2Y0SE

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
170
structure length
164
Chain Sequence
MYKLIKARSIVRIPPNEFGKPLNEIALNELRQQYQEKILKDLGLVLAILNVKTSEEGMLVFGDGATYHEVEFDMITYVPVVQEVVEGEVLQVDNYGVFVNLGPMDGLVHISQITDDTLKYDNVRGIIFGEKSKKVIQKGDKVRARVISVASPRIALTMRQPYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 16
structure length 164
sequence length 170
chains with identical sequence T
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2y0sE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2y0sE01
2B29A 1CSPA 1M1KC 1GVPA 2LSSA 4GOPC 3CF5A 4LNQA 3PO3H 2ZJRA 1N9WA 2AHOB 2K50A 5HGQA 1G51A 3STBD 2IHFA 4DV2Q 3GDEA 1HZBA 1QZGA 5JJKA 1N36L 3D0FA 2UXDQ 3SGIA 1VS0A 3K80C 1Y1WG 3GO5A 1BBWA 3U50C 3RN5A 3HOUH 3G48A 4DV1L 5DLQE 2K75A 1N34L 3CCEA 3M3YH 1WOCA 1GM5A 4DR6Q 1IBLL 3M7NA 4RMFA 3HOYH 1VQJA 3KJOA 5LMNQ 2IHEA 4YCVA 4X66Q 4HJ9A 3KDFA 2UXBL 4IFDJ 4A93G 4A3KH 4JI7L 1L1OA 4BY1G 2C35B 2ZTEA 4HJAA 3HOVG 4A3MG 2CWAA 2E2JH 2CQOA 4C2MH 1WCMH 5M3MH 3CCLA 1FGUA 2EQSA 3TEHB 3UDXA 1NTGA 5M3FH 3BZKA 3H3VH 1P16A 2CFMA 1NJIC 1S40A 2VS1A 4JOIA 1CUKA 3RN2A 2B63H 2VNUD 1N36Q 2AMCB 2Z6KA 2A1AA 2N3SA 1K0RA 4DNIA 4JI8Q 2K5NA 1VQLA 2UUCL 4TQUS 4EQ5A 1HZCA 5IYBH 4JOIC 4DR6L 4DV0Q 4IFDG 3G4SA 1X55A 2YTYA 1XMOQ 3PF4A 1XMQQ 4X66L 2ZJPA 2UUAQ 1CKNA 2CWPA 4IPDA 2WAQG 4A3IG 1FJGQ 5GROA 2K5HA 2VY3A 4NXMQ 1LM0A 3PUYA 4DV6Q 1IBKQ 1HNZL 5FJ8G 1E7ZA 2VW9A 2EIFA 3GTLH 4GKKL 4QIWE 4B3TL 5LMUL 4DR1Q 3I4OA 1MKHA 2F4VL 4A3DH 2Q2IA 5IP9G 4A3KG 1YITA 4AYBG 1KXLA 3KF8B 5AJ3Q 4DR7L 4JI2L 2MO0A 1VQGA 1VQEA 3FKIH 1EQRA 2ASBA 4POFA 1YHAA 1EIFA 4JI8L 4KI0A 2KENA 3NELA 4OONA 3S24A 3S1RH 1KIXA 3H3VI 4JI4L 3HOZG 4DR4Q 3AQQA 5M3FG 5FLMH 2BH8A 2JA9A 4YWMA 3I4NH 4IPGA 4BXXH 3G71A 5GQOA 1SLJA 1Q86C 1XMQL 3CCSA 2K5VA 1WFQA 1LYLA 2KHIA 1QUQA 4X62L 4B3MQ 1NY4A 3ULJA 4ALPA 2UXBQ 3CXCA 5BR8Q 3UDIA 1S3OA 3CCRA 3DM3A 3HOZH 4GNXB 1XNRL 1TWAH 4A3EG 1VQBA 1QZHA 2JJQA 1EFWA 2NZHA 3KFUA 2N78A 4LFCQ 4GNXC 1N33Q 2R7FA 1Y1VG 3GTGH 5EAYA 3HKSA 4JI1Q 5IP9H 4P72A 1PH2A 4LFAL 3HOXH 1XPRA 2IX1A 5C44H 1SMXA 1PH6A 4Y52H 1K83H 1C7YA 2IX0A 4HJ8A 1ASYA 4BA1I 1KQSA 2PNHA 3M85A 1H95A 2PQAB 4A3CH 4DR3L 1TWHH 1VQ6A 3CPFA 4O2DA 4DUZL 2JA5H 4X6AH 2AWNA 5IWAQ 4X62Q 3PIPA 3K8AA 1K3RA 4QY7A 5HY6A 4JBWA 3F1ZA 3H0GG 3M9BA 1XNQQ 4XIGS 1HNXQ 4A3BG 3M4PA 3J80c 3PGZA 1JMCA 1SN8A 3U4ZA 3PUXA 4YY3L 2BA1A 4PMWA 3PIOA 4NB3A 3PO3G 4OO1I 1UE6A 4GN4B 2B3GA 2D62A 2E8GA 2KHJA 2RCNA 1VQ4A 1HNZQ 4A76A 2WB1G 3CD6A 2NN6G 2F4VQ 4UP8A 1VQHA 5IYBG 2BH2A 1X3EA 2HT1A 5JJIA 1N8RC 4YHHL 3J81i 3J81c 4A3FH 4C3IH 3J7A5 3M4OH 3HOUG 4IJLA 1TWFH 4JBMA 4JI5Q 3F8TA 1E24A 4B3RL 3S17H 3F2DA 1A0IA 1PH9A 4DK6C 3T1YQ 4DR4L 2K52A 4A93H 1Y14B 2ZTDA 3D31A 3PUWA 2R6GA 3J80i 4DAMA 3HFZB 4LF8Q 2NN6I 2Q2TA 3TRZA 1N32Q 4A3MH 2HIXA 4JI3Q 2OCEA 4A4IA 1TXYA 1S72A 4JBKA 4IFDI 3L7ZC 1Q7YC 1X3GA 4HJ7A 4O0AA 2JA5G 4LF5Q 2UXCL 1MJEA 3ZJYC 3EBEA 4Y7NH 5GAGC 4A3GG 2N8NA 4JCVE 4MZ9A 1KRTA 4PZ8A 1V9PA 3FP9A 2Y0SG 3WWVA 2WB1E 3U58A 1YJNA 3PUVA 2VQEQ 2PQAA 4JI6L 4DUYL 4IPCA 1U5KA 1HR0Q 2JA8G 3ER0A 1BVSA 2VL6A 4FDBA 3RLOA 2CCZA 4JYAL 5C3EG 1J5EL 2UUBL 1SRUA 2IT1A 1WI5A 1KL9A 4YWLA 4X65L 4DR5L 5M5YH 1OXTA 1DGSA 1GO3E 4C3JH 4X64L 4NXNQ 4LF8L 3VDYA 1TWCH 5GAHC 2D0OA 4LF7Q 3UDFA 3J81j 3W1BA 4DR2Q 4POGA 1Y1WH 1VQOA 4JI3L 2JE6I 2E5LL 2MO1A 1G291 3GTQH 4DR3Q 3L2PA 1R9TH 1PH1A 3G6EA 1JB7A 5LMNW 1OXUA 4YCWA 4LF4Q 2UXCQ 4K0KL 3RLNA 2E2HH 3TS0A 4LFBL 4LF9Q 2JA6H 4IOAA 4EX5A 4MTNA 1HNXL 1Y1VH 1VQ8A 2JEAI 1KD1C 2VZAA 1LUZA 1QUQB 2Z0SA 3ERSX 5C0XG 4AQYQ 2NVQH 3NENA 5C44G 1RIPA 3STBC 4DV2L 2DGYA 1G6PA 2R7ZH 2UXDL 2D0PA 5FLMG 4BY7H 4JYAQ 4AYBE 1PHJA 1V1QA 4B3ML 1Q1BA 3ULPA 1J5EQ 1Q8KA 4R4TA 1YNXA 4DV1Q 1YZ6A 5ELNA 2I5LX 2H5XA 4YHHQ 3CCQA 3BZCA 1IYJB 3GTOH 4WJ4A 1YBYA 3NBHB 1SROA 2F3IA 4JC0A 4NXNL 3H0GH 3TQYA 5C4XG 4IOCA 1U0LA 4DR2L 2JA8H 3S15H 3EIVA 5C3EH 1XJVA 2EXDA 3NEMA 1VQDA 4LWCA 2PMZE 2KCMA 4JI7Q 4IJHA 1FL0A 4B3RQ 1TWGH 4B3SQ 4C3HH 3RZOH 4WJ3M 1A63A 3MXNB 2RHSB 2QEXA 3CC7A 1EIYB 4DV3L 3PUZA 1HH2P 1B7YB 3AYHB 1X6OA 1PH7A 1B8AA 2ZM6Q 3HOWG 2MQHA 5IY0A 2VQFL 2OWOA 4A3FG 4JG2A 3UE1A 2QGQA 1X54A 5IP7H 1PA6A 1SE8A 2JA7H 3I55A 4GOPB 1L1OC 3KF6A 2HQLA 4GN5A 3UE0A 4GLVB 5FJ8H 2MNAA 3HOXG 4DV5Q 1EUJA 1HR0W 3GTPH 1YVCA 2I5MX 1PH3A 3Q8DA 5C0XJ 3S16H 4A3DG 3GTMH 2Y0SE 3CCJA 1I5FA 4DV0L 4DUYQ 2UUCQ 1IXRA 3AFPA 1E1TA 2HIVA 3JAMc 4DV4Q 2Z6KC 3MEFA 1HR0L 1XMOL 3CCVA 4AIMA 4A3LG 2IY5B 2NVYH 2PI2E 3CQZH 3E9IA 5IE8A 4LF6Q 3GTKH 2UUBQ 3CW2C 3L0OA 1WJJA 2GVBA 3CCMA 1HNWQ 4AH6A 4UY8C 5J3BA 4L5SA 3I7FA 1UEBA 4DPGA 3U4VA 4GNXA 4PG3A 1C9OA 1CKMA 3AEVA 1JJGA 4LUVA 1IBKL 1T9HA 3M4QA 4UP9A 2ZM6L 4HIOA 4OX9Q 4JV5L 4GLAC 2OQKA 1Q12A 3K7AH 1I94L 1Q81C 5LMUQ 4DR1L 3CC4A 2XGTA 3K0XA 1SR3A 3KDFB 3TS2A 2BA0A 4K0KQ 3TREA 3S14H 2AWOA 4XTCS 5AJ3L 1VQIA 3E0EA 3KLWA 4A3JH 2VUMH 1X65A 5IYCG 4AQYL 1I3QH 3J7ZC 3A5ZB 5IP7G 4JI0L 5IYDH 4BY1H 1O7IA 3S2DH 1OXVA 1EOVA 1K73C 3HOYG 3CMAA 1WYDA 3F2CA 1IBMQ 2E2IH 3CC2A 1CKOA 4JBJA 2YU9H 2K4KA 2R92H 1HNWL 1YHQA 2MFIA 1Q1EA 1VQKA 2UU9L 1QVGA 3CAMA 1UE7A 1AE2A 2WAQE 1JJ2A 2OTLA 4R4CA 1K8AC 4QJFA 1JE5A 4L5QA 1NMFA 1Z9FA 3A74A 4R4IA 2UUAL 4OX9L 4A3GH 1FJGL 4NXML 1V43A 1XTDA 3A0JA 1I94Q 4DV6L 1RL2A 1E1OA 1FVIA 2KCTA 1XNRQ 2KBNA 4GKKQ 3W5OA 4DV3Q 1QVCA 3OYYA 4P73A 2ALYB 4A3BH 4A75A 4HIMA 4GLXA 1K9MC 1PH8A 3CMEA 1HJPA 4DR7Q 1P8LA 3B6YA 3JC66 3DLLA 4BBRG 4DV5L 2AKWB 4KLKA 1KRSA 2HHHQ 3HKZG 1KHIA 2WFWA 4IPHA 4L5TA 1YEZA 3AFQA 4UP7A 4JI2Q 1Q46A 1EYGA 4KHPL 1D7QA 4JI4Q 1PFSA 2YYZA 2ATWA 5IWAL 1KAWA 2OQ0A 3RZDH 3PO2H 2ZTCA 1HZAA 1AE3A 1VCIA 4DV4L 5JEAG 5IYDG 4DUZQ 3RLFA 5E7NA 4LF6L 3I56A 2ZJQA 2FXQA 4DV7Q 2Q2UA 2JA6G 1L0WA 2R93H 4UPAA 2YTVA 2XTIA 4ME3A 4YY3Q 1M90C 3BJUA 3LGJA 4P74A 1UWVA 4DK3C 5GAEC 3CPWA 2JA7G 3K7UC 2ES2A 2R92G 1KC8C 3S1MH 2YTXA 4NPSA 1NMGA 3EN2A 4BBSH 1VQFA 1L1OB 1OXXK 5K36G 4P71A 3CCUA 1BBUA 1NE3A 5FLXc 4JV5Q 3HKZE 3KYHC 1MJCA 4LUZA 3RNUA 4OWTB 4LUOA 1GKHA 4MNOA 5BR8L 4HIKA 3F2BA 2F52A 1PH4A 1SFOH 3HOVH 4A3LH 1JJCB 4LFCL 2NVXH 2L15A 3UDGA 1E22A 4OWWB 1VQMA 2A19A 4JI1L 1K8GA 1W3SA 3CP0A 4GKJQ 4OO1G 1VQ5A 1N33L 1D8LA 4R4QA 4JI0Q 2B63G 1UE1A 3T1YL 1N32L 4LFAQ 4LW1A 1IZ6A 1IBML 4DV7L 3T1HQ 1W2BA 2GN5A 1ASZA 5JEAJ 3KF6B 2ID0A 2UU9Q 4P75A 3H15A 4IO9A 1VQNA 4PZ7A 1YJWA 5IT9c 4A3EH 4BA2I 4GN3B 5IYCH 1EQQA 2R93G 4HJ5A 4A3IH 1XNQL 1YIJA 1A8VA 2RHQB 1CKNB 1E3PA 1YJ9A 4J15A 3KOJA 4R4OA 4DKAC 1PH5A 1B70B 5JJLA 3BU2A 1C0AA 1Z47A 4JI6Q 1X9NA 1VQAA 1AH9A 4KHZA 2N49A 3PSIA 1I50H 1MIUA 5C0XI 4KHPQ 1I6HH 4GKJL 1CSQA 1J6QA 3PV0A 4DR5Q 3OTOQ 4PZ6A 1PYSB 2R7ZG 3PF5A 1JT8A 4BY7G 2HHHL 1PV4A 2DUDA 5M5XH 4RG1A 3OW2A 2E5LQ 1BKBA 3ICEA 1NBWA 2CKZB 4JI5L 1XPUA 3I4MG 5H1SE 3I2ZA 4QQBX 2NZOA 3I4NG 5C4XH 3E9HA 4QL5A 2Q2HA 1X56A 3GTJH 1OTCA 2PI2A 4OWXB 5M5WH 4LF9L 1QVFA 4LF4L 1IL2A 3S2HH 4GS3A 4LFBQ 3IRBA 2WP8J 5C4JH 4YWKA 3K81C 4R1JA 2V1CC 1LTLA 4H02A 3ULLA 3FHWA 4A3JG 1XPOA 4LF5L 1VQPA 2VUMG 4BBRH 2LXJA 2JQOA 1Q82C 4YCUA 3W1GA 1UE5A 3HOWH 3KJPA 2I5HA 3A5UA 1L2FA 2GVAA 2JK8A 1VQCA 1GD7A 2R7DA 4OXPA 1EWIA 2RF4A 3JAMi 3S1NH 3PO2G 3PCOB 2NVTH 2K14A 2LXKA 3OTOL 2VQEL 4L5RC 1VQ9A 4X65Q 2YV5A 3FKIG 1A62A 2JEBI 4QGUA 1VQ7A 3GD7A 4APVA 1N34Q 4LF7L 3S1QH 4BBSG 1IBLQ 5GADC 1X3FA 1YHBA 4TVAB 4X64Q 4B3SL 5LMNL 2QA4A 2A8VA 4BXXG 4GOPA 3RR5A 2I0QA 4B3TQ 3T1HL 4A3CG 1PYBA 1WCMG 1OXSC 1HZ9A 5M3MG 1PVOA 2OTJA 3I4MH 2VQFQ 5ELOA 1YI2A 4HIDA 4DAYB
chains in the Genus database with same CATH superfamily
2B29A 1M1KC 4GC7A 4LAAA 1LTTD 2BE5C 3MAQA 3CF5A 1N9WA 2K50A 4DV2Q 2FINB 2JA7B 4GKJH 3TZUA 1B53A 3L4KA 1Y8OB 4O42A 2FFKB 4ABNA 1N36L 3NBHA 1SMYC 1PRTF 4HNUA 1TIID 1B4OA 3U50C 3D6CA 3G48A 2G5DA 3C0FB 1GM5A 3M7NA 4RMFA 4A3FB 1VQJA 2WAQA 2IHEA 4IALA 4X66Q 3KDFA 2J0TD 4YAKB 4RKLA 1G2SA 1L1OA 4BY1G 2UVUA 4HJAA 3L3OC 3HB9A 4IRKA 2R8JA 4YR0A 2VR1A 3CCLA 1RF2D 1F9SA 4KHVA 1NJIC 1N36Q 2AMCB 2ZXRA 2N3SA 4ZKCB 1WCMA 4DNIA 2RDGA 2K5NA 1E2VA 2XVSA 4JI8Q 2O5JC 3MR3A 1PK8A 5IYBH 5BMVF 5DQGA 5EPJA 4Q5VA 4A3GB 2PMZA 4Q44A 5I6YA 3BQ2A 2NU8B 5KFOA 1CKNA 4IPDA 2MJ8A 4A3IG 1FJGQ 3K57A 2K5HA 1E4GT 4NXMQ 1YNND 1IBKQ 4ZCKA 3NK9A 5C4ZA 1K0SA 2NVTB 5DQIA 1E7ZA 4GKKL 1Q3LA 5LMUL 3I4OA 4X3UA 2WTFA 1VMCA 1BUVT 2UVWA 4FU0A 1SE2A 4AYBG 2YL2A 3RB4A 3KF8B 4KKUA 1VQGA 3GTMB 4ED3A 3NELA 1CI3M 1KIXA 4C5AA 1H9JA 2SDFA 4Q8EA 3I4NH 1KDAA 4CDCC 4BXXH 2YYAA 2N55A 5GQOA 1Q86C 5KG6A 1B2TA 1LV9A 1U4MA 2KHIA 3HKZB 5KT5A 4DFAA 1QJOA 4EG0A 3FVQA 4S3SA 2K33A 1G2TA 2F0UA 2GLTA 2R61A 3L9AX 1C30A 1LTRD 3CXCA 3UDIA 4HNVA 3HOZH 2JEJA 3U9OA 2B2YC 4GNXB 4B3TH 3GV3A 1X3QA 3SK8A 4CDDC 1QZHA 1EFWA 2NZHA 4HN7A 1N36H 1N33Q 2F0QA 4YIJA 3GTKA 4BS9A 4NP5A 5EAYA 3HKSA 4JI1Q 4U6PA 5KYIA 2KEDA 5NUCA 3HOXH 2IX1A 2F0EA 4BA1I 2EY2A 3GTGA 2ZXPA 4O2DA 4O1NA 2JA5H 2RKSA 2RSNA 3Q8SB 3K8AA 4QY7A 3WNZA 3F1ZA 5IGCA 1O7LA 3M4PA 4HMJA 4ZK9B 4M9UA 3J80c 3U4ZA 2BA1A 1QG7A 3A8JE 4PMWA 4OO1I 4ECRA 1CE8A 2XRSD 2RCNA 2WB1G 3I91A 3CD6A 1VBHA 1I6HB 3AMUA 2CZGA 1S0MA 3FDSA 5EOYA 3HKZA 4LFAH 5JPNC 2P5ZX 2FPIB 3GV5B 1Z2OX 3JSNA 2R93B 1D5MC 1D6EC 4IJLA 1TWFH 4V190 1KLUD 4A3MB 2KECA 4JBMA 1KJ8A 4JI5Q 2B2VA 3U9TA 3F2DA 4DR4L 2K52A 3PUWA 1AN8A 3E5NA 5KFMA 3HFZB 2FE3A 1PZID 2NVQB 2MUYA 4IUQA 1SFOA 2HIXA 2K03A 3M4YA 1TXYA 2M9VA 3BDCA 3JZIA 4E6IA 4JBKA 1NR4A 1WTHA 3JRXA 5BN4A 2JA5G 3FKIA 4JI5H 4EYIB 1RODA 3EBEA 3LNNA 5CV9A 4HAEA 1S5DD 4JCVE 1U4RA 4MZ9A 3TZDA 1BF4A 2Y0SG 5D1OB 5DNFA 3U58A 3PUVA 4KN7C 5KGUA 2L4NA 4HMIA 3MFYA 3MXUA 3ER0A 2VL6A 4FDBA 3Q8QB 2GA4B 3VPCA 5IT9W 2PNRC 5C3EG 2IT1A 4DR5L 1HQMC 1KL9A 1WI5A 3MFGA 4YWLA 4LF7H 4IQZA 2J9GA 2L1BA 5LL6b 1DGSA 1FKAH 2F0GA 3UI2A 3VDYA 2JEIA 3W1BA 1HA5A 5D1OA 5D8DA 1L0XB 1VQOA 4MA0A 4QUFA 1G291 1EIHA 4LSXA 1I4XA 2F1MA 4P2CB 3C46A 1F9PA 1R9TH 1PH1A 4FF3A 1B6SA 1OXUA 4LF4Q 4HEDA 4LFBL 4LF9Q 1KC7A 1UUPA 1HNXL 2EJGC 3VR2A 1VQ8A 1SEIA 5E1FA 3TQ1A 3GTPB 4DR6H 5C0XG 2MCTA 2DGYA 2R7ZH 5M3MB 2D0PA 4TSSA 5FLMG 4BY7H 2D2CC 1GUSA 1RKNA 1V1QA 4K6DA 3U9SA 5A2QW 1GHKA 3URYA 2RBMA 1YNXA 1M7JA 1YZ6A 5CV7A 3QIAA 1EUCB 4YHHQ 3VA7A 4WJ4A 1SROA 5C4XG 3H0GH 4IOCA 3RFCA 4DR2L 3BQ0A 3GILA 3S15H 1TS4A 5C3EH 1PX2A 4LWCA 4B3RQ 4WBNF 2EPBA 1FL0A 2VXWA 5CV4A 1DXMA 5LXTF 3MXNB 2KA7A 3CC7A 1EIYB 4J6HA 1M0WA 1B7YB 3VMMA 3GLKA 4F4WA 3TQTA 1PH7A 3HOWG 3QG1A 2SOBA 2QGQA 1AW7A 4HNTA 1SE8A 1XTCD 1HUNA 5C3XA 4A2BA 4I65A 1KBLA 2MNAA 4DV5Q 3HOXG 5FJ8H 3GTPH 4F4YA 4YQWA 1YVCA 2I5MX 1PH3A 5CAEB 2EYJA 5C0XJ 3S16H 5KFDA 2AQ1B 3GTMH 3ND9A 2UUCQ 3KBGA 3JAMc 1B6RA 3TDQA 3CCVA 2I8CA 2FLNA 2NVYH 3CQZH 4LF6Q 1N32H 4QMGA 4BY1B 3GTOB 1DOMA 2L12A 2AGPA 2FPPB 2P0AA 2DY7A 3A56A 3IKJA 3CVZA 4UY8C 2DN8A 5J2UF 1UEBA 4GNXA 4JV0A 4JPBW 4PG3A 2B2UC 4RGTA 3T1HH 1C9OA 1QNUA 3AEVA 3DEOA 1T9HA 3K5OA 3M4QA 4UP9A 5CC4A 2OQKA 2V4QA 4CJ2C 1I94L 5LMUQ 3GQCA 3N52A 3OUZA 1CHPD 4RGNA 2CHBD 1HNXH 4EGVA 3S14H 2WAQB 1VQIA 3E0EA 3KLWA 4O4LF 3OIQA 5IYCG 1AFPA 1I3QH 5KFNA 3A5ZB 3K7AB 3TMEA 4JI0L 4YHHH 2EYPA 1OXVA 5KFZA 2VUMA 1ZYRC 1LT5D 3CMAA 4NKLA 4IRCA 1DCZA 5JVDF 2AQ3B 4OGQC 1YHQA 1E2WA 2HCCA 4RGOS 1Q1EA 4ED2A 4LF5H 1N33H 1QVGA 4JV5H 2BOSA 4R4CA 4B3ML 4L5QA 1NMFA 4CKCA 1FJGL 1B1ZA 1I94Q 1JLLB 1RL2A 3CQZB 2KCTA 1DZ1A 4I4TF 2KBNA 4GKKQ 3DM1A 1Z2PX 3RV4A 4P73A 2Y0SA 5KFWA 2WB1A 4GLXA 4ED6A 2MHVA 2B2WC 4DR7Q 1EYAA 1P8LA 1SYGA 3B6YA 4BBSB 4YJ3F 3DLLA 2KOLA 2Z9HA 1RJTA 4KLKA 1KRSA 2UUAH 3QO2A 4IR9A 3MXGA 1H9SA 4K2LA 3QJYA 1EYGA 3K3PA 2ATWA 1MD2D 3G6JB 3N44B 3I72A 5H80A 3PO2H 3RZDH 4K14A 3RLFA 1HHVA 1I3QB 3I56A 3GTQB 2F0SA 1L0WA 1C48A 1CA5A 3K5HA 1FGBD 4ME3A 1M90C 3GIQA 1V1PA 4X6AH 1CQIB 3S1MH 4UHVA 1KC8C 3EN2A 2SNMA 4FM9A 5C1OA 3GIPA 5CV6A 4NMZA 1V4YA 4IUNA 2XN9C 4KJNA 2C2DA 5KKNB 3KYHC 4LUZA 3RNUA 4BY1H 4O2AF 4AYBA 5BR8L 3F2BA 2F52A 3T56B 2W7OA 1TQOA 3BS1A 2ZM6H 2ZDQA 1JJCB 2K01A 4K2KA 3GTJA 5KFVA 3X3MA 2A19A 4BWSC 5G3LD 2R87A 1K8GA 2NVYB 4GKJQ 2W6OA 4DV2H 4TQSA 4RHRA 1VQ5A 1ZYRD 5D3IB 3QFFA 5CORA 2BDOA 4LFAQ 3I8ZA 1IZ6A 3VR3A 3J80W 4YJ2F 3IG0A 1ZHQA 5DEHA 3K5LA 1ENAA 2ID0A 3G6XA 3WOEA 3OOCA 1S03G 4HJ5A 1XNQL 2R85A 2O2LD 1YIJA 1E3PA 1YJ9A 5CA0F 2BE5D 1C0AA 3EJIA 3ETJA 1J5EH 1VQAA 5KG0A 3V6HA 3S1MB 4KHZA 4V0BA 1I50H 5C0XI 4GKJL 4DR5Q 1EUDB 3LWEA 1JT8A 2DUDA 3DXJC 4TV9F 3OW2A 1E2ZA 2WIIB 1NBWA 4OIJA 2B39A 5CV5A 1AN7A 5BN5A 2A73B 2RDHA 2VUGA 2L5TA 2BR0A 4AYBB 3E9HA 4QL5A 1VF5C 1X56A 1CM9A 1ZKOA 1QVFA 3VYRA 4Z9CB 5G3LF 4LFBQ 5D1PA 2VB2X 1D2BA 3ULLA 3BQ1A 3HG9A 1XPOA 2VUMG 1VQPA 2QDBA 4BBRH 4C5BA 1YNJC 1F9QA 3KJPA 4FF4A 4X3SA 4MTEA 2JK8A 4KHPL 1ILQA 5KFLA 3PCOB 3WOFA 3PVXA 1DV1A 2HVQA 2F0DA 5EJWA 2DNEA 4LF8H 4ED0A 2JA7A 3GD7A 4APVA 1N34Q 1CK1A 3K5NA 1IBLQ 3KHLA 1YHBA 3NP8A 5LMNL 1YNNC 1QE6A 5EWGA 1WCMG 1Y8PB 1HZ9A 5L1IA 3ITPA 4RGMA 1KNEA 2K05A 2VQFQ 1BOSA 1KJ9A 3T5LA 3OMCA 1YI2A 2HHHH 1RDPD 5L1JA 2RDIA 1HR0H 4PDBA 5T1IA 4EEQA 2IHFA 1STHA 3ZYYX 5KG7A 2EY6A 1Y8NB 5IGEA 3W3AA 3H0GB 2QDLA 2W9CB 1VS0A 1Y1WG 4A3BB 4EFBA 1XNRH 2RCFA 4RA8A 3RIZA 3RN5A 2EYFA 3M3YH 3CCEA 4DR6Q 5C5LA 1RD9D 1A3TA 2B8GA 3C1FA 3VA5A 2DJFC 4HTHA 4WFN3 3V2TA 3MJFA 2L9HA 3RAQA 2PZUA 1CHQD 4A3KH 3NXWA 4MV9A 4IZOA 4DL5A 4MAMA 4ECTA 2ZTEA 4X3TA 4ULLA 3TBIB 2E2JH 1EY4A 5KFAA 2KCNA 4KV6A 1WCMH 2HDMA 2EQSA 2L0CA 4J1MA 3TEHB 1NTGA 4ED8A 2XNAC 2CFMA 3H3VH 4JI1H 1S40A 1K1SA 3RN2A 1G91A 2F0JA 4LFCH 2A1AA 4G4KA 2W6PA 1K0RA 5IYZF 2VA2A 1VQLA 2UUCL 4EQ5A 1HZCA 1STGA 3MVVA 3H6MA 1CQVA 4DV0Q 4ETSA 1XNQH 3M3YB 1XMQQ 4X66L 3UFXB 2H4OA 2Y0SB 1JDBB 5KT3A 1H9KA 1I6VC 2YZGA 2HVSA 5GROA 2VY3A 1Y1WA 2MGSA 2TMPA 3NE5B 2F0KA 4PV1C 3PUYA 1Y69U 4BY7B 4UDUC 4H44C 4QIWE 5JJZA 4DR1Q 2VPSA 2Q8TA 4DV4H 4A3DH 5IWAH 1AUXA 5IP9G 4A3KG 3D6WA 4M7EA 4DR1H 2OEOA 1KXLA 3J81E 2K32A 2F0VA 4DR7L 1S97A 2MO0A 2RVLA 5C1PA 2YRWA 3BVMA 3KLSX 1YHAA 4DV5H 4JI8L 1CZWA 4RNNA 4JI6H 3CU7A 1TS3A 4DR4Q 5KG4A 4FO2A 2BQ3A 5FLMH 2BH8A 4YWMA 3J7AV 5BR8H 5IGGA 4J9QA 4DXGA 1XMQL 3CCSA 1LYLA 1I7LA 4MV8A 2ATLA 4B3MQ 4OX9H 1NY4A 3G8CA 1TWGB 2UXBQ 5J39A 1PLFA 3H40A 5BR8Q 1S3OA 3CCRA 4UCVA 4DV1H 3DWQA 1MZBA 1Z7TA 3VR4A 1I3QA 5ISRA 1JICA 1VQBA 5KFTA 2JJQA 3KFUA 2PW5A 1II3A 4GNXC 1J9OA 1DJRD 4RAYA 4DV3H 3GTGH 5IP9H 2QW7A 1PH2A 2JA6B 5CGKA 3WDNA 2NTTA 2QILA 3EYYA 2RGRA 3PMFA 1K83H 1C7YA 2IX0A 3HOWB 3NGDA 2K04A 2CQAA 2RSOA 5HGTA 1H95A 4A3CH 3MWDA 5LL6X 1TWHH 3BZDB 3CPFA 1VQ6A 5M5YB 4JI4H 2NTSA 3HOXB 2ASDA 4JBWA 4JW0A 5KT2A 2CW0D 1XNQQ 1HNXQ 1DOKA 4A3BG 2NYZD 3N8DA 1W6JA 3PUXA 4YY3L 3PIOA 3PO3G 3KLSA 2WKDA 4NB3A 3EROA 2ASLA 4MA5A 1SFOB 1EY8A 1B33N 1VQ4A 1TWGA 2J7ZA 1G8ZD 4RWSC 1XMOH 1QOHA 2NN6G 2F4VQ 4CDFC 2BH2A 2JP1A 4YHHL 5FO7B 5LL6S 4C3IH 4A3FH 3HOUG 1U4PA 2E5LH 4KJOA 4LF6H 1E24A 4B3RL 1U9RA 1PH9A 3PW0A 1UC9A 2R93A 4Y7NB 2ZTDA 4LF8Q 2ZDHA 2EY1A 3J80i 4EGQA 4KK7A 3GTMA 1I94H 4GC6A 3MR5A 3A8IE 1N32Q 3RMHA 1CQJB 2OCEA 5EKLA 1PTOH 1PFMA 1KDBA 1S72A 5E4WC 1O78A 1EEID 1X3GA 4LF5Q 4O0AA 2UXCL 2SCUB 1XMQH 1A2TA 2N8NA 4DK0A 3HOYB 4J0MA 4WJWA 1KLGD 4CDEC 1KRTA 1TWHA 4PZ8A 1V9PA 2IPKD 2W8LA 4DV6H 2PCFB 2VQEQ 1KDCA 1PRTB 4JI6L 3LP8A 1LT6D 4IPCA 1U5KA 1HR0Q 4K6LA 1E0BA 1BVSA 2CCZA 1STEA 4JYAL 1K8OA 2Z4IA 4EYHB 5KNCA 1ZETA 5LYJF 3GIMA 1SMYD 1OXTA 4X64L 1O7ZA 4C3IG 4NXNQ 5I6WA 4ED1A 2D0OA 3UDFA 3J81j 4BWGB 1RK6A 1ET6A 5A2QE 2E5LL 4K5VA 1TR5A 4RFBA 3GTQH 5A35A 3PW2A 2C28A 1KJIA 5JQWA 2CW0C 5LMNW 2UXCQ 5F2DA 3R5XA 5EWFA 3RLNA 3TS0A 4X66H 3GV6A 3PO2B 2FMAA 4ECVA 1Y1VH 1HTPA 2CVRA 1LUZA 2E2JB 5C44G 1RIPA 3KAKA 4UCOA 1G6PA 3D8GA 3I4LA 1ZXTA 5L37A 1ZQ7A 4LH7A 1B9NA 5IGFA 1ENCA 3N42B 3QOLA 4DF7A 1Q1BA 4LF9H 5KFCA 2W9BA 4B3SH 2H5XA 4K5WA 3CCQA 2HDLA 1HA6A 1RJRA 4NXNL 1DD2A 4JC0A 4XYOA 3EQLC 2YZNA 1U0LA 1K1QA 3MTSA 1WR2A 4YAJB 1XJVA 2EXDA 3NEMA 4ILWA 3M4IA 1EYCA 2KCMA 2PMZE 4IJHA 5D14A 3RZOH 3R5FA 1KAAA 1A63A 4DV3L 3VYSA 5BPFA 1J8IA 2MQHA 4RHSA 2VQFL 2LMCB 4JG2A 3UE1A 4ECUA 3RB3A 3J81W 1DV2A 5IP7H 5I9OA 1Y1WB 3HRZC 5KG3A 1L1OC 2AUKA 1BNCA 5J2TF 3K5IA 3R23A 2F4IA 1A3UA 1JC7A 3RJ0A 3S1QB 2G9HD 3HOVB 1GOZA 3TN2A 3CCJA 1I5FA 1IXRA 2NVXB 1E1TA 2HIVA 4DA2A 1HR0L 2Z6KC 2EXZA 2Z6BA 3HP3A 4AIMA 5C5JA 3E9IA 1I4QA 2GVBA 3CCMA 1HNWQ 2ICEC 4AH6A 2KUMA 3A7AB 3GIKA 2D9UA 3U4VA 4JVZA 2AUJD 3H20A 1JJGA 4RAZA 1EYZA 2R7LA 4DR7H 3H91A 1Q12A 4DR1L 4U673 2XGTA 3D4WA 1GYFA 3K0XA 4HYKA 3KDFB 4F50A 2BA0A 3AU7A 3GV7B 4XTCS 4CKBA 1F2LA 2VUMH 1X65A 4AQYL 4C2MB 2XWJB 5IP7G 2CH4A 4QW8A 3GIDA 1WD0A 1K73C 1WYDA 1IBMQ 2R86A 2E2IH 1BCPD 1CKOA 2YU9H 4XZ3B 2X0SA 2K4KA 4U7CA 4G3IA 1QCBD 3PIP3 5M5XB 1I50A 2UU9L 1UE7A 1JJ2A 1K8AC 1JE5A 2WACA 3LX0A 1Z9FA 4O4HF 1EOTA 2AQ4A 5FD6A 1T5XD 1V43A 2AGQA 1T5EA 4C3HB 1FVIA 4J9RA 4K8IA 1ENFA 4DV3Q 5I2YA 5KEEA 1IKMA 4CC5A 1PH8A 3CMEA 4F8MA 3DWAA 1GSAA 2QCPX 2R6FA 5JUMA 1H9MA 2AKWB 4ZKBB 5KT6A 2ZXOA 1KHIA 4IPHA 4L5TA 4UP7A 1YEZA 3AFQA 4JI2Q 2SNSA 3TP5A 1PFSA 3BYYB 3S2DB 3EFXD 1SXTA 3NSWA 1AE3A 5JEAG 5IYDG 3GTJB 1XX8A 3PQIA 5T1GA 1F2ZA 4C5CA 1M8AA 4UPAA 5A2QL 3CPWA 4QF4A 4DK3C 1UWVA 5GAEC 4RKBA 2JA7G 4AQYH 2ES2A 2ICIA 3K3VA 1MSGA 2K5QA 4PQXA 2XCAA 1AZPA 1GGOA 4XX0B 4RZRA 4KKTA 1L1OB 1OXXK 3M9OB 1JX4A 5CBAE 2Q8RE 2N88A 3CCUA 2I87A 5FLXc 2Z4HA 5LOVF 1RTOA 1B9MA 3T4AC 4Q8FA 4XYQA 3HOVH 1MGSA 4J9OA 2E74C 2R8IA 4OWWB 1VQMA 4L6TB 2JA5A 4FF2A 1M0TA 5LMNH 3CP0A 3DF7A 4DUZH 1IL8A 3HXLA 2Z1CA 2B63G 1UE1A 4LW1A 3BA8A 3PO3B 3MR6A 1M4VA 1IBML 3RAXA 1CA6A 4CJ1B 2EYHA 5HBRB 2W7PA 3GIIA 1ASZA 1KTKA 3NTHA 5I4DA 2UU9Q 4P75A 3H15A 5DG9A 1YJWA 4A3EH 3JRWA 5JAVA 1L0YB 3KUPA 1EQQA 4O3NA 2H1EA 4RU9A 2W70A 1EU3A 1CKNB 2RHQB 2RGVA 5LA6F 2IW3A 1PTOC 2W57A 4RCOA 4X65H 5HURA 4JI6Q 1PTOF 4DK1A 3V6KA 3SK4A 1AH9A 1HRJA 2N49A 3PSIA 1MIUA 1R4PB 1J6QA 3OTOQ 1S5FD 2EE1A 2R7ZG 4IR1A 4BY7G 3QR8A 1A2UA 3BYTB 2E5LQ 3ICEA 2JA5B 2C2EA 1EY0A 2F0NA 5HV6A 1EY5A 3I2ZA 3TIIA 1M6VA 2Q2HA 3V96A 4LF9L 5M5WH 4YR3A 5KFQA 3ND8A 1IL2A 4GS3A 4HCEA 5F9LA 1IHZA 1VMPA 3OHXC 5EQ0A 4YWKA 4LF5L 1LTLA 2HD3A 1V1PB 3T5KA 1Q82C 3TINA 4ZQIA 3GTQA 3HOWH 2EYMA 1TU2B 3Q22A 1WTPA 2I5HA 3RTXA 3OTOH 2O4XA 3A5UA 1L2FA 4OXPA 3ERQA 1K83A 4C1NI 2NUAB 1EWIA 2RF4A 3JAMi 1JOKA 3S9WA 1RTNA 2XD4A 3Q2OA 1STAA 4EGJA 1WTRA 1D1IA 3RV3A 2PYKA 1H9SB 4QWDA 4MN3A 1VQ7A 2JEBI 4X64H 3W2DA 3GTKB 4BBSG 5GADC 1X3FA 1F9RA 2A8VA 3HGBA 4BXXG 2B63A 5C44B 3T1HL 4A3CG 1PYBA 3T5HA 1XXGA 3Q6SA 1BQQT 2OTJA 4KTAA 3QB3A 3C3LA 3AB9A 3VYUA 3JSLA 1CZGA 1CSPA 2JXMB 3F8NA 1GVPA 4QW9A 2LSSA 4GOPC 1HCZA 1LTAD 3PO3H 2ZJRA 3TSSA 2AHOB 5HGQA 3C1EA 3STBD 1I4RA 2LS01 2EZVA 1QZGA 3R5HA 5ELBA 3KLRA 3SHLA 2UXDQ 2R8GA 4DL6A 3K80C 1PFBA 1LTGD 2O5IC 4TUYF 1L2ZA 3V6JA 5J1ZA 1BBWA 3KAJA 3HOUH 4DL4A 1GUTA 5DLQE 1N34L 2R7KA 1W93A 1WOCA 1IBLL 2J4XA 3HOYH 2K7VA 5LMNQ 3KJOA 2EYLA 4QWAA 4NW2A 4YCVA 4HJ9A 2UXBL 2R7ZA 4EBCA 1T94A 5CA1F 3BA9A 2WKCA 3BDOA 1PTOB 1IYUA 4DV7H 3HOVG 3Q23A 3V4ZA 2CWAA 5DM63 1K28A 4MV6A 5CV8A 4DR2H 2CQOA 2FLPA 2YCHA 5M3MH 4XYLB 1FGUA 4DNRB 5KFIA 5M3FH 3BZKA 5AFWA 5KX5F 1STBA 2VS1A 4JOIA 1CUKA 3SDZA 2B63H 1NAPA 2VNUD 2KVMA 2GPSA 1R4QB 4ZAIA 1DIKA 5KFRA 4TQUS 5EWEA 5CYUA 1GLVA 2C00A 4QIWA 5FPOA 1F2MA 4JOIC 4O3RA 4DR6L 4FNFA 3G4SA 1X55A 2YTYA 3O13A 2A69D 1GJXA 1QNKA 1XMOQ 1DOLA 1KNAA 2QKIC 3MZ5A 3PF4A 2E2HA 4LFBH 4ZRZA 2DJGC 2NUCA 4ZLTF 3S16B 4KKSA 1HNZL 2JN4A 4TRDA 5EKKA 4KY7A 2VW9A 1JR0D 3GTLH 4APMA 2F4VL 1MKHA 2DIKA 3I4MB 4CBVA 4DR5H 2OH2A 2RDFA 5EPLA 4JI2L 3WO1A 2EOTA 2ASBA 2PQEA 4POFA 1EIFA 3SE0A 4LMYA 1I4PA 2I46A 1RJQA 2VUMB 4OONA 4KY6A 3S1RH 1O80A 3K59A 3H3VI 5M3FG 2JA9A 2E2DC 5EBCA 4DR3H 3G71A 5LHY1 3OPOA 3VR5A 4KD4A 3K58A 4R8UB 3PN1A 3S14B 1QUQA 4X62L 4TKOB 1JOOA 4ALPA 5KFGA 1B3QA 1SSOA 2UXBH 1TWAA 2MPMA 5JVG3 4DU9A 1BXRA 4DGZA 4EEYA 2HQEA 3PZPA 1HNWH 1FNWA 2C5CA 4I50F 2R7NA 4KN4C 2VPQA 3RBEA 4G7HC 1HTLD 4FXKC 4FS2A 2R7FA 1Y1VG 4FF1A 1K8MA 2E76C 4HR7B 4X62H 2C9OA 3OUUA 4LFAL 2YU9A 2R92A 1SMXA 1PH6A 3RGXA 4RB3C 4XQJA 4HJ8A 2PNHA 3M85A 2PQAB 1EU4A 2QF7A 4DR3L 4ED7A 1DYQA 1KEEA 5DM73 3IAYA 3E0JA 3H0GG 1EZ8A 3M9BA 4XIGS 3GQBA 1D5ZC 5M5WB 1I7NA 5DGBA 1SN8A 2K1BA 1T36A 4RH6A 3CRLC 4GN4B 3TP8A 5KNBA 2KHJA 1HNZQ 1EZ1A 3UQ8A 1FNUA 4A76A 2F4VH 2FP4B 1I50B 1VQHA 4HSVA 5IYBG 1HNZH 1X3EA 5JJIA 1N8RC 3J81i 4KY5A 1GXDC 3EVQA 4ECYA 4M1UB 2MP1A 3RZDB 1BO0A 2R3ZA 1A0IA 4DK6C 3T1YQ 1TT2A 4TQRA 1FNVA 4ZOLF 2UVRA 5IODA 1JIHA 3H09A 2Q2TA 1R9TB 3TRZA 2ASJA 1BR9A 4JI3Q 1IBKH 4A4IA 2K5WA 3EA6A 4IAJA 5I9PA 2YZMA 2B2YA 4ECXA 1MJEA 2FK1A 4Y7NH 5KFFA 4A3GG 3J81L 4G57A 5EBDA 4RCNA 3FP9A 1SNPA 1TY0A 2WB1E 1YJNA 2PQAA 5KG5A 1NUCA 5KG2A 4I55F 5KYLA 1QB5D 1PRTC 5FK9C 2UUBL 3K0YA 1SRUA 4ODGA 4X65L 2A74C 5M5YH 3GP7A 4C3HG 3H4DA 4C3JH 1XDNA 4J9PA 2J6TA 4LF8L 1LTID 4LF7Q 3MHBA 3QZ7A 1K83B 1MBYA 5FLXW 2JE6I 4I7ZC 4IWYA 2MO1A 1GSHA 4DR3Q 1C8CA 1CS0A 1TWCA 1WSCA 3L2PA 1JB7A 3N41B 1JDEA 4KHPH 2E2IA 2K5DA 3FKIB 2IX3A 4EBDA 3K6OA 4IOAA 4ECQA 3MXNA 4EX5A 4MTNA 2JEAI 3KXYT 4AQYQ 1QUQB 3M4OB 2NVQH 1W96A 4UCTA 3STBC 2UXDL 2WYOA 1AZQA 1TS5A 4JYAQ 4AYBE 4LMQD 1Y1VA 4G7OC 3ULPA 1STNA 5D3DA 1U4LA 1B3AA 4ZHQF 1IYJB 3D4RA 3GTOH 4FYDA 1YBYA 3I3CA 2B2TA 2F3IA 3NBHB 1ESRA 3TQYA 2I80A 5EZYF 2JA8H 4A3EB 1D5XC 3T53B 5L1KA 2I07B 3I73A 3EIVA 1PZKD 5C4HA 1VQDA 1I4HA 4DV0H 4K0KH 2BQRA 1TWGH 4B3SQ 4C3HH 2QEXA 2SEBD 3PUZA 5C5MA 1X6OA 2ZM6Q 1ULZA 4A2AA 4UAIA 5IY0A 3D4DA 5T14A 1X54A 1PA6A 2Z8LA 2JA7H 4GOPB 3KF6A 3TP6A 1NNXA 4FVMA 4GN5A 3UE0A 4RNOA 4H7BA 1S0OA 1DONA 3FPUB 3GTGB 1XWEA 3Q8DA 3DWPA 4A3DG 3MFHA 3KK7A 1EFID 2A68C 1RK5A 4N9PA 4WRDA 2Y0SE 1WTQA 1S5BD 4DV0L 4DUYQ 1C4QA 3MEFA 5LP6F 3C2PA 2OT2A 1GUOA 5JVH3 1EWHA 5IE8A 2UUBQ 5J3BA 1ML0D 3I7FA 1QILA 1A9XA 3CHBD 3SXHA 1CKMA 2EJFC 1AP0A 4LUVA 2ZM6L 4N8FA 2NU7B 2W6ZA 2PO4A 4HIOA 3MWMA 4GLAC 1S0NA 2UXDH 1ZHSA 1JCKB 1AEXA 3MFIA 3CC4A 4RUAA 5C4JB 2ENBA 2DZDA 4XQQA 3TS2A 3TREA 4ME5A 3RD4A 2AWOA 1STYA 2EDGA 2RQXA 5AJ3L 4ZQ3A 4GKKH 3E6ZX 1NCVA 1BGWA 2F0FA 3HZXA 3J7ZC 2W6QA 2UVVA 5ELCA 1TAEA 3T13A 5JEAH 5IYDH 1O7IA 4WORA 1EOVA 3E3XA 5FO8B 5IGBA 4R8IA 4A3JB 1HNWL 1ESFA 3LWBA 3CAMA 3LWUA 2WAQE 2V9WA 4A3KB 2UUAL 4QJFA 4A3GH 5JH7F 3A74A 4R4IA 5ELEA 3QZ8A 2BCOA 2G9DA 2VQDA 3RZOB 2W9AA 1E1OA 4R7RA 3L4JA 3W5OA 3TP7A 1QVCA 1PTOD 2EYOA 5L1LA 2L55A 1K9MC 4HIMA 4K5XA 2V5AA 2V58A 2VA3A 1HJPA 1FYCA 4ECWA 1EZ6A 1LO5D 3RGZA 3PR4A 2JSOA 1FJGH 1HFGA 4BBRG 5COYA 1IW7D 5FLXL 3HKZG 3TIGA 4RUCA 2WFWA 2NN6H 1IKLA 3KHHA 1WH2A 1WCMB 1HFNA 3NPPA 1KAWA 1HZAA 1VCIA 2FB9A 3P1HA 1Y1VB 5E7NA 1LLRD 2O03A 2R93H 4DV7Q 3S2HB 2HVRA 2JA6G 2YTVA 1EQVA 2XTIA 4YY3Q 3LGJA 1K3BC 2R92G 2F0LA 3KTMA 4L1KA 5DG8A 1OWTA 4NPSA 2YTXA 2VB3X 1NMGA 1FR3A 1VQFA 4BBSH 2CW8A 2DLNA 2PBZA 3RF2A 2IMWP 4B08A 1TA8A 1IYVA 2AU0A 1H9RA 3HKZE 2QEJC 2HT1A 3J7A5 4HIKA 4LUOA 1GKHA 2M05A 4F88A 2FK3A 1SFOH 4X3KA 1GHJA 1BJTA 3G6YA 4A3LH 4MIUA 2L15A 3MR2A 4YP3A 5DQHA 5FO9B 2FPGB 4F4ZA 1BCPB 1D1KA 1V1OA 4OO1G 3H0GA 4A93B 2W9CA 2UU9H 4CKEA 2NVXA 3T1YL 1N32L 4R8NA 2JEFA 5E4XA 2HCIA 5DGAA 2F0WA 4DV7L 2F0PA 3T1HQ 2GN5A 3S17B 3CRKC 2VQEH 2E75C 3KBXA 3KF6B 3MWEA 5K2MA 1LT4D 3KHRA 4JV2A 1VQNA 4PZ7A 1WTOA 3T16A 5IT9c 3QOJA 4C3JB 4GN3B 4BA2I 4QCLA 2WE6A 2R93G 4RB2C 1N34H 3P75A 3SR1A 1A8VA 1PYWD 3KOJA 4R4OA 1Z47A 2C2RA 1RHPA 2NZ1D 1X9NA 4PWQA 3OWEB 4H13C 3BDLA 1JORA 2B2VC 2JYOA 3H94A 4J8QA 1SCUB 4LF4H 1PRTD 3GTLB 1I6HH 5C0XH 1O75A 4PZ6A 1PYSB 5CBEE 3PF5A 1PV4A 4L63B 1XYIA 3GV8B 3IN5A 1V51A 1SNDA 3NQTA 3Q0AA 4OO1H 4GZYC 2FK2A 5H1SE 5KFEA 5C4XH 4NXMH 3A7LA 3R2IA 4FP5D 4DN4M 3GTJH 4MTDA 1OTCA 4OWXB 1B50A 1GUNA 3I70A 1B44D 4JI2H 3I12A 2WP8J 4ZI7F 4A3JG 4R1JA 3FHWA 5C3EB 2LXJA 2JQOA 5M3FB 4B3RH 1CFMA 4YCUA 1UAPA 3W1GA 4LJZC 2WV6D 5BN3A 3N6RA 5DG7A 1BCPF 2GVAA 2R7DA 1VQCA 1GD7A 3KHGA 1EY7A 5KFKA 2LXKA 3OTOL 2BDNA 4IUPA 2A68D 1VQ9A 1HUMA 4I7AA 2KCCA 2M2LA 4X65Q 1SYXB 4J9KA 5JVLA 2F0OA 1NSNS 5IGDA 4J9SA 4LF7L 5K36H 1S5ED 2F3VA 4YR2A 4B3SL 2QA4A 4IUUA 2FMMA 1PXUA 3RR5A 4GOPA 1PMRA 4XXEA 5C4XB 2XWBB 4OEMB 1OXSC 1PVOA 5M3MG 5FD5A 4RB0A 5KRUA 3I4MH 3CQZA 1SAPA 5ELOA 5KT4A 2V4DA 1WTVA 4FBUA 1SNOA 4LNQA 5TSSA 3R8BA 4CJ0B 1G51A 5DLFA 3GDEA 1HZBA 5JJKA 2FKLA 3D0FA 4QWEA 3SGIA 3DMUA 2W8KA 1IBLH 4DR4H 3GO5A 2VOBA 4F4XA 5ELFA 4DV1L 3BAAA 2K75A 4DL3A 4A3DB 1S9FA 4XT3B 3SK5A 3OSPA 1SE3A 1GSOA 1ICFB 1VDZA 1SNMA 2NBFA 4JYAH 4IFDJ 3M9MB 4A93G 4JI7L 5E3FA 1W6KA 2C35B 3HOUB 5KFUA 2OXPA 1IBMH 3JAML 3K5MA 5CMDA 4A3MG 3RB0A 4PMBA 1GUGA 1FD7D 1GUWA 2KSWA 4C2MH 1CTMA 1IOVA 3UDXA 1E4EB 2NWGA 2UXCH 1P16A 2B2UA 2E2HB 1VAJA 4M8AA 2DPJA 2Z6KA 4O3OA 3GTOA 1BNZA 4MHEA 1KABA 3JAME 3PIO3 4ME6A 3H3VC 3OSOA 5ELDA 3FMAA 1E4FT 4UCSA 4IFDG 1EIGA 2A69C 4HR7A 2FLLA 3J7AK 1AUVA 3SI8A 1EY9A 3BVZA 1KJJA 2FJ2A 1F77A 2AQ2B 1N48A 2ZJPA 1TVXA 4DAYA 2UUAQ 2CWPA 2IWHA 1KJQA 1ICWA 2WAQG 3J7YW 2W6NA 3IFTA 2XCLA 1LM0A 5DAUA 4DV6Q 3M9NB 5FJ8G 2EIFA 2PZWA 4B3TL 3MC0B 5KFJA 2Q2IA 3T1YH 1YITA 4EQPA 4YY3H 4RAUC 5AJ3Q 1O7YA 4R8UA 1VQEA 3FKIH 2IBKA 1EQRA 1IW7C 4FXGC 3BJYA 1SE4A 1JWUD 4KI0A 2X69A 2KENA 4F87A 4XDXA 3S24A 2NVYA 4JI4L 2R7MA 3AQQA 4DL7A 4IPGA 3E5SA 4B9XA 5C3WA 4C2MA 1SLJA 1S10A 2K5VA 3MXPA 3HOZB 5BPHA 1WFQA 1CQFA 1EEFD 5KG1A 3VPBA 5C6AA 1JE4A 3QWNA 5KFYA 3ULJA 2EY5A 5FOBB 3S15B 1TWCB 2KJXA 3DM3A 4DAPA 3VPDA 5LMUH 2E2IB 3R93A 5F9NA 1XNRL 1TWAH 4A3EG 3T5JA 3NTKA 2ALZA 2N78A 4LFCQ 3IL8A 4L8JA 2K6AA 3RBDA 3SK6A 1Q8IA 1X32A 2NU9B 4P72A 4JV1A 1XPRA 4B9WA 2J6UA 5C44H 2R92B 4Y52H 1LTBD 1ASYA 4DLKA 1KQSA 5EDWA 2RDJA 5KFHA 2X6GA 2R8HA 4DUZL 4J9MA 2AWNA 5IWAQ 4X62Q 3PIPA 1K3RA 5HY6A 3BG5A 2OLSA 5J22A 4RZQA 2F0TA 2KEEA 2LFNA 4O4IF 3PGZA 1JMCA 2DWCA 2A6ED 3VR6A 1SDFA 2ZDGA 1UE6A 1JWSD 2A6EC 2B3GA 2D62A 2E8GA 3NTIA 3NQIA 1TWFA 5KIXA 4N9TA 4I7HA 2FMCA 3BG3A 4UP8A 5KFSA 3N40P 2EVBA 3I90A 3FRPB 3DUZA 3M4OH 4C3JG 3J81c 1QWYA 4CHTB 1IOWA 1PDQA 1HPCA 4ECZA 2M00A 4QB4A 1UNSA 4OELB 3D3RA 5EGTA 3Q24A 3F8TA 3S1RB 3S17H 2V4RA 4A93H 1Y14B 3D31A 4MV3A 2R6GA 1JKJB 4DAMA 4UCUA 4WD3A 2BQUA 4Y8VB 4F7XA 2NN6I 5JOBA 4A3MH 4XYMB 1SYEA 2L11A 4LSAA 3OHAA 4IFDI 3L7ZC 1Q7YC 3N6XA 4HJ7A 2F3WA 4DUYH 4EQOA 5JPMC 2D5DA 3A55A 3ZJYC 5GAGC 3FPPA 1UEAB 1BXTA 4IUVA 3BABA 4NXNH 1SEBD 3WWVA 3ONAB 3MEHA 2IL8A 4DUYL 4IRDA 3HS0C 2A6HD 2YS7A 2JA8G 2PVPA 2C22A 1LT3D 1OO9B 1S4ZA 2LY7A 5D65A 3RLOA 2EJMA 4J9NA 1J5EL 3J80L 2F0IA 1HQRD 4DNTB 5M9OA 2B2TC 3F2UA 1GO3E 2KHSA 1TWCH 5GAHC 2JEGA 3MWYW 2A5HA 4DR2Q 4POGA 3RUZA 1Y1WH 4JI3L 2YRXA 2J6SA 5C8YF 1E4EA 5EKIA 1SYBA 3G6EA 1RJPA 4YCWA 2XSCA 4BBRB 1S5CD 2E2HH 4K0KL 2R82A 3PW5A 5KFXA 3N43B 2JA6H 1TWAB 2DY8A 3G6VA 1KD1C 1R9TA 2VZAA 2Z0SA 2B8FA 3ERSX 2HJWA 3NENA 3LMLA 3Q8RB 4UCRA 4DV2L 1PHJA 4H0LC 3RUPA 4FBTA 1J5EQ 1Q8KA 4R4TA 4Q43A 2F0MA 4DV1Q 4E4TA 5ELNA 2I5LX 3BZCA 3BVGA 4MV1A 2W9BB 4G7ZC 4Q45A 1TS2A 1T3NA 1RYSA 1VBGA 1HXYD 3R3OA 4JI7Q 2XC9A 4ZUIA 5IIFA 1LABA 2NB0A 4WJ3M 2RHSB 5IT9E 3ORRA 1HH2P 3AYHB 3S1NB 2CH4W 3DHQA 1B8AA 5I47A 2OWOA 4ID6A 3SEBA 4A3FG 5KFPA 1X3PA 3JAMW 3V05A 2QYZA 2B63B 4JUZA 3I55A 2VQFH 2HQLA 4IWXA 1WD1A 4GLVB 2XGQA 2OF1A 1HR0W 3Q1KA 1EUJA 1MHWC 1RCVD 1EY6A 2X6LA 2UUBH 5CR3A 4O3PA 1RYRA 1EYDA 4DL2A 4ZYSA 4XT1B 3OIPA 1V8QA 3AFPA 2XRQD 4DV4Q 1WTXA 2JA6A 4QIWB 3M7GA 1XMOL 4OIKA 4C56C 1WTWA 3DEPA 4A3LG 2IY5B 2PI2E 5FKAC 3GTKH 1LTSD 3J7AF 1UNNC 3OHBA 4TV8F 4KMUC 3CW2C 3G7LA 1WJJA 3L0OA 2WDTA 4O2BF 4L5SA 2ZJTA 4DPGA 3GIJA 2V59A 3CKIB 3OW7A 1EHIA 2W6MA 4DXFA 1JWMD 1IBKL 4OX9Q 4B3MH 4JV5L 4LK1C 4CGYB 3K7AH 2PW7A 1Q81C 1JOQA 1SYCA 2DNCA 3SE7A 3PW4A 1Z6HA 3EPIA 1SR3A 1ZEQX 4K0KQ 2R7ZB 3OSNA 1JXLA 3ORQA 4A3IB 1WVLA 4A3JH 3A54A 2RA4A 1BBXC 4PMCA 3FMCA 2XCPA 4NDXA 4JI0H 2K28A 4C1NK 3I4NB 1EL0A 3OMGA 4DAVA 1A3VA 3S2DH 4YBZB 3A8KE 3HOYG 1SJED 3CC2A 3F2CA 4JBJA 3X3NA 3P7JA 2R92H 4JK1C 3GTLA 1SYFA 2MFIA 1VQKA 1Z2NX 2JA8B 1TWFB 2AGOA 1AE2A 2OTLA 4J9LA 4UFZA 3H4BA 4OX9L 2YS6A 1B04A 4NXML 1XTDA 3A0JA 3NWTA 4DV6L 1XNRQ 5L9XA 2TSSA 4C3IB 3R2TA 3OYYA 3J80E 1I4GA 3HEJA 1ILPA 1SNQA 2ALYB 4A3BH 4A75A 3RB6A 2GPWA 2DPIA 1Q90A 1EQTA 2IJ0A 2PMZB 2ZT9C 4MV4A 5IT9L 3JC66 4FS1A 4JI7H 4JI8H 4DV5L 2HHHQ 1A6XA 3ETHA 2CW7A 5I2XA 1D7QA 1Q46A 2F0HA 2IP4A 4JI4Q 2YYZA 5IWAL 2OQ0A 2ZTCA 4DV4L 1DM0B 4EQNA 4DUZQ 4OHJA 1JB3A 4LF6L 2ZJQA 2FXQA 2Q2UA 4NLGA 1PFNA 5FPRA 3P20A 3BJUA 4P74A 2B2WA 3K7UC 3GTPA 3EPGA 4YB8B 4HQ6A 4QWBA 5K36G 4EFEA 3HBLA 1ET9A 4P71A 1PZJD 1BBUA 3FEWX 1NE3A 4JV5Q 5CB4F 5K5PA 1MJCA 1TKWB 3MA2B 4OWTB 1SBBB 4MNOA 5GONF 1N56A 1PH4A 2UUCH 2XIGA 3NHHA 2KQ3A 4LFCL 3UDGA 2NVXH 5KFBA 1E22A 1G6ZA 4U68A 4JI1L 1W3SA 4ZUJA 4OL7A 2HGSA 2FHTA 2WINB 1N33L 1D8LA 4MTKA 4IN3A 4R4QA 1F2YA 4JI0Q 4IHJF 2NU6B 1BCPC 5EPKA 4ECSA 4RB1A 2Q8IB 5IOCA 4O3SA 1W2BA 2IA6A 4CC6A 4IZ8A 5JEAJ 2WB1B 4IFDH 1BDOA 4XQNA 1TWHB 4IO9A 3PW7A 2FJZA 4N8X1 4HCSA 3SVMA 5IYCH 2XIWA 4Q0YA 4A3IH 3KALA 1CT1D 1TY2A 1VF7A 4LH6A 4J15A 4DKAC 1PH5A 1B70B 4IUTA 5JJLA 3BU2A 2A6HC 4KD3A 4EVOA 2R8KA 3PR5B 4QUCA 3VYTA 1A15A 2PZTA 4KHPQ 1CSQA 3PV0A 2YU9B 2PN1A 1MSHA 2HUGA 4R9WA 1C3OA 1ONLA 3NUCA 2HHHL 5DLGA 5M5XH 4RG1A 3T51B 1BKBA 2W71A 2CKZB 3OWFA 4JI5L 1XPUA 3I4MG 4MV7A 4QQBX 3Q8PB 2XGPA 2NZOA 3I4NG 5KT7A 2QK4A 5FLXE 2PI2A 4O3QA 4LF4L 3S2HH 2PPBC 4EBEA 3IRBA 5C4JH 1JQYD 3K81C 2V1CC 4H02A 4RNMA 1NR2A 2CQYA 4QWCA 2YW2A 1YNJD 1LACA 1UE5A 4IURA 3NBIA 3HOZG 3S1NH 1S68A 3PO2G 1I6UA 4HSPA 5KNDA 2NVTH 2K14A 3IFDA 4JI3H 2VQEL 2F03A 4L5RC 1MI2A 1EWCA 2YV5A 3FKIG 1VKZA 1A62A 2LKVA 4QGUA 3KF8A 4PNYA 3S1QH 4FXDA 4X64Q 1SJHD 4TVAB 2R84A 4Q0FA 1SNCA 2I0QA 1SYDA 4B3TQ 3V4SA 1UC8A 3NWSA 3FDTA 4K8JA 3WO0A 4HIDA 4DAYB
chains in the Genus database with same CATH topology
2B29A 1CSPA 1M1KC 1GVPA 2LSSA 4GOPC 3CF5A 4LNQA 3PO3H 2ZJRA 1N9WA 2AHOB 2K50A 5HGQA 1G51A 3STBD 2IHFA 4DV2Q 3GDEA 1HZBA 1QZGA 5JJKA 1N36L 3D0FA 2UXDQ 3SGIA 1VS0A 3K80C 1Y1WG 3GO5A 1BBWA 3U50C 3RN5A 3HOUH 3G48A 4DV1L 5DLQE 2K75A 1N34L 3CCEA 3M3YH 1WOCA 1GM5A 4DR6Q 1IBLL 3M7NA 4RMFA 3HOYH 1VQJA 3KJOA 5LMNQ 2IHEA 4YCVA 4X66Q 4HJ9A 3KDFA 2UXBL 4IFDJ 4A93G 4A3KH 4JI7L 1L1OA 4BY1G 2C35B 2ZTEA 4HJAA 3HOVG 4A3MG 2CWAA 2E2JH 2CQOA 4C2MH 1WCMH 5M3MH 3CCLA 1FGUA 2EQSA 3TEHB 3UDXA 1NTGA 5M3FH 3BZKA 3H3VH 1P16A 2CFMA 1NJIC 1S40A 2VS1A 4JOIA 1CUKA 3RN2A 2B63H 2VNUD 1N36Q 2AMCB 2Z6KA 2A1AA 2N3SA 1K0RA 4DNIA 4JI8Q 2K5NA 1VQLA 2UUCL 4TQUS 4EQ5A 1HZCA 5IYBH 4JOIC 4DR6L 4DV0Q 4IFDG 3G4SA 1X55A 2YTYA 1XMOQ 3PF4A 1XMQQ 4X66L 2ZJPA 2UUAQ 1CKNA 2CWPA 4IPDA 2WAQG 4A3IG 1FJGQ 5GROA 2K5HA 2VY3A 4NXMQ 1LM0A 3PUYA 4DV6Q 1IBKQ 1HNZL 5FJ8G 1E7ZA 2VW9A 2EIFA 3GTLH 4GKKL 4QIWE 4B3TL 5LMUL 4DR1Q 3I4OA 1MKHA 2F4VL 4A3DH 2Q2IA 5IP9G 4A3KG 1YITA 4AYBG 1KXLA 3KF8B 5AJ3Q 4DR7L 4JI2L 2MO0A 1VQGA 1VQEA 3FKIH 1EQRA 2ASBA 4POFA 1YHAA 1EIFA 4JI8L 4KI0A 2KENA 3NELA 4OONA 3S24A 3S1RH 1KIXA 3H3VI 4JI4L 3HOZG 4DR4Q 3AQQA 5M3FG 5FLMH 2BH8A 2JA9A 4YWMA 3I4NH 4IPGA 4BXXH 3G71A 5GQOA 1SLJA 1Q86C 1XMQL 3CCSA 2K5VA 1WFQA 1LYLA 2KHIA 1QUQA 4X62L 4B3MQ 1NY4A 3ULJA 4ALPA 2UXBQ 3CXCA 5BR8Q 3UDIA 1S3OA 3CCRA 3DM3A 3HOZH 4GNXB 1XNRL 1TWAH 4A3EG 1VQBA 1QZHA 2JJQA 1EFWA 2NZHA 3KFUA 2N78A 4LFCQ 4GNXC 1N33Q 2R7FA 1Y1VG 3GTGH 5EAYA 3HKSA 4JI1Q 5IP9H 4P72A 1PH2A 4LFAL 3HOXH 1XPRA 2IX1A 5C44H 1SMXA 1PH6A 4Y52H 1K83H 1C7YA 2IX0A 4HJ8A 1ASYA 4BA1I 1KQSA 2PNHA 3M85A 1H95A 2PQAB 4A3CH 4DR3L 1TWHH 1VQ6A 3CPFA 4O2DA 4DUZL 2JA5H 4X6AH 2AWNA 5IWAQ 4X62Q 3PIPA 3K8AA 1K3RA 4QY7A 5HY6A 4JBWA 3F1ZA 3H0GG 3M9BA 1XNQQ 4XIGS 1HNXQ 4A3BG 3M4PA 3J80c 3PGZA 1JMCA 1SN8A 3U4ZA 3PUXA 4YY3L 2BA1A 4PMWA 3PIOA 4NB3A 3PO3G 4OO1I 1UE6A 4GN4B 2B3GA 2D62A 2E8GA 2KHJA 2RCNA 1VQ4A 1HNZQ 4A76A 2WB1G 3CD6A 2NN6G 2F4VQ 4UP8A 1VQHA 5IYBG 2BH2A 1X3EA 2HT1A 5JJIA 1N8RC 4YHHL 3J81i 3J81c 4A3FH 4C3IH 3J7A5 3M4OH 3HOUG 4IJLA 1TWFH 4JBMA 4JI5Q 3F8TA 1E24A 4B3RL 3S17H 3F2DA 1A0IA 1PH9A 4DK6C 3T1YQ 4DR4L 2K52A 4A93H 1Y14B 2ZTDA 3D31A 3PUWA 2R6GA 3J80i 4DAMA 3HFZB 4LF8Q 2NN6I 2Q2TA 3TRZA 1N32Q 4A3MH 2HIXA 4JI3Q 2OCEA 4A4IA 1TXYA 1S72A 4JBKA 4IFDI 3L7ZC 1Q7YC 1X3GA 4HJ7A 4O0AA 2JA5G 4LF5Q 2UXCL 1MJEA 3ZJYC 3EBEA 4Y7NH 5GAGC 4A3GG 2N8NA 4JCVE 4MZ9A 1KRTA 4PZ8A 1V9PA 3FP9A 2Y0SG 3WWVA 2WB1E 3U58A 1YJNA 3PUVA 2VQEQ 2PQAA 4JI6L 4DUYL 4IPCA 1U5KA 1HR0Q 2JA8G 3ER0A 1BVSA 2VL6A 4FDBA 3RLOA 2CCZA 4JYAL 5C3EG 1J5EL 2UUBL 1SRUA 2IT1A 1WI5A 1KL9A 4YWLA 4X65L 4DR5L 5M5YH 1OXTA 1DGSA 1GO3E 4C3JH 4X64L 4NXNQ 4LF8L 3VDYA 1TWCH 5GAHC 2D0OA 4LF7Q 3UDFA 3J81j 3W1BA 4DR2Q 4POGA 1Y1WH 1VQOA 4JI3L 2JE6I 2E5LL 2MO1A 1G291 3GTQH 4DR3Q 3L2PA 1R9TH 1PH1A 3G6EA 1JB7A 5LMNW 1OXUA 4YCWA 4LF4Q 2UXCQ 4K0KL 3RLNA 2E2HH 3TS0A 4LFBL 4LF9Q 2JA6H 4IOAA 4EX5A 4MTNA 1HNXL 1Y1VH 1VQ8A 2JEAI 1KD1C 2VZAA 1LUZA 1QUQB 2Z0SA 3ERSX 5C0XG 4AQYQ 2NVQH 3NENA 5C44G 1RIPA 3STBC 4DV2L 2DGYA 1G6PA 2R7ZH 2UXDL 2D0PA 5FLMG 4BY7H 4JYAQ 4AYBE 1PHJA 1V1QA 4B3ML 1Q1BA 3ULPA 1J5EQ 1Q8KA 4R4TA 1YNXA 4DV1Q 1YZ6A 5ELNA 2I5LX 2H5XA 4YHHQ 3CCQA 3BZCA 1IYJB 3GTOH 4WJ4A 1YBYA 3NBHB 1SROA 2F3IA 4JC0A 4NXNL 3H0GH 3TQYA 5C4XG 4IOCA 1U0LA 4DR2L 2JA8H 3S15H 3EIVA 5C3EH 1XJVA 2EXDA 3NEMA 1VQDA 4LWCA 2PMZE 2KCMA 4JI7Q 4IJHA 1FL0A 4B3RQ 1TWGH 4B3SQ 4C3HH 3RZOH 4WJ3M 1A63A 3MXNB 2RHSB 2QEXA 3CC7A 1EIYB 4DV3L 3PUZA 1HH2P 1B7YB 3AYHB 1X6OA 1PH7A 1B8AA 2ZM6Q 3HOWG 2MQHA 5IY0A 2VQFL 2OWOA 4A3FG 4JG2A 3UE1A 2QGQA 1X54A 5IP7H 1PA6A 1SE8A 2JA7H 3I55A 4GOPB 1L1OC 3KF6A 2HQLA 4GN5A 3UE0A 4GLVB 5FJ8H 2MNAA 3HOXG 4DV5Q 1EUJA 1HR0W 3GTPH 1YVCA 2I5MX 1PH3A 3Q8DA 5C0XJ 3S16H 4A3DG 3GTMH 2Y0SE 3CCJA 1I5FA 4DV0L 4DUYQ 2UUCQ 1IXRA 3AFPA 1E1TA 2HIVA 3JAMc 4DV4Q 2Z6KC 3MEFA 1HR0L 1XMOL 3CCVA 4AIMA 4A3LG 2IY5B 2NVYH 2PI2E 3CQZH 3E9IA 5IE8A 4LF6Q 3GTKH 2UUBQ 3CW2C 3L0OA 1WJJA 2GVBA 3CCMA 1HNWQ 4AH6A 4UY8C 5J3BA 4L5SA 3I7FA 1UEBA 4DPGA 3U4VA 4GNXA 4PG3A 1C9OA 1CKMA 3AEVA 1JJGA 4LUVA 1IBKL 1T9HA 3M4QA 4UP9A 2ZM6L 4HIOA 4OX9Q 4JV5L 4GLAC 2OQKA 1Q12A 3K7AH 1I94L 1Q81C 5LMUQ 4DR1L 3CC4A 2XGTA 3K0XA 1SR3A 3KDFB 3TS2A 2BA0A 4K0KQ 3TREA 3S14H 2AWOA 4XTCS 5AJ3L 1VQIA 3E0EA 3KLWA 4A3JH 2VUMH 1X65A 5IYCG 4AQYL 1I3QH 3J7ZC 3A5ZB 5IP7G 4JI0L 5IYDH 4BY1H 1O7IA 3S2DH 1OXVA 1EOVA 1K73C 3HOYG 3CMAA 1WYDA 3F2CA 1IBMQ 2E2IH 3CC2A 1CKOA 4JBJA 2YU9H 2K4KA 2R92H 1HNWL 1YHQA 2MFIA 1Q1EA 1VQKA 2UU9L 1QVGA 3CAMA 1UE7A 1AE2A 2WAQE 1JJ2A 2OTLA 4R4CA 1K8AC 4QJFA 1JE5A 4L5QA 1NMFA 1Z9FA 3A74A 4R4IA 2UUAL 4OX9L 4A3GH 1FJGL 4NXML 1V43A 1XTDA 3A0JA 1I94Q 4DV6L 1RL2A 1E1OA 1FVIA 2KCTA 1XNRQ 2KBNA 4GKKQ 3W5OA 4DV3Q 1QVCA 3OYYA 4P73A 2ALYB 4A3BH 4A75A 4HIMA 4GLXA 1K9MC 1PH8A 3CMEA 1HJPA 4DR7Q 1P8LA 3B6YA 3JC66 3DLLA 4BBRG 4DV5L 2AKWB 4KLKA 1KRSA 2HHHQ 3HKZG 1KHIA 2WFWA 4IPHA 4L5TA 1YEZA 3AFQA 4UP7A 4JI2Q 1Q46A 1EYGA 4KHPL 1D7QA 4JI4Q 1PFSA 2YYZA 2ATWA 5IWAL 1KAWA 2OQ0A 3RZDH 3PO2H 2ZTCA 1HZAA 1AE3A 1VCIA 4DV4L 5JEAG 5IYDG 4DUZQ 3RLFA 5E7NA 4LF6L 3I56A 2ZJQA 2FXQA 4DV7Q 2Q2UA 2JA6G 1L0WA 2R93H 4UPAA 2YTVA 2XTIA 4ME3A 4YY3Q 1M90C 3BJUA 3LGJA 4P74A 1UWVA 4DK3C 5GAEC 3CPWA 2JA7G 3K7UC 2ES2A 2R92G 1KC8C 3S1MH 2YTXA 4NPSA 1NMGA 3EN2A 4BBSH 1VQFA 1L1OB 1OXXK 5K36G 4P71A 3CCUA 1BBUA 1NE3A 5FLXc 4JV5Q 3HKZE 3KYHC 1MJCA 4LUZA 3RNUA 4OWTB 4LUOA 1GKHA 4MNOA 5BR8L 4HIKA 3F2BA 2F52A 1PH4A 1SFOH 3HOVH 4A3LH 1JJCB 4LFCL 2NVXH 2L15A 3UDGA 1E22A 4OWWB 1VQMA 2A19A 4JI1L 1K8GA 1W3SA 3CP0A 4GKJQ 4OO1G 1VQ5A 1N33L 1D8LA 4R4QA 4JI0Q 2B63G 1UE1A 3T1YL 1N32L 4LFAQ 4LW1A 1IZ6A 1IBML 4DV7L 3T1HQ 1W2BA 2GN5A 1ASZA 5JEAJ 3KF6B 2ID0A 2UU9Q 4P75A 3H15A 4IO9A 1VQNA 4PZ7A 1YJWA 5IT9c 4A3EH 4BA2I 4GN3B 5IYCH 1EQQA 2R93G 4HJ5A 4A3IH 1XNQL 1YIJA 1A8VA 2RHQB 1CKNB 1E3PA 1YJ9A 4J15A 3KOJA 4R4OA 4DKAC 1PH5A 1B70B 5JJLA 3BU2A 1C0AA 1Z47A 4JI6Q 1X9NA 1VQAA 1AH9A 4KHZA 2N49A 3PSIA 1I50H 1MIUA 5C0XI 4KHPQ 1I6HH 4GKJL 1CSQA 1J6QA 3PV0A 4DR5Q 3OTOQ 4PZ6A 1PYSB 2R7ZG 3PF5A 1JT8A 4BY7G 2HHHL 1PV4A 2DUDA 5M5XH 4RG1A 3OW2A 2E5LQ 1BKBA 3ICEA 1NBWA 2CKZB 4JI5L 1XPUA 3I4MG 5H1SE 3I2ZA 4QQBX 2NZOA 3I4NG 5C4XH 3E9HA 4QL5A 2Q2HA 1X56A 3GTJH 1OTCA 2PI2A 4OWXB 5M5WH 4LF9L 1QVFA 4LF4L 1IL2A 3S2HH 4GS3A 4LFBQ 3IRBA 2WP8J 5C4JH 4YWKA 3K81C 4R1JA 2V1CC 1LTLA 4H02A 3ULLA 3FHWA 4A3JG 1XPOA 4LF5L 1VQPA 2VUMG 4BBRH 2LXJA 2JQOA 1Q82C 4YCUA 3W1GA 1UE5A 3HOWH 3KJPA 2I5HA 3A5UA 1L2FA 2GVAA 2JK8A 1VQCA 1GD7A 2R7DA 4OXPA 1EWIA 2RF4A 3JAMi 3S1NH 3PO2G 3PCOB 2NVTH 2K14A 2LXKA 3OTOL 2VQEL 4L5RC 1VQ9A 4X65Q 2YV5A 3FKIG 1A62A 2JEBI 4QGUA 1VQ7A 3GD7A 4APVA 1N34Q 4LF7L 3S1QH 4BBSG 1IBLQ 5GADC 1X3FA 1YHBA 4TVAB 4X64Q 4B3SL 5LMNL 2QA4A 2A8VA 4BXXG 4GOPA 3RR5A 2I0QA 4B3TQ 3T1HL 4A3CG 1PYBA 1WCMG 1OXSC 1HZ9A 5M3MG 1PVOA 2OTJA 3I4MH 2VQFQ 5ELOA 1YI2A 4HIDA 4DAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B29 A;  1CSP A;  1M1K C;  1GVP A;  2LSS A;  4GOP C;  3CF5 A;  4LNQ A;  3PO3 H;  2ZJR A;  1N9W A;  2AHO B;  2K50 A;  5HGQ A;  1G51 A;  3STB D;  2IHF A;  4DV2 Q;  3GDE A;  1HZB A;  1QZG A;  5JJK A;  1N36 L;  3D0F A;  2UXD Q;  3SGI A;  1VS0 A;  3K80 C;  1Y1W G;  3GO5 A;  1BBW A;  3U50 C;  3RN5 A;  3HOU H;  3G48 A;  4DV1 L;  5DLQ E;  2K75 A;  1N34 L;  3CCE A;  3M3Y H;  1WOC A;  1GM5 A;  4DR6 Q;  1IBL L;  3M7N A;  4RMF A;  3HOY H;  1VQJ A;  3KJO A;  5LMN Q;  2IHE A;  4YCV A;  4X66 Q;  4HJ9 A;  3KDF A;  2UXB L;  4IFD J;  4A93 G;  4A3K H;  4JI7 L;  1L1O A;  4BY1 G;  2C35 B;  2ZTE A;  4HJA A;  3HOV G;  4A3M G;  2CWA A;  2E2J H;  2CQO A;  4C2M H;  1WCM H;  5M3M H;  3CCL A;  1FGU A;  2EQS A;  3TEH B;  3UDX A;  1NTG A;  5M3F H;  3BZK A;  3H3V H;  1P16 A;  2CFM A;  1NJI C;  1S40 A;  2VS1 A;  4JOI A;  1CUK A;  3RN2 A;  2B63 H;  2VNU D;  1N36 Q;  2AMC B;  2Z6K A;  2A1A A;  2N3S A;  1K0R A;  4DNI A;  4JI8 Q;  2K5N A;  1VQL A;  2UUC L;  4TQU S;  4EQ5 A;  1HZC A;  5IYB H;  4JOI C;  4DR6 L;  4DV0 Q;  4IFD G;  3G4S A;  1X55 A;  2YTY A;  1XMO Q;  3PF4 A;  1XMQ Q;  4X66 L;  2ZJP A;  2UUA Q;  1CKN A;  2CWP A;  4IPD A;  2WAQ G;  4A3I G;  1FJG Q;  5GRO A;  2K5H A;  2VY3 A;  4NXM Q;  1LM0 A;  3PUY A;  4DV6 Q;  1IBK Q;  1HNZ L;  5FJ8 G;  1E7Z A;  2VW9 A;  2EIF A;  3GTL H;  4GKK L;  4QIW E;  4B3T L;  5LMU L;  4DR1 Q;  3I4O A;  1MKH A;  2F4V L;  4A3D H;  2Q2I A;  5IP9 G;  4A3K G;  1YIT A;  4AYB G;  1KXL A;  3KF8 B;  5AJ3 Q;  4DR7 L;  4JI2 L;  2MO0 A;  1VQG A;  1VQE A;  3FKI H;  1EQR A;  2ASB A;  4POF A;  1YHA A;  1EIF A;  4JI8 L;  4KI0 A;  2KEN A;  3NEL A;  4OON A;  3S24 A;  3S1R H;  1KIX A;  3H3V I;  4JI4 L;  3HOZ G;  4DR4 Q;  3AQQ A;  5M3F G;  5FLM H;  2BH8 A;  2JA9 A;  4YWM A;  3I4N H;  4IPG A;  4BXX H;  3G71 A;  5GQO A;  1SLJ A;  1Q86 C;  1XMQ L;  3CCS A;  2K5V A;  1WFQ A;  1LYL A;  2KHI A;  1QUQ A;  4X62 L;  4B3M Q;  1NY4 A;  3ULJ A;  4ALP A;  2UXB Q;  3CXC A;  5BR8 Q;  3UDI A;  1S3O A;  3CCR A;  3DM3 A;  3HOZ H;  4GNX B;  1XNR L;  1TWA H;  4A3E G;  1VQB A;  1QZH A;  2JJQ A;  1EFW A;  2NZH A;  3KFU A;  2N78 A;  4LFC Q;  4GNX C;  1N33 Q;  2R7F A;  1Y1V G;  3GTG H;  5EAY A;  3HKS A;  4JI1 Q;  5IP9 H;  4P72 A;  1PH2 A;  4LFA L;  3HOX H;  1XPR A;  2IX1 A;  5C44 H;  1SMX A;  1PH6 A;  4Y52 H;  1K83 H;  1C7Y A;  2IX0 A;  4HJ8 A;  1ASY A;  4BA1 I;  1KQS A;  2PNH A;  3M85 A;  1H95 A;  2PQA B;  4A3C H;  4DR3 L;  1TWH H;  1VQ6 A;  3CPF A;  4O2D A;  4DUZ L;  2JA5 H;  4X6A H;  2AWN A;  5IWA Q;  4X62 Q;  3PIP A;  3K8A A;  1K3R A;  4QY7 A;  5HY6 A;  4JBW A;  3F1Z A;  3H0G G;  3M9B A;  1XNQ Q;  4XIG S;  1HNX Q;  4A3B G;  3M4P A;  3J80 c;  3PGZ A;  1JMC A;  1SN8 A;  3U4Z A;  3PUX A;  4YY3 L;  2BA1 A;  4PMW A;  3PIO A;  4NB3 A;  3PO3 G;  4OO1 I;  1UE6 A;  4GN4 B;  2B3G A;  2D62 A;  2E8G A;  2KHJ A;  2RCN A;  1VQ4 A;  1HNZ Q;  4A76 A;  2WB1 G;  3CD6 A;  2NN6 G;  2F4V Q;  4UP8 A;  1VQH A;  5IYB G;  2BH2 A;  1X3E A;  2HT1 A;  5JJI A;  1N8R C;  4YHH L;  3J81 i;  3J81 c;  4A3F H;  4C3I H;  3J7A 5;  3M4O H;  3HOU G;  4IJL A;  1TWF H;  4JBM A;  4JI5 Q;  3F8T A;  1E24 A;  4B3R L;  3S17 H;  3F2D A;  1A0I A;  1PH9 A;  4DK6 C;  3T1Y Q;  4DR4 L;  2K52 A;  4A93 H;  1Y14 B;  2ZTD A;  3D31 A;  3PUW A;  2R6G A;  3J80 i;  4DAM A;  3HFZ B;  4LF8 Q;  2NN6 I;  2Q2T A;  3TRZ A;  1N32 Q;  4A3M H;  2HIX A;  4JI3 Q;  2OCE A;  4A4I A;  1TXY A;  1S72 A;  4JBK A;  4IFD I;  3L7Z C;  1Q7Y C;  1X3G A;  4HJ7 A;  4O0A A;  2JA5 G;  4LF5 Q;  2UXC L;  1MJE A;  3ZJY C;  3EBE A;  4Y7N H;  5GAG C;  4A3G G;  2N8N A;  4JCV E;  4MZ9 A;  1KRT A;  4PZ8 A;  1V9P A;  3FP9 A;  2Y0S G;  3WWV A;  2WB1 E;  3U58 A;  1YJN A;  3PUV A;  2VQE Q;  2PQA A;  4JI6 L;  4DUY L;  4IPC A;  1U5K A;  1HR0 Q;  2JA8 G;  3ER0 A;  1BVS A;  2VL6 A;  4FDB A;  3RLO A;  2CCZ A;  4JYA L;  5C3E G;  1J5E L;  2UUB L;  1SRU A;  2IT1 A;  1WI5 A;  1KL9 A;  4YWL A;  4X65 L;  4DR5 L;  5M5Y H;  1OXT A;  1DGS A;  1GO3 E;  4C3J H;  4X64 L;  4NXN Q;  4LF8 L;  3VDY A;  1TWC H;  5GAH C;  2D0O A;  4LF7 Q;  3UDF A;  3J81 j;  3W1B A;  4DR2 Q;  4POG A;  1Y1W H;  1VQO A;  4JI3 L;  2JE6 I;  2E5L L;  2MO1 A;  1G29 1;  3GTQ H;  4DR3 Q;  3L2P A;  1R9T H;  1PH1 A;  3G6E A;  1JB7 A;  5LMN W;  1OXU A;  4YCW A;  4LF4 Q;  2UXC Q;  4K0K L;  3RLN A;  2E2H H;  3TS0 A;  4LFB L;  4LF9 Q;  2JA6 H;  4IOA A;  4EX5 A;  4MTN A;  1HNX L;  1Y1V H;  1VQ8 A;  2JEA I;  1KD1 C;  2VZA A;  1LUZ A;  1QUQ B;  2Z0S A;  3ERS X;  5C0X G;  4AQY Q;  2NVQ H;  3NEN A;  5C44 G;  1RIP A;  3STB C;  4DV2 L;  2DGY A;  1G6P A;  2R7Z H;  2UXD L;  2D0P A;  5FLM G;  4BY7 H;  4JYA Q;  4AYB E;  1PHJ A;  1V1Q A;  4B3M L;  1Q1B A;  3ULP A;  1J5E Q;  1Q8K A;  4R4T A;  1YNX A;  4DV1 Q;  1YZ6 A;  5ELN A;  2I5L X;  2H5X A;  4YHH Q;  3CCQ A;  3BZC A;  1IYJ B;  3GTO H;  4WJ4 A;  1YBY A;  3NBH B;  1SRO A;  2F3I A;  4JC0 A;  4NXN L;  3H0G H;  3TQY A;  5C4X G;  4IOC A;  1U0L A;  4DR2 L;  2JA8 H;  3S15 H;  3EIV A;  5C3E H;  1XJV A;  2EXD A;  3NEM A;  1VQD A;  4LWC A;  2PMZ E;  2KCM A;  4JI7 Q;  4IJH A;  1FL0 A;  4B3R Q;  1TWG H;  4B3S Q;  4C3H H;  3RZO H;  4WJ3 M;  1A63 A;  3MXN B;  2RHS B;  2QEX A;  3CC7 A;  1EIY B;  4DV3 L;  3PUZ A;  1HH2 P;  1B7Y B;  3AYH B;  1X6O A;  1PH7 A;  1B8A A;  2ZM6 Q;  3HOW G;  2MQH A;  5IY0 A;  2VQF L;  2OWO A;  4A3F G;  4JG2 A;  3UE1 A;  2QGQ A;  1X54 A;  5IP7 H;  1PA6 A;  1SE8 A;  2JA7 H;  3I55 A;  4GOP B;  1L1O C;  3KF6 A;  2HQL A;  4GN5 A;  3UE0 A;  4GLV B;  5FJ8 H;  2MNA A;  3HOX G;  4DV5 Q;  1EUJ A;  1HR0 W;  3GTP H;  1YVC A;  2I5M X;  1PH3 A;  3Q8D A;  5C0X J;  3S16 H;  4A3D G;  3GTM H;  2Y0S E;  3CCJ A;  1I5F A;  4DV0 L;  4DUY Q;  2UUC Q;  1IXR A;  3AFP A;  1E1T A;  2HIV A;  3JAM c;  4DV4 Q;  2Z6K C;  3MEF A;  1HR0 L;  1XMO L;  3CCV A;  4AIM A;  4A3L G;  2IY5 B;  2NVY H;  2PI2 E;  3CQZ H;  3E9I A;  5IE8 A;  4LF6 Q;  3GTK H;  2UUB Q;  3CW2 C;  3L0O A;  1WJJ A;  2GVB A;  3CCM A;  1HNW Q;  4AH6 A;  4UY8 C;  5J3B A;  4L5S A;  3I7F A;  1UEB A;  4DPG A;  3U4V A;  4GNX A;  4PG3 A;  1C9O A;  1CKM A;  3AEV A;  1JJG A;  4LUV A;  1IBK L;  1T9H A;  3M4Q A;  4UP9 A;  2ZM6 L;  4HIO A;  4OX9 Q;  4JV5 L;  4GLA C;  2OQK A;  1Q12 A;  3K7A H;  1I94 L;  1Q81 C;  5LMU Q;  4DR1 L;  3CC4 A;  2XGT A;  3K0X A;  1SR3 A;  3KDF B;  3TS2 A;  2BA0 A;  4K0K Q;  3TRE A;  3S14 H;  2AWO A;  4XTC S;  5AJ3 L;  1VQI A;  3E0E A;  3KLW A;  4A3J H;  2VUM H;  1X65 A;  5IYC G;  4AQY L;  1I3Q H;  3J7Z C;  3A5Z B;  5IP7 G;  4JI0 L;  5IYD H;  4BY1 H;  1O7I A;  3S2D H;  1OXV A;  1EOV A;  1K73 C;  3HOY G;  3CMA A;  1WYD A;  3F2C A;  1IBM Q;  2E2I H;  3CC2 A;  1CKO A;  4JBJ A;  2YU9 H;  2K4K A;  2R92 H;  1HNW L;  1YHQ A;  2MFI A;  1Q1E A;  1VQK A;  2UU9 L;  1QVG A;  3CAM A;  1UE7 A;  1AE2 A;  2WAQ E;  1JJ2 A;  2OTL A;  4R4C A;  1K8A C;  4QJF A;  1JE5 A;  4L5Q A;  1NMF A;  1Z9F A;  3A74 A;  4R4I A;  2UUA L;  4OX9 L;  4A3G H;  1FJG L;  4NXM L;  1V43 A;  1XTD A;  3A0J A;  1I94 Q;  4DV6 L;  1RL2 A;  1E1O A;  1FVI A;  2KCT A;  1XNR Q;  2KBN A;  4GKK Q;  3W5O A;  4DV3 Q;  1QVC A;  3OYY A;  4P73 A;  2ALY B;  4A3B H;  4A75 A;  4HIM A;  4GLX A;  1K9M C;  1PH8 A;  3CME A;  1HJP A;  4DR7 Q;  1P8L A;  3B6Y A;  3JC6 6;  3DLL A;  4BBR G;  4DV5 L;  2AKW B;  4KLK A;  1KRS A;  2HHH Q;  3HKZ G;  1KHI A;  2WFW A;  4IPH A;  4L5T A;  1YEZ A;  3AFQ A;  4UP7 A;  4JI2 Q;  1Q46 A;  1EYG A;  4KHP L;  1D7Q A;  4JI4 Q;  1PFS A;  2YYZ A;  2ATW A;  5IWA L;  1KAW A;  2OQ0 A;  3RZD H;  3PO2 H;  2ZTC A;  1HZA A;  1AE3 A;  1VCI A;  4DV4 L;  5JEA G;  5IYD G;  4DUZ Q;  3RLF A;  5E7N A;  4LF6 L;  3I56 A;  2ZJQ A;  2FXQ A;  4DV7 Q;  2Q2U A;  2JA6 G;  1L0W A;  2R93 H;  4UPA A;  2YTV A;  2XTI A;  4ME3 A;  4YY3 Q;  1M90 C;  3BJU A;  3LGJ A;  4P74 A;  1UWV A;  4DK3 C;  5GAE C;  3CPW A;  2JA7 G;  3K7U C;  2ES2 A;  2R92 G;  1KC8 C;  3S1M H;  2YTX A;  4NPS A;  1NMG A;  3EN2 A;  4BBS H;  1VQF A;  1L1O B;  1OXX K;  5K36 G;  4P71 A;  3CCU A;  1BBU A;  1NE3 A;  5FLX c;  4JV5 Q;  3HKZ E;  3KYH C;  1MJC A;  4LUZ A;  3RNU A;  4OWT B;  4LUO A;  1GKH A;  4MNO A;  5BR8 L;  4HIK A;  3F2B A;  2F52 A;  1PH4 A;  1SFO H;  3HOV H;  4A3L H;  1JJC B;  4LFC L;  2NVX H;  2L15 A;  3UDG A;  1E22 A;  4OWW B;  1VQM A;  2A19 A;  4JI1 L;  1K8G A;  1W3S A;  3CP0 A;  4GKJ Q;  4OO1 G;  1VQ5 A;  1N33 L;  1D8L A;  4R4Q A;  4JI0 Q;  2B63 G;  1UE1 A;  3T1Y L;  1N32 L;  4LFA Q;  4LW1 A;  1IZ6 A;  1IBM L;  4DV7 L;  3T1H Q;  1W2B A;  2GN5 A;  1ASZ A;  5JEA J;  3KF6 B;  2ID0 A;  2UU9 Q;  4P75 A;  3H15 A;  4IO9 A;  1VQN A;  4PZ7 A;  1YJW A;  5IT9 c;  4A3E H;  4BA2 I;  4GN3 B;  5IYC H;  1EQQ A;  2R93 G;  4HJ5 A;  4A3I H;  1XNQ L;  1YIJ A;  1A8V A;  2RHQ B;  1CKN B;  1E3P A;  1YJ9 A;  4J15 A;  3KOJ A;  4R4O A;  4DKA C;  1PH5 A;  1B70 B;  5JJL A;  3BU2 A;  1C0A A;  1Z47 A;  4JI6 Q;  1X9N A;  1VQA A;  1AH9 A;  4KHZ A;  2N49 A;  3PSI A;  1I50 H;  1MIU A;  5C0X I;  4KHP Q;  1I6H H;  4GKJ L;  1CSQ A;  1J6Q A;  3PV0 A;  4DR5 Q;  3OTO Q;  4PZ6 A;  1PYS B;  2R7Z G;  3PF5 A;  1JT8 A;  4BY7 G;  2HHH L;  1PV4 A;  2DUD A;  5M5X H;  4RG1 A;  3OW2 A;  2E5L Q;  1BKB A;  3ICE A;  1NBW A;  2CKZ B;  4JI5 L;  1XPU A;  3I4M G;  5H1S E;  3I2Z A;  4QQB X;  2NZO A;  3I4N G;  5C4X H;  3E9H A;  4QL5 A;  2Q2H A;  1X56 A;  3GTJ H;  1OTC A;  2PI2 A;  4OWX B;  5M5W H;  4LF9 L;  1QVF A;  4LF4 L;  1IL2 A;  3S2H H;  4GS3 A;  4LFB Q;  3IRB A;  2WP8 J;  5C4J H;  4YWK A;  3K81 C;  4R1J A;  2V1C C;  1LTL A;  4H02 A;  3ULL A;  3FHW A;  4A3J G;  1XPO A;  4LF5 L;  1VQP A;  2VUM G;  4BBR H;  2LXJ A;  2JQO A;  1Q82 C;  4YCU A;  3W1G A;  1UE5 A;  3HOW H;  3KJP A;  2I5H A;  3A5U A;  1L2F A;  2GVA A;  2JK8 A;  1VQC A;  1GD7 A;  2R7D A;  4OXP A;  1EWI A;  2RF4 A;  3JAM i;  3S1N H;  3PO2 G;  3PCO B;  2NVT H;  2K14 A;  2LXK A;  3OTO L;  2VQE L;  4L5R C;  1VQ9 A;  4X65 Q;  2YV5 A;  3FKI G;  1A62 A;  2JEB I;  4QGU A;  1VQ7 A;  3GD7 A;  4APV A;  1N34 Q;  4LF7 L;  3S1Q H;  4BBS G;  1IBL Q;  5GAD C;  1X3F A;  1YHB A;  4TVA B;  4X64 Q;  4B3S L;  5LMN L;  2QA4 A;  2A8V A;  4BXX G;  4GOP A;  3RR5 A;  2I0Q A;  4B3T Q;  3T1H L;  4A3C G;  1PYB A;  1WCM G;  1OXS C;  1HZ9 A;  5M3M G;  1PVO A;  2OTJ A;  3I4M H;  2VQF Q;  5ELO A;  1YI2 A;  4HID A;  4DAY B; 
#chains in the Genus database with same CATH topology
 2B29 A;  1M1K C;  4GC7 A;  4LAA A;  1LTT D;  2BE5 C;  3MAQ A;  3CF5 A;  1N9W A;  2K50 A;  4DV2 Q;  2FIN B;  2JA7 B;  4GKJ H;  3TZU A;  1B53 A;  3L4K A;  1Y8O B;  4O42 A;  2FFK B;  4ABN A;  1N36 L;  3NBH A;  1SMY C;  1PRT F;  4HNU A;  1TII D;  1B4O A;  3U50 C;  3D6C A;  3G48 A;  2G5D A;  3C0F B;  1GM5 A;  3M7N A;  4RMF A;  4A3F B;  1VQJ A;  2WAQ A;  2IHE A;  4IAL A;  4X66 Q;  3KDF A;  2J0T D;  4YAK B;  4RKL A;  1G2S A;  1L1O A;  4BY1 G;  2UVU A;  4HJA A;  3L3O C;  3HB9 A;  4IRK A;  2R8J A;  4YR0 A;  2VR1 A;  3CCL A;  1RF2 D;  1F9S A;  4KHV A;  1NJI C;  1N36 Q;  2AMC B;  2ZXR A;  2N3S A;  4ZKC B;  1WCM A;  4DNI A;  2RDG A;  2K5N A;  1E2V A;  2XVS A;  4JI8 Q;  2O5J C;  3MR3 A;  1PK8 A;  5IYB H;  5BMV F;  5DQG A;  5EPJ A;  4Q5V A;  4A3G B;  2PMZ A;  4Q44 A;  5I6Y A;  3BQ2 A;  2NU8 B;  5KFO A;  1CKN A;  4IPD A;  2MJ8 A;  4A3I G;  1FJG Q;  3K57 A;  2K5H A;  1E4G T;  4NXM Q;  1YNN D;  1IBK Q;  4ZCK A;  3NK9 A;  5C4Z A;  1K0S A;  2NVT B;  5DQI A;  1E7Z A;  4GKK L;  1Q3L A;  5LMU L;  3I4O A;  4X3U A;  2WTF A;  1VMC A;  1BUV T;  2UVW A;  4FU0 A;  1SE2 A;  4AYB G;  2YL2 A;  3RB4 A;  3KF8 B;  4KKU A;  1VQG A;  3GTM B;  4ED3 A;  3NEL A;  1CI3 M;  1KIX A;  4C5A A;  1H9J A;  2SDF A;  4Q8E A;  3I4N H;  1KDA A;  4CDC C;  4BXX H;  2YYA A;  2N55 A;  5GQO A;  1Q86 C;  5KG6 A;  1B2T A;  1LV9 A;  1U4M A;  2KHI A;  3HKZ B;  5KT5 A;  4DFA A;  1QJO A;  4EG0 A;  3FVQ A;  4S3S A;  2K33 A;  1G2T A;  2F0U A;  2GLT A;  2R61 A;  3L9A X;  1C30 A;  1LTR D;  3CXC A;  3UDI A;  4HNV A;  3HOZ H;  2JEJ A;  3U9O A;  2B2Y C;  4GNX B;  4B3T H;  3GV3 A;  1X3Q A;  3SK8 A;  4CDD C;  1QZH A;  1EFW A;  2NZH A;  4HN7 A;  1N36 H;  1N33 Q;  2F0Q A;  4YIJ A;  3GTK A;  4BS9 A;  4NP5 A;  5EAY A;  3HKS A;  4JI1 Q;  4U6P A;  5KYI A;  2KED A;  5NUC A;  3HOX H;  2IX1 A;  2F0E A;  4BA1 I;  2EY2 A;  3GTG A;  2ZXP A;  4O2D A;  4O1N A;  2JA5 H;  2RKS A;  2RSN A;  3Q8S B;  3K8A A;  4QY7 A;  3WNZ A;  3F1Z A;  5IGC A;  1O7L A;  3M4P A;  4HMJ A;  4ZK9 B;  4M9U A;  3J80 c;  3U4Z A;  2BA1 A;  1QG7 A;  3A8J E;  4PMW A;  4OO1 I;  4ECR A;  1CE8 A;  2XRS D;  2RCN A;  2WB1 G;  3I91 A;  3CD6 A;  1VBH A;  1I6H B;  3AMU A;  2CZG A;  1S0M A;  3FDS A;  5EOY A;  3HKZ A;  4LFA H;  5JPN C;  2P5Z X;  2FPI B;  3GV5 B;  1Z2O X;  3JSN A;  2R93 B;  1D5M C;  1D6E C;  4IJL A;  1TWF H;  4V19 0;  1KLU D;  4A3M B;  2KEC A;  4JBM A;  1KJ8 A;  4JI5 Q;  2B2V A;  3U9T A;  3F2D A;  4DR4 L;  2K52 A;  3PUW A;  1AN8 A;  3E5N A;  5KFM A;  3HFZ B;  2FE3 A;  1PZI D;  2NVQ B;  2MUY A;  4IUQ A;  1SFO A;  2HIX A;  2K03 A;  3M4Y A;  1TXY A;  2M9V A;  3BDC A;  3JZI A;  4E6I A;  4JBK A;  1NR4 A;  1WTH A;  3JRX A;  5BN4 A;  2JA5 G;  3FKI A;  4JI5 H;  4EYI B;  1ROD A;  3EBE A;  3LNN A;  5CV9 A;  4HAE A;  1S5D D;  4JCV E;  1U4R A;  4MZ9 A;  3TZD A;  1BF4 A;  2Y0S G;  5D1O B;  5DNF A;  3U58 A;  3PUV A;  4KN7 C;  5KGU A;  2L4N A;  4HMI A;  3MFY A;  3MXU A;  3ER0 A;  2VL6 A;  4FDB A;  3Q8Q B;  2GA4 B;  3VPC A;  5IT9 W;  2PNR C;  5C3E G;  2IT1 A;  4DR5 L;  1HQM C;  1KL9 A;  1WI5 A;  3MFG A;  4YWL A;  4LF7 H;  4IQZ A;  2J9G A;  2L1B A;  5LL6 b;  1DGS A;  1FKA H;  2F0G A;  3UI2 A;  3VDY A;  2JEI A;  3W1B A;  1HA5 A;  5D1O A;  5D8D A;  1L0X B;  1VQO A;  4MA0 A;  4QUF A;  1G29 1;  1EIH A;  4LSX A;  1I4X A;  2F1M A;  4P2C B;  3C46 A;  1F9P A;  1R9T H;  1PH1 A;  4FF3 A;  1B6S A;  1OXU A;  4LF4 Q;  4HED A;  4LFB L;  4LF9 Q;  1KC7 A;  1UUP A;  1HNX L;  2EJG C;  3VR2 A;  1VQ8 A;  1SEI A;  5E1F A;  3TQ1 A;  3GTP B;  4DR6 H;  5C0X G;  2MCT A;  2DGY A;  2R7Z H;  5M3M B;  2D0P A;  4TSS A;  5FLM G;  4BY7 H;  2D2C C;  1GUS A;  1RKN A;  1V1Q A;  4K6D A;  3U9S A;  5A2Q W;  1GHK A;  3URY A;  2RBM A;  1YNX A;  1M7J A;  1YZ6 A;  5CV7 A;  3QIA A;  1EUC B;  4YHH Q;  3VA7 A;  4WJ4 A;  1SRO A;  5C4X G;  3H0G H;  4IOC A;  3RFC A;  4DR2 L;  3BQ0 A;  3GIL A;  3S15 H;  1TS4 A;  5C3E H;  1PX2 A;  4LWC A;  4B3R Q;  4WBN F;  2EPB A;  1FL0 A;  2VXW A;  5CV4 A;  1DXM A;  5LXT F;  3MXN B;  2KA7 A;  3CC7 A;  1EIY B;  4J6H A;  1M0W A;  1B7Y B;  3VMM A;  3GLK A;  4F4W A;  3TQT A;  1PH7 A;  3HOW G;  3QG1 A;  2SOB A;  2QGQ A;  1AW7 A;  4HNT A;  1SE8 A;  1XTC D;  1HUN A;  5C3X A;  4A2B A;  4I65 A;  1KBL A;  2MNA A;  4DV5 Q;  3HOX G;  5FJ8 H;  3GTP H;  4F4Y A;  4YQW A;  1YVC A;  2I5M X;  1PH3 A;  5CAE B;  2EYJ A;  5C0X J;  3S16 H;  5KFD A;  2AQ1 B;  3GTM H;  3ND9 A;  2UUC Q;  3KBG A;  3JAM c;  1B6R A;  3TDQ A;  3CCV A;  2I8C A;  2FLN A;  2NVY H;  3CQZ H;  4LF6 Q;  1N32 H;  4QMG A;  4BY1 B;  3GTO B;  1DOM A;  2L12 A;  2AGP A;  2FPP B;  2P0A A;  2DY7 A;  3A56 A;  3IKJ A;  3CVZ A;  4UY8 C;  2DN8 A;  5J2U F;  1UEB A;  4GNX A;  4JV0 A;  4JPB W;  4PG3 A;  2B2U C;  4RGT A;  3T1H H;  1C9O A;  1QNU A;  3AEV A;  3DEO A;  1T9H A;  3K5O A;  3M4Q A;  4UP9 A;  5CC4 A;  2OQK A;  2V4Q A;  4CJ2 C;  1I94 L;  5LMU Q;  3GQC A;  3N52 A;  3OUZ A;  1CHP D;  4RGN A;  2CHB D;  1HNX H;  4EGV A;  3S14 H;  2WAQ B;  1VQI A;  3E0E A;  3KLW A;  4O4L F;  3OIQ A;  5IYC G;  1AFP A;  1I3Q H;  5KFN A;  3A5Z B;  3K7A B;  3TME A;  4JI0 L;  4YHH H;  2EYP A;  1OXV A;  5KFZ A;  2VUM A;  1ZYR C;  1LT5 D;  3CMA A;  4NKL A;  4IRC A;  1DCZ A;  5JVD F;  2AQ3 B;  4OGQ C;  1YHQ A;  1E2W A;  2HCC A;  4RGO S;  1Q1E A;  4ED2 A;  4LF5 H;  1N33 H;  1QVG A;  4JV5 H;  2BOS A;  4R4C A;  4B3M L;  4L5Q A;  1NMF A;  4CKC A;  1FJG L;  1B1Z A;  1I94 Q;  1JLL B;  1RL2 A;  3CQZ B;  2KCT A;  1DZ1 A;  4I4T F;  2KBN A;  4GKK Q;  3DM1 A;  1Z2P X;  3RV4 A;  4P73 A;  2Y0S A;  5KFW A;  2WB1 A;  4GLX A;  4ED6 A;  2MHV A;  2B2W C;  4DR7 Q;  1EYA A;  1P8L A;  1SYG A;  3B6Y A;  4BBS B;  4YJ3 F;  3DLL A;  2KOL A;  2Z9H A;  1RJT A;  4KLK A;  1KRS A;  2UUA H;  3QO2 A;  4IR9 A;  3MXG A;  1H9S A;  4K2L A;  3QJY A;  1EYG A;  3K3P A;  2ATW A;  1MD2 D;  3G6J B;  3N44 B;  3I72 A;  5H80 A;  3PO2 H;  3RZD H;  4K14 A;  3RLF A;  1HHV A;  1I3Q B;  3I56 A;  3GTQ B;  2F0S A;  1L0W A;  1C48 A;  1CA5 A;  3K5H A;  1FGB D;  4ME3 A;  1M90 C;  3GIQ A;  1V1P A;  4X6A H;  1CQI B;  3S1M H;  4UHV A;  1KC8 C;  3EN2 A;  2SNM A;  4FM9 A;  5C1O A;  3GIP A;  5CV6 A;  4NMZ A;  1V4Y A;  4IUN A;  2XN9 C;  4KJN A;  2C2D A;  5KKN B;  3KYH C;  4LUZ A;  3RNU A;  4BY1 H;  4O2A F;  4AYB A;  5BR8 L;  3F2B A;  2F52 A;  3T56 B;  2W7O A;  1TQO A;  3BS1 A;  2ZM6 H;  2ZDQ A;  1JJC B;  2K01 A;  4K2K A;  3GTJ A;  5KFV A;  3X3M A;  2A19 A;  4BWS C;  5G3L D;  2R87 A;  1K8G A;  2NVY B;  4GKJ Q;  2W6O A;  4DV2 H;  4TQS A;  4RHR A;  1VQ5 A;  1ZYR D;  5D3I B;  3QFF A;  5COR A;  2BDO A;  4LFA Q;  3I8Z A;  1IZ6 A;  3VR3 A;  3J80 W;  4YJ2 F;  3IG0 A;  1ZHQ A;  5DEH A;  3K5L A;  1ENA A;  2ID0 A;  3G6X A;  3WOE A;  3OOC A;  1S03 G;  4HJ5 A;  1XNQ L;  2R85 A;  2O2L D;  1YIJ A;  1E3P A;  1YJ9 A;  5CA0 F;  2BE5 D;  1C0A A;  3EJI A;  3ETJ A;  1J5E H;  1VQA A;  5KG0 A;  3V6H A;  3S1M B;  4KHZ A;  4V0B A;  1I50 H;  5C0X I;  4GKJ L;  4DR5 Q;  1EUD B;  3LWE A;  1JT8 A;  2DUD A;  3DXJ C;  4TV9 F;  3OW2 A;  1E2Z A;  2WII B;  1NBW A;  4OIJ A;  2B39 A;  5CV5 A;  1AN7 A;  5BN5 A;  2A73 B;  2RDH A;  2VUG A;  2L5T A;  2BR0 A;  4AYB B;  3E9H A;  4QL5 A;  1VF5 C;  1X56 A;  1CM9 A;  1ZKO A;  1QVF A;  3VYR A;  4Z9C B;  5G3L F;  4LFB Q;  5D1P A;  2VB2 X;  1D2B A;  3ULL A;  3BQ1 A;  3HG9 A;  1XPO A;  2VUM G;  1VQP A;  2QDB A;  4BBR H;  4C5B A;  1YNJ C;  1F9Q A;  3KJP A;  4FF4 A;  4X3S A;  4MTE A;  2JK8 A;  4KHP L;  1ILQ A;  5KFL A;  3PCO B;  3WOF A;  3PVX A;  1DV1 A;  2HVQ A;  2F0D A;  5EJW A;  2DNE A;  4LF8 H;  4ED0 A;  2JA7 A;  3GD7 A;  4APV A;  1N34 Q;  1CK1 A;  3K5N A;  1IBL Q;  3KHL A;  1YHB A;  3NP8 A;  5LMN L;  1YNN C;  1QE6 A;  5EWG A;  1WCM G;  1Y8P B;  1HZ9 A;  5L1I A;  3ITP A;  4RGM A;  1KNE A;  2K05 A;  2VQF Q;  1BOS A;  1KJ9 A;  3T5L A;  3OMC A;  1YI2 A;  2HHH H;  1RDP D;  5L1J A;  2RDI A;  1HR0 H;  4PDB A;  5T1I A;  4EEQ A;  2IHF A;  1STH A;  3ZYY X;  5KG7 A;  2EY6 A;  1Y8N B;  5IGE A;  3W3A A;  3H0G B;  2QDL A;  2W9C B;  1VS0 A;  1Y1W G;  4A3B B;  4EFB A;  1XNR H;  2RCF A;  4RA8 A;  3RIZ A;  3RN5 A;  2EYF A;  3M3Y H;  3CCE A;  4DR6 Q;  5C5L A;  1RD9 D;  1A3T A;  2B8G A;  3C1F A;  3VA5 A;  2DJF C;  4HTH A;  4WFN 3;  3V2T A;  3MJF A;  2L9H A;  3RAQ A;  2PZU A;  1CHQ D;  4A3K H;  3NXW A;  4MV9 A;  4IZO A;  4DL5 A;  4MAM A;  4ECT A;  2ZTE A;  4X3T A;  4ULL A;  3TBI B;  2E2J H;  1EY4 A;  5KFA A;  2KCN A;  4KV6 A;  1WCM H;  2HDM A;  2EQS A;  2L0C A;  4J1M A;  3TEH B;  1NTG A;  4ED8 A;  2XNA C;  2CFM A;  3H3V H;  4JI1 H;  1S40 A;  1K1S A;  3RN2 A;  1G91 A;  2F0J A;  4LFC H;  2A1A A;  4G4K A;  2W6P A;  1K0R A;  5IYZ F;  2VA2 A;  1VQL A;  2UUC L;  4EQ5 A;  1HZC A;  1STG A;  3MVV A;  3H6M A;  1CQV A;  4DV0 Q;  4ETS A;  1XNQ H;  3M3Y B;  1XMQ Q;  4X66 L;  3UFX B;  2H4O A;  2Y0S B;  1JDB B;  5KT3 A;  1H9K A;  1I6V C;  2YZG A;  2HVS A;  5GRO A;  2VY3 A;  1Y1W A;  2MGS A;  2TMP A;  3NE5 B;  2F0K A;  4PV1 C;  3PUY A;  1Y69 U;  4BY7 B;  4UDU C;  4H44 C;  4QIW E;  5JJZ A;  4DR1 Q;  2VPS A;  2Q8T A;  4DV4 H;  4A3D H;  5IWA H;  1AUX A;  5IP9 G;  4A3K G;  3D6W A;  4M7E A;  4DR1 H;  2OEO A;  1KXL A;  3J81 E;  2K32 A;  2F0V A;  4DR7 L;  1S97 A;  2MO0 A;  2RVL A;  5C1P A;  2YRW A;  3BVM A;  3KLS X;  1YHA A;  4DV5 H;  4JI8 L;  1CZW A;  4RNN A;  4JI6 H;  3CU7 A;  1TS3 A;  4DR4 Q;  5KG4 A;  4FO2 A;  2BQ3 A;  5FLM H;  2BH8 A;  4YWM A;  3J7A V;  5BR8 H;  5IGG A;  4J9Q A;  4DXG A;  1XMQ L;  3CCS A;  1LYL A;  1I7L A;  4MV8 A;  2ATL A;  4B3M Q;  4OX9 H;  1NY4 A;  3G8C A;  1TWG B;  2UXB Q;  5J39 A;  1PLF A;  3H40 A;  5BR8 Q;  1S3O A;  3CCR A;  4UCV A;  4DV1 H;  3DWQ A;  1MZB A;  1Z7T A;  3VR4 A;  1I3Q A;  5ISR A;  1JIC A;  1VQB A;  5KFT A;  2JJQ A;  3KFU A;  2PW5 A;  1II3 A;  4GNX C;  1J9O A;  1DJR D;  4RAY A;  4DV3 H;  3GTG H;  5IP9 H;  2QW7 A;  1PH2 A;  2JA6 B;  5CGK A;  3WDN A;  2NTT A;  2QIL A;  3EYY A;  2RGR A;  3PMF A;  1K83 H;  1C7Y A;  2IX0 A;  3HOW B;  3NGD A;  2K04 A;  2CQA A;  2RSO A;  5HGT A;  1H95 A;  4A3C H;  3MWD A;  5LL6 X;  1TWH H;  3BZD B;  3CPF A;  1VQ6 A;  5M5Y B;  4JI4 H;  2NTS A;  3HOX B;  2ASD A;  4JBW A;  4JW0 A;  5KT2 A;  2CW0 D;  1XNQ Q;  1HNX Q;  1DOK A;  4A3B G;  2NYZ D;  3N8D A;  1W6J A;  3PUX A;  4YY3 L;  3PIO A;  3PO3 G;  3KLS A;  2WKD A;  4NB3 A;  3ERO A;  2ASL A;  4MA5 A;  1SFO B;  1EY8 A;  1B33 N;  1VQ4 A;  1TWG A;  2J7Z A;  1G8Z D;  4RWS C;  1XMO H;  1QOH A;  2NN6 G;  2F4V Q;  4CDF C;  2BH2 A;  2JP1 A;  4YHH L;  5FO7 B;  5LL6 S;  4C3I H;  4A3F H;  3HOU G;  1U4P A;  2E5L H;  4KJO A;  4LF6 H;  1E24 A;  4B3R L;  1U9R A;  1PH9 A;  3PW0 A;  1UC9 A;  2R93 A;  4Y7N B;  2ZTD A;  4LF8 Q;  2ZDH A;  2EY1 A;  3J80 i;  4EGQ A;  4KK7 A;  3GTM A;  1I94 H;  4GC6 A;  3MR5 A;  3A8I E;  1N32 Q;  3RMH A;  1CQJ B;  2OCE A;  5EKL A;  1PTO H;  1PFM A;  1KDB A;  1S72 A;  5E4W C;  1O78 A;  1EEI D;  1X3G A;  4LF5 Q;  4O0A A;  2UXC L;  2SCU B;  1XMQ H;  1A2T A;  2N8N A;  4DK0 A;  3HOY B;  4J0M A;  4WJW A;  1KLG D;  4CDE C;  1KRT A;  1TWH A;  4PZ8 A;  1V9P A;  2IPK D;  2W8L A;  4DV6 H;  2PCF B;  2VQE Q;  1KDC A;  1PRT B;  4JI6 L;  3LP8 A;  1LT6 D;  4IPC A;  1U5K A;  1HR0 Q;  4K6L A;  1E0B A;  1BVS A;  2CCZ A;  1STE A;  4JYA L;  1K8O A;  2Z4I A;  4EYH B;  5KNC A;  1ZET A;  5LYJ F;  3GIM A;  1SMY D;  1OXT A;  4X64 L;  1O7Z A;  4C3I G;  4NXN Q;  5I6W A;  4ED1 A;  2D0O A;  3UDF A;  3J81 j;  4BWG B;  1RK6 A;  1ET6 A;  5A2Q E;  2E5L L;  4K5V A;  1TR5 A;  4RFB A;  3GTQ H;  5A35 A;  3PW2 A;  2C28 A;  1KJI A;  5JQW A;  2CW0 C;  5LMN W;  2UXC Q;  5F2D A;  3R5X A;  5EWF A;  3RLN A;  3TS0 A;  4X66 H;  3GV6 A;  3PO2 B;  2FMA A;  4ECV A;  1Y1V H;  1HTP A;  2CVR A;  1LUZ A;  2E2J B;  5C44 G;  1RIP A;  3KAK A;  4UCO A;  1G6P A;  3D8G A;  3I4L A;  1ZXT A;  5L37 A;  1ZQ7 A;  4LH7 A;  1B9N A;  5IGF A;  1ENC A;  3N42 B;  3QOL A;  4DF7 A;  1Q1B A;  4LF9 H;  5KFC A;  2W9B A;  4B3S H;  2H5X A;  4K5W A;  3CCQ A;  2HDL A;  1HA6 A;  1RJR A;  4NXN L;  1DD2 A;  4JC0 A;  4XYO A;  3EQL C;  2YZN A;  1U0L A;  1K1Q A;  3MTS A;  1WR2 A;  4YAJ B;  1XJV A;  2EXD A;  3NEM A;  4ILW A;  3M4I A;  1EYC A;  2KCM A;  2PMZ E;  4IJH A;  5D14 A;  3RZO H;  3R5F A;  1KAA A;  1A63 A;  4DV3 L;  3VYS A;  5BPF A;  1J8I A;  2MQH A;  4RHS A;  2VQF L;  2LMC B;  4JG2 A;  3UE1 A;  4ECU A;  3RB3 A;  3J81 W;  1DV2 A;  5IP7 H;  5I9O A;  1Y1W B;  3HRZ C;  5KG3 A;  1L1O C;  2AUK A;  1BNC A;  5J2T F;  3K5I A;  3R23 A;  2F4I A;  1A3U A;  1JC7 A;  3RJ0 A;  3S1Q B;  2G9H D;  3HOV B;  1GOZ A;  3TN2 A;  3CCJ A;  1I5F A;  1IXR A;  2NVX B;  1E1T A;  2HIV A;  4DA2 A;  1HR0 L;  2Z6K C;  2EXZ A;  2Z6B A;  3HP3 A;  4AIM A;  5C5J A;  3E9I A;  1I4Q A;  2GVB A;  3CCM A;  1HNW Q;  2ICE C;  4AH6 A;  2KUM A;  3A7A B;  3GIK A;  2D9U A;  3U4V A;  4JVZ A;  2AUJ D;  3H20 A;  1JJG A;  4RAZ A;  1EYZ A;  2R7L A;  4DR7 H;  3H91 A;  1Q12 A;  4DR1 L;  4U67 3;  2XGT A;  3D4W A;  1GYF A;  3K0X A;  4HYK A;  3KDF B;  4F50 A;  2BA0 A;  3AU7 A;  3GV7 B;  4XTC S;  4CKB A;  1F2L A;  2VUM H;  1X65 A;  4AQY L;  4C2M B;  2XWJ B;  5IP7 G;  2CH4 A;  4QW8 A;  3GID A;  1WD0 A;  1K73 C;  1WYD A;  1IBM Q;  2R86 A;  2E2I H;  1BCP D;  1CKO A;  2YU9 H;  4XZ3 B;  2X0S A;  2K4K A;  4U7C A;  4G3I A;  1QCB D;  3PIP 3;  5M5X B;  1I50 A;  2UU9 L;  1UE7 A;  1JJ2 A;  1K8A C;  1JE5 A;  2WAC A;  3LX0 A;  1Z9F A;  4O4H F;  1EOT A;  2AQ4 A;  5FD6 A;  1T5X D;  1V43 A;  2AGQ A;  1T5E A;  4C3H B;  1FVI A;  4J9R A;  4K8I A;  1ENF A;  4DV3 Q;  5I2Y A;  5KEE A;  1IKM A;  4CC5 A;  1PH8 A;  3CME A;  4F8M A;  3DWA A;  1GSA A;  2QCP X;  2R6F A;  5JUM A;  1H9M A;  2AKW B;  4ZKB B;  5KT6 A;  2ZXO A;  1KHI A;  4IPH A;  4L5T A;  4UP7 A;  1YEZ A;  3AFQ A;  4JI2 Q;  2SNS A;  3TP5 A;  1PFS A;  3BYY B;  3S2D B;  3EFX D;  1SXT A;  3NSW A;  1AE3 A;  5JEA G;  5IYD G;  3GTJ B;  1XX8 A;  3PQI A;  5T1G A;  1F2Z A;  4C5C A;  1M8A A;  4UPA A;  5A2Q L;  3CPW A;  4QF4 A;  4DK3 C;  1UWV A;  5GAE C;  4RKB A;  2JA7 G;  4AQY H;  2ES2 A;  2ICI A;  3K3V A;  1MSG A;  2K5Q A;  4PQX A;  2XCA A;  1AZP A;  1GGO A;  4XX0 B;  4RZR A;  4KKT A;  1L1O B;  1OXX K;  3M9O B;  1JX4 A;  5CBA E;  2Q8R E;  2N88 A;  3CCU A;  2I87 A;  5FLX c;  2Z4H A;  5LOV F;  1RTO A;  1B9M A;  3T4A C;  4Q8F A;  4XYQ A;  3HOV H;  1MGS A;  4J9O A;  2E74 C;  2R8I A;  4OWW B;  1VQM A;  4L6T B;  2JA5 A;  4FF2 A;  1M0T A;  5LMN H;  3CP0 A;  3DF7 A;  4DUZ H;  1IL8 A;  3HXL A;  2Z1C A;  2B63 G;  1UE1 A;  4LW1 A;  3BA8 A;  3PO3 B;  3MR6 A;  1M4V A;  1IBM L;  3RAX A;  1CA6 A;  4CJ1 B;  2EYH A;  5HBR B;  2W7P A;  3GII A;  1ASZ A;  1KTK A;  3NTH A;  5I4D A;  2UU9 Q;  4P75 A;  3H15 A;  5DG9 A;  1YJW A;  4A3E H;  3JRW A;  5JAV A;  1L0Y B;  3KUP A;  1EQQ A;  4O3N A;  2H1E A;  4RU9 A;  2W70 A;  1EU3 A;  1CKN B;  2RHQ B;  2RGV A;  5LA6 F;  2IW3 A;  1PTO C;  2W57 A;  4RCO A;  4X65 H;  5HUR A;  4JI6 Q;  1PTO F;  4DK1 A;  3V6K A;  3SK4 A;  1AH9 A;  1HRJ A;  2N49 A;  3PSI A;  1MIU A;  1R4P B;  1J6Q A;  3OTO Q;  1S5F D;  2EE1 A;  2R7Z G;  4IR1 A;  4BY7 G;  3QR8 A;  1A2U A;  3BYT B;  2E5L Q;  3ICE A;  2JA5 B;  2C2E A;  1EY0 A;  2F0N A;  5HV6 A;  1EY5 A;  3I2Z A;  3TII A;  1M6V A;  2Q2H A;  3V96 A;  4LF9 L;  5M5W H;  4YR3 A;  5KFQ A;  3ND8 A;  1IL2 A;  4GS3 A;  4HCE A;  5F9L A;  1IHZ A;  1VMP A;  3OHX C;  5EQ0 A;  4YWK A;  4LF5 L;  1LTL A;  2HD3 A;  1V1P B;  3T5K A;  1Q82 C;  3TIN A;  4ZQI A;  3GTQ A;  3HOW H;  2EYM A;  1TU2 B;  3Q22 A;  1WTP A;  2I5H A;  3RTX A;  3OTO H;  2O4X A;  3A5U A;  1L2F A;  4OXP A;  3ERQ A;  1K83 A;  4C1N I;  2NUA B;  1EWI A;  2RF4 A;  3JAM i;  1JOK A;  3S9W A;  1RTN A;  2XD4 A;  3Q2O A;  1STA A;  4EGJ A;  1WTR A;  1D1I A;  3RV3 A;  2PYK A;  1H9S B;  4QWD A;  4MN3 A;  1VQ7 A;  2JEB I;  4X64 H;  3W2D A;  3GTK B;  4BBS G;  5GAD C;  1X3F A;  1F9R A;  2A8V A;  3HGB A;  4BXX G;  2B63 A;  5C44 B;  3T1H L;  4A3C G;  1PYB A;  3T5H A;  1XXG A;  3Q6S A;  1BQQ T;  2OTJ A;  4KTA A;  3QB3 A;  3C3L A;  3AB9 A;  3VYU A;  3JSL A;  1CZG A;  1CSP A;  2JXM B;  3F8N A;  1GVP A;  4QW9 A;  2LSS A;  4GOP C;  1HCZ A;  1LTA D;  3PO3 H;  2ZJR A;  3TSS A;  2AHO B;  5HGQ A;  3C1E A;  3STB D;  1I4R A;  2LS0 1;  2EZV A;  1QZG A;  3R5H A;  5ELB A;  3KLR A;  3SHL A;  2UXD Q;  2R8G A;  4DL6 A;  3K80 C;  1PFB A;  1LTG D;  2O5I C;  4TUY F;  1L2Z A;  3V6J A;  5J1Z A;  1BBW A;  3KAJ A;  3HOU H;  4DL4 A;  1GUT A;  5DLQ E;  1N34 L;  2R7K A;  1W93 A;  1WOC A;  1IBL L;  2J4X A;  3HOY H;  2K7V A;  5LMN Q;  3KJO A;  2EYL A;  4QWA A;  4NW2 A;  4YCV A;  4HJ9 A;  2UXB L;  2R7Z A;  4EBC A;  1T94 A;  5CA1 F;  3BA9 A;  2WKC A;  3BDO A;  1PTO B;  1IYU A;  4DV7 H;  3HOV G;  3Q23 A;  3V4Z A;  2CWA A;  5DM6 3;  1K28 A;  4MV6 A;  5CV8 A;  4DR2 H;  2CQO A;  2FLP A;  2YCH A;  5M3M H;  4XYL B;  1FGU A;  4DNR B;  5KFI A;  5M3F H;  3BZK A;  5AFW A;  5KX5 F;  1STB A;  2VS1 A;  4JOI A;  1CUK A;  3SDZ A;  2B63 H;  1NAP A;  2VNU D;  2KVM A;  2GPS A;  1R4Q B;  4ZAI A;  1DIK A;  5KFR A;  4TQU S;  5EWE A;  5CYU A;  1GLV A;  2C00 A;  4QIW A;  5FPO A;  1F2M A;  4JOI C;  4O3R A;  4DR6 L;  4FNF A;  3G4S A;  1X55 A;  2YTY A;  3O13 A;  2A69 D;  1GJX A;  1QNK A;  1XMO Q;  1DOL A;  1KNA A;  2QKI C;  3MZ5 A;  3PF4 A;  2E2H A;  4LFB H;  4ZRZ A;  2DJG C;  2NUC A;  4ZLT F;  3S16 B;  4KKS A;  1HNZ L;  2JN4 A;  4TRD A;  5EKK A;  4KY7 A;  2VW9 A;  1JR0 D;  3GTL H;  4APM A;  2F4V L;  1MKH A;  2DIK A;  3I4M B;  4CBV A;  4DR5 H;  2OH2 A;  2RDF A;  5EPL A;  4JI2 L;  3WO1 A;  2EOT A;  2ASB A;  2PQE A;  4POF A;  1EIF A;  3SE0 A;  4LMY A;  1I4P A;  2I46 A;  1RJQ A;  2VUM B;  4OON A;  4KY6 A;  3S1R H;  1O80 A;  3K59 A;  3H3V I;  5M3F G;  2JA9 A;  2E2D C;  5EBC A;  4DR3 H;  3G71 A;  5LHY 1;  3OPO A;  3VR5 A;  4KD4 A;  3K58 A;  4R8U B;  3PN1 A;  3S14 B;  1QUQ A;  4X62 L;  4TKO B;  1JOO A;  4ALP A;  5KFG A;  1B3Q A;  1SSO A;  2UXB H;  1TWA A;  2MPM A;  5JVG 3;  4DU9 A;  1BXR A;  4DGZ A;  4EEY A;  2HQE A;  3PZP A;  1HNW H;  1FNW A;  2C5C A;  4I50 F;  2R7N A;  4KN4 C;  2VPQ A;  3RBE A;  4G7H C;  1HTL D;  4FXK C;  4FS2 A;  2R7F A;  1Y1V G;  4FF1 A;  1K8M A;  2E76 C;  4HR7 B;  4X62 H;  2C9O A;  3OUU A;  4LFA L;  2YU9 A;  2R92 A;  1SMX A;  1PH6 A;  3RGX A;  4RB3 C;  4XQJ A;  4HJ8 A;  2PNH A;  3M85 A;  2PQA B;  1EU4 A;  2QF7 A;  4DR3 L;  4ED7 A;  1DYQ A;  1KEE A;  5DM7 3;  3IAY A;  3E0J A;  3H0G G;  1EZ8 A;  3M9B A;  4XIG S;  3GQB A;  1D5Z C;  5M5W B;  1I7N A;  5DGB A;  1SN8 A;  2K1B A;  1T36 A;  4RH6 A;  3CRL C;  4GN4 B;  3TP8 A;  5KNB A;  2KHJ A;  1HNZ Q;  1EZ1 A;  3UQ8 A;  1FNU A;  4A76 A;  2F4V H;  2FP4 B;  1I50 B;  1VQH A;  4HSV A;  5IYB G;  1HNZ H;  1X3E A;  5JJI A;  1N8R C;  3J81 i;  4KY5 A;  1GXD C;  3EVQ A;  4ECY A;  4M1U B;  2MP1 A;  3RZD B;  1BO0 A;  2R3Z A;  1A0I A;  4DK6 C;  3T1Y Q;  1TT2 A;  4TQR A;  1FNV A;  4ZOL F;  2UVR A;  5IOD A;  1JIH A;  3H09 A;  2Q2T A;  1R9T B;  3TRZ A;  2ASJ A;  1BR9 A;  4JI3 Q;  1IBK H;  4A4I A;  2K5W A;  3EA6 A;  4IAJ A;  5I9P A;  2YZM A;  2B2Y A;  4ECX A;  1MJE A;  2FK1 A;  4Y7N H;  5KFF A;  4A3G G;  3J81 L;  4G57 A;  5EBD A;  4RCN A;  3FP9 A;  1SNP A;  1TY0 A;  2WB1 E;  1YJN A;  2PQA A;  5KG5 A;  1NUC A;  5KG2 A;  4I55 F;  5KYL A;  1QB5 D;  1PRT C;  5FK9 C;  2UUB L;  3K0Y A;  1SRU A;  4ODG A;  4X65 L;  2A74 C;  5M5Y H;  3GP7 A;  4C3H G;  3H4D A;  4C3J H;  1XDN A;  4J9P A;  2J6T A;  4LF8 L;  1LTI D;  4LF7 Q;  3MHB A;  3QZ7 A;  1K83 B;  1MBY A;  5FLX W;  2JE6 I;  4I7Z C;  4IWY A;  2MO1 A;  1GSH A;  4DR3 Q;  1C8C A;  1CS0 A;  1TWC A;  1WSC A;  3L2P A;  1JB7 A;  3N41 B;  1JDE A;  4KHP H;  2E2I A;  2K5D A;  3FKI B;  2IX3 A;  4EBD A;  3K6O A;  4IOA A;  4ECQ A;  3MXN A;  4EX5 A;  4MTN A;  2JEA I;  3KXY T;  4AQY Q;  1QUQ B;  3M4O B;  2NVQ H;  1W96 A;  4UCT A;  3STB C;  2UXD L;  2WYO A;  1AZQ A;  1TS5 A;  4JYA Q;  4AYB E;  4LMQ D;  1Y1V A;  4G7O C;  3ULP A;  1STN A;  5D3D A;  1U4L A;  1B3A A;  4ZHQ F;  1IYJ B;  3D4R A;  3GTO H;  4FYD A;  1YBY A;  3I3C A;  2B2T A;  2F3I A;  3NBH B;  1ESR A;  3TQY A;  2I80 A;  5EZY F;  2JA8 H;  4A3E B;  1D5X C;  3T53 B;  5L1K A;  2I07 B;  3I73 A;  3EIV A;  1PZK D;  5C4H A;  1VQD A;  1I4H A;  4DV0 H;  4K0K H;  2BQR A;  1TWG H;  4B3S Q;  4C3H H;  2QEX A;  2SEB D;  3PUZ A;  5C5M A;  1X6O A;  2ZM6 Q;  1ULZ A;  4A2A A;  4UAI A;  5IY0 A;  3D4D A;  5T14 A;  1X54 A;  1PA6 A;  2Z8L A;  2JA7 H;  4GOP B;  3KF6 A;  3TP6 A;  1NNX A;  4FVM A;  4GN5 A;  3UE0 A;  4RNO A;  4H7B A;  1S0O A;  1DON A;  3FPU B;  3GTG B;  1XWE A;  3Q8D A;  3DWP A;  4A3D G;  3MFH A;  3KK7 A;  1EFI D;  2A68 C;  1RK5 A;  4N9P A;  4WRD A;  2Y0S E;  1WTQ A;  1S5B D;  4DV0 L;  4DUY Q;  1C4Q A;  3MEF A;  5LP6 F;  3C2P A;  2OT2 A;  1GUO A;  5JVH 3;  1EWH A;  5IE8 A;  2UUB Q;  5J3B A;  1ML0 D;  3I7F A;  1QIL A;  1A9X A;  3CHB D;  3SXH A;  1CKM A;  2EJF C;  1AP0 A;  4LUV A;  2ZM6 L;  4N8F A;  2NU7 B;  2W6Z A;  2PO4 A;  4HIO A;  3MWM A;  4GLA C;  1S0N A;  2UXD H;  1ZHS A;  1JCK B;  1AEX A;  3MFI A;  3CC4 A;  4RUA A;  5C4J B;  2ENB A;  2DZD A;  4XQQ A;  3TS2 A;  3TRE A;  4ME5 A;  3RD4 A;  2AWO A;  1STY A;  2EDG A;  2RQX A;  5AJ3 L;  4ZQ3 A;  4GKK H;  3E6Z X;  1NCV A;  1BGW A;  2F0F A;  3HZX A;  3J7Z C;  2W6Q A;  2UVV A;  5ELC A;  1TAE A;  3T13 A;  5JEA H;  5IYD H;  1O7I A;  4WOR A;  1EOV A;  3E3X A;  5FO8 B;  5IGB A;  4R8I A;  4A3J B;  1HNW L;  1ESF A;  3LWB A;  3CAM A;  3LWU A;  2WAQ E;  2V9W A;  4A3K B;  2UUA L;  4QJF A;  4A3G H;  5JH7 F;  3A74 A;  4R4I A;  5ELE A;  3QZ8 A;  2BCO A;  2G9D A;  2VQD A;  3RZO B;  2W9A A;  1E1O A;  4R7R A;  3L4J A;  3W5O A;  3TP7 A;  1QVC A;  1PTO D;  2EYO A;  5L1L A;  2L55 A;  1K9M C;  4HIM A;  4K5X A;  2V5A A;  2V58 A;  2VA3 A;  1HJP A;  1FYC A;  4ECW A;  1EZ6 A;  1LO5 D;  3RGZ A;  3PR4 A;  2JSO A;  1FJG H;  1HFG A;  4BBR G;  5COY A;  1IW7 D;  5FLX L;  3HKZ G;  3TIG A;  4RUC A;  2WFW A;  2NN6 H;  1IKL A;  3KHH A;  1WH2 A;  1WCM B;  1HFN A;  3NPP A;  1KAW A;  1HZA A;  1VCI A;  2FB9 A;  3P1H A;  1Y1V B;  5E7N A;  1LLR D;  2O03 A;  2R93 H;  4DV7 Q;  3S2H B;  2HVR A;  2JA6 G;  2YTV A;  1EQV A;  2XTI A;  4YY3 Q;  3LGJ A;  1K3B C;  2R92 G;  2F0L A;  3KTM A;  4L1K A;  5DG8 A;  1OWT A;  4NPS A;  2YTX A;  2VB3 X;  1NMG A;  1FR3 A;  1VQF A;  4BBS H;  2CW8 A;  2DLN A;  2PBZ A;  3RF2 A;  2IMW P;  4B08 A;  1TA8 A;  1IYV A;  2AU0 A;  1H9R A;  3HKZ E;  2QEJ C;  2HT1 A;  3J7A 5;  4HIK A;  4LUO A;  1GKH A;  2M05 A;  4F88 A;  2FK3 A;  1SFO H;  4X3K A;  1GHJ A;  1BJT A;  3G6Y A;  4A3L H;  4MIU A;  2L15 A;  3MR2 A;  4YP3 A;  5DQH A;  5FO9 B;  2FPG B;  4F4Z A;  1BCP B;  1D1K A;  1V1O A;  4OO1 G;  3H0G A;  4A93 B;  2W9C A;  2UU9 H;  4CKE A;  2NVX A;  3T1Y L;  1N32 L;  4R8N A;  2JEF A;  5E4X A;  2HCI A;  5DGA A;  2F0W A;  4DV7 L;  2F0P A;  3T1H Q;  2GN5 A;  3S17 B;  3CRK C;  2VQE H;  2E75 C;  3KBX A;  3KF6 B;  3MWE A;  5K2M A;  1LT4 D;  3KHR A;  4JV2 A;  1VQN A;  4PZ7 A;  1WTO A;  3T16 A;  5IT9 c;  3QOJ A;  4C3J B;  4GN3 B;  4BA2 I;  4QCL A;  2WE6 A;  2R93 G;  4RB2 C;  1N34 H;  3P75 A;  3SR1 A;  1A8V A;  1PYW D;  3KOJ A;  4R4O A;  1Z47 A;  2C2R A;  1RHP A;  2NZ1 D;  1X9N A;  4PWQ A;  3OWE B;  4H13 C;  3BDL A;  1JOR A;  2B2V C;  2JYO A;  3H94 A;  4J8Q A;  1SCU B;  4LF4 H;  1PRT D;  3GTL B;  1I6H H;  5C0X H;  1O75 A;  4PZ6 A;  1PYS B;  5CBE E;  3PF5 A;  1PV4 A;  4L63 B;  1XYI A;  3GV8 B;  3IN5 A;  1V51 A;  1SND A;  3NQT A;  3Q0A A;  4OO1 H;  4GZY C;  2FK2 A;  5H1S E;  5KFE A;  5C4X H;  4NXM H;  3A7L A;  3R2I A;  4FP5 D;  4DN4 M;  3GTJ H;  4MTD A;  1OTC A;  4OWX B;  1B50 A;  1GUN A;  3I70 A;  1B44 D;  4JI2 H;  3I12 A;  2WP8 J;  4ZI7 F;  4A3J G;  4R1J A;  3FHW A;  5C3E B;  2LXJ A;  2JQO A;  5M3F B;  4B3R H;  1CFM A;  4YCU A;  1UAP A;  3W1G A;  4LJZ C;  2WV6 D;  5BN3 A;  3N6R A;  5DG7 A;  1BCP F;  2GVA A;  2R7D A;  1VQC A;  1GD7 A;  3KHG A;  1EY7 A;  5KFK A;  2LXK A;  3OTO L;  2BDN A;  4IUP A;  2A68 D;  1VQ9 A;  1HUM A;  4I7A A;  2KCC A;  2M2L A;  4X65 Q;  1SYX B;  4J9K A;  5JVL A;  2F0O A;  1NSN S;  5IGD A;  4J9S A;  4LF7 L;  5K36 H;  1S5E D;  2F3V A;  4YR2 A;  4B3S L;  2QA4 A;  4IUU A;  2FMM A;  1PXU A;  3RR5 A;  4GOP A;  1PMR A;  4XXE A;  5C4X B;  2XWB B;  4OEM B;  1OXS C;  1PVO A;  5M3M G;  5FD5 A;  4RB0 A;  5KRU A;  3I4M H;  3CQZ A;  1SAP A;  5ELO A;  5KT4 A;  2V4D A;  1WTV A;  4FBU A;  1SNO A;  4LNQ A;  5TSS A;  3R8B A;  4CJ0 B;  1G51 A;  5DLF A;  3GDE A;  1HZB A;  5JJK A;  2FKL A;  3D0F A;  4QWE A;  3SGI A;  3DMU A;  2W8K A;  1IBL H;  4DR4 H;  3GO5 A;  2VOB A;  4F4X A;  5ELF A;  4DV1 L;  3BAA A;  2K75 A;  4DL3 A;  4A3D B;  1S9F A;  4XT3 B;  3SK5 A;  3OSP A;  1SE3 A;  1GSO A;  1ICF B;  1VDZ A;  1SNM A;  2NBF A;  4JYA H;  4IFD J;  3M9M B;  4A93 G;  4JI7 L;  5E3F A;  1W6K A;  2C35 B;  3HOU B;  5KFU A;  2OXP A;  1IBM H;  3JAM L;  3K5M A;  5CMD A;  4A3M G;  3RB0 A;  4PMB A;  1GUG A;  1FD7 D;  1GUW A;  2KSW A;  4C2M H;  1CTM A;  1IOV A;  3UDX A;  1E4E B;  2NWG A;  2UXC H;  1P16 A;  2B2U A;  2E2H B;  1VAJ A;  4M8A A;  2DPJ A;  2Z6K A;  4O3O A;  3GTO A;  1BNZ A;  4MHE A;  1KAB A;  3JAM E;  3PIO 3;  4ME6 A;  3H3V C;  3OSO A;  5ELD A;  3FMA A;  1E4F T;  4UCS A;  4IFD G;  1EIG A;  2A69 C;  4HR7 A;  2FLL A;  3J7A K;  1AUV A;  3SI8 A;  1EY9 A;  3BVZ A;  1KJJ A;  2FJ2 A;  1F77 A;  2AQ2 B;  1N48 A;  2ZJP A;  1TVX A;  4DAY A;  2UUA Q;  2CWP A;  2IWH A;  1KJQ A;  1ICW A;  2WAQ G;  3J7Y W;  2W6N A;  3IFT A;  2XCL A;  1LM0 A;  5DAU A;  4DV6 Q;  3M9N B;  5FJ8 G;  2EIF A;  2PZW A;  4B3T L;  3MC0 B;  5KFJ A;  2Q2I A;  3T1Y H;  1YIT A;  4EQP A;  4YY3 H;  4RAU C;  5AJ3 Q;  1O7Y A;  4R8U A;  1VQE A;  3FKI H;  2IBK A;  1EQR A;  1IW7 C;  4FXG C;  3BJY A;  1SE4 A;  1JWU D;  4KI0 A;  2X69 A;  2KEN A;  4F87 A;  4XDX A;  3S24 A;  2NVY A;  4JI4 L;  2R7M A;  3AQQ A;  4DL7 A;  4IPG A;  3E5S A;  4B9X A;  5C3W A;  4C2M A;  1SLJ A;  1S10 A;  2K5V A;  3MXP A;  3HOZ B;  5BPH A;  1WFQ A;  1CQF A;  1EEF D;  5KG1 A;  3VPB A;  5C6A A;  1JE4 A;  3QWN A;  5KFY A;  3ULJ A;  2EY5 A;  5FOB B;  3S15 B;  1TWC B;  2KJX A;  3DM3 A;  4DAP A;  3VPD A;  5LMU H;  2E2I B;  3R93 A;  5F9N A;  1XNR L;  1TWA H;  4A3E G;  3T5J A;  3NTK A;  2ALZ A;  2N78 A;  4LFC Q;  3IL8 A;  4L8J A;  2K6A A;  3RBD A;  3SK6 A;  1Q8I A;  1X32 A;  2NU9 B;  4P72 A;  4JV1 A;  1XPR A;  4B9W A;  2J6U A;  5C44 H;  2R92 B;  4Y52 H;  1LTB D;  1ASY A;  4DLK A;  1KQS A;  5EDW A;  2RDJ A;  5KFH A;  2X6G A;  2R8H A;  4DUZ L;  4J9M A;  2AWN A;  5IWA Q;  4X62 Q;  3PIP A;  1K3R A;  5HY6 A;  3BG5 A;  2OLS A;  5J22 A;  4RZQ A;  2F0T A;  2KEE A;  2LFN A;  4O4I F;  3PGZ A;  1JMC A;  2DWC A;  2A6E D;  3VR6 A;  1SDF A;  2ZDG A;  1UE6 A;  1JWS D;  2A6E C;  2B3G A;  2D62 A;  2E8G A;  3NTI A;  3NQI A;  1TWF A;  5KIX A;  4N9T A;  4I7H A;  2FMC A;  3BG3 A;  4UP8 A;  5KFS A;  3N40 P;  2EVB A;  3I90 A;  3FRP B;  3DUZ A;  3M4O H;  4C3J G;  3J81 c;  1QWY A;  4CHT B;  1IOW A;  1PDQ A;  1HPC A;  4ECZ A;  2M00 A;  4QB4 A;  1UNS A;  4OEL B;  3D3R A;  5EGT A;  3Q24 A;  3F8T A;  3S1R B;  3S17 H;  2V4R A;  4A93 H;  1Y14 B;  3D31 A;  4MV3 A;  2R6G A;  1JKJ B;  4DAM A;  4UCU A;  4WD3 A;  2BQU A;  4Y8V B;  4F7X A;  2NN6 I;  5JOB A;  4A3M H;  4XYM B;  1SYE A;  2L11 A;  4LSA A;  3OHA A;  4IFD I;  3L7Z C;  1Q7Y C;  3N6X A;  4HJ7 A;  2F3W A;  4DUY H;  4EQO A;  5JPM C;  2D5D A;  3A55 A;  3ZJY C;  5GAG C;  3FPP A;  1UEA B;  1BXT A;  4IUV A;  3BAB A;  4NXN H;  1SEB D;  3WWV A;  3ONA B;  3MEH A;  2IL8 A;  4DUY L;  4IRD A;  3HS0 C;  2A6H D;  2YS7 A;  2JA8 G;  2PVP A;  2C22 A;  1LT3 D;  1OO9 B;  1S4Z A;  2LY7 A;  5D65 A;  3RLO A;  2EJM A;  4J9N A;  1J5E L;  3J80 L;  2F0I A;  1HQR D;  4DNT B;  5M9O A;  2B2T C;  3F2U A;  1GO3 E;  2KHS A;  1TWC H;  5GAH C;  2JEG A;  3MWY W;  2A5H A;  4DR2 Q;  4POG A;  3RUZ A;  1Y1W H;  4JI3 L;  2YRX A;  2J6S A;  5C8Y F;  1E4E A;  5EKI A;  1SYB A;  3G6E A;  1RJP A;  4YCW A;  2XSC A;  4BBR B;  1S5C D;  2E2H H;  4K0K L;  2R82 A;  3PW5 A;  5KFX A;  3N43 B;  2JA6 H;  1TWA B;  2DY8 A;  3G6V A;  1KD1 C;  1R9T A;  2VZA A;  2Z0S A;  2B8F A;  3ERS X;  2HJW A;  3NEN A;  3LML A;  3Q8R B;  4UCR A;  4DV2 L;  1PHJ A;  4H0L C;  3RUP A;  4FBT A;  1J5E Q;  1Q8K A;  4R4T A;  4Q43 A;  2F0M A;  4DV1 Q;  4E4T A;  5ELN A;  2I5L X;  3BZC A;  3BVG A;  4MV1 A;  2W9B B;  4G7Z C;  4Q45 A;  1TS2 A;  1T3N A;  1RYS A;  1VBG A;  1HXY D;  3R3O A;  4JI7 Q;  2XC9 A;  4ZUI A;  5IIF A;  1LAB A;  2NB0 A;  4WJ3 M;  2RHS B;  5IT9 E;  3ORR A;  1HH2 P;  3AYH B;  3S1N B;  2CH4 W;  3DHQ A;  1B8A A;  5I47 A;  2OWO A;  4ID6 A;  3SEB A;  4A3F G;  5KFP A;  1X3P A;  3JAM W;  3V05 A;  2QYZ A;  2B63 B;  4JUZ A;  3I55 A;  2VQF H;  2HQL A;  4IWX A;  1WD1 A;  4GLV B;  2XGQ A;  2OF1 A;  1HR0 W;  3Q1K A;  1EUJ A;  1MHW C;  1RCV D;  1EY6 A;  2X6L A;  2UUB H;  5CR3 A;  4O3P A;  1RYR A;  1EYD A;  4DL2 A;  4ZYS A;  4XT1 B;  3OIP A;  1V8Q A;  3AFP A;  2XRQ D;  4DV4 Q;  1WTX A;  2JA6 A;  4QIW B;  3M7G A;  1XMO L;  4OIK A;  4C56 C;  1WTW A;  3DEP A;  4A3L G;  2IY5 B;  2PI2 E;  5FKA C;  3GTK H;  1LTS D;  3J7A F;  1UNN C;  3OHB A;  4TV8 F;  4KMU C;  3CW2 C;  3G7L A;  1WJJ A;  3L0O A;  2WDT A;  4O2B F;  4L5S A;  2ZJT A;  4DPG A;  3GIJ A;  2V59 A;  3CKI B;  3OW7 A;  1EHI A;  2W6M A;  4DXF A;  1JWM D;  1IBK L;  4OX9 Q;  4B3M H;  4JV5 L;  4LK1 C;  4CGY B;  3K7A H;  2PW7 A;  1Q81 C;  1JOQ A;  1SYC A;  2DNC A;  3SE7 A;  3PW4 A;  1Z6H A;  3EPI A;  1SR3 A;  1ZEQ X;  4K0K Q;  2R7Z B;  3OSN A;  1JXL A;  3ORQ A;  4A3I B;  1WVL A;  4A3J H;  3A54 A;  2RA4 A;  1BBX C;  4PMC A;  3FMC A;  2XCP A;  4NDX A;  4JI0 H;  2K28 A;  4C1N K;  3I4N B;  1EL0 A;  3OMG A;  4DAV A;  1A3V A;  3S2D H;  4YBZ B;  3A8K E;  3HOY G;  1SJE D;  3CC2 A;  3F2C A;  4JBJ A;  3X3N A;  3P7J A;  2R92 H;  4JK1 C;  3GTL A;  1SYF A;  2MFI A;  1VQK A;  1Z2N X;  2JA8 B;  1TWF B;  2AGO A;  1AE2 A;  2OTL A;  4J9L A;  4UFZ A;  3H4B A;  4OX9 L;  2YS6 A;  1B04 A;  4NXM L;  1XTD A;  3A0J A;  3NWT A;  4DV6 L;  1XNR Q;  5L9X A;  2TSS A;  4C3I B;  3R2T A;  3OYY A;  3J80 E;  1I4G A;  3HEJ A;  1ILP A;  1SNQ A;  2ALY B;  4A3B H;  4A75 A;  3RB6 A;  2GPW A;  2DPI A;  1Q90 A;  1EQT A;  2IJ0 A;  2PMZ B;  2ZT9 C;  4MV4 A;  5IT9 L;  3JC6 6;  4FS1 A;  4JI7 H;  4JI8 H;  4DV5 L;  2HHH Q;  1A6X A;  3ETH A;  2CW7 A;  5I2X A;  1D7Q A;  1Q46 A;  2F0H A;  2IP4 A;  4JI4 Q;  2YYZ A;  5IWA L;  2OQ0 A;  2ZTC A;  4DV4 L;  1DM0 B;  4EQN A;  4DUZ Q;  4OHJ A;  1JB3 A;  4LF6 L;  2ZJQ A;  2FXQ A;  2Q2U A;  4NLG A;  1PFN A;  5FPR A;  3P20 A;  3BJU A;  4P74 A;  2B2W A;  3K7U C;  3GTP A;  3EPG A;  4YB8 B;  4HQ6 A;  4QWB A;  5K36 G;  4EFE A;  3HBL A;  1ET9 A;  4P71 A;  1PZJ D;  1BBU A;  3FEW X;  1NE3 A;  4JV5 Q;  5CB4 F;  5K5P A;  1MJC A;  1TKW B;  3MA2 B;  4OWT B;  1SBB B;  4MNO A;  5GON F;  1N56 A;  1PH4 A;  2UUC H;  2XIG A;  3NHH A;  2KQ3 A;  4LFC L;  3UDG A;  2NVX H;  5KFB A;  1E22 A;  1G6Z A;  4U68 A;  4JI1 L;  1W3S A;  4ZUJ A;  4OL7 A;  2HGS A;  2FHT A;  2WIN B;  1N33 L;  1D8L A;  4MTK A;  4IN3 A;  4R4Q A;  1F2Y A;  4JI0 Q;  4IHJ F;  2NU6 B;  1BCP C;  5EPK A;  4ECS A;  4RB1 A;  2Q8I B;  5IOC A;  4O3S A;  1W2B A;  2IA6 A;  4CC6 A;  4IZ8 A;  5JEA J;  2WB1 B;  4IFD H;  1BDO A;  4XQN A;  1TWH B;  4IO9 A;  3PW7 A;  2FJZ A;  4N8X 1;  4HCS A;  3SVM A;  5IYC H;  2XIW A;  4Q0Y A;  4A3I H;  3KAL A;  1CT1 D;  1TY2 A;  1VF7 A;  4LH6 A;  4J15 A;  4DKA C;  1PH5 A;  1B70 B;  4IUT A;  5JJL A;  3BU2 A;  2A6H C;  4KD3 A;  4EVO A;  2R8K A;  3PR5 B;  4QUC A;  3VYT A;  1A15 A;  2PZT A;  4KHP Q;  1CSQ A;  3PV0 A;  2YU9 B;  2PN1 A;  1MSH A;  2HUG A;  4R9W A;  1C3O A;  1ONL A;  3NUC A;  2HHH L;  5DLG A;  5M5X H;  4RG1 A;  3T51 B;  1BKB A;  2W71 A;  2CKZ B;  3OWF A;  4JI5 L;  1XPU A;  3I4M G;  4MV7 A;  4QQB X;  3Q8P B;  2XGP A;  2NZO A;  3I4N G;  5KT7 A;  2QK4 A;  5FLX E;  2PI2 A;  4O3Q A;  4LF4 L;  3S2H H;  2PPB C;  4EBE A;  3IRB A;  5C4J H;  1JQY D;  3K81 C;  2V1C C;  4H02 A;  4RNM A;  1NR2 A;  2CQY A;  4QWC A;  2YW2 A;  1YNJ D;  1LAC A;  1UE5 A;  4IUR A;  3NBI A;  3HOZ G;  3S1N H;  1S68 A;  3PO2 G;  1I6U A;  4HSP A;  5KND A;  2NVT H;  2K14 A;  3IFD A;  4JI3 H;  2VQE L;  2F03 A;  4L5R C;  1MI2 A;  1EWC A;  2YV5 A;  3FKI G;  1VKZ A;  1A62 A;  2LKV A;  4QGU A;  3KF8 A;  4PNY A;  3S1Q H;  4FXD A;  4X64 Q;  1SJH D;  4TVA B;  2R84 A;  4Q0F A;  1SNC A;  2I0Q A;  1SYD A;  4B3T Q;  3V4S A;  1UC8 A;  3NWS A;  3FDT A;  4K8J A;  3WO0 A;  4HID A;  4DAY B; 
#chains in the Genus database with same CATH homology
 2B29 A;  1CSP A;  1M1K C;  1GVP A;  2LSS A;  4GOP C;  3CF5 A;  4LNQ A;  3PO3 H;  2ZJR A;  1N9W A;  2AHO B;  2K50 A;  5HGQ A;  1G51 A;  3STB D;  2IHF A;  4DV2 Q;  3GDE A;  1HZB A;  1QZG A;  5JJK A;  1N36 L;  3D0F A;  2UXD Q;  3SGI A;  1VS0 A;  3K80 C;  1Y1W G;  3GO5 A;  1BBW A;  3U50 C;  3RN5 A;  3HOU H;  3G48 A;  4DV1 L;  5DLQ E;  2K75 A;  1N34 L;  3CCE A;  3M3Y H;  1WOC A;  1GM5 A;  4DR6 Q;  1IBL L;  3M7N A;  4RMF A;  3HOY H;  1VQJ A;  3KJO A;  5LMN Q;  2IHE A;  4YCV A;  4X66 Q;  4HJ9 A;  3KDF A;  2UXB L;  4IFD J;  4A93 G;  4A3K H;  4JI7 L;  1L1O A;  4BY1 G;  2C35 B;  2ZTE A;  4HJA A;  3HOV G;  4A3M G;  2CWA A;  2E2J H;  2CQO A;  4C2M H;  1WCM H;  5M3M H;  3CCL A;  1FGU A;  2EQS A;  3TEH B;  3UDX A;  1NTG A;  5M3F H;  3BZK A;  3H3V H;  1P16 A;  2CFM A;  1NJI C;  1S40 A;  2VS1 A;  4JOI A;  1CUK A;  3RN2 A;  2B63 H;  2VNU D;  1N36 Q;  2AMC B;  2Z6K A;  2A1A A;  2N3S A;  1K0R A;  4DNI A;  4JI8 Q;  2K5N A;  1VQL A;  2UUC L;  4TQU S;  4EQ5 A;  1HZC A;  5IYB H;  4JOI C;  4DR6 L;  4DV0 Q;  4IFD G;  3G4S A;  1X55 A;  2YTY A;  1XMO Q;  3PF4 A;  1XMQ Q;  4X66 L;  2ZJP A;  2UUA Q;  1CKN A;  2CWP A;  4IPD A;  2WAQ G;  4A3I G;  1FJG Q;  5GRO A;  2K5H A;  2VY3 A;  4NXM Q;  1LM0 A;  3PUY A;  4DV6 Q;  1IBK Q;  1HNZ L;  5FJ8 G;  1E7Z A;  2VW9 A;  2EIF A;  3GTL H;  4GKK L;  4QIW E;  4B3T L;  5LMU L;  4DR1 Q;  3I4O A;  1MKH A;  2F4V L;  4A3D H;  2Q2I A;  5IP9 G;  4A3K G;  1YIT A;  4AYB G;  1KXL A;  3KF8 B;  5AJ3 Q;  4DR7 L;  4JI2 L;  2MO0 A;  1VQG A;  1VQE A;  3FKI H;  1EQR A;  2ASB A;  4POF A;  1YHA A;  1EIF A;  4JI8 L;  4KI0 A;  2KEN A;  3NEL A;  4OON A;  3S24 A;  3S1R H;  1KIX A;  3H3V I;  4JI4 L;  3HOZ G;  4DR4 Q;  3AQQ A;  5M3F G;  5FLM H;  2BH8 A;  2JA9 A;  4YWM A;  3I4N H;  4IPG A;  4BXX H;  3G71 A;  5GQO A;  1SLJ A;  1Q86 C;  1XMQ L;  3CCS A;  2K5V A;  1WFQ A;  1LYL A;  2KHI A;  1QUQ A;  4X62 L;  4B3M Q;  1NY4 A;  3ULJ A;  4ALP A;  2UXB Q;  3CXC A;  5BR8 Q;  3UDI A;  1S3O A;  3CCR A;  3DM3 A;  3HOZ H;  4GNX B;  1XNR L;  1TWA H;  4A3E G;  1VQB A;  1QZH A;  2JJQ A;  1EFW A;  2NZH A;  3KFU A;  2N78 A;  4LFC Q;  4GNX C;  1N33 Q;  2R7F A;  1Y1V G;  3GTG H;  5EAY A;  3HKS A;  4JI1 Q;  5IP9 H;  4P72 A;  1PH2 A;  4LFA L;  3HOX H;  1XPR A;  2IX1 A;  5C44 H;  1SMX A;  1PH6 A;  4Y52 H;  1K83 H;  1C7Y A;  2IX0 A;  4HJ8 A;  1ASY A;  4BA1 I;  1KQS A;  2PNH A;  3M85 A;  1H95 A;  2PQA B;  4A3C H;  4DR3 L;  1TWH H;  1VQ6 A;  3CPF A;  4O2D A;  4DUZ L;  2JA5 H;  4X6A H;  2AWN A;  5IWA Q;  4X62 Q;  3PIP A;  3K8A A;  1K3R A;  4QY7 A;  5HY6 A;  4JBW A;  3F1Z A;  3H0G G;  3M9B A;  1XNQ Q;  4XIG S;  1HNX Q;  4A3B G;  3M4P A;  3J80 c;  3PGZ A;  1JMC A;  1SN8 A;  3U4Z A;  3PUX A;  4YY3 L;  2BA1 A;  4PMW A;  3PIO A;  4NB3 A;  3PO3 G;  4OO1 I;  1UE6 A;  4GN4 B;  2B3G A;  2D62 A;  2E8G A;  2KHJ A;  2RCN A;  1VQ4 A;  1HNZ Q;  4A76 A;  2WB1 G;  3CD6 A;  2NN6 G;  2F4V Q;  4UP8 A;  1VQH A;  5IYB G;  2BH2 A;  1X3E A;  2HT1 A;  5JJI A;  1N8R C;  4YHH L;  3J81 i;  3J81 c;  4A3F H;  4C3I H;  3J7A 5;  3M4O H;  3HOU G;  4IJL A;  1TWF H;  4JBM A;  4JI5 Q;  3F8T A;  1E24 A;  4B3R L;  3S17 H;  3F2D A;  1A0I A;  1PH9 A;  4DK6 C;  3T1Y Q;  4DR4 L;  2K52 A;  4A93 H;  1Y14 B;  2ZTD A;  3D31 A;  3PUW A;  2R6G A;  3J80 i;  4DAM A;  3HFZ B;  4LF8 Q;  2NN6 I;  2Q2T A;  3TRZ A;  1N32 Q;  4A3M H;  2HIX A;  4JI3 Q;  2OCE A;  4A4I A;  1TXY A;  1S72 A;  4JBK A;  4IFD I;  3L7Z C;  1Q7Y C;  1X3G A;  4HJ7 A;  4O0A A;  2JA5 G;  4LF5 Q;  2UXC L;  1MJE A;  3ZJY C;  3EBE A;  4Y7N H;  5GAG C;  4A3G G;  2N8N A;  4JCV E;  4MZ9 A;  1KRT A;  4PZ8 A;  1V9P A;  3FP9 A;  2Y0S G;  3WWV A;  2WB1 E;  3U58 A;  1YJN A;  3PUV A;  2VQE Q;  2PQA A;  4JI6 L;  4DUY L;  4IPC A;  1U5K A;  1HR0 Q;  2JA8 G;  3ER0 A;  1BVS A;  2VL6 A;  4FDB A;  3RLO A;  2CCZ A;  4JYA L;  5C3E G;  1J5E L;  2UUB L;  1SRU A;  2IT1 A;  1WI5 A;  1KL9 A;  4YWL A;  4X65 L;  4DR5 L;  5M5Y H;  1OXT A;  1DGS A;  1GO3 E;  4C3J H;  4X64 L;  4NXN Q;  4LF8 L;  3VDY A;  1TWC H;  5GAH C;  2D0O A;  4LF7 Q;  3UDF A;  3J81 j;  3W1B A;  4DR2 Q;  4POG A;  1Y1W H;  1VQO A;  4JI3 L;  2JE6 I;  2E5L L;  2MO1 A;  1G29 1;  3GTQ H;  4DR3 Q;  3L2P A;  1R9T H;  1PH1 A;  3G6E A;  1JB7 A;  5LMN W;  1OXU A;  4YCW A;  4LF4 Q;  2UXC Q;  4K0K L;  3RLN A;  2E2H H;  3TS0 A;  4LFB L;  4LF9 Q;  2JA6 H;  4IOA A;  4EX5 A;  4MTN A;  1HNX L;  1Y1V H;  1VQ8 A;  2JEA I;  1KD1 C;  2VZA A;  1LUZ A;  1QUQ B;  2Z0S A;  3ERS X;  5C0X G;  4AQY Q;  2NVQ H;  3NEN A;  5C44 G;  1RIP A;  3STB C;  4DV2 L;  2DGY A;  1G6P A;  2R7Z H;  2UXD L;  2D0P A;  5FLM G;  4BY7 H;  4JYA Q;  4AYB E;  1PHJ A;  1V1Q A;  4B3M L;  1Q1B A;  3ULP A;  1J5E Q;  1Q8K A;  4R4T A;  1YNX A;  4DV1 Q;  1YZ6 A;  5ELN A;  2I5L X;  2H5X A;  4YHH Q;  3CCQ A;  3BZC A;  1IYJ B;  3GTO H;  4WJ4 A;  1YBY A;  3NBH B;  1SRO A;  2F3I A;  4JC0 A;  4NXN L;  3H0G H;  3TQY A;  5C4X G;  4IOC A;  1U0L A;  4DR2 L;  2JA8 H;  3S15 H;  3EIV A;  5C3E H;  1XJV A;  2EXD A;  3NEM A;  1VQD A;  4LWC A;  2PMZ E;  2KCM A;  4JI7 Q;  4IJH A;  1FL0 A;  4B3R Q;  1TWG H;  4B3S Q;  4C3H H;  3RZO H;  4WJ3 M;  1A63 A;  3MXN B;  2RHS B;  2QEX A;  3CC7 A;  1EIY B;  4DV3 L;  3PUZ A;  1HH2 P;  1B7Y B;  3AYH B;  1X6O A;  1PH7 A;  1B8A A;  2ZM6 Q;  3HOW G;  2MQH A;  5IY0 A;  2VQF L;  2OWO A;  4A3F G;  4JG2 A;  3UE1 A;  2QGQ A;  1X54 A;  5IP7 H;  1PA6 A;  1SE8 A;  2JA7 H;  3I55 A;  4GOP B;  1L1O C;  3KF6 A;  2HQL A;  4GN5 A;  3UE0 A;  4GLV B;  5FJ8 H;  2MNA A;  3HOX G;  4DV5 Q;  1EUJ A;  1HR0 W;  3GTP H;  1YVC A;  2I5M X;  1PH3 A;  3Q8D A;  5C0X J;  3S16 H;  4A3D G;  3GTM H;  2Y0S E;  3CCJ A;  1I5F A;  4DV0 L;  4DUY Q;  2UUC Q;  1IXR A;  3AFP A;  1E1T A;  2HIV A;  3JAM c;  4DV4 Q;  2Z6K C;  3MEF A;  1HR0 L;  1XMO L;  3CCV A;  4AIM A;  4A3L G;  2IY5 B;  2NVY H;  2PI2 E;  3CQZ H;  3E9I A;  5IE8 A;  4LF6 Q;  3GTK H;  2UUB Q;  3CW2 C;  3L0O A;  1WJJ A;  2GVB A;  3CCM A;  1HNW Q;  4AH6 A;  4UY8 C;  5J3B A;  4L5S A;  3I7F A;  1UEB A;  4DPG A;  3U4V A;  4GNX A;  4PG3 A;  1C9O A;  1CKM A;  3AEV A;  1JJG A;  4LUV A;  1IBK L;  1T9H A;  3M4Q A;  4UP9 A;  2ZM6 L;  4HIO A;  4OX9 Q;  4JV5 L;  4GLA C;  2OQK A;  1Q12 A;  3K7A H;  1I94 L;  1Q81 C;  5LMU Q;  4DR1 L;  3CC4 A;  2XGT A;  3K0X A;  1SR3 A;  3KDF B;  3TS2 A;  2BA0 A;  4K0K Q;  3TRE A;  3S14 H;  2AWO A;  4XTC S;  5AJ3 L;  1VQI A;  3E0E A;  3KLW A;  4A3J H;  2VUM H;  1X65 A;  5IYC G;  4AQY L;  1I3Q H;  3J7Z C;  3A5Z B;  5IP7 G;  4JI0 L;  5IYD H;  4BY1 H;  1O7I A;  3S2D H;  1OXV A;  1EOV A;  1K73 C;  3HOY G;  3CMA A;  1WYD A;  3F2C A;  1IBM Q;  2E2I H;  3CC2 A;  1CKO A;  4JBJ A;  2YU9 H;  2K4K A;  2R92 H;  1HNW L;  1YHQ A;  2MFI A;  1Q1E A;  1VQK A;  2UU9 L;  1QVG A;  3CAM A;  1UE7 A;  1AE2 A;  2WAQ E;  1JJ2 A;  2OTL A;  4R4C A;  1K8A C;  4QJF A;  1JE5 A;  4L5Q A;  1NMF A;  1Z9F A;  3A74 A;  4R4I A;  2UUA L;  4OX9 L;  4A3G H;  1FJG L;  4NXM L;  1V43 A;  1XTD A;  3A0J A;  1I94 Q;  4DV6 L;  1RL2 A;  1E1O A;  1FVI A;  2KCT A;  1XNR Q;  2KBN A;  4GKK Q;  3W5O A;  4DV3 Q;  1QVC A;  3OYY A;  4P73 A;  2ALY B;  4A3B H;  4A75 A;  4HIM A;  4GLX A;  1K9M C;  1PH8 A;  3CME A;  1HJP A;  4DR7 Q;  1P8L A;  3B6Y A;  3JC6 6;  3DLL A;  4BBR G;  4DV5 L;  2AKW B;  4KLK A;  1KRS A;  2HHH Q;  3HKZ G;  1KHI A;  2WFW A;  4IPH A;  4L5T A;  1YEZ A;  3AFQ A;  4UP7 A;  4JI2 Q;  1Q46 A;  1EYG A;  4KHP L;  1D7Q A;  4JI4 Q;  1PFS A;  2YYZ A;  2ATW A;  5IWA L;  1KAW A;  2OQ0 A;  3RZD H;  3PO2 H;  2ZTC A;  1HZA A;  1AE3 A;  1VCI A;  4DV4 L;  5JEA G;  5IYD G;  4DUZ Q;  3RLF A;  5E7N A;  4LF6 L;  3I56 A;  2ZJQ A;  2FXQ A;  4DV7 Q;  2Q2U A;  2JA6 G;  1L0W A;  2R93 H;  4UPA A;  2YTV A;  2XTI A;  4ME3 A;  4YY3 Q;  1M90 C;  3BJU A;  3LGJ A;  4P74 A;  1UWV A;  4DK3 C;  5GAE C;  3CPW A;  2JA7 G;  3K7U C;  2ES2 A;  2R92 G;  1KC8 C;  3S1M H;  2YTX A;  4NPS A;  1NMG A;  3EN2 A;  4BBS H;  1VQF A;  1L1O B;  1OXX K;  5K36 G;  4P71 A;  3CCU A;  1BBU A;  1NE3 A;  5FLX c;  4JV5 Q;  3HKZ E;  3KYH C;  1MJC A;  4LUZ A;  3RNU A;  4OWT B;  4LUO A;  1GKH A;  4MNO A;  5BR8 L;  4HIK A;  3F2B A;  2F52 A;  1PH4 A;  1SFO H;  3HOV H;  4A3L H;  1JJC B;  4LFC L;  2NVX H;  2L15 A;  3UDG A;  1E22 A;  4OWW B;  1VQM A;  2A19 A;  4JI1 L;  1K8G A;  1W3S A;  3CP0 A;  4GKJ Q;  4OO1 G;  1VQ5 A;  1N33 L;  1D8L A;  4R4Q A;  4JI0 Q;  2B63 G;  1UE1 A;  3T1Y L;  1N32 L;  4LFA Q;  4LW1 A;  1IZ6 A;  1IBM L;  4DV7 L;  3T1H Q;  1W2B A;  2GN5 A;  1ASZ A;  5JEA J;  3KF6 B;  2ID0 A;  2UU9 Q;  4P75 A;  3H15 A;  4IO9 A;  1VQN A;  4PZ7 A;  1YJW A;  5IT9 c;  4A3E H;  4BA2 I;  4GN3 B;  5IYC H;  1EQQ A;  2R93 G;  4HJ5 A;  4A3I H;  1XNQ L;  1YIJ A;  1A8V A;  2RHQ B;  1CKN B;  1E3P A;  1YJ9 A;  4J15 A;  3KOJ A;  4R4O A;  4DKA C;  1PH5 A;  1B70 B;  5JJL A;  3BU2 A;  1C0A A;  1Z47 A;  4JI6 Q;  1X9N A;  1VQA A;  1AH9 A;  4KHZ A;  2N49 A;  3PSI A;  1I50 H;  1MIU A;  5C0X I;  4KHP Q;  1I6H H;  4GKJ L;  1CSQ A;  1J6Q A;  3PV0 A;  4DR5 Q;  3OTO Q;  4PZ6 A;  1PYS B;  2R7Z G;  3PF5 A;  1JT8 A;  4BY7 G;  2HHH L;  1PV4 A;  2DUD A;  5M5X H;  4RG1 A;  3OW2 A;  2E5L Q;  1BKB A;  3ICE A;  1NBW A;  2CKZ B;  4JI5 L;  1XPU A;  3I4M G;  5H1S E;  3I2Z A;  4QQB X;  2NZO A;  3I4N G;  5C4X H;  3E9H A;  4QL5 A;  2Q2H A;  1X56 A;  3GTJ H;  1OTC A;  2PI2 A;  4OWX B;  5M5W H;  4LF9 L;  1QVF A;  4LF4 L;  1IL2 A;  3S2H H;  4GS3 A;  4LFB Q;  3IRB A;  2WP8 J;  5C4J H;  4YWK A;  3K81 C;  4R1J A;  2V1C C;  1LTL A;  4H02 A;  3ULL A;  3FHW A;  4A3J G;  1XPO A;  4LF5 L;  1VQP A;  2VUM G;  4BBR H;  2LXJ A;  2JQO A;  1Q82 C;  4YCU A;  3W1G A;  1UE5 A;  3HOW H;  3KJP A;  2I5H A;  3A5U A;  1L2F A;  2GVA A;  2JK8 A;  1VQC A;  1GD7 A;  2R7D A;  4OXP A;  1EWI A;  2RF4 A;  3JAM i;  3S1N H;  3PO2 G;  3PCO B;  2NVT H;  2K14 A;  2LXK A;  3OTO L;  2VQE L;  4L5R C;  1VQ9 A;  4X65 Q;  2YV5 A;  3FKI G;  1A62 A;  2JEB I;  4QGU A;  1VQ7 A;  3GD7 A;  4APV A;  1N34 Q;  4LF7 L;  3S1Q H;  4BBS G;  1IBL Q;  5GAD C;  1X3F A;  1YHB A;  4TVA B;  4X64 Q;  4B3S L;  5LMN L;  2QA4 A;  2A8V A;  4BXX G;  4GOP A;  3RR5 A;  2I0Q A;  4B3T Q;  3T1H L;  4A3C G;  1PYB A;  1WCM G;  1OXS C;  1HZ9 A;  5M3M G;  1PVO A;  2OTJ A;  3I4M H;  2VQF Q;  5ELO A;  1YI2 A;  4HID A;  4DAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...