2Y0SE

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
170
structure length
164
Chain Sequence
MYKLIKARSIVRIPPNEFGKPLNEIALNELRQQYQEKILKDLGLVLAILNVKTSEEGMLVFGDGATYHEVEFDMITYVPVVQEVVEGEVLQVDNYGVFVNLGPMDGLVHISQITDDTLKYDNVRGIIFGEKSKKVIQKGDKVRARVISVASPRIALTMRQPYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
total genus 16
structure length 164
sequence length 170
chains with identical sequence T
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2y0sE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2y0sE01
4A3DG 1J5EQ 2XGTA 2MFIA 2BA0A 1PH5A 2OWOA 1GKHA 2JEBI 3GTQH 4X6AH 4A3JG 1PH7A 3HFZB 1K3RA 4UPAA 4R4OA 4DAMA 4DUZL 1S40A 4DR3Q 2A1AA 3U58A 1HZCA 2UU9Q 4JI3L 1Q7YC 4JI5Q 4JI7Q 5IYCH 1YHQA 2JA6H 1K0RA 1PYBA 4R4TA 2UXCQ 2HHHL 4DR6Q 3CW2C 2IT1A 5GAHC 1CKNA 3NENA 4QGUA 1I50H 2D0PA 3IRBA 5C4XH 1K9MC 3HOWG 1VQFA 4LUOA 1M90C 3B6YA 3J80i 1BBUA 2PQAB 3RLOA 5M5XH 1SROA 2Q2IA 3KDFB 1JJ2A 4NXNQ 2K4KA 2VW9A 2JJQA 4DV0Q 4AQYQ 2JA5H 4BXXH 3TEHB 5IT9c 4LUZA 4A3DH 3KLWA 1EQQA 5C0XI 2VL6A 3RNUA 3ULLA 2JA7G 3Q8DA 3PUVA 3PUWA 2YV5A 4HIOA 3I56A 3H15A 1VQ6A 3TS0A 3WWVA 1G51A 3CCSA 4LF4Q 2JEAI 2CWPA 1KAWA 1SN8A 3AFQA 3PGZA 1HZ9A 4L5TA 4XIGS 4A3IH 2UXDL 3L2PA 2NZHA 3G48A 5FLMG 4JI2L 2E2JH 1XNRL 2DUDA 5IP9G 3U4ZA 2WAQE 1TWAH 1FVIA 5M5WH 1NY4A 2I0QA 4GLVB 3I4OA 1HZBA 4O0AA 1XJVA 4AYBE 1PVOA 1R9TH 4JBKA 4A76A 1X65A 3K80C 3PUYA 1V9PA 2RHSB 5E7NA 4APVA 4PZ6A 1KIXA 3I2ZA 2WB1E 3J7ZC 1WFQA 2IX0A 4LF4L 4IFDG 4R4QA 5EAYA 2JA7H 1E7ZA 2EQSA 2K5HA 4YHHQ 5IYBH 1GD7A 2CCZA 3BZKA 5BR8L 3K8AA 3K0XA 1YI2A 1JJGA 3RN5A 4LUVA 2VZAA 1VQPA 3GTLH 2BH2A 1JT8A 2VQFQ 4OWTB 4IPCA 4L5SA 4JC0A 3AFPA 4POFA 5FLMH 4DR4L 3G4SA 3FP9A 3PO3G 2JE6I 5IP9H 1NE3A 4GLXA 4DV3L 3F2BA 1IZ6A 1CSQA 3CCVA 4DR7L 4WJ3M 1EYGA 1YVCA 1GO3E 3D0FA 4IJLA 1QUQA 3NELA 4X65L 3J7A5 4B3RQ 3J81j 1KRSA 1WJJA 4GOPA 1WYDA 1XMQQ 4A3EG 1V1QA 1XPOA 3S1RH 4RG1A 1QVCA 3NEMA 5DLQE 2ZJQA 4UY8C 2CFMA 3I7FA 3AEVA 3PV0A 1YEZA 1CKOA 1QVFA 4OONA 3F8TA 4DV7L 3M85A 1IBLL 4A93G 2ZTCA 4B3MQ 4KI0A 3L0OA 4P71A 3S24A 3U4VA 3PO3H 1YJWA 1PH3A 2KBNA 1N34L 3CCQA 2RHQB 1X6OA 1KC8C 4LF7Q 4QQBX 3MEFA 4A4IA 5HGQA 1XMQL 2RF4A 3KF6A 3J81c 1H95A 4Y52H 1X54A 2R6GA 2WAQG 3DM3A 4ME3A 5J3BA 4HJAA 5M3MG 4DR1Q 4BY1H 4A3BG 4A3EH 3MXNB 4GN5A 1EOVA 4DV1L 4AYBG 1HNWL 2FXQA 3PO2G 1L1OA 4X66Q 2UXBL 1E1OA 4BBRH 2AWOA 2R93H 4IFDI 4JG2A 2WB1G 1P16A 4O2DA 4GKKQ 2K5VA 2VY3A 4A3MH 4JI1Q 4RMFA 5JEAJ 1IBML 4A93H 5C3EG 1OXXK 2C35B 1T9HA 2F52A 4HJ8A 3PCOB 2I5HA 3EIVA 1BKBA 3RLNA 2MO0A 1JB7A 2MO1A 2UXBQ 4DUYL 4B3TQ 4YWKA 3F2CA 2YTVA 1EUJA 1RIPA 4DAYB 5C44G 1W2BA 3GTJH 1JJCB 1VQKA 3ER0A 2AMCB 5IYCG 2JA6G 4JCVE 4DUZQ 1OXUA 4KLKA 4P73A 2VS1A 4AH6A 2WP8J 2ZM6L 4WJ4A 4DNIA 2Y0SE 3CMEA 4GNXB 5C4XG 4JI3Q 1DGSA 2OQKA 1L0WA 3H3VI 2HHHQ 2OQ0A 4JI6L 2ID0A 4A3CG 1XPRA 1QZHA 4B3SL 2JA5G 4BXXG 3EN2A 1PH1A 1SE8A 1IYJB 4C3IH 1I6HH 3DLLA 1SLJA 1WCMG 4DV5Q 3RZDH 4OO1G 4R1JA 4IO9A 5IWAL 2IHFA 3PF5A 2D0OA 2E8GA 3K81C 1PHJA 4UP7A 1E3PA 4BBSH 1X56A 2QA4A 5C44H 2IY5B 5GROA 1KL9A 1N36Q 1EWIA 4FDBA 4A3IG 2DGYA 3M3YH 1YJNA 5JJIA 4P75A 5C0XJ 3ZJYC 3A5UA 1JE5A 4JI8L 2N8NA 4A3GG 4DV4L 2KHIA 1PH4A 2L15A 4JYAQ 3UE1A 2UXDQ 3PSIA 4DV5L 4JI2Q 2BA1A 2AHOB 4JOIC 4NXML 1XNQL 1XNRQ 3GTPH 3PO2H 1KRTA 4A3CH 1Q81C 3KFUA 1B7YB 3G71A 4IPHA 1WCMH 1CSPA 3JAMc 1IBKL 4K0KL 1N36L 3CPFA 2EIFA 2OTJA 5K36G 1NJIC 1MJEA 3A5ZB 5AJ3L 5IYBG 4OX9L 2Q2UA 4LF9L 4HJ5A 3S2HH 3GDEA 1HNXQ 1AE3A 2N78A 4IOCA 4JYAL 4NB3A 2KCMA 3HOVG 4YCWA 5BR8Q 2YTYA 3TREA 4DK3C 4DV2L 1QVGA 1ASZA 4A3GH 3KF8B 1MKHA 2ATWA 4DR4Q 5ELOA 5GAGC 3HOYG 3STBD 1LYLA 2Y0SG 1X3FA 4DV3Q 3A0JA 1E1TA 1MJCA 4DR7Q 1CKNB 1PV4A 1NMFA 1J6QA 1VS0A 1VQAA 2HQLA 4X65Q 1HNXL 4XTCS 2KCTA 4OO1I 2R7FA 4POGA 1YZ6A 2UUAL 1SFOH 2F4VL 2Z6KC 4GKJL 4OWXB 3AQQA 2HT1A 3HOVH 5GADC 3CCMA 4DV7Q 4X62L 4LF8L 2R92H 5IYDH 3STBC 1IBLQ 1VQLA 3NBHB 5JJKA 3KYHC 4UP8A 2IHEA 3BZCA 1N34Q 1Z47A 1FJGQ 3HOYH 4BY1G 5FLXc 4L5RC 2H5XA 1YJ9A 1EIFA 2NN6G 2RCNA 2UUCL 4LW1A 4BBRG 2R93G 1UE6A 2HIVA 4DR5L 4DV1Q 1HNWQ 3CCJA 4A3MG 3S2DH 4LFAL 4JI0L 3BU2A 1VQMA 4BA1I 4LF6L 1PH8A 4HIMA 3A74A 2F3IA 4DK6C 1NBWA 2R7ZH 1FJGL 1BBWA 4X64L 4IFDJ 1G6PA 1VQ4A 3I55A 1IBMQ 3HKZE 4MZ9A 5JEAG 1VQ9A 1X3GA 4DR2L 1HR0L 4HIDA 1QZGA 2OCEA 2VQEL 1PA6A 3TS2A 1Q12A 4DUYQ 4GN4B 1EQRA 4QL5A 1XMOL 2YU9H 1N32L 2JA8G 4ALPA 3ERSX 4QY7A 1YBYA 3OYYA 2B63G 4A3FG 2PI2E 2ZTDA 1K8AC 4BY7H 4JBWA 1QUQB 1XPUA 4JV5L 1C7YA 1EFWA 3CMAA 2ZM6Q 4LFCL 3I4NH 4GOPB 2E5LL 2LXKA 1PH2A 2GVAA 2K50A 1N33L 2ASBA 1Y1VG 1AE2A 3UDXA 5M5YH 3CCEA 1LUZA 2OTLA 3J80c 4LWCA 3UE0A 4JI6Q 3FKIH 2JA9A 2VUMG 4B3SQ 1K8GA 4P72A 4H02A 3CD6A 4BBSG 2QEXA 3H0GH 5IWAQ 4LFBL 1AH9A 1UWVA 1V43A 1CUKA 2GN5A 2JA8H 4JOIA 4IOAA 3KF6B 4A3FH 4JI4L 3E9HA 1UE7A 1UEBA 2AKWB 2NN6I 4GN3B 1OXVA 3CAMA 4HJ7A 2UUBL 1IL2A 4C3JH 3OTOL 3K7AH 1OXSC 5LMNQ 1HNZL 3CC2A 1A8VA 4B3TL 3ICEA 4JI8Q 3HOUH 1TWCH 1Z9FA 3CP0A 4DV4Q 1Y1VH 3M4QA 2PI2A 3FHWA 5LMUL 1LM0A 1WI5A 1L1OB 3M9BA 3RR5A 4NXMQ 1XNQQ 4A75A 3HKSA 2VUMH 3S16H 3CQZH 3LGJA 3SGIA 2B63H 1TXYA 2HIXA 2PQAA 4R4IA 4C3HH 3KDFA 1IBKQ 3GTOH 4K0KQ 4GNXC 4JBJA 1PH6A 2KHJA 4GS3A 4LF5L 3HKZG 3CCUA 2QGQA 4A3LH 4YCVA 5AJ3Q 1Q86C 4OX9Q 4LF9Q 3E0EA 1Q1BA 5LMNL 1Q82C 1VQEA 4HJ9A 3T1HQ 1HR0W 1M1KC 5JJLA 1VQHA 4NPSA 1IXRA 4QJFA 5HY6A 3KJOA 4KHPL 1YHBA 1Q8KA 1SR3A 2IX1A 3HOZH 3TRZA 1K73C 2A19A 2Q2HA 5FJ8H 3CCLA 3S1NH 1VQGA 4DV2Q 4MNOA 2KENA 1L2FA 1K83H 1NTGA 3PUZA 2NVYH 2Z6KA 2CKZB 1P8LA 3W1GA 1RL2A 2CQOA 1FL0A 2ZTEA 4YY3L 5H1SE 2NVTH 3T1HL 1VQ7A 3CF5A 1I94L 2I5MX 3RN2A 1VQ5A 3T1YL 2UUAQ 3KJPA 2F4VQ 1Y1WG 1Q1EA 1X55A 2R92G 5IYDG 3CC7A 4IPDA 2I5LX 4GKJQ 2V1CC 2K52A 2LXJA 1J5EL 4DPGA 1UE1A 2NZOA 3EBEA 3OW2A 2MQHA 4X62Q 4LF8Q 4C2MH 4OWWB 3S15H 3K7UC 1OTCA 1JMCA 4LNQA 4YWMA 4DR3L 2JQOA 2EXDA 4TVAB 4JI5L 4PZ7A 2UU9L 4A3JH 4JI7L 3PF4A 2UXCL 5GQOA 2E2HH 4DR6L 1VQCA 5M3FG 1ASYA 2N49A 5IP7G 1VQIA 1S3OA 1VQJA 2XTIA 1WOCA 1OXTA 1YIJA 3RLFA 2UUCQ 1C9OA 3PIPA 5ELNA 4NXNL 1X3EA 1B8AA 3M4PA 3HOXG 4DR5Q 4AQYL 4DV0L 1Y1WH 3HOWH 3UDFA 1KHIA 2R7ZG 2ES2A 1HJPA 3E9IA 4LFAQ 4JI0Q 2K5NA 2B3GA 1G291 1GVPA 4PG3A 4LF6Q 5IE8A 3M7NA 4YWLA 5LMNW 3VDYA 4X64Q 1PH9A 1UE5A 1U5KA 3GTGH 3AYHB 4EQ5A 1FGUA 2NVXH 3F2DA 1A62A 4DR2Q 1YITA 1KQSA 1HR0Q 1O7IA 2D62A 2CWAA 3D31A 4L5QA 2VQEQ 3CCRA 4BY7G 4IPGA 4MTNA 1XMOQ 3UDIA 1VQNA 4J15A 1N32Q 5M3FH 4JBMA 4P74A 5IP7H 3I4NG 4A3KG 1VCIA 1VQOA 3I4MG 2K14A 1LTLA 4DKAC 1MIUA 3HOXH 1HH2P 3CXCA 4JV5Q 4LFCQ 3S1MH 1D7QA 3FKIG 2E5LQ 3JAMi 4R4CA 3PUXA 1N33Q 3M4OH 1C0AA 3H0GG 1E22A 3W1BA 2YYZA 1NMGA 1KD1C 5IY0A 4PMWA 4YHHL 4AIMA 4LFBQ 2ALYB 2VQFL 5GAEC 4GLAC 1U0LA 2ZJRA 2PMZE 1TWHH 2AWNA 4A3KH 4IJHA 1X9NA 1HZAA 4JI4Q 2A8VA 3HOUG 4KHZA 5C4JH 2LSSA 4DV6Q 2UUBQ 3I4MH 1HNZQ 3OTOQ 3CPWA 4B3RL 4HIKA 2R7DA 3ULJA 2N3SA 1E24A 2WFWA 1Y14B 4GNXA 1Q46A 3RZOH 2JK8A 3GD7A 5LMUQ 3JC66 1VQ8A 4A3LG 1I3QH 1SMXA 2K75A 2GVBA 3H3VH 1PFSA 4GOPC 4TQUS 3PIOA 4B3ML 3KOJA 3CC4A 4LF5Q 4BA2I 1BVSA 4DV6L 3HOZG 1A0IA 4LF7L 1A63A 3S1QH 2YTXA 5FJ8G 5C0XG 3ULPA 3GTMH 4KHPQ 2MNAA 1VQBA 4EX5A 4PZ8A 3U50C 4QIWE 1GM5A 4DR1L 1S72A 2ZJPA 3F1ZA 1B70B 1SRUA 4YCUA 1TWGH 1YNXA 2VNUD 1D8LA 1XTDA 2NVQH 1YHAA 1CKMA 4X66L 4A3BH 1PYSB 2Q2TA 2E2IH 1KXLA 5M3MH 4UP9A 1N8RC 1I5FA 1W3SA 4GKKL 3UDGA 3TQYA 2Z0SA 2PNHA 4JI1L 3S14H 3L7ZC 3S17H 4YY3Q 3GO5A 1VQDA 3GTKH 1I94Q 3W5OA 3T1YQ 1TWFH 1L1OC 2B29A 4OXPA 1N9WA 1EIYB 4Y7NH 3G6EA 3J81i 5C3EH 3BJUA 2BH8A
chains in the Genus database with same CATH superfamily
3HKZB 1J5EQ 2O5JC 5BPFA 2R87A 4APMA 2MFIA 2BA0A 3GTQH 2XWBB 3I4LA 1I6UA 2K5DA 1S40A 4TV9F 4ILWA 4V0BA 4ZK9B 5CV5A 5D8DA 3BQ2A 1S4ZA 2JXMB 3BYTB 1MZBA 1PYBA 4R4TA 3S15B 2UXCQ 2IX3A 2F1MA 2C9OA 5IT9W 3ORRA 2IT1A 2D0PA 4ED6A 3JZIA 2BE5D 1BXTA 3B6YA 2PQAB 2E2HB 1SROA 2F0WA 2Q2IA 3KDFB 3PR5B 1JWSD 1BNZA 4DV0Q 4J9RA 1IW7D 3GQBA 4Q0YA 5IT9c 4ODGA 1AZPA 4LUZA 5EWGA 2E74C 1H9SA 1R4QB 2VL6A 3GIIA 2JA7G 1SBBB 5CV8A 5CBAE 2W6MA 5FO9B 5IYZF 5A35A 3QOLA 3TS0A 1G51A 3CCSA 4LMYA 4H0LC 4XIGS 5D1OB 3G6JB 1S0NA 1N48A 1MD2D 3G48A 1XNRL 2NVXB 1BR9A 2E2JH 1YNJD 4KY6A 4OELB 3U4ZA 2XCAA 2WAQE 5M5WH 1NY4A 2ZXOA 2I0QA 2B2WC 4GLVB 2V9WA 5I9PA 1HZBA 1R9TH 3PUYA 3DXJC 2RHSB 3ZYYX 4EQNA 5I4DA 4I7AA 2DY7A 2OH2A 4LF4L 1PZID 2A6HC 1E7ZA 4K6LA 1AZQA 1GD7A 3K8AA 5FD5A 1AEXA 1S68A 1CA6A 4UCTA 1RTOA 1JT8A 4TKOB 4PV1C 4X65H 3GIJA 1S10A 3VMMA 1S5DD 4POFA 5FLMH 4DR4L 3G4SA 5IP9H 2W8KA 1NE3A 4GLXA 3ETJA 2R6FA 3F2BA 1IZ6A 4DGZA 3RJ0A 1E4FT 4J9NA 1YVCA 1FNWA 4IHJF 5DG9A 3OSOA 3J7A5 2F0EA 1PLFA 1KRSA 3GTJA 4FS2A 3Q24A 3WOEA 1XPOA 3S1RH 4J9PA 4UY8C 2C5CA 3UI2A 3PW7A 3A54A 1NNXA 4OONA 1VMCA 2PN1A 1HXYD 1CZGA 1LV9A 2KECA 1IBLL 3MFHA 1HR0H 5I9OA 2A5HA 3S24A 3PO3H 1PH3A 1N34L 1X6OA 2F0UA 3W3AA 2RVLA 1T5XD 2FLNA 3PW2A 1TIID 2IJ0A 3CQZA 2FMAA 1H95A 1JB3A 3HBLA 3A55A 2A6ED 3MFYA 4M1UB 1Q8IA 5CAEB 1IBMH 1EOVA 4F8MA 3Q23A 4FF4A 1YNNC 4O2BF 4CC6A 5CA1F 3V96A 2AWOA 3E5SA 4O2DA 1Q90A 4RAZA 2K5VA 3C3LA 1NSNS 3K59A 1M6VA 1V1OA 2F52A 2ZDGA 3D8GA 3PCOB 3EIVA 4NKLA 3S14B 2FINB 3RLNA 1PFMA 2YTVA 2FJ2A 3GTJH 1Q3LA 1JJCB 4Y7NB 3VPBA 5C3EB 2AMCB 2JA6G 3WOFA 3MXPA 5LL6b 3HKZA 4DUZQ 5JQWA 4KLKA 5C4ZA 1SMYD 5ELFA 4GNXB 4JI3Q 1DGSA 4DNTB 4XX0B 4HSVA 3RTXA 3VPDA 4U673 3I8ZA 2OQ0A 1D1KA 1RHPA 2C2DA 4CDFC 1XPRA 2UVWA 4BXXG 1VDZA 3DLLA 3BA8A 4R1JA 4IO9A 3VYTA 5IWAL 5L9XA 2VPQA 4R9WA 4RUAA 4ECVA 3PF5A 4PNYA 1RJTA 4MAMA 4J9SA 1SNMA 4UP7A 4EEYA 4JI8H 2QA4A 2IY5B 1CT1D 4FF3A 2CW7A 2P0AA 4NXMH 2K33A 3Q8QB 2WV6D 1YJNA 1DOLA 3KALA 1B6RA 3AB9A 2PMZB 4XZ3B 5KFUA 5KFBA 2N8NA 2R92A 3QJYA 1IBKH 2FB9A 4JI2Q 1XNQL 3G6XA 1NUCA 3EA6A 4OEMB 1HTLD 4A3CH 2WINB 1KTKA 1Q81C 4A3IB 2N88A 4OX9H 1ILQA 4FF2A 2HDLA 3W2DA 1I94H 2WACA 2JEFA 3JAMc 3EROA 3HB9A 3SR1A 2NVXA 2D5DA 5AJ3L 4EBCA 5IYBG 1B1ZA 4LF9L 3PVXA 3G6VA 1V51A 4IRKA 2BQ3A 3K57A 5KFEA 3MR5A 5JVH3 3IAYA 4YCWA 4EGQA 3C46A 3TREA 2JA7B 4A3GH 4ZOLF 2O4XA 1VBGA 1B33N 1MKHA 5KFKA 5CORA 1SAPA 1ZXTA 5GAGC 3STBD 3HOYG 2Y0SG 1X3FA 2VA3A 2F4VH 4KV6A 1KDCA 3GIKA 2EY5A 3VR2A 2R7FA 2DIKA 1YZ6A 3MC0B 3PR4A 2NYZD 3HXLA 2NU9B 2XN9C 4ZLTF 3HOVH 3CCMA 3UQ8A 3NWSA 4N8X1 4DV7Q 2R92H 5JJKA 3MAQA 3NBHB 5C5MA 1WTVA 4UP8A 2IHEA 3ORQA 4KHVA 2X6GA 4ZKCB 1FJGQ 1XWEA 3MFGA 4RCOA 4ABNA 4J0MA 4LFAH 3EVQA 1GUTA 1BNCA 2UUCL 1VAJA 1HUNA 4BBRG 4KY5A 2WIIB 2F0KA 2HIVA 1HNWQ 1HHVA 4RAYA 4EG0A 4BY1B 4BA1I 4LF6L 4DR2H 3R93A 4EYHB 1ZETA 3Q6SA 5EPLA 1I3QB 4IR9A 4ZI7F 4X64L 2W6NA 2ZXPA 4O1NA 1VQ4A 1X3QA 1KAAA 4MZ9A 3FPUB 1C8CA 1EY9A 1X3GA 4A3MB 1HR0L 2OCEA 2PW5A 1Q12A 3NE5B 4DUYQ 3SE7A 3Q8RB 3DWPA 4HQ6A 1WTOA 4FVMA 1YBYA 3OYYA 2EYOA 2RA4A 2B63G 2ZTDA 4BY7H 5EZYF 2ENBA 2XGQA 1QUQB 3KLSX 3TDQA 1FGBD 3HGBA 2ZM6Q 4RB0A 4Q8FA 1SYGA 1C48A 4ZUIA 3PMFA 2LXKA 2GVAA 4IQZA 2KSWA 2ASBA 4EGJA 5LHY1 4G7ZC 2XD4A 1KEEA 4J1MA 4JI6Q 1Y8PB 4RH6A 2VUMG 1A3UA 4B3SQ 4J6HA 5ELDA 3GTKB 1I6VC 2J6SA 1JOQA 5JEAH 3P75A 4DV6H 4K6DA 2UUBH 1RJPA 1UWVA 4C3IB 2B2YC 4FBUA 1B4OA 4IUTA 2JP1A 4DK1A 2JA8H 4JOIA 4MV3A 1HTPA 4A3FH 4JI4L 1SYEA 3CAMA 4F87A 3PO2G 5LMNQ 1JCKB 1JOKA 3KHRA 5EBCA 2B2VA 3J7AK 2HGSA 2HQEA 3M4QA 2PI2A 3I12A 4HSPA 1LM0A 1WI5A 3RB6A 2K32A 1V1PB 2PMZA 3S16H 2AGQA 2HDMA 5KG2A 1SJHD 3C1EA 4IUNA 4KKSA 4RCNA 4KHPH 4K0KQ 2JEJA 1RTNA 4GNXC 2KHJA 4GS3A 4R8NA 1ENCA 4YCVA 4YR2A 1A3TA 1KLGD 4UCSA 5CV7A 1CM9A 1HR0W 3MJFA 2CHBD 2OT2A 3GV6A 1M1KC 4NPSA 3KK7A 2BDOA 5C5LA 1SR3A 5E3FA 5KG3A 1GLVA 3C0FB 2IL8A 2A19A 3S2HB 5FJ8H 3N44B 3OMGA 5EWEA 4JW0A 4QUFA 3SK6A 1ENFA 5C0XH 1I4GA 2KCNA 3ND9A 2ZDQA 5G3LF 1W6KA 1DXMA 1NTGA 4IUQA 1V4YA 3JAME 2ASJA 3W1GA 1GHKA 2DNCA 3HP3A 1VQ7A 1I94L 2I5MX 1BDOA 3BG3A 4XQQA 4MHEA 3KJPA 2UUAQ 5IYDG 4ECYA 2I5LX 3EYYA 3KHLA 2UU9H 1ZKOA 1UE1A 3NBIA 4LH6A 2NZOA 4LF8Q 4CKBA 1BCPC 1PTOB 3TIIA 2XCPA 4CDEC 1S03G 4YWMA 4XT1B 4DR3L 4K8JA 4E6IA 3V4SA 1E0BA 1BUVT 3PIP3 5GQOA 5T1GA 4DR6L 1JIHA 1RYSA 4QF4A 4ECQA 2N49A 3HOYB 1IYUA 1CHPD 1D5MC 2BE5C 2Y0SB 1ET6A 1EIGA 1C9OA 3MWYW 1DOKA 1X3EA 4DR5Q 5KFGA 3DWQA 2GLTA 4AQYL 3Q8SB 2R7ZG 1IW7C 1KHIA 2DJFC 2ES2A 2AQ4A 2MUYA 3E9IA 2B3GA 1GVPA 1ICFB 2NTSA 5KT7A 1O78A 1ESRA 2L0CA 2R7NA 5KFDA 1U9RA 2FMCA 1PH9A 3DHQA 5KFNA 3AYHB 4TUYF 3F2DA 1I3QA 3OOCA 1YITA 1KQSA 2D62A 4L5QA 3MVVA 1QNUA 2VQEQ 1WH2A 3UDIA 1VQNA 1F2MA 1IYVA 4BWSC 5DG8A 5ELBA 4DNRB 1VCIA 1VQOA 2YU9B 3I4MG 5J2UF 3HOXH 1HH2P 4YHHH 4LFCQ 2E5LQ 3PUXA 4BBRB 1N33Q 3G8CA 2HUGA 3I4NB 2YYZA 1NMGA 1KD1C 3L4KA 5FK9C 1MHWC 2VQFL 1U0LA 2QF7A 4B3RH 3GTKA 5LOVF 1XMQH 4C3JG 4DAPA 3H0GB 5CYUA 3H3VC 2AWNA 4A3KH 4IJHA 2A8VA 5C4JH 2LSSA 1HNZQ 1TS5A 3NPPA 2B63B 1Y14B 3MHBA 1Q46A 3GD7A 5LMUQ 3K7AB 1IOVA 5KIXA 1SE3A 1FNVA 5L1IA 3JC66 2BQUA 1I3QH 2JA6A 2GVBA 3H3VH 2VUMB 4B3ML 3KOJA 4DV6L 3HOZG 4DR1H 2EY1A 4C3HB 2F0FA 2FFKB 1M4VA 3ULPA 3QG1A 5IGDA 2A6EC 4EX5A 4PZ8A 3U50C 2YL2A 4YR0A 4F4XA 4G4KA 4GKKH 1S72A 5KNBA 5F9LA 4JI1H 1B70B 5E1FA 1SXTA 4YCUA 2VNUD 4DL7A 1D8LA 2TSSA 2NVQH 1CHQD 1CKMA 1WTRA 4X66L 4UP9A 3JRXA 1T3NA 1CS0A 1W3SA 2UXBH 2R61A 5A2QE 2Z0SA 4B3TH 4YY3Q 4HNTA 1EEID 3GTKH 1LT4D 3W5OA 4J8QA 1GSAA 2EVBA 3T1YQ 4LSXA 3FRPB 3RF2A 3J81i 2F0QA 2BH8A 2I80A 1EU4A 1M8AA 4A3DG 2AGOA 1RD9D 2R86A 3WDNA 1PDQA 1GKHA 2JEBI 5JPNC 4TQRA 5KNCA 1DYQA 1EYAA 1PH7A 2VA2A 1EFID 4DAMA 2EOTA 3N40P 1PFNA 1TS4A 3NSWA 5CV6A 4HR7A 4J9OA 1K0SA 4DV5H 1HZCA 4JI5Q 1Q7YC 1CQJB 4JI7Q 1YHQA 2JA6H 1ZQ7A 1K0RA 4NW2A 2CW0C 2HHHL 3ETHA 3CW2C 1CKNA 3NENA 2HVRA 3K5OA 1M90C 1N36H 5M5XH 2R85A 4NXNQ 2VW9A 4BXXH 1STEA 3TEHB 4O3QA 1RK5A 4KD4A 1PZJD 4FXKC 3FMCA 3J81L 5C0XI 1UUPA 2H1EA 3HOWB 1XNRH 3M4YA 4ED0A 3I56A 2EPBA 3SK5A 4LF4Q 1JDEA 2CWPA 1KAWA 3KHHA 4C56C 1DD2A 2UXDL 2DUDA 1DV2A 1PMRA 5L1KA 2BR0A 1FVIA 1PTOC 2J7ZA 2L1BA 3N41B 5KT4A 1HNXH 5ELEA 3I4OA 1F9PA 2HVSA 1XJVA 4AYBE 4HNVA 1KDAA 5C4HA 4APVA 3I2ZA 2WB1E 2EZVA 2R82A 2A69D 4H7BA 2R7ZB 5ISRA 1EYDA 1SSOA 5EOYA 4DR4H 1G8ZD 1FNUA 2K5HA 5IYBH 2CCZA 3RGXA 1YI2A 5BR8L 3M4OB 4LUVA 4GC7A 1ONLA 4JC0A 2JE6I 5KYIA 2F0MA 4LAAA 4DR7L 3T5JA 1JDBB 4IJLA 3NELA 3V6HA 1F9RA 1TWHB 1WJJA 1RF2D 1WYDA 4ZYSA 4GOPA 1KNAA 1IBLH 2RCFA 1V1QA 3I4MB 2W6ZA 2WYOA 3NEMA 4IN3A 5DLQE 2MHVA 2ZJQA 1CE8A 4IALA 2V4DA 1N34H 4KY7A 1QVFA 3J81W 2PZUA 3M85A 4A93G 2ZTCA 5KFSA 4KI0A 3L0OA 4HCSA 2GPSA 3U4VA 3QR8A 2E76C 1YJWA 4LF7Q 3CCQA 2J4XA 4QQBX 2VPSA 2W57A 1XMQL 3KF6A 3J81c 3QWNA 1X54A 2ZDHA 3S1QB 2EJGC 2WAQG 3DM3A 3SI8A 4A3EH 3MXNB 3GTMB 2K04A 4DV1L 5H80A 3N43B 2FXQA 4HCEA 1L1OA 3QO2A 4BBRH 4Q45A 4JG2A 4RGOS 4BWGB 3V05A 1D2BA 4Y8VB 2FK2A 3NP8A 4ZHQF 4A3BB 2E2IB 2NU6B 5CC4A 5C3EG 5JPMC 2C35B 1T9HA 2EJMA 2G9DA 4HJ8A 4AYBB 2I5HA 2IW3A 3S17B 1EY7A 1EL0A 1EUJA 4KN7C 1RIPA 3HOZB 1TWFB 1EZ6A 4IUVA 3S1NB 3NGDA 3AU7A 3MFIA 1GSHA 2VS1A 2JEGA 2XWJB 1B44D 2F0PA 3CMEA 4JV0A 5EKKA 5IWAH 2OQKA 1L0WA 3H3VI 1K3BC 3BABA 3CVZA 2ID0A 5LL6X 2FP4B 2Q8RE 1JWUD 1SE8A 1D6EC 2PYKA 3S9WA 1SLJA 5DGBA 4OO1G 1F2YA 1UC8A 3KXYT 4E4TA 1I50B 1SYXB 2VR1A 2IHFA 5C4XB 2K1BA 2ICIA 3K81C 4EGVA 1PHJA 5FLXL 3L9AX 3VR5A 1KL9A 5C44H 4CGYB 4RU9A 5IIFA 1WTXA 1U4PA 4A3IG 4FDBA 2JA5B 2DGYA 1SFOA 4WORA 3M3YH 1XNQH 1S97A 4A3DB 4TQSA 3ZJYC 1MSHA 2B2WA 4DAVA 3N52A 4U7CA 5CB4F 1XXGA 4WD3A 4O2AF 4IAJA 4DV4L 2YS6A 1N56A 3JRWA 3UE1A 3I72A 4TRDA 4DV5L 1B04A 3PO2H 4UCRA 1CK1A 1K8OA 4ME6A 1U4RA 1KRTA 4ZUJA 4O4LF 5GONF 2YCHA 3KFUA 4LF9H 5FKAC 3G71A 4UAIA 2NWGA 2I46A 1WCMH 2EJFC 2YRWA 1GUGA 3OHXC 4MA5A 5J2TF 4DL5A 1QWYA 1QCBD 1N36L 2F0LA 1TWAB 3CPFA 2OTJA 5K36G 4DLKA 3A5ZB 3R2IA 4OIKA 4HJ5A 1E2ZA 5JAVA 4IOCA 4FO2A 1Y8OB 1R4PB 2YTYA 4N9TA 3RD4A 4F4WA 1KLUD 4XQNA 4DK3C 4DV2L 1SYFA 1QVGA 1ASZA 3KF8B 3DMUA 2R7ZA 2ATWA 2L4NA 3GTLB 1OWTA 1LYLA 5KFZA 4QIWB 4DV3Q 1ULZA 3KAKA 1VBHA 3GV8B 2QDLA 3E0JA 1S5BD 1NMFA 1J6QA 1VS0A 3NTIA 4X65Q 1HNXL 4XTCS 1S5FD 1RODA 1AUXA 2KEEA 4Q43A 2A73B 1EY6A 1SFOH 4MV9A 4DL2A 2Z6KC 2R8JA 4GKJL 4WBNF 2HT1A 5GADC 5FLXW 1GOZA 4X62L 2ATLA 5IYDH 1VQLA 2XCLA 3G6YA 4K5XA 5DGAA 4RGMA 1GYFA 3P7JA 1JR0D 2UUCH 3VPCA 1Z47A 1XDNA 5CV9A 3C1FA 4BY1G 3I3CA 2W9BA 4JV2A 3OSPA 5FLXc 4QWCA 5M9OA 1EIFA 2NN6G 5DLFA 4LF6H 2OEOA 4LW1A 2W9CB 4X64H 3OMCA 3BVZA 3LWUA 2LKVA 3FDSA 4A3MG 3H4BA 3S2DH 1X32A 4JI0L 1MBYA 1VQMA 1PX2A 4QW8A 3I91A 1TWCA 3H6MA 2F3IA 4DK6C 1NBWA 2R7ZH 2LFNA 4X3KA 4IFDJ 1IBMQ 4FXDA 1STAA 2R93B 3HS0C 3PZPA 1FD7D 4HIDA 2Z8LA 4A93B 3TS2A 3BJYA 4QL5A 1EQRA 1XMOL 1N32L 4MV7A 3URYA 4ALPA 3P20A 3TMEA 5F9NA 2PI2E 1K8AC 4MTEA 2O03A 1SEIA 3E5NA 4JBWA 2UVVA 1RKNA 4JV5L 1SNQA 2JYOA 2W8LA 4DA2A 2R7MA 4I4TF 1ML0D 2WAQB 3FDTA 2PCFB 4C3IG 1EWHA 1Y1VG 1AE2A 5M5YH 1LUZA 1G2SA 3OIQA 1K8GA 4NLGA 5BMVF 3CD6A 4BBSG 4JI4H 4ZCKA 3TP6A 4DL4A 1LTGD 4LFBL 3SXHA 1AH9A 2W6QA 1V43A 1CTMA 3RZDB 1GUNA 1S9FA 4IOAA 1E4EB 4UHVA 3T13A 1UEBA 1IL2A 1WVLA 4RZQA 4C3JH 3OTOL 4RUCA 4RB2C 4JI8Q 1TWCH 4NXMQ 4IWXA 5KG6A 2O5IC 4A75A 1S5ED 3NQTA 2B8FA 2A68D 3CQZH 2E75C 1EQTA 5NUCA 3SGIA 1TXYA 4RHSA 2PQAA 2E2HA 1V8QA 3GTPB 3KDFA 3LWEA 2KEDA 1IBKQ 1HA6A 4LF5L 1JICA 3CCUA 1Q86C 4OX9Q 2LS01 3FPPA 3E0EA 1Q1BA 5JJLA 4HJ9A 5EWFA 3BQ0A 1VQHA 1TY0A 4QJFA 3N6XA 1YHBA 1Q8KA 2IX1A 3HOZH 2QILA 2NUAB 1HQMC 3EQLC 3O13A 3S1NH 1VQGA 5D1OA 3WO1A 4MNOA 1CQVA 2VUGA 2YZGA 1JQYD 2KENA 1L2FA 2XSCA 1WD0A 5IT9E 3PUZA 4KJOA 2PZWA 3KLSA 2RSOA 1P8LA 4FF1A 4M8AA 5KNDA 2MJ8A 4QIWA 2TMPA 1VKZA 1FR3A 2F4VQ 1Y1WG 1A2UA 1TU2B 4PMCA 5DNFA 3CC7A 4DR3H 3I70A 1LT6D 3T4AC 2Z4IA 1J5EL 3MWMA 3N42B 3R8BA 1F9QA 5DM63 1HQRD 2I87A 2ASDA 1BF4A 3IFTA 4DR6H 2QCPX 2FLPA 5F2DA 3S15H 5KKNB 3TSSA 1JMCA 2IP4A 1TS2A 2EXDA 4PZ7A 3SVMA 4DN4M 2UXCL 2E2HH 4AQYH 1JXLA 5HV6A 5M3FG 5FD6A 1DOMA 3M7GA 1HA5A 1S3OA 4IR1A 2O2LD 3RLFA 1Z2OX 5ELNA 3OWEB 2WDTA 2ASLA 4H44C 1I4QA 4DV0L 3UDFA 4LFAQ 4PG3A 2GPWA 4DFAA 5IE8A 1EUDB 2YZNA 4YWLA 3VDYA 5HBRB 2NVXH 1G91A 4R7RA 4HAEA 1WTWA 3MA2B 4DR2Q 5C1PA 2HVQA 3CCRA 4IPGA 4MTNA 4JBMA 4P74A 3R2TA 5IP7H 1KABA 3I4NG 5KFFA 5IGEA 1EIHA 2K14A 1EUCB 1UC9A 4RNOA 5KEEA 1D7QA 5CA0F 3FKIG 4S3SA 3R23A 1IKMA 1W6JA 4OIJA 1CQIB 2VQFH 2B2YA 1C0AA 3RAXA 3H0GG 3OSNA 1DONA 1EZ8A 1ZYRC 3OHBA 2J9GA 2AQ3B 4MV1A 1EY5A 2JSOA 3RB0A 4X3SA 5A2QL 4L1KA 4RB3C 2ZJRA 5DQIA 2HCCA 1KJ8A 1F9SA 5C3XA 1X9NA 2H4OA 3HOUG 2I8CA 1XTCD 4DV6Q 2UUBQ 3CPWA 1RCVD 2N3SA 1E24A 4GNXA 2B2TC 5BN4A 2C00A 2R7KA 3LMLA 2JK8A 4B3MH 5DQGA 4C3HG 4O3SA 3PIO3 4EEQA 2C22A 3J7AV 5L37A 1Y1VB 4TQUS 4GZYC 1LTBD 2Z9HA 4O4HF 1K8MA 4BBSB 4DUYH 1A0IA 3TN2A 3GTOB 3GTPA 5KT5A 3TP7A 3A7LA 4H13C 2XNAC 2NBFA 4KHPQ 4X66H 1KNEA 3QZ7A 4CDCC 1SJED 2QKIC 2MP1A 4MTDA 2J0TD 2RGVA 1XTDA 4UCOA 1YHAA 1PYSB 1N8RC 5LXTF 2RDHA 1U4MA 1JE4A 5L1LA 3S14H 2PNHA 1K83B 2NVYB 2KUMA 1NCVA 1QG7A 4EVOA 1STBA 4Y7NH 1EY4A 3GV7B 1PRTD 5C3EH 2IMWP 1BQQT 2EYPA 1G2TA 1GUOA 2HHHH 5DG7A 1K3RA 4UPAA 1UNSA 4R4OA 2JA7A 3HRZC 4DUZL 4U68A 5IGCA 2D2CC 2W9AA 2UU9Q 4BA2I 4JI3L 4C2MB 5LP6F 3FMAA 1T5EA 4NDXA 3IRBA 1K9MC 3HOWG 4ECZA 1VQFA 2R8IA 4LUOA 4WRDA 3J80i 1C3OA 1ET9A 1PFBA 1H9KA 1CQFA 2K4KA 3SE0A 1K1SA 5JVLA 4G57A 4OO1H 4PWQA 3KLWA 4JYAH 2UXDH 1Y1WB 4QWBA 3RNUA 4ID6A 3KAJA 3BVGA 3Q8DA 2CQYA 3PUWA 1ZHQA 4ECUA 3NBHA 2YV5A 3H15A 1VQ6A 3WWVA 4LK1C 2JEAI 3AFQA 4A3IH 5ELCA 3GTGB 3L2PA 4JI2L 5FLMG 2V4QA 5IP9G 1RYRA 4C5CA 5M3FB 2L11A 3J80L 2EYMA 1X65A 4JBKA 5E7NA 5BR8H 4PZ6A 4O3RA 2G9HD 3J7ZC 5BPHA 1Y69U 2IX0A 4IFDG 4R4QA 5EAYA 2JA7H 5K36H 4YHHQ 1YNJC 1VQPA 4DR7H 4RGTA 2BH2A 5IGFA 4OWTB 4IPCA 3U9OA 2R3ZA 2OLSA 5EGTA 3FP9A 3PO3G 1TQOA 3NK9A 3T51B 4RWSC 4LJZC 3CCVA 2Z1CA 4CJ1B 1KJIA 4V190 1EYGA 3OWFA 2W6OA 5K2MA 3D0FA 1QUQA 2PO4A 5I6YA 1F77A 4B3RQ 3OUZA 3J81j 3V6KA 1VF5C 2BQRA 1XMQQ 4ECTA 4HMIA 1LT3D 2Z6BA 4R8UB 4RG1A 2K01A 4DK0A 3V4ZA 3FKIB 1BXRA 2J6TA 2CFMA 2QW7A 3I7FA 4A2AA 3PV0A 1YEZA 3RZOB 2AQ2B 1CKOA 4DV7L 1YNND 2NU7B 3H91A 3A56A 3GLKA 3MEHA 3OHAA 1AN8A 4P71A 2WE6A 1KC8C 3MEFA 4A4IA 5HGQA 4DV1H 2SDFA 4UCVA 4Y52H 4XDXA 1A15A 3RIZA 4HMJA 4ZKBB 5E4WC 2AGPA 2FMMA 3L3OC 4ME3A 4DR1Q 4BY1H 4A3BG 3BDOA 3T53B 3HOUB 4F4ZA 1EYCA 1JLLB 3GILA 2NN6H 1HNWL 4AYBG 1V1PA 4RA8A 1E1OA 3WNZA 1BO0A 2WB1G 3Q1KA 4FM9A 1TWGB 4GKKQ 3BS1A 4A3MH 4JI1Q 3GIPA 5M3MB 3Q22A 2QDBA 4K2LA 1BJTA 1Z2NX 2M9VA 2MO0A 2HCIA 3VYRA 2MO1A 4IUUA 2UXBQ 4DUYL 4B3TQ 3F2CA 4HNUA 1W2BA 1KDBA 3Q8PB 1ZHSA 5IYCG 4TSSA 2F3VA 4YB8B 4P73A 4AH6A 2ZM6L 3M4IA 3GTQB 3H09A 5C4XG 2EYFA 2R84A 1X3PA 5EQ0A 5IODA 1C30A 4YR3A 3BZDB 1F2ZA 4JI6L 3OPOA 1DCZA 4A3CG 2W71A 4B3SL 2JA5G 2G5DA 1PH1A 2RSNA 1IYJB 4C3IH 4DV5Q 1LACA 1A9XA 3F2UA 1B3AA 1E3PA 4BBSH 1X56A 4DV4H 1SMYC 5GROA 3RBEA 5J1ZA 1N36Q 3U9TA 1EWIA 3ND8A 4YJ3F 5KFLA 4QWEA 1RDPD 1TKWB 4FU0A 3MWEA 4A3GG 2X6LA 3H40A 3K5NA 4ECSA 3PSIA 3H20A 1XNRQ 2WKDA 4B9XA 2BDNA 4HYKA 3R5HA 1PRTB 4G7HC 1LTRD 4IPHA 2Y0SA 3T1HH 4O4IF 4L63B 2W6PA 2EE1A 1CSPA 1WD1A 3VR3A 4K0KL 3GV5B 5TSSA 5KFWA 5M5WB 1SNPA 2Q2UA 4DV2H 2Z4HA 3S2HH 4QCLA 3GDEA 1R9TB 1AE3A 2N78A 1HNXQ 4JYAL 3LNNA 1K28A 3HOVG 1LLRD 2KA7A 3PW5A 3X3MA 4DR4Q 3A8JE 4KTAA 3RV3A 5FO8B 3A0JA 1E1TA 1NR2A 1PV4A 4IRDA 4GKJH 4EFEA 2YU9A 4KMUC 3QOJA 3S1MB 4OO1I 1Y8NB 2L5TA 3T56B 4POGA 4X62H 2UUAL 3PN1A 2X69A 3RV4A 1JOOA 3D4RA 2RDJA 1PTOH 4FS1A 2XIGA 4OWXB 1RJRA 1JWMD 3S1RB 4LF8L 3STBC 3HG9A 1DM0B 1IBLQ 5C1OA 3KYHC 3FKIA 2PW7A 1MI2A 4IZ8A 1WTQA 3D6WA 2NU8B 4KK7A 1SCUB 3BZCA 1N34Q 3HOYH 3H0GA 5KG1A 5BN3A 2OF1A 4QWDA 2L55A 1YJ9A 5KFVA 4JI0H 3PO3B 4YIJA 4QWAA 4K5VA 2RCNA 1CA5A 5KG0A 2PZTA 2F0OA 2R93G 2B63A 4DR5L 3WO0A 3K5MA 1LTSD 4MV8A 3OIPA 3MR2A 1PH8A 4HIMA 5KG5A 1SNCA 3A74A 2DLNA 5L1JA 1XMOH 1N32H 3I55A 3HKZE 2VUMA 2R7LA 5DLGA 5JEAG 1FYCA 1ILPA 4JV5H 3VYSA 3A8KE 2VQEL 1PA6A 2I07B 4GN4B 4QB4A 2YU9H 1STGA 2JA8G 2NB0A 3ERSX 4QY7A 1K1QA 2RKSA 3MWDA 4A3FG 4N9PA 4I7HA 2VQDA 1XPUA 1C7YA 1EFWA 4LFCL 3GTJB 3I4NH 2E5LL 4LSAA 1PH2A 5CV4A 2KOLA 2K50A 1N33L 3BG5A 3CCEA 3KBXA 4LFBH 1EOTA 3MR6A 1D5ZC 3FKIH 2IBKA 3GTQA 4P72A 4MV6A 5IT9L 4OGQC 2WB1B 4Q8EA 4CDDC 3H0GH 2VXWA 5IWAQ 2J6UA 2CZGA 4C5BA 3OTOH 1JC7A 2IWHA 2GN5A 2RBMA 1M0WA 3CHBD 2B63H 2IA6A 3E9HA 1UE7A 1G6PA 1HPCA 2NN6I 3D4WA 2XRSD 1HNZL 2KCCA 3K7AH 2W70A 1A8VA 3ONAB 1EEFD 5KT3A 3HOUH 3GIQA 3A8IE 3CP0A 3TQTA 3TQ1A 3CKIB 5T1IA 5KFQA 2F0GA 5LMUL 1XNQQ 4LF5H 2LMCB 3M9BA 2WTFA 3KLRA 4JV1A 2SNMA 2VUMH 3DEOA 3LGJA 5DAUA 1O75A 4C3HH 1QNKA 1AN7A 3Q0AA 4JBJA 1PH6A 1UNNC 1NR4A 5AJ3Q 4B08A 4LF9Q 1SEBD 1WR2A 2NUCA 5KT2A 5HY6A 1K73C 3CCLA 1EHIA 1FKAH 5C5JA 4XYLB 2NTTA 3AMUA 1MSGA 4MA0A 4ED8A 1BCPD 1LO5D 3T16A 3TINA 4A3GB 2Z6KA 3QZ8A 1CI3M 2CKZB 4FXGC 4K8IA 2CQOA 1FL0A 3QB3A 1J5EH 4YY3L 3IN5A 4YP3A 3T1HL 3LWBA 2KVMA 4X3TA 3SDZA 5KFIA 3RN2A 3T1YL 5D3DA 4I55F 2RDGA 2KQ3A 1Q1EA 1X55A 1PRTC 5KFTA 2K5WA 5KFCA 3OW7A 2K52A 2LXJA 4RNMA 4DPGA 3D3RA 3EBEA 2UXCH 3KBGA 4CJ0B 1OTCA 4RB1A 3HOVB 2JQOA 2ZT9C 4JI5L 2R92B 5I47A 4JI7L 5KGUA 4ED1A 1UEAB 4C1NI 4DV0H 2PQEA 3V6JA 2EY6A 1ASYA 1VQIA 1VQJA 1YIJA 1WOCA 2UUCQ 1TWHA 4I50F 3PIPA 4NXNL 1KC7A 1B8AA 3M4PA 3HOXG 3HOWH 1II3A 1QE6A 3K0YA 3VA5A 1S0OA 3NXWA 4KKUA 2V59A 1G291 4RAUC 4LF6Q 5JH7F 2PNRC 1SYDA 2C28A 4X64Q 1UE5A 4O3NA 1FGUA 1MGSA 5J39A 2HJWA 1GHJA 4J9KA 1HR0Q 5IGBA 2VOBA 3H4DA 5CBEE 4DV3H 2R8HA 4M7EA 4A3KG 3GIDA 1EU3A 4IURA 5FO7B 3CXCA 1MIUA 3MXNA 3GTMA 3S1MH 3JAMi 2PPBC 4BY7B 2F0DA 4R4CA 3LP8A 3M4OH 3RB4A 1DZ1A 2F03A 2BOSA 1E22A 1STYA 5IY0A 3J81E 4YAKB 2V4RA 3GV3A 2E2IA 2KJXA 1E4GT 4HEDA 4IFDH 5FPRA 5KFHA 4AYBA 2ALYB 5GAEC 3R5FA 4GLAC 2R8KA 1U4LA 3K3VA 2PMZE 2WB1A 1TWHH 1TWFA 2CW8A 5JOBA 3IKJA 1HZAA 4JI4Q 3F8NA 4KHZA 1TS3A 2F0SA 3NTHA 3I4MH 2RDIA 2DPJA 1PRTF 1QOHA 2JA8B 3OUUA 5KX5F 5JVDF 5BN5A 4HIKA 3VA7A 4A3FB 3RAQA 4F50A 2M05A 1J8IA 3BAAA 1A3VA 3JAML 1IHZA 1VQ8A 4A3LG 1I6HB 1SMXA 4ZRZA 1WSCA 1PFSA 4JVZA 4RZRA 3SK8A 1I50A 3S16B 3M9MB 3R5XA 5D14A 2Q8IB 3A7AB 1ICWA 4EQPA 4LF7L 2MGSA 3S1QH 2YTXA 3IG0A 2JA5A 2AUJD 5KFPA 3GTMH 1JORA 2B2UA 4WFN3 1VQBA 1TAEA 1A2TA 4EYIB 1GM5A 4K5WA 3M9OB 3GIMA 2ZJPA 3F1ZA 4XYQA 3MXUA 1HFGA 1TVXA 1YNXA 4A3BH 2Q2TA 2E2IH 4XYMB 4ZQIA 5KT6A 4J9MA 4ED3A 1AW7A 1I5FA 5KG4A 4TV8F 1GSOA 3S17H 3GP7A 1GXDC 4IWYA 1I94Q 1TWAA 2D9UA 2CW0D 4OHJA 1TWFH 2B29A 4OXPA 1EIYB 1W93A 2FPGB 4LH7A 3G6EA 3RFCA 4DUZH 3BJUA 3JSNA 3SEBA 2CVRA 4O3PA 4JI3H 2XGTA 5CR3A 3TZDA 4DXGA 1PH5A 2OWOA 3H94A 4X6AH 1TA8A 4O3OA 4A3JG 2FLLA 3L4JA 3HFZB 2B2UC 4ECRA 3KF8A 1S0MA 1SDFA 1B9MA 4DR3Q 1DIKA 2K6AA 2A1AA 3TP8A 3U58A 3RB3A 3GTLA 5IYCH 4DR6Q 2RDFA 5GAHC 4QGUA 3JAMW 1I50H 2QEJC 1J9OA 5C4XH 1RJQA 2X0SA 1BBUA 3RUZA 3RLOA 1JJ2A 1EQVA 4L6TB 4K14A 4DF7A 2JJQA 5KRUA 2DJGC 1PTOD 4AQYQ 2JA5H 1QILA 4A3DH 4PDBA 5JJZA 1EQQA 4C5AA 1E2WA 3FEWX 1BCPB 1O7YA 4JI2H 2K7VA 3ULLA 3PUVA 5HURA 2XIWA 4HIOA 4WJWA 2HD3A 4CC5A 4RKLA 1SN8A 4L8JA 1L0YB 1HZ9A 1I4PA 3PGZA 4L5TA 1EWCA 1SE2A 2NZHA 1RK6A 4N8FA 4G7OC 1WTPA 4ECWA 3CRLC 1EYZA 1KJQA 1TWAH 2MCTA 3BQ1A 1B2TA 2YZMA 4O0AA 2W9CA 4UCUA 1PVOA 4A76A 3K80C 1V9PA 1KIXA 4YQWA 4M9UA 2ALZA 1WFQA 4RGNA 2C2EA 3HOXB 5EDWA 1B9NA 3N8DA 2L9HA 4FP5D 5EKIA 1CZWA 5FLXE 4RNNA 2EQSA 2SCUB 3BZKA 4OL7A 4BS9A 3K0XA 1EZ1A 1JJGA 4G3IA 3RN5A 3GTLH 2VZAA 2R93A 2V5AA 2VQFQ 4L5SA 1I7NA 3AFPA 4EQOA 2B2TA 1B6SA 2W7OA 5DQHA 4DV3L 1CSQA 4WJ3M 5EBDA 1GO3E 1QJOA 1L2ZA 2A69C 4X65L 3ERQA 1T94A 4A3KB 3EPIA 4EBEA 4DV7H 3K58A 2PBZA 3EPGA 3NUCA 1Z7TA 2XRQD 5C4JB 4A3EG 1T36A 2WAQA 3QFFA 4RFBA 1QVCA 2F0NA 3R3OA 3DEPA 1I4XA 4GC6A 1FJGH 3AEVA 1I4HA 3F8TA 3K3PA 4JPBW 5J22A 4B3MQ 3RGZA 3I73A 4P2CB 5JUMA 1H9JA 2KBNA 2RHQB 3U9SA 1E4EA 1XYIA 1H9MA 1HNWH 2RF4A 3CRKC 3NHHA 1VF7A 2CQAA 3V2TA 4Q5VA 1HCZA 2R6GA 5J3BA 4HJAA 3D4DA 5M3MG 2F0VA 3BDCA 4GN5A 2FE3A 4PQXA 4ETSA 4X66Q 4YBZB 2FHTA 5KG7A 2R93H 4IFDI 1P16A 3GQCA 2NVQB 2VY3A 2F0IA 5JEAJ 2N55A 4RMFA 5DM73 1IBML 4A93H 2RQXA 2BCOA 1OXXK 1BKBA 1JB7A 2ZM6H 4YJ2F 3HEJA 4YWKA 5LA6F 4DAYB 2VB3X 5C44G 1F2LA 3NWTA 4RKBA 1VQKA 3ER0A 4JI6H 1L0XB 4QW9A 4B3SH 2K05A 4JCVE 1OXUA 2WP8J 3VR6A 4WJ4A 2XGPA 4DNIA 2Y0SE 4HN7A 1W96A 2MPMA 2YW2A 4XT3B 5KFMA 2HHHQ 5T14A 1QZHA 4ULLA 2NVTB 3EN2A 3DWAA 1EY8A 2JA6B 1I6HH 5A2QW 5IGGA 1WCMG 1OO9B 3RZDH 1DV1A 2CH4A 5CMDA 4CKCA 4MTKA 1O7ZA 2D0OA 2E8GA 2AUKA 5LMNH 5EJWA 2FPPB 1PXUA 1Z2PX 5M5XB 5C6AA 3T5HA 1IOWA 1O80A 3P1HA 5JJIA 4P75A 1SYBA 5C0XJ 2FKLA 1Z6HA 1G6ZA 4MIUA 3A5UA 1JE5A 4JI8L 2AU0A 4A3JB 1PH4A 2KHIA 4JYAQ 2GA4B 2L15A 5K5PA 2UXDQ 4EFBA 4K0KH 2B39A 2BA1A 2AHOB 4JOIC 4NXML 3GTPH 4Z9CB 1B7YB 3J7YW 2ZJTA 4NMZA 1IBKL 2B2VC 1KBLA 2EIFA 1O7LA 2F0JA 1NJIC 1MJEA 2VB2X 4OX9L 2A6HD 2YRXA 1A6XA 4XXEA 4NB3A 2KCMA 5BR8Q 2DZDA 1SNOA 1LTID 4CKEA 4HR7B 1ESFA 4B9WA 3C2PA 2E2DC 5ELOA 1HRJA 4XYOA 2UUAH 2ZXRA 1WTHA 1MJCA 1LTTD 4DR7Q 3UFXB 1CKNB 5I2XA 1D5XC 1VQAA 2HQLA 3KHGA 2KCTA 4NP5A 4LF8H 3K5IA 2F4IA 3BVMA 4EBDA 2F4VL 4Q44A 4DL3A 4FNFA 3J7AF 1AUVA 5D3IB 4IZOA 4PMBA 3AQQA 1PYWD 3HZXA 1E2VA 2SEBD 2SNSA 4A2BA 2EXZA 3EFXD 2UVUA 2JEIA 4F4YA 4KJNA 3PW4A 4DR5H 4JUZA 4L5RC 2H5XA 4XQJA 1AP0A 2M00A 3I90A 4DU9A 1QB5D 1UE6A 5EPKA 4ZAIA 3EJIA 4DV1Q 3CCJA 4LFAL 3BU2A 3K5HA 2XC9A 4A3EB 1VMPA 2VQEH 4RHRA 1Y1VA 1FJGL 1BBWA 5KFYA 4X3UA 3LX0A 3VYUA 1VQ9A 4DR2L 2V58A 3BYYB 1QZGA 4ED2A 3GTOA 2K5QA 4LFCH 4J9QA 1PK8A 3MXGA 5I2YA 2E5LH 3JSLA 2QK4A 1N33H 3J80W 3D6CA 3CMAA 1EY0A 1SNDA 4QMGA 4DAYA 3FVQA 4GOPB 3MZ5A 5LL6S 1STNA 4MV4A 3UDXA 4UDUC 4UFZA 2OTLA 3J80c 4LWCA 3UE0A 3E3XA 5KFAA 2JA9A 1K83A 2NVYA 4H02A 3IL8A 5AFWA 2QEXA 1BCPF 3SK4A 4IRCA 3G7LA 4F88A 1HNZH 2B8GA 2EYHA 2C2RA 1CUKA 1SYCA 5COYA 4Q0FA 4MN3A 1KJ9A 5LMUH 3KF6B 4GN3B 2AKWB 4HJ7A 1OXVA 2UUBL 1HFNA 3CC2A 1OXSC 2DN8A 1CFMA 1XX8A 5C44B 3ICEA 3QIAA 2F0HA 4FBTA 3M3YB 1Z9FA 2F3WA 3DUZA 4DV4Q 1TY2A 2NZ1D 1Y1VH 4YAJB 4C2MA 3RMHA 3FHWA 1L1OB 3RR5A 2YYAA 2R8GA 2KHSA 1DJRD 3HKSA 2HIXA 4R8IA 1I4RA 3MR3A 3PO2B 2SOBA 3DM1A 4R4IA 3GTOH 2QYZA 4A3LH 2FK1A 2A74C 3HKZG 2QGQA 1WCMB 2P5ZX 1HUMA 5HGTA 5LMNL 1Q82C 1VQEA 3T1HQ 1Y1WA 3KJOA 1IXRA 3PW0A 2EDGA 4KHPL 1BGWA 3TRZA 3BA9A 4C1NK 2Q2HA 1TT2A 2A68C 4DV2Q 5LYJF 4ED7A 4YY3H 3GTGA 2E2JB 1AFPA 1K83H 2FK3A 3T1YH 2NVYH 3BDLA 3NQIA 1RL2A 2ZTEA 4DXFA 5H1SE 2NVTH 3CF5A 3TBIB 2FJZA 1VQ5A 3TP5A 1NAPA 2R92G 4IPDA 1C4QA 5DEHA 4GKJQ 2V1CC 5FPOA 4JI5H 2DY8A 2OXPA 2JN4A 1SFOB 4JI7H 3OW2A 2M2LA 2MQHA 4X62Q 4C2MH 4OWWB 1H9RA 3K7UC 1BOSA 4LNQA 1D1IA 4ECXA 4TVAB 4ZQ3A 1BBXC 2UU9L 4A3JH 4NXNH 3PF4A 3TIGA 1B53A 1LT5D 1SE4A 1VQCA 5IP7G 2XTIA 1OXTA 1PZKD 3MTSA 3RBDA 1H9SB 1Y1WH 4R8UA 1KJJA 2YS7A 1HJPA 5EKLA 4JI0Q 1JKJB 4LMQD 2K5NA 3RUPA 4LF4H 4J9LA 5EPJA 3M7NA 5LMNW 1TR5A 5G3LD 3SHLA 3S2DB 1S5CD 2LY7A 3K5LA 1U5KA 1GUWA 2FPIB 3GTGH 4EQ5A 3KTMA 4I7ZC 4CBVA 1A62A 2DPIA 1O7IA 2CWAA 1ZYRD 3D31A 4BY7G 1B3QA 1XMOQ 1N32Q 4J15A 4HTHA 5M3FH 4U6PA 2Q8TA 2IPKD 3N6RA 4KKTA 5KYLA 5KFOA 1JX4A 4DKAC 1LTLA 4JV5Q 1LTAD 1GUSA 3TZUA 5JVG3 3E6ZX 4K2KA 1TWGA 3W1BA 1M7JA 4FYDA 2AQ1B 4PMWA 4YHHL 4JK1C 4AIMA 5M5YB 4CHTB 2K28A 4LFBQ 2DWCA 3K6OA 3CU7A 2UVRA 1IL8A 4F7XA 2W7PA 3DF7A 2W9BB 5D65A 2ICEC 2EY2A 3OTOQ 4B3RL 2CH4W 2R7DA 3ULJA 1IKLA 2F0TA 2WFWA 3J80E 5D1PA 3RZOH 4O42A 4I65A 4C3JB 2WKCA 3VR4A 1B50A 1TWCB 4LF7H 2K75A 2EYLA 2L12A 4GOPC 3PIOA 3CQZB 5C3WA 3CC4A 1LABA 5I6WA 4LF5Q 1BVSA 4CJ2C 5CGKA 1A63A 1ENAA 3PQIA 5FJ8G 1UAPA 5KFXA 3KUPA 4KD3A 5C0XG 3Q2OA 2XVSA 2RGRA 2MNAA 3T5KA 1WCMA 1PTOF 4QIWE 3IFDA 4DR1L 1M0TA 2DNEA 1SRUA 5KFRA 1TWGH 4QUCA 5C8YF 3X3NA 3ITPA 4DL6A 4ME5A 1KXLA 5M3MH 2EYJA 1GGOA 1STHA 4IUPA 3TQYA 3UDGA 1ZEQX 5IOCA 4JI1L 4GKKL 3L7ZC 1GJXA 3GO5A 1VQDA 3M9NB 3T5LA 4KN4C 5FOBB 5E4XA 2PVPA 1L1OC 2K03A 1N9WA 5KFJA 3NTKA 1R9TA 2UXBL 1I7LA 4B3TL
chains in the Genus database with same CATH topology
4A3DG 1J5EQ 2XGTA 2MFIA 2BA0A 1PH5A 2OWOA 1GKHA 2JEBI 3GTQH 4X6AH 4A3JG 1PH7A 3HFZB 1K3RA 4UPAA 4R4OA 4DAMA 4DUZL 1S40A 4DR3Q 2A1AA 3U58A 1HZCA 2UU9Q 4JI3L 1Q7YC 4JI5Q 4JI7Q 5IYCH 1YHQA 2JA6H 1K0RA 1PYBA 4R4TA 2UXCQ 2HHHL 4DR6Q 3CW2C 2IT1A 5GAHC 1CKNA 3NENA 4QGUA 1I50H 2D0PA 3IRBA 5C4XH 1K9MC 3HOWG 1VQFA 4LUOA 1M90C 3B6YA 3J80i 1BBUA 2PQAB 3RLOA 5M5XH 1SROA 2Q2IA 3KDFB 1JJ2A 4NXNQ 2K4KA 2VW9A 2JJQA 4DV0Q 4AQYQ 2JA5H 4BXXH 3TEHB 5IT9c 4LUZA 4A3DH 3KLWA 1EQQA 5C0XI 2VL6A 3RNUA 3ULLA 2JA7G 3Q8DA 3PUVA 3PUWA 2YV5A 4HIOA 3I56A 3H15A 1VQ6A 3TS0A 3WWVA 1G51A 3CCSA 4LF4Q 2JEAI 2CWPA 1KAWA 1SN8A 3AFQA 3PGZA 1HZ9A 4L5TA 4XIGS 4A3IH 2UXDL 3L2PA 2NZHA 3G48A 5FLMG 4JI2L 2E2JH 1XNRL 2DUDA 5IP9G 3U4ZA 2WAQE 1TWAH 1FVIA 5M5WH 1NY4A 2I0QA 4GLVB 3I4OA 1HZBA 4O0AA 1XJVA 4AYBE 1PVOA 1R9TH 4JBKA 4A76A 1X65A 3K80C 3PUYA 1V9PA 2RHSB 5E7NA 4APVA 4PZ6A 1KIXA 3I2ZA 2WB1E 3J7ZC 1WFQA 2IX0A 4LF4L 4IFDG 4R4QA 5EAYA 2JA7H 1E7ZA 2EQSA 2K5HA 4YHHQ 5IYBH 1GD7A 2CCZA 3BZKA 5BR8L 3K8AA 3K0XA 1YI2A 1JJGA 3RN5A 4LUVA 2VZAA 1VQPA 3GTLH 2BH2A 1JT8A 2VQFQ 4OWTB 4IPCA 4L5SA 4JC0A 3AFPA 4POFA 5FLMH 4DR4L 3G4SA 3FP9A 3PO3G 2JE6I 5IP9H 1NE3A 4GLXA 4DV3L 3F2BA 1IZ6A 1CSQA 3CCVA 4DR7L 4WJ3M 1EYGA 1YVCA 1GO3E 3D0FA 4IJLA 1QUQA 3NELA 4X65L 3J7A5 4B3RQ 3J81j 1KRSA 1WJJA 4GOPA 1WYDA 1XMQQ 4A3EG 1V1QA 1XPOA 3S1RH 4RG1A 1QVCA 3NEMA 5DLQE 2ZJQA 4UY8C 2CFMA 3I7FA 3AEVA 3PV0A 1YEZA 1CKOA 1QVFA 4OONA 3F8TA 4DV7L 3M85A 1IBLL 4A93G 2ZTCA 4B3MQ 4KI0A 3L0OA 4P71A 3S24A 3U4VA 3PO3H 1YJWA 1PH3A 2KBNA 1N34L 3CCQA 2RHQB 1X6OA 1KC8C 4LF7Q 4QQBX 3MEFA 4A4IA 5HGQA 1XMQL 2RF4A 3KF6A 3J81c 1H95A 4Y52H 1X54A 2R6GA 2WAQG 3DM3A 4ME3A 5J3BA 4HJAA 5M3MG 4DR1Q 4BY1H 4A3BG 4A3EH 3MXNB 4GN5A 1EOVA 4DV1L 4AYBG 1HNWL 2FXQA 3PO2G 1L1OA 4X66Q 2UXBL 1E1OA 4BBRH 2AWOA 2R93H 4IFDI 4JG2A 2WB1G 1P16A 4O2DA 4GKKQ 2K5VA 2VY3A 4A3MH 4JI1Q 4RMFA 5JEAJ 1IBML 4A93H 5C3EG 1OXXK 2C35B 1T9HA 2F52A 4HJ8A 3PCOB 2I5HA 3EIVA 1BKBA 3RLNA 2MO0A 1JB7A 2MO1A 2UXBQ 4DUYL 4B3TQ 4YWKA 3F2CA 2YTVA 1EUJA 1RIPA 4DAYB 5C44G 1W2BA 3GTJH 1JJCB 1VQKA 3ER0A 2AMCB 5IYCG 2JA6G 4JCVE 4DUZQ 1OXUA 4KLKA 4P73A 2VS1A 4AH6A 2WP8J 2ZM6L 4WJ4A 4DNIA 2Y0SE 3CMEA 4GNXB 5C4XG 4JI3Q 1DGSA 2OQKA 1L0WA 3H3VI 2HHHQ 2OQ0A 4JI6L 2ID0A 4A3CG 1XPRA 1QZHA 4B3SL 2JA5G 4BXXG 3EN2A 1PH1A 1SE8A 1IYJB 4C3IH 1I6HH 3DLLA 1SLJA 1WCMG 4DV5Q 3RZDH 4OO1G 4R1JA 4IO9A 5IWAL 2IHFA 3PF5A 2D0OA 2E8GA 3K81C 1PHJA 4UP7A 1E3PA 4BBSH 1X56A 2QA4A 5C44H 2IY5B 5GROA 1KL9A 1N36Q 1EWIA 4FDBA 4A3IG 2DGYA 3M3YH 1YJNA 5JJIA 4P75A 5C0XJ 3ZJYC 3A5UA 1JE5A 4JI8L 2N8NA 4A3GG 4DV4L 2KHIA 1PH4A 2L15A 4JYAQ 3UE1A 2UXDQ 3PSIA 4DV5L 4JI2Q 2BA1A 2AHOB 4JOIC 4NXML 1XNQL 1XNRQ 3GTPH 3PO2H 1KRTA 4A3CH 1Q81C 3KFUA 1B7YB 3G71A 4IPHA 1WCMH 1CSPA 3JAMc 1IBKL 4K0KL 1N36L 3CPFA 2EIFA 2OTJA 5K36G 1NJIC 1MJEA 3A5ZB 5AJ3L 5IYBG 4OX9L 2Q2UA 4LF9L 4HJ5A 3S2HH 3GDEA 1HNXQ 1AE3A 2N78A 4IOCA 4JYAL 4NB3A 2KCMA 3HOVG 4YCWA 5BR8Q 2YTYA 3TREA 4DK3C 4DV2L 1QVGA 1ASZA 4A3GH 3KF8B 1MKHA 2ATWA 4DR4Q 5ELOA 5GAGC 3HOYG 3STBD 1LYLA 2Y0SG 1X3FA 4DV3Q 3A0JA 1E1TA 1MJCA 4DR7Q 1CKNB 1PV4A 1NMFA 1J6QA 1VS0A 1VQAA 2HQLA 4X65Q 1HNXL 4XTCS 2KCTA 4OO1I 2R7FA 4POGA 1YZ6A 2UUAL 1SFOH 2F4VL 2Z6KC 4GKJL 4OWXB 3AQQA 2HT1A 3HOVH 5GADC 3CCMA 4DV7Q 4X62L 4LF8L 2R92H 5IYDH 3STBC 1IBLQ 1VQLA 3NBHB 5JJKA 3KYHC 4UP8A 2IHEA 3BZCA 1N34Q 1Z47A 1FJGQ 3HOYH 4BY1G 5FLXc 4L5RC 2H5XA 1YJ9A 1EIFA 2NN6G 2RCNA 2UUCL 4LW1A 4BBRG 2R93G 1UE6A 2HIVA 4DR5L 4DV1Q 1HNWQ 3CCJA 4A3MG 3S2DH 4LFAL 4JI0L 3BU2A 1VQMA 4BA1I 4LF6L 1PH8A 4HIMA 3A74A 2F3IA 4DK6C 1NBWA 2R7ZH 1FJGL 1BBWA 4X64L 4IFDJ 1G6PA 1VQ4A 3I55A 1IBMQ 3HKZE 4MZ9A 5JEAG 1VQ9A 1X3GA 4DR2L 1HR0L 4HIDA 1QZGA 2OCEA 2VQEL 1PA6A 3TS2A 1Q12A 4DUYQ 4GN4B 1EQRA 4QL5A 1XMOL 2YU9H 1N32L 2JA8G 4ALPA 3ERSX 4QY7A 1YBYA 3OYYA 2B63G 4A3FG 2PI2E 2ZTDA 1K8AC 4BY7H 4JBWA 1QUQB 1XPUA 4JV5L 1C7YA 1EFWA 3CMAA 2ZM6Q 4LFCL 3I4NH 4GOPB 2E5LL 2LXKA 1PH2A 2GVAA 2K50A 1N33L 2ASBA 1Y1VG 1AE2A 3UDXA 5M5YH 3CCEA 1LUZA 2OTLA 3J80c 4LWCA 3UE0A 4JI6Q 3FKIH 2JA9A 2VUMG 4B3SQ 1K8GA 4P72A 4H02A 3CD6A 4BBSG 2QEXA 3H0GH 5IWAQ 4LFBL 1AH9A 1UWVA 1V43A 1CUKA 2GN5A 2JA8H 4JOIA 4IOAA 3KF6B 4A3FH 4JI4L 3E9HA 1UE7A 1UEBA 2AKWB 2NN6I 4GN3B 1OXVA 3CAMA 4HJ7A 2UUBL 1IL2A 4C3JH 3OTOL 3K7AH 1OXSC 5LMNQ 1HNZL 3CC2A 1A8VA 4B3TL 3ICEA 4JI8Q 3HOUH 1TWCH 1Z9FA 3CP0A 4DV4Q 1Y1VH 3M4QA 2PI2A 3FHWA 5LMUL 1LM0A 1WI5A 1L1OB 3M9BA 3RR5A 4NXMQ 1XNQQ 4A75A 3HKSA 2VUMH 3S16H 3CQZH 3LGJA 3SGIA 2B63H 1TXYA 2HIXA 2PQAA 4R4IA 4C3HH 3KDFA 1IBKQ 3GTOH 4K0KQ 4GNXC 4JBJA 1PH6A 2KHJA 4GS3A 4LF5L 3HKZG 3CCUA 2QGQA 4A3LH 4YCVA 5AJ3Q 1Q86C 4OX9Q 4LF9Q 3E0EA 1Q1BA 5LMNL 1Q82C 1VQEA 4HJ9A 3T1HQ 1HR0W 1M1KC 5JJLA 1VQHA 4NPSA 1IXRA 4QJFA 5HY6A 3KJOA 4KHPL 1YHBA 1Q8KA 1SR3A 2IX1A 3HOZH 3TRZA 1K73C 2A19A 2Q2HA 5FJ8H 3CCLA 3S1NH 1VQGA 4DV2Q 4MNOA 2KENA 1L2FA 1K83H 1NTGA 3PUZA 2NVYH 2Z6KA 2CKZB 1P8LA 3W1GA 1RL2A 2CQOA 1FL0A 2ZTEA 4YY3L 5H1SE 2NVTH 3T1HL 1VQ7A 3CF5A 1I94L 2I5MX 3RN2A 1VQ5A 3T1YL 2UUAQ 3KJPA 2F4VQ 1Y1WG 1Q1EA 1X55A 2R92G 5IYDG 3CC7A 4IPDA 2I5LX 4GKJQ 2V1CC 2K52A 2LXJA 1J5EL 4DPGA 1UE1A 2NZOA 3EBEA 3OW2A 2MQHA 4X62Q 4LF8Q 4C2MH 4OWWB 3S15H 3K7UC 1OTCA 1JMCA 4LNQA 4YWMA 4DR3L 2JQOA 2EXDA 4TVAB 4JI5L 4PZ7A 2UU9L 4A3JH 4JI7L 3PF4A 2UXCL 5GQOA 2E2HH 4DR6L 1VQCA 5M3FG 1ASYA 2N49A 5IP7G 1VQIA 1S3OA 1VQJA 2XTIA 1WOCA 1OXTA 1YIJA 3RLFA 2UUCQ 1C9OA 3PIPA 5ELNA 4NXNL 1X3EA 1B8AA 3M4PA 3HOXG 4DR5Q 4AQYL 4DV0L 1Y1WH 3HOWH 3UDFA 1KHIA 2R7ZG 2ES2A 1HJPA 3E9IA 4LFAQ 4JI0Q 2K5NA 2B3GA 1G291 1GVPA 4PG3A 4LF6Q 5IE8A 3M7NA 4YWLA 5LMNW 3VDYA 4X64Q 1PH9A 1UE5A 1U5KA 3GTGH 3AYHB 4EQ5A 1FGUA 2NVXH 3F2DA 1A62A 4DR2Q 1YITA 1KQSA 1HR0Q 1O7IA 2D62A 2CWAA 3D31A 4L5QA 2VQEQ 3CCRA 4BY7G 4IPGA 4MTNA 1XMOQ 3UDIA 1VQNA 4J15A 1N32Q 5M3FH 4JBMA 4P74A 5IP7H 3I4NG 4A3KG 1VCIA 1VQOA 3I4MG 2K14A 1LTLA 4DKAC 1MIUA 3HOXH 1HH2P 3CXCA 4JV5Q 4LFCQ 3S1MH 1D7QA 3FKIG 2E5LQ 3JAMi 4R4CA 3PUXA 1N33Q 3M4OH 1C0AA 3H0GG 1E22A 3W1BA 2YYZA 1NMGA 1KD1C 5IY0A 4PMWA 4YHHL 4AIMA 4LFBQ 2ALYB 2VQFL 5GAEC 4GLAC 1U0LA 2ZJRA 2PMZE 1TWHH 2AWNA 4A3KH 4IJHA 1X9NA 1HZAA 4JI4Q 2A8VA 3HOUG 4KHZA 5C4JH 2LSSA 4DV6Q 2UUBQ 3I4MH 1HNZQ 3OTOQ 3CPWA 4B3RL 4HIKA 2R7DA 3ULJA 2N3SA 1E24A 2WFWA 1Y14B 4GNXA 1Q46A 3RZOH 2JK8A 3GD7A 5LMUQ 3JC66 1VQ8A 4A3LG 1I3QH 1SMXA 2K75A 2GVBA 3H3VH 1PFSA 4GOPC 4TQUS 3PIOA 4B3ML 3KOJA 3CC4A 4LF5Q 4BA2I 1BVSA 4DV6L 3HOZG 1A0IA 4LF7L 1A63A 3S1QH 2YTXA 5FJ8G 5C0XG 3ULPA 3GTMH 4KHPQ 2MNAA 1VQBA 4EX5A 4PZ8A 3U50C 4QIWE 1GM5A 4DR1L 1S72A 2ZJPA 3F1ZA 1B70B 1SRUA 4YCUA 1TWGH 1YNXA 2VNUD 1D8LA 1XTDA 2NVQH 1YHAA 1CKMA 4X66L 4A3BH 1PYSB 2Q2TA 2E2IH 1KXLA 5M3MH 4UP9A 1N8RC 1I5FA 1W3SA 4GKKL 3UDGA 3TQYA 2Z0SA 2PNHA 4JI1L 3S14H 3L7ZC 3S17H 4YY3Q 3GO5A 1VQDA 3GTKH 1I94Q 3W5OA 3T1YQ 1TWFH 1L1OC 2B29A 4OXPA 1N9WA 1EIYB 4Y7NH 3G6EA 3J81i 5C3EH 3BJUA 2BH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3D G;  1J5E Q;  2XGT A;  2MFI A;  2BA0 A;  1PH5 A;  2OWO A;  1GKH A;  2JEB I;  3GTQ H;  4X6A H;  4A3J G;  1PH7 A;  3HFZ B;  1K3R A;  4UPA A;  4R4O A;  4DAM A;  4DUZ L;  1S40 A;  4DR3 Q;  2A1A A;  3U58 A;  1HZC A;  2UU9 Q;  4JI3 L;  1Q7Y C;  4JI5 Q;  4JI7 Q;  5IYC H;  1YHQ A;  2JA6 H;  1K0R A;  1PYB A;  4R4T A;  2UXC Q;  2HHH L;  4DR6 Q;  3CW2 C;  2IT1 A;  5GAH C;  1CKN A;  3NEN A;  4QGU A;  1I50 H;  2D0P A;  3IRB A;  5C4X H;  1K9M C;  3HOW G;  1VQF A;  4LUO A;  1M90 C;  3B6Y A;  3J80 i;  1BBU A;  2PQA B;  3RLO A;  5M5X H;  1SRO A;  2Q2I A;  3KDF B;  1JJ2 A;  4NXN Q;  2K4K A;  2VW9 A;  2JJQ A;  4DV0 Q;  4AQY Q;  2JA5 H;  4BXX H;  3TEH B;  5IT9 c;  4LUZ A;  4A3D H;  3KLW A;  1EQQ A;  5C0X I;  2VL6 A;  3RNU A;  3ULL A;  2JA7 G;  3Q8D A;  3PUV A;  3PUW A;  2YV5 A;  4HIO A;  3I56 A;  3H15 A;  1VQ6 A;  3TS0 A;  3WWV A;  1G51 A;  3CCS A;  4LF4 Q;  2JEA I;  2CWP A;  1KAW A;  1SN8 A;  3AFQ A;  3PGZ A;  1HZ9 A;  4L5T A;  4XIG S;  4A3I H;  2UXD L;  3L2P A;  2NZH A;  3G48 A;  5FLM G;  4JI2 L;  2E2J H;  1XNR L;  2DUD A;  5IP9 G;  3U4Z A;  2WAQ E;  1TWA H;  1FVI A;  5M5W H;  1NY4 A;  2I0Q A;  4GLV B;  3I4O A;  1HZB A;  4O0A A;  1XJV A;  4AYB E;  1PVO A;  1R9T H;  4JBK A;  4A76 A;  1X65 A;  3K80 C;  3PUY A;  1V9P A;  2RHS B;  5E7N A;  4APV A;  4PZ6 A;  1KIX A;  3I2Z A;  2WB1 E;  3J7Z C;  1WFQ A;  2IX0 A;  4LF4 L;  4IFD G;  4R4Q A;  5EAY A;  2JA7 H;  1E7Z A;  2EQS A;  2K5H A;  4YHH Q;  5IYB H;  1GD7 A;  2CCZ A;  3BZK A;  5BR8 L;  3K8A A;  3K0X A;  1YI2 A;  1JJG A;  3RN5 A;  4LUV A;  2VZA A;  1VQP A;  3GTL H;  2BH2 A;  1JT8 A;  2VQF Q;  4OWT B;  4IPC A;  4L5S A;  4JC0 A;  3AFP A;  4POF A;  5FLM H;  4DR4 L;  3G4S A;  3FP9 A;  3PO3 G;  2JE6 I;  5IP9 H;  1NE3 A;  4GLX A;  4DV3 L;  3F2B A;  1IZ6 A;  1CSQ A;  3CCV A;  4DR7 L;  4WJ3 M;  1EYG A;  1YVC A;  1GO3 E;  3D0F A;  4IJL A;  1QUQ A;  3NEL A;  4X65 L;  3J7A 5;  4B3R Q;  3J81 j;  1KRS A;  1WJJ A;  4GOP A;  1WYD A;  1XMQ Q;  4A3E G;  1V1Q A;  1XPO A;  3S1R H;  4RG1 A;  1QVC A;  3NEM A;  5DLQ E;  2ZJQ A;  4UY8 C;  2CFM A;  3I7F A;  3AEV A;  3PV0 A;  1YEZ A;  1CKO A;  1QVF A;  4OON A;  3F8T A;  4DV7 L;  3M85 A;  1IBL L;  4A93 G;  2ZTC A;  4B3M Q;  4KI0 A;  3L0O A;  4P71 A;  3S24 A;  3U4V A;  3PO3 H;  1YJW A;  1PH3 A;  2KBN A;  1N34 L;  3CCQ A;  2RHQ B;  1X6O A;  1KC8 C;  4LF7 Q;  4QQB X;  3MEF A;  4A4I A;  5HGQ A;  1XMQ L;  2RF4 A;  3KF6 A;  3J81 c;  1H95 A;  4Y52 H;  1X54 A;  2R6G A;  2WAQ G;  3DM3 A;  4ME3 A;  5J3B A;  4HJA A;  5M3M G;  4DR1 Q;  4BY1 H;  4A3B G;  4A3E H;  3MXN B;  4GN5 A;  1EOV A;  4DV1 L;  4AYB G;  1HNW L;  2FXQ A;  3PO2 G;  1L1O A;  4X66 Q;  2UXB L;  1E1O A;  4BBR H;  2AWO A;  2R93 H;  4IFD I;  4JG2 A;  2WB1 G;  1P16 A;  4O2D A;  4GKK Q;  2K5V A;  2VY3 A;  4A3M H;  4JI1 Q;  4RMF A;  5JEA J;  1IBM L;  4A93 H;  5C3E G;  1OXX K;  2C35 B;  1T9H A;  2F52 A;  4HJ8 A;  3PCO B;  2I5H A;  3EIV A;  1BKB A;  3RLN A;  2MO0 A;  1JB7 A;  2MO1 A;  2UXB Q;  4DUY L;  4B3T Q;  4YWK A;  3F2C A;  2YTV A;  1EUJ A;  1RIP A;  4DAY B;  5C44 G;  1W2B A;  3GTJ H;  1JJC B;  1VQK A;  3ER0 A;  2AMC B;  5IYC G;  2JA6 G;  4JCV E;  4DUZ Q;  1OXU A;  4KLK A;  4P73 A;  2VS1 A;  4AH6 A;  2WP8 J;  2ZM6 L;  4WJ4 A;  4DNI A;  2Y0S E;  3CME A;  4GNX B;  5C4X G;  4JI3 Q;  1DGS A;  2OQK A;  1L0W A;  3H3V I;  2HHH Q;  2OQ0 A;  4JI6 L;  2ID0 A;  4A3C G;  1XPR A;  1QZH A;  4B3S L;  2JA5 G;  4BXX G;  3EN2 A;  1PH1 A;  1SE8 A;  1IYJ B;  4C3I H;  1I6H H;  3DLL A;  1SLJ A;  1WCM G;  4DV5 Q;  3RZD H;  4OO1 G;  4R1J A;  4IO9 A;  5IWA L;  2IHF A;  3PF5 A;  2D0O A;  2E8G A;  3K81 C;  1PHJ A;  4UP7 A;  1E3P A;  4BBS H;  1X56 A;  2QA4 A;  5C44 H;  2IY5 B;  5GRO A;  1KL9 A;  1N36 Q;  1EWI A;  4FDB A;  4A3I G;  2DGY A;  3M3Y H;  1YJN A;  5JJI A;  4P75 A;  5C0X J;  3ZJY C;  3A5U A;  1JE5 A;  4JI8 L;  2N8N A;  4A3G G;  4DV4 L;  2KHI A;  1PH4 A;  2L15 A;  4JYA Q;  3UE1 A;  2UXD Q;  3PSI A;  4DV5 L;  4JI2 Q;  2BA1 A;  2AHO B;  4JOI C;  4NXM L;  1XNQ L;  1XNR Q;  3GTP H;  3PO2 H;  1KRT A;  4A3C H;  1Q81 C;  3KFU A;  1B7Y B;  3G71 A;  4IPH A;  1WCM H;  1CSP A;  3JAM c;  1IBK L;  4K0K L;  1N36 L;  3CPF A;  2EIF A;  2OTJ A;  5K36 G;  1NJI C;  1MJE A;  3A5Z B;  5AJ3 L;  5IYB G;  4OX9 L;  2Q2U A;  4LF9 L;  4HJ5 A;  3S2H H;  3GDE A;  1HNX Q;  1AE3 A;  2N78 A;  4IOC A;  4JYA L;  4NB3 A;  2KCM A;  3HOV G;  4YCW A;  5BR8 Q;  2YTY A;  3TRE A;  4DK3 C;  4DV2 L;  1QVG A;  1ASZ A;  4A3G H;  3KF8 B;  1MKH A;  2ATW A;  4DR4 Q;  5ELO A;  5GAG C;  3HOY G;  3STB D;  1LYL A;  2Y0S G;  1X3F A;  4DV3 Q;  3A0J A;  1E1T A;  1MJC A;  4DR7 Q;  1CKN B;  1PV4 A;  1NMF A;  1J6Q A;  1VS0 A;  1VQA A;  2HQL A;  4X65 Q;  1HNX L;  4XTC S;  2KCT A;  4OO1 I;  2R7F A;  4POG A;  1YZ6 A;  2UUA L;  1SFO H;  2F4V L;  2Z6K C;  4GKJ L;  4OWX B;  3AQQ A;  2HT1 A;  3HOV H;  5GAD C;  3CCM A;  4DV7 Q;  4X62 L;  4LF8 L;  2R92 H;  5IYD H;  3STB C;  1IBL Q;  1VQL A;  3NBH B;  5JJK A;  3KYH C;  4UP8 A;  2IHE A;  3BZC A;  1N34 Q;  1Z47 A;  1FJG Q;  3HOY H;  4BY1 G;  5FLX c;  4L5R C;  2H5X A;  1YJ9 A;  1EIF A;  2NN6 G;  2RCN A;  2UUC L;  4LW1 A;  4BBR G;  2R93 G;  1UE6 A;  2HIV A;  4DR5 L;  4DV1 Q;  1HNW Q;  3CCJ A;  4A3M G;  3S2D H;  4LFA L;  4JI0 L;  3BU2 A;  1VQM A;  4BA1 I;  4LF6 L;  1PH8 A;  4HIM A;  3A74 A;  2F3I A;  4DK6 C;  1NBW A;  2R7Z H;  1FJG L;  1BBW A;  4X64 L;  4IFD J;  1G6P A;  1VQ4 A;  3I55 A;  1IBM Q;  3HKZ E;  4MZ9 A;  5JEA G;  1VQ9 A;  1X3G A;  4DR2 L;  1HR0 L;  4HID A;  1QZG A;  2OCE A;  2VQE L;  1PA6 A;  3TS2 A;  1Q12 A;  4DUY Q;  4GN4 B;  1EQR A;  4QL5 A;  1XMO L;  2YU9 H;  1N32 L;  2JA8 G;  4ALP A;  3ERS X;  4QY7 A;  1YBY A;  3OYY A;  2B63 G;  4A3F G;  2PI2 E;  2ZTD A;  1K8A C;  4BY7 H;  4JBW A;  1QUQ B;  1XPU A;  4JV5 L;  1C7Y A;  1EFW A;  3CMA A;  2ZM6 Q;  4LFC L;  3I4N H;  4GOP B;  2E5L L;  2LXK A;  1PH2 A;  2GVA A;  2K50 A;  1N33 L;  2ASB A;  1Y1V G;  1AE2 A;  3UDX A;  5M5Y H;  3CCE A;  1LUZ A;  2OTL A;  3J80 c;  4LWC A;  3UE0 A;  4JI6 Q;  3FKI H;  2JA9 A;  2VUM G;  4B3S Q;  1K8G A;  4P72 A;  4H02 A;  3CD6 A;  4BBS G;  2QEX A;  3H0G H;  5IWA Q;  4LFB L;  1AH9 A;  1UWV A;  1V43 A;  1CUK A;  2GN5 A;  2JA8 H;  4JOI A;  4IOA A;  3KF6 B;  4A3F H;  4JI4 L;  3E9H A;  1UE7 A;  1UEB A;  2AKW B;  2NN6 I;  4GN3 B;  1OXV A;  3CAM A;  4HJ7 A;  2UUB L;  1IL2 A;  4C3J H;  3OTO L;  3K7A H;  1OXS C;  5LMN Q;  1HNZ L;  3CC2 A;  1A8V A;  4B3T L;  3ICE A;  4JI8 Q;  3HOU H;  1TWC H;  1Z9F A;  3CP0 A;  4DV4 Q;  1Y1V H;  3M4Q A;  2PI2 A;  3FHW A;  5LMU L;  1LM0 A;  1WI5 A;  1L1O B;  3M9B A;  3RR5 A;  4NXM Q;  1XNQ Q;  4A75 A;  3HKS A;  2VUM H;  3S16 H;  3CQZ H;  3LGJ A;  3SGI A;  2B63 H;  1TXY A;  2HIX A;  2PQA A;  4R4I A;  4C3H H;  3KDF A;  1IBK Q;  3GTO H;  4K0K Q;  4GNX C;  4JBJ A;  1PH6 A;  2KHJ A;  4GS3 A;  4LF5 L;  3HKZ G;  3CCU A;  2QGQ A;  4A3L H;  4YCV A;  5AJ3 Q;  1Q86 C;  4OX9 Q;  4LF9 Q;  3E0E A;  1Q1B A;  5LMN L;  1Q82 C;  1VQE A;  4HJ9 A;  3T1H Q;  1HR0 W;  1M1K C;  5JJL A;  1VQH A;  4NPS A;  1IXR A;  4QJF A;  5HY6 A;  3KJO A;  4KHP L;  1YHB A;  1Q8K A;  1SR3 A;  2IX1 A;  3HOZ H;  3TRZ A;  1K73 C;  2A19 A;  2Q2H A;  5FJ8 H;  3CCL A;  3S1N H;  1VQG A;  4DV2 Q;  4MNO A;  2KEN A;  1L2F A;  1K83 H;  1NTG A;  3PUZ A;  2NVY H;  2Z6K A;  2CKZ B;  1P8L A;  3W1G A;  1RL2 A;  2CQO A;  1FL0 A;  2ZTE A;  4YY3 L;  5H1S E;  2NVT H;  3T1H L;  1VQ7 A;  3CF5 A;  1I94 L;  2I5M X;  3RN2 A;  1VQ5 A;  3T1Y L;  2UUA Q;  3KJP A;  2F4V Q;  1Y1W G;  1Q1E A;  1X55 A;  2R92 G;  5IYD G;  3CC7 A;  4IPD A;  2I5L X;  4GKJ Q;  2V1C C;  2K52 A;  2LXJ A;  1J5E L;  4DPG A;  1UE1 A;  2NZO A;  3EBE A;  3OW2 A;  2MQH A;  4X62 Q;  4LF8 Q;  4C2M H;  4OWW B;  3S15 H;  3K7U C;  1OTC A;  1JMC A;  4LNQ A;  4YWM A;  4DR3 L;  2JQO A;  2EXD A;  4TVA B;  4JI5 L;  4PZ7 A;  2UU9 L;  4A3J H;  4JI7 L;  3PF4 A;  2UXC L;  5GQO A;  2E2H H;  4DR6 L;  1VQC A;  5M3F G;  1ASY A;  2N49 A;  5IP7 G;  1VQI A;  1S3O A;  1VQJ A;  2XTI A;  1WOC A;  1OXT A;  1YIJ A;  3RLF A;  2UUC Q;  1C9O A;  3PIP A;  5ELN A;  4NXN L;  1X3E A;  1B8A A;  3M4P A;  3HOX G;  4DR5 Q;  4AQY L;  4DV0 L;  1Y1W H;  3HOW H;  3UDF A;  1KHI A;  2R7Z G;  2ES2 A;  1HJP A;  3E9I A;  4LFA Q;  4JI0 Q;  2K5N A;  2B3G A;  1G29 1;  1GVP A;  4PG3 A;  4LF6 Q;  5IE8 A;  3M7N A;  4YWL A;  5LMN W;  3VDY A;  4X64 Q;  1PH9 A;  1UE5 A;  1U5K A;  3GTG H;  3AYH B;  4EQ5 A;  1FGU A;  2NVX H;  3F2D A;  1A62 A;  4DR2 Q;  1YIT A;  1KQS A;  1HR0 Q;  1O7I A;  2D62 A;  2CWA A;  3D31 A;  4L5Q A;  2VQE Q;  3CCR A;  4BY7 G;  4IPG A;  4MTN A;  1XMO Q;  3UDI A;  1VQN A;  4J15 A;  1N32 Q;  5M3F H;  4JBM A;  4P74 A;  5IP7 H;  3I4N G;  4A3K G;  1VCI A;  1VQO A;  3I4M G;  2K14 A;  1LTL A;  4DKA C;  1MIU A;  3HOX H;  1HH2 P;  3CXC A;  4JV5 Q;  4LFC Q;  3S1M H;  1D7Q A;  3FKI G;  2E5L Q;  3JAM i;  4R4C A;  3PUX A;  1N33 Q;  3M4O H;  1C0A A;  3H0G G;  1E22 A;  3W1B A;  2YYZ A;  1NMG A;  1KD1 C;  5IY0 A;  4PMW A;  4YHH L;  4AIM A;  4LFB Q;  2ALY B;  2VQF L;  5GAE C;  4GLA C;  1U0L A;  2ZJR A;  2PMZ E;  1TWH H;  2AWN A;  4A3K H;  4IJH A;  1X9N A;  1HZA A;  4JI4 Q;  2A8V A;  3HOU G;  4KHZ A;  5C4J H;  2LSS A;  4DV6 Q;  2UUB Q;  3I4M H;  1HNZ Q;  3OTO Q;  3CPW A;  4B3R L;  4HIK A;  2R7D A;  3ULJ A;  2N3S A;  1E24 A;  2WFW A;  1Y14 B;  4GNX A;  1Q46 A;  3RZO H;  2JK8 A;  3GD7 A;  5LMU Q;  3JC6 6;  1VQ8 A;  4A3L G;  1I3Q H;  1SMX A;  2K75 A;  2GVB A;  3H3V H;  1PFS A;  4GOP C;  4TQU S;  3PIO A;  4B3M L;  3KOJ A;  3CC4 A;  4LF5 Q;  4BA2 I;  1BVS A;  4DV6 L;  3HOZ G;  1A0I A;  4LF7 L;  1A63 A;  3S1Q H;  2YTX A;  5FJ8 G;  5C0X G;  3ULP A;  3GTM H;  4KHP Q;  2MNA A;  1VQB A;  4EX5 A;  4PZ8 A;  3U50 C;  4QIW E;  1GM5 A;  4DR1 L;  1S72 A;  2ZJP A;  3F1Z A;  1B70 B;  1SRU A;  4YCU A;  1TWG H;  1YNX A;  2VNU D;  1D8L A;  1XTD A;  2NVQ H;  1YHA A;  1CKM A;  4X66 L;  4A3B H;  1PYS B;  2Q2T A;  2E2I H;  1KXL A;  5M3M H;  4UP9 A;  1N8R C;  1I5F A;  1W3S A;  4GKK L;  3UDG A;  3TQY A;  2Z0S A;  2PNH A;  4JI1 L;  3S14 H;  3L7Z C;  3S17 H;  4YY3 Q;  3GO5 A;  1VQD A;  3GTK H;  1I94 Q;  3W5O A;  3T1Y Q;  1TWF H;  1L1O C;  2B29 A;  4OXP A;  1N9W A;  1EIY B;  4Y7N H;  3G6E A;  3J81 i;  5C3E H;  3BJU A;  2BH8 A; 
#chains in the Genus database with same CATH topology
 3HKZ B;  1J5E Q;  2O5J C;  5BPF A;  2R87 A;  4APM A;  2MFI A;  2BA0 A;  3GTQ H;  2XWB B;  3I4L A;  1I6U A;  2K5D A;  1S40 A;  4TV9 F;  4ILW A;  4V0B A;  4ZK9 B;  5CV5 A;  5D8D A;  3BQ2 A;  1S4Z A;  2JXM B;  3BYT B;  1MZB A;  1PYB A;  4R4T A;  3S15 B;  2UXC Q;  2IX3 A;  2F1M A;  2C9O A;  5IT9 W;  3ORR A;  2IT1 A;  2D0P A;  4ED6 A;  3JZI A;  2BE5 D;  1BXT A;  3B6Y A;  2PQA B;  2E2H B;  1SRO A;  2F0W A;  2Q2I A;  3KDF B;  3PR5 B;  1JWS D;  1BNZ A;  4DV0 Q;  4J9R A;  1IW7 D;  3GQB A;  4Q0Y A;  5IT9 c;  4ODG A;  1AZP A;  4LUZ A;  5EWG A;  2E74 C;  1H9S A;  1R4Q B;  2VL6 A;  3GII A;  2JA7 G;  1SBB B;  5CV8 A;  5CBA E;  2W6M A;  5FO9 B;  5IYZ F;  5A35 A;  3QOL A;  3TS0 A;  1G51 A;  3CCS A;  4LMY A;  4H0L C;  4XIG S;  5D1O B;  3G6J B;  1S0N A;  1N48 A;  1MD2 D;  3G48 A;  1XNR L;  2NVX B;  1BR9 A;  2E2J H;  1YNJ D;  4KY6 A;  4OEL B;  3U4Z A;  2XCA A;  2WAQ E;  5M5W H;  1NY4 A;  2ZXO A;  2I0Q A;  2B2W C;  4GLV B;  2V9W A;  5I9P A;  1HZB A;  1R9T H;  3PUY A;  3DXJ C;  2RHS B;  3ZYY X;  4EQN A;  5I4D A;  4I7A A;  2DY7 A;  2OH2 A;  4LF4 L;  1PZI D;  2A6H C;  1E7Z A;  4K6L A;  1AZQ A;  1GD7 A;  3K8A A;  5FD5 A;  1AEX A;  1S68 A;  1CA6 A;  4UCT A;  1RTO A;  1JT8 A;  4TKO B;  4PV1 C;  4X65 H;  3GIJ A;  1S10 A;  3VMM A;  1S5D D;  4POF A;  5FLM H;  4DR4 L;  3G4S A;  5IP9 H;  2W8K A;  1NE3 A;  4GLX A;  3ETJ A;  2R6F A;  3F2B A;  1IZ6 A;  4DGZ A;  3RJ0 A;  1E4F T;  4J9N A;  1YVC A;  1FNW A;  4IHJ F;  5DG9 A;  3OSO A;  3J7A 5;  2F0E A;  1PLF A;  1KRS A;  3GTJ A;  4FS2 A;  3Q24 A;  3WOE A;  1XPO A;  3S1R H;  4J9P A;  4UY8 C;  2C5C A;  3UI2 A;  3PW7 A;  3A54 A;  1NNX A;  4OON A;  1VMC A;  2PN1 A;  1HXY D;  1CZG A;  1LV9 A;  2KEC A;  1IBL L;  3MFH A;  1HR0 H;  5I9O A;  2A5H A;  3S24 A;  3PO3 H;  1PH3 A;  1N34 L;  1X6O A;  2F0U A;  3W3A A;  2RVL A;  1T5X D;  2FLN A;  3PW2 A;  1TII D;  2IJ0 A;  3CQZ A;  2FMA A;  1H95 A;  1JB3 A;  3HBL A;  3A55 A;  2A6E D;  3MFY A;  4M1U B;  1Q8I A;  5CAE B;  1IBM H;  1EOV A;  4F8M A;  3Q23 A;  4FF4 A;  1YNN C;  4O2B F;  4CC6 A;  5CA1 F;  3V96 A;  2AWO A;  3E5S A;  4O2D A;  1Q90 A;  4RAZ A;  2K5V A;  3C3L A;  1NSN S;  3K59 A;  1M6V A;  1V1O A;  2F52 A;  2ZDG A;  3D8G A;  3PCO B;  3EIV A;  4NKL A;  3S14 B;  2FIN B;  3RLN A;  1PFM A;  2YTV A;  2FJ2 A;  3GTJ H;  1Q3L A;  1JJC B;  4Y7N B;  3VPB A;  5C3E B;  2AMC B;  2JA6 G;  3WOF A;  3MXP A;  5LL6 b;  3HKZ A;  4DUZ Q;  5JQW A;  4KLK A;  5C4Z A;  1SMY D;  5ELF A;  4GNX B;  4JI3 Q;  1DGS A;  4DNT B;  4XX0 B;  4HSV A;  3RTX A;  3VPD A;  4U67 3;  3I8Z A;  2OQ0 A;  1D1K A;  1RHP A;  2C2D A;  4CDF C;  1XPR A;  2UVW A;  4BXX G;  1VDZ A;  3DLL A;  3BA8 A;  4R1J A;  4IO9 A;  3VYT A;  5IWA L;  5L9X A;  2VPQ A;  4R9W A;  4RUA A;  4ECV A;  3PF5 A;  4PNY A;  1RJT A;  4MAM A;  4J9S A;  1SNM A;  4UP7 A;  4EEY A;  4JI8 H;  2QA4 A;  2IY5 B;  1CT1 D;  4FF3 A;  2CW7 A;  2P0A A;  4NXM H;  2K33 A;  3Q8Q B;  2WV6 D;  1YJN A;  1DOL A;  3KAL A;  1B6R A;  3AB9 A;  2PMZ B;  4XZ3 B;  5KFU A;  5KFB A;  2N8N A;  2R92 A;  3QJY A;  1IBK H;  2FB9 A;  4JI2 Q;  1XNQ L;  3G6X A;  1NUC A;  3EA6 A;  4OEM B;  1HTL D;  4A3C H;  2WIN B;  1KTK A;  1Q81 C;  4A3I B;  2N88 A;  4OX9 H;  1ILQ A;  4FF2 A;  2HDL A;  3W2D A;  1I94 H;  2WAC A;  2JEF A;  3JAM c;  3ERO A;  3HB9 A;  3SR1 A;  2NVX A;  2D5D A;  5AJ3 L;  4EBC A;  5IYB G;  1B1Z A;  4LF9 L;  3PVX A;  3G6V A;  1V51 A;  4IRK A;  2BQ3 A;  3K57 A;  5KFE A;  3MR5 A;  5JVH 3;  3IAY A;  4YCW A;  4EGQ A;  3C46 A;  3TRE A;  2JA7 B;  4A3G H;  4ZOL F;  2O4X A;  1VBG A;  1B33 N;  1MKH A;  5KFK A;  5COR A;  1SAP A;  1ZXT A;  5GAG C;  3STB D;  3HOY G;  2Y0S G;  1X3F A;  2VA3 A;  2F4V H;  4KV6 A;  1KDC A;  3GIK A;  2EY5 A;  3VR2 A;  2R7F A;  2DIK A;  1YZ6 A;  3MC0 B;  3PR4 A;  2NYZ D;  3HXL A;  2NU9 B;  2XN9 C;  4ZLT F;  3HOV H;  3CCM A;  3UQ8 A;  3NWS A;  4N8X 1;  4DV7 Q;  2R92 H;  5JJK A;  3MAQ A;  3NBH B;  5C5M A;  1WTV A;  4UP8 A;  2IHE A;  3ORQ A;  4KHV A;  2X6G A;  4ZKC B;  1FJG Q;  1XWE A;  3MFG A;  4RCO A;  4ABN A;  4J0M A;  4LFA H;  3EVQ A;  1GUT A;  1BNC A;  2UUC L;  1VAJ A;  1HUN A;  4BBR G;  4KY5 A;  2WII B;  2F0K A;  2HIV A;  1HNW Q;  1HHV A;  4RAY A;  4EG0 A;  4BY1 B;  4BA1 I;  4LF6 L;  4DR2 H;  3R93 A;  4EYH B;  1ZET A;  3Q6S A;  5EPL A;  1I3Q B;  4IR9 A;  4ZI7 F;  4X64 L;  2W6N A;  2ZXP A;  4O1N A;  1VQ4 A;  1X3Q A;  1KAA A;  4MZ9 A;  3FPU B;  1C8C A;  1EY9 A;  1X3G A;  4A3M B;  1HR0 L;  2OCE A;  2PW5 A;  1Q12 A;  3NE5 B;  4DUY Q;  3SE7 A;  3Q8R B;  3DWP A;  4HQ6 A;  1WTO A;  4FVM A;  1YBY A;  3OYY A;  2EYO A;  2RA4 A;  2B63 G;  2ZTD A;  4BY7 H;  5EZY F;  2ENB A;  2XGQ A;  1QUQ B;  3KLS X;  3TDQ A;  1FGB D;  3HGB A;  2ZM6 Q;  4RB0 A;  4Q8F A;  1SYG A;  1C48 A;  4ZUI A;  3PMF A;  2LXK A;  2GVA A;  4IQZ A;  2KSW A;  2ASB A;  4EGJ A;  5LHY 1;  4G7Z C;  2XD4 A;  1KEE A;  4J1M A;  4JI6 Q;  1Y8P B;  4RH6 A;  2VUM G;  1A3U A;  4B3S Q;  4J6H A;  5ELD A;  3GTK B;  1I6V C;  2J6S A;  1JOQ A;  5JEA H;  3P75 A;  4DV6 H;  4K6D A;  2UUB H;  1RJP A;  1UWV A;  4C3I B;  2B2Y C;  4FBU A;  1B4O A;  4IUT A;  2JP1 A;  4DK1 A;  2JA8 H;  4JOI A;  4MV3 A;  1HTP A;  4A3F H;  4JI4 L;  1SYE A;  3CAM A;  4F87 A;  3PO2 G;  5LMN Q;  1JCK B;  1JOK A;  3KHR A;  5EBC A;  2B2V A;  3J7A K;  2HGS A;  2HQE A;  3M4Q A;  2PI2 A;  3I12 A;  4HSP A;  1LM0 A;  1WI5 A;  3RB6 A;  2K32 A;  1V1P B;  2PMZ A;  3S16 H;  2AGQ A;  2HDM A;  5KG2 A;  1SJH D;  3C1E A;  4IUN A;  4KKS A;  4RCN A;  4KHP H;  4K0K Q;  2JEJ A;  1RTN A;  4GNX C;  2KHJ A;  4GS3 A;  4R8N A;  1ENC A;  4YCV A;  4YR2 A;  1A3T A;  1KLG D;  4UCS A;  5CV7 A;  1CM9 A;  1HR0 W;  3MJF A;  2CHB D;  2OT2 A;  3GV6 A;  1M1K C;  4NPS A;  3KK7 A;  2BDO A;  5C5L A;  1SR3 A;  5E3F A;  5KG3 A;  1GLV A;  3C0F B;  2IL8 A;  2A19 A;  3S2H B;  5FJ8 H;  3N44 B;  3OMG A;  5EWE A;  4JW0 A;  4QUF A;  3SK6 A;  1ENF A;  5C0X H;  1I4G A;  2KCN A;  3ND9 A;  2ZDQ A;  5G3L F;  1W6K A;  1DXM A;  1NTG A;  4IUQ A;  1V4Y A;  3JAM E;  2ASJ A;  3W1G A;  1GHK A;  2DNC A;  3HP3 A;  1VQ7 A;  1I94 L;  2I5M X;  1BDO A;  3BG3 A;  4XQQ A;  4MHE A;  3KJP A;  2UUA Q;  5IYD G;  4ECY A;  2I5L X;  3EYY A;  3KHL A;  2UU9 H;  1ZKO A;  1UE1 A;  3NBI A;  4LH6 A;  2NZO A;  4LF8 Q;  4CKB A;  1BCP C;  1PTO B;  3TII A;  2XCP A;  4CDE C;  1S03 G;  4YWM A;  4XT1 B;  4DR3 L;  4K8J A;  4E6I A;  3V4S A;  1E0B A;  1BUV T;  3PIP 3;  5GQO A;  5T1G A;  4DR6 L;  1JIH A;  1RYS A;  4QF4 A;  4ECQ A;  2N49 A;  3HOY B;  1IYU A;  1CHP D;  1D5M C;  2BE5 C;  2Y0S B;  1ET6 A;  1EIG A;  1C9O A;  3MWY W;  1DOK A;  1X3E A;  4DR5 Q;  5KFG A;  3DWQ A;  2GLT A;  4AQY L;  3Q8S B;  2R7Z G;  1IW7 C;  1KHI A;  2DJF C;  2ES2 A;  2AQ4 A;  2MUY A;  3E9I A;  2B3G A;  1GVP A;  1ICF B;  2NTS A;  5KT7 A;  1O78 A;  1ESR A;  2L0C A;  2R7N A;  5KFD A;  1U9R A;  2FMC A;  1PH9 A;  3DHQ A;  5KFN A;  3AYH B;  4TUY F;  3F2D A;  1I3Q A;  3OOC A;  1YIT A;  1KQS A;  2D62 A;  4L5Q A;  3MVV A;  1QNU A;  2VQE Q;  1WH2 A;  3UDI A;  1VQN A;  1F2M A;  1IYV A;  4BWS C;  5DG8 A;  5ELB A;  4DNR B;  1VCI A;  1VQO A;  2YU9 B;  3I4M G;  5J2U F;  3HOX H;  1HH2 P;  4YHH H;  4LFC Q;  2E5L Q;  3PUX A;  4BBR B;  1N33 Q;  3G8C A;  2HUG A;  3I4N B;  2YYZ A;  1NMG A;  1KD1 C;  3L4K A;  5FK9 C;  1MHW C;  2VQF L;  1U0L A;  2QF7 A;  4B3R H;  3GTK A;  5LOV F;  1XMQ H;  4C3J G;  4DAP A;  3H0G B;  5CYU A;  3H3V C;  2AWN A;  4A3K H;  4IJH A;  2A8V A;  5C4J H;  2LSS A;  1HNZ Q;  1TS5 A;  3NPP A;  2B63 B;  1Y14 B;  3MHB A;  1Q46 A;  3GD7 A;  5LMU Q;  3K7A B;  1IOV A;  5KIX A;  1SE3 A;  1FNV A;  5L1I A;  3JC6 6;  2BQU A;  1I3Q H;  2JA6 A;  2GVB A;  3H3V H;  2VUM B;  4B3M L;  3KOJ A;  4DV6 L;  3HOZ G;  4DR1 H;  2EY1 A;  4C3H B;  2F0F A;  2FFK B;  1M4V A;  3ULP A;  3QG1 A;  5IGD A;  2A6E C;  4EX5 A;  4PZ8 A;  3U50 C;  2YL2 A;  4YR0 A;  4F4X A;  4G4K A;  4GKK H;  1S72 A;  5KNB A;  5F9L A;  4JI1 H;  1B70 B;  5E1F A;  1SXT A;  4YCU A;  2VNU D;  4DL7 A;  1D8L A;  2TSS A;  2NVQ H;  1CHQ D;  1CKM A;  1WTR A;  4X66 L;  4UP9 A;  3JRX A;  1T3N A;  1CS0 A;  1W3S A;  2UXB H;  2R61 A;  5A2Q E;  2Z0S A;  4B3T H;  4YY3 Q;  4HNT A;  1EEI D;  3GTK H;  1LT4 D;  3W5O A;  4J8Q A;  1GSA A;  2EVB A;  3T1Y Q;  4LSX A;  3FRP B;  3RF2 A;  3J81 i;  2F0Q A;  2BH8 A;  2I80 A;  1EU4 A;  1M8A A;  4A3D G;  2AGO A;  1RD9 D;  2R86 A;  3WDN A;  1PDQ A;  1GKH A;  2JEB I;  5JPN C;  4TQR A;  5KNC A;  1DYQ A;  1EYA A;  1PH7 A;  2VA2 A;  1EFI D;  4DAM A;  2EOT A;  3N40 P;  1PFN A;  1TS4 A;  3NSW A;  5CV6 A;  4HR7 A;  4J9O A;  1K0S A;  4DV5 H;  1HZC A;  4JI5 Q;  1Q7Y C;  1CQJ B;  4JI7 Q;  1YHQ A;  2JA6 H;  1ZQ7 A;  1K0R A;  4NW2 A;  2CW0 C;  2HHH L;  3ETH A;  3CW2 C;  1CKN A;  3NEN A;  2HVR A;  3K5O A;  1M90 C;  1N36 H;  5M5X H;  2R85 A;  4NXN Q;  2VW9 A;  4BXX H;  1STE A;  3TEH B;  4O3Q A;  1RK5 A;  4KD4 A;  1PZJ D;  4FXK C;  3FMC A;  3J81 L;  5C0X I;  1UUP A;  2H1E A;  3HOW B;  1XNR H;  3M4Y A;  4ED0 A;  3I56 A;  2EPB A;  3SK5 A;  4LF4 Q;  1JDE A;  2CWP A;  1KAW A;  3KHH A;  4C56 C;  1DD2 A;  2UXD L;  2DUD A;  1DV2 A;  1PMR A;  5L1K A;  2BR0 A;  1FVI A;  1PTO C;  2J7Z A;  2L1B A;  3N41 B;  5KT4 A;  1HNX H;  5ELE A;  3I4O A;  1F9P A;  2HVS A;  1XJV A;  4AYB E;  4HNV A;  1KDA A;  5C4H A;  4APV A;  3I2Z A;  2WB1 E;  2EZV A;  2R82 A;  2A69 D;  4H7B A;  2R7Z B;  5ISR A;  1EYD A;  1SSO A;  5EOY A;  4DR4 H;  1G8Z D;  1FNU A;  2K5H A;  5IYB H;  2CCZ A;  3RGX A;  1YI2 A;  5BR8 L;  3M4O B;  4LUV A;  4GC7 A;  1ONL A;  4JC0 A;  2JE6 I;  5KYI A;  2F0M A;  4LAA A;  4DR7 L;  3T5J A;  1JDB B;  4IJL A;  3NEL A;  3V6H A;  1F9R A;  1TWH B;  1WJJ A;  1RF2 D;  1WYD A;  4ZYS A;  4GOP A;  1KNA A;  1IBL H;  2RCF A;  1V1Q A;  3I4M B;  2W6Z A;  2WYO A;  3NEM A;  4IN3 A;  5DLQ E;  2MHV A;  2ZJQ A;  1CE8 A;  4IAL A;  2V4D A;  1N34 H;  4KY7 A;  1QVF A;  3J81 W;  2PZU A;  3M85 A;  4A93 G;  2ZTC A;  5KFS A;  4KI0 A;  3L0O A;  4HCS A;  2GPS A;  3U4V A;  3QR8 A;  2E76 C;  1YJW A;  4LF7 Q;  3CCQ A;  2J4X A;  4QQB X;  2VPS A;  2W57 A;  1XMQ L;  3KF6 A;  3J81 c;  3QWN A;  1X54 A;  2ZDH A;  3S1Q B;  2EJG C;  2WAQ G;  3DM3 A;  3SI8 A;  4A3E H;  3MXN B;  3GTM B;  2K04 A;  4DV1 L;  5H80 A;  3N43 B;  2FXQ A;  4HCE A;  1L1O A;  3QO2 A;  4BBR H;  4Q45 A;  4JG2 A;  4RGO S;  4BWG B;  3V05 A;  1D2B A;  4Y8V B;  2FK2 A;  3NP8 A;  4ZHQ F;  4A3B B;  2E2I B;  2NU6 B;  5CC4 A;  5C3E G;  5JPM C;  2C35 B;  1T9H A;  2EJM A;  2G9D A;  4HJ8 A;  4AYB B;  2I5H A;  2IW3 A;  3S17 B;  1EY7 A;  1EL0 A;  1EUJ A;  4KN7 C;  1RIP A;  3HOZ B;  1TWF B;  1EZ6 A;  4IUV A;  3S1N B;  3NGD A;  3AU7 A;  3MFI A;  1GSH A;  2VS1 A;  2JEG A;  2XWJ B;  1B44 D;  2F0P A;  3CME A;  4JV0 A;  5EKK A;  5IWA H;  2OQK A;  1L0W A;  3H3V I;  1K3B C;  3BAB A;  3CVZ A;  2ID0 A;  5LL6 X;  2FP4 B;  2Q8R E;  1JWU D;  1SE8 A;  1D6E C;  2PYK A;  3S9W A;  1SLJ A;  5DGB A;  4OO1 G;  1F2Y A;  1UC8 A;  3KXY T;  4E4T A;  1I50 B;  1SYX B;  2VR1 A;  2IHF A;  5C4X B;  2K1B A;  2ICI A;  3K81 C;  4EGV A;  1PHJ A;  5FLX L;  3L9A X;  3VR5 A;  1KL9 A;  5C44 H;  4CGY B;  4RU9 A;  5IIF A;  1WTX A;  1U4P A;  4A3I G;  4FDB A;  2JA5 B;  2DGY A;  1SFO A;  4WOR A;  3M3Y H;  1XNQ H;  1S97 A;  4A3D B;  4TQS A;  3ZJY C;  1MSH A;  2B2W A;  4DAV A;  3N52 A;  4U7C A;  5CB4 F;  1XXG A;  4WD3 A;  4O2A F;  4IAJ A;  4DV4 L;  2YS6 A;  1N56 A;  3JRW A;  3UE1 A;  3I72 A;  4TRD A;  4DV5 L;  1B04 A;  3PO2 H;  4UCR A;  1CK1 A;  1K8O A;  4ME6 A;  1U4R A;  1KRT A;  4ZUJ A;  4O4L F;  5GON F;  2YCH A;  3KFU A;  4LF9 H;  5FKA C;  3G71 A;  4UAI A;  2NWG A;  2I46 A;  1WCM H;  2EJF C;  2YRW A;  1GUG A;  3OHX C;  4MA5 A;  5J2T F;  4DL5 A;  1QWY A;  1QCB D;  1N36 L;  2F0L A;  1TWA B;  3CPF A;  2OTJ A;  5K36 G;  4DLK A;  3A5Z B;  3R2I A;  4OIK A;  4HJ5 A;  1E2Z A;  5JAV A;  4IOC A;  4FO2 A;  1Y8O B;  1R4P B;  2YTY A;  4N9T A;  3RD4 A;  4F4W A;  1KLU D;  4XQN A;  4DK3 C;  4DV2 L;  1SYF A;  1QVG A;  1ASZ A;  3KF8 B;  3DMU A;  2R7Z A;  2ATW A;  2L4N A;  3GTL B;  1OWT A;  1LYL A;  5KFZ A;  4QIW B;  4DV3 Q;  1ULZ A;  3KAK A;  1VBH A;  3GV8 B;  2QDL A;  3E0J A;  1S5B D;  1NMF A;  1J6Q A;  1VS0 A;  3NTI A;  4X65 Q;  1HNX L;  4XTC S;  1S5F D;  1ROD A;  1AUX A;  2KEE A;  4Q43 A;  2A73 B;  1EY6 A;  1SFO H;  4MV9 A;  4DL2 A;  2Z6K C;  2R8J A;  4GKJ L;  4WBN F;  2HT1 A;  5GAD C;  5FLX W;  1GOZ A;  4X62 L;  2ATL A;  5IYD H;  1VQL A;  2XCL A;  3G6Y A;  4K5X A;  5DGA A;  4RGM A;  1GYF A;  3P7J A;  1JR0 D;  2UUC H;  3VPC A;  1Z47 A;  1XDN A;  5CV9 A;  3C1F A;  4BY1 G;  3I3C A;  2W9B A;  4JV2 A;  3OSP A;  5FLX c;  4QWC A;  5M9O A;  1EIF A;  2NN6 G;  5DLF A;  4LF6 H;  2OEO A;  4LW1 A;  2W9C B;  4X64 H;  3OMC A;  3BVZ A;  3LWU A;  2LKV A;  3FDS A;  4A3M G;  3H4B A;  3S2D H;  1X32 A;  4JI0 L;  1MBY A;  1VQM A;  1PX2 A;  4QW8 A;  3I91 A;  1TWC A;  3H6M A;  2F3I A;  4DK6 C;  1NBW A;  2R7Z H;  2LFN A;  4X3K A;  4IFD J;  1IBM Q;  4FXD A;  1STA A;  2R93 B;  3HS0 C;  3PZP A;  1FD7 D;  4HID A;  2Z8L A;  4A93 B;  3TS2 A;  3BJY A;  4QL5 A;  1EQR A;  1XMO L;  1N32 L;  4MV7 A;  3URY A;  4ALP A;  3P20 A;  3TME A;  5F9N A;  2PI2 E;  1K8A C;  4MTE A;  2O03 A;  1SEI A;  3E5N A;  4JBW A;  2UVV A;  1RKN A;  4JV5 L;  1SNQ A;  2JYO A;  2W8L A;  4DA2 A;  2R7M A;  4I4T F;  1ML0 D;  2WAQ B;  3FDT A;  2PCF B;  4C3I G;  1EWH A;  1Y1V G;  1AE2 A;  5M5Y H;  1LUZ A;  1G2S A;  3OIQ A;  1K8G A;  4NLG A;  5BMV F;  3CD6 A;  4BBS G;  4JI4 H;  4ZCK A;  3TP6 A;  4DL4 A;  1LTG D;  4LFB L;  3SXH A;  1AH9 A;  2W6Q A;  1V43 A;  1CTM A;  3RZD B;  1GUN A;  1S9F A;  4IOA A;  1E4E B;  4UHV A;  3T13 A;  1UEB A;  1IL2 A;  1WVL A;  4RZQ A;  4C3J H;  3OTO L;  4RUC A;  4RB2 C;  4JI8 Q;  1TWC H;  4NXM Q;  4IWX A;  5KG6 A;  2O5I C;  4A75 A;  1S5E D;  3NQT A;  2B8F A;  2A68 D;  3CQZ H;  2E75 C;  1EQT A;  5NUC A;  3SGI A;  1TXY A;  4RHS A;  2PQA A;  2E2H A;  1V8Q A;  3GTP B;  3KDF A;  3LWE A;  2KED A;  1IBK Q;  1HA6 A;  4LF5 L;  1JIC A;  3CCU A;  1Q86 C;  4OX9 Q;  2LS0 1;  3FPP A;  3E0E A;  1Q1B A;  5JJL A;  4HJ9 A;  5EWF A;  3BQ0 A;  1VQH A;  1TY0 A;  4QJF A;  3N6X A;  1YHB A;  1Q8K A;  2IX1 A;  3HOZ H;  2QIL A;  2NUA B;  1HQM C;  3EQL C;  3O13 A;  3S1N H;  1VQG A;  5D1O A;  3WO1 A;  4MNO A;  1CQV A;  2VUG A;  2YZG A;  1JQY D;  2KEN A;  1L2F A;  2XSC A;  1WD0 A;  5IT9 E;  3PUZ A;  4KJO A;  2PZW A;  3KLS A;  2RSO A;  1P8L A;  4FF1 A;  4M8A A;  5KND A;  2MJ8 A;  4QIW A;  2TMP A;  1VKZ A;  1FR3 A;  2F4V Q;  1Y1W G;  1A2U A;  1TU2 B;  4PMC A;  5DNF A;  3CC7 A;  4DR3 H;  3I70 A;  1LT6 D;  3T4A C;  2Z4I A;  1J5E L;  3MWM A;  3N42 B;  3R8B A;  1F9Q A;  5DM6 3;  1HQR D;  2I87 A;  2ASD A;  1BF4 A;  3IFT A;  4DR6 H;  2QCP X;  2FLP A;  5F2D A;  3S15 H;  5KKN B;  3TSS A;  1JMC A;  2IP4 A;  1TS2 A;  2EXD A;  4PZ7 A;  3SVM A;  4DN4 M;  2UXC L;  2E2H H;  4AQY H;  1JXL A;  5HV6 A;  5M3F G;  5FD6 A;  1DOM A;  3M7G A;  1HA5 A;  1S3O A;  4IR1 A;  2O2L D;  3RLF A;  1Z2O X;  5ELN A;  3OWE B;  2WDT A;  2ASL A;  4H44 C;  1I4Q A;  4DV0 L;  3UDF A;  4LFA Q;  4PG3 A;  2GPW A;  4DFA A;  5IE8 A;  1EUD B;  2YZN A;  4YWL A;  3VDY A;  5HBR B;  2NVX H;  1G91 A;  4R7R A;  4HAE A;  1WTW A;  3MA2 B;  4DR2 Q;  5C1P A;  2HVQ A;  3CCR A;  4IPG A;  4MTN A;  4JBM A;  4P74 A;  3R2T A;  5IP7 H;  1KAB A;  3I4N G;  5KFF A;  5IGE A;  1EIH A;  2K14 A;  1EUC B;  1UC9 A;  4RNO A;  5KEE A;  1D7Q A;  5CA0 F;  3FKI G;  4S3S A;  3R23 A;  1IKM A;  1W6J A;  4OIJ A;  1CQI B;  2VQF H;  2B2Y A;  1C0A A;  3RAX A;  3H0G G;  3OSN A;  1DON A;  1EZ8 A;  1ZYR C;  3OHB A;  2J9G A;  2AQ3 B;  4MV1 A;  1EY5 A;  2JSO A;  3RB0 A;  4X3S A;  5A2Q L;  4L1K A;  4RB3 C;  2ZJR A;  5DQI A;  2HCC A;  1KJ8 A;  1F9S A;  5C3X A;  1X9N A;  2H4O A;  3HOU G;  2I8C A;  1XTC D;  4DV6 Q;  2UUB Q;  3CPW A;  1RCV D;  2N3S A;  1E24 A;  4GNX A;  2B2T C;  5BN4 A;  2C00 A;  2R7K A;  3LML A;  2JK8 A;  4B3M H;  5DQG A;  4C3H G;  4O3S A;  3PIO 3;  4EEQ A;  2C22 A;  3J7A V;  5L37 A;  1Y1V B;  4TQU S;  4GZY C;  1LTB D;  2Z9H A;  4O4H F;  1K8M A;  4BBS B;  4DUY H;  1A0I A;  3TN2 A;  3GTO B;  3GTP A;  5KT5 A;  3TP7 A;  3A7L A;  4H13 C;  2XNA C;  2NBF A;  4KHP Q;  4X66 H;  1KNE A;  3QZ7 A;  4CDC C;  1SJE D;  2QKI C;  2MP1 A;  4MTD A;  2J0T D;  2RGV A;  1XTD A;  4UCO A;  1YHA A;  1PYS B;  1N8R C;  5LXT F;  2RDH A;  1U4M A;  1JE4 A;  5L1L A;  3S14 H;  2PNH A;  1K83 B;  2NVY B;  2KUM A;  1NCV A;  1QG7 A;  4EVO A;  1STB A;  4Y7N H;  1EY4 A;  3GV7 B;  1PRT D;  5C3E H;  2IMW P;  1BQQ T;  2EYP A;  1G2T A;  1GUO A;  2HHH H;  5DG7 A;  1K3R A;  4UPA A;  1UNS A;  4R4O A;  2JA7 A;  3HRZ C;  4DUZ L;  4U68 A;  5IGC A;  2D2C C;  2W9A A;  2UU9 Q;  4BA2 I;  4JI3 L;  4C2M B;  5LP6 F;  3FMA A;  1T5E A;  4NDX A;  3IRB A;  1K9M C;  3HOW G;  4ECZ A;  1VQF A;  2R8I A;  4LUO A;  4WRD A;  3J80 i;  1C3O A;  1ET9 A;  1PFB A;  1H9K A;  1CQF A;  2K4K A;  3SE0 A;  1K1S A;  5JVL A;  4G57 A;  4OO1 H;  4PWQ A;  3KLW A;  4JYA H;  2UXD H;  1Y1W B;  4QWB A;  3RNU A;  4ID6 A;  3KAJ A;  3BVG A;  3Q8D A;  2CQY A;  3PUW A;  1ZHQ A;  4ECU A;  3NBH A;  2YV5 A;  3H15 A;  1VQ6 A;  3WWV A;  4LK1 C;  2JEA I;  3AFQ A;  4A3I H;  5ELC A;  3GTG B;  3L2P A;  4JI2 L;  5FLM G;  2V4Q A;  5IP9 G;  1RYR A;  4C5C A;  5M3F B;  2L11 A;  3J80 L;  2EYM A;  1X65 A;  4JBK A;  5E7N A;  5BR8 H;  4PZ6 A;  4O3R A;  2G9H D;  3J7Z C;  5BPH A;  1Y69 U;  2IX0 A;  4IFD G;  4R4Q A;  5EAY A;  2JA7 H;  5K36 H;  4YHH Q;  1YNJ C;  1VQP A;  4DR7 H;  4RGT A;  2BH2 A;  5IGF A;  4OWT B;  4IPC A;  3U9O A;  2R3Z A;  2OLS A;  5EGT A;  3FP9 A;  3PO3 G;  1TQO A;  3NK9 A;  3T51 B;  4RWS C;  4LJZ C;  3CCV A;  2Z1C A;  4CJ1 B;  1KJI A;  4V19 0;  1EYG A;  3OWF A;  2W6O A;  5K2M A;  3D0F A;  1QUQ A;  2PO4 A;  5I6Y A;  1F77 A;  4B3R Q;  3OUZ A;  3J81 j;  3V6K A;  1VF5 C;  2BQR A;  1XMQ Q;  4ECT A;  4HMI A;  1LT3 D;  2Z6B A;  4R8U B;  4RG1 A;  2K01 A;  4DK0 A;  3V4Z A;  3FKI B;  1BXR A;  2J6T A;  2CFM A;  2QW7 A;  3I7F A;  4A2A A;  3PV0 A;  1YEZ A;  3RZO B;  2AQ2 B;  1CKO A;  4DV7 L;  1YNN D;  2NU7 B;  3H91 A;  3A56 A;  3GLK A;  3MEH A;  3OHA A;  1AN8 A;  4P71 A;  2WE6 A;  1KC8 C;  3MEF A;  4A4I A;  5HGQ A;  4DV1 H;  2SDF A;  4UCV A;  4Y52 H;  4XDX A;  1A15 A;  3RIZ A;  4HMJ A;  4ZKB B;  5E4W C;  2AGP A;  2FMM A;  3L3O C;  4ME3 A;  4DR1 Q;  4BY1 H;  4A3B G;  3BDO A;  3T53 B;  3HOU B;  4F4Z A;  1EYC A;  1JLL B;  3GIL A;  2NN6 H;  1HNW L;  4AYB G;  1V1P A;  4RA8 A;  1E1O A;  3WNZ A;  1BO0 A;  2WB1 G;  3Q1K A;  4FM9 A;  1TWG B;  4GKK Q;  3BS1 A;  4A3M H;  4JI1 Q;  3GIP A;  5M3M B;  3Q22 A;  2QDB A;  4K2L A;  1BJT A;  1Z2N X;  2M9V A;  2MO0 A;  2HCI A;  3VYR A;  2MO1 A;  4IUU A;  2UXB Q;  4DUY L;  4B3T Q;  3F2C A;  4HNU A;  1W2B A;  1KDB A;  3Q8P B;  1ZHS A;  5IYC G;  4TSS A;  2F3V A;  4YB8 B;  4P73 A;  4AH6 A;  2ZM6 L;  3M4I A;  3GTQ B;  3H09 A;  5C4X G;  2EYF A;  2R84 A;  1X3P A;  5EQ0 A;  5IOD A;  1C30 A;  4YR3 A;  3BZD B;  1F2Z A;  4JI6 L;  3OPO A;  1DCZ A;  4A3C G;  2W71 A;  4B3S L;  2JA5 G;  2G5D A;  1PH1 A;  2RSN A;  1IYJ B;  4C3I H;  4DV5 Q;  1LAC A;  1A9X A;  3F2U A;  1B3A A;  1E3P A;  4BBS H;  1X56 A;  4DV4 H;  1SMY C;  5GRO A;  3RBE A;  5J1Z A;  1N36 Q;  3U9T A;  1EWI A;  3ND8 A;  4YJ3 F;  5KFL A;  4QWE A;  1RDP D;  1TKW B;  4FU0 A;  3MWE A;  4A3G G;  2X6L A;  3H40 A;  3K5N A;  4ECS A;  3PSI A;  3H20 A;  1XNR Q;  2WKD A;  4B9X A;  2BDN A;  4HYK A;  3R5H A;  1PRT B;  4G7H C;  1LTR D;  4IPH A;  2Y0S A;  3T1H H;  4O4I F;  4L63 B;  2W6P A;  2EE1 A;  1CSP A;  1WD1 A;  3VR3 A;  4K0K L;  3GV5 B;  5TSS A;  5KFW A;  5M5W B;  1SNP A;  2Q2U A;  4DV2 H;  2Z4H A;  3S2H H;  4QCL A;  3GDE A;  1R9T B;  1AE3 A;  2N78 A;  1HNX Q;  4JYA L;  3LNN A;  1K28 A;  3HOV G;  1LLR D;  2KA7 A;  3PW5 A;  3X3M A;  4DR4 Q;  3A8J E;  4KTA A;  3RV3 A;  5FO8 B;  3A0J A;  1E1T A;  1NR2 A;  1PV4 A;  4IRD A;  4GKJ H;  4EFE A;  2YU9 A;  4KMU C;  3QOJ A;  3S1M B;  4OO1 I;  1Y8N B;  2L5T A;  3T56 B;  4POG A;  4X62 H;  2UUA L;  3PN1 A;  2X69 A;  3RV4 A;  1JOO A;  3D4R A;  2RDJ A;  1PTO H;  4FS1 A;  2XIG A;  4OWX B;  1RJR A;  1JWM D;  3S1R B;  4LF8 L;  3STB C;  3HG9 A;  1DM0 B;  1IBL Q;  5C1O A;  3KYH C;  3FKI A;  2PW7 A;  1MI2 A;  4IZ8 A;  1WTQ A;  3D6W A;  2NU8 B;  4KK7 A;  1SCU B;  3BZC A;  1N34 Q;  3HOY H;  3H0G A;  5KG1 A;  5BN3 A;  2OF1 A;  4QWD A;  2L55 A;  1YJ9 A;  5KFV A;  4JI0 H;  3PO3 B;  4YIJ A;  4QWA A;  4K5V A;  2RCN A;  1CA5 A;  5KG0 A;  2PZT A;  2F0O A;  2R93 G;  2B63 A;  4DR5 L;  3WO0 A;  3K5M A;  1LTS D;  4MV8 A;  3OIP A;  3MR2 A;  1PH8 A;  4HIM A;  5KG5 A;  1SNC A;  3A74 A;  2DLN A;  5L1J A;  1XMO H;  1N32 H;  3I55 A;  3HKZ E;  2VUM A;  2R7L A;  5DLG A;  5JEA G;  1FYC A;  1ILP A;  4JV5 H;  3VYS A;  3A8K E;  2VQE L;  1PA6 A;  2I07 B;  4GN4 B;  4QB4 A;  2YU9 H;  1STG A;  2JA8 G;  2NB0 A;  3ERS X;  4QY7 A;  1K1Q A;  2RKS A;  3MWD A;  4A3F G;  4N9P A;  4I7H A;  2VQD A;  1XPU A;  1C7Y A;  1EFW A;  4LFC L;  3GTJ B;  3I4N H;  2E5L L;  4LSA A;  1PH2 A;  5CV4 A;  2KOL A;  2K50 A;  1N33 L;  3BG5 A;  3CCE A;  3KBX A;  4LFB H;  1EOT A;  3MR6 A;  1D5Z C;  3FKI H;  2IBK A;  3GTQ A;  4P72 A;  4MV6 A;  5IT9 L;  4OGQ C;  2WB1 B;  4Q8E A;  4CDD C;  3H0G H;  2VXW A;  5IWA Q;  2J6U A;  2CZG A;  4C5B A;  3OTO H;  1JC7 A;  2IWH A;  2GN5 A;  2RBM A;  1M0W A;  3CHB D;  2B63 H;  2IA6 A;  3E9H A;  1UE7 A;  1G6P A;  1HPC A;  2NN6 I;  3D4W A;  2XRS D;  1HNZ L;  2KCC A;  3K7A H;  2W70 A;  1A8V A;  3ONA B;  1EEF D;  5KT3 A;  3HOU H;  3GIQ A;  3A8I E;  3CP0 A;  3TQT A;  3TQ1 A;  3CKI B;  5T1I A;  5KFQ A;  2F0G A;  5LMU L;  1XNQ Q;  4LF5 H;  2LMC B;  3M9B A;  2WTF A;  3KLR A;  4JV1 A;  2SNM A;  2VUM H;  3DEO A;  3LGJ A;  5DAU A;  1O75 A;  4C3H H;  1QNK A;  1AN7 A;  3Q0A A;  4JBJ A;  1PH6 A;  1UNN C;  1NR4 A;  5AJ3 Q;  4B08 A;  4LF9 Q;  1SEB D;  1WR2 A;  2NUC A;  5KT2 A;  5HY6 A;  1K73 C;  3CCL A;  1EHI A;  1FKA H;  5C5J A;  4XYL B;  2NTT A;  3AMU A;  1MSG A;  4MA0 A;  4ED8 A;  1BCP D;  1LO5 D;  3T16 A;  3TIN A;  4A3G B;  2Z6K A;  3QZ8 A;  1CI3 M;  2CKZ B;  4FXG C;  4K8I A;  2CQO A;  1FL0 A;  3QB3 A;  1J5E H;  4YY3 L;  3IN5 A;  4YP3 A;  3T1H L;  3LWB A;  2KVM A;  4X3T A;  3SDZ A;  5KFI A;  3RN2 A;  3T1Y L;  5D3D A;  4I55 F;  2RDG A;  2KQ3 A;  1Q1E A;  1X55 A;  1PRT C;  5KFT A;  2K5W A;  5KFC A;  3OW7 A;  2K52 A;  2LXJ A;  4RNM A;  4DPG A;  3D3R A;  3EBE A;  2UXC H;  3KBG A;  4CJ0 B;  1OTC A;  4RB1 A;  3HOV B;  2JQO A;  2ZT9 C;  4JI5 L;  2R92 B;  5I47 A;  4JI7 L;  5KGU A;  4ED1 A;  1UEA B;  4C1N I;  4DV0 H;  2PQE A;  3V6J A;  2EY6 A;  1ASY A;  1VQI A;  1VQJ A;  1YIJ A;  1WOC A;  2UUC Q;  1TWH A;  4I50 F;  3PIP A;  4NXN L;  1KC7 A;  1B8A A;  3M4P A;  3HOX G;  3HOW H;  1II3 A;  1QE6 A;  3K0Y A;  3VA5 A;  1S0O A;  3NXW A;  4KKU A;  2V59 A;  1G29 1;  4RAU C;  4LF6 Q;  5JH7 F;  2PNR C;  1SYD A;  2C28 A;  4X64 Q;  1UE5 A;  4O3N A;  1FGU A;  1MGS A;  5J39 A;  2HJW A;  1GHJ A;  4J9K A;  1HR0 Q;  5IGB A;  2VOB A;  3H4D A;  5CBE E;  4DV3 H;  2R8H A;  4M7E A;  4A3K G;  3GID A;  1EU3 A;  4IUR A;  5FO7 B;  3CXC A;  1MIU A;  3MXN A;  3GTM A;  3S1M H;  3JAM i;  2PPB C;  4BY7 B;  2F0D A;  4R4C A;  3LP8 A;  3M4O H;  3RB4 A;  1DZ1 A;  2F03 A;  2BOS A;  1E22 A;  1STY A;  5IY0 A;  3J81 E;  4YAK B;  2V4R A;  3GV3 A;  2E2I A;  2KJX A;  1E4G T;  4HED A;  4IFD H;  5FPR A;  5KFH A;  4AYB A;  2ALY B;  5GAE C;  3R5F A;  4GLA C;  2R8K A;  1U4L A;  3K3V A;  2PMZ E;  2WB1 A;  1TWH H;  1TWF A;  2CW8 A;  5JOB A;  3IKJ A;  1HZA A;  4JI4 Q;  3F8N A;  4KHZ A;  1TS3 A;  2F0S A;  3NTH A;  3I4M H;  2RDI A;  2DPJ A;  1PRT F;  1QOH A;  2JA8 B;  3OUU A;  5KX5 F;  5JVD F;  5BN5 A;  4HIK A;  3VA7 A;  4A3F B;  3RAQ A;  4F50 A;  2M05 A;  1J8I A;  3BAA A;  1A3V A;  3JAM L;  1IHZ A;  1VQ8 A;  4A3L G;  1I6H B;  1SMX A;  4ZRZ A;  1WSC A;  1PFS A;  4JVZ A;  4RZR A;  3SK8 A;  1I50 A;  3S16 B;  3M9M B;  3R5X A;  5D14 A;  2Q8I B;  3A7A B;  1ICW A;  4EQP A;  4LF7 L;  2MGS A;  3S1Q H;  2YTX A;  3IG0 A;  2JA5 A;  2AUJ D;  5KFP A;  3GTM H;  1JOR A;  2B2U A;  4WFN 3;  1VQB A;  1TAE A;  1A2T A;  4EYI B;  1GM5 A;  4K5W A;  3M9O B;  3GIM A;  2ZJP A;  3F1Z A;  4XYQ A;  3MXU A;  1HFG A;  1TVX A;  1YNX A;  4A3B H;  2Q2T A;  2E2I H;  4XYM B;  4ZQI A;  5KT6 A;  4J9M A;  4ED3 A;  1AW7 A;  1I5F A;  5KG4 A;  4TV8 F;  1GSO A;  3S17 H;  3GP7 A;  1GXD C;  4IWY A;  1I94 Q;  1TWA A;  2D9U A;  2CW0 D;  4OHJ A;  1TWF H;  2B29 A;  4OXP A;  1EIY B;  1W93 A;  2FPG B;  4LH7 A;  3G6E A;  3RFC A;  4DUZ H;  3BJU A;  3JSN A;  3SEB A;  2CVR A;  4O3P A;  4JI3 H;  2XGT A;  5CR3 A;  3TZD A;  4DXG A;  1PH5 A;  2OWO A;  3H94 A;  4X6A H;  1TA8 A;  4O3O A;  4A3J G;  2FLL A;  3L4J A;  3HFZ B;  2B2U C;  4ECR A;  3KF8 A;  1S0M A;  1SDF A;  1B9M A;  4DR3 Q;  1DIK A;  2K6A A;  2A1A A;  3TP8 A;  3U58 A;  3RB3 A;  3GTL A;  5IYC H;  4DR6 Q;  2RDF A;  5GAH C;  4QGU A;  3JAM W;  1I50 H;  2QEJ C;  1J9O A;  5C4X H;  1RJQ A;  2X0S A;  1BBU A;  3RUZ A;  3RLO A;  1JJ2 A;  1EQV A;  4L6T B;  4K14 A;  4DF7 A;  2JJQ A;  5KRU A;  2DJG C;  1PTO D;  4AQY Q;  2JA5 H;  1QIL A;  4A3D H;  4PDB A;  5JJZ A;  1EQQ A;  4C5A A;  1E2W A;  3FEW X;  1BCP B;  1O7Y A;  4JI2 H;  2K7V A;  3ULL A;  3PUV A;  5HUR A;  2XIW A;  4HIO A;  4WJW A;  2HD3 A;  4CC5 A;  4RKL A;  1SN8 A;  4L8J A;  1L0Y B;  1HZ9 A;  1I4P A;  3PGZ A;  4L5T A;  1EWC A;  1SE2 A;  2NZH A;  1RK6 A;  4N8F A;  4G7O C;  1WTP A;  4ECW A;  3CRL C;  1EYZ A;  1KJQ A;  1TWA H;  2MCT A;  3BQ1 A;  1B2T A;  2YZM A;  4O0A A;  2W9C A;  4UCU A;  1PVO A;  4A76 A;  3K80 C;  1V9P A;  1KIX A;  4YQW A;  4M9U A;  2ALZ A;  1WFQ A;  4RGN A;  2C2E A;  3HOX B;  5EDW A;  1B9N A;  3N8D A;  2L9H A;  4FP5 D;  5EKI A;  1CZW A;  5FLX E;  4RNN A;  2EQS A;  2SCU B;  3BZK A;  4OL7 A;  4BS9 A;  3K0X A;  1EZ1 A;  1JJG A;  4G3I A;  3RN5 A;  3GTL H;  2VZA A;  2R93 A;  2V5A A;  2VQF Q;  4L5S A;  1I7N A;  3AFP A;  4EQO A;  2B2T A;  1B6S A;  2W7O A;  5DQH A;  4DV3 L;  1CSQ A;  4WJ3 M;  5EBD A;  1GO3 E;  1QJO A;  1L2Z A;  2A69 C;  4X65 L;  3ERQ A;  1T94 A;  4A3K B;  3EPI A;  4EBE A;  4DV7 H;  3K58 A;  2PBZ A;  3EPG A;  3NUC A;  1Z7T A;  2XRQ D;  5C4J B;  4A3E G;  1T36 A;  2WAQ A;  3QFF A;  4RFB A;  1QVC A;  2F0N A;  3R3O A;  3DEP A;  1I4X A;  4GC6 A;  1FJG H;  3AEV A;  1I4H A;  3F8T A;  3K3P A;  4JPB W;  5J22 A;  4B3M Q;  3RGZ A;  3I73 A;  4P2C B;  5JUM A;  1H9J A;  2KBN A;  2RHQ B;  3U9S A;  1E4E A;  1XYI A;  1H9M A;  1HNW H;  2RF4 A;  3CRK C;  3NHH A;  1VF7 A;  2CQA A;  3V2T A;  4Q5V A;  1HCZ A;  2R6G A;  5J3B A;  4HJA A;  3D4D A;  5M3M G;  2F0V A;  3BDC A;  4GN5 A;  2FE3 A;  4PQX A;  4ETS A;  4X66 Q;  4YBZ B;  2FHT A;  5KG7 A;  2R93 H;  4IFD I;  1P16 A;  3GQC A;  2NVQ B;  2VY3 A;  2F0I A;  5JEA J;  2N55 A;  4RMF A;  5DM7 3;  1IBM L;  4A93 H;  2RQX A;  2BCO A;  1OXX K;  1BKB A;  1JB7 A;  2ZM6 H;  4YJ2 F;  3HEJ A;  4YWK A;  5LA6 F;  4DAY B;  2VB3 X;  5C44 G;  1F2L A;  3NWT A;  4RKB A;  1VQK A;  3ER0 A;  4JI6 H;  1L0X B;  4QW9 A;  4B3S H;  2K05 A;  4JCV E;  1OXU A;  2WP8 J;  3VR6 A;  4WJ4 A;  2XGP A;  4DNI A;  2Y0S E;  4HN7 A;  1W96 A;  2MPM A;  2YW2 A;  4XT3 B;  5KFM A;  2HHH Q;  5T14 A;  1QZH A;  4ULL A;  2NVT B;  3EN2 A;  3DWA A;  1EY8 A;  2JA6 B;  1I6H H;  5A2Q W;  5IGG A;  1WCM G;  1OO9 B;  3RZD H;  1DV1 A;  2CH4 A;  5CMD A;  4CKC A;  4MTK A;  1O7Z A;  2D0O A;  2E8G A;  2AUK A;  5LMN H;  5EJW A;  2FPP B;  1PXU A;  1Z2P X;  5M5X B;  5C6A A;  3T5H A;  1IOW A;  1O80 A;  3P1H A;  5JJI A;  4P75 A;  1SYB A;  5C0X J;  2FKL A;  1Z6H A;  1G6Z A;  4MIU A;  3A5U A;  1JE5 A;  4JI8 L;  2AU0 A;  4A3J B;  1PH4 A;  2KHI A;  4JYA Q;  2GA4 B;  2L15 A;  5K5P A;  2UXD Q;  4EFB A;  4K0K H;  2B39 A;  2BA1 A;  2AHO B;  4JOI C;  4NXM L;  3GTP H;  4Z9C B;  1B7Y B;  3J7Y W;  2ZJT A;  4NMZ A;  1IBK L;  2B2V C;  1KBL A;  2EIF A;  1O7L A;  2F0J A;  1NJI C;  1MJE A;  2VB2 X;  4OX9 L;  2A6H D;  2YRX A;  1A6X A;  4XXE A;  4NB3 A;  2KCM A;  5BR8 Q;  2DZD A;  1SNO A;  1LTI D;  4CKE A;  4HR7 B;  1ESF A;  4B9W A;  3C2P A;  2E2D C;  5ELO A;  1HRJ A;  4XYO A;  2UUA H;  2ZXR A;  1WTH A;  1MJC A;  1LTT D;  4DR7 Q;  3UFX B;  1CKN B;  5I2X A;  1D5X C;  1VQA A;  2HQL A;  3KHG A;  2KCT A;  4NP5 A;  4LF8 H;  3K5I A;  2F4I A;  3BVM A;  4EBD A;  2F4V L;  4Q44 A;  4DL3 A;  4FNF A;  3J7A F;  1AUV A;  5D3I B;  4IZO A;  4PMB A;  3AQQ A;  1PYW D;  3HZX A;  1E2V A;  2SEB D;  2SNS A;  4A2B A;  2EXZ A;  3EFX D;  2UVU A;  2JEI A;  4F4Y A;  4KJN A;  3PW4 A;  4DR5 H;  4JUZ A;  4L5R C;  2H5X A;  4XQJ A;  1AP0 A;  2M00 A;  3I90 A;  4DU9 A;  1QB5 D;  1UE6 A;  5EPK A;  4ZAI A;  3EJI A;  4DV1 Q;  3CCJ A;  4LFA L;  3BU2 A;  3K5H A;  2XC9 A;  4A3E B;  1VMP A;  2VQE H;  4RHR A;  1Y1V A;  1FJG L;  1BBW A;  5KFY A;  4X3U A;  3LX0 A;  3VYU A;  1VQ9 A;  4DR2 L;  2V58 A;  3BYY B;  1QZG A;  4ED2 A;  3GTO A;  2K5Q A;  4LFC H;  4J9Q A;  1PK8 A;  3MXG A;  5I2Y A;  2E5L H;  3JSL A;  2QK4 A;  1N33 H;  3J80 W;  3D6C A;  3CMA A;  1EY0 A;  1SND A;  4QMG A;  4DAY A;  3FVQ A;  4GOP B;  3MZ5 A;  5LL6 S;  1STN A;  4MV4 A;  3UDX A;  4UDU C;  4UFZ A;  2OTL A;  3J80 c;  4LWC A;  3UE0 A;  3E3X A;  5KFA A;  2JA9 A;  1K83 A;  2NVY A;  4H02 A;  3IL8 A;  5AFW A;  2QEX A;  1BCP F;  3SK4 A;  4IRC A;  3G7L A;  4F88 A;  1HNZ H;  2B8G A;  2EYH A;  2C2R A;  1CUK A;  1SYC A;  5COY A;  4Q0F A;  4MN3 A;  1KJ9 A;  5LMU H;  3KF6 B;  4GN3 B;  2AKW B;  4HJ7 A;  1OXV A;  2UUB L;  1HFN A;  3CC2 A;  1OXS C;  2DN8 A;  1CFM A;  1XX8 A;  5C44 B;  3ICE A;  3QIA A;  2F0H A;  4FBT A;  3M3Y B;  1Z9F A;  2F3W A;  3DUZ A;  4DV4 Q;  1TY2 A;  2NZ1 D;  1Y1V H;  4YAJ B;  4C2M A;  3RMH A;  3FHW A;  1L1O B;  3RR5 A;  2YYA A;  2R8G A;  2KHS A;  1DJR D;  3HKS A;  2HIX A;  4R8I A;  1I4R A;  3MR3 A;  3PO2 B;  2SOB A;  3DM1 A;  4R4I A;  3GTO H;  2QYZ A;  4A3L H;  2FK1 A;  2A74 C;  3HKZ G;  2QGQ A;  1WCM B;  2P5Z X;  1HUM A;  5HGT A;  5LMN L;  1Q82 C;  1VQE A;  3T1H Q;  1Y1W A;  3KJO A;  1IXR A;  3PW0 A;  2EDG A;  4KHP L;  1BGW A;  3TRZ A;  3BA9 A;  4C1N K;  2Q2H A;  1TT2 A;  2A68 C;  4DV2 Q;  5LYJ F;  4ED7 A;  4YY3 H;  3GTG A;  2E2J B;  1AFP A;  1K83 H;  2FK3 A;  3T1Y H;  2NVY H;  3BDL A;  3NQI A;  1RL2 A;  2ZTE A;  4DXF A;  5H1S E;  2NVT H;  3CF5 A;  3TBI B;  2FJZ A;  1VQ5 A;  3TP5 A;  1NAP A;  2R92 G;  4IPD A;  1C4Q A;  5DEH A;  4GKJ Q;  2V1C C;  5FPO A;  4JI5 H;  2DY8 A;  2OXP A;  2JN4 A;  1SFO B;  4JI7 H;  3OW2 A;  2M2L A;  2MQH A;  4X62 Q;  4C2M H;  4OWW B;  1H9R A;  3K7U C;  1BOS A;  4LNQ A;  1D1I A;  4ECX A;  4TVA B;  4ZQ3 A;  1BBX C;  2UU9 L;  4A3J H;  4NXN H;  3PF4 A;  3TIG A;  1B53 A;  1LT5 D;  1SE4 A;  1VQC A;  5IP7 G;  2XTI A;  1OXT A;  1PZK D;  3MTS A;  3RBD A;  1H9S B;  1Y1W H;  4R8U A;  1KJJ A;  2YS7 A;  1HJP A;  5EKL A;  4JI0 Q;  1JKJ B;  4LMQ D;  2K5N A;  3RUP A;  4LF4 H;  4J9L A;  5EPJ A;  3M7N A;  5LMN W;  1TR5 A;  5G3L D;  3SHL A;  3S2D B;  1S5C D;  2LY7 A;  3K5L A;  1U5K A;  1GUW A;  2FPI B;  3GTG H;  4EQ5 A;  3KTM A;  4I7Z C;  4CBV A;  1A62 A;  2DPI A;  1O7I A;  2CWA A;  1ZYR D;  3D31 A;  4BY7 G;  1B3Q A;  1XMO Q;  1N32 Q;  4J15 A;  4HTH A;  5M3F H;  4U6P A;  2Q8T A;  2IPK D;  3N6R A;  4KKT A;  5KYL A;  5KFO A;  1JX4 A;  4DKA C;  1LTL A;  4JV5 Q;  1LTA D;  1GUS A;  3TZU A;  5JVG 3;  3E6Z X;  4K2K A;  1TWG A;  3W1B A;  1M7J A;  4FYD A;  2AQ1 B;  4PMW A;  4YHH L;  4JK1 C;  4AIM A;  5M5Y B;  4CHT B;  2K28 A;  4LFB Q;  2DWC A;  3K6O A;  3CU7 A;  2UVR A;  1IL8 A;  4F7X A;  2W7P A;  3DF7 A;  2W9B B;  5D65 A;  2ICE C;  2EY2 A;  3OTO Q;  4B3R L;  2CH4 W;  2R7D A;  3ULJ A;  1IKL A;  2F0T A;  2WFW A;  3J80 E;  5D1P A;  3RZO H;  4O42 A;  4I65 A;  4C3J B;  2WKC A;  3VR4 A;  1B50 A;  1TWC B;  4LF7 H;  2K75 A;  2EYL A;  2L12 A;  4GOP C;  3PIO A;  3CQZ B;  5C3W A;  3CC4 A;  1LAB A;  5I6W A;  4LF5 Q;  1BVS A;  4CJ2 C;  5CGK A;  1A63 A;  1ENA A;  3PQI A;  5FJ8 G;  1UAP A;  5KFX A;  3KUP A;  4KD3 A;  5C0X G;  3Q2O A;  2XVS A;  2RGR A;  2MNA A;  3T5K A;  1WCM A;  1PTO F;  4QIW E;  3IFD A;  4DR1 L;  1M0T A;  2DNE A;  1SRU A;  5KFR A;  1TWG H;  4QUC A;  5C8Y F;  3X3N A;  3ITP A;  4DL6 A;  4ME5 A;  1KXL A;  5M3M H;  2EYJ A;  1GGO A;  1STH A;  4IUP A;  3TQY A;  3UDG A;  1ZEQ X;  5IOC A;  4JI1 L;  4GKK L;  3L7Z C;  1GJX A;  3GO5 A;  1VQD A;  3M9N B;  3T5L A;  4KN4 C;  5FOB B;  5E4X A;  2PVP A;  1L1O C;  2K03 A;  1N9W A;  5KFJ A;  3NTK A;  1R9T A;  2UXB L;  1I7L A;  4B3T L; 
#chains in the Genus database with same CATH homology
 4A3D G;  1J5E Q;  2XGT A;  2MFI A;  2BA0 A;  1PH5 A;  2OWO A;  1GKH A;  2JEB I;  3GTQ H;  4X6A H;  4A3J G;  1PH7 A;  3HFZ B;  1K3R A;  4UPA A;  4R4O A;  4DAM A;  4DUZ L;  1S40 A;  4DR3 Q;  2A1A A;  3U58 A;  1HZC A;  2UU9 Q;  4JI3 L;  1Q7Y C;  4JI5 Q;  4JI7 Q;  5IYC H;  1YHQ A;  2JA6 H;  1K0R A;  1PYB A;  4R4T A;  2UXC Q;  2HHH L;  4DR6 Q;  3CW2 C;  2IT1 A;  5GAH C;  1CKN A;  3NEN A;  4QGU A;  1I50 H;  2D0P A;  3IRB A;  5C4X H;  1K9M C;  3HOW G;  1VQF A;  4LUO A;  1M90 C;  3B6Y A;  3J80 i;  1BBU A;  2PQA B;  3RLO A;  5M5X H;  1SRO A;  2Q2I A;  3KDF B;  1JJ2 A;  4NXN Q;  2K4K A;  2VW9 A;  2JJQ A;  4DV0 Q;  4AQY Q;  2JA5 H;  4BXX H;  3TEH B;  5IT9 c;  4LUZ A;  4A3D H;  3KLW A;  1EQQ A;  5C0X I;  2VL6 A;  3RNU A;  3ULL A;  2JA7 G;  3Q8D A;  3PUV A;  3PUW A;  2YV5 A;  4HIO A;  3I56 A;  3H15 A;  1VQ6 A;  3TS0 A;  3WWV A;  1G51 A;  3CCS A;  4LF4 Q;  2JEA I;  2CWP A;  1KAW A;  1SN8 A;  3AFQ A;  3PGZ A;  1HZ9 A;  4L5T A;  4XIG S;  4A3I H;  2UXD L;  3L2P A;  2NZH A;  3G48 A;  5FLM G;  4JI2 L;  2E2J H;  1XNR L;  2DUD A;  5IP9 G;  3U4Z A;  2WAQ E;  1TWA H;  1FVI A;  5M5W H;  1NY4 A;  2I0Q A;  4GLV B;  3I4O A;  1HZB A;  4O0A A;  1XJV A;  4AYB E;  1PVO A;  1R9T H;  4JBK A;  4A76 A;  1X65 A;  3K80 C;  3PUY A;  1V9P A;  2RHS B;  5E7N A;  4APV A;  4PZ6 A;  1KIX A;  3I2Z A;  2WB1 E;  3J7Z C;  1WFQ A;  2IX0 A;  4LF4 L;  4IFD G;  4R4Q A;  5EAY A;  2JA7 H;  1E7Z A;  2EQS A;  2K5H A;  4YHH Q;  5IYB H;  1GD7 A;  2CCZ A;  3BZK A;  5BR8 L;  3K8A A;  3K0X A;  1YI2 A;  1JJG A;  3RN5 A;  4LUV A;  2VZA A;  1VQP A;  3GTL H;  2BH2 A;  1JT8 A;  2VQF Q;  4OWT B;  4IPC A;  4L5S A;  4JC0 A;  3AFP A;  4POF A;  5FLM H;  4DR4 L;  3G4S A;  3FP9 A;  3PO3 G;  2JE6 I;  5IP9 H;  1NE3 A;  4GLX A;  4DV3 L;  3F2B A;  1IZ6 A;  1CSQ A;  3CCV A;  4DR7 L;  4WJ3 M;  1EYG A;  1YVC A;  1GO3 E;  3D0F A;  4IJL A;  1QUQ A;  3NEL A;  4X65 L;  3J7A 5;  4B3R Q;  3J81 j;  1KRS A;  1WJJ A;  4GOP A;  1WYD A;  1XMQ Q;  4A3E G;  1V1Q A;  1XPO A;  3S1R H;  4RG1 A;  1QVC A;  3NEM A;  5DLQ E;  2ZJQ A;  4UY8 C;  2CFM A;  3I7F A;  3AEV A;  3PV0 A;  1YEZ A;  1CKO A;  1QVF A;  4OON A;  3F8T A;  4DV7 L;  3M85 A;  1IBL L;  4A93 G;  2ZTC A;  4B3M Q;  4KI0 A;  3L0O A;  4P71 A;  3S24 A;  3U4V A;  3PO3 H;  1YJW A;  1PH3 A;  2KBN A;  1N34 L;  3CCQ A;  2RHQ B;  1X6O A;  1KC8 C;  4LF7 Q;  4QQB X;  3MEF A;  4A4I A;  5HGQ A;  1XMQ L;  2RF4 A;  3KF6 A;  3J81 c;  1H95 A;  4Y52 H;  1X54 A;  2R6G A;  2WAQ G;  3DM3 A;  4ME3 A;  5J3B A;  4HJA A;  5M3M G;  4DR1 Q;  4BY1 H;  4A3B G;  4A3E H;  3MXN B;  4GN5 A;  1EOV A;  4DV1 L;  4AYB G;  1HNW L;  2FXQ A;  3PO2 G;  1L1O A;  4X66 Q;  2UXB L;  1E1O A;  4BBR H;  2AWO A;  2R93 H;  4IFD I;  4JG2 A;  2WB1 G;  1P16 A;  4O2D A;  4GKK Q;  2K5V A;  2VY3 A;  4A3M H;  4JI1 Q;  4RMF A;  5JEA J;  1IBM L;  4A93 H;  5C3E G;  1OXX K;  2C35 B;  1T9H A;  2F52 A;  4HJ8 A;  3PCO B;  2I5H A;  3EIV A;  1BKB A;  3RLN A;  2MO0 A;  1JB7 A;  2MO1 A;  2UXB Q;  4DUY L;  4B3T Q;  4YWK A;  3F2C A;  2YTV A;  1EUJ A;  1RIP A;  4DAY B;  5C44 G;  1W2B A;  3GTJ H;  1JJC B;  1VQK A;  3ER0 A;  2AMC B;  5IYC G;  2JA6 G;  4JCV E;  4DUZ Q;  1OXU A;  4KLK A;  4P73 A;  2VS1 A;  4AH6 A;  2WP8 J;  2ZM6 L;  4WJ4 A;  4DNI A;  2Y0S E;  3CME A;  4GNX B;  5C4X G;  4JI3 Q;  1DGS A;  2OQK A;  1L0W A;  3H3V I;  2HHH Q;  2OQ0 A;  4JI6 L;  2ID0 A;  4A3C G;  1XPR A;  1QZH A;  4B3S L;  2JA5 G;  4BXX G;  3EN2 A;  1PH1 A;  1SE8 A;  1IYJ B;  4C3I H;  1I6H H;  3DLL A;  1SLJ A;  1WCM G;  4DV5 Q;  3RZD H;  4OO1 G;  4R1J A;  4IO9 A;  5IWA L;  2IHF A;  3PF5 A;  2D0O A;  2E8G A;  3K81 C;  1PHJ A;  4UP7 A;  1E3P A;  4BBS H;  1X56 A;  2QA4 A;  5C44 H;  2IY5 B;  5GRO A;  1KL9 A;  1N36 Q;  1EWI A;  4FDB A;  4A3I G;  2DGY A;  3M3Y H;  1YJN A;  5JJI A;  4P75 A;  5C0X J;  3ZJY C;  3A5U A;  1JE5 A;  4JI8 L;  2N8N A;  4A3G G;  4DV4 L;  2KHI A;  1PH4 A;  2L15 A;  4JYA Q;  3UE1 A;  2UXD Q;  3PSI A;  4DV5 L;  4JI2 Q;  2BA1 A;  2AHO B;  4JOI C;  4NXM L;  1XNQ L;  1XNR Q;  3GTP H;  3PO2 H;  1KRT A;  4A3C H;  1Q81 C;  3KFU A;  1B7Y B;  3G71 A;  4IPH A;  1WCM H;  1CSP A;  3JAM c;  1IBK L;  4K0K L;  1N36 L;  3CPF A;  2EIF A;  2OTJ A;  5K36 G;  1NJI C;  1MJE A;  3A5Z B;  5AJ3 L;  5IYB G;  4OX9 L;  2Q2U A;  4LF9 L;  4HJ5 A;  3S2H H;  3GDE A;  1HNX Q;  1AE3 A;  2N78 A;  4IOC A;  4JYA L;  4NB3 A;  2KCM A;  3HOV G;  4YCW A;  5BR8 Q;  2YTY A;  3TRE A;  4DK3 C;  4DV2 L;  1QVG A;  1ASZ A;  4A3G H;  3KF8 B;  1MKH A;  2ATW A;  4DR4 Q;  5ELO A;  5GAG C;  3HOY G;  3STB D;  1LYL A;  2Y0S G;  1X3F A;  4DV3 Q;  3A0J A;  1E1T A;  1MJC A;  4DR7 Q;  1CKN B;  1PV4 A;  1NMF A;  1J6Q A;  1VS0 A;  1VQA A;  2HQL A;  4X65 Q;  1HNX L;  4XTC S;  2KCT A;  4OO1 I;  2R7F A;  4POG A;  1YZ6 A;  2UUA L;  1SFO H;  2F4V L;  2Z6K C;  4GKJ L;  4OWX B;  3AQQ A;  2HT1 A;  3HOV H;  5GAD C;  3CCM A;  4DV7 Q;  4X62 L;  4LF8 L;  2R92 H;  5IYD H;  3STB C;  1IBL Q;  1VQL A;  3NBH B;  5JJK A;  3KYH C;  4UP8 A;  2IHE A;  3BZC A;  1N34 Q;  1Z47 A;  1FJG Q;  3HOY H;  4BY1 G;  5FLX c;  4L5R C;  2H5X A;  1YJ9 A;  1EIF A;  2NN6 G;  2RCN A;  2UUC L;  4LW1 A;  4BBR G;  2R93 G;  1UE6 A;  2HIV A;  4DR5 L;  4DV1 Q;  1HNW Q;  3CCJ A;  4A3M G;  3S2D H;  4LFA L;  4JI0 L;  3BU2 A;  1VQM A;  4BA1 I;  4LF6 L;  1PH8 A;  4HIM A;  3A74 A;  2F3I A;  4DK6 C;  1NBW A;  2R7Z H;  1FJG L;  1BBW A;  4X64 L;  4IFD J;  1G6P A;  1VQ4 A;  3I55 A;  1IBM Q;  3HKZ E;  4MZ9 A;  5JEA G;  1VQ9 A;  1X3G A;  4DR2 L;  1HR0 L;  4HID A;  1QZG A;  2OCE A;  2VQE L;  1PA6 A;  3TS2 A;  1Q12 A;  4DUY Q;  4GN4 B;  1EQR A;  4QL5 A;  1XMO L;  2YU9 H;  1N32 L;  2JA8 G;  4ALP A;  3ERS X;  4QY7 A;  1YBY A;  3OYY A;  2B63 G;  4A3F G;  2PI2 E;  2ZTD A;  1K8A C;  4BY7 H;  4JBW A;  1QUQ B;  1XPU A;  4JV5 L;  1C7Y A;  1EFW A;  3CMA A;  2ZM6 Q;  4LFC L;  3I4N H;  4GOP B;  2E5L L;  2LXK A;  1PH2 A;  2GVA A;  2K50 A;  1N33 L;  2ASB A;  1Y1V G;  1AE2 A;  3UDX A;  5M5Y H;  3CCE A;  1LUZ A;  2OTL A;  3J80 c;  4LWC A;  3UE0 A;  4JI6 Q;  3FKI H;  2JA9 A;  2VUM G;  4B3S Q;  1K8G A;  4P72 A;  4H02 A;  3CD6 A;  4BBS G;  2QEX A;  3H0G H;  5IWA Q;  4LFB L;  1AH9 A;  1UWV A;  1V43 A;  1CUK A;  2GN5 A;  2JA8 H;  4JOI A;  4IOA A;  3KF6 B;  4A3F H;  4JI4 L;  3E9H A;  1UE7 A;  1UEB A;  2AKW B;  2NN6 I;  4GN3 B;  1OXV A;  3CAM A;  4HJ7 A;  2UUB L;  1IL2 A;  4C3J H;  3OTO L;  3K7A H;  1OXS C;  5LMN Q;  1HNZ L;  3CC2 A;  1A8V A;  4B3T L;  3ICE A;  4JI8 Q;  3HOU H;  1TWC H;  1Z9F A;  3CP0 A;  4DV4 Q;  1Y1V H;  3M4Q A;  2PI2 A;  3FHW A;  5LMU L;  1LM0 A;  1WI5 A;  1L1O B;  3M9B A;  3RR5 A;  4NXM Q;  1XNQ Q;  4A75 A;  3HKS A;  2VUM H;  3S16 H;  3CQZ H;  3LGJ A;  3SGI A;  2B63 H;  1TXY A;  2HIX A;  2PQA A;  4R4I A;  4C3H H;  3KDF A;  1IBK Q;  3GTO H;  4K0K Q;  4GNX C;  4JBJ A;  1PH6 A;  2KHJ A;  4GS3 A;  4LF5 L;  3HKZ G;  3CCU A;  2QGQ A;  4A3L H;  4YCV A;  5AJ3 Q;  1Q86 C;  4OX9 Q;  4LF9 Q;  3E0E A;  1Q1B A;  5LMN L;  1Q82 C;  1VQE A;  4HJ9 A;  3T1H Q;  1HR0 W;  1M1K C;  5JJL A;  1VQH A;  4NPS A;  1IXR A;  4QJF A;  5HY6 A;  3KJO A;  4KHP L;  1YHB A;  1Q8K A;  1SR3 A;  2IX1 A;  3HOZ H;  3TRZ A;  1K73 C;  2A19 A;  2Q2H A;  5FJ8 H;  3CCL A;  3S1N H;  1VQG A;  4DV2 Q;  4MNO A;  2KEN A;  1L2F A;  1K83 H;  1NTG A;  3PUZ A;  2NVY H;  2Z6K A;  2CKZ B;  1P8L A;  3W1G A;  1RL2 A;  2CQO A;  1FL0 A;  2ZTE A;  4YY3 L;  5H1S E;  2NVT H;  3T1H L;  1VQ7 A;  3CF5 A;  1I94 L;  2I5M X;  3RN2 A;  1VQ5 A;  3T1Y L;  2UUA Q;  3KJP A;  2F4V Q;  1Y1W G;  1Q1E A;  1X55 A;  2R92 G;  5IYD G;  3CC7 A;  4IPD A;  2I5L X;  4GKJ Q;  2V1C C;  2K52 A;  2LXJ A;  1J5E L;  4DPG A;  1UE1 A;  2NZO A;  3EBE A;  3OW2 A;  2MQH A;  4X62 Q;  4LF8 Q;  4C2M H;  4OWW B;  3S15 H;  3K7U C;  1OTC A;  1JMC A;  4LNQ A;  4YWM A;  4DR3 L;  2JQO A;  2EXD A;  4TVA B;  4JI5 L;  4PZ7 A;  2UU9 L;  4A3J H;  4JI7 L;  3PF4 A;  2UXC L;  5GQO A;  2E2H H;  4DR6 L;  1VQC A;  5M3F G;  1ASY A;  2N49 A;  5IP7 G;  1VQI A;  1S3O A;  1VQJ A;  2XTI A;  1WOC A;  1OXT A;  1YIJ A;  3RLF A;  2UUC Q;  1C9O A;  3PIP A;  5ELN A;  4NXN L;  1X3E A;  1B8A A;  3M4P A;  3HOX G;  4DR5 Q;  4AQY L;  4DV0 L;  1Y1W H;  3HOW H;  3UDF A;  1KHI A;  2R7Z G;  2ES2 A;  1HJP A;  3E9I A;  4LFA Q;  4JI0 Q;  2K5N A;  2B3G A;  1G29 1;  1GVP A;  4PG3 A;  4LF6 Q;  5IE8 A;  3M7N A;  4YWL A;  5LMN W;  3VDY A;  4X64 Q;  1PH9 A;  1UE5 A;  1U5K A;  3GTG H;  3AYH B;  4EQ5 A;  1FGU A;  2NVX H;  3F2D A;  1A62 A;  4DR2 Q;  1YIT A;  1KQS A;  1HR0 Q;  1O7I A;  2D62 A;  2CWA A;  3D31 A;  4L5Q A;  2VQE Q;  3CCR A;  4BY7 G;  4IPG A;  4MTN A;  1XMO Q;  3UDI A;  1VQN A;  4J15 A;  1N32 Q;  5M3F H;  4JBM A;  4P74 A;  5IP7 H;  3I4N G;  4A3K G;  1VCI A;  1VQO A;  3I4M G;  2K14 A;  1LTL A;  4DKA C;  1MIU A;  3HOX H;  1HH2 P;  3CXC A;  4JV5 Q;  4LFC Q;  3S1M H;  1D7Q A;  3FKI G;  2E5L Q;  3JAM i;  4R4C A;  3PUX A;  1N33 Q;  3M4O H;  1C0A A;  3H0G G;  1E22 A;  3W1B A;  2YYZ A;  1NMG A;  1KD1 C;  5IY0 A;  4PMW A;  4YHH L;  4AIM A;  4LFB Q;  2ALY B;  2VQF L;  5GAE C;  4GLA C;  1U0L A;  2ZJR A;  2PMZ E;  1TWH H;  2AWN A;  4A3K H;  4IJH A;  1X9N A;  1HZA A;  4JI4 Q;  2A8V A;  3HOU G;  4KHZ A;  5C4J H;  2LSS A;  4DV6 Q;  2UUB Q;  3I4M H;  1HNZ Q;  3OTO Q;  3CPW A;  4B3R L;  4HIK A;  2R7D A;  3ULJ A;  2N3S A;  1E24 A;  2WFW A;  1Y14 B;  4GNX A;  1Q46 A;  3RZO H;  2JK8 A;  3GD7 A;  5LMU Q;  3JC6 6;  1VQ8 A;  4A3L G;  1I3Q H;  1SMX A;  2K75 A;  2GVB A;  3H3V H;  1PFS A;  4GOP C;  4TQU S;  3PIO A;  4B3M L;  3KOJ A;  3CC4 A;  4LF5 Q;  4BA2 I;  1BVS A;  4DV6 L;  3HOZ G;  1A0I A;  4LF7 L;  1A63 A;  3S1Q H;  2YTX A;  5FJ8 G;  5C0X G;  3ULP A;  3GTM H;  4KHP Q;  2MNA A;  1VQB A;  4EX5 A;  4PZ8 A;  3U50 C;  4QIW E;  1GM5 A;  4DR1 L;  1S72 A;  2ZJP A;  3F1Z A;  1B70 B;  1SRU A;  4YCU A;  1TWG H;  1YNX A;  2VNU D;  1D8L A;  1XTD A;  2NVQ H;  1YHA A;  1CKM A;  4X66 L;  4A3B H;  1PYS B;  2Q2T A;  2E2I H;  1KXL A;  5M3M H;  4UP9 A;  1N8R C;  1I5F A;  1W3S A;  4GKK L;  3UDG A;  3TQY A;  2Z0S A;  2PNH A;  4JI1 L;  3S14 H;  3L7Z C;  3S17 H;  4YY3 Q;  3GO5 A;  1VQD A;  3GTK H;  1I94 Q;  3W5O A;  3T1Y Q;  1TWF H;  1L1O C;  2B29 A;  4OXP A;  1N9W A;  1EIY B;  4Y7N H;  3G6E A;  3J81 i;  5C3E H;  3BJU A;  2BH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...