1Y14B

Crystal structure of yeast subcomplex of rpb4 and rpb7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
154
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNASYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Complete RNA Polymerase II and Its Subcomplex, Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II 32 kDa polypeptide
total genus 28
structure length 154
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y14B02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y14B01
2JA9A 4RG1A 3I4NH 2CQOA 4GNXB 2B3GA 3F1ZA 2E5LL 4A3CH 4LF6L 1Y1WH 3IRBA 2WAQG 3S1MH 4DV6Q 2QEXA 3T1HL 1QUQA 4PMWA 2VW9A 2JK8A 1S40A 2VUMH 1VQHA 1SROA 2RCNA 1KD1C 4GNXC 4NXML 1D7QA 1GO3E 1IBLQ 4IFDG 4OO1G 5J3BA 5IYCH 3RZOH 2UUAQ 4OONA 1AE3A 1P16A 2N8NA 1EWIA 3PUXA 1V9PA 4DUYQ 2ID0A 5JEAG 1LYLA 3TS0A 2E2JH 4JC0A 2I0QA 2HT1A 4JV5L 4LF6Q 1H95A 4BBSG 3TRZA 1CSQA 1OXTA 2PMZE 1IBML 2K4KA 4DNIA 5IYCG 3HOYH 2YV5A 5FLXc 4DUZQ 4OX9L 1W3SA 4DV4L 3UDIA 5M5YH 5GAHC 3CPFA 4DR2Q 1XMOQ 4DV5L 3RLOA 1IBMQ 3E9HA 3M7NA 3T1HQ 1TWGH 2FXQA 1XNRL 3CMAA 3RN5A 1YVCA 1QVGA 2NVXH 1KQSA 2A8VA 5AJ3Q 2VQEQ 1IBKL 1N32Q 4DV0Q 1PV4A 1N34L 3KJOA 1XMOL 4C3HH 3M4PA 3F2DA 1XTDA 4DV2L 4DR7L 2OQ0A 2E8GA 3AFQA 4GOPB 2ES2A 2A1AA 2QGQA 2JA7G 1PYSB 1VQFA 2AWNA 4JI4L 4OX9Q 3M3YH 1CKMA 5FLMG 4P72A 1BKBA 2YTVA 4JG2A 3GTJH 3HOWH 2ZTEA 3CC7A 1IBKQ 4LF9L 1K9MC 4KHPQ 1E24A 1XNQQ 4B3SQ 3EIVA 4YY3Q 4LF4L 1QVCA 2JA5H 4DAYB 1CKNA 4MZ9A 4QIWE 4NXNL 1Q8KA 3KFUA 1U5KA 4YHHQ 3FHWA 3HOZH 2PI2A 4JCVE 4JBMA 1NBWA 3H0GH 3CCJA 1V43A 1VQJA 4R4TA 4JI1L 4DV0L 1YEZA 5C0XJ 1I50H 2D62A 4B3TQ 1S72A 1HH2P 1WJJA 3A0JA 2H5XA 4PZ6A 5C0XG 4HIKA 4GNXA 1HNZL 2JA5G 4POGA 2F4VQ 2UXCQ 1SE8A 1X3GA 4UP9A 5IP7G 3U50C 1FGUA 4P73A 5IY0A 4A3KH 1VQ9A 1KAWA 3CQZH 3M4QA 4JI6Q 2ZTCA 3HKSA 5ELOA 2Z6KA 1SLJA 2R92H 4A3DH 1B8AA 2I5MX 1PVOA 2JEBI 1XNQL 3RZDH 2LSSA 5IP7H 4B3SL 4B3RQ 1Y1VG 4GKKQ 1V1QA 1VQ7A 1OXVA 3CCRA 4DV6L 2VQFQ 1FL0A 1KL9A 3T1YL 1YNXA 2BA0A 2WFWA 3TREA 3A5UA 2JA7H 4IPGA 3S15H 5C4XG 2ZJRA 2E5LQ 3CD6A 3W5OA 1SFOH 3GO5A 2JJQA 4IOAA 4X66Q 2NZHA 3B6YA 2F3IA 5HY6A 2QA4A 1QZGA 4LF7Q 2JE6I 1N33L 3M85A 1E1TA 3M4OH 4OWXB 4NXMQ 1YHBA 1W2BA 2I5HA 3KLWA 3S14H 2MQHA 1XPOA 5BR8Q 4JYAL 3KDFB 1J6QA 2NVQH 1L1OA 3HOYG 4DR2L 3CCQA 2VZAA 2Q2IA 4R4IA 5IP9H 2HHHQ 3ULLA 2Y0SG 3K7AH 4DUZL 1VQPA 1N36Q 4O2DA 3KF8B 4X64L 4DV1L 2EIFA 1I5FA 1XMQL 1TWHH 2VQEL 4P75A 3J7A5 3CMEA 4GLVB 2JA6H 5GAEC 4JI5Q 4JI0L 3RLFA 1N33Q 3HKZG 1L1OB 5IWAQ 4BXXG 3PUYA 3I2ZA 4UPAA 4R4CA 5AJ3L 1YJNA 3S17H 4BBRG 3PIPA 3BZCA 4WJ3M 4A3MH 4A3EG 3DM3A 1VQDA 1RIPA 1HNWL 4LFAL 4HIOA 2WB1G 1HNXL 2ZJQA 2NVYH 4LF5Q 4LFBQ 1WI5A 3UE0A 1WFQA 1UE5A 4IPHA 1Z9FA 4A3IH 2UUCL 2R7ZH 3MEFA 1N36L 4JI4Q 3CCSA 4A3LG 1PH9A 5M5XH 3I4OA 4DPGA 3CP0A 4H02A 1X55A 3PO2G 3FP9A 4OWTB 2UUAL 1P8LA 3CAMA 3UDXA 4POFA 2MNAA 1G291 4A3IG 3RN2A 1GM5A 3TS2A 4DV4Q 4OWWB 3Q8DA 4L5TA 3I55A 1EYGA 3I4NG 2Z0SA 1HJPA 1M1KC 4K0KL 4A3FG 2NZOA 3PO2H 4GN3B 1XPUA 4WJ4A 1X65A 2CWPA 1Y1VH 3F8TA 4IJHA 3STBC 3AYHB 4YHHL 4DV7Q 4JI1Q 5M3FG 2R7FA 4JI3L 2UXDQ 1WCMG 5DLQE 4Y52H 4JI2L 3E0EA 2K14A 4JOIA 1KHIA 5LMNQ 5C4XH 4BY7H 2UUCQ 5IYBG 4JBJA 5HGQA 2B63H 2D0OA 4YCVA 4R4QA 3D0FA 2PQAB 1HR0W 3KYHC 2KCMA 5M5WH 3S1QH 1OXUA 1UE1A 4LF8L 4BBSH 4NPSA 3T1YQ 1OXXK 4JI8Q 1MKHA 1YHAA 3SGIA 2Q2TA 4IO9A 2UU9L 1NY4A 3RR5A 1X6OA 3J81i 2R93G 1TWCH 1E22A 3NELA 4KHPL 5IT9c 2I5LX 4BA1I 3A5ZB 1QZHA 2PI2E 3TQYA 3KF6A 4LF4Q 3GTLH 2R7ZG 1QUQB 4HJ9A 3S1RH 4UY8C 2PQAA 5ELNA 4HJ7A 3S2HH 3STBD 4LWCA 1EIFA 4DK3C 4KHZA 3UE1A 2HIXA 4A93G 1VCIA 3F2CA 1Q81C 4HJ8A 2JQOA 1K8GA 1M90C 2RF4A 1VS0A 5IE8A 3I4MH 1X56A 2HHHL 3MXNB 2E2IH 1C9OA 1Q1BA 2V1CC 1CUKA 3I7FA 4GN5A 2K75A 4PZ7A 4TQUS 5FLMH 1MJEA 4JI8L 2KBNA 3U4VA 4C3IH 1EIYB 1NMFA 1FJGL 4DV3Q 5IP9G 1YJWA 3ERSX 3PIOA 2KHJA 4DUYL 2K5NA 4Y7NH 1CSPA 2NN6I 3PUZA 4BY7G 2NN6G 2Z6KC 1KRSA 5IWAL 1PH7A 3KOJA 1BBWA 4LUVA 2K52A 2JA8G 2K50A 1A8VA 4DK6C 1B7YB 3HFZB 5C44H 4YWMA 1YITA 4A3GH 4JV5Q 1OXSC 2KCTA 4QJFA 1ASYA 2UUBL 3H3VH 4LF5L 1R9TH 3HOXH 1VQCA 4QY7A 2AHOB 1VQMA 1Q12A 1GD7A 4AYBG 4BBRH 4HIDA 1Z47A 4B3ML 4A3MG 1YJ9A 2DGYA 4YCWA 1Q82C 4LFCQ 2R92G 4DR3L 3HOUG 4A3DG 2VL6A 1Q7YC 1IL2A 1KXLA 1PH4A 1Q86C 2CWAA 3W1GA 4A3KG 4O0AA 1N32L 1B70B 1X54A 3HOVG 3PUWA 1XNRQ 1HR0L 3ZJYC 1KC8C 5K36G 1BVSA 1UWVA 4C3JH 3CW2C 3M9BA 4K0KQ 1OTCA 2VNUD 2IX0A 4GKJL 1L2FA 3H15A 4A75A 1FVIA 1JJGA 5IYDH 1NMGA 5JJIA 4R1JA 1Q1EA 4ALPA 4JI3Q 2OTJA 2UXDL 1EUJA 3J80c 2UXBL 4JI2Q 1YIJA 4AQYL 1VQLA 1VQEA 3L0OA 5C3EH 1U0LA 3JAMc 1JMCA 1VQGA 1YHQA 1GKHA 2L15A 4KLKA 5C0XI 1X9NA 5LMUQ 4YY3L 4IFDJ 1JJ2A 2EQSA 1VQAA 3UDGA 4OXPA 4GKJQ 4LW1A 4GOPC 3PF4A 4HJAA 2B63G 3CF5A 1X3EA 5C44G 4A3GG 5GQOA 1JJCB 1HNXQ 4B3TL 3GTPH 1I6HH 1LM0A 5JJLA 3VDYA 1ASZA 3NENA 4MTNA 4FDBA 1PH3A 2ALYB 4UP7A 2LXJA 2N49A 4R4OA 2HQLA 3BU2A 4A3JH 4IFDI 4OO1I 1IZ6A 1QVFA 3CC2A 1HZBA 4LFAQ 5EAYA 1PH5A 3G71A 2Q2UA 3LGJA 3HOVH 1VQ5A 4A3JG 3KF6B 5LMUL 4A76A 4DV2Q 3GTMH 2XTIA 3GTQH 3KDFA 1VQ6A 4PG3A 1VQIA 2F52A 3CCUA 3EN2A 4C2MH 1Q46A 4JBKA 1KRTA 1NTGA 1E1OA 1DGSA 2K5HA 2OCEA 3K7UC 1PHJA 4UP8A 2IHEA 1VQNA 4IJLA 4X62L 4XIGS 3S24A 2IX1A 1IXRA 1HZCA 1D8LA 5IYBH 4DR4Q 5JJKA 4DR5L 2AMCB 4JOIC 1EFWA 3HOZG 1GVPA 3CCEA 4HJ5A 1CKOA 1WOCA 3HOXG 3CCVA 1VQOA 3CXCA 1LUZA 2B29A 4GLAC 3HOUH 1T9HA 4YCUA 1K73C 2CCZA 4QL5A 2UU9Q 2ZM6Q 2VY3A 3ICEA 2AKWB 4X62Q 2A19A 2MFIA 2GVAA 2OQKA 2KENA 5H1SE 5BR8L 1N8RC 1PA6A 4B3MQ 1NJIC 4DV1Q 4X64Q 1IBLL 3JC66 1UE6A 3K81C 4A3CG 3PGZA 5C4JH 1BBUA 1WCMH 4A93H 2UXCL 4JI5L 4YWKA 3I56A 3RNUA 2YTXA 2VUMG 5JEAJ 4A3BG 3OW2A 1PH1A 1HZAA 1NE3A 2K5VA 1SR3A 3PCOB 3AFPA 3G48A 4JBWA 1XPRA 1G6PA 2ZJPA 2WAQE 5FJ8G 1HR0Q 4A3BH 4J15A 3J81c 4PZ8A 4GOPA 3CCMA 2YU9H 4DV5Q 1PH6A 3CC4A 3PSIA 5M3MH 4X65Q 1I94Q 5IYDG 1A0IA 1PH8A 4L5QA 1N9WA 3GD7A 4LUOA 3AQQA 1L1OC 1EQRA 3E9IA 1FJGQ 1K3RA 3DLLA 5C3EG 4DV3L 4APVA 4AYBE 4GLXA 1PFSA 2Y0SE 3OTOQ 2GVBA 4NB3A 1IYJB 2WP8J 2Q2HA 3S16H 4A3EH 4DR1L 4JI7L 1MJCA 1YZ6A 2C35B 1TWAH 3G4SA 3NEMA 3H3VI 3K80C 1CKNB 4DR7Q 4X65L 3F2BA 1JB7A 1K0RA 1X3FA 4MNOA 1E3PA 3HKZE 3I4MG 2WB1E 4JYAQ 1C0AA 2ATWA 1A63A 1XMQQ 1VQKA 2MO1A 1HZ9A 5GROA 2ASBA 2JA6G 4IPCA 1N34Q 1TWFH 3GTGH 3FKIH 1RL2A 4JI7Q 5LMNL 1TXYA 2ZTDA 3UDFA 3U4ZA 3GTOH 4GN4B 3L2PA 1XJVA 3L7ZC 2CKZB 2YTYA 5E7NA 2JA8H 2IT1A 4DR3Q 2R6GA 2VS1A 3A74A 4NXNQ 3HOWG 1K8AC 4LF8Q 1J5EQ 2LXKA 5M3FH 4DR6L 2PNHA 4X6AH 2IY5B 2BA1A 1L0WA 2JEAI 4JI0Q 3GTKH 2KHIA 2HIVA 3GDEA 2GN5A 3NBHB 4AH6A 4LNQA 2N78A 4BY1G 4LFBL 3BJUA 1MIUA 3PUVA 1A62A 1E7ZA 2MO0A 1EQQA 2N3SA 1G51A 3PO3G 3BZKA 1K83H 1C7YA 1YI2A 2BH8A 2UXBQ 4AIMA 4BY1H 1S3OA 3WWVA 4AQYQ 1J5EL 4L5SA 4IPDA 3U58A 4IOCA 2E2HH 4A3FH 1EOVA 2F4VL 4QGUA 4HIMA 3W1BA 2CFMA 4GS3A 4EX5A 2NVTH 4KI0A 2IHFA 2VQFL 3S1NH 2DUDA 3S2DH 2BH2A 4DR6Q 1LTLA 1VQ4A 1YBYA 4GKKL 3J80i 1Y1WG 3AEVA 1JT8A 3PF5A 1HNWQ 3ULPA 4P74A 4DAMA 3JAMi 2RHSB 4QQBX 3ULJA 4ME3A 1UE7A 4EQ5A 2RHQB 4DV7L 3D31A 1UEBA 1AE2A 1JE5A 3EBEA 5M3MG 4DKAC 1AH9A 1Y14B 2OWOA 4LF9Q 1I3QH 4BA2I 2R93H 4BXXH 3K8AA 4YWLA 4X66L 3KJPA 3H0GG 1PYBA 4LF7L 1SRUA 2OTLA 3J81j 1O7IA 5GADC 3G6EA 4P71A 4DR4L 5FJ8H 4DR5Q 3CPWA 2XGTA 3PO3H 5GAGC 1SMXA 2EXDA 3J7ZC 4LUZA 4XTCS 3TEHB 5LMNW 3CCLA 1SN8A 1WYDA 3RLNA 3K0XA 3OTOL 2YYZA 3ER0A 4TVAB 4A4IA 2D0PA 1HNZQ 2AWOA 1VQ8A 2UUBQ 4A3LH 4DR1Q 4B3RL 1I94L 3OYYA 2ZM6L 4L5RC 1PH2A 3PV0A 2R7DA 3FKIG 1VQBA 4LFCL 4RMFA 1KIXA 4JI6L
chains in the Genus database with same CATH superfamily
5J1ZA 5FD6A 1U9RA 5KFEA 4DL6A 1GUGA 3IRBA 5CAEB 4DV6Q 5K2MA 1QUQA 5K36H 2VW9A 1S5FD 2JK8A 4FU0A 2ZDQA 1KD1C 2NU7B 5CV9A 1BUVT 1S4ZA 5C44B 3CHBD 2IW3A 4OONA 1P16A 2XN9C 1EWIA 3BZDB 4UDUC 3SEBA 4DUYQ 1LYLA 3D6CA 4JV5L 4MTKA 5BN3A 3TRZA 1OXTA 3MR3A 2K4KA 5NUCA 4DNIA 5C4JB 3HOYH 3OIPA 5FLXc 5L1IA 1NSNS 1BOSA 5LOVF 3MFYA 4DV4L 4ETSA 5GAHC 4A3JB 2XCLA 2XC9A 2E76C 1XMOQ 2D2CC 1PZID 2K5WA 3M7NA 1SJED 2DY7A 1GSAA 1BO0A 1TWGH 3CMAA 2EY1A 3A7LA 2UVVA 3MC0B 4UFZA 2YU9B 3GQCA 1XMOH 3J7AV 3T5HA 5AJ3Q 2VQEQ 1UC8A 4LMQD 4BWSC 3J7AF 5EPKA 2NVYB 3HS0C 3H3VC 5KFMA 1PV4A 1TS5A 3HRZC 4EQPA 2PZTA 4DV2L 3F2DA 1XMOL 2C2EA 4DR7L 4O3QA 1PYSB 4JI4L 2VUGA 1CM9A 1EQTA 3S15B 4RNMA 3MWEA 3GTJH 2WE6A 2FKLA 3HOWH 4DV2H 1N56A 4C3HG 2ICEC 2ZTEA 2IPKD 4LF9L 1K9MC 1E24A 4EGVA 4YHHH 3EIVA 5FO7B 2KEEA 1QVCA 3P1HA 2JA5H 5FKAC 4QIWE 1GXDC 3X3NA 1SFOB 1STYA 1NBWA 3H0GH 4DV0L 4R4TA 4JI1L 4JBMA 1WR2A 4RAZA 3KHGA 1YEZA 3Q2OA 2D62A 3A0JA 2JA5G 1SE8A 3N6XA 2V59A 5IGBA 5ELOA 1I4QA 3LWUA 3DWAA 2B2VC 1PX2A 4IALA 2R8GA 1ZYRC 1EY6A 2FK3A 1PVOA 2JEBI 4KTAA 1XNQL 5HBRB 1EWCA 2LSSA 2PZWA 4HN7A 3N8DA 1KJQA 3PW2A 2DNEA 1AP0A 2W71A 2J6SA 2BOSA 1TIID 1HPCA 4DNRB 4Q8FA 1FL0A 2HUGA 2BA0A 4DXFA 1DXMA 1GUTA 3TREA 3A5UA 3E5NA 4JUZA 3Q8RB 1G6ZA 4KK7A 1EIGA 1JOKA 3GQBA 1YNND 5IGFA 1SFOH 3J81L 2JJQA 4IOAA 4X66Q 2MPMA 3B6YA 2B2VA 4ID6A 3TIIA 2Q8RE 1N33L 1K8OA 1KC7A 2FHTA 1W2BA 1NNXA 1C30A 3EVQA 4JYAL 3PVXA 3E6ZX 4QIWA 1PFNA 5L37A 1J6QA 1L1OA 3HOYG 4ULLA 2ATLA 1G91A 2RDHA 1TS4A 2Q2IA 5LA6F 5EWGA 1RYSA 2DPIA 3ULLA 1VQPA 1N36Q 3HOYB 3I72A 1BCPB 1TWHH 3P20A 5EOYA 1EYAA 3J81E 2C2DA 3URYA 5GAEC 4JI5Q 4M9UA 4JI0L 1BNZA 2VB3X 4J6HA 3MXNA 4Z9CB 3QWNA 4R4CA 4QWEA 4KV6A 1TS2A 1MHWC 1JICA 2VA2A 1DD2A 2FPIB 3I8ZA 4N8FA 5CC4A 4LFBQ 4I55F 2MJ8A 2SEBD 2XGQA 1VMCA 1K1SA 4MV3A 1OO9B 2UUCL 2E2IA 2F03A 1PH9A 4RH6A 5M5XH 4H02A 1RD9D 2CW0D 4OWTB 1I4GA 1P8LA 1TWHA 4KHPH 3JSLA 3ONAB 4DV4Q 4L5TA 1EYGA 3I55A 3I4MB 5L1JA 3RIZA 2O2LD 3BDCA 1F77A 4A3FG 2YRXA 2XGPA 2K04A 4WJ4A 3P75A 3I91A 4DK1A 3RGZA 5M5YB 2IBKA 4O3NA 1SMYC 4CKCA 5M3FG 4JI3L 2FK2A 2VQDA 4Y52H 1VBGA 4KY5A 1RF2D 2OEOA 1BF4A 4KY6A 3TSSA 1KHIA 4V190 4JBJA 4YCVA 3D0FA 3MR5A 3NQIA 3MA2B 5M5WH 2WINB 1SYFA 5CMDA 1LTID 3Q24A 4YAJB 4ECWA 2V4RA 1ICWA 4FM9A 4L6TB 1MKHA 4JI8Q 1JC7A 1TAEA 5CV8A 2Z4IA 1X6OA 1JCKB 3J81i 2R93G 3NELA 1C8CA 3KF6A 3MVVA 5HGTA 5FLXE 4HJ9A 4BY1B 3GTLH 3I70A 5ELNA 1CK1A 4TV9F 3LWEA 4MTEA 3S2HH 3UE1A 1LT3D 2KVMA 4Q0FA 1M4VA 4DR5H 1EHIA 3C46A 2JQOA 5IE8A 1UNSA 2J7ZA 1EUCB 4UCOA 1M6VA 2HVRA 1QWYA 5C4XB 4TQUS 1Y1VB 1HR0H 1WTPA 2VUMB 2PNRC 5IP9G 1YJWA 4RWSC 2G9DA 2KHJA 4DUYL 2K5NA 4DN4M 4UCTA 3T5KA 4IHJF 2FLPA 1JKJB 1WTOA 5IWAL 5D14A 5JVLA 4BWGB 3KOJA 1DIKA 4HR7B 3TBIB 4YBZB 3NUCA 4WD3A 4B3MH 2PVPA 1NR4A 1YITA 3RUZA 2WV6D 2ZXRA 3JRXA 3VR2A 4QJFA 5L9XA 5DLFA 2PW5A 1XYIA 1SBBB 1YNJD 1VQMA 3EJIA 1GD7A 4B3ML 3R23A 1PTOH 2A6HC 1YJ9A 3PQIA 5JOBA 4EBEA 1Q7YC 1U4LA 4NKLA 1IL2A 1KXLA 1S5CD 4J9PA 2CWAA 1EY7A 1X54A 4APMA 1KC8C 1BVSA 1UWVA 3JZIA 4K0KQ 5D1OB 3DWPA 5C5MA 2IMWP 2E2IB 1A15A 4ME5A 5KNDA 4R1JA 4ALPA 1K83B 5C1OA 3Q8SB 3BJYA 4AQYL 1EY0A 2YRWA 4Q44A 2Z6BA 1VQGA 4MV8A 2PQEA 4C3HB 3KHLA 2KCCA 4K6DA 4AQYH 3TP6A 3J80W 4JVZA 3PF4A 3HEJA 4HJAA 3CF5A 4A3GG 3GTPH 1JJCB 1K1QA 1N32H 3RB3A 4DR6H 2N49A 5C6AA 5D1PA 5C1PA 2Q2UA 4ECYA 3LGJA 4HCSA 3K5OA 4A3JG 3M4IA 5JPNC 1WSCA 2XTIA 4RHSA 3AU7A 1VKZA 2ASDA 3KDFA 1EYDA 4PG3A 1LTRD 2SNMA 2F52A 3HGBA 3T56B 3EN2A 1TS3A 5A2QW 4J9KA 1LLRD 3L3OC 4JBKA 4UP8A 5M3MB 4RNOA 3V6KA 4YJ2F 2AMCB 1EFWA 2Q8TA 1WOCA 3I73A 4KJNA 5T1GA 2E74C 3CXCA 3RF2A 2WAQB 1IOWA 2F0GA 2RBMA 4ODGA 2PCFB 4QL5A 2A69D 3WOEA 2VY3A 3ICEA 4E4TA 2AKWB 5KFSA 5H1SE 2KENA 4ECZA 2RSOA 3NPPA 3V96A 2R7MA 2R86A 4X64Q 4UCRA 1TWCB 4LF7H 3N44B 2EPBA 3GV6A 3I3CA 1IBLL 2ALZA 4A3CG 4BBSB 2HVQA 1GSHA 3G6VA 5JJZA 4JI5L 3I56A 5JEAJ 2UVUA 1PTOD 4V0BA 1IBLH 3K5MA 1BCPD 3G48A 1G6PA 3RAXA 3VYTA 2ZJPA 3J80L 1IYUA 1HR0Q 1QOHA 4GOPA 4DV5Q 2CH4A 3PSIA 5M3MH 3M7GA 1PH8A 4LUOA 4R8UA 2NUCA 1FJGQ 1K3RA 4RUCA 4DK0A 4GLXA 2F0HA 4APVA 3MTSA 3R3OA 4NB3A 4ED8A 2ZJTA 1MJCA 2X6LA 3RJ0A 4QCLA 1FJGH 4YIJA 2JEIA 2R3ZA 5ELBA 1K0RA 4H0LC 3F8NA 5CV4A 3I4MG 4TRDA 3OHXC 1ZEQX 3NQTA 1XMQQ 4CJ1B 2ASBA 1O7LA 4UCUA 2I46A 3D4DA 2LKVA 5A2QL 3HZXA 4CBVA 3GTGH 5LMNL 3UDFA 5I6WA 2W9BB 2HCIA 4GN4B 3L2PA 1XJVA 2ICIA 5E7NA 2JA8H 4OELB 1UC9A 1I50B 3GIQA 2R6GA 3D4RA 4LF5H 1D1KA 2Y0SB 1K8AC 3WO0A 1JLLB 4Y8VB 3NGDA 2F0FA 5M3FH 4H44C 2IA6A 5J39A 3GTKH 2HIVA 1J8IA 4YB8B 4LNQA 2N78A 2QW7A 1LTAD 2XSCA 3GTOB 1K83H 3PIP3 2BE5D 1C7YA 3BA8A 3KBGA 1ET6A 3K5NA 1YI2A 4BY1H 3K0YA 3WWVA 3GTLB 4AQYQ 2R93A 3U58A 5F9NA 3S16B 2E2HH 1DJRD 1EOVA 3KLSA 5KFFA 1M8AA 2NVTH 4CJ0B 4LK1C 2VQFL 2DUDA 2BH2A 1PTOF 1VQ4A 1CHQD 4GKKL 2DNCA 3FVQA 2VQFH 1B50A 1JOQA 4DAMA 5KG1A 4QQBX 4ME3A 1O7ZA 1UE7A 1I4PA 4X3SA 4EQ5A 1AZPA 1SE2A 3S1QB 1ZHSA 4J0MA 3BQ0A 1UEBA 1DM0B 2OWOA 3QJYA 4LF9Q 5J2TF 4BA2I 2E2JB 1HXYD 4BXXH 4C2MA 1SNMA 4YWLA 1SYBA 1B9MA 1ESRA 4KKTA 3T13A 4I7HA 4WFN3 3I12A 3PR5B 4YR0A 3V6JA 5GADC 3S9WA 1GUWA 2K32A 3TZDA 2PBZA 1X3PA 5IIFA 1B53A 4TVAB 3ER0A 4A4IA 1K0SA 4DR1Q 2XVSA 3OYYA 1PH2A 4C5CA 3PV0A 4XQQA 5KT3A 2O5JC 4ZQ3A 1HNWH 5CA0F 4PDBA 4MA0A 2JA9A 2N88A 4RG1A 3I4NH 4IR1A 1EZ6A 1N33H 3VR3A 1TKWB 1LTTD 2B3GA 5KNCA 5KX5F 1Z2OX 2WKDA 1BNCA 4ZCKA 1STHA 3TQTA 1G2TA 3PMFA 3T1HL 2UUAH 4PMWA 2JA5A 2RCNA 4NXML 4GNXC 4G7ZC 2V4QA 5CR3A 4OO1G 2ASLA 5CYUA 4K0KH 4FVMA 3QIAA 5E3FA 5BR8H 5E4WC 1AE3A 4A3DB 3OW7A 1V9PA 4H7BA 2ID0A 2HT1A 3Q1KA 3TS0A 4JI4H 2E75C 1EUDB 2PMZE 3K7AB 2QK4A 1SDFA 4DV5H 4NP5A 1BDOA 1XNRH 5KT5A 4WJWA 2R92A 1I50A 2G9HD 5D65A 3UDIA 5M5YH 2Z8LA 3C1EA 5C0XH 1WD1A 1V1PB 4DV5L 3ND8A 4F50A 1XNRL 1M0WA 1E2WA 1YVCA 4DV0H 1EYCA 4JI1H 4CHTB 1RKNA 5DLGA 1ICFB 4QIWB 2KJXA 4HMIA 1KDBA 1KQSA 4IRKA 3C3LA 5F2DA 3N40P 1N32Q 4DV0Q 2UUCH 3GTLA 3KJOA 3M4PA 3BG5A 1XTDA 1WTRA 5KGUA 2O5IC 3AFQA 1HQMC 4C3IG 2A1AA 2QCPX 5KG5A 1JXLA 4IZ8A 4JI7H 5KFNA 4O4HF 3GTPA 2HDMA 2AWNA 1XNQH 1TWFB 4ECXA 5FLMG 4P72A 1BKBA 1F9RA 2YTVA 1VBHA 1JX4A 5KYLA 2RKSA 5JVDF 3EROA 2A68C 4CC5A 1MGSA 1S68A 2A6ED 3N42B 4YY3Q 3OMCA 3S14B 2K28A 5I9PA 4CDDC 3FHWA 2PI2A 1V43A 1VQJA 2KA7A 1EU3A 5KFWA 4F4XA 2HJWA 1HH2P 1WJJA 4PZ6A 5KFHA 4POGA 2UXCQ 5BPFA 3KBXA 4LMYA 4UP9A 1FGUA 2W8KA 1VQ9A 4RU9A 1X32A 5KFBA 2ZTCA 4K5WA 2Z6KA 4MV1A 1SLJA 3SK8A 5TSSA 2EJGC 2B2UC 4C3JG 2DWCA 4DR4H 3VPCA 3VR5A 1Y1VG 4GKKQ 3GP7A 2W6MA 3T53B 1VQ7A 2QEJC 3VPDA 2CQYA 3CCRA 4DV6L 2VQFQ 4FS2A 1KL9A 1YNXA 2WFWA 2AUJD 4EBCA 2DJGC 5C4HA 2ZJRA 2E5LQ 2R82A 3GTJA 3FPUB 4IUQA 2QYZA 3V05A 2NZHA 5KT7A 1QZGA 2QA4A 1BCPF 1Y1WB 3M4OH 3DXJC 1AEXA 4OWXB 1GJXA 2E5LH 1TWAB 2BDNA 3S14H 4DUYH 3KDFB 2A69C 5A2QE 3PR4A 3U9OA 4RB0A 4DR2L 4DAPA 1I4HA 3CCQA 2EYFA 5DQIA 3ND9A 3GTGB 3K7AH 4DUZL 4O2DA 1PYWD 4DV1L 4HQ6A 2EIFA 4Q5VA 1XMQL 4DR2H 5CGKA 4RNNA 2DN8A 4ILWA 3CMEA 2R92B 3RB6A 3Q23A 4U6PA 2RQXA 3A8IE 2R7LA 3HG9A 2YCHA 5C5LA 5C8YF 1XMQH 2CVRA 3PUYA 1BCPC 5LL6X 3OTOH 3QOLA 4H13C 4PMBA 4UPAA 4ZYSA 1GSOA 5AJ3L 2FLLA 4RGMA 5ELCA 1S97A 4J1MA 4A3MH 3DF7A 3J7YW 2HD3A 1RIPA 2I80A 2WB1G 3I4LA 5EGTA 1WFQA 2F0NA 4C1NK 2XIGA 4IPHA 1Z9FA 4A3IH 2R7ZH 3MEFA 4JI4Q 2R61A 3CCSA 4A3LG 3SE0A 2NB0A 2GPWA 4LF6H 3I4OA 3PO2G 3FP9A 1LTBD 3VPBA 3CAMA 4ED7A 3BDLA 4POFA 1G291 2F0LA 4A3IG 1BBXC 3TS2A 4J8QA 2QILA 3I4NG 1ZYRD 3S1RB 1F2ZA 2NZOA 4GN3B 1X65A 1Y1VH 3BA9A 4FXGC 1GUOA 1W6JA 2E2HA 1CQFA 5DQHA 4G57A 2R7FA 3K5IA 1WCMG 4QUFA 4DF7A 2RSNA 1GOZA 4Q45A 5C4XH 2UUCQ 5IYBG 2B63H 3N52A 2D0OA 5E1FA 4ECVA 4R4QA 3DHQA 2PQAB 1HR0W 1ESFA 4PWQA 4N9PA 3KYHC 2KCMA 3FMCA 3O13A 5T14A 1UE1A 4ZAIA 1YHAA 4RKBA 4IO9A 1XTCD 5EKIA 1XWEA 3FDTA 2UU9L 1NY4A 3K58A 1E22A 1IBKH 4F88A 3M3YB 4J9LA 2PN1A 3Q0AA 3T51B 2WKCA 2NVTB 5KFUA 2PI2E 1VAJA 4B3SH 2R7ZG 1GLVA 1S0MA 2E2DC 5J2UF 4HJ7A 1SXTA 2YU9A 1U4PA 4RZRA 4LWCA 4DK3C 3RAQA 4KHZA 3C0FB 2HIXA 5EZYF 2YS7A 4ABNA 3BAAA 1IHZA 4HJ8A 5DM73 1K8GA 1M90C 5KG3A 2N55A 4DV3H 4XYQA 1I7LA 2HHHL 5BPHA 1Q1BA 1Y1WA 1MJEA 4ECQA 2K75A 3ETHA 1T5EA 4LJZC 5KKNB 4C3IH 4YQWA 4DV3Q 1EFID 5ISRA 4FBUA 4ZUIA 2ZXOA 3PIOA 2X0SA 2HHHH 3R5HA 3KUPA 3NXWA 4JPBW 5FLXW 1FYCA 4Y7NH 2NN6I 2W6OA 2NN6G 5M5XB 3PZPA 4YR3A 1UEAB 1HNZH 2PW7A 3LNNA 4Q8EA 2GA4B 3GTGA 2K50A 1A8VA 1AW7A 1B7YB 5D3DA 5C44H 4YWMA 3OUUA 4X64H 1E2VA 3JRWA 4O42A 5DQGA 2UUBL 1MBYA 3H3VH 2BR0A 1VQCA 2M05A 5J22A 4TKOB 1Z47A 4C1NI 5L1LA 5KFRA 4F87A 2R92G 1Q8IA 3U9SA 4A3DG 2VL6A 1EEFD 3S17B 1Q86C 5CA1F 4DGZA 4A3KG 2GLTA 4O0AA 1N32L 3HOVG 1CQIB 1XNRQ 3CW2C 4RB1A 1AUVA 1RJTA 1Z2NX 4XYMB 4PV1C 4KN7C 1RCVD 3HBLA 4ZKCB 4A75A 1SYEA 1JJGA 3OOCA 1Q1EA 4JI3Q 3BABA 2UXBL 4IUVA 1QNKA 3D3RA 3L0OA 5C3EH 1VQLA 1U0LA 3ETJA 4F4ZA 3PW5A 3K59A 1X9NA 1ENAA 4G4KA 1UUPA 2C9OA 3TP8A 4YY3L 4RGOS 2R87A 1VQAA 3EFXD 5IT9W 1WTVA 1L0XB 4F4WA 1KDCA 2L11A 2B63G 1JDBB 3MWDA 1IW7D 1X3EA 5C44G 2LMCB 1BQQT 3KLSX 1I6HH 4C5BA 1KEEA 1ASZA 3C1FA 3NENA 2B63B 3T5LA 1PH3A 5JH7F 2LXJA 5KIXA 1IZ6A 3N41B 3J81W 4IUTA 3IG0A 2CW8A 3SR1A 5EAYA 5DEHA 2F0QA 4R9WA 3HOVH 1RYRA 3KF6B 5I9OA 1L2ZA 5JAVA 4C3JB 4LFAH 4B08A 3GTMH 1S9FA 1F9PA 1VQIA 5C4ZA 3TN2A 1Q46A 3DEPA 3I90A 5KG0A 1PHJA 2IHEA 1RJPA 1IXRA 1HZCA 4RHRA 4DR4Q 4MHEA 5JJKA 3ORRA 1I6UA 4JOIC 4AYBA 3EPGA 1STBA 4HJ5A 4GKKH 3HOXG 5I4DA 2F0MA 4HYKA 3N6RA 5EKLA 3VYUA 2VPSA 2YZMA 1EEID 2UU9Q 5KFCA 3VA5A 1HTPA 4K8JA 2XRSD 1MD2D 4C5AA 4B3MQ 4J9OA 3RB4A 3TIGA 2SDFA 4OIJA 1T5XD 4DV1Q 1DZ1A 4JV5H 1K3BC 1PFMA 1TWFA 3EQLC 5KT6A 5FK9C 4EFEA 2V4DA 2F0OA 4XT3B 5EQ0A 3PGZA 1IKLA 5C4JH 1WCMH 1V8QA 4LAAA 2K6AA 2IWHA 3V4ZA 2C5CA 1ILPA 2JEGA 1G2SA 2W6QA 5C3XA 4N8X1 1PH1A 5JUMA 1NE3A 3PCOB 2HDLA 5COYA 1CA6A 1TWGB 2L4NA 4KMUC 2WAQE 3R2IA 2C28A 1GGOA 2HQEA 4A3BH 1DOMA 1F9QA 2YU9H 4PZ8A 3JSNA 3CCMA 3WOFA 1YNNC 1IOVA 2PMZA 3RFCA 1A0IA 1WD0A 2FJZA 4O3OA 4DR1H 3R5FA 2FMAA 3E9IA 2KOLA 1KLGD 5C3EG 3TP7A 3OTOQ 2GVBA 4X65H 4O1NA 4G7OC 3T1HH 4DR7H 4DR1L 1YZ6A 3G4SA 3K80C 1E4EB 1CKNB 1WH2A 4A3IB 4DR7Q 4X65L 1JB7A 1X3FA 2WB1E 4JYAQ 1QB5D 1WTWA 1C0AA 2B2WC 5IGGA 1SEIA 5EJWA 1I3QA 1VQKA 1HZ9A 1TU2B 1N34Q 3NK9A 4DU9A 5ELFA 3OHAA 1B4OA 2KCNA 3RMHA 5LHY1 2ZTDA 1AN7A 2YTYA 2M9VA 1STNA 4CC6A 2B63A 1F2LA 3SVMA 3A74A 2VS1A 3FDSA 4NXNQ 3K6OA 4X3KA 1J5EQ 5KFPA 2PNHA 4X6AH 2AU0A 2J4XA 4K8IA 3BYYB 3NP8A 4EQOA 2JEAI 3LWBA 4ME6A 2NU8B 2GN5A 1F9SA 1MIUA 2BQ3A 1SNQA 4UHVA 2K7VA 1EQQA 1B6SA 2N3SA 2SCUB 1WTHA 1H9MA 3F2UA 3JAME 1E4FT 2BH8A 2I07B 3WDNA 2W9CB 1J5EL 4GKJH 2B2TC 1V51A 4KKSA 1Z2PX 4A3FH 5IT9L 3KLRA 5IGCA 3K5HA 4GS3A 2NU6B 5D1OA 5FD5A 4ED0A 2NTTA 2IHFA 3S1NH 4TQSA 3MJFA 1LTLA 2ZDHA 5CBAE 3J80i 3AEVA 3PF5A 1JWSD 3GIIA 3JAMi 4IRDA 4FS1A 5KFTA 3ULJA 4UCVA 1Y8PB 3D31A 4DV7L 1TWCA 2YZGA 1AH9A 3QZ7A 1GYFA 1HUMA 2ZDGA 4XYLB 2R93H 2F0KA 4X66L 4ED1A 4L8JA 3GTMB 4NXMH 1SRUA 2OTLA 4IQZA 3OSOA 4P71A 4DR4L 1JDEA 5K5PA 4QMGA 2VR1A 3X3MA 3PO3H 3A54A 4LUZA 2M00A 3RLNA 2UUBQ 2YYZA 2D0PA 3E0JA 1NUCA 1WVLA 4O2BF 2J6UA 2R7DA 1O75A 5KFLA 5CB4F 4RMFA 2EYHA 4JI6L 1PTOB 2EYLA 5D8DA 4ZRZA 3HOZB 1A3TA 3LP8A 2CQOA 3F1ZA 2E5LL 4ECTA 1Y1WH 5AFWA 3S1MH 2WAQG 1M0TA 3NBHA 2FMMA 5C3EB 1S40A 1VQHA 1SROA 4WRDA 1GO3E 3BVZA 4LH7A 3KALA 5KT2A 4IFDG 1ULZA 5J3BA 5IYCH 3RZOH 1B2TA 3IL8A 2N8NA 2E2JH 2XCAA 4DUZH 2VPQA 4FBTA 4K14A 4HTHA 4BBSG 4JI3H 1CSQA 4IFDH 1G8ZD 5IYCG 1UAPA 2YV5A 2O03A 4DUZQ 2A68D 1B3QA 4I50F 1QJOA 3T5JA 1W3SA 1SNDA 5HURA 3ERQA 3E5SA 3CPFA 4OHJA 4DR2Q 1CS0A 4L1KA 1W93A 3SXHA 3RLOA 3E9HA 2BDOA 3T1HQ 2B2YC 3BQ2A 1T36A 5FOBB 3RBEA 2EJFC 3W2DA 3QO2A 4I7ZC 2A8VA 1SSOA 1IL8A 2EVBA 2R93B 5KFXA 2D9UA 2AGQA 3GTQB 3A8KE 3D6WA 1EWHA 1N34L 2L12A 1S0OA 4A3KB 4C3HH 2R7KA 4OGQC 2OQ0A 2E8GA 4GOPB 4A3EB 2QGQA 2JA7G 4OX9Q 1XDNA 3M3YH 1CE8A 2CH4W 3VMMA 4JG2A 4DL5A 4R8UB 1D6EC 1O7YA 3CC7A 4IWXA 3NBIA 4OX9H 3G6JB 1CT1D 1GHJA 4ZLTF 1TR5A 4DAYB 3MFGA 4MZ9A 4NXNL 3FKIA 3KFUA 3RV3A 4YHHQ 4ECRA 3HOZH 1FR3A 4JCVE 5CBEE 3WNZA 1SYCA 5E4XA 1I50H 1S72A 4RA8A 2IX1A 1CI3M 4GNXA 4HIKA 1CQJB 2DY8A 2F4VQ 1KNEA 5FO9B 1X3GA 3OUZA 4OIKA 3OHBA 5IY0A 5DAUA 2UU9H 1KAWA 3M4QA 5FLXL 4P2CB 5I47A 1KAAA 3PO3B 2R92H 4A3DH 4K6LA 2JXMB 2KHSA 2YS6A 3RZDH 4B3SL 4B3RQ 1EZ8A 3GTJB 4DV1H 5KFOA 1V1QA 5M9OA 3M9MB 2K5DA 5KFKA 4GC6A 1RK6A 2K01A 2F3WA 4B3RH 4MV6A 2JA7H 2ZM6H 1WCMA 1SNPA 4LF4H 4IPGA 1HUNA 3S15H 3N43B 4YAKB 2R8KA 3W5OA 5CV5A 4LF7Q 5IGDA 2F3IA 1E1TA 1K28A 4NXMQ 4I4TF 3LX0A 3GIPA 2I5HA 3KLWA 4DL7A 2F0WA 5BR8Q 1PDQA 3DWQA 2NVQH 3BG3A 4IZOA 1JWUD 4R4IA 1Y8NB 1DCZA 5IP9H 2RA4A 2HHHQ 2NUAB 3TZUA 2R7ZA 1IYVA 3GV3A 3P7JA 4X64L 4PNYA 1PTOC 2EYOA 4C56C 4CJ2C 5ELEA 4QWDA 2P0AA 4O4LF 3DEOA 5EBDA 3RLFA 3HKZG 1L1OB 1QE6A 3I2ZA 3KF8A 4KKUA 1BJTA 2FK1A 1A2TA 4DA2A 4IUNA 4ZOLF 2X69A 2F0PA 4FO2A 3A7AB 3S17H 1V1OA 2F0DA 4WJ3M 1B1ZA 5G3LD 1KJ9A 3DM3A 1CZGA 4HIOA 1HNXL 3VA7A 5IT9E 3OWFA 2ZJQA 3WO1A 1WI5A 3UE0A 1KBLA 3RBDA 3GTQA 1UE5A 4DFAA 1KTKA 1LT5D 5FPOA 3GV7B 1FNWA 4IUUA 2B2YA 3UDXA 3GV8B 2R8JA 1X3QA 4YY3H 4OWWB 1WTXA 1HJPA 1M1KC 4JI2H 1BXRA 1Y69U 2CWPA 2JA6B 4GZYC 3F8TA 4IJHA 2W6ZA 2WACA 2JA5B 4DV7Q 1SYGA 5G3LF 3MR6A 2UXDQ 4JI2L 2K14A 2MHVA 2B39A 4KD4A 5LMNQ 4BY7H 2KSWA 4RB2C 3HP3A 4J9SA 1GUSA 1STGA 1ZKOA 1EY9A 4BBSH 4NPSA 3T1YQ 1OXXK 2K1BA 4KD3A 2Q2TA 5KFQA 2J6TA 1DYQA 4OL7A 3RR5A 3FPPA 3NTIA 2DZDA 3GIDA 5L1KA 2EYMA 5IT9c 3KTMA 1V1PA 4BA1I 3Q22A 5KG6A 1I7NA 5EPLA 1Y1VA 3TQYA 5LXTF 3ORQA 2IX3A 1QUQB 1RTOA 2D5DA 3S1RH 1Q3LA 2V9WA 5LP6F 3STBD 2H4OA 1EIFA 4R8NA 2F0UA 3F2CA 2EXZA 4XXEA 1Q81C 3I4MH 1WTQA 4LF9H 3VYSA 1X56A 2JYOA 4GN5A 2Q8IB 1CUKA 3I7FA 4PZ7A 5FLMH 4HNVA 2KBNA 4RZQA 4IUPA 1FJGL 1EIYB 2QDLA 1ZETA 1H9SB 1ET9A 3ERSX 4PQXA 3IKJA 1SJHD 4CDCC 3PUZA 4BY7G 2W7PA 2Z6KC 1KRSA 2R85A 2EJMA 1PH7A 2UVRA 1BBWA 3EYYA 4DK6C 3H09A 4A3GH 5KYIA 4JV5Q 2VUMA 1OXSC 2KCTA 2JA8B 4LF5L 2EZVA 3PN1A 1R9TH 2WTFA 4QY7A 2AHOB 2P5ZX 2FP4B 1PLFA 4LSAA 2DGYA 3HOUG 4LFCQ 1PH4A 3MHBA 1B70B 3HOUB 5KFJA 2KEDA 1SNCA 3ZJYC 1AZQA 2JN4A 3GTMA 3M9BA 1MZBA 1OTCA 4R7RA 1D2BA 1EIHA 3CU7A 2DIKA 1SE3A 3H15A 1FVIA 2UVWA 5KT4A 1ZXTA 2WB1B 5IYDH 5JJIA 1N36H 1EY4A 2OTJA 1JB3A 4C3IB 3IAYA 1EUJA 3J80c 4EYHB 2RCFA 4EG0A 1S10A 1YIJA 2XWBB 1VQEA 2OF1A 3GILA 1YHQA 2L15A 5C0XI 1DONA 5LMUQ 1AUXA 1HFNA 1Q90A 2EQSA 3UDGA 1TWGA 4OXPA 3QG1A 4LW1A 2OT2A 4GOPC 2A6HD 4RB3C 4KN4C 2NTSA 4BS9A 2L1BA 2V5AA 1HNXQ 3OSPA 2QDBA 4MV4A 1LM0A 3RUPA 4FDBA 2ALYB 4UP7A 1DOLA 3NWTA 4NW2A 4R4OA 2F0IA 3BU2A 4A3JH 2BQUA 4OO1I 1A6XA 3CC2A 3KAKA 2W8LA 3K57A 1RHPA 4LF8H 4O2AF 1E4EA 1EQVA 3RD4A 3L4KA 4A76A 5DG9A 3K3PA 3GTQH 3PW0A 1BXTA 1VQ6A 5C5JA 3CCUA 1EU4A 2WIIB 3Q8QB 1NTGA 1E1OA 1DGSA 2OCEA 2B8GA 4EVOA 5KFIA 3CQZA 1ONLA 2DJFC 3BDOA 3S24A 1B6RA 1D8LA 1LABA 3BS1A 1Z6HA 1XXGA 1GVPA 4B3TH 4IN3A 1YNJC 1CKOA 1FKAH 2L0CA 4HSVA 1LUZA 3TQ1A 3HOUH 5M3FB 1C4QA 4YP3A 2YYAA 2CCZA 4JI8H 2ZM6Q 1H9SA 3H20A 3RGXA 2A74C 2W70A 2C00A 3HB9A 3IFTA 2A19A 4KHVA 2CZGA 5BR8L 4OEMB 4X66H 1NJIC 2JEFA 3QOJA 5IODA 3JC66 1UE6A 2RDGA 2KQ3A 3K81C 2JSOA 5KEEA 1F2MA 2UXCL 5A35A 1T94A 2VUMG 2NWGA 5CV7A 1LT6D 3L4JA 1PK8A 4JW0A 1HZAA 3S2DB 3M9OB 4IAJA 3A55A 1QCBD 3H91A 3MFIA 3J81c 3CC4A 2NVXB 1PH6A 2LS01 5IYDG 3AQQA 1L1OC 1EQRA 1CA5A 4K2KA 3DLLA 2R6FA 1PFSA 2NVQB 1IYJB 3S16H 1I3QB 2JP1A 3T4AC 2NYZD 4JI7L 1SEBD 1TWAH 4UCSA 2W7OA 3H3VI 1ILQA 3HXLA 2BE5C 5KFAA 1PRTD 2CW0C 4MNOA 2Y0SA 2W9AA 2XD4A 2XIWA 2PO4A 5IGEA 2ATWA 5IWAH 2JA6G 4MN3A 5EWEA 2KECA 1W96A 3FKIH 2NN6H 2AQ1B 4JI7Q 3U4ZA 5T1IA 4RCOA 2CKZB 4QWCA 2FJ2A 2IT1A 1BGWA 1C3OA 1ZHQA 1PFBA 2B8FA 1DOKA 2BA1A 1L0WA 2XRQD 2KHIA 4DV7H 1II3A 3NBHB 4AH6A 4BY1G 3FRPB 3BJUA 5LL6S 1OWTA 1A62A 4LSXA 4E6IA 4EQNA 2MO0A 3GV5B 2W9BA 3HKZB 1G51A 3BZKA 1PMRA 1PZKD 5LMUH 4M1UB 4AIMA 4IPDA 4RAUC 2R8HA 4HSPA 2CFMA 3KHHA 3S2DH 4DR6Q 2FINB 3UFXB 5EPJA 3NTHA 1B3AA 5KFGA 5KG7A 2K05A 1E4GT 1SMYD 3MWYW 3ULPA 4PMCA 1VF7A 2RHSB 2W6PA 4FF2A 2RHQB 2F1MA 1U4MA 1AE2A 1JE5A 1HFGA 2TMPA 2VXWA 3EBEA 4DKAC 5M3MG 2ASJA 2Z1CA 1I3QH 4MAMA 1F2YA 1I4RA 4DAVA 3K8AA 2FE3A 2RGRA 3KJPA 3JAML 1VF5C 3PIO3 1O7IA 2W6NA 2E2HB 1A2UA 1E0BA 3CRKC 4XQJA 2F4VH 1R4QB 2JA6A 1ENFA 2XGTA 1R9TB 1SMXA 2EOTA 4XTCS 3TP5A 3H4DA 5LMNW 4O3SA 4ED6A 3RZDB 5DM63 1UNNC 3OTOL 1VQ8A 2AWOA 4C2MB 4A3LH 1C48A 4B3RL 1I94L 2ZM6L 1EOTA 4FF1A 2NVXA 3FKIG 4LFCL 3OWEB 1KIXA 4HEDA 2A73B 3TMEA 2KUMA 5EBCA 1HTLD 4HCEA 4GNXB 1JQYD 4LFCH 4A3CH 4LF6L 4TSSA 4A3MB 2FB9A 2QEXA 1E2ZA 5JEAH 2DLNA 2VUMH 1KNAA 2ENBA 1D7QA 4B9WA 4AYBB 1N34H 1IBLQ 4A3GB 3U9TA 2UUAQ 4ZQIA 4A3FB 3JAMW 1IBML 3PUXA 2I0QA 5JEAG 4TV8F 4JC0A 4LF6Q 1H95A 4JK1C 4OO1H 1JIHA 5FPRA 5JVG3 4EGQA 3EA6A 1IBMH 1O78A 4A2BA 4OX9L 4ECSA 3KHRA 3SDZA 4U673 4K2LA 1A3UA 4BBRB 3QZ8A 1EY8A 1TT2A 1IBMQ 3G6YA 4ED3A 5M5WB 2FXQA 3RN5A 4J9NA 5KG4A 2XWJB 2CHBD 1QVGA 2NVXH 4J9RA 3SK6A 3R5XA 1HNXH 4QF4A 1IBKL 4EFBA 3H0GA 4JV1A 1FD7D 1CHPD 3HOVB 1FGBD 5C3WA 2ES2A 3K5LA 2AQ4A 1VDZA 1VQFA 1CKMA 4DAYA 5H80A 1FNVA 1NCVA 1IBKQ 2JEJA 4KHPQ 3GIKA 1H9RA 4XYOA 1XNQQ 4MV9A 4B3SQ 1PRTB 3C2PA 2EDGA 4DV4H 4LF4L 3VR4A 1RK5A 2HCCA 3SK5A 1CKNA 1Q8KA 1U5KA 2I87A 3I4NB 1HA6A 4KY7A 3H6MA 4TQRA 3CCJA 4QB4A 1SYDA 2F0JA 2WB1A 4XT1B 5C0XJ 1R4PB 3TINA 4B3TQ 1MI2A 3GTOH 2H5XA 2K5QA 5C0XG 1HNZL 5KFVA 1A3VA 4HMJA 5IP7G 4FYDA 3U50C 3QB3A 4P73A 1KJ8A 5EDWA 4A3KH 3CQZH 4S3SA 4JI6Q 2F0EA 5KNBA 3HKSA 4QW8A 2C2RA 2OLSA 2UUBH 2F0SA 1B8AA 1HCZA 2I5MX 4ECUA 5F9LA 3T1YH 5EKKA 5IP7H 1MSGA 4CDFC 2O4XA 4KJOA 2J9GA 4A93B 2R84A 1OXVA 5GONF 5D3IB 3T1YL 3MFHA 3ITPA 5C4XG 5HV6A 3CD6A 1S0NA 3RTXA 3GO5A 4CKEA 1B33N 1H9JA 5HY6A 2I8CA 2JE6I 3M85A 3OIQA 1YHBA 2MQHA 1XPOA 1CZWA 3RZOB 2L9HA 1ZQ7A 3CVZA 3D4WA 2FMCA 2VZAA 2AQ2B 1RODA 3L9AX 4MA5A 5DG8A 2Y0SG 3R93A 3KF8B 1CFMA 4MIUA 4GC7A 1I5FA 1TWAA 4M8AA 2ZT9C 4FXDA 2VQEL 4P75A 3J7A5 4A3BB 4HR7A 4IRCA 4GLVB 2JA6H 5ELDA 1LTSD 1TA8A 1N33Q 4L63B 1KLUD 2H1EA 3QR8A 5IWAQ 4BXXG 2F0TA 5DG7A 3GTKB 2VQEH 4J9QA 1H9KA 3UQ8A 2AGPA 1YJNA 1S5DD 4BBRG 3PIPA 3BZCA 4IURA 4A3EG 1VQDA 1HNWL 4LFAL 3J80E 2AUKA 2NVYH 4LF5Q 4LH6A 2L55A 4JYAH 2XCPA 3DMUA 4U68A 1N36L 3DM1A 2RDFA 4DPGA 3CP0A 1X55A 4YR2A 2UUAL 1KDAA 1STEA 2MGSA 2MNAA 4EEYA 3SK4A 3RN2A 1GM5A 3HOWB 2NBFA 1HA5A 3Q8DA 5JQWA 1K83A 3VYRA 2Z0SA 4K0KL 4O4IF 3PO2H 3LMLA 1XPUA 1JOOA 1I6VC 3STBC 1TVXA 3AYHB 4YHHL 2DPJA 2RDIA 4JI0H 2F0VA 1B04A 4JI1Q 3CKIB 5DLQE 4QWAA 3E0EA 1I4XA 3G8CA 2RDJA 5I2XA 1JR0D 4JOIA 2B2WA 4ED2A 4G3IA 1JE4A 1JORA 5HGQA 2B2UA 4FF3A 3M4OB 3R2TA 4UAIA 4RAYA 4G7HC 3OPOA 2VB2X 2A5HA 1OXUA 3S1QH 4A2AA 4LF8L 1RTNA 1EYZA 3GIJA 5I6YA 3SGIA 2J0TD 1S03G 3J7AK 4RUAA 3IFDA 2QKIC 1TWCH 2F4IA 3HOXB 4KHPL 3RV4A 4F4YA 2I5LX 1SAPA 3A5ZB 1W6KA 1QZHA 4LF4Q 1V4YA 4UY8C 2PQAA 1HHVA 1D5XC 4DXGA 5DGAA 3NE5B 2JA7B 2MCTA 2EYPA 4CKBA 5JVH3 4A93G 3OSNA 1VCIA 3H4BA 4XZ3B 3MXPA 2RF4A 1VS0A 4NLGA 3H40A 3MXNB 2E2IH 1C9OA 2V1CC 2NZ1D 2G5DA 5BN4A 3MXGA 4JI8L 1D5ZC 3U4VA 1NMFA 4HNTA 1ENCA 2PZUA 2WAQA 5BN5A 1CSPA 3EPIA 1LV9A 3PW4A 3KK7A 2YW2A 4TUYF 4LUVA 2K52A 1TY0A 2JA8G 3FKIB 4R8IA 1GHKA 3HFZB 4HNUA 1TQOA 1TWHB 3CQZB 4ZKBB 4K5XA 1ASYA 2MUYA 2W57A 1K8MA 3FMAA 3HOXH 1RJQA 2NU9B 1Q12A 4BBRH 4AYBG 4HIDA 3BQ1A 4A3MG 1T3NA 4YCWA 1Q82C 2RGVA 4ZI7F 4DR3L 5LL6b 4J9MA 3GTKA 3GTPB 3UI2A 1LTGD 4I7AA 4DV6H 3W1GA 2EYJA 1U4RA 3PUWA 3KXYT 1HR0L 3V6HA 1SYXB 1D5MC 1QG7A 4C3JH 5K36G 2GPSA 4DR3H 5FO8B 2RVLA 4RGTA 2VNUD 2IX0A 4GKJL 1L2FA 5DGBA 3V2TA 1J5EH 1SFOA 3SHLA 1LO5D 1NMGA 1A9XA 1Y8OB 1NAPA 2MP1A 2X6GA 2ZXPA 2UXDL 4XX0B 4N9TA 4JI2Q 1CQVA 4RKLA 3Q8PB 3JAMc 1JMCA 2R8IA 1GKHA 4KLKA 2UXDH 2A6EC 4IFDJ 1JJ2A 4GKJQ 3R8BA 4F8MA 2V58A 2Z4HA 1AFPA 1EZ1A 5GQOA 2LFNA 1KJJA 4B3TL 1L0YB 1PZJD 2HVSA 2OH2A 4RFBA 5JJLA 1Z7TA 3VDYA 4MTNA 2SNSA 1B9NA 2PYKA 2HQLA 2IJ0A 4IFDI 3W3AA 1QVFA 1JWMD 1B44D 1HZBA 2EY5A 3CRLC 4LFAQ 1VMPA 1PH5A 3G71A 1SE4A 1FNUA 4WORA 2AQ3B 1KJIA 1LT4D 1VQ5A 2C22A 2FLNA 5LMUL 1RDPD 4DV2Q 3G6XA 4IWYA 3D8GA 2LY7A 2YZNA 3GTOA 4C2MH 4EBDA 2SOBA 2UXCH 4NDXA 5KFDA 2FFKB 4EYIB 1KRTA 2JA7A 2K5HA 3K7UC 4JI6H 1VQNA 4IJLA 4X62L 4XIGS 4F7XA 1KABA 1IW7C 5IOCA 5IYBH 5EWFA 4DR5L 3AB9A 3HOZG 4K5VA 3CCEA 3BYTB 4MV7A 1QILA 3CCVA 4QWBA 3PW7A 1VQOA 4X3UA 4ZUJA 4BY7B 4X62H 2M2LA 2B29A 4GLAC 1T9HA 4YCUA 1K73C 1LACA 5KFYA 1NR2A 2TSSA 4O3RA 4Y7NB 4X62Q 4JV0A 3SE7A 4DL2A 2MFIA 2OXPA 2GVAA 2OQKA 3H94A 1PA6A 1N8RC 3S1MB 2AGOA 4EEQA 2EY2A 1PXUA 2BQRA 3QFFA 1BBUA 3M4YA 4A93H 4JV2A 4YWKA 3RNUA 2YTXA 4A3BG 3OW2A 1HQRD 5CORA 4RCNA 4DL4A 4U7CA 2CQAA 2K5VA 1SR3A 1IKMA 3AFPA 3V4SA 3RB0A 4JBWA 1XPRA 4IR9A 1I94H 5FJ8G 4YJ3F 5KFZA 3T16A 1DV2A 4J15A 5KG2A 1EY5A 1PRTF 2B2TA 4X65Q 5JPMC 1I94Q 4L5QA 4ZK9B 3TDQA 1N9WA 3GD7A 2IL8A 2FPPB 4Q0YA 2EE1A 4FP5D 4DV3L 4AYBE 1HNWQ 2Y0SE 1STAA 4QW9A 3GIMA 2WP8J 3ZYYX 2Q2HA 3K3VA 3NSWA 4A3EH 2C35B 4HAEA 1ML0D 3NEMA 2K33A 3G7LA 3AMUA 2PMZB 4FNFA 3F2BA 2R7NA 1WCMB 1R9TA 1E3PA 1S5BD 3HKZE 1D1IA 3BVGA 5DNFA 2CW7A 4JI5H 4DL3A 1A63A 2MO1A 5GROA 1GUNA 4IPCA 5IYZF 1TWFH 1BR9A 1RL2A 3SI8A 4NXNH 1TXYA 3S1NB 1J9OA 1I6HB 3L7ZC 2HGSA 4FF4A 3MZ5A 1EL0A 3E3XA 4DR3Q 4LFBH 1AN8A 3HOWG 3HKZA 2W9CA 3FEWX 4LF8Q 2LXKA 4DR6L 5BMVF 2IY5B 4B9XA 1O80A 4JI0Q 1QNUA 3GDEA 4XQNA 3BVMA 4LFBL 3NTKA 2R7ZB 3PUVA 1E7ZA 3NWSA 3MXUA 3PO3G 2XNAC 4DNTB 3MAQA 2NVYA 2UXBQ 1S3OA 4L5SA 1SCUB 1DV1A 4IOCA 1N48A 2WYOA 4NMZA 2Z9HA 4FXKC 3A56A 2F4VL 3PO2B 3GLKA 4QGUA 4HIMA 3IN5A 3W1BA 3VR6A 2UXBH 4EX5A 4KI0A 4RGNA 4WBNF 5LMNH 5LYJF 2FPGB 2YL2A 2BCOA 1XX8A 1YBYA 1JT8A 1Y1WG 3KAJA 3NHHA 2K03A 2QF7A 4P74A 1RJRA 3A8JE 3MR2A 1SNOA 2WDTA 3H0GB 4I65A 4Q43A 2PPBC 4EGJA 1Y14B 3MWMA 3OMGA 2F3VA 4LF7L 2VA3A 3H0GG 1PYBA 2IP4A 3Q6SA 4O3PA 1CTMA 3J81j 4XDXA 2L5TA 3MEHA 3G6EA 4MTDA 5FJ8H 4DR5Q 1M7JA 3CPWA 1PRTC 3S2HB 2EY6A 5GAGC 1HRJA 2EXDA 5I2YA 3J7ZC 4CGYB 3TEHB 3CCLA 1SN8A 1WYDA 3K0XA 1HNZQ 1MSHA 3DUZA 1S5ED 1TY2A 4M7EA 4L5RC 5CV6A 4ZHQF 3M9NB 5KRUA 4CDEC 4DLKA 1VQBA 4X3TA 2VOBA 4QUCA
chains in the Genus database with same CATH topology
2JA9A 4RG1A 3I4NH 2CQOA 4GNXB 2B3GA 3F1ZA 2E5LL 4A3CH 4LF6L 1Y1WH 3IRBA 2WAQG 3S1MH 4DV6Q 2QEXA 3T1HL 1QUQA 4PMWA 2VW9A 2JK8A 1S40A 2VUMH 1VQHA 1SROA 2RCNA 1KD1C 4GNXC 4NXML 1D7QA 1GO3E 1IBLQ 4IFDG 4OO1G 5J3BA 5IYCH 3RZOH 2UUAQ 4OONA 1AE3A 1P16A 2N8NA 1EWIA 3PUXA 1V9PA 4DUYQ 2ID0A 5JEAG 1LYLA 3TS0A 2E2JH 4JC0A 2I0QA 2HT1A 4JV5L 4LF6Q 1H95A 4BBSG 3TRZA 1CSQA 1OXTA 2PMZE 1IBML 2K4KA 4DNIA 5IYCG 3HOYH 2YV5A 5FLXc 4DUZQ 4OX9L 1W3SA 4DV4L 3UDIA 5M5YH 5GAHC 3CPFA 4DR2Q 1XMOQ 4DV5L 3RLOA 1IBMQ 3E9HA 3M7NA 3T1HQ 1TWGH 2FXQA 1XNRL 3CMAA 3RN5A 1YVCA 1QVGA 2NVXH 1KQSA 2A8VA 5AJ3Q 2VQEQ 1IBKL 1N32Q 4DV0Q 1PV4A 1N34L 3KJOA 1XMOL 4C3HH 3M4PA 3F2DA 1XTDA 4DV2L 4DR7L 2OQ0A 2E8GA 3AFQA 4GOPB 2ES2A 2A1AA 2QGQA 2JA7G 1PYSB 1VQFA 2AWNA 4JI4L 4OX9Q 3M3YH 1CKMA 5FLMG 4P72A 1BKBA 2YTVA 4JG2A 3GTJH 3HOWH 2ZTEA 3CC7A 1IBKQ 4LF9L 1K9MC 4KHPQ 1E24A 1XNQQ 4B3SQ 3EIVA 4YY3Q 4LF4L 1QVCA 2JA5H 4DAYB 1CKNA 4MZ9A 4QIWE 4NXNL 1Q8KA 3KFUA 1U5KA 4YHHQ 3FHWA 3HOZH 2PI2A 4JCVE 4JBMA 1NBWA 3H0GH 3CCJA 1V43A 1VQJA 4R4TA 4JI1L 4DV0L 1YEZA 5C0XJ 1I50H 2D62A 4B3TQ 1S72A 1HH2P 1WJJA 3A0JA 2H5XA 4PZ6A 5C0XG 4HIKA 4GNXA 1HNZL 2JA5G 4POGA 2F4VQ 2UXCQ 1SE8A 1X3GA 4UP9A 5IP7G 3U50C 1FGUA 4P73A 5IY0A 4A3KH 1VQ9A 1KAWA 3CQZH 3M4QA 4JI6Q 2ZTCA 3HKSA 5ELOA 2Z6KA 1SLJA 2R92H 4A3DH 1B8AA 2I5MX 1PVOA 2JEBI 1XNQL 3RZDH 2LSSA 5IP7H 4B3SL 4B3RQ 1Y1VG 4GKKQ 1V1QA 1VQ7A 1OXVA 3CCRA 4DV6L 2VQFQ 1FL0A 1KL9A 3T1YL 1YNXA 2BA0A 2WFWA 3TREA 3A5UA 2JA7H 4IPGA 3S15H 5C4XG 2ZJRA 2E5LQ 3CD6A 3W5OA 1SFOH 3GO5A 2JJQA 4IOAA 4X66Q 2NZHA 3B6YA 2F3IA 5HY6A 2QA4A 1QZGA 4LF7Q 2JE6I 1N33L 3M85A 1E1TA 3M4OH 4OWXB 4NXMQ 1YHBA 1W2BA 2I5HA 3KLWA 3S14H 2MQHA 1XPOA 5BR8Q 4JYAL 3KDFB 1J6QA 2NVQH 1L1OA 3HOYG 4DR2L 3CCQA 2VZAA 2Q2IA 4R4IA 5IP9H 2HHHQ 3ULLA 2Y0SG 3K7AH 4DUZL 1VQPA 1N36Q 4O2DA 3KF8B 4X64L 4DV1L 2EIFA 1I5FA 1XMQL 1TWHH 2VQEL 4P75A 3J7A5 3CMEA 4GLVB 2JA6H 5GAEC 4JI5Q 4JI0L 3RLFA 1N33Q 3HKZG 1L1OB 5IWAQ 4BXXG 3PUYA 3I2ZA 4UPAA 4R4CA 5AJ3L 1YJNA 3S17H 4BBRG 3PIPA 3BZCA 4WJ3M 4A3MH 4A3EG 3DM3A 1VQDA 1RIPA 1HNWL 4LFAL 4HIOA 2WB1G 1HNXL 2ZJQA 2NVYH 4LF5Q 4LFBQ 1WI5A 3UE0A 1WFQA 1UE5A 4IPHA 1Z9FA 4A3IH 2UUCL 2R7ZH 3MEFA 1N36L 4JI4Q 3CCSA 4A3LG 1PH9A 5M5XH 3I4OA 4DPGA 3CP0A 4H02A 1X55A 3PO2G 3FP9A 4OWTB 2UUAL 1P8LA 3CAMA 3UDXA 4POFA 2MNAA 1G291 4A3IG 3RN2A 1GM5A 3TS2A 4DV4Q 4OWWB 3Q8DA 4L5TA 3I55A 1EYGA 3I4NG 2Z0SA 1HJPA 1M1KC 4K0KL 4A3FG 2NZOA 3PO2H 4GN3B 1XPUA 4WJ4A 1X65A 2CWPA 1Y1VH 3F8TA 4IJHA 3STBC 3AYHB 4YHHL 4DV7Q 4JI1Q 5M3FG 2R7FA 4JI3L 2UXDQ 1WCMG 5DLQE 4Y52H 4JI2L 3E0EA 2K14A 4JOIA 1KHIA 5LMNQ 5C4XH 4BY7H 2UUCQ 5IYBG 4JBJA 5HGQA 2B63H 2D0OA 4YCVA 4R4QA 3D0FA 2PQAB 1HR0W 3KYHC 2KCMA 5M5WH 3S1QH 1OXUA 1UE1A 4LF8L 4BBSH 4NPSA 3T1YQ 1OXXK 4JI8Q 1MKHA 1YHAA 3SGIA 2Q2TA 4IO9A 2UU9L 1NY4A 3RR5A 1X6OA 3J81i 2R93G 1TWCH 1E22A 3NELA 4KHPL 5IT9c 2I5LX 4BA1I 3A5ZB 1QZHA 2PI2E 3TQYA 3KF6A 4LF4Q 3GTLH 2R7ZG 1QUQB 4HJ9A 3S1RH 4UY8C 2PQAA 5ELNA 4HJ7A 3S2HH 3STBD 4LWCA 1EIFA 4DK3C 4KHZA 3UE1A 2HIXA 4A93G 1VCIA 3F2CA 1Q81C 4HJ8A 2JQOA 1K8GA 1M90C 2RF4A 1VS0A 5IE8A 3I4MH 1X56A 2HHHL 3MXNB 2E2IH 1C9OA 1Q1BA 2V1CC 1CUKA 3I7FA 4GN5A 2K75A 4PZ7A 4TQUS 5FLMH 1MJEA 4JI8L 2KBNA 3U4VA 4C3IH 1EIYB 1NMFA 1FJGL 4DV3Q 5IP9G 1YJWA 3ERSX 3PIOA 2KHJA 4DUYL 2K5NA 4Y7NH 1CSPA 2NN6I 3PUZA 4BY7G 2NN6G 2Z6KC 1KRSA 5IWAL 1PH7A 3KOJA 1BBWA 4LUVA 2K52A 2JA8G 2K50A 1A8VA 4DK6C 1B7YB 3HFZB 5C44H 4YWMA 1YITA 4A3GH 4JV5Q 1OXSC 2KCTA 4QJFA 1ASYA 2UUBL 3H3VH 4LF5L 1R9TH 3HOXH 1VQCA 4QY7A 2AHOB 1VQMA 1Q12A 1GD7A 4AYBG 4BBRH 4HIDA 1Z47A 4B3ML 4A3MG 1YJ9A 2DGYA 4YCWA 1Q82C 4LFCQ 2R92G 4DR3L 3HOUG 4A3DG 2VL6A 1Q7YC 1IL2A 1KXLA 1PH4A 1Q86C 2CWAA 3W1GA 4A3KG 4O0AA 1N32L 1B70B 1X54A 3HOVG 3PUWA 1XNRQ 1HR0L 3ZJYC 1KC8C 5K36G 1BVSA 1UWVA 4C3JH 3CW2C 3M9BA 4K0KQ 1OTCA 2VNUD 2IX0A 4GKJL 1L2FA 3H15A 4A75A 1FVIA 1JJGA 5IYDH 1NMGA 5JJIA 4R1JA 1Q1EA 4ALPA 4JI3Q 2OTJA 2UXDL 1EUJA 3J80c 2UXBL 4JI2Q 1YIJA 4AQYL 1VQLA 1VQEA 3L0OA 5C3EH 1U0LA 3JAMc 1JMCA 1VQGA 1YHQA 1GKHA 2L15A 4KLKA 5C0XI 1X9NA 5LMUQ 4YY3L 4IFDJ 1JJ2A 2EQSA 1VQAA 3UDGA 4OXPA 4GKJQ 4LW1A 4GOPC 3PF4A 4HJAA 2B63G 3CF5A 1X3EA 5C44G 4A3GG 5GQOA 1JJCB 1HNXQ 4B3TL 3GTPH 1I6HH 1LM0A 5JJLA 3VDYA 1ASZA 3NENA 4MTNA 4FDBA 1PH3A 2ALYB 4UP7A 2LXJA 2N49A 4R4OA 2HQLA 3BU2A 4A3JH 4IFDI 4OO1I 1IZ6A 1QVFA 3CC2A 1HZBA 4LFAQ 5EAYA 1PH5A 3G71A 2Q2UA 3LGJA 3HOVH 1VQ5A 4A3JG 3KF6B 5LMUL 4A76A 4DV2Q 3GTMH 2XTIA 3GTQH 3KDFA 1VQ6A 4PG3A 1VQIA 2F52A 3CCUA 3EN2A 4C2MH 1Q46A 4JBKA 1KRTA 1NTGA 1E1OA 1DGSA 2K5HA 2OCEA 3K7UC 1PHJA 4UP8A 2IHEA 1VQNA 4IJLA 4X62L 4XIGS 3S24A 2IX1A 1IXRA 1HZCA 1D8LA 5IYBH 4DR4Q 5JJKA 4DR5L 2AMCB 4JOIC 1EFWA 3HOZG 1GVPA 3CCEA 4HJ5A 1CKOA 1WOCA 3HOXG 3CCVA 1VQOA 3CXCA 1LUZA 2B29A 4GLAC 3HOUH 1T9HA 4YCUA 1K73C 2CCZA 4QL5A 2UU9Q 2ZM6Q 2VY3A 3ICEA 2AKWB 4X62Q 2A19A 2MFIA 2GVAA 2OQKA 2KENA 5H1SE 5BR8L 1N8RC 1PA6A 4B3MQ 1NJIC 4DV1Q 4X64Q 1IBLL 3JC66 1UE6A 3K81C 4A3CG 3PGZA 5C4JH 1BBUA 1WCMH 4A93H 2UXCL 4JI5L 4YWKA 3I56A 3RNUA 2YTXA 2VUMG 5JEAJ 4A3BG 3OW2A 1PH1A 1HZAA 1NE3A 2K5VA 1SR3A 3PCOB 3AFPA 3G48A 4JBWA 1XPRA 1G6PA 2ZJPA 2WAQE 5FJ8G 1HR0Q 4A3BH 4J15A 3J81c 4PZ8A 4GOPA 3CCMA 2YU9H 4DV5Q 1PH6A 3CC4A 3PSIA 5M3MH 4X65Q 1I94Q 5IYDG 1A0IA 1PH8A 4L5QA 1N9WA 3GD7A 4LUOA 3AQQA 1L1OC 1EQRA 3E9IA 1FJGQ 1K3RA 3DLLA 5C3EG 4DV3L 4APVA 4AYBE 4GLXA 1PFSA 2Y0SE 3OTOQ 2GVBA 4NB3A 1IYJB 2WP8J 2Q2HA 3S16H 4A3EH 4DR1L 4JI7L 1MJCA 1YZ6A 2C35B 1TWAH 3G4SA 3NEMA 3H3VI 3K80C 1CKNB 4DR7Q 4X65L 3F2BA 1JB7A 1K0RA 1X3FA 4MNOA 1E3PA 3HKZE 3I4MG 2WB1E 4JYAQ 1C0AA 2ATWA 1A63A 1XMQQ 1VQKA 2MO1A 1HZ9A 5GROA 2ASBA 2JA6G 4IPCA 1N34Q 1TWFH 3GTGH 3FKIH 1RL2A 4JI7Q 5LMNL 1TXYA 2ZTDA 3UDFA 3U4ZA 3GTOH 4GN4B 3L2PA 1XJVA 3L7ZC 2CKZB 2YTYA 5E7NA 2JA8H 2IT1A 4DR3Q 2R6GA 2VS1A 3A74A 4NXNQ 3HOWG 1K8AC 4LF8Q 1J5EQ 2LXKA 5M3FH 4DR6L 2PNHA 4X6AH 2IY5B 2BA1A 1L0WA 2JEAI 4JI0Q 3GTKH 2KHIA 2HIVA 3GDEA 2GN5A 3NBHB 4AH6A 4LNQA 2N78A 4BY1G 4LFBL 3BJUA 1MIUA 3PUVA 1A62A 1E7ZA 2MO0A 1EQQA 2N3SA 1G51A 3PO3G 3BZKA 1K83H 1C7YA 1YI2A 2BH8A 2UXBQ 4AIMA 4BY1H 1S3OA 3WWVA 4AQYQ 1J5EL 4L5SA 4IPDA 3U58A 4IOCA 2E2HH 4A3FH 1EOVA 2F4VL 4QGUA 4HIMA 3W1BA 2CFMA 4GS3A 4EX5A 2NVTH 4KI0A 2IHFA 2VQFL 3S1NH 2DUDA 3S2DH 2BH2A 4DR6Q 1LTLA 1VQ4A 1YBYA 4GKKL 3J80i 1Y1WG 3AEVA 1JT8A 3PF5A 1HNWQ 3ULPA 4P74A 4DAMA 3JAMi 2RHSB 4QQBX 3ULJA 4ME3A 1UE7A 4EQ5A 2RHQB 4DV7L 3D31A 1UEBA 1AE2A 1JE5A 3EBEA 5M3MG 4DKAC 1AH9A 1Y14B 2OWOA 4LF9Q 1I3QH 4BA2I 2R93H 4BXXH 3K8AA 4YWLA 4X66L 3KJPA 3H0GG 1PYBA 4LF7L 1SRUA 2OTLA 3J81j 1O7IA 5GADC 3G6EA 4P71A 4DR4L 5FJ8H 4DR5Q 3CPWA 2XGTA 3PO3H 5GAGC 1SMXA 2EXDA 3J7ZC 4LUZA 4XTCS 3TEHB 5LMNW 3CCLA 1SN8A 1WYDA 3RLNA 3K0XA 3OTOL 2YYZA 3ER0A 4TVAB 4A4IA 2D0PA 1HNZQ 2AWOA 1VQ8A 2UUBQ 4A3LH 4DR1Q 4B3RL 1I94L 3OYYA 2ZM6L 4L5RC 1PH2A 3PV0A 2R7DA 3FKIG 1VQBA 4LFCL 4RMFA 1KIXA 4JI6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA9 A;  4RG1 A;  3I4N H;  2CQO A;  4GNX B;  2B3G A;  3F1Z A;  2E5L L;  4A3C H;  4LF6 L;  1Y1W H;  3IRB A;  2WAQ G;  3S1M H;  4DV6 Q;  2QEX A;  3T1H L;  1QUQ A;  4PMW A;  2VW9 A;  2JK8 A;  1S40 A;  2VUM H;  1VQH A;  1SRO A;  2RCN A;  1KD1 C;  4GNX C;  4NXM L;  1D7Q A;  1GO3 E;  1IBL Q;  4IFD G;  4OO1 G;  5J3B A;  5IYC H;  3RZO H;  2UUA Q;  4OON A;  1AE3 A;  1P16 A;  2N8N A;  1EWI A;  3PUX A;  1V9P A;  4DUY Q;  2ID0 A;  5JEA G;  1LYL A;  3TS0 A;  2E2J H;  4JC0 A;  2I0Q A;  2HT1 A;  4JV5 L;  4LF6 Q;  1H95 A;  4BBS G;  3TRZ A;  1CSQ A;  1OXT A;  2PMZ E;  1IBM L;  2K4K A;  4DNI A;  5IYC G;  3HOY H;  2YV5 A;  5FLX c;  4DUZ Q;  4OX9 L;  1W3S A;  4DV4 L;  3UDI A;  5M5Y H;  5GAH C;  3CPF A;  4DR2 Q;  1XMO Q;  4DV5 L;  3RLO A;  1IBM Q;  3E9H A;  3M7N A;  3T1H Q;  1TWG H;  2FXQ A;  1XNR L;  3CMA A;  3RN5 A;  1YVC A;  1QVG A;  2NVX H;  1KQS A;  2A8V A;  5AJ3 Q;  2VQE Q;  1IBK L;  1N32 Q;  4DV0 Q;  1PV4 A;  1N34 L;  3KJO A;  1XMO L;  4C3H H;  3M4P A;  3F2D A;  1XTD A;  4DV2 L;  4DR7 L;  2OQ0 A;  2E8G A;  3AFQ A;  4GOP B;  2ES2 A;  2A1A A;  2QGQ A;  2JA7 G;  1PYS B;  1VQF A;  2AWN A;  4JI4 L;  4OX9 Q;  3M3Y H;  1CKM A;  5FLM G;  4P72 A;  1BKB A;  2YTV A;  4JG2 A;  3GTJ H;  3HOW H;  2ZTE A;  3CC7 A;  1IBK Q;  4LF9 L;  1K9M C;  4KHP Q;  1E24 A;  1XNQ Q;  4B3S Q;  3EIV A;  4YY3 Q;  4LF4 L;  1QVC A;  2JA5 H;  4DAY B;  1CKN A;  4MZ9 A;  4QIW E;  4NXN L;  1Q8K A;  3KFU A;  1U5K A;  4YHH Q;  3FHW A;  3HOZ H;  2PI2 A;  4JCV E;  4JBM A;  1NBW A;  3H0G H;  3CCJ A;  1V43 A;  1VQJ A;  4R4T A;  4JI1 L;  4DV0 L;  1YEZ A;  5C0X J;  1I50 H;  2D62 A;  4B3T Q;  1S72 A;  1HH2 P;  1WJJ A;  3A0J A;  2H5X A;  4PZ6 A;  5C0X G;  4HIK A;  4GNX A;  1HNZ L;  2JA5 G;  4POG A;  2F4V Q;  2UXC Q;  1SE8 A;  1X3G A;  4UP9 A;  5IP7 G;  3U50 C;  1FGU A;  4P73 A;  5IY0 A;  4A3K H;  1VQ9 A;  1KAW A;  3CQZ H;  3M4Q A;  4JI6 Q;  2ZTC A;  3HKS A;  5ELO A;  2Z6K A;  1SLJ A;  2R92 H;  4A3D H;  1B8A A;  2I5M X;  1PVO A;  2JEB I;  1XNQ L;  3RZD H;  2LSS A;  5IP7 H;  4B3S L;  4B3R Q;  1Y1V G;  4GKK Q;  1V1Q A;  1VQ7 A;  1OXV A;  3CCR A;  4DV6 L;  2VQF Q;  1FL0 A;  1KL9 A;  3T1Y L;  1YNX A;  2BA0 A;  2WFW A;  3TRE A;  3A5U A;  2JA7 H;  4IPG A;  3S15 H;  5C4X G;  2ZJR A;  2E5L Q;  3CD6 A;  3W5O A;  1SFO H;  3GO5 A;  2JJQ A;  4IOA A;  4X66 Q;  2NZH A;  3B6Y A;  2F3I A;  5HY6 A;  2QA4 A;  1QZG A;  4LF7 Q;  2JE6 I;  1N33 L;  3M85 A;  1E1T A;  3M4O H;  4OWX B;  4NXM Q;  1YHB A;  1W2B A;  2I5H A;  3KLW A;  3S14 H;  2MQH A;  1XPO A;  5BR8 Q;  4JYA L;  3KDF B;  1J6Q A;  2NVQ H;  1L1O A;  3HOY G;  4DR2 L;  3CCQ A;  2VZA A;  2Q2I A;  4R4I A;  5IP9 H;  2HHH Q;  3ULL A;  2Y0S G;  3K7A H;  4DUZ L;  1VQP A;  1N36 Q;  4O2D A;  3KF8 B;  4X64 L;  4DV1 L;  2EIF A;  1I5F A;  1XMQ L;  1TWH H;  2VQE L;  4P75 A;  3J7A 5;  3CME A;  4GLV B;  2JA6 H;  5GAE C;  4JI5 Q;  4JI0 L;  3RLF A;  1N33 Q;  3HKZ G;  1L1O B;  5IWA Q;  4BXX G;  3PUY A;  3I2Z A;  4UPA A;  4R4C A;  5AJ3 L;  1YJN A;  3S17 H;  4BBR G;  3PIP A;  3BZC A;  4WJ3 M;  4A3M H;  4A3E G;  3DM3 A;  1VQD A;  1RIP A;  1HNW L;  4LFA L;  4HIO A;  2WB1 G;  1HNX L;  2ZJQ A;  2NVY H;  4LF5 Q;  4LFB Q;  1WI5 A;  3UE0 A;  1WFQ A;  1UE5 A;  4IPH A;  1Z9F A;  4A3I H;  2UUC L;  2R7Z H;  3MEF A;  1N36 L;  4JI4 Q;  3CCS A;  4A3L G;  1PH9 A;  5M5X H;  3I4O A;  4DPG A;  3CP0 A;  4H02 A;  1X55 A;  3PO2 G;  3FP9 A;  4OWT B;  2UUA L;  1P8L A;  3CAM A;  3UDX A;  4POF A;  2MNA A;  1G29 1;  4A3I G;  3RN2 A;  1GM5 A;  3TS2 A;  4DV4 Q;  4OWW B;  3Q8D A;  4L5T A;  3I55 A;  1EYG A;  3I4N G;  2Z0S A;  1HJP A;  1M1K C;  4K0K L;  4A3F G;  2NZO A;  3PO2 H;  4GN3 B;  1XPU A;  4WJ4 A;  1X65 A;  2CWP A;  1Y1V H;  3F8T A;  4IJH A;  3STB C;  3AYH B;  4YHH L;  4DV7 Q;  4JI1 Q;  5M3F G;  2R7F A;  4JI3 L;  2UXD Q;  1WCM G;  5DLQ E;  4Y52 H;  4JI2 L;  3E0E A;  2K14 A;  4JOI A;  1KHI A;  5LMN Q;  5C4X H;  4BY7 H;  2UUC Q;  5IYB G;  4JBJ A;  5HGQ A;  2B63 H;  2D0O A;  4YCV A;  4R4Q A;  3D0F A;  2PQA B;  1HR0 W;  3KYH C;  2KCM A;  5M5W H;  3S1Q H;  1OXU A;  1UE1 A;  4LF8 L;  4BBS H;  4NPS A;  3T1Y Q;  1OXX K;  4JI8 Q;  1MKH A;  1YHA A;  3SGI A;  2Q2T A;  4IO9 A;  2UU9 L;  1NY4 A;  3RR5 A;  1X6O A;  3J81 i;  2R93 G;  1TWC H;  1E22 A;  3NEL A;  4KHP L;  5IT9 c;  2I5L X;  4BA1 I;  3A5Z B;  1QZH A;  2PI2 E;  3TQY A;  3KF6 A;  4LF4 Q;  3GTL H;  2R7Z G;  1QUQ B;  4HJ9 A;  3S1R H;  4UY8 C;  2PQA A;  5ELN A;  4HJ7 A;  3S2H H;  3STB D;  4LWC A;  1EIF A;  4DK3 C;  4KHZ A;  3UE1 A;  2HIX A;  4A93 G;  1VCI A;  3F2C A;  1Q81 C;  4HJ8 A;  2JQO A;  1K8G A;  1M90 C;  2RF4 A;  1VS0 A;  5IE8 A;  3I4M H;  1X56 A;  2HHH L;  3MXN B;  2E2I H;  1C9O A;  1Q1B A;  2V1C C;  1CUK A;  3I7F A;  4GN5 A;  2K75 A;  4PZ7 A;  4TQU S;  5FLM H;  1MJE A;  4JI8 L;  2KBN A;  3U4V A;  4C3I H;  1EIY B;  1NMF A;  1FJG L;  4DV3 Q;  5IP9 G;  1YJW A;  3ERS X;  3PIO A;  2KHJ A;  4DUY L;  2K5N A;  4Y7N H;  1CSP A;  2NN6 I;  3PUZ A;  4BY7 G;  2NN6 G;  2Z6K C;  1KRS A;  5IWA L;  1PH7 A;  3KOJ A;  1BBW A;  4LUV A;  2K52 A;  2JA8 G;  2K50 A;  1A8V A;  4DK6 C;  1B7Y B;  3HFZ B;  5C44 H;  4YWM A;  1YIT A;  4A3G H;  4JV5 Q;  1OXS C;  2KCT A;  4QJF A;  1ASY A;  2UUB L;  3H3V H;  4LF5 L;  1R9T H;  3HOX H;  1VQC A;  4QY7 A;  2AHO B;  1VQM A;  1Q12 A;  1GD7 A;  4AYB G;  4BBR H;  4HID A;  1Z47 A;  4B3M L;  4A3M G;  1YJ9 A;  2DGY A;  4YCW A;  1Q82 C;  4LFC Q;  2R92 G;  4DR3 L;  3HOU G;  4A3D G;  2VL6 A;  1Q7Y C;  1IL2 A;  1KXL A;  1PH4 A;  1Q86 C;  2CWA A;  3W1G A;  4A3K G;  4O0A A;  1N32 L;  1B70 B;  1X54 A;  3HOV G;  3PUW A;  1XNR Q;  1HR0 L;  3ZJY C;  1KC8 C;  5K36 G;  1BVS A;  1UWV A;  4C3J H;  3CW2 C;  3M9B A;  4K0K Q;  1OTC A;  2VNU D;  2IX0 A;  4GKJ L;  1L2F A;  3H15 A;  4A75 A;  1FVI A;  1JJG A;  5IYD H;  1NMG A;  5JJI A;  4R1J A;  1Q1E A;  4ALP A;  4JI3 Q;  2OTJ A;  2UXD L;  1EUJ A;  3J80 c;  2UXB L;  4JI2 Q;  1YIJ A;  4AQY L;  1VQL A;  1VQE A;  3L0O A;  5C3E H;  1U0L A;  3JAM c;  1JMC A;  1VQG A;  1YHQ A;  1GKH A;  2L15 A;  4KLK A;  5C0X I;  1X9N A;  5LMU Q;  4YY3 L;  4IFD J;  1JJ2 A;  2EQS A;  1VQA A;  3UDG A;  4OXP A;  4GKJ Q;  4LW1 A;  4GOP C;  3PF4 A;  4HJA A;  2B63 G;  3CF5 A;  1X3E A;  5C44 G;  4A3G G;  5GQO A;  1JJC B;  1HNX Q;  4B3T L;  3GTP H;  1I6H H;  1LM0 A;  5JJL A;  3VDY A;  1ASZ A;  3NEN A;  4MTN A;  4FDB A;  1PH3 A;  2ALY B;  4UP7 A;  2LXJ A;  2N49 A;  4R4O A;  2HQL A;  3BU2 A;  4A3J H;  4IFD I;  4OO1 I;  1IZ6 A;  1QVF A;  3CC2 A;  1HZB A;  4LFA Q;  5EAY A;  1PH5 A;  3G71 A;  2Q2U A;  3LGJ A;  3HOV H;  1VQ5 A;  4A3J G;  3KF6 B;  5LMU L;  4A76 A;  4DV2 Q;  3GTM H;  2XTI A;  3GTQ H;  3KDF A;  1VQ6 A;  4PG3 A;  1VQI A;  2F52 A;  3CCU A;  3EN2 A;  4C2M H;  1Q46 A;  4JBK A;  1KRT A;  1NTG A;  1E1O A;  1DGS A;  2K5H A;  2OCE A;  3K7U C;  1PHJ A;  4UP8 A;  2IHE A;  1VQN A;  4IJL A;  4X62 L;  4XIG S;  3S24 A;  2IX1 A;  1IXR A;  1HZC A;  1D8L A;  5IYB H;  4DR4 Q;  5JJK A;  4DR5 L;  2AMC B;  4JOI C;  1EFW A;  3HOZ G;  1GVP A;  3CCE A;  4HJ5 A;  1CKO A;  1WOC A;  3HOX G;  3CCV A;  1VQO A;  3CXC A;  1LUZ A;  2B29 A;  4GLA C;  3HOU H;  1T9H A;  4YCU A;  1K73 C;  2CCZ A;  4QL5 A;  2UU9 Q;  2ZM6 Q;  2VY3 A;  3ICE A;  2AKW B;  4X62 Q;  2A19 A;  2MFI A;  2GVA A;  2OQK A;  2KEN A;  5H1S E;  5BR8 L;  1N8R C;  1PA6 A;  4B3M Q;  1NJI C;  4DV1 Q;  4X64 Q;  1IBL L;  3JC6 6;  1UE6 A;  3K81 C;  4A3C G;  3PGZ A;  5C4J H;  1BBU A;  1WCM H;  4A93 H;  2UXC L;  4JI5 L;  4YWK A;  3I56 A;  3RNU A;  2YTX A;  2VUM G;  5JEA J;  4A3B G;  3OW2 A;  1PH1 A;  1HZA A;  1NE3 A;  2K5V A;  1SR3 A;  3PCO B;  3AFP A;  3G48 A;  4JBW A;  1XPR A;  1G6P A;  2ZJP A;  2WAQ E;  5FJ8 G;  1HR0 Q;  4A3B H;  4J15 A;  3J81 c;  4PZ8 A;  4GOP A;  3CCM A;  2YU9 H;  4DV5 Q;  1PH6 A;  3CC4 A;  3PSI A;  5M3M H;  4X65 Q;  1I94 Q;  5IYD G;  1A0I A;  1PH8 A;  4L5Q A;  1N9W A;  3GD7 A;  4LUO A;  3AQQ A;  1L1O C;  1EQR A;  3E9I A;  1FJG Q;  1K3R A;  3DLL A;  5C3E G;  4DV3 L;  4APV A;  4AYB E;  4GLX A;  1PFS A;  2Y0S E;  3OTO Q;  2GVB A;  4NB3 A;  1IYJ B;  2WP8 J;  2Q2H A;  3S16 H;  4A3E H;  4DR1 L;  4JI7 L;  1MJC A;  1YZ6 A;  2C35 B;  1TWA H;  3G4S A;  3NEM A;  3H3V I;  3K80 C;  1CKN B;  4DR7 Q;  4X65 L;  3F2B A;  1JB7 A;  1K0R A;  1X3F A;  4MNO A;  1E3P A;  3HKZ E;  3I4M G;  2WB1 E;  4JYA Q;  1C0A A;  2ATW A;  1A63 A;  1XMQ Q;  1VQK A;  2MO1 A;  1HZ9 A;  5GRO A;  2ASB A;  2JA6 G;  4IPC A;  1N34 Q;  1TWF H;  3GTG H;  3FKI H;  1RL2 A;  4JI7 Q;  5LMN L;  1TXY A;  2ZTD A;  3UDF A;  3U4Z A;  3GTO H;  4GN4 B;  3L2P A;  1XJV A;  3L7Z C;  2CKZ B;  2YTY A;  5E7N A;  2JA8 H;  2IT1 A;  4DR3 Q;  2R6G A;  2VS1 A;  3A74 A;  4NXN Q;  3HOW G;  1K8A C;  4LF8 Q;  1J5E Q;  2LXK A;  5M3F H;  4DR6 L;  2PNH A;  4X6A H;  2IY5 B;  2BA1 A;  1L0W A;  2JEA I;  4JI0 Q;  3GTK H;  2KHI A;  2HIV A;  3GDE A;  2GN5 A;  3NBH B;  4AH6 A;  4LNQ A;  2N78 A;  4BY1 G;  4LFB L;  3BJU A;  1MIU A;  3PUV A;  1A62 A;  1E7Z A;  2MO0 A;  1EQQ A;  2N3S A;  1G51 A;  3PO3 G;  3BZK A;  1K83 H;  1C7Y A;  1YI2 A;  2BH8 A;  2UXB Q;  4AIM A;  4BY1 H;  1S3O A;  3WWV A;  4AQY Q;  1J5E L;  4L5S A;  4IPD A;  3U58 A;  4IOC A;  2E2H H;  4A3F H;  1EOV A;  2F4V L;  4QGU A;  4HIM A;  3W1B A;  2CFM A;  4GS3 A;  4EX5 A;  2NVT H;  4KI0 A;  2IHF A;  2VQF L;  3S1N H;  2DUD A;  3S2D H;  2BH2 A;  4DR6 Q;  1LTL A;  1VQ4 A;  1YBY A;  4GKK L;  3J80 i;  1Y1W G;  3AEV A;  1JT8 A;  3PF5 A;  1HNW Q;  3ULP A;  4P74 A;  4DAM A;  3JAM i;  2RHS B;  4QQB X;  3ULJ A;  4ME3 A;  1UE7 A;  4EQ5 A;  2RHQ B;  4DV7 L;  3D31 A;  1UEB A;  1AE2 A;  1JE5 A;  3EBE A;  5M3M G;  4DKA C;  1AH9 A;  1Y14 B;  2OWO A;  4LF9 Q;  1I3Q H;  4BA2 I;  2R93 H;  4BXX H;  3K8A A;  4YWL A;  4X66 L;  3KJP A;  3H0G G;  1PYB A;  4LF7 L;  1SRU A;  2OTL A;  3J81 j;  1O7I A;  5GAD C;  3G6E A;  4P71 A;  4DR4 L;  5FJ8 H;  4DR5 Q;  3CPW A;  2XGT A;  3PO3 H;  5GAG C;  1SMX A;  2EXD A;  3J7Z C;  4LUZ A;  4XTC S;  3TEH B;  5LMN W;  3CCL A;  1SN8 A;  1WYD A;  3RLN A;  3K0X A;  3OTO L;  2YYZ A;  3ER0 A;  4TVA B;  4A4I A;  2D0P A;  1HNZ Q;  2AWO A;  1VQ8 A;  2UUB Q;  4A3L H;  4DR1 Q;  4B3R L;  1I94 L;  3OYY A;  2ZM6 L;  4L5R C;  1PH2 A;  3PV0 A;  2R7D A;  3FKI G;  1VQB A;  4LFC L;  4RMF A;  1KIX A;  4JI6 L; 
#chains in the Genus database with same CATH topology
 5J1Z A;  5FD6 A;  1U9R A;  5KFE A;  4DL6 A;  1GUG A;  3IRB A;  5CAE B;  4DV6 Q;  5K2M A;  1QUQ A;  5K36 H;  2VW9 A;  1S5F D;  2JK8 A;  4FU0 A;  2ZDQ A;  1KD1 C;  2NU7 B;  5CV9 A;  1BUV T;  1S4Z A;  5C44 B;  3CHB D;  2IW3 A;  4OON A;  1P16 A;  2XN9 C;  1EWI A;  3BZD B;  4UDU C;  3SEB A;  4DUY Q;  1LYL A;  3D6C A;  4JV5 L;  4MTK A;  5BN3 A;  3TRZ A;  1OXT A;  3MR3 A;  2K4K A;  5NUC A;  4DNI A;  5C4J B;  3HOY H;  3OIP A;  5FLX c;  5L1I A;  1NSN S;  1BOS A;  5LOV F;  3MFY A;  4DV4 L;  4ETS A;  5GAH C;  4A3J B;  2XCL A;  2XC9 A;  2E76 C;  1XMO Q;  2D2C C;  1PZI D;  2K5W A;  3M7N A;  1SJE D;  2DY7 A;  1GSA A;  1BO0 A;  1TWG H;  3CMA A;  2EY1 A;  3A7L A;  2UVV A;  3MC0 B;  4UFZ A;  2YU9 B;  3GQC A;  1XMO H;  3J7A V;  3T5H A;  5AJ3 Q;  2VQE Q;  1UC8 A;  4LMQ D;  4BWS C;  3J7A F;  5EPK A;  2NVY B;  3HS0 C;  3H3V C;  5KFM A;  1PV4 A;  1TS5 A;  3HRZ C;  4EQP A;  2PZT A;  4DV2 L;  3F2D A;  1XMO L;  2C2E A;  4DR7 L;  4O3Q A;  1PYS B;  4JI4 L;  2VUG A;  1CM9 A;  1EQT A;  3S15 B;  4RNM A;  3MWE A;  3GTJ H;  2WE6 A;  2FKL A;  3HOW H;  4DV2 H;  1N56 A;  4C3H G;  2ICE C;  2ZTE A;  2IPK D;  4LF9 L;  1K9M C;  1E24 A;  4EGV A;  4YHH H;  3EIV A;  5FO7 B;  2KEE A;  1QVC A;  3P1H A;  2JA5 H;  5FKA C;  4QIW E;  1GXD C;  3X3N A;  1SFO B;  1STY A;  1NBW A;  3H0G H;  4DV0 L;  4R4T A;  4JI1 L;  4JBM A;  1WR2 A;  4RAZ A;  3KHG A;  1YEZ A;  3Q2O A;  2D62 A;  3A0J A;  2JA5 G;  1SE8 A;  3N6X A;  2V59 A;  5IGB A;  5ELO A;  1I4Q A;  3LWU A;  3DWA A;  2B2V C;  1PX2 A;  4IAL A;  2R8G A;  1ZYR C;  1EY6 A;  2FK3 A;  1PVO A;  2JEB I;  4KTA A;  1XNQ L;  5HBR B;  1EWC A;  2LSS A;  2PZW A;  4HN7 A;  3N8D A;  1KJQ A;  3PW2 A;  2DNE A;  1AP0 A;  2W71 A;  2J6S A;  2BOS A;  1TII D;  1HPC A;  4DNR B;  4Q8F A;  1FL0 A;  2HUG A;  2BA0 A;  4DXF A;  1DXM A;  1GUT A;  3TRE A;  3A5U A;  3E5N A;  4JUZ A;  3Q8R B;  1G6Z A;  4KK7 A;  1EIG A;  1JOK A;  3GQB A;  1YNN D;  5IGF A;  1SFO H;  3J81 L;  2JJQ A;  4IOA A;  4X66 Q;  2MPM A;  3B6Y A;  2B2V A;  4ID6 A;  3TII A;  2Q8R E;  1N33 L;  1K8O A;  1KC7 A;  2FHT A;  1W2B A;  1NNX A;  1C30 A;  3EVQ A;  4JYA L;  3PVX A;  3E6Z X;  4QIW A;  1PFN A;  5L37 A;  1J6Q A;  1L1O A;  3HOY G;  4ULL A;  2ATL A;  1G91 A;  2RDH A;  1TS4 A;  2Q2I A;  5LA6 F;  5EWG A;  1RYS A;  2DPI A;  3ULL A;  1VQP A;  1N36 Q;  3HOY B;  3I72 A;  1BCP B;  1TWH H;  3P20 A;  5EOY A;  1EYA A;  3J81 E;  2C2D A;  3URY A;  5GAE C;  4JI5 Q;  4M9U A;  4JI0 L;  1BNZ A;  2VB3 X;  4J6H A;  3MXN A;  4Z9C B;  3QWN A;  4R4C A;  4QWE A;  4KV6 A;  1TS2 A;  1MHW C;  1JIC A;  2VA2 A;  1DD2 A;  2FPI B;  3I8Z A;  4N8F A;  5CC4 A;  4LFB Q;  4I55 F;  2MJ8 A;  2SEB D;  2XGQ A;  1VMC A;  1K1S A;  4MV3 A;  1OO9 B;  2UUC L;  2E2I A;  2F03 A;  1PH9 A;  4RH6 A;  5M5X H;  4H02 A;  1RD9 D;  2CW0 D;  4OWT B;  1I4G A;  1P8L A;  1TWH A;  4KHP H;  3JSL A;  3ONA B;  4DV4 Q;  4L5T A;  1EYG A;  3I55 A;  3I4M B;  5L1J A;  3RIZ A;  2O2L D;  3BDC A;  1F77 A;  4A3F G;  2YRX A;  2XGP A;  2K04 A;  4WJ4 A;  3P75 A;  3I91 A;  4DK1 A;  3RGZ A;  5M5Y B;  2IBK A;  4O3N A;  1SMY C;  4CKC A;  5M3F G;  4JI3 L;  2FK2 A;  2VQD A;  4Y52 H;  1VBG A;  4KY5 A;  1RF2 D;  2OEO A;  1BF4 A;  4KY6 A;  3TSS A;  1KHI A;  4V19 0;  4JBJ A;  4YCV A;  3D0F A;  3MR5 A;  3NQI A;  3MA2 B;  5M5W H;  2WIN B;  1SYF A;  5CMD A;  1LTI D;  3Q24 A;  4YAJ B;  4ECW A;  2V4R A;  1ICW A;  4FM9 A;  4L6T B;  1MKH A;  4JI8 Q;  1JC7 A;  1TAE A;  5CV8 A;  2Z4I A;  1X6O A;  1JCK B;  3J81 i;  2R93 G;  3NEL A;  1C8C A;  3KF6 A;  3MVV A;  5HGT A;  5FLX E;  4HJ9 A;  4BY1 B;  3GTL H;  3I70 A;  5ELN A;  1CK1 A;  4TV9 F;  3LWE A;  4MTE A;  3S2H H;  3UE1 A;  1LT3 D;  2KVM A;  4Q0F A;  1M4V A;  4DR5 H;  1EHI A;  3C46 A;  2JQO A;  5IE8 A;  1UNS A;  2J7Z A;  1EUC B;  4UCO A;  1M6V A;  2HVR A;  1QWY A;  5C4X B;  4TQU S;  1Y1V B;  1HR0 H;  1WTP A;  2VUM B;  2PNR C;  5IP9 G;  1YJW A;  4RWS C;  2G9D A;  2KHJ A;  4DUY L;  2K5N A;  4DN4 M;  4UCT A;  3T5K A;  4IHJ F;  2FLP A;  1JKJ B;  1WTO A;  5IWA L;  5D14 A;  5JVL A;  4BWG B;  3KOJ A;  1DIK A;  4HR7 B;  3TBI B;  4YBZ B;  3NUC A;  4WD3 A;  4B3M H;  2PVP A;  1NR4 A;  1YIT A;  3RUZ A;  2WV6 D;  2ZXR A;  3JRX A;  3VR2 A;  4QJF A;  5L9X A;  5DLF A;  2PW5 A;  1XYI A;  1SBB B;  1YNJ D;  1VQM A;  3EJI A;  1GD7 A;  4B3M L;  3R23 A;  1PTO H;  2A6H C;  1YJ9 A;  3PQI A;  5JOB A;  4EBE A;  1Q7Y C;  1U4L A;  4NKL A;  1IL2 A;  1KXL A;  1S5C D;  4J9P A;  2CWA A;  1EY7 A;  1X54 A;  4APM A;  1KC8 C;  1BVS A;  1UWV A;  3JZI A;  4K0K Q;  5D1O B;  3DWP A;  5C5M A;  2IMW P;  2E2I B;  1A15 A;  4ME5 A;  5KND A;  4R1J A;  4ALP A;  1K83 B;  5C1O A;  3Q8S B;  3BJY A;  4AQY L;  1EY0 A;  2YRW A;  4Q44 A;  2Z6B A;  1VQG A;  4MV8 A;  2PQE A;  4C3H B;  3KHL A;  2KCC A;  4K6D A;  4AQY H;  3TP6 A;  3J80 W;  4JVZ A;  3PF4 A;  3HEJ A;  4HJA A;  3CF5 A;  4A3G G;  3GTP H;  1JJC B;  1K1Q A;  1N32 H;  3RB3 A;  4DR6 H;  2N49 A;  5C6A A;  5D1P A;  5C1P A;  2Q2U A;  4ECY A;  3LGJ A;  4HCS A;  3K5O A;  4A3J G;  3M4I A;  5JPN C;  1WSC A;  2XTI A;  4RHS A;  3AU7 A;  1VKZ A;  2ASD A;  3KDF A;  1EYD A;  4PG3 A;  1LTR D;  2SNM A;  2F52 A;  3HGB A;  3T56 B;  3EN2 A;  1TS3 A;  5A2Q W;  4J9K A;  1LLR D;  3L3O C;  4JBK A;  4UP8 A;  5M3M B;  4RNO A;  3V6K A;  4YJ2 F;  2AMC B;  1EFW A;  2Q8T A;  1WOC A;  3I73 A;  4KJN A;  5T1G A;  2E74 C;  3CXC A;  3RF2 A;  2WAQ B;  1IOW A;  2F0G A;  2RBM A;  4ODG A;  2PCF B;  4QL5 A;  2A69 D;  3WOE A;  2VY3 A;  3ICE A;  4E4T A;  2AKW B;  5KFS A;  5H1S E;  2KEN A;  4ECZ A;  2RSO A;  3NPP A;  3V96 A;  2R7M A;  2R86 A;  4X64 Q;  4UCR A;  1TWC B;  4LF7 H;  3N44 B;  2EPB A;  3GV6 A;  3I3C A;  1IBL L;  2ALZ A;  4A3C G;  4BBS B;  2HVQ A;  1GSH A;  3G6V A;  5JJZ A;  4JI5 L;  3I56 A;  5JEA J;  2UVU A;  1PTO D;  4V0B A;  1IBL H;  3K5M A;  1BCP D;  3G48 A;  1G6P A;  3RAX A;  3VYT A;  2ZJP A;  3J80 L;  1IYU A;  1HR0 Q;  1QOH A;  4GOP A;  4DV5 Q;  2CH4 A;  3PSI A;  5M3M H;  3M7G A;  1PH8 A;  4LUO A;  4R8U A;  2NUC A;  1FJG Q;  1K3R A;  4RUC A;  4DK0 A;  4GLX A;  2F0H A;  4APV A;  3MTS A;  3R3O A;  4NB3 A;  4ED8 A;  2ZJT A;  1MJC A;  2X6L A;  3RJ0 A;  4QCL A;  1FJG H;  4YIJ A;  2JEI A;  2R3Z A;  5ELB A;  1K0R A;  4H0L C;  3F8N A;  5CV4 A;  3I4M G;  4TRD A;  3OHX C;  1ZEQ X;  3NQT A;  1XMQ Q;  4CJ1 B;  2ASB A;  1O7L A;  4UCU A;  2I46 A;  3D4D A;  2LKV A;  5A2Q L;  3HZX A;  4CBV A;  3GTG H;  5LMN L;  3UDF A;  5I6W A;  2W9B B;  2HCI A;  4GN4 B;  3L2P A;  1XJV A;  2ICI A;  5E7N A;  2JA8 H;  4OEL B;  1UC9 A;  1I50 B;  3GIQ A;  2R6G A;  3D4R A;  4LF5 H;  1D1K A;  2Y0S B;  1K8A C;  3WO0 A;  1JLL B;  4Y8V B;  3NGD A;  2F0F A;  5M3F H;  4H44 C;  2IA6 A;  5J39 A;  3GTK H;  2HIV A;  1J8I A;  4YB8 B;  4LNQ A;  2N78 A;  2QW7 A;  1LTA D;  2XSC A;  3GTO B;  1K83 H;  3PIP 3;  2BE5 D;  1C7Y A;  3BA8 A;  3KBG A;  1ET6 A;  3K5N A;  1YI2 A;  4BY1 H;  3K0Y A;  3WWV A;  3GTL B;  4AQY Q;  2R93 A;  3U58 A;  5F9N A;  3S16 B;  2E2H H;  1DJR D;  1EOV A;  3KLS A;  5KFF A;  1M8A A;  2NVT H;  4CJ0 B;  4LK1 C;  2VQF L;  2DUD A;  2BH2 A;  1PTO F;  1VQ4 A;  1CHQ D;  4GKK L;  2DNC A;  3FVQ A;  2VQF H;  1B50 A;  1JOQ A;  4DAM A;  5KG1 A;  4QQB X;  4ME3 A;  1O7Z A;  1UE7 A;  1I4P A;  4X3S A;  4EQ5 A;  1AZP A;  1SE2 A;  3S1Q B;  1ZHS A;  4J0M A;  3BQ0 A;  1UEB A;  1DM0 B;  2OWO A;  3QJY A;  4LF9 Q;  5J2T F;  4BA2 I;  2E2J B;  1HXY D;  4BXX H;  4C2M A;  1SNM A;  4YWL A;  1SYB A;  1B9M A;  1ESR A;  4KKT A;  3T13 A;  4I7H A;  4WFN 3;  3I12 A;  3PR5 B;  4YR0 A;  3V6J A;  5GAD C;  3S9W A;  1GUW A;  2K32 A;  3TZD A;  2PBZ A;  1X3P A;  5IIF A;  1B53 A;  4TVA B;  3ER0 A;  4A4I A;  1K0S A;  4DR1 Q;  2XVS A;  3OYY A;  1PH2 A;  4C5C A;  3PV0 A;  4XQQ A;  5KT3 A;  2O5J C;  4ZQ3 A;  1HNW H;  5CA0 F;  4PDB A;  4MA0 A;  2JA9 A;  2N88 A;  4RG1 A;  3I4N H;  4IR1 A;  1EZ6 A;  1N33 H;  3VR3 A;  1TKW B;  1LTT D;  2B3G A;  5KNC A;  5KX5 F;  1Z2O X;  2WKD A;  1BNC A;  4ZCK A;  1STH A;  3TQT A;  1G2T A;  3PMF A;  3T1H L;  2UUA H;  4PMW A;  2JA5 A;  2RCN A;  4NXM L;  4GNX C;  4G7Z C;  2V4Q A;  5CR3 A;  4OO1 G;  2ASL A;  5CYU A;  4K0K H;  4FVM A;  3QIA A;  5E3F A;  5BR8 H;  5E4W C;  1AE3 A;  4A3D B;  3OW7 A;  1V9P A;  4H7B A;  2ID0 A;  2HT1 A;  3Q1K A;  3TS0 A;  4JI4 H;  2E75 C;  1EUD B;  2PMZ E;  3K7A B;  2QK4 A;  1SDF A;  4DV5 H;  4NP5 A;  1BDO A;  1XNR H;  5KT5 A;  4WJW A;  2R92 A;  1I50 A;  2G9H D;  5D65 A;  3UDI A;  5M5Y H;  2Z8L A;  3C1E A;  5C0X H;  1WD1 A;  1V1P B;  4DV5 L;  3ND8 A;  4F50 A;  1XNR L;  1M0W A;  1E2W A;  1YVC A;  4DV0 H;  1EYC A;  4JI1 H;  4CHT B;  1RKN A;  5DLG A;  1ICF B;  4QIW B;  2KJX A;  4HMI A;  1KDB A;  1KQS A;  4IRK A;  3C3L A;  5F2D A;  3N40 P;  1N32 Q;  4DV0 Q;  2UUC H;  3GTL A;  3KJO A;  3M4P A;  3BG5 A;  1XTD A;  1WTR A;  5KGU A;  2O5I C;  3AFQ A;  1HQM C;  4C3I G;  2A1A A;  2QCP X;  5KG5 A;  1JXL A;  4IZ8 A;  4JI7 H;  5KFN A;  4O4H F;  3GTP A;  2HDM A;  2AWN A;  1XNQ H;  1TWF B;  4ECX A;  5FLM G;  4P72 A;  1BKB A;  1F9R A;  2YTV A;  1VBH A;  1JX4 A;  5KYL A;  2RKS A;  5JVD F;  3ERO A;  2A68 C;  4CC5 A;  1MGS A;  1S68 A;  2A6E D;  3N42 B;  4YY3 Q;  3OMC A;  3S14 B;  2K28 A;  5I9P A;  4CDD C;  3FHW A;  2PI2 A;  1V43 A;  1VQJ A;  2KA7 A;  1EU3 A;  5KFW A;  4F4X A;  2HJW A;  1HH2 P;  1WJJ A;  4PZ6 A;  5KFH A;  4POG A;  2UXC Q;  5BPF A;  3KBX A;  4LMY A;  4UP9 A;  1FGU A;  2W8K A;  1VQ9 A;  4RU9 A;  1X32 A;  5KFB A;  2ZTC A;  4K5W A;  2Z6K A;  4MV1 A;  1SLJ A;  3SK8 A;  5TSS A;  2EJG C;  2B2U C;  4C3J G;  2DWC A;  4DR4 H;  3VPC A;  3VR5 A;  1Y1V G;  4GKK Q;  3GP7 A;  2W6M A;  3T53 B;  1VQ7 A;  2QEJ C;  3VPD A;  2CQY A;  3CCR A;  4DV6 L;  2VQF Q;  4FS2 A;  1KL9 A;  1YNX A;  2WFW A;  2AUJ D;  4EBC A;  2DJG C;  5C4H A;  2ZJR A;  2E5L Q;  2R82 A;  3GTJ A;  3FPU B;  4IUQ A;  2QYZ A;  3V05 A;  2NZH A;  5KT7 A;  1QZG A;  2QA4 A;  1BCP F;  1Y1W B;  3M4O H;  3DXJ C;  1AEX A;  4OWX B;  1GJX A;  2E5L H;  1TWA B;  2BDN A;  3S14 H;  4DUY H;  3KDF B;  2A69 C;  5A2Q E;  3PR4 A;  3U9O A;  4RB0 A;  4DR2 L;  4DAP A;  1I4H A;  3CCQ A;  2EYF A;  5DQI A;  3ND9 A;  3GTG B;  3K7A H;  4DUZ L;  4O2D A;  1PYW D;  4DV1 L;  4HQ6 A;  2EIF A;  4Q5V A;  1XMQ L;  4DR2 H;  5CGK A;  4RNN A;  2DN8 A;  4ILW A;  3CME A;  2R92 B;  3RB6 A;  3Q23 A;  4U6P A;  2RQX A;  3A8I E;  2R7L A;  3HG9 A;  2YCH A;  5C5L A;  5C8Y F;  1XMQ H;  2CVR A;  3PUY A;  1BCP C;  5LL6 X;  3OTO H;  3QOL A;  4H13 C;  4PMB A;  4UPA A;  4ZYS A;  1GSO A;  5AJ3 L;  2FLL A;  4RGM A;  5ELC A;  1S97 A;  4J1M A;  4A3M H;  3DF7 A;  3J7Y W;  2HD3 A;  1RIP A;  2I80 A;  2WB1 G;  3I4L A;  5EGT A;  1WFQ A;  2F0N A;  4C1N K;  2XIG A;  4IPH A;  1Z9F A;  4A3I H;  2R7Z H;  3MEF A;  4JI4 Q;  2R61 A;  3CCS A;  4A3L G;  3SE0 A;  2NB0 A;  2GPW A;  4LF6 H;  3I4O A;  3PO2 G;  3FP9 A;  1LTB D;  3VPB A;  3CAM A;  4ED7 A;  3BDL A;  4POF A;  1G29 1;  2F0L A;  4A3I G;  1BBX C;  3TS2 A;  4J8Q A;  2QIL A;  3I4N G;  1ZYR D;  3S1R B;  1F2Z A;  2NZO A;  4GN3 B;  1X65 A;  1Y1V H;  3BA9 A;  4FXG C;  1GUO A;  1W6J A;  2E2H A;  1CQF A;  5DQH A;  4G57 A;  2R7F A;  3K5I A;  1WCM G;  4QUF A;  4DF7 A;  2RSN A;  1GOZ A;  4Q45 A;  5C4X H;  2UUC Q;  5IYB G;  2B63 H;  3N52 A;  2D0O A;  5E1F A;  4ECV A;  4R4Q A;  3DHQ A;  2PQA B;  1HR0 W;  1ESF A;  4PWQ A;  4N9P A;  3KYH C;  2KCM A;  3FMC A;  3O13 A;  5T14 A;  1UE1 A;  4ZAI A;  1YHA A;  4RKB A;  4IO9 A;  1XTC D;  5EKI A;  1XWE A;  3FDT A;  2UU9 L;  1NY4 A;  3K58 A;  1E22 A;  1IBK H;  4F88 A;  3M3Y B;  4J9L A;  2PN1 A;  3Q0A A;  3T51 B;  2WKC A;  2NVT B;  5KFU A;  2PI2 E;  1VAJ A;  4B3S H;  2R7Z G;  1GLV A;  1S0M A;  2E2D C;  5J2U F;  4HJ7 A;  1SXT A;  2YU9 A;  1U4P A;  4RZR A;  4LWC A;  4DK3 C;  3RAQ A;  4KHZ A;  3C0F B;  2HIX A;  5EZY F;  2YS7 A;  4ABN A;  3BAA A;  1IHZ A;  4HJ8 A;  5DM7 3;  1K8G A;  1M90 C;  5KG3 A;  2N55 A;  4DV3 H;  4XYQ A;  1I7L A;  2HHH L;  5BPH A;  1Q1B A;  1Y1W A;  1MJE A;  4ECQ A;  2K75 A;  3ETH A;  1T5E A;  4LJZ C;  5KKN B;  4C3I H;  4YQW A;  4DV3 Q;  1EFI D;  5ISR A;  4FBU A;  4ZUI A;  2ZXO A;  3PIO A;  2X0S A;  2HHH H;  3R5H A;  3KUP A;  3NXW A;  4JPB W;  5FLX W;  1FYC A;  4Y7N H;  2NN6 I;  2W6O A;  2NN6 G;  5M5X B;  3PZP A;  4YR3 A;  1UEA B;  1HNZ H;  2PW7 A;  3LNN A;  4Q8E A;  2GA4 B;  3GTG A;  2K50 A;  1A8V A;  1AW7 A;  1B7Y B;  5D3D A;  5C44 H;  4YWM A;  3OUU A;  4X64 H;  1E2V A;  3JRW A;  4O42 A;  5DQG A;  2UUB L;  1MBY A;  3H3V H;  2BR0 A;  1VQC A;  2M05 A;  5J22 A;  4TKO B;  1Z47 A;  4C1N I;  5L1L A;  5KFR A;  4F87 A;  2R92 G;  1Q8I A;  3U9S A;  4A3D G;  2VL6 A;  1EEF D;  3S17 B;  1Q86 C;  5CA1 F;  4DGZ A;  4A3K G;  2GLT A;  4O0A A;  1N32 L;  3HOV G;  1CQI B;  1XNR Q;  3CW2 C;  4RB1 A;  1AUV A;  1RJT A;  1Z2N X;  4XYM B;  4PV1 C;  4KN7 C;  1RCV D;  3HBL A;  4ZKC B;  4A75 A;  1SYE A;  1JJG A;  3OOC A;  1Q1E A;  4JI3 Q;  3BAB A;  2UXB L;  4IUV A;  1QNK A;  3D3R A;  3L0O A;  5C3E H;  1VQL A;  1U0L A;  3ETJ A;  4F4Z A;  3PW5 A;  3K59 A;  1X9N A;  1ENA A;  4G4K A;  1UUP A;  2C9O A;  3TP8 A;  4YY3 L;  4RGO S;  2R87 A;  1VQA A;  3EFX D;  5IT9 W;  1WTV A;  1L0X B;  4F4W A;  1KDC A;  2L11 A;  2B63 G;  1JDB B;  3MWD A;  1IW7 D;  1X3E A;  5C44 G;  2LMC B;  1BQQ T;  3KLS X;  1I6H H;  4C5B A;  1KEE A;  1ASZ A;  3C1F A;  3NEN A;  2B63 B;  3T5L A;  1PH3 A;  5JH7 F;  2LXJ A;  5KIX A;  1IZ6 A;  3N41 B;  3J81 W;  4IUT A;  3IG0 A;  2CW8 A;  3SR1 A;  5EAY A;  5DEH A;  2F0Q A;  4R9W A;  3HOV H;  1RYR A;  3KF6 B;  5I9O A;  1L2Z A;  5JAV A;  4C3J B;  4LFA H;  4B08 A;  3GTM H;  1S9F A;  1F9P A;  1VQI A;  5C4Z A;  3TN2 A;  1Q46 A;  3DEP A;  3I90 A;  5KG0 A;  1PHJ A;  2IHE A;  1RJP A;  1IXR A;  1HZC A;  4RHR A;  4DR4 Q;  4MHE A;  5JJK A;  3ORR A;  1I6U A;  4JOI C;  4AYB A;  3EPG A;  1STB A;  4HJ5 A;  4GKK H;  3HOX G;  5I4D A;  2F0M A;  4HYK A;  3N6R A;  5EKL A;  3VYU A;  2VPS A;  2YZM A;  1EEI D;  2UU9 Q;  5KFC A;  3VA5 A;  1HTP A;  4K8J A;  2XRS D;  1MD2 D;  4C5A A;  4B3M Q;  4J9O A;  3RB4 A;  3TIG A;  2SDF A;  4OIJ A;  1T5X D;  4DV1 Q;  1DZ1 A;  4JV5 H;  1K3B C;  1PFM A;  1TWF A;  3EQL C;  5KT6 A;  5FK9 C;  4EFE A;  2V4D A;  2F0O A;  4XT3 B;  5EQ0 A;  3PGZ A;  1IKL A;  5C4J H;  1WCM H;  1V8Q A;  4LAA A;  2K6A A;  2IWH A;  3V4Z A;  2C5C A;  1ILP A;  2JEG A;  1G2S A;  2W6Q A;  5C3X A;  4N8X 1;  1PH1 A;  5JUM A;  1NE3 A;  3PCO B;  2HDL A;  5COY A;  1CA6 A;  1TWG B;  2L4N A;  4KMU C;  2WAQ E;  3R2I A;  2C28 A;  1GGO A;  2HQE A;  4A3B H;  1DOM A;  1F9Q A;  2YU9 H;  4PZ8 A;  3JSN A;  3CCM A;  3WOF A;  1YNN C;  1IOV A;  2PMZ A;  3RFC A;  1A0I A;  1WD0 A;  2FJZ A;  4O3O A;  4DR1 H;  3R5F A;  2FMA A;  3E9I A;  2KOL A;  1KLG D;  5C3E G;  3TP7 A;  3OTO Q;  2GVB A;  4X65 H;  4O1N A;  4G7O C;  3T1H H;  4DR7 H;  4DR1 L;  1YZ6 A;  3G4S A;  3K80 C;  1E4E B;  1CKN B;  1WH2 A;  4A3I B;  4DR7 Q;  4X65 L;  1JB7 A;  1X3F A;  2WB1 E;  4JYA Q;  1QB5 D;  1WTW A;  1C0A A;  2B2W C;  5IGG A;  1SEI A;  5EJW A;  1I3Q A;  1VQK A;  1HZ9 A;  1TU2 B;  1N34 Q;  3NK9 A;  4DU9 A;  5ELF A;  3OHA A;  1B4O A;  2KCN A;  3RMH A;  5LHY 1;  2ZTD A;  1AN7 A;  2YTY A;  2M9V A;  1STN A;  4CC6 A;  2B63 A;  1F2L A;  3SVM A;  3A74 A;  2VS1 A;  3FDS A;  4NXN Q;  3K6O A;  4X3K A;  1J5E Q;  5KFP A;  2PNH A;  4X6A H;  2AU0 A;  2J4X A;  4K8I A;  3BYY B;  3NP8 A;  4EQO A;  2JEA I;  3LWB A;  4ME6 A;  2NU8 B;  2GN5 A;  1F9S A;  1MIU A;  2BQ3 A;  1SNQ A;  4UHV A;  2K7V A;  1EQQ A;  1B6S A;  2N3S A;  2SCU B;  1WTH A;  1H9M A;  3F2U A;  3JAM E;  1E4F T;  2BH8 A;  2I07 B;  3WDN A;  2W9C B;  1J5E L;  4GKJ H;  2B2T C;  1V51 A;  4KKS A;  1Z2P X;  4A3F H;  5IT9 L;  3KLR A;  5IGC A;  3K5H A;  4GS3 A;  2NU6 B;  5D1O A;  5FD5 A;  4ED0 A;  2NTT A;  2IHF A;  3S1N H;  4TQS A;  3MJF A;  1LTL A;  2ZDH A;  5CBA E;  3J80 i;  3AEV A;  3PF5 A;  1JWS D;  3GII A;  3JAM i;  4IRD A;  4FS1 A;  5KFT A;  3ULJ A;  4UCV A;  1Y8P B;  3D31 A;  4DV7 L;  1TWC A;  2YZG A;  1AH9 A;  3QZ7 A;  1GYF A;  1HUM A;  2ZDG A;  4XYL B;  2R93 H;  2F0K A;  4X66 L;  4ED1 A;  4L8J A;  3GTM B;  4NXM H;  1SRU A;  2OTL A;  4IQZ A;  3OSO A;  4P71 A;  4DR4 L;  1JDE A;  5K5P A;  4QMG A;  2VR1 A;  3X3M A;  3PO3 H;  3A54 A;  4LUZ A;  2M00 A;  3RLN A;  2UUB Q;  2YYZ A;  2D0P A;  3E0J A;  1NUC A;  1WVL A;  4O2B F;  2J6U A;  2R7D A;  1O75 A;  5KFL A;  5CB4 F;  4RMF A;  2EYH A;  4JI6 L;  1PTO B;  2EYL A;  5D8D A;  4ZRZ A;  3HOZ B;  1A3T A;  3LP8 A;  2CQO A;  3F1Z A;  2E5L L;  4ECT A;  1Y1W H;  5AFW A;  3S1M H;  2WAQ G;  1M0T A;  3NBH A;  2FMM A;  5C3E B;  1S40 A;  1VQH A;  1SRO A;  4WRD A;  1GO3 E;  3BVZ A;  4LH7 A;  3KAL A;  5KT2 A;  4IFD G;  1ULZ A;  5J3B A;  5IYC H;  3RZO H;  1B2T A;  3IL8 A;  2N8N A;  2E2J H;  2XCA A;  4DUZ H;  2VPQ A;  4FBT A;  4K14 A;  4HTH A;  4BBS G;  4JI3 H;  1CSQ A;  4IFD H;  1G8Z D;  5IYC G;  1UAP A;  2YV5 A;  2O03 A;  4DUZ Q;  2A68 D;  1B3Q A;  4I50 F;  1QJO A;  3T5J A;  1W3S A;  1SND A;  5HUR A;  3ERQ A;  3E5S A;  3CPF A;  4OHJ A;  4DR2 Q;  1CS0 A;  4L1K A;  1W93 A;  3SXH A;  3RLO A;  3E9H A;  2BDO A;  3T1H Q;  2B2Y C;  3BQ2 A;  1T36 A;  5FOB B;  3RBE A;  2EJF C;  3W2D A;  3QO2 A;  4I7Z C;  2A8V A;  1SSO A;  1IL8 A;  2EVB A;  2R93 B;  5KFX A;  2D9U A;  2AGQ A;  3GTQ B;  3A8K E;  3D6W A;  1EWH A;  1N34 L;  2L12 A;  1S0O A;  4A3K B;  4C3H H;  2R7K A;  4OGQ C;  2OQ0 A;  2E8G A;  4GOP B;  4A3E B;  2QGQ A;  2JA7 G;  4OX9 Q;  1XDN A;  3M3Y H;  1CE8 A;  2CH4 W;  3VMM A;  4JG2 A;  4DL5 A;  4R8U B;  1D6E C;  1O7Y A;  3CC7 A;  4IWX A;  3NBI A;  4OX9 H;  3G6J B;  1CT1 D;  1GHJ A;  4ZLT F;  1TR5 A;  4DAY B;  3MFG A;  4MZ9 A;  4NXN L;  3FKI A;  3KFU A;  3RV3 A;  4YHH Q;  4ECR A;  3HOZ H;  1FR3 A;  4JCV E;  5CBE E;  3WNZ A;  1SYC A;  5E4X A;  1I50 H;  1S72 A;  4RA8 A;  2IX1 A;  1CI3 M;  4GNX A;  4HIK A;  1CQJ B;  2DY8 A;  2F4V Q;  1KNE A;  5FO9 B;  1X3G A;  3OUZ A;  4OIK A;  3OHB A;  5IY0 A;  5DAU A;  2UU9 H;  1KAW A;  3M4Q A;  5FLX L;  4P2C B;  5I47 A;  1KAA A;  3PO3 B;  2R92 H;  4A3D H;  4K6L A;  2JXM B;  2KHS A;  2YS6 A;  3RZD H;  4B3S L;  4B3R Q;  1EZ8 A;  3GTJ B;  4DV1 H;  5KFO A;  1V1Q A;  5M9O A;  3M9M B;  2K5D A;  5KFK A;  4GC6 A;  1RK6 A;  2K01 A;  2F3W A;  4B3R H;  4MV6 A;  2JA7 H;  2ZM6 H;  1WCM A;  1SNP A;  4LF4 H;  4IPG A;  1HUN A;  3S15 H;  3N43 B;  4YAK B;  2R8K A;  3W5O A;  5CV5 A;  4LF7 Q;  5IGD A;  2F3I A;  1E1T A;  1K28 A;  4NXM Q;  4I4T F;  3LX0 A;  3GIP A;  2I5H A;  3KLW A;  4DL7 A;  2F0W A;  5BR8 Q;  1PDQ A;  3DWQ A;  2NVQ H;  3BG3 A;  4IZO A;  1JWU D;  4R4I A;  1Y8N B;  1DCZ A;  5IP9 H;  2RA4 A;  2HHH Q;  2NUA B;  3TZU A;  2R7Z A;  1IYV A;  3GV3 A;  3P7J A;  4X64 L;  4PNY A;  1PTO C;  2EYO A;  4C56 C;  4CJ2 C;  5ELE A;  4QWD A;  2P0A A;  4O4L F;  3DEO A;  5EBD A;  3RLF A;  3HKZ G;  1L1O B;  1QE6 A;  3I2Z A;  3KF8 A;  4KKU A;  1BJT A;  2FK1 A;  1A2T A;  4DA2 A;  4IUN A;  4ZOL F;  2X69 A;  2F0P A;  4FO2 A;  3A7A B;  3S17 H;  1V1O A;  2F0D A;  4WJ3 M;  1B1Z A;  5G3L D;  1KJ9 A;  3DM3 A;  1CZG A;  4HIO A;  1HNX L;  3VA7 A;  5IT9 E;  3OWF A;  2ZJQ A;  3WO1 A;  1WI5 A;  3UE0 A;  1KBL A;  3RBD A;  3GTQ A;  1UE5 A;  4DFA A;  1KTK A;  1LT5 D;  5FPO A;  3GV7 B;  1FNW A;  4IUU A;  2B2Y A;  3UDX A;  3GV8 B;  2R8J A;  1X3Q A;  4YY3 H;  4OWW B;  1WTX A;  1HJP A;  1M1K C;  4JI2 H;  1BXR A;  1Y69 U;  2CWP A;  2JA6 B;  4GZY C;  3F8T A;  4IJH A;  2W6Z A;  2WAC A;  2JA5 B;  4DV7 Q;  1SYG A;  5G3L F;  3MR6 A;  2UXD Q;  4JI2 L;  2K14 A;  2MHV A;  2B39 A;  4KD4 A;  5LMN Q;  4BY7 H;  2KSW A;  4RB2 C;  3HP3 A;  4J9S A;  1GUS A;  1STG A;  1ZKO A;  1EY9 A;  4BBS H;  4NPS A;  3T1Y Q;  1OXX K;  2K1B A;  4KD3 A;  2Q2T A;  5KFQ A;  2J6T A;  1DYQ A;  4OL7 A;  3RR5 A;  3FPP A;  3NTI A;  2DZD A;  3GID A;  5L1K A;  2EYM A;  5IT9 c;  3KTM A;  1V1P A;  4BA1 I;  3Q22 A;  5KG6 A;  1I7N A;  5EPL A;  1Y1V A;  3TQY A;  5LXT F;  3ORQ A;  2IX3 A;  1QUQ B;  1RTO A;  2D5D A;  3S1R H;  1Q3L A;  2V9W A;  5LP6 F;  3STB D;  2H4O A;  1EIF A;  4R8N A;  2F0U A;  3F2C A;  2EXZ A;  4XXE A;  1Q81 C;  3I4M H;  1WTQ A;  4LF9 H;  3VYS A;  1X56 A;  2JYO A;  4GN5 A;  2Q8I B;  1CUK A;  3I7F A;  4PZ7 A;  5FLM H;  4HNV A;  2KBN A;  4RZQ A;  4IUP A;  1FJG L;  1EIY B;  2QDL A;  1ZET A;  1H9S B;  1ET9 A;  3ERS X;  4PQX A;  3IKJ A;  1SJH D;  4CDC C;  3PUZ A;  4BY7 G;  2W7P A;  2Z6K C;  1KRS A;  2R85 A;  2EJM A;  1PH7 A;  2UVR A;  1BBW A;  3EYY A;  4DK6 C;  3H09 A;  4A3G H;  5KYI A;  4JV5 Q;  2VUM A;  1OXS C;  2KCT A;  2JA8 B;  4LF5 L;  2EZV A;  3PN1 A;  1R9T H;  2WTF A;  4QY7 A;  2AHO B;  2P5Z X;  2FP4 B;  1PLF A;  4LSA A;  2DGY A;  3HOU G;  4LFC Q;  1PH4 A;  3MHB A;  1B70 B;  3HOU B;  5KFJ A;  2KED A;  1SNC A;  3ZJY C;  1AZQ A;  2JN4 A;  3GTM A;  3M9B A;  1MZB A;  1OTC A;  4R7R A;  1D2B A;  1EIH A;  3CU7 A;  2DIK A;  1SE3 A;  3H15 A;  1FVI A;  2UVW A;  5KT4 A;  1ZXT A;  2WB1 B;  5IYD H;  5JJI A;  1N36 H;  1EY4 A;  2OTJ A;  1JB3 A;  4C3I B;  3IAY A;  1EUJ A;  3J80 c;  4EYH B;  2RCF A;  4EG0 A;  1S10 A;  1YIJ A;  2XWB B;  1VQE A;  2OF1 A;  3GIL A;  1YHQ A;  2L15 A;  5C0X I;  1DON A;  5LMU Q;  1AUX A;  1HFN A;  1Q90 A;  2EQS A;  3UDG A;  1TWG A;  4OXP A;  3QG1 A;  4LW1 A;  2OT2 A;  4GOP C;  2A6H D;  4RB3 C;  4KN4 C;  2NTS A;  4BS9 A;  2L1B A;  2V5A A;  1HNX Q;  3OSP A;  2QDB A;  4MV4 A;  1LM0 A;  3RUP A;  4FDB A;  2ALY B;  4UP7 A;  1DOL A;  3NWT A;  4NW2 A;  4R4O A;  2F0I A;  3BU2 A;  4A3J H;  2BQU A;  4OO1 I;  1A6X A;  3CC2 A;  3KAK A;  2W8L A;  3K57 A;  1RHP A;  4LF8 H;  4O2A F;  1E4E A;  1EQV A;  3RD4 A;  3L4K A;  4A76 A;  5DG9 A;  3K3P A;  3GTQ H;  3PW0 A;  1BXT A;  1VQ6 A;  5C5J A;  3CCU A;  1EU4 A;  2WII B;  3Q8Q B;  1NTG A;  1E1O A;  1DGS A;  2OCE A;  2B8G A;  4EVO A;  5KFI A;  3CQZ A;  1ONL A;  2DJF C;  3BDO A;  3S24 A;  1B6R A;  1D8L A;  1LAB A;  3BS1 A;  1Z6H A;  1XXG A;  1GVP A;  4B3T H;  4IN3 A;  1YNJ C;  1CKO A;  1FKA H;  2L0C A;  4HSV A;  1LUZ A;  3TQ1 A;  3HOU H;  5M3F B;  1C4Q A;  4YP3 A;  2YYA A;  2CCZ A;  4JI8 H;  2ZM6 Q;  1H9S A;  3H20 A;  3RGX A;  2A74 C;  2W70 A;  2C00 A;  3HB9 A;  3IFT A;  2A19 A;  4KHV A;  2CZG A;  5BR8 L;  4OEM B;  4X66 H;  1NJI C;  2JEF A;  3QOJ A;  5IOD A;  3JC6 6;  1UE6 A;  2RDG A;  2KQ3 A;  3K81 C;  2JSO A;  5KEE A;  1F2M A;  2UXC L;  5A35 A;  1T94 A;  2VUM G;  2NWG A;  5CV7 A;  1LT6 D;  3L4J A;  1PK8 A;  4JW0 A;  1HZA A;  3S2D B;  3M9O B;  4IAJ A;  3A55 A;  1QCB D;  3H91 A;  3MFI A;  3J81 c;  3CC4 A;  2NVX B;  1PH6 A;  2LS0 1;  5IYD G;  3AQQ A;  1L1O C;  1EQR A;  1CA5 A;  4K2K A;  3DLL A;  2R6F A;  1PFS A;  2NVQ B;  1IYJ B;  3S16 H;  1I3Q B;  2JP1 A;  3T4A C;  2NYZ D;  4JI7 L;  1SEB D;  1TWA H;  4UCS A;  2W7O A;  3H3V I;  1ILQ A;  3HXL A;  2BE5 C;  5KFA A;  1PRT D;  2CW0 C;  4MNO A;  2Y0S A;  2W9A A;  2XD4 A;  2XIW A;  2PO4 A;  5IGE A;  2ATW A;  5IWA H;  2JA6 G;  4MN3 A;  5EWE A;  2KEC A;  1W96 A;  3FKI H;  2NN6 H;  2AQ1 B;  4JI7 Q;  3U4Z A;  5T1I A;  4RCO A;  2CKZ B;  4QWC A;  2FJ2 A;  2IT1 A;  1BGW A;  1C3O A;  1ZHQ A;  1PFB A;  2B8F A;  1DOK A;  2BA1 A;  1L0W A;  2XRQ D;  2KHI A;  4DV7 H;  1II3 A;  3NBH B;  4AH6 A;  4BY1 G;  3FRP B;  3BJU A;  5LL6 S;  1OWT A;  1A62 A;  4LSX A;  4E6I A;  4EQN A;  2MO0 A;  3GV5 B;  2W9B A;  3HKZ B;  1G51 A;  3BZK A;  1PMR A;  1PZK D;  5LMU H;  4M1U B;  4AIM A;  4IPD A;  4RAU C;  2R8H A;  4HSP A;  2CFM A;  3KHH A;  3S2D H;  4DR6 Q;  2FIN B;  3UFX B;  5EPJ A;  3NTH A;  1B3A A;  5KFG A;  5KG7 A;  2K05 A;  1E4G T;  1SMY D;  3MWY W;  3ULP A;  4PMC A;  1VF7 A;  2RHS B;  2W6P A;  4FF2 A;  2RHQ B;  2F1M A;  1U4M A;  1AE2 A;  1JE5 A;  1HFG A;  2TMP A;  2VXW A;  3EBE A;  4DKA C;  5M3M G;  2ASJ A;  2Z1C A;  1I3Q H;  4MAM A;  1F2Y A;  1I4R A;  4DAV A;  3K8A A;  2FE3 A;  2RGR A;  3KJP A;  3JAM L;  1VF5 C;  3PIO 3;  1O7I A;  2W6N A;  2E2H B;  1A2U A;  1E0B A;  3CRK C;  4XQJ A;  2F4V H;  1R4Q B;  2JA6 A;  1ENF A;  2XGT A;  1R9T B;  1SMX A;  2EOT A;  4XTC S;  3TP5 A;  3H4D A;  5LMN W;  4O3S A;  4ED6 A;  3RZD B;  5DM6 3;  1UNN C;  3OTO L;  1VQ8 A;  2AWO A;  4C2M B;  4A3L H;  1C48 A;  4B3R L;  1I94 L;  2ZM6 L;  1EOT A;  4FF1 A;  2NVX A;  3FKI G;  4LFC L;  3OWE B;  1KIX A;  4HED A;  2A73 B;  3TME A;  2KUM A;  5EBC A;  1HTL D;  4HCE A;  4GNX B;  1JQY D;  4LFC H;  4A3C H;  4LF6 L;  4TSS A;  4A3M B;  2FB9 A;  2QEX A;  1E2Z A;  5JEA H;  2DLN A;  2VUM H;  1KNA A;  2ENB A;  1D7Q A;  4B9W A;  4AYB B;  1N34 H;  1IBL Q;  4A3G B;  3U9T A;  2UUA Q;  4ZQI A;  4A3F B;  3JAM W;  1IBM L;  3PUX A;  2I0Q A;  5JEA G;  4TV8 F;  4JC0 A;  4LF6 Q;  1H95 A;  4JK1 C;  4OO1 H;  1JIH A;  5FPR A;  5JVG 3;  4EGQ A;  3EA6 A;  1IBM H;  1O78 A;  4A2B A;  4OX9 L;  4ECS A;  3KHR A;  3SDZ A;  4U67 3;  4K2L A;  1A3U A;  4BBR B;  3QZ8 A;  1EY8 A;  1TT2 A;  1IBM Q;  3G6Y A;  4ED3 A;  5M5W B;  2FXQ A;  3RN5 A;  4J9N A;  5KG4 A;  2XWJ B;  2CHB D;  1QVG A;  2NVX H;  4J9R A;  3SK6 A;  3R5X A;  1HNX H;  4QF4 A;  1IBK L;  4EFB A;  3H0G A;  4JV1 A;  1FD7 D;  1CHP D;  3HOV B;  1FGB D;  5C3W A;  2ES2 A;  3K5L A;  2AQ4 A;  1VDZ A;  1VQF A;  1CKM A;  4DAY A;  5H80 A;  1FNV A;  1NCV A;  1IBK Q;  2JEJ A;  4KHP Q;  3GIK A;  1H9R A;  4XYO A;  1XNQ Q;  4MV9 A;  4B3S Q;  1PRT B;  3C2P A;  2EDG A;  4DV4 H;  4LF4 L;  3VR4 A;  1RK5 A;  2HCC A;  3SK5 A;  1CKN A;  1Q8K A;  1U5K A;  2I87 A;  3I4N B;  1HA6 A;  4KY7 A;  3H6M A;  4TQR A;  3CCJ A;  4QB4 A;  1SYD A;  2F0J A;  2WB1 A;  4XT1 B;  5C0X J;  1R4P B;  3TIN A;  4B3T Q;  1MI2 A;  3GTO H;  2H5X A;  2K5Q A;  5C0X G;  1HNZ L;  5KFV A;  1A3V A;  4HMJ A;  5IP7 G;  4FYD A;  3U50 C;  3QB3 A;  4P73 A;  1KJ8 A;  5EDW A;  4A3K H;  3CQZ H;  4S3S A;  4JI6 Q;  2F0E A;  5KNB A;  3HKS A;  4QW8 A;  2C2R A;  2OLS A;  2UUB H;  2F0S A;  1B8A A;  1HCZ A;  2I5M X;  4ECU A;  5F9L A;  3T1Y H;  5EKK A;  5IP7 H;  1MSG A;  4CDF C;  2O4X A;  4KJO A;  2J9G A;  4A93 B;  2R84 A;  1OXV A;  5GON F;  5D3I B;  3T1Y L;  3MFH A;  3ITP A;  5C4X G;  5HV6 A;  3CD6 A;  1S0N A;  3RTX A;  3GO5 A;  4CKE A;  1B33 N;  1H9J A;  5HY6 A;  2I8C A;  2JE6 I;  3M85 A;  3OIQ A;  1YHB A;  2MQH A;  1XPO A;  1CZW A;  3RZO B;  2L9H A;  1ZQ7 A;  3CVZ A;  3D4W A;  2FMC A;  2VZA A;  2AQ2 B;  1ROD A;  3L9A X;  4MA5 A;  5DG8 A;  2Y0S G;  3R93 A;  3KF8 B;  1CFM A;  4MIU A;  4GC7 A;  1I5F A;  1TWA A;  4M8A A;  2ZT9 C;  4FXD A;  2VQE L;  4P75 A;  3J7A 5;  4A3B B;  4HR7 A;  4IRC A;  4GLV B;  2JA6 H;  5ELD A;  1LTS D;  1TA8 A;  1N33 Q;  4L63 B;  1KLU D;  2H1E A;  3QR8 A;  5IWA Q;  4BXX G;  2F0T A;  5DG7 A;  3GTK B;  2VQE H;  4J9Q A;  1H9K A;  3UQ8 A;  2AGP A;  1YJN A;  1S5D D;  4BBR G;  3PIP A;  3BZC A;  4IUR A;  4A3E G;  1VQD A;  1HNW L;  4LFA L;  3J80 E;  2AUK A;  2NVY H;  4LF5 Q;  4LH6 A;  2L55 A;  4JYA H;  2XCP A;  3DMU A;  4U68 A;  1N36 L;  3DM1 A;  2RDF A;  4DPG A;  3CP0 A;  1X55 A;  4YR2 A;  2UUA L;  1KDA A;  1STE A;  2MGS A;  2MNA A;  4EEY A;  3SK4 A;  3RN2 A;  1GM5 A;  3HOW B;  2NBF A;  1HA5 A;  3Q8D A;  5JQW A;  1K83 A;  3VYR A;  2Z0S A;  4K0K L;  4O4I F;  3PO2 H;  3LML A;  1XPU A;  1JOO A;  1I6V C;  3STB C;  1TVX A;  3AYH B;  4YHH L;  2DPJ A;  2RDI A;  4JI0 H;  2F0V A;  1B04 A;  4JI1 Q;  3CKI B;  5DLQ E;  4QWA A;  3E0E A;  1I4X A;  3G8C A;  2RDJ A;  5I2X A;  1JR0 D;  4JOI A;  2B2W A;  4ED2 A;  4G3I A;  1JE4 A;  1JOR A;  5HGQ A;  2B2U A;  4FF3 A;  3M4O B;  3R2T A;  4UAI A;  4RAY A;  4G7H C;  3OPO A;  2VB2 X;  2A5H A;  1OXU A;  3S1Q H;  4A2A A;  4LF8 L;  1RTN A;  1EYZ A;  3GIJ A;  5I6Y A;  3SGI A;  2J0T D;  1S03 G;  3J7A K;  4RUA A;  3IFD A;  2QKI C;  1TWC H;  2F4I A;  3HOX B;  4KHP L;  3RV4 A;  4F4Y A;  2I5L X;  1SAP A;  3A5Z B;  1W6K A;  1QZH A;  4LF4 Q;  1V4Y A;  4UY8 C;  2PQA A;  1HHV A;  1D5X C;  4DXG A;  5DGA A;  3NE5 B;  2JA7 B;  2MCT A;  2EYP A;  4CKB A;  5JVH 3;  4A93 G;  3OSN A;  1VCI A;  3H4B A;  4XZ3 B;  3MXP A;  2RF4 A;  1VS0 A;  4NLG A;  3H40 A;  3MXN B;  2E2I H;  1C9O A;  2V1C C;  2NZ1 D;  2G5D A;  5BN4 A;  3MXG A;  4JI8 L;  1D5Z C;  3U4V A;  1NMF A;  4HNT A;  1ENC A;  2PZU A;  2WAQ A;  5BN5 A;  1CSP A;  3EPI A;  1LV9 A;  3PW4 A;  3KK7 A;  2YW2 A;  4TUY F;  4LUV A;  2K52 A;  1TY0 A;  2JA8 G;  3FKI B;  4R8I A;  1GHK A;  3HFZ B;  4HNU A;  1TQO A;  1TWH B;  3CQZ B;  4ZKB B;  4K5X A;  1ASY A;  2MUY A;  2W57 A;  1K8M A;  3FMA A;  3HOX H;  1RJQ A;  2NU9 B;  1Q12 A;  4BBR H;  4AYB G;  4HID A;  3BQ1 A;  4A3M G;  1T3N A;  4YCW A;  1Q82 C;  2RGV A;  4ZI7 F;  4DR3 L;  5LL6 b;  4J9M A;  3GTK A;  3GTP B;  3UI2 A;  1LTG D;  4I7A A;  4DV6 H;  3W1G A;  2EYJ A;  1U4R A;  3PUW A;  3KXY T;  1HR0 L;  3V6H A;  1SYX B;  1D5M C;  1QG7 A;  4C3J H;  5K36 G;  2GPS A;  4DR3 H;  5FO8 B;  2RVL A;  4RGT A;  2VNU D;  2IX0 A;  4GKJ L;  1L2F A;  5DGB A;  3V2T A;  1J5E H;  1SFO A;  3SHL A;  1LO5 D;  1NMG A;  1A9X A;  1Y8O B;  1NAP A;  2MP1 A;  2X6G A;  2ZXP A;  2UXD L;  4XX0 B;  4N9T A;  4JI2 Q;  1CQV A;  4RKL A;  3Q8P B;  3JAM c;  1JMC A;  2R8I A;  1GKH A;  4KLK A;  2UXD H;  2A6E C;  4IFD J;  1JJ2 A;  4GKJ Q;  3R8B A;  4F8M A;  2V58 A;  2Z4H A;  1AFP A;  1EZ1 A;  5GQO A;  2LFN A;  1KJJ A;  4B3T L;  1L0Y B;  1PZJ D;  2HVS A;  2OH2 A;  4RFB A;  5JJL A;  1Z7T A;  3VDY A;  4MTN A;  2SNS A;  1B9N A;  2PYK A;  2HQL A;  2IJ0 A;  4IFD I;  3W3A A;  1QVF A;  1JWM D;  1B44 D;  1HZB A;  2EY5 A;  3CRL C;  4LFA Q;  1VMP A;  1PH5 A;  3G71 A;  1SE4 A;  1FNU A;  4WOR A;  2AQ3 B;  1KJI A;  1LT4 D;  1VQ5 A;  2C22 A;  2FLN A;  5LMU L;  1RDP D;  4DV2 Q;  3G6X A;  4IWY A;  3D8G A;  2LY7 A;  2YZN A;  3GTO A;  4C2M H;  4EBD A;  2SOB A;  2UXC H;  4NDX A;  5KFD A;  2FFK B;  4EYI B;  1KRT A;  2JA7 A;  2K5H A;  3K7U C;  4JI6 H;  1VQN A;  4IJL A;  4X62 L;  4XIG S;  4F7X A;  1KAB A;  1IW7 C;  5IOC A;  5IYB H;  5EWF A;  4DR5 L;  3AB9 A;  3HOZ G;  4K5V A;  3CCE A;  3BYT B;  4MV7 A;  1QIL A;  3CCV A;  4QWB A;  3PW7 A;  1VQO A;  4X3U A;  4ZUJ A;  4BY7 B;  4X62 H;  2M2L A;  2B29 A;  4GLA C;  1T9H A;  4YCU A;  1K73 C;  1LAC A;  5KFY A;  1NR2 A;  2TSS A;  4O3R A;  4Y7N B;  4X62 Q;  4JV0 A;  3SE7 A;  4DL2 A;  2MFI A;  2OXP A;  2GVA A;  2OQK A;  3H94 A;  1PA6 A;  1N8R C;  3S1M B;  2AGO A;  4EEQ A;  2EY2 A;  1PXU A;  2BQR A;  3QFF A;  1BBU A;  3M4Y A;  4A93 H;  4JV2 A;  4YWK A;  3RNU A;  2YTX A;  4A3B G;  3OW2 A;  1HQR D;  5COR A;  4RCN A;  4DL4 A;  4U7C A;  2CQA A;  2K5V A;  1SR3 A;  1IKM A;  3AFP A;  3V4S A;  3RB0 A;  4JBW A;  1XPR A;  4IR9 A;  1I94 H;  5FJ8 G;  4YJ3 F;  5KFZ A;  3T16 A;  1DV2 A;  4J15 A;  5KG2 A;  1EY5 A;  1PRT F;  2B2T A;  4X65 Q;  5JPM C;  1I94 Q;  4L5Q A;  4ZK9 B;  3TDQ A;  1N9W A;  3GD7 A;  2IL8 A;  2FPP B;  4Q0Y A;  2EE1 A;  4FP5 D;  4DV3 L;  4AYB E;  1HNW Q;  2Y0S E;  1STA A;  4QW9 A;  3GIM A;  2WP8 J;  3ZYY X;  2Q2H A;  3K3V A;  3NSW A;  4A3E H;  2C35 B;  4HAE A;  1ML0 D;  3NEM A;  2K33 A;  3G7L A;  3AMU A;  2PMZ B;  4FNF A;  3F2B A;  2R7N A;  1WCM B;  1R9T A;  1E3P A;  1S5B D;  3HKZ E;  1D1I A;  3BVG A;  5DNF A;  2CW7 A;  4JI5 H;  4DL3 A;  1A63 A;  2MO1 A;  5GRO A;  1GUN A;  4IPC A;  5IYZ F;  1TWF H;  1BR9 A;  1RL2 A;  3SI8 A;  4NXN H;  1TXY A;  3S1N B;  1J9O A;  1I6H B;  3L7Z C;  2HGS A;  4FF4 A;  3MZ5 A;  1EL0 A;  3E3X A;  4DR3 Q;  4LFB H;  1AN8 A;  3HOW G;  3HKZ A;  2W9C A;  3FEW X;  4LF8 Q;  2LXK A;  4DR6 L;  5BMV F;  2IY5 B;  4B9X A;  1O80 A;  4JI0 Q;  1QNU A;  3GDE A;  4XQN A;  3BVM A;  4LFB L;  3NTK A;  2R7Z B;  3PUV A;  1E7Z A;  3NWS A;  3MXU A;  3PO3 G;  2XNA C;  4DNT B;  3MAQ A;  2NVY A;  2UXB Q;  1S3O A;  4L5S A;  1SCU B;  1DV1 A;  4IOC A;  1N48 A;  2WYO A;  4NMZ A;  2Z9H A;  4FXK C;  3A56 A;  2F4V L;  3PO2 B;  3GLK A;  4QGU A;  4HIM A;  3IN5 A;  3W1B A;  3VR6 A;  2UXB H;  4EX5 A;  4KI0 A;  4RGN A;  4WBN F;  5LMN H;  5LYJ F;  2FPG B;  2YL2 A;  2BCO A;  1XX8 A;  1YBY A;  1JT8 A;  1Y1W G;  3KAJ A;  3NHH A;  2K03 A;  2QF7 A;  4P74 A;  1RJR A;  3A8J E;  3MR2 A;  1SNO A;  2WDT A;  3H0G B;  4I65 A;  4Q43 A;  2PPB C;  4EGJ A;  1Y14 B;  3MWM A;  3OMG A;  2F3V A;  4LF7 L;  2VA3 A;  3H0G G;  1PYB A;  2IP4 A;  3Q6S A;  4O3P A;  1CTM A;  3J81 j;  4XDX A;  2L5T A;  3MEH A;  3G6E A;  4MTD A;  5FJ8 H;  4DR5 Q;  1M7J A;  3CPW A;  1PRT C;  3S2H B;  2EY6 A;  5GAG C;  1HRJ A;  2EXD A;  5I2Y A;  3J7Z C;  4CGY B;  3TEH B;  3CCL A;  1SN8 A;  1WYD A;  3K0X A;  1HNZ Q;  1MSH A;  3DUZ A;  1S5E D;  1TY2 A;  4M7E A;  4L5R C;  5CV6 A;  4ZHQ F;  3M9N B;  5KRU A;  4CDE C;  4DLK A;  1VQB A;  4X3T A;  2VOB A;  4QUC A; 
#chains in the Genus database with same CATH homology
 2JA9 A;  4RG1 A;  3I4N H;  2CQO A;  4GNX B;  2B3G A;  3F1Z A;  2E5L L;  4A3C H;  4LF6 L;  1Y1W H;  3IRB A;  2WAQ G;  3S1M H;  4DV6 Q;  2QEX A;  3T1H L;  1QUQ A;  4PMW A;  2VW9 A;  2JK8 A;  1S40 A;  2VUM H;  1VQH A;  1SRO A;  2RCN A;  1KD1 C;  4GNX C;  4NXM L;  1D7Q A;  1GO3 E;  1IBL Q;  4IFD G;  4OO1 G;  5J3B A;  5IYC H;  3RZO H;  2UUA Q;  4OON A;  1AE3 A;  1P16 A;  2N8N A;  1EWI A;  3PUX A;  1V9P A;  4DUY Q;  2ID0 A;  5JEA G;  1LYL A;  3TS0 A;  2E2J H;  4JC0 A;  2I0Q A;  2HT1 A;  4JV5 L;  4LF6 Q;  1H95 A;  4BBS G;  3TRZ A;  1CSQ A;  1OXT A;  2PMZ E;  1IBM L;  2K4K A;  4DNI A;  5IYC G;  3HOY H;  2YV5 A;  5FLX c;  4DUZ Q;  4OX9 L;  1W3S A;  4DV4 L;  3UDI A;  5M5Y H;  5GAH C;  3CPF A;  4DR2 Q;  1XMO Q;  4DV5 L;  3RLO A;  1IBM Q;  3E9H A;  3M7N A;  3T1H Q;  1TWG H;  2FXQ A;  1XNR L;  3CMA A;  3RN5 A;  1YVC A;  1QVG A;  2NVX H;  1KQS A;  2A8V A;  5AJ3 Q;  2VQE Q;  1IBK L;  1N32 Q;  4DV0 Q;  1PV4 A;  1N34 L;  3KJO A;  1XMO L;  4C3H H;  3M4P A;  3F2D A;  1XTD A;  4DV2 L;  4DR7 L;  2OQ0 A;  2E8G A;  3AFQ A;  4GOP B;  2ES2 A;  2A1A A;  2QGQ A;  2JA7 G;  1PYS B;  1VQF A;  2AWN A;  4JI4 L;  4OX9 Q;  3M3Y H;  1CKM A;  5FLM G;  4P72 A;  1BKB A;  2YTV A;  4JG2 A;  3GTJ H;  3HOW H;  2ZTE A;  3CC7 A;  1IBK Q;  4LF9 L;  1K9M C;  4KHP Q;  1E24 A;  1XNQ Q;  4B3S Q;  3EIV A;  4YY3 Q;  4LF4 L;  1QVC A;  2JA5 H;  4DAY B;  1CKN A;  4MZ9 A;  4QIW E;  4NXN L;  1Q8K A;  3KFU A;  1U5K A;  4YHH Q;  3FHW A;  3HOZ H;  2PI2 A;  4JCV E;  4JBM A;  1NBW A;  3H0G H;  3CCJ A;  1V43 A;  1VQJ A;  4R4T A;  4JI1 L;  4DV0 L;  1YEZ A;  5C0X J;  1I50 H;  2D62 A;  4B3T Q;  1S72 A;  1HH2 P;  1WJJ A;  3A0J A;  2H5X A;  4PZ6 A;  5C0X G;  4HIK A;  4GNX A;  1HNZ L;  2JA5 G;  4POG A;  2F4V Q;  2UXC Q;  1SE8 A;  1X3G A;  4UP9 A;  5IP7 G;  3U50 C;  1FGU A;  4P73 A;  5IY0 A;  4A3K H;  1VQ9 A;  1KAW A;  3CQZ H;  3M4Q A;  4JI6 Q;  2ZTC A;  3HKS A;  5ELO A;  2Z6K A;  1SLJ A;  2R92 H;  4A3D H;  1B8A A;  2I5M X;  1PVO A;  2JEB I;  1XNQ L;  3RZD H;  2LSS A;  5IP7 H;  4B3S L;  4B3R Q;  1Y1V G;  4GKK Q;  1V1Q A;  1VQ7 A;  1OXV A;  3CCR A;  4DV6 L;  2VQF Q;  1FL0 A;  1KL9 A;  3T1Y L;  1YNX A;  2BA0 A;  2WFW A;  3TRE A;  3A5U A;  2JA7 H;  4IPG A;  3S15 H;  5C4X G;  2ZJR A;  2E5L Q;  3CD6 A;  3W5O A;  1SFO H;  3GO5 A;  2JJQ A;  4IOA A;  4X66 Q;  2NZH A;  3B6Y A;  2F3I A;  5HY6 A;  2QA4 A;  1QZG A;  4LF7 Q;  2JE6 I;  1N33 L;  3M85 A;  1E1T A;  3M4O H;  4OWX B;  4NXM Q;  1YHB A;  1W2B A;  2I5H A;  3KLW A;  3S14 H;  2MQH A;  1XPO A;  5BR8 Q;  4JYA L;  3KDF B;  1J6Q A;  2NVQ H;  1L1O A;  3HOY G;  4DR2 L;  3CCQ A;  2VZA A;  2Q2I A;  4R4I A;  5IP9 H;  2HHH Q;  3ULL A;  2Y0S G;  3K7A H;  4DUZ L;  1VQP A;  1N36 Q;  4O2D A;  3KF8 B;  4X64 L;  4DV1 L;  2EIF A;  1I5F A;  1XMQ L;  1TWH H;  2VQE L;  4P75 A;  3J7A 5;  3CME A;  4GLV B;  2JA6 H;  5GAE C;  4JI5 Q;  4JI0 L;  3RLF A;  1N33 Q;  3HKZ G;  1L1O B;  5IWA Q;  4BXX G;  3PUY A;  3I2Z A;  4UPA A;  4R4C A;  5AJ3 L;  1YJN A;  3S17 H;  4BBR G;  3PIP A;  3BZC A;  4WJ3 M;  4A3M H;  4A3E G;  3DM3 A;  1VQD A;  1RIP A;  1HNW L;  4LFA L;  4HIO A;  2WB1 G;  1HNX L;  2ZJQ A;  2NVY H;  4LF5 Q;  4LFB Q;  1WI5 A;  3UE0 A;  1WFQ A;  1UE5 A;  4IPH A;  1Z9F A;  4A3I H;  2UUC L;  2R7Z H;  3MEF A;  1N36 L;  4JI4 Q;  3CCS A;  4A3L G;  1PH9 A;  5M5X H;  3I4O A;  4DPG A;  3CP0 A;  4H02 A;  1X55 A;  3PO2 G;  3FP9 A;  4OWT B;  2UUA L;  1P8L A;  3CAM A;  3UDX A;  4POF A;  2MNA A;  1G29 1;  4A3I G;  3RN2 A;  1GM5 A;  3TS2 A;  4DV4 Q;  4OWW B;  3Q8D A;  4L5T A;  3I55 A;  1EYG A;  3I4N G;  2Z0S A;  1HJP A;  1M1K C;  4K0K L;  4A3F G;  2NZO A;  3PO2 H;  4GN3 B;  1XPU A;  4WJ4 A;  1X65 A;  2CWP A;  1Y1V H;  3F8T A;  4IJH A;  3STB C;  3AYH B;  4YHH L;  4DV7 Q;  4JI1 Q;  5M3F G;  2R7F A;  4JI3 L;  2UXD Q;  1WCM G;  5DLQ E;  4Y52 H;  4JI2 L;  3E0E A;  2K14 A;  4JOI A;  1KHI A;  5LMN Q;  5C4X H;  4BY7 H;  2UUC Q;  5IYB G;  4JBJ A;  5HGQ A;  2B63 H;  2D0O A;  4YCV A;  4R4Q A;  3D0F A;  2PQA B;  1HR0 W;  3KYH C;  2KCM A;  5M5W H;  3S1Q H;  1OXU A;  1UE1 A;  4LF8 L;  4BBS H;  4NPS A;  3T1Y Q;  1OXX K;  4JI8 Q;  1MKH A;  1YHA A;  3SGI A;  2Q2T A;  4IO9 A;  2UU9 L;  1NY4 A;  3RR5 A;  1X6O A;  3J81 i;  2R93 G;  1TWC H;  1E22 A;  3NEL A;  4KHP L;  5IT9 c;  2I5L X;  4BA1 I;  3A5Z B;  1QZH A;  2PI2 E;  3TQY A;  3KF6 A;  4LF4 Q;  3GTL H;  2R7Z G;  1QUQ B;  4HJ9 A;  3S1R H;  4UY8 C;  2PQA A;  5ELN A;  4HJ7 A;  3S2H H;  3STB D;  4LWC A;  1EIF A;  4DK3 C;  4KHZ A;  3UE1 A;  2HIX A;  4A93 G;  1VCI A;  3F2C A;  1Q81 C;  4HJ8 A;  2JQO A;  1K8G A;  1M90 C;  2RF4 A;  1VS0 A;  5IE8 A;  3I4M H;  1X56 A;  2HHH L;  3MXN B;  2E2I H;  1C9O A;  1Q1B A;  2V1C C;  1CUK A;  3I7F A;  4GN5 A;  2K75 A;  4PZ7 A;  4TQU S;  5FLM H;  1MJE A;  4JI8 L;  2KBN A;  3U4V A;  4C3I H;  1EIY B;  1NMF A;  1FJG L;  4DV3 Q;  5IP9 G;  1YJW A;  3ERS X;  3PIO A;  2KHJ A;  4DUY L;  2K5N A;  4Y7N H;  1CSP A;  2NN6 I;  3PUZ A;  4BY7 G;  2NN6 G;  2Z6K C;  1KRS A;  5IWA L;  1PH7 A;  3KOJ A;  1BBW A;  4LUV A;  2K52 A;  2JA8 G;  2K50 A;  1A8V A;  4DK6 C;  1B7Y B;  3HFZ B;  5C44 H;  4YWM A;  1YIT A;  4A3G H;  4JV5 Q;  1OXS C;  2KCT A;  4QJF A;  1ASY A;  2UUB L;  3H3V H;  4LF5 L;  1R9T H;  3HOX H;  1VQC A;  4QY7 A;  2AHO B;  1VQM A;  1Q12 A;  1GD7 A;  4AYB G;  4BBR H;  4HID A;  1Z47 A;  4B3M L;  4A3M G;  1YJ9 A;  2DGY A;  4YCW A;  1Q82 C;  4LFC Q;  2R92 G;  4DR3 L;  3HOU G;  4A3D G;  2VL6 A;  1Q7Y C;  1IL2 A;  1KXL A;  1PH4 A;  1Q86 C;  2CWA A;  3W1G A;  4A3K G;  4O0A A;  1N32 L;  1B70 B;  1X54 A;  3HOV G;  3PUW A;  1XNR Q;  1HR0 L;  3ZJY C;  1KC8 C;  5K36 G;  1BVS A;  1UWV A;  4C3J H;  3CW2 C;  3M9B A;  4K0K Q;  1OTC A;  2VNU D;  2IX0 A;  4GKJ L;  1L2F A;  3H15 A;  4A75 A;  1FVI A;  1JJG A;  5IYD H;  1NMG A;  5JJI A;  4R1J A;  1Q1E A;  4ALP A;  4JI3 Q;  2OTJ A;  2UXD L;  1EUJ A;  3J80 c;  2UXB L;  4JI2 Q;  1YIJ A;  4AQY L;  1VQL A;  1VQE A;  3L0O A;  5C3E H;  1U0L A;  3JAM c;  1JMC A;  1VQG A;  1YHQ A;  1GKH A;  2L15 A;  4KLK A;  5C0X I;  1X9N A;  5LMU Q;  4YY3 L;  4IFD J;  1JJ2 A;  2EQS A;  1VQA A;  3UDG A;  4OXP A;  4GKJ Q;  4LW1 A;  4GOP C;  3PF4 A;  4HJA A;  2B63 G;  3CF5 A;  1X3E A;  5C44 G;  4A3G G;  5GQO A;  1JJC B;  1HNX Q;  4B3T L;  3GTP H;  1I6H H;  1LM0 A;  5JJL A;  3VDY A;  1ASZ A;  3NEN A;  4MTN A;  4FDB A;  1PH3 A;  2ALY B;  4UP7 A;  2LXJ A;  2N49 A;  4R4O A;  2HQL A;  3BU2 A;  4A3J H;  4IFD I;  4OO1 I;  1IZ6 A;  1QVF A;  3CC2 A;  1HZB A;  4LFA Q;  5EAY A;  1PH5 A;  3G71 A;  2Q2U A;  3LGJ A;  3HOV H;  1VQ5 A;  4A3J G;  3KF6 B;  5LMU L;  4A76 A;  4DV2 Q;  3GTM H;  2XTI A;  3GTQ H;  3KDF A;  1VQ6 A;  4PG3 A;  1VQI A;  2F52 A;  3CCU A;  3EN2 A;  4C2M H;  1Q46 A;  4JBK A;  1KRT A;  1NTG A;  1E1O A;  1DGS A;  2K5H A;  2OCE A;  3K7U C;  1PHJ A;  4UP8 A;  2IHE A;  1VQN A;  4IJL A;  4X62 L;  4XIG S;  3S24 A;  2IX1 A;  1IXR A;  1HZC A;  1D8L A;  5IYB H;  4DR4 Q;  5JJK A;  4DR5 L;  2AMC B;  4JOI C;  1EFW A;  3HOZ G;  1GVP A;  3CCE A;  4HJ5 A;  1CKO A;  1WOC A;  3HOX G;  3CCV A;  1VQO A;  3CXC A;  1LUZ A;  2B29 A;  4GLA C;  3HOU H;  1T9H A;  4YCU A;  1K73 C;  2CCZ A;  4QL5 A;  2UU9 Q;  2ZM6 Q;  2VY3 A;  3ICE A;  2AKW B;  4X62 Q;  2A19 A;  2MFI A;  2GVA A;  2OQK A;  2KEN A;  5H1S E;  5BR8 L;  1N8R C;  1PA6 A;  4B3M Q;  1NJI C;  4DV1 Q;  4X64 Q;  1IBL L;  3JC6 6;  1UE6 A;  3K81 C;  4A3C G;  3PGZ A;  5C4J H;  1BBU A;  1WCM H;  4A93 H;  2UXC L;  4JI5 L;  4YWK A;  3I56 A;  3RNU A;  2YTX A;  2VUM G;  5JEA J;  4A3B G;  3OW2 A;  1PH1 A;  1HZA A;  1NE3 A;  2K5V A;  1SR3 A;  3PCO B;  3AFP A;  3G48 A;  4JBW A;  1XPR A;  1G6P A;  2ZJP A;  2WAQ E;  5FJ8 G;  1HR0 Q;  4A3B H;  4J15 A;  3J81 c;  4PZ8 A;  4GOP A;  3CCM A;  2YU9 H;  4DV5 Q;  1PH6 A;  3CC4 A;  3PSI A;  5M3M H;  4X65 Q;  1I94 Q;  5IYD G;  1A0I A;  1PH8 A;  4L5Q A;  1N9W A;  3GD7 A;  4LUO A;  3AQQ A;  1L1O C;  1EQR A;  3E9I A;  1FJG Q;  1K3R A;  3DLL A;  5C3E G;  4DV3 L;  4APV A;  4AYB E;  4GLX A;  1PFS A;  2Y0S E;  3OTO Q;  2GVB A;  4NB3 A;  1IYJ B;  2WP8 J;  2Q2H A;  3S16 H;  4A3E H;  4DR1 L;  4JI7 L;  1MJC A;  1YZ6 A;  2C35 B;  1TWA H;  3G4S A;  3NEM A;  3H3V I;  3K80 C;  1CKN B;  4DR7 Q;  4X65 L;  3F2B A;  1JB7 A;  1K0R A;  1X3F A;  4MNO A;  1E3P A;  3HKZ E;  3I4M G;  2WB1 E;  4JYA Q;  1C0A A;  2ATW A;  1A63 A;  1XMQ Q;  1VQK A;  2MO1 A;  1HZ9 A;  5GRO A;  2ASB A;  2JA6 G;  4IPC A;  1N34 Q;  1TWF H;  3GTG H;  3FKI H;  1RL2 A;  4JI7 Q;  5LMN L;  1TXY A;  2ZTD A;  3UDF A;  3U4Z A;  3GTO H;  4GN4 B;  3L2P A;  1XJV A;  3L7Z C;  2CKZ B;  2YTY A;  5E7N A;  2JA8 H;  2IT1 A;  4DR3 Q;  2R6G A;  2VS1 A;  3A74 A;  4NXN Q;  3HOW G;  1K8A C;  4LF8 Q;  1J5E Q;  2LXK A;  5M3F H;  4DR6 L;  2PNH A;  4X6A H;  2IY5 B;  2BA1 A;  1L0W A;  2JEA I;  4JI0 Q;  3GTK H;  2KHI A;  2HIV A;  3GDE A;  2GN5 A;  3NBH B;  4AH6 A;  4LNQ A;  2N78 A;  4BY1 G;  4LFB L;  3BJU A;  1MIU A;  3PUV A;  1A62 A;  1E7Z A;  2MO0 A;  1EQQ A;  2N3S A;  1G51 A;  3PO3 G;  3BZK A;  1K83 H;  1C7Y A;  1YI2 A;  2BH8 A;  2UXB Q;  4AIM A;  4BY1 H;  1S3O A;  3WWV A;  4AQY Q;  1J5E L;  4L5S A;  4IPD A;  3U58 A;  4IOC A;  2E2H H;  4A3F H;  1EOV A;  2F4V L;  4QGU A;  4HIM A;  3W1B A;  2CFM A;  4GS3 A;  4EX5 A;  2NVT H;  4KI0 A;  2IHF A;  2VQF L;  3S1N H;  2DUD A;  3S2D H;  2BH2 A;  4DR6 Q;  1LTL A;  1VQ4 A;  1YBY A;  4GKK L;  3J80 i;  1Y1W G;  3AEV A;  1JT8 A;  3PF5 A;  1HNW Q;  3ULP A;  4P74 A;  4DAM A;  3JAM i;  2RHS B;  4QQB X;  3ULJ A;  4ME3 A;  1UE7 A;  4EQ5 A;  2RHQ B;  4DV7 L;  3D31 A;  1UEB A;  1AE2 A;  1JE5 A;  3EBE A;  5M3M G;  4DKA C;  1AH9 A;  1Y14 B;  2OWO A;  4LF9 Q;  1I3Q H;  4BA2 I;  2R93 H;  4BXX H;  3K8A A;  4YWL A;  4X66 L;  3KJP A;  3H0G G;  1PYB A;  4LF7 L;  1SRU A;  2OTL A;  3J81 j;  1O7I A;  5GAD C;  3G6E A;  4P71 A;  4DR4 L;  5FJ8 H;  4DR5 Q;  3CPW A;  2XGT A;  3PO3 H;  5GAG C;  1SMX A;  2EXD A;  3J7Z C;  4LUZ A;  4XTC S;  3TEH B;  5LMN W;  3CCL A;  1SN8 A;  1WYD A;  3RLN A;  3K0X A;  3OTO L;  2YYZ A;  3ER0 A;  4TVA B;  4A4I A;  2D0P A;  1HNZ Q;  2AWO A;  1VQ8 A;  2UUB Q;  4A3L H;  4DR1 Q;  4B3R L;  1I94 L;  3OYY A;  2ZM6 L;  4L5R C;  1PH2 A;  3PV0 A;  2R7D A;  3FKI G;  1VQB A;  4LFC L;  4RMF A;  1KIX A;  4JI6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...