3SM8A

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with an (n5) flavin adduct
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-dependent catabolic D-arginine dehydrogenase, DauA
publication title Atomic-resolution structure of an N5 flavin adduct in D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 118
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2011-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3sm8A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3sm8A01
2OAMA 5C2TA 1TYPA 3H4KA 4A9WA 2ARDA 2C76A 1B5QA 3CGBA 3KU9A 5BRTA 3S61A 3VQRA 3K30A 2DKHA 4O5QA 3ZDNA 4TLXA 1JRXA 4Y4MA 5FS9A 1PXBA 1CBOA 3OC4A 3UKHA 1TDFA 3C4AA 4IV9A 4CNKA 4YKGA 3AXBA 3LZXA 4GRTA 2XFPA 4XWRA 4DGKA 4U8NA 4H4WA 3GSIA 4J31A 1K0JA 4AP3A 3QSSA 4UDPA 3G5RA 2RGOA 4A6NA 4ADWA 1NHQA 4U8PA 1O94A 3Q9TA 3UKQA 5EB4A 1P2EA 1FEBA 2VQBA 4H2PA 2GRTA 4A6NB 1S2YA 3QFBA 4B1BA 2WPFA 1C0LA 4U8LA 1TDEA 3ATRA 2RABA 3V3OA 4K22A 4YSYA 3PO7A 3NN0X 4M52A 3EAOA 1F6MA 3CPIG 4PAAA 4C5OA 5KVHA 1ZY8A 1E1NA 4QFDA 1PBBA 5LV9A 1IJHA 2VRLA 4H4XA 3QVRA 2XFQA 2YG6A 1BWCA 1NHRA 3NYFA 4OPGA 4CNJA 3NN6X 3VRAA 1GXFA 2E5VA 4KPRA 4YTMA 2C3CA 1BKWA 4GCMA 1L9CA 2YG5A 1DJNA 4BJZA 1H81A 1QO8A 3G3EA 3RP7A 1OJAA 4Z2TA 2GB0A 1GRBA 1IUXA 3AEAA 3AE9A 3DK9A 2BYBA 3OZ2A 3NIXA 3QJ4A 4OVIA 1PBCA 4XWZA 1QLBA 1VDCA 3SFDA 4EM4A 4YSHA 4D03A 1DOBA 2IVDA 1D4EA 1W4XA 1ZX9A 2WBAA 3KKJA 5KRQA 2FBWA 1Q1RA 3GMBA 3RHAA 4I59A 3ATQA 4EIQA 4RG4A 4U8KA 4B65A 4O5UA 1EL8A 5U1OA 3S5WA 1ZOYA 2R4JA 3UTGA 5JCLA 2V3AA 4K5RA 5J7XA 2X99A 1Q9IA 1JOAA 1B8SA 5M0ZA 4X9NA 4YSXA 1L9EA 1GNDA 1XHCA 4YJFA 1EVIA 2GVCA 3CGCA 3ICTA 4JDRA 3ICSA 3KPFA 2WDQA 2XVEA 2NPXA 2UZZA 4IA5A 4YJFB 2E1MA 3BI5A 5FS6A 2B76A 1XDIA 1PN0A 3W4KA 4HB9A 3BNMA 2GQFA 2XVIA 3CNTA 1E39A 3KVEA 1EBDA 4A65A 3LOVA 2YR4A 2XLPA 2YVGA 3CGDA 1KSUA 1NDAA 4Z44A 2YLXA 4Z25A 3UTEA 5BULA 4Y4LA 3K7MX 4YKFA 1JNRA 4B68A 3RP8A 1D5TA 2DU8A 3B6DA 3IWAA 2GAGB 1UKVG 2Y6RA 2VOUA 4NEWA 2Q0LA 2R4EA 3DJEA 4EIPA 4CY6A 2E82A 4H4VA 2Q7VA 1F3PA 2C64A 4TM0A 2JB3A 3GDNA 2WESA 1PJ6A 5KXJA 1E6EA 1IUWA 4UDQA 3VRDB 3BI4A 1GETA 4EQSA 4TM3A 1PHHA 3GWDA 1NHSA 3NKSA 1EL9A 4NZHA 1ZMCA 2BC0A 4FDCB 1NPXA 2F5ZA 3AE6A 3ALLA 3QSEA 4LIIA 4EQXA 1NG4A 1VG0A 1ZDLA 3ZNPA 1IUVA 3O0HA 1PXAA 1YQZA 1FOHA 4BK2A 3AB1A 4U2SA 4LA1A 2ZZBA 3NTDA 1IUSA 3FG2P 1COYA 2PHHA 1N4WA 1DDOA 3UCLA 1CC4A 2AR8A 3AEBA 1CC6A 4J33A 3UP4A 2WPCA 1C0PA 3ICRA 1DOCA 3ZNQA 2APGA 2BK4A 2B9XA 3WE0A 1RYIA 4FK1A 3UP5A 2WDRA 2XFOA 4GR1A 1ELIA 3I6DA 1PBFA 4WCTA 2E4AA 2Z5XA 3VR8A 1VQWA 4CCRA 2XDOA 1ZMDA 3VRBA 4APNA 4ZCCA 1KNRA 1E1MA 4U8OA 4ZCDA 1CL0A 2WS3A 4H7UA 2GMHA 3ZNNA 1FEAA 3ZNOA 1N4VA 1LTXR 2FJDA 2GV8A 2VRMA 3F8DA 3L8KA 4OPLA 5FS7A 3QSMA 1XANA 4H2NA 3RNMA 1MO9A 1BGNA 1E1LA 3ALJA 3DJGX 1GREA 4IVMB 4RG3A 3AWIA 2GR0A 3NH3X 4H2RA 2OA1A 3AEGA 3CNDA 1XPQA 3KLJA 4JY2A 5FMHA 3LADA 3AD8B 2BXSA 2XVFA 2Y6QA 3BI2A 4U2LA 5TR3A 1PXCA 5HHFA 5BUKA 5M10A 1CJ4A 2VZ2A 3DK4A 3NT6A 2ZZ0A 4FK1C 4H4QA 4IVOB 4NEVA 2A87A 5GRTA 4JN9A 1E1KA 4XXGA 1N4UA 5EOWA 1NG3A 1M64A 3GD4A 2R0CA 3T37A 4WX1A 5EBKA 4YWOA 2R46A 2QA2A 1EL5A 2WEUA 1CJ2A 3II4A 2C65A 2AAQA 3AYLA 4RSLA 4C3YA 4B69A 1TYTA 4OPIA 3ALMA 2Q0KA 4Z2UA 2B7SA 2BXRA 1RP0A 2WP9A 5HYMA 4K2XA 2BABA 2DKIA 3W4IA 3CPJG 2R0GA 5DBJA 2GEWA 2WOVA 3M0OA 1D7YA 4BK1A 1HYUA 2YLRA 3C4NA 2WDVA 2BK3A 3F8RA 2ACZA 3WGTA 3GMCA 4Z43A 3ITJA 1KDGA 1Y0PA 3AYJA 3FIMB 2X3NA 2C72A 3B3RA 3FBSA 2XVJA 4JY3A 4USRA 1K0LA 3GYJA 4UDRA 1Y56A 1BZLA 1TDNA 2YR5A 4C3XA 5L46A 2VQ7A 3RP6A 1D4DA 4U8IA 3VR9A 1LVLA 4ECHA 2YG7A 1S3BA 1Y56B 2GR3A 4J57A 2EQ9A 3P4SA 3SFEA 4B66A 2C73A 3CNJA 4N9XA 4EMWA 2JK6A 2B9YA 1GTEA 3UKPA 1NHPA 3AE5A 3EF6A 4Z26A 4AP1A 2WQYA 2IVEA 2YG4A 1KF6A 3CNPA 2YVFA 2H89A 3R9UA 1S3EA 1GRHA 1KIFA 1MOKA 3D1CA 3GD3A 4CBQA 2RGHA 1L9DA 1F8RA 3NGCX 3AD7B 2YLZA 2YWLA 4H4PA 2XFUA 4MJWA 1CHUA 4JQ9A 4OPDA 1AOGA 4H2QA 3CN8A 5IQ1A 3ABVA 1X31B 2R45A 3UKKA 1DODA 4H4ZA 1B4VA 1S2QA 2C3DA 4CRTA 1PBDA 4Z24A 1BF3A 1YQ4A 4P9SA 1M6IA 4FX9A 3BNUA 3E1TA 4QFCA 2XCGA 4U8MA 4DNAA 3NLCA 2GAHB 2C67A 3P4PA 5KVIA 4J2WA 2XLSA 3COXA 3GDPA 2WP6A 3AE7A 3UOZA 2X8HA 1DOEA 4J36A 5CQFA 5IQ4A 3P1WA 5JCMA 2WETA 4GDPA 4BV6A 2J3NA 3LZWA 4BK3A 1DAOA 3ZYXA 2C7GA 3QVPA 1L0VA 4EMJA 3W4JA 2Z5YA 1CJCA 1O5WA 2YG3A 3EPTA 1LJ1A 2EQ6A 3UOYA 3UOVA 3AYIA 4BURA 2JKCA 4OPCA 2EQ7A 2YR6A 5HXIA 3M13A 3DH9A 4K7ZA 4A7AA 1GOSA 4H50A 1D7LA 4YJHA 1E7PA 2V5ZA 3NK2X 3DJJA 3LJPA 1NEKA 2YLTA 4B64A 2VVLG 4YJDA 1DJQA 1H7XA 4YJHB 3AD9B 2BCPA 2YAUA 4K8DA 4GDEA 1PBEA 4TM4A 3C96A 2GR1A 3CIRA 3AE3A 4C77A 2RGJA 3NNEA 4U8JA 2XLTA 5BVAA 1F8WA 2FJEA 3H8IA 3BHKA 1V59A 3CTYA 1LQUA 1IUTA 1OJ9A 4C74A 2CFYA 2GF3A 2ZBWA 4EQRA 5KOWA 2GH5A 3NHOX 3AEDA 2CDUA 3IHGA 2EQ8A 3Q6JA 3URHA 2W0HA 1KSSA 1CC2A 1IUUA 1Q1WA 3M12A 1DXLA 1ONFA 3AE2A 3V3NA 2X8GA 1YKJA 1H83A 3ISHA 3F8PA 4AOSA 1C0IA 3D8XA 4B67A 1GT8A 4CY8A 3LB8A 4ICYA 2BCGG 2JB2A 1TDOA 1TDKA 4GUVA 4AT2A 4IA6A 2FJAA 1DNCA 2YM1A 1OJTA 2QAEA 1LV0A 3DA1A 2YLWA 1PJ5A 2R0PA 4Y4NA 2WHDA 2JBVA 4EQWA 2BACA 5FS8A 4A79A 4H4SA 2Q6UA 1TRBA 1JRYA 1JRZA 2I0ZA 3SQPA 1ZK7A 4I58A 4X4JA 1D4CA 2BS3A 3GWFA 1RSGA 1SEZA 1CF3A 4NTDA 4B63A 2B7RA 1GRAA 1NAAA 1YY5A 1Z6LA 2V60A 4H4UA 3CPHG 2BC1A 2ZZCA 4UP3A 3BHFA 1F8SA 4YXDA 1FL2A 3DMEA 1KNPA 2VVMA 1VG9A 4U2TA 1FECA 2V6OA 5ER0A 2WOIA 4JNQA 1REOA 4REKA 2CVJA 2BS4A 4YTPA 3SM8A 1GALA 1GSNA 1H82A 2TPRA 3NRNA 3G5SA 3CGEA 2OLNA 3V76A 5JCIA 3H8LA 2R9ZA 1GEUA 2JB1A 3NYCA 1ZOVA 3DJDA 2C66A 5C3JA 1GPEA 2YLSA 1P2HA 3NK0X 3IF9A 3P4RA 4OPUA 1ZP0A 5KWFA 2YVJA 3AE8A 3AE1A 3L1RA 2C75A 1VRQB 4AT0A 1EL7A 1K4QA 2AQJA 4HA6A 5J60A 4PABA 1PJ7A 3I3LA 2XLRA 1LPFA 3IHMA 3AE4A 5JCKA 2B9WA 1H6VA 3IC9A 1N1PA 3NK1X 3DGHA 3GRSA 3GRTA 1CJ3A 3PS9A 1YQ3A 2V61A 1MXTA 2NVKX 4CCQA 5GSNA 2XFNA 1BGJA 2YQUA 4YTNA 1ZKQA 5EB5A 3UTFA 1OJDA 2TMDA 3KD9A 1JNZA 4DSGA 1OJCA 4AOXA 2HQMA 2E48A 1GESA 1H84A 2V3BA 3G5QA 4OCGA 2WU2A 1VE9A 2X8CA 3AECA 3AEEA 2BA9A 4H4YA 3HZLA 1GRTA 2WOWA 2WP5A 2XLUA 3LXDA 4JNAA 3NYEA 4GF7A 4H4RA 5HY5A 1O95A 4EMIA 3UOXA 4D04A 3KA7A 4YJGA 4K5SA 5U63A 4Z2RA 3CUKA 2E4GA 1H7WA 1AN9A 5U25A 1NENA 2FJBA 2GR2A 2WU5A 3AEFA 4USQA 3DGZA 2C70A 4YJGB 3P9UA 4NTEA 2X50A 2A8XA 3P4QA 4H4TA 4OPTA 4ZN0A 2A89A 2OLOA 2E49A 2XYOA 3K7QX 2BK5A 3NG7X 1GRGA 1LQTA 3UKLA 3QFAA 1FCDA 5CKUA 4E0VA 4YT0A 4A99A 4DSHA 1JU2A 2PYXA 4YSZA 1PS9A 3REDA 4TM1A 1C0KA 1GTHA 4J34A 3JSKA 2OALA 3DK8A 3UKAA 2O9ZA 1GERA 3K7TA 4NTCA 4A5LA 4J56A 4BJYA 2GQWA 1PDHA 2XVHA 3NTAA 1QJDA 4KX6A 4EM3A 5IPYA 2GMJA 3UTHA 3CNSA 4LU6A 5JCNA 2YM2A 2CULA 3FMWA 3FPZA 2BS2A 1KFYA 2VVLA 4TLZA 1H86A 3UKFA 1B37A 3EANA 5KOXA 4X9MA 2JAEA 2QA1A 3PVCA 3GYIA 3SGLA 3ADAB 2H88A 2WPEA 1GRFA 1JEHA 1GV4A 2IIDA 2QCUA 1K0IA
chains in the Genus database with same CATH superfamily
2OAMA 5C2TA 1TYPA 3H4KA 4A9WA 2ARDA 2C76A 1B5QA 3CGBA 3KU9A 5BRTA 3S61A 3VQRA 3K30A 2DKHA 4O5QA 3ZDNA 4TLXA 1JRXA 4Y4MA 5FS9A 1PXBA 1CBOA 3OC4A 3UKHA 1TDFA 3C4AA 4IV9A 4CNKA 4YKGA 3AXBA 3LZXA 4GRTA 2XFPA 4XWRA 4DGKA 4U8NA 4H4WA 3GSIA 4J31A 1K0JA 4AP3A 3QSSA 4UDPA 3G5RA 2RGOA 4A6NA 4ADWA 1NHQA 4U8PA 1O94A 3Q9TA 3UKQA 5EB4A 1P2EA 1FEBA 4H2PA 2VQBA 2GRTA 4A6NB 1S2YA 3QFBA 4B1BA 2WPFA 1C0LA 4U8LA 1TDEA 3ATRA 5KMRA 2RABA 3V3OA 4K22A 4YSYA 3PO7A 3NN0X 4M52A 3EAOA 1F6MA 3CPIG 4PAAA 4C5OA 5KVHA 1ZY8A 1E1NA 4QFDA 1PBBA 5LV9A 1IJHA 2VRLA 4H4XA 3QVRA 2XFQA 2YG6A 1BWCA 1NHRA 3NYFA 4OPGA 4CNJA 3NN6X 3VRAA 1GXFA 2E5VA 4KPRA 4YTMA 2C3CA 1BKWA 4GCMA 1L9CA 2YG5A 1DJNA 4BJZA 1H81A 3GYXA 1QO8A 3G3EA 3RP7A 1OJAA 4Z2TA 2GB0A 1GRBA 1IUXA 3AEAA 3AE9A 3DK9A 2BYBA 3OZ2A 3NIXA 3QJ4A 4OVIA 1PBCA 4XWZA 1QLBA 1VDCA 3SFDA 4EM4A 4YSHA 4D03A 1DOBA 2IVDA 1D4EA 1W4XA 1ZX9A 2WBAA 3KKJA 5KRQA 2FBWA 1Q1RA 3GMBA 3RHAA 4I59A 3ATQA 4EIQA 4RG4A 4U8KA 4B65A 4O5UA 1EL8A 5U1OA 3S5WA 1ZOYA 2R4JA 3UTGA 5JCLA 2V3AA 4K5RA 5J7XA 2X99A 1Q9IA 1JOAA 1B8SA 5M0ZA 4X9NA 4YSXA 1L9EA 1GNDA 1XHCA 4YJFA 1EVIA 2GVCA 3CGCA 3ICTA 4JDRA 4II3A 3ICSA 3KPFA 2WDQA 2XVEA 2NPXA 2UZZA 4IA5A 4YJFB 2E1MA 3BI5A 5FS6A 2B76A 2BRAA 1XDIA 1PN0A 3W4KA 4G73A 4HB9A 3BNMA 2GQFA 2XVIA 3CNTA 1E39A 3KVEA 1EBDA 4A65A 3LOVA 2YR4A 2XLPA 2YVGA 3CGDA 1KSUA 1NDAA 4Z44A 2YLXA 4Z25A 3UTEA 5BULA 4Y4LA 3K7MX 4YKFA 1JNRA 4B68A 3RP8A 1D5TA 2DU8A 3B6DA 3IWAA 2GAGB 1UKVG 2Y6RA 2VOUA 4NEWA 2Q0LA 2R4EA 3DJEA 4EIPA 4CY6A 2E82A 4H4VA 2Q7VA 1F3PA 2C64A 4TM0A 2JB3A 3GDNA 2WESA 1PJ6A 5KNLA 5KXJA 1E6EA 1IUWA 4UDQA 3VRDB 3BI4A 1GETA 4EQSA 4TM3A 1PHHA 3GWDA 1NHSA 3NKSA 1EL9A 4NZHA 1ZMCA 3SZWA 2BC0A 4FDCB 3ALLA 1NPXA 2F5ZA 3AE6A 3QSEA 4G74A 4LIIA 4EQXA 1NG4A 1VG0A 1ZDLA 3ZNPA 1IUVA 3O0HA 1PXAA 3SZFA 1YQZA 1FOHA 4BK2A 3AB1A 4U2SA 4LA1A 2ZZBA 3NTDA 1IUSA 3FG2P 1COYA 2PHHA 1N4WA 1DDOA 3UCLA 1CC4A 2AR8A 3AEBA 1CC6A 4J33A 3UP4A 2WPCA 1C0PA 3ICRA 1DOCA 3ZNQA 2APGA 2BK4A 2B9XA 3WE0A 1RYIA 4FK1A 3UP5A 2WDRA 2XFOA 4GR1A 1ELIA 3I6DA 1PBFA 4WCTA 2E4AA 2Z5XA 3VR8A 1VQWA 4CCRA 2XDOA 1ZMDA 3VRBA 4APNA 4ZCCA 1KNRA 1E1MA 4U8OA 4ZCDA 3T0KA 1CL0A 2WS3A 4H7UA 2GMHA 3ZNNA 1FEAA 3ZNOA 1N4VA 1LTXR 2FJDA 2GV8A 2VRMA 3F8DA 3L8KA 4OPLA 5FS7A 5KMQA 3QSMA 4H2NA 1XANA 3RNMA 1MO9A 3ALJA 1BGNA 1E1LA 3DJGX 1GREA 4IVMB 4RG3A 3AWIA 2GR0A 3NH3X 4H2RA 2OA1A 3AEGA 3CNDA 1XPQA 3KLJA 4JY2A 5FMHA 3LADA 3AD8B 2BXSA 2XVFA 2Y6QA 3BI2A 4U2LA 5TR3A 1PXCA 5HHFA 5BUKA 5M10A 1CJ4A 2VZ2A 3DK4A 3NT6A 2ZZ0A 4FK1C 4H4QA 4IVOB 4NEVA 2A87A 5GRTA 4JN9A 1E1KA 4XXGA 1N4UA 5EOWA 1NG3A 3T14A 1M64A 3GD4A 2R0CA 3T37A 4WX1A 5EBKA 4YWOA 2R46A 2QA2A 1EL5A 2WEUA 3HYWA 1CJ2A 3II4A 2C65A 2AAQA 3AYLA 4RSLA 4C3YA 4B69A 1TYTA 4OPIA 3ALMA 2Q0KA 4Z2UA 2B7SA 2BXRA 1RP0A 2WP9A 5HYMA 4K2XA 2BABA 2DKIA 3W4IA 3CPJG 2R0GA 5DBJA 2GEWA 2WOVA 3M0OA 1D7YA 4BK1A 3T2ZA 1HYUA 2YLRA 3C4NA 2WDVA 2BK3A 3F8RA 2ACZA 2BRYA 3WGTA 3GMCA 4Z43A 3ITJA 1KDGA 4NWZA 1Y0PA 5KMPA 3AYJA 3FIMB 2X3NA 2C72A 3B3RA 3FBSA 4JY3A 2XVJA 4USRA 1K0LA 3GYJA 4UDRA 1Y56A 1BZLA 1TDNA 2YR5A 4C3XA 3CMMA 5L46A 3RP6A 2VQ7A 1D4DA 4U8IA 3VR9A 1LVLA 4ECHA 2YG7A 1S3BA 1Y56B 2GR3A 4J57A 2EQ9A 3P4SA 4II2A 3SFEA 4B66A 2C73A 3CNJA 4N9XA 4EMWA 2JK6A 4G6GA 2B9YA 1GTEA 3UKPA 1NHPA 3AE5A 3EF6A 4Z26A 4AP1A 2WQYA 3SY4A 2IVEA 2YG4A 1KF6A 3CNPA 2YVFA 2H89A 3R9UA 1S3EA 1GRHA 1KIFA 1MOKA 3D1CA 3GD3A 4CBQA 2RGHA 1L9DA 1F8RA 3NGCX 3AD7B 2YLZA 2YWLA 4H4PA 2XFUA 4MJWA 1CHUA 4JQ9A 4OPDA 1AOGA 4H2QA 3CN8A 5IQ1A 3ABVA 1X31B 2R45A 3UKKA 1DODA 4H4ZA 1B4VA 1S2QA 2C3DA 4CRTA 1PBDA 4Z24A 1BF3A 1YQ4A 4P9SA 4G9KA 1M6IA 4FX9A 3E1TA 3BNUA 4QFCA 2XCGA 4U8MA 4DNAA 3NLCA 2GAHB 2C67A 3P4PA 5KVIA 4J2WA 2XLSA 3COXA 3GDPA 2WP6A 3AE7A 3UOZA 2X8HA 1DOEA 4J36A 5CQFA 5IQ4A 3P1WA 5JCMA 2WETA 4GDPA 4BV6A 2J3NA 3LZWA 4BK3A 1DAOA 3ZYXA 2C7GA 3QVPA 1L0VA 4EMJA 3W4JA 2Z5YA 1CJCA 1O5WA 3SXIA 2YG3A 3EPTA 1LJ1A 2EQ6A 3UOYA 3UOVA 3AYIA 4BURA 5HXIA 2JKCA 2EQ7A 2YR6A 4OPCA 3M13A 3DH9A 4K7ZA 4A7AA 1GOSA 4H50A 1D7LA 4YJHA 1E7PA 2V5ZA 3NK2X 3DJJA 3SZ0A 3LJPA 1NEKA 2YLTA 4B64A 2VVLG 4YJDA 1DJQA 1H7XA 4YJHB 3AD9B 2BCPA 2YAUA 4K8DA 4GDEA 1PBEA 4TM4A 3C96A 2GR1A 3CIRA 3AE3A 4C77A 2RGJA 3NNEA 4U8JA 2XLTA 5BVAA 1F8WA 2FJEA 3H8IA 3KPKA 3BHKA 1V59A 3CTYA 1LQUA 1IUTA 1OJ9A 4C74A 2CFYA 2GF3A 2ZBWA 4EQRA 5KOWA 2GH5A 3NHOX 3AEDA 2CDUA 3IHGA 2EQ8A 3Q6JA 3URHA 2W0HA 1KSSA 1CC2A 1IUUA 1Q1WA 3M12A 1DXLA 1ONFA 3AE2A 3V3NA 2X8GA 1YKJA 5KMSA 1H83A 3ISHA 3F8PA 4AOSA 1C0IA 3D8XA 4B67A 1GT8A 3T2KA 4CY8A 3LB8A 4ICYA 2BCGG 2C4CA 2JB2A 1TDOA 1TDKA 4GUVA 4AT2A 4IA6A 2FJAA 1DNCA 2YM1A 1OJTA 2QAEA 1LV0A 3DA1A 2YLWA 4NNJA 1PJ5A 2R0PA 4Y4NA 2WHDA 2JBVA 4EQWA 2BACA 5FS8A 4A79A 4H4SA 2Q6UA 1TRBA 1JRYA 1JRZA 2I0ZA 3SQPA 1ZK7A 4I58A 4X4JA 1D4CA 2BS3A 3GWFA 1RSGA 1SEZA 1CF3A 4NTDA 4B63A 2B7RA 1GRAA 1NAAA 1YY5A 1Z6LA 2V60A 4H4UA 3CPHG 2BC1A 2ZZCA 4UP3A 3BHFA 1F8SA 4YXDA 1FL2A 3DMEA 1KNPA 2VVMA 1VG9A 4U2TA 1FECA 2V6OA 5ER0A 2WOIA 4JNQA 1REOA 4REKA 2CVJA 2BS4A 4YTPA 3SM8A 1GALA 1GSNA 1H82A 2TPRA 3NRNA 3G5SA 3SX6A 3CGEA 2OLNA 3V76A 5JCIA 3H8LA 3HYVA 2R9ZA 1GEUA 2JB1A 3SYIA 3NYCA 1ZOVA 3DJDA 2C66A 5C3JA 1GPEA 2YLSA 1P2HA 3NK0X 3IF9A 3P4RA 4GAVA 1ZP0A 4OPUA 5KWFA 2YVJA 3AE8A 3AE1A 3L1RA 2C75A 1VRQB 4AT0A 1EL7A 1K4QA 2AQJA 4HA6A 5J60A 4PABA 1PJ7A 3I3LA 2XLRA 1LPFA 3IHMA 3AE4A 5JCKA 2B9WA 1H6VA 3IC9A 1N1PA 3NK1X 3DGHA 3GRSA 3GRTA 1CJ3A 3PS9A 1YQ3A 2V61A 1MXTA 2NVKX 4CCQA 5GSNA 2XFNA 1BGJA 2YQUA 4YTNA 1ZKQA 5EB5A 3UTFA 1OJDA 2TMDA 3KD9A 1JNZA 4DSGA 1OJCA 4AOXA 4GAPA 2HQMA 2E48A 1GESA 1H84A 2V3BA 3G5QA 4OCGA 2WU2A 1VE9A 2X8CA 3AECA 3AEEA 2BA9A 4H4YA 3HZLA 3T31A 1GRTA 2WOWA 2WP5A 2XLUA 3LXDA 4JNAA 3NYEA 4GF7A 4H4RA 5HY5A 1O95A 4EMIA 3UOXA 4D04A 3KA7A 4YJGA 4K5SA 5U63A 4Z2RA 3CUKA 2E4GA 1H7WA 1AN9A 5U25A 1NENA 2FJBA 2GR2A 2WU5A 3AEFA 4USQA 3DGZA 2C70A 4YJGB 3P9UA 4NTEA 2X50A 3SZCA 2A8XA 3P4QA 4H4TA 4OPTA 4ZN0A 2A89A 2OLOA 2E49A 2XYOA 3K7QX 2BK5A 3NG7X 1GRGA 1LQTA 3UKLA 3QFAA 1FCDA 5CKUA 4E0VA 4YT0A 4A99A 4G6HA 4DSHA 1JU2A 2PYXA 4YSZA 1PS9A 3REDA 3HYXA 4TM1A 1C0KA 1GTHA 4J34A 3JSKA 2OALA 3DK8A 3UKAA 2O9ZA 1GERA 3K7TA 4NTCA 3T2YA 4A5LA 4J56A 4BJYA 2GQWA 1PDHA 2XVHA 3NTAA 1QJDA 4KX6A 4EM3A 5IPYA 2GMJA 3UTHA 3CNSA 4LU6A 5JCNA 2YM2A 2CULA 3FMWA 3FPZA 2BS2A 1KFYA 2VVLA 4TLZA 1H86A 3UKFA 1B37A 3EANA 5KOXA 4X9MA 2JAEA 2QA1A 3PVCA 3GYIA 3SGLA 3ADAB 2H88A 2WPEA 1GRFA 1JEHA 1GV4A 2IIDA 2QCUA 1K0IA
chains in the Genus database with same CATH topology
2OAMA 5C2TA 1TYPA 3H4KA 4A9WA 2ARDA 2C76A 1B5QA 3CGBA 3KU9A 5BRTA 3S61A 3VQRA 3K30A 2DKHA 4O5QA 3ZDNA 4TLXA 1JRXA 4Y4MA 5FS9A 1PXBA 1CBOA 3OC4A 3UKHA 1TDFA 3C4AA 4IV9A 4CNKA 4YKGA 3AXBA 3LZXA 4GRTA 2XFPA 4XWRA 4DGKA 4U8NA 4H4WA 3GSIA 4J31A 1K0JA 4AP3A 3QSSA 4UDPA 3G5RA 2RGOA 4A6NA 4ADWA 1NHQA 4U8PA 1O94A 3Q9TA 3UKQA 5EB4A 1P2EA 1FEBA 2VQBA 4H2PA 2GRTA 4A6NB 1S2YA 3QFBA 4B1BA 2WPFA 1C0LA 4U8LA 1TDEA 3ATRA 5KMRA 2RABA 3V3OA 4K22A 4YSYA 3PO7A 3NN0X 4M52A 3EAOA 1F6MA 3CPIG 4PAAA 4C5OA 5KVHA 1ZY8A 1E1NA 4QFDA 1PBBA 5LV9A 1IJHA 2VRLA 4H4XA 3QVRA 2XFQA 2YG6A 1BWCA 1NHRA 3NYFA 4OPGA 4CNJA 3NN6X 3VRAA 1GXFA 2E5VA 4KPRA 4YTMA 2C3CA 1BKWA 4GCMA 1L9CA 2YG5A 1DJNA 4BJZA 1H81A 3GYXA 1QO8A 3G3EA 3RP7A 1OJAA 4Z2TA 2GB0A 1GRBA 1IUXA 3AEAA 3AE9A 3DK9A 2BYBA 3OZ2A 3NIXA 3QJ4A 4OVIA 1PBCA 4XWZA 1QLBA 1VDCA 3SFDA 4EM4A 4YSHA 4D03A 1DOBA 2IVDA 1D4EA 1W4XA 1ZX9A 2WBAA 3KKJA 5KRQA 2FBWA 1Q1RA 3GMBA 3RHAA 4I59A 3ATQA 4EIQA 4RG4A 4U8KA 4B65A 4O5UA 1EL8A 5U1OA 3S5WA 1ZOYA 2R4JA 3UTGA 5JCLA 2V3AA 4K5RA 5J7XA 2X99A 1Q9IA 1JOAA 1B8SA 5M0ZA 4X9NA 4YSXA 1L9EA 1GNDA 1XHCA 4YJFA 1EVIA 2GVCA 3CGCA 3ICTA 4JDRA 4II3A 3ICSA 3KPFA 2WDQA 2XVEA 2NPXA 2UZZA 4IA5A 4YJFB 2E1MA 3BI5A 5FS6A 2B76A 2BRAA 1XDIA 1PN0A 3W4KA 4G73A 4HB9A 3BNMA 2GQFA 2XVIA 3CNTA 1E39A 3KVEA 1EBDA 4A65A 3LOVA 2YR4A 2XLPA 2YVGA 3CGDA 1KSUA 1NDAA 4Z44A 2YLXA 4Z25A 3UTEA 5BULA 4Y4LA 3K7MX 4YKFA 1JNRA 4B68A 3RP8A 1D5TA 2DU8A 3B6DA 3IWAA 2GAGB 1UKVG 2Y6RA 2VOUA 4NEWA 2Q0LA 2R4EA 3DJEA 4EIPA 4CY6A 2E82A 4H4VA 2Q7VA 1F3PA 2C64A 4TM0A 2JB3A 3GDNA 2WESA 1PJ6A 5KNLA 5KXJA 1E6EA 1IUWA 4UDQA 3VRDB 3BI4A 1GETA 4EQSA 4TM3A 1PHHA 3GWDA 1NHSA 3NKSA 1EL9A 4NZHA 1ZMCA 3SZWA 2BC0A 4FDCB 1NPXA 2F5ZA 3AE6A 3ALLA 3QSEA 4G74A 4LIIA 4EQXA 1NG4A 1VG0A 1ZDLA 3ZNPA 1IUVA 3O0HA 1PXAA 3SZFA 1YQZA 1FOHA 4BK2A 3AB1A 4U2SA 4LA1A 2ZZBA 3NTDA 1IUSA 3FG2P 1COYA 2PHHA 1N4WA 1DDOA 3UCLA 1CC4A 2AR8A 3AEBA 1CC6A 4J33A 3UP4A 2WPCA 1C0PA 3ICRA 1DOCA 3ZNQA 2APGA 2BK4A 2B9XA 3WE0A 1RYIA 4FK1A 3UP5A 2WDRA 2XFOA 4GR1A 1ELIA 3I6DA 1PBFA 4WCTA 2E4AA 2Z5XA 3VR8A 1VQWA 4CCRA 2XDOA 1ZMDA 3VRBA 4APNA 4ZCCA 1KNRA 1E1MA 4U8OA 4ZCDA 3T0KA 1CL0A 2WS3A 4H7UA 2GMHA 3ZNNA 1FEAA 3ZNOA 1N4VA 1LTXR 2FJDA 2GV8A 2VRMA 3F8DA 3L8KA 4OPLA 5FS7A 5KMQA 3QSMA 1XANA 4H2NA 3RNMA 1MO9A 1BGNA 1E1LA 3ALJA 3DJGX 1GREA 4IVMB 4RG3A 3AWIA 2GR0A 3NH3X 4H2RA 2OA1A 3AEGA 3CNDA 1XPQA 3KLJA 4JY2A 5FMHA 3LADA 3AD8B 2BXSA 2XVFA 2Y6QA 3BI2A 4U2LA 5TR3A 1PXCA 5HHFA 5BUKA 5M10A 1CJ4A 2VZ2A 3DK4A 3NT6A 2ZZ0A 4FK1C 4H4QA 4IVOB 4NEVA 2A87A 5GRTA 4JN9A 1E1KA 4XXGA 1N4UA 5EOWA 1NG3A 3T14A 1M64A 3GD4A 2R0CA 3T37A 4WX1A 5EBKA 4YWOA 2R46A 2QA2A 1EL5A 2WEUA 3HYWA 1CJ2A 3II4A 2C65A 2AAQA 3AYLA 4RSLA 4C3YA 4B69A 1TYTA 4OPIA 3ALMA 2Q0KA 4Z2UA 2B7SA 2BXRA 1RP0A 2WP9A 5HYMA 4K2XA 2BABA 2DKIA 3W4IA 3CPJG 2R0GA 5DBJA 2GEWA 2WOVA 3M0OA 1D7YA 3T2ZA 4BK1A 1HYUA 2YLRA 3C4NA 2WDVA 2BK3A 3F8RA 2ACZA 2BRYA 3WGTA 3GMCA 4Z43A 3ITJA 1KDGA 4NWZA 1Y0PA 5KMPA 3AYJA 3FIMB 2X3NA 2C72A 3B3RA 3FBSA 2XVJA 4JY3A 4USRA 1K0LA 3GYJA 4UDRA 1Y56A 1BZLA 1TDNA 2YR5A 4C3XA 3CMMA 5L46A 2VQ7A 3RP6A 1D4DA 4U8IA 3VR9A 1LVLA 4ECHA 2YG7A 1S3BA 1Y56B 2GR3A 4J57A 2EQ9A 3P4SA 4II2A 3SFEA 4B66A 2C73A 3CNJA 4N9XA 4EMWA 2JK6A 4G6GA 2B9YA 1GTEA 3UKPA 1NHPA 3AE5A 3EF6A 4Z26A 4AP1A 2WQYA 3SY4A 2IVEA 2YG4A 1KF6A 3CNPA 2YVFA 2H89A 3R9UA 1S3EA 1GRHA 1KIFA 1MOKA 3D1CA 3GD3A 4CBQA 2RGHA 1L9DA 1F8RA 3NGCX 3AD7B 2YLZA 2YWLA 4H4PA 2XFUA 4MJWA 1CHUA 4JQ9A 4OPDA 1AOGA 4H2QA 3CN8A 5IQ1A 3ABVA 1X31B 2R45A 3UKKA 1DODA 4H4ZA 1B4VA 1S2QA 2C3DA 4CRTA 1PBDA 4Z24A 1BF3A 1YQ4A 4P9SA 4G9KA 1M6IA 4FX9A 3BNUA 3E1TA 4QFCA 2XCGA 4U8MA 4DNAA 3NLCA 2GAHB 2C67A 3P4PA 5KVIA 4J2WA 2XLSA 3COXA 3GDPA 2WP6A 3AE7A 3UOZA 2X8HA 1DOEA 4J36A 5CQFA 5IQ4A 3P1WA 5JCMA 2WETA 4GDPA 4BV6A 2J3NA 3LZWA 4BK3A 1DAOA 3ZYXA 2C7GA 3QVPA 1L0VA 4EMJA 3W4JA 2Z5YA 1CJCA 1O5WA 3SXIA 2YG3A 3EPTA 1LJ1A 2EQ6A 3UOYA 3UOVA 3AYIA 4BURA 2JKCA 4OPCA 2EQ7A 2YR6A 5HXIA 3M13A 3DH9A 4K7ZA 4A7AA 1GOSA 4H50A 1D7LA 4YJHA 1E7PA 2V5ZA 3NK2X 3DJJA 3SZ0A 3LJPA 1NEKA 2YLTA 4B64A 2VVLG 4YJDA 1DJQA 1H7XA 4YJHB 3AD9B 2BCPA 2YAUA 4K8DA 4GDEA 1PBEA 4TM4A 3C96A 2GR1A 3CIRA 3AE3A 4C77A 2RGJA 3NNEA 4U8JA 2XLTA 5BVAA 1F8WA 2FJEA 3H8IA 3KPKA 3BHKA 1V59A 3CTYA 1LQUA 1IUTA 1OJ9A 4C74A 2CFYA 2GF3A 2ZBWA 4EQRA 5KOWA 2GH5A 3NHOX 3AEDA 2CDUA 3IHGA 2EQ8A 3Q6JA 3URHA 2W0HA 1KSSA 1CC2A 1IUUA 1Q1WA 3M12A 1DXLA 1ONFA 3AE2A 3V3NA 2X8GA 1YKJA 5KMSA 1H83A 3ISHA 3F8PA 4AOSA 1C0IA 3D8XA 4B67A 1GT8A 3T2KA 4CY8A 3LB8A 4ICYA 2BCGG 2C4CA 2JB2A 1TDOA 1TDKA 4GUVA 4AT2A 4IA6A 2FJAA 1DNCA 2YM1A 1OJTA 2QAEA 1LV0A 3DA1A 2YLWA 4NNJA 1PJ5A 2R0PA 4Y4NA 2WHDA 2JBVA 4EQWA 2BACA 5FS8A 4A79A 4H4SA 2Q6UA 1TRBA 1JRYA 1JRZA 2I0ZA 3SQPA 1ZK7A 4I58A 4X4JA 1D4CA 2BS3A 3GWFA 1RSGA 1SEZA 1CF3A 4NTDA 4B63A 2B7RA 1GRAA 1NAAA 1YY5A 1Z6LA 2V60A 4H4UA 3CPHG 2BC1A 2ZZCA 4UP3A 3BHFA 1F8SA 4YXDA 1FL2A 3DMEA 1KNPA 2VVMA 1VG9A 4U2TA 1FECA 2V6OA 5ER0A 2WOIA 4JNQA 1REOA 4REKA 2CVJA 2BS4A 4YTPA 3SM8A 1GALA 1GSNA 1H82A 2TPRA 3NRNA 3G5SA 3SX6A 3CGEA 2OLNA 3V76A 5JCIA 3H8LA 3HYVA 2R9ZA 1GEUA 2JB1A 3SYIA 3NYCA 1ZOVA 3DJDA 2C66A 5C3JA 1GPEA 2YLSA 1P2HA 3NK0X 3IF9A 3P4RA 4GAVA 1ZP0A 4OPUA 5KWFA 2YVJA 3AE8A 3AE1A 3L1RA 2C75A 1VRQB 4AT0A 1EL7A 1K4QA 2AQJA 4HA6A 5J60A 4PABA 1PJ7A 3I3LA 2XLRA 1LPFA 3IHMA 3AE4A 5JCKA 2B9WA 1H6VA 3IC9A 1N1PA 3NK1X 3DGHA 3GRSA 3GRTA 1CJ3A 3PS9A 1YQ3A 2V61A 1MXTA 2NVKX 4CCQA 5GSNA 2XFNA 1BGJA 2YQUA 4YTNA 1ZKQA 5EB5A 3UTFA 1OJDA 2TMDA 3KD9A 1JNZA 4DSGA 1OJCA 4AOXA 4GAPA 2HQMA 2E48A 1GESA 1H84A 2V3BA 3G5QA 4OCGA 2WU2A 1VE9A 2X8CA 3AECA 3AEEA 2BA9A 4H4YA 3HZLA 3T31A 1GRTA 2WOWA 2WP5A 2XLUA 3LXDA 4JNAA 3NYEA 4GF7A 4H4RA 5HY5A 1O95A 4EMIA 3UOXA 4D04A 3KA7A 4YJGA 4K5SA 5U63A 4Z2RA 3CUKA 2E4GA 1H7WA 1AN9A 5U25A 1NENA 2FJBA 2GR2A 2WU5A 3AEFA 4USQA 3DGZA 2C70A 4YJGB 3P9UA 4NTEA 2X50A 3SZCA 2A8XA 3P4QA 4H4TA 4OPTA 4ZN0A 2A89A 2OLOA 2E49A 2XYOA 3K7QX 2BK5A 3NG7X 1GRGA 1LQTA 3UKLA 3QFAA 1FCDA 5CKUA 4E0VA 4YT0A 4A99A 4G6HA 4DSHA 1JU2A 2PYXA 4YSZA 1PS9A 3REDA 3HYXA 4TM1A 1C0KA 1GTHA 4J34A 3JSKA 2OALA 3DK8A 3UKAA 2O9ZA 1GERA 3K7TA 4NTCA 3T2YA 4A5LA 4J56A 4BJYA 2GQWA 1PDHA 2XVHA 3NTAA 1QJDA 4KX6A 4EM3A 5IPYA 2GMJA 3UTHA 3CNSA 4LU6A 5JCNA 2YM2A 2CULA 3FMWA 3FPZA 2BS2A 1KFYA 2VVLA 4TLZA 1H86A 3UKFA 1B37A 3EANA 5KOXA 4X9MA 2JAEA 2QA1A 3PVCA 3GYIA 3SGLA 3ADAB 2H88A 2WPEA 1GRFA 1JEHA 1GV4A 2IIDA 2QCUA 1K0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAM A;  5C2T A;  1TYP A;  3H4K A;  4A9W A;  2ARD A;  2C76 A;  1B5Q A;  3CGB A;  3KU9 A;  5BRT A;  3S61 A;  3VQR A;  3K30 A;  2DKH A;  4O5Q A;  3ZDN A;  4TLX A;  1JRX A;  4Y4M A;  5FS9 A;  1PXB A;  1CBO A;  3OC4 A;  3UKH A;  1TDF A;  3C4A A;  4IV9 A;  4CNK A;  4YKG A;  3AXB A;  3LZX A;  4GRT A;  2XFP A;  4XWR A;  4DGK A;  4U8N A;  4H4W A;  3GSI A;  4J31 A;  1K0J A;  4AP3 A;  3QSS A;  4UDP A;  3G5R A;  2RGO A;  4A6N A;  4ADW A;  1NHQ A;  4U8P A;  1O94 A;  3Q9T A;  3UKQ A;  5EB4 A;  1P2E A;  1FEB A;  2VQB A;  4H2P A;  2GRT A;  4A6N B;  1S2Y A;  3QFB A;  4B1B A;  2WPF A;  1C0L A;  4U8L A;  1TDE A;  3ATR A;  2RAB A;  3V3O A;  4K22 A;  4YSY A;  3PO7 A;  3NN0 X;  4M52 A;  3EAO A;  1F6M A;  3CPI G;  4PAA A;  4C5O A;  5KVH A;  1ZY8 A;  1E1N A;  4QFD A;  1PBB A;  5LV9 A;  1IJH A;  2VRL A;  4H4X A;  3QVR A;  2XFQ A;  2YG6 A;  1BWC A;  1NHR A;  3NYF A;  4OPG A;  4CNJ A;  3NN6 X;  3VRA A;  1GXF A;  2E5V A;  4KPR A;  4YTM A;  2C3C A;  1BKW A;  4GCM A;  1L9C A;  2YG5 A;  1DJN A;  4BJZ A;  1H81 A;  1QO8 A;  3G3E A;  3RP7 A;  1OJA A;  4Z2T A;  2GB0 A;  1GRB A;  1IUX A;  3AEA A;  3AE9 A;  3DK9 A;  2BYB A;  3OZ2 A;  3NIX A;  3QJ4 A;  4OVI A;  1PBC A;  4XWZ A;  1QLB A;  1VDC A;  3SFD A;  4EM4 A;  4YSH A;  4D03 A;  1DOB A;  2IVD A;  1D4E A;  1W4X A;  1ZX9 A;  2WBA A;  3KKJ A;  5KRQ A;  2FBW A;  1Q1R A;  3GMB A;  3RHA A;  4I59 A;  3ATQ A;  4EIQ A;  4RG4 A;  4U8K A;  4B65 A;  4O5U A;  1EL8 A;  5U1O A;  3S5W A;  1ZOY A;  2R4J A;  3UTG A;  5JCL A;  2V3A A;  4K5R A;  5J7X A;  2X99 A;  1Q9I A;  1JOA A;  1B8S A;  5M0Z A;  4X9N A;  4YSX A;  1L9E A;  1GND A;  1XHC A;  4YJF A;  1EVI A;  2GVC A;  3CGC A;  3ICT A;  4JDR A;  3ICS A;  3KPF A;  2WDQ A;  2XVE A;  2NPX A;  2UZZ A;  4IA5 A;  4YJF B;  2E1M A;  3BI5 A;  5FS6 A;  2B76 A;  1XDI A;  1PN0 A;  3W4K A;  4HB9 A;  3BNM A;  2GQF A;  2XVI A;  3CNT A;  1E39 A;  3KVE A;  1EBD A;  4A65 A;  3LOV A;  2YR4 A;  2XLP A;  2YVG A;  3CGD A;  1KSU A;  1NDA A;  4Z44 A;  2YLX A;  4Z25 A;  3UTE A;  5BUL A;  4Y4L A;  3K7M X;  4YKF A;  1JNR A;  4B68 A;  3RP8 A;  1D5T A;  2DU8 A;  3B6D A;  3IWA A;  2GAG B;  1UKV G;  2Y6R A;  2VOU A;  4NEW A;  2Q0L A;  2R4E A;  3DJE A;  4EIP A;  4CY6 A;  2E82 A;  4H4V A;  2Q7V A;  1F3P A;  2C64 A;  4TM0 A;  2JB3 A;  3GDN A;  2WES A;  1PJ6 A;  5KXJ A;  1E6E A;  1IUW A;  4UDQ A;  3VRD B;  3BI4 A;  1GET A;  4EQS A;  4TM3 A;  1PHH A;  3GWD A;  1NHS A;  3NKS A;  1EL9 A;  4NZH A;  1ZMC A;  2BC0 A;  4FDC B;  1NPX A;  2F5Z A;  3AE6 A;  3ALL A;  3QSE A;  4LII A;  4EQX A;  1NG4 A;  1VG0 A;  1ZDL A;  3ZNP A;  1IUV A;  3O0H A;  1PXA A;  1YQZ A;  1FOH A;  4BK2 A;  3AB1 A;  4U2S A;  4LA1 A;  2ZZB A;  3NTD A;  1IUS A;  3FG2 P;  1COY A;  2PHH A;  1N4W A;  1DDO A;  3UCL A;  1CC4 A;  2AR8 A;  3AEB A;  1CC6 A;  4J33 A;  3UP4 A;  2WPC A;  1C0P A;  3ICR A;  1DOC A;  3ZNQ A;  2APG A;  2BK4 A;  2B9X A;  3WE0 A;  1RYI A;  4FK1 A;  3UP5 A;  2WDR A;  2XFO A;  4GR1 A;  1ELI A;  3I6D A;  1PBF A;  4WCT A;  2E4A A;  2Z5X A;  3VR8 A;  1VQW A;  4CCR A;  2XDO A;  1ZMD A;  3VRB A;  4APN A;  4ZCC A;  1KNR A;  1E1M A;  4U8O A;  4ZCD A;  1CL0 A;  2WS3 A;  4H7U A;  2GMH A;  3ZNN A;  1FEA A;  3ZNO A;  1N4V A;  1LTX R;  2FJD A;  2GV8 A;  2VRM A;  3F8D A;  3L8K A;  4OPL A;  5FS7 A;  3QSM A;  1XAN A;  4H2N A;  3RNM A;  1MO9 A;  1BGN A;  1E1L A;  3ALJ A;  3DJG X;  1GRE A;  4IVM B;  4RG3 A;  3AWI A;  2GR0 A;  3NH3 X;  4H2R A;  2OA1 A;  3AEG A;  3CND A;  1XPQ A;  3KLJ A;  4JY2 A;  5FMH A;  3LAD A;  3AD8 B;  2BXS A;  2XVF A;  2Y6Q A;  3BI2 A;  4U2L A;  5TR3 A;  1PXC A;  5HHF A;  5BUK A;  5M10 A;  1CJ4 A;  2VZ2 A;  3DK4 A;  3NT6 A;  2ZZ0 A;  4FK1 C;  4H4Q A;  4IVO B;  4NEV A;  2A87 A;  5GRT A;  4JN9 A;  1E1K A;  4XXG A;  1N4U A;  5EOW A;  1NG3 A;  1M64 A;  3GD4 A;  2R0C A;  3T37 A;  4WX1 A;  5EBK A;  4YWO A;  2R46 A;  2QA2 A;  1EL5 A;  2WEU A;  1CJ2 A;  3II4 A;  2C65 A;  2AAQ A;  3AYL A;  4RSL A;  4C3Y A;  4B69 A;  1TYT A;  4OPI A;  3ALM A;  2Q0K A;  4Z2U A;  2B7S A;  2BXR A;  1RP0 A;  2WP9 A;  5HYM A;  4K2X A;  2BAB A;  2DKI A;  3W4I A;  3CPJ G;  2R0G A;  5DBJ A;  2GEW A;  2WOV A;  3M0O A;  1D7Y A;  4BK1 A;  1HYU A;  2YLR A;  3C4N A;  2WDV A;  2BK3 A;  3F8R A;  2ACZ A;  3WGT A;  3GMC A;  4Z43 A;  3ITJ A;  1KDG A;  1Y0P A;  3AYJ A;  3FIM B;  2X3N A;  2C72 A;  3B3R A;  3FBS A;  2XVJ A;  4JY3 A;  4USR A;  1K0L A;  3GYJ A;  4UDR A;  1Y56 A;  1BZL A;  1TDN A;  2YR5 A;  4C3X A;  5L46 A;  2VQ7 A;  3RP6 A;  1D4D A;  4U8I A;  3VR9 A;  1LVL A;  4ECH A;  2YG7 A;  1S3B A;  1Y56 B;  2GR3 A;  4J57 A;  2EQ9 A;  3P4S A;  3SFE A;  4B66 A;  2C73 A;  3CNJ A;  4N9X A;  4EMW A;  2JK6 A;  2B9Y A;  1GTE A;  3UKP A;  1NHP A;  3AE5 A;  3EF6 A;  4Z26 A;  4AP1 A;  2WQY A;  2IVE A;  2YG4 A;  1KF6 A;  3CNP A;  2YVF A;  2H89 A;  3R9U A;  1S3E A;  1GRH A;  1KIF A;  1MOK A;  3D1C A;  3GD3 A;  4CBQ A;  2RGH A;  1L9D A;  1F8R A;  3NGC X;  3AD7 B;  2YLZ A;  2YWL A;  4H4P A;  2XFU A;  4MJW A;  1CHU A;  4JQ9 A;  4OPD A;  1AOG A;  4H2Q A;  3CN8 A;  5IQ1 A;  3ABV A;  1X31 B;  2R45 A;  3UKK A;  1DOD A;  4H4Z A;  1B4V A;  1S2Q A;  2C3D A;  4CRT A;  1PBD A;  4Z24 A;  1BF3 A;  1YQ4 A;  4P9S A;  1M6I A;  4FX9 A;  3BNU A;  3E1T A;  4QFC A;  2XCG A;  4U8M A;  4DNA A;  3NLC A;  2GAH B;  2C67 A;  3P4P A;  5KVI A;  4J2W A;  2XLS A;  3COX A;  3GDP A;  2WP6 A;  3AE7 A;  3UOZ A;  2X8H A;  1DOE A;  4J36 A;  5CQF A;  5IQ4 A;  3P1W A;  5JCM A;  2WET A;  4GDP A;  4BV6 A;  2J3N A;  3LZW A;  4BK3 A;  1DAO A;  3ZYX A;  2C7G A;  3QVP A;  1L0V A;  4EMJ A;  3W4J A;  2Z5Y A;  1CJC A;  1O5W A;  2YG3 A;  3EPT A;  1LJ1 A;  2EQ6 A;  3UOY A;  3UOV A;  3AYI A;  4BUR A;  2JKC A;  4OPC A;  2EQ7 A;  2YR6 A;  5HXI A;  3M13 A;  3DH9 A;  4K7Z A;  4A7A A;  1GOS A;  4H50 A;  1D7L A;  4YJH A;  1E7P A;  2V5Z A;  3NK2 X;  3DJJ A;  3LJP A;  1NEK A;  2YLT A;  4B64 A;  2VVL G;  4YJD A;  1DJQ A;  1H7X A;  4YJH B;  3AD9 B;  2BCP A;  2YAU A;  4K8D A;  4GDE A;  1PBE A;  4TM4 A;  3C96 A;  2GR1 A;  3CIR A;  3AE3 A;  4C77 A;  2RGJ A;  3NNE A;  4U8J A;  2XLT A;  5BVA A;  1F8W A;  2FJE A;  3H8I A;  3BHK A;  1V59 A;  3CTY A;  1LQU A;  1IUT A;  1OJ9 A;  4C74 A;  2CFY A;  2GF3 A;  2ZBW A;  4EQR A;  5KOW A;  2GH5 A;  3NHO X;  3AED A;  2CDU A;  3IHG A;  2EQ8 A;  3Q6J A;  3URH A;  2W0H A;  1KSS A;  1CC2 A;  1IUU A;  1Q1W A;  3M12 A;  1DXL A;  1ONF A;  3AE2 A;  3V3N A;  2X8G A;  1YKJ A;  1H83 A;  3ISH A;  3F8P A;  4AOS A;  1C0I A;  3D8X A;  4B67 A;  1GT8 A;  4CY8 A;  3LB8 A;  4ICY A;  2BCG G;  2JB2 A;  1TDO A;  1TDK A;  4GUV A;  4AT2 A;  4IA6 A;  2FJA A;  1DNC A;  2YM1 A;  1OJT A;  2QAE A;  1LV0 A;  3DA1 A;  2YLW A;  1PJ5 A;  2R0P A;  4Y4N A;  2WHD A;  2JBV A;  4EQW A;  2BAC A;  5FS8 A;  4A79 A;  4H4S A;  2Q6U A;  1TRB A;  1JRY A;  1JRZ A;  2I0Z A;  3SQP A;  1ZK7 A;  4I58 A;  4X4J A;  1D4C A;  2BS3 A;  3GWF A;  1RSG A;  1SEZ A;  1CF3 A;  4NTD A;  4B63 A;  2B7R A;  1GRA A;  1NAA A;  1YY5 A;  1Z6L A;  2V60 A;  4H4U A;  3CPH G;  2BC1 A;  2ZZC A;  4UP3 A;  3BHF A;  1F8S A;  4YXD A;  1FL2 A;  3DME A;  1KNP A;  2VVM A;  1VG9 A;  4U2T A;  1FEC A;  2V6O A;  5ER0 A;  2WOI A;  4JNQ A;  1REO A;  4REK A;  2CVJ A;  2BS4 A;  4YTP A;  3SM8 A;  1GAL A;  1GSN A;  1H82 A;  2TPR A;  3NRN A;  3G5S A;  3CGE A;  2OLN A;  3V76 A;  5JCI A;  3H8L A;  2R9Z A;  1GEU A;  2JB1 A;  3NYC A;  1ZOV A;  3DJD A;  2C66 A;  5C3J A;  1GPE A;  2YLS A;  1P2H A;  3NK0 X;  3IF9 A;  3P4R A;  4OPU A;  1ZP0 A;  5KWF A;  2YVJ A;  3AE8 A;  3AE1 A;  3L1R A;  2C75 A;  1VRQ B;  4AT0 A;  1EL7 A;  1K4Q A;  2AQJ A;  4HA6 A;  5J60 A;  4PAB A;  1PJ7 A;  3I3L A;  2XLR A;  1LPF A;  3IHM A;  3AE4 A;  5JCK A;  2B9W A;  1H6V A;  3IC9 A;  1N1P A;  3NK1 X;  3DGH A;  3GRS A;  3GRT A;  1CJ3 A;  3PS9 A;  1YQ3 A;  2V61 A;  1MXT A;  2NVK X;  4CCQ A;  5GSN A;  2XFN A;  1BGJ A;  2YQU A;  4YTN A;  1ZKQ A;  5EB5 A;  3UTF A;  1OJD A;  2TMD A;  3KD9 A;  1JNZ A;  4DSG A;  1OJC A;  4AOX A;  2HQM A;  2E48 A;  1GES A;  1H84 A;  2V3B A;  3G5Q A;  4OCG A;  2WU2 A;  1VE9 A;  2X8C A;  3AEC A;  3AEE A;  2BA9 A;  4H4Y A;  3HZL A;  1GRT A;  2WOW A;  2WP5 A;  2XLU A;  3LXD A;  4JNA A;  3NYE A;  4GF7 A;  4H4R A;  5HY5 A;  1O95 A;  4EMI A;  3UOX A;  4D04 A;  3KA7 A;  4YJG A;  4K5S A;  5U63 A;  4Z2R A;  3CUK A;  2E4G A;  1H7W A;  1AN9 A;  5U25 A;  1NEN A;  2FJB A;  2GR2 A;  2WU5 A;  3AEF A;  4USQ A;  3DGZ A;  2C70 A;  4YJG B;  3P9U A;  4NTE A;  2X50 A;  2A8X A;  3P4Q A;  4H4T A;  4OPT A;  4ZN0 A;  2A89 A;  2OLO A;  2E49 A;  2XYO A;  3K7Q X;  2BK5 A;  3NG7 X;  1GRG A;  1LQT A;  3UKL A;  3QFA A;  1FCD A;  5CKU A;  4E0V A;  4YT0 A;  4A99 A;  4DSH A;  1JU2 A;  2PYX A;  4YSZ A;  1PS9 A;  3RED A;  4TM1 A;  1C0K A;  1GTH A;  4J34 A;  3JSK A;  2OAL A;  3DK8 A;  3UKA A;  2O9Z A;  1GER A;  3K7T A;  4NTC A;  4A5L A;  4J56 A;  4BJY A;  2GQW A;  1PDH A;  2XVH A;  3NTA A;  1QJD A;  4KX6 A;  4EM3 A;  5IPY A;  2GMJ A;  3UTH A;  3CNS A;  4LU6 A;  5JCN A;  2YM2 A;  2CUL A;  3FMW A;  3FPZ A;  2BS2 A;  1KFY A;  2VVL A;  4TLZ A;  1H86 A;  3UKF A;  1B37 A;  3EAN A;  5KOX A;  4X9M A;  2JAE A;  2QA1 A;  3PVC A;  3GYI A;  3SGL A;  3ADA B;  2H88 A;  2WPE A;  1GRF A;  1JEH A;  1GV4 A;  2IID A;  2QCU A;  1K0I A; 
#chains in the Genus database with same CATH topology
 2OAM A;  5C2T A;  1TYP A;  3H4K A;  4A9W A;  2ARD A;  2C76 A;  1B5Q A;  3CGB A;  3KU9 A;  5BRT A;  3S61 A;  3VQR A;  3K30 A;  2DKH A;  4O5Q A;  3ZDN A;  4TLX A;  1JRX A;  4Y4M A;  5FS9 A;  1PXB A;  1CBO A;  3OC4 A;  3UKH A;  1TDF A;  3C4A A;  4IV9 A;  4CNK A;  4YKG A;  3AXB A;  3LZX A;  4GRT A;  2XFP A;  4XWR A;  4DGK A;  4U8N A;  4H4W A;  3GSI A;  4J31 A;  1K0J A;  4AP3 A;  3QSS A;  4UDP A;  3G5R A;  2RGO A;  4A6N A;  4ADW A;  1NHQ A;  4U8P A;  1O94 A;  3Q9T A;  3UKQ A;  5EB4 A;  1P2E A;  1FEB A;  4H2P A;  2VQB A;  2GRT A;  4A6N B;  1S2Y A;  3QFB A;  4B1B A;  2WPF A;  1C0L A;  4U8L A;  1TDE A;  3ATR A;  5KMR A;  2RAB A;  3V3O A;  4K22 A;  4YSY A;  3PO7 A;  3NN0 X;  4M52 A;  3EAO A;  1F6M A;  3CPI G;  4PAA A;  4C5O A;  5KVH A;  1ZY8 A;  1E1N A;  4QFD A;  1PBB A;  5LV9 A;  1IJH A;  2VRL A;  4H4X A;  3QVR A;  2XFQ A;  2YG6 A;  1BWC A;  1NHR A;  3NYF A;  4OPG A;  4CNJ A;  3NN6 X;  3VRA A;  1GXF A;  2E5V A;  4KPR A;  4YTM A;  2C3C A;  1BKW A;  4GCM A;  1L9C A;  2YG5 A;  1DJN A;  4BJZ A;  1H81 A;  3GYX A;  1QO8 A;  3G3E A;  3RP7 A;  1OJA A;  4Z2T A;  2GB0 A;  1GRB A;  1IUX A;  3AEA A;  3AE9 A;  3DK9 A;  2BYB A;  3OZ2 A;  3NIX A;  3QJ4 A;  4OVI A;  1PBC A;  4XWZ A;  1QLB A;  1VDC A;  3SFD A;  4EM4 A;  4YSH A;  4D03 A;  1DOB A;  2IVD A;  1D4E A;  1W4X A;  1ZX9 A;  2WBA A;  3KKJ A;  5KRQ A;  2FBW A;  1Q1R A;  3GMB A;  3RHA A;  4I59 A;  3ATQ A;  4EIQ A;  4RG4 A;  4U8K A;  4B65 A;  4O5U A;  1EL8 A;  5U1O A;  3S5W A;  1ZOY A;  2R4J A;  3UTG A;  5JCL A;  2V3A A;  4K5R A;  5J7X A;  2X99 A;  1Q9I A;  1JOA A;  1B8S A;  5M0Z A;  4X9N A;  4YSX A;  1L9E A;  1GND A;  1XHC A;  4YJF A;  1EVI A;  2GVC A;  3CGC A;  3ICT A;  4JDR A;  4II3 A;  3ICS A;  3KPF A;  2WDQ A;  2XVE A;  2NPX A;  2UZZ A;  4IA5 A;  4YJF B;  2E1M A;  3BI5 A;  5FS6 A;  2B76 A;  2BRA A;  1XDI A;  1PN0 A;  3W4K A;  4G73 A;  4HB9 A;  3BNM A;  2GQF A;  2XVI A;  3CNT A;  1E39 A;  3KVE A;  1EBD A;  4A65 A;  3LOV A;  2YR4 A;  2XLP A;  2YVG A;  3CGD A;  1KSU A;  1NDA A;  4Z44 A;  2YLX A;  4Z25 A;  3UTE A;  5BUL A;  4Y4L A;  3K7M X;  4YKF A;  1JNR A;  4B68 A;  3RP8 A;  1D5T A;  2DU8 A;  3B6D A;  3IWA A;  2GAG B;  1UKV G;  2Y6R A;  2VOU A;  4NEW A;  2Q0L A;  2R4E A;  3DJE A;  4EIP A;  4CY6 A;  2E82 A;  4H4V A;  2Q7V A;  1F3P A;  2C64 A;  4TM0 A;  2JB3 A;  3GDN A;  2WES A;  1PJ6 A;  5KNL A;  5KXJ A;  1E6E A;  1IUW A;  4UDQ A;  3VRD B;  3BI4 A;  1GET A;  4EQS A;  4TM3 A;  1PHH A;  3GWD A;  1NHS A;  3NKS A;  1EL9 A;  4NZH A;  1ZMC A;  3SZW A;  2BC0 A;  4FDC B;  3ALL A;  1NPX A;  2F5Z A;  3AE6 A;  3QSE A;  4G74 A;  4LII A;  4EQX A;  1NG4 A;  1VG0 A;  1ZDL A;  3ZNP A;  1IUV A;  3O0H A;  1PXA A;  3SZF A;  1YQZ A;  1FOH A;  4BK2 A;  3AB1 A;  4U2S A;  4LA1 A;  2ZZB A;  3NTD A;  1IUS A;  3FG2 P;  1COY A;  2PHH A;  1N4W A;  1DDO A;  3UCL A;  1CC4 A;  2AR8 A;  3AEB A;  1CC6 A;  4J33 A;  3UP4 A;  2WPC A;  1C0P A;  3ICR A;  1DOC A;  3ZNQ A;  2APG A;  2BK4 A;  2B9X A;  3WE0 A;  1RYI A;  4FK1 A;  3UP5 A;  2WDR A;  2XFO A;  4GR1 A;  1ELI A;  3I6D A;  1PBF A;  4WCT A;  2E4A A;  2Z5X A;  3VR8 A;  1VQW A;  4CCR A;  2XDO A;  1ZMD A;  3VRB A;  4APN A;  4ZCC A;  1KNR A;  1E1M A;  4U8O A;  4ZCD A;  3T0K A;  1CL0 A;  2WS3 A;  4H7U A;  2GMH A;  3ZNN A;  1FEA A;  3ZNO A;  1N4V A;  1LTX R;  2FJD A;  2GV8 A;  2VRM A;  3F8D A;  3L8K A;  4OPL A;  5FS7 A;  5KMQ A;  3QSM A;  4H2N A;  1XAN A;  3RNM A;  1MO9 A;  3ALJ A;  1BGN A;  1E1L A;  3DJG X;  1GRE A;  4IVM B;  4RG3 A;  3AWI A;  2GR0 A;  3NH3 X;  4H2R A;  2OA1 A;  3AEG A;  3CND A;  1XPQ A;  3KLJ A;  4JY2 A;  5FMH A;  3LAD A;  3AD8 B;  2BXS A;  2XVF A;  2Y6Q A;  3BI2 A;  4U2L A;  5TR3 A;  1PXC A;  5HHF A;  5BUK A;  5M10 A;  1CJ4 A;  2VZ2 A;  3DK4 A;  3NT6 A;  2ZZ0 A;  4FK1 C;  4H4Q A;  4IVO B;  4NEV A;  2A87 A;  5GRT A;  4JN9 A;  1E1K A;  4XXG A;  1N4U A;  5EOW A;  1NG3 A;  3T14 A;  1M64 A;  3GD4 A;  2R0C A;  3T37 A;  4WX1 A;  5EBK A;  4YWO A;  2R46 A;  2QA2 A;  1EL5 A;  2WEU A;  3HYW A;  1CJ2 A;  3II4 A;  2C65 A;  2AAQ A;  3AYL A;  4RSL A;  4C3Y A;  4B69 A;  1TYT A;  4OPI A;  3ALM A;  2Q0K A;  4Z2U A;  2B7S A;  2BXR A;  1RP0 A;  2WP9 A;  5HYM A;  4K2X A;  2BAB A;  2DKI A;  3W4I A;  3CPJ G;  2R0G A;  5DBJ A;  2GEW A;  2WOV A;  3M0O A;  1D7Y A;  4BK1 A;  3T2Z A;  1HYU A;  2YLR A;  3C4N A;  2WDV A;  2BK3 A;  3F8R A;  2ACZ A;  2BRY A;  3WGT A;  3GMC A;  4Z43 A;  3ITJ A;  1KDG A;  4NWZ A;  1Y0P A;  5KMP A;  3AYJ A;  3FIM B;  2X3N A;  2C72 A;  3B3R A;  3FBS A;  4JY3 A;  2XVJ A;  4USR A;  1K0L A;  3GYJ A;  4UDR A;  1Y56 A;  1BZL A;  1TDN A;  2YR5 A;  4C3X A;  3CMM A;  5L46 A;  3RP6 A;  2VQ7 A;  1D4D A;  4U8I A;  3VR9 A;  1LVL A;  4ECH A;  2YG7 A;  1S3B A;  1Y56 B;  2GR3 A;  4J57 A;  2EQ9 A;  3P4S A;  4II2 A;  3SFE A;  4B66 A;  2C73 A;  3CNJ A;  4N9X A;  4EMW A;  2JK6 A;  4G6G A;  2B9Y A;  1GTE A;  3UKP A;  1NHP A;  3AE5 A;  3EF6 A;  4Z26 A;  4AP1 A;  2WQY A;  3SY4 A;  2IVE A;  2YG4 A;  1KF6 A;  3CNP A;  2YVF A;  2H89 A;  3R9U A;  1S3E A;  1GRH A;  1KIF A;  1MOK A;  3D1C A;  3GD3 A;  4CBQ A;  2RGH A;  1L9D A;  1F8R A;  3NGC X;  3AD7 B;  2YLZ A;  2YWL A;  4H4P A;  2XFU A;  4MJW A;  1CHU A;  4JQ9 A;  4OPD A;  1AOG A;  4H2Q A;  3CN8 A;  5IQ1 A;  3ABV A;  1X31 B;  2R45 A;  3UKK A;  1DOD A;  4H4Z A;  1B4V A;  1S2Q A;  2C3D A;  4CRT A;  1PBD A;  4Z24 A;  1BF3 A;  1YQ4 A;  4P9S A;  4G9K A;  1M6I A;  4FX9 A;  3E1T A;  3BNU A;  4QFC A;  2XCG A;  4U8M A;  4DNA A;  3NLC A;  2GAH B;  2C67 A;  3P4P A;  5KVI A;  4J2W A;  2XLS A;  3COX A;  3GDP A;  2WP6 A;  3AE7 A;  3UOZ A;  2X8H A;  1DOE A;  4J36 A;  5CQF A;  5IQ4 A;  3P1W A;  5JCM A;  2WET A;  4GDP A;  4BV6 A;  2J3N A;  3LZW A;  4BK3 A;  1DAO A;  3ZYX A;  2C7G A;  3QVP A;  1L0V A;  4EMJ A;  3W4J A;  2Z5Y A;  1CJC A;  1O5W A;  3SXI A;  2YG3 A;  3EPT A;  1LJ1 A;  2EQ6 A;  3UOY A;  3UOV A;  3AYI A;  4BUR A;  5HXI A;  2JKC A;  2EQ7 A;  2YR6 A;  4OPC A;  3M13 A;  3DH9 A;  4K7Z A;  4A7A A;  1GOS A;  4H50 A;  1D7L A;  4YJH A;  1E7P A;  2V5Z A;  3NK2 X;  3DJJ A;  3SZ0 A;  3LJP A;  1NEK A;  2YLT A;  4B64 A;  2VVL G;  4YJD A;  1DJQ A;  1H7X A;  4YJH B;  3AD9 B;  2BCP A;  2YAU A;  4K8D A;  4GDE A;  1PBE A;  4TM4 A;  3C96 A;  2GR1 A;  3CIR A;  3AE3 A;  4C77 A;  2RGJ A;  3NNE A;  4U8J A;  2XLT A;  5BVA A;  1F8W A;  2FJE A;  3H8I A;  3KPK A;  3BHK A;  1V59 A;  3CTY A;  1LQU A;  1IUT A;  1OJ9 A;  4C74 A;  2CFY A;  2GF3 A;  2ZBW A;  4EQR A;  5KOW A;  2GH5 A;  3NHO X;  3AED A;  2CDU A;  3IHG A;  2EQ8 A;  3Q6J A;  3URH A;  2W0H A;  1KSS A;  1CC2 A;  1IUU A;  1Q1W A;  3M12 A;  1DXL A;  1ONF A;  3AE2 A;  3V3N A;  2X8G A;  1YKJ A;  5KMS A;  1H83 A;  3ISH A;  3F8P A;  4AOS A;  1C0I A;  3D8X A;  4B67 A;  1GT8 A;  3T2K A;  4CY8 A;  3LB8 A;  4ICY A;  2BCG G;  2C4C A;  2JB2 A;  1TDO A;  1TDK A;  4GUV A;  4AT2 A;  4IA6 A;  2FJA A;  1DNC A;  2YM1 A;  1OJT A;  2QAE A;  1LV0 A;  3DA1 A;  2YLW A;  4NNJ A;  1PJ5 A;  2R0P A;  4Y4N A;  2WHD A;  2JBV A;  4EQW A;  2BAC A;  5FS8 A;  4A79 A;  4H4S A;  2Q6U A;  1TRB A;  1JRY A;  1JRZ A;  2I0Z A;  3SQP A;  1ZK7 A;  4I58 A;  4X4J A;  1D4C A;  2BS3 A;  3GWF A;  1RSG A;  1SEZ A;  1CF3 A;  4NTD A;  4B63 A;  2B7R A;  1GRA A;  1NAA A;  1YY5 A;  1Z6L A;  2V60 A;  4H4U A;  3CPH G;  2BC1 A;  2ZZC A;  4UP3 A;  3BHF A;  1F8S A;  4YXD A;  1FL2 A;  3DME A;  1KNP A;  2VVM A;  1VG9 A;  4U2T A;  1FEC A;  2V6O A;  5ER0 A;  2WOI A;  4JNQ A;  1REO A;  4REK A;  2CVJ A;  2BS4 A;  4YTP A;  3SM8 A;  1GAL A;  1GSN A;  1H82 A;  2TPR A;  3NRN A;  3G5S A;  3SX6 A;  3CGE A;  2OLN A;  3V76 A;  5JCI A;  3H8L A;  3HYV A;  2R9Z A;  1GEU A;  2JB1 A;  3SYI A;  3NYC A;  1ZOV A;  3DJD A;  2C66 A;  5C3J A;  1GPE A;  2YLS A;  1P2H A;  3NK0 X;  3IF9 A;  3P4R A;  4GAV A;  1ZP0 A;  4OPU A;  5KWF A;  2YVJ A;  3AE8 A;  3AE1 A;  3L1R A;  2C75 A;  1VRQ B;  4AT0 A;  1EL7 A;  1K4Q A;  2AQJ A;  4HA6 A;  5J60 A;  4PAB A;  1PJ7 A;  3I3L A;  2XLR A;  1LPF A;  3IHM A;  3AE4 A;  5JCK A;  2B9W A;  1H6V A;  3IC9 A;  1N1P A;  3NK1 X;  3DGH A;  3GRS A;  3GRT A;  1CJ3 A;  3PS9 A;  1YQ3 A;  2V61 A;  1MXT A;  2NVK X;  4CCQ A;  5GSN A;  2XFN A;  1BGJ A;  2YQU A;  4YTN A;  1ZKQ A;  5EB5 A;  3UTF A;  1OJD A;  2TMD A;  3KD9 A;  1JNZ A;  4DSG A;  1OJC A;  4AOX A;  4GAP A;  2HQM A;  2E48 A;  1GES A;  1H84 A;  2V3B A;  3G5Q A;  4OCG A;  2WU2 A;  1VE9 A;  2X8C A;  3AEC A;  3AEE A;  2BA9 A;  4H4Y A;  3HZL A;  3T31 A;  1GRT A;  2WOW A;  2WP5 A;  2XLU A;  3LXD A;  4JNA A;  3NYE A;  4GF7 A;  4H4R A;  5HY5 A;  1O95 A;  4EMI A;  3UOX A;  4D04 A;  3KA7 A;  4YJG A;  4K5S A;  5U63 A;  4Z2R A;  3CUK A;  2E4G A;  1H7W A;  1AN9 A;  5U25 A;  1NEN A;  2FJB A;  2GR2 A;  2WU5 A;  3AEF A;  4USQ A;  3DGZ A;  2C70 A;  4YJG B;  3P9U A;  4NTE A;  2X50 A;  3SZC A;  2A8X A;  3P4Q A;  4H4T A;  4OPT A;  4ZN0 A;  2A89 A;  2OLO A;  2E49 A;  2XYO A;  3K7Q X;  2BK5 A;  3NG7 X;  1GRG A;  1LQT A;  3UKL A;  3QFA A;  1FCD A;  5CKU A;  4E0V A;  4YT0 A;  4A99 A;  4G6H A;  4DSH A;  1JU2 A;  2PYX A;  4YSZ A;  1PS9 A;  3RED A;  3HYX A;  4TM1 A;  1C0K A;  1GTH A;  4J34 A;  3JSK A;  2OAL A;  3DK8 A;  3UKA A;  2O9Z A;  1GER A;  3K7T A;  4NTC A;  3T2Y A;  4A5L A;  4J56 A;  4BJY A;  2GQW A;  1PDH A;  2XVH A;  3NTA A;  1QJD A;  4KX6 A;  4EM3 A;  5IPY A;  2GMJ A;  3UTH A;  3CNS A;  4LU6 A;  5JCN A;  2YM2 A;  2CUL A;  3FMW A;  3FPZ A;  2BS2 A;  1KFY A;  2VVL A;  4TLZ A;  1H86 A;  3UKF A;  1B37 A;  3EAN A;  5KOX A;  4X9M A;  2JAE A;  2QA1 A;  3PVC A;  3GYI A;  3SGL A;  3ADA B;  2H88 A;  2WPE A;  1GRF A;  1JEH A;  1GV4 A;  2IID A;  2QCU A;  1K0I A; 
#chains in the Genus database with same CATH homology
 2OAM A;  5C2T A;  1TYP A;  3H4K A;  4A9W A;  2ARD A;  2C76 A;  1B5Q A;  3CGB A;  3KU9 A;  5BRT A;  3S61 A;  3VQR A;  3K30 A;  2DKH A;  4O5Q A;  3ZDN A;  4TLX A;  1JRX A;  4Y4M A;  5FS9 A;  1PXB A;  1CBO A;  3OC4 A;  3UKH A;  1TDF A;  3C4A A;  4IV9 A;  4CNK A;  4YKG A;  3AXB A;  3LZX A;  4GRT A;  2XFP A;  4XWR A;  4DGK A;  4U8N A;  4H4W A;  3GSI A;  4J31 A;  1K0J A;  4AP3 A;  3QSS A;  4UDP A;  3G5R A;  2RGO A;  4A6N A;  4ADW A;  1NHQ A;  4U8P A;  1O94 A;  3Q9T A;  3UKQ A;  5EB4 A;  1P2E A;  1FEB A;  2VQB A;  4H2P A;  2GRT A;  4A6N B;  1S2Y A;  3QFB A;  4B1B A;  2WPF A;  1C0L A;  4U8L A;  1TDE A;  3ATR A;  5KMR A;  2RAB A;  3V3O A;  4K22 A;  4YSY A;  3PO7 A;  3NN0 X;  4M52 A;  3EAO A;  1F6M A;  3CPI G;  4PAA A;  4C5O A;  5KVH A;  1ZY8 A;  1E1N A;  4QFD A;  1PBB A;  5LV9 A;  1IJH A;  2VRL A;  4H4X A;  3QVR A;  2XFQ A;  2YG6 A;  1BWC A;  1NHR A;  3NYF A;  4OPG A;  4CNJ A;  3NN6 X;  3VRA A;  1GXF A;  2E5V A;  4KPR A;  4YTM A;  2C3C A;  1BKW A;  4GCM A;  1L9C A;  2YG5 A;  1DJN A;  4BJZ A;  1H81 A;  3GYX A;  1QO8 A;  3G3E A;  3RP7 A;  1OJA A;  4Z2T A;  2GB0 A;  1GRB A;  1IUX A;  3AEA A;  3AE9 A;  3DK9 A;  2BYB A;  3OZ2 A;  3NIX A;  3QJ4 A;  4OVI A;  1PBC A;  4XWZ A;  1QLB A;  1VDC A;  3SFD A;  4EM4 A;  4YSH A;  4D03 A;  1DOB A;  2IVD A;  1D4E A;  1W4X A;  1ZX9 A;  2WBA A;  3KKJ A;  5KRQ A;  2FBW A;  1Q1R A;  3GMB A;  3RHA A;  4I59 A;  3ATQ A;  4EIQ A;  4RG4 A;  4U8K A;  4B65 A;  4O5U A;  1EL8 A;  5U1O A;  3S5W A;  1ZOY A;  2R4J A;  3UTG A;  5JCL A;  2V3A A;  4K5R A;  5J7X A;  2X99 A;  1Q9I A;  1JOA A;  1B8S A;  5M0Z A;  4X9N A;  4YSX A;  1L9E A;  1GND A;  1XHC A;  4YJF A;  1EVI A;  2GVC A;  3CGC A;  3ICT A;  4JDR A;  4II3 A;  3ICS A;  3KPF A;  2WDQ A;  2XVE A;  2NPX A;  2UZZ A;  4IA5 A;  4YJF B;  2E1M A;  3BI5 A;  5FS6 A;  2B76 A;  2BRA A;  1XDI A;  1PN0 A;  3W4K A;  4G73 A;  4HB9 A;  3BNM A;  2GQF A;  2XVI A;  3CNT A;  1E39 A;  3KVE A;  1EBD A;  4A65 A;  3LOV A;  2YR4 A;  2XLP A;  2YVG A;  3CGD A;  1KSU A;  1NDA A;  4Z44 A;  2YLX A;  4Z25 A;  3UTE A;  5BUL A;  4Y4L A;  3K7M X;  4YKF A;  1JNR A;  4B68 A;  3RP8 A;  1D5T A;  2DU8 A;  3B6D A;  3IWA A;  2GAG B;  1UKV G;  2Y6R A;  2VOU A;  4NEW A;  2Q0L A;  2R4E A;  3DJE A;  4EIP A;  4CY6 A;  2E82 A;  4H4V A;  2Q7V A;  1F3P A;  2C64 A;  4TM0 A;  2JB3 A;  3GDN A;  2WES A;  1PJ6 A;  5KNL A;  5KXJ A;  1E6E A;  1IUW A;  4UDQ A;  3VRD B;  3BI4 A;  1GET A;  4EQS A;  4TM3 A;  1PHH A;  3GWD A;  1NHS A;  3NKS A;  1EL9 A;  4NZH A;  1ZMC A;  3SZW A;  2BC0 A;  4FDC B;  1NPX A;  2F5Z A;  3AE6 A;  3ALL A;  3QSE A;  4G74 A;  4LII A;  4EQX A;  1NG4 A;  1VG0 A;  1ZDL A;  3ZNP A;  1IUV A;  3O0H A;  1PXA A;  3SZF A;  1YQZ A;  1FOH A;  4BK2 A;  3AB1 A;  4U2S A;  4LA1 A;  2ZZB A;  3NTD A;  1IUS A;  3FG2 P;  1COY A;  2PHH A;  1N4W A;  1DDO A;  3UCL A;  1CC4 A;  2AR8 A;  3AEB A;  1CC6 A;  4J33 A;  3UP4 A;  2WPC A;  1C0P A;  3ICR A;  1DOC A;  3ZNQ A;  2APG A;  2BK4 A;  2B9X A;  3WE0 A;  1RYI A;  4FK1 A;  3UP5 A;  2WDR A;  2XFO A;  4GR1 A;  1ELI A;  3I6D A;  1PBF A;  4WCT A;  2E4A A;  2Z5X A;  3VR8 A;  1VQW A;  4CCR A;  2XDO A;  1ZMD A;  3VRB A;  4APN A;  4ZCC A;  1KNR A;  1E1M A;  4U8O A;  4ZCD A;  3T0K A;  1CL0 A;  2WS3 A;  4H7U A;  2GMH A;  3ZNN A;  1FEA A;  3ZNO A;  1N4V A;  1LTX R;  2FJD A;  2GV8 A;  2VRM A;  3F8D A;  3L8K A;  4OPL A;  5FS7 A;  5KMQ A;  3QSM A;  1XAN A;  4H2N A;  3RNM A;  1MO9 A;  1BGN A;  1E1L A;  3ALJ A;  3DJG X;  1GRE A;  4IVM B;  4RG3 A;  3AWI A;  2GR0 A;  3NH3 X;  4H2R A;  2OA1 A;  3AEG A;  3CND A;  1XPQ A;  3KLJ A;  4JY2 A;  5FMH A;  3LAD A;  3AD8 B;  2BXS A;  2XVF A;  2Y6Q A;  3BI2 A;  4U2L A;  5TR3 A;  1PXC A;  5HHF A;  5BUK A;  5M10 A;  1CJ4 A;  2VZ2 A;  3DK4 A;  3NT6 A;  2ZZ0 A;  4FK1 C;  4H4Q A;  4IVO B;  4NEV A;  2A87 A;  5GRT A;  4JN9 A;  1E1K A;  4XXG A;  1N4U A;  5EOW A;  1NG3 A;  3T14 A;  1M64 A;  3GD4 A;  2R0C A;  3T37 A;  4WX1 A;  5EBK A;  4YWO A;  2R46 A;  2QA2 A;  1EL5 A;  2WEU A;  3HYW A;  1CJ2 A;  3II4 A;  2C65 A;  2AAQ A;  3AYL A;  4RSL A;  4C3Y A;  4B69 A;  1TYT A;  4OPI A;  3ALM A;  2Q0K A;  4Z2U A;  2B7S A;  2BXR A;  1RP0 A;  2WP9 A;  5HYM A;  4K2X A;  2BAB A;  2DKI A;  3W4I A;  3CPJ G;  2R0G A;  5DBJ A;  2GEW A;  2WOV A;  3M0O A;  1D7Y A;  3T2Z A;  4BK1 A;  1HYU A;  2YLR A;  3C4N A;  2WDV A;  2BK3 A;  3F8R A;  2ACZ A;  2BRY A;  3WGT A;  3GMC A;  4Z43 A;  3ITJ A;  1KDG A;  4NWZ A;  1Y0P A;  5KMP A;  3AYJ A;  3FIM B;  2X3N A;  2C72 A;  3B3R A;  3FBS A;  2XVJ A;  4JY3 A;  4USR A;  1K0L A;  3GYJ A;  4UDR A;  1Y56 A;  1BZL A;  1TDN A;  2YR5 A;  4C3X A;  3CMM A;  5L46 A;  2VQ7 A;  3RP6 A;  1D4D A;  4U8I A;  3VR9 A;  1LVL A;  4ECH A;  2YG7 A;  1S3B A;  1Y56 B;  2GR3 A;  4J57 A;  2EQ9 A;  3P4S A;  4II2 A;  3SFE A;  4B66 A;  2C73 A;  3CNJ A;  4N9X A;  4EMW A;  2JK6 A;  4G6G A;  2B9Y A;  1GTE A;  3UKP A;  1NHP A;  3AE5 A;  3EF6 A;  4Z26 A;  4AP1 A;  2WQY A;  3SY4 A;  2IVE A;  2YG4 A;  1KF6 A;  3CNP A;  2YVF A;  2H89 A;  3R9U A;  1S3E A;  1GRH A;  1KIF A;  1MOK A;  3D1C A;  3GD3 A;  4CBQ A;  2RGH A;  1L9D A;  1F8R A;  3NGC X;  3AD7 B;  2YLZ A;  2YWL A;  4H4P A;  2XFU A;  4MJW A;  1CHU A;  4JQ9 A;  4OPD A;  1AOG A;  4H2Q A;  3CN8 A;  5IQ1 A;  3ABV A;  1X31 B;  2R45 A;  3UKK A;  1DOD A;  4H4Z A;  1B4V A;  1S2Q A;  2C3D A;  4CRT A;  1PBD A;  4Z24 A;  1BF3 A;  1YQ4 A;  4P9S A;  4G9K A;  1M6I A;  4FX9 A;  3BNU A;  3E1T A;  4QFC A;  2XCG A;  4U8M A;  4DNA A;  3NLC A;  2GAH B;  2C67 A;  3P4P A;  5KVI A;  4J2W A;  2XLS A;  3COX A;  3GDP A;  2WP6 A;  3AE7 A;  3UOZ A;  2X8H A;  1DOE A;  4J36 A;  5CQF A;  5IQ4 A;  3P1W A;  5JCM A;  2WET A;  4GDP A;  4BV6 A;  2J3N A;  3LZW A;  4BK3 A;  1DAO A;  3ZYX A;  2C7G A;  3QVP A;  1L0V A;  4EMJ A;  3W4J A;  2Z5Y A;  1CJC A;  1O5W A;  3SXI A;  2YG3 A;  3EPT A;  1LJ1 A;  2EQ6 A;  3UOY A;  3UOV A;  3AYI A;  4BUR A;  2JKC A;  4OPC A;  2EQ7 A;  2YR6 A;  5HXI A;  3M13 A;  3DH9 A;  4K7Z A;  4A7A A;  1GOS A;  4H50 A;  1D7L A;  4YJH A;  1E7P A;  2V5Z A;  3NK2 X;  3DJJ A;  3SZ0 A;  3LJP A;  1NEK A;  2YLT A;  4B64 A;  2VVL G;  4YJD A;  1DJQ A;  1H7X A;  4YJH B;  3AD9 B;  2BCP A;  2YAU A;  4K8D A;  4GDE A;  1PBE A;  4TM4 A;  3C96 A;  2GR1 A;  3CIR A;  3AE3 A;  4C77 A;  2RGJ A;  3NNE A;  4U8J A;  2XLT A;  5BVA A;  1F8W A;  2FJE A;  3H8I A;  3KPK A;  3BHK A;  1V59 A;  3CTY A;  1LQU A;  1IUT A;  1OJ9 A;  4C74 A;  2CFY A;  2GF3 A;  2ZBW A;  4EQR A;  5KOW A;  2GH5 A;  3NHO X;  3AED A;  2CDU A;  3IHG A;  2EQ8 A;  3Q6J A;  3URH A;  2W0H A;  1KSS A;  1CC2 A;  1IUU A;  1Q1W A;  3M12 A;  1DXL A;  1ONF A;  3AE2 A;  3V3N A;  2X8G A;  1YKJ A;  5KMS A;  1H83 A;  3ISH A;  3F8P A;  4AOS A;  1C0I A;  3D8X A;  4B67 A;  1GT8 A;  3T2K A;  4CY8 A;  3LB8 A;  4ICY A;  2BCG G;  2C4C A;  2JB2 A;  1TDO A;  1TDK A;  4GUV A;  4AT2 A;  4IA6 A;  2FJA A;  1DNC A;  2YM1 A;  1OJT A;  2QAE A;  1LV0 A;  3DA1 A;  2YLW A;  4NNJ A;  1PJ5 A;  2R0P A;  4Y4N A;  2WHD A;  2JBV A;  4EQW A;  2BAC A;  5FS8 A;  4A79 A;  4H4S A;  2Q6U A;  1TRB A;  1JRY A;  1JRZ A;  2I0Z A;  3SQP A;  1ZK7 A;  4I58 A;  4X4J A;  1D4C A;  2BS3 A;  3GWF A;  1RSG A;  1SEZ A;  1CF3 A;  4NTD A;  4B63 A;  2B7R A;  1GRA A;  1NAA A;  1YY5 A;  1Z6L A;  2V60 A;  4H4U A;  3CPH G;  2BC1 A;  2ZZC A;  4UP3 A;  3BHF A;  1F8S A;  4YXD A;  1FL2 A;  3DME A;  1KNP A;  2VVM A;  1VG9 A;  4U2T A;  1FEC A;  2V6O A;  5ER0 A;  2WOI A;  4JNQ A;  1REO A;  4REK A;  2CVJ A;  2BS4 A;  4YTP A;  3SM8 A;  1GAL A;  1GSN A;  1H82 A;  2TPR A;  3NRN A;  3G5S A;  3SX6 A;  3CGE A;  2OLN A;  3V76 A;  5JCI A;  3H8L A;  3HYV A;  2R9Z A;  1GEU A;  2JB1 A;  3SYI A;  3NYC A;  1ZOV A;  3DJD A;  2C66 A;  5C3J A;  1GPE A;  2YLS A;  1P2H A;  3NK0 X;  3IF9 A;  3P4R A;  4GAV A;  1ZP0 A;  4OPU A;  5KWF A;  2YVJ A;  3AE8 A;  3AE1 A;  3L1R A;  2C75 A;  1VRQ B;  4AT0 A;  1EL7 A;  1K4Q A;  2AQJ A;  4HA6 A;  5J60 A;  4PAB A;  1PJ7 A;  3I3L A;  2XLR A;  1LPF A;  3IHM A;  3AE4 A;  5JCK A;  2B9W A;  1H6V A;  3IC9 A;  1N1P A;  3NK1 X;  3DGH A;  3GRS A;  3GRT A;  1CJ3 A;  3PS9 A;  1YQ3 A;  2V61 A;  1MXT A;  2NVK X;  4CCQ A;  5GSN A;  2XFN A;  1BGJ A;  2YQU A;  4YTN A;  1ZKQ A;  5EB5 A;  3UTF A;  1OJD A;  2TMD A;  3KD9 A;  1JNZ A;  4DSG A;  1OJC A;  4AOX A;  4GAP A;  2HQM A;  2E48 A;  1GES A;  1H84 A;  2V3B A;  3G5Q A;  4OCG A;  2WU2 A;  1VE9 A;  2X8C A;  3AEC A;  3AEE A;  2BA9 A;  4H4Y A;  3HZL A;  3T31 A;  1GRT A;  2WOW A;  2WP5 A;  2XLU A;  3LXD A;  4JNA A;  3NYE A;  4GF7 A;  4H4R A;  5HY5 A;  1O95 A;  4EMI A;  3UOX A;  4D04 A;  3KA7 A;  4YJG A;  4K5S A;  5U63 A;  4Z2R A;  3CUK A;  2E4G A;  1H7W A;  1AN9 A;  5U25 A;  1NEN A;  2FJB A;  2GR2 A;  2WU5 A;  3AEF A;  4USQ A;  3DGZ A;  2C70 A;  4YJG B;  3P9U A;  4NTE A;  2X50 A;  3SZC A;  2A8X A;  3P4Q A;  4H4T A;  4OPT A;  4ZN0 A;  2A89 A;  2OLO A;  2E49 A;  2XYO A;  3K7Q X;  2BK5 A;  3NG7 X;  1GRG A;  1LQT A;  3UKL A;  3QFA A;  1FCD A;  5CKU A;  4E0V A;  4YT0 A;  4A99 A;  4G6H A;  4DSH A;  1JU2 A;  2PYX A;  4YSZ A;  1PS9 A;  3RED A;  3HYX A;  4TM1 A;  1C0K A;  1GTH A;  4J34 A;  3JSK A;  2OAL A;  3DK8 A;  3UKA A;  2O9Z A;  1GER A;  3K7T A;  4NTC A;  3T2Y A;  4A5L A;  4J56 A;  4BJY A;  2GQW A;  1PDH A;  2XVH A;  3NTA A;  1QJD A;  4KX6 A;  4EM3 A;  5IPY A;  2GMJ A;  3UTH A;  3CNS A;  4LU6 A;  5JCN A;  2YM2 A;  2CUL A;  3FMW A;  3FPZ A;  2BS2 A;  1KFY A;  2VVL A;  4TLZ A;  1H86 A;  3UKF A;  1B37 A;  3EAN A;  5KOX A;  4X9M A;  2JAE A;  2QA1 A;  3PVC A;  3GYI A;  3SGL A;  3ADA B;  2H88 A;  2WPE A;  1GRF A;  1JEH A;  1GV4 A;  2IID A;  2QCU A;  1K0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...