3DMEA

Crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
366
Chain Sequence
TDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved exported protein
publication title Crystal structure of conserved exported protein from Bordetella pertussis. NorthEast Structural Genomics target BeR141
rcsb
source organism Bordetella pertussis
total genus 110
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3dmeA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dmeA01
1F8WA 3B6DA 3RNMA 1KSUA 1M6IA 3C4AA 2R45A 1TYTA 2Q0LA 4REKA 3UOYA 2XVFA 2BK3A 4GUVA 3UTGA 2BCPA 3ISHA 3FIMB 1COYA 2BXRA 2E1MA 5DBJA 3UKPA 1QJDA 1JRZA 2Y6RA 3BNUA 3H8LA 5HXIA 3AE1A 4C3XA 1KF6A 3DGZA 2TMDA 4IA5A 3DMEA 3GSIA 3DA1A 2R0GA 3ZNQA 4A7AA 2BS4A 4C5OA 1FL2A 2Z5YA 4YTNA 1C0KA 2GV8A 4AOSA 5KOXA 3NYFA 1BWCA 5FMHA 4YJGB 4A6NA 1NG4A 4AP1A 1C0LA 1TDOA 1GETA 2XFUA 1ZKQA 4YKGA 4H4UA 1DOCA 2B9WA 4H4TA 5BULA 1CC6A 3GD4A 3UTEA 2GH5A 4GCMA 4EIPA 4J36A 2ACZA 3FMWA 2X50A 4QFCA 4Z2TA 1XDIA 1P2EA 4JN9A 4C74A 1CBOA 5KRQA 5FS8A 4IA6A 4TM0A 3GYJA 3OC4A 2WP6A 3II4A 4B69A 1VQWA 4EQRA 1B4VA 1PBCA 2BS2A 1N1PA 4CBQA 3KLJA 2CVJA 3QVRA 3NT6A 1X31B 2VRMA 1EL5A 4CNKA 1PXAA 4GRTA 2IIDA 3P4SA 2YG6A 2CFYA 2GQWA 3LZXA 1CJ3A 2EQ8A 2XVHA 4OCGA 4U8KA 3K7QX 2APGA 1DOEA 3AE4A 3PVCA 5J7XA 5TR3A 1IJHA 2ZZBA 2WP9A 2EQ9A 4BK2A 2VVLG 4J57A 3KPFA 5FS6A 4PABA 5BVAA 3CGEA 3KVEA 3T37A 1GRAA 4H4ZA 4BURA 1EVIA 3WGTA 1D4DA 2YG7A 2YAUA 2VOUA 3UOVA 2GR0A 3SFEA 3V3NA 4E0VA 1OJCA 1GALA 2XVIA 1B37A 4U2SA 3UKFA 3UTHA 1D4CA 1O5WA 4JNQA 2XLTA 4Z24A 3IHMA 2C75A 4DSHA 4CCRA 1KSSA 2V5ZA 3AE8A 3ICSA 1S2YA 2BACA 4K5SA 4U8MA 3G5RA 4B63A 4FDCB 1ZX9A 2VVLA 2YWLA 3UKKA 3L1RA 4D04A 2R0PA 1H83A 3WE0A 1XHCA 4X9NA 2JK6A 2X99A 4U8JA 4H4XA 4WCTA 3UTFA 2C66A 5JCMA 3CNTA 4A9WA 3CPHG 2GQFA 1W4XA 1JU2A 1LTXR 2C76A 1EL7A 2H89A 2OLOA 4XXGA 4NEVA 1H7XA 2JKCA 3AYIA 2GR2A 1FEAA 2GF3A 1OJTA 2BK5A 1BKWA 1O95A 3DJDA 1DODA 1OJAA 4C3YA 1K0JA 1DJQA 4H4WA 4K22A 5KVIA 1PS9A 2BS3A 2YG5A 3SQPA 1JOAA 4NTCA 1BZLA 1IUWA 1ZY8A 2C3CA 2AAQA 3VR9A 1KFYA 4YJDA 3LXDA 3ZYXA 2Z5XA 2YG3A 1HYUA 1KNRA 4TM1A 3KU9A 4RG3A 3P4QA 3W4IA 1NHSA 4KX6A 5CKUA 4Z2RA 1NDAA 1GEUA 2RGJA 5U25A 3ABVA 3AEDA 3CUKA 3K30A 1TDKA 2B7RA 3AD9B 1DDOA 1RP0A 4Z25A 4H4PA 2Y6QA 2FBWA 4I58A 2VZ2A 3AE7A 1QO8A 4RG4A 1YKJA 3URHA 4B65A 1GRHA 2BCGG 2JAEA 4YJFA 1PXBA 1F3PA 2ZBWA 4A65A 3IC9A 2FJBA 2VVMA 2WU5A 3AE9A 4EMIA 1YQ4A 3RHAA 1Y0PA 4AOXA 4WX1A 3VRDB 1ELIA 1NG3A 4YSHA 1FECA 1GOSA 4K5RA 5FS7A 1B8SA 4GR1A 1AOGA 2V3BA 2YLXA 4CY8A 4IVMB 2WESA 4Z26A 3IHGA 4NZHA 1E1LA 2CDUA 3VQRA 1JRXA 1GSNA 4H2PA 4H4RA 4UDRA 5M0ZA 5JCIA 3BI4A 3V76A 1JNZA 5U1OA 2YVJA 3NNEA 3W4JA 4YJHA 3NIXA 3Q6JA 4APNA 3NHOX 3LB8A 4Y4MA 4H4SA 4UDPA 3CGBA 1H81A 4PAAA 1CC4A 4OPUA 3KA7A 3REDA 3PO7A 4YT0A 3ZNPA 3NYEA 1H84A 2OALA 3ATRA 3UKQA 2B9YA 1GT8A 2WBAA 3DJEA 1O94A 2A89A 4U2LA 1S3EA 1TYPA 3G5SA 3VR8A 1L9EA 4CNJA 2Q6UA 1GXFA 5IQ4A 4J2WA 4ZCCA 3G3EA 1K4QA 3UOZA 2BC1A 1S3BA 4BJZA 1NAAA 2BYBA 1Y56B 1V59A 2XLUA 3BHKA 1JEHA 2OLNA 1LQTA 2R9ZA 3Q9TA 2X8GA 3ZDNA 3QJ4A 4H2NA 4EIQA 2JB1A 4FX9A 1D4EA 2Q7VA 2V6OA 3AEFA 3JSKA 1GRTA 4NTEA 4EQSA 3SFDA 2GVCA 1Z6LA 3AE3A 4JNAA 5JCNA 2GAHB 4JY2A 2E4GA 4J33A 3L8KA 1NEKA 2ARDA 3K7MX 2JB2A 3E1TA 2GB0A 3GYIA 1H82A 1PJ5A 2V60A 1SEZA 4OPTA 3RP7A 3AE5A 3IWAA 3P1WA 3M13A 2C3DA 2ZZ0A 2JBVA 2EQ7A 2BK4A 1PJ6A 1F6MA 2NVKX 1CHUA 4EM4A 2QCUA 4Y4NA 2C64A 1D7YA 3CPJG 2YM2A 1ZOYA 2B9XA 3H8IA 1EL9A 2WDVA 1CF3A 3GMCA 3F8RA 2WU2A 4ICYA 3OZ2A 1Q1WA 1GERA 3UOXA 4DSGA 3PS9A 1CJ2A 2DU8A 1TDFA 1VG0A 1ZP0A 3GD3A 4FK1C 4YTMA 1YQ3A 4OPLA 4A5LA 1OJDA 1EBDA 1B5QA 1GNDA 3ALMA 3AECA 4FK1A 1MO9A 1D5TA 2OA1A 4N9XA 3S5WA 2NPXA 2X8HA 4Z44A 5ER0A 2YM1A 2AQJA 2W0HA 4GDEA 5KXJA 4YJGA 5L46A 4KPRA 2OAMA 2YLWA 2YR4A 2VQ7A 5BRTA 3ATQA 3V3OA 1P2HA 2XLPA 2XLRA 2BA9A 1E6EA 3FPZA 4K7ZA 2XFQA 3GRTA 4IV9A 5JCKA 4B1BA 3KKJA 4H7UA 5C2TA 2DKIA 1IUSA 1CJCA 2GMHA 3CIRA 2FJAA 1VG9A 3GMBA 2VQBA 3M0OA 3UKHA 2B76A 3ICRA 3AE6A 3K7TA 5KVHA 3CGDA 2A8XA 2EQ6A 4J56A 1PHHA 3DK8A 5HHFA 4B66A 1NHQA 3NYCA 4XWZA 1UKVG 4YXDA 4TM3A 4LIIA 2XVEA 4H2RA 4H4YA 1PBDA 5U63A 1DJNA 4B67A 2YLSA 4MJWA 2WHDA 1H7WA 4NTDA 4OPIA 4A79A 3QFAA 4C77A 4Y4LA 3ALJA 3NK2X 3AEEA 4YWOA 2YG4A 4U2TA 4B64A 1L9CA 3NGCX 4BK3A 1REOA 4BJYA 2FJEA 2YR5A 1LQUA 3D8XA 2GRTA 3I6DA 4BK1A 4UP3A 3FBSA 1GTEA 3CPIG 1L0VA 1H86A 3NRNA 1MXTA 1JNRA 4EMJA 2WP5A 3RP6A 2E49A 3ADAB 1GV4A 4JDRA 4YSZA 1D7LA 4HB9A 1L9DA 3AEAA 1MOKA 3F8PA 4U8NA 2QAEA 3EAOA 4EQXA 1CJ4A 1DXLA 2HQMA 3BI5A 2GMJA 2DKHA 2WPCA 1KIFA 1PXCA 4IVOB 3G5QA 3C4NA 1LPFA 4OPGA 2XCGA 4H2QA 3ZNOA 4ZN0A 3IF9A 3GDNA 1N4UA 4TLZA 4USQA 2V3AA 3LADA 3CTYA 4H50A 3GRSA 4D03A 5J60A 2RGOA 5KOWA 3GDPA 5HY5A 1GPEA 1ZMCA 2GAGB 3QVPA 1E1NA 3NTDA 1KNPA 1LVLA 3AYJA 1K0LA 3AD7B 4BV6A 4EQWA 4Z2UA 2YR6A 1LV0A 2BC0A 2WOVA 2PYXA 3AEGA 3LZWA 1E7PA 1GRBA 4AT2A 2WPFA 1F8RA 2ZZCA 2UZZA 2IVDA 3UCLA 2C72A 2WETA 1VE9A 1M64A 5CQFA 4DGKA 3BI2A 4X4JA 2E4AA 2B7SA 2XFPA 3GWDA 4J31A 2FJDA 1JRYA 1OJ9A 5IQ1A 2V61A 1RYIA 2CULA 3AE2A 2J3NA 3B3RA 2YLZA 1Q1RA 1TDNA 3NG7X 3EANA 4ZCDA 2WQYA 5EOWA 2GR1A 1K0IA 3DK9A 3M12A 3VRBA 1PN0A 1CL0A 2TPRA 3NN0X 5HYMA 1BF3A 3BNMA 5IPYA 1VRQB 2XYOA 3CNSA 4AP3A 4YTPA 2O9ZA 4U8IA 3QSSA 4P9SA 4K2XA 4X9MA 2C65A 3FG2P 4U8OA 4Z43A 2R0CA 3AD8B 5EBKA 5LV9A 2WOWA 1IUXA 2RGHA 1FEBA 2X8CA 2XDOA 2XFOA 2AR8A 3EF6A 4OPDA 5GRTA 3VRAA 2VRLA 4ADWA 4XWRA 4EMWA 4GF7A 1F8SA 3D1CA 1RSGA 1N4VA 4YKFA 2YLTA 5C3JA 3NN6X 1ONFA 3UP4A 4AT0A 3ICTA 4ECHA 3DH9A 2R4EA 2C70A 1DAOA 3F8DA 4CY6A 3NTAA 1FOHA 4YJFB 4U8PA 3SGLA 1YY5A 2F5ZA 1IUVA 2E48A 2WDQA 2IVEA 1CC2A 1Q9IA 1PBFA 1IUTA 2X3NA 1EL8A 3AEBA 2BABA 1ZOVA 5EB5A 3NK1X 3KD9A 1GRGA 3CNDA 4TM4A 5FS9A 2C7GA 3CGCA 1GTHA 4DNAA 3LOVA 4J34A 3GWFA 3AWIA 2GEWA 2JB3A 3NK0X 1FCDA 2WS3A 2YLRA 1DOBA 1NPXA 3QSMA 4YJHB 1LJ1A 2A87A 2XLSA 3DGHA 3AXBA 4M52A 2I0ZA 5JCLA 1DNCA 4I59A 3UKLA 1Y56A 4U8LA 3ITJA 3COXA 4RSLA 1GESA 1N4WA 2R46A 1E39A 1YQZA 4A6NB 4OPCA 5EB4A 4NEWA 1E1MA 4A99A 2WEUA 3AB1A 2YVGA 2H88A 2C67A 1XPQA 1XANA 3NKSA 5BUKA 2WOIA 1ZDLA 3W4KA 1C0IA 2PHHA 4OVIA 4B68A 3UP5A 2YQUA 2WDRA 3NLCA 3I3LA 3O0HA 4USRA 3P4PA 3C96A 4GDPA 1QLBA 4O5QA 1GRFA 3UKAA 5KWFA 3BHFA 2C73A 2RABA 3DJJA 1IUUA 4HA6A 3P4RA 1TDEA 3S61A 3AYLA 1PDHA 3P9UA 3QSEA 1PBEA 3LJPA 3DK4A 4UDQA 2XVJA 1AN9A 4K8DA 4H4VA 1NHRA 1BGNA 2E82A 4TLXA 3CN8A 4LU6A 2R4JA 1GREA 2GR3A 5GSNA 4JY3A 1C0PA 1VDCA 3CNJA 3R9UA 4O5UA 1ZK7A 1NHPA 3ZNNA 4YSXA 1BGJA 3HZLA 2XFNA 4H4QA 4CRTA 4EM3A 2QA1A 2YVFA 3H4KA 4JQ9A 1NENA 4CCQA 1ZMDA 3CNPA 1PBBA 1KDGA 1H6VA 2QA2A 1E1KA 2WPEA 3ALLA 1S2QA 3QFBA 3SM8A 4QFDA 3EPTA 3NH3X 2E5VA 2Q0KA 2BXSA 3DJGX 1TRBA 4LA1A 3RP8A 5M10A 4YSYA 1PJ7A
chains in the Genus database with same CATH superfamily
1F8WA 3B6DA 3RNMA 1KSUA 1M6IA 3C4AA 2R45A 1TYTA 2Q0LA 4REKA 3UOYA 2XVFA 2BK3A 4GUVA 3UTGA 2BCPA 3ISHA 3FIMB 1COYA 2BXRA 2E1MA 5DBJA 3UKPA 1QJDA 1JRZA 2Y6RA 5HXIA 3BNUA 3H8LA 3AE1A 4C3XA 1KF6A 3DGZA 4IA5A 2TMDA 2R0GA 3DMEA 3DA1A 3GSIA 3ZNQA 4A7AA 2BS4A 4C5OA 1FL2A 2Z5YA 4YTNA 1C0KA 2GV8A 4AOSA 3T14A 5KOXA 3NYFA 1BWCA 5FMHA 4YJGB 3SZCA 1NG4A 4A6NA 1C0LA 1TDOA 1GETA 2XFUA 1ZKQA 4AP1A 4YKGA 4H4UA 1DOCA 2B9WA 4H4TA 5BULA 1CC6A 3GD4A 3UTEA 2GH5A 4EIPA 4GCMA 4J36A 3T2ZA 2ACZA 3CMMA 3FMWA 2X50A 3T2YA 4QFCA 4Z2TA 1XDIA 1P2EA 4JN9A 4C74A 1CBOA 5KRQA 5FS8A 4IA6A 4TM0A 3GYJA 3OC4A 2WP6A 3II4A 4B69A 1VQWA 4EQRA 1B4VA 1PBCA 2BS2A 1N1PA 4CBQA 3KLJA 2CVJA 3QVRA 3NT6A 1X31B 2VRMA 1EL5A 4CNKA 1PXAA 4GRTA 2IIDA 3P4SA 4G9KA 2YG6A 2CFYA 2GQWA 3LZXA 1CJ3A 2EQ8A 2XVHA 4OCGA 4U8KA 3K7QX 2APGA 1DOEA 3AE4A 3PVCA 5J7XA 5TR3A 1IJHA 2ZZBA 2WP9A 4BK2A 2EQ9A 4GAPA 2VVLG 4J57A 3KPFA 5FS6A 4PABA 5BVAA 3CGEA 3KVEA 3T37A 1GRAA 4H4ZA 4BURA 1EVIA 3WGTA 1D4DA 2YG7A 2YAUA 2VOUA 3UOVA 2GR0A 3SFEA 3V3NA 4E0VA 1OJCA 1GALA 2XVIA 1B37A 4U2SA 3UKFA 3UTHA 3KPKA 1D4CA 1O5WA 4JNQA 2XLTA 4Z24A 3IHMA 2C75A 4DSHA 4CCRA 1KSSA 2V5ZA 3AE8A 3ICSA 1S2YA 2BACA 4K5SA 4U8MA 3G5RA 4B63A 4FDCB 1ZX9A 2VVLA 2YWLA 3UKKA 2C4CA 3L1RA 4D04A 2R0PA 1H83A 3WE0A 1XHCA 4X9NA 2JK6A 2X99A 4U8JA 4H4XA 4WCTA 3UTFA 2C66A 5JCMA 3CNTA 4A9WA 3CPHG 2GQFA 1W4XA 1JU2A 1LTXR 2C76A 1EL7A 2H89A 2OLOA 4XXGA 4NEVA 1H7XA 2JKCA 3AYIA 2GR2A 1FEAA 3T31A 2GF3A 1OJTA 2BK5A 1BKWA 1O95A 3DJDA 1DODA 1OJAA 4C3YA 1K0JA 4K22A 1DJQA 4H4WA 5KVIA 1PS9A 2BS3A 2YG5A 3SQPA 1JOAA 4NTCA 1BZLA 1IUWA 1ZY8A 2C3CA 2AAQA 3VR9A 1KFYA 4YJDA 3LXDA 3ZYXA 2Z5XA 2YG3A 1HYUA 1KNRA 4TM1A 3KU9A 4RG3A 3P4QA 3W4IA 1NHSA 4KX6A 5CKUA 4Z2RA 1NDAA 1GEUA 3SX6A 2RGJA 5U25A 3ABVA 3AEDA 3CUKA 3K30A 1TDKA 3HYXA 2B7RA 3AD9B 1DDOA 1RP0A 4Z25A 4H4PA 2Y6QA 2FBWA 4I58A 2VZ2A 3AE7A 1QO8A 4RG4A 1YKJA 3URHA 4B65A 1GRHA 2BCGG 2JAEA 4YJFA 1PXBA 1F3PA 2ZBWA 4A65A 3IC9A 2FJBA 2VVMA 2WU5A 3AE9A 4EMIA 1YQ4A 3RHAA 1Y0PA 4AOXA 4WX1A 3VRDB 1ELIA 1NG3A 4YSHA 1FECA 1GOSA 3HYVA 4K5RA 1B8SA 4GR1A 5FS7A 1AOGA 2V3BA 2YLXA 4CY8A 4IVMB 2WESA 4Z26A 3IHGA 4NZHA 1E1LA 2CDUA 4H2PA 3VQRA 1GSNA 1JRXA 4H4RA 4UDRA 5M0ZA 5JCIA 3BI4A 3V76A 1JNZA 5U1OA 2YVJA 3NNEA 3W4JA 4YJHA 3NIXA 3Q6JA 4APNA 3NHOX 3LB8A 4Y4MA 4H4SA 4UDPA 3CGBA 1H81A 4PAAA 1CC4A 4OPUA 3KA7A 3REDA 3PO7A 4YT0A 3ZNPA 3NYEA 1H84A 2OALA 3ATRA 3UKQA 2B9YA 1GT8A 2WBAA 3DJEA 1O94A 2A89A 4U2LA 1S3EA 1TYPA 3G5SA 3VR8A 1L9EA 4CNJA 2Q6UA 1GXFA 5IQ4A 4J2WA 4ZCCA 3G3EA 1K4QA 3UOZA 2BC1A 4BJZA 1S3BA 1NAAA 2BYBA 2BRYA 5KMRA 1Y56B 1V59A 2XLUA 3BHKA 1JEHA 2OLNA 1LQTA 2R9ZA 3Q9TA 2X8GA 3ZDNA 4H2NA 3QJ4A 4EIQA 2JB1A 4FX9A 1D4EA 2Q7VA 2V6OA 3AEFA 3JSKA 1GRTA 4NTEA 4EQSA 3SFDA 2GVCA 1Z6LA 3AE3A 4JNAA 5JCNA 2GAHB 4JY2A 2E4GA 4J33A 3L8KA 1NEKA 2ARDA 3K7MX 3E1TA 2JB2A 2GB0A 3GYIA 1H82A 1PJ5A 2V60A 1SEZA 3RP7A 4OPTA 3AE5A 3IWAA 3P1WA 3M13A 2C3DA 2ZZ0A 2JBVA 2EQ7A 2BK4A 1PJ6A 1F6MA 2NVKX 1CHUA 4EM4A 2QCUA 4Y4NA 2C64A 1D7YA 3CPJG 2YM2A 1ZOYA 2B9XA 3H8IA 1EL9A 2WDVA 1CF3A 3GMCA 3F8RA 2WU2A 5KMPA 4ICYA 3OZ2A 1GERA 1Q1WA 3UOXA 4DSGA 3PS9A 1CJ2A 2DU8A 1TDFA 1VG0A 1ZP0A 3GD3A 4FK1C 4YTMA 1YQ3A 4OPLA 4A5LA 1OJDA 1EBDA 3SZWA 1B5QA 1GNDA 3ALMA 3AECA 4FK1A 1MO9A 1D5TA 2OA1A 4N9XA 3S5WA 2NPXA 2X8HA 4Z44A 5ER0A 3GYXA 2YM1A 2AQJA 2W0HA 4GDEA 5KXJA 4YJGA 5L46A 4KPRA 2OAMA 2YLWA 2YR4A 2VQ7A 5BRTA 3ATQA 3V3OA 1P2HA 2XLPA 2XLRA 2BA9A 5KNLA 1E6EA 3FPZA 4K7ZA 2XFQA 3GRTA 4IV9A 5JCKA 4B1BA 3KKJA 4H7UA 5C2TA 2DKIA 1IUSA 2GMHA 1CJCA 3CIRA 2FJAA 1VG9A 3GMBA 2VQBA 3M0OA 3UKHA 2B76A 3ICRA 3AE6A 3K7TA 5KVHA 3CGDA 2A8XA 2EQ6A 4J56A 1PHHA 3DK8A 5HHFA 4B66A 1NHQA 3NYCA 4XWZA 1UKVG 4YXDA 4TM3A 4LIIA 2XVEA 4H2RA 4H4YA 1PBDA 5U63A 1DJNA 5KMQA 4B67A 2YLSA 4MJWA 2WHDA 1H7WA 4NTDA 4OPIA 4A79A 3QFAA 4C77A 4Y4LA 3ALJA 3NK2X 3AEEA 4YWOA 2YG4A 4U2TA 4B64A 1L9CA 3NGCX 4BK3A 4BJYA 1REOA 2FJEA 2YR5A 1LQUA 3D8XA 2GRTA 4BK1A 3I6DA 4UP3A 3FBSA 1GTEA 3CPIG 1L0VA 1H86A 3NRNA 1MXTA 1JNRA 4EMJA 2WP5A 3RP6A 2E49A 3ADAB 1GV4A 4JDRA 4YSZA 1D7LA 4HB9A 1L9DA 3AEAA 1MOKA 3F8PA 4U8NA 2QAEA 3EAOA 4EQXA 1CJ4A 1DXLA 2HQMA 3BI5A 2GMJA 2DKHA 2WPCA 1KIFA 1PXCA 4IVOB 3G5QA 3C4NA 1LPFA 4OPGA 2XCGA 4H2QA 3ZNOA 3T0KA 4ZN0A 3IF9A 3GDNA 1N4UA 3T2KA 4TLZA 4USQA 2V3AA 3LADA 4G6HA 3CTYA 4H50A 3GRSA 4D03A 5J60A 2RGOA 5KOWA 3GDPA 4GAVA 4G74A 5HY5A 1GPEA 1ZMCA 2GAGB 3QVPA 1E1NA 3NTDA 1KNPA 1LVLA 3AYJA 1K0LA 3AD7B 4BV6A 4EQWA 4Z2UA 2YR6A 1LV0A 2BC0A 2WOVA 2PYXA 3AEGA 3LZWA 1E7PA 1GRBA 4AT2A 2WPFA 1F8RA 2ZZCA 2UZZA 2IVDA 3UCLA 2C72A 2WETA 1VE9A 1M64A 5CQFA 4DGKA 3BI2A 4X4JA 2E4AA 2B7SA 2XFPA 3GWDA 4J31A 2FJDA 1JRYA 1OJ9A 5IQ1A 2V61A 1RYIA 2CULA 3AE2A 2J3NA 3B3RA 2YLZA 1Q1RA 1TDNA 3NG7X 3EANA 4ZCDA 2WQYA 5EOWA 2GR1A 1K0IA 3DK9A 3M12A 3VRBA 1PN0A 1CL0A 2TPRA 5HYMA 3NN0X 3SYIA 1BF3A 3BNMA 5IPYA 1VRQB 2XYOA 3CNSA 4AP3A 4YTPA 2O9ZA 4G73A 4U8IA 3QSSA 4P9SA 4K2XA 4X9MA 2C65A 3FG2P 4U8OA 4G6GA 4Z43A 2R0CA 3AD8B 5EBKA 5LV9A 2WOWA 1IUXA 2RGHA 1FEBA 2X8CA 2XDOA 2XFOA 2AR8A 3EF6A 4OPDA 5GRTA 3VRAA 4II3A 2VRLA 4ADWA 4XWRA 4EMWA 3SY4A 4GF7A 1F8SA 5KMSA 3D1CA 1RSGA 1N4VA 4YKFA 3SXIA 2YLTA 5C3JA 3NN6X 1ONFA 3HYWA 3UP4A 4AT0A 3ICTA 4ECHA 3DH9A 2R4EA 2C70A 1DAOA 3F8DA 4CY6A 3NTAA 1FOHA 4YJFB 4U8PA 3SGLA 1YY5A 2F5ZA 1IUVA 2E48A 2WDQA 2IVEA 1CC2A 2X3NA 1PBFA 1IUTA 1Q9IA 1EL8A 3AEBA 2BABA 1ZOVA 5EB5A 3NK1X 3SZFA 3KD9A 1GRGA 3CNDA 4TM4A 5FS9A 2C7GA 3CGCA 1GTHA 4DNAA 3LOVA 4J34A 3GWFA 3AWIA 2GEWA 2JB3A 3NK0X 1FCDA 2WS3A 2YLRA 1DOBA 1NPXA 3QSMA 4YJHB 1LJ1A 2A87A 2XLSA 3DGHA 3AXBA 4M52A 2I0ZA 5JCLA 1DNCA 4I59A 3UKLA 1Y56A 4U8LA 3ITJA 3COXA 4RSLA 1GESA 1N4WA 2R46A 1E39A 1YQZA 4A6NB 4OPCA 5EB4A 4NEWA 1E1MA 4A99A 2WEUA 3AB1A 2YVGA 2H88A 2C67A 1XPQA 1XANA 3NKSA 5BUKA 2WOIA 1ZDLA 3W4KA 1C0IA 2PHHA 4II2A 4OVIA 4B68A 3UP5A 2YQUA 2WDRA 3NLCA 4NNJA 3I3LA 3O0HA 4USRA 3P4PA 3C96A 4GDPA 1QLBA 4O5QA 1GRFA 3UKAA 5KWFA 3BHFA 2C73A 2RABA 3DJJA 1IUUA 4HA6A 3P4RA 1TDEA 3S61A 3AYLA 1PDHA 3P9UA 3QSEA 1PBEA 3LJPA 3DK4A 3SZ0A 4UDQA 2XVJA 1AN9A 4K8DA 4H4VA 1NHRA 1BGNA 2E82A 4TLXA 3CN8A 4LU6A 2R4JA 1GREA 2BRAA 2GR3A 4JY3A 5GSNA 1C0PA 4NWZA 1VDCA 3CNJA 3R9UA 4O5UA 1ZK7A 1NHPA 3ZNNA 4YSXA 1BGJA 3HZLA 2XFNA 4H4QA 4CRTA 4EM3A 2QA1A 2YVFA 3H4KA 4JQ9A 1NENA 4CCQA 1ZMDA 3CNPA 1PBBA 1KDGA 1H6VA 2QA2A 1E1KA 2WPEA 3ALLA 1S2QA 3QFBA 3SM8A 3EPTA 4QFDA 3NH3X 2E5VA 2Q0KA 3RP8A 2BXSA 1TRBA 3DJGX 4LA1A 5M10A 4YSYA 1PJ7A
chains in the Genus database with same CATH topology
1F8WA 3B6DA 3RNMA 1KSUA 1M6IA 3C4AA 2R45A 1TYTA 2Q0LA 4REKA 3UOYA 2XVFA 2BK3A 4GUVA 3UTGA 2BCPA 3ISHA 3FIMB 1COYA 2BXRA 2E1MA 5DBJA 3UKPA 1QJDA 1JRZA 2Y6RA 3BNUA 3H8LA 5HXIA 3AE1A 4C3XA 1KF6A 3DGZA 2TMDA 4IA5A 3DMEA 3GSIA 3DA1A 2R0GA 3ZNQA 4A7AA 2BS4A 4C5OA 1FL2A 2Z5YA 4YTNA 1C0KA 2GV8A 4AOSA 3T14A 5KOXA 3NYFA 1BWCA 5FMHA 4YJGB 3SZCA 1NG4A 4A6NA 1C0LA 1TDOA 1GETA 2XFUA 1ZKQA 4AP1A 4YKGA 4H4UA 1DOCA 2B9WA 4H4TA 5BULA 1CC6A 3GD4A 3UTEA 2GH5A 4GCMA 4EIPA 4J36A 3T2ZA 2ACZA 3CMMA 3FMWA 2X50A 3T2YA 4QFCA 4Z2TA 1XDIA 1P2EA 4JN9A 4C74A 1CBOA 5KRQA 5FS8A 4IA6A 4TM0A 3GYJA 3OC4A 2WP6A 3II4A 4B69A 1VQWA 4EQRA 1B4VA 1PBCA 2BS2A 1N1PA 4CBQA 3KLJA 2CVJA 3QVRA 3NT6A 1X31B 2VRMA 1EL5A 4CNKA 1PXAA 4GRTA 2IIDA 3P4SA 4G9KA 2YG6A 2CFYA 2GQWA 3LZXA 1CJ3A 2EQ8A 2XVHA 4OCGA 4U8KA 3K7QX 2APGA 1DOEA 3AE4A 3PVCA 5J7XA 5TR3A 1IJHA 2ZZBA 2WP9A 2EQ9A 4GAPA 4BK2A 2VVLG 4J57A 3KPFA 5FS6A 4PABA 5BVAA 3CGEA 3KVEA 3T37A 1GRAA 4H4ZA 4BURA 1EVIA 3WGTA 1D4DA 2YG7A 2YAUA 2VOUA 3UOVA 2GR0A 3SFEA 3V3NA 4E0VA 1OJCA 1GALA 2XVIA 1B37A 4U2SA 3UKFA 3UTHA 3KPKA 1D4CA 1O5WA 4JNQA 2XLTA 4Z24A 3IHMA 2C75A 4DSHA 4CCRA 1KSSA 2V5ZA 3AE8A 3ICSA 1S2YA 2BACA 4K5SA 4U8MA 3G5RA 4B63A 4FDCB 1ZX9A 2VVLA 2YWLA 3UKKA 2C4CA 3L1RA 4D04A 2R0PA 1H83A 3WE0A 1XHCA 4X9NA 2JK6A 2X99A 4U8JA 4H4XA 4WCTA 3UTFA 2C66A 5JCMA 3CNTA 4A9WA 3CPHG 2GQFA 1W4XA 1JU2A 1LTXR 2C76A 1EL7A 2H89A 2OLOA 4XXGA 4NEVA 1H7XA 2JKCA 3AYIA 2GR2A 1FEAA 3T31A 2GF3A 1OJTA 2BK5A 1BKWA 1O95A 3DJDA 1DODA 1OJAA 4C3YA 1K0JA 1DJQA 4H4WA 4K22A 5KVIA 1PS9A 2BS3A 2YG5A 3SQPA 1JOAA 4NTCA 1BZLA 1IUWA 1ZY8A 2C3CA 2AAQA 3VR9A 1KFYA 4YJDA 3LXDA 3ZYXA 2Z5XA 2YG3A 1HYUA 1KNRA 4TM1A 3KU9A 4RG3A 3P4QA 3W4IA 1NHSA 4KX6A 5CKUA 4Z2RA 1NDAA 1GEUA 3SX6A 2RGJA 5U25A 3ABVA 3AEDA 3CUKA 3K30A 1TDKA 3HYXA 2B7RA 3AD9B 1DDOA 1RP0A 4Z25A 4H4PA 2Y6QA 2FBWA 4I58A 2VZ2A 3AE7A 1QO8A 4RG4A 1YKJA 3URHA 4B65A 1GRHA 2BCGG 2JAEA 4YJFA 1PXBA 1F3PA 2ZBWA 4A65A 3IC9A 2FJBA 2VVMA 2WU5A 3AE9A 4EMIA 1YQ4A 3RHAA 1Y0PA 4AOXA 4WX1A 3VRDB 1ELIA 1NG3A 4YSHA 1FECA 1GOSA 3HYVA 4K5RA 1B8SA 4GR1A 5FS7A 1AOGA 2V3BA 2YLXA 4CY8A 4IVMB 2WESA 4Z26A 3IHGA 4NZHA 1E1LA 2CDUA 3VQRA 1JRXA 1GSNA 4H2PA 4H4RA 4UDRA 5M0ZA 5JCIA 3BI4A 3V76A 1JNZA 5U1OA 2YVJA 3NNEA 3W4JA 4YJHA 3NIXA 3Q6JA 4APNA 3NHOX 3LB8A 4Y4MA 4H4SA 4UDPA 3CGBA 1H81A 4PAAA 1CC4A 4OPUA 3KA7A 3REDA 3PO7A 4YT0A 3ZNPA 3NYEA 1H84A 2OALA 3ATRA 3UKQA 2B9YA 1GT8A 2WBAA 3DJEA 1O94A 2A89A 4U2LA 1S3EA 1TYPA 3G5SA 3VR8A 1L9EA 4CNJA 2Q6UA 1GXFA 5IQ4A 4J2WA 4ZCCA 3G3EA 1K4QA 3UOZA 2BC1A 1S3BA 4BJZA 1NAAA 2BYBA 2BRYA 5KMRA 1Y56B 1V59A 2XLUA 3BHKA 1JEHA 2OLNA 1LQTA 2R9ZA 3Q9TA 2X8GA 3ZDNA 3QJ4A 4H2NA 4EIQA 2JB1A 4FX9A 1D4EA 2Q7VA 2V6OA 3AEFA 3JSKA 1GRTA 4NTEA 4EQSA 3SFDA 2GVCA 1Z6LA 3AE3A 4JNAA 5JCNA 2GAHB 4JY2A 2E4GA 4J33A 3L8KA 1NEKA 2ARDA 3K7MX 2JB2A 3E1TA 2GB0A 3GYIA 1H82A 1PJ5A 2V60A 1SEZA 4OPTA 3RP7A 3AE5A 3IWAA 3P1WA 3M13A 2C3DA 2ZZ0A 2JBVA 2EQ7A 2BK4A 1PJ6A 1F6MA 2NVKX 1CHUA 4EM4A 2QCUA 4Y4NA 2C64A 1D7YA 3CPJG 2YM2A 1ZOYA 2B9XA 3H8IA 1EL9A 2WDVA 1CF3A 3GMCA 3F8RA 2WU2A 5KMPA 4ICYA 3OZ2A 1Q1WA 1GERA 3UOXA 4DSGA 3PS9A 1CJ2A 2DU8A 1TDFA 1VG0A 1ZP0A 3GD3A 4FK1C 4YTMA 1YQ3A 4OPLA 4A5LA 1OJDA 1EBDA 3SZWA 1B5QA 1GNDA 3ALMA 3AECA 4FK1A 1MO9A 1D5TA 2OA1A 4N9XA 3S5WA 2NPXA 2X8HA 4Z44A 5ER0A 3GYXA 2YM1A 2AQJA 2W0HA 4GDEA 5KXJA 4YJGA 5L46A 4KPRA 2OAMA 2YLWA 2YR4A 2VQ7A 5BRTA 3ATQA 3V3OA 1P2HA 2XLPA 2XLRA 2BA9A 5KNLA 1E6EA 3FPZA 4K7ZA 2XFQA 3GRTA 4IV9A 5JCKA 4B1BA 3KKJA 4H7UA 5C2TA 2DKIA 1IUSA 1CJCA 2GMHA 3CIRA 2FJAA 1VG9A 3GMBA 2VQBA 3M0OA 3UKHA 2B76A 3ICRA 3AE6A 3K7TA 5KVHA 3CGDA 2A8XA 2EQ6A 4J56A 1PHHA 3DK8A 5HHFA 4B66A 1NHQA 3NYCA 4XWZA 1UKVG 4YXDA 4TM3A 4LIIA 2XVEA 4H2RA 4H4YA 1PBDA 5U63A 1DJNA 5KMQA 4B67A 2YLSA 4MJWA 2WHDA 1H7WA 4NTDA 4OPIA 4A79A 3QFAA 4C77A 4Y4LA 3ALJA 3NK2X 3AEEA 4YWOA 2YG4A 4U2TA 4B64A 1L9CA 3NGCX 4BK3A 1REOA 4BJYA 2FJEA 2YR5A 1LQUA 3D8XA 2GRTA 3I6DA 4BK1A 4UP3A 3FBSA 1GTEA 3CPIG 1L0VA 1H86A 3NRNA 1MXTA 1JNRA 4EMJA 2WP5A 3RP6A 2E49A 3ADAB 1GV4A 4JDRA 4YSZA 1D7LA 4HB9A 1L9DA 3AEAA 1MOKA 3F8PA 4U8NA 2QAEA 3EAOA 4EQXA 1CJ4A 1DXLA 2HQMA 3BI5A 2GMJA 2DKHA 2WPCA 1KIFA 1PXCA 4IVOB 3G5QA 3C4NA 1LPFA 4OPGA 2XCGA 4H2QA 3ZNOA 3T0KA 4ZN0A 3IF9A 3GDNA 1N4UA 3T2KA 4TLZA 4USQA 2V3AA 3LADA 4G6HA 3CTYA 4H50A 3GRSA 4D03A 5J60A 2RGOA 5KOWA 3GDPA 4GAVA 4G74A 5HY5A 1GPEA 1ZMCA 2GAGB 3QVPA 1E1NA 3NTDA 1KNPA 1LVLA 3AYJA 1K0LA 3AD7B 4BV6A 4EQWA 4Z2UA 2YR6A 1LV0A 2BC0A 2WOVA 2PYXA 3AEGA 3LZWA 1E7PA 1GRBA 4AT2A 2WPFA 1F8RA 2ZZCA 2UZZA 2IVDA 3UCLA 2C72A 2WETA 1VE9A 1M64A 5CQFA 4DGKA 3BI2A 4X4JA 2E4AA 2B7SA 2XFPA 3GWDA 4J31A 2FJDA 1JRYA 1OJ9A 5IQ1A 2V61A 1RYIA 2CULA 3AE2A 2J3NA 3B3RA 2YLZA 1Q1RA 1TDNA 3NG7X 3EANA 4ZCDA 2WQYA 5EOWA 2GR1A 1K0IA 3DK9A 3M12A 3VRBA 1PN0A 1CL0A 2TPRA 3NN0X 3SYIA 5HYMA 1BF3A 3BNMA 5IPYA 1VRQB 2XYOA 3CNSA 4AP3A 4YTPA 2O9ZA 4G73A 4U8IA 3QSSA 4P9SA 4K2XA 4X9MA 2C65A 3FG2P 4U8OA 4G6GA 4Z43A 2R0CA 3AD8B 5EBKA 5LV9A 2WOWA 1IUXA 2RGHA 1FEBA 2X8CA 2XDOA 2XFOA 2AR8A 3EF6A 4OPDA 5GRTA 3VRAA 4II3A 2VRLA 4ADWA 4XWRA 4EMWA 3SY4A 4GF7A 1F8SA 5KMSA 3D1CA 1RSGA 1N4VA 4YKFA 3SXIA 2YLTA 5C3JA 3NN6X 1ONFA 3HYWA 3UP4A 4AT0A 3ICTA 4ECHA 3DH9A 2R4EA 2C70A 1DAOA 3F8DA 4CY6A 3NTAA 1FOHA 4YJFB 4U8PA 3SGLA 1YY5A 2F5ZA 1IUVA 2E48A 2WDQA 2IVEA 1CC2A 1Q9IA 1PBFA 1IUTA 2X3NA 1EL8A 3AEBA 2BABA 1ZOVA 5EB5A 3NK1X 3SZFA 3KD9A 1GRGA 3CNDA 4TM4A 5FS9A 2C7GA 3CGCA 1GTHA 4DNAA 3LOVA 4J34A 3GWFA 3AWIA 2GEWA 2JB3A 3NK0X 1FCDA 2WS3A 2YLRA 1DOBA 1NPXA 3QSMA 4YJHB 1LJ1A 2A87A 2XLSA 3DGHA 3AXBA 4M52A 2I0ZA 5JCLA 1DNCA 4I59A 3UKLA 1Y56A 4U8LA 3ITJA 3COXA 4RSLA 1GESA 1N4WA 2R46A 1E39A 1YQZA 4A6NB 4OPCA 5EB4A 4NEWA 1E1MA 4A99A 2WEUA 3AB1A 2YVGA 2H88A 2C67A 1XPQA 1XANA 3NKSA 5BUKA 2WOIA 1ZDLA 3W4KA 1C0IA 2PHHA 4II2A 4OVIA 4B68A 3UP5A 2YQUA 2WDRA 3NLCA 4NNJA 3I3LA 3O0HA 4USRA 3P4PA 3C96A 4GDPA 1QLBA 4O5QA 1GRFA 3UKAA 5KWFA 3BHFA 2C73A 2RABA 3DJJA 1IUUA 4HA6A 3P4RA 1TDEA 3S61A 3AYLA 1PDHA 3P9UA 3QSEA 1PBEA 3LJPA 3DK4A 3SZ0A 4UDQA 2XVJA 1AN9A 4K8DA 4H4VA 1NHRA 1BGNA 2E82A 4TLXA 3CN8A 4LU6A 2R4JA 1GREA 2BRAA 2GR3A 4JY3A 5GSNA 1C0PA 4NWZA 1VDCA 3CNJA 3R9UA 4O5UA 1ZK7A 1NHPA 3ZNNA 4YSXA 1BGJA 3HZLA 2XFNA 4H4QA 4CRTA 4EM3A 2QA1A 2YVFA 3H4KA 4JQ9A 1NENA 4CCQA 1ZMDA 3CNPA 1PBBA 1KDGA 1H6VA 2QA2A 1E1KA 2WPEA 3ALLA 1S2QA 3QFBA 3SM8A 4QFDA 3EPTA 3NH3X 2E5VA 2Q0KA 2BXSA 3DJGX 1TRBA 4LA1A 3RP8A 5M10A 4YSYA 1PJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8W A;  3B6D A;  3RNM A;  1KSU A;  1M6I A;  3C4A A;  2R45 A;  1TYT A;  2Q0L A;  4REK A;  3UOY A;  2XVF A;  2BK3 A;  4GUV A;  3UTG A;  2BCP A;  3ISH A;  3FIM B;  1COY A;  2BXR A;  2E1M A;  5DBJ A;  3UKP A;  1QJD A;  1JRZ A;  2Y6R A;  3BNU A;  3H8L A;  5HXI A;  3AE1 A;  4C3X A;  1KF6 A;  3DGZ A;  2TMD A;  4IA5 A;  3DME A;  3GSI A;  3DA1 A;  2R0G A;  3ZNQ A;  4A7A A;  2BS4 A;  4C5O A;  1FL2 A;  2Z5Y A;  4YTN A;  1C0K A;  2GV8 A;  4AOS A;  5KOX A;  3NYF A;  1BWC A;  5FMH A;  4YJG B;  4A6N A;  1NG4 A;  4AP1 A;  1C0L A;  1TDO A;  1GET A;  2XFU A;  1ZKQ A;  4YKG A;  4H4U A;  1DOC A;  2B9W A;  4H4T A;  5BUL A;  1CC6 A;  3GD4 A;  3UTE A;  2GH5 A;  4GCM A;  4EIP A;  4J36 A;  2ACZ A;  3FMW A;  2X50 A;  4QFC A;  4Z2T A;  1XDI A;  1P2E A;  4JN9 A;  4C74 A;  1CBO A;  5KRQ A;  5FS8 A;  4IA6 A;  4TM0 A;  3GYJ A;  3OC4 A;  2WP6 A;  3II4 A;  4B69 A;  1VQW A;  4EQR A;  1B4V A;  1PBC A;  2BS2 A;  1N1P A;  4CBQ A;  3KLJ A;  2CVJ A;  3QVR A;  3NT6 A;  1X31 B;  2VRM A;  1EL5 A;  4CNK A;  1PXA A;  4GRT A;  2IID A;  3P4S A;  2YG6 A;  2CFY A;  2GQW A;  3LZX A;  1CJ3 A;  2EQ8 A;  2XVH A;  4OCG A;  4U8K A;  3K7Q X;  2APG A;  1DOE A;  3AE4 A;  3PVC A;  5J7X A;  5TR3 A;  1IJH A;  2ZZB A;  2WP9 A;  2EQ9 A;  4BK2 A;  2VVL G;  4J57 A;  3KPF A;  5FS6 A;  4PAB A;  5BVA A;  3CGE A;  3KVE A;  3T37 A;  1GRA A;  4H4Z A;  4BUR A;  1EVI A;  3WGT A;  1D4D A;  2YG7 A;  2YAU A;  2VOU A;  3UOV A;  2GR0 A;  3SFE A;  3V3N A;  4E0V A;  1OJC A;  1GAL A;  2XVI A;  1B37 A;  4U2S A;  3UKF A;  3UTH A;  1D4C A;  1O5W A;  4JNQ A;  2XLT A;  4Z24 A;  3IHM A;  2C75 A;  4DSH A;  4CCR A;  1KSS A;  2V5Z A;  3AE8 A;  3ICS A;  1S2Y A;  2BAC A;  4K5S A;  4U8M A;  3G5R A;  4B63 A;  4FDC B;  1ZX9 A;  2VVL A;  2YWL A;  3UKK A;  3L1R A;  4D04 A;  2R0P A;  1H83 A;  3WE0 A;  1XHC A;  4X9N A;  2JK6 A;  2X99 A;  4U8J A;  4H4X A;  4WCT A;  3UTF A;  2C66 A;  5JCM A;  3CNT A;  4A9W A;  3CPH G;  2GQF A;  1W4X A;  1JU2 A;  1LTX R;  2C76 A;  1EL7 A;  2H89 A;  2OLO A;  4XXG A;  4NEV A;  1H7X A;  2JKC A;  3AYI A;  2GR2 A;  1FEA A;  2GF3 A;  1OJT A;  2BK5 A;  1BKW A;  1O95 A;  3DJD A;  1DOD A;  1OJA A;  4C3Y A;  1K0J A;  1DJQ A;  4H4W A;  4K22 A;  5KVI A;  1PS9 A;  2BS3 A;  2YG5 A;  3SQP A;  1JOA A;  4NTC A;  1BZL A;  1IUW A;  1ZY8 A;  2C3C A;  2AAQ A;  3VR9 A;  1KFY A;  4YJD A;  3LXD A;  3ZYX A;  2Z5X A;  2YG3 A;  1HYU A;  1KNR A;  4TM1 A;  3KU9 A;  4RG3 A;  3P4Q A;  3W4I A;  1NHS A;  4KX6 A;  5CKU A;  4Z2R A;  1NDA A;  1GEU A;  2RGJ A;  5U25 A;  3ABV A;  3AED A;  3CUK A;  3K30 A;  1TDK A;  2B7R A;  3AD9 B;  1DDO A;  1RP0 A;  4Z25 A;  4H4P A;  2Y6Q A;  2FBW A;  4I58 A;  2VZ2 A;  3AE7 A;  1QO8 A;  4RG4 A;  1YKJ A;  3URH A;  4B65 A;  1GRH A;  2BCG G;  2JAE A;  4YJF A;  1PXB A;  1F3P A;  2ZBW A;  4A65 A;  3IC9 A;  2FJB A;  2VVM A;  2WU5 A;  3AE9 A;  4EMI A;  1YQ4 A;  3RHA A;  1Y0P A;  4AOX A;  4WX1 A;  3VRD B;  1ELI A;  1NG3 A;  4YSH A;  1FEC A;  1GOS A;  4K5R A;  5FS7 A;  1B8S A;  4GR1 A;  1AOG A;  2V3B A;  2YLX A;  4CY8 A;  4IVM B;  2WES A;  4Z26 A;  3IHG A;  4NZH A;  1E1L A;  2CDU A;  3VQR A;  1JRX A;  1GSN A;  4H2P A;  4H4R A;  4UDR A;  5M0Z A;  5JCI A;  3BI4 A;  3V76 A;  1JNZ A;  5U1O A;  2YVJ A;  3NNE A;  3W4J A;  4YJH A;  3NIX A;  3Q6J A;  4APN A;  3NHO X;  3LB8 A;  4Y4M A;  4H4S A;  4UDP A;  3CGB A;  1H81 A;  4PAA A;  1CC4 A;  4OPU A;  3KA7 A;  3RED A;  3PO7 A;  4YT0 A;  3ZNP A;  3NYE A;  1H84 A;  2OAL A;  3ATR A;  3UKQ A;  2B9Y A;  1GT8 A;  2WBA A;  3DJE A;  1O94 A;  2A89 A;  4U2L A;  1S3E A;  1TYP A;  3G5S A;  3VR8 A;  1L9E A;  4CNJ A;  2Q6U A;  1GXF A;  5IQ4 A;  4J2W A;  4ZCC A;  3G3E A;  1K4Q A;  3UOZ A;  2BC1 A;  1S3B A;  4BJZ A;  1NAA A;  2BYB A;  1Y56 B;  1V59 A;  2XLU A;  3BHK A;  1JEH A;  2OLN A;  1LQT A;  2R9Z A;  3Q9T A;  2X8G A;  3ZDN A;  3QJ4 A;  4H2N A;  4EIQ A;  2JB1 A;  4FX9 A;  1D4E A;  2Q7V A;  2V6O A;  3AEF A;  3JSK A;  1GRT A;  4NTE A;  4EQS A;  3SFD A;  2GVC A;  1Z6L A;  3AE3 A;  4JNA A;  5JCN A;  2GAH B;  4JY2 A;  2E4G A;  4J33 A;  3L8K A;  1NEK A;  2ARD A;  3K7M X;  2JB2 A;  3E1T A;  2GB0 A;  3GYI A;  1H82 A;  1PJ5 A;  2V60 A;  1SEZ A;  4OPT A;  3RP7 A;  3AE5 A;  3IWA A;  3P1W A;  3M13 A;  2C3D A;  2ZZ0 A;  2JBV A;  2EQ7 A;  2BK4 A;  1PJ6 A;  1F6M A;  2NVK X;  1CHU A;  4EM4 A;  2QCU A;  4Y4N A;  2C64 A;  1D7Y A;  3CPJ G;  2YM2 A;  1ZOY A;  2B9X A;  3H8I A;  1EL9 A;  2WDV A;  1CF3 A;  3GMC A;  3F8R A;  2WU2 A;  4ICY A;  3OZ2 A;  1Q1W A;  1GER A;  3UOX A;  4DSG A;  3PS9 A;  1CJ2 A;  2DU8 A;  1TDF A;  1VG0 A;  1ZP0 A;  3GD3 A;  4FK1 C;  4YTM A;  1YQ3 A;  4OPL A;  4A5L A;  1OJD A;  1EBD A;  1B5Q A;  1GND A;  3ALM A;  3AEC A;  4FK1 A;  1MO9 A;  1D5T A;  2OA1 A;  4N9X A;  3S5W A;  2NPX A;  2X8H A;  4Z44 A;  5ER0 A;  2YM1 A;  2AQJ A;  2W0H A;  4GDE A;  5KXJ A;  4YJG A;  5L46 A;  4KPR A;  2OAM A;  2YLW A;  2YR4 A;  2VQ7 A;  5BRT A;  3ATQ A;  3V3O A;  1P2H A;  2XLP A;  2XLR A;  2BA9 A;  1E6E A;  3FPZ A;  4K7Z A;  2XFQ A;  3GRT A;  4IV9 A;  5JCK A;  4B1B A;  3KKJ A;  4H7U A;  5C2T A;  2DKI A;  1IUS A;  1CJC A;  2GMH A;  3CIR A;  2FJA A;  1VG9 A;  3GMB A;  2VQB A;  3M0O A;  3UKH A;  2B76 A;  3ICR A;  3AE6 A;  3K7T A;  5KVH A;  3CGD A;  2A8X A;  2EQ6 A;  4J56 A;  1PHH A;  3DK8 A;  5HHF A;  4B66 A;  1NHQ A;  3NYC A;  4XWZ A;  1UKV G;  4YXD A;  4TM3 A;  4LII A;  2XVE A;  4H2R A;  4H4Y A;  1PBD A;  5U63 A;  1DJN A;  4B67 A;  2YLS A;  4MJW A;  2WHD A;  1H7W A;  4NTD A;  4OPI A;  4A79 A;  3QFA A;  4C77 A;  4Y4L A;  3ALJ A;  3NK2 X;  3AEE A;  4YWO A;  2YG4 A;  4U2T A;  4B64 A;  1L9C A;  3NGC X;  4BK3 A;  1REO A;  4BJY A;  2FJE A;  2YR5 A;  1LQU A;  3D8X A;  2GRT A;  3I6D A;  4BK1 A;  4UP3 A;  3FBS A;  1GTE A;  3CPI G;  1L0V A;  1H86 A;  3NRN A;  1MXT A;  1JNR A;  4EMJ A;  2WP5 A;  3RP6 A;  2E49 A;  3ADA B;  1GV4 A;  4JDR A;  4YSZ A;  1D7L A;  4HB9 A;  1L9D A;  3AEA A;  1MOK A;  3F8P A;  4U8N A;  2QAE A;  3EAO A;  4EQX A;  1CJ4 A;  1DXL A;  2HQM A;  3BI5 A;  2GMJ A;  2DKH A;  2WPC A;  1KIF A;  1PXC A;  4IVO B;  3G5Q A;  3C4N A;  1LPF A;  4OPG A;  2XCG A;  4H2Q A;  3ZNO A;  4ZN0 A;  3IF9 A;  3GDN A;  1N4U A;  4TLZ A;  4USQ A;  2V3A A;  3LAD A;  3CTY A;  4H50 A;  3GRS A;  4D03 A;  5J60 A;  2RGO A;  5KOW A;  3GDP A;  5HY5 A;  1GPE A;  1ZMC A;  2GAG B;  3QVP A;  1E1N A;  3NTD A;  1KNP A;  1LVL A;  3AYJ A;  1K0L A;  3AD7 B;  4BV6 A;  4EQW A;  4Z2U A;  2YR6 A;  1LV0 A;  2BC0 A;  2WOV A;  2PYX A;  3AEG A;  3LZW A;  1E7P A;  1GRB A;  4AT2 A;  2WPF A;  1F8R A;  2ZZC A;  2UZZ A;  2IVD A;  3UCL A;  2C72 A;  2WET A;  1VE9 A;  1M64 A;  5CQF A;  4DGK A;  3BI2 A;  4X4J A;  2E4A A;  2B7S A;  2XFP A;  3GWD A;  4J31 A;  2FJD A;  1JRY A;  1OJ9 A;  5IQ1 A;  2V61 A;  1RYI A;  2CUL A;  3AE2 A;  2J3N A;  3B3R A;  2YLZ A;  1Q1R A;  1TDN A;  3NG7 X;  3EAN A;  4ZCD A;  2WQY A;  5EOW A;  2GR1 A;  1K0I A;  3DK9 A;  3M12 A;  3VRB A;  1PN0 A;  1CL0 A;  2TPR A;  3NN0 X;  5HYM A;  1BF3 A;  3BNM A;  5IPY A;  1VRQ B;  2XYO A;  3CNS A;  4AP3 A;  4YTP A;  2O9Z A;  4U8I A;  3QSS A;  4P9S A;  4K2X A;  4X9M A;  2C65 A;  3FG2 P;  4U8O A;  4Z43 A;  2R0C A;  3AD8 B;  5EBK A;  5LV9 A;  2WOW A;  1IUX A;  2RGH A;  1FEB A;  2X8C A;  2XDO A;  2XFO A;  2AR8 A;  3EF6 A;  4OPD A;  5GRT A;  3VRA A;  2VRL A;  4ADW A;  4XWR A;  4EMW A;  4GF7 A;  1F8S A;  3D1C A;  1RSG A;  1N4V A;  4YKF A;  2YLT A;  5C3J A;  3NN6 X;  1ONF A;  3UP4 A;  4AT0 A;  3ICT A;  4ECH A;  3DH9 A;  2R4E A;  2C70 A;  1DAO A;  3F8D A;  4CY6 A;  3NTA A;  1FOH A;  4YJF B;  4U8P A;  3SGL A;  1YY5 A;  2F5Z A;  1IUV A;  2E48 A;  2WDQ A;  2IVE A;  1CC2 A;  1Q9I A;  1PBF A;  1IUT A;  2X3N A;  1EL8 A;  3AEB A;  2BAB A;  1ZOV A;  5EB5 A;  3NK1 X;  3KD9 A;  1GRG A;  3CND A;  4TM4 A;  5FS9 A;  2C7G A;  3CGC A;  1GTH A;  4DNA A;  3LOV A;  4J34 A;  3GWF A;  3AWI A;  2GEW A;  2JB3 A;  3NK0 X;  1FCD A;  2WS3 A;  2YLR A;  1DOB A;  1NPX A;  3QSM A;  4YJH B;  1LJ1 A;  2A87 A;  2XLS A;  3DGH A;  3AXB A;  4M52 A;  2I0Z A;  5JCL A;  1DNC A;  4I59 A;  3UKL A;  1Y56 A;  4U8L A;  3ITJ A;  3COX A;  4RSL A;  1GES A;  1N4W A;  2R46 A;  1E39 A;  1YQZ A;  4A6N B;  4OPC A;  5EB4 A;  4NEW A;  1E1M A;  4A99 A;  2WEU A;  3AB1 A;  2YVG A;  2H88 A;  2C67 A;  1XPQ A;  1XAN A;  3NKS A;  5BUK A;  2WOI A;  1ZDL A;  3W4K A;  1C0I A;  2PHH A;  4OVI A;  4B68 A;  3UP5 A;  2YQU A;  2WDR A;  3NLC A;  3I3L A;  3O0H A;  4USR A;  3P4P A;  3C96 A;  4GDP A;  1QLB A;  4O5Q A;  1GRF A;  3UKA A;  5KWF A;  3BHF A;  2C73 A;  2RAB A;  3DJJ A;  1IUU A;  4HA6 A;  3P4R A;  1TDE A;  3S61 A;  3AYL A;  1PDH A;  3P9U A;  3QSE A;  1PBE A;  3LJP A;  3DK4 A;  4UDQ A;  2XVJ A;  1AN9 A;  4K8D A;  4H4V A;  1NHR A;  1BGN A;  2E82 A;  4TLX A;  3CN8 A;  4LU6 A;  2R4J A;  1GRE A;  2GR3 A;  5GSN A;  4JY3 A;  1C0P A;  1VDC A;  3CNJ A;  3R9U A;  4O5U A;  1ZK7 A;  1NHP A;  3ZNN A;  4YSX A;  1BGJ A;  3HZL A;  2XFN A;  4H4Q A;  4CRT A;  4EM3 A;  2QA1 A;  2YVF A;  3H4K A;  4JQ9 A;  1NEN A;  4CCQ A;  1ZMD A;  3CNP A;  1PBB A;  1KDG A;  1H6V A;  2QA2 A;  1E1K A;  2WPE A;  3ALL A;  1S2Q A;  3QFB A;  3SM8 A;  4QFD A;  3EPT A;  3NH3 X;  2E5V A;  2Q0K A;  2BXS A;  3DJG X;  1TRB A;  4LA1 A;  3RP8 A;  5M10 A;  4YSY A;  1PJ7 A; 
#chains in the Genus database with same CATH topology
 1F8W A;  3B6D A;  3RNM A;  1KSU A;  1M6I A;  3C4A A;  2R45 A;  1TYT A;  2Q0L A;  4REK A;  3UOY A;  2XVF A;  2BK3 A;  4GUV A;  3UTG A;  2BCP A;  3ISH A;  3FIM B;  1COY A;  2BXR A;  2E1M A;  5DBJ A;  3UKP A;  1QJD A;  1JRZ A;  2Y6R A;  5HXI A;  3BNU A;  3H8L A;  3AE1 A;  4C3X A;  1KF6 A;  3DGZ A;  4IA5 A;  2TMD A;  2R0G A;  3DME A;  3DA1 A;  3GSI A;  3ZNQ A;  4A7A A;  2BS4 A;  4C5O A;  1FL2 A;  2Z5Y A;  4YTN A;  1C0K A;  2GV8 A;  4AOS A;  3T14 A;  5KOX A;  3NYF A;  1BWC A;  5FMH A;  4YJG B;  3SZC A;  1NG4 A;  4A6N A;  1C0L A;  1TDO A;  1GET A;  2XFU A;  1ZKQ A;  4AP1 A;  4YKG A;  4H4U A;  1DOC A;  2B9W A;  4H4T A;  5BUL A;  1CC6 A;  3GD4 A;  3UTE A;  2GH5 A;  4EIP A;  4GCM A;  4J36 A;  3T2Z A;  2ACZ A;  3CMM A;  3FMW A;  2X50 A;  3T2Y A;  4QFC A;  4Z2T A;  1XDI A;  1P2E A;  4JN9 A;  4C74 A;  1CBO A;  5KRQ A;  5FS8 A;  4IA6 A;  4TM0 A;  3GYJ A;  3OC4 A;  2WP6 A;  3II4 A;  4B69 A;  1VQW A;  4EQR A;  1B4V A;  1PBC A;  2BS2 A;  1N1P A;  4CBQ A;  3KLJ A;  2CVJ A;  3QVR A;  3NT6 A;  1X31 B;  2VRM A;  1EL5 A;  4CNK A;  1PXA A;  4GRT A;  2IID A;  3P4S A;  4G9K A;  2YG6 A;  2CFY A;  2GQW A;  3LZX A;  1CJ3 A;  2EQ8 A;  2XVH A;  4OCG A;  4U8K A;  3K7Q X;  2APG A;  1DOE A;  3AE4 A;  3PVC A;  5J7X A;  5TR3 A;  1IJH A;  2ZZB A;  2WP9 A;  4BK2 A;  2EQ9 A;  4GAP A;  2VVL G;  4J57 A;  3KPF A;  5FS6 A;  4PAB A;  5BVA A;  3CGE A;  3KVE A;  3T37 A;  1GRA A;  4H4Z A;  4BUR A;  1EVI A;  3WGT A;  1D4D A;  2YG7 A;  2YAU A;  2VOU A;  3UOV A;  2GR0 A;  3SFE A;  3V3N A;  4E0V A;  1OJC A;  1GAL A;  2XVI A;  1B37 A;  4U2S A;  3UKF A;  3UTH A;  3KPK A;  1D4C A;  1O5W A;  4JNQ A;  2XLT A;  4Z24 A;  3IHM A;  2C75 A;  4DSH A;  4CCR A;  1KSS A;  2V5Z A;  3AE8 A;  3ICS A;  1S2Y A;  2BAC A;  4K5S A;  4U8M A;  3G5R A;  4B63 A;  4FDC B;  1ZX9 A;  2VVL A;  2YWL A;  3UKK A;  2C4C A;  3L1R A;  4D04 A;  2R0P A;  1H83 A;  3WE0 A;  1XHC A;  4X9N A;  2JK6 A;  2X99 A;  4U8J A;  4H4X A;  4WCT A;  3UTF A;  2C66 A;  5JCM A;  3CNT A;  4A9W A;  3CPH G;  2GQF A;  1W4X A;  1JU2 A;  1LTX R;  2C76 A;  1EL7 A;  2H89 A;  2OLO A;  4XXG A;  4NEV A;  1H7X A;  2JKC A;  3AYI A;  2GR2 A;  1FEA A;  3T31 A;  2GF3 A;  1OJT A;  2BK5 A;  1BKW A;  1O95 A;  3DJD A;  1DOD A;  1OJA A;  4C3Y A;  1K0J A;  4K22 A;  1DJQ A;  4H4W A;  5KVI A;  1PS9 A;  2BS3 A;  2YG5 A;  3SQP A;  1JOA A;  4NTC A;  1BZL A;  1IUW A;  1ZY8 A;  2C3C A;  2AAQ A;  3VR9 A;  1KFY A;  4YJD A;  3LXD A;  3ZYX A;  2Z5X A;  2YG3 A;  1HYU A;  1KNR A;  4TM1 A;  3KU9 A;  4RG3 A;  3P4Q A;  3W4I A;  1NHS A;  4KX6 A;  5CKU A;  4Z2R A;  1NDA A;  1GEU A;  3SX6 A;  2RGJ A;  5U25 A;  3ABV A;  3AED A;  3CUK A;  3K30 A;  1TDK A;  3HYX A;  2B7R A;  3AD9 B;  1DDO A;  1RP0 A;  4Z25 A;  4H4P A;  2Y6Q A;  2FBW A;  4I58 A;  2VZ2 A;  3AE7 A;  1QO8 A;  4RG4 A;  1YKJ A;  3URH A;  4B65 A;  1GRH A;  2BCG G;  2JAE A;  4YJF A;  1PXB A;  1F3P A;  2ZBW A;  4A65 A;  3IC9 A;  2FJB A;  2VVM A;  2WU5 A;  3AE9 A;  4EMI A;  1YQ4 A;  3RHA A;  1Y0P A;  4AOX A;  4WX1 A;  3VRD B;  1ELI A;  1NG3 A;  4YSH A;  1FEC A;  1GOS A;  3HYV A;  4K5R A;  1B8S A;  4GR1 A;  5FS7 A;  1AOG A;  2V3B A;  2YLX A;  4CY8 A;  4IVM B;  2WES A;  4Z26 A;  3IHG A;  4NZH A;  1E1L A;  2CDU A;  4H2P A;  3VQR A;  1GSN A;  1JRX A;  4H4R A;  4UDR A;  5M0Z A;  5JCI A;  3BI4 A;  3V76 A;  1JNZ A;  5U1O A;  2YVJ A;  3NNE A;  3W4J A;  4YJH A;  3NIX A;  3Q6J A;  4APN A;  3NHO X;  3LB8 A;  4Y4M A;  4H4S A;  4UDP A;  3CGB A;  1H81 A;  4PAA A;  1CC4 A;  4OPU A;  3KA7 A;  3RED A;  3PO7 A;  4YT0 A;  3ZNP A;  3NYE A;  1H84 A;  2OAL A;  3ATR A;  3UKQ A;  2B9Y A;  1GT8 A;  2WBA A;  3DJE A;  1O94 A;  2A89 A;  4U2L A;  1S3E A;  1TYP A;  3G5S A;  3VR8 A;  1L9E A;  4CNJ A;  2Q6U A;  1GXF A;  5IQ4 A;  4J2W A;  4ZCC A;  3G3E A;  1K4Q A;  3UOZ A;  2BC1 A;  4BJZ A;  1S3B A;  1NAA A;  2BYB A;  2BRY A;  5KMR A;  1Y56 B;  1V59 A;  2XLU A;  3BHK A;  1JEH A;  2OLN A;  1LQT A;  2R9Z A;  3Q9T A;  2X8G A;  3ZDN A;  4H2N A;  3QJ4 A;  4EIQ A;  2JB1 A;  4FX9 A;  1D4E A;  2Q7V A;  2V6O A;  3AEF A;  3JSK A;  1GRT A;  4NTE A;  4EQS A;  3SFD A;  2GVC A;  1Z6L A;  3AE3 A;  4JNA A;  5JCN A;  2GAH B;  4JY2 A;  2E4G A;  4J33 A;  3L8K A;  1NEK A;  2ARD A;  3K7M X;  3E1T A;  2JB2 A;  2GB0 A;  3GYI A;  1H82 A;  1PJ5 A;  2V60 A;  1SEZ A;  3RP7 A;  4OPT A;  3AE5 A;  3IWA A;  3P1W A;  3M13 A;  2C3D A;  2ZZ0 A;  2JBV A;  2EQ7 A;  2BK4 A;  1PJ6 A;  1F6M A;  2NVK X;  1CHU A;  4EM4 A;  2QCU A;  4Y4N A;  2C64 A;  1D7Y A;  3CPJ G;  2YM2 A;  1ZOY A;  2B9X A;  3H8I A;  1EL9 A;  2WDV A;  1CF3 A;  3GMC A;  3F8R A;  2WU2 A;  5KMP A;  4ICY A;  3OZ2 A;  1GER A;  1Q1W A;  3UOX A;  4DSG A;  3PS9 A;  1CJ2 A;  2DU8 A;  1TDF A;  1VG0 A;  1ZP0 A;  3GD3 A;  4FK1 C;  4YTM A;  1YQ3 A;  4OPL A;  4A5L A;  1OJD A;  1EBD A;  3SZW A;  1B5Q A;  1GND A;  3ALM A;  3AEC A;  4FK1 A;  1MO9 A;  1D5T A;  2OA1 A;  4N9X A;  3S5W A;  2NPX A;  2X8H A;  4Z44 A;  5ER0 A;  3GYX A;  2YM1 A;  2AQJ A;  2W0H A;  4GDE A;  5KXJ A;  4YJG A;  5L46 A;  4KPR A;  2OAM A;  2YLW A;  2YR4 A;  2VQ7 A;  5BRT A;  3ATQ A;  3V3O A;  1P2H A;  2XLP A;  2XLR A;  2BA9 A;  5KNL A;  1E6E A;  3FPZ A;  4K7Z A;  2XFQ A;  3GRT A;  4IV9 A;  5JCK A;  4B1B A;  3KKJ A;  4H7U A;  5C2T A;  2DKI A;  1IUS A;  2GMH A;  1CJC A;  3CIR A;  2FJA A;  1VG9 A;  3GMB A;  2VQB A;  3M0O A;  3UKH A;  2B76 A;  3ICR A;  3AE6 A;  3K7T A;  5KVH A;  3CGD A;  2A8X A;  2EQ6 A;  4J56 A;  1PHH A;  3DK8 A;  5HHF A;  4B66 A;  1NHQ A;  3NYC A;  4XWZ A;  1UKV G;  4YXD A;  4TM3 A;  4LII A;  2XVE A;  4H2R A;  4H4Y A;  1PBD A;  5U63 A;  1DJN A;  5KMQ A;  4B67 A;  2YLS A;  4MJW A;  2WHD A;  1H7W A;  4NTD A;  4OPI A;  4A79 A;  3QFA A;  4C77 A;  4Y4L A;  3ALJ A;  3NK2 X;  3AEE A;  4YWO A;  2YG4 A;  4U2T A;  4B64 A;  1L9C A;  3NGC X;  4BK3 A;  4BJY A;  1REO A;  2FJE A;  2YR5 A;  1LQU A;  3D8X A;  2GRT A;  4BK1 A;  3I6D A;  4UP3 A;  3FBS A;  1GTE A;  3CPI G;  1L0V A;  1H86 A;  3NRN A;  1MXT A;  1JNR A;  4EMJ A;  2WP5 A;  3RP6 A;  2E49 A;  3ADA B;  1GV4 A;  4JDR A;  4YSZ A;  1D7L A;  4HB9 A;  1L9D A;  3AEA A;  1MOK A;  3F8P A;  4U8N A;  2QAE A;  3EAO A;  4EQX A;  1CJ4 A;  1DXL A;  2HQM A;  3BI5 A;  2GMJ A;  2DKH A;  2WPC A;  1KIF A;  1PXC A;  4IVO B;  3G5Q A;  3C4N A;  1LPF A;  4OPG A;  2XCG A;  4H2Q A;  3ZNO A;  3T0K A;  4ZN0 A;  3IF9 A;  3GDN A;  1N4U A;  3T2K A;  4TLZ A;  4USQ A;  2V3A A;  3LAD A;  4G6H A;  3CTY A;  4H50 A;  3GRS A;  4D03 A;  5J60 A;  2RGO A;  5KOW A;  3GDP A;  4GAV A;  4G74 A;  5HY5 A;  1GPE A;  1ZMC A;  2GAG B;  3QVP A;  1E1N A;  3NTD A;  1KNP A;  1LVL A;  3AYJ A;  1K0L A;  3AD7 B;  4BV6 A;  4EQW A;  4Z2U A;  2YR6 A;  1LV0 A;  2BC0 A;  2WOV A;  2PYX A;  3AEG A;  3LZW A;  1E7P A;  1GRB A;  4AT2 A;  2WPF A;  1F8R A;  2ZZC A;  2UZZ A;  2IVD A;  3UCL A;  2C72 A;  2WET A;  1VE9 A;  1M64 A;  5CQF A;  4DGK A;  3BI2 A;  4X4J A;  2E4A A;  2B7S A;  2XFP A;  3GWD A;  4J31 A;  2FJD A;  1JRY A;  1OJ9 A;  5IQ1 A;  2V61 A;  1RYI A;  2CUL A;  3AE2 A;  2J3N A;  3B3R A;  2YLZ A;  1Q1R A;  1TDN A;  3NG7 X;  3EAN A;  4ZCD A;  2WQY A;  5EOW A;  2GR1 A;  1K0I A;  3DK9 A;  3M12 A;  3VRB A;  1PN0 A;  1CL0 A;  2TPR A;  5HYM A;  3NN0 X;  3SYI A;  1BF3 A;  3BNM A;  5IPY A;  1VRQ B;  2XYO A;  3CNS A;  4AP3 A;  4YTP A;  2O9Z A;  4G73 A;  4U8I A;  3QSS A;  4P9S A;  4K2X A;  4X9M A;  2C65 A;  3FG2 P;  4U8O A;  4G6G A;  4Z43 A;  2R0C A;  3AD8 B;  5EBK A;  5LV9 A;  2WOW A;  1IUX A;  2RGH A;  1FEB A;  2X8C A;  2XDO A;  2XFO A;  2AR8 A;  3EF6 A;  4OPD A;  5GRT A;  3VRA A;  4II3 A;  2VRL A;  4ADW A;  4XWR A;  4EMW A;  3SY4 A;  4GF7 A;  1F8S A;  5KMS A;  3D1C A;  1RSG A;  1N4V A;  4YKF A;  3SXI A;  2YLT A;  5C3J A;  3NN6 X;  1ONF A;  3HYW A;  3UP4 A;  4AT0 A;  3ICT A;  4ECH A;  3DH9 A;  2R4E A;  2C70 A;  1DAO A;  3F8D A;  4CY6 A;  3NTA A;  1FOH A;  4YJF B;  4U8P A;  3SGL A;  1YY5 A;  2F5Z A;  1IUV A;  2E48 A;  2WDQ A;  2IVE A;  1CC2 A;  2X3N A;  1PBF A;  1IUT A;  1Q9I A;  1EL8 A;  3AEB A;  2BAB A;  1ZOV A;  5EB5 A;  3NK1 X;  3SZF A;  3KD9 A;  1GRG A;  3CND A;  4TM4 A;  5FS9 A;  2C7G A;  3CGC A;  1GTH A;  4DNA A;  3LOV A;  4J34 A;  3GWF A;  3AWI A;  2GEW A;  2JB3 A;  3NK0 X;  1FCD A;  2WS3 A;  2YLR A;  1DOB A;  1NPX A;  3QSM A;  4YJH B;  1LJ1 A;  2A87 A;  2XLS A;  3DGH A;  3AXB A;  4M52 A;  2I0Z A;  5JCL A;  1DNC A;  4I59 A;  3UKL A;  1Y56 A;  4U8L A;  3ITJ A;  3COX A;  4RSL A;  1GES A;  1N4W A;  2R46 A;  1E39 A;  1YQZ A;  4A6N B;  4OPC A;  5EB4 A;  4NEW A;  1E1M A;  4A99 A;  2WEU A;  3AB1 A;  2YVG A;  2H88 A;  2C67 A;  1XPQ A;  1XAN A;  3NKS A;  5BUK A;  2WOI A;  1ZDL A;  3W4K A;  1C0I A;  2PHH A;  4II2 A;  4OVI A;  4B68 A;  3UP5 A;  2YQU A;  2WDR A;  3NLC A;  4NNJ A;  3I3L A;  3O0H A;  4USR A;  3P4P A;  3C96 A;  4GDP A;  1QLB A;  4O5Q A;  1GRF A;  3UKA A;  5KWF A;  3BHF A;  2C73 A;  2RAB A;  3DJJ A;  1IUU A;  4HA6 A;  3P4R A;  1TDE A;  3S61 A;  3AYL A;  1PDH A;  3P9U A;  3QSE A;  1PBE A;  3LJP A;  3DK4 A;  3SZ0 A;  4UDQ A;  2XVJ A;  1AN9 A;  4K8D A;  4H4V A;  1NHR A;  1BGN A;  2E82 A;  4TLX A;  3CN8 A;  4LU6 A;  2R4J A;  1GRE A;  2BRA A;  2GR3 A;  4JY3 A;  5GSN A;  1C0P A;  4NWZ A;  1VDC A;  3CNJ A;  3R9U A;  4O5U A;  1ZK7 A;  1NHP A;  3ZNN A;  4YSX A;  1BGJ A;  3HZL A;  2XFN A;  4H4Q A;  4CRT A;  4EM3 A;  2QA1 A;  2YVF A;  3H4K A;  4JQ9 A;  1NEN A;  4CCQ A;  1ZMD A;  3CNP A;  1PBB A;  1KDG A;  1H6V A;  2QA2 A;  1E1K A;  2WPE A;  3ALL A;  1S2Q A;  3QFB A;  3SM8 A;  3EPT A;  4QFD A;  3NH3 X;  2E5V A;  2Q0K A;  3RP8 A;  2BXS A;  1TRB A;  3DJG X;  4LA1 A;  5M10 A;  4YSY A;  1PJ7 A; 
#chains in the Genus database with same CATH homology
 1F8W A;  3B6D A;  3RNM A;  1KSU A;  1M6I A;  3C4A A;  2R45 A;  1TYT A;  2Q0L A;  4REK A;  3UOY A;  2XVF A;  2BK3 A;  4GUV A;  3UTG A;  2BCP A;  3ISH A;  3FIM B;  1COY A;  2BXR A;  2E1M A;  5DBJ A;  3UKP A;  1QJD A;  1JRZ A;  2Y6R A;  3BNU A;  3H8L A;  5HXI A;  3AE1 A;  4C3X A;  1KF6 A;  3DGZ A;  2TMD A;  4IA5 A;  3DME A;  3GSI A;  3DA1 A;  2R0G A;  3ZNQ A;  4A7A A;  2BS4 A;  4C5O A;  1FL2 A;  2Z5Y A;  4YTN A;  1C0K A;  2GV8 A;  4AOS A;  3T14 A;  5KOX A;  3NYF A;  1BWC A;  5FMH A;  4YJG B;  3SZC A;  1NG4 A;  4A6N A;  1C0L A;  1TDO A;  1GET A;  2XFU A;  1ZKQ A;  4AP1 A;  4YKG A;  4H4U A;  1DOC A;  2B9W A;  4H4T A;  5BUL A;  1CC6 A;  3GD4 A;  3UTE A;  2GH5 A;  4GCM A;  4EIP A;  4J36 A;  3T2Z A;  2ACZ A;  3CMM A;  3FMW A;  2X50 A;  3T2Y A;  4QFC A;  4Z2T A;  1XDI A;  1P2E A;  4JN9 A;  4C74 A;  1CBO A;  5KRQ A;  5FS8 A;  4IA6 A;  4TM0 A;  3GYJ A;  3OC4 A;  2WP6 A;  3II4 A;  4B69 A;  1VQW A;  4EQR A;  1B4V A;  1PBC A;  2BS2 A;  1N1P A;  4CBQ A;  3KLJ A;  2CVJ A;  3QVR A;  3NT6 A;  1X31 B;  2VRM A;  1EL5 A;  4CNK A;  1PXA A;  4GRT A;  2IID A;  3P4S A;  4G9K A;  2YG6 A;  2CFY A;  2GQW A;  3LZX A;  1CJ3 A;  2EQ8 A;  2XVH A;  4OCG A;  4U8K A;  3K7Q X;  2APG A;  1DOE A;  3AE4 A;  3PVC A;  5J7X A;  5TR3 A;  1IJH A;  2ZZB A;  2WP9 A;  2EQ9 A;  4GAP A;  4BK2 A;  2VVL G;  4J57 A;  3KPF A;  5FS6 A;  4PAB A;  5BVA A;  3CGE A;  3KVE A;  3T37 A;  1GRA A;  4H4Z A;  4BUR A;  1EVI A;  3WGT A;  1D4D A;  2YG7 A;  2YAU A;  2VOU A;  3UOV A;  2GR0 A;  3SFE A;  3V3N A;  4E0V A;  1OJC A;  1GAL A;  2XVI A;  1B37 A;  4U2S A;  3UKF A;  3UTH A;  3KPK A;  1D4C A;  1O5W A;  4JNQ A;  2XLT A;  4Z24 A;  3IHM A;  2C75 A;  4DSH A;  4CCR A;  1KSS A;  2V5Z A;  3AE8 A;  3ICS A;  1S2Y A;  2BAC A;  4K5S A;  4U8M A;  3G5R A;  4B63 A;  4FDC B;  1ZX9 A;  2VVL A;  2YWL A;  3UKK A;  2C4C A;  3L1R A;  4D04 A;  2R0P A;  1H83 A;  3WE0 A;  1XHC A;  4X9N A;  2JK6 A;  2X99 A;  4U8J A;  4H4X A;  4WCT A;  3UTF A;  2C66 A;  5JCM A;  3CNT A;  4A9W A;  3CPH G;  2GQF A;  1W4X A;  1JU2 A;  1LTX R;  2C76 A;  1EL7 A;  2H89 A;  2OLO A;  4XXG A;  4NEV A;  1H7X A;  2JKC A;  3AYI A;  2GR2 A;  1FEA A;  3T31 A;  2GF3 A;  1OJT A;  2BK5 A;  1BKW A;  1O95 A;  3DJD A;  1DOD A;  1OJA A;  4C3Y A;  1K0J A;  1DJQ A;  4H4W A;  4K22 A;  5KVI A;  1PS9 A;  2BS3 A;  2YG5 A;  3SQP A;  1JOA A;  4NTC A;  1BZL A;  1IUW A;  1ZY8 A;  2C3C A;  2AAQ A;  3VR9 A;  1KFY A;  4YJD A;  3LXD A;  3ZYX A;  2Z5X A;  2YG3 A;  1HYU A;  1KNR A;  4TM1 A;  3KU9 A;  4RG3 A;  3P4Q A;  3W4I A;  1NHS A;  4KX6 A;  5CKU A;  4Z2R A;  1NDA A;  1GEU A;  3SX6 A;  2RGJ A;  5U25 A;  3ABV A;  3AED A;  3CUK A;  3K30 A;  1TDK A;  3HYX A;  2B7R A;  3AD9 B;  1DDO A;  1RP0 A;  4Z25 A;  4H4P A;  2Y6Q A;  2FBW A;  4I58 A;  2VZ2 A;  3AE7 A;  1QO8 A;  4RG4 A;  1YKJ A;  3URH A;  4B65 A;  1GRH A;  2BCG G;  2JAE A;  4YJF A;  1PXB A;  1F3P A;  2ZBW A;  4A65 A;  3IC9 A;  2FJB A;  2VVM A;  2WU5 A;  3AE9 A;  4EMI A;  1YQ4 A;  3RHA A;  1Y0P A;  4AOX A;  4WX1 A;  3VRD B;  1ELI A;  1NG3 A;  4YSH A;  1FEC A;  1GOS A;  3HYV A;  4K5R A;  1B8S A;  4GR1 A;  5FS7 A;  1AOG A;  2V3B A;  2YLX A;  4CY8 A;  4IVM B;  2WES A;  4Z26 A;  3IHG A;  4NZH A;  1E1L A;  2CDU A;  3VQR A;  1JRX A;  1GSN A;  4H2P A;  4H4R A;  4UDR A;  5M0Z A;  5JCI A;  3BI4 A;  3V76 A;  1JNZ A;  5U1O A;  2YVJ A;  3NNE A;  3W4J A;  4YJH A;  3NIX A;  3Q6J A;  4APN A;  3NHO X;  3LB8 A;  4Y4M A;  4H4S A;  4UDP A;  3CGB A;  1H81 A;  4PAA A;  1CC4 A;  4OPU A;  3KA7 A;  3RED A;  3PO7 A;  4YT0 A;  3ZNP A;  3NYE A;  1H84 A;  2OAL A;  3ATR A;  3UKQ A;  2B9Y A;  1GT8 A;  2WBA A;  3DJE A;  1O94 A;  2A89 A;  4U2L A;  1S3E A;  1TYP A;  3G5S A;  3VR8 A;  1L9E A;  4CNJ A;  2Q6U A;  1GXF A;  5IQ4 A;  4J2W A;  4ZCC A;  3G3E A;  1K4Q A;  3UOZ A;  2BC1 A;  1S3B A;  4BJZ A;  1NAA A;  2BYB A;  2BRY A;  5KMR A;  1Y56 B;  1V59 A;  2XLU A;  3BHK A;  1JEH A;  2OLN A;  1LQT A;  2R9Z A;  3Q9T A;  2X8G A;  3ZDN A;  3QJ4 A;  4H2N A;  4EIQ A;  2JB1 A;  4FX9 A;  1D4E A;  2Q7V A;  2V6O A;  3AEF A;  3JSK A;  1GRT A;  4NTE A;  4EQS A;  3SFD A;  2GVC A;  1Z6L A;  3AE3 A;  4JNA A;  5JCN A;  2GAH B;  4JY2 A;  2E4G A;  4J33 A;  3L8K A;  1NEK A;  2ARD A;  3K7M X;  2JB2 A;  3E1T A;  2GB0 A;  3GYI A;  1H82 A;  1PJ5 A;  2V60 A;  1SEZ A;  4OPT A;  3RP7 A;  3AE5 A;  3IWA A;  3P1W A;  3M13 A;  2C3D A;  2ZZ0 A;  2JBV A;  2EQ7 A;  2BK4 A;  1PJ6 A;  1F6M A;  2NVK X;  1CHU A;  4EM4 A;  2QCU A;  4Y4N A;  2C64 A;  1D7Y A;  3CPJ G;  2YM2 A;  1ZOY A;  2B9X A;  3H8I A;  1EL9 A;  2WDV A;  1CF3 A;  3GMC A;  3F8R A;  2WU2 A;  5KMP A;  4ICY A;  3OZ2 A;  1Q1W A;  1GER A;  3UOX A;  4DSG A;  3PS9 A;  1CJ2 A;  2DU8 A;  1TDF A;  1VG0 A;  1ZP0 A;  3GD3 A;  4FK1 C;  4YTM A;  1YQ3 A;  4OPL A;  4A5L A;  1OJD A;  1EBD A;  3SZW A;  1B5Q A;  1GND A;  3ALM A;  3AEC A;  4FK1 A;  1MO9 A;  1D5T A;  2OA1 A;  4N9X A;  3S5W A;  2NPX A;  2X8H A;  4Z44 A;  5ER0 A;  3GYX A;  2YM1 A;  2AQJ A;  2W0H A;  4GDE A;  5KXJ A;  4YJG A;  5L46 A;  4KPR A;  2OAM A;  2YLW A;  2YR4 A;  2VQ7 A;  5BRT A;  3ATQ A;  3V3O A;  1P2H A;  2XLP A;  2XLR A;  2BA9 A;  5KNL A;  1E6E A;  3FPZ A;  4K7Z A;  2XFQ A;  3GRT A;  4IV9 A;  5JCK A;  4B1B A;  3KKJ A;  4H7U A;  5C2T A;  2DKI A;  1IUS A;  1CJC A;  2GMH A;  3CIR A;  2FJA A;  1VG9 A;  3GMB A;  2VQB A;  3M0O A;  3UKH A;  2B76 A;  3ICR A;  3AE6 A;  3K7T A;  5KVH A;  3CGD A;  2A8X A;  2EQ6 A;  4J56 A;  1PHH A;  3DK8 A;  5HHF A;  4B66 A;  1NHQ A;  3NYC A;  4XWZ A;  1UKV G;  4YXD A;  4TM3 A;  4LII A;  2XVE A;  4H2R A;  4H4Y A;  1PBD A;  5U63 A;  1DJN A;  5KMQ A;  4B67 A;  2YLS A;  4MJW A;  2WHD A;  1H7W A;  4NTD A;  4OPI A;  4A79 A;  3QFA A;  4C77 A;  4Y4L A;  3ALJ A;  3NK2 X;  3AEE A;  4YWO A;  2YG4 A;  4U2T A;  4B64 A;  1L9C A;  3NGC X;  4BK3 A;  1REO A;  4BJY A;  2FJE A;  2YR5 A;  1LQU A;  3D8X A;  2GRT A;  3I6D A;  4BK1 A;  4UP3 A;  3FBS A;  1GTE A;  3CPI G;  1L0V A;  1H86 A;  3NRN A;  1MXT A;  1JNR A;  4EMJ A;  2WP5 A;  3RP6 A;  2E49 A;  3ADA B;  1GV4 A;  4JDR A;  4YSZ A;  1D7L A;  4HB9 A;  1L9D A;  3AEA A;  1MOK A;  3F8P A;  4U8N A;  2QAE A;  3EAO A;  4EQX A;  1CJ4 A;  1DXL A;  2HQM A;  3BI5 A;  2GMJ A;  2DKH A;  2WPC A;  1KIF A;  1PXC A;  4IVO B;  3G5Q A;  3C4N A;  1LPF A;  4OPG A;  2XCG A;  4H2Q A;  3ZNO A;  3T0K A;  4ZN0 A;  3IF9 A;  3GDN A;  1N4U A;  3T2K A;  4TLZ A;  4USQ A;  2V3A A;  3LAD A;  4G6H A;  3CTY A;  4H50 A;  3GRS A;  4D03 A;  5J60 A;  2RGO A;  5KOW A;  3GDP A;  4GAV A;  4G74 A;  5HY5 A;  1GPE A;  1ZMC A;  2GAG B;  3QVP A;  1E1N A;  3NTD A;  1KNP A;  1LVL A;  3AYJ A;  1K0L A;  3AD7 B;  4BV6 A;  4EQW A;  4Z2U A;  2YR6 A;  1LV0 A;  2BC0 A;  2WOV A;  2PYX A;  3AEG A;  3LZW A;  1E7P A;  1GRB A;  4AT2 A;  2WPF A;  1F8R A;  2ZZC A;  2UZZ A;  2IVD A;  3UCL A;  2C72 A;  2WET A;  1VE9 A;  1M64 A;  5CQF A;  4DGK A;  3BI2 A;  4X4J A;  2E4A A;  2B7S A;  2XFP A;  3GWD A;  4J31 A;  2FJD A;  1JRY A;  1OJ9 A;  5IQ1 A;  2V61 A;  1RYI A;  2CUL A;  3AE2 A;  2J3N A;  3B3R A;  2YLZ A;  1Q1R A;  1TDN A;  3NG7 X;  3EAN A;  4ZCD A;  2WQY A;  5EOW A;  2GR1 A;  1K0I A;  3DK9 A;  3M12 A;  3VRB A;  1PN0 A;  1CL0 A;  2TPR A;  3NN0 X;  3SYI A;  5HYM A;  1BF3 A;  3BNM A;  5IPY A;  1VRQ B;  2XYO A;  3CNS A;  4AP3 A;  4YTP A;  2O9Z A;  4G73 A;  4U8I A;  3QSS A;  4P9S A;  4K2X A;  4X9M A;  2C65 A;  3FG2 P;  4U8O A;  4G6G A;  4Z43 A;  2R0C A;  3AD8 B;  5EBK A;  5LV9 A;  2WOW A;  1IUX A;  2RGH A;  1FEB A;  2X8C A;  2XDO A;  2XFO A;  2AR8 A;  3EF6 A;  4OPD A;  5GRT A;  3VRA A;  4II3 A;  2VRL A;  4ADW A;  4XWR A;  4EMW A;  3SY4 A;  4GF7 A;  1F8S A;  5KMS A;  3D1C A;  1RSG A;  1N4V A;  4YKF A;  3SXI A;  2YLT A;  5C3J A;  3NN6 X;  1ONF A;  3HYW A;  3UP4 A;  4AT0 A;  3ICT A;  4ECH A;  3DH9 A;  2R4E A;  2C70 A;  1DAO A;  3F8D A;  4CY6 A;  3NTA A;  1FOH A;  4YJF B;  4U8P A;  3SGL A;  1YY5 A;  2F5Z A;  1IUV A;  2E48 A;  2WDQ A;  2IVE A;  1CC2 A;  1Q9I A;  1PBF A;  1IUT A;  2X3N A;  1EL8 A;  3AEB A;  2BAB A;  1ZOV A;  5EB5 A;  3NK1 X;  3SZF A;  3KD9 A;  1GRG A;  3CND A;  4TM4 A;  5FS9 A;  2C7G A;  3CGC A;  1GTH A;  4DNA A;  3LOV A;  4J34 A;  3GWF A;  3AWI A;  2GEW A;  2JB3 A;  3NK0 X;  1FCD A;  2WS3 A;  2YLR A;  1DOB A;  1NPX A;  3QSM A;  4YJH B;  1LJ1 A;  2A87 A;  2XLS A;  3DGH A;  3AXB A;  4M52 A;  2I0Z A;  5JCL A;  1DNC A;  4I59 A;  3UKL A;  1Y56 A;  4U8L A;  3ITJ A;  3COX A;  4RSL A;  1GES A;  1N4W A;  2R46 A;  1E39 A;  1YQZ A;  4A6N B;  4OPC A;  5EB4 A;  4NEW A;  1E1M A;  4A99 A;  2WEU A;  3AB1 A;  2YVG A;  2H88 A;  2C67 A;  1XPQ A;  1XAN A;  3NKS A;  5BUK A;  2WOI A;  1ZDL A;  3W4K A;  1C0I A;  2PHH A;  4II2 A;  4OVI A;  4B68 A;  3UP5 A;  2YQU A;  2WDR A;  3NLC A;  4NNJ A;  3I3L A;  3O0H A;  4USR A;  3P4P A;  3C96 A;  4GDP A;  1QLB A;  4O5Q A;  1GRF A;  3UKA A;  5KWF A;  3BHF A;  2C73 A;  2RAB A;  3DJJ A;  1IUU A;  4HA6 A;  3P4R A;  1TDE A;  3S61 A;  3AYL A;  1PDH A;  3P9U A;  3QSE A;  1PBE A;  3LJP A;  3DK4 A;  3SZ0 A;  4UDQ A;  2XVJ A;  1AN9 A;  4K8D A;  4H4V A;  1NHR A;  1BGN A;  2E82 A;  4TLX A;  3CN8 A;  4LU6 A;  2R4J A;  1GRE A;  2BRA A;  2GR3 A;  4JY3 A;  5GSN A;  1C0P A;  4NWZ A;  1VDC A;  3CNJ A;  3R9U A;  4O5U A;  1ZK7 A;  1NHP A;  3ZNN A;  4YSX A;  1BGJ A;  3HZL A;  2XFN A;  4H4Q A;  4CRT A;  4EM3 A;  2QA1 A;  2YVF A;  3H4K A;  4JQ9 A;  1NEN A;  4CCQ A;  1ZMD A;  3CNP A;  1PBB A;  1KDG A;  1H6V A;  2QA2 A;  1E1K A;  2WPE A;  3ALL A;  1S2Q A;  3QFB A;  3SM8 A;  4QFD A;  3EPT A;  3NH3 X;  2E5V A;  2Q0K A;  2BXS A;  3DJG X;  1TRB A;  4LA1 A;  3RP8 A;  5M10 A;  4YSY A;  1PJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...