1Y14B

Crystal structure of yeast subcomplex of rpb4 and rpb7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
154
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNASYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II 32 kDa polypeptide
publication title Structures of Complete RNA Polymerase II and Its Subcomplex, Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 28
structure length 154
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y14B02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y14B01
3AFPA 4PG3A 3MXNB 4A3JH 2R92G 1HNZQ 3J81j 2DUDA 4YY3L 1JMCA 2R6GA 1N8RC 2UU9L 4LFCQ 1N34Q 2L15A 1HH2P 1V1QA 2A1AA 3K7AH 1NY4A 2VW9A 4RMFA 2UXBQ 2IHFA 4JI5Q 1UE1A 4PZ6A 5C4XH 1U5KA 5LMUQ 1PH9A 3H15A 4KLKA 2KCTA 3UDFA 3RN5A 4LFAL 1BBUA 2OTJA 5M5WH 1L1OB 1KQSA 4NXMQ 2EIFA 1D7QA 3PV0A 1TXYA 1ASYA 3GTOH 3HKZE 1I94Q 3RLOA 1KAWA 4X66Q 3CCQA 2BH2A 2LSSA 4IFDJ 3T1YL 1CKMA 2MNAA 4A3MH 4BBRG 4IJHA 1VQFA 3G48A 4X65Q 4DR3L 2JE6I 1GVPA 2KENA 4QL5A 5M3FG 3L0OA 2I5MX 1VQAA 4DNIA 5C0XG 2VZAA 3U50C 1X54A 1I50H 4Y7NH 3OTOQ 4A76A 2HQLA 4OX9L 2XGTA 2ZJPA 3G4SA 1H95A 3HOVG 3FKIH 3I7FA 1VQ6A 4JI8Q 2Q2TA 4R4IA 3H0GH 4JI7L 1XPRA 2ZTCA 4J15A 3OW2A 5C3EH 2QGQA 1YHAA 1Y1VH 2YYZA 4A3BH 2AWOA 2KHJA 4DUYQ 4MNOA 1XMOL 1UWVA 3J80c 3F2BA 1VQLA 3S24A 2IT1A 2ALYB 4AIMA 5IYBG 5ELOA 2VQEL 1Q1EA 4BY1H 3KLWA 2QA4A 2E8GA 4EQ5A 5GAEC 3CAMA 4P71A 5LMNW 1VQJA 2PI2E 3S2HH 3I4NH 1C0AA 1YHBA 2LXKA 4A3KG 2VL6A 1GD7A 4AQYL 4NXNQ 2F52A 4NPSA 2Z6KA 4PZ7A 3HOYH 4A3GG 4LFBL 1CSPA 4A3LH 1EOVA 3M85A 1JT8A 3AYHB 1E24A 4LW1A 2KBNA 4O2DA 2YU9H 5E7NA 3GTGH 2Q2HA 3CQZH 2CWAA 3TREA 4GN4B 3GTQH 4DR5Q 1IXRA 4LUZA 2OQ0A 2WP8J 1CKNB 3PUVA 4A3IG 3D31A 3KYHC 3PIPA 1Q7YC 3J80i 3DLLA 4DV6L 3RR5A 1ASZA 4GN3B 1YJ9A 5IP9G 4GNXC 4B3RL 4YHHL 5FLXc 3PUZA 4KHPL 5IYCH 3TRZA 4UY8C 1FVIA 4C2MH 3UE1A 3S15H 3U4VA 4B3MQ 1K83H 2ZM6L 4DV0Q 4JI2Q 5ELNA 2NVTH 2V1CC 1X3EA 4JV5L 3HOXH 4A3JG 2JA6H 1P8LA 3AFQA 4P75A 3F1ZA 3KJOA 4JBKA 1N33Q 2NVQH 4A3CH 4X64L 1SLJA 2K5NA 4JOIA 1L0WA 5GAGC 4C3IH 2I5LX 5M3MH 4PMWA 2HHHL 2RHSB 1E1TA 2N49A 4DK6C 1TWHH 3K80C 4JI6Q 5IP7H 5C4XG 1HZAA 3VDYA 2UXCL 2ZJRA 3PGZA 1M90C 3HOZG 1RIPA 1JB7A 5JJKA 1MJCA 5FLMG 4GLAC 2QEXA 4BY7H 4DR6L 2MO0A 4GKJL 2MO1A 2I5HA 2MFIA 1EIFA 2R7FA 4LNQA 2GN5A 3UDGA 4LF9L 2JQOA 1HNXQ 4IJLA 4LF6Q 4UP7A 3TS2A 1PVOA 1YI2A 1B8AA 3NELA 4LF8L 3KF8B 4GS3A 4LUVA 1HNZL 1XNRQ 4IFDI 4LFCL 1UE7A 2ZTEA 3S2DH 1N34L 1PA6A 2JA9A 4A75A 1QZHA 2D0OA 4ME3A 2UXBL 4JI5L 1VQPA 4JI0Q 1VQ8A 5LMUL 3GTLH 3FKIG 3F2DA 4XTCS 1VQ4A 5HGQA 1I5FA 3GTPH 4B3TQ 1CKNA 1VQDA 4DR2Q 4NXML 2R93H 2BA0A 1FGUA 5C3EG 1I94L 1I6HH 1IBKL 2ZTDA 4X66L 4A3BG 3CCUA 3CF5A 1BVSA 1HZ9A 4MZ9A 3RN2A 3CC7A 4DR7Q 1Z47A 3K8AA 3PF5A 4YWLA 1E7ZA 4X65L 4BY1G 2AHOB 5IE8A 1TWCH 3CCSA 3PO2G 4WJ4A 1IBLQ 1CUKA 4HIDA 4APVA 2IHEA 5K36G 1WYDA 4L5RC 4NB3A 4DKAC 5JEAG 3I55A 3L2PA 3T1HQ 4A3FH 3OTOL 4YCWA 4LF8Q 3HOYG 4DV4Q 1VS0A 1AE3A 1QVFA 4A3LG 4X62Q 4JI8L 1Q12A 1PYBA 5C0XI 2Q2UA 3CD6A 2JK8A 3M4QA 5IY0A 5BR8L 2VQFQ 2JA8G 1OXVA 4LF5Q 4A3DH 1HNWQ 2PMZE 4DUYL 1EUJA 1Q81C 3CCJA 1N36L 3J81c 1IBKQ 1KHIA 2CWPA 3FHWA 4QIWE 2IY5B 1QVGA 1XNQQ 5IYCG 1PH7A 2E5LQ 3CPWA 3S1QH 1JJCB 2UUAQ 1T9HA 2E2HH 4B3SQ 3W5OA 1Y1WH 5JEAJ 1VQGA 3OYYA 3G6EA 4DV2Q 4HJ7A 2JA6G 4BXXH 1VQOA 2C35B 5LMNQ 1VQNA 4NXNL 4A3CG 4JI1Q 4JYAQ 5GAHC 5M3MG 1XMQQ 1NTGA 1OXUA 4L5TA 4LUOA 5H1SE 5IP7G 4DV3Q 4DR4Q 4LF7Q 2N8NA 4K0KQ 3CMEA 4OWXB 3CCMA 4DR5L 4JV5Q 5BR8Q 3CMAA 4MTNA 4BY7G 3J81i 1KIXA 2JA5H 5IYDH 2YTXA 4R4CA 3KJPA 2ZJQA 4GKKQ 4JI3Q 4UP8A 3HKSA 3UE0A 3PUXA 1N36Q 3PO3H 1A63A 4B3ML 2OWOA 4DV0L 4JI2L 1W2BA 1TWGH 2A19A 1EWIA 1EQQA 3ERSX 1JE5A 2WB1G 4TVAB 2YTYA 2I0QA 4JG2A 3S1NH 4QQBX 3NBHB 1VQ7A 1N33L 3BZCA 3H3VH 4P72A 1VCIA 1VQMA 4HJ9A 4OWWB 3D0FA 4HIKA 3CC4A 4A93H 3B6YA 3ER0A 1VQIA 4DR1L 1JJ2A 4LF4Q 3CCLA 4P73A 1PV4A 4GOPC 1DGSA 4JI6L 5M5XH 4O0AA 1L2FA 4L5QA 1WCMH 2ATWA 2R93G 1WI5A 5GQOA 1YHQA 1KC8C 3NENA 1HJPA 1YJNA 1J5EQ 1C7YA 4JBWA 4A3EG 2D0PA 3CXCA 4X6AH 1A62A 2K14A 1N32Q 5JJIA 1EQRA 4JI4L 3K81C 2RF4A 5J3BA 1HNXL 2PQAB 1Q46A 3S16H 4LF6L 1L1OC 1Z9FA 1S72A 2Z0SA 2VUMH 2B29A 3RLFA 3RZOH 3HOUH 1XTDA 1XNRL 2R7ZG 1C9OA 1QVCA 1XPUA 1K9MC 4DAMA 3LGJA 5C44H 2H5XA 4JI0L 1RL2A 1Q1BA 2R7DA 2R7ZH 1VQKA 1G6PA 1V9PA 4FDBA 4DR1Q 1WOCA 3M3YH 3I4OA 4JCVE 3ULJA 4B3TL 4DR2L 1PYSB 4GLVB 3BJUA 3W1BA 1PH5A 4POGA 1TWAH 3TQYA 2A8VA 4JOIC 3ULPA 2ID0A 4C3JH 1MJEA 2YTVA 4DR7L 5AJ3Q 3TS0A 1KRTA 4BBRH 3SGIA 1HR0W 4JI4Q 4A3MG 1IBLL 2YV5A 1JJGA 2UUCL 4XIGS 4HJAA 5M3FH 3CW2C 3T1HL 3GDEA 3Q8DA 3RZDH 4BXXG 2MQHA 5FJ8H 3CCRA 1YJWA 4DV4L 3A0JA 3WWVA 1G51A 1CSQA 4X62L 3ULLA 4R1JA 3HOVH 3S17H 1U0LA 3W1GA 2ASBA 1VQEA 4UPAA 3NEMA 4POFA 2VQFL 4LF5L 4OO1G 2HIVA 4OONA 1HNWL 1OXXK 3M9BA 3CPFA 3H0GG 2EQSA 4ALPA 3RNUA 2PQAA 2JA5G 4IPCA 1X56A 5IYDG 1Y1VG 3ICEA 1O7IA 2RCNA 3TEHB 4KHZA 2UXDQ 1A0IA 1B70B 1XNQL 4RG1A 4R4QA 1QZGA 2E5LL 3PO3G 2AMCB 1GO3E 2WB1E 2E2JH 2UUAL 3GTKH 2OCEA 4P74A 4B3SL 4DV1L 2KHIA 1YNXA 2WAQG 3PUWA 3CCEA 4DV2L 2B63H 2UUCQ 1HZBA 1BBWA 1Y14B 3IRBA 5LMNL 2NN6G 1KRSA 4JI1L 3M4OH 2Q2IA 4BBSH 3I4NG 4IPGA 4JYAL 4A3GH 4A93G 4KI0A 4OWTB 1PFSA 1XMQL 2N3SA 4DV3L 4DR4L 1NMGA 1XJVA 4DUZL 1PH4A 4LF7L 4K0KL 4WJ3M 2IX1A 1YEZA 1UE6A 1WCMG 4IOCA 3K0XA 3DM3A 5DLQE 4YWKA 3S1RH 1S40A 3A5UA 1SFOH 3HOWH 1X65A 2ES2A 2F4VQ 4GKKL 4JI3L 1SR3A 1B7YB 1V43A 5IP9H 2CKZB 1TWFH 3CCVA 1HZCA 1VQ5A 1IBMQ 3J7A5 2EXDA 2VUMG 4GOPB 1Q86C 1OXSC 1YVCA 2PNHA 4IO9A 3GTJH 3HOUG 1AE2A 1PH2A 1K8AC 4IPHA 2B3GA 4DV1Q 4GLXA 1UEBA 3K7UC 2WFWA 3BU2A 3J7ZC 3HOXG 3F2CA 4HJ8A 5C44G 4LF4L 1VQCA 1J6QA 3STBD 1MKHA 1AH9A 1PH1A 3A74A 4GN5A 1K73C 1D8LA 5HY6A 3HOZH 2UUBQ 3E0EA 2K52A 2AWNA 3FP9A 3EN2A 4GNXB 3RLNA 1OTCA 3KF6A 4LWCA 5FLMH 4DUZQ 1J5EL 1E22A 5M5YH 5GROA 1XPOA 1X9NA 1N32L 2HIXA 1UE5A 1E1OA 5IWAL 5C4JH 1HR0Q 2DGYA 1W3SA 3E9HA 1X6OA 1SROA 1SE8A 4DV7Q 4IPDA 1GM5A 3JAMc 5FJ8G 3PUYA 2F3IA 2NZOA 1EFWA 4AYBG 1I3QH 1M1KC 2KCMA 4DK3C 4YY3Q 2UU9Q 2BH8A 1NE3A 4IOAA 1QUQB 1YIJA 3HFZB 4QJFA 2JEAI 1X3FA 1YZ6A 1Q82C 3UDXA 4JC0A 4DV5L 1NJIC 4HIMA 4PZ8A 4LFAQ 4BA1I 3GTMH 3I4MH 2K75A 1OXTA 2JA7H 2OQKA 3KDFB 1PH3A 5AJ3L 2FXQA 4GOPA 2Z6KC 3PCOB 1WFQA 5IWAQ 3T1YQ 3PO2H 3PF4A 2WAQE 1GKHA 3JAMi 4DR3Q 2N78A 1K3RA 4HJ5A 2Y0SG 4YCVA 5C0XJ 2CCZA 2B63G 2JJQA 2R92H 4C3HH 4A3FG 4DPGA 2E2IH 4BBSG 2XTIA 4BA2I 1P16A 1YITA 4OX9Q 1E3PA 1SN8A 1KXLA 1X55A 1L1OA 4GNXA 1BKBA 2AKWB 1R9TH 2GVBA 3M7NA 1FJGL 2JA8H 3GO5A 3U4ZA 1LM0A 5GADC 3HOWG 2IX0A 4A4IA 4R4OA 4DV5Q 4JI7Q 4A3DG 1IYJB 1PH6A 1EIYB 2UXDL 4OO1I 2CFMA 3HKZG 4JBJA 1YBYA 3CP0A 4HIOA 1N9WA 2K5HA 1XMOQ 1IL2A 2LXJA 2VS1A 3PSIA 4YCUA 4UP9A 2VQEQ 1KL9A 4QGUA 2HT1A 3E9IA 2D62A 2BA1A 4QY7A 1Y1WG 1MIUA 3M4PA 1K0RA 1QUQA 3U58A 4Y52H 4AQYQ 1KD1C 1FL0A 4LFBQ 2NZHA 2PI2A 4H02A 3H3VI 2K5VA 2NN6I 3CC2A 3KDFA 1FJGQ 3ZJYC 3PIOA 2NVXH 2GVAA 2F4VL 3KOJA 4AH6A 2RHQB 3STBC 4EX5A 2K50A 4L5SA 3KF6B 1VQHA 1VQ9A 3KFUA 1IBML 4DV6Q 4R4TA 1G291 3MEFA 1S3OA 1CKOA 4OXPA 5IYBH 4YHHQ 3L7ZC 1NBWA 2OTLA 3S14H 1LYLA 4B3RQ 4KHPQ 3G71A 1WJJA 2ZM6Q 3JC66 2VY3A 1K8GA 4AYBE 4A3KH 1NMFA 1PH8A 1LUZA 4X64Q 4YWMA 3AEVA 1A8VA 1SMXA 2HHHQ 1EYGA 2CQOA 2UUBL 3GD7A 4TQUS 3AQQA 1PHJA 1X3GA 3BZKA 1SRUA 3UDIA 2UXCQ 3I4MG 3EBEA 2VNUD 1LTLA 3A5ZB 4A3EH 3EIVA 3I2ZA 2JA7G 4A3IH 4DR6Q 1HR0L 4GKJQ 2NVYH 4IFDG 3I56A 1VQBA 5EAYA 3S1MH 4LF9Q 1IZ6A 1Q8KA 4DAYB 4JBMA 2JEBI 2Y0SE 4DV7L 5JJLA 3F8TA 2K4KA 5IT9c
chains in the Genus database with same CATH superfamily
1VF7A 2W9AA 4A3JH 2PZUA 3H20A 3DWAA 1HNZQ 3J81j 4K5VA 3HKZB 4YY3L 1JMCA 2R6GA 2UU9L 4LFCQ 4FF3A 2W9BA 2AQ1B 5JQWA 1T5EA 2A1AA 2VW9A 4JYAH 4RZQA 3VMMA 1EIGA 2IHFA 4QB4A 2UXBQ 4PDBA 4MV3A 1U5KA 5LMUQ 3OSNA 4K5WA 3H15A 4DV3H 2KCTA 1DD2A 4K0KH 1Y1WB 1KQSA 3V4SA 4NXMQ 1D7QA 1TXYA 2RBMA 3N6RA 1N48A 3J7AF 3SK5A 2FMAA 5FLXW 4JI3H 2VA3A 1CKMA 4YJ2F 3H91A 3GTPA 4J9NA 4IJHA 1B3AA 2JE6I 1LTRD 2UVWA 1S97A 1PX2A 1X54A 3QFFA 3ONAB 4OX9L 1EU4A 3BYTB 1KEEA 4ECTA 2Y0SA 5KFBA 3L4JA 3T56B 1RKNA 5E3FA 1A2UA 4JV0A 3H0GH 2EYFA 1XPRA 3OMCA 2QGQA 1YHAA 1I3QB 2AWOA 3KAKA 3RB3A 5KFNA 4DUYQ 3SXHA 1SFOA 5EKKA 4A2BA 5DG9A 2IT1A 1Q1EA 3KLSX 4FF2A 3AB9A 3I4MB 4RCOA 2IMWP 2K7VA 3I4NH 3M7GA 3HOYH 4AQYL 4FF4A 4R8UA 1EOVA 3OMGA 4LJZC 3M85A 2E74C 3J7AK 3QOJA 3PW4A 2KJXA 5TSSA 1FYCA 2KBNA 4G3IA 2YU9H 5E7NA 2EOTA 3EQLC 1BXRA 2DPIA 2Q2HA 2PNRC 2CWAA 3TREA 3SVMA 4GN4B 3PR5B 2B39A 3PUVA 5LXTF 2DZDA 3KBGA 5EPKA 1N56A 4JK1C 1R9TB 2O4XA 5T1GA 3IG0A 2F0GA 4YHHL 3PUZA 1W6JA 4KHPL 3M3YB 4UY8C 4C2MH 4IAJA 2ZM6L 3RF2A 4DV0Q 4KV6A 5KFUA 2WTFA 4JBKA 1BNCA 4X64L 1SLJA 1L0WA 5LMNW 2I5LX 5M3MH 1E1TA 2N49A 4K14A 2ZJRA 3PGZA 1M90C 1L0XB 1HPCA 4IUUA 4RNNA 5FLMG 4GLAC 4BY7H 2F0JA 2WKCA 3N44B 2EYOA 3GTMA 2JQOA 5KGUA 4LF6Q 4UP7A 3Q2OA 4O4HF 3I3CA 1XNRQ 4IFDI 2NTSA 2E2DC 5DQGA 1PZJD 4ZAIA 3TIGA 4X3KA 1GSHA 5J1ZA 4A75A 3KXYT 4ECRA 4JI5L 5ELBA 1VQ8A 4CDFC 1WSCA 4YB8B 3GTLH 5FPRA 2VA2A 1NR4A 3FKIG 1WTPA 1FKAH 1I5FA 3MWMA 4B3TQ 1CKNA 5KFJA 5KG1A 2BA0A 1FGUA 4YIJA 1GUSA 3M4OB 2WV6D 1I94L 4A3BG 2WE6A 1FD7D 3KALA 1QJOA 3CC7A 4LF9H 1Z47A 3HEJA 3TN2A 4X65L 4QWAA 2NBFA 5IT9L 4BY1G 2AHOB 4ED2A 1H9RA 4WJ4A 5K36G 4HIDA 1PK8A 2IHEA 5EBDA 3T1HQ 3I55A 4A3IB 3OTOL 2PMZB 4YCWA 4HCEA 1B6RA 1JWUD 2XCLA 4MV8A 1WR2A 1JOQA 3E5NA 4JI8L 1Q12A 1PYBA 4L8JA 1IOVA 4K8JA 3GTJB 3LX0A 4LF5Q 4A3JB 1UNNC 1HNWQ 1V1OA 2K28A 4JUZA 3G6JB 1Q81C 2AQ2B 1QB5D 1N36L 4RAYA 3FHWA 4YR2A 4QIWE 3RFCA 1F2LA 3KAJA 1B3QA 2H4OA 3KF8A 1DV2A 2I87A 1I6VC 2E2HH 3W5OA 4BXXH 1E2WA 1VQGA 2TSSA 3OYYA 4DV2Q 2M05A 2R8JA 1VQNA 2B2TC 4NXNL 2V4RA 2CZGA 3Q8RB 5KFDA 1XMQQ 1MBYA 4LUOA 3V2TA 4DR4Q 2CW7A 4FM9A 2N8NA 4OWXB 4UFZA 2J0TD 2W7PA 3HZXA 4HR7A 1KC7A 2ZJQA 4GKKQ 2ZXOA 3PO3H 1C3OA 3ETHA 3RAXA 4B3ML 2HDLA 1OWTA 1AUVA 2L11A 4Q0FA 4JI2L 5KIXA 1TU2B 1JE5A 2ICIA 2LS01 1GXDC 3S1NH 2FB9A 4RFBA 2QEJC 1TWFA 5LYJF 5KFIA 2W6OA 3G6XA 2NN6H 1VCIA 4OWWB 4HIKA 4F88A 1VQIA 4DR1L 3NWSA 1DGSA 4JI6L 3PO2B 1EQVA 4I65A 1BCPD 5GQOA 4K2KA 3R3OA 3RB0A 1LTAD 4EGQA 1N32Q 3K3VA 1HNXL 3HRZC 1XMOH 4N9TA 4O3SA 2DJFC 4MA0A 3GTOA 2JA8B 2B29A 5KFTA 2VQEH 1H9KA 1H9MA 1RTNA 1XPUA 2R82A 3BS1A 2W9CA 1GSAA 1U4LA 2YZMA 4JI0L 2XC9A 1G6PA 1V9PA 5BN3A 5KG6A 3OOCA 1WOCA 3I4OA 4JCVE 4EQPA 1PH5A 2PW7A 1TWAH 5M3MB 2F0QA 2ASJA 1EYDA 2ID0A 4C3JH 2YTVA 1MJEA 3TS0A 4K5XA 1CQFA 4JI4Q 5JVG3 2WKDA 4A3MG 3H3VC 2YV5A 2YS6A 1BGWA 5M3FH 2VPQA 1XNRH 5C0XH 4KN7C 2A6ED 2K01A 3NWTA 5KFWA 2X6LA 4LK1C 5FO9B 4DL2A 1Q8IA 3IFDA 1YNJD 4HMIA 1CHQD 1PFMA 2ASBA 2HHHH 4EYHB 4EYIB 5KFSA 1VQEA 4UPAA 3NEMA 1AUXA 4B3TH 4ECSA 4O3RA 4PQXA 1OXXK 1WTQA 3TBIB 1GUNA 4ZHQF 2LFNA 4BWSC 2JA5G 3ICEA 2O03A 4FS2A 4DR6H 1O7IA 3T13A 1O80A 2UXDQ 4EEYA 5IYZF 1KABA 2JYOA 3VR6A 2AMCB 1GUTA 5A2QL 4ECYA 4P74A 4DV1L 1LTGD 2KHIA 2WAQG 3PUWA 3RUZA 3CCEA 1KJIA 2UUCQ 4A3EB 1HZBA 2DN8A 3PW5A 1G8ZD 4IUQA 3FMAA 2W8LA 3JRWA 4B9WA 3NGDA 1BOSA 1PFSA 4IRDA 2N3SA 3E3XA 1M0WA 3J7YW 5F9LA 1U9RA 2XD4A 1E2VA 4WJ3M 2IX1A 1SFOH 1WCMG 3S1RH 1LO5D 2N55A 3J81L 1IYVA 1U4MA 2K5QA 4CBVA 2RA4A 5KFHA 1BCPC 4TQRA 2E75C 1IBMQ 4GOPB 1Q86C 1OXSC 2PNHA 2A74C 3QB3A 4OHJA 5M5WB 3OSPA 1K8AC 1NR2A 4GLXA 2YCHA 3K7UC 2WFWA 3W3AA 4MV7A 1B53A 2F0NA 4LF4L 1J6QA 2WB1A 1F9SA 1EYZA 1PH1A 2RDIA 4GN5A 1WTRA 1D8LA 2BDOA 4DR4H 3HOZH 1D2BA 3E0EA 2E2HB 2EJGC 1RK6A 5C1PA 4LWCA 4DUZQ 4LAAA 2R7KA 1J5EL 1E22A 1X9NA 5GROA 2K04A 2B2TA 3MFGA 1UE5A 3EA6A 5IWAL 1HR0Q 4QUFA 4DL3A 3FVQA 3V6KA 1X6OA 3NTKA 1SROA 4F4XA 1STNA 3JAMc 2ZXPA 5FJ8G 1H9SA 1Y1VB 4A3BB 2B8FA 2F3IA 1EFWA 1Y8PB 1BUVT 4YY3Q 1M4VA 5KYIA 2QDLA 2UU9Q 4C5BA 2SNMA 3QR8A 1NE3A 2F4IA 1J9OA 2R8HA 3UDXA 2A6EC 4KY7A 3TP6A 4HIMA 3M4IA 3GTMH 3S2HB 2I46A 3BZDB 4DR5H 3DWQA 5F9NA 5CV7A 1SMYD 3OPOA 1Z2PX 4DXFA 2Z6KC 3Q22A 5KX5F 3JAME 4S3SA 3GTGB 1GKHA 1SYDA 1I4XA 3JAMi 1B04A 2NU6B 2B2VC 2CCZA 4YCVA 5I4DA 2JJQA 3C1EA 4BBSG 1N33H 4EG0A 2FKLA 4CDCC 4OX9Q 1SN8A 5EQ0A 2W6PA 3N52A 4GNXA 2XCPA 1VMPA 2HD3A 1VAJA 3L4KA 4F4ZA 3K5LA 5J2UF 2IX0A 4DV5Q 2NVQB 1JIHA 2VXWA 2L4NA 4OO1I 3HKZG 2A6HD 3CP0A 3PW0A 4JI4H 3BVZA 3H0GA 2J7ZA 2LXJA 1QNUA 3PSIA 1EOTA 1ZXTA 1SYGA 4QGUA 2HT1A 5JVLA 4RHSA 3SE7A 1Y1WG 2CH4A 2RKSA 3M4PA 3P75A 1K0RA 1STEA 1A2TA 4AQYQ 1D1KA 2W9BB 1SCUB 4H02A 2NN6I 1TS3A 4RGNA 1I4QA 4UCVA 1JWSD 1ML0D 3ZJYC 2GVAA 3E5SA 2F4VL 3KLSA 4AH6A 4EX5A 3KF6B 2YU9A 1F2YA 5IYBH 4YHHQ 2OTLA 1NBWA 3S14H 1EWHA 1LYLA 4KHPQ 3GTPB 2RGRA 2NTTA 5LOVF 1IBLH 2ZM6Q 2CW8A 3OIQA 2UUCH 1BQQT 4AYBE 1KDBA 4DV4H 4X64Q 4J8QA 3MR2A 1A8VA 4DLKA 4X62H 4TQUS 4ED0A 4RB3C 3LP8A 2Y0SB 5M9OA 4BWGB 2VQFH 3I4MG 1SNDA 2KHSA 2VNUD 1PTOF 3MTSA 2JA7G 4IURA 4RCNA 2R7MA 3T5HA 4IFDG 3S1MH 2DNCA 2JEBI 3C3LA 3S1RB 2WYOA 3FPUB 2R7ZH 4I4TF 5IT9c 3NK9A 1SMYC 4FP5D 5DQIA 3P20A 3FEWX 3HB9A 2L15A 1HH2P 1SEBD 3K7AH 2A69D 4J9QA 1JICA 4JI5Q 5C4XH 1PH9A 2I80A 2IJ0A 4R8UB 4LFAL 3UDFA 3RN5A 4DUZH 4LF7H 2C9OA 4J9OA 3DMUA 4LSXA 2EIFA 3BQ0A 3GTOH 2RQXA 1I94Q 3GTLA 4DK0A 2BH2A 1DOLA 2LSSA 1DXMA 2MNAA 1RJTA 5IT9E 2FPPB 3PIO3 1PRTF 4X65Q 4DR3L 1A6XA 1E0BA 2DY7A 4DNIA 2NUAB 3VR4A 4ME6A 1LLRD 1TVXA 2VZAA 2JA5B 3UFXB 3GTKA 3OTOQ 1S0MA 5G3LD 4MTKA 1ZKOA 2XGTA 3I8ZA 5NUCA 3G4SA 2ZJPA 4IRKA 2B63A 1H95A 1BXTA 2XWBB 3DWPA 1VQ6A 4JI8Q 1F9QA 2W6ZA 1ESRA 4RB0A 4X3TA 4JI7L 5I2YA 5C3EH 2YYZA 1K28A 2D2CC 1WVLA 4I7AA 4MNOA 3URYA 3J80c 1CFMA 4R7RA 1VQLA 2ALYB 3KHHA 2FK1A 2ZJTA 2C2EA 1EEID 3KLWA 2QA4A 4EQ5A 5GAEC 3GTMB 3CAMA 2YRXA 4ZUJA 4ULLA 5IGBA 5CA1F 1YHBA 2VL6A 2X69A 3SK6A 4OX9H 1TR5A 4X3SA 4NXNQ 2Z6KA 4LFBL 1DYQA 3KLRA 2C2DA 1MGSA 3AYHB 3VPCA 3RZOB 4O2DA 3EPGA 2B2VA 1CI3M 4MV4A 4QWBA 4DV5H 3GTQH 5FK9C 4U68A 5T1IA 3T4AC 3BVMA 3J80E 2NZ1D 1CKNB 2WP8J 4A3IG 3D31A 4Y8VB 1QWYA 2K32A 3J80i 5DM63 4DV6L 4TSSA 1S5ED 1KDAA 4RA8A 2GPSA 4R8IA 1FVIA 3UE1A 3U4VA 4B3MQ 5H80A 1VBGA 4EFBA 4JI2Q 5EWFA 4O2BF 2NVTH 2M9VA 3HOXH 4A3JG 3GILA 4P75A 4JV2A 4A3CH 4JOIA 5I2XA 4C3IH 4BBRB 3K5HA 2XNAC 4PMWA 5JPMC 4OELB 1KJ8A 4DK6C 3HXLA 4FBUA 1TWHH 4KY6A 4JI6Q 5IP7H 2NU8B 1BBXC 2UXCL 1TT2A 1SYXB 3G7LA 4QWEA 2CW0D 4RKLA 3R8BA 4RUCA 2A69C 2MO1A 5JOBA 3VR3A 2R7FA 3HOVB 4HN7A 3S17B 2GN5A 2HCIA 4EBDA 1HNXQ 2D9UA 4DN4M 5KG0A 1PVOA 3BG3A 3NELA 4CDDC 3BA9A 3KF8B 3D4RA 4LUVA 3S2DH 1N34L 2LKVA 1QZHA 3FPPA 1Y69U 4JI0Q 4ZQIA 2W8KA 3S14B 1MD2D 3PR4A 1VQ4A 3G8CA 2EVBA 2MPMA 4M7EA 5EOYA 5L9XA 3OUZA 5F2DA 5I6WA 1XYIA 1IBKL 3MWYW 4A3GB 5C3XA 2R87A 1JB3A 4MZ9A 1Z7TA 2AU0A 4HR7B 3PF5A 1A3TA 5COYA 3PO2G 2YZGA 3JAMW 1LV9A 2FLPA 4NB3A 4A3FH 3L2PA 4RGTA 1KDCA 1AW7A 1IHZA 1JOOA 3GIJA 4LF8Q 5KFFA 3HOYG 4M1UB 1TWFB 4P2CB 3IKJA 1AE3A 1QVFA 4L63B 1LT3D 5J2TF 4CC6A 3BYYB 3K3PA 2O5IC 2UUBH 4E6IA 3M4QA 4F87A 5IY0A 5BR8L 4L1KA 2JA8G 2C28A 2EJMA 5CYUA 4A3DH 5KYLA 1K0SA 3HBLA 1EUJA 3J81c 1QE6A 4KJOA 2CWPA 5C4XB 1F2MA 1QVGA 4YAKB 3CPWA 5EWGA 3S1QH 1RDPD 1CK1A 3AU7A 1EY4A 2VUGA 5JEAJ 4HJ7A 3G6EA 3EPIA 1EQTA 2C2RA 4NLGA 2K05A 4O3PA 5M3MG 2W9CB 1PFNA 1PYWD 5H1SE 3OW7A 3GIIA 3J81E 2RSNA 4MTNA 3FDTA 4BY7G 3TZDA 3J81i 1KIXA 1FNVA 4KD3A 5ELFA 3KJPA 3HKSA 3UE0A 3PUXA 1A63A 3GQCA 2OWOA 3T1YH 1W2BA 2A19A 4MTEA 1EWIA 2F0FA 2CW0C 5C3EB 1SYFA 4QQBX 1AN7A 2NVYA 1PDQA 4TKOB 4DA2A 3M9OB 2JA7B 1HCZA 3BZCA 3H3VH 1S5BD 2A73B 2V4QA 4QIWA 3K58A 3ER0A 4LF4Q 3CCLA 2R86A 1DJRD 4P73A 1PV4A 2MJ8A 2ALZA 1TS2A 5M5XH 2YL2A 1EZ1A 4L5QA 1IYUA 1RJPA 5EDWA 1KC8C 2KOLA 5KEEA 5L1IA 4C3HB 3NENA 1YJNA 1J5EQ 2Z8LA 1JORA 3RAQA 4JV1A 2GA4B 2D0PA 5FLXL 4A3EG 5JJIA 3ND9A 3K81C 2RF4A 2XSCA 5FKAC 4MV1A 1Q46A 3S16H 1Z9FA 2W7OA 1S72A 1HHVA 2VQDA 2VUMH 3RLFA 3HOUH 2EYMA 2FE3A 1C9OA 4ID6A 1M0TA 2X6GA 3LGJA 1Q1BA 2R7DA 4YP3A 2AQ3B 1VQKA 1ZQ7A 2QF7A 1PTOD 1I50A 2NVTB 4H0LC 4DR2L 1PYSB 1LACA 3BJUA 4POGA 3T5JA 4ZKBB 1GUWA 2XN9C 2A8VA 5KT5A 4C3IB 2JEFA 4KTAA 4DR7L 2F0UA 1KBLA 1JE4A 5IGFA 1F9PA 1KRTA 1E4GT 1STYA 1EIHA 4B3RH 3Q24A 3NBHA 3W2DA 4XIGS 1B6SA 3TQTA 3KHRA 3CW2C 3D6WA 2L1BA 3GDEA 2NVXB 4BXXG 2F0DA 3CCRA 4XZ3B 3QG1A 2W71A 1G51A 4JI0H 3ULLA 4R1JA 1XWEA 1GLVA 2R85A 1XDNA 2G5DA 2WB1B 1ILQA 1U4RA 4RKBA 4POFA 4OO1G 4DU9A 4BS9A 3S2DB 1MZBA 2EQSA 5DEHA 5KFGA 1D1IA 2VB2X 3HG9A 1PRTD 3PQIA 1Y1VG 3TEHB 4KHZA 3CQZA 4ZK9B 4RG1A 3E6ZX 2E5LL 1XNQL 3PO3G 2FK2A 2E2JH 2UUAL 2CH4W 2EXZA 3GTKH 4IR9A 1YNXA 4U7CA 2B63H 2ZT9C 5LMNL 3HGBA 2NN6G 3KHLA 4LF8H 1HNZH 4IPGA 4JYAL 4LFCH 1H9SB 1XTCD 4OWTB 4FF1A 3UQ8A 3GV5B 5C1OA 2UXBH 5EKIA 4DV3L 2JA6A 2BE5C 5LMUH 4K0KL 1PZKD 1QILA 4JV5L 3A7LA 3K0XA 2CQAA 1D5ZC 5D14A 3A5UA 2XWJB 1UUPA 1S40A 3HOWH 2QK4A 3PW7A 1X65A 1SE2A 4ZUIA 4NXMH 2F0LA 1IKMA 4Q8EA 1YNND 2F4VQ 4JI3L 1SR3A 1B7YB 4ZOLF 3J80W 2FPIB 1KNAA 4FU0A 1WH2A 3T53B 4PMCA 4J9MA 4LH6A 2XGPA 1AE2A 3MWDA 3GIDA 4IPHA 2B3GA 1UEBA 3F2CA 3OHAA 5L37A 1PZID 4C1NI 3N8DA 1AH9A 2J6SA 3MFYA 2MUYA 5HY6A 5CC4A 3N40P 2AWNA 1GUGA 4GNXB 3V6HA 1OTCA 5FLMH 4ILWA 4Q5VA 2HIXA 1TIID 3U9OA 5IGGA 1TA8A 4LH7A 4J9KA 4DUYH 5C4JH 2R93A 1PTOC 1DV1A 3EFXD 3E9HA 4CKCA 1CA6A 1CA5A 3H0GB 4IPDA 3PUYA 3T5KA 5FD5A 2EY5A 2NZOA 3OHXC 1M1KC 4LF4H 5KT3A 2R7ZA 1SXTA 4IOAA 3EJIA 1X3PA 1YIJA 5EZYF 4QJFA 4PMBA 1X3FA 2JEAI 4XX0B 5HBRB 4WORA 1CQIB 4LFAQ 2UVUA 4HNTA 2ATLA 3I4NB 5E4WC 4YR3A 4HAEA 3HOYB 5BMVF 4DL4A 4F7XA 1HTPA 2NYZD 3PCOB 3NUCA 3EYYA 2JXMB 1FR3A 2WAQE 3PF4A 1GHJA 2YU9B 4IRCA 1S5CD 2OXPA 4B9XA 4DR3Q 4DV0H 2EYLA 2Y0SG 1PRTC 2F3WA 1Q90A 1DZ1A 2R92H 3DUZA 1EFID 3I90A 2N88A 4DPGA 2E2IH 3FDSA 3S16B 1NSNS 1X55A 2V9WA 1BKBA 5KFKA 2AKWB 4EQOA 4C2MB 2GVBA 3M7NA 3HOUB 3D4WA 3F8NA 3GO5A 3U4ZA 2HGSA 4RUAA 1WTVA 2EYHA 2V5AA 4JI7Q 1IYJB 4FNFA 1EIYB 4QWDA 2CFMA 5LL6S 1ONLA 3GV7B 4HIOA 1IL2A 2VS1A 3RGXA 5LHY1 4YCUA 4LF6H 4UP9A 1KL9A 2F1MA 4I55F 1NNXA 1YNNC 4BY7B 4QY7A 3RUPA 1JR0D 4RU9A 3KBXA 1KD1C 3H4BA 3DXJC 4LFBQ 3SK4A 2P5ZX 2PI2A 1UC9A 3H3VI 3CC2A 1BCPB 4QUCA 5C4ZA 5CA0F 3NTIA 4DL7A 3KDFA 3GV6A 1FJGQ 2CQYA 3N42B 3PIOA 3IAYA 1QCBD 1GHKA 5T14A 4FBTA 3KOJA 1CE8A 2RHQB 5LMNH 2K50A 1RTOA 5KNCA 2HJWA 1VQHA 4WRDA 1B50A 3JZIA 2JEJA 4DV6Q 4R4TA 3BJYA 3GTLB 1CQJB 1S3OA 4OXPA 5DAUA 4C56C 3TIIA 3L7ZC 1KJQA 3GTQA 4YBZB 2IA6A 2F0HA 3JC66 1CZWA 1K8GA 2V59A 2ZXRA 3T1HH 4ECUA 2XGQA 2BDNA 4OGQC 4NKLA 4A3KH 3I70A 5JAVA 2B2WC 2ZDGA 1B9MA 1SYEA 2JSOA 2E2JB 3GTKB 3WNZA 3GD7A 3GV8B 3AQQA 3GIMA 1X3GA 4K8IA 3BZKA 1JWMD 2B63B 2UXCQ 4LF5H 5DM73 1HNWH 3EBEA 1JX4A 3A5ZB 3DEPA 3I2ZA 2F03A 5FPOA 1TWHA 5CV5A 2BQRA 3SK8A 2NVYH 3GIPA 4CJ2C 4DNRB 1C8CA 3I56A 5EAYA 4GC6A 2LY7A 5JJLA 4DV7L 2RDFA 3R5XA 3F8TA 2K4KA 1SNMA 3HOWB 1UC8A 5L1JA 3AFPA 4PG3A 5CBEE 4DV2H 1NCVA 2MP1A 2DUDA 3U9SA 1N8RC 1N34Q 1DM0B 1V1QA 1NY4A 4ZCKA 4RMFA 1KLGD 1UE1A 4H44C 1XMQH 5DGAA 2OF1A 1STAA 4KLKA 4AYBA 4KKUA 1L1OB 1ZHQA 4KHVA 5C4HA 1ASYA 4DAVA 1RK5A 1CM9A 3RJ0A 3HKZE 5K2MA 1KAWA 5C5MA 5JPNC 4UAIA 5KFOA 5GONF 4HNVA 4GKKH 1Z6HA 3LMLA 4A3MH 4BBRG 2AQ4A 1VQFA 3G48A 4XXEA 2WINB 3TMEA 3GQBA 3NQTA 5LL6X 2JEGA 4IZ8A 4F8MA 1GVPA 2KENA 3A8IE 3BDOA 5DQHA 1G6ZA 5C4JB 1ET6A 1I50H 2Q8IB 4Y7NH 4A76A 2HQLA 1KJ9A 2B2UC 2IBKA 3PO3B 1BNZA 4NMZA 4IQZA 3HOVG 4TV8F 2XCAA 1V1PA 4R4IA 4FXKC 3S1NB 5D8DA 4J15A 1J8IA 1ENAA 1OO9B 5EPLA 1N32H 1XMOL 2X0SA 3F2BA 2MCTA 4AIMA 5IYBG 2WDTA 2FMCA 2VQEL 3MXNA 5DLFA 2PMZA 2ASLA 3BDLA 1GJXA 2PI2E 5JEAH 2J9GA 2Z6BA 3UI2A 2A68C 4HCSA 2F52A 4NPSA 4A3GG 3PN1A 1CSPA 4A3LH 2HVQA 4ME5A 1S68A 4U673 1E24A 4LW1A 4OIJA 4FYDA 3TP8A 1RODA 3CQZH 1G91A 3ND8A 3CRKC 4DNTB 1IXRA 1KLUD 4LUZA 4QCLA 3PIPA 3Q23A 3TQ1A 1ASZA 3CU7A 1YJ9A 5IP9G 5FLXc 5IYCH 3TRZA 5BPHA 1K83H 1LABA 4MN3A 4RWSC 5ELNA 4ED6A 3NXWA 1X3EA 4RHRA 1S4ZA 5FO8B 1TWAB 4IUVA 1P8LA 2JA6H 4C3JB 1SNCA 5E4XA 2K5NA 4IUNA 2GLTA 2HHHL 2RHSB 1TKWB 2LMCB 2SOBA 5C4XG 2BOSA 2P0AA 3VDYA 5C8YF 5M3FB 3F2UA 1FJGH 1RIPA 3K6OA 5JJKA 1E4EA 5KNDA 2F0PA 3X3MA 2QEXA 4DR6L 3Q0AA 1S5DD 4MIUA 4GKJL 4CGYB 2I5HA 3K0YA 2FK3A 3GLKA 1ZHSA 1FGBD 2UXDH 1SYBA 3UDGA 2EYPA 4IJLA 4WFN3 3TS2A 3PZPA 3SI8A 2QYZA 1YI2A 4RAUC 1B8AA 5C5JA 2EDGA 4ECQA 3IN5A 2XRSD 1UE7A 2ZTEA 4OEMB 1DOKA 1PA6A 4DFAA 4ME3A 2VUMA 3F2DA 4CHTB 5HGQA 1RJRA 1VBHA 2R93H 1VQDA 5I47A 2EY2A 4DR2Q 4V0BA 4FXGC 4A3KB 1HRJA 5C3EG 1I6HH 2ZTDA 1W6KA 1B9NA 4X66L 5FO7B 3CCUA 2ASDA 3CF5A 2YZNA 5EBCA 1BVSA 2KEEA 1G2SA 4ED1A 4DR7Q 2K5DA 3K8AA 1IBMH 4ZQ3A 5DNFA 1E7ZA 4YWLA 1L2ZA 2XIGA 5AFWA 1TWCH 1SFOB 3MJFA 4J9PA 3A56A 4J9RA 2RCFA 4C5AA 1SEIA 3T5LA 1LTTD 4C3HG 1N34H 1EU3A 2NWGA 1B44D 5KG5A 2AGOA 4QIWB 3TSSA 5C0XI 2Q2UA 1D5XC 4YQWA 2JK8A 4XYLB 1GYFA 1M7JA 5KFZA 2W6QA 4EBCA 1B2TA 4G57A 2PMZE 1EL0A 4O3OA 1SBBB 1RYRA 3CCJA 1TY0A 1ULZA 2DJGC 1SE3A 3AMUA 4WBNF 1HR0H 2IY5B 2BR0A 1XNQQ 3HOZB 3G6YA 2E5LQ 3M9MB 5L1KA 5C6AA 5EKLA 5KT4A 1JJCB 2UUAQ 5KT2A 1T9HA 4ED3A 1Y1WH 2G9HD 2QW7A 4QMGA 4C1NK 3O13A 5LMNQ 4A3CG 2OLSA 4JYAQ 4C3IG 4YY3H 4A2AA 2UU9H 3IFTA 1NTGA 1ZEQX 1IW7D 5IP7G 4DV3Q 1ET9A 3VR5A 3MXUA 4K0KQ 3CMEA 4DR5L 2OH2A 4JV5Q 1L0YB 4LSAA 1I50B 1I4RA 5IYDH 2B2UA 5EWEA 4R4CA 4OIKA 4JI3Q 4UP8A 2F0EA 1N36Q 5KFQA 1QNKA 2L55A 4CC5A 3KK7A 1EQQA 2WB1G 4TVAB 2I0QA 2F0SA 4JG2A 4E4TA 5ISRA 3NBHB 4DL6A 1N33L 4P72A 4YAJB 1VQMA 4A93H 3B6YA 2R61A 1JJ2A 2MHVA 1EEFD 4J9SA 4XQNA 3N41B 4C5CA 1SNOA 4IHJF 4EGJA 5C5LA 1YHQA 1SSOA 2PO4A 3CXCA 2W6MA 5KG3A 2K14A 3K5NA 2R8IA 1EQRA 4JI4L 3NE5B 4Q43A 5DG7A 3QO2A 2O5JC 2Z0SA 3CQZB 2RGVA 1MSGA 1HXYD 4IWYA 4ED8A 1QVCA 1K9MC 3TP7A 4CDEC 1ICFB 4DAMA 1M6VA 1SNPA 5C44H 2VPSA 1RL2A 1VF5C 4UCOA 4ZYSA 1B1ZA 1EZ8A 4AQYH 4EEQA 1UNSA 4DR1Q 3M3YH 2OEOA 2GPWA 4GLVB 2JA6B 2RVLA 5IGCA 3R5FA 3RTXA 1HQRD 3FKIA 1EUCB 1XX8A 3ULPA 3OIPA 4ODGA 1BR9A 3MR3A 3SGIA 1HR0W 1DIKA 2K33A 1ZETA 4YHHH 1IBLL 1JJGA 4KHPH 2UUCL 4N8X1 4HJAA 4ECWA 2J4XA 2ZM6H 4DGZA 2MQHA 4R8NA 1LT5D 2M00A 1YJWA 4UCTA 1EUDB 5CB4F 4DV4L 1KNEA 2J6UA 1CSQA 2L12A 4X62L 1JKJB 4X64H 4RNOA 3W1GA 3RBDA 2R92A 2VQFL 5I6YA 3QJYA 2HIVA 4M8AA 4OONA 2E2IA 4MA5A 4TUYF 2F0OA 2HUGA 3CPFA 1M8AA 2R8KA 3H0GG 1BCPF 5HURA 2DIKA 4ABNA 4ALPA 2PQAA 3RNUA 1ILPA 1I7LA 3V96A 1X56A 1SJED 2RCNA 1IW7C 2VB3X 4R4QA 1QZGA 1VMCA 1GO3E 4O4LF 2R93B 2OCEA 4PV1C 4EBEA 1PTOH 4B3SL 3I73A 1RYSA 1BBWA 3M4OH 2YYAA 1KRSA 4JI1L 2Q2IA 3I4NG 5EJWA 4ETSA 2V58A 3K5OA 1I4HA 4RAZA 5KT6A 2SNSA 3S1MB 1SJHD 4H7BA 4JI5H 5ELEA 3NSWA 4DUZL 4XT3B 1XJVA 1PH4A 4LF7L 2QILA 2R7ZB 2AGPA 4IOCA 5DLQE 4YWKA 1AZPA 2R8GA 3TDQA 5KRUA 2ICEC 1I94H 2PQEA 1CQVA 3K7AB 2CKZB 5ELCA 4O3QA 1HZCA 1XNQH 4H13C 2EXDA 4QW8A 3VR2A 4DL5A 2E5LH 2KCNA 2VUMG 4X65H 5I9PA 5A2QE 4IO9A 3HOUG 3GTJH 1JDBB 4I7HA 4UCUA 3GTOB 4CKBA 4DV1Q 3J7ZC 3PMFA 3BU2A 4MHEA 3OTOH 1VQCA 1TY2A 4JPBW 1QOHA 1MKHA 3A74A 1E2ZA 2Q8TA 4JI8H 4I7ZC 2L0CA 3FP9A 1X3QA 3MEHA 2IWHA 1JC7A 3KF6A 1T3NA 4JV5H 2C5CA 2KA7A 1JXLA 1XPOA 5M5YH 1MSHA 1FNUA 2KCCA 1N36H 4LMYA 3DF7A 2DGYA 4GZYC 3JAML 3MFHA 3A8KE 2EY6A 1W3SA 2IP4A 3FRPB 4DV7Q 3ITPA 5KFYA 3LWBA 3OUUA 1GM5A 2BE5D 2Q8RE 4RH6A 4IZOA 2YW2A 2HVRA 3CHBD 3QZ8A 3BQ2A 5CV4A 2KCMA 1RJQA 4NXNH 1SE4A 4K2LA 2BH8A 2F0IA 1SDFA 2DNEA 4ZI7F 2K03A 4KY5A 4TRDA 2RSOA 4JC0A 4DV5L 1NJIC 4HSVA 1RHPA 4KN4C 2K75A 3LWEA 4NDXA 4EQNA 1OXTA 4A93B 1HFGA 4DK1A 3KDFB 3MR6A 1PH3A 5AJ3L 2O2LD 1HUNA 5KG2A 4L6TB 1WFQA 1F2ZA 5IWAQ 3PO2H 1SYCA 1ESFA 2EY1A 1RCVD 3RD4A 5D1PA 4EGVA 5HV6A 3KTMA 4JI2H 4B3MH 1K3RA 1STBA 2PPBC 3GTQB 2B63G 3WO0A 3QOLA 3ETJA 5KFAA 3Q8SB 5L1LA 1HUMA 2F0TA 2G9DA 3MAQA 1F77A 2F3VA 1P16A 2XTIA 4XDXA 1E3PA 1YITA 4BA2I 1KXLA 1EYCA 4M9UA 4MTDA 4DR1H 2FJ2A 2KEDA 2YRWA 4JI6H 3I72A 5IODA 2JA8H 4B08A 1NAPA 1LM0A 5GADC 4KJNA 3HOWG 3GV3A 3HOXB 3MZ5A 4A4IA 4R4OA 4FXDA 5C44B 1K3BC 1HFNA 1PH6A 3BG5A 2W70A 1S9FA 1W93A 4JBJA 3MHBA 1C4QA 1YBYA 2Z1CA 2SDFA 1TWHB 1NUCA 4XQQA 2JN4A 1XMOQ 1HNXH 4K6DA 2JA5A 3WDNA 1R4PB 2VQEQ 1Y8OB 2R84A 3RB6A 3LWUA 5IT9W 2D62A 2BA1A 3M4YA 2W57A 1S10A 4F4YA 5KG7A 1TWGA 4XYMB 1T36A 1QUQA 3U58A 2WAQA 4MV6A 2C22A 2NZHA 2BCOA 2K5VA 3U9TA 2UVVA 1O7YA 1S5FD 4AYBB 3MVVA 4ZLTF 4CJ0B 4L5SA 1G2TA 1WCMA 1KTKA 3EVQA 4J1MA 1VKZA 3Q6SA 3MEFA 3I12A 1IL8A 1WJJA 1XXGA 1GSOA 4MV9A 3QIAA 1WTHA 1AN8A 1PH8A 4F4WA 1K83A 2VOBA 4Z9CB 4YWMA 2SCUB 5KT7A 1SMXA 3R2TA 2HHHQ 3VYUA 2UUBL 3SEBA 1PTOB 4Q8FA 1SRUA 3CKIB 4A3FB 1B4OA 5JH7F 3L3OC 4EFEA 1LTLA 4A3EH 1V1PB 3EIVA 4HNUA 3BDCA 2QKIC 4DR6Q 1PLFA 4GKJQ 2B8GA 1LTID 1EZ6A 1IZ6A 4JBMA 2Y0SE 1AEXA 3K57A 2K5WA 4UHVA 4A3DB 1WD1A 4DV1H 3MXNB 1O78A 2R92G 3HP3A 3RIZA 3A8JE 5KG4A 1C48A 3MXGA 2EPBA 4PZ6A 3S1QB 2RDHA 2WACA 1BBUA 2OTJA 5M5WH 4I50F 2R7NA 3PV0A 3D8GA 3MC0B 4FVMA 3RLOA 1PRTB 4X66Q 3CCQA 4C3JG 4IFDJ 3T1YL 1WD0A 1KJJA 5JVH3 5BN5A 4DV7H 4HQ6A 5JUMA 5M5YB 2MGSA 4QL5A 2BQUA 5M3FG 3L0OA 1LTBD 1VQAA 2I5MX 4FO2A 5C0XG 3U50C 5D1OA 4O42A 2FFKB 1EY5A 1TWCA 3TP5A 2UVRA 4OO1H 1Z2NX 3OHBA 3FKIH 3I7FA 1STGA 2W6NA 2Q2TA 1A15A 4TQSA 3D4DA 4HMJA 1EY6A 1ICWA 2ZTCA 3QWNA 3OW2A 3J80L 4G7HC 3N43B 2L5TA 1Y1VH 4A3BH 1J5EH 1X32A 3VYTA 2KHJA 1E4EB 2JP1A 4DAYA 1E4FT 1UWVA 5IWAH 3S24A 1D6EC 4LMQD 5M5XB 5ELOA 4BY1H 2Z4IA 2E8GA 1AP0A 4P71A 5K36H 3HKZA 2Z9HA 2E76C 1VQJA 5E1FA 3S2HH 2NU7B 4A3KG 2LXKA 4G7ZC 1GD7A 4J0MA 4PZ7A 3ERQA 3H4DA 1JT8A 1Y1WA 2VUMB 4NP5A 3VYSA 3GTGH 4RZRA 3JRXA 3LNNA 4DR5Q 2ZDQA 5KFRA 3V05A 2OQ0A 1Q7YC 2C00A 3KYHC 3C2PA 3DLLA 3RR5A 4GN3B 5J39A 4GNXC 4B3RL 2YS7A 3S15H 3GP7A 1HA6A 5KKNB 2V1CC 1I4GA 5A2QW 3AFQA 3F1ZA 3KJOA 1N33Q 2NVQH 5IOCA 5GAGC 3DHQA 1IOWA 2FLNA 1KAAA 3K80C 5G3LF 1HZAA 3ZYYX 2FINB 3HOZG 1I3QA 4KKSA 1JB7A 1MJCA 1IKLA 3JSLA 2MO0A 2FHTA 3J81W 2MFIA 1EIFA 1AZQA 3SE0A 3Q8PB 4LNQA 2FLLA 4LF9L 3I91A 2A68D 2CVRA 2JA7A 1K8MA 3SHLA 1V4YA 4ZKCB 2I07B 3KHGA 4RB2C 1UAPA 4LF8L 4GS3A 1HNZL 4LFCL 5KFVA 4PWQA 4IALA 2JA9A 2F0VA 1CS0A 2D0OA 4RGMA 4XYQA 2UXBL 5KFMA 1VQPA 3WOEA 4J6HA 5LMUL 4OL7A 3KUPA 3H94A 3BQ1A 1BO0A 4XTCS 2PN1A 3GTPH 4NXML 3GIKA 3DM1A 3JSNA 1R9TA 3QZ7A 4G4KA 5DGBA 2PCFB 5KNBA 4GKJH 5I9OA 2F4VH 1HZ9A 2PYKA 3RN2A 5KFLA 1JLLB 3D6CA 1Z2OX 5IE8A 3CCSA 2R3ZA 1IBLQ 3IL8A 3RV3A 1CUKA 3L9AX 4APVA 3H40A 1WYDA 4L5RC 4DKAC 5JEAG 4APMA 1ENFA 4DV4Q 1U4PA 4N9PA 1DOMA 1VS0A 4A3LG 2OT2A 4X62Q 2K6AA 4CJ1B 4RNMA 3P7JA 3CD6A 2VQFQ 4UCRA 1OXVA 4HYKA 1LT4D 4DUYL 4X66H 2XRQD 1IBKQ 1EY8A 1AFPA 1KHIA 5A35A 2NVXA 1EY7A 4XT1B 5IYCG 3K5MA 5ELDA 1PH7A 1DCZA 5CORA 1R4QB 1DONA 1TS5A 4DF7A 1CZGA 4B3SQ 2FP4B 4ECVA 1S0NA 2JA6G 1VQOA 2C35B 3PW2A 3T51B 2FPGB 4JI1Q 3BVGA 5GAHC 3MA2B 5EGTA 5LA6F 5CV6A 2KSWA 4L5TA 1OXUA 1JOKA 2AGQA 4LF7Q 4TV9F 3CCMA 2IX3A 2J6TA 4LFAH 4IN3A 5BR8Q 3CMAA 3NPPA 4Q45A 2JA5H 1GUOA 2YTXA 3H6MA 2AUKA 5BN4A 2ENBA 1LT6D 1O7LA 3FKIB 5CMDA 3C46A 5JVDF 4RGOS 4DV0L 3R23A 1TWGH 3ERSX 1SNQA 2EZVA 4DR3H 3OSOA 2YTYA 1VQ7A 1I6UA 4HJ9A 3D0FA 4X3UA 3CC4A 5CGKA 3R5HA 2DLNA 4IUPA 1WTXA 3GTJA 4BY1B 3K5IA 4GOPC 4YR0A 4ECZA 2TMPA 5LL6b 4O0AA 1O7ZA 1L2FA 3R93A 1WCMH 2ATWA 2R93G 1WI5A 2WIIB 1K1SA 2R92B 1YNJC 1HJPA 1C7YA 2E2IB 4JI7H 4JBWA 4X6AH 1A62A 5KFPA 1W96A 1PFBA 1F9RA 3FMCA 2PQAB 5J3BA 4LF6L 1L1OC 1I7NA 3BA8A 3RZOH 1XTDA 1TQOA 2AUJD 1XNRL 3NTHA 2R7ZG 3M9NB 4HSPA 5CAEB 2H5XA 5FD6A 4F50A 2B2YC 1BDOA 3S15B 4FDBA 4LFBH 1MHWC 3ULJA 4B3TL 4Q0YA 3W1BA 1WTOA 2HVSA 4O1NA 3TQYA 3DEOA 1LTSD 2M2LA 5FLXE 2HDMA 4JOIC 4UDUC 5AJ3Q 5IGEA 4BBRH 4DV6H 3ORRA 3PVXA 3RBEA 2EE1A 3T1HL 2HCCA 1T5XD 3Q8DA 3RZDH 5FJ8H 1GOZA 5KFXA 3A0JA 3WWVA 3HS0C 4O3NA 4KKTA 3HOVH 3S17H 1U0LA 4XQJA 4Q44A 2F0WA 1ZYRD 4EVOA 4CKEA 3V4ZA 3Q8QB 4LF5L 2KVMA 2KQ3A 2QDBA 4KK7A 5CBAE 1HNWL 2UXCH 3M9BA 1V51A 3TINA 4IPCA 3VA7A 1SAPA 5IYDG 2B2WA 1A0IA 1B70B 3H09A 2NB0A 1STHA 4HEDA 2WB1E 4MAMA 2K1BA 3E0JA 3TZUA 5CV8A 4WD3A 4DV2L 2IPKD 4JW0A 1Y14B 2KECA 3IRBA 4BBSH 4C2MA 2PZWA 4A3GH 4A93G 3NQIA 2NVYB 4KI0A 1XMQL 3MR5A 1EHIA 4DR4L 1NMGA 2PZTA 1T94A 5C3WA 4QF4A 1YEZA 1UE6A 1C0AA 3DM3A 5D3IB 1A3UA 5HGTA 1EWCA 3X3NA 2ES2A 1B33N 4GKKL 1IBKH 1V43A 5IP9H 1BF4A 1TWFH 5EPJA 3CCVA 1VQ5A 3J7A5 3CVZA 1HQMC 3VYRA 2VR1A 1YVCA 3A7AB 1PMRA 1FNWA 4B3SH 1PH2A 4K6LA 3WOFA 3Q1KA 2KUMA 2A5HA 3HOXG 4HJ8A 4JI1H 2Z4HA 2R7LA 3RMHA 5C44G 3STBD 4A3MB 1K73C 3N6XA 2UUBQ 3NBIA 3OWEB 2K52A 2D5DA 3EN2A 4HTHA 3RLNA 3J7AV 5BR8H 1O75A 3VPBA 3RB4A 1N32L 4Y7NB 1CTMA 4U6PA 1E1OA 3RV4A 3C1FA 5KFCA 3OWFA 4V190 2F0MA 5CR3A 4PNYA 1RD9D 1SE8A 4ED7A 5K5PA 2A6HC 2XVSA 4FS1A 1BJTA 2NUCA 3K59A 4AYBG 1I3QH 4DK3C 2DPJA 2XIWA 1TWGB 1QUQB 3HFZB 1D5MC 1PXUA 2WAQB 1YZ6A 1Q82C 1S0OA 2R6FA 4PZ8A 4BA1I 3I4MH 3P1HA 1K1QA 3BABA 2JA7H 2OQKA 2PVPA 2QCPX 3C0FB 3A54A 5D3DA 2FXQA 1EYAA 1ZYRC 4GOPA 4RB1A 4IFDH 1II3A 3T1YQ 5FOBB 1WCMB 3MFIA 5DG8A 2N78A 4HJ5A 5C0XJ 5KFEA 3D3RA 4C3HH 4A3FG 4QWCA 3SR1A 5J22A 4IUTA 2E2HA 1L1OA 1Q3LA 1R9TH 2FJZA 3VA5A 4QW9A 1FJGL 1K83B 1JCKB 2PW5A 4GC7A 3MXPA 1JDEA 5JJZA 4NW2A 4KMUC 1V8QA 4J9LA 4A3DG 1C30A 1I4PA 2PBZA 3A55A 2HQEA 1VDZA 2UXDL 1TAEA 3V6JA 2B2YA 2IL8A 1MI2A 1N9WA 2K5HA 1Y8NB 1Y1VA 2DY8A 2EYJA 3E9IA 1EY0A 1CHPD 3MWEA 4UCSA 5DLGA 2EJFC 2IW3A 3S9WA 3ORQA 1MIUA 3SDZA 4N8FA 3NHHA 4O2AF 1TS4A 4Y52H 4G7OC 2H1EA 1FL0A 3RGZA 5D65A 4KD4A 1JQYD 3WO1A 1HTLD 3RZDB 2ZDHA 1A9XA 4DR2H 1HA5A 2NVXH 4ECXA 3STBC 4DXGA 4ZRZA 2CHBD 1RF2D 3KFUA 1VQ9A 1IBML 3GIQA 3GTGA 4DR7H 2SEBD 1G291 1CKOA 3EROA 4B3RQ 3R2IA 2DWCA 4O4IF 5IIFA 2BQ3A 3G71A 3T16A 2L9HA 2VY3A 1I6HB 1A3VA 1NMFA 1LUZA 3BAAA 2JEIA 5D1OB 3AEVA 4IWXA 5BPFA 1UEAB 1EYGA 2CQOA 1PHJA 3VPDA 1EY9A 1TWCB 3CRLC 5CV9A 1CT1D 1QG7A 3UDIA 1ENCA 4BBSB 4YJ3F 2NU9B 4DAPA 4R9WA 1WTWA 4WJWA 1H9JA 4IR1A 4A3IH 2RDGA 3NP8A 4JVZA 4XYOA 1HR0L 5LP6F 1K8OA 3G6VA 5IGDA 2RDJA 1VQBA 2F0KA 4LF9Q 1Q8KA 1TWAA 4DAYB 3I4LA 3PIP3 2I8CA 1S03G 1GGOA 2UUAH 2V4DA 2FMMA
chains in the Genus database with same CATH topology
3AFPA 4PG3A 3MXNB 4A3JH 2R92G 1HNZQ 3J81j 2DUDA 4YY3L 1JMCA 2R6GA 1N8RC 2UU9L 4LFCQ 1N34Q 2L15A 1HH2P 1V1QA 2A1AA 3K7AH 1NY4A 2VW9A 4RMFA 2UXBQ 2IHFA 4JI5Q 1UE1A 4PZ6A 5C4XH 1U5KA 5LMUQ 1PH9A 3H15A 4KLKA 2KCTA 3UDFA 3RN5A 4LFAL 1BBUA 2OTJA 5M5WH 1L1OB 1KQSA 4NXMQ 2EIFA 1D7QA 3PV0A 1TXYA 1ASYA 3GTOH 3HKZE 1I94Q 3RLOA 1KAWA 4X66Q 3CCQA 2BH2A 2LSSA 4IFDJ 3T1YL 1CKMA 2MNAA 4A3MH 4BBRG 4IJHA 1VQFA 3G48A 4X65Q 4DR3L 2JE6I 1GVPA 2KENA 4QL5A 5M3FG 3L0OA 2I5MX 1VQAA 4DNIA 5C0XG 2VZAA 3U50C 1X54A 1I50H 4Y7NH 3OTOQ 4A76A 2HQLA 4OX9L 2XGTA 2ZJPA 3G4SA 1H95A 3HOVG 3FKIH 3I7FA 1VQ6A 4JI8Q 2Q2TA 4R4IA 3H0GH 4JI7L 1XPRA 2ZTCA 4J15A 3OW2A 5C3EH 2QGQA 1YHAA 1Y1VH 2YYZA 4A3BH 2AWOA 2KHJA 4DUYQ 4MNOA 1XMOL 1UWVA 3J80c 3F2BA 1VQLA 3S24A 2IT1A 2ALYB 4AIMA 5IYBG 5ELOA 2VQEL 1Q1EA 4BY1H 3KLWA 2QA4A 2E8GA 4EQ5A 5GAEC 3CAMA 4P71A 5LMNW 1VQJA 2PI2E 3S2HH 3I4NH 1C0AA 1YHBA 2LXKA 4A3KG 2VL6A 1GD7A 4AQYL 4NXNQ 2F52A 4NPSA 2Z6KA 4PZ7A 3HOYH 4A3GG 4LFBL 1CSPA 4A3LH 1EOVA 3M85A 1JT8A 3AYHB 1E24A 4LW1A 2KBNA 4O2DA 2YU9H 5E7NA 3GTGH 2Q2HA 3CQZH 2CWAA 3TREA 4GN4B 3GTQH 4DR5Q 1IXRA 4LUZA 2OQ0A 2WP8J 1CKNB 3PUVA 4A3IG 3D31A 3KYHC 3PIPA 1Q7YC 3J80i 3DLLA 4DV6L 3RR5A 1ASZA 4GN3B 1YJ9A 5IP9G 4GNXC 4B3RL 4YHHL 5FLXc 3PUZA 4KHPL 5IYCH 3TRZA 4UY8C 1FVIA 4C2MH 3UE1A 3S15H 3U4VA 4B3MQ 1K83H 2ZM6L 4DV0Q 4JI2Q 5ELNA 2NVTH 2V1CC 1X3EA 4JV5L 3HOXH 4A3JG 2JA6H 1P8LA 3AFQA 4P75A 3F1ZA 3KJOA 4JBKA 1N33Q 2NVQH 4A3CH 4X64L 1SLJA 2K5NA 4JOIA 1L0WA 5GAGC 4C3IH 2I5LX 5M3MH 4PMWA 2HHHL 2RHSB 1E1TA 2N49A 4DK6C 1TWHH 3K80C 4JI6Q 5IP7H 5C4XG 1HZAA 3VDYA 2UXCL 2ZJRA 3PGZA 1M90C 3HOZG 1RIPA 1JB7A 5JJKA 1MJCA 5FLMG 4GLAC 2QEXA 4BY7H 4DR6L 2MO0A 4GKJL 2MO1A 2I5HA 2MFIA 1EIFA 2R7FA 4LNQA 2GN5A 3UDGA 4LF9L 2JQOA 1HNXQ 4IJLA 4LF6Q 4UP7A 3TS2A 1PVOA 1YI2A 1B8AA 3NELA 4LF8L 3KF8B 4GS3A 4LUVA 1HNZL 1XNRQ 4IFDI 4LFCL 1UE7A 2ZTEA 3S2DH 1N34L 1PA6A 2JA9A 4A75A 1QZHA 2D0OA 4ME3A 2UXBL 4JI5L 1VQPA 4JI0Q 1VQ8A 5LMUL 3GTLH 3FKIG 3F2DA 4XTCS 1VQ4A 5HGQA 1I5FA 3GTPH 4B3TQ 1CKNA 1VQDA 4DR2Q 4NXML 2R93H 2BA0A 1FGUA 5C3EG 1I94L 1I6HH 1IBKL 2ZTDA 4X66L 4A3BG 3CCUA 3CF5A 1BVSA 1HZ9A 4MZ9A 3RN2A 3CC7A 4DR7Q 1Z47A 3K8AA 3PF5A 4YWLA 1E7ZA 4X65L 4BY1G 2AHOB 5IE8A 1TWCH 3CCSA 3PO2G 4WJ4A 1IBLQ 1CUKA 4HIDA 4APVA 2IHEA 5K36G 1WYDA 4L5RC 4NB3A 4DKAC 5JEAG 3I55A 3L2PA 3T1HQ 4A3FH 3OTOL 4YCWA 4LF8Q 3HOYG 4DV4Q 1VS0A 1AE3A 1QVFA 4A3LG 4X62Q 4JI8L 1Q12A 1PYBA 5C0XI 2Q2UA 3CD6A 2JK8A 3M4QA 5IY0A 5BR8L 2VQFQ 2JA8G 1OXVA 4LF5Q 4A3DH 1HNWQ 2PMZE 4DUYL 1EUJA 1Q81C 3CCJA 1N36L 3J81c 1IBKQ 1KHIA 2CWPA 3FHWA 4QIWE 2IY5B 1QVGA 1XNQQ 5IYCG 1PH7A 2E5LQ 3CPWA 3S1QH 1JJCB 2UUAQ 1T9HA 2E2HH 4B3SQ 3W5OA 1Y1WH 5JEAJ 1VQGA 3OYYA 3G6EA 4DV2Q 4HJ7A 2JA6G 4BXXH 1VQOA 2C35B 5LMNQ 1VQNA 4NXNL 4A3CG 4JI1Q 4JYAQ 5GAHC 5M3MG 1XMQQ 1NTGA 1OXUA 4L5TA 4LUOA 5H1SE 5IP7G 4DV3Q 4DR4Q 4LF7Q 2N8NA 4K0KQ 3CMEA 4OWXB 3CCMA 4DR5L 4JV5Q 5BR8Q 3CMAA 4MTNA 4BY7G 3J81i 1KIXA 2JA5H 5IYDH 2YTXA 4R4CA 3KJPA 2ZJQA 4GKKQ 4JI3Q 4UP8A 3HKSA 3UE0A 3PUXA 1N36Q 3PO3H 1A63A 4B3ML 2OWOA 4DV0L 4JI2L 1W2BA 1TWGH 2A19A 1EWIA 1EQQA 3ERSX 1JE5A 2WB1G 4TVAB 2YTYA 2I0QA 4JG2A 3S1NH 4QQBX 3NBHB 1VQ7A 1N33L 3BZCA 3H3VH 4P72A 1VCIA 1VQMA 4HJ9A 4OWWB 3D0FA 4HIKA 3CC4A 4A93H 3B6YA 3ER0A 1VQIA 4DR1L 1JJ2A 4LF4Q 3CCLA 4P73A 1PV4A 4GOPC 1DGSA 4JI6L 5M5XH 4O0AA 1L2FA 4L5QA 1WCMH 2ATWA 2R93G 1WI5A 5GQOA 1YHQA 1KC8C 3NENA 1HJPA 1YJNA 1J5EQ 1C7YA 4JBWA 4A3EG 2D0PA 3CXCA 4X6AH 1A62A 2K14A 1N32Q 5JJIA 1EQRA 4JI4L 3K81C 2RF4A 5J3BA 1HNXL 2PQAB 1Q46A 3S16H 4LF6L 1L1OC 1Z9FA 1S72A 2Z0SA 2VUMH 2B29A 3RLFA 3RZOH 3HOUH 1XTDA 1XNRL 2R7ZG 1C9OA 1QVCA 1XPUA 1K9MC 4DAMA 3LGJA 5C44H 2H5XA 4JI0L 1RL2A 1Q1BA 2R7DA 2R7ZH 1VQKA 1G6PA 1V9PA 4FDBA 4DR1Q 1WOCA 3M3YH 3I4OA 4JCVE 3ULJA 4B3TL 4DR2L 1PYSB 4GLVB 3BJUA 3W1BA 1PH5A 4POGA 1TWAH 3TQYA 2A8VA 4JOIC 3ULPA 2ID0A 4C3JH 1MJEA 2YTVA 4DR7L 5AJ3Q 3TS0A 1KRTA 4BBRH 3SGIA 1HR0W 4JI4Q 4A3MG 1IBLL 2YV5A 1JJGA 2UUCL 4XIGS 4HJAA 5M3FH 3CW2C 3T1HL 3GDEA 3Q8DA 3RZDH 4BXXG 2MQHA 5FJ8H 3CCRA 1YJWA 4DV4L 3A0JA 3WWVA 1G51A 1CSQA 4X62L 3ULLA 4R1JA 3HOVH 3S17H 1U0LA 3W1GA 2ASBA 1VQEA 4UPAA 3NEMA 4POFA 2VQFL 4LF5L 4OO1G 2HIVA 4OONA 1HNWL 1OXXK 3M9BA 3CPFA 3H0GG 2EQSA 4ALPA 3RNUA 2PQAA 2JA5G 4IPCA 1X56A 5IYDG 1Y1VG 3ICEA 1O7IA 2RCNA 3TEHB 4KHZA 2UXDQ 1A0IA 1B70B 1XNQL 4RG1A 4R4QA 1QZGA 2E5LL 3PO3G 2AMCB 1GO3E 2WB1E 2E2JH 2UUAL 3GTKH 2OCEA 4P74A 4B3SL 4DV1L 2KHIA 1YNXA 2WAQG 3PUWA 3CCEA 4DV2L 2B63H 2UUCQ 1HZBA 1BBWA 1Y14B 3IRBA 5LMNL 2NN6G 1KRSA 4JI1L 3M4OH 2Q2IA 4BBSH 3I4NG 4IPGA 4JYAL 4A3GH 4A93G 4KI0A 4OWTB 1PFSA 1XMQL 2N3SA 4DV3L 4DR4L 1NMGA 1XJVA 4DUZL 1PH4A 4LF7L 4K0KL 4WJ3M 2IX1A 1YEZA 1UE6A 1WCMG 4IOCA 3K0XA 3DM3A 5DLQE 4YWKA 3S1RH 1S40A 3A5UA 1SFOH 3HOWH 1X65A 2ES2A 2F4VQ 4GKKL 4JI3L 1SR3A 1B7YB 1V43A 5IP9H 2CKZB 1TWFH 3CCVA 1HZCA 1VQ5A 1IBMQ 3J7A5 2EXDA 2VUMG 4GOPB 1Q86C 1OXSC 1YVCA 2PNHA 4IO9A 3GTJH 3HOUG 1AE2A 1PH2A 1K8AC 4IPHA 2B3GA 4DV1Q 4GLXA 1UEBA 3K7UC 2WFWA 3BU2A 3J7ZC 3HOXG 3F2CA 4HJ8A 5C44G 4LF4L 1VQCA 1J6QA 3STBD 1MKHA 1AH9A 1PH1A 3A74A 4GN5A 1K73C 1D8LA 5HY6A 3HOZH 2UUBQ 3E0EA 2K52A 2AWNA 3FP9A 3EN2A 4GNXB 3RLNA 1OTCA 3KF6A 4LWCA 5FLMH 4DUZQ 1J5EL 1E22A 5M5YH 5GROA 1XPOA 1X9NA 1N32L 2HIXA 1UE5A 1E1OA 5IWAL 5C4JH 1HR0Q 2DGYA 1W3SA 3E9HA 1X6OA 1SROA 1SE8A 4DV7Q 4IPDA 1GM5A 3JAMc 5FJ8G 3PUYA 2F3IA 2NZOA 1EFWA 4AYBG 1I3QH 1M1KC 2KCMA 4DK3C 4YY3Q 2UU9Q 2BH8A 1NE3A 4IOAA 1QUQB 1YIJA 3HFZB 4QJFA 2JEAI 1X3FA 1YZ6A 1Q82C 3UDXA 4JC0A 4DV5L 1NJIC 4HIMA 4PZ8A 4LFAQ 4BA1I 3GTMH 3I4MH 2K75A 1OXTA 2JA7H 2OQKA 3KDFB 1PH3A 5AJ3L 2FXQA 4GOPA 2Z6KC 3PCOB 1WFQA 5IWAQ 3T1YQ 3PO2H 3PF4A 2WAQE 1GKHA 3JAMi 4DR3Q 2N78A 1K3RA 4HJ5A 2Y0SG 4YCVA 5C0XJ 2CCZA 2B63G 2JJQA 2R92H 4C3HH 4A3FG 4DPGA 2E2IH 4BBSG 2XTIA 4BA2I 1P16A 1YITA 4OX9Q 1E3PA 1SN8A 1KXLA 1X55A 1L1OA 4GNXA 1BKBA 2AKWB 1R9TH 2GVBA 3M7NA 1FJGL 2JA8H 3GO5A 3U4ZA 1LM0A 5GADC 3HOWG 2IX0A 4A4IA 4R4OA 4DV5Q 4JI7Q 4A3DG 1IYJB 1PH6A 1EIYB 2UXDL 4OO1I 2CFMA 3HKZG 4JBJA 1YBYA 3CP0A 4HIOA 1N9WA 2K5HA 1XMOQ 1IL2A 2LXJA 2VS1A 3PSIA 4YCUA 4UP9A 2VQEQ 1KL9A 4QGUA 2HT1A 3E9IA 2D62A 2BA1A 4QY7A 1Y1WG 1MIUA 3M4PA 1K0RA 1QUQA 3U58A 4Y52H 4AQYQ 1KD1C 1FL0A 4LFBQ 2NZHA 2PI2A 4H02A 3H3VI 2K5VA 2NN6I 3CC2A 3KDFA 1FJGQ 3ZJYC 3PIOA 2NVXH 2GVAA 2F4VL 3KOJA 4AH6A 2RHQB 3STBC 4EX5A 2K50A 4L5SA 3KF6B 1VQHA 1VQ9A 3KFUA 1IBML 4DV6Q 4R4TA 1G291 3MEFA 1S3OA 1CKOA 4OXPA 5IYBH 4YHHQ 3L7ZC 1NBWA 2OTLA 3S14H 1LYLA 4B3RQ 4KHPQ 3G71A 1WJJA 2ZM6Q 3JC66 2VY3A 1K8GA 4AYBE 4A3KH 1NMFA 1PH8A 1LUZA 4X64Q 4YWMA 3AEVA 1A8VA 1SMXA 2HHHQ 1EYGA 2CQOA 2UUBL 3GD7A 4TQUS 3AQQA 1PHJA 1X3GA 3BZKA 1SRUA 3UDIA 2UXCQ 3I4MG 3EBEA 2VNUD 1LTLA 3A5ZB 4A3EH 3EIVA 3I2ZA 2JA7G 4A3IH 4DR6Q 1HR0L 4GKJQ 2NVYH 4IFDG 3I56A 1VQBA 5EAYA 3S1MH 4LF9Q 1IZ6A 1Q8KA 4DAYB 4JBMA 2JEBI 2Y0SE 4DV7L 5JJLA 3F8TA 2K4KA 5IT9c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFP A;  4PG3 A;  3MXN B;  4A3J H;  2R92 G;  1HNZ Q;  3J81 j;  2DUD A;  4YY3 L;  1JMC A;  2R6G A;  1N8R C;  2UU9 L;  4LFC Q;  1N34 Q;  2L15 A;  1HH2 P;  1V1Q A;  2A1A A;  3K7A H;  1NY4 A;  2VW9 A;  4RMF A;  2UXB Q;  2IHF A;  4JI5 Q;  1UE1 A;  4PZ6 A;  5C4X H;  1U5K A;  5LMU Q;  1PH9 A;  3H15 A;  4KLK A;  2KCT A;  3UDF A;  3RN5 A;  4LFA L;  1BBU A;  2OTJ A;  5M5W H;  1L1O B;  1KQS A;  4NXM Q;  2EIF A;  1D7Q A;  3PV0 A;  1TXY A;  1ASY A;  3GTO H;  3HKZ E;  1I94 Q;  3RLO A;  1KAW A;  4X66 Q;  3CCQ A;  2BH2 A;  2LSS A;  4IFD J;  3T1Y L;  1CKM A;  2MNA A;  4A3M H;  4BBR G;  4IJH A;  1VQF A;  3G48 A;  4X65 Q;  4DR3 L;  2JE6 I;  1GVP A;  2KEN A;  4QL5 A;  5M3F G;  3L0O A;  2I5M X;  1VQA A;  4DNI A;  5C0X G;  2VZA A;  3U50 C;  1X54 A;  1I50 H;  4Y7N H;  3OTO Q;  4A76 A;  2HQL A;  4OX9 L;  2XGT A;  2ZJP A;  3G4S A;  1H95 A;  3HOV G;  3FKI H;  3I7F A;  1VQ6 A;  4JI8 Q;  2Q2T A;  4R4I A;  3H0G H;  4JI7 L;  1XPR A;  2ZTC A;  4J15 A;  3OW2 A;  5C3E H;  2QGQ A;  1YHA A;  1Y1V H;  2YYZ A;  4A3B H;  2AWO A;  2KHJ A;  4DUY Q;  4MNO A;  1XMO L;  1UWV A;  3J80 c;  3F2B A;  1VQL A;  3S24 A;  2IT1 A;  2ALY B;  4AIM A;  5IYB G;  5ELO A;  2VQE L;  1Q1E A;  4BY1 H;  3KLW A;  2QA4 A;  2E8G A;  4EQ5 A;  5GAE C;  3CAM A;  4P71 A;  5LMN W;  1VQJ A;  2PI2 E;  3S2H H;  3I4N H;  1C0A A;  1YHB A;  2LXK A;  4A3K G;  2VL6 A;  1GD7 A;  4AQY L;  4NXN Q;  2F52 A;  4NPS A;  2Z6K A;  4PZ7 A;  3HOY H;  4A3G G;  4LFB L;  1CSP A;  4A3L H;  1EOV A;  3M85 A;  1JT8 A;  3AYH B;  1E24 A;  4LW1 A;  2KBN A;  4O2D A;  2YU9 H;  5E7N A;  3GTG H;  2Q2H A;  3CQZ H;  2CWA A;  3TRE A;  4GN4 B;  3GTQ H;  4DR5 Q;  1IXR A;  4LUZ A;  2OQ0 A;  2WP8 J;  1CKN B;  3PUV A;  4A3I G;  3D31 A;  3KYH C;  3PIP A;  1Q7Y C;  3J80 i;  3DLL A;  4DV6 L;  3RR5 A;  1ASZ A;  4GN3 B;  1YJ9 A;  5IP9 G;  4GNX C;  4B3R L;  4YHH L;  5FLX c;  3PUZ A;  4KHP L;  5IYC H;  3TRZ A;  4UY8 C;  1FVI A;  4C2M H;  3UE1 A;  3S15 H;  3U4V A;  4B3M Q;  1K83 H;  2ZM6 L;  4DV0 Q;  4JI2 Q;  5ELN A;  2NVT H;  2V1C C;  1X3E A;  4JV5 L;  3HOX H;  4A3J G;  2JA6 H;  1P8L A;  3AFQ A;  4P75 A;  3F1Z A;  3KJO A;  4JBK A;  1N33 Q;  2NVQ H;  4A3C H;  4X64 L;  1SLJ A;  2K5N A;  4JOI A;  1L0W A;  5GAG C;  4C3I H;  2I5L X;  5M3M H;  4PMW A;  2HHH L;  2RHS B;  1E1T A;  2N49 A;  4DK6 C;  1TWH H;  3K80 C;  4JI6 Q;  5IP7 H;  5C4X G;  1HZA A;  3VDY A;  2UXC L;  2ZJR A;  3PGZ A;  1M90 C;  3HOZ G;  1RIP A;  1JB7 A;  5JJK A;  1MJC A;  5FLM G;  4GLA C;  2QEX A;  4BY7 H;  4DR6 L;  2MO0 A;  4GKJ L;  2MO1 A;  2I5H A;  2MFI A;  1EIF A;  2R7F A;  4LNQ A;  2GN5 A;  3UDG A;  4LF9 L;  2JQO A;  1HNX Q;  4IJL A;  4LF6 Q;  4UP7 A;  3TS2 A;  1PVO A;  1YI2 A;  1B8A A;  3NEL A;  4LF8 L;  3KF8 B;  4GS3 A;  4LUV A;  1HNZ L;  1XNR Q;  4IFD I;  4LFC L;  1UE7 A;  2ZTE A;  3S2D H;  1N34 L;  1PA6 A;  2JA9 A;  4A75 A;  1QZH A;  2D0O A;  4ME3 A;  2UXB L;  4JI5 L;  1VQP A;  4JI0 Q;  1VQ8 A;  5LMU L;  3GTL H;  3FKI G;  3F2D A;  4XTC S;  1VQ4 A;  5HGQ A;  1I5F A;  3GTP H;  4B3T Q;  1CKN A;  1VQD A;  4DR2 Q;  4NXM L;  2R93 H;  2BA0 A;  1FGU A;  5C3E G;  1I94 L;  1I6H H;  1IBK L;  2ZTD A;  4X66 L;  4A3B G;  3CCU A;  3CF5 A;  1BVS A;  1HZ9 A;  4MZ9 A;  3RN2 A;  3CC7 A;  4DR7 Q;  1Z47 A;  3K8A A;  3PF5 A;  4YWL A;  1E7Z A;  4X65 L;  4BY1 G;  2AHO B;  5IE8 A;  1TWC H;  3CCS A;  3PO2 G;  4WJ4 A;  1IBL Q;  1CUK A;  4HID A;  4APV A;  2IHE A;  5K36 G;  1WYD A;  4L5R C;  4NB3 A;  4DKA C;  5JEA G;  3I55 A;  3L2P A;  3T1H Q;  4A3F H;  3OTO L;  4YCW A;  4LF8 Q;  3HOY G;  4DV4 Q;  1VS0 A;  1AE3 A;  1QVF A;  4A3L G;  4X62 Q;  4JI8 L;  1Q12 A;  1PYB A;  5C0X I;  2Q2U A;  3CD6 A;  2JK8 A;  3M4Q A;  5IY0 A;  5BR8 L;  2VQF Q;  2JA8 G;  1OXV A;  4LF5 Q;  4A3D H;  1HNW Q;  2PMZ E;  4DUY L;  1EUJ A;  1Q81 C;  3CCJ A;  1N36 L;  3J81 c;  1IBK Q;  1KHI A;  2CWP A;  3FHW A;  4QIW E;  2IY5 B;  1QVG A;  1XNQ Q;  5IYC G;  1PH7 A;  2E5L Q;  3CPW A;  3S1Q H;  1JJC B;  2UUA Q;  1T9H A;  2E2H H;  4B3S Q;  3W5O A;  1Y1W H;  5JEA J;  1VQG A;  3OYY A;  3G6E A;  4DV2 Q;  4HJ7 A;  2JA6 G;  4BXX H;  1VQO A;  2C35 B;  5LMN Q;  1VQN A;  4NXN L;  4A3C G;  4JI1 Q;  4JYA Q;  5GAH C;  5M3M G;  1XMQ Q;  1NTG A;  1OXU A;  4L5T A;  4LUO A;  5H1S E;  5IP7 G;  4DV3 Q;  4DR4 Q;  4LF7 Q;  2N8N A;  4K0K Q;  3CME A;  4OWX B;  3CCM A;  4DR5 L;  4JV5 Q;  5BR8 Q;  3CMA A;  4MTN A;  4BY7 G;  3J81 i;  1KIX A;  2JA5 H;  5IYD H;  2YTX A;  4R4C A;  3KJP A;  2ZJQ A;  4GKK Q;  4JI3 Q;  4UP8 A;  3HKS A;  3UE0 A;  3PUX A;  1N36 Q;  3PO3 H;  1A63 A;  4B3M L;  2OWO A;  4DV0 L;  4JI2 L;  1W2B A;  1TWG H;  2A19 A;  1EWI A;  1EQQ A;  3ERS X;  1JE5 A;  2WB1 G;  4TVA B;  2YTY A;  2I0Q A;  4JG2 A;  3S1N H;  4QQB X;  3NBH B;  1VQ7 A;  1N33 L;  3BZC A;  3H3V H;  4P72 A;  1VCI A;  1VQM A;  4HJ9 A;  4OWW B;  3D0F A;  4HIK A;  3CC4 A;  4A93 H;  3B6Y A;  3ER0 A;  1VQI A;  4DR1 L;  1JJ2 A;  4LF4 Q;  3CCL A;  4P73 A;  1PV4 A;  4GOP C;  1DGS A;  4JI6 L;  5M5X H;  4O0A A;  1L2F A;  4L5Q A;  1WCM H;  2ATW A;  2R93 G;  1WI5 A;  5GQO A;  1YHQ A;  1KC8 C;  3NEN A;  1HJP A;  1YJN A;  1J5E Q;  1C7Y A;  4JBW A;  4A3E G;  2D0P A;  3CXC A;  4X6A H;  1A62 A;  2K14 A;  1N32 Q;  5JJI A;  1EQR A;  4JI4 L;  3K81 C;  2RF4 A;  5J3B A;  1HNX L;  2PQA B;  1Q46 A;  3S16 H;  4LF6 L;  1L1O C;  1Z9F A;  1S72 A;  2Z0S A;  2VUM H;  2B29 A;  3RLF A;  3RZO H;  3HOU H;  1XTD A;  1XNR L;  2R7Z G;  1C9O A;  1QVC A;  1XPU A;  1K9M C;  4DAM A;  3LGJ A;  5C44 H;  2H5X A;  4JI0 L;  1RL2 A;  1Q1B A;  2R7D A;  2R7Z H;  1VQK A;  1G6P A;  1V9P A;  4FDB A;  4DR1 Q;  1WOC A;  3M3Y H;  3I4O A;  4JCV E;  3ULJ A;  4B3T L;  4DR2 L;  1PYS B;  4GLV B;  3BJU A;  3W1B A;  1PH5 A;  4POG A;  1TWA H;  3TQY A;  2A8V A;  4JOI C;  3ULP A;  2ID0 A;  4C3J H;  1MJE A;  2YTV A;  4DR7 L;  5AJ3 Q;  3TS0 A;  1KRT A;  4BBR H;  3SGI A;  1HR0 W;  4JI4 Q;  4A3M G;  1IBL L;  2YV5 A;  1JJG A;  2UUC L;  4XIG S;  4HJA A;  5M3F H;  3CW2 C;  3T1H L;  3GDE A;  3Q8D A;  3RZD H;  4BXX G;  2MQH A;  5FJ8 H;  3CCR A;  1YJW A;  4DV4 L;  3A0J A;  3WWV A;  1G51 A;  1CSQ A;  4X62 L;  3ULL A;  4R1J A;  3HOV H;  3S17 H;  1U0L A;  3W1G A;  2ASB A;  1VQE A;  4UPA A;  3NEM A;  4POF A;  2VQF L;  4LF5 L;  4OO1 G;  2HIV A;  4OON A;  1HNW L;  1OXX K;  3M9B A;  3CPF A;  3H0G G;  2EQS A;  4ALP A;  3RNU A;  2PQA A;  2JA5 G;  4IPC A;  1X56 A;  5IYD G;  1Y1V G;  3ICE A;  1O7I A;  2RCN A;  3TEH B;  4KHZ A;  2UXD Q;  1A0I A;  1B70 B;  1XNQ L;  4RG1 A;  4R4Q A;  1QZG A;  2E5L L;  3PO3 G;  2AMC B;  1GO3 E;  2WB1 E;  2E2J H;  2UUA L;  3GTK H;  2OCE A;  4P74 A;  4B3S L;  4DV1 L;  2KHI A;  1YNX A;  2WAQ G;  3PUW A;  3CCE A;  4DV2 L;  2B63 H;  2UUC Q;  1HZB A;  1BBW A;  1Y14 B;  3IRB A;  5LMN L;  2NN6 G;  1KRS A;  4JI1 L;  3M4O H;  2Q2I A;  4BBS H;  3I4N G;  4IPG A;  4JYA L;  4A3G H;  4A93 G;  4KI0 A;  4OWT B;  1PFS A;  1XMQ L;  2N3S A;  4DV3 L;  4DR4 L;  1NMG A;  1XJV A;  4DUZ L;  1PH4 A;  4LF7 L;  4K0K L;  4WJ3 M;  2IX1 A;  1YEZ A;  1UE6 A;  1WCM G;  4IOC A;  3K0X A;  3DM3 A;  5DLQ E;  4YWK A;  3S1R H;  1S40 A;  3A5U A;  1SFO H;  3HOW H;  1X65 A;  2ES2 A;  2F4V Q;  4GKK L;  4JI3 L;  1SR3 A;  1B7Y B;  1V43 A;  5IP9 H;  2CKZ B;  1TWF H;  3CCV A;  1HZC A;  1VQ5 A;  1IBM Q;  3J7A 5;  2EXD A;  2VUM G;  4GOP B;  1Q86 C;  1OXS C;  1YVC A;  2PNH A;  4IO9 A;  3GTJ H;  3HOU G;  1AE2 A;  1PH2 A;  1K8A C;  4IPH A;  2B3G A;  4DV1 Q;  4GLX A;  1UEB A;  3K7U C;  2WFW A;  3BU2 A;  3J7Z C;  3HOX G;  3F2C A;  4HJ8 A;  5C44 G;  4LF4 L;  1VQC A;  1J6Q A;  3STB D;  1MKH A;  1AH9 A;  1PH1 A;  3A74 A;  4GN5 A;  1K73 C;  1D8L A;  5HY6 A;  3HOZ H;  2UUB Q;  3E0E A;  2K52 A;  2AWN A;  3FP9 A;  3EN2 A;  4GNX B;  3RLN A;  1OTC A;  3KF6 A;  4LWC A;  5FLM H;  4DUZ Q;  1J5E L;  1E22 A;  5M5Y H;  5GRO A;  1XPO A;  1X9N A;  1N32 L;  2HIX A;  1UE5 A;  1E1O A;  5IWA L;  5C4J H;  1HR0 Q;  2DGY A;  1W3S A;  3E9H A;  1X6O A;  1SRO A;  1SE8 A;  4DV7 Q;  4IPD A;  1GM5 A;  3JAM c;  5FJ8 G;  3PUY A;  2F3I A;  2NZO A;  1EFW A;  4AYB G;  1I3Q H;  1M1K C;  2KCM A;  4DK3 C;  4YY3 Q;  2UU9 Q;  2BH8 A;  1NE3 A;  4IOA A;  1QUQ B;  1YIJ A;  3HFZ B;  4QJF A;  2JEA I;  1X3F A;  1YZ6 A;  1Q82 C;  3UDX A;  4JC0 A;  4DV5 L;  1NJI C;  4HIM A;  4PZ8 A;  4LFA Q;  4BA1 I;  3GTM H;  3I4M H;  2K75 A;  1OXT A;  2JA7 H;  2OQK A;  3KDF B;  1PH3 A;  5AJ3 L;  2FXQ A;  4GOP A;  2Z6K C;  3PCO B;  1WFQ A;  5IWA Q;  3T1Y Q;  3PO2 H;  3PF4 A;  2WAQ E;  1GKH A;  3JAM i;  4DR3 Q;  2N78 A;  1K3R A;  4HJ5 A;  2Y0S G;  4YCV A;  5C0X J;  2CCZ A;  2B63 G;  2JJQ A;  2R92 H;  4C3H H;  4A3F G;  4DPG A;  2E2I H;  4BBS G;  2XTI A;  4BA2 I;  1P16 A;  1YIT A;  4OX9 Q;  1E3P A;  1SN8 A;  1KXL A;  1X55 A;  1L1O A;  4GNX A;  1BKB A;  2AKW B;  1R9T H;  2GVB A;  3M7N A;  1FJG L;  2JA8 H;  3GO5 A;  3U4Z A;  1LM0 A;  5GAD C;  3HOW G;  2IX0 A;  4A4I A;  4R4O A;  4DV5 Q;  4JI7 Q;  4A3D G;  1IYJ B;  1PH6 A;  1EIY B;  2UXD L;  4OO1 I;  2CFM A;  3HKZ G;  4JBJ A;  1YBY A;  3CP0 A;  4HIO A;  1N9W A;  2K5H A;  1XMO Q;  1IL2 A;  2LXJ A;  2VS1 A;  3PSI A;  4YCU A;  4UP9 A;  2VQE Q;  1KL9 A;  4QGU A;  2HT1 A;  3E9I A;  2D62 A;  2BA1 A;  4QY7 A;  1Y1W G;  1MIU A;  3M4P A;  1K0R A;  1QUQ A;  3U58 A;  4Y52 H;  4AQY Q;  1KD1 C;  1FL0 A;  4LFB Q;  2NZH A;  2PI2 A;  4H02 A;  3H3V I;  2K5V A;  2NN6 I;  3CC2 A;  3KDF A;  1FJG Q;  3ZJY C;  3PIO A;  2NVX H;  2GVA A;  2F4V L;  3KOJ A;  4AH6 A;  2RHQ B;  3STB C;  4EX5 A;  2K50 A;  4L5S A;  3KF6 B;  1VQH A;  1VQ9 A;  3KFU A;  1IBM L;  4DV6 Q;  4R4T A;  1G29 1;  3MEF A;  1S3O A;  1CKO A;  4OXP A;  5IYB H;  4YHH Q;  3L7Z C;  1NBW A;  2OTL A;  3S14 H;  1LYL A;  4B3R Q;  4KHP Q;  3G71 A;  1WJJ A;  2ZM6 Q;  3JC6 6;  2VY3 A;  1K8G A;  4AYB E;  4A3K H;  1NMF A;  1PH8 A;  1LUZ A;  4X64 Q;  4YWM A;  3AEV A;  1A8V A;  1SMX A;  2HHH Q;  1EYG A;  2CQO A;  2UUB L;  3GD7 A;  4TQU S;  3AQQ A;  1PHJ A;  1X3G A;  3BZK A;  1SRU A;  3UDI A;  2UXC Q;  3I4M G;  3EBE A;  2VNU D;  1LTL A;  3A5Z B;  4A3E H;  3EIV A;  3I2Z A;  2JA7 G;  4A3I H;  4DR6 Q;  1HR0 L;  4GKJ Q;  2NVY H;  4IFD G;  3I56 A;  1VQB A;  5EAY A;  3S1M H;  4LF9 Q;  1IZ6 A;  1Q8K A;  4DAY B;  4JBM A;  2JEB I;  2Y0S E;  4DV7 L;  5JJL A;  3F8T A;  2K4K A;  5IT9 c; 
#chains in the Genus database with same CATH topology
 1VF7 A;  2W9A A;  4A3J H;  2PZU A;  3H20 A;  3DWA A;  1HNZ Q;  3J81 j;  4K5V A;  3HKZ B;  4YY3 L;  1JMC A;  2R6G A;  2UU9 L;  4LFC Q;  4FF3 A;  2W9B A;  2AQ1 B;  5JQW A;  1T5E A;  2A1A A;  2VW9 A;  4JYA H;  4RZQ A;  3VMM A;  1EIG A;  2IHF A;  4QB4 A;  2UXB Q;  4PDB A;  4MV3 A;  1U5K A;  5LMU Q;  3OSN A;  4K5W A;  3H15 A;  4DV3 H;  2KCT A;  1DD2 A;  4K0K H;  1Y1W B;  1KQS A;  3V4S A;  4NXM Q;  1D7Q A;  1TXY A;  2RBM A;  3N6R A;  1N48 A;  3J7A F;  3SK5 A;  2FMA A;  5FLX W;  4JI3 H;  2VA3 A;  1CKM A;  4YJ2 F;  3H91 A;  3GTP A;  4J9N A;  4IJH A;  1B3A A;  2JE6 I;  1LTR D;  2UVW A;  1S97 A;  1PX2 A;  1X54 A;  3QFF A;  3ONA B;  4OX9 L;  1EU4 A;  3BYT B;  1KEE A;  4ECT A;  2Y0S A;  5KFB A;  3L4J A;  3T56 B;  1RKN A;  5E3F A;  1A2U A;  4JV0 A;  3H0G H;  2EYF A;  1XPR A;  3OMC A;  2QGQ A;  1YHA A;  1I3Q B;  2AWO A;  3KAK A;  3RB3 A;  5KFN A;  4DUY Q;  3SXH A;  1SFO A;  5EKK A;  4A2B A;  5DG9 A;  2IT1 A;  1Q1E A;  3KLS X;  4FF2 A;  3AB9 A;  3I4M B;  4RCO A;  2IMW P;  2K7V A;  3I4N H;  3M7G A;  3HOY H;  4AQY L;  4FF4 A;  4R8U A;  1EOV A;  3OMG A;  4LJZ C;  3M85 A;  2E74 C;  3J7A K;  3QOJ A;  3PW4 A;  2KJX A;  5TSS A;  1FYC A;  2KBN A;  4G3I A;  2YU9 H;  5E7N A;  2EOT A;  3EQL C;  1BXR A;  2DPI A;  2Q2H A;  2PNR C;  2CWA A;  3TRE A;  3SVM A;  4GN4 B;  3PR5 B;  2B39 A;  3PUV A;  5LXT F;  2DZD A;  3KBG A;  5EPK A;  1N56 A;  4JK1 C;  1R9T B;  2O4X A;  5T1G A;  3IG0 A;  2F0G A;  4YHH L;  3PUZ A;  1W6J A;  4KHP L;  3M3Y B;  4UY8 C;  4C2M H;  4IAJ A;  2ZM6 L;  3RF2 A;  4DV0 Q;  4KV6 A;  5KFU A;  2WTF A;  4JBK A;  1BNC A;  4X64 L;  1SLJ A;  1L0W A;  5LMN W;  2I5L X;  5M3M H;  1E1T A;  2N49 A;  4K14 A;  2ZJR A;  3PGZ A;  1M90 C;  1L0X B;  1HPC A;  4IUU A;  4RNN A;  5FLM G;  4GLA C;  4BY7 H;  2F0J A;  2WKC A;  3N44 B;  2EYO A;  3GTM A;  2JQO A;  5KGU A;  4LF6 Q;  4UP7 A;  3Q2O A;  4O4H F;  3I3C A;  1XNR Q;  4IFD I;  2NTS A;  2E2D C;  5DQG A;  1PZJ D;  4ZAI A;  3TIG A;  4X3K A;  1GSH A;  5J1Z A;  4A75 A;  3KXY T;  4ECR A;  4JI5 L;  5ELB A;  1VQ8 A;  4CDF C;  1WSC A;  4YB8 B;  3GTL H;  5FPR A;  2VA2 A;  1NR4 A;  3FKI G;  1WTP A;  1FKA H;  1I5F A;  3MWM A;  4B3T Q;  1CKN A;  5KFJ A;  5KG1 A;  2BA0 A;  1FGU A;  4YIJ A;  1GUS A;  3M4O B;  2WV6 D;  1I94 L;  4A3B G;  2WE6 A;  1FD7 D;  3KAL A;  1QJO A;  3CC7 A;  4LF9 H;  1Z47 A;  3HEJ A;  3TN2 A;  4X65 L;  4QWA A;  2NBF A;  5IT9 L;  4BY1 G;  2AHO B;  4ED2 A;  1H9R A;  4WJ4 A;  5K36 G;  4HID A;  1PK8 A;  2IHE A;  5EBD A;  3T1H Q;  3I55 A;  4A3I B;  3OTO L;  2PMZ B;  4YCW A;  4HCE A;  1B6R A;  1JWU D;  2XCL A;  4MV8 A;  1WR2 A;  1JOQ A;  3E5N A;  4JI8 L;  1Q12 A;  1PYB A;  4L8J A;  1IOV A;  4K8J A;  3GTJ B;  3LX0 A;  4LF5 Q;  4A3J B;  1UNN C;  1HNW Q;  1V1O A;  2K28 A;  4JUZ A;  3G6J B;  1Q81 C;  2AQ2 B;  1QB5 D;  1N36 L;  4RAY A;  3FHW A;  4YR2 A;  4QIW E;  3RFC A;  1F2L A;  3KAJ A;  1B3Q A;  2H4O A;  3KF8 A;  1DV2 A;  2I87 A;  1I6V C;  2E2H H;  3W5O A;  4BXX H;  1E2W A;  1VQG A;  2TSS A;  3OYY A;  4DV2 Q;  2M05 A;  2R8J A;  1VQN A;  2B2T C;  4NXN L;  2V4R A;  2CZG A;  3Q8R B;  5KFD A;  1XMQ Q;  1MBY A;  4LUO A;  3V2T A;  4DR4 Q;  2CW7 A;  4FM9 A;  2N8N A;  4OWX B;  4UFZ A;  2J0T D;  2W7P A;  3HZX A;  4HR7 A;  1KC7 A;  2ZJQ A;  4GKK Q;  2ZXO A;  3PO3 H;  1C3O A;  3ETH A;  3RAX A;  4B3M L;  2HDL A;  1OWT A;  1AUV A;  2L11 A;  4Q0F A;  4JI2 L;  5KIX A;  1TU2 B;  1JE5 A;  2ICI A;  2LS0 1;  1GXD C;  3S1N H;  2FB9 A;  4RFB A;  2QEJ C;  1TWF A;  5LYJ F;  5KFI A;  2W6O A;  3G6X A;  2NN6 H;  1VCI A;  4OWW B;  4HIK A;  4F88 A;  1VQI A;  4DR1 L;  3NWS A;  1DGS A;  4JI6 L;  3PO2 B;  1EQV A;  4I65 A;  1BCP D;  5GQO A;  4K2K A;  3R3O A;  3RB0 A;  1LTA D;  4EGQ A;  1N32 Q;  3K3V A;  1HNX L;  3HRZ C;  1XMO H;  4N9T A;  4O3S A;  2DJF C;  4MA0 A;  3GTO A;  2JA8 B;  2B29 A;  5KFT A;  2VQE H;  1H9K A;  1H9M A;  1RTN A;  1XPU A;  2R82 A;  3BS1 A;  2W9C A;  1GSA A;  1U4L A;  2YZM A;  4JI0 L;  2XC9 A;  1G6P A;  1V9P A;  5BN3 A;  5KG6 A;  3OOC A;  1WOC A;  3I4O A;  4JCV E;  4EQP A;  1PH5 A;  2PW7 A;  1TWA H;  5M3M B;  2F0Q A;  2ASJ A;  1EYD A;  2ID0 A;  4C3J H;  2YTV A;  1MJE A;  3TS0 A;  4K5X A;  1CQF A;  4JI4 Q;  5JVG 3;  2WKD A;  4A3M G;  3H3V C;  2YV5 A;  2YS6 A;  1BGW A;  5M3F H;  2VPQ A;  1XNR H;  5C0X H;  4KN7 C;  2A6E D;  2K01 A;  3NWT A;  5KFW A;  2X6L A;  4LK1 C;  5FO9 B;  4DL2 A;  1Q8I A;  3IFD A;  1YNJ D;  4HMI A;  1CHQ D;  1PFM A;  2ASB A;  2HHH H;  4EYH B;  4EYI B;  5KFS A;  1VQE A;  4UPA A;  3NEM A;  1AUX A;  4B3T H;  4ECS A;  4O3R A;  4PQX A;  1OXX K;  1WTQ A;  3TBI B;  1GUN A;  4ZHQ F;  2LFN A;  4BWS C;  2JA5 G;  3ICE A;  2O03 A;  4FS2 A;  4DR6 H;  1O7I A;  3T13 A;  1O80 A;  2UXD Q;  4EEY A;  5IYZ F;  1KAB A;  2JYO A;  3VR6 A;  2AMC B;  1GUT A;  5A2Q L;  4ECY A;  4P74 A;  4DV1 L;  1LTG D;  2KHI A;  2WAQ G;  3PUW A;  3RUZ A;  3CCE A;  1KJI A;  2UUC Q;  4A3E B;  1HZB A;  2DN8 A;  3PW5 A;  1G8Z D;  4IUQ A;  3FMA A;  2W8L A;  3JRW A;  4B9W A;  3NGD A;  1BOS A;  1PFS A;  4IRD A;  2N3S A;  3E3X A;  1M0W A;  3J7Y W;  5F9L A;  1U9R A;  2XD4 A;  1E2V A;  4WJ3 M;  2IX1 A;  1SFO H;  1WCM G;  3S1R H;  1LO5 D;  2N55 A;  3J81 L;  1IYV A;  1U4M A;  2K5Q A;  4CBV A;  2RA4 A;  5KFH A;  1BCP C;  4TQR A;  2E75 C;  1IBM Q;  4GOP B;  1Q86 C;  1OXS C;  2PNH A;  2A74 C;  3QB3 A;  4OHJ A;  5M5W B;  3OSP A;  1K8A C;  1NR2 A;  4GLX A;  2YCH A;  3K7U C;  2WFW A;  3W3A A;  4MV7 A;  1B53 A;  2F0N A;  4LF4 L;  1J6Q A;  2WB1 A;  1F9S A;  1EYZ A;  1PH1 A;  2RDI A;  4GN5 A;  1WTR A;  1D8L A;  2BDO A;  4DR4 H;  3HOZ H;  1D2B A;  3E0E A;  2E2H B;  2EJG C;  1RK6 A;  5C1P A;  4LWC A;  4DUZ Q;  4LAA A;  2R7K A;  1J5E L;  1E22 A;  1X9N A;  5GRO A;  2K04 A;  2B2T A;  3MFG A;  1UE5 A;  3EA6 A;  5IWA L;  1HR0 Q;  4QUF A;  4DL3 A;  3FVQ A;  3V6K A;  1X6O A;  3NTK A;  1SRO A;  4F4X A;  1STN A;  3JAM c;  2ZXP A;  5FJ8 G;  1H9S A;  1Y1V B;  4A3B B;  2B8F A;  2F3I A;  1EFW A;  1Y8P B;  1BUV T;  4YY3 Q;  1M4V A;  5KYI A;  2QDL A;  2UU9 Q;  4C5B A;  2SNM A;  3QR8 A;  1NE3 A;  2F4I A;  1J9O A;  2R8H A;  3UDX A;  2A6E C;  4KY7 A;  3TP6 A;  4HIM A;  3M4I A;  3GTM H;  3S2H B;  2I46 A;  3BZD B;  4DR5 H;  3DWQ A;  5F9N A;  5CV7 A;  1SMY D;  3OPO A;  1Z2P X;  4DXF A;  2Z6K C;  3Q22 A;  5KX5 F;  3JAM E;  4S3S A;  3GTG B;  1GKH A;  1SYD A;  1I4X A;  3JAM i;  1B04 A;  2NU6 B;  2B2V C;  2CCZ A;  4YCV A;  5I4D A;  2JJQ A;  3C1E A;  4BBS G;  1N33 H;  4EG0 A;  2FKL A;  4CDC C;  4OX9 Q;  1SN8 A;  5EQ0 A;  2W6P A;  3N52 A;  4GNX A;  2XCP A;  1VMP A;  2HD3 A;  1VAJ A;  3L4K A;  4F4Z A;  3K5L A;  5J2U F;  2IX0 A;  4DV5 Q;  2NVQ B;  1JIH A;  2VXW A;  2L4N A;  4OO1 I;  3HKZ G;  2A6H D;  3CP0 A;  3PW0 A;  4JI4 H;  3BVZ A;  3H0G A;  2J7Z A;  2LXJ A;  1QNU A;  3PSI A;  1EOT A;  1ZXT A;  1SYG A;  4QGU A;  2HT1 A;  5JVL A;  4RHS A;  3SE7 A;  1Y1W G;  2CH4 A;  2RKS A;  3M4P A;  3P75 A;  1K0R A;  1STE A;  1A2T A;  4AQY Q;  1D1K A;  2W9B B;  1SCU B;  4H02 A;  2NN6 I;  1TS3 A;  4RGN A;  1I4Q A;  4UCV A;  1JWS D;  1ML0 D;  3ZJY C;  2GVA A;  3E5S A;  2F4V L;  3KLS A;  4AH6 A;  4EX5 A;  3KF6 B;  2YU9 A;  1F2Y A;  5IYB H;  4YHH Q;  2OTL A;  1NBW A;  3S14 H;  1EWH A;  1LYL A;  4KHP Q;  3GTP B;  2RGR A;  2NTT A;  5LOV F;  1IBL H;  2ZM6 Q;  2CW8 A;  3OIQ A;  2UUC H;  1BQQ T;  4AYB E;  1KDB A;  4DV4 H;  4X64 Q;  4J8Q A;  3MR2 A;  1A8V A;  4DLK A;  4X62 H;  4TQU S;  4ED0 A;  4RB3 C;  3LP8 A;  2Y0S B;  5M9O A;  4BWG B;  2VQF H;  3I4M G;  1SND A;  2KHS A;  2VNU D;  1PTO F;  3MTS A;  2JA7 G;  4IUR A;  4RCN A;  2R7M A;  3T5H A;  4IFD G;  3S1M H;  2DNC A;  2JEB I;  3C3L A;  3S1R B;  2WYO A;  3FPU B;  2R7Z H;  4I4T F;  5IT9 c;  3NK9 A;  1SMY C;  4FP5 D;  5DQI A;  3P20 A;  3FEW X;  3HB9 A;  2L15 A;  1HH2 P;  1SEB D;  3K7A H;  2A69 D;  4J9Q A;  1JIC A;  4JI5 Q;  5C4X H;  1PH9 A;  2I80 A;  2IJ0 A;  4R8U B;  4LFA L;  3UDF A;  3RN5 A;  4DUZ H;  4LF7 H;  2C9O A;  4J9O A;  3DMU A;  4LSX A;  2EIF A;  3BQ0 A;  3GTO H;  2RQX A;  1I94 Q;  3GTL A;  4DK0 A;  2BH2 A;  1DOL A;  2LSS A;  1DXM A;  2MNA A;  1RJT A;  5IT9 E;  2FPP B;  3PIO 3;  1PRT F;  4X65 Q;  4DR3 L;  1A6X A;  1E0B A;  2DY7 A;  4DNI A;  2NUA B;  3VR4 A;  4ME6 A;  1LLR D;  1TVX A;  2VZA A;  2JA5 B;  3UFX B;  3GTK A;  3OTO Q;  1S0M A;  5G3L D;  4MTK A;  1ZKO A;  2XGT A;  3I8Z A;  5NUC A;  3G4S A;  2ZJP A;  4IRK A;  2B63 A;  1H95 A;  1BXT A;  2XWB B;  3DWP A;  1VQ6 A;  4JI8 Q;  1F9Q A;  2W6Z A;  1ESR A;  4RB0 A;  4X3T A;  4JI7 L;  5I2Y A;  5C3E H;  2YYZ A;  1K28 A;  2D2C C;  1WVL A;  4I7A A;  4MNO A;  3URY A;  3J80 c;  1CFM A;  4R7R A;  1VQL A;  2ALY B;  3KHH A;  2FK1 A;  2ZJT A;  2C2E A;  1EEI D;  3KLW A;  2QA4 A;  4EQ5 A;  5GAE C;  3GTM B;  3CAM A;  2YRX A;  4ZUJ A;  4ULL A;  5IGB A;  5CA1 F;  1YHB A;  2VL6 A;  2X69 A;  3SK6 A;  4OX9 H;  1TR5 A;  4X3S A;  4NXN Q;  2Z6K A;  4LFB L;  1DYQ A;  3KLR A;  2C2D A;  1MGS A;  3AYH B;  3VPC A;  3RZO B;  4O2D A;  3EPG A;  2B2V A;  1CI3 M;  4MV4 A;  4QWB A;  4DV5 H;  3GTQ H;  5FK9 C;  4U68 A;  5T1I A;  3T4A C;  3BVM A;  3J80 E;  2NZ1 D;  1CKN B;  2WP8 J;  4A3I G;  3D31 A;  4Y8V B;  1QWY A;  2K32 A;  3J80 i;  5DM6 3;  4DV6 L;  4TSS A;  1S5E D;  1KDA A;  4RA8 A;  2GPS A;  4R8I A;  1FVI A;  3UE1 A;  3U4V A;  4B3M Q;  5H80 A;  1VBG A;  4EFB A;  4JI2 Q;  5EWF A;  4O2B F;  2NVT H;  2M9V A;  3HOX H;  4A3J G;  3GIL A;  4P75 A;  4JV2 A;  4A3C H;  4JOI A;  5I2X A;  4C3I H;  4BBR B;  3K5H A;  2XNA C;  4PMW A;  5JPM C;  4OEL B;  1KJ8 A;  4DK6 C;  3HXL A;  4FBU A;  1TWH H;  4KY6 A;  4JI6 Q;  5IP7 H;  2NU8 B;  1BBX C;  2UXC L;  1TT2 A;  1SYX B;  3G7L A;  4QWE A;  2CW0 D;  4RKL A;  3R8B A;  4RUC A;  2A69 C;  2MO1 A;  5JOB A;  3VR3 A;  2R7F A;  3HOV B;  4HN7 A;  3S17 B;  2GN5 A;  2HCI A;  4EBD A;  1HNX Q;  2D9U A;  4DN4 M;  5KG0 A;  1PVO A;  3BG3 A;  3NEL A;  4CDD C;  3BA9 A;  3KF8 B;  3D4R A;  4LUV A;  3S2D H;  1N34 L;  2LKV A;  1QZH A;  3FPP A;  1Y69 U;  4JI0 Q;  4ZQI A;  2W8K A;  3S14 B;  1MD2 D;  3PR4 A;  1VQ4 A;  3G8C A;  2EVB A;  2MPM A;  4M7E A;  5EOY A;  5L9X A;  3OUZ A;  5F2D A;  5I6W A;  1XYI A;  1IBK L;  3MWY W;  4A3G B;  5C3X A;  2R87 A;  1JB3 A;  4MZ9 A;  1Z7T A;  2AU0 A;  4HR7 B;  3PF5 A;  1A3T A;  5COY A;  3PO2 G;  2YZG A;  3JAM W;  1LV9 A;  2FLP A;  4NB3 A;  4A3F H;  3L2P A;  4RGT A;  1KDC A;  1AW7 A;  1IHZ A;  1JOO A;  3GIJ A;  4LF8 Q;  5KFF A;  3HOY G;  4M1U B;  1TWF B;  4P2C B;  3IKJ A;  1AE3 A;  1QVF A;  4L63 B;  1LT3 D;  5J2T F;  4CC6 A;  3BYY B;  3K3P A;  2O5I C;  2UUB H;  4E6I A;  3M4Q A;  4F87 A;  5IY0 A;  5BR8 L;  4L1K A;  2JA8 G;  2C28 A;  2EJM A;  5CYU A;  4A3D H;  5KYL A;  1K0S A;  3HBL A;  1EUJ A;  3J81 c;  1QE6 A;  4KJO A;  2CWP A;  5C4X B;  1F2M A;  1QVG A;  4YAK B;  3CPW A;  5EWG A;  3S1Q H;  1RDP D;  1CK1 A;  3AU7 A;  1EY4 A;  2VUG A;  5JEA J;  4HJ7 A;  3G6E A;  3EPI A;  1EQT A;  2C2R A;  4NLG A;  2K05 A;  4O3P A;  5M3M G;  2W9C B;  1PFN A;  1PYW D;  5H1S E;  3OW7 A;  3GII A;  3J81 E;  2RSN A;  4MTN A;  3FDT A;  4BY7 G;  3TZD A;  3J81 i;  1KIX A;  1FNV A;  4KD3 A;  5ELF A;  3KJP A;  3HKS A;  3UE0 A;  3PUX A;  1A63 A;  3GQC A;  2OWO A;  3T1Y H;  1W2B A;  2A19 A;  4MTE A;  1EWI A;  2F0F A;  2CW0 C;  5C3E B;  1SYF A;  4QQB X;  1AN7 A;  2NVY A;  1PDQ A;  4TKO B;  4DA2 A;  3M9O B;  2JA7 B;  1HCZ A;  3BZC A;  3H3V H;  1S5B D;  2A73 B;  2V4Q A;  4QIW A;  3K58 A;  3ER0 A;  4LF4 Q;  3CCL A;  2R86 A;  1DJR D;  4P73 A;  1PV4 A;  2MJ8 A;  2ALZ A;  1TS2 A;  5M5X H;  2YL2 A;  1EZ1 A;  4L5Q A;  1IYU A;  1RJP A;  5EDW A;  1KC8 C;  2KOL A;  5KEE A;  5L1I A;  4C3H B;  3NEN A;  1YJN A;  1J5E Q;  2Z8L A;  1JOR A;  3RAQ A;  4JV1 A;  2GA4 B;  2D0P A;  5FLX L;  4A3E G;  5JJI A;  3ND9 A;  3K81 C;  2RF4 A;  2XSC A;  5FKA C;  4MV1 A;  1Q46 A;  3S16 H;  1Z9F A;  2W7O A;  1S72 A;  1HHV A;  2VQD A;  2VUM H;  3RLF A;  3HOU H;  2EYM A;  2FE3 A;  1C9O A;  4ID6 A;  1M0T A;  2X6G A;  3LGJ A;  1Q1B A;  2R7D A;  4YP3 A;  2AQ3 B;  1VQK A;  1ZQ7 A;  2QF7 A;  1PTO D;  1I50 A;  2NVT B;  4H0L C;  4DR2 L;  1PYS B;  1LAC A;  3BJU A;  4POG A;  3T5J A;  4ZKB B;  1GUW A;  2XN9 C;  2A8V A;  5KT5 A;  4C3I B;  2JEF A;  4KTA A;  4DR7 L;  2F0U A;  1KBL A;  1JE4 A;  5IGF A;  1F9P A;  1KRT A;  1E4G T;  1STY A;  1EIH A;  4B3R H;  3Q24 A;  3NBH A;  3W2D A;  4XIG S;  1B6S A;  3TQT A;  3KHR A;  3CW2 C;  3D6W A;  2L1B A;  3GDE A;  2NVX B;  4BXX G;  2F0D A;  3CCR A;  4XZ3 B;  3QG1 A;  2W71 A;  1G51 A;  4JI0 H;  3ULL A;  4R1J A;  1XWE A;  1GLV A;  2R85 A;  1XDN A;  2G5D A;  2WB1 B;  1ILQ A;  1U4R A;  4RKB A;  4POF A;  4OO1 G;  4DU9 A;  4BS9 A;  3S2D B;  1MZB A;  2EQS A;  5DEH A;  5KFG A;  1D1I A;  2VB2 X;  3HG9 A;  1PRT D;  3PQI A;  1Y1V G;  3TEH B;  4KHZ A;  3CQZ A;  4ZK9 B;  4RG1 A;  3E6Z X;  2E5L L;  1XNQ L;  3PO3 G;  2FK2 A;  2E2J H;  2UUA L;  2CH4 W;  2EXZ A;  3GTK H;  4IR9 A;  1YNX A;  4U7C A;  2B63 H;  2ZT9 C;  5LMN L;  3HGB A;  2NN6 G;  3KHL A;  4LF8 H;  1HNZ H;  4IPG A;  4JYA L;  4LFC H;  1H9S B;  1XTC D;  4OWT B;  4FF1 A;  3UQ8 A;  3GV5 B;  5C1O A;  2UXB H;  5EKI A;  4DV3 L;  2JA6 A;  2BE5 C;  5LMU H;  4K0K L;  1PZK D;  1QIL A;  4JV5 L;  3A7L A;  3K0X A;  2CQA A;  1D5Z C;  5D14 A;  3A5U A;  2XWJ B;  1UUP A;  1S40 A;  3HOW H;  2QK4 A;  3PW7 A;  1X65 A;  1SE2 A;  4ZUI A;  4NXM H;  2F0L A;  1IKM A;  4Q8E A;  1YNN D;  2F4V Q;  4JI3 L;  1SR3 A;  1B7Y B;  4ZOL F;  3J80 W;  2FPI B;  1KNA A;  4FU0 A;  1WH2 A;  3T53 B;  4PMC A;  4J9M A;  4LH6 A;  2XGP A;  1AE2 A;  3MWD A;  3GID A;  4IPH A;  2B3G A;  1UEB A;  3F2C A;  3OHA A;  5L37 A;  1PZI D;  4C1N I;  3N8D A;  1AH9 A;  2J6S A;  3MFY A;  2MUY A;  5HY6 A;  5CC4 A;  3N40 P;  2AWN A;  1GUG A;  4GNX B;  3V6H A;  1OTC A;  5FLM H;  4ILW A;  4Q5V A;  2HIX A;  1TII D;  3U9O A;  5IGG A;  1TA8 A;  4LH7 A;  4J9K A;  4DUY H;  5C4J H;  2R93 A;  1PTO C;  1DV1 A;  3EFX D;  3E9H A;  4CKC A;  1CA6 A;  1CA5 A;  3H0G B;  4IPD A;  3PUY A;  3T5K A;  5FD5 A;  2EY5 A;  2NZO A;  3OHX C;  1M1K C;  4LF4 H;  5KT3 A;  2R7Z A;  1SXT A;  4IOA A;  3EJI A;  1X3P A;  1YIJ A;  5EZY F;  4QJF A;  4PMB A;  1X3F A;  2JEA I;  4XX0 B;  5HBR B;  4WOR A;  1CQI B;  4LFA Q;  2UVU A;  4HNT A;  2ATL A;  3I4N B;  5E4W C;  4YR3 A;  4HAE A;  3HOY B;  5BMV F;  4DL4 A;  4F7X A;  1HTP A;  2NYZ D;  3PCO B;  3NUC A;  3EYY A;  2JXM B;  1FR3 A;  2WAQ E;  3PF4 A;  1GHJ A;  2YU9 B;  4IRC A;  1S5C D;  2OXP A;  4B9X A;  4DR3 Q;  4DV0 H;  2EYL A;  2Y0S G;  1PRT C;  2F3W A;  1Q90 A;  1DZ1 A;  2R92 H;  3DUZ A;  1EFI D;  3I90 A;  2N88 A;  4DPG A;  2E2I H;  3FDS A;  3S16 B;  1NSN S;  1X55 A;  2V9W A;  1BKB A;  5KFK A;  2AKW B;  4EQO A;  4C2M B;  2GVB A;  3M7N A;  3HOU B;  3D4W A;  3F8N A;  3GO5 A;  3U4Z A;  2HGS A;  4RUA A;  1WTV A;  2EYH A;  2V5A A;  4JI7 Q;  1IYJ B;  4FNF A;  1EIY B;  4QWD A;  2CFM A;  5LL6 S;  1ONL A;  3GV7 B;  4HIO A;  1IL2 A;  2VS1 A;  3RGX A;  5LHY 1;  4YCU A;  4LF6 H;  4UP9 A;  1KL9 A;  2F1M A;  4I55 F;  1NNX A;  1YNN C;  4BY7 B;  4QY7 A;  3RUP A;  1JR0 D;  4RU9 A;  3KBX A;  1KD1 C;  3H4B A;  3DXJ C;  4LFB Q;  3SK4 A;  2P5Z X;  2PI2 A;  1UC9 A;  3H3V I;  3CC2 A;  1BCP B;  4QUC A;  5C4Z A;  5CA0 F;  3NTI A;  4DL7 A;  3KDF A;  3GV6 A;  1FJG Q;  2CQY A;  3N42 B;  3PIO A;  3IAY A;  1QCB D;  1GHK A;  5T14 A;  4FBT A;  3KOJ A;  1CE8 A;  2RHQ B;  5LMN H;  2K50 A;  1RTO A;  5KNC A;  2HJW A;  1VQH A;  4WRD A;  1B50 A;  3JZI A;  2JEJ A;  4DV6 Q;  4R4T A;  3BJY A;  3GTL B;  1CQJ B;  1S3O A;  4OXP A;  5DAU A;  4C56 C;  3TII A;  3L7Z C;  1KJQ A;  3GTQ A;  4YBZ B;  2IA6 A;  2F0H A;  3JC6 6;  1CZW A;  1K8G A;  2V59 A;  2ZXR A;  3T1H H;  4ECU A;  2XGQ A;  2BDN A;  4OGQ C;  4NKL A;  4A3K H;  3I70 A;  5JAV A;  2B2W C;  2ZDG A;  1B9M A;  1SYE A;  2JSO A;  2E2J B;  3GTK B;  3WNZ A;  3GD7 A;  3GV8 B;  3AQQ A;  3GIM A;  1X3G A;  4K8I A;  3BZK A;  1JWM D;  2B63 B;  2UXC Q;  4LF5 H;  5DM7 3;  1HNW H;  3EBE A;  1JX4 A;  3A5Z B;  3DEP A;  3I2Z A;  2F03 A;  5FPO A;  1TWH A;  5CV5 A;  2BQR A;  3SK8 A;  2NVY H;  3GIP A;  4CJ2 C;  4DNR B;  1C8C A;  3I56 A;  5EAY A;  4GC6 A;  2LY7 A;  5JJL A;  4DV7 L;  2RDF A;  3R5X A;  3F8T A;  2K4K A;  1SNM A;  3HOW B;  1UC8 A;  5L1J A;  3AFP A;  4PG3 A;  5CBE E;  4DV2 H;  1NCV A;  2MP1 A;  2DUD A;  3U9S A;  1N8R C;  1N34 Q;  1DM0 B;  1V1Q A;  1NY4 A;  4ZCK A;  4RMF A;  1KLG D;  1UE1 A;  4H44 C;  1XMQ H;  5DGA A;  2OF1 A;  1STA A;  4KLK A;  4AYB A;  4KKU A;  1L1O B;  1ZHQ A;  4KHV A;  5C4H A;  1ASY A;  4DAV A;  1RK5 A;  1CM9 A;  3RJ0 A;  3HKZ E;  5K2M A;  1KAW A;  5C5M A;  5JPN C;  4UAI A;  5KFO A;  5GON F;  4HNV A;  4GKK H;  1Z6H A;  3LML A;  4A3M H;  4BBR G;  2AQ4 A;  1VQF A;  3G48 A;  4XXE A;  2WIN B;  3TME A;  3GQB A;  3NQT A;  5LL6 X;  2JEG A;  4IZ8 A;  4F8M A;  1GVP A;  2KEN A;  3A8I E;  3BDO A;  5DQH A;  1G6Z A;  5C4J B;  1ET6 A;  1I50 H;  2Q8I B;  4Y7N H;  4A76 A;  2HQL A;  1KJ9 A;  2B2U C;  2IBK A;  3PO3 B;  1BNZ A;  4NMZ A;  4IQZ A;  3HOV G;  4TV8 F;  2XCA A;  1V1P A;  4R4I A;  4FXK C;  3S1N B;  5D8D A;  4J15 A;  1J8I A;  1ENA A;  1OO9 B;  5EPL A;  1N32 H;  1XMO L;  2X0S A;  3F2B A;  2MCT A;  4AIM A;  5IYB G;  2WDT A;  2FMC A;  2VQE L;  3MXN A;  5DLF A;  2PMZ A;  2ASL A;  3BDL A;  1GJX A;  2PI2 E;  5JEA H;  2J9G A;  2Z6B A;  3UI2 A;  2A68 C;  4HCS A;  2F52 A;  4NPS A;  4A3G G;  3PN1 A;  1CSP A;  4A3L H;  2HVQ A;  4ME5 A;  1S68 A;  4U67 3;  1E24 A;  4LW1 A;  4OIJ A;  4FYD A;  3TP8 A;  1ROD A;  3CQZ H;  1G91 A;  3ND8 A;  3CRK C;  4DNT B;  1IXR A;  1KLU D;  4LUZ A;  4QCL A;  3PIP A;  3Q23 A;  3TQ1 A;  1ASZ A;  3CU7 A;  1YJ9 A;  5IP9 G;  5FLX c;  5IYC H;  3TRZ A;  5BPH A;  1K83 H;  1LAB A;  4MN3 A;  4RWS C;  5ELN A;  4ED6 A;  3NXW A;  1X3E A;  4RHR A;  1S4Z A;  5FO8 B;  1TWA B;  4IUV A;  1P8L A;  2JA6 H;  4C3J B;  1SNC A;  5E4X A;  2K5N A;  4IUN A;  2GLT A;  2HHH L;  2RHS B;  1TKW B;  2LMC B;  2SOB A;  5C4X G;  2BOS A;  2P0A A;  3VDY A;  5C8Y F;  5M3F B;  3F2U A;  1FJG H;  1RIP A;  3K6O A;  5JJK A;  1E4E A;  5KND A;  2F0P A;  3X3M A;  2QEX A;  4DR6 L;  3Q0A A;  1S5D D;  4MIU A;  4GKJ L;  4CGY B;  2I5H A;  3K0Y A;  2FK3 A;  3GLK A;  1ZHS A;  1FGB D;  2UXD H;  1SYB A;  3UDG A;  2EYP A;  4IJL A;  4WFN 3;  3TS2 A;  3PZP A;  3SI8 A;  2QYZ A;  1YI2 A;  4RAU C;  1B8A A;  5C5J A;  2EDG A;  4ECQ A;  3IN5 A;  2XRS D;  1UE7 A;  2ZTE A;  4OEM B;  1DOK A;  1PA6 A;  4DFA A;  4ME3 A;  2VUM A;  3F2D A;  4CHT B;  5HGQ A;  1RJR A;  1VBH A;  2R93 H;  1VQD A;  5I47 A;  2EY2 A;  4DR2 Q;  4V0B A;  4FXG C;  4A3K B;  1HRJ A;  5C3E G;  1I6H H;  2ZTD A;  1W6K A;  1B9N A;  4X66 L;  5FO7 B;  3CCU A;  2ASD A;  3CF5 A;  2YZN A;  5EBC A;  1BVS A;  2KEE A;  1G2S A;  4ED1 A;  4DR7 Q;  2K5D A;  3K8A A;  1IBM H;  4ZQ3 A;  5DNF A;  1E7Z A;  4YWL A;  1L2Z A;  2XIG A;  5AFW A;  1TWC H;  1SFO B;  3MJF A;  4J9P A;  3A56 A;  4J9R A;  2RCF A;  4C5A A;  1SEI A;  3T5L A;  1LTT D;  4C3H G;  1N34 H;  1EU3 A;  2NWG A;  1B44 D;  5KG5 A;  2AGO A;  4QIW B;  3TSS A;  5C0X I;  2Q2U A;  1D5X C;  4YQW A;  2JK8 A;  4XYL B;  1GYF A;  1M7J A;  5KFZ A;  2W6Q A;  4EBC A;  1B2T A;  4G57 A;  2PMZ E;  1EL0 A;  4O3O A;  1SBB B;  1RYR A;  3CCJ A;  1TY0 A;  1ULZ A;  2DJG C;  1SE3 A;  3AMU A;  4WBN F;  1HR0 H;  2IY5 B;  2BR0 A;  1XNQ Q;  3HOZ B;  3G6Y A;  2E5L Q;  3M9M B;  5L1K A;  5C6A A;  5EKL A;  5KT4 A;  1JJC B;  2UUA Q;  5KT2 A;  1T9H A;  4ED3 A;  1Y1W H;  2G9H D;  2QW7 A;  4QMG A;  4C1N K;  3O13 A;  5LMN Q;  4A3C G;  2OLS A;  4JYA Q;  4C3I G;  4YY3 H;  4A2A A;  2UU9 H;  3IFT A;  1NTG A;  1ZEQ X;  1IW7 D;  5IP7 G;  4DV3 Q;  1ET9 A;  3VR5 A;  3MXU A;  4K0K Q;  3CME A;  4DR5 L;  2OH2 A;  4JV5 Q;  1L0Y B;  4LSA A;  1I50 B;  1I4R A;  5IYD H;  2B2U A;  5EWE A;  4R4C A;  4OIK A;  4JI3 Q;  4UP8 A;  2F0E A;  1N36 Q;  5KFQ A;  1QNK A;  2L55 A;  4CC5 A;  3KK7 A;  1EQQ A;  2WB1 G;  4TVA B;  2I0Q A;  2F0S A;  4JG2 A;  4E4T A;  5ISR A;  3NBH B;  4DL6 A;  1N33 L;  4P72 A;  4YAJ B;  1VQM A;  4A93 H;  3B6Y A;  2R61 A;  1JJ2 A;  2MHV A;  1EEF D;  4J9S A;  4XQN A;  3N41 B;  4C5C A;  1SNO A;  4IHJ F;  4EGJ A;  5C5L A;  1YHQ A;  1SSO A;  2PO4 A;  3CXC A;  2W6M A;  5KG3 A;  2K14 A;  3K5N A;  2R8I A;  1EQR A;  4JI4 L;  3NE5 B;  4Q43 A;  5DG7 A;  3QO2 A;  2O5J C;  2Z0S A;  3CQZ B;  2RGV A;  1MSG A;  1HXY D;  4IWY A;  4ED8 A;  1QVC A;  1K9M C;  3TP7 A;  4CDE C;  1ICF B;  4DAM A;  1M6V A;  1SNP A;  5C44 H;  2VPS A;  1RL2 A;  1VF5 C;  4UCO A;  4ZYS A;  1B1Z A;  1EZ8 A;  4AQY H;  4EEQ A;  1UNS A;  4DR1 Q;  3M3Y H;  2OEO A;  2GPW A;  4GLV B;  2JA6 B;  2RVL A;  5IGC A;  3R5F A;  3RTX A;  1HQR D;  3FKI A;  1EUC B;  1XX8 A;  3ULP A;  3OIP A;  4ODG A;  1BR9 A;  3MR3 A;  3SGI A;  1HR0 W;  1DIK A;  2K33 A;  1ZET A;  4YHH H;  1IBL L;  1JJG A;  4KHP H;  2UUC L;  4N8X 1;  4HJA A;  4ECW A;  2J4X A;  2ZM6 H;  4DGZ A;  2MQH A;  4R8N A;  1LT5 D;  2M00 A;  1YJW A;  4UCT A;  1EUD B;  5CB4 F;  4DV4 L;  1KNE A;  2J6U A;  1CSQ A;  2L12 A;  4X62 L;  1JKJ B;  4X64 H;  4RNO A;  3W1G A;  3RBD A;  2R92 A;  2VQF L;  5I6Y A;  3QJY A;  2HIV A;  4M8A A;  4OON A;  2E2I A;  4MA5 A;  4TUY F;  2F0O A;  2HUG A;  3CPF A;  1M8A A;  2R8K A;  3H0G G;  1BCP F;  5HUR A;  2DIK A;  4ABN A;  4ALP A;  2PQA A;  3RNU A;  1ILP A;  1I7L A;  3V96 A;  1X56 A;  1SJE D;  2RCN A;  1IW7 C;  2VB3 X;  4R4Q A;  1QZG A;  1VMC A;  1GO3 E;  4O4L F;  2R93 B;  2OCE A;  4PV1 C;  4EBE A;  1PTO H;  4B3S L;  3I73 A;  1RYS A;  1BBW A;  3M4O H;  2YYA A;  1KRS A;  4JI1 L;  2Q2I A;  3I4N G;  5EJW A;  4ETS A;  2V58 A;  3K5O A;  1I4H A;  4RAZ A;  5KT6 A;  2SNS A;  3S1M B;  1SJH D;  4H7B A;  4JI5 H;  5ELE A;  3NSW A;  4DUZ L;  4XT3 B;  1XJV A;  1PH4 A;  4LF7 L;  2QIL A;  2R7Z B;  2AGP A;  4IOC A;  5DLQ E;  4YWK A;  1AZP A;  2R8G A;  3TDQ A;  5KRU A;  2ICE C;  1I94 H;  2PQE A;  1CQV A;  3K7A B;  2CKZ B;  5ELC A;  4O3Q A;  1HZC A;  1XNQ H;  4H13 C;  2EXD A;  4QW8 A;  3VR2 A;  4DL5 A;  2E5L H;  2KCN A;  2VUM G;  4X65 H;  5I9P A;  5A2Q E;  4IO9 A;  3HOU G;  3GTJ H;  1JDB B;  4I7H A;  4UCU A;  3GTO B;  4CKB A;  4DV1 Q;  3J7Z C;  3PMF A;  3BU2 A;  4MHE A;  3OTO H;  1VQC A;  1TY2 A;  4JPB W;  1QOH A;  1MKH A;  3A74 A;  1E2Z A;  2Q8T A;  4JI8 H;  4I7Z C;  2L0C A;  3FP9 A;  1X3Q A;  3MEH A;  2IWH A;  1JC7 A;  3KF6 A;  1T3N A;  4JV5 H;  2C5C A;  2KA7 A;  1JXL A;  1XPO A;  5M5Y H;  1MSH A;  1FNU A;  2KCC A;  1N36 H;  4LMY A;  3DF7 A;  2DGY A;  4GZY C;  3JAM L;  3MFH A;  3A8K E;  2EY6 A;  1W3S A;  2IP4 A;  3FRP B;  4DV7 Q;  3ITP A;  5KFY A;  3LWB A;  3OUU A;  1GM5 A;  2BE5 D;  2Q8R E;  4RH6 A;  4IZO A;  2YW2 A;  2HVR A;  3CHB D;  3QZ8 A;  3BQ2 A;  5CV4 A;  2KCM A;  1RJQ A;  4NXN H;  1SE4 A;  4K2L A;  2BH8 A;  2F0I A;  1SDF A;  2DNE A;  4ZI7 F;  2K03 A;  4KY5 A;  4TRD A;  2RSO A;  4JC0 A;  4DV5 L;  1NJI C;  4HSV A;  1RHP A;  4KN4 C;  2K75 A;  3LWE A;  4NDX A;  4EQN A;  1OXT A;  4A93 B;  1HFG A;  4DK1 A;  3KDF B;  3MR6 A;  1PH3 A;  5AJ3 L;  2O2L D;  1HUN A;  5KG2 A;  4L6T B;  1WFQ A;  1F2Z A;  5IWA Q;  3PO2 H;  1SYC A;  1ESF A;  2EY1 A;  1RCV D;  3RD4 A;  5D1P A;  4EGV A;  5HV6 A;  3KTM A;  4JI2 H;  4B3M H;  1K3R A;  1STB A;  2PPB C;  3GTQ B;  2B63 G;  3WO0 A;  3QOL A;  3ETJ A;  5KFA A;  3Q8S B;  5L1L A;  1HUM A;  2F0T A;  2G9D A;  3MAQ A;  1F77 A;  2F3V A;  1P16 A;  2XTI A;  4XDX A;  1E3P A;  1YIT A;  4BA2 I;  1KXL A;  1EYC A;  4M9U A;  4MTD A;  4DR1 H;  2FJ2 A;  2KED A;  2YRW A;  4JI6 H;  3I72 A;  5IOD A;  2JA8 H;  4B08 A;  1NAP A;  1LM0 A;  5GAD C;  4KJN A;  3HOW G;  3GV3 A;  3HOX B;  3MZ5 A;  4A4I A;  4R4O A;  4FXD A;  5C44 B;  1K3B C;  1HFN A;  1PH6 A;  3BG5 A;  2W70 A;  1S9F A;  1W93 A;  4JBJ A;  3MHB A;  1C4Q A;  1YBY A;  2Z1C A;  2SDF A;  1TWH B;  1NUC A;  4XQQ A;  2JN4 A;  1XMO Q;  1HNX H;  4K6D A;  2JA5 A;  3WDN A;  1R4P B;  2VQE Q;  1Y8O B;  2R84 A;  3RB6 A;  3LWU A;  5IT9 W;  2D62 A;  2BA1 A;  3M4Y A;  2W57 A;  1S10 A;  4F4Y A;  5KG7 A;  1TWG A;  4XYM B;  1T36 A;  1QUQ A;  3U58 A;  2WAQ A;  4MV6 A;  2C22 A;  2NZH A;  2BCO A;  2K5V A;  3U9T A;  2UVV A;  1O7Y A;  1S5F D;  4AYB B;  3MVV A;  4ZLT F;  4CJ0 B;  4L5S A;  1G2T A;  1WCM A;  1KTK A;  3EVQ A;  4J1M A;  1VKZ A;  3Q6S A;  3MEF A;  3I12 A;  1IL8 A;  1WJJ A;  1XXG A;  1GSO A;  4MV9 A;  3QIA A;  1WTH A;  1AN8 A;  1PH8 A;  4F4W A;  1K83 A;  2VOB A;  4Z9C B;  4YWM A;  2SCU B;  5KT7 A;  1SMX A;  3R2T A;  2HHH Q;  3VYU A;  2UUB L;  3SEB A;  1PTO B;  4Q8F A;  1SRU A;  3CKI B;  4A3F B;  1B4O A;  5JH7 F;  3L3O C;  4EFE A;  1LTL A;  4A3E H;  1V1P B;  3EIV A;  4HNU A;  3BDC A;  2QKI C;  4DR6 Q;  1PLF A;  4GKJ Q;  2B8G A;  1LTI D;  1EZ6 A;  1IZ6 A;  4JBM A;  2Y0S E;  1AEX A;  3K57 A;  2K5W A;  4UHV A;  4A3D B;  1WD1 A;  4DV1 H;  3MXN B;  1O78 A;  2R92 G;  3HP3 A;  3RIZ A;  3A8J E;  5KG4 A;  1C48 A;  3MXG A;  2EPB A;  4PZ6 A;  3S1Q B;  2RDH A;  2WAC A;  1BBU A;  2OTJ A;  5M5W H;  4I50 F;  2R7N A;  3PV0 A;  3D8G A;  3MC0 B;  4FVM A;  3RLO A;  1PRT B;  4X66 Q;  3CCQ A;  4C3J G;  4IFD J;  3T1Y L;  1WD0 A;  1KJJ A;  5JVH 3;  5BN5 A;  4DV7 H;  4HQ6 A;  5JUM A;  5M5Y B;  2MGS A;  4QL5 A;  2BQU A;  5M3F G;  3L0O A;  1LTB D;  1VQA A;  2I5M X;  4FO2 A;  5C0X G;  3U50 C;  5D1O A;  4O42 A;  2FFK B;  1EY5 A;  1TWC A;  3TP5 A;  2UVR A;  4OO1 H;  1Z2N X;  3OHB A;  3FKI H;  3I7F A;  1STG A;  2W6N A;  2Q2T A;  1A15 A;  4TQS A;  3D4D A;  4HMJ A;  1EY6 A;  1ICW A;  2ZTC A;  3QWN A;  3OW2 A;  3J80 L;  4G7H C;  3N43 B;  2L5T A;  1Y1V H;  4A3B H;  1J5E H;  1X32 A;  3VYT A;  2KHJ A;  1E4E B;  2JP1 A;  4DAY A;  1E4F T;  1UWV A;  5IWA H;  3S24 A;  1D6E C;  4LMQ D;  5M5X B;  5ELO A;  4BY1 H;  2Z4I A;  2E8G A;  1AP0 A;  4P71 A;  5K36 H;  3HKZ A;  2Z9H A;  2E76 C;  1VQJ A;  5E1F A;  3S2H H;  2NU7 B;  4A3K G;  2LXK A;  4G7Z C;  1GD7 A;  4J0M A;  4PZ7 A;  3ERQ A;  3H4D A;  1JT8 A;  1Y1W A;  2VUM B;  4NP5 A;  3VYS A;  3GTG H;  4RZR A;  3JRX A;  3LNN A;  4DR5 Q;  2ZDQ A;  5KFR A;  3V05 A;  2OQ0 A;  1Q7Y C;  2C00 A;  3KYH C;  3C2P A;  3DLL A;  3RR5 A;  4GN3 B;  5J39 A;  4GNX C;  4B3R L;  2YS7 A;  3S15 H;  3GP7 A;  1HA6 A;  5KKN B;  2V1C C;  1I4G A;  5A2Q W;  3AFQ A;  3F1Z A;  3KJO A;  1N33 Q;  2NVQ H;  5IOC A;  5GAG C;  3DHQ A;  1IOW A;  2FLN A;  1KAA A;  3K80 C;  5G3L F;  1HZA A;  3ZYY X;  2FIN B;  3HOZ G;  1I3Q A;  4KKS A;  1JB7 A;  1MJC A;  1IKL A;  3JSL A;  2MO0 A;  2FHT A;  3J81 W;  2MFI A;  1EIF A;  1AZQ A;  3SE0 A;  3Q8P B;  4LNQ A;  2FLL A;  4LF9 L;  3I91 A;  2A68 D;  2CVR A;  2JA7 A;  1K8M A;  3SHL A;  1V4Y A;  4ZKC B;  2I07 B;  3KHG A;  4RB2 C;  1UAP A;  4LF8 L;  4GS3 A;  1HNZ L;  4LFC L;  5KFV A;  4PWQ A;  4IAL A;  2JA9 A;  2F0V A;  1CS0 A;  2D0O A;  4RGM A;  4XYQ A;  2UXB L;  5KFM A;  1VQP A;  3WOE A;  4J6H A;  5LMU L;  4OL7 A;  3KUP A;  3H94 A;  3BQ1 A;  1BO0 A;  4XTC S;  2PN1 A;  3GTP H;  4NXM L;  3GIK A;  3DM1 A;  3JSN A;  1R9T A;  3QZ7 A;  4G4K A;  5DGB A;  2PCF B;  5KNB A;  4GKJ H;  5I9O A;  2F4V H;  1HZ9 A;  2PYK A;  3RN2 A;  5KFL A;  1JLL B;  3D6C A;  1Z2O X;  5IE8 A;  3CCS A;  2R3Z A;  1IBL Q;  3IL8 A;  3RV3 A;  1CUK A;  3L9A X;  4APV A;  3H40 A;  1WYD A;  4L5R C;  4DKA C;  5JEA G;  4APM A;  1ENF A;  4DV4 Q;  1U4P A;  4N9P A;  1DOM A;  1VS0 A;  4A3L G;  2OT2 A;  4X62 Q;  2K6A A;  4CJ1 B;  4RNM A;  3P7J A;  3CD6 A;  2VQF Q;  4UCR A;  1OXV A;  4HYK A;  1LT4 D;  4DUY L;  4X66 H;  2XRQ D;  1IBK Q;  1EY8 A;  1AFP A;  1KHI A;  5A35 A;  2NVX A;  1EY7 A;  4XT1 B;  5IYC G;  3K5M A;  5ELD A;  1PH7 A;  1DCZ A;  5COR A;  1R4Q B;  1DON A;  1TS5 A;  4DF7 A;  1CZG A;  4B3S Q;  2FP4 B;  4ECV A;  1S0N A;  2JA6 G;  1VQO A;  2C35 B;  3PW2 A;  3T51 B;  2FPG B;  4JI1 Q;  3BVG A;  5GAH C;  3MA2 B;  5EGT A;  5LA6 F;  5CV6 A;  2KSW A;  4L5T A;  1OXU A;  1JOK A;  2AGQ A;  4LF7 Q;  4TV9 F;  3CCM A;  2IX3 A;  2J6T A;  4LFA H;  4IN3 A;  5BR8 Q;  3CMA A;  3NPP A;  4Q45 A;  2JA5 H;  1GUO A;  2YTX A;  3H6M A;  2AUK A;  5BN4 A;  2ENB A;  1LT6 D;  1O7L A;  3FKI B;  5CMD A;  3C46 A;  5JVD F;  4RGO S;  4DV0 L;  3R23 A;  1TWG H;  3ERS X;  1SNQ A;  2EZV A;  4DR3 H;  3OSO A;  2YTY A;  1VQ7 A;  1I6U A;  4HJ9 A;  3D0F A;  4X3U A;  3CC4 A;  5CGK A;  3R5H A;  2DLN A;  4IUP A;  1WTX A;  3GTJ A;  4BY1 B;  3K5I A;  4GOP C;  4YR0 A;  4ECZ A;  2TMP A;  5LL6 b;  4O0A A;  1O7Z A;  1L2F A;  3R93 A;  1WCM H;  2ATW A;  2R93 G;  1WI5 A;  2WII B;  1K1S A;  2R92 B;  1YNJ C;  1HJP A;  1C7Y A;  2E2I B;  4JI7 H;  4JBW A;  4X6A H;  1A62 A;  5KFP A;  1W96 A;  1PFB A;  1F9R A;  3FMC A;  2PQA B;  5J3B A;  4LF6 L;  1L1O C;  1I7N A;  3BA8 A;  3RZO H;  1XTD A;  1TQO A;  2AUJ D;  1XNR L;  3NTH A;  2R7Z G;  3M9N B;  4HSP A;  5CAE B;  2H5X A;  5FD6 A;  4F50 A;  2B2Y C;  1BDO A;  3S15 B;  4FDB A;  4LFB H;  1MHW C;  3ULJ A;  4B3T L;  4Q0Y A;  3W1B A;  1WTO A;  2HVS A;  4O1N A;  3TQY A;  3DEO A;  1LTS D;  2M2L A;  5FLX E;  2HDM A;  4JOI C;  4UDU C;  5AJ3 Q;  5IGE A;  4BBR H;  4DV6 H;  3ORR A;  3PVX A;  3RBE A;  2EE1 A;  3T1H L;  2HCC A;  1T5X D;  3Q8D A;  3RZD H;  5FJ8 H;  1GOZ A;  5KFX A;  3A0J A;  3WWV A;  3HS0 C;  4O3N A;  4KKT A;  3HOV H;  3S17 H;  1U0L A;  4XQJ A;  4Q44 A;  2F0W A;  1ZYR D;  4EVO A;  4CKE A;  3V4Z A;  3Q8Q B;  4LF5 L;  2KVM A;  2KQ3 A;  2QDB A;  4KK7 A;  5CBA E;  1HNW L;  2UXC H;  3M9B A;  1V51 A;  3TIN A;  4IPC A;  3VA7 A;  1SAP A;  5IYD G;  2B2W A;  1A0I A;  1B70 B;  3H09 A;  2NB0 A;  1STH A;  4HED A;  2WB1 E;  4MAM A;  2K1B A;  3E0J A;  3TZU A;  5CV8 A;  4WD3 A;  4DV2 L;  2IPK D;  4JW0 A;  1Y14 B;  2KEC A;  3IRB A;  4BBS H;  4C2M A;  2PZW A;  4A3G H;  4A93 G;  3NQI A;  2NVY B;  4KI0 A;  1XMQ L;  3MR5 A;  1EHI A;  4DR4 L;  1NMG A;  2PZT A;  1T94 A;  5C3W A;  4QF4 A;  1YEZ A;  1UE6 A;  1C0A A;  3DM3 A;  5D3I B;  1A3U A;  5HGT A;  1EWC A;  3X3N A;  2ES2 A;  1B33 N;  4GKK L;  1IBK H;  1V43 A;  5IP9 H;  1BF4 A;  1TWF H;  5EPJ A;  3CCV A;  1VQ5 A;  3J7A 5;  3CVZ A;  1HQM C;  3VYR A;  2VR1 A;  1YVC A;  3A7A B;  1PMR A;  1FNW A;  4B3S H;  1PH2 A;  4K6L A;  3WOF A;  3Q1K A;  2KUM A;  2A5H A;  3HOX G;  4HJ8 A;  4JI1 H;  2Z4H A;  2R7L A;  3RMH A;  5C44 G;  3STB D;  4A3M B;  1K73 C;  3N6X A;  2UUB Q;  3NBI A;  3OWE B;  2K52 A;  2D5D A;  3EN2 A;  4HTH A;  3RLN A;  3J7A V;  5BR8 H;  1O75 A;  3VPB A;  3RB4 A;  1N32 L;  4Y7N B;  1CTM A;  4U6P A;  1E1O A;  3RV4 A;  3C1F A;  5KFC A;  3OWF A;  4V19 0;  2F0M A;  5CR3 A;  4PNY A;  1RD9 D;  1SE8 A;  4ED7 A;  5K5P A;  2A6H C;  2XVS A;  4FS1 A;  1BJT A;  2NUC A;  3K59 A;  4AYB G;  1I3Q H;  4DK3 C;  2DPJ A;  2XIW A;  1TWG B;  1QUQ B;  3HFZ B;  1D5M C;  1PXU A;  2WAQ B;  1YZ6 A;  1Q82 C;  1S0O A;  2R6F A;  4PZ8 A;  4BA1 I;  3I4M H;  3P1H A;  1K1Q A;  3BAB A;  2JA7 H;  2OQK A;  2PVP A;  2QCP X;  3C0F B;  3A54 A;  5D3D A;  2FXQ A;  1EYA A;  1ZYR C;  4GOP A;  4RB1 A;  4IFD H;  1II3 A;  3T1Y Q;  5FOB B;  1WCM B;  3MFI A;  5DG8 A;  2N78 A;  4HJ5 A;  5C0X J;  5KFE A;  3D3R A;  4C3H H;  4A3F G;  4QWC A;  3SR1 A;  5J22 A;  4IUT A;  2E2H A;  1L1O A;  1Q3L A;  1R9T H;  2FJZ A;  3VA5 A;  4QW9 A;  1FJG L;  1K83 B;  1JCK B;  2PW5 A;  4GC7 A;  3MXP A;  1JDE A;  5JJZ A;  4NW2 A;  4KMU C;  1V8Q A;  4J9L A;  4A3D G;  1C30 A;  1I4P A;  2PBZ A;  3A55 A;  2HQE A;  1VDZ A;  2UXD L;  1TAE A;  3V6J A;  2B2Y A;  2IL8 A;  1MI2 A;  1N9W A;  2K5H A;  1Y8N B;  1Y1V A;  2DY8 A;  2EYJ A;  3E9I A;  1EY0 A;  1CHP D;  3MWE A;  4UCS A;  5DLG A;  2EJF C;  2IW3 A;  3S9W A;  3ORQ A;  1MIU A;  3SDZ A;  4N8F A;  3NHH A;  4O2A F;  1TS4 A;  4Y52 H;  4G7O C;  2H1E A;  1FL0 A;  3RGZ A;  5D65 A;  4KD4 A;  1JQY D;  3WO1 A;  1HTL D;  3RZD B;  2ZDH A;  1A9X A;  4DR2 H;  1HA5 A;  2NVX H;  4ECX A;  3STB C;  4DXG A;  4ZRZ A;  2CHB D;  1RF2 D;  3KFU A;  1VQ9 A;  1IBM L;  3GIQ A;  3GTG A;  4DR7 H;  2SEB D;  1G29 1;  1CKO A;  3ERO A;  4B3R Q;  3R2I A;  2DWC A;  4O4I F;  5IIF A;  2BQ3 A;  3G71 A;  3T16 A;  2L9H A;  2VY3 A;  1I6H B;  1A3V A;  1NMF A;  1LUZ A;  3BAA A;  2JEI A;  5D1O B;  3AEV A;  4IWX A;  5BPF A;  1UEA B;  1EYG A;  2CQO A;  1PHJ A;  3VPD A;  1EY9 A;  1TWC B;  3CRL C;  5CV9 A;  1CT1 D;  1QG7 A;  3UDI A;  1ENC A;  4BBS B;  4YJ3 F;  2NU9 B;  4DAP A;  4R9W A;  1WTW A;  4WJW A;  1H9J A;  4IR1 A;  4A3I H;  2RDG A;  3NP8 A;  4JVZ A;  4XYO A;  1HR0 L;  5LP6 F;  1K8O A;  3G6V A;  5IGD A;  2RDJ A;  1VQB A;  2F0K A;  4LF9 Q;  1Q8K A;  1TWA A;  4DAY B;  3I4L A;  3PIP 3;  2I8C A;  1S03 G;  1GGO A;  2UUA H;  2V4D A;  2FMM A; 
#chains in the Genus database with same CATH homology
 3AFP A;  4PG3 A;  3MXN B;  4A3J H;  2R92 G;  1HNZ Q;  3J81 j;  2DUD A;  4YY3 L;  1JMC A;  2R6G A;  1N8R C;  2UU9 L;  4LFC Q;  1N34 Q;  2L15 A;  1HH2 P;  1V1Q A;  2A1A A;  3K7A H;  1NY4 A;  2VW9 A;  4RMF A;  2UXB Q;  2IHF A;  4JI5 Q;  1UE1 A;  4PZ6 A;  5C4X H;  1U5K A;  5LMU Q;  1PH9 A;  3H15 A;  4KLK A;  2KCT A;  3UDF A;  3RN5 A;  4LFA L;  1BBU A;  2OTJ A;  5M5W H;  1L1O B;  1KQS A;  4NXM Q;  2EIF A;  1D7Q A;  3PV0 A;  1TXY A;  1ASY A;  3GTO H;  3HKZ E;  1I94 Q;  3RLO A;  1KAW A;  4X66 Q;  3CCQ A;  2BH2 A;  2LSS A;  4IFD J;  3T1Y L;  1CKM A;  2MNA A;  4A3M H;  4BBR G;  4IJH A;  1VQF A;  3G48 A;  4X65 Q;  4DR3 L;  2JE6 I;  1GVP A;  2KEN A;  4QL5 A;  5M3F G;  3L0O A;  2I5M X;  1VQA A;  4DNI A;  5C0X G;  2VZA A;  3U50 C;  1X54 A;  1I50 H;  4Y7N H;  3OTO Q;  4A76 A;  2HQL A;  4OX9 L;  2XGT A;  2ZJP A;  3G4S A;  1H95 A;  3HOV G;  3FKI H;  3I7F A;  1VQ6 A;  4JI8 Q;  2Q2T A;  4R4I A;  3H0G H;  4JI7 L;  1XPR A;  2ZTC A;  4J15 A;  3OW2 A;  5C3E H;  2QGQ A;  1YHA A;  1Y1V H;  2YYZ A;  4A3B H;  2AWO A;  2KHJ A;  4DUY Q;  4MNO A;  1XMO L;  1UWV A;  3J80 c;  3F2B A;  1VQL A;  3S24 A;  2IT1 A;  2ALY B;  4AIM A;  5IYB G;  5ELO A;  2VQE L;  1Q1E A;  4BY1 H;  3KLW A;  2QA4 A;  2E8G A;  4EQ5 A;  5GAE C;  3CAM A;  4P71 A;  5LMN W;  1VQJ A;  2PI2 E;  3S2H H;  3I4N H;  1C0A A;  1YHB A;  2LXK A;  4A3K G;  2VL6 A;  1GD7 A;  4AQY L;  4NXN Q;  2F52 A;  4NPS A;  2Z6K A;  4PZ7 A;  3HOY H;  4A3G G;  4LFB L;  1CSP A;  4A3L H;  1EOV A;  3M85 A;  1JT8 A;  3AYH B;  1E24 A;  4LW1 A;  2KBN A;  4O2D A;  2YU9 H;  5E7N A;  3GTG H;  2Q2H A;  3CQZ H;  2CWA A;  3TRE A;  4GN4 B;  3GTQ H;  4DR5 Q;  1IXR A;  4LUZ A;  2OQ0 A;  2WP8 J;  1CKN B;  3PUV A;  4A3I G;  3D31 A;  3KYH C;  3PIP A;  1Q7Y C;  3J80 i;  3DLL A;  4DV6 L;  3RR5 A;  1ASZ A;  4GN3 B;  1YJ9 A;  5IP9 G;  4GNX C;  4B3R L;  4YHH L;  5FLX c;  3PUZ A;  4KHP L;  5IYC H;  3TRZ A;  4UY8 C;  1FVI A;  4C2M H;  3UE1 A;  3S15 H;  3U4V A;  4B3M Q;  1K83 H;  2ZM6 L;  4DV0 Q;  4JI2 Q;  5ELN A;  2NVT H;  2V1C C;  1X3E A;  4JV5 L;  3HOX H;  4A3J G;  2JA6 H;  1P8L A;  3AFQ A;  4P75 A;  3F1Z A;  3KJO A;  4JBK A;  1N33 Q;  2NVQ H;  4A3C H;  4X64 L;  1SLJ A;  2K5N A;  4JOI A;  1L0W A;  5GAG C;  4C3I H;  2I5L X;  5M3M H;  4PMW A;  2HHH L;  2RHS B;  1E1T A;  2N49 A;  4DK6 C;  1TWH H;  3K80 C;  4JI6 Q;  5IP7 H;  5C4X G;  1HZA A;  3VDY A;  2UXC L;  2ZJR A;  3PGZ A;  1M90 C;  3HOZ G;  1RIP A;  1JB7 A;  5JJK A;  1MJC A;  5FLM G;  4GLA C;  2QEX A;  4BY7 H;  4DR6 L;  2MO0 A;  4GKJ L;  2MO1 A;  2I5H A;  2MFI A;  1EIF A;  2R7F A;  4LNQ A;  2GN5 A;  3UDG A;  4LF9 L;  2JQO A;  1HNX Q;  4IJL A;  4LF6 Q;  4UP7 A;  3TS2 A;  1PVO A;  1YI2 A;  1B8A A;  3NEL A;  4LF8 L;  3KF8 B;  4GS3 A;  4LUV A;  1HNZ L;  1XNR Q;  4IFD I;  4LFC L;  1UE7 A;  2ZTE A;  3S2D H;  1N34 L;  1PA6 A;  2JA9 A;  4A75 A;  1QZH A;  2D0O A;  4ME3 A;  2UXB L;  4JI5 L;  1VQP A;  4JI0 Q;  1VQ8 A;  5LMU L;  3GTL H;  3FKI G;  3F2D A;  4XTC S;  1VQ4 A;  5HGQ A;  1I5F A;  3GTP H;  4B3T Q;  1CKN A;  1VQD A;  4DR2 Q;  4NXM L;  2R93 H;  2BA0 A;  1FGU A;  5C3E G;  1I94 L;  1I6H H;  1IBK L;  2ZTD A;  4X66 L;  4A3B G;  3CCU A;  3CF5 A;  1BVS A;  1HZ9 A;  4MZ9 A;  3RN2 A;  3CC7 A;  4DR7 Q;  1Z47 A;  3K8A A;  3PF5 A;  4YWL A;  1E7Z A;  4X65 L;  4BY1 G;  2AHO B;  5IE8 A;  1TWC H;  3CCS A;  3PO2 G;  4WJ4 A;  1IBL Q;  1CUK A;  4HID A;  4APV A;  2IHE A;  5K36 G;  1WYD A;  4L5R C;  4NB3 A;  4DKA C;  5JEA G;  3I55 A;  3L2P A;  3T1H Q;  4A3F H;  3OTO L;  4YCW A;  4LF8 Q;  3HOY G;  4DV4 Q;  1VS0 A;  1AE3 A;  1QVF A;  4A3L G;  4X62 Q;  4JI8 L;  1Q12 A;  1PYB A;  5C0X I;  2Q2U A;  3CD6 A;  2JK8 A;  3M4Q A;  5IY0 A;  5BR8 L;  2VQF Q;  2JA8 G;  1OXV A;  4LF5 Q;  4A3D H;  1HNW Q;  2PMZ E;  4DUY L;  1EUJ A;  1Q81 C;  3CCJ A;  1N36 L;  3J81 c;  1IBK Q;  1KHI A;  2CWP A;  3FHW A;  4QIW E;  2IY5 B;  1QVG A;  1XNQ Q;  5IYC G;  1PH7 A;  2E5L Q;  3CPW A;  3S1Q H;  1JJC B;  2UUA Q;  1T9H A;  2E2H H;  4B3S Q;  3W5O A;  1Y1W H;  5JEA J;  1VQG A;  3OYY A;  3G6E A;  4DV2 Q;  4HJ7 A;  2JA6 G;  4BXX H;  1VQO A;  2C35 B;  5LMN Q;  1VQN A;  4NXN L;  4A3C G;  4JI1 Q;  4JYA Q;  5GAH C;  5M3M G;  1XMQ Q;  1NTG A;  1OXU A;  4L5T A;  4LUO A;  5H1S E;  5IP7 G;  4DV3 Q;  4DR4 Q;  4LF7 Q;  2N8N A;  4K0K Q;  3CME A;  4OWX B;  3CCM A;  4DR5 L;  4JV5 Q;  5BR8 Q;  3CMA A;  4MTN A;  4BY7 G;  3J81 i;  1KIX A;  2JA5 H;  5IYD H;  2YTX A;  4R4C A;  3KJP A;  2ZJQ A;  4GKK Q;  4JI3 Q;  4UP8 A;  3HKS A;  3UE0 A;  3PUX A;  1N36 Q;  3PO3 H;  1A63 A;  4B3M L;  2OWO A;  4DV0 L;  4JI2 L;  1W2B A;  1TWG H;  2A19 A;  1EWI A;  1EQQ A;  3ERS X;  1JE5 A;  2WB1 G;  4TVA B;  2YTY A;  2I0Q A;  4JG2 A;  3S1N H;  4QQB X;  3NBH B;  1VQ7 A;  1N33 L;  3BZC A;  3H3V H;  4P72 A;  1VCI A;  1VQM A;  4HJ9 A;  4OWW B;  3D0F A;  4HIK A;  3CC4 A;  4A93 H;  3B6Y A;  3ER0 A;  1VQI A;  4DR1 L;  1JJ2 A;  4LF4 Q;  3CCL A;  4P73 A;  1PV4 A;  4GOP C;  1DGS A;  4JI6 L;  5M5X H;  4O0A A;  1L2F A;  4L5Q A;  1WCM H;  2ATW A;  2R93 G;  1WI5 A;  5GQO A;  1YHQ A;  1KC8 C;  3NEN A;  1HJP A;  1YJN A;  1J5E Q;  1C7Y A;  4JBW A;  4A3E G;  2D0P A;  3CXC A;  4X6A H;  1A62 A;  2K14 A;  1N32 Q;  5JJI A;  1EQR A;  4JI4 L;  3K81 C;  2RF4 A;  5J3B A;  1HNX L;  2PQA B;  1Q46 A;  3S16 H;  4LF6 L;  1L1O C;  1Z9F A;  1S72 A;  2Z0S A;  2VUM H;  2B29 A;  3RLF A;  3RZO H;  3HOU H;  1XTD A;  1XNR L;  2R7Z G;  1C9O A;  1QVC A;  1XPU A;  1K9M C;  4DAM A;  3LGJ A;  5C44 H;  2H5X A;  4JI0 L;  1RL2 A;  1Q1B A;  2R7D A;  2R7Z H;  1VQK A;  1G6P A;  1V9P A;  4FDB A;  4DR1 Q;  1WOC A;  3M3Y H;  3I4O A;  4JCV E;  3ULJ A;  4B3T L;  4DR2 L;  1PYS B;  4GLV B;  3BJU A;  3W1B A;  1PH5 A;  4POG A;  1TWA H;  3TQY A;  2A8V A;  4JOI C;  3ULP A;  2ID0 A;  4C3J H;  1MJE A;  2YTV A;  4DR7 L;  5AJ3 Q;  3TS0 A;  1KRT A;  4BBR H;  3SGI A;  1HR0 W;  4JI4 Q;  4A3M G;  1IBL L;  2YV5 A;  1JJG A;  2UUC L;  4XIG S;  4HJA A;  5M3F H;  3CW2 C;  3T1H L;  3GDE A;  3Q8D A;  3RZD H;  4BXX G;  2MQH A;  5FJ8 H;  3CCR A;  1YJW A;  4DV4 L;  3A0J A;  3WWV A;  1G51 A;  1CSQ A;  4X62 L;  3ULL A;  4R1J A;  3HOV H;  3S17 H;  1U0L A;  3W1G A;  2ASB A;  1VQE A;  4UPA A;  3NEM A;  4POF A;  2VQF L;  4LF5 L;  4OO1 G;  2HIV A;  4OON A;  1HNW L;  1OXX K;  3M9B A;  3CPF A;  3H0G G;  2EQS A;  4ALP A;  3RNU A;  2PQA A;  2JA5 G;  4IPC A;  1X56 A;  5IYD G;  1Y1V G;  3ICE A;  1O7I A;  2RCN A;  3TEH B;  4KHZ A;  2UXD Q;  1A0I A;  1B70 B;  1XNQ L;  4RG1 A;  4R4Q A;  1QZG A;  2E5L L;  3PO3 G;  2AMC B;  1GO3 E;  2WB1 E;  2E2J H;  2UUA L;  3GTK H;  2OCE A;  4P74 A;  4B3S L;  4DV1 L;  2KHI A;  1YNX A;  2WAQ G;  3PUW A;  3CCE A;  4DV2 L;  2B63 H;  2UUC Q;  1HZB A;  1BBW A;  1Y14 B;  3IRB A;  5LMN L;  2NN6 G;  1KRS A;  4JI1 L;  3M4O H;  2Q2I A;  4BBS H;  3I4N G;  4IPG A;  4JYA L;  4A3G H;  4A93 G;  4KI0 A;  4OWT B;  1PFS A;  1XMQ L;  2N3S A;  4DV3 L;  4DR4 L;  1NMG A;  1XJV A;  4DUZ L;  1PH4 A;  4LF7 L;  4K0K L;  4WJ3 M;  2IX1 A;  1YEZ A;  1UE6 A;  1WCM G;  4IOC A;  3K0X A;  3DM3 A;  5DLQ E;  4YWK A;  3S1R H;  1S40 A;  3A5U A;  1SFO H;  3HOW H;  1X65 A;  2ES2 A;  2F4V Q;  4GKK L;  4JI3 L;  1SR3 A;  1B7Y B;  1V43 A;  5IP9 H;  2CKZ B;  1TWF H;  3CCV A;  1HZC A;  1VQ5 A;  1IBM Q;  3J7A 5;  2EXD A;  2VUM G;  4GOP B;  1Q86 C;  1OXS C;  1YVC A;  2PNH A;  4IO9 A;  3GTJ H;  3HOU G;  1AE2 A;  1PH2 A;  1K8A C;  4IPH A;  2B3G A;  4DV1 Q;  4GLX A;  1UEB A;  3K7U C;  2WFW A;  3BU2 A;  3J7Z C;  3HOX G;  3F2C A;  4HJ8 A;  5C44 G;  4LF4 L;  1VQC A;  1J6Q A;  3STB D;  1MKH A;  1AH9 A;  1PH1 A;  3A74 A;  4GN5 A;  1K73 C;  1D8L A;  5HY6 A;  3HOZ H;  2UUB Q;  3E0E A;  2K52 A;  2AWN A;  3FP9 A;  3EN2 A;  4GNX B;  3RLN A;  1OTC A;  3KF6 A;  4LWC A;  5FLM H;  4DUZ Q;  1J5E L;  1E22 A;  5M5Y H;  5GRO A;  1XPO A;  1X9N A;  1N32 L;  2HIX A;  1UE5 A;  1E1O A;  5IWA L;  5C4J H;  1HR0 Q;  2DGY A;  1W3S A;  3E9H A;  1X6O A;  1SRO A;  1SE8 A;  4DV7 Q;  4IPD A;  1GM5 A;  3JAM c;  5FJ8 G;  3PUY A;  2F3I A;  2NZO A;  1EFW A;  4AYB G;  1I3Q H;  1M1K C;  2KCM A;  4DK3 C;  4YY3 Q;  2UU9 Q;  2BH8 A;  1NE3 A;  4IOA A;  1QUQ B;  1YIJ A;  3HFZ B;  4QJF A;  2JEA I;  1X3F A;  1YZ6 A;  1Q82 C;  3UDX A;  4JC0 A;  4DV5 L;  1NJI C;  4HIM A;  4PZ8 A;  4LFA Q;  4BA1 I;  3GTM H;  3I4M H;  2K75 A;  1OXT A;  2JA7 H;  2OQK A;  3KDF B;  1PH3 A;  5AJ3 L;  2FXQ A;  4GOP A;  2Z6K C;  3PCO B;  1WFQ A;  5IWA Q;  3T1Y Q;  3PO2 H;  3PF4 A;  2WAQ E;  1GKH A;  3JAM i;  4DR3 Q;  2N78 A;  1K3R A;  4HJ5 A;  2Y0S G;  4YCV A;  5C0X J;  2CCZ A;  2B63 G;  2JJQ A;  2R92 H;  4C3H H;  4A3F G;  4DPG A;  2E2I H;  4BBS G;  2XTI A;  4BA2 I;  1P16 A;  1YIT A;  4OX9 Q;  1E3P A;  1SN8 A;  1KXL A;  1X55 A;  1L1O A;  4GNX A;  1BKB A;  2AKW B;  1R9T H;  2GVB A;  3M7N A;  1FJG L;  2JA8 H;  3GO5 A;  3U4Z A;  1LM0 A;  5GAD C;  3HOW G;  2IX0 A;  4A4I A;  4R4O A;  4DV5 Q;  4JI7 Q;  4A3D G;  1IYJ B;  1PH6 A;  1EIY B;  2UXD L;  4OO1 I;  2CFM A;  3HKZ G;  4JBJ A;  1YBY A;  3CP0 A;  4HIO A;  1N9W A;  2K5H A;  1XMO Q;  1IL2 A;  2LXJ A;  2VS1 A;  3PSI A;  4YCU A;  4UP9 A;  2VQE Q;  1KL9 A;  4QGU A;  2HT1 A;  3E9I A;  2D62 A;  2BA1 A;  4QY7 A;  1Y1W G;  1MIU A;  3M4P A;  1K0R A;  1QUQ A;  3U58 A;  4Y52 H;  4AQY Q;  1KD1 C;  1FL0 A;  4LFB Q;  2NZH A;  2PI2 A;  4H02 A;  3H3V I;  2K5V A;  2NN6 I;  3CC2 A;  3KDF A;  1FJG Q;  3ZJY C;  3PIO A;  2NVX H;  2GVA A;  2F4V L;  3KOJ A;  4AH6 A;  2RHQ B;  3STB C;  4EX5 A;  2K50 A;  4L5S A;  3KF6 B;  1VQH A;  1VQ9 A;  3KFU A;  1IBM L;  4DV6 Q;  4R4T A;  1G29 1;  3MEF A;  1S3O A;  1CKO A;  4OXP A;  5IYB H;  4YHH Q;  3L7Z C;  1NBW A;  2OTL A;  3S14 H;  1LYL A;  4B3R Q;  4KHP Q;  3G71 A;  1WJJ A;  2ZM6 Q;  3JC6 6;  2VY3 A;  1K8G A;  4AYB E;  4A3K H;  1NMF A;  1PH8 A;  1LUZ A;  4X64 Q;  4YWM A;  3AEV A;  1A8V A;  1SMX A;  2HHH Q;  1EYG A;  2CQO A;  2UUB L;  3GD7 A;  4TQU S;  3AQQ A;  1PHJ A;  1X3G A;  3BZK A;  1SRU A;  3UDI A;  2UXC Q;  3I4M G;  3EBE A;  2VNU D;  1LTL A;  3A5Z B;  4A3E H;  3EIV A;  3I2Z A;  2JA7 G;  4A3I H;  4DR6 Q;  1HR0 L;  4GKJ Q;  2NVY H;  4IFD G;  3I56 A;  1VQB A;  5EAY A;  3S1M H;  4LF9 Q;  1IZ6 A;  1Q8K A;  4DAY B;  4JBM A;  2JEB I;  2Y0S E;  4DV7 L;  5JJL A;  3F8T A;  2K4K A;  5IT9 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...