3ALMA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
b'KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMAPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3almA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3almA01
2BC1A 2E4GA 4TM0A 4UP3A 1TDOA 3FBSA 5IPYA 2H88A 4U8OA 3UKPA 3NN6X 5KXJA 3H8IA 2F5ZA 2GR3A 1H81A 4Y4NA 4YKFA 1LTXR 4J57A 4BJYA 3DJDA 1JNRA 1OJ9A 1YKJA 4YTMA 2JAEA 4H4PA 2X50A 3AE3A 5LV9A 4N9XA 4B67A 1ZMDA 1S2YA 4NTCA 4CBQA 1LVLA 1DOCA 1ZY8A 2YLXA 2YWLA 4YSXA 4YT0A 4YTPA 4Z2RA 2C3CA 1OJAA 3EANA 5JCNA 1H7XA 2YLWA 4U8JA 2YLZA 3PVCA 3QSSA 1P2HA 3ALMA 1N4VA 3FMWA 4LU6A 3GWDA 4X9NA 3LXDA 3F8PA 4C3XA 1NHPA 1RSGA 1GV4A 2XVIA 5BULA 2R0GA 1CJ3A 2GEWA 3BI2A 4EMJA 3AE5A 1ZOYA 2ZZBA 3GMCA 3H4KA 2JB2A 3BHFA 1CC4A 3AE1A 1F6MA 3V3OA 4CNKA 4CY8A 2WDQA 1DJNA 1TDFA 4NTDA 1UKVG 1GREA 2RGOA 3PS9A 4DSHA 4H2RA 1IUSA 2UZZA 2YLRA 3D8XA 4IA6A 4UDQA 2X3NA 4YSYA 1CF3A 1KF6A 3GRTA 3NYFA 1YQZA 2BXSA 2O9ZA 1PBBA 2WPFA 4H4ZA 1NG3A 1VRQB 1KFYA 3B3RA 4YXDA 4OPGA 1DOBA 2OAMA 5KRQA 2GVCA 1Q9IA 4H4UA 4H4TA 2BS2A 5JCMA 3DK4A 1D4DA 4M52A 4OPLA 2W0HA 4U8LA 4BK2A 3IWAA 4BURA 1GRAA 4E0VA 2BS3A 2XVFA 4CCQA 1GRHA 3AEEA 2WOIA 1OJCA 3GD3A 5CQFA 4B68A 4K5RA 2XCGA 1H84A 1CBOA 3QVPA 2V3AA 1IUWA 5U1OA 1ZDLA 2JK6A 1CJ2A 3LZWA 2XFQA 3LZXA 4H4VA 3PO7A 2BABA 4Y4LA 1SEZA 1PJ5A 2JKCA 5FS9A 1B8SA 3NK2X 1GXFA 1RP0A 3C4AA 2C65A 5FS6A 3RHAA 4A6NA 4H2QA 1CJCA 2X99A 2GRTA 3NK0X 3VQRA 1K0IA 1E1LA 3ALJA 3CPIG 3AD8B 3ZYXA 4H4WA 4EM4A 2XLTA 4FDCB 4HB9A 3UTGA 1GNDA 2VZ2A 1GERA 1TRBA 5BUKA 2XDOA 1N4UA 2WOWA 4OPDA 4WX1A 1D7YA 4B63A 1YY5A 1O94A 1ZOVA 3I6DA 3II4A 1EL5A 1JEHA 5FS7A 5EBKA 2YG5A 3AE2A 3AYLA 2GAGB 3LOVA 2RGHA 1XANA 2I0ZA 1E1KA 2RGJA 2VQBA 2V60A 3I3LA 2C72A 1ELIA 2EQ9A 3AEDA 3CGBA 4O5UA 3V3NA 2V5ZA 1TDEA 1IUUA 1PS9A 2VVLG 4EMWA 1ONFA 3DJJA 3UKLA 2R46A 4H4SA 3DK8A 1IUVA 4NEVA 4RSLA 4H4XA 4A79A 3UKQA 4ZCDA 1H86A 4EQSA 4P9SA 4TLZA 1DXLA 3DH9A 1H7WA 3NKSA 2C76A 3IHMA 3VRBA 1M6IA 5JCKA 1GRFA 1LJ1A 2XFUA 2NVKX 2YG4A 3WE0A 1PBEA 3DGZA 3UCLA 1FL2A 1O95A 3VRDB 4IVOB 3CGEA 3R9UA 4TM3A 3UOXA 1CHUA 2Q0KA 2E5VA 3CIRA 3QFBA 1Q1RA 4U8NA 3F8DA 4H2PA 1PJ7A 2RABA 1BF3A 3UOZA 4B1BA 3O0HA 2WP5A 1CC2A 1NPXA 3DK9A 1VG0A 1GPEA 4BK3A 5JCIA 2R9ZA 4K2XA 3RP8A 3S5WA 2Z5YA 4H7UA 3IHGA 5U25A 4Y4MA 3REDA 4GF7A 3AEAA 4K22A 2BCGG 3KPFA 3T37A 2VOUA 3GWFA 2AQJA 4U8IA 2EQ6A 3EPTA 1P2EA 4JQ9A 3CN8A 1TDKA 2BK5A 5GSNA 5M0ZA 2WPEA 4J56A 2YG3A 1L9EA 1B4VA 2B9YA 3CPJG 1GOSA 3NLCA 2DKHA 2ZBWA 2YG7A 1BKWA 2V61A 1RYIA 3LJPA 3LADA 5JCLA 2YM2A 2BC0A 3SGLA 3K30A 3UP5A 3DA1A 3QSEA 2GAHB 3GD4A 3M12A 5EB4A 1DOEA 3K7QX 2GR1A 5BVAA 5ER0A 4WCTA 4B66A 1BGJA 1KDGA 3NTAA 1CC6A 4JNQA 2H89A 2GF3A 1L0VA 2AR8A 2FJDA 3H8LA 1IUXA 4NZHA 1OJDA 3P4RA 3M0OA 1BZLA 4U8KA 4A6NB 4CY6A 2OLOA 1D4EA 2Q0LA 5IQ4A 1S2QA 5L46A 4AOSA 2FBWA 4CRTA 1AOGA 4GUVA 2YR5A 5HHFA 4C5OA 2APGA 3AB1A 3NH3X 3VR8A 2XLUA 3UKAA 2WU5A 3BNUA 4PABA 1GETA 1GRBA 2C7GA 4KPRA 2B7RA 5EOWA 1GRTA 5C2TA 2XVHA 1NDAA 3KU9A 2ARDA 4JDRA 4Z25A 1EL7A 2QAEA 1NHSA 2Y6QA 3AEBA 3KVEA 1L9CA 2Q6UA 1TYPA 2BYBA 4XXGA 3Q9TA 1L9DA 1MO9A 2YR4A 2JB3A 2YM1A 3DGHA 1YQ4A 5GRTA 3RNMA 2VRLA 4EIQA 1E1MA 1GALA 4Z44A 3AD7B 3FIMB 2YR6A 1V59A 3K7TA 2J3NA 1OJTA 5DBJA 1VG9A 5EB5A 1VQWA 3GYJA 4KX6A 1IUTA 3BI4A 5KWFA 1F3PA 1JNZA 2A89A 3AD9B 3NNEA 4CCRA 2Q7VA 3G5SA 5CKUA 2A87A 3FG2P 4U8PA 3CNPA 4ZN0A 2R4JA 1KSSA 1BWCA 2X8GA 3NIXA 4EIPA 2Y6RA 3ADAB 2YVGA 1PJ6A 4OVIA 4U2LA 1GSNA 1DJQA 2YG6A 2WBAA 2QA2A 3VR9A 3ALLA 3L8KA 2GV8A 2X8CA 1LPFA 1EL8A 1NEKA 3NYEA 4DSGA 3P1WA 2BK4A 1JRZA 4J33A 2C75A 2GH5A 1TYTA 3BI5A 3UKHA 1Q1WA 5HYMA 1B5QA 1QJDA 2TPRA 3ATQA 1ZP0A 2YQUA 3QFAA 4J2WA 4Z43A 1NG4A 3Q6JA 4J31A 5J60A 1VDCA 1O5WA 1D4CA 3NHOX 2WS3A 3AECA 2CVJA 2V6OA 3AEFA 4IVMB 2GR2A 1PXBA 2IVEA 1K4QA 4OPUA 4U2SA 4EQXA 2GMJA 1GTHA 4CNJA 1TDNA 2CDUA 1M64A 1HYUA 3NG7X 4K7ZA 5FMHA 2YLSA 4JNAA 3SFEA 4ECHA 4C77A 2TMDA 2YLTA 2V3BA 3CNJA 5U63A 4A5LA 4JN9A 4AT0A 2X8HA 2WPCA 4H4RA 4BJZA 3P9UA 3GMBA 1H6VA 2C3DA 4YTNA 1H82A 4B69A 2BCPA 1YQ3A 1PXCA 2YVFA 1W4XA 2DKIA 1FOHA 2WDVA 3ICRA 5KVHA 1PXAA 4AT2A 3CNDA 1KSUA 4EMIA 4ICYA 5KVIA 2PYXA 4A65A 2OLNA 2FJEA 2R0PA 4DNAA 1PBCA 4GDEA 2BS4A 3UOVA 3UTEA 4FK1C 4REKA 3HZLA 2YVJA 3EF6A 1PHHA 2C66A 2GMHA 2FJBA 1BGNA 1K0LA 2XFNA 3AYIA 3NK1X 3UOYA 3AE7A 4XWZA 2XVEA 2ZZCA 1E6EA 4NTEA 3DMEA 1Y56A 4B65A 1H83A 5BRTA 2BK3A 4U2TA 1JOAA 4USQA 4D03A 1S3EA 3BHKA 2EQ8A 4O5QA 1FEAA 1GRGA 5KOXA 5HY5A 2C67A 4BV6A 3D1CA 4UDPA 2BXRA 2C70A 3IF9A 1F8SA 2XYOA 3ICTA 4D04A 2XLSA 2JBVA 3JSKA 2GB0A 1NHQA 4J34A 4Z24A 2B9XA 4ZCCA 4H2NA 1DODA 2HQMA 2VRMA 3COXA 3SFDA 1FECA 2EQ7A 3AEGA 4A7AA 2CFYA 3V76A 4DGKA 4GCMA 1GEUA 2QA1A 1PBFA 1COYA 2ACZA 4MJWA 1D5TA 4K5SA 1KNRA 2WDRA 4OPCA 4U8MA 3BNMA 2GR0A 4FK1A 1JRXA 2WQYA 3ITJA 2AAQA 3ISHA 2XVJA 1B37A 3KLJA 4X9MA 1PDHA 1Z6LA 4H4YA 2B7SA 3AE8A 3NGCX 1GT8A 4GRTA 1N4WA 3C96A 3ABVA 1N1PA 4XWRA 3K7MX 2CULA 1PN0A 3CPHG 3GSIA 5HXIA 1K0JA 4GDPA 3CGDA 4HA6A 1DNCA 2XFOA 4ADWA 3RP7A 3AE9A 2B76A 3SQPA 4IA5A 3GYIA 2WOVA 3KKJA 1X31B 2WEUA 3L1RA 4C74A 3AYJA 5TR3A 3ZDNA 2A8XA 4APNA 1MOKA 1CJ4A 2B9WA 4A99A 2WU2A 5C3JA 3QSMA 4TM1A 5M10A 4OPIA 3GRSA 3NN0X 4I58A 2JB1A 4AOXA 3QVRA 2OALA 2WESA 3G5QA 2WP9A 4H4QA 3CGCA 4BK1A 4C3YA 2E1MA 3DJGX 4J36A 2OA1A 1GESA 2PHHA 4NEWA 3AXBA 1QLBA 3P4PA 1LV0A 1Y0PA 2R45A 1LQUA 4USRA 5KOWA 2VQ7A 3UTHA 4Z26A 1ZK7A 4UDRA 3GDNA 1E1NA 3CTYA 2YAUA 4JY2A 4IV9A 4RG3A 5J7XA 1E39A 3OZ2A 2GQWA 4X4JA 1QO8A 4Z2TA 4JY3A 1XPQA 4I59A 1ZMCA 2XLRA 3NT6A 1GTEA 3UKKA 3F8RA 4FX9A 2BACA 3CNTA 5FS8A 2NPXA 2BA9A 1Y56B 4EQRA 1ZX9A 1FEBA 4OCGA 1F8WA 4K8DA 3NTDA 2ZZ0A 3P4QA 4LA1A 4YWOA 4EM3A 4TLXA 1IJHA 3UKFA 3GDPA 3URHA 2R0CA 1KNPA 3AE6A 2XFPA 1PBDA 4H50A 4AP1A 3AWIA 3IC9A 3C4NA 2C73A 3CNSA 3DJEA 2R4EA 1FCDA 2FJAA 2Z5XA 3FPZA 1NAAA 3QJ4A 3S61A 1NENA 1LQTA 2VVLA 3UP4A 3ATRA 2IIDA 1S3BA 3OC4A 3E1TA 2WP6A 4EQWA 1XDIA 1ZKQA 3UTFA 3NYCA 4RG4A 3SM8A 1CL0A 3M13A 3VRAA 4A9WA 1MXTA 4Z2UA 5IQ1A 2VVMA 4YSHA 1EBDA 1D7LA 3B6DA 2XLPA 1NHRA 2C64A 1EL9A 1XHCA 3NRNA 4TM4A 2IVDA 1E7PA 3RP6A 4B64A 3P4SA 3KD9A 4PAAA 3AE4A 2WETA 4YSZA 1JU2A 4OPTA 2QCUA 3ICSA 2WHDA 4GR1A 2GQFA 3EAOA 4YKGA 1F8RA 4LIIA 3KA7A 3LB8A 4AP3A 1JRYA 3G5RA 1REOA
chains in the Genus database with same CATH superfamily
2BC1A 2E4GA 4TM0A 4UP3A 1TDOA 3FBSA 5IPYA 2H88A 4U8OA 3UKPA 3NN6X 5KXJA 3H8IA 2F5ZA 2GR3A 1H81A 4Y4NA 4YKFA 1LTXR 4BJYA 4J57A 5KMQA 3DJDA 1JNRA 1OJ9A 1YKJA 4YTMA 2JAEA 4H4PA 2X50A 3AE3A 5LV9A 4N9XA 4B67A 1ZMDA 1S2YA 4NTCA 4CBQA 1LVLA 1DOCA 1ZY8A 2YLXA 2YWLA 4YSXA 2E48A 4YT0A 4YTPA 4Z2RA 2C3CA 1OJAA 3EANA 3SX6A 1H7XA 2YLWA 5JCNA 4U8JA 2YLZA 3PVCA 3QSSA 1P2HA 3ALMA 1N4VA 3FMWA 4LU6A 3GWDA 4X9NA 3LXDA 3F8PA 4C3XA 1C0IA 1NHPA 1RSGA 1GV4A 2XVIA 5BULA 2R0GA 5KMSA 1CJ3A 2GEWA 3BI2A 4EMJA 3AE5A 1ZOYA 1AN9A 2ZZBA 3W4IA 3GMCA 3H4KA 4GAPA 2JB2A 3SZ0A 3BHFA 1CC4A 3AE1A 1F6MA 3V3OA 3GYXA 4CNKA 4CY8A 2WDQA 1DJNA 1TDFA 3KPKA 4QFCA 1UKVG 1GREA 2RGOA 3PS9A 4NTDA 4DSHA 1IUSA 4H2RA 2UZZA 2YLRA 4II3A 3D8XA 3T0KA 5KMRA 4IA6A 4UDQA 2X3NA 4YSYA 1CF3A 1KF6A 3NYFA 3GRTA 1YQZA 2BXSA 2O9ZA 3SZCA 1PBBA 2WPFA 4H4ZA 1NG3A 1VRQB 1KFYA 3B3RA 4YXDA 2E4AA 4OPGA 1DOBA 2OAMA 5KRQA 2GVCA 1Q9IA 4H4UA 4H4TA 2BS2A 5JCMA 3DK4A 1D4DA 4M52A 4OPLA 2W0HA 4U8LA 4BK2A 3IWAA 4BURA 1GRAA 4E0VA 2BS3A 1C0KA 2XVFA 4CCQA 1GRHA 3AEEA 3WGTA 1OJCA 2WOIA 3GD3A 5CQFA 4B68A 4K5RA 2XCGA 1H84A 1CBOA 3QVPA 2V3AA 1IUWA 5U1OA 1ZDLA 2JK6A 1CJ2A 3LZWA 2XFQA 3LZXA 4H4VA 3PO7A 2BABA 4Y4LA 1SEZA 1PJ5A 2JKCA 5FS9A 1B8SA 3NK2X 4YJGB 1GXFA 3C4AA 1RP0A 2C65A 5FS6A 1VE9A 3RHAA 4A6NA 4H2QA 1CJCA 4G74A 2X99A 2GRTA 3NK0X 3VQRA 1K0IA 1E1LA 3ALJA 3CPIG 3AD8B 3ZYXA 4H4WA 4EM4A 2XLTA 4FDCB 4HB9A 3UTGA 1GNDA 2VZ2A 1GERA 1TRBA 5BUKA 2XDOA 1N4UA 2WOWA 4OPDA 4WX1A 1D7YA 4B63A 1YY5A 1ZOVA 1O94A 3I6DA 3II4A 1EL5A 1JEHA 5FS7A 5EBKA 2YG5A 3AE2A 3AYLA 2GAGB 3LOVA 2RGHA 1XANA 2I0ZA 1E1KA 3T14A 2RGJA 2VQBA 3ZNQA 2V60A 3I3LA 2C72A 1ELIA 2EQ9A 3AEDA 3CGBA 4O5UA 3V3NA 2V5ZA 1IUUA 1TDEA 1PS9A 2VVLG 4EMWA 1ONFA 3DJJA 3UKLA 2R46A 4H4SA 3DK8A 1IUVA 4NEVA 4RSLA 4H4XA 4A79A 2BRYA 4G6HA 3UKQA 4ZCDA 1H86A 4EQSA 4P9SA 4TLZA 3ZNOA 1DXLA 3DH9A 1H7WA 3NKSA 2C76A 3IHMA 3VRBA 1M6IA 5JCKA 1GRFA 1LJ1A 2XFUA 2NVKX 2YG4A 3WE0A 1PBEA 3DGZA 3UCLA 1FL2A 1O95A 3VRDB 4IVOB 3CGEA 4GAVA 3R9UA 4TM3A 3UOXA 1CHUA 2Q0KA 2E5VA 3CIRA 3QFBA 1Q1RA 4U8NA 3F8DA 4H2PA 2BRAA 1PJ7A 2RABA 1BF3A 3UOZA 4B1BA 3O0HA 2WP5A 1CC2A 1NPXA 4G9KA 3DK9A 1VG0A 1GPEA 4BK3A 5JCIA 2R9ZA 3RP8A 4K2XA 3S5WA 2Z5YA 4H7UA 3IHGA 4NNJA 5U25A 4Y4MA 3REDA 4GF7A 3AEAA 4K22A 2BCGG 3KPFA 3T37A 4NWZA 2VOUA 3GWFA 2AQJA 4U8IA 2EQ6A 3EPTA 1P2EA 4JQ9A 3CN8A 1TDKA 2BK5A 5GSNA 5M0ZA 2E49A 2WPEA 4J56A 2YG3A 1L9EA 1B4VA 2B9YA 3CPJG 1GOSA 3NLCA 2DKHA 2ZBWA 4G6GA 2YG7A 1BKWA 2V61A 1RYIA 3LJPA 3LADA 5JCLA 4YJDA 5KNLA 2YM2A 2BC0A 3SGLA 3K30A 3G3EA 3UP5A 3DA1A 3QSEA 2GAHB 3GD4A 3M12A 5EB4A 1DOEA 3K7QX 2GR1A 5BVAA 5ER0A 4WCTA 4B66A 1BGJA 1KDGA 3NTAA 1CC6A 4JNQA 2H89A 2GF3A 1L0VA 3HYVA 2AR8A 2FJDA 3H8LA 3SXIA 1IUXA 4NZHA 1OJDA 3P4RA 3M0OA 1BZLA 4U8KA 4A6NB 3HYXA 2OLOA 1D4EA 4CY6A 2Q0LA 5IQ4A 5L46A 1S2QA 4YJFB 4AOSA 2FBWA 4CRTA 1AOGA 4GUVA 2YR5A 5HHFA 4C5OA 2APGA 3AB1A 3NH3X 3VR8A 2XLUA 3UKAA 2WU5A 3BNUA 4PABA 1GETA 1GRBA 2C7GA 4YJHA 4KPRA 2B7RA 5EOWA 1GRTA 5C2TA 2XVHA 1NDAA 3KU9A 2ARDA 4JDRA 4Z25A 1EL7A 2QAEA 2E82A 1NHSA 2Y6QA 3AEBA 4QFDA 1L9CA 2Q6UA 3KVEA 1TYPA 2BYBA 4XXGA 3Q9TA 1L9DA 1C0PA 1MO9A 2YR4A 2JB3A 2YM1A 3DGHA 1YQ4A 5GRTA 3RNMA 2VRLA 4EIQA 1E1MA 1GALA 4Z44A 3AD7B 3FIMB 2YR6A 1V59A 3K7TA 2J3NA 1OJTA 4G73A 5DBJA 1VG9A 5EB5A 1VQWA 3GYJA 4KX6A 1IUTA 3BI4A 5KWFA 1F3PA 2A89A 3AD9B 1JNZA 3NNEA 4CCRA 2Q7VA 3G5SA 5CKUA 2A87A 3FG2P 4U8PA 3CNPA 4ZN0A 2R4JA 1KSSA 1BWCA 2X8GA 3NIXA 4EIPA 3ADAB 2Y6RA 2YVGA 1PJ6A 4OVIA 4U2LA 1GSNA 1DJQA 3SZWA 2YG6A 2WBAA 2QA2A 3VR9A 3ALLA 3L8KA 2GV8A 2X8CA 1LPFA 1EL8A 1NEKA 3NYEA 4DSGA 3P1WA 2BK4A 1JRZA 4J33A 2C75A 2GH5A 1TYTA 5HYMA 3BI5A 1Q1WA 1DAOA 3UKHA 1B5QA 1QJDA 2TPRA 3ATQA 1ZP0A 2YQUA 3QFAA 4J2WA 4Z43A 1NG4A 3Q6JA 4J31A 5J60A 1VDCA 1O5WA 1D4CA 3NHOX 2WS3A 3AECA 2CVJA 2V6OA 3AEFA 4IVMB 2GR2A 1PXBA 2IVEA 1K4QA 4OPUA 4U2SA 4EQXA 2GMJA 1GTHA 4CNJA 1TDNA 2CDUA 1M64A 1HYUA 3NG7X 4K7ZA 5FMHA 2YLSA 4JNAA 3SFEA 4ECHA 4C77A 2TMDA 2YLTA 2V3BA 3CNJA 5U63A 4A5LA 4JN9A 4AT0A 2X8HA 2WPCA 4H4RA 4BJZA 3P9UA 3GMBA 1H6VA 2C3DA 4II2A 1H82A 4YTNA 4B69A 2BCPA 1YQ3A 1PXCA 2YVFA 1W4XA 2DKIA 1FOHA 3W4KA 2WDVA 3ICRA 1PXAA 5KVHA 4AT2A 3CNDA 1KSUA 4EMIA 1DDOA 4ICYA 5KVIA 2PYXA 4A65A 2OLNA 2FJEA 2R0PA 4DNAA 1PBCA 4GDEA 2BS4A 3UOVA 3UTEA 4FK1C 4REKA 3HZLA 2YVJA 3EF6A 1PHHA 2GMHA 2C66A 2FJBA 1BGNA 1K0LA 2XFNA 3AYIA 3NK1X 3UOYA 3AE7A 4XWZA 2XVEA 2ZZCA 1E6EA 2DU8A 4NTEA 1EVIA 3DMEA 1Y56A 1H83A 4B65A 5BRTA 2BK3A 4U2TA 1JOAA 4USQA 2C4CA 4D03A 1S3EA 3BHKA 2EQ8A 3T2ZA 4O5QA 1FEAA 1GRGA 5KOXA 5HY5A 1C0LA 2C67A 4BV6A 3D1CA 4UDPA 2BXRA 3IF9A 2C70A 1F8SA 2XYOA 3ICTA 4D04A 2XLSA 2JBVA 3JSKA 2GB0A 1NHQA 4J34A 4Z24A 2B9XA 4ZCCA 4H2NA 1DODA 2HQMA 2VRMA 3COXA 3SFDA 1FECA 2EQ7A 3AEGA 4A7AA 2CFYA 3V76A 4DGKA 4GCMA 3ZNPA 1GEUA 2QA1A 1PBFA 1COYA 2ACZA 4MJWA 1D5TA 4K5SA 1KNRA 2WDRA 4OPCA 4U8MA 3BNMA 2GR0A 4FK1A 1JRXA 2WQYA 4X9MA 2AAQA 3ISHA 2XVJA 1B37A 3ITJA 3KLJA 1PDHA 1Z6LA 4H4YA 2B7SA 3AE8A 3NGCX 1GT8A 4GRTA 3SY4A 1N4WA 3C96A 3W4JA 3ABVA 1N1PA 4XWRA 3K7MX 2CULA 1PN0A 3GSIA 3CPHG 1K0JA 5HXIA 4GDPA 3CGDA 4HA6A 1DNCA 2XFOA 4ADWA 3RP7A 3AE9A 2B76A 3SQPA 4IA5A 3GYIA 2WOVA 3KKJA 5KMPA 1X31B 3T2YA 2WEUA 3L1RA 4C74A 3SYIA 3AYJA 5TR3A 3ZDNA 2A8XA 4APNA 1MOKA 1CJ4A 2B9WA 3HYWA 4A99A 2WU2A 5C3JA 3QSMA 4TM1A 5M10A 4OPIA 3GRSA 3NN0X 4I58A 2JB1A 4AOXA 3QVRA 2OALA 2WESA 3G5QA 4BK1A 2WP9A 3CGCA 4H4QA 4C3YA 2E1MA 3DJGX 4J36A 2OA1A 2PHHA 1GESA 4NEWA 3AXBA 1QLBA 3P4PA 1LV0A 1Y0PA 2R45A 1LQUA 4USRA 3SZFA 5KOWA 2VQ7A 3UTHA 4Z26A 1ZK7A 4UDRA 3GDNA 1E1NA 3CTYA 3CMMA 2YAUA 4JY2A 4IV9A 4RG3A 5J7XA 1E39A 3OZ2A 3T2KA 2GQWA 4X4JA 1QO8A 4Z2TA 4JY3A 1XPQA 4I59A 4YJFA 3CUKA 1ZMCA 2XLRA 3NT6A 1GTEA 3UKKA 3F8RA 4FX9A 2BACA 3CNTA 5FS8A 2NPXA 2BA9A 1Y56B 4EQRA 1ZX9A 1FEBA 4OCGA 1F8WA 4K8DA 3NTDA 2ZZ0A 3P4QA 4LA1A 4YWOA 4EM3A 4TLXA 1IJHA 3UKFA 3GDPA 3URHA 2R0CA 1KNPA 3AE6A 2XFPA 1PBDA 4H50A 4AP1A 3AWIA 3IC9A 3T31A 3C4NA 3DJEA 2C73A 3CNSA 2R4EA 1FCDA 2FJAA 2Z5XA 3FPZA 1NAAA 3QJ4A 3S61A 1NENA 1LQTA 2VVLA 3UP4A 3ATRA 2IIDA 1S3BA 3OC4A 3E1TA 2WP6A 4EQWA 1XDIA 1ZKQA 3UTFA 3NYCA 4RG4A 3SM8A 3M13A 1CL0A 3VRAA 3ZNNA 4A9WA 1MXTA 4Z2UA 5IQ1A 1KIFA 4YJGA 4YSHA 2VVMA 1EBDA 1D7LA 3B6DA 2XLPA 1NHRA 2C64A 1EL9A 1XHCA 3NRNA 4TM4A 2IVDA 1E7PA 3RP6A 4B64A 3P4SA 4PAAA 4YJHB 3AE4A 3KD9A 2WETA 4YSZA 1JU2A 4OPTA 2QCUA 3ICSA 2WHDA 4GR1A 2GQFA 3EAOA 4YKGA 1F8RA 4LIIA 3KA7A 3LB8A 4AP3A 1JRYA 3G5RA 1REOA
chains in the Genus database with same CATH topology
2BC1A 2E4GA 4TM0A 4UP3A 1TDOA 3FBSA 5IPYA 2H88A 4U8OA 3UKPA 3NN6X 5KXJA 3H8IA 2F5ZA 2GR3A 1H81A 4Y4NA 4YKFA 1LTXR 4BJYA 4J57A 5KMQA 3DJDA 1JNRA 1OJ9A 1YKJA 4YTMA 2JAEA 4H4PA 2X50A 3AE3A 5LV9A 4N9XA 4B67A 1ZMDA 1S2YA 4NTCA 4CBQA 1LVLA 1DOCA 1ZY8A 2YLXA 2YWLA 4YSXA 4YT0A 4YTPA 4Z2RA 2C3CA 1OJAA 3EANA 3SX6A 1H7XA 2YLWA 5JCNA 4U8JA 2YLZA 3PVCA 3QSSA 1P2HA 3ALMA 1N4VA 3FMWA 4LU6A 3GWDA 4X9NA 3LXDA 3F8PA 4C3XA 1NHPA 1RSGA 1GV4A 2XVIA 5BULA 2R0GA 5KMSA 1CJ3A 2GEWA 3BI2A 4EMJA 3AE5A 1ZOYA 2ZZBA 3SZ0A 3GMCA 3H4KA 4GAPA 2JB2A 3BHFA 1CC4A 3AE1A 1F6MA 3V3OA 3GYXA 4CNKA 4CY8A 2WDQA 1DJNA 1TDFA 3KPKA 4NTDA 1UKVG 1GREA 2RGOA 3PS9A 4DSHA 4H2RA 1IUSA 2UZZA 2YLRA 4II3A 3D8XA 3T0KA 5KMRA 4IA6A 4UDQA 2X3NA 4YSYA 1CF3A 1KF6A 3GRTA 3NYFA 1YQZA 2BXSA 2O9ZA 3SZCA 1PBBA 2WPFA 4H4ZA 1NG3A 1VRQB 1KFYA 3B3RA 4YXDA 4OPGA 1DOBA 2OAMA 5KRQA 2GVCA 1Q9IA 4H4UA 4H4TA 2BS2A 5JCMA 3DK4A 1D4DA 4M52A 4OPLA 2W0HA 4U8LA 4BK2A 3IWAA 4BURA 1GRAA 4E0VA 2BS3A 2XVFA 4CCQA 1GRHA 3AEEA 2WOIA 1OJCA 3GD3A 5CQFA 4B68A 4K5RA 2XCGA 1H84A 1CBOA 3QVPA 2V3AA 1IUWA 5U1OA 1ZDLA 2JK6A 1CJ2A 3LZWA 2XFQA 3LZXA 4H4VA 3PO7A 2BABA 4Y4LA 1SEZA 1PJ5A 2JKCA 5FS9A 1B8SA 3NK2X 1GXFA 3C4AA 1RP0A 2C65A 5FS6A 3RHAA 4A6NA 4H2QA 1CJCA 4G74A 2X99A 2GRTA 3NK0X 3VQRA 1K0IA 1E1LA 3ALJA 3CPIG 3AD8B 3ZYXA 4H4WA 4EM4A 2XLTA 4FDCB 4HB9A 3UTGA 1GNDA 2VZ2A 1GERA 1TRBA 5BUKA 2XDOA 1N4UA 2WOWA 4OPDA 4WX1A 1D7YA 4B63A 1YY5A 1O94A 1ZOVA 3I6DA 3II4A 1EL5A 1JEHA 5FS7A 5EBKA 2YG5A 3AE2A 3AYLA 2GAGB 3LOVA 2RGHA 1XANA 2I0ZA 1E1KA 3T14A 2RGJA 2VQBA 2V60A 3I3LA 2C72A 1ELIA 2EQ9A 3AEDA 3CGBA 4O5UA 3V3NA 2V5ZA 1TDEA 1IUUA 1PS9A 2VVLG 4EMWA 1ONFA 3DJJA 3UKLA 2R46A 4H4SA 3DK8A 1IUVA 4NEVA 4RSLA 4H4XA 4A79A 2BRYA 4G6HA 3UKQA 4ZCDA 1H86A 4EQSA 4P9SA 4TLZA 1DXLA 3DH9A 1H7WA 3NKSA 2C76A 3IHMA 3VRBA 1M6IA 5JCKA 1GRFA 1LJ1A 2XFUA 2NVKX 2YG4A 3WE0A 1PBEA 3DGZA 3UCLA 1FL2A 1O95A 3VRDB 4IVOB 3CGEA 4GAVA 3R9UA 4TM3A 3UOXA 1CHUA 2Q0KA 2E5VA 3CIRA 3QFBA 1Q1RA 4U8NA 3F8DA 4H2PA 2BRAA 1PJ7A 2RABA 1BF3A 3UOZA 4B1BA 3O0HA 2WP5A 1CC2A 1NPXA 4G9KA 3DK9A 1VG0A 1GPEA 4BK3A 5JCIA 2R9ZA 3RP8A 4K2XA 3S5WA 2Z5YA 4H7UA 3IHGA 4NNJA 5U25A 4Y4MA 3REDA 4GF7A 3AEAA 4K22A 2BCGG 3KPFA 3T37A 4NWZA 2VOUA 3GWFA 2AQJA 4U8IA 2EQ6A 3EPTA 1P2EA 4JQ9A 3CN8A 1TDKA 2BK5A 5GSNA 5M0ZA 2WPEA 4J56A 2YG3A 1L9EA 1B4VA 2B9YA 3CPJG 1GOSA 3NLCA 2DKHA 2ZBWA 4G6GA 2YG7A 1BKWA 2V61A 1RYIA 3LJPA 3LADA 5JCLA 5KNLA 2YM2A 2BC0A 3SGLA 3K30A 3UP5A 3DA1A 3QSEA 2GAHB 3GD4A 3M12A 5EB4A 1DOEA 3K7QX 2GR1A 5BVAA 5ER0A 4WCTA 4B66A 1BGJA 1KDGA 3NTAA 1CC6A 4JNQA 2H89A 2GF3A 1L0VA 3HYVA 2AR8A 2FJDA 3H8LA 3SXIA 1IUXA 4NZHA 1OJDA 3P4RA 3M0OA 1BZLA 4U8KA 4A6NB 3HYXA 2OLOA 1D4EA 4CY6A 2Q0LA 5IQ4A 1S2QA 5L46A 4AOSA 2FBWA 4CRTA 1AOGA 4GUVA 2YR5A 5HHFA 4C5OA 2APGA 3AB1A 3NH3X 3VR8A 2XLUA 3UKAA 2WU5A 3BNUA 4PABA 1GETA 1GRBA 2C7GA 4KPRA 2B7RA 5EOWA 1GRTA 5C2TA 2XVHA 1NDAA 3KU9A 2ARDA 4JDRA 4Z25A 1EL7A 2QAEA 1NHSA 2Y6QA 3AEBA 3KVEA 1L9CA 2Q6UA 1TYPA 2BYBA 4XXGA 3Q9TA 1L9DA 1MO9A 2YR4A 2JB3A 2YM1A 3DGHA 1YQ4A 5GRTA 3RNMA 2VRLA 4EIQA 1E1MA 1GALA 4Z44A 3AD7B 3FIMB 2YR6A 1V59A 3K7TA 2J3NA 1OJTA 4G73A 5DBJA 1VG9A 5EB5A 1VQWA 3GYJA 4KX6A 1IUTA 3BI4A 5KWFA 1F3PA 1JNZA 2A89A 3AD9B 3NNEA 4CCRA 2Q7VA 3G5SA 5CKUA 2A87A 3FG2P 4U8PA 3CNPA 4ZN0A 2R4JA 1KSSA 1BWCA 2X8GA 3NIXA 4EIPA 2Y6RA 3ADAB 2YVGA 1PJ6A 4OVIA 4U2LA 1GSNA 1DJQA 3SZWA 2YG6A 2WBAA 2QA2A 3VR9A 3ALLA 3L8KA 2GV8A 2X8CA 1LPFA 1EL8A 1NEKA 3NYEA 4DSGA 3P1WA 2BK4A 1JRZA 4J33A 2C75A 2GH5A 1TYTA 5HYMA 3BI5A 1Q1WA 3UKHA 1B5QA 1QJDA 2TPRA 3ATQA 1ZP0A 2YQUA 3QFAA 4J2WA 4Z43A 1NG4A 3Q6JA 4J31A 5J60A 1VDCA 1O5WA 1D4CA 3NHOX 2WS3A 3AECA 2CVJA 2V6OA 3AEFA 4IVMB 2GR2A 1PXBA 2IVEA 1K4QA 4OPUA 4U2SA 4EQXA 2GMJA 1GTHA 4CNJA 1TDNA 2CDUA 1M64A 1HYUA 3NG7X 4K7ZA 5FMHA 2YLSA 4JNAA 3SFEA 4ECHA 4C77A 2TMDA 2YLTA 2V3BA 3CNJA 5U63A 4A5LA 4JN9A 4AT0A 2X8HA 2WPCA 4H4RA 4BJZA 3P9UA 3GMBA 1H6VA 2C3DA 4II2A 1H82A 4YTNA 4B69A 2BCPA 1YQ3A 1PXCA 2YVFA 1W4XA 2DKIA 1FOHA 2WDVA 3ICRA 5KVHA 1PXAA 4AT2A 3CNDA 1KSUA 4EMIA 4ICYA 5KVIA 2PYXA 4A65A 2OLNA 2FJEA 2R0PA 4DNAA 1PBCA 4GDEA 2BS4A 3UOVA 3UTEA 4FK1C 4REKA 3HZLA 2YVJA 3EF6A 1PHHA 2GMHA 2C66A 2FJBA 1BGNA 1K0LA 2XFNA 3AYIA 3NK1X 3UOYA 3AE7A 4XWZA 2XVEA 2ZZCA 1E6EA 4NTEA 3DMEA 1Y56A 4B65A 1H83A 5BRTA 2BK3A 4U2TA 1JOAA 4USQA 2C4CA 4D03A 1S3EA 3BHKA 2EQ8A 3T2ZA 4O5QA 1FEAA 1GRGA 5KOXA 5HY5A 2C67A 4BV6A 3D1CA 4UDPA 2BXRA 2C70A 3IF9A 1F8SA 2XYOA 3ICTA 4D04A 2XLSA 2JBVA 3JSKA 2GB0A 1NHQA 4J34A 4Z24A 2B9XA 4ZCCA 4H2NA 1DODA 2HQMA 2VRMA 3COXA 3SFDA 1FECA 2EQ7A 3AEGA 4A7AA 2CFYA 3V76A 4DGKA 4GCMA 1GEUA 2QA1A 1PBFA 1COYA 2ACZA 4MJWA 1D5TA 4K5SA 1KNRA 2WDRA 4OPCA 4U8MA 3BNMA 2GR0A 4FK1A 1JRXA 2WQYA 3ITJA 2AAQA 3ISHA 2XVJA 1B37A 3KLJA 4X9MA 1PDHA 1Z6LA 4H4YA 2B7SA 3AE8A 3NGCX 1GT8A 4GRTA 3SY4A 1N4WA 3C96A 3ABVA 1N1PA 4XWRA 3K7MX 2CULA 1PN0A 3CPHG 3GSIA 5HXIA 1K0JA 4GDPA 3CGDA 4HA6A 1DNCA 2XFOA 4ADWA 3RP7A 3AE9A 2B76A 3SQPA 4IA5A 3GYIA 2WOVA 3KKJA 5KMPA 1X31B 3T2YA 2WEUA 3L1RA 4C74A 3SYIA 3AYJA 5TR3A 3ZDNA 2A8XA 4APNA 1MOKA 1CJ4A 2B9WA 3HYWA 4A99A 2WU2A 5C3JA 3QSMA 4TM1A 5M10A 4OPIA 3GRSA 3NN0X 4I58A 2JB1A 4AOXA 3QVRA 2OALA 2WESA 3G5QA 4BK1A 2WP9A 3CGCA 4H4QA 4C3YA 2E1MA 3DJGX 4J36A 2OA1A 1GESA 2PHHA 4NEWA 3AXBA 1QLBA 3P4PA 1LV0A 1Y0PA 2R45A 1LQUA 4USRA 3SZFA 5KOWA 2VQ7A 3UTHA 4Z26A 1ZK7A 4UDRA 3GDNA 1E1NA 3CTYA 3CMMA 2YAUA 4JY2A 4IV9A 4RG3A 5J7XA 1E39A 3OZ2A 3T2KA 2GQWA 4X4JA 1QO8A 4Z2TA 4JY3A 1XPQA 4I59A 1ZMCA 2XLRA 3NT6A 1GTEA 3UKKA 3F8RA 4FX9A 2BACA 3CNTA 5FS8A 2NPXA 2BA9A 1Y56B 4EQRA 1ZX9A 1FEBA 4OCGA 1F8WA 4K8DA 3NTDA 2ZZ0A 3P4QA 4LA1A 4YWOA 4EM3A 4TLXA 1IJHA 3UKFA 3GDPA 3URHA 2R0CA 1KNPA 3AE6A 2XFPA 1PBDA 4H50A 4AP1A 3AWIA 3IC9A 3T31A 3C4NA 2C73A 3CNSA 3DJEA 2R4EA 1FCDA 2FJAA 2Z5XA 3FPZA 1NAAA 3QJ4A 3S61A 1NENA 1LQTA 2VVLA 3UP4A 3ATRA 2IIDA 1S3BA 3OC4A 3E1TA 2WP6A 4EQWA 1XDIA 1ZKQA 3UTFA 3NYCA 4RG4A 3SM8A 1CL0A 3M13A 3VRAA 4A9WA 1MXTA 4Z2UA 5IQ1A 2VVMA 4YSHA 1EBDA 1D7LA 3B6DA 2XLPA 1NHRA 2C64A 1EL9A 1XHCA 3NRNA 4TM4A 2IVDA 1E7PA 3RP6A 4B64A 3P4SA 3KD9A 4PAAA 3AE4A 2WETA 4YSZA 1JU2A 4OPTA 2QCUA 3ICSA 2WHDA 4GR1A 2GQFA 3EAOA 4YKGA 1F8RA 4LIIA 3KA7A 3LB8A 4AP3A 1JRYA 3G5RA 1REOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BC1 A;  2E4G A;  4TM0 A;  4UP3 A;  1TDO A;  3FBS A;  5IPY A;  2H88 A;  4U8O A;  3UKP A;  3NN6 X;  5KXJ A;  3H8I A;  2F5Z A;  2GR3 A;  1H81 A;  4Y4N A;  4YKF A;  1LTX R;  4J57 A;  4BJY A;  3DJD A;  1JNR A;  1OJ9 A;  1YKJ A;  4YTM A;  2JAE A;  4H4P A;  2X50 A;  3AE3 A;  5LV9 A;  4N9X A;  4B67 A;  1ZMD A;  1S2Y A;  4NTC A;  4CBQ A;  1LVL A;  1DOC A;  1ZY8 A;  2YLX A;  2YWL A;  4YSX A;  4YT0 A;  4YTP A;  4Z2R A;  2C3C A;  1OJA A;  3EAN A;  5JCN A;  1H7X A;  2YLW A;  4U8J A;  2YLZ A;  3PVC A;  3QSS A;  1P2H A;  3ALM A;  1N4V A;  3FMW A;  4LU6 A;  3GWD A;  4X9N A;  3LXD A;  3F8P A;  4C3X A;  1NHP A;  1RSG A;  1GV4 A;  2XVI A;  5BUL A;  2R0G A;  1CJ3 A;  2GEW A;  3BI2 A;  4EMJ A;  3AE5 A;  1ZOY A;  2ZZB A;  3GMC A;  3H4K A;  2JB2 A;  3BHF A;  1CC4 A;  3AE1 A;  1F6M A;  3V3O A;  4CNK A;  4CY8 A;  2WDQ A;  1DJN A;  1TDF A;  4NTD A;  1UKV G;  1GRE A;  2RGO A;  3PS9 A;  4DSH A;  4H2R A;  1IUS A;  2UZZ A;  2YLR A;  3D8X A;  4IA6 A;  4UDQ A;  2X3N A;  4YSY A;  1CF3 A;  1KF6 A;  3GRT A;  3NYF A;  1YQZ A;  2BXS A;  2O9Z A;  1PBB A;  2WPF A;  4H4Z A;  1NG3 A;  1VRQ B;  1KFY A;  3B3R A;  4YXD A;  4OPG A;  1DOB A;  2OAM A;  5KRQ A;  2GVC A;  1Q9I A;  4H4U A;  4H4T A;  2BS2 A;  5JCM A;  3DK4 A;  1D4D A;  4M52 A;  4OPL A;  2W0H A;  4U8L A;  4BK2 A;  3IWA A;  4BUR A;  1GRA A;  4E0V A;  2BS3 A;  2XVF A;  4CCQ A;  1GRH A;  3AEE A;  2WOI A;  1OJC A;  3GD3 A;  5CQF A;  4B68 A;  4K5R A;  2XCG A;  1H84 A;  1CBO A;  3QVP A;  2V3A A;  1IUW A;  5U1O A;  1ZDL A;  2JK6 A;  1CJ2 A;  3LZW A;  2XFQ A;  3LZX A;  4H4V A;  3PO7 A;  2BAB A;  4Y4L A;  1SEZ A;  1PJ5 A;  2JKC A;  5FS9 A;  1B8S A;  3NK2 X;  1GXF A;  1RP0 A;  3C4A A;  2C65 A;  5FS6 A;  3RHA A;  4A6N A;  4H2Q A;  1CJC A;  2X99 A;  2GRT A;  3NK0 X;  3VQR A;  1K0I A;  1E1L A;  3ALJ A;  3CPI G;  3AD8 B;  3ZYX A;  4H4W A;  4EM4 A;  2XLT A;  4FDC B;  4HB9 A;  3UTG A;  1GND A;  2VZ2 A;  1GER A;  1TRB A;  5BUK A;  2XDO A;  1N4U A;  2WOW A;  4OPD A;  4WX1 A;  1D7Y A;  4B63 A;  1YY5 A;  1O94 A;  1ZOV A;  3I6D A;  3II4 A;  1EL5 A;  1JEH A;  5FS7 A;  5EBK A;  2YG5 A;  3AE2 A;  3AYL A;  2GAG B;  3LOV A;  2RGH A;  1XAN A;  2I0Z A;  1E1K A;  2RGJ A;  2VQB A;  2V60 A;  3I3L A;  2C72 A;  1ELI A;  2EQ9 A;  3AED A;  3CGB A;  4O5U A;  3V3N A;  2V5Z A;  1TDE A;  1IUU A;  1PS9 A;  2VVL G;  4EMW A;  1ONF A;  3DJJ A;  3UKL A;  2R46 A;  4H4S A;  3DK8 A;  1IUV A;  4NEV A;  4RSL A;  4H4X A;  4A79 A;  3UKQ A;  4ZCD A;  1H86 A;  4EQS A;  4P9S A;  4TLZ A;  1DXL A;  3DH9 A;  1H7W A;  3NKS A;  2C76 A;  3IHM A;  3VRB A;  1M6I A;  5JCK A;  1GRF A;  1LJ1 A;  2XFU A;  2NVK X;  2YG4 A;  3WE0 A;  1PBE A;  3DGZ A;  3UCL A;  1FL2 A;  1O95 A;  3VRD B;  4IVO B;  3CGE A;  3R9U A;  4TM3 A;  3UOX A;  1CHU A;  2Q0K A;  2E5V A;  3CIR A;  3QFB A;  1Q1R A;  4U8N A;  3F8D A;  4H2P A;  1PJ7 A;  2RAB A;  1BF3 A;  3UOZ A;  4B1B A;  3O0H A;  2WP5 A;  1CC2 A;  1NPX A;  3DK9 A;  1VG0 A;  1GPE A;  4BK3 A;  5JCI A;  2R9Z A;  4K2X A;  3RP8 A;  3S5W A;  2Z5Y A;  4H7U A;  3IHG A;  5U25 A;  4Y4M A;  3RED A;  4GF7 A;  3AEA A;  4K22 A;  2BCG G;  3KPF A;  3T37 A;  2VOU A;  3GWF A;  2AQJ A;  4U8I A;  2EQ6 A;  3EPT A;  1P2E A;  4JQ9 A;  3CN8 A;  1TDK A;  2BK5 A;  5GSN A;  5M0Z A;  2WPE A;  4J56 A;  2YG3 A;  1L9E A;  1B4V A;  2B9Y A;  3CPJ G;  1GOS A;  3NLC A;  2DKH A;  2ZBW A;  2YG7 A;  1BKW A;  2V61 A;  1RYI A;  3LJP A;  3LAD A;  5JCL A;  2YM2 A;  2BC0 A;  3SGL A;  3K30 A;  3UP5 A;  3DA1 A;  3QSE A;  2GAH B;  3GD4 A;  3M12 A;  5EB4 A;  1DOE A;  3K7Q X;  2GR1 A;  5BVA A;  5ER0 A;  4WCT A;  4B66 A;  1BGJ A;  1KDG A;  3NTA A;  1CC6 A;  4JNQ A;  2H89 A;  2GF3 A;  1L0V A;  2AR8 A;  2FJD A;  3H8L A;  1IUX A;  4NZH A;  1OJD A;  3P4R A;  3M0O A;  1BZL A;  4U8K A;  4A6N B;  4CY6 A;  2OLO A;  1D4E A;  2Q0L A;  5IQ4 A;  1S2Q A;  5L46 A;  4AOS A;  2FBW A;  4CRT A;  1AOG A;  4GUV A;  2YR5 A;  5HHF A;  4C5O A;  2APG A;  3AB1 A;  3NH3 X;  3VR8 A;  2XLU A;  3UKA A;  2WU5 A;  3BNU A;  4PAB A;  1GET A;  1GRB A;  2C7G A;  4KPR A;  2B7R A;  5EOW A;  1GRT A;  5C2T A;  2XVH A;  1NDA A;  3KU9 A;  2ARD A;  4JDR A;  4Z25 A;  1EL7 A;  2QAE A;  1NHS A;  2Y6Q A;  3AEB A;  3KVE A;  1L9C A;  2Q6U A;  1TYP A;  2BYB A;  4XXG A;  3Q9T A;  1L9D A;  1MO9 A;  2YR4 A;  2JB3 A;  2YM1 A;  3DGH A;  1YQ4 A;  5GRT A;  3RNM A;  2VRL A;  4EIQ A;  1E1M A;  1GAL A;  4Z44 A;  3AD7 B;  3FIM B;  2YR6 A;  1V59 A;  3K7T A;  2J3N A;  1OJT A;  5DBJ A;  1VG9 A;  5EB5 A;  1VQW A;  3GYJ A;  4KX6 A;  1IUT A;  3BI4 A;  5KWF A;  1F3P A;  1JNZ A;  2A89 A;  3AD9 B;  3NNE A;  4CCR A;  2Q7V A;  3G5S A;  5CKU A;  2A87 A;  3FG2 P;  4U8P A;  3CNP A;  4ZN0 A;  2R4J A;  1KSS A;  1BWC A;  2X8G A;  3NIX A;  4EIP A;  2Y6R A;  3ADA B;  2YVG A;  1PJ6 A;  4OVI A;  4U2L A;  1GSN A;  1DJQ A;  2YG6 A;  2WBA A;  2QA2 A;  3VR9 A;  3ALL A;  3L8K A;  2GV8 A;  2X8C A;  1LPF A;  1EL8 A;  1NEK A;  3NYE A;  4DSG A;  3P1W A;  2BK4 A;  1JRZ A;  4J33 A;  2C75 A;  2GH5 A;  1TYT A;  3BI5 A;  3UKH A;  1Q1W A;  5HYM A;  1B5Q A;  1QJD A;  2TPR A;  3ATQ A;  1ZP0 A;  2YQU A;  3QFA A;  4J2W A;  4Z43 A;  1NG4 A;  3Q6J A;  4J31 A;  5J60 A;  1VDC A;  1O5W A;  1D4C A;  3NHO X;  2WS3 A;  3AEC A;  2CVJ A;  2V6O A;  3AEF A;  4IVM B;  2GR2 A;  1PXB A;  2IVE A;  1K4Q A;  4OPU A;  4U2S A;  4EQX A;  2GMJ A;  1GTH A;  4CNJ A;  1TDN A;  2CDU A;  1M64 A;  1HYU A;  3NG7 X;  4K7Z A;  5FMH A;  2YLS A;  4JNA A;  3SFE A;  4ECH A;  4C77 A;  2TMD A;  2YLT A;  2V3B A;  3CNJ A;  5U63 A;  4A5L A;  4JN9 A;  4AT0 A;  2X8H A;  2WPC A;  4H4R A;  4BJZ A;  3P9U A;  3GMB A;  1H6V A;  2C3D A;  4YTN A;  1H82 A;  4B69 A;  2BCP A;  1YQ3 A;  1PXC A;  2YVF A;  1W4X A;  2DKI A;  1FOH A;  2WDV A;  3ICR A;  5KVH A;  1PXA A;  4AT2 A;  3CND A;  1KSU A;  4EMI A;  4ICY A;  5KVI A;  2PYX A;  4A65 A;  2OLN A;  2FJE A;  2R0P A;  4DNA A;  1PBC A;  4GDE A;  2BS4 A;  3UOV A;  3UTE A;  4FK1 C;  4REK A;  3HZL A;  2YVJ A;  3EF6 A;  1PHH A;  2C66 A;  2GMH A;  2FJB A;  1BGN A;  1K0L A;  2XFN A;  3AYI A;  3NK1 X;  3UOY A;  3AE7 A;  4XWZ A;  2XVE A;  2ZZC A;  1E6E A;  4NTE A;  3DME A;  1Y56 A;  4B65 A;  1H83 A;  5BRT A;  2BK3 A;  4U2T A;  1JOA A;  4USQ A;  4D03 A;  1S3E A;  3BHK A;  2EQ8 A;  4O5Q A;  1FEA A;  1GRG A;  5KOX A;  5HY5 A;  2C67 A;  4BV6 A;  3D1C A;  4UDP A;  2BXR A;  2C70 A;  3IF9 A;  1F8S A;  2XYO A;  3ICT A;  4D04 A;  2XLS A;  2JBV A;  3JSK A;  2GB0 A;  1NHQ A;  4J34 A;  4Z24 A;  2B9X A;  4ZCC A;  4H2N A;  1DOD A;  2HQM A;  2VRM A;  3COX A;  3SFD A;  1FEC A;  2EQ7 A;  3AEG A;  4A7A A;  2CFY A;  3V76 A;  4DGK A;  4GCM A;  1GEU A;  2QA1 A;  1PBF A;  1COY A;  2ACZ A;  4MJW A;  1D5T A;  4K5S A;  1KNR A;  2WDR A;  4OPC A;  4U8M A;  3BNM A;  2GR0 A;  4FK1 A;  1JRX A;  2WQY A;  3ITJ A;  2AAQ A;  3ISH A;  2XVJ A;  1B37 A;  3KLJ A;  4X9M A;  1PDH A;  1Z6L A;  4H4Y A;  2B7S A;  3AE8 A;  3NGC X;  1GT8 A;  4GRT A;  1N4W A;  3C96 A;  3ABV A;  1N1P A;  4XWR A;  3K7M X;  2CUL A;  1PN0 A;  3CPH G;  3GSI A;  5HXI A;  1K0J A;  4GDP A;  3CGD A;  4HA6 A;  1DNC A;  2XFO A;  4ADW A;  3RP7 A;  3AE9 A;  2B76 A;  3SQP A;  4IA5 A;  3GYI A;  2WOV A;  3KKJ A;  1X31 B;  2WEU A;  3L1R A;  4C74 A;  3AYJ A;  5TR3 A;  3ZDN A;  2A8X A;  4APN A;  1MOK A;  1CJ4 A;  2B9W A;  4A99 A;  2WU2 A;  5C3J A;  3QSM A;  4TM1 A;  5M10 A;  4OPI A;  3GRS A;  3NN0 X;  4I58 A;  2JB1 A;  4AOX A;  3QVR A;  2OAL A;  2WES A;  3G5Q A;  2WP9 A;  4H4Q A;  3CGC A;  4BK1 A;  4C3Y A;  2E1M A;  3DJG X;  4J36 A;  2OA1 A;  1GES A;  2PHH A;  4NEW A;  3AXB A;  1QLB A;  3P4P A;  1LV0 A;  1Y0P A;  2R45 A;  1LQU A;  4USR A;  5KOW A;  2VQ7 A;  3UTH A;  4Z26 A;  1ZK7 A;  4UDR A;  3GDN A;  1E1N A;  3CTY A;  2YAU A;  4JY2 A;  4IV9 A;  4RG3 A;  5J7X A;  1E39 A;  3OZ2 A;  2GQW A;  4X4J A;  1QO8 A;  4Z2T A;  4JY3 A;  1XPQ A;  4I59 A;  1ZMC A;  2XLR A;  3NT6 A;  1GTE A;  3UKK A;  3F8R A;  4FX9 A;  2BAC A;  3CNT A;  5FS8 A;  2NPX A;  2BA9 A;  1Y56 B;  4EQR A;  1ZX9 A;  1FEB A;  4OCG A;  1F8W A;  4K8D A;  3NTD A;  2ZZ0 A;  3P4Q A;  4LA1 A;  4YWO A;  4EM3 A;  4TLX A;  1IJH A;  3UKF A;  3GDP A;  3URH A;  2R0C A;  1KNP A;  3AE6 A;  2XFP A;  1PBD A;  4H50 A;  4AP1 A;  3AWI A;  3IC9 A;  3C4N A;  2C73 A;  3CNS A;  3DJE A;  2R4E A;  1FCD A;  2FJA A;  2Z5X A;  3FPZ A;  1NAA A;  3QJ4 A;  3S61 A;  1NEN A;  1LQT A;  2VVL A;  3UP4 A;  3ATR A;  2IID A;  1S3B A;  3OC4 A;  3E1T A;  2WP6 A;  4EQW A;  1XDI A;  1ZKQ A;  3UTF A;  3NYC A;  4RG4 A;  3SM8 A;  1CL0 A;  3M13 A;  3VRA A;  4A9W A;  1MXT A;  4Z2U A;  5IQ1 A;  2VVM A;  4YSH A;  1EBD A;  1D7L A;  3B6D A;  2XLP A;  1NHR A;  2C64 A;  1EL9 A;  1XHC A;  3NRN A;  4TM4 A;  2IVD A;  1E7P A;  3RP6 A;  4B64 A;  3P4S A;  3KD9 A;  4PAA A;  3AE4 A;  2WET A;  4YSZ A;  1JU2 A;  4OPT A;  2QCU A;  3ICS A;  2WHD A;  4GR1 A;  2GQF A;  3EAO A;  4YKG A;  1F8R A;  4LII A;  3KA7 A;  3LB8 A;  4AP3 A;  1JRY A;  3G5R A;  1REO A; 
#chains in the Genus database with same CATH topology
 2BC1 A;  2E4G A;  4TM0 A;  4UP3 A;  1TDO A;  3FBS A;  5IPY A;  2H88 A;  4U8O A;  3UKP A;  3NN6 X;  5KXJ A;  3H8I A;  2F5Z A;  2GR3 A;  1H81 A;  4Y4N A;  4YKF A;  1LTX R;  4BJY A;  4J57 A;  5KMQ A;  3DJD A;  1JNR A;  1OJ9 A;  1YKJ A;  4YTM A;  2JAE A;  4H4P A;  2X50 A;  3AE3 A;  5LV9 A;  4N9X A;  4B67 A;  1ZMD A;  1S2Y A;  4NTC A;  4CBQ A;  1LVL A;  1DOC A;  1ZY8 A;  2YLX A;  2YWL A;  4YSX A;  2E48 A;  4YT0 A;  4YTP A;  4Z2R A;  2C3C A;  1OJA A;  3EAN A;  3SX6 A;  1H7X A;  2YLW A;  5JCN A;  4U8J A;  2YLZ A;  3PVC A;  3QSS A;  1P2H A;  3ALM A;  1N4V A;  3FMW A;  4LU6 A;  3GWD A;  4X9N A;  3LXD A;  3F8P A;  4C3X A;  1C0I A;  1NHP A;  1RSG A;  1GV4 A;  2XVI A;  5BUL A;  2R0G A;  5KMS A;  1CJ3 A;  2GEW A;  3BI2 A;  4EMJ A;  3AE5 A;  1ZOY A;  1AN9 A;  2ZZB A;  3W4I A;  3GMC A;  3H4K A;  4GAP A;  2JB2 A;  3SZ0 A;  3BHF A;  1CC4 A;  3AE1 A;  1F6M A;  3V3O A;  3GYX A;  4CNK A;  4CY8 A;  2WDQ A;  1DJN A;  1TDF A;  3KPK A;  4QFC A;  1UKV G;  1GRE A;  2RGO A;  3PS9 A;  4NTD A;  4DSH A;  1IUS A;  4H2R A;  2UZZ A;  2YLR A;  4II3 A;  3D8X A;  3T0K A;  5KMR A;  4IA6 A;  4UDQ A;  2X3N A;  4YSY A;  1CF3 A;  1KF6 A;  3NYF A;  3GRT A;  1YQZ A;  2BXS A;  2O9Z A;  3SZC A;  1PBB A;  2WPF A;  4H4Z A;  1NG3 A;  1VRQ B;  1KFY A;  3B3R A;  4YXD A;  2E4A A;  4OPG A;  1DOB A;  2OAM A;  5KRQ A;  2GVC A;  1Q9I A;  4H4U A;  4H4T A;  2BS2 A;  5JCM A;  3DK4 A;  1D4D A;  4M52 A;  4OPL A;  2W0H A;  4U8L A;  4BK2 A;  3IWA A;  4BUR A;  1GRA A;  4E0V A;  2BS3 A;  1C0K A;  2XVF A;  4CCQ A;  1GRH A;  3AEE A;  3WGT A;  1OJC A;  2WOI A;  3GD3 A;  5CQF A;  4B68 A;  4K5R A;  2XCG A;  1H84 A;  1CBO A;  3QVP A;  2V3A A;  1IUW A;  5U1O A;  1ZDL A;  2JK6 A;  1CJ2 A;  3LZW A;  2XFQ A;  3LZX A;  4H4V A;  3PO7 A;  2BAB A;  4Y4L A;  1SEZ A;  1PJ5 A;  2JKC A;  5FS9 A;  1B8S A;  3NK2 X;  4YJG B;  1GXF A;  3C4A A;  1RP0 A;  2C65 A;  5FS6 A;  1VE9 A;  3RHA A;  4A6N A;  4H2Q A;  1CJC A;  4G74 A;  2X99 A;  2GRT A;  3NK0 X;  3VQR A;  1K0I A;  1E1L A;  3ALJ A;  3CPI G;  3AD8 B;  3ZYX A;  4H4W A;  4EM4 A;  2XLT A;  4FDC B;  4HB9 A;  3UTG A;  1GND A;  2VZ2 A;  1GER A;  1TRB A;  5BUK A;  2XDO A;  1N4U A;  2WOW A;  4OPD A;  4WX1 A;  1D7Y A;  4B63 A;  1YY5 A;  1ZOV A;  1O94 A;  3I6D A;  3II4 A;  1EL5 A;  1JEH A;  5FS7 A;  5EBK A;  2YG5 A;  3AE2 A;  3AYL A;  2GAG B;  3LOV A;  2RGH A;  1XAN A;  2I0Z A;  1E1K A;  3T14 A;  2RGJ A;  2VQB A;  3ZNQ A;  2V60 A;  3I3L A;  2C72 A;  1ELI A;  2EQ9 A;  3AED A;  3CGB A;  4O5U A;  3V3N A;  2V5Z A;  1IUU A;  1TDE A;  1PS9 A;  2VVL G;  4EMW A;  1ONF A;  3DJJ A;  3UKL A;  2R46 A;  4H4S A;  3DK8 A;  1IUV A;  4NEV A;  4RSL A;  4H4X A;  4A79 A;  2BRY A;  4G6H A;  3UKQ A;  4ZCD A;  1H86 A;  4EQS A;  4P9S A;  4TLZ A;  3ZNO A;  1DXL A;  3DH9 A;  1H7W A;  3NKS A;  2C76 A;  3IHM A;  3VRB A;  1M6I A;  5JCK A;  1GRF A;  1LJ1 A;  2XFU A;  2NVK X;  2YG4 A;  3WE0 A;  1PBE A;  3DGZ A;  3UCL A;  1FL2 A;  1O95 A;  3VRD B;  4IVO B;  3CGE A;  4GAV A;  3R9U A;  4TM3 A;  3UOX A;  1CHU A;  2Q0K A;  2E5V A;  3CIR A;  3QFB A;  1Q1R A;  4U8N A;  3F8D A;  4H2P A;  2BRA A;  1PJ7 A;  2RAB A;  1BF3 A;  3UOZ A;  4B1B A;  3O0H A;  2WP5 A;  1CC2 A;  1NPX A;  4G9K A;  3DK9 A;  1VG0 A;  1GPE A;  4BK3 A;  5JCI A;  2R9Z A;  3RP8 A;  4K2X A;  3S5W A;  2Z5Y A;  4H7U A;  3IHG A;  4NNJ A;  5U25 A;  4Y4M A;  3RED A;  4GF7 A;  3AEA A;  4K22 A;  2BCG G;  3KPF A;  3T37 A;  4NWZ A;  2VOU A;  3GWF A;  2AQJ A;  4U8I A;  2EQ6 A;  3EPT A;  1P2E A;  4JQ9 A;  3CN8 A;  1TDK A;  2BK5 A;  5GSN A;  5M0Z A;  2E49 A;  2WPE A;  4J56 A;  2YG3 A;  1L9E A;  1B4V A;  2B9Y A;  3CPJ G;  1GOS A;  3NLC A;  2DKH A;  2ZBW A;  4G6G A;  2YG7 A;  1BKW A;  2V61 A;  1RYI A;  3LJP A;  3LAD A;  5JCL A;  4YJD A;  5KNL A;  2YM2 A;  2BC0 A;  3SGL A;  3K30 A;  3G3E A;  3UP5 A;  3DA1 A;  3QSE A;  2GAH B;  3GD4 A;  3M12 A;  5EB4 A;  1DOE A;  3K7Q X;  2GR1 A;  5BVA A;  5ER0 A;  4WCT A;  4B66 A;  1BGJ A;  1KDG A;  3NTA A;  1CC6 A;  4JNQ A;  2H89 A;  2GF3 A;  1L0V A;  3HYV A;  2AR8 A;  2FJD A;  3H8L A;  3SXI A;  1IUX A;  4NZH A;  1OJD A;  3P4R A;  3M0O A;  1BZL A;  4U8K A;  4A6N B;  3HYX A;  2OLO A;  1D4E A;  4CY6 A;  2Q0L A;  5IQ4 A;  5L46 A;  1S2Q A;  4YJF B;  4AOS A;  2FBW A;  4CRT A;  1AOG A;  4GUV A;  2YR5 A;  5HHF A;  4C5O A;  2APG A;  3AB1 A;  3NH3 X;  3VR8 A;  2XLU A;  3UKA A;  2WU5 A;  3BNU A;  4PAB A;  1GET A;  1GRB A;  2C7G A;  4YJH A;  4KPR A;  2B7R A;  5EOW A;  1GRT A;  5C2T A;  2XVH A;  1NDA A;  3KU9 A;  2ARD A;  4JDR A;  4Z25 A;  1EL7 A;  2QAE A;  2E82 A;  1NHS A;  2Y6Q A;  3AEB A;  4QFD A;  1L9C A;  2Q6U A;  3KVE A;  1TYP A;  2BYB A;  4XXG A;  3Q9T A;  1L9D A;  1C0P A;  1MO9 A;  2YR4 A;  2JB3 A;  2YM1 A;  3DGH A;  1YQ4 A;  5GRT A;  3RNM A;  2VRL A;  4EIQ A;  1E1M A;  1GAL A;  4Z44 A;  3AD7 B;  3FIM B;  2YR6 A;  1V59 A;  3K7T A;  2J3N A;  1OJT A;  4G73 A;  5DBJ A;  1VG9 A;  5EB5 A;  1VQW A;  3GYJ A;  4KX6 A;  1IUT A;  3BI4 A;  5KWF A;  1F3P A;  2A89 A;  3AD9 B;  1JNZ A;  3NNE A;  4CCR A;  2Q7V A;  3G5S A;  5CKU A;  2A87 A;  3FG2 P;  4U8P A;  3CNP A;  4ZN0 A;  2R4J A;  1KSS A;  1BWC A;  2X8G A;  3NIX A;  4EIP A;  3ADA B;  2Y6R A;  2YVG A;  1PJ6 A;  4OVI A;  4U2L A;  1GSN A;  1DJQ A;  3SZW A;  2YG6 A;  2WBA A;  2QA2 A;  3VR9 A;  3ALL A;  3L8K A;  2GV8 A;  2X8C A;  1LPF A;  1EL8 A;  1NEK A;  3NYE A;  4DSG A;  3P1W A;  2BK4 A;  1JRZ A;  4J33 A;  2C75 A;  2GH5 A;  1TYT A;  5HYM A;  3BI5 A;  1Q1W A;  1DAO A;  3UKH A;  1B5Q A;  1QJD A;  2TPR A;  3ATQ A;  1ZP0 A;  2YQU A;  3QFA A;  4J2W A;  4Z43 A;  1NG4 A;  3Q6J A;  4J31 A;  5J60 A;  1VDC A;  1O5W A;  1D4C A;  3NHO X;  2WS3 A;  3AEC A;  2CVJ A;  2V6O A;  3AEF A;  4IVM B;  2GR2 A;  1PXB A;  2IVE A;  1K4Q A;  4OPU A;  4U2S A;  4EQX A;  2GMJ A;  1GTH A;  4CNJ A;  1TDN A;  2CDU A;  1M64 A;  1HYU A;  3NG7 X;  4K7Z A;  5FMH A;  2YLS A;  4JNA A;  3SFE A;  4ECH A;  4C77 A;  2TMD A;  2YLT A;  2V3B A;  3CNJ A;  5U63 A;  4A5L A;  4JN9 A;  4AT0 A;  2X8H A;  2WPC A;  4H4R A;  4BJZ A;  3P9U A;  3GMB A;  1H6V A;  2C3D A;  4II2 A;  1H82 A;  4YTN A;  4B69 A;  2BCP A;  1YQ3 A;  1PXC A;  2YVF A;  1W4X A;  2DKI A;  1FOH A;  3W4K A;  2WDV A;  3ICR A;  1PXA A;  5KVH A;  4AT2 A;  3CND A;  1KSU A;  4EMI A;  1DDO A;  4ICY A;  5KVI A;  2PYX A;  4A65 A;  2OLN A;  2FJE A;  2R0P A;  4DNA A;  1PBC A;  4GDE A;  2BS4 A;  3UOV A;  3UTE A;  4FK1 C;  4REK A;  3HZL A;  2YVJ A;  3EF6 A;  1PHH A;  2GMH A;  2C66 A;  2FJB A;  1BGN A;  1K0L A;  2XFN A;  3AYI A;  3NK1 X;  3UOY A;  3AE7 A;  4XWZ A;  2XVE A;  2ZZC A;  1E6E A;  2DU8 A;  4NTE A;  1EVI A;  3DME A;  1Y56 A;  1H83 A;  4B65 A;  5BRT A;  2BK3 A;  4U2T A;  1JOA A;  4USQ A;  2C4C A;  4D03 A;  1S3E A;  3BHK A;  2EQ8 A;  3T2Z A;  4O5Q A;  1FEA A;  1GRG A;  5KOX A;  5HY5 A;  1C0L A;  2C67 A;  4BV6 A;  3D1C A;  4UDP A;  2BXR A;  3IF9 A;  2C70 A;  1F8S A;  2XYO A;  3ICT A;  4D04 A;  2XLS A;  2JBV A;  3JSK A;  2GB0 A;  1NHQ A;  4J34 A;  4Z24 A;  2B9X A;  4ZCC A;  4H2N A;  1DOD A;  2HQM A;  2VRM A;  3COX A;  3SFD A;  1FEC A;  2EQ7 A;  3AEG A;  4A7A A;  2CFY A;  3V76 A;  4DGK A;  4GCM A;  3ZNP A;  1GEU A;  2QA1 A;  1PBF A;  1COY A;  2ACZ A;  4MJW A;  1D5T A;  4K5S A;  1KNR A;  2WDR A;  4OPC A;  4U8M A;  3BNM A;  2GR0 A;  4FK1 A;  1JRX A;  2WQY A;  4X9M A;  2AAQ A;  3ISH A;  2XVJ A;  1B37 A;  3ITJ A;  3KLJ A;  1PDH A;  1Z6L A;  4H4Y A;  2B7S A;  3AE8 A;  3NGC X;  1GT8 A;  4GRT A;  3SY4 A;  1N4W A;  3C96 A;  3W4J A;  3ABV A;  1N1P A;  4XWR A;  3K7M X;  2CUL A;  1PN0 A;  3GSI A;  3CPH G;  1K0J A;  5HXI A;  4GDP A;  3CGD A;  4HA6 A;  1DNC A;  2XFO A;  4ADW A;  3RP7 A;  3AE9 A;  2B76 A;  3SQP A;  4IA5 A;  3GYI A;  2WOV A;  3KKJ A;  5KMP A;  1X31 B;  3T2Y A;  2WEU A;  3L1R A;  4C74 A;  3SYI A;  3AYJ A;  5TR3 A;  3ZDN A;  2A8X A;  4APN A;  1MOK A;  1CJ4 A;  2B9W A;  3HYW A;  4A99 A;  2WU2 A;  5C3J A;  3QSM A;  4TM1 A;  5M10 A;  4OPI A;  3GRS A;  3NN0 X;  4I58 A;  2JB1 A;  4AOX A;  3QVR A;  2OAL A;  2WES A;  3G5Q A;  4BK1 A;  2WP9 A;  3CGC A;  4H4Q A;  4C3Y A;  2E1M A;  3DJG X;  4J36 A;  2OA1 A;  2PHH A;  1GES A;  4NEW A;  3AXB A;  1QLB A;  3P4P A;  1LV0 A;  1Y0P A;  2R45 A;  1LQU A;  4USR A;  3SZF A;  5KOW A;  2VQ7 A;  3UTH A;  4Z26 A;  1ZK7 A;  4UDR A;  3GDN A;  1E1N A;  3CTY A;  3CMM A;  2YAU A;  4JY2 A;  4IV9 A;  4RG3 A;  5J7X A;  1E39 A;  3OZ2 A;  3T2K A;  2GQW A;  4X4J A;  1QO8 A;  4Z2T A;  4JY3 A;  1XPQ A;  4I59 A;  4YJF A;  3CUK A;  1ZMC A;  2XLR A;  3NT6 A;  1GTE A;  3UKK A;  3F8R A;  4FX9 A;  2BAC A;  3CNT A;  5FS8 A;  2NPX A;  2BA9 A;  1Y56 B;  4EQR A;  1ZX9 A;  1FEB A;  4OCG A;  1F8W A;  4K8D A;  3NTD A;  2ZZ0 A;  3P4Q A;  4LA1 A;  4YWO A;  4EM3 A;  4TLX A;  1IJH A;  3UKF A;  3GDP A;  3URH A;  2R0C A;  1KNP A;  3AE6 A;  2XFP A;  1PBD A;  4H50 A;  4AP1 A;  3AWI A;  3IC9 A;  3T31 A;  3C4N A;  3DJE A;  2C73 A;  3CNS A;  2R4E A;  1FCD A;  2FJA A;  2Z5X A;  3FPZ A;  1NAA A;  3QJ4 A;  3S61 A;  1NEN A;  1LQT A;  2VVL A;  3UP4 A;  3ATR A;  2IID A;  1S3B A;  3OC4 A;  3E1T A;  2WP6 A;  4EQW A;  1XDI A;  1ZKQ A;  3UTF A;  3NYC A;  4RG4 A;  3SM8 A;  3M13 A;  1CL0 A;  3VRA A;  3ZNN A;  4A9W A;  1MXT A;  4Z2U A;  5IQ1 A;  1KIF A;  4YJG A;  4YSH A;  2VVM A;  1EBD A;  1D7L A;  3B6D A;  2XLP A;  1NHR A;  2C64 A;  1EL9 A;  1XHC A;  3NRN A;  4TM4 A;  2IVD A;  1E7P A;  3RP6 A;  4B64 A;  3P4S A;  4PAA A;  4YJH B;  3AE4 A;  3KD9 A;  2WET A;  4YSZ A;  1JU2 A;  4OPT A;  2QCU A;  3ICS A;  2WHD A;  4GR1 A;  2GQF A;  3EAO A;  4YKG A;  1F8R A;  4LII A;  3KA7 A;  3LB8 A;  4AP3 A;  1JRY A;  3G5R A;  1REO A; 
#chains in the Genus database with same CATH homology
 2BC1 A;  2E4G A;  4TM0 A;  4UP3 A;  1TDO A;  3FBS A;  5IPY A;  2H88 A;  4U8O A;  3UKP A;  3NN6 X;  5KXJ A;  3H8I A;  2F5Z A;  2GR3 A;  1H81 A;  4Y4N A;  4YKF A;  1LTX R;  4BJY A;  4J57 A;  5KMQ A;  3DJD A;  1JNR A;  1OJ9 A;  1YKJ A;  4YTM A;  2JAE A;  4H4P A;  2X50 A;  3AE3 A;  5LV9 A;  4N9X A;  4B67 A;  1ZMD A;  1S2Y A;  4NTC A;  4CBQ A;  1LVL A;  1DOC A;  1ZY8 A;  2YLX A;  2YWL A;  4YSX A;  4YT0 A;  4YTP A;  4Z2R A;  2C3C A;  1OJA A;  3EAN A;  3SX6 A;  1H7X A;  2YLW A;  5JCN A;  4U8J A;  2YLZ A;  3PVC A;  3QSS A;  1P2H A;  3ALM A;  1N4V A;  3FMW A;  4LU6 A;  3GWD A;  4X9N A;  3LXD A;  3F8P A;  4C3X A;  1NHP A;  1RSG A;  1GV4 A;  2XVI A;  5BUL A;  2R0G A;  5KMS A;  1CJ3 A;  2GEW A;  3BI2 A;  4EMJ A;  3AE5 A;  1ZOY A;  2ZZB A;  3SZ0 A;  3GMC A;  3H4K A;  4GAP A;  2JB2 A;  3BHF A;  1CC4 A;  3AE1 A;  1F6M A;  3V3O A;  3GYX A;  4CNK A;  4CY8 A;  2WDQ A;  1DJN A;  1TDF A;  3KPK A;  4NTD A;  1UKV G;  1GRE A;  2RGO A;  3PS9 A;  4DSH A;  4H2R A;  1IUS A;  2UZZ A;  2YLR A;  4II3 A;  3D8X A;  3T0K A;  5KMR A;  4IA6 A;  4UDQ A;  2X3N A;  4YSY A;  1CF3 A;  1KF6 A;  3GRT A;  3NYF A;  1YQZ A;  2BXS A;  2O9Z A;  3SZC A;  1PBB A;  2WPF A;  4H4Z A;  1NG3 A;  1VRQ B;  1KFY A;  3B3R A;  4YXD A;  4OPG A;  1DOB A;  2OAM A;  5KRQ A;  2GVC A;  1Q9I A;  4H4U A;  4H4T A;  2BS2 A;  5JCM A;  3DK4 A;  1D4D A;  4M52 A;  4OPL A;  2W0H A;  4U8L A;  4BK2 A;  3IWA A;  4BUR A;  1GRA A;  4E0V A;  2BS3 A;  2XVF A;  4CCQ A;  1GRH A;  3AEE A;  2WOI A;  1OJC A;  3GD3 A;  5CQF A;  4B68 A;  4K5R A;  2XCG A;  1H84 A;  1CBO A;  3QVP A;  2V3A A;  1IUW A;  5U1O A;  1ZDL A;  2JK6 A;  1CJ2 A;  3LZW A;  2XFQ A;  3LZX A;  4H4V A;  3PO7 A;  2BAB A;  4Y4L A;  1SEZ A;  1PJ5 A;  2JKC A;  5FS9 A;  1B8S A;  3NK2 X;  1GXF A;  3C4A A;  1RP0 A;  2C65 A;  5FS6 A;  3RHA A;  4A6N A;  4H2Q A;  1CJC A;  4G74 A;  2X99 A;  2GRT A;  3NK0 X;  3VQR A;  1K0I A;  1E1L A;  3ALJ A;  3CPI G;  3AD8 B;  3ZYX A;  4H4W A;  4EM4 A;  2XLT A;  4FDC B;  4HB9 A;  3UTG A;  1GND A;  2VZ2 A;  1GER A;  1TRB A;  5BUK A;  2XDO A;  1N4U A;  2WOW A;  4OPD A;  4WX1 A;  1D7Y A;  4B63 A;  1YY5 A;  1O94 A;  1ZOV A;  3I6D A;  3II4 A;  1EL5 A;  1JEH A;  5FS7 A;  5EBK A;  2YG5 A;  3AE2 A;  3AYL A;  2GAG B;  3LOV A;  2RGH A;  1XAN A;  2I0Z A;  1E1K A;  3T14 A;  2RGJ A;  2VQB A;  2V60 A;  3I3L A;  2C72 A;  1ELI A;  2EQ9 A;  3AED A;  3CGB A;  4O5U A;  3V3N A;  2V5Z A;  1TDE A;  1IUU A;  1PS9 A;  2VVL G;  4EMW A;  1ONF A;  3DJJ A;  3UKL A;  2R46 A;  4H4S A;  3DK8 A;  1IUV A;  4NEV A;  4RSL A;  4H4X A;  4A79 A;  2BRY A;  4G6H A;  3UKQ A;  4ZCD A;  1H86 A;  4EQS A;  4P9S A;  4TLZ A;  1DXL A;  3DH9 A;  1H7W A;  3NKS A;  2C76 A;  3IHM A;  3VRB A;  1M6I A;  5JCK A;  1GRF A;  1LJ1 A;  2XFU A;  2NVK X;  2YG4 A;  3WE0 A;  1PBE A;  3DGZ A;  3UCL A;  1FL2 A;  1O95 A;  3VRD B;  4IVO B;  3CGE A;  4GAV A;  3R9U A;  4TM3 A;  3UOX A;  1CHU A;  2Q0K A;  2E5V A;  3CIR A;  3QFB A;  1Q1R A;  4U8N A;  3F8D A;  4H2P A;  2BRA A;  1PJ7 A;  2RAB A;  1BF3 A;  3UOZ A;  4B1B A;  3O0H A;  2WP5 A;  1CC2 A;  1NPX A;  4G9K A;  3DK9 A;  1VG0 A;  1GPE A;  4BK3 A;  5JCI A;  2R9Z A;  3RP8 A;  4K2X A;  3S5W A;  2Z5Y A;  4H7U A;  3IHG A;  4NNJ A;  5U25 A;  4Y4M A;  3RED A;  4GF7 A;  3AEA A;  4K22 A;  2BCG G;  3KPF A;  3T37 A;  4NWZ A;  2VOU A;  3GWF A;  2AQJ A;  4U8I A;  2EQ6 A;  3EPT A;  1P2E A;  4JQ9 A;  3CN8 A;  1TDK A;  2BK5 A;  5GSN A;  5M0Z A;  2WPE A;  4J56 A;  2YG3 A;  1L9E A;  1B4V A;  2B9Y A;  3CPJ G;  1GOS A;  3NLC A;  2DKH A;  2ZBW A;  4G6G A;  2YG7 A;  1BKW A;  2V61 A;  1RYI A;  3LJP A;  3LAD A;  5JCL A;  5KNL A;  2YM2 A;  2BC0 A;  3SGL A;  3K30 A;  3UP5 A;  3DA1 A;  3QSE A;  2GAH B;  3GD4 A;  3M12 A;  5EB4 A;  1DOE A;  3K7Q X;  2GR1 A;  5BVA A;  5ER0 A;  4WCT A;  4B66 A;  1BGJ A;  1KDG A;  3NTA A;  1CC6 A;  4JNQ A;  2H89 A;  2GF3 A;  1L0V A;  3HYV A;  2AR8 A;  2FJD A;  3H8L A;  3SXI A;  1IUX A;  4NZH A;  1OJD A;  3P4R A;  3M0O A;  1BZL A;  4U8K A;  4A6N B;  3HYX A;  2OLO A;  1D4E A;  4CY6 A;  2Q0L A;  5IQ4 A;  1S2Q A;  5L46 A;  4AOS A;  2FBW A;  4CRT A;  1AOG A;  4GUV A;  2YR5 A;  5HHF A;  4C5O A;  2APG A;  3AB1 A;  3NH3 X;  3VR8 A;  2XLU A;  3UKA A;  2WU5 A;  3BNU A;  4PAB A;  1GET A;  1GRB A;  2C7G A;  4KPR A;  2B7R A;  5EOW A;  1GRT A;  5C2T A;  2XVH A;  1NDA A;  3KU9 A;  2ARD A;  4JDR A;  4Z25 A;  1EL7 A;  2QAE A;  1NHS A;  2Y6Q A;  3AEB A;  3KVE A;  1L9C A;  2Q6U A;  1TYP A;  2BYB A;  4XXG A;  3Q9T A;  1L9D A;  1MO9 A;  2YR4 A;  2JB3 A;  2YM1 A;  3DGH A;  1YQ4 A;  5GRT A;  3RNM A;  2VRL A;  4EIQ A;  1E1M A;  1GAL A;  4Z44 A;  3AD7 B;  3FIM B;  2YR6 A;  1V59 A;  3K7T A;  2J3N A;  1OJT A;  4G73 A;  5DBJ A;  1VG9 A;  5EB5 A;  1VQW A;  3GYJ A;  4KX6 A;  1IUT A;  3BI4 A;  5KWF A;  1F3P A;  1JNZ A;  2A89 A;  3AD9 B;  3NNE A;  4CCR A;  2Q7V A;  3G5S A;  5CKU A;  2A87 A;  3FG2 P;  4U8P A;  3CNP A;  4ZN0 A;  2R4J A;  1KSS A;  1BWC A;  2X8G A;  3NIX A;  4EIP A;  2Y6R A;  3ADA B;  2YVG A;  1PJ6 A;  4OVI A;  4U2L A;  1GSN A;  1DJQ A;  3SZW A;  2YG6 A;  2WBA A;  2QA2 A;  3VR9 A;  3ALL A;  3L8K A;  2GV8 A;  2X8C A;  1LPF A;  1EL8 A;  1NEK A;  3NYE A;  4DSG A;  3P1W A;  2BK4 A;  1JRZ A;  4J33 A;  2C75 A;  2GH5 A;  1TYT A;  5HYM A;  3BI5 A;  1Q1W A;  3UKH A;  1B5Q A;  1QJD A;  2TPR A;  3ATQ A;  1ZP0 A;  2YQU A;  3QFA A;  4J2W A;  4Z43 A;  1NG4 A;  3Q6J A;  4J31 A;  5J60 A;  1VDC A;  1O5W A;  1D4C A;  3NHO X;  2WS3 A;  3AEC A;  2CVJ A;  2V6O A;  3AEF A;  4IVM B;  2GR2 A;  1PXB A;  2IVE A;  1K4Q A;  4OPU A;  4U2S A;  4EQX A;  2GMJ A;  1GTH A;  4CNJ A;  1TDN A;  2CDU A;  1M64 A;  1HYU A;  3NG7 X;  4K7Z A;  5FMH A;  2YLS A;  4JNA A;  3SFE A;  4ECH A;  4C77 A;  2TMD A;  2YLT A;  2V3B A;  3CNJ A;  5U63 A;  4A5L A;  4JN9 A;  4AT0 A;  2X8H A;  2WPC A;  4H4R A;  4BJZ A;  3P9U A;  3GMB A;  1H6V A;  2C3D A;  4II2 A;  1H82 A;  4YTN A;  4B69 A;  2BCP A;  1YQ3 A;  1PXC A;  2YVF A;  1W4X A;  2DKI A;  1FOH A;  2WDV A;  3ICR A;  5KVH A;  1PXA A;  4AT2 A;  3CND A;  1KSU A;  4EMI A;  4ICY A;  5KVI A;  2PYX A;  4A65 A;  2OLN A;  2FJE A;  2R0P A;  4DNA A;  1PBC A;  4GDE A;  2BS4 A;  3UOV A;  3UTE A;  4FK1 C;  4REK A;  3HZL A;  2YVJ A;  3EF6 A;  1PHH A;  2GMH A;  2C66 A;  2FJB A;  1BGN A;  1K0L A;  2XFN A;  3AYI A;  3NK1 X;  3UOY A;  3AE7 A;  4XWZ A;  2XVE A;  2ZZC A;  1E6E A;  4NTE A;  3DME A;  1Y56 A;  4B65 A;  1H83 A;  5BRT A;  2BK3 A;  4U2T A;  1JOA A;  4USQ A;  2C4C A;  4D03 A;  1S3E A;  3BHK A;  2EQ8 A;  3T2Z A;  4O5Q A;  1FEA A;  1GRG A;  5KOX A;  5HY5 A;  2C67 A;  4BV6 A;  3D1C A;  4UDP A;  2BXR A;  2C70 A;  3IF9 A;  1F8S A;  2XYO A;  3ICT A;  4D04 A;  2XLS A;  2JBV A;  3JSK A;  2GB0 A;  1NHQ A;  4J34 A;  4Z24 A;  2B9X A;  4ZCC A;  4H2N A;  1DOD A;  2HQM A;  2VRM A;  3COX A;  3SFD A;  1FEC A;  2EQ7 A;  3AEG A;  4A7A A;  2CFY A;  3V76 A;  4DGK A;  4GCM A;  1GEU A;  2QA1 A;  1PBF A;  1COY A;  2ACZ A;  4MJW A;  1D5T A;  4K5S A;  1KNR A;  2WDR A;  4OPC A;  4U8M A;  3BNM A;  2GR0 A;  4FK1 A;  1JRX A;  2WQY A;  3ITJ A;  2AAQ A;  3ISH A;  2XVJ A;  1B37 A;  3KLJ A;  4X9M A;  1PDH A;  1Z6L A;  4H4Y A;  2B7S A;  3AE8 A;  3NGC X;  1GT8 A;  4GRT A;  3SY4 A;  1N4W A;  3C96 A;  3ABV A;  1N1P A;  4XWR A;  3K7M X;  2CUL A;  1PN0 A;  3CPH G;  3GSI A;  5HXI A;  1K0J A;  4GDP A;  3CGD A;  4HA6 A;  1DNC A;  2XFO A;  4ADW A;  3RP7 A;  3AE9 A;  2B76 A;  3SQP A;  4IA5 A;  3GYI A;  2WOV A;  3KKJ A;  5KMP A;  1X31 B;  3T2Y A;  2WEU A;  3L1R A;  4C74 A;  3SYI A;  3AYJ A;  5TR3 A;  3ZDN A;  2A8X A;  4APN A;  1MOK A;  1CJ4 A;  2B9W A;  3HYW A;  4A99 A;  2WU2 A;  5C3J A;  3QSM A;  4TM1 A;  5M10 A;  4OPI A;  3GRS A;  3NN0 X;  4I58 A;  2JB1 A;  4AOX A;  3QVR A;  2OAL A;  2WES A;  3G5Q A;  4BK1 A;  2WP9 A;  3CGC A;  4H4Q A;  4C3Y A;  2E1M A;  3DJG X;  4J36 A;  2OA1 A;  1GES A;  2PHH A;  4NEW A;  3AXB A;  1QLB A;  3P4P A;  1LV0 A;  1Y0P A;  2R45 A;  1LQU A;  4USR A;  3SZF A;  5KOW A;  2VQ7 A;  3UTH A;  4Z26 A;  1ZK7 A;  4UDR A;  3GDN A;  1E1N A;  3CTY A;  3CMM A;  2YAU A;  4JY2 A;  4IV9 A;  4RG3 A;  5J7X A;  1E39 A;  3OZ2 A;  3T2K A;  2GQW A;  4X4J A;  1QO8 A;  4Z2T A;  4JY3 A;  1XPQ A;  4I59 A;  1ZMC A;  2XLR A;  3NT6 A;  1GTE A;  3UKK A;  3F8R A;  4FX9 A;  2BAC A;  3CNT A;  5FS8 A;  2NPX A;  2BA9 A;  1Y56 B;  4EQR A;  1ZX9 A;  1FEB A;  4OCG A;  1F8W A;  4K8D A;  3NTD A;  2ZZ0 A;  3P4Q A;  4LA1 A;  4YWO A;  4EM3 A;  4TLX A;  1IJH A;  3UKF A;  3GDP A;  3URH A;  2R0C A;  1KNP A;  3AE6 A;  2XFP A;  1PBD A;  4H50 A;  4AP1 A;  3AWI A;  3IC9 A;  3T31 A;  3C4N A;  2C73 A;  3CNS A;  3DJE A;  2R4E A;  1FCD A;  2FJA A;  2Z5X A;  3FPZ A;  1NAA A;  3QJ4 A;  3S61 A;  1NEN A;  1LQT A;  2VVL A;  3UP4 A;  3ATR A;  2IID A;  1S3B A;  3OC4 A;  3E1T A;  2WP6 A;  4EQW A;  1XDI A;  1ZKQ A;  3UTF A;  3NYC A;  4RG4 A;  3SM8 A;  1CL0 A;  3M13 A;  3VRA A;  4A9W A;  1MXT A;  4Z2U A;  5IQ1 A;  2VVM A;  4YSH A;  1EBD A;  1D7L A;  3B6D A;  2XLP A;  1NHR A;  2C64 A;  1EL9 A;  1XHC A;  3NRN A;  4TM4 A;  2IVD A;  1E7P A;  3RP6 A;  4B64 A;  3P4S A;  3KD9 A;  4PAA A;  3AE4 A;  2WET A;  4YSZ A;  1JU2 A;  4OPT A;  2QCU A;  3ICS A;  2WHD A;  4GR1 A;  2GQF A;  3EAO A;  4YKG A;  1F8R A;  4LII A;  3KA7 A;  3LB8 A;  4AP3 A;  1JRY A;  3G5R A;  1REO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...