1B37A

A 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PROTEIN (POLYAMINE OXIDASE)
publication title A 30-angstrom-long U-shaped catalytic tunnel in the crystal structure of polyamine oxidase.
pubmed doi rcsb
total genus 163
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1b37A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1b37A02
2B76A 2BABA 1VG0A 4GUVA 1JOAA 4ICYA 3FMWA 4C3YA 2GEWA 3NTDA 3NKSA 1FECA 2E5VA 3NK0X 2YWLA 2VRMA 1NEKA 1O95A 1PS9A 1PJ7A 1YQZA 2JKCA 1GNDA 2UZZA 2XLTA 2VVLG 2TPRA 4U8OA 1CF3A 4FX9A 3LJPA 4JDRA 1PXCA 2BC1A 2RGOA 2XFOA 2R9ZA 5C2TA 1EL9A 4NZHA 4C77A 4TM1A 4B65A 1RSGA 1LQUA 1Y56B 4CNKA 1FEAA 3CGCA 2APGA 4Z2UA 3UCLA 2VQ7A 1F8SA 2Y6RA 2C72A 4J56A 1DJQA 1RP0A 2WS3A 3AEBA 3F8RA 3IHMA 2YM2A 5FMHA 5KXJA 2VRLA 4J36A 1GRHA 3L8KA 4EMIA 4OPCA 1LJ1A 3ZYXA 3K7MX 5ER0A 3NHOX 4YXDA 3OC4A 3NT6A 4X4JA 3KA7A 2WOIA 1Y56A 4HB9A 2XVFA 1TDEA 4B64A 4GCMA 1KSUA 1ZMDA 1NDAA 3II4A 2YVFA 2Z5YA 3C96A 1CC4A 4LA1A 1E1LA 2AQJA 4NTCA 1EBDA 2WHDA 2GF3A 3KVEA 4WX1A 2V61A 4PABA 2BS2A 1NHQA 2RGJA 3DJGX 4H2NA 1GTHA 2R0CA 1GREA 2V3AA 2WQYA 3C4AA 4H4RA 3FG2P 2BCGG 2BS4A 1ZX9A 2FBWA 3BHKA 1E1MA 2X50A 3DJJA 5JCLA 2Q6UA 2WOVA 4AT0A 1GXFA 4YTMA 4YSYA 4X9MA 4J33A 2X8HA 3CNDA 1PXBA 4EQSA 5JCKA 4AP3A 1E6EA 4AP1A 4B67A 1QJDA 1LVLA 4BJYA 4BK3A 2FJBA 5HY5A 3M12A 1ZY8A 2R4EA 4U8NA 2QA1A 4K2XA 1Y0PA 2R0GA 1D7YA 2GRTA 3KKJA 2RABA 2Z5XA 5BRTA 4OPIA 4JNAA 3PS9A 2FJAA 3UOYA 4ZCDA 4A7AA 2FJDA 3T37A 3DGZA 1DXLA 3UKHA 1E39A 1TDKA 2BS3A 1KNPA 3AE3A 3NN6X 4H4TA 2EQ6A 1CC2A 2YG7A 4DNAA 3UOZA 3M0OA 4IV9A 3UKLA 2C65A 1KF6A 3AE1A 1BGNA 2NVKX 4YKGA 2GR0A 3AYJA 4NEWA 3NRNA 3UP4A 2GR1A 4TM4A 4IA5A 3RNMA 1ZMCA 1KDGA 4U8LA 3AEEA 2Q7VA 2X99A 1VQWA 2A89A 1NHSA 3AE4A 2R0PA 2JB3A 2AR8A 2WDVA 4C74A 2A8XA 1YY5A 4EIQA 4A6NB 1PJ5A 1V59A 1S3EA 2V60A 2YLSA 4A79A 2C73A 3AE7A 2GR2A 5GSNA 2YLZA 3NYCA 4O5UA 4U2TA 1ONFA 4FK1A 2GQFA 2XLSA 3P1WA 3UKFA 3PO7A 1REOA 5JCMA 3FPZA 2YG6A 3URHA 3DA1A 3BNMA 3P4PA 5EOWA 3ALJA 3NN0X 3BI2A 5J60A 1KFYA 2WP6A 4H2QA 5KRQA 1GOSA 3V3NA 3FBSA 4EIPA 4GR1A 4UDRA 2B9WA 2JBVA 2YG5A 2BK4A 3SGLA 4A6NA 5TR3A 2V6OA 2NPXA 2C76A 1N1PA 1S3BA 3AEGA 3H4KA 4LIIA 1B5QA 1D4DA 3LADA 4D03A 4H4WA 1D4EA 4DSHA 5BVAA 2X3NA 3L1RA 2VOUA 2WP9A 4ADWA 1DNCA 2A87A 3GDPA 3QFBA 4CBQA 1GPEA 5U25A 3K7TA 3GD4A 2CULA 2XFPA 1K0LA 4I59A 1N4VA 2ACZA 2VZ2A 3ALLA 4TLXA 1JNZA 1MOKA 1MO9A 2GV8A 1PXAA 1K0IA 2BA9A 3CGDA 1IUWA 4U8JA 2WP5A 3QVRA 3VR8A 3UOXA 2JAEA 1PN0A 2IIDA 5C3JA 3NH3X 2O9ZA 1NENA 2AAQA 1QLBA 2B9YA 4EQXA 4Z25A 2CDUA 1KSSA 3AEFA 1OJDA 4A65A 3LZWA 2XVJA 4B68A 2JB1A 1NAAA 1Q9IA 4DSGA 1FOHA 3AB1A 3DK8A 4GDPA 5EBKA 1XDIA 3RP6A 4Z2RA 5FS8A 3IC9A 2ZZCA 1EL5A 2X8GA 4CY6A 3KD9A 4K8DA 1OJ9A 4H4ZA 4ECHA 3DGHA 1L9EA 4Z2TA 2XCGA 1ZOYA 1JEHA 2XVEA 3AD8B 1K4QA 3QSMA 4U8KA 2OLOA 1GRAA 5JCIA 1GRFA 2R45A 5DBJA 3JSKA 4CRTA 3K30A 4ZCCA 4A9WA 4NTEA 3WE0A 3GYJA 2Q0LA 3QVPA 1Q1RA 3UTHA 1E7PA 3GRTA 3CPJG 1H83A 4J34A 3DMEA 1S2QA 4WCTA 4Y4NA 3ABVA 3EANA 2VVMA 2WBAA 3NK2X 2BXRA 3ATQA 3QSEA 5KVIA 1F8WA 3O0HA 3CNSA 2ZZ0A 3ICSA 3GWFA 5M10A 3CGEA 2YLTA 2B7RA 3LB8A 5JCNA 5EB4A 2I0ZA 5M0ZA 2XDOA 3UTEA 2OLNA 2CVJA 4A5LA 1F3PA 3AXBA 1IUSA 3BI4A 4BURA 3VR9A 3EAOA 1NHRA 3ZDNA 4B69A 2YAUA 1B8SA 2GQWA 1CBOA 1L9DA 1ZOVA 5IQ4A 2WPFA 3AECA 2VQBA 2GMJA 3VRBA 3Q6JA 3E1TA 1TRBA 4H4YA 4XWRA 2V5ZA 5HYMA 2DKIA 2BC0A 4J31A 2BACA 4EM3A 4H2PA 4J57A 4AOSA 1GESA 1COYA 4KPRA 4OVIA 1L9CA 1XANA 4NTDA 2GMHA 1GEUA 4OCGA 3NG7X 3CNJA 3UKQA 4K7ZA 2C64A 4K22A 1NPXA 3GRSA 4IVMB 4E0VA 3BI5A 1CJ2A 2EQ9A 1DOEA 4APNA 1CJCA 2E1MA 3FIMB 4H4XA 1LPFA 2R46A 3SM8A 1VG9A 3AE6A 3CGBA 1PBEA 4K5SA 5CKUA 3BHFA 1IUXA 3I6DA 3ICTA 3UKAA 1PBCA 5CQFA 2WDQA 1GSNA 2BK5A 3K7QX 4Z26A 1CJ3A 3NIXA 3CPHG 3GSIA 1TDOA 4OPDA 4BV6A 4GRTA 5KOXA 2BK3A 1GALA 4CCRA 3BNUA 3S5WA 5HHFA 3UTGA 1JNRA 3EF6A 4BK1A 4KX6A 1AOGA 1ZP0A 3GWDA 4EMWA 4Z44A 4Y4MA 2WESA 2ZZBA 3AYIA 4MJWA 2WPCA 4JQ9A 4YT0A 5FS6A 1YKJA 1FCDA 1VRQB 3AE9A 2IVEA 1CL0A 2XLUA 4REKA 2C3CA 1IUTA 1YQ4A 1JRYA 2B7SA 3LOVA 2YR5A 2WOWA 5KOWA 2BXSA 2C7GA 4USQA 3ADAB 3SFEA 4H4SA 3UTFA 4OPUA 2WETA 4H50A 1EL7A 1LQTA 1P2HA 1PJ6A 3P4RA 3RHAA 2BCPA 3P9UA 2H88A 3QSSA 1DODA 2WPEA 4YKFA 1FL2A 4IVOB 1GRTA 1JU2A 2Y6QA 3EPTA 3G5SA 1ZK7A 2RGHA 2ARDA 3DJDA 4FDCB 2XFUA 3V76A 3HZLA 3VRAA 3IF9A 2WEUA 4X9NA 4M52A 2XLRA 3P4QA 4H4VA 3CTYA 1IUVA 4H2RA 4N9XA 2WU5A 2XFNA 1H7XA 2YLWA 2OALA 4UP3A 1K0JA 1DOCA 5IPYA 2TMDA 1F8RA 4FK1C 5KWFA 3F8DA 4B66A 4D04A 5GRTA 4GF7A 1H86A 3SQPA 1ZKQA 3DK9A 5EB5A 4CNJA 4BJZA 2XLPA 4IA6A 1HYUA 2Q0KA 1PBFA 1UKVG 5FS7A 4AOXA 3NTAA 4LU6A 1X31B 3VRDB 3COXA 3B3RA 2JB2A 3LXDA 2C75A 3Q9TA 1CC6A 3ISHA 3AE8A 3KU9A 2C3DA 1BWCA 1H82A 1LTXR 2CFYA 3ATRA 4U8IA 4H4QA 2YM1A 2QA2A 4OPTA 3M13A 4Y4LA 4JY2A 3AD7B 4B1BA 2FJEA 3ALMA 3RP8A 1D7LA 3LZXA 3AD9B 3AE5A 4H4UA 2YR6A 4TM0A 3GMCA 3DK4A 2PHHA 3R9UA 5FS9A 3DJEA 3RP7A 2H89A 3C4NA 2ZBWA 1PHHA 4USRA 5U1OA 1TYTA 1BGJA 2J3NA 3NNEA 2OA1A 2EQ8A 3OZ2A 4EM4A 1MXTA 2YVGA 3GYIA 3PVCA 4YSHA 4HA6A 3NGCX 2DKHA 2OAMA 3H8IA 3CN8A 1H7WA 1DJNA 1PBBA 2BYBA 4RSLA 1E1KA 4UDQA 1ZDLA 1YQ3A 1GTEA 4YWOA 2X8CA 2YLXA 2YLRA 3D8XA 1KNRA 4C3XA 1NG4A 3QJ4A 4DGKA 4TLZA 3AE2A 1VDCA 1OJTA 2YQUA 3CNPA 3IWAA 4JY3A 1FEBA 3S61A 2EQ7A 4EQWA 4PAAA 4XWZA 4B63A 2GH5A 1M64A 2JK6A 2WDRA 3G5QA 2IVDA 1DOBA 2YG4A 2YG3A 3D1CA 2QCUA 1CHUA 3CNTA 1N4WA 3UKPA 3SFDA 1JRZA 4EQRA 1SEZA 1IJHA 1JRXA 4H4PA 1IUUA 4NEVA 1TDNA 2XVHA 3CIRA 4JNQA 1GETA 2WU2A 4U8MA 1GERA 1XHCA 4U2SA 4CCQA 2VVLA 3KLJA 3G5RA 1D5TA 1XPQA 1GT8A 5J7XA 4EMJA 4OPGA 2QAEA 2YR4A 4GDEA 1BF3A 2C66A 1E1NA 3H8LA 1S2YA 1B4VA 3NYFA 4J2WA 4RG3A 3ITJA 3UP5A 3P4SA 3AWIA 3GD3A 2HQMA 2YVJA 3AYLA 3QFAA 1TDFA 1GV4A 1M6IA 1L0VA 4CY8A 4AT2A 1OJCA 1O5WA 2V3BA 2C70A 3KPFA 1W4XA 4I58A 3NYEA 4RG4A 1BKWA 4K5RA 5U63A 3I3LA 3UOVA 3DH9A 1Z6LA 3AEAA 1O94A 1GRBA 1NG3A 3IHGA 4O5QA 2C67A 4BK2A 1GRGA 3UKKA 3CPIG 4YSZA 2W0HA 5L46A 5BULA 4A99A 1QO8A 1LV0A 4U2LA 4ZN0A 2GR3A 4H7UA 2GAGB 2F5ZA 3F8PA 5IQ1A 1Q1WA 3NK1X 3ICRA 4UDPA 2XYOA 1NHPA 1ELIA 2XVIA 1EL8A 3V3OA 1TYPA 1B37A 1D4CA 2R4JA 3REDA 5HXIA 4Z24A 4TM3A 5LV9A 4YSXA 2GB0A 4JN9A 1PBDA 2E4GA 1RYIA 1N4UA 4P9SA 5BUKA 1OJAA 1CJ4A 1F6MA 2PYXA 4XXGA 1PDHA 3B6DA 3GDNA 4YTNA 5KVHA 1P2EA 4C5OA 2GAHB 4Z43A 2XFQA 2B9XA 3NLCA 2GVCA 3VQRA 1H6VA 3GMBA 4U8PA 3AEDA 4OPLA 4YTPA 1H84A 1BZLA 1H81A
chains in the Genus database with same CATH superfamily
2B76A 2BABA 1VG0A 4GUVA 1JOAA 4ICYA 3FMWA 3T14A 4C3YA 2GEWA 3NTDA 3NKSA 1FECA 2E5VA 3NK0X 2YWLA 2VRMA 1NEKA 1O95A 4II3A 1PS9A 1PJ7A 1YQZA 2JKCA 1GNDA 2UZZA 2XLTA 2VVLG 2TPRA 4U8OA 1CF3A 4FX9A 3LJPA 4JDRA 1PXCA 2BC1A 2RGOA 3SZFA 2XFOA 2R9ZA 5C2TA 1EL9A 4NZHA 4C77A 4NNJA 4TM1A 4B65A 1RSGA 1LQUA 1Y56B 4CNKA 1FEAA 3CGCA 4II2A 2APGA 4Z2UA 3UCLA 2VQ7A 1F8SA 2Y6RA 2C72A 4J56A 5KNLA 1DJQA 1RP0A 2WS3A 3AEBA 3F8RA 3IHMA 2YM2A 5FMHA 5KXJA 2VRLA 4J36A 1GRHA 3L8KA 4EMIA 4OPCA 1LJ1A 3ZYXA 3K7MX 5ER0A 3NHOX 4YXDA 3OC4A 3NT6A 5KMPA 4X4JA 3KA7A 2WOIA 1Y56A 4HB9A 2XVFA 1TDEA 4B64A 4GCMA 1KSUA 1ZMDA 1NDAA 3II4A 2YVFA 2Z5YA 3C96A 1CC4A 4LA1A 1E1LA 2AQJA 4NTCA 1EBDA 2WHDA 2GF3A 3KVEA 4WX1A 2V61A 4PABA 2BS2A 1NHQA 2RGJA 3DJGX 4H2NA 1GTHA 2R0CA 1GREA 2V3AA 2WQYA 3C4AA 3HYWA 4H4RA 3FG2P 2BCGG 2BS4A 1ZX9A 2FBWA 3BHKA 1E1MA 2X50A 3DJJA 5JCLA 2Q6UA 2WOVA 4AT0A 1GXFA 4YTMA 4YSYA 4X9MA 4J33A 2X8HA 3CNDA 1PXBA 4EQSA 5JCKA 4AP3A 1E6EA 4AP1A 4B67A 1QJDA 1LVLA 4BJYA 4BK3A 2FJBA 5HY5A 3M12A 1ZY8A 2R4EA 4U8NA 2QA1A 4K2XA 3T31A 1Y0PA 2R0GA 1D7YA 2GRTA 3KKJA 2RABA 2Z5XA 5BRTA 4OPIA 4JNAA 3PS9A 2FJAA 3UOYA 4ZCDA 4A7AA 2FJDA 3T37A 3DGZA 1DXLA 4G73A 3UKHA 1E39A 1TDKA 2BS3A 1KNPA 3AE3A 3NN6X 4H4TA 2EQ6A 1CC2A 2YG7A 4DNAA 3UOZA 3M0OA 4IV9A 3UKLA 2C65A 3T0KA 1KF6A 3AE1A 1BGNA 2NVKX 4YKGA 2GR0A 3AYJA 4NEWA 3NRNA 3UP4A 2GR1A 4TM4A 4IA5A 3RNMA 1ZMCA 1KDGA 4U8LA 3AEEA 2Q7VA 2X99A 4G9KA 1VQWA 2A89A 1NHSA 3AE4A 2R0PA 2JB3A 2AR8A 2C4CA 2WDVA 2A8XA 1YY5A 4C74A 4A6NB 1PJ5A 1V59A 1S3EA 2V60A 2YLSA 4A79A 2C73A 3AE7A 2GR2A 5GSNA 3SZWA 2YLZA 3NYCA 4O5UA 4U2TA 1ONFA 4GAVA 4FK1A 2GQFA 2XLSA 3P1WA 3UKFA 3PO7A 1REOA 5JCMA 3FPZA 2YG6A 3URHA 3DA1A 3BNMA 3P4PA 5EOWA 3ALJA 3NN0X 3BI2A 5J60A 1KFYA 2WP6A 4H2QA 5KRQA 1GOSA 3V3NA 3FBSA 4EIPA 4GR1A 4UDRA 2B9WA 2JBVA 2YG5A 2BK4A 3SGLA 4A6NA 5TR3A 2V6OA 2NPXA 2C76A 1N1PA 1S3BA 3AEGA 3H4KA 4LIIA 1B5QA 1D4DA 3LADA 4D03A 4H4WA 1D4EA 4DSHA 5BVAA 2X3NA 3L1RA 2VOUA 2WP9A 4ADWA 1DNCA 2A87A 3GDPA 3QFBA 4CBQA 1GPEA 5U25A 3K7TA 3GD4A 2CULA 2XFPA 1K0LA 4I59A 1N4VA 2ACZA 2VZ2A 3SZCA 3ALLA 4TLXA 1JNZA 1MOKA 1MO9A 2GV8A 1PXAA 1K0IA 2BA9A 3CGDA 1IUWA 4U8JA 2WP5A 3QVRA 3VR8A 3UOXA 2JAEA 1PN0A 2IIDA 5C3JA 3NH3X 2O9ZA 1NENA 2AAQA 1QLBA 2B9YA 4EQXA 4Z25A 2CDUA 1KSSA 3AEFA 1OJDA 4A65A 3LZWA 2XVJA 4B68A 2JB1A 1NAAA 1Q9IA 4DSGA 1FOHA 3AB1A 3DK8A 4GDPA 5EBKA 1XDIA 3RP6A 4Z2RA 5FS8A 3IC9A 2ZZCA 1EL5A 2X8GA 4CY6A 3SXIA 3KD9A 4K8DA 1OJ9A 4H4ZA 4ECHA 3DGHA 1L9EA 4Z2TA 2XCGA 1ZOYA 1JEHA 2XVEA 3AD8B 1K4QA 3QSMA 4U8KA 2OLOA 1GRAA 5JCIA 1GRFA 2R45A 5DBJA 3JSKA 4CRTA 3K30A 4ZCCA 4A9WA 4NTEA 3WE0A 3GYJA 2Q0LA 3QVPA 1Q1RA 3UTHA 1E7PA 3GRTA 3CPJG 1H83A 4J34A 3DMEA 1S2QA 4WCTA 4Y4NA 3ABVA 3EANA 2VVMA 2WBAA 3SY4A 3NK2X 2BXRA 3ATQA 3QSEA 5KVIA 1F8WA 3O0HA 3CNSA 2ZZ0A 3ICSA 3GWFA 5M10A 3CGEA 2YLTA 2B7RA 3LB8A 3SX6A 4GAPA 5JCNA 5EB4A 2I0ZA 5M0ZA 2XDOA 3UTEA 2OLNA 2CVJA 4A5LA 1F3PA 3AXBA 1IUSA 3BI4A 4BURA 3VR9A 3EAOA 1NHRA 3ZDNA 4B69A 2YAUA 1B8SA 2GQWA 1CBOA 1L9DA 1ZOVA 5IQ4A 2WPFA 3AECA 2VQBA 2GMJA 3VRBA 3Q6JA 3E1TA 1TRBA 4H4YA 4XWRA 2V5ZA 5HYMA 2DKIA 2BC0A 4J31A 2BACA 4EM3A 4H2PA 4J57A 4AOSA 1GESA 1COYA 4KPRA 4OVIA 1L9CA 1XANA 4NTDA 2GMHA 1GEUA 4OCGA 3NG7X 3CNJA 3UKQA 4K7ZA 2C64A 4K22A 1NPXA 3GRSA 4IVMB 4E0VA 3BI5A 1CJ2A 2EQ9A 1DOEA 4APNA 1CJCA 2E1MA 3FIMB 4H4XA 1LPFA 2R46A 3SM8A 1VG9A 3AE6A 3CGBA 1PBEA 4K5SA 5CKUA 3BHFA 1IUXA 3I6DA 3ICTA 3UKAA 1PBCA 5CQFA 2WDQA 1GSNA 2BK5A 3K7QX 4Z26A 1CJ3A 3NIXA 3CPHG 3GSIA 1TDOA 3KPKA 4OPDA 4BV6A 4GRTA 5KOXA 2BK3A 1GALA 4CCRA 3BNUA 3S5WA 5HHFA 3UTGA 1JNRA 3EF6A 4BK1A 4KX6A 1AOGA 1ZP0A 3GWDA 4EMWA 3CMMA 4Z44A 4Y4MA 2WESA 2ZZBA 3AYIA 4MJWA 2WPCA 4JQ9A 4YT0A 5FS6A 1YKJA 1FCDA 1VRQB 3AE9A 2IVEA 1CL0A 2XLUA 4REKA 2C3CA 1IUTA 1YQ4A 1JRYA 2B7SA 3LOVA 2YR5A 2WOWA 5KOWA 2BXSA 2C7GA 4USQA 3ADAB 4NWZA 3SFEA 4H4SA 5KMSA 3UTFA 4OPUA 2WETA 4H50A 1EL7A 1LQTA 1P2HA 1PJ6A 3P4RA 3RHAA 2BCPA 3P9UA 2H88A 3QSSA 1DODA 2WPEA 4YKFA 1FL2A 4IVOB 1GRTA 1JU2A 2Y6QA 3EPTA 3G5SA 1ZK7A 2RGHA 2ARDA 3DJDA 4FDCB 2XFUA 3V76A 3HZLA 2BRAA 3IF9A 3VRAA 2WEUA 4X9NA 4M52A 2XLRA 3P4QA 4H4VA 3CTYA 1IUVA 4H2RA 3T2YA 4N9XA 2WU5A 2XFNA 1H7XA 2YLWA 2OALA 4UP3A 1K0JA 1DOCA 5IPYA 2TMDA 1F8RA 4FK1C 5KWFA 3F8DA 4EIQA 4B66A 4D04A 5KMQA 5GRTA 4GF7A 1H86A 3SQPA 1ZKQA 3DK9A 5EB5A 4CNJA 4BJZA 2XLPA 4IA6A 1HYUA 2Q0KA 1PBFA 1UKVG 5FS7A 4AOXA 3NTAA 4LU6A 1X31B 3VRDB 3COXA 3B3RA 4G6GA 2JB2A 3LXDA 2C75A 3Q9TA 1CC6A 3ISHA 3AE8A 3KU9A 2C3DA 1BWCA 1H82A 1LTXR 2CFYA 3ATRA 4U8IA 4H4QA 2YM1A 2QA2A 4OPTA 2BRYA 3M13A 4Y4LA 4JY2A 3AD7B 4B1BA 2FJEA 3ALMA 3RP8A 1D7LA 3LZXA 3AD9B 3AE5A 4H4UA 2YR6A 4TM0A 3GMCA 4G6HA 3DK4A 2PHHA 3R9UA 5FS9A 3DJEA 3RP7A 2H89A 3C4NA 2ZBWA 1PHHA 4USRA 5U1OA 1TYTA 1BGJA 2J3NA 3NNEA 2OA1A 2EQ8A 3OZ2A 4EM4A 1MXTA 2YVGA 3GYIA 3HYVA 3PVCA 4YSHA 4HA6A 3NGCX 2DKHA 2OAMA 3H8IA 3CN8A 1H7WA 1DJNA 1PBBA 2BYBA 4RSLA 1E1KA 4UDQA 1ZDLA 1YQ3A 1GTEA 4YWOA 2X8CA 2YLXA 2YLRA 3D8XA 1KNRA 4C3XA 1NG4A 3QJ4A 4DGKA 4TLZA 3AE2A 1VDCA 1OJTA 2YQUA 3CNPA 3IWAA 4JY3A 1FEBA 3S61A 2EQ7A 4EQWA 4PAAA 4XWZA 4B63A 2GH5A 1M64A 2JK6A 2WDRA 3G5QA 2IVDA 1DOBA 2YG4A 2YG3A 3D1CA 2QCUA 1CHUA 3CNTA 1N4WA 3UKPA 3SFDA 1JRZA 4EQRA 1SEZA 1IJHA 1JRXA 4H4PA 1IUUA 4NEVA 1TDNA 2XVHA 3CIRA 4JNQA 1GETA 2WU2A 4U8MA 1GERA 1XHCA 4U2SA 4CCQA 2VVLA 3KLJA 3G5RA 1D5TA 1XPQA 1GT8A 5J7XA 4EMJA 4OPGA 2QAEA 2YR4A 4GDEA 1BF3A 2C66A 3T2KA 1E1NA 3H8LA 1S2YA 1B4VA 3NYFA 4J2WA 4RG3A 3ITJA 3UP5A 3P4SA 3AWIA 3GD3A 2HQMA 2YVJA 3AYLA 3QFAA 1TDFA 1GV4A 1M6IA 1L0VA 4CY8A 4AT2A 1OJCA 1O5WA 2V3BA 2C70A 3KPFA 1W4XA 4I58A 3NYEA 4RG4A 1BKWA 4K5RA 5U63A 3I3LA 3UOVA 3DH9A 1Z6LA 3AEAA 1O94A 3SZ0A 1GRBA 1NG3A 3IHGA 4O5QA 2C67A 4BK2A 3GYXA 1GRGA 3UKKA 3CPIG 4YSZA 2W0HA 5L46A 5BULA 4A99A 1QO8A 1LV0A 4U2LA 4ZN0A 2GR3A 4H7UA 2GAGB 2F5ZA 3F8PA 5IQ1A 1Q1WA 3NK1X 3ICRA 4UDPA 2XYOA 1NHPA 1ELIA 2XVIA 5KMRA 1EL8A 4G74A 3V3OA 1TYPA 1B37A 1D4CA 3T2ZA 2R4JA 3REDA 5HXIA 4Z24A 4TM3A 5LV9A 4YSXA 2GB0A 3HYXA 4JN9A 1PBDA 2E4GA 1RYIA 1N4UA 4P9SA 5BUKA 1OJAA 1CJ4A 1F6MA 3SYIA 2PYXA 4XXGA 1PDHA 3B6DA 3GDNA 4YTNA 5KVHA 1P2EA 4C5OA 2GAHB 4Z43A 2XFQA 2B9XA 3NLCA 2GVCA 3VQRA 1H6VA 3GMBA 4U8PA 3AEDA 4OPLA 4YTPA 1H84A 1BZLA 1H81A
chains in the Genus database with same CATH topology
2B76A 2BABA 1VG0A 4GUVA 1JOAA 4ICYA 3FMWA 3T14A 4C3YA 2GEWA 3NTDA 3NKSA 1FECA 2E5VA 3NK0X 2YWLA 2VRMA 1NEKA 1O95A 4II3A 1PS9A 1PJ7A 1YQZA 2JKCA 1GNDA 2UZZA 2XLTA 2VVLG 2TPRA 4U8OA 1CF3A 4FX9A 3LJPA 4JDRA 1PXCA 2BC1A 2RGOA 3SZFA 2XFOA 2R9ZA 5C2TA 1EL9A 4NZHA 4C77A 4NNJA 4TM1A 4B65A 1RSGA 1LQUA 1Y56B 4CNKA 1FEAA 3CGCA 4II2A 2APGA 4Z2UA 3UCLA 2VQ7A 1F8SA 2Y6RA 2C72A 4J56A 5KNLA 1DJQA 1RP0A 2WS3A 3AEBA 3F8RA 3IHMA 2YM2A 5FMHA 5KXJA 2VRLA 4J36A 1GRHA 3L8KA 4EMIA 4OPCA 1LJ1A 3ZYXA 3K7MX 5ER0A 3NHOX 4YXDA 3OC4A 3NT6A 5KMPA 4X4JA 3KA7A 2WOIA 1Y56A 4HB9A 2XVFA 1TDEA 4B64A 4GCMA 1KSUA 1ZMDA 1NDAA 3II4A 2YVFA 2Z5YA 3C96A 1CC4A 4LA1A 1E1LA 2AQJA 4NTCA 1EBDA 2WHDA 2GF3A 3KVEA 4WX1A 2V61A 4PABA 2BS2A 1NHQA 2RGJA 3DJGX 4H2NA 1GTHA 2R0CA 1GREA 2V3AA 2WQYA 3C4AA 3HYWA 4H4RA 3FG2P 2BCGG 2BS4A 1ZX9A 2FBWA 3BHKA 1E1MA 2X50A 3DJJA 5JCLA 2Q6UA 2WOVA 4AT0A 1GXFA 4YTMA 4YSYA 4X9MA 4J33A 2X8HA 3CNDA 1PXBA 4EQSA 5JCKA 4AP3A 1E6EA 4AP1A 4B67A 1QJDA 1LVLA 4BJYA 4BK3A 2FJBA 5HY5A 3M12A 1ZY8A 2R4EA 4U8NA 2QA1A 4K2XA 3T31A 1Y0PA 2R0GA 1D7YA 2GRTA 3KKJA 2RABA 2Z5XA 5BRTA 4OPIA 4JNAA 3PS9A 2FJAA 3UOYA 4ZCDA 4A7AA 2FJDA 3T37A 3DGZA 1DXLA 4G73A 3UKHA 1E39A 1TDKA 2BS3A 1KNPA 3AE3A 3NN6X 4H4TA 2EQ6A 1CC2A 2YG7A 4DNAA 3UOZA 3M0OA 4IV9A 3UKLA 2C65A 3T0KA 1KF6A 3AE1A 1BGNA 2NVKX 4YKGA 2GR0A 3AYJA 4NEWA 3NRNA 3UP4A 2GR1A 4TM4A 4IA5A 3RNMA 1ZMCA 1KDGA 4U8LA 3AEEA 2Q7VA 2X99A 4G9KA 1VQWA 2A89A 1NHSA 3AE4A 2R0PA 2JB3A 2AR8A 2C4CA 2WDVA 2A8XA 1YY5A 4C74A 4A6NB 1PJ5A 1V59A 1S3EA 2V60A 2YLSA 4A79A 2C73A 3AE7A 2GR2A 5GSNA 3SZWA 2YLZA 3NYCA 4O5UA 4U2TA 1ONFA 4GAVA 4FK1A 2GQFA 2XLSA 3P1WA 3UKFA 3PO7A 1REOA 5JCMA 3FPZA 2YG6A 3URHA 3DA1A 3BNMA 3P4PA 5EOWA 3ALJA 3NN0X 3BI2A 5J60A 1KFYA 2WP6A 4H2QA 5KRQA 1GOSA 3V3NA 3FBSA 4EIPA 4GR1A 4UDRA 2B9WA 2JBVA 2YG5A 2BK4A 3SGLA 4A6NA 5TR3A 2V6OA 2NPXA 2C76A 1N1PA 1S3BA 3AEGA 3H4KA 4LIIA 1B5QA 1D4DA 3LADA 4D03A 4H4WA 1D4EA 4DSHA 5BVAA 2X3NA 3L1RA 2VOUA 2WP9A 4ADWA 1DNCA 2A87A 3GDPA 3QFBA 4CBQA 1GPEA 5U25A 3K7TA 3GD4A 2CULA 2XFPA 1K0LA 4I59A 1N4VA 2ACZA 2VZ2A 3SZCA 3ALLA 4TLXA 1JNZA 1MOKA 1MO9A 2GV8A 1PXAA 1K0IA 2BA9A 3CGDA 1IUWA 4U8JA 2WP5A 3QVRA 3VR8A 3UOXA 2JAEA 1PN0A 2IIDA 5C3JA 3NH3X 2O9ZA 1NENA 2AAQA 1QLBA 2B9YA 4EQXA 4Z25A 2CDUA 1KSSA 3AEFA 1OJDA 4A65A 3LZWA 2XVJA 4B68A 2JB1A 1NAAA 1Q9IA 4DSGA 1FOHA 3AB1A 3DK8A 4GDPA 5EBKA 1XDIA 3RP6A 4Z2RA 5FS8A 3IC9A 2ZZCA 1EL5A 2X8GA 4CY6A 3SXIA 3KD9A 4K8DA 1OJ9A 4H4ZA 4ECHA 3DGHA 1L9EA 4Z2TA 2XCGA 1ZOYA 1JEHA 2XVEA 3AD8B 1K4QA 3QSMA 4U8KA 2OLOA 1GRAA 5JCIA 1GRFA 2R45A 5DBJA 3JSKA 4CRTA 3K30A 4ZCCA 4A9WA 4NTEA 3WE0A 3GYJA 2Q0LA 3QVPA 1Q1RA 3UTHA 1E7PA 3GRTA 3CPJG 1H83A 4J34A 3DMEA 1S2QA 4WCTA 4Y4NA 3ABVA 3EANA 2VVMA 2WBAA 3SY4A 3NK2X 2BXRA 3ATQA 3QSEA 5KVIA 1F8WA 3O0HA 3CNSA 2ZZ0A 3ICSA 3GWFA 5M10A 3CGEA 2YLTA 2B7RA 3LB8A 3SX6A 4GAPA 5JCNA 5EB4A 2I0ZA 5M0ZA 2XDOA 3UTEA 2OLNA 2CVJA 4A5LA 1F3PA 3AXBA 1IUSA 3BI4A 4BURA 3VR9A 3EAOA 1NHRA 3ZDNA 4B69A 2YAUA 1B8SA 2GQWA 1CBOA 1L9DA 1ZOVA 5IQ4A 2WPFA 3AECA 2VQBA 2GMJA 3VRBA 3Q6JA 3E1TA 1TRBA 4H4YA 4XWRA 2V5ZA 5HYMA 2DKIA 2BC0A 4J31A 2BACA 4EM3A 4H2PA 4J57A 4AOSA 1GESA 1COYA 4KPRA 4OVIA 1L9CA 1XANA 4NTDA 2GMHA 1GEUA 4OCGA 3NG7X 3CNJA 3UKQA 4K7ZA 2C64A 4K22A 1NPXA 3GRSA 4IVMB 4E0VA 3BI5A 1CJ2A 2EQ9A 1DOEA 4APNA 1CJCA 2E1MA 3FIMB 4H4XA 1LPFA 2R46A 3SM8A 1VG9A 3AE6A 3CGBA 1PBEA 4K5SA 5CKUA 3BHFA 1IUXA 3I6DA 3ICTA 3UKAA 1PBCA 5CQFA 2WDQA 1GSNA 2BK5A 3K7QX 4Z26A 1CJ3A 3NIXA 3CPHG 3GSIA 1TDOA 3KPKA 4OPDA 4BV6A 4GRTA 5KOXA 2BK3A 1GALA 4CCRA 3BNUA 3S5WA 5HHFA 3UTGA 1JNRA 3EF6A 4BK1A 4KX6A 1AOGA 1ZP0A 3GWDA 4EMWA 3CMMA 4Z44A 4Y4MA 2WESA 2ZZBA 3AYIA 4MJWA 2WPCA 4JQ9A 4YT0A 5FS6A 1YKJA 1FCDA 1VRQB 3AE9A 2IVEA 1CL0A 2XLUA 4REKA 2C3CA 1IUTA 1YQ4A 1JRYA 2B7SA 3LOVA 2YR5A 2WOWA 5KOWA 2BXSA 2C7GA 4USQA 3ADAB 4NWZA 3SFEA 4H4SA 5KMSA 3UTFA 4OPUA 2WETA 4H50A 1EL7A 1LQTA 1P2HA 1PJ6A 3P4RA 3RHAA 2BCPA 3P9UA 2H88A 3QSSA 1DODA 2WPEA 4YKFA 1FL2A 4IVOB 1GRTA 1JU2A 2Y6QA 3EPTA 3G5SA 1ZK7A 2RGHA 2ARDA 3DJDA 4FDCB 2XFUA 3V76A 3HZLA 2BRAA 3IF9A 3VRAA 2WEUA 4X9NA 4M52A 2XLRA 3P4QA 4H4VA 3CTYA 1IUVA 4H2RA 3T2YA 4N9XA 2WU5A 2XFNA 1H7XA 2YLWA 2OALA 4UP3A 1K0JA 1DOCA 5IPYA 2TMDA 1F8RA 4FK1C 5KWFA 3F8DA 4EIQA 4B66A 4D04A 5KMQA 5GRTA 4GF7A 1H86A 3SQPA 1ZKQA 3DK9A 5EB5A 4CNJA 4BJZA 2XLPA 4IA6A 1HYUA 2Q0KA 1PBFA 1UKVG 5FS7A 4AOXA 3NTAA 4LU6A 1X31B 3VRDB 3COXA 3B3RA 4G6GA 2JB2A 3LXDA 2C75A 3Q9TA 1CC6A 3ISHA 3AE8A 3KU9A 2C3DA 1BWCA 1H82A 1LTXR 2CFYA 3ATRA 4U8IA 4H4QA 2YM1A 2QA2A 4OPTA 2BRYA 3M13A 4Y4LA 4JY2A 3AD7B 4B1BA 2FJEA 3ALMA 3RP8A 1D7LA 3LZXA 3AD9B 3AE5A 4H4UA 2YR6A 4TM0A 3GMCA 4G6HA 3DK4A 2PHHA 3R9UA 5FS9A 3DJEA 3RP7A 2H89A 3C4NA 2ZBWA 1PHHA 4USRA 5U1OA 1TYTA 1BGJA 2J3NA 3NNEA 2OA1A 2EQ8A 3OZ2A 4EM4A 1MXTA 2YVGA 3GYIA 3HYVA 3PVCA 4YSHA 4HA6A 3NGCX 2DKHA 2OAMA 3H8IA 3CN8A 1H7WA 1DJNA 1PBBA 2BYBA 4RSLA 1E1KA 4UDQA 1ZDLA 1YQ3A 1GTEA 4YWOA 2X8CA 2YLXA 2YLRA 3D8XA 1KNRA 4C3XA 1NG4A 3QJ4A 4DGKA 4TLZA 3AE2A 1VDCA 1OJTA 2YQUA 3CNPA 3IWAA 4JY3A 1FEBA 3S61A 2EQ7A 4EQWA 4PAAA 4XWZA 4B63A 2GH5A 1M64A 2JK6A 2WDRA 3G5QA 2IVDA 1DOBA 2YG4A 2YG3A 3D1CA 2QCUA 1CHUA 3CNTA 1N4WA 3UKPA 3SFDA 1JRZA 4EQRA 1SEZA 1IJHA 1JRXA 4H4PA 1IUUA 4NEVA 1TDNA 2XVHA 3CIRA 4JNQA 1GETA 2WU2A 4U8MA 1GERA 1XHCA 4U2SA 4CCQA 2VVLA 3KLJA 3G5RA 1D5TA 1XPQA 1GT8A 5J7XA 4EMJA 4OPGA 2QAEA 2YR4A 4GDEA 1BF3A 2C66A 3T2KA 1E1NA 3H8LA 1S2YA 1B4VA 3NYFA 4J2WA 4RG3A 3ITJA 3UP5A 3P4SA 3AWIA 3GD3A 2HQMA 2YVJA 3AYLA 3QFAA 1TDFA 1GV4A 1M6IA 1L0VA 4CY8A 4AT2A 1OJCA 1O5WA 2V3BA 2C70A 3KPFA 1W4XA 4I58A 3NYEA 4RG4A 1BKWA 4K5RA 5U63A 3I3LA 3UOVA 3DH9A 1Z6LA 3AEAA 1O94A 3SZ0A 1GRBA 1NG3A 3IHGA 4O5QA 2C67A 4BK2A 3GYXA 1GRGA 3UKKA 3CPIG 4YSZA 2W0HA 5L46A 5BULA 4A99A 1QO8A 1LV0A 4U2LA 4ZN0A 2GR3A 4H7UA 2GAGB 2F5ZA 3F8PA 5IQ1A 1Q1WA 3NK1X 3ICRA 4UDPA 2XYOA 1NHPA 1ELIA 2XVIA 5KMRA 1EL8A 4G74A 3V3OA 1TYPA 1B37A 1D4CA 3T2ZA 2R4JA 3REDA 5HXIA 4Z24A 4TM3A 5LV9A 4YSXA 2GB0A 3HYXA 4JN9A 1PBDA 2E4GA 1RYIA 1N4UA 4P9SA 5BUKA 1OJAA 1CJ4A 1F6MA 3SYIA 2PYXA 4XXGA 1PDHA 3B6DA 3GDNA 4YTNA 5KVHA 1P2EA 4C5OA 2GAHB 4Z43A 2XFQA 2B9XA 3NLCA 2GVCA 3VQRA 1H6VA 3GMBA 4U8PA 3AEDA 4OPLA 4YTPA 1H84A 1BZLA 1H81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B76 A;  2BAB A;  1VG0 A;  4GUV A;  1JOA A;  4ICY A;  3FMW A;  4C3Y A;  2GEW A;  3NTD A;  3NKS A;  1FEC A;  2E5V A;  3NK0 X;  2YWL A;  2VRM A;  1NEK A;  1O95 A;  1PS9 A;  1PJ7 A;  1YQZ A;  2JKC A;  1GND A;  2UZZ A;  2XLT A;  2VVL G;  2TPR A;  4U8O A;  1CF3 A;  4FX9 A;  3LJP A;  4JDR A;  1PXC A;  2BC1 A;  2RGO A;  2XFO A;  2R9Z A;  5C2T A;  1EL9 A;  4NZH A;  4C77 A;  4TM1 A;  4B65 A;  1RSG A;  1LQU A;  1Y56 B;  4CNK A;  1FEA A;  3CGC A;  2APG A;  4Z2U A;  3UCL A;  2VQ7 A;  1F8S A;  2Y6R A;  2C72 A;  4J56 A;  1DJQ A;  1RP0 A;  2WS3 A;  3AEB A;  3F8R A;  3IHM A;  2YM2 A;  5FMH A;  5KXJ A;  2VRL A;  4J36 A;  1GRH A;  3L8K A;  4EMI A;  4OPC A;  1LJ1 A;  3ZYX A;  3K7M X;  5ER0 A;  3NHO X;  4YXD A;  3OC4 A;  3NT6 A;  4X4J A;  3KA7 A;  2WOI A;  1Y56 A;  4HB9 A;  2XVF A;  1TDE A;  4B64 A;  4GCM A;  1KSU A;  1ZMD A;  1NDA A;  3II4 A;  2YVF A;  2Z5Y A;  3C96 A;  1CC4 A;  4LA1 A;  1E1L A;  2AQJ A;  4NTC A;  1EBD A;  2WHD A;  2GF3 A;  3KVE A;  4WX1 A;  2V61 A;  4PAB A;  2BS2 A;  1NHQ A;  2RGJ A;  3DJG X;  4H2N A;  1GTH A;  2R0C A;  1GRE A;  2V3A A;  2WQY A;  3C4A A;  4H4R A;  3FG2 P;  2BCG G;  2BS4 A;  1ZX9 A;  2FBW A;  3BHK A;  1E1M A;  2X50 A;  3DJJ A;  5JCL A;  2Q6U A;  2WOV A;  4AT0 A;  1GXF A;  4YTM A;  4YSY A;  4X9M A;  4J33 A;  2X8H A;  3CND A;  1PXB A;  4EQS A;  5JCK A;  4AP3 A;  1E6E A;  4AP1 A;  4B67 A;  1QJD A;  1LVL A;  4BJY A;  4BK3 A;  2FJB A;  5HY5 A;  3M12 A;  1ZY8 A;  2R4E A;  4U8N A;  2QA1 A;  4K2X A;  1Y0P A;  2R0G A;  1D7Y A;  2GRT A;  3KKJ A;  2RAB A;  2Z5X A;  5BRT A;  4OPI A;  4JNA A;  3PS9 A;  2FJA A;  3UOY A;  4ZCD A;  4A7A A;  2FJD A;  3T37 A;  3DGZ A;  1DXL A;  3UKH A;  1E39 A;  1TDK A;  2BS3 A;  1KNP A;  3AE3 A;  3NN6 X;  4H4T A;  2EQ6 A;  1CC2 A;  2YG7 A;  4DNA A;  3UOZ A;  3M0O A;  4IV9 A;  3UKL A;  2C65 A;  1KF6 A;  3AE1 A;  1BGN A;  2NVK X;  4YKG A;  2GR0 A;  3AYJ A;  4NEW A;  3NRN A;  3UP4 A;  2GR1 A;  4TM4 A;  4IA5 A;  3RNM A;  1ZMC A;  1KDG A;  4U8L A;  3AEE A;  2Q7V A;  2X99 A;  1VQW A;  2A89 A;  1NHS A;  3AE4 A;  2R0P A;  2JB3 A;  2AR8 A;  2WDV A;  4C74 A;  2A8X A;  1YY5 A;  4EIQ A;  4A6N B;  1PJ5 A;  1V59 A;  1S3E A;  2V60 A;  2YLS A;  4A79 A;  2C73 A;  3AE7 A;  2GR2 A;  5GSN A;  2YLZ A;  3NYC A;  4O5U A;  4U2T A;  1ONF A;  4FK1 A;  2GQF A;  2XLS A;  3P1W A;  3UKF A;  3PO7 A;  1REO A;  5JCM A;  3FPZ A;  2YG6 A;  3URH A;  3DA1 A;  3BNM A;  3P4P A;  5EOW A;  3ALJ A;  3NN0 X;  3BI2 A;  5J60 A;  1KFY A;  2WP6 A;  4H2Q A;  5KRQ A;  1GOS A;  3V3N A;  3FBS A;  4EIP A;  4GR1 A;  4UDR A;  2B9W A;  2JBV A;  2YG5 A;  2BK4 A;  3SGL A;  4A6N A;  5TR3 A;  2V6O A;  2NPX A;  2C76 A;  1N1P A;  1S3B A;  3AEG A;  3H4K A;  4LII A;  1B5Q A;  1D4D A;  3LAD A;  4D03 A;  4H4W A;  1D4E A;  4DSH A;  5BVA A;  2X3N A;  3L1R A;  2VOU A;  2WP9 A;  4ADW A;  1DNC A;  2A87 A;  3GDP A;  3QFB A;  4CBQ A;  1GPE A;  5U25 A;  3K7T A;  3GD4 A;  2CUL A;  2XFP A;  1K0L A;  4I59 A;  1N4V A;  2ACZ A;  2VZ2 A;  3ALL A;  4TLX A;  1JNZ A;  1MOK A;  1MO9 A;  2GV8 A;  1PXA A;  1K0I A;  2BA9 A;  3CGD A;  1IUW A;  4U8J A;  2WP5 A;  3QVR A;  3VR8 A;  3UOX A;  2JAE A;  1PN0 A;  2IID A;  5C3J A;  3NH3 X;  2O9Z A;  1NEN A;  2AAQ A;  1QLB A;  2B9Y A;  4EQX A;  4Z25 A;  2CDU A;  1KSS A;  3AEF A;  1OJD A;  4A65 A;  3LZW A;  2XVJ A;  4B68 A;  2JB1 A;  1NAA A;  1Q9I A;  4DSG A;  1FOH A;  3AB1 A;  3DK8 A;  4GDP A;  5EBK A;  1XDI A;  3RP6 A;  4Z2R A;  5FS8 A;  3IC9 A;  2ZZC A;  1EL5 A;  2X8G A;  4CY6 A;  3KD9 A;  4K8D A;  1OJ9 A;  4H4Z A;  4ECH A;  3DGH A;  1L9E A;  4Z2T A;  2XCG A;  1ZOY A;  1JEH A;  2XVE A;  3AD8 B;  1K4Q A;  3QSM A;  4U8K A;  2OLO A;  1GRA A;  5JCI A;  1GRF A;  2R45 A;  5DBJ A;  3JSK A;  4CRT A;  3K30 A;  4ZCC A;  4A9W A;  4NTE A;  3WE0 A;  3GYJ A;  2Q0L A;  3QVP A;  1Q1R A;  3UTH A;  1E7P A;  3GRT A;  3CPJ G;  1H83 A;  4J34 A;  3DME A;  1S2Q A;  4WCT A;  4Y4N A;  3ABV A;  3EAN A;  2VVM A;  2WBA A;  3NK2 X;  2BXR A;  3ATQ A;  3QSE A;  5KVI A;  1F8W A;  3O0H A;  3CNS A;  2ZZ0 A;  3ICS A;  3GWF A;  5M10 A;  3CGE A;  2YLT A;  2B7R A;  3LB8 A;  5JCN A;  5EB4 A;  2I0Z A;  5M0Z A;  2XDO A;  3UTE A;  2OLN A;  2CVJ A;  4A5L A;  1F3P A;  3AXB A;  1IUS A;  3BI4 A;  4BUR A;  3VR9 A;  3EAO A;  1NHR A;  3ZDN A;  4B69 A;  2YAU A;  1B8S A;  2GQW A;  1CBO A;  1L9D A;  1ZOV A;  5IQ4 A;  2WPF A;  3AEC A;  2VQB A;  2GMJ A;  3VRB A;  3Q6J A;  3E1T A;  1TRB A;  4H4Y A;  4XWR A;  2V5Z A;  5HYM A;  2DKI A;  2BC0 A;  4J31 A;  2BAC A;  4EM3 A;  4H2P A;  4J57 A;  4AOS A;  1GES A;  1COY A;  4KPR A;  4OVI A;  1L9C A;  1XAN A;  4NTD A;  2GMH A;  1GEU A;  4OCG A;  3NG7 X;  3CNJ A;  3UKQ A;  4K7Z A;  2C64 A;  4K22 A;  1NPX A;  3GRS A;  4IVM B;  4E0V A;  3BI5 A;  1CJ2 A;  2EQ9 A;  1DOE A;  4APN A;  1CJC A;  2E1M A;  3FIM B;  4H4X A;  1LPF A;  2R46 A;  3SM8 A;  1VG9 A;  3AE6 A;  3CGB A;  1PBE A;  4K5S A;  5CKU A;  3BHF A;  1IUX A;  3I6D A;  3ICT A;  3UKA A;  1PBC A;  5CQF A;  2WDQ A;  1GSN A;  2BK5 A;  3K7Q X;  4Z26 A;  1CJ3 A;  3NIX A;  3CPH G;  3GSI A;  1TDO A;  4OPD A;  4BV6 A;  4GRT A;  5KOX A;  2BK3 A;  1GAL A;  4CCR A;  3BNU A;  3S5W A;  5HHF A;  3UTG A;  1JNR A;  3EF6 A;  4BK1 A;  4KX6 A;  1AOG A;  1ZP0 A;  3GWD A;  4EMW A;  4Z44 A;  4Y4M A;  2WES A;  2ZZB A;  3AYI A;  4MJW A;  2WPC A;  4JQ9 A;  4YT0 A;  5FS6 A;  1YKJ A;  1FCD A;  1VRQ B;  3AE9 A;  2IVE A;  1CL0 A;  2XLU A;  4REK A;  2C3C A;  1IUT A;  1YQ4 A;  1JRY A;  2B7S A;  3LOV A;  2YR5 A;  2WOW A;  5KOW A;  2BXS A;  2C7G A;  4USQ A;  3ADA B;  3SFE A;  4H4S A;  3UTF A;  4OPU A;  2WET A;  4H50 A;  1EL7 A;  1LQT A;  1P2H A;  1PJ6 A;  3P4R A;  3RHA A;  2BCP A;  3P9U A;  2H88 A;  3QSS A;  1DOD A;  2WPE A;  4YKF A;  1FL2 A;  4IVO B;  1GRT A;  1JU2 A;  2Y6Q A;  3EPT A;  3G5S A;  1ZK7 A;  2RGH A;  2ARD A;  3DJD A;  4FDC B;  2XFU A;  3V76 A;  3HZL A;  3VRA A;  3IF9 A;  2WEU A;  4X9N A;  4M52 A;  2XLR A;  3P4Q A;  4H4V A;  3CTY A;  1IUV A;  4H2R A;  4N9X A;  2WU5 A;  2XFN A;  1H7X A;  2YLW A;  2OAL A;  4UP3 A;  1K0J A;  1DOC A;  5IPY A;  2TMD A;  1F8R A;  4FK1 C;  5KWF A;  3F8D A;  4B66 A;  4D04 A;  5GRT A;  4GF7 A;  1H86 A;  3SQP A;  1ZKQ A;  3DK9 A;  5EB5 A;  4CNJ A;  4BJZ A;  2XLP A;  4IA6 A;  1HYU A;  2Q0K A;  1PBF A;  1UKV G;  5FS7 A;  4AOX A;  3NTA A;  4LU6 A;  1X31 B;  3VRD B;  3COX A;  3B3R A;  2JB2 A;  3LXD A;  2C75 A;  3Q9T A;  1CC6 A;  3ISH A;  3AE8 A;  3KU9 A;  2C3D A;  1BWC A;  1H82 A;  1LTX R;  2CFY A;  3ATR A;  4U8I A;  4H4Q A;  2YM1 A;  2QA2 A;  4OPT A;  3M13 A;  4Y4L A;  4JY2 A;  3AD7 B;  4B1B A;  2FJE A;  3ALM A;  3RP8 A;  1D7L A;  3LZX A;  3AD9 B;  3AE5 A;  4H4U A;  2YR6 A;  4TM0 A;  3GMC A;  3DK4 A;  2PHH A;  3R9U A;  5FS9 A;  3DJE A;  3RP7 A;  2H89 A;  3C4N A;  2ZBW A;  1PHH A;  4USR A;  5U1O A;  1TYT A;  1BGJ A;  2J3N A;  3NNE A;  2OA1 A;  2EQ8 A;  3OZ2 A;  4EM4 A;  1MXT A;  2YVG A;  3GYI A;  3PVC A;  4YSH A;  4HA6 A;  3NGC X;  2DKH A;  2OAM A;  3H8I A;  3CN8 A;  1H7W A;  1DJN A;  1PBB A;  2BYB A;  4RSL A;  1E1K A;  4UDQ A;  1ZDL A;  1YQ3 A;  1GTE A;  4YWO A;  2X8C A;  2YLX A;  2YLR A;  3D8X A;  1KNR A;  4C3X A;  1NG4 A;  3QJ4 A;  4DGK A;  4TLZ A;  3AE2 A;  1VDC A;  1OJT A;  2YQU A;  3CNP A;  3IWA A;  4JY3 A;  1FEB A;  3S61 A;  2EQ7 A;  4EQW A;  4PAA A;  4XWZ A;  4B63 A;  2GH5 A;  1M64 A;  2JK6 A;  2WDR A;  3G5Q A;  2IVD A;  1DOB A;  2YG4 A;  2YG3 A;  3D1C A;  2QCU A;  1CHU A;  3CNT A;  1N4W A;  3UKP A;  3SFD A;  1JRZ A;  4EQR A;  1SEZ A;  1IJH A;  1JRX A;  4H4P A;  1IUU A;  4NEV A;  1TDN A;  2XVH A;  3CIR A;  4JNQ A;  1GET A;  2WU2 A;  4U8M A;  1GER A;  1XHC A;  4U2S A;  4CCQ A;  2VVL A;  3KLJ A;  3G5R A;  1D5T A;  1XPQ A;  1GT8 A;  5J7X A;  4EMJ A;  4OPG A;  2QAE A;  2YR4 A;  4GDE A;  1BF3 A;  2C66 A;  1E1N A;  3H8L A;  1S2Y A;  1B4V A;  3NYF A;  4J2W A;  4RG3 A;  3ITJ A;  3UP5 A;  3P4S A;  3AWI A;  3GD3 A;  2HQM A;  2YVJ A;  3AYL A;  3QFA A;  1TDF A;  1GV4 A;  1M6I A;  1L0V A;  4CY8 A;  4AT2 A;  1OJC A;  1O5W A;  2V3B A;  2C70 A;  3KPF A;  1W4X A;  4I58 A;  3NYE A;  4RG4 A;  1BKW A;  4K5R A;  5U63 A;  3I3L A;  3UOV A;  3DH9 A;  1Z6L A;  3AEA A;  1O94 A;  1GRB A;  1NG3 A;  3IHG A;  4O5Q A;  2C67 A;  4BK2 A;  1GRG A;  3UKK A;  3CPI G;  4YSZ A;  2W0H A;  5L46 A;  5BUL A;  4A99 A;  1QO8 A;  1LV0 A;  4U2L A;  4ZN0 A;  2GR3 A;  4H7U A;  2GAG B;  2F5Z A;  3F8P A;  5IQ1 A;  1Q1W A;  3NK1 X;  3ICR A;  4UDP A;  2XYO A;  1NHP A;  1ELI A;  2XVI A;  1EL8 A;  3V3O A;  1TYP A;  1B37 A;  1D4C A;  2R4J A;  3RED A;  5HXI A;  4Z24 A;  4TM3 A;  5LV9 A;  4YSX A;  2GB0 A;  4JN9 A;  1PBD A;  2E4G A;  1RYI A;  1N4U A;  4P9S A;  5BUK A;  1OJA A;  1CJ4 A;  1F6M A;  2PYX A;  4XXG A;  1PDH A;  3B6D A;  3GDN A;  4YTN A;  5KVH A;  1P2E A;  4C5O A;  2GAH B;  4Z43 A;  2XFQ A;  2B9X A;  3NLC A;  2GVC A;  3VQR A;  1H6V A;  3GMB A;  4U8P A;  3AED A;  4OPL A;  4YTP A;  1H84 A;  1BZL A;  1H81 A; 
#chains in the Genus database with same CATH topology
 2B76 A;  2BAB A;  1VG0 A;  4GUV A;  1JOA A;  4ICY A;  3FMW A;  3T14 A;  4C3Y A;  2GEW A;  3NTD A;  3NKS A;  1FEC A;  2E5V A;  3NK0 X;  2YWL A;  2VRM A;  1NEK A;  1O95 A;  4II3 A;  1PS9 A;  1PJ7 A;  1YQZ A;  2JKC A;  1GND A;  2UZZ A;  2XLT A;  2VVL G;  2TPR A;  4U8O A;  1CF3 A;  4FX9 A;  3LJP A;  4JDR A;  1PXC A;  2BC1 A;  2RGO A;  3SZF A;  2XFO A;  2R9Z A;  5C2T A;  1EL9 A;  4NZH A;  4C77 A;  4NNJ A;  4TM1 A;  4B65 A;  1RSG A;  1LQU A;  1Y56 B;  4CNK A;  1FEA A;  3CGC A;  4II2 A;  2APG A;  4Z2U A;  3UCL A;  2VQ7 A;  1F8S A;  2Y6R A;  2C72 A;  4J56 A;  5KNL A;  1DJQ A;  1RP0 A;  2WS3 A;  3AEB A;  3F8R A;  3IHM A;  2YM2 A;  5FMH A;  5KXJ A;  2VRL A;  4J36 A;  1GRH A;  3L8K A;  4EMI A;  4OPC A;  1LJ1 A;  3ZYX A;  3K7M X;  5ER0 A;  3NHO X;  4YXD A;  3OC4 A;  3NT6 A;  5KMP A;  4X4J A;  3KA7 A;  2WOI A;  1Y56 A;  4HB9 A;  2XVF A;  1TDE A;  4B64 A;  4GCM A;  1KSU A;  1ZMD A;  1NDA A;  3II4 A;  2YVF A;  2Z5Y A;  3C96 A;  1CC4 A;  4LA1 A;  1E1L A;  2AQJ A;  4NTC A;  1EBD A;  2WHD A;  2GF3 A;  3KVE A;  4WX1 A;  2V61 A;  4PAB A;  2BS2 A;  1NHQ A;  2RGJ A;  3DJG X;  4H2N A;  1GTH A;  2R0C A;  1GRE A;  2V3A A;  2WQY A;  3C4A A;  3HYW A;  4H4R A;  3FG2 P;  2BCG G;  2BS4 A;  1ZX9 A;  2FBW A;  3BHK A;  1E1M A;  2X50 A;  3DJJ A;  5JCL A;  2Q6U A;  2WOV A;  4AT0 A;  1GXF A;  4YTM A;  4YSY A;  4X9M A;  4J33 A;  2X8H A;  3CND A;  1PXB A;  4EQS A;  5JCK A;  4AP3 A;  1E6E A;  4AP1 A;  4B67 A;  1QJD A;  1LVL A;  4BJY A;  4BK3 A;  2FJB A;  5HY5 A;  3M12 A;  1ZY8 A;  2R4E A;  4U8N A;  2QA1 A;  4K2X A;  3T31 A;  1Y0P A;  2R0G A;  1D7Y A;  2GRT A;  3KKJ A;  2RAB A;  2Z5X A;  5BRT A;  4OPI A;  4JNA A;  3PS9 A;  2FJA A;  3UOY A;  4ZCD A;  4A7A A;  2FJD A;  3T37 A;  3DGZ A;  1DXL A;  4G73 A;  3UKH A;  1E39 A;  1TDK A;  2BS3 A;  1KNP A;  3AE3 A;  3NN6 X;  4H4T A;  2EQ6 A;  1CC2 A;  2YG7 A;  4DNA A;  3UOZ A;  3M0O A;  4IV9 A;  3UKL A;  2C65 A;  3T0K A;  1KF6 A;  3AE1 A;  1BGN A;  2NVK X;  4YKG A;  2GR0 A;  3AYJ A;  4NEW A;  3NRN A;  3UP4 A;  2GR1 A;  4TM4 A;  4IA5 A;  3RNM A;  1ZMC A;  1KDG A;  4U8L A;  3AEE A;  2Q7V A;  2X99 A;  4G9K A;  1VQW A;  2A89 A;  1NHS A;  3AE4 A;  2R0P A;  2JB3 A;  2AR8 A;  2C4C A;  2WDV A;  2A8X A;  1YY5 A;  4C74 A;  4A6N B;  1PJ5 A;  1V59 A;  1S3E A;  2V60 A;  2YLS A;  4A79 A;  2C73 A;  3AE7 A;  2GR2 A;  5GSN A;  3SZW A;  2YLZ A;  3NYC A;  4O5U A;  4U2T A;  1ONF A;  4GAV A;  4FK1 A;  2GQF A;  2XLS A;  3P1W A;  3UKF A;  3PO7 A;  1REO A;  5JCM A;  3FPZ A;  2YG6 A;  3URH A;  3DA1 A;  3BNM A;  3P4P A;  5EOW A;  3ALJ A;  3NN0 X;  3BI2 A;  5J60 A;  1KFY A;  2WP6 A;  4H2Q A;  5KRQ A;  1GOS A;  3V3N A;  3FBS A;  4EIP A;  4GR1 A;  4UDR A;  2B9W A;  2JBV A;  2YG5 A;  2BK4 A;  3SGL A;  4A6N A;  5TR3 A;  2V6O A;  2NPX A;  2C76 A;  1N1P A;  1S3B A;  3AEG A;  3H4K A;  4LII A;  1B5Q A;  1D4D A;  3LAD A;  4D03 A;  4H4W A;  1D4E A;  4DSH A;  5BVA A;  2X3N A;  3L1R A;  2VOU A;  2WP9 A;  4ADW A;  1DNC A;  2A87 A;  3GDP A;  3QFB A;  4CBQ A;  1GPE A;  5U25 A;  3K7T A;  3GD4 A;  2CUL A;  2XFP A;  1K0L A;  4I59 A;  1N4V A;  2ACZ A;  2VZ2 A;  3SZC A;  3ALL A;  4TLX A;  1JNZ A;  1MOK A;  1MO9 A;  2GV8 A;  1PXA A;  1K0I A;  2BA9 A;  3CGD A;  1IUW A;  4U8J A;  2WP5 A;  3QVR A;  3VR8 A;  3UOX A;  2JAE A;  1PN0 A;  2IID A;  5C3J A;  3NH3 X;  2O9Z A;  1NEN A;  2AAQ A;  1QLB A;  2B9Y A;  4EQX A;  4Z25 A;  2CDU A;  1KSS A;  3AEF A;  1OJD A;  4A65 A;  3LZW A;  2XVJ A;  4B68 A;  2JB1 A;  1NAA A;  1Q9I A;  4DSG A;  1FOH A;  3AB1 A;  3DK8 A;  4GDP A;  5EBK A;  1XDI A;  3RP6 A;  4Z2R A;  5FS8 A;  3IC9 A;  2ZZC A;  1EL5 A;  2X8G A;  4CY6 A;  3SXI A;  3KD9 A;  4K8D A;  1OJ9 A;  4H4Z A;  4ECH A;  3DGH A;  1L9E A;  4Z2T A;  2XCG A;  1ZOY A;  1JEH A;  2XVE A;  3AD8 B;  1K4Q A;  3QSM A;  4U8K A;  2OLO A;  1GRA A;  5JCI A;  1GRF A;  2R45 A;  5DBJ A;  3JSK A;  4CRT A;  3K30 A;  4ZCC A;  4A9W A;  4NTE A;  3WE0 A;  3GYJ A;  2Q0L A;  3QVP A;  1Q1R A;  3UTH A;  1E7P A;  3GRT A;  3CPJ G;  1H83 A;  4J34 A;  3DME A;  1S2Q A;  4WCT A;  4Y4N A;  3ABV A;  3EAN A;  2VVM A;  2WBA A;  3SY4 A;  3NK2 X;  2BXR A;  3ATQ A;  3QSE A;  5KVI A;  1F8W A;  3O0H A;  3CNS A;  2ZZ0 A;  3ICS A;  3GWF A;  5M10 A;  3CGE A;  2YLT A;  2B7R A;  3LB8 A;  3SX6 A;  4GAP A;  5JCN A;  5EB4 A;  2I0Z A;  5M0Z A;  2XDO A;  3UTE A;  2OLN A;  2CVJ A;  4A5L A;  1F3P A;  3AXB A;  1IUS A;  3BI4 A;  4BUR A;  3VR9 A;  3EAO A;  1NHR A;  3ZDN A;  4B69 A;  2YAU A;  1B8S A;  2GQW A;  1CBO A;  1L9D A;  1ZOV A;  5IQ4 A;  2WPF A;  3AEC A;  2VQB A;  2GMJ A;  3VRB A;  3Q6J A;  3E1T A;  1TRB A;  4H4Y A;  4XWR A;  2V5Z A;  5HYM A;  2DKI A;  2BC0 A;  4J31 A;  2BAC A;  4EM3 A;  4H2P A;  4J57 A;  4AOS A;  1GES A;  1COY A;  4KPR A;  4OVI A;  1L9C A;  1XAN A;  4NTD A;  2GMH A;  1GEU A;  4OCG A;  3NG7 X;  3CNJ A;  3UKQ A;  4K7Z A;  2C64 A;  4K22 A;  1NPX A;  3GRS A;  4IVM B;  4E0V A;  3BI5 A;  1CJ2 A;  2EQ9 A;  1DOE A;  4APN A;  1CJC A;  2E1M A;  3FIM B;  4H4X A;  1LPF A;  2R46 A;  3SM8 A;  1VG9 A;  3AE6 A;  3CGB A;  1PBE A;  4K5S A;  5CKU A;  3BHF A;  1IUX A;  3I6D A;  3ICT A;  3UKA A;  1PBC A;  5CQF A;  2WDQ A;  1GSN A;  2BK5 A;  3K7Q X;  4Z26 A;  1CJ3 A;  3NIX A;  3CPH G;  3GSI A;  1TDO A;  3KPK A;  4OPD A;  4BV6 A;  4GRT A;  5KOX A;  2BK3 A;  1GAL A;  4CCR A;  3BNU A;  3S5W A;  5HHF A;  3UTG A;  1JNR A;  3EF6 A;  4BK1 A;  4KX6 A;  1AOG A;  1ZP0 A;  3GWD A;  4EMW A;  3CMM A;  4Z44 A;  4Y4M A;  2WES A;  2ZZB A;  3AYI A;  4MJW A;  2WPC A;  4JQ9 A;  4YT0 A;  5FS6 A;  1YKJ A;  1FCD A;  1VRQ B;  3AE9 A;  2IVE A;  1CL0 A;  2XLU A;  4REK A;  2C3C A;  1IUT A;  1YQ4 A;  1JRY A;  2B7S A;  3LOV A;  2YR5 A;  2WOW A;  5KOW A;  2BXS A;  2C7G A;  4USQ A;  3ADA B;  4NWZ A;  3SFE A;  4H4S A;  5KMS A;  3UTF A;  4OPU A;  2WET A;  4H50 A;  1EL7 A;  1LQT A;  1P2H A;  1PJ6 A;  3P4R A;  3RHA A;  2BCP A;  3P9U A;  2H88 A;  3QSS A;  1DOD A;  2WPE A;  4YKF A;  1FL2 A;  4IVO B;  1GRT A;  1JU2 A;  2Y6Q A;  3EPT A;  3G5S A;  1ZK7 A;  2RGH A;  2ARD A;  3DJD A;  4FDC B;  2XFU A;  3V76 A;  3HZL A;  2BRA A;  3IF9 A;  3VRA A;  2WEU A;  4X9N A;  4M52 A;  2XLR A;  3P4Q A;  4H4V A;  3CTY A;  1IUV A;  4H2R A;  3T2Y A;  4N9X A;  2WU5 A;  2XFN A;  1H7X A;  2YLW A;  2OAL A;  4UP3 A;  1K0J A;  1DOC A;  5IPY A;  2TMD A;  1F8R A;  4FK1 C;  5KWF A;  3F8D A;  4EIQ A;  4B66 A;  4D04 A;  5KMQ A;  5GRT A;  4GF7 A;  1H86 A;  3SQP A;  1ZKQ A;  3DK9 A;  5EB5 A;  4CNJ A;  4BJZ A;  2XLP A;  4IA6 A;  1HYU A;  2Q0K A;  1PBF A;  1UKV G;  5FS7 A;  4AOX A;  3NTA A;  4LU6 A;  1X31 B;  3VRD B;  3COX A;  3B3R A;  4G6G A;  2JB2 A;  3LXD A;  2C75 A;  3Q9T A;  1CC6 A;  3ISH A;  3AE8 A;  3KU9 A;  2C3D A;  1BWC A;  1H82 A;  1LTX R;  2CFY A;  3ATR A;  4U8I A;  4H4Q A;  2YM1 A;  2QA2 A;  4OPT A;  2BRY A;  3M13 A;  4Y4L A;  4JY2 A;  3AD7 B;  4B1B A;  2FJE A;  3ALM A;  3RP8 A;  1D7L A;  3LZX A;  3AD9 B;  3AE5 A;  4H4U A;  2YR6 A;  4TM0 A;  3GMC A;  4G6H A;  3DK4 A;  2PHH A;  3R9U A;  5FS9 A;  3DJE A;  3RP7 A;  2H89 A;  3C4N A;  2ZBW A;  1PHH A;  4USR A;  5U1O A;  1TYT A;  1BGJ A;  2J3N A;  3NNE A;  2OA1 A;  2EQ8 A;  3OZ2 A;  4EM4 A;  1MXT A;  2YVG A;  3GYI A;  3HYV A;  3PVC A;  4YSH A;  4HA6 A;  3NGC X;  2DKH A;  2OAM A;  3H8I A;  3CN8 A;  1H7W A;  1DJN A;  1PBB A;  2BYB A;  4RSL A;  1E1K A;  4UDQ A;  1ZDL A;  1YQ3 A;  1GTE A;  4YWO A;  2X8C A;  2YLX A;  2YLR A;  3D8X A;  1KNR A;  4C3X A;  1NG4 A;  3QJ4 A;  4DGK A;  4TLZ A;  3AE2 A;  1VDC A;  1OJT A;  2YQU A;  3CNP A;  3IWA A;  4JY3 A;  1FEB A;  3S61 A;  2EQ7 A;  4EQW A;  4PAA A;  4XWZ A;  4B63 A;  2GH5 A;  1M64 A;  2JK6 A;  2WDR A;  3G5Q A;  2IVD A;  1DOB A;  2YG4 A;  2YG3 A;  3D1C A;  2QCU A;  1CHU A;  3CNT A;  1N4W A;  3UKP A;  3SFD A;  1JRZ A;  4EQR A;  1SEZ A;  1IJH A;  1JRX A;  4H4P A;  1IUU A;  4NEV A;  1TDN A;  2XVH A;  3CIR A;  4JNQ A;  1GET A;  2WU2 A;  4U8M A;  1GER A;  1XHC A;  4U2S A;  4CCQ A;  2VVL A;  3KLJ A;  3G5R A;  1D5T A;  1XPQ A;  1GT8 A;  5J7X A;  4EMJ A;  4OPG A;  2QAE A;  2YR4 A;  4GDE A;  1BF3 A;  2C66 A;  3T2K A;  1E1N A;  3H8L A;  1S2Y A;  1B4V A;  3NYF A;  4J2W A;  4RG3 A;  3ITJ A;  3UP5 A;  3P4S A;  3AWI A;  3GD3 A;  2HQM A;  2YVJ A;  3AYL A;  3QFA A;  1TDF A;  1GV4 A;  1M6I A;  1L0V A;  4CY8 A;  4AT2 A;  1OJC A;  1O5W A;  2V3B A;  2C70 A;  3KPF A;  1W4X A;  4I58 A;  3NYE A;  4RG4 A;  1BKW A;  4K5R A;  5U63 A;  3I3L A;  3UOV A;  3DH9 A;  1Z6L A;  3AEA A;  1O94 A;  3SZ0 A;  1GRB A;  1NG3 A;  3IHG A;  4O5Q A;  2C67 A;  4BK2 A;  3GYX A;  1GRG A;  3UKK A;  3CPI G;  4YSZ A;  2W0H A;  5L46 A;  5BUL A;  4A99 A;  1QO8 A;  1LV0 A;  4U2L A;  4ZN0 A;  2GR3 A;  4H7U A;  2GAG B;  2F5Z A;  3F8P A;  5IQ1 A;  1Q1W A;  3NK1 X;  3ICR A;  4UDP A;  2XYO A;  1NHP A;  1ELI A;  2XVI A;  5KMR A;  1EL8 A;  4G74 A;  3V3O A;  1TYP A;  1B37 A;  1D4C A;  3T2Z A;  2R4J A;  3RED A;  5HXI A;  4Z24 A;  4TM3 A;  5LV9 A;  4YSX A;  2GB0 A;  3HYX A;  4JN9 A;  1PBD A;  2E4G A;  1RYI A;  1N4U A;  4P9S A;  5BUK A;  1OJA A;  1CJ4 A;  1F6M A;  3SYI A;  2PYX A;  4XXG A;  1PDH A;  3B6D A;  3GDN A;  4YTN A;  5KVH A;  1P2E A;  4C5O A;  2GAH B;  4Z43 A;  2XFQ A;  2B9X A;  3NLC A;  2GVC A;  3VQR A;  1H6V A;  3GMB A;  4U8P A;  3AED A;  4OPL A;  4YTP A;  1H84 A;  1BZL A;  1H81 A; 
#chains in the Genus database with same CATH homology
 2B76 A;  2BAB A;  1VG0 A;  4GUV A;  1JOA A;  4ICY A;  3FMW A;  3T14 A;  4C3Y A;  2GEW A;  3NTD A;  3NKS A;  1FEC A;  2E5V A;  3NK0 X;  2YWL A;  2VRM A;  1NEK A;  1O95 A;  4II3 A;  1PS9 A;  1PJ7 A;  1YQZ A;  2JKC A;  1GND A;  2UZZ A;  2XLT A;  2VVL G;  2TPR A;  4U8O A;  1CF3 A;  4FX9 A;  3LJP A;  4JDR A;  1PXC A;  2BC1 A;  2RGO A;  3SZF A;  2XFO A;  2R9Z A;  5C2T A;  1EL9 A;  4NZH A;  4C77 A;  4NNJ A;  4TM1 A;  4B65 A;  1RSG A;  1LQU A;  1Y56 B;  4CNK A;  1FEA A;  3CGC A;  4II2 A;  2APG A;  4Z2U A;  3UCL A;  2VQ7 A;  1F8S A;  2Y6R A;  2C72 A;  4J56 A;  5KNL A;  1DJQ A;  1RP0 A;  2WS3 A;  3AEB A;  3F8R A;  3IHM A;  2YM2 A;  5FMH A;  5KXJ A;  2VRL A;  4J36 A;  1GRH A;  3L8K A;  4EMI A;  4OPC A;  1LJ1 A;  3ZYX A;  3K7M X;  5ER0 A;  3NHO X;  4YXD A;  3OC4 A;  3NT6 A;  5KMP A;  4X4J A;  3KA7 A;  2WOI A;  1Y56 A;  4HB9 A;  2XVF A;  1TDE A;  4B64 A;  4GCM A;  1KSU A;  1ZMD A;  1NDA A;  3II4 A;  2YVF A;  2Z5Y A;  3C96 A;  1CC4 A;  4LA1 A;  1E1L A;  2AQJ A;  4NTC A;  1EBD A;  2WHD A;  2GF3 A;  3KVE A;  4WX1 A;  2V61 A;  4PAB A;  2BS2 A;  1NHQ A;  2RGJ A;  3DJG X;  4H2N A;  1GTH A;  2R0C A;  1GRE A;  2V3A A;  2WQY A;  3C4A A;  3HYW A;  4H4R A;  3FG2 P;  2BCG G;  2BS4 A;  1ZX9 A;  2FBW A;  3BHK A;  1E1M A;  2X50 A;  3DJJ A;  5JCL A;  2Q6U A;  2WOV A;  4AT0 A;  1GXF A;  4YTM A;  4YSY A;  4X9M A;  4J33 A;  2X8H A;  3CND A;  1PXB A;  4EQS A;  5JCK A;  4AP3 A;  1E6E A;  4AP1 A;  4B67 A;  1QJD A;  1LVL A;  4BJY A;  4BK3 A;  2FJB A;  5HY5 A;  3M12 A;  1ZY8 A;  2R4E A;  4U8N A;  2QA1 A;  4K2X A;  3T31 A;  1Y0P A;  2R0G A;  1D7Y A;  2GRT A;  3KKJ A;  2RAB A;  2Z5X A;  5BRT A;  4OPI A;  4JNA A;  3PS9 A;  2FJA A;  3UOY A;  4ZCD A;  4A7A A;  2FJD A;  3T37 A;  3DGZ A;  1DXL A;  4G73 A;  3UKH A;  1E39 A;  1TDK A;  2BS3 A;  1KNP A;  3AE3 A;  3NN6 X;  4H4T A;  2EQ6 A;  1CC2 A;  2YG7 A;  4DNA A;  3UOZ A;  3M0O A;  4IV9 A;  3UKL A;  2C65 A;  3T0K A;  1KF6 A;  3AE1 A;  1BGN A;  2NVK X;  4YKG A;  2GR0 A;  3AYJ A;  4NEW A;  3NRN A;  3UP4 A;  2GR1 A;  4TM4 A;  4IA5 A;  3RNM A;  1ZMC A;  1KDG A;  4U8L A;  3AEE A;  2Q7V A;  2X99 A;  4G9K A;  1VQW A;  2A89 A;  1NHS A;  3AE4 A;  2R0P A;  2JB3 A;  2AR8 A;  2C4C A;  2WDV A;  2A8X A;  1YY5 A;  4C74 A;  4A6N B;  1PJ5 A;  1V59 A;  1S3E A;  2V60 A;  2YLS A;  4A79 A;  2C73 A;  3AE7 A;  2GR2 A;  5GSN A;  3SZW A;  2YLZ A;  3NYC A;  4O5U A;  4U2T A;  1ONF A;  4GAV A;  4FK1 A;  2GQF A;  2XLS A;  3P1W A;  3UKF A;  3PO7 A;  1REO A;  5JCM A;  3FPZ A;  2YG6 A;  3URH A;  3DA1 A;  3BNM A;  3P4P A;  5EOW A;  3ALJ A;  3NN0 X;  3BI2 A;  5J60 A;  1KFY A;  2WP6 A;  4H2Q A;  5KRQ A;  1GOS A;  3V3N A;  3FBS A;  4EIP A;  4GR1 A;  4UDR A;  2B9W A;  2JBV A;  2YG5 A;  2BK4 A;  3SGL A;  4A6N A;  5TR3 A;  2V6O A;  2NPX A;  2C76 A;  1N1P A;  1S3B A;  3AEG A;  3H4K A;  4LII A;  1B5Q A;  1D4D A;  3LAD A;  4D03 A;  4H4W A;  1D4E A;  4DSH A;  5BVA A;  2X3N A;  3L1R A;  2VOU A;  2WP9 A;  4ADW A;  1DNC A;  2A87 A;  3GDP A;  3QFB A;  4CBQ A;  1GPE A;  5U25 A;  3K7T A;  3GD4 A;  2CUL A;  2XFP A;  1K0L A;  4I59 A;  1N4V A;  2ACZ A;  2VZ2 A;  3SZC A;  3ALL A;  4TLX A;  1JNZ A;  1MOK A;  1MO9 A;  2GV8 A;  1PXA A;  1K0I A;  2BA9 A;  3CGD A;  1IUW A;  4U8J A;  2WP5 A;  3QVR A;  3VR8 A;  3UOX A;  2JAE A;  1PN0 A;  2IID A;  5C3J A;  3NH3 X;  2O9Z A;  1NEN A;  2AAQ A;  1QLB A;  2B9Y A;  4EQX A;  4Z25 A;  2CDU A;  1KSS A;  3AEF A;  1OJD A;  4A65 A;  3LZW A;  2XVJ A;  4B68 A;  2JB1 A;  1NAA A;  1Q9I A;  4DSG A;  1FOH A;  3AB1 A;  3DK8 A;  4GDP A;  5EBK A;  1XDI A;  3RP6 A;  4Z2R A;  5FS8 A;  3IC9 A;  2ZZC A;  1EL5 A;  2X8G A;  4CY6 A;  3SXI A;  3KD9 A;  4K8D A;  1OJ9 A;  4H4Z A;  4ECH A;  3DGH A;  1L9E A;  4Z2T A;  2XCG A;  1ZOY A;  1JEH A;  2XVE A;  3AD8 B;  1K4Q A;  3QSM A;  4U8K A;  2OLO A;  1GRA A;  5JCI A;  1GRF A;  2R45 A;  5DBJ A;  3JSK A;  4CRT A;  3K30 A;  4ZCC A;  4A9W A;  4NTE A;  3WE0 A;  3GYJ A;  2Q0L A;  3QVP A;  1Q1R A;  3UTH A;  1E7P A;  3GRT A;  3CPJ G;  1H83 A;  4J34 A;  3DME A;  1S2Q A;  4WCT A;  4Y4N A;  3ABV A;  3EAN A;  2VVM A;  2WBA A;  3SY4 A;  3NK2 X;  2BXR A;  3ATQ A;  3QSE A;  5KVI A;  1F8W A;  3O0H A;  3CNS A;  2ZZ0 A;  3ICS A;  3GWF A;  5M10 A;  3CGE A;  2YLT A;  2B7R A;  3LB8 A;  3SX6 A;  4GAP A;  5JCN A;  5EB4 A;  2I0Z A;  5M0Z A;  2XDO A;  3UTE A;  2OLN A;  2CVJ A;  4A5L A;  1F3P A;  3AXB A;  1IUS A;  3BI4 A;  4BUR A;  3VR9 A;  3EAO A;  1NHR A;  3ZDN A;  4B69 A;  2YAU A;  1B8S A;  2GQW A;  1CBO A;  1L9D A;  1ZOV A;  5IQ4 A;  2WPF A;  3AEC A;  2VQB A;  2GMJ A;  3VRB A;  3Q6J A;  3E1T A;  1TRB A;  4H4Y A;  4XWR A;  2V5Z A;  5HYM A;  2DKI A;  2BC0 A;  4J31 A;  2BAC A;  4EM3 A;  4H2P A;  4J57 A;  4AOS A;  1GES A;  1COY A;  4KPR A;  4OVI A;  1L9C A;  1XAN A;  4NTD A;  2GMH A;  1GEU A;  4OCG A;  3NG7 X;  3CNJ A;  3UKQ A;  4K7Z A;  2C64 A;  4K22 A;  1NPX A;  3GRS A;  4IVM B;  4E0V A;  3BI5 A;  1CJ2 A;  2EQ9 A;  1DOE A;  4APN A;  1CJC A;  2E1M A;  3FIM B;  4H4X A;  1LPF A;  2R46 A;  3SM8 A;  1VG9 A;  3AE6 A;  3CGB A;  1PBE A;  4K5S A;  5CKU A;  3BHF A;  1IUX A;  3I6D A;  3ICT A;  3UKA A;  1PBC A;  5CQF A;  2WDQ A;  1GSN A;  2BK5 A;  3K7Q X;  4Z26 A;  1CJ3 A;  3NIX A;  3CPH G;  3GSI A;  1TDO A;  3KPK A;  4OPD A;  4BV6 A;  4GRT A;  5KOX A;  2BK3 A;  1GAL A;  4CCR A;  3BNU A;  3S5W A;  5HHF A;  3UTG A;  1JNR A;  3EF6 A;  4BK1 A;  4KX6 A;  1AOG A;  1ZP0 A;  3GWD A;  4EMW A;  3CMM A;  4Z44 A;  4Y4M A;  2WES A;  2ZZB A;  3AYI A;  4MJW A;  2WPC A;  4JQ9 A;  4YT0 A;  5FS6 A;  1YKJ A;  1FCD A;  1VRQ B;  3AE9 A;  2IVE A;  1CL0 A;  2XLU A;  4REK A;  2C3C A;  1IUT A;  1YQ4 A;  1JRY A;  2B7S A;  3LOV A;  2YR5 A;  2WOW A;  5KOW A;  2BXS A;  2C7G A;  4USQ A;  3ADA B;  4NWZ A;  3SFE A;  4H4S A;  5KMS A;  3UTF A;  4OPU A;  2WET A;  4H50 A;  1EL7 A;  1LQT A;  1P2H A;  1PJ6 A;  3P4R A;  3RHA A;  2BCP A;  3P9U A;  2H88 A;  3QSS A;  1DOD A;  2WPE A;  4YKF A;  1FL2 A;  4IVO B;  1GRT A;  1JU2 A;  2Y6Q A;  3EPT A;  3G5S A;  1ZK7 A;  2RGH A;  2ARD A;  3DJD A;  4FDC B;  2XFU A;  3V76 A;  3HZL A;  2BRA A;  3IF9 A;  3VRA A;  2WEU A;  4X9N A;  4M52 A;  2XLR A;  3P4Q A;  4H4V A;  3CTY A;  1IUV A;  4H2R A;  3T2Y A;  4N9X A;  2WU5 A;  2XFN A;  1H7X A;  2YLW A;  2OAL A;  4UP3 A;  1K0J A;  1DOC A;  5IPY A;  2TMD A;  1F8R A;  4FK1 C;  5KWF A;  3F8D A;  4EIQ A;  4B66 A;  4D04 A;  5KMQ A;  5GRT A;  4GF7 A;  1H86 A;  3SQP A;  1ZKQ A;  3DK9 A;  5EB5 A;  4CNJ A;  4BJZ A;  2XLP A;  4IA6 A;  1HYU A;  2Q0K A;  1PBF A;  1UKV G;  5FS7 A;  4AOX A;  3NTA A;  4LU6 A;  1X31 B;  3VRD B;  3COX A;  3B3R A;  4G6G A;  2JB2 A;  3LXD A;  2C75 A;  3Q9T A;  1CC6 A;  3ISH A;  3AE8 A;  3KU9 A;  2C3D A;  1BWC A;  1H82 A;  1LTX R;  2CFY A;  3ATR A;  4U8I A;  4H4Q A;  2YM1 A;  2QA2 A;  4OPT A;  2BRY A;  3M13 A;  4Y4L A;  4JY2 A;  3AD7 B;  4B1B A;  2FJE A;  3ALM A;  3RP8 A;  1D7L A;  3LZX A;  3AD9 B;  3AE5 A;  4H4U A;  2YR6 A;  4TM0 A;  3GMC A;  4G6H A;  3DK4 A;  2PHH A;  3R9U A;  5FS9 A;  3DJE A;  3RP7 A;  2H89 A;  3C4N A;  2ZBW A;  1PHH A;  4USR A;  5U1O A;  1TYT A;  1BGJ A;  2J3N A;  3NNE A;  2OA1 A;  2EQ8 A;  3OZ2 A;  4EM4 A;  1MXT A;  2YVG A;  3GYI A;  3HYV A;  3PVC A;  4YSH A;  4HA6 A;  3NGC X;  2DKH A;  2OAM A;  3H8I A;  3CN8 A;  1H7W A;  1DJN A;  1PBB A;  2BYB A;  4RSL A;  1E1K A;  4UDQ A;  1ZDL A;  1YQ3 A;  1GTE A;  4YWO A;  2X8C A;  2YLX A;  2YLR A;  3D8X A;  1KNR A;  4C3X A;  1NG4 A;  3QJ4 A;  4DGK A;  4TLZ A;  3AE2 A;  1VDC A;  1OJT A;  2YQU A;  3CNP A;  3IWA A;  4JY3 A;  1FEB A;  3S61 A;  2EQ7 A;  4EQW A;  4PAA A;  4XWZ A;  4B63 A;  2GH5 A;  1M64 A;  2JK6 A;  2WDR A;  3G5Q A;  2IVD A;  1DOB A;  2YG4 A;  2YG3 A;  3D1C A;  2QCU A;  1CHU A;  3CNT A;  1N4W A;  3UKP A;  3SFD A;  1JRZ A;  4EQR A;  1SEZ A;  1IJH A;  1JRX A;  4H4P A;  1IUU A;  4NEV A;  1TDN A;  2XVH A;  3CIR A;  4JNQ A;  1GET A;  2WU2 A;  4U8M A;  1GER A;  1XHC A;  4U2S A;  4CCQ A;  2VVL A;  3KLJ A;  3G5R A;  1D5T A;  1XPQ A;  1GT8 A;  5J7X A;  4EMJ A;  4OPG A;  2QAE A;  2YR4 A;  4GDE A;  1BF3 A;  2C66 A;  3T2K A;  1E1N A;  3H8L A;  1S2Y A;  1B4V A;  3NYF A;  4J2W A;  4RG3 A;  3ITJ A;  3UP5 A;  3P4S A;  3AWI A;  3GD3 A;  2HQM A;  2YVJ A;  3AYL A;  3QFA A;  1TDF A;  1GV4 A;  1M6I A;  1L0V A;  4CY8 A;  4AT2 A;  1OJC A;  1O5W A;  2V3B A;  2C70 A;  3KPF A;  1W4X A;  4I58 A;  3NYE A;  4RG4 A;  1BKW A;  4K5R A;  5U63 A;  3I3L A;  3UOV A;  3DH9 A;  1Z6L A;  3AEA A;  1O94 A;  3SZ0 A;  1GRB A;  1NG3 A;  3IHG A;  4O5Q A;  2C67 A;  4BK2 A;  3GYX A;  1GRG A;  3UKK A;  3CPI G;  4YSZ A;  2W0H A;  5L46 A;  5BUL A;  4A99 A;  1QO8 A;  1LV0 A;  4U2L A;  4ZN0 A;  2GR3 A;  4H7U A;  2GAG B;  2F5Z A;  3F8P A;  5IQ1 A;  1Q1W A;  3NK1 X;  3ICR A;  4UDP A;  2XYO A;  1NHP A;  1ELI A;  2XVI A;  5KMR A;  1EL8 A;  4G74 A;  3V3O A;  1TYP A;  1B37 A;  1D4C A;  3T2Z A;  2R4J A;  3RED A;  5HXI A;  4Z24 A;  4TM3 A;  5LV9 A;  4YSX A;  2GB0 A;  3HYX A;  4JN9 A;  1PBD A;  2E4G A;  1RYI A;  1N4U A;  4P9S A;  5BUK A;  1OJA A;  1CJ4 A;  1F6M A;  3SYI A;  2PYX A;  4XXG A;  1PDH A;  3B6D A;  3GDN A;  4YTN A;  5KVH A;  1P2E A;  4C5O A;  2GAH B;  4Z43 A;  2XFQ A;  2B9X A;  3NLC A;  2GVC A;  3VQR A;  1H6V A;  3GMB A;  4U8P A;  3AED A;  4OPL A;  4YTP A;  1H84 A;  1BZL A;  1H81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...