1GO3E

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
184
structure length
177
Chain Sequence
MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPEMYELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSYDPKAIIGKETGKVLEIGDYVRARIVAISLKASKIALTMRQPYLGKLEWIEEEKAKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
total genus 39
structure length 177
sequence length 184
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1go3E01
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1go3E02
4PZ6A 2L15A 4LF5Q 4BBRG 2GVBA 1HZCA 1KRTA 3CMEA 4DV3L 4HIOA 3U58A 2F4VQ 3HOZH 3F2DA 5IP7G 2IX1A 1L1OA 4IFDG 1JJCB 3EBEA 1SE8A 3A0JA 4LFBL 4O2DA 1BBUA 3G4SA 1VQ4A 1K73C 1N8RC 2CKZB 2K4KA 1RL2A 3ULPA 3TQYA 2Q2IA 1CSPA 1E22A 2F52A 3L2PA 1GD7A 4DUYQ 2Q2HA 4OWTB 3KOJA 4L5TA 4DAMA 3G71A 2YYZA 4A3KG 5C44G 2CQOA 1LYLA 2NZOA 3KLWA 3I56A 2JA6G 4X66L 1I6HH 1VQ9A 4JBWA 3I4OA 1L0WA 2VQFQ 3I4MG 1PVOA 3RLNA 2UXDL 2UUAL 3F2BA 2C35B 2R7ZG 4TQUS 2LXKA 1X6OA 1EIYB 2E5LQ 3HOUG 4IFDJ 1B8AA 3I2ZA 1Q1BA 5JEAG 3ER0A 4JC0A 2NVYH 1Z9FA 5IYDH 2Z6KA 1SRUA 3A5UA 3CC4A 4DR7Q 4BXXH 3Q8DA 2KENA 4DV4L 4UPAA 4B3RQ 1EQRA 4DR7L 1B70B 1HZAA 1WCMH 1CUKA 3TRZA 2ATWA 5GQOA 3ERSX 2K50A 2ZTEA 1HNXQ 1VQEA 4QL5A 4DUZQ 4JV5Q 4JI3L 1L1OC 4J15A 2N49A 1KIXA 3AFPA 1N34L 2JE6I 4A3FG 1QUQB 4LFAL 2BH8A 1BVSA 1QZHA 1X3FA 5JEAJ 4JI4Q 5M3MH 1HJPA 4AQYQ 4KI0A 1Q12A 2UXBQ 2ZJPA 4JI6Q 2AMCB 4X64L 2EXDA 5LMUQ 1IYJB 3BZCA 4K0KL 2WP8J 4A3LG 3PUVA 4JI0Q 4DR6Q 5C4XH 2R93H 2I5HA 1IXRA 2EQSA 1OXTA 5AJ3Q 4UP9A 4AH6A 1R9TH 4DV0L 1K0RA 2N78A 2VL6A 4DR2Q 1KC8C 2UUCL 1Q86C 2YTXA 1TWFH 2PNHA 3FHWA 1NY4A 3K81C 5C44H 2K14A 3LGJA 1XTDA 4OX9L 3M7NA 2UXCL 4EQ5A 4GLAC 1HNWL 2OTJA 1D8LA 3HOYH 4POFA 4LF6L 2R7ZH 1PH1A 1SR3A 1NMFA 3PF4A 2CFMA 1PH8A 3AYHB 3MEFA 1HR0Q 1WCMG 3GTPH 1YJWA 1KQSA 4JI2L 4JI7L 1JJ2A 3S14H 3AFQA 2KHIA 1FVIA 3PO3H 1JJGA 4IPHA 3HKSA 4PZ7A 4DV7Q 2K5NA 4JI5Q 4GOPC 4A3FH 4JG2A 1EYGA 5E7NA 3CCQA 4B3RL 4BY7G 3K7UC 5H1SE 5IE8A 4YWKA 5FJ8G 1VQGA 4LUZA 1J6QA 4GNXA 4NXML 1AH9A 3CCMA 2ZTCA 2XTIA 2RHSB 3S2DH 1IBKQ 3KF6B 1N33Q 1B7YB 1FJGQ 5C4XG 4DV1Q 5EAYA 3HOVG 4A93G 4LW1A 1VQFA 1C9OA 3S1NH 3RN2A 2ZTDA 4LF7L 3DM3A 2N3SA 3K8AA 4WJ4A 3ICEA 1H95A 3HOYG 3M4PA 1A8VA 4HJ7A 3RNUA 3CQZH 2I5LX 3PSIA 2HHHQ 4DR1L 2AHOB 1XNQQ 2EIFA 4DV3Q 1TWAH 1EQQA 4X65Q 1C7YA 2B63H 3BJUA 4R4OA 2AWOA 2V1CC 4YHHQ 5M5YH 4FDBA 2IHEA 1AE2A 2VQEQ 2JEAI 3CP0A 1N36Q 2IHFA 4OWXB 4BY1G 1HNWQ 1X9NA 3GO5A 2DGYA 1GKHA 3JC66 4R1JA 4HJAA 4X6AH 2NVTH 2QEXA 1G51A 4JI8Q 4PG3A 3CXCA 3U4ZA 1UE1A 1Q82C 1QUQA 2OQ0A 3T1HQ 3CD6A 3MXNB 4HJ5A 1I94Q 3J7ZC 3RR5A 1HNZL 1LTLA 5HY6A 3M3YH 1CKMA 4AYBG 1CKNA 3ZJYC 5IWAL 2UU9L 1X54A 2K5VA 5IY0A 3CAMA 4APVA 3J81i 4XIGS 4LFCQ 5M3FG 4LF8L 1RIPA 5DLQE 2JA8G 1KAWA 4IOAA 2VNUD 5IYBG 4LF4Q 3GTLH 4A93H 1XNQL 4AYBE 4DV6Q 1PYSB 3U50C 4Y7NH 1XPOA 1I5FA 1QZGA 4A3CH 2KCMA 3F8TA 1HZ9A 3I55A 4LFBQ 3KYHC 4GNXB 3FKIG 4A3KH 1PH2A 4DUZL 2Q2TA 4DV2L 4QGUA 1IL2A 1Y14B 4DV1L 4OX9Q 2UXCQ 3CCEA 4A3JG 5ELOA 3UE0A 1NTGA 5IP9H 3CCLA 1QVGA 4GLXA 2B63G 4BY1H 1EUJA 4LF9Q 2JQOA 2OCEA 2JA5G 1VQDA 1PV4A 4ALPA 2D62A 1VS0A 2E5LL 1Q46A 2HIXA 4PMWA 2PMZE 1UEBA 2YV5A 3CPFA 3UE1A 1VQKA 4JI1Q 1S3OA 4JI0L 4X64Q 4DR6L 3CCRA 4B3TL 2NZHA 1M1KC 4DV0Q 2H5XA 1GM5A 1NJIC 4KHPL 3KFUA 1O7IA 1TWHH 3TS0A 5C0XJ 1YIJA 2QGQA 1JMCA 2N8NA 3ULJA 1N32Q 2RCNA 3K80C 1EOVA 1UE5A 1YHBA 3T1YQ 3S1MH 3GD7A 2MNAA 4LF6Q 5JJKA 4DPGA 1PFSA 3CCUA 1K8AC 3UDXA 1HR0W 2UU9Q 3PCOB 2YTYA 1K8GA 4LFCL 3FP9A 4MTNA 2I0QA 4A3CG 4A3GH 4IPDA 1DGSA 1WFQA 4JI2Q 3B6YA 3FKIH 1PH6A 4JI7Q 4QQBX 1E1OA 5BR8L 3OTOQ 1PH5A 2OTLA 2HHHL 1A0IA 4WJ3M 1TXYA 1Q8KA 3L0OA 1E3PA 2PQAB 3PO2G 1GO3E 4JYAQ 1OXVA 1Y1VH 2Z6KC 3H0GH 2JA7G 2NVQH 3M4OH 4JOIA 2F3IA 2ZJRA 3BU2A 1FJGL 2KHJA 3PO3G 3EN2A 2B3GA 5HGQA 2PI2A 2R92H 4DUYL 4A3MH 1QVCA 4A3IG 3SGIA 1Y1WH 4BA2I 2WAQE 2HIVA 4P75A 3OW2A 4C3IH 2XGTA 3CC7A 4LFAQ 2E2JH 1N34Q 5IP7H 3CCJA 1MIUA 5IYCG 1E1TA 1W2BA 2DUDA 4POGA 2K52A 4GKKL 1Q1EA 1S72A 4B3ML 4LF8Q 1JB7A 1SN8A 4IJLA 3CCVA 3D31A 4A3GG 3H3VI 2YTVA 5GAHC 4A3EH 2IX0A 4DV5Q 3CF5A 2MQHA 1G291 4RG1A 1V9PA 5AJ3L 3HOXG 3NENA 1VQHA 3CPWA 2UUCQ 4DR4Q 1U5KA 2IT1A 3E9IA 2CWPA 4DR5Q 1HZBA 4A3DH 1YZ6A 3HOUH 4IPGA 3WWVA 2VY3A 2Z0SA 1PHJA 4A3BG 4B3SL 1OXSC 2UXBL 1W3SA 1XMOL 1I94L 2JA9A 1OXUA 3ULLA 1NMGA 3KF8B 1HR0L 4DR1Q 1WJJA 3K0XA 4X62L 2R92G 1X3GA 3H0GG 4IO9A 2JA7H 3W5OA 4YHHL 5ELNA 4P74A 1GVPA 3GTJH 1JE5A 1YITA 1QVFA 1IZ6A 4BA1I 2VW9A 4JBMA 2I5MX 4IPCA 4LF4L 4OO1I 4DV6L 1PH7A 3W1BA 5IYCH 4GKJQ 2PQAA 2F4VL 4KHPQ 1LM0A 3E9HA 5M3MG 1YJ9A 1SROA 4L5QA 5M5WH 1XJVA 5C0XG 4YY3Q 3PUXA 4P72A 1U0LA 2D0PA 5JJLA 4DR4L 1VQIA 3S17H 1IBKL 1K83H 1N33L 1SFOH 4BXXG 2NN6I 1XPRA 1CKOA 3HOXH 1IBML 3I4NH 1BKBA 1N9WA 3HKZG 3PUZA 1XMQQ 3U4VA 4JI1L 3L7ZC 1I50H 3UDIA 4B3MQ 3I4MH 1NBWA 4YCVA 4GOPB 2UXDQ 2ALYB 3CMAA 3OTOL 1UE6A 2OWOA 4A3BH 1FL0A 1CKNB 4YWLA 2Y0SE 4A3DG 1VQCA 1L2FA 4OXPA 1JT8A 3G48A 1AE3A 1N36L 1K9MC 2QA4A 1PA6A 1XPUA 1A62A 2BA1A 2PI2E 1X56A 3JAMc 5C3EG 4HIMA 2IY5B 3A5ZB 2R93G 4LF7Q 1HNXL 4JV5L 3TEHB 3T1HL 1YVCA 2R7DA 4YCWA 1SLJA 3RZDH 4A75A 5FLXc 1YBYA 3PIPA 2HQLA 1KL9A 1HNZQ 1X65A 1T9HA 2VZAA 4LUOA 5IWAQ 1M90C 1TWCH 4NXNL 1VQNA 3W1GA 4DR2L 2NN6G 2CWAA 2VQEL 5LMUL 4LUVA 1WOCA 1EWIA 1Q81C 4XTCS 5FLMG 3G6EA 1YI2A 1J5EQ 3PV0A 3HOVH 3KF6A 2JJQA 3J7A5 1PYBA 4R4IA 1TWGH 3I4NG 4KLKA 1YHQA 2ID0A 4BBRH 4ME3A 1I3QH 1P16A 1OXXK 5M5XH 4JOIC 4BY7H 4Y52H 3KDFB 5LMNQ 2VUMG 3S24A 4QY7A 4C2MH 3OYYA 1VQOA 2JEBI 4AIMA 1IBLQ 4JBJA 1V1QA 3DLLA 4LF5L 3F1ZA 1XNRL 3TREA 5IT9c 1FGUA 2CCZA 4JYAL 3KJOA 4O0AA 4QIWE 4A3MG 4DK3C 5JJIA 2JA6H 4NPSA 2YU9H 4B3TQ 2HT1A 4GOPA 3UDFA 2Y0SG 3RLOA 1VQ8A 4DV2Q 3HFZB 1KD1C 5GAGC 1VQAA 4GN5A 1ASZA 4DK6C 4GKJL 2OQKA 4DV5L 1VQJA 3EIVA 4GN3B 1S40A 3S15H 2WFWA 2KCTA 3KJPA 4LF9L 4DKAC 4B3SQ 2JA8H 3S2HH 3K7AH 3T1YL 4YWMA 3J81j 1YNXA 1VQPA 2ZM6Q 4UP8A 1K3RA 3I7FA 2LXJA 4P71A 3VDYA 1MJEA 4JI4L 2UUBL 3J81c 1VQ7A 1E24A 4A3EG 3CW2C 1WYDA 4YCUA 2A19A 4TVAB 4OO1G 2UUAQ 4HIKA 3PGZA 2ZJQA 1MKHA 4A3JH 2KBNA 1VQMA 3RZOH 3RN5A 2VUMH 5IP9G 1PH9A 3JAMi 1PH3A 3STBC 3M9BA 1D7QA 2AKWB 5J3BA 4QJFA 4DV4Q 1KHIA 5M3FH 3IRBA 1MJCA 4MNOA 2ES2A 1X3EA 4BBSG 2MFIA 4A3LH 5IYBH 4R4QA 5LMNL 5C4JH 3J80c 2WAQG 1SMXA 4UY8C 3A74A 3NBHB 1UWVA 3UDGA 3NELA 2ASBA 3GTQH 2BH2A 1YHAA 1L1OB 2R7FA 2WB1E 3F2CA 1BBWA 4HIDA 1IBLL 4JI3Q 4GN4B 1Q7YC 4X62Q 4PZ8A 2RHQB 3S16H 1KXLA 1A63A 4DAYB 5BR8Q 1HH2P 3H3VH 2E8GA 3KDFA 3STBD 4R4CA 2ZM6L 4GLVB 3S1QH 3GTMH 4K0KQ 1YEZA 4KHZA 4X65L 2GVAA 4L5RC 1XMQL 2UUBQ 4JI6L 2MO1A 4GS3A 4IOCA 1VQLA 4LNQA 2Q2UA 5C0XI 2NVXH 4OWWB 1G6PA 4NXNQ 4JCVE 1VCIA 3HOWH 3PUYA 4IJHA 4C3HH 4NB3A 3PIOA 4HJ9A 1PH4A 2JA5H 2A1AA 2A8VA 1EFWA 1CSQA 3J80i 3S1RH 3TS2A 2E2HH 4LWCA 4JI8L 1P8LA 5GROA 3GTKH 1NE3A 2K5HA 1Z47A 3H15A 2JK8A 1X55A 1OTCA 1IBMQ 3M85A 2B29A 4NXMQ 5FJ8H 4DR5L 3RLFA 1C0AA 4DR3L 4OONA 4A76A 3CC2A 3HOZG 2WB1G 3CCSA 4AQYL 1YJNA 1Y1VG 2AWNA 4DNIA 3E0EA 4GKKQ 4IFDI 2D0OA 4JI5L 4X66Q 3HKZE 2VQFL 4BBSH 2LSSA 4L5SA 1J5EL 5K36G 2FXQA 4A3IH 1Y1WG 5C3EH 4RMFA 4C3JH 3PF5A 2GN5A 1E7ZA 3NEMA 4JBKA 1UE7A 4A4IA 4HJ8A 3AQQA 4H02A 5GAEC 3M4QA 4EX5A 4MZ9A 3BZKA 1KRSA 1ASYA 3PUWA 3D0FA 4UP7A 1VQ5A 3HOWG 1V43A 1N32L 3PO2H 5GADC 4YY3L 4R4TA 5LMNW 4GNXC 1XMOQ 1LUZA 1EIFA 2VS1A 1VQ6A 5IYDG 5FLMH 3GTGH 2E2IH 2RF4A 2BA0A 2MO0A 1VQBA 4DR3Q 1XNRQ 3AEVA 2K75A 4DV7L 3GTOH 2R6GA 1WI5A 3GDEA 4P73A
chains in the Genus database with same CATH superfamily
4PZ6A 4BBRG 4ZKCB 1SE4A 4DL4A 3HOZH 4RKBA 1SAPA 3T5KA 3H4DA 4GC7A 1QCBD 5I4DA 1JJCB 3Q8PB 3EBEA 4O2DA 2NVYA 4JI5H 4IALA 2K33A 4CKCA 1RL2A 1H9SB 4A2AA 3KOJA 5FO9B 1H9MA 2CQOA 2JA6G 3I56A 2W71A 4KJNA 1PVOA 5K2MA 4KK7A 2C35B 3IFTA 3Q0AA 1STGA 4QWBA 3I2ZA 3PW2A 5JEAG 5C0XH 1S5BD 1Z9FA 5IYDH 4LFAH 3NSWA 3FVQA 2KENA 2HHHH 5GQOA 1TWGB 3ERSX 4QIWA 3OMCA 3I70A 1HNXQ 1VQEA 2QDBA 3D3RA 5KNDA 1DV2A 3RMHA 2N49A 4LFAL 1TWFA 5I9OA 4C3IB 1O80A 1PFNA 4KI0A 2EXZA 4K5XA 4FF4A 3J7AK 2AMCB 2EXDA 1HQRD 4K0KL 4RA8A 3M4IA 1JWMD 3PUVA 2WB1A 2EYLA 4DR6Q 2DIKA 3QZ7A 5E1FA 5AJ3Q 4L63B 4UP9A 3RZOB 1K0RA 2NTSA 2NVQB 5JVG3 2R6FA 1A63A 1Q86C 2PNHA 3M7NA 3K81C 1NY4A 2K14A 3LGJA 4GLAC 2OTJA 2UXDH 4RNMA 3T53B 5CBEE 4X66H 2R7ZH 4XQJA 2NU8B 3PF4A 2AGOA 2XIGA 5J2UF 4RB2C 3HOVB 3MZ5A 2NZ1D 1JJ2A 3S14H 2W8LA 3MWMA 2KHIA 4OIJA 4IPHA 1UEAB 2AQ1B 4PZ7A 2ZJTA 1SFOA 2L9HA 4JG2A 4A3FH 1L0XB 2UU9H 4B3RL 4BY7G 2DN8A 1WH2A 3KALA 1B3AA 2G9HD 1V1PB 5ELBA 4ZUJA 5KT2A 3NUCA 4K2LA 4ED6A 3S2DH 1IBKQ 1N33Q 3JRWA 1B04A 5C4XG 5IYZF 1K83B 2WB1B 1SYFA 4LF4H 4A93G 1ZKOA 1ICWA 2I8CA 2K03A 4JK1C 1N32H 3ICEA 3HOYG 1I50B 1PMRA 3I91A 1IBKH 1N33H 1U4LA 3GTMB 1I6UA 2AHOB 2RDHA 4O4HF 4NW2A 2Q8RE 2B63H 3BJUA 4R4OA 4JI8H 5KFMA 5KFJA 2XSCA 1AE2A 3PR4A 3CP0A 5C3EB 4BY1G 1PTOH 1E2WA 1SBBB 3GO5A 1HRJA 1B6RA 1GKHA 4HJAA 5I9PA 2SEBD 2OH2A 1B6SA 5KG4A 5LL6b 1G51A 4YHHH 2W6QA 1Q82C 4ZKBB 1SMYD 1K8OA 4I50F 1QOHA 2L5TA 2PW7A 5A35A 1KDBA 3RZDB 5HY6A 4CBVA 3TIGA 2EPBA 3ND8A 3JAME 1JWUD 3ZJYC 3IL8A 1CFMA 3WDNA 2K5VA 5IY0A 2UU9L 4DL7A 4APVA 5M3FG 2R7MA 1RIPA 4F8MA 3HS0C 4EBEA 1GUGA 1S5FD 2HCCA 1SNQA 4DV6Q 4MV4A 3ETJA 4QB4A 5KX5F 2KCMA 3F8TA 3HBLA 1HZ9A 1EQTA 3I55A 4A3KH 5FD5A 4DUZL 1HXYD 4OO1H 2BR0A 2W6MA 5L37A 4OX9Q 5CV7A 4A3JG 5EPKA 1NTGA 4DV7H 4A3JB 5IP9H 3CCLA 3I73A 4CJ0B 4GLXA 1QVGA 2GLTA 5IGFA 2F0VA 3H6MA 2OCEA 5CA0F 4QWEA 1VQDA 3VYSA 2E5LL 2HIXA 4PMWA 4EEYA 1IYUA 3PIP3 2ASJA 1R4PB 4JI0L 1D5XC 2FLPA 2QK4A 1M1KC 2J7ZA 2H5XA 2GA4B 2OT2A 5KG0A 4EG0A 3S16B 4K0KH 4U673 1EY5A 2QGQA 4ECTA 3ULJA 2F0HA 1SNMA 4O1NA 4EQOA 2JSOA 1EOVA 2A6HD 1BNZA 2R87A 4KD3A 2ASLA 1S9FA 1GHKA 1K28A 1ZHQA 3EFXD 4QMGA 2F0LA 2MNAA 5JPNC 5JJKA 1PFSA 5K36H 3RAQA 4LSAA 3BVZA 4L6TB 5DNFA 1K8GA 2FK3A 2MGSA 4LFCL 3FP9A 1UNSA 2I0QA 1HNWH 2WE6A 3UQ8A 4V0BA 1E1OA 2B2TC 2OTLA 1G91A 3I12A 5DG8A 5FO8B 4QWAA 1HR0H 4RGMA 1JCKB 1Q8KA 3L0OA 3E5NA 3GTOA 2VUMB 4JV2A 1SYBA 2I87A 1L0YB 1TY0A 1BF4A 3GIDA 3BU2A 4C5CA 3PO3G 1EUCB 5KFYA 2R92H 3K5IA 5EWEA 4NDXA 3K57A 4A3MH 2FLNA 4IR9A 3NK9A 3SGIA 2O5IC 1KJJA 2HIVA 1ZETA 2G9DA 1JC7A 2BDNA 1GSOA 1L2ZA 1ZYRC 4CDFC 4MTKA 2ATLA 1N34Q 1MIUA 3S1QB 3EPGA 2C2RA 4J9QA 1E1TA 2NBFA 4YJ2F 1TAEA 1WD1A 2K52A 3RB6A 4IWYA 1JB7A 1KAAA 2BQ3A 4IJLA 1K83A 1CA5A 1E2VA 3CCVA 5DLFA 1ZEQX 3H3VI 2YTVA 2Z6BA 4Q5VA 4A3EH 1KABA 4RNOA 2A5HA 2AUJD 3T56B 4FF2A 2V58A 2R85A 1VQHA 5KT6A 1F9RA 4DR4Q 1U5KA 3RAXA 2IT1A 2CWPA 1HZBA 4NKLA 3DF7A 5C3WA 2VY3A 2R3ZA 4EGVA 5J39A 3GIKA 1OXSC 1XMOL 2TSSA 1OXUA 2F0PA 1NMGA 4Q8FA 1WJJA 3K0XA 2F0SA 4IO9A 1F2MA 1FJGH 3MJFA 3W5OA 5ELNA 3O13A 1YITA 4BA1I 2VW9A 4JBMA 2IA6A 3TN2A 2B63B 3NE5B 4K6LA 5IYCH 2F4VL 2VQFH 4KHPQ 2Z1CA 4FVMA 5M3MG 4IAJA 5E3FA 5M5WH 1EOTA 1LTGD 4X65H 4YY3Q 3GQBA 1VQIA 1BXRA 5KFTA 4UCOA 2JA7A 3WO0A 1PLFA 4BXXG 1GUWA 4IRDA 2RQXA 4IZOA 1KBLA 1HQMC 5KYLA 1GLVA 1N9WA 2K5WA 1A3UA 3HKZG 2KHSA 2L1BA 3QB3A 1S5DD 4B3MQ 3GTGA 1PRTF 3MWYW 5JVH3 2UXDQ 3JZIA 1UE6A 2FMCA 1CA6A 1A6XA 2Y0SE 4A3DG 5DAUA 4RUAA 2JN4A 2HCIA 1JT8A 1UNNC 2UVUA 2KUMA 5KFSA 1RHPA 4A3KB 2G5DA 2NVXB 4LJZC 5EBDA 4G7OC 2A69D 5G3LD 4HIMA 2FP4B 5CB4F 3TZDA 3R23A 3T1HL 4WORA 3VYTA 4F88A 2WAQA 1YBYA 3PIPA 1KL9A 3QO2A 4M1UB 5FLXW 4LUOA 2VZAA 5LA6F 5EWGA 2R7KA 3W1GA 2RSNA 4QWDA 2F0NA 2W9AA 5F9NA 5FLMG 4YP3A 1J5EQ 4MV9A 1C8CA 1KJQA 1F77A 3KF6A 2JJQA 3J7A5 5IGDA 3PO3B 5KT3A 2H4OA 3C1EA 4DLKA 2OXPA 4JI1H 4ME3A 3OHXC 3OWEB 2VB3X 3H4BA 2FHTA 5KGUA 5LMNQ 4I7HA 4HSPA 1D2BA 4QCLA 2EY2A 2RDIA 4C2MH 4UCRA 1V51A 1DM0B 2EYPA 5C6AA 2M00A 2RDJA 1V1QA 2F3WA 3QZ8A 3H94A 2RDGA 1SYEA 3ITPA 3TREA 4C1NI 1PTOD 2FMAA 2JA5A 3SK8A 2CCZA 3A55A 2UVWA 4KJOA 4QIWE 4QUFA 3MFIA 4DK3C 4AYBA 2JA6H 2HT1A 2Y0SG 1TWFB 1HA6A 1GSAA 3HFZB 3U9SA 4K5WA 3PW5A 4DK6C 1DIKA 4DAVA 4PMBA 3S15H 1S68A 1AFPA 1XWEA 1BUVT 2BOSA 3CRKC 3D8GA 1CQFA 4YWMA 3J81j 4DV0H 2WKDA 1VQPA 3V6KA 1CZWA 4GC6A 2PMZA 3CRLC 1LTTD 2R8KA 2A19A 2A74C 5M5WB 4OO1G 2UUAQ 4ECVA 4DUZH 4CGYB 4J9PA 1WTWA 4A3JH 2EY6A 2KBNA 4O4LF 5KG5A 1IBLH 2EYFA 5IP9G 1JE4A 3LWUA 1D7QA 3NHHA 4XQQA 2ICIA 2KCCA 4ME5A 5IYBH 5C4JH 3J80c 2C00A 1SMXA 3A74A 3NBHB 4ZRZA 3UDGA 4O3NA 1PXUA 3F2CA 1BOSA 4E6IA 4HIDA 4L1KA 3J80L 1Q7YC 4F4WA 4DR6H 4X62Q 3S16H 1KXLA 4HR7B 2NYZD 4CJ2C 4DAYB 4F87A 5D3IB 3H3VH 3STBD 4K0KQ 2ZM6L 4GLVB 1YEZA 3RB3A 1QB5D 2DJGC 1VQLA 2Q2UA 1G6PA 4BY1B 5DM63 4F50A 1PFMA 4IHJF 2A1AA 4FYDA 2O5JC 1TT2A 5CV9A 1EFWA 2HD3A 2UXBH 5FK9C 1NR2A 4JI8L 1I3QA 2FK2A 3GTKH 2KEEA 3HKZA 2K5HA 3NTIA 2JK8A 2NUCA 5HBRB 3UFXB 1IBMQ 2B29A 5FJ8H 3GIMA 4A76A 1LO5D 1EWCA 5EPJA 3CCSA 1RK6A 5ELFA 5JUMA 4DNIA 4RNNA 2TMPA 1FNWA 4H7BA 5EKKA 4X66Q 3FPPA 4MHEA 1QNUA 3SK6A 2BCOA 4A3MB 2XD4A 4J9RA 3GTPB 2FXQA 4A3IH 4BWSC 3NPPA 1E7ZA 3NEMA 4KY7A 2QEJC 2A6ED 1UE7A 2PZWA 4A4IA 3K58A 4HJ8A 4H02A 4QW9A 2JXMB 1ENFA 2QDLA 5NUCA 3MWDA 1VQ5A 4UP7A 3SE7A 4J6HA 3PO2H 4C3HG 4DL2A 2F0IA 1XMOQ 2VS1A 3MEHA 4QW8A 2XCAA 1JX4A 1VBGA 3K3PA 3I4NB 1XNRQ 3GTOH 4O3PA 1VQBA 4DR3Q 3AEVA 2K75A 4YBZB 4DR2Q 1WI5A 1ESFA 1SNOA 4P73A 5EWFA 3Q22A 4O4IF 1Y1WB 4DF7A 3EPIA 3P75A 2JEFA 2F4VQ 5IP7G 1HNZH 4KKTA 4CC6A 4DR3H 3V6HA 3RB4A 4ZOLF 2IX1A 4IFDG 1WD0A 2W70A 3EJIA 1K1QA 1EYCA 2K4KA 3TQYA 1I6VC 1CSPA 4DUYQ 1DCZA 2Q2HA 3IAYA 3G71A 2YYZA 2YZGA 3T16A 3KLWA 4H0LC 1VQ9A 2VQFQ 2CH4A 3R2TA 2UXDL 3F2BA 4TQUS 2E5LQ 1X6OA 3QWNA 4IFDJ 4ID6A 3N6XA 3J81E 1I4QA 2JEJA 3A5UA 5C1PA 3Q8DA 3NP8A 3R8BA 4UPAA 2JA6B 1E2ZA 2VUGA 2X0SA 1Q8IA 1Y8NB 3VYRA 3TRZA 5BR8H 3MC0B 1JOOA 2K50A 2A68D 2KCNA 2VA3A 2UVVA 4DXGA 1OO9B 1TA8A 4YAKB 2DWCA 5DG9A 4JI3L 2YS7A 1RYRA 2B8FA 2EDGA 3K0YA 2BH8A 1F2LA 1BVSA 2KVMA 1X3FA 5JEAJ 1QZHA 1HJPA 2XCPA 4CKBA 4TV8F 1KEEA 4F4ZA 3TP6A 2W9BA 4JI6Q 1IL8A 1IYJB 5C1OA 2V4RA 1B9NA 4RKLA 4JW0A 2R93H 1OXTA 4K5VA 2UUCL 4DV0L 4DR1H 2N78A 3PVXA 3FHWA 1JDEA 5EQ0A 2FFKB 4F7XA 1XTDA 4OX9L 5KNBA 1HNWL 4EQ5A 4LK1C 1S0MA 1SR3A 1YNJC 2LFNA 4YR3A 2B63A 2CFMA 3GTQA 3MEFA 1HR0Q 1OWTA 1KQSA 4R8IA 3WNZA 4Q45A 3DEOA 4P2CB 3PO3H 2O03A 4RGOS 4DA2A 4X3TA 5M5XB 2C2EA 5FLXL 2K5NA 3T5LA 4MV6A 4B9WA 2BE5D 3MXNA 3CCQA 2YZNA 4PQXA 3RTXA 1VQGA 5EBCA 5CBAE 5JPMC 3RV3A 1J6QA 5KFOA 4GNXA 1TS2A 5CV4A 2E2IB 1AH9A 3IFDA 3NWSA 2W7OA 4ED8A 2P5ZX 1B7YB 4UAIA 3GTKA 2E74C 1FJGQ 5FD6A 2NTTA 5EAYA 2R86A 2IPKD 3MTSA 5L9XA 4LW1A 1VQFA 4J9LA 1IOVA 3RN2A 3EYYA 1EEFD 5IT9L 2KOLA 1SJED 4WJ4A 3JSLA 1A8VA 5K5PA 4DV2H 4EBCA 2I5LX 3PW4A 3PSIA 2VR1A 5DGBA 3QFFA 4DV3Q 1C7YA 4TRDA 4X65Q 1I50A 4K14A 2AWOA 3BJYA 3D4WA 4FDBA 1LT3D 2XWBB 2NB0A 1EY8A 2IHFA 4OWXB 2Z9HA 3C1FA 5KFDA 3JC66 2E2HB 1JWSD 1FNUA 4AQYH 2EOTA 2NVTH 5KFFA 1A9XA 4PG3A 3CXCA 3MXNB 4HJ5A 1TIID 1NAPA 1EYAA 3RR5A 1LTLA 4Y8VB 4AYBG 1VMPA 1C4QA 2B2YC 4QUCA 3RGXA 2YYAA 1U4RA 3J81i 3C3LA 2VNUD 4DV1H 4BBSB 5FLXE 5IYBG 1GUOA 5LHY1 4A93H 1HNXH 3I4LA 3U50C 1FD7D 1MSGA 1XPOA 1C30A 1E0BA 4A3CH 4LFBQ 1PZKD 2FKLA 5CC4A 3FKIG 2PBZA 1JIHA 1B4OA 1RK5A 4YJ3F 3SR1A 2Q2TA 3A8JE 3BA9A 3OIPA 2M2LA 2UXCQ 3CCEA 3GLKA 3UE0A 2B63G 2WAQB 4BY1H 1Z7TA 1IKLA 4LF9Q 2JQOA 1HUMA 3QR8A 2JA5G 1XDNA 2D62A 2EY5A 4RCOA 1IOWA 4MV8A 3QOLA 2PMZE 3CPFA 4N8X1 1VQKA 4TV9F 3CCRA 4DN4M 4B3TL 2NZHA 2YRXA 4ECUA 4IUNA 2Y0SB 4KHPL 3F2UA 4O2BF 3OSNA 2C9OA 1KNAA 1JMCA 1WSCA 4BBRB 2RCNA 2UUAH 2D9UA 2CZGA 1RCVD 1HPCA 3T1YQ 4YAJB 3GD7A 4LF6Q 3CCUA 3UDXA 2UU9Q 2L0CA 5T1IA 2YCHA 4A3GH 1HTLD 1PH6A 4JI2Q 3B6YA 3FKIH 4JI7Q 4QQBX 5BR8L 2HHHL 1A0IA 2K05A 4JI4H 3PO2G 3HZXA 1GO3E 1OXVA 1SCUB 2R93A 2NU6B 2HVQA 2Z6KC 2JA7G 5D1OA 4JOIA 4X64H 1QG7A 2KHJA 2OEOA 3EN2A 1QWYA 2E2DC 4DUYL 3OSPA 1VBHA 5DEHA 1Y1WH 4C3JG 4EFEA 5ELEA 2ICEC 3N44B 1STNA 3BYTB 3HOZB 4LFAQ 2FINB 3TMEA 2R8GA 1K8MA 3BQ1A 5IP7H 2XC9A 5KFBA 1PTOB 4GZYC 1U4PA 1WVLA 4POGA 1VF7A 1LTID 1S72A 2W6OA 4LF7H 5CR3A 4IWXA 4LF8Q 4J9NA 1KNEA 1GHJA 1FGBD 3LX0A 3SHLA 3IKJA 2IP4A 1CS0A 5KFLA 2HVRA 1PRTB 4RAYA 3S1RB 4M8AA 3HOXG 1G291 5AJ3L 1V9PA 1DZ1A 2W6ZA 2ZDGA 2K1BA 5I2XA 4HR7A 1JLLB 3E9IA 3TDQA 3HGBA 4DU9A 4DR5Q 5T1GA 1BXTA 4IPGA 3Q2OA 4O2AF 3TINA 3AB9A 5KT7A 2Z0SA 4A3BG 2IWHA 5E4WC 4B3SL 1W3SA 1I94L 5IGBA 4ZI7F 2F0FA 3KF8B 3S14B 3IN5A 4X62L 2QW7A 2R92G 4KD4A 1X3GA 2Q8IB 4YHHL 3DXJC 4P74A 1DJRD 1GVPA 3GTJH 1QVFA 1GUSA 4A3FB 1CQIB 4TQRA 4J9KA 3FMAA 2I5MX 4IPCA 2QF7A 3NGDA 4IQZA 3M9OB 5C5MA 2W9CA 1LM0A 3E9HA 1M7JA 2R8IA 1T3NA 1XXGA 4IUTA 2CVRA 4P72A 3D6WA 2D0PA 2NVTB 4DR4L 3A7LA 5BPFA 4RH6A 1IBKL 1N33L 2A6HC 1SFOH 2QKIC 3ERQA 1I4GA 2EJGC 1CKOA 1IBML 2X6LA 3PUZA 3U4VA 4JI1L 2QCPX 1I50H 2XWJB 4HSVA 4I55F 4O3OA 3GV7B 2E76C 3VR2A 3VPBA 4JI7H 3L9AX 5EGTA 4GOPB 5J1ZA 2ALYB 1EY4A 3CMAA 3OTOL 2OWOA 4ED0A 1T5EA 2BQRA 1E4EA 1TS3A 2B2UA 1L2FA 4OXPA 4PNYA 3X3MA 2R82A 2K6AA 4FU0A 1AE3A 3AMUA 1PA6A 3VR4A 1XNRH 2CQAA 1GOZA 2EZVA 4TUYF 3G6VA 2SNSA 2F0KA 5D65A 3HOWB 2IY5B 5C3EG 1KJ8A 2FK1A 3JRXA 4N9TA 3TEHB 1ML0D 1YVCA 2R7DA 1SLJA 3R2IA 3RZDH 1ULZA 1PX2A 1YNND 3UI2A 1ZQ7A 2PYKA 4KY5A 3I72A 3HOYB 2ALZA 2LKVA 3PIO3 2DPIA 1MI2A 4DR2L 5LMUL 2VPQA 2ENBA 3GTLB 1EWIA 4XTCS 1RD9D 4I65A 4DL5A 3SE0A 1YI2A 4LAAA 5IGEA 4ECYA 1CI3M 4KLKA 1I4XA 1J9OA 2EYOA 4BBRH 1I3QH 1P16A 3NTHA 4XX0B 3LWBA 4Y52H 3PR5B 4C3JB 1TKWB 2B2YA 4J1MA 4RHSA 2VUMG 2DLNA 2E5LH 2PW5A 3S24A 1EIGA 4IFDH 1SXTA 3MFHA 1IBLQ 4AIMA 1O78A 1X3PA 2PMZB 2XGPA 1H9SA 4WFN3 1FGUA 5FKAC 4Q0FA 4O0AA 1VAJA 1SNCA 2RGVA 4KV6A 2YU9H 2AQ4A 4GOPA 5C4HA 5LYJF 1VQAA 4GKJL 3R93A 4DV5L 1VQJA 2B8GA 3EIVA 4R8NA 4LFCH 3GILA 4LF9L 3S2HH 4ECRA 2LMCB 1TR5A 2KJXA 1YNXA 2L55A 4G57A 1K3RA 2Z8LA 2LXJA 3VDYA 2AQ3B 1MJEA 4FXDA 1SYDA 2FE3A 2R7NA 1RKNA 3CW2C 5GONF 2E2IA 1RTOA 1WYDA 4YCUA 2XVSA 3Q8SB 4TVAB 3VR5A 1ILPA 5LMNH 1I94H 1LTAD 3PGZA 4OEMB 4YIJA 1MKHA 3A7AB 3URYA 3BAAA 2PZTA 1N34H 3OHBA 1PH9A 3JAMi 2PO4A 3M9BA 3KTMA 5J3BA 3MWEA 3K5OA 1KHIA 4ZK9B 3M4OB 1MJCA 1HA5A 4LF5H 2XGQA 4R4QA 5LMNL 4G3IA 2WAQG 2R92B 4DV6H 2NVYB 5DLGA 3NELA 3KHRA 2BH2A 1YHAA 2R7FA 1ET9A 5CAEB 1G2TA 2YZMA 2HUGA 4PZ8A 5KKNB 5KG7A 1F9SA 3M9NB 3A8IE 4C1NK 2BQUA 5BR8Q 1HH2P 1FYCA 2E8GA 4DR4H 2MP1A 4CDCC 4ZAIA 2F03A 5LP6F 1S03G 5C0XI 2NVXH 5KFAA 3HOWH 5IOCA 1EYZA 3V4ZA 3Q6SA 1LTRD 3ORQA 2X69A 5A2QL 3IG0A 4IR1A 1CSQA 1IW7C 1VF5C 4IN3A 3N8DA 5GROA 4LMQD 4CKEA 1DXMA 1UC8A 1HHVA 4QF4A 4ECXA 4IUVA 1KLGD 1EFID 1OTCA 1Y69U 3RLFA 1C0AA 3E3XA 2M9VA 1M0WA 5J22A 2WB1G 2C2DA 2L11A 1BCPF 4RZQA 5LL6S 3BVMA 1TWAB 3ETHA 3D6CA 3GQCA 1ILQA 2LSSA 1TU2B 4DFAA 5C5JA 2E2HA 3KHLA 1WCMA 4C3JH 3PF5A 2GN5A 4JBKA 1EY0A 4JV1A 1NCVA 3M4QA 1GJXA 2GPSA 4O42A 2HVSA 2WYOA 3BZKA 1O7LA 1ASYA 1S4ZA 3D0FA 1N32L 4ED7A 4F4XA 4YY3L 5LMNW 5C5LA 2UVRA 4H13C 2VA2A 1LT4D 1EY9A 5IYDG 5BN5A 2A6EC 4J0MA 4AQYL 4B9XA 1UC9A 4UDUC 2L15A 3U9OA 1CHQD 4LF5Q 4MAMA 1TWCB 2GVBA 1EY7A 5EZYF 3S15B 2V59A 3KLRA 5L1IA 5I6WA 1KRTA 4HIOA 3HXLA 1JXLA 1V1OA 2XRQD 5IT9E 1Y1WA 5A2QW 3A0JA 2B2UC 4LFBL 1BBUA 1JKJB 1TWHA 4HCEA 2CKZB 2Q2IA 1BR9A 1I3QB 1E22A 3GTJB 2F52A 2GPWA 4NLGA 1DYQA 3KF8A 2K5QA 5CMDA 4L5TA 4A3KG 5C44G 1LYLA 1S0OA 4X66L 4JBWA 1L0WA 3RB0A 1LV9A 3RLNA 1EWHA 2LXKA 4O3RA 4FP5D 4LMYA 1B8AA 1LTSD 5CYUA 1V4YA 2NVYH 2Z6KA 3T1YH 3N52A 4O3SA 3CC4A 4DR7Q 3EROA 5KFWA 1GUNA 4BXXH 4DV4L 2W8KA 1EQRA 4AYBB 1WCMH 1HZAA 1E4FT 2PVPA 1B9MA 4G7HC 5KFVA 2EE1A 2A73B 2AGPA 1I4RA 3MR2A 4DUZQ 1M4VA 4QL5A 2VXWA 4J15A 4B3TH 1KIXA 3AFPA 2JE6I 4A3FG 3A54A 3I90A 4JI4Q 4J9SA 4JI0H 4A3GB 1Q12A 3FKIB 2UXBQ 5I47A 4BWGB 4NXMH 1A2TA 2UXCH 4ED2A 5LMUQ 3CKIB 3FDSA 2YU9A 5D14A 4A3LG 3GV6A 4JI0Q 5ISRA 5C4XH 4R7RA 1IXRA 5HURA 2P0AA 4C2MA 4A3EB 4C56C 4NXMQ 2YTXA 3T4AC 3I4MG 4R8UA 5C44H 2UXCL 1UAPA 1RODA 4YB8B 1GYFA 1D8LA 3HOYH 4MA5A 4LF6L 1EZ6A 4ME6A 2KA7A 4GKKH 2CW0C 4DL6A 4RCNA 2L12A 3BA8A 3Q8QB 5H80A 3JAMW 1MD2D 1PH8A 3AYHB 3GTPH 1GUTA 2F0OA 2M05A 4H44C 4JI2L 1V8QA 3LWEA 4JI7L 3BQ2A 3AFQA 1FVIA 3S1MB 4DV7Q 4JI5Q 4GOPC 5E7NA 1BO0A 1CE8A 5HV6A 3K7UC 1AZPA 4RAZA 5H1SE 5BPHA 1XMOH 5IE8A 4YWKA 3RJ0A 4XT1B 2EJFC 1Y8OB 3ORRA 1BQQT 2F0JA 3VPDA 3CCMA 2ZTCA 2XTIA 3W3AA 3KF6B 3EA6A 2Z4IA 4IURA 3Q24A 4DV1Q 3GTQB 4HMJA 3HOVG 3S9WA 1C9OA 5LL6X 2ZTDA 3HRZC 3DM3A 2LY7A 4LSXA 2VUMA 2N3SA 2EJMA 4FS2A 4EQNA 3KLSA 2JA7B 4XYLB 4ZLTF 3M4PA 4HJ7A 3RNUA 3CQZH 2HHHQ 1SJHD 2W9CB 1XNQQ 5JQWA 1TWAH 1EQQA 5KFGA 3TQTA 3PW0A 4YHHQ 2DNEA 4RFBA 5M5YH 2IHEA 2JEAI 3K59A 1N36Q 2SDFA 2JA5B 1HNWQ 2AQ2B 1W96A 2DGYA 1PRTD 3OTOH 4R1JA 1JOKA 1WTXA 4TKOB 4DNRB 4X6AH 1O7ZA 4LF8H 4JI8Q 5C3XA 1UE1A 1A2UA 1YNJD 5L1LA 1DONA 2PZUA 4FS1A 3H40A 1N36H 1PDQA 1I94Q 3TQ1A 1CM9A 3OPOA 1HNZL 3M3YH 5DGAA 3OSOA 5IWAL 4HYKA 1X54A 4QIWB 5JH7F 5L1JA 2K5DA 3M9MB 3CAMA 4XIGS 4IRKA 4LF8L 3HKZB 3Q8RB 2JA8G 5J2TF 2FJZA 1A3TA 1MGSA 4JV5H 1H9KA 4AYBE 1ONLA 4J9MA 1PTOC 2QYZA 1I5FA 1QZGA 2O4XA 3NTKA 1TS4A 3KYHC 4HNVA 4DR2H 1DOKA 1SYXB 4ULLA 4DV2L 1Y14B 1O75A 3DHQA 3GTPA 4EGQA 4C2MB 1I4HA 3CU7A 1EY6A 2FB9A 5M3FB 2CQYA 1VS0A 1K3BC 3Q1KA 1G8ZD 2YV5A 1UEBA 3UE1A 1KJIA 2J6UA 1S3OA 3S17B 4X64Q 4DR6L 4ECZA 1GM5A 4HNUA 3KFUA 1K1SA 1O7IA 3G6JB 3TS0A 1YIJA 1N32Q 5JVDF 3K80C 3VYUA 1UE5A 5KIXA 1YHBA 3PMFA 1NUCA 3RUZA 5IWAH 3H20A 4PWQA 4MV1A 1K8AC 1HR0W 1CQJB 1PFBA 1AN7A 1DD2A 4MTNA 4A3CG 1DGSA 1WFQA 1NNXA 1KC7A 3OTOQ 5D3DA 4ETSA 5KEEA 1PH5A 1STHA 2Y0SA 1TXYA 3F8NA 2PQAB 4B3SH 2ASDA 1T94A 5C4XB 5KT5A 1BGWA 1Y1VH 4FXGC 3LP8A 3H0GH 4JPBW 4JUZA 2B3GA 3CQZB 5HGQA 1B3QA 1K0SA 4DK0A 1QVCA 4IZ8A 2RA4A 4BA2I 3FKIA 4BS9A 5DQHA 1UUPA 2WAQE 3OW2A 1SDFA 5M5YB 4C3IH 4X3SA 3G6XA 3J80E 2XGTA 5EKIA 3A56A 3CCJA 3RIZA 1LLRD 5IYCG 2K28A 1JQYD 2F0TA 3CHBD 1W2BA 3N40P 2RVLA 2J4XA 4NMZA 2I80A 4BY7B 3NQTA 4GKKL 4LF6H 1Q1EA 1WTVA 5DQGA 5ELDA 2YRWA 2PNRC 1SN8A 2BDOA 1Z6HA 2R93B 2D2CC 5GAHC 1PK8A 4DV5Q 3NXWA 2MQHA 3CF5A 4RG1A 2ZM6H 3CPWA 2UUCQ 4RZRA 3KHHA 2C22A 2R8HA 2IL8A 1TVXA 1W6JA 3LMLA 5KFIA 1YZ6A 3J80W 3WWVA 1SEBD 1PHJA 2UXBL 4K2KA 1PZID 1HR0L 4DR1Q 4XDXA 3MR3A 4LH7A 1SYCA 1BDOA 3BYYB 2JA7H 2W9BB 4EYIB 4RAUC 3CQZA 1CQVA 2JA8B 1JE5A 4G4KA 1GGOA 1R4QB 1KDCA 4OO1I 4LF4L 2J6TA 4GKJQ 4ECWA 1U4MA 3WOFA 1Z2OX 4X3UA 1E4GT 1IW7D 1RF2D 3T51B 2J9GA 1SROA 5KG6A 2CW7A 1Y1VA 5KNCA 3PUXA 2DY8A 2ZT9C 4YQWA 1U0LA 1CHPD 2F3VA 5JJLA 1EZ8A 5BMVF 1AW7A 1K83H 2N55A 2DNCA 4APMA 2NN6I 1XPRA 1F2YA 5A2QE 3I4NH 3D4DA 3GTOB 1C3OA 2HDLA 5I2YA 5KFEA 3I4MH 1A3VA 3FEWX 2H1EA 4CC5A 4J8QA 1ZHSA 4YCVA 3PN1A 1LABA 5KFNA 3V6JA 1I7NA 3SVMA 5EKLA 1ENAA 2ZDQA 1CKNB 1NR4A 5G3LF 1VQCA 3OUUA 2WACA 3G48A 5COYA 2K04A 3BDLA 1K9MC 2WDTA 4KN4C 4DGZA 2QA4A 2EYMA 3C2PA 4Z9CB 4KTAA 1A62A 2BE5C 4JI2H 1D5ZC 2PI2E 1X56A 4XQNA 3JAMc 3M4YA 4JV5L 2FPGB 5CV6A 3TP8A 3N6RA 4ZYSA 4YCWA 1QE6A 3JAML 4A75A 2W6NA 1J5EH 1X65A 1T9HA 4OELB 1TWCH 3MXUA 5KFXA 3OWFA 2CH4W 3QOJA 2CW0D 1Q81C 3TZUA 3QIAA 3G6EA 3GIQA 2N88A 3GTJA 2DZDA 3HOVH 5BN3A 1TWHB 2K7VA 1TWGH 3KK7A 4I4TF 3LNNA 5DM73 2ID0A 5JJZA 4M7EA 1TQOA 3CVZA 4BY7H 1B1ZA 2B2WC 1I6HB 3OYYA 3L3OC 5KFRA 2JEBI 4FBUA 1RJPA 4JBJA 4HNTA 3DLLA 4LF5L 1AZQA 3F1ZA 1XNRL 1BNCA 3RD4A 5IT9c 2AU0A 1TWGA 4JYAL 5ELCA 3KJOA 4A3MG 1VDZA 5JJIA 2JEGA 4NPSA 4B3TQ 4WJWA 3UDFA 3M3YB 1F9QA 4MN3A 3ZYYX 1Y1VB 4DV2Q 1DV1A 4EYHB 1KD1C 1CK1A 1ASZA 4L8JA 5KFHA 2EY1A 1VKZA 1N48A 4GN3B 1A15A 2WFWA 4Q44A 2R8JA 3PW7A 2JA8H 1KTKA 4DKAC 4FO2A 3P1HA 3K7AH 2K01A 4ECQA 3T1YL 2WV6D 2I46A 4TSSA 4ZQ3A 3VPCA 3I7FA 2E75C 4P71A 2E2JB 4JI4L 2UUBL 1VQ7A 1E24A 4A3EG 3RF2A 1XYIA 1AEXA 4WBNF 1X3QA 1RYSA 1EZ1A 1HFGA 4HIKA 2ZJQA 1N56A 1VQMA 1SFOB 3RN5A 1KDAA 2VUMH 2F0MA 5C44B 4JI3H 2IW3A 2LS01 4WD3A 4X62H 5M3FH 1XNQH 4BBSG 4MNOA 1X3EA 4A3LH 4KKUA 4B08A 1GSHA 1CTMA 2F4IA 1UWVA 4UCSA 4RB3C 5KRUA 2ASBA 2VOBA 2F4VH 1L1OB 1IBLL 1MHWC 4JI3Q 4GN4B 4NP5A 4JYAH 4R4CA 3S1QH 3GTMH 1TWCA 4KHZA 3MA2B 4L5RC 2WINB 1XMQL 4JI6L 2MO1A 4GS3A 5LOVF 4OWWB 4NXNQ 1VCIA 4LF9H 4IJHA 3PIOA 1PH4A 1B53A 1II3A 2VQDA 2A8VA 4PMCA 1NSNS 3T13A 1BJTA 4LWCA 1F2ZA 4EVOA 1S5ED 4U6PA 1WTOA 2W7PA 4QWCA 1X55A 2HDMA 2RCFA 5KFQA 4ZHQF 4DR5L 3VMMA 3CC2A 3HOZG 2RBMA 3HOXB 2AWNA 2B2VC 4KMUC 3E0EA 4GKKQ 4IFDI 4JI5L 3RUPA 5DG7A 1JB3A 3MFYA 3HKZE 2KECA 3KLSX 4ODGA 2OF1A 4L5SA 1J5EL 1Y1WG 4DR5H 3E0JA 3RGZA 1IHZA 1R9TA 3OMGA 3AQQA 5FPOA 4XXEA 2RKSA 3TP5A 4KHVA 5EDWA 1S5CD 2B2WA 5KFPA 5KFCA 3I8ZA 3RBEA 4CDDC 1MZBA 2KQ3A 5EJWA 1VMCA 2B39A 5FLMH 3GTGH 4EGJA 4X3KA 3BQ0A 2RF4A 2MO0A 2MUYA 2CW8A 4DV7L 1ZYRD 3PZPA 3OOCA 3GDEA 1STEA 4GNXB 2DJFC 3BG5A 3QG1A 2MJ8A 2IMWP 4ABNA 2NU7B 3MAQA 1HZCA 2FJ2A 3CMEA 4DV3L 3U58A 1HUNA 3F2DA 2NVXA 3N42B 4OL7A 1L1OA 2MCTA 4HCSA 1ENCA 1SE8A 4RU9A 3G4SA 1VQ4A 1K73C 1N8RC 3T5HA 3DWAA 3D4RA 3ULPA 4MV7A 3KHGA 2IBKA 2R84A 3L2PA 1GD7A 2A69C 4OWTB 1FNVA 4DAMA 3BS1A 1J8IA 1I6HH 2NZOA 4RGNA 3OHAA 4EEQA 1FKAH 3SI8A 3I4OA 4GKJH 2UUAL 2R7ZG 1H9RA 3R5HA 3G6YA 1EIYB 3HOUG 1HFNA 1Q1BA 3ER0A 4JC0A 4RGTA 3V4SA 1HTPA 1SRUA 4B3RQ 1EIHA 3K3VA 4FNFA 1B70B 5CA1F 1CUKA 2ATWA 2HGSA 2PN1A 2ZTEA 4JV5Q 1BCPD 1L1OC 3G7LA 2HQEA 4Y7NB 5IIFA 1N34L 1W93A 1QUQB 2J0TD 1WTQA 3G8CA 4DK1A 3DMUA 5M3MH 1WR2A 4AQYQ 1DOLA 3TIIA 4EFBA 1LT6D 3KAKA 2ZJPA 3NQIA 1XX8A 4X64L 4Q8EA 5M9OA 4I7AA 4OX9H 1W6KA 2SNMA 4J9OA 3BZCA 4HN7A 2WP8J 2SCUB 1I4PA 4DAPA 3I3CA 3GTLA 2I5HA 4RWSC 2EQSA 1R9TH 2XIWA 4AH6A 3H0GB 1KC8C 2YU9B 4JI6H 2VL6A 3T5JA 4DR7L 4UCVA 1TWFH 4PV1C 3FMCA 3SK4A 3WOEA 3TP7A 4POFA 1PH1A 4C5BA 1NMFA 1SEIA 1SMYC 2JP1A 1WCMG 2ZXRA 3BVGA 1YJWA 4DV4H 3VA5A 2J6SA 3L4JA 1JJGA 5D8DA 4U68A 3HKSA 5FO7B 2XNAC 2B2VA 3HG9A 1EYGA 2B2TA 3EVQA 4DUYH 4C3HB 5IGCA 5FJ8G 5F9LA 2PQEA 4LUZA 3K5HA 1B44D 2I07B 3SDZA 3K5MA 5LMUH 5KFKA 2O2LD 4NXML 2FPIB 2F0QA 1ZXTA 2NN6H 2EVBA 2RHSB 3MR6A 2JA6A 3VR3A 4RHRA 3A8KE 3H09A 3J7AF 1SE3A 1GXDC 4YR0A 3DM1A 3S1NH 5L1KA 4LF7L 4RB0A 2WTFA 1EEID 3K8AA 1H95A 1B33N 1PZJD 4DL3A 4DR1L 2UUCH 1G2SA 2EIFA 2F0GA 4R9WA 1JORA 5CV8A 4V190 2V1CC 1MSHA 1RDPD 3K7AB 2VQEQ 4ED3A 3BDOA 3FPUB 2ZXOA 1X9NA 2JEIA 3BDCA 2DY7A 4OGQC 3X3NA 1S0NA 2QEXA 3SEBA 3K6OA 3U4ZA 1SE2A 4F4YA 1QUQA 2OQ0A 3T1HQ 3CD6A 2UUBH 1S97A 5IT9W 2ZXPA 3J7ZC 1D5MC 3SXHA 3MVVA 1CKMA 1CKNA 5C4ZA 3GTGB 3OIQA 3I4MB 3GIIA 4LFBH 4YR2A 1KLUD 5AFWA 3MXGA 4LFCQ 3RFCA 1SYGA 5JOBA 3WO1A 5DLQE 2C5CA 4IOAA 1KAWA 3HEJA 3HOUB 4A3DB 4LF4Q 3GTLH 3AU7A 1XNQL 4XZ3B 1PYSB 5KG2A 4Y7NH 1D1KA 2K32A 3K5LA 1AUVA 1YNNC 3GIJA 3RBDA 3TSSA 4HMIA 4FF1A 1PH2A 1V1PA 4QGUA 1IL2A 4DV1L 1F9PA 2KSWA 5KFZA 1EU3A 5ELOA 1QNKA 4MV3A 1M8AA 4ZCKA 1SNPA 3K5NA 1EL0A 4UCTA 4MTDA 2A68C 4KHPH 1EUJA 3DWQA 3OW7A 2D5DA 5BN4A 3U9TA 1CT1D 1PV4A 4ALPA 5D1OB 1Q46A 1T36A 5C4JB 3SK5A 3ONAB 4JI1Q 4A2BA 1S10A 3C0FB 3V05A 2FLLA 4DV0Q 2F0DA 1NJIC 4EQPA 1EU4A 1WTHA 2F0WA 4RUCA 1TWHH 2FMMA 2R61A 4B3MH 5C0XJ 3W2DA 1AP0A 2N8NA 5IGGA 1STBA 3VR6A 4HTHA 1ESRA 3R3OA 3S1MH 3S2HB 3GV5B 4DR7H 2L4NA 4DPGA 2AGQA 2Z4HA 3PCOB 3KUPA 5KG1A 3HB9A 2YTYA 2VQEH 1RTNA 1CZGA 4IPDA 4MTEA 4DV5H 3GTKB 4K8IA 5C8YF 4O3QA 3GP7A 3KBXA 5HGTA 3J81L 4WJ3M 1E3PA 3DWPA 3KXYT 4JYAQ 4XYOA 3L4KA 3R5FA 1M0TA 3S1NB 4FM9A 1WCMB 2NVQH 1HCZA 4MIUA 5FOBB 2F3IA 2ZJRA 4FF3A 1FJGL 3M4OH 4U7CA 1SSOA 2PI2A 3E6ZX 2PPBC 4A3IG 4A3IB 1IKMA 1B50A 2JYOA 2MHVA 4P75A 2RDFA 3CC7A 2E2JH 2SOBA 4C5AA 3JSNA 3KBGA 1XTCD 4DAYA 2DUDA 2YL2A 3H0GA 3PO2B 4ILWA 4B3ML 1STAA 3NBHA 1TS5A 2C28A 3D31A 1WTRA 4A3GG 4Q43A 5JVLA 4HEDA 2IX0A 3NENA 4WRDA 3MXPA 4JV0A 3S2DB 3RV4A 4E4TA 5T14A 4A3DH 4CHTB 3HOUH 2HJWA 2V5AA 2NWGA 3J7AV 1BBXC 5D1PA 4UFZA 2JA9A 3ULLA 4B3RH 3R5XA 1ET6A 3H0GG 2R92A 5CV5A 2AUKA 1O7YA 1Z2NX 4Q0YA 1IZ6A 5IODA 4C3IG 5CORA 4UHVA 3HP3A 2YW2A 4DV6L 1PH7A 3W1BA 1RJQA 2PQAA 5FPRA 1Q90A 4CJ1B 2CHBD 1YJ9A 4L5QA 1XJVA 5JEAH 5C0XG 3S17H 5KFUA 3BG3A 3VA7A 4K6DA 3HOXH 2EYJA 1BKBA 2XRSD 1XMQQ 3L7ZC 3UDIA 1EYDA 1NBWA 5E4XA 4ECSA 4HAEA 3P20A 4A3BH 1FL0A 4KN7C 4YWLA 1RJRA 1DOMA 1IBMH 2VB2X 4EBDA 4XYQA 3MHBA 1ICFB 1N36L 1X32A 3NWTA 3FDTA 1XPUA 4NXNH 2BA1A 4OIKA 1WTPA 3A5ZB 2R93G 4LF7Q 1HNXL 4S3SA 3GIPA 2V4QA 1RJTA 1TY2A 5FLXc 1HNZQ 2HQLA 2XCLA 5IWAQ 2V4DA 1M90C 1VQNA 4IUPA 4NXNL 1AN8A 4DNTB 3V96A 2IX3A 1H9JA 2Q8TA 2NN6G 2CWAA 2VQEL 1PTOF 4LUVA 4FBTA 1U9RA 1WOCA 4A93B 1I7LA 1Z2PX 1EQVA 2WKCA 3PV0A 1LACA 3EQLC 3J7YW 1PYBA 5F2DA 1D6EC 2X6GA 4R4IA 3I4NG 1YHQA 3PQIA 5M5XH 1QJOA 1OXXK 2ZDHA 2V9WA 3QJYA 4JOIC 1KJ9A 3KDFB 1EHIA 2W57A 1BCPB 4QY7A 1G6ZA 2FPPB 1QILA 1VQOA 1D1IA 2IJ0A 2MPMA 5TSSA 2R7ZA 5LXTF 4UCUA 2YS6A 1MBYA 4TQSA 3KAJA 3GV3A 1C48A 3RLOA 1VQ8A 4HQ6A 4ED1A 2F0EA 5EPLA 3NBIA 5GAGC 4GN5A 1XMQH 2OQKA 2NUAB 1S40A 4G7ZC 3MR5A 2KCTA 3KJPA 4XT3B 4B3SQ 3MFGA 5KT4A 4I7ZC 2XN9C 1LT5D 5M3MB 3Q23A 2WIIB 2ZM6Q 1T5XD 4UP8A 3N43B 4KY6A 3J81c 4IRCA 1Y8PB 5I6YA 2NU9B 4CDEC 2DPJA 1EUDB 2OLSA 4LH6A 3M7GA 1R9TB 3RZOH 1PH3A 3STBC 2RGRA 4KKSA 2AKWB 4QJFA 1PYWD 4DV4Q 3IRBA 2ES2A 3TBIB 2MFIA 4UY8C 2R7ZB 1TWAA 3GTQH 1E4EB 2WB1E 1BBWA 2QILA 4IUQA 2KEDA 4DXFA 4A3BB 4XYMB 1FR3A 2RHQB 3KDFA 1STYA 5KG3A 4YY3H 4X65L 2GVAA 2PCFB 2UUBQ 4IOCA 4LNQA 4OHJA 1JOQA 4JCVE 4IUUA 1JICA 4JVZA 3PUYA 4C3HH 4HJ9A 4NB3A 4MA0A 1Q3LA 2JA5H 1JR0D 2R7LA 1M6VA 3V2TA 3J80i 1PRTC 4FXKC 3S1RH 3TS2A 2E2HH 1B2TA 1P8LA 3E5SA 1NE3A 4M9UA 1Z47A 5CGKA 5EOYA 5DQIA 3H15A 4DV3H 4K8JA 3M85A 5JAVA 2W6PA 3ND9A 4DR3L 4OONA 2EYHA 3OUZA 1YJNA 1Y1VG 3DEPA 2F1MA 2RSOA 3FRPB 2D0OA 4PDBA 3BZDB 2VQFL 4BBSH 3BABA 3GV8B 3P7JA 5K36G 3N41B 4RB1A 1JDBB 1LTBD 5C3EH 4RMFA 3T1HH 3J81W 1SNDA 5GAEC 3GTMA 4EX5A 4MZ9A 4R8UB 1KRSA 4N9PA 3PUWA 2F0UA 3HOWG 1V43A 4ZQIA 5GADC 4N8FA 1BCPC 4R4TA 4ZUIA 4GNXC 1VQ6A 1LUZA 1EIFA 2VPSA 3C46A 1IYVA 3H3VC 5KYIA 1AUXA 2E2IH 2BA0A 2R6GA 3DUZA 3H91A
chains in the Genus database with same CATH topology
4PZ6A 2L15A 4LF5Q 4BBRG 2GVBA 1HZCA 1KRTA 3CMEA 4DV3L 4HIOA 3U58A 2F4VQ 3HOZH 3F2DA 5IP7G 2IX1A 1L1OA 4IFDG 1JJCB 3EBEA 1SE8A 3A0JA 4LFBL 4O2DA 1BBUA 3G4SA 1VQ4A 1K73C 1N8RC 2CKZB 2K4KA 1RL2A 3ULPA 3TQYA 2Q2IA 1CSPA 1E22A 2F52A 3L2PA 1GD7A 4DUYQ 2Q2HA 4OWTB 3KOJA 4L5TA 4DAMA 3G71A 2YYZA 4A3KG 5C44G 2CQOA 1LYLA 2NZOA 3KLWA 3I56A 2JA6G 4X66L 1I6HH 1VQ9A 4JBWA 3I4OA 1L0WA 2VQFQ 3I4MG 1PVOA 3RLNA 2UXDL 2UUAL 3F2BA 2C35B 2R7ZG 4TQUS 2LXKA 1X6OA 1EIYB 2E5LQ 3HOUG 4IFDJ 1B8AA 3I2ZA 1Q1BA 5JEAG 3ER0A 4JC0A 2NVYH 1Z9FA 5IYDH 2Z6KA 1SRUA 3A5UA 3CC4A 4DR7Q 4BXXH 3Q8DA 2KENA 4DV4L 4UPAA 4B3RQ 1EQRA 4DR7L 1B70B 1HZAA 1WCMH 1CUKA 3TRZA 2ATWA 5GQOA 3ERSX 2K50A 2ZTEA 1HNXQ 1VQEA 4QL5A 4DUZQ 4JV5Q 4JI3L 1L1OC 4J15A 2N49A 1KIXA 3AFPA 1N34L 2JE6I 4A3FG 1QUQB 4LFAL 2BH8A 1BVSA 1QZHA 1X3FA 5JEAJ 4JI4Q 5M3MH 1HJPA 4AQYQ 4KI0A 1Q12A 2UXBQ 2ZJPA 4JI6Q 2AMCB 4X64L 2EXDA 5LMUQ 1IYJB 3BZCA 4K0KL 2WP8J 4A3LG 3PUVA 4JI0Q 4DR6Q 5C4XH 2R93H 2I5HA 1IXRA 2EQSA 1OXTA 5AJ3Q 4UP9A 4AH6A 1R9TH 4DV0L 1K0RA 2N78A 2VL6A 4DR2Q 1KC8C 2UUCL 1Q86C 2YTXA 1TWFH 2PNHA 3FHWA 1NY4A 3K81C 5C44H 2K14A 3LGJA 1XTDA 4OX9L 3M7NA 2UXCL 4EQ5A 4GLAC 1HNWL 2OTJA 1D8LA 3HOYH 4POFA 4LF6L 2R7ZH 1PH1A 1SR3A 1NMFA 3PF4A 2CFMA 1PH8A 3AYHB 3MEFA 1HR0Q 1WCMG 3GTPH 1YJWA 1KQSA 4JI2L 4JI7L 1JJ2A 3S14H 3AFQA 2KHIA 1FVIA 3PO3H 1JJGA 4IPHA 3HKSA 4PZ7A 4DV7Q 2K5NA 4JI5Q 4GOPC 4A3FH 4JG2A 1EYGA 5E7NA 3CCQA 4B3RL 4BY7G 3K7UC 5H1SE 5IE8A 4YWKA 5FJ8G 1VQGA 4LUZA 1J6QA 4GNXA 4NXML 1AH9A 3CCMA 2ZTCA 2XTIA 2RHSB 3S2DH 1IBKQ 3KF6B 1N33Q 1B7YB 1FJGQ 5C4XG 4DV1Q 5EAYA 3HOVG 4A93G 4LW1A 1VQFA 1C9OA 3S1NH 3RN2A 2ZTDA 4LF7L 3DM3A 2N3SA 3K8AA 4WJ4A 3ICEA 1H95A 3HOYG 3M4PA 1A8VA 4HJ7A 3RNUA 3CQZH 2I5LX 3PSIA 2HHHQ 4DR1L 2AHOB 1XNQQ 2EIFA 4DV3Q 1TWAH 1EQQA 4X65Q 1C7YA 2B63H 3BJUA 4R4OA 2AWOA 2V1CC 4YHHQ 5M5YH 4FDBA 2IHEA 1AE2A 2VQEQ 2JEAI 3CP0A 1N36Q 2IHFA 4OWXB 4BY1G 1HNWQ 1X9NA 3GO5A 2DGYA 1GKHA 3JC66 4R1JA 4HJAA 4X6AH 2NVTH 2QEXA 1G51A 4JI8Q 4PG3A 3CXCA 3U4ZA 1UE1A 1Q82C 1QUQA 2OQ0A 3T1HQ 3CD6A 3MXNB 4HJ5A 1I94Q 3J7ZC 3RR5A 1HNZL 1LTLA 5HY6A 3M3YH 1CKMA 4AYBG 1CKNA 3ZJYC 5IWAL 2UU9L 1X54A 2K5VA 5IY0A 3CAMA 4APVA 3J81i 4XIGS 4LFCQ 5M3FG 4LF8L 1RIPA 5DLQE 2JA8G 1KAWA 4IOAA 2VNUD 5IYBG 4LF4Q 3GTLH 4A93H 1XNQL 4AYBE 4DV6Q 1PYSB 3U50C 4Y7NH 1XPOA 1I5FA 1QZGA 4A3CH 2KCMA 3F8TA 1HZ9A 3I55A 4LFBQ 3KYHC 4GNXB 3FKIG 4A3KH 1PH2A 4DUZL 2Q2TA 4DV2L 4QGUA 1IL2A 1Y14B 4DV1L 4OX9Q 2UXCQ 3CCEA 4A3JG 5ELOA 3UE0A 1NTGA 5IP9H 3CCLA 1QVGA 4GLXA 2B63G 4BY1H 1EUJA 4LF9Q 2JQOA 2OCEA 2JA5G 1VQDA 1PV4A 4ALPA 2D62A 1VS0A 2E5LL 1Q46A 2HIXA 4PMWA 2PMZE 1UEBA 2YV5A 3CPFA 3UE1A 1VQKA 4JI1Q 1S3OA 4JI0L 4X64Q 4DR6L 3CCRA 4B3TL 2NZHA 1M1KC 4DV0Q 2H5XA 1GM5A 1NJIC 4KHPL 3KFUA 1O7IA 1TWHH 3TS0A 5C0XJ 1YIJA 2QGQA 1JMCA 2N8NA 3ULJA 1N32Q 2RCNA 3K80C 1EOVA 1UE5A 1YHBA 3T1YQ 3S1MH 3GD7A 2MNAA 4LF6Q 5JJKA 4DPGA 1PFSA 3CCUA 1K8AC 3UDXA 1HR0W 2UU9Q 3PCOB 2YTYA 1K8GA 4LFCL 3FP9A 4MTNA 2I0QA 4A3CG 4A3GH 4IPDA 1DGSA 1WFQA 4JI2Q 3B6YA 3FKIH 1PH6A 4JI7Q 4QQBX 1E1OA 5BR8L 3OTOQ 1PH5A 2OTLA 2HHHL 1A0IA 4WJ3M 1TXYA 1Q8KA 3L0OA 1E3PA 2PQAB 3PO2G 1GO3E 4JYAQ 1OXVA 1Y1VH 2Z6KC 3H0GH 2JA7G 2NVQH 3M4OH 4JOIA 2F3IA 2ZJRA 3BU2A 1FJGL 2KHJA 3PO3G 3EN2A 2B3GA 5HGQA 2PI2A 2R92H 4DUYL 4A3MH 1QVCA 4A3IG 3SGIA 1Y1WH 4BA2I 2WAQE 2HIVA 4P75A 3OW2A 4C3IH 2XGTA 3CC7A 4LFAQ 2E2JH 1N34Q 5IP7H 3CCJA 1MIUA 5IYCG 1E1TA 1W2BA 2DUDA 4POGA 2K52A 4GKKL 1Q1EA 1S72A 4B3ML 4LF8Q 1JB7A 1SN8A 4IJLA 3CCVA 3D31A 4A3GG 3H3VI 2YTVA 5GAHC 4A3EH 2IX0A 4DV5Q 3CF5A 2MQHA 1G291 4RG1A 1V9PA 5AJ3L 3HOXG 3NENA 1VQHA 3CPWA 2UUCQ 4DR4Q 1U5KA 2IT1A 3E9IA 2CWPA 4DR5Q 1HZBA 4A3DH 1YZ6A 3HOUH 4IPGA 3WWVA 2VY3A 2Z0SA 1PHJA 4A3BG 4B3SL 1OXSC 2UXBL 1W3SA 1XMOL 1I94L 2JA9A 1OXUA 3ULLA 1NMGA 3KF8B 1HR0L 4DR1Q 1WJJA 3K0XA 4X62L 2R92G 1X3GA 3H0GG 4IO9A 2JA7H 3W5OA 4YHHL 5ELNA 4P74A 1GVPA 3GTJH 1JE5A 1YITA 1QVFA 1IZ6A 4BA1I 2VW9A 4JBMA 2I5MX 4IPCA 4LF4L 4OO1I 4DV6L 1PH7A 3W1BA 5IYCH 4GKJQ 2PQAA 2F4VL 4KHPQ 1LM0A 3E9HA 5M3MG 1YJ9A 1SROA 4L5QA 5M5WH 1XJVA 5C0XG 4YY3Q 3PUXA 4P72A 1U0LA 2D0PA 5JJLA 4DR4L 1VQIA 3S17H 1IBKL 1K83H 1N33L 1SFOH 4BXXG 2NN6I 1XPRA 1CKOA 3HOXH 1IBML 3I4NH 1BKBA 1N9WA 3HKZG 3PUZA 1XMQQ 3U4VA 4JI1L 3L7ZC 1I50H 3UDIA 4B3MQ 3I4MH 1NBWA 4YCVA 4GOPB 2UXDQ 2ALYB 3CMAA 3OTOL 1UE6A 2OWOA 4A3BH 1FL0A 1CKNB 4YWLA 2Y0SE 4A3DG 1VQCA 1L2FA 4OXPA 1JT8A 3G48A 1AE3A 1N36L 1K9MC 2QA4A 1PA6A 1XPUA 1A62A 2BA1A 2PI2E 1X56A 3JAMc 5C3EG 4HIMA 2IY5B 3A5ZB 2R93G 4LF7Q 1HNXL 4JV5L 3TEHB 3T1HL 1YVCA 2R7DA 4YCWA 1SLJA 3RZDH 4A75A 5FLXc 1YBYA 3PIPA 2HQLA 1KL9A 1HNZQ 1X65A 1T9HA 2VZAA 4LUOA 5IWAQ 1M90C 1TWCH 4NXNL 1VQNA 3W1GA 4DR2L 2NN6G 2CWAA 2VQEL 5LMUL 4LUVA 1WOCA 1EWIA 1Q81C 4XTCS 5FLMG 3G6EA 1YI2A 1J5EQ 3PV0A 3HOVH 3KF6A 2JJQA 3J7A5 1PYBA 4R4IA 1TWGH 3I4NG 4KLKA 1YHQA 2ID0A 4BBRH 4ME3A 1I3QH 1P16A 1OXXK 5M5XH 4JOIC 4BY7H 4Y52H 3KDFB 5LMNQ 2VUMG 3S24A 4QY7A 4C2MH 3OYYA 1VQOA 2JEBI 4AIMA 1IBLQ 4JBJA 1V1QA 3DLLA 4LF5L 3F1ZA 1XNRL 3TREA 5IT9c 1FGUA 2CCZA 4JYAL 3KJOA 4O0AA 4QIWE 4A3MG 4DK3C 5JJIA 2JA6H 4NPSA 2YU9H 4B3TQ 2HT1A 4GOPA 3UDFA 2Y0SG 3RLOA 1VQ8A 4DV2Q 3HFZB 1KD1C 5GAGC 1VQAA 4GN5A 1ASZA 4DK6C 4GKJL 2OQKA 4DV5L 1VQJA 3EIVA 4GN3B 1S40A 3S15H 2WFWA 2KCTA 3KJPA 4LF9L 4DKAC 4B3SQ 2JA8H 3S2HH 3K7AH 3T1YL 4YWMA 3J81j 1YNXA 1VQPA 2ZM6Q 4UP8A 1K3RA 3I7FA 2LXJA 4P71A 3VDYA 1MJEA 4JI4L 2UUBL 3J81c 1VQ7A 1E24A 4A3EG 3CW2C 1WYDA 4YCUA 2A19A 4TVAB 4OO1G 2UUAQ 4HIKA 3PGZA 2ZJQA 1MKHA 4A3JH 2KBNA 1VQMA 3RZOH 3RN5A 2VUMH 5IP9G 1PH9A 3JAMi 1PH3A 3STBC 3M9BA 1D7QA 2AKWB 5J3BA 4QJFA 4DV4Q 1KHIA 5M3FH 3IRBA 1MJCA 4MNOA 2ES2A 1X3EA 4BBSG 2MFIA 4A3LH 5IYBH 4R4QA 5LMNL 5C4JH 3J80c 2WAQG 1SMXA 4UY8C 3A74A 3NBHB 1UWVA 3UDGA 3NELA 2ASBA 3GTQH 2BH2A 1YHAA 1L1OB 2R7FA 2WB1E 3F2CA 1BBWA 4HIDA 1IBLL 4JI3Q 4GN4B 1Q7YC 4X62Q 4PZ8A 2RHQB 3S16H 1KXLA 1A63A 4DAYB 5BR8Q 1HH2P 3H3VH 2E8GA 3KDFA 3STBD 4R4CA 2ZM6L 4GLVB 3S1QH 3GTMH 4K0KQ 1YEZA 4KHZA 4X65L 2GVAA 4L5RC 1XMQL 2UUBQ 4JI6L 2MO1A 4GS3A 4IOCA 1VQLA 4LNQA 2Q2UA 5C0XI 2NVXH 4OWWB 1G6PA 4NXNQ 4JCVE 1VCIA 3HOWH 3PUYA 4IJHA 4C3HH 4NB3A 3PIOA 4HJ9A 1PH4A 2JA5H 2A1AA 2A8VA 1EFWA 1CSQA 3J80i 3S1RH 3TS2A 2E2HH 4LWCA 4JI8L 1P8LA 5GROA 3GTKH 1NE3A 2K5HA 1Z47A 3H15A 2JK8A 1X55A 1OTCA 1IBMQ 3M85A 2B29A 4NXMQ 5FJ8H 4DR5L 3RLFA 1C0AA 4DR3L 4OONA 4A76A 3CC2A 3HOZG 2WB1G 3CCSA 4AQYL 1YJNA 1Y1VG 2AWNA 4DNIA 3E0EA 4GKKQ 4IFDI 2D0OA 4JI5L 4X66Q 3HKZE 2VQFL 4BBSH 2LSSA 4L5SA 1J5EL 5K36G 2FXQA 4A3IH 1Y1WG 5C3EH 4RMFA 4C3JH 3PF5A 2GN5A 1E7ZA 3NEMA 4JBKA 1UE7A 4A4IA 4HJ8A 3AQQA 4H02A 5GAEC 3M4QA 4EX5A 4MZ9A 3BZKA 1KRSA 1ASYA 3PUWA 3D0FA 4UP7A 1VQ5A 3HOWG 1V43A 1N32L 3PO2H 5GADC 4YY3L 4R4TA 5LMNW 4GNXC 1XMOQ 1LUZA 1EIFA 2VS1A 1VQ6A 5IYDG 5FLMH 3GTGH 2E2IH 2RF4A 2BA0A 2MO0A 1VQBA 4DR3Q 1XNRQ 3AEVA 2K75A 4DV7L 3GTOH 2R6GA 1WI5A 3GDEA 4P73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ6 A;  2L15 A;  4LF5 Q;  4BBR G;  2GVB A;  1HZC A;  1KRT A;  3CME A;  4DV3 L;  4HIO A;  3U58 A;  2F4V Q;  3HOZ H;  3F2D A;  5IP7 G;  2IX1 A;  1L1O A;  4IFD G;  1JJC B;  3EBE A;  1SE8 A;  3A0J A;  4LFB L;  4O2D A;  1BBU A;  3G4S A;  1VQ4 A;  1K73 C;  1N8R C;  2CKZ B;  2K4K A;  1RL2 A;  3ULP A;  3TQY A;  2Q2I A;  1CSP A;  1E22 A;  2F52 A;  3L2P A;  1GD7 A;  4DUY Q;  2Q2H A;  4OWT B;  3KOJ A;  4L5T A;  4DAM A;  3G71 A;  2YYZ A;  4A3K G;  5C44 G;  2CQO A;  1LYL A;  2NZO A;  3KLW A;  3I56 A;  2JA6 G;  4X66 L;  1I6H H;  1VQ9 A;  4JBW A;  3I4O A;  1L0W A;  2VQF Q;  3I4M G;  1PVO A;  3RLN A;  2UXD L;  2UUA L;  3F2B A;  2C35 B;  2R7Z G;  4TQU S;  2LXK A;  1X6O A;  1EIY B;  2E5L Q;  3HOU G;  4IFD J;  1B8A A;  3I2Z A;  1Q1B A;  5JEA G;  3ER0 A;  4JC0 A;  2NVY H;  1Z9F A;  5IYD H;  2Z6K A;  1SRU A;  3A5U A;  3CC4 A;  4DR7 Q;  4BXX H;  3Q8D A;  2KEN A;  4DV4 L;  4UPA A;  4B3R Q;  1EQR A;  4DR7 L;  1B70 B;  1HZA A;  1WCM H;  1CUK A;  3TRZ A;  2ATW A;  5GQO A;  3ERS X;  2K50 A;  2ZTE A;  1HNX Q;  1VQE A;  4QL5 A;  4DUZ Q;  4JV5 Q;  4JI3 L;  1L1O C;  4J15 A;  2N49 A;  1KIX A;  3AFP A;  1N34 L;  2JE6 I;  4A3F G;  1QUQ B;  4LFA L;  2BH8 A;  1BVS A;  1QZH A;  1X3F A;  5JEA J;  4JI4 Q;  5M3M H;  1HJP A;  4AQY Q;  4KI0 A;  1Q12 A;  2UXB Q;  2ZJP A;  4JI6 Q;  2AMC B;  4X64 L;  2EXD A;  5LMU Q;  1IYJ B;  3BZC A;  4K0K L;  2WP8 J;  4A3L G;  3PUV A;  4JI0 Q;  4DR6 Q;  5C4X H;  2R93 H;  2I5H A;  1IXR A;  2EQS A;  1OXT A;  5AJ3 Q;  4UP9 A;  4AH6 A;  1R9T H;  4DV0 L;  1K0R A;  2N78 A;  2VL6 A;  4DR2 Q;  1KC8 C;  2UUC L;  1Q86 C;  2YTX A;  1TWF H;  2PNH A;  3FHW A;  1NY4 A;  3K81 C;  5C44 H;  2K14 A;  3LGJ A;  1XTD A;  4OX9 L;  3M7N A;  2UXC L;  4EQ5 A;  4GLA C;  1HNW L;  2OTJ A;  1D8L A;  3HOY H;  4POF A;  4LF6 L;  2R7Z H;  1PH1 A;  1SR3 A;  1NMF A;  3PF4 A;  2CFM A;  1PH8 A;  3AYH B;  3MEF A;  1HR0 Q;  1WCM G;  3GTP H;  1YJW A;  1KQS A;  4JI2 L;  4JI7 L;  1JJ2 A;  3S14 H;  3AFQ A;  2KHI A;  1FVI A;  3PO3 H;  1JJG A;  4IPH A;  3HKS A;  4PZ7 A;  4DV7 Q;  2K5N A;  4JI5 Q;  4GOP C;  4A3F H;  4JG2 A;  1EYG A;  5E7N A;  3CCQ A;  4B3R L;  4BY7 G;  3K7U C;  5H1S E;  5IE8 A;  4YWK A;  5FJ8 G;  1VQG A;  4LUZ A;  1J6Q A;  4GNX A;  4NXM L;  1AH9 A;  3CCM A;  2ZTC A;  2XTI A;  2RHS B;  3S2D H;  1IBK Q;  3KF6 B;  1N33 Q;  1B7Y B;  1FJG Q;  5C4X G;  4DV1 Q;  5EAY A;  3HOV G;  4A93 G;  4LW1 A;  1VQF A;  1C9O A;  3S1N H;  3RN2 A;  2ZTD A;  4LF7 L;  3DM3 A;  2N3S A;  3K8A A;  4WJ4 A;  3ICE A;  1H95 A;  3HOY G;  3M4P A;  1A8V A;  4HJ7 A;  3RNU A;  3CQZ H;  2I5L X;  3PSI A;  2HHH Q;  4DR1 L;  2AHO B;  1XNQ Q;  2EIF A;  4DV3 Q;  1TWA H;  1EQQ A;  4X65 Q;  1C7Y A;  2B63 H;  3BJU A;  4R4O A;  2AWO A;  2V1C C;  4YHH Q;  5M5Y H;  4FDB A;  2IHE A;  1AE2 A;  2VQE Q;  2JEA I;  3CP0 A;  1N36 Q;  2IHF A;  4OWX B;  4BY1 G;  1HNW Q;  1X9N A;  3GO5 A;  2DGY A;  1GKH A;  3JC6 6;  4R1J A;  4HJA A;  4X6A H;  2NVT H;  2QEX A;  1G51 A;  4JI8 Q;  4PG3 A;  3CXC A;  3U4Z A;  1UE1 A;  1Q82 C;  1QUQ A;  2OQ0 A;  3T1H Q;  3CD6 A;  3MXN B;  4HJ5 A;  1I94 Q;  3J7Z C;  3RR5 A;  1HNZ L;  1LTL A;  5HY6 A;  3M3Y H;  1CKM A;  4AYB G;  1CKN A;  3ZJY C;  5IWA L;  2UU9 L;  1X54 A;  2K5V A;  5IY0 A;  3CAM A;  4APV A;  3J81 i;  4XIG S;  4LFC Q;  5M3F G;  4LF8 L;  1RIP A;  5DLQ E;  2JA8 G;  1KAW A;  4IOA A;  2VNU D;  5IYB G;  4LF4 Q;  3GTL H;  4A93 H;  1XNQ L;  4AYB E;  4DV6 Q;  1PYS B;  3U50 C;  4Y7N H;  1XPO A;  1I5F A;  1QZG A;  4A3C H;  2KCM A;  3F8T A;  1HZ9 A;  3I55 A;  4LFB Q;  3KYH C;  4GNX B;  3FKI G;  4A3K H;  1PH2 A;  4DUZ L;  2Q2T A;  4DV2 L;  4QGU A;  1IL2 A;  1Y14 B;  4DV1 L;  4OX9 Q;  2UXC Q;  3CCE A;  4A3J G;  5ELO A;  3UE0 A;  1NTG A;  5IP9 H;  3CCL A;  1QVG A;  4GLX A;  2B63 G;  4BY1 H;  1EUJ A;  4LF9 Q;  2JQO A;  2OCE A;  2JA5 G;  1VQD A;  1PV4 A;  4ALP A;  2D62 A;  1VS0 A;  2E5L L;  1Q46 A;  2HIX A;  4PMW A;  2PMZ E;  1UEB A;  2YV5 A;  3CPF A;  3UE1 A;  1VQK A;  4JI1 Q;  1S3O A;  4JI0 L;  4X64 Q;  4DR6 L;  3CCR A;  4B3T L;  2NZH A;  1M1K C;  4DV0 Q;  2H5X A;  1GM5 A;  1NJI C;  4KHP L;  3KFU A;  1O7I A;  1TWH H;  3TS0 A;  5C0X J;  1YIJ A;  2QGQ A;  1JMC A;  2N8N A;  3ULJ A;  1N32 Q;  2RCN A;  3K80 C;  1EOV A;  1UE5 A;  1YHB A;  3T1Y Q;  3S1M H;  3GD7 A;  2MNA A;  4LF6 Q;  5JJK A;  4DPG A;  1PFS A;  3CCU A;  1K8A C;  3UDX A;  1HR0 W;  2UU9 Q;  3PCO B;  2YTY A;  1K8G A;  4LFC L;  3FP9 A;  4MTN A;  2I0Q A;  4A3C G;  4A3G H;  4IPD A;  1DGS A;  1WFQ A;  4JI2 Q;  3B6Y A;  3FKI H;  1PH6 A;  4JI7 Q;  4QQB X;  1E1O A;  5BR8 L;  3OTO Q;  1PH5 A;  2OTL A;  2HHH L;  1A0I A;  4WJ3 M;  1TXY A;  1Q8K A;  3L0O A;  1E3P A;  2PQA B;  3PO2 G;  1GO3 E;  4JYA Q;  1OXV A;  1Y1V H;  2Z6K C;  3H0G H;  2JA7 G;  2NVQ H;  3M4O H;  4JOI A;  2F3I A;  2ZJR A;  3BU2 A;  1FJG L;  2KHJ A;  3PO3 G;  3EN2 A;  2B3G A;  5HGQ A;  2PI2 A;  2R92 H;  4DUY L;  4A3M H;  1QVC A;  4A3I G;  3SGI A;  1Y1W H;  4BA2 I;  2WAQ E;  2HIV A;  4P75 A;  3OW2 A;  4C3I H;  2XGT A;  3CC7 A;  4LFA Q;  2E2J H;  1N34 Q;  5IP7 H;  3CCJ A;  1MIU A;  5IYC G;  1E1T A;  1W2B A;  2DUD A;  4POG A;  2K52 A;  4GKK L;  1Q1E A;  1S72 A;  4B3M L;  4LF8 Q;  1JB7 A;  1SN8 A;  4IJL A;  3CCV A;  3D31 A;  4A3G G;  3H3V I;  2YTV A;  5GAH C;  4A3E H;  2IX0 A;  4DV5 Q;  3CF5 A;  2MQH A;  1G29 1;  4RG1 A;  1V9P A;  5AJ3 L;  3HOX G;  3NEN A;  1VQH A;  3CPW A;  2UUC Q;  4DR4 Q;  1U5K A;  2IT1 A;  3E9I A;  2CWP A;  4DR5 Q;  1HZB A;  4A3D H;  1YZ6 A;  3HOU H;  4IPG A;  3WWV A;  2VY3 A;  2Z0S A;  1PHJ A;  4A3B G;  4B3S L;  1OXS C;  2UXB L;  1W3S A;  1XMO L;  1I94 L;  2JA9 A;  1OXU A;  3ULL A;  1NMG A;  3KF8 B;  1HR0 L;  4DR1 Q;  1WJJ A;  3K0X A;  4X62 L;  2R92 G;  1X3G A;  3H0G G;  4IO9 A;  2JA7 H;  3W5O A;  4YHH L;  5ELN A;  4P74 A;  1GVP A;  3GTJ H;  1JE5 A;  1YIT A;  1QVF A;  1IZ6 A;  4BA1 I;  2VW9 A;  4JBM A;  2I5M X;  4IPC A;  4LF4 L;  4OO1 I;  4DV6 L;  1PH7 A;  3W1B A;  5IYC H;  4GKJ Q;  2PQA A;  2F4V L;  4KHP Q;  1LM0 A;  3E9H A;  5M3M G;  1YJ9 A;  1SRO A;  4L5Q A;  5M5W H;  1XJV A;  5C0X G;  4YY3 Q;  3PUX A;  4P72 A;  1U0L A;  2D0P A;  5JJL A;  4DR4 L;  1VQI A;  3S17 H;  1IBK L;  1K83 H;  1N33 L;  1SFO H;  4BXX G;  2NN6 I;  1XPR A;  1CKO A;  3HOX H;  1IBM L;  3I4N H;  1BKB A;  1N9W A;  3HKZ G;  3PUZ A;  1XMQ Q;  3U4V A;  4JI1 L;  3L7Z C;  1I50 H;  3UDI A;  4B3M Q;  3I4M H;  1NBW A;  4YCV A;  4GOP B;  2UXD Q;  2ALY B;  3CMA A;  3OTO L;  1UE6 A;  2OWO A;  4A3B H;  1FL0 A;  1CKN B;  4YWL A;  2Y0S E;  4A3D G;  1VQC A;  1L2F A;  4OXP A;  1JT8 A;  3G48 A;  1AE3 A;  1N36 L;  1K9M C;  2QA4 A;  1PA6 A;  1XPU A;  1A62 A;  2BA1 A;  2PI2 E;  1X56 A;  3JAM c;  5C3E G;  4HIM A;  2IY5 B;  3A5Z B;  2R93 G;  4LF7 Q;  1HNX L;  4JV5 L;  3TEH B;  3T1H L;  1YVC A;  2R7D A;  4YCW A;  1SLJ A;  3RZD H;  4A75 A;  5FLX c;  1YBY A;  3PIP A;  2HQL A;  1KL9 A;  1HNZ Q;  1X65 A;  1T9H A;  2VZA A;  4LUO A;  5IWA Q;  1M90 C;  1TWC H;  4NXN L;  1VQN A;  3W1G A;  4DR2 L;  2NN6 G;  2CWA A;  2VQE L;  5LMU L;  4LUV A;  1WOC A;  1EWI A;  1Q81 C;  4XTC S;  5FLM G;  3G6E A;  1YI2 A;  1J5E Q;  3PV0 A;  3HOV H;  3KF6 A;  2JJQ A;  3J7A 5;  1PYB A;  4R4I A;  1TWG H;  3I4N G;  4KLK A;  1YHQ A;  2ID0 A;  4BBR H;  4ME3 A;  1I3Q H;  1P16 A;  1OXX K;  5M5X H;  4JOI C;  4BY7 H;  4Y52 H;  3KDF B;  5LMN Q;  2VUM G;  3S24 A;  4QY7 A;  4C2M H;  3OYY A;  1VQO A;  2JEB I;  4AIM A;  1IBL Q;  4JBJ A;  1V1Q A;  3DLL A;  4LF5 L;  3F1Z A;  1XNR L;  3TRE A;  5IT9 c;  1FGU A;  2CCZ A;  4JYA L;  3KJO A;  4O0A A;  4QIW E;  4A3M G;  4DK3 C;  5JJI A;  2JA6 H;  4NPS A;  2YU9 H;  4B3T Q;  2HT1 A;  4GOP A;  3UDF A;  2Y0S G;  3RLO A;  1VQ8 A;  4DV2 Q;  3HFZ B;  1KD1 C;  5GAG C;  1VQA A;  4GN5 A;  1ASZ A;  4DK6 C;  4GKJ L;  2OQK A;  4DV5 L;  1VQJ A;  3EIV A;  4GN3 B;  1S40 A;  3S15 H;  2WFW A;  2KCT A;  3KJP A;  4LF9 L;  4DKA C;  4B3S Q;  2JA8 H;  3S2H H;  3K7A H;  3T1Y L;  4YWM A;  3J81 j;  1YNX A;  1VQP A;  2ZM6 Q;  4UP8 A;  1K3R A;  3I7F A;  2LXJ A;  4P71 A;  3VDY A;  1MJE A;  4JI4 L;  2UUB L;  3J81 c;  1VQ7 A;  1E24 A;  4A3E G;  3CW2 C;  1WYD A;  4YCU A;  2A19 A;  4TVA B;  4OO1 G;  2UUA Q;  4HIK A;  3PGZ A;  2ZJQ A;  1MKH A;  4A3J H;  2KBN A;  1VQM A;  3RZO H;  3RN5 A;  2VUM H;  5IP9 G;  1PH9 A;  3JAM i;  1PH3 A;  3STB C;  3M9B A;  1D7Q A;  2AKW B;  5J3B A;  4QJF A;  4DV4 Q;  1KHI A;  5M3F H;  3IRB A;  1MJC A;  4MNO A;  2ES2 A;  1X3E A;  4BBS G;  2MFI A;  4A3L H;  5IYB H;  4R4Q A;  5LMN L;  5C4J H;  3J80 c;  2WAQ G;  1SMX A;  4UY8 C;  3A74 A;  3NBH B;  1UWV A;  3UDG A;  3NEL A;  2ASB A;  3GTQ H;  2BH2 A;  1YHA A;  1L1O B;  2R7F A;  2WB1 E;  3F2C A;  1BBW A;  4HID A;  1IBL L;  4JI3 Q;  4GN4 B;  1Q7Y C;  4X62 Q;  4PZ8 A;  2RHQ B;  3S16 H;  1KXL A;  1A63 A;  4DAY B;  5BR8 Q;  1HH2 P;  3H3V H;  2E8G A;  3KDF A;  3STB D;  4R4C A;  2ZM6 L;  4GLV B;  3S1Q H;  3GTM H;  4K0K Q;  1YEZ A;  4KHZ A;  4X65 L;  2GVA A;  4L5R C;  1XMQ L;  2UUB Q;  4JI6 L;  2MO1 A;  4GS3 A;  4IOC A;  1VQL A;  4LNQ A;  2Q2U A;  5C0X I;  2NVX H;  4OWW B;  1G6P A;  4NXN Q;  4JCV E;  1VCI A;  3HOW H;  3PUY A;  4IJH A;  4C3H H;  4NB3 A;  3PIO A;  4HJ9 A;  1PH4 A;  2JA5 H;  2A1A A;  2A8V A;  1EFW A;  1CSQ A;  3J80 i;  3S1R H;  3TS2 A;  2E2H H;  4LWC A;  4JI8 L;  1P8L A;  5GRO A;  3GTK H;  1NE3 A;  2K5H A;  1Z47 A;  3H15 A;  2JK8 A;  1X55 A;  1OTC A;  1IBM Q;  3M85 A;  2B29 A;  4NXM Q;  5FJ8 H;  4DR5 L;  3RLF A;  1C0A A;  4DR3 L;  4OON A;  4A76 A;  3CC2 A;  3HOZ G;  2WB1 G;  3CCS A;  4AQY L;  1YJN A;  1Y1V G;  2AWN A;  4DNI A;  3E0E A;  4GKK Q;  4IFD I;  2D0O A;  4JI5 L;  4X66 Q;  3HKZ E;  2VQF L;  4BBS H;  2LSS A;  4L5S A;  1J5E L;  5K36 G;  2FXQ A;  4A3I H;  1Y1W G;  5C3E H;  4RMF A;  4C3J H;  3PF5 A;  2GN5 A;  1E7Z A;  3NEM A;  4JBK A;  1UE7 A;  4A4I A;  4HJ8 A;  3AQQ A;  4H02 A;  5GAE C;  3M4Q A;  4EX5 A;  4MZ9 A;  3BZK A;  1KRS A;  1ASY A;  3PUW A;  3D0F A;  4UP7 A;  1VQ5 A;  3HOW G;  1V43 A;  1N32 L;  3PO2 H;  5GAD C;  4YY3 L;  4R4T A;  5LMN W;  4GNX C;  1XMO Q;  1LUZ A;  1EIF A;  2VS1 A;  1VQ6 A;  5IYD G;  5FLM H;  3GTG H;  2E2I H;  2RF4 A;  2BA0 A;  2MO0 A;  1VQB A;  4DR3 Q;  1XNR Q;  3AEV A;  2K75 A;  4DV7 L;  3GTO H;  2R6G A;  1WI5 A;  3GDE A;  4P73 A; 
#chains in the Genus database with same CATH topology
 4PZ6 A;  4BBR G;  4ZKC B;  1SE4 A;  4DL4 A;  3HOZ H;  4RKB A;  1SAP A;  3T5K A;  3H4D A;  4GC7 A;  1QCB D;  5I4D A;  1JJC B;  3Q8P B;  3EBE A;  4O2D A;  2NVY A;  4JI5 H;  4IAL A;  2K33 A;  4CKC A;  1RL2 A;  1H9S B;  4A2A A;  3KOJ A;  5FO9 B;  1H9M A;  2CQO A;  2JA6 G;  3I56 A;  2W71 A;  4KJN A;  1PVO A;  5K2M A;  4KK7 A;  2C35 B;  3IFT A;  3Q0A A;  1STG A;  4QWB A;  3I2Z A;  3PW2 A;  5JEA G;  5C0X H;  1S5B D;  1Z9F A;  5IYD H;  4LFA H;  3NSW A;  3FVQ A;  2KEN A;  2HHH H;  5GQO A;  1TWG B;  3ERS X;  4QIW A;  3OMC A;  3I70 A;  1HNX Q;  1VQE A;  2QDB A;  3D3R A;  5KND A;  1DV2 A;  3RMH A;  2N49 A;  4LFA L;  1TWF A;  5I9O A;  4C3I B;  1O80 A;  1PFN A;  4KI0 A;  2EXZ A;  4K5X A;  4FF4 A;  3J7A K;  2AMC B;  2EXD A;  1HQR D;  4K0K L;  4RA8 A;  3M4I A;  1JWM D;  3PUV A;  2WB1 A;  2EYL A;  4DR6 Q;  2DIK A;  3QZ7 A;  5E1F A;  5AJ3 Q;  4L63 B;  4UP9 A;  3RZO B;  1K0R A;  2NTS A;  2NVQ B;  5JVG 3;  2R6F A;  1A63 A;  1Q86 C;  2PNH A;  3M7N A;  3K81 C;  1NY4 A;  2K14 A;  3LGJ A;  4GLA C;  2OTJ A;  2UXD H;  4RNM A;  3T53 B;  5CBE E;  4X66 H;  2R7Z H;  4XQJ A;  2NU8 B;  3PF4 A;  2AGO A;  2XIG A;  5J2U F;  4RB2 C;  3HOV B;  3MZ5 A;  2NZ1 D;  1JJ2 A;  3S14 H;  2W8L A;  3MWM A;  2KHI A;  4OIJ A;  4IPH A;  1UEA B;  2AQ1 B;  4PZ7 A;  2ZJT A;  1SFO A;  2L9H A;  4JG2 A;  4A3F H;  1L0X B;  2UU9 H;  4B3R L;  4BY7 G;  2DN8 A;  1WH2 A;  3KAL A;  1B3A A;  2G9H D;  1V1P B;  5ELB A;  4ZUJ A;  5KT2 A;  3NUC A;  4K2L A;  4ED6 A;  3S2D H;  1IBK Q;  1N33 Q;  3JRW A;  1B04 A;  5C4X G;  5IYZ F;  1K83 B;  2WB1 B;  1SYF A;  4LF4 H;  4A93 G;  1ZKO A;  1ICW A;  2I8C A;  2K03 A;  4JK1 C;  1N32 H;  3ICE A;  3HOY G;  1I50 B;  1PMR A;  3I91 A;  1IBK H;  1N33 H;  1U4L A;  3GTM B;  1I6U A;  2AHO B;  2RDH A;  4O4H F;  4NW2 A;  2Q8R E;  2B63 H;  3BJU A;  4R4O A;  4JI8 H;  5KFM A;  5KFJ A;  2XSC A;  1AE2 A;  3PR4 A;  3CP0 A;  5C3E B;  4BY1 G;  1PTO H;  1E2W A;  1SBB B;  3GO5 A;  1HRJ A;  1B6R A;  1GKH A;  4HJA A;  5I9P A;  2SEB D;  2OH2 A;  1B6S A;  5KG4 A;  5LL6 b;  1G51 A;  4YHH H;  2W6Q A;  1Q82 C;  4ZKB B;  1SMY D;  1K8O A;  4I50 F;  1QOH A;  2L5T A;  2PW7 A;  5A35 A;  1KDB A;  3RZD B;  5HY6 A;  4CBV A;  3TIG A;  2EPB A;  3ND8 A;  3JAM E;  1JWU D;  3ZJY C;  3IL8 A;  1CFM A;  3WDN A;  2K5V A;  5IY0 A;  2UU9 L;  4DL7 A;  4APV A;  5M3F G;  2R7M A;  1RIP A;  4F8M A;  3HS0 C;  4EBE A;  1GUG A;  1S5F D;  2HCC A;  1SNQ A;  4DV6 Q;  4MV4 A;  3ETJ A;  4QB4 A;  5KX5 F;  2KCM A;  3F8T A;  3HBL A;  1HZ9 A;  1EQT A;  3I55 A;  4A3K H;  5FD5 A;  4DUZ L;  1HXY D;  4OO1 H;  2BR0 A;  2W6M A;  5L37 A;  4OX9 Q;  5CV7 A;  4A3J G;  5EPK A;  1NTG A;  4DV7 H;  4A3J B;  5IP9 H;  3CCL A;  3I73 A;  4CJ0 B;  4GLX A;  1QVG A;  2GLT A;  5IGF A;  2F0V A;  3H6M A;  2OCE A;  5CA0 F;  4QWE A;  1VQD A;  3VYS A;  2E5L L;  2HIX A;  4PMW A;  4EEY A;  1IYU A;  3PIP 3;  2ASJ A;  1R4P B;  4JI0 L;  1D5X C;  2FLP A;  2QK4 A;  1M1K C;  2J7Z A;  2H5X A;  2GA4 B;  2OT2 A;  5KG0 A;  4EG0 A;  3S16 B;  4K0K H;  4U67 3;  1EY5 A;  2QGQ A;  4ECT A;  3ULJ A;  2F0H A;  1SNM A;  4O1N A;  4EQO A;  2JSO A;  1EOV A;  2A6H D;  1BNZ A;  2R87 A;  4KD3 A;  2ASL A;  1S9F A;  1GHK A;  1K28 A;  1ZHQ A;  3EFX D;  4QMG A;  2F0L A;  2MNA A;  5JPN C;  5JJK A;  1PFS A;  5K36 H;  3RAQ A;  4LSA A;  3BVZ A;  4L6T B;  5DNF A;  1K8G A;  2FK3 A;  2MGS A;  4LFC L;  3FP9 A;  1UNS A;  2I0Q A;  1HNW H;  2WE6 A;  3UQ8 A;  4V0B A;  1E1O A;  2B2T C;  2OTL A;  1G91 A;  3I12 A;  5DG8 A;  5FO8 B;  4QWA A;  1HR0 H;  4RGM A;  1JCK B;  1Q8K A;  3L0O A;  3E5N A;  3GTO A;  2VUM B;  4JV2 A;  1SYB A;  2I87 A;  1L0Y B;  1TY0 A;  1BF4 A;  3GID A;  3BU2 A;  4C5C A;  3PO3 G;  1EUC B;  5KFY A;  2R92 H;  3K5I A;  5EWE A;  4NDX A;  3K57 A;  4A3M H;  2FLN A;  4IR9 A;  3NK9 A;  3SGI A;  2O5I C;  1KJJ A;  2HIV A;  1ZET A;  2G9D A;  1JC7 A;  2BDN A;  1GSO A;  1L2Z A;  1ZYR C;  4CDF C;  4MTK A;  2ATL A;  1N34 Q;  1MIU A;  3S1Q B;  3EPG A;  2C2R A;  4J9Q A;  1E1T A;  2NBF A;  4YJ2 F;  1TAE A;  1WD1 A;  2K52 A;  3RB6 A;  4IWY A;  1JB7 A;  1KAA A;  2BQ3 A;  4IJL A;  1K83 A;  1CA5 A;  1E2V A;  3CCV A;  5DLF A;  1ZEQ X;  3H3V I;  2YTV A;  2Z6B A;  4Q5V A;  4A3E H;  1KAB A;  4RNO A;  2A5H A;  2AUJ D;  3T56 B;  4FF2 A;  2V58 A;  2R85 A;  1VQH A;  5KT6 A;  1F9R A;  4DR4 Q;  1U5K A;  3RAX A;  2IT1 A;  2CWP A;  1HZB A;  4NKL A;  3DF7 A;  5C3W A;  2VY3 A;  2R3Z A;  4EGV A;  5J39 A;  3GIK A;  1OXS C;  1XMO L;  2TSS A;  1OXU A;  2F0P A;  1NMG A;  4Q8F A;  1WJJ A;  3K0X A;  2F0S A;  4IO9 A;  1F2M A;  1FJG H;  3MJF A;  3W5O A;  5ELN A;  3O13 A;  1YIT A;  4BA1 I;  2VW9 A;  4JBM A;  2IA6 A;  3TN2 A;  2B63 B;  3NE5 B;  4K6L A;  5IYC H;  2F4V L;  2VQF H;  4KHP Q;  2Z1C A;  4FVM A;  5M3M G;  4IAJ A;  5E3F A;  5M5W H;  1EOT A;  1LTG D;  4X65 H;  4YY3 Q;  3GQB A;  1VQI A;  1BXR A;  5KFT A;  4UCO A;  2JA7 A;  3WO0 A;  1PLF A;  4BXX G;  1GUW A;  4IRD A;  2RQX A;  4IZO A;  1KBL A;  1HQM C;  5KYL A;  1GLV A;  1N9W A;  2K5W A;  1A3U A;  3HKZ G;  2KHS A;  2L1B A;  3QB3 A;  1S5D D;  4B3M Q;  3GTG A;  1PRT F;  3MWY W;  5JVH 3;  2UXD Q;  3JZI A;  1UE6 A;  2FMC A;  1CA6 A;  1A6X A;  2Y0S E;  4A3D G;  5DAU A;  4RUA A;  2JN4 A;  2HCI A;  1JT8 A;  1UNN C;  2UVU A;  2KUM A;  5KFS A;  1RHP A;  4A3K B;  2G5D A;  2NVX B;  4LJZ C;  5EBD A;  4G7O C;  2A69 D;  5G3L D;  4HIM A;  2FP4 B;  5CB4 F;  3TZD A;  3R23 A;  3T1H L;  4WOR A;  3VYT A;  4F88 A;  2WAQ A;  1YBY A;  3PIP A;  1KL9 A;  3QO2 A;  4M1U B;  5FLX W;  4LUO A;  2VZA A;  5LA6 F;  5EWG A;  2R7K A;  3W1G A;  2RSN A;  4QWD A;  2F0N A;  2W9A A;  5F9N A;  5FLM G;  4YP3 A;  1J5E Q;  4MV9 A;  1C8C A;  1KJQ A;  1F77 A;  3KF6 A;  2JJQ A;  3J7A 5;  5IGD A;  3PO3 B;  5KT3 A;  2H4O A;  3C1E A;  4DLK A;  2OXP A;  4JI1 H;  4ME3 A;  3OHX C;  3OWE B;  2VB3 X;  3H4B A;  2FHT A;  5KGU A;  5LMN Q;  4I7H A;  4HSP A;  1D2B A;  4QCL A;  2EY2 A;  2RDI A;  4C2M H;  4UCR A;  1V51 A;  1DM0 B;  2EYP A;  5C6A A;  2M00 A;  2RDJ A;  1V1Q A;  2F3W A;  3QZ8 A;  3H94 A;  2RDG A;  1SYE A;  3ITP A;  3TRE A;  4C1N I;  1PTO D;  2FMA A;  2JA5 A;  3SK8 A;  2CCZ A;  3A55 A;  2UVW A;  4KJO A;  4QIW E;  4QUF A;  3MFI A;  4DK3 C;  4AYB A;  2JA6 H;  2HT1 A;  2Y0S G;  1TWF B;  1HA6 A;  1GSA A;  3HFZ B;  3U9S A;  4K5W A;  3PW5 A;  4DK6 C;  1DIK A;  4DAV A;  4PMB A;  3S15 H;  1S68 A;  1AFP A;  1XWE A;  1BUV T;  2BOS A;  3CRK C;  3D8G A;  1CQF A;  4YWM A;  3J81 j;  4DV0 H;  2WKD A;  1VQP A;  3V6K A;  1CZW A;  4GC6 A;  2PMZ A;  3CRL C;  1LTT D;  2R8K A;  2A19 A;  2A74 C;  5M5W B;  4OO1 G;  2UUA Q;  4ECV A;  4DUZ H;  4CGY B;  4J9P A;  1WTW A;  4A3J H;  2EY6 A;  2KBN A;  4O4L F;  5KG5 A;  1IBL H;  2EYF A;  5IP9 G;  1JE4 A;  3LWU A;  1D7Q A;  3NHH A;  4XQQ A;  2ICI A;  2KCC A;  4ME5 A;  5IYB H;  5C4J H;  3J80 c;  2C00 A;  1SMX A;  3A74 A;  3NBH B;  4ZRZ A;  3UDG A;  4O3N A;  1PXU A;  3F2C A;  1BOS A;  4E6I A;  4HID A;  4L1K A;  3J80 L;  1Q7Y C;  4F4W A;  4DR6 H;  4X62 Q;  3S16 H;  1KXL A;  4HR7 B;  2NYZ D;  4CJ2 C;  4DAY B;  4F87 A;  5D3I B;  3H3V H;  3STB D;  4K0K Q;  2ZM6 L;  4GLV B;  1YEZ A;  3RB3 A;  1QB5 D;  2DJG C;  1VQL A;  2Q2U A;  1G6P A;  4BY1 B;  5DM6 3;  4F50 A;  1PFM A;  4IHJ F;  2A1A A;  4FYD A;  2O5J C;  1TT2 A;  5CV9 A;  1EFW A;  2HD3 A;  2UXB H;  5FK9 C;  1NR2 A;  4JI8 L;  1I3Q A;  2FK2 A;  3GTK H;  2KEE A;  3HKZ A;  2K5H A;  3NTI A;  2JK8 A;  2NUC A;  5HBR B;  3UFX B;  1IBM Q;  2B29 A;  5FJ8 H;  3GIM A;  4A76 A;  1LO5 D;  1EWC A;  5EPJ A;  3CCS A;  1RK6 A;  5ELF A;  5JUM A;  4DNI A;  4RNN A;  2TMP A;  1FNW A;  4H7B A;  5EKK A;  4X66 Q;  3FPP A;  4MHE A;  1QNU A;  3SK6 A;  2BCO A;  4A3M B;  2XD4 A;  4J9R A;  3GTP B;  2FXQ A;  4A3I H;  4BWS C;  3NPP A;  1E7Z A;  3NEM A;  4KY7 A;  2QEJ C;  2A6E D;  1UE7 A;  2PZW A;  4A4I A;  3K58 A;  4HJ8 A;  4H02 A;  4QW9 A;  2JXM B;  1ENF A;  2QDL A;  5NUC A;  3MWD A;  1VQ5 A;  4UP7 A;  3SE7 A;  4J6H A;  3PO2 H;  4C3H G;  4DL2 A;  2F0I A;  1XMO Q;  2VS1 A;  3MEH A;  4QW8 A;  2XCA A;  1JX4 A;  1VBG A;  3K3P A;  3I4N B;  1XNR Q;  3GTO H;  4O3P A;  1VQB A;  4DR3 Q;  3AEV A;  2K75 A;  4YBZ B;  4DR2 Q;  1WI5 A;  1ESF A;  1SNO A;  4P73 A;  5EWF A;  3Q22 A;  4O4I F;  1Y1W B;  4DF7 A;  3EPI A;  3P75 A;  2JEF A;  2F4V Q;  5IP7 G;  1HNZ H;  4KKT A;  4CC6 A;  4DR3 H;  3V6H A;  3RB4 A;  4ZOL F;  2IX1 A;  4IFD G;  1WD0 A;  2W70 A;  3EJI A;  1K1Q A;  1EYC A;  2K4K A;  3TQY A;  1I6V C;  1CSP A;  4DUY Q;  1DCZ A;  2Q2H A;  3IAY A;  3G71 A;  2YYZ A;  2YZG A;  3T16 A;  3KLW A;  4H0L C;  1VQ9 A;  2VQF Q;  2CH4 A;  3R2T A;  2UXD L;  3F2B A;  4TQU S;  2E5L Q;  1X6O A;  3QWN A;  4IFD J;  4ID6 A;  3N6X A;  3J81 E;  1I4Q A;  2JEJ A;  3A5U A;  5C1P A;  3Q8D A;  3NP8 A;  3R8B A;  4UPA A;  2JA6 B;  1E2Z A;  2VUG A;  2X0S A;  1Q8I A;  1Y8N B;  3VYR A;  3TRZ A;  5BR8 H;  3MC0 B;  1JOO A;  2K50 A;  2A68 D;  2KCN A;  2VA3 A;  2UVV A;  4DXG A;  1OO9 B;  1TA8 A;  4YAK B;  2DWC A;  5DG9 A;  4JI3 L;  2YS7 A;  1RYR A;  2B8F A;  2EDG A;  3K0Y A;  2BH8 A;  1F2L A;  1BVS A;  2KVM A;  1X3F A;  5JEA J;  1QZH A;  1HJP A;  2XCP A;  4CKB A;  4TV8 F;  1KEE A;  4F4Z A;  3TP6 A;  2W9B A;  4JI6 Q;  1IL8 A;  1IYJ B;  5C1O A;  2V4R A;  1B9N A;  4RKL A;  4JW0 A;  2R93 H;  1OXT A;  4K5V A;  2UUC L;  4DV0 L;  4DR1 H;  2N78 A;  3PVX A;  3FHW A;  1JDE A;  5EQ0 A;  2FFK B;  4F7X A;  1XTD A;  4OX9 L;  5KNB A;  1HNW L;  4EQ5 A;  4LK1 C;  1S0M A;  1SR3 A;  1YNJ C;  2LFN A;  4YR3 A;  2B63 A;  2CFM A;  3GTQ A;  3MEF A;  1HR0 Q;  1OWT A;  1KQS A;  4R8I A;  3WNZ A;  4Q45 A;  3DEO A;  4P2C B;  3PO3 H;  2O03 A;  4RGO S;  4DA2 A;  4X3T A;  5M5X B;  2C2E A;  5FLX L;  2K5N A;  3T5L A;  4MV6 A;  4B9W A;  2BE5 D;  3MXN A;  3CCQ A;  2YZN A;  4PQX A;  3RTX A;  1VQG A;  5EBC A;  5CBA E;  5JPM C;  3RV3 A;  1J6Q A;  5KFO A;  4GNX A;  1TS2 A;  5CV4 A;  2E2I B;  1AH9 A;  3IFD A;  3NWS A;  2W7O A;  4ED8 A;  2P5Z X;  1B7Y B;  4UAI A;  3GTK A;  2E74 C;  1FJG Q;  5FD6 A;  2NTT A;  5EAY A;  2R86 A;  2IPK D;  3MTS A;  5L9X A;  4LW1 A;  1VQF A;  4J9L A;  1IOV A;  3RN2 A;  3EYY A;  1EEF D;  5IT9 L;  2KOL A;  1SJE D;  4WJ4 A;  3JSL A;  1A8V A;  5K5P A;  4DV2 H;  4EBC A;  2I5L X;  3PW4 A;  3PSI A;  2VR1 A;  5DGB A;  3QFF A;  4DV3 Q;  1C7Y A;  4TRD A;  4X65 Q;  1I50 A;  4K14 A;  2AWO A;  3BJY A;  3D4W A;  4FDB A;  1LT3 D;  2XWB B;  2NB0 A;  1EY8 A;  2IHF A;  4OWX B;  2Z9H A;  3C1F A;  5KFD A;  3JC6 6;  2E2H B;  1JWS D;  1FNU A;  4AQY H;  2EOT A;  2NVT H;  5KFF A;  1A9X A;  4PG3 A;  3CXC A;  3MXN B;  4HJ5 A;  1TII D;  1NAP A;  1EYA A;  3RR5 A;  1LTL A;  4Y8V B;  4AYB G;  1VMP A;  1C4Q A;  2B2Y C;  4QUC A;  3RGX A;  2YYA A;  1U4R A;  3J81 i;  3C3L A;  2VNU D;  4DV1 H;  4BBS B;  5FLX E;  5IYB G;  1GUO A;  5LHY 1;  4A93 H;  1HNX H;  3I4L A;  3U50 C;  1FD7 D;  1MSG A;  1XPO A;  1C30 A;  1E0B A;  4A3C H;  4LFB Q;  1PZK D;  2FKL A;  5CC4 A;  3FKI G;  2PBZ A;  1JIH A;  1B4O A;  1RK5 A;  4YJ3 F;  3SR1 A;  2Q2T A;  3A8J E;  3BA9 A;  3OIP A;  2M2L A;  2UXC Q;  3CCE A;  3GLK A;  3UE0 A;  2B63 G;  2WAQ B;  4BY1 H;  1Z7T A;  1IKL A;  4LF9 Q;  2JQO A;  1HUM A;  3QR8 A;  2JA5 G;  1XDN A;  2D62 A;  2EY5 A;  4RCO A;  1IOW A;  4MV8 A;  3QOL A;  2PMZ E;  3CPF A;  4N8X 1;  1VQK A;  4TV9 F;  3CCR A;  4DN4 M;  4B3T L;  2NZH A;  2YRX A;  4ECU A;  4IUN A;  2Y0S B;  4KHP L;  3F2U A;  4O2B F;  3OSN A;  2C9O A;  1KNA A;  1JMC A;  1WSC A;  4BBR B;  2RCN A;  2UUA H;  2D9U A;  2CZG A;  1RCV D;  1HPC A;  3T1Y Q;  4YAJ B;  3GD7 A;  4LF6 Q;  3CCU A;  3UDX A;  2UU9 Q;  2L0C A;  5T1I A;  2YCH A;  4A3G H;  1HTL D;  1PH6 A;  4JI2 Q;  3B6Y A;  3FKI H;  4JI7 Q;  4QQB X;  5BR8 L;  2HHH L;  1A0I A;  2K05 A;  4JI4 H;  3PO2 G;  3HZX A;  1GO3 E;  1OXV A;  1SCU B;  2R93 A;  2NU6 B;  2HVQ A;  2Z6K C;  2JA7 G;  5D1O A;  4JOI A;  4X64 H;  1QG7 A;  2KHJ A;  2OEO A;  3EN2 A;  1QWY A;  2E2D C;  4DUY L;  3OSP A;  1VBH A;  5DEH A;  1Y1W H;  4C3J G;  4EFE A;  5ELE A;  2ICE C;  3N44 B;  1STN A;  3BYT B;  3HOZ B;  4LFA Q;  2FIN B;  3TME A;  2R8G A;  1K8M A;  3BQ1 A;  5IP7 H;  2XC9 A;  5KFB A;  1PTO B;  4GZY C;  1U4P A;  1WVL A;  4POG A;  1VF7 A;  1LTI D;  1S72 A;  2W6O A;  4LF7 H;  5CR3 A;  4IWX A;  4LF8 Q;  4J9N A;  1KNE A;  1GHJ A;  1FGB D;  3LX0 A;  3SHL A;  3IKJ A;  2IP4 A;  1CS0 A;  5KFL A;  2HVR A;  1PRT B;  4RAY A;  3S1R B;  4M8A A;  3HOX G;  1G29 1;  5AJ3 L;  1V9P A;  1DZ1 A;  2W6Z A;  2ZDG A;  2K1B A;  5I2X A;  4HR7 A;  1JLL B;  3E9I A;  3TDQ A;  3HGB A;  4DU9 A;  4DR5 Q;  5T1G A;  1BXT A;  4IPG A;  3Q2O A;  4O2A F;  3TIN A;  3AB9 A;  5KT7 A;  2Z0S A;  4A3B G;  2IWH A;  5E4W C;  4B3S L;  1W3S A;  1I94 L;  5IGB A;  4ZI7 F;  2F0F A;  3KF8 B;  3S14 B;  3IN5 A;  4X62 L;  2QW7 A;  2R92 G;  4KD4 A;  1X3G A;  2Q8I B;  4YHH L;  3DXJ C;  4P74 A;  1DJR D;  1GVP A;  3GTJ H;  1QVF A;  1GUS A;  4A3F B;  1CQI B;  4TQR A;  4J9K A;  3FMA A;  2I5M X;  4IPC A;  2QF7 A;  3NGD A;  4IQZ A;  3M9O B;  5C5M A;  2W9C A;  1LM0 A;  3E9H A;  1M7J A;  2R8I A;  1T3N A;  1XXG A;  4IUT A;  2CVR A;  4P72 A;  3D6W A;  2D0P A;  2NVT B;  4DR4 L;  3A7L A;  5BPF A;  4RH6 A;  1IBK L;  1N33 L;  2A6H C;  1SFO H;  2QKI C;  3ERQ A;  1I4G A;  2EJG C;  1CKO A;  1IBM L;  2X6L A;  3PUZ A;  3U4V A;  4JI1 L;  2QCP X;  1I50 H;  2XWJ B;  4HSV A;  4I55 F;  4O3O A;  3GV7 B;  2E76 C;  3VR2 A;  3VPB A;  4JI7 H;  3L9A X;  5EGT A;  4GOP B;  5J1Z A;  2ALY B;  1EY4 A;  3CMA A;  3OTO L;  2OWO A;  4ED0 A;  1T5E A;  2BQR A;  1E4E A;  1TS3 A;  2B2U A;  1L2F A;  4OXP A;  4PNY A;  3X3M A;  2R82 A;  2K6A A;  4FU0 A;  1AE3 A;  3AMU A;  1PA6 A;  3VR4 A;  1XNR H;  2CQA A;  1GOZ A;  2EZV A;  4TUY F;  3G6V A;  2SNS A;  2F0K A;  5D65 A;  3HOW B;  2IY5 B;  5C3E G;  1KJ8 A;  2FK1 A;  3JRX A;  4N9T A;  3TEH B;  1ML0 D;  1YVC A;  2R7D A;  1SLJ A;  3R2I A;  3RZD H;  1ULZ A;  1PX2 A;  1YNN D;  3UI2 A;  1ZQ7 A;  2PYK A;  4KY5 A;  3I72 A;  3HOY B;  2ALZ A;  2LKV A;  3PIO 3;  2DPI A;  1MI2 A;  4DR2 L;  5LMU L;  2VPQ A;  2ENB A;  3GTL B;  1EWI A;  4XTC S;  1RD9 D;  4I65 A;  4DL5 A;  3SE0 A;  1YI2 A;  4LAA A;  5IGE A;  4ECY A;  1CI3 M;  4KLK A;  1I4X A;  1J9O A;  2EYO A;  4BBR H;  1I3Q H;  1P16 A;  3NTH A;  4XX0 B;  3LWB A;  4Y52 H;  3PR5 B;  4C3J B;  1TKW B;  2B2Y A;  4J1M A;  4RHS A;  2VUM G;  2DLN A;  2E5L H;  2PW5 A;  3S24 A;  1EIG A;  4IFD H;  1SXT A;  3MFH A;  1IBL Q;  4AIM A;  1O78 A;  1X3P A;  2PMZ B;  2XGP A;  1H9S A;  4WFN 3;  1FGU A;  5FKA C;  4Q0F A;  4O0A A;  1VAJ A;  1SNC A;  2RGV A;  4KV6 A;  2YU9 H;  2AQ4 A;  4GOP A;  5C4H A;  5LYJ F;  1VQA A;  4GKJ L;  3R93 A;  4DV5 L;  1VQJ A;  2B8G A;  3EIV A;  4R8N A;  4LFC H;  3GIL A;  4LF9 L;  3S2H H;  4ECR A;  2LMC B;  1TR5 A;  2KJX A;  1YNX A;  2L55 A;  4G57 A;  1K3R A;  2Z8L A;  2LXJ A;  3VDY A;  2AQ3 B;  1MJE A;  4FXD A;  1SYD A;  2FE3 A;  2R7N A;  1RKN A;  3CW2 C;  5GON F;  2E2I A;  1RTO A;  1WYD A;  4YCU A;  2XVS A;  3Q8S B;  4TVA B;  3VR5 A;  1ILP A;  5LMN H;  1I94 H;  1LTA D;  3PGZ A;  4OEM B;  4YIJ A;  1MKH A;  3A7A B;  3URY A;  3BAA A;  2PZT A;  1N34 H;  3OHB A;  1PH9 A;  3JAM i;  2PO4 A;  3M9B A;  3KTM A;  5J3B A;  3MWE A;  3K5O A;  1KHI A;  4ZK9 B;  3M4O B;  1MJC A;  1HA5 A;  4LF5 H;  2XGQ A;  4R4Q A;  5LMN L;  4G3I A;  2WAQ G;  2R92 B;  4DV6 H;  2NVY B;  5DLG A;  3NEL A;  3KHR A;  2BH2 A;  1YHA A;  2R7F A;  1ET9 A;  5CAE B;  1G2T A;  2YZM A;  2HUG A;  4PZ8 A;  5KKN B;  5KG7 A;  1F9S A;  3M9N B;  3A8I E;  4C1N K;  2BQU A;  5BR8 Q;  1HH2 P;  1FYC A;  2E8G A;  4DR4 H;  2MP1 A;  4CDC C;  4ZAI A;  2F03 A;  5LP6 F;  1S03 G;  5C0X I;  2NVX H;  5KFA A;  3HOW H;  5IOC A;  1EYZ A;  3V4Z A;  3Q6S A;  1LTR D;  3ORQ A;  2X69 A;  5A2Q L;  3IG0 A;  4IR1 A;  1CSQ A;  1IW7 C;  1VF5 C;  4IN3 A;  3N8D A;  5GRO A;  4LMQ D;  4CKE A;  1DXM A;  1UC8 A;  1HHV A;  4QF4 A;  4ECX A;  4IUV A;  1KLG D;  1EFI D;  1OTC A;  1Y69 U;  3RLF A;  1C0A A;  3E3X A;  2M9V A;  1M0W A;  5J22 A;  2WB1 G;  2C2D A;  2L11 A;  1BCP F;  4RZQ A;  5LL6 S;  3BVM A;  1TWA B;  3ETH A;  3D6C A;  3GQC A;  1ILQ A;  2LSS A;  1TU2 B;  4DFA A;  5C5J A;  2E2H A;  3KHL A;  1WCM A;  4C3J H;  3PF5 A;  2GN5 A;  4JBK A;  1EY0 A;  4JV1 A;  1NCV A;  3M4Q A;  1GJX A;  2GPS A;  4O42 A;  2HVS A;  2WYO A;  3BZK A;  1O7L A;  1ASY A;  1S4Z A;  3D0F A;  1N32 L;  4ED7 A;  4F4X A;  4YY3 L;  5LMN W;  5C5L A;  2UVR A;  4H13 C;  2VA2 A;  1LT4 D;  1EY9 A;  5IYD G;  5BN5 A;  2A6E C;  4J0M A;  4AQY L;  4B9X A;  1UC9 A;  4UDU C;  2L15 A;  3U9O A;  1CHQ D;  4LF5 Q;  4MAM A;  1TWC B;  2GVB A;  1EY7 A;  5EZY F;  3S15 B;  2V59 A;  3KLR A;  5L1I A;  5I6W A;  1KRT A;  4HIO A;  3HXL A;  1JXL A;  1V1O A;  2XRQ D;  5IT9 E;  1Y1W A;  5A2Q W;  3A0J A;  2B2U C;  4LFB L;  1BBU A;  1JKJ B;  1TWH A;  4HCE A;  2CKZ B;  2Q2I A;  1BR9 A;  1I3Q B;  1E22 A;  3GTJ B;  2F52 A;  2GPW A;  4NLG A;  1DYQ A;  3KF8 A;  2K5Q A;  5CMD A;  4L5T A;  4A3K G;  5C44 G;  1LYL A;  1S0O A;  4X66 L;  4JBW A;  1L0W A;  3RB0 A;  1LV9 A;  3RLN A;  1EWH A;  2LXK A;  4O3R A;  4FP5 D;  4LMY A;  1B8A A;  1LTS D;  5CYU A;  1V4Y A;  2NVY H;  2Z6K A;  3T1Y H;  3N52 A;  4O3S A;  3CC4 A;  4DR7 Q;  3ERO A;  5KFW A;  1GUN A;  4BXX H;  4DV4 L;  2W8K A;  1EQR A;  4AYB B;  1WCM H;  1HZA A;  1E4F T;  2PVP A;  1B9M A;  4G7H C;  5KFV A;  2EE1 A;  2A73 B;  2AGP A;  1I4R A;  3MR2 A;  4DUZ Q;  1M4V A;  4QL5 A;  2VXW A;  4J15 A;  4B3T H;  1KIX A;  3AFP A;  2JE6 I;  4A3F G;  3A54 A;  3I90 A;  4JI4 Q;  4J9S A;  4JI0 H;  4A3G B;  1Q12 A;  3FKI B;  2UXB Q;  5I47 A;  4BWG B;  4NXM H;  1A2T A;  2UXC H;  4ED2 A;  5LMU Q;  3CKI B;  3FDS A;  2YU9 A;  5D14 A;  4A3L G;  3GV6 A;  4JI0 Q;  5ISR A;  5C4X H;  4R7R A;  1IXR A;  5HUR A;  2P0A A;  4C2M A;  4A3E B;  4C56 C;  4NXM Q;  2YTX A;  3T4A C;  3I4M G;  4R8U A;  5C44 H;  2UXC L;  1UAP A;  1ROD A;  4YB8 B;  1GYF A;  1D8L A;  3HOY H;  4MA5 A;  4LF6 L;  1EZ6 A;  4ME6 A;  2KA7 A;  4GKK H;  2CW0 C;  4DL6 A;  4RCN A;  2L12 A;  3BA8 A;  3Q8Q B;  5H80 A;  3JAM W;  1MD2 D;  1PH8 A;  3AYH B;  3GTP H;  1GUT A;  2F0O A;  2M05 A;  4H44 C;  4JI2 L;  1V8Q A;  3LWE A;  4JI7 L;  3BQ2 A;  3AFQ A;  1FVI A;  3S1M B;  4DV7 Q;  4JI5 Q;  4GOP C;  5E7N A;  1BO0 A;  1CE8 A;  5HV6 A;  3K7U C;  1AZP A;  4RAZ A;  5H1S E;  5BPH A;  1XMO H;  5IE8 A;  4YWK A;  3RJ0 A;  4XT1 B;  2EJF C;  1Y8O B;  3ORR A;  1BQQ T;  2F0J A;  3VPD A;  3CCM A;  2ZTC A;  2XTI A;  3W3A A;  3KF6 B;  3EA6 A;  2Z4I A;  4IUR A;  3Q24 A;  4DV1 Q;  3GTQ B;  4HMJ A;  3HOV G;  3S9W A;  1C9O A;  5LL6 X;  2ZTD A;  3HRZ C;  3DM3 A;  2LY7 A;  4LSX A;  2VUM A;  2N3S A;  2EJM A;  4FS2 A;  4EQN A;  3KLS A;  2JA7 B;  4XYL B;  4ZLT F;  3M4P A;  4HJ7 A;  3RNU A;  3CQZ H;  2HHH Q;  1SJH D;  2W9C B;  1XNQ Q;  5JQW A;  1TWA H;  1EQQ A;  5KFG A;  3TQT A;  3PW0 A;  4YHH Q;  2DNE A;  4RFB A;  5M5Y H;  2IHE A;  2JEA I;  3K59 A;  1N36 Q;  2SDF A;  2JA5 B;  1HNW Q;  2AQ2 B;  1W96 A;  2DGY A;  1PRT D;  3OTO H;  4R1J A;  1JOK A;  1WTX A;  4TKO B;  4DNR B;  4X6A H;  1O7Z A;  4LF8 H;  4JI8 Q;  5C3X A;  1UE1 A;  1A2U A;  1YNJ D;  5L1L A;  1DON A;  2PZU A;  4FS1 A;  3H40 A;  1N36 H;  1PDQ A;  1I94 Q;  3TQ1 A;  1CM9 A;  3OPO A;  1HNZ L;  3M3Y H;  5DGA A;  3OSO A;  5IWA L;  4HYK A;  1X54 A;  4QIW B;  5JH7 F;  5L1J A;  2K5D A;  3M9M B;  3CAM A;  4XIG S;  4IRK A;  4LF8 L;  3HKZ B;  3Q8R B;  2JA8 G;  5J2T F;  2FJZ A;  1A3T A;  1MGS A;  4JV5 H;  1H9K A;  4AYB E;  1ONL A;  4J9M A;  1PTO C;  2QYZ A;  1I5F A;  1QZG A;  2O4X A;  3NTK A;  1TS4 A;  3KYH C;  4HNV A;  4DR2 H;  1DOK A;  1SYX B;  4ULL A;  4DV2 L;  1Y14 B;  1O75 A;  3DHQ A;  3GTP A;  4EGQ A;  4C2M B;  1I4H A;  3CU7 A;  1EY6 A;  2FB9 A;  5M3F B;  2CQY A;  1VS0 A;  1K3B C;  3Q1K A;  1G8Z D;  2YV5 A;  1UEB A;  3UE1 A;  1KJI A;  2J6U A;  1S3O A;  3S17 B;  4X64 Q;  4DR6 L;  4ECZ A;  1GM5 A;  4HNU A;  3KFU A;  1K1S A;  1O7I A;  3G6J B;  3TS0 A;  1YIJ A;  1N32 Q;  5JVD F;  3K80 C;  3VYU A;  1UE5 A;  5KIX A;  1YHB A;  3PMF A;  1NUC A;  3RUZ A;  5IWA H;  3H20 A;  4PWQ A;  4MV1 A;  1K8A C;  1HR0 W;  1CQJ B;  1PFB A;  1AN7 A;  1DD2 A;  4MTN A;  4A3C G;  1DGS A;  1WFQ A;  1NNX A;  1KC7 A;  3OTO Q;  5D3D A;  4ETS A;  5KEE A;  1PH5 A;  1STH A;  2Y0S A;  1TXY A;  3F8N A;  2PQA B;  4B3S H;  2ASD A;  1T94 A;  5C4X B;  5KT5 A;  1BGW A;  1Y1V H;  4FXG C;  3LP8 A;  3H0G H;  4JPB W;  4JUZ A;  2B3G A;  3CQZ B;  5HGQ A;  1B3Q A;  1K0S A;  4DK0 A;  1QVC A;  4IZ8 A;  2RA4 A;  4BA2 I;  3FKI A;  4BS9 A;  5DQH A;  1UUP A;  2WAQ E;  3OW2 A;  1SDF A;  5M5Y B;  4C3I H;  4X3S A;  3G6X A;  3J80 E;  2XGT A;  5EKI A;  3A56 A;  3CCJ A;  3RIZ A;  1LLR D;  5IYC G;  2K28 A;  1JQY D;  2F0T A;  3CHB D;  1W2B A;  3N40 P;  2RVL A;  2J4X A;  4NMZ A;  2I80 A;  4BY7 B;  3NQT A;  4GKK L;  4LF6 H;  1Q1E A;  1WTV A;  5DQG A;  5ELD A;  2YRW A;  2PNR C;  1SN8 A;  2BDO A;  1Z6H A;  2R93 B;  2D2C C;  5GAH C;  1PK8 A;  4DV5 Q;  3NXW A;  2MQH A;  3CF5 A;  4RG1 A;  2ZM6 H;  3CPW A;  2UUC Q;  4RZR A;  3KHH A;  2C22 A;  2R8H A;  2IL8 A;  1TVX A;  1W6J A;  3LML A;  5KFI A;  1YZ6 A;  3J80 W;  3WWV A;  1SEB D;  1PHJ A;  2UXB L;  4K2K A;  1PZI D;  1HR0 L;  4DR1 Q;  4XDX A;  3MR3 A;  4LH7 A;  1SYC A;  1BDO A;  3BYY B;  2JA7 H;  2W9B B;  4EYI B;  4RAU C;  3CQZ A;  1CQV A;  2JA8 B;  1JE5 A;  4G4K A;  1GGO A;  1R4Q B;  1KDC A;  4OO1 I;  4LF4 L;  2J6T A;  4GKJ Q;  4ECW A;  1U4M A;  3WOF A;  1Z2O X;  4X3U A;  1E4G T;  1IW7 D;  1RF2 D;  3T51 B;  2J9G A;  1SRO A;  5KG6 A;  2CW7 A;  1Y1V A;  5KNC A;  3PUX A;  2DY8 A;  2ZT9 C;  4YQW A;  1U0L A;  1CHP D;  2F3V A;  5JJL A;  1EZ8 A;  5BMV F;  1AW7 A;  1K83 H;  2N55 A;  2DNC A;  4APM A;  2NN6 I;  1XPR A;  1F2Y A;  5A2Q E;  3I4N H;  3D4D A;  3GTO B;  1C3O A;  2HDL A;  5I2Y A;  5KFE A;  3I4M H;  1A3V A;  3FEW X;  2H1E A;  4CC5 A;  4J8Q A;  1ZHS A;  4YCV A;  3PN1 A;  1LAB A;  5KFN A;  3V6J A;  1I7N A;  3SVM A;  5EKL A;  1ENA A;  2ZDQ A;  1CKN B;  1NR4 A;  5G3L F;  1VQC A;  3OUU A;  2WAC A;  3G48 A;  5COY A;  2K04 A;  3BDL A;  1K9M C;  2WDT A;  4KN4 C;  4DGZ A;  2QA4 A;  2EYM A;  3C2P A;  4Z9C B;  4KTA A;  1A62 A;  2BE5 C;  4JI2 H;  1D5Z C;  2PI2 E;  1X56 A;  4XQN A;  3JAM c;  3M4Y A;  4JV5 L;  2FPG B;  5CV6 A;  3TP8 A;  3N6R A;  4ZYS A;  4YCW A;  1QE6 A;  3JAM L;  4A75 A;  2W6N A;  1J5E H;  1X65 A;  1T9H A;  4OEL B;  1TWC H;  3MXU A;  5KFX A;  3OWF A;  2CH4 W;  3QOJ A;  2CW0 D;  1Q81 C;  3TZU A;  3QIA A;  3G6E A;  3GIQ A;  2N88 A;  3GTJ A;  2DZD A;  3HOV H;  5BN3 A;  1TWH B;  2K7V A;  1TWG H;  3KK7 A;  4I4T F;  3LNN A;  5DM7 3;  2ID0 A;  5JJZ A;  4M7E A;  1TQO A;  3CVZ A;  4BY7 H;  1B1Z A;  2B2W C;  1I6H B;  3OYY A;  3L3O C;  5KFR A;  2JEB I;  4FBU A;  1RJP A;  4JBJ A;  4HNT A;  3DLL A;  4LF5 L;  1AZQ A;  3F1Z A;  1XNR L;  1BNC A;  3RD4 A;  5IT9 c;  2AU0 A;  1TWG A;  4JYA L;  5ELC A;  3KJO A;  4A3M G;  1VDZ A;  5JJI A;  2JEG A;  4NPS A;  4B3T Q;  4WJW A;  3UDF A;  3M3Y B;  1F9Q A;  4MN3 A;  3ZYY X;  1Y1V B;  4DV2 Q;  1DV1 A;  4EYH B;  1KD1 C;  1CK1 A;  1ASZ A;  4L8J A;  5KFH A;  2EY1 A;  1VKZ A;  1N48 A;  4GN3 B;  1A15 A;  2WFW A;  4Q44 A;  2R8J A;  3PW7 A;  2JA8 H;  1KTK A;  4DKA C;  4FO2 A;  3P1H A;  3K7A H;  2K01 A;  4ECQ A;  3T1Y L;  2WV6 D;  2I46 A;  4TSS A;  4ZQ3 A;  3VPC A;  3I7F A;  2E75 C;  4P71 A;  2E2J B;  4JI4 L;  2UUB L;  1VQ7 A;  1E24 A;  4A3E G;  3RF2 A;  1XYI A;  1AEX A;  4WBN F;  1X3Q A;  1RYS A;  1EZ1 A;  1HFG A;  4HIK A;  2ZJQ A;  1N56 A;  1VQM A;  1SFO B;  3RN5 A;  1KDA A;  2VUM H;  2F0M A;  5C44 B;  4JI3 H;  2IW3 A;  2LS0 1;  4WD3 A;  4X62 H;  5M3F H;  1XNQ H;  4BBS G;  4MNO A;  1X3E A;  4A3L H;  4KKU A;  4B08 A;  1GSH A;  1CTM A;  2F4I A;  1UWV A;  4UCS A;  4RB3 C;  5KRU A;  2ASB A;  2VOB A;  2F4V H;  1L1O B;  1IBL L;  1MHW C;  4JI3 Q;  4GN4 B;  4NP5 A;  4JYA H;  4R4C A;  3S1Q H;  3GTM H;  1TWC A;  4KHZ A;  3MA2 B;  4L5R C;  2WIN B;  1XMQ L;  4JI6 L;  2MO1 A;  4GS3 A;  5LOV F;  4OWW B;  4NXN Q;  1VCI A;  4LF9 H;  4IJH A;  3PIO A;  1PH4 A;  1B53 A;  1II3 A;  2VQD A;  2A8V A;  4PMC A;  1NSN S;  3T13 A;  1BJT A;  4LWC A;  1F2Z A;  4EVO A;  1S5E D;  4U6P A;  1WTO A;  2W7P A;  4QWC A;  1X55 A;  2HDM A;  2RCF A;  5KFQ A;  4ZHQ F;  4DR5 L;  3VMM A;  3CC2 A;  3HOZ G;  2RBM A;  3HOX B;  2AWN A;  2B2V C;  4KMU C;  3E0E A;  4GKK Q;  4IFD I;  4JI5 L;  3RUP A;  5DG7 A;  1JB3 A;  3MFY A;  3HKZ E;  2KEC A;  3KLS X;  4ODG A;  2OF1 A;  4L5S A;  1J5E L;  1Y1W G;  4DR5 H;  3E0J A;  3RGZ A;  1IHZ A;  1R9T A;  3OMG A;  3AQQ A;  5FPO A;  4XXE A;  2RKS A;  3TP5 A;  4KHV A;  5EDW A;  1S5C D;  2B2W A;  5KFP A;  5KFC A;  3I8Z A;  3RBE A;  4CDD C;  1MZB A;  2KQ3 A;  5EJW A;  1VMC A;  2B39 A;  5FLM H;  3GTG H;  4EGJ A;  4X3K A;  3BQ0 A;  2RF4 A;  2MO0 A;  2MUY A;  2CW8 A;  4DV7 L;  1ZYR D;  3PZP A;  3OOC A;  3GDE A;  1STE A;  4GNX B;  2DJF C;  3BG5 A;  3QG1 A;  2MJ8 A;  2IMW P;  4ABN A;  2NU7 B;  3MAQ A;  1HZC A;  2FJ2 A;  3CME A;  4DV3 L;  3U58 A;  1HUN A;  3F2D A;  2NVX A;  3N42 B;  4OL7 A;  1L1O A;  2MCT A;  4HCS A;  1ENC A;  1SE8 A;  4RU9 A;  3G4S A;  1VQ4 A;  1K73 C;  1N8R C;  3T5H A;  3DWA A;  3D4R A;  3ULP A;  4MV7 A;  3KHG A;  2IBK A;  2R84 A;  3L2P A;  1GD7 A;  2A69 C;  4OWT B;  1FNV A;  4DAM A;  3BS1 A;  1J8I A;  1I6H H;  2NZO A;  4RGN A;  3OHA A;  4EEQ A;  1FKA H;  3SI8 A;  3I4O A;  4GKJ H;  2UUA L;  2R7Z G;  1H9R A;  3R5H A;  3G6Y A;  1EIY B;  3HOU G;  1HFN A;  1Q1B A;  3ER0 A;  4JC0 A;  4RGT A;  3V4S A;  1HTP A;  1SRU A;  4B3R Q;  1EIH A;  3K3V A;  4FNF A;  1B70 B;  5CA1 F;  1CUK A;  2ATW A;  2HGS A;  2PN1 A;  2ZTE A;  4JV5 Q;  1BCP D;  1L1O C;  3G7L A;  2HQE A;  4Y7N B;  5IIF A;  1N34 L;  1W93 A;  1QUQ B;  2J0T D;  1WTQ A;  3G8C A;  4DK1 A;  3DMU A;  5M3M H;  1WR2 A;  4AQY Q;  1DOL A;  3TII A;  4EFB A;  1LT6 D;  3KAK A;  2ZJP A;  3NQI A;  1XX8 A;  4X64 L;  4Q8E A;  5M9O A;  4I7A A;  4OX9 H;  1W6K A;  2SNM A;  4J9O A;  3BZC A;  4HN7 A;  2WP8 J;  2SCU B;  1I4P A;  4DAP A;  3I3C A;  3GTL A;  2I5H A;  4RWS C;  2EQS A;  1R9T H;  2XIW A;  4AH6 A;  3H0G B;  1KC8 C;  2YU9 B;  4JI6 H;  2VL6 A;  3T5J A;  4DR7 L;  4UCV A;  1TWF H;  4PV1 C;  3FMC A;  3SK4 A;  3WOE A;  3TP7 A;  4POF A;  1PH1 A;  4C5B A;  1NMF A;  1SEI A;  1SMY C;  2JP1 A;  1WCM G;  2ZXR A;  3BVG A;  1YJW A;  4DV4 H;  3VA5 A;  2J6S A;  3L4J A;  1JJG A;  5D8D A;  4U68 A;  3HKS A;  5FO7 B;  2XNA C;  2B2V A;  3HG9 A;  1EYG A;  2B2T A;  3EVQ A;  4DUY H;  4C3H B;  5IGC A;  5FJ8 G;  5F9L A;  2PQE A;  4LUZ A;  3K5H A;  1B44 D;  2I07 B;  3SDZ A;  3K5M A;  5LMU H;  5KFK A;  2O2L D;  4NXM L;  2FPI B;  2F0Q A;  1ZXT A;  2NN6 H;  2EVB A;  2RHS B;  3MR6 A;  2JA6 A;  3VR3 A;  4RHR A;  3A8K E;  3H09 A;  3J7A F;  1SE3 A;  1GXD C;  4YR0 A;  3DM1 A;  3S1N H;  5L1K A;  4LF7 L;  4RB0 A;  2WTF A;  1EEI D;  3K8A A;  1H95 A;  1B33 N;  1PZJ D;  4DL3 A;  4DR1 L;  2UUC H;  1G2S A;  2EIF A;  2F0G A;  4R9W A;  1JOR A;  5CV8 A;  4V19 0;  2V1C C;  1MSH A;  1RDP D;  3K7A B;  2VQE Q;  4ED3 A;  3BDO A;  3FPU B;  2ZXO A;  1X9N A;  2JEI A;  3BDC A;  2DY7 A;  4OGQ C;  3X3N A;  1S0N A;  2QEX A;  3SEB A;  3K6O A;  3U4Z A;  1SE2 A;  4F4Y A;  1QUQ A;  2OQ0 A;  3T1H Q;  3CD6 A;  2UUB H;  1S97 A;  5IT9 W;  2ZXP A;  3J7Z C;  1D5M C;  3SXH A;  3MVV A;  1CKM A;  1CKN A;  5C4Z A;  3GTG B;  3OIQ A;  3I4M B;  3GII A;  4LFB H;  4YR2 A;  1KLU D;  5AFW A;  3MXG A;  4LFC Q;  3RFC A;  1SYG A;  5JOB A;  3WO1 A;  5DLQ E;  2C5C A;  4IOA A;  1KAW A;  3HEJ A;  3HOU B;  4A3D B;  4LF4 Q;  3GTL H;  3AU7 A;  1XNQ L;  4XZ3 B;  1PYS B;  5KG2 A;  4Y7N H;  1D1K A;  2K32 A;  3K5L A;  1AUV A;  1YNN C;  3GIJ A;  3RBD A;  3TSS A;  4HMI A;  4FF1 A;  1PH2 A;  1V1P A;  4QGU A;  1IL2 A;  4DV1 L;  1F9P A;  2KSW A;  5KFZ A;  1EU3 A;  5ELO A;  1QNK A;  4MV3 A;  1M8A A;  4ZCK A;  1SNP A;  3K5N A;  1EL0 A;  4UCT A;  4MTD A;  2A68 C;  4KHP H;  1EUJ A;  3DWQ A;  3OW7 A;  2D5D A;  5BN4 A;  3U9T A;  1CT1 D;  1PV4 A;  4ALP A;  5D1O B;  1Q46 A;  1T36 A;  5C4J B;  3SK5 A;  3ONA B;  4JI1 Q;  4A2B A;  1S10 A;  3C0F B;  3V05 A;  2FLL A;  4DV0 Q;  2F0D A;  1NJI C;  4EQP A;  1EU4 A;  1WTH A;  2F0W A;  4RUC A;  1TWH H;  2FMM A;  2R61 A;  4B3M H;  5C0X J;  3W2D A;  1AP0 A;  2N8N A;  5IGG A;  1STB A;  3VR6 A;  4HTH A;  1ESR A;  3R3O A;  3S1M H;  3S2H B;  3GV5 B;  4DR7 H;  2L4N A;  4DPG A;  2AGQ A;  2Z4H A;  3PCO B;  3KUP A;  5KG1 A;  3HB9 A;  2YTY A;  2VQE H;  1RTN A;  1CZG A;  4IPD A;  4MTE A;  4DV5 H;  3GTK B;  4K8I A;  5C8Y F;  4O3Q A;  3GP7 A;  3KBX A;  5HGT A;  3J81 L;  4WJ3 M;  1E3P A;  3DWP A;  3KXY T;  4JYA Q;  4XYO A;  3L4K A;  3R5F A;  1M0T A;  3S1N B;  4FM9 A;  1WCM B;  2NVQ H;  1HCZ A;  4MIU A;  5FOB B;  2F3I A;  2ZJR A;  4FF3 A;  1FJG L;  3M4O H;  4U7C A;  1SSO A;  2PI2 A;  3E6Z X;  2PPB C;  4A3I G;  4A3I B;  1IKM A;  1B50 A;  2JYO A;  2MHV A;  4P75 A;  2RDF A;  3CC7 A;  2E2J H;  2SOB A;  4C5A A;  3JSN A;  3KBG A;  1XTC D;  4DAY A;  2DUD A;  2YL2 A;  3H0G A;  3PO2 B;  4ILW A;  4B3M L;  1STA A;  3NBH A;  1TS5 A;  2C28 A;  3D31 A;  1WTR A;  4A3G G;  4Q43 A;  5JVL A;  4HED A;  2IX0 A;  3NEN A;  4WRD A;  3MXP A;  4JV0 A;  3S2D B;  3RV4 A;  4E4T A;  5T14 A;  4A3D H;  4CHT B;  3HOU H;  2HJW A;  2V5A A;  2NWG A;  3J7A V;  1BBX C;  5D1P A;  4UFZ A;  2JA9 A;  3ULL A;  4B3R H;  3R5X A;  1ET6 A;  3H0G G;  2R92 A;  5CV5 A;  2AUK A;  1O7Y A;  1Z2N X;  4Q0Y A;  1IZ6 A;  5IOD A;  4C3I G;  5COR A;  4UHV A;  3HP3 A;  2YW2 A;  4DV6 L;  1PH7 A;  3W1B A;  1RJQ A;  2PQA A;  5FPR A;  1Q90 A;  4CJ1 B;  2CHB D;  1YJ9 A;  4L5Q A;  1XJV A;  5JEA H;  5C0X G;  3S17 H;  5KFU A;  3BG3 A;  3VA7 A;  4K6D A;  3HOX H;  2EYJ A;  1BKB A;  2XRS D;  1XMQ Q;  3L7Z C;  3UDI A;  1EYD A;  1NBW A;  5E4X A;  4ECS A;  4HAE A;  3P20 A;  4A3B H;  1FL0 A;  4KN7 C;  4YWL A;  1RJR A;  1DOM A;  1IBM H;  2VB2 X;  4EBD A;  4XYQ A;  3MHB A;  1ICF B;  1N36 L;  1X32 A;  3NWT A;  3FDT A;  1XPU A;  4NXN H;  2BA1 A;  4OIK A;  1WTP A;  3A5Z B;  2R93 G;  4LF7 Q;  1HNX L;  4S3S A;  3GIP A;  2V4Q A;  1RJT A;  1TY2 A;  5FLX c;  1HNZ Q;  2HQL A;  2XCL A;  5IWA Q;  2V4D A;  1M90 C;  1VQN A;  4IUP A;  4NXN L;  1AN8 A;  4DNT B;  3V96 A;  2IX3 A;  1H9J A;  2Q8T A;  2NN6 G;  2CWA A;  2VQE L;  1PTO F;  4LUV A;  4FBT A;  1U9R A;  1WOC A;  4A93 B;  1I7L A;  1Z2P X;  1EQV A;  2WKC A;  3PV0 A;  1LAC A;  3EQL C;  3J7Y W;  1PYB A;  5F2D A;  1D6E C;  2X6G A;  4R4I A;  3I4N G;  1YHQ A;  3PQI A;  5M5X H;  1QJO A;  1OXX K;  2ZDH A;  2V9W A;  3QJY A;  4JOI C;  1KJ9 A;  3KDF B;  1EHI A;  2W57 A;  1BCP B;  4QY7 A;  1G6Z A;  2FPP B;  1QIL A;  1VQO A;  1D1I A;  2IJ0 A;  2MPM A;  5TSS A;  2R7Z A;  5LXT F;  4UCU A;  2YS6 A;  1MBY A;  4TQS A;  3KAJ A;  3GV3 A;  1C48 A;  3RLO A;  1VQ8 A;  4HQ6 A;  4ED1 A;  2F0E A;  5EPL A;  3NBI A;  5GAG C;  4GN5 A;  1XMQ H;  2OQK A;  2NUA B;  1S40 A;  4G7Z C;  3MR5 A;  2KCT A;  3KJP A;  4XT3 B;  4B3S Q;  3MFG A;  5KT4 A;  4I7Z C;  2XN9 C;  1LT5 D;  5M3M B;  3Q23 A;  2WII B;  2ZM6 Q;  1T5X D;  4UP8 A;  3N43 B;  4KY6 A;  3J81 c;  4IRC A;  1Y8P B;  5I6Y A;  2NU9 B;  4CDE C;  2DPJ A;  1EUD B;  2OLS A;  4LH6 A;  3M7G A;  1R9T B;  3RZO H;  1PH3 A;  3STB C;  2RGR A;  4KKS A;  2AKW B;  4QJF A;  1PYW D;  4DV4 Q;  3IRB A;  2ES2 A;  3TBI B;  2MFI A;  4UY8 C;  2R7Z B;  1TWA A;  3GTQ H;  1E4E B;  2WB1 E;  1BBW A;  2QIL A;  4IUQ A;  2KED A;  4DXF A;  4A3B B;  4XYM B;  1FR3 A;  2RHQ B;  3KDF A;  1STY A;  5KG3 A;  4YY3 H;  4X65 L;  2GVA A;  2PCF B;  2UUB Q;  4IOC A;  4LNQ A;  4OHJ A;  1JOQ A;  4JCV E;  4IUU A;  1JIC A;  4JVZ A;  3PUY A;  4C3H H;  4HJ9 A;  4NB3 A;  4MA0 A;  1Q3L A;  2JA5 H;  1JR0 D;  2R7L A;  1M6V A;  3V2T A;  3J80 i;  1PRT C;  4FXK C;  3S1R H;  3TS2 A;  2E2H H;  1B2T A;  1P8L A;  3E5S A;  1NE3 A;  4M9U A;  1Z47 A;  5CGK A;  5EOY A;  5DQI A;  3H15 A;  4DV3 H;  4K8J A;  3M85 A;  5JAV A;  2W6P A;  3ND9 A;  4DR3 L;  4OON A;  2EYH A;  3OUZ A;  1YJN A;  1Y1V G;  3DEP A;  2F1M A;  2RSO A;  3FRP B;  2D0O A;  4PDB A;  3BZD B;  2VQF L;  4BBS H;  3BAB A;  3GV8 B;  3P7J A;  5K36 G;  3N41 B;  4RB1 A;  1JDB B;  1LTB D;  5C3E H;  4RMF A;  3T1H H;  3J81 W;  1SND A;  5GAE C;  3GTM A;  4EX5 A;  4MZ9 A;  4R8U B;  1KRS A;  4N9P A;  3PUW A;  2F0U A;  3HOW G;  1V43 A;  4ZQI A;  5GAD C;  4N8F A;  1BCP C;  4R4T A;  4ZUI A;  4GNX C;  1VQ6 A;  1LUZ A;  1EIF A;  2VPS A;  3C46 A;  1IYV A;  3H3V C;  5KYI A;  1AUX A;  2E2I H;  2BA0 A;  2R6G A;  3DUZ A;  3H91 A; 
#chains in the Genus database with same CATH homology
 4PZ6 A;  2L15 A;  4LF5 Q;  4BBR G;  2GVB A;  1HZC A;  1KRT A;  3CME A;  4DV3 L;  4HIO A;  3U58 A;  2F4V Q;  3HOZ H;  3F2D A;  5IP7 G;  2IX1 A;  1L1O A;  4IFD G;  1JJC B;  3EBE A;  1SE8 A;  3A0J A;  4LFB L;  4O2D A;  1BBU A;  3G4S A;  1VQ4 A;  1K73 C;  1N8R C;  2CKZ B;  2K4K A;  1RL2 A;  3ULP A;  3TQY A;  2Q2I A;  1CSP A;  1E22 A;  2F52 A;  3L2P A;  1GD7 A;  4DUY Q;  2Q2H A;  4OWT B;  3KOJ A;  4L5T A;  4DAM A;  3G71 A;  2YYZ A;  4A3K G;  5C44 G;  2CQO A;  1LYL A;  2NZO A;  3KLW A;  3I56 A;  2JA6 G;  4X66 L;  1I6H H;  1VQ9 A;  4JBW A;  3I4O A;  1L0W A;  2VQF Q;  3I4M G;  1PVO A;  3RLN A;  2UXD L;  2UUA L;  3F2B A;  2C35 B;  2R7Z G;  4TQU S;  2LXK A;  1X6O A;  1EIY B;  2E5L Q;  3HOU G;  4IFD J;  1B8A A;  3I2Z A;  1Q1B A;  5JEA G;  3ER0 A;  4JC0 A;  2NVY H;  1Z9F A;  5IYD H;  2Z6K A;  1SRU A;  3A5U A;  3CC4 A;  4DR7 Q;  4BXX H;  3Q8D A;  2KEN A;  4DV4 L;  4UPA A;  4B3R Q;  1EQR A;  4DR7 L;  1B70 B;  1HZA A;  1WCM H;  1CUK A;  3TRZ A;  2ATW A;  5GQO A;  3ERS X;  2K50 A;  2ZTE A;  1HNX Q;  1VQE A;  4QL5 A;  4DUZ Q;  4JV5 Q;  4JI3 L;  1L1O C;  4J15 A;  2N49 A;  1KIX A;  3AFP A;  1N34 L;  2JE6 I;  4A3F G;  1QUQ B;  4LFA L;  2BH8 A;  1BVS A;  1QZH A;  1X3F A;  5JEA J;  4JI4 Q;  5M3M H;  1HJP A;  4AQY Q;  4KI0 A;  1Q12 A;  2UXB Q;  2ZJP A;  4JI6 Q;  2AMC B;  4X64 L;  2EXD A;  5LMU Q;  1IYJ B;  3BZC A;  4K0K L;  2WP8 J;  4A3L G;  3PUV A;  4JI0 Q;  4DR6 Q;  5C4X H;  2R93 H;  2I5H A;  1IXR A;  2EQS A;  1OXT A;  5AJ3 Q;  4UP9 A;  4AH6 A;  1R9T H;  4DV0 L;  1K0R A;  2N78 A;  2VL6 A;  4DR2 Q;  1KC8 C;  2UUC L;  1Q86 C;  2YTX A;  1TWF H;  2PNH A;  3FHW A;  1NY4 A;  3K81 C;  5C44 H;  2K14 A;  3LGJ A;  1XTD A;  4OX9 L;  3M7N A;  2UXC L;  4EQ5 A;  4GLA C;  1HNW L;  2OTJ A;  1D8L A;  3HOY H;  4POF A;  4LF6 L;  2R7Z H;  1PH1 A;  1SR3 A;  1NMF A;  3PF4 A;  2CFM A;  1PH8 A;  3AYH B;  3MEF A;  1HR0 Q;  1WCM G;  3GTP H;  1YJW A;  1KQS A;  4JI2 L;  4JI7 L;  1JJ2 A;  3S14 H;  3AFQ A;  2KHI A;  1FVI A;  3PO3 H;  1JJG A;  4IPH A;  3HKS A;  4PZ7 A;  4DV7 Q;  2K5N A;  4JI5 Q;  4GOP C;  4A3F H;  4JG2 A;  1EYG A;  5E7N A;  3CCQ A;  4B3R L;  4BY7 G;  3K7U C;  5H1S E;  5IE8 A;  4YWK A;  5FJ8 G;  1VQG A;  4LUZ A;  1J6Q A;  4GNX A;  4NXM L;  1AH9 A;  3CCM A;  2ZTC A;  2XTI A;  2RHS B;  3S2D H;  1IBK Q;  3KF6 B;  1N33 Q;  1B7Y B;  1FJG Q;  5C4X G;  4DV1 Q;  5EAY A;  3HOV G;  4A93 G;  4LW1 A;  1VQF A;  1C9O A;  3S1N H;  3RN2 A;  2ZTD A;  4LF7 L;  3DM3 A;  2N3S A;  3K8A A;  4WJ4 A;  3ICE A;  1H95 A;  3HOY G;  3M4P A;  1A8V A;  4HJ7 A;  3RNU A;  3CQZ H;  2I5L X;  3PSI A;  2HHH Q;  4DR1 L;  2AHO B;  1XNQ Q;  2EIF A;  4DV3 Q;  1TWA H;  1EQQ A;  4X65 Q;  1C7Y A;  2B63 H;  3BJU A;  4R4O A;  2AWO A;  2V1C C;  4YHH Q;  5M5Y H;  4FDB A;  2IHE A;  1AE2 A;  2VQE Q;  2JEA I;  3CP0 A;  1N36 Q;  2IHF A;  4OWX B;  4BY1 G;  1HNW Q;  1X9N A;  3GO5 A;  2DGY A;  1GKH A;  3JC6 6;  4R1J A;  4HJA A;  4X6A H;  2NVT H;  2QEX A;  1G51 A;  4JI8 Q;  4PG3 A;  3CXC A;  3U4Z A;  1UE1 A;  1Q82 C;  1QUQ A;  2OQ0 A;  3T1H Q;  3CD6 A;  3MXN B;  4HJ5 A;  1I94 Q;  3J7Z C;  3RR5 A;  1HNZ L;  1LTL A;  5HY6 A;  3M3Y H;  1CKM A;  4AYB G;  1CKN A;  3ZJY C;  5IWA L;  2UU9 L;  1X54 A;  2K5V A;  5IY0 A;  3CAM A;  4APV A;  3J81 i;  4XIG S;  4LFC Q;  5M3F G;  4LF8 L;  1RIP A;  5DLQ E;  2JA8 G;  1KAW A;  4IOA A;  2VNU D;  5IYB G;  4LF4 Q;  3GTL H;  4A93 H;  1XNQ L;  4AYB E;  4DV6 Q;  1PYS B;  3U50 C;  4Y7N H;  1XPO A;  1I5F A;  1QZG A;  4A3C H;  2KCM A;  3F8T A;  1HZ9 A;  3I55 A;  4LFB Q;  3KYH C;  4GNX B;  3FKI G;  4A3K H;  1PH2 A;  4DUZ L;  2Q2T A;  4DV2 L;  4QGU A;  1IL2 A;  1Y14 B;  4DV1 L;  4OX9 Q;  2UXC Q;  3CCE A;  4A3J G;  5ELO A;  3UE0 A;  1NTG A;  5IP9 H;  3CCL A;  1QVG A;  4GLX A;  2B63 G;  4BY1 H;  1EUJ A;  4LF9 Q;  2JQO A;  2OCE A;  2JA5 G;  1VQD A;  1PV4 A;  4ALP A;  2D62 A;  1VS0 A;  2E5L L;  1Q46 A;  2HIX A;  4PMW A;  2PMZ E;  1UEB A;  2YV5 A;  3CPF A;  3UE1 A;  1VQK A;  4JI1 Q;  1S3O A;  4JI0 L;  4X64 Q;  4DR6 L;  3CCR A;  4B3T L;  2NZH A;  1M1K C;  4DV0 Q;  2H5X A;  1GM5 A;  1NJI C;  4KHP L;  3KFU A;  1O7I A;  1TWH H;  3TS0 A;  5C0X J;  1YIJ A;  2QGQ A;  1JMC A;  2N8N A;  3ULJ A;  1N32 Q;  2RCN A;  3K80 C;  1EOV A;  1UE5 A;  1YHB A;  3T1Y Q;  3S1M H;  3GD7 A;  2MNA A;  4LF6 Q;  5JJK A;  4DPG A;  1PFS A;  3CCU A;  1K8A C;  3UDX A;  1HR0 W;  2UU9 Q;  3PCO B;  2YTY A;  1K8G A;  4LFC L;  3FP9 A;  4MTN A;  2I0Q A;  4A3C G;  4A3G H;  4IPD A;  1DGS A;  1WFQ A;  4JI2 Q;  3B6Y A;  3FKI H;  1PH6 A;  4JI7 Q;  4QQB X;  1E1O A;  5BR8 L;  3OTO Q;  1PH5 A;  2OTL A;  2HHH L;  1A0I A;  4WJ3 M;  1TXY A;  1Q8K A;  3L0O A;  1E3P A;  2PQA B;  3PO2 G;  1GO3 E;  4JYA Q;  1OXV A;  1Y1V H;  2Z6K C;  3H0G H;  2JA7 G;  2NVQ H;  3M4O H;  4JOI A;  2F3I A;  2ZJR A;  3BU2 A;  1FJG L;  2KHJ A;  3PO3 G;  3EN2 A;  2B3G A;  5HGQ A;  2PI2 A;  2R92 H;  4DUY L;  4A3M H;  1QVC A;  4A3I G;  3SGI A;  1Y1W H;  4BA2 I;  2WAQ E;  2HIV A;  4P75 A;  3OW2 A;  4C3I H;  2XGT A;  3CC7 A;  4LFA Q;  2E2J H;  1N34 Q;  5IP7 H;  3CCJ A;  1MIU A;  5IYC G;  1E1T A;  1W2B A;  2DUD A;  4POG A;  2K52 A;  4GKK L;  1Q1E A;  1S72 A;  4B3M L;  4LF8 Q;  1JB7 A;  1SN8 A;  4IJL A;  3CCV A;  3D31 A;  4A3G G;  3H3V I;  2YTV A;  5GAH C;  4A3E H;  2IX0 A;  4DV5 Q;  3CF5 A;  2MQH A;  1G29 1;  4RG1 A;  1V9P A;  5AJ3 L;  3HOX G;  3NEN A;  1VQH A;  3CPW A;  2UUC Q;  4DR4 Q;  1U5K A;  2IT1 A;  3E9I A;  2CWP A;  4DR5 Q;  1HZB A;  4A3D H;  1YZ6 A;  3HOU H;  4IPG A;  3WWV A;  2VY3 A;  2Z0S A;  1PHJ A;  4A3B G;  4B3S L;  1OXS C;  2UXB L;  1W3S A;  1XMO L;  1I94 L;  2JA9 A;  1OXU A;  3ULL A;  1NMG A;  3KF8 B;  1HR0 L;  4DR1 Q;  1WJJ A;  3K0X A;  4X62 L;  2R92 G;  1X3G A;  3H0G G;  4IO9 A;  2JA7 H;  3W5O A;  4YHH L;  5ELN A;  4P74 A;  1GVP A;  3GTJ H;  1JE5 A;  1YIT A;  1QVF A;  1IZ6 A;  4BA1 I;  2VW9 A;  4JBM A;  2I5M X;  4IPC A;  4LF4 L;  4OO1 I;  4DV6 L;  1PH7 A;  3W1B A;  5IYC H;  4GKJ Q;  2PQA A;  2F4V L;  4KHP Q;  1LM0 A;  3E9H A;  5M3M G;  1YJ9 A;  1SRO A;  4L5Q A;  5M5W H;  1XJV A;  5C0X G;  4YY3 Q;  3PUX A;  4P72 A;  1U0L A;  2D0P A;  5JJL A;  4DR4 L;  1VQI A;  3S17 H;  1IBK L;  1K83 H;  1N33 L;  1SFO H;  4BXX G;  2NN6 I;  1XPR A;  1CKO A;  3HOX H;  1IBM L;  3I4N H;  1BKB A;  1N9W A;  3HKZ G;  3PUZ A;  1XMQ Q;  3U4V A;  4JI1 L;  3L7Z C;  1I50 H;  3UDI A;  4B3M Q;  3I4M H;  1NBW A;  4YCV A;  4GOP B;  2UXD Q;  2ALY B;  3CMA A;  3OTO L;  1UE6 A;  2OWO A;  4A3B H;  1FL0 A;  1CKN B;  4YWL A;  2Y0S E;  4A3D G;  1VQC A;  1L2F A;  4OXP A;  1JT8 A;  3G48 A;  1AE3 A;  1N36 L;  1K9M C;  2QA4 A;  1PA6 A;  1XPU A;  1A62 A;  2BA1 A;  2PI2 E;  1X56 A;  3JAM c;  5C3E G;  4HIM A;  2IY5 B;  3A5Z B;  2R93 G;  4LF7 Q;  1HNX L;  4JV5 L;  3TEH B;  3T1H L;  1YVC A;  2R7D A;  4YCW A;  1SLJ A;  3RZD H;  4A75 A;  5FLX c;  1YBY A;  3PIP A;  2HQL A;  1KL9 A;  1HNZ Q;  1X65 A;  1T9H A;  2VZA A;  4LUO A;  5IWA Q;  1M90 C;  1TWC H;  4NXN L;  1VQN A;  3W1G A;  4DR2 L;  2NN6 G;  2CWA A;  2VQE L;  5LMU L;  4LUV A;  1WOC A;  1EWI A;  1Q81 C;  4XTC S;  5FLM G;  3G6E A;  1YI2 A;  1J5E Q;  3PV0 A;  3HOV H;  3KF6 A;  2JJQ A;  3J7A 5;  1PYB A;  4R4I A;  1TWG H;  3I4N G;  4KLK A;  1YHQ A;  2ID0 A;  4BBR H;  4ME3 A;  1I3Q H;  1P16 A;  1OXX K;  5M5X H;  4JOI C;  4BY7 H;  4Y52 H;  3KDF B;  5LMN Q;  2VUM G;  3S24 A;  4QY7 A;  4C2M H;  3OYY A;  1VQO A;  2JEB I;  4AIM A;  1IBL Q;  4JBJ A;  1V1Q A;  3DLL A;  4LF5 L;  3F1Z A;  1XNR L;  3TRE A;  5IT9 c;  1FGU A;  2CCZ A;  4JYA L;  3KJO A;  4O0A A;  4QIW E;  4A3M G;  4DK3 C;  5JJI A;  2JA6 H;  4NPS A;  2YU9 H;  4B3T Q;  2HT1 A;  4GOP A;  3UDF A;  2Y0S G;  3RLO A;  1VQ8 A;  4DV2 Q;  3HFZ B;  1KD1 C;  5GAG C;  1VQA A;  4GN5 A;  1ASZ A;  4DK6 C;  4GKJ L;  2OQK A;  4DV5 L;  1VQJ A;  3EIV A;  4GN3 B;  1S40 A;  3S15 H;  2WFW A;  2KCT A;  3KJP A;  4LF9 L;  4DKA C;  4B3S Q;  2JA8 H;  3S2H H;  3K7A H;  3T1Y L;  4YWM A;  3J81 j;  1YNX A;  1VQP A;  2ZM6 Q;  4UP8 A;  1K3R A;  3I7F A;  2LXJ A;  4P71 A;  3VDY A;  1MJE A;  4JI4 L;  2UUB L;  3J81 c;  1VQ7 A;  1E24 A;  4A3E G;  3CW2 C;  1WYD A;  4YCU A;  2A19 A;  4TVA B;  4OO1 G;  2UUA Q;  4HIK A;  3PGZ A;  2ZJQ A;  1MKH A;  4A3J H;  2KBN A;  1VQM A;  3RZO H;  3RN5 A;  2VUM H;  5IP9 G;  1PH9 A;  3JAM i;  1PH3 A;  3STB C;  3M9B A;  1D7Q A;  2AKW B;  5J3B A;  4QJF A;  4DV4 Q;  1KHI A;  5M3F H;  3IRB A;  1MJC A;  4MNO A;  2ES2 A;  1X3E A;  4BBS G;  2MFI A;  4A3L H;  5IYB H;  4R4Q A;  5LMN L;  5C4J H;  3J80 c;  2WAQ G;  1SMX A;  4UY8 C;  3A74 A;  3NBH B;  1UWV A;  3UDG A;  3NEL A;  2ASB A;  3GTQ H;  2BH2 A;  1YHA A;  1L1O B;  2R7F A;  2WB1 E;  3F2C A;  1BBW A;  4HID A;  1IBL L;  4JI3 Q;  4GN4 B;  1Q7Y C;  4X62 Q;  4PZ8 A;  2RHQ B;  3S16 H;  1KXL A;  1A63 A;  4DAY B;  5BR8 Q;  1HH2 P;  3H3V H;  2E8G A;  3KDF A;  3STB D;  4R4C A;  2ZM6 L;  4GLV B;  3S1Q H;  3GTM H;  4K0K Q;  1YEZ A;  4KHZ A;  4X65 L;  2GVA A;  4L5R C;  1XMQ L;  2UUB Q;  4JI6 L;  2MO1 A;  4GS3 A;  4IOC A;  1VQL A;  4LNQ A;  2Q2U A;  5C0X I;  2NVX H;  4OWW B;  1G6P A;  4NXN Q;  4JCV E;  1VCI A;  3HOW H;  3PUY A;  4IJH A;  4C3H H;  4NB3 A;  3PIO A;  4HJ9 A;  1PH4 A;  2JA5 H;  2A1A A;  2A8V A;  1EFW A;  1CSQ A;  3J80 i;  3S1R H;  3TS2 A;  2E2H H;  4LWC A;  4JI8 L;  1P8L A;  5GRO A;  3GTK H;  1NE3 A;  2K5H A;  1Z47 A;  3H15 A;  2JK8 A;  1X55 A;  1OTC A;  1IBM Q;  3M85 A;  2B29 A;  4NXM Q;  5FJ8 H;  4DR5 L;  3RLF A;  1C0A A;  4DR3 L;  4OON A;  4A76 A;  3CC2 A;  3HOZ G;  2WB1 G;  3CCS A;  4AQY L;  1YJN A;  1Y1V G;  2AWN A;  4DNI A;  3E0E A;  4GKK Q;  4IFD I;  2D0O A;  4JI5 L;  4X66 Q;  3HKZ E;  2VQF L;  4BBS H;  2LSS A;  4L5S A;  1J5E L;  5K36 G;  2FXQ A;  4A3I H;  1Y1W G;  5C3E H;  4RMF A;  4C3J H;  3PF5 A;  2GN5 A;  1E7Z A;  3NEM A;  4JBK A;  1UE7 A;  4A4I A;  4HJ8 A;  3AQQ A;  4H02 A;  5GAE C;  3M4Q A;  4EX5 A;  4MZ9 A;  3BZK A;  1KRS A;  1ASY A;  3PUW A;  3D0F A;  4UP7 A;  1VQ5 A;  3HOW G;  1V43 A;  1N32 L;  3PO2 H;  5GAD C;  4YY3 L;  4R4T A;  5LMN W;  4GNX C;  1XMO Q;  1LUZ A;  1EIF A;  2VS1 A;  1VQ6 A;  5IYD G;  5FLM H;  3GTG H;  2E2I H;  2RF4 A;  2BA0 A;  2MO0 A;  1VQB A;  4DR3 Q;  1XNR Q;  3AEV A;  2K75 A;  4DV7 L;  3GTO H;  2R6G A;  1WI5 A;  3GDE A;  4P73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...