3ALMA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMAPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3almA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3almA01
1TDOA 1PBFA 4Y4LA 4AOSA 2R45A 5FS8A 4H4VA 4CNJA 1LPFA 3P1WA 3IC9A 1D7LA 2YG6A 1ELIA 3NN0X 4A79A 2BS4A 3FPZA 2OAMA 3UKAA 4YSHA 3BHKA 3P4SA 3DGHA 5FS6A 2HQMA 4K2XA 1O5WA 1XANA 2V3AA 3DJDA 2YLSA 3RP7A 1D4DA 2PYXA 1GREA 4JDRA 2DKHA 2WP6A 2OA1A 3NRNA 5KRQA 5L46A 1GEUA 3P4RA 2QAEA 3DGZA 1EL5A 4LA1A 2A8XA 2BA9A 3EPTA 4U2SA 1JNRA 3QVRA 3LZWA 1CF3A 1Y56A 1GV4A 4IVMB 2V6OA 5LV9A 4OCGA 4JY3A 4U8OA 3SM8A 1GT8A 1ZK7A 2WHDA 3PVCA 4U8JA 5J60A 4C3YA 4YTNA 1RSGA 5KXJA 2UZZA 2E1MA 1KDGA 3F8PA 5BVAA 2H88A 4FK1C 1LJ1A 4IA6A 4Z44A 2B7RA 4EIQA 1H83A 1YY5A 2XYOA 1EL8A 1GTHA 2IIDA 1GRGA 1RP0A 3AEAA 4H4RA 4PABA 2FJDA 1DNCA 1PXCA 5BUKA 3VRAA 3IWAA 3NT6A 1FECA 1FEAA 3DJJA 1D5TA 4IA5A 1B37A 2E4GA 2GAHB 1CJ2A 2WOWA 2ZZBA 2BS3A 2VVLA 5TR3A 2CDUA 1TYPA 1LQUA 3CNSA 3CPHG 4BJYA 1KSUA 5CQFA 2FJEA 1E6EA 3NH3X 5HY5A 1PN0A 1H6VA 2EQ7A 2YAUA 1TDNA 5KVHA 3F8RA 2BYBA 3PS9A 4RG4A 3NYEA 1QJDA 2Q6UA 4A99A 2YR5A 4K7ZA 1S2YA 1ZOYA 5CKUA 5EBKA 5BULA 5FS9A 1K4QA 1JU2A 2V3BA 1GNDA 4A6NA 2BC1A 4Z43A 3VRBA 4C5OA 3BHFA 1TYTA 4OPIA 1BGJA 2WDQA 1CL0A 3QFBA 3UP5A 4DSHA 2VQBA 1GRTA 4UP3A 3AECA 3CPJG 2XLRA 5GRTA 3AE9A 3GD3A 4K8DA 1IJHA 4EM4A 4AP3A 1OJDA 3M13A 1N4WA 4TM3A 3AB1A 4H2PA 1GETA 3BNMA 1IUSA 1P2HA 3GMBA 1CJ3A 3CIRA 2R0GA 1JNZA 1DOCA 1X31B 4EMJA 1UKVG 3I6DA 2Z5YA 1F8RA 3UTFA 4EQXA 5HYMA 1NDAA 2Y6QA 3UP4A 4D03A 3L1RA 2GV8A 2PHHA 4BK2A 1YQ3A 1S3BA 2BS2A 1H82A 3VQRA 4YSYA 1E1KA 3C4NA 1CC4A 4EQWA 1DJNA 1NAAA 4HA6A 1DODA 1GRHA 1TDEA 2ARDA 3K7MX 3M0OA 3UKKA 3V3NA 5KOWA 3QFAA 3AE1A 4X9NA 4WCTA 3K7TA 4TLZA 4D04A 1BZLA 4A9WA 2YM2A 3UOZA 4TM1A 3SFDA 3LADA 2TMDA 3IHMA 4OPDA 2Q7VA 2QCUA 2WPEA 1ONFA 1CHUA 1YQZA 1RYIA 1SEZA 4WX1A 4ZCDA 4MJWA 4O5QA 5EOWA 1IUVA 4Y4MA 2Q0KA 4M52A 4ADWA 4K5SA 2WETA 4LIIA 1EBDA 2XVJA 2JAEA 3AE2A 1EL9A 2JB2A 1PBBA 2OALA 4TLXA 1GRBA 3AE4A 3URHA 4A65A 2B9YA 2WS3A 2YG3A 3RP6A 3EF6A 1PHHA 3UOXA 4RSLA 4YTPA 5JCLA 4AT0A 1OJAA 3UKPA 3K7QX 4AOXA 2BCGG 4EQRA 3FG2P 2BK4A 3BI4A 5FMHA 4YXDA 1KF6A 2GQFA 4USRA 2V5ZA 2GQWA 4C74A 3RHAA 4Z2TA 1K0LA 3D1CA 2AAQA 3GDPA 3HZLA 2EQ9A 3SGLA 2XDOA 3M12A 4J36A 4U8LA 2TPRA 4P9SA 2VZ2A 4B66A 2FBWA 3AE7A 1PJ7A 4PAAA 1LVLA 1PJ6A 3AWIA 4NZHA 5JCMA 2APGA 4JY2A 2O9ZA 1VRQB 4GCMA 1PDHA 5IQ1A 3AYJA 4K5RA 2W0HA 3UKHA 4X4JA 2JB3A 3H4KA 3DK9A 1Y56B 4NTCA 1L9EA 1PBDA 4CCQA 2ZBWA 2X8CA 4HB9A 5M0ZA 1IUWA 1JEHA 2WP9A 1E1LA 3CTYA 1CJCA 4H4ZA 4BV6A 3D8XA 3AE5A 4IV9A 2YVJA 3DJGX 1GERA 3SFEA 5KWFA 1GESA 4GUVA 2C7GA 1NHPA 2YR6A 3REDA 4CRTA 1O95A 1GPEA 1L0VA 2ZZCA 3BNUA 3FIMB 3UTEA 4H7UA 4Z24A 3ATQA 1BF3A 2GH5A 3GSIA 1E7PA 2YQUA 2YVFA 4B1BA 1E1MA 2WU2A 3H8LA 3LZXA 4B69A 4OPGA 1LV0A 4H4YA 1MO9A 4YKGA 1KFYA 1HYUA 3AEGA 4EM3A 5HXIA 2C67A 1Y0PA 4X9MA 3UCLA 2GAGB 4BK3A 1ZX9A 3CNTA 2XFPA 4H2RA 4XXGA 1F6MA 2R4EA 4B64A 3CGEA 4K22A 4J57A 3KPFA 2JK6A 3DK8A 2C72A 3K30A 2WDRA 2X99A 3AE6A 2J3NA 2B7SA 3DMEA 4FDCB 4YSXA 4BURA 1DXLA 1NPXA 2WP5A 1F3PA 3G5SA 3BI5A 1ZOVA 2BXRA 4AT2A 2JKCA 1NENA 4ECHA 2QA1A 3DJEA 3KKJA 5IPYA 3IHGA 1BKWA 2WOIA 2RGHA 5C3JA 2XVHA 2XVEA 3AD9B 2YG7A 4OPTA 1COYA 2WESA 3CGCA 4CCRA 3CN8A 4FK1A 4APNA 2GRTA 4JN9A 1O94A 1XDIA 2A87A 2NVKX 4U8PA 1NHRA 2YLTA 4U8KA 2GVCA 3R9UA 3NK2X 4U2TA 1DOBA 3ISHA 3UKLA 2VQ7A 3KU9A 1XHCA 3AE3A 2XVFA 4A5LA 3GRSA 1VG0A 2OLNA 4U2LA 3GMCA 3QSSA 4NTEA 3S5WA 4Z25A 5C2TA 3F8DA 3LOVA 3UTHA 1IUTA 3KVEA 3O0HA 2FJAA 2C70A 3EAOA 3FBSA 2C3DA 3AEDA 2JB1A 2X8GA 1YKJA 2Z5XA 1ZP0A 1S2QA 3QSEA 1PJ5A 3VR9A 2X3NA 1EL7A 3BI2A 3QSMA 1N1PA 4ICYA 3NNEA 4GDEA 4UDQA 4XWRA 4Z2RA 1QO8A 3AEEA 2VVLG 2XLTA 2XFUA 2EQ8A 2WU5A 2XVIA 3NLCA 5ER0A 2YR4A 5GSNA 3I3LA 1PBCA 2YLXA 4O5UA 3ALLA 1GSNA 5HHFA 3V76A 1K0JA 5U63A 3UKQA 1KSSA 1ZMDA 3AE8A 3FMWA 2XLUA 3AXBA 4TM4A 1MXTA 1V59A 4YKFA 3EANA 4NTDA 3AD7B 2YG5A 1NG4A 2YLRA 3GWFA 2BC0A 2XLSA 3NTDA 4BK1A 2RABA 4YSZA 3NGCX 1PXBA 1H7XA 2C75A 1B4VA 2VOUA 3CNPA 2R46A 4RG3A 5JCNA 3V3OA 1JRZA 1LQTA 5FS7A 2C73A 4U8IA 2BK3A 2V60A 3NYCA 2B9XA 3PO7A 1TRBA 2GR0A 3COXA 3ITJA 4OVIA 4USQA 5JCIA 1GALA 2R0PA 1H7WA 5KOXA 2X8HA 3P4PA 3CPIG 4I58A 4H4PA 3Q6JA 4H4WA 3G5RA 3B6DA 3II4A 4OPCA 1CC6A 1PBEA 3ALMA 2C3CA 1F8SA 2WPFA 3KLJA 3VR8A 5BRTA 1LTXR 1DOEA 4H50A 1CJ4A 3UOVA 4EMWA 1E1NA 1H84A 3DA1A 4DSGA 3NTAA 3CNDA 3AD8B 4CNKA 4N9XA 1FOHA 1FL2A 2RGJA 2WBAA 5EB4A 4GRTA 2BCPA 1KNPA 2XCGA 3UKFA 4YWOA 3NYFA 2GR3A 2VVMA 2XFQA 3ZYXA 4BJZA 1GRAA 4J56A 1E39A 4CBQA 4ZN0A 4U8MA 3GWDA 4JNAA 1OJ9A 2Q0LA 2V61A 2GB0A 1JRYA 3ATRA 2WOVA 2NPXA 4A6NB 4E0VA 4FX9A 3AEBA 2AR8A 1IUXA 1ZY8A 4YT0A 1VDCA 2YLWA 5U25A 4GF7A 1D4CA 3OC4A 4REKA 4B63A 2CVJA 1ZMCA 1PS9A 1VG9A 1XPQA 2C76A 4J34A 2BK5A 3DK4A 4DNAA 2ACZA 2E5VA 5IQ4A 1NG3A 3KD9A 1F8WA 1S3EA 4AP1A 1KNRA 2GR2A 2XLPA 3IF9A 3GRTA 4XWZA 2FJBA 4NEVA 2GEWA 1DJQA 2JBVA 2IVDA 2AQJA 3ICTA 3NG7X 2R4JA 1NHQA 3VRDB 2C64A 3L8KA 1JRXA 3CNJA 2CULA 4B65A 1BWCA 3OZ2A 2C65A 4H4SA 1Q1RA 3QVPA 5DBJA 5KVIA 2A89A 2VRLA 3RNMA 3AYLA 2XFNA 2YG4A 3H8IA 1GOSA 3T37A 4LU6A 4EQSA 1JOAA 2OLOA 4Y4NA 3NKSA 2DKIA 4CY6A 1FCDA 2BACA 3C96A 3P9UA 4UDPA 1TDFA 2GMHA 2ZZ0A 1P2EA 4IVOB 3ADAB 1B8SA 1L9DA 3ALJA 4UDRA 1GRFA 2GMJA 3GD4A 1Q9IA 2Y6RA 2XFOA 3C4AA 5U1OA 3DH9A 1H81A 1NEKA 3GYJA 3CGDA 1VQWA 3QJ4A 4I59A 1PXAA 2C66A 2WEUA 2BABA 4J2WA 1ZKQA 2CFYA 1B5QA 2WQYA 4H2QA 3LB8A 3AYIA 4C77A 1AOGA 4OPLA 1YQ4A 2YVGA 1BGNA 2IVEA 4GDPA 2BXSA 4J33A 4OPUA 1OJTA 1OJCA 4KX6A 4EIPA 3LXDA 1D4EA 3B3RA 2WPCA 4JNQA 1CBOA 3UOYA 1FEBA 2B76A 5J7XA 2GR1A 4NEWA 2R0CA 1TDKA 2YWLA 1IUUA 1REOA 1H86A 4YTMA 3ABVA 4Z26A 2F5ZA 3KA7A 3E1TA 3Q9TA 4GR1A 1W4XA 1ZDLA 3G5QA 3NHOX 5M10A 4H4UA 2QA2A 3RP8A 1M64A 3UTGA 1NHSA 2R9ZA 3CGBA 4EMIA 1GXFA 3GDNA 1QLBA 2YM1A 3NK0X 2X50A 3NN6X 2YLZA 4H4XA 1GTEA 2WDVA 1L9CA 4KPRA 2H89A 2VRMA 4B68A 4DGKA 1D7YA 1N4UA 4J31A 1Z6LA 3ICRA 3S61A 3JSKA 3LJPA 2EQ6A 2I0ZA 1MOKA 4H4TA 3P4QA 4A7AA 4H4QA 1Q1WA 5EB5A 3ICSA 1N4VA 4ZCCA 1K0IA 4TM0A 3GYIA 3NK1X 3WE0A 3NIXA 4C3XA 4Z2UA 2GF3A 4U8NA 3ZDNA 4CY8A 3AEFA 3SQPA 2RGOA 5JCKA 4H2NA 1M6IA 4B67A 4JQ9A 2B9WA 1CC2A
chains in the Genus database with same CATH superfamily
1TDOA 1PBFA 4Y4LA 4AOSA 2R45A 5FS8A 4H4VA 4CNJA 1LPFA 3T2YA 3P1WA 3IC9A 1D7LA 2YG6A 1ELIA 3NN0X 4A79A 2BS4A 3FPZA 2OAMA 3UKAA 4YSHA 3BHKA 3P4SA 3DGHA 5FS6A 2HQMA 4K2XA 3DJDA 1O5WA 1XANA 2V3AA 2YLSA 3RP7A 1D4DA 2PYXA 5L46A 1GREA 2DKHA 2WP6A 2OA1A 3NRNA 4JDRA 5KRQA 4NWZA 1GEUA 3P4RA 2QAEA 3DGZA 1EL5A 4LA1A 2A8XA 2BA9A 4G9KA 3EPTA 4U2SA 1JNRA 3QVRA 3LZWA 1CF3A 1Y56A 1GV4A 4IVMB 2V6OA 5LV9A 4OCGA 4JY3A 3SM8A 4U8OA 1GT8A 1ZK7A 2WHDA 3PVCA 4U8JA 5J60A 4C3YA 4YTNA 1RSGA 5KXJA 2UZZA 2E1MA 1KDGA 3F8PA 5BVAA 2H88A 4IA6A 1LJ1A 4FK1C 3HYXA 2B7RA 4EIQA 1H83A 4Z44A 3T14A 1YY5A 2XYOA 1EL8A 1GTHA 4PABA 1GRGA 1RP0A 2IIDA 3AEAA 4H4RA 2FJDA 1DNCA 1PXCA 5BUKA 3VRAA 5KMPA 3IWAA 3NT6A 1FECA 1FEAA 3DJJA 4IA5A 1D5TA 1B37A 2E4GA 2GAHB 1CJ2A 2WOWA 1C0KA 2ZZBA 2BS3A 2VVLA 5TR3A 1TYPA 4YJGA 1LQUA 2CDUA 4BJYA 3CNSA 3CPHG 1KSUA 5CQFA 2FJEA 1E6EA 3NH3X 5HY5A 1PN0A 1H6VA 2EQ7A 2YAUA 1TDNA 5KVHA 3F8RA 2BYBA 3PS9A 4RG4A 3NYEA 1QJDA 2Q6UA 4A99A 2YR5A 4K7ZA 1S2YA 1ZOYA 5CKUA 5EBKA 5BULA 5FS9A 1K4QA 1JU2A 2V3BA 1GNDA 4A6NA 2BC1A 4Z43A 3VRBA 4C5OA 3BHFA 1TYTA 4OPIA 1BGJA 2WDQA 1CL0A 3QFBA 3UP5A 4DSHA 2VQBA 1GRTA 4UP3A 3AECA 3CPJG 2XLRA 5GRTA 3AE9A 3GD3A 4K8DA 1IJHA 4EM4A 4AP3A 1OJDA 3M13A 1N4WA 4TM3A 3AB1A 4H2PA 1GETA 3BNMA 1IUSA 1P2HA 1AN9A 3GMBA 4NNJA 1CJ3A 3CIRA 2R0GA 1JNZA 1DOCA 1X31B 4EMJA 1UKVG 3I6DA 2Z5YA 1F8RA 3UTFA 4EQXA 5HYMA 1NDAA 2Y6QA 3UP4A 4D03A 3L1RA 2GV8A 2PHHA 4BK2A 1YQ3A 1S3BA 3VQRA 1H82A 2BS2A 4YSYA 3C4NA 1E1KA 1CC4A 4EQWA 1DJNA 1NAAA 4HA6A 1DODA 1GRHA 1TDEA 2ARDA 3K7MX 3M0OA 3UKKA 3V3NA 5KOWA 3QFAA 3AE1A 4X9NA 4WCTA 3K7TA 4TLZA 4D04A 1BZLA 4A9WA 2YM2A 3UOZA 4TM1A 3SFDA 3LADA 2TMDA 3IHMA 4OPDA 2Q7VA 2QCUA 2WPEA 1ONFA 1CHUA 1YQZA 1RYIA 1SEZA 4WX1A 4ZCDA 4MJWA 4O5QA 5EOWA 1IUVA 4Y4MA 2Q0KA 4M52A 4ADWA 4K5SA 2WETA 4LIIA 1EBDA 2XVJA 2JAEA 2E49A 3AE2A 1EL9A 2JB2A 1PBBA 2OALA 4TLXA 1GRBA 3AE4A 3URHA 4A65A 2B9YA 2WS3A 2YG3A 3RP6A 3EF6A 1PHHA 3UOXA 4RSLA 4YTPA 5JCLA 4AT0A 1OJAA 3UKPA 3K7QX 4AOXA 2BCGG 4EQRA 3FG2P 2BK4A 3BI4A 5FMHA 4YXDA 1KF6A 2GQFA 3W4IA 4USRA 2V5ZA 2GQWA 3WGTA 3RHAA 4C74A 4Z2TA 1K0LA 3D1CA 2AAQA 3GDPA 3HZLA 2EQ9A 3SGLA 2XDOA 3M12A 4J36A 4U8LA 2TPRA 4P9SA 2VZ2A 4B66A 2FBWA 3AE7A 1PJ7A 4PAAA 1LVLA 1PJ6A 3AWIA 4NZHA 5JCMA 2APGA 4JY2A 2O9ZA 1VRQB 4GCMA 1PDHA 5IQ1A 3AYJA 4K5RA 2W0HA 2E48A 3UKHA 4X4JA 2JB3A 3H4KA 3DK9A 1Y56B 4NTCA 1L9EA 1PBDA 4CCQA 2ZBWA 2X8CA 4HB9A 5M0ZA 1IUWA 1JEHA 2WP9A 1E1LA 3CTYA 1CJCA 4H4ZA 4BV6A 3D8XA 3AE5A 4IV9A 2YVJA 3DJGX 1GERA 3SFEA 5KWFA 1GESA 4GUVA 2C7GA 1NHPA 2YR6A 3REDA 4CRTA 1O95A 1GPEA 1L0VA 1C0IA 2ZZCA 3BNUA 3FIMB 3UTEA 4H7UA 5KMSA 3GYXA 4Z24A 3ATQA 1BF3A 3GSIA 2GH5A 1E7PA 2YQUA 2YVFA 4YJHA 4B1BA 1E1MA 2WU2A 3H8LA 3LZXA 4B69A 4OPGA 1LV0A 4H4YA 1MO9A 4YKGA 1C0PA 1HYUA 1KFYA 3AEGA 5HXIA 4EM3A 2C67A 4X9MA 1Y0PA 3UCLA 2GAGB 4BK3A 1ZX9A 3CNTA 2XFPA 3SY4A 4H2RA 4XXGA 1F6MA 2R4EA 4B64A 3CGEA 4K22A 4J57A 3KPFA 2JK6A 3DK8A 2C72A 3K30A 2WDRA 2X99A 4G6GA 3AE6A 2J3NA 2B7SA 3DMEA 4FDCB 4YSXA 4BURA 1DXLA 1NPXA 2WP5A 1F3PA 3G5SA 3BI5A 1ZOVA 2BXRA 4AT2A 2JKCA 1NENA 4ECHA 2E82A 2QA1A 3ZNNA 3DJEA 3KKJA 5IPYA 3IHGA 1BKWA 2WOIA 2RGHA 5C3JA 2XVHA 3AD9B 2XVEA 2YG7A 4OPTA 1COYA 2WESA 3CGCA 4CCRA 3CN8A 4FK1A 4APNA 2GRTA 4JN9A 1O94A 1XDIA 2A87A 2NVKX 4U8PA 1NHRA 2YLTA 4U8KA 2GVCA 3R9UA 3NK2X 4U2TA 1DOBA 3ISHA 3UKLA 2VQ7A 3KU9A 1XHCA 3SZ0A 3AE3A 2XVFA 4A5LA 3GRSA 1VG0A 2OLNA 4U2LA 3GMCA 3QSSA 4NTEA 3S5WA 4Z25A 5C2TA 3W4JA 3CMMA 1KIFA 2BRYA 3F8DA 3LOVA 3UTHA 1IUTA 3KVEA 3O0HA 2FJAA 2C70A 3EAOA 3FBSA 2C3DA 3AEDA 2JB1A 2X8GA 1YKJA 2Z5XA 1ZP0A 1S2QA 3QSEA 1PJ5A 3VR9A 3CUKA 1EL7A 2X3NA 3QSMA 3BI2A 1N1PA 4G6HA 3NNEA 4GDEA 4ICYA 4UDQA 4XWRA 1QO8A 4Z2RA 3AEEA 2VVLG 2XLTA 2XFUA 2EQ8A 2WU5A 2XVIA 3NLCA 5ER0A 2YR4A 5GSNA 3I3LA 1PBCA 2YLXA 4O5UA 3ALLA 1GSNA 5HHFA 3V76A 1K0JA 5KMRA 5U63A 3UKQA 1KSSA 1ZMDA 3AE8A 3FMWA 2XLUA 3AXBA 4TM4A 1MXTA 1V59A 4YKFA 3EANA 4NTDA 3AD7B 2YG5A 1NG4A 2YLRA 3GWFA 2BC0A 2XLSA 3NTDA 4BK1A 2RABA 4YSZA 3NGCX 1PXBA 1H7XA 2VOUA 1B4VA 2C75A 3CNPA 2R46A 4RG3A 5JCNA 3V3OA 1JRZA 1C0LA 1LQTA 5FS7A 4GAVA 2C73A 4U8IA 2BK3A 2V60A 3NYCA 2B9XA 3PO7A 3SZCA 1TRBA 2GR0A 3COXA 3ITJA 3KPKA 4OVIA 4USQA 5JCIA 1GALA 2R0PA 4YJFB 1H7WA 5KOXA 2X8HA 3P4PA 3CPIG 4I58A 4H4PA 3Q6JA 4H4WA 3G5RA 3B6DA 3II4A 4OPCA 1CC6A 1PBEA 3ALMA 2C3CA 1F8SA 2WPFA 3HYWA 3KLJA 4G73A 3VR8A 5BRTA 1LTXR 1DOEA 4H50A 1CJ4A 3UOVA 4EMWA 1E1NA 1H84A 3DA1A 4DSGA 3NTAA 3ZNPA 3SZWA 3CNDA 1VE9A 3T2KA 3AD8B 4CNKA 4N9XA 1FOHA 1FL2A 2RGJA 4QFCA 2WBAA 5EB4A 4GRTA 2BCPA 1KNPA 2XCGA 3UKFA 4YWOA 3NYFA 2GR3A 2VVMA 2XFQA 3ZYXA 4BJZA 1GRAA 4J56A 4YJDA 4QFDA 1E39A 4CBQA 4ZN0A 4U8MA 3GWDA 4JNAA 1OJ9A 2Q0LA 2V61A 2GB0A 1JRYA 3ATRA 2WOVA 2NPXA 3HYVA 4A6NB 4E0VA 4FX9A 3AEBA 2AR8A 1IUXA 2DU8A 3SYIA 1ZY8A 4YT0A 1VDCA 2YLWA 5U25A 4GF7A 1D4CA 3OC4A 4REKA 4B63A 1ZMCA 2CVJA 1PS9A 1VG9A 1XPQA 2C76A 4J34A 2BK5A 3DK4A 4DNAA 2ACZA 2E5VA 5IQ4A 1NG3A 1DDOA 3KD9A 1F8WA 4GAPA 1S3EA 4AP1A 3IF9A 1KNRA 2GR2A 2XLPA 3GRTA 4XWZA 2FJBA 4NEVA 2GEWA 1DJQA 2JBVA 2IVDA 2AQJA 3ICTA 4II3A 3NG7X 2R4JA 1NHQA 3VRDB 1EVIA 2C64A 3L8KA 1JRXA 3CNJA 2CULA 3T2ZA 3G3EA 4B65A 3OZ2A 1BWCA 2C65A 4H4SA 1Q1RA 4G74A 3QVPA 5DBJA 5KVIA 2A89A 2VRLA 3RNMA 3AYLA 2XFNA 2YG4A 3H8IA 1GOSA 3T37A 5KNLA 4LU6A 4YJFA 4EQSA 1JOAA 2OLOA 4Y4NA 3T0KA 3NKSA 2DKIA 4CY6A 1FCDA 2BACA 3C96A 3P9UA 4UDPA 1TDFA 2GMHA 2ZZ0A 1P2EA 4II2A 4IVOB 3ADAB 1B8SA 1L9DA 3ALJA 4UDRA 2GMJA 1GRFA 3GD4A 1Q9IA 2Y6RA 2XFOA 3C4AA 5U1OA 2C4CA 3DH9A 1H81A 1NEKA 3GYJA 3CGDA 1VQWA 3QJ4A 4I59A 1PXAA 2C66A 2WEUA 2BABA 4J2WA 1ZKQA 2CFYA 1B5QA 2WQYA 4H2QA 3LB8A 3AYIA 4C77A 1AOGA 4OPLA 1YQ4A 2YVGA 1BGNA 2IVEA 4GDPA 2BXSA 4J33A 4OPUA 1OJTA 1OJCA 4KX6A 4YJHB 5KMQA 4EIPA 3LXDA 1D4EA 3B3RA 2WPCA 4JNQA 3SXIA 1CBOA 3UOYA 1FEBA 2B76A 3SZFA 5J7XA 2GR1A 4NEWA 2R0CA 1TDKA 2YWLA 1IUUA 1REOA 1H86A 4YTMA 3ABVA 4Z26A 3SX6A 2F5ZA 3KA7A 3E1TA 3Q9TA 4GR1A 1W4XA 1ZDLA 3G5QA 3NHOX 5M10A 2E4AA 4H4UA 3RP8A 2QA2A 1M64A 3UTGA 1NHSA 2R9ZA 3CGBA 4EMIA 1GXFA 3GDNA 1QLBA 2YM1A 3NK0X 2X50A 3NN6X 2YLZA 4H4XA 3T31A 1GTEA 2WDVA 1L9CA 4KPRA 2H89A 2VRMA 4B68A 4DGKA 1D7YA 1N4UA 4J31A 1Z6LA 3ICRA 3S61A 1DAOA 3JSKA 3LJPA 2EQ6A 2I0ZA 1MOKA 4H4TA 3P4QA 4A7AA 4H4QA 2BRAA 1Q1WA 5EB5A 3ICSA 1N4VA 4YJGB 4ZCCA 3W4KA 1K0IA 4TM0A 3GYIA 3NK1X 3WE0A 3NIXA 4C3XA 4Z2UA 2GF3A 4U8NA 3ZDNA 4CY8A 3AEFA 3ZNQA 2RGOA 3SQPA 5JCKA 4H2NA 1M6IA 4B67A 4JQ9A 2B9WA 1CC2A 3ZNOA
chains in the Genus database with same CATH topology
1TDOA 1PBFA 4Y4LA 4AOSA 2R45A 5FS8A 4H4VA 4CNJA 1LPFA 3T2YA 3P1WA 3IC9A 1D7LA 2YG6A 1ELIA 3NN0X 4A79A 2BS4A 3FPZA 2OAMA 3UKAA 4YSHA 3BHKA 3P4SA 3DGHA 5FS6A 2HQMA 4K2XA 1O5WA 1XANA 2V3AA 3DJDA 2YLSA 3RP7A 1D4DA 2PYXA 1GREA 4JDRA 2DKHA 2WP6A 2OA1A 3NRNA 5KRQA 5L46A 4NWZA 1GEUA 3P4RA 2QAEA 3DGZA 1EL5A 4LA1A 2A8XA 2BA9A 4G9KA 3EPTA 4U2SA 1JNRA 3QVRA 3LZWA 1CF3A 1Y56A 1GV4A 4IVMB 2V6OA 5LV9A 4OCGA 4JY3A 4U8OA 3SM8A 1GT8A 1ZK7A 2WHDA 3PVCA 4U8JA 5J60A 4C3YA 4YTNA 1RSGA 5KXJA 2UZZA 2E1MA 1KDGA 3F8PA 5BVAA 2H88A 4IA6A 1LJ1A 4FK1C 3HYXA 2B7RA 4EIQA 1H83A 4Z44A 3T14A 1YY5A 2XYOA 1EL8A 1GTHA 2IIDA 1GRGA 1RP0A 3AEAA 4H4RA 4PABA 2FJDA 1DNCA 1PXCA 5BUKA 3VRAA 5KMPA 3IWAA 3NT6A 1FECA 1FEAA 3DJJA 4IA5A 1D5TA 1B37A 2E4GA 2GAHB 1CJ2A 2WOWA 2ZZBA 2BS3A 2VVLA 5TR3A 2CDUA 1TYPA 1LQUA 3CNSA 4BJYA 3CPHG 1KSUA 5CQFA 2FJEA 1E6EA 3NH3X 5HY5A 1PN0A 1H6VA 2EQ7A 2YAUA 1TDNA 5KVHA 3F8RA 2BYBA 3PS9A 4RG4A 3NYEA 1QJDA 2Q6UA 4A99A 2YR5A 4K7ZA 1S2YA 1ZOYA 5CKUA 5EBKA 5BULA 5FS9A 1K4QA 1JU2A 2V3BA 1GNDA 4A6NA 2BC1A 4Z43A 3VRBA 4C5OA 3BHFA 1TYTA 4OPIA 1BGJA 2WDQA 1CL0A 3QFBA 3UP5A 4DSHA 2VQBA 1GRTA 4UP3A 3AECA 3CPJG 2XLRA 5GRTA 3AE9A 3GD3A 4K8DA 1IJHA 4EM4A 4AP3A 1OJDA 3M13A 1N4WA 4TM3A 3AB1A 4H2PA 1GETA 3BNMA 1IUSA 1P2HA 3GMBA 4NNJA 1CJ3A 3CIRA 2R0GA 1JNZA 1DOCA 1X31B 4EMJA 1UKVG 3I6DA 2Z5YA 1F8RA 3UTFA 4EQXA 5HYMA 1NDAA 2Y6QA 3UP4A 4D03A 3L1RA 2GV8A 4BK2A 2PHHA 1YQ3A 1S3BA 2BS2A 1H82A 3VQRA 4YSYA 1E1KA 3C4NA 1CC4A 4EQWA 1DJNA 1NAAA 4HA6A 1DODA 1GRHA 1TDEA 2ARDA 3K7MX 3M0OA 3UKKA 3V3NA 5KOWA 3QFAA 3AE1A 4X9NA 4WCTA 3K7TA 4TLZA 4D04A 1BZLA 4A9WA 2YM2A 3UOZA 4TM1A 3SFDA 3LADA 2TMDA 3IHMA 4OPDA 2Q7VA 2QCUA 2WPEA 1ONFA 1CHUA 1YQZA 1RYIA 1SEZA 4WX1A 4ZCDA 4MJWA 4O5QA 5EOWA 1IUVA 4Y4MA 2Q0KA 4M52A 4ADWA 4K5SA 2WETA 4LIIA 1EBDA 2XVJA 2JAEA 3AE2A 5KMSA 1EL9A 2JB2A 1PBBA 2OALA 4TLXA 1GRBA 3AE4A 3URHA 4A65A 2B9YA 2WS3A 2YG3A 3RP6A 3EF6A 1PHHA 3UOXA 4RSLA 4YTPA 5JCLA 4AT0A 1OJAA 3UKPA 3K7QX 4AOXA 2BCGG 4EQRA 3FG2P 2BK4A 3BI4A 5FMHA 4YXDA 1KF6A 2GQFA 4USRA 2V5ZA 2GQWA 4C74A 3RHAA 4Z2TA 1K0LA 3D1CA 2AAQA 3GDPA 3HZLA 2EQ9A 3SGLA 2XDOA 3M12A 4J36A 4U8LA 2TPRA 4P9SA 2VZ2A 4B66A 2FBWA 3AE7A 1PJ7A 4PAAA 1LVLA 1PJ6A 3AWIA 4NZHA 5JCMA 2APGA 4JY2A 2O9ZA 1VRQB 4GCMA 1PDHA 5IQ1A 3AYJA 4K5RA 2W0HA 3UKHA 4X4JA 2JB3A 3H4KA 3DK9A 1Y56B 4NTCA 1L9EA 1PBDA 4CCQA 2ZBWA 2X8CA 4HB9A 5M0ZA 1IUWA 1JEHA 2WP9A 1E1LA 3CTYA 1CJCA 4H4ZA 4BV6A 3D8XA 3AE5A 4IV9A 2YVJA 3DJGX 1GERA 3SFEA 5KWFA 1GESA 4GUVA 2C7GA 1NHPA 2YR6A 3REDA 4CRTA 1O95A 1GPEA 1L0VA 2ZZCA 3BNUA 3FIMB 3UTEA 4H7UA 3GYXA 4Z24A 3ATQA 1BF3A 2GH5A 3GSIA 1E7PA 2YQUA 2YVFA 4B1BA 1E1MA 2WU2A 3H8LA 3LZXA 4B69A 4OPGA 1LV0A 4H4YA 1MO9A 4YKGA 1KFYA 1HYUA 3AEGA 4EM3A 5HXIA 2C67A 1Y0PA 4X9MA 3UCLA 2GAGB 4BK3A 1ZX9A 3CNTA 2XFPA 3SY4A 4H2RA 4XXGA 1F6MA 2R4EA 4B64A 3CGEA 4K22A 4J57A 3KPFA 2JK6A 3DK8A 2C72A 3K30A 2WDRA 2X99A 4G6GA 3AE6A 2J3NA 2B7SA 3DMEA 4FDCB 4YSXA 4BURA 1DXLA 1NPXA 2WP5A 1F3PA 3G5SA 3BI5A 1ZOVA 2BXRA 4AT2A 2JKCA 1NENA 4ECHA 2QA1A 3DJEA 3KKJA 5IPYA 3IHGA 1BKWA 2WOIA 2RGHA 5C3JA 2XVHA 2XVEA 3AD9B 2YG7A 4OPTA 1COYA 2WESA 3CGCA 4CCRA 3CN8A 4FK1A 4APNA 2GRTA 4JN9A 1O94A 1XDIA 2A87A 2NVKX 4U8PA 1NHRA 2YLTA 4U8KA 2GVCA 3R9UA 3NK2X 4U2TA 1DOBA 3ISHA 3UKLA 2VQ7A 3KU9A 1XHCA 3SZ0A 3AE3A 2XVFA 4A5LA 3GRSA 1VG0A 2OLNA 4U2LA 3GMCA 3QSSA 4NTEA 3S5WA 4Z25A 5C2TA 3CMMA 2BRYA 3F8DA 3LOVA 3UTHA 1IUTA 3KVEA 3O0HA 2FJAA 2C70A 3EAOA 3FBSA 2C3DA 3AEDA 2JB1A 2X8GA 1YKJA 2Z5XA 1ZP0A 1S2QA 3QSEA 1PJ5A 3VR9A 4G6HA 2X3NA 1EL7A 3BI2A 3QSMA 1N1PA 4ICYA 3NNEA 4GDEA 4UDQA 4XWRA 4Z2RA 1QO8A 3AEEA 2VVLG 2XLTA 2XFUA 2EQ8A 2WU5A 2XVIA 3NLCA 5ER0A 2YR4A 5GSNA 3I3LA 1PBCA 2YLXA 4O5UA 3ALLA 1GSNA 5HHFA 3V76A 1K0JA 5KMRA 5U63A 3UKQA 1KSSA 1ZMDA 3AE8A 3FMWA 2XLUA 3AXBA 4TM4A 1MXTA 1V59A 4YKFA 3EANA 4NTDA 3AD7B 2YG5A 1NG4A 2YLRA 3GWFA 2BC0A 2XLSA 3NTDA 4BK1A 2RABA 4YSZA 3NGCX 1PXBA 1H7XA 2VOUA 1B4VA 2C75A 3CNPA 2R46A 4RG3A 5JCNA 3V3OA 1JRZA 1LQTA 5FS7A 4GAVA 2C73A 4U8IA 2BK3A 2V60A 3NYCA 2B9XA 3PO7A 3SZCA 1TRBA 2GR0A 3COXA 3ITJA 3KPKA 4OVIA 4USQA 5JCIA 1GALA 2R0PA 1H7WA 5KOXA 2X8HA 3P4PA 3CPIG 4I58A 4H4PA 3Q6JA 4H4WA 3G5RA 3B6DA 3II4A 4OPCA 1CC6A 1PBEA 3ALMA 2C3CA 1F8SA 2WPFA 3HYWA 3KLJA 4G73A 3VR8A 5BRTA 1LTXR 1DOEA 4H50A 1CJ4A 3UOVA 4EMWA 1E1NA 1H84A 3DA1A 4DSGA 3NTAA 3SZWA 3CNDA 3T2KA 3AD8B 4CNKA 4N9XA 1FOHA 1FL2A 2RGJA 2WBAA 5EB4A 4GRTA 2BCPA 1KNPA 2XCGA 3UKFA 4YWOA 3NYFA 2GR3A 2VVMA 2XFQA 3ZYXA 4BJZA 1GRAA 4J56A 1E39A 4CBQA 4ZN0A 4U8MA 3GWDA 4JNAA 1OJ9A 2Q0LA 2V61A 2GB0A 1JRYA 3ATRA 2WOVA 2NPXA 3HYVA 4A6NB 4E0VA 4FX9A 3AEBA 2AR8A 1IUXA 3SYIA 1ZY8A 4YT0A 1VDCA 2YLWA 5U25A 4GF7A 1D4CA 3OC4A 4REKA 4B63A 2CVJA 1ZMCA 1PS9A 1VG9A 1XPQA 2C76A 4J34A 2BK5A 3DK4A 4DNAA 2ACZA 2E5VA 5IQ4A 1NG3A 3KD9A 4GAPA 1F8WA 1S3EA 4AP1A 1KNRA 2GR2A 2XLPA 3IF9A 3GRTA 4XWZA 2FJBA 4NEVA 2GEWA 1DJQA 2JBVA 2IVDA 2AQJA 3ICTA 4II3A 3NG7X 2R4JA 1NHQA 3VRDB 2C64A 3L8KA 1JRXA 3CNJA 2CULA 3T2ZA 4B65A 1BWCA 3OZ2A 2C65A 4H4SA 1Q1RA 4G74A 3QVPA 5DBJA 5KVIA 2A89A 2VRLA 3RNMA 3AYLA 2XFNA 2YG4A 3H8IA 1GOSA 3T37A 5KNLA 4LU6A 4EQSA 1JOAA 2OLOA 4Y4NA 3T0KA 3NKSA 2DKIA 4CY6A 1FCDA 2BACA 3C96A 3P9UA 4UDPA 1TDFA 2GMHA 2ZZ0A 1P2EA 4II2A 4IVOB 3ADAB 1B8SA 1L9DA 3ALJA 4UDRA 2GMJA 1GRFA 3GD4A 1Q9IA 2Y6RA 2XFOA 3C4AA 5U1OA 2C4CA 3DH9A 1H81A 1NEKA 3GYJA 3CGDA 1VQWA 3QJ4A 4I59A 1PXAA 2C66A 2WEUA 2BABA 4J2WA 1ZKQA 2CFYA 1B5QA 2WQYA 4H2QA 3LB8A 3AYIA 4C77A 1AOGA 4OPLA 1YQ4A 2YVGA 1BGNA 2IVEA 4GDPA 2BXSA 4J33A 4OPUA 1OJTA 1OJCA 4KX6A 5KMQA 4EIPA 3LXDA 1D4EA 3B3RA 2WPCA 4JNQA 3SXIA 1CBOA 3UOYA 1FEBA 2B76A 3SZFA 5J7XA 2GR1A 4NEWA 2R0CA 1TDKA 2YWLA 1IUUA 1REOA 1H86A 4YTMA 3ABVA 4Z26A 3SX6A 2F5ZA 3KA7A 3E1TA 3Q9TA 4GR1A 1W4XA 1ZDLA 3G5QA 3NHOX 5M10A 4H4UA 3RP8A 2QA2A 1M64A 3UTGA 1NHSA 2R9ZA 3CGBA 4EMIA 1GXFA 3GDNA 1QLBA 2YM1A 3NK0X 2X50A 3NN6X 2YLZA 4H4XA 3T31A 1GTEA 2WDVA 1L9CA 4KPRA 2H89A 2VRMA 4B68A 4DGKA 1D7YA 1N4UA 4J31A 1Z6LA 3ICRA 3S61A 3JSKA 3LJPA 2EQ6A 2I0ZA 1MOKA 4H4TA 3P4QA 4A7AA 4H4QA 2BRAA 1Q1WA 5EB5A 3ICSA 1N4VA 4ZCCA 1K0IA 4TM0A 3GYIA 3NK1X 3WE0A 3NIXA 4C3XA 4Z2UA 2GF3A 4U8NA 3ZDNA 4CY8A 3AEFA 3SQPA 2RGOA 5JCKA 4H2NA 1M6IA 4B67A 4JQ9A 2B9WA 1CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDO A;  1PBF A;  4Y4L A;  4AOS A;  2R45 A;  5FS8 A;  4H4V A;  4CNJ A;  1LPF A;  3P1W A;  3IC9 A;  1D7L A;  2YG6 A;  1ELI A;  3NN0 X;  4A79 A;  2BS4 A;  3FPZ A;  2OAM A;  3UKA A;  4YSH A;  3BHK A;  3P4S A;  3DGH A;  5FS6 A;  2HQM A;  4K2X A;  1O5W A;  1XAN A;  2V3A A;  3DJD A;  2YLS A;  3RP7 A;  1D4D A;  2PYX A;  1GRE A;  4JDR A;  2DKH A;  2WP6 A;  2OA1 A;  3NRN A;  5KRQ A;  5L46 A;  1GEU A;  3P4R A;  2QAE A;  3DGZ A;  1EL5 A;  4LA1 A;  2A8X A;  2BA9 A;  3EPT A;  4U2S A;  1JNR A;  3QVR A;  3LZW A;  1CF3 A;  1Y56 A;  1GV4 A;  4IVM B;  2V6O A;  5LV9 A;  4OCG A;  4JY3 A;  4U8O A;  3SM8 A;  1GT8 A;  1ZK7 A;  2WHD A;  3PVC A;  4U8J A;  5J60 A;  4C3Y A;  4YTN A;  1RSG A;  5KXJ A;  2UZZ A;  2E1M A;  1KDG A;  3F8P A;  5BVA A;  2H88 A;  4FK1 C;  1LJ1 A;  4IA6 A;  4Z44 A;  2B7R A;  4EIQ A;  1H83 A;  1YY5 A;  2XYO A;  1EL8 A;  1GTH A;  2IID A;  1GRG A;  1RP0 A;  3AEA A;  4H4R A;  4PAB A;  2FJD A;  1DNC A;  1PXC A;  5BUK A;  3VRA A;  3IWA A;  3NT6 A;  1FEC A;  1FEA A;  3DJJ A;  1D5T A;  4IA5 A;  1B37 A;  2E4G A;  2GAH B;  1CJ2 A;  2WOW A;  2ZZB A;  2BS3 A;  2VVL A;  5TR3 A;  2CDU A;  1TYP A;  1LQU A;  3CNS A;  3CPH G;  4BJY A;  1KSU A;  5CQF A;  2FJE A;  1E6E A;  3NH3 X;  5HY5 A;  1PN0 A;  1H6V A;  2EQ7 A;  2YAU A;  1TDN A;  5KVH A;  3F8R A;  2BYB A;  3PS9 A;  4RG4 A;  3NYE A;  1QJD A;  2Q6U A;  4A99 A;  2YR5 A;  4K7Z A;  1S2Y A;  1ZOY A;  5CKU A;  5EBK A;  5BUL A;  5FS9 A;  1K4Q A;  1JU2 A;  2V3B A;  1GND A;  4A6N A;  2BC1 A;  4Z43 A;  3VRB A;  4C5O A;  3BHF A;  1TYT A;  4OPI A;  1BGJ A;  2WDQ A;  1CL0 A;  3QFB A;  3UP5 A;  4DSH A;  2VQB A;  1GRT A;  4UP3 A;  3AEC A;  3CPJ G;  2XLR A;  5GRT A;  3AE9 A;  3GD3 A;  4K8D A;  1IJH A;  4EM4 A;  4AP3 A;  1OJD A;  3M13 A;  1N4W A;  4TM3 A;  3AB1 A;  4H2P A;  1GET A;  3BNM A;  1IUS A;  1P2H A;  3GMB A;  1CJ3 A;  3CIR A;  2R0G A;  1JNZ A;  1DOC A;  1X31 B;  4EMJ A;  1UKV G;  3I6D A;  2Z5Y A;  1F8R A;  3UTF A;  4EQX A;  5HYM A;  1NDA A;  2Y6Q A;  3UP4 A;  4D03 A;  3L1R A;  2GV8 A;  2PHH A;  4BK2 A;  1YQ3 A;  1S3B A;  2BS2 A;  1H82 A;  3VQR A;  4YSY A;  1E1K A;  3C4N A;  1CC4 A;  4EQW A;  1DJN A;  1NAA A;  4HA6 A;  1DOD A;  1GRH A;  1TDE A;  2ARD A;  3K7M X;  3M0O A;  3UKK A;  3V3N A;  5KOW A;  3QFA A;  3AE1 A;  4X9N A;  4WCT A;  3K7T A;  4TLZ A;  4D04 A;  1BZL A;  4A9W A;  2YM2 A;  3UOZ A;  4TM1 A;  3SFD A;  3LAD A;  2TMD A;  3IHM A;  4OPD A;  2Q7V A;  2QCU A;  2WPE A;  1ONF A;  1CHU A;  1YQZ A;  1RYI A;  1SEZ A;  4WX1 A;  4ZCD A;  4MJW A;  4O5Q A;  5EOW A;  1IUV A;  4Y4M A;  2Q0K A;  4M52 A;  4ADW A;  4K5S A;  2WET A;  4LII A;  1EBD A;  2XVJ A;  2JAE A;  3AE2 A;  1EL9 A;  2JB2 A;  1PBB A;  2OAL A;  4TLX A;  1GRB A;  3AE4 A;  3URH A;  4A65 A;  2B9Y A;  2WS3 A;  2YG3 A;  3RP6 A;  3EF6 A;  1PHH A;  3UOX A;  4RSL A;  4YTP A;  5JCL A;  4AT0 A;  1OJA A;  3UKP A;  3K7Q X;  4AOX A;  2BCG G;  4EQR A;  3FG2 P;  2BK4 A;  3BI4 A;  5FMH A;  4YXD A;  1KF6 A;  2GQF A;  4USR A;  2V5Z A;  2GQW A;  4C74 A;  3RHA A;  4Z2T A;  1K0L A;  3D1C A;  2AAQ A;  3GDP A;  3HZL A;  2EQ9 A;  3SGL A;  2XDO A;  3M12 A;  4J36 A;  4U8L A;  2TPR A;  4P9S A;  2VZ2 A;  4B66 A;  2FBW A;  3AE7 A;  1PJ7 A;  4PAA A;  1LVL A;  1PJ6 A;  3AWI A;  4NZH A;  5JCM A;  2APG A;  4JY2 A;  2O9Z A;  1VRQ B;  4GCM A;  1PDH A;  5IQ1 A;  3AYJ A;  4K5R A;  2W0H A;  3UKH A;  4X4J A;  2JB3 A;  3H4K A;  3DK9 A;  1Y56 B;  4NTC A;  1L9E A;  1PBD A;  4CCQ A;  2ZBW A;  2X8C A;  4HB9 A;  5M0Z A;  1IUW A;  1JEH A;  2WP9 A;  1E1L A;  3CTY A;  1CJC A;  4H4Z A;  4BV6 A;  3D8X A;  3AE5 A;  4IV9 A;  2YVJ A;  3DJG X;  1GER A;  3SFE A;  5KWF A;  1GES A;  4GUV A;  2C7G A;  1NHP A;  2YR6 A;  3RED A;  4CRT A;  1O95 A;  1GPE A;  1L0V A;  2ZZC A;  3BNU A;  3FIM B;  3UTE A;  4H7U A;  4Z24 A;  3ATQ A;  1BF3 A;  2GH5 A;  3GSI A;  1E7P A;  2YQU A;  2YVF A;  4B1B A;  1E1M A;  2WU2 A;  3H8L A;  3LZX A;  4B69 A;  4OPG A;  1LV0 A;  4H4Y A;  1MO9 A;  4YKG A;  1KFY A;  1HYU A;  3AEG A;  4EM3 A;  5HXI A;  2C67 A;  1Y0P A;  4X9M A;  3UCL A;  2GAG B;  4BK3 A;  1ZX9 A;  3CNT A;  2XFP A;  4H2R A;  4XXG A;  1F6M A;  2R4E A;  4B64 A;  3CGE A;  4K22 A;  4J57 A;  3KPF A;  2JK6 A;  3DK8 A;  2C72 A;  3K30 A;  2WDR A;  2X99 A;  3AE6 A;  2J3N A;  2B7S A;  3DME A;  4FDC B;  4YSX A;  4BUR A;  1DXL A;  1NPX A;  2WP5 A;  1F3P A;  3G5S A;  3BI5 A;  1ZOV A;  2BXR A;  4AT2 A;  2JKC A;  1NEN A;  4ECH A;  2QA1 A;  3DJE A;  3KKJ A;  5IPY A;  3IHG A;  1BKW A;  2WOI A;  2RGH A;  5C3J A;  2XVH A;  2XVE A;  3AD9 B;  2YG7 A;  4OPT A;  1COY A;  2WES A;  3CGC A;  4CCR A;  3CN8 A;  4FK1 A;  4APN A;  2GRT A;  4JN9 A;  1O94 A;  1XDI A;  2A87 A;  2NVK X;  4U8P A;  1NHR A;  2YLT A;  4U8K A;  2GVC A;  3R9U A;  3NK2 X;  4U2T A;  1DOB A;  3ISH A;  3UKL A;  2VQ7 A;  3KU9 A;  1XHC A;  3AE3 A;  2XVF A;  4A5L A;  3GRS A;  1VG0 A;  2OLN A;  4U2L A;  3GMC A;  3QSS A;  4NTE A;  3S5W A;  4Z25 A;  5C2T A;  3F8D A;  3LOV A;  3UTH A;  1IUT A;  3KVE A;  3O0H A;  2FJA A;  2C70 A;  3EAO A;  3FBS A;  2C3D A;  3AED A;  2JB1 A;  2X8G A;  1YKJ A;  2Z5X A;  1ZP0 A;  1S2Q A;  3QSE A;  1PJ5 A;  3VR9 A;  2X3N A;  1EL7 A;  3BI2 A;  3QSM A;  1N1P A;  4ICY A;  3NNE A;  4GDE A;  4UDQ A;  4XWR A;  4Z2R A;  1QO8 A;  3AEE A;  2VVL G;  2XLT A;  2XFU A;  2EQ8 A;  2WU5 A;  2XVI A;  3NLC A;  5ER0 A;  2YR4 A;  5GSN A;  3I3L A;  1PBC A;  2YLX A;  4O5U A;  3ALL A;  1GSN A;  5HHF A;  3V76 A;  1K0J A;  5U63 A;  3UKQ A;  1KSS A;  1ZMD A;  3AE8 A;  3FMW A;  2XLU A;  3AXB A;  4TM4 A;  1MXT A;  1V59 A;  4YKF A;  3EAN A;  4NTD A;  3AD7 B;  2YG5 A;  1NG4 A;  2YLR A;  3GWF A;  2BC0 A;  2XLS A;  3NTD A;  4BK1 A;  2RAB A;  4YSZ A;  3NGC X;  1PXB A;  1H7X A;  2C75 A;  1B4V A;  2VOU A;  3CNP A;  2R46 A;  4RG3 A;  5JCN A;  3V3O A;  1JRZ A;  1LQT A;  5FS7 A;  2C73 A;  4U8I A;  2BK3 A;  2V60 A;  3NYC A;  2B9X A;  3PO7 A;  1TRB A;  2GR0 A;  3COX A;  3ITJ A;  4OVI A;  4USQ A;  5JCI A;  1GAL A;  2R0P A;  1H7W A;  5KOX A;  2X8H A;  3P4P A;  3CPI G;  4I58 A;  4H4P A;  3Q6J A;  4H4W A;  3G5R A;  3B6D A;  3II4 A;  4OPC A;  1CC6 A;  1PBE A;  3ALM A;  2C3C A;  1F8S A;  2WPF A;  3KLJ A;  3VR8 A;  5BRT A;  1LTX R;  1DOE A;  4H50 A;  1CJ4 A;  3UOV A;  4EMW A;  1E1N A;  1H84 A;  3DA1 A;  4DSG A;  3NTA A;  3CND A;  3AD8 B;  4CNK A;  4N9X A;  1FOH A;  1FL2 A;  2RGJ A;  2WBA A;  5EB4 A;  4GRT A;  2BCP A;  1KNP A;  2XCG A;  3UKF A;  4YWO A;  3NYF A;  2GR3 A;  2VVM A;  2XFQ A;  3ZYX A;  4BJZ A;  1GRA A;  4J56 A;  1E39 A;  4CBQ A;  4ZN0 A;  4U8M A;  3GWD A;  4JNA A;  1OJ9 A;  2Q0L A;  2V61 A;  2GB0 A;  1JRY A;  3ATR A;  2WOV A;  2NPX A;  4A6N B;  4E0V A;  4FX9 A;  3AEB A;  2AR8 A;  1IUX A;  1ZY8 A;  4YT0 A;  1VDC A;  2YLW A;  5U25 A;  4GF7 A;  1D4C A;  3OC4 A;  4REK A;  4B63 A;  2CVJ A;  1ZMC A;  1PS9 A;  1VG9 A;  1XPQ A;  2C76 A;  4J34 A;  2BK5 A;  3DK4 A;  4DNA A;  2ACZ A;  2E5V A;  5IQ4 A;  1NG3 A;  3KD9 A;  1F8W A;  1S3E A;  4AP1 A;  1KNR A;  2GR2 A;  2XLP A;  3IF9 A;  3GRT A;  4XWZ A;  2FJB A;  4NEV A;  2GEW A;  1DJQ A;  2JBV A;  2IVD A;  2AQJ A;  3ICT A;  3NG7 X;  2R4J A;  1NHQ A;  3VRD B;  2C64 A;  3L8K A;  1JRX A;  3CNJ A;  2CUL A;  4B65 A;  1BWC A;  3OZ2 A;  2C65 A;  4H4S A;  1Q1R A;  3QVP A;  5DBJ A;  5KVI A;  2A89 A;  2VRL A;  3RNM A;  3AYL A;  2XFN A;  2YG4 A;  3H8I A;  1GOS A;  3T37 A;  4LU6 A;  4EQS A;  1JOA A;  2OLO A;  4Y4N A;  3NKS A;  2DKI A;  4CY6 A;  1FCD A;  2BAC A;  3C96 A;  3P9U A;  4UDP A;  1TDF A;  2GMH A;  2ZZ0 A;  1P2E A;  4IVO B;  3ADA B;  1B8S A;  1L9D A;  3ALJ A;  4UDR A;  1GRF A;  2GMJ A;  3GD4 A;  1Q9I A;  2Y6R A;  2XFO A;  3C4A A;  5U1O A;  3DH9 A;  1H81 A;  1NEK A;  3GYJ A;  3CGD A;  1VQW A;  3QJ4 A;  4I59 A;  1PXA A;  2C66 A;  2WEU A;  2BAB A;  4J2W A;  1ZKQ A;  2CFY A;  1B5Q A;  2WQY A;  4H2Q A;  3LB8 A;  3AYI A;  4C77 A;  1AOG A;  4OPL A;  1YQ4 A;  2YVG A;  1BGN A;  2IVE A;  4GDP A;  2BXS A;  4J33 A;  4OPU A;  1OJT A;  1OJC A;  4KX6 A;  4EIP A;  3LXD A;  1D4E A;  3B3R A;  2WPC A;  4JNQ A;  1CBO A;  3UOY A;  1FEB A;  2B76 A;  5J7X A;  2GR1 A;  4NEW A;  2R0C A;  1TDK A;  2YWL A;  1IUU A;  1REO A;  1H86 A;  4YTM A;  3ABV A;  4Z26 A;  2F5Z A;  3KA7 A;  3E1T A;  3Q9T A;  4GR1 A;  1W4X A;  1ZDL A;  3G5Q A;  3NHO X;  5M10 A;  4H4U A;  2QA2 A;  3RP8 A;  1M64 A;  3UTG A;  1NHS A;  2R9Z A;  3CGB A;  4EMI A;  1GXF A;  3GDN A;  1QLB A;  2YM1 A;  3NK0 X;  2X50 A;  3NN6 X;  2YLZ A;  4H4X A;  1GTE A;  2WDV A;  1L9C A;  4KPR A;  2H89 A;  2VRM A;  4B68 A;  4DGK A;  1D7Y A;  1N4U A;  4J31 A;  1Z6L A;  3ICR A;  3S61 A;  3JSK A;  3LJP A;  2EQ6 A;  2I0Z A;  1MOK A;  4H4T A;  3P4Q A;  4A7A A;  4H4Q A;  1Q1W A;  5EB5 A;  3ICS A;  1N4V A;  4ZCC A;  1K0I A;  4TM0 A;  3GYI A;  3NK1 X;  3WE0 A;  3NIX A;  4C3X A;  4Z2U A;  2GF3 A;  4U8N A;  3ZDN A;  4CY8 A;  3AEF A;  3SQP A;  2RGO A;  5JCK A;  4H2N A;  1M6I A;  4B67 A;  4JQ9 A;  2B9W A;  1CC2 A; 
#chains in the Genus database with same CATH topology
 1TDO A;  1PBF A;  4Y4L A;  4AOS A;  2R45 A;  5FS8 A;  4H4V A;  4CNJ A;  1LPF A;  3T2Y A;  3P1W A;  3IC9 A;  1D7L A;  2YG6 A;  1ELI A;  3NN0 X;  4A79 A;  2BS4 A;  3FPZ A;  2OAM A;  3UKA A;  4YSH A;  3BHK A;  3P4S A;  3DGH A;  5FS6 A;  2HQM A;  4K2X A;  3DJD A;  1O5W A;  1XAN A;  2V3A A;  2YLS A;  3RP7 A;  1D4D A;  2PYX A;  5L46 A;  1GRE A;  2DKH A;  2WP6 A;  2OA1 A;  3NRN A;  4JDR A;  5KRQ A;  4NWZ A;  1GEU A;  3P4R A;  2QAE A;  3DGZ A;  1EL5 A;  4LA1 A;  2A8X A;  2BA9 A;  4G9K A;  3EPT A;  4U2S A;  1JNR A;  3QVR A;  3LZW A;  1CF3 A;  1Y56 A;  1GV4 A;  4IVM B;  2V6O A;  5LV9 A;  4OCG A;  4JY3 A;  3SM8 A;  4U8O A;  1GT8 A;  1ZK7 A;  2WHD A;  3PVC A;  4U8J A;  5J60 A;  4C3Y A;  4YTN A;  1RSG A;  5KXJ A;  2UZZ A;  2E1M A;  1KDG A;  3F8P A;  5BVA A;  2H88 A;  4IA6 A;  1LJ1 A;  4FK1 C;  3HYX A;  2B7R A;  4EIQ A;  1H83 A;  4Z44 A;  3T14 A;  1YY5 A;  2XYO A;  1EL8 A;  1GTH A;  4PAB A;  1GRG A;  1RP0 A;  2IID A;  3AEA A;  4H4R A;  2FJD A;  1DNC A;  1PXC A;  5BUK A;  3VRA A;  5KMP A;  3IWA A;  3NT6 A;  1FEC A;  1FEA A;  3DJJ A;  4IA5 A;  1D5T A;  1B37 A;  2E4G A;  2GAH B;  1CJ2 A;  2WOW A;  1C0K A;  2ZZB A;  2BS3 A;  2VVL A;  5TR3 A;  1TYP A;  4YJG A;  1LQU A;  2CDU A;  4BJY A;  3CNS A;  3CPH G;  1KSU A;  5CQF A;  2FJE A;  1E6E A;  3NH3 X;  5HY5 A;  1PN0 A;  1H6V A;  2EQ7 A;  2YAU A;  1TDN A;  5KVH A;  3F8R A;  2BYB A;  3PS9 A;  4RG4 A;  3NYE A;  1QJD A;  2Q6U A;  4A99 A;  2YR5 A;  4K7Z A;  1S2Y A;  1ZOY A;  5CKU A;  5EBK A;  5BUL A;  5FS9 A;  1K4Q A;  1JU2 A;  2V3B A;  1GND A;  4A6N A;  2BC1 A;  4Z43 A;  3VRB A;  4C5O A;  3BHF A;  1TYT A;  4OPI A;  1BGJ A;  2WDQ A;  1CL0 A;  3QFB A;  3UP5 A;  4DSH A;  2VQB A;  1GRT A;  4UP3 A;  3AEC A;  3CPJ G;  2XLR A;  5GRT A;  3AE9 A;  3GD3 A;  4K8D A;  1IJH A;  4EM4 A;  4AP3 A;  1OJD A;  3M13 A;  1N4W A;  4TM3 A;  3AB1 A;  4H2P A;  1GET A;  3BNM A;  1IUS A;  1P2H A;  1AN9 A;  3GMB A;  4NNJ A;  1CJ3 A;  3CIR A;  2R0G A;  1JNZ A;  1DOC A;  1X31 B;  4EMJ A;  1UKV G;  3I6D A;  2Z5Y A;  1F8R A;  3UTF A;  4EQX A;  5HYM A;  1NDA A;  2Y6Q A;  3UP4 A;  4D03 A;  3L1R A;  2GV8 A;  2PHH A;  4BK2 A;  1YQ3 A;  1S3B A;  3VQR A;  1H82 A;  2BS2 A;  4YSY A;  3C4N A;  1E1K A;  1CC4 A;  4EQW A;  1DJN A;  1NAA A;  4HA6 A;  1DOD A;  1GRH A;  1TDE A;  2ARD A;  3K7M X;  3M0O A;  3UKK A;  3V3N A;  5KOW A;  3QFA A;  3AE1 A;  4X9N A;  4WCT A;  3K7T A;  4TLZ A;  4D04 A;  1BZL A;  4A9W A;  2YM2 A;  3UOZ A;  4TM1 A;  3SFD A;  3LAD A;  2TMD A;  3IHM A;  4OPD A;  2Q7V A;  2QCU A;  2WPE A;  1ONF A;  1CHU A;  1YQZ A;  1RYI A;  1SEZ A;  4WX1 A;  4ZCD A;  4MJW A;  4O5Q A;  5EOW A;  1IUV A;  4Y4M A;  2Q0K A;  4M52 A;  4ADW A;  4K5S A;  2WET A;  4LII A;  1EBD A;  2XVJ A;  2JAE A;  2E49 A;  3AE2 A;  1EL9 A;  2JB2 A;  1PBB A;  2OAL A;  4TLX A;  1GRB A;  3AE4 A;  3URH A;  4A65 A;  2B9Y A;  2WS3 A;  2YG3 A;  3RP6 A;  3EF6 A;  1PHH A;  3UOX A;  4RSL A;  4YTP A;  5JCL A;  4AT0 A;  1OJA A;  3UKP A;  3K7Q X;  4AOX A;  2BCG G;  4EQR A;  3FG2 P;  2BK4 A;  3BI4 A;  5FMH A;  4YXD A;  1KF6 A;  2GQF A;  3W4I A;  4USR A;  2V5Z A;  2GQW A;  3WGT A;  3RHA A;  4C74 A;  4Z2T A;  1K0L A;  3D1C A;  2AAQ A;  3GDP A;  3HZL A;  2EQ9 A;  3SGL A;  2XDO A;  3M12 A;  4J36 A;  4U8L A;  2TPR A;  4P9S A;  2VZ2 A;  4B66 A;  2FBW A;  3AE7 A;  1PJ7 A;  4PAA A;  1LVL A;  1PJ6 A;  3AWI A;  4NZH A;  5JCM A;  2APG A;  4JY2 A;  2O9Z A;  1VRQ B;  4GCM A;  1PDH A;  5IQ1 A;  3AYJ A;  4K5R A;  2W0H A;  2E48 A;  3UKH A;  4X4J A;  2JB3 A;  3H4K A;  3DK9 A;  1Y56 B;  4NTC A;  1L9E A;  1PBD A;  4CCQ A;  2ZBW A;  2X8C A;  4HB9 A;  5M0Z A;  1IUW A;  1JEH A;  2WP9 A;  1E1L A;  3CTY A;  1CJC A;  4H4Z A;  4BV6 A;  3D8X A;  3AE5 A;  4IV9 A;  2YVJ A;  3DJG X;  1GER A;  3SFE A;  5KWF A;  1GES A;  4GUV A;  2C7G A;  1NHP A;  2YR6 A;  3RED A;  4CRT A;  1O95 A;  1GPE A;  1L0V A;  1C0I A;  2ZZC A;  3BNU A;  3FIM B;  3UTE A;  4H7U A;  5KMS A;  3GYX A;  4Z24 A;  3ATQ A;  1BF3 A;  3GSI A;  2GH5 A;  1E7P A;  2YQU A;  2YVF A;  4YJH A;  4B1B A;  1E1M A;  2WU2 A;  3H8L A;  3LZX A;  4B69 A;  4OPG A;  1LV0 A;  4H4Y A;  1MO9 A;  4YKG A;  1C0P A;  1HYU A;  1KFY A;  3AEG A;  5HXI A;  4EM3 A;  2C67 A;  4X9M A;  1Y0P A;  3UCL A;  2GAG B;  4BK3 A;  1ZX9 A;  3CNT A;  2XFP A;  3SY4 A;  4H2R A;  4XXG A;  1F6M A;  2R4E A;  4B64 A;  3CGE A;  4K22 A;  4J57 A;  3KPF A;  2JK6 A;  3DK8 A;  2C72 A;  3K30 A;  2WDR A;  2X99 A;  4G6G A;  3AE6 A;  2J3N A;  2B7S A;  3DME A;  4FDC B;  4YSX A;  4BUR A;  1DXL A;  1NPX A;  2WP5 A;  1F3P A;  3G5S A;  3BI5 A;  1ZOV A;  2BXR A;  4AT2 A;  2JKC A;  1NEN A;  4ECH A;  2E82 A;  2QA1 A;  3ZNN A;  3DJE A;  3KKJ A;  5IPY A;  3IHG A;  1BKW A;  2WOI A;  2RGH A;  5C3J A;  2XVH A;  3AD9 B;  2XVE A;  2YG7 A;  4OPT A;  1COY A;  2WES A;  3CGC A;  4CCR A;  3CN8 A;  4FK1 A;  4APN A;  2GRT A;  4JN9 A;  1O94 A;  1XDI A;  2A87 A;  2NVK X;  4U8P A;  1NHR A;  2YLT A;  4U8K A;  2GVC A;  3R9U A;  3NK2 X;  4U2T A;  1DOB A;  3ISH A;  3UKL A;  2VQ7 A;  3KU9 A;  1XHC A;  3SZ0 A;  3AE3 A;  2XVF A;  4A5L A;  3GRS A;  1VG0 A;  2OLN A;  4U2L A;  3GMC A;  3QSS A;  4NTE A;  3S5W A;  4Z25 A;  5C2T A;  3W4J A;  3CMM A;  1KIF A;  2BRY A;  3F8D A;  3LOV A;  3UTH A;  1IUT A;  3KVE A;  3O0H A;  2FJA A;  2C70 A;  3EAO A;  3FBS A;  2C3D A;  3AED A;  2JB1 A;  2X8G A;  1YKJ A;  2Z5X A;  1ZP0 A;  1S2Q A;  3QSE A;  1PJ5 A;  3VR9 A;  3CUK A;  1EL7 A;  2X3N A;  3QSM A;  3BI2 A;  1N1P A;  4G6H A;  3NNE A;  4GDE A;  4ICY A;  4UDQ A;  4XWR A;  1QO8 A;  4Z2R A;  3AEE A;  2VVL G;  2XLT A;  2XFU A;  2EQ8 A;  2WU5 A;  2XVI A;  3NLC A;  5ER0 A;  2YR4 A;  5GSN A;  3I3L A;  1PBC A;  2YLX A;  4O5U A;  3ALL A;  1GSN A;  5HHF A;  3V76 A;  1K0J A;  5KMR A;  5U63 A;  3UKQ A;  1KSS A;  1ZMD A;  3AE8 A;  3FMW A;  2XLU A;  3AXB A;  4TM4 A;  1MXT A;  1V59 A;  4YKF A;  3EAN A;  4NTD A;  3AD7 B;  2YG5 A;  1NG4 A;  2YLR A;  3GWF A;  2BC0 A;  2XLS A;  3NTD A;  4BK1 A;  2RAB A;  4YSZ A;  3NGC X;  1PXB A;  1H7X A;  2VOU A;  1B4V A;  2C75 A;  3CNP A;  2R46 A;  4RG3 A;  5JCN A;  3V3O A;  1JRZ A;  1C0L A;  1LQT A;  5FS7 A;  4GAV A;  2C73 A;  4U8I A;  2BK3 A;  2V60 A;  3NYC A;  2B9X A;  3PO7 A;  3SZC A;  1TRB A;  2GR0 A;  3COX A;  3ITJ A;  3KPK A;  4OVI A;  4USQ A;  5JCI A;  1GAL A;  2R0P A;  4YJF B;  1H7W A;  5KOX A;  2X8H A;  3P4P A;  3CPI G;  4I58 A;  4H4P A;  3Q6J A;  4H4W A;  3G5R A;  3B6D A;  3II4 A;  4OPC A;  1CC6 A;  1PBE A;  3ALM A;  2C3C A;  1F8S A;  2WPF A;  3HYW A;  3KLJ A;  4G73 A;  3VR8 A;  5BRT A;  1LTX R;  1DOE A;  4H50 A;  1CJ4 A;  3UOV A;  4EMW A;  1E1N A;  1H84 A;  3DA1 A;  4DSG A;  3NTA A;  3ZNP A;  3SZW A;  3CND A;  1VE9 A;  3T2K A;  3AD8 B;  4CNK A;  4N9X A;  1FOH A;  1FL2 A;  2RGJ A;  4QFC A;  2WBA A;  5EB4 A;  4GRT A;  2BCP A;  1KNP A;  2XCG A;  3UKF A;  4YWO A;  3NYF A;  2GR3 A;  2VVM A;  2XFQ A;  3ZYX A;  4BJZ A;  1GRA A;  4J56 A;  4YJD A;  4QFD A;  1E39 A;  4CBQ A;  4ZN0 A;  4U8M A;  3GWD A;  4JNA A;  1OJ9 A;  2Q0L A;  2V61 A;  2GB0 A;  1JRY A;  3ATR A;  2WOV A;  2NPX A;  3HYV A;  4A6N B;  4E0V A;  4FX9 A;  3AEB A;  2AR8 A;  1IUX A;  2DU8 A;  3SYI A;  1ZY8 A;  4YT0 A;  1VDC A;  2YLW A;  5U25 A;  4GF7 A;  1D4C A;  3OC4 A;  4REK A;  4B63 A;  1ZMC A;  2CVJ A;  1PS9 A;  1VG9 A;  1XPQ A;  2C76 A;  4J34 A;  2BK5 A;  3DK4 A;  4DNA A;  2ACZ A;  2E5V A;  5IQ4 A;  1NG3 A;  1DDO A;  3KD9 A;  1F8W A;  4GAP A;  1S3E A;  4AP1 A;  3IF9 A;  1KNR A;  2GR2 A;  2XLP A;  3GRT A;  4XWZ A;  2FJB A;  4NEV A;  2GEW A;  1DJQ A;  2JBV A;  2IVD A;  2AQJ A;  3ICT A;  4II3 A;  3NG7 X;  2R4J A;  1NHQ A;  3VRD B;  1EVI A;  2C64 A;  3L8K A;  1JRX A;  3CNJ A;  2CUL A;  3T2Z A;  3G3E A;  4B65 A;  3OZ2 A;  1BWC A;  2C65 A;  4H4S A;  1Q1R A;  4G74 A;  3QVP A;  5DBJ A;  5KVI A;  2A89 A;  2VRL A;  3RNM A;  3AYL A;  2XFN A;  2YG4 A;  3H8I A;  1GOS A;  3T37 A;  5KNL A;  4LU6 A;  4YJF A;  4EQS A;  1JOA A;  2OLO A;  4Y4N A;  3T0K A;  3NKS A;  2DKI A;  4CY6 A;  1FCD A;  2BAC A;  3C96 A;  3P9U A;  4UDP A;  1TDF A;  2GMH A;  2ZZ0 A;  1P2E A;  4II2 A;  4IVO B;  3ADA B;  1B8S A;  1L9D A;  3ALJ A;  4UDR A;  2GMJ A;  1GRF A;  3GD4 A;  1Q9I A;  2Y6R A;  2XFO A;  3C4A A;  5U1O A;  2C4C A;  3DH9 A;  1H81 A;  1NEK A;  3GYJ A;  3CGD A;  1VQW A;  3QJ4 A;  4I59 A;  1PXA A;  2C66 A;  2WEU A;  2BAB A;  4J2W A;  1ZKQ A;  2CFY A;  1B5Q A;  2WQY A;  4H2Q A;  3LB8 A;  3AYI A;  4C77 A;  1AOG A;  4OPL A;  1YQ4 A;  2YVG A;  1BGN A;  2IVE A;  4GDP A;  2BXS A;  4J33 A;  4OPU A;  1OJT A;  1OJC A;  4KX6 A;  4YJH B;  5KMQ A;  4EIP A;  3LXD A;  1D4E A;  3B3R A;  2WPC A;  4JNQ A;  3SXI A;  1CBO A;  3UOY A;  1FEB A;  2B76 A;  3SZF A;  5J7X A;  2GR1 A;  4NEW A;  2R0C A;  1TDK A;  2YWL A;  1IUU A;  1REO A;  1H86 A;  4YTM A;  3ABV A;  4Z26 A;  3SX6 A;  2F5Z A;  3KA7 A;  3E1T A;  3Q9T A;  4GR1 A;  1W4X A;  1ZDL A;  3G5Q A;  3NHO X;  5M10 A;  2E4A A;  4H4U A;  3RP8 A;  2QA2 A;  1M64 A;  3UTG A;  1NHS A;  2R9Z A;  3CGB A;  4EMI A;  1GXF A;  3GDN A;  1QLB A;  2YM1 A;  3NK0 X;  2X50 A;  3NN6 X;  2YLZ A;  4H4X A;  3T31 A;  1GTE A;  2WDV A;  1L9C A;  4KPR A;  2H89 A;  2VRM A;  4B68 A;  4DGK A;  1D7Y A;  1N4U A;  4J31 A;  1Z6L A;  3ICR A;  3S61 A;  1DAO A;  3JSK A;  3LJP A;  2EQ6 A;  2I0Z A;  1MOK A;  4H4T A;  3P4Q A;  4A7A A;  4H4Q A;  2BRA A;  1Q1W A;  5EB5 A;  3ICS A;  1N4V A;  4YJG B;  4ZCC A;  3W4K A;  1K0I A;  4TM0 A;  3GYI A;  3NK1 X;  3WE0 A;  3NIX A;  4C3X A;  4Z2U A;  2GF3 A;  4U8N A;  3ZDN A;  4CY8 A;  3AEF A;  3ZNQ A;  2RGO A;  3SQP A;  5JCK A;  4H2N A;  1M6I A;  4B67 A;  4JQ9 A;  2B9W A;  1CC2 A;  3ZNO A; 
#chains in the Genus database with same CATH homology
 1TDO A;  1PBF A;  4Y4L A;  4AOS A;  2R45 A;  5FS8 A;  4H4V A;  4CNJ A;  1LPF A;  3T2Y A;  3P1W A;  3IC9 A;  1D7L A;  2YG6 A;  1ELI A;  3NN0 X;  4A79 A;  2BS4 A;  3FPZ A;  2OAM A;  3UKA A;  4YSH A;  3BHK A;  3P4S A;  3DGH A;  5FS6 A;  2HQM A;  4K2X A;  1O5W A;  1XAN A;  2V3A A;  3DJD A;  2YLS A;  3RP7 A;  1D4D A;  2PYX A;  1GRE A;  4JDR A;  2DKH A;  2WP6 A;  2OA1 A;  3NRN A;  5KRQ A;  5L46 A;  4NWZ A;  1GEU A;  3P4R A;  2QAE A;  3DGZ A;  1EL5 A;  4LA1 A;  2A8X A;  2BA9 A;  4G9K A;  3EPT A;  4U2S A;  1JNR A;  3QVR A;  3LZW A;  1CF3 A;  1Y56 A;  1GV4 A;  4IVM B;  2V6O A;  5LV9 A;  4OCG A;  4JY3 A;  4U8O A;  3SM8 A;  1GT8 A;  1ZK7 A;  2WHD A;  3PVC A;  4U8J A;  5J60 A;  4C3Y A;  4YTN A;  1RSG A;  5KXJ A;  2UZZ A;  2E1M A;  1KDG A;  3F8P A;  5BVA A;  2H88 A;  4IA6 A;  1LJ1 A;  4FK1 C;  3HYX A;  2B7R A;  4EIQ A;  1H83 A;  4Z44 A;  3T14 A;  1YY5 A;  2XYO A;  1EL8 A;  1GTH A;  2IID A;  1GRG A;  1RP0 A;  3AEA A;  4H4R A;  4PAB A;  2FJD A;  1DNC A;  1PXC A;  5BUK A;  3VRA A;  5KMP A;  3IWA A;  3NT6 A;  1FEC A;  1FEA A;  3DJJ A;  4IA5 A;  1D5T A;  1B37 A;  2E4G A;  2GAH B;  1CJ2 A;  2WOW A;  2ZZB A;  2BS3 A;  2VVL A;  5TR3 A;  2CDU A;  1TYP A;  1LQU A;  3CNS A;  4BJY A;  3CPH G;  1KSU A;  5CQF A;  2FJE A;  1E6E A;  3NH3 X;  5HY5 A;  1PN0 A;  1H6V A;  2EQ7 A;  2YAU A;  1TDN A;  5KVH A;  3F8R A;  2BYB A;  3PS9 A;  4RG4 A;  3NYE A;  1QJD A;  2Q6U A;  4A99 A;  2YR5 A;  4K7Z A;  1S2Y A;  1ZOY A;  5CKU A;  5EBK A;  5BUL A;  5FS9 A;  1K4Q A;  1JU2 A;  2V3B A;  1GND A;  4A6N A;  2BC1 A;  4Z43 A;  3VRB A;  4C5O A;  3BHF A;  1TYT A;  4OPI A;  1BGJ A;  2WDQ A;  1CL0 A;  3QFB A;  3UP5 A;  4DSH A;  2VQB A;  1GRT A;  4UP3 A;  3AEC A;  3CPJ G;  2XLR A;  5GRT A;  3AE9 A;  3GD3 A;  4K8D A;  1IJH A;  4EM4 A;  4AP3 A;  1OJD A;  3M13 A;  1N4W A;  4TM3 A;  3AB1 A;  4H2P A;  1GET A;  3BNM A;  1IUS A;  1P2H A;  3GMB A;  4NNJ A;  1CJ3 A;  3CIR A;  2R0G A;  1JNZ A;  1DOC A;  1X31 B;  4EMJ A;  1UKV G;  3I6D A;  2Z5Y A;  1F8R A;  3UTF A;  4EQX A;  5HYM A;  1NDA A;  2Y6Q A;  3UP4 A;  4D03 A;  3L1R A;  2GV8 A;  4BK2 A;  2PHH A;  1YQ3 A;  1S3B A;  2BS2 A;  1H82 A;  3VQR A;  4YSY A;  1E1K A;  3C4N A;  1CC4 A;  4EQW A;  1DJN A;  1NAA A;  4HA6 A;  1DOD A;  1GRH A;  1TDE A;  2ARD A;  3K7M X;  3M0O A;  3UKK A;  3V3N A;  5KOW A;  3QFA A;  3AE1 A;  4X9N A;  4WCT A;  3K7T A;  4TLZ A;  4D04 A;  1BZL A;  4A9W A;  2YM2 A;  3UOZ A;  4TM1 A;  3SFD A;  3LAD A;  2TMD A;  3IHM A;  4OPD A;  2Q7V A;  2QCU A;  2WPE A;  1ONF A;  1CHU A;  1YQZ A;  1RYI A;  1SEZ A;  4WX1 A;  4ZCD A;  4MJW A;  4O5Q A;  5EOW A;  1IUV A;  4Y4M A;  2Q0K A;  4M52 A;  4ADW A;  4K5S A;  2WET A;  4LII A;  1EBD A;  2XVJ A;  2JAE A;  3AE2 A;  5KMS A;  1EL9 A;  2JB2 A;  1PBB A;  2OAL A;  4TLX A;  1GRB A;  3AE4 A;  3URH A;  4A65 A;  2B9Y A;  2WS3 A;  2YG3 A;  3RP6 A;  3EF6 A;  1PHH A;  3UOX A;  4RSL A;  4YTP A;  5JCL A;  4AT0 A;  1OJA A;  3UKP A;  3K7Q X;  4AOX A;  2BCG G;  4EQR A;  3FG2 P;  2BK4 A;  3BI4 A;  5FMH A;  4YXD A;  1KF6 A;  2GQF A;  4USR A;  2V5Z A;  2GQW A;  4C74 A;  3RHA A;  4Z2T A;  1K0L A;  3D1C A;  2AAQ A;  3GDP A;  3HZL A;  2EQ9 A;  3SGL A;  2XDO A;  3M12 A;  4J36 A;  4U8L A;  2TPR A;  4P9S A;  2VZ2 A;  4B66 A;  2FBW A;  3AE7 A;  1PJ7 A;  4PAA A;  1LVL A;  1PJ6 A;  3AWI A;  4NZH A;  5JCM A;  2APG A;  4JY2 A;  2O9Z A;  1VRQ B;  4GCM A;  1PDH A;  5IQ1 A;  3AYJ A;  4K5R A;  2W0H A;  3UKH A;  4X4J A;  2JB3 A;  3H4K A;  3DK9 A;  1Y56 B;  4NTC A;  1L9E A;  1PBD A;  4CCQ A;  2ZBW A;  2X8C A;  4HB9 A;  5M0Z A;  1IUW A;  1JEH A;  2WP9 A;  1E1L A;  3CTY A;  1CJC A;  4H4Z A;  4BV6 A;  3D8X A;  3AE5 A;  4IV9 A;  2YVJ A;  3DJG X;  1GER A;  3SFE A;  5KWF A;  1GES A;  4GUV A;  2C7G A;  1NHP A;  2YR6 A;  3RED A;  4CRT A;  1O95 A;  1GPE A;  1L0V A;  2ZZC A;  3BNU A;  3FIM B;  3UTE A;  4H7U A;  3GYX A;  4Z24 A;  3ATQ A;  1BF3 A;  2GH5 A;  3GSI A;  1E7P A;  2YQU A;  2YVF A;  4B1B A;  1E1M A;  2WU2 A;  3H8L A;  3LZX A;  4B69 A;  4OPG A;  1LV0 A;  4H4Y A;  1MO9 A;  4YKG A;  1KFY A;  1HYU A;  3AEG A;  4EM3 A;  5HXI A;  2C67 A;  1Y0P A;  4X9M A;  3UCL A;  2GAG B;  4BK3 A;  1ZX9 A;  3CNT A;  2XFP A;  3SY4 A;  4H2R A;  4XXG A;  1F6M A;  2R4E A;  4B64 A;  3CGE A;  4K22 A;  4J57 A;  3KPF A;  2JK6 A;  3DK8 A;  2C72 A;  3K30 A;  2WDR A;  2X99 A;  4G6G A;  3AE6 A;  2J3N A;  2B7S A;  3DME A;  4FDC B;  4YSX A;  4BUR A;  1DXL A;  1NPX A;  2WP5 A;  1F3P A;  3G5S A;  3BI5 A;  1ZOV A;  2BXR A;  4AT2 A;  2JKC A;  1NEN A;  4ECH A;  2QA1 A;  3DJE A;  3KKJ A;  5IPY A;  3IHG A;  1BKW A;  2WOI A;  2RGH A;  5C3J A;  2XVH A;  2XVE A;  3AD9 B;  2YG7 A;  4OPT A;  1COY A;  2WES A;  3CGC A;  4CCR A;  3CN8 A;  4FK1 A;  4APN A;  2GRT A;  4JN9 A;  1O94 A;  1XDI A;  2A87 A;  2NVK X;  4U8P A;  1NHR A;  2YLT A;  4U8K A;  2GVC A;  3R9U A;  3NK2 X;  4U2T A;  1DOB A;  3ISH A;  3UKL A;  2VQ7 A;  3KU9 A;  1XHC A;  3SZ0 A;  3AE3 A;  2XVF A;  4A5L A;  3GRS A;  1VG0 A;  2OLN A;  4U2L A;  3GMC A;  3QSS A;  4NTE A;  3S5W A;  4Z25 A;  5C2T A;  3CMM A;  2BRY A;  3F8D A;  3LOV A;  3UTH A;  1IUT A;  3KVE A;  3O0H A;  2FJA A;  2C70 A;  3EAO A;  3FBS A;  2C3D A;  3AED A;  2JB1 A;  2X8G A;  1YKJ A;  2Z5X A;  1ZP0 A;  1S2Q A;  3QSE A;  1PJ5 A;  3VR9 A;  4G6H A;  2X3N A;  1EL7 A;  3BI2 A;  3QSM A;  1N1P A;  4ICY A;  3NNE A;  4GDE A;  4UDQ A;  4XWR A;  4Z2R A;  1QO8 A;  3AEE A;  2VVL G;  2XLT A;  2XFU A;  2EQ8 A;  2WU5 A;  2XVI A;  3NLC A;  5ER0 A;  2YR4 A;  5GSN A;  3I3L A;  1PBC A;  2YLX A;  4O5U A;  3ALL A;  1GSN A;  5HHF A;  3V76 A;  1K0J A;  5KMR A;  5U63 A;  3UKQ A;  1KSS A;  1ZMD A;  3AE8 A;  3FMW A;  2XLU A;  3AXB A;  4TM4 A;  1MXT A;  1V59 A;  4YKF A;  3EAN A;  4NTD A;  3AD7 B;  2YG5 A;  1NG4 A;  2YLR A;  3GWF A;  2BC0 A;  2XLS A;  3NTD A;  4BK1 A;  2RAB A;  4YSZ A;  3NGC X;  1PXB A;  1H7X A;  2VOU A;  1B4V A;  2C75 A;  3CNP A;  2R46 A;  4RG3 A;  5JCN A;  3V3O A;  1JRZ A;  1LQT A;  5FS7 A;  4GAV A;  2C73 A;  4U8I A;  2BK3 A;  2V60 A;  3NYC A;  2B9X A;  3PO7 A;  3SZC A;  1TRB A;  2GR0 A;  3COX A;  3ITJ A;  3KPK A;  4OVI A;  4USQ A;  5JCI A;  1GAL A;  2R0P A;  1H7W A;  5KOX A;  2X8H A;  3P4P A;  3CPI G;  4I58 A;  4H4P A;  3Q6J A;  4H4W A;  3G5R A;  3B6D A;  3II4 A;  4OPC A;  1CC6 A;  1PBE A;  3ALM A;  2C3C A;  1F8S A;  2WPF A;  3HYW A;  3KLJ A;  4G73 A;  3VR8 A;  5BRT A;  1LTX R;  1DOE A;  4H50 A;  1CJ4 A;  3UOV A;  4EMW A;  1E1N A;  1H84 A;  3DA1 A;  4DSG A;  3NTA A;  3SZW A;  3CND A;  3T2K A;  3AD8 B;  4CNK A;  4N9X A;  1FOH A;  1FL2 A;  2RGJ A;  2WBA A;  5EB4 A;  4GRT A;  2BCP A;  1KNP A;  2XCG A;  3UKF A;  4YWO A;  3NYF A;  2GR3 A;  2VVM A;  2XFQ A;  3ZYX A;  4BJZ A;  1GRA A;  4J56 A;  1E39 A;  4CBQ A;  4ZN0 A;  4U8M A;  3GWD A;  4JNA A;  1OJ9 A;  2Q0L A;  2V61 A;  2GB0 A;  1JRY A;  3ATR A;  2WOV A;  2NPX A;  3HYV A;  4A6N B;  4E0V A;  4FX9 A;  3AEB A;  2AR8 A;  1IUX A;  3SYI A;  1ZY8 A;  4YT0 A;  1VDC A;  2YLW A;  5U25 A;  4GF7 A;  1D4C A;  3OC4 A;  4REK A;  4B63 A;  2CVJ A;  1ZMC A;  1PS9 A;  1VG9 A;  1XPQ A;  2C76 A;  4J34 A;  2BK5 A;  3DK4 A;  4DNA A;  2ACZ A;  2E5V A;  5IQ4 A;  1NG3 A;  3KD9 A;  4GAP A;  1F8W A;  1S3E A;  4AP1 A;  1KNR A;  2GR2 A;  2XLP A;  3IF9 A;  3GRT A;  4XWZ A;  2FJB A;  4NEV A;  2GEW A;  1DJQ A;  2JBV A;  2IVD A;  2AQJ A;  3ICT A;  4II3 A;  3NG7 X;  2R4J A;  1NHQ A;  3VRD B;  2C64 A;  3L8K A;  1JRX A;  3CNJ A;  2CUL A;  3T2Z A;  4B65 A;  1BWC A;  3OZ2 A;  2C65 A;  4H4S A;  1Q1R A;  4G74 A;  3QVP A;  5DBJ A;  5KVI A;  2A89 A;  2VRL A;  3RNM A;  3AYL A;  2XFN A;  2YG4 A;  3H8I A;  1GOS A;  3T37 A;  5KNL A;  4LU6 A;  4EQS A;  1JOA A;  2OLO A;  4Y4N A;  3T0K A;  3NKS A;  2DKI A;  4CY6 A;  1FCD A;  2BAC A;  3C96 A;  3P9U A;  4UDP A;  1TDF A;  2GMH A;  2ZZ0 A;  1P2E A;  4II2 A;  4IVO B;  3ADA B;  1B8S A;  1L9D A;  3ALJ A;  4UDR A;  2GMJ A;  1GRF A;  3GD4 A;  1Q9I A;  2Y6R A;  2XFO A;  3C4A A;  5U1O A;  2C4C A;  3DH9 A;  1H81 A;  1NEK A;  3GYJ A;  3CGD A;  1VQW A;  3QJ4 A;  4I59 A;  1PXA A;  2C66 A;  2WEU A;  2BAB A;  4J2W A;  1ZKQ A;  2CFY A;  1B5Q A;  2WQY A;  4H2Q A;  3LB8 A;  3AYI A;  4C77 A;  1AOG A;  4OPL A;  1YQ4 A;  2YVG A;  1BGN A;  2IVE A;  4GDP A;  2BXS A;  4J33 A;  4OPU A;  1OJT A;  1OJC A;  4KX6 A;  5KMQ A;  4EIP A;  3LXD A;  1D4E A;  3B3R A;  2WPC A;  4JNQ A;  3SXI A;  1CBO A;  3UOY A;  1FEB A;  2B76 A;  3SZF A;  5J7X A;  2GR1 A;  4NEW A;  2R0C A;  1TDK A;  2YWL A;  1IUU A;  1REO A;  1H86 A;  4YTM A;  3ABV A;  4Z26 A;  3SX6 A;  2F5Z A;  3KA7 A;  3E1T A;  3Q9T A;  4GR1 A;  1W4X A;  1ZDL A;  3G5Q A;  3NHO X;  5M10 A;  4H4U A;  3RP8 A;  2QA2 A;  1M64 A;  3UTG A;  1NHS A;  2R9Z A;  3CGB A;  4EMI A;  1GXF A;  3GDN A;  1QLB A;  2YM1 A;  3NK0 X;  2X50 A;  3NN6 X;  2YLZ A;  4H4X A;  3T31 A;  1GTE A;  2WDV A;  1L9C A;  4KPR A;  2H89 A;  2VRM A;  4B68 A;  4DGK A;  1D7Y A;  1N4U A;  4J31 A;  1Z6L A;  3ICR A;  3S61 A;  3JSK A;  3LJP A;  2EQ6 A;  2I0Z A;  1MOK A;  4H4T A;  3P4Q A;  4A7A A;  4H4Q A;  2BRA A;  1Q1W A;  5EB5 A;  3ICS A;  1N4V A;  4ZCC A;  1K0I A;  4TM0 A;  3GYI A;  3NK1 X;  3WE0 A;  3NIX A;  4C3X A;  4Z2U A;  2GF3 A;  4U8N A;  3ZDN A;  4CY8 A;  3AEF A;  3SQP A;  2RGO A;  5JCK A;  4H2N A;  1M6I A;  4B67 A;  4JQ9 A;  2B9W A;  1CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...