1Y14B

Crystal structure of yeast subcomplex of rpb4 and rpb7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
154
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNASYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II 32 kDa polypeptide
publication title Structures of Complete RNA Polymerase II and Its Subcomplex, Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 28
structure length 154
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y14B02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y14B01
2R7FA 3A5ZB 1QVGA 2OQ0A 2Y0SG 1VQNA 2ZTEA 3PGZA 1T9HA 1JT8A 3KYHC 5FJ8G 3AFQA 4A93G 3CXCA 4B3SL 3I55A 1GKHA 2L15A 5DLQE 2KCMA 1YNXA 2ALYB 3PIOA 2QA4A 1NMFA 1TWFH 4A3JG 1OXVA 2JQOA 2WB1G 1XPUA 3E9IA 1M90C 5C0XG 1VQ6A 4PZ6A 1N32L 5ELOA 4QGUA 1LTLA 1SMXA 1C0AA 2EIFA 2CWAA 3K7UC 4DR3Q 2I0QA 4X62Q 2LSSA 4LF9Q 1GD7A 2GVBA 2AHOB 4DUYL 2YU9H 4BBRG 4JI5L 3UDIA 3HOYH 2AWNA 3M7NA 5K36G 3GTGH 4PMWA 5IT9c 2UXBQ 1CSPA 1Y1VH 2JJQA 2AWOA 2JA8G 1XNQQ 3S14H 4LWCA 3CCRA 3CAMA 1IBLQ 3I4OA 4OXPA 4UP9A 2R92G 2VL6A 4YY3Q 5C4XH 3J80i 5J3BA 4L5TA 2VQEQ 3ULPA 1PV4A 3TRZA 4IFDJ 1CKNA 1SRUA 2K5HA 4GS3A 3K7AH 3HOUG 1E24A 2JEBI 3EN2A 4KLKA 4DR4L 2C35B 2ZTDA 4JI4Q 5GAHC 3PCOB 1W2BA 1JJGA 4H02A 3S1RH 4L5SA 1CKOA 5M5YH 4C3HH 4DV2Q 3BJUA 3HOZH 1HZ9A 3KOJA 1GM5A 2VZAA 1RIPA 1PA6A 1AE3A 3GTKH 3F2DA 4POFA 4LNQA 3W5OA 4A3KG 4YCVA 1XMQL 3WWVA 5IYCG 1Q46A 2K4KA 1NMGA 4OONA 4A3BG 3KJOA 4HJ9A 3LGJA 2ASBA 4Y52H 1PH2A 1EQQA 5BR8Q 1YHQA 4JI8L 4HJ5A 1KAWA 1Y1VG 4AYBG 1E22A 4DR1L 3NBHB 4GOPA 5H1SE 2R7DA 2MO1A 4DR6L 4LF8L 1N8RC 3HKZG 1IZ6A 1Q1EA 5IP9G 3HOVG 5LMUL 4R4CA 2NZOA 4YWKA 3KDFA 1HJPA 4DV6L 2OTLA 4QIWE 1VQ4A 1A63A 4DV4Q 4GNXA 2CFMA 2RF4A 1HR0W 1XJVA 1VQ7A 3PF5A 1E7ZA 1JJ2A 4JI0L 3M3YH 1L0WA 3HOWH 1N32Q 1WCMH 4LF4Q 4POGA 4OWWB 1KL9A 1PH9A 1WI5A 4ALPA 5JJKA 4DR2L 4NB3A 1VQBA 3NEMA 3CCEA 2PMZE 2K5VA 1RL2A 4LUZA 4LUVA 3TREA 5AJ3L 4DUYQ 2BA0A 4GLVB 1Y14B 2OTJA 3EBEA 1PVOA 3AYHB 1VQLA 3CC4A 1VQPA 4GLXA 3RLOA 1IBKL 4A3DG 2IT1A 1HNWL 5C4JH 4GKKL 1VQJA 4EQ5A 1YZ6A 5GQOA 2K52A 1Q12A 4IJHA 2K5NA 2I5MX 1OXSC 1WFQA 3PO3H 1VQAA 1TWAH 2IHFA 5IYDG 3F2CA 1EFWA 1R9TH 1IXRA 4JV5L 4JOIC 1TWGH 4R4OA 3CMAA 3GO5A 4QQBX 4BBSH 3CD6A 2IX1A 1Z9FA 4DR4Q 1L1OB 2YYZA 1N36L 4A3FH 3ER0A 1NE3A 1NY4A 3NELA 3PIPA 3CCMA 1A62A 1C9OA 1P8LA 4YHHL 3AFPA 1N34L 3A5UA 1YJWA 2E5LQ 3AQQA 3H0GG 4GN3B 3HOWG 5M5XH 2DUDA 2VNUD 2OCEA 2UUBQ 4OWTB 3D0FA 4MTNA 1OTCA 2UUAL 1J6QA 2IX0A 1X3FA 3HOXH 1K8GA 3L2PA 3W1BA 4BY7H 2JA6G 1UE6A 1FL0A 4HIDA 3S2DH 3FKIH 1A0IA 3UDXA 3U50C 5M3FG 1VQKA 2JA5H 4JI8Q 1O7IA 2KHJA 2ZTCA 1E3PA 4HJ7A 4DR1Q 1DGSA 3KF6A 4DK3C 4DR6Q 2D62A 5LMNL 5C3EH 4IOAA 4LF8Q 2BH8A 4LF7Q 1FJGL 1CKMA 4MNOA 2OWOA 1KXLA 4A3IH 4X64L 1VQOA 1Q7YC 3STBC 1UWVA 1VQDA 1X3EA 2R7ZG 4HJAA 3G71A 1N9WA 4DV6Q 4XIGS 4WJ4A 4EX5A 4JBWA 1AE2A 2MNAA 2D0PA 1PH4A 1LYLA 1X55A 3H15A 4KHPL 4DR7L 4JI0Q 2FXQA 3CP0A 2WAQG 3EIVA 3VDYA 5FLMG 1XTDA 3RR5A 1BBWA 2CWPA 2YV5A 2XTIA 4YCUA 5C0XI 1EIFA 1YJ9A 4IFDG 3OTOL 4A3LH 4A76A 4PZ8A 1KRSA 3E0EA 4APVA 1PH6A 1CSQA 1V9PA 2PQAA 4A4IA 1Q82C 3RN2A 3BZKA 4JCVE 1HZCA 1HNXL 2KENA 2UXDL 1VS0A 4R1JA 4C3JH 1ASZA 2IY5B 4GLAC 3ICEA 3SGIA 4JI1L 1IBKQ 1HNWQ 2VUMH 4GKKQ 2B3GA 4JI6L 1U5KA 1N33L 4Y7NH 1PH8A 2B63H 4A3CH 3PV0A 2ZM6Q 3CCSA 1Y1WH 4JOIA 1QVFA 1KQSA 3TS0A 1PFSA 4JV5Q 4DK6C 5IWAL 1J5EL 1XMOQ 1IBMQ 1BBUA 5IP7H 1YITA 4L5RC 2Q2HA 2CCZA 3M85A 3T1YQ 1N36Q 3B6YA 4FDBA 2CQOA 3GTPH 1I5FA 3AEVA 3NENA 4DUZL 3UDFA 1EUJA 3PF4A 3PUWA 2YTXA 4P75A 2Y0SE 2BH2A 4B3TL 3HOYG 3RZOH 5JJLA 5JEAJ 4AQYQ 1ASYA 1I94Q 3GTMH 4BXXH 4DV3L 3JAMc 2JA9A 4LF5L 4DV0Q 2UUAQ 1V43A 2RCNA 2YTVA 3CCUA 4IOCA 2JA7H 3H3VH 3CCJA 1CUKA 1S3OA 1W3SA 2JE6I 4J15A 3L7ZC 4DV7L 1LM0A 3U4VA 1G51A 5C4XG 1KD1C 4P72A 2F3IA 4JC0A 3T1HL 4B3SQ 4BA2I 3TEHB 1K73C 4IPDA 5IE8A 3J81c 1I50H 5HGQA 1PYBA 1I6HH 3STBD 2WFWA 4KI0A 3ULJA 1P16A 4DV1L 1EQRA 3BZCA 4A3GH 4X6AH 3F8TA 4X64Q 4WJ3M 4LFBL 3HOZG 3CW2C 2OQKA 3U4ZA 2NN6G 1Q8KA 1QUQA 5C44H 4HIOA 1L2FA 2ZJPA 1JE5A 2PI2E 4KHPQ 4DR7Q 3HKSA 2N78A 1OXUA 4A3EH 3J7ZC 1WJJA 1H95A 4JI5Q 3S17H 1XPRA 4A3MH 4B3ML 1S40A 2GVAA 4NXML 3Q8DA 3PSIA 1NJIC 2NN6I 3S2HH 3E9HA 3I4NH 2UUCL 3G6EA 2H5XA 1YHAA 3DLLA 2YTYA 1UE5A 5M3MH 5IYBH 4JI3L 4QL5A 2HHHL 3CC7A 2HIVA 2N3SA 3A74A 3J81j 2E2JH 2RHSB 3GDEA 1VQEA 3MEFA 4IO9A 1BKBA 3I4MH 3M4PA 4RG1A 4JBKA 3M4OH 1SN8A 4LUOA 1C7YA 4JI6Q 3S1QH 3I2ZA 1N33Q 3FP9A 2KBNA 3K0XA 2MO0A 3RNUA 3M4QA 5FJ8H 5IWAQ 2NVTH 1PH7A 4A93H 3PUZA 3U58A 1I3QH 1WCMG 2PI2A 1PH1A 3K81C 1X65A 2I5HA 4PG3A 4AYBE 3GD7A 1JJCB 4QY7A 4DPGA 1XMQQ 2JEAI 1HR0L 3BU2A 4A3JH 3I7FA 3RLNA 1E1OA 4B3TQ 4OWXB 1B8AA 3G4SA 1M1KC 1SLJA 1L1OC 4DV3Q 2N8NA 4LF5Q 4JYAL 4QJFA 3GTQH 1MIUA 4K0KL 2HQLA 3PO2H 4BBRH 1XNRL 3PO3G 4GNXB 3DM3A 1OXTA 4DV7Q 2B29A 5LMUQ 4DV5L 1Q86C 4OX9L 4NPSA 4JBMA 5BR8L 2JA8H 2VY3A 3FHWA 4MZ9A 2Z0SA 1X9NA 5EAYA 1JMCA 4BBSG 1E1TA 4X65L 2ATWA 4A3FG 2R92H 2PNHA 2ID0A 4JBJA 4DV1Q 1VQIA 2UU9L 1K9MC 4LFBQ 4R4QA 1FVIA 4HJ8A 1X56A 3HOUH 4IPCA 3J80c 2Z6KC 1GO3E 2VQFL 4DV4L 4DR2Q 4OO1G 1K3RA 1QUQB 4GNXC 1XPOA 3IRBA 3KLWA 5AJ3Q 5IY0A 3HOXG 1VQMA 2E2IH 4B3MQ 4BY7G 4LFAL 4NXMQ 4DAYB 1MJCA 4LF4L 4DKAC 2LXJA 4IFDI 1BVSA 3FKIG 4O0AA 2JA5G 2ZJRA 1QZGA 4A3KH 2UUCQ 5E7NA 1D8LA 4GKJL 5IYCH 4OO1I 3G48A 4P73A 1QZHA 1KRTA 1TWCH 4A3BH 1VQHA 2XGTA 4JI3Q 3PO2G 5C3EG 1HNZL 3UE1A 2HHHQ 4JI2L 2AMCB 5JJIA 1B7YB 1YEZA 3KF8B 2V1CC 4R4TA 5C0XJ 3K80C 4UY8C 5FLXc 4YWLA 4UPAA 1KIXA 4A3IG 1UEBA 4LFCL 2ZJQA 2D0OA 3S1NH 2ES2A 5JEAG 2NVXH 2F4VL 1K83H 3MXNB 2KCTA 2DGYA 3HFZB 4UP8A 3GTJH 3CF5A 4X66L 3S24A 4A75A 1EYGA 4GN4B 4DAMA 4ME3A 4YHHQ 5IP9H 3HOVH 1N34Q 4JI7L 1MJEA 1HZBA 1YBYA 3KJPA 1A8VA 1TWHH 1OXXK 3J7A5 4A3LG 2JK8A 4HIKA 3CCVA 4DR5L 1EIYB 4BA1I 4B3RL 1X54A 3S1MH 3D31A 4UP7A 3PUXA 1HR0Q 4P74A 1NBWA 3CC2A 4TQUS 3F2BA 3PUVA 1TXYA 5HY6A 1G291 4NXNL 5GAGC 2E5LL 3KF6B 4LF6L 4IPHA 1L1OA 2AKWB 2WB1E 3S15H 1Q81C 2K14A 1D7QA 1X3GA 4JYAQ 1K0RA 1YJNA 2UUBL 2VUMG 1MKHA 3CPFA 3TQYA 2QEXA 1IYJB 1SFOH 4K0KQ 5LMNQ 4C2MH 1XNRQ 2NVYH 2UXCL 4DNIA 4R4IA 1FJGQ 4LW1A 2B63G 1GVPA 4A3CG 2WAQE 1Y1WG 4DV5Q 4OX9Q 2BA1A 3K8AA 3JC66 1X6OA 4A3DH 3CCQA 2EQSA 1EOVA 5IP7G 1B70B 1WYDA 2I5LX 4X65Q 2VS1A 3UE0A 1UE1A 3OW2A 1HH2P 4LF7L 2WP8J 5IYDH 2F52A 2N49A 2GN5A 2UU9Q 2PQAB 4AIMA 2Z6KA 1JB7A 3JAMi 4AH6A 3ULLA 2R6GA 1PH5A 3S16H 3OTOQ 4O2DA 3CPWA 2EXDA 4YCWA 5GADC 2VQFQ 4BXXG 4DR3L 1AH9A 1CKNB 1WOCA 4X62L 3PUYA 2MFIA 3UDGA 4LF9L 1VQ5A 2JA7G 3A0JA 1FGUA 1IL2A 2E2HH 2K50A 1HNXQ 2UXDQ 2NZHA 3H0GH 5ELNA 4LFAQ 2R93H 2NVQH 3CMEA 4BY1H 1VQCA 1VCIA 1YVCA 2UXBL 4JI1Q 1SE8A 3RLFA 1PH3A 5LMNW 4JG2A 1XNQL 4GKJQ 1PYSB 3J81i 2A19A 2Q2IA 4XTCS 1IBLL 1VQFA 4JI2Q 1HNZQ 2JA6H 3H3VI 1NTGA 1Q1BA 1VQ8A 5GAEC 2MQHA 4YY3L 3CQZH 2VQEL 5M3FH 1V1QA 4GN5A 1J5EQ 4LFCQ 2IHEA 4A3GG 4P71A 4L5QA 4RMFA 2F4VQ 1PHJA 3W1GA 3GTLH 5C44G 3OYYA 3L0OA 3M9BA 1KC8C 1LUZA 1KHIA 4X66Q 4IPGA 2CKZB 3ERSX 4JI4L 4KHZA 5GROA 3I56A 3TS2A 2LXKA 4YWMA 2ZM6L 4DUZQ 2E8GA 2Q2UA 2A1AA 3GTOH 4A3EG 4JI7Q 4DV2L 2R7ZH 3HKZE 3F1ZA 2RHQB 4GOPB 4A3MG 3RZDH 1XMOL 1IBML 4C3IH 2VW9A 1U0LA 4DR5Q 3KFUA 2QGQA 1YHBA 2K75A 1SROA 4B3RQ 3T1YL 1EWIA 3I4NG 2HT1A 1QVCA 3RN5A 4IJLA 1G6PA 5IYBG 1HZAA 1SR3A 3KDFB 1UE7A 1Z47A 5M3MG 5FLMH 5M5WH 3CCLA 4LF6Q 4NXNQ 4TVAB 1VQGA 1YIJA 1K8AC 2R93G 1YI2A 4AQYL 4HIMA 1I94L 4BY1G 2Q2TA 1S72A 2KHIA 3I4MG 3T1HQ 4DV0L 4PZ7A 3ZJYC 1VQ9A 2UXCQ 4GOPC 2HIXA 2A8VA
chains in the Genus database with same CATH superfamily
1Z2NX 4HR7B 1A3UA 1QVGA 1B53A 1PTOF 1LV9A 2EJFC 5D65A 3IAYA 3K5MA 3AFQA 4O2AF 2PZUA 2HGSA 4A93G 2DIKA 4XQJA 2NVTB 3TINA 5LMNH 4YB8B 3I55A 2FMAA 2AQ1B 2L15A 4S3SA 5DLQE 1EOTA 5M5XB 3R5HA 4OELB 4ME6A 1Y8PB 4HNVA 1TWFH 5T1GA 1RJPA 1VQ6A 4QWEA 4PZ6A 3AB9A 2NWGA 1LTLA 4BY7B 3A55A 4DR3Q 3S2DB 2XCLA 2I0QA 4X62Q 1SE2A 2N55A 2AHOB 1RHPA 5C3EB 3M7NA 2MP1A 4KJOA 4QUFA 2JEGA 4A3IB 2DPIA 3N42B 1IBLQ 4RCNA 4OXPA 5KFAA 3VPBA 4J9QA 3KHGA 2VL6A 4YY3Q 4K2LA 5C4XH 1PV4A 3TRZA 1SCUB 2V4QA 4JI1H 3C2PA 1AN7A 1M6VA 2JEFA 1Z7TA 4X3KA 3RB6A 5G3LF 1CHPD 3H20A 3EN2A 2B2UA 4XX0B 4X3TA 2C35B 5EKIA 2J6UA 4JI4Q 1M7JA 2IA6A 2C00A 3PCOB 5FO9B 1BNZA 4O42A 1LLRD 4ZUJA 4DV2Q 1HZ9A 3KOJA 3TZDA 1QJOA 3QZ8A 1WSCA 1EY4A 4ED7A 4XZ3B 1XTCD 3F2DA 2PZWA 3JSLA 4DUZH 2FE3A 1HTPA 5JQWA 1T94A 1Q46A 3TQTA 4OONA 1NMGA 1STAA 4A3BG 3KJOA 4CDEC 4DR5H 2CW0C 2TMPA 3KHLA 2KEDA 1Y1VG 3NBHB 1TY0A 2NVXB 4Q43A 1SEBD 3GIDA 4L6TB 4NDXA 2QYZA 1N8RC 3HKZG 1Q1EA 2Z6BA 3GTPB 3T1HH 5LMUL 5H80A 4YWKA 4EGVA 4EVOA 1A63A 2IPKD 4O4IF 2V4RA 2RF4A 1HR0W 4HMJA 2HD3A 1PRTB 3UFXB 2W9AA 4JI0L 3M3YH 2F0NA 2FMMA 2D2CC 1UUPA 4OWWB 3TN2A 1PH9A 1WI5A 2C5CA 4ALPA 1H9MA 5EDWA 3CCEA 4LUZA 1LTID 5KFGA 2VB2X 2OTJA 4H13C 1EUCB 1I7LA 3RV3A 1I50B 1SYXB 1XYIA 2L5TA 4A3DG 2IT1A 1U4RA 5GQOA 3RUPA 1MZBA 4IJHA 1B4OA 1TKWB 2I5MX 1KABA 2K5NA 2BE5C 2CH4A 1E0BA 3KBXA 3FKIA 2JA5A 4JOIC 3K6OA 4UCTA 1TWGH 2ZXRA 5I47A 3S17B 1LT3D 3UI2A 1TU2B 2EY1A 4DR4Q 4FS2A 1L1OB 1N36L 2HVSA 3ER0A 1NY4A 2E74C 2F0UA 1WTXA 3S2HB 1UNNC 1TWFA 3CCMA 1VBHA 1YJWA 1S5DD 5M3MB 3HOWG 3H0GG 4O3RA 1KLGD 2Q8RE 4G4KA 5M5XH 2PMZA 2OCEA 1QILA 2D9UA 5E3FA 4OWTB 2UUAL 2UUBQ 4BY1B 3I4MB 2YZGA 1J6QA 2NTSA 1U4MA 3R2TA 3L2PA 2ASDA 4BY7H 2JA6G 1JQYD 1FL0A 2FFKB 2JA6B 4HIDA 2A69C 3S2DH 5M3FG 4RGMA 4JI8Q 2NU6B 3RV4A 4DK3C 5KIXA 5C3EH 2R7LA 1FJGL 4MNOA 4A3IH 1VQOA 4A3JB 5D3IB 4FNFA 1N9WA 4JBWA 3RZDB 3KAKA 4ZHQF 4LAAA 2K5DA 3PW7A 4M8AA 1LYLA 1F2ZA 2BCOA 2NZ1D 3FRPB 3C3LA 1IOWA 1MHWC 1NSNS 3M9NB 1S97A 2FXQA 4JK1C 3CP0A 4N8FA 2RCFA 3RR5A 2LMCB 4DAVA 4HEDA 1WTWA 5CV8A 3OTOL 2YRXA 4C1NK 2XD4A 2JA8B 5EPLA 1G2TA 5K2MA 1FNWA 2K03A 4JCVE 1N32H 1HZCA 5C3XA 3HEJA 3AU7A 2R92B 3UQ8A 2A74C 1HNWQ 2VUMH 2F0PA 1L0XB 4FF3A 4RGNA 1WTHA 4EEQA 2TSSA 1D2BA 3EPGA 4MTDA 1KQSA 2Z8LA 4DK6C 4JV5Q 1IBMQ 2K33A 1YITA 2CCZA 3M85A 4R8UA 1UC8A 4UAIA 4FDBA 4TV9F 3GTPH 3NENA 4A3KB 1EUJA 3HOYG 1A9XA 4IUUA 3K5NA 4B3TL 5JJLA 1N48A 4J9LA 3MR5A 4DV0Q 3S1NB 4IOCA 4NP5A 4JV0A 1NUCA 3BA8A 1A2TA 3S14B 1XXGA 4F50A 1W3SA 4F7XA 1DD2A 3L7ZC 5CAEB 2XSCA 3U4VA 4P72A 5AFWA 2JYOA 4JC0A 1YNJC 1WTOA 4BA2I 1FR3A 1LT5D 2EJMA 2K5WA 3BVZA 1I50H 3J81c 1BNCA 1ICFB 1PYBA 3GIKA 2WFWA 2WV6D 3BZCA 3KK7A 4FU0A 3K58A 3HOZG 4DR6H 2F0LA 4CJ2C 2HDLA 2PYKA 4HR7A 4LF7H 2PI2E 1F9SA 3NPPA 3J7ZC 4JI5Q 3S17H 1XPRA 3OW7A 1S40A 1I3QA 2NVYB 4IHJF 1GYFA 3ITPA 4DR3H 2FK1A 3S2HH 4YR3A 2CHBD 3PW2A 3W3AA 3QB3A 1CQIB 5IYBH 5M3MH 1MD2D 5NUCA 5J2TF 2HHHL 1JB3A 2N3SA 1D6EC 2K32A 3BJYA 3I4MH 1BKBA 2WYOA 4ODGA 4C5AA 4LUOA 1C7YA 1FD7D 2WIIB 1HA5A 1YNND 2EJGC 4KMUC 3V6KA 3FMCA 5KNBA 1SYFA 4I7AA 4J9SA 1C8CA 2R8HA 2I5HA 4J1MA 1HFNA 3C1FA 5EWGA 2ZM6H 3NQIA 4QY7A 2JEAI 4A3JH 4C5CA 4DV2H 2SNSA 1XMOH 2PN1A 2CZGA 3QIAA 4PMBA 1H9RA 3O13A 5KT3A 4DU9A 3G4SA 1M1KC 5C4ZA 4LF5Q 5CV9A 2JN4A 4QJFA 3NTHA 4K0KL 3PO2H 3JAML 1XNRL 4AQYH 1I94H 4OX9L 2JA8H 1R9TB 3HS0C 4IUVA 1E1TA 4EGQA 2R92H 2K1BA 4ED6A 1U4LA 3Q8QB 1AP0A 1QOHA 3NBHA 4B3SH 2NVXA 1AZPA 4I65A 4IRDA 2EYMA 1PTOC 3DHQA 3DMUA 3QJYA 4DR2Q 4CDDC 1XPOA 2O2LD 1AZQA 4B3MQ 3L4JA 4RB2C 4MN3A 4DA2A 4DR7H 1QZGA 2ZXOA 4A3KH 4Q8FA 2BE5D 1LTGD 4OO1I 5IYCH 4XYOA 4P73A 4XXEA 4MTEA 1VQHA 4JI2L 2B2WC 3OHXC 3UE1A 1E4EA 1YEZA 2A68C 4MV4A 4YWLA 3S1NH 1UEBA 4RUAA 3SVMA 3MWMA 1EZ6A 4U6PA 3WO0A 2KCTA 3HFZB 1M0WA 2WE6A 4UP8A 3ETJA 4X66L 5FO8B 1I50A 5KFJA 3VR4A 4DAMA 4YAJB 4MV3A 4EYHB 3T5HA 2R85A 1JOQA 1E4FT 2W8LA 1EIGA 5CMDA 4JI7L 1MJEA 3WOEA 4JI6H 2YU9B 4DR4H 1N33H 4IUTA 4CJ1B 5IGDA 2KEEA 4HIKA 4V190 2ASLA 3D6CA 4KK7A 3PUXA 4UP7A 3GTGB 2G9DA 2P5ZX 1HR0Q 4P74A 1NBWA 5C1PA 5IWAH 4TQUS 3F2BA 4NXNL 4F87A 4KY5A 1L1OA 1Q81C 4F4XA 2K14A 4CHTB 5EBCA 1I4GA 1DXMA 1X3GA 2UUBL 3MXUA 5T1IA 1MKHA 3TQYA 3V2TA 2QEXA 1Z2PX 5LMNQ 2NVYH 5LL6S 1TIID 1JIHA 4DV3H 5FPOA 2B2YA 4JI8H 5C5MA 1GUWA 2BA1A 3CCQA 2W6MA 4C3HB 1KBLA 5IP7G 2GPWA 1B70B 2I5LX 1ILPA 2VS1A 3UE0A 1J8IA 4ED2A 1V8QA 5A35A 2JA6A 3OW2A 4DV7H 5IYDH 4RUCA 4ECTA 2GN5A 4KD4A 5D1OB 1SYCA 4E4TA 1D5XC 2YRWA 2R6GA 3K0YA 3WDNA 4LH6A 4BXXG 5GADC 4ED8A 1JCKB 4ULLA 3LWUA 1AH9A 4NLGA 3UDGA 4LF9L 1HRJA 1H9SB 2X6LA 5ELEA 1UAPA 4PWQA 3I91A 1VQCA 4ECRA 3RAQA 4JI1Q 2J7ZA 1XNQL 1ZHQA 3JAMW 1PYSB 2A19A 1FKAH 3VYTA 1VQFA 4IN3A 3J81E 4ZKBB 5EKKA 2VQEL 3H40A 1I6HB 1PX2A 5ELDA 2OF1A 3K5OA 4A3GG 1AN8A 5KFXA 2DJGC 5FLXL 1TS4A 4IPGA 3LWBA 2R92A 1V1PB 1KNAA 1A2UA 5EQ0A 4KHZA 4JV5H 4DUZQ 4KN7C 3SDZA 2E8GA 3HP3A 3BG5A 2BQ3A 1IBML 4A3MG 5KFSA 4V0BA 2VW9A 5JPMC 4DR5Q 3KFUA 1R4PB 2B2VA 4YHHH 1EWIA 1N34H 2HT1A 2FMCA 4YJ3F 5KT7A 1G6PA 5C4JB 2J9GA 3MXNA 1B1ZA 3C46A 4TVAB 1E4GT 1NAPA 1TWAB 4HIMA 2KA7A 3T1HQ 4DV0L 1MSHA 4HSPA 3VMMA 1EWCA 4BBSB 4N9TA 4GOPC 1HFGA 3A7LA 3QOLA 2R7FA 3A5ZB 2OQ0A 1VQNA 2ZTEA 1JT8A 5FJ8G 4RU9A 2ICIA 3BYTB 5CGKA 3CXCA 1EU3A 4CC5A 5A2QW 4EBCA 3HXLA 1GKHA 3PR4A 1JWSD 4DV5H 1NMFA 4KV6A 3GIQA 2XWJB 3KTMA 1O7YA 3K3PA 2WB1G 3E9IA 5C0XG 3OIPA 1KJJA 5ELOA 1C0AA 2EIFA 2CWAA 3K7UC 4J9PA 2F0TA 4PDBA 2JA5B 1CZWA 1X3QA 3QR8A 2V4DA 1KTKA 3KLSA 4DUYL 2YU9H 4O2BF 3D4RA 3N52A 4F88A 3QG1A 4JI5L 3T13A 5KFRA 1ZQ7A 2PVPA 3GTGH 4PMWA 4O4HF 4HAEA 4ZQIA 3G6XA 1STHA 4TKOB 4UFZA 3NXWA 1ZHSA 1HNXH 2NVYA 4LFAH 4I55F 4R8NA 1RYSA 3ULPA 4IFDJ 2A6HC 4QCLA 3PQIA 1SRUA 1T5XD 2K5HA 3HOUG 3RAXA 3MEHA 2JEBI 2RDJA 2EYPA 4QWDA 2ZTDA 4C1NI 1Y8OB 4H02A 5KG6A 4C3HH 4ZKCB 3RD4A 5COYA 4L63B 2NN6H 3I70A 1RIPA 1A3TA 3RF2A 3J80W 4MTKA 5CV4A 3W5OA 4YCVA 4Q45A 2HCIA 4HJ9A 3H4DA 3TQ1A 3LGJA 1ZYRC 1JWUD 4Q44A 2ASBA 1LO5D 2B63B 4LF5H 4B3RH 1PH2A 2FK2A 1EQQA 1YHQA 1KAWA 4IAJA 4DR1L 3ONAB 5HV6A 1SMYD 2HDMA 4LF8L 2AGQA 2F03A 1BR9A 3X3MA 1HUNA 5IIFA 3N8DA 3EQLC 4KKTA 5IP9G 1WTPA 1EY5A 3HOVG 5FLXW 2WDTA 4DV6L 2P0AA 2UXCH 1CQFA 4HSVA 2EYHA 3MWDA 3K5HA 1XJVA 3VYSA 3PF5A 1D5MC 1JJ2A 5KT2A 1GUOA 1R9TA 1S4ZA 1GHKA 2IP4A 1N32Q 4K5WA 5J2UF 4O4LF 4POGA 3Q8RB 5JVH3 4DR2L 1TAEA 1SDFA 4MV6A 2PMZE 3TREA 2CQYA 4O3NA 2BA0A 2C22A 2V9WA 1Y14B 1EEFD 4R8UB 2LFNA 2J6TA 1PVOA 3AYHB 3NK9A 3TP5A 1EYZA 2X6GA 1IBKL 5C4JH 3DM1A 4GC6A 1PXUA 1YZ6A 3U9OA 1F9QA 3BZDB 4RHRA 1F9RA 4ZI7F 1JOOA 4JPBW 4WFN3 1TWAH 2IHFA 2V5AA 2MJ8A 2UXBH 1SJHD 3OMCA 1PLFA 3GO5A 4IR1A 5G3LD 3CD6A 2IX1A 4BBSH 4QB4A 1Z9FA 4ID6A 2YYZA 1EFID 4A3FH 3E6ZX 5EOYA 4YBZB 4P2CB 3RGZA 3A5UA 4OEMB 3EJIA 3AQQA 5DQHA 1G6ZA 1B9NA 2R93B 2WACA 2NVQB 4K6LA 1B50A 2L11A 3D0FA 2IX0A 1X3FA 2YU9A 5KFUA 1K8GA 3GQCA 3D4DA 3ORRA 1S0OA 4HMIA 3FKIH 1A0IA 2JA5H 3GTGA 2KHJA 1E3PA 4A93B 1DGSA 1I3QB 4DR6Q 4YAKB 5LMNL 4LF7Q 3JRXA 2IWHA 1U4PA 2B2TC 3L4KA 2IBKA 5BR8H 3H91A 3P75A 4X64L 1Q7YC 5JEAH 2R7ZG 4WJ4A 5KFWA 4HJAA 4YR2A 1S10A 1EUDB 4C3IG 1AE2A 3LWEA 1DOMA 4N8X1 2MNAA 4KHPL 1STNA 3RUZA 3VDYA 2HCCA 1XTDA 2W7OA 1BBWA 2F0DA 2YV5A 2XTIA 4YCUA 3LNNA 5ELFA 5C0XI 3NWSA 2XCPA 4A76A 2K5QA 1ENCA 3E0EA 5D1OA 1STEA 1V9PA 2SNMA 3CVZA 2H1EA 1CQVA 3GILA 4LF4H 2R82A 2YZNA 2KENA 1CHQD 1SYDA 1KDBA 1VS0A 2BDOA 3V6HA 4F4ZA 4GLAC 4JI1L 1H9SA 4EQPA 4GKKQ 4BS9A 1U5KA 4QUCA 4Y7NH 1DV2A 2B63H 5EJWA 3V4SA 4A3CH 5ELCA 2ZM6Q 1YNNC 4JOIA 4NMZA 3VR6A 5I6WA 3TS0A 3HZXA 1XMOQ 2W6ZA 5DQGA 5T14A 3T4AC 5L37A 3QWNA 2IX3A 4L5RC 5KYLA 1GSAA 3E3XA 2CQOA 4KY6A 2HVRA 4DUZL 1LT4D 1TWCB 3PUWA 4P75A 4A3BB 5KFKA 3T53B 5JEAJ 1V1PA 3Q24A 4AQYQ 1I94Q 3DF7A 3JAMc 3SEBA 3A8JE 5C5LA 4XYLB 3CHBD 2YTVA 1Y1VB 2RBMA 3CCUA 3H3VH 1CUKA 1DCZA 1WTVA 1QCBD 2W6OA 1SYEA 1KLUD 2SEBD 3NSWA 4PNYA 2W9BB 4J15A 4F4WA 1LM0A 2QDLA 1G51A 3HKZB 3PW0A 2RDIA 4U68A 3T1HL 1MGSA 1LTRD 3K59A 4B3SQ 4UCOA 5JUMA 1TWHB 1GSOA 5KFPA 4IRCA 5IT9W 4TUYF 4BWGB 5HGQA 1EYCA 1TWAA 3STBD 3S1MB 1P16A 4DV1L 2FK3A 3F8TA 4WJ3M 3HRZC 4LFBL 3MFYA 3CW2C 3G8CA 3U4ZA 1Q8KA 5LL6b 5CR3A 1E4EB 2PQEA 2BQUA 1L2FA 4DN4M 2ZJPA 4DXFA 2AUKA 1VAJA 4LH7A 1NR4A 1BCPB 2KVMA 3HKSA 5CORA 4U673 2F0KA 4DR7Q 2VB3X 2V58A 1RODA 1R4QB 1WJJA 2YZMA 2Q8IB 2C2DA 3LMLA 1PRTF 4NXML 3Q8DA 3LP8A 2DJFC 4NW2A 3OHAA 4ABNA 4UCUA 2NU7B 2UUCL 3G6EA 2H5XA 3T5KA 4A3DB 1SYBA 4JI3L 2EYFA 2A6HD 4QL5A 1II3A 3E5NA 3A74A 1BCPF 2RHSB 4J0MA 4IO9A 3MEFA 4Q0YA 3TIIA 1QE6A 2B8FA 4JBKA 3T56B 4JI6Q 1N33Q 4KKSA 1PZID 3NWTA 5KG1A 5KFMA 4XQQA 3MFHA 1E2VA 5IWAQ 2NVTH 4A93H 3PUZA 2RDFA 3U58A 1I3QH 2SCUB 1WCMG 5KYIA 3H0GB 3HOWB 4YR0A 1X65A 3E5SA 4EQNA 1D1IA 2B2UC 2I07B 1ZYRD 1RJTA 5C5JA 3I7FA 1TR5A 2LY7A 1B8AA 1N36H 1ESFA 5DQIA 4DV3Q 2N8NA 4MA5A 5M3FB 4JYAL 1EY6A 2WINB 1BO0A 3GTLB 5CV5A 2Z1CA 3PO3G 4GNXB 5JOBA 1I4QA 3DM3A 4DV7Q 2F0OA 4CKEA 4ECUA 2UUAH 2LS01 1ULZA 3NUCA 4FYDA 2J4XA 2K28A 5EAYA 1JMCA 4X65L 2EY5A 5KNCA 4FM9A 2B63A 5DAUA 2YS7A 2PNHA 3MFIA 1VQIA 2UU9L 1FVIA 3J80c 2D5DA 3DWQA 2DPJA 3MXGA 2F0JA 2Z6KC 4RNMA 2GA4B 3TP8A 1GO3E 2VQFL 4OO1G 4FBTA 3RB4A 5AJ3Q 1F2LA 4Q0FA 3T51B 1K1QA 5IY0A 3HOXG 3I4LA 2ALZA 4DAYB 1K8MA 2QF7A 2R6FA 5KFHA 2I80A 4FBUA 2ZJRA 5E7NA 4QIWB 4GKJL 1H9KA 3G48A 1KRTA 3I12A 1EY8A 1TWCH 4XT1B 4A3BH 2XGTA 3P1HA 3PO2G 5LXTF 1HNZL 5IGFA 4RAUC 4R4TA 1B2TA 4UY8C 3K80C 1AUXA 5FLXc 2W6QA 4LFCL 4KKUA 2NVXH 2F4VL 3MXNB 5JJZA 2DGYA 3T16A 4DAPA 2ICEC 5IGBA 1EYGA 1EHIA 1JWMD 1O7ZA 4YHHQ 4DL2A 1N34Q 4JV1A 1YBYA 5J22A 1A8VA 1TWHH 3HOYB 4A3LG 3CCVA 4BA1I 2FJ2A 1X54A 3S1MH 4QMGA 1PFNA 2ZDGA 3CC2A 5L1IA 2VUGA 1G2SA 5GAGC 2XVSA 5LHY1 3MR6A 1BXTA 4C3JG 1M0TA 1PFBA 1XMQH 3DUZA 4C3JB 1K0RA 3CPFA 3D8GA 3K7AB 2FPIB 2W57A 4B3TH 2E2HA 2F0SA 1C3OA 2PW5A 1BF4A 2R93A 1Y1WG 1S68A 3SE7A 4DV5Q 2C9OA 2XN9C 4RB1A 4A3DH 5M5YB 3HOZB 4K6DA 4B08A 1EOVA 4RAYA 1RJRA 2DWCA 5TSSA 3X3NA 4DL3A 1Q8IA 4LF7L 3MWEA 2F52A 5EPKA 4YIJA 1JB7A 4AH6A 3ULLA 4HYKA 1DONA 3CPWA 4YCWA 4EFBA 1RCVD 4DR3L 3I90A 3JAME 4TV8F 3EPIA 4X62L 3DXJC 2MFIA 3PUYA 2JA7G 3A0JA 1IW7D 2NYZD 1HNXQ 3BDCA 3H0GH 4NKLA 4LFAQ 1BQQT 1SNOA 3CMEA 1YVCA 4BY1H 2FB9A 3SI8A 4TQSA 1TS2A 4G7ZC 1DZ1A 4JG2A 1QNUA 4H44C 5DG9A 3J81i 3L3OC 1CTMA 1F77A 1LTSD 2PNRC 4XTCS 3G7LA 1IBLL 3IL8A 2DZDA 2JA6H 1GUSA 1Q1BA 3IFTA 4LJZC 4LSAA 3GIPA 4YY3L 5M3FH 1V1QA 4RGTA 5KFCA 4GKKH 4P71A 1SJED 2BOSA 4L5QA 4RMFA 5EGTA 5LYJF 3GTLH 4KY7A 5C44G 3N6XA 2HHHH 3Q8SB 5C44B 4JI4L 3N40P 2R8IA 2ZM6L 4YWMA 2M00A 1S9FA 4A3EG 4DV2L 4Z9CB 2RHQB 3RZDH 1XMOL 3BAAA 3TSSA 1ENFA 1U0LA 2QGQA 4APMA 1SROA 5DEHA 3KF8A 1IYUA 4B3RQ 4RKBA 3GLKA 3RGXA 5C4HA 3I4NG 1K28A 1SR3A 1H95A 5IODA 3CCLA 1Z6HA 4LF6Q 4IZOA 2PCFB 1YIJA 4AQYL 1I94L 3IKJA 2KHIA 3ERQA 4J9RA 4EEYA 1SNQA 5A2QE 4PZ7A 1TWCA 2R84A 1S5BD 3M4OB 1VQ9A 2UXCQ 3PUVA 5EBDA 3S1QB 5CC4A 1SMYC 4RFBA 1HQMC 4ETSA 3M9OB 2Y0SG 2W9CB 5KT4A 3PGZA 3G6VA 3KYHC 3VR2A 1Y1VA 4K0KH 4FP5D 1VMCA 1XNRH 4B3SL 2W9BA 4FXGC 2KCMA 1YNXA 2ALYB 3PIOA 3HKZA 4OX9H 2XIWA 1EQTA 4EQOA 1OXVA 3KXYT 1EIHA 2B8GA 2JQOA 4K14A 2ZXPA 1M90C 1TWHA 2XCAA 2W8KA 3DWAA 1M8AA 4G57A 4QGUA 3J7AV 1SMXA 2E75C 3V05A 4RCOA 4FO2A 2LSSA 1ET6A 3SK4A 4B9XA 3VA5A 2GVBA 3OWFA 4BBRG 3HOYH 2AWNA 3GTKA 5K36G 5IT9c 2UXBQ 3EA6A 3FEWX 2DN8A 1KAAA 3OPOA 5I2YA 3S14H 2KSWA 3CAMA 2KCNA 2UXDH 4RGOS 1GUGA 2KECA 4KD3A 3U9SA 1I6VC 3GQBA 4ECZA 2EYOA 1RDPD 5KG7A 4GS3A 3K7AH 4G3IA 1E24A 1IYVA 1PFMA 4ZOLF 3J80E 2YS6A 4JI2H 3GV6A 4DR4L 3K3VA 2LKVA 2R87A 1JJGA 1J9OA 1J5EH 5KRUA 1I4RA 5J39A 5M5YH 4L5SA 3EFXD 3HOZH 3BJUA 1ZKOA 3H4BA 4QW9A 4X66H 2KCCA 1K8OA 4POFA 4LNQA 1EY0A 1WTQA 2W7PA 3MR3A 4JI7H 1I7NA 5DM73 3NQTA 3H0GA 4EBEA 1WCMA 3P20A 4Y52H 3KBGA 1HPCA 5BR8Q 5FLXE 2CW8A 4JI8L 3OMGA 5KG3A 4AYBG 5KFLA 1E22A 4NXNH 4AYBB 5H1SE 2R7DA 2MO1A 4GOPA 1JORA 1B04A 5GONF 3P7JA 4K5VA 2RGVA 1IZ6A 2N88A 3VYUA 4R4CA 1WTRA 5LOVF 3KLSX 3GTLA 1HJPA 1JC7A 1RTNA 2H4OA 4HCEA 2EY6A 3RZOB 4R9WA 4GNXA 2XC9A 1CS0A 1E7ZA 3I73A 1O7LA 5JVLA 4LF4Q 2G5DA 1KL9A 1SYGA 1QB5D 4NB3A 1VQBA 5I4DA 3NEMA 5AJ3L 2K5VA 4LUVA 4HNUA 1XWEA 1EWHA 3EBEA 4MAMA 5C8YF 1VQPA 4DK0A 4LF9H 4A3GB 1HNWL 3NHHA 4DGZA 1PRTC 2XWBB 4JVZA 4EQ5A 4UCVA 2L55A 2NTTA 2K52A 4DAYA 1OXSC 1WFQA 1I4PA 3F2CA 2A5HA 1I4XA 3OHBA 1EY9A 1EFWA 1R9TH 4QIWA 2CVRA 4JV5L 5DG7A 3MAQA 2R7MA 2FINB 4C56C 4A3MB 2ATLA 2KHSA 3SE0A 2OEOA 4KN4C 1NE3A 4UHVA 3NELA 2Z4HA 2VQEH 1A62A 1P8LA 4YHHL 4A2BA 3AFPA 1N34L 2IL8A 1DJRD 3GIMA 5BN3A 4IFDH 4GN3B 1A15A 2E2JB 2DUDA 4ME5A 1WD1A 4MTNA 1OTCA 1BXRA 2UVWA 3V4ZA 3RB3A 5IGGA 2F4IA 5CB4F 3NGDA 2AQ3B 1H9JA 3U50C 1VQKA 3BQ1A 2MGSA 1RD9D 2ZTCA 4HJ7A 5L1KA 2D62A 4IOAA 5D8DA 3M4IA 3H6MA 1BDOA 4FS1A 1CKMA 5KFYA 3RTXA 1MSGA 1KNEA 3SR1A 4A2AA 1AEXA 3STBC 1UWVA 1X3EA 2WB1B 4IUPA 2PZTA 3G71A 2K6AA 4EX5A 3WNZA 5BMVF 3R2IA 1CK1A 2SOBA 1X55A 3VYRA 3H15A 1SNDA 1GSHA 1Y1WA 4JI0Q 2WAQG 5FLMG 3J81L 5LL6X 3A8IE 4DV4H 1YJ9A 2WKCA 4PZ8A 1NCVA 1CSQA 1CFMA 1F2YA 4A4IA 3RN2A 4MIUA 1GLVA 3GP7A 4EGJA 2DLNA 3HGBA 1LT6D 2F0VA 1HNXL 2W71A 3MA2B 1FNUA 3TZUA 1KJQA 4I50F 5CA1F 3ICEA 2EDGA 1K0SA 2A6EC 2AU0A 3JSNA 3HOUB 1TA8A 3K5IA 2B3GA 2XRQD 4DUYH 1DV1A 5DGAA 2Z9HA 1PH8A 1A3VA 4J9OA 3PV0A 4KJNA 4XT3B 2DNEA 3BG3A 1BBUA 5IP7H 2E2IB 3HBLA 4RNOA 2I87A 1N36Q 5IYZF 1LTTD 3B6YA 1I5FA 3AEVA 4K8JA 3PF4A 2BH2A 2YTXA 3RZOH 4C5BA 1ASYA 4BXXH 3GV8B 4LF5L 2UUAQ 5IT9E 3H94A 2ZDQA 1V43A 2B2VC 3KALA 4LMYA 2DNCA 2EOTA 1CI3M 2W6PA 4LF6H 2E5LH 1K83B 3D4WA 2NBFA 3CCJA 1VKZA 5C1OA 4MV8A 1JOKA 2RSNA 4QWAA 4I7ZC 5C4XG 5KFDA 3HOVB 2F3IA 2IJ0A 3V6JA 5LP6F 4IPDA 2B2TA 4RWSC 2VA2A 4HCSA 1I6HH 3ULJA 4KI0A 4X6AH 1EQRA 4ZAIA 4A3GH 4G7HC 5BPFA 1S5ED 3M7GA 4FF1A 3GIIA 1TQOA 4DR1H 2OQKA 5K5PA 4B9WA 4J9KA 3IG0A 4HIOA 1JXLA 4IQZA 1JE5A 2W9CA 3NP8A 2Y0SA 4FXDA 1OXUA 2AGPA 2F0IA 4FF4A 4CKCA 1SFOB 4A3MH 4B3ML 1PZJD 4I4TF 4DV6H 4C2MB 1EQVA 2GVAA 5JVG3 4OGQC 4OL7A 2OLSA 1NJIC 2NN6I 2C2RA 3BQ0A 2M05A 2F0FA 1RYRA 3DLLA 1EL0A 2YTYA 1UE5A 1DM0B 3A8KE 4RZRA 3J7YW 1S5FD 3CC7A 1LABA 2HIVA 2E2JH 4ILWA 1VQEA 4GC7A 2HQEA 3M4PA 1WD0A 4DF7A 1SN8A 3I2ZA 1PYWD 3FP9A 2KBNA 3S16B 4MV9A 2YCHA 3K0XA 5KFQA 2O5IC 1B44D 2MO0A 1IBKH 5FJ8H 1PH7A 2YYAA 3M3YB 5M9OA 2E2HB 2ZT9C 3GV5B 1PH1A 3K81C 3SXHA 2FPGB 4PG3A 3ND9A 1JJCB 4DPGA 5KX5F 1XMQQ 1HR0L 5ELBA 3RLNA 1Y8NB 4X3UA 4B3TQ 5E4WC 3T1YH 3Q22A 1I4HA 4HN7A 1XX8A 4ECWA 1G91A 3EROA 2L0CA 1IOVA 1X3PA 2NUCA 1PTOB 2JP1A 4IURA 3PVXA 1KJ9A 1JDEA 2B29A 1Q86C 5IGCA 5BR8L 2VY3A 3FHWA 3GTOB 2Z0SA 4L8JA 2R7ZB 3TBIB 1E2ZA 2L9HA 4PQXA 4C3IB 2ATWA 2ID0A 3J7AF 4JBJA 4CC6A 1UNSA 4ZUIA 2L1BA 4R4QA 1S03G 3HOUH 1X56A 4AYBA 5M5WB 1ILQA 3GTJA 1EZ8A 1K3RA 1BJTA 3N44B 3IRBA 4X64H 3TDQA 5D3DA 4CDFC 5CBEE 1MBYA 1IHZA 4PMCA 2FKLA 2E2IH 2FLPA 5F9NA 4DK1A 4BY7G 4FXKC 1DIKA 1CT1D 4M1UB 1PRTD 4LF4L 3SHLA 1PDQA 4DKAC 1IW7C 1SNCA 2F1MA 1BVSA 1XDNA 4KHPH 1D8LA 1QZHA 3WO1A 3R3OA 5C3EG 2HHHQ 2AMCB 1SBBB 3KF8B 1SE3A 2V1CC 5C0XJ 5JVDF 2FLNA 4J6HA 1BCPD 4UPAA 3ZYYX 4A3IG 1KIXA 2ES2A 5IOCA 1TVXA 1K83H 1O80A 1W6KA 3FVQA 3RIZA 3R23A 4MV1A 3CF5A 2KUMA 2KOLA 4A75A 5KFEA 4ME3A 3Q23A 4DL7A 5IP9H 3HOVH 4WORA 1ZXTA 2KQ3A 1AW7A 1HZBA 2QKIC 3KJPA 4OHJA 1OXXK 3J7A5 4DR5L 2MCTA 1LACA 1VDZA 1EIYB 5FOBB 1VBGA 3D31A 1BGWA 2X69A 2GLTA 3T5LA 4LMQD 1TXYA 1G291 2K7VA 2QW7A 3KF6B 4IPHA 2AKWB 1WVLA 1BBXC 3A54A 1KJIA 1ONLA 2EYLA 1D7QA 2OH2A 1YJNA 3MHBA 2VUMG 2W70A 3RB0A 4K0KQ 1SFOH 2VUMB 4C2MH 1XNRQ 5I2XA 4R4IA 4LW1A 1L0YB 1GVPA 3SK8A 3OSPA 2M9VA 1TS3A 4OX9Q 1UEAB 1X6OA 2EY2A 3S1RB 2FLLA 2EQSA 2EYJA 4J9MA 4TSSA 1UE1A 3GTKB 1HH2P 5LMUH 2VPQA 3CQZA 2RQXA 2PQAB 4AIMA 1F9PA 2Z6KA 2IMWP 3JAMi 3PN1A 3S16H 4CBVA 2FPPB 2EXDA 5KG0A 4MHEA 4JI0H 4DV1H 1WOCA 1PZKD 4LFBH 2WB1A 3I3CA 4ZLTF 1FGUA 1RTOA 2R86A 2E2HH 4EFEA 4RNNA 2UXDQ 2CH4W 2NZHA 5ELNA 2R93H 2A6ED 3QOJA 5CBAE 2NVQH 3OSNA 4ECVA 5KFOA 1HCZA 1PH3A 5LMNW 4M9UA 2F0QA 1RK6A 2WAQA 2RSOA 4NXMH 4JI2Q 3JZIA 4J8QA 3H3VI 1B33N 1VQ8A 4UCRA 1IKMA 5EWFA 1HQRD 1ICWA 3BQ2A 3URYA 1J5EQ 2UUCH 1AUVA 2IHEA 1PTOH 1PHJA 1Z2OX 2K05A 1X32A 4JI3H 3M9MB 3OYYA 1KC8C 1WCMB 5FD5A 1LUZA 4X66Q 2CKZB 2K01A 3ERSX 4ED3A 5GROA 3I56A 3TS2A 3W2DA 2A1AA 3GTOH 4JI7Q 1HTLD 5EZYF 2R7ZH 2XGPA 1KDAA 3HKZE 3F1ZA 4ZYSA 4GOPB 1KDCA 3GV7B 4C3IH 2OXPA 5DM63 1YHBA 3Q6SA 4IUQA 4RZQA 1QVCA 5IGEA 4IJLA 5IYBG 2NB0A 3MXPA 5M3MG 1HXYD 4NXNQ 3RJ0A 3KHHA 5M5WH 3G6JB 2E2IA 1VQGA 4H7BA 2UVVA 1YI2A 1FYCA 3PO3B 5FK9C 4BY1G 1V4YA 1S72A 3I4MG 1RK5A 1QUQB 5KKNB 3DEOA 2PW7A 4JYAH 1T9HA 1ET9A 1S5CD 1K83A 1E2WA 2J6SA 1B3AA 1U9RA 3K5LA 1FJGH 4RAZA 2EPBA 4JUZA 4RKLA 2QA4A 4A3JG 1DYQA 1XPUA 4IALA 1GXDC 1TT2A 3HOXB 1N32L 4X65H 2JXMB 2M2LA 5CYUA 5HBRB 4Y8VB 5FKAC 2O03A 4DXGA 4LF9Q 3ETHA 2UU9H 1TY2A 1JICA 1GD7A 5E4XA 3UDIA 5EWEA 3PO2B 3OTOH 5DLGA 2VQFH 2R8KA 1LTAD 1B9MA 1CSPA 1Y1VH 2JJQA 2AWOA 2JA8G 1XNQQ 1Q3LA 1SFOA 4LWCA 3CCRA 1B6SA 4TQRA 4C2MA 1EZ1A 2C2EA 3CRKC 3I4OA 1WH2A 3N6RA 1PK8A 2UVUA 4UP9A 2R92G 2EVBA 4RH6A 3J80i 5J3BA 4L5TA 2VQEQ 3E0JA 3MJFA 4PV1C 1CKNA 4GKJH 3I72A 3Q1KA 4ZRZA 4KLKA 1HNZH 4UDUC 4LK1C 4MA0A 5GAHC 1W2BA 1SEIA 5E1FA 4LFCH 3S1RH 3IFDA 4Q8EA 4DL5A 1CKOA 2F0MA 2F4VH 1VF5C 1GM5A 2VZAA 3FPUB 1PA6A 1CA5A 3JRWA 1AE3A 3Q0AA 5EPJA 3GTKH 1ESRA 4DNTB 4A3KG 3HB9A 1XMQL 3WWVA 5I9OA 5IYCG 2ZDHA 3R93A 2K4KA 3MC0B 2I8CA 1Y1WB 1PMRA 2QCPX 3DWPA 4HJ5A 1N56A 4O3QA 4DR6L 5ISRA 1D5ZC 2HJWA 1IKLA 3RMHA 4RHSA 1ENAA 5FO7B 1CA6A 3SK6A 2ZJTA 2NZOA 2OT2A 4F8MA 2OTLA 3KDFA 4QIWE 3MTSA 1VQ4A 3TP6A 4DV4Q 3BYYB 2ASJA 2CFMA 3GTMB 1VQ7A 5JAVA 1CE8A 1B6RA 4IWYA 3GTOA 4GZYC 2R7ZA 1EYAA 1TWGA 1L0WA 3HOWH 2JA7B 1SNMA 1BUVT 1WCMH 5KT6A 3KAJA 5JJKA 4EYIB 3G6YA 2B2WA 1RL2A 4DUYQ 4GLVB 2Q8TA 5CA0F 3WOFA 5FD6A 1VQLA 5KG2A 3CC4A 5KNDA 4GLXA 4X62H 2EE1A 3RLOA 4EG0A 4XQNA 4GKKL 1VQJA 1NR2A 5KFIA 4M7EA 1Q12A 3H3VC 3PO3H 3OSOA 1VQAA 5IYDG 4RB3C 1ZETA 1IXRA 2B39A 3ORQA 4R4OA 3CMAA 1G8ZD 4A3EB 4QQBX 4DL4A 1IBLH 4WRDA 5HURA 2J0TD 5KFVA 4YY3H 4O1NA 3PIPA 2YL2A 3I4NB 1C9OA 2E5LQ 1EEID 1CZGA 4OO1H 4JI4H 1Y69U 2VNUD 3CU7A 3MFGA 4O3OA 2CW0D 3HOXH 2RVLA 3W1BA 1UE6A 2AGOA 3UDXA 2Y0SB 1O7IA 3R5XA 3PZPA 4N9PA 4DR1Q 3KF6A 4K8IA 2VA3A 4LF8Q 2BH8A 2NUAB 4J9NA 1S0NA 1JX4A 2F3WA 2OWOA 5BN5A 1KXLA 3K57A 5CV7A 4FVMA 4HNTA 1VQDA 1SAPA 4IRKA 1HUMA 2VUMA 2R8GA 4CJ0B 4XIGS 4DV6Q 1O75A 2V59A 3TP7A 4OIJA 1K3BC 1RF2D 2D0PA 1PH4A 1FGBD 2W6NA 3VPCA 1MI2A 4DR7L 3QFFA 3GTQB 3R5FA 3EIVA 5LA6F 4BBRB 2CWPA 4IFDG 4A3LH 4HQ6A 1EIFA 3D3RA 3KLRA 5D14A 4F4YA 1KRSA 2WKDA 4APVA 4ECQA 3GTPA 2KJXA 1PH6A 3OIQA 2PQAA 2C28A 1Q82C 4QWBA 3BZKA 2HVQA 1GHJA 1T36A 2UXDL 4O3PA 5L1JA 4C3JH 4R1JA 1ASZA 2A73B 2IY5B 3VR3A 3SGIA 1IBKQ 5KT5A 2K04A 4JI6L 4UCSA 1N33L 1GUTA 5I6YA 4YJ2F 3CCSA 1Y1WH 5JPNC 4ED1A 1QVFA 1PFSA 5JH7F 1J5EL 5IWAL 1GUNA 1W96A 1KC7A 5DNFA 2Q2HA 4XYQA 3L9AX 4E6IA 3PW4A 3BDOA 3T1YQ 3I8ZA 5A2QL 3A56A 3OWEB 3U9TA 1GJXA 2JEJA 3UDFA 3S9WA 1QG7A 4DNRB 2Y0SE 3VA7A 2XGQA 3GTMH 2ENBA 1DOLA 3DEPA 5KFNA 5DG8A 4DV3L 3OUZA 3T5JA 3HG9A 4I7HA 2JA9A 1CQJB 2R61A 2RCNA 2DY7A 2JA7H 2A69D 3FMAA 1S3OA 3GTJB 2X0SA 5KGUA 2JE6I 4DV7L 1STGA 2UUBH 2F0WA 1KD1C 4K2KA 2QEJC 4R8IA 4TRDA 4KTAA 3Q8PB 2E2DC 3A7AB 2VPSA 5KFBA 3TEHB 1K73C 1GGOA 4U7CA 4QWCA 1I6UA 1RKNA 5IE8A 1UC9A 4R7RA 5KEEA 2R7KA 5KG5A 2VQDA 1CM9A 1JKJB 4X64Q 4C3HG 1GOZA 1HHVA 5C44H 2NN6G 1QUQA 1SSOA 2R7NA 4IZ8A 5D1PA 2IW3A 1QNKA 1VF7A 3S15B 1LTBD 1BOSA 4KHPQ 2N78A 4IUNA 4A3EH 3BA9A 1SE4A 4YP3A 2PO4A 3PSIA 4G7OC 3H09A 3N41B 4CDCC 5L9XA 4K5XA 3E9HA 3I4NH 1VMPA 1JR0D 3J80L 3PR5B 4DL6A 1YHAA 1Q90A 3M4YA 5DLFA 4WD3A 4FF2A 2FP4B 3J81j 3BVMA 3QO2A 3GDEA 4XDXA 1XNQH 4ECXA 2NU9B 2XNAC 4RB0A 4RG1A 3M4OH 1BCPC 2PPBC 3S1QH 3BABA 2G9HD 4ED0A 2F3VA 5FPRA 3KUPA 2E76C 2R8JA 2O4XA 1HNWH 3RNUA 3M4QA 3N43B 2I46A 3OUUA 2EXZA 3BVGA 2PI2A 1C48A 4YQWA 4AYBE 3GD7A 2NU8B 2VXWA 2L4NA 3BU2A 1O78A 1IBMH 1TS5A 3J7AK 1E1OA 1STBA 4OWXB 2FHTA 5HGTA 3PW5A 1SLJA 4BWSC 1L1OC 4QF4A 4JW0A 2L12A 2HUGA 2RDGA 3CQZB 3GTQH 1MIUA 2HQLA 2JSOA 4BBRH 5BPHA 3LX0A 1OXTA 5K36H 4DV5L 5LMUQ 4DV0H 1EYDA 1YNJD 4NPSA 2B2YC 4JBMA 4MZ9A 1X9NA 1KEEA 4BBSG 4A3FG 4A3FB 4DV1Q 2MUYA 4ZK9B 1B3QA 2XRSD 1K9MC 4LFBQ 4HJ8A 3V96A 4XYMB 2WTFA 3D6WA 2WAQB 4IPCA 3AMUA 5EKLA 4IR9A 4DV4L 5KFZA 5KFFA 4GNXC 2CQAA 4L1KA 3KLWA 1QWYA 1VQMA 3SK5A 4ZCKA 4LFAL 4NXMQ 3GTMA 1MJCA 1JDBB 2LXJA 4IFDI 3FKIG 4O0AA 2JA5G 5C3WA 3FKIB 3NTKA 2UUCQ 3GIJA 2JA7A 4JI5H 4KHVA 2SDFA 2O5JC 4JI3Q 1WR2A 4Q5VA 4CKBA 5JJIA 1B7YB 1K1SA 2AUJD 3FDTA 1V1OA 4ZQ3A 2FJZA 1T5EA 1TWFB 2D0OA 2ZJQA 5JEAG 4IWXA 3NBIA 3CRLC 3GTJH 2VOBA 5I9PA 3S24A 4CGYB 4GN4B 1OO9B 3KHRA 2PMZB 2VR1A 3VR5A 2BDNA 5C6AA 3PMFA 2R3ZA 1V51A 4EBDA 2JK8A 4ECYA 4B3RL 3MR2A 4ECSA 3NTIA 3OOCA 1ZEQX 2QILA 3C0FB 5HY6A 5KFTA 4LF6L 5L1LA 2E5LL 4LSXA 4DLKA 2WB1E 5J1ZA 3S15H 3CKIB 2EZVA 3IN5A 5C4XB 3Q2OA 4JYAQ 1JE4A 3QZ7A 1L2ZA 1NNXA 2RDHA 1IYJB 1T3NA 4O3SA 3GV3A 2UXCL 2F0GA 5KG4A 4DNIA 1FJGQ 2B63G 4Y7NB 2WAQE 3BDLA 4A3CG 1C30A 1DOKA 3RFCA 3K8AA 4RA8A 3JC66 3VPDA 2GPSA 2JEIA 5F9LA 2CW7A 4X65Q 1WYDA 4LF8H 1SXTA 3F2UA 5DGBA 2QK4A 2AQ4A 2WP8J 4WBNF 2N49A 3PIP3 1PTOD 2MPMA 2UU9Q 4DFAA 1FNVA 2F0HA 1PH5A 1EY7A 3OTOQ 4O2DA 2Z4IA 2VQFQ 1OWTA 4MV7A 2AQ2B 2QDBA 4QW8A 1CKNB 5BN4A 1JLLB 3NE5B 1VQ5A 1IL2A 2K50A 2RGRA 4WJWA 1W93A 4DR2H 1VCIA 3MVVA 2UXBL 1S0MA 1SE8A 3GTQA 3RLFA 4GKJQ 1SNPA 3BS1A 3ND8A 3EYYA 2Q2IA 2A68D 4B3MH 3F8NA 1HNZQ 1A6XA 3TMEA 2UVRA 1NTGA 3EVQA 5GAEC 2MQHA 3CQZH 3PIO3 1AFPA 4GN5A 4LFCQ 1W6JA 1EU4A 3FDSA 1HA6A 2F4VQ 3W1GA 2RA4A 3L0OA 3M9BA 2XIGA 3RBEA 1KHIA 5IT9L 3FPPA 2LXKA 2Q2UA 4OIKA 3J81W 4X3SA 1M4VA 5C0XH 4HTHA 1F2MA 1KJ8A 3TIGA 3R8BA 2K75A 4JV2A 3T1YL 1ML0D 3C1EA 2RKSA 1IL8A 1D1KA 3MZ5A 5CV6A 3RN5A 3KDFB 1HZAA 1STYA 1UE7A 1Z47A 2DY8A 2MHVA 5F2DA 5FLMH 3RBDA 1K8AC 2R93G 4H0LC 2YW2A 1C4QA 2Q2TA 2F0EA 2BR0A 2PBZA 1HR0H 1TWGB 3ZJYC 3MWYW 2BQRA 1RJQA 2HIXA 2A8VA
chains in the Genus database with same CATH topology
2R7FA 3A5ZB 1QVGA 2OQ0A 2Y0SG 1VQNA 2ZTEA 3PGZA 1T9HA 1JT8A 3KYHC 5FJ8G 3AFQA 4A93G 3CXCA 4B3SL 3I55A 1GKHA 2L15A 5DLQE 2KCMA 1YNXA 2ALYB 3PIOA 2QA4A 1NMFA 1TWFH 4A3JG 1OXVA 2JQOA 2WB1G 1XPUA 3E9IA 1M90C 5C0XG 1VQ6A 4PZ6A 1N32L 5ELOA 4QGUA 1LTLA 1SMXA 1C0AA 2EIFA 2CWAA 3K7UC 4DR3Q 2I0QA 4X62Q 2LSSA 4LF9Q 1GD7A 2GVBA 2AHOB 4DUYL 2YU9H 4BBRG 4JI5L 3UDIA 3HOYH 2AWNA 3M7NA 5K36G 3GTGH 4PMWA 5IT9c 2UXBQ 1CSPA 1Y1VH 2JJQA 2AWOA 2JA8G 1XNQQ 3S14H 4LWCA 3CCRA 3CAMA 1IBLQ 3I4OA 4OXPA 4UP9A 2R92G 2VL6A 4YY3Q 5C4XH 3J80i 5J3BA 4L5TA 2VQEQ 3ULPA 1PV4A 3TRZA 4IFDJ 1CKNA 1SRUA 2K5HA 4GS3A 3K7AH 3HOUG 1E24A 2JEBI 3EN2A 4KLKA 4DR4L 2C35B 2ZTDA 4JI4Q 5GAHC 3PCOB 1W2BA 1JJGA 4H02A 3S1RH 4L5SA 1CKOA 5M5YH 4C3HH 4DV2Q 3BJUA 3HOZH 1HZ9A 3KOJA 1GM5A 2VZAA 1RIPA 1PA6A 1AE3A 3GTKH 3F2DA 4POFA 4LNQA 3W5OA 4A3KG 4YCVA 1XMQL 3WWVA 5IYCG 1Q46A 2K4KA 1NMGA 4OONA 4A3BG 3KJOA 4HJ9A 3LGJA 2ASBA 4Y52H 1PH2A 1EQQA 5BR8Q 1YHQA 4JI8L 4HJ5A 1KAWA 1Y1VG 4AYBG 1E22A 4DR1L 3NBHB 4GOPA 5H1SE 2R7DA 2MO1A 4DR6L 4LF8L 1N8RC 3HKZG 1IZ6A 1Q1EA 5IP9G 3HOVG 5LMUL 4R4CA 2NZOA 4YWKA 3KDFA 1HJPA 4DV6L 2OTLA 4QIWE 1VQ4A 1A63A 4DV4Q 4GNXA 2CFMA 2RF4A 1HR0W 1XJVA 1VQ7A 3PF5A 1E7ZA 1JJ2A 4JI0L 3M3YH 1L0WA 3HOWH 1N32Q 1WCMH 4LF4Q 4POGA 4OWWB 1KL9A 1PH9A 1WI5A 4ALPA 5JJKA 4DR2L 4NB3A 1VQBA 3NEMA 3CCEA 2PMZE 2K5VA 1RL2A 4LUZA 4LUVA 3TREA 5AJ3L 4DUYQ 2BA0A 4GLVB 1Y14B 2OTJA 3EBEA 1PVOA 3AYHB 1VQLA 3CC4A 1VQPA 4GLXA 3RLOA 1IBKL 4A3DG 2IT1A 1HNWL 5C4JH 4GKKL 1VQJA 4EQ5A 1YZ6A 5GQOA 2K52A 1Q12A 4IJHA 2K5NA 2I5MX 1OXSC 1WFQA 3PO3H 1VQAA 1TWAH 2IHFA 5IYDG 3F2CA 1EFWA 1R9TH 1IXRA 4JV5L 4JOIC 1TWGH 4R4OA 3CMAA 3GO5A 4QQBX 4BBSH 3CD6A 2IX1A 1Z9FA 4DR4Q 1L1OB 2YYZA 1N36L 4A3FH 3ER0A 1NE3A 1NY4A 3NELA 3PIPA 3CCMA 1A62A 1C9OA 1P8LA 4YHHL 3AFPA 1N34L 3A5UA 1YJWA 2E5LQ 3AQQA 3H0GG 4GN3B 3HOWG 5M5XH 2DUDA 2VNUD 2OCEA 2UUBQ 4OWTB 3D0FA 4MTNA 1OTCA 2UUAL 1J6QA 2IX0A 1X3FA 3HOXH 1K8GA 3L2PA 3W1BA 4BY7H 2JA6G 1UE6A 1FL0A 4HIDA 3S2DH 3FKIH 1A0IA 3UDXA 3U50C 5M3FG 1VQKA 2JA5H 4JI8Q 1O7IA 2KHJA 2ZTCA 1E3PA 4HJ7A 4DR1Q 1DGSA 3KF6A 4DK3C 4DR6Q 2D62A 5LMNL 5C3EH 4IOAA 4LF8Q 2BH8A 4LF7Q 1FJGL 1CKMA 4MNOA 2OWOA 1KXLA 4A3IH 4X64L 1VQOA 1Q7YC 3STBC 1UWVA 1VQDA 1X3EA 2R7ZG 4HJAA 3G71A 1N9WA 4DV6Q 4XIGS 4WJ4A 4EX5A 4JBWA 1AE2A 2MNAA 2D0PA 1PH4A 1LYLA 1X55A 3H15A 4KHPL 4DR7L 4JI0Q 2FXQA 3CP0A 2WAQG 3EIVA 3VDYA 5FLMG 1XTDA 3RR5A 1BBWA 2CWPA 2YV5A 2XTIA 4YCUA 5C0XI 1EIFA 1YJ9A 4IFDG 3OTOL 4A3LH 4A76A 4PZ8A 1KRSA 3E0EA 4APVA 1PH6A 1CSQA 1V9PA 2PQAA 4A4IA 1Q82C 3RN2A 3BZKA 4JCVE 1HZCA 1HNXL 2KENA 2UXDL 1VS0A 4R1JA 4C3JH 1ASZA 2IY5B 4GLAC 3ICEA 3SGIA 4JI1L 1IBKQ 1HNWQ 2VUMH 4GKKQ 2B3GA 4JI6L 1U5KA 1N33L 4Y7NH 1PH8A 2B63H 4A3CH 3PV0A 2ZM6Q 3CCSA 1Y1WH 4JOIA 1QVFA 1KQSA 3TS0A 1PFSA 4JV5Q 4DK6C 5IWAL 1J5EL 1XMOQ 1IBMQ 1BBUA 5IP7H 1YITA 4L5RC 2Q2HA 2CCZA 3M85A 3T1YQ 1N36Q 3B6YA 4FDBA 2CQOA 3GTPH 1I5FA 3AEVA 3NENA 4DUZL 3UDFA 1EUJA 3PF4A 3PUWA 2YTXA 4P75A 2Y0SE 2BH2A 4B3TL 3HOYG 3RZOH 5JJLA 5JEAJ 4AQYQ 1ASYA 1I94Q 3GTMH 4BXXH 4DV3L 3JAMc 2JA9A 4LF5L 4DV0Q 2UUAQ 1V43A 2RCNA 2YTVA 3CCUA 4IOCA 2JA7H 3H3VH 3CCJA 1CUKA 1S3OA 1W3SA 2JE6I 4J15A 3L7ZC 4DV7L 1LM0A 3U4VA 1G51A 5C4XG 1KD1C 4P72A 2F3IA 4JC0A 3T1HL 4B3SQ 4BA2I 3TEHB 1K73C 4IPDA 5IE8A 3J81c 1I50H 5HGQA 1PYBA 1I6HH 3STBD 2WFWA 4KI0A 3ULJA 1P16A 4DV1L 1EQRA 3BZCA 4A3GH 4X6AH 3F8TA 4X64Q 4WJ3M 4LFBL 3HOZG 3CW2C 2OQKA 3U4ZA 2NN6G 1Q8KA 1QUQA 5C44H 4HIOA 1L2FA 2ZJPA 1JE5A 2PI2E 4KHPQ 4DR7Q 3HKSA 2N78A 1OXUA 4A3EH 3J7ZC 1WJJA 1H95A 4JI5Q 3S17H 1XPRA 4A3MH 4B3ML 1S40A 2GVAA 4NXML 3Q8DA 3PSIA 1NJIC 2NN6I 3S2HH 3E9HA 3I4NH 2UUCL 3G6EA 2H5XA 1YHAA 3DLLA 2YTYA 1UE5A 5M3MH 5IYBH 4JI3L 4QL5A 2HHHL 3CC7A 2HIVA 2N3SA 3A74A 3J81j 2E2JH 2RHSB 3GDEA 1VQEA 3MEFA 4IO9A 1BKBA 3I4MH 3M4PA 4RG1A 4JBKA 3M4OH 1SN8A 4LUOA 1C7YA 4JI6Q 3S1QH 3I2ZA 1N33Q 3FP9A 2KBNA 3K0XA 2MO0A 3RNUA 3M4QA 5FJ8H 5IWAQ 2NVTH 1PH7A 4A93H 3PUZA 3U58A 1I3QH 1WCMG 2PI2A 1PH1A 3K81C 1X65A 2I5HA 4PG3A 4AYBE 3GD7A 1JJCB 4QY7A 4DPGA 1XMQQ 2JEAI 1HR0L 3BU2A 4A3JH 3I7FA 3RLNA 1E1OA 4B3TQ 4OWXB 1B8AA 3G4SA 1M1KC 1SLJA 1L1OC 4DV3Q 2N8NA 4LF5Q 4JYAL 4QJFA 3GTQH 1MIUA 4K0KL 2HQLA 3PO2H 4BBRH 1XNRL 3PO3G 4GNXB 3DM3A 1OXTA 4DV7Q 2B29A 5LMUQ 4DV5L 1Q86C 4OX9L 4NPSA 4JBMA 5BR8L 2JA8H 2VY3A 3FHWA 4MZ9A 2Z0SA 1X9NA 5EAYA 1JMCA 4BBSG 1E1TA 4X65L 2ATWA 4A3FG 2R92H 2PNHA 2ID0A 4JBJA 4DV1Q 1VQIA 2UU9L 1K9MC 4LFBQ 4R4QA 1FVIA 4HJ8A 1X56A 3HOUH 4IPCA 3J80c 2Z6KC 1GO3E 2VQFL 4DV4L 4DR2Q 4OO1G 1K3RA 1QUQB 4GNXC 1XPOA 3IRBA 3KLWA 5AJ3Q 5IY0A 3HOXG 1VQMA 2E2IH 4B3MQ 4BY7G 4LFAL 4NXMQ 4DAYB 1MJCA 4LF4L 4DKAC 2LXJA 4IFDI 1BVSA 3FKIG 4O0AA 2JA5G 2ZJRA 1QZGA 4A3KH 2UUCQ 5E7NA 1D8LA 4GKJL 5IYCH 4OO1I 3G48A 4P73A 1QZHA 1KRTA 1TWCH 4A3BH 1VQHA 2XGTA 4JI3Q 3PO2G 5C3EG 1HNZL 3UE1A 2HHHQ 4JI2L 2AMCB 5JJIA 1B7YB 1YEZA 3KF8B 2V1CC 4R4TA 5C0XJ 3K80C 4UY8C 5FLXc 4YWLA 4UPAA 1KIXA 4A3IG 1UEBA 4LFCL 2ZJQA 2D0OA 3S1NH 2ES2A 5JEAG 2NVXH 2F4VL 1K83H 3MXNB 2KCTA 2DGYA 3HFZB 4UP8A 3GTJH 3CF5A 4X66L 3S24A 4A75A 1EYGA 4GN4B 4DAMA 4ME3A 4YHHQ 5IP9H 3HOVH 1N34Q 4JI7L 1MJEA 1HZBA 1YBYA 3KJPA 1A8VA 1TWHH 1OXXK 3J7A5 4A3LG 2JK8A 4HIKA 3CCVA 4DR5L 1EIYB 4BA1I 4B3RL 1X54A 3S1MH 3D31A 4UP7A 3PUXA 1HR0Q 4P74A 1NBWA 3CC2A 4TQUS 3F2BA 3PUVA 1TXYA 5HY6A 1G291 4NXNL 5GAGC 2E5LL 3KF6B 4LF6L 4IPHA 1L1OA 2AKWB 2WB1E 3S15H 1Q81C 2K14A 1D7QA 1X3GA 4JYAQ 1K0RA 1YJNA 2UUBL 2VUMG 1MKHA 3CPFA 3TQYA 2QEXA 1IYJB 1SFOH 4K0KQ 5LMNQ 4C2MH 1XNRQ 2NVYH 2UXCL 4DNIA 4R4IA 1FJGQ 4LW1A 2B63G 1GVPA 4A3CG 2WAQE 1Y1WG 4DV5Q 4OX9Q 2BA1A 3K8AA 3JC66 1X6OA 4A3DH 3CCQA 2EQSA 1EOVA 5IP7G 1B70B 1WYDA 2I5LX 4X65Q 2VS1A 3UE0A 1UE1A 3OW2A 1HH2P 4LF7L 2WP8J 5IYDH 2F52A 2N49A 2GN5A 2UU9Q 2PQAB 4AIMA 2Z6KA 1JB7A 3JAMi 4AH6A 3ULLA 2R6GA 1PH5A 3S16H 3OTOQ 4O2DA 3CPWA 2EXDA 4YCWA 5GADC 2VQFQ 4BXXG 4DR3L 1AH9A 1CKNB 1WOCA 4X62L 3PUYA 2MFIA 3UDGA 4LF9L 1VQ5A 2JA7G 3A0JA 1FGUA 1IL2A 2E2HH 2K50A 1HNXQ 2UXDQ 2NZHA 3H0GH 5ELNA 4LFAQ 2R93H 2NVQH 3CMEA 4BY1H 1VQCA 1VCIA 1YVCA 2UXBL 4JI1Q 1SE8A 3RLFA 1PH3A 5LMNW 4JG2A 1XNQL 4GKJQ 1PYSB 3J81i 2A19A 2Q2IA 4XTCS 1IBLL 1VQFA 4JI2Q 1HNZQ 2JA6H 3H3VI 1NTGA 1Q1BA 1VQ8A 5GAEC 2MQHA 4YY3L 3CQZH 2VQEL 5M3FH 1V1QA 4GN5A 1J5EQ 4LFCQ 2IHEA 4A3GG 4P71A 4L5QA 4RMFA 2F4VQ 1PHJA 3W1GA 3GTLH 5C44G 3OYYA 3L0OA 3M9BA 1KC8C 1LUZA 1KHIA 4X66Q 4IPGA 2CKZB 3ERSX 4JI4L 4KHZA 5GROA 3I56A 3TS2A 2LXKA 4YWMA 2ZM6L 4DUZQ 2E8GA 2Q2UA 2A1AA 3GTOH 4A3EG 4JI7Q 4DV2L 2R7ZH 3HKZE 3F1ZA 2RHQB 4GOPB 4A3MG 3RZDH 1XMOL 1IBML 4C3IH 2VW9A 1U0LA 4DR5Q 3KFUA 2QGQA 1YHBA 2K75A 1SROA 4B3RQ 3T1YL 1EWIA 3I4NG 2HT1A 1QVCA 3RN5A 4IJLA 1G6PA 5IYBG 1HZAA 1SR3A 3KDFB 1UE7A 1Z47A 5M3MG 5FLMH 5M5WH 3CCLA 4LF6Q 4NXNQ 4TVAB 1VQGA 1YIJA 1K8AC 2R93G 1YI2A 4AQYL 4HIMA 1I94L 4BY1G 2Q2TA 1S72A 2KHIA 3I4MG 3T1HQ 4DV0L 4PZ7A 3ZJYC 1VQ9A 2UXCQ 4GOPC 2HIXA 2A8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7F A;  3A5Z B;  1QVG A;  2OQ0 A;  2Y0S G;  1VQN A;  2ZTE A;  3PGZ A;  1T9H A;  1JT8 A;  3KYH C;  5FJ8 G;  3AFQ A;  4A93 G;  3CXC A;  4B3S L;  3I55 A;  1GKH A;  2L15 A;  5DLQ E;  2KCM A;  1YNX A;  2ALY B;  3PIO A;  2QA4 A;  1NMF A;  1TWF H;  4A3J G;  1OXV A;  2JQO A;  2WB1 G;  1XPU A;  3E9I A;  1M90 C;  5C0X G;  1VQ6 A;  4PZ6 A;  1N32 L;  5ELO A;  4QGU A;  1LTL A;  1SMX A;  1C0A A;  2EIF A;  2CWA A;  3K7U C;  4DR3 Q;  2I0Q A;  4X62 Q;  2LSS A;  4LF9 Q;  1GD7 A;  2GVB A;  2AHO B;  4DUY L;  2YU9 H;  4BBR G;  4JI5 L;  3UDI A;  3HOY H;  2AWN A;  3M7N A;  5K36 G;  3GTG H;  4PMW A;  5IT9 c;  2UXB Q;  1CSP A;  1Y1V H;  2JJQ A;  2AWO A;  2JA8 G;  1XNQ Q;  3S14 H;  4LWC A;  3CCR A;  3CAM A;  1IBL Q;  3I4O A;  4OXP A;  4UP9 A;  2R92 G;  2VL6 A;  4YY3 Q;  5C4X H;  3J80 i;  5J3B A;  4L5T A;  2VQE Q;  3ULP A;  1PV4 A;  3TRZ A;  4IFD J;  1CKN A;  1SRU A;  2K5H A;  4GS3 A;  3K7A H;  3HOU G;  1E24 A;  2JEB I;  3EN2 A;  4KLK A;  4DR4 L;  2C35 B;  2ZTD A;  4JI4 Q;  5GAH C;  3PCO B;  1W2B A;  1JJG A;  4H02 A;  3S1R H;  4L5S A;  1CKO A;  5M5Y H;  4C3H H;  4DV2 Q;  3BJU A;  3HOZ H;  1HZ9 A;  3KOJ A;  1GM5 A;  2VZA A;  1RIP A;  1PA6 A;  1AE3 A;  3GTK H;  3F2D A;  4POF A;  4LNQ A;  3W5O A;  4A3K G;  4YCV A;  1XMQ L;  3WWV A;  5IYC G;  1Q46 A;  2K4K A;  1NMG A;  4OON A;  4A3B G;  3KJO A;  4HJ9 A;  3LGJ A;  2ASB A;  4Y52 H;  1PH2 A;  1EQQ A;  5BR8 Q;  1YHQ A;  4JI8 L;  4HJ5 A;  1KAW A;  1Y1V G;  4AYB G;  1E22 A;  4DR1 L;  3NBH B;  4GOP A;  5H1S E;  2R7D A;  2MO1 A;  4DR6 L;  4LF8 L;  1N8R C;  3HKZ G;  1IZ6 A;  1Q1E A;  5IP9 G;  3HOV G;  5LMU L;  4R4C A;  2NZO A;  4YWK A;  3KDF A;  1HJP A;  4DV6 L;  2OTL A;  4QIW E;  1VQ4 A;  1A63 A;  4DV4 Q;  4GNX A;  2CFM A;  2RF4 A;  1HR0 W;  1XJV A;  1VQ7 A;  3PF5 A;  1E7Z A;  1JJ2 A;  4JI0 L;  3M3Y H;  1L0W A;  3HOW H;  1N32 Q;  1WCM H;  4LF4 Q;  4POG A;  4OWW B;  1KL9 A;  1PH9 A;  1WI5 A;  4ALP A;  5JJK A;  4DR2 L;  4NB3 A;  1VQB A;  3NEM A;  3CCE A;  2PMZ E;  2K5V A;  1RL2 A;  4LUZ A;  4LUV A;  3TRE A;  5AJ3 L;  4DUY Q;  2BA0 A;  4GLV B;  1Y14 B;  2OTJ A;  3EBE A;  1PVO A;  3AYH B;  1VQL A;  3CC4 A;  1VQP A;  4GLX A;  3RLO A;  1IBK L;  4A3D G;  2IT1 A;  1HNW L;  5C4J H;  4GKK L;  1VQJ A;  4EQ5 A;  1YZ6 A;  5GQO A;  2K52 A;  1Q12 A;  4IJH A;  2K5N A;  2I5M X;  1OXS C;  1WFQ A;  3PO3 H;  1VQA A;  1TWA H;  2IHF A;  5IYD G;  3F2C A;  1EFW A;  1R9T H;  1IXR A;  4JV5 L;  4JOI C;  1TWG H;  4R4O A;  3CMA A;  3GO5 A;  4QQB X;  4BBS H;  3CD6 A;  2IX1 A;  1Z9F A;  4DR4 Q;  1L1O B;  2YYZ A;  1N36 L;  4A3F H;  3ER0 A;  1NE3 A;  1NY4 A;  3NEL A;  3PIP A;  3CCM A;  1A62 A;  1C9O A;  1P8L A;  4YHH L;  3AFP A;  1N34 L;  3A5U A;  1YJW A;  2E5L Q;  3AQQ A;  3H0G G;  4GN3 B;  3HOW G;  5M5X H;  2DUD A;  2VNU D;  2OCE A;  2UUB Q;  4OWT B;  3D0F A;  4MTN A;  1OTC A;  2UUA L;  1J6Q A;  2IX0 A;  1X3F A;  3HOX H;  1K8G A;  3L2P A;  3W1B A;  4BY7 H;  2JA6 G;  1UE6 A;  1FL0 A;  4HID A;  3S2D H;  3FKI H;  1A0I A;  3UDX A;  3U50 C;  5M3F G;  1VQK A;  2JA5 H;  4JI8 Q;  1O7I A;  2KHJ A;  2ZTC A;  1E3P A;  4HJ7 A;  4DR1 Q;  1DGS A;  3KF6 A;  4DK3 C;  4DR6 Q;  2D62 A;  5LMN L;  5C3E H;  4IOA A;  4LF8 Q;  2BH8 A;  4LF7 Q;  1FJG L;  1CKM A;  4MNO A;  2OWO A;  1KXL A;  4A3I H;  4X64 L;  1VQO A;  1Q7Y C;  3STB C;  1UWV A;  1VQD A;  1X3E A;  2R7Z G;  4HJA A;  3G71 A;  1N9W A;  4DV6 Q;  4XIG S;  4WJ4 A;  4EX5 A;  4JBW A;  1AE2 A;  2MNA A;  2D0P A;  1PH4 A;  1LYL A;  1X55 A;  3H15 A;  4KHP L;  4DR7 L;  4JI0 Q;  2FXQ A;  3CP0 A;  2WAQ G;  3EIV A;  3VDY A;  5FLM G;  1XTD A;  3RR5 A;  1BBW A;  2CWP A;  2YV5 A;  2XTI A;  4YCU A;  5C0X I;  1EIF A;  1YJ9 A;  4IFD G;  3OTO L;  4A3L H;  4A76 A;  4PZ8 A;  1KRS A;  3E0E A;  4APV A;  1PH6 A;  1CSQ A;  1V9P A;  2PQA A;  4A4I A;  1Q82 C;  3RN2 A;  3BZK A;  4JCV E;  1HZC A;  1HNX L;  2KEN A;  2UXD L;  1VS0 A;  4R1J A;  4C3J H;  1ASZ A;  2IY5 B;  4GLA C;  3ICE A;  3SGI A;  4JI1 L;  1IBK Q;  1HNW Q;  2VUM H;  4GKK Q;  2B3G A;  4JI6 L;  1U5K A;  1N33 L;  4Y7N H;  1PH8 A;  2B63 H;  4A3C H;  3PV0 A;  2ZM6 Q;  3CCS A;  1Y1W H;  4JOI A;  1QVF A;  1KQS A;  3TS0 A;  1PFS A;  4JV5 Q;  4DK6 C;  5IWA L;  1J5E L;  1XMO Q;  1IBM Q;  1BBU A;  5IP7 H;  1YIT A;  4L5R C;  2Q2H A;  2CCZ A;  3M85 A;  3T1Y Q;  1N36 Q;  3B6Y A;  4FDB A;  2CQO A;  3GTP H;  1I5F A;  3AEV A;  3NEN A;  4DUZ L;  3UDF A;  1EUJ A;  3PF4 A;  3PUW A;  2YTX A;  4P75 A;  2Y0S E;  2BH2 A;  4B3T L;  3HOY G;  3RZO H;  5JJL A;  5JEA J;  4AQY Q;  1ASY A;  1I94 Q;  3GTM H;  4BXX H;  4DV3 L;  3JAM c;  2JA9 A;  4LF5 L;  4DV0 Q;  2UUA Q;  1V43 A;  2RCN A;  2YTV A;  3CCU A;  4IOC A;  2JA7 H;  3H3V H;  3CCJ A;  1CUK A;  1S3O A;  1W3S A;  2JE6 I;  4J15 A;  3L7Z C;  4DV7 L;  1LM0 A;  3U4V A;  1G51 A;  5C4X G;  1KD1 C;  4P72 A;  2F3I A;  4JC0 A;  3T1H L;  4B3S Q;  4BA2 I;  3TEH B;  1K73 C;  4IPD A;  5IE8 A;  3J81 c;  1I50 H;  5HGQ A;  1PYB A;  1I6H H;  3STB D;  2WFW A;  4KI0 A;  3ULJ A;  1P16 A;  4DV1 L;  1EQR A;  3BZC A;  4A3G H;  4X6A H;  3F8T A;  4X64 Q;  4WJ3 M;  4LFB L;  3HOZ G;  3CW2 C;  2OQK A;  3U4Z A;  2NN6 G;  1Q8K A;  1QUQ A;  5C44 H;  4HIO A;  1L2F A;  2ZJP A;  1JE5 A;  2PI2 E;  4KHP Q;  4DR7 Q;  3HKS A;  2N78 A;  1OXU A;  4A3E H;  3J7Z C;  1WJJ A;  1H95 A;  4JI5 Q;  3S17 H;  1XPR A;  4A3M H;  4B3M L;  1S40 A;  2GVA A;  4NXM L;  3Q8D A;  3PSI A;  1NJI C;  2NN6 I;  3S2H H;  3E9H A;  3I4N H;  2UUC L;  3G6E A;  2H5X A;  1YHA A;  3DLL A;  2YTY A;  1UE5 A;  5M3M H;  5IYB H;  4JI3 L;  4QL5 A;  2HHH L;  3CC7 A;  2HIV A;  2N3S A;  3A74 A;  3J81 j;  2E2J H;  2RHS B;  3GDE A;  1VQE A;  3MEF A;  4IO9 A;  1BKB A;  3I4M H;  3M4P A;  4RG1 A;  4JBK A;  3M4O H;  1SN8 A;  4LUO A;  1C7Y A;  4JI6 Q;  3S1Q H;  3I2Z A;  1N33 Q;  3FP9 A;  2KBN A;  3K0X A;  2MO0 A;  3RNU A;  3M4Q A;  5FJ8 H;  5IWA Q;  2NVT H;  1PH7 A;  4A93 H;  3PUZ A;  3U58 A;  1I3Q H;  1WCM G;  2PI2 A;  1PH1 A;  3K81 C;  1X65 A;  2I5H A;  4PG3 A;  4AYB E;  3GD7 A;  1JJC B;  4QY7 A;  4DPG A;  1XMQ Q;  2JEA I;  1HR0 L;  3BU2 A;  4A3J H;  3I7F A;  3RLN A;  1E1O A;  4B3T Q;  4OWX B;  1B8A A;  3G4S A;  1M1K C;  1SLJ A;  1L1O C;  4DV3 Q;  2N8N A;  4LF5 Q;  4JYA L;  4QJF A;  3GTQ H;  1MIU A;  4K0K L;  2HQL A;  3PO2 H;  4BBR H;  1XNR L;  3PO3 G;  4GNX B;  3DM3 A;  1OXT A;  4DV7 Q;  2B29 A;  5LMU Q;  4DV5 L;  1Q86 C;  4OX9 L;  4NPS A;  4JBM A;  5BR8 L;  2JA8 H;  2VY3 A;  3FHW A;  4MZ9 A;  2Z0S A;  1X9N A;  5EAY A;  1JMC A;  4BBS G;  1E1T A;  4X65 L;  2ATW A;  4A3F G;  2R92 H;  2PNH A;  2ID0 A;  4JBJ A;  4DV1 Q;  1VQI A;  2UU9 L;  1K9M C;  4LFB Q;  4R4Q A;  1FVI A;  4HJ8 A;  1X56 A;  3HOU H;  4IPC A;  3J80 c;  2Z6K C;  1GO3 E;  2VQF L;  4DV4 L;  4DR2 Q;  4OO1 G;  1K3R A;  1QUQ B;  4GNX C;  1XPO A;  3IRB A;  3KLW A;  5AJ3 Q;  5IY0 A;  3HOX G;  1VQM A;  2E2I H;  4B3M Q;  4BY7 G;  4LFA L;  4NXM Q;  4DAY B;  1MJC A;  4LF4 L;  4DKA C;  2LXJ A;  4IFD I;  1BVS A;  3FKI G;  4O0A A;  2JA5 G;  2ZJR A;  1QZG A;  4A3K H;  2UUC Q;  5E7N A;  1D8L A;  4GKJ L;  5IYC H;  4OO1 I;  3G48 A;  4P73 A;  1QZH A;  1KRT A;  1TWC H;  4A3B H;  1VQH A;  2XGT A;  4JI3 Q;  3PO2 G;  5C3E G;  1HNZ L;  3UE1 A;  2HHH Q;  4JI2 L;  2AMC B;  5JJI A;  1B7Y B;  1YEZ A;  3KF8 B;  2V1C C;  4R4T A;  5C0X J;  3K80 C;  4UY8 C;  5FLX c;  4YWL A;  4UPA A;  1KIX A;  4A3I G;  1UEB A;  4LFC L;  2ZJQ A;  2D0O A;  3S1N H;  2ES2 A;  5JEA G;  2NVX H;  2F4V L;  1K83 H;  3MXN B;  2KCT A;  2DGY A;  3HFZ B;  4UP8 A;  3GTJ H;  3CF5 A;  4X66 L;  3S24 A;  4A75 A;  1EYG A;  4GN4 B;  4DAM A;  4ME3 A;  4YHH Q;  5IP9 H;  3HOV H;  1N34 Q;  4JI7 L;  1MJE A;  1HZB A;  1YBY A;  3KJP A;  1A8V A;  1TWH H;  1OXX K;  3J7A 5;  4A3L G;  2JK8 A;  4HIK A;  3CCV A;  4DR5 L;  1EIY B;  4BA1 I;  4B3R L;  1X54 A;  3S1M H;  3D31 A;  4UP7 A;  3PUX A;  1HR0 Q;  4P74 A;  1NBW A;  3CC2 A;  4TQU S;  3F2B A;  3PUV A;  1TXY A;  5HY6 A;  1G29 1;  4NXN L;  5GAG C;  2E5L L;  3KF6 B;  4LF6 L;  4IPH A;  1L1O A;  2AKW B;  2WB1 E;  3S15 H;  1Q81 C;  2K14 A;  1D7Q A;  1X3G A;  4JYA Q;  1K0R A;  1YJN A;  2UUB L;  2VUM G;  1MKH A;  3CPF A;  3TQY A;  2QEX A;  1IYJ B;  1SFO H;  4K0K Q;  5LMN Q;  4C2M H;  1XNR Q;  2NVY H;  2UXC L;  4DNI A;  4R4I A;  1FJG Q;  4LW1 A;  2B63 G;  1GVP A;  4A3C G;  2WAQ E;  1Y1W G;  4DV5 Q;  4OX9 Q;  2BA1 A;  3K8A A;  3JC6 6;  1X6O A;  4A3D H;  3CCQ A;  2EQS A;  1EOV A;  5IP7 G;  1B70 B;  1WYD A;  2I5L X;  4X65 Q;  2VS1 A;  3UE0 A;  1UE1 A;  3OW2 A;  1HH2 P;  4LF7 L;  2WP8 J;  5IYD H;  2F52 A;  2N49 A;  2GN5 A;  2UU9 Q;  2PQA B;  4AIM A;  2Z6K A;  1JB7 A;  3JAM i;  4AH6 A;  3ULL A;  2R6G A;  1PH5 A;  3S16 H;  3OTO Q;  4O2D A;  3CPW A;  2EXD A;  4YCW A;  5GAD C;  2VQF Q;  4BXX G;  4DR3 L;  1AH9 A;  1CKN B;  1WOC A;  4X62 L;  3PUY A;  2MFI A;  3UDG A;  4LF9 L;  1VQ5 A;  2JA7 G;  3A0J A;  1FGU A;  1IL2 A;  2E2H H;  2K50 A;  1HNX Q;  2UXD Q;  2NZH A;  3H0G H;  5ELN A;  4LFA Q;  2R93 H;  2NVQ H;  3CME A;  4BY1 H;  1VQC A;  1VCI A;  1YVC A;  2UXB L;  4JI1 Q;  1SE8 A;  3RLF A;  1PH3 A;  5LMN W;  4JG2 A;  1XNQ L;  4GKJ Q;  1PYS B;  3J81 i;  2A19 A;  2Q2I A;  4XTC S;  1IBL L;  1VQF A;  4JI2 Q;  1HNZ Q;  2JA6 H;  3H3V I;  1NTG A;  1Q1B A;  1VQ8 A;  5GAE C;  2MQH A;  4YY3 L;  3CQZ H;  2VQE L;  5M3F H;  1V1Q A;  4GN5 A;  1J5E Q;  4LFC Q;  2IHE A;  4A3G G;  4P71 A;  4L5Q A;  4RMF A;  2F4V Q;  1PHJ A;  3W1G A;  3GTL H;  5C44 G;  3OYY A;  3L0O A;  3M9B A;  1KC8 C;  1LUZ A;  1KHI A;  4X66 Q;  4IPG A;  2CKZ B;  3ERS X;  4JI4 L;  4KHZ A;  5GRO A;  3I56 A;  3TS2 A;  2LXK A;  4YWM A;  2ZM6 L;  4DUZ Q;  2E8G A;  2Q2U A;  2A1A A;  3GTO H;  4A3E G;  4JI7 Q;  4DV2 L;  2R7Z H;  3HKZ E;  3F1Z A;  2RHQ B;  4GOP B;  4A3M G;  3RZD H;  1XMO L;  1IBM L;  4C3I H;  2VW9 A;  1U0L A;  4DR5 Q;  3KFU A;  2QGQ A;  1YHB A;  2K75 A;  1SRO A;  4B3R Q;  3T1Y L;  1EWI A;  3I4N G;  2HT1 A;  1QVC A;  3RN5 A;  4IJL A;  1G6P A;  5IYB G;  1HZA A;  1SR3 A;  3KDF B;  1UE7 A;  1Z47 A;  5M3M G;  5FLM H;  5M5W H;  3CCL A;  4LF6 Q;  4NXN Q;  4TVA B;  1VQG A;  1YIJ A;  1K8A C;  2R93 G;  1YI2 A;  4AQY L;  4HIM A;  1I94 L;  4BY1 G;  2Q2T A;  1S72 A;  2KHI A;  3I4M G;  3T1H Q;  4DV0 L;  4PZ7 A;  3ZJY C;  1VQ9 A;  2UXC Q;  4GOP C;  2HIX A;  2A8V A; 
#chains in the Genus database with same CATH topology
 1Z2N X;  4HR7 B;  1A3U A;  1QVG A;  1B53 A;  1PTO F;  1LV9 A;  2EJF C;  5D65 A;  3IAY A;  3K5M A;  3AFQ A;  4O2A F;  2PZU A;  2HGS A;  4A93 G;  2DIK A;  4XQJ A;  2NVT B;  3TIN A;  5LMN H;  4YB8 B;  3I55 A;  2FMA A;  2AQ1 B;  2L15 A;  4S3S A;  5DLQ E;  1EOT A;  5M5X B;  3R5H A;  4OEL B;  4ME6 A;  1Y8P B;  4HNV A;  1TWF H;  5T1G A;  1RJP A;  1VQ6 A;  4QWE A;  4PZ6 A;  3AB9 A;  2NWG A;  1LTL A;  4BY7 B;  3A55 A;  4DR3 Q;  3S2D B;  2XCL A;  2I0Q A;  4X62 Q;  1SE2 A;  2N55 A;  2AHO B;  1RHP A;  5C3E B;  3M7N A;  2MP1 A;  4KJO A;  4QUF A;  2JEG A;  4A3I B;  2DPI A;  3N42 B;  1IBL Q;  4RCN A;  4OXP A;  5KFA A;  3VPB A;  4J9Q A;  3KHG A;  2VL6 A;  4YY3 Q;  4K2L A;  5C4X H;  1PV4 A;  3TRZ A;  1SCU B;  2V4Q A;  4JI1 H;  3C2P A;  1AN7 A;  1M6V A;  2JEF A;  1Z7T A;  4X3K A;  3RB6 A;  5G3L F;  1CHP D;  3H20 A;  3EN2 A;  2B2U A;  4XX0 B;  4X3T A;  2C35 B;  5EKI A;  2J6U A;  4JI4 Q;  1M7J A;  2IA6 A;  2C00 A;  3PCO B;  5FO9 B;  1BNZ A;  4O42 A;  1LLR D;  4ZUJ A;  4DV2 Q;  1HZ9 A;  3KOJ A;  3TZD A;  1QJO A;  3QZ8 A;  1WSC A;  1EY4 A;  4ED7 A;  4XZ3 B;  1XTC D;  3F2D A;  2PZW A;  3JSL A;  4DUZ H;  2FE3 A;  1HTP A;  5JQW A;  1T94 A;  1Q46 A;  3TQT A;  4OON A;  1NMG A;  1STA A;  4A3B G;  3KJO A;  4CDE C;  4DR5 H;  2CW0 C;  2TMP A;  3KHL A;  2KED A;  1Y1V G;  3NBH B;  1TY0 A;  2NVX B;  4Q43 A;  1SEB D;  3GID A;  4L6T B;  4NDX A;  2QYZ A;  1N8R C;  3HKZ G;  1Q1E A;  2Z6B A;  3GTP B;  3T1H H;  5LMU L;  5H80 A;  4YWK A;  4EGV A;  4EVO A;  1A63 A;  2IPK D;  4O4I F;  2V4R A;  2RF4 A;  1HR0 W;  4HMJ A;  2HD3 A;  1PRT B;  3UFX B;  2W9A A;  4JI0 L;  3M3Y H;  2F0N A;  2FMM A;  2D2C C;  1UUP A;  4OWW B;  3TN2 A;  1PH9 A;  1WI5 A;  2C5C A;  4ALP A;  1H9M A;  5EDW A;  3CCE A;  4LUZ A;  1LTI D;  5KFG A;  2VB2 X;  2OTJ A;  4H13 C;  1EUC B;  1I7L A;  3RV3 A;  1I50 B;  1SYX B;  1XYI A;  2L5T A;  4A3D G;  2IT1 A;  1U4R A;  5GQO A;  3RUP A;  1MZB A;  4IJH A;  1B4O A;  1TKW B;  2I5M X;  1KAB A;  2K5N A;  2BE5 C;  2CH4 A;  1E0B A;  3KBX A;  3FKI A;  2JA5 A;  4JOI C;  3K6O A;  4UCT A;  1TWG H;  2ZXR A;  5I47 A;  3S17 B;  1LT3 D;  3UI2 A;  1TU2 B;  2EY1 A;  4DR4 Q;  4FS2 A;  1L1O B;  1N36 L;  2HVS A;  3ER0 A;  1NY4 A;  2E74 C;  2F0U A;  1WTX A;  3S2H B;  1UNN C;  1TWF A;  3CCM A;  1VBH A;  1YJW A;  1S5D D;  5M3M B;  3HOW G;  3H0G G;  4O3R A;  1KLG D;  2Q8R E;  4G4K A;  5M5X H;  2PMZ A;  2OCE A;  1QIL A;  2D9U A;  5E3F A;  4OWT B;  2UUA L;  2UUB Q;  4BY1 B;  3I4M B;  2YZG A;  1J6Q A;  2NTS A;  1U4M A;  3R2T A;  3L2P A;  2ASD A;  4BY7 H;  2JA6 G;  1JQY D;  1FL0 A;  2FFK B;  2JA6 B;  4HID A;  2A69 C;  3S2D H;  5M3F G;  4RGM A;  4JI8 Q;  2NU6 B;  3RV4 A;  4DK3 C;  5KIX A;  5C3E H;  2R7L A;  1FJG L;  4MNO A;  4A3I H;  1VQO A;  4A3J B;  5D3I B;  4FNF A;  1N9W A;  4JBW A;  3RZD B;  3KAK A;  4ZHQ F;  4LAA A;  2K5D A;  3PW7 A;  4M8A A;  1LYL A;  1F2Z A;  2BCO A;  2NZ1 D;  3FRP B;  3C3L A;  1IOW A;  1MHW C;  1NSN S;  3M9N B;  1S97 A;  2FXQ A;  4JK1 C;  3CP0 A;  4N8F A;  2RCF A;  3RR5 A;  2LMC B;  4DAV A;  4HED A;  1WTW A;  5CV8 A;  3OTO L;  2YRX A;  4C1N K;  2XD4 A;  2JA8 B;  5EPL A;  1G2T A;  5K2M A;  1FNW A;  2K03 A;  4JCV E;  1N32 H;  1HZC A;  5C3X A;  3HEJ A;  3AU7 A;  2R92 B;  3UQ8 A;  2A74 C;  1HNW Q;  2VUM H;  2F0P A;  1L0X B;  4FF3 A;  4RGN A;  1WTH A;  4EEQ A;  2TSS A;  1D2B A;  3EPG A;  4MTD A;  1KQS A;  2Z8L A;  4DK6 C;  4JV5 Q;  1IBM Q;  2K33 A;  1YIT A;  2CCZ A;  3M85 A;  4R8U A;  1UC8 A;  4UAI A;  4FDB A;  4TV9 F;  3GTP H;  3NEN A;  4A3K B;  1EUJ A;  3HOY G;  1A9X A;  4IUU A;  3K5N A;  4B3T L;  5JJL A;  1N48 A;  4J9L A;  3MR5 A;  4DV0 Q;  3S1N B;  4IOC A;  4NP5 A;  4JV0 A;  1NUC A;  3BA8 A;  1A2T A;  3S14 B;  1XXG A;  4F50 A;  1W3S A;  4F7X A;  1DD2 A;  3L7Z C;  5CAE B;  2XSC A;  3U4V A;  4P72 A;  5AFW A;  2JYO A;  4JC0 A;  1YNJ C;  1WTO A;  4BA2 I;  1FR3 A;  1LT5 D;  2EJM A;  2K5W A;  3BVZ A;  1I50 H;  3J81 c;  1BNC A;  1ICF B;  1PYB A;  3GIK A;  2WFW A;  2WV6 D;  3BZC A;  3KK7 A;  4FU0 A;  3K58 A;  3HOZ G;  4DR6 H;  2F0L A;  4CJ2 C;  2HDL A;  2PYK A;  4HR7 A;  4LF7 H;  2PI2 E;  1F9S A;  3NPP A;  3J7Z C;  4JI5 Q;  3S17 H;  1XPR A;  3OW7 A;  1S40 A;  1I3Q A;  2NVY B;  4IHJ F;  1GYF A;  3ITP A;  4DR3 H;  2FK1 A;  3S2H H;  4YR3 A;  2CHB D;  3PW2 A;  3W3A A;  3QB3 A;  1CQI B;  5IYB H;  5M3M H;  1MD2 D;  5NUC A;  5J2T F;  2HHH L;  1JB3 A;  2N3S A;  1D6E C;  2K32 A;  3BJY A;  3I4M H;  1BKB A;  2WYO A;  4ODG A;  4C5A A;  4LUO A;  1C7Y A;  1FD7 D;  2WII B;  1HA5 A;  1YNN D;  2EJG C;  4KMU C;  3V6K A;  3FMC A;  5KNB A;  1SYF A;  4I7A A;  4J9S A;  1C8C A;  2R8H A;  2I5H A;  4J1M A;  1HFN A;  3C1F A;  5EWG A;  2ZM6 H;  3NQI A;  4QY7 A;  2JEA I;  4A3J H;  4C5C A;  4DV2 H;  2SNS A;  1XMO H;  2PN1 A;  2CZG A;  3QIA A;  4PMB A;  1H9R A;  3O13 A;  5KT3 A;  4DU9 A;  3G4S A;  1M1K C;  5C4Z A;  4LF5 Q;  5CV9 A;  2JN4 A;  4QJF A;  3NTH A;  4K0K L;  3PO2 H;  3JAM L;  1XNR L;  4AQY H;  1I94 H;  4OX9 L;  2JA8 H;  1R9T B;  3HS0 C;  4IUV A;  1E1T A;  4EGQ A;  2R92 H;  2K1B A;  4ED6 A;  1U4L A;  3Q8Q B;  1AP0 A;  1QOH A;  3NBH A;  4B3S H;  2NVX A;  1AZP A;  4I65 A;  4IRD A;  2EYM A;  1PTO C;  3DHQ A;  3DMU A;  3QJY A;  4DR2 Q;  4CDD C;  1XPO A;  2O2L D;  1AZQ A;  4B3M Q;  3L4J A;  4RB2 C;  4MN3 A;  4DA2 A;  4DR7 H;  1QZG A;  2ZXO A;  4A3K H;  4Q8F A;  2BE5 D;  1LTG D;  4OO1 I;  5IYC H;  4XYO A;  4P73 A;  4XXE A;  4MTE A;  1VQH A;  4JI2 L;  2B2W C;  3OHX C;  3UE1 A;  1E4E A;  1YEZ A;  2A68 C;  4MV4 A;  4YWL A;  3S1N H;  1UEB A;  4RUA A;  3SVM A;  3MWM A;  1EZ6 A;  4U6P A;  3WO0 A;  2KCT A;  3HFZ B;  1M0W A;  2WE6 A;  4UP8 A;  3ETJ A;  4X66 L;  5FO8 B;  1I50 A;  5KFJ A;  3VR4 A;  4DAM A;  4YAJ B;  4MV3 A;  4EYH B;  3T5H A;  2R85 A;  1JOQ A;  1E4F T;  2W8L A;  1EIG A;  5CMD A;  4JI7 L;  1MJE A;  3WOE A;  4JI6 H;  2YU9 B;  4DR4 H;  1N33 H;  4IUT A;  4CJ1 B;  5IGD A;  2KEE A;  4HIK A;  4V19 0;  2ASL A;  3D6C A;  4KK7 A;  3PUX A;  4UP7 A;  3GTG B;  2G9D A;  2P5Z X;  1HR0 Q;  4P74 A;  1NBW A;  5C1P A;  5IWA H;  4TQU S;  3F2B A;  4NXN L;  4F87 A;  4KY5 A;  1L1O A;  1Q81 C;  4F4X A;  2K14 A;  4CHT B;  5EBC A;  1I4G A;  1DXM A;  1X3G A;  2UUB L;  3MXU A;  5T1I A;  1MKH A;  3TQY A;  3V2T A;  2QEX A;  1Z2P X;  5LMN Q;  2NVY H;  5LL6 S;  1TII D;  1JIH A;  4DV3 H;  5FPO A;  2B2Y A;  4JI8 H;  5C5M A;  1GUW A;  2BA1 A;  3CCQ A;  2W6M A;  4C3H B;  1KBL A;  5IP7 G;  2GPW A;  1B70 B;  2I5L X;  1ILP A;  2VS1 A;  3UE0 A;  1J8I A;  4ED2 A;  1V8Q A;  5A35 A;  2JA6 A;  3OW2 A;  4DV7 H;  5IYD H;  4RUC A;  4ECT A;  2GN5 A;  4KD4 A;  5D1O B;  1SYC A;  4E4T A;  1D5X C;  2YRW A;  2R6G A;  3K0Y A;  3WDN A;  4LH6 A;  4BXX G;  5GAD C;  4ED8 A;  1JCK B;  4ULL A;  3LWU A;  1AH9 A;  4NLG A;  3UDG A;  4LF9 L;  1HRJ A;  1H9S B;  2X6L A;  5ELE A;  1UAP A;  4PWQ A;  3I91 A;  1VQC A;  4ECR A;  3RAQ A;  4JI1 Q;  2J7Z A;  1XNQ L;  1ZHQ A;  3JAM W;  1PYS B;  2A19 A;  1FKA H;  3VYT A;  1VQF A;  4IN3 A;  3J81 E;  4ZKB B;  5EKK A;  2VQE L;  3H40 A;  1I6H B;  1PX2 A;  5ELD A;  2OF1 A;  3K5O A;  4A3G G;  1AN8 A;  5KFX A;  2DJG C;  5FLX L;  1TS4 A;  4IPG A;  3LWB A;  2R92 A;  1V1P B;  1KNA A;  1A2U A;  5EQ0 A;  4KHZ A;  4JV5 H;  4DUZ Q;  4KN7 C;  3SDZ A;  2E8G A;  3HP3 A;  3BG5 A;  2BQ3 A;  1IBM L;  4A3M G;  5KFS A;  4V0B A;  2VW9 A;  5JPM C;  4DR5 Q;  3KFU A;  1R4P B;  2B2V A;  4YHH H;  1EWI A;  1N34 H;  2HT1 A;  2FMC A;  4YJ3 F;  5KT7 A;  1G6P A;  5C4J B;  2J9G A;  3MXN A;  1B1Z A;  3C46 A;  4TVA B;  1E4G T;  1NAP A;  1TWA B;  4HIM A;  2KA7 A;  3T1H Q;  4DV0 L;  1MSH A;  4HSP A;  3VMM A;  1EWC A;  4BBS B;  4N9T A;  4GOP C;  1HFG A;  3A7L A;  3QOL A;  2R7F A;  3A5Z B;  2OQ0 A;  1VQN A;  2ZTE A;  1JT8 A;  5FJ8 G;  4RU9 A;  2ICI A;  3BYT B;  5CGK A;  3CXC A;  1EU3 A;  4CC5 A;  5A2Q W;  4EBC A;  3HXL A;  1GKH A;  3PR4 A;  1JWS D;  4DV5 H;  1NMF A;  4KV6 A;  3GIQ A;  2XWJ B;  3KTM A;  1O7Y A;  3K3P A;  2WB1 G;  3E9I A;  5C0X G;  3OIP A;  1KJJ A;  5ELO A;  1C0A A;  2EIF A;  2CWA A;  3K7U C;  4J9P A;  2F0T A;  4PDB A;  2JA5 B;  1CZW A;  1X3Q A;  3QR8 A;  2V4D A;  1KTK A;  3KLS A;  4DUY L;  2YU9 H;  4O2B F;  3D4R A;  3N52 A;  4F88 A;  3QG1 A;  4JI5 L;  3T13 A;  5KFR A;  1ZQ7 A;  2PVP A;  3GTG H;  4PMW A;  4O4H F;  4HAE A;  4ZQI A;  3G6X A;  1STH A;  4TKO B;  4UFZ A;  3NXW A;  1ZHS A;  1HNX H;  2NVY A;  4LFA H;  4I55 F;  4R8N A;  1RYS A;  3ULP A;  4IFD J;  2A6H C;  4QCL A;  3PQI A;  1SRU A;  1T5X D;  2K5H A;  3HOU G;  3RAX A;  3MEH A;  2JEB I;  2RDJ A;  2EYP A;  4QWD A;  2ZTD A;  4C1N I;  1Y8O B;  4H02 A;  5KG6 A;  4C3H H;  4ZKC B;  3RD4 A;  5COY A;  4L63 B;  2NN6 H;  3I70 A;  1RIP A;  1A3T A;  3RF2 A;  3J80 W;  4MTK A;  5CV4 A;  3W5O A;  4YCV A;  4Q45 A;  2HCI A;  4HJ9 A;  3H4D A;  3TQ1 A;  3LGJ A;  1ZYR C;  1JWU D;  4Q44 A;  2ASB A;  1LO5 D;  2B63 B;  4LF5 H;  4B3R H;  1PH2 A;  2FK2 A;  1EQQ A;  1YHQ A;  1KAW A;  4IAJ A;  4DR1 L;  3ONA B;  5HV6 A;  1SMY D;  2HDM A;  4LF8 L;  2AGQ A;  2F03 A;  1BR9 A;  3X3M A;  1HUN A;  5IIF A;  3N8D A;  3EQL C;  4KKT A;  5IP9 G;  1WTP A;  1EY5 A;  3HOV G;  5FLX W;  2WDT A;  4DV6 L;  2P0A A;  2UXC H;  1CQF A;  4HSV A;  2EYH A;  3MWD A;  3K5H A;  1XJV A;  3VYS A;  3PF5 A;  1D5M C;  1JJ2 A;  5KT2 A;  1GUO A;  1R9T A;  1S4Z A;  1GHK A;  2IP4 A;  1N32 Q;  4K5W A;  5J2U F;  4O4L F;  4POG A;  3Q8R B;  5JVH 3;  4DR2 L;  1TAE A;  1SDF A;  4MV6 A;  2PMZ E;  3TRE A;  2CQY A;  4O3N A;  2BA0 A;  2C22 A;  2V9W A;  1Y14 B;  1EEF D;  4R8U B;  2LFN A;  2J6T A;  1PVO A;  3AYH B;  3NK9 A;  3TP5 A;  1EYZ A;  2X6G A;  1IBK L;  5C4J H;  3DM1 A;  4GC6 A;  1PXU A;  1YZ6 A;  3U9O A;  1F9Q A;  3BZD B;  4RHR A;  1F9R A;  4ZI7 F;  1JOO A;  4JPB W;  4WFN 3;  1TWA H;  2IHF A;  2V5A A;  2MJ8 A;  2UXB H;  1SJH D;  3OMC A;  1PLF A;  3GO5 A;  4IR1 A;  5G3L D;  3CD6 A;  2IX1 A;  4BBS H;  4QB4 A;  1Z9F A;  4ID6 A;  2YYZ A;  1EFI D;  4A3F H;  3E6Z X;  5EOY A;  4YBZ B;  4P2C B;  3RGZ A;  3A5U A;  4OEM B;  3EJI A;  3AQQ A;  5DQH A;  1G6Z A;  1B9N A;  2R93 B;  2WAC A;  2NVQ B;  4K6L A;  1B50 A;  2L11 A;  3D0F A;  2IX0 A;  1X3F A;  2YU9 A;  5KFU A;  1K8G A;  3GQC A;  3D4D A;  3ORR A;  1S0O A;  4HMI A;  3FKI H;  1A0I A;  2JA5 H;  3GTG A;  2KHJ A;  1E3P A;  4A93 B;  1DGS A;  1I3Q B;  4DR6 Q;  4YAK B;  5LMN L;  4LF7 Q;  3JRX A;  2IWH A;  1U4P A;  2B2T C;  3L4K A;  2IBK A;  5BR8 H;  3H91 A;  3P75 A;  4X64 L;  1Q7Y C;  5JEA H;  2R7Z G;  4WJ4 A;  5KFW A;  4HJA A;  4YR2 A;  1S10 A;  1EUD B;  4C3I G;  1AE2 A;  3LWE A;  1DOM A;  4N8X 1;  2MNA A;  4KHP L;  1STN A;  3RUZ A;  3VDY A;  2HCC A;  1XTD A;  2W7O A;  1BBW A;  2F0D A;  2YV5 A;  2XTI A;  4YCU A;  3LNN A;  5ELF A;  5C0X I;  3NWS A;  2XCP A;  4A76 A;  2K5Q A;  1ENC A;  3E0E A;  5D1O A;  1STE A;  1V9P A;  2SNM A;  3CVZ A;  2H1E A;  1CQV A;  3GIL A;  4LF4 H;  2R82 A;  2YZN A;  2KEN A;  1CHQ D;  1SYD A;  1KDB A;  1VS0 A;  2BDO A;  3V6H A;  4F4Z A;  4GLA C;  4JI1 L;  1H9S A;  4EQP A;  4GKK Q;  4BS9 A;  1U5K A;  4QUC A;  4Y7N H;  1DV2 A;  2B63 H;  5EJW A;  3V4S A;  4A3C H;  5ELC A;  2ZM6 Q;  1YNN C;  4JOI A;  4NMZ A;  3VR6 A;  5I6W A;  3TS0 A;  3HZX A;  1XMO Q;  2W6Z A;  5DQG A;  5T14 A;  3T4A C;  5L37 A;  3QWN A;  2IX3 A;  4L5R C;  5KYL A;  1GSA A;  3E3X A;  2CQO A;  4KY6 A;  2HVR A;  4DUZ L;  1LT4 D;  1TWC B;  3PUW A;  4P75 A;  4A3B B;  5KFK A;  3T53 B;  5JEA J;  1V1P A;  3Q24 A;  4AQY Q;  1I94 Q;  3DF7 A;  3JAM c;  3SEB A;  3A8J E;  5C5L A;  4XYL B;  3CHB D;  2YTV A;  1Y1V B;  2RBM A;  3CCU A;  3H3V H;  1CUK A;  1DCZ A;  1WTV A;  1QCB D;  2W6O A;  1SYE A;  1KLU D;  2SEB D;  3NSW A;  4PNY A;  2W9B B;  4J15 A;  4F4W A;  1LM0 A;  2QDL A;  1G51 A;  3HKZ B;  3PW0 A;  2RDI A;  4U68 A;  3T1H L;  1MGS A;  1LTR D;  3K59 A;  4B3S Q;  4UCO A;  5JUM A;  1TWH B;  1GSO A;  5KFP A;  4IRC A;  5IT9 W;  4TUY F;  4BWG B;  5HGQ A;  1EYC A;  1TWA A;  3STB D;  3S1M B;  1P16 A;  4DV1 L;  2FK3 A;  3F8T A;  4WJ3 M;  3HRZ C;  4LFB L;  3MFY A;  3CW2 C;  3G8C A;  3U4Z A;  1Q8K A;  5LL6 b;  5CR3 A;  1E4E B;  2PQE A;  2BQU A;  1L2F A;  4DN4 M;  2ZJP A;  4DXF A;  2AUK A;  1VAJ A;  4LH7 A;  1NR4 A;  1BCP B;  2KVM A;  3HKS A;  5COR A;  4U67 3;  2F0K A;  4DR7 Q;  2VB3 X;  2V58 A;  1ROD A;  1R4Q B;  1WJJ A;  2YZM A;  2Q8I B;  2C2D A;  3LML A;  1PRT F;  4NXM L;  3Q8D A;  3LP8 A;  2DJF C;  4NW2 A;  3OHA A;  4ABN A;  4UCU A;  2NU7 B;  2UUC L;  3G6E A;  2H5X A;  3T5K A;  4A3D B;  1SYB A;  4JI3 L;  2EYF A;  2A6H D;  4QL5 A;  1II3 A;  3E5N A;  3A74 A;  1BCP F;  2RHS B;  4J0M A;  4IO9 A;  3MEF A;  4Q0Y A;  3TII A;  1QE6 A;  2B8F A;  4JBK A;  3T56 B;  4JI6 Q;  1N33 Q;  4KKS A;  1PZI D;  3NWT A;  5KG1 A;  5KFM A;  4XQQ A;  3MFH A;  1E2V A;  5IWA Q;  2NVT H;  4A93 H;  3PUZ A;  2RDF A;  3U58 A;  1I3Q H;  2SCU B;  1WCM G;  5KYI A;  3H0G B;  3HOW B;  4YR0 A;  1X65 A;  3E5S A;  4EQN A;  1D1I A;  2B2U C;  2I07 B;  1ZYR D;  1RJT A;  5C5J A;  3I7F A;  1TR5 A;  2LY7 A;  1B8A A;  1N36 H;  1ESF A;  5DQI A;  4DV3 Q;  2N8N A;  4MA5 A;  5M3F B;  4JYA L;  1EY6 A;  2WIN B;  1BO0 A;  3GTL B;  5CV5 A;  2Z1C A;  3PO3 G;  4GNX B;  5JOB A;  1I4Q A;  3DM3 A;  4DV7 Q;  2F0O A;  4CKE A;  4ECU A;  2UUA H;  2LS0 1;  1ULZ A;  3NUC A;  4FYD A;  2J4X A;  2K28 A;  5EAY A;  1JMC A;  4X65 L;  2EY5 A;  5KNC A;  4FM9 A;  2B63 A;  5DAU A;  2YS7 A;  2PNH A;  3MFI A;  1VQI A;  2UU9 L;  1FVI A;  3J80 c;  2D5D A;  3DWQ A;  2DPJ A;  3MXG A;  2F0J A;  2Z6K C;  4RNM A;  2GA4 B;  3TP8 A;  1GO3 E;  2VQF L;  4OO1 G;  4FBT A;  3RB4 A;  5AJ3 Q;  1F2L A;  4Q0F A;  3T51 B;  1K1Q A;  5IY0 A;  3HOX G;  3I4L A;  2ALZ A;  4DAY B;  1K8M A;  2QF7 A;  2R6F A;  5KFH A;  2I80 A;  4FBU A;  2ZJR A;  5E7N A;  4QIW B;  4GKJ L;  1H9K A;  3G48 A;  1KRT A;  3I12 A;  1EY8 A;  1TWC H;  4XT1 B;  4A3B H;  2XGT A;  3P1H A;  3PO2 G;  5LXT F;  1HNZ L;  5IGF A;  4RAU C;  4R4T A;  1B2T A;  4UY8 C;  3K80 C;  1AUX A;  5FLX c;  2W6Q A;  4LFC L;  4KKU A;  2NVX H;  2F4V L;  3MXN B;  5JJZ A;  2DGY A;  3T16 A;  4DAP A;  2ICE C;  5IGB A;  1EYG A;  1EHI A;  1JWM D;  1O7Z A;  4YHH Q;  4DL2 A;  1N34 Q;  4JV1 A;  1YBY A;  5J22 A;  1A8V A;  1TWH H;  3HOY B;  4A3L G;  3CCV A;  4BA1 I;  2FJ2 A;  1X54 A;  3S1M H;  4QMG A;  1PFN A;  2ZDG A;  3CC2 A;  5L1I A;  2VUG A;  1G2S A;  5GAG C;  2XVS A;  5LHY 1;  3MR6 A;  1BXT A;  4C3J G;  1M0T A;  1PFB A;  1XMQ H;  3DUZ A;  4C3J B;  1K0R A;  3CPF A;  3D8G A;  3K7A B;  2FPI B;  2W57 A;  4B3T H;  2E2H A;  2F0S A;  1C3O A;  2PW5 A;  1BF4 A;  2R93 A;  1Y1W G;  1S68 A;  3SE7 A;  4DV5 Q;  2C9O A;  2XN9 C;  4RB1 A;  4A3D H;  5M5Y B;  3HOZ B;  4K6D A;  4B08 A;  1EOV A;  4RAY A;  1RJR A;  2DWC A;  5TSS A;  3X3N A;  4DL3 A;  1Q8I A;  4LF7 L;  3MWE A;  2F52 A;  5EPK A;  4YIJ A;  1JB7 A;  4AH6 A;  3ULL A;  4HYK A;  1DON A;  3CPW A;  4YCW A;  4EFB A;  1RCV D;  4DR3 L;  3I90 A;  3JAM E;  4TV8 F;  3EPI A;  4X62 L;  3DXJ C;  2MFI A;  3PUY A;  2JA7 G;  3A0J A;  1IW7 D;  2NYZ D;  1HNX Q;  3BDC A;  3H0G H;  4NKL A;  4LFA Q;  1BQQ T;  1SNO A;  3CME A;  1YVC A;  4BY1 H;  2FB9 A;  3SI8 A;  4TQS A;  1TS2 A;  4G7Z C;  1DZ1 A;  4JG2 A;  1QNU A;  4H44 C;  5DG9 A;  3J81 i;  3L3O C;  1CTM A;  1F77 A;  1LTS D;  2PNR C;  4XTC S;  3G7L A;  1IBL L;  3IL8 A;  2DZD A;  2JA6 H;  1GUS A;  1Q1B A;  3IFT A;  4LJZ C;  4LSA A;  3GIP A;  4YY3 L;  5M3F H;  1V1Q A;  4RGT A;  5KFC A;  4GKK H;  4P71 A;  1SJE D;  2BOS A;  4L5Q A;  4RMF A;  5EGT A;  5LYJ F;  3GTL H;  4KY7 A;  5C44 G;  3N6X A;  2HHH H;  3Q8S B;  5C44 B;  4JI4 L;  3N40 P;  2R8I A;  2ZM6 L;  4YWM A;  2M00 A;  1S9F A;  4A3E G;  4DV2 L;  4Z9C B;  2RHQ B;  3RZD H;  1XMO L;  3BAA A;  3TSS A;  1ENF A;  1U0L A;  2QGQ A;  4APM A;  1SRO A;  5DEH A;  3KF8 A;  1IYU A;  4B3R Q;  4RKB A;  3GLK A;  3RGX A;  5C4H A;  3I4N G;  1K28 A;  1SR3 A;  1H95 A;  5IOD A;  3CCL A;  1Z6H A;  4LF6 Q;  4IZO A;  2PCF B;  1YIJ A;  4AQY L;  1I94 L;  3IKJ A;  2KHI A;  3ERQ A;  4J9R A;  4EEY A;  1SNQ A;  5A2Q E;  4PZ7 A;  1TWC A;  2R84 A;  1S5B D;  3M4O B;  1VQ9 A;  2UXC Q;  3PUV A;  5EBD A;  3S1Q B;  5CC4 A;  1SMY C;  4RFB A;  1HQM C;  4ETS A;  3M9O B;  2Y0S G;  2W9C B;  5KT4 A;  3PGZ A;  3G6V A;  3KYH C;  3VR2 A;  1Y1V A;  4K0K H;  4FP5 D;  1VMC A;  1XNR H;  4B3S L;  2W9B A;  4FXG C;  2KCM A;  1YNX A;  2ALY B;  3PIO A;  3HKZ A;  4OX9 H;  2XIW A;  1EQT A;  4EQO A;  1OXV A;  3KXY T;  1EIH A;  2B8G A;  2JQO A;  4K14 A;  2ZXP A;  1M90 C;  1TWH A;  2XCA A;  2W8K A;  3DWA A;  1M8A A;  4G57 A;  4QGU A;  3J7A V;  1SMX A;  2E75 C;  3V05 A;  4RCO A;  4FO2 A;  2LSS A;  1ET6 A;  3SK4 A;  4B9X A;  3VA5 A;  2GVB A;  3OWF A;  4BBR G;  3HOY H;  2AWN A;  3GTK A;  5K36 G;  5IT9 c;  2UXB Q;  3EA6 A;  3FEW X;  2DN8 A;  1KAA A;  3OPO A;  5I2Y A;  3S14 H;  2KSW A;  3CAM A;  2KCN A;  2UXD H;  4RGO S;  1GUG A;  2KEC A;  4KD3 A;  3U9S A;  1I6V C;  3GQB A;  4ECZ A;  2EYO A;  1RDP D;  5KG7 A;  4GS3 A;  3K7A H;  4G3I A;  1E24 A;  1IYV A;  1PFM A;  4ZOL F;  3J80 E;  2YS6 A;  4JI2 H;  3GV6 A;  4DR4 L;  3K3V A;  2LKV A;  2R87 A;  1JJG A;  1J9O A;  1J5E H;  5KRU A;  1I4R A;  5J39 A;  5M5Y H;  4L5S A;  3EFX D;  3HOZ H;  3BJU A;  1ZKO A;  3H4B A;  4QW9 A;  4X66 H;  2KCC A;  1K8O A;  4POF A;  4LNQ A;  1EY0 A;  1WTQ A;  2W7P A;  3MR3 A;  4JI7 H;  1I7N A;  5DM7 3;  3NQT A;  3H0G A;  4EBE A;  1WCM A;  3P20 A;  4Y52 H;  3KBG A;  1HPC A;  5BR8 Q;  5FLX E;  2CW8 A;  4JI8 L;  3OMG A;  5KG3 A;  4AYB G;  5KFL A;  1E22 A;  4NXN H;  4AYB B;  5H1S E;  2R7D A;  2MO1 A;  4GOP A;  1JOR A;  1B04 A;  5GON F;  3P7J A;  4K5V A;  2RGV A;  1IZ6 A;  2N88 A;  3VYU A;  4R4C A;  1WTR A;  5LOV F;  3KLS X;  3GTL A;  1HJP A;  1JC7 A;  1RTN A;  2H4O A;  4HCE A;  2EY6 A;  3RZO B;  4R9W A;  4GNX A;  2XC9 A;  1CS0 A;  1E7Z A;  3I73 A;  1O7L A;  5JVL A;  4LF4 Q;  2G5D A;  1KL9 A;  1SYG A;  1QB5 D;  4NB3 A;  1VQB A;  5I4D A;  3NEM A;  5AJ3 L;  2K5V A;  4LUV A;  4HNU A;  1XWE A;  1EWH A;  3EBE A;  4MAM A;  5C8Y F;  1VQP A;  4DK0 A;  4LF9 H;  4A3G B;  1HNW L;  3NHH A;  4DGZ A;  1PRT C;  2XWB B;  4JVZ A;  4EQ5 A;  4UCV A;  2L55 A;  2NTT A;  2K52 A;  4DAY A;  1OXS C;  1WFQ A;  1I4P A;  3F2C A;  2A5H A;  1I4X A;  3OHB A;  1EY9 A;  1EFW A;  1R9T H;  4QIW A;  2CVR A;  4JV5 L;  5DG7 A;  3MAQ A;  2R7M A;  2FIN B;  4C56 C;  4A3M B;  2ATL A;  2KHS A;  3SE0 A;  2OEO A;  4KN4 C;  1NE3 A;  4UHV A;  3NEL A;  2Z4H A;  2VQE H;  1A62 A;  1P8L A;  4YHH L;  4A2B A;  3AFP A;  1N34 L;  2IL8 A;  1DJR D;  3GIM A;  5BN3 A;  4IFD H;  4GN3 B;  1A15 A;  2E2J B;  2DUD A;  4ME5 A;  1WD1 A;  4MTN A;  1OTC A;  1BXR A;  2UVW A;  3V4Z A;  3RB3 A;  5IGG A;  2F4I A;  5CB4 F;  3NGD A;  2AQ3 B;  1H9J A;  3U50 C;  1VQK A;  3BQ1 A;  2MGS A;  1RD9 D;  2ZTC A;  4HJ7 A;  5L1K A;  2D62 A;  4IOA A;  5D8D A;  3M4I A;  3H6M A;  1BDO A;  4FS1 A;  1CKM A;  5KFY A;  3RTX A;  1MSG A;  1KNE A;  3SR1 A;  4A2A A;  1AEX A;  3STB C;  1UWV A;  1X3E A;  2WB1 B;  4IUP A;  2PZT A;  3G71 A;  2K6A A;  4EX5 A;  3WNZ A;  5BMV F;  3R2I A;  1CK1 A;  2SOB A;  1X55 A;  3VYR A;  3H15 A;  1SND A;  1GSH A;  1Y1W A;  4JI0 Q;  2WAQ G;  5FLM G;  3J81 L;  5LL6 X;  3A8I E;  4DV4 H;  1YJ9 A;  2WKC A;  4PZ8 A;  1NCV A;  1CSQ A;  1CFM A;  1F2Y A;  4A4I A;  3RN2 A;  4MIU A;  1GLV A;  3GP7 A;  4EGJ A;  2DLN A;  3HGB A;  1LT6 D;  2F0V A;  1HNX L;  2W71 A;  3MA2 B;  1FNU A;  3TZU A;  1KJQ A;  4I50 F;  5CA1 F;  3ICE A;  2EDG A;  1K0S A;  2A6E C;  2AU0 A;  3JSN A;  3HOU B;  1TA8 A;  3K5I A;  2B3G A;  2XRQ D;  4DUY H;  1DV1 A;  5DGA A;  2Z9H A;  1PH8 A;  1A3V A;  4J9O A;  3PV0 A;  4KJN A;  4XT3 B;  2DNE A;  3BG3 A;  1BBU A;  5IP7 H;  2E2I B;  3HBL A;  4RNO A;  2I87 A;  1N36 Q;  5IYZ F;  1LTT D;  3B6Y A;  1I5F A;  3AEV A;  4K8J A;  3PF4 A;  2BH2 A;  2YTX A;  3RZO H;  4C5B A;  1ASY A;  4BXX H;  3GV8 B;  4LF5 L;  2UUA Q;  5IT9 E;  3H94 A;  2ZDQ A;  1V43 A;  2B2V C;  3KAL A;  4LMY A;  2DNC A;  2EOT A;  1CI3 M;  2W6P A;  4LF6 H;  2E5L H;  1K83 B;  3D4W A;  2NBF A;  3CCJ A;  1VKZ A;  5C1O A;  4MV8 A;  1JOK A;  2RSN A;  4QWA A;  4I7Z C;  5C4X G;  5KFD A;  3HOV B;  2F3I A;  2IJ0 A;  3V6J A;  5LP6 F;  4IPD A;  2B2T A;  4RWS C;  2VA2 A;  4HCS A;  1I6H H;  3ULJ A;  4KI0 A;  4X6A H;  1EQR A;  4ZAI A;  4A3G H;  4G7H C;  5BPF A;  1S5E D;  3M7G A;  4FF1 A;  3GII A;  1TQO A;  4DR1 H;  2OQK A;  5K5P A;  4B9W A;  4J9K A;  3IG0 A;  4HIO A;  1JXL A;  4IQZ A;  1JE5 A;  2W9C A;  3NP8 A;  2Y0S A;  4FXD A;  1OXU A;  2AGP A;  2F0I A;  4FF4 A;  4CKC A;  1SFO B;  4A3M H;  4B3M L;  1PZJ D;  4I4T F;  4DV6 H;  4C2M B;  1EQV A;  2GVA A;  5JVG 3;  4OGQ C;  4OL7 A;  2OLS A;  1NJI C;  2NN6 I;  2C2R A;  3BQ0 A;  2M05 A;  2F0F A;  1RYR A;  3DLL A;  1EL0 A;  2YTY A;  1UE5 A;  1DM0 B;  3A8K E;  4RZR A;  3J7Y W;  1S5F D;  3CC7 A;  1LAB A;  2HIV A;  2E2J H;  4ILW A;  1VQE A;  4GC7 A;  2HQE A;  3M4P A;  1WD0 A;  4DF7 A;  1SN8 A;  3I2Z A;  1PYW D;  3FP9 A;  2KBN A;  3S16 B;  4MV9 A;  2YCH A;  3K0X A;  5KFQ A;  2O5I C;  1B44 D;  2MO0 A;  1IBK H;  5FJ8 H;  1PH7 A;  2YYA A;  3M3Y B;  5M9O A;  2E2H B;  2ZT9 C;  3GV5 B;  1PH1 A;  3K81 C;  3SXH A;  2FPG B;  4PG3 A;  3ND9 A;  1JJC B;  4DPG A;  5KX5 F;  1XMQ Q;  1HR0 L;  5ELB A;  3RLN A;  1Y8N B;  4X3U A;  4B3T Q;  5E4W C;  3T1Y H;  3Q22 A;  1I4H A;  4HN7 A;  1XX8 A;  4ECW A;  1G91 A;  3ERO A;  2L0C A;  1IOV A;  1X3P A;  2NUC A;  1PTO B;  2JP1 A;  4IUR A;  3PVX A;  1KJ9 A;  1JDE A;  2B29 A;  1Q86 C;  5IGC A;  5BR8 L;  2VY3 A;  3FHW A;  3GTO B;  2Z0S A;  4L8J A;  2R7Z B;  3TBI B;  1E2Z A;  2L9H A;  4PQX A;  4C3I B;  2ATW A;  2ID0 A;  3J7A F;  4JBJ A;  4CC6 A;  1UNS A;  4ZUI A;  2L1B A;  4R4Q A;  1S03 G;  3HOU H;  1X56 A;  4AYB A;  5M5W B;  1ILQ A;  3GTJ A;  1EZ8 A;  1K3R A;  1BJT A;  3N44 B;  3IRB A;  4X64 H;  3TDQ A;  5D3D A;  4CDF C;  5CBE E;  1MBY A;  1IHZ A;  4PMC A;  2FKL A;  2E2I H;  2FLP A;  5F9N A;  4DK1 A;  4BY7 G;  4FXK C;  1DIK A;  1CT1 D;  4M1U B;  1PRT D;  4LF4 L;  3SHL A;  1PDQ A;  4DKA C;  1IW7 C;  1SNC A;  2F1M A;  1BVS A;  1XDN A;  4KHP H;  1D8L A;  1QZH A;  3WO1 A;  3R3O A;  5C3E G;  2HHH Q;  2AMC B;  1SBB B;  3KF8 B;  1SE3 A;  2V1C C;  5C0X J;  5JVD F;  2FLN A;  4J6H A;  1BCP D;  4UPA A;  3ZYY X;  4A3I G;  1KIX A;  2ES2 A;  5IOC A;  1TVX A;  1K83 H;  1O80 A;  1W6K A;  3FVQ A;  3RIZ A;  3R23 A;  4MV1 A;  3CF5 A;  2KUM A;  2KOL A;  4A75 A;  5KFE A;  4ME3 A;  3Q23 A;  4DL7 A;  5IP9 H;  3HOV H;  4WOR A;  1ZXT A;  2KQ3 A;  1AW7 A;  1HZB A;  2QKI C;  3KJP A;  4OHJ A;  1OXX K;  3J7A 5;  4DR5 L;  2MCT A;  1LAC A;  1VDZ A;  1EIY B;  5FOB B;  1VBG A;  3D31 A;  1BGW A;  2X69 A;  2GLT A;  3T5L A;  4LMQ D;  1TXY A;  1G29 1;  2K7V A;  2QW7 A;  3KF6 B;  4IPH A;  2AKW B;  1WVL A;  1BBX C;  3A54 A;  1KJI A;  1ONL A;  2EYL A;  1D7Q A;  2OH2 A;  1YJN A;  3MHB A;  2VUM G;  2W70 A;  3RB0 A;  4K0K Q;  1SFO H;  2VUM B;  4C2M H;  1XNR Q;  5I2X A;  4R4I A;  4LW1 A;  1L0Y B;  1GVP A;  3SK8 A;  3OSP A;  2M9V A;  1TS3 A;  4OX9 Q;  1UEA B;  1X6O A;  2EY2 A;  3S1R B;  2FLL A;  2EQS A;  2EYJ A;  4J9M A;  4TSS A;  1UE1 A;  3GTK B;  1HH2 P;  5LMU H;  2VPQ A;  3CQZ A;  2RQX A;  2PQA B;  4AIM A;  1F9P A;  2Z6K A;  2IMW P;  3JAM i;  3PN1 A;  3S16 H;  4CBV A;  2FPP B;  2EXD A;  5KG0 A;  4MHE A;  4JI0 H;  4DV1 H;  1WOC A;  1PZK D;  4LFB H;  2WB1 A;  3I3C A;  4ZLT F;  1FGU A;  1RTO A;  2R86 A;  2E2H H;  4EFE A;  4RNN A;  2UXD Q;  2CH4 W;  2NZH A;  5ELN A;  2R93 H;  2A6E D;  3QOJ A;  5CBA E;  2NVQ H;  3OSN A;  4ECV A;  5KFO A;  1HCZ A;  1PH3 A;  5LMN W;  4M9U A;  2F0Q A;  1RK6 A;  2WAQ A;  2RSO A;  4NXM H;  4JI2 Q;  3JZI A;  4J8Q A;  3H3V I;  1B33 N;  1VQ8 A;  4UCR A;  1IKM A;  5EWF A;  1HQR D;  1ICW A;  3BQ2 A;  3URY A;  1J5E Q;  2UUC H;  1AUV A;  2IHE A;  1PTO H;  1PHJ A;  1Z2O X;  2K05 A;  1X32 A;  4JI3 H;  3M9M B;  3OYY A;  1KC8 C;  1WCM B;  5FD5 A;  1LUZ A;  4X66 Q;  2CKZ B;  2K01 A;  3ERS X;  4ED3 A;  5GRO A;  3I56 A;  3TS2 A;  3W2D A;  2A1A A;  3GTO H;  4JI7 Q;  1HTL D;  5EZY F;  2R7Z H;  2XGP A;  1KDA A;  3HKZ E;  3F1Z A;  4ZYS A;  4GOP B;  1KDC A;  3GV7 B;  4C3I H;  2OXP A;  5DM6 3;  1YHB A;  3Q6S A;  4IUQ A;  4RZQ A;  1QVC A;  5IGE A;  4IJL A;  5IYB G;  2NB0 A;  3MXP A;  5M3M G;  1HXY D;  4NXN Q;  3RJ0 A;  3KHH A;  5M5W H;  3G6J B;  2E2I A;  1VQG A;  4H7B A;  2UVV A;  1YI2 A;  1FYC A;  3PO3 B;  5FK9 C;  4BY1 G;  1V4Y A;  1S72 A;  3I4M G;  1RK5 A;  1QUQ B;  5KKN B;  3DEO A;  2PW7 A;  4JYA H;  1T9H A;  1ET9 A;  1S5C D;  1K83 A;  1E2W A;  2J6S A;  1B3A A;  1U9R A;  3K5L A;  1FJG H;  4RAZ A;  2EPB A;  4JUZ A;  4RKL A;  2QA4 A;  4A3J G;  1DYQ A;  1XPU A;  4IAL A;  1GXD C;  1TT2 A;  3HOX B;  1N32 L;  4X65 H;  2JXM B;  2M2L A;  5CYU A;  5HBR B;  4Y8V B;  5FKA C;  2O03 A;  4DXG A;  4LF9 Q;  3ETH A;  2UU9 H;  1TY2 A;  1JIC A;  1GD7 A;  5E4X A;  3UDI A;  5EWE A;  3PO2 B;  3OTO H;  5DLG A;  2VQF H;  2R8K A;  1LTA D;  1B9M A;  1CSP A;  1Y1V H;  2JJQ A;  2AWO A;  2JA8 G;  1XNQ Q;  1Q3L A;  1SFO A;  4LWC A;  3CCR A;  1B6S A;  4TQR A;  4C2M A;  1EZ1 A;  2C2E A;  3CRK C;  3I4O A;  1WH2 A;  3N6R A;  1PK8 A;  2UVU A;  4UP9 A;  2R92 G;  2EVB A;  4RH6 A;  3J80 i;  5J3B A;  4L5T A;  2VQE Q;  3E0J A;  3MJF A;  4PV1 C;  1CKN A;  4GKJ H;  3I72 A;  3Q1K A;  4ZRZ A;  4KLK A;  1HNZ H;  4UDU C;  4LK1 C;  4MA0 A;  5GAH C;  1W2B A;  1SEI A;  5E1F A;  4LFC H;  3S1R H;  3IFD A;  4Q8E A;  4DL5 A;  1CKO A;  2F0M A;  2F4V H;  1VF5 C;  1GM5 A;  2VZA A;  3FPU B;  1PA6 A;  1CA5 A;  3JRW A;  1AE3 A;  3Q0A A;  5EPJ A;  3GTK H;  1ESR A;  4DNT B;  4A3K G;  3HB9 A;  1XMQ L;  3WWV A;  5I9O A;  5IYC G;  2ZDH A;  3R93 A;  2K4K A;  3MC0 B;  2I8C A;  1Y1W B;  1PMR A;  2QCP X;  3DWP A;  4HJ5 A;  1N56 A;  4O3Q A;  4DR6 L;  5ISR A;  1D5Z C;  2HJW A;  1IKL A;  3RMH A;  4RHS A;  1ENA A;  5FO7 B;  1CA6 A;  3SK6 A;  2ZJT A;  2NZO A;  2OT2 A;  4F8M A;  2OTL A;  3KDF A;  4QIW E;  3MTS A;  1VQ4 A;  3TP6 A;  4DV4 Q;  3BYY B;  2ASJ A;  2CFM A;  3GTM B;  1VQ7 A;  5JAV A;  1CE8 A;  1B6R A;  4IWY A;  3GTO A;  4GZY C;  2R7Z A;  1EYA A;  1TWG A;  1L0W A;  3HOW H;  2JA7 B;  1SNM A;  1BUV T;  1WCM H;  5KT6 A;  3KAJ A;  5JJK A;  4EYI B;  3G6Y A;  2B2W A;  1RL2 A;  4DUY Q;  4GLV B;  2Q8T A;  5CA0 F;  3WOF A;  5FD6 A;  1VQL A;  5KG2 A;  3CC4 A;  5KND A;  4GLX A;  4X62 H;  2EE1 A;  3RLO A;  4EG0 A;  4XQN A;  4GKK L;  1VQJ A;  1NR2 A;  5KFI A;  4M7E A;  1Q12 A;  3H3V C;  3PO3 H;  3OSO A;  1VQA A;  5IYD G;  4RB3 C;  1ZET A;  1IXR A;  2B39 A;  3ORQ A;  4R4O A;  3CMA A;  1G8Z D;  4A3E B;  4QQB X;  4DL4 A;  1IBL H;  4WRD A;  5HUR A;  2J0T D;  5KFV A;  4YY3 H;  4O1N A;  3PIP A;  2YL2 A;  3I4N B;  1C9O A;  2E5L Q;  1EEI D;  1CZG A;  4OO1 H;  4JI4 H;  1Y69 U;  2VNU D;  3CU7 A;  3MFG A;  4O3O A;  2CW0 D;  3HOX H;  2RVL A;  3W1B A;  1UE6 A;  2AGO A;  3UDX A;  2Y0S B;  1O7I A;  3R5X A;  3PZP A;  4N9P A;  4DR1 Q;  3KF6 A;  4K8I A;  2VA3 A;  4LF8 Q;  2BH8 A;  2NUA B;  4J9N A;  1S0N A;  1JX4 A;  2F3W A;  2OWO A;  5BN5 A;  1KXL A;  3K57 A;  5CV7 A;  4FVM A;  4HNT A;  1VQD A;  1SAP A;  4IRK A;  1HUM A;  2VUM A;  2R8G A;  4CJ0 B;  4XIG S;  4DV6 Q;  1O75 A;  2V59 A;  3TP7 A;  4OIJ A;  1K3B C;  1RF2 D;  2D0P A;  1PH4 A;  1FGB D;  2W6N A;  3VPC A;  1MI2 A;  4DR7 L;  3QFF A;  3GTQ B;  3R5F A;  3EIV A;  5LA6 F;  4BBR B;  2CWP A;  4IFD G;  4A3L H;  4HQ6 A;  1EIF A;  3D3R A;  3KLR A;  5D14 A;  4F4Y A;  1KRS A;  2WKD A;  4APV A;  4ECQ A;  3GTP A;  2KJX A;  1PH6 A;  3OIQ A;  2PQA A;  2C28 A;  1Q82 C;  4QWB A;  3BZK A;  2HVQ A;  1GHJ A;  1T36 A;  2UXD L;  4O3P A;  5L1J A;  4C3J H;  4R1J A;  1ASZ A;  2A73 B;  2IY5 B;  3VR3 A;  3SGI A;  1IBK Q;  5KT5 A;  2K04 A;  4JI6 L;  4UCS A;  1N33 L;  1GUT A;  5I6Y A;  4YJ2 F;  3CCS A;  1Y1W H;  5JPN C;  4ED1 A;  1QVF A;  1PFS A;  5JH7 F;  1J5E L;  5IWA L;  1GUN A;  1W96 A;  1KC7 A;  5DNF A;  2Q2H A;  4XYQ A;  3L9A X;  4E6I A;  3PW4 A;  3BDO A;  3T1Y Q;  3I8Z A;  5A2Q L;  3A56 A;  3OWE B;  3U9T A;  1GJX A;  2JEJ A;  3UDF A;  3S9W A;  1QG7 A;  4DNR B;  2Y0S E;  3VA7 A;  2XGQ A;  3GTM H;  2ENB A;  1DOL A;  3DEP A;  5KFN A;  5DG8 A;  4DV3 L;  3OUZ A;  3T5J A;  3HG9 A;  4I7H A;  2JA9 A;  1CQJ B;  2R61 A;  2RCN A;  2DY7 A;  2JA7 H;  2A69 D;  3FMA A;  1S3O A;  3GTJ B;  2X0S A;  5KGU A;  2JE6 I;  4DV7 L;  1STG A;  2UUB H;  2F0W A;  1KD1 C;  4K2K A;  2QEJ C;  4R8I A;  4TRD A;  4KTA A;  3Q8P B;  2E2D C;  3A7A B;  2VPS A;  5KFB A;  3TEH B;  1K73 C;  1GGO A;  4U7C A;  4QWC A;  1I6U A;  1RKN A;  5IE8 A;  1UC9 A;  4R7R A;  5KEE A;  2R7K A;  5KG5 A;  2VQD A;  1CM9 A;  1JKJ B;  4X64 Q;  4C3H G;  1GOZ A;  1HHV A;  5C44 H;  2NN6 G;  1QUQ A;  1SSO A;  2R7N A;  4IZ8 A;  5D1P A;  2IW3 A;  1QNK A;  1VF7 A;  3S15 B;  1LTB D;  1BOS A;  4KHP Q;  2N78 A;  4IUN A;  4A3E H;  3BA9 A;  1SE4 A;  4YP3 A;  2PO4 A;  3PSI A;  4G7O C;  3H09 A;  3N41 B;  4CDC C;  5L9X A;  4K5X A;  3E9H A;  3I4N H;  1VMP A;  1JR0 D;  3J80 L;  3PR5 B;  4DL6 A;  1YHA A;  1Q90 A;  3M4Y A;  5DLF A;  4WD3 A;  4FF2 A;  2FP4 B;  3J81 j;  3BVM A;  3QO2 A;  3GDE A;  4XDX A;  1XNQ H;  4ECX A;  2NU9 B;  2XNA C;  4RB0 A;  4RG1 A;  3M4O H;  1BCP C;  2PPB C;  3S1Q H;  3BAB A;  2G9H D;  4ED0 A;  2F3V A;  5FPR A;  3KUP A;  2E76 C;  2R8J A;  2O4X A;  1HNW H;  3RNU A;  3M4Q A;  3N43 B;  2I46 A;  3OUU A;  2EXZ A;  3BVG A;  2PI2 A;  1C48 A;  4YQW A;  4AYB E;  3GD7 A;  2NU8 B;  2VXW A;  2L4N A;  3BU2 A;  1O78 A;  1IBM H;  1TS5 A;  3J7A K;  1E1O A;  1STB A;  4OWX B;  2FHT A;  5HGT A;  3PW5 A;  1SLJ A;  4BWS C;  1L1O C;  4QF4 A;  4JW0 A;  2L12 A;  2HUG A;  2RDG A;  3CQZ B;  3GTQ H;  1MIU A;  2HQL A;  2JSO A;  4BBR H;  5BPH A;  3LX0 A;  1OXT A;  5K36 H;  4DV5 L;  5LMU Q;  4DV0 H;  1EYD A;  1YNJ D;  4NPS A;  2B2Y C;  4JBM A;  4MZ9 A;  1X9N A;  1KEE A;  4BBS G;  4A3F G;  4A3F B;  4DV1 Q;  2MUY A;  4ZK9 B;  1B3Q A;  2XRS D;  1K9M C;  4LFB Q;  4HJ8 A;  3V96 A;  4XYM B;  2WTF A;  3D6W A;  2WAQ B;  4IPC A;  3AMU A;  5EKL A;  4IR9 A;  4DV4 L;  5KFZ A;  5KFF A;  4GNX C;  2CQA A;  4L1K A;  3KLW A;  1QWY A;  1VQM A;  3SK5 A;  4ZCK A;  4LFA L;  4NXM Q;  3GTM A;  1MJC A;  1JDB B;  2LXJ A;  4IFD I;  3FKI G;  4O0A A;  2JA5 G;  5C3W A;  3FKI B;  3NTK A;  2UUC Q;  3GIJ A;  2JA7 A;  4JI5 H;  4KHV A;  2SDF A;  2O5J C;  4JI3 Q;  1WR2 A;  4Q5V A;  4CKB A;  5JJI A;  1B7Y B;  1K1S A;  2AUJ D;  3FDT A;  1V1O A;  4ZQ3 A;  2FJZ A;  1T5E A;  1TWF B;  2D0O A;  2ZJQ A;  5JEA G;  4IWX A;  3NBI A;  3CRL C;  3GTJ H;  2VOB A;  5I9P A;  3S24 A;  4CGY B;  4GN4 B;  1OO9 B;  3KHR A;  2PMZ B;  2VR1 A;  3VR5 A;  2BDN A;  5C6A A;  3PMF A;  2R3Z A;  1V51 A;  4EBD A;  2JK8 A;  4ECY A;  4B3R L;  3MR2 A;  4ECS A;  3NTI A;  3OOC A;  1ZEQ X;  2QIL A;  3C0F B;  5HY6 A;  5KFT A;  4LF6 L;  5L1L A;  2E5L L;  4LSX A;  4DLK A;  2WB1 E;  5J1Z A;  3S15 H;  3CKI B;  2EZV A;  3IN5 A;  5C4X B;  3Q2O A;  4JYA Q;  1JE4 A;  3QZ7 A;  1L2Z A;  1NNX A;  2RDH A;  1IYJ B;  1T3N A;  4O3S A;  3GV3 A;  2UXC L;  2F0G A;  5KG4 A;  4DNI A;  1FJG Q;  2B63 G;  4Y7N B;  2WAQ E;  3BDL A;  4A3C G;  1C30 A;  1DOK A;  3RFC A;  3K8A A;  4RA8 A;  3JC6 6;  3VPD A;  2GPS A;  2JEI A;  5F9L A;  2CW7 A;  4X65 Q;  1WYD A;  4LF8 H;  1SXT A;  3F2U A;  5DGB A;  2QK4 A;  2AQ4 A;  2WP8 J;  4WBN F;  2N49 A;  3PIP 3;  1PTO D;  2MPM A;  2UU9 Q;  4DFA A;  1FNV A;  2F0H A;  1PH5 A;  1EY7 A;  3OTO Q;  4O2D A;  2Z4I A;  2VQF Q;  1OWT A;  4MV7 A;  2AQ2 B;  2QDB A;  4QW8 A;  1CKN B;  5BN4 A;  1JLL B;  3NE5 B;  1VQ5 A;  1IL2 A;  2K50 A;  2RGR A;  4WJW A;  1W93 A;  4DR2 H;  1VCI A;  3MVV A;  2UXB L;  1S0M A;  1SE8 A;  3GTQ A;  3RLF A;  4GKJ Q;  1SNP A;  3BS1 A;  3ND8 A;  3EYY A;  2Q2I A;  2A68 D;  4B3M H;  3F8N A;  1HNZ Q;  1A6X A;  3TME A;  2UVR A;  1NTG A;  3EVQ A;  5GAE C;  2MQH A;  3CQZ H;  3PIO 3;  1AFP A;  4GN5 A;  4LFC Q;  1W6J A;  1EU4 A;  3FDS A;  1HA6 A;  2F4V Q;  3W1G A;  2RA4 A;  3L0O A;  3M9B A;  2XIG A;  3RBE A;  1KHI A;  5IT9 L;  3FPP A;  2LXK A;  2Q2U A;  4OIK A;  3J81 W;  4X3S A;  1M4V A;  5C0X H;  4HTH A;  1F2M A;  1KJ8 A;  3TIG A;  3R8B A;  2K75 A;  4JV2 A;  3T1Y L;  1ML0 D;  3C1E A;  2RKS A;  1IL8 A;  1D1K A;  3MZ5 A;  5CV6 A;  3RN5 A;  3KDF B;  1HZA A;  1STY A;  1UE7 A;  1Z47 A;  2DY8 A;  2MHV A;  5F2D A;  5FLM H;  3RBD A;  1K8A C;  2R93 G;  4H0L C;  2YW2 A;  1C4Q A;  2Q2T A;  2F0E A;  2BR0 A;  2PBZ A;  1HR0 H;  1TWG B;  3ZJY C;  3MWY W;  2BQR A;  1RJQ A;  2HIX A;  2A8V A; 
#chains in the Genus database with same CATH homology
 2R7F A;  3A5Z B;  1QVG A;  2OQ0 A;  2Y0S G;  1VQN A;  2ZTE A;  3PGZ A;  1T9H A;  1JT8 A;  3KYH C;  5FJ8 G;  3AFQ A;  4A93 G;  3CXC A;  4B3S L;  3I55 A;  1GKH A;  2L15 A;  5DLQ E;  2KCM A;  1YNX A;  2ALY B;  3PIO A;  2QA4 A;  1NMF A;  1TWF H;  4A3J G;  1OXV A;  2JQO A;  2WB1 G;  1XPU A;  3E9I A;  1M90 C;  5C0X G;  1VQ6 A;  4PZ6 A;  1N32 L;  5ELO A;  4QGU A;  1LTL A;  1SMX A;  1C0A A;  2EIF A;  2CWA A;  3K7U C;  4DR3 Q;  2I0Q A;  4X62 Q;  2LSS A;  4LF9 Q;  1GD7 A;  2GVB A;  2AHO B;  4DUY L;  2YU9 H;  4BBR G;  4JI5 L;  3UDI A;  3HOY H;  2AWN A;  3M7N A;  5K36 G;  3GTG H;  4PMW A;  5IT9 c;  2UXB Q;  1CSP A;  1Y1V H;  2JJQ A;  2AWO A;  2JA8 G;  1XNQ Q;  3S14 H;  4LWC A;  3CCR A;  3CAM A;  1IBL Q;  3I4O A;  4OXP A;  4UP9 A;  2R92 G;  2VL6 A;  4YY3 Q;  5C4X H;  3J80 i;  5J3B A;  4L5T A;  2VQE Q;  3ULP A;  1PV4 A;  3TRZ A;  4IFD J;  1CKN A;  1SRU A;  2K5H A;  4GS3 A;  3K7A H;  3HOU G;  1E24 A;  2JEB I;  3EN2 A;  4KLK A;  4DR4 L;  2C35 B;  2ZTD A;  4JI4 Q;  5GAH C;  3PCO B;  1W2B A;  1JJG A;  4H02 A;  3S1R H;  4L5S A;  1CKO A;  5M5Y H;  4C3H H;  4DV2 Q;  3BJU A;  3HOZ H;  1HZ9 A;  3KOJ A;  1GM5 A;  2VZA A;  1RIP A;  1PA6 A;  1AE3 A;  3GTK H;  3F2D A;  4POF A;  4LNQ A;  3W5O A;  4A3K G;  4YCV A;  1XMQ L;  3WWV A;  5IYC G;  1Q46 A;  2K4K A;  1NMG A;  4OON A;  4A3B G;  3KJO A;  4HJ9 A;  3LGJ A;  2ASB A;  4Y52 H;  1PH2 A;  1EQQ A;  5BR8 Q;  1YHQ A;  4JI8 L;  4HJ5 A;  1KAW A;  1Y1V G;  4AYB G;  1E22 A;  4DR1 L;  3NBH B;  4GOP A;  5H1S E;  2R7D A;  2MO1 A;  4DR6 L;  4LF8 L;  1N8R C;  3HKZ G;  1IZ6 A;  1Q1E A;  5IP9 G;  3HOV G;  5LMU L;  4R4C A;  2NZO A;  4YWK A;  3KDF A;  1HJP A;  4DV6 L;  2OTL A;  4QIW E;  1VQ4 A;  1A63 A;  4DV4 Q;  4GNX A;  2CFM A;  2RF4 A;  1HR0 W;  1XJV A;  1VQ7 A;  3PF5 A;  1E7Z A;  1JJ2 A;  4JI0 L;  3M3Y H;  1L0W A;  3HOW H;  1N32 Q;  1WCM H;  4LF4 Q;  4POG A;  4OWW B;  1KL9 A;  1PH9 A;  1WI5 A;  4ALP A;  5JJK A;  4DR2 L;  4NB3 A;  1VQB A;  3NEM A;  3CCE A;  2PMZ E;  2K5V A;  1RL2 A;  4LUZ A;  4LUV A;  3TRE A;  5AJ3 L;  4DUY Q;  2BA0 A;  4GLV B;  1Y14 B;  2OTJ A;  3EBE A;  1PVO A;  3AYH B;  1VQL A;  3CC4 A;  1VQP A;  4GLX A;  3RLO A;  1IBK L;  4A3D G;  2IT1 A;  1HNW L;  5C4J H;  4GKK L;  1VQJ A;  4EQ5 A;  1YZ6 A;  5GQO A;  2K52 A;  1Q12 A;  4IJH A;  2K5N A;  2I5M X;  1OXS C;  1WFQ A;  3PO3 H;  1VQA A;  1TWA H;  2IHF A;  5IYD G;  3F2C A;  1EFW A;  1R9T H;  1IXR A;  4JV5 L;  4JOI C;  1TWG H;  4R4O A;  3CMA A;  3GO5 A;  4QQB X;  4BBS H;  3CD6 A;  2IX1 A;  1Z9F A;  4DR4 Q;  1L1O B;  2YYZ A;  1N36 L;  4A3F H;  3ER0 A;  1NE3 A;  1NY4 A;  3NEL A;  3PIP A;  3CCM A;  1A62 A;  1C9O A;  1P8L A;  4YHH L;  3AFP A;  1N34 L;  3A5U A;  1YJW A;  2E5L Q;  3AQQ A;  3H0G G;  4GN3 B;  3HOW G;  5M5X H;  2DUD A;  2VNU D;  2OCE A;  2UUB Q;  4OWT B;  3D0F A;  4MTN A;  1OTC A;  2UUA L;  1J6Q A;  2IX0 A;  1X3F A;  3HOX H;  1K8G A;  3L2P A;  3W1B A;  4BY7 H;  2JA6 G;  1UE6 A;  1FL0 A;  4HID A;  3S2D H;  3FKI H;  1A0I A;  3UDX A;  3U50 C;  5M3F G;  1VQK A;  2JA5 H;  4JI8 Q;  1O7I A;  2KHJ A;  2ZTC A;  1E3P A;  4HJ7 A;  4DR1 Q;  1DGS A;  3KF6 A;  4DK3 C;  4DR6 Q;  2D62 A;  5LMN L;  5C3E H;  4IOA A;  4LF8 Q;  2BH8 A;  4LF7 Q;  1FJG L;  1CKM A;  4MNO A;  2OWO A;  1KXL A;  4A3I H;  4X64 L;  1VQO A;  1Q7Y C;  3STB C;  1UWV A;  1VQD A;  1X3E A;  2R7Z G;  4HJA A;  3G71 A;  1N9W A;  4DV6 Q;  4XIG S;  4WJ4 A;  4EX5 A;  4JBW A;  1AE2 A;  2MNA A;  2D0P A;  1PH4 A;  1LYL A;  1X55 A;  3H15 A;  4KHP L;  4DR7 L;  4JI0 Q;  2FXQ A;  3CP0 A;  2WAQ G;  3EIV A;  3VDY A;  5FLM G;  1XTD A;  3RR5 A;  1BBW A;  2CWP A;  2YV5 A;  2XTI A;  4YCU A;  5C0X I;  1EIF A;  1YJ9 A;  4IFD G;  3OTO L;  4A3L H;  4A76 A;  4PZ8 A;  1KRS A;  3E0E A;  4APV A;  1PH6 A;  1CSQ A;  1V9P A;  2PQA A;  4A4I A;  1Q82 C;  3RN2 A;  3BZK A;  4JCV E;  1HZC A;  1HNX L;  2KEN A;  2UXD L;  1VS0 A;  4R1J A;  4C3J H;  1ASZ A;  2IY5 B;  4GLA C;  3ICE A;  3SGI A;  4JI1 L;  1IBK Q;  1HNW Q;  2VUM H;  4GKK Q;  2B3G A;  4JI6 L;  1U5K A;  1N33 L;  4Y7N H;  1PH8 A;  2B63 H;  4A3C H;  3PV0 A;  2ZM6 Q;  3CCS A;  1Y1W H;  4JOI A;  1QVF A;  1KQS A;  3TS0 A;  1PFS A;  4JV5 Q;  4DK6 C;  5IWA L;  1J5E L;  1XMO Q;  1IBM Q;  1BBU A;  5IP7 H;  1YIT A;  4L5R C;  2Q2H A;  2CCZ A;  3M85 A;  3T1Y Q;  1N36 Q;  3B6Y A;  4FDB A;  2CQO A;  3GTP H;  1I5F A;  3AEV A;  3NEN A;  4DUZ L;  3UDF A;  1EUJ A;  3PF4 A;  3PUW A;  2YTX A;  4P75 A;  2Y0S E;  2BH2 A;  4B3T L;  3HOY G;  3RZO H;  5JJL A;  5JEA J;  4AQY Q;  1ASY A;  1I94 Q;  3GTM H;  4BXX H;  4DV3 L;  3JAM c;  2JA9 A;  4LF5 L;  4DV0 Q;  2UUA Q;  1V43 A;  2RCN A;  2YTV A;  3CCU A;  4IOC A;  2JA7 H;  3H3V H;  3CCJ A;  1CUK A;  1S3O A;  1W3S A;  2JE6 I;  4J15 A;  3L7Z C;  4DV7 L;  1LM0 A;  3U4V A;  1G51 A;  5C4X G;  1KD1 C;  4P72 A;  2F3I A;  4JC0 A;  3T1H L;  4B3S Q;  4BA2 I;  3TEH B;  1K73 C;  4IPD A;  5IE8 A;  3J81 c;  1I50 H;  5HGQ A;  1PYB A;  1I6H H;  3STB D;  2WFW A;  4KI0 A;  3ULJ A;  1P16 A;  4DV1 L;  1EQR A;  3BZC A;  4A3G H;  4X6A H;  3F8T A;  4X64 Q;  4WJ3 M;  4LFB L;  3HOZ G;  3CW2 C;  2OQK A;  3U4Z A;  2NN6 G;  1Q8K A;  1QUQ A;  5C44 H;  4HIO A;  1L2F A;  2ZJP A;  1JE5 A;  2PI2 E;  4KHP Q;  4DR7 Q;  3HKS A;  2N78 A;  1OXU A;  4A3E H;  3J7Z C;  1WJJ A;  1H95 A;  4JI5 Q;  3S17 H;  1XPR A;  4A3M H;  4B3M L;  1S40 A;  2GVA A;  4NXM L;  3Q8D A;  3PSI A;  1NJI C;  2NN6 I;  3S2H H;  3E9H A;  3I4N H;  2UUC L;  3G6E A;  2H5X A;  1YHA A;  3DLL A;  2YTY A;  1UE5 A;  5M3M H;  5IYB H;  4JI3 L;  4QL5 A;  2HHH L;  3CC7 A;  2HIV A;  2N3S A;  3A74 A;  3J81 j;  2E2J H;  2RHS B;  3GDE A;  1VQE A;  3MEF A;  4IO9 A;  1BKB A;  3I4M H;  3M4P A;  4RG1 A;  4JBK A;  3M4O H;  1SN8 A;  4LUO A;  1C7Y A;  4JI6 Q;  3S1Q H;  3I2Z A;  1N33 Q;  3FP9 A;  2KBN A;  3K0X A;  2MO0 A;  3RNU A;  3M4Q A;  5FJ8 H;  5IWA Q;  2NVT H;  1PH7 A;  4A93 H;  3PUZ A;  3U58 A;  1I3Q H;  1WCM G;  2PI2 A;  1PH1 A;  3K81 C;  1X65 A;  2I5H A;  4PG3 A;  4AYB E;  3GD7 A;  1JJC B;  4QY7 A;  4DPG A;  1XMQ Q;  2JEA I;  1HR0 L;  3BU2 A;  4A3J H;  3I7F A;  3RLN A;  1E1O A;  4B3T Q;  4OWX B;  1B8A A;  3G4S A;  1M1K C;  1SLJ A;  1L1O C;  4DV3 Q;  2N8N A;  4LF5 Q;  4JYA L;  4QJF A;  3GTQ H;  1MIU A;  4K0K L;  2HQL A;  3PO2 H;  4BBR H;  1XNR L;  3PO3 G;  4GNX B;  3DM3 A;  1OXT A;  4DV7 Q;  2B29 A;  5LMU Q;  4DV5 L;  1Q86 C;  4OX9 L;  4NPS A;  4JBM A;  5BR8 L;  2JA8 H;  2VY3 A;  3FHW A;  4MZ9 A;  2Z0S A;  1X9N A;  5EAY A;  1JMC A;  4BBS G;  1E1T A;  4X65 L;  2ATW A;  4A3F G;  2R92 H;  2PNH A;  2ID0 A;  4JBJ A;  4DV1 Q;  1VQI A;  2UU9 L;  1K9M C;  4LFB Q;  4R4Q A;  1FVI A;  4HJ8 A;  1X56 A;  3HOU H;  4IPC A;  3J80 c;  2Z6K C;  1GO3 E;  2VQF L;  4DV4 L;  4DR2 Q;  4OO1 G;  1K3R A;  1QUQ B;  4GNX C;  1XPO A;  3IRB A;  3KLW A;  5AJ3 Q;  5IY0 A;  3HOX G;  1VQM A;  2E2I H;  4B3M Q;  4BY7 G;  4LFA L;  4NXM Q;  4DAY B;  1MJC A;  4LF4 L;  4DKA C;  2LXJ A;  4IFD I;  1BVS A;  3FKI G;  4O0A A;  2JA5 G;  2ZJR A;  1QZG A;  4A3K H;  2UUC Q;  5E7N A;  1D8L A;  4GKJ L;  5IYC H;  4OO1 I;  3G48 A;  4P73 A;  1QZH A;  1KRT A;  1TWC H;  4A3B H;  1VQH A;  2XGT A;  4JI3 Q;  3PO2 G;  5C3E G;  1HNZ L;  3UE1 A;  2HHH Q;  4JI2 L;  2AMC B;  5JJI A;  1B7Y B;  1YEZ A;  3KF8 B;  2V1C C;  4R4T A;  5C0X J;  3K80 C;  4UY8 C;  5FLX c;  4YWL A;  4UPA A;  1KIX A;  4A3I G;  1UEB A;  4LFC L;  2ZJQ A;  2D0O A;  3S1N H;  2ES2 A;  5JEA G;  2NVX H;  2F4V L;  1K83 H;  3MXN B;  2KCT A;  2DGY A;  3HFZ B;  4UP8 A;  3GTJ H;  3CF5 A;  4X66 L;  3S24 A;  4A75 A;  1EYG A;  4GN4 B;  4DAM A;  4ME3 A;  4YHH Q;  5IP9 H;  3HOV H;  1N34 Q;  4JI7 L;  1MJE A;  1HZB A;  1YBY A;  3KJP A;  1A8V A;  1TWH H;  1OXX K;  3J7A 5;  4A3L G;  2JK8 A;  4HIK A;  3CCV A;  4DR5 L;  1EIY B;  4BA1 I;  4B3R L;  1X54 A;  3S1M H;  3D31 A;  4UP7 A;  3PUX A;  1HR0 Q;  4P74 A;  1NBW A;  3CC2 A;  4TQU S;  3F2B A;  3PUV A;  1TXY A;  5HY6 A;  1G29 1;  4NXN L;  5GAG C;  2E5L L;  3KF6 B;  4LF6 L;  4IPH A;  1L1O A;  2AKW B;  2WB1 E;  3S15 H;  1Q81 C;  2K14 A;  1D7Q A;  1X3G A;  4JYA Q;  1K0R A;  1YJN A;  2UUB L;  2VUM G;  1MKH A;  3CPF A;  3TQY A;  2QEX A;  1IYJ B;  1SFO H;  4K0K Q;  5LMN Q;  4C2M H;  1XNR Q;  2NVY H;  2UXC L;  4DNI A;  4R4I A;  1FJG Q;  4LW1 A;  2B63 G;  1GVP A;  4A3C G;  2WAQ E;  1Y1W G;  4DV5 Q;  4OX9 Q;  2BA1 A;  3K8A A;  3JC6 6;  1X6O A;  4A3D H;  3CCQ A;  2EQS A;  1EOV A;  5IP7 G;  1B70 B;  1WYD A;  2I5L X;  4X65 Q;  2VS1 A;  3UE0 A;  1UE1 A;  3OW2 A;  1HH2 P;  4LF7 L;  2WP8 J;  5IYD H;  2F52 A;  2N49 A;  2GN5 A;  2UU9 Q;  2PQA B;  4AIM A;  2Z6K A;  1JB7 A;  3JAM i;  4AH6 A;  3ULL A;  2R6G A;  1PH5 A;  3S16 H;  3OTO Q;  4O2D A;  3CPW A;  2EXD A;  4YCW A;  5GAD C;  2VQF Q;  4BXX G;  4DR3 L;  1AH9 A;  1CKN B;  1WOC A;  4X62 L;  3PUY A;  2MFI A;  3UDG A;  4LF9 L;  1VQ5 A;  2JA7 G;  3A0J A;  1FGU A;  1IL2 A;  2E2H H;  2K50 A;  1HNX Q;  2UXD Q;  2NZH A;  3H0G H;  5ELN A;  4LFA Q;  2R93 H;  2NVQ H;  3CME A;  4BY1 H;  1VQC A;  1VCI A;  1YVC A;  2UXB L;  4JI1 Q;  1SE8 A;  3RLF A;  1PH3 A;  5LMN W;  4JG2 A;  1XNQ L;  4GKJ Q;  1PYS B;  3J81 i;  2A19 A;  2Q2I A;  4XTC S;  1IBL L;  1VQF A;  4JI2 Q;  1HNZ Q;  2JA6 H;  3H3V I;  1NTG A;  1Q1B A;  1VQ8 A;  5GAE C;  2MQH A;  4YY3 L;  3CQZ H;  2VQE L;  5M3F H;  1V1Q A;  4GN5 A;  1J5E Q;  4LFC Q;  2IHE A;  4A3G G;  4P71 A;  4L5Q A;  4RMF A;  2F4V Q;  1PHJ A;  3W1G A;  3GTL H;  5C44 G;  3OYY A;  3L0O A;  3M9B A;  1KC8 C;  1LUZ A;  1KHI A;  4X66 Q;  4IPG A;  2CKZ B;  3ERS X;  4JI4 L;  4KHZ A;  5GRO A;  3I56 A;  3TS2 A;  2LXK A;  4YWM A;  2ZM6 L;  4DUZ Q;  2E8G A;  2Q2U A;  2A1A A;  3GTO H;  4A3E G;  4JI7 Q;  4DV2 L;  2R7Z H;  3HKZ E;  3F1Z A;  2RHQ B;  4GOP B;  4A3M G;  3RZD H;  1XMO L;  1IBM L;  4C3I H;  2VW9 A;  1U0L A;  4DR5 Q;  3KFU A;  2QGQ A;  1YHB A;  2K75 A;  1SRO A;  4B3R Q;  3T1Y L;  1EWI A;  3I4N G;  2HT1 A;  1QVC A;  3RN5 A;  4IJL A;  1G6P A;  5IYB G;  1HZA A;  1SR3 A;  3KDF B;  1UE7 A;  1Z47 A;  5M3M G;  5FLM H;  5M5W H;  3CCL A;  4LF6 Q;  4NXN Q;  4TVA B;  1VQG A;  1YIJ A;  1K8A C;  2R93 G;  1YI2 A;  4AQY L;  4HIM A;  1I94 L;  4BY1 G;  2Q2T A;  1S72 A;  2KHI A;  3I4M G;  3T1H Q;  4DV0 L;  4PZ7 A;  3ZJY C;  1VQ9 A;  2UXC Q;  4GOP C;  2HIX A;  2A8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...