3SM8A

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with an (n5) flavin adduct
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FAD-dependent catabolic D-arginine dehydrogenase, DauA
publication title Atomic-resolution structure of an N5 flavin adduct in D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 118
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2011-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3sm8A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3sm8A01
4EM3A 4YXDA 2YVGA 5IQ4A 4XXGA 4B66A 4H4TA 1E7PA 2GR0A 3AD9B 2BK3A 4YSHA 2GR1A 3P9UA 3ALLA 2YM1A 1CC6A 3UTGA 2BXSA 3GD4A 2YLWA 2R0CA 1GT8A 1PHHA 3C4NA 3SM8A 4K5SA 5U25A 3VRBA 1SEZA 2DKHA 3DH9A 4JN9A 1JEHA 3D1CA 1GV4A 2YG4A 1JOAA 2YLTA 2WOVA 1LV0A 3QVRA 4Z2TA 3CN8A 1ZOVA 3VR9A 1GALA 2JB1A 2TMDA 5JCLA 1Y56A 1GERA 4LA1A 1JRYA 4CY6A 1RSGA 3ISHA 1M6IA 5J60A 2XLUA 3EANA 5GRTA 3B3RA 4K2XA 2EQ7A 2I0ZA 4USQA 1TDFA 3NLCA 3BI5A 3S5WA 1NENA 4TM3A 1YQ4A 1PBBA 2XLRA 1NHQA 2B76A 3P4SA 4B64A 2IIDA 4U8OA 2WESA 2XFPA 3LADA 4GUVA 3W4IA 2WU5A 1C0LA 1EL7A 4AP3A 4JNQA 4EIQA 3DJDA 2W0HA 3NK0X 3ICSA 2WHDA 1IJHA 2Q7VA 3NNEA 3AE1A 3VRAA 3NYEA 5KOXA 1H83A 3AE4A 3B6DA 1X31B 3P1WA 4TM1A 1D4DA 3FBSA 5EB4A 2Y6QA 2FBWA 4A7AA 5LV9A 1EBDA 1DNCA 1REOA 2A89A 1PBEA 1TDNA 5EOWA 5HYMA 1GPEA 3ABVA 3AECA 2Q0KA 3RHAA 2GVCA 3QFBA 2GF3A 2WETA 2VVLA 2BCPA 2C70A 3UOXA 4Y4MA 3DJEA 3G5RA 5IPYA 3LXDA 4U8LA 3JSKA 3NGCX 4GF7A 4GDEA 2A87A 2GQWA 2UZZA 3AEEA 3DK8A 1N4UA 3M13A 1FEBA 3AEAA 4YJDA 1TYPA 2JBVA 4EMIA 1D7YA 1CC2A 3C4AA 4J2WA 4YSZA 1ZMDA 4D04A 3E1TA 3CGDA 4WCTA 3L8KA 3ZNPA 4JY3A 4C3YA 2YM2A 3D8XA 3SGLA 4K5RA 4OPGA 3F8RA 2R46A 1V59A 5KVHA 1QJDA 2WDRA 2XYOA 4AP1A 1PN0A 3UKHA 4YT0A 2XFNA 1CJ4A 2JB2A 4J34A 1PXBA 2YR4A 3V3NA 5HXIA 4YJHA 1TRBA 4KPRA 2VRMA 3H8LA 1NHRA 1F8WA 1LPFA 3UP5A 1Q1RA 2JB3A 3NTDA 2Q6UA 4QFDA 2BYBA 4ICYA 3ICTA 3VRDB 1N1PA 3SQPA 1GRBA 2F5ZA 5U1OA 5C2TA 2V3AA 3NKSA 3Q6JA 1F8RA 1C0KA 2RGHA 4FK1A 4NTCA 1KNRA 4LIIA 4H50A 2GRTA 4P9SA 2RGOA 3GWFA 4TM0A 4YJFA 4APNA 1GESA 1IUUA 4H4VA 3AE2A 1E39A 1OJDA 3P4QA 4YKGA 1IUXA 3RP6A 2YQUA 2GR3A 3AD8B 2BC0A 1C0PA 5IQ1A 4YSYA 3NIXA 5C3JA 4NEVA 4Z44A 4EQXA 5FS6A 3RP7A 3F8PA 2YVJA 2DKIA 2YG3A 4N9XA 4Y4LA 3V3OA 3ZNNA 2XDOA 2QCUA 1H6VA 4H4PA 4K8DA 1LVLA 3CNPA 1N4VA 3ZNOA 4NZHA 2E1MA 2IVEA 1KFYA 2C64A 1FCDA 4DNAA 2TPRA 3KLJA 2GMHA 2GQFA 2R4EA 1PJ5A 3NT6A 2CULA 3AEGA 2E5VA 1ONFA 2QA1A 4YJHB 1ZOYA 2WDVA 2WDQA 2BS2A 1K4QA 3FG2P 3K7MX 3NN6X 2C3DA 4HA6A 4OPTA 4CBQA 1KSUA 4Z43A 2ZBWA 1DJNA 2XVFA 3QSSA 1H81A 4IA6A 2C3CA 2YG5A 2J3NA 4OPLA 1VG9A 3OC4A 3CNDA 3RNMA 4CNKA 3QSEA 3DK4A 2V61A 1PJ7A 1S3BA 2B9WA 3ALJA 4U8MA 2XCGA 3AE3A 3LZWA 4J56A 1P2HA 2R0GA 2XFQA 1NPXA 3NHOX 2B9XA 3BHKA 2HQMA 2B7RA 5EBKA 2CVJA 2X3NA 1N4WA 1TYTA 4J33A 3R9UA 3K30A 2R9ZA 1KF6A 4AOSA 4NTDA 1BGNA 4D03A 2BXRA 1KIFA 4A5LA 2YLSA 2WPFA 4K22A 1L0VA 4OPCA 2EQ9A 1GSNA 3FPZA 5KVIA 2X8GA 4OPUA 4A6NB 3QVPA 2AR8A 3II4A 4H4QA 5JCKA 1B4VA 2OALA 3CPJG 2AQJA 1GTHA 3CUKA 3ZYXA 2FJDA 1O5WA 1YY5A 3CPIG 2R4JA 2YVFA 4H4RA 5HHFA 1ZP0A 3L1RA 4O5QA 3RP8A 4YJGA 3AEFA 1ZDLA 2JAEA 2XVHA 3VR8A 1H7WA 4XWRA 2PHHA 2WP9A 1IUVA 1DDOA 3K7TA 4AT2A 4H4XA 2GV8A 2O9ZA 1O95A 1BKWA 2FJBA 2IVDA 3M12A 4GCMA 1E1NA 1KNPA 3C96A 4BJZA 3UTFA 2E49A 1M64A 1RP0A 4JDRA 1GRGA 1ZMCA 4U8JA 2Z5YA 3Q9TA 4CNJA 3EF6A 4RG4A 4TM4A 4H2PA 1MO9A 1GETA 3GMBA 5JCMA 1Q9IA 2VVLG 3GRSA 1Z6LA 1TDOA 1FL2A 3GRTA 1IUWA 3AWIA 3DK9A 4E0VA 5BVAA 1VQWA 3GDNA 1GRAA 2C73A 3UKPA 5FS9A 4H4YA 4EQRA 2V3BA 1GRHA 2WEUA 2E82A 1E1MA 4FK1C 3S61A 3COXA 1Y56B 1BGJA 2Q0LA 3DGZA 1BWCA 2BA9A 3KKJA 2B7SA 1B5QA 3I6DA 1GRFA 1PDHA 5L46A 4H7UA 4BURA 1GREA 1PJ6A 4BJYA 2X8CA 1KSSA 3NYFA 4FX9A 1JU2A 3GYJA 5JCNA 5FS7A 2H88A 4H4ZA 2C66A 1E1LA 1H7XA 2JKCA 3GWDA 5BULA 1D4CA 1PBCA 2C75A 2RABA 3AE7A 4LU6A 4A9WA 1YQZA 4A99A 1CBOA 5GSNA 3AXBA 5U63A 3ATQA 3UKKA 1MOKA 1NG3A 3DMEA 3IF9A 1PS9A 3H8IA 4RG3A 3UKQA 4B63A 1VG0A 2XFOA 2VOUA 4EIPA 3M0OA 2GAGB 5KXJA 3BHFA 1COYA 2C67A 2E4AA 1BZLA 1K0LA 3AEDA 4PAAA 1VDCA 3GDPA 4J31A 4REKA 1B37A 1NEKA 5FS8A 3ZDNA 4X4JA 3LOVA 4B1BA 1MXTA 2ACZA 3QFAA 2GMJA 1ZX9A 4OCGA 3UKFA 3W4KA 3K7QX 2BS3A 2Y6RA 5CKUA 3AEBA 1ELIA 4DSGA 4ECHA 3OZ2A 2C65A 3ITJA 1JRZA 2VVMA 4Z26A 3GMCA 3PVCA 1DXLA 2V60A 1F6MA 4JQ9A 1EL9A 1NHSA 3CNSA 4FDCB 4C74A 2NPXA 1S3EA 2BC1A 3KVEA 3NRNA 1F3PA 2B9YA 3LJPA 5CQFA 4EQWA 4GRTA 3UP4A 1NG4A 5KWFA 4OPIA 2WPCA 1W4XA 1ZK7A 2EQ6A 2X8HA 2YR6A 2BCGG 3CGCA 5DBJA 1GXFA 1CJCA 1JRXA 2JK6A 4GDPA 4TLXA 3P4RA 3UOYA 3UTEA 4H4SA 2YR5A 1XANA 2WOIA 3AE9A 4X9NA 1RYIA 3AE6A 4OVIA 4TLZA 1S2YA 4J57A 4A65A 4A79A 4Z25A 3NYCA 2NVKX 4KX6A 4UDPA 4WX1A 5KOWA 1DJQA 1F8SA 4B67A 4RSLA 2E48A 2XVIA 1CJ2A 3AE8A 3FMWA 4YKFA 4Z24A 5HY5A 3GYIA 1D7LA 3CGBA 4YJFB 3NTAA 4M52A 2WU2A 4IV9A 4U2SA 2GR2A 1UKVG 4XWZA 1O94A 4B68A 4CRTA 4ZN0A 2PYXA 1KDGA 4YTNA 3ADAB 1K0IA 1EL8A 3BNUA 1DAOA 2OLOA 2RGJA 3AYLA 3UKLA 2VQBA 2ZZ0A 1FEAA 2C72A 2A8XA 3CNJA 1IUTA 1OJAA 2FJAA 2R45A 2H89A 2R0PA 3KU9A 3AYIA 1QLBA 1IUSA 4EMJA 1PXCA 1GEUA 2GEWA 4JY2A 4H4WA 4Z2RA 4EM4A 4IVMB 1FOHA 1NHPA 1AOGA 1CHUA 3PO7A 3URHA 1C0IA 2WP6A 1LJ1A 1FECA 1NDAA 4IA5A 4AOXA 3NK1X 3H4KA 2BABA 2EQ8A 3DA1A 3BI2A 1GTEA 2WOWA 3UCLA 1JNZA 4I59A 4H2QA 4O5UA 4C5OA 2XVEA 2VZ2A 2DU8A 2GAHB 4BK3A 1OJ9A 2VRLA 4J36A 3VQRA 3WGTA 2CDUA 3CPHG 2YWLA 3I3LA 1L9EA 3QSMA 3NN0X 2XLSA 2C7GA 1VE9A 5FMHA 1B8SA 5M10A 1LQUA 1GOSA 2FJEA 3G5QA 2X99A 3SFDA 1VRQB 4ZCCA 3QJ4A 3IHGA 4BK1A 4IVOB 3DGHA 1QO8A 1AN9A 1Y0PA 1YKJA 1NAAA 2V5ZA 2XLTA 4HB9A 3T37A 4B65A 1XPQA 2C76A 2BK4A 3UKAA 1LQTA 1XDIA 2E4GA 3AB1A 3EAOA 4MJWA 3G3EA 1E6EA 2YG6A 4UP3A 3KA7A 1GRTA 4U8KA 3KD9A 4BV6A 5KRQA 3IWAA 4CY8A 3P4PA 1ZY8A 3CGEA 4C77A 2BS4A 1PBFA 1HYUA 2WPEA 2WS3A 4UDQA 5BRTA 4H4UA 1ZKQA 3ATRA 3LB8A 1E1KA 1DODA 5EB5A 4U8IA 1XHCA 1K0JA 3HZLA 3NG7X 4Z2UA 5BUKA 3AYJA 2YAUA 3NK2X 1CL0A 2XVJA 1H84A 4YJGB 2OAMA 4YTMA 4PABA 3IHMA 3NH3X 3KPFA 1H86A 1LTXR 3CNTA 3BNMA 1H82A 4X9MA 3ZNQA 1YQ3A 4ZCDA 4I58A 4DGKA 3REDA 5ER0A 2V6OA 1TDKA 4QFCA 2YG7A 5J7XA 3UTHA 1S2QA 4CCRA 3V76A 3DJGX 2OLNA 1BF3A 4Y4NA 3ICRA 3BI4A 3IC9A 2XFUA 4H2RA 4U2TA 1JNRA 3O0HA 4U8PA 4YWOA 4EQSA 2ARDA 2OA1A 5JCIA 2XLPA 3AE5A 3WE0A 4EMWA 1OJTA 1L9CA 4UDRA 1DOEA 2APGA 4GR1A 2Z5XA 2VQ7A 2WP5A 2WQYA 4YSXA 2QAEA 2YLRA 3UOVA 3GD3A 3FIMB 4OPDA 1DOBA 1DOCA 3AD7B 3GSIA 1Q1WA 2X50A 1CF3A 4U2LA 4U8NA 4ADWA 2CFYA 4BK2A 1OJCA 1D5TA 3ALMA 4NEWA 2GH5A 3F8DA 3G5SA 4H2NA 2YLXA 3CIRA 4USRA 4CCQA 1D4EA 3EPTA 4JNAA 2WBAA 4NTEA 3SFEA 1PBDA 4DSHA 4C3XA 3DJJA 2ZZBA 4A6NA 2GB0A 2BK5A 1L9DA 1GNDA 3PS9A 2YLZA 4K7ZA 3CTYA 2QA2A 3LZXA 2BACA 1P2EA 1EL5A 1TDEA 2ZZCA 1EVIA 5TR3A 1PXAA 1CJ3A 5M0ZA 4B69A 1CC4A 3W4JA 3UOZA 4AT0A 2AAQA 4YTPA
chains in the Genus database with same CATH superfamily
4EM3A 4YXDA 2YVGA 5IQ4A 4XXGA 4B66A 4H4TA 1E7PA 2GR0A 3AD9B 2BK3A 4YSHA 2GR1A 3P9UA 3ALLA 2YM1A 1CC6A 3UTGA 2BXSA 3GD4A 2YLWA 2R0CA 1GT8A 1PHHA 3C4NA 3SM8A 4K5SA 5U25A 3VRBA 2DKHA 1SEZA 3DH9A 4JN9A 1JEHA 3D1CA 1GV4A 2YG4A 1JOAA 2YLTA 2WOVA 1LV0A 3QVRA 4Z2TA 3CN8A 1ZOVA 4GAVA 3VR9A 1GALA 2JB1A 2TMDA 5JCLA 1Y56A 1GERA 4LA1A 1JRYA 4CY6A 1RSGA 3ISHA 1M6IA 4NNJA 5J60A 2XLUA 3T0KA 3EANA 5GRTA 3B3RA 4K2XA 2EQ7A 2I0ZA 4USQA 1TDFA 3NLCA 3BI5A 3S5WA 1NENA 4TM3A 1YQ4A 2BRAA 1PBBA 2XLRA 1NHQA 2B76A 3P4SA 4B64A 2IIDA 4U8OA 2WESA 2XFPA 3LADA 4GUVA 3W4IA 2WU5A 1C0LA 1EL7A 4AP3A 4JNQA 4EIQA 3DJDA 2W0HA 3NK0X 3ICSA 2WHDA 1IJHA 2Q7VA 3NNEA 3AE1A 4GAPA 3VRAA 3NYEA 5KOXA 1H83A 3AE4A 3B6DA 1X31B 3P1WA 4TM1A 1D4DA 3FBSA 5EB4A 2Y6QA 2FBWA 4A7AA 5LV9A 1EBDA 1DNCA 1REOA 2A89A 1PBEA 5HYMA 1TDNA 5EOWA 1GPEA 3ABVA 3AECA 2Q0KA 3RHAA 2GVCA 3QFBA 2GF3A 2WETA 2VVLA 2BCPA 2C70A 3UOXA 4Y4MA 3DJEA 3G5RA 5IPYA 3LXDA 4U8LA 3JSKA 3NGCX 4GF7A 4GDEA 5KNLA 2A87A 3SX6A 2GQWA 2UZZA 3AEEA 3DK8A 1N4UA 3M13A 1FEBA 3AEAA 4YJDA 1TYPA 2JBVA 4EMIA 1D7YA 1CC2A 3C4AA 4J2WA 4YSZA 1ZMDA 4D04A 3E1TA 3CGDA 4WCTA 3L8KA 3ZNPA 4JY3A 4C3YA 2YM2A 3D8XA 3SGLA 4K5RA 4OPGA 3SXIA 3SZFA 3F8RA 2R46A 1V59A 5KMPA 5KVHA 1QJDA 2WDRA 2XYOA 4AP1A 1PN0A 3UKHA 4YT0A 2XFNA 1CJ4A 2JB2A 4J34A 1PXBA 2YR4A 3V3NA 5HXIA 4YJHA 1TRBA 4KPRA 2VRMA 3H8LA 1NHRA 1F8WA 1LPFA 3UP5A 1Q1RA 2JB3A 3NTDA 2Q6UA 4QFDA 2BYBA 4ICYA 3ICTA 3VRDB 1N1PA 3SQPA 1GRBA 2F5ZA 5U1OA 4II2A 5C2TA 2V3AA 3NKSA 3Q6JA 1F8RA 1C0KA 2RGHA 4FK1A 4NTCA 1KNRA 4LIIA 4H50A 2GRTA 4P9SA 2RGOA 3GWFA 4TM0A 4YJFA 4APNA 1GESA 1IUUA 4H4VA 3AE2A 1E39A 1OJDA 3P4QA 4YKGA 1IUXA 3RP6A 2YQUA 2GR3A 3AD8B 2BC0A 1C0PA 5IQ1A 4YSYA 3NIXA 3SZ0A 5C3JA 4NEVA 4Z44A 4EQXA 3RP7A 5FS6A 3SZWA 3F8PA 2YVJA 2DKIA 2YG3A 4N9XA 4Y4LA 3V3OA 3HYVA 3ZNNA 2XDOA 2QCUA 1H6VA 4H4PA 4K8DA 1LVLA 3CNPA 1N4VA 3ZNOA 4NZHA 2E1MA 2IVEA 4G6HA 1KFYA 2C64A 1FCDA 4DNAA 2TPRA 3KLJA 2GMHA 2GQFA 2R4EA 1PJ5A 3NT6A 2CULA 3AEGA 2E5VA 1ONFA 2QA1A 4YJHB 1ZOYA 2WDVA 2WDQA 2BS2A 1K4QA 3FG2P 3K7MX 3NN6X 2C3DA 4HA6A 4OPTA 4CBQA 1KSUA 4Z43A 2ZBWA 1DJNA 4IA6A 3QSSA 1H81A 2XVFA 2C3CA 2YG5A 2J3NA 4OPLA 1VG9A 3OC4A 3CNDA 3RNMA 4CNKA 3QSEA 5KMQA 3DK4A 2V61A 1PJ7A 1S3BA 2B9WA 3ALJA 4U8MA 2XCGA 3AE3A 3LZWA 4J56A 1P2HA 2R0GA 2XFQA 1NPXA 3NHOX 2B9XA 3BHKA 2HQMA 2B7RA 5EBKA 3T2YA 2CVJA 2X3NA 1N4WA 1TYTA 4J33A 3R9UA 3K30A 2R9ZA 1KF6A 4AOSA 4NTDA 1BGNA 4D03A 2BXRA 1KIFA 4A5LA 2YLSA 4K22A 2WPFA 1L0VA 4OPCA 2EQ9A 1GSNA 3FPZA 4NWZA 5KVIA 2X8GA 4OPUA 4A6NB 3QVPA 2AR8A 3GYXA 3II4A 4H4QA 5JCKA 1B4VA 2OALA 3CPJG 2AQJA 1GTHA 3CUKA 3ZYXA 4G74A 2FJDA 1O5WA 1YY5A 3CPIG 2R4JA 2YVFA 4H4RA 5HHFA 1ZP0A 3L1RA 4O5QA 3RP8A 4YJGA 3AEFA 1ZDLA 2JAEA 2XVHA 3VR8A 1H7WA 4XWRA 2PHHA 2WP9A 1IUVA 1DDOA 3K7TA 4AT2A 3T2ZA 4H4XA 2GV8A 2O9ZA 1O95A 1BKWA 2FJBA 2IVDA 3M12A 4GCMA 3C96A 1E1NA 1KNPA 4BJZA 3UTFA 2E49A 1M64A 1RP0A 4JDRA 1GRGA 1ZMCA 4U8JA 2Z5YA 3Q9TA 4CNJA 3EF6A 4RG4A 4TM4A 4H2PA 1MO9A 3GMBA 1GETA 5JCMA 1Q9IA 2VVLG 3GRSA 1Z6LA 1TDOA 1FL2A 3GRTA 1IUWA 3AWIA 3DK9A 4E0VA 5BVAA 1VQWA 3GDNA 1GRAA 2C73A 3UKPA 5FS9A 4H4YA 4EQRA 2V3BA 1GRHA 2WEUA 2E82A 1E1MA 2C4CA 4FK1C 3COXA 3S61A 1Y56B 5KMSA 1BGJA 2Q0LA 3DGZA 1BWCA 2BA9A 3KKJA 2B7SA 1B5QA 3I6DA 1GRFA 1PDHA 5L46A 4H7UA 3SY4A 4BURA 1GREA 1PJ6A 4BJYA 2X8CA 1KSSA 3NYFA 4FX9A 1JU2A 3GYJA 5JCNA 5FS7A 2H88A 4H4ZA 2C66A 1E1LA 1H7XA 2JKCA 3GWDA 5BULA 1D4CA 1PBCA 2C75A 2RABA 3AE7A 3KPKA 4LU6A 4A9WA 1YQZA 4A99A 1CBOA 5GSNA 3AXBA 5U63A 3ATQA 3UKKA 1MOKA 1NG3A 3DMEA 3IF9A 1PS9A 3H8IA 4RG3A 3UKQA 4B63A 1VG0A 2XFOA 2VOUA 4EIPA 3M0OA 2GAGB 5KXJA 3BHFA 1COYA 2C67A 2E4AA 1BZLA 1K0LA 3AEDA 4PAAA 1VDCA 3GDPA 4G73A 4J31A 4REKA 3T2KA 1B37A 1NEKA 5FS8A 3ZDNA 4X4JA 3LOVA 4B1BA 1MXTA 2ACZA 3QFAA 2GMJA 1ZX9A 4OCGA 3UKFA 3W4KA 3K7QX 2BS3A 2Y6RA 5CKUA 3AEBA 1ELIA 4II3A 4DSGA 3OZ2A 2C65A 3ITJA 1JRZA 4ECHA 2VVMA 4Z26A 3GMCA 3PVCA 1DXLA 2V60A 1F6MA 4JQ9A 1EL9A 1NHSA 3HYXA 3CNSA 4FDCB 4C74A 2NPXA 4G6GA 1S3EA 2BC1A 3KVEA 3NRNA 1F3PA 2B9YA 3LJPA 5CQFA 4EQWA 4GRTA 3UP4A 1NG4A 5KWFA 4OPIA 2WPCA 1W4XA 4G9KA 1ZK7A 2EQ6A 2X8HA 2YR6A 2BCGG 3CGCA 5DBJA 1GXFA 1CJCA 1JRXA 2JK6A 4GDPA 4TLXA 3P4RA 3UOYA 3UTEA 4H4SA 2YR5A 1XANA 2WOIA 3SZCA 3AE9A 5KMRA 4X9NA 1RYIA 3AE6A 4OVIA 4TLZA 1S2YA 4J57A 4A65A 4A79A 4Z25A 3NYCA 2NVKX 4KX6A 4UDPA 4WX1A 5KOWA 1DJQA 1F8SA 4B67A 4RSLA 2E48A 2XVIA 1CJ2A 3AE8A 3FMWA 4YKFA 4Z24A 5HY5A 3GYIA 1D7LA 3CGBA 4YJFB 3NTAA 4M52A 2WU2A 4IV9A 4U2SA 2GR2A 1UKVG 4XWZA 1O94A 4B68A 4CRTA 4ZN0A 2PYXA 1KDGA 4YTNA 3ADAB 1K0IA 1EL8A 3BNUA 2BRYA 1DAOA 2OLOA 2RGJA 3AYLA 3T14A 3UKLA 2VQBA 2ZZ0A 1FEAA 2C72A 2A8XA 3CNJA 1IUTA 1OJAA 2FJAA 2R45A 2R0PA 2H89A 3KU9A 3AYIA 1QLBA 1IUSA 4EMJA 1PXCA 4JY2A 1GEUA 2GEWA 4H4WA 4Z2RA 4EM4A 4IVMB 1FOHA 1NHPA 1AOGA 1CHUA 3PO7A 3URHA 1C0IA 2WP6A 1LJ1A 1FECA 1NDAA 4IA5A 4AOXA 3NK1X 3H4KA 2BABA 2EQ8A 3DA1A 3BI2A 1GTEA 2WOWA 3UCLA 1JNZA 4I59A 4H2QA 4O5UA 4C5OA 2XVEA 4BK3A 2DU8A 2GAHB 2VZ2A 1OJ9A 2VRLA 4J36A 3VQRA 3WGTA 2CDUA 3CPHG 2YWLA 3I3LA 1L9EA 3QSMA 3NN0X 2XLSA 2C7GA 1VE9A 5FMHA 1B8SA 5M10A 1LQUA 1GOSA 2FJEA 3G5QA 2X99A 3SFDA 1VRQB 4ZCCA 3QJ4A 3IHGA 3CMMA 4BK1A 4IVOB 3DGHA 1QO8A 1AN9A 1Y0PA 1YKJA 1NAAA 2V5ZA 2XLTA 4HB9A 3T37A 4B65A 1XPQA 2C76A 2BK4A 3UKAA 1LQTA 1XDIA 2E4GA 3AB1A 3EAOA 4MJWA 3G3EA 1E6EA 2YG6A 4UP3A 3KA7A 1GRTA 4U8KA 3KD9A 3T31A 4BV6A 5KRQA 3IWAA 4CY8A 3P4PA 1ZY8A 3CGEA 4C77A 2BS4A 1PBFA 1HYUA 2WPEA 2WS3A 4UDQA 5BRTA 4H4UA 1ZKQA 3ATRA 3LB8A 1E1KA 1DODA 5EB5A 4U8IA 1XHCA 1K0JA 3HZLA 3NG7X 4Z2UA 5BUKA 3AYJA 2YAUA 3NK2X 1CL0A 2XVJA 1H84A 4YJGB 2OAMA 4YTMA 3IHMA 4PABA 3NH3X 3KPFA 1H86A 1LTXR 3CNTA 3BNMA 1H82A 4X9MA 3ZNQA 1YQ3A 4ZCDA 3SYIA 4I58A 4DGKA 3REDA 5ER0A 2V6OA 1TDKA 4QFCA 2YG7A 5J7XA 3UTHA 1S2QA 4CCRA 3V76A 3DJGX 2OLNA 1BF3A 4Y4NA 3ICRA 3BI4A 4H2RA 2XFUA 3IC9A 4U2TA 1JNRA 3O0HA 4U8PA 4YWOA 4EQSA 2ARDA 2OA1A 5JCIA 2XLPA 3AE5A 3WE0A 4EMWA 1OJTA 1L9CA 4UDRA 1DOEA 2APGA 4GR1A 2Z5XA 2VQ7A 2WP5A 2WQYA 4YSXA 2QAEA 2YLRA 3UOVA 3GD3A 3FIMB 4OPDA 1DOBA 1DOCA 3AD7B 3GSIA 1Q1WA 2X50A 4BK2A 1CF3A 4U2LA 4U8NA 2CFYA 4ADWA 1OJCA 1D5TA 3ALMA 4NEWA 2GH5A 3F8DA 3G5SA 4H2NA 2YLXA 3CIRA 4USRA 4CCQA 1D4EA 3EPTA 4JNAA 2WBAA 4NTEA 3SFEA 1PBDA 4DSHA 4C3XA 3DJJA 2ZZBA 4A6NA 2GB0A 2BK5A 1L9DA 1GNDA 3PS9A 2YLZA 4K7ZA 3CTYA 2QA2A 3LZXA 2BACA 1P2EA 1EL5A 1TDEA 2ZZCA 3HYWA 1EVIA 5TR3A 1PXAA 1CJ3A 5M0ZA 4B69A 1CC4A 3W4JA 3UOZA 4AT0A 2AAQA 4YTPA
chains in the Genus database with same CATH topology
4EM3A 4YXDA 2YVGA 5IQ4A 4XXGA 4B66A 4H4TA 1E7PA 2GR0A 3AD9B 2BK3A 4YSHA 2GR1A 3P9UA 3ALLA 2YM1A 1CC6A 3UTGA 2BXSA 3GD4A 2YLWA 2R0CA 1GT8A 1PHHA 3C4NA 3SM8A 4K5SA 5U25A 3VRBA 1SEZA 2DKHA 3DH9A 4JN9A 1JEHA 3D1CA 1GV4A 2YG4A 1JOAA 2YLTA 2WOVA 1LV0A 3QVRA 4Z2TA 3CN8A 1ZOVA 4GAVA 3VR9A 1GALA 2JB1A 2TMDA 5JCLA 1Y56A 1GERA 4LA1A 1JRYA 4CY6A 1RSGA 3ISHA 1M6IA 4NNJA 5J60A 2XLUA 3T0KA 3EANA 5GRTA 3B3RA 4K2XA 2EQ7A 2I0ZA 4USQA 1TDFA 3NLCA 3BI5A 3S5WA 1NENA 4TM3A 1YQ4A 2BRAA 1PBBA 2XLRA 1NHQA 2B76A 3P4SA 4B64A 2IIDA 4U8OA 2WESA 2XFPA 3LADA 4GUVA 3W4IA 2WU5A 1C0LA 1EL7A 4AP3A 4JNQA 4EIQA 3DJDA 2W0HA 3NK0X 3ICSA 2WHDA 1IJHA 2Q7VA 3NNEA 3AE1A 4GAPA 3VRAA 3NYEA 5KOXA 1H83A 3AE4A 3B6DA 1X31B 3P1WA 4TM1A 1D4DA 3FBSA 5EB4A 2Y6QA 2FBWA 4A7AA 5LV9A 1EBDA 1DNCA 1REOA 2A89A 1PBEA 1TDNA 5EOWA 5HYMA 1GPEA 3ABVA 3AECA 2Q0KA 3RHAA 2GVCA 3QFBA 2GF3A 2WETA 2VVLA 2BCPA 2C70A 3UOXA 4Y4MA 3DJEA 3G5RA 5IPYA 3LXDA 4U8LA 3JSKA 3NGCX 4GF7A 4GDEA 5KNLA 2A87A 3SX6A 2GQWA 2UZZA 3AEEA 3DK8A 1N4UA 3M13A 1FEBA 3AEAA 4YJDA 1TYPA 2JBVA 4EMIA 1D7YA 1CC2A 3C4AA 4J2WA 4YSZA 1ZMDA 4D04A 3E1TA 3CGDA 4WCTA 3L8KA 3ZNPA 4JY3A 4C3YA 2YM2A 3D8XA 3SGLA 4K5RA 4OPGA 3SXIA 3SZFA 3F8RA 2R46A 1V59A 5KMPA 5KVHA 1QJDA 2WDRA 2XYOA 4AP1A 1PN0A 3UKHA 4YT0A 2XFNA 1CJ4A 2JB2A 4J34A 1PXBA 2YR4A 3V3NA 5HXIA 4YJHA 1TRBA 4KPRA 2VRMA 3H8LA 1NHRA 1F8WA 1LPFA 3UP5A 1Q1RA 2JB3A 3NTDA 2Q6UA 4QFDA 2BYBA 4ICYA 3ICTA 3VRDB 1N1PA 3SQPA 1GRBA 2F5ZA 5U1OA 4II2A 5C2TA 2V3AA 3NKSA 3Q6JA 1F8RA 1C0KA 2RGHA 4FK1A 4NTCA 1KNRA 4LIIA 4H50A 2GRTA 4P9SA 2RGOA 3GWFA 4TM0A 4YJFA 4APNA 1GESA 1IUUA 4H4VA 3AE2A 1E39A 1OJDA 3P4QA 4YKGA 1IUXA 3RP6A 2YQUA 2GR3A 3AD8B 2BC0A 1C0PA 5IQ1A 4YSYA 3NIXA 3SZ0A 5C3JA 4NEVA 4Z44A 4EQXA 5FS6A 3RP7A 3SZWA 3F8PA 2YVJA 2DKIA 2YG3A 4N9XA 4Y4LA 3V3OA 3HYVA 3ZNNA 2XDOA 2QCUA 1H6VA 4H4PA 4K8DA 1LVLA 3CNPA 1N4VA 3ZNOA 4NZHA 2E1MA 2IVEA 4G6HA 1KFYA 2C64A 1FCDA 4DNAA 2TPRA 3KLJA 2GMHA 2GQFA 2R4EA 1PJ5A 3NT6A 2CULA 3AEGA 2E5VA 1ONFA 2QA1A 4YJHB 1ZOYA 2WDVA 2WDQA 2BS2A 1K4QA 3FG2P 3K7MX 3NN6X 2C3DA 4HA6A 4OPTA 4CBQA 1KSUA 4Z43A 2ZBWA 1DJNA 2XVFA 3QSSA 1H81A 4IA6A 2C3CA 2YG5A 2J3NA 4OPLA 1VG9A 3OC4A 3CNDA 3RNMA 4CNKA 3QSEA 5KMQA 3DK4A 2V61A 1PJ7A 1S3BA 2B9WA 3ALJA 4U8MA 2XCGA 3AE3A 3LZWA 4J56A 1P2HA 2R0GA 2XFQA 1NPXA 3NHOX 2B9XA 3BHKA 2HQMA 2B7RA 5EBKA 3T2YA 2CVJA 2X3NA 1N4WA 1TYTA 4J33A 3R9UA 3K30A 2R9ZA 1KF6A 4AOSA 4NTDA 1BGNA 4D03A 2BXRA 1KIFA 4A5LA 2YLSA 2WPFA 4K22A 1L0VA 4OPCA 2EQ9A 1GSNA 3FPZA 4NWZA 5KVIA 2X8GA 4OPUA 4A6NB 3QVPA 2AR8A 3GYXA 3II4A 4H4QA 5JCKA 1B4VA 2OALA 3CPJG 2AQJA 1GTHA 3CUKA 3ZYXA 4G74A 2FJDA 1O5WA 1YY5A 3CPIG 2R4JA 2YVFA 4H4RA 5HHFA 1ZP0A 3L1RA 4O5QA 3RP8A 4YJGA 3AEFA 1ZDLA 2JAEA 2XVHA 3VR8A 1H7WA 4XWRA 2PHHA 2WP9A 1IUVA 1DDOA 3K7TA 4AT2A 3T2ZA 4H4XA 2GV8A 2O9ZA 1O95A 1BKWA 2FJBA 2IVDA 3M12A 4GCMA 1E1NA 1KNPA 3C96A 4BJZA 3UTFA 2E49A 1M64A 1RP0A 4JDRA 1GRGA 1ZMCA 4U8JA 2Z5YA 3Q9TA 4CNJA 3EF6A 4RG4A 4TM4A 4H2PA 1MO9A 1GETA 3GMBA 5JCMA 1Q9IA 2VVLG 3GRSA 1Z6LA 1TDOA 1FL2A 3GRTA 1IUWA 3AWIA 3DK9A 4E0VA 5BVAA 1VQWA 3GDNA 1GRAA 2C73A 3UKPA 5FS9A 4H4YA 4EQRA 2V3BA 1GRHA 2WEUA 2E82A 1E1MA 2C4CA 4FK1C 3COXA 3S61A 1Y56B 5KMSA 1BGJA 2Q0LA 3DGZA 1BWCA 2BA9A 3KKJA 2B7SA 1B5QA 3I6DA 1GRFA 1PDHA 5L46A 4H7UA 3SY4A 4BURA 1GREA 1PJ6A 4BJYA 2X8CA 1KSSA 3NYFA 4FX9A 1JU2A 3GYJA 5JCNA 5FS7A 2H88A 4H4ZA 2C66A 1E1LA 1H7XA 2JKCA 3GWDA 5BULA 1D4CA 1PBCA 2C75A 2RABA 3AE7A 3KPKA 4LU6A 4A9WA 1YQZA 4A99A 1CBOA 5GSNA 3AXBA 5U63A 3ATQA 3UKKA 1MOKA 1NG3A 3DMEA 3IF9A 1PS9A 3H8IA 4RG3A 3UKQA 4B63A 1VG0A 2XFOA 2VOUA 4EIPA 3M0OA 2GAGB 5KXJA 3BHFA 1COYA 2C67A 2E4AA 1BZLA 1K0LA 3AEDA 4PAAA 1VDCA 3GDPA 4G73A 4J31A 4REKA 3T2KA 1B37A 1NEKA 5FS8A 3ZDNA 4X4JA 3LOVA 4B1BA 1MXTA 2ACZA 3QFAA 2GMJA 1ZX9A 4OCGA 3UKFA 3W4KA 3K7QX 2BS3A 2Y6RA 5CKUA 3AEBA 1ELIA 4II3A 4DSGA 3OZ2A 2C65A 3ITJA 1JRZA 4ECHA 2VVMA 4Z26A 3GMCA 3PVCA 1DXLA 2V60A 1F6MA 4JQ9A 1EL9A 1NHSA 3HYXA 3CNSA 4FDCB 4C74A 2NPXA 4G6GA 1S3EA 2BC1A 3KVEA 3NRNA 1F3PA 2B9YA 3LJPA 5CQFA 4EQWA 4GRTA 3UP4A 1NG4A 5KWFA 4OPIA 2WPCA 1W4XA 4G9KA 1ZK7A 2EQ6A 2X8HA 2YR6A 2BCGG 3CGCA 5DBJA 1GXFA 1CJCA 1JRXA 2JK6A 4GDPA 4TLXA 3P4RA 3UOYA 3UTEA 4H4SA 2YR5A 1XANA 2WOIA 3SZCA 3AE9A 5KMRA 4X9NA 1RYIA 3AE6A 4OVIA 4TLZA 1S2YA 4J57A 4A65A 4A79A 4Z25A 3NYCA 2NVKX 4KX6A 4UDPA 4WX1A 5KOWA 1DJQA 1F8SA 4B67A 4RSLA 2E48A 2XVIA 1CJ2A 3AE8A 3FMWA 4YKFA 4Z24A 5HY5A 3GYIA 1D7LA 3CGBA 4YJFB 3NTAA 4M52A 2WU2A 4IV9A 4U2SA 2GR2A 1UKVG 4XWZA 1O94A 4B68A 4CRTA 4ZN0A 2PYXA 1KDGA 4YTNA 3ADAB 1K0IA 1EL8A 3BNUA 2BRYA 1DAOA 2OLOA 2RGJA 3AYLA 3T14A 3UKLA 2VQBA 2ZZ0A 1FEAA 2C72A 2A8XA 3CNJA 1IUTA 1OJAA 2FJAA 2R45A 2H89A 2R0PA 3KU9A 3AYIA 1QLBA 1IUSA 4EMJA 1PXCA 1GEUA 2GEWA 4JY2A 4H4WA 4Z2RA 4EM4A 4IVMB 1FOHA 1NHPA 1AOGA 1CHUA 3PO7A 3URHA 1C0IA 2WP6A 1LJ1A 1FECA 1NDAA 4IA5A 4AOXA 3NK1X 3H4KA 2BABA 2EQ8A 3DA1A 3BI2A 1GTEA 2WOWA 3UCLA 1JNZA 4I59A 4H2QA 4O5UA 4C5OA 2XVEA 2VZ2A 2DU8A 2GAHB 4BK3A 1OJ9A 2VRLA 4J36A 3VQRA 3WGTA 2CDUA 3CPHG 2YWLA 3I3LA 1L9EA 3QSMA 3NN0X 2XLSA 2C7GA 1VE9A 5FMHA 1B8SA 5M10A 1LQUA 1GOSA 2FJEA 3G5QA 2X99A 3SFDA 1VRQB 4ZCCA 3QJ4A 3IHGA 3CMMA 4BK1A 4IVOB 3DGHA 1QO8A 1AN9A 1Y0PA 1YKJA 1NAAA 2V5ZA 2XLTA 4HB9A 3T37A 4B65A 1XPQA 2C76A 2BK4A 3UKAA 1LQTA 1XDIA 2E4GA 3AB1A 3EAOA 4MJWA 3G3EA 1E6EA 2YG6A 4UP3A 3KA7A 1GRTA 4U8KA 3KD9A 3T31A 4BV6A 5KRQA 3IWAA 4CY8A 3P4PA 1ZY8A 3CGEA 4C77A 2BS4A 1PBFA 1HYUA 2WPEA 2WS3A 4UDQA 5BRTA 4H4UA 1ZKQA 3ATRA 3LB8A 1E1KA 1DODA 5EB5A 4U8IA 1XHCA 1K0JA 3HZLA 3NG7X 4Z2UA 5BUKA 3AYJA 2YAUA 3NK2X 1CL0A 2XVJA 1H84A 4YJGB 2OAMA 4YTMA 4PABA 3IHMA 3NH3X 3KPFA 1H86A 1LTXR 3CNTA 3BNMA 1H82A 4X9MA 3ZNQA 1YQ3A 4ZCDA 3SYIA 4I58A 4DGKA 3REDA 5ER0A 2V6OA 1TDKA 4QFCA 2YG7A 5J7XA 3UTHA 1S2QA 4CCRA 3V76A 3DJGX 2OLNA 1BF3A 4Y4NA 3ICRA 3BI4A 3IC9A 2XFUA 4H2RA 4U2TA 1JNRA 3O0HA 4U8PA 4YWOA 4EQSA 2ARDA 2OA1A 5JCIA 2XLPA 3AE5A 3WE0A 4EMWA 1OJTA 1L9CA 4UDRA 1DOEA 2APGA 4GR1A 2Z5XA 2VQ7A 2WP5A 2WQYA 4YSXA 2QAEA 2YLRA 3UOVA 3GD3A 3FIMB 4OPDA 1DOBA 1DOCA 3AD7B 3GSIA 1Q1WA 2X50A 1CF3A 4U2LA 4U8NA 4ADWA 2CFYA 4BK2A 1OJCA 1D5TA 3ALMA 4NEWA 2GH5A 3F8DA 3G5SA 4H2NA 2YLXA 3CIRA 4USRA 4CCQA 1D4EA 3EPTA 4JNAA 2WBAA 4NTEA 3SFEA 1PBDA 4DSHA 4C3XA 3DJJA 2ZZBA 4A6NA 2GB0A 2BK5A 1L9DA 1GNDA 3PS9A 2YLZA 4K7ZA 3CTYA 2QA2A 3LZXA 2BACA 1P2EA 1EL5A 1TDEA 2ZZCA 3HYWA 1EVIA 5TR3A 1PXAA 1CJ3A 5M0ZA 4B69A 1CC4A 3W4JA 3UOZA 4AT0A 2AAQA 4YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM3 A;  4YXD A;  2YVG A;  5IQ4 A;  4XXG A;  4B66 A;  4H4T A;  1E7P A;  2GR0 A;  3AD9 B;  2BK3 A;  4YSH A;  2GR1 A;  3P9U A;  3ALL A;  2YM1 A;  1CC6 A;  3UTG A;  2BXS A;  3GD4 A;  2YLW A;  2R0C A;  1GT8 A;  1PHH A;  3C4N A;  3SM8 A;  4K5S A;  5U25 A;  3VRB A;  1SEZ A;  2DKH A;  3DH9 A;  4JN9 A;  1JEH A;  3D1C A;  1GV4 A;  2YG4 A;  1JOA A;  2YLT A;  2WOV A;  1LV0 A;  3QVR A;  4Z2T A;  3CN8 A;  1ZOV A;  3VR9 A;  1GAL A;  2JB1 A;  2TMD A;  5JCL A;  1Y56 A;  1GER A;  4LA1 A;  1JRY A;  4CY6 A;  1RSG A;  3ISH A;  1M6I A;  5J60 A;  2XLU A;  3EAN A;  5GRT A;  3B3R A;  4K2X A;  2EQ7 A;  2I0Z A;  4USQ A;  1TDF A;  3NLC A;  3BI5 A;  3S5W A;  1NEN A;  4TM3 A;  1YQ4 A;  1PBB A;  2XLR A;  1NHQ A;  2B76 A;  3P4S A;  4B64 A;  2IID A;  4U8O A;  2WES A;  2XFP A;  3LAD A;  4GUV A;  3W4I A;  2WU5 A;  1C0L A;  1EL7 A;  4AP3 A;  4JNQ A;  4EIQ A;  3DJD A;  2W0H A;  3NK0 X;  3ICS A;  2WHD A;  1IJH A;  2Q7V A;  3NNE A;  3AE1 A;  3VRA A;  3NYE A;  5KOX A;  1H83 A;  3AE4 A;  3B6D A;  1X31 B;  3P1W A;  4TM1 A;  1D4D A;  3FBS A;  5EB4 A;  2Y6Q A;  2FBW A;  4A7A A;  5LV9 A;  1EBD A;  1DNC A;  1REO A;  2A89 A;  1PBE A;  1TDN A;  5EOW A;  5HYM A;  1GPE A;  3ABV A;  3AEC A;  2Q0K A;  3RHA A;  2GVC A;  3QFB A;  2GF3 A;  2WET A;  2VVL A;  2BCP A;  2C70 A;  3UOX A;  4Y4M A;  3DJE A;  3G5R A;  5IPY A;  3LXD A;  4U8L A;  3JSK A;  3NGC X;  4GF7 A;  4GDE A;  2A87 A;  2GQW A;  2UZZ A;  3AEE A;  3DK8 A;  1N4U A;  3M13 A;  1FEB A;  3AEA A;  4YJD A;  1TYP A;  2JBV A;  4EMI A;  1D7Y A;  1CC2 A;  3C4A A;  4J2W A;  4YSZ A;  1ZMD A;  4D04 A;  3E1T A;  3CGD A;  4WCT A;  3L8K A;  3ZNP A;  4JY3 A;  4C3Y A;  2YM2 A;  3D8X A;  3SGL A;  4K5R A;  4OPG A;  3F8R A;  2R46 A;  1V59 A;  5KVH A;  1QJD A;  2WDR A;  2XYO A;  4AP1 A;  1PN0 A;  3UKH A;  4YT0 A;  2XFN A;  1CJ4 A;  2JB2 A;  4J34 A;  1PXB A;  2YR4 A;  3V3N A;  5HXI A;  4YJH A;  1TRB A;  4KPR A;  2VRM A;  3H8L A;  1NHR A;  1F8W A;  1LPF A;  3UP5 A;  1Q1R A;  2JB3 A;  3NTD A;  2Q6U A;  4QFD A;  2BYB A;  4ICY A;  3ICT A;  3VRD B;  1N1P A;  3SQP A;  1GRB A;  2F5Z A;  5U1O A;  5C2T A;  2V3A A;  3NKS A;  3Q6J A;  1F8R A;  1C0K A;  2RGH A;  4FK1 A;  4NTC A;  1KNR A;  4LII A;  4H50 A;  2GRT A;  4P9S A;  2RGO A;  3GWF A;  4TM0 A;  4YJF A;  4APN A;  1GES A;  1IUU A;  4H4V A;  3AE2 A;  1E39 A;  1OJD A;  3P4Q A;  4YKG A;  1IUX A;  3RP6 A;  2YQU A;  2GR3 A;  3AD8 B;  2BC0 A;  1C0P A;  5IQ1 A;  4YSY A;  3NIX A;  5C3J A;  4NEV A;  4Z44 A;  4EQX A;  5FS6 A;  3RP7 A;  3F8P A;  2YVJ A;  2DKI A;  2YG3 A;  4N9X A;  4Y4L A;  3V3O A;  3ZNN A;  2XDO A;  2QCU A;  1H6V A;  4H4P A;  4K8D A;  1LVL A;  3CNP A;  1N4V A;  3ZNO A;  4NZH A;  2E1M A;  2IVE A;  1KFY A;  2C64 A;  1FCD A;  4DNA A;  2TPR A;  3KLJ A;  2GMH A;  2GQF A;  2R4E A;  1PJ5 A;  3NT6 A;  2CUL A;  3AEG A;  2E5V A;  1ONF A;  2QA1 A;  4YJH B;  1ZOY A;  2WDV A;  2WDQ A;  2BS2 A;  1K4Q A;  3FG2 P;  3K7M X;  3NN6 X;  2C3D A;  4HA6 A;  4OPT A;  4CBQ A;  1KSU A;  4Z43 A;  2ZBW A;  1DJN A;  2XVF A;  3QSS A;  1H81 A;  4IA6 A;  2C3C A;  2YG5 A;  2J3N A;  4OPL A;  1VG9 A;  3OC4 A;  3CND A;  3RNM A;  4CNK A;  3QSE A;  3DK4 A;  2V61 A;  1PJ7 A;  1S3B A;  2B9W A;  3ALJ A;  4U8M A;  2XCG A;  3AE3 A;  3LZW A;  4J56 A;  1P2H A;  2R0G A;  2XFQ A;  1NPX A;  3NHO X;  2B9X A;  3BHK A;  2HQM A;  2B7R A;  5EBK A;  2CVJ A;  2X3N A;  1N4W A;  1TYT A;  4J33 A;  3R9U A;  3K30 A;  2R9Z A;  1KF6 A;  4AOS A;  4NTD A;  1BGN A;  4D03 A;  2BXR A;  1KIF A;  4A5L A;  2YLS A;  2WPF A;  4K22 A;  1L0V A;  4OPC A;  2EQ9 A;  1GSN A;  3FPZ A;  5KVI A;  2X8G A;  4OPU A;  4A6N B;  3QVP A;  2AR8 A;  3II4 A;  4H4Q A;  5JCK A;  1B4V A;  2OAL A;  3CPJ G;  2AQJ A;  1GTH A;  3CUK A;  3ZYX A;  2FJD A;  1O5W A;  1YY5 A;  3CPI G;  2R4J A;  2YVF A;  4H4R A;  5HHF A;  1ZP0 A;  3L1R A;  4O5Q A;  3RP8 A;  4YJG A;  3AEF A;  1ZDL A;  2JAE A;  2XVH A;  3VR8 A;  1H7W A;  4XWR A;  2PHH A;  2WP9 A;  1IUV A;  1DDO A;  3K7T A;  4AT2 A;  4H4X A;  2GV8 A;  2O9Z A;  1O95 A;  1BKW A;  2FJB A;  2IVD A;  3M12 A;  4GCM A;  1E1N A;  1KNP A;  3C96 A;  4BJZ A;  3UTF A;  2E49 A;  1M64 A;  1RP0 A;  4JDR A;  1GRG A;  1ZMC A;  4U8J A;  2Z5Y A;  3Q9T A;  4CNJ A;  3EF6 A;  4RG4 A;  4TM4 A;  4H2P A;  1MO9 A;  1GET A;  3GMB A;  5JCM A;  1Q9I A;  2VVL G;  3GRS A;  1Z6L A;  1TDO A;  1FL2 A;  3GRT A;  1IUW A;  3AWI A;  3DK9 A;  4E0V A;  5BVA A;  1VQW A;  3GDN A;  1GRA A;  2C73 A;  3UKP A;  5FS9 A;  4H4Y A;  4EQR A;  2V3B A;  1GRH A;  2WEU A;  2E82 A;  1E1M A;  4FK1 C;  3S61 A;  3COX A;  1Y56 B;  1BGJ A;  2Q0L A;  3DGZ A;  1BWC A;  2BA9 A;  3KKJ A;  2B7S A;  1B5Q A;  3I6D A;  1GRF A;  1PDH A;  5L46 A;  4H7U A;  4BUR A;  1GRE A;  1PJ6 A;  4BJY A;  2X8C A;  1KSS A;  3NYF A;  4FX9 A;  1JU2 A;  3GYJ A;  5JCN A;  5FS7 A;  2H88 A;  4H4Z A;  2C66 A;  1E1L A;  1H7X A;  2JKC A;  3GWD A;  5BUL A;  1D4C A;  1PBC A;  2C75 A;  2RAB A;  3AE7 A;  4LU6 A;  4A9W A;  1YQZ A;  4A99 A;  1CBO A;  5GSN A;  3AXB A;  5U63 A;  3ATQ A;  3UKK A;  1MOK A;  1NG3 A;  3DME A;  3IF9 A;  1PS9 A;  3H8I A;  4RG3 A;  3UKQ A;  4B63 A;  1VG0 A;  2XFO A;  2VOU A;  4EIP A;  3M0O A;  2GAG B;  5KXJ A;  3BHF A;  1COY A;  2C67 A;  2E4A A;  1BZL A;  1K0L A;  3AED A;  4PAA A;  1VDC A;  3GDP A;  4J31 A;  4REK A;  1B37 A;  1NEK A;  5FS8 A;  3ZDN A;  4X4J A;  3LOV A;  4B1B A;  1MXT A;  2ACZ A;  3QFA A;  2GMJ A;  1ZX9 A;  4OCG A;  3UKF A;  3W4K A;  3K7Q X;  2BS3 A;  2Y6R A;  5CKU A;  3AEB A;  1ELI A;  4DSG A;  4ECH A;  3OZ2 A;  2C65 A;  3ITJ A;  1JRZ A;  2VVM A;  4Z26 A;  3GMC A;  3PVC A;  1DXL A;  2V60 A;  1F6M A;  4JQ9 A;  1EL9 A;  1NHS A;  3CNS A;  4FDC B;  4C74 A;  2NPX A;  1S3E A;  2BC1 A;  3KVE A;  3NRN A;  1F3P A;  2B9Y A;  3LJP A;  5CQF A;  4EQW A;  4GRT A;  3UP4 A;  1NG4 A;  5KWF A;  4OPI A;  2WPC A;  1W4X A;  1ZK7 A;  2EQ6 A;  2X8H A;  2YR6 A;  2BCG G;  3CGC A;  5DBJ A;  1GXF A;  1CJC A;  1JRX A;  2JK6 A;  4GDP A;  4TLX A;  3P4R A;  3UOY A;  3UTE A;  4H4S A;  2YR5 A;  1XAN A;  2WOI A;  3AE9 A;  4X9N A;  1RYI A;  3AE6 A;  4OVI A;  4TLZ A;  1S2Y A;  4J57 A;  4A65 A;  4A79 A;  4Z25 A;  3NYC A;  2NVK X;  4KX6 A;  4UDP A;  4WX1 A;  5KOW A;  1DJQ A;  1F8S A;  4B67 A;  4RSL A;  2E48 A;  2XVI A;  1CJ2 A;  3AE8 A;  3FMW A;  4YKF A;  4Z24 A;  5HY5 A;  3GYI A;  1D7L A;  3CGB A;  4YJF B;  3NTA A;  4M52 A;  2WU2 A;  4IV9 A;  4U2S A;  2GR2 A;  1UKV G;  4XWZ A;  1O94 A;  4B68 A;  4CRT A;  4ZN0 A;  2PYX A;  1KDG A;  4YTN A;  3ADA B;  1K0I A;  1EL8 A;  3BNU A;  1DAO A;  2OLO A;  2RGJ A;  3AYL A;  3UKL A;  2VQB A;  2ZZ0 A;  1FEA A;  2C72 A;  2A8X A;  3CNJ A;  1IUT A;  1OJA A;  2FJA A;  2R45 A;  2H89 A;  2R0P A;  3KU9 A;  3AYI A;  1QLB A;  1IUS A;  4EMJ A;  1PXC A;  1GEU A;  2GEW A;  4JY2 A;  4H4W A;  4Z2R A;  4EM4 A;  4IVM B;  1FOH A;  1NHP A;  1AOG A;  1CHU A;  3PO7 A;  3URH A;  1C0I A;  2WP6 A;  1LJ1 A;  1FEC A;  1NDA A;  4IA5 A;  4AOX A;  3NK1 X;  3H4K A;  2BAB A;  2EQ8 A;  3DA1 A;  3BI2 A;  1GTE A;  2WOW A;  3UCL A;  1JNZ A;  4I59 A;  4H2Q A;  4O5U A;  4C5O A;  2XVE A;  2VZ2 A;  2DU8 A;  2GAH B;  4BK3 A;  1OJ9 A;  2VRL A;  4J36 A;  3VQR A;  3WGT A;  2CDU A;  3CPH G;  2YWL A;  3I3L A;  1L9E A;  3QSM A;  3NN0 X;  2XLS A;  2C7G A;  1VE9 A;  5FMH A;  1B8S A;  5M10 A;  1LQU A;  1GOS A;  2FJE A;  3G5Q A;  2X99 A;  3SFD A;  1VRQ B;  4ZCC A;  3QJ4 A;  3IHG A;  4BK1 A;  4IVO B;  3DGH A;  1QO8 A;  1AN9 A;  1Y0P A;  1YKJ A;  1NAA A;  2V5Z A;  2XLT A;  4HB9 A;  3T37 A;  4B65 A;  1XPQ A;  2C76 A;  2BK4 A;  3UKA A;  1LQT A;  1XDI A;  2E4G A;  3AB1 A;  3EAO A;  4MJW A;  3G3E A;  1E6E A;  2YG6 A;  4UP3 A;  3KA7 A;  1GRT A;  4U8K A;  3KD9 A;  4BV6 A;  5KRQ A;  3IWA A;  4CY8 A;  3P4P A;  1ZY8 A;  3CGE A;  4C77 A;  2BS4 A;  1PBF A;  1HYU A;  2WPE A;  2WS3 A;  4UDQ A;  5BRT A;  4H4U A;  1ZKQ A;  3ATR A;  3LB8 A;  1E1K A;  1DOD A;  5EB5 A;  4U8I A;  1XHC A;  1K0J A;  3HZL A;  3NG7 X;  4Z2U A;  5BUK A;  3AYJ A;  2YAU A;  3NK2 X;  1CL0 A;  2XVJ A;  1H84 A;  4YJG B;  2OAM A;  4YTM A;  4PAB A;  3IHM A;  3NH3 X;  3KPF A;  1H86 A;  1LTX R;  3CNT A;  3BNM A;  1H82 A;  4X9M A;  3ZNQ A;  1YQ3 A;  4ZCD A;  4I58 A;  4DGK A;  3RED A;  5ER0 A;  2V6O A;  1TDK A;  4QFC A;  2YG7 A;  5J7X A;  3UTH A;  1S2Q A;  4CCR A;  3V76 A;  3DJG X;  2OLN A;  1BF3 A;  4Y4N A;  3ICR A;  3BI4 A;  3IC9 A;  2XFU A;  4H2R A;  4U2T A;  1JNR A;  3O0H A;  4U8P A;  4YWO A;  4EQS A;  2ARD A;  2OA1 A;  5JCI A;  2XLP A;  3AE5 A;  3WE0 A;  4EMW A;  1OJT A;  1L9C A;  4UDR A;  1DOE A;  2APG A;  4GR1 A;  2Z5X A;  2VQ7 A;  2WP5 A;  2WQY A;  4YSX A;  2QAE A;  2YLR A;  3UOV A;  3GD3 A;  3FIM B;  4OPD A;  1DOB A;  1DOC A;  3AD7 B;  3GSI A;  1Q1W A;  2X50 A;  1CF3 A;  4U2L A;  4U8N A;  4ADW A;  2CFY A;  4BK2 A;  1OJC A;  1D5T A;  3ALM A;  4NEW A;  2GH5 A;  3F8D A;  3G5S A;  4H2N A;  2YLX A;  3CIR A;  4USR A;  4CCQ A;  1D4E A;  3EPT A;  4JNA A;  2WBA A;  4NTE A;  3SFE A;  1PBD A;  4DSH A;  4C3X A;  3DJJ A;  2ZZB A;  4A6N A;  2GB0 A;  2BK5 A;  1L9D A;  1GND A;  3PS9 A;  2YLZ A;  4K7Z A;  3CTY A;  2QA2 A;  3LZX A;  2BAC A;  1P2E A;  1EL5 A;  1TDE A;  2ZZC A;  1EVI A;  5TR3 A;  1PXA A;  1CJ3 A;  5M0Z A;  4B69 A;  1CC4 A;  3W4J A;  3UOZ A;  4AT0 A;  2AAQ A;  4YTP A; 
#chains in the Genus database with same CATH topology
 4EM3 A;  4YXD A;  2YVG A;  5IQ4 A;  4XXG A;  4B66 A;  4H4T A;  1E7P A;  2GR0 A;  3AD9 B;  2BK3 A;  4YSH A;  2GR1 A;  3P9U A;  3ALL A;  2YM1 A;  1CC6 A;  3UTG A;  2BXS A;  3GD4 A;  2YLW A;  2R0C A;  1GT8 A;  1PHH A;  3C4N A;  3SM8 A;  4K5S A;  5U25 A;  3VRB A;  2DKH A;  1SEZ A;  3DH9 A;  4JN9 A;  1JEH A;  3D1C A;  1GV4 A;  2YG4 A;  1JOA A;  2YLT A;  2WOV A;  1LV0 A;  3QVR A;  4Z2T A;  3CN8 A;  1ZOV A;  4GAV A;  3VR9 A;  1GAL A;  2JB1 A;  2TMD A;  5JCL A;  1Y56 A;  1GER A;  4LA1 A;  1JRY A;  4CY6 A;  1RSG A;  3ISH A;  1M6I A;  4NNJ A;  5J60 A;  2XLU A;  3T0K A;  3EAN A;  5GRT A;  3B3R A;  4K2X A;  2EQ7 A;  2I0Z A;  4USQ A;  1TDF A;  3NLC A;  3BI5 A;  3S5W A;  1NEN A;  4TM3 A;  1YQ4 A;  2BRA A;  1PBB A;  2XLR A;  1NHQ A;  2B76 A;  3P4S A;  4B64 A;  2IID A;  4U8O A;  2WES A;  2XFP A;  3LAD A;  4GUV A;  3W4I A;  2WU5 A;  1C0L A;  1EL7 A;  4AP3 A;  4JNQ A;  4EIQ A;  3DJD A;  2W0H A;  3NK0 X;  3ICS A;  2WHD A;  1IJH A;  2Q7V A;  3NNE A;  3AE1 A;  4GAP A;  3VRA A;  3NYE A;  5KOX A;  1H83 A;  3AE4 A;  3B6D A;  1X31 B;  3P1W A;  4TM1 A;  1D4D A;  3FBS A;  5EB4 A;  2Y6Q A;  2FBW A;  4A7A A;  5LV9 A;  1EBD A;  1DNC A;  1REO A;  2A89 A;  1PBE A;  5HYM A;  1TDN A;  5EOW A;  1GPE A;  3ABV A;  3AEC A;  2Q0K A;  3RHA A;  2GVC A;  3QFB A;  2GF3 A;  2WET A;  2VVL A;  2BCP A;  2C70 A;  3UOX A;  4Y4M A;  3DJE A;  3G5R A;  5IPY A;  3LXD A;  4U8L A;  3JSK A;  3NGC X;  4GF7 A;  4GDE A;  5KNL A;  2A87 A;  3SX6 A;  2GQW A;  2UZZ A;  3AEE A;  3DK8 A;  1N4U A;  3M13 A;  1FEB A;  3AEA A;  4YJD A;  1TYP A;  2JBV A;  4EMI A;  1D7Y A;  1CC2 A;  3C4A A;  4J2W A;  4YSZ A;  1ZMD A;  4D04 A;  3E1T A;  3CGD A;  4WCT A;  3L8K A;  3ZNP A;  4JY3 A;  4C3Y A;  2YM2 A;  3D8X A;  3SGL A;  4K5R A;  4OPG A;  3SXI A;  3SZF A;  3F8R A;  2R46 A;  1V59 A;  5KMP A;  5KVH A;  1QJD A;  2WDR A;  2XYO A;  4AP1 A;  1PN0 A;  3UKH A;  4YT0 A;  2XFN A;  1CJ4 A;  2JB2 A;  4J34 A;  1PXB A;  2YR4 A;  3V3N A;  5HXI A;  4YJH A;  1TRB A;  4KPR A;  2VRM A;  3H8L A;  1NHR A;  1F8W A;  1LPF A;  3UP5 A;  1Q1R A;  2JB3 A;  3NTD A;  2Q6U A;  4QFD A;  2BYB A;  4ICY A;  3ICT A;  3VRD B;  1N1P A;  3SQP A;  1GRB A;  2F5Z A;  5U1O A;  4II2 A;  5C2T A;  2V3A A;  3NKS A;  3Q6J A;  1F8R A;  1C0K A;  2RGH A;  4FK1 A;  4NTC A;  1KNR A;  4LII A;  4H50 A;  2GRT A;  4P9S A;  2RGO A;  3GWF A;  4TM0 A;  4YJF A;  4APN A;  1GES A;  1IUU A;  4H4V A;  3AE2 A;  1E39 A;  1OJD A;  3P4Q A;  4YKG A;  1IUX A;  3RP6 A;  2YQU A;  2GR3 A;  3AD8 B;  2BC0 A;  1C0P A;  5IQ1 A;  4YSY A;  3NIX A;  3SZ0 A;  5C3J A;  4NEV A;  4Z44 A;  4EQX A;  3RP7 A;  5FS6 A;  3SZW A;  3F8P A;  2YVJ A;  2DKI A;  2YG3 A;  4N9X A;  4Y4L A;  3V3O A;  3HYV A;  3ZNN A;  2XDO A;  2QCU A;  1H6V A;  4H4P A;  4K8D A;  1LVL A;  3CNP A;  1N4V A;  3ZNO A;  4NZH A;  2E1M A;  2IVE A;  4G6H A;  1KFY A;  2C64 A;  1FCD A;  4DNA A;  2TPR A;  3KLJ A;  2GMH A;  2GQF A;  2R4E A;  1PJ5 A;  3NT6 A;  2CUL A;  3AEG A;  2E5V A;  1ONF A;  2QA1 A;  4YJH B;  1ZOY A;  2WDV A;  2WDQ A;  2BS2 A;  1K4Q A;  3FG2 P;  3K7M X;  3NN6 X;  2C3D A;  4HA6 A;  4OPT A;  4CBQ A;  1KSU A;  4Z43 A;  2ZBW A;  1DJN A;  4IA6 A;  3QSS A;  1H81 A;  2XVF A;  2C3C A;  2YG5 A;  2J3N A;  4OPL A;  1VG9 A;  3OC4 A;  3CND A;  3RNM A;  4CNK A;  3QSE A;  5KMQ A;  3DK4 A;  2V61 A;  1PJ7 A;  1S3B A;  2B9W A;  3ALJ A;  4U8M A;  2XCG A;  3AE3 A;  3LZW A;  4J56 A;  1P2H A;  2R0G A;  2XFQ A;  1NPX A;  3NHO X;  2B9X A;  3BHK A;  2HQM A;  2B7R A;  5EBK A;  3T2Y A;  2CVJ A;  2X3N A;  1N4W A;  1TYT A;  4J33 A;  3R9U A;  3K30 A;  2R9Z A;  1KF6 A;  4AOS A;  4NTD A;  1BGN A;  4D03 A;  2BXR A;  1KIF A;  4A5L A;  2YLS A;  4K22 A;  2WPF A;  1L0V A;  4OPC A;  2EQ9 A;  1GSN A;  3FPZ A;  4NWZ A;  5KVI A;  2X8G A;  4OPU A;  4A6N B;  3QVP A;  2AR8 A;  3GYX A;  3II4 A;  4H4Q A;  5JCK A;  1B4V A;  2OAL A;  3CPJ G;  2AQJ A;  1GTH A;  3CUK A;  3ZYX A;  4G74 A;  2FJD A;  1O5W A;  1YY5 A;  3CPI G;  2R4J A;  2YVF A;  4H4R A;  5HHF A;  1ZP0 A;  3L1R A;  4O5Q A;  3RP8 A;  4YJG A;  3AEF A;  1ZDL A;  2JAE A;  2XVH A;  3VR8 A;  1H7W A;  4XWR A;  2PHH A;  2WP9 A;  1IUV A;  1DDO A;  3K7T A;  4AT2 A;  3T2Z A;  4H4X A;  2GV8 A;  2O9Z A;  1O95 A;  1BKW A;  2FJB A;  2IVD A;  3M12 A;  4GCM A;  3C96 A;  1E1N A;  1KNP A;  4BJZ A;  3UTF A;  2E49 A;  1M64 A;  1RP0 A;  4JDR A;  1GRG A;  1ZMC A;  4U8J A;  2Z5Y A;  3Q9T A;  4CNJ A;  3EF6 A;  4RG4 A;  4TM4 A;  4H2P A;  1MO9 A;  3GMB A;  1GET A;  5JCM A;  1Q9I A;  2VVL G;  3GRS A;  1Z6L A;  1TDO A;  1FL2 A;  3GRT A;  1IUW A;  3AWI A;  3DK9 A;  4E0V A;  5BVA A;  1VQW A;  3GDN A;  1GRA A;  2C73 A;  3UKP A;  5FS9 A;  4H4Y A;  4EQR A;  2V3B A;  1GRH A;  2WEU A;  2E82 A;  1E1M A;  2C4C A;  4FK1 C;  3COX A;  3S61 A;  1Y56 B;  5KMS A;  1BGJ A;  2Q0L A;  3DGZ A;  1BWC A;  2BA9 A;  3KKJ A;  2B7S A;  1B5Q A;  3I6D A;  1GRF A;  1PDH A;  5L46 A;  4H7U A;  3SY4 A;  4BUR A;  1GRE A;  1PJ6 A;  4BJY A;  2X8C A;  1KSS A;  3NYF A;  4FX9 A;  1JU2 A;  3GYJ A;  5JCN A;  5FS7 A;  2H88 A;  4H4Z A;  2C66 A;  1E1L A;  1H7X A;  2JKC A;  3GWD A;  5BUL A;  1D4C A;  1PBC A;  2C75 A;  2RAB A;  3AE7 A;  3KPK A;  4LU6 A;  4A9W A;  1YQZ A;  4A99 A;  1CBO A;  5GSN A;  3AXB A;  5U63 A;  3ATQ A;  3UKK A;  1MOK A;  1NG3 A;  3DME A;  3IF9 A;  1PS9 A;  3H8I A;  4RG3 A;  3UKQ A;  4B63 A;  1VG0 A;  2XFO A;  2VOU A;  4EIP A;  3M0O A;  2GAG B;  5KXJ A;  3BHF A;  1COY A;  2C67 A;  2E4A A;  1BZL A;  1K0L A;  3AED A;  4PAA A;  1VDC A;  3GDP A;  4G73 A;  4J31 A;  4REK A;  3T2K A;  1B37 A;  1NEK A;  5FS8 A;  3ZDN A;  4X4J A;  3LOV A;  4B1B A;  1MXT A;  2ACZ A;  3QFA A;  2GMJ A;  1ZX9 A;  4OCG A;  3UKF A;  3W4K A;  3K7Q X;  2BS3 A;  2Y6R A;  5CKU A;  3AEB A;  1ELI A;  4II3 A;  4DSG A;  3OZ2 A;  2C65 A;  3ITJ A;  1JRZ A;  4ECH A;  2VVM A;  4Z26 A;  3GMC A;  3PVC A;  1DXL A;  2V60 A;  1F6M A;  4JQ9 A;  1EL9 A;  1NHS A;  3HYX A;  3CNS A;  4FDC B;  4C74 A;  2NPX A;  4G6G A;  1S3E A;  2BC1 A;  3KVE A;  3NRN A;  1F3P A;  2B9Y A;  3LJP A;  5CQF A;  4EQW A;  4GRT A;  3UP4 A;  1NG4 A;  5KWF A;  4OPI A;  2WPC A;  1W4X A;  4G9K A;  1ZK7 A;  2EQ6 A;  2X8H A;  2YR6 A;  2BCG G;  3CGC A;  5DBJ A;  1GXF A;  1CJC A;  1JRX A;  2JK6 A;  4GDP A;  4TLX A;  3P4R A;  3UOY A;  3UTE A;  4H4S A;  2YR5 A;  1XAN A;  2WOI A;  3SZC A;  3AE9 A;  5KMR A;  4X9N A;  1RYI A;  3AE6 A;  4OVI A;  4TLZ A;  1S2Y A;  4J57 A;  4A65 A;  4A79 A;  4Z25 A;  3NYC A;  2NVK X;  4KX6 A;  4UDP A;  4WX1 A;  5KOW A;  1DJQ A;  1F8S A;  4B67 A;  4RSL A;  2E48 A;  2XVI A;  1CJ2 A;  3AE8 A;  3FMW A;  4YKF A;  4Z24 A;  5HY5 A;  3GYI A;  1D7L A;  3CGB A;  4YJF B;  3NTA A;  4M52 A;  2WU2 A;  4IV9 A;  4U2S A;  2GR2 A;  1UKV G;  4XWZ A;  1O94 A;  4B68 A;  4CRT A;  4ZN0 A;  2PYX A;  1KDG A;  4YTN A;  3ADA B;  1K0I A;  1EL8 A;  3BNU A;  2BRY A;  1DAO A;  2OLO A;  2RGJ A;  3AYL A;  3T14 A;  3UKL A;  2VQB A;  2ZZ0 A;  1FEA A;  2C72 A;  2A8X A;  3CNJ A;  1IUT A;  1OJA A;  2FJA A;  2R45 A;  2R0P A;  2H89 A;  3KU9 A;  3AYI A;  1QLB A;  1IUS A;  4EMJ A;  1PXC A;  4JY2 A;  1GEU A;  2GEW A;  4H4W A;  4Z2R A;  4EM4 A;  4IVM B;  1FOH A;  1NHP A;  1AOG A;  1CHU A;  3PO7 A;  3URH A;  1C0I A;  2WP6 A;  1LJ1 A;  1FEC A;  1NDA A;  4IA5 A;  4AOX A;  3NK1 X;  3H4K A;  2BAB A;  2EQ8 A;  3DA1 A;  3BI2 A;  1GTE A;  2WOW A;  3UCL A;  1JNZ A;  4I59 A;  4H2Q A;  4O5U A;  4C5O A;  2XVE A;  4BK3 A;  2DU8 A;  2GAH B;  2VZ2 A;  1OJ9 A;  2VRL A;  4J36 A;  3VQR A;  3WGT A;  2CDU A;  3CPH G;  2YWL A;  3I3L A;  1L9E A;  3QSM A;  3NN0 X;  2XLS A;  2C7G A;  1VE9 A;  5FMH A;  1B8S A;  5M10 A;  1LQU A;  1GOS A;  2FJE A;  3G5Q A;  2X99 A;  3SFD A;  1VRQ B;  4ZCC A;  3QJ4 A;  3IHG A;  3CMM A;  4BK1 A;  4IVO B;  3DGH A;  1QO8 A;  1AN9 A;  1Y0P A;  1YKJ A;  1NAA A;  2V5Z A;  2XLT A;  4HB9 A;  3T37 A;  4B65 A;  1XPQ A;  2C76 A;  2BK4 A;  3UKA A;  1LQT A;  1XDI A;  2E4G A;  3AB1 A;  3EAO A;  4MJW A;  3G3E A;  1E6E A;  2YG6 A;  4UP3 A;  3KA7 A;  1GRT A;  4U8K A;  3KD9 A;  3T31 A;  4BV6 A;  5KRQ A;  3IWA A;  4CY8 A;  3P4P A;  1ZY8 A;  3CGE A;  4C77 A;  2BS4 A;  1PBF A;  1HYU A;  2WPE A;  2WS3 A;  4UDQ A;  5BRT A;  4H4U A;  1ZKQ A;  3ATR A;  3LB8 A;  1E1K A;  1DOD A;  5EB5 A;  4U8I A;  1XHC A;  1K0J A;  3HZL A;  3NG7 X;  4Z2U A;  5BUK A;  3AYJ A;  2YAU A;  3NK2 X;  1CL0 A;  2XVJ A;  1H84 A;  4YJG B;  2OAM A;  4YTM A;  3IHM A;  4PAB A;  3NH3 X;  3KPF A;  1H86 A;  1LTX R;  3CNT A;  3BNM A;  1H82 A;  4X9M A;  3ZNQ A;  1YQ3 A;  4ZCD A;  3SYI A;  4I58 A;  4DGK A;  3RED A;  5ER0 A;  2V6O A;  1TDK A;  4QFC A;  2YG7 A;  5J7X A;  3UTH A;  1S2Q A;  4CCR A;  3V76 A;  3DJG X;  2OLN A;  1BF3 A;  4Y4N A;  3ICR A;  3BI4 A;  4H2R A;  2XFU A;  3IC9 A;  4U2T A;  1JNR A;  3O0H A;  4U8P A;  4YWO A;  4EQS A;  2ARD A;  2OA1 A;  5JCI A;  2XLP A;  3AE5 A;  3WE0 A;  4EMW A;  1OJT A;  1L9C A;  4UDR A;  1DOE A;  2APG A;  4GR1 A;  2Z5X A;  2VQ7 A;  2WP5 A;  2WQY A;  4YSX A;  2QAE A;  2YLR A;  3UOV A;  3GD3 A;  3FIM B;  4OPD A;  1DOB A;  1DOC A;  3AD7 B;  3GSI A;  1Q1W A;  2X50 A;  4BK2 A;  1CF3 A;  4U2L A;  4U8N A;  2CFY A;  4ADW A;  1OJC A;  1D5T A;  3ALM A;  4NEW A;  2GH5 A;  3F8D A;  3G5S A;  4H2N A;  2YLX A;  3CIR A;  4USR A;  4CCQ A;  1D4E A;  3EPT A;  4JNA A;  2WBA A;  4NTE A;  3SFE A;  1PBD A;  4DSH A;  4C3X A;  3DJJ A;  2ZZB A;  4A6N A;  2GB0 A;  2BK5 A;  1L9D A;  1GND A;  3PS9 A;  2YLZ A;  4K7Z A;  3CTY A;  2QA2 A;  3LZX A;  2BAC A;  1P2E A;  1EL5 A;  1TDE A;  2ZZC A;  3HYW A;  1EVI A;  5TR3 A;  1PXA A;  1CJ3 A;  5M0Z A;  4B69 A;  1CC4 A;  3W4J A;  3UOZ A;  4AT0 A;  2AAQ A;  4YTP A; 
#chains in the Genus database with same CATH homology
 4EM3 A;  4YXD A;  2YVG A;  5IQ4 A;  4XXG A;  4B66 A;  4H4T A;  1E7P A;  2GR0 A;  3AD9 B;  2BK3 A;  4YSH A;  2GR1 A;  3P9U A;  3ALL A;  2YM1 A;  1CC6 A;  3UTG A;  2BXS A;  3GD4 A;  2YLW A;  2R0C A;  1GT8 A;  1PHH A;  3C4N A;  3SM8 A;  4K5S A;  5U25 A;  3VRB A;  1SEZ A;  2DKH A;  3DH9 A;  4JN9 A;  1JEH A;  3D1C A;  1GV4 A;  2YG4 A;  1JOA A;  2YLT A;  2WOV A;  1LV0 A;  3QVR A;  4Z2T A;  3CN8 A;  1ZOV A;  4GAV A;  3VR9 A;  1GAL A;  2JB1 A;  2TMD A;  5JCL A;  1Y56 A;  1GER A;  4LA1 A;  1JRY A;  4CY6 A;  1RSG A;  3ISH A;  1M6I A;  4NNJ A;  5J60 A;  2XLU A;  3T0K A;  3EAN A;  5GRT A;  3B3R A;  4K2X A;  2EQ7 A;  2I0Z A;  4USQ A;  1TDF A;  3NLC A;  3BI5 A;  3S5W A;  1NEN A;  4TM3 A;  1YQ4 A;  2BRA A;  1PBB A;  2XLR A;  1NHQ A;  2B76 A;  3P4S A;  4B64 A;  2IID A;  4U8O A;  2WES A;  2XFP A;  3LAD A;  4GUV A;  3W4I A;  2WU5 A;  1C0L A;  1EL7 A;  4AP3 A;  4JNQ A;  4EIQ A;  3DJD A;  2W0H A;  3NK0 X;  3ICS A;  2WHD A;  1IJH A;  2Q7V A;  3NNE A;  3AE1 A;  4GAP A;  3VRA A;  3NYE A;  5KOX A;  1H83 A;  3AE4 A;  3B6D A;  1X31 B;  3P1W A;  4TM1 A;  1D4D A;  3FBS A;  5EB4 A;  2Y6Q A;  2FBW A;  4A7A A;  5LV9 A;  1EBD A;  1DNC A;  1REO A;  2A89 A;  1PBE A;  1TDN A;  5EOW A;  5HYM A;  1GPE A;  3ABV A;  3AEC A;  2Q0K A;  3RHA A;  2GVC A;  3QFB A;  2GF3 A;  2WET A;  2VVL A;  2BCP A;  2C70 A;  3UOX A;  4Y4M A;  3DJE A;  3G5R A;  5IPY A;  3LXD A;  4U8L A;  3JSK A;  3NGC X;  4GF7 A;  4GDE A;  5KNL A;  2A87 A;  3SX6 A;  2GQW A;  2UZZ A;  3AEE A;  3DK8 A;  1N4U A;  3M13 A;  1FEB A;  3AEA A;  4YJD A;  1TYP A;  2JBV A;  4EMI A;  1D7Y A;  1CC2 A;  3C4A A;  4J2W A;  4YSZ A;  1ZMD A;  4D04 A;  3E1T A;  3CGD A;  4WCT A;  3L8K A;  3ZNP A;  4JY3 A;  4C3Y A;  2YM2 A;  3D8X A;  3SGL A;  4K5R A;  4OPG A;  3SXI A;  3SZF A;  3F8R A;  2R46 A;  1V59 A;  5KMP A;  5KVH A;  1QJD A;  2WDR A;  2XYO A;  4AP1 A;  1PN0 A;  3UKH A;  4YT0 A;  2XFN A;  1CJ4 A;  2JB2 A;  4J34 A;  1PXB A;  2YR4 A;  3V3N A;  5HXI A;  4YJH A;  1TRB A;  4KPR A;  2VRM A;  3H8L A;  1NHR A;  1F8W A;  1LPF A;  3UP5 A;  1Q1R A;  2JB3 A;  3NTD A;  2Q6U A;  4QFD A;  2BYB A;  4ICY A;  3ICT A;  3VRD B;  1N1P A;  3SQP A;  1GRB A;  2F5Z A;  5U1O A;  4II2 A;  5C2T A;  2V3A A;  3NKS A;  3Q6J A;  1F8R A;  1C0K A;  2RGH A;  4FK1 A;  4NTC A;  1KNR A;  4LII A;  4H50 A;  2GRT A;  4P9S A;  2RGO A;  3GWF A;  4TM0 A;  4YJF A;  4APN A;  1GES A;  1IUU A;  4H4V A;  3AE2 A;  1E39 A;  1OJD A;  3P4Q A;  4YKG A;  1IUX A;  3RP6 A;  2YQU A;  2GR3 A;  3AD8 B;  2BC0 A;  1C0P A;  5IQ1 A;  4YSY A;  3NIX A;  3SZ0 A;  5C3J A;  4NEV A;  4Z44 A;  4EQX A;  5FS6 A;  3RP7 A;  3SZW A;  3F8P A;  2YVJ A;  2DKI A;  2YG3 A;  4N9X A;  4Y4L A;  3V3O A;  3HYV A;  3ZNN A;  2XDO A;  2QCU A;  1H6V A;  4H4P A;  4K8D A;  1LVL A;  3CNP A;  1N4V A;  3ZNO A;  4NZH A;  2E1M A;  2IVE A;  4G6H A;  1KFY A;  2C64 A;  1FCD A;  4DNA A;  2TPR A;  3KLJ A;  2GMH A;  2GQF A;  2R4E A;  1PJ5 A;  3NT6 A;  2CUL A;  3AEG A;  2E5V A;  1ONF A;  2QA1 A;  4YJH B;  1ZOY A;  2WDV A;  2WDQ A;  2BS2 A;  1K4Q A;  3FG2 P;  3K7M X;  3NN6 X;  2C3D A;  4HA6 A;  4OPT A;  4CBQ A;  1KSU A;  4Z43 A;  2ZBW A;  1DJN A;  2XVF A;  3QSS A;  1H81 A;  4IA6 A;  2C3C A;  2YG5 A;  2J3N A;  4OPL A;  1VG9 A;  3OC4 A;  3CND A;  3RNM A;  4CNK A;  3QSE A;  5KMQ A;  3DK4 A;  2V61 A;  1PJ7 A;  1S3B A;  2B9W A;  3ALJ A;  4U8M A;  2XCG A;  3AE3 A;  3LZW A;  4J56 A;  1P2H A;  2R0G A;  2XFQ A;  1NPX A;  3NHO X;  2B9X A;  3BHK A;  2HQM A;  2B7R A;  5EBK A;  3T2Y A;  2CVJ A;  2X3N A;  1N4W A;  1TYT A;  4J33 A;  3R9U A;  3K30 A;  2R9Z A;  1KF6 A;  4AOS A;  4NTD A;  1BGN A;  4D03 A;  2BXR A;  1KIF A;  4A5L A;  2YLS A;  2WPF A;  4K22 A;  1L0V A;  4OPC A;  2EQ9 A;  1GSN A;  3FPZ A;  4NWZ A;  5KVI A;  2X8G A;  4OPU A;  4A6N B;  3QVP A;  2AR8 A;  3GYX A;  3II4 A;  4H4Q A;  5JCK A;  1B4V A;  2OAL A;  3CPJ G;  2AQJ A;  1GTH A;  3CUK A;  3ZYX A;  4G74 A;  2FJD A;  1O5W A;  1YY5 A;  3CPI G;  2R4J A;  2YVF A;  4H4R A;  5HHF A;  1ZP0 A;  3L1R A;  4O5Q A;  3RP8 A;  4YJG A;  3AEF A;  1ZDL A;  2JAE A;  2XVH A;  3VR8 A;  1H7W A;  4XWR A;  2PHH A;  2WP9 A;  1IUV A;  1DDO A;  3K7T A;  4AT2 A;  3T2Z A;  4H4X A;  2GV8 A;  2O9Z A;  1O95 A;  1BKW A;  2FJB A;  2IVD A;  3M12 A;  4GCM A;  1E1N A;  1KNP A;  3C96 A;  4BJZ A;  3UTF A;  2E49 A;  1M64 A;  1RP0 A;  4JDR A;  1GRG A;  1ZMC A;  4U8J A;  2Z5Y A;  3Q9T A;  4CNJ A;  3EF6 A;  4RG4 A;  4TM4 A;  4H2P A;  1MO9 A;  1GET A;  3GMB A;  5JCM A;  1Q9I A;  2VVL G;  3GRS A;  1Z6L A;  1TDO A;  1FL2 A;  3GRT A;  1IUW A;  3AWI A;  3DK9 A;  4E0V A;  5BVA A;  1VQW A;  3GDN A;  1GRA A;  2C73 A;  3UKP A;  5FS9 A;  4H4Y A;  4EQR A;  2V3B A;  1GRH A;  2WEU A;  2E82 A;  1E1M A;  2C4C A;  4FK1 C;  3COX A;  3S61 A;  1Y56 B;  5KMS A;  1BGJ A;  2Q0L A;  3DGZ A;  1BWC A;  2BA9 A;  3KKJ A;  2B7S A;  1B5Q A;  3I6D A;  1GRF A;  1PDH A;  5L46 A;  4H7U A;  3SY4 A;  4BUR A;  1GRE A;  1PJ6 A;  4BJY A;  2X8C A;  1KSS A;  3NYF A;  4FX9 A;  1JU2 A;  3GYJ A;  5JCN A;  5FS7 A;  2H88 A;  4H4Z A;  2C66 A;  1E1L A;  1H7X A;  2JKC A;  3GWD A;  5BUL A;  1D4C A;  1PBC A;  2C75 A;  2RAB A;  3AE7 A;  3KPK A;  4LU6 A;  4A9W A;  1YQZ A;  4A99 A;  1CBO A;  5GSN A;  3AXB A;  5U63 A;  3ATQ A;  3UKK A;  1MOK A;  1NG3 A;  3DME A;  3IF9 A;  1PS9 A;  3H8I A;  4RG3 A;  3UKQ A;  4B63 A;  1VG0 A;  2XFO A;  2VOU A;  4EIP A;  3M0O A;  2GAG B;  5KXJ A;  3BHF A;  1COY A;  2C67 A;  2E4A A;  1BZL A;  1K0L A;  3AED A;  4PAA A;  1VDC A;  3GDP A;  4G73 A;  4J31 A;  4REK A;  3T2K A;  1B37 A;  1NEK A;  5FS8 A;  3ZDN A;  4X4J A;  3LOV A;  4B1B A;  1MXT A;  2ACZ A;  3QFA A;  2GMJ A;  1ZX9 A;  4OCG A;  3UKF A;  3W4K A;  3K7Q X;  2BS3 A;  2Y6R A;  5CKU A;  3AEB A;  1ELI A;  4II3 A;  4DSG A;  3OZ2 A;  2C65 A;  3ITJ A;  1JRZ A;  4ECH A;  2VVM A;  4Z26 A;  3GMC A;  3PVC A;  1DXL A;  2V60 A;  1F6M A;  4JQ9 A;  1EL9 A;  1NHS A;  3HYX A;  3CNS A;  4FDC B;  4C74 A;  2NPX A;  4G6G A;  1S3E A;  2BC1 A;  3KVE A;  3NRN A;  1F3P A;  2B9Y A;  3LJP A;  5CQF A;  4EQW A;  4GRT A;  3UP4 A;  1NG4 A;  5KWF A;  4OPI A;  2WPC A;  1W4X A;  4G9K A;  1ZK7 A;  2EQ6 A;  2X8H A;  2YR6 A;  2BCG G;  3CGC A;  5DBJ A;  1GXF A;  1CJC A;  1JRX A;  2JK6 A;  4GDP A;  4TLX A;  3P4R A;  3UOY A;  3UTE A;  4H4S A;  2YR5 A;  1XAN A;  2WOI A;  3SZC A;  3AE9 A;  5KMR A;  4X9N A;  1RYI A;  3AE6 A;  4OVI A;  4TLZ A;  1S2Y A;  4J57 A;  4A65 A;  4A79 A;  4Z25 A;  3NYC A;  2NVK X;  4KX6 A;  4UDP A;  4WX1 A;  5KOW A;  1DJQ A;  1F8S A;  4B67 A;  4RSL A;  2E48 A;  2XVI A;  1CJ2 A;  3AE8 A;  3FMW A;  4YKF A;  4Z24 A;  5HY5 A;  3GYI A;  1D7L A;  3CGB A;  4YJF B;  3NTA A;  4M52 A;  2WU2 A;  4IV9 A;  4U2S A;  2GR2 A;  1UKV G;  4XWZ A;  1O94 A;  4B68 A;  4CRT A;  4ZN0 A;  2PYX A;  1KDG A;  4YTN A;  3ADA B;  1K0I A;  1EL8 A;  3BNU A;  2BRY A;  1DAO A;  2OLO A;  2RGJ A;  3AYL A;  3T14 A;  3UKL A;  2VQB A;  2ZZ0 A;  1FEA A;  2C72 A;  2A8X A;  3CNJ A;  1IUT A;  1OJA A;  2FJA A;  2R45 A;  2H89 A;  2R0P A;  3KU9 A;  3AYI A;  1QLB A;  1IUS A;  4EMJ A;  1PXC A;  1GEU A;  2GEW A;  4JY2 A;  4H4W A;  4Z2R A;  4EM4 A;  4IVM B;  1FOH A;  1NHP A;  1AOG A;  1CHU A;  3PO7 A;  3URH A;  1C0I A;  2WP6 A;  1LJ1 A;  1FEC A;  1NDA A;  4IA5 A;  4AOX A;  3NK1 X;  3H4K A;  2BAB A;  2EQ8 A;  3DA1 A;  3BI2 A;  1GTE A;  2WOW A;  3UCL A;  1JNZ A;  4I59 A;  4H2Q A;  4O5U A;  4C5O A;  2XVE A;  2VZ2 A;  2DU8 A;  2GAH B;  4BK3 A;  1OJ9 A;  2VRL A;  4J36 A;  3VQR A;  3WGT A;  2CDU A;  3CPH G;  2YWL A;  3I3L A;  1L9E A;  3QSM A;  3NN0 X;  2XLS A;  2C7G A;  1VE9 A;  5FMH A;  1B8S A;  5M10 A;  1LQU A;  1GOS A;  2FJE A;  3G5Q A;  2X99 A;  3SFD A;  1VRQ B;  4ZCC A;  3QJ4 A;  3IHG A;  3CMM A;  4BK1 A;  4IVO B;  3DGH A;  1QO8 A;  1AN9 A;  1Y0P A;  1YKJ A;  1NAA A;  2V5Z A;  2XLT A;  4HB9 A;  3T37 A;  4B65 A;  1XPQ A;  2C76 A;  2BK4 A;  3UKA A;  1LQT A;  1XDI A;  2E4G A;  3AB1 A;  3EAO A;  4MJW A;  3G3E A;  1E6E A;  2YG6 A;  4UP3 A;  3KA7 A;  1GRT A;  4U8K A;  3KD9 A;  3T31 A;  4BV6 A;  5KRQ A;  3IWA A;  4CY8 A;  3P4P A;  1ZY8 A;  3CGE A;  4C77 A;  2BS4 A;  1PBF A;  1HYU A;  2WPE A;  2WS3 A;  4UDQ A;  5BRT A;  4H4U A;  1ZKQ A;  3ATR A;  3LB8 A;  1E1K A;  1DOD A;  5EB5 A;  4U8I A;  1XHC A;  1K0J A;  3HZL A;  3NG7 X;  4Z2U A;  5BUK A;  3AYJ A;  2YAU A;  3NK2 X;  1CL0 A;  2XVJ A;  1H84 A;  4YJG B;  2OAM A;  4YTM A;  4PAB A;  3IHM A;  3NH3 X;  3KPF A;  1H86 A;  1LTX R;  3CNT A;  3BNM A;  1H82 A;  4X9M A;  3ZNQ A;  1YQ3 A;  4ZCD A;  3SYI A;  4I58 A;  4DGK A;  3RED A;  5ER0 A;  2V6O A;  1TDK A;  4QFC A;  2YG7 A;  5J7X A;  3UTH A;  1S2Q A;  4CCR A;  3V76 A;  3DJG X;  2OLN A;  1BF3 A;  4Y4N A;  3ICR A;  3BI4 A;  3IC9 A;  2XFU A;  4H2R A;  4U2T A;  1JNR A;  3O0H A;  4U8P A;  4YWO A;  4EQS A;  2ARD A;  2OA1 A;  5JCI A;  2XLP A;  3AE5 A;  3WE0 A;  4EMW A;  1OJT A;  1L9C A;  4UDR A;  1DOE A;  2APG A;  4GR1 A;  2Z5X A;  2VQ7 A;  2WP5 A;  2WQY A;  4YSX A;  2QAE A;  2YLR A;  3UOV A;  3GD3 A;  3FIM B;  4OPD A;  1DOB A;  1DOC A;  3AD7 B;  3GSI A;  1Q1W A;  2X50 A;  1CF3 A;  4U2L A;  4U8N A;  4ADW A;  2CFY A;  4BK2 A;  1OJC A;  1D5T A;  3ALM A;  4NEW A;  2GH5 A;  3F8D A;  3G5S A;  4H2N A;  2YLX A;  3CIR A;  4USR A;  4CCQ A;  1D4E A;  3EPT A;  4JNA A;  2WBA A;  4NTE A;  3SFE A;  1PBD A;  4DSH A;  4C3X A;  3DJJ A;  2ZZB A;  4A6N A;  2GB0 A;  2BK5 A;  1L9D A;  1GND A;  3PS9 A;  2YLZ A;  4K7Z A;  3CTY A;  2QA2 A;  3LZX A;  2BAC A;  1P2E A;  1EL5 A;  1TDE A;  2ZZC A;  3HYW A;  1EVI A;  5TR3 A;  1PXA A;  1CJ3 A;  5M0Z A;  4B69 A;  1CC4 A;  3W4J A;  3UOZ A;  4AT0 A;  2AAQ A;  4YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...