3DMEA

Crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
366
Chain Sequence
b'TDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved exported protein
publication title Crystal structure of conserved exported protein from Bordetella pertussis. NorthEast Structural Genomics target BeR141
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
total genus 110
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3dmeA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dmeA01
4OPDA 4A65A 3NYEA 1XPQA 1GNDA 3V3OA 4Z2RA 3BHKA 2BYBA 1IUTA 4IV9A 2R0CA 1DOBA 1TDOA 5FS9A 1C0LA 3GD4A 2XCGA 3RNMA 4H2QA 3UOYA 1H6VA 2XLUA 4GRTA 4QFDA 2XVJA 4U8IA 3D1CA 4YSZA 1JNZA 4YJHA 3AEBA 2YLWA 2EQ8A 1JU2A 4RG4A 1YY5A 3KD9A 2E49A 2B76A 4REKA 1KFYA 4OPGA 4Z43A 1S3BA 1B4VA 1CHUA 4DNAA 3ZNNA 1VG0A 2YVGA 4OVIA 4N9XA 5C3JA 1L9DA 4EQWA 3DK8A 4TM4A 3D8XA 3NTDA 2EQ9A 1GRTA 4PABA 4YTNA 3CNPA 4HA6A 3SM8A 2APGA 4GCMA 2GR3A 4UDQA 3UTFA 3CNSA 1BGJA 2RGOA 3FBSA 4FX9A 3VR9A 5J7XA 4BK1A 2UZZA 4WCTA 3DH9A 4YSYA 1LVLA 2BCGG 1MO9A 1UKVG 4LA1A 3NK0X 3FG2P 3REDA 3Q6JA 1RYIA 3AE6A 3G3EA 3GSIA 2GV8A 3P9UA 1L0VA 1PBCA 2C64A 1NHSA 2GEWA 3B3RA 4BJYA 4U8MA 3I6DA 1H86A 5BUKA 3GYIA 1E1LA 1K0JA 1LJ1A 2XFPA 4EMIA 1QO8A 2BACA 2WPCA 1ZKQA 4JNAA 3M0OA 3QVPA 3AXBA 4TM0A 3UCLA 1LV0A 3H8LA 2WETA 5JCKA 2OLNA 3F8RA 3ICSA 1KSSA 2XLTA 5HYMA 3R9UA 3NH3X 4H4TA 3KPFA 1DOCA 1D4CA 1S2YA 3AE3A 3B6DA 3LXDA 1GETA 2X99A 1Y56B 2C75A 1E39A 3WE0A 4B69A 4YJGB 2ZZCA 1PBDA 1GRBA 3AE4A 2GRTA 2YVJA 4ADWA 1DNCA 3M12A 3BHFA 1E7PA 1PBBA 1VE9A 1TRBA 4U2SA 3G5SA 4ZCCA 2YG7A 2YG6A 2C3CA 4B67A 1VRQB 1GPEA 1CJ4A 1H81A 3CGEA 3ISHA 3G5QA 1NHQA 2B7RA 2AR8A 2BS4A 2HQMA 1NENA 2ZZBA 4A6NB 1P2HA 3NK2X 5C2TA 1C0IA 4BV6A 2GMJA 1RP0A 2YLTA 4AT2A 1TYTA 2F5ZA 1REOA 2DKIA 2OA1A 2PYXA 1O5WA 3ABVA 3C4AA 4EQXA 3WGTA 3DA1A 2H88A 4U2LA 2I0ZA 4EIQA 1GRGA 2E1MA 2YAUA 5FS6A 2FJEA 4M52A 1TYPA 3P4QA 4NEVA 1GTEA 1EL7A 3CUKA 2BABA 1GRFA 2YM1A 3KKJA 2E5VA 1COYA 4GF7A 4H4PA 1CC4A 2YLZA 1ZOVA 2BXRA 1RSGA 2Y6RA 3KU9A 3P4PA 3OZ2A 1TDFA 2FJDA 2WHDA 5BRTA 1GOSA 2OAMA 1CJ3A 1PHHA 1DJQA 1NDAA 3LB8A 1YQ3A 3GWFA 2AAQA 1CC6A 2C76A 4DSHA 1FEBA 2Q6UA 1OJ9A 4AOSA 3CGBA 3AE7A 3IHGA 3RHAA 1F8WA 3SGLA 3NIXA 1GT8A 4J2WA 1YQZA 2GH5A 4J33A 4J31A 2E82A 2WP6A 1GEUA 4U8JA 4YTMA 1MXTA 3NGCX 5KXJA 4EM3A 3M13A 3UKFA 1ZDLA 1KSUA 2WPEA 2V6OA 4BK3A 1H84A 2X50A 2ARDA 4H2RA 2WQYA 4A7AA 3DJEA 3NYCA 3G5RA 5U63A 4PAAA 1EL9A 1LPFA 4KX6A 3K30A 3W4IA 4APNA 3NG7X 4DSGA 1NG4A 3K7MX 1JOAA 4Y4MA 3BNUA 2ACZA 1EVIA 4UDRA 4JN9A 4Z2TA 1EL5A 3URHA 3IF9A 4JQ9A 4H4SA 1CBOA 4K5SA 3AYJA 3AYLA 1QLBA 4FK1C 4YJDA 1D4EA 2Y6QA 3L8KA 1KIFA 2CULA 4K5RA 4TM1A 3UKLA 5CKUA 4A5LA 4U8NA 4QFCA 2R0PA 4UP3A 3ICRA 3KA7A 2WESA 2DU8A 3UKPA 3GDNA 1EBDA 1OJCA 4TLZA 4B65A 4EM4A 3AD8B 3DJDA 3AEDA 3COXA 3H4KA 4UDPA 2RGJA 4X9MA 2VVLG 4CY8A 3NT6A 1C0KA 1JNRA 4YJFA 1N4UA 1SEZA 1XDIA 1GERA 1BGNA 1QJDA 2C70A 1L9EA 1W4XA 1K4QA 2YR5A 2ZZ0A 4OPLA 5FMHA 4AT0A 5IQ1A 2A8XA 5DBJA 3CGDA 2R0GA 5EOWA 1F3PA 4YSHA 1JEHA 2CDUA 1LQTA 3AD7B 4H4UA 1VG9A 3UOXA 4EMWA 1ZY8A 3EPTA 1IUVA 4H2PA 4IVOB 4P9SA 4JDRA 2JK6A 1H7XA 3AE2A 3QJ4A 5GRTA 3VQRA 2WDQA 2O9ZA 5HXIA 1DODA 1TDKA 2YQUA 3GDPA 4B66A 5EB4A 5HHFA 4DGKA 1H7WA 2QA2A 3ZNPA 2QA1A 1ZMDA 1ZK7A 4NTDA 3DJJA 3P4RA 5KWFA 5JCIA 4RSLA 4AOXA 2C72A 3GRSA 1IJHA 4B1BA 4Z44A 3W4JA 3FPZA 4B68A 1PXBA 3EF6A 2A89A 2TMDA 3C96A 3GD3A 2WU2A 1IUSA 4CCQA 3GMCA 1CL0A 2VZ2A 5JCNA 1HYUA 3F8DA 2E4AA 4BK2A 1IUUA 1PJ7A 1O94A 4GDPA 3UTGA 3AE1A 2XFOA 2VQ7A 3DGHA 1PJ6A 1KF6A 1D7LA 4GUVA 1PBFA 4YJHB 2WPFA 4H7UA 4A99A 3AECA 1EL8A 1KNPA 2JKCA 3BI5A 4H50A 3DJGX 3QVRA 2C67A 1XANA 2C66A 1BKWA 4NEWA 3CNTA 2XFQA 3AE8A 4NTEA 3UP5A 3ADAB 4H4YA 1B5QA 2B7SA 2V3BA 1MOKA 4B64A 1VQWA 1DOEA 2WU5A 1ZOYA 4J36A 2JBVA 5TR3A 2DKHA 1FECA 3ITJA 2NVKX 4YTPA 2CVJA 3IWAA 3CPHG 4I58A 3ZNOA 2WP9A 2YG4A 1C0PA 3NKSA 4KPRA 1TDNA 2FBWA 3UKQA 1K0IA 2VRLA 1CJCA 2XVEA 3PO7A 3AEAA 3LADA 4H4XA 1D4DA 4OPUA 1CC2A 4YWOA 2XLPA 2RABA 1E6EA 1VDCA 4X4JA 3SQPA 1ZMCA 4H2NA 2GMHA 4FDCB 4ZCDA 1LTXR 2X8CA 2FJBA 3NK1X 3AD9B 4JY3A 4Y4LA 4A9WA 1PBEA 2BS2A 1YKJA 1F6MA 2WEUA 3GRTA 2WOIA 3GWDA 4YJFB 4HB9A 4TM3A 2FJAA 1YQ4A 2GAGB 3K7QX 3IHMA 3NTAA 4CY6A 2E48A 3Q9TA 4YXDA 1Q1RA 2WOWA 3CNDA 3OC4A 4CBQA 1FL2A 1GV4A 1OJDA 2QCUA 2OLOA 1S2QA 3NNEA 2R9ZA 3UTHA 2JAEA 4YKGA 4U8LA 4K2XA 3VRBA 5KOWA 4EQSA 2R45A 1GSNA 1N1PA 2YR6A 2C7GA 2R4JA 1GREA 2WP5A 2JB2A 3I3LA 4B63A 3II4A 2X8GA 3L1RA 4XWRA 1AN9A 4OCGA 2WS3A 3AB1A 4K22A 3LJPA 1NPXA 3CGCA 3F8PA 1Q1WA 1LQUA 2YLXA 4NZHA 2PHHA 1GRAA 4H4VA 4AP1A 3GYJA 3K7TA 3ZNQA 4O5UA 1S3EA 3RP8A 4CCRA 4EQRA 4YSXA 2XDOA 1B37A 2VQBA 4BJZA 1JRZA 2R46A 1GESA 1N4WA 1KDGA 3ALLA 1FEAA 4LIIA 4Y4NA 2VOUA 2VVLA 4OPIA 4A6NA 1NEKA 2WBAA 4O5QA 5J60A 2IVEA 4Z2UA 3EANA 1PXAA 3ALJA 3NRNA 5FS7A 5GSNA 4ZN0A 3NYFA 2IVDA 2YLSA 1P2EA 2BK3A 2B9XA 3IC9A 3C4NA 2V5ZA 4U8OA 3CIRA 1IUXA 4E0VA 1NAAA 2EQ7A 2GQWA 2WDVA 2XVIA 5CQFA 4FK1A 1DXLA 3BNMA 3PVCA 4C77A 3AE9A 1NHRA 2Q7VA 2GAHB 3FMWA 4MJWA 3RP6A 2GR0A 2TPRA 3UKHA 2XFUA 3HZLA 4Z25A 2BCPA 1GALA 5EB5A 4XWZA 5U25A 1D5TA 3QSSA 3LZXA 1FOHA 5BULA 1PJ5A 1X31B 2GVCA 3VR8A 2XLSA 4X9NA 4Z24A 2B9YA 3P1WA 3UOZA 4BURA 2H89A 1M6IA 2XFNA 2Z5YA 2X3NA 2BC0A 1AOGA 2GR2A 1O95A 4GDEA 2BK4A 3NN0X 4OPCA 2AQJA 3AEEA 1FCDA 4ICYA 2NPXA 1ZP0A 4K7ZA 5BVAA 3PS9A 5KVHA 4RG3A 3ATRA 4D04A 2V60A 1JRYA 3VRDB 1CF3A 2JB1A 3QFAA 1H83A 5M0ZA 1ZX9A 1PN0A 4TLXA 2R4EA 3NN6X 3ATQA 3CTYA 4WX1A 2V61A 2A87A 4AP3A 4U2TA 3UP4A 1GXFA 4IVMB 2XLRA 3DMEA 4NTCA 2QAEA 2E4GA 4H4WA 3ZYXA 4JNQA 3BI4A 1OJAA 4U8KA 3LOVA 4YKFA 3SFDA 3DK4A 2XYOA 4H4RA 1PDHA 2GR1A 1OJTA 5ER0A 1BWCA 4LU6A 2C73A 3S61A 2JB3A 1CJ2A 4I59A 3CPIG 4H4ZA 3FIMB 3AWIA 1JRXA 4XXGA 2Q0LA 2YWLA 4J34A 4C3XA 4CRTA 2YM2A 4CNJA 3DGZA 5HY5A 1ELIA 1N4VA 3ZDNA 1XHCA 5IPYA 4USRA 3P4SA 2VRMA 2YG5A 1TDEA 2RGHA 2GQFA 1GTHA 3AE5A 4GR1A 1BF3A 2W0HA 4EIPA 2WDRA 4K8DA 3W4KA 3QFBA 3V76A 2IIDA 3ICTA 1M64A 2Q0KA 4C3YA 4Z26A 2BC1A 3O0HA 4C5OA 3KVEA 2XVHA 4USQA 1ONFA 2BK5A 2V3AA 5FS8A 2GB0A 2YG3A 1BZLA 1IUWA 3QSMA 3CPJG 3UOVA 3VRAA 2GF3A 3AEFA 1Q9IA 3QSEA 4J56A 3LZWA 4H4QA 3JSKA 3DK9A 3UKAA 1L9CA 2BXSA 2C3DA 1PXCA 2YVFA 4C74A 1Z6LA 3NLCA 3CNJA 3SFEA 1PS9A 2ZBWA 5KRQA 4YT0A 5M10A 3T37A 4D03A 3EAOA 1GRHA 1H82A 5U1OA 1DAOA 1V59A 2OALA 2C65A 3ALMA 1E1NA 4CNKA 3CN8A 4A79A 3H8IA 1K0LA 1KNRA 5JCMA 5EBKA 1Y0PA 4OPTA 3NHOX 1NHPA 1DDOA 1F8RA 1DJNA 1E1MA 4IA5A 4ECHA 2B9WA 2WOVA 2XVFA 2X8HA 5LV9A 3RP7A 2YR4A 1Y56A 1D7YA 3KLJA 1B8SA 4IA6A 3UTEA 2VVMA 5JCLA 2BS3A 4YJGA 2J3NA 5KOXA 3AEGA 3UKKA 5IQ4A 5L46A 1NG3A 2YLRA 1E1KA 1F8SA 3GMBA 4J57A 2EQ6A 2BA9A 4JY2A 3V3NA 3E1TA 5KVIA 2CFYA 4U8PA 3AYIA 3BI2A 3S5WA 4EMJA 2Z5XA
chains in the Genus database with same CATH superfamily
4OPDA 4A65A 3NYEA 1XPQA 1GNDA 3SZ0A 3V3OA 4Z2RA 3BHKA 2BYBA 1IUTA 4IV9A 2R0CA 1DOBA 1TDOA 5FS9A 1C0LA 3GD4A 2XCGA 3RNMA 4H2QA 3UOYA 1H6VA 2XLUA 4GRTA 4QFDA 2XVJA 4U8IA 3D1CA 4YSZA 1JNZA 4YJHA 3AEBA 2YLWA 2EQ8A 1JU2A 4G6HA 4RG4A 1YY5A 3KD9A 2E49A 2B76A 4REKA 1KFYA 4OPGA 4Z43A 1S3BA 1B4VA 1CHUA 4DNAA 3ZNNA 1VG0A 2YVGA 4OVIA 4N9XA 5C3JA 1L9DA 4EQWA 3DK8A 4TM4A 3D8XA 3NTDA 2EQ9A 1GRTA 4PABA 4YTNA 3CNPA 4HA6A 3SM8A 2APGA 4GCMA 2GR3A 4UDQA 3UTFA 3CNSA 1BGJA 2RGOA 3FBSA 4FX9A 3VR9A 5J7XA 4BK1A 2UZZA 4WCTA 3DH9A 4YSYA 1LVLA 2BCGG 1MO9A 1UKVG 4LA1A 3NK0X 3FG2P 3REDA 3Q6JA 1RYIA 3AE6A 3G3EA 3GSIA 2GV8A 3P9UA 1L0VA 1PBCA 4BJYA 1NHSA 2C64A 2GEWA 3B3RA 4U8MA 3I6DA 1H86A 5BUKA 3GYIA 1E1LA 4G73A 1K0JA 1LJ1A 2XFPA 4EMIA 1QO8A 2BACA 2WPCA 1ZKQA 4JNAA 3M0OA 3QVPA 3AXBA 4TM0A 3UCLA 1LV0A 3H8LA 2WETA 5JCKA 2OLNA 3F8RA 3ICSA 1KSSA 4NNJA 2XLTA 5HYMA 3R9UA 3NH3X 4H4TA 3KPFA 1DOCA 1D4CA 1S2YA 3AE3A 3B6DA 3LXDA 3SX6A 1GETA 2X99A 1Y56B 2C75A 1E39A 3WE0A 4B69A 4YJGB 2ZZCA 1PBDA 1GRBA 3AE4A 2GRTA 2YVJA 4GAVA 4ADWA 1DNCA 3M12A 3BHFA 1E7PA 1PBBA 1VE9A 1TRBA 4U2SA 3G5SA 4ZCCA 2YG7A 2YG6A 2C3CA 4B67A 1VRQB 1GPEA 1CJ4A 1H81A 3CGEA 3ISHA 3G5QA 1NHQA 2B7RA 2AR8A 2BS4A 2HQMA 5KMPA 1NENA 2ZZBA 4A6NB 1P2HA 3NK2X 5C2TA 1C0IA 4BV6A 2GMJA 1RP0A 2YLTA 4AT2A 1TYTA 2F5ZA 1REOA 2DKIA 2OA1A 2PYXA 3C4AA 1O5WA 3ABVA 4EQXA 3WGTA 3DA1A 2H88A 4U2LA 2I0ZA 4EIQA 1GRGA 2E1MA 2YAUA 5FS6A 2FJEA 4M52A 1TYPA 2C4CA 3P4QA 1GTEA 1EL7A 3CUKA 2BABA 4NEVA 1GRFA 2YM1A 3KKJA 2E5VA 4GF7A 1COYA 4H4PA 1CC4A 2YLZA 1ZOVA 2BXRA 1RSGA 2Y6RA 3KU9A 3P4PA 3OZ2A 1TDFA 2FJDA 2WHDA 5BRTA 1GOSA 2OAMA 1CJ3A 3HYVA 1PHHA 1DJQA 1NDAA 3SYIA 3LB8A 1YQ3A 3GWFA 2AAQA 1CC6A 2C76A 4DSHA 1FEBA 2Q6UA 3T14A 1OJ9A 4AOSA 3CGBA 3AE7A 3IHGA 3RHAA 1F8WA 3SGLA 3NIXA 1GT8A 4J2WA 1YQZA 2GH5A 4J33A 4J31A 2E82A 2WP6A 1GEUA 4U8JA 4YTMA 1MXTA 4G74A 3NGCX 5KXJA 4NWZA 4EM3A 3M13A 3UKFA 1ZDLA 4BK3A 1KSUA 2V6OA 2WPEA 1H84A 2X50A 4H2RA 2ARDA 2WQYA 4A7AA 3DJEA 3NYCA 3G5RA 5U63A 4PAAA 1EL9A 1LPFA 4KX6A 3K30A 3W4IA 4APNA 3NG7X 4DSGA 1NG4A 3K7MX 1JOAA 4Y4MA 3BNUA 2ACZA 1EVIA 4UDRA 4JN9A 4Z2TA 1EL5A 3URHA 3IF9A 4JQ9A 4H4SA 1CBOA 4K5SA 3AYJA 3AYLA 1QLBA 4FK1C 4YJDA 1D4EA 2Y6QA 3L8KA 1KIFA 2CULA 4K5RA 4TM1A 3UKLA 5CKUA 4A5LA 4U8NA 4QFCA 2R0PA 4UP3A 3ICRA 3KA7A 2WESA 2DU8A 3UKPA 3GDNA 1EBDA 1OJCA 4TLZA 4B65A 4EM4A 3AD8B 3DJDA 3AEDA 3COXA 3H4KA 4UDPA 2RGJA 4X9MA 2VVLG 4CY8A 3NT6A 1C0KA 1JNRA 4YJFA 1N4UA 1GERA 1BGNA 1SEZA 1XDIA 1QJDA 2C70A 1L9EA 1W4XA 1K4QA 2YR5A 2ZZ0A 4OPLA 5FMHA 4AT0A 5IQ1A 2A8XA 5DBJA 3CGDA 2R0GA 5EOWA 1F3PA 3SZFA 4YSHA 5KMSA 1JEHA 2CDUA 1LQTA 3AD7B 4H4UA 1VG9A 3UOXA 4EMWA 3EPTA 1ZY8A 1IUVA 4H2PA 4IVOB 4P9SA 4JDRA 2JK6A 1H7XA 3AE2A 3QJ4A 5GRTA 3VQRA 2WDQA 2O9ZA 5HXIA 1DODA 1TDKA 2YQUA 3GDPA 4B66A 5EB4A 5HHFA 4DGKA 1H7WA 2QA2A 3ZNPA 2QA1A 1ZMDA 1ZK7A 4NTDA 3DJJA 3P4RA 5KWFA 5JCIA 4RSLA 4AOXA 2C72A 3GRSA 1IJHA 4B1BA 4Z44A 3W4JA 3FPZA 4B68A 3HYXA 1PXBA 3EF6A 2A89A 3C96A 2TMDA 3GD3A 2WU2A 1IUSA 4CCQA 3GMCA 1CL0A 2VZ2A 5JCNA 1HYUA 3F8DA 2E4AA 4BK2A 1IUUA 1PJ7A 1O94A 4GDPA 3UTGA 3AE1A 2XFOA 2VQ7A 3DGHA 3T31A 1PJ6A 1KF6A 1D7LA 4GUVA 1PBFA 4YJHB 2WPFA 4H7UA 4A99A 3AECA 1EL8A 1KNPA 2JKCA 3BI5A 4H50A 3DJGX 3QVRA 2C67A 1XANA 2C66A 1BKWA 4NEWA 3CNTA 2XFQA 3AE8A 4NTEA 3UP5A 3ADAB 4H4YA 1B5QA 2B7SA 2V3BA 1MOKA 2BRAA 4B64A 1VQWA 5KMQA 4II2A 3SZCA 1DOEA 2WU5A 1ZOYA 4J36A 2JBVA 5TR3A 2DKHA 1FECA 3ITJA 2NVKX 4YTPA 2CVJA 3IWAA 3CPHG 4I58A 3ZNOA 2WP9A 2YG4A 1C0PA 3NKSA 4KPRA 1TDNA 2FBWA 3UKQA 1K0IA 2VRLA 1CJCA 2XVEA 3PO7A 3AEAA 3LADA 4H4XA 1D4DA 4OPUA 1CC2A 4YWOA 2XLPA 2RABA 1E6EA 1VDCA 4X4JA 3SQPA 1ZMCA 4H2NA 2GMHA 4FDCB 4ZCDA 1LTXR 2X8CA 2FJBA 3NK1X 3AD9B 4JY3A 4Y4LA 4A9WA 1PBEA 2BS2A 1YKJA 1F6MA 2WEUA 3GRTA 2WOIA 3GWDA 4YJFB 4HB9A 4TM3A 2FJAA 1YQ4A 2GAGB 3K7QX 3IHMA 3NTAA 4CY6A 2E48A 3Q9TA 4YXDA 1Q1RA 2WOWA 3CNDA 3OC4A 4CBQA 1FL2A 1GV4A 1OJDA 2QCUA 2OLOA 1S2QA 3NNEA 2R9ZA 3UTHA 2JAEA 4YKGA 4U8LA 4GAPA 4K2XA 3VRBA 5KOWA 4EQSA 2R45A 3HYWA 1GSNA 1N1PA 2YR6A 3SZWA 2C7GA 2R4JA 1GREA 2WP5A 2JB2A 3I3LA 4B63A 3II4A 2X8GA 3L1RA 4XWRA 1AN9A 4OCGA 2WS3A 3AB1A 4K22A 3LJPA 1NPXA 3CGCA 3F8PA 1Q1WA 1LQUA 2YLXA 4NZHA 2PHHA 1GRAA 5KMRA 4H4VA 4AP1A 3GYJA 3K7TA 3ZNQA 4O5UA 1S3EA 3RP8A 4CCRA 4EQRA 4YSXA 2XDOA 4BJZA 1B37A 2VQBA 1JRZA 2R46A 3ALLA 1N4WA 1GESA 1KDGA 1FEAA 4LIIA 4Y4NA 2VOUA 2VVLA 4OPIA 4A6NA 1NEKA 2WBAA 4O5QA 5J60A 2IVEA 4Z2UA 3EANA 1PXAA 3ALJA 3NRNA 5FS7A 5GSNA 4ZN0A 3NYFA 2IVDA 2YLSA 1P2EA 4II3A 2BK3A 2B9XA 3IC9A 3C4NA 2V5ZA 4U8OA 3CIRA 1IUXA 4E0VA 1NAAA 2EQ7A 2GQWA 2WDVA 2XVIA 5CQFA 4FK1A 1DXLA 3BNMA 3PVCA 4C77A 3AE9A 1NHRA 2Q7VA 2GAHB 3FMWA 4G9KA 4MJWA 3RP6A 2GR0A 2TPRA 3T0KA 3T2KA 3UKHA 2XFUA 3T2YA 3HZLA 3GYXA 4Z25A 2BCPA 1GALA 5EB5A 4XWZA 5U25A 1D5TA 3QSSA 3LZXA 1FOHA 5BULA 1PJ5A 1X31B 2GVCA 3VR8A 2XLSA 4X9NA 4Z24A 2B9YA 3P1WA 3UOZA 4BURA 2H89A 1M6IA 2XFNA 2Z5YA 2X3NA 2BC0A 1AOGA 2GR2A 1O95A 4GDEA 2BK4A 3NN0X 4OPCA 2AQJA 3AEEA 1FCDA 4ICYA 2NPXA 1ZP0A 4K7ZA 5BVAA 3PS9A 5KVHA 4RG3A 3ATRA 4D04A 2V60A 1JRYA 3VRDB 1CF3A 2JB1A 3QFAA 1H83A 5M0ZA 3SXIA 1ZX9A 1PN0A 4TLXA 2R4EA 3NN6X 3ATQA 3CTYA 4WX1A 2V61A 2A87A 4AP3A 4U2TA 3UP4A 1GXFA 4IVMB 2XLRA 3DMEA 4NTCA 3SY4A 2QAEA 2E4GA 4H4WA 3ZYXA 4JNQA 3BI4A 1OJAA 4U8KA 3LOVA 4YKFA 3SFDA 3DK4A 2XYOA 4H4RA 1PDHA 3CMMA 2GR1A 1OJTA 5ER0A 1BWCA 4LU6A 2C73A 3S61A 2JB3A 1CJ2A 4I59A 3CPIG 4H4ZA 3FIMB 3AWIA 1JRXA 4XXGA 2Q0LA 2YWLA 4J34A 4C3XA 4CRTA 2YM2A 4CNJA 3DGZA 5HY5A 1ELIA 1N4VA 3ZDNA 1XHCA 5IPYA 4USRA 3P4SA 2VRMA 2YG5A 1TDEA 2RGHA 2GQFA 1GTHA 3AE5A 4GR1A 1BF3A 2W0HA 4EIPA 2WDRA 4K8DA 3W4KA 3QFBA 3V76A 2IIDA 3ICTA 1M64A 2Q0KA 4C3YA 4Z26A 2BC1A 3O0HA 4C5OA 3KVEA 2XVHA 4USQA 1ONFA 2BK5A 2V3AA 5FS8A 2GB0A 2YG3A 1BZLA 1IUWA 3QSMA 3CPJG 3UOVA 3VRAA 2GF3A 3AEFA 1Q9IA 3QSEA 4J56A 3LZWA 4H4QA 3JSKA 3DK9A 3UKAA 1L9CA 2BXSA 2C3DA 1PXCA 2YVFA 4C74A 1Z6LA 3NLCA 3CNJA 3SFEA 1PS9A 2ZBWA 5KRQA 4YT0A 5M10A 3T37A 4D03A 3EAOA 1GRHA 1H82A 5U1OA 1DAOA 1V59A 2OALA 2C65A 3ALMA 1E1NA 4CNKA 3CN8A 4A79A 3H8IA 1K0LA 1KNRA 5JCMA 5EBKA 1Y0PA 4OPTA 3NHOX 1NHPA 1DDOA 1F8RA 1DJNA 1E1MA 2BRYA 4IA5A 4ECHA 2B9WA 2WOVA 2XVFA 2X8HA 5LV9A 3RP7A 4IA6A 1Y56A 1D7YA 2YR4A 1B8SA 3KLJA 3UTEA 2VVMA 5JCLA 2BS3A 4YJGA 2J3NA 5KOXA 3AEGA 3UKKA 5IQ4A 5L46A 1NG3A 2YLRA 1E1KA 1F8SA 3GMBA 4J57A 2EQ6A 4G6GA 2BA9A 4JY2A 3V3NA 3E1TA 5KVIA 2CFYA 4U8PA 5KNLA 3AYIA 3BI2A 3KPKA 3S5WA 3T2ZA 4EMJA 2Z5XA
chains in the Genus database with same CATH topology
4OPDA 4A65A 3NYEA 1XPQA 1GNDA 3SZ0A 3V3OA 4Z2RA 3BHKA 2BYBA 1IUTA 4IV9A 2R0CA 1DOBA 1TDOA 5FS9A 1C0LA 3GD4A 2XCGA 3RNMA 4H2QA 3UOYA 1H6VA 2XLUA 4GRTA 4QFDA 2XVJA 4U8IA 3D1CA 4YSZA 1JNZA 4YJHA 3AEBA 2YLWA 2EQ8A 1JU2A 4G6HA 4RG4A 1YY5A 3KD9A 2E49A 2B76A 4REKA 1KFYA 4OPGA 4Z43A 1S3BA 1B4VA 1CHUA 4DNAA 3ZNNA 1VG0A 2YVGA 4OVIA 4N9XA 5C3JA 1L9DA 4EQWA 3DK8A 4TM4A 3D8XA 3NTDA 2EQ9A 1GRTA 4PABA 4YTNA 3CNPA 4HA6A 3SM8A 2APGA 4GCMA 2GR3A 4UDQA 3UTFA 3CNSA 1BGJA 2RGOA 3FBSA 4FX9A 3VR9A 5J7XA 4BK1A 2UZZA 4WCTA 3DH9A 4YSYA 1LVLA 2BCGG 1MO9A 1UKVG 4LA1A 3NK0X 3FG2P 3REDA 3Q6JA 1RYIA 3AE6A 3G3EA 3GSIA 2GV8A 3P9UA 1L0VA 1PBCA 2C64A 1NHSA 2GEWA 3B3RA 4BJYA 4U8MA 3I6DA 1H86A 5BUKA 3GYIA 1E1LA 4G73A 1K0JA 1LJ1A 2XFPA 4EMIA 1QO8A 2BACA 2WPCA 1ZKQA 4JNAA 3M0OA 3QVPA 3AXBA 4TM0A 3UCLA 1LV0A 3H8LA 2WETA 5JCKA 2OLNA 3F8RA 3ICSA 1KSSA 4NNJA 2XLTA 5HYMA 3R9UA 3NH3X 4H4TA 3KPFA 1DOCA 1D4CA 1S2YA 3AE3A 3B6DA 3LXDA 3SX6A 1GETA 2X99A 1Y56B 2C75A 1E39A 3WE0A 4B69A 4YJGB 2ZZCA 1PBDA 1GRBA 3AE4A 2GRTA 2YVJA 4GAVA 4ADWA 1DNCA 3M12A 3BHFA 1E7PA 1PBBA 1VE9A 1TRBA 4U2SA 3G5SA 4ZCCA 2YG7A 2YG6A 2C3CA 4B67A 1VRQB 1GPEA 1CJ4A 1H81A 3CGEA 3ISHA 3G5QA 1NHQA 2B7RA 2AR8A 2BS4A 2HQMA 5KMPA 1NENA 2ZZBA 4A6NB 1P2HA 3NK2X 5C2TA 1C0IA 4BV6A 2GMJA 1RP0A 2YLTA 4AT2A 1TYTA 2F5ZA 1REOA 2DKIA 2OA1A 2PYXA 1O5WA 3ABVA 3C4AA 4EQXA 3WGTA 3DA1A 2H88A 4U2LA 2I0ZA 4EIQA 1GRGA 2E1MA 2YAUA 5FS6A 2FJEA 4M52A 1TYPA 2C4CA 3P4QA 1GTEA 1EL7A 3CUKA 2BABA 4NEVA 1GRFA 2YM1A 3KKJA 2E5VA 1COYA 4GF7A 4H4PA 1CC4A 2YLZA 1ZOVA 2BXRA 1RSGA 2Y6RA 3KU9A 3P4PA 3OZ2A 1TDFA 2FJDA 2WHDA 5BRTA 1GOSA 2OAMA 1CJ3A 3HYVA 1PHHA 1DJQA 1NDAA 3SYIA 3LB8A 1YQ3A 3GWFA 2AAQA 1CC6A 2C76A 4DSHA 1FEBA 2Q6UA 3T14A 1OJ9A 4AOSA 3CGBA 3AE7A 3IHGA 3RHAA 1F8WA 3SGLA 3NIXA 1GT8A 4J2WA 1YQZA 2GH5A 4J33A 4J31A 2E82A 2WP6A 1GEUA 4U8JA 4YTMA 1MXTA 4G74A 3NGCX 5KXJA 4NWZA 4EM3A 3M13A 3UKFA 1ZDLA 1KSUA 2WPEA 2V6OA 4BK3A 1H84A 2X50A 2ARDA 4H2RA 2WQYA 4A7AA 3DJEA 3NYCA 3G5RA 5U63A 4PAAA 1EL9A 1LPFA 4KX6A 3K30A 3W4IA 4APNA 3NG7X 4DSGA 1NG4A 3K7MX 1JOAA 4Y4MA 3BNUA 2ACZA 1EVIA 4UDRA 4JN9A 4Z2TA 1EL5A 3URHA 3IF9A 4JQ9A 4H4SA 1CBOA 4K5SA 3AYJA 3AYLA 1QLBA 4FK1C 4YJDA 1D4EA 2Y6QA 3L8KA 1KIFA 2CULA 4K5RA 4TM1A 3UKLA 5CKUA 4A5LA 4U8NA 4QFCA 2R0PA 4UP3A 3ICRA 3KA7A 2WESA 2DU8A 3UKPA 3GDNA 1EBDA 1OJCA 4TLZA 4B65A 4EM4A 3AD8B 3DJDA 3AEDA 3COXA 3H4KA 4UDPA 2RGJA 4X9MA 2VVLG 4CY8A 3NT6A 1C0KA 1JNRA 4YJFA 1N4UA 1SEZA 1XDIA 1GERA 1BGNA 1QJDA 2C70A 1L9EA 1W4XA 1K4QA 2YR5A 2ZZ0A 4OPLA 5FMHA 4AT0A 5IQ1A 2A8XA 5DBJA 3CGDA 2R0GA 5EOWA 1F3PA 3SZFA 4YSHA 5KMSA 1JEHA 2CDUA 1LQTA 3AD7B 4H4UA 1VG9A 3UOXA 4EMWA 1ZY8A 3EPTA 1IUVA 4H2PA 4IVOB 4P9SA 4JDRA 2JK6A 1H7XA 3AE2A 3QJ4A 5GRTA 3VQRA 2WDQA 2O9ZA 5HXIA 1DODA 1TDKA 2YQUA 3GDPA 4B66A 5EB4A 5HHFA 4DGKA 1H7WA 2QA2A 3ZNPA 2QA1A 1ZMDA 1ZK7A 4NTDA 3DJJA 3P4RA 5KWFA 5JCIA 4RSLA 4AOXA 2C72A 3GRSA 1IJHA 4B1BA 4Z44A 3W4JA 3FPZA 4B68A 3HYXA 1PXBA 3EF6A 2A89A 2TMDA 3C96A 3GD3A 2WU2A 1IUSA 4CCQA 3GMCA 1CL0A 2VZ2A 5JCNA 1HYUA 3F8DA 2E4AA 4BK2A 1IUUA 1PJ7A 1O94A 4GDPA 3UTGA 3AE1A 2XFOA 2VQ7A 3DGHA 3T31A 1PJ6A 1KF6A 1D7LA 4GUVA 1PBFA 4YJHB 2WPFA 4H7UA 4A99A 3AECA 1EL8A 1KNPA 2JKCA 3BI5A 4H50A 3DJGX 3QVRA 2C67A 1XANA 2C66A 1BKWA 4NEWA 3CNTA 2XFQA 3AE8A 4NTEA 3UP5A 3ADAB 4H4YA 1B5QA 2B7SA 2V3BA 1MOKA 2BRAA 4B64A 1VQWA 5KMQA 4II2A 3SZCA 1DOEA 2WU5A 1ZOYA 4J36A 2JBVA 5TR3A 2DKHA 1FECA 3ITJA 2NVKX 4YTPA 2CVJA 3IWAA 3CPHG 4I58A 3ZNOA 2WP9A 2YG4A 1C0PA 3NKSA 4KPRA 1TDNA 2FBWA 3UKQA 1K0IA 2VRLA 1CJCA 2XVEA 3PO7A 3AEAA 3LADA 4H4XA 1D4DA 4OPUA 1CC2A 4YWOA 2XLPA 2RABA 1E6EA 1VDCA 4X4JA 3SQPA 1ZMCA 4H2NA 2GMHA 4FDCB 4ZCDA 1LTXR 2X8CA 2FJBA 3NK1X 3AD9B 4JY3A 4Y4LA 4A9WA 1PBEA 2BS2A 1YKJA 1F6MA 2WEUA 3GRTA 2WOIA 3GWDA 4YJFB 4HB9A 4TM3A 2FJAA 1YQ4A 2GAGB 3K7QX 3IHMA 3NTAA 4CY6A 2E48A 3Q9TA 4YXDA 1Q1RA 2WOWA 3CNDA 3OC4A 4CBQA 1FL2A 1GV4A 1OJDA 2QCUA 2OLOA 1S2QA 3NNEA 2R9ZA 3UTHA 2JAEA 4YKGA 4U8LA 4GAPA 4K2XA 3VRBA 5KOWA 4EQSA 2R45A 3HYWA 1GSNA 1N1PA 2YR6A 3SZWA 2C7GA 2R4JA 1GREA 2WP5A 2JB2A 3I3LA 4B63A 3II4A 2X8GA 3L1RA 4XWRA 1AN9A 4OCGA 2WS3A 3AB1A 4K22A 3LJPA 1NPXA 3CGCA 3F8PA 1Q1WA 1LQUA 2YLXA 4NZHA 2PHHA 1GRAA 5KMRA 4H4VA 4AP1A 3GYJA 3K7TA 3ZNQA 4O5UA 1S3EA 3RP8A 4CCRA 4EQRA 4YSXA 2XDOA 1B37A 2VQBA 4BJZA 1JRZA 2R46A 1GESA 1N4WA 1KDGA 3ALLA 1FEAA 4LIIA 4Y4NA 2VOUA 2VVLA 4OPIA 4A6NA 1NEKA 2WBAA 4O5QA 5J60A 2IVEA 4Z2UA 3EANA 1PXAA 3ALJA 3NRNA 5FS7A 5GSNA 4ZN0A 3NYFA 2IVDA 2YLSA 1P2EA 4II3A 2BK3A 2B9XA 3IC9A 3C4NA 2V5ZA 4U8OA 3CIRA 1IUXA 4E0VA 1NAAA 2EQ7A 2GQWA 2WDVA 2XVIA 5CQFA 4FK1A 1DXLA 3BNMA 3PVCA 4C77A 3AE9A 1NHRA 2Q7VA 2GAHB 3FMWA 4G9KA 4MJWA 3RP6A 2GR0A 2TPRA 3T0KA 3T2KA 3UKHA 2XFUA 3T2YA 3HZLA 3GYXA 4Z25A 2BCPA 1GALA 5EB5A 4XWZA 5U25A 1D5TA 3QSSA 3LZXA 1FOHA 5BULA 1PJ5A 1X31B 2GVCA 3VR8A 2XLSA 4X9NA 4Z24A 2B9YA 3P1WA 3UOZA 4BURA 2H89A 1M6IA 2XFNA 2Z5YA 2X3NA 2BC0A 1AOGA 2GR2A 1O95A 4GDEA 2BK4A 3NN0X 4OPCA 2AQJA 3AEEA 1FCDA 4ICYA 2NPXA 1ZP0A 4K7ZA 5BVAA 3PS9A 5KVHA 4RG3A 3ATRA 4D04A 2V60A 1JRYA 3VRDB 1CF3A 2JB1A 3QFAA 1H83A 5M0ZA 3SXIA 1ZX9A 1PN0A 4TLXA 2R4EA 3NN6X 3ATQA 3CTYA 4WX1A 2V61A 2A87A 4AP3A 4U2TA 3UP4A 1GXFA 4IVMB 2XLRA 3DMEA 4NTCA 3SY4A 2QAEA 2E4GA 4H4WA 3ZYXA 4JNQA 3BI4A 1OJAA 4U8KA 3LOVA 4YKFA 3SFDA 3DK4A 2XYOA 4H4RA 1PDHA 3CMMA 2GR1A 1OJTA 5ER0A 1BWCA 4LU6A 2C73A 3S61A 2JB3A 1CJ2A 4I59A 3CPIG 4H4ZA 3FIMB 3AWIA 1JRXA 4XXGA 2Q0LA 2YWLA 4J34A 4C3XA 4CRTA 2YM2A 4CNJA 3DGZA 5HY5A 1ELIA 1N4VA 3ZDNA 1XHCA 5IPYA 4USRA 3P4SA 2VRMA 2YG5A 1TDEA 2RGHA 2GQFA 1GTHA 3AE5A 4GR1A 1BF3A 2W0HA 4EIPA 2WDRA 4K8DA 3W4KA 3QFBA 3V76A 2IIDA 3ICTA 1M64A 2Q0KA 4C3YA 4Z26A 2BC1A 3O0HA 4C5OA 3KVEA 2XVHA 4USQA 1ONFA 2BK5A 2V3AA 5FS8A 2GB0A 2YG3A 1BZLA 1IUWA 3QSMA 3CPJG 3UOVA 3VRAA 2GF3A 3AEFA 1Q9IA 3QSEA 4J56A 3LZWA 4H4QA 3JSKA 3DK9A 3UKAA 1L9CA 2BXSA 2C3DA 1PXCA 2YVFA 4C74A 1Z6LA 3NLCA 3CNJA 3SFEA 1PS9A 2ZBWA 5KRQA 4YT0A 5M10A 3T37A 4D03A 3EAOA 1GRHA 1H82A 5U1OA 1DAOA 1V59A 2OALA 2C65A 3ALMA 1E1NA 4CNKA 3CN8A 4A79A 3H8IA 1K0LA 1KNRA 5JCMA 5EBKA 1Y0PA 4OPTA 3NHOX 1NHPA 1DDOA 1F8RA 1DJNA 1E1MA 2BRYA 4IA5A 4ECHA 2B9WA 2WOVA 2XVFA 2X8HA 5LV9A 3RP7A 2YR4A 1Y56A 1D7YA 3KLJA 1B8SA 4IA6A 3UTEA 2VVMA 5JCLA 2BS3A 4YJGA 2J3NA 5KOXA 3AEGA 3UKKA 5IQ4A 5L46A 1NG3A 2YLRA 1E1KA 1F8SA 3GMBA 4J57A 2EQ6A 4G6GA 2BA9A 4JY2A 3V3NA 3E1TA 5KVIA 2CFYA 4U8PA 5KNLA 3AYIA 3BI2A 3KPKA 3S5WA 3T2ZA 4EMJA 2Z5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPD A;  4A65 A;  3NYE A;  1XPQ A;  1GND A;  3V3O A;  4Z2R A;  3BHK A;  2BYB A;  1IUT A;  4IV9 A;  2R0C A;  1DOB A;  1TDO A;  5FS9 A;  1C0L A;  3GD4 A;  2XCG A;  3RNM A;  4H2Q A;  3UOY A;  1H6V A;  2XLU A;  4GRT A;  4QFD A;  2XVJ A;  4U8I A;  3D1C A;  4YSZ A;  1JNZ A;  4YJH A;  3AEB A;  2YLW A;  2EQ8 A;  1JU2 A;  4RG4 A;  1YY5 A;  3KD9 A;  2E49 A;  2B76 A;  4REK A;  1KFY A;  4OPG A;  4Z43 A;  1S3B A;  1B4V A;  1CHU A;  4DNA A;  3ZNN A;  1VG0 A;  2YVG A;  4OVI A;  4N9X A;  5C3J A;  1L9D A;  4EQW A;  3DK8 A;  4TM4 A;  3D8X A;  3NTD A;  2EQ9 A;  1GRT A;  4PAB A;  4YTN A;  3CNP A;  4HA6 A;  3SM8 A;  2APG A;  4GCM A;  2GR3 A;  4UDQ A;  3UTF A;  3CNS A;  1BGJ A;  2RGO A;  3FBS A;  4FX9 A;  3VR9 A;  5J7X A;  4BK1 A;  2UZZ A;  4WCT A;  3DH9 A;  4YSY A;  1LVL A;  2BCG G;  1MO9 A;  1UKV G;  4LA1 A;  3NK0 X;  3FG2 P;  3RED A;  3Q6J A;  1RYI A;  3AE6 A;  3G3E A;  3GSI A;  2GV8 A;  3P9U A;  1L0V A;  1PBC A;  2C64 A;  1NHS A;  2GEW A;  3B3R A;  4BJY A;  4U8M A;  3I6D A;  1H86 A;  5BUK A;  3GYI A;  1E1L A;  1K0J A;  1LJ1 A;  2XFP A;  4EMI A;  1QO8 A;  2BAC A;  2WPC A;  1ZKQ A;  4JNA A;  3M0O A;  3QVP A;  3AXB A;  4TM0 A;  3UCL A;  1LV0 A;  3H8L A;  2WET A;  5JCK A;  2OLN A;  3F8R A;  3ICS A;  1KSS A;  2XLT A;  5HYM A;  3R9U A;  3NH3 X;  4H4T A;  3KPF A;  1DOC A;  1D4C A;  1S2Y A;  3AE3 A;  3B6D A;  3LXD A;  1GET A;  2X99 A;  1Y56 B;  2C75 A;  1E39 A;  3WE0 A;  4B69 A;  4YJG B;  2ZZC A;  1PBD A;  1GRB A;  3AE4 A;  2GRT A;  2YVJ A;  4ADW A;  1DNC A;  3M12 A;  3BHF A;  1E7P A;  1PBB A;  1VE9 A;  1TRB A;  4U2S A;  3G5S A;  4ZCC A;  2YG7 A;  2YG6 A;  2C3C A;  4B67 A;  1VRQ B;  1GPE A;  1CJ4 A;  1H81 A;  3CGE A;  3ISH A;  3G5Q A;  1NHQ A;  2B7R A;  2AR8 A;  2BS4 A;  2HQM A;  1NEN A;  2ZZB A;  4A6N B;  1P2H A;  3NK2 X;  5C2T A;  1C0I A;  4BV6 A;  2GMJ A;  1RP0 A;  2YLT A;  4AT2 A;  1TYT A;  2F5Z A;  1REO A;  2DKI A;  2OA1 A;  2PYX A;  1O5W A;  3ABV A;  3C4A A;  4EQX A;  3WGT A;  3DA1 A;  2H88 A;  4U2L A;  2I0Z A;  4EIQ A;  1GRG A;  2E1M A;  2YAU A;  5FS6 A;  2FJE A;  4M52 A;  1TYP A;  3P4Q A;  4NEV A;  1GTE A;  1EL7 A;  3CUK A;  2BAB A;  1GRF A;  2YM1 A;  3KKJ A;  2E5V A;  1COY A;  4GF7 A;  4H4P A;  1CC4 A;  2YLZ A;  1ZOV A;  2BXR A;  1RSG A;  2Y6R A;  3KU9 A;  3P4P A;  3OZ2 A;  1TDF A;  2FJD A;  2WHD A;  5BRT A;  1GOS A;  2OAM A;  1CJ3 A;  1PHH A;  1DJQ A;  1NDA A;  3LB8 A;  1YQ3 A;  3GWF A;  2AAQ A;  1CC6 A;  2C76 A;  4DSH A;  1FEB A;  2Q6U A;  1OJ9 A;  4AOS A;  3CGB A;  3AE7 A;  3IHG A;  3RHA A;  1F8W A;  3SGL A;  3NIX A;  1GT8 A;  4J2W A;  1YQZ A;  2GH5 A;  4J33 A;  4J31 A;  2E82 A;  2WP6 A;  1GEU A;  4U8J A;  4YTM A;  1MXT A;  3NGC X;  5KXJ A;  4EM3 A;  3M13 A;  3UKF A;  1ZDL A;  1KSU A;  2WPE A;  2V6O A;  4BK3 A;  1H84 A;  2X50 A;  2ARD A;  4H2R A;  2WQY A;  4A7A A;  3DJE A;  3NYC A;  3G5R A;  5U63 A;  4PAA A;  1EL9 A;  1LPF A;  4KX6 A;  3K30 A;  3W4I A;  4APN A;  3NG7 X;  4DSG A;  1NG4 A;  3K7M X;  1JOA A;  4Y4M A;  3BNU A;  2ACZ A;  1EVI A;  4UDR A;  4JN9 A;  4Z2T A;  1EL5 A;  3URH A;  3IF9 A;  4JQ9 A;  4H4S A;  1CBO A;  4K5S A;  3AYJ A;  3AYL A;  1QLB A;  4FK1 C;  4YJD A;  1D4E A;  2Y6Q A;  3L8K A;  1KIF A;  2CUL A;  4K5R A;  4TM1 A;  3UKL A;  5CKU A;  4A5L A;  4U8N A;  4QFC A;  2R0P A;  4UP3 A;  3ICR A;  3KA7 A;  2WES A;  2DU8 A;  3UKP A;  3GDN A;  1EBD A;  1OJC A;  4TLZ A;  4B65 A;  4EM4 A;  3AD8 B;  3DJD A;  3AED A;  3COX A;  3H4K A;  4UDP A;  2RGJ A;  4X9M A;  2VVL G;  4CY8 A;  3NT6 A;  1C0K A;  1JNR A;  4YJF A;  1N4U A;  1SEZ A;  1XDI A;  1GER A;  1BGN A;  1QJD A;  2C70 A;  1L9E A;  1W4X A;  1K4Q A;  2YR5 A;  2ZZ0 A;  4OPL A;  5FMH A;  4AT0 A;  5IQ1 A;  2A8X A;  5DBJ A;  3CGD A;  2R0G A;  5EOW A;  1F3P A;  4YSH A;  1JEH A;  2CDU A;  1LQT A;  3AD7 B;  4H4U A;  1VG9 A;  3UOX A;  4EMW A;  1ZY8 A;  3EPT A;  1IUV A;  4H2P A;  4IVO B;  4P9S A;  4JDR A;  2JK6 A;  1H7X A;  3AE2 A;  3QJ4 A;  5GRT A;  3VQR A;  2WDQ A;  2O9Z A;  5HXI A;  1DOD A;  1TDK A;  2YQU A;  3GDP A;  4B66 A;  5EB4 A;  5HHF A;  4DGK A;  1H7W A;  2QA2 A;  3ZNP A;  2QA1 A;  1ZMD A;  1ZK7 A;  4NTD A;  3DJJ A;  3P4R A;  5KWF A;  5JCI A;  4RSL A;  4AOX A;  2C72 A;  3GRS A;  1IJH A;  4B1B A;  4Z44 A;  3W4J A;  3FPZ A;  4B68 A;  1PXB A;  3EF6 A;  2A89 A;  2TMD A;  3C96 A;  3GD3 A;  2WU2 A;  1IUS A;  4CCQ A;  3GMC A;  1CL0 A;  2VZ2 A;  5JCN A;  1HYU A;  3F8D A;  2E4A A;  4BK2 A;  1IUU A;  1PJ7 A;  1O94 A;  4GDP A;  3UTG A;  3AE1 A;  2XFO A;  2VQ7 A;  3DGH A;  1PJ6 A;  1KF6 A;  1D7L A;  4GUV A;  1PBF A;  4YJH B;  2WPF A;  4H7U A;  4A99 A;  3AEC A;  1EL8 A;  1KNP A;  2JKC A;  3BI5 A;  4H50 A;  3DJG X;  3QVR A;  2C67 A;  1XAN A;  2C66 A;  1BKW A;  4NEW A;  3CNT A;  2XFQ A;  3AE8 A;  4NTE A;  3UP5 A;  3ADA B;  4H4Y A;  1B5Q A;  2B7S A;  2V3B A;  1MOK A;  4B64 A;  1VQW A;  1DOE A;  2WU5 A;  1ZOY A;  4J36 A;  2JBV A;  5TR3 A;  2DKH A;  1FEC A;  3ITJ A;  2NVK X;  4YTP A;  2CVJ A;  3IWA A;  3CPH G;  4I58 A;  3ZNO A;  2WP9 A;  2YG4 A;  1C0P A;  3NKS A;  4KPR A;  1TDN A;  2FBW A;  3UKQ A;  1K0I A;  2VRL A;  1CJC A;  2XVE A;  3PO7 A;  3AEA A;  3LAD A;  4H4X A;  1D4D A;  4OPU A;  1CC2 A;  4YWO A;  2XLP A;  2RAB A;  1E6E A;  1VDC A;  4X4J A;  3SQP A;  1ZMC A;  4H2N A;  2GMH A;  4FDC B;  4ZCD A;  1LTX R;  2X8C A;  2FJB A;  3NK1 X;  3AD9 B;  4JY3 A;  4Y4L A;  4A9W A;  1PBE A;  2BS2 A;  1YKJ A;  1F6M A;  2WEU A;  3GRT A;  2WOI A;  3GWD A;  4YJF B;  4HB9 A;  4TM3 A;  2FJA A;  1YQ4 A;  2GAG B;  3K7Q X;  3IHM A;  3NTA A;  4CY6 A;  2E48 A;  3Q9T A;  4YXD A;  1Q1R A;  2WOW A;  3CND A;  3OC4 A;  4CBQ A;  1FL2 A;  1GV4 A;  1OJD A;  2QCU A;  2OLO A;  1S2Q A;  3NNE A;  2R9Z A;  3UTH A;  2JAE A;  4YKG A;  4U8L A;  4K2X A;  3VRB A;  5KOW A;  4EQS A;  2R45 A;  1GSN A;  1N1P A;  2YR6 A;  2C7G A;  2R4J A;  1GRE A;  2WP5 A;  2JB2 A;  3I3L A;  4B63 A;  3II4 A;  2X8G A;  3L1R A;  4XWR A;  1AN9 A;  4OCG A;  2WS3 A;  3AB1 A;  4K22 A;  3LJP A;  1NPX A;  3CGC A;  3F8P A;  1Q1W A;  1LQU A;  2YLX A;  4NZH A;  2PHH A;  1GRA A;  4H4V A;  4AP1 A;  3GYJ A;  3K7T A;  3ZNQ A;  4O5U A;  1S3E A;  3RP8 A;  4CCR A;  4EQR A;  4YSX A;  2XDO A;  1B37 A;  2VQB A;  4BJZ A;  1JRZ A;  2R46 A;  1GES A;  1N4W A;  1KDG A;  3ALL A;  1FEA A;  4LII A;  4Y4N A;  2VOU A;  2VVL A;  4OPI A;  4A6N A;  1NEK A;  2WBA A;  4O5Q A;  5J60 A;  2IVE A;  4Z2U A;  3EAN A;  1PXA A;  3ALJ A;  3NRN A;  5FS7 A;  5GSN A;  4ZN0 A;  3NYF A;  2IVD A;  2YLS A;  1P2E A;  2BK3 A;  2B9X A;  3IC9 A;  3C4N A;  2V5Z A;  4U8O A;  3CIR A;  1IUX A;  4E0V A;  1NAA A;  2EQ7 A;  2GQW A;  2WDV A;  2XVI A;  5CQF A;  4FK1 A;  1DXL A;  3BNM A;  3PVC A;  4C77 A;  3AE9 A;  1NHR A;  2Q7V A;  2GAH B;  3FMW A;  4MJW A;  3RP6 A;  2GR0 A;  2TPR A;  3UKH A;  2XFU A;  3HZL A;  4Z25 A;  2BCP A;  1GAL A;  5EB5 A;  4XWZ A;  5U25 A;  1D5T A;  3QSS A;  3LZX A;  1FOH A;  5BUL A;  1PJ5 A;  1X31 B;  2GVC A;  3VR8 A;  2XLS A;  4X9N A;  4Z24 A;  2B9Y A;  3P1W A;  3UOZ A;  4BUR A;  2H89 A;  1M6I A;  2XFN A;  2Z5Y A;  2X3N A;  2BC0 A;  1AOG A;  2GR2 A;  1O95 A;  4GDE A;  2BK4 A;  3NN0 X;  4OPC A;  2AQJ A;  3AEE A;  1FCD A;  4ICY A;  2NPX A;  1ZP0 A;  4K7Z A;  5BVA A;  3PS9 A;  5KVH A;  4RG3 A;  3ATR A;  4D04 A;  2V60 A;  1JRY A;  3VRD B;  1CF3 A;  2JB1 A;  3QFA A;  1H83 A;  5M0Z A;  1ZX9 A;  1PN0 A;  4TLX A;  2R4E A;  3NN6 X;  3ATQ A;  3CTY A;  4WX1 A;  2V61 A;  2A87 A;  4AP3 A;  4U2T A;  3UP4 A;  1GXF A;  4IVM B;  2XLR A;  3DME A;  4NTC A;  2QAE A;  2E4G A;  4H4W A;  3ZYX A;  4JNQ A;  3BI4 A;  1OJA A;  4U8K A;  3LOV A;  4YKF A;  3SFD A;  3DK4 A;  2XYO A;  4H4R A;  1PDH A;  2GR1 A;  1OJT A;  5ER0 A;  1BWC A;  4LU6 A;  2C73 A;  3S61 A;  2JB3 A;  1CJ2 A;  4I59 A;  3CPI G;  4H4Z A;  3FIM B;  3AWI A;  1JRX A;  4XXG A;  2Q0L A;  2YWL A;  4J34 A;  4C3X A;  4CRT A;  2YM2 A;  4CNJ A;  3DGZ A;  5HY5 A;  1ELI A;  1N4V A;  3ZDN A;  1XHC A;  5IPY A;  4USR A;  3P4S A;  2VRM A;  2YG5 A;  1TDE A;  2RGH A;  2GQF A;  1GTH A;  3AE5 A;  4GR1 A;  1BF3 A;  2W0H A;  4EIP A;  2WDR A;  4K8D A;  3W4K A;  3QFB A;  3V76 A;  2IID A;  3ICT A;  1M64 A;  2Q0K A;  4C3Y A;  4Z26 A;  2BC1 A;  3O0H A;  4C5O A;  3KVE A;  2XVH A;  4USQ A;  1ONF A;  2BK5 A;  2V3A A;  5FS8 A;  2GB0 A;  2YG3 A;  1BZL A;  1IUW A;  3QSM A;  3CPJ G;  3UOV A;  3VRA A;  2GF3 A;  3AEF A;  1Q9I A;  3QSE A;  4J56 A;  3LZW A;  4H4Q A;  3JSK A;  3DK9 A;  3UKA A;  1L9C A;  2BXS A;  2C3D A;  1PXC A;  2YVF A;  4C74 A;  1Z6L A;  3NLC A;  3CNJ A;  3SFE A;  1PS9 A;  2ZBW A;  5KRQ A;  4YT0 A;  5M10 A;  3T37 A;  4D03 A;  3EAO A;  1GRH A;  1H82 A;  5U1O A;  1DAO A;  1V59 A;  2OAL A;  2C65 A;  3ALM A;  1E1N A;  4CNK A;  3CN8 A;  4A79 A;  3H8I A;  1K0L A;  1KNR A;  5JCM A;  5EBK A;  1Y0P A;  4OPT A;  3NHO X;  1NHP A;  1DDO A;  1F8R A;  1DJN A;  1E1M A;  4IA5 A;  4ECH A;  2B9W A;  2WOV A;  2XVF A;  2X8H A;  5LV9 A;  3RP7 A;  2YR4 A;  1Y56 A;  1D7Y A;  3KLJ A;  1B8S A;  4IA6 A;  3UTE A;  2VVM A;  5JCL A;  2BS3 A;  4YJG A;  2J3N A;  5KOX A;  3AEG A;  3UKK A;  5IQ4 A;  5L46 A;  1NG3 A;  2YLR A;  1E1K A;  1F8S A;  3GMB A;  4J57 A;  2EQ6 A;  2BA9 A;  4JY2 A;  3V3N A;  3E1T A;  5KVI A;  2CFY A;  4U8P A;  3AYI A;  3BI2 A;  3S5W A;  4EMJ A;  2Z5X A; 
#chains in the Genus database with same CATH topology
 4OPD A;  4A65 A;  3NYE A;  1XPQ A;  1GND A;  3SZ0 A;  3V3O A;  4Z2R A;  3BHK A;  2BYB A;  1IUT A;  4IV9 A;  2R0C A;  1DOB A;  1TDO A;  5FS9 A;  1C0L A;  3GD4 A;  2XCG A;  3RNM A;  4H2Q A;  3UOY A;  1H6V A;  2XLU A;  4GRT A;  4QFD A;  2XVJ A;  4U8I A;  3D1C A;  4YSZ A;  1JNZ A;  4YJH A;  3AEB A;  2YLW A;  2EQ8 A;  1JU2 A;  4G6H A;  4RG4 A;  1YY5 A;  3KD9 A;  2E49 A;  2B76 A;  4REK A;  1KFY A;  4OPG A;  4Z43 A;  1S3B A;  1B4V A;  1CHU A;  4DNA A;  3ZNN A;  1VG0 A;  2YVG A;  4OVI A;  4N9X A;  5C3J A;  1L9D A;  4EQW A;  3DK8 A;  4TM4 A;  3D8X A;  3NTD A;  2EQ9 A;  1GRT A;  4PAB A;  4YTN A;  3CNP A;  4HA6 A;  3SM8 A;  2APG A;  4GCM A;  2GR3 A;  4UDQ A;  3UTF A;  3CNS A;  1BGJ A;  2RGO A;  3FBS A;  4FX9 A;  3VR9 A;  5J7X A;  4BK1 A;  2UZZ A;  4WCT A;  3DH9 A;  4YSY A;  1LVL A;  2BCG G;  1MO9 A;  1UKV G;  4LA1 A;  3NK0 X;  3FG2 P;  3RED A;  3Q6J A;  1RYI A;  3AE6 A;  3G3E A;  3GSI A;  2GV8 A;  3P9U A;  1L0V A;  1PBC A;  4BJY A;  1NHS A;  2C64 A;  2GEW A;  3B3R A;  4U8M A;  3I6D A;  1H86 A;  5BUK A;  3GYI A;  1E1L A;  4G73 A;  1K0J A;  1LJ1 A;  2XFP A;  4EMI A;  1QO8 A;  2BAC A;  2WPC A;  1ZKQ A;  4JNA A;  3M0O A;  3QVP A;  3AXB A;  4TM0 A;  3UCL A;  1LV0 A;  3H8L A;  2WET A;  5JCK A;  2OLN A;  3F8R A;  3ICS A;  1KSS A;  4NNJ A;  2XLT A;  5HYM A;  3R9U A;  3NH3 X;  4H4T A;  3KPF A;  1DOC A;  1D4C A;  1S2Y A;  3AE3 A;  3B6D A;  3LXD A;  3SX6 A;  1GET A;  2X99 A;  1Y56 B;  2C75 A;  1E39 A;  3WE0 A;  4B69 A;  4YJG B;  2ZZC A;  1PBD A;  1GRB A;  3AE4 A;  2GRT A;  2YVJ A;  4GAV A;  4ADW A;  1DNC A;  3M12 A;  3BHF A;  1E7P A;  1PBB A;  1VE9 A;  1TRB A;  4U2S A;  3G5S A;  4ZCC A;  2YG7 A;  2YG6 A;  2C3C A;  4B67 A;  1VRQ B;  1GPE A;  1CJ4 A;  1H81 A;  3CGE A;  3ISH A;  3G5Q A;  1NHQ A;  2B7R A;  2AR8 A;  2BS4 A;  2HQM A;  5KMP A;  1NEN A;  2ZZB A;  4A6N B;  1P2H A;  3NK2 X;  5C2T A;  1C0I A;  4BV6 A;  2GMJ A;  1RP0 A;  2YLT A;  4AT2 A;  1TYT A;  2F5Z A;  1REO A;  2DKI A;  2OA1 A;  2PYX A;  3C4A A;  1O5W A;  3ABV A;  4EQX A;  3WGT A;  3DA1 A;  2H88 A;  4U2L A;  2I0Z A;  4EIQ A;  1GRG A;  2E1M A;  2YAU A;  5FS6 A;  2FJE A;  4M52 A;  1TYP A;  2C4C A;  3P4Q A;  1GTE A;  1EL7 A;  3CUK A;  2BAB A;  4NEV A;  1GRF A;  2YM1 A;  3KKJ A;  2E5V A;  4GF7 A;  1COY A;  4H4P A;  1CC4 A;  2YLZ A;  1ZOV A;  2BXR A;  1RSG A;  2Y6R A;  3KU9 A;  3P4P A;  3OZ2 A;  1TDF A;  2FJD A;  2WHD A;  5BRT A;  1GOS A;  2OAM A;  1CJ3 A;  3HYV A;  1PHH A;  1DJQ A;  1NDA A;  3SYI A;  3LB8 A;  1YQ3 A;  3GWF A;  2AAQ A;  1CC6 A;  2C76 A;  4DSH A;  1FEB A;  2Q6U A;  3T14 A;  1OJ9 A;  4AOS A;  3CGB A;  3AE7 A;  3IHG A;  3RHA A;  1F8W A;  3SGL A;  3NIX A;  1GT8 A;  4J2W A;  1YQZ A;  2GH5 A;  4J33 A;  4J31 A;  2E82 A;  2WP6 A;  1GEU A;  4U8J A;  4YTM A;  1MXT A;  4G74 A;  3NGC X;  5KXJ A;  4NWZ A;  4EM3 A;  3M13 A;  3UKF A;  1ZDL A;  4BK3 A;  1KSU A;  2V6O A;  2WPE A;  1H84 A;  2X50 A;  4H2R A;  2ARD A;  2WQY A;  4A7A A;  3DJE A;  3NYC A;  3G5R A;  5U63 A;  4PAA A;  1EL9 A;  1LPF A;  4KX6 A;  3K30 A;  3W4I A;  4APN A;  3NG7 X;  4DSG A;  1NG4 A;  3K7M X;  1JOA A;  4Y4M A;  3BNU A;  2ACZ A;  1EVI A;  4UDR A;  4JN9 A;  4Z2T A;  1EL5 A;  3URH A;  3IF9 A;  4JQ9 A;  4H4S A;  1CBO A;  4K5S A;  3AYJ A;  3AYL A;  1QLB A;  4FK1 C;  4YJD A;  1D4E A;  2Y6Q A;  3L8K A;  1KIF A;  2CUL A;  4K5R A;  4TM1 A;  3UKL A;  5CKU A;  4A5L A;  4U8N A;  4QFC A;  2R0P A;  4UP3 A;  3ICR A;  3KA7 A;  2WES A;  2DU8 A;  3UKP A;  3GDN A;  1EBD A;  1OJC A;  4TLZ A;  4B65 A;  4EM4 A;  3AD8 B;  3DJD A;  3AED A;  3COX A;  3H4K A;  4UDP A;  2RGJ A;  4X9M A;  2VVL G;  4CY8 A;  3NT6 A;  1C0K A;  1JNR A;  4YJF A;  1N4U A;  1GER A;  1BGN A;  1SEZ A;  1XDI A;  1QJD A;  2C70 A;  1L9E A;  1W4X A;  1K4Q A;  2YR5 A;  2ZZ0 A;  4OPL A;  5FMH A;  4AT0 A;  5IQ1 A;  2A8X A;  5DBJ A;  3CGD A;  2R0G A;  5EOW A;  1F3P A;  3SZF A;  4YSH A;  5KMS A;  1JEH A;  2CDU A;  1LQT A;  3AD7 B;  4H4U A;  1VG9 A;  3UOX A;  4EMW A;  3EPT A;  1ZY8 A;  1IUV A;  4H2P A;  4IVO B;  4P9S A;  4JDR A;  2JK6 A;  1H7X A;  3AE2 A;  3QJ4 A;  5GRT A;  3VQR A;  2WDQ A;  2O9Z A;  5HXI A;  1DOD A;  1TDK A;  2YQU A;  3GDP A;  4B66 A;  5EB4 A;  5HHF A;  4DGK A;  1H7W A;  2QA2 A;  3ZNP A;  2QA1 A;  1ZMD A;  1ZK7 A;  4NTD A;  3DJJ A;  3P4R A;  5KWF A;  5JCI A;  4RSL A;  4AOX A;  2C72 A;  3GRS A;  1IJH A;  4B1B A;  4Z44 A;  3W4J A;  3FPZ A;  4B68 A;  3HYX A;  1PXB A;  3EF6 A;  2A89 A;  3C96 A;  2TMD A;  3GD3 A;  2WU2 A;  1IUS A;  4CCQ A;  3GMC A;  1CL0 A;  2VZ2 A;  5JCN A;  1HYU A;  3F8D A;  2E4A A;  4BK2 A;  1IUU A;  1PJ7 A;  1O94 A;  4GDP A;  3UTG A;  3AE1 A;  2XFO A;  2VQ7 A;  3DGH A;  3T31 A;  1PJ6 A;  1KF6 A;  1D7L A;  4GUV A;  1PBF A;  4YJH B;  2WPF A;  4H7U A;  4A99 A;  3AEC A;  1EL8 A;  1KNP A;  2JKC A;  3BI5 A;  4H50 A;  3DJG X;  3QVR A;  2C67 A;  1XAN A;  2C66 A;  1BKW A;  4NEW A;  3CNT A;  2XFQ A;  3AE8 A;  4NTE A;  3UP5 A;  3ADA B;  4H4Y A;  1B5Q A;  2B7S A;  2V3B A;  1MOK A;  2BRA A;  4B64 A;  1VQW A;  5KMQ A;  4II2 A;  3SZC A;  1DOE A;  2WU5 A;  1ZOY A;  4J36 A;  2JBV A;  5TR3 A;  2DKH A;  1FEC A;  3ITJ A;  2NVK X;  4YTP A;  2CVJ A;  3IWA A;  3CPH G;  4I58 A;  3ZNO A;  2WP9 A;  2YG4 A;  1C0P A;  3NKS A;  4KPR A;  1TDN A;  2FBW A;  3UKQ A;  1K0I A;  2VRL A;  1CJC A;  2XVE A;  3PO7 A;  3AEA A;  3LAD A;  4H4X A;  1D4D A;  4OPU A;  1CC2 A;  4YWO A;  2XLP A;  2RAB A;  1E6E A;  1VDC A;  4X4J A;  3SQP A;  1ZMC A;  4H2N A;  2GMH A;  4FDC B;  4ZCD A;  1LTX R;  2X8C A;  2FJB A;  3NK1 X;  3AD9 B;  4JY3 A;  4Y4L A;  4A9W A;  1PBE A;  2BS2 A;  1YKJ A;  1F6M A;  2WEU A;  3GRT A;  2WOI A;  3GWD A;  4YJF B;  4HB9 A;  4TM3 A;  2FJA A;  1YQ4 A;  2GAG B;  3K7Q X;  3IHM A;  3NTA A;  4CY6 A;  2E48 A;  3Q9T A;  4YXD A;  1Q1R A;  2WOW A;  3CND A;  3OC4 A;  4CBQ A;  1FL2 A;  1GV4 A;  1OJD A;  2QCU A;  2OLO A;  1S2Q A;  3NNE A;  2R9Z A;  3UTH A;  2JAE A;  4YKG A;  4U8L A;  4GAP A;  4K2X A;  3VRB A;  5KOW A;  4EQS A;  2R45 A;  3HYW A;  1GSN A;  1N1P A;  2YR6 A;  3SZW A;  2C7G A;  2R4J A;  1GRE A;  2WP5 A;  2JB2 A;  3I3L A;  4B63 A;  3II4 A;  2X8G A;  3L1R A;  4XWR A;  1AN9 A;  4OCG A;  2WS3 A;  3AB1 A;  4K22 A;  3LJP A;  1NPX A;  3CGC A;  3F8P A;  1Q1W A;  1LQU A;  2YLX A;  4NZH A;  2PHH A;  1GRA A;  5KMR A;  4H4V A;  4AP1 A;  3GYJ A;  3K7T A;  3ZNQ A;  4O5U A;  1S3E A;  3RP8 A;  4CCR A;  4EQR A;  4YSX A;  2XDO A;  4BJZ A;  1B37 A;  2VQB A;  1JRZ A;  2R46 A;  3ALL A;  1N4W A;  1GES A;  1KDG A;  1FEA A;  4LII A;  4Y4N A;  2VOU A;  2VVL A;  4OPI A;  4A6N A;  1NEK A;  2WBA A;  4O5Q A;  5J60 A;  2IVE A;  4Z2U A;  3EAN A;  1PXA A;  3ALJ A;  3NRN A;  5FS7 A;  5GSN A;  4ZN0 A;  3NYF A;  2IVD A;  2YLS A;  1P2E A;  4II3 A;  2BK3 A;  2B9X A;  3IC9 A;  3C4N A;  2V5Z A;  4U8O A;  3CIR A;  1IUX A;  4E0V A;  1NAA A;  2EQ7 A;  2GQW A;  2WDV A;  2XVI A;  5CQF A;  4FK1 A;  1DXL A;  3BNM A;  3PVC A;  4C77 A;  3AE9 A;  1NHR A;  2Q7V A;  2GAH B;  3FMW A;  4G9K A;  4MJW A;  3RP6 A;  2GR0 A;  2TPR A;  3T0K A;  3T2K A;  3UKH A;  2XFU A;  3T2Y A;  3HZL A;  3GYX A;  4Z25 A;  2BCP A;  1GAL A;  5EB5 A;  4XWZ A;  5U25 A;  1D5T A;  3QSS A;  3LZX A;  1FOH A;  5BUL A;  1PJ5 A;  1X31 B;  2GVC A;  3VR8 A;  2XLS A;  4X9N A;  4Z24 A;  2B9Y A;  3P1W A;  3UOZ A;  4BUR A;  2H89 A;  1M6I A;  2XFN A;  2Z5Y A;  2X3N A;  2BC0 A;  1AOG A;  2GR2 A;  1O95 A;  4GDE A;  2BK4 A;  3NN0 X;  4OPC A;  2AQJ A;  3AEE A;  1FCD A;  4ICY A;  2NPX A;  1ZP0 A;  4K7Z A;  5BVA A;  3PS9 A;  5KVH A;  4RG3 A;  3ATR A;  4D04 A;  2V60 A;  1JRY A;  3VRD B;  1CF3 A;  2JB1 A;  3QFA A;  1H83 A;  5M0Z A;  3SXI A;  1ZX9 A;  1PN0 A;  4TLX A;  2R4E A;  3NN6 X;  3ATQ A;  3CTY A;  4WX1 A;  2V61 A;  2A87 A;  4AP3 A;  4U2T A;  3UP4 A;  1GXF A;  4IVM B;  2XLR A;  3DME A;  4NTC A;  3SY4 A;  2QAE A;  2E4G A;  4H4W A;  3ZYX A;  4JNQ A;  3BI4 A;  1OJA A;  4U8K A;  3LOV A;  4YKF A;  3SFD A;  3DK4 A;  2XYO A;  4H4R A;  1PDH A;  3CMM A;  2GR1 A;  1OJT A;  5ER0 A;  1BWC A;  4LU6 A;  2C73 A;  3S61 A;  2JB3 A;  1CJ2 A;  4I59 A;  3CPI G;  4H4Z A;  3FIM B;  3AWI A;  1JRX A;  4XXG A;  2Q0L A;  2YWL A;  4J34 A;  4C3X A;  4CRT A;  2YM2 A;  4CNJ A;  3DGZ A;  5HY5 A;  1ELI A;  1N4V A;  3ZDN A;  1XHC A;  5IPY A;  4USR A;  3P4S A;  2VRM A;  2YG5 A;  1TDE A;  2RGH A;  2GQF A;  1GTH A;  3AE5 A;  4GR1 A;  1BF3 A;  2W0H A;  4EIP A;  2WDR A;  4K8D A;  3W4K A;  3QFB A;  3V76 A;  2IID A;  3ICT A;  1M64 A;  2Q0K A;  4C3Y A;  4Z26 A;  2BC1 A;  3O0H A;  4C5O A;  3KVE A;  2XVH A;  4USQ A;  1ONF A;  2BK5 A;  2V3A A;  5FS8 A;  2GB0 A;  2YG3 A;  1BZL A;  1IUW A;  3QSM A;  3CPJ G;  3UOV A;  3VRA A;  2GF3 A;  3AEF A;  1Q9I A;  3QSE A;  4J56 A;  3LZW A;  4H4Q A;  3JSK A;  3DK9 A;  3UKA A;  1L9C A;  2BXS A;  2C3D A;  1PXC A;  2YVF A;  4C74 A;  1Z6L A;  3NLC A;  3CNJ A;  3SFE A;  1PS9 A;  2ZBW A;  5KRQ A;  4YT0 A;  5M10 A;  3T37 A;  4D03 A;  3EAO A;  1GRH A;  1H82 A;  5U1O A;  1DAO A;  1V59 A;  2OAL A;  2C65 A;  3ALM A;  1E1N A;  4CNK A;  3CN8 A;  4A79 A;  3H8I A;  1K0L A;  1KNR A;  5JCM A;  5EBK A;  1Y0P A;  4OPT A;  3NHO X;  1NHP A;  1DDO A;  1F8R A;  1DJN A;  1E1M A;  2BRY A;  4IA5 A;  4ECH A;  2B9W A;  2WOV A;  2XVF A;  2X8H A;  5LV9 A;  3RP7 A;  4IA6 A;  1Y56 A;  1D7Y A;  2YR4 A;  1B8S A;  3KLJ A;  3UTE A;  2VVM A;  5JCL A;  2BS3 A;  4YJG A;  2J3N A;  5KOX A;  3AEG A;  3UKK A;  5IQ4 A;  5L46 A;  1NG3 A;  2YLR A;  1E1K A;  1F8S A;  3GMB A;  4J57 A;  2EQ6 A;  4G6G A;  2BA9 A;  4JY2 A;  3V3N A;  3E1T A;  5KVI A;  2CFY A;  4U8P A;  5KNL A;  3AYI A;  3BI2 A;  3KPK A;  3S5W A;  3T2Z A;  4EMJ A;  2Z5X A; 
#chains in the Genus database with same CATH homology
 4OPD A;  4A65 A;  3NYE A;  1XPQ A;  1GND A;  3SZ0 A;  3V3O A;  4Z2R A;  3BHK A;  2BYB A;  1IUT A;  4IV9 A;  2R0C A;  1DOB A;  1TDO A;  5FS9 A;  1C0L A;  3GD4 A;  2XCG A;  3RNM A;  4H2Q A;  3UOY A;  1H6V A;  2XLU A;  4GRT A;  4QFD A;  2XVJ A;  4U8I A;  3D1C A;  4YSZ A;  1JNZ A;  4YJH A;  3AEB A;  2YLW A;  2EQ8 A;  1JU2 A;  4G6H A;  4RG4 A;  1YY5 A;  3KD9 A;  2E49 A;  2B76 A;  4REK A;  1KFY A;  4OPG A;  4Z43 A;  1S3B A;  1B4V A;  1CHU A;  4DNA A;  3ZNN A;  1VG0 A;  2YVG A;  4OVI A;  4N9X A;  5C3J A;  1L9D A;  4EQW A;  3DK8 A;  4TM4 A;  3D8X A;  3NTD A;  2EQ9 A;  1GRT A;  4PAB A;  4YTN A;  3CNP A;  4HA6 A;  3SM8 A;  2APG A;  4GCM A;  2GR3 A;  4UDQ A;  3UTF A;  3CNS A;  1BGJ A;  2RGO A;  3FBS A;  4FX9 A;  3VR9 A;  5J7X A;  4BK1 A;  2UZZ A;  4WCT A;  3DH9 A;  4YSY A;  1LVL A;  2BCG G;  1MO9 A;  1UKV G;  4LA1 A;  3NK0 X;  3FG2 P;  3RED A;  3Q6J A;  1RYI A;  3AE6 A;  3G3E A;  3GSI A;  2GV8 A;  3P9U A;  1L0V A;  1PBC A;  2C64 A;  1NHS A;  2GEW A;  3B3R A;  4BJY A;  4U8M A;  3I6D A;  1H86 A;  5BUK A;  3GYI A;  1E1L A;  4G73 A;  1K0J A;  1LJ1 A;  2XFP A;  4EMI A;  1QO8 A;  2BAC A;  2WPC A;  1ZKQ A;  4JNA A;  3M0O A;  3QVP A;  3AXB A;  4TM0 A;  3UCL A;  1LV0 A;  3H8L A;  2WET A;  5JCK A;  2OLN A;  3F8R A;  3ICS A;  1KSS A;  4NNJ A;  2XLT A;  5HYM A;  3R9U A;  3NH3 X;  4H4T A;  3KPF A;  1DOC A;  1D4C A;  1S2Y A;  3AE3 A;  3B6D A;  3LXD A;  3SX6 A;  1GET A;  2X99 A;  1Y56 B;  2C75 A;  1E39 A;  3WE0 A;  4B69 A;  4YJG B;  2ZZC A;  1PBD A;  1GRB A;  3AE4 A;  2GRT A;  2YVJ A;  4GAV A;  4ADW A;  1DNC A;  3M12 A;  3BHF A;  1E7P A;  1PBB A;  1VE9 A;  1TRB A;  4U2S A;  3G5S A;  4ZCC A;  2YG7 A;  2YG6 A;  2C3C A;  4B67 A;  1VRQ B;  1GPE A;  1CJ4 A;  1H81 A;  3CGE A;  3ISH A;  3G5Q A;  1NHQ A;  2B7R A;  2AR8 A;  2BS4 A;  2HQM A;  5KMP A;  1NEN A;  2ZZB A;  4A6N B;  1P2H A;  3NK2 X;  5C2T A;  1C0I A;  4BV6 A;  2GMJ A;  1RP0 A;  2YLT A;  4AT2 A;  1TYT A;  2F5Z A;  1REO A;  2DKI A;  2OA1 A;  2PYX A;  1O5W A;  3ABV A;  3C4A A;  4EQX A;  3WGT A;  3DA1 A;  2H88 A;  4U2L A;  2I0Z A;  4EIQ A;  1GRG A;  2E1M A;  2YAU A;  5FS6 A;  2FJE A;  4M52 A;  1TYP A;  2C4C A;  3P4Q A;  1GTE A;  1EL7 A;  3CUK A;  2BAB A;  4NEV A;  1GRF A;  2YM1 A;  3KKJ A;  2E5V A;  1COY A;  4GF7 A;  4H4P A;  1CC4 A;  2YLZ A;  1ZOV A;  2BXR A;  1RSG A;  2Y6R A;  3KU9 A;  3P4P A;  3OZ2 A;  1TDF A;  2FJD A;  2WHD A;  5BRT A;  1GOS A;  2OAM A;  1CJ3 A;  3HYV A;  1PHH A;  1DJQ A;  1NDA A;  3SYI A;  3LB8 A;  1YQ3 A;  3GWF A;  2AAQ A;  1CC6 A;  2C76 A;  4DSH A;  1FEB A;  2Q6U A;  3T14 A;  1OJ9 A;  4AOS A;  3CGB A;  3AE7 A;  3IHG A;  3RHA A;  1F8W A;  3SGL A;  3NIX A;  1GT8 A;  4J2W A;  1YQZ A;  2GH5 A;  4J33 A;  4J31 A;  2E82 A;  2WP6 A;  1GEU A;  4U8J A;  4YTM A;  1MXT A;  4G74 A;  3NGC X;  5KXJ A;  4NWZ A;  4EM3 A;  3M13 A;  3UKF A;  1ZDL A;  1KSU A;  2WPE A;  2V6O A;  4BK3 A;  1H84 A;  2X50 A;  2ARD A;  4H2R A;  2WQY A;  4A7A A;  3DJE A;  3NYC A;  3G5R A;  5U63 A;  4PAA A;  1EL9 A;  1LPF A;  4KX6 A;  3K30 A;  3W4I A;  4APN A;  3NG7 X;  4DSG A;  1NG4 A;  3K7M X;  1JOA A;  4Y4M A;  3BNU A;  2ACZ A;  1EVI A;  4UDR A;  4JN9 A;  4Z2T A;  1EL5 A;  3URH A;  3IF9 A;  4JQ9 A;  4H4S A;  1CBO A;  4K5S A;  3AYJ A;  3AYL A;  1QLB A;  4FK1 C;  4YJD A;  1D4E A;  2Y6Q A;  3L8K A;  1KIF A;  2CUL A;  4K5R A;  4TM1 A;  3UKL A;  5CKU A;  4A5L A;  4U8N A;  4QFC A;  2R0P A;  4UP3 A;  3ICR A;  3KA7 A;  2WES A;  2DU8 A;  3UKP A;  3GDN A;  1EBD A;  1OJC A;  4TLZ A;  4B65 A;  4EM4 A;  3AD8 B;  3DJD A;  3AED A;  3COX A;  3H4K A;  4UDP A;  2RGJ A;  4X9M A;  2VVL G;  4CY8 A;  3NT6 A;  1C0K A;  1JNR A;  4YJF A;  1N4U A;  1SEZ A;  1XDI A;  1GER A;  1BGN A;  1QJD A;  2C70 A;  1L9E A;  1W4X A;  1K4Q A;  2YR5 A;  2ZZ0 A;  4OPL A;  5FMH A;  4AT0 A;  5IQ1 A;  2A8X A;  5DBJ A;  3CGD A;  2R0G A;  5EOW A;  1F3P A;  3SZF A;  4YSH A;  5KMS A;  1JEH A;  2CDU A;  1LQT A;  3AD7 B;  4H4U A;  1VG9 A;  3UOX A;  4EMW A;  1ZY8 A;  3EPT A;  1IUV A;  4H2P A;  4IVO B;  4P9S A;  4JDR A;  2JK6 A;  1H7X A;  3AE2 A;  3QJ4 A;  5GRT A;  3VQR A;  2WDQ A;  2O9Z A;  5HXI A;  1DOD A;  1TDK A;  2YQU A;  3GDP A;  4B66 A;  5EB4 A;  5HHF A;  4DGK A;  1H7W A;  2QA2 A;  3ZNP A;  2QA1 A;  1ZMD A;  1ZK7 A;  4NTD A;  3DJJ A;  3P4R A;  5KWF A;  5JCI A;  4RSL A;  4AOX A;  2C72 A;  3GRS A;  1IJH A;  4B1B A;  4Z44 A;  3W4J A;  3FPZ A;  4B68 A;  3HYX A;  1PXB A;  3EF6 A;  2A89 A;  2TMD A;  3C96 A;  3GD3 A;  2WU2 A;  1IUS A;  4CCQ A;  3GMC A;  1CL0 A;  2VZ2 A;  5JCN A;  1HYU A;  3F8D A;  2E4A A;  4BK2 A;  1IUU A;  1PJ7 A;  1O94 A;  4GDP A;  3UTG A;  3AE1 A;  2XFO A;  2VQ7 A;  3DGH A;  3T31 A;  1PJ6 A;  1KF6 A;  1D7L A;  4GUV A;  1PBF A;  4YJH B;  2WPF A;  4H7U A;  4A99 A;  3AEC A;  1EL8 A;  1KNP A;  2JKC A;  3BI5 A;  4H50 A;  3DJG X;  3QVR A;  2C67 A;  1XAN A;  2C66 A;  1BKW A;  4NEW A;  3CNT A;  2XFQ A;  3AE8 A;  4NTE A;  3UP5 A;  3ADA B;  4H4Y A;  1B5Q A;  2B7S A;  2V3B A;  1MOK A;  2BRA A;  4B64 A;  1VQW A;  5KMQ A;  4II2 A;  3SZC A;  1DOE A;  2WU5 A;  1ZOY A;  4J36 A;  2JBV A;  5TR3 A;  2DKH A;  1FEC A;  3ITJ A;  2NVK X;  4YTP A;  2CVJ A;  3IWA A;  3CPH G;  4I58 A;  3ZNO A;  2WP9 A;  2YG4 A;  1C0P A;  3NKS A;  4KPR A;  1TDN A;  2FBW A;  3UKQ A;  1K0I A;  2VRL A;  1CJC A;  2XVE A;  3PO7 A;  3AEA A;  3LAD A;  4H4X A;  1D4D A;  4OPU A;  1CC2 A;  4YWO A;  2XLP A;  2RAB A;  1E6E A;  1VDC A;  4X4J A;  3SQP A;  1ZMC A;  4H2N A;  2GMH A;  4FDC B;  4ZCD A;  1LTX R;  2X8C A;  2FJB A;  3NK1 X;  3AD9 B;  4JY3 A;  4Y4L A;  4A9W A;  1PBE A;  2BS2 A;  1YKJ A;  1F6M A;  2WEU A;  3GRT A;  2WOI A;  3GWD A;  4YJF B;  4HB9 A;  4TM3 A;  2FJA A;  1YQ4 A;  2GAG B;  3K7Q X;  3IHM A;  3NTA A;  4CY6 A;  2E48 A;  3Q9T A;  4YXD A;  1Q1R A;  2WOW A;  3CND A;  3OC4 A;  4CBQ A;  1FL2 A;  1GV4 A;  1OJD A;  2QCU A;  2OLO A;  1S2Q A;  3NNE A;  2R9Z A;  3UTH A;  2JAE A;  4YKG A;  4U8L A;  4GAP A;  4K2X A;  3VRB A;  5KOW A;  4EQS A;  2R45 A;  3HYW A;  1GSN A;  1N1P A;  2YR6 A;  3SZW A;  2C7G A;  2R4J A;  1GRE A;  2WP5 A;  2JB2 A;  3I3L A;  4B63 A;  3II4 A;  2X8G A;  3L1R A;  4XWR A;  1AN9 A;  4OCG A;  2WS3 A;  3AB1 A;  4K22 A;  3LJP A;  1NPX A;  3CGC A;  3F8P A;  1Q1W A;  1LQU A;  2YLX A;  4NZH A;  2PHH A;  1GRA A;  5KMR A;  4H4V A;  4AP1 A;  3GYJ A;  3K7T A;  3ZNQ A;  4O5U A;  1S3E A;  3RP8 A;  4CCR A;  4EQR A;  4YSX A;  2XDO A;  1B37 A;  2VQB A;  4BJZ A;  1JRZ A;  2R46 A;  1GES A;  1N4W A;  1KDG A;  3ALL A;  1FEA A;  4LII A;  4Y4N A;  2VOU A;  2VVL A;  4OPI A;  4A6N A;  1NEK A;  2WBA A;  4O5Q A;  5J60 A;  2IVE A;  4Z2U A;  3EAN A;  1PXA A;  3ALJ A;  3NRN A;  5FS7 A;  5GSN A;  4ZN0 A;  3NYF A;  2IVD A;  2YLS A;  1P2E A;  4II3 A;  2BK3 A;  2B9X A;  3IC9 A;  3C4N A;  2V5Z A;  4U8O A;  3CIR A;  1IUX A;  4E0V A;  1NAA A;  2EQ7 A;  2GQW A;  2WDV A;  2XVI A;  5CQF A;  4FK1 A;  1DXL A;  3BNM A;  3PVC A;  4C77 A;  3AE9 A;  1NHR A;  2Q7V A;  2GAH B;  3FMW A;  4G9K A;  4MJW A;  3RP6 A;  2GR0 A;  2TPR A;  3T0K A;  3T2K A;  3UKH A;  2XFU A;  3T2Y A;  3HZL A;  3GYX A;  4Z25 A;  2BCP A;  1GAL A;  5EB5 A;  4XWZ A;  5U25 A;  1D5T A;  3QSS A;  3LZX A;  1FOH A;  5BUL A;  1PJ5 A;  1X31 B;  2GVC A;  3VR8 A;  2XLS A;  4X9N A;  4Z24 A;  2B9Y A;  3P1W A;  3UOZ A;  4BUR A;  2H89 A;  1M6I A;  2XFN A;  2Z5Y A;  2X3N A;  2BC0 A;  1AOG A;  2GR2 A;  1O95 A;  4GDE A;  2BK4 A;  3NN0 X;  4OPC A;  2AQJ A;  3AEE A;  1FCD A;  4ICY A;  2NPX A;  1ZP0 A;  4K7Z A;  5BVA A;  3PS9 A;  5KVH A;  4RG3 A;  3ATR A;  4D04 A;  2V60 A;  1JRY A;  3VRD B;  1CF3 A;  2JB1 A;  3QFA A;  1H83 A;  5M0Z A;  3SXI A;  1ZX9 A;  1PN0 A;  4TLX A;  2R4E A;  3NN6 X;  3ATQ A;  3CTY A;  4WX1 A;  2V61 A;  2A87 A;  4AP3 A;  4U2T A;  3UP4 A;  1GXF A;  4IVM B;  2XLR A;  3DME A;  4NTC A;  3SY4 A;  2QAE A;  2E4G A;  4H4W A;  3ZYX A;  4JNQ A;  3BI4 A;  1OJA A;  4U8K A;  3LOV A;  4YKF A;  3SFD A;  3DK4 A;  2XYO A;  4H4R A;  1PDH A;  3CMM A;  2GR1 A;  1OJT A;  5ER0 A;  1BWC A;  4LU6 A;  2C73 A;  3S61 A;  2JB3 A;  1CJ2 A;  4I59 A;  3CPI G;  4H4Z A;  3FIM B;  3AWI A;  1JRX A;  4XXG A;  2Q0L A;  2YWL A;  4J34 A;  4C3X A;  4CRT A;  2YM2 A;  4CNJ A;  3DGZ A;  5HY5 A;  1ELI A;  1N4V A;  3ZDN A;  1XHC A;  5IPY A;  4USR A;  3P4S A;  2VRM A;  2YG5 A;  1TDE A;  2RGH A;  2GQF A;  1GTH A;  3AE5 A;  4GR1 A;  1BF3 A;  2W0H A;  4EIP A;  2WDR A;  4K8D A;  3W4K A;  3QFB A;  3V76 A;  2IID A;  3ICT A;  1M64 A;  2Q0K A;  4C3Y A;  4Z26 A;  2BC1 A;  3O0H A;  4C5O A;  3KVE A;  2XVH A;  4USQ A;  1ONF A;  2BK5 A;  2V3A A;  5FS8 A;  2GB0 A;  2YG3 A;  1BZL A;  1IUW A;  3QSM A;  3CPJ G;  3UOV A;  3VRA A;  2GF3 A;  3AEF A;  1Q9I A;  3QSE A;  4J56 A;  3LZW A;  4H4Q A;  3JSK A;  3DK9 A;  3UKA A;  1L9C A;  2BXS A;  2C3D A;  1PXC A;  2YVF A;  4C74 A;  1Z6L A;  3NLC A;  3CNJ A;  3SFE A;  1PS9 A;  2ZBW A;  5KRQ A;  4YT0 A;  5M10 A;  3T37 A;  4D03 A;  3EAO A;  1GRH A;  1H82 A;  5U1O A;  1DAO A;  1V59 A;  2OAL A;  2C65 A;  3ALM A;  1E1N A;  4CNK A;  3CN8 A;  4A79 A;  3H8I A;  1K0L A;  1KNR A;  5JCM A;  5EBK A;  1Y0P A;  4OPT A;  3NHO X;  1NHP A;  1DDO A;  1F8R A;  1DJN A;  1E1M A;  2BRY A;  4IA5 A;  4ECH A;  2B9W A;  2WOV A;  2XVF A;  2X8H A;  5LV9 A;  3RP7 A;  2YR4 A;  1Y56 A;  1D7Y A;  3KLJ A;  1B8S A;  4IA6 A;  3UTE A;  2VVM A;  5JCL A;  2BS3 A;  4YJG A;  2J3N A;  5KOX A;  3AEG A;  3UKK A;  5IQ4 A;  5L46 A;  1NG3 A;  2YLR A;  1E1K A;  1F8S A;  3GMB A;  4J57 A;  2EQ6 A;  4G6G A;  2BA9 A;  4JY2 A;  3V3N A;  3E1T A;  5KVI A;  2CFY A;  4U8P A;  5KNL A;  3AYI A;  3BI2 A;  3KPK A;  3S5W A;  3T2Z A;  4EMJ A;  2Z5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...