA 2F0WA 3CW2C 2Y0SE 2A69D 2NYZD 1LV9A 2UUAH 2QW7A 1LTID 2WKCA 3MEHA 1MBYA 1X3EA 1HTPA 2XD4A 5KFMA 1VQEA 1ENCA 4JV1A 1EIFA 3KYHC 3E5SA 3EVQA 4UY8C 2SDFA 3T1HL 2HHHQ 1CHPD 3HKZE 3HOWH 1Z6HA 3R3OA 4ZLTF 4RAZA 1UE1A 2KEEA 4X62H 3I91A 3DXJC 1V4YA 4BBSB 5KFNA 1PH2A 3RBEA 1EUCB 2PQAA 2UUBQ 5GAHC 1V51A 2NUAB 3NELA 2ZXPA 5EGTA 3W1BA 2OQKA 2PMZB 4R8IA 1IW7C 3QB3A 4GS3A 4J9OA 1IXRA 1WH2A 3DWQA 3TQ1A 1X56A 3VPDA 1SR3A 1RDPD 4K0KL 4ECTA 3E6ZX 3KHHA 1NBWA 3CCVA 5C4XG 1B50A 4IO9A 5KFXA 3I7FA 1JJCB 3N44B 2UUBH 5A2QE 1K8GA 4LF8L 4HEDA 3P20A 3Q8RB 5FLXc 5IGEA 4DL3A 1I4PA 4CDDC 2A68D 4O2DA 2EJMA 2CWPA 4PMWA 1TWHH 4BWGB 2R93B 5F2DA 3HKZA 3EQLC 3HOVG 1PFMA 2R7NA 1PXUA 1SNPA 4JBMA 1HA6A 4CDEC 4DUYQ 4JI5L 4X66H 4NXNL 3SHLA 4ME3A 4LK1C 3KHLA 4NXML 1GUTA 5DQHA 3KDFA 1X54A 5G3LF 3RTXA 2E5LH 3RUPA 5IWAH 4B3ML 1ZYRD 1SNMA 2WDTA 2R92G 5BPHA 1M7JA 1DJRD 1SJED 3RFCA 5DQGA 5TSSA 3PF5A 4YCVA 4JI6H 1A3VA 5IGCA 1KEEA 4C5BA 1AP0A 5IYCG 3F8NA 4JI1Q 1X3FA 1Q82C 4BXXG 3KF6B 4JK1C 5EDWA 2L9HA 3K7AH 3JZIA 2UXDH 4A3KH 1PTOF 4LF5Q 2F0HA 1Z2NX 1I94H 4A93G 2VA3A 5IT9E 1U5KA 3I4MH 2ALZA 3BDCA 2VXWA 5EWEA 2Q8IB 5HGTA 2F0IA 4ECVA 2R8JA 1U9RA 2VZAA 3RR5A 1QJOA 4CDFC 4B3TQ 4NXNQ 5M5XB 1G8ZD 4Y7NB 2R7MA 2Z4HA 2UXBQ 3KJOA 1Q90A 1EZ1A 4ZK9B 1WCMH 5JVDF 1KXLA 5CBEE 3GTQH 2FK2A 4NW2A 4EX5A 4JI6L 1GHJA 3RAXA 2IX3A 3PIPA 4C3IH 1C30A 1YIJA 3GIQA 2OQ0A 2ENBA 3F2UA 3OW7A 2EYHA 2GN5A 1IBLL 3KFUA 4DR6Q 4IFDJ 3FMAA 4P2CB 5FPOA 2I5HA 4IUNA 4BY1B 5LL6b 3PW5A 1BBWA 2R85A 4MV4A 3K80C 1TXYA 2NZHA 5FKAC 3CRLC 4EBCA 3J7AF 4RCNA 2XNAC 5KT5A 2FK1A 3MR6A 5C5LA 1A62A 2FMAA 3IN5A 2CKZB 4L1KA 3MXPA 2AUJD 1F2YA 4U7CA 2HUGA 1UE7A 5EWGA 1YHBA 1N9WA 2XN9C 1N34L 4PNYA 3K5HA 1SYGA 4Q8FA 4DV5L 5CORA 3BQ0A 4RB1A 1CKOA 4OHJA 1XPRA 4DV4H 4H7BA 1BOSA 1KHIA 1S5BD 2NU8B 2F52A 4LMQD 4AQYH 4KTAA 1A2TA 1SXTA 1WR2A 3BABA 4A3CG 1N32Q 4P72A 3CAMA 4IOAA 1EZ6A 4GLAC 3K3VA 1A3TA 5L1JA 3H6MA 3GIMA 3OMGA 4FF1A 3S2DH 2B2YC 4PZ6A 4GKJL 2Z6BA 3S2HB 1R9TA 2OH2A 4A3EB 4ECUA 1PYWD 1C7YA 5BN5A 4A3JH 4LFAL 1C9OA 5EOYA 2ASJA 4JI0H 4DR2Q 3PO2B 1JICA 4YHHQ 3G6VA 1GUWA 4PWQA 1UC8A 1EWHA 1JXLA 1WTVA 5CV4A 2BE5C 2VPQA 4JI3H 2R92A 1RODA 2G9DA 2MO1A 3VYRA 5JVLA 5KFBA 3NBHA 1AE2A 4LF5L 1TY2A 2KECA 3RV3A 2RVLA 2KJXA 4GZYC 1RK6A 3BU2A 2MJ8A 4IR9A 2UU9H 4K6LA 4IFDG 1HNZL 3M3YB 2MP1A 1UWVA 2BH8A 1PTOH 4KD4A 2K4KA 1EEID 3PW2A 5GADC 4IAJA 1O7LA 3J80W 1E7ZA 4PZ7A 4X3KA 4EQ5A 4DV0Q 4KN4C 2ASBA 5IT9L 4LFBH 1DYQA 3V6JA 2HQEA 2KUMA 1GVPA 2XWBB 4FS1A 1B2TA 4X66Q 4DUYH 3SR1A 3SXHA 3QZ8A 1I5FA 1TU2B 2RF4A 3I4MB 4XTCS 5KT6A 1EIGA 3SK4A 4KKTA 3GIPA 4ME6A 4YP3A 1N36L 1HUNA 3DWAA 5L1KA 2JA8H 4X6AH 2JA6H 1TWHA 5L1LA 3DM3A 2CCZA 3IKJA 2R7ZG 2R82A 3NEMA 4DGZA 1W96A 2J4XA 1Y1WB 1EHIA 4LH7A 4GKKH 4X65L 4Q5VA 2JA6A 4LF9H 2E8GA 4BBRH 2H1EA 1K1QA 5DLGA 1WTOA 3W3AA 1GHKA 4PG3A 1UAPA 4K2LA 4K6DA 4EFEA 4KLKA 4RAUC 1HNZQ 4FVMA 1K83B 4FF4A 4HR7B 4B3SL 4J15A 5GAEC 2PBZA 3Q2OA 4K14A 2PMZA 1EZ8A 5BR8L 3Q23A 2NVQB 1IBLQ 4DR6L 1KDAA 3PZPA 3KF8B 5KNDA 1WD0A 4C1NK 2NN6H 3K5OA 2EYPA 4WJ3M 2R86A 3MFHA 4P71A 2CQYA 3Q0AA 4JI5H 3I70A 4LFCQ 2BCOA 1EY5A 4BA2I 3T13A 2Q2IA 3M85A 3K7UC 3H0GH 1HQMC 2DY8A 5LMUL 3ITPA 1V1QA 1LTAD 1PRTB 1QVCA 1SNOA 3STBC 2K33A 3LWUA 4HCSA 1W2BA 2GLTA 5EAYA 1S0OA 3PN1A 1RL2A 1WTHA 3I12A 4QWCA 5C1PA 4MV8A 1HNWH 4PV1C 1GGOA 4MTEA 4LF9L 2KEDA 3GTPH 4DN4M 3C46A 3LP8A 3K6OA 4B3RQ 3CVZA 5BMVF 3PR4A 3MFYA 4RU9A 2Q2HA 3D3RA 4JPBW 2P0AA 4R8UB 4J9MA 3PQIA 1G51A 4MIUA 2HIXA 1WVLA 2C28A 4L5QA 3GQBA 5A35A 3HOZB 1XTCD 3GTOA 1B3QA 1EYDA 4O2BF 1Z9FA 1LTSD 1N8RC 1HJPA 3GTMH 4K5WA 1UC9A 1EY9A 5C3EB 2UUCQ 3I4MG 3KLSX 1QE6A 3PV0A 1F9QA 4DR2L 3MWDA 3HOXB 3GILA 4JCVE 2K05A 3ULJA 4POGA 1ILQA 2FXQA 3OMCA 2VQEQ 4MV7A 1HR0Q 1F9SA 3VR2A 3GTGA 4C3IB 5CB4F 1TWGB 4JBWA 2CW8A 5D1OA 4TQRA 4DR6H 1VQAA 2MHVA 3L4KA 1Y1WG 3QG1A 1HNXQ 3M3YH 3VDYA 5M3FG 3GTQB 1EY4A 2EOTA 1QWYA 4O3PA 3H40A 3ND9A 4XYMB 2MPMA 3BYTB 4UP9A 4LF9Q 2C00A 3RGXA 2VB3X 4C2MH 3D31A 4L6TB 3V6HA 1N36H 2OLSA 1EYZA 4IUQA 2O03A 4A3FG 1ASYA 2DWCA 1XNQH 3RMHA 4C2MB 2KSWA 1X65A 4X3SA 2BDNA 1MSGA 2E76C 5DNFA 1I4XA 5M3MB 5J3BA 2GVAA 1R9TH 3HGBA 4LJZC 2K1BA 4A3EH 4F8MA 5H80A 1S0NA 4XIGS 2QILA 5GAGC 4MHEA 5EZYF 3PR5B 2XGPA 4M8AA 2L4NA 3H4DA 2DJFC 1W93A 1XMOL 4QW9A 4A3DG 1HZ9A 1H9SB 1BF4A 1V1OA 1K1SA 1JWUD 5EPLA 5C3EH 3UDGA 4A3LG 1YNXA 1QG7A 2PI2A 3NXWA 4YCUA 4C1NI 2W9CB 1MGSA 1PTOC 4OONA 4FO2A 4APVA 4DR1Q 2E2HB 2NBFA 4CC6A 4DV6L 4K2KA 2A6EC 1X9NA 1Z7TA 3HFZB 3MXNA 3CCSA 5BPFA 4F4XA 1HPCA 1WJJA 1G6PA 1B44D 1GO3E 2MO0A 4KJOA 1JMCA 1SYBA 2WFWA 1WTWA 3OTOH 1H9SA 2IJ0A 2RDHA 2WAQE 2DY7A 2DPJA 2EY6A 1V9PA 2FINB 4JI0L 1F9PA 3QFFA 2VQFH 3GTLH 3FMCA 3AFPA 4JI6Q 3UDXA 2GPWA 1GKHA 2NVYH 2UVWA 4GNXA 5IT9c 1PLFA 4F7XA 3MWEA 3H15A 2N55A 2BH2A 5BN3A 4RNOA 5DG7A 2PW7A 5KYIA 3RUZA 3RAQA 4OO1G 3JRWA 5KG1A 4DUZH 4C3IG 5E7NA 1I6UA 4LFBQ 1GSAA 1D8LA 3T5HA 2UUAL 1T9HA 5M3FB 4OELB 1X32A 2A69C 2YTVA 3NBHB 3PVXA 1I7NA 1STNA 2L11A 2XCPA 2XC9A 3T53B 4DR3Q 3U9TA 3ND8A 1S10A 5KG5A 4LFCH 4LF7Q 5KT2A 1Q1EA 2WB1B 2QEXA 1N32L 1WFQA 3ETHA 1G291 1XMQH 5IP7G 3B6YA 2QGQA 3LMLA 5C44G 4DV7Q 2B39A 1WD1A 4YIJA 1LUZA 2F0GA 2NVXA 4QJFA 1GXDC 2QDLA 3W1GA 4GKJQ 3W5OA 1KTKA 1TS5A 3RB0A 4OX9Q 1GUNA 3I4NH 1X3PA 4Y7NH 1XTDA 3JAMW 3SI8A 3AQQA 1HRJA 1T5EA 2TMPA 5KFWA 1L0WA 3BQ2A 1SMXA 1Z2PX 3U4ZA 2EXZA 4JI2Q 4JBJA 3HRZC 1WSCA 1U4LA 4TVAB 4ALPA 2A5HA 1VKZA 3J7AK 3NPPA 1HUMA 3E3XA 5DM73 4HR7A 2CVRA 4RB3C 1B6RA 1Y1VB 4OX9H 3A5UA 3D6WA 3GTPA 1Z47A 4UP8A 3J7YW 3D8GA 4K8IA 2JYOA 5DM63 2BOSA 2WKDA 1D1IA 3ICEA 5JUMA 4FBUA 1NCVA 2F3VA 3PMFA 3TREA 1JKJB 3GTKB 3R5HA 4F4ZA 4KKSA 2FJ2A 3VR3A 1EQTA 3DWPA 5FJ8G 1STGA 2YU9H 3M4PA 1VMPA 4EYHB 2IBKA 1NTGA 1S97A 1XMQL 2NVTH 2W6ZA 1AN8A 4X64Q 4WJWA 5I6WA 3ETJA 1SE8A 2R7FA 1EYGA 1GSHA 2UVUA 1YJWA 1CUKA 4IPHA 4TV9F 2FFKB 4ECQA 4B3RH 2KVMA 4OX9L 1PFSA 3PSIA 3CCJA 1SAPA 2JP1A 1KQSA 3R5XA 4FBTA 4DV1L 5D1PA 1CT1D 4HJ7A 2W6QA 2PYKA 4IZ8A 2ASLA 1Y14B 1CA5A 4LUZA 3HOVH 1IOVA 5I9PA 5C4JB 1B4OA 3V6KA 4X62L 1E2WA 4ZAIA 1VQOA 1VQIA 1JOQA 5EPJA 1B3AA 1TWFH 4JI5Q 4BBSH 2K7VA 5CR3A 4B9WA 1Q8KA 2HCIA 3LGJA 2F0SA 5FJ8H 5IIFA 4HNVA 3M4IA 1VMCA 1FL0A 3E9IA 1PYSB 3FVQA 1ET9A 2EY5A 2HVRA 5IE8A 1TWFA 1O7IA 2Z0SA 3GTJB 1TWCB 5FLXE 5IYBG 4POFA 1XMQQ 2IHFA 1KL9A 2PQEA 1NUCA 4YB8B 1X3GA 1C8CA 1OTCA 1EU3A 2B63B 2K75A 2A19A 1I3QA 2KQ3A 3A7LA 2OCEA 4MTKA 1ILPA 2KBNA 1B33N 3AEVA 5EKKA 3H94A 1PH1A 5CA0F 4LF8H 4EQNA 1XWEA 4Q0YA 4XZ3B 2JA5G 2W6MA 5A2QW 1RYRA 2WE6A 4DV7L 3HOWB 3M9NB 3I3CA 4UCRA 1Y8OB 3VR4A 2JSOA 3HOYB 3BVMA 5CV9A 2RDIA 4QY7A 1B8AA 3GV5B 4MTNA 5ELCA 3IFDA 2E2HA 4O1NA 2R7DA 2IT1A 3V4ZA 1J6QA 3R23A 2A6HD 2I80A 5JEAG 1S72A 4IPDA 3CRKC 4HTHA 1W6JA 2EYMA 1OWTA 2FPIB 2DNCA 2E2IB 1V1PA 3L0OA 3G6JB 1MD2D 4DFAA 4ODGA 3SK5A 3EROA 2R84A 1WYDA 1B70B 4B3SQ 1B7YB 2NVYA 4J8QA 4L5RC 4LUVA 4TQUS 1JCKB 3RZOH 1L1OC 3H09A 1RTNA 4A93B 3PIP3 1PYBA 4LF7H 3NWSA 4QIWB 4XDXA 4ZUJA 3MFGA 4A3JB 1E1TA 1L0YB 4MN3A 5C44H 1JB7A 4AYBG 2D9UA 2F3WA 4A93H 1DONA 1SJHD 5KG7A 5KFDA 4MA0A 2UXCH 3N40P 1BCPF 2RSOA 4DL5A 4PQXA 1SN8A 3L9AX 2RKSA 2F0PA 1LT6D 1PFNA 3NENA 2ZJPA 2KCMA 4G7HC 4F4WA 4J9SA 2LY7A 5KFRA 1VQPA 1A63A 2KCTA 1CKNA 4MA5A 4RHRA 2EIFA 1SMYC 4EBDA 4CKCA 3PO3H 3MWMA 4J9RA 3GIKA 3J80c 3J80E 1BGWA 2NU6B 4CJ1B 2RCNA 5KG6A 2K5VA 4HN7A 3OWEB 1F2MA 4A3DH 3FDTA 1O7YA 1TWHB 1S5CD 4IOCA 5LXTF 4KHPL 2RHQB 3J81L 2OWOA 1KJ9A 3NSWA 2QDBA 1OXVA 2ZM6L 3VPBA 2RGRA 2B3GA 4EQPA 3H4BA 1RJQA 2C35B 2J6TA 1RCVD 3VMMA 2KCNA 3HEJA 2BE5D 3M4QA 3PCOB 4DK6C 4ZYSA 5IP9H 5IOCA 2JXMB 3G8CA 3VR6A 1EEFD 5CBAE 5LL6X 1WCMA 5I2YA 4OO1I 4CDCC 1C3OA 2Q2UA 2F4VL 1P16A 1LABA 4B3SH 1RKNA 1PX2A 1NY4A 4DR7Q 1S5ED 2Z1CA 5JJIA 1B9MA 4I7AA 2KCCA 1BR9A 4N9PA 4XYOA 4DAVA 1JX4A 4TV8F 1XJVA 4Q43A 4DR4H 3MA2B 1CM9A 3MTSA 2Y0SG 1CSPA 5KFHA 4UCTA 3BG5A 4A4IA 3NWTA 4A3EG 5I6YA 4FYDA 1G91A 1IW7D 4B9XA 4UHVA 5DLFA 3D6CA 2X6GA 1VQFA 1FJGQ 2VY3A 3X3NA 4LF6L 4X3UA 1VQBA 4TRDA 4A3KB 2OEOA 4NDXA 2ZJQA 5D65A 3CC2A 1VCIA 3A55A 4IPGA 4N9TA 1E1OA 2NWGA 2L1BA 3HKSA 3PUYA 4U68A 2PQAB 2GPSA 1U4PA 3F1ZA 4HNUA 4MTDA 1GSOA 3WNZA 2EYLA 2L15A 3FDSA 2HDMA 4JUZA 3KK7A 5KG3A 4YR3A 4YY3L 1Q86C 3EIVA 1ZHQA 3T1HQ 3S14H 4ECYA 1YBYA 4N8X1 3BDLA 2W8LA 3GTOB 4O0AA 2UVRA 2F0OA 2NTTA 2B2WC 1JB3A 4A3FH 2ICIA 5FLMG 1NE3A 4CHTB 3R2IA 1EWCA 1JQYD 4JI2L 1HHVA 2EY2A 3H0GG 4L8JA 4DPGA 1O78A 2QK4A 4RB2C 3A7AB 2ZM6Q 3A8KE 2VS1A 4HJ5A 2R7ZB 4A3BH 4DK0A 3KAJA 4KY5A 2A8VA 2K01A 4O4IF 1K8MA 2A68C 4OO1H 4QCLA 4GLXA 1J9OA 1OXSC 4XT1B 2K14A 5M5WH 5ELFA 2OXPA 3AFQA 5IT9W 1CSQA 4LFBL 4OIKA 1AUVA 1BKBA 1GUGA 3PUWA 4B3MQ 1VDZA 3LWEA 3QWNA 4DV2Q 1PZKD 4FM9A 4FXKC 4KN7C 4JI7Q 1B9NA 1MI2A 3I2ZA 2W6NA 2NU9B 2EYJA 4LF6H 3BDOA 2FPPB 1EY7A 5F9LA 1KNAA 3ORQA 4G3IA 2RA4A 4JBKA 4UDUC 4JV2A 1XNRH 4N8FA 2O2LD 4Y52H 3R8BA 1VQ8A 4MV1A 2EXDA 4JI3Q 1YNJC 3X3MA 1EQVA 2F0FA 2WAQB 3GIDA 4GKKL 2NU7B 1SE4A 2FLNA 2FMMA 4PZ8A 1RTOA 3NP8A 3S1MB 3FPPA 3LNNA 5M5YH 3Q1KA 3J7A5 1KNEA 4G7ZC 1IBMQ 5COYA 1PH9A 2VA2A 4JV5H 3CMEA 2K32A 2YYZA 2ZJTA 3S1QH 1K3RA 4MV6A 1A15A 1OXTA 2DJGC 3TP8A 1GUOA 5EWFA 1ENFA 3S14B 2EDGA 4A3MH 4K5VA 4R8NA 1ZHSA 1JDEA 4YCWA 1KRTA 1HTLD 5HY6A 4XX0B 4ZOLF 2D5DA 3OIPA 1L1OA 3SGIA 2W71A 4AQYQ 3QJYA 4YBZB 3MEFA 2W7OA 5NUCA 5KGUA 2N78A 3EBEA 3SK6A 1VQ6A 4OWWB 1SE2A 2UU9L 3T1YQ 1JT8A 3BJYA 4EYIB 3HZXA 4U6PA 2E2HH 1II3A 4ED2A 5KYLA 4YR2A 1PH4A 1EQRA 1STHA 1JWMD 5M3MG 2EVBA 5K36G 1S3OA 1M6VA 4FXDA 4LFAQ 2LMCB 4JC0A 2F0JA 1M4VA 1PVOA 2F0EA 2AUKA 4ZQIA 3C0FB 4JV0A 4G57A 2W6PA 2V4DA 1NR4A 1ICWA 1ESRA 3C3LA 4C56C 4GKJH 1IBLH 4EVOA 1YHQA 4QWBA 2B2TC 1I6HB 2DZDA 3KHGA 2AQ4A 4QGUA 1HFNA 3OHAA 1IZ6A 4GLVB 2K03A 5IYZF 1WTRA 1E0BA 1I3QH 2L0CA 1PV4A 1OXXK 4YAKB 5J22A 1SCUB 2F0TA 4KHPH 4LF5H 2AWNA 3ERQA 3T5JA 2JK8A 2B2UC 2A1AA 2RBMA 3J81j 5C0XJ 2E2IH 4GKKQ 2F0KA 1FNVA 2W6OA 1K3BC 4ZKCB 4OL7A 3NE5B 4I7HA 4M9UA 1I7LA 3S1QB 5JOBA 4LFAH 3BA8A 1ENAA 4A3DB 1L0XB 4LH6A 2BQUA 1LTBD 2XVSA 2UXDL 2J9GA 4YWLA 4RKBA 5IWAQ 3MC0B 4XXEA 2O5JC 5FLMH 4APMA 4H44C 4X65Q 3MR2A 4J9QA 4UCUA 5J1ZA 4EGVA 3NHHA 2C22A 1QZHA 1TQOA 1FVIA 2JJQA 3GTJH 4O3NA 1QUQA 2KHSA 4X3TA 3TINA 1IKMA 5KNCA 3HOZH 1XPUA 3L3OC 3RGZA 4O42A 1BCPC 3M4OB 3UDIA 1MSHA 1T3NA 2ALYB 2PVPA 4IZOA 2DN8A 1FYCA 1CQIB 2WB1G 2CQAA 3CPFA 3HKZB 4BY7G 1I3QB 3MR3A 1E2VA 2I5MX 2WV6D 4RMFA 4HJ9A 1GM5A 1EQQA 4O4HF 4UCSA 3BG3A 5C44B 1ZYRC 3CU7A 5KG0A 4HIOA 4QWDA 2F3IA 1ML0D 4NLGA 2F0QA 3RLFA 2W7PA 5M5WB 1BNCA 2K5DA 2I0QA 2UXBH 4RNMA 3T5KA 4LWCA 5DEHA 4A3BG 1E22A 2R61A 4DL7A 1I50H 2W70A 4IFDI 3E5NA 4DAYA 3OW2A 2R93G 1TVXA 1VQ4A 4QUCA 1EOVA 5KFPA 1R9TB 2X69A 2HHHL 2R92H 3HOVB 4DL2A 1Y1VG 4KJNA 3TP6A 2AWOA 5M3MH 1KDBA 5K36H 4DR7L 4DAPA 4H13C 1L1OB 3TN2A 2CZGA 3OSNA 4F50A 1S03G 4YY3H 3GTKH 1N33H 3T4AC 1E4EA 1S0MA 3KOJA 3VYTA 5C0XH 2K5WA 4LSXA 5KFKA 3RLNA 4LSAA 4ED0A 2KOLA 4LF7L 3HOUB 4BXXH 2JEJA 3QIAA 4RGOS 2E5LL 3J81E 3CCEA 4ZHQF 3V4SA 4DL4A 1MJEA 3K0YA 1HR0H 1VQ7A 1A0IA 2Z6KC 2YYAA 1LT5D 1FJGL 3TS2A 1EIHA 3RIZA 2XIWA 1U4MA 2WIIB 2XCLA 1A9XA 4DR1H 4QW8A 1KLUD 2N3SA 2HHHH 1SEIA 1RJPA 5L1IA 3GD7A 1Y1VA 4HAEA 3K5MA 3K3PA 3I4NB 2F1MA 3DMUA 1JJ2A 5J2UF 2JA6B 2NB0A 2VQDA 5JEAJ 4QUFA 4NMZA 4PMCA 1KJJA 1I6VC 1TAEA 1Y1VH 4LNQA 3GV7B 4F4YA 1HNXH 3CCUA 3DEPA 4RZQA 1Y8NB 1PH3A 2VR1A 5LMUQ 2XCAA 1NNXA 1SMYD 2O4XA 1HXYD 5IWAL 2Z6KA 5LHY1 2V4RA 4IUTA 1PH5A 5KFIA 3I8ZA 3OTOL 3O13A 1RIPA 3J80L 5M3FH 3KXYT 3BVGA 1LYLA 4H02A 1K8AC 3RNUA 3HKZG 3H20A 3UFXB 4JI4H 4DR7H 2RDGA 3EFXD 1YJNA 3DUZA 1TS2A 5ISRA 1SRUA 5D3IB 4A3GB 2WYOA 1JE4A 4HIMA 4YJ2F 1D5MC 3E0JA 5KFCA 1NMFA 2WB1A 1G2SA 5IGDA 3S9WA 3RZDH 3KLSA 4IURA 1EFWA 2UXDQ 4R7RA 1HNXL 1PZID 1ZEQX 4A75A 1XMOQ 2EPBA 1ASZA 1VQNA 2YRXA 1D5XC 2JA5B 3T1YH 3S17B 2XRQD 3D0FA 3TP5A 4A3BB 2GVBA 3HOWG 4LF4Q 3N6RA 1QOHA 2PN1A 2I5LX 4HCEA 4YHHL 3TMEA 2MGSA 3CCMA 3G48A 5IY0A 1HA5A 2YU9B 3BVZA 2JEGA 4GOPC 4L5TA 1BQQT 2VQFQ 4O3QA 2ZTEA 3A5ZB 3MWYW 4IQZA 4JW0A 2ICEC 2IX1A 2Z9HA 3CCRA 2FLLA 4JI7H 2DNEA 1Z2OX 1M0TA 1N48A 3SK8A 4FXGC 2AGOA 3PW7A 4IHJF 1T5XD 2C2RA 4BBRB 1S4ZA 3G6XA 1SYCA 5LL6S 2MCTA 3GTMA 5LMNQ 1WI5A 5JEAH 4JYAQ 2JN4A 4KY7A 4U673 1BBXC 2E5LQ 3ER0A 5I9OA 4M7EA 4I50F 3I90A 3J81c 3T56B 1ZKOA
chains in the Genus database with same CATH topology
3HOYG 2AMCB 3UDFA 4A93G 1K9MC 4LF4L 4BBRG 3L0OA 1U5KA 3I4MH 1JE5A 3ULLA 3PUVA 2JA7G 5IYDH 1VQ9A 4JG2A 1WYDA 4BY1H 1B70B 4B3SQ 1C0AA 2VUMH 5H1SE 1B7YB 4L5RC 5DLQE 4LUVA 2VZAA 4TQUS 3RR5A 4DV1Q 2WB1E 3RZOH 2XTIA 2EQSA 2VQEL 1L1OC 4B3TQ 4NXNQ 2HQLA 2CWAA 1PYBA 4R4OA 4RG1A 3J81i 3KJOA 4BY1G 2UXBQ 1WCMH 4DNIA 1XNRQ 1KXLA 4DUZL 1E1TA 3GTQH 4A3KG 5C44H 4EX5A 4JI6L 1JB7A 1D7QA 4AYBG 4A93H 3IRBA 4JV5L 5M5XH 1J5EQ 3PIPA 4C3IH 4BY7H 1YIJA 2OQ0A 3CF5A 3TQYA 5IYDG 1SN8A 2GN5A 1IBLL 3KFUA 3M4OH 4DR6Q 5LMNL 4IFDJ 2I5HA 2CQOA 4A3CH 1BBWA 3NENA 2ZJPA 4WJ4A 2KCMA 4DV5Q 3K80C 1TXYA 2NZHA 2KENA 1QVFA 1MIUA 3PO2H 4X66L 1VQDA 2D0OA 1VQPA 2KHIA 1A63A 2KCTA 4X64L 3S24A 1CKNA 2EIFA 4GNXB 3PO3H 3E0EA 3J80c 1PA6A 3A0JA 3FHWA 4IJHA 1KAWA 4HJAA 1A62A 3F2DA 2RCNA 1QUQB 2CKZB 2RHSB 2K5VA 1GD7A 4GN5A 1K0RA 4A3DH 4LF8Q 1HNWL 1UE7A 1YHBA 2B63H 1N9WA 1N34L 1LTLA 4DV5L 3A74A 1EUJA 2VNUD 1CKOA 4IOCA 1XPRA 2UUCL 4KHPL 4QQBX 2RHQB 4P75A 1KHIA 2OWOA 2F52A 1OXVA 2ZM6L 4AIMA 2B3GA 4DV6Q 3CCLA 2C35B 4C3JH 4A3CG 4GN4B 4P72A 1N32Q 3CAMA 4IOAA 3M4QA 3PCOB 5IP9H 4DK6C 4DKAC 4A3KH 4GLAC 3PO3G 1XNQQ 3S2DH 1FGUA 1CKMA 4PZ6A 4GKJL 4OO1I 4LF6Q 1N36Q 1BBUA 1C7YA 2Q2UA 2F4VL 1P16A 1PHJA 3PGZA 4A3JH 1C9OA 4LFAL 3KJPA 3F8TA 4B3RL 1NY4A 4DR2Q 3CMAA 4DR7Q 1I6HH 4YHHQ 5JJIA 4KI0A 4JI1L 1XJVA 1E24A 2Y0SG 1CSPA 3S16H 1VQGA 1KC8C 2MO1A 4A4IA 2IHEA 4K0KQ 1XNRL 1AE2A 4A3EG 4LF5L 2R7ZH 5C4JH 3L2PA 1JJGA 4DAYB 1VQFA 3BU2A 1FJGQ 2VY3A 3PUZA 4LF6L 4IFDG 1VQBA 1HNZL 3M9BA 1UWVA 2BH8A 5JJLA 2ZJQA 2K4KA 3CC2A 1VCIA 4IPGA 3Q8DA 4GN3B 2CFMA 5GADC 1E7ZA 4PZ7A 1E1OA 3PUYA 4EQ5A 1HZAA 2PMZE 3HKSA 3G6EA 2PQAB 4DV0Q 2ASBA 2UXCQ 3HOXH 1VQKA 1GVPA 3F1ZA 1YJ9A 2IX0A 3PIOA 4X66Q 4DR5Q 4JOIA 1YEZA 1UEBA 1I5FA 1VQCA 2L15A 3RN2A 2RF4A 1XNQL 4XTCS 5ELOA 4YY3L 1Q86C 3EIVA 3T1HQ 3S14H 1N36L 1U0LA 1YBYA 3HOXG 2JA8H 4O0AA 3CCQA 2OTLA 2JA6H 2JEBI 4X6AH 3DM3A 2CCZA 2R7ZG 1YHAA 4KHZA 4JI8Q 3NEMA 1PH8A 4A3FH 5FLMG 1M1KC 2JA8G 1NE3A 2NZOA 5GQOA 4X65L 4DR4Q 1DGSA 4JI2L 3GTOH 3S1MH 2E8GA 4BBRH 1IBKQ 4C3HH 2E2JH 1Q12A 3H0GG 2BA0A 4DPGA 2UXBL 2ZM6Q 4HJ5A 1TWCH 2VS1A 4PG3A 4YY3Q 4R1JA 4A3BH 4LUOA 1N33Q 4KLKA 3BJUA 2A8VA 1X55A 1IYJB 1S40A 1HNZQ 3CD6A 3HOUH 4JV5Q 4NB3A 3S1NH 4B3SL 4GLXA 4J15A 5GAEC 1OXSC 5M5WH 2K14A 5BR8L 4DK3C 1IBLQ 4DR6L 2K5NA 1HNWQ 3AFQA 2YTXA 5HGQA 1CSQA 4DV0L 4LFBL 3KF8B 4HIKA 3KDFB 2H5XA 3UE0A 1BKBA 2D0PA 3PUWA 1PH6A 4YWMA 1VQLA 4B3MQ 4FDBA 2MFIA 2F4VQ 4DV2Q 4WJ3M 4P71A 2WP8J 4JI7Q 3I2ZA 2WAQG 2DGYA 3AYHB 4LFCQ 5IYCH 4BA2I 2Q2IA 1MKHA 3M85A 4JI4Q 3PO2G 3K7UC 3H0GH 5LMUL 1V1QA 2NVQH 4JBKA 1QVCA 5IP9G 3STBC 1W2BA 5EAYA 1KD1C 3RN5A 4Y52H 1K83H 3H3VH 3U50C 1RL2A 3TEHB 4A3MG 1VQ8A 3HOZG 2EXDA 2VUMG 2R6GA 4JI3Q 4LF9L 2UUBL 1IBKL 3GTPH 3CQZH 2JA7H 4B3RQ 4GKKL 3J80i 4PZ8A 5C4XG 4X62Q 2Q2HA 5M5YH 3J7A5 1IBMQ 2Q2TA 3GO5A 1PH9A 4L5SA 1G51A 3CMEA 3STBD 2HIXA 2YYZA 4A76A 3S1QH 1K3RA 4L5QA 1OXTA 4MNOA 3FKIH 4JI4L 1Z9FA 2NN6I 2PI2E 2KHJA 1N8RC 1HJPA 3GTMH 4A3MH 4AYBE 3F2BA 2UUAQ 4YCWA 4HJ8A 1KRTA 2UUCQ 3I4MG 5HY6A 3PV0A 3SGIA 1L1OA 1CKNB 4DR2L 4AQYQ 4JCVE 4QL5A 3MEFA 1PH7A 4POGA 5ELNA 3ULJA 2PNHA 2FXQA 2N78A 3EBEA 2VQEQ 3UE1A 1Y1WH 1HR0Q 1IBML 4OWWB 2UU9L 3T1YQ 5JJKA 1JT8A 4JBWA 3F2CA 1VQAA 3FP9A 1H95A 1Y1WG 1EWIA 1SFOH 3EN2A 2E2HH 1HNXQ 3M3YH 3VDYA 5M3FG 3PF4A 1PH4A 1EQRA 2ES2A 4IJLA 2YV5A 3M7NA 2YTYA 5M3MG 5K36G 4LF9Q 2JA9A 1S3OA 4UP9A 4R4TA 3DLLA 1HH2P 5C4XH 1J5EL 3L7ZC 4LFAQ 3I56A 1XPOA 1Q81C 4C2MH 3D31A 5AJ3L 4JC0A 4P74A 1PVOA 1UE5A 1TWAH 4A3FG 1ASYA 1I94L 2VW9A 4DUYL 1WOCA 1HR0L 1OXUA 5LMNW 1X65A 1YVCA 2MNAA 3MXNB 2D62A 3BZKA 1YHQA 2JEAI 1Q46A 5J3BA 4JI7L 4QGUA 2GVAA 1R9TH 1IZ6A 3GDEA 1IL2A 4MZ9A 4GLVB 4A3EH 2AHOB 4XIGS 3S1RH 1I3QH 4JOIC 1L2FA 5GAGC 1QZGA 1PV4A 1OXXK 2LXJA 2JE6I 2ZJRA 3ULPA 2ZTDA 3K81C 4NPSA 4JI8L 4OXPA 3CP0A 1HR0W 1XMOL 4A3DG 2IY5B 1HZ9A 2AWNA 1I94Q 2UU9Q 2B29A 2VL6A 2HIVA 2JK8A 5C3EH 2A1AA 2ID0A 3UDGA 4A3LG 1WCMG 1YNXA 2PI2A 3KF6A 4YCUA 3J81j 5C0XJ 2E2IH 4GKKQ 4OONA 1UE6A 4A3IH 1LM0A 4LFCL 4APVA 4DR1Q 1K73C 4UP7A 5IYBH 4DV6L 1VQ5A 1X9NA 3S2HH 1MJCA 2N8NA 2BA1A 3HFZB 3CCSA 1EFWA 2OTJA 4A3LH 4LW1A 1WJJA 3JAMi 2JA6G 2UXDL 1YI2A 1GO3E 2MO0A 4YWLA 1G6PA 4DV3Q 5IWAQ 1JMCA 1YZ6A 5FLMH 2WFWA 4X65Q 4DR4L 4DAMA 4YWKA 3S15H 4HIDA 1QZHA 2WAQE 1FVIA 2JJQA 3GTJH 3U58A 1QUQA 1V9PA 3ZJYC 4GOPB 2JA5H 4JI0L 1P8LA 3GTLH 3AFPA 4JI6Q 3UDXA 4AQYL 4A3IG 3HOZH 1GKHA 2NVYH 5C3EG 1XPUA 4GNXA 5IT9c 2UXCL 4BBSG 3H15A 5C0XI 3UDIA 4NXMQ 2BH2A 2ALYB 3JAMc 4DR5L 5BR8Q 4OO1G 5C0XG 2WB1G 3CPFA 4BY7G 5E7NA 4LFBQ 2I5MX 4RMFA 4HJ9A 1GM5A 1AH9A 1HZCA 1D8LA 1EQQA 2UUAL 2K52A 3FKIG 1T9HA 4OWTB 4DV2L 4HIOA 3S17H 5AJ3Q 2F3IA 2YTVA 1Q7YC 3NBHB 1QVGA 4A3GG 1KIXA 3K8AA 3RLFA 4DV4L 3ERSX 2K50A 4DR3Q 3JC66 4P73A 1HZBA 2I0QA 4LF7Q 4A3GH 1Q1EA 2QEXA 1KRSA 1W3SA 1N32L 1WFQA 1G291 4LWCA 2XGTA 4A3BG 5IP7G 3B6YA 2QGQA 1E22A 5C44G 4DV7Q 3TS0A 3HOUG 1YITA 1I50H 1LUZA 4IFDI 4QJFA 1VQMA 2B63G 3W1GA 3CPWA 4GKJQ 2UXDQ 3W5OA 3OW2A 2R93G 1VQ4A 3U4VA 4GNXC 1EOVA 4QIWE 2HHHL 2R92H 4OX9Q 1Y1VG 4OWXB 2AWOA 2LSSA 5M3MH 1VQ6A 4Y7NH 3I4NH 1L1OB 2NVXH 1XTDA 4DR7L 3AQQA 1TWGH 3GTKH 1L0WA 4DR3L 3KOJA 4R4CA 1SMXA 3RLNA 3U4ZA 2K5HA 1Q1BA 4JI2Q 4JBJA 4LF7L 4BXXH 4TVAB 3I55A 4ALPA 2ZTCA 1M90C 2E5LL 3CCEA 3I4NG 4DUZQ 4GOPA 1MJEA 3I4OA 3HOYH 1VQ7A 3A5UA 1A0IA 2HT1A 1N33L 2Z6KC 2N49A 1Z47A 1VQHA 4UP8A 5GROA 3E9HA 1FJGL 3TS2A 3ICEA 3TREA 2N3SA 1VS0A 1NJIC 3CC7A 1X6OA 4DV3L 3GD7A 3WWVA 3OYYA 3CW2C 2Y0SE 1N34Q 3OTOQ 1JJ2A 5FJ8G 4JI3L 2YU9H 3M4PA 1NTGA 2R93H 1X3EA 1XMQL 5JEAJ 2NVTH 4X64Q 1VQEA 1Y1VH 1SE8A 2AKWB 2R7FA 3G4SA 3CCUA 4DR1L 1YJWA 1CUKA 1EYGA 1EIFA 1A8VA 3KYHC 4IPHA 1PH3A 4UY8C 1EIYB 3T1HL 2HHHQ 1AE3A 5LMUQ 4OX9L 1PFSA 3HKZE 3PSIA 3HOWH 4UPAA 3CCJA 1UE1A 1KQSA 5IWAL 2Z6KA 2QA4A 4DV1L 1PH5A 4HJ7A 1PH2A 1Y14B 3KLWA 4LUZA 2PQAA 1RIPA 3OTOL 4A3JG 3K0XA 5GAHC 5M3FH 2UUBQ 3HOVH 1LYLA 4H02A 1K8AC 3NELA 3HKZG 3RNUA 4KHPQ 5IP7H 3W1BA 4JI0Q 2OQKA 4DV4Q 4GS3A 4X62L 1YJNA 1VQOA 1VQIA 1IXRA 1SROA 1SRUA 1TWFH 2VQFL 4JI5Q 4BBSH 1Q8KA 4IPCA 1X56A 3LGJA 5FJ8H 1NMFA 3CXCA 1SR3A 4HIMA 4K0KL 1FL0A 3E9IA 4BA1I 1PYSB 1NBWA 1NMGA 3CCVA 3RZDH 4IO9A 1HNXL 3I7FA 1JJCB 1E3PA 4A75A 1XMOQ 1K8GA 1ASZA 1VQNA 5IE8A 4LF8L 3D0FA 1O7IA 2Z0SA 2GVBA 3BZCA 4LF4Q 5IYBG 2LXKA 5FLXc 3HOWG 4POFA 3TRZA 2DUDA 4R4QA 1XMQQ 2IHFA 2I5LX 1KL9A 4O2DA 2CWPA 2JQOA 4PMWA 1BVSA 1TWHH 1X3GA 4YHHL 1OTCA 2K75A 3G48A 5IY0A 3CCMA 2ATWA 2A19A 2MQHA 3HOVG 2OCEA 2KBNA 4JYAL 3AEVA 4GOPC 4JBMA 1PH1A 4L5TA 1SLJA 3T1YL 4DUYQ 4JI5L 2VQFQ 4NXNL 2ZTEA 3A5ZB 4R4IA 4ME3A 2JA5G 3CC4A 4NXML 2IX1A 4DV7L 3J7ZC 3CCRA 3RLOA 3KDFA 1X54A 4AH6A 1V43A 4B3ML 2NN6G 2R92G 3GTGH 3G71A 4QY7A 1B8AA 4MTNA 3PUXA 3PF5A 4YCVA 4LNQA 5LMNQ 2R7DA 1WI5A 5IYCG 4JYAQ 2IT1A 1X3FA 4JI1Q 1Q82C 2V1CC 4B3TL 4BXXG 3KF6B 1J6QA 3H3VI 3K7AH 2E5LQ 3ER0A 5JEAG 1VQJA 1S72A 4IPDA 3J81c 4LF5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY G;  2AMC B;  3UDF A;  4A93 G;  1K9M C;  4LF4 L;  4BBR G;  3L0O A;  1U5K A;  3I4M H;  1JE5 A;  3ULL A;  3PUV A;  2JA7 G;  5IYD H;  1VQ9 A;  4JG2 A;  1WYD A;  4BY1 H;  1B70 B;  4B3S Q;  1C0A A;  2VUM H;  5H1S E;  1B7Y B;  4L5R C;  5DLQ E;  4LUV A;  2VZA A;  4TQU S;  3RR5 A;  4DV1 Q;  2WB1 E;  3RZO H;  2XTI A;  2EQS A;  2VQE L;  1L1O C;  4B3T Q;  4NXN Q;  2HQL A;  2CWA A;  1PYB A;  4R4O A;  4RG1 A;  3J81 i;  3KJO A;  4BY1 G;  2UXB Q;  1WCM H;  4DNI A;  1XNR Q;  1KXL A;  4DUZ L;  1E1T A;  3GTQ H;  4A3K G;  5C44 H;  4EX5 A;  4JI6 L;  1JB7 A;  1D7Q A;  4AYB G;  4A93 H;  3IRB A;  4JV5 L;  5M5X H;  1J5E Q;  3PIP A;  4C3I H;  4BY7 H;  1YIJ A;  2OQ0 A;  3CF5 A;  3TQY A;  5IYD G;  1SN8 A;  2GN5 A;  1IBL L;  3KFU A;  3M4O H;  4DR6 Q;  5LMN L;  4IFD J;  2I5H A;  2CQO A;  4A3C H;  1BBW A;  3NEN A;  2ZJP A;  4WJ4 A;  2KCM A;  4DV5 Q;  3K80 C;  1TXY A;  2NZH A;  2KEN A;  1QVF A;  1MIU A;  3PO2 H;  4X66 L;  1VQD A;  2D0O A;  1VQP A;  2KHI A;  1A63 A;  2KCT A;  4X64 L;  3S24 A;  1CKN A;  2EIF A;  4GNX B;  3PO3 H;  3E0E A;  3J80 c;  1PA6 A;  3A0J A;  3FHW A;  4IJH A;  1KAW A;  4HJA A;  1A62 A;  3F2D A;  2RCN A;  1QUQ B;  2CKZ B;  2RHS B;  2K5V A;  1GD7 A;  4GN5 A;  1K0R A;  4A3D H;  4LF8 Q;  1HNW L;  1UE7 A;  1YHB A;  2B63 H;  1N9W A;  1N34 L;  1LTL A;  4DV5 L;  3A74 A;  1EUJ A;  2VNU D;  1CKO A;  4IOC A;  1XPR A;  2UUC L;  4KHP L;  4QQB X;  2RHQ B;  4P75 A;  1KHI A;  2OWO A;  2F52 A;  1OXV A;  2ZM6 L;  4AIM A;  2B3G A;  4DV6 Q;  3CCL A;  2C35 B;  4C3J H;  4A3C G;  4GN4 B;  4P72 A;  1N32 Q;  3CAM A;  4IOA A;  3M4Q A;  3PCO B;  5IP9 H;  4DK6 C;  4DKA C;  4A3K H;  4GLA C;  3PO3 G;  1XNQ Q;  3S2D H;  1FGU A;  1CKM A;  4PZ6 A;  4GKJ L;  4OO1 I;  4LF6 Q;  1N36 Q;  1BBU A;  1C7Y A;  2Q2U A;  2F4V L;  1P16 A;  1PHJ A;  3PGZ A;  4A3J H;  1C9O A;  4LFA L;  3KJP A;  3F8T A;  4B3R L;  1NY4 A;  4DR2 Q;  3CMA A;  4DR7 Q;  1I6H H;  4YHH Q;  5JJI A;  4KI0 A;  4JI1 L;  1XJV A;  1E24 A;  2Y0S G;  1CSP A;  3S16 H;  1VQG A;  1KC8 C;  2MO1 A;  4A4I A;  2IHE A;  4K0K Q;  1XNR L;  1AE2 A;  4A3E G;  4LF5 L;  2R7Z H;  5C4J H;  3L2P A;  1JJG A;  4DAY B;  1VQF A;  3BU2 A;  1FJG Q;  2VY3 A;  3PUZ A;  4LF6 L;  4IFD G;  1VQB A;  1HNZ L;  3M9B A;  1UWV A;  2BH8 A;  5JJL A;  2ZJQ A;  2K4K A;  3CC2 A;  1VCI A;  4IPG A;  3Q8D A;  4GN3 B;  2CFM A;  5GAD C;  1E7Z A;  4PZ7 A;  1E1O A;  3PUY A;  4EQ5 A;  1HZA A;  2PMZ E;  3HKS A;  3G6E A;  2PQA B;  4DV0 Q;  2ASB A;  2UXC Q;  3HOX H;  1VQK A;  1GVP A;  3F1Z A;  1YJ9 A;  2IX0 A;  3PIO A;  4X66 Q;  4DR5 Q;  4JOI A;  1YEZ A;  1UEB A;  1I5F A;  1VQC A;  2L15 A;  3RN2 A;  2RF4 A;  1XNQ L;  4XTC S;  5ELO A;  4YY3 L;  1Q86 C;  3EIV A;  3T1H Q;  3S14 H;  1N36 L;  1U0L A;  1YBY A;  3HOX G;  2JA8 H;  4O0A A;  3CCQ A;  2OTL A;  2JA6 H;  2JEB I;  4X6A H;  3DM3 A;  2CCZ A;  2R7Z G;  1YHA A;  4KHZ A;  4JI8 Q;  3NEM A;  1PH8 A;  4A3F H;  5FLM G;  1M1K C;  2JA8 G;  1NE3 A;  2NZO A;  5GQO A;  4X65 L;  4DR4 Q;  1DGS A;  4JI2 L;  3GTO H;  3S1M H;  2E8G A;  4BBR H;  1IBK Q;  4C3H H;  2E2J H;  1Q12 A;  3H0G G;  2BA0 A;  4DPG A;  2UXB L;  2ZM6 Q;  4HJ5 A;  1TWC H;  2VS1 A;  4PG3 A;  4YY3 Q;  4R1J A;  4A3B H;  4LUO A;  1N33 Q;  4KLK A;  3BJU A;  2A8V A;  1X55 A;  1IYJ B;  1S40 A;  1HNZ Q;  3CD6 A;  3HOU H;  4JV5 Q;  4NB3 A;  3S1N H;  4B3S L;  4GLX A;  4J15 A;  5GAE C;  1OXS C;  5M5W H;  2K14 A;  5BR8 L;  4DK3 C;  1IBL Q;  4DR6 L;  2K5N A;  1HNW Q;  3AFQ A;  2YTX A;  5HGQ A;  1CSQ A;  4DV0 L;  4LFB L;  3KF8 B;  4HIK A;  3KDF B;  2H5X A;  3UE0 A;  1BKB A;  2D0P A;  3PUW A;  1PH6 A;  4YWM A;  1VQL A;  4B3M Q;  4FDB A;  2MFI A;  2F4V Q;  4DV2 Q;  4WJ3 M;  4P71 A;  2WP8 J;  4JI7 Q;  3I2Z A;  2WAQ G;  2DGY A;  3AYH B;  4LFC Q;  5IYC H;  4BA2 I;  2Q2I A;  1MKH A;  3M85 A;  4JI4 Q;  3PO2 G;  3K7U C;  3H0G H;  5LMU L;  1V1Q A;  2NVQ H;  4JBK A;  1QVC A;  5IP9 G;  3STB C;  1W2B A;  5EAY A;  1KD1 C;  3RN5 A;  4Y52 H;  1K83 H;  3H3V H;  3U50 C;  1RL2 A;  3TEH B;  4A3M G;  1VQ8 A;  3HOZ G;  2EXD A;  2VUM G;  2R6G A;  4JI3 Q;  4LF9 L;  2UUB L;  1IBK L;  3GTP H;  3CQZ H;  2JA7 H;  4B3R Q;  4GKK L;  3J80 i;  4PZ8 A;  5C4X G;  4X62 Q;  2Q2H A;  5M5Y H;  3J7A 5;  1IBM Q;  2Q2T A;  3GO5 A;  1PH9 A;  4L5S A;  1G51 A;  3CME A;  3STB D;  2HIX A;  2YYZ A;  4A76 A;  3S1Q H;  1K3R A;  4L5Q A;  1OXT A;  4MNO A;  3FKI H;  4JI4 L;  1Z9F A;  2NN6 I;  2PI2 E;  2KHJ A;  1N8R C;  1HJP A;  3GTM H;  4A3M H;  4AYB E;  3F2B A;  2UUA Q;  4YCW A;  4HJ8 A;  1KRT A;  2UUC Q;  3I4M G;  5HY6 A;  3PV0 A;  3SGI A;  1L1O A;  1CKN B;  4DR2 L;  4AQY Q;  4JCV E;  4QL5 A;  3MEF A;  1PH7 A;  4POG A;  5ELN A;  3ULJ A;  2PNH A;  2FXQ A;  2N78 A;  3EBE A;  2VQE Q;  3UE1 A;  1Y1W H;  1HR0 Q;  1IBM L;  4OWW B;  2UU9 L;  3T1Y Q;  5JJK A;  1JT8 A;  4JBW A;  3F2C A;  1VQA A;  3FP9 A;  1H95 A;  1Y1W G;  1EWI A;  1SFO H;  3EN2 A;  2E2H H;  1HNX Q;  3M3Y H;  3VDY A;  5M3F G;  3PF4 A;  1PH4 A;  1EQR A;  2ES2 A;  4IJL A;  2YV5 A;  3M7N A;  2YTY A;  5M3M G;  5K36 G;  4LF9 Q;  2JA9 A;  1S3O A;  4UP9 A;  4R4T A;  3DLL A;  1HH2 P;  5C4X H;  1J5E L;  3L7Z C;  4LFA Q;  3I56 A;  1XPO A;  1Q81 C;  4C2M H;  3D31 A;  5AJ3 L;  4JC0 A;  4P74 A;  1PVO A;  1UE5 A;  1TWA H;  4A3F G;  1ASY A;  1I94 L;  2VW9 A;  4DUY L;  1WOC A;  1HR0 L;  1OXU A;  5LMN W;  1X65 A;  1YVC A;  2MNA A;  3MXN B;  2D62 A;  3BZK A;  1YHQ A;  2JEA I;  1Q46 A;  5J3B A;  4JI7 L;  4QGU A;  2GVA A;  1R9T H;  1IZ6 A;  3GDE A;  1IL2 A;  4MZ9 A;  4GLV B;  4A3E H;  2AHO B;  4XIG S;  3S1R H;  1I3Q H;  4JOI C;  1L2F A;  5GAG C;  1QZG A;  1PV4 A;  1OXX K;  2LXJ A;  2JE6 I;  2ZJR A;  3ULP A;  2ZTD A;  3K81 C;  4NPS A;  4JI8 L;  4OXP A;  3CP0 A;  1HR0 W;  1XMO L;  4A3D G;  2IY5 B;  1HZ9 A;  2AWN A;  1I94 Q;  2UU9 Q;  2B29 A;  2VL6 A;  2HIV A;  2JK8 A;  5C3E H;  2A1A A;  2ID0 A;  3UDG A;  4A3L G;  1WCM G;  1YNX A;  2PI2 A;  3KF6 A;  4YCU A;  3J81 j;  5C0X J;  2E2I H;  4GKK Q;  4OON A;  1UE6 A;  4A3I H;  1LM0 A;  4LFC L;  4APV A;  4DR1 Q;  1K73 C;  4UP7 A;  5IYB H;  4DV6 L;  1VQ5 A;  1X9N A;  3S2H H;  1MJC A;  2N8N A;  2BA1 A;  3HFZ B;  3CCS A;  1EFW A;  2OTJ A;  4A3L H;  4LW1 A;  1WJJ A;  3JAM i;  2JA6 G;  2UXD L;  1YI2 A;  1GO3 E;  2MO0 A;  4YWL A;  1G6P A;  4DV3 Q;  5IWA Q;  1JMC A;  1YZ6 A;  5FLM H;  2WFW A;  4X65 Q;  4DR4 L;  4DAM A;  4YWK A;  3S15 H;  4HID A;  1QZH A;  2WAQ E;  1FVI A;  2JJQ A;  3GTJ H;  3U58 A;  1QUQ A;  1V9P A;  3ZJY C;  4GOP B;  2JA5 H;  4JI0 L;  1P8L A;  3GTL H;  3AFP A;  4JI6 Q;  3UDX A;  4AQY L;  4A3I G;  3HOZ H;  1GKH A;  2NVY H;  5C3E G;  1XPU A;  4GNX A;  5IT9 c;  2UXC L;  4BBS G;  3H15 A;  5C0X I;  3UDI A;  4NXM Q;  2BH2 A;  2ALY B;  3JAM c;  4DR5 L;  5BR8 Q;  4OO1 G;  5C0X G;  2WB1 G;  3CPF A;  4BY7 G;  5E7N A;  4LFB Q;  2I5M X;  4RMF A;  4HJ9 A;  1GM5 A;  1AH9 A;  1HZC A;  1D8L A;  1EQQ A;  2UUA L;  2K52 A;  3FKI G;  1T9H A;  4OWT B;  4DV2 L;  4HIO A;  3S17 H;  5AJ3 Q;  2F3I A;  2YTV A;  1Q7Y C;  3NBH B;  1QVG A;  4A3G G;  1KIX A;  3K8A A;  3RLF A;  4DV4 L;  3ERS X;  2K50 A;  4DR3 Q;  3JC6 6;  4P73 A;  1HZB A;  2I0Q A;  4LF7 Q;  4A3G H;  1Q1E A;  2QEX A;  1KRS A;  1W3S A;  1N32 L;  1WFQ A;  1G29 1;  4LWC A;  2XGT A;  4A3B G;  5IP7 G;  3B6Y A;  2QGQ A;  1E22 A;  5C44 G;  4DV7 Q;  3TS0 A;  3HOU G;  1YIT A;  1I50 H;  1LUZ A;  4IFD I;  4QJF A;  1VQM A;  2B63 G;  3W1G A;  3CPW A;  4GKJ Q;  2UXD Q;  3W5O A;  3OW2 A;  2R93 G;  1VQ4 A;  3U4V A;  4GNX C;  1EOV A;  4QIW E;  2HHH L;  2R92 H;  4OX9 Q;  1Y1V G;  4OWX B;  2AWO A;  2LSS A;  5M3M H;  1VQ6 A;  4Y7N H;  3I4N H;  1L1O B;  2NVX H;  1XTD A;  4DR7 L;  3AQQ A;  1TWG H;  3GTK H;  1L0W A;  4DR3 L;  3KOJ A;  4R4C A;  1SMX A;  3RLN A;  3U4Z A;  2K5H A;  1Q1B A;  4JI2 Q;  4JBJ A;  4LF7 L;  4BXX H;  4TVA B;  3I55 A;  4ALP A;  2ZTC A;  1M90 C;  2E5L L;  3CCE A;  3I4N G;  4DUZ Q;  4GOP A;  1MJE A;  3I4O A;  3HOY H;  1VQ7 A;  3A5U A;  1A0I A;  2HT1 A;  1N33 L;  2Z6K C;  2N49 A;  1Z47 A;  1VQH A;  4UP8 A;  5GRO A;  3E9H A;  1FJG L;  3TS2 A;  3ICE A;  3TRE A;  2N3S A;  1VS0 A;  1NJI C;  3CC7 A;  1X6O A;  4DV3 L;  3GD7 A;  3WWV A;  3OYY A;  3CW2 C;  2Y0S E;  1N34 Q;  3OTO Q;  1JJ2 A;  5FJ8 G;  4JI3 L;  2YU9 H;  3M4P A;  1NTG A;  2R93 H;  1X3E A;  1XMQ L;  5JEA J;  2NVT H;  4X64 Q;  1VQE A;  1Y1V H;  1SE8 A;  2AKW B;  2R7F A;  3G4S A;  3CCU A;  4DR1 L;  1YJW A;  1CUK A;  1EYG A;  1EIF A;  1A8V A;  3KYH C;  4IPH A;  1PH3 A;  4UY8 C;  1EIY B;  3T1H L;  2HHH Q;  1AE3 A;  5LMU Q;  4OX9 L;  1PFS A;  3HKZ E;  3PSI A;  3HOW H;  4UPA A;  3CCJ A;  1UE1 A;  1KQS A;  5IWA L;  2Z6K A;  2QA4 A;  4DV1 L;  1PH5 A;  4HJ7 A;  1PH2 A;  1Y14 B;  3KLW A;  4LUZ A;  2PQA A;  1RIP A;  3OTO L;  4A3J G;  3K0X A;  5GAH C;  5M3F H;  2UUB Q;  3HOV H;  1LYL A;  4H02 A;  1K8A C;  3NEL A;  3HKZ G;  3RNU A;  4KHP Q;  5IP7 H;  3W1B A;  4JI0 Q;  2OQK A;  4DV4 Q;  4GS3 A;  4X62 L;  1YJN A;  1VQO A;  1VQI A;  1IXR A;  1SRO A;  1SRU A;  1TWF H;  2VQF L;  4JI5 Q;  4BBS H;  1Q8K A;  4IPC A;  1X56 A;  3LGJ A;  5FJ8 H;  1NMF A;  3CXC A;  1SR3 A;  4HIM A;  4K0K L;  1FL0 A;  3E9I A;  4BA1 I;  1PYS B;  1NBW A;  1NMG A;  3CCV A;  3RZD H;  4IO9 A;  1HNX L;  3I7F A;  1JJC B;  1E3P A;  4A75 A;  1XMO Q;  1K8G A;  1ASZ A;  1VQN A;  5IE8 A;  4LF8 L;  3D0F A;  1O7I A;  2Z0S A;  2GVB A;  3BZC A;  4LF4 Q;  5IYB G;  2LXK A;  5FLX c;  3HOW G;  4POF A;  3TRZ A;  2DUD A;  4R4Q A;  1XMQ Q;  2IHF A;  2I5L X;  1KL9 A;  4O2D A;  2CWP A;  2JQO A;  4PMW A;  1BVS A;  1TWH H;  1X3G A;  4YHH L;  1OTC A;  2K75 A;  3G48 A;  5IY0 A;  3CCM A;  2ATW A;  2A19 A;  2MQH A;  3HOV G;  2OCE A;  2KBN A;  4JYA L;  3AEV A;  4GOP C;  4JBM A;  1PH1 A;  4L5T A;  1SLJ A;  3T1Y L;  4DUY Q;  4JI5 L;  2VQF Q;  4NXN L;  2ZTE A;  3A5Z B;  4R4I A;  4ME3 A;  2JA5 G;  3CC4 A;  4NXM L;  2IX1 A;  4DV7 L;  3J7Z C;  3CCR A;  3RLO A;  3KDF A;  1X54 A;  4AH6 A;  1V43 A;  4B3M L;  2NN6 G;  2R92 G;  3GTG H;  3G71 A;  4QY7 A;  1B8A A;  4MTN A;  3PUX A;  3PF5 A;  4YCV A;  4LNQ A;  5LMN Q;  2R7D A;  1WI5 A;  5IYC G;  4JYA Q;  2IT1 A;  1X3F A;  4JI1 Q;  1Q82 C;  2V1C C;  4B3T L;  4BXX G;  3KF6 B;  1J6Q A;  3H3V I;  3K7A H;  2E5L Q;  3ER0 A;  5JEA G;  1VQJ A;  1S72 A;  4IPD A;  3J81 c;  4LF5 Q; 
#chains in the Genus database with same CATH topology
 3HOY G;  2AMC B;  2VUM A;  4IRC A;  1T94 A;  4LF4 L;  1FD7 D;  2D2C C;  1IBM H;  5KFJ A;  3WO0 A;  1CHQ D;  1PMR A;  3N41 B;  4V0B A;  4DXF A;  2Z8L A;  1F2Z A;  4JG2 A;  4BY1 H;  1C0A A;  2PZW A;  2VUM H;  5H1S E;  3NTI A;  1J5E H;  1KJ8 A;  4XQJ A;  4H0L C;  1TWA B;  2WB1 E;  5C3X A;  2G9H D;  4HNT A;  1K83 A;  4C2M A;  2HQL A;  4R4O A;  3J81 i;  2TSS A;  2ZT9 C;  4DNI A;  4WOR A;  1XNR Q;  4EEQ A;  1BNZ A;  4UAI A;  1KC7 A;  5M5X H;  1J5E Q;  1E4F T;  3RJ0 A;  3CF5 A;  5FLX W;  1YNN D;  5LMN L;  4TKO B;  4EG0 A;  2ATL A;  4WJ4 A;  4ZRZ A;  3M9O B;  1QVF A;  5C4X B;  1MIU A;  5KFZ A;  3PO2 H;  4X66 L;  4S3S A;  2D0O A;  4KD3 A;  2KHI A;  3S24 A;  2I87 A;  2QKI C;  2Q8T A;  5KFL A;  1PA6 A;  4HJA A;  1FGB D;  1QUQ B;  1LT3 D;  3Q8Q B;  1D5Z C;  2RHS B;  1WTQ A;  2B2U A;  1ET6 A;  3M9M B;  2RGV A;  1GD7 A;  3VA7 A;  4DNT B;  2EJG C;  1K0R A;  1VF7 A;  4LF8 Q;  1SYE A;  2B63 H;  5K2M A;  1ICF B;  1LTL A;  1KJI A;  1TY0 A;  3LWB A;  5IGG A;  2O5I C;  3PO3 B;  2IMW P;  1CQV A;  3A74 A;  2VNU D;  3BYY B;  1DIK A;  4ETS A;  3N52 A;  1UNS A;  1STB A;  5CV6 A;  4QQB X;  4P75 A;  4GC6 A;  4FF3 A;  2PNR C;  3BA9 A;  5JAV A;  4AIM A;  5FLX L;  5ELE A;  3K58 A;  2YS6 A;  4GN4 B;  2PPB C;  1RK5 A;  1DZ1 A;  3Q8S B;  5KT7 A;  2FJZ A;  1H9M A;  4DK1 A;  1PK8 A;  4J9N A;  3OUU A;  1TKW B;  4DA2 A;  1IL8 A;  3OIQ A;  4LF6 Q;  1N36 Q;  4JI2 H;  2V5A A;  3G6Y A;  1TA8 A;  3F8T A;  3Q6S A;  3I73 A;  1C4Q A;  4B3R L;  2R8H A;  1BXR A;  1TT2 A;  4RUC A;  1QB5 D;  4KI0 A;  4JI1 L;  1IYU A;  2YCH A;  5T1G A;  3S1N B;  4ED6 A;  3OWF A;  1XNR L;  2K5Q A;  1SEB D;  2A73 B;  2ZXO A;  3L2P A;  1G2T A;  4C3H G;  5JVG 3;  2NVT B;  5DQI A;  2PCF B;  1I4Q A;  5JJL A;  2Y0S B;  2WAC A;  1D1K A;  2E74 C;  3Q8D A;  2CFM A;  1PTO D;  4CJ0 B;  3H0G A;  3HOZ G;  3WO1 A;  3TRZ A;  2UXC Q;  3IG0 A;  2PMZ E;  3RF2 A;  4ECS A;  3HOX H;  2FMC A;  5D14 A;  2JA8 B;  4J0M A;  1BO0 A;  1YJ9 A;  5HBR B;  2IX0 A;  4JOI A;  1M0W A;  1YEZ A;  1UEB A;  1VQC A;  4XT3 B;  3D4D A;  3RN2 A;  1XYI A;  3R93 A;  1AZQ A;  2M2L A;  1S68 A;  2JA5 A;  3MJF A;  5KFF A;  2BQ3 A;  2L12 A;  3HOX G;  3CCQ A;  2JEB I;  2I07 B;  1BDO A;  3DF7 A;  2R7L A;  2IL8 A;  4BS9 A;  2NZO A;  1PTO B;  4X65 H;  4LMY A;  1TWC A;  5JPM C;  4O2A F;  4C3H H;  2EYF A;  2E2J H;  1Q12 A;  5T14 A;  2UXB L;  3QOL A;  4YAJ B;  1IOW A;  4QIW A;  1TWC H;  4YY3 Q;  2HVS A;  4DNR B;  2EY1 A;  4LUO A;  3CD6 A;  3BJU A;  2LS0 1;  1X55 A;  1IYJ B;  3EA6 A;  3AB9 A;  4HSV A;  1S40 A;  3HOU H;  2HGS A;  4C5A A;  3S1N H;  4KMU C;  3FEW X;  3EJI A;  3GP7 A;  1JOO A;  1RJT A;  2K5N A;  5HGQ A;  3H0G B;  4J9K A;  4DV0 L;  2F0U A;  3KDF B;  4J1M A;  3UE0 A;  2D0P A;  3P7J A;  4YWM A;  1VQL A;  4Y8V B;  3MHB A;  2WP8 J;  4IAL A;  3GTP B;  1HFG A;  2WAQ G;  3AYH B;  5IYC H;  3LX0 A;  1L2Z A;  5HUR A;  4JI4 Q;  4HQ6 A;  5GON F;  3PO2 G;  5KG4 A;  3VYU A;  1S5D D;  2ZM6 H;  2NVQ H;  2LFN A;  5IP9 G;  3CQZ A;  2V4Q A;  1E2Z A;  2JA7 A;  2NVY B;  3RN5 A;  1PFB A;  1CE8 A;  1K83 H;  2HJW A;  3U50 C;  3TEH B;  1EYA A;  1LT4 D;  4MV9 A;  4RCO A;  4UCO A;  1DCZ A;  2UUB L;  4EEY A;  2ZDQ A;  5J39 A;  3W2D A;  3CQZ H;  3DM1 A;  5JPN C;  4FF2 A;  2JA7 H;  1GJX A;  5CV5 A;  1CQJ B;  4DLK A;  3SE7 A;  5LMU H;  5LMN H;  3J80 i;  3NQI A;  1W6K A;  4C3H B;  2E2J B;  1AN7 A;  4RZR A;  4A2A A;  4O3S A;  2Q2T A;  1KLG D;  4QF4 A;  3AMU A;  4L5S A;  3H3V C;  1DD2 A;  2FPG B;  4I4T F;  4A76 A;  3Q8P B;  2CH4 A;  3FKI H;  2A74 C;  2NN6 I;  4IUV A;  4AYB E;  2UUA Q;  3HXL A;  4PDB A;  2AQ3 B;  3MXU A;  4HJ8 A;  2HVQ A;  2R8K A;  1SND A;  3FKI A;  2GA4 B;  1CKN B;  1FNW A;  4CC5 A;  3T1H H;  4WRD A;  4QL5 A;  3HBL A;  3WDN A;  3VR5 A;  1PH7 A;  5ELN A;  2PNH A;  1Y1W H;  3UE1 A;  1IBM L;  1S9F A;  4ZCK A;  4LF4 H;  4CJ2 C;  1H95 A;  1SFO H;  4OEM B;  2IWH A;  1MZB A;  5M9O A;  4UFZ A;  2YV5 A;  2YTY A;  3TDQ A;  1LLR D;  1HH2 P;  5C4X H;  5D8D A;  2KA7 A;  1XPO A;  1JR0 D;  1SBB B;  3IL8 A;  5AJ3 L;  1IHZ A;  2P5Z X;  1A3U A;  1JC7 A;  1TWA H;  3MAQ A;  5KFO A;  3GIJ A;  1FJG H;  4NP5 A;  2IP4 A;  3OSO A;  3OHB A;  2EE1 A;  1GYF A;  3GTQ A;  1UUP A;  1I94 L;  5DGB A;  2VW9 A;  4DUY L;  5EQ0 A;  5KFU A;  3SDZ A;  3V96 A;  1YVC A;  3MXN B;  3K5N A;  2D62 A;  3BZK A;  3A56 A;  3U9S A;  5C6A A;  1B6S A;  3G7L A;  1CK1 A;  5FPR A;  3GDE A;  1B53 A;  4DV7 H;  4B3T H;  1WCM B;  3NTK A;  2AHO B;  2W9C A;  4JOI C;  4Q0F A;  4ZUI A;  3D4R A;  3KBG A;  1V1P B;  4Q44 A;  3KBX A;  2ASD A;  2LXJ A;  1M8A A;  2JE6 I;  3H91 A;  5KRU A;  4OGQ C;  1QNU A;  3ULP A;  5LA6 F;  3QR8 A;  2X0S A;  3CP0 A;  2IY5 B;  2IA6 A;  2VQE H;  2FP4 B;  4L63 B;  2B29 A;  2VL6 A;  2ID0 A;  4RHS A;  3KF6 A;  3R2T A;  4DL6 A;  3TP7 A;  3K5L A;  4IWX A;  3QO2 A;  1DV1 A;  4MV3 A;  4LFC L;  1JLL B;  3S15 B;  5HV6 A;  5IYB H;  4QMG A;  1VQ5 A;  3L4J A;  3S2H H;  5JVH 3;  3S2D B;  4YJ3 F;  1MJC A;  4ED1 A;  4KKU A;  2BA1 A;  5CYU A;  4O3O A;  3UQ8 A;  2RDF A;  5KFQ A;  4LW1 A;  3VYS A;  1B1Z A;  1YI2 A;  4X64 H;  5KX5 F;  3OSP A;  1F9R A;  3CKI B;  4DR4 L;  4HYK A;  3HS0 C;  1SNC A;  3S15 H;  2C2E A;  3BS1 A;  3U58 A;  4GOP B;  1AFP A;  2JA5 H;  4TUY F;  2A6H C;  2UVV A;  5C3E G;  2ZDH A;  4F88 A;  4ECX A;  2UUC H;  3BZD B;  5C0X I;  1VF5 C;  3JAM c;  2RSN A;  4DR5 L;  3N8D A;  4ZKB B;  4HSP A;  5LP6 F;  2YU9 A;  2B8F A;  3NQT A;  1AH9 A;  1HZC A;  3GLK A;  2K52 A;  3FKI G;  4ME5 A;  4OWT B;  4DV2 L;  4A3I B;  3S17 H;  5AJ3 Q;  1DXM A;  1QVG A;  5C4Z A;  5FD6 A;  1KIX A;  3K8A A;  4DV4 L;  2XWJ B;  3ERS X;  4FNF A;  2R7Z A;  3JC6 6;  4P73 A;  1I50 A;  3M4Y A;  1TS3 A;  1HZB A;  4FP5 D;  4A3G H;  5C3W A;  5FO9 B;  1N34 H;  1W3S A;  2Y0S A;  2SNM A;  5DG8 A;  3KHR A;  4IRK A;  4RH6 A;  2SEB D;  3HOU G;  2K6A A;  2B63 G;  3SE0 A;  4XYL B;  4CKE A;  4GNX C;  2K04 A;  2NTS A;  3FRP B;  4OWX B;  4DR3 H;  2QCP X;  4EBE A;  1SYD A;  1TWG H;  3QOJ A;  4IWY A;  4R4C A;  3JAM E;  2K5H A;  3V2T A;  3KF8 A;  2W57 A;  4RB0 A;  1ZQ7 A;  2BDO A;  4EFB A;  5LYJ F;  4YR0 A;  1M90 C;  3I4N G;  2QYZ A;  2XIG A;  1GOZ A;  4ULL A;  4DUZ Q;  4ECR A;  3C1F A;  5ELB A;  3GTM B;  3A8I E;  3D4W A;  1N33 L;  2L5T A;  2N49 A;  3C1E A;  1IYV A;  3MVV A;  5E1F A;  3GV3 A;  2R8I A;  4JYA H;  5C5J A;  3K7A B;  1VS0 A;  1X6O A;  1Y69 U;  2PZT A;  1EYC A;  1U4R A;  2IW3 A;  1SDF A;  4B08 A;  3OTO Q;  1N34 Q;  4ECW A;  4JI3 L;  1PDQ A;  1VBG A;  2R93 H;  4DV3 H;  1EOT A;  4FS2 A;  2BR0 A;  5KNB A;  2W9B B;  2AKW B;  2N88 A;  1AW7 A;  3G4S A;  3CQZ B;  4DR1 L;  2JA7 B;  4XYQ A;  4ILW A;  1A8V A;  1EIY B;  2B2W A;  5F9N A;  1AE3 A;  1RJR A;  1DM0 B;  2B2V A;  2F4I A;  4RGT A;  4UPA A;  3N6X A;  4B3M H;  4EGJ A;  2QA4 A;  2DLN A;  2NVX B;  2DPI A;  5E4W C;  5C4H A;  5M5Y B;  2FE3 A;  3KLW A;  4A3J G;  2HDL A;  3K0X A;  1BJT A;  4I7Z C;  4KHP Q;  5IP7 H;  4JI0 Q;  4EQO A;  5IOD A;  4AYB A;  5FK9 C;  3Q22 A;  4DV4 Q;  1AUX A;  5FO8 B;  4V19 0;  5EJW A;  4ECZ A;  1SRO A;  5K5P A;  3S16 B;  2VQF L;  5KFE A;  3T51 B;  3TBI B;  4IPC A;  3CXC A;  2M00 A;  5JH7 F;  3C2P A;  4BA1 I;  1IBK H;  1NMG A;  1N32 H;  4XQQ A;  1E3P A;  2EJF C;  2DIK A;  3TSS A;  3BZC A;  1CQF A;  1TR5 A;  2LXK A;  5C5M A;  2CW7 A;  2DUD A;  4R4Q A;  2M9V A;  3P75 A;  1C48 A;  5CMD A;  1E4G T;  3JSN A;  3T5L A;  2JQO A;  1BVS A;  2ATW A;  2MQH A;  1LO5 D;  2MUY A;  2SCU B;  4JYA L;  4JI4 L;  4C3J G;  1SLJ A;  4G4K A;  3T1Y L;  4R4I A;  3MXG A;  3RBD A;  3CC4 A;  5FOB B;  2W9A A;  3J7Z C;  1TII D;  1GUS A;  2A6E D;  3RLO A;  2SNS A;  3Q24 A;  4AH6 A;  1V43 A;  1O7Z A;  4RAY A;  4WBN F;  5CV8 A;  3NGD A;  1NSN S;  1YNN C;  5BR8 H;  2NN6 G;  1Y8P B;  1N56 A;  4JI8 H;  3GTG H;  3OHX C;  3G71 A;  2QF7 A;  5FO7 B;  3WOE A;  3PUX A;  4OIJ A;  2ZDG A;  1EY8 A;  3JAM L;  2FKL A;  1E4E B;  2K28 A;  4B3T L;  2PW5 A;  2V1C C;  1OO9 B;  5KT3 A;  4DV1 H;  4O4L F;  3H3V I;  5KFY A;  5DGA A;  1VQJ A;  1DOM A;  3TZU A;  2JEI A;  5EBC A;  1S5F D;  2J6S A;  4KV6 A;  2R92 B;  3UDF A;  2AQ2 B;  1K9M C;  2WAQ A;  1I4H A;  1BUV T;  4BBR G;  4M1U B;  4K5X A;  1JE5 A;  3ULL A;  4IFD H;  4ZQ3 A;  3PUV A;  1BXT A;  4F87 A;  2JA7 G;  5IYD H;  1VQ9 A;  1EUD B;  2V58 A;  2J6U A;  2WIN B;  5T1I A;  1F77 A;  3K57 A;  5DLQ E;  4KY6 A;  3RB3 A;  4DV1 Q;  2R3Z A;  2XTI A;  2EQS A;  1SE3 A;  4DV2 H;  2VQE L;  1HCZ A;  2V59 A;  2CWA A;  5IGF A;  4RG1 A;  4BY1 G;  4IR1 A;  3BAA A;  1MHW C;  4NKL A;  4DUZ L;  5D3D A;  4A3K G;  1RYS A;  2B2V C;  5EPK A;  3SEB A;  1D7Q A;  2R8G A;  3IRB A;  4RFB A;  4JV5 L;  4KK7 A;  1LAC A;  4BY7 H;  3JSL A;  4LAA A;  2ZXR A;  5DG9 A;  3TQY A;  5IYD G;  5JQW A;  3M4O H;  3J81 W;  2OT2 A;  2CH4 W;  2CQO A;  5ELD A;  4A3C H;  1LTT D;  3SVM A;  5DAU A;  4DV5 Q;  4NXM H;  2KEN A;  1CZG A;  1TS4 A;  3FPU B;  5D1O B;  2FHT A;  4NXN H;  4DU9 A;  1VQD A;  2RCF A;  2W9B A;  4X64 L;  4GNX B;  5C1O A;  5AFW A;  3GQC A;  3E0E A;  1WTX A;  1UNN C;  1ZET A;  3A0J A;  3FHW A;  4IJH A;  4YQW A;  1KAW A;  1JWS D;  5FD5 A;  4O3R A;  1NAP A;  3F2D A;  4QWE A;  4IN3 A;  4DV6 H;  4C5C A;  1O75 A;  4GN5 A;  1AEX A;  4C3J B;  1SFO A;  1HNW L;  2M05 A;  3GTL A;  1IKL A;  1VAJ A;  2V9W A;  1JIH A;  2PO4 A;  1EUJ A;  2FB9 A;  2UUC L;  3TQT A;  1Q8I A;  1RHP A;  1TWA A;  4DV6 Q;  1ZXT A;  5E4X A;  3CCL A;  3GII A;  4C3J H;  3KUP A;  3EPG A;  4DKA C;  2J0T D;  4R9W A;  4DR5 H;  2LKV A;  3PO3 G;  1CZW A;  3GV6 A;  1QIL A;  1SYF A;  3MFI A;  1XNQ Q;  4RGN A;  1FGU A;  1CKM A;  5EKI A;  5CA1 F;  1BBU A;  4Q8E A;  1PHJ A;  3PGZ A;  3KJP A;  1I6H H;  3CMA A;  2C2D A;  5KKN B;  3HP3 A;  3OOC A;  1STY A;  1A2U A;  2W8K A;  1E24 A;  2AU0 A;  1TWF B;  3S16 H;  5JJZ A;  1VQG A;  1KC8 C;  2VUM B;  4K0K Q;  2X6L A;  2IHE A;  4GC7 A;  4ED8 A;  4A2B A;  1JOK A;  2R7Z H;  3K59 A;  5C4J H;  4RA8 A;  1STE A;  4DAY B;  3OUZ A;  2XRS D;  4HMI A;  3PUZ A;  3N43 B;  3M9B A;  1RD9 D;  4AYB B;  4DR2 H;  3MZ5 A;  4ED7 A;  4GN3 B;  1ONL A;  5EBD A;  1PRT F;  1HZA A;  3G6E A;  2I46 A;  3EYY A;  1O80 A;  5L9X A;  1VQK A;  2B63 A;  3ORR A;  3PIO A;  1F2L A;  4DR5 Q;  1TWG A;  5KFS A;  2FK3 A;  1D6E C;  4RUA A;  1XNQ L;  5ELO A;  3URY A;  5A2Q L;  4PMB A;  1QCB D;  1U0L A;  3J7A V;  2OTL A;  3CHB D;  1HQR D;  1YHA A;  3K5I A;  4KHZ A;  4JI8 Q;  1PH8 A;  4J6H A;  1M1K C;  5KT4 A;  2JA8 G;  1XXG A;  1KJQ A;  1SYX B;  1GLV A;  5GQO A;  1K0S A;  1SSO A;  2YZG A;  4DR4 Q;  1DGS A;  3DHQ A;  4IUU A;  3GTO H;  3S1M H;  1DOL A;  4KHV A;  1IBK Q;  2BA0 A;  5KFG A;  1BCP D;  1AZP A;  1EFI D;  1J8I A;  1VBH A;  1QNK A;  4R1J A;  1N33 Q;  2AGP A;  3VPC A;  1JDB B;  4JV5 Q;  4CKB A;  2R87 A;  5KFA A;  4NB3 A;  4K8J A;  1ESF A;  3RZD B;  2B8G A;  2YW2 A;  4DK3 C;  3I4L A;  1HNW Q;  2YTX A;  3KLR A;  1EY0 A;  4HIK A;  2H5X A;  4WFN 3;  1PH6 A;  4Q45 A;  1FR3 A;  4MAM A;  4FDB A;  2MFI A;  2F4V Q;  4J9P A;  3KTM A;  2Q8R E;  2RDJ A;  5J2T F;  5I4D A;  1YNJ D;  2DGY A;  1KDC A;  1MKH A;  5I2X A;  1KBL A;  1R4Q B;  4YHH H;  2F03 A;  3PW4 A;  4CBV A;  5CC4 A;  1XX8 A;  4QB4 A;  1KD1 C;  3H3V H;  1V8Q A;  4A3M G;  4ABN A;  2NUC A;  4QWA A;  2VUM G;  2R6G A;  2YRW A;  4JI1 H;  3TZD A;  1IBK L;  3TII A;  3I72 A;  4K0K H;  3V05 A;  1DOK A;  1BCP B;  2CW0 D;  2QEJ C;  3UI2 A;  4X62 Q;  3IFT A;  4EGQ A;  2EYO A;  1SNQ A;  2R6F A;  3GO5 A;  5CV7 A;  5KIX A;  3STB D;  1ULZ A;  4MNO A;  4DV0 H;  3GTL B;  2R93 A;  2VOB A;  4CGY B;  2I8C A;  2PI2 E;  2KHJ A;  1CI3 M;  2YZM A;  4E4T A;  3F2B A;  1Y1W A;  1H9R A;  1Q3L A;  3HB9 A;  4J9L A;  4RNN A;  3WOF A;  5JJK A;  4IUP A;  4FU0 A;  4BY7 B;  4A3F B;  1K28 A;  3VA5 A;  3F2C A;  5KFT A;  3FP9 A;  3RB4 A;  1EWI A;  1KAB A;  2AQ1 B;  3EN2 A;  2CHB D;  3PF4 A;  2ES2 A;  3M7N A;  4IJL A;  2OF1 A;  2YZN A;  2JA9 A;  1CTM A;  3DLL A;  4R4T A;  3GTJ A;  1J5E L;  1I50 B;  3L7Z C;  4DF7 A;  3I56 A;  1X3Q A;  2F0L A;  1Q81 C;  3PW0 A;  4P74 A;  4Z9C B;  3RZO B;  1UE5 A;  1LTG D;  4JVZ A;  1LTR D;  2C9O A;  3U9O A;  3A54 A;  2F0V A;  5IGB A;  2YL2 A;  1WOC A;  1HR0 L;  1OXU A;  5LMN W;  3MR5 A;  1NR2 A;  2F4V H;  1H9K A;  1UEA B;  2MNA A;  2JEA I;  1K8O A;  1Q46 A;  4JI7 L;  1A6X A;  5KFV A;  1IL2 A;  2HCC A;  4MZ9 A;  3NUC A;  1KAA A;  3AU7 A;  3S1R H;  2XGQ A;  1EL0 A;  4TSS A;  1CFM A;  4BWS C;  1PZJ D;  1L2F A;  4I65 A;  1QZG A;  5KG2 A;  2ZJR A;  2HD3 A;  2F0M A;  2ZTD A;  3K81 C;  4NPS A;  2XSC A;  4OXP A;  4JI8 L;  2C5C A;  5KEE A;  1HR0 W;  5CAE B;  1I94 Q;  2UU9 Q;  2HIV A;  1JJG A;  1DV2 A;  1WCM G;  2VUG A;  4UCV A;  4A3M B;  1UE6 A;  1R4P B;  5C8Y F;  2SOB A;  4A3I H;  1LM0 A;  2E2D C;  1K73 C;  2VPS A;  1HNZ H;  1PRT C;  3PIO 3;  4UP7 A;  1SFO B;  4ZI7 F;  3RD4 A;  3QZ7 A;  4TQS A;  5L37 A;  4E6I A;  1FKA H;  2N8N A;  2VB2 X;  2OTJ A;  2F0D A;  4A3L H;  2BQR A;  1CA6 A;  3JAM i;  3GTK A;  2JA6 G;  3N42 B;  1B04 A;  4DV3 Q;  1WTP A;  2NZ1 D;  1YZ6 A;  1T36 A;  1EY6 A;  4DAM A;  4YWK A;  3GTG B;  4HMJ A;  4I55 F;  4RGM A;  5LOV F;  1PRT D;  1RF2 D;  3ZYY X;  4RWS C;  4HID A;  2AGQ A;  4G7O C;  3ZJY C;  1P8L A;  3FKI B;  2EZV A;  4AQY L;  4A3I G;  3OPO A;  2Z4I A;  2UXC L;  3A8J E;  3TIG A;  4BBS G;  4NXM Q;  4DV5 H;  3IAY A;  3RV4 A;  3KAL A;  2RQX A;  3EPI A;  3NK9 A;  5BR8 Q;  4RKL A;  5C0X G;  2H4O A;  3S1R B;  1EU4 A;  2G5D A;  4XQN A;  4R8U A;  1D2B A;  1G6Z A;  2F0N A;  2IPK D;  1Q7Y C;  4A3G G;  3GV8 B;  2K50 A;  4DXG A;  3R5F A;  3ONA B;  2B2Y A;  3RB6 A;  3BQ1 A;  1KRS A;  1JOR A;  2XGT A;  2J7Z A;  3TS0 A;  5EKL A;  2E2I A;  1YIT A;  2WTF A;  1I4G A;  3NBI A;  1VQM A;  1XMO H;  1H9J A;  4ID6 A;  3CPW A;  4IRD A;  3M7G A;  2YS7 A;  3U4V A;  4ED3 A;  4QIW E;  2L55 A;  2JEF A;  2E75 C;  2LSS A;  3HG9 A;  3P1H A;  5I47 A;  5BN4 A;  2NVX H;  2PZU A;  1CS0 A;  4WD3 A;  1XDN A;  5E3F A;  4DR3 L;  1FNU A;  1Q1B A;  2FLP A;  1I4R A;  3I55 A;  3KAK A;  2CW0 C;  2ZTC A;  4GOP A;  3I4O A;  3HOY H;  2R7K A;  3NTH A;  3JRX A;  2HT1 A;  1VQH A;  5GRO A;  2B2T A;  3E9H A;  5CGK A;  3T16 A;  1NJI C;  3CC7 A;  4DV3 L;  3DEO A;  1STA A;  5G3L D;  3WWV A;  3OYY A;  2F0W A;  3CW2 C;  2Y0S E;  2A69 D;  2NYZ D;  1LV9 A;  2UUA H;  2QW7 A;  1LTI D;  2WKC A;  3MEH A;  1MBY A;  1X3E A;  1HTP A;  2XD4 A;  5KFM A;  1VQE A;  1ENC A;  4JV1 A;  1EIF A;  3KYH C;  3E5S A;  3EVQ A;  4UY8 C;  2SDF A;  3T1H L;  2HHH Q;  1CHP D;  3HKZ E;  3HOW H;  1Z6H A;  3R3O A;  4ZLT F;  4RAZ A;  1UE1 A;  2KEE A;  4X62 H;  3I91 A;  3DXJ C;  1V4Y A;  4BBS B;  5KFN A;  1PH2 A;  3RBE A;  1EUC B;  2PQA A;  2UUB Q;  5GAH C;  1V51 A;  2NUA B;  3NEL A;  2ZXP A;  5EGT A;  3W1B A;  2OQK A;  2PMZ B;  4R8I A;  1IW7 C;  3QB3 A;  4GS3 A;  4J9O A;  1IXR A;  1WH2 A;  3DWQ A;  3TQ1 A;  1X56 A;  3VPD A;  1SR3 A;  1RDP D;  4K0K L;  4ECT A;  3E6Z X;  3KHH A;  1NBW A;  3CCV A;  5C4X G;  1B50 A;  4IO9 A;  5KFX A;  3I7F A;  1JJC B;  3N44 B;  2UUB H;  5A2Q E;  1K8G A;  4LF8 L;  4HED A;  3P20 A;  3Q8R B;  5FLX c;  5IGE A;  4DL3 A;  1I4P A;  4CDD C;  2A68 D;  4O2D A;  2EJM A;  2CWP A;  4PMW A;  1TWH H;  4BWG B;  2R93 B;  5F2D A;  3HKZ A;  3EQL C;  3HOV G;  1PFM A;  2R7N A;  1PXU A;  1SNP A;  4JBM A;  1HA6 A;  4CDE C;  4DUY Q;  4JI5 L;  4X66 H;  4NXN L;  3SHL A;  4ME3 A;  4LK1 C;  3KHL A;  4NXM L;  1GUT A;  5DQH A;  3KDF A;  1X54 A;  5G3L F;  3RTX A;  2E5L H;  3RUP A;  5IWA H;  4B3M L;  1ZYR D;  1SNM A;  2WDT A;  2R92 G;  5BPH A;  1M7J A;  1DJR D;  1SJE D;  3RFC A;  5DQG A;  5TSS A;  3PF5 A;  4YCV A;  4JI6 H;  1A3V A;  5IGC A;  1KEE A;  4C5B A;  1AP0 A;  5IYC G;  3F8N A;  4JI1 Q;  1X3F A;  1Q82 C;  4BXX G;  3KF6 B;  4JK1 C;  5EDW A;  2L9H A;  3K7A H;  3JZI A;  2UXD H;  4A3K H;  1PTO F;  4LF5 Q;  2F0H A;  1Z2N X;  1I94 H;  4A93 G;  2VA3 A;  5IT9 E;  1U5K A;  3I4M H;  2ALZ A;  3BDC A;  2VXW A;  5EWE A;  2Q8I B;  5HGT A;  2F0I A;  4ECV A;  2R8J A;  1U9R A;  2VZA A;  3RR5 A;  1QJO A;  4CDF C;  4B3T Q;  4NXN Q;  5M5X B;  1G8Z D;  4Y7N B;  2R7M A;  2Z4H A;  2UXB Q;  3KJO A;  1Q90 A;  1EZ1 A;  4ZK9 B;  1WCM H;  5JVD F;  1KXL A;  5CBE E;  3GTQ H;  2FK2 A;  4NW2 A;  4EX5 A;  4JI6 L;  1GHJ A;  3RAX A;  2IX3 A;  3PIP A;  4C3I H;  1C30 A;  1YIJ A;  3GIQ A;  2OQ0 A;  2ENB A;  3F2U A;  3OW7 A;  2EYH A;  2GN5 A;  1IBL L;  3KFU A;  4DR6 Q;  4IFD J;  3FMA A;  4P2C B;  5FPO A;  2I5H A;  4IUN A;  4BY1 B;  5LL6 b;  3PW5 A;  1BBW A;  2R85 A;  4MV4 A;  3K80 C;  1TXY A;  2NZH A;  5FKA C;  3CRL C;  4EBC A;  3J7A F;  4RCN A;  2XNA C;  5KT5 A;  2FK1 A;  3MR6 A;  5C5L A;  1A62 A;  2FMA A;  3IN5 A;  2CKZ B;  4L1K A;  3MXP A;  2AUJ D;  1F2Y A;  4U7C A;  2HUG A;  1UE7 A;  5EWG A;  1YHB A;  1N9W A;  2XN9 C;  1N34 L;  4PNY A;  3K5H A;  1SYG A;  4Q8F A;  4DV5 L;  5COR A;  3BQ0 A;  4RB1 A;  1CKO A;  4OHJ A;  1XPR A;  4DV4 H;  4H7B A;  1BOS A;  1KHI A;  1S5B D;  2NU8 B;  2F52 A;  4LMQ D;  4AQY H;  4KTA A;  1A2T A;  1SXT A;  1WR2 A;  3BAB A;  4A3C G;  1N32 Q;  4P72 A;  3CAM A;  4IOA A;  1EZ6 A;  4GLA C;  3K3V A;  1A3T A;  5L1J A;  3H6M A;  3GIM A;  3OMG A;  4FF1 A;  3S2D H;  2B2Y C;  4PZ6 A;  4GKJ L;  2Z6B A;  3S2H B;  1R9T A;  2OH2 A;  4A3E B;  4ECU A;  1PYW D;  1C7Y A;  5BN5 A;  4A3J H;  4LFA L;  1C9O A;  5EOY A;  2ASJ A;  4JI0 H;  4DR2 Q;  3PO2 B;  1JIC A;  4YHH Q;  3G6V A;  1GUW A;  4PWQ A;  1UC8 A;  1EWH A;  1JXL A;  1WTV A;  5CV4 A;  2BE5 C;  2VPQ A;  4JI3 H;  2R92 A;  1ROD A;  2G9D A;  2MO1 A;  3VYR A;  5JVL A;  5KFB A;  3NBH A;  1AE2 A;  4LF5 L;  1TY2 A;  2KEC A;  3RV3 A;  2RVL A;  2KJX A;  4GZY C;  1RK6 A;  3BU2 A;  2MJ8 A;  4IR9 A;  2UU9 H;  4K6L A;  4IFD G;  1HNZ L;  3M3Y B;  2MP1 A;  1UWV A;  2BH8 A;  1PTO H;  4KD4 A;  2K4K A;  1EEI D;  3PW2 A;  5GAD C;  4IAJ A;  1O7L A;  3J80 W;  1E7Z A;  4PZ7 A;  4X3K A;  4EQ5 A;  4DV0 Q;  4KN4 C;  2ASB A;  5IT9 L;  4LFB H;  1DYQ A;  3V6J A;  2HQE A;  2KUM A;  1GVP A;  2XWB B;  4FS1 A;  1B2T A;  4X66 Q;  4DUY H;  3SR1 A;  3SXH A;  3QZ8 A;  1I5F A;  1TU2 B;  2RF4 A;  3I4M B;  4XTC S;  5KT6 A;  1EIG A;  3SK4 A;  4KKT A;  3GIP A;  4ME6 A;  4YP3 A;  1N36 L;  1HUN A;  3DWA A;  5L1K A;  2JA8 H;  4X6A H;  2JA6 H;  1TWH A;  5L1L A;  3DM3 A;  2CCZ A;  3IKJ A;  2R7Z G;  2R82 A;  3NEM A;  4DGZ A;  1W96 A;  2J4X A;  1Y1W B;  1EHI A;  4LH7 A;  4GKK H;  4X65 L;  4Q5V A;  2JA6 A;  4LF9 H;  2E8G A;  4BBR H;  2H1E A;  1K1Q A;  5DLG A;  1WTO A;  3W3A A;  1GHK A;  4PG3 A;  1UAP A;  4K2L A;  4K6D A;  4EFE A;  4KLK A;  4RAU C;  1HNZ Q;  4FVM A;  1K83 B;  4FF4 A;  4HR7 B;  4B3S L;  4J15 A;  5GAE C;  2PBZ A;  3Q2O A;  4K14 A;  2PMZ A;  1EZ8 A;  5BR8 L;  3Q23 A;  2NVQ B;  1IBL Q;  4DR6 L;  1KDA A;  3PZP A;  3KF8 B;  5KND A;  1WD0 A;  4C1N K;  2NN6 H;  3K5O A;  2EYP A;  4WJ3 M;  2R86 A;  3MFH A;  4P71 A;  2CQY A;  3Q0A A;  4JI5 H;  3I70 A;  4LFC Q;  2BCO A;  1EY5 A;  4BA2 I;  3T13 A;  2Q2I A;  3M85 A;  3K7U C;  3H0G H;  1HQM C;  2DY8 A;  5LMU L;  3ITP A;  1V1Q A;  1LTA D;  1PRT B;  1QVC A;  1SNO A;  3STB C;  2K33 A;  3LWU A;  4HCS A;  1W2B A;  2GLT A;  5EAY A;  1S0O A;  3PN1 A;  1RL2 A;  1WTH A;  3I12 A;  4QWC A;  5C1P A;  4MV8 A;  1HNW H;  4PV1 C;  1GGO A;  4MTE A;  4LF9 L;  2KED A;  3GTP H;  4DN4 M;  3C46 A;  3LP8 A;  3K6O A;  4B3R Q;  3CVZ A;  5BMV F;  3PR4 A;  3MFY A;  4RU9 A;  2Q2H A;  3D3R A;  4JPB W;  2P0A A;  4R8U B;  4J9M A;  3PQI A;  1G51 A;  4MIU A;  2HIX A;  1WVL A;  2C28 A;  4L5Q A;  3GQB A;  5A35 A;  3HOZ B;  1XTC D;  3GTO A;  1B3Q A;  1EYD A;  4O2B F;  1Z9F A;  1LTS D;  1N8R C;  1HJP A;  3GTM H;  4K5W A;  1UC9 A;  1EY9 A;  5C3E B;  2UUC Q;  3I4M G;  3KLS X;  1QE6 A;  3PV0 A;  1F9Q A;  4DR2 L;  3MWD A;  3HOX B;  3GIL A;  4JCV E;  2K05 A;  3ULJ A;  4POG A;  1ILQ A;  2FXQ A;  3OMC A;  2VQE Q;  4MV7 A;  1HR0 Q;  1F9S A;  3VR2 A;  3GTG A;  4C3I B;  5CB4 F;  1TWG B;  4JBW A;  2CW8 A;  5D1O A;  4TQR A;  4DR6 H;  1VQA A;  2MHV A;  3L4K A;  1Y1W G;  3QG1 A;  1HNX Q;  3M3Y H;  3VDY A;  5M3F G;  3GTQ B;  1EY4 A;  2EOT A;  1QWY A;  4O3P A;  3H40 A;  3ND9 A;  4XYM B;  2MPM A;  3BYT B;  4UP9 A;  4LF9 Q;  2C00 A;  3RGX A;  2VB3 X;  4C2M H;  3D31 A;  4L6T B;  3V6H A;  1N36 H;  2OLS A;  1EYZ A;  4IUQ A;  2O03 A;  4A3F G;  1ASY A;  2DWC A;  1XNQ H;  3RMH A;  4C2M B;  2KSW A;  1X65 A;  4X3S A;  2BDN A;  1MSG A;  2E76 C;  5DNF A;  1I4X A;  5M3M B;  5J3B A;  2GVA A;  1R9T H;  3HGB A;  4LJZ C;  2K1B A;  4A3E H;  4F8M A;  5H80 A;  1S0N A;  4XIG S;  2QIL A;  5GAG C;  4MHE A;  5EZY F;  3PR5 B;  2XGP A;  4M8A A;  2L4N A;  3H4D A;  2DJF C;  1W93 A;  1XMO L;  4QW9 A;  4A3D G;  1HZ9 A;  1H9S B;  1BF4 A;  1V1O A;  1K1S A;  1JWU D;  5EPL A;  5C3E H;  3UDG A;  4A3L G;  1YNX A;  1QG7 A;  2PI2 A;  3NXW A;  4YCU A;  4C1N I;  2W9C B;  1MGS A;  1PTO C;  4OON A;  4FO2 A;  4APV A;  4DR1 Q;  2E2H B;  2NBF A;  4CC6 A;  4DV6 L;  4K2K A;  2A6E C;  1X9N A;  1Z7T A;  3HFZ B;  3MXN A;  3CCS A;  5BPF A;  4F4X A;  1HPC A;  1WJJ A;  1G6P A;  1B44 D;  1GO3 E;  2MO0 A;  4KJO A;  1JMC A;  1SYB A;  2WFW A;  1WTW A;  3OTO H;  1H9S A;  2IJ0 A;  2RDH A;  2WAQ E;  2DY7 A;  2DPJ A;  2EY6 A;  1V9P A;  2FIN B;  4JI0 L;  1F9P A;  3QFF A;  2VQF H;  3GTL H;  3FMC A;  3AFP A;  4JI6 Q;  3UDX A;  2GPW A;  1GKH A;  2NVY H;  2UVW A;  4GNX A;  5IT9 c;  1PLF A;  4F7X A;  3MWE A;  3H15 A;  2N55 A;  2BH2 A;  5BN3 A;  4RNO A;  5DG7 A;  2PW7 A;  5KYI A;  3RUZ A;  3RAQ A;  4OO1 G;  3JRW A;  5KG1 A;  4DUZ H;  4C3I G;  5E7N A;  1I6U A;  4LFB Q;  1GSA A;  1D8L A;  3T5H A;  2UUA L;  1T9H A;  5M3F B;  4OEL B;  1X32 A;  2A69 C;  2YTV A;  3NBH B;  3PVX A;  1I7N A;  1STN A;  2L11 A;  2XCP A;  2XC9 A;  3T53 B;  4DR3 Q;  3U9T A;  3ND8 A;  1S10 A;  5KG5 A;  4LFC H;  4LF7 Q;  5KT2 A;  1Q1E A;  2WB1 B;  2QEX A;  1N32 L;  1WFQ A;  3ETH A;  1G29 1;  1XMQ H;  5IP7 G;  3B6Y A;  2QGQ A;  3LML A;  5C44 G;  4DV7 Q;  2B39 A;  1WD1 A;  4YIJ A;  1LUZ A;  2F0G A;  2NVX A;  4QJF A;  1GXD C;  2QDL A;  3W1G A;  4GKJ Q;  3W5O A;  1KTK A;  1TS5 A;  3RB0 A;  4OX9 Q;  1GUN A;  3I4N H;  1X3P A;  4Y7N H;  1XTD A;  3JAM W;  3SI8 A;  3AQQ A;  1HRJ A;  1T5E A;  2TMP A;  5KFW A;  1L0W A;  3BQ2 A;  1SMX A;  1Z2P X;  3U4Z A;  2EXZ A;  4JI2 Q;  4JBJ A;  3HRZ C;  1WSC A;  1U4L A;  4TVA B;  4ALP A;  2A5H A;  1VKZ A;  3J7A K;  3NPP A;  1HUM A;  3E3X A;  5DM7 3;  4HR7 A;  2CVR A;  4RB3 C;  1B6R A;  1Y1V B;  4OX9 H;  3A5U A;  3D6W A;  3GTP A;  1Z47 A;  4UP8 A;  3J7Y W;  3D8G A;  4K8I A;  2JYO A;  5DM6 3;  2BOS A;  2WKD A;  1D1I A;  3ICE A;  5JUM A;  4FBU A;  1NCV A;  2F3V A;  3PMF A;  3TRE A;  1JKJ B;  3GTK B;  3R5H A;  4F4Z A;  4KKS A;  2FJ2 A;  3VR3 A;  1EQT A;  3DWP A;  5FJ8 G;  1STG A;  2YU9 H;  3M4P A;  1VMP A;  4EYH B;  2IBK A;  1NTG A;  1S97 A;  1XMQ L;  2NVT H;  2W6Z A;  1AN8 A;  4X64 Q;  4WJW A;  5I6W A;  3ETJ A;  1SE8 A;  2R7F A;  1EYG A;  1GSH A;  2UVU A;  1YJW A;  1CUK A;  4IPH A;  4TV9 F;  2FFK B;  4ECQ A;  4B3R H;  2KVM A;  4OX9 L;  1PFS A;  3PSI A;  3CCJ A;  1SAP A;  2JP1 A;  1KQS A;  3R5X A;  4FBT A;  4DV1 L;  5D1P A;  1CT1 D;  4HJ7 A;  2W6Q A;  2PYK A;  4IZ8 A;  2ASL A;  1Y14 B;  1CA5 A;  4LUZ A;  3HOV H;  1IOV A;  5I9P A;  5C4J B;  1B4O A;  3V6K A;  4X62 L;  1E2W A;  4ZAI A;  1VQO A;  1VQI A;  1JOQ A;  5EPJ A;  1B3A A;  1TWF H;  4JI5 Q;  4BBS H;  2K7V A;  5CR3 A;  4B9W A;  1Q8K A;  2HCI A;  3LGJ A;  2F0S A;  5FJ8 H;  5IIF A;  4HNV A;  3M4I A;  1VMC A;  1FL0 A;  3E9I A;  1PYS B;  3FVQ A;  1ET9 A;  2EY5 A;  2HVR A;  5IE8 A;  1TWF A;  1O7I A;  2Z0S A;  3GTJ B;  1TWC B;  5FLX E;  5IYB G;  4POF A;  1XMQ Q;  2IHF A;  1KL9 A;  2PQE A;  1NUC A;  4YB8 B;  1X3G A;  1C8C A;  1OTC A;  1EU3 A;  2B63 B;  2K75 A;  2A19 A;  1I3Q A;  2KQ3 A;  3A7L A;  2OCE A;  4MTK A;  1ILP A;  2KBN A;  1B33 N;  3AEV A;  5EKK A;  3H94 A;  1PH1 A;  5CA0 F;  4LF8 H;  4EQN A;  1XWE A;  4Q0Y A;  4XZ3 B;  2JA5 G;  2W6M A;  5A2Q W;  1RYR A;  2WE6 A;  4DV7 L;  3HOW B;  3M9N B;  3I3C A;  4UCR A;  1Y8O B;  3VR4 A;  2JSO A;  3HOY B;  3BVM A;  5CV9 A;  2RDI A;  4QY7 A;  1B8A A;  3GV5 B;  4MTN A;  5ELC A;  3IFD A;  2E2H A;  4O1N A;  2R7D A;  2IT1 A;  3V4Z A;  1J6Q A;  3R23 A;  2A6H D;  2I80 A;  5JEA G;  1S72 A;  4IPD A;  3CRK C;  4HTH A;  1W6J A;  2EYM A;  1OWT A;  2FPI B;  2DNC A;  2E2I B;  1V1P A;  3L0O A;  3G6J B;  1MD2 D;  4DFA A;  4ODG A;  3SK5 A;  3ERO A;  2R84 A;  1WYD A;  1B70 B;  4B3S Q;  1B7Y B;  2NVY A;  4J8Q A;  4L5R C;  4LUV A;  4TQU S;  1JCK B;  3RZO H;  1L1O C;  3H09 A;  1RTN A;  4A93 B;  3PIP 3;  1PYB A;  4LF7 H;  3NWS A;  4QIW B;  4XDX A;  4ZUJ A;  3MFG A;  4A3J B;  1E1T A;  1L0Y B;  4MN3 A;  5C44 H;  1JB7 A;  4AYB G;  2D9U A;  2F3W A;  4A93 H;  1DON A;  1SJH D;  5KG7 A;  5KFD A;  4MA0 A;  2UXC H;  3N40 P;  1BCP F;  2RSO A;  4DL5 A;  4PQX A;  1SN8 A;  3L9A X;  2RKS A;  2F0P A;  1LT6 D;  1PFN A;  3NEN A;  2ZJP A;  2KCM A;  4G7H C;  4F4W A;  4J9S A;  2LY7 A;  5KFR A;  1VQP A;  1A63 A;  2KCT A;  1CKN A;  4MA5 A;  4RHR A;  2EIF A;  1SMY C;  4EBD A;  4CKC A;  3PO3 H;  3MWM A;  4J9R A;  3GIK A;  3J80 c;  3J80 E;  1BGW A;  2NU6 B;  4CJ1 B;  2RCN A;  5KG6 A;  2K5V A;  4HN7 A;  3OWE B;  1F2M A;  4A3D H;  3FDT A;  1O7Y A;  1TWH B;  1S5C D;  4IOC A;  5LXT F;  4KHP L;  2RHQ B;  3J81 L;  2OWO A;  1KJ9 A;  3NSW A;  2QDB A;  1OXV A;  2ZM6 L;  3VPB A;  2RGR A;  2B3G A;  4EQP A;  3H4B A;  1RJQ A;  2C35 B;  2J6T A;  1RCV D;  3VMM A;  2KCN A;  3HEJ A;  2BE5 D;  3M4Q A;  3PCO B;  4DK6 C;  4ZYS A;  5IP9 H;  5IOC A;  2JXM B;  3G8C A;  3VR6 A;  1EEF D;  5CBA E;  5LL6 X;  1WCM A;  5I2Y A;  4OO1 I;  4CDC C;  1C3O A;  2Q2U A;  2F4V L;  1P16 A;  1LAB A;  4B3S H;  1RKN A;  1PX2 A;  1NY4 A;  4DR7 Q;  1S5E D;  2Z1C A;  5JJI A;  1B9M A;  4I7A A;  2KCC A;  1BR9 A;  4N9P A;  4XYO A;  4DAV A;  1JX4 A;  4TV8 F;  1XJV A;  4Q43 A;  4DR4 H;  3MA2 B;  1CM9 A;  3MTS A;  2Y0S G;  1CSP A;  5KFH A;  4UCT A;  3BG5 A;  4A4I A;  3NWT A;  4A3E G;  5I6Y A;  4FYD A;  1G91 A;  1IW7 D;  4B9X A;  4UHV A;  5DLF A;  3D6C A;  2X6G A;  1VQF A;  1FJG Q;  2VY3 A;  3X3N A;  4LF6 L;  4X3U A;  1VQB A;  4TRD A;  4A3K B;  2OEO A;  4NDX A;  2ZJQ A;  5D65 A;  3CC2 A;  1VCI A;  3A55 A;  4IPG A;  4N9T A;  1E1O A;  2NWG A;  2L1B A;  3HKS A;  3PUY A;  4U68 A;  2PQA B;  2GPS A;  1U4P A;  3F1Z A;  4HNU A;  4MTD A;  1GSO A;  3WNZ A;  2EYL A;  2L15 A;  3FDS A;  2HDM A;  4JUZ A;  3KK7 A;  5KG3 A;  4YR3 A;  4YY3 L;  1Q86 C;  3EIV A;  1ZHQ A;  3T1H Q;  3S14 H;  4ECY A;  1YBY A;  4N8X 1;  3BDL A;  2W8L A;  3GTO B;  4O0A A;  2UVR A;  2F0O A;  2NTT A;  2B2W C;  1JB3 A;  4A3F H;  2ICI A;  5FLM G;  1NE3 A;  4CHT B;  3R2I A;  1EWC A;  1JQY D;  4JI2 L;  1HHV A;  2EY2 A;  3H0G G;  4L8J A;  4DPG A;  1O78 A;  2QK4 A;  4RB2 C;  3A7A B;  2ZM6 Q;  3A8K E;  2VS1 A;  4HJ5 A;  2R7Z B;  4A3B H;  4DK0 A;  3KAJ A;  4KY5 A;  2A8V A;  2K01 A;  4O4I F;  1K8M A;  2A68 C;  4OO1 H;  4QCL A;  4GLX A;  1J9O A;  1OXS C;  4XT1 B;  2K14 A;  5M5W H;  5ELF A;  2OXP A;  3AFQ A;  5IT9 W;  1CSQ A;  4LFB L;  4OIK A;  1AUV A;  1BKB A;  1GUG A;  3PUW A;  4B3M Q;  1VDZ A;  3LWE A;  3QWN A;  4DV2 Q;  1PZK D;  4FM9 A;  4FXK C;  4KN7 C;  4JI7 Q;  1B9N A;  1MI2 A;  3I2Z A;  2W6N A;  2NU9 B;  2EYJ A;  4LF6 H;  3BDO A;  2FPP B;  1EY7 A;  5F9L A;  1KNA A;  3ORQ A;  4G3I A;  2RA4 A;  4JBK A;  4UDU C;  4JV2 A;  1XNR H;  4N8F A;  2O2L D;  4Y52 H;  3R8B A;  1VQ8 A;  4MV1 A;  2EXD A;  4JI3 Q;  1YNJ C;  3X3M A;  1EQV A;  2F0F A;  2WAQ B;  3GID A;  4GKK L;  2NU7 B;  1SE4 A;  2FLN A;  2FMM A;  4PZ8 A;  1RTO A;  3NP8 A;  3S1M B;  3FPP A;  3LNN A;  5M5Y H;  3Q1K A;  3J7A 5;  1KNE A;  4G7Z C;  1IBM Q;  5COY A;  1PH9 A;  2VA2 A;  4JV5 H;  3CME A;  2K32 A;  2YYZ A;  2ZJT A;  3S1Q H;  1K3R A;  4MV6 A;  1A15 A;  1OXT A;  2DJG C;  3TP8 A;  1GUO A;  5EWF A;  1ENF A;  3S14 B;  2EDG A;  4A3M H;  4K5V A;  4R8N A;  1ZHS A;  1JDE A;  4YCW A;  1KRT A;  1HTL D;  5HY6 A;  4XX0 B;  4ZOL F;  2D5D A;  3OIP A;  1L1O A;  3SGI A;  2W71 A;  4AQY Q;  3QJY A;  4YBZ B;  3MEF A;  2W7O A;  5NUC A;  5KGU A;  2N78 A;  3EBE A;  3SK6 A;  1VQ6 A;  4OWW B;  1SE2 A;  2UU9 L;  3T1Y Q;  1JT8 A;  3BJY A;  4EYI B;  3HZX A;  4U6P A;  2E2H H;  1II3 A;  4ED2 A;  5KYL A;  4YR2 A;  1PH4 A;  1EQR A;  1STH A;  1JWM D;  5M3M G;  2EVB A;  5K36 G;  1S3O A;  1M6V A;  4FXD A;  4LFA Q;  2LMC B;  4JC0 A;  2F0J A;  1M4V A;  1PVO A;  2F0E A;  2AUK A;  4ZQI A;  3C0F B;  4JV0 A;  4G57 A;  2W6P A;  2V4D A;  1NR4 A;  1ICW A;  1ESR A;  3C3L A;  4C56 C;  4GKJ H;  1IBL H;  4EVO A;  1YHQ A;  4QWB A;  2B2T C;  1I6H B;  2DZD A;  3KHG A;  2AQ4 A;  4QGU A;  1HFN A;  3OHA A;  1IZ6 A;  4GLV B;  2K03 A;  5IYZ F;  1WTR A;  1E0B A;  1I3Q H;  2L0C A;  1PV4 A;  1OXX K;  4YAK B;  5J22 A;  1SCU B;  2F0T A;  4KHP H;  4LF5 H;  2AWN A;  3ERQ A;  3T5J A;  2JK8 A;  2B2U C;  2A1A A;  2RBM A;  3J81 j;  5C0X J;  2E2I H;  4GKK Q;  2F0K A;  1FNV A;  2W6O A;  1K3B C;  4ZKC B;  4OL7 A;  3NE5 B;  4I7H A;  4M9U A;  1I7L A;  3S1Q B;  5JOB A;  4LFA H;  3BA8 A;  1ENA A;  4A3D B;  1L0X B;  4LH6 A;  2BQU A;  1LTB D;  2XVS A;  2UXD L;  2J9G A;  4YWL A;  4RKB A;  5IWA Q;  3MC0 B;  4XXE A;  2O5J C;  5FLM H;  4APM A;  4H44 C;  4X65 Q;  3MR2 A;  4J9Q A;  4UCU A;  5J1Z A;  4EGV A;  3NHH A;  2C22 A;  1QZH A;  1TQO A;  1FVI A;  2JJQ A;  3GTJ H;  4O3N A;  1QUQ A;  2KHS A;  4X3T A;  3TIN A;  1IKM A;  5KNC A;  3HOZ H;  1XPU A;  3L3O C;  3RGZ A;  4O42 A;  1BCP C;  3M4O B;  3UDI A;  1MSH A;  1T3N A;  2ALY B;  2PVP A;  4IZO A;  2DN8 A;  1FYC A;  1CQI B;  2WB1 G;  2CQA A;  3CPF A;  3HKZ B;  4BY7 G;  1I3Q B;  3MR3 A;  1E2V A;  2I5M X;  2WV6 D;  4RMF A;  4HJ9 A;  1GM5 A;  1EQQ A;  4O4H F;  4UCS A;  3BG3 A;  5C44 B;  1ZYR C;  3CU7 A;  5KG0 A;  4HIO A;  4QWD A;  2F3I A;  1ML0 D;  4NLG A;  2F0Q A;  3RLF A;  2W7P A;  5M5W B;  1BNC A;  2K5D A;  2I0Q A;  2UXB H;  4RNM A;  3T5K A;  4LWC A;  5DEH A;  4A3B G;  1E22 A;  2R61 A;  4DL7 A;  1I50 H;  2W70 A;  4IFD I;  3E5N A;  4DAY A;  3OW2 A;  2R93 G;  1TVX A;  1VQ4 A;  4QUC A;  1EOV A;  5KFP A;  1R9T B;  2X69 A;  2HHH L;  2R92 H;  3HOV B;  4DL2 A;  1Y1V G;  4KJN A;  3TP6 A;  2AWO A;  5M3M H;  1KDB A;  5K36 H;  4DR7 L;  4DAP A;  4H13 C;  1L1O B;  3TN2 A;  2CZG A;  3OSN A;  4F50 A;  1S03 G;  4YY3 H;  3GTK H;  1N33 H;  3T4A C;  1E4E A;  1S0M A;  3KOJ A;  3VYT A;  5C0X H;  2K5W A;  4LSX A;  5KFK A;  3RLN A;  4LSA A;  4ED0 A;  2KOL A;  4LF7 L;  3HOU B;  4BXX H;  2JEJ A;  3QIA A;  4RGO S;  2E5L L;  3J81 E;  3CCE A;  4ZHQ F;  3V4S A;  4DL4 A;  1MJE A;  3K0Y A;  1HR0 H;  1VQ7 A;  1A0I A;  2Z6K C;  2YYA A;  1LT5 D;  1FJG L;  3TS2 A;  1EIH A;  3RIZ A;  2XIW A;  1U4M A;  2WII B;  2XCL A;  1A9X A;  4DR1 H;  4QW8 A;  1KLU D;  2N3S A;  2HHH H;  1SEI A;  1RJP A;  5L1I A;  3GD7 A;  1Y1V A;  4HAE A;  3K5M A;  3K3P A;  3I4N B;  2F1M A;  3DMU A;  1JJ2 A;  5J2U F;  2JA6 B;  2NB0 A;  2VQD A;  5JEA J;  4QUF A;  4NMZ A;  4PMC A;  1KJJ A;  1I6V C;  1TAE A;  1Y1V H;  4LNQ A;  3GV7 B;  4F4Y A;  1HNX H;  3CCU A;  3DEP A;  4RZQ A;  1Y8N B;  1PH3 A;  2VR1 A;  5LMU Q;  2XCA A;  1NNX A;  1SMY D;  2O4X A;  1HXY D;  5IWA L;  2Z6K A;  5LHY 1;  2V4R A;  4IUT A;  1PH5 A;  5KFI A;  3I8Z A;  3OTO L;  3O13 A;  1RIP A;  3J80 L;  5M3F H;  3KXY T;  3BVG A;  1LYL A;  4H02 A;  1K8A C;  3RNU A;  3HKZ G;  3H20 A;  3UFX B;  4JI4 H;  4DR7 H;  2RDG A;  3EFX D;  1YJN A;  3DUZ A;  1TS2 A;  5ISR A;  1SRU A;  5D3I B;  4A3G B;  2WYO A;  1JE4 A;  4HIM A;  4YJ2 F;  1D5M C;  3E0J A;  5KFC A;  1NMF A;  2WB1 A;  1G2S A;  5IGD A;  3S9W A;  3RZD H;  3KLS A;  4IUR A;  1EFW A;  2UXD Q;  4R7R A;  1HNX L;  1PZI D;  1ZEQ X;  4A75 A;  1XMO Q;  2EPB A;  1ASZ A;  1VQN A;  2YRX A;  1D5X C;  2JA5 B;  3T1Y H;  3S17 B;  2XRQ D;  3D0F A;  3TP5 A;  4A3B B;  2GVB A;  3HOW G;  4LF4 Q;  3N6R A;  1QOH A;  2PN1 A;  2I5L X;  4HCE A;  4YHH L;  3TME A;  2MGS A;  3CCM A;  3G48 A;  5IY0 A;  1HA5 A;  2YU9 B;  3BVZ A;  2JEG A;  4GOP C;  4L5T A;  1BQQ T;  2VQF Q;  4O3Q A;  2ZTE A;  3A5Z B;  3MWY W;  4IQZ A;  4JW0 A;  2ICE C;  2IX1 A;  2Z9H A;  3CCR A;  2FLL A;  4JI7 H;  2DNE A;  1Z2O X;  1M0T A;  1N48 A;  3SK8 A;  4FXG C;  2AGO A;  3PW7 A;  4IHJ F;  1T5X D;  2C2R A;  4BBR B;  1S4Z A;  3G6X A;  1SYC A;  5LL6 S;  2MCT A;  3GTM A;  5LMN Q;  1WI5 A;  5JEA H;  4JYA Q;  2JN4 A;  4KY7 A;  4U67 3;  1BBX C;  2E5L Q;  3ER0 A;  5I9O A;  4M7E A;  4I50 F;  3I90 A;  3J81 c;  3T56 B;  1ZKO A; 
#chains in the Genus database with same CATH homology
 3HOY G;  2AMC B;  3UDF A;  4A93 G;  1K9M C;  4LF4 L;  4BBR G;  3L0O A;  1U5K A;  3I4M H;  1JE5 A;  3ULL A;  3PUV A;  2JA7 G;  5IYD H;  1VQ9 A;  4JG2 A;  1WYD A;  4BY1 H;  1B70 B;  4B3S Q;  1C0A A;  2VUM H;  5H1S E;  1B7Y B;  4L5R C;  5DLQ E;  4LUV A;  2VZA A;  4TQU S;  3RR5 A;  4DV1 Q;  2WB1 E;  3RZO H;  2XTI A;  2EQS A;  2VQE L;  1L1O C;  4B3T Q;  4NXN Q;  2HQL A;  2CWA A;  1PYB A;  4R4O A;  4RG1 A;  3J81 i;  3KJO A;  4BY1 G;  2UXB Q;  1WCM H;  4DNI A;  1XNR Q;  1KXL A;  4DUZ L;  1E1T A;  3GTQ H;  4A3K G;  5C44 H;  4EX5 A;  4JI6 L;  1JB7 A;  1D7Q A;  4AYB G;  4A93 H;  3IRB A;  4JV5 L;  5M5X H;  1J5E Q;  3PIP A;  4C3I H;  4BY7 H;  1YIJ A;  2OQ0 A;  3CF5 A;  3TQY A;  5IYD G;  1SN8 A;  2GN5 A;  1IBL L;  3KFU A;  3M4O H;  4DR6 Q;  5LMN L;  4IFD J;  2I5H A;  2CQO A;  4A3C H;  1BBW A;  3NEN A;  2ZJP A;  4WJ4 A;  2KCM A;  4DV5 Q;  3K80 C;  1TXY A;  2NZH A;  2KEN A;  1QVF A;  1MIU A;  3PO2 H;  4X66 L;  1VQD A;  2D0O A;  1VQP A;  2KHI A;  1A63 A;  2KCT A;  4X64 L;  3S24 A;  1CKN A;  2EIF A;  4GNX B;  3PO3 H;  3E0E A;  3J80 c;  1PA6 A;  3A0J A;  3FHW A;  4IJH A;  1KAW A;  4HJA A;  1A62 A;  3F2D A;  2RCN A;  1QUQ B;  2CKZ B;  2RHS B;  2K5V A;  1GD7 A;  4GN5 A;  1K0R A;  4A3D H;  4LF8 Q;  1HNW L;  1UE7 A;  1YHB A;  2B63 H;  1N9W A;  1N34 L;  1LTL A;  4DV5 L;  3A74 A;  1EUJ A;  2VNU D;  1CKO A;  4IOC A;  1XPR A;  2UUC L;  4KHP L;  4QQB X;  2RHQ B;  4P75 A;  1KHI A;  2OWO A;  2F52 A;  1OXV A;  2ZM6 L;  4AIM A;  2B3G A;  4DV6 Q;  3CCL A;  2C35 B;  4C3J H;  4A3C G;  4GN4 B;  4P72 A;  1N32 Q;  3CAM A;  4IOA A;  3M4Q A;  3PCO B;  5IP9 H;  4DK6 C;  4DKA C;  4A3K H;  4GLA C;  3PO3 G;  1XNQ Q;  3S2D H;  1FGU A;  1CKM A;  4PZ6 A;  4GKJ L;  4OO1 I;  4LF6 Q;  1N36 Q;  1BBU A;  1C7Y A;  2Q2U A;  2F4V L;  1P16 A;  1PHJ A;  3PGZ A;  4A3J H;  1C9O A;  4LFA L;  3KJP A;  3F8T A;  4B3R L;  1NY4 A;  4DR2 Q;  3CMA A;  4DR7 Q;  1I6H H;  4YHH Q;  5JJI A;  4KI0 A;  4JI1 L;  1XJV A;  1E24 A;  2Y0S G;  1CSP A;  3S16 H;  1VQG A;  1KC8 C;  2MO1 A;  4A4I A;  2IHE A;  4K0K Q;  1XNR L;  1AE2 A;  4A3E G;  4LF5 L;  2R7Z H;  5C4J H;  3L2P A;  1JJG A;  4DAY B;  1VQF A;  3BU2 A;  1FJG Q;  2VY3 A;  3PUZ A;  4LF6 L;  4IFD G;  1VQB A;  1HNZ L;  3M9B A;  1UWV A;  2BH8 A;  5JJL A;  2ZJQ A;  2K4K A;  3CC2 A;  1VCI A;  4IPG A;  3Q8D A;  4GN3 B;  2CFM A;  5GAD C;  1E7Z A;  4PZ7 A;  1E1O A;  3PUY A;  4EQ5 A;  1HZA A;  2PMZ E;  3HKS A;  3G6E A;  2PQA B;  4DV0 Q;  2ASB A;  2UXC Q;  3HOX H;  1VQK A;  1GVP A;  3F1Z A;  1YJ9 A;  2IX0 A;  3PIO A;  4X66 Q;  4DR5 Q;  4JOI A;  1YEZ A;  1UEB A;  1I5F A;  1VQC A;  2L15 A;  3RN2 A;  2RF4 A;  1XNQ L;  4XTC S;  5ELO A;  4YY3 L;  1Q86 C;  3EIV A;  3T1H Q;  3S14 H;  1N36 L;  1U0L A;  1YBY A;  3HOX G;  2JA8 H;  4O0A A;  3CCQ A;  2OTL A;  2JA6 H;  2JEB I;  4X6A H;  3DM3 A;  2CCZ A;  2R7Z G;  1YHA A;  4KHZ A;  4JI8 Q;  3NEM A;  1PH8 A;  4A3F H;  5FLM G;  1M1K C;  2JA8 G;  1NE3 A;  2NZO A;  5GQO A;  4X65 L;  4DR4 Q;  1DGS A;  4JI2 L;  3GTO H;  3S1M H;  2E8G A;  4BBR H;  1IBK Q;  4C3H H;  2E2J H;  1Q12 A;  3H0G G;  2BA0 A;  4DPG A;  2UXB L;  2ZM6 Q;  4HJ5 A;  1TWC H;  2VS1 A;  4PG3 A;  4YY3 Q;  4R1J A;  4A3B H;  4LUO A;  1N33 Q;  4KLK A;  3BJU A;  2A8V A;  1X55 A;  1IYJ B;  1S40 A;  1HNZ Q;  3CD6 A;  3HOU H;  4JV5 Q;  4NB3 A;  3S1N H;  4B3S L;  4GLX A;  4J15 A;  5GAE C;  1OXS C;  5M5W H;  2K14 A;  5BR8 L;  4DK3 C;  1IBL Q;  4DR6 L;  2K5N A;  1HNW Q;  3AFQ A;  2YTX A;  5HGQ A;  1CSQ A;  4DV0 L;  4LFB L;  3KF8 B;  4HIK A;  3KDF B;  2H5X A;  3UE0 A;  1BKB A;  2D0P A;  3PUW A;  1PH6 A;  4YWM A;  1VQL A;  4B3M Q;  4FDB A;  2MFI A;  2F4V Q;  4DV2 Q;  4WJ3 M;  4P71 A;  2WP8 J;  4JI7 Q;  3I2Z A;  2WAQ G;  2DGY A;  3AYH B;  4LFC Q;  5IYC H;  4BA2 I;  2Q2I A;  1MKH A;  3M85 A;  4JI4 Q;  3PO2 G;  3K7U C;  3H0G H;  5LMU L;  1V1Q A;  2NVQ H;  4JBK A;  1QVC A;  5IP9 G;  3STB C;  1W2B A;  5EAY A;  1KD1 C;  3RN5 A;  4Y52 H;  1K83 H;  3H3V H;  3U50 C;  1RL2 A;  3TEH B;  4A3M G;  1VQ8 A;  3HOZ G;  2EXD A;  2VUM G;  2R6G A;  4JI3 Q;  4LF9 L;  2UUB L;  1IBK L;  3GTP H;  3CQZ H;  2JA7 H;  4B3R Q;  4GKK L;  3J80 i;  4PZ8 A;  5C4X G;  4X62 Q;  2Q2H A;  5M5Y H;  3J7A 5;  1IBM Q;  2Q2T A;  3GO5 A;  1PH9 A;  4L5S A;  1G51 A;  3CME A;  3STB D;  2HIX A;  2YYZ A;  4A76 A;  3S1Q H;  1K3R A;  4L5Q A;  1OXT A;  4MNO A;  3FKI H;  4JI4 L;  1Z9F A;  2NN6 I;  2PI2 E;  2KHJ A;  1N8R C;  1HJP A;  3GTM H;  4A3M H;  4AYB E;  3F2B A;  2UUA Q;  4YCW A;  4HJ8 A;  1KRT A;  2UUC Q;  3I4M G;  5HY6 A;  3PV0 A;  3SGI A;  1L1O A;  1CKN B;  4DR2 L;  4AQY Q;  4JCV E;  4QL5 A;  3MEF A;  1PH7 A;  4POG A;  5ELN A;  3ULJ A;  2PNH A;  2FXQ A;  2N78 A;  3EBE A;  2VQE Q;  3UE1 A;  1Y1W H;  1HR0 Q;  1IBM L;  4OWW B;  2UU9 L;  3T1Y Q;  5JJK A;  1JT8 A;  4JBW A;  3F2C A;  1VQA A;  3FP9 A;  1H95 A;  1Y1W G;  1EWI A;  1SFO H;  3EN2 A;  2E2H H;  1HNX Q;  3M3Y H;  3VDY A;  5M3F G;  3PF4 A;  1PH4 A;  1EQR A;  2ES2 A;  4IJL A;  2YV5 A;  3M7N A;  2YTY A;  5M3M G;  5K36 G;  4LF9 Q;  2JA9 A;  1S3O A;  4UP9 A;  4R4T A;  3DLL A;  1HH2 P;  5C4X H;  1J5E L;  3L7Z C;  4LFA Q;  3I56 A;  1XPO A;  1Q81 C;  4C2M H;  3D31 A;  5AJ3 L;  4JC0 A;  4P74 A;  1PVO A;  1UE5 A;  1TWA H;  4A3F G;  1ASY A;  1I94 L;  2VW9 A;  4DUY L;  1WOC A;  1HR0 L;  1OXU A;  5LMN W;  1X65 A;  1YVC A;  2MNA A;  3MXN B;  2D62 A;  3BZK A;  1YHQ A;  2JEA I;  1Q46 A;  5J3B A;  4JI7 L;  4QGU A;  2GVA A;  1R9T H;  1IZ6 A;  3GDE A;  1IL2 A;  4MZ9 A;  4GLV B;  4A3E H;  2AHO B;  4XIG S;  3S1R H;  1I3Q H;  4JOI C;  1L2F A;  5GAG C;  1QZG A;  1PV4 A;  1OXX K;  2LXJ A;  2JE6 I;  2ZJR A;  3ULP A;  2ZTD A;  3K81 C;  4NPS A;  4JI8 L;  4OXP A;  3CP0 A;  1HR0 W;  1XMO L;  4A3D G;  2IY5 B;  1HZ9 A;  2AWN A;  1I94 Q;  2UU9 Q;  2B29 A;  2VL6 A;  2HIV A;  2JK8 A;  5C3E H;  2A1A A;  2ID0 A;  3UDG A;  4A3L G;  1WCM G;  1YNX A;  2PI2 A;  3KF6 A;  4YCU A;  3J81 j;  5C0X J;  2E2I H;  4GKK Q;  4OON A;  1UE6 A;  4A3I H;  1LM0 A;  4LFC L;  4APV A;  4DR1 Q;  1K73 C;  4UP7 A;  5IYB H;  4DV6 L;  1VQ5 A;  1X9N A;  3S2H H;  1MJC A;  2N8N A;  2BA1 A;  3HFZ B;  3CCS A;  1EFW A;  2OTJ A;  4A3L H;  4LW1 A;  1WJJ A;  3JAM i;  2JA6 G;  2UXD L;  1YI2 A;  1GO3 E;  2MO0 A;  4YWL A;  1G6P A;  4DV3 Q;  5IWA Q;  1JMC A;  1YZ6 A;  5FLM H;  2WFW A;  4X65 Q;  4DR4 L;  4DAM A;  4YWK A;  3S15 H;  4HID A;  1QZH A;  2WAQ E;  1FVI A;  2JJQ A;  3GTJ H;  3U58 A;  1QUQ A;  1V9P A;  3ZJY C;  4GOP B;  2JA5 H;  4JI0 L;  1P8L A;  3GTL H;  3AFP A;  4JI6 Q;  3UDX A;  4AQY L;  4A3I G;  3HOZ H;  1GKH A;  2NVY H;  5C3E G;  1XPU A;  4GNX A;  5IT9 c;  2UXC L;  4BBS G;  3H15 A;  5C0X I;  3UDI A;  4NXM Q;  2BH2 A;  2ALY B;  3JAM c;  4DR5 L;  5BR8 Q;  4OO1 G;  5C0X G;  2WB1 G;  3CPF A;  4BY7 G;  5E7N A;  4LFB Q;  2I5M X;  4RMF A;  4HJ9 A;  1GM5 A;  1AH9 A;  1HZC A;  1D8L A;  1EQQ A;  2UUA L;  2K52 A;  3FKI G;  1T9H A;  4OWT B;  4DV2 L;  4HIO A;  3S17 H;  5AJ3 Q;  2F3I A;  2YTV A;  1Q7Y C;  3NBH B;  1QVG A;  4A3G G;  1KIX A;  3K8A A;  3RLF A;  4DV4 L;  3ERS X;  2K50 A;  4DR3 Q;  3JC6 6;  4P73 A;  1HZB A;  2I0Q A;  4LF7 Q;  4A3G H;  1Q1E A;  2QEX A;  1KRS A;  1W3S A;  1N32 L;  1WFQ A;  1G29 1;  4LWC A;  2XGT A;  4A3B G;  5IP7 G;  3B6Y A;  2QGQ A;  1E22 A;  5C44 G;  4DV7 Q;  3TS0 A;  3HOU G;  1YIT A;  1I50 H;  1LUZ A;  4IFD I;  4QJF A;  1VQM A;  2B63 G;  3W1G A;  3CPW A;  4GKJ Q;  2UXD Q;  3W5O A;  3OW2 A;  2R93 G;  1VQ4 A;  3U4V A;  4GNX C;  1EOV A;  4QIW E;  2HHH L;  2R92 H;  4OX9 Q;  1Y1V G;  4OWX B;  2AWO A;  2LSS A;  5M3M H;  1VQ6 A;  4Y7N H;  3I4N H;  1L1O B;  2NVX H;  1XTD A;  4DR7 L;  3AQQ A;  1TWG H;  3GTK H;  1L0W A;  4DR3 L;  3KOJ A;  4R4C A;  1SMX A;  3RLN A;  3U4Z A;  2K5H A;  1Q1B A;  4JI2 Q;  4JBJ A;  4LF7 L;  4BXX H;  4TVA B;  3I55 A;  4ALP A;  2ZTC A;  1M90 C;  2E5L L;  3CCE A;  3I4N G;  4DUZ Q;  4GOP A;  1MJE A;  3I4O A;  3HOY H;  1VQ7 A;  3A5U A;  1A0I A;  2HT1 A;  1N33 L;  2Z6K C;  2N49 A;  1Z47 A;  1VQH A;  4UP8 A;  5GRO A;  3E9H A;  1FJG L;  3TS2 A;  3ICE A;  3TRE A;  2N3S A;  1VS0 A;  1NJI C;  3CC7 A;  1X6O A;  4DV3 L;  3GD7 A;  3WWV A;  3OYY A;  3CW2 C;  2Y0S E;  1N34 Q;  3OTO Q;  1JJ2 A;  5FJ8 G;  4JI3 L;  2YU9 H;  3M4P A;  1NTG A;  2R93 H;  1X3E A;  1XMQ L;  5JEA J;  2NVT H;  4X64 Q;  1VQE A;  1Y1V H;  1SE8 A;  2AKW B;  2R7F A;  3G4S A;  3CCU A;  4DR1 L;  1YJW A;  1CUK A;  1EYG A;  1EIF A;  1A8V A;  3KYH C;  4IPH A;  1PH3 A;  4UY8 C;  1EIY B;  3T1H L;  2HHH Q;  1AE3 A;  5LMU Q;  4OX9 L;  1PFS A;  3HKZ E;  3PSI A;  3HOW H;  4UPA A;  3CCJ A;  1UE1 A;  1KQS A;  5IWA L;  2Z6K A;  2QA4 A;  4DV1 L;  1PH5 A;  4HJ7 A;  1PH2 A;  1Y14 B;  3KLW A;  4LUZ A;  2PQA A;  1RIP A;  3OTO L;  4A3J G;  3K0X A;  5GAH C;  5M3F H;  2UUB Q;  3HOV H;  1LYL A;  4H02 A;  1K8A C;  3NEL A;  3HKZ G;  3RNU A;  4KHP Q;  5IP7 H;  3W1B A;  4JI0 Q;  2OQK A;  4DV4 Q;  4GS3 A;  4X62 L;  1YJN A;  1VQO A;  1VQI A;  1IXR A;  1SRO A;  1SRU A;  1TWF H;  2VQF L;  4JI5 Q;  4BBS H;  1Q8K A;  4IPC A;  1X56 A;  3LGJ A;  5FJ8 H;  1NMF A;  3CXC A;  1SR3 A;  4HIM A;  4K0K L;  1FL0 A;  3E9I A;  4BA1 I;  1PYS B;  1NBW A;  1NMG A;  3CCV A;  3RZD H;  4IO9 A;  1HNX L;  3I7F A;  1JJC B;  1E3P A;  4A75 A;  1XMO Q;  1K8G A;  1ASZ A;  1VQN A;  5IE8 A;  4LF8 L;  3D0F A;  1O7I A;  2Z0S A;  2GVB A;  3BZC A;  4LF4 Q;  5IYB G;  2LXK A;  5FLX c;  3HOW G;  4POF A;  3TRZ A;  2DUD A;  4R4Q A;  1XMQ Q;  2IHF A;  2I5L X;  1KL9 A;  4O2D A;  2CWP A;  2JQO A;  4PMW A;  1BVS A;  1TWH H;  1X3G A;  4YHH L;  1OTC A;  2K75 A;  3G48 A;  5IY0 A;  3CCM A;  2ATW A;  2A19 A;  2MQH A;  3HOV G;  2OCE A;  2KBN A;  4JYA L;  3AEV A;  4GOP C;  4JBM A;  1PH1 A;  4L5T A;  1SLJ A;  3T1Y L;  4DUY Q;  4JI5 L;  2VQF Q;  4NXN L;  2ZTE A;  3A5Z B;  4R4I A;  4ME3 A;  2JA5 G;  3CC4 A;  4NXM L;  2IX1 A;  4DV7 L;  3J7Z C;  3CCR A;  3RLO A;  3KDF A;  1X54 A;  4AH6 A;  1V43 A;  4B3M L;  2NN6 G;  2R92 G;  3GTG H;  3G71 A;  4QY7 A;  1B8A A;  4MTN A;  3PUX A;  3PF5 A;  4YCV A;  4LNQ A;  5LMN Q;  2R7D A;  1WI5 A;  5IYC G;  4JYA Q;  2IT1 A;  1X3F A;  4JI1 Q;  1Q82 C;  2V1C C;  4B3T L;  4BXX G;  3KF6 B;  1J6Q A;  3H3V I;  3K7A H;  2E5L Q;  3ER0 A;  5JEA G;  1VQJ A;  1S72 A;  4IPD A;  3J81 c;  4LF5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...