1B37A

A 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (POLYAMINE OXIDASE)
publication title A 30-angstrom-long U-shaped catalytic tunnel in the crystal structure of polyamine oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 163
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1b37A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1b37A02
3UKQA 1UKVG 5KOXA 1NG4A 4Z25A 4YXDA 2XVIA 1KF6A 1KNPA 3ITJA 4FX9A 4O5UA 2R9ZA 4EQXA 3UP4A 4NTCA 3KA7A 3WE0A 2C76A 2JKCA 3DJJA 1FECA 1GTHA 1EL8A 2OA1A 3ICSA 3JSKA 5CQFA 3DA1A 1KSUA 5KVHA 1GRBA 4UP3A 2CDUA 1D7LA 5HXIA 3AD7B 2VVLG 1N4WA 2YG7A 1N4UA 4J57A 2YLTA 2YG5A 4YSXA 4U8PA 1XHCA 3QJ4A 2DKHA 3CNTA 1IUUA 1FEBA 4H4TA 4K8DA 5KVIA 1NHPA 1IUTA 4N9XA 2C66A 3DH9A 5C2TA 1W4XA 3AE4A 3FBSA 3GYIA 2BXRA 3LADA 5EOWA 1EBDA 5GSNA 1GRTA 1LVLA 4Y4NA 3GDPA 3PO7A 1S3BA 1GTEA 5JCMA 4DNAA 2GEWA 3LJPA 4B66A 4CY6A 3DGHA 3UTEA 5KOWA 2JB3A 4E0VA 4CNKA 3GD3A 3AE2A 3KD9A 3KLJA 2B9WA 2YLRA 3AEAA 1VRQB 5LV9A 1ZP0A 1CBOA 2IVEA 2XLRA 2XLSA 3IHGA 4U8OA 4OPIA 1JRYA 4GRTA 5J7XA 2R4EA 3D1CA 4NTDA 2R0PA 4JDRA 2H89A 4GCMA 5JCLA 1PBCA 3H8LA 3OZ2A 4H4YA 1CC2A 3QSEA 4RSLA 2YAUA 1PJ6A 1ZKQA 1L9DA 1YQZA 1OJTA 3AEEA 3GRSA 2GMHA 1M6IA 4K2XA 3RP7A 3T37A 2NVKX 4CRTA 1DOEA 4B64A 4ZN0A 3COXA 3AEGA 4AOSA 2GRTA 5U25A 1TDFA 1PXAA 5U63A 2XFPA 3QVPA 4U2LA 3F8RA 4IA5A 1ZMDA 3UKLA 4EMIA 5L46A 1NHRA 3AEBA 4D04A 3V3OA 3KPFA 1NDAA 3L1RA 1M64A 1FCDA 2VOUA 1L0VA 4GDEA 3L8KA 3OC4A 3CN8A 1YY5A 2C65A 2GR3A 2OAMA 2C70A 1F6MA 3BNMA 1TRBA 3DK4A 3G5QA 1PS9A 2GQFA 1Q9IA 2V60A 1Q1WA 4OPUA 1BGJA 4K5SA 1GERA 3LXDA 5HHFA 1N4VA 2YLSA 4RG4A 2BK5A 4AT2A 2JB1A 2B7RA 3CIRA 4LIIA 5FS6A 1BF3A 4B65A 4J36A 3H4KA 4H2NA 4BURA 2R4JA 2OLOA 4Z2RA 1GT8A 1H83A 2R0GA 3NRNA 4OPDA 2CFYA 1LQUA 2E1MA 3VRDB 2XDOA 4J56A 4YTPA 1GETA 2B9YA 3GWFA 1MOKA 1GSNA 2WU5A 4FK1A 4XWRA 1QJDA 1TYPA 2BACA 2R0CA 4Z24A 2YG3A 3Q9TA 1KFYA 4BJZA 2RGOA 2BXSA 4WCTA 3VRAA 3ZYXA 2XFOA 1B37A 1F8WA 3ISHA 3P4RA 4X4JA 4J33A 1PHHA 2EQ9A 4I59A 3SM8A 3I6DA 4APNA 3NNEA 2YM1A 3QSSA 1L9CA 1NHQA 1F8SA 4Z44A 3QVRA 2YVGA 1K0LA 3P4PA 1E1MA 1XPQA 3VR8A 2RGJA 1DJNA 4NZHA 2YG6A 3CPJG 2X99A 1H7WA 2VZ2A 4C3YA 4FDCB 2X8GA 2ACZA 4I58A 4TM3A 3AB1A 4H4UA 1OJ9A 1YKJA 1KNRA 3DK8A 1JU2A 3NG7X 1NG3A 2RGHA 3AE8A 4AT0A 1PBBA 2H88A 4J2WA 1JEHA 1LJ1A 3C4NA 3UTGA 4H50A 4YKFA 3NIXA 1ZOVA 3NTAA 4PAAA 4P9SA 2R45A 3K7TA 2YM2A 3CTYA 4H4VA 2E5VA 2AAQA 1E7PA 3LZXA 4LA1A 2UZZA 4NEWA 2WP6A 1CL0A 2BK4A 1D4EA 1L9EA 1JRXA 4XXGA 2BS3A 2WDQA 1Y0PA 3ATRA 2ZZCA 2V6OA 3DMEA 4K7ZA 5FS9A 3ALJA 4TLZA 2XLTA 3IHMA 1GV4A 4B67A 4DSHA 4A9WA 4Z43A 1GXFA 3CNDA 3UKHA 3P4SA 2XVFA 5CKUA 1ONFA 4TLXA 1D4CA 4H4WA 2QA2A 3AD9B 4LU6A 5C3JA 3FPZA 4OPLA 3DJGX 1GRFA 3SFDA 1E39A 1EL9A 1XANA 4OCGA 3NGCX 3BNUA 1FEAA 1CJCA 1V59A 2GR2A 1S2YA 2VVMA 2GR0A 3NYFA 5DBJA 1CJ2A 1H86A 2B9XA 5M0ZA 1PDHA 4AP1A 1CC6A 1GRGA 2ZBWA 3IF9A 4JN9A 5EBKA 1PXCA 3UKFA 1Y56A 4U8NA 4ADWA 3SQPA 4ZCDA 1PJ7A 3VR9A 2YLXA 1PBEA 4FK1C 2XFQA 1DOCA 2Z5YA 4K22A 3URHA 3CNJA 5J60A 4H7UA 2V3AA 3RNMA 2BABA 3K7MX 3GWDA 3II4A 1GRAA 2WU2A 3PVCA 3UTHA 4YKGA 3K7QX 2WHDA 2X50A 1RP0A 4AP3A 3VRBA 3KVEA 1Y56B 1XDIA 4RG3A 1PXBA 3AWIA 3C96A 2E4GA 2XVHA 3V76A 2WQYA 1DODA 2X3NA 1HYUA 1CJ3A 2NPXA 1CJ4A 2A8XA 1F8RA 4UDQA 3GDNA 4B63A 4YSHA 3O0HA 2BYBA 4H4PA 1NEKA 1EL7A 1LQTA 4BJYA 4C74A 5JCKA 2Y6QA 2YVJA 3NK1X 1DOBA 3HZLA 3UP5A 2JK6A 3GD4A 1AOGA 3H8IA 5IQ1A 2BCPA 3AYLA 4NTEA 1VG9A 4ZCCA 2WP5A 3F8DA 4JY2A 4TM0A 4U8KA 3ZDNA 1GALA 5IQ4A 2GAGB 3BHFA 4HB9A 4EM4A 3AE6A 1TYTA 2GV8A 2V5ZA 3AE7A 4C5OA 3UOVA 1K0JA 2B76A 3QSMA 4BK2A 4EM3A 2V61A 3GRTA 1E6EA 4JNQA 3ADAB 2J3NA 3P4QA 4YWOA 1COYA 2C75A 3AECA 3UKKA 5KXJA 1IUXA 1JRZA 4USRA 2BCGG 1GEUA 2WPCA 5GRTA 4Z26A 1ZY8A 2WEUA 4IA6A 3FIMB 1X31B 4A5LA 2A89A 1E1LA 2RABA 4DSGA 1D4DA 3AXBA 2EQ8A 4H2QA 2F5ZA 4OPGA 1RYIA 1NAAA 2JBVA 4EMWA 1IUVA 4H4SA 2VRMA 1S2QA 3FG2P 2YR5A 3IWAA 4J34A 4AOXA 4MJWA 5BVAA 1PBDA 1BWCA 4BK1A 4Z2TA 3BHKA 4A7AA 4EQWA 4ICYA 1VQWA 2FJDA 2VQBA 2FJAA 3KU9A 3VQRA 4GUVA 5BUKA 1O95A 2C3DA 3DJDA 4H4RA 4A79A 3UOZA 4XWZA 4H4ZA 1IUSA 3Q6JA 2Y6RA 2VQ7A 2AQJA 1GESA 1REOA 1D7YA 4OPTA 2VRLA 4UDPA 2WETA 4REKA 3CNSA 2C64A 2TMDA 1N1PA 3IC9A 2WDVA 1OJDA 2QCUA 3CGCA 1B8SA 2B7SA 2C73A 1TDNA 1GOSA 5JCIA 2HQMA 4CY8A 4U8MA 1KDGA 2BK3A 4YTMA 4O5QA 3B6DA 3EANA 4DGKA 4CCQA 2GH5A 3NN0X 2IIDA 2YVFA 3SGLA 4TM1A 4U2TA 4U8IA 1TDKA 2YLWA 2Z5XA 2EQ6A 1PBFA 2FBWA 4HA6A 4NEVA 3BI5A 3ALLA 4A65A 1ZOYA 4GDPA 2GR1A 4WX1A 1JNZA 4EIQA 1B5QA 4U2SA 1KSSA 2WOIA 3I3LA 3R9UA 2OALA 3C4AA 5HY5A 4Z2UA 1EL5A 1DJQA 2YR6A 4TM4A 3GMBA 4EQRA 1P2EA 1K0IA 1QLBA 1NPXA 2CVJA 3B3RA 5BULA 2C7GA 1JOAA 2O9ZA 2WP9A 3S61A 1NENA 4J31A 2IVDA 3BI4A 2JAEA 1Q1RA 3ABVA 1VDCA 2GAHB 3NYCA 4USQA 2JB2A 2XCGA 2WS3A 2GMJA 3EAOA 4EMJA 1GNDA 1LTXR 1RSGA 3DGZA 1GREA 3CNPA 3D8XA 3RP8A 3AE9A 4YTNA 2TPRA 4D03A 3DJEA 2ZZBA 1ZK7A 3QFBA 3M0OA 2YLZA 1CF3A 4JQ9A 3CGEA 2W0HA 1E1KA 3AEDA 4K5RA 5EB5A 2X8HA 3UKAA 1JNRA 2WOWA 2XYOA 3G5RA 3KKJA 4IVMB 1Z6LA 3P9UA 2YR4A 2R46A 2EQ7A 5ER0A 2ZZ0A 1H82A 1E1NA 2YQUA 1QO8A 3UOXA 4U8LA 3AEFA 4YSYA 1H6VA 1S3EA 4JY3A 1FOHA 4C77A 5KWFA 1P2HA 2WBAA 3DK9A 4KX6A 2WPFA 2V3BA 3EF6A 1LPFA 2VVLA 3G5SA 3GYJA 4UDRA 2QA1A 1H81A 3P1WA 1ELIA 3NK2X 2GF3A 2Q0KA 4EQSA 1ZMCA 2I0ZA 3QFAA 2YWLA 5IPYA 3E1TA 3F8PA 4B68A 5FMHA 2APGA 3AYIA 4BK3A 2OLNA 1LV0A 1H7XA 3CPIG 2CULA 3SFEA 2C3CA 2BC1A 2XFUA 3AYJA 2PYXA 3NYEA 1FL2A 2WPEA 3M13A 3M12A 4M52A 4U8JA 3ALMA 5EB4A 3NN6X 1GPEA 1TDOA 1CHUA 2WOVA 5HYMA 1TDEA 2X8CA 1B4VA 4H4QA 2GQWA 1OJCA 1MXTA 1SEZA 4JNAA 4GR1A 1YQ4A 1CC4A 4A6NA 4OVIA 2GVCA 4IVOB 3LB8A 4H4XA 3UCLA 2GB0A 3CPHG 3REDA 3CGBA 4OPCA 3NT6A 3UOYA 4H2PA 3UTFA 4KPRA 3NH3X 4B1BA 1DNCA 2DKIA 4Y4LA 3NK0X 2Q7VA 5FS7A 4A6NB 4IV9A 5TR3A 5BRTA 5U1OA 4YT0A 1MO9A 1ZDLA 3LOVA 4BV6A 3GMCA 1GRHA 1O5WA 4ECHA 1O94A 3AE1A 2C72A 2Q0LA 3NLCA 2A87A 2XVEA 1PJ5A 1NHSA 2PHHA 4X9MA 4Y4MA 3BI2A 4PABA 4A99A 4CCRA 1F3PA 2Q6UA 4EIPA 3FMWA 3RP6A 3PS9A 3UKPA 3ATQA 2FJBA 4CBQA 3AE5A 3NHOX 4CNJA 2XLUA 3GSIA 3V3NA 4C3XA 4B69A 3LZWA 1BKWA 4GF7A 2BC0A 3EPTA 3AD8B 1BGNA 1OJAA 2WESA 4YSZA 5M10A 2BS4A 2WDRA 2AR8A 5FS8A 2BS2A 1DXLA 1IUWA 4X9NA 1VG0A 5JCNA 3ICRA 3CGDA 2QAEA 3K30A 1IJHA 2XLPA 1ZX9A 3S5WA 1YQ3A 1H84A 1BZLA 5KRQA 2BA9A 3AE3A 2XFNA 2YG4A 2C67A 2FJEA 3NKSA 4H2RA 3ICTA 2XVJA 3NTDA 3RHAA 1PN0A 1K4QA 1D5TA 2ARDA
chains in the Genus database with same CATH superfamily
3UKQA 1UKVG 5KOXA 1NG4A 4Z25A 4YXDA 2XVIA 1KF6A 1KNPA 3ITJA 4FX9A 4O5UA 2R9ZA 4EQXA 3UP4A 4NTCA 2BRYA 3KA7A 3WE0A 2C76A 2JKCA 3DJJA 1FECA 1GTHA 1EL8A 2OA1A 3ICSA 3JSKA 5CQFA 3DA1A 1KSUA 5KVHA 1GRBA 4UP3A 2CDUA 1D7LA 5HXIA 3AD7B 2VVLG 1N4WA 2YG7A 1N4UA 4J57A 3T14A 2YLTA 2YG5A 4YSXA 4U8PA 1XHCA 3QJ4A 2DKHA 3CNTA 1IUUA 1FEBA 4H4TA 4K8DA 5KVIA 1NHPA 1IUTA 4N9XA 2C66A 3DH9A 5C2TA 1W4XA 3AE4A 3FBSA 3GYIA 2BXRA 3LADA 5EOWA 1EBDA 5GSNA 1GRTA 1LVLA 4Y4NA 3GDPA 3PO7A 1S3BA 1GTEA 5JCMA 4DNAA 2GEWA 3LJPA 4B66A 4CY6A 3DGHA 3UTEA 5KOWA 2JB3A 3KPKA 4E0VA 4CNKA 3GD3A 3AE2A 3KD9A 3KLJA 2B9WA 2YLRA 3AEAA 1VRQB 5LV9A 1ZP0A 1CBOA 2IVEA 2XLRA 2XLSA 3IHGA 4U8OA 4OPIA 1JRYA 4GRTA 5J7XA 2R4EA 3D1CA 4NTDA 2R0PA 4JDRA 2H89A 4GCMA 5JCLA 1PBCA 3H8LA 3OZ2A 4H4YA 1CC2A 3QSEA 4RSLA 2YAUA 1PJ6A 1ZKQA 1L9DA 1YQZA 1OJTA 3AEEA 3GRSA 2GMHA 1M6IA 4K2XA 3RP7A 3T37A 2NVKX 4CRTA 1DOEA 4B64A 4ZN0A 3COXA 3AEGA 4AOSA 2GRTA 5U25A 1TDFA 3GYXA 1PXAA 5U63A 2XFPA 3QVPA 4U2LA 3F8RA 4IA5A 1ZMDA 3UKLA 4EMIA 5L46A 1NHRA 3SZFA 3AEBA 4D04A 3V3OA 3KPFA 1NDAA 3L1RA 1M64A 1FCDA 2VOUA 1L0VA 3T2ZA 4GDEA 3L8KA 3OC4A 3CN8A 1YY5A 2C65A 2GR3A 2OAMA 2C70A 1F6MA 3BNMA 1TRBA 3DK4A 3G5QA 1PS9A 2GQFA 3T2YA 1Q9IA 2V60A 1Q1WA 4OPUA 4G74A 1BGJA 4K5SA 1GERA 3LXDA 5HHFA 1N4VA 2YLSA 4RG4A 2BK5A 4AT2A 2JB1A 2B7RA 3CIRA 4LIIA 5FS6A 1BF3A 4B65A 4J36A 3H4KA 4H2NA 4BURA 2R4JA 2OLOA 4Z2RA 1GT8A 1H83A 2R0GA 3NRNA 4OPDA 2CFYA 1LQUA 2E1MA 3VRDB 2XDOA 4J56A 3SXIA 4YTPA 1GETA 2B9YA 3GWFA 1MOKA 1GSNA 2WU5A 4FK1A 4XWRA 1QJDA 1TYPA 2BACA 2R0CA 4Z24A 2YG3A 3Q9TA 1KFYA 4BJZA 2RGOA 2BXSA 4WCTA 3VRAA 3ZYXA 2XFOA 1B37A 1F8WA 3ISHA 3P4RA 4X4JA 4J33A 1PHHA 2EQ9A 4I59A 3SM8A 3I6DA 4APNA 3NNEA 2YM1A 3QSSA 1L9CA 1NHQA 1F8SA 4Z44A 3QVRA 2YVGA 1K0LA 3P4PA 4NNJA 1E1MA 1XPQA 3VR8A 2RGJA 1DJNA 4NZHA 2YG6A 3CPJG 2X99A 1H7WA 2VZ2A 4C3YA 4FDCB 2X8GA 2ACZA 4I58A 4TM3A 3AB1A 4H4UA 1OJ9A 1YKJA 1KNRA 3DK8A 1JU2A 3NG7X 1NG3A 2RGHA 3AE8A 4AT0A 1PBBA 2H88A 4J2WA 1JEHA 1LJ1A 3C4NA 3UTGA 4H50A 4YKFA 3NIXA 1ZOVA 3NTAA 4PAAA 4P9SA 2R45A 3K7TA 2YM2A 3CTYA 4H4VA 2E5VA 2AAQA 1E7PA 3LZXA 4LA1A 2UZZA 4NEWA 2WP6A 1CL0A 2BK4A 1D4EA 1L9EA 1JRXA 4XXGA 2BS3A 2WDQA 1Y0PA 3ATRA 2ZZCA 2V6OA 3DMEA 4K7ZA 5FS9A 3ALJA 4TLZA 2XLTA 3IHMA 1GV4A 4B67A 4DSHA 4A9WA 4Z43A 1GXFA 3CNDA 3UKHA 3P4SA 2XVFA 5CKUA 1ONFA 4TLXA 1D4CA 4H4WA 2QA2A 3AD9B 4LU6A 5C3JA 3FPZA 4OPLA 3DJGX 1GRFA 3SFDA 1E39A 1EL9A 3HYVA 1XANA 4OCGA 3NGCX 3BNUA 1FEAA 1CJCA 1V59A 2GR2A 1S2YA 2VVMA 2GR0A 3NYFA 5DBJA 1CJ2A 3SZ0A 1H86A 2B9XA 5M0ZA 1PDHA 4AP1A 1CC6A 1GRGA 2ZBWA 3IF9A 4JN9A 5EBKA 1PXCA 5KMQA 3UKFA 1Y56A 4U8NA 4ADWA 3SQPA 4ZCDA 1PJ7A 3VR9A 2YLXA 1PBEA 4FK1C 2XFQA 1DOCA 2Z5YA 4K22A 3URHA 3CNJA 5J60A 4H7UA 2V3AA 3RNMA 2BABA 3K7MX 3GWDA 3II4A 1GRAA 2WU2A 3PVCA 3UTHA 4YKGA 3K7QX 2WHDA 2X50A 1RP0A 4AP3A 3VRBA 3KVEA 1Y56B 1XDIA 4RG3A 1PXBA 3AWIA 3C96A 2E4GA 2XVHA 3V76A 2WQYA 1DODA 2X3NA 1HYUA 1CJ3A 2NPXA 1CJ4A 2A8XA 4G6HA 1F8RA 4UDQA 3GDNA 4B63A 4YSHA 3O0HA 2BYBA 4H4PA 1NEKA 1EL7A 1LQTA 4BJYA 4C74A 5JCKA 2Y6QA 2YVJA 3NK1X 1DOBA 3HZLA 3UP5A 2JK6A 3GD4A 1AOGA 3H8IA 5IQ1A 2BCPA 3AYLA 4NTEA 1VG9A 4ZCCA 2WP5A 3F8DA 4JY2A 4TM0A 4U8KA 3ZDNA 1GALA 5IQ4A 2GAGB 4G73A 3BHFA 4HB9A 4EM4A 3AE6A 1TYTA 2GV8A 2V5ZA 3AE7A 4C5OA 3UOVA 1K0JA 2B76A 3QSMA 4BK2A 4EM3A 2V61A 3GRTA 1E6EA 4JNQA 3ADAB 2J3NA 3P4QA 4YWOA 1COYA 2C75A 3AECA 3UKKA 5KXJA 1IUXA 1JRZA 4USRA 2BCGG 1GEUA 2WPCA 5GRTA 4Z26A 1ZY8A 2WEUA 4IA6A 3FIMB 1X31B 4A5LA 2A89A 1E1LA 2RABA 4DSGA 1D4DA 3AXBA 3SX6A 2EQ8A 4H2QA 2F5ZA 4OPGA 1RYIA 1NAAA 2JBVA 4EMWA 1IUVA 4H4SA 2VRMA 1S2QA 3FG2P 2YR5A 3IWAA 4J34A 4AOXA 4G9KA 4MJWA 5BVAA 1PBDA 1BWCA 4BK1A 4Z2TA 3BHKA 5KMSA 4A7AA 4EQWA 4ICYA 1VQWA 2FJDA 5KNLA 2VQBA 2FJAA 3KU9A 3VQRA 4GUVA 5BUKA 1O95A 2C3DA 3DJDA 4H4RA 4A79A 3UOZA 4XWZA 4H4ZA 1IUSA 3Q6JA 2Y6RA 2VQ7A 2AQJA 1GESA 1REOA 1D7YA 4OPTA 2VRLA 4UDPA 2WETA 4REKA 3CNSA 2C64A 2TMDA 1N1PA 3IC9A 2WDVA 1OJDA 3CMMA 2QCUA 3CGCA 1B8SA 3SZCA 2B7SA 3SYIA 2C73A 1TDNA 1GOSA 5JCIA 2HQMA 4CY8A 4U8MA 1KDGA 2BK3A 4YTMA 4O5QA 3B6DA 3EANA 4DGKA 4CCQA 2GH5A 3NN0X 2IIDA 2YVFA 3SGLA 4TM1A 4U2TA 4U8IA 4II2A 1TDKA 2YLWA 2Z5XA 2EQ6A 1PBFA 2FBWA 4HA6A 4NEVA 3BI5A 3ALLA 4A65A 1ZOYA 4GDPA 2GR1A 4WX1A 1JNZA 4EIQA 1B5QA 4U2SA 1KSSA 2WOIA 3I3LA 3R9UA 2OALA 3C4AA 5HY5A 4Z2UA 1EL5A 1DJQA 2YR6A 4TM4A 3GMBA 4EQRA 1P2EA 4G6GA 1K0IA 1QLBA 1NPXA 2CVJA 3B3RA 5BULA 2C7GA 4II3A 1JOAA 2O9ZA 2WP9A 3S61A 1NENA 4GAPA 4J31A 2IVDA 3BI4A 2JAEA 1Q1RA 3ABVA 4NWZA 1VDCA 2GAHB 3NYCA 4USQA 2JB2A 2XCGA 2WS3A 2GMJA 3EAOA 4EMJA 1GNDA 1LTXR 1RSGA 3DGZA 1GREA 3CNPA 3D8XA 3RP8A 3AE9A 4YTNA 2TPRA 4D03A 3DJEA 2ZZBA 1ZK7A 3QFBA 3T0KA 3M0OA 2YLZA 3SY4A 1CF3A 4JQ9A 3CGEA 2W0HA 1E1KA 3AEDA 4K5RA 5EB5A 2X8HA 3UKAA 1JNRA 2WOWA 2XYOA 3G5RA 3KKJA 4IVMB 1Z6LA 3P9UA 2YR4A 2R46A 2EQ7A 3T2KA 5ER0A 2ZZ0A 1H82A 1E1NA 2YQUA 1QO8A 3UOXA 4U8LA 3AEFA 4YSYA 1H6VA 1S3EA 4JY3A 1FOHA 4C77A 5KWFA 1P2HA 2WBAA 3DK9A 4KX6A 2WPFA 2V3BA 3EF6A 1LPFA 2VVLA 3G5SA 3GYJA 4UDRA 2QA1A 1H81A 3P1WA 1ELIA 3NK2X 2GF3A 2BRAA 2Q0KA 4EQSA 1ZMCA 2I0ZA 3QFAA 2YWLA 5IPYA 3E1TA 3F8PA 4B68A 5FMHA 2APGA 3AYIA 3SZWA 2OLNA 1LV0A 1H7XA 4BK3A 3CPIG 3T31A 2CULA 3SFEA 2C3CA 2BC1A 2XFUA 3AYJA 2PYXA 3NYEA 1FL2A 2WPEA 3M13A 3M12A 4M52A 4U8JA 3ALMA 5EB4A 3NN6X 1GPEA 1TDOA 1CHUA 2WOVA 5HYMA 4GAVA 1TDEA 2X8CA 1B4VA 5KMRA 4H4QA 2GQWA 1OJCA 1MXTA 1SEZA 5KMPA 4JNAA 4GR1A 1YQ4A 1CC4A 4A6NA 4OVIA 2GVCA 4IVOB 3LB8A 4H4XA 3UCLA 2GB0A 3CPHG 3REDA 3CGBA 4OPCA 3NT6A 3UOYA 4H2PA 3UTFA 4KPRA 3NH3X 4B1BA 1DNCA 2DKIA 4Y4LA 3NK0X 2Q7VA 5FS7A 4A6NB 4IV9A 5TR3A 5BRTA 5U1OA 4YT0A 1MO9A 1ZDLA 3LOVA 4BV6A 3GMCA 1GRHA 1O5WA 4ECHA 1O94A 3AE1A 2C72A 2Q0LA 3NLCA 2A87A 2XVEA 1PJ5A 1NHSA 2PHHA 3HYWA 4X9MA 4Y4MA 3BI2A 4PABA 4A99A 4CCRA 1F3PA 2Q6UA 4EIPA 3FMWA 3RP6A 3PS9A 3UKPA 3ATQA 2FJBA 4CBQA 3AE5A 3NHOX 4CNJA 2XLUA 3GSIA 3V3NA 4C3XA 4B69A 3LZWA 1BKWA 4GF7A 2BC0A 2C4CA 3EPTA 3AD8B 1BGNA 1OJAA 3HYXA 2WESA 4YSZA 5M10A 2BS4A 2WDRA 2AR8A 5FS8A 2BS2A 1DXLA 1IUWA 4X9NA 1VG0A 5JCNA 3ICRA 3CGDA 2QAEA 3K30A 1IJHA 2XLPA 1ZX9A 3S5WA 1YQ3A 1H84A 1BZLA 5KRQA 2BA9A 3AE3A 2XFNA 2YG4A 2C67A 2FJEA 3NKSA 4H2RA 3ICTA 2XVJA 3NTDA 3RHAA 1PN0A 1K4QA 1D5TA 2ARDA
chains in the Genus database with same CATH topology
3UKQA 1UKVG 5KOXA 1NG4A 4Z25A 4YXDA 2XVIA 1KF6A 1KNPA 3ITJA 4FX9A 4O5UA 2R9ZA 4EQXA 3UP4A 4NTCA 2BRYA 3KA7A 3WE0A 2C76A 2JKCA 3DJJA 1FECA 1GTHA 1EL8A 2OA1A 3ICSA 3JSKA 5CQFA 3DA1A 1KSUA 5KVHA 1GRBA 4UP3A 2CDUA 1D7LA 5HXIA 3AD7B 2VVLG 1N4WA 2YG7A 1N4UA 4J57A 3T14A 2YLTA 2YG5A 4YSXA 4U8PA 1XHCA 3QJ4A 2DKHA 3CNTA 1IUUA 1FEBA 4H4TA 4K8DA 5KVIA 1NHPA 1IUTA 4N9XA 2C66A 3DH9A 5C2TA 1W4XA 3AE4A 3FBSA 3GYIA 2BXRA 3LADA 5EOWA 1EBDA 5GSNA 1GRTA 1LVLA 4Y4NA 3GDPA 3PO7A 1S3BA 1GTEA 5JCMA 4DNAA 2GEWA 3LJPA 4B66A 4CY6A 3DGHA 3UTEA 5KOWA 2JB3A 3KPKA 4E0VA 4CNKA 3GD3A 3AE2A 3KD9A 3KLJA 2B9WA 2YLRA 3AEAA 1VRQB 5LV9A 1ZP0A 1CBOA 2IVEA 2XLRA 2XLSA 3IHGA 4U8OA 4OPIA 1JRYA 4GRTA 5J7XA 2R4EA 3D1CA 4NTDA 2R0PA 4JDRA 2H89A 4GCMA 5JCLA 1PBCA 3H8LA 3OZ2A 4H4YA 1CC2A 3QSEA 4RSLA 2YAUA 1PJ6A 1ZKQA 1L9DA 1YQZA 1OJTA 3AEEA 3GRSA 2GMHA 1M6IA 4K2XA 3RP7A 3T37A 2NVKX 4CRTA 1DOEA 4B64A 4ZN0A 3COXA 3AEGA 4AOSA 2GRTA 5U25A 1TDFA 3GYXA 1PXAA 5U63A 2XFPA 3QVPA 4U2LA 3F8RA 4IA5A 1ZMDA 3UKLA 4EMIA 5L46A 1NHRA 3SZFA 3AEBA 4D04A 3V3OA 3KPFA 1NDAA 3L1RA 1M64A 1FCDA 2VOUA 1L0VA 3T2ZA 4GDEA 3L8KA 3OC4A 3CN8A 1YY5A 2C65A 2GR3A 2OAMA 2C70A 1F6MA 3BNMA 1TRBA 3DK4A 3G5QA 1PS9A 2GQFA 3T2YA 1Q9IA 2V60A 1Q1WA 4OPUA 4G74A 1BGJA 4K5SA 1GERA 3LXDA 5HHFA 1N4VA 2YLSA 4RG4A 2BK5A 4AT2A 2JB1A 2B7RA 3CIRA 4LIIA 5FS6A 1BF3A 4B65A 4J36A 3H4KA 4H2NA 4BURA 2R4JA 2OLOA 4Z2RA 1GT8A 1H83A 2R0GA 3NRNA 4OPDA 2CFYA 1LQUA 2E1MA 3VRDB 2XDOA 4J56A 3SXIA 4YTPA 1GETA 2B9YA 3GWFA 1MOKA 1GSNA 2WU5A 4FK1A 4XWRA 1QJDA 1TYPA 2BACA 2R0CA 4Z24A 2YG3A 3Q9TA 1KFYA 4BJZA 2RGOA 2BXSA 4WCTA 3VRAA 3ZYXA 2XFOA 1B37A 1F8WA 3ISHA 3P4RA 4X4JA 4J33A 1PHHA 2EQ9A 4I59A 3SM8A 3I6DA 4APNA 3NNEA 2YM1A 3QSSA 1L9CA 1NHQA 1F8SA 4Z44A 3QVRA 2YVGA 1K0LA 3P4PA 4NNJA 1E1MA 1XPQA 3VR8A 2RGJA 1DJNA 4NZHA 2YG6A 3CPJG 2X99A 1H7WA 2VZ2A 4C3YA 4FDCB 2X8GA 2ACZA 4I58A 4TM3A 3AB1A 4H4UA 1OJ9A 1YKJA 1KNRA 3DK8A 1JU2A 3NG7X 1NG3A 2RGHA 3AE8A 4AT0A 1PBBA 2H88A 4J2WA 1JEHA 1LJ1A 3C4NA 3UTGA 4H50A 4YKFA 3NIXA 1ZOVA 3NTAA 4PAAA 4P9SA 2R45A 3K7TA 2YM2A 3CTYA 4H4VA 2E5VA 2AAQA 1E7PA 3LZXA 4LA1A 2UZZA 4NEWA 2WP6A 1CL0A 2BK4A 1D4EA 1L9EA 1JRXA 4XXGA 2BS3A 2WDQA 1Y0PA 3ATRA 2ZZCA 2V6OA 3DMEA 4K7ZA 5FS9A 3ALJA 4TLZA 2XLTA 3IHMA 1GV4A 4B67A 4DSHA 4A9WA 4Z43A 1GXFA 3CNDA 3UKHA 3P4SA 2XVFA 5CKUA 1ONFA 4TLXA 1D4CA 4H4WA 2QA2A 3AD9B 4LU6A 5C3JA 3FPZA 4OPLA 3DJGX 1GRFA 3SFDA 1E39A 1EL9A 3HYVA 1XANA 4OCGA 3NGCX 3BNUA 1FEAA 1CJCA 1V59A 2GR2A 1S2YA 2VVMA 2GR0A 3NYFA 5DBJA 1CJ2A 3SZ0A 1H86A 2B9XA 5M0ZA 1PDHA 4AP1A 1CC6A 1GRGA 2ZBWA 3IF9A 4JN9A 5EBKA 1PXCA 5KMQA 3UKFA 1Y56A 4U8NA 4ADWA 3SQPA 4ZCDA 1PJ7A 3VR9A 2YLXA 1PBEA 4FK1C 2XFQA 1DOCA 2Z5YA 4K22A 3URHA 3CNJA 5J60A 4H7UA 2V3AA 3RNMA 2BABA 3K7MX 3GWDA 3II4A 1GRAA 2WU2A 3PVCA 3UTHA 4YKGA 3K7QX 2WHDA 2X50A 1RP0A 4AP3A 3VRBA 3KVEA 1Y56B 1XDIA 4RG3A 1PXBA 3AWIA 3C96A 2E4GA 2XVHA 3V76A 2WQYA 1DODA 2X3NA 1HYUA 1CJ3A 2NPXA 1CJ4A 2A8XA 4G6HA 1F8RA 4UDQA 3GDNA 4B63A 4YSHA 3O0HA 2BYBA 4H4PA 1NEKA 1EL7A 1LQTA 4BJYA 4C74A 5JCKA 2Y6QA 2YVJA 3NK1X 1DOBA 3HZLA 3UP5A 2JK6A 3GD4A 1AOGA 3H8IA 5IQ1A 2BCPA 3AYLA 4NTEA 1VG9A 4ZCCA 2WP5A 3F8DA 4JY2A 4TM0A 4U8KA 3ZDNA 1GALA 5IQ4A 2GAGB 4G73A 3BHFA 4HB9A 4EM4A 3AE6A 1TYTA 2GV8A 2V5ZA 3AE7A 4C5OA 3UOVA 1K0JA 2B76A 3QSMA 4BK2A 4EM3A 2V61A 3GRTA 1E6EA 4JNQA 3ADAB 2J3NA 3P4QA 4YWOA 1COYA 2C75A 3AECA 3UKKA 5KXJA 1IUXA 1JRZA 4USRA 2BCGG 1GEUA 2WPCA 5GRTA 4Z26A 1ZY8A 2WEUA 4IA6A 3FIMB 1X31B 4A5LA 2A89A 1E1LA 2RABA 4DSGA 1D4DA 3AXBA 3SX6A 2EQ8A 4H2QA 2F5ZA 4OPGA 1RYIA 1NAAA 2JBVA 4EMWA 1IUVA 4H4SA 2VRMA 1S2QA 3FG2P 2YR5A 3IWAA 4J34A 4AOXA 4G9KA 4MJWA 5BVAA 1PBDA 1BWCA 4BK1A 4Z2TA 3BHKA 5KMSA 4A7AA 4EQWA 4ICYA 1VQWA 2FJDA 5KNLA 2VQBA 2FJAA 3KU9A 3VQRA 4GUVA 5BUKA 1O95A 2C3DA 3DJDA 4H4RA 4A79A 3UOZA 4XWZA 4H4ZA 1IUSA 3Q6JA 2Y6RA 2VQ7A 2AQJA 1GESA 1REOA 1D7YA 4OPTA 2VRLA 4UDPA 2WETA 4REKA 3CNSA 2C64A 2TMDA 1N1PA 3IC9A 2WDVA 1OJDA 3CMMA 2QCUA 3CGCA 1B8SA 3SZCA 2B7SA 3SYIA 2C73A 1TDNA 1GOSA 5JCIA 2HQMA 4CY8A 4U8MA 1KDGA 2BK3A 4YTMA 4O5QA 3B6DA 3EANA 4DGKA 4CCQA 2GH5A 3NN0X 2IIDA 2YVFA 3SGLA 4TM1A 4U2TA 4U8IA 4II2A 1TDKA 2YLWA 2Z5XA 2EQ6A 1PBFA 2FBWA 4HA6A 4NEVA 3BI5A 3ALLA 4A65A 1ZOYA 4GDPA 2GR1A 4WX1A 1JNZA 4EIQA 1B5QA 4U2SA 1KSSA 2WOIA 3I3LA 3R9UA 2OALA 3C4AA 5HY5A 4Z2UA 1EL5A 1DJQA 2YR6A 4TM4A 3GMBA 4EQRA 1P2EA 4G6GA 1K0IA 1QLBA 1NPXA 2CVJA 3B3RA 5BULA 2C7GA 4II3A 1JOAA 2O9ZA 2WP9A 3S61A 1NENA 4GAPA 4J31A 2IVDA 3BI4A 2JAEA 1Q1RA 3ABVA 4NWZA 1VDCA 2GAHB 3NYCA 4USQA 2JB2A 2XCGA 2WS3A 2GMJA 3EAOA 4EMJA 1GNDA 1LTXR 1RSGA 3DGZA 1GREA 3CNPA 3D8XA 3RP8A 3AE9A 4YTNA 2TPRA 4D03A 3DJEA 2ZZBA 1ZK7A 3QFBA 3T0KA 3M0OA 2YLZA 3SY4A 1CF3A 4JQ9A 3CGEA 2W0HA 1E1KA 3AEDA 4K5RA 5EB5A 2X8HA 3UKAA 1JNRA 2WOWA 2XYOA 3G5RA 3KKJA 4IVMB 1Z6LA 3P9UA 2YR4A 2R46A 2EQ7A 3T2KA 5ER0A 2ZZ0A 1H82A 1E1NA 2YQUA 1QO8A 3UOXA 4U8LA 3AEFA 4YSYA 1H6VA 1S3EA 4JY3A 1FOHA 4C77A 5KWFA 1P2HA 2WBAA 3DK9A 4KX6A 2WPFA 2V3BA 3EF6A 1LPFA 2VVLA 3G5SA 3GYJA 4UDRA 2QA1A 1H81A 3P1WA 1ELIA 3NK2X 2GF3A 2BRAA 2Q0KA 4EQSA 1ZMCA 2I0ZA 3QFAA 2YWLA 5IPYA 3E1TA 3F8PA 4B68A 5FMHA 2APGA 3AYIA 3SZWA 2OLNA 1LV0A 1H7XA 4BK3A 3CPIG 3T31A 2CULA 3SFEA 2C3CA 2BC1A 2XFUA 3AYJA 2PYXA 3NYEA 1FL2A 2WPEA 3M13A 3M12A 4M52A 4U8JA 3ALMA 5EB4A 3NN6X 1GPEA 1TDOA 1CHUA 2WOVA 5HYMA 4GAVA 1TDEA 2X8CA 1B4VA 5KMRA 4H4QA 2GQWA 1OJCA 1MXTA 1SEZA 5KMPA 4JNAA 4GR1A 1YQ4A 1CC4A 4A6NA 4OVIA 2GVCA 4IVOB 3LB8A 4H4XA 3UCLA 2GB0A 3CPHG 3REDA 3CGBA 4OPCA 3NT6A 3UOYA 4H2PA 3UTFA 4KPRA 3NH3X 4B1BA 1DNCA 2DKIA 4Y4LA 3NK0X 2Q7VA 5FS7A 4A6NB 4IV9A 5TR3A 5BRTA 5U1OA 4YT0A 1MO9A 1ZDLA 3LOVA 4BV6A 3GMCA 1GRHA 1O5WA 4ECHA 1O94A 3AE1A 2C72A 2Q0LA 3NLCA 2A87A 2XVEA 1PJ5A 1NHSA 2PHHA 3HYWA 4X9MA 4Y4MA 3BI2A 4PABA 4A99A 4CCRA 1F3PA 2Q6UA 4EIPA 3FMWA 3RP6A 3PS9A 3UKPA 3ATQA 2FJBA 4CBQA 3AE5A 3NHOX 4CNJA 2XLUA 3GSIA 3V3NA 4C3XA 4B69A 3LZWA 1BKWA 4GF7A 2BC0A 2C4CA 3EPTA 3AD8B 1BGNA 1OJAA 3HYXA 2WESA 4YSZA 5M10A 2BS4A 2WDRA 2AR8A 5FS8A 2BS2A 1DXLA 1IUWA 4X9NA 1VG0A 5JCNA 3ICRA 3CGDA 2QAEA 3K30A 1IJHA 2XLPA 1ZX9A 3S5WA 1YQ3A 1H84A 1BZLA 5KRQA 2BA9A 3AE3A 2XFNA 2YG4A 2C67A 2FJEA 3NKSA 4H2RA 3ICTA 2XVJA 3NTDA 3RHAA 1PN0A 1K4QA 1D5TA 2ARDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKQ A;  1UKV G;  5KOX A;  1NG4 A;  4Z25 A;  4YXD A;  2XVI A;  1KF6 A;  1KNP A;  3ITJ A;  4FX9 A;  4O5U A;  2R9Z A;  4EQX A;  3UP4 A;  4NTC A;  3KA7 A;  3WE0 A;  2C76 A;  2JKC A;  3DJJ A;  1FEC A;  1GTH A;  1EL8 A;  2OA1 A;  3ICS A;  3JSK A;  5CQF A;  3DA1 A;  1KSU A;  5KVH A;  1GRB A;  4UP3 A;  2CDU A;  1D7L A;  5HXI A;  3AD7 B;  2VVL G;  1N4W A;  2YG7 A;  1N4U A;  4J57 A;  2YLT A;  2YG5 A;  4YSX A;  4U8P A;  1XHC A;  3QJ4 A;  2DKH A;  3CNT A;  1IUU A;  1FEB A;  4H4T A;  4K8D A;  5KVI A;  1NHP A;  1IUT A;  4N9X A;  2C66 A;  3DH9 A;  5C2T A;  1W4X A;  3AE4 A;  3FBS A;  3GYI A;  2BXR A;  3LAD A;  5EOW A;  1EBD A;  5GSN A;  1GRT A;  1LVL A;  4Y4N A;  3GDP A;  3PO7 A;  1S3B A;  1GTE A;  5JCM A;  4DNA A;  2GEW A;  3LJP A;  4B66 A;  4CY6 A;  3DGH A;  3UTE A;  5KOW A;  2JB3 A;  4E0V A;  4CNK A;  3GD3 A;  3AE2 A;  3KD9 A;  3KLJ A;  2B9W A;  2YLR A;  3AEA A;  1VRQ B;  5LV9 A;  1ZP0 A;  1CBO A;  2IVE A;  2XLR A;  2XLS A;  3IHG A;  4U8O A;  4OPI A;  1JRY A;  4GRT A;  5J7X A;  2R4E A;  3D1C A;  4NTD A;  2R0P A;  4JDR A;  2H89 A;  4GCM A;  5JCL A;  1PBC A;  3H8L A;  3OZ2 A;  4H4Y A;  1CC2 A;  3QSE A;  4RSL A;  2YAU A;  1PJ6 A;  1ZKQ A;  1L9D A;  1YQZ A;  1OJT A;  3AEE A;  3GRS A;  2GMH A;  1M6I A;  4K2X A;  3RP7 A;  3T37 A;  2NVK X;  4CRT A;  1DOE A;  4B64 A;  4ZN0 A;  3COX A;  3AEG A;  4AOS A;  2GRT A;  5U25 A;  1TDF A;  1PXA A;  5U63 A;  2XFP A;  3QVP A;  4U2L A;  3F8R A;  4IA5 A;  1ZMD A;  3UKL A;  4EMI A;  5L46 A;  1NHR A;  3AEB A;  4D04 A;  3V3O A;  3KPF A;  1NDA A;  3L1R A;  1M64 A;  1FCD A;  2VOU A;  1L0V A;  4GDE A;  3L8K A;  3OC4 A;  3CN8 A;  1YY5 A;  2C65 A;  2GR3 A;  2OAM A;  2C70 A;  1F6M A;  3BNM A;  1TRB A;  3DK4 A;  3G5Q A;  1PS9 A;  2GQF A;  1Q9I A;  2V60 A;  1Q1W A;  4OPU A;  1BGJ A;  4K5S A;  1GER A;  3LXD A;  5HHF A;  1N4V A;  2YLS A;  4RG4 A;  2BK5 A;  4AT2 A;  2JB1 A;  2B7R A;  3CIR A;  4LII A;  5FS6 A;  1BF3 A;  4B65 A;  4J36 A;  3H4K A;  4H2N A;  4BUR A;  2R4J A;  2OLO A;  4Z2R A;  1GT8 A;  1H83 A;  2R0G A;  3NRN A;  4OPD A;  2CFY A;  1LQU A;  2E1M A;  3VRD B;  2XDO A;  4J56 A;  4YTP A;  1GET A;  2B9Y A;  3GWF A;  1MOK A;  1GSN A;  2WU5 A;  4FK1 A;  4XWR A;  1QJD A;  1TYP A;  2BAC A;  2R0C A;  4Z24 A;  2YG3 A;  3Q9T A;  1KFY A;  4BJZ A;  2RGO A;  2BXS A;  4WCT A;  3VRA A;  3ZYX A;  2XFO A;  1B37 A;  1F8W A;  3ISH A;  3P4R A;  4X4J A;  4J33 A;  1PHH A;  2EQ9 A;  4I59 A;  3SM8 A;  3I6D A;  4APN A;  3NNE A;  2YM1 A;  3QSS A;  1L9C A;  1NHQ A;  1F8S A;  4Z44 A;  3QVR A;  2YVG A;  1K0L A;  3P4P A;  1E1M A;  1XPQ A;  3VR8 A;  2RGJ A;  1DJN A;  4NZH A;  2YG6 A;  3CPJ G;  2X99 A;  1H7W A;  2VZ2 A;  4C3Y A;  4FDC B;  2X8G A;  2ACZ A;  4I58 A;  4TM3 A;  3AB1 A;  4H4U A;  1OJ9 A;  1YKJ A;  1KNR A;  3DK8 A;  1JU2 A;  3NG7 X;  1NG3 A;  2RGH A;  3AE8 A;  4AT0 A;  1PBB A;  2H88 A;  4J2W A;  1JEH A;  1LJ1 A;  3C4N A;  3UTG A;  4H50 A;  4YKF A;  3NIX A;  1ZOV A;  3NTA A;  4PAA A;  4P9S A;  2R45 A;  3K7T A;  2YM2 A;  3CTY A;  4H4V A;  2E5V A;  2AAQ A;  1E7P A;  3LZX A;  4LA1 A;  2UZZ A;  4NEW A;  2WP6 A;  1CL0 A;  2BK4 A;  1D4E A;  1L9E A;  1JRX A;  4XXG A;  2BS3 A;  2WDQ A;  1Y0P A;  3ATR A;  2ZZC A;  2V6O A;  3DME A;  4K7Z A;  5FS9 A;  3ALJ A;  4TLZ A;  2XLT A;  3IHM A;  1GV4 A;  4B67 A;  4DSH A;  4A9W A;  4Z43 A;  1GXF A;  3CND A;  3UKH A;  3P4S A;  2XVF A;  5CKU A;  1ONF A;  4TLX A;  1D4C A;  4H4W A;  2QA2 A;  3AD9 B;  4LU6 A;  5C3J A;  3FPZ A;  4OPL A;  3DJG X;  1GRF A;  3SFD A;  1E39 A;  1EL9 A;  1XAN A;  4OCG A;  3NGC X;  3BNU A;  1FEA A;  1CJC A;  1V59 A;  2GR2 A;  1S2Y A;  2VVM A;  2GR0 A;  3NYF A;  5DBJ A;  1CJ2 A;  1H86 A;  2B9X A;  5M0Z A;  1PDH A;  4AP1 A;  1CC6 A;  1GRG A;  2ZBW A;  3IF9 A;  4JN9 A;  5EBK A;  1PXC A;  3UKF A;  1Y56 A;  4U8N A;  4ADW A;  3SQP A;  4ZCD A;  1PJ7 A;  3VR9 A;  2YLX A;  1PBE A;  4FK1 C;  2XFQ A;  1DOC A;  2Z5Y A;  4K22 A;  3URH A;  3CNJ A;  5J60 A;  4H7U A;  2V3A A;  3RNM A;  2BAB A;  3K7M X;  3GWD A;  3II4 A;  1GRA A;  2WU2 A;  3PVC A;  3UTH A;  4YKG A;  3K7Q X;  2WHD A;  2X50 A;  1RP0 A;  4AP3 A;  3VRB A;  3KVE A;  1Y56 B;  1XDI A;  4RG3 A;  1PXB A;  3AWI A;  3C96 A;  2E4G A;  2XVH A;  3V76 A;  2WQY A;  1DOD A;  2X3N A;  1HYU A;  1CJ3 A;  2NPX A;  1CJ4 A;  2A8X A;  1F8R A;  4UDQ A;  3GDN A;  4B63 A;  4YSH A;  3O0H A;  2BYB A;  4H4P A;  1NEK A;  1EL7 A;  1LQT A;  4BJY A;  4C74 A;  5JCK A;  2Y6Q A;  2YVJ A;  3NK1 X;  1DOB A;  3HZL A;  3UP5 A;  2JK6 A;  3GD4 A;  1AOG A;  3H8I A;  5IQ1 A;  2BCP A;  3AYL A;  4NTE A;  1VG9 A;  4ZCC A;  2WP5 A;  3F8D A;  4JY2 A;  4TM0 A;  4U8K A;  3ZDN A;  1GAL A;  5IQ4 A;  2GAG B;  3BHF A;  4HB9 A;  4EM4 A;  3AE6 A;  1TYT A;  2GV8 A;  2V5Z A;  3AE7 A;  4C5O A;  3UOV A;  1K0J A;  2B76 A;  3QSM A;  4BK2 A;  4EM3 A;  2V61 A;  3GRT A;  1E6E A;  4JNQ A;  3ADA B;  2J3N A;  3P4Q A;  4YWO A;  1COY A;  2C75 A;  3AEC A;  3UKK A;  5KXJ A;  1IUX A;  1JRZ A;  4USR A;  2BCG G;  1GEU A;  2WPC A;  5GRT A;  4Z26 A;  1ZY8 A;  2WEU A;  4IA6 A;  3FIM B;  1X31 B;  4A5L A;  2A89 A;  1E1L A;  2RAB A;  4DSG A;  1D4D A;  3AXB A;  2EQ8 A;  4H2Q A;  2F5Z A;  4OPG A;  1RYI A;  1NAA A;  2JBV A;  4EMW A;  1IUV A;  4H4S A;  2VRM A;  1S2Q A;  3FG2 P;  2YR5 A;  3IWA A;  4J34 A;  4AOX A;  4MJW A;  5BVA A;  1PBD A;  1BWC A;  4BK1 A;  4Z2T A;  3BHK A;  4A7A A;  4EQW A;  4ICY A;  1VQW A;  2FJD A;  2VQB A;  2FJA A;  3KU9 A;  3VQR A;  4GUV A;  5BUK A;  1O95 A;  2C3D A;  3DJD A;  4H4R A;  4A79 A;  3UOZ A;  4XWZ A;  4H4Z A;  1IUS A;  3Q6J A;  2Y6R A;  2VQ7 A;  2AQJ A;  1GES A;  1REO A;  1D7Y A;  4OPT A;  2VRL A;  4UDP A;  2WET A;  4REK A;  3CNS A;  2C64 A;  2TMD A;  1N1P A;  3IC9 A;  2WDV A;  1OJD A;  2QCU A;  3CGC A;  1B8S A;  2B7S A;  2C73 A;  1TDN A;  1GOS A;  5JCI A;  2HQM A;  4CY8 A;  4U8M A;  1KDG A;  2BK3 A;  4YTM A;  4O5Q A;  3B6D A;  3EAN A;  4DGK A;  4CCQ A;  2GH5 A;  3NN0 X;  2IID A;  2YVF A;  3SGL A;  4TM1 A;  4U2T A;  4U8I A;  1TDK A;  2YLW A;  2Z5X A;  2EQ6 A;  1PBF A;  2FBW A;  4HA6 A;  4NEV A;  3BI5 A;  3ALL A;  4A65 A;  1ZOY A;  4GDP A;  2GR1 A;  4WX1 A;  1JNZ A;  4EIQ A;  1B5Q A;  4U2S A;  1KSS A;  2WOI A;  3I3L A;  3R9U A;  2OAL A;  3C4A A;  5HY5 A;  4Z2U A;  1EL5 A;  1DJQ A;  2YR6 A;  4TM4 A;  3GMB A;  4EQR A;  1P2E A;  1K0I A;  1QLB A;  1NPX A;  2CVJ A;  3B3R A;  5BUL A;  2C7G A;  1JOA A;  2O9Z A;  2WP9 A;  3S61 A;  1NEN A;  4J31 A;  2IVD A;  3BI4 A;  2JAE A;  1Q1R A;  3ABV A;  1VDC A;  2GAH B;  3NYC A;  4USQ A;  2JB2 A;  2XCG A;  2WS3 A;  2GMJ A;  3EAO A;  4EMJ A;  1GND A;  1LTX R;  1RSG A;  3DGZ A;  1GRE A;  3CNP A;  3D8X A;  3RP8 A;  3AE9 A;  4YTN A;  2TPR A;  4D03 A;  3DJE A;  2ZZB A;  1ZK7 A;  3QFB A;  3M0O A;  2YLZ A;  1CF3 A;  4JQ9 A;  3CGE A;  2W0H A;  1E1K A;  3AED A;  4K5R A;  5EB5 A;  2X8H A;  3UKA A;  1JNR A;  2WOW A;  2XYO A;  3G5R A;  3KKJ A;  4IVM B;  1Z6L A;  3P9U A;  2YR4 A;  2R46 A;  2EQ7 A;  5ER0 A;  2ZZ0 A;  1H82 A;  1E1N A;  2YQU A;  1QO8 A;  3UOX A;  4U8L A;  3AEF A;  4YSY A;  1H6V A;  1S3E A;  4JY3 A;  1FOH A;  4C77 A;  5KWF A;  1P2H A;  2WBA A;  3DK9 A;  4KX6 A;  2WPF A;  2V3B A;  3EF6 A;  1LPF A;  2VVL A;  3G5S A;  3GYJ A;  4UDR A;  2QA1 A;  1H81 A;  3P1W A;  1ELI A;  3NK2 X;  2GF3 A;  2Q0K A;  4EQS A;  1ZMC A;  2I0Z A;  3QFA A;  2YWL A;  5IPY A;  3E1T A;  3F8P A;  4B68 A;  5FMH A;  2APG A;  3AYI A;  4BK3 A;  2OLN A;  1LV0 A;  1H7X A;  3CPI G;  2CUL A;  3SFE A;  2C3C A;  2BC1 A;  2XFU A;  3AYJ A;  2PYX A;  3NYE A;  1FL2 A;  2WPE A;  3M13 A;  3M12 A;  4M52 A;  4U8J A;  3ALM A;  5EB4 A;  3NN6 X;  1GPE A;  1TDO A;  1CHU A;  2WOV A;  5HYM A;  1TDE A;  2X8C A;  1B4V A;  4H4Q A;  2GQW A;  1OJC A;  1MXT A;  1SEZ A;  4JNA A;  4GR1 A;  1YQ4 A;  1CC4 A;  4A6N A;  4OVI A;  2GVC A;  4IVO B;  3LB8 A;  4H4X A;  3UCL A;  2GB0 A;  3CPH G;  3RED A;  3CGB A;  4OPC A;  3NT6 A;  3UOY A;  4H2P A;  3UTF A;  4KPR A;  3NH3 X;  4B1B A;  1DNC A;  2DKI A;  4Y4L A;  3NK0 X;  2Q7V A;  5FS7 A;  4A6N B;  4IV9 A;  5TR3 A;  5BRT A;  5U1O A;  4YT0 A;  1MO9 A;  1ZDL A;  3LOV A;  4BV6 A;  3GMC A;  1GRH A;  1O5W A;  4ECH A;  1O94 A;  3AE1 A;  2C72 A;  2Q0L A;  3NLC A;  2A87 A;  2XVE A;  1PJ5 A;  1NHS A;  2PHH A;  4X9M A;  4Y4M A;  3BI2 A;  4PAB A;  4A99 A;  4CCR A;  1F3P A;  2Q6U A;  4EIP A;  3FMW A;  3RP6 A;  3PS9 A;  3UKP A;  3ATQ A;  2FJB A;  4CBQ A;  3AE5 A;  3NHO X;  4CNJ A;  2XLU A;  3GSI A;  3V3N A;  4C3X A;  4B69 A;  3LZW A;  1BKW A;  4GF7 A;  2BC0 A;  3EPT A;  3AD8 B;  1BGN A;  1OJA A;  2WES A;  4YSZ A;  5M10 A;  2BS4 A;  2WDR A;  2AR8 A;  5FS8 A;  2BS2 A;  1DXL A;  1IUW A;  4X9N A;  1VG0 A;  5JCN A;  3ICR A;  3CGD A;  2QAE A;  3K30 A;  1IJH A;  2XLP A;  1ZX9 A;  3S5W A;  1YQ3 A;  1H84 A;  1BZL A;  5KRQ A;  2BA9 A;  3AE3 A;  2XFN A;  2YG4 A;  2C67 A;  2FJE A;  3NKS A;  4H2R A;  3ICT A;  2XVJ A;  3NTD A;  3RHA A;  1PN0 A;  1K4Q A;  1D5T A;  2ARD A; 
#chains in the Genus database with same CATH topology
 3UKQ A;  1UKV G;  5KOX A;  1NG4 A;  4Z25 A;  4YXD A;  2XVI A;  1KF6 A;  1KNP A;  3ITJ A;  4FX9 A;  4O5U A;  2R9Z A;  4EQX A;  3UP4 A;  4NTC A;  2BRY A;  3KA7 A;  3WE0 A;  2C76 A;  2JKC A;  3DJJ A;  1FEC A;  1GTH A;  1EL8 A;  2OA1 A;  3ICS A;  3JSK A;  5CQF A;  3DA1 A;  1KSU A;  5KVH A;  1GRB A;  4UP3 A;  2CDU A;  1D7L A;  5HXI A;  3AD7 B;  2VVL G;  1N4W A;  2YG7 A;  1N4U A;  4J57 A;  3T14 A;  2YLT A;  2YG5 A;  4YSX A;  4U8P A;  1XHC A;  3QJ4 A;  2DKH A;  3CNT A;  1IUU A;  1FEB A;  4H4T A;  4K8D A;  5KVI A;  1NHP A;  1IUT A;  4N9X A;  2C66 A;  3DH9 A;  5C2T A;  1W4X A;  3AE4 A;  3FBS A;  3GYI A;  2BXR A;  3LAD A;  5EOW A;  1EBD A;  5GSN A;  1GRT A;  1LVL A;  4Y4N A;  3GDP A;  3PO7 A;  1S3B A;  1GTE A;  5JCM A;  4DNA A;  2GEW A;  3LJP A;  4B66 A;  4CY6 A;  3DGH A;  3UTE A;  5KOW A;  2JB3 A;  3KPK A;  4E0V A;  4CNK A;  3GD3 A;  3AE2 A;  3KD9 A;  3KLJ A;  2B9W A;  2YLR A;  3AEA A;  1VRQ B;  5LV9 A;  1ZP0 A;  1CBO A;  2IVE A;  2XLR A;  2XLS A;  3IHG A;  4U8O A;  4OPI A;  1JRY A;  4GRT A;  5J7X A;  2R4E A;  3D1C A;  4NTD A;  2R0P A;  4JDR A;  2H89 A;  4GCM A;  5JCL A;  1PBC A;  3H8L A;  3OZ2 A;  4H4Y A;  1CC2 A;  3QSE A;  4RSL A;  2YAU A;  1PJ6 A;  1ZKQ A;  1L9D A;  1YQZ A;  1OJT A;  3AEE A;  3GRS A;  2GMH A;  1M6I A;  4K2X A;  3RP7 A;  3T37 A;  2NVK X;  4CRT A;  1DOE A;  4B64 A;  4ZN0 A;  3COX A;  3AEG A;  4AOS A;  2GRT A;  5U25 A;  1TDF A;  3GYX A;  1PXA A;  5U63 A;  2XFP A;  3QVP A;  4U2L A;  3F8R A;  4IA5 A;  1ZMD A;  3UKL A;  4EMI A;  5L46 A;  1NHR A;  3SZF A;  3AEB A;  4D04 A;  3V3O A;  3KPF A;  1NDA A;  3L1R A;  1M64 A;  1FCD A;  2VOU A;  1L0V A;  3T2Z A;  4GDE A;  3L8K A;  3OC4 A;  3CN8 A;  1YY5 A;  2C65 A;  2GR3 A;  2OAM A;  2C70 A;  1F6M A;  3BNM A;  1TRB A;  3DK4 A;  3G5Q A;  1PS9 A;  2GQF A;  3T2Y A;  1Q9I A;  2V60 A;  1Q1W A;  4OPU A;  4G74 A;  1BGJ A;  4K5S A;  1GER A;  3LXD A;  5HHF A;  1N4V A;  2YLS A;  4RG4 A;  2BK5 A;  4AT2 A;  2JB1 A;  2B7R A;  3CIR A;  4LII A;  5FS6 A;  1BF3 A;  4B65 A;  4J36 A;  3H4K A;  4H2N A;  4BUR A;  2R4J A;  2OLO A;  4Z2R A;  1GT8 A;  1H83 A;  2R0G A;  3NRN A;  4OPD A;  2CFY A;  1LQU A;  2E1M A;  3VRD B;  2XDO A;  4J56 A;  3SXI A;  4YTP A;  1GET A;  2B9Y A;  3GWF A;  1MOK A;  1GSN A;  2WU5 A;  4FK1 A;  4XWR A;  1QJD A;  1TYP A;  2BAC A;  2R0C A;  4Z24 A;  2YG3 A;  3Q9T A;  1KFY A;  4BJZ A;  2RGO A;  2BXS A;  4WCT A;  3VRA A;  3ZYX A;  2XFO A;  1B37 A;  1F8W A;  3ISH A;  3P4R A;  4X4J A;  4J33 A;  1PHH A;  2EQ9 A;  4I59 A;  3SM8 A;  3I6D A;  4APN A;  3NNE A;  2YM1 A;  3QSS A;  1L9C A;  1NHQ A;  1F8S A;  4Z44 A;  3QVR A;  2YVG A;  1K0L A;  3P4P A;  4NNJ A;  1E1M A;  1XPQ A;  3VR8 A;  2RGJ A;  1DJN A;  4NZH A;  2YG6 A;  3CPJ G;  2X99 A;  1H7W A;  2VZ2 A;  4C3Y A;  4FDC B;  2X8G A;  2ACZ A;  4I58 A;  4TM3 A;  3AB1 A;  4H4U A;  1OJ9 A;  1YKJ A;  1KNR A;  3DK8 A;  1JU2 A;  3NG7 X;  1NG3 A;  2RGH A;  3AE8 A;  4AT0 A;  1PBB A;  2H88 A;  4J2W A;  1JEH A;  1LJ1 A;  3C4N A;  3UTG A;  4H50 A;  4YKF A;  3NIX A;  1ZOV A;  3NTA A;  4PAA A;  4P9S A;  2R45 A;  3K7T A;  2YM2 A;  3CTY A;  4H4V A;  2E5V A;  2AAQ A;  1E7P A;  3LZX A;  4LA1 A;  2UZZ A;  4NEW A;  2WP6 A;  1CL0 A;  2BK4 A;  1D4E A;  1L9E A;  1JRX A;  4XXG A;  2BS3 A;  2WDQ A;  1Y0P A;  3ATR A;  2ZZC A;  2V6O A;  3DME A;  4K7Z A;  5FS9 A;  3ALJ A;  4TLZ A;  2XLT A;  3IHM A;  1GV4 A;  4B67 A;  4DSH A;  4A9W A;  4Z43 A;  1GXF A;  3CND A;  3UKH A;  3P4S A;  2XVF A;  5CKU A;  1ONF A;  4TLX A;  1D4C A;  4H4W A;  2QA2 A;  3AD9 B;  4LU6 A;  5C3J A;  3FPZ A;  4OPL A;  3DJG X;  1GRF A;  3SFD A;  1E39 A;  1EL9 A;  3HYV A;  1XAN A;  4OCG A;  3NGC X;  3BNU A;  1FEA A;  1CJC A;  1V59 A;  2GR2 A;  1S2Y A;  2VVM A;  2GR0 A;  3NYF A;  5DBJ A;  1CJ2 A;  3SZ0 A;  1H86 A;  2B9X A;  5M0Z A;  1PDH A;  4AP1 A;  1CC6 A;  1GRG A;  2ZBW A;  3IF9 A;  4JN9 A;  5EBK A;  1PXC A;  5KMQ A;  3UKF A;  1Y56 A;  4U8N A;  4ADW A;  3SQP A;  4ZCD A;  1PJ7 A;  3VR9 A;  2YLX A;  1PBE A;  4FK1 C;  2XFQ A;  1DOC A;  2Z5Y A;  4K22 A;  3URH A;  3CNJ A;  5J60 A;  4H7U A;  2V3A A;  3RNM A;  2BAB A;  3K7M X;  3GWD A;  3II4 A;  1GRA A;  2WU2 A;  3PVC A;  3UTH A;  4YKG A;  3K7Q X;  2WHD A;  2X50 A;  1RP0 A;  4AP3 A;  3VRB A;  3KVE A;  1Y56 B;  1XDI A;  4RG3 A;  1PXB A;  3AWI A;  3C96 A;  2E4G A;  2XVH A;  3V76 A;  2WQY A;  1DOD A;  2X3N A;  1HYU A;  1CJ3 A;  2NPX A;  1CJ4 A;  2A8X A;  4G6H A;  1F8R A;  4UDQ A;  3GDN A;  4B63 A;  4YSH A;  3O0H A;  2BYB A;  4H4P A;  1NEK A;  1EL7 A;  1LQT A;  4BJY A;  4C74 A;  5JCK A;  2Y6Q A;  2YVJ A;  3NK1 X;  1DOB A;  3HZL A;  3UP5 A;  2JK6 A;  3GD4 A;  1AOG A;  3H8I A;  5IQ1 A;  2BCP A;  3AYL A;  4NTE A;  1VG9 A;  4ZCC A;  2WP5 A;  3F8D A;  4JY2 A;  4TM0 A;  4U8K A;  3ZDN A;  1GAL A;  5IQ4 A;  2GAG B;  4G73 A;  3BHF A;  4HB9 A;  4EM4 A;  3AE6 A;  1TYT A;  2GV8 A;  2V5Z A;  3AE7 A;  4C5O A;  3UOV A;  1K0J A;  2B76 A;  3QSM A;  4BK2 A;  4EM3 A;  2V61 A;  3GRT A;  1E6E A;  4JNQ A;  3ADA B;  2J3N A;  3P4Q A;  4YWO A;  1COY A;  2C75 A;  3AEC A;  3UKK A;  5KXJ A;  1IUX A;  1JRZ A;  4USR A;  2BCG G;  1GEU A;  2WPC A;  5GRT A;  4Z26 A;  1ZY8 A;  2WEU A;  4IA6 A;  3FIM B;  1X31 B;  4A5L A;  2A89 A;  1E1L A;  2RAB A;  4DSG A;  1D4D A;  3AXB A;  3SX6 A;  2EQ8 A;  4H2Q A;  2F5Z A;  4OPG A;  1RYI A;  1NAA A;  2JBV A;  4EMW A;  1IUV A;  4H4S A;  2VRM A;  1S2Q A;  3FG2 P;  2YR5 A;  3IWA A;  4J34 A;  4AOX A;  4G9K A;  4MJW A;  5BVA A;  1PBD A;  1BWC A;  4BK1 A;  4Z2T A;  3BHK A;  5KMS A;  4A7A A;  4EQW A;  4ICY A;  1VQW A;  2FJD A;  5KNL A;  2VQB A;  2FJA A;  3KU9 A;  3VQR A;  4GUV A;  5BUK A;  1O95 A;  2C3D A;  3DJD A;  4H4R A;  4A79 A;  3UOZ A;  4XWZ A;  4H4Z A;  1IUS A;  3Q6J A;  2Y6R A;  2VQ7 A;  2AQJ A;  1GES A;  1REO A;  1D7Y A;  4OPT A;  2VRL A;  4UDP A;  2WET A;  4REK A;  3CNS A;  2C64 A;  2TMD A;  1N1P A;  3IC9 A;  2WDV A;  1OJD A;  3CMM A;  2QCU A;  3CGC A;  1B8S A;  3SZC A;  2B7S A;  3SYI A;  2C73 A;  1TDN A;  1GOS A;  5JCI A;  2HQM A;  4CY8 A;  4U8M A;  1KDG A;  2BK3 A;  4YTM A;  4O5Q A;  3B6D A;  3EAN A;  4DGK A;  4CCQ A;  2GH5 A;  3NN0 X;  2IID A;  2YVF A;  3SGL A;  4TM1 A;  4U2T A;  4U8I A;  4II2 A;  1TDK A;  2YLW A;  2Z5X A;  2EQ6 A;  1PBF A;  2FBW A;  4HA6 A;  4NEV A;  3BI5 A;  3ALL A;  4A65 A;  1ZOY A;  4GDP A;  2GR1 A;  4WX1 A;  1JNZ A;  4EIQ A;  1B5Q A;  4U2S A;  1KSS A;  2WOI A;  3I3L A;  3R9U A;  2OAL A;  3C4A A;  5HY5 A;  4Z2U A;  1EL5 A;  1DJQ A;  2YR6 A;  4TM4 A;  3GMB A;  4EQR A;  1P2E A;  4G6G A;  1K0I A;  1QLB A;  1NPX A;  2CVJ A;  3B3R A;  5BUL A;  2C7G A;  4II3 A;  1JOA A;  2O9Z A;  2WP9 A;  3S61 A;  1NEN A;  4GAP A;  4J31 A;  2IVD A;  3BI4 A;  2JAE A;  1Q1R A;  3ABV A;  4NWZ A;  1VDC A;  2GAH B;  3NYC A;  4USQ A;  2JB2 A;  2XCG A;  2WS3 A;  2GMJ A;  3EAO A;  4EMJ A;  1GND A;  1LTX R;  1RSG A;  3DGZ A;  1GRE A;  3CNP A;  3D8X A;  3RP8 A;  3AE9 A;  4YTN A;  2TPR A;  4D03 A;  3DJE A;  2ZZB A;  1ZK7 A;  3QFB A;  3T0K A;  3M0O A;  2YLZ A;  3SY4 A;  1CF3 A;  4JQ9 A;  3CGE A;  2W0H A;  1E1K A;  3AED A;  4K5R A;  5EB5 A;  2X8H A;  3UKA A;  1JNR A;  2WOW A;  2XYO A;  3G5R A;  3KKJ A;  4IVM B;  1Z6L A;  3P9U A;  2YR4 A;  2R46 A;  2EQ7 A;  3T2K A;  5ER0 A;  2ZZ0 A;  1H82 A;  1E1N A;  2YQU A;  1QO8 A;  3UOX A;  4U8L A;  3AEF A;  4YSY A;  1H6V A;  1S3E A;  4JY3 A;  1FOH A;  4C77 A;  5KWF A;  1P2H A;  2WBA A;  3DK9 A;  4KX6 A;  2WPF A;  2V3B A;  3EF6 A;  1LPF A;  2VVL A;  3G5S A;  3GYJ A;  4UDR A;  2QA1 A;  1H81 A;  3P1W A;  1ELI A;  3NK2 X;  2GF3 A;  2BRA A;  2Q0K A;  4EQS A;  1ZMC A;  2I0Z A;  3QFA A;  2YWL A;  5IPY A;  3E1T A;  3F8P A;  4B68 A;  5FMH A;  2APG A;  3AYI A;  3SZW A;  2OLN A;  1LV0 A;  1H7X A;  4BK3 A;  3CPI G;  3T31 A;  2CUL A;  3SFE A;  2C3C A;  2BC1 A;  2XFU A;  3AYJ A;  2PYX A;  3NYE A;  1FL2 A;  2WPE A;  3M13 A;  3M12 A;  4M52 A;  4U8J A;  3ALM A;  5EB4 A;  3NN6 X;  1GPE A;  1TDO A;  1CHU A;  2WOV A;  5HYM A;  4GAV A;  1TDE A;  2X8C A;  1B4V A;  5KMR A;  4H4Q A;  2GQW A;  1OJC A;  1MXT A;  1SEZ A;  5KMP A;  4JNA A;  4GR1 A;  1YQ4 A;  1CC4 A;  4A6N A;  4OVI A;  2GVC A;  4IVO B;  3LB8 A;  4H4X A;  3UCL A;  2GB0 A;  3CPH G;  3RED A;  3CGB A;  4OPC A;  3NT6 A;  3UOY A;  4H2P A;  3UTF A;  4KPR A;  3NH3 X;  4B1B A;  1DNC A;  2DKI A;  4Y4L A;  3NK0 X;  2Q7V A;  5FS7 A;  4A6N B;  4IV9 A;  5TR3 A;  5BRT A;  5U1O A;  4YT0 A;  1MO9 A;  1ZDL A;  3LOV A;  4BV6 A;  3GMC A;  1GRH A;  1O5W A;  4ECH A;  1O94 A;  3AE1 A;  2C72 A;  2Q0L A;  3NLC A;  2A87 A;  2XVE A;  1PJ5 A;  1NHS A;  2PHH A;  3HYW A;  4X9M A;  4Y4M A;  3BI2 A;  4PAB A;  4A99 A;  4CCR A;  1F3P A;  2Q6U A;  4EIP A;  3FMW A;  3RP6 A;  3PS9 A;  3UKP A;  3ATQ A;  2FJB A;  4CBQ A;  3AE5 A;  3NHO X;  4CNJ A;  2XLU A;  3GSI A;  3V3N A;  4C3X A;  4B69 A;  3LZW A;  1BKW A;  4GF7 A;  2BC0 A;  2C4C A;  3EPT A;  3AD8 B;  1BGN A;  1OJA A;  3HYX A;  2WES A;  4YSZ A;  5M10 A;  2BS4 A;  2WDR A;  2AR8 A;  5FS8 A;  2BS2 A;  1DXL A;  1IUW A;  4X9N A;  1VG0 A;  5JCN A;  3ICR A;  3CGD A;  2QAE A;  3K30 A;  1IJH A;  2XLP A;  1ZX9 A;  3S5W A;  1YQ3 A;  1H84 A;  1BZL A;  5KRQ A;  2BA9 A;  3AE3 A;  2XFN A;  2YG4 A;  2C67 A;  2FJE A;  3NKS A;  4H2R A;  3ICT A;  2XVJ A;  3NTD A;  3RHA A;  1PN0 A;  1K4Q A;  1D5T A;  2ARD A; 
#chains in the Genus database with same CATH homology
 3UKQ A;  1UKV G;  5KOX A;  1NG4 A;  4Z25 A;  4YXD A;  2XVI A;  1KF6 A;  1KNP A;  3ITJ A;  4FX9 A;  4O5U A;  2R9Z A;  4EQX A;  3UP4 A;  4NTC A;  2BRY A;  3KA7 A;  3WE0 A;  2C76 A;  2JKC A;  3DJJ A;  1FEC A;  1GTH A;  1EL8 A;  2OA1 A;  3ICS A;  3JSK A;  5CQF A;  3DA1 A;  1KSU A;  5KVH A;  1GRB A;  4UP3 A;  2CDU A;  1D7L A;  5HXI A;  3AD7 B;  2VVL G;  1N4W A;  2YG7 A;  1N4U A;  4J57 A;  3T14 A;  2YLT A;  2YG5 A;  4YSX A;  4U8P A;  1XHC A;  3QJ4 A;  2DKH A;  3CNT A;  1IUU A;  1FEB A;  4H4T A;  4K8D A;  5KVI A;  1NHP A;  1IUT A;  4N9X A;  2C66 A;  3DH9 A;  5C2T A;  1W4X A;  3AE4 A;  3FBS A;  3GYI A;  2BXR A;  3LAD A;  5EOW A;  1EBD A;  5GSN A;  1GRT A;  1LVL A;  4Y4N A;  3GDP A;  3PO7 A;  1S3B A;  1GTE A;  5JCM A;  4DNA A;  2GEW A;  3LJP A;  4B66 A;  4CY6 A;  3DGH A;  3UTE A;  5KOW A;  2JB3 A;  3KPK A;  4E0V A;  4CNK A;  3GD3 A;  3AE2 A;  3KD9 A;  3KLJ A;  2B9W A;  2YLR A;  3AEA A;  1VRQ B;  5LV9 A;  1ZP0 A;  1CBO A;  2IVE A;  2XLR A;  2XLS A;  3IHG A;  4U8O A;  4OPI A;  1JRY A;  4GRT A;  5J7X A;  2R4E A;  3D1C A;  4NTD A;  2R0P A;  4JDR A;  2H89 A;  4GCM A;  5JCL A;  1PBC A;  3H8L A;  3OZ2 A;  4H4Y A;  1CC2 A;  3QSE A;  4RSL A;  2YAU A;  1PJ6 A;  1ZKQ A;  1L9D A;  1YQZ A;  1OJT A;  3AEE A;  3GRS A;  2GMH A;  1M6I A;  4K2X A;  3RP7 A;  3T37 A;  2NVK X;  4CRT A;  1DOE A;  4B64 A;  4ZN0 A;  3COX A;  3AEG A;  4AOS A;  2GRT A;  5U25 A;  1TDF A;  3GYX A;  1PXA A;  5U63 A;  2XFP A;  3QVP A;  4U2L A;  3F8R A;  4IA5 A;  1ZMD A;  3UKL A;  4EMI A;  5L46 A;  1NHR A;  3SZF A;  3AEB A;  4D04 A;  3V3O A;  3KPF A;  1NDA A;  3L1R A;  1M64 A;  1FCD A;  2VOU A;  1L0V A;  3T2Z A;  4GDE A;  3L8K A;  3OC4 A;  3CN8 A;  1YY5 A;  2C65 A;  2GR3 A;  2OAM A;  2C70 A;  1F6M A;  3BNM A;  1TRB A;  3DK4 A;  3G5Q A;  1PS9 A;  2GQF A;  3T2Y A;  1Q9I A;  2V60 A;  1Q1W A;  4OPU A;  4G74 A;  1BGJ A;  4K5S A;  1GER A;  3LXD A;  5HHF A;  1N4V A;  2YLS A;  4RG4 A;  2BK5 A;  4AT2 A;  2JB1 A;  2B7R A;  3CIR A;  4LII A;  5FS6 A;  1BF3 A;  4B65 A;  4J36 A;  3H4K A;  4H2N A;  4BUR A;  2R4J A;  2OLO A;  4Z2R A;  1GT8 A;  1H83 A;  2R0G A;  3NRN A;  4OPD A;  2CFY A;  1LQU A;  2E1M A;  3VRD B;  2XDO A;  4J56 A;  3SXI A;  4YTP A;  1GET A;  2B9Y A;  3GWF A;  1MOK A;  1GSN A;  2WU5 A;  4FK1 A;  4XWR A;  1QJD A;  1TYP A;  2BAC A;  2R0C A;  4Z24 A;  2YG3 A;  3Q9T A;  1KFY A;  4BJZ A;  2RGO A;  2BXS A;  4WCT A;  3VRA A;  3ZYX A;  2XFO A;  1B37 A;  1F8W A;  3ISH A;  3P4R A;  4X4J A;  4J33 A;  1PHH A;  2EQ9 A;  4I59 A;  3SM8 A;  3I6D A;  4APN A;  3NNE A;  2YM1 A;  3QSS A;  1L9C A;  1NHQ A;  1F8S A;  4Z44 A;  3QVR A;  2YVG A;  1K0L A;  3P4P A;  4NNJ A;  1E1M A;  1XPQ A;  3VR8 A;  2RGJ A;  1DJN A;  4NZH A;  2YG6 A;  3CPJ G;  2X99 A;  1H7W A;  2VZ2 A;  4C3Y A;  4FDC B;  2X8G A;  2ACZ A;  4I58 A;  4TM3 A;  3AB1 A;  4H4U A;  1OJ9 A;  1YKJ A;  1KNR A;  3DK8 A;  1JU2 A;  3NG7 X;  1NG3 A;  2RGH A;  3AE8 A;  4AT0 A;  1PBB A;  2H88 A;  4J2W A;  1JEH A;  1LJ1 A;  3C4N A;  3UTG A;  4H50 A;  4YKF A;  3NIX A;  1ZOV A;  3NTA A;  4PAA A;  4P9S A;  2R45 A;  3K7T A;  2YM2 A;  3CTY A;  4H4V A;  2E5V A;  2AAQ A;  1E7P A;  3LZX A;  4LA1 A;  2UZZ A;  4NEW A;  2WP6 A;  1CL0 A;  2BK4 A;  1D4E A;  1L9E A;  1JRX A;  4XXG A;  2BS3 A;  2WDQ A;  1Y0P A;  3ATR A;  2ZZC A;  2V6O A;  3DME A;  4K7Z A;  5FS9 A;  3ALJ A;  4TLZ A;  2XLT A;  3IHM A;  1GV4 A;  4B67 A;  4DSH A;  4A9W A;  4Z43 A;  1GXF A;  3CND A;  3UKH A;  3P4S A;  2XVF A;  5CKU A;  1ONF A;  4TLX A;  1D4C A;  4H4W A;  2QA2 A;  3AD9 B;  4LU6 A;  5C3J A;  3FPZ A;  4OPL A;  3DJG X;  1GRF A;  3SFD A;  1E39 A;  1EL9 A;  3HYV A;  1XAN A;  4OCG A;  3NGC X;  3BNU A;  1FEA A;  1CJC A;  1V59 A;  2GR2 A;  1S2Y A;  2VVM A;  2GR0 A;  3NYF A;  5DBJ A;  1CJ2 A;  3SZ0 A;  1H86 A;  2B9X A;  5M0Z A;  1PDH A;  4AP1 A;  1CC6 A;  1GRG A;  2ZBW A;  3IF9 A;  4JN9 A;  5EBK A;  1PXC A;  5KMQ A;  3UKF A;  1Y56 A;  4U8N A;  4ADW A;  3SQP A;  4ZCD A;  1PJ7 A;  3VR9 A;  2YLX A;  1PBE A;  4FK1 C;  2XFQ A;  1DOC A;  2Z5Y A;  4K22 A;  3URH A;  3CNJ A;  5J60 A;  4H7U A;  2V3A A;  3RNM A;  2BAB A;  3K7M X;  3GWD A;  3II4 A;  1GRA A;  2WU2 A;  3PVC A;  3UTH A;  4YKG A;  3K7Q X;  2WHD A;  2X50 A;  1RP0 A;  4AP3 A;  3VRB A;  3KVE A;  1Y56 B;  1XDI A;  4RG3 A;  1PXB A;  3AWI A;  3C96 A;  2E4G A;  2XVH A;  3V76 A;  2WQY A;  1DOD A;  2X3N A;  1HYU A;  1CJ3 A;  2NPX A;  1CJ4 A;  2A8X A;  4G6H A;  1F8R A;  4UDQ A;  3GDN A;  4B63 A;  4YSH A;  3O0H A;  2BYB A;  4H4P A;  1NEK A;  1EL7 A;  1LQT A;  4BJY A;  4C74 A;  5JCK A;  2Y6Q A;  2YVJ A;  3NK1 X;  1DOB A;  3HZL A;  3UP5 A;  2JK6 A;  3GD4 A;  1AOG A;  3H8I A;  5IQ1 A;  2BCP A;  3AYL A;  4NTE A;  1VG9 A;  4ZCC A;  2WP5 A;  3F8D A;  4JY2 A;  4TM0 A;  4U8K A;  3ZDN A;  1GAL A;  5IQ4 A;  2GAG B;  4G73 A;  3BHF A;  4HB9 A;  4EM4 A;  3AE6 A;  1TYT A;  2GV8 A;  2V5Z A;  3AE7 A;  4C5O A;  3UOV A;  1K0J A;  2B76 A;  3QSM A;  4BK2 A;  4EM3 A;  2V61 A;  3GRT A;  1E6E A;  4JNQ A;  3ADA B;  2J3N A;  3P4Q A;  4YWO A;  1COY A;  2C75 A;  3AEC A;  3UKK A;  5KXJ A;  1IUX A;  1JRZ A;  4USR A;  2BCG G;  1GEU A;  2WPC A;  5GRT A;  4Z26 A;  1ZY8 A;  2WEU A;  4IA6 A;  3FIM B;  1X31 B;  4A5L A;  2A89 A;  1E1L A;  2RAB A;  4DSG A;  1D4D A;  3AXB A;  3SX6 A;  2EQ8 A;  4H2Q A;  2F5Z A;  4OPG A;  1RYI A;  1NAA A;  2JBV A;  4EMW A;  1IUV A;  4H4S A;  2VRM A;  1S2Q A;  3FG2 P;  2YR5 A;  3IWA A;  4J34 A;  4AOX A;  4G9K A;  4MJW A;  5BVA A;  1PBD A;  1BWC A;  4BK1 A;  4Z2T A;  3BHK A;  5KMS A;  4A7A A;  4EQW A;  4ICY A;  1VQW A;  2FJD A;  5KNL A;  2VQB A;  2FJA A;  3KU9 A;  3VQR A;  4GUV A;  5BUK A;  1O95 A;  2C3D A;  3DJD A;  4H4R A;  4A79 A;  3UOZ A;  4XWZ A;  4H4Z A;  1IUS A;  3Q6J A;  2Y6R A;  2VQ7 A;  2AQJ A;  1GES A;  1REO A;  1D7Y A;  4OPT A;  2VRL A;  4UDP A;  2WET A;  4REK A;  3CNS A;  2C64 A;  2TMD A;  1N1P A;  3IC9 A;  2WDV A;  1OJD A;  3CMM A;  2QCU A;  3CGC A;  1B8S A;  3SZC A;  2B7S A;  3SYI A;  2C73 A;  1TDN A;  1GOS A;  5JCI A;  2HQM A;  4CY8 A;  4U8M A;  1KDG A;  2BK3 A;  4YTM A;  4O5Q A;  3B6D A;  3EAN A;  4DGK A;  4CCQ A;  2GH5 A;  3NN0 X;  2IID A;  2YVF A;  3SGL A;  4TM1 A;  4U2T A;  4U8I A;  4II2 A;  1TDK A;  2YLW A;  2Z5X A;  2EQ6 A;  1PBF A;  2FBW A;  4HA6 A;  4NEV A;  3BI5 A;  3ALL A;  4A65 A;  1ZOY A;  4GDP A;  2GR1 A;  4WX1 A;  1JNZ A;  4EIQ A;  1B5Q A;  4U2S A;  1KSS A;  2WOI A;  3I3L A;  3R9U A;  2OAL A;  3C4A A;  5HY5 A;  4Z2U A;  1EL5 A;  1DJQ A;  2YR6 A;  4TM4 A;  3GMB A;  4EQR A;  1P2E A;  4G6G A;  1K0I A;  1QLB A;  1NPX A;  2CVJ A;  3B3R A;  5BUL A;  2C7G A;  4II3 A;  1JOA A;  2O9Z A;  2WP9 A;  3S61 A;  1NEN A;  4GAP A;  4J31 A;  2IVD A;  3BI4 A;  2JAE A;  1Q1R A;  3ABV A;  4NWZ A;  1VDC A;  2GAH B;  3NYC A;  4USQ A;  2JB2 A;  2XCG A;  2WS3 A;  2GMJ A;  3EAO A;  4EMJ A;  1GND A;  1LTX R;  1RSG A;  3DGZ A;  1GRE A;  3CNP A;  3D8X A;  3RP8 A;  3AE9 A;  4YTN A;  2TPR A;  4D03 A;  3DJE A;  2ZZB A;  1ZK7 A;  3QFB A;  3T0K A;  3M0O A;  2YLZ A;  3SY4 A;  1CF3 A;  4JQ9 A;  3CGE A;  2W0H A;  1E1K A;  3AED A;  4K5R A;  5EB5 A;  2X8H A;  3UKA A;  1JNR A;  2WOW A;  2XYO A;  3G5R A;  3KKJ A;  4IVM B;  1Z6L A;  3P9U A;  2YR4 A;  2R46 A;  2EQ7 A;  3T2K A;  5ER0 A;  2ZZ0 A;  1H82 A;  1E1N A;  2YQU A;  1QO8 A;  3UOX A;  4U8L A;  3AEF A;  4YSY A;  1H6V A;  1S3E A;  4JY3 A;  1FOH A;  4C77 A;  5KWF A;  1P2H A;  2WBA A;  3DK9 A;  4KX6 A;  2WPF A;  2V3B A;  3EF6 A;  1LPF A;  2VVL A;  3G5S A;  3GYJ A;  4UDR A;  2QA1 A;  1H81 A;  3P1W A;  1ELI A;  3NK2 X;  2GF3 A;  2BRA A;  2Q0K A;  4EQS A;  1ZMC A;  2I0Z A;  3QFA A;  2YWL A;  5IPY A;  3E1T A;  3F8P A;  4B68 A;  5FMH A;  2APG A;  3AYI A;  3SZW A;  2OLN A;  1LV0 A;  1H7X A;  4BK3 A;  3CPI G;  3T31 A;  2CUL A;  3SFE A;  2C3C A;  2BC1 A;  2XFU A;  3AYJ A;  2PYX A;  3NYE A;  1FL2 A;  2WPE A;  3M13 A;  3M12 A;  4M52 A;  4U8J A;  3ALM A;  5EB4 A;  3NN6 X;  1GPE A;  1TDO A;  1CHU A;  2WOV A;  5HYM A;  4GAV A;  1TDE A;  2X8C A;  1B4V A;  5KMR A;  4H4Q A;  2GQW A;  1OJC A;  1MXT A;  1SEZ A;  5KMP A;  4JNA A;  4GR1 A;  1YQ4 A;  1CC4 A;  4A6N A;  4OVI A;  2GVC A;  4IVO B;  3LB8 A;  4H4X A;  3UCL A;  2GB0 A;  3CPH G;  3RED A;  3CGB A;  4OPC A;  3NT6 A;  3UOY A;  4H2P A;  3UTF A;  4KPR A;  3NH3 X;  4B1B A;  1DNC A;  2DKI A;  4Y4L A;  3NK0 X;  2Q7V A;  5FS7 A;  4A6N B;  4IV9 A;  5TR3 A;  5BRT A;  5U1O A;  4YT0 A;  1MO9 A;  1ZDL A;  3LOV A;  4BV6 A;  3GMC A;  1GRH A;  1O5W A;  4ECH A;  1O94 A;  3AE1 A;  2C72 A;  2Q0L A;  3NLC A;  2A87 A;  2XVE A;  1PJ5 A;  1NHS A;  2PHH A;  3HYW A;  4X9M A;  4Y4M A;  3BI2 A;  4PAB A;  4A99 A;  4CCR A;  1F3P A;  2Q6U A;  4EIP A;  3FMW A;  3RP6 A;  3PS9 A;  3UKP A;  3ATQ A;  2FJB A;  4CBQ A;  3AE5 A;  3NHO X;  4CNJ A;  2XLU A;  3GSI A;  3V3N A;  4C3X A;  4B69 A;  3LZW A;  1BKW A;  4GF7 A;  2BC0 A;  2C4C A;  3EPT A;  3AD8 B;  1BGN A;  1OJA A;  3HYX A;  2WES A;  4YSZ A;  5M10 A;  2BS4 A;  2WDR A;  2AR8 A;  5FS8 A;  2BS2 A;  1DXL A;  1IUW A;  4X9N A;  1VG0 A;  5JCN A;  3ICR A;  3CGD A;  2QAE A;  3K30 A;  1IJH A;  2XLP A;  1ZX9 A;  3S5W A;  1YQ3 A;  1H84 A;  1BZL A;  5KRQ A;  2BA9 A;  3AE3 A;  2XFN A;  2YG4 A;  2C67 A;  2FJE A;  3NKS A;  4H2R A;  3ICT A;  2XVJ A;  3NTD A;  3RHA A;  1PN0 A;  1K4Q A;  1D5T A;  2ARD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...