3ALMA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMAPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3almA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3almA01
3CNTA 5EB5A 4FX9A 4A79A 2VRLA 2YQUA 3KPFA 4EQRA 4H4VA 3EANA 4NTCA 2WDRA 5BULA 1KNRA 2YR4A 3NGCX 5KWFA 4H4UA 1B4VA 2Z5YA 3P4RA 5KRQA 3F8RA 4U2TA 1E7PA 1ZY8A 4CCRA 1N4WA 4TM3A 5U63A 1CC2A 4Z2RA 1GRFA 1E1NA 1IUSA 1CC4A 1H86A 3D8XA 2WHDA 3KD9A 5HXIA 3Q9TA 2RGOA 3GYJA 2FBWA 1BGJA 2YG4A 1JRXA 1GT8A 1XDIA 3K7MX 5FMHA 3RP7A 4LA1A 4U8PA 2YLSA 3UKPA 2Y6QA 1MOKA 1N4VA 4OPIA 1D7LA 1CJCA 2QCUA 3KLJA 3OC4A 1JNRA 3CPJG 2XFUA 3AEBA 3CGDA 5KOWA 1P2EA 2WS3A 2WOIA 3NK2X 4BJZA 2C3DA 3RHAA 3DJJA 3NKSA 2EQ7A 1DOEA 1GREA 1DOBA 3L1RA 4H4QA 4XWZA 2IIDA 2WPCA 3CNSA 1XANA 1PJ6A 1CL0A 1YY5A 4YSXA 4YSYA 2GQFA 1IJHA 2GV8A 3UTGA 1ZX9A 3H8LA 1GRGA 3AD7B 4ADWA 2AR8A 1W4XA 1COYA 1JOAA 4REKA 4I58A 3II4A 2C72A 3BNMA 1MXTA 3ICRA 3SQPA 3M0OA 1D4CA 3AEEA 1RSGA 2IVEA 3V3NA 4GDEA 2YLXA 2XVIA 1JRYA 4B69A 5FS6A 4RG4A 3UOXA 4K7ZA 3LB8A 4EMWA 2BK5A 1ELIA 3AECA 4E0VA 3KVEA 3NNEA 2R4JA 3AD8B 1PXAA 3NG7X 3CGCA 1KF6A 3AD9B 3DJEA 1LQTA 1Y56B 1H7WA 2ARDA 4USRA 4U8MA 3NYFA 1QJDA 4CNKA 2XVFA 2AAQA 2YLWA 2UZZA 5J7XA 4H4RA 1OJDA 1VQWA 3I6DA 1M6IA 1GTEA 1TDKA 3AEAA 1BKWA 1CJ4A 4B68A 3K7TA 4BK1A 1JU2A 3DJGX 1X31B 3AEFA 2V6OA 2F5ZA 1K0LA 3IHMA 1E1KA 3QSSA 4IV9A 4UDRA 2C7GA 4X9MA 5FS7A 1YKJA 1KFYA 1B8SA 1VDCA 4Z26A 5LV9A 5CKUA 3IC9A 4UP3A 3C96A 4D03A 1ZMDA 3NT6A 2V61A 2R9ZA 5JCLA 3B6DA 3BHFA 3K7QX 3P4SA 2WU2A 4K2XA 5IQ4A 1REOA 1GNDA 4TM0A 2Q0KA 5BVAA 4D04A 1L9DA 2DKIA 3PVCA 2YVFA 2XVEA 3UCLA 3LZWA 3AE5A 2W0HA 3GD4A 2GH5A 4J33A 4OCGA 3GMCA 1PS9A 2OLOA 3S61A 1GRBA 3AYJA 4HB9A 2BXRA 2EQ8A 3LXDA 3C4AA 4JN9A 3SFEA 3UOYA 2J3NA 4DSHA 1ZP0A 2OLNA 4OPTA 4B66A 5HYMA 1YQZA 4KX6A 4N9XA 4Z43A 3PO7A 2R0CA 3UTEA 4C74A 2X8GA 1PXBA 4H2RA 3CTYA 3UKFA 2WP9A 2YR5A 2APGA 1H81A 3QFAA 3HZLA 4XWRA 1F3PA 4H4ZA 1XPQA 1QO8A 1NHQA 4Z25A 3FIMB 4C5OA 4OPLA 1YQ4A 3C4NA 1FECA 2BACA 4YKFA 1VG9A 4RSLA 4A6NA 3QVRA 3NN0X 1PJ5A 1NAAA 3BI4A 1NG3A 3P4PA 4H4WA 4Y4MA 2YG6A 1XHCA 4J34A 2WP6A 2EQ9A 2WDVA 4NTDA 1ZOYA 4EIPA 2YG3A 2ACZA 2ZZCA 1H7XA 1Z6LA 5EOWA 4K5RA 3ZYXA 1E6EA 2GB0A 3AEGA 3P1WA 3GMBA 1FL2A 1ZOVA 3QVPA 1LQUA 2C3CA 4NTEA 1YQ3A 3GWDA 4A5LA 2R4EA 1M64A 3P9UA 4O5QA 5HHFA 1EBDA 2YG5A 1CHUA 1UKVG 1F8RA 3G5QA 2R0PA 3GDPA 1FEBA 2YAUA 3NYEA 1LPFA 4FDCB 3RP8A 1S2QA 2YM1A 4YTPA 2X99A 1QLBA 3BHKA 3UKKA 2YM2A 2BA9A 4HA6A 4IA6A 4JDRA 1AOGA 4U8KA 5KVIA 1Q1WA 2WDQA 1CBOA 1H83A 1TDOA 3GD3A 4A7AA 4K22A 2AQJA 3CGEA 2YVJA 1Q9IA 1NPXA 3BI5A 2GRTA 4IA5A 1K0IA 4CCQA 4JY3A 3NYCA 5KOXA 2GAHB 1E39A 1IUVA 3PS9A 1FEAA 2PHHA 4FK1C 4TM4A 4H4PA 2XCGA 3F8PA 2YLTA 3DMEA 4ICYA 1GESA 2XFOA 4J57A 2YLZA 2BC0A 3AE8A 3EF6A 4AT0A 1GRAA 4Z2UA 4A65A 1OJAA 1DJNA 3ADAB 1D5TA 3BNUA 1VRQB 5EB4A 5HY5A 1VG0A 1EL7A 4BV6A 1GRHA 4WX1A 5CQFA 3UKAA 4U2SA 3Q6JA 2FJAA 3SM8A 2XLPA 3VR9A 5U1OA 3FMWA 1OJTA 3ICSA 2WETA 4OPCA 3NTAA 4PAAA 1LTXR 2XLSA 1KSSA 2Y6RA 3BI2A 4U8LA 1D7YA 1GRTA 1H6VA 2V3BA 4GDPA 3AEDA 2OALA 4H7UA 3SFDA 4DGKA 2E1MA 1H82A 1EL8A 2E4GA 3QSEA 4J31A 4CNJA 5C3JA 2E5VA 4RG3A 3CPIG 1K4QA 4NEVA 3CN8A 2B9YA 2HQMA 1BF3A 3RP6A 1NDAA 2TPRA 3F8DA 4H4YA 3AB1A 4H2QA 1B37A 1NG4A 2FJEA 3JSKA 4YSZA 1KDGA 1PXCA 3COXA 2C66A 1E1MA 2VVLA 1OJ9A 3AE9A 4J36A 2VVLG 1TDFA 3ISHA 4YSHA 4X9NA 1PHHA 1PBFA 3GYIA 4CY8A 3DK8A 3DGZA 2NPXA 2C70A 2GMJA 1N4UA 3UTFA 2GR0A 2RGHA 1Y56A 2QA2A 4GRTA 2QA1A 4YTMA 2NVKX 2BK4A 5KVHA 4AOSA 3CNDA 4JY2A 2BS3A 5JCKA 3NH3X 4YTNA 4U2LA 1P2HA 2RABA 4EQXA 3AYLA 2GMHA 2A87A 3AE2A 3T37A 1LV0A 1O94A 3AE3A 2VRMA 1PBEA 3CGBA 2Z5XA 4O5UA 1CC6A 1Y0PA 3AE7A 1NEKA 1EL9A 4U8NA 1S3EA 2BCPA 3I3LA 4M52A 3ICTA 4U8IA 2Q0LA 5KXJA 2BS2A 4Y4NA 2WU5A 1EL5A 2YG7A 3EAOA 5JCIA 3RNMA 2A89A 3LJPA 3ATRA 4H2NA 4LU6A 2CFYA 2BABA 4ZCDA 4B67A 3M13A 4JQ9A 3GRSA 3CNJA 4OPDA 2V3AA 3LZXA 5IQ1A 3AYIA 4YKGA 1BGNA 1JEHA 2H88A 1GSNA 3UOZA 3VR8A 4C3YA 3DK4A 4K8DA 3WE0A 4GUVA 2VVMA 3UKQA 1PDHA 1OJCA 4EM4A 2VOUA 2XFPA 2WQYA 4OPGA 2XYOA 3LADA 3NN6X 3QSMA 2X3NA 1JNZA 3K30A 2OAMA 4OVIA 5DBJA 4YWOA 2C73A 2XFQA 5C2TA 1MO9A 4EQWA 1TDEA 2YR6A 2GR3A 1IUXA 2C65A 2GR2A 2JB1A 2GF3A 5GRTA 2R46A 1PBDA 2OA1A 1D4EA 3FPZA 2CDUA 1DXLA 4CBQA 2B7RA 2B7SA 1ZKQA 2BC1A 3QFBA 3NK1X 3H4KA 1KNPA 4H4SA 3UKHA 2TMDA 1RP0A 3AE6A 1GPEA 3QJ4A 2H89A 2V5ZA 3R9UA 1F6MA 2JKCA 3AE4A 3NK0X 4AP3A 4MJWA 4B1BA 1BWCA 1H84A 1GEUA 2FJDA 3KU9A 5L46A 4DNAA 2WOVA 2ZZ0A 1GTHA 3P4QA 4JNQA 1HYUA 3ALMA 2WPFA 3KA7A 3UOVA 1LVLA 4GR1A 3URHA 3ZDNA 4WCTA 2CULA 5JCMA 1IUWA 3UKLA 4GCMA 2BXSA 2FJBA 4TLZA 4BK2A 3DH9A 4Z24A 2R45A 2XLTA 3EPTA 4C77A 3IWAA 4J56A 2XFNA 1DOCA 4PABA 2WPEA 1NHSA 3CIRA 1GXFA 4EM3A 3ALLA 1SEZA 4USQA 3ABVA 3ITJA 4H50A 4LIIA 2VQBA 3GRTA 2GAGB 2DKHA 1CF3A 2WESA 3B3RA 2X8CA 4KPRA 1DODA 2XLUA 3NTDA 2JK6A 4BJYA 4H4TA 5BUKA 3G5RA 3NLCA 1GETA 4J2WA 1GERA 1PJ7A 2B9WA 1O95A 3FG2P 3UP4A 1KSUA 4YXDA 4ZN0A 5JCNA 2WP5A 4CY6A 4TM1A 2YLRA 2C75A 2R0GA 2GVCA 2WEUA 3D1CA 3O0HA 3SGLA 4AT2A 1LJ1A 3M12A 4H2PA 1K0JA 5FS9A 3IF9A 2GQWA 4Z44A 1DJQA 2Q6UA 3CPHG 4B63A 4BURA 2BCGG 5J60A 1B5QA 3ALJA 3S5WA 1GOSA 4C3XA 2CVJA 4UDQA 2JAEA 3UP5A 2C76A 2QAEA 1F8SA 1ONFA 3VRAA 5M0ZA 4TLXA 1ZDLA 4EMIA 5BRTA 2EQ6A 4X4JA 3AE1A 2C64A 3E1TA 3GWFA 4EQSA 1O5WA 4B64A 4A9WA 2ZBWA 4AOXA 2XLRA 3OZ2A 1GV4A 3L8KA 1L9CA 3DK9A 4APNA 4EMJA 5ER0A 1E1LA 1V59A 2O9ZA 2YWLA 4NEWA 4A99A 4AP1A 3AXBA 5FS8A 2B9XA 5U25A 5GSNA 2IVDA 1TYTA 2JBVA 4B65A 3ATQA 2C67A 1TDNA 2Q7VA 2VZ2A 2X50A 1DNCA 4U8OA 4P9SA 4GF7A 3CNPA 2GEWA 5IPYA 3DJDA 4XXGA 4YT0A 3UTHA 1GALA 1NENA 2WBAA 2VQ7A 1IUTA 1PN0A 3GSIA 4A6NB 4BK3A 4H4XA 2GR1A 2YVGA 4Z2TA 2BK3A 4IVMB 2V60A 2PYXA 1FCDA 2X8HA 4JNAA 2XVHA 1PBCA 3VRDB 4CRTA 1CJ3A 4OPUA 2JB2A 4EIQA 2I0ZA 4ECHA 3IHGA 1S2YA 2WOWA 3REDA 1TRBA 1D4DA 3G5SA 2BS4A 1PBBA 2XDOA 3DA1A 4NZHA 1CJ2A 2A8XA 2XVJA 1JRZA 1N1PA 3DGHA 3LOVA 1S3BA 4U8JA 4UDPA 3VQRA 3H8IA 3V3OA 3AWIA 4DSGA 3GDNA 3FBSA 1RYIA 2BYBA 3NIXA 5EBKA 1ZMCA 2ZZBA 4I59A 4K5SA 1F8WA 1ZK7A 4FK1A 1L9EA 5M10A 1IUUA 2B76A 1FOHA 1L0VA 3V76A 3NRNA 2RGJA 4IVOB 5TR3A 3VRBA 3NHOX 1NHPA 4ZCCA 2JB3A 4Y4LA 3KKJA 1NHRA 1BZLA 1Q1RA 1TYPA
chains in the Genus database with same CATH superfamily
3CNTA 5EB5A 4FX9A 4A79A 2VRLA 2YQUA 3KPFA 4EQRA 4H4VA 1EVIA 3EANA 4NTCA 2WDRA 5BULA 1KNRA 2YR4A 3NGCX 3ZNOA 5KWFA 4H4UA 1B4VA 2Z5YA 3P4RA 5KRQA 3F8RA 4U2TA 1E7PA 1ZY8A 4CCRA 1N4WA 4TM3A 5U63A 1CC2A 4Z2RA 1GRFA 1E1NA 1IUSA 1CC4A 1H86A 3D8XA 2WHDA 3KD9A 5HXIA 3Q9TA 2RGOA 3GYJA 2FBWA 1BGJA 2YG4A 1JRXA 1GT8A 1XDIA 3K7MX 3RP7A 5FMHA 4LA1A 4U8PA 2YLSA 3UKPA 2Y6QA 1MOKA 1N4VA 4OPIA 1D7LA 2QCUA 1CJCA 3KLJA 3OC4A 3WGTA 1JNRA 2XFUA 3CPJG 3AEBA 3CGDA 5KOWA 3T31A 1P2EA 2WS3A 2WOIA 4BJZA 3NK2X 2C3DA 3RHAA 3DJJA 3NKSA 2EQ7A 1DOEA 1GREA 1DOBA 4XWZA 3L1RA 4H4QA 2IIDA 2WPCA 3CNSA 1XANA 1PJ6A 1CL0A 1YY5A 4YSXA 4YSYA 2GQFA 1IJHA 2GV8A 3UTGA 1ZX9A 3H8LA 3AD7B 1GRGA 4ADWA 2AR8A 1W4XA 1COYA 1JOAA 4REKA 4I58A 3II4A 2C72A 3BNMA 1MXTA 3ICRA 3SQPA 3M0OA 1D4CA 3AEEA 1RSGA 3W4IA 2IVEA 3V3NA 4GDEA 2YLXA 2XVIA 1JRYA 4B69A 5FS6A 4RG4A 3UOXA 4K7ZA 3LB8A 4EMWA 2BK5A 1ELIA 3AECA 4E0VA 3KVEA 3NNEA 2R4JA 3AD8B 1PXAA 4G6GA 3NG7X 3DJEA 3AD9B 1KF6A 3CGCA 4NWZA 1LQTA 1Y56B 1H7WA 2ARDA 4USRA 4U8MA 3NYFA 1QJDA 4CNKA 2XVFA 2E82A 2AAQA 2YLWA 2UZZA 5J7XA 4H4RA 1OJDA 1VQWA 3I6DA 2DU8A 1M6IA 1GTEA 1TDKA 3AEAA 1BKWA 1CJ4A 4BK1A 3K7TA 4B68A 1JU2A 1DAOA 3DJGX 4NNJA 1C0KA 1X31B 3AEFA 3SXIA 1C0IA 2V6OA 3T2YA 2F5ZA 1K0LA 3IHMA 1E1KA 3QSSA 4IV9A 4UDRA 4X9MA 2C7GA 5FS7A 1YKJA 1KFYA 1B8SA 1VDCA 4Z26A 5LV9A 5CKUA 3IC9A 4UP3A 3C96A 4D03A 1ZMDA 3NT6A 2V61A 2R9ZA 5JCLA 3B6DA 4YJHA 3BHFA 3K7QX 3P4SA 2WU2A 4K2XA 5IQ4A 1REOA 1GNDA 4TM0A 2Q0KA 5BVAA 4D04A 1L9DA 5KMPA 2DKIA 3PVCA 2YVFA 2XVEA 3UCLA 3LZWA 3AE5A 2W0HA 3GD4A 2GH5A 4J33A 4OCGA 2OLOA 3GMCA 1PS9A 3S61A 1GRBA 3AYJA 4HB9A 2BXRA 2EQ8A 3LXDA 3C4AA 4JN9A 3SFEA 3UOYA 2J3NA 4DSHA 1ZP0A 2OLNA 5HYMA 4OPTA 4B66A 1YQZA 4KX6A 4N9XA 4Z43A 3PO7A 2R0CA 3CMMA 3UTEA 4C74A 2E48A 2X8GA 1PXBA 4H2RA 3CTYA 3UKFA 2WP9A 2YR5A 2APGA 1H81A 3QFAA 3HZLA 4XWRA 1F3PA 4H4ZA 1XPQA 1QO8A 1NHQA 4Z25A 3FIMB 4C5OA 4OPLA 1YQ4A 3C4NA 1FECA 2BACA 4G6HA 4YKFA 1VG9A 4RSLA 4A6NA 3QVRA 3NN0X 1PJ5A 1NAAA 3BI4A 1NG3A 3P4PA 4H4WA 4Y4MA 2YG6A 1XHCA 4J34A 2WP6A 2EQ9A 2WDVA 4NTDA 1ZOYA 4EIPA 2YG3A 2ACZA 2ZZCA 1H7XA 1Z6LA 5EOWA 4K5RA 3ZYXA 2GB0A 1E6EA 3AEGA 3P1WA 1ZOVA 3GMBA 1FL2A 3QVPA 1LQUA 2C3CA 4NTEA 1YQ3A 3GWDA 4A5LA 2R4EA 1M64A 3P9UA 4O5QA 5HHFA 1EBDA 3ZNNA 2YG5A 1CHUA 1UKVG 1F8RA 2BRYA 3G5QA 2R0PA 3GDPA 3NYEA 1FEBA 2YAUA 1LPFA 4FDCB 3RP8A 1S2QA 2YM1A 1KIFA 4YTPA 2X99A 1QLBA 3BHKA 3UKKA 4IA6A 2BA9A 2YM2A 4HA6A 4JDRA 1AOGA 4U8KA 5KVIA 1Q1WA 2WDQA 1CBOA 1H83A 1TDOA 3GD3A 4A7AA 3ZNQA 4K22A 2AQJA 3CGEA 2YVJA 1Q9IA 1NPXA 5KMQA 3BI5A 2GRTA 4IA5A 1K0IA 4CCQA 4JY3A 3NYCA 5KOXA 2GAHB 3W4KA 1IUVA 1E39A 3PS9A 1FEAA 2PHHA 4FK1C 4TM4A 4H4PA 2XCGA 3F8PA 2YLTA 3DMEA 4ICYA 1GESA 2XFOA 4J57A 2YLZA 2BC0A 3AE8A 3EF6A 4AT0A 1GRAA 4Z2UA 4A65A 4II2A 1OJAA 1DJNA 3ADAB 1D5TA 3BNUA 1VRQB 5EB4A 5HY5A 1VG0A 1EL7A 4BV6A 1GRHA 4WX1A 5CQFA 3UKAA 4U2SA 3SM8A 2FJAA 3Q6JA 2XLPA 3VR9A 5U1OA 3FMWA 1OJTA 3ICSA 2WETA 4PAAA 3NTAA 4OPCA 1LTXR 2XLSA 5KNLA 1KSSA 2Y6RA 3BI2A 4U8LA 1D7YA 1GRTA 1H6VA 2V3BA 4GDPA 3AEDA 2OALA 4H7UA 3SFDA 2E49A 2E1MA 4DGKA 1H82A 1EL8A 2E4GA 3QSEA 4J31A 4CNJA 5C3JA 2E5VA 4RG3A 3CPIG 1K4QA 4NEVA 3CN8A 2B9YA 2HQMA 3ZNPA 1BF3A 3RP6A 1NDAA 2TPRA 3F8DA 4G74A 4H4YA 3AB1A 4H2QA 1B37A 1NG4A 4YJGA 2FJEA 3JSKA 1PXCA 1KDGA 4YSZA 3G3EA 3COXA 2C66A 1E1MA 2VVLA 1OJ9A 4GAPA 3AE9A 4J36A 4YJHB 2VVLG 4YSHA 1TDFA 3ISHA 3CUKA 4X9NA 1PHHA 1PBFA 3GYIA 4CY8A 3DK8A 3DGZA 1DDOA 2NPXA 2C70A 2GMJA 1N4UA 3UTFA 2GR0A 2RGHA 1Y56A 2QA2A 4GRTA 2QA1A 4YTMA 4II3A 2NVKX 2BK4A 3KPKA 4AOSA 3CNDA 4JY2A 5KVHA 2BS3A 5JCKA 4QFDA 3NH3X 4YTNA 4U2LA 1P2HA 2RABA 4EQXA 1C0PA 3AYLA 2GMHA 2A87A 3AE2A 3T2KA 1LV0A 1O94A 3AE3A 3T37A 2VRMA 1PBEA 3CGBA 2Z5XA 4O5UA 1CC6A 1Y0PA 3AE7A 1NEKA 1EL9A 3T14A 4U8NA 1S3EA 2BCPA 3I3LA 4M52A 3ICTA 4U8IA 2Q0LA 4G73A 5KXJA 2BS2A 4Y4NA 2WU5A 1EL5A 2YG7A 3EAOA 5JCIA 3RNMA 2A89A 3LJPA 3ATRA 4H2NA 4LU6A 2CFYA 2BABA 4ZCDA 4B67A 3M13A 4JQ9A 3GRSA 3CNJA 4OPDA 2V3AA 3LZXA 5IQ1A 3AYIA 4YJFA 4YKGA 1BGNA 1JEHA 2H88A 1GSNA 3UOZA 3VR8A 3SZCA 4C3YA 3DK4A 4K8DA 3WE0A 4GUVA 2VVMA 3UKQA 1PDHA 4QFCA 1OJCA 4EM4A 2VOUA 2XFPA 2WQYA 4OPGA 2XYOA 3LADA 3NN6X 3QSMA 2X3NA 1JNZA 3K30A 2OAMA 4OVIA 5DBJA 4YWOA 3T0KA 2C73A 2XFQA 3T2ZA 5C2TA 1MO9A 4EQWA 1TDEA 2YR6A 2GR3A 1IUXA 2C65A 2GR2A 2JB1A 2GF3A 3W4JA 5GRTA 2R46A 1PBDA 2OA1A 1D4EA 3FPZA 2CDUA 1DXLA 4CBQA 2B7RA 2B7SA 1ZKQA 2BC1A 3QFBA 3NK1X 3H4KA 1KNPA 4H4SA 3UKHA 2TMDA 1RP0A 3AE6A 1GPEA 3QJ4A 2H89A 2V5ZA 3R9UA 1F6MA 5KMSA 2JKCA 3AE4A 3NK0X 4AP3A 4MJWA 4B1BA 1BWCA 1H84A 1GEUA 2FJDA 5KMRA 3KU9A 5L46A 4DNAA 2WOVA 2ZZ0A 1GTHA 3P4QA 4JNQA 1HYUA 3ALMA 1AN9A 2WPFA 3KA7A 3UOVA 1LVLA 4GR1A 3URHA 3ZDNA 4WCTA 1VE9A 2CULA 5JCMA 1IUWA 3UKLA 4GCMA 2BXSA 2FJBA 4TLZA 2BRAA 3HYWA 4BK2A 3DH9A 4Z24A 2R45A 2XLTA 3EPTA 3GYXA 4C77A 3IWAA 4J56A 2XFNA 1DOCA 4PABA 2WPEA 1NHSA 3CIRA 1GXFA 4EM3A 3ALLA 1SEZA 4USQA 3ABVA 3ITJA 4H50A 4LIIA 2VQBA 3GRTA 2GAGB 2DKHA 1CF3A 2WESA 3B3RA 3SYIA 2X8CA 4KPRA 1DODA 2XLUA 4BJYA 2JK6A 3NTDA 4H4TA 5BUKA 3G5RA 3NLCA 1GETA 4J2WA 1GERA 1PJ7A 2B9WA 1O95A 3FG2P 3UP4A 1KSUA 4YXDA 4ZN0A 5JCNA 2WP5A 4CY6A 4TM1A 2YLRA 2C75A 2R0GA 3SGLA 2GVCA 2WEUA 3D1CA 4YJGB 3HYXA 3O0HA 4AT2A 1LJ1A 3M12A 4H2PA 1K0JA 3SX6A 5FS9A 3IF9A 2GQWA 4Z44A 1DJQA 2Q6UA 3CPHG 4B63A 4BURA 2BCGG 5J60A 1B5QA 3ALJA 3S5WA 3SZ0A 1GOSA 4C3XA 2CVJA 4UDQA 2JAEA 3UP5A 2C76A 2QAEA 1F8SA 1ONFA 3VRAA 5M0ZA 4TLXA 1ZDLA 4EMIA 5BRTA 2EQ6A 4X4JA 3AE1A 2C64A 3E1TA 3GWFA 4EQSA 1O5WA 4B64A 4A9WA 2ZBWA 4AOXA 2XLRA 3OZ2A 1GV4A 3L8KA 3SY4A 1L9CA 3DK9A 4APNA 4EMJA 5ER0A 1E1LA 1V59A 2O9ZA 2YWLA 4NEWA 4A99A 4AP1A 3AXBA 5FS8A 2B9XA 5U25A 5GSNA 2IVDA 1TYTA 2JBVA 4B65A 3ATQA 2C67A 1TDNA 2Q7VA 2VZ2A 2X50A 1DNCA 4U8OA 4P9SA 4GF7A 3CNPA 2GEWA 5IPYA 3DJDA 1C0LA 4XXGA 4YT0A 3UTHA 3GSIA 1GALA 1NENA 2VQ7A 1IUTA 1PN0A 2WBAA 4A6NB 4BK3A 3HYVA 4YJFB 2GR1A 2YVGA 4H4XA 4Z2TA 2BK3A 4IVMB 2V60A 2E4AA 2PYXA 1FCDA 2X8HA 4JNAA 2XVHA 1PBCA 3SZWA 3VRDB 4CRTA 1CJ3A 4OPUA 2JB2A 4EIQA 4YJDA 2I0ZA 4ECHA 3IHGA 1S2YA 2WOWA 3REDA 1TRBA 1D4DA 3G5SA 2BS4A 1PBBA 2XDOA 3DA1A 4NZHA 1CJ2A 3VQRA 2A8XA 1JRZA 1N1PA 2XVJA 3DGHA 1S3BA 3LOVA 4G9KA 4U8JA 4UDPA 3H8IA 3V3OA 3AWIA 4DSGA 3GDNA 4GAVA 3FBSA 1RYIA 2BYBA 3NIXA 5EBKA 1ZMCA 2ZZBA 4I59A 4K5SA 1F8WA 1ZK7A 4FK1A 1L9EA 3SZFA 1IUUA 2B76A 5M10A 1FOHA 1L0VA 3V76A 3NRNA 2RGJA 4IVOB 5TR3A 3VRBA 3NHOX 1NHPA 4ZCCA 2JB3A 4Y4LA 3KKJA 1NHRA 2C4CA 1BZLA 1Q1RA 1TYPA
chains in the Genus database with same CATH topology
3CNTA 5EB5A 4FX9A 4A79A 2VRLA 2YQUA 3KPFA 4EQRA 4H4VA 3EANA 4NTCA 2WDRA 5BULA 1KNRA 2YR4A 3NGCX 5KWFA 4H4UA 1B4VA 2Z5YA 3P4RA 5KRQA 3F8RA 4U2TA 1E7PA 1ZY8A 4CCRA 1N4WA 4TM3A 5U63A 1CC2A 4Z2RA 1GRFA 1E1NA 1IUSA 1CC4A 3VQRA 1H86A 3D8XA 2WHDA 3KD9A 5HXIA 3Q9TA 2RGOA 3GYJA 2FBWA 1BGJA 2YG4A 1JRXA 1GT8A 1XDIA 3K7MX 3RP7A 5FMHA 4LA1A 4U8PA 2YLSA 3UKPA 2Y6QA 1MOKA 1N4VA 4OPIA 1D7LA 1CJCA 2QCUA 3KLJA 3OC4A 1JNRA 3CPJG 2XFUA 3AEBA 3CGDA 5KOWA 3T31A 1P2EA 2WS3A 2WOIA 4BJZA 3NK2X 2C3DA 3RHAA 3DJJA 3NKSA 2EQ7A 1DOEA 1GREA 1DOBA 3L1RA 4H4QA 4XWZA 2IIDA 2WPCA 3CNSA 1XANA 1PJ6A 1CL0A 1YY5A 4YSXA 4YSYA 2GQFA 1IJHA 2GV8A 3UTGA 1ZX9A 3H8LA 1GRGA 3AD7B 4ADWA 2AR8A 1W4XA 1COYA 1JOAA 4REKA 4I58A 3II4A 2C72A 3BNMA 1MXTA 3ICRA 3SQPA 3M0OA 1D4CA 3AEEA 1RSGA 2IVEA 3V3NA 4GDEA 2YLXA 2XVIA 1JRYA 4B69A 5FS6A 4RG4A 3UOXA 4K7ZA 3LB8A 4EMWA 2BK5A 1ELIA 3AECA 4E0VA 3KVEA 3NNEA 2R4JA 3AD8B 1PXAA 4G6GA 3NG7X 3CGCA 1KF6A 3AD9B 3DJEA 4NWZA 1LQTA 1Y56B 1H7WA 2ARDA 4USRA 4U8MA 3NYFA 1QJDA 4CNKA 2XVFA 2AAQA 2YLWA 2UZZA 5J7XA 4H4RA 1OJDA 1VQWA 3I6DA 1M6IA 1GTEA 1TDKA 3AEAA 1BKWA 1CJ4A 4BK1A 3K7TA 4B68A 1JU2A 3DJGX 4NNJA 1X31B 3AEFA 3SXIA 2V6OA 3T2YA 2F5ZA 1K0LA 3IHMA 1E1KA 3QSSA 4IV9A 4UDRA 2C7GA 4X9MA 5FS7A 1YKJA 1KFYA 1B8SA 1VDCA 4Z26A 5LV9A 5CKUA 3IC9A 4UP3A 3C96A 4D03A 1ZMDA 3NT6A 2V61A 2R9ZA 5JCLA 3B6DA 3BHFA 3K7QX 3P4SA 2WU2A 4K2XA 5IQ4A 1REOA 1GNDA 4TM0A 2Q0KA 5BVAA 4D04A 1L9DA 5KMPA 2DKIA 3PVCA 2YVFA 2XVEA 3UCLA 3LZWA 3AE5A 2W0HA 3GD4A 2GH5A 4J33A 4OCGA 3GMCA 1PS9A 2OLOA 3S61A 1GRBA 3AYJA 4HB9A 2BXRA 2EQ8A 3LXDA 3C4AA 4JN9A 3SFEA 3UOYA 2J3NA 4DSHA 1ZP0A 5HYMA 2OLNA 4OPTA 4B66A 1YQZA 4KX6A 4N9XA 4Z43A 3PO7A 2R0CA 3CMMA 3UTEA 4C74A 2X8GA 1PXBA 4H2RA 3CTYA 3UKFA 2WP9A 2YR5A 2APGA 1H81A 3QFAA 3HZLA 4XWRA 1F3PA 4H4ZA 1XPQA 1QO8A 1NHQA 4Z25A 3FIMB 4C5OA 4OPLA 1YQ4A 3C4NA 1FECA 2BACA 4G6HA 4YKFA 1VG9A 4RSLA 4A6NA 3QVRA 3NN0X 1PJ5A 1NAAA 3BI4A 1NG3A 3P4PA 4H4WA 4Y4MA 2YG6A 1XHCA 4J34A 2WP6A 2EQ9A 2WDVA 4NTDA 1ZOYA 4EIPA 2YG3A 2ACZA 2ZZCA 1H7XA 1Z6LA 5EOWA 4K5RA 3ZYXA 1E6EA 2GB0A 3AEGA 3P1WA 3GMBA 1FL2A 1ZOVA 3QVPA 1LQUA 2C3CA 4NTEA 1YQ3A 3GWDA 4A5LA 2R4EA 1M64A 3P9UA 4O5QA 5HHFA 1EBDA 2YG5A 1CHUA 1UKVG 1F8RA 2BRYA 3G5QA 2R0PA 3GDPA 1FEBA 2YAUA 3NYEA 1LPFA 4FDCB 3RP8A 1S2QA 2YM1A 4YTPA 2X99A 1QLBA 3BHKA 3UKKA 4IA6A 2BA9A 2YM2A 4HA6A 4JDRA 1AOGA 4U8KA 5KVIA 1Q1WA 2WDQA 1CBOA 1H83A 1TDOA 3GD3A 4A7AA 4K22A 2AQJA 3CGEA 2YVJA 1Q9IA 1NPXA 5KMQA 3BI5A 2GRTA 4IA5A 1K0IA 4CCQA 4JY3A 3NYCA 5KOXA 2GAHB 1E39A 1IUVA 3PS9A 1FEAA 2PHHA 4FK1C 4TM4A 4H4PA 2XCGA 3F8PA 2YLTA 3DMEA 4ICYA 1GESA 2XFOA 4J57A 2YLZA 2BC0A 3AE8A 3EF6A 4AT0A 1GRAA 4Z2UA 4A65A 4II2A 1OJAA 1DJNA 3ADAB 1D5TA 3BNUA 1VRQB 5EB4A 5HY5A 1VG0A 1EL7A 4BV6A 1GRHA 4WX1A 5CQFA 3UKAA 4U2SA 3Q6JA 2FJAA 3SM8A 2XLPA 3VR9A 5U1OA 3FMWA 1OJTA 3ICSA 2WETA 4OPCA 3NTAA 4PAAA 1LTXR 2XLSA 5KNLA 1KSSA 2Y6RA 3BI2A 4U8LA 1D7YA 1GRTA 1H6VA 2V3BA 4GDPA 3AEDA 2OALA 4H7UA 3SFDA 4DGKA 2E1MA 1H82A 1EL8A 2E4GA 3QSEA 4J31A 4CNJA 5C3JA 2E5VA 4RG3A 3CPIG 1K4QA 4NEVA 3CN8A 2B9YA 2HQMA 1BF3A 3RP6A 1NDAA 2TPRA 3F8DA 4G74A 4H4YA 3AB1A 4H2QA 1B37A 1NG4A 2FJEA 3JSKA 4YSZA 1KDGA 1PXCA 3COXA 2C66A 1E1MA 2VVLA 1OJ9A 4GAPA 3AE9A 4J36A 2VVLG 1TDFA 3ISHA 4YSHA 4X9NA 1PHHA 1PBFA 3GYIA 4CY8A 3DK8A 3DGZA 2NPXA 2C70A 2GMJA 1N4UA 3UTFA 2GR0A 2RGHA 1Y56A 2QA2A 4GRTA 2QA1A 4YTMA 4II3A 2NVKX 2BK4A 3KPKA 4AOSA 3CNDA 4JY2A 5KVHA 2BS3A 5JCKA 3NH3X 4YTNA 4U2LA 1P2HA 2RABA 4EQXA 3AYLA 2GMHA 2A87A 3AE2A 3T2KA 1LV0A 1O94A 3AE3A 3T37A 2VRMA 1PBEA 3CGBA 2Z5XA 4O5UA 1CC6A 1Y0PA 3AE7A 1NEKA 1EL9A 3T14A 4U8NA 1S3EA 2BCPA 3I3LA 4M52A 3ICTA 4U8IA 2Q0LA 4G73A 5KXJA 2BS2A 4Y4NA 2WU5A 1EL5A 2YG7A 3EAOA 5JCIA 3RNMA 2A89A 3LJPA 3ATRA 4H2NA 4LU6A 2CFYA 2BABA 4ZCDA 4B67A 3M13A 4JQ9A 3GRSA 3CNJA 4OPDA 2V3AA 3LZXA 5IQ1A 3AYIA 4YKGA 1BGNA 1JEHA 2H88A 1GSNA 3UOZA 3VR8A 3SZCA 4C3YA 3DK4A 4K8DA 3WE0A 4GUVA 2VVMA 3UKQA 1PDHA 1OJCA 4EM4A 2VOUA 2XFPA 2WQYA 4OPGA 2XYOA 3LADA 3NN6X 3QSMA 2X3NA 1JNZA 3K30A 2OAMA 4OVIA 5DBJA 4YWOA 3T0KA 2C73A 2XFQA 3T2ZA 5C2TA 1MO9A 4EQWA 1TDEA 2YR6A 2GR3A 1IUXA 2C65A 2GR2A 2JB1A 2GF3A 5GRTA 2R46A 1PBDA 2OA1A 1D4EA 3FPZA 2CDUA 1DXLA 4CBQA 2B7RA 2B7SA 1ZKQA 2BC1A 3QFBA 3NK1X 3H4KA 1KNPA 4H4SA 3UKHA 2TMDA 1RP0A 3AE6A 1GPEA 3QJ4A 2H89A 2V5ZA 3R9UA 1F6MA 5KMSA 2JKCA 3AE4A 3NK0X 4AP3A 4MJWA 4B1BA 1BWCA 1H84A 1GEUA 2FJDA 5KMRA 3KU9A 5L46A 4DNAA 2WOVA 2ZZ0A 1GTHA 3P4QA 4JNQA 1HYUA 3ALMA 2WPFA 3KA7A 3UOVA 1LVLA 4GR1A 3URHA 3ZDNA 4WCTA 2CULA 5JCMA 1IUWA 3UKLA 4GCMA 2BXSA 2FJBA 4TLZA 2BRAA 3HYWA 4BK2A 3DH9A 4Z24A 2R45A 2XLTA 3EPTA 3GYXA 4C77A 3IWAA 4J56A 2XFNA 1DOCA 4PABA 2WPEA 1NHSA 3CIRA 1GXFA 4EM3A 3ALLA 1SEZA 4USQA 3ABVA 3ITJA 4H50A 4LIIA 2VQBA 3GRTA 2GAGB 2DKHA 1CF3A 2WESA 3B3RA 3SYIA 2X8CA 4KPRA 1DODA 2XLUA 4BJYA 2JK6A 3NTDA 4H4TA 5BUKA 3G5RA 3NLCA 1GETA 4J2WA 1GERA 1PJ7A 2B9WA 1O95A 3FG2P 3UP4A 1KSUA 4YXDA 4ZN0A 5JCNA 2WP5A 4CY6A 4TM1A 2YLRA 2C75A 2R0GA 2GVCA 2WEUA 3D1CA 3HYXA 3O0HA 3SGLA 4AT2A 1LJ1A 3M12A 4H2PA 1K0JA 3SX6A 5FS9A 3IF9A 2GQWA 4Z44A 1DJQA 2Q6UA 3CPHG 4B63A 4BURA 2BCGG 5J60A 1B5QA 3ALJA 3S5WA 3SZ0A 1GOSA 4C3XA 2CVJA 4UDQA 2JAEA 3UP5A 2C76A 2QAEA 1F8SA 1ONFA 3VRAA 5M0ZA 4TLXA 1ZDLA 4EMIA 5BRTA 2EQ6A 4X4JA 3AE1A 2C64A 3E1TA 3GWFA 4EQSA 1O5WA 4B64A 4A9WA 2ZBWA 4AOXA 2XLRA 3OZ2A 1GV4A 3L8KA 3SY4A 1L9CA 3DK9A 4APNA 4EMJA 5ER0A 1E1LA 1V59A 2O9ZA 2YWLA 4NEWA 4A99A 4AP1A 3AXBA 5FS8A 2B9XA 5U25A 5GSNA 2IVDA 1TYTA 2JBVA 4B65A 3ATQA 2C67A 1TDNA 2Q7VA 2VZ2A 2X50A 1DNCA 4U8OA 4P9SA 4GF7A 3CNPA 2GEWA 5IPYA 3DJDA 4XXGA 4YT0A 3UTHA 1GALA 1NENA 2WBAA 2VQ7A 1IUTA 1PN0A 3GSIA 4A6NB 4BK3A 3HYVA 4H4XA 2GR1A 2YVGA 4Z2TA 2BK3A 4IVMB 2V60A 2PYXA 1FCDA 2X8HA 4JNAA 2XVHA 1PBCA 3SZWA 3VRDB 4CRTA 1CJ3A 4OPUA 2JB2A 4EIQA 2I0ZA 4ECHA 3IHGA 1S2YA 2WOWA 3REDA 1TRBA 1D4DA 3G5SA 2BS4A 1PBBA 2XDOA 3DA1A 4NZHA 2A8XA 1CJ2A 2XVJA 1JRZA 1N1PA 3DGHA 3LOVA 1S3BA 4G9KA 4U8JA 4UDPA 3H8IA 3V3OA 3AWIA 4DSGA 3GDNA 4GAVA 3FBSA 1RYIA 2BYBA 3NIXA 5EBKA 1ZMCA 2ZZBA 4I59A 4K5SA 1F8WA 1ZK7A 4FK1A 1L9EA 3SZFA 1IUUA 2B76A 5M10A 1FOHA 1L0VA 3V76A 3NRNA 2RGJA 4IVOB 5TR3A 3VRBA 3NHOX 1NHPA 4ZCCA 2JB3A 4Y4LA 3KKJA 1NHRA 2C4CA 1BZLA 1Q1RA 1TYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNT A;  5EB5 A;  4FX9 A;  4A79 A;  2VRL A;  2YQU A;  3KPF A;  4EQR A;  4H4V A;  3EAN A;  4NTC A;  2WDR A;  5BUL A;  1KNR A;  2YR4 A;  3NGC X;  5KWF A;  4H4U A;  1B4V A;  2Z5Y A;  3P4R A;  5KRQ A;  3F8R A;  4U2T A;  1E7P A;  1ZY8 A;  4CCR A;  1N4W A;  4TM3 A;  5U63 A;  1CC2 A;  4Z2R A;  1GRF A;  1E1N A;  1IUS A;  1CC4 A;  1H86 A;  3D8X A;  2WHD A;  3KD9 A;  5HXI A;  3Q9T A;  2RGO A;  3GYJ A;  2FBW A;  1BGJ A;  2YG4 A;  1JRX A;  1GT8 A;  1XDI A;  3K7M X;  5FMH A;  3RP7 A;  4LA1 A;  4U8P A;  2YLS A;  3UKP A;  2Y6Q A;  1MOK A;  1N4V A;  4OPI A;  1D7L A;  1CJC A;  2QCU A;  3KLJ A;  3OC4 A;  1JNR A;  3CPJ G;  2XFU A;  3AEB A;  3CGD A;  5KOW A;  1P2E A;  2WS3 A;  2WOI A;  3NK2 X;  4BJZ A;  2C3D A;  3RHA A;  3DJJ A;  3NKS A;  2EQ7 A;  1DOE A;  1GRE A;  1DOB A;  3L1R A;  4H4Q A;  4XWZ A;  2IID A;  2WPC A;  3CNS A;  1XAN A;  1PJ6 A;  1CL0 A;  1YY5 A;  4YSX A;  4YSY A;  2GQF A;  1IJH A;  2GV8 A;  3UTG A;  1ZX9 A;  3H8L A;  1GRG A;  3AD7 B;  4ADW A;  2AR8 A;  1W4X A;  1COY A;  1JOA A;  4REK A;  4I58 A;  3II4 A;  2C72 A;  3BNM A;  1MXT A;  3ICR A;  3SQP A;  3M0O A;  1D4C A;  3AEE A;  1RSG A;  2IVE A;  3V3N A;  4GDE A;  2YLX A;  2XVI A;  1JRY A;  4B69 A;  5FS6 A;  4RG4 A;  3UOX A;  4K7Z A;  3LB8 A;  4EMW A;  2BK5 A;  1ELI A;  3AEC A;  4E0V A;  3KVE A;  3NNE A;  2R4J A;  3AD8 B;  1PXA A;  3NG7 X;  3CGC A;  1KF6 A;  3AD9 B;  3DJE A;  1LQT A;  1Y56 B;  1H7W A;  2ARD A;  4USR A;  4U8M A;  3NYF A;  1QJD A;  4CNK A;  2XVF A;  2AAQ A;  2YLW A;  2UZZ A;  5J7X A;  4H4R A;  1OJD A;  1VQW A;  3I6D A;  1M6I A;  1GTE A;  1TDK A;  3AEA A;  1BKW A;  1CJ4 A;  4B68 A;  3K7T A;  4BK1 A;  1JU2 A;  3DJG X;  1X31 B;  3AEF A;  2V6O A;  2F5Z A;  1K0L A;  3IHM A;  1E1K A;  3QSS A;  4IV9 A;  4UDR A;  2C7G A;  4X9M A;  5FS7 A;  1YKJ A;  1KFY A;  1B8S A;  1VDC A;  4Z26 A;  5LV9 A;  5CKU A;  3IC9 A;  4UP3 A;  3C96 A;  4D03 A;  1ZMD A;  3NT6 A;  2V61 A;  2R9Z A;  5JCL A;  3B6D A;  3BHF A;  3K7Q X;  3P4S A;  2WU2 A;  4K2X A;  5IQ4 A;  1REO A;  1GND A;  4TM0 A;  2Q0K A;  5BVA A;  4D04 A;  1L9D A;  2DKI A;  3PVC A;  2YVF A;  2XVE A;  3UCL A;  3LZW A;  3AE5 A;  2W0H A;  3GD4 A;  2GH5 A;  4J33 A;  4OCG A;  3GMC A;  1PS9 A;  2OLO A;  3S61 A;  1GRB A;  3AYJ A;  4HB9 A;  2BXR A;  2EQ8 A;  3LXD A;  3C4A A;  4JN9 A;  3SFE A;  3UOY A;  2J3N A;  4DSH A;  1ZP0 A;  2OLN A;  4OPT A;  4B66 A;  5HYM A;  1YQZ A;  4KX6 A;  4N9X A;  4Z43 A;  3PO7 A;  2R0C A;  3UTE A;  4C74 A;  2X8G A;  1PXB A;  4H2R A;  3CTY A;  3UKF A;  2WP9 A;  2YR5 A;  2APG A;  1H81 A;  3QFA A;  3HZL A;  4XWR A;  1F3P A;  4H4Z A;  1XPQ A;  1QO8 A;  1NHQ A;  4Z25 A;  3FIM B;  4C5O A;  4OPL A;  1YQ4 A;  3C4N A;  1FEC A;  2BAC A;  4YKF A;  1VG9 A;  4RSL A;  4A6N A;  3QVR A;  3NN0 X;  1PJ5 A;  1NAA A;  3BI4 A;  1NG3 A;  3P4P A;  4H4W A;  4Y4M A;  2YG6 A;  1XHC A;  4J34 A;  2WP6 A;  2EQ9 A;  2WDV A;  4NTD A;  1ZOY A;  4EIP A;  2YG3 A;  2ACZ A;  2ZZC A;  1H7X A;  1Z6L A;  5EOW A;  4K5R A;  3ZYX A;  1E6E A;  2GB0 A;  3AEG A;  3P1W A;  3GMB A;  1FL2 A;  1ZOV A;  3QVP A;  1LQU A;  2C3C A;  4NTE A;  1YQ3 A;  3GWD A;  4A5L A;  2R4E A;  1M64 A;  3P9U A;  4O5Q A;  5HHF A;  1EBD A;  2YG5 A;  1CHU A;  1UKV G;  1F8R A;  3G5Q A;  2R0P A;  3GDP A;  1FEB A;  2YAU A;  3NYE A;  1LPF A;  4FDC B;  3RP8 A;  1S2Q A;  2YM1 A;  4YTP A;  2X99 A;  1QLB A;  3BHK A;  3UKK A;  2YM2 A;  2BA9 A;  4HA6 A;  4IA6 A;  4JDR A;  1AOG A;  4U8K A;  5KVI A;  1Q1W A;  2WDQ A;  1CBO A;  1H83 A;  1TDO A;  3GD3 A;  4A7A A;  4K22 A;  2AQJ A;  3CGE A;  2YVJ A;  1Q9I A;  1NPX A;  3BI5 A;  2GRT A;  4IA5 A;  1K0I A;  4CCQ A;  4JY3 A;  3NYC A;  5KOX A;  2GAH B;  1E39 A;  1IUV A;  3PS9 A;  1FEA A;  2PHH A;  4FK1 C;  4TM4 A;  4H4P A;  2XCG A;  3F8P A;  2YLT A;  3DME A;  4ICY A;  1GES A;  2XFO A;  4J57 A;  2YLZ A;  2BC0 A;  3AE8 A;  3EF6 A;  4AT0 A;  1GRA A;  4Z2U A;  4A65 A;  1OJA A;  1DJN A;  3ADA B;  1D5T A;  3BNU A;  1VRQ B;  5EB4 A;  5HY5 A;  1VG0 A;  1EL7 A;  4BV6 A;  1GRH A;  4WX1 A;  5CQF A;  3UKA A;  4U2S A;  3Q6J A;  2FJA A;  3SM8 A;  2XLP A;  3VR9 A;  5U1O A;  3FMW A;  1OJT A;  3ICS A;  2WET A;  4OPC A;  3NTA A;  4PAA A;  1LTX R;  2XLS A;  1KSS A;  2Y6R A;  3BI2 A;  4U8L A;  1D7Y A;  1GRT A;  1H6V A;  2V3B A;  4GDP A;  3AED A;  2OAL A;  4H7U A;  3SFD A;  4DGK A;  2E1M A;  1H82 A;  1EL8 A;  2E4G A;  3QSE A;  4J31 A;  4CNJ A;  5C3J A;  2E5V A;  4RG3 A;  3CPI G;  1K4Q A;  4NEV A;  3CN8 A;  2B9Y A;  2HQM A;  1BF3 A;  3RP6 A;  1NDA A;  2TPR A;  3F8D A;  4H4Y A;  3AB1 A;  4H2Q A;  1B37 A;  1NG4 A;  2FJE A;  3JSK A;  4YSZ A;  1KDG A;  1PXC A;  3COX A;  2C66 A;  1E1M A;  2VVL A;  1OJ9 A;  3AE9 A;  4J36 A;  2VVL G;  1TDF A;  3ISH A;  4YSH A;  4X9N A;  1PHH A;  1PBF A;  3GYI A;  4CY8 A;  3DK8 A;  3DGZ A;  2NPX A;  2C70 A;  2GMJ A;  1N4U A;  3UTF A;  2GR0 A;  2RGH A;  1Y56 A;  2QA2 A;  4GRT A;  2QA1 A;  4YTM A;  2NVK X;  2BK4 A;  5KVH A;  4AOS A;  3CND A;  4JY2 A;  2BS3 A;  5JCK A;  3NH3 X;  4YTN A;  4U2L A;  1P2H A;  2RAB A;  4EQX A;  3AYL A;  2GMH A;  2A87 A;  3AE2 A;  3T37 A;  1LV0 A;  1O94 A;  3AE3 A;  2VRM A;  1PBE A;  3CGB A;  2Z5X A;  4O5U A;  1CC6 A;  1Y0P A;  3AE7 A;  1NEK A;  1EL9 A;  4U8N A;  1S3E A;  2BCP A;  3I3L A;  4M52 A;  3ICT A;  4U8I A;  2Q0L A;  5KXJ A;  2BS2 A;  4Y4N A;  2WU5 A;  1EL5 A;  2YG7 A;  3EAO A;  5JCI A;  3RNM A;  2A89 A;  3LJP A;  3ATR A;  4H2N A;  4LU6 A;  2CFY A;  2BAB A;  4ZCD A;  4B67 A;  3M13 A;  4JQ9 A;  3GRS A;  3CNJ A;  4OPD A;  2V3A A;  3LZX A;  5IQ1 A;  3AYI A;  4YKG A;  1BGN A;  1JEH A;  2H88 A;  1GSN A;  3UOZ A;  3VR8 A;  4C3Y A;  3DK4 A;  4K8D A;  3WE0 A;  4GUV A;  2VVM A;  3UKQ A;  1PDH A;  1OJC A;  4EM4 A;  2VOU A;  2XFP A;  2WQY A;  4OPG A;  2XYO A;  3LAD A;  3NN6 X;  3QSM A;  2X3N A;  1JNZ A;  3K30 A;  2OAM A;  4OVI A;  5DBJ A;  4YWO A;  2C73 A;  2XFQ A;  5C2T A;  1MO9 A;  4EQW A;  1TDE A;  2YR6 A;  2GR3 A;  1IUX A;  2C65 A;  2GR2 A;  2JB1 A;  2GF3 A;  5GRT A;  2R46 A;  1PBD A;  2OA1 A;  1D4E A;  3FPZ A;  2CDU A;  1DXL A;  4CBQ A;  2B7R A;  2B7S A;  1ZKQ A;  2BC1 A;  3QFB A;  3NK1 X;  3H4K A;  1KNP A;  4H4S A;  3UKH A;  2TMD A;  1RP0 A;  3AE6 A;  1GPE A;  3QJ4 A;  2H89 A;  2V5Z A;  3R9U A;  1F6M A;  2JKC A;  3AE4 A;  3NK0 X;  4AP3 A;  4MJW A;  4B1B A;  1BWC A;  1H84 A;  1GEU A;  2FJD A;  3KU9 A;  5L46 A;  4DNA A;  2WOV A;  2ZZ0 A;  1GTH A;  3P4Q A;  4JNQ A;  1HYU A;  3ALM A;  2WPF A;  3KA7 A;  3UOV A;  1LVL A;  4GR1 A;  3URH A;  3ZDN A;  4WCT A;  2CUL A;  5JCM A;  1IUW A;  3UKL A;  4GCM A;  2BXS A;  2FJB A;  4TLZ A;  4BK2 A;  3DH9 A;  4Z24 A;  2R45 A;  2XLT A;  3EPT A;  4C77 A;  3IWA A;  4J56 A;  2XFN A;  1DOC A;  4PAB A;  2WPE A;  1NHS A;  3CIR A;  1GXF A;  4EM3 A;  3ALL A;  1SEZ A;  4USQ A;  3ABV A;  3ITJ A;  4H50 A;  4LII A;  2VQB A;  3GRT A;  2GAG B;  2DKH A;  1CF3 A;  2WES A;  3B3R A;  2X8C A;  4KPR A;  1DOD A;  2XLU A;  3NTD A;  2JK6 A;  4BJY A;  4H4T A;  5BUK A;  3G5R A;  3NLC A;  1GET A;  4J2W A;  1GER A;  1PJ7 A;  2B9W A;  1O95 A;  3FG2 P;  3UP4 A;  1KSU A;  4YXD A;  4ZN0 A;  5JCN A;  2WP5 A;  4CY6 A;  4TM1 A;  2YLR A;  2C75 A;  2R0G A;  2GVC A;  2WEU A;  3D1C A;  3O0H A;  3SGL A;  4AT2 A;  1LJ1 A;  3M12 A;  4H2P A;  1K0J A;  5FS9 A;  3IF9 A;  2GQW A;  4Z44 A;  1DJQ A;  2Q6U A;  3CPH G;  4B63 A;  4BUR A;  2BCG G;  5J60 A;  1B5Q A;  3ALJ A;  3S5W A;  1GOS A;  4C3X A;  2CVJ A;  4UDQ A;  2JAE A;  3UP5 A;  2C76 A;  2QAE A;  1F8S A;  1ONF A;  3VRA A;  5M0Z A;  4TLX A;  1ZDL A;  4EMI A;  5BRT A;  2EQ6 A;  4X4J A;  3AE1 A;  2C64 A;  3E1T A;  3GWF A;  4EQS A;  1O5W A;  4B64 A;  4A9W A;  2ZBW A;  4AOX A;  2XLR A;  3OZ2 A;  1GV4 A;  3L8K A;  1L9C A;  3DK9 A;  4APN A;  4EMJ A;  5ER0 A;  1E1L A;  1V59 A;  2O9Z A;  2YWL A;  4NEW A;  4A99 A;  4AP1 A;  3AXB A;  5FS8 A;  2B9X A;  5U25 A;  5GSN A;  2IVD A;  1TYT A;  2JBV A;  4B65 A;  3ATQ A;  2C67 A;  1TDN A;  2Q7V A;  2VZ2 A;  2X50 A;  1DNC A;  4U8O A;  4P9S A;  4GF7 A;  3CNP A;  2GEW A;  5IPY A;  3DJD A;  4XXG A;  4YT0 A;  3UTH A;  1GAL A;  1NEN A;  2WBA A;  2VQ7 A;  1IUT A;  1PN0 A;  3GSI A;  4A6N B;  4BK3 A;  4H4X A;  2GR1 A;  2YVG A;  4Z2T A;  2BK3 A;  4IVM B;  2V60 A;  2PYX A;  1FCD A;  2X8H A;  4JNA A;  2XVH A;  1PBC A;  3VRD B;  4CRT A;  1CJ3 A;  4OPU A;  2JB2 A;  4EIQ A;  2I0Z A;  4ECH A;  3IHG A;  1S2Y A;  2WOW A;  3RED A;  1TRB A;  1D4D A;  3G5S A;  2BS4 A;  1PBB A;  2XDO A;  3DA1 A;  4NZH A;  1CJ2 A;  2A8X A;  2XVJ A;  1JRZ A;  1N1P A;  3DGH A;  3LOV A;  1S3B A;  4U8J A;  4UDP A;  3VQR A;  3H8I A;  3V3O A;  3AWI A;  4DSG A;  3GDN A;  3FBS A;  1RYI A;  2BYB A;  3NIX A;  5EBK A;  1ZMC A;  2ZZB A;  4I59 A;  4K5S A;  1F8W A;  1ZK7 A;  4FK1 A;  1L9E A;  5M10 A;  1IUU A;  2B76 A;  1FOH A;  1L0V A;  3V76 A;  3NRN A;  2RGJ A;  4IVO B;  5TR3 A;  3VRB A;  3NHO X;  1NHP A;  4ZCC A;  2JB3 A;  4Y4L A;  3KKJ A;  1NHR A;  1BZL A;  1Q1R A;  1TYP A; 
#chains in the Genus database with same CATH topology
 3CNT A;  5EB5 A;  4FX9 A;  4A79 A;  2VRL A;  2YQU A;  3KPF A;  4EQR A;  4H4V A;  1EVI A;  3EAN A;  4NTC A;  2WDR A;  5BUL A;  1KNR A;  2YR4 A;  3NGC X;  3ZNO A;  5KWF A;  4H4U A;  1B4V A;  2Z5Y A;  3P4R A;  5KRQ A;  3F8R A;  4U2T A;  1E7P A;  1ZY8 A;  4CCR A;  1N4W A;  4TM3 A;  5U63 A;  1CC2 A;  4Z2R A;  1GRF A;  1E1N A;  1IUS A;  1CC4 A;  1H86 A;  3D8X A;  2WHD A;  3KD9 A;  5HXI A;  3Q9T A;  2RGO A;  3GYJ A;  2FBW A;  1BGJ A;  2YG4 A;  1JRX A;  1GT8 A;  1XDI A;  3K7M X;  3RP7 A;  5FMH A;  4LA1 A;  4U8P A;  2YLS A;  3UKP A;  2Y6Q A;  1MOK A;  1N4V A;  4OPI A;  1D7L A;  2QCU A;  1CJC A;  3KLJ A;  3OC4 A;  3WGT A;  1JNR A;  2XFU A;  3CPJ G;  3AEB A;  3CGD A;  5KOW A;  3T31 A;  1P2E A;  2WS3 A;  2WOI A;  4BJZ A;  3NK2 X;  2C3D A;  3RHA A;  3DJJ A;  3NKS A;  2EQ7 A;  1DOE A;  1GRE A;  1DOB A;  4XWZ A;  3L1R A;  4H4Q A;  2IID A;  2WPC A;  3CNS A;  1XAN A;  1PJ6 A;  1CL0 A;  1YY5 A;  4YSX A;  4YSY A;  2GQF A;  1IJH A;  2GV8 A;  3UTG A;  1ZX9 A;  3H8L A;  3AD7 B;  1GRG A;  4ADW A;  2AR8 A;  1W4X A;  1COY A;  1JOA A;  4REK A;  4I58 A;  3II4 A;  2C72 A;  3BNM A;  1MXT A;  3ICR A;  3SQP A;  3M0O A;  1D4C A;  3AEE A;  1RSG A;  3W4I A;  2IVE A;  3V3N A;  4GDE A;  2YLX A;  2XVI A;  1JRY A;  4B69 A;  5FS6 A;  4RG4 A;  3UOX A;  4K7Z A;  3LB8 A;  4EMW A;  2BK5 A;  1ELI A;  3AEC A;  4E0V A;  3KVE A;  3NNE A;  2R4J A;  3AD8 B;  1PXA A;  4G6G A;  3NG7 X;  3DJE A;  3AD9 B;  1KF6 A;  3CGC A;  4NWZ A;  1LQT A;  1Y56 B;  1H7W A;  2ARD A;  4USR A;  4U8M A;  3NYF A;  1QJD A;  4CNK A;  2XVF A;  2E82 A;  2AAQ A;  2YLW A;  2UZZ A;  5J7X A;  4H4R A;  1OJD A;  1VQW A;  3I6D A;  2DU8 A;  1M6I A;  1GTE A;  1TDK A;  3AEA A;  1BKW A;  1CJ4 A;  4BK1 A;  3K7T A;  4B68 A;  1JU2 A;  1DAO A;  3DJG X;  4NNJ A;  1C0K A;  1X31 B;  3AEF A;  3SXI A;  1C0I A;  2V6O A;  3T2Y A;  2F5Z A;  1K0L A;  3IHM A;  1E1K A;  3QSS A;  4IV9 A;  4UDR A;  4X9M A;  2C7G A;  5FS7 A;  1YKJ A;  1KFY A;  1B8S A;  1VDC A;  4Z26 A;  5LV9 A;  5CKU A;  3IC9 A;  4UP3 A;  3C96 A;  4D03 A;  1ZMD A;  3NT6 A;  2V61 A;  2R9Z A;  5JCL A;  3B6D A;  4YJH A;  3BHF A;  3K7Q X;  3P4S A;  2WU2 A;  4K2X A;  5IQ4 A;  1REO A;  1GND A;  4TM0 A;  2Q0K A;  5BVA A;  4D04 A;  1L9D A;  5KMP A;  2DKI A;  3PVC A;  2YVF A;  2XVE A;  3UCL A;  3LZW A;  3AE5 A;  2W0H A;  3GD4 A;  2GH5 A;  4J33 A;  4OCG A;  2OLO A;  3GMC A;  1PS9 A;  3S61 A;  1GRB A;  3AYJ A;  4HB9 A;  2BXR A;  2EQ8 A;  3LXD A;  3C4A A;  4JN9 A;  3SFE A;  3UOY A;  2J3N A;  4DSH A;  1ZP0 A;  2OLN A;  5HYM A;  4OPT A;  4B66 A;  1YQZ A;  4KX6 A;  4N9X A;  4Z43 A;  3PO7 A;  2R0C A;  3CMM A;  3UTE A;  4C74 A;  2E48 A;  2X8G A;  1PXB A;  4H2R A;  3CTY A;  3UKF A;  2WP9 A;  2YR5 A;  2APG A;  1H81 A;  3QFA A;  3HZL A;  4XWR A;  1F3P A;  4H4Z A;  1XPQ A;  1QO8 A;  1NHQ A;  4Z25 A;  3FIM B;  4C5O A;  4OPL A;  1YQ4 A;  3C4N A;  1FEC A;  2BAC A;  4G6H A;  4YKF A;  1VG9 A;  4RSL A;  4A6N A;  3QVR A;  3NN0 X;  1PJ5 A;  1NAA A;  3BI4 A;  1NG3 A;  3P4P A;  4H4W A;  4Y4M A;  2YG6 A;  1XHC A;  4J34 A;  2WP6 A;  2EQ9 A;  2WDV A;  4NTD A;  1ZOY A;  4EIP A;  2YG3 A;  2ACZ A;  2ZZC A;  1H7X A;  1Z6L A;  5EOW A;  4K5R A;  3ZYX A;  2GB0 A;  1E6E A;  3AEG A;  3P1W A;  1ZOV A;  3GMB A;  1FL2 A;  3QVP A;  1LQU A;  2C3C A;  4NTE A;  1YQ3 A;  3GWD A;  4A5L A;  2R4E A;  1M64 A;  3P9U A;  4O5Q A;  5HHF A;  1EBD A;  3ZNN A;  2YG5 A;  1CHU A;  1UKV G;  1F8R A;  2BRY A;  3G5Q A;  2R0P A;  3GDP A;  3NYE A;  1FEB A;  2YAU A;  1LPF A;  4FDC B;  3RP8 A;  1S2Q A;  2YM1 A;  1KIF A;  4YTP A;  2X99 A;  1QLB A;  3BHK A;  3UKK A;  4IA6 A;  2BA9 A;  2YM2 A;  4HA6 A;  4JDR A;  1AOG A;  4U8K A;  5KVI A;  1Q1W A;  2WDQ A;  1CBO A;  1H83 A;  1TDO A;  3GD3 A;  4A7A A;  3ZNQ A;  4K22 A;  2AQJ A;  3CGE A;  2YVJ A;  1Q9I A;  1NPX A;  5KMQ A;  3BI5 A;  2GRT A;  4IA5 A;  1K0I A;  4CCQ A;  4JY3 A;  3NYC A;  5KOX A;  2GAH B;  3W4K A;  1IUV A;  1E39 A;  3PS9 A;  1FEA A;  2PHH A;  4FK1 C;  4TM4 A;  4H4P A;  2XCG A;  3F8P A;  2YLT A;  3DME A;  4ICY A;  1GES A;  2XFO A;  4J57 A;  2YLZ A;  2BC0 A;  3AE8 A;  3EF6 A;  4AT0 A;  1GRA A;  4Z2U A;  4A65 A;  4II2 A;  1OJA A;  1DJN A;  3ADA B;  1D5T A;  3BNU A;  1VRQ B;  5EB4 A;  5HY5 A;  1VG0 A;  1EL7 A;  4BV6 A;  1GRH A;  4WX1 A;  5CQF A;  3UKA A;  4U2S A;  3SM8 A;  2FJA A;  3Q6J A;  2XLP A;  3VR9 A;  5U1O A;  3FMW A;  1OJT A;  3ICS A;  2WET A;  4PAA A;  3NTA A;  4OPC A;  1LTX R;  2XLS A;  5KNL A;  1KSS A;  2Y6R A;  3BI2 A;  4U8L A;  1D7Y A;  1GRT A;  1H6V A;  2V3B A;  4GDP A;  3AED A;  2OAL A;  4H7U A;  3SFD A;  2E49 A;  2E1M A;  4DGK A;  1H82 A;  1EL8 A;  2E4G A;  3QSE A;  4J31 A;  4CNJ A;  5C3J A;  2E5V A;  4RG3 A;  3CPI G;  1K4Q A;  4NEV A;  3CN8 A;  2B9Y A;  2HQM A;  3ZNP A;  1BF3 A;  3RP6 A;  1NDA A;  2TPR A;  3F8D A;  4G74 A;  4H4Y A;  3AB1 A;  4H2Q A;  1B37 A;  1NG4 A;  4YJG A;  2FJE A;  3JSK A;  1PXC A;  1KDG A;  4YSZ A;  3G3E A;  3COX A;  2C66 A;  1E1M A;  2VVL A;  1OJ9 A;  4GAP A;  3AE9 A;  4J36 A;  4YJH B;  2VVL G;  4YSH A;  1TDF A;  3ISH A;  3CUK A;  4X9N A;  1PHH A;  1PBF A;  3GYI A;  4CY8 A;  3DK8 A;  3DGZ A;  1DDO A;  2NPX A;  2C70 A;  2GMJ A;  1N4U A;  3UTF A;  2GR0 A;  2RGH A;  1Y56 A;  2QA2 A;  4GRT A;  2QA1 A;  4YTM A;  4II3 A;  2NVK X;  2BK4 A;  3KPK A;  4AOS A;  3CND A;  4JY2 A;  5KVH A;  2BS3 A;  5JCK A;  4QFD A;  3NH3 X;  4YTN A;  4U2L A;  1P2H A;  2RAB A;  4EQX A;  1C0P A;  3AYL A;  2GMH A;  2A87 A;  3AE2 A;  3T2K A;  1LV0 A;  1O94 A;  3AE3 A;  3T37 A;  2VRM A;  1PBE A;  3CGB A;  2Z5X A;  4O5U A;  1CC6 A;  1Y0P A;  3AE7 A;  1NEK A;  1EL9 A;  3T14 A;  4U8N A;  1S3E A;  2BCP A;  3I3L A;  4M52 A;  3ICT A;  4U8I A;  2Q0L A;  4G73 A;  5KXJ A;  2BS2 A;  4Y4N A;  2WU5 A;  1EL5 A;  2YG7 A;  3EAO A;  5JCI A;  3RNM A;  2A89 A;  3LJP A;  3ATR A;  4H2N A;  4LU6 A;  2CFY A;  2BAB A;  4ZCD A;  4B67 A;  3M13 A;  4JQ9 A;  3GRS A;  3CNJ A;  4OPD A;  2V3A A;  3LZX A;  5IQ1 A;  3AYI A;  4YJF A;  4YKG A;  1BGN A;  1JEH A;  2H88 A;  1GSN A;  3UOZ A;  3VR8 A;  3SZC A;  4C3Y A;  3DK4 A;  4K8D A;  3WE0 A;  4GUV A;  2VVM A;  3UKQ A;  1PDH A;  4QFC A;  1OJC A;  4EM4 A;  2VOU A;  2XFP A;  2WQY A;  4OPG A;  2XYO A;  3LAD A;  3NN6 X;  3QSM A;  2X3N A;  1JNZ A;  3K30 A;  2OAM A;  4OVI A;  5DBJ A;  4YWO A;  3T0K A;  2C73 A;  2XFQ A;  3T2Z A;  5C2T A;  1MO9 A;  4EQW A;  1TDE A;  2YR6 A;  2GR3 A;  1IUX A;  2C65 A;  2GR2 A;  2JB1 A;  2GF3 A;  3W4J A;  5GRT A;  2R46 A;  1PBD A;  2OA1 A;  1D4E A;  3FPZ A;  2CDU A;  1DXL A;  4CBQ A;  2B7R A;  2B7S A;  1ZKQ A;  2BC1 A;  3QFB A;  3NK1 X;  3H4K A;  1KNP A;  4H4S A;  3UKH A;  2TMD A;  1RP0 A;  3AE6 A;  1GPE A;  3QJ4 A;  2H89 A;  2V5Z A;  3R9U A;  1F6M A;  5KMS A;  2JKC A;  3AE4 A;  3NK0 X;  4AP3 A;  4MJW A;  4B1B A;  1BWC A;  1H84 A;  1GEU A;  2FJD A;  5KMR A;  3KU9 A;  5L46 A;  4DNA A;  2WOV A;  2ZZ0 A;  1GTH A;  3P4Q A;  4JNQ A;  1HYU A;  3ALM A;  1AN9 A;  2WPF A;  3KA7 A;  3UOV A;  1LVL A;  4GR1 A;  3URH A;  3ZDN A;  4WCT A;  1VE9 A;  2CUL A;  5JCM A;  1IUW A;  3UKL A;  4GCM A;  2BXS A;  2FJB A;  4TLZ A;  2BRA A;  3HYW A;  4BK2 A;  3DH9 A;  4Z24 A;  2R45 A;  2XLT A;  3EPT A;  3GYX A;  4C77 A;  3IWA A;  4J56 A;  2XFN A;  1DOC A;  4PAB A;  2WPE A;  1NHS A;  3CIR A;  1GXF A;  4EM3 A;  3ALL A;  1SEZ A;  4USQ A;  3ABV A;  3ITJ A;  4H50 A;  4LII A;  2VQB A;  3GRT A;  2GAG B;  2DKH A;  1CF3 A;  2WES A;  3B3R A;  3SYI A;  2X8C A;  4KPR A;  1DOD A;  2XLU A;  4BJY A;  2JK6 A;  3NTD A;  4H4T A;  5BUK A;  3G5R A;  3NLC A;  1GET A;  4J2W A;  1GER A;  1PJ7 A;  2B9W A;  1O95 A;  3FG2 P;  3UP4 A;  1KSU A;  4YXD A;  4ZN0 A;  5JCN A;  2WP5 A;  4CY6 A;  4TM1 A;  2YLR A;  2C75 A;  2R0G A;  3SGL A;  2GVC A;  2WEU A;  3D1C A;  4YJG B;  3HYX A;  3O0H A;  4AT2 A;  1LJ1 A;  3M12 A;  4H2P A;  1K0J A;  3SX6 A;  5FS9 A;  3IF9 A;  2GQW A;  4Z44 A;  1DJQ A;  2Q6U A;  3CPH G;  4B63 A;  4BUR A;  2BCG G;  5J60 A;  1B5Q A;  3ALJ A;  3S5W A;  3SZ0 A;  1GOS A;  4C3X A;  2CVJ A;  4UDQ A;  2JAE A;  3UP5 A;  2C76 A;  2QAE A;  1F8S A;  1ONF A;  3VRA A;  5M0Z A;  4TLX A;  1ZDL A;  4EMI A;  5BRT A;  2EQ6 A;  4X4J A;  3AE1 A;  2C64 A;  3E1T A;  3GWF A;  4EQS A;  1O5W A;  4B64 A;  4A9W A;  2ZBW A;  4AOX A;  2XLR A;  3OZ2 A;  1GV4 A;  3L8K A;  3SY4 A;  1L9C A;  3DK9 A;  4APN A;  4EMJ A;  5ER0 A;  1E1L A;  1V59 A;  2O9Z A;  2YWL A;  4NEW A;  4A99 A;  4AP1 A;  3AXB A;  5FS8 A;  2B9X A;  5U25 A;  5GSN A;  2IVD A;  1TYT A;  2JBV A;  4B65 A;  3ATQ A;  2C67 A;  1TDN A;  2Q7V A;  2VZ2 A;  2X50 A;  1DNC A;  4U8O A;  4P9S A;  4GF7 A;  3CNP A;  2GEW A;  5IPY A;  3DJD A;  1C0L A;  4XXG A;  4YT0 A;  3UTH A;  3GSI A;  1GAL A;  1NEN A;  2VQ7 A;  1IUT A;  1PN0 A;  2WBA A;  4A6N B;  4BK3 A;  3HYV A;  4YJF B;  2GR1 A;  2YVG A;  4H4X A;  4Z2T A;  2BK3 A;  4IVM B;  2V60 A;  2E4A A;  2PYX A;  1FCD A;  2X8H A;  4JNA A;  2XVH A;  1PBC A;  3SZW A;  3VRD B;  4CRT A;  1CJ3 A;  4OPU A;  2JB2 A;  4EIQ A;  4YJD A;  2I0Z A;  4ECH A;  3IHG A;  1S2Y A;  2WOW A;  3RED A;  1TRB A;  1D4D A;  3G5S A;  2BS4 A;  1PBB A;  2XDO A;  3DA1 A;  4NZH A;  1CJ2 A;  3VQR A;  2A8X A;  1JRZ A;  1N1P A;  2XVJ A;  3DGH A;  1S3B A;  3LOV A;  4G9K A;  4U8J A;  4UDP A;  3H8I A;  3V3O A;  3AWI A;  4DSG A;  3GDN A;  4GAV A;  3FBS A;  1RYI A;  2BYB A;  3NIX A;  5EBK A;  1ZMC A;  2ZZB A;  4I59 A;  4K5S A;  1F8W A;  1ZK7 A;  4FK1 A;  1L9E A;  3SZF A;  1IUU A;  2B76 A;  5M10 A;  1FOH A;  1L0V A;  3V76 A;  3NRN A;  2RGJ A;  4IVO B;  5TR3 A;  3VRB A;  3NHO X;  1NHP A;  4ZCC A;  2JB3 A;  4Y4L A;  3KKJ A;  1NHR A;  2C4C A;  1BZL A;  1Q1R A;  1TYP A; 
#chains in the Genus database with same CATH homology
 3CNT A;  5EB5 A;  4FX9 A;  4A79 A;  2VRL A;  2YQU A;  3KPF A;  4EQR A;  4H4V A;  3EAN A;  4NTC A;  2WDR A;  5BUL A;  1KNR A;  2YR4 A;  3NGC X;  5KWF A;  4H4U A;  1B4V A;  2Z5Y A;  3P4R A;  5KRQ A;  3F8R A;  4U2T A;  1E7P A;  1ZY8 A;  4CCR A;  1N4W A;  4TM3 A;  5U63 A;  1CC2 A;  4Z2R A;  1GRF A;  1E1N A;  1IUS A;  1CC4 A;  3VQR A;  1H86 A;  3D8X A;  2WHD A;  3KD9 A;  5HXI A;  3Q9T A;  2RGO A;  3GYJ A;  2FBW A;  1BGJ A;  2YG4 A;  1JRX A;  1GT8 A;  1XDI A;  3K7M X;  3RP7 A;  5FMH A;  4LA1 A;  4U8P A;  2YLS A;  3UKP A;  2Y6Q A;  1MOK A;  1N4V A;  4OPI A;  1D7L A;  1CJC A;  2QCU A;  3KLJ A;  3OC4 A;  1JNR A;  3CPJ G;  2XFU A;  3AEB A;  3CGD A;  5KOW A;  3T31 A;  1P2E A;  2WS3 A;  2WOI A;  4BJZ A;  3NK2 X;  2C3D A;  3RHA A;  3DJJ A;  3NKS A;  2EQ7 A;  1DOE A;  1GRE A;  1DOB A;  3L1R A;  4H4Q A;  4XWZ A;  2IID A;  2WPC A;  3CNS A;  1XAN A;  1PJ6 A;  1CL0 A;  1YY5 A;  4YSX A;  4YSY A;  2GQF A;  1IJH A;  2GV8 A;  3UTG A;  1ZX9 A;  3H8L A;  1GRG A;  3AD7 B;  4ADW A;  2AR8 A;  1W4X A;  1COY A;  1JOA A;  4REK A;  4I58 A;  3II4 A;  2C72 A;  3BNM A;  1MXT A;  3ICR A;  3SQP A;  3M0O A;  1D4C A;  3AEE A;  1RSG A;  2IVE A;  3V3N A;  4GDE A;  2YLX A;  2XVI A;  1JRY A;  4B69 A;  5FS6 A;  4RG4 A;  3UOX A;  4K7Z A;  3LB8 A;  4EMW A;  2BK5 A;  1ELI A;  3AEC A;  4E0V A;  3KVE A;  3NNE A;  2R4J A;  3AD8 B;  1PXA A;  4G6G A;  3NG7 X;  3CGC A;  1KF6 A;  3AD9 B;  3DJE A;  4NWZ A;  1LQT A;  1Y56 B;  1H7W A;  2ARD A;  4USR A;  4U8M A;  3NYF A;  1QJD A;  4CNK A;  2XVF A;  2AAQ A;  2YLW A;  2UZZ A;  5J7X A;  4H4R A;  1OJD A;  1VQW A;  3I6D A;  1M6I A;  1GTE A;  1TDK A;  3AEA A;  1BKW A;  1CJ4 A;  4BK1 A;  3K7T A;  4B68 A;  1JU2 A;  3DJG X;  4NNJ A;  1X31 B;  3AEF A;  3SXI A;  2V6O A;  3T2Y A;  2F5Z A;  1K0L A;  3IHM A;  1E1K A;  3QSS A;  4IV9 A;  4UDR A;  2C7G A;  4X9M A;  5FS7 A;  1YKJ A;  1KFY A;  1B8S A;  1VDC A;  4Z26 A;  5LV9 A;  5CKU A;  3IC9 A;  4UP3 A;  3C96 A;  4D03 A;  1ZMD A;  3NT6 A;  2V61 A;  2R9Z A;  5JCL A;  3B6D A;  3BHF A;  3K7Q X;  3P4S A;  2WU2 A;  4K2X A;  5IQ4 A;  1REO A;  1GND A;  4TM0 A;  2Q0K A;  5BVA A;  4D04 A;  1L9D A;  5KMP A;  2DKI A;  3PVC A;  2YVF A;  2XVE A;  3UCL A;  3LZW A;  3AE5 A;  2W0H A;  3GD4 A;  2GH5 A;  4J33 A;  4OCG A;  3GMC A;  1PS9 A;  2OLO A;  3S61 A;  1GRB A;  3AYJ A;  4HB9 A;  2BXR A;  2EQ8 A;  3LXD A;  3C4A A;  4JN9 A;  3SFE A;  3UOY A;  2J3N A;  4DSH A;  1ZP0 A;  5HYM A;  2OLN A;  4OPT A;  4B66 A;  1YQZ A;  4KX6 A;  4N9X A;  4Z43 A;  3PO7 A;  2R0C A;  3CMM A;  3UTE A;  4C74 A;  2X8G A;  1PXB A;  4H2R A;  3CTY A;  3UKF A;  2WP9 A;  2YR5 A;  2APG A;  1H81 A;  3QFA A;  3HZL A;  4XWR A;  1F3P A;  4H4Z A;  1XPQ A;  1QO8 A;  1NHQ A;  4Z25 A;  3FIM B;  4C5O A;  4OPL A;  1YQ4 A;  3C4N A;  1FEC A;  2BAC A;  4G6H A;  4YKF A;  1VG9 A;  4RSL A;  4A6N A;  3QVR A;  3NN0 X;  1PJ5 A;  1NAA A;  3BI4 A;  1NG3 A;  3P4P A;  4H4W A;  4Y4M A;  2YG6 A;  1XHC A;  4J34 A;  2WP6 A;  2EQ9 A;  2WDV A;  4NTD A;  1ZOY A;  4EIP A;  2YG3 A;  2ACZ A;  2ZZC A;  1H7X A;  1Z6L A;  5EOW A;  4K5R A;  3ZYX A;  1E6E A;  2GB0 A;  3AEG A;  3P1W A;  3GMB A;  1FL2 A;  1ZOV A;  3QVP A;  1LQU A;  2C3C A;  4NTE A;  1YQ3 A;  3GWD A;  4A5L A;  2R4E A;  1M64 A;  3P9U A;  4O5Q A;  5HHF A;  1EBD A;  2YG5 A;  1CHU A;  1UKV G;  1F8R A;  2BRY A;  3G5Q A;  2R0P A;  3GDP A;  1FEB A;  2YAU A;  3NYE A;  1LPF A;  4FDC B;  3RP8 A;  1S2Q A;  2YM1 A;  4YTP A;  2X99 A;  1QLB A;  3BHK A;  3UKK A;  4IA6 A;  2BA9 A;  2YM2 A;  4HA6 A;  4JDR A;  1AOG A;  4U8K A;  5KVI A;  1Q1W A;  2WDQ A;  1CBO A;  1H83 A;  1TDO A;  3GD3 A;  4A7A A;  4K22 A;  2AQJ A;  3CGE A;  2YVJ A;  1Q9I A;  1NPX A;  5KMQ A;  3BI5 A;  2GRT A;  4IA5 A;  1K0I A;  4CCQ A;  4JY3 A;  3NYC A;  5KOX A;  2GAH B;  1E39 A;  1IUV A;  3PS9 A;  1FEA A;  2PHH A;  4FK1 C;  4TM4 A;  4H4P A;  2XCG A;  3F8P A;  2YLT A;  3DME A;  4ICY A;  1GES A;  2XFO A;  4J57 A;  2YLZ A;  2BC0 A;  3AE8 A;  3EF6 A;  4AT0 A;  1GRA A;  4Z2U A;  4A65 A;  4II2 A;  1OJA A;  1DJN A;  3ADA B;  1D5T A;  3BNU A;  1VRQ B;  5EB4 A;  5HY5 A;  1VG0 A;  1EL7 A;  4BV6 A;  1GRH A;  4WX1 A;  5CQF A;  3UKA A;  4U2S A;  3Q6J A;  2FJA A;  3SM8 A;  2XLP A;  3VR9 A;  5U1O A;  3FMW A;  1OJT A;  3ICS A;  2WET A;  4OPC A;  3NTA A;  4PAA A;  1LTX R;  2XLS A;  5KNL A;  1KSS A;  2Y6R A;  3BI2 A;  4U8L A;  1D7Y A;  1GRT A;  1H6V A;  2V3B A;  4GDP A;  3AED A;  2OAL A;  4H7U A;  3SFD A;  4DGK A;  2E1M A;  1H82 A;  1EL8 A;  2E4G A;  3QSE A;  4J31 A;  4CNJ A;  5C3J A;  2E5V A;  4RG3 A;  3CPI G;  1K4Q A;  4NEV A;  3CN8 A;  2B9Y A;  2HQM A;  1BF3 A;  3RP6 A;  1NDA A;  2TPR A;  3F8D A;  4G74 A;  4H4Y A;  3AB1 A;  4H2Q A;  1B37 A;  1NG4 A;  2FJE A;  3JSK A;  4YSZ A;  1KDG A;  1PXC A;  3COX A;  2C66 A;  1E1M A;  2VVL A;  1OJ9 A;  4GAP A;  3AE9 A;  4J36 A;  2VVL G;  1TDF A;  3ISH A;  4YSH A;  4X9N A;  1PHH A;  1PBF A;  3GYI A;  4CY8 A;  3DK8 A;  3DGZ A;  2NPX A;  2C70 A;  2GMJ A;  1N4U A;  3UTF A;  2GR0 A;  2RGH A;  1Y56 A;  2QA2 A;  4GRT A;  2QA1 A;  4YTM A;  4II3 A;  2NVK X;  2BK4 A;  3KPK A;  4AOS A;  3CND A;  4JY2 A;  5KVH A;  2BS3 A;  5JCK A;  3NH3 X;  4YTN A;  4U2L A;  1P2H A;  2RAB A;  4EQX A;  3AYL A;  2GMH A;  2A87 A;  3AE2 A;  3T2K A;  1LV0 A;  1O94 A;  3AE3 A;  3T37 A;  2VRM A;  1PBE A;  3CGB A;  2Z5X A;  4O5U A;  1CC6 A;  1Y0P A;  3AE7 A;  1NEK A;  1EL9 A;  3T14 A;  4U8N A;  1S3E A;  2BCP A;  3I3L A;  4M52 A;  3ICT A;  4U8I A;  2Q0L A;  4G73 A;  5KXJ A;  2BS2 A;  4Y4N A;  2WU5 A;  1EL5 A;  2YG7 A;  3EAO A;  5JCI A;  3RNM A;  2A89 A;  3LJP A;  3ATR A;  4H2N A;  4LU6 A;  2CFY A;  2BAB A;  4ZCD A;  4B67 A;  3M13 A;  4JQ9 A;  3GRS A;  3CNJ A;  4OPD A;  2V3A A;  3LZX A;  5IQ1 A;  3AYI A;  4YKG A;  1BGN A;  1JEH A;  2H88 A;  1GSN A;  3UOZ A;  3VR8 A;  3SZC A;  4C3Y A;  3DK4 A;  4K8D A;  3WE0 A;  4GUV A;  2VVM A;  3UKQ A;  1PDH A;  1OJC A;  4EM4 A;  2VOU A;  2XFP A;  2WQY A;  4OPG A;  2XYO A;  3LAD A;  3NN6 X;  3QSM A;  2X3N A;  1JNZ A;  3K30 A;  2OAM A;  4OVI A;  5DBJ A;  4YWO A;  3T0K A;  2C73 A;  2XFQ A;  3T2Z A;  5C2T A;  1MO9 A;  4EQW A;  1TDE A;  2YR6 A;  2GR3 A;  1IUX A;  2C65 A;  2GR2 A;  2JB1 A;  2GF3 A;  5GRT A;  2R46 A;  1PBD A;  2OA1 A;  1D4E A;  3FPZ A;  2CDU A;  1DXL A;  4CBQ A;  2B7R A;  2B7S A;  1ZKQ A;  2BC1 A;  3QFB A;  3NK1 X;  3H4K A;  1KNP A;  4H4S A;  3UKH A;  2TMD A;  1RP0 A;  3AE6 A;  1GPE A;  3QJ4 A;  2H89 A;  2V5Z A;  3R9U A;  1F6M A;  5KMS A;  2JKC A;  3AE4 A;  3NK0 X;  4AP3 A;  4MJW A;  4B1B A;  1BWC A;  1H84 A;  1GEU A;  2FJD A;  5KMR A;  3KU9 A;  5L46 A;  4DNA A;  2WOV A;  2ZZ0 A;  1GTH A;  3P4Q A;  4JNQ A;  1HYU A;  3ALM A;  2WPF A;  3KA7 A;  3UOV A;  1LVL A;  4GR1 A;  3URH A;  3ZDN A;  4WCT A;  2CUL A;  5JCM A;  1IUW A;  3UKL A;  4GCM A;  2BXS A;  2FJB A;  4TLZ A;  2BRA A;  3HYW A;  4BK2 A;  3DH9 A;  4Z24 A;  2R45 A;  2XLT A;  3EPT A;  3GYX A;  4C77 A;  3IWA A;  4J56 A;  2XFN A;  1DOC A;  4PAB A;  2WPE A;  1NHS A;  3CIR A;  1GXF A;  4EM3 A;  3ALL A;  1SEZ A;  4USQ A;  3ABV A;  3ITJ A;  4H50 A;  4LII A;  2VQB A;  3GRT A;  2GAG B;  2DKH A;  1CF3 A;  2WES A;  3B3R A;  3SYI A;  2X8C A;  4KPR A;  1DOD A;  2XLU A;  4BJY A;  2JK6 A;  3NTD A;  4H4T A;  5BUK A;  3G5R A;  3NLC A;  1GET A;  4J2W A;  1GER A;  1PJ7 A;  2B9W A;  1O95 A;  3FG2 P;  3UP4 A;  1KSU A;  4YXD A;  4ZN0 A;  5JCN A;  2WP5 A;  4CY6 A;  4TM1 A;  2YLR A;  2C75 A;  2R0G A;  2GVC A;  2WEU A;  3D1C A;  3HYX A;  3O0H A;  3SGL A;  4AT2 A;  1LJ1 A;  3M12 A;  4H2P A;  1K0J A;  3SX6 A;  5FS9 A;  3IF9 A;  2GQW A;  4Z44 A;  1DJQ A;  2Q6U A;  3CPH G;  4B63 A;  4BUR A;  2BCG G;  5J60 A;  1B5Q A;  3ALJ A;  3S5W A;  3SZ0 A;  1GOS A;  4C3X A;  2CVJ A;  4UDQ A;  2JAE A;  3UP5 A;  2C76 A;  2QAE A;  1F8S A;  1ONF A;  3VRA A;  5M0Z A;  4TLX A;  1ZDL A;  4EMI A;  5BRT A;  2EQ6 A;  4X4J A;  3AE1 A;  2C64 A;  3E1T A;  3GWF A;  4EQS A;  1O5W A;  4B64 A;  4A9W A;  2ZBW A;  4AOX A;  2XLR A;  3OZ2 A;  1GV4 A;  3L8K A;  3SY4 A;  1L9C A;  3DK9 A;  4APN A;  4EMJ A;  5ER0 A;  1E1L A;  1V59 A;  2O9Z A;  2YWL A;  4NEW A;  4A99 A;  4AP1 A;  3AXB A;  5FS8 A;  2B9X A;  5U25 A;  5GSN A;  2IVD A;  1TYT A;  2JBV A;  4B65 A;  3ATQ A;  2C67 A;  1TDN A;  2Q7V A;  2VZ2 A;  2X50 A;  1DNC A;  4U8O A;  4P9S A;  4GF7 A;  3CNP A;  2GEW A;  5IPY A;  3DJD A;  4XXG A;  4YT0 A;  3UTH A;  1GAL A;  1NEN A;  2WBA A;  2VQ7 A;  1IUT A;  1PN0 A;  3GSI A;  4A6N B;  4BK3 A;  3HYV A;  4H4X A;  2GR1 A;  2YVG A;  4Z2T A;  2BK3 A;  4IVM B;  2V60 A;  2PYX A;  1FCD A;  2X8H A;  4JNA A;  2XVH A;  1PBC A;  3SZW A;  3VRD B;  4CRT A;  1CJ3 A;  4OPU A;  2JB2 A;  4EIQ A;  2I0Z A;  4ECH A;  3IHG A;  1S2Y A;  2WOW A;  3RED A;  1TRB A;  1D4D A;  3G5S A;  2BS4 A;  1PBB A;  2XDO A;  3DA1 A;  4NZH A;  2A8X A;  1CJ2 A;  2XVJ A;  1JRZ A;  1N1P A;  3DGH A;  3LOV A;  1S3B A;  4G9K A;  4U8J A;  4UDP A;  3H8I A;  3V3O A;  3AWI A;  4DSG A;  3GDN A;  4GAV A;  3FBS A;  1RYI A;  2BYB A;  3NIX A;  5EBK A;  1ZMC A;  2ZZB A;  4I59 A;  4K5S A;  1F8W A;  1ZK7 A;  4FK1 A;  1L9E A;  3SZF A;  1IUU A;  2B76 A;  5M10 A;  1FOH A;  1L0V A;  3V76 A;  3NRN A;  2RGJ A;  4IVO B;  5TR3 A;  3VRB A;  3NHO X;  1NHP A;  4ZCC A;  2JB3 A;  4Y4L A;  3KKJ A;  1NHR A;  2C4C A;  1BZL A;  1Q1R A;  1TYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...