2Y0SE

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
170
structure length
164
Chain Sequence
MYKLIKARSIVRIPPNEFGKPLNEIALNELRQQYQEKILKDLGLVLAILNVKTSEEGMLVFGDGATYHEVEFDMITYVPVVQEVVEGEVLQVDNYGVFVNLGPMDGLVHISQITDDTLKYDNVRGIIFGEKSKKVIQKGDKVRARVISVASPRIALTMRQPYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 16
structure length 164
sequence length 170
chains with identical sequence T
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2y0sE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2y0sE01
4BY7G 1Z9FA 2ZTDA 2VY3A 4JI5L 5M3MH 2LSSA 4A3DG 2ZTEA 4ALPA 1GKHA 3G71A 2B29A 4LF5Q 2RHSB 3M4OH 3CCUA 4C3HH 2E2JH 1YITA 2JA5H 4BBSG 4A3LH 1I5FA 4JOIC 4LF7Q 4B3RQ 4LFCL 4DV1L 3HOXH 2R93H 4DR3Q 4BY1H 4QIWE 3TS2A 2JEAI 3FP9A 1L0WA 2K75A 3W1BA 1YBYA 4A4IA 1VQNA 4LW1A 3CC7A 2DUDA 4DKAC 3CCMA 1M1KC 1KQSA 5C4XH 3I56A 2ZJQA 1AH9A 4B3MQ 2PI2E 2PQAA 3S1MH 3H15A 2MO1A 4X65L 4DV6L 3T1YQ 5EAYA 1G6PA 4LF9L 1SLJA 1Q8KA 2VQEL 1XNQQ 1VQIA 4DV4L 1IYJB 2JA6G 1B70B 2WAQG 3S2HH 1TWGH 2A19A 4AH6A 1K8GA 3I4MG 3CQZH 2C35B 2UUCL 4DR1Q 3A0JA 4A3MG 4JV5Q 1RIPA 4LUVA 3KJOA 1L1OA 4KLKA 1AE3A 2MO0A 4LFBL 2I5HA 2IT1A 4A3FH 4YWKA 4JI1L 3UE0A 2VS1A 1Q1BA 1UEBA 1J5EL 1PH4A 2KCTA 2R7ZH 2I5MX 3HOZG 1E1OA 1TXYA 2KCMA 3CCSA 1IBMQ 1E3PA 1PHJA 4LUZA 3AYHB 2D0OA 2KENA 3E9IA 3CCJA 1Q46A 1UE5A 1VQFA 4PZ7A 1N32L 2GVBA 4JBKA 2XGTA 4POGA 2UXDQ 1HH2P 4JI7Q 5IYCH 3PIPA 1IBLL 2NVXH 2Q2IA 4LFAQ 2UU9Q 1C7YA 2OTLA 2A8VA 2UUBQ 1IBKQ 2N3SA 4HIOA 3OTOL 2ZM6Q 1SFOH 1PH2A 1CKMA 3ERSX 4IPDA 3TREA 4GKJQ 4OONA 2E2HH 4K0KL 1SROA 2F52A 1XMQQ 2HT1A 1S3OA 4X66Q 4HJ5A 3H0GH 5E7NA 2Z6KC 1ASZA 4A3IH 2QEXA 3PV0A 4A3CH 3M4QA 4JYAL 1A0IA 1XPOA 4X6AH 4DV0L 4DR4Q 4DAYB 4OWTB 5FLXc 3CXCA 2E5LQ 1Q81C 2JA5G 4A3LG 1KHIA 4GS3A 4DUYL 1N36L 3HOXG 2BA1A 3U50C 2R93G 1OXUA 1CKNB 4X64L 4BY1G 1NMGA 4JI2Q 2K52A 1FGUA 2D62A 4GLAC 3PSIA 4JOIA 2D0PA 3UDIA 5BR8Q 2AKWB 2VW9A 1KD1C 4B3TQ 1XNRL 3KFUA 2YTXA 4TQUS 4LF8Q 5GAGC 5C4XG 2JA8H 2EXDA 1P16A 1KRSA 4R4OA 5GAHC 3JAMc 4YHHQ 1P8LA 4GNXB 4HJAA 1VQOA 1W3SA 3G4SA 1E24A 1Y14B 2I0QA 4AYBE 3TEHB 5JJIA 4GOPB 1OXVA 1KAWA 1L2FA 3KDFB 5FLMG 3RNUA 1SMXA 4JI6Q 1MKHA 2DGYA 3K80C 2WP8J 1H95A 1M90C 4LF7L 4B3RL 3NBHB 3PO2H 1VQEA 3G48A 5GQOA 4DR3L 1JJCB 4KHPQ 4JBWA 1UE6A 2KBNA 1X3EA 1VQ9A 1VQ8A 3I55A 1A63A 3EBEA 2UUAL 3CCQA 3I4NH 4L5SA 4IOAA 4A3FG 1SE8A 1HZ9A 1YHQA 2CCZA 2GVAA 2YV5A 2WFWA 5JEAG 3J7A5 4PZ8A 3HKZG 1QVCA 1C9OA 1B8AA 4LWCA 2ZJPA 4OWXB 2Q2UA 3AFPA 3T1YL 3S2DH 2R92G 1AE2A 4GN3B 3F2CA 1D8LA 1UWVA 2JJQA 2LXKA 4JI8Q 3J81j 4A3KH 1K9MC 1XNQL 4UP8A 3STBC 1YEZA 2Y0SE 3S17H 2HIXA 3PO3H 5IYCG 1I3QH 2PI2A 1WI5A 5IWAQ 4DR1L 3FKIH 3PIOA 1Q1EA 1WJJA 1HNWQ 4JV5L 2OQKA 4QL5A 3WWVA 1OXSC 3KF6A 2IHEA 2JA7H 1NTGA 3F8TA 5IE8A 3CD6A 2PMZE 4DNIA 2UXBQ 4GNXC 4R4CA 4JI4Q 3PF4A 1EIYB 4HIKA 1BBWA 1IBML 1EOVA 3HOUH 3S14H 3Q8DA 3GTPH 4GOPC 1K83H 3H0GG 4HIDA 4AQYQ 1I6HH 3J81c 3UE1A 2JK8A 1N9WA 3M4PA 1W2BA 5HY6A 4DPGA 3K7AH 2Z6KA 4GKKQ 2UXDL 4JI7L 2CFMA 2HHHQ 2MQHA 5JEAJ 5IP7H 3S1RH 1OXTA 2F4VL 4LFAL 2UU9L 2UUBL 1IBKL 2ZM6L 4GKJL 4NPSA 4IO9A 2JA8G 5IYDH 1VQJA 3GTGH 3BU2A 4EQ5A 3K81C 4NXNQ 1TWHH 3KLWA 1C0AA 1VQAA 2K5HA 2YTYA 1YJWA 3TRZA 3CCEA 4X66L 5LMNW 2WB1G 4R4IA 4R1JA 3D31A 3PUZA 4J15A 5IP9G 1XJVA 1UE7A 1KL9A 2NVTH 4DR4L 2NZOA 1Q82C 2E5LL 3HOYH 4DR6Q 3E9HA 4RMFA 3PO2G 3GTQH 4LF6Q 4JI3Q 1VQDA 1HZBA 4JI2L 4P73A 4DK3C 5BR8L 1Y1WG 4HJ8A 4B3TL 1BBUA 3I4NG 2K5VA 2VQFQ 1A8VA 2BH2A 3GTMH 3RZOH 4KI0A 1HNZQ 4LF8L 2OQ0A 4BXXH 4YHHL 1Y1VH 2N8NA 3AFQA 3K7UC 5LMNQ 4RG1A 2CKZB 1JE5A 2K4KA 3KYHC 1S40A 4DV7L 1MJEA 1SR3A 4GN4B 3RN5A 3SGIA 2VUMH 1XMOQ 5C3EH 1I50H 1N8RC 3HOVH 4JI6L 3ULPA 4WJ3M 1HZCA 1Q12A 2OCEA 4A3KG 3UDGA 1X3GA 4AYBG 3I4OA 1PH5A 1D7QA 4A3JH 1KC8C 1L1OB 3H3VH 2OWOA 3PO3G 5M3MG 3PUVA 1U0LA 1VQ6A 3FKIG 3KOJA 1FJGL 1J6QA 1S72A 4QGUA 4JYAQ 1GO3E 4OX9Q 3GD7A 2JA7G 3A5ZB 4PG3A 2BA0A 2UXCQ 2FXQA 1X55A 2IX0A 2WAQE 3F2DA 3HOUG 2K5NA 1EWIA 2I5LX 4Y52H 2KHIA 2A1AA 4GLVB 4YY3Q 4JI8L 5C0XI 2B3GA 4DV2Q 4BBSH 3H3VI 3DM3A 1G291 3HFZB 4BA1I 2CWAA 2PNHA 3MXNB 4A75A 1HZAA 1T9HA 1VQ5A 5IWAL 5C4JH 2ALYB 4OO1I 1YNXA 5IP7G 3CCLA 4DV5Q 5M5WH 2ATWA 4LF5L 2JE6I 1HNWL 1YHBA 2Y0SG 4DR5Q 1RL2A 1JB7A 1E7ZA 1NE3A 4FDBA 1SRUA 3D0FA 3ZJYC 1Q7YC 1NMFA 5IYDG 3RN2A 1J5EQ 3I2ZA 4L5TA 2UXBL 3NEMA 1QUQA 4H02A 4AIMA 3GTKH 4JI4L 4DR7Q 3PUXA 1QZGA 4B3SQ 1EFWA 4YCVA 3ULLA 1PVOA 1A62A 3JC66 2NZHA 3GTJH 1JMCA 3J80c 4AQYL 1QVFA 2ZTCA 3STBD 1YIJA 4NXMQ 5IY0A 1MIUA 4XTCS 5DLQE 3HOYG 3S1QH 4GKKL 1TWFH 4B3ML 2YTVA 2R7ZG 2HHHL 3PGZA 1MJCA 1NY4A 4L5QA 4APVA 4A93H 4DUZQ 4A3GH 4HJ7A 2GN5A 3F2BA 1N33Q 4IOCA 2NN6I 3T1HQ 3AEVA 1Z47A 1R9TH 4XIGS 3GTOH 2JQOA 2IHFA 4UPAA 4BXXG 2H5XA 3JAMi 3B6YA 3HOZH 1Y1VG 3GDEA 3PUWA 4NXNL 1PH7A 3HOWH 1CUKA 1E1TA 3CF5A 5GADC 2YU9H 3S15H 3U58A 1HNXQ 2VUMG 3S1NH 1YJNA 2RCNA 5C3EG 1X65A 4Y7NH 1WCMH 2RF4A 2QGQA 4LF4Q 5C0XG 3M3YH 1YHAA 3K0XA 4A3JG 1WFQA 1PH6A 3NENA 2VNUD 1PV4A 3EN2A 3CPWA 3CCVA 3MEFA 4DR6L 5JJKA 1QVGA 3S24A 3AQQA 4LF6L 4JI3L 4EX5A 1GVPA 1N34Q 4OO1G 1YI2A 1IZ6A 4JG2A 4GN5A 4NB3A 5IYBH 2VQFL 4A3IG 4A3CG 1CKOA 4OXPA 1HNZL 2AWNA 3L7ZC 4A3BH 5AJ3Q 4P71A 2N49A 5M5YH 5LMUQ 1PH3A 1HR0W 5LMNL 2NVQH 1PH8A 4YCUA 4O0AA 4IPHA 2N78A 3KF8B 3M9BA 1XMOL 4BA2I 3NELA 1K0RA 1PH9A 1VQBA 2E8GA 1PYSB 1X6OA 3E0EA 4IFDI 2K50A 4OWWB 1BKBA 3BJUA 4P75A 4JC0A 5HGQA 1XMQL 3KF6B 3CAMA 3DLLA 5FJ8H 5C44H 4BBRH 1LYLA 3HKZE 4PZ6A 4YWLA 2MFIA 4DK6C 2UUAQ 1E22A 4DV3Q 2NN6G 4X62Q 5M3FH 4C3JH 4DR2Q 1HR0Q 4OX9L 1K3RA 1GM5A 4JI0Q 1CSPA 2BH8A 2B63H 3OYYA 4O2DA 3TS0A 1IXRA 2UXCL 3UDXA 1LTLA 1NBWA 3PCOB 2CQOA 2JA9A 5C0XJ 3BZCA 1VQ4A 1EQRA 1X9NA 4POFA 4KHZA 1EYGA 1SN8A 1YJ9A 4HIMA 5FLMH 2Q2HA 4MNOA 2AWOA 2VL6A 2PQAB 3CPFA 3J81i 1JJ2A 1I94Q 1GD7A 4YY3L 3RLNA 4DV2L 4JBJA 4P74A 1XTDA 4A3EH 3TQYA 2JEBI 4JI5Q 2AHOB 2HIVA 4IPGA 1WOCA 4C2MH 4GLXA 2F3IA 2E2IH 4A93G 1EIFA 4A3GG 4IJHA 4P72A 3U4VA 4DV5L 3IRBA 1K8AC 1XPUA 3CMEA 2HQLA 2ES2A 3U4ZA 4DR5L 3LGJA 3RLOA 1OXXK 5IT9c 3GO5A 1O7IA 3A74A 1PH1A 3ER0A 4YCWA 4DV1Q 2VZAA 4LFCQ 1K73C 1X56A 5ELOA 3HOWG 4DR7L 4R4QA 3VDYA 4B3SL 3KJPA 4R4TA 5GAEC 4KHPL 3A5UA 1VS0A 4TVAB 2R92H 1EQQA 3CCRA 4JBMA 4PMWA 4DAMA 1WCMG 5GROA 1X3FA 1CKNA 4IJLA 4UP9A 4LNQA 4NXML 5J3BA 3UDFA 2MNAA 4BY7H 4IFDG 4A3DH 2R7DA 2CWPA 2XTIA 1OTCA 4X65Q 4DUZL 2NVYH 4DV6Q 1VQMA 2F4VQ 4WJ4A 4GNXA 1N33L 4LF9Q 4MZ9A 5IYBG 1YZ6A 2VQEQ 3T1HL 2ZJRA 4DV4Q 3M7NA 1TWAH 2WB1E 1XPRA 4UY8C 1JJGA 2R6GA 3FHWA 3W1GA 4GOPA 4A3BG 5M5XH 3KDFA 2UUCQ 3M85A 1LM0A 3GTLH 1HNXL 3J7ZC 1UE1A 2Q2TA 4QY7A 3EIVA 2IY5B 5JJLA 1CSQA 1TWCH 4LFBQ 1VCIA 2EIFA 1EUJA 4JI1Q 4LF4L 1JT8A 3G6EA 1VQGA 3PF5A 3CMAA 1IL2A 4JCVE 1WYDA 5FJ8G 4QQBX 5C44G 2ID0A 4ME3A 4BBRG 1N34L 2ASBA 4MTNA 2YYZA 1LUZA 3W5OA 3CW2C 1N32Q 5M3FG 2JA6H 4QJFA 1V43A 1KRTA 1PA6A 1NJIC 2B63G 3ICEA 1X54A 5AJ3L 3CC4A 5LMUL 1ASYA 4L5RC 3I4MH 3PUYA 3CC2A 1IBLQ 1L1OC 4DV7Q 2L15A 4UP7A 1FVIA 4IFDJ 1KXLA 4A3MH 1B7YB 3S16H 2OTJA 2Z0SA 5IP9H 1VQPA 1FL0A 4IPCA 1PFSA 1VQCA 3L0OA 3OTOQ 4YWMA 4C3IH 3RLFA 4HJ9A 2IX1A 2LXJA 3BZKA 3ULJA 4A3EG 1VQKA 4K0KQ 3RR5A 1DGSA 1VQLA 2R7FA 3CP0A 5H1SE 1Y1WH 1FJGQ 1QUQB 2K14A 1U5KA 1VQ7A 2RHQB 2V1CC 4DV3L 1HJPA 4A76A 4X62L 4DV0Q 1QZHA 4DR2L 1HR0L 3HOVG 5K36G 4JI0L 2EQSA 1YVCA 1BVSA 4DUYQ 1N36Q 1V1QA 1VQHA 3L2PA 3RZDH 4LUOA 4X64Q 1KIXA 1G51A 2AMCB 3K8AA 3HKSA 1XNRQ 3J80i 5ELNA 2KHJA 2QA4A 3OW2A 3F1ZA 1I94L 1V9PA 1PYBA 3I7FA 1Q86C
chains in the Genus database with same CATH superfamily
1TVXA 3NWTA 2ZTDA 4RCNA 2VY3A 2A5HA 1RJPA 2V5AA 1DONA 2ZTEA 3VYUA 3DEPA 4ALPA 3KLSA 2G9HD 2HCIA 2OF1A 2NVXA 4LF6H 4JI3H 2DNEA 2E2JH 3OSPA 2M9VA 1BOSA 4DV1L 3HOXH 2R93H 3EJIA 4DR3Q 1HNZH 2W7PA 1PTOH 2JEAI 3X3NA 3FP9A 1L0WA 2R6FA 4DL5A 2N88A 1YBYA 4A4IA 4CBVA 1M1KC 4QW9A 1STYA 5C4XH 3I56A 3C46A 4KD3A 5DG9A 1XMOH 3K5NA 4RNMA 3H15A 5JUMA 3NUCA 4UCOA 2EE1A 4L63B 3BABA 1BCPF 1B6RA 1Q8KA 1VQIA 2A74C 4CDEC 2WAQG 1PDQA 3I4MG 2W9BB 2EYLA 2V9WA 1B53A 1TS4A 2F0GA 1WTPA 2IWHA 3SK4A 1HA6A 4J9LA 3JSLA 3KJOA 1O7LA 1AE3A 4C3IG 3UE0A 1J5EL 2WB1A 3L4KA 5M5XB 4ECZA 1E1OA 3TP7A 4PMCA 4DV2H 1PHJA 3E9IA 3CCJA 1Q46A 2VB3X 1VQFA 2DIKA 4TUYF 2GVBA 4JBKA 2F0MA 2RVLA 4OGQC 2V4QA 4JI7Q 4XYQA 1IBLL 2ASDA 2FFKB 3GIMA 3MR3A 2X6GA 4H44C 1C7YA 3MXNA 2OTLA 2A8VA 1F9RA 3NSWA 4HMJA 5KFDA 3OTOL 1PH2A 2BQ3A 2WAQB 1CKMA 4B3SH 4OONA 2E2HH 3I4MB 4K0KL 2F52A 4J9QA 2EJFC 2WIIB 1I7NA 3MR5A 1VAJA 4TQSA 1EY0A 3H0GH 4JPBW 2AQ1B 1F2ZA 1EQTA 1ZYRC 3PV0A 2QEXA 4C3IB 2ZJTA 4DV0L 4DUZH 4OWTB 2JA5G 4A3LG 1Q81C 1I4XA 1N33H 2F03A 2F0QA 3OUZA 1AUXA 3LX0A 3U50C 5DQGA 3L9AX 4UDUC 1NMGA 4GLAC 1HHVA 3FEWX 1ZETA 3S1NB 1F2YA 3T4AC 5A2QW 3E0JA 4CDCC 1KJ8A 5CV8A 4L1KA 1KTKA 1KRSA 1T5EA 2GA4B 5GAHC 3JAMc 1P8LA 1K83A 2EYPA 1H9SA 1E24A 1K28A 2MHVA 3TEHB 5JJIA 1I7LA 2B2WC 1B3AA 1V8QA 1UUPA 4B08A 4JI6Q 1S4ZA 5KFPA 1CM9A 4LF7L 1TIID 3NBHB 4QMGA 4V0BA 1RTOA 1JJCB 3K3VA 4MTDA 3SXHA 1VQ8A 3I55A 2UUAL 1TWHA 3RF2A 4A3FG 4K2KA 2W8LA 2JA5B 4KN7C 2CCZA 2GVAA 4MV8A 4KJOA 5DLFA 3EROA 3HKZG 1LTBD 4MAMA 3AFPA 2FKLA 1RJQA 2WKDA 1XNQL 5TSSA 2OEOA 4YR2A 3LWBA 3LNNA 2B2YC 4C5AA 3PW5A 1I3QH 2FJZA 1WI5A 4HYKA 1SMYD 1C30A 1ZKOA 4DR1L 1WH2A 2J6UA 1ILQA 1HNWQ 4IRKA 1X3PA 2Q8TA 4MV1A 2IHEA 2EYHA 3S2HB 5IE8A 1EUDB 4DNRB 3WNZA 1D5MC 1DV2A 2A6EC 1J8IA 3PF4A 3PW2A 3JAMW 2BE5D 3QO2A 1EIYB 1IBML 3OSOA 1EOVA 2R7LA 2W9CB 3Q8DA 2EXZA 2QDBA 3RBEA 2K05A 1UNNC 4A3FB 3UE1A 2ZDQA 4DPGA 3K57A 2O2LD 3OIQA 3HKZB 2HHHQ 3KALA 2FLPA 3RJ0A 2MQHA 5IP7H 3LWUA 5KIXA 3S1RH 1ILPA 4LFAL 4I7ZC 5KT5A 2UU9L 1PXUA 3GV8B 1MSGA 3TDQA 2JA8G 4J9RA 3K81C 1MBYA 2CVRA 2NVXB 4FS1A 1BDOA 2KSWA 2YTYA 1YJWA 2WB1G 3BVZA 3H4BA 4F50A 2KCNA 2K32A 1VKZA 2PBZA 2PZWA 4Y8VB 1HPCA 4DR4L 3KBGA 1V51A 4KY7A 3GTQH 1HTPA 4DV4H 1HZBA 1XYIA 4JI2L 2XGQA 3GV6A 3U9SA 1TS3A 4V190 1Y1WG 3I91A 2VQFQ 4RUAA 3AB9A 2M05A 1RHPA 3ZYYX 3GTJA 1Y1VH 4MHEA 2N8NA 4RG1A 2KVMA 1K1SA 5DQHA 4JI1H 4ZAIA 4R9WA 5LOVF 3G6YA 5KX5F 1TR5A 3RN5A 5C3EH 1JQYD 1MSHA 5I4DA 1R4QB 3HOVH 3DEOA 2TSSA 1HZCA 2OCEA 4F87A 4RKBA 4PNYA 1L0XB 4RAYA 3RAQA 2PW5A 2R7KA 2K5QA 2FK1A 3H3VH 3PO3G 4LMYA 3ND8A 2K1BA 2WB1B 1FJGL 4OO1H 1J6QA 4RB1A 4PG3A 5D3IB 2FXQA 5T1IA 3MFGA 4XT1B 2DN8A 2BDNA 3OW7A 5KGUA 4ED7A 2F0FA 2I5LX 2XIWA 1MD2D 1Y1WB 4JV2A 4ABNA 1GHJA 3KXYT 5DEHA 2VOBA 2B3GA 3GLKA 5KFHA 4J1MA 3H3VI 2FK2A 1G291 3HFZB 1GUWA 3H4DA 2PNHA 3MXNB 1GSOA 1EWCA 3RZDB 1T9HA 3FMCA 2KEEA 1YNXA 4OO1I 2RGRA 3CCLA 4DV5Q 5M5WH 1ZEQX 1YHBA 3HP3A 1VMCA 2ICIA 1E7ZA 2MP1A 4DAPA 4MV3A 2R7MA 4X64H 3H09A 4FDBA 1J5EQ 5A35A 2ZXOA 1NMFA 4A2AA 3I2ZA 3PO3B 2UXBL 4IWYA 2DJGC 1GXDC 4DR7Q 4JI4L 4HSPA 2F3VA 2CW0D 5I9OA 1RODA 3K6OA 2NUCA 3JC66 2NZHA 2SNMA 1JMCA 4IRCA 1HQMC 2ZTCA 3STBD 1YIJA 3OWEB 5FLXL 2E2JB 4XTCS 3KLSX 3HOYG 4GKKL 3FDTA 3FRPB 4L5QA 3NTHA 4A3GH 1K83B 2G5DA 1H9SB 1Z47A 4DR3H 4Q43A 4O42A 2IHFA 4UPAA 2B2TA 4NXNL 1CUKA 5DLGA 1DOLA 4RGMA 4WFN3 1HNXQ 2NU6B 2R8GA 2E2IA 4C5CA 1WCMH 2RF4A 2QGQA 2R3ZA 4A2BA 3MWEA 2L9HA 2XWJB 3K0XA 1TWHB 4DR6L 3EN2A 5JJKA 3S24A 5CA0F 4EX5A 1JCKB 1N34Q 1LTAD 1YI2A 5KFRA 4JG2A 4NP5A 1ZHQA 1S0OA 1S5BD 3HOYB 1G2TA 1DJRD 2B8GA 2N49A 5LMUQ 2Z6BA 4K5XA 1PH3A 4ZK9B 3WO1A 5L1IA 4ZLTF 4YCUA 2OT2A 1PFBA 4MA0A 2F3WA 4BA2I 1EL0A 1DM0B 1MZBA 1PH9A 1VQBA 3BS1A 1G2SA 2MJ8A 1UNSA 4ECUA 3V6JA 2K03A 1X32A 3BJUA 1JWUD 4JC0A 5K2MA 2C22A 1AP0A 1LYLA 1PTOC 4PZ6A 2UUAQ 2MFIA 3MFYA 4B9XA 5L37A 4JI7H 3BZDB 4X62Q 5M3FH 4OX9L 3GTLA 1K3RA 1D2BA 4O2DA 5C5LA 1IXRA 4LSXA 2RGVA 4I7HA 5ELEA 2EZVA 1NBWA 4KK7A 4QUCA 3A54A 3M9MB 1EYZA 1EYGA 3Q24A 3VMMA 2Q2HA 4MNOA 2ASJA 3TINA 3J81L 3J81i 1I94Q 1XTDA 5COYA 2NYZD 5JVG3 4A93G 1U4RA 4ECXA 4IJHA 2X0SA 1K8AC 3IRBA 4MIUA 1LT5D 3HRZC 5JPMC 1KBLA 4EEYA 2EOTA 5IT9c 1A2UA 1PH1A 2V59A 5K36H 4KKTA 2GPWA 2VZAA 3D6WA 4ZOLF 3MWYW 1X56A 3P20A 5ELOA 2W6PA 3E5SA 4R4TA 1VS0A 1QOHA 3CCRA 1NR2A 3RB3A 1X3FA 1F77A 4IFDG 5C6AA 4JI6H 2XTIA 2HVRA 2CH4W 2L55A 2A6HD 2QKIC 4RH6A 4GNXA 3GTJB 3URYA 4LF9Q 4FS2A 5IYBG 2VQEQ 3T1HL 3RV4A 4KY6A 2V4RA 2B39A 2WE6A 4UY8C 4ED2A 4GOPA 4A3BG 3S1QB 5M5XH 3KDFA 2UUCQ 3M85A 2K5DA 4A93B 1EY4A 2ZXPA 3J7ZC 2Q2TA 2JN4A 2LMCB 3AMUA 1SYDA 3L4JA 1FKAH 2F0WA 1CSQA 1TWCH 1W6KA 1DYQA 2RDHA 4RGTA 2EIFA 3I90A 2SEBD 4LFBQ 1VBGA 2FMAA 3NTIA 4O4IF 1EOTA 5C1PA 1PRTD 3G6EA 2M2LA 1W96A 1VQGA 2J4XA 4HAEA 3K5IA 3K5MA 2RBMA 5CV6A 4QQBX 2ID0A 4ME3A 3J7AV 5HURA 2YYZA 1LUZA 4Y7NB 3T51B 4ECRA 1JC7A 1N32Q 3A8JE 4C3JG 4QJFA 1V43A 3M3YB 4RB2C 1HNWH 5AJ3L 3CC4A 3I4MH 2R84A 5IT9W 4K6DA 3DWPA 1RKNA 5KFSA 3CC2A 4PDBA 2L5TA 1L1OC 2OH2A 2C2EA 2HVSA 5KFYA 1A3VA 1KNEA 1EIHA 2V4DA 3L0OA 2K01A 3V6HA 4C3IH 3SE7A 4A3BB 2IPKD 5M5YB 5KYIA 1NNXA 1QG7A 2NVQB 1DGSA 5D14A 1VQLA 5J2TF 2IJ0A 2R7FA 3N52A 4XQQA 3J80E 2HQEA 1FJGQ 4J8QA 1TWGA 1K1QA 3CQZA 4O2AF 1VQ7A 2JYOA 2KA7A 1Y8PB 2V1CC 4DV3L 4A76A 3HOVG 2HHHH 4DR2L 4JI0L 1NAPA 1YVCA 4ECSA 4DUYQ 2EJGC 1N36Q 1V1QA 2F0TA 3BG5A 4KMUC 4LUOA 5ELBA 5KT7A 2QW7A 3IFTA 1G51A 3BAAA 1L2ZA 2CQYA 4QIWA 1XNRQ 3J80i 3J80L 2R8HA 4C3JB 5HGTA 1JJ2A 3I7FA 2F0IA 1Z9FA 2FJ2A 2LFNA 4C1NK 4JI5L 2LSSA 2ZDHA 3GTQB 5DQIA 3W3AA 5I2YA 1GKHA 3G71A 2B29A 1GSHA 4ECVA 1YITA 2JA5H 4A3LH 2E2IB 4LFCL 1Y1VB 4K5WA 4DXGA 5FD5A 2XCAA 2VQFH 1SFOA 4QIWE 3TS2A 1PK8A 1AN7A 1VQNA 3HOVB 2FB9A 5L9XA 1XTCD 1KDCA 5EKKA 4DKAC 1KQSA 1S0MA 3OHBA 2J7ZA 2ZJQA 1AH9A 5CV5A 2ALZA 2PQAA 3RB4A 4K2LA 1STGA 5KRUA 5BN4A 4X65L 4DV6L 2JSOA 4ETSA 5L1JA 4RHSA 3S2HH 5CC4A 1WSCA 2MUYA 1K8GA 3LP8A 2C35B 3R2TA 3JRWA 3A0JA 3NXWA 1IYVA 2L4NA 4YBZB 1KEEA 4A3FH 4YWKA 1Q1BA 1PH4A 2R7ZH 2ASLA 1CA6A 1TXYA 2KCMA 4ZRZA 3GTLB 2KEDA 2J6TA 3AYHB 3TP8A 1QNUA 1UE5A 4YJ3F 3PIO3 4R7RA 3EYYA 4MA5A 2C9OA 4RNOA 4EGVA 2B2UC 4DV5H 1BGWA 3PIPA 2NVXH 1NSNS 4U7CA 1J5EH 1GUNA 1PFMA 2W9AA 1M0TA 1V1OA 3K0YA 4DR7H 1EYDA 4KHPH 2YS6A 4M1UB 3T16A 2UVWA 1PRTB 2HGSA 2JEJA 2R82A 1S5CD 2XD4A 3H3VC 4AYBA 2RDFA 3S16B 1S3OA 4HJ5A 1CS0A 4RB3C 2C5CA 3M4QA 1CQJB 1Z7TA 2E5LQ 1KHIA 3K3PA 1OXUA 1A3TA 4BY1G 4JOIA 3UDIA 2VW9A 5BR8Q 2D0PA 2YTXA 4TQUS 4IZOA 1YNND 5GAGC 5IGEA 2JA8H 4GNXB 1HNXH 2UVRA 3MFIA 3U9TA 2JP1A 3G4SA 1SAPA 2IBKA 4EFBA 3IL8A 3VR6A 4AYBE 4GOPB 3J7YW 1K3BC 3KDFB 1SMXA 1JIHA 3MWMA 2DGYA 2BQUA 2F0LA 2WP8J 1N34H 1M90C 3ITPA 4B3RL 2Y0SA 2EY6A 1SNPA 2NU8B 1M4VA 4MV4A 1H9RA 2Z9HA 2KBNA 1EU4A 1GUTA 4N9PA 1X3EA 3A8KE 1QNKA 1VQ9A 2W57A 5LMUH 3EBEA 5AFWA 3VYSA 4K8IA 2F0JA 2YV5A 5EZYF 1WTOA 1NR4A 4BY1B 3QB3A 3BA9A 2ZJPA 2Q2UA 4OWXB 4U673 4CKBA 3T1YL 1B4OA 2R7ZA 2YW2A 1PZKD 1D8LA 3J81j 4JV0A 1K0SA 5CV7A 2Y0SE 1HCZA 3PO3H 4F8MA 5IWAQ 4X62H 3PIOA 5ELDA 4JV5L 5DAUA 1CFMA 5IGFA 4YQWA 2TMPA 1EZ6A 2MPMA 1OXSC 3J7AK 4J6HA 1CE8A 1I4RA 1NTGA 1CQFA 1TWGB 5KG1A 3FMAA 2VUMA 4DNIA 3CQZB 4GNXC 3O13A 4RB0A 1I50A 5E4XA 1I94H 1RF2D 4WBNF 1BBWA 3OMCA 3FVQA 1K83H 4HIDA 4GOPC 4KY5A 4AQYQ 1KJ9A 2XIGA 2JK8A 1N9WA 3M4PA 4QIWB 5HY6A 2BDOA 2Z6KA 4ZQ3A 4LAAA 4FF3A 2UVUA 2UXDL 2AQ3B 4DL3A 2CFMA 3M9OB 2KQ3A 1F2MA 3BDOA 2F4VL 2EYOA 2VA3A 2NWGA 2G9DA 2RA4A 2UUBL 1IBKL 2ZM6L 4GKJL 5KFZA 4IO9A 2MCTA 3I8ZA 4IUTA 1TWHH 3KLWA 2FE3A 2O5IC 3TMEA 2Q8RE 4X66L 4R4IA 5EOYA 4RNNA 1SFOB 2ZDGA 1U4PA 3C3LA 3HG9A 1UE7A 2W71A 3IG0A 3HOYH 1JE4A 4LF9H 1B6SA 4RMFA 4DU9A 3PO2G 2PCFB 2YCHA 2VQEH 1PMRA 3R2IA 1KABA 2ZT9C 3VYTA 1WD1A 4RKLA 4B3TL 1BBUA 3I4NG 2K5VA 1TWCB 1A8VA 4XQNA 3RZOH 3PN1A 4E4TA 3SK8A 4LF8L 3C0FB 4J9NA 2UUCH 1Z2OX 4PMBA 2IA6A 4YHHL 5KFKA 5LMNQ 5A2QE 4LFBH 3KYHC 4RWSC 5D65A 2EPBA 3SGIA 5LYJF 1TWFA 4XYLB 1N8RC 4LH6A 4WJ3M 2HDLA 3JRXA 5IGGA 4A3KG 4AYBG 3I4OA 5KFFA 1JOQA 3VR2A 1LTGD 1R9TA 1N32H 1VQ6A 5A2QL 5IGDA 5FO9B 3WO0A 4U68A 2QYZA 4H13C 3QZ8A 1ENFA 4JYAQ 1GO3E 2YU9A 2JXMB 3A5ZB 2BA0A 2UXCQ 3PO2B 3N43B 4EGQA 2IX0A 3F2DA 3G6XA 1BCPD 5JQWA 5D1OA 1ZHSA 4IHJF 3I4NB 1TQOA 2P5ZX 2K33A 2K5WA 4GLVB 3GP7A 3H91A 4JI8L 4YY3Q 3Q8SB 3GV7B 1STHA 2VPQA 4A75A 1PX2A 1HZAA 2DY7A 2ALYB 1U9RA 4HR7B 1XDNA 3N42B 4LF5L 2JE6I 1PTOF 4DUYH 2Y0SG 2QF7A 4C1NI 4DR5Q 1N36H 1RL2A 1QWYA 4A3KB 4AYBB 1SRUA 2I80A 3RN2A 4B9WA 2IP4A 4L5TA 1XNRH 1ICFB 3QWNA 2W8KA 5LA6F 1QZGA 1EFWA 4YCVA 1PVOA 1RK6A 5DNFA 3GTJH 4ZUJA 2IL8A 4NXMQ 1DIKA 1MIUA 4IWXA 2F0UA 3S1QH 4B3ML 4O2BF 2R7ZG 3T5KA 3PGZA 4A93H 1NY4A 3S14B 2F0KA 4Q0FA 2B63A 4K5VA 3S9WA 5KNCA 1SSOA 4IN3A 1I6HB 3ETJA 4CC5A 2PN1A 1A3UA 2A69C 2H5XA 3JAML 3JAMi 4BXXG 3JSNA 3HOZH 1JR0D 5L1KA 3M4YA 3VPDA 2JEGA 1PH7A 3SVMA 1A9XA 5GADC 5GONF 2VUMG 2Y0SB 2L1BA 4C2MA 1X65A 4Y7NH 1AEXA 1WTHA 4LF4Q 3T5JA 3M3YH 1T3NA 1YHAA 4IR1A 4A3JG 1PH6A 4IFDH 2J9GA 4FF1A 1PV4A 4U6PA 3CPWA 1DOMA 1QVGA 2A73B 4LF6L 4JI3L 3OIPA 3SHLA 3NQTA 4GZYC 5EPJA 1CHPD 5IYBH 4OIJA 1CKOA 2RDJA 1HNZL 2K28A 3TP5A 1B1ZA 3L7ZC 4A3BH 3GTKA 5C3WA 5M5YH 2R7ZB 2FPGB 4DLKA 1SEBD 3HS0C 2NVQH 1M0WA 1WTWA 4IPHA 2N78A 1D5XC 1XMOL 1LV9A 4DN4M 1J9OA 2BCOA 1K0RA 3NELA 5D1PA 1SE2A 3SI8A 3G7LA 2P0AA 5I2XA 4IFDI 2A68C 3HB9A 4UHVA 4P75A 1XMQL 1N56A 3KTMA 1QB5D 3CAMA 3DLLA 4TSSA 2VUMB 1F9SA 4O1NA 4QB4A 5EPLA 4DK6C 1CQVA 2NN6G 2FHTA 4C3JH 1HR0Q 1GM5A 5EBDA 2BH8A 4ULLA 4A3JB 4UFZA 3PCOB 4POFA 4KHZA 1YJ9A 2F0OA 4HIMA 5FLMH 2VL6A 1BF4A 4KJNA 4RU9A 5CAEB 4DV2L 4JBJA 2XGPA 2JEBI 3P7JA 4IPGA 1WOCA 2E2IH 4O3PA 2F3IA 5F9NA 2CQAA 1EIFA 2E5LH 5IGBA 2AGPA 1XPUA 3CMEA 2ES2A 4GC6A 3Q8PB 1KLUD 3U4ZA 2L0CA 5EKLA 4IZ8A 1O7IA 4CGYB 2JA8B 5KG4A 3ER0A 5BR8H 4DV1Q 3T13A 4R4QA 5C4JB 3Q23A 3VDYA 1S5FD 1TT2A 4B3SL 3MJFA 1BCPB 4TVAB 4DAYA 1D6EC 3V4SA 1WD0A 4JBMA 3QG1A 4PMWA 1QJOA 1W6JA 5GROA 5KFWA 1CKNA 4IJLA 5J3BA 4DV7H 3UDFA 5EBCA 3M7GA 3KHGA 4EYIB 3GTKB 1JXLA 4X3KA 2CWPA 1UAPA 3E5NA 1KC7A 4DUZL 4MTEA 2F4VQ 1O7YA 4WJ4A 1N33L 3I73A 1E4EA 4MZ9A 1YZ6A 3M7NA 1TWAH 1JJGA 2R6GA 1T5XD 1TWFB 3PMFA 4XT3B 1ET9A 1LM0A 4E6IA 3GTLH 3KK7A 2SNSA 4QY7A 5FK9C 5JJLA 3N44B 1JDBB 1R9TB 2H4OA 1IHZA 1VCIA 2KCCA 5FLXE 5KG6A 1B04A 1BXTA 1XXGA 4Q44A 3R3OA 3IN5A 5G3LF 4JUZA 3CMAA 1IL2A 1EYAA 4EBDA 4FXGC 3G6JB 1Y8NB 5C44G 2X69A 3W5OA 5FOBB 3TQTA 1TKWB 3VPBA 5IWAH 2B63G 3WOFA 5D1OB 2DY8A 3MVVA 1IBLQ 1LABA 1FVIA 3GIJA 4IFDJ 3QOLA 2XCLA 1KXLA 3FDSA 3S16H 1B7YB 4ECQA 1SNOA 1UC8A 3H94A 1GUSA 4ED0A 1ET6A 4IPCA 2J0TD 1PFSA 1VQCA 3OTOQ 2I8CA 1C48A 3ONAB 3RLFA 2IX1A 1EQVA 3BZKA 2NBFA 4JW0A 4A3EG 4K0KQ 5FPOA 4F4ZA 2FMMA 4AQYH 4ZKBB 4ECWA 3KAKA 5J22A 4DV0Q 3OWFA 3I3CA 5KFIA 4O3SA 2C00A 3RIZA 1I4HA 2Z4HA 1KIXA 4HQ6A 5C44B 5KFUA 5ELFA 5CYUA 2AMCB 3MR6A 1WVLA 4RGNA 5ELNA 4HSVA 3F1ZA 1GVPA 2B63B 1PYBA 1Q86C 4CJ2C 5KT4A 2LS01 4HNTA 4IUPA 5M3MH 1JKJB 3QFFA 5KFNA 4M7EA 4LF5Q 3RZOB 2K04A 3M4OH 1GYFA 3E3XA 5G3LD 4A3EB 1I5FA 1RYSA 4LF7Q 5KFEA 4C2MB 1CT1D 5FKAC 4BY1H 4K6LA 1TWAA 2AGQA 1SE4A 2K75A 2PW7A 1SMYC 3MXPA 3HXLA 3J81E 5KG5A 3W1BA 5KFBA 3V4ZA 4MV7A 4ID6A 4LW1A 5LMNH 1BBXC 4B3MQ 4HTHA 2PI2E 4HCEA 3RFCA 1E4GT 5KFLA 1G6PA 4DGZA 2RKSA 2BE5C 3BDCA 5EAYA 1EZ8A 3T56B 1SLJA 2CW7A 4G7HC 1XNQQ 1MGSA 4DV4L 4UCSA 1B70B 1TS5A 4GC7A 2W6MA 1TWGH 2VA2A 1F9QA 2A19A 4AH6A 3NQIA 3CQZH 4O3NA 4FF4A 2X6LA 1Z2PX 1LT3D 4JYAH 4DR1Q 1LLRD 5T14A 2UXCH 4TV8F 3K5OA 4KLKA 5CORA 3CU7A 3MEHA 4C5BA 2I5HA 2C28A 2IT1A 2RSNA 4JI1L 2VS1A 1HTLD 3RMHA 3EPGA 2KCTA 3HOZG 3CCSA 4YY3H 1IBMQ 1E3PA 2XC9A 4LUZA 3V2TA 2KENA 4HN7A 3T5HA 1C8CA 3PW4A 2W6OA 4QWDA 1TY0A 1SYCA 1LTID 2XGTA 4POGA 3KHRA 3U9OA 4DR5H 3D4DA 3UI2A 2ICEC 2ENBA 4LFAQ 1SDFA 1EZ1A 1EFID 2UU9Q 3D3RA 5IT9E 1SBBB 2R87A 1E4FT 2N3SA 4HIOA 1SFOH 2WV6D 3NK9A 3ERSX 4IPDA 5C0XH 4O3QA 3JZIA 1SROA 1XMQQ 2XRSD 5IIFA 3R93A 3GIKA 4MTKA 4NXMH 5CBEE 5EWFA 1H9MA 4J9PA 5BPHA 3OPOA 5KFTA 5E7NA 1A0IA 4C3HG 5IT9L 4DR4Q 4X6AH 3RB6A 1RJTA 4DAYB 3FKIA 3QIAA 3BVMA 3SR1A 1PZID 3HOZB 4GS3A 2BA1A 5D8DA 1CKNB 4X64L 2JA7A 4JI2Q 2K52A 1FGUA 1YNJD 1KD1C 1DD2A 1JWSD 2AKWB 1K8OA 3TBIB 3KFUA 2AUJD 1BO0A 1DV1A 4RZRA 1M8AA 5I9PA 2EXDA 1E4EB 3WOEA 4HJAA 3EPIA 1VQOA 5C3XA 4LF4H 5CMDA 1KAWA 4RZQA 5FLMG 4RCOA 3RNUA 3K80C 4JV1A 3RUPA 1H95A 1WTQA 4O3OA 3PO2H 3G48A 5GQOA 4YP3A 4DR3L 1KJQA 5E1FA 3NWSA 3GIIA 3GTGA 1A63A 3V96A 3I4NH 4L5SA 5EKIA 4C3HB 1YHQA 5JEAG 2PMZA 4PZ8A 1Q8IA 5IGCA 1QVCA 1RTNA 2QK4A 4JVZA 3F8NA 2CW0C 3F2CA 1UWVA 2JJQA 4A3KH 4UP8A 1WTRA 3STBC 1YEZA 2K7VA 2AU0A 3S1MB 5BPFA 5IYCG 3GTMA 4J0MA 2YZMA 1HR0H 1Q1EA 1WJJA 2OQKA 4QL5A 3WWVA 3D8GA 3FPUB 3KF6A 3R8BA 3TZUA 5HBRB 2PMZE 3K59A 4ECTA 2F0SA 2UXBQ 2YRXA 2K6AA 4JI4Q 4WJWA 4HIKA 1LT6D 3S14H 4RA8A 4APMA 3MHBA 3GTPH 3D4WA 1EY8A 1I6HH 4QUFA 1W2BA 1ICWA 2R8KA 2F0NA 4GKKQ 4JI7L 4XZ3B 3DMUA 1XX8A 1B9NA 3A55A 4F88A 1OXTA 4DNTB 3T5LA 4DV1H 2NU9B 5DG8A 4IUNA 3QZ7A 4J9SA 2RQXA 1JOOA 4RUCA 5LHY1 4EQ5A 5JVH3 4NXNQ 2FK3A 3OSNA 1C3OA 4OL7A 5EGTA 3CCEA 5LMNW 1FYCA 1EIGA 3PUZA 4X3UA 1SYBA 1TWAB 2F4VH 4QW8A 2GPSA 5C1OA 4DR6Q 3F2UA 1VQDA 4P73A 4DK3C 1HXYD 3QOJA 2ATLA 2B2TC 1IW7C 2NU7B 3OHAA 1HUMA 4X3SA 4BXXH 1FNVA 1HFNA 3AFQA 3K7UC 4OHJA 2CKZB 3MTSA 3GV3A 3MFHA 1N48A 1HFGA 3S2DB 4GN4B 4NDXA 1ZYRD 2VUMH 1I50H 4JI6L 2DJFC 4ED6A 2EDGA 4FM9A 1X3GA 2F0VA 1PH5A 2PQEA 2PZTA 4A3JH 2OWOA 5M3MG 4FXDA 3GTOA 3PUVA 1U0LA 3IFDA 5CGKA 4YAJB 3FKIG 2B2YA 3KOJA 3P1HA 4HNUA 1ESRA 1S72A 1AZPA 1IBLH 1FR3A 5NUCA 4OX9Q 2JA7G 3GD7A 3R5XA 4R8UA 2W6NA 4WORA 3GQCA 5E4WC 1STAA 4N9TA 3VYRA 3UQ8A 1X55A 2WAQE 1VBHA 4Q45A 3OTOH 3HOUG 5LL6S 4FYDA 4BWSC 3EA6A 2WINB 4XX0B 4K0KH 3QR8A 4NMZA 1IL8A 2A1AA 5KG0A 4YR0A 1BJTA 4BBSH 1QE6A 3DM3A 3GTPA 4MV6A 2CWAA 3BJYA 1VQ5A 5C4JH 3RBDA 4DV0H 3Q8QB 3C1EA 1HNWL 2A6HC 2E2DC 1KDBA 2NN6H 1FGBD 1NE3A 2YS7A 1Q7YC 5IYDG 1NCVA 3S17B 4IAJA 3MA2B 1QUQA 4H02A 5M3MB 2HVQA 3GTKH 1G8ZD 4EEQA 3PUXA 3FKIB 1A62A 2VQDA 1QVFA 2O5JC 1K8MA 3M4OB 4EFEA 3N41B 4DL2A 2JA7B 1M7JA 5IY0A 2FPIB 4UCTA 5DLQE 5FD6A 1IOVA 2D2CC 1TWFH 2VB2X 2HHHL 1PRTC 3ORQA 4APVA 3HOUB 3KUPA 2GN5A 4LF7H 1D5ZC 2NN6I 3T1HQ 3AEVA 5I47A 1R9TH 4XIGS 2JQOA 3ND9A 3K7AB 2A6ED 2UVVA 4G7OC 3B6YA 2R8JA 3NE5B 3GDEA 3Q6SA 2UUAH 1B9MA 3ERQA 3CF5A 2NZ1D 2YU9H 3IKJA 2W7OA 1LO5D 1OO9B 2RCNA 1FNWA 1ML0D 3D6CA 4KHVA 2B8FA 2W9CA 5C0XG 3GTGB 2WDTA 3TZDA 2VNUD 1SNDA 1B44D 3CCVA 3MEFA 5JPNC 1EU3A 1MHWC 1XNQH 1Y8OB 2AGOA 2A68D 4GN5A 4NB3A 2VQFL 2NVTB 5C8YF 2CZGA 1STBA 1B50A 2AWNA 3OUUA 4DR1H 1BR9A 2WKCA 3I70A 5AJ3Q 3UFXB 1HR0W 1SCUB 3H40A 3BQ0A 1E2VA 3GILA 4BWGB 1EEFD 3A7LA 3GQBA 3GTMB 5IODA 3MXGA 1CK1A 5C5MA 4EQNA 1IBMH 1X6OA 1PYSB 2E8GA 3A8IE 4F7XA 2NVYA 3GIPA 5EDWA 3VR4A 3KF6B 1A15A 3DXJC 3WDNA 5I6WA 4OELB 1GOZA 1ZQ7A 5C44H 3HKZE 5JJZA 2I87A 3R5HA 4DV3Q 2JEIA 4DR2Q 2B63H 4JI0Q 3OYYA 4LFAH 3TS0A 2HDMA 4NW2A 2UU9H 1LTLA 1VQ4A 1X9NA 2JA9A 1EQRA 3GIDA 4YB8B 2SOBA 2O4XA 1XMQH 1C4QA 2PQAB 4ODGA 1GD7A 3RLNA 5BN5A 1SNMA 1JWMD 4P74A 4A3EH 4JI5Q 2HIVA 4C2MH 4GLXA 1I6UA 3BYTB 2EY5A 1QILA 1IYUA 3Q0AA 1ZXTA 4DR4H 2JA6A 1S5ED 3U4VA 3VR3A 4DV5L 5J2UF 3LWEA 4DXFA 3LGJA 3ORRA 4JI2H 1R4PB 4YCWA 3Q1KA 4LFCQ 1SYGA 1K73C 3HOWG 4DR7L 1I4GA 1CTMA 4KHPL 5GAEC 5CV4A 3A5UA 2R92H 5KEEA 4S3SA 4UP9A 2HJWA 3G6VA 4LMQD 2SCUB 1Y1WA 3BQ2A 4L8JA 5KFJA 2R7DA 5M9OA 1AFPA 3V6KA 1JORA 3MC0B 1OTCA 4X65Q 3KBXA 4DV6Q 1BNZA 1SNQA 1JDEA 4G7ZC 5EWGA 2ZJRA 1EEID 2WB1E 1TS2A 3FHWA 1T94A 1JOKA 1FJGH 3M9NB 3TIIA 3VA7A 4TQRA 4YJ2F 4EGJA 2C2RA 2F1MA 3E6ZX 4EQOA 4KKUA 1B33N 5KT6A 3RB0A 1HNXL 4FF2A 1UE1A 4M9UA 2IY5B 4RAUC 2KOLA 1GHKA 2WYOA 3GTOB 4IUVA 4QCLA 4G57A 4L6TB 5LL6X 4FVMA 2R8IA 3HOWB 1S03G 3S15B 4JCVE 1DCZA 5FJ8G 4R8UB 4J9KA 4BBRG 1N34L 2ASBA 1CZWA 4ZHQF 2R93A 1WR2A 3CKIB 2W70A 3CW2C 1SJHD 1CQIB 3JAME 5KT3A 3RD4A 1X54A 5LMUL 1ASYA 3PUYA 1BNCA 2L15A 1L0YB 4CC6A 5LL6b 1SXTA 3GTPB 3PW0A 5EPKA 1HUNA 2UXBH 5IP9H 1VQPA 5KNDA 2IW3A 1O75A 3EVQA 4JI4H 2OLSA 1KJIA 3G8CA 4ZYSA 3BQ1A 1YNNC 1VQKA 3TN2A 5KFGA 4ME5A 1TA8A 5KFCA 3CP0A 3V05A 5H1SE 4I65A 1JICA 2RDGA 2BQRA 1QUQB 4GKKH 2K14A 2RHQB 1QZHA 4KKSA 4X62L 2KHSA 5KNBA 2EQSA 1D1IA 4QF4A 1KNAA 5KFMA 1VF7A 5BN3A 3L2PA 4YIJA 1ESFA 1S0NA 4BBRB 5DGAA 3HKSA 4IUQA 4H0LC 5JOBA 4NXNH 3HBLA 2KHJA 1I94L 3OW2A 1RCVD 1V9PA 1LACA 1X3QA 1ENCA 4BY7G 3ETHA 2R92A 4A3DG 1ULZA 1PTOD 2W6QA 3MR2A 4Q0YA 4UCRA 3BVGA 5KYLA 3TP6A 4DR6H 4RFBA 2F0EA 3PQIA 2RHSB 4Q8EA 3CCUA 5KT2A 4C3HH 3C1FA 1D1KA 4BBSG 4BS9A 1SNCA 4JOIC 4B3RQ 3GIQA 5T1GA 2JEFA 4PQXA 1AN8A 2J6SA 2PYKA 2E2HA 5CBAE 1H9JA 1I50B 1JB3A 3CC7A 2DUDA 4N8FA 3CCMA 2CW8A 3HGBA 1V1PA 1B2TA 3H0GA 2PNRC 3CVZA 3S1MH 2MO1A 3T1YQ 4DA2A 4LF9L 2YRWA 2KECA 3KLRA 2VQEL 1UC9A 1IYJB 2B2VA 1SYFA 5F2DA 1H9KA 2JA6G 4BY7B 4A3DB 2EJMA 2UUCL 5DGBA 3LMLA 2D5DA 1EY9A 2VPSA 2NVYB 4OX9H 1AZQA 4A3MG 4JV5Q 1RIPA 2Z8LA 4LUVA 3I12A 4XYMB 1E2WA 1L1OA 2MO0A 4H7BA 4LFBL 4BBSB 1UEBA 3PR4A 4LJZC 5JEAH 3T53B 2I5MX 1EYCA 4FBTA 4XXEA 4ZUIA 5KFXA 2D0OA 1CA5A 2NTSA 1MI2A 5FPRA 4PZ7A 4RHRA 1N32L 4I50F 1SYEA 1RK5A 2UXDQ 1HH2P 1S10A 3RV3A 5IYCH 3NBIA 4C56C 3L3OC 2DPJA 2F0HA 2Q2IA 1E2ZA 3SEBA 1A2TA 3DUZA 2BOSA 1PYWD 4CKEA 2UUBQ 1IBKQ 2JA6B 2ZM6Q 4GKJQ 4DL4A 3TREA 2QILA 4YAKB 2R61A 1W93A 2HT1A 1SE3A 4M8AA 4A3MB 4X66Q 2ZXRA 4HCSA 4CHTB 3C2PA 1DXMA 4A3CH 2Z6KC 1ASZA 4A3IH 5KKNB 1I3QA 1S97A 1XPOA 5FLXc 3CXCA 1S68A 4DUYL 2PZUA 1N36L 3HOXG 2R93G 3T1HH 5ISRA 1KAAA 1I6VC 2YU9B 4LK1C 5L1LA 2D62A 4EVOA 3S2DH 3PSIA 5FO7B 2NTTA 4CDDC 1XNRL 4B3TQ 1A6XA 4LF8Q 2W6ZA 4ZKCB 3IAYA 3SDZA 3I72A 5C4XG 4R4OA 1P16A 3A56A 4ZCKA 4YHHQ 2WACA 4UAIA 2BR0A 4Q8FA 2DLNA 1W3SA 2EYFA 5CB4F 1Y14B 2I0QA 3NP8A 4YR3A 1OXVA 1UEAB 2LKVA 1BCPC 1L2FA 3HZXA 1MKHA 4X3TA 2DZDA 5F9LA 1TAEA 4ZI7F 4KV6A 1ONLA 5LP6F 5LXTF 3N40P 4O3RA 1VQEA 4LH7A 4KHPQ 4JBWA 1UE6A 2FPPB 3OHXC 3FPPA 4I7AA 1GLVA 3CCQA 4IOAA 5DG7A 1EWHA 1SE8A 1HZ9A 1AUVA 1S5DD 1T36A 2WFWA 3J7A5 2V58A 2CHBD 3HOXB 2R93B 4R8NA 5EWEA 1C9OA 1B8AA 3AU7A 1PTOB 4LWCA 4KTAA 1AE2A 2R92G 3BA8A 4GN3B 3W2DA 2XCPA 3GTQA 3MZ5A 4JI8Q 2LXKA 1K9MC 5C4XB 2C2DA 4N8X1 1PFNA 3KF8A 3S17H 2HIXA 5DM63 5FLXW 4KD4A 2PI2A 4DV3H 4QWBA 1STNA 2B2UA 4DR2H 2F0PA 3FKIH 2HD3A 4JI0H 2Z4IA 1IKMA 1Y1VA 2RSOA 4MN3A 5IOCA 1DOKA 2JA7H 3CD6A 3F8TA 1RJRA 2R7NA 1KLGD 2CH4A 4XDXA 4WRDA 3QJYA 4R4CA 2WTFA 2YL2A 3PR5B 4QWAA 3HOUH 3RGXA 3BG3A 1O7ZA 3H0GG 4JI5H 1VF5C 2Z1CA 3J81c 3J7AF 3OOCA 4TRDA 3EFXD 3K7AH 1FD7D 2XRQD 5JEAJ 2R92B 3MAQA 4LFCH 4OIKA 3D4RA 2PPBC 4TV9F 4NPSA 1EY5A 5IYDH 1VQJA 3GTGH 3BU2A 1C0AA 3BDLA 1VQAA 4WD3A 2K5HA 3TRZA 1IW7D 2AQ4A 1VMPA 1LTRD 3D31A 4J15A 4R1JA 5IP9G 1XJVA 3Q2OA 1I4PA 1KL9A 2NVTH 4LSAA 2E2HB 4X65H 2NZOA 1Q82C 4FNFA 2E5LL 4DV6H 5JVDF 3E9HA 4HMIA 2MGSA 5IYZF 1PRTF 1F9PA 4JI3Q 4LF6Q 1V1PB 3H0GB 5BR8L 4I55F 1IKLA 4HJ8A 1LT4D 3P75A 2BH2A 5K5PA 4CDFC 3GTMH 2PVPA 4KI0A 1HNZQ 4I4TF 2OQ0A 1M6VA 4RAZA 4FP5D 1EY6A 2L11A 2YYAA 1JE5A 1OWTA 2K4KA 4IQZA 4DV7L 4CJ0B 1SR3A 1S40A 1MJEA 2RDIA 1XMOQ 3TSSA 2VUGA 5C5JA 3ULPA 5KG7A 3A7AB 1Q12A 4DL7A 3UDGA 4ED8A 4ME6A 3RGZA 2GLTA 3J81W 1D7QA 5JVLA 1KC8C 4DL6A 1L1OB 2HUGA 4J9OA 2XSCA 1G91A 4DAVA 4K14A 1EUCB 4QGUA 2L12A 3M4IA 1BUVT 5KG3A 1GJXA 3DHQA 5KFVA 2EYJA 2XWBB 5CV9A 4FU0A 1WCMA 2QEJC 1WTVA 5C4ZA 2K5NA 2DWCA 1EWIA 2XN9C 4IALA 4Z9CB 4Y52H 2KHIA 4EQPA 1CHQD 3BYYB 2R86A 5C4HA 5C0XI 1RDPD 4DV2Q 3SK6A 3N6RA 3R23A 4ECYA 4BA1I 1GGOA 3SK5A 5IWAL 5KFOA 3EQLC 1B3QA 5IP7G 2FLNA 1O80A 2ATWA 4DK0A 4F4XA 4Q5VA 2QDLA 3H20A 5D3DA 1EY7A 1JB7A 1IOWA 2YZNA 3NGDA 2AUKA 3ZJYC 3D0FA 3Q8RB 2IX3A 1O78A 3NEMA 1I3QB 4AIMA 4B3SQ 4ZQIA 2B2VC 3ULLA 1SEIA 4CKCA 1HQRD 2KJXA 1PZJD 3J80c 4AQYL 4TKOB 3R5FA 1S9FA 2FLLA 5ELCA 4UCVA 2XVSA 2YTVA 3SE0A 1WTXA 1MJCA 4P2CB 1Z2NX 4O4HF 4DUZQ 3RAXA 4HJ7A 3F2BA 1N33Q 4B3RH 4IOCA 2F4IA 1HA5A 3GTOH 1GSAA 4IURA 2IMWP 1Y1VG 3PUWA 1LTSD 3HOWH 4IRDA 1RYRA 1E1TA 4DFAA 3S15H 3S1RB 3U58A 3PIP3 2DNCA 4XQJA 5C3EG 1YJNA 3S1NH 3N6XA 2NUAB 3N8DA 4DK1A 2NB0A 2R85A 3T1YH 1WFQA 3NENA 4NLGA 1F2LA 3AQQA 5HV6A 1PLFA 2HCCA 4OO1G 1IZ6A 1Z6HA 2YZGA 4A3CG 1BXRA 4A3IG 3KHLA 2F0DA 4OXPA 4EG0A 2XNAC 4P71A 4JV5H 1E0BA 5LMNL 1DZ1A 1PH8A 4CJ1B 3VR5A 4O0AA 3GV5B 1TU2B 3KF8B 3M9BA 3K58A 1V4YA 2W9BA 3OMGA 1II3A 2Q8IB 3J80W 5JAVA 3E0EA 4F4WA 1KDAA 2K50A 1BKBA 5I6YA 4OWWB 5HGQA 4EBCA 5FJ8H 1FNUA 1SYXB 4BBRH 1VDZA 2AQ2B 5C3EB 2EVBA 4YWLA 3X3MA 3CRLC 2UXDH 1E22A 1STEA 2SDFA 4XYOA 2RCFA 4JYAL 2B2WA 1CSPA 1I4QA 4IUUA 3CHBD 2UXCL 4G3IA 3UDXA 1TWCA 2UUBH 5C0XJ 2CQOA 1IBKH 3BZCA 2ZM6H 4GKJH 1SN8A 1U4MA 5FO8B 2EY1A 4ED1A 2AWOA 3CPFA 4A3IB 4YY3L 2M00A 4OEMB 2E76C 5EJWA 4X66H 3TQYA 2AHOB 2QCPX 1NUCA 5J1ZA 4HEDA 1CZGA 4A3GG 1QCBD 4P72A 2WAQA 3PVXA 2HQLA 5CR3A 2I46A 4ILWA 4DR5L 4ED3A 3DM1A 3RLOA 1OXXK 3GO5A 3A74A 3TIGA 1BQQT 1RD9D 4B3TH 4LF8H 3KJPA 2OXPA 3DWAA 5M5WB 4YHHH 1EQQA 3DWQA 2DPIA 4KN4C 4DAMA 4MV9A 1WCMG 2PO4A 4NXML 4LNQA 2MNAA 4HNVA 4BY7H 4FXKC 3KHHA 4A3DH 2EYMA 4DF7A 3KAJA 3RTXA 1XWEA 3PW7A 1VQMA 2NVYH 1GUOA 3RUZA 4DV4Q 5E3FA 3Q22A 5H80A 1XPRA 4HR7A 3TQ1A 2VXWA 3W1GA 5KFAA 2EY2A 3K5HA 3CRKC 1JLLB 4A3GB 3H6MA 2FINB 5EQ0A 1Y69U 3EIVA 4FBUA 3NBHA 5KG2A 2LY7A 4IR9A 1EUJA 4JI1Q 4LF4L 1G6ZA 4UCUA 2KUMA 1KJJA 1JT8A 3VA5A 3PF5A 4JK1C 4FO2A 4JI8H 1WYDA 4R8IA 2JA5A 1EHIA 4MTNA 1JX4A 5KFQA 1WCMB 3NHHA 3VPCA 2A69D 4NKLA 5M3FG 2JA6H 3PZPA 1NJIC 2I07B 1KRTA 1PA6A 3ICEA 2FP4B 3DF7A 4LF5H 1U4LA 1Q90A 3I4LA 4L5RC 4G4KA 5DM73 2VR1A 1TY2A 4J9MA 3NPPA 4DV7Q 4UP7A 4O4LF 4A3MH 2OTJA 4QWCA 3NTKA 4RGOS 2Z0SA 1YNJC 3MXUA 1FL0A 4HJ9A 4YWMA 2LXJA 2E74C 3ULJA 3RR5A 3MWDA 4EYHB 1GUGA 4K8JA 2O03A 1LTTD 1Y1WH 5BMVF 4F4YA 1AW7A 4B3MH 1U5KA 3K5LA 4EBEA 5J39A 1HJPA 5CA1F 1SJED 1HR0L 4QWEA 5K36G 5JH7F 1BVSA 1CI3M 1HRJA 1Q3LA 1ENAA 1VQHA 3RZDH 2H1EA 4X64Q 3HEJA 2E75C 3K8AA 4PWQA 2N55A 4PV1C 2PMZB 3HKZA 2QA4A 5M3FB 2D9UA 2FMCA
chains in the Genus database with same CATH topology
4BY7G 1Z9FA 2ZTDA 2VY3A 4JI5L 5M3MH 2LSSA 4A3DG 2ZTEA 4ALPA 1GKHA 3G71A 2B29A 4LF5Q 2RHSB 3M4OH 3CCUA 4C3HH 2E2JH 1YITA 2JA5H 4BBSG 4A3LH 1I5FA 4JOIC 4LF7Q 4B3RQ 4LFCL 4DV1L 3HOXH 2R93H 4DR3Q 4BY1H 4QIWE 3TS2A 2JEAI 3FP9A 1L0WA 2K75A 3W1BA 1YBYA 4A4IA 1VQNA 4LW1A 3CC7A 2DUDA 4DKAC 3CCMA 1M1KC 1KQSA 5C4XH 3I56A 2ZJQA 1AH9A 4B3MQ 2PI2E 2PQAA 3S1MH 3H15A 2MO1A 4X65L 4DV6L 3T1YQ 5EAYA 1G6PA 4LF9L 1SLJA 1Q8KA 2VQEL 1XNQQ 1VQIA 4DV4L 1IYJB 2JA6G 1B70B 2WAQG 3S2HH 1TWGH 2A19A 4AH6A 1K8GA 3I4MG 3CQZH 2C35B 2UUCL 4DR1Q 3A0JA 4A3MG 4JV5Q 1RIPA 4LUVA 3KJOA 1L1OA 4KLKA 1AE3A 2MO0A 4LFBL 2I5HA 2IT1A 4A3FH 4YWKA 4JI1L 3UE0A 2VS1A 1Q1BA 1UEBA 1J5EL 1PH4A 2KCTA 2R7ZH 2I5MX 3HOZG 1E1OA 1TXYA 2KCMA 3CCSA 1IBMQ 1E3PA 1PHJA 4LUZA 3AYHB 2D0OA 2KENA 3E9IA 3CCJA 1Q46A 1UE5A 1VQFA 4PZ7A 1N32L 2GVBA 4JBKA 2XGTA 4POGA 2UXDQ 1HH2P 4JI7Q 5IYCH 3PIPA 1IBLL 2NVXH 2Q2IA 4LFAQ 2UU9Q 1C7YA 2OTLA 2A8VA 2UUBQ 1IBKQ 2N3SA 4HIOA 3OTOL 2ZM6Q 1SFOH 1PH2A 1CKMA 3ERSX 4IPDA 3TREA 4GKJQ 4OONA 2E2HH 4K0KL 1SROA 2F52A 1XMQQ 2HT1A 1S3OA 4X66Q 4HJ5A 3H0GH 5E7NA 2Z6KC 1ASZA 4A3IH 2QEXA 3PV0A 4A3CH 3M4QA 4JYAL 1A0IA 1XPOA 4X6AH 4DV0L 4DR4Q 4DAYB 4OWTB 5FLXc 3CXCA 2E5LQ 1Q81C 2JA5G 4A3LG 1KHIA 4GS3A 4DUYL 1N36L 3HOXG 2BA1A 3U50C 2R93G 1OXUA 1CKNB 4X64L 4BY1G 1NMGA 4JI2Q 2K52A 1FGUA 2D62A 4GLAC 3PSIA 4JOIA 2D0PA 3UDIA 5BR8Q 2AKWB 2VW9A 1KD1C 4B3TQ 1XNRL 3KFUA 2YTXA 4TQUS 4LF8Q 5GAGC 5C4XG 2JA8H 2EXDA 1P16A 1KRSA 4R4OA 5GAHC 3JAMc 4YHHQ 1P8LA 4GNXB 4HJAA 1VQOA 1W3SA 3G4SA 1E24A 1Y14B 2I0QA 4AYBE 3TEHB 5JJIA 4GOPB 1OXVA 1KAWA 1L2FA 3KDFB 5FLMG 3RNUA 1SMXA 4JI6Q 1MKHA 2DGYA 3K80C 2WP8J 1H95A 1M90C 4LF7L 4B3RL 3NBHB 3PO2H 1VQEA 3G48A 5GQOA 4DR3L 1JJCB 4KHPQ 4JBWA 1UE6A 2KBNA 1X3EA 1VQ9A 1VQ8A 3I55A 1A63A 3EBEA 2UUAL 3CCQA 3I4NH 4L5SA 4IOAA 4A3FG 1SE8A 1HZ9A 1YHQA 2CCZA 2GVAA 2YV5A 2WFWA 5JEAG 3J7A5 4PZ8A 3HKZG 1QVCA 1C9OA 1B8AA 4LWCA 2ZJPA 4OWXB 2Q2UA 3AFPA 3T1YL 3S2DH 2R92G 1AE2A 4GN3B 3F2CA 1D8LA 1UWVA 2JJQA 2LXKA 4JI8Q 3J81j 4A3KH 1K9MC 1XNQL 4UP8A 3STBC 1YEZA 2Y0SE 3S17H 2HIXA 3PO3H 5IYCG 1I3QH 2PI2A 1WI5A 5IWAQ 4DR1L 3FKIH 3PIOA 1Q1EA 1WJJA 1HNWQ 4JV5L 2OQKA 4QL5A 3WWVA 1OXSC 3KF6A 2IHEA 2JA7H 1NTGA 3F8TA 5IE8A 3CD6A 2PMZE 4DNIA 2UXBQ 4GNXC 4R4CA 4JI4Q 3PF4A 1EIYB 4HIKA 1BBWA 1IBML 1EOVA 3HOUH 3S14H 3Q8DA 3GTPH 4GOPC 1K83H 3H0GG 4HIDA 4AQYQ 1I6HH 3J81c 3UE1A 2JK8A 1N9WA 3M4PA 1W2BA 5HY6A 4DPGA 3K7AH 2Z6KA 4GKKQ 2UXDL 4JI7L 2CFMA 2HHHQ 2MQHA 5JEAJ 5IP7H 3S1RH 1OXTA 2F4VL 4LFAL 2UU9L 2UUBL 1IBKL 2ZM6L 4GKJL 4NPSA 4IO9A 2JA8G 5IYDH 1VQJA 3GTGH 3BU2A 4EQ5A 3K81C 4NXNQ 1TWHH 3KLWA 1C0AA 1VQAA 2K5HA 2YTYA 1YJWA 3TRZA 3CCEA 4X66L 5LMNW 2WB1G 4R4IA 4R1JA 3D31A 3PUZA 4J15A 5IP9G 1XJVA 1UE7A 1KL9A 2NVTH 4DR4L 2NZOA 1Q82C 2E5LL 3HOYH 4DR6Q 3E9HA 4RMFA 3PO2G 3GTQH 4LF6Q 4JI3Q 1VQDA 1HZBA 4JI2L 4P73A 4DK3C 5BR8L 1Y1WG 4HJ8A 4B3TL 1BBUA 3I4NG 2K5VA 2VQFQ 1A8VA 2BH2A 3GTMH 3RZOH 4KI0A 1HNZQ 4LF8L 2OQ0A 4BXXH 4YHHL 1Y1VH 2N8NA 3AFQA 3K7UC 5LMNQ 4RG1A 2CKZB 1JE5A 2K4KA 3KYHC 1S40A 4DV7L 1MJEA 1SR3A 4GN4B 3RN5A 3SGIA 2VUMH 1XMOQ 5C3EH 1I50H 1N8RC 3HOVH 4JI6L 3ULPA 4WJ3M 1HZCA 1Q12A 2OCEA 4A3KG 3UDGA 1X3GA 4AYBG 3I4OA 1PH5A 1D7QA 4A3JH 1KC8C 1L1OB 3H3VH 2OWOA 3PO3G 5M3MG 3PUVA 1U0LA 1VQ6A 3FKIG 3KOJA 1FJGL 1J6QA 1S72A 4QGUA 4JYAQ 1GO3E 4OX9Q 3GD7A 2JA7G 3A5ZB 4PG3A 2BA0A 2UXCQ 2FXQA 1X55A 2IX0A 2WAQE 3F2DA 3HOUG 2K5NA 1EWIA 2I5LX 4Y52H 2KHIA 2A1AA 4GLVB 4YY3Q 4JI8L 5C0XI 2B3GA 4DV2Q 4BBSH 3H3VI 3DM3A 1G291 3HFZB 4BA1I 2CWAA 2PNHA 3MXNB 4A75A 1HZAA 1T9HA 1VQ5A 5IWAL 5C4JH 2ALYB 4OO1I 1YNXA 5IP7G 3CCLA 4DV5Q 5M5WH 2ATWA 4LF5L 2JE6I 1HNWL 1YHBA 2Y0SG 4DR5Q 1RL2A 1JB7A 1E7ZA 1NE3A 4FDBA 1SRUA 3D0FA 3ZJYC 1Q7YC 1NMFA 5IYDG 3RN2A 1J5EQ 3I2ZA 4L5TA 2UXBL 3NEMA 1QUQA 4H02A 4AIMA 3GTKH 4JI4L 4DR7Q 3PUXA 1QZGA 4B3SQ 1EFWA 4YCVA 3ULLA 1PVOA 1A62A 3JC66 2NZHA 3GTJH 1JMCA 3J80c 4AQYL 1QVFA 2ZTCA 3STBD 1YIJA 4NXMQ 5IY0A 1MIUA 4XTCS 5DLQE 3HOYG 3S1QH 4GKKL 1TWFH 4B3ML 2YTVA 2R7ZG 2HHHL 3PGZA 1MJCA 1NY4A 4L5QA 4APVA 4A93H 4DUZQ 4A3GH 4HJ7A 2GN5A 3F2BA 1N33Q 4IOCA 2NN6I 3T1HQ 3AEVA 1Z47A 1R9TH 4XIGS 3GTOH 2JQOA 2IHFA 4UPAA 4BXXG 2H5XA 3JAMi 3B6YA 3HOZH 1Y1VG 3GDEA 3PUWA 4NXNL 1PH7A 3HOWH 1CUKA 1E1TA 3CF5A 5GADC 2YU9H 3S15H 3U58A 1HNXQ 2VUMG 3S1NH 1YJNA 2RCNA 5C3EG 1X65A 4Y7NH 1WCMH 2RF4A 2QGQA 4LF4Q 5C0XG 3M3YH 1YHAA 3K0XA 4A3JG 1WFQA 1PH6A 3NENA 2VNUD 1PV4A 3EN2A 3CPWA 3CCVA 3MEFA 4DR6L 5JJKA 1QVGA 3S24A 3AQQA 4LF6L 4JI3L 4EX5A 1GVPA 1N34Q 4OO1G 1YI2A 1IZ6A 4JG2A 4GN5A 4NB3A 5IYBH 2VQFL 4A3IG 4A3CG 1CKOA 4OXPA 1HNZL 2AWNA 3L7ZC 4A3BH 5AJ3Q 4P71A 2N49A 5M5YH 5LMUQ 1PH3A 1HR0W 5LMNL 2NVQH 1PH8A 4YCUA 4O0AA 4IPHA 2N78A 3KF8B 3M9BA 1XMOL 4BA2I 3NELA 1K0RA 1PH9A 1VQBA 2E8GA 1PYSB 1X6OA 3E0EA 4IFDI 2K50A 4OWWB 1BKBA 3BJUA 4P75A 4JC0A 5HGQA 1XMQL 3KF6B 3CAMA 3DLLA 5FJ8H 5C44H 4BBRH 1LYLA 3HKZE 4PZ6A 4YWLA 2MFIA 4DK6C 2UUAQ 1E22A 4DV3Q 2NN6G 4X62Q 5M3FH 4C3JH 4DR2Q 1HR0Q 4OX9L 1K3RA 1GM5A 4JI0Q 1CSPA 2BH8A 2B63H 3OYYA 4O2DA 3TS0A 1IXRA 2UXCL 3UDXA 1LTLA 1NBWA 3PCOB 2CQOA 2JA9A 5C0XJ 3BZCA 1VQ4A 1EQRA 1X9NA 4POFA 4KHZA 1EYGA 1SN8A 1YJ9A 4HIMA 5FLMH 2Q2HA 4MNOA 2AWOA 2VL6A 2PQAB 3CPFA 3J81i 1JJ2A 1I94Q 1GD7A 4YY3L 3RLNA 4DV2L 4JBJA 4P74A 1XTDA 4A3EH 3TQYA 2JEBI 4JI5Q 2AHOB 2HIVA 4IPGA 1WOCA 4C2MH 4GLXA 2F3IA 2E2IH 4A93G 1EIFA 4A3GG 4IJHA 4P72A 3U4VA 4DV5L 3IRBA 1K8AC 1XPUA 3CMEA 2HQLA 2ES2A 3U4ZA 4DR5L 3LGJA 3RLOA 1OXXK 5IT9c 3GO5A 1O7IA 3A74A 1PH1A 3ER0A 4YCWA 4DV1Q 2VZAA 4LFCQ 1K73C 1X56A 5ELOA 3HOWG 4DR7L 4R4QA 3VDYA 4B3SL 3KJPA 4R4TA 5GAEC 4KHPL 3A5UA 1VS0A 4TVAB 2R92H 1EQQA 3CCRA 4JBMA 4PMWA 4DAMA 1WCMG 5GROA 1X3FA 1CKNA 4IJLA 4UP9A 4LNQA 4NXML 5J3BA 3UDFA 2MNAA 4BY7H 4IFDG 4A3DH 2R7DA 2CWPA 2XTIA 1OTCA 4X65Q 4DUZL 2NVYH 4DV6Q 1VQMA 2F4VQ 4WJ4A 4GNXA 1N33L 4LF9Q 4MZ9A 5IYBG 1YZ6A 2VQEQ 3T1HL 2ZJRA 4DV4Q 3M7NA 1TWAH 2WB1E 1XPRA 4UY8C 1JJGA 2R6GA 3FHWA 3W1GA 4GOPA 4A3BG 5M5XH 3KDFA 2UUCQ 3M85A 1LM0A 3GTLH 1HNXL 3J7ZC 1UE1A 2Q2TA 4QY7A 3EIVA 2IY5B 5JJLA 1CSQA 1TWCH 4LFBQ 1VCIA 2EIFA 1EUJA 4JI1Q 4LF4L 1JT8A 3G6EA 1VQGA 3PF5A 3CMAA 1IL2A 4JCVE 1WYDA 5FJ8G 4QQBX 5C44G 2ID0A 4ME3A 4BBRG 1N34L 2ASBA 4MTNA 2YYZA 1LUZA 3W5OA 3CW2C 1N32Q 5M3FG 2JA6H 4QJFA 1V43A 1KRTA 1PA6A 1NJIC 2B63G 3ICEA 1X54A 5AJ3L 3CC4A 5LMUL 1ASYA 4L5RC 3I4MH 3PUYA 3CC2A 1IBLQ 1L1OC 4DV7Q 2L15A 4UP7A 1FVIA 4IFDJ 1KXLA 4A3MH 1B7YB 3S16H 2OTJA 2Z0SA 5IP9H 1VQPA 1FL0A 4IPCA 1PFSA 1VQCA 3L0OA 3OTOQ 4YWMA 4C3IH 3RLFA 4HJ9A 2IX1A 2LXJA 3BZKA 3ULJA 4A3EG 1VQKA 4K0KQ 3RR5A 1DGSA 1VQLA 2R7FA 3CP0A 5H1SE 1Y1WH 1FJGQ 1QUQB 2K14A 1U5KA 1VQ7A 2RHQB 2V1CC 4DV3L 1HJPA 4A76A 4X62L 4DV0Q 1QZHA 4DR2L 1HR0L 3HOVG 5K36G 4JI0L 2EQSA 1YVCA 1BVSA 4DUYQ 1N36Q 1V1QA 1VQHA 3L2PA 3RZDH 4LUOA 4X64Q 1KIXA 1G51A 2AMCB 3K8AA 3HKSA 1XNRQ 3J80i 5ELNA 2KHJA 2QA4A 3OW2A 3F1ZA 1I94L 1V9PA 1PYBA 3I7FA 1Q86C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 G;  1Z9F A;  2ZTD A;  2VY3 A;  4JI5 L;  5M3M H;  2LSS A;  4A3D G;  2ZTE A;  4ALP A;  1GKH A;  3G71 A;  2B29 A;  4LF5 Q;  2RHS B;  3M4O H;  3CCU A;  4C3H H;  2E2J H;  1YIT A;  2JA5 H;  4BBS G;  4A3L H;  1I5F A;  4JOI C;  4LF7 Q;  4B3R Q;  4LFC L;  4DV1 L;  3HOX H;  2R93 H;  4DR3 Q;  4BY1 H;  4QIW E;  3TS2 A;  2JEA I;  3FP9 A;  1L0W A;  2K75 A;  3W1B A;  1YBY A;  4A4I A;  1VQN A;  4LW1 A;  3CC7 A;  2DUD A;  4DKA C;  3CCM A;  1M1K C;  1KQS A;  5C4X H;  3I56 A;  2ZJQ A;  1AH9 A;  4B3M Q;  2PI2 E;  2PQA A;  3S1M H;  3H15 A;  2MO1 A;  4X65 L;  4DV6 L;  3T1Y Q;  5EAY A;  1G6P A;  4LF9 L;  1SLJ A;  1Q8K A;  2VQE L;  1XNQ Q;  1VQI A;  4DV4 L;  1IYJ B;  2JA6 G;  1B70 B;  2WAQ G;  3S2H H;  1TWG H;  2A19 A;  4AH6 A;  1K8G A;  3I4M G;  3CQZ H;  2C35 B;  2UUC L;  4DR1 Q;  3A0J A;  4A3M G;  4JV5 Q;  1RIP A;  4LUV A;  3KJO A;  1L1O A;  4KLK A;  1AE3 A;  2MO0 A;  4LFB L;  2I5H A;  2IT1 A;  4A3F H;  4YWK A;  4JI1 L;  3UE0 A;  2VS1 A;  1Q1B A;  1UEB A;  1J5E L;  1PH4 A;  2KCT A;  2R7Z H;  2I5M X;  3HOZ G;  1E1O A;  1TXY A;  2KCM A;  3CCS A;  1IBM Q;  1E3P A;  1PHJ A;  4LUZ A;  3AYH B;  2D0O A;  2KEN A;  3E9I A;  3CCJ A;  1Q46 A;  1UE5 A;  1VQF A;  4PZ7 A;  1N32 L;  2GVB A;  4JBK A;  2XGT A;  4POG A;  2UXD Q;  1HH2 P;  4JI7 Q;  5IYC H;  3PIP A;  1IBL L;  2NVX H;  2Q2I A;  4LFA Q;  2UU9 Q;  1C7Y A;  2OTL A;  2A8V A;  2UUB Q;  1IBK Q;  2N3S A;  4HIO A;  3OTO L;  2ZM6 Q;  1SFO H;  1PH2 A;  1CKM A;  3ERS X;  4IPD A;  3TRE A;  4GKJ Q;  4OON A;  2E2H H;  4K0K L;  1SRO A;  2F52 A;  1XMQ Q;  2HT1 A;  1S3O A;  4X66 Q;  4HJ5 A;  3H0G H;  5E7N A;  2Z6K C;  1ASZ A;  4A3I H;  2QEX A;  3PV0 A;  4A3C H;  3M4Q A;  4JYA L;  1A0I A;  1XPO A;  4X6A H;  4DV0 L;  4DR4 Q;  4DAY B;  4OWT B;  5FLX c;  3CXC A;  2E5L Q;  1Q81 C;  2JA5 G;  4A3L G;  1KHI A;  4GS3 A;  4DUY L;  1N36 L;  3HOX G;  2BA1 A;  3U50 C;  2R93 G;  1OXU A;  1CKN B;  4X64 L;  4BY1 G;  1NMG A;  4JI2 Q;  2K52 A;  1FGU A;  2D62 A;  4GLA C;  3PSI A;  4JOI A;  2D0P A;  3UDI A;  5BR8 Q;  2AKW B;  2VW9 A;  1KD1 C;  4B3T Q;  1XNR L;  3KFU A;  2YTX A;  4TQU S;  4LF8 Q;  5GAG C;  5C4X G;  2JA8 H;  2EXD A;  1P16 A;  1KRS A;  4R4O A;  5GAH C;  3JAM c;  4YHH Q;  1P8L A;  4GNX B;  4HJA A;  1VQO A;  1W3S A;  3G4S A;  1E24 A;  1Y14 B;  2I0Q A;  4AYB E;  3TEH B;  5JJI A;  4GOP B;  1OXV A;  1KAW A;  1L2F A;  3KDF B;  5FLM G;  3RNU A;  1SMX A;  4JI6 Q;  1MKH A;  2DGY A;  3K80 C;  2WP8 J;  1H95 A;  1M90 C;  4LF7 L;  4B3R L;  3NBH B;  3PO2 H;  1VQE A;  3G48 A;  5GQO A;  4DR3 L;  1JJC B;  4KHP Q;  4JBW A;  1UE6 A;  2KBN A;  1X3E A;  1VQ9 A;  1VQ8 A;  3I55 A;  1A63 A;  3EBE A;  2UUA L;  3CCQ A;  3I4N H;  4L5S A;  4IOA A;  4A3F G;  1SE8 A;  1HZ9 A;  1YHQ A;  2CCZ A;  2GVA A;  2YV5 A;  2WFW A;  5JEA G;  3J7A 5;  4PZ8 A;  3HKZ G;  1QVC A;  1C9O A;  1B8A A;  4LWC A;  2ZJP A;  4OWX B;  2Q2U A;  3AFP A;  3T1Y L;  3S2D H;  2R92 G;  1AE2 A;  4GN3 B;  3F2C A;  1D8L A;  1UWV A;  2JJQ A;  2LXK A;  4JI8 Q;  3J81 j;  4A3K H;  1K9M C;  1XNQ L;  4UP8 A;  3STB C;  1YEZ A;  2Y0S E;  3S17 H;  2HIX A;  3PO3 H;  5IYC G;  1I3Q H;  2PI2 A;  1WI5 A;  5IWA Q;  4DR1 L;  3FKI H;  3PIO A;  1Q1E A;  1WJJ A;  1HNW Q;  4JV5 L;  2OQK A;  4QL5 A;  3WWV A;  1OXS C;  3KF6 A;  2IHE A;  2JA7 H;  1NTG A;  3F8T A;  5IE8 A;  3CD6 A;  2PMZ E;  4DNI A;  2UXB Q;  4GNX C;  4R4C A;  4JI4 Q;  3PF4 A;  1EIY B;  4HIK A;  1BBW A;  1IBM L;  1EOV A;  3HOU H;  3S14 H;  3Q8D A;  3GTP H;  4GOP C;  1K83 H;  3H0G G;  4HID A;  4AQY Q;  1I6H H;  3J81 c;  3UE1 A;  2JK8 A;  1N9W A;  3M4P A;  1W2B A;  5HY6 A;  4DPG A;  3K7A H;  2Z6K A;  4GKK Q;  2UXD L;  4JI7 L;  2CFM A;  2HHH Q;  2MQH A;  5JEA J;  5IP7 H;  3S1R H;  1OXT A;  2F4V L;  4LFA L;  2UU9 L;  2UUB L;  1IBK L;  2ZM6 L;  4GKJ L;  4NPS A;  4IO9 A;  2JA8 G;  5IYD H;  1VQJ A;  3GTG H;  3BU2 A;  4EQ5 A;  3K81 C;  4NXN Q;  1TWH H;  3KLW A;  1C0A A;  1VQA A;  2K5H A;  2YTY A;  1YJW A;  3TRZ A;  3CCE A;  4X66 L;  5LMN W;  2WB1 G;  4R4I A;  4R1J A;  3D31 A;  3PUZ A;  4J15 A;  5IP9 G;  1XJV A;  1UE7 A;  1KL9 A;  2NVT H;  4DR4 L;  2NZO A;  1Q82 C;  2E5L L;  3HOY H;  4DR6 Q;  3E9H A;  4RMF A;  3PO2 G;  3GTQ H;  4LF6 Q;  4JI3 Q;  1VQD A;  1HZB A;  4JI2 L;  4P73 A;  4DK3 C;  5BR8 L;  1Y1W G;  4HJ8 A;  4B3T L;  1BBU A;  3I4N G;  2K5V A;  2VQF Q;  1A8V A;  2BH2 A;  3GTM H;  3RZO H;  4KI0 A;  1HNZ Q;  4LF8 L;  2OQ0 A;  4BXX H;  4YHH L;  1Y1V H;  2N8N A;  3AFQ A;  3K7U C;  5LMN Q;  4RG1 A;  2CKZ B;  1JE5 A;  2K4K A;  3KYH C;  1S40 A;  4DV7 L;  1MJE A;  1SR3 A;  4GN4 B;  3RN5 A;  3SGI A;  2VUM H;  1XMO Q;  5C3E H;  1I50 H;  1N8R C;  3HOV H;  4JI6 L;  3ULP A;  4WJ3 M;  1HZC A;  1Q12 A;  2OCE A;  4A3K G;  3UDG A;  1X3G A;  4AYB G;  3I4O A;  1PH5 A;  1D7Q A;  4A3J H;  1KC8 C;  1L1O B;  3H3V H;  2OWO A;  3PO3 G;  5M3M G;  3PUV A;  1U0L A;  1VQ6 A;  3FKI G;  3KOJ A;  1FJG L;  1J6Q A;  1S72 A;  4QGU A;  4JYA Q;  1GO3 E;  4OX9 Q;  3GD7 A;  2JA7 G;  3A5Z B;  4PG3 A;  2BA0 A;  2UXC Q;  2FXQ A;  1X55 A;  2IX0 A;  2WAQ E;  3F2D A;  3HOU G;  2K5N A;  1EWI A;  2I5L X;  4Y52 H;  2KHI A;  2A1A A;  4GLV B;  4YY3 Q;  4JI8 L;  5C0X I;  2B3G A;  4DV2 Q;  4BBS H;  3H3V I;  3DM3 A;  1G29 1;  3HFZ B;  4BA1 I;  2CWA A;  2PNH A;  3MXN B;  4A75 A;  1HZA A;  1T9H A;  1VQ5 A;  5IWA L;  5C4J H;  2ALY B;  4OO1 I;  1YNX A;  5IP7 G;  3CCL A;  4DV5 Q;  5M5W H;  2ATW A;  4LF5 L;  2JE6 I;  1HNW L;  1YHB A;  2Y0S G;  4DR5 Q;  1RL2 A;  1JB7 A;  1E7Z A;  1NE3 A;  4FDB A;  1SRU A;  3D0F A;  3ZJY C;  1Q7Y C;  1NMF A;  5IYD G;  3RN2 A;  1J5E Q;  3I2Z A;  4L5T A;  2UXB L;  3NEM A;  1QUQ A;  4H02 A;  4AIM A;  3GTK H;  4JI4 L;  4DR7 Q;  3PUX A;  1QZG A;  4B3S Q;  1EFW A;  4YCV A;  3ULL A;  1PVO A;  1A62 A;  3JC6 6;  2NZH A;  3GTJ H;  1JMC A;  3J80 c;  4AQY L;  1QVF A;  2ZTC A;  3STB D;  1YIJ A;  4NXM Q;  5IY0 A;  1MIU A;  4XTC S;  5DLQ E;  3HOY G;  3S1Q H;  4GKK L;  1TWF H;  4B3M L;  2YTV A;  2R7Z G;  2HHH L;  3PGZ A;  1MJC A;  1NY4 A;  4L5Q A;  4APV A;  4A93 H;  4DUZ Q;  4A3G H;  4HJ7 A;  2GN5 A;  3F2B A;  1N33 Q;  4IOC A;  2NN6 I;  3T1H Q;  3AEV A;  1Z47 A;  1R9T H;  4XIG S;  3GTO H;  2JQO A;  2IHF A;  4UPA A;  4BXX G;  2H5X A;  3JAM i;  3B6Y A;  3HOZ H;  1Y1V G;  3GDE A;  3PUW A;  4NXN L;  1PH7 A;  3HOW H;  1CUK A;  1E1T A;  3CF5 A;  5GAD C;  2YU9 H;  3S15 H;  3U58 A;  1HNX Q;  2VUM G;  3S1N H;  1YJN A;  2RCN A;  5C3E G;  1X65 A;  4Y7N H;  1WCM H;  2RF4 A;  2QGQ A;  4LF4 Q;  5C0X G;  3M3Y H;  1YHA A;  3K0X A;  4A3J G;  1WFQ A;  1PH6 A;  3NEN A;  2VNU D;  1PV4 A;  3EN2 A;  3CPW A;  3CCV A;  3MEF A;  4DR6 L;  5JJK A;  1QVG A;  3S24 A;  3AQQ A;  4LF6 L;  4JI3 L;  4EX5 A;  1GVP A;  1N34 Q;  4OO1 G;  1YI2 A;  1IZ6 A;  4JG2 A;  4GN5 A;  4NB3 A;  5IYB H;  2VQF L;  4A3I G;  4A3C G;  1CKO A;  4OXP A;  1HNZ L;  2AWN A;  3L7Z C;  4A3B H;  5AJ3 Q;  4P71 A;  2N49 A;  5M5Y H;  5LMU Q;  1PH3 A;  1HR0 W;  5LMN L;  2NVQ H;  1PH8 A;  4YCU A;  4O0A A;  4IPH A;  2N78 A;  3KF8 B;  3M9B A;  1XMO L;  4BA2 I;  3NEL A;  1K0R A;  1PH9 A;  1VQB A;  2E8G A;  1PYS B;  1X6O A;  3E0E A;  4IFD I;  2K50 A;  4OWW B;  1BKB A;  3BJU A;  4P75 A;  4JC0 A;  5HGQ A;  1XMQ L;  3KF6 B;  3CAM A;  3DLL A;  5FJ8 H;  5C44 H;  4BBR H;  1LYL A;  3HKZ E;  4PZ6 A;  4YWL A;  2MFI A;  4DK6 C;  2UUA Q;  1E22 A;  4DV3 Q;  2NN6 G;  4X62 Q;  5M3F H;  4C3J H;  4DR2 Q;  1HR0 Q;  4OX9 L;  1K3R A;  1GM5 A;  4JI0 Q;  1CSP A;  2BH8 A;  2B63 H;  3OYY A;  4O2D A;  3TS0 A;  1IXR A;  2UXC L;  3UDX A;  1LTL A;  1NBW A;  3PCO B;  2CQO A;  2JA9 A;  5C0X J;  3BZC A;  1VQ4 A;  1EQR A;  1X9N A;  4POF A;  4KHZ A;  1EYG A;  1SN8 A;  1YJ9 A;  4HIM A;  5FLM H;  2Q2H A;  4MNO A;  2AWO A;  2VL6 A;  2PQA B;  3CPF A;  3J81 i;  1JJ2 A;  1I94 Q;  1GD7 A;  4YY3 L;  3RLN A;  4DV2 L;  4JBJ A;  4P74 A;  1XTD A;  4A3E H;  3TQY A;  2JEB I;  4JI5 Q;  2AHO B;  2HIV A;  4IPG A;  1WOC A;  4C2M H;  4GLX A;  2F3I A;  2E2I H;  4A93 G;  1EIF A;  4A3G G;  4IJH A;  4P72 A;  3U4V A;  4DV5 L;  3IRB A;  1K8A C;  1XPU A;  3CME A;  2HQL A;  2ES2 A;  3U4Z A;  4DR5 L;  3LGJ A;  3RLO A;  1OXX K;  5IT9 c;  3GO5 A;  1O7I A;  3A74 A;  1PH1 A;  3ER0 A;  4YCW A;  4DV1 Q;  2VZA A;  4LFC Q;  1K73 C;  1X56 A;  5ELO A;  3HOW G;  4DR7 L;  4R4Q A;  3VDY A;  4B3S L;  3KJP A;  4R4T A;  5GAE C;  4KHP L;  3A5U A;  1VS0 A;  4TVA B;  2R92 H;  1EQQ A;  3CCR A;  4JBM A;  4PMW A;  4DAM A;  1WCM G;  5GRO A;  1X3F A;  1CKN A;  4IJL A;  4UP9 A;  4LNQ A;  4NXM L;  5J3B A;  3UDF A;  2MNA A;  4BY7 H;  4IFD G;  4A3D H;  2R7D A;  2CWP A;  2XTI A;  1OTC A;  4X65 Q;  4DUZ L;  2NVY H;  4DV6 Q;  1VQM A;  2F4V Q;  4WJ4 A;  4GNX A;  1N33 L;  4LF9 Q;  4MZ9 A;  5IYB G;  1YZ6 A;  2VQE Q;  3T1H L;  2ZJR A;  4DV4 Q;  3M7N A;  1TWA H;  2WB1 E;  1XPR A;  4UY8 C;  1JJG A;  2R6G A;  3FHW A;  3W1G A;  4GOP A;  4A3B G;  5M5X H;  3KDF A;  2UUC Q;  3M85 A;  1LM0 A;  3GTL H;  1HNX L;  3J7Z C;  1UE1 A;  2Q2T A;  4QY7 A;  3EIV A;  2IY5 B;  5JJL A;  1CSQ A;  1TWC H;  4LFB Q;  1VCI A;  2EIF A;  1EUJ A;  4JI1 Q;  4LF4 L;  1JT8 A;  3G6E A;  1VQG A;  3PF5 A;  3CMA A;  1IL2 A;  4JCV E;  1WYD A;  5FJ8 G;  4QQB X;  5C44 G;  2ID0 A;  4ME3 A;  4BBR G;  1N34 L;  2ASB A;  4MTN A;  2YYZ A;  1LUZ A;  3W5O A;  3CW2 C;  1N32 Q;  5M3F G;  2JA6 H;  4QJF A;  1V43 A;  1KRT A;  1PA6 A;  1NJI C;  2B63 G;  3ICE A;  1X54 A;  5AJ3 L;  3CC4 A;  5LMU L;  1ASY A;  4L5R C;  3I4M H;  3PUY A;  3CC2 A;  1IBL Q;  1L1O C;  4DV7 Q;  2L15 A;  4UP7 A;  1FVI A;  4IFD J;  1KXL A;  4A3M H;  1B7Y B;  3S16 H;  2OTJ A;  2Z0S A;  5IP9 H;  1VQP A;  1FL0 A;  4IPC A;  1PFS A;  1VQC A;  3L0O A;  3OTO Q;  4YWM A;  4C3I H;  3RLF A;  4HJ9 A;  2IX1 A;  2LXJ A;  3BZK A;  3ULJ A;  4A3E G;  1VQK A;  4K0K Q;  3RR5 A;  1DGS A;  1VQL A;  2R7F A;  3CP0 A;  5H1S E;  1Y1W H;  1FJG Q;  1QUQ B;  2K14 A;  1U5K A;  1VQ7 A;  2RHQ B;  2V1C C;  4DV3 L;  1HJP A;  4A76 A;  4X62 L;  4DV0 Q;  1QZH A;  4DR2 L;  1HR0 L;  3HOV G;  5K36 G;  4JI0 L;  2EQS A;  1YVC A;  1BVS A;  4DUY Q;  1N36 Q;  1V1Q A;  1VQH A;  3L2P A;  3RZD H;  4LUO A;  4X64 Q;  1KIX A;  1G51 A;  2AMC B;  3K8A A;  3HKS A;  1XNR Q;  3J80 i;  5ELN A;  2KHJ A;  2QA4 A;  3OW2 A;  3F1Z A;  1I94 L;  1V9P A;  1PYB A;  3I7F A;  1Q86 C; 
#chains in the Genus database with same CATH topology
 1TVX A;  3NWT A;  2ZTD A;  4RCN A;  2VY3 A;  2A5H A;  1RJP A;  2V5A A;  1DON A;  2ZTE A;  3VYU A;  3DEP A;  4ALP A;  3KLS A;  2G9H D;  2HCI A;  2OF1 A;  2NVX A;  4LF6 H;  4JI3 H;  2DNE A;  2E2J H;  3OSP A;  2M9V A;  1BOS A;  4DV1 L;  3HOX H;  2R93 H;  3EJI A;  4DR3 Q;  1HNZ H;  2W7P A;  1PTO H;  2JEA I;  3X3N A;  3FP9 A;  1L0W A;  2R6F A;  4DL5 A;  2N88 A;  1YBY A;  4A4I A;  4CBV A;  1M1K C;  4QW9 A;  1STY A;  5C4X H;  3I56 A;  3C46 A;  4KD3 A;  5DG9 A;  1XMO H;  3K5N A;  4RNM A;  3H15 A;  5JUM A;  3NUC A;  4UCO A;  2EE1 A;  4L63 B;  3BAB A;  1BCP F;  1B6R A;  1Q8K A;  1VQI A;  2A74 C;  4CDE C;  2WAQ G;  1PDQ A;  3I4M G;  2W9B B;  2EYL A;  2V9W A;  1B53 A;  1TS4 A;  2F0G A;  1WTP A;  2IWH A;  3SK4 A;  1HA6 A;  4J9L A;  3JSL A;  3KJO A;  1O7L A;  1AE3 A;  4C3I G;  3UE0 A;  1J5E L;  2WB1 A;  3L4K A;  5M5X B;  4ECZ A;  1E1O A;  3TP7 A;  4PMC A;  4DV2 H;  1PHJ A;  3E9I A;  3CCJ A;  1Q46 A;  2VB3 X;  1VQF A;  2DIK A;  4TUY F;  2GVB A;  4JBK A;  2F0M A;  2RVL A;  4OGQ C;  2V4Q A;  4JI7 Q;  4XYQ A;  1IBL L;  2ASD A;  2FFK B;  3GIM A;  3MR3 A;  2X6G A;  4H44 C;  1C7Y A;  3MXN A;  2OTL A;  2A8V A;  1F9R A;  3NSW A;  4HMJ A;  5KFD A;  3OTO L;  1PH2 A;  2BQ3 A;  2WAQ B;  1CKM A;  4B3S H;  4OON A;  2E2H H;  3I4M B;  4K0K L;  2F52 A;  4J9Q A;  2EJF C;  2WII B;  1I7N A;  3MR5 A;  1VAJ A;  4TQS A;  1EY0 A;  3H0G H;  4JPB W;  2AQ1 B;  1F2Z A;  1EQT A;  1ZYR C;  3PV0 A;  2QEX A;  4C3I B;  2ZJT A;  4DV0 L;  4DUZ H;  4OWT B;  2JA5 G;  4A3L G;  1Q81 C;  1I4X A;  1N33 H;  2F03 A;  2F0Q A;  3OUZ A;  1AUX A;  3LX0 A;  3U50 C;  5DQG A;  3L9A X;  4UDU C;  1NMG A;  4GLA C;  1HHV A;  3FEW X;  1ZET A;  3S1N B;  1F2Y A;  3T4A C;  5A2Q W;  3E0J A;  4CDC C;  1KJ8 A;  5CV8 A;  4L1K A;  1KTK A;  1KRS A;  1T5E A;  2GA4 B;  5GAH C;  3JAM c;  1P8L A;  1K83 A;  2EYP A;  1H9S A;  1E24 A;  1K28 A;  2MHV A;  3TEH B;  5JJI A;  1I7L A;  2B2W C;  1B3A A;  1V8Q A;  1UUP A;  4B08 A;  4JI6 Q;  1S4Z A;  5KFP A;  1CM9 A;  4LF7 L;  1TII D;  3NBH B;  4QMG A;  4V0B A;  1RTO A;  1JJC B;  3K3V A;  4MTD A;  3SXH A;  1VQ8 A;  3I55 A;  2UUA L;  1TWH A;  3RF2 A;  4A3F G;  4K2K A;  2W8L A;  2JA5 B;  4KN7 C;  2CCZ A;  2GVA A;  4MV8 A;  4KJO A;  5DLF A;  3ERO A;  3HKZ G;  1LTB D;  4MAM A;  3AFP A;  2FKL A;  1RJQ A;  2WKD A;  1XNQ L;  5TSS A;  2OEO A;  4YR2 A;  3LWB A;  3LNN A;  2B2Y C;  4C5A A;  3PW5 A;  1I3Q H;  2FJZ A;  1WI5 A;  4HYK A;  1SMY D;  1C30 A;  1ZKO A;  4DR1 L;  1WH2 A;  2J6U A;  1ILQ A;  1HNW Q;  4IRK A;  1X3P A;  2Q8T A;  4MV1 A;  2IHE A;  2EYH A;  3S2H B;  5IE8 A;  1EUD B;  4DNR B;  3WNZ A;  1D5M C;  1DV2 A;  2A6E C;  1J8I A;  3PF4 A;  3PW2 A;  3JAM W;  2BE5 D;  3QO2 A;  1EIY B;  1IBM L;  3OSO A;  1EOV A;  2R7L A;  2W9C B;  3Q8D A;  2EXZ A;  2QDB A;  3RBE A;  2K05 A;  1UNN C;  4A3F B;  3UE1 A;  2ZDQ A;  4DPG A;  3K57 A;  2O2L D;  3OIQ A;  3HKZ B;  2HHH Q;  3KAL A;  2FLP A;  3RJ0 A;  2MQH A;  5IP7 H;  3LWU A;  5KIX A;  3S1R H;  1ILP A;  4LFA L;  4I7Z C;  5KT5 A;  2UU9 L;  1PXU A;  3GV8 B;  1MSG A;  3TDQ A;  2JA8 G;  4J9R A;  3K81 C;  1MBY A;  2CVR A;  2NVX B;  4FS1 A;  1BDO A;  2KSW A;  2YTY A;  1YJW A;  2WB1 G;  3BVZ A;  3H4B A;  4F50 A;  2KCN A;  2K32 A;  1VKZ A;  2PBZ A;  2PZW A;  4Y8V B;  1HPC A;  4DR4 L;  3KBG A;  1V51 A;  4KY7 A;  3GTQ H;  1HTP A;  4DV4 H;  1HZB A;  1XYI A;  4JI2 L;  2XGQ A;  3GV6 A;  3U9S A;  1TS3 A;  4V19 0;  1Y1W G;  3I91 A;  2VQF Q;  4RUA A;  3AB9 A;  2M05 A;  1RHP A;  3ZYY X;  3GTJ A;  1Y1V H;  4MHE A;  2N8N A;  4RG1 A;  2KVM A;  1K1S A;  5DQH A;  4JI1 H;  4ZAI A;  4R9W A;  5LOV F;  3G6Y A;  5KX5 F;  1TR5 A;  3RN5 A;  5C3E H;  1JQY D;  1MSH A;  5I4D A;  1R4Q B;  3HOV H;  3DEO A;  2TSS A;  1HZC A;  2OCE A;  4F87 A;  4RKB A;  4PNY A;  1L0X B;  4RAY A;  3RAQ A;  2PW5 A;  2R7K A;  2K5Q A;  2FK1 A;  3H3V H;  3PO3 G;  4LMY A;  3ND8 A;  2K1B A;  2WB1 B;  1FJG L;  4OO1 H;  1J6Q A;  4RB1 A;  4PG3 A;  5D3I B;  2FXQ A;  5T1I A;  3MFG A;  4XT1 B;  2DN8 A;  2BDN A;  3OW7 A;  5KGU A;  4ED7 A;  2F0F A;  2I5L X;  2XIW A;  1MD2 D;  1Y1W B;  4JV2 A;  4ABN A;  1GHJ A;  3KXY T;  5DEH A;  2VOB A;  2B3G A;  3GLK A;  5KFH A;  4J1M A;  3H3V I;  2FK2 A;  1G29 1;  3HFZ B;  1GUW A;  3H4D A;  2PNH A;  3MXN B;  1GSO A;  1EWC A;  3RZD B;  1T9H A;  3FMC A;  2KEE A;  1YNX A;  4OO1 I;  2RGR A;  3CCL A;  4DV5 Q;  5M5W H;  1ZEQ X;  1YHB A;  3HP3 A;  1VMC A;  2ICI A;  1E7Z A;  2MP1 A;  4DAP A;  4MV3 A;  2R7M A;  4X64 H;  3H09 A;  4FDB A;  1J5E Q;  5A35 A;  2ZXO A;  1NMF A;  4A2A A;  3I2Z A;  3PO3 B;  2UXB L;  4IWY A;  2DJG C;  1GXD C;  4DR7 Q;  4JI4 L;  4HSP A;  2F3V A;  2CW0 D;  5I9O A;  1ROD A;  3K6O A;  2NUC A;  3JC6 6;  2NZH A;  2SNM A;  1JMC A;  4IRC A;  1HQM C;  2ZTC A;  3STB D;  1YIJ A;  3OWE B;  5FLX L;  2E2J B;  4XTC S;  3KLS X;  3HOY G;  4GKK L;  3FDT A;  3FRP B;  4L5Q A;  3NTH A;  4A3G H;  1K83 B;  2G5D A;  1H9S B;  1Z47 A;  4DR3 H;  4Q43 A;  4O42 A;  2IHF A;  4UPA A;  2B2T A;  4NXN L;  1CUK A;  5DLG A;  1DOL A;  4RGM A;  4WFN 3;  1HNX Q;  2NU6 B;  2R8G A;  2E2I A;  4C5C A;  1WCM H;  2RF4 A;  2QGQ A;  2R3Z A;  4A2B A;  3MWE A;  2L9H A;  2XWJ B;  3K0X A;  1TWH B;  4DR6 L;  3EN2 A;  5JJK A;  3S24 A;  5CA0 F;  4EX5 A;  1JCK B;  1N34 Q;  1LTA D;  1YI2 A;  5KFR A;  4JG2 A;  4NP5 A;  1ZHQ A;  1S0O A;  1S5B D;  3HOY B;  1G2T A;  1DJR D;  2B8G A;  2N49 A;  5LMU Q;  2Z6B A;  4K5X A;  1PH3 A;  4ZK9 B;  3WO1 A;  5L1I A;  4ZLT F;  4YCU A;  2OT2 A;  1PFB A;  4MA0 A;  2F3W A;  4BA2 I;  1EL0 A;  1DM0 B;  1MZB A;  1PH9 A;  1VQB A;  3BS1 A;  1G2S A;  2MJ8 A;  1UNS A;  4ECU A;  3V6J A;  2K03 A;  1X32 A;  3BJU A;  1JWU D;  4JC0 A;  5K2M A;  2C22 A;  1AP0 A;  1LYL A;  1PTO C;  4PZ6 A;  2UUA Q;  2MFI A;  3MFY A;  4B9X A;  5L37 A;  4JI7 H;  3BZD B;  4X62 Q;  5M3F H;  4OX9 L;  3GTL A;  1K3R A;  1D2B A;  4O2D A;  5C5L A;  1IXR A;  4LSX A;  2RGV A;  4I7H A;  5ELE A;  2EZV A;  1NBW A;  4KK7 A;  4QUC A;  3A54 A;  3M9M B;  1EYZ A;  1EYG A;  3Q24 A;  3VMM A;  2Q2H A;  4MNO A;  2ASJ A;  3TIN A;  3J81 L;  3J81 i;  1I94 Q;  1XTD A;  5COY A;  2NYZ D;  5JVG 3;  4A93 G;  1U4R A;  4ECX A;  4IJH A;  2X0S A;  1K8A C;  3IRB A;  4MIU A;  1LT5 D;  3HRZ C;  5JPM C;  1KBL A;  4EEY A;  2EOT A;  5IT9 c;  1A2U A;  1PH1 A;  2V59 A;  5K36 H;  4KKT A;  2GPW A;  2VZA A;  3D6W A;  4ZOL F;  3MWY W;  1X56 A;  3P20 A;  5ELO A;  2W6P A;  3E5S A;  4R4T A;  1VS0 A;  1QOH A;  3CCR A;  1NR2 A;  3RB3 A;  1X3F A;  1F77 A;  4IFD G;  5C6A A;  4JI6 H;  2XTI A;  2HVR A;  2CH4 W;  2L55 A;  2A6H D;  2QKI C;  4RH6 A;  4GNX A;  3GTJ B;  3URY A;  4LF9 Q;  4FS2 A;  5IYB G;  2VQE Q;  3T1H L;  3RV4 A;  4KY6 A;  2V4R A;  2B39 A;  2WE6 A;  4UY8 C;  4ED2 A;  4GOP A;  4A3B G;  3S1Q B;  5M5X H;  3KDF A;  2UUC Q;  3M85 A;  2K5D A;  4A93 B;  1EY4 A;  2ZXP A;  3J7Z C;  2Q2T A;  2JN4 A;  2LMC B;  3AMU A;  1SYD A;  3L4J A;  1FKA H;  2F0W A;  1CSQ A;  1TWC H;  1W6K A;  1DYQ A;  2RDH A;  4RGT A;  2EIF A;  3I90 A;  2SEB D;  4LFB Q;  1VBG A;  2FMA A;  3NTI A;  4O4I F;  1EOT A;  5C1P A;  1PRT D;  3G6E A;  2M2L A;  1W96 A;  1VQG A;  2J4X A;  4HAE A;  3K5I A;  3K5M A;  2RBM A;  5CV6 A;  4QQB X;  2ID0 A;  4ME3 A;  3J7A V;  5HUR A;  2YYZ A;  1LUZ A;  4Y7N B;  3T51 B;  4ECR A;  1JC7 A;  1N32 Q;  3A8J E;  4C3J G;  4QJF A;  1V43 A;  3M3Y B;  4RB2 C;  1HNW H;  5AJ3 L;  3CC4 A;  3I4M H;  2R84 A;  5IT9 W;  4K6D A;  3DWP A;  1RKN A;  5KFS A;  3CC2 A;  4PDB A;  2L5T A;  1L1O C;  2OH2 A;  2C2E A;  2HVS A;  5KFY A;  1A3V A;  1KNE A;  1EIH A;  2V4D A;  3L0O A;  2K01 A;  3V6H A;  4C3I H;  3SE7 A;  4A3B B;  2IPK D;  5M5Y B;  5KYI A;  1NNX A;  1QG7 A;  2NVQ B;  1DGS A;  5D14 A;  1VQL A;  5J2T F;  2IJ0 A;  2R7F A;  3N52 A;  4XQQ A;  3J80 E;  2HQE A;  1FJG Q;  4J8Q A;  1TWG A;  1K1Q A;  3CQZ A;  4O2A F;  1VQ7 A;  2JYO A;  2KA7 A;  1Y8P B;  2V1C C;  4DV3 L;  4A76 A;  3HOV G;  2HHH H;  4DR2 L;  4JI0 L;  1NAP A;  1YVC A;  4ECS A;  4DUY Q;  2EJG C;  1N36 Q;  1V1Q A;  2F0T A;  3BG5 A;  4KMU C;  4LUO A;  5ELB A;  5KT7 A;  2QW7 A;  3IFT A;  1G51 A;  3BAA A;  1L2Z A;  2CQY A;  4QIW A;  1XNR Q;  3J80 i;  3J80 L;  2R8H A;  4C3J B;  5HGT A;  1JJ2 A;  3I7F A;  2F0I A;  1Z9F A;  2FJ2 A;  2LFN A;  4C1N K;  4JI5 L;  2LSS A;  2ZDH A;  3GTQ B;  5DQI A;  3W3A A;  5I2Y A;  1GKH A;  3G71 A;  2B29 A;  1GSH A;  4ECV A;  1YIT A;  2JA5 H;  4A3L H;  2E2I B;  4LFC L;  1Y1V B;  4K5W A;  4DXG A;  5FD5 A;  2XCA A;  2VQF H;  1SFO A;  4QIW E;  3TS2 A;  1PK8 A;  1AN7 A;  1VQN A;  3HOV B;  2FB9 A;  5L9X A;  1XTC D;  1KDC A;  5EKK A;  4DKA C;  1KQS A;  1S0M A;  3OHB A;  2J7Z A;  2ZJQ A;  1AH9 A;  5CV5 A;  2ALZ A;  2PQA A;  3RB4 A;  4K2L A;  1STG A;  5KRU A;  5BN4 A;  4X65 L;  4DV6 L;  2JSO A;  4ETS A;  5L1J A;  4RHS A;  3S2H H;  5CC4 A;  1WSC A;  2MUY A;  1K8G A;  3LP8 A;  2C35 B;  3R2T A;  3JRW A;  3A0J A;  3NXW A;  1IYV A;  2L4N A;  4YBZ B;  1KEE A;  4A3F H;  4YWK A;  1Q1B A;  1PH4 A;  2R7Z H;  2ASL A;  1CA6 A;  1TXY A;  2KCM A;  4ZRZ A;  3GTL B;  2KED A;  2J6T A;  3AYH B;  3TP8 A;  1QNU A;  1UE5 A;  4YJ3 F;  3PIO 3;  4R7R A;  3EYY A;  4MA5 A;  2C9O A;  4RNO A;  4EGV A;  2B2U C;  4DV5 H;  1BGW A;  3PIP A;  2NVX H;  1NSN S;  4U7C A;  1J5E H;  1GUN A;  1PFM A;  2W9A A;  1M0T A;  1V1O A;  3K0Y A;  4DR7 H;  1EYD A;  4KHP H;  2YS6 A;  4M1U B;  3T16 A;  2UVW A;  1PRT B;  2HGS A;  2JEJ A;  2R82 A;  1S5C D;  2XD4 A;  3H3V C;  4AYB A;  2RDF A;  3S16 B;  1S3O A;  4HJ5 A;  1CS0 A;  4RB3 C;  2C5C A;  3M4Q A;  1CQJ B;  1Z7T A;  2E5L Q;  1KHI A;  3K3P A;  1OXU A;  1A3T A;  4BY1 G;  4JOI A;  3UDI A;  2VW9 A;  5BR8 Q;  2D0P A;  2YTX A;  4TQU S;  4IZO A;  1YNN D;  5GAG C;  5IGE A;  2JA8 H;  4GNX B;  1HNX H;  2UVR A;  3MFI A;  3U9T A;  2JP1 A;  3G4S A;  1SAP A;  2IBK A;  4EFB A;  3IL8 A;  3VR6 A;  4AYB E;  4GOP B;  3J7Y W;  1K3B C;  3KDF B;  1SMX A;  1JIH A;  3MWM A;  2DGY A;  2BQU A;  2F0L A;  2WP8 J;  1N34 H;  1M90 C;  3ITP A;  4B3R L;  2Y0S A;  2EY6 A;  1SNP A;  2NU8 B;  1M4V A;  4MV4 A;  1H9R A;  2Z9H A;  2KBN A;  1EU4 A;  1GUT A;  4N9P A;  1X3E A;  3A8K E;  1QNK A;  1VQ9 A;  2W57 A;  5LMU H;  3EBE A;  5AFW A;  3VYS A;  4K8I A;  2F0J A;  2YV5 A;  5EZY F;  1WTO A;  1NR4 A;  4BY1 B;  3QB3 A;  3BA9 A;  2ZJP A;  2Q2U A;  4OWX B;  4U67 3;  4CKB A;  3T1Y L;  1B4O A;  2R7Z A;  2YW2 A;  1PZK D;  1D8L A;  3J81 j;  4JV0 A;  1K0S A;  5CV7 A;  2Y0S E;  1HCZ A;  3PO3 H;  4F8M A;  5IWA Q;  4X62 H;  3PIO A;  5ELD A;  4JV5 L;  5DAU A;  1CFM A;  5IGF A;  4YQW A;  2TMP A;  1EZ6 A;  2MPM A;  1OXS C;  3J7A K;  4J6H A;  1CE8 A;  1I4R A;  1NTG A;  1CQF A;  1TWG B;  5KG1 A;  3FMA A;  2VUM A;  4DNI A;  3CQZ B;  4GNX C;  3O13 A;  4RB0 A;  1I50 A;  5E4X A;  1I94 H;  1RF2 D;  4WBN F;  1BBW A;  3OMC A;  3FVQ A;  1K83 H;  4HID A;  4GOP C;  4KY5 A;  4AQY Q;  1KJ9 A;  2XIG A;  2JK8 A;  1N9W A;  3M4P A;  4QIW B;  5HY6 A;  2BDO A;  2Z6K A;  4ZQ3 A;  4LAA A;  4FF3 A;  2UVU A;  2UXD L;  2AQ3 B;  4DL3 A;  2CFM A;  3M9O B;  2KQ3 A;  1F2M A;  3BDO A;  2F4V L;  2EYO A;  2VA3 A;  2NWG A;  2G9D A;  2RA4 A;  2UUB L;  1IBK L;  2ZM6 L;  4GKJ L;  5KFZ A;  4IO9 A;  2MCT A;  3I8Z A;  4IUT A;  1TWH H;  3KLW A;  2FE3 A;  2O5I C;  3TME A;  2Q8R E;  4X66 L;  4R4I A;  5EOY A;  4RNN A;  1SFO B;  2ZDG A;  1U4P A;  3C3L A;  3HG9 A;  1UE7 A;  2W71 A;  3IG0 A;  3HOY H;  1JE4 A;  4LF9 H;  1B6S A;  4RMF A;  4DU9 A;  3PO2 G;  2PCF B;  2YCH A;  2VQE H;  1PMR A;  3R2I A;  1KAB A;  2ZT9 C;  3VYT A;  1WD1 A;  4RKL A;  4B3T L;  1BBU A;  3I4N G;  2K5V A;  1TWC B;  1A8V A;  4XQN A;  3RZO H;  3PN1 A;  4E4T A;  3SK8 A;  4LF8 L;  3C0F B;  4J9N A;  2UUC H;  1Z2O X;  4PMB A;  2IA6 A;  4YHH L;  5KFK A;  5LMN Q;  5A2Q E;  4LFB H;  3KYH C;  4RWS C;  5D65 A;  2EPB A;  3SGI A;  5LYJ F;  1TWF A;  4XYL B;  1N8R C;  4LH6 A;  4WJ3 M;  2HDL A;  3JRX A;  5IGG A;  4A3K G;  4AYB G;  3I4O A;  5KFF A;  1JOQ A;  3VR2 A;  1LTG D;  1R9T A;  1N32 H;  1VQ6 A;  5A2Q L;  5IGD A;  5FO9 B;  3WO0 A;  4U68 A;  2QYZ A;  4H13 C;  3QZ8 A;  1ENF A;  4JYA Q;  1GO3 E;  2YU9 A;  2JXM B;  3A5Z B;  2BA0 A;  2UXC Q;  3PO2 B;  3N43 B;  4EGQ A;  2IX0 A;  3F2D A;  3G6X A;  1BCP D;  5JQW A;  5D1O A;  1ZHS A;  4IHJ F;  3I4N B;  1TQO A;  2P5Z X;  2K33 A;  2K5W A;  4GLV B;  3GP7 A;  3H91 A;  4JI8 L;  4YY3 Q;  3Q8S B;  3GV7 B;  1STH A;  2VPQ A;  4A75 A;  1PX2 A;  1HZA A;  2DY7 A;  2ALY B;  1U9R A;  4HR7 B;  1XDN A;  3N42 B;  4LF5 L;  2JE6 I;  1PTO F;  4DUY H;  2Y0S G;  2QF7 A;  4C1N I;  4DR5 Q;  1N36 H;  1RL2 A;  1QWY A;  4A3K B;  4AYB B;  1SRU A;  2I80 A;  3RN2 A;  4B9W A;  2IP4 A;  4L5T A;  1XNR H;  1ICF B;  3QWN A;  2W8K A;  5LA6 F;  1QZG A;  1EFW A;  4YCV A;  1PVO A;  1RK6 A;  5DNF A;  3GTJ H;  4ZUJ A;  2IL8 A;  4NXM Q;  1DIK A;  1MIU A;  4IWX A;  2F0U A;  3S1Q H;  4B3M L;  4O2B F;  2R7Z G;  3T5K A;  3PGZ A;  4A93 H;  1NY4 A;  3S14 B;  2F0K A;  4Q0F A;  2B63 A;  4K5V A;  3S9W A;  5KNC A;  1SSO A;  4IN3 A;  1I6H B;  3ETJ A;  4CC5 A;  2PN1 A;  1A3U A;  2A69 C;  2H5X A;  3JAM L;  3JAM i;  4BXX G;  3JSN A;  3HOZ H;  1JR0 D;  5L1K A;  3M4Y A;  3VPD A;  2JEG A;  1PH7 A;  3SVM A;  1A9X A;  5GAD C;  5GON F;  2VUM G;  2Y0S B;  2L1B A;  4C2M A;  1X65 A;  4Y7N H;  1AEX A;  1WTH A;  4LF4 Q;  3T5J A;  3M3Y H;  1T3N A;  1YHA A;  4IR1 A;  4A3J G;  1PH6 A;  4IFD H;  2J9G A;  4FF1 A;  1PV4 A;  4U6P A;  3CPW A;  1DOM A;  1QVG A;  2A73 B;  4LF6 L;  4JI3 L;  3OIP A;  3SHL A;  3NQT A;  4GZY C;  5EPJ A;  1CHP D;  5IYB H;  4OIJ A;  1CKO A;  2RDJ A;  1HNZ L;  2K28 A;  3TP5 A;  1B1Z A;  3L7Z C;  4A3B H;  3GTK A;  5C3W A;  5M5Y H;  2R7Z B;  2FPG B;  4DLK A;  1SEB D;  3HS0 C;  2NVQ H;  1M0W A;  1WTW A;  4IPH A;  2N78 A;  1D5X C;  1XMO L;  1LV9 A;  4DN4 M;  1J9O A;  2BCO A;  1K0R A;  3NEL A;  5D1P A;  1SE2 A;  3SI8 A;  3G7L A;  2P0A A;  5I2X A;  4IFD I;  2A68 C;  3HB9 A;  4UHV A;  4P75 A;  1XMQ L;  1N56 A;  3KTM A;  1QB5 D;  3CAM A;  3DLL A;  4TSS A;  2VUM B;  1F9S A;  4O1N A;  4QB4 A;  5EPL A;  4DK6 C;  1CQV A;  2NN6 G;  2FHT A;  4C3J H;  1HR0 Q;  1GM5 A;  5EBD A;  2BH8 A;  4ULL A;  4A3J B;  4UFZ A;  3PCO B;  4POF A;  4KHZ A;  1YJ9 A;  2F0O A;  4HIM A;  5FLM H;  2VL6 A;  1BF4 A;  4KJN A;  4RU9 A;  5CAE B;  4DV2 L;  4JBJ A;  2XGP A;  2JEB I;  3P7J A;  4IPG A;  1WOC A;  2E2I H;  4O3P A;  2F3I A;  5F9N A;  2CQA A;  1EIF A;  2E5L H;  5IGB A;  2AGP A;  1XPU A;  3CME A;  2ES2 A;  4GC6 A;  3Q8P B;  1KLU D;  3U4Z A;  2L0C A;  5EKL A;  4IZ8 A;  1O7I A;  4CGY B;  2JA8 B;  5KG4 A;  3ER0 A;  5BR8 H;  4DV1 Q;  3T13 A;  4R4Q A;  5C4J B;  3Q23 A;  3VDY A;  1S5F D;  1TT2 A;  4B3S L;  3MJF A;  1BCP B;  4TVA B;  4DAY A;  1D6E C;  3V4S A;  1WD0 A;  4JBM A;  3QG1 A;  4PMW A;  1QJO A;  1W6J A;  5GRO A;  5KFW A;  1CKN A;  4IJL A;  5J3B A;  4DV7 H;  3UDF A;  5EBC A;  3M7G A;  3KHG A;  4EYI B;  3GTK B;  1JXL A;  4X3K A;  2CWP A;  1UAP A;  3E5N A;  1KC7 A;  4DUZ L;  4MTE A;  2F4V Q;  1O7Y A;  4WJ4 A;  1N33 L;  3I73 A;  1E4E A;  4MZ9 A;  1YZ6 A;  3M7N A;  1TWA H;  1JJG A;  2R6G A;  1T5X D;  1TWF B;  3PMF A;  4XT3 B;  1ET9 A;  1LM0 A;  4E6I A;  3GTL H;  3KK7 A;  2SNS A;  4QY7 A;  5FK9 C;  5JJL A;  3N44 B;  1JDB B;  1R9T B;  2H4O A;  1IHZ A;  1VCI A;  2KCC A;  5FLX E;  5KG6 A;  1B04 A;  1BXT A;  1XXG A;  4Q44 A;  3R3O A;  3IN5 A;  5G3L F;  4JUZ A;  3CMA A;  1IL2 A;  1EYA A;  4EBD A;  4FXG C;  3G6J B;  1Y8N B;  5C44 G;  2X69 A;  3W5O A;  5FOB B;  3TQT A;  1TKW B;  3VPB A;  5IWA H;  2B63 G;  3WOF A;  5D1O B;  2DY8 A;  3MVV A;  1IBL Q;  1LAB A;  1FVI A;  3GIJ A;  4IFD J;  3QOL A;  2XCL A;  1KXL A;  3FDS A;  3S16 H;  1B7Y B;  4ECQ A;  1SNO A;  1UC8 A;  3H94 A;  1GUS A;  4ED0 A;  1ET6 A;  4IPC A;  2J0T D;  1PFS A;  1VQC A;  3OTO Q;  2I8C A;  1C48 A;  3ONA B;  3RLF A;  2IX1 A;  1EQV A;  3BZK A;  2NBF A;  4JW0 A;  4A3E G;  4K0K Q;  5FPO A;  4F4Z A;  2FMM A;  4AQY H;  4ZKB B;  4ECW A;  3KAK A;  5J22 A;  4DV0 Q;  3OWF A;  3I3C A;  5KFI A;  4O3S A;  2C00 A;  3RIZ A;  1I4H A;  2Z4H A;  1KIX A;  4HQ6 A;  5C44 B;  5KFU A;  5ELF A;  5CYU A;  2AMC B;  3MR6 A;  1WVL A;  4RGN A;  5ELN A;  4HSV A;  3F1Z A;  1GVP A;  2B63 B;  1PYB A;  1Q86 C;  4CJ2 C;  5KT4 A;  2LS0 1;  4HNT A;  4IUP A;  5M3M H;  1JKJ B;  3QFF A;  5KFN A;  4M7E A;  4LF5 Q;  3RZO B;  2K04 A;  3M4O H;  1GYF A;  3E3X A;  5G3L D;  4A3E B;  1I5F A;  1RYS A;  4LF7 Q;  5KFE A;  4C2M B;  1CT1 D;  5FKA C;  4BY1 H;  4K6L A;  1TWA A;  2AGQ A;  1SE4 A;  2K75 A;  2PW7 A;  1SMY C;  3MXP A;  3HXL A;  3J81 E;  5KG5 A;  3W1B A;  5KFB A;  3V4Z A;  4MV7 A;  4ID6 A;  4LW1 A;  5LMN H;  1BBX C;  4B3M Q;  4HTH A;  2PI2 E;  4HCE A;  3RFC A;  1E4G T;  5KFL A;  1G6P A;  4DGZ A;  2RKS A;  2BE5 C;  3BDC A;  5EAY A;  1EZ8 A;  3T56 B;  1SLJ A;  2CW7 A;  4G7H C;  1XNQ Q;  1MGS A;  4DV4 L;  4UCS A;  1B70 B;  1TS5 A;  4GC7 A;  2W6M A;  1TWG H;  2VA2 A;  1F9Q A;  2A19 A;  4AH6 A;  3NQI A;  3CQZ H;  4O3N A;  4FF4 A;  2X6L A;  1Z2P X;  1LT3 D;  4JYA H;  4DR1 Q;  1LLR D;  5T14 A;  2UXC H;  4TV8 F;  3K5O A;  4KLK A;  5COR A;  3CU7 A;  3MEH A;  4C5B A;  2I5H A;  2C28 A;  2IT1 A;  2RSN A;  4JI1 L;  2VS1 A;  1HTL D;  3RMH A;  3EPG A;  2KCT A;  3HOZ G;  3CCS A;  4YY3 H;  1IBM Q;  1E3P A;  2XC9 A;  4LUZ A;  3V2T A;  2KEN A;  4HN7 A;  3T5H A;  1C8C A;  3PW4 A;  2W6O A;  4QWD A;  1TY0 A;  1SYC A;  1LTI D;  2XGT A;  4POG A;  3KHR A;  3U9O A;  4DR5 H;  3D4D A;  3UI2 A;  2ICE C;  2ENB A;  4LFA Q;  1SDF A;  1EZ1 A;  1EFI D;  2UU9 Q;  3D3R A;  5IT9 E;  1SBB B;  2R87 A;  1E4F T;  2N3S A;  4HIO A;  1SFO H;  2WV6 D;  3NK9 A;  3ERS X;  4IPD A;  5C0X H;  4O3Q A;  3JZI A;  1SRO A;  1XMQ Q;  2XRS D;  5IIF A;  3R93 A;  3GIK A;  4MTK A;  4NXM H;  5CBE E;  5EWF A;  1H9M A;  4J9P A;  5BPH A;  3OPO A;  5KFT A;  5E7N A;  1A0I A;  4C3H G;  5IT9 L;  4DR4 Q;  4X6A H;  3RB6 A;  1RJT A;  4DAY B;  3FKI A;  3QIA A;  3BVM A;  3SR1 A;  1PZI D;  3HOZ B;  4GS3 A;  2BA1 A;  5D8D A;  1CKN B;  4X64 L;  2JA7 A;  4JI2 Q;  2K52 A;  1FGU A;  1YNJ D;  1KD1 C;  1DD2 A;  1JWS D;  2AKW B;  1K8O A;  3TBI B;  3KFU A;  2AUJ D;  1BO0 A;  1DV1 A;  4RZR A;  1M8A A;  5I9P A;  2EXD A;  1E4E B;  3WOE A;  4HJA A;  3EPI A;  1VQO A;  5C3X A;  4LF4 H;  5CMD A;  1KAW A;  4RZQ A;  5FLM G;  4RCO A;  3RNU A;  3K80 C;  4JV1 A;  3RUP A;  1H95 A;  1WTQ A;  4O3O A;  3PO2 H;  3G48 A;  5GQO A;  4YP3 A;  4DR3 L;  1KJQ A;  5E1F A;  3NWS A;  3GII A;  3GTG A;  1A63 A;  3V96 A;  3I4N H;  4L5S A;  5EKI A;  4C3H B;  1YHQ A;  5JEA G;  2PMZ A;  4PZ8 A;  1Q8I A;  5IGC A;  1QVC A;  1RTN A;  2QK4 A;  4JVZ A;  3F8N A;  2CW0 C;  3F2C A;  1UWV A;  2JJQ A;  4A3K H;  4UP8 A;  1WTR A;  3STB C;  1YEZ A;  2K7V A;  2AU0 A;  3S1M B;  5BPF A;  5IYC G;  3GTM A;  4J0M A;  2YZM A;  1HR0 H;  1Q1E A;  1WJJ A;  2OQK A;  4QL5 A;  3WWV A;  3D8G A;  3FPU B;  3KF6 A;  3R8B A;  3TZU A;  5HBR B;  2PMZ E;  3K59 A;  4ECT A;  2F0S A;  2UXB Q;  2YRX A;  2K6A A;  4JI4 Q;  4WJW A;  4HIK A;  1LT6 D;  3S14 H;  4RA8 A;  4APM A;  3MHB A;  3GTP H;  3D4W A;  1EY8 A;  1I6H H;  4QUF A;  1W2B A;  1ICW A;  2R8K A;  2F0N A;  4GKK Q;  4JI7 L;  4XZ3 B;  3DMU A;  1XX8 A;  1B9N A;  3A55 A;  4F88 A;  1OXT A;  4DNT B;  3T5L A;  4DV1 H;  2NU9 B;  5DG8 A;  4IUN A;  3QZ7 A;  4J9S A;  2RQX A;  1JOO A;  4RUC A;  5LHY 1;  4EQ5 A;  5JVH 3;  4NXN Q;  2FK3 A;  3OSN A;  1C3O A;  4OL7 A;  5EGT A;  3CCE A;  5LMN W;  1FYC A;  1EIG A;  3PUZ A;  4X3U A;  1SYB A;  1TWA B;  2F4V H;  4QW8 A;  2GPS A;  5C1O A;  4DR6 Q;  3F2U A;  1VQD A;  4P73 A;  4DK3 C;  1HXY D;  3QOJ A;  2ATL A;  2B2T C;  1IW7 C;  2NU7 B;  3OHA A;  1HUM A;  4X3S A;  4BXX H;  1FNV A;  1HFN A;  3AFQ A;  3K7U C;  4OHJ A;  2CKZ B;  3MTS A;  3GV3 A;  3MFH A;  1N48 A;  1HFG A;  3S2D B;  4GN4 B;  4NDX A;  1ZYR D;  2VUM H;  1I50 H;  4JI6 L;  2DJF C;  4ED6 A;  2EDG A;  4FM9 A;  1X3G A;  2F0V A;  1PH5 A;  2PQE A;  2PZT A;  4A3J H;  2OWO A;  5M3M G;  4FXD A;  3GTO A;  3PUV A;  1U0L A;  3IFD A;  5CGK A;  4YAJ B;  3FKI G;  2B2Y A;  3KOJ A;  3P1H A;  4HNU A;  1ESR A;  1S72 A;  1AZP A;  1IBL H;  1FR3 A;  5NUC A;  4OX9 Q;  2JA7 G;  3GD7 A;  3R5X A;  4R8U A;  2W6N A;  4WOR A;  3GQC A;  5E4W C;  1STA A;  4N9T A;  3VYR A;  3UQ8 A;  1X55 A;  2WAQ E;  1VBH A;  4Q45 A;  3OTO H;  3HOU G;  5LL6 S;  4FYD A;  4BWS C;  3EA6 A;  2WIN B;  4XX0 B;  4K0K H;  3QR8 A;  4NMZ A;  1IL8 A;  2A1A A;  5KG0 A;  4YR0 A;  1BJT A;  4BBS H;  1QE6 A;  3DM3 A;  3GTP A;  4MV6 A;  2CWA A;  3BJY A;  1VQ5 A;  5C4J H;  3RBD A;  4DV0 H;  3Q8Q B;  3C1E A;  1HNW L;  2A6H C;  2E2D C;  1KDB A;  2NN6 H;  1FGB D;  1NE3 A;  2YS7 A;  1Q7Y C;  5IYD G;  1NCV A;  3S17 B;  4IAJ A;  3MA2 B;  1QUQ A;  4H02 A;  5M3M B;  2HVQ A;  3GTK H;  1G8Z D;  4EEQ A;  3PUX A;  3FKI B;  1A62 A;  2VQD A;  1QVF A;  2O5J C;  1K8M A;  3M4O B;  4EFE A;  3N41 B;  4DL2 A;  2JA7 B;  1M7J A;  5IY0 A;  2FPI B;  4UCT A;  5DLQ E;  5FD6 A;  1IOV A;  2D2C C;  1TWF H;  2VB2 X;  2HHH L;  1PRT C;  3ORQ A;  4APV A;  3HOU B;  3KUP A;  2GN5 A;  4LF7 H;  1D5Z C;  2NN6 I;  3T1H Q;  3AEV A;  5I47 A;  1R9T H;  4XIG S;  2JQO A;  3ND9 A;  3K7A B;  2A6E D;  2UVV A;  4G7O C;  3B6Y A;  2R8J A;  3NE5 B;  3GDE A;  3Q6S A;  2UUA H;  1B9M A;  3ERQ A;  3CF5 A;  2NZ1 D;  2YU9 H;  3IKJ A;  2W7O A;  1LO5 D;  1OO9 B;  2RCN A;  1FNW A;  1ML0 D;  3D6C A;  4KHV A;  2B8F A;  2W9C A;  5C0X G;  3GTG B;  2WDT A;  3TZD A;  2VNU D;  1SND A;  1B44 D;  3CCV A;  3MEF A;  5JPN C;  1EU3 A;  1MHW C;  1XNQ H;  1Y8O B;  2AGO A;  2A68 D;  4GN5 A;  4NB3 A;  2VQF L;  2NVT B;  5C8Y F;  2CZG A;  1STB A;  1B50 A;  2AWN A;  3OUU A;  4DR1 H;  1BR9 A;  2WKC A;  3I70 A;  5AJ3 Q;  3UFX B;  1HR0 W;  1SCU B;  3H40 A;  3BQ0 A;  1E2V A;  3GIL A;  4BWG B;  1EEF D;  3A7L A;  3GQB A;  3GTM B;  5IOD A;  3MXG A;  1CK1 A;  5C5M A;  4EQN A;  1IBM H;  1X6O A;  1PYS B;  2E8G A;  3A8I E;  4F7X A;  2NVY A;  3GIP A;  5EDW A;  3VR4 A;  3KF6 B;  1A15 A;  3DXJ C;  3WDN A;  5I6W A;  4OEL B;  1GOZ A;  1ZQ7 A;  5C44 H;  3HKZ E;  5JJZ A;  2I87 A;  3R5H A;  4DV3 Q;  2JEI A;  4DR2 Q;  2B63 H;  4JI0 Q;  3OYY A;  4LFA H;  3TS0 A;  2HDM A;  4NW2 A;  2UU9 H;  1LTL A;  1VQ4 A;  1X9N A;  2JA9 A;  1EQR A;  3GID A;  4YB8 B;  2SOB A;  2O4X A;  1XMQ H;  1C4Q A;  2PQA B;  4ODG A;  1GD7 A;  3RLN A;  5BN5 A;  1SNM A;  1JWM D;  4P74 A;  4A3E H;  4JI5 Q;  2HIV A;  4C2M H;  4GLX A;  1I6U A;  3BYT B;  2EY5 A;  1QIL A;  1IYU A;  3Q0A A;  1ZXT A;  4DR4 H;  2JA6 A;  1S5E D;  3U4V A;  3VR3 A;  4DV5 L;  5J2U F;  3LWE A;  4DXF A;  3LGJ A;  3ORR A;  4JI2 H;  1R4P B;  4YCW A;  3Q1K A;  4LFC Q;  1SYG A;  1K73 C;  3HOW G;  4DR7 L;  1I4G A;  1CTM A;  4KHP L;  5GAE C;  5CV4 A;  3A5U A;  2R92 H;  5KEE A;  4S3S A;  4UP9 A;  2HJW A;  3G6V A;  4LMQ D;  2SCU B;  1Y1W A;  3BQ2 A;  4L8J A;  5KFJ A;  2R7D A;  5M9O A;  1AFP A;  3V6K A;  1JOR A;  3MC0 B;  1OTC A;  4X65 Q;  3KBX A;  4DV6 Q;  1BNZ A;  1SNQ A;  1JDE A;  4G7Z C;  5EWG A;  2ZJR A;  1EEI D;  2WB1 E;  1TS2 A;  3FHW A;  1T94 A;  1JOK A;  1FJG H;  3M9N B;  3TII A;  3VA7 A;  4TQR A;  4YJ2 F;  4EGJ A;  2C2R A;  2F1M A;  3E6Z X;  4EQO A;  4KKU A;  1B33 N;  5KT6 A;  3RB0 A;  1HNX L;  4FF2 A;  1UE1 A;  4M9U A;  2IY5 B;  4RAU C;  2KOL A;  1GHK A;  2WYO A;  3GTO B;  4IUV A;  4QCL A;  4G57 A;  4L6T B;  5LL6 X;  4FVM A;  2R8I A;  3HOW B;  1S03 G;  3S15 B;  4JCV E;  1DCZ A;  5FJ8 G;  4R8U B;  4J9K A;  4BBR G;  1N34 L;  2ASB A;  1CZW A;  4ZHQ F;  2R93 A;  1WR2 A;  3CKI B;  2W70 A;  3CW2 C;  1SJH D;  1CQI B;  3JAM E;  5KT3 A;  3RD4 A;  1X54 A;  5LMU L;  1ASY A;  3PUY A;  1BNC A;  2L15 A;  1L0Y B;  4CC6 A;  5LL6 b;  1SXT A;  3GTP B;  3PW0 A;  5EPK A;  1HUN A;  2UXB H;  5IP9 H;  1VQP A;  5KND A;  2IW3 A;  1O75 A;  3EVQ A;  4JI4 H;  2OLS A;  1KJI A;  3G8C A;  4ZYS A;  3BQ1 A;  1YNN C;  1VQK A;  3TN2 A;  5KFG A;  4ME5 A;  1TA8 A;  5KFC A;  3CP0 A;  3V05 A;  5H1S E;  4I65 A;  1JIC A;  2RDG A;  2BQR A;  1QUQ B;  4GKK H;  2K14 A;  2RHQ B;  1QZH A;  4KKS A;  4X62 L;  2KHS A;  5KNB A;  2EQS A;  1D1I A;  4QF4 A;  1KNA A;  5KFM A;  1VF7 A;  5BN3 A;  3L2P A;  4YIJ A;  1ESF A;  1S0N A;  4BBR B;  5DGA A;  3HKS A;  4IUQ A;  4H0L C;  5JOB A;  4NXN H;  3HBL A;  2KHJ A;  1I94 L;  3OW2 A;  1RCV D;  1V9P A;  1LAC A;  1X3Q A;  1ENC A;  4BY7 G;  3ETH A;  2R92 A;  4A3D G;  1ULZ A;  1PTO D;  2W6Q A;  3MR2 A;  4Q0Y A;  4UCR A;  3BVG A;  5KYL A;  3TP6 A;  4DR6 H;  4RFB A;  2F0E A;  3PQI A;  2RHS B;  4Q8E A;  3CCU A;  5KT2 A;  4C3H H;  3C1F A;  1D1K A;  4BBS G;  4BS9 A;  1SNC A;  4JOI C;  4B3R Q;  3GIQ A;  5T1G A;  2JEF A;  4PQX A;  1AN8 A;  2J6S A;  2PYK A;  2E2H A;  5CBA E;  1H9J A;  1I50 B;  1JB3 A;  3CC7 A;  2DUD A;  4N8F A;  3CCM A;  2CW8 A;  3HGB A;  1V1P A;  1B2T A;  3H0G A;  2PNR C;  3CVZ A;  3S1M H;  2MO1 A;  3T1Y Q;  4DA2 A;  4LF9 L;  2YRW A;  2KEC A;  3KLR A;  2VQE L;  1UC9 A;  1IYJ B;  2B2V A;  1SYF A;  5F2D A;  1H9K A;  2JA6 G;  4BY7 B;  4A3D B;  2EJM A;  2UUC L;  5DGB A;  3LML A;  2D5D A;  1EY9 A;  2VPS A;  2NVY B;  4OX9 H;  1AZQ A;  4A3M G;  4JV5 Q;  1RIP A;  2Z8L A;  4LUV A;  3I12 A;  4XYM B;  1E2W A;  1L1O A;  2MO0 A;  4H7B A;  4LFB L;  4BBS B;  1UEB A;  3PR4 A;  4LJZ C;  5JEA H;  3T53 B;  2I5M X;  1EYC A;  4FBT A;  4XXE A;  4ZUI A;  5KFX A;  2D0O A;  1CA5 A;  2NTS A;  1MI2 A;  5FPR A;  4PZ7 A;  4RHR A;  1N32 L;  4I50 F;  1SYE A;  1RK5 A;  2UXD Q;  1HH2 P;  1S10 A;  3RV3 A;  5IYC H;  3NBI A;  4C56 C;  3L3O C;  2DPJ A;  2F0H A;  2Q2I A;  1E2Z A;  3SEB A;  1A2T A;  3DUZ A;  2BOS A;  1PYW D;  4CKE A;  2UUB Q;  1IBK Q;  2JA6 B;  2ZM6 Q;  4GKJ Q;  4DL4 A;  3TRE A;  2QIL A;  4YAK B;  2R61 A;  1W93 A;  2HT1 A;  1SE3 A;  4M8A A;  4A3M B;  4X66 Q;  2ZXR A;  4HCS A;  4CHT B;  3C2P A;  1DXM A;  4A3C H;  2Z6K C;  1ASZ A;  4A3I H;  5KKN B;  1I3Q A;  1S97 A;  1XPO A;  5FLX c;  3CXC A;  1S68 A;  4DUY L;  2PZU A;  1N36 L;  3HOX G;  2R93 G;  3T1H H;  5ISR A;  1KAA A;  1I6V C;  2YU9 B;  4LK1 C;  5L1L A;  2D62 A;  4EVO A;  3S2D H;  3PSI A;  5FO7 B;  2NTT A;  4CDD C;  1XNR L;  4B3T Q;  1A6X A;  4LF8 Q;  2W6Z A;  4ZKC B;  3IAY A;  3SDZ A;  3I72 A;  5C4X G;  4R4O A;  1P16 A;  3A56 A;  4ZCK A;  4YHH Q;  2WAC A;  4UAI A;  2BR0 A;  4Q8F A;  2DLN A;  1W3S A;  2EYF A;  5CB4 F;  1Y14 B;  2I0Q A;  3NP8 A;  4YR3 A;  1OXV A;  1UEA B;  2LKV A;  1BCP C;  1L2F A;  3HZX A;  1MKH A;  4X3T A;  2DZD A;  5F9L A;  1TAE A;  4ZI7 F;  4KV6 A;  1ONL A;  5LP6 F;  5LXT F;  3N40 P;  4O3R A;  1VQE A;  4LH7 A;  4KHP Q;  4JBW A;  1UE6 A;  2FPP B;  3OHX C;  3FPP A;  4I7A A;  1GLV A;  3CCQ A;  4IOA A;  5DG7 A;  1EWH A;  1SE8 A;  1HZ9 A;  1AUV A;  1S5D D;  1T36 A;  2WFW A;  3J7A 5;  2V58 A;  2CHB D;  3HOX B;  2R93 B;  4R8N A;  5EWE A;  1C9O A;  1B8A A;  3AU7 A;  1PTO B;  4LWC A;  4KTA A;  1AE2 A;  2R92 G;  3BA8 A;  4GN3 B;  3W2D A;  2XCP A;  3GTQ A;  3MZ5 A;  4JI8 Q;  2LXK A;  1K9M C;  5C4X B;  2C2D A;  4N8X 1;  1PFN A;  3KF8 A;  3S17 H;  2HIX A;  5DM6 3;  5FLX W;  4KD4 A;  2PI2 A;  4DV3 H;  4QWB A;  1STN A;  2B2U A;  4DR2 H;  2F0P A;  3FKI H;  2HD3 A;  4JI0 H;  2Z4I A;  1IKM A;  1Y1V A;  2RSO A;  4MN3 A;  5IOC A;  1DOK A;  2JA7 H;  3CD6 A;  3F8T A;  1RJR A;  2R7N A;  1KLG D;  2CH4 A;  4XDX A;  4WRD A;  3QJY A;  4R4C A;  2WTF A;  2YL2 A;  3PR5 B;  4QWA A;  3HOU H;  3RGX A;  3BG3 A;  1O7Z A;  3H0G G;  4JI5 H;  1VF5 C;  2Z1C A;  3J81 c;  3J7A F;  3OOC A;  4TRD A;  3EFX D;  3K7A H;  1FD7 D;  2XRQ D;  5JEA J;  2R92 B;  3MAQ A;  4LFC H;  4OIK A;  3D4R A;  2PPB C;  4TV9 F;  4NPS A;  1EY5 A;  5IYD H;  1VQJ A;  3GTG H;  3BU2 A;  1C0A A;  3BDL A;  1VQA A;  4WD3 A;  2K5H A;  3TRZ A;  1IW7 D;  2AQ4 A;  1VMP A;  1LTR D;  3D31 A;  4J15 A;  4R1J A;  5IP9 G;  1XJV A;  3Q2O A;  1I4P A;  1KL9 A;  2NVT H;  4LSA A;  2E2H B;  4X65 H;  2NZO A;  1Q82 C;  4FNF A;  2E5L L;  4DV6 H;  5JVD F;  3E9H A;  4HMI A;  2MGS A;  5IYZ F;  1PRT F;  1F9P A;  4JI3 Q;  4LF6 Q;  1V1P B;  3H0G B;  5BR8 L;  4I55 F;  1IKL A;  4HJ8 A;  1LT4 D;  3P75 A;  2BH2 A;  5K5P A;  4CDF C;  3GTM H;  2PVP A;  4KI0 A;  1HNZ Q;  4I4T F;  2OQ0 A;  1M6V A;  4RAZ A;  4FP5 D;  1EY6 A;  2L11 A;  2YYA A;  1JE5 A;  1OWT A;  2K4K A;  4IQZ A;  4DV7 L;  4CJ0 B;  1SR3 A;  1S40 A;  1MJE A;  2RDI A;  1XMO Q;  3TSS A;  2VUG A;  5C5J A;  3ULP A;  5KG7 A;  3A7A B;  1Q12 A;  4DL7 A;  3UDG A;  4ED8 A;  4ME6 A;  3RGZ A;  2GLT A;  3J81 W;  1D7Q A;  5JVL A;  1KC8 C;  4DL6 A;  1L1O B;  2HUG A;  4J9O A;  2XSC A;  1G91 A;  4DAV A;  4K14 A;  1EUC B;  4QGU A;  2L12 A;  3M4I A;  1BUV T;  5KG3 A;  1GJX A;  3DHQ A;  5KFV A;  2EYJ A;  2XWB B;  5CV9 A;  4FU0 A;  1WCM A;  2QEJ C;  1WTV A;  5C4Z A;  2K5N A;  2DWC A;  1EWI A;  2XN9 C;  4IAL A;  4Z9C B;  4Y52 H;  2KHI A;  4EQP A;  1CHQ D;  3BYY B;  2R86 A;  5C4H A;  5C0X I;  1RDP D;  4DV2 Q;  3SK6 A;  3N6R A;  3R23 A;  4ECY A;  4BA1 I;  1GGO A;  3SK5 A;  5IWA L;  5KFO A;  3EQL C;  1B3Q A;  5IP7 G;  2FLN A;  1O80 A;  2ATW A;  4DK0 A;  4F4X A;  4Q5V A;  2QDL A;  3H20 A;  5D3D A;  1EY7 A;  1JB7 A;  1IOW A;  2YZN A;  3NGD A;  2AUK A;  3ZJY C;  3D0F A;  3Q8R B;  2IX3 A;  1O78 A;  3NEM A;  1I3Q B;  4AIM A;  4B3S Q;  4ZQI A;  2B2V C;  3ULL A;  1SEI A;  4CKC A;  1HQR D;  2KJX A;  1PZJ D;  3J80 c;  4AQY L;  4TKO B;  3R5F A;  1S9F A;  2FLL A;  5ELC A;  4UCV A;  2XVS A;  2YTV A;  3SE0 A;  1WTX A;  1MJC A;  4P2C B;  1Z2N X;  4O4H F;  4DUZ Q;  3RAX A;  4HJ7 A;  3F2B A;  1N33 Q;  4B3R H;  4IOC A;  2F4I A;  1HA5 A;  3GTO H;  1GSA A;  4IUR A;  2IMW P;  1Y1V G;  3PUW A;  1LTS D;  3HOW H;  4IRD A;  1RYR A;  1E1T A;  4DFA A;  3S15 H;  3S1R B;  3U58 A;  3PIP 3;  2DNC A;  4XQJ A;  5C3E G;  1YJN A;  3S1N H;  3N6X A;  2NUA B;  3N8D A;  4DK1 A;  2NB0 A;  2R85 A;  3T1Y H;  1WFQ A;  3NEN A;  4NLG A;  1F2L A;  3AQQ A;  5HV6 A;  1PLF A;  2HCC A;  4OO1 G;  1IZ6 A;  1Z6H A;  2YZG A;  4A3C G;  1BXR A;  4A3I G;  3KHL A;  2F0D A;  4OXP A;  4EG0 A;  2XNA C;  4P71 A;  4JV5 H;  1E0B A;  5LMN L;  1DZ1 A;  1PH8 A;  4CJ1 B;  3VR5 A;  4O0A A;  3GV5 B;  1TU2 B;  3KF8 B;  3M9B A;  3K58 A;  1V4Y A;  2W9B A;  3OMG A;  1II3 A;  2Q8I B;  3J80 W;  5JAV A;  3E0E A;  4F4W A;  1KDA A;  2K50 A;  1BKB A;  5I6Y A;  4OWW B;  5HGQ A;  4EBC A;  5FJ8 H;  1FNU A;  1SYX B;  4BBR H;  1VDZ A;  2AQ2 B;  5C3E B;  2EVB A;  4YWL A;  3X3M A;  3CRL C;  2UXD H;  1E22 A;  1STE A;  2SDF A;  4XYO A;  2RCF A;  4JYA L;  2B2W A;  1CSP A;  1I4Q A;  4IUU A;  3CHB D;  2UXC L;  4G3I A;  3UDX A;  1TWC A;  2UUB H;  5C0X J;  2CQO A;  1IBK H;  3BZC A;  2ZM6 H;  4GKJ H;  1SN8 A;  1U4M A;  5FO8 B;  2EY1 A;  4ED1 A;  2AWO A;  3CPF A;  4A3I B;  4YY3 L;  2M00 A;  4OEM B;  2E76 C;  5EJW A;  4X66 H;  3TQY A;  2AHO B;  2QCP X;  1NUC A;  5J1Z A;  4HED A;  1CZG A;  4A3G G;  1QCB D;  4P72 A;  2WAQ A;  3PVX A;  2HQL A;  5CR3 A;  2I46 A;  4ILW A;  4DR5 L;  4ED3 A;  3DM1 A;  3RLO A;  1OXX K;  3GO5 A;  3A74 A;  3TIG A;  1BQQ T;  1RD9 D;  4B3T H;  4LF8 H;  3KJP A;  2OXP A;  3DWA A;  5M5W B;  4YHH H;  1EQQ A;  3DWQ A;  2DPI A;  4KN4 C;  4DAM A;  4MV9 A;  1WCM G;  2PO4 A;  4NXM L;  4LNQ A;  2MNA A;  4HNV A;  4BY7 H;  4FXK C;  3KHH A;  4A3D H;  2EYM A;  4DF7 A;  3KAJ A;  3RTX A;  1XWE A;  3PW7 A;  1VQM A;  2NVY H;  1GUO A;  3RUZ A;  4DV4 Q;  5E3F A;  3Q22 A;  5H80 A;  1XPR A;  4HR7 A;  3TQ1 A;  2VXW A;  3W1G A;  5KFA A;  2EY2 A;  3K5H A;  3CRK C;  1JLL B;  4A3G B;  3H6M A;  2FIN B;  5EQ0 A;  1Y69 U;  3EIV A;  4FBU A;  3NBH A;  5KG2 A;  2LY7 A;  4IR9 A;  1EUJ A;  4JI1 Q;  4LF4 L;  1G6Z A;  4UCU A;  2KUM A;  1KJJ A;  1JT8 A;  3VA5 A;  3PF5 A;  4JK1 C;  4FO2 A;  4JI8 H;  1WYD A;  4R8I A;  2JA5 A;  1EHI A;  4MTN A;  1JX4 A;  5KFQ A;  1WCM B;  3NHH A;  3VPC A;  2A69 D;  4NKL A;  5M3F G;  2JA6 H;  3PZP A;  1NJI C;  2I07 B;  1KRT A;  1PA6 A;  3ICE A;  2FP4 B;  3DF7 A;  4LF5 H;  1U4L A;  1Q90 A;  3I4L A;  4L5R C;  4G4K A;  5DM7 3;  2VR1 A;  1TY2 A;  4J9M A;  3NPP A;  4DV7 Q;  4UP7 A;  4O4L F;  4A3M H;  2OTJ A;  4QWC A;  3NTK A;  4RGO S;  2Z0S A;  1YNJ C;  3MXU A;  1FL0 A;  4HJ9 A;  4YWM A;  2LXJ A;  2E74 C;  3ULJ A;  3RR5 A;  3MWD A;  4EYH B;  1GUG A;  4K8J A;  2O03 A;  1LTT D;  1Y1W H;  5BMV F;  4F4Y A;  1AW7 A;  4B3M H;  1U5K A;  3K5L A;  4EBE A;  5J39 A;  1HJP A;  5CA1 F;  1SJE D;  1HR0 L;  4QWE A;  5K36 G;  5JH7 F;  1BVS A;  1CI3 M;  1HRJ A;  1Q3L A;  1ENA A;  1VQH A;  3RZD H;  2H1E A;  4X64 Q;  3HEJ A;  2E75 C;  3K8A A;  4PWQ A;  2N55 A;  4PV1 C;  2PMZ B;  3HKZ A;  2QA4 A;  5M3F B;  2D9U A;  2FMC A; 
#chains in the Genus database with same CATH homology
 4BY7 G;  1Z9F A;  2ZTD A;  2VY3 A;  4JI5 L;  5M3M H;  2LSS A;  4A3D G;  2ZTE A;  4ALP A;  1GKH A;  3G71 A;  2B29 A;  4LF5 Q;  2RHS B;  3M4O H;  3CCU A;  4C3H H;  2E2J H;  1YIT A;  2JA5 H;  4BBS G;  4A3L H;  1I5F A;  4JOI C;  4LF7 Q;  4B3R Q;  4LFC L;  4DV1 L;  3HOX H;  2R93 H;  4DR3 Q;  4BY1 H;  4QIW E;  3TS2 A;  2JEA I;  3FP9 A;  1L0W A;  2K75 A;  3W1B A;  1YBY A;  4A4I A;  1VQN A;  4LW1 A;  3CC7 A;  2DUD A;  4DKA C;  3CCM A;  1M1K C;  1KQS A;  5C4X H;  3I56 A;  2ZJQ A;  1AH9 A;  4B3M Q;  2PI2 E;  2PQA A;  3S1M H;  3H15 A;  2MO1 A;  4X65 L;  4DV6 L;  3T1Y Q;  5EAY A;  1G6P A;  4LF9 L;  1SLJ A;  1Q8K A;  2VQE L;  1XNQ Q;  1VQI A;  4DV4 L;  1IYJ B;  2JA6 G;  1B70 B;  2WAQ G;  3S2H H;  1TWG H;  2A19 A;  4AH6 A;  1K8G A;  3I4M G;  3CQZ H;  2C35 B;  2UUC L;  4DR1 Q;  3A0J A;  4A3M G;  4JV5 Q;  1RIP A;  4LUV A;  3KJO A;  1L1O A;  4KLK A;  1AE3 A;  2MO0 A;  4LFB L;  2I5H A;  2IT1 A;  4A3F H;  4YWK A;  4JI1 L;  3UE0 A;  2VS1 A;  1Q1B A;  1UEB A;  1J5E L;  1PH4 A;  2KCT A;  2R7Z H;  2I5M X;  3HOZ G;  1E1O A;  1TXY A;  2KCM A;  3CCS A;  1IBM Q;  1E3P A;  1PHJ A;  4LUZ A;  3AYH B;  2D0O A;  2KEN A;  3E9I A;  3CCJ A;  1Q46 A;  1UE5 A;  1VQF A;  4PZ7 A;  1N32 L;  2GVB A;  4JBK A;  2XGT A;  4POG A;  2UXD Q;  1HH2 P;  4JI7 Q;  5IYC H;  3PIP A;  1IBL L;  2NVX H;  2Q2I A;  4LFA Q;  2UU9 Q;  1C7Y A;  2OTL A;  2A8V A;  2UUB Q;  1IBK Q;  2N3S A;  4HIO A;  3OTO L;  2ZM6 Q;  1SFO H;  1PH2 A;  1CKM A;  3ERS X;  4IPD A;  3TRE A;  4GKJ Q;  4OON A;  2E2H H;  4K0K L;  1SRO A;  2F52 A;  1XMQ Q;  2HT1 A;  1S3O A;  4X66 Q;  4HJ5 A;  3H0G H;  5E7N A;  2Z6K C;  1ASZ A;  4A3I H;  2QEX A;  3PV0 A;  4A3C H;  3M4Q A;  4JYA L;  1A0I A;  1XPO A;  4X6A H;  4DV0 L;  4DR4 Q;  4DAY B;  4OWT B;  5FLX c;  3CXC A;  2E5L Q;  1Q81 C;  2JA5 G;  4A3L G;  1KHI A;  4GS3 A;  4DUY L;  1N36 L;  3HOX G;  2BA1 A;  3U50 C;  2R93 G;  1OXU A;  1CKN B;  4X64 L;  4BY1 G;  1NMG A;  4JI2 Q;  2K52 A;  1FGU A;  2D62 A;  4GLA C;  3PSI A;  4JOI A;  2D0P A;  3UDI A;  5BR8 Q;  2AKW B;  2VW9 A;  1KD1 C;  4B3T Q;  1XNR L;  3KFU A;  2YTX A;  4TQU S;  4LF8 Q;  5GAG C;  5C4X G;  2JA8 H;  2EXD A;  1P16 A;  1KRS A;  4R4O A;  5GAH C;  3JAM c;  4YHH Q;  1P8L A;  4GNX B;  4HJA A;  1VQO A;  1W3S A;  3G4S A;  1E24 A;  1Y14 B;  2I0Q A;  4AYB E;  3TEH B;  5JJI A;  4GOP B;  1OXV A;  1KAW A;  1L2F A;  3KDF B;  5FLM G;  3RNU A;  1SMX A;  4JI6 Q;  1MKH A;  2DGY A;  3K80 C;  2WP8 J;  1H95 A;  1M90 C;  4LF7 L;  4B3R L;  3NBH B;  3PO2 H;  1VQE A;  3G48 A;  5GQO A;  4DR3 L;  1JJC B;  4KHP Q;  4JBW A;  1UE6 A;  2KBN A;  1X3E A;  1VQ9 A;  1VQ8 A;  3I55 A;  1A63 A;  3EBE A;  2UUA L;  3CCQ A;  3I4N H;  4L5S A;  4IOA A;  4A3F G;  1SE8 A;  1HZ9 A;  1YHQ A;  2CCZ A;  2GVA A;  2YV5 A;  2WFW A;  5JEA G;  3J7A 5;  4PZ8 A;  3HKZ G;  1QVC A;  1C9O A;  1B8A A;  4LWC A;  2ZJP A;  4OWX B;  2Q2U A;  3AFP A;  3T1Y L;  3S2D H;  2R92 G;  1AE2 A;  4GN3 B;  3F2C A;  1D8L A;  1UWV A;  2JJQ A;  2LXK A;  4JI8 Q;  3J81 j;  4A3K H;  1K9M C;  1XNQ L;  4UP8 A;  3STB C;  1YEZ A;  2Y0S E;  3S17 H;  2HIX A;  3PO3 H;  5IYC G;  1I3Q H;  2PI2 A;  1WI5 A;  5IWA Q;  4DR1 L;  3FKI H;  3PIO A;  1Q1E A;  1WJJ A;  1HNW Q;  4JV5 L;  2OQK A;  4QL5 A;  3WWV A;  1OXS C;  3KF6 A;  2IHE A;  2JA7 H;  1NTG A;  3F8T A;  5IE8 A;  3CD6 A;  2PMZ E;  4DNI A;  2UXB Q;  4GNX C;  4R4C A;  4JI4 Q;  3PF4 A;  1EIY B;  4HIK A;  1BBW A;  1IBM L;  1EOV A;  3HOU H;  3S14 H;  3Q8D A;  3GTP H;  4GOP C;  1K83 H;  3H0G G;  4HID A;  4AQY Q;  1I6H H;  3J81 c;  3UE1 A;  2JK8 A;  1N9W A;  3M4P A;  1W2B A;  5HY6 A;  4DPG A;  3K7A H;  2Z6K A;  4GKK Q;  2UXD L;  4JI7 L;  2CFM A;  2HHH Q;  2MQH A;  5JEA J;  5IP7 H;  3S1R H;  1OXT A;  2F4V L;  4LFA L;  2UU9 L;  2UUB L;  1IBK L;  2ZM6 L;  4GKJ L;  4NPS A;  4IO9 A;  2JA8 G;  5IYD H;  1VQJ A;  3GTG H;  3BU2 A;  4EQ5 A;  3K81 C;  4NXN Q;  1TWH H;  3KLW A;  1C0A A;  1VQA A;  2K5H A;  2YTY A;  1YJW A;  3TRZ A;  3CCE A;  4X66 L;  5LMN W;  2WB1 G;  4R4I A;  4R1J A;  3D31 A;  3PUZ A;  4J15 A;  5IP9 G;  1XJV A;  1UE7 A;  1KL9 A;  2NVT H;  4DR4 L;  2NZO A;  1Q82 C;  2E5L L;  3HOY H;  4DR6 Q;  3E9H A;  4RMF A;  3PO2 G;  3GTQ H;  4LF6 Q;  4JI3 Q;  1VQD A;  1HZB A;  4JI2 L;  4P73 A;  4DK3 C;  5BR8 L;  1Y1W G;  4HJ8 A;  4B3T L;  1BBU A;  3I4N G;  2K5V A;  2VQF Q;  1A8V A;  2BH2 A;  3GTM H;  3RZO H;  4KI0 A;  1HNZ Q;  4LF8 L;  2OQ0 A;  4BXX H;  4YHH L;  1Y1V H;  2N8N A;  3AFQ A;  3K7U C;  5LMN Q;  4RG1 A;  2CKZ B;  1JE5 A;  2K4K A;  3KYH C;  1S40 A;  4DV7 L;  1MJE A;  1SR3 A;  4GN4 B;  3RN5 A;  3SGI A;  2VUM H;  1XMO Q;  5C3E H;  1I50 H;  1N8R C;  3HOV H;  4JI6 L;  3ULP A;  4WJ3 M;  1HZC A;  1Q12 A;  2OCE A;  4A3K G;  3UDG A;  1X3G A;  4AYB G;  3I4O A;  1PH5 A;  1D7Q A;  4A3J H;  1KC8 C;  1L1O B;  3H3V H;  2OWO A;  3PO3 G;  5M3M G;  3PUV A;  1U0L A;  1VQ6 A;  3FKI G;  3KOJ A;  1FJG L;  1J6Q A;  1S72 A;  4QGU A;  4JYA Q;  1GO3 E;  4OX9 Q;  3GD7 A;  2JA7 G;  3A5Z B;  4PG3 A;  2BA0 A;  2UXC Q;  2FXQ A;  1X55 A;  2IX0 A;  2WAQ E;  3F2D A;  3HOU G;  2K5N A;  1EWI A;  2I5L X;  4Y52 H;  2KHI A;  2A1A A;  4GLV B;  4YY3 Q;  4JI8 L;  5C0X I;  2B3G A;  4DV2 Q;  4BBS H;  3H3V I;  3DM3 A;  1G29 1;  3HFZ B;  4BA1 I;  2CWA A;  2PNH A;  3MXN B;  4A75 A;  1HZA A;  1T9H A;  1VQ5 A;  5IWA L;  5C4J H;  2ALY B;  4OO1 I;  1YNX A;  5IP7 G;  3CCL A;  4DV5 Q;  5M5W H;  2ATW A;  4LF5 L;  2JE6 I;  1HNW L;  1YHB A;  2Y0S G;  4DR5 Q;  1RL2 A;  1JB7 A;  1E7Z A;  1NE3 A;  4FDB A;  1SRU A;  3D0F A;  3ZJY C;  1Q7Y C;  1NMF A;  5IYD G;  3RN2 A;  1J5E Q;  3I2Z A;  4L5T A;  2UXB L;  3NEM A;  1QUQ A;  4H02 A;  4AIM A;  3GTK H;  4JI4 L;  4DR7 Q;  3PUX A;  1QZG A;  4B3S Q;  1EFW A;  4YCV A;  3ULL A;  1PVO A;  1A62 A;  3JC6 6;  2NZH A;  3GTJ H;  1JMC A;  3J80 c;  4AQY L;  1QVF A;  2ZTC A;  3STB D;  1YIJ A;  4NXM Q;  5IY0 A;  1MIU A;  4XTC S;  5DLQ E;  3HOY G;  3S1Q H;  4GKK L;  1TWF H;  4B3M L;  2YTV A;  2R7Z G;  2HHH L;  3PGZ A;  1MJC A;  1NY4 A;  4L5Q A;  4APV A;  4A93 H;  4DUZ Q;  4A3G H;  4HJ7 A;  2GN5 A;  3F2B A;  1N33 Q;  4IOC A;  2NN6 I;  3T1H Q;  3AEV A;  1Z47 A;  1R9T H;  4XIG S;  3GTO H;  2JQO A;  2IHF A;  4UPA A;  4BXX G;  2H5X A;  3JAM i;  3B6Y A;  3HOZ H;  1Y1V G;  3GDE A;  3PUW A;  4NXN L;  1PH7 A;  3HOW H;  1CUK A;  1E1T A;  3CF5 A;  5GAD C;  2YU9 H;  3S15 H;  3U58 A;  1HNX Q;  2VUM G;  3S1N H;  1YJN A;  2RCN A;  5C3E G;  1X65 A;  4Y7N H;  1WCM H;  2RF4 A;  2QGQ A;  4LF4 Q;  5C0X G;  3M3Y H;  1YHA A;  3K0X A;  4A3J G;  1WFQ A;  1PH6 A;  3NEN A;  2VNU D;  1PV4 A;  3EN2 A;  3CPW A;  3CCV A;  3MEF A;  4DR6 L;  5JJK A;  1QVG A;  3S24 A;  3AQQ A;  4LF6 L;  4JI3 L;  4EX5 A;  1GVP A;  1N34 Q;  4OO1 G;  1YI2 A;  1IZ6 A;  4JG2 A;  4GN5 A;  4NB3 A;  5IYB H;  2VQF L;  4A3I G;  4A3C G;  1CKO A;  4OXP A;  1HNZ L;  2AWN A;  3L7Z C;  4A3B H;  5AJ3 Q;  4P71 A;  2N49 A;  5M5Y H;  5LMU Q;  1PH3 A;  1HR0 W;  5LMN L;  2NVQ H;  1PH8 A;  4YCU A;  4O0A A;  4IPH A;  2N78 A;  3KF8 B;  3M9B A;  1XMO L;  4BA2 I;  3NEL A;  1K0R A;  1PH9 A;  1VQB A;  2E8G A;  1PYS B;  1X6O A;  3E0E A;  4IFD I;  2K50 A;  4OWW B;  1BKB A;  3BJU A;  4P75 A;  4JC0 A;  5HGQ A;  1XMQ L;  3KF6 B;  3CAM A;  3DLL A;  5FJ8 H;  5C44 H;  4BBR H;  1LYL A;  3HKZ E;  4PZ6 A;  4YWL A;  2MFI A;  4DK6 C;  2UUA Q;  1E22 A;  4DV3 Q;  2NN6 G;  4X62 Q;  5M3F H;  4C3J H;  4DR2 Q;  1HR0 Q;  4OX9 L;  1K3R A;  1GM5 A;  4JI0 Q;  1CSP A;  2BH8 A;  2B63 H;  3OYY A;  4O2D A;  3TS0 A;  1IXR A;  2UXC L;  3UDX A;  1LTL A;  1NBW A;  3PCO B;  2CQO A;  2JA9 A;  5C0X J;  3BZC A;  1VQ4 A;  1EQR A;  1X9N A;  4POF A;  4KHZ A;  1EYG A;  1SN8 A;  1YJ9 A;  4HIM A;  5FLM H;  2Q2H A;  4MNO A;  2AWO A;  2VL6 A;  2PQA B;  3CPF A;  3J81 i;  1JJ2 A;  1I94 Q;  1GD7 A;  4YY3 L;  3RLN A;  4DV2 L;  4JBJ A;  4P74 A;  1XTD A;  4A3E H;  3TQY A;  2JEB I;  4JI5 Q;  2AHO B;  2HIV A;  4IPG A;  1WOC A;  4C2M H;  4GLX A;  2F3I A;  2E2I H;  4A93 G;  1EIF A;  4A3G G;  4IJH A;  4P72 A;  3U4V A;  4DV5 L;  3IRB A;  1K8A C;  1XPU A;  3CME A;  2HQL A;  2ES2 A;  3U4Z A;  4DR5 L;  3LGJ A;  3RLO A;  1OXX K;  5IT9 c;  3GO5 A;  1O7I A;  3A74 A;  1PH1 A;  3ER0 A;  4YCW A;  4DV1 Q;  2VZA A;  4LFC Q;  1K73 C;  1X56 A;  5ELO A;  3HOW G;  4DR7 L;  4R4Q A;  3VDY A;  4B3S L;  3KJP A;  4R4T A;  5GAE C;  4KHP L;  3A5U A;  1VS0 A;  4TVA B;  2R92 H;  1EQQ A;  3CCR A;  4JBM A;  4PMW A;  4DAM A;  1WCM G;  5GRO A;  1X3F A;  1CKN A;  4IJL A;  4UP9 A;  4LNQ A;  4NXM L;  5J3B A;  3UDF A;  2MNA A;  4BY7 H;  4IFD G;  4A3D H;  2R7D A;  2CWP A;  2XTI A;  1OTC A;  4X65 Q;  4DUZ L;  2NVY H;  4DV6 Q;  1VQM A;  2F4V Q;  4WJ4 A;  4GNX A;  1N33 L;  4LF9 Q;  4MZ9 A;  5IYB G;  1YZ6 A;  2VQE Q;  3T1H L;  2ZJR A;  4DV4 Q;  3M7N A;  1TWA H;  2WB1 E;  1XPR A;  4UY8 C;  1JJG A;  2R6G A;  3FHW A;  3W1G A;  4GOP A;  4A3B G;  5M5X H;  3KDF A;  2UUC Q;  3M85 A;  1LM0 A;  3GTL H;  1HNX L;  3J7Z C;  1UE1 A;  2Q2T A;  4QY7 A;  3EIV A;  2IY5 B;  5JJL A;  1CSQ A;  1TWC H;  4LFB Q;  1VCI A;  2EIF A;  1EUJ A;  4JI1 Q;  4LF4 L;  1JT8 A;  3G6E A;  1VQG A;  3PF5 A;  3CMA A;  1IL2 A;  4JCV E;  1WYD A;  5FJ8 G;  4QQB X;  5C44 G;  2ID0 A;  4ME3 A;  4BBR G;  1N34 L;  2ASB A;  4MTN A;  2YYZ A;  1LUZ A;  3W5O A;  3CW2 C;  1N32 Q;  5M3F G;  2JA6 H;  4QJF A;  1V43 A;  1KRT A;  1PA6 A;  1NJI C;  2B63 G;  3ICE A;  1X54 A;  5AJ3 L;  3CC4 A;  5LMU L;  1ASY A;  4L5R C;  3I4M H;  3PUY A;  3CC2 A;  1IBL Q;  1L1O C;  4DV7 Q;  2L15 A;  4UP7 A;  1FVI A;  4IFD J;  1KXL A;  4A3M H;  1B7Y B;  3S16 H;  2OTJ A;  2Z0S A;  5IP9 H;  1VQP A;  1FL0 A;  4IPC A;  1PFS A;  1VQC A;  3L0O A;  3OTO Q;  4YWM A;  4C3I H;  3RLF A;  4HJ9 A;  2IX1 A;  2LXJ A;  3BZK A;  3ULJ A;  4A3E G;  1VQK A;  4K0K Q;  3RR5 A;  1DGS A;  1VQL A;  2R7F A;  3CP0 A;  5H1S E;  1Y1W H;  1FJG Q;  1QUQ B;  2K14 A;  1U5K A;  1VQ7 A;  2RHQ B;  2V1C C;  4DV3 L;  1HJP A;  4A76 A;  4X62 L;  4DV0 Q;  1QZH A;  4DR2 L;  1HR0 L;  3HOV G;  5K36 G;  4JI0 L;  2EQS A;  1YVC A;  1BVS A;  4DUY Q;  1N36 Q;  1V1Q A;  1VQH A;  3L2P A;  3RZD H;  4LUO A;  4X64 Q;  1KIX A;  1G51 A;  2AMC B;  3K8A A;  3HKS A;  1XNR Q;  3J80 i;  5ELN A;  2KHJ A;  2QA4 A;  3OW2 A;  3F1Z A;  1I94 L;  1V9P A;  1PYB A;  3I7F A;  1Q86 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...