3DMEA

Crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
366
Chain Sequence
TDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved exported protein
publication title Crystal structure of conserved exported protein from Bordetella pertussis. NorthEast Structural Genomics target BeR141
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
total genus 110
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3dmeA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dmeA01
3CNPA 3CNDA 2RGJA 2E4AA 3SFDA 3UKKA 2TPRA 1FOHA 1S2YA 3PS9A 4K22A 4HA6A 2YLWA 3EPTA 3IHMA 3JSKA 2ZZCA 1CC4A 1VE9A 1VG0A 1PJ6A 2YLRA 4LIIA 5EB5A 3BI5A 3P9UA 4QFDA 1LVLA 1DAOA 1LV0A 3LJPA 1CJCA 4CY6A 5KRQA 1F8WA 2YLXA 1KDGA 3CGDA 3P4SA 1PDHA 5KVIA 1FEBA 4GCMA 4H7UA 4CNKA 2FBWA 4U2LA 2AAQA 4U8NA 3FPZA 3AE4A 3PVCA 2ARDA 1LPFA 1FEAA 2YLTA 1KFYA 3V3OA 3CPJG 3BI2A 3UP4A 4Z2RA 3UOXA 1N4VA 4GRTA 3K7QX 1DJQA 3DK4A 4O5QA 3UTHA 2WP9A 3DJDA 3NYEA 3ZNNA 2WOIA 2GQFA 3DJEA 1S3BA 2YR4A 4P9SA 1ZMDA 2GMJA 4J33A 3NHOX 2BS4A 3Q6JA 1CC2A 4GDPA 4YJHB 4K8DA 4Z43A 3WE0A 3FG2P 1KNPA 2WDRA 3V76A 4A6NA 1JNRA 3AEFA 4FDCB 2WOVA 3H4KA 5LV9A 3GWFA 1DODA 1M6IA 1Z6LA 1AOGA 2X50A 1L0VA 1IUXA 4TLZA 1GT8A 1NEKA 3EF6A 4KPRA 3ALJA 2R4JA 4I58A 4NTDA 4TM1A 4H4VA 5EBKA 1NENA 1P2HA 3GD3A 3CNJA 3IC9A 3SQPA 1OJ9A 4H4QA 1DDOA 2GH5A 1GPEA 2B7SA 4WCTA 5J7XA 2AR8A 3ISHA 2WPCA 4NTEA 3DK9A 4OCGA 1CJ3A 4EMIA 1N4UA 1S3EA 1COYA 2YVJA 1B37A 2EQ6A 3II4A 3NN0X 2GF3A 1KIFA 3ADAB 3QSSA 3KD9A 4YWOA 4U2TA 4JY2A 1NHRA 3AEBA 3F8PA 4J31A 2WBAA 2C75A 4YTMA 2ACZA 1ONFA 3LXDA 2C7GA 3QSEA 3GWDA 3ICSA 1F3PA 3UP5A 3UTEA 5BUKA 4BV6A 2XLTA 3AEGA 2GR1A 2YAUA 1H6VA 2BK4A 1QJDA 2WETA 4AOSA 1B4VA 2C66A 4ADWA 2A87A 2GR2A 1YQ3A 2WPEA 1GESA 2I0ZA 4H4WA 1AN9A 2CULA 2YLZA 5TR3A 3UCLA 1ELIA 3NH3X 1IUTA 1KSUA 2BCPA 4U8PA 2C64A 1BGJA 1NDAA 4EQSA 4JY3A 1OJCA 2E1MA 1L9EA 1GRTA 2JB3A 4GF7A 2WU5A 2JAEA 3NKSA 3M13A 3NLCA 1CL0A 1H84A 4Z24A 4JDRA 1KNRA 4H2QA 2YG7A 3P4QA 3NYCA 3VR9A 2BC1A 4IVOB 4B69A 4NEWA 1XDIA 2VVLG 4BJYA 3ZNOA 2RABA 3LZWA 3P4PA 2XDOA 4YSYA 1O94A 1LQTA 1N4WA 3W4KA 3P1WA 4EQWA 2BYBA 1TDKA 2V6OA 1PBBA 1D7YA 2XLUA 3IWAA 4J36A 3ZYXA 2FJDA 3LADA 3VR8A 1NPXA 1GNDA 2FJAA 2R0CA 5JCMA 3G5SA 5L46A 4NEVA 2GAGB 3NT6A 4ICYA 2E82A 2XFOA 4REKA 3W4IA 1CJ4A 2B7RA 2R4EA 4Y4NA 4Z2TA 1NG3A 4YJFB 3AE6A 3UOYA 5KWFA 2VZ2A 4EMWA 3P4RA 3LZXA 1SEZA 1NHSA 4U8OA 4A99A 3B6DA 4H50A 3UOZA 4U2SA 4H4SA 3C4AA 1XHCA 1CBOA 3C4NA 2E49A 2H89A 3KU9A 5C3JA 3QFAA 1PXCA 1L9DA 2WS3A 3C96A 2EQ9A 2JB2A 5KXJA 2R46A 4K5RA 2OAMA 3D8XA 4EMJA 5HYMA 2BK5A 4D04A 2YG6A 3AD9B 1W4XA 3H8IA 2DU8A 3O0HA 4FK1C 4Z44A 3EANA 2WESA 1PXAA 1F8SA 3RHAA 5FMHA 2Q0LA 3LOVA 2BS2A 4GDEA 4X4JA 4ECHA 5C2TA 1TDOA 3K30A 5U25A 2C65A 2FJEA 4TM4A 1TDFA 1Q1RA 5GRTA 1GTEA 1GRGA 1ZDLA 2DKHA 2XFUA 5KVHA 2BACA 3AE3A 4RSLA 3I3LA 4IV9A 5IQ1A 3ZDNA 4DSHA 2XFNA 1VRQB 4H4XA 4K5SA 1K0IA 2JK6A 2VVMA 3QVRA 4XWRA 1C0LA 4TM0A 4PAAA 2QCUA 3F8DA 2F5ZA 4U8KA 1EL5A 1D5TA 2YG5A 1PBFA 2AQJA 4OVIA 4UP3A 1PN0A 2R45A 3M12A 2GMHA 3VQRA 4A6NB 2WP6A 4BK2A 1PJ7A 4C5OA 1GRHA 4C77A 2B76A 1RYIA 3AEDA 3NRNA 1KF6A 1H7WA 3UOVA 1YKJA 1GERA 1DOCA 1YQ4A 2GR3A 3KKJA 4U8JA 3GMCA 4H4RA 2B9YA 2ZZBA 5CKUA 1RP0A 4JNQA 1TYPA 1L9CA 1P2EA 3RP7A 4ZCCA 1E6EA 3ITJA 1Y0PA 1JNZA 1Q1WA 4EM3A 2XFQA 1CHUA 1UKVG 4NZHA 2V5ZA 2GRTA 5GSNA 3FBSA 4NTCA 3REDA 4AT2A 1TYTA 3NN6X 2XCGA 3ATQA 2GQWA 3ICRA 2PYXA 3CPIG 2APGA 4B63A 3AE7A 3GRSA 2JKCA 2WDQA 4APNA 1JRZA 1GETA 4PABA 1YQZA 3FIMB 1LTXR 2XYOA 2GR0A 3FMWA 1RSGA 4YKFA 1E1LA 2R9ZA 1NAAA 4M52A 5M0ZA 4A7AA 3AE8A 3UKHA 1PS9A 3NYFA 4CBQA 5FS7A 1CF3A 1QLBA 2YR6A 4LA1A 4OPCA 5M10A 1PHHA 2V3BA 3GYJA 3L8KA 4EM4A 5U63A 2GV8A 1YY5A 2GVCA 3CGCA 4OPTA 4B66A 2QAEA 3CGEA 4H4UA 1GXFA 3AB1A 4U8IA 2C3DA 4YSXA 3GDNA 2A8XA 3I6DA 3QVPA 4CY8A 1XPQA 1DJNA 2XVJA 3AEEA 4QFCA 1KSSA 3E1TA 3UTFA 3GD4A 1ZP0A 1IUUA 5KOXA 2XFPA 2BK3A 2Q6UA 2Y6RA 2IVDA 3UKQA 3OZ2A 1FECA 3LB8A 3V3NA 1D7LA 2X8GA 1BGNA 1B5QA 4Y4LA 3GYIA 1OJAA 2R0GA 4TM3A 4OPIA 5EB4A 2XVIA 2WPFA 3NG7X 3S61A 1O95A 4A5LA 3K7TA 3RP8A 1DNCA 2O9ZA 4JN9A 1MOKA 2NPXA 1IUSA 5JCNA 3AXBA 3ALMA 5KOWA 1MXTA 3AEAA 4A9WA 4YT0A 4XXGA 2XLPA 4B65A 1N1PA 1TRBA 4I59A 4BJZA 4JQ9A 2VVLA 2IVEA 3GSIA 3K7MX 4JNAA 5HY5A 3DH9A 3WGTA 3AD8B 2OLOA 2PHHA 1H7XA 2QA2A 4LU6A 5HXIA 3CPHG 1GSNA 2VQBA 1BF3A 5J60A 1JOAA 4CCRA 2CVJA 4A79A 1NHPA 2Z5XA 2CFYA 2BC0A 5BVAA 1OJTA 4A65A 3GRTA 2C72A 2DKIA 1IJHA 1OJDA 2A89A 1HYUA 2XVEA 3L1RA 2WEUA 4J57A 3T37A 4J2WA 4YTPA 3DK8A 4H2RA 4Y4MA 3UKFA 4CNJA 4EIPA 1F8RA 2TMDA 4GUVA 1E39A 3S5WA 4AT0A 2VQ7A 4KX6A 4USQA 4Z25A 3AYIA 3AE5A 3CGBA 1K4QA 2C76A 3SFEA 4AOXA 4D03A 4OPGA 3AD7B 2UZZA 1H83A 3NTDA 1LQUA 3W4JA 4USRA 1Y56A 4ZCDA 4ZN0A 1E7PA 1H81A 4IA6A 4YTNA 3AE9A 1JRYA 4GR1A 3COXA 1DOEA 2WP5A 4J34A 3KLJA 3ZNQA 4FK1A 1XANA 4OPLA 5IQ4A 2V3AA 3HZLA 3G5RA 2Y6QA 2J3NA 1NHQA 3QFBA 4C74A 3CIRA 2VRLA 1F6MA 3AECA 3NK0X 4H4PA 5JCKA 4BK1A 4AP3A 2E5VA 4B67A 4YJGA 3KPFA 3B3RA 1GRBA 3IF9A 1TDNA 2YM2A 3CNSA 5FS6A 2YG3A 1E1MA 1ZOVA 1TDEA 2BXRA 3SM8A 2E48A 4K2XA 5U1OA 4DNAA 2HQMA 4XWZA 2FJBA 3BNMA 2X8HA 2YLSA 4CCQA 1GALA 2IIDA 2JB1A 5BRTA 4H2PA 4H4TA 4BK3A 2EQ7A 4N9XA 1S2QA 3RNMA 3QJ4A 2B9WA 1CJ2A 3NIXA 3URHA 2NVKX 1BWCA 4RG4A 3AYLA 1BKWA 3NNEA 4BURA 2BXSA 4DSGA 3QSMA 1M64A 1ZX9A 2X3NA 4UDQA 5ER0A 3RP6A 1IUWA 2YG4A 4IVMB 3BHKA 3UKPA 5DBJA 4OPDA 3CNTA 4Z2UA 4C3XA 3UTGA 1K0JA 1GEUA 3CTYA 2B9XA 3AYJA 3DMEA 4AP1A 4J56A 1ZKQA 4MJWA 4U8LA 1NG4A 2ZBWA 3H8LA 4EIQA 1O5WA 1REOA 2YVFA 1FL2A 2Q0KA 1MO9A 3KVEA 4YJHA 2OA1A 5JCLA 4YJDA 3AE2A 3ZNPA 2XVHA 2C67A 4IA5A 4C3YA 2YQUA 2CDUA 1PBDA 2W0HA 3F8RA 3D1CA 3NGCX 1JU2A 2ZZ0A 3ALLA 1B8SA 2YM1A 2RGOA 1C0IA 1BZLA 1QO8A 2QA1A 3BNUA 2YVGA 1GRFA 2RGHA 1D4DA 1PXBA 2XLSA 1H86A 4B1BA 1EBDA 3EAOA 3DGHA 4CRTA 2WHDA 3GMBA 5HHFA 2Z5YA 2GB0A 1GREA 2C3CA 1PJ5A 4E0VA 3NK1X 5CQFA 1X31B 3M0OA 3GDPA 4TLXA 3G3EA 1JEHA 4H2NA 2C73A 2Q7VA 2OLNA 3BI4A 4X9NA 4UDRA 1GOSA 1ZK7A 4B68A 3ATRA 1PBCA 1E1NA 2OALA 4B64A 3DJJA 1E1KA 3CN8A 3ICTA 2XLRA 5FS9A 1CC6A 4Z26A 4H4ZA 2XVFA 4O5UA 4WX1A 2R0PA 1IUVA 4FX9A 3VRAA 3AE1A 3G5QA 4H4YA 3BHFA 1H82A 2GEWA 2JBVA 3UKAA 4EQRA 2GAHB 1D4CA 1Q9IA 2VOUA 2X99A 5FS8A 4DGKA 1PBEA 1GRAA 3NK2X 1EVIA 4YSZA 4HB9A 2WOWA 4YKGA 2WU2A 2YR5A 4RG3A 4YXDA 5BULA 1VDCA 1DOBA 1V59A 1DXLA 2WDVA 1C0KA 1GV4A 2H88A 1ZOYA 3OC4A 3Q9TA 3CUKA 1VQWA 3DA1A 3KA7A 2EQ8A 1VG9A 3IHGA 1ZMCA 5EOWA 3DJGX 1LJ1A 1C0PA 1Y56B 3SGLA 2YWLA 4K7ZA 5JCIA 4EQXA 1D4EA 4OPUA 3R9UA 2BABA 3UKLA 2BCGG 2E4GA 3DGZA 1EL7A 4X9MA 2BS3A 1JRXA 1ZY8A 2WQYA 3VRDB 1GTHA 1FCDA 2BA9A 4YJFA 2V60A 1EL9A 3ABVA 4UDPA 5IPYA 3VRBA 2V61A 4YJGB 2VRMA 2X8CA 3NTAA 1K0LA 1EL8A 4YSHA 3AWIA 3PO7A 2C70A 4U8MA
chains in the Genus database with same CATH superfamily
3CNPA 3CNDA 2RGJA 2E4AA 3SFDA 3UKKA 2TPRA 1FOHA 1S2YA 3PS9A 4K22A 4HA6A 2YLWA 3EPTA 3IHMA 3JSKA 2ZZCA 4II2A 1CC4A 1VE9A 1VG0A 1PJ6A 2YLRA 4G9KA 4LIIA 5EB5A 3BI5A 3P9UA 4QFDA 1LVLA 1DAOA 1LV0A 3LJPA 1CJCA 4CY6A 5KRQA 1F8WA 2YLXA 1KDGA 3CGDA 3P4SA 1PDHA 5KVIA 1FEBA 4GCMA 4H7UA 4CNKA 2FBWA 4U2LA 2AAQA 4U8NA 3FPZA 3AE4A 3PVCA 2ARDA 1LPFA 1FEAA 2YLTA 1KFYA 3T2ZA 3V3OA 3CPJG 3BI2A 3UP4A 4Z2RA 3UOXA 1N4VA 4GRTA 3K7QX 1DJQA 3DK4A 4O5QA 3UTHA 2WP9A 3DJDA 3NYEA 3ZNNA 2WOIA 2GQFA 2BRYA 3DJEA 1S3BA 2YR4A 4P9SA 1ZMDA 2GMJA 4J33A 3NHOX 2BS4A 3Q6JA 1CC2A 4GDPA 4YJHB 4K8DA 4Z43A 3WE0A 3T2KA 3FG2P 1KNPA 2WDRA 3V76A 4A6NA 1JNRA 3AEFA 4FDCB 2WOVA 3H4KA 5LV9A 3GWFA 1DODA 1M6IA 1Z6LA 3SYIA 1AOGA 2X50A 1L0VA 1IUXA 4TLZA 1GT8A 1NEKA 3EF6A 4KPRA 3ALJA 2R4JA 4I58A 4NTDA 4TM1A 4H4VA 5EBKA 1NENA 1P2HA 3GD3A 3CNJA 3IC9A 3SQPA 1OJ9A 4H4QA 1DDOA 2GH5A 1GPEA 2B7SA 4WCTA 5J7XA 2AR8A 3ISHA 2WPCA 4NTEA 3DK9A 4OCGA 1CJ3A 4EMIA 1N4UA 1S3EA 1COYA 2YVJA 1B37A 2EQ6A 3II4A 3NN0X 2GF3A 1KIFA 3ADAB 3QSSA 3KD9A 4YWOA 5KMRA 4U2TA 4JY2A 1NHRA 3AEBA 3F8PA 4J31A 2WBAA 2C75A 4YTMA 2ACZA 1ONFA 3LXDA 2C7GA 3QSEA 3GWDA 3ICSA 1F3PA 3UP5A 3UTEA 5BUKA 4BV6A 2XLTA 3AEGA 2GR1A 2YAUA 1H6VA 2BK4A 1QJDA 2WETA 4AOSA 1B4VA 2C66A 4ADWA 2A87A 2GR2A 1YQ3A 2WPEA 1GESA 2I0ZA 4H4WA 1AN9A 2CULA 2YLZA 5TR3A 3UCLA 1ELIA 3NH3X 1IUTA 5KNLA 1KSUA 2BCPA 4II3A 2C64A 1BGJA 4U8PA 1NDAA 4EQSA 4JY3A 1OJCA 2E1MA 1L9EA 1GRTA 4GF7A 2JB3A 2WU5A 2JAEA 3NKSA 3M13A 3NLCA 1CL0A 1H84A 4Z24A 4JDRA 1KNRA 4H2QA 2YG7A 3P4QA 3NYCA 3VR9A 2BC1A 4IVOB 4B69A 4NEWA 4BJYA 1XDIA 2VVLG 3ZNOA 2RABA 3LZWA 3P4PA 2XDOA 4YSYA 1O94A 1LQTA 1N4WA 3W4KA 3P1WA 4EQWA 2BYBA 1TDKA 2V6OA 1PBBA 1D7YA 2XLUA 3IWAA 4J36A 3ZYXA 2FJDA 3LADA 3VR8A 1NPXA 1GNDA 2FJAA 2R0CA 5JCMA 3G5SA 5L46A 4NEVA 2GAGB 3NT6A 4ICYA 2E82A 2XFOA 4REKA 3W4IA 1CJ4A 2B7RA 2R4EA 4Y4NA 4Z2TA 1NG3A 4YJFB 3AE6A 3UOYA 5KWFA 2VZ2A 4EMWA 3P4RA 3LZXA 1SEZA 1NHSA 4U8OA 4A99A 3B6DA 4H50A 3UOZA 4U2SA 4H4SA 3C4AA 1XHCA 1CBOA 3C4NA 2E49A 2H89A 3KU9A 5C3JA 3SXIA 3QFAA 1PXCA 1L9DA 3C96A 2WS3A 2EQ9A 2JB2A 5KXJA 2R46A 5HYMA 2OAMA 3D8XA 4K5RA 4EMJA 2BK5A 4D04A 2YG6A 3AD9B 1W4XA 3H8IA 2DU8A 3O0HA 4FK1C 4Z44A 3EANA 2WESA 1PXAA 1F8SA 3SX6A 3RHAA 5FMHA 2Q0LA 3LOVA 2BS2A 4GDEA 4X4JA 4ECHA 5C2TA 1TDOA 3K30A 5U25A 2C65A 2FJEA 4NNJA 4TM4A 1TDFA 1Q1RA 5GRTA 3SY4A 1GTEA 1GRGA 1ZDLA 2DKHA 2XFUA 5KVHA 2BACA 3AE3A 4RSLA 3I3LA 4IV9A 5IQ1A 3ZDNA 4DSHA 2XFNA 1VRQB 4H4XA 4K5SA 1K0IA 2JK6A 2VVMA 3QVRA 4XWRA 1C0LA 4TM0A 4PAAA 4G6HA 2QCUA 3F8DA 2F5ZA 4U8KA 1EL5A 1D5TA 2YG5A 1PBFA 2AQJA 4OVIA 4UP3A 1PN0A 2R45A 2GMHA 3M12A 3VQRA 4A6NB 2WP6A 4BK2A 1PJ7A 4C5OA 2BRAA 1GRHA 4C77A 2B76A 1RYIA 3AEDA 3NRNA 1KF6A 1H7WA 3UOVA 3SZCA 1YKJA 1GERA 1DOCA 1YQ4A 2GR3A 3KKJA 4U8JA 3GMCA 5KMSA 4H4RA 2B9YA 2ZZBA 5CKUA 1RP0A 4JNQA 1TYPA 1L9CA 1P2EA 3RP7A 3CMMA 1E6EA 4ZCCA 3ITJA 1Y0PA 4NWZA 1JNZA 1Q1WA 4EM3A 2XFQA 1CHUA 1UKVG 4NZHA 2V5ZA 2GRTA 5GSNA 3FBSA 4NTCA 3REDA 4AT2A 1TYTA 3NN6X 2XCGA 3ATQA 2GQWA 3ICRA 2PYXA 3CPIG 2APGA 4B63A 3AE7A 3GRSA 2JKCA 2WDQA 4APNA 1JRZA 1GETA 4PABA 1YQZA 3FIMB 1LTXR 2XYOA 2GR0A 3FMWA 1RSGA 4YKFA 1E1LA 2R9ZA 1NAAA 4M52A 5M0ZA 3SZFA 4A7AA 3AE8A 3UKHA 1PS9A 3NYFA 4CBQA 5FS7A 1CF3A 3T0KA 1QLBA 2YR6A 4LA1A 4OPCA 4G74A 5M10A 1PHHA 2V3BA 3GYJA 3L8KA 4EM4A 5U63A 2GV8A 1YY5A 2GVCA 3CGCA 4OPTA 4B66A 2QAEA 3CGEA 4H4UA 1GXFA 3AB1A 4U8IA 2C3DA 4YSXA 3GDNA 2A8XA 3I6DA 3QVPA 4CY8A 1XPQA 3E1TA 1DJNA 2XVJA 4QFCA 1KSSA 3AEEA 3UTFA 3GD4A 1ZP0A 1IUUA 5KOXA 2XFPA 2BK3A 2Q6UA 2Y6RA 2IVDA 3UKQA 3OZ2A 1FECA 3LB8A 3V3NA 1D7LA 2X8GA 1BGNA 1B5QA 4GAVA 4Y4LA 3GYIA 1OJAA 2R0GA 4TM3A 4OPIA 5EB4A 2XVIA 3SZWA 2WPFA 3NG7X 4G73A 3S61A 1O95A 4A5LA 3K7TA 3RP8A 1DNCA 2O9ZA 4JN9A 1MOKA 2NPXA 1IUSA 5JCNA 3ALMA 3AXBA 5KOWA 1MXTA 3AEAA 4A9WA 3HYWA 4YT0A 4XXGA 2XLPA 4B65A 1N1PA 4BJZA 1TRBA 4I59A 4JQ9A 2VVLA 2IVEA 3GSIA 3K7MX 4JNAA 5HY5A 3DH9A 3WGTA 3AD8B 3T14A 2OLOA 2PHHA 1H7XA 2QA2A 4LU6A 5HXIA 3CPHG 4G6GA 1GSNA 2VQBA 1BF3A 5J60A 1JOAA 4CCRA 2CVJA 4A79A 1NHPA 2Z5XA 2CFYA 2BC0A 5BVAA 1OJTA 4A65A 3GRTA 2C72A 2DKIA 1IJHA 1OJDA 2A89A 1HYUA 2XVEA 3L1RA 2WEUA 4J57A 3T37A 4J2WA 4YTPA 3DK8A 4H2RA 4Y4MA 5KMQA 3UKFA 4EIPA 4CNJA 1F8RA 2TMDA 4GUVA 1E39A 3S5WA 4AT0A 2VQ7A 4KX6A 4USQA 4Z25A 3AYIA 3AE5A 3CGBA 1K4QA 2C76A 3SFEA 4AOXA 4D03A 4OPGA 3AD7B 2UZZA 1H83A 3NTDA 1LQUA 3W4JA 4USRA 1Y56A 4ZCDA 4ZN0A 1E7PA 1H81A 4IA6A 4YTNA 3AE9A 1JRYA 4GR1A 3COXA 1DOEA 2WP5A 4J34A 3KLJA 3ZNQA 4FK1A 1XANA 4OPLA 5IQ4A 2V3AA 3HZLA 3G5RA 2Y6QA 2J3NA 1NHQA 3QFBA 4C74A 3CIRA 2VRLA 1F6MA 3AECA 3NK0X 4H4PA 5JCKA 4BK1A 4AP3A 2E5VA 4B67A 4YJGA 3KPFA 3B3RA 1GRBA 3IF9A 1TDNA 2YM2A 3CNSA 5FS6A 2YG3A 1E1MA 1ZOVA 1TDEA 2BXRA 3SM8A 2E48A 4K2XA 5U1OA 4DNAA 2HQMA 4XWZA 2FJBA 3BNMA 2X8HA 2YLSA 4CCQA 1GALA 2IIDA 2JB1A 5BRTA 4H2PA 4BK3A 4H4TA 2EQ7A 4N9XA 1S2QA 3RNMA 3QJ4A 5KMPA 3KPKA 2B9WA 1CJ2A 3NIXA 3GYXA 3URHA 2NVKX 1BWCA 4RG4A 3AYLA 1BKWA 3NNEA 4BURA 2BXSA 4DSGA 3QSMA 1M64A 2X3NA 3RP6A 1ZX9A 4UDQA 5ER0A 1IUWA 2YG4A 4IVMB 3BHKA 3UKPA 5DBJA 4OPDA 3CNTA 4Z2UA 4C3XA 3UTGA 1K0JA 1GEUA 2C4CA 2B9XA 3AYJA 3DMEA 3CTYA 4AP1A 4J56A 1ZKQA 4MJWA 4U8LA 1NG4A 4EIQA 2ZBWA 3H8LA 1O5WA 1REOA 2YVFA 1FL2A 2Q0KA 1MO9A 3KVEA 4YJHA 2OA1A 5JCLA 4YJDA 3AE2A 3ZNPA 2XVHA 4IA5A 2C67A 4C3YA 2YQUA 2CDUA 1PBDA 2W0HA 3F8RA 3D1CA 3NGCX 1JU2A 2ZZ0A 4GAPA 3ALLA 1B8SA 2YM1A 2RGOA 1C0IA 1BZLA 1QO8A 2QA1A 3BNUA 2YVGA 1GRFA 3SZ0A 2RGHA 1D4DA 1PXBA 2XLSA 1H86A 4B1BA 1EBDA 3EAOA 3DGHA 4CRTA 2WHDA 3GMBA 5HHFA 2Z5YA 2GB0A 1GREA 2C3CA 1PJ5A 4E0VA 3NK1X 5CQFA 1X31B 3M0OA 3GDPA 4TLXA 3G3EA 3T31A 4H2NA 1JEHA 2C73A 2Q7VA 2OLNA 3BI4A 4X9NA 4UDRA 1GOSA 1ZK7A 4B68A 3ATRA 1PBCA 1E1NA 2OALA 4B64A 3DJJA 1E1KA 3CN8A 3ICTA 2XLRA 5FS9A 1CC6A 4Z26A 4H4ZA 2XVFA 3HYXA 4O5UA 4WX1A 2R0PA 1IUVA 4FX9A 3VRAA 3AE1A 3G5QA 4H4YA 3BHFA 1H82A 2GEWA 2JBVA 3UKAA 4EQRA 2GAHB 2VOUA 1D4CA 1Q9IA 2X99A 5FS8A 4DGKA 1PBEA 1GRAA 3NK2X 1EVIA 4YSZA 4HB9A 2WOWA 4YKGA 2WU2A 2YR5A 4RG3A 4YXDA 5BULA 1VDCA 1DOBA 1V59A 1DXLA 2WDVA 1C0KA 1GV4A 2H88A 1ZOYA 3OC4A 3Q9TA 3CUKA 1VQWA 3DA1A 3KA7A 3T2YA 2EQ8A 1VG9A 3IHGA 1ZMCA 5EOWA 3DJGX 1LJ1A 1C0PA 1Y56B 3SGLA 2YWLA 4K7ZA 5JCIA 4EQXA 1D4EA 4OPUA 3HYVA 3R9UA 2BABA 3UKLA 2BCGG 2E4GA 3DGZA 1EL7A 4X9MA 2BS3A 1JRXA 1ZY8A 2WQYA 3VRDB 1GTHA 1FCDA 2BA9A 4YJFA 2V60A 1EL9A 3ABVA 4UDPA 5IPYA 3VRBA 2V61A 4YJGB 2VRMA 2X8CA 3NTAA 1K0LA 1EL8A 4YSHA 3AWIA 3PO7A 2C70A 4U8MA
chains in the Genus database with same CATH topology
3CNPA 3CNDA 2RGJA 2E4AA 3SFDA 3UKKA 2TPRA 1FOHA 1S2YA 3PS9A 4K22A 4HA6A 2YLWA 3EPTA 3IHMA 3JSKA 2ZZCA 4II2A 1CC4A 1VE9A 1VG0A 1PJ6A 2YLRA 4G9KA 4LIIA 5EB5A 3BI5A 3P9UA 4QFDA 1LVLA 1DAOA 1LV0A 3LJPA 1CJCA 4CY6A 5KRQA 1F8WA 2YLXA 1KDGA 3CGDA 3P4SA 1PDHA 5KVIA 1FEBA 4GCMA 4H7UA 4CNKA 2FBWA 4U2LA 2AAQA 4U8NA 3FPZA 3AE4A 3PVCA 2ARDA 1LPFA 1FEAA 2YLTA 1KFYA 3T2ZA 3V3OA 3CPJG 3BI2A 3UP4A 4Z2RA 3UOXA 1N4VA 4GRTA 3K7QX 1DJQA 3DK4A 4O5QA 3UTHA 2WP9A 3DJDA 3NYEA 3ZNNA 2WOIA 2GQFA 2BRYA 3DJEA 1S3BA 2YR4A 4P9SA 1ZMDA 2GMJA 4J33A 3NHOX 2BS4A 3Q6JA 1CC2A 4GDPA 4YJHB 4K8DA 4Z43A 3WE0A 3T2KA 3FG2P 1KNPA 2WDRA 3V76A 4A6NA 1JNRA 3AEFA 4FDCB 2WOVA 3H4KA 5LV9A 3GWFA 1DODA 1M6IA 1Z6LA 3SYIA 1AOGA 2X50A 1L0VA 1IUXA 4TLZA 1GT8A 1NEKA 3EF6A 4KPRA 3ALJA 2R4JA 4I58A 4NTDA 4TM1A 4H4VA 5EBKA 1NENA 1P2HA 3GD3A 3CNJA 3IC9A 3SQPA 1OJ9A 4H4QA 1DDOA 2GH5A 1GPEA 2B7SA 4WCTA 5J7XA 2AR8A 3ISHA 2WPCA 4NTEA 3DK9A 4OCGA 1CJ3A 4EMIA 1N4UA 1S3EA 1COYA 2YVJA 1B37A 2EQ6A 3II4A 3NN0X 2GF3A 1KIFA 3ADAB 3QSSA 3KD9A 4YWOA 5KMRA 4U2TA 4JY2A 1NHRA 3AEBA 3F8PA 4J31A 2WBAA 2C75A 4YTMA 2ACZA 1ONFA 3LXDA 2C7GA 3QSEA 3GWDA 3ICSA 1F3PA 3UP5A 3UTEA 5BUKA 4BV6A 2XLTA 3AEGA 2GR1A 2YAUA 1H6VA 2BK4A 1QJDA 2WETA 4AOSA 1B4VA 2C66A 4ADWA 2A87A 2GR2A 1YQ3A 2WPEA 1GESA 2I0ZA 4H4WA 1AN9A 2CULA 2YLZA 5TR3A 3UCLA 1ELIA 3NH3X 1IUTA 5KNLA 1KSUA 2BCPA 4II3A 2C64A 1BGJA 4U8PA 1NDAA 4EQSA 4JY3A 1OJCA 2E1MA 1L9EA 1GRTA 2JB3A 4GF7A 2WU5A 2JAEA 3NKSA 3M13A 3NLCA 1CL0A 1H84A 4Z24A 4JDRA 1KNRA 4H2QA 2YG7A 3P4QA 3NYCA 3VR9A 2BC1A 4IVOB 4B69A 4NEWA 1XDIA 2VVLG 4BJYA 3ZNOA 2RABA 3LZWA 3P4PA 2XDOA 4YSYA 1O94A 1LQTA 1N4WA 3W4KA 3P1WA 4EQWA 2BYBA 1TDKA 2V6OA 1PBBA 1D7YA 2XLUA 3IWAA 4J36A 3ZYXA 2FJDA 3LADA 3VR8A 1NPXA 1GNDA 2FJAA 2R0CA 5JCMA 3G5SA 5L46A 4NEVA 2GAGB 3NT6A 4ICYA 2E82A 2XFOA 4REKA 3W4IA 1CJ4A 2B7RA 2R4EA 4Y4NA 4Z2TA 1NG3A 4YJFB 3AE6A 3UOYA 5KWFA 2VZ2A 4EMWA 3P4RA 3LZXA 1SEZA 1NHSA 4U8OA 4A99A 3B6DA 4H50A 3UOZA 4U2SA 4H4SA 3C4AA 1XHCA 1CBOA 3C4NA 2E49A 2H89A 3KU9A 5C3JA 3SXIA 3QFAA 1PXCA 1L9DA 2WS3A 3C96A 2EQ9A 2JB2A 5KXJA 2R46A 4K5RA 2OAMA 3D8XA 4EMJA 5HYMA 2BK5A 4D04A 2YG6A 3AD9B 1W4XA 3H8IA 2DU8A 3O0HA 4FK1C 4Z44A 3EANA 2WESA 1PXAA 1F8SA 3SX6A 3RHAA 5FMHA 2Q0LA 3LOVA 2BS2A 4GDEA 4X4JA 4ECHA 5C2TA 1TDOA 3K30A 5U25A 2C65A 2FJEA 4NNJA 4TM4A 1TDFA 1Q1RA 5GRTA 3SY4A 1GTEA 1GRGA 1ZDLA 2DKHA 2XFUA 5KVHA 2BACA 3AE3A 4RSLA 3I3LA 4IV9A 5IQ1A 3ZDNA 4DSHA 2XFNA 1VRQB 4H4XA 4K5SA 1K0IA 2JK6A 2VVMA 3QVRA 4XWRA 1C0LA 4TM0A 4PAAA 4G6HA 2QCUA 3F8DA 2F5ZA 4U8KA 1EL5A 1D5TA 2YG5A 1PBFA 2AQJA 4OVIA 4UP3A 1PN0A 2R45A 3M12A 2GMHA 3VQRA 4A6NB 2WP6A 4BK2A 1PJ7A 4C5OA 2BRAA 1GRHA 4C77A 2B76A 1RYIA 3AEDA 3NRNA 1KF6A 1H7WA 3UOVA 3SZCA 1YKJA 1GERA 1DOCA 1YQ4A 2GR3A 3KKJA 4U8JA 3GMCA 5KMSA 4H4RA 2B9YA 2ZZBA 5CKUA 1RP0A 4JNQA 1TYPA 1L9CA 1P2EA 3RP7A 3CMMA 1E6EA 4ZCCA 3ITJA 1Y0PA 4NWZA 1JNZA 1Q1WA 4EM3A 2XFQA 1CHUA 1UKVG 4NZHA 2V5ZA 2GRTA 5GSNA 3FBSA 4NTCA 3REDA 4AT2A 1TYTA 3NN6X 2XCGA 3ATQA 2GQWA 3ICRA 2PYXA 3CPIG 2APGA 4B63A 3AE7A 3GRSA 2JKCA 2WDQA 4APNA 1JRZA 1GETA 4PABA 1YQZA 3FIMB 1LTXR 2XYOA 2GR0A 3FMWA 1RSGA 4YKFA 1E1LA 2R9ZA 1NAAA 4M52A 5M0ZA 3SZFA 4A7AA 3AE8A 3UKHA 1PS9A 3NYFA 4CBQA 5FS7A 1CF3A 3T0KA 1QLBA 2YR6A 4LA1A 4OPCA 4G74A 5M10A 1PHHA 2V3BA 3GYJA 3L8KA 4EM4A 5U63A 2GV8A 1YY5A 2GVCA 3CGCA 4OPTA 4B66A 2QAEA 3CGEA 4H4UA 1GXFA 3AB1A 4U8IA 2C3DA 4YSXA 3GDNA 2A8XA 3I6DA 3QVPA 4CY8A 1XPQA 1DJNA 2XVJA 3AEEA 4QFCA 1KSSA 3E1TA 3UTFA 3GD4A 1ZP0A 1IUUA 5KOXA 2XFPA 2BK3A 2Q6UA 2Y6RA 2IVDA 3UKQA 3OZ2A 1FECA 3LB8A 3V3NA 1D7LA 2X8GA 1BGNA 1B5QA 4GAVA 4Y4LA 3GYIA 1OJAA 2R0GA 4TM3A 4OPIA 5EB4A 2XVIA 3SZWA 2WPFA 3NG7X 4G73A 3S61A 1O95A 4A5LA 3K7TA 3RP8A 1DNCA 2O9ZA 4JN9A 1MOKA 2NPXA 1IUSA 5JCNA 3AXBA 3ALMA 5KOWA 1MXTA 3AEAA 4A9WA 3HYWA 4YT0A 4XXGA 2XLPA 4B65A 1N1PA 1TRBA 4I59A 4BJZA 4JQ9A 2VVLA 2IVEA 3GSIA 3K7MX 4JNAA 5HY5A 3DH9A 3WGTA 3AD8B 3T14A 2OLOA 2PHHA 1H7XA 2QA2A 4LU6A 5HXIA 3CPHG 4G6GA 1GSNA 2VQBA 1BF3A 5J60A 1JOAA 4CCRA 2CVJA 4A79A 1NHPA 2Z5XA 2CFYA 2BC0A 5BVAA 1OJTA 4A65A 3GRTA 2C72A 2DKIA 1IJHA 1OJDA 2A89A 1HYUA 2XVEA 3L1RA 2WEUA 4J57A 3T37A 4J2WA 4YTPA 3DK8A 4H2RA 4Y4MA 5KMQA 3UKFA 4CNJA 4EIPA 1F8RA 2TMDA 4GUVA 1E39A 3S5WA 4AT0A 2VQ7A 4KX6A 4USQA 4Z25A 3AYIA 3AE5A 3CGBA 1K4QA 2C76A 3SFEA 4AOXA 4D03A 4OPGA 3AD7B 2UZZA 1H83A 3NTDA 1LQUA 3W4JA 4USRA 1Y56A 4ZCDA 4ZN0A 1E7PA 1H81A 4IA6A 4YTNA 3AE9A 1JRYA 4GR1A 3COXA 1DOEA 2WP5A 4J34A 3KLJA 3ZNQA 4FK1A 1XANA 4OPLA 5IQ4A 2V3AA 3HZLA 3G5RA 2Y6QA 2J3NA 1NHQA 3QFBA 4C74A 3CIRA 2VRLA 1F6MA 3AECA 3NK0X 4H4PA 5JCKA 4BK1A 4AP3A 2E5VA 4B67A 4YJGA 3KPFA 3B3RA 1GRBA 3IF9A 1TDNA 2YM2A 3CNSA 5FS6A 2YG3A 1E1MA 1ZOVA 1TDEA 2BXRA 3SM8A 2E48A 4K2XA 5U1OA 4DNAA 2HQMA 4XWZA 2FJBA 3BNMA 2X8HA 2YLSA 4CCQA 1GALA 2IIDA 2JB1A 5BRTA 4H2PA 4H4TA 4BK3A 2EQ7A 4N9XA 1S2QA 3RNMA 3QJ4A 5KMPA 3KPKA 2B9WA 1CJ2A 3NIXA 3GYXA 3URHA 2NVKX 1BWCA 4RG4A 3AYLA 1BKWA 3NNEA 4BURA 2BXSA 4DSGA 3QSMA 1M64A 1ZX9A 2X3NA 4UDQA 5ER0A 3RP6A 1IUWA 2YG4A 4IVMB 3BHKA 3UKPA 5DBJA 4OPDA 3CNTA 4Z2UA 4C3XA 3UTGA 1K0JA 1GEUA 2C4CA 2B9XA 3AYJA 3DMEA 3CTYA 4AP1A 4J56A 1ZKQA 4MJWA 4U8LA 1NG4A 2ZBWA 3H8LA 4EIQA 1O5WA 1REOA 2YVFA 1FL2A 2Q0KA 1MO9A 3KVEA 4YJHA 2OA1A 5JCLA 4YJDA 3AE2A 3ZNPA 2XVHA 2C67A 4IA5A 4C3YA 2YQUA 2CDUA 1PBDA 2W0HA 3F8RA 3D1CA 3NGCX 1JU2A 2ZZ0A 4GAPA 3ALLA 1B8SA 2YM1A 2RGOA 1C0IA 1BZLA 1QO8A 2QA1A 3BNUA 2YVGA 1GRFA 3SZ0A 2RGHA 1D4DA 1PXBA 2XLSA 1H86A 4B1BA 1EBDA 3EAOA 3DGHA 4CRTA 2WHDA 3GMBA 5HHFA 2Z5YA 2GB0A 1GREA 2C3CA 1PJ5A 4E0VA 3NK1X 5CQFA 1X31B 3M0OA 3GDPA 4TLXA 3G3EA 3T31A 1JEHA 4H2NA 2C73A 2Q7VA 2OLNA 3BI4A 4X9NA 4UDRA 1GOSA 1ZK7A 4B68A 3ATRA 1PBCA 1E1NA 2OALA 4B64A 3DJJA 1E1KA 3CN8A 3ICTA 2XLRA 5FS9A 1CC6A 4Z26A 4H4ZA 2XVFA 3HYXA 4O5UA 4WX1A 2R0PA 1IUVA 4FX9A 3VRAA 3AE1A 3G5QA 4H4YA 3BHFA 1H82A 2GEWA 2JBVA 3UKAA 4EQRA 2GAHB 1D4CA 1Q9IA 2VOUA 2X99A 5FS8A 4DGKA 1PBEA 1GRAA 3NK2X 1EVIA 4YSZA 4HB9A 2WOWA 4YKGA 2WU2A 2YR5A 4RG3A 4YXDA 5BULA 1VDCA 1DOBA 1V59A 1DXLA 2WDVA 1C0KA 1GV4A 2H88A 1ZOYA 3OC4A 3Q9TA 3CUKA 1VQWA 3DA1A 3KA7A 3T2YA 2EQ8A 1VG9A 3IHGA 1ZMCA 5EOWA 3DJGX 1LJ1A 1C0PA 1Y56B 3SGLA 2YWLA 4K7ZA 5JCIA 4EQXA 1D4EA 4OPUA 3HYVA 3R9UA 2BABA 3UKLA 2BCGG 2E4GA 3DGZA 1EL7A 4X9MA 2BS3A 1JRXA 1ZY8A 2WQYA 3VRDB 1GTHA 1FCDA 2BA9A 4YJFA 2V60A 1EL9A 3ABVA 4UDPA 5IPYA 3VRBA 2V61A 4YJGB 2VRMA 2X8CA 3NTAA 1K0LA 1EL8A 4YSHA 3AWIA 3PO7A 2C70A 4U8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNP A;  3CND A;  2RGJ A;  2E4A A;  3SFD A;  3UKK A;  2TPR A;  1FOH A;  1S2Y A;  3PS9 A;  4K22 A;  4HA6 A;  2YLW A;  3EPT A;  3IHM A;  3JSK A;  2ZZC A;  1CC4 A;  1VE9 A;  1VG0 A;  1PJ6 A;  2YLR A;  4LII A;  5EB5 A;  3BI5 A;  3P9U A;  4QFD A;  1LVL A;  1DAO A;  1LV0 A;  3LJP A;  1CJC A;  4CY6 A;  5KRQ A;  1F8W A;  2YLX A;  1KDG A;  3CGD A;  3P4S A;  1PDH A;  5KVI A;  1FEB A;  4GCM A;  4H7U A;  4CNK A;  2FBW A;  4U2L A;  2AAQ A;  4U8N A;  3FPZ A;  3AE4 A;  3PVC A;  2ARD A;  1LPF A;  1FEA A;  2YLT A;  1KFY A;  3V3O A;  3CPJ G;  3BI2 A;  3UP4 A;  4Z2R A;  3UOX A;  1N4V A;  4GRT A;  3K7Q X;  1DJQ A;  3DK4 A;  4O5Q A;  3UTH A;  2WP9 A;  3DJD A;  3NYE A;  3ZNN A;  2WOI A;  2GQF A;  3DJE A;  1S3B A;  2YR4 A;  4P9S A;  1ZMD A;  2GMJ A;  4J33 A;  3NHO X;  2BS4 A;  3Q6J A;  1CC2 A;  4GDP A;  4YJH B;  4K8D A;  4Z43 A;  3WE0 A;  3FG2 P;  1KNP A;  2WDR A;  3V76 A;  4A6N A;  1JNR A;  3AEF A;  4FDC B;  2WOV A;  3H4K A;  5LV9 A;  3GWF A;  1DOD A;  1M6I A;  1Z6L A;  1AOG A;  2X50 A;  1L0V A;  1IUX A;  4TLZ A;  1GT8 A;  1NEK A;  3EF6 A;  4KPR A;  3ALJ A;  2R4J A;  4I58 A;  4NTD A;  4TM1 A;  4H4V A;  5EBK A;  1NEN A;  1P2H A;  3GD3 A;  3CNJ A;  3IC9 A;  3SQP A;  1OJ9 A;  4H4Q A;  1DDO A;  2GH5 A;  1GPE A;  2B7S A;  4WCT A;  5J7X A;  2AR8 A;  3ISH A;  2WPC A;  4NTE A;  3DK9 A;  4OCG A;  1CJ3 A;  4EMI A;  1N4U A;  1S3E A;  1COY A;  2YVJ A;  1B37 A;  2EQ6 A;  3II4 A;  3NN0 X;  2GF3 A;  1KIF A;  3ADA B;  3QSS A;  3KD9 A;  4YWO A;  4U2T A;  4JY2 A;  1NHR A;  3AEB A;  3F8P A;  4J31 A;  2WBA A;  2C75 A;  4YTM A;  2ACZ A;  1ONF A;  3LXD A;  2C7G A;  3QSE A;  3GWD A;  3ICS A;  1F3P A;  3UP5 A;  3UTE A;  5BUK A;  4BV6 A;  2XLT A;  3AEG A;  2GR1 A;  2YAU A;  1H6V A;  2BK4 A;  1QJD A;  2WET A;  4AOS A;  1B4V A;  2C66 A;  4ADW A;  2A87 A;  2GR2 A;  1YQ3 A;  2WPE A;  1GES A;  2I0Z A;  4H4W A;  1AN9 A;  2CUL A;  2YLZ A;  5TR3 A;  3UCL A;  1ELI A;  3NH3 X;  1IUT A;  1KSU A;  2BCP A;  4U8P A;  2C64 A;  1BGJ A;  1NDA A;  4EQS A;  4JY3 A;  1OJC A;  2E1M A;  1L9E A;  1GRT A;  2JB3 A;  4GF7 A;  2WU5 A;  2JAE A;  3NKS A;  3M13 A;  3NLC A;  1CL0 A;  1H84 A;  4Z24 A;  4JDR A;  1KNR A;  4H2Q A;  2YG7 A;  3P4Q A;  3NYC A;  3VR9 A;  2BC1 A;  4IVO B;  4B69 A;  4NEW A;  1XDI A;  2VVL G;  4BJY A;  3ZNO A;  2RAB A;  3LZW A;  3P4P A;  2XDO A;  4YSY A;  1O94 A;  1LQT A;  1N4W A;  3W4K A;  3P1W A;  4EQW A;  2BYB A;  1TDK A;  2V6O A;  1PBB A;  1D7Y A;  2XLU A;  3IWA A;  4J36 A;  3ZYX A;  2FJD A;  3LAD A;  3VR8 A;  1NPX A;  1GND A;  2FJA A;  2R0C A;  5JCM A;  3G5S A;  5L46 A;  4NEV A;  2GAG B;  3NT6 A;  4ICY A;  2E82 A;  2XFO A;  4REK A;  3W4I A;  1CJ4 A;  2B7R A;  2R4E A;  4Y4N A;  4Z2T A;  1NG3 A;  4YJF B;  3AE6 A;  3UOY A;  5KWF A;  2VZ2 A;  4EMW A;  3P4R A;  3LZX A;  1SEZ A;  1NHS A;  4U8O A;  4A99 A;  3B6D A;  4H50 A;  3UOZ A;  4U2S A;  4H4S A;  3C4A A;  1XHC A;  1CBO A;  3C4N A;  2E49 A;  2H89 A;  3KU9 A;  5C3J A;  3QFA A;  1PXC A;  1L9D A;  2WS3 A;  3C96 A;  2EQ9 A;  2JB2 A;  5KXJ A;  2R46 A;  4K5R A;  2OAM A;  3D8X A;  4EMJ A;  5HYM A;  2BK5 A;  4D04 A;  2YG6 A;  3AD9 B;  1W4X A;  3H8I A;  2DU8 A;  3O0H A;  4FK1 C;  4Z44 A;  3EAN A;  2WES A;  1PXA A;  1F8S A;  3RHA A;  5FMH A;  2Q0L A;  3LOV A;  2BS2 A;  4GDE A;  4X4J A;  4ECH A;  5C2T A;  1TDO A;  3K30 A;  5U25 A;  2C65 A;  2FJE A;  4TM4 A;  1TDF A;  1Q1R A;  5GRT A;  1GTE A;  1GRG A;  1ZDL A;  2DKH A;  2XFU A;  5KVH A;  2BAC A;  3AE3 A;  4RSL A;  3I3L A;  4IV9 A;  5IQ1 A;  3ZDN A;  4DSH A;  2XFN A;  1VRQ B;  4H4X A;  4K5S A;  1K0I A;  2JK6 A;  2VVM A;  3QVR A;  4XWR A;  1C0L A;  4TM0 A;  4PAA A;  2QCU A;  3F8D A;  2F5Z A;  4U8K A;  1EL5 A;  1D5T A;  2YG5 A;  1PBF A;  2AQJ A;  4OVI A;  4UP3 A;  1PN0 A;  2R45 A;  3M12 A;  2GMH A;  3VQR A;  4A6N B;  2WP6 A;  4BK2 A;  1PJ7 A;  4C5O A;  1GRH A;  4C77 A;  2B76 A;  1RYI A;  3AED A;  3NRN A;  1KF6 A;  1H7W A;  3UOV A;  1YKJ A;  1GER A;  1DOC A;  1YQ4 A;  2GR3 A;  3KKJ A;  4U8J A;  3GMC A;  4H4R A;  2B9Y A;  2ZZB A;  5CKU A;  1RP0 A;  4JNQ A;  1TYP A;  1L9C A;  1P2E A;  3RP7 A;  4ZCC A;  1E6E A;  3ITJ A;  1Y0P A;  1JNZ A;  1Q1W A;  4EM3 A;  2XFQ A;  1CHU A;  1UKV G;  4NZH A;  2V5Z A;  2GRT A;  5GSN A;  3FBS A;  4NTC A;  3RED A;  4AT2 A;  1TYT A;  3NN6 X;  2XCG A;  3ATQ A;  2GQW A;  3ICR A;  2PYX A;  3CPI G;  2APG A;  4B63 A;  3AE7 A;  3GRS A;  2JKC A;  2WDQ A;  4APN A;  1JRZ A;  1GET A;  4PAB A;  1YQZ A;  3FIM B;  1LTX R;  2XYO A;  2GR0 A;  3FMW A;  1RSG A;  4YKF A;  1E1L A;  2R9Z A;  1NAA A;  4M52 A;  5M0Z A;  4A7A A;  3AE8 A;  3UKH A;  1PS9 A;  3NYF A;  4CBQ A;  5FS7 A;  1CF3 A;  1QLB A;  2YR6 A;  4LA1 A;  4OPC A;  5M10 A;  1PHH A;  2V3B A;  3GYJ A;  3L8K A;  4EM4 A;  5U63 A;  2GV8 A;  1YY5 A;  2GVC A;  3CGC A;  4OPT A;  4B66 A;  2QAE A;  3CGE A;  4H4U A;  1GXF A;  3AB1 A;  4U8I A;  2C3D A;  4YSX A;  3GDN A;  2A8X A;  3I6D A;  3QVP A;  4CY8 A;  1XPQ A;  1DJN A;  2XVJ A;  3AEE A;  4QFC A;  1KSS A;  3E1T A;  3UTF A;  3GD4 A;  1ZP0 A;  1IUU A;  5KOX A;  2XFP A;  2BK3 A;  2Q6U A;  2Y6R A;  2IVD A;  3UKQ A;  3OZ2 A;  1FEC A;  3LB8 A;  3V3N A;  1D7L A;  2X8G A;  1BGN A;  1B5Q A;  4Y4L A;  3GYI A;  1OJA A;  2R0G A;  4TM3 A;  4OPI A;  5EB4 A;  2XVI A;  2WPF A;  3NG7 X;  3S61 A;  1O95 A;  4A5L A;  3K7T A;  3RP8 A;  1DNC A;  2O9Z A;  4JN9 A;  1MOK A;  2NPX A;  1IUS A;  5JCN A;  3AXB A;  3ALM A;  5KOW A;  1MXT A;  3AEA A;  4A9W A;  4YT0 A;  4XXG A;  2XLP A;  4B65 A;  1N1P A;  1TRB A;  4I59 A;  4BJZ A;  4JQ9 A;  2VVL A;  2IVE A;  3GSI A;  3K7M X;  4JNA A;  5HY5 A;  3DH9 A;  3WGT A;  3AD8 B;  2OLO A;  2PHH A;  1H7X A;  2QA2 A;  4LU6 A;  5HXI A;  3CPH G;  1GSN A;  2VQB A;  1BF3 A;  5J60 A;  1JOA A;  4CCR A;  2CVJ A;  4A79 A;  1NHP A;  2Z5X A;  2CFY A;  2BC0 A;  5BVA A;  1OJT A;  4A65 A;  3GRT A;  2C72 A;  2DKI A;  1IJH A;  1OJD A;  2A89 A;  1HYU A;  2XVE A;  3L1R A;  2WEU A;  4J57 A;  3T37 A;  4J2W A;  4YTP A;  3DK8 A;  4H2R A;  4Y4M A;  3UKF A;  4CNJ A;  4EIP A;  1F8R A;  2TMD A;  4GUV A;  1E39 A;  3S5W A;  4AT0 A;  2VQ7 A;  4KX6 A;  4USQ A;  4Z25 A;  3AYI A;  3AE5 A;  3CGB A;  1K4Q A;  2C76 A;  3SFE A;  4AOX A;  4D03 A;  4OPG A;  3AD7 B;  2UZZ A;  1H83 A;  3NTD A;  1LQU A;  3W4J A;  4USR A;  1Y56 A;  4ZCD A;  4ZN0 A;  1E7P A;  1H81 A;  4IA6 A;  4YTN A;  3AE9 A;  1JRY A;  4GR1 A;  3COX A;  1DOE A;  2WP5 A;  4J34 A;  3KLJ A;  3ZNQ A;  4FK1 A;  1XAN A;  4OPL A;  5IQ4 A;  2V3A A;  3HZL A;  3G5R A;  2Y6Q A;  2J3N A;  1NHQ A;  3QFB A;  4C74 A;  3CIR A;  2VRL A;  1F6M A;  3AEC A;  3NK0 X;  4H4P A;  5JCK A;  4BK1 A;  4AP3 A;  2E5V A;  4B67 A;  4YJG A;  3KPF A;  3B3R A;  1GRB A;  3IF9 A;  1TDN A;  2YM2 A;  3CNS A;  5FS6 A;  2YG3 A;  1E1M A;  1ZOV A;  1TDE A;  2BXR A;  3SM8 A;  2E48 A;  4K2X A;  5U1O A;  4DNA A;  2HQM A;  4XWZ A;  2FJB A;  3BNM A;  2X8H A;  2YLS A;  4CCQ A;  1GAL A;  2IID A;  2JB1 A;  5BRT A;  4H2P A;  4H4T A;  4BK3 A;  2EQ7 A;  4N9X A;  1S2Q A;  3RNM A;  3QJ4 A;  2B9W A;  1CJ2 A;  3NIX A;  3URH A;  2NVK X;  1BWC A;  4RG4 A;  3AYL A;  1BKW A;  3NNE A;  4BUR A;  2BXS A;  4DSG A;  3QSM A;  1M64 A;  1ZX9 A;  2X3N A;  4UDQ A;  5ER0 A;  3RP6 A;  1IUW A;  2YG4 A;  4IVM B;  3BHK A;  3UKP A;  5DBJ A;  4OPD A;  3CNT A;  4Z2U A;  4C3X A;  3UTG A;  1K0J A;  1GEU A;  3CTY A;  2B9X A;  3AYJ A;  3DME A;  4AP1 A;  4J56 A;  1ZKQ A;  4MJW A;  4U8L A;  1NG4 A;  2ZBW A;  3H8L A;  4EIQ A;  1O5W A;  1REO A;  2YVF A;  1FL2 A;  2Q0K A;  1MO9 A;  3KVE A;  4YJH A;  2OA1 A;  5JCL A;  4YJD A;  3AE2 A;  3ZNP A;  2XVH A;  2C67 A;  4IA5 A;  4C3Y A;  2YQU A;  2CDU A;  1PBD A;  2W0H A;  3F8R A;  3D1C A;  3NGC X;  1JU2 A;  2ZZ0 A;  3ALL A;  1B8S A;  2YM1 A;  2RGO A;  1C0I A;  1BZL A;  1QO8 A;  2QA1 A;  3BNU A;  2YVG A;  1GRF A;  2RGH A;  1D4D A;  1PXB A;  2XLS A;  1H86 A;  4B1B A;  1EBD A;  3EAO A;  3DGH A;  4CRT A;  2WHD A;  3GMB A;  5HHF A;  2Z5Y A;  2GB0 A;  1GRE A;  2C3C A;  1PJ5 A;  4E0V A;  3NK1 X;  5CQF A;  1X31 B;  3M0O A;  3GDP A;  4TLX A;  3G3E A;  1JEH A;  4H2N A;  2C73 A;  2Q7V A;  2OLN A;  3BI4 A;  4X9N A;  4UDR A;  1GOS A;  1ZK7 A;  4B68 A;  3ATR A;  1PBC A;  1E1N A;  2OAL A;  4B64 A;  3DJJ A;  1E1K A;  3CN8 A;  3ICT A;  2XLR A;  5FS9 A;  1CC6 A;  4Z26 A;  4H4Z A;  2XVF A;  4O5U A;  4WX1 A;  2R0P A;  1IUV A;  4FX9 A;  3VRA A;  3AE1 A;  3G5Q A;  4H4Y A;  3BHF A;  1H82 A;  2GEW A;  2JBV A;  3UKA A;  4EQR A;  2GAH B;  1D4C A;  1Q9I A;  2VOU A;  2X99 A;  5FS8 A;  4DGK A;  1PBE A;  1GRA A;  3NK2 X;  1EVI A;  4YSZ A;  4HB9 A;  2WOW A;  4YKG A;  2WU2 A;  2YR5 A;  4RG3 A;  4YXD A;  5BUL A;  1VDC A;  1DOB A;  1V59 A;  1DXL A;  2WDV A;  1C0K A;  1GV4 A;  2H88 A;  1ZOY A;  3OC4 A;  3Q9T A;  3CUK A;  1VQW A;  3DA1 A;  3KA7 A;  2EQ8 A;  1VG9 A;  3IHG A;  1ZMC A;  5EOW A;  3DJG X;  1LJ1 A;  1C0P A;  1Y56 B;  3SGL A;  2YWL A;  4K7Z A;  5JCI A;  4EQX A;  1D4E A;  4OPU A;  3R9U A;  2BAB A;  3UKL A;  2BCG G;  2E4G A;  3DGZ A;  1EL7 A;  4X9M A;  2BS3 A;  1JRX A;  1ZY8 A;  2WQY A;  3VRD B;  1GTH A;  1FCD A;  2BA9 A;  4YJF A;  2V60 A;  1EL9 A;  3ABV A;  4UDP A;  5IPY A;  3VRB A;  2V61 A;  4YJG B;  2VRM A;  2X8C A;  3NTA A;  1K0L A;  1EL8 A;  4YSH A;  3AWI A;  3PO7 A;  2C70 A;  4U8M A; 
#chains in the Genus database with same CATH topology
 3CNP A;  3CND A;  2RGJ A;  2E4A A;  3SFD A;  3UKK A;  2TPR A;  1FOH A;  1S2Y A;  3PS9 A;  4K22 A;  4HA6 A;  2YLW A;  3EPT A;  3IHM A;  3JSK A;  2ZZC A;  4II2 A;  1CC4 A;  1VE9 A;  1VG0 A;  1PJ6 A;  2YLR A;  4G9K A;  4LII A;  5EB5 A;  3BI5 A;  3P9U A;  4QFD A;  1LVL A;  1DAO A;  1LV0 A;  3LJP A;  1CJC A;  4CY6 A;  5KRQ A;  1F8W A;  2YLX A;  1KDG A;  3CGD A;  3P4S A;  1PDH A;  5KVI A;  1FEB A;  4GCM A;  4H7U A;  4CNK A;  2FBW A;  4U2L A;  2AAQ A;  4U8N A;  3FPZ A;  3AE4 A;  3PVC A;  2ARD A;  1LPF A;  1FEA A;  2YLT A;  1KFY A;  3T2Z A;  3V3O A;  3CPJ G;  3BI2 A;  3UP4 A;  4Z2R A;  3UOX A;  1N4V A;  4GRT A;  3K7Q X;  1DJQ A;  3DK4 A;  4O5Q A;  3UTH A;  2WP9 A;  3DJD A;  3NYE A;  3ZNN A;  2WOI A;  2GQF A;  2BRY A;  3DJE A;  1S3B A;  2YR4 A;  4P9S A;  1ZMD A;  2GMJ A;  4J33 A;  3NHO X;  2BS4 A;  3Q6J A;  1CC2 A;  4GDP A;  4YJH B;  4K8D A;  4Z43 A;  3WE0 A;  3T2K A;  3FG2 P;  1KNP A;  2WDR A;  3V76 A;  4A6N A;  1JNR A;  3AEF A;  4FDC B;  2WOV A;  3H4K A;  5LV9 A;  3GWF A;  1DOD A;  1M6I A;  1Z6L A;  3SYI A;  1AOG A;  2X50 A;  1L0V A;  1IUX A;  4TLZ A;  1GT8 A;  1NEK A;  3EF6 A;  4KPR A;  3ALJ A;  2R4J A;  4I58 A;  4NTD A;  4TM1 A;  4H4V A;  5EBK A;  1NEN A;  1P2H A;  3GD3 A;  3CNJ A;  3IC9 A;  3SQP A;  1OJ9 A;  4H4Q A;  1DDO A;  2GH5 A;  1GPE A;  2B7S A;  4WCT A;  5J7X A;  2AR8 A;  3ISH A;  2WPC A;  4NTE A;  3DK9 A;  4OCG A;  1CJ3 A;  4EMI A;  1N4U A;  1S3E A;  1COY A;  2YVJ A;  1B37 A;  2EQ6 A;  3II4 A;  3NN0 X;  2GF3 A;  1KIF A;  3ADA B;  3QSS A;  3KD9 A;  4YWO A;  5KMR A;  4U2T A;  4JY2 A;  1NHR A;  3AEB A;  3F8P A;  4J31 A;  2WBA A;  2C75 A;  4YTM A;  2ACZ A;  1ONF A;  3LXD A;  2C7G A;  3QSE A;  3GWD A;  3ICS A;  1F3P A;  3UP5 A;  3UTE A;  5BUK A;  4BV6 A;  2XLT A;  3AEG A;  2GR1 A;  2YAU A;  1H6V A;  2BK4 A;  1QJD A;  2WET A;  4AOS A;  1B4V A;  2C66 A;  4ADW A;  2A87 A;  2GR2 A;  1YQ3 A;  2WPE A;  1GES A;  2I0Z A;  4H4W A;  1AN9 A;  2CUL A;  2YLZ A;  5TR3 A;  3UCL A;  1ELI A;  3NH3 X;  1IUT A;  5KNL A;  1KSU A;  2BCP A;  4II3 A;  2C64 A;  1BGJ A;  4U8P A;  1NDA A;  4EQS A;  4JY3 A;  1OJC A;  2E1M A;  1L9E A;  1GRT A;  4GF7 A;  2JB3 A;  2WU5 A;  2JAE A;  3NKS A;  3M13 A;  3NLC A;  1CL0 A;  1H84 A;  4Z24 A;  4JDR A;  1KNR A;  4H2Q A;  2YG7 A;  3P4Q A;  3NYC A;  3VR9 A;  2BC1 A;  4IVO B;  4B69 A;  4NEW A;  4BJY A;  1XDI A;  2VVL G;  3ZNO A;  2RAB A;  3LZW A;  3P4P A;  2XDO A;  4YSY A;  1O94 A;  1LQT A;  1N4W A;  3W4K A;  3P1W A;  4EQW A;  2BYB A;  1TDK A;  2V6O A;  1PBB A;  1D7Y A;  2XLU A;  3IWA A;  4J36 A;  3ZYX A;  2FJD A;  3LAD A;  3VR8 A;  1NPX A;  1GND A;  2FJA A;  2R0C A;  5JCM A;  3G5S A;  5L46 A;  4NEV A;  2GAG B;  3NT6 A;  4ICY A;  2E82 A;  2XFO A;  4REK A;  3W4I A;  1CJ4 A;  2B7R A;  2R4E A;  4Y4N A;  4Z2T A;  1NG3 A;  4YJF B;  3AE6 A;  3UOY A;  5KWF A;  2VZ2 A;  4EMW A;  3P4R A;  3LZX A;  1SEZ A;  1NHS A;  4U8O A;  4A99 A;  3B6D A;  4H50 A;  3UOZ A;  4U2S A;  4H4S A;  3C4A A;  1XHC A;  1CBO A;  3C4N A;  2E49 A;  2H89 A;  3KU9 A;  5C3J A;  3SXI A;  3QFA A;  1PXC A;  1L9D A;  3C96 A;  2WS3 A;  2EQ9 A;  2JB2 A;  5KXJ A;  2R46 A;  5HYM A;  2OAM A;  3D8X A;  4K5R A;  4EMJ A;  2BK5 A;  4D04 A;  2YG6 A;  3AD9 B;  1W4X A;  3H8I A;  2DU8 A;  3O0H A;  4FK1 C;  4Z44 A;  3EAN A;  2WES A;  1PXA A;  1F8S A;  3SX6 A;  3RHA A;  5FMH A;  2Q0L A;  3LOV A;  2BS2 A;  4GDE A;  4X4J A;  4ECH A;  5C2T A;  1TDO A;  3K30 A;  5U25 A;  2C65 A;  2FJE A;  4NNJ A;  4TM4 A;  1TDF A;  1Q1R A;  5GRT A;  3SY4 A;  1GTE A;  1GRG A;  1ZDL A;  2DKH A;  2XFU A;  5KVH A;  2BAC A;  3AE3 A;  4RSL A;  3I3L A;  4IV9 A;  5IQ1 A;  3ZDN A;  4DSH A;  2XFN A;  1VRQ B;  4H4X A;  4K5S A;  1K0I A;  2JK6 A;  2VVM A;  3QVR A;  4XWR A;  1C0L A;  4TM0 A;  4PAA A;  4G6H A;  2QCU A;  3F8D A;  2F5Z A;  4U8K A;  1EL5 A;  1D5T A;  2YG5 A;  1PBF A;  2AQJ A;  4OVI A;  4UP3 A;  1PN0 A;  2R45 A;  2GMH A;  3M12 A;  3VQR A;  4A6N B;  2WP6 A;  4BK2 A;  1PJ7 A;  4C5O A;  2BRA A;  1GRH A;  4C77 A;  2B76 A;  1RYI A;  3AED A;  3NRN A;  1KF6 A;  1H7W A;  3UOV A;  3SZC A;  1YKJ A;  1GER A;  1DOC A;  1YQ4 A;  2GR3 A;  3KKJ A;  4U8J A;  3GMC A;  5KMS A;  4H4R A;  2B9Y A;  2ZZB A;  5CKU A;  1RP0 A;  4JNQ A;  1TYP A;  1L9C A;  1P2E A;  3RP7 A;  3CMM A;  1E6E A;  4ZCC A;  3ITJ A;  1Y0P A;  4NWZ A;  1JNZ A;  1Q1W A;  4EM3 A;  2XFQ A;  1CHU A;  1UKV G;  4NZH A;  2V5Z A;  2GRT A;  5GSN A;  3FBS A;  4NTC A;  3RED A;  4AT2 A;  1TYT A;  3NN6 X;  2XCG A;  3ATQ A;  2GQW A;  3ICR A;  2PYX A;  3CPI G;  2APG A;  4B63 A;  3AE7 A;  3GRS A;  2JKC A;  2WDQ A;  4APN A;  1JRZ A;  1GET A;  4PAB A;  1YQZ A;  3FIM B;  1LTX R;  2XYO A;  2GR0 A;  3FMW A;  1RSG A;  4YKF A;  1E1L A;  2R9Z A;  1NAA A;  4M52 A;  5M0Z A;  3SZF A;  4A7A A;  3AE8 A;  3UKH A;  1PS9 A;  3NYF A;  4CBQ A;  5FS7 A;  1CF3 A;  3T0K A;  1QLB A;  2YR6 A;  4LA1 A;  4OPC A;  4G74 A;  5M10 A;  1PHH A;  2V3B A;  3GYJ A;  3L8K A;  4EM4 A;  5U63 A;  2GV8 A;  1YY5 A;  2GVC A;  3CGC A;  4OPT A;  4B66 A;  2QAE A;  3CGE A;  4H4U A;  1GXF A;  3AB1 A;  4U8I A;  2C3D A;  4YSX A;  3GDN A;  2A8X A;  3I6D A;  3QVP A;  4CY8 A;  1XPQ A;  3E1T A;  1DJN A;  2XVJ A;  4QFC A;  1KSS A;  3AEE A;  3UTF A;  3GD4 A;  1ZP0 A;  1IUU A;  5KOX A;  2XFP A;  2BK3 A;  2Q6U A;  2Y6R A;  2IVD A;  3UKQ A;  3OZ2 A;  1FEC A;  3LB8 A;  3V3N A;  1D7L A;  2X8G A;  1BGN A;  1B5Q A;  4GAV A;  4Y4L A;  3GYI A;  1OJA A;  2R0G A;  4TM3 A;  4OPI A;  5EB4 A;  2XVI A;  3SZW A;  2WPF A;  3NG7 X;  4G73 A;  3S61 A;  1O95 A;  4A5L A;  3K7T A;  3RP8 A;  1DNC A;  2O9Z A;  4JN9 A;  1MOK A;  2NPX A;  1IUS A;  5JCN A;  3ALM A;  3AXB A;  5KOW A;  1MXT A;  3AEA A;  4A9W A;  3HYW A;  4YT0 A;  4XXG A;  2XLP A;  4B65 A;  1N1P A;  4BJZ A;  1TRB A;  4I59 A;  4JQ9 A;  2VVL A;  2IVE A;  3GSI A;  3K7M X;  4JNA A;  5HY5 A;  3DH9 A;  3WGT A;  3AD8 B;  3T14 A;  2OLO A;  2PHH A;  1H7X A;  2QA2 A;  4LU6 A;  5HXI A;  3CPH G;  4G6G A;  1GSN A;  2VQB A;  1BF3 A;  5J60 A;  1JOA A;  4CCR A;  2CVJ A;  4A79 A;  1NHP A;  2Z5X A;  2CFY A;  2BC0 A;  5BVA A;  1OJT A;  4A65 A;  3GRT A;  2C72 A;  2DKI A;  1IJH A;  1OJD A;  2A89 A;  1HYU A;  2XVE A;  3L1R A;  2WEU A;  4J57 A;  3T37 A;  4J2W A;  4YTP A;  3DK8 A;  4H2R A;  4Y4M A;  5KMQ A;  3UKF A;  4EIP A;  4CNJ A;  1F8R A;  2TMD A;  4GUV A;  1E39 A;  3S5W A;  4AT0 A;  2VQ7 A;  4KX6 A;  4USQ A;  4Z25 A;  3AYI A;  3AE5 A;  3CGB A;  1K4Q A;  2C76 A;  3SFE A;  4AOX A;  4D03 A;  4OPG A;  3AD7 B;  2UZZ A;  1H83 A;  3NTD A;  1LQU A;  3W4J A;  4USR A;  1Y56 A;  4ZCD A;  4ZN0 A;  1E7P A;  1H81 A;  4IA6 A;  4YTN A;  3AE9 A;  1JRY A;  4GR1 A;  3COX A;  1DOE A;  2WP5 A;  4J34 A;  3KLJ A;  3ZNQ A;  4FK1 A;  1XAN A;  4OPL A;  5IQ4 A;  2V3A A;  3HZL A;  3G5R A;  2Y6Q A;  2J3N A;  1NHQ A;  3QFB A;  4C74 A;  3CIR A;  2VRL A;  1F6M A;  3AEC A;  3NK0 X;  4H4P A;  5JCK A;  4BK1 A;  4AP3 A;  2E5V A;  4B67 A;  4YJG A;  3KPF A;  3B3R A;  1GRB A;  3IF9 A;  1TDN A;  2YM2 A;  3CNS A;  5FS6 A;  2YG3 A;  1E1M A;  1ZOV A;  1TDE A;  2BXR A;  3SM8 A;  2E48 A;  4K2X A;  5U1O A;  4DNA A;  2HQM A;  4XWZ A;  2FJB A;  3BNM A;  2X8H A;  2YLS A;  4CCQ A;  1GAL A;  2IID A;  2JB1 A;  5BRT A;  4H2P A;  4BK3 A;  4H4T A;  2EQ7 A;  4N9X A;  1S2Q A;  3RNM A;  3QJ4 A;  5KMP A;  3KPK A;  2B9W A;  1CJ2 A;  3NIX A;  3GYX A;  3URH A;  2NVK X;  1BWC A;  4RG4 A;  3AYL A;  1BKW A;  3NNE A;  4BUR A;  2BXS A;  4DSG A;  3QSM A;  1M64 A;  2X3N A;  3RP6 A;  1ZX9 A;  4UDQ A;  5ER0 A;  1IUW A;  2YG4 A;  4IVM B;  3BHK A;  3UKP A;  5DBJ A;  4OPD A;  3CNT A;  4Z2U A;  4C3X A;  3UTG A;  1K0J A;  1GEU A;  2C4C A;  2B9X A;  3AYJ A;  3DME A;  3CTY A;  4AP1 A;  4J56 A;  1ZKQ A;  4MJW A;  4U8L A;  1NG4 A;  4EIQ A;  2ZBW A;  3H8L A;  1O5W A;  1REO A;  2YVF A;  1FL2 A;  2Q0K A;  1MO9 A;  3KVE A;  4YJH A;  2OA1 A;  5JCL A;  4YJD A;  3AE2 A;  3ZNP A;  2XVH A;  4IA5 A;  2C67 A;  4C3Y A;  2YQU A;  2CDU A;  1PBD A;  2W0H A;  3F8R A;  3D1C A;  3NGC X;  1JU2 A;  2ZZ0 A;  4GAP A;  3ALL A;  1B8S A;  2YM1 A;  2RGO A;  1C0I A;  1BZL A;  1QO8 A;  2QA1 A;  3BNU A;  2YVG A;  1GRF A;  3SZ0 A;  2RGH A;  1D4D A;  1PXB A;  2XLS A;  1H86 A;  4B1B A;  1EBD A;  3EAO A;  3DGH A;  4CRT A;  2WHD A;  3GMB A;  5HHF A;  2Z5Y A;  2GB0 A;  1GRE A;  2C3C A;  1PJ5 A;  4E0V A;  3NK1 X;  5CQF A;  1X31 B;  3M0O A;  3GDP A;  4TLX A;  3G3E A;  3T31 A;  4H2N A;  1JEH A;  2C73 A;  2Q7V A;  2OLN A;  3BI4 A;  4X9N A;  4UDR A;  1GOS A;  1ZK7 A;  4B68 A;  3ATR A;  1PBC A;  1E1N A;  2OAL A;  4B64 A;  3DJJ A;  1E1K A;  3CN8 A;  3ICT A;  2XLR A;  5FS9 A;  1CC6 A;  4Z26 A;  4H4Z A;  2XVF A;  3HYX A;  4O5U A;  4WX1 A;  2R0P A;  1IUV A;  4FX9 A;  3VRA A;  3AE1 A;  3G5Q A;  4H4Y A;  3BHF A;  1H82 A;  2GEW A;  2JBV A;  3UKA A;  4EQR A;  2GAH B;  2VOU A;  1D4C A;  1Q9I A;  2X99 A;  5FS8 A;  4DGK A;  1PBE A;  1GRA A;  3NK2 X;  1EVI A;  4YSZ A;  4HB9 A;  2WOW A;  4YKG A;  2WU2 A;  2YR5 A;  4RG3 A;  4YXD A;  5BUL A;  1VDC A;  1DOB A;  1V59 A;  1DXL A;  2WDV A;  1C0K A;  1GV4 A;  2H88 A;  1ZOY A;  3OC4 A;  3Q9T A;  3CUK A;  1VQW A;  3DA1 A;  3KA7 A;  3T2Y A;  2EQ8 A;  1VG9 A;  3IHG A;  1ZMC A;  5EOW A;  3DJG X;  1LJ1 A;  1C0P A;  1Y56 B;  3SGL A;  2YWL A;  4K7Z A;  5JCI A;  4EQX A;  1D4E A;  4OPU A;  3HYV A;  3R9U A;  2BAB A;  3UKL A;  2BCG G;  2E4G A;  3DGZ A;  1EL7 A;  4X9M A;  2BS3 A;  1JRX A;  1ZY8 A;  2WQY A;  3VRD B;  1GTH A;  1FCD A;  2BA9 A;  4YJF A;  2V60 A;  1EL9 A;  3ABV A;  4UDP A;  5IPY A;  3VRB A;  2V61 A;  4YJG B;  2VRM A;  2X8C A;  3NTA A;  1K0L A;  1EL8 A;  4YSH A;  3AWI A;  3PO7 A;  2C70 A;  4U8M A; 
#chains in the Genus database with same CATH homology
 3CNP A;  3CND A;  2RGJ A;  2E4A A;  3SFD A;  3UKK A;  2TPR A;  1FOH A;  1S2Y A;  3PS9 A;  4K22 A;  4HA6 A;  2YLW A;  3EPT A;  3IHM A;  3JSK A;  2ZZC A;  4II2 A;  1CC4 A;  1VE9 A;  1VG0 A;  1PJ6 A;  2YLR A;  4G9K A;  4LII A;  5EB5 A;  3BI5 A;  3P9U A;  4QFD A;  1LVL A;  1DAO A;  1LV0 A;  3LJP A;  1CJC A;  4CY6 A;  5KRQ A;  1F8W A;  2YLX A;  1KDG A;  3CGD A;  3P4S A;  1PDH A;  5KVI A;  1FEB A;  4GCM A;  4H7U A;  4CNK A;  2FBW A;  4U2L A;  2AAQ A;  4U8N A;  3FPZ A;  3AE4 A;  3PVC A;  2ARD A;  1LPF A;  1FEA A;  2YLT A;  1KFY A;  3T2Z A;  3V3O A;  3CPJ G;  3BI2 A;  3UP4 A;  4Z2R A;  3UOX A;  1N4V A;  4GRT A;  3K7Q X;  1DJQ A;  3DK4 A;  4O5Q A;  3UTH A;  2WP9 A;  3DJD A;  3NYE A;  3ZNN A;  2WOI A;  2GQF A;  2BRY A;  3DJE A;  1S3B A;  2YR4 A;  4P9S A;  1ZMD A;  2GMJ A;  4J33 A;  3NHO X;  2BS4 A;  3Q6J A;  1CC2 A;  4GDP A;  4YJH B;  4K8D A;  4Z43 A;  3WE0 A;  3T2K A;  3FG2 P;  1KNP A;  2WDR A;  3V76 A;  4A6N A;  1JNR A;  3AEF A;  4FDC B;  2WOV A;  3H4K A;  5LV9 A;  3GWF A;  1DOD A;  1M6I A;  1Z6L A;  3SYI A;  1AOG A;  2X50 A;  1L0V A;  1IUX A;  4TLZ A;  1GT8 A;  1NEK A;  3EF6 A;  4KPR A;  3ALJ A;  2R4J A;  4I58 A;  4NTD A;  4TM1 A;  4H4V A;  5EBK A;  1NEN A;  1P2H A;  3GD3 A;  3CNJ A;  3IC9 A;  3SQP A;  1OJ9 A;  4H4Q A;  1DDO A;  2GH5 A;  1GPE A;  2B7S A;  4WCT A;  5J7X A;  2AR8 A;  3ISH A;  2WPC A;  4NTE A;  3DK9 A;  4OCG A;  1CJ3 A;  4EMI A;  1N4U A;  1S3E A;  1COY A;  2YVJ A;  1B37 A;  2EQ6 A;  3II4 A;  3NN0 X;  2GF3 A;  1KIF A;  3ADA B;  3QSS A;  3KD9 A;  4YWO A;  5KMR A;  4U2T A;  4JY2 A;  1NHR A;  3AEB A;  3F8P A;  4J31 A;  2WBA A;  2C75 A;  4YTM A;  2ACZ A;  1ONF A;  3LXD A;  2C7G A;  3QSE A;  3GWD A;  3ICS A;  1F3P A;  3UP5 A;  3UTE A;  5BUK A;  4BV6 A;  2XLT A;  3AEG A;  2GR1 A;  2YAU A;  1H6V A;  2BK4 A;  1QJD A;  2WET A;  4AOS A;  1B4V A;  2C66 A;  4ADW A;  2A87 A;  2GR2 A;  1YQ3 A;  2WPE A;  1GES A;  2I0Z A;  4H4W A;  1AN9 A;  2CUL A;  2YLZ A;  5TR3 A;  3UCL A;  1ELI A;  3NH3 X;  1IUT A;  5KNL A;  1KSU A;  2BCP A;  4II3 A;  2C64 A;  1BGJ A;  4U8P A;  1NDA A;  4EQS A;  4JY3 A;  1OJC A;  2E1M A;  1L9E A;  1GRT A;  2JB3 A;  4GF7 A;  2WU5 A;  2JAE A;  3NKS A;  3M13 A;  3NLC A;  1CL0 A;  1H84 A;  4Z24 A;  4JDR A;  1KNR A;  4H2Q A;  2YG7 A;  3P4Q A;  3NYC A;  3VR9 A;  2BC1 A;  4IVO B;  4B69 A;  4NEW A;  1XDI A;  2VVL G;  4BJY A;  3ZNO A;  2RAB A;  3LZW A;  3P4P A;  2XDO A;  4YSY A;  1O94 A;  1LQT A;  1N4W A;  3W4K A;  3P1W A;  4EQW A;  2BYB A;  1TDK A;  2V6O A;  1PBB A;  1D7Y A;  2XLU A;  3IWA A;  4J36 A;  3ZYX A;  2FJD A;  3LAD A;  3VR8 A;  1NPX A;  1GND A;  2FJA A;  2R0C A;  5JCM A;  3G5S A;  5L46 A;  4NEV A;  2GAG B;  3NT6 A;  4ICY A;  2E82 A;  2XFO A;  4REK A;  3W4I A;  1CJ4 A;  2B7R A;  2R4E A;  4Y4N A;  4Z2T A;  1NG3 A;  4YJF B;  3AE6 A;  3UOY A;  5KWF A;  2VZ2 A;  4EMW A;  3P4R A;  3LZX A;  1SEZ A;  1NHS A;  4U8O A;  4A99 A;  3B6D A;  4H50 A;  3UOZ A;  4U2S A;  4H4S A;  3C4A A;  1XHC A;  1CBO A;  3C4N A;  2E49 A;  2H89 A;  3KU9 A;  5C3J A;  3SXI A;  3QFA A;  1PXC A;  1L9D A;  2WS3 A;  3C96 A;  2EQ9 A;  2JB2 A;  5KXJ A;  2R46 A;  4K5R A;  2OAM A;  3D8X A;  4EMJ A;  5HYM A;  2BK5 A;  4D04 A;  2YG6 A;  3AD9 B;  1W4X A;  3H8I A;  2DU8 A;  3O0H A;  4FK1 C;  4Z44 A;  3EAN A;  2WES A;  1PXA A;  1F8S A;  3SX6 A;  3RHA A;  5FMH A;  2Q0L A;  3LOV A;  2BS2 A;  4GDE A;  4X4J A;  4ECH A;  5C2T A;  1TDO A;  3K30 A;  5U25 A;  2C65 A;  2FJE A;  4NNJ A;  4TM4 A;  1TDF A;  1Q1R A;  5GRT A;  3SY4 A;  1GTE A;  1GRG A;  1ZDL A;  2DKH A;  2XFU A;  5KVH A;  2BAC A;  3AE3 A;  4RSL A;  3I3L A;  4IV9 A;  5IQ1 A;  3ZDN A;  4DSH A;  2XFN A;  1VRQ B;  4H4X A;  4K5S A;  1K0I A;  2JK6 A;  2VVM A;  3QVR A;  4XWR A;  1C0L A;  4TM0 A;  4PAA A;  4G6H A;  2QCU A;  3F8D A;  2F5Z A;  4U8K A;  1EL5 A;  1D5T A;  2YG5 A;  1PBF A;  2AQJ A;  4OVI A;  4UP3 A;  1PN0 A;  2R45 A;  3M12 A;  2GMH A;  3VQR A;  4A6N B;  2WP6 A;  4BK2 A;  1PJ7 A;  4C5O A;  2BRA A;  1GRH A;  4C77 A;  2B76 A;  1RYI A;  3AED A;  3NRN A;  1KF6 A;  1H7W A;  3UOV A;  3SZC A;  1YKJ A;  1GER A;  1DOC A;  1YQ4 A;  2GR3 A;  3KKJ A;  4U8J A;  3GMC A;  5KMS A;  4H4R A;  2B9Y A;  2ZZB A;  5CKU A;  1RP0 A;  4JNQ A;  1TYP A;  1L9C A;  1P2E A;  3RP7 A;  3CMM A;  1E6E A;  4ZCC A;  3ITJ A;  1Y0P A;  4NWZ A;  1JNZ A;  1Q1W A;  4EM3 A;  2XFQ A;  1CHU A;  1UKV G;  4NZH A;  2V5Z A;  2GRT A;  5GSN A;  3FBS A;  4NTC A;  3RED A;  4AT2 A;  1TYT A;  3NN6 X;  2XCG A;  3ATQ A;  2GQW A;  3ICR A;  2PYX A;  3CPI G;  2APG A;  4B63 A;  3AE7 A;  3GRS A;  2JKC A;  2WDQ A;  4APN A;  1JRZ A;  1GET A;  4PAB A;  1YQZ A;  3FIM B;  1LTX R;  2XYO A;  2GR0 A;  3FMW A;  1RSG A;  4YKF A;  1E1L A;  2R9Z A;  1NAA A;  4M52 A;  5M0Z A;  3SZF A;  4A7A A;  3AE8 A;  3UKH A;  1PS9 A;  3NYF A;  4CBQ A;  5FS7 A;  1CF3 A;  3T0K A;  1QLB A;  2YR6 A;  4LA1 A;  4OPC A;  4G74 A;  5M10 A;  1PHH A;  2V3B A;  3GYJ A;  3L8K A;  4EM4 A;  5U63 A;  2GV8 A;  1YY5 A;  2GVC A;  3CGC A;  4OPT A;  4B66 A;  2QAE A;  3CGE A;  4H4U A;  1GXF A;  3AB1 A;  4U8I A;  2C3D A;  4YSX A;  3GDN A;  2A8X A;  3I6D A;  3QVP A;  4CY8 A;  1XPQ A;  1DJN A;  2XVJ A;  3AEE A;  4QFC A;  1KSS A;  3E1T A;  3UTF A;  3GD4 A;  1ZP0 A;  1IUU A;  5KOX A;  2XFP A;  2BK3 A;  2Q6U A;  2Y6R A;  2IVD A;  3UKQ A;  3OZ2 A;  1FEC A;  3LB8 A;  3V3N A;  1D7L A;  2X8G A;  1BGN A;  1B5Q A;  4GAV A;  4Y4L A;  3GYI A;  1OJA A;  2R0G A;  4TM3 A;  4OPI A;  5EB4 A;  2XVI A;  3SZW A;  2WPF A;  3NG7 X;  4G73 A;  3S61 A;  1O95 A;  4A5L A;  3K7T A;  3RP8 A;  1DNC A;  2O9Z A;  4JN9 A;  1MOK A;  2NPX A;  1IUS A;  5JCN A;  3AXB A;  3ALM A;  5KOW A;  1MXT A;  3AEA A;  4A9W A;  3HYW A;  4YT0 A;  4XXG A;  2XLP A;  4B65 A;  1N1P A;  1TRB A;  4I59 A;  4BJZ A;  4JQ9 A;  2VVL A;  2IVE A;  3GSI A;  3K7M X;  4JNA A;  5HY5 A;  3DH9 A;  3WGT A;  3AD8 B;  3T14 A;  2OLO A;  2PHH A;  1H7X A;  2QA2 A;  4LU6 A;  5HXI A;  3CPH G;  4G6G A;  1GSN A;  2VQB A;  1BF3 A;  5J60 A;  1JOA A;  4CCR A;  2CVJ A;  4A79 A;  1NHP A;  2Z5X A;  2CFY A;  2BC0 A;  5BVA A;  1OJT A;  4A65 A;  3GRT A;  2C72 A;  2DKI A;  1IJH A;  1OJD A;  2A89 A;  1HYU A;  2XVE A;  3L1R A;  2WEU A;  4J57 A;  3T37 A;  4J2W A;  4YTP A;  3DK8 A;  4H2R A;  4Y4M A;  5KMQ A;  3UKF A;  4CNJ A;  4EIP A;  1F8R A;  2TMD A;  4GUV A;  1E39 A;  3S5W A;  4AT0 A;  2VQ7 A;  4KX6 A;  4USQ A;  4Z25 A;  3AYI A;  3AE5 A;  3CGB A;  1K4Q A;  2C76 A;  3SFE A;  4AOX A;  4D03 A;  4OPG A;  3AD7 B;  2UZZ A;  1H83 A;  3NTD A;  1LQU A;  3W4J A;  4USR A;  1Y56 A;  4ZCD A;  4ZN0 A;  1E7P A;  1H81 A;  4IA6 A;  4YTN A;  3AE9 A;  1JRY A;  4GR1 A;  3COX A;  1DOE A;  2WP5 A;  4J34 A;  3KLJ A;  3ZNQ A;  4FK1 A;  1XAN A;  4OPL A;  5IQ4 A;  2V3A A;  3HZL A;  3G5R A;  2Y6Q A;  2J3N A;  1NHQ A;  3QFB A;  4C74 A;  3CIR A;  2VRL A;  1F6M A;  3AEC A;  3NK0 X;  4H4P A;  5JCK A;  4BK1 A;  4AP3 A;  2E5V A;  4B67 A;  4YJG A;  3KPF A;  3B3R A;  1GRB A;  3IF9 A;  1TDN A;  2YM2 A;  3CNS A;  5FS6 A;  2YG3 A;  1E1M A;  1ZOV A;  1TDE A;  2BXR A;  3SM8 A;  2E48 A;  4K2X A;  5U1O A;  4DNA A;  2HQM A;  4XWZ A;  2FJB A;  3BNM A;  2X8H A;  2YLS A;  4CCQ A;  1GAL A;  2IID A;  2JB1 A;  5BRT A;  4H2P A;  4H4T A;  4BK3 A;  2EQ7 A;  4N9X A;  1S2Q A;  3RNM A;  3QJ4 A;  5KMP A;  3KPK A;  2B9W A;  1CJ2 A;  3NIX A;  3GYX A;  3URH A;  2NVK X;  1BWC A;  4RG4 A;  3AYL A;  1BKW A;  3NNE A;  4BUR A;  2BXS A;  4DSG A;  3QSM A;  1M64 A;  1ZX9 A;  2X3N A;  4UDQ A;  5ER0 A;  3RP6 A;  1IUW A;  2YG4 A;  4IVM B;  3BHK A;  3UKP A;  5DBJ A;  4OPD A;  3CNT A;  4Z2U A;  4C3X A;  3UTG A;  1K0J A;  1GEU A;  2C4C A;  2B9X A;  3AYJ A;  3DME A;  3CTY A;  4AP1 A;  4J56 A;  1ZKQ A;  4MJW A;  4U8L A;  1NG4 A;  2ZBW A;  3H8L A;  4EIQ A;  1O5W A;  1REO A;  2YVF A;  1FL2 A;  2Q0K A;  1MO9 A;  3KVE A;  4YJH A;  2OA1 A;  5JCL A;  4YJD A;  3AE2 A;  3ZNP A;  2XVH A;  2C67 A;  4IA5 A;  4C3Y A;  2YQU A;  2CDU A;  1PBD A;  2W0H A;  3F8R A;  3D1C A;  3NGC X;  1JU2 A;  2ZZ0 A;  4GAP A;  3ALL A;  1B8S A;  2YM1 A;  2RGO A;  1C0I A;  1BZL A;  1QO8 A;  2QA1 A;  3BNU A;  2YVG A;  1GRF A;  3SZ0 A;  2RGH A;  1D4D A;  1PXB A;  2XLS A;  1H86 A;  4B1B A;  1EBD A;  3EAO A;  3DGH A;  4CRT A;  2WHD A;  3GMB A;  5HHF A;  2Z5Y A;  2GB0 A;  1GRE A;  2C3C A;  1PJ5 A;  4E0V A;  3NK1 X;  5CQF A;  1X31 B;  3M0O A;  3GDP A;  4TLX A;  3G3E A;  3T31 A;  1JEH A;  4H2N A;  2C73 A;  2Q7V A;  2OLN A;  3BI4 A;  4X9N A;  4UDR A;  1GOS A;  1ZK7 A;  4B68 A;  3ATR A;  1PBC A;  1E1N A;  2OAL A;  4B64 A;  3DJJ A;  1E1K A;  3CN8 A;  3ICT A;  2XLR A;  5FS9 A;  1CC6 A;  4Z26 A;  4H4Z A;  2XVF A;  3HYX A;  4O5U A;  4WX1 A;  2R0P A;  1IUV A;  4FX9 A;  3VRA A;  3AE1 A;  3G5Q A;  4H4Y A;  3BHF A;  1H82 A;  2GEW A;  2JBV A;  3UKA A;  4EQR A;  2GAH B;  1D4C A;  1Q9I A;  2VOU A;  2X99 A;  5FS8 A;  4DGK A;  1PBE A;  1GRA A;  3NK2 X;  1EVI A;  4YSZ A;  4HB9 A;  2WOW A;  4YKG A;  2WU2 A;  2YR5 A;  4RG3 A;  4YXD A;  5BUL A;  1VDC A;  1DOB A;  1V59 A;  1DXL A;  2WDV A;  1C0K A;  1GV4 A;  2H88 A;  1ZOY A;  3OC4 A;  3Q9T A;  3CUK A;  1VQW A;  3DA1 A;  3KA7 A;  3T2Y A;  2EQ8 A;  1VG9 A;  3IHG A;  1ZMC A;  5EOW A;  3DJG X;  1LJ1 A;  1C0P A;  1Y56 B;  3SGL A;  2YWL A;  4K7Z A;  5JCI A;  4EQX A;  1D4E A;  4OPU A;  3HYV A;  3R9U A;  2BAB A;  3UKL A;  2BCG G;  2E4G A;  3DGZ A;  1EL7 A;  4X9M A;  2BS3 A;  1JRX A;  1ZY8 A;  2WQY A;  3VRD B;  1GTH A;  1FCD A;  2BA9 A;  4YJF A;  2V60 A;  1EL9 A;  3ABV A;  4UDP A;  5IPY A;  3VRB A;  2V61 A;  4YJG B;  2VRM A;  2X8C A;  3NTA A;  1K0L A;  1EL8 A;  4YSH A;  3AWI A;  3PO7 A;  2C70 A;  4U8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...