3DMEA

Crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
366
Chain Sequence
TDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved exported protein from Bordetella pertussis. NorthEast Structural Genomics target BeR141
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
molecule keywords conserved exported protein
total genus 110
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3dmeA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dmeA01
1CC2A 3AE9A 4EQSA 3SGLA 2XCGA 4EIPA 1IUSA 2TPRA 4EMIA 2YG7A 1F6MA 4FK1A 3UKLA 4A6NB 1H82A 2JB3A 2VOUA 3H8LA 3NK1X 2W0HA 1L9CA 1BGJA 3UOYA 5FS6A 4H4RA 2GR1A 2GQWA 3DGHA 5JCLA 4YJDA 5KOWA 1DOBA 2YVGA 3NTAA 3ATQA 4H2NA 2RABA 1FL2A 4TM4A 1GSNA 4BV6A 1N1PA 2BABA 2FBWA 1S3BA 4I58A 2WP6A 3B3RA 4A9WA 3OZ2A 4JY2A 5GSNA 3CPJG 5EB4A 3V76A 1PBFA 3L8KA 1NHPA 3P4RA 3CNJA 4OPGA 2Q6UA 2XDOA 4TM1A 3DJGX 4UDRA 4ZN0A 1Q1WA 4OPIA 1F8WA 2BC0A 2JB2A 2GR0A 4JY3A 3UP5A 1EBDA 2QA2A 1ZKQA 3F8RA 3PVCA 3VR8A 3REDA 4ADWA 1YQ3A 2OAMA 1CJ4A 1NDAA 2BXSA 5BUKA 3RNMA 4JNAA 3AD9B 3ALMA 4IA6A 1JOAA 4OCGA 3UP4A 2ARDA 4XWRA 3UOXA 2YR4A 3IHGA 2XVIA 3WE0A 1ONFA 2C72A 1ELIA 4YJGA 1PBCA 1XANA 3AE8A 4H4XA 2Q0LA 4OPCA 4YKFA 3P4PA 2AAQA 3AXBA 2QA1A 4YTMA 3UKAA 1PJ6A 4LU6A 1EL5A 4IA5A 1OJDA 3ATRA 1GV4A 2TMDA 1LV0A 4X9NA 2WBAA 3UOZA 4O5UA 1AOGA 2GF3A 1O95A 1DOEA 3ITJA 3AD8B 3VRBA 4BJZA 1VQWA 4GDEA 3NGCX 2R0CA 4QFCA 2V3AA 4UDQA 3SQPA 2BK3A 3II4A 4H4SA 2R45A 2XFUA 3ZNOA 4CNKA 2GH5A 3CN8A 5C2TA 2FJBA 2R4EA 1LPFA 4D03A 1PBDA 2B9WA 1CBOA 2BK4A 3B6DA 2C75A 2ZBWA 4Y4LA 1GESA 1S2QA 4XXGA 1LJ1A 2V60A 1TDFA 1Q1RA 3UTFA 1H7WA 2XVFA 3BNMA 2A8XA 1K0JA 5U63A 4C3YA 4NTDA 5C3JA 5L46A 2RGJA 2ZZ0A 3QFBA 1PJ5A 1PJ7A 5EBKA 4K7ZA 3BI4A 2BYBA 3S61A 1D7YA 4YSZA 4N9XA 2WETA 4H4ZA 4K5RA 2OLOA 3I3LA 2AR8A 2C65A 4USQA 3NYCA 5J7XA 2X50A 4YJHB 1XPQA 2DKHA 3OC4A 1MO9A 3DJEA 1BZLA 1VE9A 3AE1A 4YJGB 3JSKA 4A7AA 4AP1A 4Z25A 1JRXA 2YLWA 5KVIA 3CGDA 4H4TA 2R0PA 3D8XA 2QCUA 1VRQB 1GXFA 3KU9A 3AD7B 1B4VA 4GF7A 3UKHA 4XWZA 4TLXA 2XVJA 3DK8A 3URHA 1CL0A 1GPEA 1F8SA 1YQ4A 2NPXA 1DDOA 2X8GA 2YLXA 1RYIA 3GWFA 2B76A 1DJQA 3LB8A 3Q6JA 4YTNA 2GEWA 3DGZA 4M52A 4A79A 2WDQA 2YM2A 1CF3A 2WPEA 3AEEA 3LXDA 4C77A 2BS3A 3CIRA 3VQRA 1N4WA 3AEFA 2E1MA 1MXTA 3AEDA 2VQ7A 4U8NA 3ABVA 4IVMB 2V5ZA 4U2LA 4DGKA 2O9ZA 1Q9IA 1NG3A 1H6VA 2X99A 3KKJA 2GB0A 3ZNNA 3PS9A 1BWCA 1TRBA 4OPLA 3RHAA 3H4KA 2YVFA 1NAAA 5U25A 1ZY8A 5FS9A 1C0LA 2GQFA 1NHRA 2JKCA 2E48A 3C4NA 3WGTA 4J2WA 1TDNA 3VRDB 1C0PA 2WU5A 1IUVA 1KDGA 3GDPA 5KVHA 1PBEA 2X3NA 3LOVA 1DOCA 4OPTA 2WQYA 4Y4NA 1KIFA 2OA1A 3NK0X 3AE5A 1QO8A 4A99A 1OJCA 1DXLA 1FECA 3ZDNA 4B1BA 1TDEA 3NKSA 4Z2UA 2YQUA 2Q0KA 2YG6A 3UCLA 4Z2RA 3CNDA 4B63A 3C4AA 2EQ6A 1GERA 4CCRA 3DJDA 4CY6A 3ZNQA 3QFAA 4YJFB 1CC6A 1XDIA 2BC1A 2XYOA 1ZK7A 3NTDA 2BCPA 3K30A 5EB5A 3NYEA 4ZCDA 1XHCA 3AEGA 1GRGA 3D1CA 2FJEA 1L9EA 1AN9A 3IHMA 4BURA 4B65A 2Q7VA 2YR6A 4FK1C 4H4YA 3G5RA 3CGBA 3DH9A 4K22A 1ZMCA 3G5SA 2UZZA 4CBQA 4EMWA 4IV9A 3F8PA 4JNQA 1VG9A 1V59A 3KLJA 4DSGA 3V3NA 1BGNA 2FJDA 3KPFA 3NH3X 1LQUA 4ECHA 3NLCA 2XLUA 3EAOA 3CGCA 3GD4A 3NNEA 1KSUA 4FDCB 3W4IA 2XFOA 2JBVA 4TM0A 1CC4A 5CKUA 1GT8A 1NHSA 1GNDA 4CNJA 1H84A 1UKVG 1NHQA 1Y56B 4I59A 1K0LA 3P4QA 2R0GA 3GYIA 1ZX9A 2BACA 4H4UA 3AEBA 1B8SA 4YSYA 1IUTA 2ZZBA 5J60A 2C66A 1W4XA 3DK9A 2RGHA 4CY8A 2H89A 3NIXA 5EOWA 1NPXA 4H2RA 2XLRA 3P9UA 4NZHA 3M12A 2R4JA 2WDRA 3QJ4A 1B37A 1GRAA 2VVMA 4LA1A 5CQFA 4NEVA 4B64A 3NHOX 2Z5YA 2C67A 3R9UA 2ACZA 1JRYA 2VRLA 2CULA 1GEUA 2GMJA 2OALA 4NTEA 5LV9A 3C96A 3NT6A 4J33A 4K2XA 4JDRA 2XVHA 1E1MA 3G5QA 3KA7A 3EPTA 4YKGA 3SFEA 1H86A 3UKKA 4K5SA 1EL7A 3ALLA 4B66A 1D5TA 3W4JA 2DU8A 1RP0A 2ZZCA 4H4QA 2FJAA 4TM3A 2XFQA 1TDOA 3FMWA 5TR3A 3ZNPA 1DNCA 3UKFA 4GDPA 3RP6A 1ZDLA 2I0ZA 4USRA 2E82A 3GMBA 5FS7A 3FPZA 4GUVA 3T37A 4P9SA 1H7XA 2Y6RA 3O0HA 2IIDA 3RP7A 1KFYA 3K7MX 2B9YA 5JCMA 4K8DA 4REKA 4DSHA 3QSSA 3AE2A 4Z2TA 3AB1A 1KNPA 1ZOYA 2GR2A 2PYXA 1D7LA 1PXAA 3IF9A 1GRFA 5BVAA 4LIIA 1NENA 1BF3A 4EQWA 1CJCA 2WOIA 5BRTA 1CHUA 4Y4MA 1H81A 2CFYA 2JK6A 3CPIG 1EL9A 2E49A 3DMEA 1ZOVA 2WESA 4TLZA 4IVOB 4EM3A 1HYUA 3V3OA 1PDHA 3CNTA 3ICSA 3CGEA 1JNRA 2C3CA 3DK4A 3AYLA 1LTXR 1E7PA 2WOWA 1DAOA 1TYPA 1GRHA 3KD9A 2XFPA 2GAHB 4QFDA 2C3DA 3UKQA 2YLRA 1E1LA 1SEZA 3AEAA 4U8KA 4U8OA 4YWOA 1L0VA 4YXDA 5GRTA 2C73A 3CNSA 2XFNA 4YSXA 1D4EA 2VVLA 1X31B 2C76A 4NTCA 4A65A 2WS3A 3QSEA 2V6OA 1S2YA 3G3EA 3QVPA 1E6EA 5ER0A 4B69A 4Z26A 1F3PA 1QJDA 3RP8A 4YT0A 2WU2A 3S5WA 3NYFA 4CCQA 5JCIA 5KOXA 2X8CA 3ICTA 1OJ9A 5JCKA 3CTYA 4AT0A 4AOXA 4YSHA 3FG2P 3NG7X 3PO7A 4X4JA 2R46A 3UTHA 1K4QA 1FEBA 1OJAA 2BS4A 1C0IA 3BHFA 2C70A 4U8JA 1LVLA 3NN6X 4JQ9A 1IUXA 1ZMDA 3LJPA 4FX9A 3M0OA 5U1OA 4B67A 2C7GA 4EQXA 1EVIA 2BXRA 2EQ9A 3AYJA 1VDCA 2EQ8A 2WP9A 1Y56A 2WEUA 3ICRA 1JNZA 2F5ZA 2GVCA 3UKPA 2E4GA 3ADAB 1E39A 4Z24A 4A5LA 2GRTA 3QVRA 1GRBA 4J34A 5KRQA 4H4VA 3LZXA 2V61A 2IVDA 1COYA 1GETA 1Y0PA 4BK1A 1PHHA 3AE3A 3BI2A 3GD3A 4BJYA 4AOSA 4GCMA 4B68A 2VQBA 2JB1A 3AECA 3CUKA 2OLNA 1YY5A 2BA9A 3NN0X 2VRMA 2VZ2A 3IC9A 2YVJA 5M0ZA 1LQTA 3L1RA 3AWIA 3QSMA 2HQMA 1IJHA 3FIMB 4Z43A 2R9ZA 1FOHA 3P1WA 4EIQA 4JN9A 1Z6LA 2WP5A 3EF6A 1GRTA 4C3XA 1VG0A 2APGA 1C0KA 2A87A 1QLBA 2H88A 2X8HA 2XLPA 2YAUA 3ZYXA 4CRTA 1IUUA 2AQJA 3UTEA 4U8IA 4H7UA 3GRTA 3CPHG 4OPUA 4C5OA 3K7QX 5HY5A 2YG3A 4O5QA 2J3NA 1TYTA 2Z5XA 3NRNA 1M64A 2YLZA 2RGOA 2QAEA 3GDNA 3UOVA 4AP3A 4BK2A 4AT2A 3I6DA 4PABA 3DJJA 2Y6QA 1BKWA 3VR9A 1KNRA 2WHDA 4WX1A 4APNA 2XLTA 5IQ4A 3BHKA 2XVEA 4J56A 4E0VA 5KWFA 4PAAA 2B9XA 3KVEA 2NVKX 2WDVA 4H2QA 4H2PA 4HB9A 4RG4A 1CJ3A 3COXA 1GALA 1K0IA 5IPYA 4RSLA 4ZCCA 1NEKA 1GOSA 1KF6A 5HHFA 2YG4A 4OPDA 1PN0A 2B7RA 1OJTA 1EL8A 3LADA 4KPRA 5HYMA 2VVLG 5FMHA 1NG4A 3GYJA 2XLSA 4J57A 4U8LA 2E5VA 3IWAA 1S3EA 5BULA 1GREA 4MJWA 1REOA 1MOKA 3AE7A 3ALJA 2BCGG 1E1KA 4H4WA 4NEWA 3M13A 3GWDA 3E1TA 2GR3A 3P4SA 2GMHA 2GV8A 3CNPA 4A6NA 1PXCA 4U2TA 1O5WA 3K7TA 1L9DA 2YR5A 4U8PA 1YQZA 4RG3A 1YKJA 1PS9A 2C64A 2WPFA 2YLTA 2BS2A 2YM1A 4H50A 4ICYA 1DODA 3SFDA 1JRZA 4YJHA 4UP3A 4EMJA 2YWLA 3GSIA 4DNAA 2EQ7A 1FEAA 2YG5A 5HXIA 3HZLA 2B7SA 1KSSA 1H83A 3LZWA 2WPCA 5IQ1A 2CDUA 1TDKA 2A89A 4U8MA 3GMCA 4YJFA 4U2SA 5FS8A 1F8RA 4BK3A 1O94A 3W4KA 4EM4A 1D4DA 4GRTA 3UTGA 2JAEA 1PBBA 3DA1A 3FBSA 2E4AA 1N4VA 2PHHA 4C74A 4Z44A 2CVJA 4WCTA 4GR1A 4KX6A 3AYIA 2WOVA 2YLSA 2BK5A 3NK2X 5KXJA 4EQRA 1N4UA 5M10A 1PXBA 3BNUA 3EANA 4HA6A 1CJ2A 1DJNA 4OVIA 4X9MA 5DBJA 1GTEA 3F8DA 4J31A 1P2HA 1JEHA 4YTPA 3BI5A 1B5QA 1FCDA 4J36A 2DKIA 4D04A 4UDPA 3ISHA 3AE6A 1IUWA 2V3BA 1M6IA 3AE4A 3GRSA 3Q9TA 3VRAA 3SM8A 1RSGA 1E1NA 3H8IA 1P2EA 5JCNA 1GTHA 1D4CA 1ZP0A 2IVEA 1JU2A 4H4PA 2GAGB
chains in the Genus database with same CATH superfamily
1CC2A 3AE9A 4EQSA 3SGLA 4EIPA 2XCGA 1IUSA 2TPRA 4EMIA 2YG7A 1F6MA 4FK1A 3UKLA 4A6NB 1H82A 2JB3A 2VOUA 3H8LA 3NK1X 2W0HA 1L9CA 1BGJA 4NNJA 3UOYA 3T14A 5FS6A 4H4RA 2GR1A 2GQWA 3DGHA 5JCLA 4YJDA 5KOWA 1DOBA 2YVGA 3NTAA 3ATQA 4H2NA 2RABA 1FL2A 4TM4A 1GSNA 4BV6A 1N1PA 2BABA 2FBWA 1S3BA 4I58A 2WP6A 3B3RA 4A9WA 3OZ2A 4JY2A 5GSNA 3CPJG 5EB4A 3V76A 1PBFA 3L8KA 1NHPA 3P4RA 3CNJA 4OPGA 2Q6UA 2XDOA 4TM1A 3SY4A 3DJGX 4UDRA 4ZN0A 1Q1WA 4OPIA 1F8WA 2BC0A 2JB2A 4JY3A 2GR0A 3UP5A 1EBDA 2QA2A 1ZKQA 3F8RA 3PVCA 3VR8A 3REDA 4ADWA 1YQ3A 2OAMA 1CJ4A 1NDAA 3HYWA 3T2YA 2BXSA 5BUKA 3SX6A 3RNMA 4JNAA 3AD9B 3ALMA 4IA6A 1JOAA 4OCGA 3UP4A 2ARDA 4XWRA 3UOXA 2YR4A 3IHGA 2XVIA 3WE0A 1ONFA 2C72A 1ELIA 4YJGA 1PBCA 1XANA 3KPKA 3AE8A 4H4XA 2Q0LA 4OPCA 4YKFA 3P4PA 2AAQA 3AXBA 2QA1A 4YTMA 3UKAA 1PJ6A 4LU6A 1EL5A 4IA5A 1OJDA 3ATRA 1GV4A 2TMDA 4GAVA 1LV0A 4X9NA 2WBAA 3T0KA 3UOZA 4O5UA 1AOGA 2GF3A 1O95A 1DOEA 3ITJA 3AD8B 4BJZA 3VRBA 1VQWA 4GDEA 3NGCX 2R0CA 4QFCA 2V3AA 4UDQA 3SQPA 2BK3A 3II4A 4H4SA 2R45A 2XFUA 3ZNOA 4CNKA 2GH5A 3CN8A 5C2TA 2FJBA 2R4EA 1LPFA 4D03A 1PBDA 2B9WA 1CBOA 2BK4A 3B6DA 2C75A 2ZBWA 4Y4LA 1GESA 1S2QA 4XXGA 1LJ1A 2V60A 1TDFA 1Q1RA 3UTFA 1H7WA 2XVFA 3BNMA 2A8XA 1K0JA 5U63A 4C3YA 4NTDA 5C3JA 5L46A 4GAPA 2RGJA 2ZZ0A 4G6HA 3QFBA 1PJ5A 1PJ7A 5EBKA 4K7ZA 3BI4A 2BYBA 3S61A 1D7YA 4YSZA 4N9XA 2WETA 4H4ZA 4K5RA 2OLOA 3I3LA 2AR8A 2C65A 4USQA 3NYCA 5J7XA 2X50A 4YJHB 1XPQA 2DKHA 3OC4A 1MO9A 3DJEA 1BZLA 1VE9A 3AE1A 4YJGB 3JSKA 4A7AA 4AP1A 4Z25A 1JRXA 2YLWA 5KVIA 3CGDA 4H4TA 2R0PA 3D8XA 2QCUA 1VRQB 4GF7A 1GXFA 3AD7B 1B4VA 3KU9A 3SZ0A 4XWZA 3UKHA 4TLXA 2XVJA 3DK8A 3URHA 1CL0A 1GPEA 1F8SA 1YQ4A 2NPXA 1DDOA 2X8GA 2YLXA 1RYIA 3GWFA 1DJQA 2B76A 3LB8A 3Q6JA 4YTNA 2GEWA 3DGZA 4M52A 4A79A 2WDQA 2YM2A 1CF3A 2WPEA 3AEEA 3LXDA 4C77A 2BS3A 3CIRA 3VQRA 1N4WA 3AEFA 3SZFA 2E1MA 1MXTA 3AEDA 2VQ7A 4U8NA 3ABVA 4IVMB 2V5ZA 4U2LA 4DGKA 2O9ZA 1Q9IA 1NG3A 1H6VA 2X99A 3KKJA 2GB0A 3ZNNA 3PS9A 1BWCA 1TRBA 4OPLA 3RHAA 3H4KA 2YVFA 1NAAA 5U25A 1ZY8A 5FS9A 1C0LA 2GQFA 1NHRA 2JKCA 2E48A 3C4NA 3WGTA 4J2WA 1TDNA 3VRDB 1C0PA 2WU5A 1IUVA 1KDGA 3GDPA 5KVHA 1PBEA 2X3NA 3LOVA 1DOCA 4OPTA 2WQYA 4Y4NA 1KIFA 2OA1A 3NK0X 3SXIA 3AE5A 1QO8A 4A99A 1OJCA 1DXLA 1FECA 3ZDNA 4B1BA 1TDEA 3NKSA 4Z2UA 2YQUA 2Q0KA 2YG6A 3UCLA 4Z2RA 3CNDA 4B63A 3C4AA 2EQ6A 1GERA 4CCRA 3DJDA 4CY6A 3ZNQA 3QFAA 4YJFB 1CC6A 1XDIA 2BC1A 2XYOA 1ZK7A 3NTDA 2BCPA 3K30A 5EB5A 3NYEA 4ZCDA 1XHCA 3AEGA 1GRGA 3D1CA 2FJEA 1L9EA 4II3A 1AN9A 3IHMA 4BURA 4B65A 2Q7VA 2YR6A 4FK1C 4H4YA 3G5RA 3CGBA 3DH9A 4K22A 1ZMCA 3G5SA 2UZZA 4CBQA 4EMWA 4IV9A 3F8PA 4JNQA 1VG9A 1V59A 3KLJA 4DSGA 3V3NA 1BGNA 2FJDA 3KPFA 3NH3X 1LQUA 4ECHA 3NLCA 2XLUA 3EAOA 3CGCA 3GD4A 3NNEA 1KSUA 4FDCB 3W4IA 2XFOA 2JBVA 4TM0A 1CC4A 5CKUA 1GT8A 1NHSA 1GNDA 4G6GA 4CNJA 1H84A 1UKVG 1NHQA 1Y56B 4I59A 1K0LA 3P4QA 2R0GA 3GYIA 1ZX9A 2BACA 4H4UA 3AEBA 1B8SA 5KMQA 4YSYA 1IUTA 2ZZBA 5J60A 2C66A 1W4XA 3DK9A 2RGHA 3T31A 4CY8A 2H89A 3NIXA 5EOWA 1NPXA 4H2RA 2XLRA 3P9UA 4NZHA 3M12A 2R4JA 2WDRA 3QJ4A 1B37A 1GRAA 2VVMA 4LA1A 5CQFA 4NEVA 4B64A 3NHOX 2Z5YA 2C67A 3R9UA 2ACZA 1JRYA 2VRLA 2CULA 1GEUA 2GMJA 2OALA 4NTEA 5LV9A 3C96A 3NT6A 4J33A 4K2XA 4JDRA 2XVHA 1E1MA 3G5QA 3KA7A 3EPTA 4YKGA 3T2KA 5KMSA 3SFEA 1H86A 3UKKA 4K5SA 3ALLA 1EL7A 4B66A 1D5TA 3W4JA 2DU8A 1RP0A 2ZZCA 4H4QA 2FJAA 4TM3A 2XFQA 1TDOA 3FMWA 5TR3A 3ZNPA 1DNCA 3UKFA 4GDPA 3RP6A 1ZDLA 2I0ZA 4USRA 2E82A 3GMBA 5FS7A 3FPZA 4GUVA 3T37A 4P9SA 1H7XA 2Y6RA 3O0HA 3RP7A 2IIDA 1KFYA 3K7MX 2B9YA 5JCMA 4K8DA 4REKA 4DSHA 3QSSA 3AE2A 4Z2TA 3AB1A 1KNPA 1ZOYA 2GR2A 2PYXA 1D7LA 1PXAA 3IF9A 1GRFA 5BVAA 4LIIA 1NENA 1BF3A 4EQWA 1CJCA 2WOIA 5BRTA 1CHUA 4Y4MA 1H81A 2CFYA 2JK6A 3CPIG 1EL9A 2E49A 3DMEA 1ZOVA 2WESA 4TLZA 4IVOB 4EM3A 1HYUA 3V3OA 1PDHA 3CNTA 3ICSA 3CGEA 1JNRA 2C3CA 3DK4A 3AYLA 1LTXR 1E7PA 2WOWA 1DAOA 1TYPA 1GRHA 3KD9A 2XFPA 2GAHB 4QFDA 2C3DA 3UKQA 2YLRA 1E1LA 1SEZA 3AEAA 4U8KA 4U8OA 4YWOA 1L0VA 4YXDA 5GRTA 2C73A 3CNSA 2XFNA 4YSXA 1D4EA 2VVLA 1X31B 2C76A 4NTCA 4A65A 2WS3A 3QSEA 2V6OA 1S2YA 3G3EA 3QVPA 1E6EA 4G9KA 5ER0A 4B69A 4Z26A 1F3PA 1QJDA 3RP8A 4YT0A 2WU2A 3S5WA 3HYVA 3NYFA 4CCQA 5JCIA 5KOXA 2X8CA 3ICTA 1OJ9A 5JCKA 3CTYA 4AT0A 4AOXA 4YSHA 3SZWA 3FG2P 3NG7X 3PO7A 4X4JA 2R46A 3UTHA 1K4QA 1FEBA 1OJAA 2BS4A 1C0IA 3BHFA 2C70A 4U8JA 5KMRA 1LVLA 3NN6X 3T2ZA 4JQ9A 1IUXA 1ZMDA 3LJPA 4FX9A 3M0OA 5U1OA 4B67A 2C7GA 4EQXA 1EVIA 2BXRA 2EQ9A 3AYJA 1VDCA 2EQ8A 2WP9A 3SYIA 1Y56A 2WEUA 3ICRA 1JNZA 2F5ZA 2GVCA 3UKPA 2E4GA 3ADAB 1E39A 4Z24A 3HYXA 2GRTA 4A5LA 3QVRA 1GRBA 4J34A 5KRQA 4H4VA 3LZXA 2V61A 2IVDA 1COYA 1GETA 1Y0PA 4BK1A 1PHHA 3AE3A 3BI2A 3GD3A 4BJYA 3CMMA 4AOSA 4GCMA 4B68A 2VQBA 2JB1A 3AECA 3CUKA 2OLNA 1YY5A 2BA9A 3NN0X 2VRMA 2VZ2A 3IC9A 2YVJA 5M0ZA 1LQTA 3L1RA 3AWIA 3QSMA 2HQMA 1IJHA 3FIMB 3SZCA 4Z43A 2R9ZA 1FOHA 4EIQA 3P1WA 4JN9A 1Z6LA 2WP5A 3EF6A 1GRTA 4C3XA 1VG0A 2APGA 1C0KA 2A87A 1QLBA 2H88A 2X8HA 2XLPA 2YAUA 3ZYXA 4CRTA 1IUUA 2AQJA 3UTEA 4U8IA 4H7UA 3GRTA 3CPHG 4OPUA 4C5OA 3K7QX 5HY5A 2YG3A 4O5QA 2J3NA 1TYTA 2Z5XA 3NRNA 1M64A 2YLZA 2RGOA 2QAEA 3GDNA 3UOVA 4AP3A 4BK2A 4AT2A 3I6DA 4PABA 3DJJA 2Y6QA 1BKWA 3VR9A 1KNRA 2WHDA 4WX1A 4APNA 2XLTA 5IQ4A 3BHKA 2XVEA 4J56A 4E0VA 5KWFA 4PAAA 2B9XA 3KVEA 2NVKX 2WDVA 4H2QA 4H2PA 4HB9A 4RG4A 1CJ3A 3COXA 1GALA 1K0IA 5IPYA 4RSLA 4ZCCA 1NEKA 1GOSA 1KF6A 5HHFA 4II2A 2YG4A 4OPDA 1PN0A 2B7RA 1OJTA 1EL8A 3LADA 5HYMA 4KPRA 2VVLG 5FMHA 1NG4A 3GYJA 2XLSA 4J57A 4U8LA 2C4CA 2E5VA 1S3EA 3IWAA 1GREA 4G74A 4MJWA 1REOA 1MOKA 3ALJA 3AE7A 2BCGG 1E1KA 4H4WA 4NEWA 3M13A 3GWDA 3E1TA 2GR3A 3P4SA 2GMHA 2GV8A 3CNPA 4A6NA 1PXCA 4U2TA 1O5WA 3K7TA 1L9DA 2YR5A 4U8PA 1YQZA 4RG3A 1YKJA 1PS9A 2C64A 2WPFA 2YLTA 2BS2A 2YM1A 4H50A 4ICYA 1DODA 3SFDA 1JRZA 4YJHA 4NWZA 4UP3A 4EMJA 2YWLA 3GSIA 4DNAA 2EQ7A 1FEAA 2YG5A 5HXIA 3HZLA 2B7SA 1KSSA 1H83A 3LZWA 2WPCA 5IQ1A 2BRYA 2CDUA 1TDKA 2A89A 4U8MA 3GMCA 4YJFA 4U2SA 5FS8A 1F8RA 4BK3A 1O94A 3W4KA 4EM4A 1D4DA 4GRTA 3UTGA 2JAEA 1PBBA 3DA1A 3FBSA 2E4AA 1N4VA 2PHHA 3GYXA 4C74A 4Z44A 5KMPA 2CVJA 4WCTA 4GR1A 4KX6A 3AYIA 2WOVA 2YLSA 2BK5A 5KNLA 3NK2X 5KXJA 4EQRA 1N4UA 2BRAA 5M10A 1PXBA 3BNUA 3EANA 4HA6A 1CJ2A 4G73A 1DJNA 4OVIA 4X9MA 5DBJA 1GTEA 3F8DA 4J31A 1P2HA 1JEHA 4YTPA 3BI5A 5BULA 1B5QA 1FCDA 4J36A 2DKIA 4D04A 4UDPA 3ISHA 3AE6A 1IUWA 2V3BA 1M6IA 3AE4A 3GRSA 3Q9TA 3VRAA 3SM8A 1RSGA 1E1NA 3H8IA 1P2EA 5JCNA 1GTHA 1D4CA 1ZP0A 2IVEA 1JU2A 4H4PA 2GAGB
chains in the Genus database with same CATH topology
1CC2A 3AE9A 4EQSA 3SGLA 2XCGA 4EIPA 1IUSA 2TPRA 4EMIA 2YG7A 1F6MA 4FK1A 3UKLA 4A6NB 1H82A 2JB3A 2VOUA 3H8LA 3NK1X 2W0HA 1L9CA 1BGJA 4NNJA 3UOYA 3T14A 5FS6A 4H4RA 2GR1A 2GQWA 3DGHA 5JCLA 4YJDA 5KOWA 1DOBA 2YVGA 3NTAA 3ATQA 4H2NA 2RABA 1FL2A 4TM4A 1GSNA 4BV6A 1N1PA 2BABA 2FBWA 1S3BA 4I58A 2WP6A 3B3RA 4A9WA 3OZ2A 4JY2A 5GSNA 3CPJG 5EB4A 3V76A 1PBFA 3L8KA 1NHPA 3P4RA 3CNJA 4OPGA 2Q6UA 2XDOA 4TM1A 3SY4A 3DJGX 4UDRA 4ZN0A 1Q1WA 4OPIA 1F8WA 2BC0A 2JB2A 2GR0A 4JY3A 3UP5A 1EBDA 2QA2A 1ZKQA 3F8RA 3PVCA 3VR8A 3REDA 4ADWA 1YQ3A 2OAMA 1CJ4A 1NDAA 3HYWA 3T2YA 2BXSA 5BUKA 3SX6A 3RNMA 4JNAA 3AD9B 3ALMA 4IA6A 1JOAA 4OCGA 3UP4A 2ARDA 4XWRA 3UOXA 2YR4A 3IHGA 2XVIA 3WE0A 1ONFA 2C72A 1ELIA 4YJGA 1PBCA 1XANA 3KPKA 3AE8A 4H4XA 2Q0LA 4OPCA 4YKFA 3P4PA 2AAQA 3AXBA 2QA1A 4YTMA 3UKAA 1PJ6A 4LU6A 1EL5A 4IA5A 1OJDA 3ATRA 1GV4A 2TMDA 4GAVA 1LV0A 4X9NA 2WBAA 3T0KA 3UOZA 4O5UA 1AOGA 2GF3A 1O95A 1DOEA 3ITJA 3AD8B 3VRBA 4BJZA 1VQWA 4GDEA 3NGCX 2R0CA 4QFCA 2V3AA 4UDQA 3SQPA 2BK3A 3II4A 4H4SA 2R45A 2XFUA 3ZNOA 4CNKA 2GH5A 3CN8A 5C2TA 2FJBA 2R4EA 1LPFA 4D03A 1PBDA 2B9WA 1CBOA 2BK4A 3B6DA 2C75A 2ZBWA 4Y4LA 1GESA 1S2QA 4XXGA 1LJ1A 2V60A 1TDFA 1Q1RA 3UTFA 1H7WA 2XVFA 3BNMA 2A8XA 1K0JA 5U63A 4C3YA 4NTDA 5C3JA 5L46A 4GAPA 2RGJA 2ZZ0A 4G6HA 3QFBA 1PJ5A 1PJ7A 5EBKA 4K7ZA 3BI4A 2BYBA 3S61A 1D7YA 4YSZA 4N9XA 2WETA 4H4ZA 4K5RA 2OLOA 3I3LA 2AR8A 2C65A 4USQA 3NYCA 5J7XA 2X50A 4YJHB 1XPQA 2DKHA 3OC4A 1MO9A 3DJEA 1BZLA 1VE9A 3AE1A 4YJGB 3JSKA 4A7AA 4AP1A 4Z25A 1JRXA 2YLWA 5KVIA 3CGDA 4H4TA 2R0PA 3D8XA 2QCUA 1VRQB 1GXFA 3KU9A 3AD7B 1B4VA 4GF7A 3SZ0A 4XWZA 3UKHA 4TLXA 2XVJA 3DK8A 3URHA 1CL0A 1GPEA 1F8SA 1YQ4A 2NPXA 1DDOA 2X8GA 2YLXA 1RYIA 3GWFA 2B76A 1DJQA 3LB8A 3Q6JA 4YTNA 2GEWA 3DGZA 4M52A 4A79A 2WDQA 2YM2A 1CF3A 2WPEA 3AEEA 3LXDA 4C77A 2BS3A 3CIRA 3VQRA 1N4WA 3AEFA 3SZFA 2E1MA 1MXTA 3AEDA 2VQ7A 4U8NA 3ABVA 4IVMB 2V5ZA 4U2LA 4DGKA 2O9ZA 1Q9IA 1NG3A 1H6VA 2X99A 3KKJA 2GB0A 3ZNNA 3PS9A 1BWCA 1TRBA 4OPLA 3RHAA 3H4KA 2YVFA 1NAAA 5U25A 1ZY8A 5FS9A 1C0LA 2GQFA 1NHRA 2JKCA 2E48A 3C4NA 3WGTA 4J2WA 1TDNA 3VRDB 1C0PA 2WU5A 1IUVA 1KDGA 3GDPA 5KVHA 1PBEA 2X3NA 3LOVA 1DOCA 4OPTA 2WQYA 4Y4NA 1KIFA 2OA1A 3NK0X 3SXIA 3AE5A 1QO8A 4A99A 1OJCA 1DXLA 1FECA 3ZDNA 4B1BA 1TDEA 3NKSA 4Z2UA 2YQUA 2Q0KA 2YG6A 3UCLA 4Z2RA 3CNDA 4B63A 3C4AA 2EQ6A 1GERA 4CCRA 3DJDA 4CY6A 3ZNQA 3QFAA 4YJFB 1CC6A 1XDIA 2BC1A 2XYOA 1ZK7A 3NTDA 2BCPA 3K30A 5EB5A 3NYEA 4ZCDA 1XHCA 3AEGA 1GRGA 3D1CA 2FJEA 1L9EA 4II3A 1AN9A 3IHMA 4BURA 4B65A 2Q7VA 2YR6A 4FK1C 4H4YA 3G5RA 3CGBA 3DH9A 4K22A 1ZMCA 3G5SA 2UZZA 4CBQA 4EMWA 4IV9A 3F8PA 4JNQA 1VG9A 1V59A 3KLJA 4DSGA 3V3NA 1BGNA 2FJDA 3KPFA 3NH3X 1LQUA 4ECHA 3NLCA 2XLUA 3EAOA 3CGCA 3GD4A 3NNEA 1KSUA 4FDCB 3W4IA 2XFOA 2JBVA 4TM0A 1CC4A 5CKUA 1GT8A 1NHSA 1GNDA 4G6GA 4CNJA 1H84A 1UKVG 1NHQA 1Y56B 4I59A 1K0LA 3P4QA 2R0GA 3GYIA 1ZX9A 2BACA 4H4UA 3AEBA 1B8SA 5KMQA 4YSYA 1IUTA 2ZZBA 5J60A 2C66A 1W4XA 3DK9A 2RGHA 3T31A 4CY8A 2H89A 3NIXA 5EOWA 1NPXA 4H2RA 2XLRA 3P9UA 4NZHA 3M12A 2R4JA 2WDRA 3QJ4A 1B37A 1GRAA 2VVMA 4LA1A 5CQFA 4NEVA 4B64A 3NHOX 2Z5YA 2C67A 3R9UA 2ACZA 1JRYA 2VRLA 2CULA 1GEUA 2GMJA 2OALA 4NTEA 5LV9A 3C96A 3NT6A 4J33A 4K2XA 4JDRA 2XVHA 1E1MA 3G5QA 3KA7A 3EPTA 4YKGA 3T2KA 5KMSA 3SFEA 1H86A 3UKKA 4K5SA 1EL7A 3ALLA 4B66A 1D5TA 3W4JA 2DU8A 1RP0A 2ZZCA 4H4QA 2FJAA 4TM3A 2XFQA 1TDOA 3FMWA 5TR3A 3ZNPA 1DNCA 3UKFA 4GDPA 3RP6A 1ZDLA 2I0ZA 4USRA 2E82A 3GMBA 5FS7A 3FPZA 4GUVA 3T37A 4P9SA 1H7XA 2Y6RA 3O0HA 2IIDA 3RP7A 1KFYA 3K7MX 2B9YA 5JCMA 4K8DA 4REKA 4DSHA 3QSSA 3AE2A 4Z2TA 3AB1A 1KNPA 1ZOYA 2GR2A 2PYXA 1D7LA 1PXAA 3IF9A 1GRFA 5BVAA 4LIIA 1NENA 1BF3A 4EQWA 1CJCA 2WOIA 5BRTA 1CHUA 4Y4MA 1H81A 2CFYA 2JK6A 3CPIG 1EL9A 2E49A 3DMEA 1ZOVA 2WESA 4TLZA 4IVOB 4EM3A 1HYUA 3V3OA 1PDHA 3CNTA 3ICSA 3CGEA 1JNRA 2C3CA 3DK4A 3AYLA 1LTXR 1E7PA 2WOWA 1DAOA 1TYPA 1GRHA 3KD9A 2XFPA 2GAHB 4QFDA 2C3DA 3UKQA 2YLRA 1E1LA 1SEZA 3AEAA 4U8KA 4U8OA 4YWOA 1L0VA 4YXDA 5GRTA 2C73A 3CNSA 2XFNA 4YSXA 1D4EA 2VVLA 1X31B 2C76A 4NTCA 4A65A 2WS3A 3QSEA 2V6OA 1S2YA 3G3EA 3QVPA 1E6EA 4G9KA 5ER0A 4B69A 4Z26A 1F3PA 1QJDA 3RP8A 4YT0A 2WU2A 3S5WA 3HYVA 3NYFA 4CCQA 5JCIA 5KOXA 2X8CA 3ICTA 1OJ9A 5JCKA 3CTYA 4AT0A 4AOXA 4YSHA 3SZWA 3FG2P 3NG7X 3PO7A 4X4JA 2R46A 3UTHA 1K4QA 1FEBA 1OJAA 2BS4A 1C0IA 3BHFA 2C70A 4U8JA 5KMRA 1LVLA 3NN6X 3T2ZA 4JQ9A 1IUXA 1ZMDA 3LJPA 4FX9A 3M0OA 5U1OA 4B67A 2C7GA 4EQXA 1EVIA 2BXRA 2EQ9A 3AYJA 1VDCA 2EQ8A 2WP9A 3SYIA 1Y56A 2WEUA 3ICRA 1JNZA 2F5ZA 2GVCA 3UKPA 2E4GA 3ADAB 1E39A 4Z24A 3HYXA 2GRTA 4A5LA 3QVRA 1GRBA 4J34A 5KRQA 4H4VA 3LZXA 2V61A 2IVDA 1COYA 1GETA 1Y0PA 4BK1A 1PHHA 3AE3A 3BI2A 3GD3A 4BJYA 3CMMA 4AOSA 4GCMA 4B68A 2VQBA 2JB1A 3AECA 3CUKA 2OLNA 1YY5A 2BA9A 3NN0X 2VRMA 2VZ2A 3IC9A 2YVJA 5M0ZA 1LQTA 3L1RA 3AWIA 3QSMA 2HQMA 1IJHA 3FIMB 3SZCA 4Z43A 2R9ZA 1FOHA 3P1WA 4EIQA 4JN9A 1Z6LA 2WP5A 3EF6A 1GRTA 4C3XA 1VG0A 2APGA 1C0KA 2A87A 1QLBA 2H88A 2X8HA 2XLPA 2YAUA 3ZYXA 4CRTA 1IUUA 2AQJA 3UTEA 4U8IA 4H7UA 3GRTA 3CPHG 4OPUA 4C5OA 3K7QX 5HY5A 2YG3A 4O5QA 2J3NA 1TYTA 2Z5XA 3NRNA 1M64A 2YLZA 2RGOA 2QAEA 3GDNA 3UOVA 4AP3A 4BK2A 4AT2A 3I6DA 4PABA 3DJJA 2Y6QA 1BKWA 3VR9A 1KNRA 2WHDA 4WX1A 4APNA 2XLTA 5IQ4A 3BHKA 2XVEA 4J56A 4E0VA 5KWFA 4PAAA 2B9XA 3KVEA 2NVKX 2WDVA 4H2QA 4H2PA 4HB9A 4RG4A 1CJ3A 3COXA 1GALA 1K0IA 5IPYA 4RSLA 4ZCCA 1NEKA 1GOSA 1KF6A 5HHFA 4II2A 2YG4A 4OPDA 1PN0A 2B7RA 1OJTA 1EL8A 3LADA 4KPRA 5HYMA 2VVLG 5FMHA 1NG4A 3GYJA 2XLSA 4J57A 4U8LA 2C4CA 2E5VA 1S3EA 3IWAA 1GREA 4G74A 4MJWA 1REOA 1MOKA 3AE7A 3ALJA 2BCGG 1E1KA 4H4WA 4NEWA 3M13A 3GWDA 3E1TA 2GR3A 3P4SA 2GMHA 2GV8A 3CNPA 4A6NA 1PXCA 4U2TA 1O5WA 3K7TA 1L9DA 2YR5A 4U8PA 1YQZA 4RG3A 1YKJA 1PS9A 2C64A 2WPFA 2YLTA 2BS2A 2YM1A 4H50A 4ICYA 1DODA 3SFDA 1JRZA 4YJHA 4NWZA 4UP3A 4EMJA 2YWLA 3GSIA 4DNAA 2EQ7A 1FEAA 2YG5A 5HXIA 3HZLA 2B7SA 1KSSA 1H83A 3LZWA 2WPCA 5IQ1A 2BRYA 2CDUA 1TDKA 2A89A 4U8MA 3GMCA 4YJFA 4U2SA 5FS8A 1F8RA 4BK3A 1O94A 3W4KA 4EM4A 1D4DA 4GRTA 3UTGA 2JAEA 1PBBA 3DA1A 3FBSA 2E4AA 1N4VA 2PHHA 3GYXA 4C74A 4Z44A 5KMPA 2CVJA 4WCTA 4GR1A 4KX6A 3AYIA 2WOVA 2YLSA 2BK5A 5KNLA 3NK2X 5KXJA 4EQRA 1N4UA 2BRAA 5M10A 1PXBA 3BNUA 3EANA 4HA6A 1CJ2A 4G73A 1DJNA 4OVIA 4X9MA 5DBJA 1GTEA 3F8DA 4J31A 1P2HA 1JEHA 4YTPA 3BI5A 5BULA 1B5QA 1FCDA 4J36A 2DKIA 4D04A 4UDPA 3ISHA 3AE6A 1IUWA 2V3BA 1M6IA 3AE4A 3GRSA 3Q9TA 3VRAA 3SM8A 1RSGA 1E1NA 3H8IA 1P2EA 5JCNA 1GTHA 1D4CA 1ZP0A 2IVEA 1JU2A 4H4PA 2GAGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CC2 A;  3AE9 A;  4EQS A;  3SGL A;  2XCG A;  4EIP A;  1IUS A;  2TPR A;  4EMI A;  2YG7 A;  1F6M A;  4FK1 A;  3UKL A;  4A6N B;  1H82 A;  2JB3 A;  2VOU A;  3H8L A;  3NK1 X;  2W0H A;  1L9C A;  1BGJ A;  3UOY A;  5FS6 A;  4H4R A;  2GR1 A;  2GQW A;  3DGH A;  5JCL A;  4YJD A;  5KOW A;  1DOB A;  2YVG A;  3NTA A;  3ATQ A;  4H2N A;  2RAB A;  1FL2 A;  4TM4 A;  1GSN A;  4BV6 A;  1N1P A;  2BAB A;  2FBW A;  1S3B A;  4I58 A;  2WP6 A;  3B3R A;  4A9W A;  3OZ2 A;  4JY2 A;  5GSN A;  3CPJ G;  5EB4 A;  3V76 A;  1PBF A;  3L8K A;  1NHP A;  3P4R A;  3CNJ A;  4OPG A;  2Q6U A;  2XDO A;  4TM1 A;  3DJG X;  4UDR A;  4ZN0 A;  1Q1W A;  4OPI A;  1F8W A;  2BC0 A;  2JB2 A;  2GR0 A;  4JY3 A;  3UP5 A;  1EBD A;  2QA2 A;  1ZKQ A;  3F8R A;  3PVC A;  3VR8 A;  3RED A;  4ADW A;  1YQ3 A;  2OAM A;  1CJ4 A;  1NDA A;  2BXS A;  5BUK A;  3RNM A;  4JNA A;  3AD9 B;  3ALM A;  4IA6 A;  1JOA A;  4OCG A;  3UP4 A;  2ARD A;  4XWR A;  3UOX A;  2YR4 A;  3IHG A;  2XVI A;  3WE0 A;  1ONF A;  2C72 A;  1ELI A;  4YJG A;  1PBC A;  1XAN A;  3AE8 A;  4H4X A;  2Q0L A;  4OPC A;  4YKF A;  3P4P A;  2AAQ A;  3AXB A;  2QA1 A;  4YTM A;  3UKA A;  1PJ6 A;  4LU6 A;  1EL5 A;  4IA5 A;  1OJD A;  3ATR A;  1GV4 A;  2TMD A;  1LV0 A;  4X9N A;  2WBA A;  3UOZ A;  4O5U A;  1AOG A;  2GF3 A;  1O95 A;  1DOE A;  3ITJ A;  3AD8 B;  3VRB A;  4BJZ A;  1VQW A;  4GDE A;  3NGC X;  2R0C A;  4QFC A;  2V3A A;  4UDQ A;  3SQP A;  2BK3 A;  3II4 A;  4H4S A;  2R45 A;  2XFU A;  3ZNO A;  4CNK A;  2GH5 A;  3CN8 A;  5C2T A;  2FJB A;  2R4E A;  1LPF A;  4D03 A;  1PBD A;  2B9W A;  1CBO A;  2BK4 A;  3B6D A;  2C75 A;  2ZBW A;  4Y4L A;  1GES A;  1S2Q A;  4XXG A;  1LJ1 A;  2V60 A;  1TDF A;  1Q1R A;  3UTF A;  1H7W A;  2XVF A;  3BNM A;  2A8X A;  1K0J A;  5U63 A;  4C3Y A;  4NTD A;  5C3J A;  5L46 A;  2RGJ A;  2ZZ0 A;  3QFB A;  1PJ5 A;  1PJ7 A;  5EBK A;  4K7Z A;  3BI4 A;  2BYB A;  3S61 A;  1D7Y A;  4YSZ A;  4N9X A;  2WET A;  4H4Z A;  4K5R A;  2OLO A;  3I3L A;  2AR8 A;  2C65 A;  4USQ A;  3NYC A;  5J7X A;  2X50 A;  4YJH B;  1XPQ A;  2DKH A;  3OC4 A;  1MO9 A;  3DJE A;  1BZL A;  1VE9 A;  3AE1 A;  4YJG B;  3JSK A;  4A7A A;  4AP1 A;  4Z25 A;  1JRX A;  2YLW A;  5KVI A;  3CGD A;  4H4T A;  2R0P A;  3D8X A;  2QCU A;  1VRQ B;  1GXF A;  3KU9 A;  3AD7 B;  1B4V A;  4GF7 A;  3UKH A;  4XWZ A;  4TLX A;  2XVJ A;  3DK8 A;  3URH A;  1CL0 A;  1GPE A;  1F8S A;  1YQ4 A;  2NPX A;  1DDO A;  2X8G A;  2YLX A;  1RYI A;  3GWF A;  2B76 A;  1DJQ A;  3LB8 A;  3Q6J A;  4YTN A;  2GEW A;  3DGZ A;  4M52 A;  4A79 A;  2WDQ A;  2YM2 A;  1CF3 A;  2WPE A;  3AEE A;  3LXD A;  4C77 A;  2BS3 A;  3CIR A;  3VQR A;  1N4W A;  3AEF A;  2E1M A;  1MXT A;  3AED A;  2VQ7 A;  4U8N A;  3ABV A;  4IVM B;  2V5Z A;  4U2L A;  4DGK A;  2O9Z A;  1Q9I A;  1NG3 A;  1H6V A;  2X99 A;  3KKJ A;  2GB0 A;  3ZNN A;  3PS9 A;  1BWC A;  1TRB A;  4OPL A;  3RHA A;  3H4K A;  2YVF A;  1NAA A;  5U25 A;  1ZY8 A;  5FS9 A;  1C0L A;  2GQF A;  1NHR A;  2JKC A;  2E48 A;  3C4N A;  3WGT A;  4J2W A;  1TDN A;  3VRD B;  1C0P A;  2WU5 A;  1IUV A;  1KDG A;  3GDP A;  5KVH A;  1PBE A;  2X3N A;  3LOV A;  1DOC A;  4OPT A;  2WQY A;  4Y4N A;  1KIF A;  2OA1 A;  3NK0 X;  3AE5 A;  1QO8 A;  4A99 A;  1OJC A;  1DXL A;  1FEC A;  3ZDN A;  4B1B A;  1TDE A;  3NKS A;  4Z2U A;  2YQU A;  2Q0K A;  2YG6 A;  3UCL A;  4Z2R A;  3CND A;  4B63 A;  3C4A A;  2EQ6 A;  1GER A;  4CCR A;  3DJD A;  4CY6 A;  3ZNQ A;  3QFA A;  4YJF B;  1CC6 A;  1XDI A;  2BC1 A;  2XYO A;  1ZK7 A;  3NTD A;  2BCP A;  3K30 A;  5EB5 A;  3NYE A;  4ZCD A;  1XHC A;  3AEG A;  1GRG A;  3D1C A;  2FJE A;  1L9E A;  1AN9 A;  3IHM A;  4BUR A;  4B65 A;  2Q7V A;  2YR6 A;  4FK1 C;  4H4Y A;  3G5R A;  3CGB A;  3DH9 A;  4K22 A;  1ZMC A;  3G5S A;  2UZZ A;  4CBQ A;  4EMW A;  4IV9 A;  3F8P A;  4JNQ A;  1VG9 A;  1V59 A;  3KLJ A;  4DSG A;  3V3N A;  1BGN A;  2FJD A;  3KPF A;  3NH3 X;  1LQU A;  4ECH A;  3NLC A;  2XLU A;  3EAO A;  3CGC A;  3GD4 A;  3NNE A;  1KSU A;  4FDC B;  3W4I A;  2XFO A;  2JBV A;  4TM0 A;  1CC4 A;  5CKU A;  1GT8 A;  1NHS A;  1GND A;  4CNJ A;  1H84 A;  1UKV G;  1NHQ A;  1Y56 B;  4I59 A;  1K0L A;  3P4Q A;  2R0G A;  3GYI A;  1ZX9 A;  2BAC A;  4H4U A;  3AEB A;  1B8S A;  4YSY A;  1IUT A;  2ZZB A;  5J60 A;  2C66 A;  1W4X A;  3DK9 A;  2RGH A;  4CY8 A;  2H89 A;  3NIX A;  5EOW A;  1NPX A;  4H2R A;  2XLR A;  3P9U A;  4NZH A;  3M12 A;  2R4J A;  2WDR A;  3QJ4 A;  1B37 A;  1GRA A;  2VVM A;  4LA1 A;  5CQF A;  4NEV A;  4B64 A;  3NHO X;  2Z5Y A;  2C67 A;  3R9U A;  2ACZ A;  1JRY A;  2VRL A;  2CUL A;  1GEU A;  2GMJ A;  2OAL A;  4NTE A;  5LV9 A;  3C96 A;  3NT6 A;  4J33 A;  4K2X A;  4JDR A;  2XVH A;  1E1M A;  3G5Q A;  3KA7 A;  3EPT A;  4YKG A;  3SFE A;  1H86 A;  3UKK A;  4K5S A;  1EL7 A;  3ALL A;  4B66 A;  1D5T A;  3W4J A;  2DU8 A;  1RP0 A;  2ZZC A;  4H4Q A;  2FJA A;  4TM3 A;  2XFQ A;  1TDO A;  3FMW A;  5TR3 A;  3ZNP A;  1DNC A;  3UKF A;  4GDP A;  3RP6 A;  1ZDL A;  2I0Z A;  4USR A;  2E82 A;  3GMB A;  5FS7 A;  3FPZ A;  4GUV A;  3T37 A;  4P9S A;  1H7X A;  2Y6R A;  3O0H A;  2IID A;  3RP7 A;  1KFY A;  3K7M X;  2B9Y A;  5JCM A;  4K8D A;  4REK A;  4DSH A;  3QSS A;  3AE2 A;  4Z2T A;  3AB1 A;  1KNP A;  1ZOY A;  2GR2 A;  2PYX A;  1D7L A;  1PXA A;  3IF9 A;  1GRF A;  5BVA A;  4LII A;  1NEN A;  1BF3 A;  4EQW A;  1CJC A;  2WOI A;  5BRT A;  1CHU A;  4Y4M A;  1H81 A;  2CFY A;  2JK6 A;  3CPI G;  1EL9 A;  2E49 A;  3DME A;  1ZOV A;  2WES A;  4TLZ A;  4IVO B;  4EM3 A;  1HYU A;  3V3O A;  1PDH A;  3CNT A;  3ICS A;  3CGE A;  1JNR A;  2C3C A;  3DK4 A;  3AYL A;  1LTX R;  1E7P A;  2WOW A;  1DAO A;  1TYP A;  1GRH A;  3KD9 A;  2XFP A;  2GAH B;  4QFD A;  2C3D A;  3UKQ A;  2YLR A;  1E1L A;  1SEZ A;  3AEA A;  4U8K A;  4U8O A;  4YWO A;  1L0V A;  4YXD A;  5GRT A;  2C73 A;  3CNS A;  2XFN A;  4YSX A;  1D4E A;  2VVL A;  1X31 B;  2C76 A;  4NTC A;  4A65 A;  2WS3 A;  3QSE A;  2V6O A;  1S2Y A;  3G3E A;  3QVP A;  1E6E A;  5ER0 A;  4B69 A;  4Z26 A;  1F3P A;  1QJD A;  3RP8 A;  4YT0 A;  2WU2 A;  3S5W A;  3NYF A;  4CCQ A;  5JCI A;  5KOX A;  2X8C A;  3ICT A;  1OJ9 A;  5JCK A;  3CTY A;  4AT0 A;  4AOX A;  4YSH A;  3FG2 P;  3NG7 X;  3PO7 A;  4X4J A;  2R46 A;  3UTH A;  1K4Q A;  1FEB A;  1OJA A;  2BS4 A;  1C0I A;  3BHF A;  2C70 A;  4U8J A;  1LVL A;  3NN6 X;  4JQ9 A;  1IUX A;  1ZMD A;  3LJP A;  4FX9 A;  3M0O A;  5U1O A;  4B67 A;  2C7G A;  4EQX A;  1EVI A;  2BXR A;  2EQ9 A;  3AYJ A;  1VDC A;  2EQ8 A;  2WP9 A;  1Y56 A;  2WEU A;  3ICR A;  1JNZ A;  2F5Z A;  2GVC A;  3UKP A;  2E4G A;  3ADA B;  1E39 A;  4Z24 A;  4A5L A;  2GRT A;  3QVR A;  1GRB A;  4J34 A;  5KRQ A;  4H4V A;  3LZX A;  2V61 A;  2IVD A;  1COY A;  1GET A;  1Y0P A;  4BK1 A;  1PHH A;  3AE3 A;  3BI2 A;  3GD3 A;  4BJY A;  4AOS A;  4GCM A;  4B68 A;  2VQB A;  2JB1 A;  3AEC A;  3CUK A;  2OLN A;  1YY5 A;  2BA9 A;  3NN0 X;  2VRM A;  2VZ2 A;  3IC9 A;  2YVJ A;  5M0Z A;  1LQT A;  3L1R A;  3AWI A;  3QSM A;  2HQM A;  1IJH A;  3FIM B;  4Z43 A;  2R9Z A;  1FOH A;  3P1W A;  4EIQ A;  4JN9 A;  1Z6L A;  2WP5 A;  3EF6 A;  1GRT A;  4C3X A;  1VG0 A;  2APG A;  1C0K A;  2A87 A;  1QLB A;  2H88 A;  2X8H A;  2XLP A;  2YAU A;  3ZYX A;  4CRT A;  1IUU A;  2AQJ A;  3UTE A;  4U8I A;  4H7U A;  3GRT A;  3CPH G;  4OPU A;  4C5O A;  3K7Q X;  5HY5 A;  2YG3 A;  4O5Q A;  2J3N A;  1TYT A;  2Z5X A;  3NRN A;  1M64 A;  2YLZ A;  2RGO A;  2QAE A;  3GDN A;  3UOV A;  4AP3 A;  4BK2 A;  4AT2 A;  3I6D A;  4PAB A;  3DJJ A;  2Y6Q A;  1BKW A;  3VR9 A;  1KNR A;  2WHD A;  4WX1 A;  4APN A;  2XLT A;  5IQ4 A;  3BHK A;  2XVE A;  4J56 A;  4E0V A;  5KWF A;  4PAA A;  2B9X A;  3KVE A;  2NVK X;  2WDV A;  4H2Q A;  4H2P A;  4HB9 A;  4RG4 A;  1CJ3 A;  3COX A;  1GAL A;  1K0I A;  5IPY A;  4RSL A;  4ZCC A;  1NEK A;  1GOS A;  1KF6 A;  5HHF A;  2YG4 A;  4OPD A;  1PN0 A;  2B7R A;  1OJT A;  1EL8 A;  3LAD A;  4KPR A;  5HYM A;  2VVL G;  5FMH A;  1NG4 A;  3GYJ A;  2XLS A;  4J57 A;  4U8L A;  2E5V A;  3IWA A;  1S3E A;  5BUL A;  1GRE A;  4MJW A;  1REO A;  1MOK A;  3AE7 A;  3ALJ A;  2BCG G;  1E1K A;  4H4W A;  4NEW A;  3M13 A;  3GWD A;  3E1T A;  2GR3 A;  3P4S A;  2GMH A;  2GV8 A;  3CNP A;  4A6N A;  1PXC A;  4U2T A;  1O5W A;  3K7T A;  1L9D A;  2YR5 A;  4U8P A;  1YQZ A;  4RG3 A;  1YKJ A;  1PS9 A;  2C64 A;  2WPF A;  2YLT A;  2BS2 A;  2YM1 A;  4H50 A;  4ICY A;  1DOD A;  3SFD A;  1JRZ A;  4YJH A;  4UP3 A;  4EMJ A;  2YWL A;  3GSI A;  4DNA A;  2EQ7 A;  1FEA A;  2YG5 A;  5HXI A;  3HZL A;  2B7S A;  1KSS A;  1H83 A;  3LZW A;  2WPC A;  5IQ1 A;  2CDU A;  1TDK A;  2A89 A;  4U8M A;  3GMC A;  4YJF A;  4U2S A;  5FS8 A;  1F8R A;  4BK3 A;  1O94 A;  3W4K A;  4EM4 A;  1D4D A;  4GRT A;  3UTG A;  2JAE A;  1PBB A;  3DA1 A;  3FBS A;  2E4A A;  1N4V A;  2PHH A;  4C74 A;  4Z44 A;  2CVJ A;  4WCT A;  4GR1 A;  4KX6 A;  3AYI A;  2WOV A;  2YLS A;  2BK5 A;  3NK2 X;  5KXJ A;  4EQR A;  1N4U A;  5M10 A;  1PXB A;  3BNU A;  3EAN A;  4HA6 A;  1CJ2 A;  1DJN A;  4OVI A;  4X9M A;  5DBJ A;  1GTE A;  3F8D A;  4J31 A;  1P2H A;  1JEH A;  4YTP A;  3BI5 A;  1B5Q A;  1FCD A;  4J36 A;  2DKI A;  4D04 A;  4UDP A;  3ISH A;  3AE6 A;  1IUW A;  2V3B A;  1M6I A;  3AE4 A;  3GRS A;  3Q9T A;  3VRA A;  3SM8 A;  1RSG A;  1E1N A;  3H8I A;  1P2E A;  5JCN A;  1GTH A;  1D4C A;  1ZP0 A;  2IVE A;  1JU2 A;  4H4P A;  2GAG B; 
#chains in the Genus database with same CATH topology
 1CC2 A;  3AE9 A;  4EQS A;  3SGL A;  4EIP A;  2XCG A;  1IUS A;  2TPR A;  4EMI A;  2YG7 A;  1F6M A;  4FK1 A;  3UKL A;  4A6N B;  1H82 A;  2JB3 A;  2VOU A;  3H8L A;  3NK1 X;  2W0H A;  1L9C A;  1BGJ A;  4NNJ A;  3UOY A;  3T14 A;  5FS6 A;  4H4R A;  2GR1 A;  2GQW A;  3DGH A;  5JCL A;  4YJD A;  5KOW A;  1DOB A;  2YVG A;  3NTA A;  3ATQ A;  4H2N A;  2RAB A;  1FL2 A;  4TM4 A;  1GSN A;  4BV6 A;  1N1P A;  2BAB A;  2FBW A;  1S3B A;  4I58 A;  2WP6 A;  3B3R A;  4A9W A;  3OZ2 A;  4JY2 A;  5GSN A;  3CPJ G;  5EB4 A;  3V76 A;  1PBF A;  3L8K A;  1NHP A;  3P4R A;  3CNJ A;  4OPG A;  2Q6U A;  2XDO A;  4TM1 A;  3SY4 A;  3DJG X;  4UDR A;  4ZN0 A;  1Q1W A;  4OPI A;  1F8W A;  2BC0 A;  2JB2 A;  4JY3 A;  2GR0 A;  3UP5 A;  1EBD A;  2QA2 A;  1ZKQ A;  3F8R A;  3PVC A;  3VR8 A;  3RED A;  4ADW A;  1YQ3 A;  2OAM A;  1CJ4 A;  1NDA A;  3HYW A;  3T2Y A;  2BXS A;  5BUK A;  3SX6 A;  3RNM A;  4JNA A;  3AD9 B;  3ALM A;  4IA6 A;  1JOA A;  4OCG A;  3UP4 A;  2ARD A;  4XWR A;  3UOX A;  2YR4 A;  3IHG A;  2XVI A;  3WE0 A;  1ONF A;  2C72 A;  1ELI A;  4YJG A;  1PBC A;  1XAN A;  3KPK A;  3AE8 A;  4H4X A;  2Q0L A;  4OPC A;  4YKF A;  3P4P A;  2AAQ A;  3AXB A;  2QA1 A;  4YTM A;  3UKA A;  1PJ6 A;  4LU6 A;  1EL5 A;  4IA5 A;  1OJD A;  3ATR A;  1GV4 A;  2TMD A;  4GAV A;  1LV0 A;  4X9N A;  2WBA A;  3T0K A;  3UOZ A;  4O5U A;  1AOG A;  2GF3 A;  1O95 A;  1DOE A;  3ITJ A;  3AD8 B;  4BJZ A;  3VRB A;  1VQW A;  4GDE A;  3NGC X;  2R0C A;  4QFC A;  2V3A A;  4UDQ A;  3SQP A;  2BK3 A;  3II4 A;  4H4S A;  2R45 A;  2XFU A;  3ZNO A;  4CNK A;  2GH5 A;  3CN8 A;  5C2T A;  2FJB A;  2R4E A;  1LPF A;  4D03 A;  1PBD A;  2B9W A;  1CBO A;  2BK4 A;  3B6D A;  2C75 A;  2ZBW A;  4Y4L A;  1GES A;  1S2Q A;  4XXG A;  1LJ1 A;  2V60 A;  1TDF A;  1Q1R A;  3UTF A;  1H7W A;  2XVF A;  3BNM A;  2A8X A;  1K0J A;  5U63 A;  4C3Y A;  4NTD A;  5C3J A;  5L46 A;  4GAP A;  2RGJ A;  2ZZ0 A;  4G6H A;  3QFB A;  1PJ5 A;  1PJ7 A;  5EBK A;  4K7Z A;  3BI4 A;  2BYB A;  3S61 A;  1D7Y A;  4YSZ A;  4N9X A;  2WET A;  4H4Z A;  4K5R A;  2OLO A;  3I3L A;  2AR8 A;  2C65 A;  4USQ A;  3NYC A;  5J7X A;  2X50 A;  4YJH B;  1XPQ A;  2DKH A;  3OC4 A;  1MO9 A;  3DJE A;  1BZL A;  1VE9 A;  3AE1 A;  4YJG B;  3JSK A;  4A7A A;  4AP1 A;  4Z25 A;  1JRX A;  2YLW A;  5KVI A;  3CGD A;  4H4T A;  2R0P A;  3D8X A;  2QCU A;  1VRQ B;  4GF7 A;  1GXF A;  3AD7 B;  1B4V A;  3KU9 A;  3SZ0 A;  4XWZ A;  3UKH A;  4TLX A;  2XVJ A;  3DK8 A;  3URH A;  1CL0 A;  1GPE A;  1F8S A;  1YQ4 A;  2NPX A;  1DDO A;  2X8G A;  2YLX A;  1RYI A;  3GWF A;  1DJQ A;  2B76 A;  3LB8 A;  3Q6J A;  4YTN A;  2GEW A;  3DGZ A;  4M52 A;  4A79 A;  2WDQ A;  2YM2 A;  1CF3 A;  2WPE A;  3AEE A;  3LXD A;  4C77 A;  2BS3 A;  3CIR A;  3VQR A;  1N4W A;  3AEF A;  3SZF A;  2E1M A;  1MXT A;  3AED A;  2VQ7 A;  4U8N A;  3ABV A;  4IVM B;  2V5Z A;  4U2L A;  4DGK A;  2O9Z A;  1Q9I A;  1NG3 A;  1H6V A;  2X99 A;  3KKJ A;  2GB0 A;  3ZNN A;  3PS9 A;  1BWC A;  1TRB A;  4OPL A;  3RHA A;  3H4K A;  2YVF A;  1NAA A;  5U25 A;  1ZY8 A;  5FS9 A;  1C0L A;  2GQF A;  1NHR A;  2JKC A;  2E48 A;  3C4N A;  3WGT A;  4J2W A;  1TDN A;  3VRD B;  1C0P A;  2WU5 A;  1IUV A;  1KDG A;  3GDP A;  5KVH A;  1PBE A;  2X3N A;  3LOV A;  1DOC A;  4OPT A;  2WQY A;  4Y4N A;  1KIF A;  2OA1 A;  3NK0 X;  3SXI A;  3AE5 A;  1QO8 A;  4A99 A;  1OJC A;  1DXL A;  1FEC A;  3ZDN A;  4B1B A;  1TDE A;  3NKS A;  4Z2U A;  2YQU A;  2Q0K A;  2YG6 A;  3UCL A;  4Z2R A;  3CND A;  4B63 A;  3C4A A;  2EQ6 A;  1GER A;  4CCR A;  3DJD A;  4CY6 A;  3ZNQ A;  3QFA A;  4YJF B;  1CC6 A;  1XDI A;  2BC1 A;  2XYO A;  1ZK7 A;  3NTD A;  2BCP A;  3K30 A;  5EB5 A;  3NYE A;  4ZCD A;  1XHC A;  3AEG A;  1GRG A;  3D1C A;  2FJE A;  1L9E A;  4II3 A;  1AN9 A;  3IHM A;  4BUR A;  4B65 A;  2Q7V A;  2YR6 A;  4FK1 C;  4H4Y A;  3G5R A;  3CGB A;  3DH9 A;  4K22 A;  1ZMC A;  3G5S A;  2UZZ A;  4CBQ A;  4EMW A;  4IV9 A;  3F8P A;  4JNQ A;  1VG9 A;  1V59 A;  3KLJ A;  4DSG A;  3V3N A;  1BGN A;  2FJD A;  3KPF A;  3NH3 X;  1LQU A;  4ECH A;  3NLC A;  2XLU A;  3EAO A;  3CGC A;  3GD4 A;  3NNE A;  1KSU A;  4FDC B;  3W4I A;  2XFO A;  2JBV A;  4TM0 A;  1CC4 A;  5CKU A;  1GT8 A;  1NHS A;  1GND A;  4G6G A;  4CNJ A;  1H84 A;  1UKV G;  1NHQ A;  1Y56 B;  4I59 A;  1K0L A;  3P4Q A;  2R0G A;  3GYI A;  1ZX9 A;  2BAC A;  4H4U A;  3AEB A;  1B8S A;  5KMQ A;  4YSY A;  1IUT A;  2ZZB A;  5J60 A;  2C66 A;  1W4X A;  3DK9 A;  2RGH A;  3T31 A;  4CY8 A;  2H89 A;  3NIX A;  5EOW A;  1NPX A;  4H2R A;  2XLR A;  3P9U A;  4NZH A;  3M12 A;  2R4J A;  2WDR A;  3QJ4 A;  1B37 A;  1GRA A;  2VVM A;  4LA1 A;  5CQF A;  4NEV A;  4B64 A;  3NHO X;  2Z5Y A;  2C67 A;  3R9U A;  2ACZ A;  1JRY A;  2VRL A;  2CUL A;  1GEU A;  2GMJ A;  2OAL A;  4NTE A;  5LV9 A;  3C96 A;  3NT6 A;  4J33 A;  4K2X A;  4JDR A;  2XVH A;  1E1M A;  3G5Q A;  3KA7 A;  3EPT A;  4YKG A;  3T2K A;  5KMS A;  3SFE A;  1H86 A;  3UKK A;  4K5S A;  3ALL A;  1EL7 A;  4B66 A;  1D5T A;  3W4J A;  2DU8 A;  1RP0 A;  2ZZC A;  4H4Q A;  2FJA A;  4TM3 A;  2XFQ A;  1TDO A;  3FMW A;  5TR3 A;  3ZNP A;  1DNC A;  3UKF A;  4GDP A;  3RP6 A;  1ZDL A;  2I0Z A;  4USR A;  2E82 A;  3GMB A;  5FS7 A;  3FPZ A;  4GUV A;  3T37 A;  4P9S A;  1H7X A;  2Y6R A;  3O0H A;  3RP7 A;  2IID A;  1KFY A;  3K7M X;  2B9Y A;  5JCM A;  4K8D A;  4REK A;  4DSH A;  3QSS A;  3AE2 A;  4Z2T A;  3AB1 A;  1KNP A;  1ZOY A;  2GR2 A;  2PYX A;  1D7L A;  1PXA A;  3IF9 A;  1GRF A;  5BVA A;  4LII A;  1NEN A;  1BF3 A;  4EQW A;  1CJC A;  2WOI A;  5BRT A;  1CHU A;  4Y4M A;  1H81 A;  2CFY A;  2JK6 A;  3CPI G;  1EL9 A;  2E49 A;  3DME A;  1ZOV A;  2WES A;  4TLZ A;  4IVO B;  4EM3 A;  1HYU A;  3V3O A;  1PDH A;  3CNT A;  3ICS A;  3CGE A;  1JNR A;  2C3C A;  3DK4 A;  3AYL A;  1LTX R;  1E7P A;  2WOW A;  1DAO A;  1TYP A;  1GRH A;  3KD9 A;  2XFP A;  2GAH B;  4QFD A;  2C3D A;  3UKQ A;  2YLR A;  1E1L A;  1SEZ A;  3AEA A;  4U8K A;  4U8O A;  4YWO A;  1L0V A;  4YXD A;  5GRT A;  2C73 A;  3CNS A;  2XFN A;  4YSX A;  1D4E A;  2VVL A;  1X31 B;  2C76 A;  4NTC A;  4A65 A;  2WS3 A;  3QSE A;  2V6O A;  1S2Y A;  3G3E A;  3QVP A;  1E6E A;  4G9K A;  5ER0 A;  4B69 A;  4Z26 A;  1F3P A;  1QJD A;  3RP8 A;  4YT0 A;  2WU2 A;  3S5W A;  3HYV A;  3NYF A;  4CCQ A;  5JCI A;  5KOX A;  2X8C A;  3ICT A;  1OJ9 A;  5JCK A;  3CTY A;  4AT0 A;  4AOX A;  4YSH A;  3SZW A;  3FG2 P;  3NG7 X;  3PO7 A;  4X4J A;  2R46 A;  3UTH A;  1K4Q A;  1FEB A;  1OJA A;  2BS4 A;  1C0I A;  3BHF A;  2C70 A;  4U8J A;  5KMR A;  1LVL A;  3NN6 X;  3T2Z A;  4JQ9 A;  1IUX A;  1ZMD A;  3LJP A;  4FX9 A;  3M0O A;  5U1O A;  4B67 A;  2C7G A;  4EQX A;  1EVI A;  2BXR A;  2EQ9 A;  3AYJ A;  1VDC A;  2EQ8 A;  2WP9 A;  3SYI A;  1Y56 A;  2WEU A;  3ICR A;  1JNZ A;  2F5Z A;  2GVC A;  3UKP A;  2E4G A;  3ADA B;  1E39 A;  4Z24 A;  3HYX A;  2GRT A;  4A5L A;  3QVR A;  1GRB A;  4J34 A;  5KRQ A;  4H4V A;  3LZX A;  2V61 A;  2IVD A;  1COY A;  1GET A;  1Y0P A;  4BK1 A;  1PHH A;  3AE3 A;  3BI2 A;  3GD3 A;  4BJY A;  3CMM A;  4AOS A;  4GCM A;  4B68 A;  2VQB A;  2JB1 A;  3AEC A;  3CUK A;  2OLN A;  1YY5 A;  2BA9 A;  3NN0 X;  2VRM A;  2VZ2 A;  3IC9 A;  2YVJ A;  5M0Z A;  1LQT A;  3L1R A;  3AWI A;  3QSM A;  2HQM A;  1IJH A;  3FIM B;  3SZC A;  4Z43 A;  2R9Z A;  1FOH A;  4EIQ A;  3P1W A;  4JN9 A;  1Z6L A;  2WP5 A;  3EF6 A;  1GRT A;  4C3X A;  1VG0 A;  2APG A;  1C0K A;  2A87 A;  1QLB A;  2H88 A;  2X8H A;  2XLP A;  2YAU A;  3ZYX A;  4CRT A;  1IUU A;  2AQJ A;  3UTE A;  4U8I A;  4H7U A;  3GRT A;  3CPH G;  4OPU A;  4C5O A;  3K7Q X;  5HY5 A;  2YG3 A;  4O5Q A;  2J3N A;  1TYT A;  2Z5X A;  3NRN A;  1M64 A;  2YLZ A;  2RGO A;  2QAE A;  3GDN A;  3UOV A;  4AP3 A;  4BK2 A;  4AT2 A;  3I6D A;  4PAB A;  3DJJ A;  2Y6Q A;  1BKW A;  3VR9 A;  1KNR A;  2WHD A;  4WX1 A;  4APN A;  2XLT A;  5IQ4 A;  3BHK A;  2XVE A;  4J56 A;  4E0V A;  5KWF A;  4PAA A;  2B9X A;  3KVE A;  2NVK X;  2WDV A;  4H2Q A;  4H2P A;  4HB9 A;  4RG4 A;  1CJ3 A;  3COX A;  1GAL A;  1K0I A;  5IPY A;  4RSL A;  4ZCC A;  1NEK A;  1GOS A;  1KF6 A;  5HHF A;  4II2 A;  2YG4 A;  4OPD A;  1PN0 A;  2B7R A;  1OJT A;  1EL8 A;  3LAD A;  5HYM A;  4KPR A;  2VVL G;  5FMH A;  1NG4 A;  3GYJ A;  2XLS A;  4J57 A;  4U8L A;  2C4C A;  2E5V A;  1S3E A;  3IWA A;  1GRE A;  4G74 A;  4MJW A;  1REO A;  1MOK A;  3ALJ A;  3AE7 A;  2BCG G;  1E1K A;  4H4W A;  4NEW A;  3M13 A;  3GWD A;  3E1T A;  2GR3 A;  3P4S A;  2GMH A;  2GV8 A;  3CNP A;  4A6N A;  1PXC A;  4U2T A;  1O5W A;  3K7T A;  1L9D A;  2YR5 A;  4U8P A;  1YQZ A;  4RG3 A;  1YKJ A;  1PS9 A;  2C64 A;  2WPF A;  2YLT A;  2BS2 A;  2YM1 A;  4H50 A;  4ICY A;  1DOD A;  3SFD A;  1JRZ A;  4YJH A;  4NWZ A;  4UP3 A;  4EMJ A;  2YWL A;  3GSI A;  4DNA A;  2EQ7 A;  1FEA A;  2YG5 A;  5HXI A;  3HZL A;  2B7S A;  1KSS A;  1H83 A;  3LZW A;  2WPC A;  5IQ1 A;  2BRY A;  2CDU A;  1TDK A;  2A89 A;  4U8M A;  3GMC A;  4YJF A;  4U2S A;  5FS8 A;  1F8R A;  4BK3 A;  1O94 A;  3W4K A;  4EM4 A;  1D4D A;  4GRT A;  3UTG A;  2JAE A;  1PBB A;  3DA1 A;  3FBS A;  2E4A A;  1N4V A;  2PHH A;  3GYX A;  4C74 A;  4Z44 A;  5KMP A;  2CVJ A;  4WCT A;  4GR1 A;  4KX6 A;  3AYI A;  2WOV A;  2YLS A;  2BK5 A;  5KNL A;  3NK2 X;  5KXJ A;  4EQR A;  1N4U A;  2BRA A;  5M10 A;  1PXB A;  3BNU A;  3EAN A;  4HA6 A;  1CJ2 A;  4G73 A;  1DJN A;  4OVI A;  4X9M A;  5DBJ A;  1GTE A;  3F8D A;  4J31 A;  1P2H A;  1JEH A;  4YTP A;  3BI5 A;  5BUL A;  1B5Q A;  1FCD A;  4J36 A;  2DKI A;  4D04 A;  4UDP A;  3ISH A;  3AE6 A;  1IUW A;  2V3B A;  1M6I A;  3AE4 A;  3GRS A;  3Q9T A;  3VRA A;  3SM8 A;  1RSG A;  1E1N A;  3H8I A;  1P2E A;  5JCN A;  1GTH A;  1D4C A;  1ZP0 A;  2IVE A;  1JU2 A;  4H4P A;  2GAG B; 
#chains in the Genus database with same CATH homology
 1CC2 A;  3AE9 A;  4EQS A;  3SGL A;  2XCG A;  4EIP A;  1IUS A;  2TPR A;  4EMI A;  2YG7 A;  1F6M A;  4FK1 A;  3UKL A;  4A6N B;  1H82 A;  2JB3 A;  2VOU A;  3H8L A;  3NK1 X;  2W0H A;  1L9C A;  1BGJ A;  4NNJ A;  3UOY A;  3T14 A;  5FS6 A;  4H4R A;  2GR1 A;  2GQW A;  3DGH A;  5JCL A;  4YJD A;  5KOW A;  1DOB A;  2YVG A;  3NTA A;  3ATQ A;  4H2N A;  2RAB A;  1FL2 A;  4TM4 A;  1GSN A;  4BV6 A;  1N1P A;  2BAB A;  2FBW A;  1S3B A;  4I58 A;  2WP6 A;  3B3R A;  4A9W A;  3OZ2 A;  4JY2 A;  5GSN A;  3CPJ G;  5EB4 A;  3V76 A;  1PBF A;  3L8K A;  1NHP A;  3P4R A;  3CNJ A;  4OPG A;  2Q6U A;  2XDO A;  4TM1 A;  3SY4 A;  3DJG X;  4UDR A;  4ZN0 A;  1Q1W A;  4OPI A;  1F8W A;  2BC0 A;  2JB2 A;  2GR0 A;  4JY3 A;  3UP5 A;  1EBD A;  2QA2 A;  1ZKQ A;  3F8R A;  3PVC A;  3VR8 A;  3RED A;  4ADW A;  1YQ3 A;  2OAM A;  1CJ4 A;  1NDA A;  3HYW A;  3T2Y A;  2BXS A;  5BUK A;  3SX6 A;  3RNM A;  4JNA A;  3AD9 B;  3ALM A;  4IA6 A;  1JOA A;  4OCG A;  3UP4 A;  2ARD A;  4XWR A;  3UOX A;  2YR4 A;  3IHG A;  2XVI A;  3WE0 A;  1ONF A;  2C72 A;  1ELI A;  4YJG A;  1PBC A;  1XAN A;  3KPK A;  3AE8 A;  4H4X A;  2Q0L A;  4OPC A;  4YKF A;  3P4P A;  2AAQ A;  3AXB A;  2QA1 A;  4YTM A;  3UKA A;  1PJ6 A;  4LU6 A;  1EL5 A;  4IA5 A;  1OJD A;  3ATR A;  1GV4 A;  2TMD A;  4GAV A;  1LV0 A;  4X9N A;  2WBA A;  3T0K A;  3UOZ A;  4O5U A;  1AOG A;  2GF3 A;  1O95 A;  1DOE A;  3ITJ A;  3AD8 B;  3VRB A;  4BJZ A;  1VQW A;  4GDE A;  3NGC X;  2R0C A;  4QFC A;  2V3A A;  4UDQ A;  3SQP A;  2BK3 A;  3II4 A;  4H4S A;  2R45 A;  2XFU A;  3ZNO A;  4CNK A;  2GH5 A;  3CN8 A;  5C2T A;  2FJB A;  2R4E A;  1LPF A;  4D03 A;  1PBD A;  2B9W A;  1CBO A;  2BK4 A;  3B6D A;  2C75 A;  2ZBW A;  4Y4L A;  1GES A;  1S2Q A;  4XXG A;  1LJ1 A;  2V60 A;  1TDF A;  1Q1R A;  3UTF A;  1H7W A;  2XVF A;  3BNM A;  2A8X A;  1K0J A;  5U63 A;  4C3Y A;  4NTD A;  5C3J A;  5L46 A;  4GAP A;  2RGJ A;  2ZZ0 A;  4G6H A;  3QFB A;  1PJ5 A;  1PJ7 A;  5EBK A;  4K7Z A;  3BI4 A;  2BYB A;  3S61 A;  1D7Y A;  4YSZ A;  4N9X A;  2WET A;  4H4Z A;  4K5R A;  2OLO A;  3I3L A;  2AR8 A;  2C65 A;  4USQ A;  3NYC A;  5J7X A;  2X50 A;  4YJH B;  1XPQ A;  2DKH A;  3OC4 A;  1MO9 A;  3DJE A;  1BZL A;  1VE9 A;  3AE1 A;  4YJG B;  3JSK A;  4A7A A;  4AP1 A;  4Z25 A;  1JRX A;  2YLW A;  5KVI A;  3CGD A;  4H4T A;  2R0P A;  3D8X A;  2QCU A;  1VRQ B;  1GXF A;  3KU9 A;  3AD7 B;  1B4V A;  4GF7 A;  3SZ0 A;  4XWZ A;  3UKH A;  4TLX A;  2XVJ A;  3DK8 A;  3URH A;  1CL0 A;  1GPE A;  1F8S A;  1YQ4 A;  2NPX A;  1DDO A;  2X8G A;  2YLX A;  1RYI A;  3GWF A;  2B76 A;  1DJQ A;  3LB8 A;  3Q6J A;  4YTN A;  2GEW A;  3DGZ A;  4M52 A;  4A79 A;  2WDQ A;  2YM2 A;  1CF3 A;  2WPE A;  3AEE A;  3LXD A;  4C77 A;  2BS3 A;  3CIR A;  3VQR A;  1N4W A;  3AEF A;  3SZF A;  2E1M A;  1MXT A;  3AED A;  2VQ7 A;  4U8N A;  3ABV A;  4IVM B;  2V5Z A;  4U2L A;  4DGK A;  2O9Z A;  1Q9I A;  1NG3 A;  1H6V A;  2X99 A;  3KKJ A;  2GB0 A;  3ZNN A;  3PS9 A;  1BWC A;  1TRB A;  4OPL A;  3RHA A;  3H4K A;  2YVF A;  1NAA A;  5U25 A;  1ZY8 A;  5FS9 A;  1C0L A;  2GQF A;  1NHR A;  2JKC A;  2E48 A;  3C4N A;  3WGT A;  4J2W A;  1TDN A;  3VRD B;  1C0P A;  2WU5 A;  1IUV A;  1KDG A;  3GDP A;  5KVH A;  1PBE A;  2X3N A;  3LOV A;  1DOC A;  4OPT A;  2WQY A;  4Y4N A;  1KIF A;  2OA1 A;  3NK0 X;  3SXI A;  3AE5 A;  1QO8 A;  4A99 A;  1OJC A;  1DXL A;  1FEC A;  3ZDN A;  4B1B A;  1TDE A;  3NKS A;  4Z2U A;  2YQU A;  2Q0K A;  2YG6 A;  3UCL A;  4Z2R A;  3CND A;  4B63 A;  3C4A A;  2EQ6 A;  1GER A;  4CCR A;  3DJD A;  4CY6 A;  3ZNQ A;  3QFA A;  4YJF B;  1CC6 A;  1XDI A;  2BC1 A;  2XYO A;  1ZK7 A;  3NTD A;  2BCP A;  3K30 A;  5EB5 A;  3NYE A;  4ZCD A;  1XHC A;  3AEG A;  1GRG A;  3D1C A;  2FJE A;  1L9E A;  4II3 A;  1AN9 A;  3IHM A;  4BUR A;  4B65 A;  2Q7V A;  2YR6 A;  4FK1 C;  4H4Y A;  3G5R A;  3CGB A;  3DH9 A;  4K22 A;  1ZMC A;  3G5S A;  2UZZ A;  4CBQ A;  4EMW A;  4IV9 A;  3F8P A;  4JNQ A;  1VG9 A;  1V59 A;  3KLJ A;  4DSG A;  3V3N A;  1BGN A;  2FJD A;  3KPF A;  3NH3 X;  1LQU A;  4ECH A;  3NLC A;  2XLU A;  3EAO A;  3CGC A;  3GD4 A;  3NNE A;  1KSU A;  4FDC B;  3W4I A;  2XFO A;  2JBV A;  4TM0 A;  1CC4 A;  5CKU A;  1GT8 A;  1NHS A;  1GND A;  4G6G A;  4CNJ A;  1H84 A;  1UKV G;  1NHQ A;  1Y56 B;  4I59 A;  1K0L A;  3P4Q A;  2R0G A;  3GYI A;  1ZX9 A;  2BAC A;  4H4U A;  3AEB A;  1B8S A;  5KMQ A;  4YSY A;  1IUT A;  2ZZB A;  5J60 A;  2C66 A;  1W4X A;  3DK9 A;  2RGH A;  3T31 A;  4CY8 A;  2H89 A;  3NIX A;  5EOW A;  1NPX A;  4H2R A;  2XLR A;  3P9U A;  4NZH A;  3M12 A;  2R4J A;  2WDR A;  3QJ4 A;  1B37 A;  1GRA A;  2VVM A;  4LA1 A;  5CQF A;  4NEV A;  4B64 A;  3NHO X;  2Z5Y A;  2C67 A;  3R9U A;  2ACZ A;  1JRY A;  2VRL A;  2CUL A;  1GEU A;  2GMJ A;  2OAL A;  4NTE A;  5LV9 A;  3C96 A;  3NT6 A;  4J33 A;  4K2X A;  4JDR A;  2XVH A;  1E1M A;  3G5Q A;  3KA7 A;  3EPT A;  4YKG A;  3T2K A;  5KMS A;  3SFE A;  1H86 A;  3UKK A;  4K5S A;  1EL7 A;  3ALL A;  4B66 A;  1D5T A;  3W4J A;  2DU8 A;  1RP0 A;  2ZZC A;  4H4Q A;  2FJA A;  4TM3 A;  2XFQ A;  1TDO A;  3FMW A;  5TR3 A;  3ZNP A;  1DNC A;  3UKF A;  4GDP A;  3RP6 A;  1ZDL A;  2I0Z A;  4USR A;  2E82 A;  3GMB A;  5FS7 A;  3FPZ A;  4GUV A;  3T37 A;  4P9S A;  1H7X A;  2Y6R A;  3O0H A;  2IID A;  3RP7 A;  1KFY A;  3K7M X;  2B9Y A;  5JCM A;  4K8D A;  4REK A;  4DSH A;  3QSS A;  3AE2 A;  4Z2T A;  3AB1 A;  1KNP A;  1ZOY A;  2GR2 A;  2PYX A;  1D7L A;  1PXA A;  3IF9 A;  1GRF A;  5BVA A;  4LII A;  1NEN A;  1BF3 A;  4EQW A;  1CJC A;  2WOI A;  5BRT A;  1CHU A;  4Y4M A;  1H81 A;  2CFY A;  2JK6 A;  3CPI G;  1EL9 A;  2E49 A;  3DME A;  1ZOV A;  2WES A;  4TLZ A;  4IVO B;  4EM3 A;  1HYU A;  3V3O A;  1PDH A;  3CNT A;  3ICS A;  3CGE A;  1JNR A;  2C3C A;  3DK4 A;  3AYL A;  1LTX R;  1E7P A;  2WOW A;  1DAO A;  1TYP A;  1GRH A;  3KD9 A;  2XFP A;  2GAH B;  4QFD A;  2C3D A;  3UKQ A;  2YLR A;  1E1L A;  1SEZ A;  3AEA A;  4U8K A;  4U8O A;  4YWO A;  1L0V A;  4YXD A;  5GRT A;  2C73 A;  3CNS A;  2XFN A;  4YSX A;  1D4E A;  2VVL A;  1X31 B;  2C76 A;  4NTC A;  4A65 A;  2WS3 A;  3QSE A;  2V6O A;  1S2Y A;  3G3E A;  3QVP A;  1E6E A;  4G9K A;  5ER0 A;  4B69 A;  4Z26 A;  1F3P A;  1QJD A;  3RP8 A;  4YT0 A;  2WU2 A;  3S5W A;  3HYV A;  3NYF A;  4CCQ A;  5JCI A;  5KOX A;  2X8C A;  3ICT A;  1OJ9 A;  5JCK A;  3CTY A;  4AT0 A;  4AOX A;  4YSH A;  3SZW A;  3FG2 P;  3NG7 X;  3PO7 A;  4X4J A;  2R46 A;  3UTH A;  1K4Q A;  1FEB A;  1OJA A;  2BS4 A;  1C0I A;  3BHF A;  2C70 A;  4U8J A;  5KMR A;  1LVL A;  3NN6 X;  3T2Z A;  4JQ9 A;  1IUX A;  1ZMD A;  3LJP A;  4FX9 A;  3M0O A;  5U1O A;  4B67 A;  2C7G A;  4EQX A;  1EVI A;  2BXR A;  2EQ9 A;  3AYJ A;  1VDC A;  2EQ8 A;  2WP9 A;  3SYI A;  1Y56 A;  2WEU A;  3ICR A;  1JNZ A;  2F5Z A;  2GVC A;  3UKP A;  2E4G A;  3ADA B;  1E39 A;  4Z24 A;  3HYX A;  2GRT A;  4A5L A;  3QVR A;  1GRB A;  4J34 A;  5KRQ A;  4H4V A;  3LZX A;  2V61 A;  2IVD A;  1COY A;  1GET A;  1Y0P A;  4BK1 A;  1PHH A;  3AE3 A;  3BI2 A;  3GD3 A;  4BJY A;  3CMM A;  4AOS A;  4GCM A;  4B68 A;  2VQB A;  2JB1 A;  3AEC A;  3CUK A;  2OLN A;  1YY5 A;  2BA9 A;  3NN0 X;  2VRM A;  2VZ2 A;  3IC9 A;  2YVJ A;  5M0Z A;  1LQT A;  3L1R A;  3AWI A;  3QSM A;  2HQM A;  1IJH A;  3FIM B;  3SZC A;  4Z43 A;  2R9Z A;  1FOH A;  3P1W A;  4EIQ A;  4JN9 A;  1Z6L A;  2WP5 A;  3EF6 A;  1GRT A;  4C3X A;  1VG0 A;  2APG A;  1C0K A;  2A87 A;  1QLB A;  2H88 A;  2X8H A;  2XLP A;  2YAU A;  3ZYX A;  4CRT A;  1IUU A;  2AQJ A;  3UTE A;  4U8I A;  4H7U A;  3GRT A;  3CPH G;  4OPU A;  4C5O A;  3K7Q X;  5HY5 A;  2YG3 A;  4O5Q A;  2J3N A;  1TYT A;  2Z5X A;  3NRN A;  1M64 A;  2YLZ A;  2RGO A;  2QAE A;  3GDN A;  3UOV A;  4AP3 A;  4BK2 A;  4AT2 A;  3I6D A;  4PAB A;  3DJJ A;  2Y6Q A;  1BKW A;  3VR9 A;  1KNR A;  2WHD A;  4WX1 A;  4APN A;  2XLT A;  5IQ4 A;  3BHK A;  2XVE A;  4J56 A;  4E0V A;  5KWF A;  4PAA A;  2B9X A;  3KVE A;  2NVK X;  2WDV A;  4H2Q A;  4H2P A;  4HB9 A;  4RG4 A;  1CJ3 A;  3COX A;  1GAL A;  1K0I A;  5IPY A;  4RSL A;  4ZCC A;  1NEK A;  1GOS A;  1KF6 A;  5HHF A;  4II2 A;  2YG4 A;  4OPD A;  1PN0 A;  2B7R A;  1OJT A;  1EL8 A;  3LAD A;  4KPR A;  5HYM A;  2VVL G;  5FMH A;  1NG4 A;  3GYJ A;  2XLS A;  4J57 A;  4U8L A;  2C4C A;  2E5V A;  1S3E A;  3IWA A;  1GRE A;  4G74 A;  4MJW A;  1REO A;  1MOK A;  3AE7 A;  3ALJ A;  2BCG G;  1E1K A;  4H4W A;  4NEW A;  3M13 A;  3GWD A;  3E1T A;  2GR3 A;  3P4S A;  2GMH A;  2GV8 A;  3CNP A;  4A6N A;  1PXC A;  4U2T A;  1O5W A;  3K7T A;  1L9D A;  2YR5 A;  4U8P A;  1YQZ A;  4RG3 A;  1YKJ A;  1PS9 A;  2C64 A;  2WPF A;  2YLT A;  2BS2 A;  2YM1 A;  4H50 A;  4ICY A;  1DOD A;  3SFD A;  1JRZ A;  4YJH A;  4NWZ A;  4UP3 A;  4EMJ A;  2YWL A;  3GSI A;  4DNA A;  2EQ7 A;  1FEA A;  2YG5 A;  5HXI A;  3HZL A;  2B7S A;  1KSS A;  1H83 A;  3LZW A;  2WPC A;  5IQ1 A;  2BRY A;  2CDU A;  1TDK A;  2A89 A;  4U8M A;  3GMC A;  4YJF A;  4U2S A;  5FS8 A;  1F8R A;  4BK3 A;  1O94 A;  3W4K A;  4EM4 A;  1D4D A;  4GRT A;  3UTG A;  2JAE A;  1PBB A;  3DA1 A;  3FBS A;  2E4A A;  1N4V A;  2PHH A;  3GYX A;  4C74 A;  4Z44 A;  5KMP A;  2CVJ A;  4WCT A;  4GR1 A;  4KX6 A;  3AYI A;  2WOV A;  2YLS A;  2BK5 A;  5KNL A;  3NK2 X;  5KXJ A;  4EQR A;  1N4U A;  2BRA A;  5M10 A;  1PXB A;  3BNU A;  3EAN A;  4HA6 A;  1CJ2 A;  4G73 A;  1DJN A;  4OVI A;  4X9M A;  5DBJ A;  1GTE A;  3F8D A;  4J31 A;  1P2H A;  1JEH A;  4YTP A;  3BI5 A;  5BUL A;  1B5Q A;  1FCD A;  4J36 A;  2DKI A;  4D04 A;  4UDP A;  3ISH A;  3AE6 A;  1IUW A;  2V3B A;  1M6I A;  3AE4 A;  3GRS A;  3Q9T A;  3VRA A;  3SM8 A;  1RSG A;  1E1N A;  3H8I A;  1P2E A;  5JCN A;  1GTH A;  1D4C A;  1ZP0 A;  2IVE A;  1JU2 A;  4H4P A;  2GAG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...