1GO3E

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
184
structure length
177
Chain Sequence
MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPEMYELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSYDPKAIIGKETGKVLEIGDYVRARIVAISLKASKIALTMRQPYLGKLEWIEEEKAKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 39
structure length 177
sequence length 184
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1go3E01
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1go3E02
4X64Q 3G48A 4DR4Q 1HR0Q 1GD7A 2GN5A 3JC66 1V43A 3AFQA 3S1QH 5EAYA 2BA0A 5IYCG 4HJ5A 3IRBA 1VQHA 2N8NA 4PG3A 3CQZH 3AQQA 3FKIG 1GKHA 3PUVA 1N34Q 5ELNA 3KF6B 4GKKL 1VQ5A 5LMNQ 2EQSA 3RZDH 2UXCL 4GOPB 1HZBA 3A5UA 3M3YH 2CQOA 3K7UC 4HIOA 3CMEA 1LTLA 3TS0A 4HIKA 4LF5L 1JE5A 1YHAA 2JK8A 4L5TA 2DUDA 2RHQB 1L1OB 4B3TL 2JA7G 2A8VA 2VUMG 4IFDG 2A19A 1NMGA 1TXYA 1W3SA 4LUVA 4GNXA 3RN5A 2LXKA 2R7FA 2R7DA 5JEAG 4GKKQ 2VQFQ 3EIVA 4GN3B 3ULJA 1KC8C 1N33Q 1VQMA 2HT1A 3HOVG 2OWOA 4JI6Q 2UXCQ 4QJFA 2VQEL 1PHJA 2KCTA 2YTYA 4IFDI 1L1OC 4P73A 3M7NA 4LW1A 4GKJQ 3OTOQ 4LF5Q 1C0AA 4DR6L 4O0AA 2NZOA 3OW2A 4BBRH 4B3TQ 1KIXA 3HOYG 2UUAL 1VQGA 4J15A 1IBML 3L7ZC 1XPOA 1CUKA 3PV0A 3GDEA 1E24A 1HR0W 1K0RA 1X9NA 4JI5L 2E8GA 5IWAL 1XJVA 1IZ6A 1BKBA 1KL9A 5E7NA 4H02A 2VQEQ 3HOZH 1AH9A 1E3PA 5GAGC 1XNQQ 3BJUA 1K9MC 3BU2A 4MZ9A 5LMNW 1QUQB 5C3EG 2AMCB 5FJ8G 1EOVA 3CCMA 2WAQE 1I6HH 4DR6Q 3G4SA 4BXXH 4DUYQ 1L0WA 3PCOB 1IBMQ 2UUAQ 4P74A 4JBJA 3PIOA 2RHSB 2PI2E 1CKNA 4PMWA 1LM0A 4JI5Q 1L1OA 4YWMA 3MEFA 3T1YL 3HOUG 3UDXA 4DV4L 3T1HQ 4LF6L 3S2DH 1X6OA 4HIDA 2N78A 4DV5L 1VQIA 3AFPA 4P75A 3ERSX 2K5HA 4DV6L 3BZCA 2HHHQ 2KCMA 2K5NA 3RR5A 2R7ZG 1HJPA 2B29A 3K8AA 4A75A 1Q82C 2JA5G 1TWHH 4X6AH 4XIGS 1N36L 1E7ZA 3CD6A 1NJIC 1GO3E 2Q2UA 2KENA 1VQFA 2LSSA 3KDFA 3PO3H 1VQ6A 2Y0SE 4MNOA 1PH3A 4DV5Q 1C7YA 4JOIC 3S1NH 1K73C 4DV6Q 3VDYA 1SROA 1XMQQ 5C0XJ 1VQ8A 4QY7A 3PO2H 1VQAA 1HNZL 1QUQA 2Z6KC 4OWXB 1N36Q 1Q12A 3HKSA 4DR1L 4A3BH 4NB3A 1HZ9A 4YCVA 1SE8A 2K5VA 3D0FA 3S1MH 1HH2P 1WJJA 2AKWB 2KBNA 2I0QA 3F2BA 1T9HA 3EBEA 4DR7L 4DUZL 2RCNA 1XMOQ 1G6PA 2JJQA 4A93H 4OWTB 1N32L 4A3KG 2VUMH 4QL5A 1HNZQ 1VQDA 2D62A 3CCEA 1B70B 1A62A 4A3LH 1J5EQ 2K52A 3PGZA 5M3MG 4C2MH 5IE8A 4JBWA 4JOIA 5JJIA 3CCRA 5FLMH 3L0OA 1Y1VH 2UUCL 1QZGA 3I4OA 1S3OA 3M4PA 3I55A 4GNXB 2Z6KA 3HOYH 1N32Q 4BY7G 3HKZG 3CPFA 2Y0SG 2CWAA 4DR5L 3CPWA 1OXSC 4IPGA 2ATWA 2BH2A 1XPUA 3J80i 1KD1C 4R4QA 4DV0L 1VCIA 2CFMA 3CP0A 4GLVB 4GNXC 3GTLH 2E2JH 3A5ZB 3OYYA 4JCVE 4DR2L 2CCZA 4BBSG 2BA1A 4KI0A 1JMCA 2UUCQ 4LNQA 5C3EH 4OO1G 5FJ8H 2Q2IA 4AIMA 2ID0A 3PIPA 3KJOA 3E0EA 4JI3L 4JI1L 1IXRA 1X3EA 1YJ9A 3GTGH 4DR5Q 4QIWE 1IL2A 3PO2G 1RL2A 4P72A 4R4OA 1O7IA 1EYGA 1U5KA 1BBUA 2ALYB 1SMXA 2H5XA 4JI8Q 3U50C 1YJWA 4A3BG 1OXVA 4B3SL 1RIPA 4DR2Q 3ULLA 4GN5A 5AJ3L 1HZCA 3FP9A 1HNXQ 3K80C 1FL0A 4DR7Q 4JI3Q 4JI1Q 3WWVA 1VQ7A 2JEAI 1CKNB 4A93G 1UE1A 2R7ZH 4K0KL 3J81i 2JA5H 3S16H 4R1JA 4JV5L 4A3LG 1WYDA 3TQYA 5C4XG 1X65A 1SR3A 4PZ6A 3HFZB 1M1KC 5FLMG 1BVSA 1PFSA 1VQKA 3PSIA 4DV2L 3UE0A 1Y1VG 2NN6G 3GTKH 1JJCB 1I50H 3STBD 3F8TA 1KQSA 1LYLA 4NXML 1Z9FA 4IJLA 3KDFB 4X65L 4JV5Q 4IFDJ 2MNAA 1UWVA 1YNXA 3GTMH 4JI0L 2JA6G 1D7QA 1W2BA 3TEHB 3RLFA 1PH5A 2Z0SA 4WJ3M 5JEAJ 1AE3A 3UDIA 2HIXA 4P71A 2B3GA 4C3HH 1OXXK 3PUWA 2VNUD 1A63A 3Q8DA 1YBYA 4A3KH 4DV7L 3BZKA 4OX9L 1CKOA 5H1SE 4NXMQ 1Q1EA 2WFWA 4R4TA 4X65Q 3RLOA 1PH2A 2OCEA 5M3MH 1V9PA 4JI0Q 1OXTA 2R92H 5IWAQ 3PUZA 5K36G 1YHBA 3U58A 4O2DA 2WB1G 3S24A 1UEBA 3PUYA 4EQ5A 5FLXc 4GLAC 4JC0A 3HOXH 4BY7H 2UXDL 2IT1A 1VS0A 2D0OA 1I94L 5GAHC 1VQBA 5DLQE 4OX9Q 2D0PA 3M4QA 4DV1L 4A3EH 1IBKL 1LUZA 2NVYH 2YTXA 2QGQA 3K7AH 1X56A 1HNWL 1KHIA 4XTCS 2JA8H 1QVCA 3JAMc 1UE6A 4A3CG 4A76A 2EIFA 3T1YQ 2V1CC 4DV4Q 4BBSH 2YYZA 1X3FA 3ZJYC 5GQOA 5J3BA 3CC7A 3GTPH 4LF6Q 1NE3A 3HKZE 1ASYA 3DLLA 3CCJA 4HJ8A 4A3JH 2ES2A 4Y52H 1K3RA 2OTLA 3HOWG 1N8RC 4GS3A 3CCLA 2F52A 3EN2A 4DV1Q 1ASZA 5C0XG 3CCVA 1B7YB 2E5LL 1HNWQ 1WCMH 5C44H 3FHWA 2CWPA 4DV3L 4A3FG 3TRZA 4LFAL 1PH6A 4JG2A 1Q7YC 4BA2I 3F1ZA 3J81c 1YIJA 4B3ML 1Y1WH 5LMUL 4YHHL 3DM3A 2VY3A 4DAYB 5C4JH 1PH4A 1QZHA 1G51A 3KFUA 2AWOA 1KAWA 1V1QA 2N49A 4GN4B 4OXPA 1PYBA 1IBLL 1PH1A 2UU9L 4B3RL 4UP9A 3UE1A 3ER0A 2E5LQ 4JBKA 3S17H 3ULPA 1M90C 4DV3Q 1WFQA 3K0XA 5C4XH 3H3VH 4YWKA 5IYBH 4DR1Q 3I4MH 3S15H 2BH8A 2MO0A 4L5RC 2VL6A 3M9BA 4B3MQ 4EX5A 5LMUQ 2R92G 3LGJA 4YHHQ 1H95A 4C3JH 4LFBL 1JJGA 4A4IA 1EQRA 3CCSA 3S14H 3S1RH 3AEVA 4KHPL 2LXJA 4DUZQ 4A3IH 4ALPA 4DPGA 1MIUA 1L2FA 2GVBA 3HOXG 3K81C 3HOUH 1JB7A 1IBLQ 3SGIA 1U0LA 2DGYA 4YCUA 1E1OA 3I56A 1MJEA 4A3EG 2Q2HA 4IPCA 1XTDA 1VQNA 5BR8L 2JA6H 4X62L 1GVPA 2JA8G 1NTGA 4JYAL 4FDBA 4YWLA 2NVXH 4A3CH 1JT8A 4AH6A 1MKHA 3RNUA 1YEZA 3CF5A 1EIYB 4C3IH 2I5HA 3I2ZA 4KHPQ 4A3JG 2KHJA 2JA9A 2UUBL 2OQKA 4LFCL 4OWWB 2NZHA 2ZM6L 4QQBX 1TWFH 5BR8Q 4JYAQ 4X62Q 3U4VA 1WCMG 3A74A 1CSQA 4X64L 5C44G 4OO1I 4DR4L 4DV0Q 1VQLA 4JI7L 1SN8A 1P16A 1HZAA 1CSPA 3NELA 2F3IA 1NBWA 3GO5A 1VQ4A 1Y1WG 4R4IA 4IPHA 4AYBG 1VQCA 5GADC 3I4NH 1UE7A 1K8AC 4YY3L 1EWIA 3I7FA 2ZJRA 3GTQH 1AE2A 1EQQA 4LFCQ 2ZM6Q 1PH7A 5JJLA 1PVOA 5M5YH 1YJNA 2K50A 4R4CA 3STBC 2QEXA 1FJGL 1BBWA 2WB1E 5M5XH 5IYBG 1TWGH 4JI7Q 3RN2A 3I4MG 4A3DG 4B3SQ 4LWCA 4L5QA 4OONA 5IP7H 5AJ3Q 4AQYL 3HOWH 4POFA 3H0GG 1CKMA 2VQFL 1E22A 2CKZB 1N33L 4YY3Q 2B63G 1Z47A 4JI6L 4A3IG 4IOAA 3D31A 4A3GH 1I3QH 4LF8L 3J7A5 2VW9A 2N3SA 1OTCA 4POGA 1VQEA 2JEBI 2WP8J 4Y7NH 3H3VI 1TWCH 4A3FH 3OTOL 4GKJL 2ZJPA 1XPRA 1FJGQ 2XGTA 3KLWA 2GVAA 2YTVA 2NN6I 4NPSA 4LUOA 1EUJA 1KRSA 5GAEC 2HQLA 2I5LX 1C9OA 3L2PA 2QA4A 5M3FG 4HIMA 4GOPC 5IYDG 4AQYQ 1Q46A 4PZ7A 4DNIA 4DV2Q 4A3MH 2AWNA 4BY1H 1QVFA 3TS2A 1YZ6A 4DR3L 4WJ4A 1YVCA 4LF8Q 4PZ8A 1XNQL 4JI4L 2RF4A 4LF7L 4UP8A 2PQAA 3AYHB 2IY5B 4KHZA 5M5WH 4DUYL 1Q86C 4KLKA 1PV4A 3PUXA 3KOJA 2IX0A 1TWAH 1S72A 3GTOH 5IY0A 2A1AA 3J80c 2K14A 4HJAA 2JQOA 4DR3Q 3T1HL 3I4NG 4DV7Q 3MXNB 4JI4Q 1A8VA 2OTJA 4LF7Q 3M4OH 3KF6A 1PYSB 3NENA 4GOPA 2HHHL 1P8LA 1N9WA 3NEMA 4IPDA 1KRTA 3F2DA 1WOCA 2XTIA 1EIFA 4L5SA 2R93H 1PH8A 3GTJH 2AHOB 2NVTH 5IP7G 5IT9c 3S2HH 1NMFA 1PA6A 2OQ0A 3RZOH 2UXDQ 2K4KA 1I94Q 5IP9H 4IO9A 1R9TH 1IBKQ 4A3GG 2MFIA 3W1GA 3UDGA 2K75A 3CAMA 4TVAB 3G6EA 1Q81C 1QVGA 2IX1A 1FGUA 4DAMA 1EFWA 1VQ9A 1XMQL 4HJ9A 1VQPA 2VZAA 4NXNL 3M85A 2EXDA 2MQHA 4UPAA 2YU9H 3CCQA 5GROA 4DKAC 3J81j 1VQOA 5C0XI 1SLJA 1YITA 4DK6C 3H15A 4JI2L 1NY4A 3E9IA 4A3MG 3PF4A 4BY1G 2F4VL 4IJHA 3CMAA 2NVQH 4UP7A 3B6YA 2Q2TA 1JJ2A 2VS1A 3UDFA 1HNXL 4UY8C 4K0KQ 1MJCA 4YCWA 3CCUA 4X66L 1DGSA 1XMOL 3CW2C 2PNHA 4LFAQ 1X3GA 4A3DH 1WI5A 4NXNQ 4AYBE 4BBRG 4LF4L 1IYJB 3CC2A 3G71A 2FXQA 2C35B 2E2IH 5IYCH 2WAQG 1Q1BA 4IOCA 1X55A 1J5EL 4RMFA 3FKIH 3H0GH 1J6QA 1SRUA 2IHEA 4JI2Q 2E2HH 2B63H 3NBHB 2F4VQ 2L15A 4DK3C 1GM5A 1FVIA 3GD7A 3CXCA 2IHFA 1Q8KA 3KF8B 1UE5A 1I5FA 1YI2A 1K8GA 2UU9Q 4JBMA 3HOZG 4B3RQ 4QGUA 2ZTEA 3KYHC 2MO1A 4X66Q 3A0JA 2ZTCA 2I5MX 2ZJQA 2JA7H 1X54A 2KHIA 4LF4Q 4BXXG 4APVA 5M3FH 3CC4A 1XNRL 5IYDH 5HGQA 4GLXA 4LFBQ 2R93G 3W1BA 3HOVH 2HIVA 3U4ZA 1KXLA 3PF5A 2JE6I 1PH9A 4HJ7A 3TREA 4BA1I 5IP9G 2UXBL 3RLNA 4LF9L 2YV5A 1OXUA 4ME3A 3F2CA 1S40A 1K83H 5JJKA 5ELOA 4MTNA 3ICEA 1HR0L 3W5OA 1XNRQ 4RG1A 3J7ZC 3KJPA 3E9HA 1SFOH 2PI2A 5HY6A 1G291 4JI8L 1N34L 1VQJA 4LUZA 1E1TA 2PQAB 5LMNL 2ZTDA 2UUBQ 1YHQA 2ASBA 2UXBQ 4TQUS 3PO3G 1Y14B 2R6GA 4LF9Q 2PMZE 1A0IA 1B8AA 3JAMi 1D8LA
chains in the Genus database with same CATH superfamily
3VYUA 4OX9H 1XTCD 2FK1A 3NK9A 2R8HA 2IJ0A 1GD7A 2GN5A 3AFQA 3S1QH 1K0SA 1R4PB 2BA0A 5JAVA 2JEJA 2DJFC 3IRBA 3NTIA 5LYJF 2N8NA 1S03G 4PG3A 2A6ED 2CQAA 2TMPA 1TT2A 4DGZA 4IALA 2IW3A 1WSCA 4ECRA 2CZGA 4UCOA 3A5UA 3M3YH 3P7JA 3K5NA 2CQOA 1WTOA 5FPRA 1B04A 1EYDA 4HIOA 4CKBA 3TS0A 3GIJA 1TWHA 4TUYF 4DV1H 4IFDG 4V190 2EYFA 1FYCA 2RHQB 2J0TD 2A8VA 2JA7G 1YNNC 2D2CC 2VUMG 4ECWA 1TXYA 1XYIA 3HOYB 2L5TA 1F9QA 1HPCA 2R87A 4E6IA 2ZDHA 2PMZB 4GKKQ 3NTHA 2VQFQ 4GN3B 1KC8C 1N33Q 3HOVG 4WJ3M 3PVXA 2CW0C 1SXTA 2EY6A 4QJFA 2VQEL 2UXCQ 3JAMW 2XRSD 4DN4M 4LW1A 2J4XA 1I4QA 1U9RA 2F0QA 4LF5Q 4GKJQ 1C0AA 3VPBA 2NBFA 4O0AA 2XCLA 4M9UA 1VQGA 3L7ZC 1CUKA 2WIIB 4LK1C 1GXDC 3GDEA 4DR1H 1E24A 1HR0W 1KABA 3TINA 2VA2A 1X9NA 4JI5L 3Q8PB 4IZ8A 5LMUH 1BKBA 4YHHH 4ECTA 1DYQA 3OWFA 1XNQQ 4V0BA 3BU2A 2L11A 4L1KA 2UU9H 4B3RH 5EJWA 4LAAA 1IBMQ 1I7NA 4YAJB 4U68A 1QCBD 1ML0D 3RB4A 5HGTA 5ELEA 1L1OA 2MUYA 3QZ8A 4DV4L 5KX5F 4XQJA 3S2DH 1ENFA 4O1NA 1CM9A 2N78A 5EPJA 2V4RA 4KHPH 2F0UA 3AFPA 1O78A 4KJNA 4ZKCB 5CBEE 2K5HA 2HHHQ 2KCMA 3K58A 4I7ZC 4HMJA 4X62H 1TWHH 2RDJA 1N36L 4TV9F 1GO3E 1QNUA 4RWSC 1E4EA 2KENA 2YL2A 5KKNB 3PO3H 1KNEA 1VQ6A 2FINB 4MNOA 1PH3A 4RGMA 3Q6SA 4Q0FA 2R61A 3S1NH 3T5HA 3E6ZX 5DQHA 1N56A 1GOZA 1LT5D 3WOEA 1XMQQ 1VQ8A 3GIKA 4QY7A 5FO8B 3PO2H 2K28A 2NZ1D 5E4XA 4EFBA 2XC9A 2ZM6H 1I6HB 1VF7A 3H94A 3TP7A 1M6VA 2XIGA 2PZWA 1FNVA 2E2DC 3BABA 4NB3A 1PTOD 1SE8A 2K5VA 3D0FA 5KFIA 4FXGC 2LY7A 3LNNA 4ED6A 2JA5A 1PTOF 3KBXA 4OWTB 1B9MA 1KDBA 4ZKBB 4RB2C 1HNZQ 3ONAB 1VDZA 2E76C 4MIUA 1CFMA 3WO0A 3PGZA 5IE8A 1VBHA 1GJXA 5FLMH 5CYUA 1ZQ7A 1RJTA 1ICFB 2EY2A 5D1OA 2PQEA 1QZGA 1S3OA 4K8IA 3I55A 1N32Q 3Q8SB 1H9RA 3G6JB 3HKZG 3T51B 2Y0SG 2Z9HA 3VR4A 3OTOH 1D5XC 1OXSC 1XPUA 1Q90A 2B2UC 4QB4A 1VCIA 2A69D 2E2JH 5KT6A 4IAJA 4XYOA 2R84A 4LNQA 2UUCQ 4ECYA 5FJ8H 1YJ9A 4A3BB 3E0EA 3T16A 4KV6A 4DV7H 1MZBA 4O42A 1ENAA 1CHPD 4DR5Q 2L1BA 4R4OA 4P72A 3ETHA 1EL0A 4A93B 5DNFA 1EYGA 4DUYH 2VUMB 1MBYA 3C1EA 1RIPA 4B3SL 2UVWA 1S4ZA 5KT7A 1PLFA 5AJ3L 1JKJB 2H4OA 4IQZA 4KMUC 3K80C 1FL0A 1KJQA 4DR7Q 3MC0B 4JI3Q 4HN7A 2RA4A 1KNAA 1WTVA 1CKNB 4ED0A 3MHBA 1UE1A 2JA5H 3S16H 2ZXRA 2EYOA 1M7JA 2ICIA 2AGQA 4R8NA 1HXYD 1WYDA 3TQYA 5C4XG 1X65A 2SEBD 1B53A 2K1BA 2A68C 5KNCA 2PZTA 3RB6A 1VQKA 4QIWB 4C3JG 2PO4A 1O7YA 3W2DA 1I50H 2JEIA 3STBD 4ZHQF 3PW5A 3PIO3 1Z9FA 4IJLA 3KDFB 4X65L 2M00A 3I72A 1HFGA 1YNXA 2YS7A 4JI0L 2AQ1B 2JA6G 4RNOA 3MWEA 4CJ1B 1EQVA 3TP8A 2W57A 5L9XA 3BYTB 2K5WA 2F4VH 1A63A 2CW7A 2WB1B 1G6ZA 1WH2A 4NXMQ 4X66H 4R4TA 3GIDA 5BN5A 1V9PA 3X3MA 1Y1VA 3PUZA 4LFBH 3KHHA 4S3SA 2R6FA 4ED8A 3G6YA 3F2UA 4BY7H 1I94L 1VQBA 1IBKL 3EFXD 3L4JA 2XN9C 1KHIA 4XTCS 2JA8H 2R7MA 3GTLA 3JAMc 2RDFA 4NLGA 2H1EA 1E2VA 2EIFA 2VB3X 2V1CC 3A7AB 4DV4Q 4BBSH 2QYZA 2YYZA 3ZJYC 4EEYA 3PW7A 1XX8A 4Y52H 1SE4A 4DAPA 4ME6A 3J80E 1GSAA 4GC6A 5C0XG 4DNTB 1IHZA 3I8ZA 1AN8A 1LO5D 5J1ZA 5C44H 4LFAL 3JAME 1BR9A 5LP6F 2QCPX 2F4IA 1K3BC 1KDAA 3SK5A 4MA5A 5C4JH 3QOJA 2EY5A 1N34H 3J7YW 2KHSA 4FBUA 2AUJD 1KAWA 3BG3A 1QWYA 5KFZA 3UE1A 5KRUA 2E5LQ 3QWNA 3HOXB 3S17H 1GSHA 3HKZB 4DV3Q 1M90C 1PX2A 1IYUA 1WFQA 3K0XA 1RF2D 4NMZA 3H3VH 4O3RA 1F2LA 3S15H 1TA8A 3LP8A 5DLFA 3J7AV 3OSNA 2AUKA 1O80A 5KG0A 3H4BA 2I46A 3PIP3 3S1RH 4HYKA 1RHPA 1JC7A 4DPGA 1TWCA 5JH7F 1TY2A 4J6HA 1B4OA 1IBLQ 2RKSA 1U0LA 4YCUA 4QWCA 3GLKA 1VQNA 2Q2HA 2QKIC 4B3TH 1X3PA 2V59A 4AH6A 2MCTA 3HRZC 4HNUA 1Z7TA 4C3IH 3JAML 2EZVA 2EJMA 4U7CA 3K6OA 5IGDA 3E3XA 2JA9A 1LTAD 1Y1WB 3DHQA 4AYBB 3Q2OA 4EFEA 2R92A 1SNOA 3GTOA 4DR6H 2FP4B 5BR8Q 4O4IF 1WCMG 2K04A 3A74A 4OELB 4IURA 1WTXA 1HFNA 1C3OA 4DR4L 3LMLA 4JPBW 3NELA 3GO5A 2KQ3A 3I70A 5C4XB 3OHBA 4IPHA 5GADC 1VQCA 3I4MB 1SMYD 1UE7A 1TAEA 3LX0A 2NVYA 5KGUA 1S97A 4IUPA 4C3JB 3V05A 5KFTA 5M5YH 4A3IB 2MP1A 4R4CA 3OWEB 1LTGD 4XZ3B 1EYCA 2WB1E 3G7LA 3HOUB 5IYBG 4A3DG 1KAAA 1CE8A 4HQ6A 2LS01 1CT1D 5FK9C 4B3SQ 5KNDA 5FD5A 5AJ3Q 5IP7H 2KEEA 4AQYL 2JA6B 1YNJD 4POFA 1ESFA 3H0GG 5J22A 3FPUB 3GV6A 4QUFA 1G2TA 1PTOH 1Z47A 1SYXB 4LF8L 3I90A 1OTCA 4BS9A 2WP8J 4DV6H 1TWCH 4A3FH 2DNCA 2ZJPA 4K5VA 1TR5A 1S0OA 1TY0A 1TKWB 3GQBA 1GUGA 2YTVA 3SVMA 1EUJA 2ATLA 1C9OA 5M3FG 4GOPC 4PZ7A 4XQQA 1YZ6A 2HJWA 1STYA 1YVCA 1J9OA 3M4IA 2AQ3B 4O3NA 3GTQB 3OOCA 2K5DA 1LTID 1KTKA 5M5WH 4YQWA 1NSNS 3GTOH 3KXYT 2R3ZA 5IIFA 1NUCA 4IRKA 2YRWA 3T1HL 3I4NG 3TQTA 4G3IA 5KYLA 4JI4Q 2OTJA 4B9WA 5C4HA 5D1PA 4LF7Q 3MFYA 4H13C 1I3QB 5EDWA 3NEMA 4IUUA 3F2DA 1WOCA 1VAJA 2HDMA 2R93H 3GTJH 3S2HH 1Z2NX 1NMFA 3R93A 1EY4A 1I94Q 4MTEA 5IP9H 1W96A 4Y8VB 1ZHQA 1IBKQ 2K75A 4TVAB 1Q81C 2IX1A 2Z1CA 1VQ9A 3GV3A 5HURA 2VQDA 4PMBA 2VZAA 4NXNL 3M85A 4RA8A 1A6XA 2QILA 1HHVA 4RGNA 5C0XI 2W6PA 1ILPA 3KLSA 1V8QA 2O4XA 1MHWC 4KKTA 4BY1G 4DR2H 1EZ8A 3FDSA 4UY8C 2K5QA 3UDFA 1NCVA 4K0KQ 4JI1H 3CCUA 1PRTB 1STAA 1XMOL 3KAJA 1JWSD 4TV8F 4IRCA 3D4RA 1X3GA 4LFAQ 4AYBE 4BBRG 4L6TB 5EWGA 4PV1C 1X55A 1J6QA 4J8QA 3H91A 2KECA 1NAPA 4MAMA 3M9NB 1H9KA 1AZQA 3OUUA 1FVIA 4YAKB 3GD7A 1U4LA 2IHFA 2V4DA 4JBMA 4JK1C 2NVTB 2PCFB 5FPOA 2O2LD 2FE3A 4MV3A 4IFDH 3BA9A 3K3PA 2JA7H 2ZJQA 4WORA 3ORRA 3U9SA 4DL7A 4LMQD 4RCOA 4IUQA 3CC4A 4UAIA 5CBAE 4GLXA 2FFKB 2QK4A 1WTPA 3OMCA 3HOVH 3U4ZA 4RKLA 2SOBA 1J8IA 3FVQA 3PF5A 1OWTA 1BCPB 1LTSD 4XT1B 3QZ7A 3C3LA 3WO1A 4BA1I 3VYTA 2F0IA 3RLNA 2YV5A 4OL7A 1S40A 1TWAA 5IODA 2WAQA 2JEGA 2NVQB 2V9WA 2OXPA 3R3OA 4I65A 3TIGA 1HTPA 4N8FA 3J7ZC 5HY6A 2O03A 2RSNA 2VB2X 2UVUA 2WACA 5IWAH 4A3DB 1PRTD 1WD1A 3OIQA 1E1TA 2PQAB 3NUCA 1YHQA 3TIIA 3AMUA 2UXBQ 3K5IA 3H0GB 2W70A 2R6GA 2E2HB 1PRTF 3NGDA 1GUNA 1A0IA 3VYRA 3JAMi 4QUCA 2RVLA 2DNEA 2AGOA 3N42B 2JP1A 5KFUA 4DR4Q 1HR0Q 4CDDC 3JC66 1EIHA 4JV2A 1I4GA 4HJ5A 3FKIG 3AQQA 4GKKL 4TRDA 2IMWP 3KF6B 1VQ5A 4LF6H 3RZDH 2UXCL 3ITPA 2Y0SA 3CKIB 3K7UC 4LF5L 1WTWA 1LTLA 2IBKA 2YU9A 1JE5A 2JK8A 5C5MA 5FLXW 5L1LA 3BDCA 1BUVT 1L1OB 2YZGA 2XGPA 3N41B 1HNWH 3X3NA 1I4RA 1BCPD 1PDQA 4LUVA 4GNXA 1K83B 4F7XA 2HT1A 1BCPF 2JYOA 3EIVA 3ULJA 1SFOB 1H9MA 2KCTA 2YTYA 1L1OC 2XWJB 5ISRA 4MA0A 3M7NA 3PR4A 2F0NA 1FKAH 3MFGA 5CGKA 3HOYG 1IBML 1XPOA 4MV8A 4Q43A 5KFJA 4B3MH 2E8GA 1XJVA 3RV3A 1EYAA 1O75A 5A35A 2C2DA 3JSNA 5E7NA 3HOZH 1AH9A 5IGGA 1PYWD 1KBLA 1KLUD 4M1UB 2W6MA 4DUZH 4MZ9A 3CQZB 4MV6A 3J81W 4EBCA 2AMCB 3CCMA 1EOVA 1IKLA 4BXXH 1HRJA 2UUAQ 1L0WA 3PCOB 1K1SA 4C2MA 4JBJA 4F4XA 1LM0A 4YWMA 3MEFA 4K14A 5L1JA 3Q24A 3T1HQ 5C3WA 4HAEA 3DWPA 2SCUB 5GONF 3ERSX 1DIKA 1JOKA 1RKNA 5J2TF 2K5NA 3RR5A 2R7ZG 3Q8QB 1HJPA 1CZGA 2B29A 3K8AA 3SHLA 4A75A 2CW8A 5LOVF 2ZDGA 2DY7A 2F0KA 3A7LA 1E7ZA 3CD6A 3V4ZA 5D1OB 4DV0H 2GLTA 3G8CA 4O2BF 1JB3A 2EYMA 5KFVA 4I7HA 3NWTA 4DV5Q 4O4LF 1QE6A 3FRPB 1ESRA 5CV6A 3VDYA 3SEBA 1KEEA 1LTRD 5TSSA 3ERQA 5C0XJ 2DZDA 1EY5A 3OUZA 4LFCH 1VQAA 4ECXA 3PW2A 1HNZL 1C30A 1I6UA 2BQUA 1WD0A 1V1OA 1V1PB 3K59A 4FM9A 3HKSA 4DR1L 5DG7A 4JI7H 1HZ9A 3GQCA 1LT4D 1HH2P 2AKWB 4UCRA 2I87A 3UFXB 4YY3H 1XMOQ 2F3VA 2JJQA 1N32L 5KFHA 5LA6F 4FO2A 5CV7A 4A3KG 4KD4A 4ECUA 4QL5A 1T5XD 2D62A 3CCEA 1FJGH 4RNNA 5M3MG 5JJIA 1MSHA 4C2MH 4JOIA 1JXLA 3CCRA 4DV2H 1Z2OX 3RD4A 2UUCL 1M0WA 2EOTA 3H09A 2AQ2B 1SEBD 4H44C 2M2LA 5LL6X 3CPFA 2CWAA 3VR3A 4DR5L 4FF2A 5A2QW 4GKJH 1FGBD 2MHVA 2HD3A 2ATWA 4C5AA 4DL6A 1EY0A 4ILWA 4CC6A 1SBBB 2IL8A 4WD3A 3CP0A 3AB9A 3J7AF 4OO1G 2BA1A 1PMRA 2A6EC 5C3EH 4YP3A 4AIMA 1L0XB 4DR3H 4JI3L 3L3OC 4UDUC 3S1MB 4K6LA 2R7LA 1IL2A 4QW9A 4CHTB 5KG1A 4A3BG 4LH6A 1AUVA 1HZCA 3IAYA 1HNXQ 2PNRC 5COYA 3RAQA 3WWVA 2GA4B 4ED1A 5ELBA 3MVVA 4A93G 4RCNA 1Y1VB 3SXHA 1RJPA 1AP0A 3GTPA 1VMPA 3H3VC 2WDTA 5BMVF 3D4WA 1JOQA 2A74C 5BPFA 3O13A 1M1KC 4KN7C 1BVSA 3PSIA 2FMCA 2WE6A 5J2UF 2B2WA 4QWDA 2GPSA 2NN6G 3GTKH 4ZI7F 3GTLB 1KQSA 3F8TA 5C0XH 1TQOA 1WCMA 1QNKA 5IT9W 4NXML 4JV5Q 5JUMA 2MNAA 4RU9A 3GTMH 3GTGB 4UHVA 5C5LA 3TEHB 3RLFA 1UNNC 5EZYF 4JI2H 5JEAJ 2G9HD 5DG8A 2HIXA 4P71A 2NU8B 5KG7A 1XXGA 1YBYA 4DV7L 4OIKA 2VXWA 5EPKA 3NPPA 3PZPA 1YNND 4G7ZC 1PH2A 1B44D 1ZEQX 2BOSA 5BN3A 1D2BA 2E75C 4LF4H 2R7ZB 5DM63 4RHRA 5K36G 2CW0D 3U58A 2AU0A 5ELCA 2WB1G 5FLXc 4GLAC 3T53B 2IT1A 1VS0A 2D0OA 2LKVA 5DLQE 4OX9Q 4J9PA 1LUZA 2B8GA 2NVXA 1X56A 1QVCA 1TS2A 1UE6A 1XNRH 3RB0A 1G91A 1EUCB 1X3FA 3HBLA 3GTPH 3NE5B 1E4GT 3N44B 3RFCA 4HJ8A 4BWSC 3NTKA 4CDEC 3HOWG 1N8RC 5FLXE 4F50A 5I9PA 3CCLA 1PTOC 1TWFA 2F0OA 4FU0A 3EN2A 4DV1Q 4LF9H 3RF2A 3EA6A 4C3HB 1B7YB 2E5LL 3KHRA 1WCMH 4X64H 4DV3L 4A3KB 1PH6A 2CH4A 2EDGA 1GUOA 1S5DD 3Q0AA 3F1ZA 3J81c 4KTAA 2A6HC 1YIJA 4BA2I 4B08A 3DM3A 2VY3A 5M3MB 2R85A 1QZHA 4XYMB 1G51A 2R92B 5LMNH 4WBNF 2RSOA 1V1QA 4GN4B 1IBLL 1PH1A 4DR7H 1JCKB 1LACA 3ER0A 4MV1A 4JBKA 4NP5A 1Y69U 4M7EA 5IYBH 4DR1Q 3MR6A 1UAPA 4FVMA 3K7AB 2NVYB 3HG9A 5NUCA 4A3EB 1I50A 5LMUQ 2F0DA 3LGJA 4ZQ3A 4YHHQ 3J81E 4LFBL 5DLGA 4RB1A 3S14H 3CCSA 3MFHA 2DN8A 3AEVA 1KJJA 3MAQA 3MR2A 4JI6H 4YIJA 4ALPA 3VPCA 1L2FA 3HOXG 3M4YA 2EYJA 2DGYA 4A3JB 1MJEA 5FLXL 1IYVA 3BVZA 5BR8L 1GVPA 4FDBA 4YWLA 2NVXH 3GIQA 5CORA 1MKHA 2KVMA 3RNUA 2W9AA 1D6EC 4ULLA 2BCOA 5KFBA 5AFWA 5FO9B 1PZKD 4KHPQ 1RD9D 5KFMA 2VQEH 2KHJA 3T5LA 5HV6A 2AQ4A 2PPBC 2UUBL 4OWWB 2NZHA 4QQBX 2JXMB 1JORA 3F8NA 1SNDA 1TWFH 3MWMA 4IWXA 4X62Q 3U4VA 1EY9A 4OO1I 3H4DA 2O5JC 4P2CB 1HZAA 3C46A 1CSPA 3FMCA 4JI5H 4EBDA 1Y1WG 1ILQA 3MEHA 4AYBG 3I4NH 4RZQA 2ZJRA 4UFZA 1AE2A 2CVRA 1KJ8A 2ZM6Q 4RHSA 2W6NA 5JJLA 4ZOLF 5L1IA 3NBHA 1KJIA 3TP6A 5CAEB 3STBC 4G7HC 3D4DA 2QEXA 3KF8A 5M5XH 2ZXPA 1GYFA 3I4MG 1EWCA 4DV4H 4J9KA 5F9LA 4QWAA 1E22A 2P5ZX 4G57A 5F9NA 5DQIA 2B63G 4HCSA 4JV0A 4DK0A 1B33N 4A3IG 1BBXC 2RCFA 2VW9A 2N3SA 3HOUG 5KFXA 2FMAA 3QG1A 1XPRA 5DGBA 3MXPA 4IN3A 3RUZA 2HDLA 2PBZA 2NN6I 1EFWA 3L2PA 4A3CG 3KAKA 4EYHB 1N36H 2R8KA 5HBRB 3K5LA 3RBEA 3TS2A 1BDOA 4BY1H 2OH2A 3IFTA 5A2QE 1AW7A 4PZ8A 4JI4L 4LF7L 4RUAA 4L8JA 4ZLTF 2IY5B 2ZDQA 4EQPA 3FKIA 3PUXA 5IY0A 2A68D 2FK2A 1STNA 2RBMA 3J80c 3Q1KA 1TWGB 2FK3A 4HJAA 1JQYD 2JQOA 3EPIA 4DV7Q 3MXNB 3HOWB 1A8VA 1TVXA 2V5AA 3GV7B 3PQIA 3NENA 1P8LA 4TQSA 4A3GB 1B6SA 5T1IA 4IPDA 4Y7NB 2ICEC 1EIFA 1EZ6A 2PW5A 4HSVA 1B1ZA 2RGVA 5IT9c 2OQ0A 2SDFA 3RZOH 4FS2A 4FP5D 3BQ2A 1VF5C 4OHJA 4A3MB 2X0SA 3MWDA 1QVGA 3UDGA 4K0KL 3CAMA 2PMZA 5A2QL 4XX0B 4HJ9A 2J6SA 1VQPA 2MQHA 4UPAA 2W71A 3R2IA 1H9SA 2PW7A 5IYZF 3TN2A 1I4XA 2V4QA 1SYCA 2FMMA 4DKAC 2A5HA 1SE3A 1YITA 3H15A 5KFEA 5IT9E 1TWAB 3E5SA 1K1QA 3FDTA 4EG0A 2LMCB 3B6YA 2VS1A 2BDNA 1K8OA 4MV4A 1MJCA 3W3AA 5KT2A 2VA3A 1S5BD 2YYAA 1WI5A 3G71A 4Q5VA 2C35B 3M4OB 4IOCA 1Q1BA 1J5EL 3T56B 4G4KA 1IW7C 3FKIH 4XDXA 3R5XA 2XGQA 3SDZA 2F4VQ 4B3SH 4CDFC 5C3XA 1DCZA 1WR2A 1PZID 3BZDB 1K8GA 1UE5A 4HNTA 4QGUA 3J80L 4X66Q 2MO1A 3MXUA 2NU6B 2SNSA 2I5MX 3DWAA 1R9TB 3DXJC 2R7NA 3DEPA 2B2VC 4CKCA 1D1IA 1K8MA 5IYDH 4LFBQ 4EQOA 1BF4A 3A55A 4FBTA 2HIVA 2VOBA 1KXLA 4Z9CB 2ASDA 1BO0A 2JE6I 2YU9B 1HUMA 3M9MB 3NHHA 2UXBL 1EEID 3BVGA 3IFDA 5IT9L 1OXUA 5ELOA 4DA2A 3P20A 4O2AF 1HR0L 4X65H 3VR5A 3E9HA 1Y8OB 2PI2A 3A56A 1AN7A 4JI0H 3ETJA 2JEFA 2L0CA 4JI8L 2E2IB 3KTMA 4ID6A 2UUBQ 2ZTDA 3WNZA 2P0AA 2FPPB 2XD4A 2R8GA 3PO3G 1I4HA 1YNJC 4TQRA 3OSPA 4C5BA 2B63B 4HR7A 1DOKA 2R93A 3GTJA 3G48A 1V43A 4IZOA 4F88A 5DGAA 2BDOA 5EAYA 1NNXA 2F3WA 1VQHA 2WYOA 1RYSA 2K32A 1GKHA 1FD7D 1N34Q 5ELNA 1BOSA 3BAAA 1BQQT 4GOPB 2HQEA 3BVMA 2B2YA 2QDBA 5CB4F 4EGVA 4HIKA 3RTXA 4RFBA 3OPOA 1YHAA 3VA5A 1Y8NB 4ZYSA 1NMGA 1W3SA 5FOBB 1GGOA 1STGA 5C4ZA 1I6VC 3RN5A 4OGQC 1SCUB 1V4YA 2LXKA 2R7FA 5JEAG 1BJTA 4KKSA 1VQMA 4J1MA 2OWOA 1PHJA 1UUPA 4P73A 2BE5C 3ORQA 2NZOA 1D5ZC 3OW2A 5E3FA 4B3TQ 1KIXA 1Q8IA 3V4SA 2UUAL 5FD6A 5C3EB 3KHGA 3PV0A 3OHAA 1EY7A 4LFAH 2WTFA 1KLGD 4R9WA 3TBIB 5IWAL 3K57A 1IZ6A 2ASLA 3S1QB 3SE0A 1L0YB 1SYDA 1TIID 1E3PA 1T3NA 4RKBA 2JA7A 1SNPA 3BJUA 3MWYW 1K9MC 2EY1A 5LMNW 2ASJA 2VUMA 1JOOA 5FJ8G 1I6HH 3RAXA 2WAQE 1H9JA 4DR6Q 3G4SA 3GP7A 3M3YB 1ENCA 2DWCA 5KFFA 3PIOA 3BQ1A 2EJGC 4CGYB 1CKNA 4PMWA 3T1YL 3EVQA 1RDPD 3QO2A 4XXEA 4IRDA 5EKLA 4LF6L 2XCAA 1SE2A 1X6OA 4HIDA 4DV5L 2F0GA 1VQIA 4P75A 1SYFA 3BZCA 4RNMA 4JVZA 4QIWA 5IGFA 4RGTA 2C00A 2L4NA 4KY7A 1Q82C 1Q3LA 2B39A 2JA5G 1G8ZD 3KALA 3T5KA 4XIGS 1NJIC 2Q2UA 2KCCA 1RK6A 1VQFA 2LSSA 3KDFA 4OO1H 3M7GA 4ZQIA 4I7AA 2ALZA 2Y0SE 1W6KA 4JOIC 1K73C 1ONLA 4DV6Q 4Q8EA 2FLLA 4PDBA 1QUQA 4HSPA 2L55A 1RTNA 1TU2B 1SYGA 2BQRA 3SK8A 3E5NA 1AUXA 4DR4H 1Q12A 1F9PA 4A3BH 1EIGA 1ZYRC 2CH4W 4OEMB 2K03A 5D3DA 4J9OA 1F2MA 3F2BA 1G6PA 4DUZL 2RCNA 1SEIA 4A93H 1S0NA 4PMCA 3S2DB 2VUMH 5L1KA 1VQDA 5C8YF 1B3AA 1PFMA 4KY6A 1B70B 1CS0A 3NQTA 1J5EQ 1EFID 2V58A 2NU7B 4F4ZA 3BJYA 1MI2A 2K52A 3OMGA 4JBWA 1W93A 5DM73 4AQYH 1TWHB 4MN3A 2SNMA 2NN6H 2OF1A 3I4OA 3M4PA 4DLKA 1RTOA 1HQMC 2Z6KA 2NTSA 5JPNC 4BY7G 4LF8H 3PO3B 3D6WA 1TS5A 4IPGA 2HVSA 3S1NB 2BR0A 2BH2A 3MFIA 2QDLA 3J80i 3PO2B 1KD1C 4R4QA 5DG9A 4DV0L 4UCTA 2CFMA 3Q22A 2KOLA 4BBSG 2CCZA 4JCVE 3I91A 1JMCA 4Q44A 4UCSA 3PIPA 3KJOA 1M8AA 2ID0A 4DNRB 1HNXL 3G6VA 3R23A 2B2WC 2NU9B 4GC7A 5I2XA 4U673 4NDXA 1U5KA 5F2DA 2ALYB 3VA7A 2J6UA 4K5WA 2FB9A 4JI8Q 1B6RA 1W6JA 1KC7A 3R2TA 1EWHA 4DR2Q 3HKZA 5JQWA 1UC8A 4GN5A 2F03A 5E1FA 2UXDH 4JI1Q 5M9OA 1VQ7A 2JEAI 1WTQA 1ET6A 3Q23A 1U4PA 4RAUC 4JV5L 1QB5D 2B2TA 4A3LG 3PR5B 3MR5A 1SR3A 2W7OA 4PWQA 1PFSA 1MGSA 2KJXA 3UE0A 4DV2L 2NB0A 1Y1VG 2C5CA 5ELDA 2E2JB 1LYLA 1EUDB 1JDEA 2W6OA 5KT4A 3I4LA 1HA5A 2OT2A 2Q8RE 1E4EB 2IP4A 4NXNH 1UC9A 4O3OA 4EEQA 2YW2A 1D7QA 1W2BA 1PH5A 5EWEA 2Z0SA 1DM0B 2JSOA 2WKCA 4HCEA 1X3QA 3P1HA 3T4AC 2B3GA 3PUWA 5D3IB 1GUSA 3TQ1A 3BQ0A 2FPGB 2EPBA 4OX9L 4ZK9B 2W6QA 4NKLA 4CJ2C 2OCEA 3JZIA 2HVRA 2PYKA 4M8AA 1OXTA 1G2SA 5IWAQ 2JA5B 4LJZC 3S16B 4ECSA 1YHBA 3QOLA 3OHXC 1LT6D 1UEBA 3PUYA 3GV8B 3NSWA 4JC0A 3HOXH 5KFGA 3U9TA 2JA6A 1DV2A 4IUTA 3K0YA 4DV1L 1C8CA 2F0SA 4ECVA 2QGQA 3URYA 3BS1A 1I50B 1VBGA 4RB0A 2X69A 2I07B 1CA5A 1ZHSA 4Q8FA 1QILA 4RGOS 3T1YQ 4A2BA 4RB3C 3CC7A 4LF6Q 5KFOA 2IA6A 1ASYA 1EHIA 3CCJA 4K5XA 2QW7A 3EROA 2OTLA 1SNMA 4GS3A 1MSGA 2KA7A 2F52A 5KYIA 1LTBD 1WTHA 3CCVA 1S0MA 1FNUA 1HNWQ 3HB9A 3FHWA 2CWPA 4A3FG 4HEDA 2L9HA 5D14A 1EZ1A 1Z6HA 4RZRA 3KK7A 1ICWA 5LMUL 1Y1WH 4YHHL 2NTTA 4YBZB 1STHA 5I2YA 3GTQA 5CC4A 1VMCA 3A8KE 4C3HG 3VPDA 2N49A 4OXPA 2UU9L 4B3RL 4KHVA 2IPKD 1LLRD 1U4MA 3ULPA 4BY7B 2RDIA 2ENBA 5C4XH 1FR3A 3I4MH 2X6LA 2BH8A 2MO0A 3I3CA 4DXGA 5BN4A 4L5RC 4B3MQ 3M9BA 2R92G 1H95A 5CA1F 3GTKA 2JA8B 4C3JH 5IGCA 1JJGA 4ECQA 1EQRA 2VQFH 2W6ZA 1I3QA 4GKKH 1N33H 5JVDF 4KHPL 4KKUA 4DUZQ 2Q8TA 4A3IH 4BBSB 3M9OB 2J7ZA 1MIUA 2UXCH 2GVBA 5KG3A 3IL8A 3HOUH 1A9XA 1JB7A 4MTDA 3GTMA 4LF5H 2Z4HA 4A3EG 4K6DA 4IPCA 1XTDA 1RJQA 4F4YA 3ND8A 4MHEA 2JA6H 4X62L 3OW7A 1NTGA 4JW0A 4A3CH 1JT8A 1ULZA 2XWBB 3AU7A 2NUCA 3CF5A 1EIYB 5C44B 2I5HA 2XIWA 4QWEA 3I2ZA 4A3JG 1XNQH 2OQKA 4DAYA 2ZM6L 5C4JB 3LWBA 4RUCA 4JYAQ 3RB3A 4X64L 1IBMH 3OSOA 1R4QB 2XSCA 4DV0Q 1VQLA 1P16A 3S17B 2XRQD 5BPHA 1ET9A 1XWEA 2F3IA 1VQ4A 5T1GA 4R4IA 4YJ2F 5C6AA 3S15B 1EWIA 4CJ0B 3GTQH 4LFCQ 1FNWA 2FLPA 1S68A 2KUMA 1OO9B 3S1RB 1PVOA 1TS4A 1YJNA 2K50A 2HHHH 3I73A 3CVZA 2OEOA 4C1NK 1LABA 4JI7Q 2L12A 4JUZA 4LWCA 1M4VA 1LTTD 4YR0A 4WJWA 2W9CA 4YY3Q 3PW0A 4JI6L 2F0TA 4IOAA 4C3IB 2E74C 1I3QH 4J9SA 5KFWA 3H3VI 3GIIA 1VQEA 2JEBI 2ZJTA 2C28A 1BXTA 3OTOL 1XMQH 1F2ZA 3HGBA 1FJGQ 1AZPA 3QIAA 1UEAB 3D8GA 5KT3A 2G5DA 3KLWA 2GVAA 4NPSA 5GAEC 3CMAA 4LUOA 2FPIB 4O3SA 2HQLA 2QA4A 4HIMA 5KFCA 2F0MA 4A2AA 1DOLA 4DNIA 4DV2Q 5KG2A 2AWNA 3VMMA 3V6HA 1C48A 4WJ4A 1T94A 5KFYA 3V6KA 4F8MA 4JYAH 2RF4A 1H9SB 4UP8A 2PQAA 3AYHB 1HNZH 1A3UA 4KHZA 4DUYL 3H0GA 1Q86C 2E2HA 3HZXA 2FJ2A 2VR1A 1S72A 5M5YB 3MZ5A 3MR3A 3TSSA 3JRWA 2C2RA 1X32A 4DL3A 2K7VA 1T5EA 4DR3Q 2R86A 1L2ZA 2D9UA 4R8IA 3EJIA 3KF6A 1N32H 1PTOB 1JR0D 1PYSB 1S5ED 3MA2B 4OIJA 4PQXA 1TWCB 4A3FB 5IGBA 3BG5A 5CV9A 5G3LD 2NVTH 5JVLA 2C22A 3DWQA 1F9SA 4IO9A 1K83A 5G3LF 2UUCH 1PFNA 5CV8A 2MFIA 3W1GA 4A3GG 1DD2A 2AGPA 3G6EA 1FGUA 4KD3A 1SFOA 2R82A 4DR5H 4DAVA 3MTSA 2R7KA 3V2TA 3J81j 3L9AX 1VQOA 1RODA 1SLJA 5M5WB 1NY4A 3E9IA 4A3MG 3PF4A 2F4VL 3GTOB 2EYHA 1EQTA 2NVQH 1JX4A 3K3VA 4UP7A 5KEEA 1JJ2A 2PVPA 1JLLB 4JI3H 1K28A 1NR2A 4YCWA 4X66L 3DEOA 4FXKC 4KK7A 2X6GA 4R8UA 4A3DH 3CQZA 4IUNA 4KN4C 5DEHA 2FXQA 2EYPA 4K2KA 2WAQG 2EXZA 4RMFA 3VR2A 3RV4A 1U4RA 2IHEA 3H0GH 4JI2Q 2E2HH 4DU9A 2L15A 4DK3C 4HR7B 1GM5A 2A69C 3CXCA 2R93B 2UU9Q 2HGSA 3HOZG 3GTJB 4B3RQ 3SK6A 4O3PA 4ME5A 2I80A 3S2HB 1TS3A 3N6RA 2ZTEA 5IOCA 1SYEA 4ECZA 2ZTCA 2B8FA 4LF4Q 4BXXG 2CHBD 2IX3A 4APVA 5M3FH 4U6PA 2A6HD 4XQNA 4J0MA 5JEAH 4LH7A 5I4DA 3CRKC 1I7LA 2W8LA 4J9LA 1II3A 4HJ7A 3TREA 4ZUIA 1UNSA 5EKIA 4TKOB 4ME3A 3SK4A 3F2CA 1K83H 2G9DA 4MTNA 2B2YC 4NXMH 5D65A 3GIPA 3C0FB 1XNRQ 5EKKA 4N8X1 3KJPA 3J80W 1SFOH 2R8JA 5KT5A 1G291 1CQVA 4HNVA 5KFLA 4WRDA 1N34L 1VQJA 1N48A 4LUZA 2YS6A 3I12A 3J81L 1V1PA 4TQUS 5DAUA 4YB8B 1IL8A 4KY5A 2PMZE 4LF9Q 3Q8RB 1DV1A 4X64Q 2KEDA 3S9WA 1F9RA 1SYBA 3IG0A 4ODGA 1CQIB 3BDOA 5IYCG 1E4FT 2JA7B 1SJED 1A15A 3CQZH 3H6MA 3PUVA 1CQJB 4ED2A 2MPMA 2OLSA 1B3QA 4DXFA 5LMNQ 2EQSA 1HZBA 1B2TA 3FMAA 3HOVB 1S9FA 1CZWA 1SAPA 1DZ1A 4FF3A 3DF7A 2DIKA 3TZUA 3CMEA 4L5TA 4B3TL 2DUDA 1CA6A 3A8IE 2A19A 3H20A 5I47A 4ZRZA 3J7AK 2R7DA 2DPJA 1JWMD 4JI6Q 2ZXOA 3E0JA 2F0PA 4IFDI 2A73B 5I6WA 1GHJA 4N9PA 3CRLC 5EBDA 3RBDA 3OTOQ 4DR6L 2FJZA 4BBRH 2F0LA 4J15A 2F0JA 4ZUJA 2K01A 1HA6A 2E5LH 4DV3H 1QOHA 1QJOA 1K0RA 3R5FA 1DONA 1D1KA 1A2TA 2F0EA 1ZETA 1KL9A 1ZKOA 2F0HA 3HS0C 4H02A 2VQEQ 5CMDA 5GAGC 2EJFC 2D5DA 3A54A 1QUQB 2M9VA 4L63B 5C3EG 3RZDB 1IBLH 4DUYQ 3EPGA 2WKDA 4P74A 4LMYA 5KG5A 4IWYA 2RHSB 2PI2E 1GUTA 3FPPA 1F77A 4KJOA 5KFQA 4JI5Q 3MJFA 3UDXA 2Z8LA 2M05A 3TZDA 2YCHA 4O3QA 4EBEA 2N88A 1BGWA 2DPIA 3EYYA 2WV6D 4QMGA 1WVLA 5I9OA 3N6XA 3NQIA 4DV6L 2VUGA 4CKEA 2XNAC 2CQYA 5BR8H 4X6AH 4LSAA 3KUPA 2WAQB 4EGJA 1KJ9A 2F0VA 3GTGA 1C7YA 4MTKA 5ELFA 2UUBH 1SROA 3HOZB 5KFPA 4ED7A 2Z6KC 3TDQA 4OWXB 1N36Q 2VPQA 2J6TA 3JSLA 1SSOA 3QJYA 3GILA 4YCVA 3N40P 3BYYB 3S1MH 1WJJA 2KBNA 2I0QA 2R7ZA 1T9HA 2WINB 3EBEA 4DR7L 1DOMA 4C5CA 1HCZA 2N55A 3H40A 2O5IC 2K33A 1A62A 4GZYC 3NWSA 4A3LH 2Y0SB 1STEA 2EE1A 4EVOA 3RIZA 1JDBB 4CC5A 4HMIA 3L0OA 1Y1VH 4X3UA 1SMYC 4I55F 1A2UA 4GNXB 3HOYH 3N8DA 3RGXA 1EYZA 3N52A 3CPWA 4J9RA 1HQRD 3G6XA 2KCNA 1IW7D 2ZT9C 4FF4A 4GNXC 2B2TC 4GLVB 2MGSA 3GTLH 3A5ZB 3OYYA 4DR2L 4YR2A 2W8KA 4KI0A 2Z4IA 4FS1A 5KFRA 2Q2IA 1I4PA 4JI1L 1IXRA 1X3EA 3KLSX 1PZJD 3HP3A 4JI4H 3GTGH 1S5CD 1IKMA 4QIWE 4LF7H 3PO2G 1RL2A 4O4HF 1JWUD 1O7IA 4XYQA 2K6AA 2XCPA 1BBUA 3R8BA 1SMXA 2H5XA 4G7OC 3U50C 1YJWA 3LWEA 1OXVA 3K5MA 3CU7A 4BWGB 3ULLA 2DY8A 3FP9A 3NBIA 4C2MB 1I94H 1BNZA 5KG4A 2FLNA 1IBKH 2R7ZH 2B2UA 1AFPA 3J81i 4R1JA 4DL4A 4RH6A 4PZ6A 3HFZB 3U9OA 1LT3D 4K8JA 5FLMG 1HTLD 5JJZA 1B50A 2W9BB 1E0BA 1JJCB 4E4TA 4WFN3 4PNYA 4K0KH 3D3RA 4Q0YA 1SDFA 3UQ8A 4DF7A 4IFDJ 2YRXA 4QW8A 1UWVA 4FYDA 5EGTA 2DJGC 3QFFA 4QWBA 3DM1A 2J9GA 2KSWA 2JN4A 3V96A 1AE3A 1Y8PB 3UDIA 2VNUD 2HUGA 4C3HH 1O7ZA 1OXXK 2HCCA 3Q8DA 4A3KH 1JIHA 4X3SA 3BZKA 1CKOA 5H1SE 5T14A 1Q1EA 2F1MA 2WFWA 4UCUA 4X65Q 3RLOA 5M3MH 4JI0Q 2EVBA 2R92H 2FHTA 3HXLA 1J5EH 1DXMA 4CDCC 5D8DA 2XVSA 4O2DA 1EOTA 1PXUA 3S24A 4EQ5A 1PK8A 2BE5D 1S10A 2UXDL 5GAHC 4B9XA 2C2EA 2D0PA 3M4QA 3RGZA 4A3EH 3K7AH 2NVYH 2YTXA 1GSOA 4UCVA 3GTKB 1E2ZA 1HNWL 4IHJF 4A76A 4ED3A 5CV4A 4FXDA 4YR3A 5GQOA 5J3BA 2NYZD 1NE3A 3HKZE 4CBVA 4DL5A 3DLLA 1MD2D 4A3JH 2ES2A 3GTMB 5K2MA 1K3RA 3IN5A 3SI8A 1RYRA 3CHBD 2UXBH 3WDNA 1IOVA 1ASZA 4N9TA 3FEWX 4K2LA 3TRZA 2WB1A 1GHKA 1HR0H 2YZNA 4JG2A 4DK1A 1Q7YC 3K5OA 1KDCA 1CTMA 3UI2A 2NUAB 4B3ML 5LL6b 5C1OA 3KBGA 4ZCKA 5EWFA 5K5PA 3GV5B 4DAYB 4JI8H 1PH4A 1QG7A 1CI3M 1GLVA 2C9OA 3KFUA 2AWOA 3VR6A 1V51A 1O7LA 1PYBA 4C1NI 4UP9A 2PZUA 1RK5A 1TWGA 3T5JA 4EGQA 3HEJA 3MXNA 5H80A 4YWKA 4H0LC 5LXTF 5EPLA 4NW2A 2VL6A 2F0FA 4EX5A 2Z6BA 4A4IA 3L4KA 1A3TA 1DJRD 2LXJA 1PRTC 1XDNA 3D6CA 3GTPB 5KFDA 3K81C 2UVVA 3SGIA 3P75A 1E1OA 3I56A 1PFBA 1SJHD 4JYAL 4LSXA 2JA8G 1S5FD 4YJ3F 2W9CB 4ZAIA 1YEZA 1ZYRD 1CQFA 1RCVD 1WCMB 3K5HA 3PN1A 2RGRA 2IWHA 1AEXA 3KHLA 3IKJA 3TP5A 3GIMA 4LFCL 1EY6A 4C56C 5KG6A 5E4WC 4EQNA 2UUAH 5C44G 1CSQA 2MJ8A 5K36H 2R8IA 4X3KA 4JI7L 1BCPC 1SN8A 4DFAA 1RJRA 1CK1A 1NBWA 1D5MC 3BDLA 3T1HH 1K8AC 2RDGA 4YY3L 3I7FA 1EQQA 4J9NA 3S14B 1PH7A 1BNCA 2GPWA 2B2VA 4IUVA 2NWGA 3LWUA 1E2WA 5C5JA 1FJGL 1BBWA 2K05A 1TWGH 4X3TA 3RN2A 4HTHA 4L5QA 4OONA 3TMEA 3HOWH 1JICA 3T1YH 5EOYA 1R9TA 2Q8IB 2NVXB 1CKMA 2VQFL 2CKZB 1N33L 4MV7A 1JE4A 5M3FB 5LL6S 4XYLB 3D31A 2FKLA 4A3GH 1CHQD 3J7A5 4DV5H 4POGA 4Y7NH 4IR1A 4GKJL 4ETSA 2DLNA 1Y1WA 2XGTA 4AYBA 4J9MA 2RQXA 1KRSA 1TWFB 2I5LX 1STBA 4QF4A 4AQYQ 5IYDG 1Q46A 4A3MH 1EU4A 4C3IG 1QVFA 3R5HA 4MV9A 2W9BA 1EEFD 3C1FA 4DR3L 4LF8Q 4Q45A 1XNQL 1F2YA 4EYIB 4H7BA 5FO7B 3ZYYX 1Z2PX 1XMOH 3RMHA 5KIXA 3I4NB 1GUWA 3RUPA 2E2IA 5CR3A 3VYSA 1PV4A 4KLKA 3KOJA 2IX0A 1TWAH 2B63A 5L37A 4I4TF 3RJ0A 2A1AA 1SNQA 5KNBA 5EQ0A 4QCLA 5M5XB 5J39A 2K14A 1SNCA 4DL2A 4I50F 4R8UB 1HUNA 1LV9A 3M4OH 4F87A 5CA0F 2QEJC 1B9NA 3DMUA 4GOPA 2HHHL 1N9WA 1IOWA 2PN1A 1KRTA 2TSSA 2XTIA 4F4WA 4L5SA 2EYLA 1PH8A 5JPMC 2AHOB 5IP7G 1C4QA 5LHY1 1PA6A 2UXDQ 2K4KA 3OIPA 3PMFA 1EU3A 3QB3A 1R9TH 5KFKA 4BY1B 3JRXA 4DAMA 1T36A 1XMQL 4ABNA 3BA8A 2EXDA 5C1PA 1EY8A 5I6YA 5IGEA 2YU9H 3CCQA 2I8CA 5GROA 2QF7A 4BBRB 4JI2L 4DK6C 2HVQA 4R7RA 4JV1A 4IJHA 3NP8A 5CV5A 2VPSA 2Q2TA 1HNXH 2LFNA 2YZMA 3ND9A 3EQLC 1DGSA 4J9QA 3CW2C 2PNHA 4NXNQ 3WOFA 4LF4L 1IYJB 5EBCA 3CC2A 2E2IH 4IR9A 5IYCH 3SE7A 5FKAC 1SRUA 1WTRA 2B63H 3SR1A 3NBHB 3QR8A 5KFSA 1Q8KA 3KF8B 4TSSA 1I5FA 1YI2A 1BXRA 4RAYA 5DQGA 3KYHC 5JVH3 3RZOB 3KLRA 3A0JA 3DUZA 1NR4A 1X54A 2KHIA 4FF1A 4JV5H 3MXGA 1XNRL 2W7PA 3N43B 5JOBA 5HGQA 5KFAA 2R93G 3W1BA 1VKZA 1A3VA 1PH9A 3A8JE 4FNFA 5IP9G 5JVG3 3PW4A 4LF9L 2UVRA 3V6JA 5JJKA 3T13A 3ICEA 4RAZA 3W5OA 4RG1A 4APMA 1M0TA 5KFNA 2HCIA 2BQ3A 4XT3B 2F0WA 1ZXTA 5LMNL 2ASBA 3NXWA 3FKIB 1Y14B 2RDHA 3C2PA 1B8AA 1D8LA
chains in the Genus database with same CATH topology
4X64Q 3G48A 4DR4Q 1HR0Q 1GD7A 2GN5A 3JC66 1V43A 3AFQA 3S1QH 5EAYA 2BA0A 5IYCG 4HJ5A 3IRBA 1VQHA 2N8NA 4PG3A 3CQZH 3AQQA 3FKIG 1GKHA 3PUVA 1N34Q 5ELNA 3KF6B 4GKKL 1VQ5A 5LMNQ 2EQSA 3RZDH 2UXCL 4GOPB 1HZBA 3A5UA 3M3YH 2CQOA 3K7UC 4HIOA 3CMEA 1LTLA 3TS0A 4HIKA 4LF5L 1JE5A 1YHAA 2JK8A 4L5TA 2DUDA 2RHQB 1L1OB 4B3TL 2JA7G 2A8VA 2VUMG 4IFDG 2A19A 1NMGA 1TXYA 1W3SA 4LUVA 4GNXA 3RN5A 2LXKA 2R7FA 2R7DA 5JEAG 4GKKQ 2VQFQ 3EIVA 4GN3B 3ULJA 1KC8C 1N33Q 1VQMA 2HT1A 3HOVG 2OWOA 4JI6Q 2UXCQ 4QJFA 2VQEL 1PHJA 2KCTA 2YTYA 4IFDI 1L1OC 4P73A 3M7NA 4LW1A 4GKJQ 3OTOQ 4LF5Q 1C0AA 4DR6L 4O0AA 2NZOA 3OW2A 4BBRH 4B3TQ 1KIXA 3HOYG 2UUAL 1VQGA 4J15A 1IBML 3L7ZC 1XPOA 1CUKA 3PV0A 3GDEA 1E24A 1HR0W 1K0RA 1X9NA 4JI5L 2E8GA 5IWAL 1XJVA 1IZ6A 1BKBA 1KL9A 5E7NA 4H02A 2VQEQ 3HOZH 1AH9A 1E3PA 5GAGC 1XNQQ 3BJUA 1K9MC 3BU2A 4MZ9A 5LMNW 1QUQB 5C3EG 2AMCB 5FJ8G 1EOVA 3CCMA 2WAQE 1I6HH 4DR6Q 3G4SA 4BXXH 4DUYQ 1L0WA 3PCOB 1IBMQ 2UUAQ 4P74A 4JBJA 3PIOA 2RHSB 2PI2E 1CKNA 4PMWA 1LM0A 4JI5Q 1L1OA 4YWMA 3MEFA 3T1YL 3HOUG 3UDXA 4DV4L 3T1HQ 4LF6L 3S2DH 1X6OA 4HIDA 2N78A 4DV5L 1VQIA 3AFPA 4P75A 3ERSX 2K5HA 4DV6L 3BZCA 2HHHQ 2KCMA 2K5NA 3RR5A 2R7ZG 1HJPA 2B29A 3K8AA 4A75A 1Q82C 2JA5G 1TWHH 4X6AH 4XIGS 1N36L 1E7ZA 3CD6A 1NJIC 1GO3E 2Q2UA 2KENA 1VQFA 2LSSA 3KDFA 3PO3H 1VQ6A 2Y0SE 4MNOA 1PH3A 4DV5Q 1C7YA 4JOIC 3S1NH 1K73C 4DV6Q 3VDYA 1SROA 1XMQQ 5C0XJ 1VQ8A 4QY7A 3PO2H 1VQAA 1HNZL 1QUQA 2Z6KC 4OWXB 1N36Q 1Q12A 3HKSA 4DR1L 4A3BH 4NB3A 1HZ9A 4YCVA 1SE8A 2K5VA 3D0FA 3S1MH 1HH2P 1WJJA 2AKWB 2KBNA 2I0QA 3F2BA 1T9HA 3EBEA 4DR7L 4DUZL 2RCNA 1XMOQ 1G6PA 2JJQA 4A93H 4OWTB 1N32L 4A3KG 2VUMH 4QL5A 1HNZQ 1VQDA 2D62A 3CCEA 1B70B 1A62A 4A3LH 1J5EQ 2K52A 3PGZA 5M3MG 4C2MH 5IE8A 4JBWA 4JOIA 5JJIA 3CCRA 5FLMH 3L0OA 1Y1VH 2UUCL 1QZGA 3I4OA 1S3OA 3M4PA 3I55A 4GNXB 2Z6KA 3HOYH 1N32Q 4BY7G 3HKZG 3CPFA 2Y0SG 2CWAA 4DR5L 3CPWA 1OXSC 4IPGA 2ATWA 2BH2A 1XPUA 3J80i 1KD1C 4R4QA 4DV0L 1VCIA 2CFMA 3CP0A 4GLVB 4GNXC 3GTLH 2E2JH 3A5ZB 3OYYA 4JCVE 4DR2L 2CCZA 4BBSG 2BA1A 4KI0A 1JMCA 2UUCQ 4LNQA 5C3EH 4OO1G 5FJ8H 2Q2IA 4AIMA 2ID0A 3PIPA 3KJOA 3E0EA 4JI3L 4JI1L 1IXRA 1X3EA 1YJ9A 3GTGH 4DR5Q 4QIWE 1IL2A 3PO2G 1RL2A 4P72A 4R4OA 1O7IA 1EYGA 1U5KA 1BBUA 2ALYB 1SMXA 2H5XA 4JI8Q 3U50C 1YJWA 4A3BG 1OXVA 4B3SL 1RIPA 4DR2Q 3ULLA 4GN5A 5AJ3L 1HZCA 3FP9A 1HNXQ 3K80C 1FL0A 4DR7Q 4JI3Q 4JI1Q 3WWVA 1VQ7A 2JEAI 1CKNB 4A93G 1UE1A 2R7ZH 4K0KL 3J81i 2JA5H 3S16H 4R1JA 4JV5L 4A3LG 1WYDA 3TQYA 5C4XG 1X65A 1SR3A 4PZ6A 3HFZB 1M1KC 5FLMG 1BVSA 1PFSA 1VQKA 3PSIA 4DV2L 3UE0A 1Y1VG 2NN6G 3GTKH 1JJCB 1I50H 3STBD 3F8TA 1KQSA 1LYLA 4NXML 1Z9FA 4IJLA 3KDFB 4X65L 4JV5Q 4IFDJ 2MNAA 1UWVA 1YNXA 3GTMH 4JI0L 2JA6G 1D7QA 1W2BA 3TEHB 3RLFA 1PH5A 2Z0SA 4WJ3M 5JEAJ 1AE3A 3UDIA 2HIXA 4P71A 2B3GA 4C3HH 1OXXK 3PUWA 2VNUD 1A63A 3Q8DA 1YBYA 4A3KH 4DV7L 3BZKA 4OX9L 1CKOA 5H1SE 4NXMQ 1Q1EA 2WFWA 4R4TA 4X65Q 3RLOA 1PH2A 2OCEA 5M3MH 1V9PA 4JI0Q 1OXTA 2R92H 5IWAQ 3PUZA 5K36G 1YHBA 3U58A 4O2DA 2WB1G 3S24A 1UEBA 3PUYA 4EQ5A 5FLXc 4GLAC 4JC0A 3HOXH 4BY7H 2UXDL 2IT1A 1VS0A 2D0OA 1I94L 5GAHC 1VQBA 5DLQE 4OX9Q 2D0PA 3M4QA 4DV1L 4A3EH 1IBKL 1LUZA 2NVYH 2YTXA 2QGQA 3K7AH 1X56A 1HNWL 1KHIA 4XTCS 2JA8H 1QVCA 3JAMc 1UE6A 4A3CG 4A76A 2EIFA 3T1YQ 2V1CC 4DV4Q 4BBSH 2YYZA 1X3FA 3ZJYC 5GQOA 5J3BA 3CC7A 3GTPH 4LF6Q 1NE3A 3HKZE 1ASYA 3DLLA 3CCJA 4HJ8A 4A3JH 2ES2A 4Y52H 1K3RA 2OTLA 3HOWG 1N8RC 4GS3A 3CCLA 2F52A 3EN2A 4DV1Q 1ASZA 5C0XG 3CCVA 1B7YB 2E5LL 1HNWQ 1WCMH 5C44H 3FHWA 2CWPA 4DV3L 4A3FG 3TRZA 4LFAL 1PH6A 4JG2A 1Q7YC 4BA2I 3F1ZA 3J81c 1YIJA 4B3ML 1Y1WH 5LMUL 4YHHL 3DM3A 2VY3A 4DAYB 5C4JH 1PH4A 1QZHA 1G51A 3KFUA 2AWOA 1KAWA 1V1QA 2N49A 4GN4B 4OXPA 1PYBA 1IBLL 1PH1A 2UU9L 4B3RL 4UP9A 3UE1A 3ER0A 2E5LQ 4JBKA 3S17H 3ULPA 1M90C 4DV3Q 1WFQA 3K0XA 5C4XH 3H3VH 4YWKA 5IYBH 4DR1Q 3I4MH 3S15H 2BH8A 2MO0A 4L5RC 2VL6A 3M9BA 4B3MQ 4EX5A 5LMUQ 2R92G 3LGJA 4YHHQ 1H95A 4C3JH 4LFBL 1JJGA 4A4IA 1EQRA 3CCSA 3S14H 3S1RH 3AEVA 4KHPL 2LXJA 4DUZQ 4A3IH 4ALPA 4DPGA 1MIUA 1L2FA 2GVBA 3HOXG 3K81C 3HOUH 1JB7A 1IBLQ 3SGIA 1U0LA 2DGYA 4YCUA 1E1OA 3I56A 1MJEA 4A3EG 2Q2HA 4IPCA 1XTDA 1VQNA 5BR8L 2JA6H 4X62L 1GVPA 2JA8G 1NTGA 4JYAL 4FDBA 4YWLA 2NVXH 4A3CH 1JT8A 4AH6A 1MKHA 3RNUA 1YEZA 3CF5A 1EIYB 4C3IH 2I5HA 3I2ZA 4KHPQ 4A3JG 2KHJA 2JA9A 2UUBL 2OQKA 4LFCL 4OWWB 2NZHA 2ZM6L 4QQBX 1TWFH 5BR8Q 4JYAQ 4X62Q 3U4VA 1WCMG 3A74A 1CSQA 4X64L 5C44G 4OO1I 4DR4L 4DV0Q 1VQLA 4JI7L 1SN8A 1P16A 1HZAA 1CSPA 3NELA 2F3IA 1NBWA 3GO5A 1VQ4A 1Y1WG 4R4IA 4IPHA 4AYBG 1VQCA 5GADC 3I4NH 1UE7A 1K8AC 4YY3L 1EWIA 3I7FA 2ZJRA 3GTQH 1AE2A 1EQQA 4LFCQ 2ZM6Q 1PH7A 5JJLA 1PVOA 5M5YH 1YJNA 2K50A 4R4CA 3STBC 2QEXA 1FJGL 1BBWA 2WB1E 5M5XH 5IYBG 1TWGH 4JI7Q 3RN2A 3I4MG 4A3DG 4B3SQ 4LWCA 4L5QA 4OONA 5IP7H 5AJ3Q 4AQYL 3HOWH 4POFA 3H0GG 1CKMA 2VQFL 1E22A 2CKZB 1N33L 4YY3Q 2B63G 1Z47A 4JI6L 4A3IG 4IOAA 3D31A 4A3GH 1I3QH 4LF8L 3J7A5 2VW9A 2N3SA 1OTCA 4POGA 1VQEA 2JEBI 2WP8J 4Y7NH 3H3VI 1TWCH 4A3FH 3OTOL 4GKJL 2ZJPA 1XPRA 1FJGQ 2XGTA 3KLWA 2GVAA 2YTVA 2NN6I 4NPSA 4LUOA 1EUJA 1KRSA 5GAEC 2HQLA 2I5LX 1C9OA 3L2PA 2QA4A 5M3FG 4HIMA 4GOPC 5IYDG 4AQYQ 1Q46A 4PZ7A 4DNIA 4DV2Q 4A3MH 2AWNA 4BY1H 1QVFA 3TS2A 1YZ6A 4DR3L 4WJ4A 1YVCA 4LF8Q 4PZ8A 1XNQL 4JI4L 2RF4A 4LF7L 4UP8A 2PQAA 3AYHB 2IY5B 4KHZA 5M5WH 4DUYL 1Q86C 4KLKA 1PV4A 3PUXA 3KOJA 2IX0A 1TWAH 1S72A 3GTOH 5IY0A 2A1AA 3J80c 2K14A 4HJAA 2JQOA 4DR3Q 3T1HL 3I4NG 4DV7Q 3MXNB 4JI4Q 1A8VA 2OTJA 4LF7Q 3M4OH 3KF6A 1PYSB 3NENA 4GOPA 2HHHL 1P8LA 1N9WA 3NEMA 4IPDA 1KRTA 3F2DA 1WOCA 2XTIA 1EIFA 4L5SA 2R93H 1PH8A 3GTJH 2AHOB 2NVTH 5IP7G 5IT9c 3S2HH 1NMFA 1PA6A 2OQ0A 3RZOH 2UXDQ 2K4KA 1I94Q 5IP9H 4IO9A 1R9TH 1IBKQ 4A3GG 2MFIA 3W1GA 3UDGA 2K75A 3CAMA 4TVAB 3G6EA 1Q81C 1QVGA 2IX1A 1FGUA 4DAMA 1EFWA 1VQ9A 1XMQL 4HJ9A 1VQPA 2VZAA 4NXNL 3M85A 2EXDA 2MQHA 4UPAA 2YU9H 3CCQA 5GROA 4DKAC 3J81j 1VQOA 5C0XI 1SLJA 1YITA 4DK6C 3H15A 4JI2L 1NY4A 3E9IA 4A3MG 3PF4A 4BY1G 2F4VL 4IJHA 3CMAA 2NVQH 4UP7A 3B6YA 2Q2TA 1JJ2A 2VS1A 3UDFA 1HNXL 4UY8C 4K0KQ 1MJCA 4YCWA 3CCUA 4X66L 1DGSA 1XMOL 3CW2C 2PNHA 4LFAQ 1X3GA 4A3DH 1WI5A 4NXNQ 4AYBE 4BBRG 4LF4L 1IYJB 3CC2A 3G71A 2FXQA 2C35B 2E2IH 5IYCH 2WAQG 1Q1BA 4IOCA 1X55A 1J5EL 4RMFA 3FKIH 3H0GH 1J6QA 1SRUA 2IHEA 4JI2Q 2E2HH 2B63H 3NBHB 2F4VQ 2L15A 4DK3C 1GM5A 1FVIA 3GD7A 3CXCA 2IHFA 1Q8KA 3KF8B 1UE5A 1I5FA 1YI2A 1K8GA 2UU9Q 4JBMA 3HOZG 4B3RQ 4QGUA 2ZTEA 3KYHC 2MO1A 4X66Q 3A0JA 2ZTCA 2I5MX 2ZJQA 2JA7H 1X54A 2KHIA 4LF4Q 4BXXG 4APVA 5M3FH 3CC4A 1XNRL 5IYDH 5HGQA 4GLXA 4LFBQ 2R93G 3W1BA 3HOVH 2HIVA 3U4ZA 1KXLA 3PF5A 2JE6I 1PH9A 4HJ7A 3TREA 4BA1I 5IP9G 2UXBL 3RLNA 4LF9L 2YV5A 1OXUA 4ME3A 3F2CA 1S40A 1K83H 5JJKA 5ELOA 4MTNA 3ICEA 1HR0L 3W5OA 1XNRQ 4RG1A 3J7ZC 3KJPA 3E9HA 1SFOH 2PI2A 5HY6A 1G291 4JI8L 1N34L 1VQJA 4LUZA 1E1TA 2PQAB 5LMNL 2ZTDA 2UUBQ 1YHQA 2ASBA 2UXBQ 4TQUS 3PO3G 1Y14B 2R6GA 4LF9Q 2PMZE 1A0IA 1B8AA 3JAMi 1D8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 Q;  3G48 A;  4DR4 Q;  1HR0 Q;  1GD7 A;  2GN5 A;  3JC6 6;  1V43 A;  3AFQ A;  3S1Q H;  5EAY A;  2BA0 A;  5IYC G;  4HJ5 A;  3IRB A;  1VQH A;  2N8N A;  4PG3 A;  3CQZ H;  3AQQ A;  3FKI G;  1GKH A;  3PUV A;  1N34 Q;  5ELN A;  3KF6 B;  4GKK L;  1VQ5 A;  5LMN Q;  2EQS A;  3RZD H;  2UXC L;  4GOP B;  1HZB A;  3A5U A;  3M3Y H;  2CQO A;  3K7U C;  4HIO A;  3CME A;  1LTL A;  3TS0 A;  4HIK A;  4LF5 L;  1JE5 A;  1YHA A;  2JK8 A;  4L5T A;  2DUD A;  2RHQ B;  1L1O B;  4B3T L;  2JA7 G;  2A8V A;  2VUM G;  4IFD G;  2A19 A;  1NMG A;  1TXY A;  1W3S A;  4LUV A;  4GNX A;  3RN5 A;  2LXK A;  2R7F A;  2R7D A;  5JEA G;  4GKK Q;  2VQF Q;  3EIV A;  4GN3 B;  3ULJ A;  1KC8 C;  1N33 Q;  1VQM A;  2HT1 A;  3HOV G;  2OWO A;  4JI6 Q;  2UXC Q;  4QJF A;  2VQE L;  1PHJ A;  2KCT A;  2YTY A;  4IFD I;  1L1O C;  4P73 A;  3M7N A;  4LW1 A;  4GKJ Q;  3OTO Q;  4LF5 Q;  1C0A A;  4DR6 L;  4O0A A;  2NZO A;  3OW2 A;  4BBR H;  4B3T Q;  1KIX A;  3HOY G;  2UUA L;  1VQG A;  4J15 A;  1IBM L;  3L7Z C;  1XPO A;  1CUK A;  3PV0 A;  3GDE A;  1E24 A;  1HR0 W;  1K0R A;  1X9N A;  4JI5 L;  2E8G A;  5IWA L;  1XJV A;  1IZ6 A;  1BKB A;  1KL9 A;  5E7N A;  4H02 A;  2VQE Q;  3HOZ H;  1AH9 A;  1E3P A;  5GAG C;  1XNQ Q;  3BJU A;  1K9M C;  3BU2 A;  4MZ9 A;  5LMN W;  1QUQ B;  5C3E G;  2AMC B;  5FJ8 G;  1EOV A;  3CCM A;  2WAQ E;  1I6H H;  4DR6 Q;  3G4S A;  4BXX H;  4DUY Q;  1L0W A;  3PCO B;  1IBM Q;  2UUA Q;  4P74 A;  4JBJ A;  3PIO A;  2RHS B;  2PI2 E;  1CKN A;  4PMW A;  1LM0 A;  4JI5 Q;  1L1O A;  4YWM A;  3MEF A;  3T1Y L;  3HOU G;  3UDX A;  4DV4 L;  3T1H Q;  4LF6 L;  3S2D H;  1X6O A;  4HID A;  2N78 A;  4DV5 L;  1VQI A;  3AFP A;  4P75 A;  3ERS X;  2K5H A;  4DV6 L;  3BZC A;  2HHH Q;  2KCM A;  2K5N A;  3RR5 A;  2R7Z G;  1HJP A;  2B29 A;  3K8A A;  4A75 A;  1Q82 C;  2JA5 G;  1TWH H;  4X6A H;  4XIG S;  1N36 L;  1E7Z A;  3CD6 A;  1NJI C;  1GO3 E;  2Q2U A;  2KEN A;  1VQF A;  2LSS A;  3KDF A;  3PO3 H;  1VQ6 A;  2Y0S E;  4MNO A;  1PH3 A;  4DV5 Q;  1C7Y A;  4JOI C;  3S1N H;  1K73 C;  4DV6 Q;  3VDY A;  1SRO A;  1XMQ Q;  5C0X J;  1VQ8 A;  4QY7 A;  3PO2 H;  1VQA A;  1HNZ L;  1QUQ A;  2Z6K C;  4OWX B;  1N36 Q;  1Q12 A;  3HKS A;  4DR1 L;  4A3B H;  4NB3 A;  1HZ9 A;  4YCV A;  1SE8 A;  2K5V A;  3D0F A;  3S1M H;  1HH2 P;  1WJJ A;  2AKW B;  2KBN A;  2I0Q A;  3F2B A;  1T9H A;  3EBE A;  4DR7 L;  4DUZ L;  2RCN A;  1XMO Q;  1G6P A;  2JJQ A;  4A93 H;  4OWT B;  1N32 L;  4A3K G;  2VUM H;  4QL5 A;  1HNZ Q;  1VQD A;  2D62 A;  3CCE A;  1B70 B;  1A62 A;  4A3L H;  1J5E Q;  2K52 A;  3PGZ A;  5M3M G;  4C2M H;  5IE8 A;  4JBW A;  4JOI A;  5JJI A;  3CCR A;  5FLM H;  3L0O A;  1Y1V H;  2UUC L;  1QZG A;  3I4O A;  1S3O A;  3M4P A;  3I55 A;  4GNX B;  2Z6K A;  3HOY H;  1N32 Q;  4BY7 G;  3HKZ G;  3CPF A;  2Y0S G;  2CWA A;  4DR5 L;  3CPW A;  1OXS C;  4IPG A;  2ATW A;  2BH2 A;  1XPU A;  3J80 i;  1KD1 C;  4R4Q A;  4DV0 L;  1VCI A;  2CFM A;  3CP0 A;  4GLV B;  4GNX C;  3GTL H;  2E2J H;  3A5Z B;  3OYY A;  4JCV E;  4DR2 L;  2CCZ A;  4BBS G;  2BA1 A;  4KI0 A;  1JMC A;  2UUC Q;  4LNQ A;  5C3E H;  4OO1 G;  5FJ8 H;  2Q2I A;  4AIM A;  2ID0 A;  3PIP A;  3KJO A;  3E0E A;  4JI3 L;  4JI1 L;  1IXR A;  1X3E A;  1YJ9 A;  3GTG H;  4DR5 Q;  4QIW E;  1IL2 A;  3PO2 G;  1RL2 A;  4P72 A;  4R4O A;  1O7I A;  1EYG A;  1U5K A;  1BBU A;  2ALY B;  1SMX A;  2H5X A;  4JI8 Q;  3U50 C;  1YJW A;  4A3B G;  1OXV A;  4B3S L;  1RIP A;  4DR2 Q;  3ULL A;  4GN5 A;  5AJ3 L;  1HZC A;  3FP9 A;  1HNX Q;  3K80 C;  1FL0 A;  4DR7 Q;  4JI3 Q;  4JI1 Q;  3WWV A;  1VQ7 A;  2JEA I;  1CKN B;  4A93 G;  1UE1 A;  2R7Z H;  4K0K L;  3J81 i;  2JA5 H;  3S16 H;  4R1J A;  4JV5 L;  4A3L G;  1WYD A;  3TQY A;  5C4X G;  1X65 A;  1SR3 A;  4PZ6 A;  3HFZ B;  1M1K C;  5FLM G;  1BVS A;  1PFS A;  1VQK A;  3PSI A;  4DV2 L;  3UE0 A;  1Y1V G;  2NN6 G;  3GTK H;  1JJC B;  1I50 H;  3STB D;  3F8T A;  1KQS A;  1LYL A;  4NXM L;  1Z9F A;  4IJL A;  3KDF B;  4X65 L;  4JV5 Q;  4IFD J;  2MNA A;  1UWV A;  1YNX A;  3GTM H;  4JI0 L;  2JA6 G;  1D7Q A;  1W2B A;  3TEH B;  3RLF A;  1PH5 A;  2Z0S A;  4WJ3 M;  5JEA J;  1AE3 A;  3UDI A;  2HIX A;  4P71 A;  2B3G A;  4C3H H;  1OXX K;  3PUW A;  2VNU D;  1A63 A;  3Q8D A;  1YBY A;  4A3K H;  4DV7 L;  3BZK A;  4OX9 L;  1CKO A;  5H1S E;  4NXM Q;  1Q1E A;  2WFW A;  4R4T A;  4X65 Q;  3RLO A;  1PH2 A;  2OCE A;  5M3M H;  1V9P A;  4JI0 Q;  1OXT A;  2R92 H;  5IWA Q;  3PUZ A;  5K36 G;  1YHB A;  3U58 A;  4O2D A;  2WB1 G;  3S24 A;  1UEB A;  3PUY A;  4EQ5 A;  5FLX c;  4GLA C;  4JC0 A;  3HOX H;  4BY7 H;  2UXD L;  2IT1 A;  1VS0 A;  2D0O A;  1I94 L;  5GAH C;  1VQB A;  5DLQ E;  4OX9 Q;  2D0P A;  3M4Q A;  4DV1 L;  4A3E H;  1IBK L;  1LUZ A;  2NVY H;  2YTX A;  2QGQ A;  3K7A H;  1X56 A;  1HNW L;  1KHI A;  4XTC S;  2JA8 H;  1QVC A;  3JAM c;  1UE6 A;  4A3C G;  4A76 A;  2EIF A;  3T1Y Q;  2V1C C;  4DV4 Q;  4BBS H;  2YYZ A;  1X3F A;  3ZJY C;  5GQO A;  5J3B A;  3CC7 A;  3GTP H;  4LF6 Q;  1NE3 A;  3HKZ E;  1ASY A;  3DLL A;  3CCJ A;  4HJ8 A;  4A3J H;  2ES2 A;  4Y52 H;  1K3R A;  2OTL A;  3HOW G;  1N8R C;  4GS3 A;  3CCL A;  2F52 A;  3EN2 A;  4DV1 Q;  1ASZ A;  5C0X G;  3CCV A;  1B7Y B;  2E5L L;  1HNW Q;  1WCM H;  5C44 H;  3FHW A;  2CWP A;  4DV3 L;  4A3F G;  3TRZ A;  4LFA L;  1PH6 A;  4JG2 A;  1Q7Y C;  4BA2 I;  3F1Z A;  3J81 c;  1YIJ A;  4B3M L;  1Y1W H;  5LMU L;  4YHH L;  3DM3 A;  2VY3 A;  4DAY B;  5C4J H;  1PH4 A;  1QZH A;  1G51 A;  3KFU A;  2AWO A;  1KAW A;  1V1Q A;  2N49 A;  4GN4 B;  4OXP A;  1PYB A;  1IBL L;  1PH1 A;  2UU9 L;  4B3R L;  4UP9 A;  3UE1 A;  3ER0 A;  2E5L Q;  4JBK A;  3S17 H;  3ULP A;  1M90 C;  4DV3 Q;  1WFQ A;  3K0X A;  5C4X H;  3H3V H;  4YWK A;  5IYB H;  4DR1 Q;  3I4M H;  3S15 H;  2BH8 A;  2MO0 A;  4L5R C;  2VL6 A;  3M9B A;  4B3M Q;  4EX5 A;  5LMU Q;  2R92 G;  3LGJ A;  4YHH Q;  1H95 A;  4C3J H;  4LFB L;  1JJG A;  4A4I A;  1EQR A;  3CCS A;  3S14 H;  3S1R H;  3AEV A;  4KHP L;  2LXJ A;  4DUZ Q;  4A3I H;  4ALP A;  4DPG A;  1MIU A;  1L2F A;  2GVB A;  3HOX G;  3K81 C;  3HOU H;  1JB7 A;  1IBL Q;  3SGI A;  1U0L A;  2DGY A;  4YCU A;  1E1O A;  3I56 A;  1MJE A;  4A3E G;  2Q2H A;  4IPC A;  1XTD A;  1VQN A;  5BR8 L;  2JA6 H;  4X62 L;  1GVP A;  2JA8 G;  1NTG A;  4JYA L;  4FDB A;  4YWL A;  2NVX H;  4A3C H;  1JT8 A;  4AH6 A;  1MKH A;  3RNU A;  1YEZ A;  3CF5 A;  1EIY B;  4C3I H;  2I5H A;  3I2Z A;  4KHP Q;  4A3J G;  2KHJ A;  2JA9 A;  2UUB L;  2OQK A;  4LFC L;  4OWW B;  2NZH A;  2ZM6 L;  4QQB X;  1TWF H;  5BR8 Q;  4JYA Q;  4X62 Q;  3U4V A;  1WCM G;  3A74 A;  1CSQ A;  4X64 L;  5C44 G;  4OO1 I;  4DR4 L;  4DV0 Q;  1VQL A;  4JI7 L;  1SN8 A;  1P16 A;  1HZA A;  1CSP A;  3NEL A;  2F3I A;  1NBW A;  3GO5 A;  1VQ4 A;  1Y1W G;  4R4I A;  4IPH A;  4AYB G;  1VQC A;  5GAD C;  3I4N H;  1UE7 A;  1K8A C;  4YY3 L;  1EWI A;  3I7F A;  2ZJR A;  3GTQ H;  1AE2 A;  1EQQ A;  4LFC Q;  2ZM6 Q;  1PH7 A;  5JJL A;  1PVO A;  5M5Y H;  1YJN A;  2K50 A;  4R4C A;  3STB C;  2QEX A;  1FJG L;  1BBW A;  2WB1 E;  5M5X H;  5IYB G;  1TWG H;  4JI7 Q;  3RN2 A;  3I4M G;  4A3D G;  4B3S Q;  4LWC A;  4L5Q A;  4OON A;  5IP7 H;  5AJ3 Q;  4AQY L;  3HOW H;  4POF A;  3H0G G;  1CKM A;  2VQF L;  1E22 A;  2CKZ B;  1N33 L;  4YY3 Q;  2B63 G;  1Z47 A;  4JI6 L;  4A3I G;  4IOA A;  3D31 A;  4A3G H;  1I3Q H;  4LF8 L;  3J7A 5;  2VW9 A;  2N3S A;  1OTC A;  4POG A;  1VQE A;  2JEB I;  2WP8 J;  4Y7N H;  3H3V I;  1TWC H;  4A3F H;  3OTO L;  4GKJ L;  2ZJP A;  1XPR A;  1FJG Q;  2XGT A;  3KLW A;  2GVA A;  2YTV A;  2NN6 I;  4NPS A;  4LUO A;  1EUJ A;  1KRS A;  5GAE C;  2HQL A;  2I5L X;  1C9O A;  3L2P A;  2QA4 A;  5M3F G;  4HIM A;  4GOP C;  5IYD G;  4AQY Q;  1Q46 A;  4PZ7 A;  4DNI A;  4DV2 Q;  4A3M H;  2AWN A;  4BY1 H;  1QVF A;  3TS2 A;  1YZ6 A;  4DR3 L;  4WJ4 A;  1YVC A;  4LF8 Q;  4PZ8 A;  1XNQ L;  4JI4 L;  2RF4 A;  4LF7 L;  4UP8 A;  2PQA A;  3AYH B;  2IY5 B;  4KHZ A;  5M5W H;  4DUY L;  1Q86 C;  4KLK A;  1PV4 A;  3PUX A;  3KOJ A;  2IX0 A;  1TWA H;  1S72 A;  3GTO H;  5IY0 A;  2A1A A;  3J80 c;  2K14 A;  4HJA A;  2JQO A;  4DR3 Q;  3T1H L;  3I4N G;  4DV7 Q;  3MXN B;  4JI4 Q;  1A8V A;  2OTJ A;  4LF7 Q;  3M4O H;  3KF6 A;  1PYS B;  3NEN A;  4GOP A;  2HHH L;  1P8L A;  1N9W A;  3NEM A;  4IPD A;  1KRT A;  3F2D A;  1WOC A;  2XTI A;  1EIF A;  4L5S A;  2R93 H;  1PH8 A;  3GTJ H;  2AHO B;  2NVT H;  5IP7 G;  5IT9 c;  3S2H H;  1NMF A;  1PA6 A;  2OQ0 A;  3RZO H;  2UXD Q;  2K4K A;  1I94 Q;  5IP9 H;  4IO9 A;  1R9T H;  1IBK Q;  4A3G G;  2MFI A;  3W1G A;  3UDG A;  2K75 A;  3CAM A;  4TVA B;  3G6E A;  1Q81 C;  1QVG A;  2IX1 A;  1FGU A;  4DAM A;  1EFW A;  1VQ9 A;  1XMQ L;  4HJ9 A;  1VQP A;  2VZA A;  4NXN L;  3M85 A;  2EXD A;  2MQH A;  4UPA A;  2YU9 H;  3CCQ A;  5GRO A;  4DKA C;  3J81 j;  1VQO A;  5C0X I;  1SLJ A;  1YIT A;  4DK6 C;  3H15 A;  4JI2 L;  1NY4 A;  3E9I A;  4A3M G;  3PF4 A;  4BY1 G;  2F4V L;  4IJH A;  3CMA A;  2NVQ H;  4UP7 A;  3B6Y A;  2Q2T A;  1JJ2 A;  2VS1 A;  3UDF A;  1HNX L;  4UY8 C;  4K0K Q;  1MJC A;  4YCW A;  3CCU A;  4X66 L;  1DGS A;  1XMO L;  3CW2 C;  2PNH A;  4LFA Q;  1X3G A;  4A3D H;  1WI5 A;  4NXN Q;  4AYB E;  4BBR G;  4LF4 L;  1IYJ B;  3CC2 A;  3G71 A;  2FXQ A;  2C35 B;  2E2I H;  5IYC H;  2WAQ G;  1Q1B A;  4IOC A;  1X55 A;  1J5E L;  4RMF A;  3FKI H;  3H0G H;  1J6Q A;  1SRU A;  2IHE A;  4JI2 Q;  2E2H H;  2B63 H;  3NBH B;  2F4V Q;  2L15 A;  4DK3 C;  1GM5 A;  1FVI A;  3GD7 A;  3CXC A;  2IHF A;  1Q8K A;  3KF8 B;  1UE5 A;  1I5F A;  1YI2 A;  1K8G A;  2UU9 Q;  4JBM A;  3HOZ G;  4B3R Q;  4QGU A;  2ZTE A;  3KYH C;  2MO1 A;  4X66 Q;  3A0J A;  2ZTC A;  2I5M X;  2ZJQ A;  2JA7 H;  1X54 A;  2KHI A;  4LF4 Q;  4BXX G;  4APV A;  5M3F H;  3CC4 A;  1XNR L;  5IYD H;  5HGQ A;  4GLX A;  4LFB Q;  2R93 G;  3W1B A;  3HOV H;  2HIV A;  3U4Z A;  1KXL A;  3PF5 A;  2JE6 I;  1PH9 A;  4HJ7 A;  3TRE A;  4BA1 I;  5IP9 G;  2UXB L;  3RLN A;  4LF9 L;  2YV5 A;  1OXU A;  4ME3 A;  3F2C A;  1S40 A;  1K83 H;  5JJK A;  5ELO A;  4MTN A;  3ICE A;  1HR0 L;  3W5O A;  1XNR Q;  4RG1 A;  3J7Z C;  3KJP A;  3E9H A;  1SFO H;  2PI2 A;  5HY6 A;  1G29 1;  4JI8 L;  1N34 L;  1VQJ A;  4LUZ A;  1E1T A;  2PQA B;  5LMN L;  2ZTD A;  2UUB Q;  1YHQ A;  2ASB A;  2UXB Q;  4TQU S;  3PO3 G;  1Y14 B;  2R6G A;  4LF9 Q;  2PMZ E;  1A0I A;  1B8A A;  3JAM i;  1D8L A; 
#chains in the Genus database with same CATH topology
 3VYU A;  4OX9 H;  1XTC D;  2FK1 A;  3NK9 A;  2R8H A;  2IJ0 A;  1GD7 A;  2GN5 A;  3AFQ A;  3S1Q H;  1K0S A;  1R4P B;  2BA0 A;  5JAV A;  2JEJ A;  2DJF C;  3IRB A;  3NTI A;  5LYJ F;  2N8N A;  1S03 G;  4PG3 A;  2A6E D;  2CQA A;  2TMP A;  1TT2 A;  4DGZ A;  4IAL A;  2IW3 A;  1WSC A;  4ECR A;  2CZG A;  4UCO A;  3A5U A;  3M3Y H;  3P7J A;  3K5N A;  2CQO A;  1WTO A;  5FPR A;  1B04 A;  1EYD A;  4HIO A;  4CKB A;  3TS0 A;  3GIJ A;  1TWH A;  4TUY F;  4DV1 H;  4IFD G;  4V19 0;  2EYF A;  1FYC A;  2RHQ B;  2J0T D;  2A8V A;  2JA7 G;  1YNN C;  2D2C C;  2VUM G;  4ECW A;  1TXY A;  1XYI A;  3HOY B;  2L5T A;  1F9Q A;  1HPC A;  2R87 A;  4E6I A;  2ZDH A;  2PMZ B;  4GKK Q;  3NTH A;  2VQF Q;  4GN3 B;  1KC8 C;  1N33 Q;  3HOV G;  4WJ3 M;  3PVX A;  2CW0 C;  1SXT A;  2EY6 A;  4QJF A;  2VQE L;  2UXC Q;  3JAM W;  2XRS D;  4DN4 M;  4LW1 A;  2J4X A;  1I4Q A;  1U9R A;  2F0Q A;  4LF5 Q;  4GKJ Q;  1C0A A;  3VPB A;  2NBF A;  4O0A A;  2XCL A;  4M9U A;  1VQG A;  3L7Z C;  1CUK A;  2WII B;  4LK1 C;  1GXD C;  3GDE A;  4DR1 H;  1E24 A;  1HR0 W;  1KAB A;  3TIN A;  2VA2 A;  1X9N A;  4JI5 L;  3Q8P B;  4IZ8 A;  5LMU H;  1BKB A;  4YHH H;  4ECT A;  1DYQ A;  3OWF A;  1XNQ Q;  4V0B A;  3BU2 A;  2L11 A;  4L1K A;  2UU9 H;  4B3R H;  5EJW A;  4LAA A;  1IBM Q;  1I7N A;  4YAJ B;  4U68 A;  1QCB D;  1ML0 D;  3RB4 A;  5HGT A;  5ELE A;  1L1O A;  2MUY A;  3QZ8 A;  4DV4 L;  5KX5 F;  4XQJ A;  3S2D H;  1ENF A;  4O1N A;  1CM9 A;  2N78 A;  5EPJ A;  2V4R A;  4KHP H;  2F0U A;  3AFP A;  1O78 A;  4KJN A;  4ZKC B;  5CBE E;  2K5H A;  2HHH Q;  2KCM A;  3K58 A;  4I7Z C;  4HMJ A;  4X62 H;  1TWH H;  2RDJ A;  1N36 L;  4TV9 F;  1GO3 E;  1QNU A;  4RWS C;  1E4E A;  2KEN A;  2YL2 A;  5KKN B;  3PO3 H;  1KNE A;  1VQ6 A;  2FIN B;  4MNO A;  1PH3 A;  4RGM A;  3Q6S A;  4Q0F A;  2R61 A;  3S1N H;  3T5H A;  3E6Z X;  5DQH A;  1N56 A;  1GOZ A;  1LT5 D;  3WOE A;  1XMQ Q;  1VQ8 A;  3GIK A;  4QY7 A;  5FO8 B;  3PO2 H;  2K28 A;  2NZ1 D;  5E4X A;  4EFB A;  2XC9 A;  2ZM6 H;  1I6H B;  1VF7 A;  3H94 A;  3TP7 A;  1M6V A;  2XIG A;  2PZW A;  1FNV A;  2E2D C;  3BAB A;  4NB3 A;  1PTO D;  1SE8 A;  2K5V A;  3D0F A;  5KFI A;  4FXG C;  2LY7 A;  3LNN A;  4ED6 A;  2JA5 A;  1PTO F;  3KBX A;  4OWT B;  1B9M A;  1KDB A;  4ZKB B;  4RB2 C;  1HNZ Q;  3ONA B;  1VDZ A;  2E76 C;  4MIU A;  1CFM A;  3WO0 A;  3PGZ A;  5IE8 A;  1VBH A;  1GJX A;  5FLM H;  5CYU A;  1ZQ7 A;  1RJT A;  1ICF B;  2EY2 A;  5D1O A;  2PQE A;  1QZG A;  1S3O A;  4K8I A;  3I55 A;  1N32 Q;  3Q8S B;  1H9R A;  3G6J B;  3HKZ G;  3T51 B;  2Y0S G;  2Z9H A;  3VR4 A;  3OTO H;  1D5X C;  1OXS C;  1XPU A;  1Q90 A;  2B2U C;  4QB4 A;  1VCI A;  2A69 D;  2E2J H;  5KT6 A;  4IAJ A;  4XYO A;  2R84 A;  4LNQ A;  2UUC Q;  4ECY A;  5FJ8 H;  1YJ9 A;  4A3B B;  3E0E A;  3T16 A;  4KV6 A;  4DV7 H;  1MZB A;  4O42 A;  1ENA A;  1CHP D;  4DR5 Q;  2L1B A;  4R4O A;  4P72 A;  3ETH A;  1EL0 A;  4A93 B;  5DNF A;  1EYG A;  4DUY H;  2VUM B;  1MBY A;  3C1E A;  1RIP A;  4B3S L;  2UVW A;  1S4Z A;  5KT7 A;  1PLF A;  5AJ3 L;  1JKJ B;  2H4O A;  4IQZ A;  4KMU C;  3K80 C;  1FL0 A;  1KJQ A;  4DR7 Q;  3MC0 B;  4JI3 Q;  4HN7 A;  2RA4 A;  1KNA A;  1WTV A;  1CKN B;  4ED0 A;  3MHB A;  1UE1 A;  2JA5 H;  3S16 H;  2ZXR A;  2EYO A;  1M7J A;  2ICI A;  2AGQ A;  4R8N A;  1HXY D;  1WYD A;  3TQY A;  5C4X G;  1X65 A;  2SEB D;  1B53 A;  2K1B A;  2A68 C;  5KNC A;  2PZT A;  3RB6 A;  1VQK A;  4QIW B;  4C3J G;  2PO4 A;  1O7Y A;  3W2D A;  1I50 H;  2JEI A;  3STB D;  4ZHQ F;  3PW5 A;  3PIO 3;  1Z9F A;  4IJL A;  3KDF B;  4X65 L;  2M00 A;  3I72 A;  1HFG A;  1YNX A;  2YS7 A;  4JI0 L;  2AQ1 B;  2JA6 G;  4RNO A;  3MWE A;  4CJ1 B;  1EQV A;  3TP8 A;  2W57 A;  5L9X A;  3BYT B;  2K5W A;  2F4V H;  1A63 A;  2CW7 A;  2WB1 B;  1G6Z A;  1WH2 A;  4NXM Q;  4X66 H;  4R4T A;  3GID A;  5BN5 A;  1V9P A;  3X3M A;  1Y1V A;  3PUZ A;  4LFB H;  3KHH A;  4S3S A;  2R6F A;  4ED8 A;  3G6Y A;  3F2U A;  4BY7 H;  1I94 L;  1VQB A;  1IBK L;  3EFX D;  3L4J A;  2XN9 C;  1KHI A;  4XTC S;  2JA8 H;  2R7M A;  3GTL A;  3JAM c;  2RDF A;  4NLG A;  2H1E A;  1E2V A;  2EIF A;  2VB3 X;  2V1C C;  3A7A B;  4DV4 Q;  4BBS H;  2QYZ A;  2YYZ A;  3ZJY C;  4EEY A;  3PW7 A;  1XX8 A;  4Y52 H;  1SE4 A;  4DAP A;  4ME6 A;  3J80 E;  1GSA A;  4GC6 A;  5C0X G;  4DNT B;  1IHZ A;  3I8Z A;  1AN8 A;  1LO5 D;  5J1Z A;  5C44 H;  4LFA L;  3JAM E;  1BR9 A;  5LP6 F;  2QCP X;  2F4I A;  1K3B C;  1KDA A;  3SK5 A;  4MA5 A;  5C4J H;  3QOJ A;  2EY5 A;  1N34 H;  3J7Y W;  2KHS A;  4FBU A;  2AUJ D;  1KAW A;  3BG3 A;  1QWY A;  5KFZ A;  3UE1 A;  5KRU A;  2E5L Q;  3QWN A;  3HOX B;  3S17 H;  1GSH A;  3HKZ B;  4DV3 Q;  1M90 C;  1PX2 A;  1IYU A;  1WFQ A;  3K0X A;  1RF2 D;  4NMZ A;  3H3V H;  4O3R A;  1F2L A;  3S15 H;  1TA8 A;  3LP8 A;  5DLF A;  3J7A V;  3OSN A;  2AUK A;  1O80 A;  5KG0 A;  3H4B A;  2I46 A;  3PIP 3;  3S1R H;  4HYK A;  1RHP A;  1JC7 A;  4DPG A;  1TWC A;  5JH7 F;  1TY2 A;  4J6H A;  1B4O A;  1IBL Q;  2RKS A;  1U0L A;  4YCU A;  4QWC A;  3GLK A;  1VQN A;  2Q2H A;  2QKI C;  4B3T H;  1X3P A;  2V59 A;  4AH6 A;  2MCT A;  3HRZ C;  4HNU A;  1Z7T A;  4C3I H;  3JAM L;  2EZV A;  2EJM A;  4U7C A;  3K6O A;  5IGD A;  3E3X A;  2JA9 A;  1LTA D;  1Y1W B;  3DHQ A;  4AYB B;  3Q2O A;  4EFE A;  2R92 A;  1SNO A;  3GTO A;  4DR6 H;  2FP4 B;  5BR8 Q;  4O4I F;  1WCM G;  2K04 A;  3A74 A;  4OEL B;  4IUR A;  1WTX A;  1HFN A;  1C3O A;  4DR4 L;  3LML A;  4JPB W;  3NEL A;  3GO5 A;  2KQ3 A;  3I70 A;  5C4X B;  3OHB A;  4IPH A;  5GAD C;  1VQC A;  3I4M B;  1SMY D;  1UE7 A;  1TAE A;  3LX0 A;  2NVY A;  5KGU A;  1S97 A;  4IUP A;  4C3J B;  3V05 A;  5KFT A;  5M5Y H;  4A3I B;  2MP1 A;  4R4C A;  3OWE B;  1LTG D;  4XZ3 B;  1EYC A;  2WB1 E;  3G7L A;  3HOU B;  5IYB G;  4A3D G;  1KAA A;  1CE8 A;  4HQ6 A;  2LS0 1;  1CT1 D;  5FK9 C;  4B3S Q;  5KND A;  5FD5 A;  5AJ3 Q;  5IP7 H;  2KEE A;  4AQY L;  2JA6 B;  1YNJ D;  4POF A;  1ESF A;  3H0G G;  5J22 A;  3FPU B;  3GV6 A;  4QUF A;  1G2T A;  1PTO H;  1Z47 A;  1SYX B;  4LF8 L;  3I90 A;  1OTC A;  4BS9 A;  2WP8 J;  4DV6 H;  1TWC H;  4A3F H;  2DNC A;  2ZJP A;  4K5V A;  1TR5 A;  1S0O A;  1TY0 A;  1TKW B;  3GQB A;  1GUG A;  2YTV A;  3SVM A;  1EUJ A;  2ATL A;  1C9O A;  5M3F G;  4GOP C;  4PZ7 A;  4XQQ A;  1YZ6 A;  2HJW A;  1STY A;  1YVC A;  1J9O A;  3M4I A;  2AQ3 B;  4O3N A;  3GTQ B;  3OOC A;  2K5D A;  1LTI D;  1KTK A;  5M5W H;  4YQW A;  1NSN S;  3GTO H;  3KXY T;  2R3Z A;  5IIF A;  1NUC A;  4IRK A;  2YRW A;  3T1H L;  3I4N G;  3TQT A;  4G3I A;  5KYL A;  4JI4 Q;  2OTJ A;  4B9W A;  5C4H A;  5D1P A;  4LF7 Q;  3MFY A;  4H13 C;  1I3Q B;  5EDW A;  3NEM A;  4IUU A;  3F2D A;  1WOC A;  1VAJ A;  2HDM A;  2R93 H;  3GTJ H;  3S2H H;  1Z2N X;  1NMF A;  3R93 A;  1EY4 A;  1I94 Q;  4MTE A;  5IP9 H;  1W96 A;  4Y8V B;  1ZHQ A;  1IBK Q;  2K75 A;  4TVA B;  1Q81 C;  2IX1 A;  2Z1C A;  1VQ9 A;  3GV3 A;  5HUR A;  2VQD A;  4PMB A;  2VZA A;  4NXN L;  3M85 A;  4RA8 A;  1A6X A;  2QIL A;  1HHV A;  4RGN A;  5C0X I;  2W6P A;  1ILP A;  3KLS A;  1V8Q A;  2O4X A;  1MHW C;  4KKT A;  4BY1 G;  4DR2 H;  1EZ8 A;  3FDS A;  4UY8 C;  2K5Q A;  3UDF A;  1NCV A;  4K0K Q;  4JI1 H;  3CCU A;  1PRT B;  1STA A;  1XMO L;  3KAJ A;  1JWS D;  4TV8 F;  4IRC A;  3D4R A;  1X3G A;  4LFA Q;  4AYB E;  4BBR G;  4L6T B;  5EWG A;  4PV1 C;  1X55 A;  1J6Q A;  4J8Q A;  3H91 A;  2KEC A;  1NAP A;  4MAM A;  3M9N B;  1H9K A;  1AZQ A;  3OUU A;  1FVI A;  4YAK B;  3GD7 A;  1U4L A;  2IHF A;  2V4D A;  4JBM A;  4JK1 C;  2NVT B;  2PCF B;  5FPO A;  2O2L D;  2FE3 A;  4MV3 A;  4IFD H;  3BA9 A;  3K3P A;  2JA7 H;  2ZJQ A;  4WOR A;  3ORR A;  3U9S A;  4DL7 A;  4LMQ D;  4RCO A;  4IUQ A;  3CC4 A;  4UAI A;  5CBA E;  4GLX A;  2FFK B;  2QK4 A;  1WTP A;  3OMC A;  3HOV H;  3U4Z A;  4RKL A;  2SOB A;  1J8I A;  3FVQ A;  3PF5 A;  1OWT A;  1BCP B;  1LTS D;  4XT1 B;  3QZ7 A;  3C3L A;  3WO1 A;  4BA1 I;  3VYT A;  2F0I A;  3RLN A;  2YV5 A;  4OL7 A;  1S40 A;  1TWA A;  5IOD A;  2WAQ A;  2JEG A;  2NVQ B;  2V9W A;  2OXP A;  3R3O A;  4I65 A;  3TIG A;  1HTP A;  4N8F A;  3J7Z C;  5HY6 A;  2O03 A;  2RSN A;  2VB2 X;  2UVU A;  2WAC A;  5IWA H;  4A3D B;  1PRT D;  1WD1 A;  3OIQ A;  1E1T A;  2PQA B;  3NUC A;  1YHQ A;  3TII A;  3AMU A;  2UXB Q;  3K5I A;  3H0G B;  2W70 A;  2R6G A;  2E2H B;  1PRT F;  3NGD A;  1GUN A;  1A0I A;  3VYR A;  3JAM i;  4QUC A;  2RVL A;  2DNE A;  2AGO A;  3N42 B;  2JP1 A;  5KFU A;  4DR4 Q;  1HR0 Q;  4CDD C;  3JC6 6;  1EIH A;  4JV2 A;  1I4G A;  4HJ5 A;  3FKI G;  3AQQ A;  4GKK L;  4TRD A;  2IMW P;  3KF6 B;  1VQ5 A;  4LF6 H;  3RZD H;  2UXC L;  3ITP A;  2Y0S A;  3CKI B;  3K7U C;  4LF5 L;  1WTW A;  1LTL A;  2IBK A;  2YU9 A;  1JE5 A;  2JK8 A;  5C5M A;  5FLX W;  5L1L A;  3BDC A;  1BUV T;  1L1O B;  2YZG A;  2XGP A;  3N41 B;  1HNW H;  3X3N A;  1I4R A;  1BCP D;  1PDQ A;  4LUV A;  4GNX A;  1K83 B;  4F7X A;  2HT1 A;  1BCP F;  2JYO A;  3EIV A;  3ULJ A;  1SFO B;  1H9M A;  2KCT A;  2YTY A;  1L1O C;  2XWJ B;  5ISR A;  4MA0 A;  3M7N A;  3PR4 A;  2F0N A;  1FKA H;  3MFG A;  5CGK A;  3HOY G;  1IBM L;  1XPO A;  4MV8 A;  4Q43 A;  5KFJ A;  4B3M H;  2E8G A;  1XJV A;  3RV3 A;  1EYA A;  1O75 A;  5A35 A;  2C2D A;  3JSN A;  5E7N A;  3HOZ H;  1AH9 A;  5IGG A;  1PYW D;  1KBL A;  1KLU D;  4M1U B;  2W6M A;  4DUZ H;  4MZ9 A;  3CQZ B;  4MV6 A;  3J81 W;  4EBC A;  2AMC B;  3CCM A;  1EOV A;  1IKL A;  4BXX H;  1HRJ A;  2UUA Q;  1L0W A;  3PCO B;  1K1S A;  4C2M A;  4JBJ A;  4F4X A;  1LM0 A;  4YWM A;  3MEF A;  4K14 A;  5L1J A;  3Q24 A;  3T1H Q;  5C3W A;  4HAE A;  3DWP A;  2SCU B;  5GON F;  3ERS X;  1DIK A;  1JOK A;  1RKN A;  5J2T F;  2K5N A;  3RR5 A;  2R7Z G;  3Q8Q B;  1HJP A;  1CZG A;  2B29 A;  3K8A A;  3SHL A;  4A75 A;  2CW8 A;  5LOV F;  2ZDG A;  2DY7 A;  2F0K A;  3A7L A;  1E7Z A;  3CD6 A;  3V4Z A;  5D1O B;  4DV0 H;  2GLT A;  3G8C A;  4O2B F;  1JB3 A;  2EYM A;  5KFV A;  4I7H A;  3NWT A;  4DV5 Q;  4O4L F;  1QE6 A;  3FRP B;  1ESR A;  5CV6 A;  3VDY A;  3SEB A;  1KEE A;  1LTR D;  5TSS A;  3ERQ A;  5C0X J;  2DZD A;  1EY5 A;  3OUZ A;  4LFC H;  1VQA A;  4ECX A;  3PW2 A;  1HNZ L;  1C30 A;  1I6U A;  2BQU A;  1WD0 A;  1V1O A;  1V1P B;  3K59 A;  4FM9 A;  3HKS A;  4DR1 L;  5DG7 A;  4JI7 H;  1HZ9 A;  3GQC A;  1LT4 D;  1HH2 P;  2AKW B;  4UCR A;  2I87 A;  3UFX B;  4YY3 H;  1XMO Q;  2F3V A;  2JJQ A;  1N32 L;  5KFH A;  5LA6 F;  4FO2 A;  5CV7 A;  4A3K G;  4KD4 A;  4ECU A;  4QL5 A;  1T5X D;  2D62 A;  3CCE A;  1FJG H;  4RNN A;  5M3M G;  5JJI A;  1MSH A;  4C2M H;  4JOI A;  1JXL A;  3CCR A;  4DV2 H;  1Z2O X;  3RD4 A;  2UUC L;  1M0W A;  2EOT A;  3H09 A;  2AQ2 B;  1SEB D;  4H44 C;  2M2L A;  5LL6 X;  3CPF A;  2CWA A;  3VR3 A;  4DR5 L;  4FF2 A;  5A2Q W;  4GKJ H;  1FGB D;  2MHV A;  2HD3 A;  2ATW A;  4C5A A;  4DL6 A;  1EY0 A;  4ILW A;  4CC6 A;  1SBB B;  2IL8 A;  4WD3 A;  3CP0 A;  3AB9 A;  3J7A F;  4OO1 G;  2BA1 A;  1PMR A;  2A6E C;  5C3E H;  4YP3 A;  4AIM A;  1L0X B;  4DR3 H;  4JI3 L;  3L3O C;  4UDU C;  3S1M B;  4K6L A;  2R7L A;  1IL2 A;  4QW9 A;  4CHT B;  5KG1 A;  4A3B G;  4LH6 A;  1AUV A;  1HZC A;  3IAY A;  1HNX Q;  2PNR C;  5COY A;  3RAQ A;  3WWV A;  2GA4 B;  4ED1 A;  5ELB A;  3MVV A;  4A93 G;  4RCN A;  1Y1V B;  3SXH A;  1RJP A;  1AP0 A;  3GTP A;  1VMP A;  3H3V C;  2WDT A;  5BMV F;  3D4W A;  1JOQ A;  2A74 C;  5BPF A;  3O13 A;  1M1K C;  4KN7 C;  1BVS A;  3PSI A;  2FMC A;  2WE6 A;  5J2U F;  2B2W A;  4QWD A;  2GPS A;  2NN6 G;  3GTK H;  4ZI7 F;  3GTL B;  1KQS A;  3F8T A;  5C0X H;  1TQO A;  1WCM A;  1QNK A;  5IT9 W;  4NXM L;  4JV5 Q;  5JUM A;  2MNA A;  4RU9 A;  3GTM H;  3GTG B;  4UHV A;  5C5L A;  3TEH B;  3RLF A;  1UNN C;  5EZY F;  4JI2 H;  5JEA J;  2G9H D;  5DG8 A;  2HIX A;  4P71 A;  2NU8 B;  5KG7 A;  1XXG A;  1YBY A;  4DV7 L;  4OIK A;  2VXW A;  5EPK A;  3NPP A;  3PZP A;  1YNN D;  4G7Z C;  1PH2 A;  1B44 D;  1ZEQ X;  2BOS A;  5BN3 A;  1D2B A;  2E75 C;  4LF4 H;  2R7Z B;  5DM6 3;  4RHR A;  5K36 G;  2CW0 D;  3U58 A;  2AU0 A;  5ELC A;  2WB1 G;  5FLX c;  4GLA C;  3T53 B;  2IT1 A;  1VS0 A;  2D0O A;  2LKV A;  5DLQ E;  4OX9 Q;  4J9P A;  1LUZ A;  2B8G A;  2NVX A;  1X56 A;  1QVC A;  1TS2 A;  1UE6 A;  1XNR H;  3RB0 A;  1G91 A;  1EUC B;  1X3F A;  3HBL A;  3GTP H;  3NE5 B;  1E4G T;  3N44 B;  3RFC A;  4HJ8 A;  4BWS C;  3NTK A;  4CDE C;  3HOW G;  1N8R C;  5FLX E;  4F50 A;  5I9P A;  3CCL A;  1PTO C;  1TWF A;  2F0O A;  4FU0 A;  3EN2 A;  4DV1 Q;  4LF9 H;  3RF2 A;  3EA6 A;  4C3H B;  1B7Y B;  2E5L L;  3KHR A;  1WCM H;  4X64 H;  4DV3 L;  4A3K B;  1PH6 A;  2CH4 A;  2EDG A;  1GUO A;  1S5D D;  3Q0A A;  3F1Z A;  3J81 c;  4KTA A;  2A6H C;  1YIJ A;  4BA2 I;  4B08 A;  3DM3 A;  2VY3 A;  5M3M B;  2R85 A;  1QZH A;  4XYM B;  1G51 A;  2R92 B;  5LMN H;  4WBN F;  2RSO A;  1V1Q A;  4GN4 B;  1IBL L;  1PH1 A;  4DR7 H;  1JCK B;  1LAC A;  3ER0 A;  4MV1 A;  4JBK A;  4NP5 A;  1Y69 U;  4M7E A;  5IYB H;  4DR1 Q;  3MR6 A;  1UAP A;  4FVM A;  3K7A B;  2NVY B;  3HG9 A;  5NUC A;  4A3E B;  1I50 A;  5LMU Q;  2F0D A;  3LGJ A;  4ZQ3 A;  4YHH Q;  3J81 E;  4LFB L;  5DLG A;  4RB1 A;  3S14 H;  3CCS A;  3MFH A;  2DN8 A;  3AEV A;  1KJJ A;  3MAQ A;  3MR2 A;  4JI6 H;  4YIJ A;  4ALP A;  3VPC A;  1L2F A;  3HOX G;  3M4Y A;  2EYJ A;  2DGY A;  4A3J B;  1MJE A;  5FLX L;  1IYV A;  3BVZ A;  5BR8 L;  1GVP A;  4FDB A;  4YWL A;  2NVX H;  3GIQ A;  5COR A;  1MKH A;  2KVM A;  3RNU A;  2W9A A;  1D6E C;  4ULL A;  2BCO A;  5KFB A;  5AFW A;  5FO9 B;  1PZK D;  4KHP Q;  1RD9 D;  5KFM A;  2VQE H;  2KHJ A;  3T5L A;  5HV6 A;  2AQ4 A;  2PPB C;  2UUB L;  4OWW B;  2NZH A;  4QQB X;  2JXM B;  1JOR A;  3F8N A;  1SND A;  1TWF H;  3MWM A;  4IWX A;  4X62 Q;  3U4V A;  1EY9 A;  4OO1 I;  3H4D A;  2O5J C;  4P2C B;  1HZA A;  3C46 A;  1CSP A;  3FMC A;  4JI5 H;  4EBD A;  1Y1W G;  1ILQ A;  3MEH A;  4AYB G;  3I4N H;  4RZQ A;  2ZJR A;  4UFZ A;  1AE2 A;  2CVR A;  1KJ8 A;  2ZM6 Q;  4RHS A;  2W6N A;  5JJL A;  4ZOL F;  5L1I A;  3NBH A;  1KJI A;  3TP6 A;  5CAE B;  3STB C;  4G7H C;  3D4D A;  2QEX A;  3KF8 A;  5M5X H;  2ZXP A;  1GYF A;  3I4M G;  1EWC A;  4DV4 H;  4J9K A;  5F9L A;  4QWA A;  1E22 A;  2P5Z X;  4G57 A;  5F9N A;  5DQI A;  2B63 G;  4HCS A;  4JV0 A;  4DK0 A;  1B33 N;  4A3I G;  1BBX C;  2RCF A;  2VW9 A;  2N3S A;  3HOU G;  5KFX A;  2FMA A;  3QG1 A;  1XPR A;  5DGB A;  3MXP A;  4IN3 A;  3RUZ A;  2HDL A;  2PBZ A;  2NN6 I;  1EFW A;  3L2P A;  4A3C G;  3KAK A;  4EYH B;  1N36 H;  2R8K A;  5HBR B;  3K5L A;  3RBE A;  3TS2 A;  1BDO A;  4BY1 H;  2OH2 A;  3IFT A;  5A2Q E;  1AW7 A;  4PZ8 A;  4JI4 L;  4LF7 L;  4RUA A;  4L8J A;  4ZLT F;  2IY5 B;  2ZDQ A;  4EQP A;  3FKI A;  3PUX A;  5IY0 A;  2A68 D;  2FK2 A;  1STN A;  2RBM A;  3J80 c;  3Q1K A;  1TWG B;  2FK3 A;  4HJA A;  1JQY D;  2JQO A;  3EPI A;  4DV7 Q;  3MXN B;  3HOW B;  1A8V A;  1TVX A;  2V5A A;  3GV7 B;  3PQI A;  3NEN A;  1P8L A;  4TQS A;  4A3G B;  1B6S A;  5T1I A;  4IPD A;  4Y7N B;  2ICE C;  1EIF A;  1EZ6 A;  2PW5 A;  4HSV A;  1B1Z A;  2RGV A;  5IT9 c;  2OQ0 A;  2SDF A;  3RZO H;  4FS2 A;  4FP5 D;  3BQ2 A;  1VF5 C;  4OHJ A;  4A3M B;  2X0S A;  3MWD A;  1QVG A;  3UDG A;  4K0K L;  3CAM A;  2PMZ A;  5A2Q L;  4XX0 B;  4HJ9 A;  2J6S A;  1VQP A;  2MQH A;  4UPA A;  2W71 A;  3R2I A;  1H9S A;  2PW7 A;  5IYZ F;  3TN2 A;  1I4X A;  2V4Q A;  1SYC A;  2FMM A;  4DKA C;  2A5H A;  1SE3 A;  1YIT A;  3H15 A;  5KFE A;  5IT9 E;  1TWA B;  3E5S A;  1K1Q A;  3FDT A;  4EG0 A;  2LMC B;  3B6Y A;  2VS1 A;  2BDN A;  1K8O A;  4MV4 A;  1MJC A;  3W3A A;  5KT2 A;  2VA3 A;  1S5B D;  2YYA A;  1WI5 A;  3G71 A;  4Q5V A;  2C35 B;  3M4O B;  4IOC A;  1Q1B A;  1J5E L;  3T56 B;  4G4K A;  1IW7 C;  3FKI H;  4XDX A;  3R5X A;  2XGQ A;  3SDZ A;  2F4V Q;  4B3S H;  4CDF C;  5C3X A;  1DCZ A;  1WR2 A;  1PZI D;  3BZD B;  1K8G A;  1UE5 A;  4HNT A;  4QGU A;  3J80 L;  4X66 Q;  2MO1 A;  3MXU A;  2NU6 B;  2SNS A;  2I5M X;  3DWA A;  1R9T B;  3DXJ C;  2R7N A;  3DEP A;  2B2V C;  4CKC A;  1D1I A;  1K8M A;  5IYD H;  4LFB Q;  4EQO A;  1BF4 A;  3A55 A;  4FBT A;  2HIV A;  2VOB A;  1KXL A;  4Z9C B;  2ASD A;  1BO0 A;  2JE6 I;  2YU9 B;  1HUM A;  3M9M B;  3NHH A;  2UXB L;  1EEI D;  3BVG A;  3IFD A;  5IT9 L;  1OXU A;  5ELO A;  4DA2 A;  3P20 A;  4O2A F;  1HR0 L;  4X65 H;  3VR5 A;  3E9H A;  1Y8O B;  2PI2 A;  3A56 A;  1AN7 A;  4JI0 H;  3ETJ A;  2JEF A;  2L0C A;  4JI8 L;  2E2I B;  3KTM A;  4ID6 A;  2UUB Q;  2ZTD A;  3WNZ A;  2P0A A;  2FPP B;  2XD4 A;  2R8G A;  3PO3 G;  1I4H A;  1YNJ C;  4TQR A;  3OSP A;  4C5B A;  2B63 B;  4HR7 A;  1DOK A;  2R93 A;  3GTJ A;  3G48 A;  1V43 A;  4IZO A;  4F88 A;  5DGA A;  2BDO A;  5EAY A;  1NNX A;  2F3W A;  1VQH A;  2WYO A;  1RYS A;  2K32 A;  1GKH A;  1FD7 D;  1N34 Q;  5ELN A;  1BOS A;  3BAA A;  1BQQ T;  4GOP B;  2HQE A;  3BVM A;  2B2Y A;  2QDB A;  5CB4 F;  4EGV A;  4HIK A;  3RTX A;  4RFB A;  3OPO A;  1YHA A;  3VA5 A;  1Y8N B;  4ZYS A;  1NMG A;  1W3S A;  5FOB B;  1GGO A;  1STG A;  5C4Z A;  1I6V C;  3RN5 A;  4OGQ C;  1SCU B;  1V4Y A;  2LXK A;  2R7F A;  5JEA G;  1BJT A;  4KKS A;  1VQM A;  4J1M A;  2OWO A;  1PHJ A;  1UUP A;  4P73 A;  2BE5 C;  3ORQ A;  2NZO A;  1D5Z C;  3OW2 A;  5E3F A;  4B3T Q;  1KIX A;  1Q8I A;  3V4S A;  2UUA L;  5FD6 A;  5C3E B;  3KHG A;  3PV0 A;  3OHA A;  1EY7 A;  4LFA H;  2WTF A;  1KLG D;  4R9W A;  3TBI B;  5IWA L;  3K57 A;  1IZ6 A;  2ASL A;  3S1Q B;  3SE0 A;  1L0Y B;  1SYD A;  1TII D;  1E3P A;  1T3N A;  4RKB A;  2JA7 A;  1SNP A;  3BJU A;  3MWY W;  1K9M C;  2EY1 A;  5LMN W;  2ASJ A;  2VUM A;  1JOO A;  5FJ8 G;  1I6H H;  3RAX A;  2WAQ E;  1H9J A;  4DR6 Q;  3G4S A;  3GP7 A;  3M3Y B;  1ENC A;  2DWC A;  5KFF A;  3PIO A;  3BQ1 A;  2EJG C;  4CGY B;  1CKN A;  4PMW A;  3T1Y L;  3EVQ A;  1RDP D;  3QO2 A;  4XXE A;  4IRD A;  5EKL A;  4LF6 L;  2XCA A;  1SE2 A;  1X6O A;  4HID A;  4DV5 L;  2F0G A;  1VQI A;  4P75 A;  1SYF A;  3BZC A;  4RNM A;  4JVZ A;  4QIW A;  5IGF A;  4RGT A;  2C00 A;  2L4N A;  4KY7 A;  1Q82 C;  1Q3L A;  2B39 A;  2JA5 G;  1G8Z D;  3KAL A;  3T5K A;  4XIG S;  1NJI C;  2Q2U A;  2KCC A;  1RK6 A;  1VQF A;  2LSS A;  3KDF A;  4OO1 H;  3M7G A;  4ZQI A;  4I7A A;  2ALZ A;  2Y0S E;  1W6K A;  4JOI C;  1K73 C;  1ONL A;  4DV6 Q;  4Q8E A;  2FLL A;  4PDB A;  1QUQ A;  4HSP A;  2L55 A;  1RTN A;  1TU2 B;  1SYG A;  2BQR A;  3SK8 A;  3E5N A;  1AUX A;  4DR4 H;  1Q12 A;  1F9P A;  4A3B H;  1EIG A;  1ZYR C;  2CH4 W;  4OEM B;  2K03 A;  5D3D A;  4J9O A;  1F2M A;  3F2B A;  1G6P A;  4DUZ L;  2RCN A;  1SEI A;  4A93 H;  1S0N A;  4PMC A;  3S2D B;  2VUM H;  5L1K A;  1VQD A;  5C8Y F;  1B3A A;  1PFM A;  4KY6 A;  1B70 B;  1CS0 A;  3NQT A;  1J5E Q;  1EFI D;  2V58 A;  2NU7 B;  4F4Z A;  3BJY A;  1MI2 A;  2K52 A;  3OMG A;  4JBW A;  1W93 A;  5DM7 3;  4AQY H;  1TWH B;  4MN3 A;  2SNM A;  2NN6 H;  2OF1 A;  3I4O A;  3M4P A;  4DLK A;  1RTO A;  1HQM C;  2Z6K A;  2NTS A;  5JPN C;  4BY7 G;  4LF8 H;  3PO3 B;  3D6W A;  1TS5 A;  4IPG A;  2HVS A;  3S1N B;  2BR0 A;  2BH2 A;  3MFI A;  2QDL A;  3J80 i;  3PO2 B;  1KD1 C;  4R4Q A;  5DG9 A;  4DV0 L;  4UCT A;  2CFM A;  3Q22 A;  2KOL A;  4BBS G;  2CCZ A;  4JCV E;  3I91 A;  1JMC A;  4Q44 A;  4UCS A;  3PIP A;  3KJO A;  1M8A A;  2ID0 A;  4DNR B;  1HNX L;  3G6V A;  3R23 A;  2B2W C;  2NU9 B;  4GC7 A;  5I2X A;  4U67 3;  4NDX A;  1U5K A;  5F2D A;  2ALY B;  3VA7 A;  2J6U A;  4K5W A;  2FB9 A;  4JI8 Q;  1B6R A;  1W6J A;  1KC7 A;  3R2T A;  1EWH A;  4DR2 Q;  3HKZ A;  5JQW A;  1UC8 A;  4GN5 A;  2F03 A;  5E1F A;  2UXD H;  4JI1 Q;  5M9O A;  1VQ7 A;  2JEA I;  1WTQ A;  1ET6 A;  3Q23 A;  1U4P A;  4RAU C;  4JV5 L;  1QB5 D;  2B2T A;  4A3L G;  3PR5 B;  3MR5 A;  1SR3 A;  2W7O A;  4PWQ A;  1PFS A;  1MGS A;  2KJX A;  3UE0 A;  4DV2 L;  2NB0 A;  1Y1V G;  2C5C A;  5ELD A;  2E2J B;  1LYL A;  1EUD B;  1JDE A;  2W6O A;  5KT4 A;  3I4L A;  1HA5 A;  2OT2 A;  2Q8R E;  1E4E B;  2IP4 A;  4NXN H;  1UC9 A;  4O3O A;  4EEQ A;  2YW2 A;  1D7Q A;  1W2B A;  1PH5 A;  5EWE A;  2Z0S A;  1DM0 B;  2JSO A;  2WKC A;  4HCE A;  1X3Q A;  3P1H A;  3T4A C;  2B3G A;  3PUW A;  5D3I B;  1GUS A;  3TQ1 A;  3BQ0 A;  2FPG B;  2EPB A;  4OX9 L;  4ZK9 B;  2W6Q A;  4NKL A;  4CJ2 C;  2OCE A;  3JZI A;  2HVR A;  2PYK A;  4M8A A;  1OXT A;  1G2S A;  5IWA Q;  2JA5 B;  4LJZ C;  3S16 B;  4ECS A;  1YHB A;  3QOL A;  3OHX C;  1LT6 D;  1UEB A;  3PUY A;  3GV8 B;  3NSW A;  4JC0 A;  3HOX H;  5KFG A;  3U9T A;  2JA6 A;  1DV2 A;  4IUT A;  3K0Y A;  4DV1 L;  1C8C A;  2F0S A;  4ECV A;  2QGQ A;  3URY A;  3BS1 A;  1I50 B;  1VBG A;  4RB0 A;  2X69 A;  2I07 B;  1CA5 A;  1ZHS A;  4Q8F A;  1QIL A;  4RGO S;  3T1Y Q;  4A2B A;  4RB3 C;  3CC7 A;  4LF6 Q;  5KFO A;  2IA6 A;  1ASY A;  1EHI A;  3CCJ A;  4K5X A;  2QW7 A;  3ERO A;  2OTL A;  1SNM A;  4GS3 A;  1MSG A;  2KA7 A;  2F52 A;  5KYI A;  1LTB D;  1WTH A;  3CCV A;  1S0M A;  1FNU A;  1HNW Q;  3HB9 A;  3FHW A;  2CWP A;  4A3F G;  4HED A;  2L9H A;  5D14 A;  1EZ1 A;  1Z6H A;  4RZR A;  3KK7 A;  1ICW A;  5LMU L;  1Y1W H;  4YHH L;  2NTT A;  4YBZ B;  1STH A;  5I2Y A;  3GTQ A;  5CC4 A;  1VMC A;  3A8K E;  4C3H G;  3VPD A;  2N49 A;  4OXP A;  2UU9 L;  4B3R L;  4KHV A;  2IPK D;  1LLR D;  1U4M A;  3ULP A;  4BY7 B;  2RDI A;  2ENB A;  5C4X H;  1FR3 A;  3I4M H;  2X6L A;  2BH8 A;  2MO0 A;  3I3C A;  4DXG A;  5BN4 A;  4L5R C;  4B3M Q;  3M9B A;  2R92 G;  1H95 A;  5CA1 F;  3GTK A;  2JA8 B;  4C3J H;  5IGC A;  1JJG A;  4ECQ A;  1EQR A;  2VQF H;  2W6Z A;  1I3Q A;  4GKK H;  1N33 H;  5JVD F;  4KHP L;  4KKU A;  4DUZ Q;  2Q8T A;  4A3I H;  4BBS B;  3M9O B;  2J7Z A;  1MIU A;  2UXC H;  2GVB A;  5KG3 A;  3IL8 A;  3HOU H;  1A9X A;  1JB7 A;  4MTD A;  3GTM A;  4LF5 H;  2Z4H A;  4A3E G;  4K6D A;  4IPC A;  1XTD A;  1RJQ A;  4F4Y A;  3ND8 A;  4MHE A;  2JA6 H;  4X62 L;  3OW7 A;  1NTG A;  4JW0 A;  4A3C H;  1JT8 A;  1ULZ A;  2XWB B;  3AU7 A;  2NUC A;  3CF5 A;  1EIY B;  5C44 B;  2I5H A;  2XIW A;  4QWE A;  3I2Z A;  4A3J G;  1XNQ H;  2OQK A;  4DAY A;  2ZM6 L;  5C4J B;  3LWB A;  4RUC A;  4JYA Q;  3RB3 A;  4X64 L;  1IBM H;  3OSO A;  1R4Q B;  2XSC A;  4DV0 Q;  1VQL A;  1P16 A;  3S17 B;  2XRQ D;  5BPH A;  1ET9 A;  1XWE A;  2F3I A;  1VQ4 A;  5T1G A;  4R4I A;  4YJ2 F;  5C6A A;  3S15 B;  1EWI A;  4CJ0 B;  3GTQ H;  4LFC Q;  1FNW A;  2FLP A;  1S68 A;  2KUM A;  1OO9 B;  3S1R B;  1PVO A;  1TS4 A;  1YJN A;  2K50 A;  2HHH H;  3I73 A;  3CVZ A;  2OEO A;  4C1N K;  1LAB A;  4JI7 Q;  2L12 A;  4JUZ A;  4LWC A;  1M4V A;  1LTT D;  4YR0 A;  4WJW A;  2W9C A;  4YY3 Q;  3PW0 A;  4JI6 L;  2F0T A;  4IOA A;  4C3I B;  2E74 C;  1I3Q H;  4J9S A;  5KFW A;  3H3V I;  3GII A;  1VQE A;  2JEB I;  2ZJT A;  2C28 A;  1BXT A;  3OTO L;  1XMQ H;  1F2Z A;  3HGB A;  1FJG Q;  1AZP A;  3QIA A;  1UEA B;  3D8G A;  5KT3 A;  2G5D A;  3KLW A;  2GVA A;  4NPS A;  5GAE C;  3CMA A;  4LUO A;  2FPI B;  4O3S A;  2HQL A;  2QA4 A;  4HIM A;  5KFC A;  2F0M A;  4A2A A;  1DOL A;  4DNI A;  4DV2 Q;  5KG2 A;  2AWN A;  3VMM A;  3V6H A;  1C48 A;  4WJ4 A;  1T94 A;  5KFY A;  3V6K A;  4F8M A;  4JYA H;  2RF4 A;  1H9S B;  4UP8 A;  2PQA A;  3AYH B;  1HNZ H;  1A3U A;  4KHZ A;  4DUY L;  3H0G A;  1Q86 C;  2E2H A;  3HZX A;  2FJ2 A;  2VR1 A;  1S72 A;  5M5Y B;  3MZ5 A;  3MR3 A;  3TSS A;  3JRW A;  2C2R A;  1X32 A;  4DL3 A;  2K7V A;  1T5E A;  4DR3 Q;  2R86 A;  1L2Z A;  2D9U A;  4R8I A;  3EJI A;  3KF6 A;  1N32 H;  1PTO B;  1JR0 D;  1PYS B;  1S5E D;  3MA2 B;  4OIJ A;  4PQX A;  1TWC B;  4A3F B;  5IGB A;  3BG5 A;  5CV9 A;  5G3L D;  2NVT H;  5JVL A;  2C22 A;  3DWQ A;  1F9S A;  4IO9 A;  1K83 A;  5G3L F;  2UUC H;  1PFN A;  5CV8 A;  2MFI A;  3W1G A;  4A3G G;  1DD2 A;  2AGP A;  3G6E A;  1FGU A;  4KD3 A;  1SFO A;  2R82 A;  4DR5 H;  4DAV A;  3MTS A;  2R7K A;  3V2T A;  3J81 j;  3L9A X;  1VQO A;  1ROD A;  1SLJ A;  5M5W B;  1NY4 A;  3E9I A;  4A3M G;  3PF4 A;  2F4V L;  3GTO B;  2EYH A;  1EQT A;  2NVQ H;  1JX4 A;  3K3V A;  4UP7 A;  5KEE A;  1JJ2 A;  2PVP A;  1JLL B;  4JI3 H;  1K28 A;  1NR2 A;  4YCW A;  4X66 L;  3DEO A;  4FXK C;  4KK7 A;  2X6G A;  4R8U A;  4A3D H;  3CQZ A;  4IUN A;  4KN4 C;  5DEH A;  2FXQ A;  2EYP A;  4K2K A;  2WAQ G;  2EXZ A;  4RMF A;  3VR2 A;  3RV4 A;  1U4R A;  2IHE A;  3H0G H;  4JI2 Q;  2E2H H;  4DU9 A;  2L15 A;  4DK3 C;  4HR7 B;  1GM5 A;  2A69 C;  3CXC A;  2R93 B;  2UU9 Q;  2HGS A;  3HOZ G;  3GTJ B;  4B3R Q;  3SK6 A;  4O3P A;  4ME5 A;  2I80 A;  3S2H B;  1TS3 A;  3N6R A;  2ZTE A;  5IOC A;  1SYE A;  4ECZ A;  2ZTC A;  2B8F A;  4LF4 Q;  4BXX G;  2CHB D;  2IX3 A;  4APV A;  5M3F H;  4U6P A;  2A6H D;  4XQN A;  4J0M A;  5JEA H;  4LH7 A;  5I4D A;  3CRK C;  1I7L A;  2W8L A;  4J9L A;  1II3 A;  4HJ7 A;  3TRE A;  4ZUI A;  1UNS A;  5EKI A;  4TKO B;  4ME3 A;  3SK4 A;  3F2C A;  1K83 H;  2G9D A;  4MTN A;  2B2Y C;  4NXM H;  5D65 A;  3GIP A;  3C0F B;  1XNR Q;  5EKK A;  4N8X 1;  3KJP A;  3J80 W;  1SFO H;  2R8J A;  5KT5 A;  1G29 1;  1CQV A;  4HNV A;  5KFL A;  4WRD A;  1N34 L;  1VQJ A;  1N48 A;  4LUZ A;  2YS6 A;  3I12 A;  3J81 L;  1V1P A;  4TQU S;  5DAU A;  4YB8 B;  1IL8 A;  4KY5 A;  2PMZ E;  4LF9 Q;  3Q8R B;  1DV1 A;  4X64 Q;  2KED A;  3S9W A;  1F9R A;  1SYB A;  3IG0 A;  4ODG A;  1CQI B;  3BDO A;  5IYC G;  1E4F T;  2JA7 B;  1SJE D;  1A15 A;  3CQZ H;  3H6M A;  3PUV A;  1CQJ B;  4ED2 A;  2MPM A;  2OLS A;  1B3Q A;  4DXF A;  5LMN Q;  2EQS A;  1HZB A;  1B2T A;  3FMA A;  3HOV B;  1S9F A;  1CZW A;  1SAP A;  1DZ1 A;  4FF3 A;  3DF7 A;  2DIK A;  3TZU A;  3CME A;  4L5T A;  4B3T L;  2DUD A;  1CA6 A;  3A8I E;  2A19 A;  3H20 A;  5I47 A;  4ZRZ A;  3J7A K;  2R7D A;  2DPJ A;  1JWM D;  4JI6 Q;  2ZXO A;  3E0J A;  2F0P A;  4IFD I;  2A73 B;  5I6W A;  1GHJ A;  4N9P A;  3CRL C;  5EBD A;  3RBD A;  3OTO Q;  4DR6 L;  2FJZ A;  4BBR H;  2F0L A;  4J15 A;  2F0J A;  4ZUJ A;  2K01 A;  1HA6 A;  2E5L H;  4DV3 H;  1QOH A;  1QJO A;  1K0R A;  3R5F A;  1DON A;  1D1K A;  1A2T A;  2F0E A;  1ZET A;  1KL9 A;  1ZKO A;  2F0H A;  3HS0 C;  4H02 A;  2VQE Q;  5CMD A;  5GAG C;  2EJF C;  2D5D A;  3A54 A;  1QUQ B;  2M9V A;  4L63 B;  5C3E G;  3RZD B;  1IBL H;  4DUY Q;  3EPG A;  2WKD A;  4P74 A;  4LMY A;  5KG5 A;  4IWY A;  2RHS B;  2PI2 E;  1GUT A;  3FPP A;  1F77 A;  4KJO A;  5KFQ A;  4JI5 Q;  3MJF A;  3UDX A;  2Z8L A;  2M05 A;  3TZD A;  2YCH A;  4O3Q A;  4EBE A;  2N88 A;  1BGW A;  2DPI A;  3EYY A;  2WV6 D;  4QMG A;  1WVL A;  5I9O A;  3N6X A;  3NQI A;  4DV6 L;  2VUG A;  4CKE A;  2XNA C;  2CQY A;  5BR8 H;  4X6A H;  4LSA A;  3KUP A;  2WAQ B;  4EGJ A;  1KJ9 A;  2F0V A;  3GTG A;  1C7Y A;  4MTK A;  5ELF A;  2UUB H;  1SRO A;  3HOZ B;  5KFP A;  4ED7 A;  2Z6K C;  3TDQ A;  4OWX B;  1N36 Q;  2VPQ A;  2J6T A;  3JSL A;  1SSO A;  3QJY A;  3GIL A;  4YCV A;  3N40 P;  3BYY B;  3S1M H;  1WJJ A;  2KBN A;  2I0Q A;  2R7Z A;  1T9H A;  2WIN B;  3EBE A;  4DR7 L;  1DOM A;  4C5C A;  1HCZ A;  2N55 A;  3H40 A;  2O5I C;  2K33 A;  1A62 A;  4GZY C;  3NWS A;  4A3L H;  2Y0S B;  1STE A;  2EE1 A;  4EVO A;  3RIZ A;  1JDB B;  4CC5 A;  4HMI A;  3L0O A;  1Y1V H;  4X3U A;  1SMY C;  4I55 F;  1A2U A;  4GNX B;  3HOY H;  3N8D A;  3RGX A;  1EYZ A;  3N52 A;  3CPW A;  4J9R A;  1HQR D;  3G6X A;  2KCN A;  1IW7 D;  2ZT9 C;  4FF4 A;  4GNX C;  2B2T C;  4GLV B;  2MGS A;  3GTL H;  3A5Z B;  3OYY A;  4DR2 L;  4YR2 A;  2W8K A;  4KI0 A;  2Z4I A;  4FS1 A;  5KFR A;  2Q2I A;  1I4P A;  4JI1 L;  1IXR A;  1X3E A;  3KLS X;  1PZJ D;  3HP3 A;  4JI4 H;  3GTG H;  1S5C D;  1IKM A;  4QIW E;  4LF7 H;  3PO2 G;  1RL2 A;  4O4H F;  1JWU D;  1O7I A;  4XYQ A;  2K6A A;  2XCP A;  1BBU A;  3R8B A;  1SMX A;  2H5X A;  4G7O C;  3U50 C;  1YJW A;  3LWE A;  1OXV A;  3K5M A;  3CU7 A;  4BWG B;  3ULL A;  2DY8 A;  3FP9 A;  3NBI A;  4C2M B;  1I94 H;  1BNZ A;  5KG4 A;  2FLN A;  1IBK H;  2R7Z H;  2B2U A;  1AFP A;  3J81 i;  4R1J A;  4DL4 A;  4RH6 A;  4PZ6 A;  3HFZ B;  3U9O A;  1LT3 D;  4K8J A;  5FLM G;  1HTL D;  5JJZ A;  1B50 A;  2W9B B;  1E0B A;  1JJC B;  4E4T A;  4WFN 3;  4PNY A;  4K0K H;  3D3R A;  4Q0Y A;  1SDF A;  3UQ8 A;  4DF7 A;  4IFD J;  2YRX A;  4QW8 A;  1UWV A;  4FYD A;  5EGT A;  2DJG C;  3QFF A;  4QWB A;  3DM1 A;  2J9G A;  2KSW A;  2JN4 A;  3V96 A;  1AE3 A;  1Y8P B;  3UDI A;  2VNU D;  2HUG A;  4C3H H;  1O7Z A;  1OXX K;  2HCC A;  3Q8D A;  4A3K H;  1JIH A;  4X3S A;  3BZK A;  1CKO A;  5H1S E;  5T14 A;  1Q1E A;  2F1M A;  2WFW A;  4UCU A;  4X65 Q;  3RLO A;  5M3M H;  4JI0 Q;  2EVB A;  2R92 H;  2FHT A;  3HXL A;  1J5E H;  1DXM A;  4CDC C;  5D8D A;  2XVS A;  4O2D A;  1EOT A;  1PXU A;  3S24 A;  4EQ5 A;  1PK8 A;  2BE5 D;  1S10 A;  2UXD L;  5GAH C;  4B9X A;  2C2E A;  2D0P A;  3M4Q A;  3RGZ A;  4A3E H;  3K7A H;  2NVY H;  2YTX A;  1GSO A;  4UCV A;  3GTK B;  1E2Z A;  1HNW L;  4IHJ F;  4A76 A;  4ED3 A;  5CV4 A;  4FXD A;  4YR3 A;  5GQO A;  5J3B A;  2NYZ D;  1NE3 A;  3HKZ E;  4CBV A;  4DL5 A;  3DLL A;  1MD2 D;  4A3J H;  2ES2 A;  3GTM B;  5K2M A;  1K3R A;  3IN5 A;  3SI8 A;  1RYR A;  3CHB D;  2UXB H;  3WDN A;  1IOV A;  1ASZ A;  4N9T A;  3FEW X;  4K2L A;  3TRZ A;  2WB1 A;  1GHK A;  1HR0 H;  2YZN A;  4JG2 A;  4DK1 A;  1Q7Y C;  3K5O A;  1KDC A;  1CTM A;  3UI2 A;  2NUA B;  4B3M L;  5LL6 b;  5C1O A;  3KBG A;  4ZCK A;  5EWF A;  5K5P A;  3GV5 B;  4DAY B;  4JI8 H;  1PH4 A;  1QG7 A;  1CI3 M;  1GLV A;  2C9O A;  3KFU A;  2AWO A;  3VR6 A;  1V51 A;  1O7L A;  1PYB A;  4C1N I;  4UP9 A;  2PZU A;  1RK5 A;  1TWG A;  3T5J A;  4EGQ A;  3HEJ A;  3MXN A;  5H80 A;  4YWK A;  4H0L C;  5LXT F;  5EPL A;  4NW2 A;  2VL6 A;  2F0F A;  4EX5 A;  2Z6B A;  4A4I A;  3L4K A;  1A3T A;  1DJR D;  2LXJ A;  1PRT C;  1XDN A;  3D6C A;  3GTP B;  5KFD A;  3K81 C;  2UVV A;  3SGI A;  3P75 A;  1E1O A;  3I56 A;  1PFB A;  1SJH D;  4JYA L;  4LSX A;  2JA8 G;  1S5F D;  4YJ3 F;  2W9C B;  4ZAI A;  1YEZ A;  1ZYR D;  1CQF A;  1RCV D;  1WCM B;  3K5H A;  3PN1 A;  2RGR A;  2IWH A;  1AEX A;  3KHL A;  3IKJ A;  3TP5 A;  3GIM A;  4LFC L;  1EY6 A;  4C56 C;  5KG6 A;  5E4W C;  4EQN A;  2UUA H;  5C44 G;  1CSQ A;  2MJ8 A;  5K36 H;  2R8I A;  4X3K A;  4JI7 L;  1BCP C;  1SN8 A;  4DFA A;  1RJR A;  1CK1 A;  1NBW A;  1D5M C;  3BDL A;  3T1H H;  1K8A C;  2RDG A;  4YY3 L;  3I7F A;  1EQQ A;  4J9N A;  3S14 B;  1PH7 A;  1BNC A;  2GPW A;  2B2V A;  4IUV A;  2NWG A;  3LWU A;  1E2W A;  5C5J A;  1FJG L;  1BBW A;  2K05 A;  1TWG H;  4X3T A;  3RN2 A;  4HTH A;  4L5Q A;  4OON A;  3TME A;  3HOW H;  1JIC A;  3T1Y H;  5EOY A;  1R9T A;  2Q8I B;  2NVX B;  1CKM A;  2VQF L;  2CKZ B;  1N33 L;  4MV7 A;  1JE4 A;  5M3F B;  5LL6 S;  4XYL B;  3D31 A;  2FKL A;  4A3G H;  1CHQ D;  3J7A 5;  4DV5 H;  4POG A;  4Y7N H;  4IR1 A;  4GKJ L;  4ETS A;  2DLN A;  1Y1W A;  2XGT A;  4AYB A;  4J9M A;  2RQX A;  1KRS A;  1TWF B;  2I5L X;  1STB A;  4QF4 A;  4AQY Q;  5IYD G;  1Q46 A;  4A3M H;  1EU4 A;  4C3I G;  1QVF A;  3R5H A;  4MV9 A;  2W9B A;  1EEF D;  3C1F A;  4DR3 L;  4LF8 Q;  4Q45 A;  1XNQ L;  1F2Y A;  4EYI B;  4H7B A;  5FO7 B;  3ZYY X;  1Z2P X;  1XMO H;  3RMH A;  5KIX A;  3I4N B;  1GUW A;  3RUP A;  2E2I A;  5CR3 A;  3VYS A;  1PV4 A;  4KLK A;  3KOJ A;  2IX0 A;  1TWA H;  2B63 A;  5L37 A;  4I4T F;  3RJ0 A;  2A1A A;  1SNQ A;  5KNB A;  5EQ0 A;  4QCL A;  5M5X B;  5J39 A;  2K14 A;  1SNC A;  4DL2 A;  4I50 F;  4R8U B;  1HUN A;  1LV9 A;  3M4O H;  4F87 A;  5CA0 F;  2QEJ C;  1B9N A;  3DMU A;  4GOP A;  2HHH L;  1N9W A;  1IOW A;  2PN1 A;  1KRT A;  2TSS A;  2XTI A;  4F4W A;  4L5S A;  2EYL A;  1PH8 A;  5JPM C;  2AHO B;  5IP7 G;  1C4Q A;  5LHY 1;  1PA6 A;  2UXD Q;  2K4K A;  3OIP A;  3PMF A;  1EU3 A;  3QB3 A;  1R9T H;  5KFK A;  4BY1 B;  3JRX A;  4DAM A;  1T36 A;  1XMQ L;  4ABN A;  3BA8 A;  2EXD A;  5C1P A;  1EY8 A;  5I6Y A;  5IGE A;  2YU9 H;  3CCQ A;  2I8C A;  5GRO A;  2QF7 A;  4BBR B;  4JI2 L;  4DK6 C;  2HVQ A;  4R7R A;  4JV1 A;  4IJH A;  3NP8 A;  5CV5 A;  2VPS A;  2Q2T A;  1HNX H;  2LFN A;  2YZM A;  3ND9 A;  3EQL C;  1DGS A;  4J9Q A;  3CW2 C;  2PNH A;  4NXN Q;  3WOF A;  4LF4 L;  1IYJ B;  5EBC A;  3CC2 A;  2E2I H;  4IR9 A;  5IYC H;  3SE7 A;  5FKA C;  1SRU A;  1WTR A;  2B63 H;  3SR1 A;  3NBH B;  3QR8 A;  5KFS A;  1Q8K A;  3KF8 B;  4TSS A;  1I5F A;  1YI2 A;  1BXR A;  4RAY A;  5DQG A;  3KYH C;  5JVH 3;  3RZO B;  3KLR A;  3A0J A;  3DUZ A;  1NR4 A;  1X54 A;  2KHI A;  4FF1 A;  4JV5 H;  3MXG A;  1XNR L;  2W7P A;  3N43 B;  5JOB A;  5HGQ A;  5KFA A;  2R93 G;  3W1B A;  1VKZ A;  1A3V A;  1PH9 A;  3A8J E;  4FNF A;  5IP9 G;  5JVG 3;  3PW4 A;  4LF9 L;  2UVR A;  3V6J A;  5JJK A;  3T13 A;  3ICE A;  4RAZ A;  3W5O A;  4RG1 A;  4APM A;  1M0T A;  5KFN A;  2HCI A;  2BQ3 A;  4XT3 B;  2F0W A;  1ZXT A;  5LMN L;  2ASB A;  3NXW A;  3FKI B;  1Y14 B;  2RDH A;  3C2P A;  1B8A A;  1D8L A; 
#chains in the Genus database with same CATH homology
 4X64 Q;  3G48 A;  4DR4 Q;  1HR0 Q;  1GD7 A;  2GN5 A;  3JC6 6;  1V43 A;  3AFQ A;  3S1Q H;  5EAY A;  2BA0 A;  5IYC G;  4HJ5 A;  3IRB A;  1VQH A;  2N8N A;  4PG3 A;  3CQZ H;  3AQQ A;  3FKI G;  1GKH A;  3PUV A;  1N34 Q;  5ELN A;  3KF6 B;  4GKK L;  1VQ5 A;  5LMN Q;  2EQS A;  3RZD H;  2UXC L;  4GOP B;  1HZB A;  3A5U A;  3M3Y H;  2CQO A;  3K7U C;  4HIO A;  3CME A;  1LTL A;  3TS0 A;  4HIK A;  4LF5 L;  1JE5 A;  1YHA A;  2JK8 A;  4L5T A;  2DUD A;  2RHQ B;  1L1O B;  4B3T L;  2JA7 G;  2A8V A;  2VUM G;  4IFD G;  2A19 A;  1NMG A;  1TXY A;  1W3S A;  4LUV A;  4GNX A;  3RN5 A;  2LXK A;  2R7F A;  2R7D A;  5JEA G;  4GKK Q;  2VQF Q;  3EIV A;  4GN3 B;  3ULJ A;  1KC8 C;  1N33 Q;  1VQM A;  2HT1 A;  3HOV G;  2OWO A;  4JI6 Q;  2UXC Q;  4QJF A;  2VQE L;  1PHJ A;  2KCT A;  2YTY A;  4IFD I;  1L1O C;  4P73 A;  3M7N A;  4LW1 A;  4GKJ Q;  3OTO Q;  4LF5 Q;  1C0A A;  4DR6 L;  4O0A A;  2NZO A;  3OW2 A;  4BBR H;  4B3T Q;  1KIX A;  3HOY G;  2UUA L;  1VQG A;  4J15 A;  1IBM L;  3L7Z C;  1XPO A;  1CUK A;  3PV0 A;  3GDE A;  1E24 A;  1HR0 W;  1K0R A;  1X9N A;  4JI5 L;  2E8G A;  5IWA L;  1XJV A;  1IZ6 A;  1BKB A;  1KL9 A;  5E7N A;  4H02 A;  2VQE Q;  3HOZ H;  1AH9 A;  1E3P A;  5GAG C;  1XNQ Q;  3BJU A;  1K9M C;  3BU2 A;  4MZ9 A;  5LMN W;  1QUQ B;  5C3E G;  2AMC B;  5FJ8 G;  1EOV A;  3CCM A;  2WAQ E;  1I6H H;  4DR6 Q;  3G4S A;  4BXX H;  4DUY Q;  1L0W A;  3PCO B;  1IBM Q;  2UUA Q;  4P74 A;  4JBJ A;  3PIO A;  2RHS B;  2PI2 E;  1CKN A;  4PMW A;  1LM0 A;  4JI5 Q;  1L1O A;  4YWM A;  3MEF A;  3T1Y L;  3HOU G;  3UDX A;  4DV4 L;  3T1H Q;  4LF6 L;  3S2D H;  1X6O A;  4HID A;  2N78 A;  4DV5 L;  1VQI A;  3AFP A;  4P75 A;  3ERS X;  2K5H A;  4DV6 L;  3BZC A;  2HHH Q;  2KCM A;  2K5N A;  3RR5 A;  2R7Z G;  1HJP A;  2B29 A;  3K8A A;  4A75 A;  1Q82 C;  2JA5 G;  1TWH H;  4X6A H;  4XIG S;  1N36 L;  1E7Z A;  3CD6 A;  1NJI C;  1GO3 E;  2Q2U A;  2KEN A;  1VQF A;  2LSS A;  3KDF A;  3PO3 H;  1VQ6 A;  2Y0S E;  4MNO A;  1PH3 A;  4DV5 Q;  1C7Y A;  4JOI C;  3S1N H;  1K73 C;  4DV6 Q;  3VDY A;  1SRO A;  1XMQ Q;  5C0X J;  1VQ8 A;  4QY7 A;  3PO2 H;  1VQA A;  1HNZ L;  1QUQ A;  2Z6K C;  4OWX B;  1N36 Q;  1Q12 A;  3HKS A;  4DR1 L;  4A3B H;  4NB3 A;  1HZ9 A;  4YCV A;  1SE8 A;  2K5V A;  3D0F A;  3S1M H;  1HH2 P;  1WJJ A;  2AKW B;  2KBN A;  2I0Q A;  3F2B A;  1T9H A;  3EBE A;  4DR7 L;  4DUZ L;  2RCN A;  1XMO Q;  1G6P A;  2JJQ A;  4A93 H;  4OWT B;  1N32 L;  4A3K G;  2VUM H;  4QL5 A;  1HNZ Q;  1VQD A;  2D62 A;  3CCE A;  1B70 B;  1A62 A;  4A3L H;  1J5E Q;  2K52 A;  3PGZ A;  5M3M G;  4C2M H;  5IE8 A;  4JBW A;  4JOI A;  5JJI A;  3CCR A;  5FLM H;  3L0O A;  1Y1V H;  2UUC L;  1QZG A;  3I4O A;  1S3O A;  3M4P A;  3I55 A;  4GNX B;  2Z6K A;  3HOY H;  1N32 Q;  4BY7 G;  3HKZ G;  3CPF A;  2Y0S G;  2CWA A;  4DR5 L;  3CPW A;  1OXS C;  4IPG A;  2ATW A;  2BH2 A;  1XPU A;  3J80 i;  1KD1 C;  4R4Q A;  4DV0 L;  1VCI A;  2CFM A;  3CP0 A;  4GLV B;  4GNX C;  3GTL H;  2E2J H;  3A5Z B;  3OYY A;  4JCV E;  4DR2 L;  2CCZ A;  4BBS G;  2BA1 A;  4KI0 A;  1JMC A;  2UUC Q;  4LNQ A;  5C3E H;  4OO1 G;  5FJ8 H;  2Q2I A;  4AIM A;  2ID0 A;  3PIP A;  3KJO A;  3E0E A;  4JI3 L;  4JI1 L;  1IXR A;  1X3E A;  1YJ9 A;  3GTG H;  4DR5 Q;  4QIW E;  1IL2 A;  3PO2 G;  1RL2 A;  4P72 A;  4R4O A;  1O7I A;  1EYG A;  1U5K A;  1BBU A;  2ALY B;  1SMX A;  2H5X A;  4JI8 Q;  3U50 C;  1YJW A;  4A3B G;  1OXV A;  4B3S L;  1RIP A;  4DR2 Q;  3ULL A;  4GN5 A;  5AJ3 L;  1HZC A;  3FP9 A;  1HNX Q;  3K80 C;  1FL0 A;  4DR7 Q;  4JI3 Q;  4JI1 Q;  3WWV A;  1VQ7 A;  2JEA I;  1CKN B;  4A93 G;  1UE1 A;  2R7Z H;  4K0K L;  3J81 i;  2JA5 H;  3S16 H;  4R1J A;  4JV5 L;  4A3L G;  1WYD A;  3TQY A;  5C4X G;  1X65 A;  1SR3 A;  4PZ6 A;  3HFZ B;  1M1K C;  5FLM G;  1BVS A;  1PFS A;  1VQK A;  3PSI A;  4DV2 L;  3UE0 A;  1Y1V G;  2NN6 G;  3GTK H;  1JJC B;  1I50 H;  3STB D;  3F8T A;  1KQS A;  1LYL A;  4NXM L;  1Z9F A;  4IJL A;  3KDF B;  4X65 L;  4JV5 Q;  4IFD J;  2MNA A;  1UWV A;  1YNX A;  3GTM H;  4JI0 L;  2JA6 G;  1D7Q A;  1W2B A;  3TEH B;  3RLF A;  1PH5 A;  2Z0S A;  4WJ3 M;  5JEA J;  1AE3 A;  3UDI A;  2HIX A;  4P71 A;  2B3G A;  4C3H H;  1OXX K;  3PUW A;  2VNU D;  1A63 A;  3Q8D A;  1YBY A;  4A3K H;  4DV7 L;  3BZK A;  4OX9 L;  1CKO A;  5H1S E;  4NXM Q;  1Q1E A;  2WFW A;  4R4T A;  4X65 Q;  3RLO A;  1PH2 A;  2OCE A;  5M3M H;  1V9P A;  4JI0 Q;  1OXT A;  2R92 H;  5IWA Q;  3PUZ A;  5K36 G;  1YHB A;  3U58 A;  4O2D A;  2WB1 G;  3S24 A;  1UEB A;  3PUY A;  4EQ5 A;  5FLX c;  4GLA C;  4JC0 A;  3HOX H;  4BY7 H;  2UXD L;  2IT1 A;  1VS0 A;  2D0O A;  1I94 L;  5GAH C;  1VQB A;  5DLQ E;  4OX9 Q;  2D0P A;  3M4Q A;  4DV1 L;  4A3E H;  1IBK L;  1LUZ A;  2NVY H;  2YTX A;  2QGQ A;  3K7A H;  1X56 A;  1HNW L;  1KHI A;  4XTC S;  2JA8 H;  1QVC A;  3JAM c;  1UE6 A;  4A3C G;  4A76 A;  2EIF A;  3T1Y Q;  2V1C C;  4DV4 Q;  4BBS H;  2YYZ A;  1X3F A;  3ZJY C;  5GQO A;  5J3B A;  3CC7 A;  3GTP H;  4LF6 Q;  1NE3 A;  3HKZ E;  1ASY A;  3DLL A;  3CCJ A;  4HJ8 A;  4A3J H;  2ES2 A;  4Y52 H;  1K3R A;  2OTL A;  3HOW G;  1N8R C;  4GS3 A;  3CCL A;  2F52 A;  3EN2 A;  4DV1 Q;  1ASZ A;  5C0X G;  3CCV A;  1B7Y B;  2E5L L;  1HNW Q;  1WCM H;  5C44 H;  3FHW A;  2CWP A;  4DV3 L;  4A3F G;  3TRZ A;  4LFA L;  1PH6 A;  4JG2 A;  1Q7Y C;  4BA2 I;  3F1Z A;  3J81 c;  1YIJ A;  4B3M L;  1Y1W H;  5LMU L;  4YHH L;  3DM3 A;  2VY3 A;  4DAY B;  5C4J H;  1PH4 A;  1QZH A;  1G51 A;  3KFU A;  2AWO A;  1KAW A;  1V1Q A;  2N49 A;  4GN4 B;  4OXP A;  1PYB A;  1IBL L;  1PH1 A;  2UU9 L;  4B3R L;  4UP9 A;  3UE1 A;  3ER0 A;  2E5L Q;  4JBK A;  3S17 H;  3ULP A;  1M90 C;  4DV3 Q;  1WFQ A;  3K0X A;  5C4X H;  3H3V H;  4YWK A;  5IYB H;  4DR1 Q;  3I4M H;  3S15 H;  2BH8 A;  2MO0 A;  4L5R C;  2VL6 A;  3M9B A;  4B3M Q;  4EX5 A;  5LMU Q;  2R92 G;  3LGJ A;  4YHH Q;  1H95 A;  4C3J H;  4LFB L;  1JJG A;  4A4I A;  1EQR A;  3CCS A;  3S14 H;  3S1R H;  3AEV A;  4KHP L;  2LXJ A;  4DUZ Q;  4A3I H;  4ALP A;  4DPG A;  1MIU A;  1L2F A;  2GVB A;  3HOX G;  3K81 C;  3HOU H;  1JB7 A;  1IBL Q;  3SGI A;  1U0L A;  2DGY A;  4YCU A;  1E1O A;  3I56 A;  1MJE A;  4A3E G;  2Q2H A;  4IPC A;  1XTD A;  1VQN A;  5BR8 L;  2JA6 H;  4X62 L;  1GVP A;  2JA8 G;  1NTG A;  4JYA L;  4FDB A;  4YWL A;  2NVX H;  4A3C H;  1JT8 A;  4AH6 A;  1MKH A;  3RNU A;  1YEZ A;  3CF5 A;  1EIY B;  4C3I H;  2I5H A;  3I2Z A;  4KHP Q;  4A3J G;  2KHJ A;  2JA9 A;  2UUB L;  2OQK A;  4LFC L;  4OWW B;  2NZH A;  2ZM6 L;  4QQB X;  1TWF H;  5BR8 Q;  4JYA Q;  4X62 Q;  3U4V A;  1WCM G;  3A74 A;  1CSQ A;  4X64 L;  5C44 G;  4OO1 I;  4DR4 L;  4DV0 Q;  1VQL A;  4JI7 L;  1SN8 A;  1P16 A;  1HZA A;  1CSP A;  3NEL A;  2F3I A;  1NBW A;  3GO5 A;  1VQ4 A;  1Y1W G;  4R4I A;  4IPH A;  4AYB G;  1VQC A;  5GAD C;  3I4N H;  1UE7 A;  1K8A C;  4YY3 L;  1EWI A;  3I7F A;  2ZJR A;  3GTQ H;  1AE2 A;  1EQQ A;  4LFC Q;  2ZM6 Q;  1PH7 A;  5JJL A;  1PVO A;  5M5Y H;  1YJN A;  2K50 A;  4R4C A;  3STB C;  2QEX A;  1FJG L;  1BBW A;  2WB1 E;  5M5X H;  5IYB G;  1TWG H;  4JI7 Q;  3RN2 A;  3I4M G;  4A3D G;  4B3S Q;  4LWC A;  4L5Q A;  4OON A;  5IP7 H;  5AJ3 Q;  4AQY L;  3HOW H;  4POF A;  3H0G G;  1CKM A;  2VQF L;  1E22 A;  2CKZ B;  1N33 L;  4YY3 Q;  2B63 G;  1Z47 A;  4JI6 L;  4A3I G;  4IOA A;  3D31 A;  4A3G H;  1I3Q H;  4LF8 L;  3J7A 5;  2VW9 A;  2N3S A;  1OTC A;  4POG A;  1VQE A;  2JEB I;  2WP8 J;  4Y7N H;  3H3V I;  1TWC H;  4A3F H;  3OTO L;  4GKJ L;  2ZJP A;  1XPR A;  1FJG Q;  2XGT A;  3KLW A;  2GVA A;  2YTV A;  2NN6 I;  4NPS A;  4LUO A;  1EUJ A;  1KRS A;  5GAE C;  2HQL A;  2I5L X;  1C9O A;  3L2P A;  2QA4 A;  5M3F G;  4HIM A;  4GOP C;  5IYD G;  4AQY Q;  1Q46 A;  4PZ7 A;  4DNI A;  4DV2 Q;  4A3M H;  2AWN A;  4BY1 H;  1QVF A;  3TS2 A;  1YZ6 A;  4DR3 L;  4WJ4 A;  1YVC A;  4LF8 Q;  4PZ8 A;  1XNQ L;  4JI4 L;  2RF4 A;  4LF7 L;  4UP8 A;  2PQA A;  3AYH B;  2IY5 B;  4KHZ A;  5M5W H;  4DUY L;  1Q86 C;  4KLK A;  1PV4 A;  3PUX A;  3KOJ A;  2IX0 A;  1TWA H;  1S72 A;  3GTO H;  5IY0 A;  2A1A A;  3J80 c;  2K14 A;  4HJA A;  2JQO A;  4DR3 Q;  3T1H L;  3I4N G;  4DV7 Q;  3MXN B;  4JI4 Q;  1A8V A;  2OTJ A;  4LF7 Q;  3M4O H;  3KF6 A;  1PYS B;  3NEN A;  4GOP A;  2HHH L;  1P8L A;  1N9W A;  3NEM A;  4IPD A;  1KRT A;  3F2D A;  1WOC A;  2XTI A;  1EIF A;  4L5S A;  2R93 H;  1PH8 A;  3GTJ H;  2AHO B;  2NVT H;  5IP7 G;  5IT9 c;  3S2H H;  1NMF A;  1PA6 A;  2OQ0 A;  3RZO H;  2UXD Q;  2K4K A;  1I94 Q;  5IP9 H;  4IO9 A;  1R9T H;  1IBK Q;  4A3G G;  2MFI A;  3W1G A;  3UDG A;  2K75 A;  3CAM A;  4TVA B;  3G6E A;  1Q81 C;  1QVG A;  2IX1 A;  1FGU A;  4DAM A;  1EFW A;  1VQ9 A;  1XMQ L;  4HJ9 A;  1VQP A;  2VZA A;  4NXN L;  3M85 A;  2EXD A;  2MQH A;  4UPA A;  2YU9 H;  3CCQ A;  5GRO A;  4DKA C;  3J81 j;  1VQO A;  5C0X I;  1SLJ A;  1YIT A;  4DK6 C;  3H15 A;  4JI2 L;  1NY4 A;  3E9I A;  4A3M G;  3PF4 A;  4BY1 G;  2F4V L;  4IJH A;  3CMA A;  2NVQ H;  4UP7 A;  3B6Y A;  2Q2T A;  1JJ2 A;  2VS1 A;  3UDF A;  1HNX L;  4UY8 C;  4K0K Q;  1MJC A;  4YCW A;  3CCU A;  4X66 L;  1DGS A;  1XMO L;  3CW2 C;  2PNH A;  4LFA Q;  1X3G A;  4A3D H;  1WI5 A;  4NXN Q;  4AYB E;  4BBR G;  4LF4 L;  1IYJ B;  3CC2 A;  3G71 A;  2FXQ A;  2C35 B;  2E2I H;  5IYC H;  2WAQ G;  1Q1B A;  4IOC A;  1X55 A;  1J5E L;  4RMF A;  3FKI H;  3H0G H;  1J6Q A;  1SRU A;  2IHE A;  4JI2 Q;  2E2H H;  2B63 H;  3NBH B;  2F4V Q;  2L15 A;  4DK3 C;  1GM5 A;  1FVI A;  3GD7 A;  3CXC A;  2IHF A;  1Q8K A;  3KF8 B;  1UE5 A;  1I5F A;  1YI2 A;  1K8G A;  2UU9 Q;  4JBM A;  3HOZ G;  4B3R Q;  4QGU A;  2ZTE A;  3KYH C;  2MO1 A;  4X66 Q;  3A0J A;  2ZTC A;  2I5M X;  2ZJQ A;  2JA7 H;  1X54 A;  2KHI A;  4LF4 Q;  4BXX G;  4APV A;  5M3F H;  3CC4 A;  1XNR L;  5IYD H;  5HGQ A;  4GLX A;  4LFB Q;  2R93 G;  3W1B A;  3HOV H;  2HIV A;  3U4Z A;  1KXL A;  3PF5 A;  2JE6 I;  1PH9 A;  4HJ7 A;  3TRE A;  4BA1 I;  5IP9 G;  2UXB L;  3RLN A;  4LF9 L;  2YV5 A;  1OXU A;  4ME3 A;  3F2C A;  1S40 A;  1K83 H;  5JJK A;  5ELO A;  4MTN A;  3ICE A;  1HR0 L;  3W5O A;  1XNR Q;  4RG1 A;  3J7Z C;  3KJP A;  3E9H A;  1SFO H;  2PI2 A;  5HY6 A;  1G29 1;  4JI8 L;  1N34 L;  1VQJ A;  4LUZ A;  1E1T A;  2PQA B;  5LMN L;  2ZTD A;  2UUB Q;  1YHQ A;  2ASB A;  2UXB Q;  4TQU S;  3PO3 G;  1Y14 B;  2R6G A;  4LF9 Q;  2PMZ E;  1A0I A;  1B8A A;  3JAM i;  1D8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...