1Y14B

Crystal structure of yeast subcomplex of rpb4 and rpb7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
154
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNASYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II 32 kDa polypeptide
publication title Structures of Complete RNA Polymerase II and Its Subcomplex, Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 154
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y14B02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y14B01
4LFAQ 2Q2IA 4BY1G 2OWOA 2VQEL 2EQSA 4A3KG 2MO1A 4DR5L 2VS1A 1OXTA 4GOPA 2VL6A 2YU9H 5FLXc 3UDXA 1TXYA 2PQAA 4UP9A 1N8RC 1U0LA 3A5UA 2UXBL 3CCLA 2UXCQ 3A0JA 4K0KQ 3ULJA 2JA5H 4XTCS 4HJ5A 1CSPA 4JBJA 4C3IH 3DM3A 3OW2A 2KCMA 1N9WA 1VQ5A 3HOWG 4OONA 2WAQE 4DV0Q 2ZJQA 5M5WH 4POGA 1VQMA 5HGQA 2HHHQ 3PUWA 3I4MH 1UEBA 1UE6A 3AFPA 4X66L 3CF5A 4B3ML 4JI0Q 5FJ8H 2B63H 4L5QA 2QGQA 1Q81C 4B3SQ 1YVCA 4DK6C 2HQLA 3H0GH 2CQOA 2Z6KA 4P74A 4DV7Q 1IBLL 4DV4L 2N3SA 3RR5A 4DV2Q 4R4TA 1EIYB 1Y14B 2E8GA 4JI2Q 4IO9A 4APVA 2A8VA 2R93G 1YJNA 3A74A 3G6EA 3U4ZA 4A3MH 4DR2Q 2JE6I 1HZBA 5C4JH 3M4OH 4QJFA 4OO1I 4X65L 2QEXA 2VQFL 1IXRA 3PO2H 4LF9L 1HZAA 3PF5A 4NXNL 3MEFA 4QIWE 4JYAL 1UE1A 1AH9A 2YTXA 1EFWA 4QY7A 4DR1Q 4A3BG 1X54A 5K36G 1E1TA 4LF4L 3K81C 2E2HH 2PI2A 2JA7G 4JC0A 2Q2HA 3TS0A 1M1KC 3H3VI 4GOPC 1OXUA 2ATWA 2K52A 2ZTCA 1EOVA 1JT8A 5C4XH 2E5LL 1N33Q 1HZ9A 2NN6I 3S2HH 1HNXL 1VQBA 4PMWA 3PUXA 4LF5Q 1E3PA 1IBKL 1PYBA 3CCVA 3HOVH 3J80i 1VQLA 4GKKQ 1N32L 2AMCB 4WJ3M 1A62A 4YCVA 1Q82C 3EN2A 4TQUS 2UUCQ 3GTPH 4RG1A 3RZDH 5C0XG 3PUVA 4JBKA 4GN4B 3PIOA 3GTKH 5IP9G 4DR2L 5GAEC 3T1HL 5GQOA 3KLWA 2AWNA 4UP7A 1QZHA 1X3GA 3S16H 3PIPA 1SLJA 4C3HH 3F2BA 3CCJA 4GOPB 1HR0Q 4DR7Q 2Y0SG 3HOXG 3KFUA 3KF8B 1VQPA 4GLVB 3GTJH 1EQRA 3E0EA 3W1BA 3G71A 1K73C 1Q8KA 2Z6KC 4DR1L 4KLKA 1GKHA 2ZTEA 4A3JG 3OTOL 1VQIA 2K50A 4BY7H 2XTIA 3J7A5 3F8TA 3S1MH 1LM0A 4YCWA 3JAMi 1JE5A 1VQAA 2OTJA 3AYHB 1Y1WG 4DR5Q 3GTOH 4JI8L 5LMNQ 4HIMA 3I4NG 1IZ6A 1TWFH 2VZAA 4HJAA 3K8AA 2N49A 2QA4A 1PH7A 5IWAL 4RMFA 2ZJPA 2VUMH 4ME3A 4A3FG 1Q86C 3HKZG 4X64L 1MJCA 1YIJA 1XMQL 2UXBQ 4POFA 1YBYA 2A1AA 2RHQB 1QVGA 1J5EL 4KHPL 1FGUA 1PH6A 1K0RA 4AH6A 4A93G 2ZM6L 1WI5A 4IJHA 1SE8A 4OX9L 2RHSB 2E2IH 3CPFA 2JA8G 4P73A 1KL9A 1LYLA 5C3EH 2CCZA 1Y1VH 3M9BA 3CMAA 4XIGS 2D62A 3BZKA 4JI4L 4X66Q 1EIFA 2ZTDA 3TEHB 4GNXA 4BXXH 2R92H 4UPAA 4GN3B 4JI3L 1QUQA 3CCRA 3CCMA 1YHBA 3NENA 1K9MC 3HOZH 5IYBH 4X6AH 2YTVA 3UDIA 2OQ0A 2ES2A 2NVYH 5EAYA 3KDFA 1IBLQ 4DV4Q 1PHJA 2LXJA 4A3GG 3CQZH 4DV6L 4IFDI 3RLOA 5C44H 2F52A 1N34L 1L0WA 4A3LG 5LMNL 4UY8C 3BJUA 3BU2A 4A3IH 4LUOA 1S40A 4OWTB 5IYDH 3FKIG 4X65Q 3CMEA 1UE5A 2VQFQ 2ASBA 3S15H 4LF9Q 2Z0SA 1WJJA 4NXNQ 2JA6H 3F2CA 2VY3A 2KCTA 4JYAQ 2AHOB 1NE3A 4OO1G 2PI2E 4BY1H 1MIUA 2F4VL 1SN8A 3I55A 1OXSC 3EIVA 3KJPA 4A3KH 4LF4Q 1PH9A 3K7UC 1YJ9A 4LNQA 3M85A 2IT1A 3L0OA 4KI0A 1SMXA 4HIDA 1XNRQ 1EWIA 2E5LQ 4DAYB 3CPWA 2JJQA 4NPSA 1I94L 3I7FA 3CP0A 1E1OA 3GD7A 1V43A 1E24A 3PSIA 4DV1L 1K8AC 1HNXQ 3HOUG 4P72A 1IBKQ 4JOIC 5IP7G 2WB1E 2NN6G 5E7NA 3HOWH 2I5MX 2N8NA 4UP8A 1FL0A 1XPRA 1N32Q 1P16A 1Q1BA 1X65A 4JI1L 5IY0A 4LFCQ 1EYGA 3HKSA 1CKNB 2LXKA 2OQKA 3AEVA 2NZHA 2UU9L 3T1HQ 2D0OA 4A3CG 1HR0W 2CKZB 3MXNB 2IX0A 3J80c 4GNXC 3PO3G 5GADC 1KQSA 1AE2A 3D31A 3TS2A 2DUDA 1YHAA 2V1CC 5C0XJ 1PH3A 4H02A 1D8LA 1CUKA 1H95A 4DV3L 1PH2A 4BBSG 1L1OA 3S24A 1PH8A 3OTOQ 2R93H 4HJ9A 1JMCA 5BR8L 4DAMA 4QL5A 4HJ8A 3AFQA 5M3FG 3S14H 2XGTA 1MKHA 1XNRL 2UXDQ 4YWMA 4BBRG 3NBHB 3NEMA 2E2JH 2R7ZG 5LMNW 4JI8Q 4GS3A 3WWVA 1Q46A 3ULLA 4LFBL 3J7ZC 4P75A 5IWAQ 2Q2UA 1HH2P 4A3BH 4P71A 2R7DA 4LUVA 1WCMG 1W3SA 4LW1A 1X56A 3SGIA 3JAMc 4GNXB 4IPHA 3FHWA 4X64Q 1X3FA 4AYBG 2VW9A 4A3EG 1XMQQ 4TVAB 2JA7H 3S2DH 3W5OA 4LFCL 4WJ4A 1N36L 4IJLA 1S3OA 4JCVE 3CCUA 1J5EQ 4L5RC 4KHPQ 4IFDJ 1NMFA 2N78A 2ZM6Q 3KDFB 1L2FA 2JA9A 4OX9Q 3G4SA 4JI5L 2EIFA 5M3MG 3GO5A 4C3JH 3DLLA 1ASYA 3CD6A 4Y7NH 2HT1A 1KD1C 1C9OA 1G6PA 1PH1A 1VQGA 4DKAC 4JI4Q 1WYDA 1XPOA 1VQ9A 2PQAB 3RZOH 3S1QH 3PCOB 3NELA 4YWLA 2WFWA 5M5YH 5FLMG 4LUZA 1VS0A 4JI3Q 2WAQG 1VCIA 3M3YH 4LF8L 1TWGH 1Z9FA 3PV0A 1KRTA 3TQYA 1GM5A 4LF7L 5IP9H 1I6HH 3GTLH 1IYJB 5GROA 1WOCA 2UXDL 1C7YA 4A3DG 4DV6Q 3J81j 1W2BA 2NVQH 4JV5Q 1N34Q 2K5HA 4LWCA 3HOXH 3HFZB 4AQYL 1O7IA 2B29A 3S1NH 1WFQA 1I3QH 4IFDG 1OTCA 1GVPA 2PNHA 1L1OC 5DLQE 4EX5A 4JBMA 4A3JH 3TREA 4DNIA 3RN5A 1VQOA 4OWWB 1IL2A 2CFMA 4DUYQ 3PUZA 2KHJA 5IYCG 4HJ7A 4C2MH 1JJ2A 1XNQL 2F4VQ 1Y1WH 2CWAA 1BKBA 4DUZL 4B3TL 3RN2A 1CKMA 3HOYG 3M4QA 4JBWA 3H15A 2K5VA 3I4NH 4ALPA 5JEAG 1PH4A 4A3FH 3KF6A 3F1ZA 1VQKA 3UE0A 4IPGA 2KHIA 4A75A 1I94Q 4JI6L 5JJKA 1V9PA 4DV1Q 1I5FA 3K80C 1YJWA 1IBML 3ER0A 1PFSA 2OTLA 2IHEA 4A93H 2HIVA 1L1OB 1VQFA 4YHHL 1QZGA 1X3EA 3I56A 4JG2A 1XMOL 2JA8H 3LGJA 4JI1Q 4MTNA 1DGSA 2NZOA 3Q8DA 1K8GA 3B6YA 4JV5L 3IRBA 1VQHA 2I5HA 1HNWL 1AE3A 1GD7A 2RF4A 3STBC 2MNAA 4DR3L 2UU9Q 1C0AA 3VDYA 2MFIA 2BH8A 2MO0A 1FJGL 4O2DA 4A4IA 1M90C 1A8VA 5IE8A 4YY3L 3S1RH 4JI7L 4MZ9A 4DUYL 3E9IA 4DV3Q 2I5LX 2B3GA 2FXQA 3ICEA 4A3GH 4GKJL 2ZJRA 2JA5G 3CCEA 1FVIA 4A3LH 4IPDA 5BR8Q 3FP9A 2D0PA 4DV5L 2GVAA 4HIKA 1TWAH 3AQQA 3E9HA 4IPCA 1A63A 3I2ZA 3FKIH 1KIXA 2YYZA 1Z47A 1VQCA 4HIOA 4O0AA 4X62L 4KHZA 3I4MG 1K3RA 4LFBQ 2NVTH 5LMUL 1PV4A 2Y0SE 3K0XA 4NB3A 1B7YB 5FJ8G 2UUAL 2B63G 2IY5B 3CW2C 1NMGA 3J81i 4DR6L 1BBUA 3L2PA 1V1QA 2K14A 3F2DA 3M7NA 4LF6Q 2KENA 1N36Q 3RLFA 3H0GG 3U4VA 1JB7A 2UUBL 2AKWB 3RNUA 1VQNA 1SFOH 1PVOA 3H3VH 4JI5Q 3RLNA 1VQ6A 4NXMQ 3M4PA 4R1JA 1TWHH 3HOUH 1LUZA 4A3MG 1R9TH 1X9NA 5IP7H 4IOAA 3GTMH 3I4OA 1E7ZA 1G51A 2GN5A 2MQHA 3CC2A 3T1YL 3PO2G 2IHFA 2R6GA 3HKZE 3ERSX 5J3BA 5HY6A 3U58A 2DGYA 3KOJA 1BVSA 4LF8Q 4LFAL 2K5NA 2VNUD 1YEZA 4LF7Q 2OCEA 2I0QA 4A3CH 5JJIA 1QVFA 4DK3C 1OXVA 1RIPA 5ELOA 5JJLA 2JQOA 3JC66 1YHQA 3PO3H 1KRSA 2CWPA 1VQ4A 4AQYQ 1SR3A 3KF6B 5C4XG 4YWKA 2AWOA 4BBSH 1YITA 4GLAC 2UXCL 1UWVA 1UE7A 4K0KL 1EQQA 2PMZE 1QUQB 3OYYA 4QQBX 3K7AH 1PA6A 4LF6L 3A5ZB 5M3FH 1NJIC 3HOVG 2YTYA 1XNQQ 4DR4Q 3GDEA 1NBWA 3GTQH 4BBRH 4DV0L 1KAWA 1SROA 2R7ZH 4DUZQ 4B3TQ 1YI2A 1GO3E 4NXML 2HHHL 1JJCB 2GVBA 3PUYA 3W1GA 1X55A 4JI0L 1WCMH 2WP8J 4FDBA 1KXLA 4YCUA 1X6OA 3UDGA 4Y52H 1TWCH 3STBD 4A3EH 2Q2TA 4JI6Q 1XJVA 1XPUA 2ID0A 2H5XA 4B3SL 5GAGC 1NY4A 2JEAI 1IBMQ 5JEAJ 3BZCA 4B3RL 2LSSA 4DV7L 4IOCA 2BA0A 4EQ5A 1SRUA 4YHHQ 2K4KA 1VQDA 1EUJA 4GN5A 1A0IA 1Q1EA 4DV2L 5M3MH 1XMOQ 1S72A 4JI2L 3UE1A 2JK8A 4R4IA 4BA2I 4BY7G 1VQEA 1PYSB 1HNWQ 3ZJYC 1HNZQ 1B8AA 4GLXA 2F3IA 4DR3Q 1XTDA 2ALYB 4J15A 4MNOA 3PF4A 1VQJA 1YZ6A 2RCNA 1NTGA 2WB1G 2BA1A 1FJGQ 3CCQA 5FLMH 4YY3Q 1VQ8A 2NVXH 4JI7Q 3CCSA 2VUMG 1LTLA 4L5SA 1ASZA 2HIXA 4DR4L 1YNXA 5AJ3Q 1T9HA 1OXXK 2BH2A 1I50H 3PGZA 4A3DH 3CXCA 5GAHC 1PH5A 2YV5A 1E22A 4OWXB 4GKJQ 1CSQA 4B3RQ 4PG3A 2C35B 3UDFA 1CKNA 3ULPA 4DV5Q 1MJEA 3U50C 4OXPA 1KC8C 4QGUA 4BA1I 2VQEQ 1N33L 4DPGA 4PZ6A 5C3EG 3KYHC 1BBWA 1Y1VG 1Q7YC 4LF5L 1D7QA 5IYCH 1K83H 1P8LA 4PZ7A 4X62Q 5H1SE 3KJOA 5C0XI 5LMUQ 2EXDA 4GKKL 2KBNA 2A19A 2R7FA 2UUAQ 2UUCL 2K75A 2R92G 4BXXG 1Q12A 3HOYH 4DR6Q 4R4QA 3HOZG 1JJGA 4JOIA 5M5XH 5IYBG 1HJPA 3CC7A 1G291 3CAMA 1HNZL 4AIMA 4A76A 2UUBQ 1HR0L 5C44G 4DR7L 3L7ZC 5ELNA 1CKOA 1KHIA 2JEBI 1B70B 1VQ7A 3GTGH 2IX1A 4L5TA 1HZCA 1J6QA 4PZ8A 3J81c 4A3IG 4B3MQ 3CC4A 3S17H 2L15A 1U5KA 5IYDG 3TRZA 3EBEA 5AJ3L 4R4OA 5IT9c 1RL2A 3T1YQ 1QVCA 2JA6G 3G48A 3D0FA 4R4CA 4AYBE
chains in the Genus database with same CATH superfamily
4LFAQ 5KRUA 2Q2IA 4EBEA 5DGAA 4N8FA 4A3JB 4ED6A 1JX4A 1SSOA 1EYDA 1EY9A 1BOSA 2VS1A 2SDFA 1V51A 1OXTA 2VUGA 2VL6A 3GQCA 1EY8A 5FLXc 4WRDA 2VB2X 1QB5D 2XWBB 1F9QA 1VBHA 3A8IE 1TS5A 1F9SA 1RCVD 2WKCA 4GKKH 4RHSA 3RAXA 3J7AK 2UUCH 4OIKA 1LT3D 1Y8PB 4POGA 1B04A 3GIMA 1CHQD 4ETSA 3PUWA 4B3ML 4X66L 2WV6D 4JI0Q 1HR0H 1F9PA 2R7ZA 2B63H 4EQOA 3SK6A 2E76C 1WTOA 2QGQA 1Q81C 4B3SQ 5KFQA 3H0GH 4P74A 3M4YA 5I2YA 4DV7Q 1IBLL 3Q2OA 4TSSA 4DV2Q 4R4TA 2A8VA 1Y14B 1Y69U 2R93G 4IO9A 4APVA 3S1RB 3A74A 2R7MA 2JN4A 5C4JH 1RD9D 1JKJB 5FPRA 1U4PA 3M4OH 4OO1I 2JYOA 3H40A 2ICIA 4FXDA 3RGZA 1HZAA 4RNOA 3A56A 1UE1A 4LMQD 4QY7A 3K81C 4KJNA 2W6NA 5LP6F 2PI2A 2K5WA 4JC0A 4X3SA 3TZDA 2M2LA 2K6AA 4ZKCB 1JT8A 3RAQA 3VR2A 1YNND 2A69D 5KFZA 1UC9A 3MAQA 1NSNS 5JVDF 2NN6I 1LTTD 4IAJA 4HNVA 1H9KA 4C3JG 3EPIA 2CVRA 3ITPA 1VQBA 5DNFA 1IBKL 3CCVA 2EY1A 1HA5A 4GKKQ 2AMCB 5CYUA 4YCVA 1B53A 2HCCA 2UUCQ 3NPPA 3GTPH 1E4EB 2FP4B 5K2MA 3ZYYX 3MXGA 3PR5B 2JEIA 5IP9G 4DV4H 3H91A 3T1HL 5DAUA 1QZHA 3J80W 3C0FB 1TR5A 5JAVA 3F2BA 1HR0Q 2C28A 3KFUA 4EBDA 1LT5D 2I07B 3G71A 3W1BA 3KLSA 4DR1L 3NE5B 4LF9H 2ZTEA 3PO3B 4A3JG 3A8JE 1VQIA 2K50A 1HCZA 3S1MH 1W96A 5D8DA 4YCWA 1Z6HA 3AYHB 3K5OA 5KYIA 1G2SA 4XX0B 3MWEA 4JI8L 2RSNA 2LKVA 1TWFH 4HEDA 2SCUB 2ZJPA 5IIFA 1T3NA 4ME3A 1Q86C 1QILA 1FD7D 2R7ZB 4X64L 1MJCA 3CHBD 3TP7A 2RHQB 4XQNA 4S3SA 4HMIA 1K0RA 4AH6A 5IGDA 2ZM6L 2RHSB 2E2IH 4A3EB 5C3EH 3E3XA 4G3IA 3HGBA 1X3PA 2XNAC 3NXWA 3KHLA 3D3RA 1QE6A 2B2WC 1II3A 3TMEA 3R5HA 5M3MB 2R92H 1SNPA 1E2ZA 2FMAA 1HRJA 2JEFA 3UDIA 3OTOH 2NVYH 1I6VC 4DV4Q 3CQZH 4KKTA 3VR4A 2EPBA 5I9OA 2F52A 5EPKA 5T14A 4YR0A 5KG0A 5TSSA 5JVG3 4NLGA 4RAZA 4A3IH 2M05A 4LUOA 1S40A 1GHJA 5IYDH 2ALZA 3CMEA 2DNCA 1UE5A 4LF9Q 2V5AA 2JA6H 2PI2E 4B9XA 1MIUA 1XMQH 3KBXA 1JCKB 4CC6A 1PH9A 1HUNA 1J5EH 2EJFC 3K7UC 3OIQA 3KHHA 4L6TB 2J9GA 1SMXA 5J39A 2RDFA 4A93B 2E2HA 5KIXA 3OWFA 3CPWA 3T5KA 1B4OA 3TDQA 1N56A 3GD7A 3PSIA 5M5XB 1HNXQ 4HMJA 1R4QB 1V1OA 4H44C 1XPRA 4FF4A 4JI3H 3JSNA 4XYMB 2HVQA 5EQ0A 5F9LA 1G8ZD 2HQEA 4F7XA 1CK1A 2D0OA 2B8FA 2CQYA 1H9JA 1FKAH 1HR0W 2CKZB 1SNQA 3K0YA 4K8IA 5IGBA 3J80c 5GADC 3PO3G 3HZXA 1N34H 2R7LA 2DUDA 2MPMA 1PH3A 4IUNA 4QWCA 4FF1A 1BXTA 1D8LA 5KFJA 1AP0A 1PH2A 1DV2A 3I70A 5HGTA 3OIPA 4DUYH 1B9MA 3OTOQ 2MHVA 2DIKA 2ZDQA 2R93H 4I4TF 4HJ8A 3OWEB 3AFQA 1RHPA 2AGPA 5FO7B 4QWBA 5E3FA 4MV1A 2R7ZG 5D65A 2AUKA 1M6VA 1JWUD 4GS3A 4C3IB 4LSXA 4J8QA 1CM9A 4IR9A 3QZ7A 1DOLA 5KFHA 3JAML 4P71A 4LW1A 1W3SA 5M5WB 3JAMc 1I94H 3FHWA 1X3FA 4A3EG 1XMQQ 3S2DH 2WB1A 1I4PA 1Q3LA 2F3WA 4LFCL 1N36L 1S3OA 1J5EQ 2VUMA 3NBIA 2N55A 1NMFA 4HR7B 4X3TA 3GTMB 3RB4A 2AQ3B 4JI1H 1L2FA 3MC0B 2B2UC 1KNEA 5M3MG 1SNOA 3GO5A 4C3JH 1QJOA 1PH1A 2UU9H 2BQRA 4RKLA 1WYDA 2PZTA 3BABA 2ZXRA 4C5AA 2UVVA 2TSSA 2KA7A 3K5LA 5M5YH 1Y1VA 3M7GA 4MHEA 4QUFA 5FLMG 4R8NA 4JI3Q 1SXTA 1TWGH 1Z9FA 2L5TA 4K2KA 4LF8L 4LF7L 3KHGA 5IP9H 2UXDL 5KYLA 4MTKA 5BR8H 1W2BA 2QDLA 1N34Q 4JV5Q 3H4DA 2B29A 4TQSA 2E2HB 3RV3A 3HS0C 1OTCA 2ASLA 4EX5A 1EQVA 4JBMA 1HQRD 4A3JH 1O7YA 5CA0F 4LFBH 2FJZA 4DUYQ 5IYCG 2KHJA 2L4NA 2SEBD 4PNYA 1KLUD 1M7JA 1TKWB 2R7KA 2A6ED 4U673 4DUZL 4B3TL 3D6WA 1CKMA 2YZMA 5DLFA 1K1QA 3ND9A 2XC9A 5LXTF 1C8CA 2EYLA 5JEAG 1PH4A 4JI5H 3R93A 3JRWA 1I4XA 2Z4IA 3F1ZA 3I8ZA 5AFWA 2YZGA 4ZUIA 4NXMH 3Q23A 4A75A 1I94Q 4JI6L 1M8AA 5CA1F 5KFNA 4DV1Q 1I5FA 1IBML 4DFAA 3P7JA 1A3VA 1STNA 1IYUA 1D6EC 4YHHL 3S16B 3LWUA 1XMOL 4JG2A 4ECTA 4JI1Q 1DGSA 3B6YA 2P5ZX 3IRBA 2MNAA 2UU9Q 3VDYA 2MFIA 2BH8A 1FJGL 4AQYH 2A68D 1A8VA 1RF2D 2HVRA 3S1RH 4JI7L 2RBMA 5IGFA 3TQTA 1RJRA 3RIZA 2G5DA 3ICEA 2WB1B 4GKJL 2ZJRA 3CCEA 1SE4A 4C3IG 5BR8Q 2VUMB 3I12A 4DV5L 4IN3A 4RB3C 4DR4H 1SYFA 4HIKA 4MV7A 3E9HA 4IPCA 4XYLB 3TN2A 3L4JA 4WORA 2NU9B 4HIOA 4O4IF 4X62L 1GYFA 4LFBQ 1XYIA 1LABA 5LMUL 1CQVA 1PV4A 2WDTA 4U6PA 3K0XA 4OELB 2F0PA 1EEFD 4MV4A 5I4DA 2G9DA 4EQNA 2IY5B 1Y1VB 2VA2A 1S03G 1V1QA 3M7NA 3F2DA 4DL4A 5CORA 1GLVA 4IUTA 1D5MC 2UUBL 4JI5Q 3MEHA 3RLNA 3DXJC 4NXMQ 1IOVA 1HNWH 4HCEA 2BDNA 4R1JA 3HOZB 2B2VC 5G3LF 3NGDA 5C3XA 4A2AA 1EZ6A 2GN5A 3CC2A 2MP1A 3T1YL 1TU2B 1I7LA 2R6GA 3HKZE 4X3KA 5J3BA 2R3ZA 4UCTA 3U58A 3KOJA 4L1KA 1BVSA 1AH9A 2W7PA 2OCEA 3U9SA 3CU7A 1OXVA 1RIPA 5ELOA 5JJLA 3S15B 4B3RH 3VA5A 3JC66 3PO3H 2CWPA 5A2QW 2SNMA 4DR6L 5DG9A 4AQYQ 4C5BA 5KFRA 1GUTA 2L11A 5G3LD 1UWVA 1UE7A 4F88A 4K0KL 3T4AC 1EQQA 1V4YA 1NCVA 1WSCA 4LMYA 4QQBX 4LF6L 3J7YW 3A5ZB 2XCPA 2JEJA 4DR4Q 2UUAH 4O1NA 3T13A 2EYMA 2AQ4A 4DV0L 1SROA 1F2ZA 2R7ZH 1YI2A 3FVQA 2HHHL 3NP8A 1KJ8A 3PUYA 4QCLA 1X55A 3HOWB 4IZOA 4FDBA 1KXLA 4Y52H 3VMMA 1S5BD 3K59A 1PDQA 4A3EH 4B3MH 2Q2TA 3N6RA 2R8IA 1OWTA 5C4JB 1A3UA 2BA0A 2R6FA 2K4KA 1A0IA 1Q1EA 4H0LC 5M3MH 2W7OA 1EY5A 1SE2A 3PW5A 3BVMA 1UNNC 3E5SA 2FPIB 5CR3A 1HNWQ 1IBLH 2F3IA 3TINA 1XTDA 1JICA 4J15A 4MNOA 3PF4A 2EYOA 2RCNA 2WB1G 3MXUA 4JK1C 3CCQA 2UVUA 1KTKA 5FLMH 2VUMG 3OW7A 4C56C 4QIWA 1WTWA 1T9HA 3UFXB 1OXXK 3WOFA 5C5LA 5GAHC 3E5NA 1CSQA 2K03A 4B3RQ 5KFUA 4ZI7F 3ULPA 4KKUA 4OXPA 4QGUA 4DL3A 3PIO3 3OPOA 4TV8F 2RA4A 1BBWA 1Y1VG 2XIGA 2F0DA 5BN4A 5IYCH 3PIP3 5H80A 2FLNA 2AQ2B 3I90A 5LOVF 3Q8PB 2A19A 2R7FA 1JR0D 2UUAQ 3C1FA 2DY7A 4ILWA 1YNNC 4R4QA 3HOZG 1O78A 5M5XH 1HJPA 4DU9A 5JEAH 1F77A 3RZOB 3NUCA 4AIMA 5JVLA 4JI2H 4RB1A 1WTXA 3TIIA 5JQWA 1UAPA 2NU8B 1KHIA 1IKLA 4B3MQ 1HZCA 1J6QA 1SYGA 2J6SA 4QMGA 4Q8EA 1U5KA 1S0OA 1LTRD 4IRDA 4R4OA 4F4XA 2H4OA 5C8YF 1TWHA 2I8CA 4WD3A 1D5XC 1QVCA 4DR1H 3G48A 4R4CA 3MTSA 1NAPA 2EXZA 1EEID 4NDXA 4MAMA 4EG0A 4ECVA 2KSWA 3CRKC 4ABNA 4O3SA 2EYHA 1MI2A 1VAJA 1TXYA 1N8RC 1K8OA 3MFYA 3WO0A 1U0LA 1KAAA 2IA6A 3X3NA 2UXBL 3V6HA 2UXCQ 3ONAB 1VMCA 2IJ0A 5J1ZA 4ULLA 2IWHA 4IURA 4C3IH 1WTPA 4A3FB 3OW2A 2KCMA 1DJRD 4E6IA 4HN7A 3HOWG 1PK8A 3A55A 2ZJQA 5M5WH 3MXPA 2Q8IB 5EKKA 5HGQA 2QK4A 1UEBA 3AFPA 3Q6SA 5C4ZA 4DR7H 2QILA 1STAA 2V4QA 4L5QA 1C48A 2UVWA 1ET6A 2HQLA 4QIWB 2Z6KA 5L9XA 3N44B 3TQ1A 1EIYB 3RR5A 2D2CC 2E8GA 4JI2Q 1EY6A 4KMUC 1KC7A 1PFMA 2CH4A 4F50A 4FO2A 4K5WA 4DR5H 3H6MA 4ZAIA 3RTXA 4OEMB 2VPSA 1TS4A 3TIGA 2A6HD 1VDZA 3VYTA 4NXNL 3HP3A 3PF5A 4QIWE 3R8BA 5CBAE 4JYAL 4DR1Q 1X54A 4Q0YA 1E1TA 4LF4L 2E2HH 1S97A 1MBYA 2OXPA 2ATWA 4JUZA 2NVXA 2K52A 2NVTB 1JXLA 4JV2A 2E5LL 5D1OA 2NTTA 3OSOA 1HZ9A 5KKNB 1ZETA 4ED2A 5FK9C 2EVBA 3PUXA 3P1HA 2KQ3A 1VQLA 1N32L 3BZDB 1HFNA 2QCPX 5CV9A 1Q82C 3EN2A 4TQUS 4FF3A 4DK0A 1TWHB 3HOUB 1FR3A 5I9PA 3HG9A 4F4ZA 5A35A 3PUVA 1K83A 3S9WA 1WR2A 4O2BF 4DR2L 5GQOA 3SE7A 3KLWA 3HRZC 1B1ZA 3S16H 4RUCA 3CCJA 4DR7Q 1HA6A 1EYAA 4IWYA 1VQPA 4GLVB 1EQRA 2XVSA 1K73C 4JPBW 4X65H 4KLKA 4IALA 1B50A 2EY2A 3KLSX 3IFDA 2WYOA 4BBSB 1GJXA 4M9UA 2OTJA 3IFTA 3Q8SB 1MSHA 4APMA 4DR5Q 4J9OA 4G57A 3S2DB 3FDSA 3MR2A 3K7AB 1IZ6A 3M9NB 2VNUD 2VUMH 3R2IA 4A3FG 4CJ0B 1YIJA 2A1AA 1QVGA 1FGUA 1PH6A 5KFCA 1BBXC 4LSAA 1PRTB 1SE8A 4OX9L 1G2TA 2XSCA 4IHJF 4O3PA 3NBHA 4LFCH 4P73A 2CCZA 3OHXC 2JA5A 1Y1VH 5KFVA 3VPCA 1L2ZA 4ED0A 3J81L 4FS2A 3OSNA 2ENBA 2W6MA 3TEHB 2FK3A 1KDCA 1OO9B 4RH6A 5IT9L 4YB8B 1QUQA 3CCMA 3HOZH 4X6AH 3RBDA 4TUYF 2OQ0A 4PMBA 2K7VA 3SK5A 2LXJA 5D3DA 2K1BA 4DV6L 1S4ZA 3RGXA 4LF7H 1MHWC 2NVXB 2E2DC 5LMNL 3MFHA 5FLXL 2UXDH 5JJZA 5D1OB 4XZ3B 3VPDA 2DJGC 4X65Q 3S15H 2VQFQ 1RK6A 3U9OA 4ZQIA 5KT4A 5IWAH 3C3LA 3NHHA 2Z9HA 5ISRA 1H9SB 2AHOB 3Q1KA 2F4VL 2RGVA 4G7ZC 4DNTB 1PXUA 3I55A 3KJPA 1S68A 4KHPH 2ATLA 3H4BA 1K83B 4DAPA 2DPIA 3SXHA 3L0OA 4KI0A 4DUZH 1RTNA 1E4FT 4OL7A 3CP0A 3GIDA 3HOUG 4JI4H 1V43A 1LTGD 2BDOA 4JOIC 5IP7G 1SYCA 2W9BB 3BA8A 5E7NA 3HOWH 3C2PA 1IBMH 4Y8VB 1Q1BA 1IOWA 3BDCA 4LFCQ 1PRTD 3EVQA 3S17B 3HKSA 1CKNB 2F0IA 2OQKA 2RSOA 2NZHA 2A73B 2F0TA 2JA7A 5EDWA 4EYIB 1KQSA 3BA9A 1STGA 3D31A 1YHAA 2V1CC 1AFPA 3GTKA 4DV3L 1K1SA 1WD1A 4BBSG 2FMCA 3RUPA 1L1OA 3NTHA 5FPOA 5COYA 4HJ9A 4DAMA 5D14A 3GTJA 4RAYA 1MKHA 1XNRL 2UXDQ 4YWMA 4BBRG 3NBHB 4I55F 2E2JH 1EZ1A 2JA5B 4I7HA 3GILA 1O7LA 2QEJC 4P75A 1I4QA 5IWAQ 1DYQA 2Q2UA 4HSPA 2R7DA 5F9NA 1KJIA 5M9OA 3SGIA 5C5MA 3GTOA 5JH7F 2IL8A 4WJ4A 4KHPQ 1LTSD 2HUGA 2JA9A 1JOKA 3DLLA 3CD6A 1C9OA 2DLNA 3WOEA 4DKAC 4Z9CB 4JI4Q 1TA8A 1VQ9A 2R8GA 4CBVA 2QKIC 3RZOH 4RB2C 3NELA 4YWLA 2C00A 5ELDA 1XWEA 3N8DA 1KRTA 2E74C 3J81E 4H13C 3GQBA 2O5IC 5GROA 5D3IB 5ELFA 5IT9E 1PTOB 1J8IA 3HFZB 1UC8A 3I91A 2OLSA 1S5DD 2ZXPA 5CGKA 5DLQE 4R8IA 4DNIA 4OWWB 1TQOA 1CE8A 2NUCA 2CFMA 3GV7B 3BDLA 3BG3A 1N48A 5FLXE 1JJ2A 1XNQL 4BWSC 1SJED 4YJ3F 2X0SA 5KFOA 4UAIA 3S2HB 5DM63 1BKBA 4LF6H 3RN2A 3M4QA 1EWHA 2C2EA 2YS7A 3HOVB 4F4WA 4A3FH 3CRLC 1ENFA 2V58A 4IPGA 3RZDB 3QIAA 2CW7A 1XTCD 5KNBA 5JJKA 1V9PA 2KECA 2DJFC 4XT1B 5LYJF 3GV8B 3K80C 4FXGC 5JVH3 3GTKB 2OTLA 1L1OB 1VQFA 1TVXA 3I56A 1LT6D 1JDEA 4R7RA 1KBLA 5KFBA 2NZOA 3GTJB 1V8QA 4C1NI 1VQHA 2I5HA 1GD7A 2RF4A 1PTOF 1C0AA 4KJOA 2MO0A 1GSOA 4ID6A 2A74C 5IE8A 4FYDA 4MZ9A 5KT5A 3E9IA 5HBRB 5J2TF 2W9CA 1RJTA 4MTEA 4GC6A 5EKIA 3GTOB 4ZYSA 2JA5G 1V1PA 1ZHSA 1ENAA 1RKNA 3QG1A 4P2CB 4IPDA 3FP9A 1EY7A 1I7NA 3GV6A 4NMZA 1PTOD 1CS0A 3I2ZA 1KIXA 4EQPA 1Z47A 4RKBA 1TS2A 4O0AA 1T36A 2NVTH 1PX2A 1BQQT 2Y0SE 3OMGA 5FJ8G 3CW2C 1NMGA 2X69A 1W6KA 1BBUA 3J81i 2K14A 3L2PA 1WTHA 1C4QA 2HDMA 4LF6Q 4RAUC 1A2UA 2NYZD 3TSSA 4FS1A 1EUDB 2KEDA 2R7NA 3VR5A 1FGBD 1K28A 1ZXTA 3H3VH 2R82A 3J80L 4DL6A 3MJFA 4ECRA 1TWHH 3HOUH 1LUZA 4HNUA 5FD6A 3PZPA 4A3MG 2D9UA 4K6DA 1KDBA 5EBDA 2NUAB 1M4VA 2EY5A 5IP7H 4DR3H 3I4OA 1E7ZA 4YY3H 1G51A 2N88A 5E4WC 3DF7A 1DOMA 4LFAL 3E0JA 2K5NA 1F9RA 1FNUA 2I0QA 5JJIA 3SK8A 2RGRA 3SI8A 2LS01 5L1IA 1BXRA 1VQ4A 4DLKA 4ED3A 1SR3A 4U7CA 4DGZA 1WH2A 2NZ1D 4YWKA 2XGPA 5ELEA 2CZGA 4BBSH 1ZHQA 1WVLA 2PMZE 1S10A 5D1PA 3K7AH 1NJIC 4NW2A 2UXBH 1VMPA 3HOVG 4MA0A 1I3QA 5KNDA 3DWPA 3A54A 4BBRH 3MZ5A 4KKSA 2VQDA 2WAQA 3URYA 3VA7A 1K3BC 3W1GA 2KJXA 4C2MA 4JI0L 3OHAA 1KEEA 2PNRC 3UDGA 1X6OA 1QWYA 1O75A 4CJ2C 1XPUA 1CI3M 2H5XA 4B3SL 3I4LA 5JEAJ 4B3RL 2B2WA 4ECUA 2LSSA 4DV7L 4IOCA 4EQ5A 3HKZA 1SRUA 1VQDA 4XYOA 4GN5A 4DV2L 4IOAA 1V1PB 2JK8A 5LL6X 3V96A 1PYSB 1STYA 3RBEA 4EFBA 1RJPA 1ZQ7A 2KEEA 4DR3Q 3ETHA 4H7BA 2F0SA 1YZ6A 3EYYA 1K8MA 4YIJA 2B2TC 4YY3Q 2NVXH 3OUUA 2KHSA 1YNXA 2OH2A 1LT4D 1PH5A 2F0GA 1E22A 2YV5A 3IL8A 5KFDA 5DQGA 3MR5A 2EZVA 4ZLTF 3GIJA 4ODGA 2VB3X 1EU3A 2OT2A 2PZUA 2EJGC 2A6HC 5IODA 1K83H 1P8LA 1SYDA 5BMVF 1TWAA 1ML0D 2KOLA 5NUCA 4GKKL 2AGQA 2R84A 3FKIA 4PV1C 2UUCL 2K75A 2IP4A 4RCNA 1Q12A 5IYZF 2HVSA 3OSPA 1JJGA 3L3OC 3EQLC 2FFKB 1HNZL 2IW3A 4HNTA 3L4KA 1TAEA 1HR0L 1RK5A 2R61A 5L1LA 4DF7A 4DR2H 3L7ZC 2JEBI 2IX1A 1PLFA 1I6HB 3S17H 3MFIA 2L15A 2L1BA 4PMCA 3R5XA 1EZ8A 1RL2A 2C5CA 4IUQA 3J80E 2EYJA 4J9KA 1R9TA 2W57A 3S1NB 1I3QB 4AYBE 2W8LA 1HXYD 2OWOA 2F0LA 2B63A 2MO1A 1IKMA 1F2LA 4GOPA 1B33N 2F0JA 1N33H 4XDXA 4CGYB 1A9XA 3VR3A 2PQAA 1ONLA 4ZQ3A 3CCLA 4LH6A 2O5JC 4LF5H 2P0AA 3I4NB 3MWYW 2JA5H 3RFCA 4HJ5A 4YQWA 1CSPA 4JBJA 4DAVA 4QWAA 3DM3A 4J1MA 1VQ5A 1N9WA 3HKZB 3VYUA 2WAQE 3Q24A 2CW0D 3JAME 4MTDA 3LWEA 4UHVA 4OX9H 1R4PB 5T1GA 5KG7A 1UE6A 1RJQA 1G6ZA 1JC7A 2B2UA 4UFZA 2JA8B 1DONA 5FJ8H 3IG0A 5EWFA 4O3NA 3QB3A 4F8MA 1I4HA 4DV4L 2YZNA 2N3SA 1TWCA 2PCFB 4RWSC 3G6EA 1GUWA 4A3MH 4DR2Q 2JE6I 1HZBA 1WTRA 2WE6A 1TY2A 5LMNH 4A3GB 3PW0A 3H3VC 2QEXA 5KG4A 2I80A 1QNKA 3T53B 4LF9L 2NU7B 2EE1A 1PTOH 1TWAB 2F0MA 4A3BG 5K36G 2H1EA 3FKIB 1SYBA 1SCUB 5EBCA 2F0UA 2AU0A 3G8CA 4RGTA 2MJ8A 3TS0A 1M1KC 3H3VI 1QCBD 1AZQA 1OXUA 2ZTCA 2F4VH 4PDBA 1M0TA 4EVOA 2RVLA 3X3MA 1N33Q 3V4SA 2K5DA 3S2HH 4QWDA 3G6XA 1HNXL 4JVZA 1SNDA 4X66H 4CDEC 4LF5Q 1E3PA 2HCIA 2KVMA 4K2LA 3J80i 3HOVH 3V6KA 1B2TA 1C30A 1T94A 4RG1A 3RZDH 1R9TB 5C0XG 4GN4B 1SEIA 3GTKH 5GAEC 4RGMA 1Q90A 4K5XA 2AWNA 4DAYA 1X3GA 2J0TD 3BQ1A 1SLJA 4GOPB 3KAJA 1HFGA 4YAJB 4MV9A 1CQJB 3GTJH 3E0EA 2CH4W 1Q8KA 2Z6KC 1PRTC 2E2JB 3OTOL 3LX0A 2GA4B 3GTGA 2XTIA 2HJWA 5EKLA 1LM0A 1E0BA 5KGUA 5KT6A 3K5MA 5CMDA 3JAMi 4FVMA 3UQ8A 3W3AA 3GTOH 3MXNA 1F2MA 5LMNQ 4HIMA 3I4NG 2GPWA 2VZAA 1O80A 4G4KA 1XNRH 5M3FB 4J9NA 2DWCA 1CZWA 2NVYA 3KALA 3HKZG 3T5LA 1SJHD 3QWNA 3DWAA 4TRDA 3SK4A 1XMQL 1IBKH 2F03A 4ECSA 2YU9A 1J5EL 2A69C 5F2DA 5KFWA 1KABA 1WI5A 1GSAA 1TWCB 4ED8A 3CPFA 3D4DA 2JA8G 1KL9A 1LYLA 3QOJA 3M9BA 3CMAA 3R23A 4R8UA 5IOCA 3T1HH 2D62A 3BZKA 2WTFA 3NTIA 3BAAA 4X66Q 1IW7D 2W6OA 1AUXA 3N52A 5J22A 4GNXA 2FKLA 2B2VA 4GN3B 4JI3L 3AU7A 4ED7A 1BUVT 1YHBA 3NENA 1U4LA 2J6UA 2YTVA 4ECWA 2ES2A 2YL2A 3HBLA 5EAYA 2F0KA 1IBLQ 1PHJA 5DG8A 4A3GG 4RNMA 3RLOA 1N34L 2MCTA 4YP3A 3QO2A 4UCUA 4QWEA 1E4GT 3LWBA 4OWTB 4A3DB 4JI8H 3FKIG 3PW4A 2ASBA 5KX5F 5KFEA 1WJJA 5C1PA 1CQFA 5L1KA 4YR2A 2VY3A 3KLRA 1NE3A 4X64H 1SYXB 2Z1CA 4IR1A 3GIPA 1OXSC 3EIVA 1KJJA 5DQIA 4XXEA 3M85A 2ZM6H 1SMYD 1XNRQ 1ICFB 4DAYB 1SEBD 2JJQA 4NPSA 2PPBC 3HOYB 1I94L 2XD4A 3I7FA 1E24A 4DV1L 4YR3A 2RDJA 3R3OA 2C2RA 3UI2A 1ZYRD 1IBKQ 4LH7A 1H9RA 1AZPA 1LACA 4UP8A 3MR6A 4JI1L 1X65A 5IY0A 1PZID 3GTGB 3VR6A 3MR3A 2L0CA 3AEVA 2UU9L 1UUPA 3T1HQ 4A3CG 4PQXA 2RDIA 1AN8A 1EY0A 3MXNB 5KFFA 1GOZA 2BCOA 2F0FA 4WJWA 1F2YA 1ICWA 4H02A 1S0NA 1CUKA 5DQHA 2ZXOA 1PH8A 4R9WA 4FU0A 4UCSA 3U9TA 3HXLA 2YU9B 1JMCA 5BR8L 2XN9C 1K0SA 3H09A 4QL5A 5M3FG 3M9OB 1IYVA 3NEMA 3HEJA 5LMNW 4O3RA 3OHBA 4JI8Q 1L0XB 3A8KE 4R8UB 3ULLA 4LFBL 3D6CA 3J7ZC 3GLKA 4KY5A 1HH2P 3QZ8A 4FF2A 4A3BH 5K36H 4LUVA 4EGJA 4EGQA 4GNXB 1X56A 3K5IA 4X64Q 1CA6A 2FE3A 2K33A 4TVAB 3W5OA 3I4MB 3SE0A 4FNFA 3WO1A 5KFPA 1PTOC 4JCVE 4X3UA 4IFDJ 3MWMA 3R2TA 1BR9A 3DM1A 3O13A 2ZM6Q 4DR6H 3G4SA 4JI5L 2Q8TA 3RD4A 1EIHA 4I7ZC 2JEGA 1KJ9A 4Y7NH 2HT1A 4DA2A 3PMFA 1VQGA 1M0WA 5KFXA 4MV3A 4DK1A 2FK2A 1EYZA 4IWXA 1B3QA 4EEYA 2QDBA 5DEHA 3J7AV 5BN5A 5C0XH 1GM5A 3DWQA 4N9PA 3PR4A 1VF7A 4QUCA 1I6HH 3T5HA 2C22A 4A3DG 3PO2B 1SDFA 1EWCA 3K58A 4AQYL 3I73A 1O7IA 3S1NH 1WFQA 1I3QH 4IFDG 4RGOS 3N40P 4BBRB 1L1OC 4I7AA 4DXGA 3TREA 1VQOA 3PUZA 5C4XB 2L12A 2RCFA 3TZUA 4C2MH 1KLGD 2KUMA 1WD0A 1BCPB 3HOYG 1N36H 3I4NH 2K5VA 4ALPA 4J9RA 3KF6A 5CBEE 1QOHA 3D4WA 1EUCB 1VQKA 3UE0A 5GONF 4PWQA 3RF2A 2IMWP 1DZ1A 4U68A 1RDPD 1ET9A 5E4XA 1YJWA 4Q43A 1PFSA 4NP5A 4KY7A 3KHRA 3EFXD 4O42A 1QZGA 1X3EA 4CKBA 2JA8H 1ENCA 3LGJA 2F0OA 4LF8H 3I72A 1RTOA 2BE5D 3Q8DA 1HNWL 5CV8A 1D2BA 1Q8IA 4YAKB 1A3TA 4MV8A 3BVGA 3E6ZX 4UCRA 4BY7B 4O2DA 4RFBA 1STBA 4IRCA 4GZYC 2I5LX 2AQ1B 2XRQD 1O7ZA 4A3GH 3WNZA 1FVIA 3BJYA 1PRTF 2D0PA 3GP7A 1BCPF 3RB6A 3N42B 1TWAH 4B3TH 3V4ZA 5L37A 2SNSA 1TS3A 3OOCA 5EGTA 1KJQA 3FKIH 4ZOLF 3RB3A 2YYZA 1GUNA 1VQCA 1SNCA 3BDOA 3MVVA 5E1FA 4KHZA 2A6EC 3I4MG 3KBGA 4J0MA 2YRWA 3ORQA 2ASJA 2O2LD 1B7YB 2UUAL 4JI6H 1HUMA 1HHVA 1LLRD 1N36Q 4KN4C 3RLFA 4YHHH 1BCPD 1XMOH 2AKWB 3RNUA 1VQNA 1BF4A 1VQ6A 5BPHA 1HNZH 2BQ3A 1R9TH 1X9NA 2FLLA 2F4IA 1FJGH 2C9OA 4KN7C 5CB4F 2CHBD 4ME5A 3DUZA 1JE4A 2MQHA 5C44B 1ESFA 3PO2G 4JI7H 1SAPA 3ERSX 5HY6A 4LF8Q 1B44D 1BGWA 4LF7Q 3SHLA 4A3CH 4DK3C 2ZDHA 1E2WA 4GKJH 2A68C 3CKIB 5FO8B 1YHQA 4DV5H 5KG3A 1KRSA 1EOTA 2PQEA 5C4XG 3KF6B 4BY1B 4J9SA 1W6JA 2YW2A 3GTLA 2AWOA 2WKDA 4HTHA 4A3KB 1YITA 2D5DA 3DEPA 4GLAC 2UXCL 4UCVA 4X62H 2Y0SA 5LMUH 1QUQB 2UVRA 2YRXA 5M3FH 5FO9B 2YTYA 2B2YA 3GDEA 2XWJB 1B6RA 4DUZQ 4B3TQ 3JSLA 4FXKC 4C1NK 4G7OC 1JJCB 3FRPB 2UUBH 3NSWA 1MSGA 1Y1WA 5C3WA 4IZ8A 1TWCH 5T1IA 3STBD 4C3HG 2YCHA 4JI6Q 1JB3A 5IGCA 2ID0A 2EOTA 1NY4A 5GAGC 4A3MB 1IBMQ 3BZCA 1GUOA 2CW0C 4YHHQ 1AW7A 3T1YH 1EUJA 1CHPD 3V2TA 1XMOQ 1S72A 4BY7G 4JI2L 4M7EA 3UE1A 4R4IA 1ULZA 2O03A 3ZJYC 1HNZQ 4GLXA 3FPUB 5FD5A 5KNCA 4QW8A 3V6JA 1VQJA 1I6UA 1NTGA 1E2VA 1FJGQ 2NU6B 1EU4A 1JLLB 1VQ8A 5CV7A 3S14B 4JI7Q 2C2DA 2WACA 4XT3B 1ASZA 2HIXA 4K0KH 2PMZA 2M9VA 2BH2A 4A3DH 2PYKA 3CXCA 3A7AB 4GKJQ 4J9PA 2B8GA 4PG3A 1MJEA 3UDFA 4DV5Q 3M9MB 4DV0H 1NR2A 4IFDH 5KG2A 3KUPA 2AGOA 3C1EA 4EEQA 4DPGA 2K5QA 3Q22A 2JA7B 2O4XA 4HAEA 1Z2NX 2HHHH 1H9MA 4ZK9B 1CT1D 1LTID 1D7QA 4X62Q 5EPLA 3JAMW 5H1SE 5LMUQ 5C0XI 2KBNA 1HNXH 1A2TA 2R86A 4BXXG 5KG5A 3OUZA 3EROA 3HOYH 1CA5A 4JOIA 5C5JA 5IYBG 1PYWD 4HYKA 5L1JA 3CC7A 2OEOA 3CAMA 3S1QB 4A76A 2UUBQ 4TV9F 3Q0AA 5C44G 4DR7L 5ELNA 3GTGH 1CKOA 3M3YB 1VQ7A 1B70B 4DL2A 3K3PA 4L5TA 2V59A 4PZ8A 2CQAA 4IQZA 4KD3A 3GTLB 4MIUA 1SFOA 2DPJA 5AJ3L 2NVQB 3ETJA 2Y0SB 1GUGA 1YNJD 1BDOA 3T1YQ 3TBIB 4CDFC 3HOXB 1HPCA 3D0FA 4ZHQF 4HR7A 3GTMA 4BY1G 4DNRB 2IX3A 4F87A 4XQQA 2EQSA 1J9OA 2VQEL 4DR5L 2Z6BA 4A3KG 5JPNC 5FKAC 2YU9H 5HV6A 3F2UA 3UDXA 3KF8A 1ILQA 4UP9A 3A5UA 1Y1WB 2CW8A 2QF7A 3ERQA 3KAKA 2I46A 1C3OA 3A0JA 4K0KQ 3ULJA 4XTCS 2LY7A 3P75A 4B08A 5BPFA 3QJYA 2W70A 4OONA 4DV0Q 1EHIA 4RZRA 3I3CA 2PW5A 4QF4A 1VQMA 4FBUA 3SEBA 5KFYA 1PFBA 2HHHQ 3I4MH 3H20A 3CF5A 4CC5A 3GTQA 1JWMD 3NK9A 5EZYF 3FEWX 5CV5A 4E4TA 3LNNA 3G6JB 3PN1A 1YVCA 4DK6C 2WINB 1GUSA 3G6YA 2CQOA 2PMZB 1WCMA 5KFLA 4AYBA 1A63A 3MWDA 1B3AA 1YJNA 5I2XA 1IW7C 4HCSA 3U4ZA 4LJZC 1AEXA 3RB0A 5KT2A 2JXMB 3GV3A 5I6YA 1FNVA 5KG1A 3D4RA 4QJFA 3QFFA 4X65L 2VQFL 1IXRA 3PO2H 4O3QA 4ECQA 4OIJA 1MD2D 4NKLA 3MEFA 5KFKA 4RCOA 4ECZA 1RODA 2YTXA 4M1UB 1EFWA 2QYZA 1X32A 3K57A 5DLGA 4TQRA 2JA7G 2Q2HA 1S0MA 4GOPC 2MGSA 2L9HA 1EOVA 1STEA 5C4XH 5J2UF 1HTPA 5LHY1 1X3QA 3SR1A 1SBBB 3R5FA 1I50A 4HQ6A 1FYCA 4BS9A 1ZEQX 4PMWA 3ORRA 5C4HA 5JPMC 1PYBA 2W9CB 1CTMA 1XXGA 1SFOB 2R85A 4WJ3M 4Q45A 4DV1H 1A62A 4Q44A 2BQUA 1S5CD 1SMYC 3WDNA 1W93A 4JBKA 3K3VA 2PVPA 1KDAA 3PIOA 3PQIA 4KHVA 4UP7A 2OF1A 1LTBD 5BN3A 3PIPA 4C3HH 4ZKBB 4DL5A 1ZYRC 3G7LA 2Y0SG 3CVZA 3HOXG 1NUCA 2RKSA 3KF8B 3VPBA 5I47A 1GKHA 3GIKA 4EBCA 4QW9A 1D5ZC 1EQTA 2K32A 4CKCA 5FOBB 4BY7H 2YS6A 4NXNH 3J7A5 4JYAH 3F8TA 2GPSA 4LF4H 1JE5A 4IUUA 4A3BB 1VQAA 2RQXA 1WTVA 1Y1WG 2NB0A 4A2BA 5JOBA 4HJAA 3K8AA 2N49A 2QA4A 1PH7A 5IWAL 4RMFA 2E5LH 3GTQB 5DGBA 3EA6A 1JQYD 4Q5VA 5EOYA 2UXBQ 4POFA 3JRXA 1YBYA 2A5HA 4Y7NB 2EY6A 3K5HA 4LK1C 4KHPL 2R8KA 1N32H 2K01A 3SVMA 1ESRA 4A93G 1WCMB 4IJHA 4AYBB 2M00A 3G6VA 1XDNA 4OGQC 4XIGS 1JORA 1L0YB 4JI4L 4O4LF 5KG6A 3L9AX 1EIFA 4IUPA 2ZTDA 5EWEA 4BXXH 1VF5C 4UPAA 3J7AF 1CQIB 4XQJA 3CCRA 1K9MC 1LTAD 5IYBH 4YBZB 2ASDA 2DNEA 2QW7A 1EFID 3KDFA 4CHTB 4IFDI 1XX8A 4N9TA 5C44H 1L0WA 2WAQB 4UY8C 4A3LG 3BJUA 3BU2A 4O4HF 3RMHA 3H0GA 4C2MB 1DIKA 3K5NA 1D1KA 1I50B 1FNWA 1BNZA 4DL7A 4Q0FA 1AUVA 3N41B 2Z0SA 1SE3A 4KK7A 4NXNQ 3F2CA 2FB9A 2DN8A 2KCTA 4JYAQ 4OO1G 1I4GA 4BY1H 2FINB 2ICEC 4DN4M 1AN7A 2VR1A 1SN8A 4LF4Q 4A3KH 2W6PA 2V9WA 1YJ9A 1TY0A 4LNQA 3FPPA 2IT1A 4HIDA 1EWIA 1WTQA 2E5LQ 2ZT9C 5C6AA 1BNCA 1B9NA 1E1OA 5EWGA 2W8KA 1K8AC 2BOSA 4P72A 4ZRZA 2WB1E 2NN6G 1GHKA 3NQIA 2I5MX 2N8NA 1N32Q 1FL0A 1Z2OX 2FPGB 4FBTA 2K28A 1P16A 2BR0A 3FDTA 2FPPB 4L63B 1NR4A 1EYGA 2LXKA 1CZGA 4B9WA 3GIQA 3IN5A 2V4RA 4CJ1B 4DV6H 3KTMA 2NWGA 4GNXC 2IX0A 1TIID 1HQMC 4O2AF 3GTPA 1AE2A 1UNSA 4KTAA 3TS2A 5C0XJ 1G91A 1H95A 1MGSA 2XIWA 3DMUA 3S24A 2BE5C 2B2TA 2NBFA 2I87A 2PN1A 4O3OA 3P20A 3S14H 2XGTA 2IPKD 3NWSA 4HSVA 3TP8A 3WWVA 1Q46A 4FM9A 1DOKA 1CFMA 1JDBB 4UDUC 5KFMA 1WCMG 2X6GA 4M8AA 5IGGA 4IPHA 4AYBG 2JA7H 2HDLA 1TWFA 5CAEB 3MHBA 4IJLA 1DD2A 3CCUA 4L5RC 3Q8RB 1DXMA 2N78A 3KDFB 2B63B 4OX9Q 2EIFA 3BQ0A 4JV5H 1ASYA 3LMLA 5KEEA 1KD1C 1G6PA 3H0GB 1XPOA 4RHRA 2PQAB 1DCZA 3S1QH 4WFN3 3PCOB 4EGVA 2E2IA 5C1OA 1LO5D 2WFWA 2B39A 1BCPC 2MUYA 4LUZA 1VS0A 4RB0A 4DV3H 2WAQG 1VCIA 3M3YH 3TQYA 3PV0A 3FMAA 2FLPA 3M4OB 3BG5A 5KFTA 5EJWA 1Y8NB 1IYJB 3GTLH 1WOCA 1C7YA 2LMCB 2R92A 4DV6Q 3J81j 2NVQH 2K5HA 4LWCA 3HOXH 2TMPA 1GSHA 1GVPA 2PNHA 3CQZA 1RYRA 2NTSA 4QB4A 3RN5A 1IL2A 2R87A 2Z8LA 4HJ7A 4V190 3N43B 3K6OA 4ME6A 4JV1A 2UXCH 4MN3A 1PZJD 2LFNA 3DHQA 3T51B 2F4VQ 2EYFA 2CWAA 2L55A 1Y1WH 2VPQA 4RUAA 2YYAA 4IRKA 4JBWA 5DM73 3H15A 2JA6A 1QG7A 5KT7A 4KD4A 3C46A 3GTPB 2F3VA 2ZJTA 2KHIA 3BYTB 2G9HD 4BWGB 4G7HC 5EPJA 4V0BA 2PW7A 2RDHA 3IAYA 3ER0A 4KV6A 4A93H 2IHEA 1I4RA 2HIVA 3JZIA 4JV0A 4J9LA 5CC4A 1DV1A 4MTNA 3RUZA 4JV5L 1K8GA 4GC7A 1A15A 5A2QL 5KFAA 2KCCA 3PW2A 1AE3A 3EPGA 3STBC 4DR3L 3OMCA 1MZBA 2HD3A 2F0QA 2R8JA 3D8GA 3S1MB 4A4IA 1M90C 2DY8A 4YY3L 1VBGA 5ELCA 4DUYL 2XCAA 4DV3Q 2B3GA 2GLTA 3VYSA 1D1IA 4CKEA 2FXQA 1B6SA 1TWFB 1Z2PX 1PFNA 1NNXA 4A3LH 2W6ZA 4J9QA 1XNQH 2GVAA 3AQQA 1SYEA 2RDGA 2DZDA 2R93A 1IL8A 5KFGA 3KXYT 4L8JA 1K3RA 4JW0A 1JOQA 4OO1H 4NB3A 2E2IB 1S5FD 2B63G 5C3EB 2K05A 1VKZA 5KT3A 3TP6A 2F0VA 2W9AA 4F4YA 2ZDGA 2KENA 4N8X1 1ILPA 3T56B 3H0GG 3U4VA 1JB7A 4ECXA 2K04A 1SFOH 1PVOA 3LP8A 2FJ2A 2R92B 1T5XD 1BJTA 3M4PA 2FK1A 1T5EA 1PMRA 4LAAA 3J81W 4CDCC 4J6HA 4I65A 2F0EA 2NN6H 2NVYB 2XRSD 3MFGA 3GTMH 1U4RA 5LL6b 4KY6A 1SNMA 3CQZB 3QR8A 3FMCA 5IT9W 1JIHA 1GGOA 2IHFA 5LL6S 2DGYA 4A3IB 3TP5A 4MA5A 1YEZA 2F0HA 3AB9A 1STHA 1QVFA 5DG7A 1EY4A 2JQOA 5I6WA 3F8NA 2R8HA 4EYHB 4ECYA 2JA6B 5FLXW 2E75C 4TKOB 1TWGA 2VQEH 3NQTA 2WIIB 3M4IA 1YNJC 2F0NA 2VOBA 1U4MA 3NTKA 3OYYA 1PA6A 3GV5B 3ND8A 4Q8FA 1U9RA 1XNQQ 1A6XA 4EFEA 1NBWA 2X6LA 3GTQH 1KAWA 2V4DA 5HURA 3AMUA 1UEAB 3QOLA 1GO3E 4NXML 4RU9A 2GVBA 5KFSA 4IUVA 2W71A 1IHZA 2J7ZA 1WCMH 2WP8J 4YCUA 1ZKOA 1EYCA 2EYPA 3H94A 4ZUJA 5K5PA 1XJVA 4K6LA 4WBNF 2JEAI 1H9SA 2FMMA 3RJ0A 3W2DA 3T16A 3PW7A 4RA8A 3VYRA 1EL0A 4BA2I 3PVXA 4LFAH 1VQEA 1GXDC 4K5VA 2XCLA 1B8AA 3BYYB 4FP5D 3N6XA 2PO4A 2FHTA 1Y8OB 2ALYB 1LV9A 2Q8RE 2R93B 1EIGA 1KNAA 4K14A 2BA1A 2PZWA 1S5ED 3BVZA 1JWSD 3A7LA 3KK7A 3MA2B 3CCSA 4RNNA 1LTLA 4L5SA 2W9BA 3BQ2A 2VQFH 5A2QE 2PBZA 4DR4L 5AJ3Q 1I50H 3PGZA 2KCNA 4OWXB 2JP1A 4YJ2F 2C35B 1CKNA 1BO0A 3U50C 1QNUA 4RGNA 1KC8C 4BA1I 2VQEQ 1N33L 2J4XA 4OHJA 3SDZA 4ED1A 4XYQA 4PZ6A 2VA3A 5C3EG 3KYHC 4J9MA 1Q7YC 3T5JA 1S9FA 2JSOA 1Z7TA 4LF5L 5IGEA 1RYSA 4JI0H 2VXWA 4PZ7A 3V05A 4RZQA 4DXFA 2W6QA 3KJOA 4CDDC 2B2YC 2EXDA 4I50F 3DEOA 2F0WA 2F1MA 4C3JB 2IBKA 2R92G 4B3SH 4C3HB 3Q8QB 4DR6Q 2J6TA 2EJMA 2XGQA 5LA6F 5CV4A 4UCOA 4DV7H 2Z4HA 1G291 4DV2H 2SOBA 1TT2A 3IKJA 5M5YB 5KFIA 3RV4A 3NWTA 1HTLD 3EJIA 5JUMA 3GIIA 1DM0B 1TWGB 4MV6A 3J81c 1E4EA 4A3IG 3CC4A 5CV6A 5IYDG 4ZCKA 4C5CA 3TRZA 3EBEA 2EDGA 3BS1A 5IT9c 4K8JA 2HGSA 1JOOA 5ELBA 2AUJD 2JA6G 2VW9A 1PZKD 3HB9A
chains in the Genus database with same CATH topology
4LFAQ 2Q2IA 4BY1G 2OWOA 2VQEL 2EQSA 4A3KG 2MO1A 4DR5L 2VS1A 1OXTA 4GOPA 2VL6A 2YU9H 5FLXc 3UDXA 1TXYA 2PQAA 4UP9A 1N8RC 1U0LA 3A5UA 2UXBL 3CCLA 2UXCQ 3A0JA 4K0KQ 3ULJA 2JA5H 4XTCS 4HJ5A 1CSPA 4JBJA 4C3IH 3DM3A 3OW2A 2KCMA 1N9WA 1VQ5A 3HOWG 4OONA 2WAQE 4DV0Q 2ZJQA 5M5WH 4POGA 1VQMA 5HGQA 2HHHQ 3PUWA 3I4MH 1UEBA 1UE6A 3AFPA 4X66L 3CF5A 4B3ML 4JI0Q 5FJ8H 2B63H 4L5QA 2QGQA 1Q81C 4B3SQ 1YVCA 4DK6C 2HQLA 3H0GH 2CQOA 2Z6KA 4P74A 4DV7Q 1IBLL 4DV4L 2N3SA 3RR5A 4DV2Q 4R4TA 1EIYB 1Y14B 2E8GA 4JI2Q 4IO9A 4APVA 2A8VA 2R93G 1YJNA 3A74A 3G6EA 3U4ZA 4A3MH 4DR2Q 2JE6I 1HZBA 5C4JH 3M4OH 4QJFA 4OO1I 4X65L 2QEXA 2VQFL 1IXRA 3PO2H 4LF9L 1HZAA 3PF5A 4NXNL 3MEFA 4QIWE 4JYAL 1UE1A 1AH9A 2YTXA 1EFWA 4QY7A 4DR1Q 4A3BG 1X54A 5K36G 1E1TA 4LF4L 3K81C 2E2HH 2PI2A 2JA7G 4JC0A 2Q2HA 3TS0A 1M1KC 3H3VI 4GOPC 1OXUA 2ATWA 2K52A 2ZTCA 1EOVA 1JT8A 5C4XH 2E5LL 1N33Q 1HZ9A 2NN6I 3S2HH 1HNXL 1VQBA 4PMWA 3PUXA 4LF5Q 1E3PA 1IBKL 1PYBA 3CCVA 3HOVH 3J80i 1VQLA 4GKKQ 1N32L 2AMCB 4WJ3M 1A62A 4YCVA 1Q82C 3EN2A 4TQUS 2UUCQ 3GTPH 4RG1A 3RZDH 5C0XG 3PUVA 4JBKA 4GN4B 3PIOA 3GTKH 5IP9G 4DR2L 5GAEC 3T1HL 5GQOA 3KLWA 2AWNA 4UP7A 1QZHA 1X3GA 3S16H 3PIPA 1SLJA 4C3HH 3F2BA 3CCJA 4GOPB 1HR0Q 4DR7Q 2Y0SG 3HOXG 3KFUA 3KF8B 1VQPA 4GLVB 3GTJH 1EQRA 3E0EA 3W1BA 3G71A 1K73C 1Q8KA 2Z6KC 4DR1L 4KLKA 1GKHA 2ZTEA 4A3JG 3OTOL 1VQIA 2K50A 4BY7H 2XTIA 3J7A5 3F8TA 3S1MH 1LM0A 4YCWA 3JAMi 1JE5A 1VQAA 2OTJA 3AYHB 1Y1WG 4DR5Q 3GTOH 4JI8L 5LMNQ 4HIMA 3I4NG 1IZ6A 1TWFH 2VZAA 4HJAA 3K8AA 2N49A 2QA4A 1PH7A 5IWAL 4RMFA 2ZJPA 2VUMH 4ME3A 4A3FG 1Q86C 3HKZG 4X64L 1MJCA 1YIJA 1XMQL 2UXBQ 4POFA 1YBYA 2A1AA 2RHQB 1QVGA 1J5EL 4KHPL 1FGUA 1PH6A 1K0RA 4AH6A 4A93G 2ZM6L 1WI5A 4IJHA 1SE8A 4OX9L 2RHSB 2E2IH 3CPFA 2JA8G 4P73A 1KL9A 1LYLA 5C3EH 2CCZA 1Y1VH 3M9BA 3CMAA 4XIGS 2D62A 3BZKA 4JI4L 4X66Q 1EIFA 2ZTDA 3TEHB 4GNXA 4BXXH 2R92H 4UPAA 4GN3B 4JI3L 1QUQA 3CCRA 3CCMA 1YHBA 3NENA 1K9MC 3HOZH 5IYBH 4X6AH 2YTVA 3UDIA 2OQ0A 2ES2A 2NVYH 5EAYA 3KDFA 1IBLQ 4DV4Q 1PHJA 2LXJA 4A3GG 3CQZH 4DV6L 4IFDI 3RLOA 5C44H 2F52A 1N34L 1L0WA 4A3LG 5LMNL 4UY8C 3BJUA 3BU2A 4A3IH 4LUOA 1S40A 4OWTB 5IYDH 3FKIG 4X65Q 3CMEA 1UE5A 2VQFQ 2ASBA 3S15H 4LF9Q 2Z0SA 1WJJA 4NXNQ 2JA6H 3F2CA 2VY3A 2KCTA 4JYAQ 2AHOB 1NE3A 4OO1G 2PI2E 4BY1H 1MIUA 2F4VL 1SN8A 3I55A 1OXSC 3EIVA 3KJPA 4A3KH 4LF4Q 1PH9A 3K7UC 1YJ9A 4LNQA 3M85A 2IT1A 3L0OA 4KI0A 1SMXA 4HIDA 1XNRQ 1EWIA 2E5LQ 4DAYB 3CPWA 2JJQA 4NPSA 1I94L 3I7FA 3CP0A 1E1OA 3GD7A 1V43A 1E24A 3PSIA 4DV1L 1K8AC 1HNXQ 3HOUG 4P72A 1IBKQ 4JOIC 5IP7G 2WB1E 2NN6G 5E7NA 3HOWH 2I5MX 2N8NA 4UP8A 1FL0A 1XPRA 1N32Q 1P16A 1Q1BA 1X65A 4JI1L 5IY0A 4LFCQ 1EYGA 3HKSA 1CKNB 2LXKA 2OQKA 3AEVA 2NZHA 2UU9L 3T1HQ 2D0OA 4A3CG 1HR0W 2CKZB 3MXNB 2IX0A 3J80c 4GNXC 3PO3G 5GADC 1KQSA 1AE2A 3D31A 3TS2A 2DUDA 1YHAA 2V1CC 5C0XJ 1PH3A 4H02A 1D8LA 1CUKA 1H95A 4DV3L 1PH2A 4BBSG 1L1OA 3S24A 1PH8A 3OTOQ 2R93H 4HJ9A 1JMCA 5BR8L 4DAMA 4QL5A 4HJ8A 3AFQA 5M3FG 3S14H 2XGTA 1MKHA 1XNRL 2UXDQ 4YWMA 4BBRG 3NBHB 3NEMA 2E2JH 2R7ZG 5LMNW 4JI8Q 4GS3A 3WWVA 1Q46A 3ULLA 4LFBL 3J7ZC 4P75A 5IWAQ 2Q2UA 1HH2P 4A3BH 4P71A 2R7DA 4LUVA 1WCMG 1W3SA 4LW1A 1X56A 3SGIA 3JAMc 4GNXB 4IPHA 3FHWA 4X64Q 1X3FA 4AYBG 2VW9A 4A3EG 1XMQQ 4TVAB 2JA7H 3S2DH 3W5OA 4LFCL 4WJ4A 1N36L 4IJLA 1S3OA 4JCVE 3CCUA 1J5EQ 4L5RC 4KHPQ 4IFDJ 1NMFA 2N78A 2ZM6Q 3KDFB 1L2FA 2JA9A 4OX9Q 3G4SA 4JI5L 2EIFA 5M3MG 3GO5A 4C3JH 3DLLA 1ASYA 3CD6A 4Y7NH 2HT1A 1KD1C 1C9OA 1G6PA 1PH1A 1VQGA 4DKAC 4JI4Q 1WYDA 1XPOA 1VQ9A 2PQAB 3RZOH 3S1QH 3PCOB 3NELA 4YWLA 2WFWA 5M5YH 5FLMG 4LUZA 1VS0A 4JI3Q 2WAQG 1VCIA 3M3YH 4LF8L 1TWGH 1Z9FA 3PV0A 1KRTA 3TQYA 1GM5A 4LF7L 5IP9H 1I6HH 3GTLH 1IYJB 5GROA 1WOCA 2UXDL 1C7YA 4A3DG 4DV6Q 3J81j 1W2BA 2NVQH 4JV5Q 1N34Q 2K5HA 4LWCA 3HOXH 3HFZB 4AQYL 1O7IA 2B29A 3S1NH 1WFQA 1I3QH 4IFDG 1OTCA 1GVPA 2PNHA 1L1OC 5DLQE 4EX5A 4JBMA 4A3JH 3TREA 4DNIA 3RN5A 1VQOA 4OWWB 1IL2A 2CFMA 4DUYQ 3PUZA 2KHJA 5IYCG 4HJ7A 4C2MH 1JJ2A 1XNQL 2F4VQ 1Y1WH 2CWAA 1BKBA 4DUZL 4B3TL 3RN2A 1CKMA 3HOYG 3M4QA 4JBWA 3H15A 2K5VA 3I4NH 4ALPA 5JEAG 1PH4A 4A3FH 3KF6A 3F1ZA 1VQKA 3UE0A 4IPGA 2KHIA 4A75A 1I94Q 4JI6L 5JJKA 1V9PA 4DV1Q 1I5FA 3K80C 1YJWA 1IBML 3ER0A 1PFSA 2OTLA 2IHEA 4A93H 2HIVA 1L1OB 1VQFA 4YHHL 1QZGA 1X3EA 3I56A 4JG2A 1XMOL 2JA8H 3LGJA 4JI1Q 4MTNA 1DGSA 2NZOA 3Q8DA 1K8GA 3B6YA 4JV5L 3IRBA 1VQHA 2I5HA 1HNWL 1AE3A 1GD7A 2RF4A 3STBC 2MNAA 4DR3L 2UU9Q 1C0AA 3VDYA 2MFIA 2BH8A 2MO0A 1FJGL 4O2DA 4A4IA 1M90C 1A8VA 5IE8A 4YY3L 3S1RH 4JI7L 4MZ9A 4DUYL 3E9IA 4DV3Q 2I5LX 2B3GA 2FXQA 3ICEA 4A3GH 4GKJL 2ZJRA 2JA5G 3CCEA 1FVIA 4A3LH 4IPDA 5BR8Q 3FP9A 2D0PA 4DV5L 2GVAA 4HIKA 1TWAH 3AQQA 3E9HA 4IPCA 1A63A 3I2ZA 3FKIH 1KIXA 2YYZA 1Z47A 1VQCA 4HIOA 4O0AA 4X62L 4KHZA 3I4MG 1K3RA 4LFBQ 2NVTH 5LMUL 1PV4A 2Y0SE 3K0XA 4NB3A 1B7YB 5FJ8G 2UUAL 2B63G 2IY5B 3CW2C 1NMGA 3J81i 4DR6L 1BBUA 3L2PA 1V1QA 2K14A 3F2DA 3M7NA 4LF6Q 2KENA 1N36Q 3RLFA 3H0GG 3U4VA 1JB7A 2UUBL 2AKWB 3RNUA 1VQNA 1SFOH 1PVOA 3H3VH 4JI5Q 3RLNA 1VQ6A 4NXMQ 3M4PA 4R1JA 1TWHH 3HOUH 1LUZA 4A3MG 1R9TH 1X9NA 5IP7H 4IOAA 3GTMH 3I4OA 1E7ZA 1G51A 2GN5A 2MQHA 3CC2A 3T1YL 3PO2G 2IHFA 2R6GA 3HKZE 3ERSX 5J3BA 5HY6A 3U58A 2DGYA 3KOJA 1BVSA 4LF8Q 4LFAL 2K5NA 2VNUD 1YEZA 4LF7Q 2OCEA 2I0QA 4A3CH 5JJIA 1QVFA 4DK3C 1OXVA 1RIPA 5ELOA 5JJLA 2JQOA 3JC66 1YHQA 3PO3H 1KRSA 2CWPA 1VQ4A 4AQYQ 1SR3A 3KF6B 5C4XG 4YWKA 2AWOA 4BBSH 1YITA 4GLAC 2UXCL 1UWVA 1UE7A 4K0KL 1EQQA 2PMZE 1QUQB 3OYYA 4QQBX 3K7AH 1PA6A 4LF6L 3A5ZB 5M3FH 1NJIC 3HOVG 2YTYA 1XNQQ 4DR4Q 3GDEA 1NBWA 3GTQH 4BBRH 4DV0L 1KAWA 1SROA 2R7ZH 4DUZQ 4B3TQ 1YI2A 1GO3E 4NXML 2HHHL 1JJCB 2GVBA 3PUYA 3W1GA 1X55A 4JI0L 1WCMH 2WP8J 4FDBA 1KXLA 4YCUA 1X6OA 3UDGA 4Y52H 1TWCH 3STBD 4A3EH 2Q2TA 4JI6Q 1XJVA 1XPUA 2ID0A 2H5XA 4B3SL 5GAGC 1NY4A 2JEAI 1IBMQ 5JEAJ 3BZCA 4B3RL 2LSSA 4DV7L 4IOCA 2BA0A 4EQ5A 1SRUA 4YHHQ 2K4KA 1VQDA 1EUJA 4GN5A 1A0IA 1Q1EA 4DV2L 5M3MH 1XMOQ 1S72A 4JI2L 3UE1A 2JK8A 4R4IA 4BA2I 4BY7G 1VQEA 1PYSB 1HNWQ 3ZJYC 1HNZQ 1B8AA 4GLXA 2F3IA 4DR3Q 1XTDA 2ALYB 4J15A 4MNOA 3PF4A 1VQJA 1YZ6A 2RCNA 1NTGA 2WB1G 2BA1A 1FJGQ 3CCQA 5FLMH 4YY3Q 1VQ8A 2NVXH 4JI7Q 3CCSA 2VUMG 1LTLA 4L5SA 1ASZA 2HIXA 4DR4L 1YNXA 5AJ3Q 1T9HA 1OXXK 2BH2A 1I50H 3PGZA 4A3DH 3CXCA 5GAHC 1PH5A 2YV5A 1E22A 4OWXB 4GKJQ 1CSQA 4B3RQ 4PG3A 2C35B 3UDFA 1CKNA 3ULPA 4DV5Q 1MJEA 3U50C 4OXPA 1KC8C 4QGUA 4BA1I 2VQEQ 1N33L 4DPGA 4PZ6A 5C3EG 3KYHC 1BBWA 1Y1VG 1Q7YC 4LF5L 1D7QA 5IYCH 1K83H 1P8LA 4PZ7A 4X62Q 5H1SE 3KJOA 5C0XI 5LMUQ 2EXDA 4GKKL 2KBNA 2A19A 2R7FA 2UUAQ 2UUCL 2K75A 2R92G 4BXXG 1Q12A 3HOYH 4DR6Q 4R4QA 3HOZG 1JJGA 4JOIA 5M5XH 5IYBG 1HJPA 3CC7A 1G291 3CAMA 1HNZL 4AIMA 4A76A 2UUBQ 1HR0L 5C44G 4DR7L 3L7ZC 5ELNA 1CKOA 1KHIA 2JEBI 1B70B 1VQ7A 3GTGH 2IX1A 4L5TA 1HZCA 1J6QA 4PZ8A 3J81c 4A3IG 4B3MQ 3CC4A 3S17H 2L15A 1U5KA 5IYDG 3TRZA 3EBEA 5AJ3L 4R4OA 5IT9c 1RL2A 3T1YQ 1QVCA 2JA6G 3G48A 3D0FA 4R4CA 4AYBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA Q;  2Q2I A;  4BY1 G;  2OWO A;  2VQE L;  2EQS A;  4A3K G;  2MO1 A;  4DR5 L;  2VS1 A;  1OXT A;  4GOP A;  2VL6 A;  2YU9 H;  5FLX c;  3UDX A;  1TXY A;  2PQA A;  4UP9 A;  1N8R C;  1U0L A;  3A5U A;  2UXB L;  3CCL A;  2UXC Q;  3A0J A;  4K0K Q;  3ULJ A;  2JA5 H;  4XTC S;  4HJ5 A;  1CSP A;  4JBJ A;  4C3I H;  3DM3 A;  3OW2 A;  2KCM A;  1N9W A;  1VQ5 A;  3HOW G;  4OON A;  2WAQ E;  4DV0 Q;  2ZJQ A;  5M5W H;  4POG A;  1VQM A;  5HGQ A;  2HHH Q;  3PUW A;  3I4M H;  1UEB A;  1UE6 A;  3AFP A;  4X66 L;  3CF5 A;  4B3M L;  4JI0 Q;  5FJ8 H;  2B63 H;  4L5Q A;  2QGQ A;  1Q81 C;  4B3S Q;  1YVC A;  4DK6 C;  2HQL A;  3H0G H;  2CQO A;  2Z6K A;  4P74 A;  4DV7 Q;  1IBL L;  4DV4 L;  2N3S A;  3RR5 A;  4DV2 Q;  4R4T A;  1EIY B;  1Y14 B;  2E8G A;  4JI2 Q;  4IO9 A;  4APV A;  2A8V A;  2R93 G;  1YJN A;  3A74 A;  3G6E A;  3U4Z A;  4A3M H;  4DR2 Q;  2JE6 I;  1HZB A;  5C4J H;  3M4O H;  4QJF A;  4OO1 I;  4X65 L;  2QEX A;  2VQF L;  1IXR A;  3PO2 H;  4LF9 L;  1HZA A;  3PF5 A;  4NXN L;  3MEF A;  4QIW E;  4JYA L;  1UE1 A;  1AH9 A;  2YTX A;  1EFW A;  4QY7 A;  4DR1 Q;  4A3B G;  1X54 A;  5K36 G;  1E1T A;  4LF4 L;  3K81 C;  2E2H H;  2PI2 A;  2JA7 G;  4JC0 A;  2Q2H A;  3TS0 A;  1M1K C;  3H3V I;  4GOP C;  1OXU A;  2ATW A;  2K52 A;  2ZTC A;  1EOV A;  1JT8 A;  5C4X H;  2E5L L;  1N33 Q;  1HZ9 A;  2NN6 I;  3S2H H;  1HNX L;  1VQB A;  4PMW A;  3PUX A;  4LF5 Q;  1E3P A;  1IBK L;  1PYB A;  3CCV A;  3HOV H;  3J80 i;  1VQL A;  4GKK Q;  1N32 L;  2AMC B;  4WJ3 M;  1A62 A;  4YCV A;  1Q82 C;  3EN2 A;  4TQU S;  2UUC Q;  3GTP H;  4RG1 A;  3RZD H;  5C0X G;  3PUV A;  4JBK A;  4GN4 B;  3PIO A;  3GTK H;  5IP9 G;  4DR2 L;  5GAE C;  3T1H L;  5GQO A;  3KLW A;  2AWN A;  4UP7 A;  1QZH A;  1X3G A;  3S16 H;  3PIP A;  1SLJ A;  4C3H H;  3F2B A;  3CCJ A;  4GOP B;  1HR0 Q;  4DR7 Q;  2Y0S G;  3HOX G;  3KFU A;  3KF8 B;  1VQP A;  4GLV B;  3GTJ H;  1EQR A;  3E0E A;  3W1B A;  3G71 A;  1K73 C;  1Q8K A;  2Z6K C;  4DR1 L;  4KLK A;  1GKH A;  2ZTE A;  4A3J G;  3OTO L;  1VQI A;  2K50 A;  4BY7 H;  2XTI A;  3J7A 5;  3F8T A;  3S1M H;  1LM0 A;  4YCW A;  3JAM i;  1JE5 A;  1VQA A;  2OTJ A;  3AYH B;  1Y1W G;  4DR5 Q;  3GTO H;  4JI8 L;  5LMN Q;  4HIM A;  3I4N G;  1IZ6 A;  1TWF H;  2VZA A;  4HJA A;  3K8A A;  2N49 A;  2QA4 A;  1PH7 A;  5IWA L;  4RMF A;  2ZJP A;  2VUM H;  4ME3 A;  4A3F G;  1Q86 C;  3HKZ G;  4X64 L;  1MJC A;  1YIJ A;  1XMQ L;  2UXB Q;  4POF A;  1YBY A;  2A1A A;  2RHQ B;  1QVG A;  1J5E L;  4KHP L;  1FGU A;  1PH6 A;  1K0R A;  4AH6 A;  4A93 G;  2ZM6 L;  1WI5 A;  4IJH A;  1SE8 A;  4OX9 L;  2RHS B;  2E2I H;  3CPF A;  2JA8 G;  4P73 A;  1KL9 A;  1LYL A;  5C3E H;  2CCZ A;  1Y1V H;  3M9B A;  3CMA A;  4XIG S;  2D62 A;  3BZK A;  4JI4 L;  4X66 Q;  1EIF A;  2ZTD A;  3TEH B;  4GNX A;  4BXX H;  2R92 H;  4UPA A;  4GN3 B;  4JI3 L;  1QUQ A;  3CCR A;  3CCM A;  1YHB A;  3NEN A;  1K9M C;  3HOZ H;  5IYB H;  4X6A H;  2YTV A;  3UDI A;  2OQ0 A;  2ES2 A;  2NVY H;  5EAY A;  3KDF A;  1IBL Q;  4DV4 Q;  1PHJ A;  2LXJ A;  4A3G G;  3CQZ H;  4DV6 L;  4IFD I;  3RLO A;  5C44 H;  2F52 A;  1N34 L;  1L0W A;  4A3L G;  5LMN L;  4UY8 C;  3BJU A;  3BU2 A;  4A3I H;  4LUO A;  1S40 A;  4OWT B;  5IYD H;  3FKI G;  4X65 Q;  3CME A;  1UE5 A;  2VQF Q;  2ASB A;  3S15 H;  4LF9 Q;  2Z0S A;  1WJJ A;  4NXN Q;  2JA6 H;  3F2C A;  2VY3 A;  2KCT A;  4JYA Q;  2AHO B;  1NE3 A;  4OO1 G;  2PI2 E;  4BY1 H;  1MIU A;  2F4V L;  1SN8 A;  3I55 A;  1OXS C;  3EIV A;  3KJP A;  4A3K H;  4LF4 Q;  1PH9 A;  3K7U C;  1YJ9 A;  4LNQ A;  3M85 A;  2IT1 A;  3L0O A;  4KI0 A;  1SMX A;  4HID A;  1XNR Q;  1EWI A;  2E5L Q;  4DAY B;  3CPW A;  2JJQ A;  4NPS A;  1I94 L;  3I7F A;  3CP0 A;  1E1O A;  3GD7 A;  1V43 A;  1E24 A;  3PSI A;  4DV1 L;  1K8A C;  1HNX Q;  3HOU G;  4P72 A;  1IBK Q;  4JOI C;  5IP7 G;  2WB1 E;  2NN6 G;  5E7N A;  3HOW H;  2I5M X;  2N8N A;  4UP8 A;  1FL0 A;  1XPR A;  1N32 Q;  1P16 A;  1Q1B A;  1X65 A;  4JI1 L;  5IY0 A;  4LFC Q;  1EYG A;  3HKS A;  1CKN B;  2LXK A;  2OQK A;  3AEV A;  2NZH A;  2UU9 L;  3T1H Q;  2D0O A;  4A3C G;  1HR0 W;  2CKZ B;  3MXN B;  2IX0 A;  3J80 c;  4GNX C;  3PO3 G;  5GAD C;  1KQS A;  1AE2 A;  3D31 A;  3TS2 A;  2DUD A;  1YHA A;  2V1C C;  5C0X J;  1PH3 A;  4H02 A;  1D8L A;  1CUK A;  1H95 A;  4DV3 L;  1PH2 A;  4BBS G;  1L1O A;  3S24 A;  1PH8 A;  3OTO Q;  2R93 H;  4HJ9 A;  1JMC A;  5BR8 L;  4DAM A;  4QL5 A;  4HJ8 A;  3AFQ A;  5M3F G;  3S14 H;  2XGT A;  1MKH A;  1XNR L;  2UXD Q;  4YWM A;  4BBR G;  3NBH B;  3NEM A;  2E2J H;  2R7Z G;  5LMN W;  4JI8 Q;  4GS3 A;  3WWV A;  1Q46 A;  3ULL A;  4LFB L;  3J7Z C;  4P75 A;  5IWA Q;  2Q2U A;  1HH2 P;  4A3B H;  4P71 A;  2R7D A;  4LUV A;  1WCM G;  1W3S A;  4LW1 A;  1X56 A;  3SGI A;  3JAM c;  4GNX B;  4IPH A;  3FHW A;  4X64 Q;  1X3F A;  4AYB G;  2VW9 A;  4A3E G;  1XMQ Q;  4TVA B;  2JA7 H;  3S2D H;  3W5O A;  4LFC L;  4WJ4 A;  1N36 L;  4IJL A;  1S3O A;  4JCV E;  3CCU A;  1J5E Q;  4L5R C;  4KHP Q;  4IFD J;  1NMF A;  2N78 A;  2ZM6 Q;  3KDF B;  1L2F A;  2JA9 A;  4OX9 Q;  3G4S A;  4JI5 L;  2EIF A;  5M3M G;  3GO5 A;  4C3J H;  3DLL A;  1ASY A;  3CD6 A;  4Y7N H;  2HT1 A;  1KD1 C;  1C9O A;  1G6P A;  1PH1 A;  1VQG A;  4DKA C;  4JI4 Q;  1WYD A;  1XPO A;  1VQ9 A;  2PQA B;  3RZO H;  3S1Q H;  3PCO B;  3NEL A;  4YWL A;  2WFW A;  5M5Y H;  5FLM G;  4LUZ A;  1VS0 A;  4JI3 Q;  2WAQ G;  1VCI A;  3M3Y H;  4LF8 L;  1TWG H;  1Z9F A;  3PV0 A;  1KRT A;  3TQY A;  1GM5 A;  4LF7 L;  5IP9 H;  1I6H H;  3GTL H;  1IYJ B;  5GRO A;  1WOC A;  2UXD L;  1C7Y A;  4A3D G;  4DV6 Q;  3J81 j;  1W2B A;  2NVQ H;  4JV5 Q;  1N34 Q;  2K5H A;  4LWC A;  3HOX H;  3HFZ B;  4AQY L;  1O7I A;  2B29 A;  3S1N H;  1WFQ A;  1I3Q H;  4IFD G;  1OTC A;  1GVP A;  2PNH A;  1L1O C;  5DLQ E;  4EX5 A;  4JBM A;  4A3J H;  3TRE A;  4DNI A;  3RN5 A;  1VQO A;  4OWW B;  1IL2 A;  2CFM A;  4DUY Q;  3PUZ A;  2KHJ A;  5IYC G;  4HJ7 A;  4C2M H;  1JJ2 A;  1XNQ L;  2F4V Q;  1Y1W H;  2CWA A;  1BKB A;  4DUZ L;  4B3T L;  3RN2 A;  1CKM A;  3HOY G;  3M4Q A;  4JBW A;  3H15 A;  2K5V A;  3I4N H;  4ALP A;  5JEA G;  1PH4 A;  4A3F H;  3KF6 A;  3F1Z A;  1VQK A;  3UE0 A;  4IPG A;  2KHI A;  4A75 A;  1I94 Q;  4JI6 L;  5JJK A;  1V9P A;  4DV1 Q;  1I5F A;  3K80 C;  1YJW A;  1IBM L;  3ER0 A;  1PFS A;  2OTL A;  2IHE A;  4A93 H;  2HIV A;  1L1O B;  1VQF A;  4YHH L;  1QZG A;  1X3E A;  3I56 A;  4JG2 A;  1XMO L;  2JA8 H;  3LGJ A;  4JI1 Q;  4MTN A;  1DGS A;  2NZO A;  3Q8D A;  1K8G A;  3B6Y A;  4JV5 L;  3IRB A;  1VQH A;  2I5H A;  1HNW L;  1AE3 A;  1GD7 A;  2RF4 A;  3STB C;  2MNA A;  4DR3 L;  2UU9 Q;  1C0A A;  3VDY A;  2MFI A;  2BH8 A;  2MO0 A;  1FJG L;  4O2D A;  4A4I A;  1M90 C;  1A8V A;  5IE8 A;  4YY3 L;  3S1R H;  4JI7 L;  4MZ9 A;  4DUY L;  3E9I A;  4DV3 Q;  2I5L X;  2B3G A;  2FXQ A;  3ICE A;  4A3G H;  4GKJ L;  2ZJR A;  2JA5 G;  3CCE A;  1FVI A;  4A3L H;  4IPD A;  5BR8 Q;  3FP9 A;  2D0P A;  4DV5 L;  2GVA A;  4HIK A;  1TWA H;  3AQQ A;  3E9H A;  4IPC A;  1A63 A;  3I2Z A;  3FKI H;  1KIX A;  2YYZ A;  1Z47 A;  1VQC A;  4HIO A;  4O0A A;  4X62 L;  4KHZ A;  3I4M G;  1K3R A;  4LFB Q;  2NVT H;  5LMU L;  1PV4 A;  2Y0S E;  3K0X A;  4NB3 A;  1B7Y B;  5FJ8 G;  2UUA L;  2B63 G;  2IY5 B;  3CW2 C;  1NMG A;  3J81 i;  4DR6 L;  1BBU A;  3L2P A;  1V1Q A;  2K14 A;  3F2D A;  3M7N A;  4LF6 Q;  2KEN A;  1N36 Q;  3RLF A;  3H0G G;  3U4V A;  1JB7 A;  2UUB L;  2AKW B;  3RNU A;  1VQN A;  1SFO H;  1PVO A;  3H3V H;  4JI5 Q;  3RLN A;  1VQ6 A;  4NXM Q;  3M4P A;  4R1J A;  1TWH H;  3HOU H;  1LUZ A;  4A3M G;  1R9T H;  1X9N A;  5IP7 H;  4IOA A;  3GTM H;  3I4O A;  1E7Z A;  1G51 A;  2GN5 A;  2MQH A;  3CC2 A;  3T1Y L;  3PO2 G;  2IHF A;  2R6G A;  3HKZ E;  3ERS X;  5J3B A;  5HY6 A;  3U58 A;  2DGY A;  3KOJ A;  1BVS A;  4LF8 Q;  4LFA L;  2K5N A;  2VNU D;  1YEZ A;  4LF7 Q;  2OCE A;  2I0Q A;  4A3C H;  5JJI A;  1QVF A;  4DK3 C;  1OXV A;  1RIP A;  5ELO A;  5JJL A;  2JQO A;  3JC6 6;  1YHQ A;  3PO3 H;  1KRS A;  2CWP A;  1VQ4 A;  4AQY Q;  1SR3 A;  3KF6 B;  5C4X G;  4YWK A;  2AWO A;  4BBS H;  1YIT A;  4GLA C;  2UXC L;  1UWV A;  1UE7 A;  4K0K L;  1EQQ A;  2PMZ E;  1QUQ B;  3OYY A;  4QQB X;  3K7A H;  1PA6 A;  4LF6 L;  3A5Z B;  5M3F H;  1NJI C;  3HOV G;  2YTY A;  1XNQ Q;  4DR4 Q;  3GDE A;  1NBW A;  3GTQ H;  4BBR H;  4DV0 L;  1KAW A;  1SRO A;  2R7Z H;  4DUZ Q;  4B3T Q;  1YI2 A;  1GO3 E;  4NXM L;  2HHH L;  1JJC B;  2GVB A;  3PUY A;  3W1G A;  1X55 A;  4JI0 L;  1WCM H;  2WP8 J;  4FDB A;  1KXL A;  4YCU A;  1X6O A;  3UDG A;  4Y52 H;  1TWC H;  3STB D;  4A3E H;  2Q2T A;  4JI6 Q;  1XJV A;  1XPU A;  2ID0 A;  2H5X A;  4B3S L;  5GAG C;  1NY4 A;  2JEA I;  1IBM Q;  5JEA J;  3BZC A;  4B3R L;  2LSS A;  4DV7 L;  4IOC A;  2BA0 A;  4EQ5 A;  1SRU A;  4YHH Q;  2K4K A;  1VQD A;  1EUJ A;  4GN5 A;  1A0I A;  1Q1E A;  4DV2 L;  5M3M H;  1XMO Q;  1S72 A;  4JI2 L;  3UE1 A;  2JK8 A;  4R4I A;  4BA2 I;  4BY7 G;  1VQE A;  1PYS B;  1HNW Q;  3ZJY C;  1HNZ Q;  1B8A A;  4GLX A;  2F3I A;  4DR3 Q;  1XTD A;  2ALY B;  4J15 A;  4MNO A;  3PF4 A;  1VQJ A;  1YZ6 A;  2RCN A;  1NTG A;  2WB1 G;  2BA1 A;  1FJG Q;  3CCQ A;  5FLM H;  4YY3 Q;  1VQ8 A;  2NVX H;  4JI7 Q;  3CCS A;  2VUM G;  1LTL A;  4L5S A;  1ASZ A;  2HIX A;  4DR4 L;  1YNX A;  5AJ3 Q;  1T9H A;  1OXX K;  2BH2 A;  1I50 H;  3PGZ A;  4A3D H;  3CXC A;  5GAH C;  1PH5 A;  2YV5 A;  1E22 A;  4OWX B;  4GKJ Q;  1CSQ A;  4B3R Q;  4PG3 A;  2C35 B;  3UDF A;  1CKN A;  3ULP A;  4DV5 Q;  1MJE A;  3U50 C;  4OXP A;  1KC8 C;  4QGU A;  4BA1 I;  2VQE Q;  1N33 L;  4DPG A;  4PZ6 A;  5C3E G;  3KYH C;  1BBW A;  1Y1V G;  1Q7Y C;  4LF5 L;  1D7Q A;  5IYC H;  1K83 H;  1P8L A;  4PZ7 A;  4X62 Q;  5H1S E;  3KJO A;  5C0X I;  5LMU Q;  2EXD A;  4GKK L;  2KBN A;  2A19 A;  2R7F A;  2UUA Q;  2UUC L;  2K75 A;  2R92 G;  4BXX G;  1Q12 A;  3HOY H;  4DR6 Q;  4R4Q A;  3HOZ G;  1JJG A;  4JOI A;  5M5X H;  5IYB G;  1HJP A;  3CC7 A;  1G29 1;  3CAM A;  1HNZ L;  4AIM A;  4A76 A;  2UUB Q;  1HR0 L;  5C44 G;  4DR7 L;  3L7Z C;  5ELN A;  1CKO A;  1KHI A;  2JEB I;  1B70 B;  1VQ7 A;  3GTG H;  2IX1 A;  4L5T A;  1HZC A;  1J6Q A;  4PZ8 A;  3J81 c;  4A3I G;  4B3M Q;  3CC4 A;  3S17 H;  2L15 A;  1U5K A;  5IYD G;  3TRZ A;  3EBE A;  5AJ3 L;  4R4O A;  5IT9 c;  1RL2 A;  3T1Y Q;  1QVC A;  2JA6 G;  3G48 A;  3D0F A;  4R4C A;  4AYB E; 
#chains in the Genus database with same CATH topology
 4LFA Q;  5KRU A;  2Q2I A;  4EBE A;  5DGA A;  4N8F A;  4A3J B;  4ED6 A;  1JX4 A;  1SSO A;  1EYD A;  1EY9 A;  1BOS A;  2VS1 A;  2SDF A;  1V51 A;  1OXT A;  2VUG A;  2VL6 A;  3GQC A;  1EY8 A;  5FLX c;  4WRD A;  2VB2 X;  1QB5 D;  2XWB B;  1F9Q A;  1VBH A;  3A8I E;  1TS5 A;  1F9S A;  1RCV D;  2WKC A;  4GKK H;  4RHS A;  3RAX A;  3J7A K;  2UUC H;  4OIK A;  1LT3 D;  1Y8P B;  4POG A;  1B04 A;  3GIM A;  1CHQ D;  4ETS A;  3PUW A;  4B3M L;  4X66 L;  2WV6 D;  4JI0 Q;  1HR0 H;  1F9P A;  2R7Z A;  2B63 H;  4EQO A;  3SK6 A;  2E76 C;  1WTO A;  2QGQ A;  1Q81 C;  4B3S Q;  5KFQ A;  3H0G H;  4P74 A;  3M4Y A;  5I2Y A;  4DV7 Q;  1IBL L;  3Q2O A;  4TSS A;  4DV2 Q;  4R4T A;  2A8V A;  1Y14 B;  1Y69 U;  2R93 G;  4IO9 A;  4APV A;  3S1R B;  3A74 A;  2R7M A;  2JN4 A;  5C4J H;  1RD9 D;  1JKJ B;  5FPR A;  1U4P A;  3M4O H;  4OO1 I;  2JYO A;  3H40 A;  2ICI A;  4FXD A;  3RGZ A;  1HZA A;  4RNO A;  3A56 A;  1UE1 A;  4LMQ D;  4QY7 A;  3K81 C;  4KJN A;  2W6N A;  5LP6 F;  2PI2 A;  2K5W A;  4JC0 A;  4X3S A;  3TZD A;  2M2L A;  2K6A A;  4ZKC B;  1JT8 A;  3RAQ A;  3VR2 A;  1YNN D;  2A69 D;  5KFZ A;  1UC9 A;  3MAQ A;  1NSN S;  5JVD F;  2NN6 I;  1LTT D;  4IAJ A;  4HNV A;  1H9K A;  4C3J G;  3EPI A;  2CVR A;  3ITP A;  1VQB A;  5DNF A;  1IBK L;  3CCV A;  2EY1 A;  1HA5 A;  4GKK Q;  2AMC B;  5CYU A;  4YCV A;  1B53 A;  2HCC A;  2UUC Q;  3NPP A;  3GTP H;  1E4E B;  2FP4 B;  5K2M A;  3ZYY X;  3MXG A;  3PR5 B;  2JEI A;  5IP9 G;  4DV4 H;  3H91 A;  3T1H L;  5DAU A;  1QZH A;  3J80 W;  3C0F B;  1TR5 A;  5JAV A;  3F2B A;  1HR0 Q;  2C28 A;  3KFU A;  4EBD A;  1LT5 D;  2I07 B;  3G71 A;  3W1B A;  3KLS A;  4DR1 L;  3NE5 B;  4LF9 H;  2ZTE A;  3PO3 B;  4A3J G;  3A8J E;  1VQI A;  2K50 A;  1HCZ A;  3S1M H;  1W96 A;  5D8D A;  4YCW A;  1Z6H A;  3AYH B;  3K5O A;  5KYI A;  1G2S A;  4XX0 B;  3MWE A;  4JI8 L;  2RSN A;  2LKV A;  1TWF H;  4HED A;  2SCU B;  2ZJP A;  5IIF A;  1T3N A;  4ME3 A;  1Q86 C;  1QIL A;  1FD7 D;  2R7Z B;  4X64 L;  1MJC A;  3CHB D;  3TP7 A;  2RHQ B;  4XQN A;  4S3S A;  4HMI A;  1K0R A;  4AH6 A;  5IGD A;  2ZM6 L;  2RHS B;  2E2I H;  4A3E B;  5C3E H;  3E3X A;  4G3I A;  3HGB A;  1X3P A;  2XNA C;  3NXW A;  3KHL A;  3D3R A;  1QE6 A;  2B2W C;  1II3 A;  3TME A;  3R5H A;  5M3M B;  2R92 H;  1SNP A;  1E2Z A;  2FMA A;  1HRJ A;  2JEF A;  3UDI A;  3OTO H;  2NVY H;  1I6V C;  4DV4 Q;  3CQZ H;  4KKT A;  3VR4 A;  2EPB A;  5I9O A;  2F52 A;  5EPK A;  5T14 A;  4YR0 A;  5KG0 A;  5TSS A;  5JVG 3;  4NLG A;  4RAZ A;  4A3I H;  2M05 A;  4LUO A;  1S40 A;  1GHJ A;  5IYD H;  2ALZ A;  3CME A;  2DNC A;  1UE5 A;  4LF9 Q;  2V5A A;  2JA6 H;  2PI2 E;  4B9X A;  1MIU A;  1XMQ H;  3KBX A;  1JCK B;  4CC6 A;  1PH9 A;  1HUN A;  1J5E H;  2EJF C;  3K7U C;  3OIQ A;  3KHH A;  4L6T B;  2J9G A;  1SMX A;  5J39 A;  2RDF A;  4A93 B;  2E2H A;  5KIX A;  3OWF A;  3CPW A;  3T5K A;  1B4O A;  3TDQ A;  1N56 A;  3GD7 A;  3PSI A;  5M5X B;  1HNX Q;  4HMJ A;  1R4Q B;  1V1O A;  4H44 C;  1XPR A;  4FF4 A;  4JI3 H;  3JSN A;  4XYM B;  2HVQ A;  5EQ0 A;  5F9L A;  1G8Z D;  2HQE A;  4F7X A;  1CK1 A;  2D0O A;  2B8F A;  2CQY A;  1H9J A;  1FKA H;  1HR0 W;  2CKZ B;  1SNQ A;  3K0Y A;  4K8I A;  5IGB A;  3J80 c;  5GAD C;  3PO3 G;  3HZX A;  1N34 H;  2R7L A;  2DUD A;  2MPM A;  1PH3 A;  4IUN A;  4QWC A;  4FF1 A;  1BXT A;  1D8L A;  5KFJ A;  1AP0 A;  1PH2 A;  1DV2 A;  3I70 A;  5HGT A;  3OIP A;  4DUY H;  1B9M A;  3OTO Q;  2MHV A;  2DIK A;  2ZDQ A;  2R93 H;  4I4T F;  4HJ8 A;  3OWE B;  3AFQ A;  1RHP A;  2AGP A;  5FO7 B;  4QWB A;  5E3F A;  4MV1 A;  2R7Z G;  5D65 A;  2AUK A;  1M6V A;  1JWU D;  4GS3 A;  4C3I B;  4LSX A;  4J8Q A;  1CM9 A;  4IR9 A;  3QZ7 A;  1DOL A;  5KFH A;  3JAM L;  4P71 A;  4LW1 A;  1W3S A;  5M5W B;  3JAM c;  1I94 H;  3FHW A;  1X3F A;  4A3E G;  1XMQ Q;  3S2D H;  2WB1 A;  1I4P A;  1Q3L A;  2F3W A;  4LFC L;  1N36 L;  1S3O A;  1J5E Q;  2VUM A;  3NBI A;  2N55 A;  1NMF A;  4HR7 B;  4X3T A;  3GTM B;  3RB4 A;  2AQ3 B;  4JI1 H;  1L2F A;  3MC0 B;  2B2U C;  1KNE A;  5M3M G;  1SNO A;  3GO5 A;  4C3J H;  1QJO A;  1PH1 A;  2UU9 H;  2BQR A;  4RKL A;  1WYD A;  2PZT A;  3BAB A;  2ZXR A;  4C5A A;  2UVV A;  2TSS A;  2KA7 A;  3K5L A;  5M5Y H;  1Y1V A;  3M7G A;  4MHE A;  4QUF A;  5FLM G;  4R8N A;  4JI3 Q;  1SXT A;  1TWG H;  1Z9F A;  2L5T A;  4K2K A;  4LF8 L;  4LF7 L;  3KHG A;  5IP9 H;  2UXD L;  5KYL A;  4MTK A;  5BR8 H;  1W2B A;  2QDL A;  1N34 Q;  4JV5 Q;  3H4D A;  2B29 A;  4TQS A;  2E2H B;  3RV3 A;  3HS0 C;  1OTC A;  2ASL A;  4EX5 A;  1EQV A;  4JBM A;  1HQR D;  4A3J H;  1O7Y A;  5CA0 F;  4LFB H;  2FJZ A;  4DUY Q;  5IYC G;  2KHJ A;  2L4N A;  2SEB D;  4PNY A;  1KLU D;  1M7J A;  1TKW B;  2R7K A;  2A6E D;  4U67 3;  4DUZ L;  4B3T L;  3D6W A;  1CKM A;  2YZM A;  5DLF A;  1K1Q A;  3ND9 A;  2XC9 A;  5LXT F;  1C8C A;  2EYL A;  5JEA G;  1PH4 A;  4JI5 H;  3R93 A;  3JRW A;  1I4X A;  2Z4I A;  3F1Z A;  3I8Z A;  5AFW A;  2YZG A;  4ZUI A;  4NXM H;  3Q23 A;  4A75 A;  1I94 Q;  4JI6 L;  1M8A A;  5CA1 F;  5KFN A;  4DV1 Q;  1I5F A;  1IBM L;  4DFA A;  3P7J A;  1A3V A;  1STN A;  1IYU A;  1D6E C;  4YHH L;  3S16 B;  3LWU A;  1XMO L;  4JG2 A;  4ECT A;  4JI1 Q;  1DGS A;  3B6Y A;  2P5Z X;  3IRB A;  2MNA A;  2UU9 Q;  3VDY A;  2MFI A;  2BH8 A;  1FJG L;  4AQY H;  2A68 D;  1A8V A;  1RF2 D;  2HVR A;  3S1R H;  4JI7 L;  2RBM A;  5IGF A;  3TQT A;  1RJR A;  3RIZ A;  2G5D A;  3ICE A;  2WB1 B;  4GKJ L;  2ZJR A;  3CCE A;  1SE4 A;  4C3I G;  5BR8 Q;  2VUM B;  3I12 A;  4DV5 L;  4IN3 A;  4RB3 C;  4DR4 H;  1SYF A;  4HIK A;  4MV7 A;  3E9H A;  4IPC A;  4XYL B;  3TN2 A;  3L4J A;  4WOR A;  2NU9 B;  4HIO A;  4O4I F;  4X62 L;  1GYF A;  4LFB Q;  1XYI A;  1LAB A;  5LMU L;  1CQV A;  1PV4 A;  2WDT A;  4U6P A;  3K0X A;  4OEL B;  2F0P A;  1EEF D;  4MV4 A;  5I4D A;  2G9D A;  4EQN A;  2IY5 B;  1Y1V B;  2VA2 A;  1S03 G;  1V1Q A;  3M7N A;  3F2D A;  4DL4 A;  5COR A;  1GLV A;  4IUT A;  1D5M C;  2UUB L;  4JI5 Q;  3MEH A;  3RLN A;  3DXJ C;  4NXM Q;  1IOV A;  1HNW H;  4HCE A;  2BDN A;  4R1J A;  3HOZ B;  2B2V C;  5G3L F;  3NGD A;  5C3X A;  4A2A A;  1EZ6 A;  2GN5 A;  3CC2 A;  2MP1 A;  3T1Y L;  1TU2 B;  1I7L A;  2R6G A;  3HKZ E;  4X3K A;  5J3B A;  2R3Z A;  4UCT A;  3U58 A;  3KOJ A;  4L1K A;  1BVS A;  1AH9 A;  2W7P A;  2OCE A;  3U9S A;  3CU7 A;  1OXV A;  1RIP A;  5ELO A;  5JJL A;  3S15 B;  4B3R H;  3VA5 A;  3JC6 6;  3PO3 H;  2CWP A;  5A2Q W;  2SNM A;  4DR6 L;  5DG9 A;  4AQY Q;  4C5B A;  5KFR A;  1GUT A;  2L11 A;  5G3L D;  1UWV A;  1UE7 A;  4F88 A;  4K0K L;  3T4A C;  1EQQ A;  1V4Y A;  1NCV A;  1WSC A;  4LMY A;  4QQB X;  4LF6 L;  3J7Y W;  3A5Z B;  2XCP A;  2JEJ A;  4DR4 Q;  2UUA H;  4O1N A;  3T13 A;  2EYM A;  2AQ4 A;  4DV0 L;  1SRO A;  1F2Z A;  2R7Z H;  1YI2 A;  3FVQ A;  2HHH L;  3NP8 A;  1KJ8 A;  3PUY A;  4QCL A;  1X55 A;  3HOW B;  4IZO A;  4FDB A;  1KXL A;  4Y52 H;  3VMM A;  1S5B D;  3K59 A;  1PDQ A;  4A3E H;  4B3M H;  2Q2T A;  3N6R A;  2R8I A;  1OWT A;  5C4J B;  1A3U A;  2BA0 A;  2R6F A;  2K4K A;  1A0I A;  1Q1E A;  4H0L C;  5M3M H;  2W7O A;  1EY5 A;  1SE2 A;  3PW5 A;  3BVM A;  1UNN C;  3E5S A;  2FPI B;  5CR3 A;  1HNW Q;  1IBL H;  2F3I A;  3TIN A;  1XTD A;  1JIC A;  4J15 A;  4MNO A;  3PF4 A;  2EYO A;  2RCN A;  2WB1 G;  3MXU A;  4JK1 C;  3CCQ A;  2UVU A;  1KTK A;  5FLM H;  2VUM G;  3OW7 A;  4C56 C;  4QIW A;  1WTW A;  1T9H A;  3UFX B;  1OXX K;  3WOF A;  5C5L A;  5GAH C;  3E5N A;  1CSQ A;  2K03 A;  4B3R Q;  5KFU A;  4ZI7 F;  3ULP A;  4KKU A;  4OXP A;  4QGU A;  4DL3 A;  3PIO 3;  3OPO A;  4TV8 F;  2RA4 A;  1BBW A;  1Y1V G;  2XIG A;  2F0D A;  5BN4 A;  5IYC H;  3PIP 3;  5H80 A;  2FLN A;  2AQ2 B;  3I90 A;  5LOV F;  3Q8P B;  2A19 A;  2R7F A;  1JR0 D;  2UUA Q;  3C1F A;  2DY7 A;  4ILW A;  1YNN C;  4R4Q A;  3HOZ G;  1O78 A;  5M5X H;  1HJP A;  4DU9 A;  5JEA H;  1F77 A;  3RZO B;  3NUC A;  4AIM A;  5JVL A;  4JI2 H;  4RB1 A;  1WTX A;  3TII A;  5JQW A;  1UAP A;  2NU8 B;  1KHI A;  1IKL A;  4B3M Q;  1HZC A;  1J6Q A;  1SYG A;  2J6S A;  4QMG A;  4Q8E A;  1U5K A;  1S0O A;  1LTR D;  4IRD A;  4R4O A;  4F4X A;  2H4O A;  5C8Y F;  1TWH A;  2I8C A;  4WD3 A;  1D5X C;  1QVC A;  4DR1 H;  3G48 A;  4R4C A;  3MTS A;  1NAP A;  2EXZ A;  1EEI D;  4NDX A;  4MAM A;  4EG0 A;  4ECV A;  2KSW A;  3CRK C;  4ABN A;  4O3S A;  2EYH A;  1MI2 A;  1VAJ A;  1TXY A;  1N8R C;  1K8O A;  3MFY A;  3WO0 A;  1U0L A;  1KAA A;  2IA6 A;  3X3N A;  2UXB L;  3V6H A;  2UXC Q;  3ONA B;  1VMC A;  2IJ0 A;  5J1Z A;  4ULL A;  2IWH A;  4IUR A;  4C3I H;  1WTP A;  4A3F B;  3OW2 A;  2KCM A;  1DJR D;  4E6I A;  4HN7 A;  3HOW G;  1PK8 A;  3A55 A;  2ZJQ A;  5M5W H;  3MXP A;  2Q8I B;  5EKK A;  5HGQ A;  2QK4 A;  1UEB A;  3AFP A;  3Q6S A;  5C4Z A;  4DR7 H;  2QIL A;  1STA A;  2V4Q A;  4L5Q A;  1C48 A;  2UVW A;  1ET6 A;  2HQL A;  4QIW B;  2Z6K A;  5L9X A;  3N44 B;  3TQ1 A;  1EIY B;  3RR5 A;  2D2C C;  2E8G A;  4JI2 Q;  1EY6 A;  4KMU C;  1KC7 A;  1PFM A;  2CH4 A;  4F50 A;  4FO2 A;  4K5W A;  4DR5 H;  3H6M A;  4ZAI A;  3RTX A;  4OEM B;  2VPS A;  1TS4 A;  3TIG A;  2A6H D;  1VDZ A;  3VYT A;  4NXN L;  3HP3 A;  3PF5 A;  4QIW E;  3R8B A;  5CBA E;  4JYA L;  4DR1 Q;  1X54 A;  4Q0Y A;  1E1T A;  4LF4 L;  2E2H H;  1S97 A;  1MBY A;  2OXP A;  2ATW A;  4JUZ A;  2NVX A;  2K52 A;  2NVT B;  1JXL A;  4JV2 A;  2E5L L;  5D1O A;  2NTT A;  3OSO A;  1HZ9 A;  5KKN B;  1ZET A;  4ED2 A;  5FK9 C;  2EVB A;  3PUX A;  3P1H A;  2KQ3 A;  1VQL A;  1N32 L;  3BZD B;  1HFN A;  2QCP X;  5CV9 A;  1Q82 C;  3EN2 A;  4TQU S;  4FF3 A;  4DK0 A;  1TWH B;  3HOU B;  1FR3 A;  5I9P A;  3HG9 A;  4F4Z A;  5A35 A;  3PUV A;  1K83 A;  3S9W A;  1WR2 A;  4O2B F;  4DR2 L;  5GQO A;  3SE7 A;  3KLW A;  3HRZ C;  1B1Z A;  3S16 H;  4RUC A;  3CCJ A;  4DR7 Q;  1HA6 A;  1EYA A;  4IWY A;  1VQP A;  4GLV B;  1EQR A;  2XVS A;  1K73 C;  4JPB W;  4X65 H;  4KLK A;  4IAL A;  1B50 A;  2EY2 A;  3KLS X;  3IFD A;  2WYO A;  4BBS B;  1GJX A;  4M9U A;  2OTJ A;  3IFT A;  3Q8S B;  1MSH A;  4APM A;  4DR5 Q;  4J9O A;  4G57 A;  3S2D B;  3FDS A;  3MR2 A;  3K7A B;  1IZ6 A;  3M9N B;  2VNU D;  2VUM H;  3R2I A;  4A3F G;  4CJ0 B;  1YIJ A;  2A1A A;  1QVG A;  1FGU A;  1PH6 A;  5KFC A;  1BBX C;  4LSA A;  1PRT B;  1SE8 A;  4OX9 L;  1G2T A;  2XSC A;  4IHJ F;  4O3P A;  3NBH A;  4LFC H;  4P73 A;  2CCZ A;  3OHX C;  2JA5 A;  1Y1V H;  5KFV A;  3VPC A;  1L2Z A;  4ED0 A;  3J81 L;  4FS2 A;  3OSN A;  2ENB A;  2W6M A;  3TEH B;  2FK3 A;  1KDC A;  1OO9 B;  4RH6 A;  5IT9 L;  4YB8 B;  1QUQ A;  3CCM A;  3HOZ H;  4X6A H;  3RBD A;  4TUY F;  2OQ0 A;  4PMB A;  2K7V A;  3SK5 A;  2LXJ A;  5D3D A;  2K1B A;  4DV6 L;  1S4Z A;  3RGX A;  4LF7 H;  1MHW C;  2NVX B;  2E2D C;  5LMN L;  3MFH A;  5FLX L;  2UXD H;  5JJZ A;  5D1O B;  4XZ3 B;  3VPD A;  2DJG C;  4X65 Q;  3S15 H;  2VQF Q;  1RK6 A;  3U9O A;  4ZQI A;  5KT4 A;  5IWA H;  3C3L A;  3NHH A;  2Z9H A;  5ISR A;  1H9S B;  2AHO B;  3Q1K A;  2F4V L;  2RGV A;  4G7Z C;  4DNT B;  1PXU A;  3I55 A;  3KJP A;  1S68 A;  4KHP H;  2ATL A;  3H4B A;  1K83 B;  4DAP A;  2DPI A;  3SXH A;  3L0O A;  4KI0 A;  4DUZ H;  1RTN A;  1E4F T;  4OL7 A;  3CP0 A;  3GID A;  3HOU G;  4JI4 H;  1V43 A;  1LTG D;  2BDO A;  4JOI C;  5IP7 G;  1SYC A;  2W9B B;  3BA8 A;  5E7N A;  3HOW H;  3C2P A;  1IBM H;  4Y8V B;  1Q1B A;  1IOW A;  3BDC A;  4LFC Q;  1PRT D;  3EVQ A;  3S17 B;  3HKS A;  1CKN B;  2F0I A;  2OQK A;  2RSO A;  2NZH A;  2A73 B;  2F0T A;  2JA7 A;  5EDW A;  4EYI B;  1KQS A;  3BA9 A;  1STG A;  3D31 A;  1YHA A;  2V1C C;  1AFP A;  3GTK A;  4DV3 L;  1K1S A;  1WD1 A;  4BBS G;  2FMC A;  3RUP A;  1L1O A;  3NTH A;  5FPO A;  5COY A;  4HJ9 A;  4DAM A;  5D14 A;  3GTJ A;  4RAY A;  1MKH A;  1XNR L;  2UXD Q;  4YWM A;  4BBR G;  3NBH B;  4I55 F;  2E2J H;  1EZ1 A;  2JA5 B;  4I7H A;  3GIL A;  1O7L A;  2QEJ C;  4P75 A;  1I4Q A;  5IWA Q;  1DYQ A;  2Q2U A;  4HSP A;  2R7D A;  5F9N A;  1KJI A;  5M9O A;  3SGI A;  5C5M A;  3GTO A;  5JH7 F;  2IL8 A;  4WJ4 A;  4KHP Q;  1LTS D;  2HUG A;  2JA9 A;  1JOK A;  3DLL A;  3CD6 A;  1C9O A;  2DLN A;  3WOE A;  4DKA C;  4Z9C B;  4JI4 Q;  1TA8 A;  1VQ9 A;  2R8G A;  4CBV A;  2QKI C;  3RZO H;  4RB2 C;  3NEL A;  4YWL A;  2C00 A;  5ELD A;  1XWE A;  3N8D A;  1KRT A;  2E74 C;  3J81 E;  4H13 C;  3GQB A;  2O5I C;  5GRO A;  5D3I B;  5ELF A;  5IT9 E;  1PTO B;  1J8I A;  3HFZ B;  1UC8 A;  3I91 A;  2OLS A;  1S5D D;  2ZXP A;  5CGK A;  5DLQ E;  4R8I A;  4DNI A;  4OWW B;  1TQO A;  1CE8 A;  2NUC A;  2CFM A;  3GV7 B;  3BDL A;  3BG3 A;  1N48 A;  5FLX E;  1JJ2 A;  1XNQ L;  4BWS C;  1SJE D;  4YJ3 F;  2X0S A;  5KFO A;  4UAI A;  3S2H B;  5DM6 3;  1BKB A;  4LF6 H;  3RN2 A;  3M4Q A;  1EWH A;  2C2E A;  2YS7 A;  3HOV B;  4F4W A;  4A3F H;  3CRL C;  1ENF A;  2V58 A;  4IPG A;  3RZD B;  3QIA A;  2CW7 A;  1XTC D;  5KNB A;  5JJK A;  1V9P A;  2KEC A;  2DJF C;  4XT1 B;  5LYJ F;  3GV8 B;  3K80 C;  4FXG C;  5JVH 3;  3GTK B;  2OTL A;  1L1O B;  1VQF A;  1TVX A;  3I56 A;  1LT6 D;  1JDE A;  4R7R A;  1KBL A;  5KFB A;  2NZO A;  3GTJ B;  1V8Q A;  4C1N I;  1VQH A;  2I5H A;  1GD7 A;  2RF4 A;  1PTO F;  1C0A A;  4KJO A;  2MO0 A;  1GSO A;  4ID6 A;  2A74 C;  5IE8 A;  4FYD A;  4MZ9 A;  5KT5 A;  3E9I A;  5HBR B;  5J2T F;  2W9C A;  1RJT A;  4MTE A;  4GC6 A;  5EKI A;  3GTO B;  4ZYS A;  2JA5 G;  1V1P A;  1ZHS A;  1ENA A;  1RKN A;  3QG1 A;  4P2C B;  4IPD A;  3FP9 A;  1EY7 A;  1I7N A;  3GV6 A;  4NMZ A;  1PTO D;  1CS0 A;  3I2Z A;  1KIX A;  4EQP A;  1Z47 A;  4RKB A;  1TS2 A;  4O0A A;  1T36 A;  2NVT H;  1PX2 A;  1BQQ T;  2Y0S E;  3OMG A;  5FJ8 G;  3CW2 C;  1NMG A;  2X69 A;  1W6K A;  1BBU A;  3J81 i;  2K14 A;  3L2P A;  1WTH A;  1C4Q A;  2HDM A;  4LF6 Q;  4RAU C;  1A2U A;  2NYZ D;  3TSS A;  4FS1 A;  1EUD B;  2KED A;  2R7N A;  3VR5 A;  1FGB D;  1K28 A;  1ZXT A;  3H3V H;  2R82 A;  3J80 L;  4DL6 A;  3MJF A;  4ECR A;  1TWH H;  3HOU H;  1LUZ A;  4HNU A;  5FD6 A;  3PZP A;  4A3M G;  2D9U A;  4K6D A;  1KDB A;  5EBD A;  2NUA B;  1M4V A;  2EY5 A;  5IP7 H;  4DR3 H;  3I4O A;  1E7Z A;  4YY3 H;  1G51 A;  2N88 A;  5E4W C;  3DF7 A;  1DOM A;  4LFA L;  3E0J A;  2K5N A;  1F9R A;  1FNU A;  2I0Q A;  5JJI A;  3SK8 A;  2RGR A;  3SI8 A;  2LS0 1;  5L1I A;  1BXR A;  1VQ4 A;  4DLK A;  4ED3 A;  1SR3 A;  4U7C A;  4DGZ A;  1WH2 A;  2NZ1 D;  4YWK A;  2XGP A;  5ELE A;  2CZG A;  4BBS H;  1ZHQ A;  1WVL A;  2PMZ E;  1S10 A;  5D1P A;  3K7A H;  1NJI C;  4NW2 A;  2UXB H;  1VMP A;  3HOV G;  4MA0 A;  1I3Q A;  5KND A;  3DWP A;  3A54 A;  4BBR H;  3MZ5 A;  4KKS A;  2VQD A;  2WAQ A;  3URY A;  3VA7 A;  1K3B C;  3W1G A;  2KJX A;  4C2M A;  4JI0 L;  3OHA A;  1KEE A;  2PNR C;  3UDG A;  1X6O A;  1QWY A;  1O75 A;  4CJ2 C;  1XPU A;  1CI3 M;  2H5X A;  4B3S L;  3I4L A;  5JEA J;  4B3R L;  2B2W A;  4ECU A;  2LSS A;  4DV7 L;  4IOC A;  4EQ5 A;  3HKZ A;  1SRU A;  1VQD A;  4XYO A;  4GN5 A;  4DV2 L;  4IOA A;  1V1P B;  2JK8 A;  5LL6 X;  3V96 A;  1PYS B;  1STY A;  3RBE A;  4EFB A;  1RJP A;  1ZQ7 A;  2KEE A;  4DR3 Q;  3ETH A;  4H7B A;  2F0S A;  1YZ6 A;  3EYY A;  1K8M A;  4YIJ A;  2B2T C;  4YY3 Q;  2NVX H;  3OUU A;  2KHS A;  1YNX A;  2OH2 A;  1LT4 D;  1PH5 A;  2F0G A;  1E22 A;  2YV5 A;  3IL8 A;  5KFD A;  5DQG A;  3MR5 A;  2EZV A;  4ZLT F;  3GIJ A;  4ODG A;  2VB3 X;  1EU3 A;  2OT2 A;  2PZU A;  2EJG C;  2A6H C;  5IOD A;  1K83 H;  1P8L A;  1SYD A;  5BMV F;  1TWA A;  1ML0 D;  2KOL A;  5NUC A;  4GKK L;  2AGQ A;  2R84 A;  3FKI A;  4PV1 C;  2UUC L;  2K75 A;  2IP4 A;  4RCN A;  1Q12 A;  5IYZ F;  2HVS A;  3OSP A;  1JJG A;  3L3O C;  3EQL C;  2FFK B;  1HNZ L;  2IW3 A;  4HNT A;  3L4K A;  1TAE A;  1HR0 L;  1RK5 A;  2R61 A;  5L1L A;  4DF7 A;  4DR2 H;  3L7Z C;  2JEB I;  2IX1 A;  1PLF A;  1I6H B;  3S17 H;  3MFI A;  2L15 A;  2L1B A;  4PMC A;  3R5X A;  1EZ8 A;  1RL2 A;  2C5C A;  4IUQ A;  3J80 E;  2EYJ A;  4J9K A;  1R9T A;  2W57 A;  3S1N B;  1I3Q B;  4AYB E;  2W8L A;  1HXY D;  2OWO A;  2F0L A;  2B63 A;  2MO1 A;  1IKM A;  1F2L A;  4GOP A;  1B33 N;  2F0J A;  1N33 H;  4XDX A;  4CGY B;  1A9X A;  3VR3 A;  2PQA A;  1ONL A;  4ZQ3 A;  3CCL A;  4LH6 A;  2O5J C;  4LF5 H;  2P0A A;  3I4N B;  3MWY W;  2JA5 H;  3RFC A;  4HJ5 A;  4YQW A;  1CSP A;  4JBJ A;  4DAV A;  4QWA A;  3DM3 A;  4J1M A;  1VQ5 A;  1N9W A;  3HKZ B;  3VYU A;  2WAQ E;  3Q24 A;  2CW0 D;  3JAM E;  4MTD A;  3LWE A;  4UHV A;  4OX9 H;  1R4P B;  5T1G A;  5KG7 A;  1UE6 A;  1RJQ A;  1G6Z A;  1JC7 A;  2B2U A;  4UFZ A;  2JA8 B;  1DON A;  5FJ8 H;  3IG0 A;  5EWF A;  4O3N A;  3QB3 A;  4F8M A;  1I4H A;  4DV4 L;  2YZN A;  2N3S A;  1TWC A;  2PCF B;  4RWS C;  3G6E A;  1GUW A;  4A3M H;  4DR2 Q;  2JE6 I;  1HZB A;  1WTR A;  2WE6 A;  1TY2 A;  5LMN H;  4A3G B;  3PW0 A;  3H3V C;  2QEX A;  5KG4 A;  2I80 A;  1QNK A;  3T53 B;  4LF9 L;  2NU7 B;  2EE1 A;  1PTO H;  1TWA B;  2F0M A;  4A3B G;  5K36 G;  2H1E A;  3FKI B;  1SYB A;  1SCU B;  5EBC A;  2F0U A;  2AU0 A;  3G8C A;  4RGT A;  2MJ8 A;  3TS0 A;  1M1K C;  3H3V I;  1QCB D;  1AZQ A;  1OXU A;  2ZTC A;  2F4V H;  4PDB A;  1M0T A;  4EVO A;  2RVL A;  3X3M A;  1N33 Q;  3V4S A;  2K5D A;  3S2H H;  4QWD A;  3G6X A;  1HNX L;  4JVZ A;  1SND A;  4X66 H;  4CDE C;  4LF5 Q;  1E3P A;  2HCI A;  2KVM A;  4K2L A;  3J80 i;  3HOV H;  3V6K A;  1B2T A;  1C30 A;  1T94 A;  4RG1 A;  3RZD H;  1R9T B;  5C0X G;  4GN4 B;  1SEI A;  3GTK H;  5GAE C;  4RGM A;  1Q90 A;  4K5X A;  2AWN A;  4DAY A;  1X3G A;  2J0T D;  3BQ1 A;  1SLJ A;  4GOP B;  3KAJ A;  1HFG A;  4YAJ B;  4MV9 A;  1CQJ B;  3GTJ H;  3E0E A;  2CH4 W;  1Q8K A;  2Z6K C;  1PRT C;  2E2J B;  3OTO L;  3LX0 A;  2GA4 B;  3GTG A;  2XTI A;  2HJW A;  5EKL A;  1LM0 A;  1E0B A;  5KGU A;  5KT6 A;  3K5M A;  5CMD A;  3JAM i;  4FVM A;  3UQ8 A;  3W3A A;  3GTO H;  3MXN A;  1F2M A;  5LMN Q;  4HIM A;  3I4N G;  2GPW A;  2VZA A;  1O80 A;  4G4K A;  1XNR H;  5M3F B;  4J9N A;  2DWC A;  1CZW A;  2NVY A;  3KAL A;  3HKZ G;  3T5L A;  1SJH D;  3QWN A;  3DWA A;  4TRD A;  3SK4 A;  1XMQ L;  1IBK H;  2F03 A;  4ECS A;  2YU9 A;  1J5E L;  2A69 C;  5F2D A;  5KFW A;  1KAB A;  1WI5 A;  1GSA A;  1TWC B;  4ED8 A;  3CPF A;  3D4D A;  2JA8 G;  1KL9 A;  1LYL A;  3QOJ A;  3M9B A;  3CMA A;  3R23 A;  4R8U A;  5IOC A;  3T1H H;  2D62 A;  3BZK A;  2WTF A;  3NTI A;  3BAA A;  4X66 Q;  1IW7 D;  2W6O A;  1AUX A;  3N52 A;  5J22 A;  4GNX A;  2FKL A;  2B2V A;  4GN3 B;  4JI3 L;  3AU7 A;  4ED7 A;  1BUV T;  1YHB A;  3NEN A;  1U4L A;  2J6U A;  2YTV A;  4ECW A;  2ES2 A;  2YL2 A;  3HBL A;  5EAY A;  2F0K A;  1IBL Q;  1PHJ A;  5DG8 A;  4A3G G;  4RNM A;  3RLO A;  1N34 L;  2MCT A;  4YP3 A;  3QO2 A;  4UCU A;  4QWE A;  1E4G T;  3LWB A;  4OWT B;  4A3D B;  4JI8 H;  3FKI G;  3PW4 A;  2ASB A;  5KX5 F;  5KFE A;  1WJJ A;  5C1P A;  1CQF A;  5L1K A;  4YR2 A;  2VY3 A;  3KLR A;  1NE3 A;  4X64 H;  1SYX B;  2Z1C A;  4IR1 A;  3GIP A;  1OXS C;  3EIV A;  1KJJ A;  5DQI A;  4XXE A;  3M85 A;  2ZM6 H;  1SMY D;  1XNR Q;  1ICF B;  4DAY B;  1SEB D;  2JJQ A;  4NPS A;  2PPB C;  3HOY B;  1I94 L;  2XD4 A;  3I7F A;  1E24 A;  4DV1 L;  4YR3 A;  2RDJ A;  3R3O A;  2C2R A;  3UI2 A;  1ZYR D;  1IBK Q;  4LH7 A;  1H9R A;  1AZP A;  1LAC A;  4UP8 A;  3MR6 A;  4JI1 L;  1X65 A;  5IY0 A;  1PZI D;  3GTG B;  3VR6 A;  3MR3 A;  2L0C A;  3AEV A;  2UU9 L;  1UUP A;  3T1H Q;  4A3C G;  4PQX A;  2RDI A;  1AN8 A;  1EY0 A;  3MXN B;  5KFF A;  1GOZ A;  2BCO A;  2F0F A;  4WJW A;  1F2Y A;  1ICW A;  4H02 A;  1S0N A;  1CUK A;  5DQH A;  2ZXO A;  1PH8 A;  4R9W A;  4FU0 A;  4UCS A;  3U9T A;  3HXL A;  2YU9 B;  1JMC A;  5BR8 L;  2XN9 C;  1K0S A;  3H09 A;  4QL5 A;  5M3F G;  3M9O B;  1IYV A;  3NEM A;  3HEJ A;  5LMN W;  4O3R A;  3OHB A;  4JI8 Q;  1L0X B;  3A8K E;  4R8U B;  3ULL A;  4LFB L;  3D6C A;  3J7Z C;  3GLK A;  4KY5 A;  1HH2 P;  3QZ8 A;  4FF2 A;  4A3B H;  5K36 H;  4LUV A;  4EGJ A;  4EGQ A;  4GNX B;  1X56 A;  3K5I A;  4X64 Q;  1CA6 A;  2FE3 A;  2K33 A;  4TVA B;  3W5O A;  3I4M B;  3SE0 A;  4FNF A;  3WO1 A;  5KFP A;  1PTO C;  4JCV E;  4X3U A;  4IFD J;  3MWM A;  3R2T A;  1BR9 A;  3DM1 A;  3O13 A;  2ZM6 Q;  4DR6 H;  3G4S A;  4JI5 L;  2Q8T A;  3RD4 A;  1EIH A;  4I7Z C;  2JEG A;  1KJ9 A;  4Y7N H;  2HT1 A;  4DA2 A;  3PMF A;  1VQG A;  1M0W A;  5KFX A;  4MV3 A;  4DK1 A;  2FK2 A;  1EYZ A;  4IWX A;  1B3Q A;  4EEY A;  2QDB A;  5DEH A;  3J7A V;  5BN5 A;  5C0X H;  1GM5 A;  3DWQ A;  4N9P A;  3PR4 A;  1VF7 A;  4QUC A;  1I6H H;  3T5H A;  2C22 A;  4A3D G;  3PO2 B;  1SDF A;  1EWC A;  3K58 A;  4AQY L;  3I73 A;  1O7I A;  3S1N H;  1WFQ A;  1I3Q H;  4IFD G;  4RGO S;  3N40 P;  4BBR B;  1L1O C;  4I7A A;  4DXG A;  3TRE A;  1VQO A;  3PUZ A;  5C4X B;  2L12 A;  2RCF A;  3TZU A;  4C2M H;  1KLG D;  2KUM A;  1WD0 A;  1BCP B;  3HOY G;  1N36 H;  3I4N H;  2K5V A;  4ALP A;  4J9R A;  3KF6 A;  5CBE E;  1QOH A;  3D4W A;  1EUC B;  1VQK A;  3UE0 A;  5GON F;  4PWQ A;  3RF2 A;  2IMW P;  1DZ1 A;  4U68 A;  1RDP D;  1ET9 A;  5E4X A;  1YJW A;  4Q43 A;  1PFS A;  4NP5 A;  4KY7 A;  3KHR A;  3EFX D;  4O42 A;  1QZG A;  1X3E A;  4CKB A;  2JA8 H;  1ENC A;  3LGJ A;  2F0O A;  4LF8 H;  3I72 A;  1RTO A;  2BE5 D;  3Q8D A;  1HNW L;  5CV8 A;  1D2B A;  1Q8I A;  4YAK B;  1A3T A;  4MV8 A;  3BVG A;  3E6Z X;  4UCR A;  4BY7 B;  4O2D A;  4RFB A;  1STB A;  4IRC A;  4GZY C;  2I5L X;  2AQ1 B;  2XRQ D;  1O7Z A;  4A3G H;  3WNZ A;  1FVI A;  3BJY A;  1PRT F;  2D0P A;  3GP7 A;  1BCP F;  3RB6 A;  3N42 B;  1TWA H;  4B3T H;  3V4Z A;  5L37 A;  2SNS A;  1TS3 A;  3OOC A;  5EGT A;  1KJQ A;  3FKI H;  4ZOL F;  3RB3 A;  2YYZ A;  1GUN A;  1VQC A;  1SNC A;  3BDO A;  3MVV A;  5E1F A;  4KHZ A;  2A6E C;  3I4M G;  3KBG A;  4J0M A;  2YRW A;  3ORQ A;  2ASJ A;  2O2L D;  1B7Y B;  2UUA L;  4JI6 H;  1HUM A;  1HHV A;  1LLR D;  1N36 Q;  4KN4 C;  3RLF A;  4YHH H;  1BCP D;  1XMO H;  2AKW B;  3RNU A;  1VQN A;  1BF4 A;  1VQ6 A;  5BPH A;  1HNZ H;  2BQ3 A;  1R9T H;  1X9N A;  2FLL A;  2F4I A;  1FJG H;  2C9O A;  4KN7 C;  5CB4 F;  2CHB D;  4ME5 A;  3DUZ A;  1JE4 A;  2MQH A;  5C44 B;  1ESF A;  3PO2 G;  4JI7 H;  1SAP A;  3ERS X;  5HY6 A;  4LF8 Q;  1B44 D;  1BGW A;  4LF7 Q;  3SHL A;  4A3C H;  4DK3 C;  2ZDH A;  1E2W A;  4GKJ H;  2A68 C;  3CKI B;  5FO8 B;  1YHQ A;  4DV5 H;  5KG3 A;  1KRS A;  1EOT A;  2PQE A;  5C4X G;  3KF6 B;  4BY1 B;  4J9S A;  1W6J A;  2YW2 A;  3GTL A;  2AWO A;  2WKD A;  4HTH A;  4A3K B;  1YIT A;  2D5D A;  3DEP A;  4GLA C;  2UXC L;  4UCV A;  4X62 H;  2Y0S A;  5LMU H;  1QUQ B;  2UVR A;  2YRX A;  5M3F H;  5FO9 B;  2YTY A;  2B2Y A;  3GDE A;  2XWJ B;  1B6R A;  4DUZ Q;  4B3T Q;  3JSL A;  4FXK C;  4C1N K;  4G7O C;  1JJC B;  3FRP B;  2UUB H;  3NSW A;  1MSG A;  1Y1W A;  5C3W A;  4IZ8 A;  1TWC H;  5T1I A;  3STB D;  4C3H G;  2YCH A;  4JI6 Q;  1JB3 A;  5IGC A;  2ID0 A;  2EOT A;  1NY4 A;  5GAG C;  4A3M B;  1IBM Q;  3BZC A;  1GUO A;  2CW0 C;  4YHH Q;  1AW7 A;  3T1Y H;  1EUJ A;  1CHP D;  3V2T A;  1XMO Q;  1S72 A;  4BY7 G;  4JI2 L;  4M7E A;  3UE1 A;  4R4I A;  1ULZ A;  2O03 A;  3ZJY C;  1HNZ Q;  4GLX A;  3FPU B;  5FD5 A;  5KNC A;  4QW8 A;  3V6J A;  1VQJ A;  1I6U A;  1NTG A;  1E2V A;  1FJG Q;  2NU6 B;  1EU4 A;  1JLL B;  1VQ8 A;  5CV7 A;  3S14 B;  4JI7 Q;  2C2D A;  2WAC A;  4XT3 B;  1ASZ A;  2HIX A;  4K0K H;  2PMZ A;  2M9V A;  2BH2 A;  4A3D H;  2PYK A;  3CXC A;  3A7A B;  4GKJ Q;  4J9P A;  2B8G A;  4PG3 A;  1MJE A;  3UDF A;  4DV5 Q;  3M9M B;  4DV0 H;  1NR2 A;  4IFD H;  5KG2 A;  3KUP A;  2AGO A;  3C1E A;  4EEQ A;  4DPG A;  2K5Q A;  3Q22 A;  2JA7 B;  2O4X A;  4HAE A;  1Z2N X;  2HHH H;  1H9M A;  4ZK9 B;  1CT1 D;  1LTI D;  1D7Q A;  4X62 Q;  5EPL A;  3JAM W;  5H1S E;  5LMU Q;  5C0X I;  2KBN A;  1HNX H;  1A2T A;  2R86 A;  4BXX G;  5KG5 A;  3OUZ A;  3ERO A;  3HOY H;  1CA5 A;  4JOI A;  5C5J A;  5IYB G;  1PYW D;  4HYK A;  5L1J A;  3CC7 A;  2OEO A;  3CAM A;  3S1Q B;  4A76 A;  2UUB Q;  4TV9 F;  3Q0A A;  5C44 G;  4DR7 L;  5ELN A;  3GTG H;  1CKO A;  3M3Y B;  1VQ7 A;  1B70 B;  4DL2 A;  3K3P A;  4L5T A;  2V59 A;  4PZ8 A;  2CQA A;  4IQZ A;  4KD3 A;  3GTL B;  4MIU A;  1SFO A;  2DPJ A;  5AJ3 L;  2NVQ B;  3ETJ A;  2Y0S B;  1GUG A;  1YNJ D;  1BDO A;  3T1Y Q;  3TBI B;  4CDF C;  3HOX B;  1HPC A;  3D0F A;  4ZHQ F;  4HR7 A;  3GTM A;  4BY1 G;  4DNR B;  2IX3 A;  4F87 A;  4XQQ A;  2EQS A;  1J9O A;  2VQE L;  4DR5 L;  2Z6B A;  4A3K G;  5JPN C;  5FKA C;  2YU9 H;  5HV6 A;  3F2U A;  3UDX A;  3KF8 A;  1ILQ A;  4UP9 A;  3A5U A;  1Y1W B;  2CW8 A;  2QF7 A;  3ERQ A;  3KAK A;  2I46 A;  1C3O A;  3A0J A;  4K0K Q;  3ULJ A;  4XTC S;  2LY7 A;  3P75 A;  4B08 A;  5BPF A;  3QJY A;  2W70 A;  4OON A;  4DV0 Q;  1EHI A;  4RZR A;  3I3C A;  2PW5 A;  4QF4 A;  1VQM A;  4FBU A;  3SEB A;  5KFY A;  1PFB A;  2HHH Q;  3I4M H;  3H20 A;  3CF5 A;  4CC5 A;  3GTQ A;  1JWM D;  3NK9 A;  5EZY F;  3FEW X;  5CV5 A;  4E4T A;  3LNN A;  3G6J B;  3PN1 A;  1YVC A;  4DK6 C;  2WIN B;  1GUS A;  3G6Y A;  2CQO A;  2PMZ B;  1WCM A;  5KFL A;  4AYB A;  1A63 A;  3MWD A;  1B3A A;  1YJN A;  5I2X A;  1IW7 C;  4HCS A;  3U4Z A;  4LJZ C;  1AEX A;  3RB0 A;  5KT2 A;  2JXM B;  3GV3 A;  5I6Y A;  1FNV A;  5KG1 A;  3D4R A;  4QJF A;  3QFF A;  4X65 L;  2VQF L;  1IXR A;  3PO2 H;  4O3Q A;  4ECQ A;  4OIJ A;  1MD2 D;  4NKL A;  3MEF A;  5KFK A;  4RCO A;  4ECZ A;  1ROD A;  2YTX A;  4M1U B;  1EFW A;  2QYZ A;  1X32 A;  3K57 A;  5DLG A;  4TQR A;  2JA7 G;  2Q2H A;  1S0M A;  4GOP C;  2MGS A;  2L9H A;  1EOV A;  1STE A;  5C4X H;  5J2U F;  1HTP A;  5LHY 1;  1X3Q A;  3SR1 A;  1SBB B;  3R5F A;  1I50 A;  4HQ6 A;  1FYC A;  4BS9 A;  1ZEQ X;  4PMW A;  3ORR A;  5C4H A;  5JPM C;  1PYB A;  2W9C B;  1CTM A;  1XXG A;  1SFO B;  2R85 A;  4WJ3 M;  4Q45 A;  4DV1 H;  1A62 A;  4Q44 A;  2BQU A;  1S5C D;  1SMY C;  3WDN A;  1W93 A;  4JBK A;  3K3V A;  2PVP A;  1KDA A;  3PIO A;  3PQI A;  4KHV A;  4UP7 A;  2OF1 A;  1LTB D;  5BN3 A;  3PIP A;  4C3H H;  4ZKB B;  4DL5 A;  1ZYR C;  3G7L A;  2Y0S G;  3CVZ A;  3HOX G;  1NUC A;  2RKS A;  3KF8 B;  3VPB A;  5I47 A;  1GKH A;  3GIK A;  4EBC A;  4QW9 A;  1D5Z C;  1EQT A;  2K32 A;  4CKC A;  5FOB B;  4BY7 H;  2YS6 A;  4NXN H;  3J7A 5;  4JYA H;  3F8T A;  2GPS A;  4LF4 H;  1JE5 A;  4IUU A;  4A3B B;  1VQA A;  2RQX A;  1WTV A;  1Y1W G;  2NB0 A;  4A2B A;  5JOB A;  4HJA A;  3K8A A;  2N49 A;  2QA4 A;  1PH7 A;  5IWA L;  4RMF A;  2E5L H;  3GTQ B;  5DGB A;  3EA6 A;  1JQY D;  4Q5V A;  5EOY A;  2UXB Q;  4POF A;  3JRX A;  1YBY A;  2A5H A;  4Y7N B;  2EY6 A;  3K5H A;  4LK1 C;  4KHP L;  2R8K A;  1N32 H;  2K01 A;  3SVM A;  1ESR A;  4A93 G;  1WCM B;  4IJH A;  4AYB B;  2M00 A;  3G6V A;  1XDN A;  4OGQ C;  4XIG S;  1JOR A;  1L0Y B;  4JI4 L;  4O4L F;  5KG6 A;  3L9A X;  1EIF A;  4IUP A;  2ZTD A;  5EWE A;  4BXX H;  1VF5 C;  4UPA A;  3J7A F;  1CQI B;  4XQJ A;  3CCR A;  1K9M C;  1LTA D;  5IYB H;  4YBZ B;  2ASD A;  2DNE A;  2QW7 A;  1EFI D;  3KDF A;  4CHT B;  4IFD I;  1XX8 A;  4N9T A;  5C44 H;  1L0W A;  2WAQ B;  4UY8 C;  4A3L G;  3BJU A;  3BU2 A;  4O4H F;  3RMH A;  3H0G A;  4C2M B;  1DIK A;  3K5N A;  1D1K A;  1I50 B;  1FNW A;  1BNZ A;  4DL7 A;  4Q0F A;  1AUV A;  3N41 B;  2Z0S A;  1SE3 A;  4KK7 A;  4NXN Q;  3F2C A;  2FB9 A;  2DN8 A;  2KCT A;  4JYA Q;  4OO1 G;  1I4G A;  4BY1 H;  2FIN B;  2ICE C;  4DN4 M;  1AN7 A;  2VR1 A;  1SN8 A;  4LF4 Q;  4A3K H;  2W6P A;  2V9W A;  1YJ9 A;  1TY0 A;  4LNQ A;  3FPP A;  2IT1 A;  4HID A;  1EWI A;  1WTQ A;  2E5L Q;  2ZT9 C;  5C6A A;  1BNC A;  1B9N A;  1E1O A;  5EWG A;  2W8K A;  1K8A C;  2BOS A;  4P72 A;  4ZRZ A;  2WB1 E;  2NN6 G;  1GHK A;  3NQI A;  2I5M X;  2N8N A;  1N32 Q;  1FL0 A;  1Z2O X;  2FPG B;  4FBT A;  2K28 A;  1P16 A;  2BR0 A;  3FDT A;  2FPP B;  4L63 B;  1NR4 A;  1EYG A;  2LXK A;  1CZG A;  4B9W A;  3GIQ A;  3IN5 A;  2V4R A;  4CJ1 B;  4DV6 H;  3KTM A;  2NWG A;  4GNX C;  2IX0 A;  1TII D;  1HQM C;  4O2A F;  3GTP A;  1AE2 A;  1UNS A;  4KTA A;  3TS2 A;  5C0X J;  1G91 A;  1H95 A;  1MGS A;  2XIW A;  3DMU A;  3S24 A;  2BE5 C;  2B2T A;  2NBF A;  2I87 A;  2PN1 A;  4O3O A;  3P20 A;  3S14 H;  2XGT A;  2IPK D;  3NWS A;  4HSV A;  3TP8 A;  3WWV A;  1Q46 A;  4FM9 A;  1DOK A;  1CFM A;  1JDB B;  4UDU C;  5KFM A;  1WCM G;  2X6G A;  4M8A A;  5IGG A;  4IPH A;  4AYB G;  2JA7 H;  2HDL A;  1TWF A;  5CAE B;  3MHB A;  4IJL A;  1DD2 A;  3CCU A;  4L5R C;  3Q8R B;  1DXM A;  2N78 A;  3KDF B;  2B63 B;  4OX9 Q;  2EIF A;  3BQ0 A;  4JV5 H;  1ASY A;  3LML A;  5KEE A;  1KD1 C;  1G6P A;  3H0G B;  1XPO A;  4RHR A;  2PQA B;  1DCZ A;  3S1Q H;  4WFN 3;  3PCO B;  4EGV A;  2E2I A;  5C1O A;  1LO5 D;  2WFW A;  2B39 A;  1BCP C;  2MUY A;  4LUZ A;  1VS0 A;  4RB0 A;  4DV3 H;  2WAQ G;  1VCI A;  3M3Y H;  3TQY A;  3PV0 A;  3FMA A;  2FLP A;  3M4O B;  3BG5 A;  5KFT A;  5EJW A;  1Y8N B;  1IYJ B;  3GTL H;  1WOC A;  1C7Y A;  2LMC B;  2R92 A;  4DV6 Q;  3J81 j;  2NVQ H;  2K5H A;  4LWC A;  3HOX H;  2TMP A;  1GSH A;  1GVP A;  2PNH A;  3CQZ A;  1RYR A;  2NTS A;  4QB4 A;  3RN5 A;  1IL2 A;  2R87 A;  2Z8L A;  4HJ7 A;  4V19 0;  3N43 B;  3K6O A;  4ME6 A;  4JV1 A;  2UXC H;  4MN3 A;  1PZJ D;  2LFN A;  3DHQ A;  3T51 B;  2F4V Q;  2EYF A;  2CWA A;  2L55 A;  1Y1W H;  2VPQ A;  4RUA A;  2YYA A;  4IRK A;  4JBW A;  5DM7 3;  3H15 A;  2JA6 A;  1QG7 A;  5KT7 A;  4KD4 A;  3C46 A;  3GTP B;  2F3V A;  2ZJT A;  2KHI A;  3BYT B;  2G9H D;  4BWG B;  4G7H C;  5EPJ A;  4V0B A;  2PW7 A;  2RDH A;  3IAY A;  3ER0 A;  4KV6 A;  4A93 H;  2IHE A;  1I4R A;  2HIV A;  3JZI A;  4JV0 A;  4J9L A;  5CC4 A;  1DV1 A;  4MTN A;  3RUZ A;  4JV5 L;  1K8G A;  4GC7 A;  1A15 A;  5A2Q L;  5KFA A;  2KCC A;  3PW2 A;  1AE3 A;  3EPG A;  3STB C;  4DR3 L;  3OMC A;  1MZB A;  2HD3 A;  2F0Q A;  2R8J A;  3D8G A;  3S1M B;  4A4I A;  1M90 C;  2DY8 A;  4YY3 L;  1VBG A;  5ELC A;  4DUY L;  2XCA A;  4DV3 Q;  2B3G A;  2GLT A;  3VYS A;  1D1I A;  4CKE A;  2FXQ A;  1B6S A;  1TWF B;  1Z2P X;  1PFN A;  1NNX A;  4A3L H;  2W6Z A;  4J9Q A;  1XNQ H;  2GVA A;  3AQQ A;  1SYE A;  2RDG A;  2DZD A;  2R93 A;  1IL8 A;  5KFG A;  3KXY T;  4L8J A;  1K3R A;  4JW0 A;  1JOQ A;  4OO1 H;  4NB3 A;  2E2I B;  1S5F D;  2B63 G;  5C3E B;  2K05 A;  1VKZ A;  5KT3 A;  3TP6 A;  2F0V A;  2W9A A;  4F4Y A;  2ZDG A;  2KEN A;  4N8X 1;  1ILP A;  3T56 B;  3H0G G;  3U4V A;  1JB7 A;  4ECX A;  2K04 A;  1SFO H;  1PVO A;  3LP8 A;  2FJ2 A;  2R92 B;  1T5X D;  1BJT A;  3M4P A;  2FK1 A;  1T5E A;  1PMR A;  4LAA A;  3J81 W;  4CDC C;  4J6H A;  4I65 A;  2F0E A;  2NN6 H;  2NVY B;  2XRS D;  3MFG A;  3GTM H;  1U4R A;  5LL6 b;  4KY6 A;  1SNM A;  3CQZ B;  3QR8 A;  3FMC A;  5IT9 W;  1JIH A;  1GGO A;  2IHF A;  5LL6 S;  2DGY A;  4A3I B;  3TP5 A;  4MA5 A;  1YEZ A;  2F0H A;  3AB9 A;  1STH A;  1QVF A;  5DG7 A;  1EY4 A;  2JQO A;  5I6W A;  3F8N A;  2R8H A;  4EYH B;  4ECY A;  2JA6 B;  5FLX W;  2E75 C;  4TKO B;  1TWG A;  2VQE H;  3NQT A;  2WII B;  3M4I A;  1YNJ C;  2F0N A;  2VOB A;  1U4M A;  3NTK A;  3OYY A;  1PA6 A;  3GV5 B;  3ND8 A;  4Q8F A;  1U9R A;  1XNQ Q;  1A6X A;  4EFE A;  1NBW A;  2X6L A;  3GTQ H;  1KAW A;  2V4D A;  5HUR A;  3AMU A;  1UEA B;  3QOL A;  1GO3 E;  4NXM L;  4RU9 A;  2GVB A;  5KFS A;  4IUV A;  2W71 A;  1IHZ A;  2J7Z A;  1WCM H;  2WP8 J;  4YCU A;  1ZKO A;  1EYC A;  2EYP A;  3H94 A;  4ZUJ A;  5K5P A;  1XJV A;  4K6L A;  4WBN F;  2JEA I;  1H9S A;  2FMM A;  3RJ0 A;  3W2D A;  3T16 A;  3PW7 A;  4RA8 A;  3VYR A;  1EL0 A;  4BA2 I;  3PVX A;  4LFA H;  1VQE A;  1GXD C;  4K5V A;  2XCL A;  1B8A A;  3BYY B;  4FP5 D;  3N6X A;  2PO4 A;  2FHT A;  1Y8O B;  2ALY B;  1LV9 A;  2Q8R E;  2R93 B;  1EIG A;  1KNA A;  4K14 A;  2BA1 A;  2PZW A;  1S5E D;  3BVZ A;  1JWS D;  3A7L A;  3KK7 A;  3MA2 B;  3CCS A;  4RNN A;  1LTL A;  4L5S A;  2W9B A;  3BQ2 A;  2VQF H;  5A2Q E;  2PBZ A;  4DR4 L;  5AJ3 Q;  1I50 H;  3PGZ A;  2KCN A;  4OWX B;  2JP1 A;  4YJ2 F;  2C35 B;  1CKN A;  1BO0 A;  3U50 C;  1QNU A;  4RGN A;  1KC8 C;  4BA1 I;  2VQE Q;  1N33 L;  2J4X A;  4OHJ A;  3SDZ A;  4ED1 A;  4XYQ A;  4PZ6 A;  2VA3 A;  5C3E G;  3KYH C;  4J9M A;  1Q7Y C;  3T5J A;  1S9F A;  2JSO A;  1Z7T A;  4LF5 L;  5IGE A;  1RYS A;  4JI0 H;  2VXW A;  4PZ7 A;  3V05 A;  4RZQ A;  4DXF A;  2W6Q A;  3KJO A;  4CDD C;  2B2Y C;  2EXD A;  4I50 F;  3DEO A;  2F0W A;  2F1M A;  4C3J B;  2IBK A;  2R92 G;  4B3S H;  4C3H B;  3Q8Q B;  4DR6 Q;  2J6T A;  2EJM A;  2XGQ A;  5LA6 F;  5CV4 A;  4UCO A;  4DV7 H;  2Z4H A;  1G29 1;  4DV2 H;  2SOB A;  1TT2 A;  3IKJ A;  5M5Y B;  5KFI A;  3RV4 A;  3NWT A;  1HTL D;  3EJI A;  5JUM A;  3GII A;  1DM0 B;  1TWG B;  4MV6 A;  3J81 c;  1E4E A;  4A3I G;  3CC4 A;  5CV6 A;  5IYD G;  4ZCK A;  4C5C A;  3TRZ A;  3EBE A;  2EDG A;  3BS1 A;  5IT9 c;  4K8J A;  2HGS A;  1JOO A;  5ELB A;  2AUJ D;  2JA6 G;  2VW9 A;  1PZK D;  3HB9 A; 
#chains in the Genus database with same CATH homology
 4LFA Q;  2Q2I A;  4BY1 G;  2OWO A;  2VQE L;  2EQS A;  4A3K G;  2MO1 A;  4DR5 L;  2VS1 A;  1OXT A;  4GOP A;  2VL6 A;  2YU9 H;  5FLX c;  3UDX A;  1TXY A;  2PQA A;  4UP9 A;  1N8R C;  1U0L A;  3A5U A;  2UXB L;  3CCL A;  2UXC Q;  3A0J A;  4K0K Q;  3ULJ A;  2JA5 H;  4XTC S;  4HJ5 A;  1CSP A;  4JBJ A;  4C3I H;  3DM3 A;  3OW2 A;  2KCM A;  1N9W A;  1VQ5 A;  3HOW G;  4OON A;  2WAQ E;  4DV0 Q;  2ZJQ A;  5M5W H;  4POG A;  1VQM A;  5HGQ A;  2HHH Q;  3PUW A;  3I4M H;  1UEB A;  1UE6 A;  3AFP A;  4X66 L;  3CF5 A;  4B3M L;  4JI0 Q;  5FJ8 H;  2B63 H;  4L5Q A;  2QGQ A;  1Q81 C;  4B3S Q;  1YVC A;  4DK6 C;  2HQL A;  3H0G H;  2CQO A;  2Z6K A;  4P74 A;  4DV7 Q;  1IBL L;  4DV4 L;  2N3S A;  3RR5 A;  4DV2 Q;  4R4T A;  1EIY B;  1Y14 B;  2E8G A;  4JI2 Q;  4IO9 A;  4APV A;  2A8V A;  2R93 G;  1YJN A;  3A74 A;  3G6E A;  3U4Z A;  4A3M H;  4DR2 Q;  2JE6 I;  1HZB A;  5C4J H;  3M4O H;  4QJF A;  4OO1 I;  4X65 L;  2QEX A;  2VQF L;  1IXR A;  3PO2 H;  4LF9 L;  1HZA A;  3PF5 A;  4NXN L;  3MEF A;  4QIW E;  4JYA L;  1UE1 A;  1AH9 A;  2YTX A;  1EFW A;  4QY7 A;  4DR1 Q;  4A3B G;  1X54 A;  5K36 G;  1E1T A;  4LF4 L;  3K81 C;  2E2H H;  2PI2 A;  2JA7 G;  4JC0 A;  2Q2H A;  3TS0 A;  1M1K C;  3H3V I;  4GOP C;  1OXU A;  2ATW A;  2K52 A;  2ZTC A;  1EOV A;  1JT8 A;  5C4X H;  2E5L L;  1N33 Q;  1HZ9 A;  2NN6 I;  3S2H H;  1HNX L;  1VQB A;  4PMW A;  3PUX A;  4LF5 Q;  1E3P A;  1IBK L;  1PYB A;  3CCV A;  3HOV H;  3J80 i;  1VQL A;  4GKK Q;  1N32 L;  2AMC B;  4WJ3 M;  1A62 A;  4YCV A;  1Q82 C;  3EN2 A;  4TQU S;  2UUC Q;  3GTP H;  4RG1 A;  3RZD H;  5C0X G;  3PUV A;  4JBK A;  4GN4 B;  3PIO A;  3GTK H;  5IP9 G;  4DR2 L;  5GAE C;  3T1H L;  5GQO A;  3KLW A;  2AWN A;  4UP7 A;  1QZH A;  1X3G A;  3S16 H;  3PIP A;  1SLJ A;  4C3H H;  3F2B A;  3CCJ A;  4GOP B;  1HR0 Q;  4DR7 Q;  2Y0S G;  3HOX G;  3KFU A;  3KF8 B;  1VQP A;  4GLV B;  3GTJ H;  1EQR A;  3E0E A;  3W1B A;  3G71 A;  1K73 C;  1Q8K A;  2Z6K C;  4DR1 L;  4KLK A;  1GKH A;  2ZTE A;  4A3J G;  3OTO L;  1VQI A;  2K50 A;  4BY7 H;  2XTI A;  3J7A 5;  3F8T A;  3S1M H;  1LM0 A;  4YCW A;  3JAM i;  1JE5 A;  1VQA A;  2OTJ A;  3AYH B;  1Y1W G;  4DR5 Q;  3GTO H;  4JI8 L;  5LMN Q;  4HIM A;  3I4N G;  1IZ6 A;  1TWF H;  2VZA A;  4HJA A;  3K8A A;  2N49 A;  2QA4 A;  1PH7 A;  5IWA L;  4RMF A;  2ZJP A;  2VUM H;  4ME3 A;  4A3F G;  1Q86 C;  3HKZ G;  4X64 L;  1MJC A;  1YIJ A;  1XMQ L;  2UXB Q;  4POF A;  1YBY A;  2A1A A;  2RHQ B;  1QVG A;  1J5E L;  4KHP L;  1FGU A;  1PH6 A;  1K0R A;  4AH6 A;  4A93 G;  2ZM6 L;  1WI5 A;  4IJH A;  1SE8 A;  4OX9 L;  2RHS B;  2E2I H;  3CPF A;  2JA8 G;  4P73 A;  1KL9 A;  1LYL A;  5C3E H;  2CCZ A;  1Y1V H;  3M9B A;  3CMA A;  4XIG S;  2D62 A;  3BZK A;  4JI4 L;  4X66 Q;  1EIF A;  2ZTD A;  3TEH B;  4GNX A;  4BXX H;  2R92 H;  4UPA A;  4GN3 B;  4JI3 L;  1QUQ A;  3CCR A;  3CCM A;  1YHB A;  3NEN A;  1K9M C;  3HOZ H;  5IYB H;  4X6A H;  2YTV A;  3UDI A;  2OQ0 A;  2ES2 A;  2NVY H;  5EAY A;  3KDF A;  1IBL Q;  4DV4 Q;  1PHJ A;  2LXJ A;  4A3G G;  3CQZ H;  4DV6 L;  4IFD I;  3RLO A;  5C44 H;  2F52 A;  1N34 L;  1L0W A;  4A3L G;  5LMN L;  4UY8 C;  3BJU A;  3BU2 A;  4A3I H;  4LUO A;  1S40 A;  4OWT B;  5IYD H;  3FKI G;  4X65 Q;  3CME A;  1UE5 A;  2VQF Q;  2ASB A;  3S15 H;  4LF9 Q;  2Z0S A;  1WJJ A;  4NXN Q;  2JA6 H;  3F2C A;  2VY3 A;  2KCT A;  4JYA Q;  2AHO B;  1NE3 A;  4OO1 G;  2PI2 E;  4BY1 H;  1MIU A;  2F4V L;  1SN8 A;  3I55 A;  1OXS C;  3EIV A;  3KJP A;  4A3K H;  4LF4 Q;  1PH9 A;  3K7U C;  1YJ9 A;  4LNQ A;  3M85 A;  2IT1 A;  3L0O A;  4KI0 A;  1SMX A;  4HID A;  1XNR Q;  1EWI A;  2E5L Q;  4DAY B;  3CPW A;  2JJQ A;  4NPS A;  1I94 L;  3I7F A;  3CP0 A;  1E1O A;  3GD7 A;  1V43 A;  1E24 A;  3PSI A;  4DV1 L;  1K8A C;  1HNX Q;  3HOU G;  4P72 A;  1IBK Q;  4JOI C;  5IP7 G;  2WB1 E;  2NN6 G;  5E7N A;  3HOW H;  2I5M X;  2N8N A;  4UP8 A;  1FL0 A;  1XPR A;  1N32 Q;  1P16 A;  1Q1B A;  1X65 A;  4JI1 L;  5IY0 A;  4LFC Q;  1EYG A;  3HKS A;  1CKN B;  2LXK A;  2OQK A;  3AEV A;  2NZH A;  2UU9 L;  3T1H Q;  2D0O A;  4A3C G;  1HR0 W;  2CKZ B;  3MXN B;  2IX0 A;  3J80 c;  4GNX C;  3PO3 G;  5GAD C;  1KQS A;  1AE2 A;  3D31 A;  3TS2 A;  2DUD A;  1YHA A;  2V1C C;  5C0X J;  1PH3 A;  4H02 A;  1D8L A;  1CUK A;  1H95 A;  4DV3 L;  1PH2 A;  4BBS G;  1L1O A;  3S24 A;  1PH8 A;  3OTO Q;  2R93 H;  4HJ9 A;  1JMC A;  5BR8 L;  4DAM A;  4QL5 A;  4HJ8 A;  3AFQ A;  5M3F G;  3S14 H;  2XGT A;  1MKH A;  1XNR L;  2UXD Q;  4YWM A;  4BBR G;  3NBH B;  3NEM A;  2E2J H;  2R7Z G;  5LMN W;  4JI8 Q;  4GS3 A;  3WWV A;  1Q46 A;  3ULL A;  4LFB L;  3J7Z C;  4P75 A;  5IWA Q;  2Q2U A;  1HH2 P;  4A3B H;  4P71 A;  2R7D A;  4LUV A;  1WCM G;  1W3S A;  4LW1 A;  1X56 A;  3SGI A;  3JAM c;  4GNX B;  4IPH A;  3FHW A;  4X64 Q;  1X3F A;  4AYB G;  2VW9 A;  4A3E G;  1XMQ Q;  4TVA B;  2JA7 H;  3S2D H;  3W5O A;  4LFC L;  4WJ4 A;  1N36 L;  4IJL A;  1S3O A;  4JCV E;  3CCU A;  1J5E Q;  4L5R C;  4KHP Q;  4IFD J;  1NMF A;  2N78 A;  2ZM6 Q;  3KDF B;  1L2F A;  2JA9 A;  4OX9 Q;  3G4S A;  4JI5 L;  2EIF A;  5M3M G;  3GO5 A;  4C3J H;  3DLL A;  1ASY A;  3CD6 A;  4Y7N H;  2HT1 A;  1KD1 C;  1C9O A;  1G6P A;  1PH1 A;  1VQG A;  4DKA C;  4JI4 Q;  1WYD A;  1XPO A;  1VQ9 A;  2PQA B;  3RZO H;  3S1Q H;  3PCO B;  3NEL A;  4YWL A;  2WFW A;  5M5Y H;  5FLM G;  4LUZ A;  1VS0 A;  4JI3 Q;  2WAQ G;  1VCI A;  3M3Y H;  4LF8 L;  1TWG H;  1Z9F A;  3PV0 A;  1KRT A;  3TQY A;  1GM5 A;  4LF7 L;  5IP9 H;  1I6H H;  3GTL H;  1IYJ B;  5GRO A;  1WOC A;  2UXD L;  1C7Y A;  4A3D G;  4DV6 Q;  3J81 j;  1W2B A;  2NVQ H;  4JV5 Q;  1N34 Q;  2K5H A;  4LWC A;  3HOX H;  3HFZ B;  4AQY L;  1O7I A;  2B29 A;  3S1N H;  1WFQ A;  1I3Q H;  4IFD G;  1OTC A;  1GVP A;  2PNH A;  1L1O C;  5DLQ E;  4EX5 A;  4JBM A;  4A3J H;  3TRE A;  4DNI A;  3RN5 A;  1VQO A;  4OWW B;  1IL2 A;  2CFM A;  4DUY Q;  3PUZ A;  2KHJ A;  5IYC G;  4HJ7 A;  4C2M H;  1JJ2 A;  1XNQ L;  2F4V Q;  1Y1W H;  2CWA A;  1BKB A;  4DUZ L;  4B3T L;  3RN2 A;  1CKM A;  3HOY G;  3M4Q A;  4JBW A;  3H15 A;  2K5V A;  3I4N H;  4ALP A;  5JEA G;  1PH4 A;  4A3F H;  3KF6 A;  3F1Z A;  1VQK A;  3UE0 A;  4IPG A;  2KHI A;  4A75 A;  1I94 Q;  4JI6 L;  5JJK A;  1V9P A;  4DV1 Q;  1I5F A;  3K80 C;  1YJW A;  1IBM L;  3ER0 A;  1PFS A;  2OTL A;  2IHE A;  4A93 H;  2HIV A;  1L1O B;  1VQF A;  4YHH L;  1QZG A;  1X3E A;  3I56 A;  4JG2 A;  1XMO L;  2JA8 H;  3LGJ A;  4JI1 Q;  4MTN A;  1DGS A;  2NZO A;  3Q8D A;  1K8G A;  3B6Y A;  4JV5 L;  3IRB A;  1VQH A;  2I5H A;  1HNW L;  1AE3 A;  1GD7 A;  2RF4 A;  3STB C;  2MNA A;  4DR3 L;  2UU9 Q;  1C0A A;  3VDY A;  2MFI A;  2BH8 A;  2MO0 A;  1FJG L;  4O2D A;  4A4I A;  1M90 C;  1A8V A;  5IE8 A;  4YY3 L;  3S1R H;  4JI7 L;  4MZ9 A;  4DUY L;  3E9I A;  4DV3 Q;  2I5L X;  2B3G A;  2FXQ A;  3ICE A;  4A3G H;  4GKJ L;  2ZJR A;  2JA5 G;  3CCE A;  1FVI A;  4A3L H;  4IPD A;  5BR8 Q;  3FP9 A;  2D0P A;  4DV5 L;  2GVA A;  4HIK A;  1TWA H;  3AQQ A;  3E9H A;  4IPC A;  1A63 A;  3I2Z A;  3FKI H;  1KIX A;  2YYZ A;  1Z47 A;  1VQC A;  4HIO A;  4O0A A;  4X62 L;  4KHZ A;  3I4M G;  1K3R A;  4LFB Q;  2NVT H;  5LMU L;  1PV4 A;  2Y0S E;  3K0X A;  4NB3 A;  1B7Y B;  5FJ8 G;  2UUA L;  2B63 G;  2IY5 B;  3CW2 C;  1NMG A;  3J81 i;  4DR6 L;  1BBU A;  3L2P A;  1V1Q A;  2K14 A;  3F2D A;  3M7N A;  4LF6 Q;  2KEN A;  1N36 Q;  3RLF A;  3H0G G;  3U4V A;  1JB7 A;  2UUB L;  2AKW B;  3RNU A;  1VQN A;  1SFO H;  1PVO A;  3H3V H;  4JI5 Q;  3RLN A;  1VQ6 A;  4NXM Q;  3M4P A;  4R1J A;  1TWH H;  3HOU H;  1LUZ A;  4A3M G;  1R9T H;  1X9N A;  5IP7 H;  4IOA A;  3GTM H;  3I4O A;  1E7Z A;  1G51 A;  2GN5 A;  2MQH A;  3CC2 A;  3T1Y L;  3PO2 G;  2IHF A;  2R6G A;  3HKZ E;  3ERS X;  5J3B A;  5HY6 A;  3U58 A;  2DGY A;  3KOJ A;  1BVS A;  4LF8 Q;  4LFA L;  2K5N A;  2VNU D;  1YEZ A;  4LF7 Q;  2OCE A;  2I0Q A;  4A3C H;  5JJI A;  1QVF A;  4DK3 C;  1OXV A;  1RIP A;  5ELO A;  5JJL A;  2JQO A;  3JC6 6;  1YHQ A;  3PO3 H;  1KRS A;  2CWP A;  1VQ4 A;  4AQY Q;  1SR3 A;  3KF6 B;  5C4X G;  4YWK A;  2AWO A;  4BBS H;  1YIT A;  4GLA C;  2UXC L;  1UWV A;  1UE7 A;  4K0K L;  1EQQ A;  2PMZ E;  1QUQ B;  3OYY A;  4QQB X;  3K7A H;  1PA6 A;  4LF6 L;  3A5Z B;  5M3F H;  1NJI C;  3HOV G;  2YTY A;  1XNQ Q;  4DR4 Q;  3GDE A;  1NBW A;  3GTQ H;  4BBR H;  4DV0 L;  1KAW A;  1SRO A;  2R7Z H;  4DUZ Q;  4B3T Q;  1YI2 A;  1GO3 E;  4NXM L;  2HHH L;  1JJC B;  2GVB A;  3PUY A;  3W1G A;  1X55 A;  4JI0 L;  1WCM H;  2WP8 J;  4FDB A;  1KXL A;  4YCU A;  1X6O A;  3UDG A;  4Y52 H;  1TWC H;  3STB D;  4A3E H;  2Q2T A;  4JI6 Q;  1XJV A;  1XPU A;  2ID0 A;  2H5X A;  4B3S L;  5GAG C;  1NY4 A;  2JEA I;  1IBM Q;  5JEA J;  3BZC A;  4B3R L;  2LSS A;  4DV7 L;  4IOC A;  2BA0 A;  4EQ5 A;  1SRU A;  4YHH Q;  2K4K A;  1VQD A;  1EUJ A;  4GN5 A;  1A0I A;  1Q1E A;  4DV2 L;  5M3M H;  1XMO Q;  1S72 A;  4JI2 L;  3UE1 A;  2JK8 A;  4R4I A;  4BA2 I;  4BY7 G;  1VQE A;  1PYS B;  1HNW Q;  3ZJY C;  1HNZ Q;  1B8A A;  4GLX A;  2F3I A;  4DR3 Q;  1XTD A;  2ALY B;  4J15 A;  4MNO A;  3PF4 A;  1VQJ A;  1YZ6 A;  2RCN A;  1NTG A;  2WB1 G;  2BA1 A;  1FJG Q;  3CCQ A;  5FLM H;  4YY3 Q;  1VQ8 A;  2NVX H;  4JI7 Q;  3CCS A;  2VUM G;  1LTL A;  4L5S A;  1ASZ A;  2HIX A;  4DR4 L;  1YNX A;  5AJ3 Q;  1T9H A;  1OXX K;  2BH2 A;  1I50 H;  3PGZ A;  4A3D H;  3CXC A;  5GAH C;  1PH5 A;  2YV5 A;  1E22 A;  4OWX B;  4GKJ Q;  1CSQ A;  4B3R Q;  4PG3 A;  2C35 B;  3UDF A;  1CKN A;  3ULP A;  4DV5 Q;  1MJE A;  3U50 C;  4OXP A;  1KC8 C;  4QGU A;  4BA1 I;  2VQE Q;  1N33 L;  4DPG A;  4PZ6 A;  5C3E G;  3KYH C;  1BBW A;  1Y1V G;  1Q7Y C;  4LF5 L;  1D7Q A;  5IYC H;  1K83 H;  1P8L A;  4PZ7 A;  4X62 Q;  5H1S E;  3KJO A;  5C0X I;  5LMU Q;  2EXD A;  4GKK L;  2KBN A;  2A19 A;  2R7F A;  2UUA Q;  2UUC L;  2K75 A;  2R92 G;  4BXX G;  1Q12 A;  3HOY H;  4DR6 Q;  4R4Q A;  3HOZ G;  1JJG A;  4JOI A;  5M5X H;  5IYB G;  1HJP A;  3CC7 A;  1G29 1;  3CAM A;  1HNZ L;  4AIM A;  4A76 A;  2UUB Q;  1HR0 L;  5C44 G;  4DR7 L;  3L7Z C;  5ELN A;  1CKO A;  1KHI A;  2JEB I;  1B70 B;  1VQ7 A;  3GTG H;  2IX1 A;  4L5T A;  1HZC A;  1J6Q A;  4PZ8 A;  3J81 c;  4A3I G;  4B3M Q;  3CC4 A;  3S17 H;  2L15 A;  1U5K A;  5IYD G;  3TRZ A;  3EBE A;  5AJ3 L;  4R4O A;  5IT9 c;  1RL2 A;  3T1Y Q;  1QVC A;  2JA6 G;  3G48 A;  3D0F A;  4R4C A;  4AYB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...