1Y14B

Crystal structure of yeast subcomplex of rpb4 and rpb7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
154
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNASYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Complete RNA Polymerase II and Its Subcomplex, Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II 32 kDa polypeptide
total genus 28
structure length 154
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y14B02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y14B01
3PO3H 1KL9A 2ASBA 1CSQA 4DV5L 5LMNQ 3D31A 2UUCQ 5ELOA 1I50H 1OXVA 3NBHB 4QL5A 3JC66 2MNAA 1YIJA 4A3CH 2YTXA 4A76A 3G48A 2CWPA 3A5UA 1YITA 3F2CA 4A3BG 3I4MH 2E2JH 5IYDH 2NZHA 2XGTA 2VQFQ 4GLAC 5ELNA 3S2HH 4BBRH 4OWTB 3TQYA 3WWVA 4DUYL 4MNOA 4UP8A 4DV4Q 3D0FA 4A93G 3STBD 4B3SQ 2A8VA 1OXXK 3AFQA 5IP7H 1VQ5A 3RLNA 4P71A 4GOPC 3PUYA 3CQZH 4L5TA 4JBJA 4AYBG 5GADC 1PH8A 4LF5Q 2RCNA 3PUWA 4NXML 1XNRQ 1A63A 1HZAA 2JA7H 5HY6A 4DUZL 3CCVA 3HFZB 2KBNA 2L15A 1N36Q 3HOVG 3E0EA 2EIFA 1YJ9A 5C3EG 1HR0L 1S3OA 4MTNA 2NVXH 2VY3A 3PUXA 2F3IA 1CKMA 4A75A 1MJEA 3PO2H 1A62A 1QVGA 1FJGL 4BXXH 5M3MH 5IYBH 5GAEC 4DV2Q 1Y1VH 2GVAA 4JI0L 2ZTDA 2BH8A 4P74A 4X66L 4BBSH 2UXBL 1CKOA 1HZ9A 4LUVA 1SE8A 4UPAA 3TRZA 3CXCA 1VQEA 3PIOA 5E7NA 4HJAA 1PV4A 1X9NA 4A3EG 1EQRA 4C3JH 4MZ9A 2K4KA 5FJ8G 4LF5L 1SMXA 2N3SA 2NVYH 4TVAB 1QUQA 3GTJH 2FXQA 4KI0A 1TWGH 2BA0A 4OXPA 4PG3A 3PF4A 2F52A 2MFIA 1IZ6A 4AIMA 4AH6A 5C44G 2Z6KA 5LMUQ 1OTCA 3K7UC 1Y1VG 1TWCH 1IBMQ 1EYGA 4BXXG 1VQ7A 4IOCA 1Q46A 1Q81C 1NTGA 4UY8C 5AJ3Q 4DV7L 1FJGQ 1NBWA 3RZDH 2OCEA 4A3MG 1Y1WH 1VQKA 4LNQA 3UDFA 2KHJA 3HOXG 4GS3A 3PV0A 2UXDQ 4QQBX 4A3MH 4X62Q 1J6QA 4C3IH 3G4SA 4GKKQ 5EAYA 2UXBQ 4WJ4A 3UDXA 1M90C 1EWIA 3W1BA 4YY3Q 3CW2C 3CCEA 2UUAL 2AHOB 4JG2A 1HR0Q 3ULPA 3U58A 3UDIA 4Y7NH 1VQBA 3CP0A 3J80c 3UDGA 4JI2L 5J3BA 4EX5A 3M85A 4R4OA 1UE5A 5LMNW 3PUVA 1Q82C 1KXLA 2YTVA 2K5HA 2KENA 2I5MX 3I7FA 1EFWA 4DV6L 5GAHC 3RN2A 4IPHA 2UUBL 3G71A 3M9BA 3TREA 2UXCL 3MXNB 4P75A 1VQNA 1HNZQ 4OX9Q 4DV0L 2JE6I 3OTOQ 1D7QA 2I5HA 2K75A 1Y1WG 3H3VI 3CMAA 5H1SE 5BR8L 3CCQA 1QZGA 2JA5H 4HJ8A 1GD7A 4GOPA 1CSPA 2MQHA 3F2DA 4B3MQ 2JA6H 1KIXA 3AQQA 2ZM6Q 2WAQG 1G6PA 1GO3E 5JEAG 1NY4A 1VQPA 3I55A 4DNIA 4LUOA 2DUDA 1K0RA 1YBYA 1N34Q 3S24A 1N8RC 3S1MH 4YHHQ 2RHQB 3IRBA 4NB3A 5IYCH 2KCTA 1Q12A 3H3VH 4KHPL 1SROA 1VQAA 4OWXB 2Q2HA 4OONA 4JCVE 3CC4A 4DV6Q 2JA8H 3J81i 1EIFA 2VS1A 3HOUH 4A3LG 3KF6B 2LSSA 2VW9A 2WB1G 1UE6A 2AKWB 1E3PA 2Z6KC 4NXNL 4DK6C 3AYHB 1C0AA 4WJ3M 1WOCA 3E9HA 2KCMA 1MIUA 1M1KC 1Z47A 1LYLA 3HKSA 1XJVA 3TS2A 1L0WA 1Q7YC 1KAWA 1IL2A 2WAQE 1E7ZA 3CPFA 2UU9Q 1QVCA 3ER0A 4P73A 4A3BH 3F1ZA 2YU9H 2NZOA 1JT8A 1X55A 3GTQH 4B3RL 1A8VA 1Q8KA 4JOIC 1NE3A 2HIVA 2ZTCA 3J81c 1V1QA 1YI2A 1HNZL 4OX9L 2R93G 2BA1A 4A3GH 4DPGA 4JC0A 2PI2E 1PH4A 3OTOL 2JA9A 1N32L 4PZ8A 3M4OH 1UE7A 3ULLA 4HIKA 2Q2UA 2E5LQ 1UEBA 2WFWA 3KDFB 1PYBA 1O7IA 4A3DG 3HOYH 1HJPA 2JJQA 2ZJQA 5FJ8H 3S2DH 4JI5L 2E8GA 5M5YH 2I0QA 3I4OA 4H02A 1BBUA 4A3EH 1TWHH 1XMQL 1I6HH 3S15H 2B63H 3KF6A 5DLQE 3CCJA 4JI7Q 1AE3A 4BA1I 2Q2IA 3T1HL 3RLFA 3UE1A 3JAMc 1IYJB 4R4QA 2JEAI 3A74A 2VUMH 3BZKA 4QY7A 4YCWA 1C9OA 3CD6A 4A3CG 1X6OA 4QGUA 4AQYQ 1XTDA 1OXUA 5M3FH 4OO1G 1PH5A 3K8AA 3H0GH 1I3QH 4DR2Q 3PO2G 4JI4Q 1L2FA 4XIGS 3J81j 2CCZA 4LF9L 2HT1A 3PO3G 1YHAA 3FKIG 1GKHA 4GLVB 2D0OA 3UE0A 3GTGH 2YYZA 1C7YA 4DR6L 1HZCA 1VQFA 1I5FA 1I94L 2R92H 3H15A 5FLMG 1PH6A 5C0XJ 2E5LL 4A3IG 4B3SL 4XTCS 2IX1A 1B8AA 4PZ7A 4DKAC 1PH7A 4HJ5A 4IPCA 1W2BA 3L2PA 1IBLL 4JI1L 3CMEA 1AE2A 4NXMQ 1XNRL 1YJNA 1TWAH 3GTLH 1A0IA 3LGJA 3GO5A 1V9PA 4DUZQ 1NJIC 1VQDA 4LF8Q 2A19A 4B3RQ 4DR3Q 4O2DA 2R93H 3S1NH 1DGSA 1NMGA 4ALPA 3K80C 4BBRG 2F4VQ 4POFA 3HKZG 4GNXB 3OW2A 4GN4B 3CCSA 4A3KG 1KQSA 3T1YL 1CKNA 3K7AH 4AQYL 4BA2I 5IYDG 3S1QH 3EN2A 3DM3A 3J80i 4DR2L 1ASYA 4JI4L 5IP9G 3H0GG 1XPOA 2ATWA 1WFQA 4IPDA 3FP9A 1E24A 5M5XH 2R7ZG 4AYBE 2HQLA 4K0KL 3HKZE 1U5KA 4HIOA 1OXSC 2CFMA 2HIXA 1WJJA 4JBWA 4Y52H 1HH2P 4DV1Q 2VL6A 4YWMA 1IBLQ 4RMFA 3HOZH 1YHBA 1E1TA 4YWKA 3KOJA 3VDYA 4OO1I 2CKZB 1HNWQ 1HNXQ 4JI6Q 2Y0SE 5IYCG 1R9TH 4LFBL 4L5RC 2R92G 1RL2A 1CKNB 4GN5A 1VQ6A 1QUQB 2RF4A 4GNXC 2JEBI 2K52A 4X66Q 4HJ9A 4DK3C 3PF5A 1I94Q 4JI3Q 1Y14B 3I4NH 4IFDJ 2AWNA 2CQOA 1K9MC 2K50A 3RZOH 2WB1E 3F8TA 1GM5A 3J7ZC 2OTLA 1VQ8A 2N49A 4LF7L 1VQCA 2BH2A 3CCRA 2UXDL 1VQGA 1B70B 4X62L 2MO1A 2N8NA 1B7YB 2IX0A 3K0XA 4R4TA 4UP9A 3KJPA 1XPRA 1QZHA 1VQLA 4APVA 4BY1G 1X3GA 2PI2A 2UUCL 4FDBA 2EQSA 5LMUL 5JJLA 2IHFA 2F4VL 4JI2Q 3ICEA 1IBML 3I2ZA 5IWAL 4QIWE 2Y0SG 3PGZA 3CC7A 4TQUS 1N33L 3SGIA 2YTYA 1FGUA 4JI6L 4DV3L 4B3TL 2ALYB 3F2BA 2D0PA 1PFSA 4A3FH 4PZ6A 3CC2A 3B6YA 2NVTH 1PVOA 4DUYQ 2V1CC 4GKKL 1WCMG 3M4PA 4K0KQ 4A4IA 2D62A 3RLOA 3TS0A 1PA6A 1KD1C 3AEVA 1LUZA 4X64L 2PQAB 1Z9FA 3PCOB 2UUAQ 3M4QA 3ULJA 4JBKA 1X56A 4DV1L 4HIMA 1JJGA 3L0OA 3MEFA 5IT9c 2E2HH 1JMCA 2NN6G 3EBEA 5C4XG 1G51A 4B3ML 1BVSA 1VQ9A 3Q8DA 2ZM6L 1V43A 1K83H 3RN5A 4BY7H 4NPSA 5M3FG 1D8LA 4LWCA 3U4ZA 1PH1A 1N36L 1HNXL 1L1OC 2UUBQ 2QGQA 2VUMG 3KFUA 4A3JH 4QJFA 1IBKQ 4LF6L 4IFDI 3GDEA 4PMWA 4JOIA 2UXCQ 4DAMA 3U4VA 3EIVA 1KRTA 4R4CA 2LXKA 1N33Q 4A3LH 3U50C 3CCUA 1J5EQ 3PIPA 1Q1EA 2RHSB 3KJOA 4JYAL 2MO0A 2PQAA 1IXRA 2Z0SA 3NELA 3J7A5 4A3DH 4BY1H 2CWAA 3S14H 1NMFA 1CUKA 5JJIA 3M3YH 3CF5A 2E2IH 1X3EA 2WP8J 5FLXc 1Q1BA 1PH2A 3FHWA 1BKBA 1VQHA 2H5XA 5M3MG 1N9WA 5IYBG 1X3FA 2JA6G 4GKJQ 3STBC 3KLWA 2DGYA 1TWFH 4J15A 1W3SA 1YNXA 3BJUA 4DV3Q 4B3TQ 1G291 4DV2L 1EQQA 4DR7L 1LM0A 3HOXH 4JI0Q 1AH9A 4NXNQ 1RIPA 2A1AA 4X65Q 1JJCB 4IO9A 2XTIA 1VQOA 2VNUD 1EUJA 3BZCA 4X64Q 1T9HA 2GN5A 3AFPA 1PHJA 1J5EL 1E22A 4A3FG 1YJWA 2AMCB 4JYAQ 4YCUA 4L5SA 2VQEQ 2IHEA 5HGQA 5GQOA 2ID0A 5JJKA 1K73C 4KLKA 2VZAA 1FL0A 4X6AH 2OQ0A 4IJHA 2JQOA 4YY3L 2R7ZH 5IY0A 1X65A 2YV5A 3GD7A 1PH9A 1HR0W 1BBWA 2Q2TA 3CCLA 1P8LA 4GNXA 1Q86C 5GROA 2I5LX 1WI5A 4YCVA 1IBKL 4LF6Q 2IY5B 4GKJL 5C4XH 3PSIA 5IE8A 1TXYA 3ZJYC 3NEMA 5AJ3L 4DV7Q 2PMZE 1VQ4A 4A3KH 3GTMH 4DR7Q 3JAMi 3K81C 3S17H 4DR6Q 1WCMH 4R1JA 3S1RH 1SFOH 4LF9Q 2ZJPA 4LF4L 4DV0Q 1YZ6A 1VCIA 5C0XG 2PNHA 1PYSB 1U0LA 2EXDA 3A5ZB 2JA5G 4JI5Q 1MJCA 1XNQQ 1VS0A 1XMQQ 4OWWB 3I4NG 4EQ5A 2R6GA 3W1GA 5BR8Q 2NVQH 4DR1Q 5JEAJ 2OWOA 5C3EH 2VQEL 1VQJA 4UP7A 2OTJA 5K36G 4LFCQ 4JI1Q 5M5WH 3E9IA 1KC8C 3PUZA 4LF8L 2N78A 4LUZA 1P16A 2HHHQ 4DR4Q 4YHHL 2QA4A 4DR3L 1YEZA 2QEXA 4JV5Q 4LFAL 5IP7G 2AWOA 2GVBA 4X65L 1XMOQ 4A3JG 3TEHB 4A93H 4IOAA 3I56A 3KF8B 4IPGA 3T1YQ 1L1OB 3BU2A 4IJLA 1E1OA 4POGA 4P72A 3CAMA 1FVIA 3S16H 1VQIA 5IP9H 1VQMA 1JB7A 3W5OA 4BY7G 3DLLA 1K3RA 2OQKA 2R7FA 4LF4Q 1YVCA 3KDFA 2ES2A 4ME3A 2B63G 3GTKH 4C3HH 3I4MG 1JJ2A 1X54A 3OYYA 4LW1A 1S72A 1N34L 1LTLA 3HOWH 3RR5A 3HOVH 4DV5Q 4HIDA 3M7NA 5LMNL 3GTPH 1SN8A 4DR1L 3HOYG 3L7ZC 4KHPQ 2JA7G 4LFCL 1OXTA 4O0AA 1HZBA 3HOZG 5GAGC 5C44H 2JK8A 1PH3A 4YWLA 1GVPA 4DR5L 3G6EA 4A3GG 3CPWA 1HNWL 2VQFL 4IFDG 4GLXA 2B29A 3ERSX 2K5VA 1K8GA 1S40A 4JI8Q 5C0XI 1UE1A 4GN3B 5C4JH 3HOWG 4L5QA 1XNQL 4R4IA 1SRUA 3GTOH 4JBMA 4DV4L 1MKHA 3FKIH 1EIYB 2B3GA 1KRSA 3A0JA 3NENA 1SR3A 4LF7Q 1H95A 4KHZA 2UU9L 4BBSG 4HJ7A 2K5NA 2C35B 1K8AC 4GOPB 2LXJA 2ZJRA 1EOVA 4DAYB 2HHHL 2ZTEA 1SLJA 4JI7L 4DR4L 2IT1A 4JV5L 4LFAQ 4C2MH 3T1HQ 4LFBQ 4RG1A 1XPUA 1L1OA 3KYHC 1XMOL 4JI3L 3HOUG 1UWVA 2NN6I 1JE5A 1N32Q 2JA8G 4DR5Q 1WYDA 5IWAQ 3CCMA 1YHQA 4A3IH 1QVFA 3RNUA 5FLMH 2KHIA 1ASZA 4JI8L 2K14A 1KHIA 2R7DA
chains in the Genus database with same CATH superfamily
4V190 1VF7A 3QOLA 3N52A 1KL9A 1CSQA 1C48A 4DV5L 2IL8A 4IUVA 3D31A 5ISRA 4TQSA 1I50H 5JQWA 2YTXA 2CWPA 5JPMC 4MTDA 3TMEA 3OSPA 4O4LF 1SDFA 2UUAH 5L37A 5IYDH 4FBUA 1KDCA 3RV4A 4GLAC 2DIKA 3JAME 1KEEA 4OWTB 2TSSA 3VYUA 4DV4Q 4ID6A 1STEA 1SYFA 3STBD 2A8VA 2YCHA 5IP7H 1EY8A 1T36A 1E4FT 2RGVA 4GOPC 3PUYA 4B9XA 4AYBG 5I2XA 3K58A 1PH8A 3PUWA 4PMBA 1W96A 4CC5A 1YNND 1GYFA 3TZUA 1D1KA 3SVMA 5F2DA 3HOVG 3GTLB 1SNPA 2EIFA 1HR0L 5C3EG 3M9NB 2NVYB 1S68A 1LT6D 2EYPA 4DXGA 2FJZA 4A75A 2A74C 1MJEA 4L8JA 2E76C 3RBDA 1FJGL 2HGSA 4B9WA 5GAEC 2H4OA 4YBZB 4GKKH 1M4VA 2BH8A 4EYHB 4UPAA 2PN1A 4WRDA 3W2DA 3PIOA 1SYBA 1JWMD 5E7NA 3C0FB 4A3EG 2DJGC 2M00A 5LMUH 3GIMA 3GTJH 4OXPA 3J7YW 1TWGH 5LL6S 3PF4A 5EDWA 3PW0A 1OTCA 1MZBA 2FK3A 3GV3A 1EYGA 3NP8A 1VQ7A 2VA2A 1HHVA 1NTGA 4ZCKA 5EJWA 5E1FA 3ETHA 2B2TC 3UDFA 3M7GA 3HOXG 4GS3A 2IJ0A 4A3MH 4RWSC 1J6QA 4X62Q 3G4SA 4WJ4A 5EAYA 5FKAC 3UDXA 2EPBA 5FPRA 4YY3Q 4BWSC 3EJIA 4M9UA 2AHOB 1HR0Q 2WTFA 4J9QA 1S03G 3S1RB 4QF4A 2EYJA 3UDGA 3OUUA 3URYA 3OUZA 3M85A 4R4OA 1C4QA 2J6SA 1A2UA 1GUSA 5K5PA 4RCNA 4F4YA 1I4PA 2J6TA 4K8IA 1RF2D 4IPHA 1LTRD 1TY2A 2DNCA 2UXCL 2F1MA 1VQNA 1BQQT 2JE6I 5EGTA 3JAML 3OTOQ 3OTOH 2SEBD 4JV1A 5H1SE 2W6PA 4EEQA 1DD2A 2ENBA 1GD7A 3NSWA 4TV9F 1CSPA 1KIXA 5EKKA 4R8UA 4RB3C 5CBAE 3H4BA 1DZ1A 1KBLA 2KQ3A 4CDCC 1K0RA 1YBYA 2HHHH 4DR4H 3S24A 5M5WB 4YHHQ 1HXYD 1BR9A 1E2WA 2EDGA 5IYCH 3D3RA 3H3VH 1VKZA 1SROA 1VQAA 3FRPB 2Q2HA 4MTEA 4JCVE 3C46A 3QZ8A 3R2IA 2B2UC 2JN4A 1PTOD 2VS1A 2PMZB 5IOCA 3FPUB 4DAVA 3LWEA 4G7ZC 1MD2D 2MJ8A 1E3PA 1ENCA 3AYHB 2X6GA 3EROA 4LF9H 3Q6SA 2B8GA 2OEOA 2I87A 1LYLA 4A3DB 3KHHA 4Z9CB 1L0WA 1EU3A 3SK5A 4FU0A 1B9MA 1Q7YC 1XTCD 2WAQE 2QDBA 1E0BA 3H94A 1B2TA 2EYLA 5IGEA 2RGRA 2B2UA 3PW2A 4LAAA 5J2UF 3HKZA 3GTQH 2F0FA 4UCVA 1Q8KA 5KFIA 2F0GA 5M3MB 1UUPA 2SOBA 3R93A 4OX9L 4A3GH 2NB0A 4OGQC 4CHTB 4ECVA 2Y0SB 2RVLA 3ULLA 3J80L 2Q2UA 1PMRA 3NQTA 2FKLA 2YZGA 4A3EB 5CAEB 4QWBA 5C4ZA 1U4MA 1FNUA 3OOCA 1IOWA 1HJPA 2V4QA 2UVVA 1FNWA 3S2DH 4KD4A 2E8GA 2F0PA 1BBUA 4A3EH 1XMQL 2PZUA 4LF8H 3KF6A 3EPIA 2KCCA 4BA1I 1L2ZA 3UE1A 3CRKC 1GGOA 1ML0D 4XX0B 4XXEA 1ESRA 1HUNA 4YCWA 1C9OA 3OSOA 3CD6A 3ORRA 1S4ZA 1XTDA 4ZKBB 1TY0A 2OXPA 1WTVA 1PH5A 4Q0YA 4BWGB 3PO2G 1HFGA 1B53A 1L2FA 2FMAA 4K2KA 1SNDA 4GLVB 2D0OA 1C7YA 5D8DA 1SYCA 1VMCA 3Q22A 1I94L 2R92H 2JA5A 4HQ6A 3BAAA 5C0XJ 2E2IA 1JORA 2E5LL 4B3SL 1TWHB 4XTCS 4U7CA 4C3HB 1DIKA 4HJ5A 2DPIA 1IBLL 2W6OA 1AE2A 4H7BA 1RDPD 1YJNA 3N41B 5KNCA 5F9NA 1V9PA 1II3A 4LF8Q 2A19A 3D6WA 3T51B 2K6AA 4O2DA 3S1NH 1IKLA 3K80C 3KTMA 3MR5A 2AGQA 2JA6B 1PZJD 3OW2A 1WTOA 4GN4B 3CCSA 1KQSA 4Q8EA 2R8GA 1D1IA 3T1YL 5D3DA 2NVXB 4IWYA 2FK2A 4X66H 1UEAB 2Z4HA 3K0YA 3TINA 4J9OA 2YYAA 2E2HA 2PBZA 5M5XH 2RSNA 3MR3A 1EWHA 4O3QA 1GUTA 1TS2A 1U5KA 2G5DA 2R7ZA 1U9RA 5DGAA 1WJJA 1IBMH 1VDZA 5FLXE 1O75A 2KECA 2VL6A 1BXRA 1A9XA 4YJ2F 3H40A 1PDQA 2QEJC 5IT9W 3V05A 1N56A 3MC0B 5KG5A 3N8DA 3J7AK 5IYCG 4L5RC 4GN5A 3PF5A 3GTQA 4DNRB 1Y14B 4ZOLF 1Y69U 4ED8A 2WB1E 1GSHA 3J7ZC 1WTXA 1VQCA 5JH7F 2B63B 2QCPX 2BH2A 4EGVA 2AGOA 1VQGA 4X62L 1IL8A 2N8NA 2IX0A 5KFVA 4R4TA 1QILA 1HPCA 2UVUA 3C3LA 2UUCL 4MA0A 1L0XB 1J8IA 1EHIA 1SEIA 5DQIA 2ZM6H 5JJLA 1DJRD 4LF5H 5E4XA 3ICEA 3BA9A 1PZID 3I2ZA 4QIWE 4TQUS 3T5KA 1IW7C 1T94A 2Z9HA 5HURA 4JI4H 2WKDA 1BNCA 3N6XA 2NU8B 2W8KA 4F4XA 1PA6A 2JEJA 1SYGA 5EWGA 5EKLA 4AQYH 2BDOA 2PQAB 1SE3A 3RGXA 3ULJA 1ET6A 3GIPA 1I7NA 4RKLA 1EYCA 4YP3A 4JV5H 2NN6G 3NHHA 2ZM6L 5KGUA 2UUCH 1NAPA 2SNSA 3OHXC 4KY5A 1RJQA 2JXMB 4JI1H 3PO2B 4RNNA 1F9PA 1IBKQ 4MTKA 2JA8B 3GDEA 4JOIA 2B2WA 3U4VA 2VUMA 2Z1CA 2EZVA 2NUAB 4IUUA 4R4CA 2LXKA 1N33Q 3U50C 1BCPB 2RHSB 1FYCA 2O4XA 2QDLA 4JYAL 2PQAA 3J7A5 3U9TA 4L63B 3WOFA 1XDNA 2SNMA 2E2IH 3NPPA 1Q1BA 4MA5A 4CC6A 3PZPA 4LJZC 3H20A 2B2VA 4A3BB 4GKJQ 3STBC 4HTHA 1TWCB 3TN2A 1B1ZA 3BJUA 1G291 4YAJB 3P75A 1LM0A 3HOXH 4XQNA 1AUXA 4NW2A 3RZDB 3RAXA 5KG3A 1K28A 1T9HA 1PHJA 4A3IB 1J5EL 1E22A 4A3FG 5ELFA 2RKSA 4KV6A 3SK8A 4MN3A 2Z6BA 3NTIA 4UCRA 4FVMA 4JK1C 1EIGA 1FL0A 3ND9A 2MHVA 4IUNA 1X65A 1PH9A 1P8LA 4GNXA 3R3OA 3RIZA 1I3QA 1WI5A 1WTHA 1NSNS 1CQIB 5C4XH 5DQGA 2EYOA 5KFGA 1VQ4A 2B2WC 1BDOA 4CJ2C 3GIJA 1AEXA 3C1FA 1X3QA 2CH4W 2W8LA 4MV7A 2EY1A 3S1RH 1SFOH 2ZJPA 4DL7A 4DV0Q 1YZ6A 2FFKB 5C0XG 1PYSB 2WV6D 3A5ZB 4FP5D 3GQBA 4OWWB 1I6VC 1I4RA 3W1GA 5BR8Q 2RDFA 4DR1Q 2VQEL 3FDTA 1SYXB 1ULZA 1RYSA 4JI1Q 4JUZA 3E9IA 4QMGA 1KC8C 1ZEQX 1D5MC 4LF8L 1P16A 2HHHQ 4DR4Q 1CZGA 5CORA 1YNJC 4JV5Q 3D4WA 3OMGA 4MV3A 1WTWA 1D6EC 3JAMW 1U4RA 3MXPA 2IW3A 1H9MA 5I6YA 2W7PA 2W9BB 1VQIA 2XCAA 2VB2X 3BVMA 3GV7B 3W5OA 4BY7G 1K3RA 2K5QA 4LF4Q 3KDFA 2ES2A 5L1LA 1K83A 4LK1C 2B63G 3GILA 3OIQA 1X54A 4JPBW 1LTLA 5J39A 3GTOA 5A35A 4HIDA 5LMNL 3GTPH 4ZUIA 2PZWA 1C8CA 4RGTA 2JA7G 4ODGA 5KFPA 1HZBA 4FF4A 4EQNA 4HR7A 2JK8A 3ORQA 5E4WC 2A68D 3C2PA 3CPWA 2HQEA 2VQFL 3VR2A 3PW5A 4JYAH 4ZAIA 5KFTA 4OIKA 2K5VA 1K8GA 5C0XI 1DOKA 5LL6X 4ED0A 1DXMA 5EBCA 1JIHA 3GTOH 1W6JA 2AQ4A 3S14B 1B6RA 3FKIH 3A7AB 1DV2A 3A0JA 4DK1A 3NWTA 1H95A 4GKJH 3T5HA 3GTOB 3Q8PB 2K5NA 1GXDC 2WE6A 3RZOB 2LXJA 4ECSA 4OL7A 4RGOS 4PDBA 2HHHL 4DR4L 1SLJA 2IT1A 4JV5L 4RU9A 5KG4A 4IR1A 1XPUA 5KEEA 4M1UB 2K32A 3HOUG 2NN6I 1JE5A 2VB3X 3NUCA 1WYDA 5C4JB 3CCMA 1BF4A 1QVFA 2JYOA 1ZYRC 3MVVA 3UI2A 5FLMH 4KKSA 5KFQA 4JI8L 1HRJA 4F50A 2R7DA 2AUKA 2Q8RE 2XGQA 2HD3A 1HTPA 2ASBA 3GTGA 1GHJA 1DONA 5LMNQ 5EZYF 2UUCQ 5ELOA 2NVTB 3JC66 2R92A 5F9LA 3G48A 3TSSA 4KN7C 4S3SA 3F2CA 4A3BG 3I4MH 2E2JH 4ED7A 5KFLA 3I90A 4ZUJA 1MBYA 4X62H 1X32A 4FF1A 4A2BA 2N55A 2E2JB 4A2AA 3TQYA 4MNOA 3H09A 2XWBB 4UP8A 1ZETA 4A93G 3D0FA 4JW0A 4MV9A 3MWMA 1B9NA 3RLNA 3LNNA 2BCOA 4P71A 1CE8A 3CQZH 4L5TA 1S5BD 4NXML 1FNVA 5CC4A 4LF5Q 1XNRQ 2OT2A 2ASDA 1HZAA 4DUZL 1JCKB 5FO8B 2KBNA 2WINB 1YJ9A 3ONAB 4MTNA 2NVXH 5KFJA 2VY3A 2F0SA 1GSAA 3E0JA 1EUCB 3PUXA 5KT4A 3KUPA 1CKMA 2A6EC 4DAYA 1A62A 3HBLA 3BVZA 4X64H 1EU4A 1Y1VH 2GVAA 1R9TA 2ZTDA 4HR7B 4X66L 4P74A 1ZHSA 3J80W 4R7RA 3HB9A 4MAMA 4E6IA 5CB4F 1VQEA 1EFID 4J9LA 2IP4A 2XCLA 1EQRA 2Z8LA 4EFBA 3GV8B 3K3VA 4MZ9A 4XQQA 1SMXA 4TVAB 2FXQA 4KI0A 1RYRA 4CKEA 2F52A 2I07B 2MFIA 1IZ6A 4AIMA 5C44G 1IBLH 2UU9H 3K7UC 2WIIB 4C56C 3VPBA 2ZXRA 4BXXG 1WTQA 4B3SH 1Q46A 4DV4H 5ELBA 3CHBD 3A8KE 1KABA 1WCMB 4IWXA 1LO5D 2R8HA 2UXDQ 3QB3A 3SE0A 4C3IH 2CQAA 2YW2A 2UUAL 3WO1A 2V9WA 3ULPA 4J9NA 4JVZA 4Y7NH 1MHWC 2F0KA 3CP0A 2HJWA 4ABNA 4JI2L 4EX5A 1Q82C 3UFXB 5KFXA 3NK9A 2AUJD 3QOJA 1EFWA 3MA2B 2I5MX 1I7LA 1V51A 1XMQH 1CM9A 3RN2A 4DV5H 1I4HA 4U673 3M9BA 3BDOA 2V59A 2R7MA 1HNZQ 3OHAA 2CQYA 4DV0L 4UCUA 4NDXA 1V8QA 3CMAA 1A15A 4OX9H 5BR8L 3CCQA 1GLVA 3MWDA 5C0XH 2WAQA 5KFYA 4LFAH 2AQ1B 3F2DA 4B3MQ 4IQZA 3R23A 1GO3E 2ZXOA 5JEAG 4RUCA 1LTGD 1NY4A 4DNIA 3K59A 1N34Q 5KFEA 1N8RC 1JC7A 3VPCA 2KCTA 3KHLA 1S10A 5I47A 4R9WA 4O42A 1EYZA 4OONA 3VMMA 2JA8H 3GTQB 2WB1A 3J81i 1EIFA 4ZRZA 3RMHA 4A3LG 2VPSA 2LSSA 4KY7A 2VW9A 1BCPD 4IN3A 2AKWB 3J7AF 4DFAA 5KT7A 5EWFA 3I4NB 4LSXA 2L1BA 4QWDA 1XJVA 3RAQA 3GTKB 2R3ZA 1IL2A 2F0OA 5IT9L 3CPFA 4KJNA 1QVCA 4P73A 1F2YA 3MFYA 3TIGA 3BQ1A 4A3BH 3F1ZA 3VYTA 5KFKA 2YU9H 5FD6A 3K3PA 4TV8F 3G6VA 1S5FD 1S0NA 1V1QA 4EBDA 1JX4A 3X3MA 4DPGA 2PI2E 1PH4A 3OTOL 4PZ8A 3M4OH 2YS7A 1UE7A 3CVZA 2A6ED 1QE6A 4HIKA 1M6VA 3Q2OA 2BDNA 1PLFA 2WFWA 2UXCH 2E75C 4G4KA 1O7IA 1I6HB 4X65H 2JJQA 2ZJQA 4JI5L 3DWPA 4RB0A 5AFWA 4DR3H 1TWHH 1I6HH 4B3RH 3S15H 3CCJA 1BO0A 3SK6A 1J9OA 3T1HL 4J1MA 2F0WA 2B2VC 3JAMc 5KG2A 5KT3A 1GUNA 3MXGA 2YRXA 3BZKA 4LMQD 4A3CG 2C2EA 1PZKD 4AQYQ 4QGUA 4RUAA 1OXUA 4OO1G 3K8AA 3H0GH 1I3QH 3DMUA 1AUVA 1N48A 2LKVA 3J81j 2R7NA 2PO4A 3PO3G 3MTSA 1YHAA 1B3QA 1GKHA 4OELB 4DR6L 4FM9A 2YYZA 1PXUA 1HZCA 3GLKA 1K83B 3T5LA 5KIXA 1PH6A 4AYBA 2Z4IA 2IX1A 2JEGA 1GOZA 4PZ7A 1PH7A 1B4OA 1Z2NX 2BQ3A 3L2PA 3T5JA 4IALA 4NXMQ 2YS6A 2LFNA 1TWAH 4IAJA 5C1OA 1A0IA 3GO5A 3V2TA 4YY3H 1TWAB 4ALPA 5A2QW 5DG8A 2M9VA 5C3XA 1LTTD 3HKZG 4GNXB 2GPWA 4WFN3 1PTOF 3PR4A 5KFRA 4J9MA 3G8CA 3EN2A 3DM3A 3BDLA 4DR2L 5CA1F 3PW7A 1C30A 3SR1A 5IP9G 5I2YA 4DV3H 1G2SA 4B3TH 3FP9A 4JI6H 1FJGH 2K5DA 4GC6A 2R7ZG 3GIDA 4TQRA 4EYIB 5IWAH 5L1IA 4DR7H 1OXSC 1SXTA 2RDIA 2FMMA 1RJRA 4JBWA 3TP7A 4Y52H 4DV1Q 1LT5D 3MR6A 1O78A 1SAPA 4RMFA 1YHBA 3T4AC 3RB0A 1G8ZD 3WNZA 2CZGA 3TIIA 2B2TA 3BS1A 2CKZB 1HNWQ 4E4TA 4K2LA 4JI6Q 2V4RA 3FKIB 2W70A 2ICIA 2R92G 1C3OA 1VQ6A 4LF7H 1QUQB 4OEMB 4GNXC 2K52A 4X66Q 4DK3C 1I6UA 1I94Q 2CQOA 2K50A 1X3PA 3NE5B 3RZOH 1PK8A 4DL5A 3F8TA 4RA8A 3R5XA 3RV3A 2V4DA 3SK4A 1TR5A 2ZXPA 2UXDL 2CW0D 3FEWX 1B70B 2KJXA 1B7YB 3DWQA 1XPRA 4R8UB 1DOMA 2FPPB 2PNRC 1MSGA 3LWUA 2PI2A 1SE4A 3AB9A 3AU7A 4APMA 2EQSA 1L0YB 1ZHQA 1WH2A 4QWEA 1B3AA 3PGZA 4K0KH 4ECXA 2YTYA 1FGUA 4N8FA 2ALYB 5KNBA 3F2BA 2IPKD 3CC2A 2NVTH 2W6QA 4DUYQ 4PNYA 4X3UA 1LT4D 2F3VA 3TS0A 2FJ2A 4AYBB 3AEVA 1AFPA 1SCUB 3MEHA 4F4WA 4JBKA 1X56A 4KY6A 3T16A 2NWGA 4HIMA 5EQ0A 4C3HG 3L0OA 3OSNA 3MEFA 4KD3A 1YNNC 1BCPC 3EBEA 2RCFA 3Q8DA 4JV2A 3S1MB 5M3FG 1D8LA 1N36L 5C3EB 3BABA 1L1OC 2QGQA 3K5HA 3KFUA 2JEFA 4A3JH 4QJFA 4LF6L 1PVOA 2UXCQ 4PMWA 3T53B 3J81W 4DAMA 4FF2A 4K5WA 1KRTA 2WACA 4KN4C 3I12A 4A3LH 3I3CA 3CCUA 1RKNA 1EEID 1QWYA 1Q1EA 2A6HC 3KJOA 2JSOA 3MAQA 1LTSD 1UNSA 4K6LA 4BY1H 2HDMA 2YRWA 3VA5A 2LY7A 1CUKA 3M3YH 1BCPF 5FLXc 2J6UA 1TWGB 5D1OA 2DPJA 2H5XA 1BUVT 1X3FA 3NXWA 2DGYA 1EQTA 1M0WA 1YNXA 4DV2L 3G6JB 2C2RA 4JI0Q 2A1AA 5LL6b 3VR6A 5COYA 1B33N 2M2LA 1EUJA 3BZCA 2GN5A 3AFPA 4RZQA 3TDQA 1EOTA 2WDTA 1ENAA 1YJWA 4JYAQ 2MUYA 4YCUA 5JOBA 3NBIA 2IWHA 2ID0A 4YHHH 1LACA 4KLKA 3PW4A 3BQ2A 2JQOA 1HR0W 1Q86C 2BE5C 1IBKL 2I5LX 2IY5B 2RDHA 3PSIA 1SMYD 1TXYA 3PO3B 4A3KH 4ED3A 5IYZF 4DR7Q 3K81C 1BOSA 4LF4H 3NWSA 4I7ZC 1HQRD 2FE3A 3OHBA 4MHEA 1WCMH 4Y7NB 1VBGA 2NVQB 4JI5Q 4YR2A 2JA5G 3K57A 1MJCA 1XNQQ 1XMQQ 1M8AA 4Q5VA 5C5MA 2R6GA 1JB3A 1SJED 2NVQH 2OWOA 3MXNA 5K36G 4LFCQ 5KKNB 5M5WH 1EZ1A 1OO9B 2ZJTA 3G6YA 3PVXA 2F0EA 3GTPB 5DG7A 4LUZA 2BE5D 4ZKCB 3RGZA 1TS4A 1YEZA 4DL2A 4L6TB 3SEBA 2AWOA 1IW7D 4F8MA 1S5CD 1XMOQ 3LWBA 3KF8B 3T1YQ 1E1OA 2F0NA 4P72A 4IZ8A 2M05A 4J9SA 3BYYB 5IP9H 5JVH3 2OQKA 5CA0F 1YVCA 3DUZA 1JJ2A 1AZQA 1B04A 3HOVH 4J9PA 4I4TF 1RD9D 4KMUC 3HOZB 2HUGA 4DR1L 3L7ZC 1QNUA 4C5CA 4KHPQ 1KJ9A 4O0AA 3KLSX 4PWQA 3VYRA 3HOZG 5JAVA 1KLUD 2KEEA 3PIP3 4WBNF 4DR5L 1R9TB 4ECYA 3G6EA 2ZDQA 2K28A 5FD5A 4C2MA 3QZ7A 1UAPA 1DM0B 1UE1A 3HOWG 5C4JH 1STNA 4R4IA 2OLSA 1VAJA 2I80A 3BVGA 3HOWB 2B3GA 3DF7A 3HOXB 3HP3A 5JUMA 4HJ7A 1BXTA 1K8AC 2WAQB 4M8AA 1PFMA 1EZ8A 4FS2A 1T5XD 2X6LA 2EJFC 2ZTEA 3GV6A 4JI7L 4ME6A 5BN3A 3GTMB 1Y8PB 4C2MH 2R93A 3KYHC 1XMOL 1S0OA 2F0TA 3K5IA 1N32Q 1YHQA 2F0JA 4DK0A 4A3IH 3RNUA 2YZMA 3ITPA 1PTOH 1K8OA 4QWAA 1A3UA 4RAUC 5KYLA 1K3BC 1ASZA 4HNTA 2OF1A 1Z7TA 5DLGA 1N33H 2R85A 1VF5C 5G3LD 2F3WA 3BG3A 3CQZB 2MNAA 3NBHB 2F03A 4A76A 5C5LA 4ZI7F 5M9OA 4PV1C 3A5UA 1V1PB 1YITA 3MJFA 3D4DA 3DWAA 3HS0C 3RBEA 1PX2A 4BBRB 2D9UA 4Q8FA 1QNKA 1ZXTA 2EJGC 2NZHA 1SNOA 5C6AA 2VQFQ 2QK4A 4MV8A 3S2HH 3MWYW 4BBRH 5HV6A 3WWVA 4DUYL 2FLLA 2L4NA 4RNOA 1F9QA 4DV7H 3AFQA 4DUYH 1RTOA 1FD7D 3GP7A 1TA8A 5GADC 4ETSA 1A63A 4LF6H 3QWNA 2RCNA 2JA7H 3CQZA 5HY6A 3CCVA 3HFZB 4BS9A 2L15A 1N36Q 5K36H 3E0EA 4C3IG 1G2TA 5IIFA 4RAZA 4RGNA 2F3IA 4O2BF 2FLNA 3L4JA 1QVGA 5KG0A 4OIJA 4BXXH 5CMDA 4DV2Q 3MFHA 4JI0L 1JDEA 2UXBL 2L5TA 1Q3LA 1B50A 1CKOA 1HZ9A 1VBHA 3KAJA 3H91A 3TRZA 3CXCA 2R8IA 2B63A 4DGZA 3GTJA 5IT9E 1X9NA 1PV4A 5DG9A 3HOYB 3OW7A 5FJ8G 2N3SA 4HMJA 2DLNA 1QUQA 3CKIB 2ZDGA 2BA0A 4RB1A 1F2LA 4AH6A 4RNMA 2ZDHA 2Z6KA 2F0QA 1F2ZA 5LMUQ 2RA4A 4FYDA 1STGA 4QW9A 1H9JA 4YIJA 4IOCA 1KJJA 3HEJA 4UY8C 2AQ2B 4N9TA 3QG1A 1FJGQ 1Y1WH 5KYIA 2QYZA 1VQKA 4LNQA 2G9HD 4LMYA 2KHJA 2F4IA 3PV0A 4GKKQ 1I50B 3VA7A 5HGTA 3J81L 3IFTA 1ZQ7A 4H0LC 3ZYYX 3JZIA 1Q90A 1EWIA 5T1IA 3W1BA 2K5WA 3CCEA 2DY8A 3U58A 4FXDA 2K7VA 2E74C 2C22A 2HVSA 4DR1H 5J3BA 1KXLA 1UE5A 2K1BA 3PUVA 5LMNW 2K5HA 2KENA 2C00A 4DV6L 3FPPA 1HTLD 5GAHC 1JDBB 2UUBL 2NZ1D 3G71A 3GTLA 3TREA 1Z2OX 1AZPA 1HA6A 2B8FA 3MXNB 4P75A 4HNUA 4DR2H 2KUMA 2K04A 3GTPA 2I5HA 1CA6A 1Y1WG 5GONF 1I50A 1IHZA 3BQ0A 3TP5A 4CBVA 4HJ8A 4GOPA 1GSOA 4CKBA 3BA8A 1G6PA 4ZHQF 4I7HA 3S16B 1TS3A 3I55A 3I4MB 4TSSA 3S1MH 5IODA 1GJXA 3IRBA 3RB3A 4NB3A 5KNDA 4KHPL 3HOUB 5C4HA 2L55A 3R8BA 1JICA 3N40P 2XD4A 4DF7A 2YL2A 2FMCA 1KNAA 2L11A 3HOUH 3H4DA 1XNQH 4X3SA 4NXNL 1Q8IA 5J1ZA 4EQPA 2K03A 4FXKC 2LS01 1R4QB 1WOCA 2O2LD 3E9HA 2KCMA 1MIUA 3M4OB 1HA5A 2ICEC 1M1KC 3HKSA 4DL6A 5I9OA 1KAWA 5K2MA 2AGPA 2NN6H 4XQJA 3T1HH 1KC7A 2A6HD 1JT8A 1X55A 1JWSD 4HSPA 1IKMA 4B3RL 1U4PA 1A8VA 5DLFA 1V4YA 2UVRA 5C44B 2ZTCA 2HIVA 2ALZA 4K6DA 1YI2A 2QF7A 1HNZL 2R93G 1ILPA 1CA5A 4JC0A 1SBBB 2A69C 2JA9A 3EA6A 4A3MB 1N32L 3R5HA 3Q8RB 1S5ED 1SFOB 1M7JA 1JLLB 1SEBD 1T3NA 4A3DG 4DV2H 5FJ8H 3FMAA 3I4OA 2C5CA 1VMPA 3C1EA 2WKCA 1NR4A 3R5FA 2B63H 1QOHA 5DLQE 2FK1A 4JI7Q 2W6MA 5I6WA 3FVQA 3LMLA 2E2HB 3KHRA 3VYSA 1T5EA 4R4QA 3KLSA 2JEAI 5ELEA 5KFBA 2VUMH 1EYDA 1SYEA 3OIPA 4QY7A 4L1KA 4C5BA 5EPLA 3TP8A 3V6JA 4H44C 2O5IC 2ATLA 2VUMB 4JI4Q 3NBHA 4DA2A 2CCZA 2HT1A 4O2AF 3SE7A 3FKIG 2W9CB 2JA6A 4UAIA 3UE0A 3GTGH 1K1SA 3FDSA 1VQFA 4BY7B 3H15A 3IFDA 5KFNA 1I4XA 4J9RA 1JWUD 3SDZA 5BPFA 4DAPA 5KX5F 4IPCA 5DQHA 4QB4A 4MV6A 1Z6HA 4QUFA 1SSOA 3NTKA 1XNRL 2VUGA 4EBEA 1TQOA 3TP6A 3LGJA 4DUZQ 4I50F 1NJIC 4RCOA 1VQDA 4QWCA 4DR3Q 1DGSA 5M3FB 1NMGA 4O4HF 4BBRG 2F4VQ 4POFA 5BMVF 1V1PA 3NGDA 4A3KG 5BR8H 1TWFB 2IBKA 4BA2I 4HAEA 1TU2B 3S1QH 2I46A 3J80i 4J8QA 1ASYA 5CV8A 1GUGA 3H0GG 3ND8A 5IGBA 1XPOA 4HSVA 4OO1H 1WFQA 1KAAA 5KFZA 4K0KL 2L12A 2HQLA 4AYBE 4HIOA 2HCIA 2HIXA 3PMFA 3I73A 1QJOA 3RD4A 4BBSB 3E3XA 5L1JA 1TIID 4O3PA 4YWMA 1IBLQ 4LSAA 3HOZH 2CW0C 1TVXA 3L4KA 3KOJA 1SNMA 4A3GB 1RJPA 1RHPA 1IYVA 3DM1A 1HNXQ 1ONLA 3OWFA 1R9TH 4LFBL 1Y1VA 4QW8A 5G3LF 4RZRA 4DR6Q 4JI3Q 1E4EA 1ZKOA 3I4NH 2R7KA 5KFSA 5C8YF 3F8NA 3S17B 2B2YA 2P5ZX 4F7XA 1VQ8A 1ICWA 2N49A 4KK7A 4UDUC 4LF7L 5LP6F 4MV1A 1ICFB 4O4IF 2MO1A 1JXLA 3K0XA 1CTMA 1VQLA 4APVA 2A69D 2DY7A 4BY1G 5KT5A 3IAYA 5EWEA 4FDBA 4JV0A 1JOQA 5IGFA 1PTOB 4FNFA 3Q8QB 2F4VL 4B3MH 4JI2Q 5IGDA 1A3VA 4FO2A 4DV1H 2R61A 5KRUA 2W71A 5IWAL 2Y0SG 2PVPA 3CC7A 3SGIA 4JI6L 4DV3L 4B3TL 2D0PA 1PFSA 4A3FH 3B6YA 1CT1D 1LT3D 2V1CC 2PW7A 4K0KQ 5FLXW 4A4IA 2D62A 3RLOA 1F9RA 1LUZA 1MSHA 4X64L 1Z9FA 4EGQA 3KK7A 2UUAQ 3M4QA 3H0GB 4IUQA 4U6PA 4DV1L 1JJGA 4BY1B 4MV4A 3S1NB 4G7OC 2XCPA 1G51A 4B3ML 1BVSA 3H0GA 4XYQA 1V43A 1K83H 3RN5A 2KCNA 3U4ZA 1HNXL 1STAA 2UUBQ 1Y8OB 3I70A 1EY4A 4TRDA 2VUMG 4NXMH 3RUPA 4TKOB 3MFGA 3OWEB 3EIVA 4HN7A 1WD1A 1J5EQ 3PN1A 2WYOA 4DR6H 3PIPA 5ELDA 4HCSA 2XRSD 5FK9C 3ERQA 2I8CA 2MO0A 1D2BA 1TWHA 2Z0SA 1IXRA 1MI2A 1HNWH 3X3NA 1NMFA 4Q44A 1CK1A 5JJIA 2WP8J 1PH2A 3FHWA 3K6OA 2EY6A 5M3MG 5IYBG 2JA6G 1N9WA 1SFOA 4J15A 2R8JA 1W3SA 4DV3Q 4B3TQ 4PMCA 3RF2A 1RIPA 4JI8H 1HQMC 4X65Q 2DWCA 4IO9A 2XTIA 1VQOA 2FPIB 4LH7A 2F0VA 2VNUD 2AU0A 2NVYA 3HRZC 3HXLA 5M5YB 4YR0A 4L5SA 4O1NA 2IHEA 3AMUA 5JJKA 1LTID 1K73C 2VZAA 5A2QL 4X6AH 4IJHA 2GPSA 4J0MA 2R7ZH 2SDFA 3CU7A 4FXGC 5DGBA 4G57A 1BBWA 2Q2TA 3CCLA 2CW7A 2A68C 2B39A 2R86A 1XNRH 5GROA 4LF6Q 1RK6A 3Q1KA 4HYKA 3HKZB 3EPGA 4GKJL 4WD3A 3ZJYC 3I8ZA 2R6FA 2PMZA 3NEMA 5AJ3L 4DV7Q 3JRXA 1GUWA 3MZ5A 4R1JA 1TS5A 2XRQD 3TBIB 1VCIA 2PNHA 5EBDA 1VS0A 3QFFA 2R84A 1S5DD 3KF8A 3LX0A 3KXYT 3A56A 3VR4A 3A7LA 4X3TA 3WO0A 4C3JG 5LMNH 4UCSA 3I4LA 4IURA 3J81E 5LHY1 2XN9C 4LFAL 5FO9B 4GZYC 1PFNA 1CHQD 4A3JG 1EUDB 4IOAA 4RHSA 5FLXL 4IPGA 4CJ0B 4HEDA 2R93B 3K5NA 4POGA 3S16H 1FVIA 3CAMA 4DV0H 1JB7A 1RTNA 2E2IB 1TAEA 1PRTB 1G6ZA 3GTKH 4C3HH 2J7ZA 4EFEA 5A2QE 1G91A 4LW1A 1S72A 3JSLA 2MGSA 3HOWH 4Q0FA 3M4IA 3RR5A 4DV5Q 3M7NA 2KEDA 4JI2H 2XGPA 2PYKA 1OXTA 2DZDA 1BJTA 1KJIA 1PH3A 5LYJF 1GVPA 4TUYF 4C2MB 1PFBA 4A3GG 1FKAH 1HNWL 3KALA 4IRCA 5DNFA 1JOKA 4GLXA 1UC9A 1S40A 3DEPA 5CR3A 3GTKA 4GN3B 3MFIA 3GTJB 1R4PB 1XNQL 1D5ZC 1SRUA 4K5XA 4DV4L 2EYFA 1ILQA 1EIYB 2N88A 1ESFA 1SR3A 4LF7Q 2UU9L 3MXUA 3D4RA 2KHSA 4BBSG 2W6ZA 1NR2A 4ZYSA 2C35B 1E4EB 3QJYA 1XXGA 1HNXH 4GOPB 1KDBA 3H6MA 3ETJA 3EVQA 2ZJRA 1EOVA 1WSCA 2FLPA 1BNZA 4WORA 2P0AA 4YR3A 2R7LA 4LFBQ 1L1OA 3L3OC 4NLGA 2JA8G 3I91A 1EY0A 4DR5Q 1J5EH 1DV1A 2EXZA 3RJ0A 2KHIA 3JRWA 5KFCA 4U68A 1KHIA 1EY6A 3PO3H 3PQIA 2UUBH 2W7OA 5JEAH 2VR1A 3P7JA 2XVSA 4XYOA 4ED1A 4EG0A 2W9BA 4RAYA 1RCVD 4V0BA 1OXVA 2PQEA 4QL5A 4A3CH 1YIJA 2F4VH 4I7AA 2IA6A 4QIWB 3DXJC 1K1QA 3SHLA 4DUZH 2XGTA 2CHBD 2DN8A 5ELNA 4UCOA 4CDFC 5D14A 5J22A 2DNEA 1LLRD 3G6XA 1QCBD 4KKUA 4G7HC 3GTGB 4B3SQ 1CQFA 2ZT9C 1OXXK 4LH6A 3GIKA 1VQ5A 4XYMB 2K33A 3RTXA 2RDJA 2BOSA 4LFBH 4JBJA 4ULLA 2W9AA 1EWCA 3W3AA 4UCTA 2A73B 2JEIA 3T13A 1S3OA 1SMYC 1F9SA 4HNVA 2PCFB 1WVLA 3M9OB 3N43B 3R2TA 5EKIA 3PO2H 2GLTA 3U9OA 2D2CC 5M3MH 5IYBH 3D6CA 3UQ8A 2YU9A 4K8JA 2FP4B 1AN7A 4K5VA 1TWCA 2UXBH 4BBSH 1FR3A 5DAUA 1EY5A 4JI0H 4LUVA 1F2MA 1SE8A 2PZTA 4HJAA 1O7LA 1WTPA 1KNEA 4C3JH 1D5XC 1S97A 2K4KA 4LF5L 1XYIA 2NVYH 4DU9A 5D65A 5ELCA 4PG3A 3P1HA 3V4SA 4C3JB 5LXTF 5FOBB 2G9DA 1Y1VG 4EBCA 2XNAC 1TWCH 1KJ8A 2OH2A 1IBMQ 3MWEA 3TZDA 5BN4A 2YU9B 1Q81C 4QUCA 2UVWA 3OPOA 5BN5A 1U4LA 5AJ3Q 4DV7L 1CS0A 1NBWA 2RQXA 2OCEA 4A3MG 3RZDH 2XIWA 4IR9A 5JJZA 1CFMA 2FB9A 2RBMA 4QQBX 2UXBQ 2VQFH 1PRTF 2EOTA 4ECUA 4C1NK 3Q24A 4HMIA 1M90C 3E5SA 4IHJF 1RK5A 1SNCA 3CW2C 4JG2A 1LABA 3UDIA 1VQBA 2A5HA 1ET9A 3J80c 3EQLC 5KFAA 2DJFC 3I7FA 2YTVA 1JE4A 1I4QA 3S15B 2VA3A 5LOVF 1H9SB 1K0SA 4A3JB 4YAKB 2F0DA 2J0TD 2MCTA 1IOVA 4OX9Q 3PIO3 2MP1A 2R8KA 4CKCA 5KG1A 2NBFA 3E6ZX 1N32H 1I3QB 2F0HA 4P2CB 1D7QA 2K75A 3H3VI 3T1YH 4RH6A 1HNZH 1SJHD 1QZGA 2JA5H 2MQHA 1XMOH 2JA6H 4F4ZA 2HDLA 2F0UA 3AQQA 1LTBD 2WAQG 4R8IA 2ZM6Q 2X0SA 1SE2A 5KT6A 4X3KA 1VQPA 5HBRB 2L0CA 3RFCA 4LUOA 2DUDA 4Q45A 5E3FA 2RHQB 2TMPA 4KJOA 3Q23A 4YJ3F 2NU9B 2VQEH 1H9SA 1Q12A 4C1NI 1STHA 3A55A 1CHPD 3S2HB 2JA7B 4XT1B 4OWXB 1E2ZA 5M5XB 3CC4A 4DV6Q 1EL0A 5KFWA 3VR3A 2E5LH 5KG6A 3KF6B 2WB1G 1I94H 3EFXD 1UE6A 2Z6KC 4DK6C 1C0AA 1K8MA 4NXNH 4WJ3M 1QB5D 1Z47A 2ASJA 2EVBA 1F77A 5D1OB 3NQIA 1EY9A 3TS2A 4RHRA 5L1KA 4KHPH 5T14A 1E7ZA 4KTAA 2X69A 2UU9Q 4I65A 2EJMA 3ER0A 5CV7A 3CRLC 3H3VC 1GHKA 5BPHA 4XDXA 2NZOA 1B44D 4OHJA 2YZNA 1DYQA 2KA7A 1NE3A 4JOIC 3J81c 4M7EA 2NVXA 4FF3A 2Q8TA 5C1PA 2BA1A 4IRKA 4N8X1 1FGBD 4ED2A 2E5LQ 2R7ZB 3T56B 1TWAA 1HCZA 1UEBA 4HCEA 3KDFB 1PYBA 3HOYH 5DM73 3KBXA 4N9PA 5M5YH 2I0QA 1O80A 4H02A 3S9WA 4DV6H 2ASLA 1W93A 3RUZA 3JSNA 5KG7A 1AE3A 2XWJB 1SYDA 2Q2IA 3RLFA 1ENFA 3V4ZA 1IYJB 3Q0AA 3A74A 4EEYA 1WD0A 2Q8IB 1X6OA 5M3FH 3KBGA 3K5OA 4DR2Q 3IKJA 4XIGS 3U9SA 4LF9L 3RB4A 4O3NA 1BGWA 1I5FA 2NTTA 4KKTA 4QIWA 2J4XA 5CV5A 5FLMG 1PRTC 1PRTD 4IUPA 3S1QB 4A3IG 1OWTA 2FPGB 1B8AA 4DKAC 2NYZD 1W2BA 2GA4B 4JI1L 3CMEA 1IBKH 1RJTA 3GTLH 3EYYA 1WTRA 5KT2A 3QIAA 4B3RQ 2KSWA 4XT3B 4QCLA 2R93H 1B6SA 3KHGA 1WR2A 1RODA 3V96A 4UFZA 3K7AB 1WCMA 5H80A 3GTMA 2KVMA 2QKIC 3TQTA 1CKNA 3K7AH 4AQYL 2R92B 5IYDG 4JI4L 3L9AX 4PQXA 2RDGA 2ATWA 2NU6B 4IPDA 1M0TA 1A3TA 2V5AA 1E24A 5L9XA 2QILA 3IL8A 3HKZE 4IZOA 2CFMA 2XSCA 5FPOA 2VPQA 5CGKA 2B2YC 2IX3A 1HH2P 4B08A 2MPMA 4RB2C 1Z2PX 2H1EA 1E1TA 4YWKA 4ECQA 5IGGA 4YB8B 2R87A 3M3YB 3V6HA 3MHBA 4IUTA 3VDYA 4OO1I 2C28A 1JQYD 3GQCA 2Y0SE 5KFUA 1RL2A 1CKNB 2F0IA 3HG9A 2R82A 2PPBC 2RF4A 3D8GA 2JEBI 1S0MA 4HJ9A 4IFDJ 2BQRA 2HVQA 1EY7A 2AWNA 1EIHA 1K9MC 4ECTA 4NP5A 1GM5A 2OTLA 4A3FB 4ILWA 2LMCB 2NUCA 2EYHA 4ZLTF 2SCUB 3I72A 3CCRA 2VXWA 1KTKA 5C4XB 5JVDF 4UP9A 3KJPA 3BZDB 1QZHA 3BG5A 1XX8A 5C3WA 3V6KA 1X3GA 3TQ1A 1N36H 3M9MB 3FKIA 5LMUL 1TKWB 3SI8A 2IHFA 1UC8A 1IBML 1LTAD 1W6KA 4DN4M 2XIGA 2NTSA 4J6HA 1V1OA 1N33L 2EY2A 5CV4A 1SNQA 1I4GA 1JR0D 4Q43A 1CZWA 4PZ6A 1YNJD 3QR8A 4GKKL 4DLKA 1MGSA 1WCMG 3M4PA 1KD1C 2W57A 3PCOB 1HFNA 5KFMA 3HZXA 4DL3A 5IT9c 2L9HA 2E2HH 5T1GA 1JMCA 5EPKA 5C4XG 4NMZA 1EQVA 1VQ9A 4BY7H 4JI7H 1HR0H 3G7LA 3KLRA 4NPSA 4LWCA 1PH1A 2FINB 3DHQA 4IFDI 2O5JC 1EZ6A 2VQDA 4ME5A 2UXDH 4J9KA 5D3IB 3WDNA 3WOEA 5CV9A 1O7ZA 1HUMA 3N6RA 3J7AV 3NELA 4O3OA 4XYLB 3N42B 5KFFA 3O13A 4IRDA 4A3DH 4O3RA 1CQVA 2CW8A 3PR5B 3GV5B 4DR5H 2CWAA 3S14H 2VOBA 3CF5A 1X3EA 3A8JE 5KFOA 2XC9A 3E5NA 5CBEE 1LV9A 1BKBA 1VQHA 2JP1A 4Y8VB 3Q8SB 3KLWA 2BQUA 3HOVB 4GC7A 4DL4A 4YQWA 1CI3M 1TWFH 1AN8A 1E2VA 1Y1WA 4DR7L 1PTOC 1EQQA 5KFHA 1AH9A 1E4GT 1UNNC 2WB1B 4NXNQ 5CV6A 3IG0A 3FMCA 1Y1WB 2BR0A 1JJCB 4ZK9B 2JA7A 4X64Q 3OMCA 3BYTB 1GUOA 3S2DB 5JVLA 2AMCB 1TT2A 4RFBA 1TWGA 4JI3H 2VQEQ 5HGQA 3MR2A 5GQOA 2HVRA 2QW7A 4EGJA 2Y0SA 2RSOA 4ZQIA 2OQ0A 4YY3L 1Y8NB 5IY0A 2YV5A 3GD7A 2EYMA 1STYA 5FO7B 3A54A 4YCVA 5NUCA 5KFDA 5IE8A 3LP8A 2W9CA 4FBTA 5JPNC 2F0LA 3GTMH 2PMZE 1TWFA 4R8NA 3JAMi 5DM63 3QO2A 3S17H 2CVRA 3BDCA 3K5MA 1EYAA 5C5JA 5EPJA 1XWEA 2K01A 4LF4L 4LF9Q 3P20A 3BJYA 2EXDA 1U0LA 4XZ3B 1BBXC 2NU7B 5J2TF 4CJ1B 3I4NG 4EQ5A 1O7YA 5CYUA 4I55F 3M4YA 5JVG3 5JEAJ 5C3EH 1VQJA 4UP7A 1PYWD 1JOOA 2OTJA 4LFCH 4CDDC 1KDAA 5DEHA 3PUZA 4F87A 4RGMA 1NNXA 2K05A 2N78A 3GIQA 1N34H 4YHHL 3NTHA 2QA4A 4DR3L 2QEXA 1STBA 4JI5H 3A8IE 5IP7G 2GVBA 4X65L 3IN5A 3TEHB 4A93H 1JKJB 3I56A 4H13C 4O3SA 1L1OB 2PW5A 3BU2A 4IJLA 2F0MA 4MIUA 1NUCA 4CDEC 3SXHA 4A93B 1IYUA 1VQMA 2O03A 3DLLA 2R7FA 4C5AA 2JA5B 4ME3A 4NKLA 1ZYRD 3I4MG 3K5LA 3OYYA 2IMWP 1N34L 4G3IA 1KLGD 1KJQA 2AQ3B 1SN8A 3HOYG 1Y1VB 2CH4A 4LFCL 4KHVA 2C2DA 1DCZA 5GAGC 5EOYA 3RB6A 5C44H 4YWLA 2KOLA 2J9GA 1NCVA 4DNTB 3F2UA 3KAKA 3N44B 3VPDA 4IFDG 1QG7A 4ECZA 2B29A 5LA6F 3ERSX 5I9PA 1S9FA 4JI8Q 4RKBA 5IGCA 4EQOA 4L5QA 1EEFD 4CGYB 2HCCA 3GIIA 4JBMA 4FS1A 2E2DC 1MKHA 3J80E 1H9RA 1KRSA 4K14A 3NENA 4KHZA 2W6NA 4C3IB 2V58A 1AP0A 2FHTA 5I4DA 2EE1A 1H9KA 1AW7A 4DXFA 4EVOA 4DAYB 4ECRA 1CQJB 4ECWA 4ZQ3A 5TSSA 4LFAQ 3VR5A 3T1HQ 4A3KB 4RG1A 3DEOA 1DOLA 1A2TA 1A6XA 4JI3L 1UWVA 2EY5A 4WJWA 4ED6A 5IWAQ 5D1PA 2D5DA 4IFDH 4F88A 2K14A 2C9OA 4UHVA 3HGBA
chains in the Genus database with same CATH topology
3PO3H 1KL9A 2ASBA 1CSQA 4DV5L 5LMNQ 3D31A 2UUCQ 5ELOA 1I50H 1OXVA 3NBHB 4QL5A 3JC66 2MNAA 1YIJA 4A3CH 2YTXA 4A76A 3G48A 2CWPA 3A5UA 1YITA 3F2CA 4A3BG 3I4MH 2E2JH 5IYDH 2NZHA 2XGTA 2VQFQ 4GLAC 5ELNA 3S2HH 4BBRH 4OWTB 3TQYA 3WWVA 4DUYL 4MNOA 4UP8A 4DV4Q 3D0FA 4A93G 3STBD 4B3SQ 2A8VA 1OXXK 3AFQA 5IP7H 1VQ5A 3RLNA 4P71A 4GOPC 3PUYA 3CQZH 4L5TA 4JBJA 4AYBG 5GADC 1PH8A 4LF5Q 2RCNA 3PUWA 4NXML 1XNRQ 1A63A 1HZAA 2JA7H 5HY6A 4DUZL 3CCVA 3HFZB 2KBNA 2L15A 1N36Q 3HOVG 3E0EA 2EIFA 1YJ9A 5C3EG 1HR0L 1S3OA 4MTNA 2NVXH 2VY3A 3PUXA 2F3IA 1CKMA 4A75A 1MJEA 3PO2H 1A62A 1QVGA 1FJGL 4BXXH 5M3MH 5IYBH 5GAEC 4DV2Q 1Y1VH 2GVAA 4JI0L 2ZTDA 2BH8A 4P74A 4X66L 4BBSH 2UXBL 1CKOA 1HZ9A 4LUVA 1SE8A 4UPAA 3TRZA 3CXCA 1VQEA 3PIOA 5E7NA 4HJAA 1PV4A 1X9NA 4A3EG 1EQRA 4C3JH 4MZ9A 2K4KA 5FJ8G 4LF5L 1SMXA 2N3SA 2NVYH 4TVAB 1QUQA 3GTJH 2FXQA 4KI0A 1TWGH 2BA0A 4OXPA 4PG3A 3PF4A 2F52A 2MFIA 1IZ6A 4AIMA 4AH6A 5C44G 2Z6KA 5LMUQ 1OTCA 3K7UC 1Y1VG 1TWCH 1IBMQ 1EYGA 4BXXG 1VQ7A 4IOCA 1Q46A 1Q81C 1NTGA 4UY8C 5AJ3Q 4DV7L 1FJGQ 1NBWA 3RZDH 2OCEA 4A3MG 1Y1WH 1VQKA 4LNQA 3UDFA 2KHJA 3HOXG 4GS3A 3PV0A 2UXDQ 4QQBX 4A3MH 4X62Q 1J6QA 4C3IH 3G4SA 4GKKQ 5EAYA 2UXBQ 4WJ4A 3UDXA 1M90C 1EWIA 3W1BA 4YY3Q 3CW2C 3CCEA 2UUAL 2AHOB 4JG2A 1HR0Q 3ULPA 3U58A 3UDIA 4Y7NH 1VQBA 3CP0A 3J80c 3UDGA 4JI2L 5J3BA 4EX5A 3M85A 4R4OA 1UE5A 5LMNW 3PUVA 1Q82C 1KXLA 2YTVA 2K5HA 2KENA 2I5MX 3I7FA 1EFWA 4DV6L 5GAHC 3RN2A 4IPHA 2UUBL 3G71A 3M9BA 3TREA 2UXCL 3MXNB 4P75A 1VQNA 1HNZQ 4OX9Q 4DV0L 2JE6I 3OTOQ 1D7QA 2I5HA 2K75A 1Y1WG 3H3VI 3CMAA 5H1SE 5BR8L 3CCQA 1QZGA 2JA5H 4HJ8A 1GD7A 4GOPA 1CSPA 2MQHA 3F2DA 4B3MQ 2JA6H 1KIXA 3AQQA 2ZM6Q 2WAQG 1G6PA 1GO3E 5JEAG 1NY4A 1VQPA 3I55A 4DNIA 4LUOA 2DUDA 1K0RA 1YBYA 1N34Q 3S24A 1N8RC 3S1MH 4YHHQ 2RHQB 3IRBA 4NB3A 5IYCH 2KCTA 1Q12A 3H3VH 4KHPL 1SROA 1VQAA 4OWXB 2Q2HA 4OONA 4JCVE 3CC4A 4DV6Q 2JA8H 3J81i 1EIFA 2VS1A 3HOUH 4A3LG 3KF6B 2LSSA 2VW9A 2WB1G 1UE6A 2AKWB 1E3PA 2Z6KC 4NXNL 4DK6C 3AYHB 1C0AA 4WJ3M 1WOCA 3E9HA 2KCMA 1MIUA 1M1KC 1Z47A 1LYLA 3HKSA 1XJVA 3TS2A 1L0WA 1Q7YC 1KAWA 1IL2A 2WAQE 1E7ZA 3CPFA 2UU9Q 1QVCA 3ER0A 4P73A 4A3BH 3F1ZA 2YU9H 2NZOA 1JT8A 1X55A 3GTQH 4B3RL 1A8VA 1Q8KA 4JOIC 1NE3A 2HIVA 2ZTCA 3J81c 1V1QA 1YI2A 1HNZL 4OX9L 2R93G 2BA1A 4A3GH 4DPGA 4JC0A 2PI2E 1PH4A 3OTOL 2JA9A 1N32L 4PZ8A 3M4OH 1UE7A 3ULLA 4HIKA 2Q2UA 2E5LQ 1UEBA 2WFWA 3KDFB 1PYBA 1O7IA 4A3DG 3HOYH 1HJPA 2JJQA 2ZJQA 5FJ8H 3S2DH 4JI5L 2E8GA 5M5YH 2I0QA 3I4OA 4H02A 1BBUA 4A3EH 1TWHH 1XMQL 1I6HH 3S15H 2B63H 3KF6A 5DLQE 3CCJA 4JI7Q 1AE3A 4BA1I 2Q2IA 3T1HL 3RLFA 3UE1A 3JAMc 1IYJB 4R4QA 2JEAI 3A74A 2VUMH 3BZKA 4QY7A 4YCWA 1C9OA 3CD6A 4A3CG 1X6OA 4QGUA 4AQYQ 1XTDA 1OXUA 5M3FH 4OO1G 1PH5A 3K8AA 3H0GH 1I3QH 4DR2Q 3PO2G 4JI4Q 1L2FA 4XIGS 3J81j 2CCZA 4LF9L 2HT1A 3PO3G 1YHAA 3FKIG 1GKHA 4GLVB 2D0OA 3UE0A 3GTGH 2YYZA 1C7YA 4DR6L 1HZCA 1VQFA 1I5FA 1I94L 2R92H 3H15A 5FLMG 1PH6A 5C0XJ 2E5LL 4A3IG 4B3SL 4XTCS 2IX1A 1B8AA 4PZ7A 4DKAC 1PH7A 4HJ5A 4IPCA 1W2BA 3L2PA 1IBLL 4JI1L 3CMEA 1AE2A 4NXMQ 1XNRL 1YJNA 1TWAH 3GTLH 1A0IA 3LGJA 3GO5A 1V9PA 4DUZQ 1NJIC 1VQDA 4LF8Q 2A19A 4B3RQ 4DR3Q 4O2DA 2R93H 3S1NH 1DGSA 1NMGA 4ALPA 3K80C 4BBRG 2F4VQ 4POFA 3HKZG 4GNXB 3OW2A 4GN4B 3CCSA 4A3KG 1KQSA 3T1YL 1CKNA 3K7AH 4AQYL 4BA2I 5IYDG 3S1QH 3EN2A 3DM3A 3J80i 4DR2L 1ASYA 4JI4L 5IP9G 3H0GG 1XPOA 2ATWA 1WFQA 4IPDA 3FP9A 1E24A 5M5XH 2R7ZG 4AYBE 2HQLA 4K0KL 3HKZE 1U5KA 4HIOA 1OXSC 2CFMA 2HIXA 1WJJA 4JBWA 4Y52H 1HH2P 4DV1Q 2VL6A 4YWMA 1IBLQ 4RMFA 3HOZH 1YHBA 1E1TA 4YWKA 3KOJA 3VDYA 4OO1I 2CKZB 1HNWQ 1HNXQ 4JI6Q 2Y0SE 5IYCG 1R9TH 4LFBL 4L5RC 2R92G 1RL2A 1CKNB 4GN5A 1VQ6A 1QUQB 2RF4A 4GNXC 2JEBI 2K52A 4X66Q 4HJ9A 4DK3C 3PF5A 1I94Q 4JI3Q 1Y14B 3I4NH 4IFDJ 2AWNA 2CQOA 1K9MC 2K50A 3RZOH 2WB1E 3F8TA 1GM5A 3J7ZC 2OTLA 1VQ8A 2N49A 4LF7L 1VQCA 2BH2A 3CCRA 2UXDL 1VQGA 1B70B 4X62L 2MO1A 2N8NA 1B7YB 2IX0A 3K0XA 4R4TA 4UP9A 3KJPA 1XPRA 1QZHA 1VQLA 4APVA 4BY1G 1X3GA 2PI2A 2UUCL 4FDBA 2EQSA 5LMUL 5JJLA 2IHFA 2F4VL 4JI2Q 3ICEA 1IBML 3I2ZA 5IWAL 4QIWE 2Y0SG 3PGZA 3CC7A 4TQUS 1N33L 3SGIA 2YTYA 1FGUA 4JI6L 4DV3L 4B3TL 2ALYB 3F2BA 2D0PA 1PFSA 4A3FH 4PZ6A 3CC2A 3B6YA 2NVTH 1PVOA 4DUYQ 2V1CC 4GKKL 1WCMG 3M4PA 4K0KQ 4A4IA 2D62A 3RLOA 3TS0A 1PA6A 1KD1C 3AEVA 1LUZA 4X64L 2PQAB 1Z9FA 3PCOB 2UUAQ 3M4QA 3ULJA 4JBKA 1X56A 4DV1L 4HIMA 1JJGA 3L0OA 3MEFA 5IT9c 2E2HH 1JMCA 2NN6G 3EBEA 5C4XG 1G51A 4B3ML 1BVSA 1VQ9A 3Q8DA 2ZM6L 1V43A 1K83H 3RN5A 4BY7H 4NPSA 5M3FG 1D8LA 4LWCA 3U4ZA 1PH1A 1N36L 1HNXL 1L1OC 2UUBQ 2QGQA 2VUMG 3KFUA 4A3JH 4QJFA 1IBKQ 4LF6L 4IFDI 3GDEA 4PMWA 4JOIA 2UXCQ 4DAMA 3U4VA 3EIVA 1KRTA 4R4CA 2LXKA 1N33Q 4A3LH 3U50C 3CCUA 1J5EQ 3PIPA 1Q1EA 2RHSB 3KJOA 4JYAL 2MO0A 2PQAA 1IXRA 2Z0SA 3NELA 3J7A5 4A3DH 4BY1H 2CWAA 3S14H 1NMFA 1CUKA 5JJIA 3M3YH 3CF5A 2E2IH 1X3EA 2WP8J 5FLXc 1Q1BA 1PH2A 3FHWA 1BKBA 1VQHA 2H5XA 5M3MG 1N9WA 5IYBG 1X3FA 2JA6G 4GKJQ 3STBC 3KLWA 2DGYA 1TWFH 4J15A 1W3SA 1YNXA 3BJUA 4DV3Q 4B3TQ 1G291 4DV2L 1EQQA 4DR7L 1LM0A 3HOXH 4JI0Q 1AH9A 4NXNQ 1RIPA 2A1AA 4X65Q 1JJCB 4IO9A 2XTIA 1VQOA 2VNUD 1EUJA 3BZCA 4X64Q 1T9HA 2GN5A 3AFPA 1PHJA 1J5EL 1E22A 4A3FG 1YJWA 2AMCB 4JYAQ 4YCUA 4L5SA 2VQEQ 2IHEA 5HGQA 5GQOA 2ID0A 5JJKA 1K73C 4KLKA 2VZAA 1FL0A 4X6AH 2OQ0A 4IJHA 2JQOA 4YY3L 2R7ZH 5IY0A 1X65A 2YV5A 3GD7A 1PH9A 1HR0W 1BBWA 2Q2TA 3CCLA 1P8LA 4GNXA 1Q86C 5GROA 2I5LX 1WI5A 4YCVA 1IBKL 4LF6Q 2IY5B 4GKJL 5C4XH 3PSIA 5IE8A 1TXYA 3ZJYC 3NEMA 5AJ3L 4DV7Q 2PMZE 1VQ4A 4A3KH 3GTMH 4DR7Q 3JAMi 3K81C 3S17H 4DR6Q 1WCMH 4R1JA 3S1RH 1SFOH 4LF9Q 2ZJPA 4LF4L 4DV0Q 1YZ6A 1VCIA 5C0XG 2PNHA 1PYSB 1U0LA 2EXDA 3A5ZB 2JA5G 4JI5Q 1MJCA 1XNQQ 1VS0A 1XMQQ 4OWWB 3I4NG 4EQ5A 2R6GA 3W1GA 5BR8Q 2NVQH 4DR1Q 5JEAJ 2OWOA 5C3EH 2VQEL 1VQJA 4UP7A 2OTJA 5K36G 4LFCQ 4JI1Q 5M5WH 3E9IA 1KC8C 3PUZA 4LF8L 2N78A 4LUZA 1P16A 2HHHQ 4DR4Q 4YHHL 2QA4A 4DR3L 1YEZA 2QEXA 4JV5Q 4LFAL 5IP7G 2AWOA 2GVBA 4X65L 1XMOQ 4A3JG 3TEHB 4A93H 4IOAA 3I56A 3KF8B 4IPGA 3T1YQ 1L1OB 3BU2A 4IJLA 1E1OA 4POGA 4P72A 3CAMA 1FVIA 3S16H 1VQIA 5IP9H 1VQMA 1JB7A 3W5OA 4BY7G 3DLLA 1K3RA 2OQKA 2R7FA 4LF4Q 1YVCA 3KDFA 2ES2A 4ME3A 2B63G 3GTKH 4C3HH 3I4MG 1JJ2A 1X54A 3OYYA 4LW1A 1S72A 1N34L 1LTLA 3HOWH 3RR5A 3HOVH 4DV5Q 4HIDA 3M7NA 5LMNL 3GTPH 1SN8A 4DR1L 3HOYG 3L7ZC 4KHPQ 2JA7G 4LFCL 1OXTA 4O0AA 1HZBA 3HOZG 5GAGC 5C44H 2JK8A 1PH3A 4YWLA 1GVPA 4DR5L 3G6EA 4A3GG 3CPWA 1HNWL 2VQFL 4IFDG 4GLXA 2B29A 3ERSX 2K5VA 1K8GA 1S40A 4JI8Q 5C0XI 1UE1A 4GN3B 5C4JH 3HOWG 4L5QA 1XNQL 4R4IA 1SRUA 3GTOH 4JBMA 4DV4L 1MKHA 3FKIH 1EIYB 2B3GA 1KRSA 3A0JA 3NENA 1SR3A 4LF7Q 1H95A 4KHZA 2UU9L 4BBSG 4HJ7A 2K5NA 2C35B 1K8AC 4GOPB 2LXJA 2ZJRA 1EOVA 4DAYB 2HHHL 2ZTEA 1SLJA 4JI7L 4DR4L 2IT1A 4JV5L 4LFAQ 4C2MH 3T1HQ 4LFBQ 4RG1A 1XPUA 1L1OA 3KYHC 1XMOL 4JI3L 3HOUG 1UWVA 2NN6I 1JE5A 1N32Q 2JA8G 4DR5Q 1WYDA 5IWAQ 3CCMA 1YHQA 4A3IH 1QVFA 3RNUA 5FLMH 2KHIA 1ASZA 4JI8L 2K14A 1KHIA 2R7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 H;  1KL9 A;  2ASB A;  1CSQ A;  4DV5 L;  5LMN Q;  3D31 A;  2UUC Q;  5ELO A;  1I50 H;  1OXV A;  3NBH B;  4QL5 A;  3JC6 6;  2MNA A;  1YIJ A;  4A3C H;  2YTX A;  4A76 A;  3G48 A;  2CWP A;  3A5U A;  1YIT A;  3F2C A;  4A3B G;  3I4M H;  2E2J H;  5IYD H;  2NZH A;  2XGT A;  2VQF Q;  4GLA C;  5ELN A;  3S2H H;  4BBR H;  4OWT B;  3TQY A;  3WWV A;  4DUY L;  4MNO A;  4UP8 A;  4DV4 Q;  3D0F A;  4A93 G;  3STB D;  4B3S Q;  2A8V A;  1OXX K;  3AFQ A;  5IP7 H;  1VQ5 A;  3RLN A;  4P71 A;  4GOP C;  3PUY A;  3CQZ H;  4L5T A;  4JBJ A;  4AYB G;  5GAD C;  1PH8 A;  4LF5 Q;  2RCN A;  3PUW A;  4NXM L;  1XNR Q;  1A63 A;  1HZA A;  2JA7 H;  5HY6 A;  4DUZ L;  3CCV A;  3HFZ B;  2KBN A;  2L15 A;  1N36 Q;  3HOV G;  3E0E A;  2EIF A;  1YJ9 A;  5C3E G;  1HR0 L;  1S3O A;  4MTN A;  2NVX H;  2VY3 A;  3PUX A;  2F3I A;  1CKM A;  4A75 A;  1MJE A;  3PO2 H;  1A62 A;  1QVG A;  1FJG L;  4BXX H;  5M3M H;  5IYB H;  5GAE C;  4DV2 Q;  1Y1V H;  2GVA A;  4JI0 L;  2ZTD A;  2BH8 A;  4P74 A;  4X66 L;  4BBS H;  2UXB L;  1CKO A;  1HZ9 A;  4LUV A;  1SE8 A;  4UPA A;  3TRZ A;  3CXC A;  1VQE A;  3PIO A;  5E7N A;  4HJA A;  1PV4 A;  1X9N A;  4A3E G;  1EQR A;  4C3J H;  4MZ9 A;  2K4K A;  5FJ8 G;  4LF5 L;  1SMX A;  2N3S A;  2NVY H;  4TVA B;  1QUQ A;  3GTJ H;  2FXQ A;  4KI0 A;  1TWG H;  2BA0 A;  4OXP A;  4PG3 A;  3PF4 A;  2F52 A;  2MFI A;  1IZ6 A;  4AIM A;  4AH6 A;  5C44 G;  2Z6K A;  5LMU Q;  1OTC A;  3K7U C;  1Y1V G;  1TWC H;  1IBM Q;  1EYG A;  4BXX G;  1VQ7 A;  4IOC A;  1Q46 A;  1Q81 C;  1NTG A;  4UY8 C;  5AJ3 Q;  4DV7 L;  1FJG Q;  1NBW A;  3RZD H;  2OCE A;  4A3M G;  1Y1W H;  1VQK A;  4LNQ A;  3UDF A;  2KHJ A;  3HOX G;  4GS3 A;  3PV0 A;  2UXD Q;  4QQB X;  4A3M H;  4X62 Q;  1J6Q A;  4C3I H;  3G4S A;  4GKK Q;  5EAY A;  2UXB Q;  4WJ4 A;  3UDX A;  1M90 C;  1EWI A;  3W1B A;  4YY3 Q;  3CW2 C;  3CCE A;  2UUA L;  2AHO B;  4JG2 A;  1HR0 Q;  3ULP A;  3U58 A;  3UDI A;  4Y7N H;  1VQB A;  3CP0 A;  3J80 c;  3UDG A;  4JI2 L;  5J3B A;  4EX5 A;  3M85 A;  4R4O A;  1UE5 A;  5LMN W;  3PUV A;  1Q82 C;  1KXL A;  2YTV A;  2K5H A;  2KEN A;  2I5M X;  3I7F A;  1EFW A;  4DV6 L;  5GAH C;  3RN2 A;  4IPH A;  2UUB L;  3G71 A;  3M9B A;  3TRE A;  2UXC L;  3MXN B;  4P75 A;  1VQN A;  1HNZ Q;  4OX9 Q;  4DV0 L;  2JE6 I;  3OTO Q;  1D7Q A;  2I5H A;  2K75 A;  1Y1W G;  3H3V I;  3CMA A;  5H1S E;  5BR8 L;  3CCQ A;  1QZG A;  2JA5 H;  4HJ8 A;  1GD7 A;  4GOP A;  1CSP A;  2MQH A;  3F2D A;  4B3M Q;  2JA6 H;  1KIX A;  3AQQ A;  2ZM6 Q;  2WAQ G;  1G6P A;  1GO3 E;  5JEA G;  1NY4 A;  1VQP A;  3I55 A;  4DNI A;  4LUO A;  2DUD A;  1K0R A;  1YBY A;  1N34 Q;  3S24 A;  1N8R C;  3S1M H;  4YHH Q;  2RHQ B;  3IRB A;  4NB3 A;  5IYC H;  2KCT A;  1Q12 A;  3H3V H;  4KHP L;  1SRO A;  1VQA A;  4OWX B;  2Q2H A;  4OON A;  4JCV E;  3CC4 A;  4DV6 Q;  2JA8 H;  3J81 i;  1EIF A;  2VS1 A;  3HOU H;  4A3L G;  3KF6 B;  2LSS A;  2VW9 A;  2WB1 G;  1UE6 A;  2AKW B;  1E3P A;  2Z6K C;  4NXN L;  4DK6 C;  3AYH B;  1C0A A;  4WJ3 M;  1WOC A;  3E9H A;  2KCM A;  1MIU A;  1M1K C;  1Z47 A;  1LYL A;  3HKS A;  1XJV A;  3TS2 A;  1L0W A;  1Q7Y C;  1KAW A;  1IL2 A;  2WAQ E;  1E7Z A;  3CPF A;  2UU9 Q;  1QVC A;  3ER0 A;  4P73 A;  4A3B H;  3F1Z A;  2YU9 H;  2NZO A;  1JT8 A;  1X55 A;  3GTQ H;  4B3R L;  1A8V A;  1Q8K A;  4JOI C;  1NE3 A;  2HIV A;  2ZTC A;  3J81 c;  1V1Q A;  1YI2 A;  1HNZ L;  4OX9 L;  2R93 G;  2BA1 A;  4A3G H;  4DPG A;  4JC0 A;  2PI2 E;  1PH4 A;  3OTO L;  2JA9 A;  1N32 L;  4PZ8 A;  3M4O H;  1UE7 A;  3ULL A;  4HIK A;  2Q2U A;  2E5L Q;  1UEB A;  2WFW A;  3KDF B;  1PYB A;  1O7I A;  4A3D G;  3HOY H;  1HJP A;  2JJQ A;  2ZJQ A;  5FJ8 H;  3S2D H;  4JI5 L;  2E8G A;  5M5Y H;  2I0Q A;  3I4O A;  4H02 A;  1BBU A;  4A3E H;  1TWH H;  1XMQ L;  1I6H H;  3S15 H;  2B63 H;  3KF6 A;  5DLQ E;  3CCJ A;  4JI7 Q;  1AE3 A;  4BA1 I;  2Q2I A;  3T1H L;  3RLF A;  3UE1 A;  3JAM c;  1IYJ B;  4R4Q A;  2JEA I;  3A74 A;  2VUM H;  3BZK A;  4QY7 A;  4YCW A;  1C9O A;  3CD6 A;  4A3C G;  1X6O A;  4QGU A;  4AQY Q;  1XTD A;  1OXU A;  5M3F H;  4OO1 G;  1PH5 A;  3K8A A;  3H0G H;  1I3Q H;  4DR2 Q;  3PO2 G;  4JI4 Q;  1L2F A;  4XIG S;  3J81 j;  2CCZ A;  4LF9 L;  2HT1 A;  3PO3 G;  1YHA A;  3FKI G;  1GKH A;  4GLV B;  2D0O A;  3UE0 A;  3GTG H;  2YYZ A;  1C7Y A;  4DR6 L;  1HZC A;  1VQF A;  1I5F A;  1I94 L;  2R92 H;  3H15 A;  5FLM G;  1PH6 A;  5C0X J;  2E5L L;  4A3I G;  4B3S L;  4XTC S;  2IX1 A;  1B8A A;  4PZ7 A;  4DKA C;  1PH7 A;  4HJ5 A;  4IPC A;  1W2B A;  3L2P A;  1IBL L;  4JI1 L;  3CME A;  1AE2 A;  4NXM Q;  1XNR L;  1YJN A;  1TWA H;  3GTL H;  1A0I A;  3LGJ A;  3GO5 A;  1V9P A;  4DUZ Q;  1NJI C;  1VQD A;  4LF8 Q;  2A19 A;  4B3R Q;  4DR3 Q;  4O2D A;  2R93 H;  3S1N H;  1DGS A;  1NMG A;  4ALP A;  3K80 C;  4BBR G;  2F4V Q;  4POF A;  3HKZ G;  4GNX B;  3OW2 A;  4GN4 B;  3CCS A;  4A3K G;  1KQS A;  3T1Y L;  1CKN A;  3K7A H;  4AQY L;  4BA2 I;  5IYD G;  3S1Q H;  3EN2 A;  3DM3 A;  3J80 i;  4DR2 L;  1ASY A;  4JI4 L;  5IP9 G;  3H0G G;  1XPO A;  2ATW A;  1WFQ A;  4IPD A;  3FP9 A;  1E24 A;  5M5X H;  2R7Z G;  4AYB E;  2HQL A;  4K0K L;  3HKZ E;  1U5K A;  4HIO A;  1OXS C;  2CFM A;  2HIX A;  1WJJ A;  4JBW A;  4Y52 H;  1HH2 P;  4DV1 Q;  2VL6 A;  4YWM A;  1IBL Q;  4RMF A;  3HOZ H;  1YHB A;  1E1T A;  4YWK A;  3KOJ A;  3VDY A;  4OO1 I;  2CKZ B;  1HNW Q;  1HNX Q;  4JI6 Q;  2Y0S E;  5IYC G;  1R9T H;  4LFB L;  4L5R C;  2R92 G;  1RL2 A;  1CKN B;  4GN5 A;  1VQ6 A;  1QUQ B;  2RF4 A;  4GNX C;  2JEB I;  2K52 A;  4X66 Q;  4HJ9 A;  4DK3 C;  3PF5 A;  1I94 Q;  4JI3 Q;  1Y14 B;  3I4N H;  4IFD J;  2AWN A;  2CQO A;  1K9M C;  2K50 A;  3RZO H;  2WB1 E;  3F8T A;  1GM5 A;  3J7Z C;  2OTL A;  1VQ8 A;  2N49 A;  4LF7 L;  1VQC A;  2BH2 A;  3CCR A;  2UXD L;  1VQG A;  1B70 B;  4X62 L;  2MO1 A;  2N8N A;  1B7Y B;  2IX0 A;  3K0X A;  4R4T A;  4UP9 A;  3KJP A;  1XPR A;  1QZH A;  1VQL A;  4APV A;  4BY1 G;  1X3G A;  2PI2 A;  2UUC L;  4FDB A;  2EQS A;  5LMU L;  5JJL A;  2IHF A;  2F4V L;  4JI2 Q;  3ICE A;  1IBM L;  3I2Z A;  5IWA L;  4QIW E;  2Y0S G;  3PGZ A;  3CC7 A;  4TQU S;  1N33 L;  3SGI A;  2YTY A;  1FGU A;  4JI6 L;  4DV3 L;  4B3T L;  2ALY B;  3F2B A;  2D0P A;  1PFS A;  4A3F H;  4PZ6 A;  3CC2 A;  3B6Y A;  2NVT H;  1PVO A;  4DUY Q;  2V1C C;  4GKK L;  1WCM G;  3M4P A;  4K0K Q;  4A4I A;  2D62 A;  3RLO A;  3TS0 A;  1PA6 A;  1KD1 C;  3AEV A;  1LUZ A;  4X64 L;  2PQA B;  1Z9F A;  3PCO B;  2UUA Q;  3M4Q A;  3ULJ A;  4JBK A;  1X56 A;  4DV1 L;  4HIM A;  1JJG A;  3L0O A;  3MEF A;  5IT9 c;  2E2H H;  1JMC A;  2NN6 G;  3EBE A;  5C4X G;  1G51 A;  4B3M L;  1BVS A;  1VQ9 A;  3Q8D A;  2ZM6 L;  1V43 A;  1K83 H;  3RN5 A;  4BY7 H;  4NPS A;  5M3F G;  1D8L A;  4LWC A;  3U4Z A;  1PH1 A;  1N36 L;  1HNX L;  1L1O C;  2UUB Q;  2QGQ A;  2VUM G;  3KFU A;  4A3J H;  4QJF A;  1IBK Q;  4LF6 L;  4IFD I;  3GDE A;  4PMW A;  4JOI A;  2UXC Q;  4DAM A;  3U4V A;  3EIV A;  1KRT A;  4R4C A;  2LXK A;  1N33 Q;  4A3L H;  3U50 C;  3CCU A;  1J5E Q;  3PIP A;  1Q1E A;  2RHS B;  3KJO A;  4JYA L;  2MO0 A;  2PQA A;  1IXR A;  2Z0S A;  3NEL A;  3J7A 5;  4A3D H;  4BY1 H;  2CWA A;  3S14 H;  1NMF A;  1CUK A;  5JJI A;  3M3Y H;  3CF5 A;  2E2I H;  1X3E A;  2WP8 J;  5FLX c;  1Q1B A;  1PH2 A;  3FHW A;  1BKB A;  1VQH A;  2H5X A;  5M3M G;  1N9W A;  5IYB G;  1X3F A;  2JA6 G;  4GKJ Q;  3STB C;  3KLW A;  2DGY A;  1TWF H;  4J15 A;  1W3S A;  1YNX A;  3BJU A;  4DV3 Q;  4B3T Q;  1G29 1;  4DV2 L;  1EQQ A;  4DR7 L;  1LM0 A;  3HOX H;  4JI0 Q;  1AH9 A;  4NXN Q;  1RIP A;  2A1A A;  4X65 Q;  1JJC B;  4IO9 A;  2XTI A;  1VQO A;  2VNU D;  1EUJ A;  3BZC A;  4X64 Q;  1T9H A;  2GN5 A;  3AFP A;  1PHJ A;  1J5E L;  1E22 A;  4A3F G;  1YJW A;  2AMC B;  4JYA Q;  4YCU A;  4L5S A;  2VQE Q;  2IHE A;  5HGQ A;  5GQO A;  2ID0 A;  5JJK A;  1K73 C;  4KLK A;  2VZA A;  1FL0 A;  4X6A H;  2OQ0 A;  4IJH A;  2JQO A;  4YY3 L;  2R7Z H;  5IY0 A;  1X65 A;  2YV5 A;  3GD7 A;  1PH9 A;  1HR0 W;  1BBW A;  2Q2T A;  3CCL A;  1P8L A;  4GNX A;  1Q86 C;  5GRO A;  2I5L X;  1WI5 A;  4YCV A;  1IBK L;  4LF6 Q;  2IY5 B;  4GKJ L;  5C4X H;  3PSI A;  5IE8 A;  1TXY A;  3ZJY C;  3NEM A;  5AJ3 L;  4DV7 Q;  2PMZ E;  1VQ4 A;  4A3K H;  3GTM H;  4DR7 Q;  3JAM i;  3K81 C;  3S17 H;  4DR6 Q;  1WCM H;  4R1J A;  3S1R H;  1SFO H;  4LF9 Q;  2ZJP A;  4LF4 L;  4DV0 Q;  1YZ6 A;  1VCI A;  5C0X G;  2PNH A;  1PYS B;  1U0L A;  2EXD A;  3A5Z B;  2JA5 G;  4JI5 Q;  1MJC A;  1XNQ Q;  1VS0 A;  1XMQ Q;  4OWW B;  3I4N G;  4EQ5 A;  2R6G A;  3W1G A;  5BR8 Q;  2NVQ H;  4DR1 Q;  5JEA J;  2OWO A;  5C3E H;  2VQE L;  1VQJ A;  4UP7 A;  2OTJ A;  5K36 G;  4LFC Q;  4JI1 Q;  5M5W H;  3E9I A;  1KC8 C;  3PUZ A;  4LF8 L;  2N78 A;  4LUZ A;  1P16 A;  2HHH Q;  4DR4 Q;  4YHH L;  2QA4 A;  4DR3 L;  1YEZ A;  2QEX A;  4JV5 Q;  4LFA L;  5IP7 G;  2AWO A;  2GVB A;  4X65 L;  1XMO Q;  4A3J G;  3TEH B;  4A93 H;  4IOA A;  3I56 A;  3KF8 B;  4IPG A;  3T1Y Q;  1L1O B;  3BU2 A;  4IJL A;  1E1O A;  4POG A;  4P72 A;  3CAM A;  1FVI A;  3S16 H;  1VQI A;  5IP9 H;  1VQM A;  1JB7 A;  3W5O A;  4BY7 G;  3DLL A;  1K3R A;  2OQK A;  2R7F A;  4LF4 Q;  1YVC A;  3KDF A;  2ES2 A;  4ME3 A;  2B63 G;  3GTK H;  4C3H H;  3I4M G;  1JJ2 A;  1X54 A;  3OYY A;  4LW1 A;  1S72 A;  1N34 L;  1LTL A;  3HOW H;  3RR5 A;  3HOV H;  4DV5 Q;  4HID A;  3M7N A;  5LMN L;  3GTP H;  1SN8 A;  4DR1 L;  3HOY G;  3L7Z C;  4KHP Q;  2JA7 G;  4LFC L;  1OXT A;  4O0A A;  1HZB A;  3HOZ G;  5GAG C;  5C44 H;  2JK8 A;  1PH3 A;  4YWL A;  1GVP A;  4DR5 L;  3G6E A;  4A3G G;  3CPW A;  1HNW L;  2VQF L;  4IFD G;  4GLX A;  2B29 A;  3ERS X;  2K5V A;  1K8G A;  1S40 A;  4JI8 Q;  5C0X I;  1UE1 A;  4GN3 B;  5C4J H;  3HOW G;  4L5Q A;  1XNQ L;  4R4I A;  1SRU A;  3GTO H;  4JBM A;  4DV4 L;  1MKH A;  3FKI H;  1EIY B;  2B3G A;  1KRS A;  3A0J A;  3NEN A;  1SR3 A;  4LF7 Q;  1H95 A;  4KHZ A;  2UU9 L;  4BBS G;  4HJ7 A;  2K5N A;  2C35 B;  1K8A C;  4GOP B;  2LXJ A;  2ZJR A;  1EOV A;  4DAY B;  2HHH L;  2ZTE A;  1SLJ A;  4JI7 L;  4DR4 L;  2IT1 A;  4JV5 L;  4LFA Q;  4C2M H;  3T1H Q;  4LFB Q;  4RG1 A;  1XPU A;  1L1O A;  3KYH C;  1XMO L;  4JI3 L;  3HOU G;  1UWV A;  2NN6 I;  1JE5 A;  1N32 Q;  2JA8 G;  4DR5 Q;  1WYD A;  5IWA Q;  3CCM A;  1YHQ A;  4A3I H;  1QVF A;  3RNU A;  5FLM H;  2KHI A;  1ASZ A;  4JI8 L;  2K14 A;  1KHI A;  2R7D A; 
#chains in the Genus database with same CATH topology
 4V19 0;  1VF7 A;  3QOL A;  3N52 A;  1KL9 A;  1CSQ A;  1C48 A;  4DV5 L;  2IL8 A;  4IUV A;  3D31 A;  5ISR A;  4TQS A;  1I50 H;  5JQW A;  2YTX A;  2CWP A;  5JPM C;  4MTD A;  3TME A;  3OSP A;  4O4L F;  1SDF A;  2UUA H;  5L37 A;  5IYD H;  4FBU A;  1KDC A;  3RV4 A;  4GLA C;  2DIK A;  3JAM E;  1KEE A;  4OWT B;  2TSS A;  3VYU A;  4DV4 Q;  4ID6 A;  1STE A;  1SYF A;  3STB D;  2A8V A;  2YCH A;  5IP7 H;  1EY8 A;  1T36 A;  1E4F T;  2RGV A;  4GOP C;  3PUY A;  4B9X A;  4AYB G;  5I2X A;  3K58 A;  1PH8 A;  3PUW A;  4PMB A;  1W96 A;  4CC5 A;  1YNN D;  1GYF A;  3TZU A;  1D1K A;  3SVM A;  5F2D A;  3HOV G;  3GTL B;  1SNP A;  2EIF A;  1HR0 L;  5C3E G;  3M9N B;  2NVY B;  1S68 A;  1LT6 D;  2EYP A;  4DXG A;  2FJZ A;  4A75 A;  2A74 C;  1MJE A;  4L8J A;  2E76 C;  3RBD A;  1FJG L;  2HGS A;  4B9W A;  5GAE C;  2H4O A;  4YBZ B;  4GKK H;  1M4V A;  2BH8 A;  4EYH B;  4UPA A;  2PN1 A;  4WRD A;  3W2D A;  3PIO A;  1SYB A;  1JWM D;  5E7N A;  3C0F B;  4A3E G;  2DJG C;  2M00 A;  5LMU H;  3GIM A;  3GTJ H;  4OXP A;  3J7Y W;  1TWG H;  5LL6 S;  3PF4 A;  5EDW A;  3PW0 A;  1OTC A;  1MZB A;  2FK3 A;  3GV3 A;  1EYG A;  3NP8 A;  1VQ7 A;  2VA2 A;  1HHV A;  1NTG A;  4ZCK A;  5EJW A;  5E1F A;  3ETH A;  2B2T C;  3UDF A;  3M7G A;  3HOX G;  4GS3 A;  2IJ0 A;  4A3M H;  4RWS C;  1J6Q A;  4X62 Q;  3G4S A;  4WJ4 A;  5EAY A;  5FKA C;  3UDX A;  2EPB A;  5FPR A;  4YY3 Q;  4BWS C;  3EJI A;  4M9U A;  2AHO B;  1HR0 Q;  2WTF A;  4J9Q A;  1S03 G;  3S1R B;  4QF4 A;  2EYJ A;  3UDG A;  3OUU A;  3URY A;  3OUZ A;  3M85 A;  4R4O A;  1C4Q A;  2J6S A;  1A2U A;  1GUS A;  5K5P A;  4RCN A;  4F4Y A;  1I4P A;  2J6T A;  4K8I A;  1RF2 D;  4IPH A;  1LTR D;  1TY2 A;  2DNC A;  2UXC L;  2F1M A;  1VQN A;  1BQQ T;  2JE6 I;  5EGT A;  3JAM L;  3OTO Q;  3OTO H;  2SEB D;  4JV1 A;  5H1S E;  2W6P A;  4EEQ A;  1DD2 A;  2ENB A;  1GD7 A;  3NSW A;  4TV9 F;  1CSP A;  1KIX A;  5EKK A;  4R8U A;  4RB3 C;  5CBA E;  3H4B A;  1DZ1 A;  1KBL A;  2KQ3 A;  4CDC C;  1K0R A;  1YBY A;  2HHH H;  4DR4 H;  3S24 A;  5M5W B;  4YHH Q;  1HXY D;  1BR9 A;  1E2W A;  2EDG A;  5IYC H;  3D3R A;  3H3V H;  1VKZ A;  1SRO A;  1VQA A;  3FRP B;  2Q2H A;  4MTE A;  4JCV E;  3C46 A;  3QZ8 A;  3R2I A;  2B2U C;  2JN4 A;  1PTO D;  2VS1 A;  2PMZ B;  5IOC A;  3FPU B;  4DAV A;  3LWE A;  4G7Z C;  1MD2 D;  2MJ8 A;  1E3P A;  1ENC A;  3AYH B;  2X6G A;  3ERO A;  4LF9 H;  3Q6S A;  2B8G A;  2OEO A;  2I87 A;  1LYL A;  4A3D B;  3KHH A;  4Z9C B;  1L0W A;  1EU3 A;  3SK5 A;  4FU0 A;  1B9M A;  1Q7Y C;  1XTC D;  2WAQ E;  2QDB A;  1E0B A;  3H94 A;  1B2T A;  2EYL A;  5IGE A;  2RGR A;  2B2U A;  3PW2 A;  4LAA A;  5J2U F;  3HKZ A;  3GTQ H;  2F0F A;  4UCV A;  1Q8K A;  5KFI A;  2F0G A;  5M3M B;  1UUP A;  2SOB A;  3R93 A;  4OX9 L;  4A3G H;  2NB0 A;  4OGQ C;  4CHT B;  4ECV A;  2Y0S B;  2RVL A;  3ULL A;  3J80 L;  2Q2U A;  1PMR A;  3NQT A;  2FKL A;  2YZG A;  4A3E B;  5CAE B;  4QWB A;  5C4Z A;  1U4M A;  1FNU A;  3OOC A;  1IOW A;  1HJP A;  2V4Q A;  2UVV A;  1FNW A;  3S2D H;  4KD4 A;  2E8G A;  2F0P A;  1BBU A;  4A3E H;  1XMQ L;  2PZU A;  4LF8 H;  3KF6 A;  3EPI A;  2KCC A;  4BA1 I;  1L2Z A;  3UE1 A;  3CRK C;  1GGO A;  1ML0 D;  4XX0 B;  4XXE A;  1ESR A;  1HUN A;  4YCW A;  1C9O A;  3OSO A;  3CD6 A;  3ORR A;  1S4Z A;  1XTD A;  4ZKB B;  1TY0 A;  2OXP A;  1WTV A;  1PH5 A;  4Q0Y A;  4BWG B;  3PO2 G;  1HFG A;  1B53 A;  1L2F A;  2FMA A;  4K2K A;  1SND A;  4GLV B;  2D0O A;  1C7Y A;  5D8D A;  1SYC A;  1VMC A;  3Q22 A;  1I94 L;  2R92 H;  2JA5 A;  4HQ6 A;  3BAA A;  5C0X J;  2E2I A;  1JOR A;  2E5L L;  4B3S L;  1TWH B;  4XTC S;  4U7C A;  4C3H B;  1DIK A;  4HJ5 A;  2DPI A;  1IBL L;  2W6O A;  1AE2 A;  4H7B A;  1RDP D;  1YJN A;  3N41 B;  5KNC A;  5F9N A;  1V9P A;  1II3 A;  4LF8 Q;  2A19 A;  3D6W A;  3T51 B;  2K6A A;  4O2D A;  3S1N H;  1IKL A;  3K80 C;  3KTM A;  3MR5 A;  2AGQ A;  2JA6 B;  1PZJ D;  3OW2 A;  1WTO A;  4GN4 B;  3CCS A;  1KQS A;  4Q8E A;  2R8G A;  1D1I A;  3T1Y L;  5D3D A;  2NVX B;  4IWY A;  2FK2 A;  4X66 H;  1UEA B;  2Z4H A;  3K0Y A;  3TIN A;  4J9O A;  2YYA A;  2E2H A;  2PBZ A;  5M5X H;  2RSN A;  3MR3 A;  1EWH A;  4O3Q A;  1GUT A;  1TS2 A;  1U5K A;  2G5D A;  2R7Z A;  1U9R A;  5DGA A;  1WJJ A;  1IBM H;  1VDZ A;  5FLX E;  1O75 A;  2KEC A;  2VL6 A;  1BXR A;  1A9X A;  4YJ2 F;  3H40 A;  1PDQ A;  2QEJ C;  5IT9 W;  3V05 A;  1N56 A;  3MC0 B;  5KG5 A;  3N8D A;  3J7A K;  5IYC G;  4L5R C;  4GN5 A;  3PF5 A;  3GTQ A;  4DNR B;  1Y14 B;  4ZOL F;  1Y69 U;  4ED8 A;  2WB1 E;  1GSH A;  3J7Z C;  1WTX A;  1VQC A;  5JH7 F;  2B63 B;  2QCP X;  2BH2 A;  4EGV A;  2AGO A;  1VQG A;  4X62 L;  1IL8 A;  2N8N A;  2IX0 A;  5KFV A;  4R4T A;  1QIL A;  1HPC A;  2UVU A;  3C3L A;  2UUC L;  4MA0 A;  1L0X B;  1J8I A;  1EHI A;  1SEI A;  5DQI A;  2ZM6 H;  5JJL A;  1DJR D;  4LF5 H;  5E4X A;  3ICE A;  3BA9 A;  1PZI D;  3I2Z A;  4QIW E;  4TQU S;  3T5K A;  1IW7 C;  1T94 A;  2Z9H A;  5HUR A;  4JI4 H;  2WKD A;  1BNC A;  3N6X A;  2NU8 B;  2W8K A;  4F4X A;  1PA6 A;  2JEJ A;  1SYG A;  5EWG A;  5EKL A;  4AQY H;  2BDO A;  2PQA B;  1SE3 A;  3RGX A;  3ULJ A;  1ET6 A;  3GIP A;  1I7N A;  4RKL A;  1EYC A;  4YP3 A;  4JV5 H;  2NN6 G;  3NHH A;  2ZM6 L;  5KGU A;  2UUC H;  1NAP A;  2SNS A;  3OHX C;  4KY5 A;  1RJQ A;  2JXM B;  4JI1 H;  3PO2 B;  4RNN A;  1F9P A;  1IBK Q;  4MTK A;  2JA8 B;  3GDE A;  4JOI A;  2B2W A;  3U4V A;  2VUM A;  2Z1C A;  2EZV A;  2NUA B;  4IUU A;  4R4C A;  2LXK A;  1N33 Q;  3U50 C;  1BCP B;  2RHS B;  1FYC A;  2O4X A;  2QDL A;  4JYA L;  2PQA A;  3J7A 5;  3U9T A;  4L63 B;  3WOF A;  1XDN A;  2SNM A;  2E2I H;  3NPP A;  1Q1B A;  4MA5 A;  4CC6 A;  3PZP A;  4LJZ C;  3H20 A;  2B2V A;  4A3B B;  4GKJ Q;  3STB C;  4HTH A;  1TWC B;  3TN2 A;  1B1Z A;  3BJU A;  1G29 1;  4YAJ B;  3P75 A;  1LM0 A;  3HOX H;  4XQN A;  1AUX A;  4NW2 A;  3RZD B;  3RAX A;  5KG3 A;  1K28 A;  1T9H A;  1PHJ A;  4A3I B;  1J5E L;  1E22 A;  4A3F G;  5ELF A;  2RKS A;  4KV6 A;  3SK8 A;  4MN3 A;  2Z6B A;  3NTI A;  4UCR A;  4FVM A;  4JK1 C;  1EIG A;  1FL0 A;  3ND9 A;  2MHV A;  4IUN A;  1X65 A;  1PH9 A;  1P8L A;  4GNX A;  3R3O A;  3RIZ A;  1I3Q A;  1WI5 A;  1WTH A;  1NSN S;  1CQI B;  5C4X H;  5DQG A;  2EYO A;  5KFG A;  1VQ4 A;  2B2W C;  1BDO A;  4CJ2 C;  3GIJ A;  1AEX A;  3C1F A;  1X3Q A;  2CH4 W;  2W8L A;  4MV7 A;  2EY1 A;  3S1R H;  1SFO H;  2ZJP A;  4DL7 A;  4DV0 Q;  1YZ6 A;  2FFK B;  5C0X G;  1PYS B;  2WV6 D;  3A5Z B;  4FP5 D;  3GQB A;  4OWW B;  1I6V C;  1I4R A;  3W1G A;  5BR8 Q;  2RDF A;  4DR1 Q;  2VQE L;  3FDT A;  1SYX B;  1ULZ A;  1RYS A;  4JI1 Q;  4JUZ A;  3E9I A;  4QMG A;  1KC8 C;  1ZEQ X;  1D5M C;  4LF8 L;  1P16 A;  2HHH Q;  4DR4 Q;  1CZG A;  5COR A;  1YNJ C;  4JV5 Q;  3D4W A;  3OMG A;  4MV3 A;  1WTW A;  1D6E C;  3JAM W;  1U4R A;  3MXP A;  2IW3 A;  1H9M A;  5I6Y A;  2W7P A;  2W9B B;  1VQI A;  2XCA A;  2VB2 X;  3BVM A;  3GV7 B;  3W5O A;  4BY7 G;  1K3R A;  2K5Q A;  4LF4 Q;  3KDF A;  2ES2 A;  5L1L A;  1K83 A;  4LK1 C;  2B63 G;  3GIL A;  3OIQ A;  1X54 A;  4JPB W;  1LTL A;  5J39 A;  3GTO A;  5A35 A;  4HID A;  5LMN L;  3GTP H;  4ZUI A;  2PZW A;  1C8C A;  4RGT A;  2JA7 G;  4ODG A;  5KFP A;  1HZB A;  4FF4 A;  4EQN A;  4HR7 A;  2JK8 A;  3ORQ A;  5E4W C;  2A68 D;  3C2P A;  3CPW A;  2HQE A;  2VQF L;  3VR2 A;  3PW5 A;  4JYA H;  4ZAI A;  5KFT A;  4OIK A;  2K5V A;  1K8G A;  5C0X I;  1DOK A;  5LL6 X;  4ED0 A;  1DXM A;  5EBC A;  1JIH A;  3GTO H;  1W6J A;  2AQ4 A;  3S14 B;  1B6R A;  3FKI H;  3A7A B;  1DV2 A;  3A0J A;  4DK1 A;  3NWT A;  1H95 A;  4GKJ H;  3T5H A;  3GTO B;  3Q8P B;  2K5N A;  1GXD C;  2WE6 A;  3RZO B;  2LXJ A;  4ECS A;  4OL7 A;  4RGO S;  4PDB A;  2HHH L;  4DR4 L;  1SLJ A;  2IT1 A;  4JV5 L;  4RU9 A;  5KG4 A;  4IR1 A;  1XPU A;  5KEE A;  4M1U B;  2K32 A;  3HOU G;  2NN6 I;  1JE5 A;  2VB3 X;  3NUC A;  1WYD A;  5C4J B;  3CCM A;  1BF4 A;  1QVF A;  2JYO A;  1ZYR C;  3MVV A;  3UI2 A;  5FLM H;  4KKS A;  5KFQ A;  4JI8 L;  1HRJ A;  4F50 A;  2R7D A;  2AUK A;  2Q8R E;  2XGQ A;  2HD3 A;  1HTP A;  2ASB A;  3GTG A;  1GHJ A;  1DON A;  5LMN Q;  5EZY F;  2UUC Q;  5ELO A;  2NVT B;  3JC6 6;  2R92 A;  5F9L A;  3G48 A;  3TSS A;  4KN7 C;  4S3S A;  3F2C A;  4A3B G;  3I4M H;  2E2J H;  4ED7 A;  5KFL A;  3I90 A;  4ZUJ A;  1MBY A;  4X62 H;  1X32 A;  4FF1 A;  4A2B A;  2N55 A;  2E2J B;  4A2A A;  3TQY A;  4MNO A;  3H09 A;  2XWB B;  4UP8 A;  1ZET A;  4A93 G;  3D0F A;  4JW0 A;  4MV9 A;  3MWM A;  1B9N A;  3RLN A;  3LNN A;  2BCO A;  4P71 A;  1CE8 A;  3CQZ H;  4L5T A;  1S5B D;  4NXM L;  1FNV A;  5CC4 A;  4LF5 Q;  1XNR Q;  2OT2 A;  2ASD A;  1HZA A;  4DUZ L;  1JCK B;  5FO8 B;  2KBN A;  2WIN B;  1YJ9 A;  3ONA B;  4MTN A;  2NVX H;  5KFJ A;  2VY3 A;  2F0S A;  1GSA A;  3E0J A;  1EUC B;  3PUX A;  5KT4 A;  3KUP A;  1CKM A;  2A6E C;  4DAY A;  1A62 A;  3HBL A;  3BVZ A;  4X64 H;  1EU4 A;  1Y1V H;  2GVA A;  1R9T A;  2ZTD A;  4HR7 B;  4X66 L;  4P74 A;  1ZHS A;  3J80 W;  4R7R A;  3HB9 A;  4MAM A;  4E6I A;  5CB4 F;  1VQE A;  1EFI D;  4J9L A;  2IP4 A;  2XCL A;  1EQR A;  2Z8L A;  4EFB A;  3GV8 B;  3K3V A;  4MZ9 A;  4XQQ A;  1SMX A;  4TVA B;  2FXQ A;  4KI0 A;  1RYR A;  4CKE A;  2F52 A;  2I07 B;  2MFI A;  1IZ6 A;  4AIM A;  5C44 G;  1IBL H;  2UU9 H;  3K7U C;  2WII B;  4C56 C;  3VPB A;  2ZXR A;  4BXX G;  1WTQ A;  4B3S H;  1Q46 A;  4DV4 H;  5ELB A;  3CHB D;  3A8K E;  1KAB A;  1WCM B;  4IWX A;  1LO5 D;  2R8H A;  2UXD Q;  3QB3 A;  3SE0 A;  4C3I H;  2CQA A;  2YW2 A;  2UUA L;  3WO1 A;  2V9W A;  3ULP A;  4J9N A;  4JVZ A;  4Y7N H;  1MHW C;  2F0K A;  3CP0 A;  2HJW A;  4ABN A;  4JI2 L;  4EX5 A;  1Q82 C;  3UFX B;  5KFX A;  3NK9 A;  2AUJ D;  3QOJ A;  1EFW A;  3MA2 B;  2I5M X;  1I7L A;  1V51 A;  1XMQ H;  1CM9 A;  3RN2 A;  4DV5 H;  1I4H A;  4U67 3;  3M9B A;  3BDO A;  2V59 A;  2R7M A;  1HNZ Q;  3OHA A;  2CQY A;  4DV0 L;  4UCU A;  4NDX A;  1V8Q A;  3CMA A;  1A15 A;  4OX9 H;  5BR8 L;  3CCQ A;  1GLV A;  3MWD A;  5C0X H;  2WAQ A;  5KFY A;  4LFA H;  2AQ1 B;  3F2D A;  4B3M Q;  4IQZ A;  3R23 A;  1GO3 E;  2ZXO A;  5JEA G;  4RUC A;  1LTG D;  1NY4 A;  4DNI A;  3K59 A;  1N34 Q;  5KFE A;  1N8R C;  1JC7 A;  3VPC A;  2KCT A;  3KHL A;  1S10 A;  5I47 A;  4R9W A;  4O42 A;  1EYZ A;  4OON A;  3VMM A;  2JA8 H;  3GTQ B;  2WB1 A;  3J81 i;  1EIF A;  4ZRZ A;  3RMH A;  4A3L G;  2VPS A;  2LSS A;  4KY7 A;  2VW9 A;  1BCP D;  4IN3 A;  2AKW B;  3J7A F;  4DFA A;  5KT7 A;  5EWF A;  3I4N B;  4LSX A;  2L1B A;  4QWD A;  1XJV A;  3RAQ A;  3GTK B;  2R3Z A;  1IL2 A;  2F0O A;  5IT9 L;  3CPF A;  4KJN A;  1QVC A;  4P73 A;  1F2Y A;  3MFY A;  3TIG A;  3BQ1 A;  4A3B H;  3F1Z A;  3VYT A;  5KFK A;  2YU9 H;  5FD6 A;  3K3P A;  4TV8 F;  3G6V A;  1S5F D;  1S0N A;  1V1Q A;  4EBD A;  1JX4 A;  3X3M A;  4DPG A;  2PI2 E;  1PH4 A;  3OTO L;  4PZ8 A;  3M4O H;  2YS7 A;  1UE7 A;  3CVZ A;  2A6E D;  1QE6 A;  4HIK A;  1M6V A;  3Q2O A;  2BDN A;  1PLF A;  2WFW A;  2UXC H;  2E75 C;  4G4K A;  1O7I A;  1I6H B;  4X65 H;  2JJQ A;  2ZJQ A;  4JI5 L;  3DWP A;  4RB0 A;  5AFW A;  4DR3 H;  1TWH H;  1I6H H;  4B3R H;  3S15 H;  3CCJ A;  1BO0 A;  3SK6 A;  1J9O A;  3T1H L;  4J1M A;  2F0W A;  2B2V C;  3JAM c;  5KG2 A;  5KT3 A;  1GUN A;  3MXG A;  2YRX A;  3BZK A;  4LMQ D;  4A3C G;  2C2E A;  1PZK D;  4AQY Q;  4QGU A;  4RUA A;  1OXU A;  4OO1 G;  3K8A A;  3H0G H;  1I3Q H;  3DMU A;  1AUV A;  1N48 A;  2LKV A;  3J81 j;  2R7N A;  2PO4 A;  3PO3 G;  3MTS A;  1YHA A;  1B3Q A;  1GKH A;  4OEL B;  4DR6 L;  4FM9 A;  2YYZ A;  1PXU A;  1HZC A;  3GLK A;  1K83 B;  3T5L A;  5KIX A;  1PH6 A;  4AYB A;  2Z4I A;  2IX1 A;  2JEG A;  1GOZ A;  4PZ7 A;  1PH7 A;  1B4O A;  1Z2N X;  2BQ3 A;  3L2P A;  3T5J A;  4IAL A;  4NXM Q;  2YS6 A;  2LFN A;  1TWA H;  4IAJ A;  5C1O A;  1A0I A;  3GO5 A;  3V2T A;  4YY3 H;  1TWA B;  4ALP A;  5A2Q W;  5DG8 A;  2M9V A;  5C3X A;  1LTT D;  3HKZ G;  4GNX B;  2GPW A;  4WFN 3;  1PTO F;  3PR4 A;  5KFR A;  4J9M A;  3G8C A;  3EN2 A;  3DM3 A;  3BDL A;  4DR2 L;  5CA1 F;  3PW7 A;  1C30 A;  3SR1 A;  5IP9 G;  5I2Y A;  4DV3 H;  1G2S A;  4B3T H;  3FP9 A;  4JI6 H;  1FJG H;  2K5D A;  4GC6 A;  2R7Z G;  3GID A;  4TQR A;  4EYI B;  5IWA H;  5L1I A;  4DR7 H;  1OXS C;  1SXT A;  2RDI A;  2FMM A;  1RJR A;  4JBW A;  3TP7 A;  4Y52 H;  4DV1 Q;  1LT5 D;  3MR6 A;  1O78 A;  1SAP A;  4RMF A;  1YHB A;  3T4A C;  3RB0 A;  1G8Z D;  3WNZ A;  2CZG A;  3TII A;  2B2T A;  3BS1 A;  2CKZ B;  1HNW Q;  4E4T A;  4K2L A;  4JI6 Q;  2V4R A;  3FKI B;  2W70 A;  2ICI A;  2R92 G;  1C3O A;  1VQ6 A;  4LF7 H;  1QUQ B;  4OEM B;  4GNX C;  2K52 A;  4X66 Q;  4DK3 C;  1I6U A;  1I94 Q;  2CQO A;  2K50 A;  1X3P A;  3NE5 B;  3RZO H;  1PK8 A;  4DL5 A;  3F8T A;  4RA8 A;  3R5X A;  3RV3 A;  2V4D A;  3SK4 A;  1TR5 A;  2ZXP A;  2UXD L;  2CW0 D;  3FEW X;  1B70 B;  2KJX A;  1B7Y B;  3DWQ A;  1XPR A;  4R8U B;  1DOM A;  2FPP B;  2PNR C;  1MSG A;  3LWU A;  2PI2 A;  1SE4 A;  3AB9 A;  3AU7 A;  4APM A;  2EQS A;  1L0Y B;  1ZHQ A;  1WH2 A;  4QWE A;  1B3A A;  3PGZ A;  4K0K H;  4ECX A;  2YTY A;  1FGU A;  4N8F A;  2ALY B;  5KNB A;  3F2B A;  2IPK D;  3CC2 A;  2NVT H;  2W6Q A;  4DUY Q;  4PNY A;  4X3U A;  1LT4 D;  2F3V A;  3TS0 A;  2FJ2 A;  4AYB B;  3AEV A;  1AFP A;  1SCU B;  3MEH A;  4F4W A;  4JBK A;  1X56 A;  4KY6 A;  3T16 A;  2NWG A;  4HIM A;  5EQ0 A;  4C3H G;  3L0O A;  3OSN A;  3MEF A;  4KD3 A;  1YNN C;  1BCP C;  3EBE A;  2RCF A;  3Q8D A;  4JV2 A;  3S1M B;  5M3F G;  1D8L A;  1N36 L;  5C3E B;  3BAB A;  1L1O C;  2QGQ A;  3K5H A;  3KFU A;  2JEF A;  4A3J H;  4QJF A;  4LF6 L;  1PVO A;  2UXC Q;  4PMW A;  3T53 B;  3J81 W;  4DAM A;  4FF2 A;  4K5W A;  1KRT A;  2WAC A;  4KN4 C;  3I12 A;  4A3L H;  3I3C A;  3CCU A;  1RKN A;  1EEI D;  1QWY A;  1Q1E A;  2A6H C;  3KJO A;  2JSO A;  3MAQ A;  1LTS D;  1UNS A;  4K6L A;  4BY1 H;  2HDM A;  2YRW A;  3VA5 A;  2LY7 A;  1CUK A;  3M3Y H;  1BCP F;  5FLX c;  2J6U A;  1TWG B;  5D1O A;  2DPJ A;  2H5X A;  1BUV T;  1X3F A;  3NXW A;  2DGY A;  1EQT A;  1M0W A;  1YNX A;  4DV2 L;  3G6J B;  2C2R A;  4JI0 Q;  2A1A A;  5LL6 b;  3VR6 A;  5COY A;  1B33 N;  2M2L A;  1EUJ A;  3BZC A;  2GN5 A;  3AFP A;  4RZQ A;  3TDQ A;  1EOT A;  2WDT A;  1ENA A;  1YJW A;  4JYA Q;  2MUY A;  4YCU A;  5JOB A;  3NBI A;  2IWH A;  2ID0 A;  4YHH H;  1LAC A;  4KLK A;  3PW4 A;  3BQ2 A;  2JQO A;  1HR0 W;  1Q86 C;  2BE5 C;  1IBK L;  2I5L X;  2IY5 B;  2RDH A;  3PSI A;  1SMY D;  1TXY A;  3PO3 B;  4A3K H;  4ED3 A;  5IYZ F;  4DR7 Q;  3K81 C;  1BOS A;  4LF4 H;  3NWS A;  4I7Z C;  1HQR D;  2FE3 A;  3OHB A;  4MHE A;  1WCM H;  4Y7N B;  1VBG A;  2NVQ B;  4JI5 Q;  4YR2 A;  2JA5 G;  3K57 A;  1MJC A;  1XNQ Q;  1XMQ Q;  1M8A A;  4Q5V A;  5C5M A;  2R6G A;  1JB3 A;  1SJE D;  2NVQ H;  2OWO A;  3MXN A;  5K36 G;  4LFC Q;  5KKN B;  5M5W H;  1EZ1 A;  1OO9 B;  2ZJT A;  3G6Y A;  3PVX A;  2F0E A;  3GTP B;  5DG7 A;  4LUZ A;  2BE5 D;  4ZKC B;  3RGZ A;  1TS4 A;  1YEZ A;  4DL2 A;  4L6T B;  3SEB A;  2AWO A;  1IW7 D;  4F8M A;  1S5C D;  1XMO Q;  3LWB A;  3KF8 B;  3T1Y Q;  1E1O A;  2F0N A;  4P72 A;  4IZ8 A;  2M05 A;  4J9S A;  3BYY B;  5IP9 H;  5JVH 3;  2OQK A;  5CA0 F;  1YVC A;  3DUZ A;  1JJ2 A;  1AZQ A;  1B04 A;  3HOV H;  4J9P A;  4I4T F;  1RD9 D;  4KMU C;  3HOZ B;  2HUG A;  4DR1 L;  3L7Z C;  1QNU A;  4C5C A;  4KHP Q;  1KJ9 A;  4O0A A;  3KLS X;  4PWQ A;  3VYR A;  3HOZ G;  5JAV A;  1KLU D;  2KEE A;  3PIP 3;  4WBN F;  4DR5 L;  1R9T B;  4ECY A;  3G6E A;  2ZDQ A;  2K28 A;  5FD5 A;  4C2M A;  3QZ7 A;  1UAP A;  1DM0 B;  1UE1 A;  3HOW G;  5C4J H;  1STN A;  4R4I A;  2OLS A;  1VAJ A;  2I80 A;  3BVG A;  3HOW B;  2B3G A;  3DF7 A;  3HOX B;  3HP3 A;  5JUM A;  4HJ7 A;  1BXT A;  1K8A C;  2WAQ B;  4M8A A;  1PFM A;  1EZ8 A;  4FS2 A;  1T5X D;  2X6L A;  2EJF C;  2ZTE A;  3GV6 A;  4JI7 L;  4ME6 A;  5BN3 A;  3GTM B;  1Y8P B;  4C2M H;  2R93 A;  3KYH C;  1XMO L;  1S0O A;  2F0T A;  3K5I A;  1N32 Q;  1YHQ A;  2F0J A;  4DK0 A;  4A3I H;  3RNU A;  2YZM A;  3ITP A;  1PTO H;  1K8O A;  4QWA A;  1A3U A;  4RAU C;  5KYL A;  1K3B C;  1ASZ A;  4HNT A;  2OF1 A;  1Z7T A;  5DLG A;  1N33 H;  2R85 A;  1VF5 C;  5G3L D;  2F3W A;  3BG3 A;  3CQZ B;  2MNA A;  3NBH B;  2F03 A;  4A76 A;  5C5L A;  4ZI7 F;  5M9O A;  4PV1 C;  3A5U A;  1V1P B;  1YIT A;  3MJF A;  3D4D A;  3DWA A;  3HS0 C;  3RBE A;  1PX2 A;  4BBR B;  2D9U A;  4Q8F A;  1QNK A;  1ZXT A;  2EJG C;  2NZH A;  1SNO A;  5C6A A;  2VQF Q;  2QK4 A;  4MV8 A;  3S2H H;  3MWY W;  4BBR H;  5HV6 A;  3WWV A;  4DUY L;  2FLL A;  2L4N A;  4RNO A;  1F9Q A;  4DV7 H;  3AFQ A;  4DUY H;  1RTO A;  1FD7 D;  3GP7 A;  1TA8 A;  5GAD C;  4ETS A;  1A63 A;  4LF6 H;  3QWN A;  2RCN A;  2JA7 H;  3CQZ A;  5HY6 A;  3CCV A;  3HFZ B;  4BS9 A;  2L15 A;  1N36 Q;  5K36 H;  3E0E A;  4C3I G;  1G2T A;  5IIF A;  4RAZ A;  4RGN A;  2F3I A;  4O2B F;  2FLN A;  3L4J A;  1QVG A;  5KG0 A;  4OIJ A;  4BXX H;  5CMD A;  4DV2 Q;  3MFH A;  4JI0 L;  1JDE A;  2UXB L;  2L5T A;  1Q3L A;  1B50 A;  1CKO A;  1HZ9 A;  1VBH A;  3KAJ A;  3H91 A;  3TRZ A;  3CXC A;  2R8I A;  2B63 A;  4DGZ A;  3GTJ A;  5IT9 E;  1X9N A;  1PV4 A;  5DG9 A;  3HOY B;  3OW7 A;  5FJ8 G;  2N3S A;  4HMJ A;  2DLN A;  1QUQ A;  3CKI B;  2ZDG A;  2BA0 A;  4RB1 A;  1F2L A;  4AH6 A;  4RNM A;  2ZDH A;  2Z6K A;  2F0Q A;  1F2Z A;  5LMU Q;  2RA4 A;  4FYD A;  1STG A;  4QW9 A;  1H9J A;  4YIJ A;  4IOC A;  1KJJ A;  3HEJ A;  4UY8 C;  2AQ2 B;  4N9T A;  3QG1 A;  1FJG Q;  1Y1W H;  5KYI A;  2QYZ A;  1VQK A;  4LNQ A;  2G9H D;  4LMY A;  2KHJ A;  2F4I A;  3PV0 A;  4GKK Q;  1I50 B;  3VA7 A;  5HGT A;  3J81 L;  3IFT A;  1ZQ7 A;  4H0L C;  3ZYY X;  3JZI A;  1Q90 A;  1EWI A;  5T1I A;  3W1B A;  2K5W A;  3CCE A;  2DY8 A;  3U58 A;  4FXD A;  2K7V A;  2E74 C;  2C22 A;  2HVS A;  4DR1 H;  5J3B A;  1KXL A;  1UE5 A;  2K1B A;  3PUV A;  5LMN W;  2K5H A;  2KEN A;  2C00 A;  4DV6 L;  3FPP A;  1HTL D;  5GAH C;  1JDB B;  2UUB L;  2NZ1 D;  3G71 A;  3GTL A;  3TRE A;  1Z2O X;  1AZP A;  1HA6 A;  2B8F A;  3MXN B;  4P75 A;  4HNU A;  4DR2 H;  2KUM A;  2K04 A;  3GTP A;  2I5H A;  1CA6 A;  1Y1W G;  5GON F;  1I50 A;  1IHZ A;  3BQ0 A;  3TP5 A;  4CBV A;  4HJ8 A;  4GOP A;  1GSO A;  4CKB A;  3BA8 A;  1G6P A;  4ZHQ F;  4I7H A;  3S16 B;  1TS3 A;  3I55 A;  3I4M B;  4TSS A;  3S1M H;  5IOD A;  1GJX A;  3IRB A;  3RB3 A;  4NB3 A;  5KND A;  4KHP L;  3HOU B;  5C4H A;  2L55 A;  3R8B A;  1JIC A;  3N40 P;  2XD4 A;  4DF7 A;  2YL2 A;  2FMC A;  1KNA A;  2L11 A;  3HOU H;  3H4D A;  1XNQ H;  4X3S A;  4NXN L;  1Q8I A;  5J1Z A;  4EQP A;  2K03 A;  4FXK C;  2LS0 1;  1R4Q B;  1WOC A;  2O2L D;  3E9H A;  2KCM A;  1MIU A;  3M4O B;  1HA5 A;  2ICE C;  1M1K C;  3HKS A;  4DL6 A;  5I9O A;  1KAW A;  5K2M A;  2AGP A;  2NN6 H;  4XQJ A;  3T1H H;  1KC7 A;  2A6H D;  1JT8 A;  1X55 A;  1JWS D;  4HSP A;  1IKM A;  4B3R L;  1U4P A;  1A8V A;  5DLF A;  1V4Y A;  2UVR A;  5C44 B;  2ZTC A;  2HIV A;  2ALZ A;  4K6D A;  1YI2 A;  2QF7 A;  1HNZ L;  2R93 G;  1ILP A;  1CA5 A;  4JC0 A;  1SBB B;  2A69 C;  2JA9 A;  3EA6 A;  4A3M B;  1N32 L;  3R5H A;  3Q8R B;  1S5E D;  1SFO B;  1M7J A;  1JLL B;  1SEB D;  1T3N A;  4A3D G;  4DV2 H;  5FJ8 H;  3FMA A;  3I4O A;  2C5C A;  1VMP A;  3C1E A;  2WKC A;  1NR4 A;  3R5F A;  2B63 H;  1QOH A;  5DLQ E;  2FK1 A;  4JI7 Q;  2W6M A;  5I6W A;  3FVQ A;  3LML A;  2E2H B;  3KHR A;  3VYS A;  1T5E A;  4R4Q A;  3KLS A;  2JEA I;  5ELE A;  5KFB A;  2VUM H;  1EYD A;  1SYE A;  3OIP A;  4QY7 A;  4L1K A;  4C5B A;  5EPL A;  3TP8 A;  3V6J A;  4H44 C;  2O5I C;  2ATL A;  2VUM B;  4JI4 Q;  3NBH A;  4DA2 A;  2CCZ A;  2HT1 A;  4O2A F;  3SE7 A;  3FKI G;  2W9C B;  2JA6 A;  4UAI A;  3UE0 A;  3GTG H;  1K1S A;  3FDS A;  1VQF A;  4BY7 B;  3H15 A;  3IFD A;  5KFN A;  1I4X A;  4J9R A;  1JWU D;  3SDZ A;  5BPF A;  4DAP A;  5KX5 F;  4IPC A;  5DQH A;  4QB4 A;  4MV6 A;  1Z6H A;  4QUF A;  1SSO A;  3NTK A;  1XNR L;  2VUG A;  4EBE A;  1TQO A;  3TP6 A;  3LGJ A;  4DUZ Q;  4I50 F;  1NJI C;  4RCO A;  1VQD A;  4QWC A;  4DR3 Q;  1DGS A;  5M3F B;  1NMG A;  4O4H F;  4BBR G;  2F4V Q;  4POF A;  5BMV F;  1V1P A;  3NGD A;  4A3K G;  5BR8 H;  1TWF B;  2IBK A;  4BA2 I;  4HAE A;  1TU2 B;  3S1Q H;  2I46 A;  3J80 i;  4J8Q A;  1ASY A;  5CV8 A;  1GUG A;  3H0G G;  3ND8 A;  5IGB A;  1XPO A;  4HSV A;  4OO1 H;  1WFQ A;  1KAA A;  5KFZ A;  4K0K L;  2L12 A;  2HQL A;  4AYB E;  4HIO A;  2HCI A;  2HIX A;  3PMF A;  3I73 A;  1QJO A;  3RD4 A;  4BBS B;  3E3X A;  5L1J A;  1TII D;  4O3P A;  4YWM A;  1IBL Q;  4LSA A;  3HOZ H;  2CW0 C;  1TVX A;  3L4K A;  3KOJ A;  1SNM A;  4A3G B;  1RJP A;  1RHP A;  1IYV A;  3DM1 A;  1HNX Q;  1ONL A;  3OWF A;  1R9T H;  4LFB L;  1Y1V A;  4QW8 A;  5G3L F;  4RZR A;  4DR6 Q;  4JI3 Q;  1E4E A;  1ZKO A;  3I4N H;  2R7K A;  5KFS A;  5C8Y F;  3F8N A;  3S17 B;  2B2Y A;  2P5Z X;  4F7X A;  1VQ8 A;  1ICW A;  2N49 A;  4KK7 A;  4UDU C;  4LF7 L;  5LP6 F;  4MV1 A;  1ICF B;  4O4I F;  2MO1 A;  1JXL A;  3K0X A;  1CTM A;  1VQL A;  4APV A;  2A69 D;  2DY7 A;  4BY1 G;  5KT5 A;  3IAY A;  5EWE A;  4FDB A;  4JV0 A;  1JOQ A;  5IGF A;  1PTO B;  4FNF A;  3Q8Q B;  2F4V L;  4B3M H;  4JI2 Q;  5IGD A;  1A3V A;  4FO2 A;  4DV1 H;  2R61 A;  5KRU A;  2W71 A;  5IWA L;  2Y0S G;  2PVP A;  3CC7 A;  3SGI A;  4JI6 L;  4DV3 L;  4B3T L;  2D0P A;  1PFS A;  4A3F H;  3B6Y A;  1CT1 D;  1LT3 D;  2V1C C;  2PW7 A;  4K0K Q;  5FLX W;  4A4I A;  2D62 A;  3RLO A;  1F9R A;  1LUZ A;  1MSH A;  4X64 L;  1Z9F A;  4EGQ A;  3KK7 A;  2UUA Q;  3M4Q A;  3H0G B;  4IUQ A;  4U6P A;  4DV1 L;  1JJG A;  4BY1 B;  4MV4 A;  3S1N B;  4G7O C;  2XCP A;  1G51 A;  4B3M L;  1BVS A;  3H0G A;  4XYQ A;  1V43 A;  1K83 H;  3RN5 A;  2KCN A;  3U4Z A;  1HNX L;  1STA A;  2UUB Q;  1Y8O B;  3I70 A;  1EY4 A;  4TRD A;  2VUM G;  4NXM H;  3RUP A;  4TKO B;  3MFG A;  3OWE B;  3EIV A;  4HN7 A;  1WD1 A;  1J5E Q;  3PN1 A;  2WYO A;  4DR6 H;  3PIP A;  5ELD A;  4HCS A;  2XRS D;  5FK9 C;  3ERQ A;  2I8C A;  2MO0 A;  1D2B A;  1TWH A;  2Z0S A;  1IXR A;  1MI2 A;  1HNW H;  3X3N A;  1NMF A;  4Q44 A;  1CK1 A;  5JJI A;  2WP8 J;  1PH2 A;  3FHW A;  3K6O A;  2EY6 A;  5M3M G;  5IYB G;  2JA6 G;  1N9W A;  1SFO A;  4J15 A;  2R8J A;  1W3S A;  4DV3 Q;  4B3T Q;  4PMC A;  3RF2 A;  1RIP A;  4JI8 H;  1HQM C;  4X65 Q;  2DWC A;  4IO9 A;  2XTI A;  1VQO A;  2FPI B;  4LH7 A;  2F0V A;  2VNU D;  2AU0 A;  2NVY A;  3HRZ C;  3HXL A;  5M5Y B;  4YR0 A;  4L5S A;  4O1N A;  2IHE A;  3AMU A;  5JJK A;  1LTI D;  1K73 C;  2VZA A;  5A2Q L;  4X6A H;  4IJH A;  2GPS A;  4J0M A;  2R7Z H;  2SDF A;  3CU7 A;  4FXG C;  5DGB A;  4G57 A;  1BBW A;  2Q2T A;  3CCL A;  2CW7 A;  2A68 C;  2B39 A;  2R86 A;  1XNR H;  5GRO A;  4LF6 Q;  1RK6 A;  3Q1K A;  4HYK A;  3HKZ B;  3EPG A;  4GKJ L;  4WD3 A;  3ZJY C;  3I8Z A;  2R6F A;  2PMZ A;  3NEM A;  5AJ3 L;  4DV7 Q;  3JRX A;  1GUW A;  3MZ5 A;  4R1J A;  1TS5 A;  2XRQ D;  3TBI B;  1VCI A;  2PNH A;  5EBD A;  1VS0 A;  3QFF A;  2R84 A;  1S5D D;  3KF8 A;  3LX0 A;  3KXY T;  3A56 A;  3VR4 A;  3A7L A;  4X3T A;  3WO0 A;  4C3J G;  5LMN H;  4UCS A;  3I4L A;  4IUR A;  3J81 E;  5LHY 1;  2XN9 C;  4LFA L;  5FO9 B;  4GZY C;  1PFN A;  1CHQ D;  4A3J G;  1EUD B;  4IOA A;  4RHS A;  5FLX L;  4IPG A;  4CJ0 B;  4HED A;  2R93 B;  3K5N A;  4POG A;  3S16 H;  1FVI A;  3CAM A;  4DV0 H;  1JB7 A;  1RTN A;  2E2I B;  1TAE A;  1PRT B;  1G6Z A;  3GTK H;  4C3H H;  2J7Z A;  4EFE A;  5A2Q E;  1G91 A;  4LW1 A;  1S72 A;  3JSL A;  2MGS A;  3HOW H;  4Q0F A;  3M4I A;  3RR5 A;  4DV5 Q;  3M7N A;  2KED A;  4JI2 H;  2XGP A;  2PYK A;  1OXT A;  2DZD A;  1BJT A;  1KJI A;  1PH3 A;  5LYJ F;  1GVP A;  4TUY F;  4C2M B;  1PFB A;  4A3G G;  1FKA H;  1HNW L;  3KAL A;  4IRC A;  5DNF A;  1JOK A;  4GLX A;  1UC9 A;  1S40 A;  3DEP A;  5CR3 A;  3GTK A;  4GN3 B;  3MFI A;  3GTJ B;  1R4P B;  1XNQ L;  1D5Z C;  1SRU A;  4K5X A;  4DV4 L;  2EYF A;  1ILQ A;  1EIY B;  2N88 A;  1ESF A;  1SR3 A;  4LF7 Q;  2UU9 L;  3MXU A;  3D4R A;  2KHS A;  4BBS G;  2W6Z A;  1NR2 A;  4ZYS A;  2C35 B;  1E4E B;  3QJY A;  1XXG A;  1HNX H;  4GOP B;  1KDB A;  3H6M A;  3ETJ A;  3EVQ A;  2ZJR A;  1EOV A;  1WSC A;  2FLP A;  1BNZ A;  4WOR A;  2P0A A;  4YR3 A;  2R7L A;  4LFB Q;  1L1O A;  3L3O C;  4NLG A;  2JA8 G;  3I91 A;  1EY0 A;  4DR5 Q;  1J5E H;  1DV1 A;  2EXZ A;  3RJ0 A;  2KHI A;  3JRW A;  5KFC A;  4U68 A;  1KHI A;  1EY6 A;  3PO3 H;  3PQI A;  2UUB H;  2W7O A;  5JEA H;  2VR1 A;  3P7J A;  2XVS A;  4XYO A;  4ED1 A;  4EG0 A;  2W9B A;  4RAY A;  1RCV D;  4V0B A;  1OXV A;  2PQE A;  4QL5 A;  4A3C H;  1YIJ A;  2F4V H;  4I7A A;  2IA6 A;  4QIW B;  3DXJ C;  1K1Q A;  3SHL A;  4DUZ H;  2XGT A;  2CHB D;  2DN8 A;  5ELN A;  4UCO A;  4CDF C;  5D14 A;  5J22 A;  2DNE A;  1LLR D;  3G6X A;  1QCB D;  4KKU A;  4G7H C;  3GTG B;  4B3S Q;  1CQF A;  2ZT9 C;  1OXX K;  4LH6 A;  3GIK A;  1VQ5 A;  4XYM B;  2K33 A;  3RTX A;  2RDJ A;  2BOS A;  4LFB H;  4JBJ A;  4ULL A;  2W9A A;  1EWC A;  3W3A A;  4UCT A;  2A73 B;  2JEI A;  3T13 A;  1S3O A;  1SMY C;  1F9S A;  4HNV A;  2PCF B;  1WVL A;  3M9O B;  3N43 B;  3R2T A;  5EKI A;  3PO2 H;  2GLT A;  3U9O A;  2D2C C;  5M3M H;  5IYB H;  3D6C A;  3UQ8 A;  2YU9 A;  4K8J A;  2FP4 B;  1AN7 A;  4K5V A;  1TWC A;  2UXB H;  4BBS H;  1FR3 A;  5DAU A;  1EY5 A;  4JI0 H;  4LUV A;  1F2M A;  1SE8 A;  2PZT A;  4HJA A;  1O7L A;  1WTP A;  1KNE A;  4C3J H;  1D5X C;  1S97 A;  2K4K A;  4LF5 L;  1XYI A;  2NVY H;  4DU9 A;  5D65 A;  5ELC A;  4PG3 A;  3P1H A;  3V4S A;  4C3J B;  5LXT F;  5FOB B;  2G9D A;  1Y1V G;  4EBC A;  2XNA C;  1TWC H;  1KJ8 A;  2OH2 A;  1IBM Q;  3MWE A;  3TZD A;  5BN4 A;  2YU9 B;  1Q81 C;  4QUC A;  2UVW A;  3OPO A;  5BN5 A;  1U4L A;  5AJ3 Q;  4DV7 L;  1CS0 A;  1NBW A;  2RQX A;  2OCE A;  4A3M G;  3RZD H;  2XIW A;  4IR9 A;  5JJZ A;  1CFM A;  2FB9 A;  2RBM A;  4QQB X;  2UXB Q;  2VQF H;  1PRT F;  2EOT A;  4ECU A;  4C1N K;  3Q24 A;  4HMI A;  1M90 C;  3E5S A;  4IHJ F;  1RK5 A;  1SNC A;  3CW2 C;  4JG2 A;  1LAB A;  3UDI A;  1VQB A;  2A5H A;  1ET9 A;  3J80 c;  3EQL C;  5KFA A;  2DJF C;  3I7F A;  2YTV A;  1JE4 A;  1I4Q A;  3S15 B;  2VA3 A;  5LOV F;  1H9S B;  1K0S A;  4A3J B;  4YAK B;  2F0D A;  2J0T D;  2MCT A;  1IOV A;  4OX9 Q;  3PIO 3;  2MP1 A;  2R8K A;  4CKC A;  5KG1 A;  2NBF A;  3E6Z X;  1N32 H;  1I3Q B;  2F0H A;  4P2C B;  1D7Q A;  2K75 A;  3H3V I;  3T1Y H;  4RH6 A;  1HNZ H;  1SJH D;  1QZG A;  2JA5 H;  2MQH A;  1XMO H;  2JA6 H;  4F4Z A;  2HDL A;  2F0U A;  3AQQ A;  1LTB D;  2WAQ G;  4R8I A;  2ZM6 Q;  2X0S A;  1SE2 A;  5KT6 A;  4X3K A;  1VQP A;  5HBR B;  2L0C A;  3RFC A;  4LUO A;  2DUD A;  4Q45 A;  5E3F A;  2RHQ B;  2TMP A;  4KJO A;  3Q23 A;  4YJ3 F;  2NU9 B;  2VQE H;  1H9S A;  1Q12 A;  4C1N I;  1STH A;  3A55 A;  1CHP D;  3S2H B;  2JA7 B;  4XT1 B;  4OWX B;  1E2Z A;  5M5X B;  3CC4 A;  4DV6 Q;  1EL0 A;  5KFW A;  3VR3 A;  2E5L H;  5KG6 A;  3KF6 B;  2WB1 G;  1I94 H;  3EFX D;  1UE6 A;  2Z6K C;  4DK6 C;  1C0A A;  1K8M A;  4NXN H;  4WJ3 M;  1QB5 D;  1Z47 A;  2ASJ A;  2EVB A;  1F77 A;  5D1O B;  3NQI A;  1EY9 A;  3TS2 A;  4RHR A;  5L1K A;  4KHP H;  5T14 A;  1E7Z A;  4KTA A;  2X69 A;  2UU9 Q;  4I65 A;  2EJM A;  3ER0 A;  5CV7 A;  3CRL C;  3H3V C;  1GHK A;  5BPH A;  4XDX A;  2NZO A;  1B44 D;  4OHJ A;  2YZN A;  1DYQ A;  2KA7 A;  1NE3 A;  4JOI C;  3J81 c;  4M7E A;  2NVX A;  4FF3 A;  2Q8T A;  5C1P A;  2BA1 A;  4IRK A;  4N8X 1;  1FGB D;  4ED2 A;  2E5L Q;  2R7Z B;  3T56 B;  1TWA A;  1HCZ A;  1UEB A;  4HCE A;  3KDF B;  1PYB A;  3HOY H;  5DM7 3;  3KBX A;  4N9P A;  5M5Y H;  2I0Q A;  1O80 A;  4H02 A;  3S9W A;  4DV6 H;  2ASL A;  1W93 A;  3RUZ A;  3JSN A;  5KG7 A;  1AE3 A;  2XWJ B;  1SYD A;  2Q2I A;  3RLF A;  1ENF A;  3V4Z A;  1IYJ B;  3Q0A A;  3A74 A;  4EEY A;  1WD0 A;  2Q8I B;  1X6O A;  5M3F H;  3KBG A;  3K5O A;  4DR2 Q;  3IKJ A;  4XIG S;  3U9S A;  4LF9 L;  3RB4 A;  4O3N A;  1BGW A;  1I5F A;  2NTT A;  4KKT A;  4QIW A;  2J4X A;  5CV5 A;  5FLM G;  1PRT C;  1PRT D;  4IUP A;  3S1Q B;  4A3I G;  1OWT A;  2FPG B;  1B8A A;  4DKA C;  2NYZ D;  1W2B A;  2GA4 B;  4JI1 L;  3CME A;  1IBK H;  1RJT A;  3GTL H;  3EYY A;  1WTR A;  5KT2 A;  3QIA A;  4B3R Q;  2KSW A;  4XT3 B;  4QCL A;  2R93 H;  1B6S A;  3KHG A;  1WR2 A;  1ROD A;  3V96 A;  4UFZ A;  3K7A B;  1WCM A;  5H80 A;  3GTM A;  2KVM A;  2QKI C;  3TQT A;  1CKN A;  3K7A H;  4AQY L;  2R92 B;  5IYD G;  4JI4 L;  3L9A X;  4PQX A;  2RDG A;  2ATW A;  2NU6 B;  4IPD A;  1M0T A;  1A3T A;  2V5A A;  1E24 A;  5L9X A;  2QIL A;  3IL8 A;  3HKZ E;  4IZO A;  2CFM A;  2XSC A;  5FPO A;  2VPQ A;  5CGK A;  2B2Y C;  2IX3 A;  1HH2 P;  4B08 A;  2MPM A;  4RB2 C;  1Z2P X;  2H1E A;  1E1T A;  4YWK A;  4ECQ A;  5IGG A;  4YB8 B;  2R87 A;  3M3Y B;  3V6H A;  3MHB A;  4IUT A;  3VDY A;  4OO1 I;  2C28 A;  1JQY D;  3GQC A;  2Y0S E;  5KFU A;  1RL2 A;  1CKN B;  2F0I A;  3HG9 A;  2R82 A;  2PPB C;  2RF4 A;  3D8G A;  2JEB I;  1S0M A;  4HJ9 A;  4IFD J;  2BQR A;  2HVQ A;  1EY7 A;  2AWN A;  1EIH A;  1K9M C;  4ECT A;  4NP5 A;  1GM5 A;  2OTL A;  4A3F B;  4ILW A;  2LMC B;  2NUC A;  2EYH A;  4ZLT F;  2SCU B;  3I72 A;  3CCR A;  2VXW A;  1KTK A;  5C4X B;  5JVD F;  4UP9 A;  3KJP A;  3BZD B;  1QZH A;  3BG5 A;  1XX8 A;  5C3W A;  3V6K A;  1X3G A;  3TQ1 A;  1N36 H;  3M9M B;  3FKI A;  5LMU L;  1TKW B;  3SI8 A;  2IHF A;  1UC8 A;  1IBM L;  1LTA D;  1W6K A;  4DN4 M;  2XIG A;  2NTS A;  4J6H A;  1V1O A;  1N33 L;  2EY2 A;  5CV4 A;  1SNQ A;  1I4G A;  1JR0 D;  4Q43 A;  1CZW A;  4PZ6 A;  1YNJ D;  3QR8 A;  4GKK L;  4DLK A;  1MGS A;  1WCM G;  3M4P A;  1KD1 C;  2W57 A;  3PCO B;  1HFN A;  5KFM A;  3HZX A;  4DL3 A;  5IT9 c;  2L9H A;  2E2H H;  5T1G A;  1JMC A;  5EPK A;  5C4X G;  4NMZ A;  1EQV A;  1VQ9 A;  4BY7 H;  4JI7 H;  1HR0 H;  3G7L A;  3KLR A;  4NPS A;  4LWC A;  1PH1 A;  2FIN B;  3DHQ A;  4IFD I;  2O5J C;  1EZ6 A;  2VQD A;  4ME5 A;  2UXD H;  4J9K A;  5D3I B;  3WDN A;  3WOE A;  5CV9 A;  1O7Z A;  1HUM A;  3N6R A;  3J7A V;  3NEL A;  4O3O A;  4XYL B;  3N42 B;  5KFF A;  3O13 A;  4IRD A;  4A3D H;  4O3R A;  1CQV A;  2CW8 A;  3PR5 B;  3GV5 B;  4DR5 H;  2CWA A;  3S14 H;  2VOB A;  3CF5 A;  1X3E A;  3A8J E;  5KFO A;  2XC9 A;  3E5N A;  5CBE E;  1LV9 A;  1BKB A;  1VQH A;  2JP1 A;  4Y8V B;  3Q8S B;  3KLW A;  2BQU A;  3HOV B;  4GC7 A;  4DL4 A;  4YQW A;  1CI3 M;  1TWF H;  1AN8 A;  1E2V A;  1Y1W A;  4DR7 L;  1PTO C;  1EQQ A;  5KFH A;  1AH9 A;  1E4G T;  1UNN C;  2WB1 B;  4NXN Q;  5CV6 A;  3IG0 A;  3FMC A;  1Y1W B;  2BR0 A;  1JJC B;  4ZK9 B;  2JA7 A;  4X64 Q;  3OMC A;  3BYT B;  1GUO A;  3S2D B;  5JVL A;  2AMC B;  1TT2 A;  4RFB A;  1TWG A;  4JI3 H;  2VQE Q;  5HGQ A;  3MR2 A;  5GQO A;  2HVR A;  2QW7 A;  4EGJ A;  2Y0S A;  2RSO A;  4ZQI A;  2OQ0 A;  4YY3 L;  1Y8N B;  5IY0 A;  2YV5 A;  3GD7 A;  2EYM A;  1STY A;  5FO7 B;  3A54 A;  4YCV A;  5NUC A;  5KFD A;  5IE8 A;  3LP8 A;  2W9C A;  4FBT A;  5JPN C;  2F0L A;  3GTM H;  2PMZ E;  1TWF A;  4R8N A;  3JAM i;  5DM6 3;  3QO2 A;  3S17 H;  2CVR A;  3BDC A;  3K5M A;  1EYA A;  5C5J A;  5EPJ A;  1XWE A;  2K01 A;  4LF4 L;  4LF9 Q;  3P20 A;  3BJY A;  2EXD A;  1U0L A;  4XZ3 B;  1BBX C;  2NU7 B;  5J2T F;  4CJ1 B;  3I4N G;  4EQ5 A;  1O7Y A;  5CYU A;  4I55 F;  3M4Y A;  5JVG 3;  5JEA J;  5C3E H;  1VQJ A;  4UP7 A;  1PYW D;  1JOO A;  2OTJ A;  4LFC H;  4CDD C;  1KDA A;  5DEH A;  3PUZ A;  4F87 A;  4RGM A;  1NNX A;  2K05 A;  2N78 A;  3GIQ A;  1N34 H;  4YHH L;  3NTH A;  2QA4 A;  4DR3 L;  2QEX A;  1STB A;  4JI5 H;  3A8I E;  5IP7 G;  2GVB A;  4X65 L;  3IN5 A;  3TEH B;  4A93 H;  1JKJ B;  3I56 A;  4H13 C;  4O3S A;  1L1O B;  2PW5 A;  3BU2 A;  4IJL A;  2F0M A;  4MIU A;  1NUC A;  4CDE C;  3SXH A;  4A93 B;  1IYU A;  1VQM A;  2O03 A;  3DLL A;  2R7F A;  4C5A A;  2JA5 B;  4ME3 A;  4NKL A;  1ZYR D;  3I4M G;  3K5L A;  3OYY A;  2IMW P;  1N34 L;  4G3I A;  1KLG D;  1KJQ A;  2AQ3 B;  1SN8 A;  3HOY G;  1Y1V B;  2CH4 A;  4LFC L;  4KHV A;  2C2D A;  1DCZ A;  5GAG C;  5EOY A;  3RB6 A;  5C44 H;  4YWL A;  2KOL A;  2J9G A;  1NCV A;  4DNT B;  3F2U A;  3KAK A;  3N44 B;  3VPD A;  4IFD G;  1QG7 A;  4ECZ A;  2B29 A;  5LA6 F;  3ERS X;  5I9P A;  1S9F A;  4JI8 Q;  4RKB A;  5IGC A;  4EQO A;  4L5Q A;  1EEF D;  4CGY B;  2HCC A;  3GII A;  4JBM A;  4FS1 A;  2E2D C;  1MKH A;  3J80 E;  1H9R A;  1KRS A;  4K14 A;  3NEN A;  4KHZ A;  2W6N A;  4C3I B;  2V58 A;  1AP0 A;  2FHT A;  5I4D A;  2EE1 A;  1H9K A;  1AW7 A;  4DXF A;  4EVO A;  4DAY B;  4ECR A;  1CQJ B;  4ECW A;  4ZQ3 A;  5TSS A;  4LFA Q;  3VR5 A;  3T1H Q;  4A3K B;  4RG1 A;  3DEO A;  1DOL A;  1A2T A;  1A6X A;  4JI3 L;  1UWV A;  2EY5 A;  4WJW A;  4ED6 A;  5IWA Q;  5D1P A;  2D5D A;  4IFD H;  4F88 A;  2K14 A;  2C9O A;  4UHV A;  3HGB A; 
#chains in the Genus database with same CATH homology
 3PO3 H;  1KL9 A;  2ASB A;  1CSQ A;  4DV5 L;  5LMN Q;  3D31 A;  2UUC Q;  5ELO A;  1I50 H;  1OXV A;  3NBH B;  4QL5 A;  3JC6 6;  2MNA A;  1YIJ A;  4A3C H;  2YTX A;  4A76 A;  3G48 A;  2CWP A;  3A5U A;  1YIT A;  3F2C A;  4A3B G;  3I4M H;  2E2J H;  5IYD H;  2NZH A;  2XGT A;  2VQF Q;  4GLA C;  5ELN A;  3S2H H;  4BBR H;  4OWT B;  3TQY A;  3WWV A;  4DUY L;  4MNO A;  4UP8 A;  4DV4 Q;  3D0F A;  4A93 G;  3STB D;  4B3S Q;  2A8V A;  1OXX K;  3AFQ A;  5IP7 H;  1VQ5 A;  3RLN A;  4P71 A;  4GOP C;  3PUY A;  3CQZ H;  4L5T A;  4JBJ A;  4AYB G;  5GAD C;  1PH8 A;  4LF5 Q;  2RCN A;  3PUW A;  4NXM L;  1XNR Q;  1A63 A;  1HZA A;  2JA7 H;  5HY6 A;  4DUZ L;  3CCV A;  3HFZ B;  2KBN A;  2L15 A;  1N36 Q;  3HOV G;  3E0E A;  2EIF A;  1YJ9 A;  5C3E G;  1HR0 L;  1S3O A;  4MTN A;  2NVX H;  2VY3 A;  3PUX A;  2F3I A;  1CKM A;  4A75 A;  1MJE A;  3PO2 H;  1A62 A;  1QVG A;  1FJG L;  4BXX H;  5M3M H;  5IYB H;  5GAE C;  4DV2 Q;  1Y1V H;  2GVA A;  4JI0 L;  2ZTD A;  2BH8 A;  4P74 A;  4X66 L;  4BBS H;  2UXB L;  1CKO A;  1HZ9 A;  4LUV A;  1SE8 A;  4UPA A;  3TRZ A;  3CXC A;  1VQE A;  3PIO A;  5E7N A;  4HJA A;  1PV4 A;  1X9N A;  4A3E G;  1EQR A;  4C3J H;  4MZ9 A;  2K4K A;  5FJ8 G;  4LF5 L;  1SMX A;  2N3S A;  2NVY H;  4TVA B;  1QUQ A;  3GTJ H;  2FXQ A;  4KI0 A;  1TWG H;  2BA0 A;  4OXP A;  4PG3 A;  3PF4 A;  2F52 A;  2MFI A;  1IZ6 A;  4AIM A;  4AH6 A;  5C44 G;  2Z6K A;  5LMU Q;  1OTC A;  3K7U C;  1Y1V G;  1TWC H;  1IBM Q;  1EYG A;  4BXX G;  1VQ7 A;  4IOC A;  1Q46 A;  1Q81 C;  1NTG A;  4UY8 C;  5AJ3 Q;  4DV7 L;  1FJG Q;  1NBW A;  3RZD H;  2OCE A;  4A3M G;  1Y1W H;  1VQK A;  4LNQ A;  3UDF A;  2KHJ A;  3HOX G;  4GS3 A;  3PV0 A;  2UXD Q;  4QQB X;  4A3M H;  4X62 Q;  1J6Q A;  4C3I H;  3G4S A;  4GKK Q;  5EAY A;  2UXB Q;  4WJ4 A;  3UDX A;  1M90 C;  1EWI A;  3W1B A;  4YY3 Q;  3CW2 C;  3CCE A;  2UUA L;  2AHO B;  4JG2 A;  1HR0 Q;  3ULP A;  3U58 A;  3UDI A;  4Y7N H;  1VQB A;  3CP0 A;  3J80 c;  3UDG A;  4JI2 L;  5J3B A;  4EX5 A;  3M85 A;  4R4O A;  1UE5 A;  5LMN W;  3PUV A;  1Q82 C;  1KXL A;  2YTV A;  2K5H A;  2KEN A;  2I5M X;  3I7F A;  1EFW A;  4DV6 L;  5GAH C;  3RN2 A;  4IPH A;  2UUB L;  3G71 A;  3M9B A;  3TRE A;  2UXC L;  3MXN B;  4P75 A;  1VQN A;  1HNZ Q;  4OX9 Q;  4DV0 L;  2JE6 I;  3OTO Q;  1D7Q A;  2I5H A;  2K75 A;  1Y1W G;  3H3V I;  3CMA A;  5H1S E;  5BR8 L;  3CCQ A;  1QZG A;  2JA5 H;  4HJ8 A;  1GD7 A;  4GOP A;  1CSP A;  2MQH A;  3F2D A;  4B3M Q;  2JA6 H;  1KIX A;  3AQQ A;  2ZM6 Q;  2WAQ G;  1G6P A;  1GO3 E;  5JEA G;  1NY4 A;  1VQP A;  3I55 A;  4DNI A;  4LUO A;  2DUD A;  1K0R A;  1YBY A;  1N34 Q;  3S24 A;  1N8R C;  3S1M H;  4YHH Q;  2RHQ B;  3IRB A;  4NB3 A;  5IYC H;  2KCT A;  1Q12 A;  3H3V H;  4KHP L;  1SRO A;  1VQA A;  4OWX B;  2Q2H A;  4OON A;  4JCV E;  3CC4 A;  4DV6 Q;  2JA8 H;  3J81 i;  1EIF A;  2VS1 A;  3HOU H;  4A3L G;  3KF6 B;  2LSS A;  2VW9 A;  2WB1 G;  1UE6 A;  2AKW B;  1E3P A;  2Z6K C;  4NXN L;  4DK6 C;  3AYH B;  1C0A A;  4WJ3 M;  1WOC A;  3E9H A;  2KCM A;  1MIU A;  1M1K C;  1Z47 A;  1LYL A;  3HKS A;  1XJV A;  3TS2 A;  1L0W A;  1Q7Y C;  1KAW A;  1IL2 A;  2WAQ E;  1E7Z A;  3CPF A;  2UU9 Q;  1QVC A;  3ER0 A;  4P73 A;  4A3B H;  3F1Z A;  2YU9 H;  2NZO A;  1JT8 A;  1X55 A;  3GTQ H;  4B3R L;  1A8V A;  1Q8K A;  4JOI C;  1NE3 A;  2HIV A;  2ZTC A;  3J81 c;  1V1Q A;  1YI2 A;  1HNZ L;  4OX9 L;  2R93 G;  2BA1 A;  4A3G H;  4DPG A;  4JC0 A;  2PI2 E;  1PH4 A;  3OTO L;  2JA9 A;  1N32 L;  4PZ8 A;  3M4O H;  1UE7 A;  3ULL A;  4HIK A;  2Q2U A;  2E5L Q;  1UEB A;  2WFW A;  3KDF B;  1PYB A;  1O7I A;  4A3D G;  3HOY H;  1HJP A;  2JJQ A;  2ZJQ A;  5FJ8 H;  3S2D H;  4JI5 L;  2E8G A;  5M5Y H;  2I0Q A;  3I4O A;  4H02 A;  1BBU A;  4A3E H;  1TWH H;  1XMQ L;  1I6H H;  3S15 H;  2B63 H;  3KF6 A;  5DLQ E;  3CCJ A;  4JI7 Q;  1AE3 A;  4BA1 I;  2Q2I A;  3T1H L;  3RLF A;  3UE1 A;  3JAM c;  1IYJ B;  4R4Q A;  2JEA I;  3A74 A;  2VUM H;  3BZK A;  4QY7 A;  4YCW A;  1C9O A;  3CD6 A;  4A3C G;  1X6O A;  4QGU A;  4AQY Q;  1XTD A;  1OXU A;  5M3F H;  4OO1 G;  1PH5 A;  3K8A A;  3H0G H;  1I3Q H;  4DR2 Q;  3PO2 G;  4JI4 Q;  1L2F A;  4XIG S;  3J81 j;  2CCZ A;  4LF9 L;  2HT1 A;  3PO3 G;  1YHA A;  3FKI G;  1GKH A;  4GLV B;  2D0O A;  3UE0 A;  3GTG H;  2YYZ A;  1C7Y A;  4DR6 L;  1HZC A;  1VQF A;  1I5F A;  1I94 L;  2R92 H;  3H15 A;  5FLM G;  1PH6 A;  5C0X J;  2E5L L;  4A3I G;  4B3S L;  4XTC S;  2IX1 A;  1B8A A;  4PZ7 A;  4DKA C;  1PH7 A;  4HJ5 A;  4IPC A;  1W2B A;  3L2P A;  1IBL L;  4JI1 L;  3CME A;  1AE2 A;  4NXM Q;  1XNR L;  1YJN A;  1TWA H;  3GTL H;  1A0I A;  3LGJ A;  3GO5 A;  1V9P A;  4DUZ Q;  1NJI C;  1VQD A;  4LF8 Q;  2A19 A;  4B3R Q;  4DR3 Q;  4O2D A;  2R93 H;  3S1N H;  1DGS A;  1NMG A;  4ALP A;  3K80 C;  4BBR G;  2F4V Q;  4POF A;  3HKZ G;  4GNX B;  3OW2 A;  4GN4 B;  3CCS A;  4A3K G;  1KQS A;  3T1Y L;  1CKN A;  3K7A H;  4AQY L;  4BA2 I;  5IYD G;  3S1Q H;  3EN2 A;  3DM3 A;  3J80 i;  4DR2 L;  1ASY A;  4JI4 L;  5IP9 G;  3H0G G;  1XPO A;  2ATW A;  1WFQ A;  4IPD A;  3FP9 A;  1E24 A;  5M5X H;  2R7Z G;  4AYB E;  2HQL A;  4K0K L;  3HKZ E;  1U5K A;  4HIO A;  1OXS C;  2CFM A;  2HIX A;  1WJJ A;  4JBW A;  4Y52 H;  1HH2 P;  4DV1 Q;  2VL6 A;  4YWM A;  1IBL Q;  4RMF A;  3HOZ H;  1YHB A;  1E1T A;  4YWK A;  3KOJ A;  3VDY A;  4OO1 I;  2CKZ B;  1HNW Q;  1HNX Q;  4JI6 Q;  2Y0S E;  5IYC G;  1R9T H;  4LFB L;  4L5R C;  2R92 G;  1RL2 A;  1CKN B;  4GN5 A;  1VQ6 A;  1QUQ B;  2RF4 A;  4GNX C;  2JEB I;  2K52 A;  4X66 Q;  4HJ9 A;  4DK3 C;  3PF5 A;  1I94 Q;  4JI3 Q;  1Y14 B;  3I4N H;  4IFD J;  2AWN A;  2CQO A;  1K9M C;  2K50 A;  3RZO H;  2WB1 E;  3F8T A;  1GM5 A;  3J7Z C;  2OTL A;  1VQ8 A;  2N49 A;  4LF7 L;  1VQC A;  2BH2 A;  3CCR A;  2UXD L;  1VQG A;  1B70 B;  4X62 L;  2MO1 A;  2N8N A;  1B7Y B;  2IX0 A;  3K0X A;  4R4T A;  4UP9 A;  3KJP A;  1XPR A;  1QZH A;  1VQL A;  4APV A;  4BY1 G;  1X3G A;  2PI2 A;  2UUC L;  4FDB A;  2EQS A;  5LMU L;  5JJL A;  2IHF A;  2F4V L;  4JI2 Q;  3ICE A;  1IBM L;  3I2Z A;  5IWA L;  4QIW E;  2Y0S G;  3PGZ A;  3CC7 A;  4TQU S;  1N33 L;  3SGI A;  2YTY A;  1FGU A;  4JI6 L;  4DV3 L;  4B3T L;  2ALY B;  3F2B A;  2D0P A;  1PFS A;  4A3F H;  4PZ6 A;  3CC2 A;  3B6Y A;  2NVT H;  1PVO A;  4DUY Q;  2V1C C;  4GKK L;  1WCM G;  3M4P A;  4K0K Q;  4A4I A;  2D62 A;  3RLO A;  3TS0 A;  1PA6 A;  1KD1 C;  3AEV A;  1LUZ A;  4X64 L;  2PQA B;  1Z9F A;  3PCO B;  2UUA Q;  3M4Q A;  3ULJ A;  4JBK A;  1X56 A;  4DV1 L;  4HIM A;  1JJG A;  3L0O A;  3MEF A;  5IT9 c;  2E2H H;  1JMC A;  2NN6 G;  3EBE A;  5C4X G;  1G51 A;  4B3M L;  1BVS A;  1VQ9 A;  3Q8D A;  2ZM6 L;  1V43 A;  1K83 H;  3RN5 A;  4BY7 H;  4NPS A;  5M3F G;  1D8L A;  4LWC A;  3U4Z A;  1PH1 A;  1N36 L;  1HNX L;  1L1O C;  2UUB Q;  2QGQ A;  2VUM G;  3KFU A;  4A3J H;  4QJF A;  1IBK Q;  4LF6 L;  4IFD I;  3GDE A;  4PMW A;  4JOI A;  2UXC Q;  4DAM A;  3U4V A;  3EIV A;  1KRT A;  4R4C A;  2LXK A;  1N33 Q;  4A3L H;  3U50 C;  3CCU A;  1J5E Q;  3PIP A;  1Q1E A;  2RHS B;  3KJO A;  4JYA L;  2MO0 A;  2PQA A;  1IXR A;  2Z0S A;  3NEL A;  3J7A 5;  4A3D H;  4BY1 H;  2CWA A;  3S14 H;  1NMF A;  1CUK A;  5JJI A;  3M3Y H;  3CF5 A;  2E2I H;  1X3E A;  2WP8 J;  5FLX c;  1Q1B A;  1PH2 A;  3FHW A;  1BKB A;  1VQH A;  2H5X A;  5M3M G;  1N9W A;  5IYB G;  1X3F A;  2JA6 G;  4GKJ Q;  3STB C;  3KLW A;  2DGY A;  1TWF H;  4J15 A;  1W3S A;  1YNX A;  3BJU A;  4DV3 Q;  4B3T Q;  1G29 1;  4DV2 L;  1EQQ A;  4DR7 L;  1LM0 A;  3HOX H;  4JI0 Q;  1AH9 A;  4NXN Q;  1RIP A;  2A1A A;  4X65 Q;  1JJC B;  4IO9 A;  2XTI A;  1VQO A;  2VNU D;  1EUJ A;  3BZC A;  4X64 Q;  1T9H A;  2GN5 A;  3AFP A;  1PHJ A;  1J5E L;  1E22 A;  4A3F G;  1YJW A;  2AMC B;  4JYA Q;  4YCU A;  4L5S A;  2VQE Q;  2IHE A;  5HGQ A;  5GQO A;  2ID0 A;  5JJK A;  1K73 C;  4KLK A;  2VZA A;  1FL0 A;  4X6A H;  2OQ0 A;  4IJH A;  2JQO A;  4YY3 L;  2R7Z H;  5IY0 A;  1X65 A;  2YV5 A;  3GD7 A;  1PH9 A;  1HR0 W;  1BBW A;  2Q2T A;  3CCL A;  1P8L A;  4GNX A;  1Q86 C;  5GRO A;  2I5L X;  1WI5 A;  4YCV A;  1IBK L;  4LF6 Q;  2IY5 B;  4GKJ L;  5C4X H;  3PSI A;  5IE8 A;  1TXY A;  3ZJY C;  3NEM A;  5AJ3 L;  4DV7 Q;  2PMZ E;  1VQ4 A;  4A3K H;  3GTM H;  4DR7 Q;  3JAM i;  3K81 C;  3S17 H;  4DR6 Q;  1WCM H;  4R1J A;  3S1R H;  1SFO H;  4LF9 Q;  2ZJP A;  4LF4 L;  4DV0 Q;  1YZ6 A;  1VCI A;  5C0X G;  2PNH A;  1PYS B;  1U0L A;  2EXD A;  3A5Z B;  2JA5 G;  4JI5 Q;  1MJC A;  1XNQ Q;  1VS0 A;  1XMQ Q;  4OWW B;  3I4N G;  4EQ5 A;  2R6G A;  3W1G A;  5BR8 Q;  2NVQ H;  4DR1 Q;  5JEA J;  2OWO A;  5C3E H;  2VQE L;  1VQJ A;  4UP7 A;  2OTJ A;  5K36 G;  4LFC Q;  4JI1 Q;  5M5W H;  3E9I A;  1KC8 C;  3PUZ A;  4LF8 L;  2N78 A;  4LUZ A;  1P16 A;  2HHH Q;  4DR4 Q;  4YHH L;  2QA4 A;  4DR3 L;  1YEZ A;  2QEX A;  4JV5 Q;  4LFA L;  5IP7 G;  2AWO A;  2GVB A;  4X65 L;  1XMO Q;  4A3J G;  3TEH B;  4A93 H;  4IOA A;  3I56 A;  3KF8 B;  4IPG A;  3T1Y Q;  1L1O B;  3BU2 A;  4IJL A;  1E1O A;  4POG A;  4P72 A;  3CAM A;  1FVI A;  3S16 H;  1VQI A;  5IP9 H;  1VQM A;  1JB7 A;  3W5O A;  4BY7 G;  3DLL A;  1K3R A;  2OQK A;  2R7F A;  4LF4 Q;  1YVC A;  3KDF A;  2ES2 A;  4ME3 A;  2B63 G;  3GTK H;  4C3H H;  3I4M G;  1JJ2 A;  1X54 A;  3OYY A;  4LW1 A;  1S72 A;  1N34 L;  1LTL A;  3HOW H;  3RR5 A;  3HOV H;  4DV5 Q;  4HID A;  3M7N A;  5LMN L;  3GTP H;  1SN8 A;  4DR1 L;  3HOY G;  3L7Z C;  4KHP Q;  2JA7 G;  4LFC L;  1OXT A;  4O0A A;  1HZB A;  3HOZ G;  5GAG C;  5C44 H;  2JK8 A;  1PH3 A;  4YWL A;  1GVP A;  4DR5 L;  3G6E A;  4A3G G;  3CPW A;  1HNW L;  2VQF L;  4IFD G;  4GLX A;  2B29 A;  3ERS X;  2K5V A;  1K8G A;  1S40 A;  4JI8 Q;  5C0X I;  1UE1 A;  4GN3 B;  5C4J H;  3HOW G;  4L5Q A;  1XNQ L;  4R4I A;  1SRU A;  3GTO H;  4JBM A;  4DV4 L;  1MKH A;  3FKI H;  1EIY B;  2B3G A;  1KRS A;  3A0J A;  3NEN A;  1SR3 A;  4LF7 Q;  1H95 A;  4KHZ A;  2UU9 L;  4BBS G;  4HJ7 A;  2K5N A;  2C35 B;  1K8A C;  4GOP B;  2LXJ A;  2ZJR A;  1EOV A;  4DAY B;  2HHH L;  2ZTE A;  1SLJ A;  4JI7 L;  4DR4 L;  2IT1 A;  4JV5 L;  4LFA Q;  4C2M H;  3T1H Q;  4LFB Q;  4RG1 A;  1XPU A;  1L1O A;  3KYH C;  1XMO L;  4JI3 L;  3HOU G;  1UWV A;  2NN6 I;  1JE5 A;  1N32 Q;  2JA8 G;  4DR5 Q;  1WYD A;  5IWA Q;  3CCM A;  1YHQ A;  4A3I H;  1QVF A;  3RNU A;  5FLM H;  2KHI A;  1ASZ A;  4JI8 L;  2K14 A;  1KHI A;  2R7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...