1B5QA

A 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A 30-angstrom-long U-shaped catalytic tunnel in the crystal structure of polyamine oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (POLYAMINE OXIDASE)
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1b5qA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1b5qA02
3LOVA 2B7SA 1KF6A 3CNTA 4B1BA 5IQ4A 2ZZ0A 3AYLA 4CY6A 2B9XA 4IA5A 4O5QA 2QCUA 3KA7A 2YM2A 4K5SA 1PHHA 3LZXA 1FCDA 2JK6A 1N4UA 4H4RA 4U8JA 3H8IA 4K7ZA 5KRQA 1GALA 2QA1A 4H2QA 2BA9A 3BNMA 4J2WA 4ADWA 1E7PA 4K22A 3VR8A 2RGOA 4DSGA 2H88A 2BCGG 2Q7VA 4BURA 3NT6A 1H81A 3QSEA 5U25A 2E1MA 3NKSA 4UDRA 2RGJA 1MXTA 5KWFA 4Z24A 4BV6A 4H50A 3R9UA 4YTNA 4YXDA 1YQZA 5U63A 4U8IA 2Q0KA 2VQBA 1S3EA 2YVJA 4MJWA 2Z5YA 2WPFA 4CNJA 1ZOYA 2C3DA 1JRYA 3PO7A 4YWOA 4B69A 5HY5A 4Z2UA 1Y0PA 4Z25A 1NENA 3AD9B 3SFEA 4K5RA 4YSZA 1MOKA 5BULA 2XVEA 3NNEA 2W0HA 2EQ7A 4GRTA 3FIMB 3C4NA 5BRTA 1GNDA 1TRBA 5FS8A 4AT2A 1VQWA 1GPEA 4OPGA 2XFPA 1PJ6A 4DGKA 4U2LA 1GXFA 2WOVA 1LJ1A 4DSHA 3ADAB 3AYJA 5M10A 1NHSA 2R45A 4Y4LA 1ZMCA 1XDIA 5GRTA 1PBCA 1COYA 1OJAA 2XLSA 3ALLA 4J57A 4YSHA 3M12A 1E39A 1LV0A 2BK3A 2GV8A 2GAHB 1K0JA 3NG7X 1GESA 1JRXA 3FBSA 5KOWA 2X99A 2Y6RA 1H7WA 4XWZA 4FX9A 1XANA 4NTCA 5EB5A 5EB4A 5JCMA 3IWAA 4YSXA 3F8DA 3V76A 4ZCDA 4NEWA 3BHKA 1JRZA 3O0HA 2YG5A 3H8LA 2X8CA 3VRAA 1TDEA 3P1WA 5CKUA 2VOUA 3CNJA 1PBEA 2WBAA 3AE1A 3NGCX 3KU9A 3AEBA 3UOXA 4AOSA 1JEHA 1GV4A 3CGCA 1GETA 1GOSA 1NEKA 2V60A 4EMIA 2JB2A 3IHMA 2XVHA 1H83A 1XPQA 1H86A 2C65A 2UZZA 3CIRA 4RG4A 4GR1A 2C76A 4GUVA 4H4ZA 1BF3A 5IQ1A 4BJZA 1H82A 4H4VA 3CGBA 4BK2A 3F8PA 2E4GA 4HB9A 4A99A 5JCLA 1DJQA 3GD3A 5ER0A 2FJBA 2YM1A 3UTHA 1L9DA 3AYIA 4NTEA 2WPEA 4OPDA 1CC2A 4REKA 3GWFA 1L0VA 4XXGA 1E6EA 3HZLA 2YG6A 1B37A 2BACA 2VZ2A 2X3NA 1QJDA 4OPIA 3ICRA 3D1CA 1IUWA 3T37A 1CC6A 2WETA 2RABA 3GRTA 4U2SA 3AEEA 3C96A 3NYCA 5CQFA 3H4KA 1KFYA 2YQUA 1QO8A 5C3JA 1MO9A 1IUSA 5TR3A 2BXSA 3QVRA 2FJAA 1CHUA 1Y56B 3ABVA 4A6NB 4RSLA 3S61A 3NN0X 3WE0A 4OVIA 1E1NA 1O5WA 3Q9TA 3FPZA 1D5TA 1V59A 2R0CA 5FS9A 3NTDA 1CJ3A 1Q9IA 3QVPA 4J36A 2WQYA 2VVMA 1RYIA 3M0OA 5C2TA 3DJEA 1AOGA 1DNCA 2A87A 1YQ3A 3UKLA 3UP5A 4YTPA 2I0ZA 3ITJA 2GVCA 1CC4A 4FDCB 2GAGB 2JKCA 4BK1A 3NIXA 3AD8B 1OJCA 2WEUA 2C70A 1DOBA 4TM1A 2R4JA 1BWCA 3AE7A 4Z2TA 3LJPA 1ONFA 2ACZA 1TYPA 2GR1A 2WDVA 2BK4A 1H7XA 4UP3A 3AB1A 1E1MA 2VRMA 4A9WA 3LADA 1LVLA 1W4XA 2GRTA 3DA1A 4CCQA 1PXAA 1PJ5A 1X31B 1S2QA 3I3LA 5JCIA 3CPJG 4IVMB 2AR8A 1IJHA 1VRQB 2GMJA 3P4RA 4PAAA 4WX1A 4OPTA 3GD4A 3UTFA 1S3BA 4JY2A 1IUVA 1ZP0A 1D7LA 5KVHA 4H4TA 3RHAA 1ZDLA 3P4SA 2B76A 1NHPA 3CGDA 3DGHA 4H4PA 1DOEA 2B7RA 3PVCA 1YQ4A 2TPRA 4U8LA 3AECA 4CRTA 1IUXA 1DOCA 1GTEA 2GR0A 4C3XA 2R4EA 1GRAA 1N1PA 2GEWA 3DJJA 2BS4A 3JSKA 4J56A 4RG3A 1NHQA 3DJGX 3UKQA 4H2PA 2EQ6A 5KXJA 3UOYA 4Y4NA 3VRBA 4I58A 1GRGA 5J60A 4C77A 2AQJA 5EOWA 1TDNA 5LV9A 2PYXA 1DODA 2GMHA 2WOWA 3ISHA 4U8KA 2BCPA 4EMJA 3SQPA 2BXRA 5U1OA 1F8SA 1NG3A 2WESA 4J33A 2YVFA 2YR5A 3NH3X 3AE8A 4BK3A 2X8GA 3CNDA 4U8OA 1B8SA 3K7TA 2XFUA 1YKJA 2EQ8A 3GYJA 3GYIA 3ALJA 4U8NA 2JB3A 4YTMA 1QLBA 1N4WA 3L1RA 4IV9A 1XHCA 4EQXA 4CBQA 2YLRA 4KX6A 1TYTA 3EPTA 3IF9A 3AE3A 4EQSA 1F6MA 1GRHA 4FK1C 4CNKA 5L46A 1NDAA 2CVJA 1B4VA 4K2XA 4KPRA 5HXIA 2WS3A 3DK4A 2V61A 4USQA 1PBFA 2FJEA 3Q6JA 3SGLA 4OPLA 2XVFA 3M13A 3RP7A 1LPFA 3QSMA 4H4UA 2C73A 1O95A 2OAMA 2ZBWA 2X50A 2QA2A 1DXLA 1EL8A 3ATQA 1FOHA 1B5QA 1PN0A 3AE4A 4ZN0A 5FS6A 1KSUA 4JQ9A 1ZKQA 2WU5A 3F8RA 3B6DA 3DMEA 4GDEA 2YWLA 4U2TA 2GQFA 4B66A 3AEDA 4AOXA 3PS9A 4HA6A 3B3RA 1NAAA 1PXBA 2C66A 1F8WA 2HQMA 1PS9A 1NG4A 3UTEA 4APNA 1Z6LA 4XWRA 5DBJA 4UDQA 1PJ7A 3ICTA 5JCKA 2APGA 4H4QA 3DGZA 2YLZA 4AT0A 2GF3A 3CN8A 2DKIA 3E1TA 4GDPA 4C5OA 2OALA 4UDPA 1NHRA 2XFOA 3BNUA 4O5UA 3UCLA 4H2NA 1IUTA 3AEGA 2A89A 3NYEA 4YKFA 1GTHA 3COXA 1N4VA 3C4AA 1UKVG 4EQRA 3QJ4A 1FECA 4B63A 4M52A 3IHGA 3VR9A 4EIQA 1GRTA 3G5RA 2WHDA 4ZCCA 3G5SA 5GSNA 2YG3A 1ZOVA 2O9ZA 1CF3A 2BC1A 3VRDB 3UKPA 3QSSA 5HYMA 1CJ2A 5FMHA 4LU6A 4A5LA 3GSIA 5J7XA 4J34A 4X9NA 1BGJA 4A6NA 4B67A 2PHHA 1NPXA 3BI2A 3NTAA 1GRBA 4AP1A 1ZK7A 2WOIA 1BZLA 4YT0A 1FEAA 1KDGA 3I6DA 2BC0A 1OJDA 2XFNA 3P4PA 2TMDA 4U8PA 5JCNA 3GWDA 1K4QA 4I59A 1O94A 4IVOB 3P9UA 4USRA 4JNQA 2GR3A 3CTYA 2C3CA 3BI4A 3NHOX 3UKFA 1P2HA 2YR4A 4U8MA 1K0IA 3NN6X 1BGNA 3BI5A 4GCMA 3OC4A 3KPFA 3AXBA 1OJ9A 2EQ9A 3AEAA 3CNSA 3DH9A 4C3YA 4H7UA 4TM4A 2C64A 2IIDA 2WDRA 4Y4MA 4ICYA 3V3OA 2NVKX 3ZYXA 4JN9A 1EL5A 1IUUA 1ZMDA 3DK8A 4LIIA 2XFQA 4Z2RA 5HHFA 2WP9A 1ELIA 1CBOA 3KLJA 3L8KA 5KOXA 1LQUA 4YSYA 2Q0LA 2XLPA 3IC9A 2YLXA 3NLCA 4Z44A 3UKHA 1VG9A 4DNAA 1HYUA 4B64A 2BS3A 4EM3A 4PABA 3OZ2A 1E1LA 4D03A 2BYBA 3NK0X 1PBDA 2R0GA 5KVIA 3NYFA 4BJYA 4JY3A 1FEBA 3EANA 1RP0A 2YG4A 3CGEA 1REOA 4TM0A 3FMWA 2A8XA 4YKGA 3LXDA 1EBDA 3SFDA 3BHFA 3CNPA 1BKWA 4TM3A 2QAEA 3GDPA 4ECHA 1M6IA 1SEZA 2E5VA 1FL2A 2JAEA 3QFBA 1D4DA 1EL9A 1TDKA 2J3NA 3UOVA 2ARDA 2GB0A 4OCGA 1M64A 4JDRA 4B68A 1JNZA 2C75A 2X8HA 2YLWA 1L9EA 3GRSA 3LZWA 1P2EA 4K8DA 3KD9A 2YLSA 2F5ZA 2YG7A 4NEVA 4OPCA 1JOAA 1PDHA 2VVLA 3NRNA 4WCTA 1Q1WA 1GSNA 2WP5A 2ZZBA 2CDUA 1LQTA 1D4EA 3P4QA 4P9SA 2V3BA 3AEFA 1K0LA 1DJNA 3CPHG 4N9XA 4AP3A 3II4A 4H4XA 1E1KA 1S2YA 3AD7B 1PXCA 3NK2X 2BS2A 3URHA 4Z43A 3UKKA 5EBKA 3UTGA 3D8XA 3LB8A 1JU2A 4A65A 4A79A 4CCRA 3EF6A 2ZZCA 1CJCA 3AE9A 3RNMA 2IVEA 3UKAA 2BABA 4EQWA 3VQRA 1OJTA 2DKHA 1GT8A 2R46A 5BUKA 3K30A 2C7GA 3ATRA 4Z26A 2XYOA 2XCGA 2OLOA 1L9CA 2AAQA 3GDNA 1VDCA 3EAOA 2CULA 2VVLG 2YAUA 5IPYA 2OLNA 1PBBA 2GQWA 2V6OA 2YLTA 2OA1A 1CL0A 1F8RA 2XLRA 1ZX9A 4TLXA 3G5QA 3GMBA 4H2RA 2XVJA 2RGHA 2V3AA 4LA1A 2XDOA 2V5ZA 3K7MX 4H4YA 3CPIG 3QFAA 4GF7A 1KNPA 1CJ4A 4X4JA 2XLTA 1YY5A 2IVDA 1KSSA 4E0VA 3RP6A 3FG2P 1KNRA 1GRFA 2CFYA 3GMCA 1H84A 5M0ZA 1GEUA 2WDQA 3AWIA 1EL7A 1TDFA 2BK5A 4EMWA 2GH5A 2YVGA 4TLZA 1Y56A 1JNRA 4JNAA 2WPCA 1TDOA 2R0PA 3K7QX 4J31A 3REDA 2Z5XA 2XLUA 3UP4A 3SM8A 1Q1RA 3AE6A 4IA6A 4X9MA 3AE2A 3RP8A 2FBWA 3ALMA 4NTDA 2B9YA 2H89A 4A7AA 2Q6UA 1RSGA 4EIPA 2WP6A 1D4CA 1H6VA 1LTXR 3KKJA 3ZDNA 2NPXA 3AE5A 3DJDA 1D7YA 1VG0A 3DK9A 5FS7A 2JBVA 2GR2A 4C74A 1GERA 4B65A 2R9ZA 1ZY8A 5BVAA 4NZHA 4FK1A 2XVIA 4D04A 3V3NA 3UOZA 1GREA 4H4WA 2C67A 3NK1X 2WU2A 2VRLA 2FJDA 3S5WA 2JB1A 2Y6QA 4OPUA 4CY8A 2C72A 4H4SA 4EM4A 2VQ7A 3ICSA 3KVEA 2YR6A 1F3PA 2B9WA
chains in the Genus database with same CATH superfamily
3LOVA 2B7SA 1KF6A 3CNTA 4B1BA 5IQ4A 2ZZ0A 3AYLA 4CY6A 2B9XA 4IA5A 4O5QA 2QCUA 3KA7A 2YM2A 4K5SA 3T0KA 1PHHA 3LZXA 1FCDA 2JK6A 1N4UA 4H4RA 4U8JA 3H8IA 4K7ZA 5KRQA 1GALA 2QA1A 4H2QA 2BA9A 3BNMA 4J2WA 4ADWA 1E7PA 4K22A 3VR8A 2RGOA 4DSGA 2H88A 2BCGG 2Q7VA 4BURA 3NT6A 1H81A 3QSEA 5U25A 2E1MA 3NKSA 4UDRA 2RGJA 1MXTA 2BRYA 4Z24A 5KWFA 4BV6A 3SY4A 4H50A 3R9UA 4YTNA 4YXDA 1YQZA 5U63A 3T31A 4U8IA 2Q0KA 2VQBA 1S3EA 2YVJA 4MJWA 2Z5YA 2WPFA 4CNJA 1ZOYA 2C3DA 1JRYA 3PO7A 4YWOA 4B69A 5HY5A 4Z2UA 1Y0PA 4Z25A 1NENA 3AD9B 3SFEA 4K5RA 4YSZA 3T14A 1MOKA 5BULA 2XVEA 3NNEA 2W0HA 2EQ7A 4GRTA 3FIMB 3C4NA 5BRTA 5KMRA 1GNDA 1TRBA 5FS8A 4AT2A 1VQWA 1GPEA 4OPGA 2XFPA 1PJ6A 4DGKA 4U2LA 1GXFA 2WOVA 3KPKA 1LJ1A 4DSHA 3ADAB 3AYJA 5M10A 1NHSA 2R45A 4Y4LA 1ZMCA 1XDIA 5GRTA 1PBCA 1COYA 1OJAA 2XLSA 3ALLA 4J57A 4YSHA 3M12A 1E39A 1LV0A 2BK3A 3HYVA 2GV8A 2GAHB 1K0JA 3NG7X 1GESA 1JRXA 3FBSA 5KOWA 2X99A 2Y6RA 1H7WA 4XWZA 4FX9A 1XANA 4NTCA 5EB5A 5EB4A 5JCMA 3IWAA 4YSXA 3F8DA 3V76A 4ZCDA 4NEWA 3BHKA 1JRZA 3O0HA 2YG5A 3H8LA 2X8CA 3VRAA 1TDEA 3P1WA 5CKUA 2VOUA 3CNJA 1PBEA 2WBAA 3AE1A 3NGCX 3KU9A 3AEBA 3UOXA 4AOSA 1JEHA 1GV4A 3CGCA 3SXIA 1GETA 1GOSA 1NEKA 2V60A 4EMIA 2JB2A 3IHMA 2XVHA 1H83A 1XPQA 1H86A 2C65A 2UZZA 3CIRA 4RG4A 4GR1A 2C76A 4GUVA 4H4ZA 1BF3A 5IQ1A 4BJZA 1H82A 4H4VA 3CGBA 4BK2A 3F8PA 2E4GA 4HB9A 4A99A 5JCLA 1DJQA 3GD3A 5ER0A 2FJBA 2YM1A 3UTHA 1L9DA 3AYIA 4NTEA 2WPEA 4OPDA 1CC2A 4REKA 3GWFA 1L0VA 4XXGA 1E6EA 3HZLA 2YG6A 1B37A 2BACA 2VZ2A 2X3NA 1QJDA 4OPIA 3ICRA 3D1CA 1IUWA 3T37A 1CC6A 2WETA 2RABA 3GRTA 4U2SA 3AEEA 3C96A 3NYCA 5CQFA 3H4KA 1KFYA 2YQUA 1QO8A 5C3JA 1MO9A 1IUSA 5TR3A 2BXSA 3QVRA 2FJAA 1CHUA 1Y56B 3ABVA 4A6NB 4RSLA 3S61A 3NN0X 3WE0A 4OVIA 1E1NA 1O5WA 3Q9TA 3FPZA 1D5TA 1V59A 2R0CA 3HYWA 5FS9A 3NTDA 1CJ3A 1Q9IA 3QVPA 4J36A 2WQYA 2VVMA 4NWZA 1RYIA 3M0OA 5C2TA 3DJEA 1AOGA 1DNCA 2A87A 3SZCA 1YQ3A 3UKLA 3UP5A 4YTPA 2I0ZA 3ITJA 2GVCA 1CC4A 4FDCB 2GAGB 2JKCA 4BK1A 3NIXA 3AD8B 1OJCA 2WEUA 3CMMA 2C70A 1DOBA 4TM1A 2R4JA 1BWCA 3AE7A 4Z2TA 3LJPA 1ONFA 2ACZA 1TYPA 2GR1A 2WDVA 2BK4A 1H7XA 4UP3A 3AB1A 1E1MA 2VRMA 4A9WA 3LADA 1LVLA 1W4XA 2GRTA 3DA1A 4CCQA 1PXAA 1PJ5A 1X31B 1S2QA 3I3LA 5JCIA 3CPJG 4IVMB 2AR8A 1IJHA 1VRQB 2GMJA 3P4RA 4PAAA 4WX1A 4OPTA 3GD4A 3UTFA 1S3BA 4JY2A 1IUVA 1ZP0A 1D7LA 5KVHA 4H4TA 3RHAA 1ZDLA 3P4SA 2B76A 1NHPA 3CGDA 3DGHA 4G6GA 4H4PA 1DOEA 2B7RA 3PVCA 1YQ4A 2TPRA 4U8LA 3AECA 4CRTA 1IUXA 1DOCA 1GTEA 2GR0A 4C3XA 2R4EA 1GRAA 1N1PA 2GEWA 3DJJA 2BS4A 3JSKA 4J56A 4RG3A 1NHQA 3DJGX 3UKQA 4H2PA 2EQ6A 5KXJA 3UOYA 4Y4NA 3VRBA 4I58A 1GRGA 5J60A 4C77A 3HYXA 2AQJA 5EOWA 1TDNA 5LV9A 2PYXA 1DODA 2GMHA 2WOWA 3ISHA 4U8KA 2BCPA 4EMJA 3SQPA 2BXRA 5U1OA 1F8SA 1NG3A 2WESA 4J33A 2YVFA 2YR5A 3NH3X 3AE8A 4BK3A 2X8GA 3CNDA 4U8OA 1B8SA 3K7TA 2XFUA 1YKJA 2EQ8A 3GYJA 3GYIA 3ALJA 4U8NA 2JB3A 4YTMA 4G6HA 1QLBA 1N4WA 3L1RA 4IV9A 1XHCA 4EQXA 4CBQA 2YLRA 4KX6A 1TYTA 3EPTA 3IF9A 3AE3A 4EQSA 1F6MA 1GRHA 4FK1C 4CNKA 5L46A 1NDAA 2CVJA 1B4VA 4K2XA 4KPRA 5HXIA 2WS3A 3DK4A 2V61A 4USQA 1PBFA 2FJEA 3Q6JA 3SGLA 4OPLA 2XVFA 3M13A 3RP7A 1LPFA 3QSMA 4H4UA 2C73A 1O95A 2OAMA 2ZBWA 2X50A 2QA2A 1DXLA 1EL8A 3ATQA 1FOHA 1B5QA 1PN0A 3AE4A 4ZN0A 5FS6A 1KSUA 4JQ9A 1ZKQA 2WU5A 3F8RA 3B6DA 3DMEA 4GDEA 2YWLA 4U2TA 2GQFA 4B66A 3AEDA 4AOXA 3PS9A 5KMPA 4HA6A 3B3RA 1NAAA 1PXBA 2C66A 1F8WA 2HQMA 1PS9A 1NG4A 3UTEA 4APNA 1Z6LA 4XWRA 5DBJA 4GAPA 4UDQA 1PJ7A 3ICTA 5JCKA 2APGA 4H4QA 3DGZA 2YLZA 4AT0A 2GF3A 3CN8A 2DKIA 3E1TA 4GDPA 4C5OA 2OALA 4UDPA 1NHRA 2XFOA 3BNUA 4O5UA 3UCLA 4H2NA 1IUTA 3AEGA 2A89A 3NYEA 4YKFA 1GTHA 3COXA 1N4VA 3C4AA 1UKVG 4G74A 3QJ4A 1FECA 4EQRA 4B63A 4M52A 3IHGA 3VR9A 4EIQA 1GRTA 5KMSA 3G5RA 2WHDA 4ZCCA 3G5SA 5GSNA 2YG3A 1ZOVA 2O9ZA 1CF3A 2BC1A 3SYIA 3VRDB 3UKPA 3QSSA 5HYMA 1CJ2A 5FMHA 4LU6A 4A5LA 3GSIA 3SZWA 5J7XA 4J34A 4X9NA 1BGJA 4A6NA 4B67A 2BRAA 2PHHA 1NPXA 3BI2A 3NTAA 1GRBA 4II2A 1ZK7A 2WOIA 1BZLA 4AP1A 4YT0A 1FEAA 1KDGA 3I6DA 2BC0A 1OJDA 2XFNA 3P4PA 2TMDA 4U8PA 5JCNA 3GWDA 1K4QA 4I59A 1O94A 4IVOB 3P9UA 4USRA 4JNQA 2GR3A 3CTYA 2C3CA 3BI4A 3NHOX 3UKFA 1P2HA 2YR4A 4U8MA 1K0IA 3NN6X 1BGNA 3BI5A 4GCMA 3OC4A 3KPFA 3AXBA 1OJ9A 2EQ9A 3AEAA 3CNSA 3DH9A 4C3YA 4H7UA 4TM4A 2C64A 2IIDA 2WDRA 4Y4MA 4ICYA 3V3OA 4G9KA 2NVKX 3ZYXA 4JN9A 1EL5A 1IUUA 1ZMDA 3DK8A 4LIIA 2XFQA 4Z2RA 5HHFA 2WP9A 1ELIA 1CBOA 3KLJA 3L8KA 5KOXA 1LQUA 3SZFA 4YSYA 2Q0LA 2XLPA 3IC9A 2YLXA 3NLCA 4Z44A 3UKHA 1VG9A 4DNAA 1HYUA 4B64A 2BS3A 4EM3A 4PABA 3OZ2A 1E1LA 4D03A 2BYBA 3NK0X 1PBDA 2R0GA 5KVIA 3NYFA 4BJYA 4JY3A 1FEBA 3EANA 1RP0A 2YG4A 3CGEA 4II3A 1REOA 4TM0A 3FMWA 2A8XA 4YKGA 3LXDA 1EBDA 3SFDA 3BHFA 3CNPA 1BKWA 4TM3A 2QAEA 3GDPA 4ECHA 1M6IA 1SEZA 2E5VA 3T2ZA 1FL2A 2JAEA 3QFBA 1D4DA 1EL9A 1TDKA 2J3NA 3UOVA 2ARDA 2GB0A 4OCGA 1M64A 4JDRA 4B68A 1JNZA 2C75A 2X8HA 2YLWA 1L9EA 3GRSA 3LZWA 1P2EA 4K8DA 3KD9A 2YLSA 2F5ZA 2YG7A 4NEVA 4OPCA 1JOAA 1PDHA 2VVLA 3NRNA 4WCTA 1Q1WA 1GSNA 2WP5A 2ZZBA 2CDUA 1LQTA 1D4EA 3P4QA 4P9SA 2V3BA 3AEFA 1K0LA 1DJNA 3CPHG 4N9XA 4AP3A 3II4A 4H4XA 1E1KA 1S2YA 5KMQA 3SX6A 3AD7B 1PXCA 3NK2X 2BS2A 3URHA 4Z43A 3UKKA 4G73A 5EBKA 3UTGA 3D8XA 3LB8A 1JU2A 4A65A 4A79A 4CCRA 3EF6A 2ZZCA 1CJCA 3AE9A 3RNMA 2IVEA 3UKAA 2BABA 4EQWA 3VQRA 1OJTA 2DKHA 1GT8A 2R46A 5BUKA 3K30A 2C7GA 3ATRA 4Z26A 2XYOA 2XCGA 2OLOA 1L9CA 2AAQA 3GDNA 1VDCA 3EAOA 2CULA 2VVLG 2YAUA 5IPYA 4GAVA 2OLNA 1PBBA 2GQWA 2V6OA 2YLTA 4NNJA 2OA1A 1CL0A 1F8RA 2XLRA 1ZX9A 4TLXA 3G5QA 3GMBA 4H2RA 2XVJA 2RGHA 2V3AA 4LA1A 2XDOA 3SZ0A 2V5ZA 3K7MX 4H4YA 3CPIG 3QFAA 4GF7A 1KNPA 1CJ4A 4X4JA 2XLTA 1YY5A 2IVDA 1KSSA 4E0VA 2C4CA 3RP6A 3FG2P 1KNRA 1GRFA 2CFYA 3GMCA 1H84A 5M0ZA 1GEUA 2WDQA 3AWIA 1EL7A 1TDFA 2BK5A 4EMWA 2GH5A 2YVGA 4TLZA 1Y56A 1JNRA 4JNAA 2WPCA 1TDOA 2R0PA 3K7QX 4J31A 3REDA 2Z5XA 3T2KA 2XLUA 3UP4A 3SM8A 1Q1RA 3AE6A 4IA6A 4X9MA 3AE2A 3RP8A 2FBWA 3ALMA 4NTDA 2B9YA 2H89A 4A7AA 2Q6UA 1RSGA 4EIPA 2WP6A 1D4CA 1H6VA 1LTXR 3KKJA 3ZDNA 2NPXA 3AE5A 3DJDA 1D7YA 1VG0A 3DK9A 5FS7A 2JBVA 2GR2A 4C74A 1GERA 4B65A 2R9ZA 1ZY8A 5BVAA 4NZHA 4FK1A 2XVIA 4D04A 3V3NA 3UOZA 1GREA 4H4WA 2C67A 3NK1X 5KNLA 2WU2A 2VRLA 2FJDA 3T2YA 3S5WA 2JB1A 2Y6QA 4OPUA 4CY8A 2C72A 3GYXA 4H4SA 2VQ7A 3ICSA 4EM4A 3KVEA 2YR6A 1F3PA 2B9WA
chains in the Genus database with same CATH topology
3LOVA 2B7SA 1KF6A 3CNTA 4B1BA 5IQ4A 2ZZ0A 3AYLA 4CY6A 2B9XA 4IA5A 4O5QA 2QCUA 3KA7A 2YM2A 4K5SA 3T0KA 1PHHA 3LZXA 1FCDA 2JK6A 1N4UA 4H4RA 4U8JA 3H8IA 4K7ZA 5KRQA 1GALA 2QA1A 4H2QA 2BA9A 3BNMA 4J2WA 4ADWA 1E7PA 4K22A 3VR8A 2RGOA 4DSGA 2H88A 2BCGG 2Q7VA 4BURA 3NT6A 1H81A 3QSEA 5U25A 2E1MA 3NKSA 4UDRA 2RGJA 1MXTA 2BRYA 4Z24A 5KWFA 4BV6A 3SY4A 4H50A 3R9UA 4YTNA 4YXDA 1YQZA 5U63A 3T31A 4U8IA 2Q0KA 2VQBA 1S3EA 2YVJA 4MJWA 2Z5YA 2WPFA 4CNJA 1ZOYA 2C3DA 1JRYA 3PO7A 4YWOA 4B69A 5HY5A 4Z2UA 1Y0PA 4Z25A 1NENA 3AD9B 3SFEA 4K5RA 4YSZA 3T14A 1MOKA 5BULA 2XVEA 3NNEA 2W0HA 2EQ7A 4GRTA 3FIMB 3C4NA 5BRTA 5KMRA 1GNDA 1TRBA 5FS8A 4AT2A 1VQWA 1GPEA 4OPGA 2XFPA 1PJ6A 4DGKA 4U2LA 1GXFA 2WOVA 3KPKA 1LJ1A 4DSHA 3ADAB 3AYJA 5M10A 1NHSA 2R45A 4Y4LA 1ZMCA 1XDIA 5GRTA 1PBCA 1COYA 1OJAA 2XLSA 3ALLA 4J57A 4YSHA 3M12A 1E39A 1LV0A 2BK3A 3HYVA 2GV8A 2GAHB 1K0JA 3NG7X 1GESA 1JRXA 3FBSA 5KOWA 2X99A 2Y6RA 1H7WA 4XWZA 4FX9A 1XANA 4NTCA 5EB5A 5EB4A 5JCMA 3IWAA 4YSXA 3F8DA 3V76A 4ZCDA 4NEWA 3BHKA 1JRZA 3O0HA 2YG5A 3H8LA 2X8CA 3VRAA 1TDEA 3P1WA 5CKUA 2VOUA 3CNJA 1PBEA 2WBAA 3AE1A 3NGCX 3KU9A 3AEBA 3UOXA 4AOSA 1JEHA 1GV4A 3CGCA 3SXIA 1GETA 1GOSA 1NEKA 2V60A 4EMIA 2JB2A 3IHMA 2XVHA 1H83A 1XPQA 1H86A 2C65A 2UZZA 3CIRA 4RG4A 4GR1A 2C76A 4GUVA 4H4ZA 1BF3A 5IQ1A 4BJZA 1H82A 4H4VA 3CGBA 4BK2A 3F8PA 2E4GA 4HB9A 4A99A 5JCLA 1DJQA 3GD3A 5ER0A 2FJBA 2YM1A 3UTHA 1L9DA 3AYIA 4NTEA 2WPEA 4OPDA 1CC2A 4REKA 3GWFA 1L0VA 4XXGA 1E6EA 3HZLA 2YG6A 1B37A 2BACA 2VZ2A 2X3NA 1QJDA 4OPIA 3ICRA 3D1CA 1IUWA 3T37A 1CC6A 2WETA 2RABA 3GRTA 4U2SA 3AEEA 3C96A 3NYCA 5CQFA 3H4KA 1KFYA 2YQUA 1QO8A 5C3JA 1MO9A 1IUSA 5TR3A 2BXSA 3QVRA 2FJAA 1CHUA 1Y56B 3ABVA 4A6NB 4RSLA 3S61A 3NN0X 3WE0A 4OVIA 1E1NA 1O5WA 3Q9TA 3FPZA 1D5TA 1V59A 2R0CA 3HYWA 5FS9A 3NTDA 1CJ3A 1Q9IA 3QVPA 4J36A 2WQYA 2VVMA 4NWZA 1RYIA 3M0OA 5C2TA 3DJEA 1AOGA 1DNCA 2A87A 3SZCA 1YQ3A 3UKLA 3UP5A 4YTPA 2I0ZA 3ITJA 2GVCA 1CC4A 4FDCB 2GAGB 2JKCA 4BK1A 3NIXA 3AD8B 1OJCA 2WEUA 3CMMA 2C70A 1DOBA 4TM1A 2R4JA 1BWCA 3AE7A 4Z2TA 3LJPA 1ONFA 2ACZA 1TYPA 2GR1A 2WDVA 2BK4A 1H7XA 4UP3A 3AB1A 1E1MA 2VRMA 4A9WA 3LADA 1LVLA 1W4XA 2GRTA 3DA1A 4CCQA 1PXAA 1PJ5A 1X31B 1S2QA 3I3LA 5JCIA 3CPJG 4IVMB 2AR8A 1IJHA 1VRQB 2GMJA 3P4RA 4PAAA 4WX1A 4OPTA 3GD4A 3UTFA 1S3BA 4JY2A 1IUVA 1ZP0A 1D7LA 5KVHA 4H4TA 3RHAA 1ZDLA 3P4SA 2B76A 1NHPA 3CGDA 3DGHA 4G6GA 4H4PA 1DOEA 2B7RA 3PVCA 1YQ4A 2TPRA 4U8LA 3AECA 4CRTA 1IUXA 1DOCA 1GTEA 2GR0A 4C3XA 2R4EA 1GRAA 1N1PA 2GEWA 3DJJA 2BS4A 3JSKA 4J56A 4RG3A 1NHQA 3DJGX 3UKQA 4H2PA 2EQ6A 5KXJA 3UOYA 4Y4NA 3VRBA 4I58A 1GRGA 5J60A 4C77A 3HYXA 2AQJA 5EOWA 1TDNA 5LV9A 2PYXA 1DODA 2GMHA 2WOWA 3ISHA 4U8KA 2BCPA 4EMJA 3SQPA 2BXRA 5U1OA 1F8SA 1NG3A 2WESA 4J33A 2YVFA 2YR5A 3NH3X 3AE8A 4BK3A 2X8GA 3CNDA 4U8OA 1B8SA 3K7TA 2XFUA 1YKJA 2EQ8A 3GYJA 3GYIA 3ALJA 4U8NA 2JB3A 4YTMA 4G6HA 1QLBA 1N4WA 3L1RA 4IV9A 1XHCA 4EQXA 4CBQA 2YLRA 4KX6A 1TYTA 3EPTA 3IF9A 3AE3A 4EQSA 1F6MA 1GRHA 4FK1C 4CNKA 5L46A 1NDAA 2CVJA 1B4VA 4K2XA 4KPRA 5HXIA 2WS3A 3DK4A 2V61A 4USQA 1PBFA 2FJEA 3Q6JA 3SGLA 4OPLA 2XVFA 3M13A 3RP7A 1LPFA 3QSMA 4H4UA 2C73A 1O95A 2OAMA 2ZBWA 2X50A 2QA2A 1DXLA 1EL8A 3ATQA 1FOHA 1B5QA 1PN0A 3AE4A 4ZN0A 5FS6A 1KSUA 4JQ9A 1ZKQA 2WU5A 3F8RA 3B6DA 3DMEA 4GDEA 2YWLA 4U2TA 2GQFA 4B66A 3AEDA 4AOXA 3PS9A 5KMPA 4HA6A 3B3RA 1NAAA 1PXBA 2C66A 1F8WA 2HQMA 1PS9A 1NG4A 3UTEA 4APNA 1Z6LA 4XWRA 5DBJA 4GAPA 4UDQA 1PJ7A 3ICTA 5JCKA 2APGA 4H4QA 3DGZA 2YLZA 4AT0A 2GF3A 3CN8A 2DKIA 3E1TA 4GDPA 4C5OA 2OALA 4UDPA 1NHRA 2XFOA 3BNUA 4O5UA 3UCLA 4H2NA 1IUTA 3AEGA 2A89A 3NYEA 4YKFA 1GTHA 3COXA 1N4VA 3C4AA 1UKVG 4G74A 3QJ4A 1FECA 4EQRA 4B63A 4M52A 3IHGA 3VR9A 4EIQA 1GRTA 5KMSA 3G5RA 2WHDA 4ZCCA 3G5SA 5GSNA 2YG3A 1ZOVA 2O9ZA 1CF3A 2BC1A 3SYIA 3VRDB 3UKPA 3QSSA 5HYMA 1CJ2A 5FMHA 4LU6A 4A5LA 3GSIA 3SZWA 5J7XA 4J34A 4X9NA 1BGJA 4A6NA 4B67A 2BRAA 2PHHA 1NPXA 3BI2A 3NTAA 1GRBA 4II2A 1ZK7A 2WOIA 1BZLA 4AP1A 4YT0A 1FEAA 1KDGA 3I6DA 2BC0A 1OJDA 2XFNA 3P4PA 2TMDA 4U8PA 5JCNA 3GWDA 1K4QA 4I59A 1O94A 4IVOB 3P9UA 4USRA 4JNQA 2GR3A 3CTYA 2C3CA 3BI4A 3NHOX 3UKFA 1P2HA 2YR4A 4U8MA 1K0IA 3NN6X 1BGNA 3BI5A 4GCMA 3OC4A 3KPFA 3AXBA 1OJ9A 2EQ9A 3AEAA 3CNSA 3DH9A 4C3YA 4H7UA 4TM4A 2C64A 2IIDA 2WDRA 4Y4MA 4ICYA 3V3OA 4G9KA 2NVKX 3ZYXA 4JN9A 1EL5A 1IUUA 1ZMDA 3DK8A 4LIIA 2XFQA 4Z2RA 5HHFA 2WP9A 1ELIA 1CBOA 3KLJA 3L8KA 5KOXA 1LQUA 3SZFA 4YSYA 2Q0LA 2XLPA 3IC9A 2YLXA 3NLCA 4Z44A 3UKHA 1VG9A 4DNAA 1HYUA 4B64A 2BS3A 4EM3A 4PABA 3OZ2A 1E1LA 4D03A 2BYBA 3NK0X 1PBDA 2R0GA 5KVIA 3NYFA 4BJYA 4JY3A 1FEBA 3EANA 1RP0A 2YG4A 3CGEA 4II3A 1REOA 4TM0A 3FMWA 2A8XA 4YKGA 3LXDA 1EBDA 3SFDA 3BHFA 3CNPA 1BKWA 4TM3A 2QAEA 3GDPA 4ECHA 1M6IA 1SEZA 2E5VA 3T2ZA 1FL2A 2JAEA 3QFBA 1D4DA 1EL9A 1TDKA 2J3NA 3UOVA 2ARDA 2GB0A 4OCGA 1M64A 4JDRA 4B68A 1JNZA 2C75A 2X8HA 2YLWA 1L9EA 3GRSA 3LZWA 1P2EA 4K8DA 3KD9A 2YLSA 2F5ZA 2YG7A 4NEVA 4OPCA 1JOAA 1PDHA 2VVLA 3NRNA 4WCTA 1Q1WA 1GSNA 2WP5A 2ZZBA 2CDUA 1LQTA 1D4EA 3P4QA 4P9SA 2V3BA 3AEFA 1K0LA 1DJNA 3CPHG 4N9XA 4AP3A 3II4A 4H4XA 1E1KA 1S2YA 5KMQA 3SX6A 3AD7B 1PXCA 3NK2X 2BS2A 3URHA 4Z43A 3UKKA 4G73A 5EBKA 3UTGA 3D8XA 3LB8A 1JU2A 4A65A 4A79A 4CCRA 3EF6A 2ZZCA 1CJCA 3AE9A 3RNMA 2IVEA 3UKAA 2BABA 4EQWA 3VQRA 1OJTA 2DKHA 1GT8A 2R46A 5BUKA 3K30A 2C7GA 3ATRA 4Z26A 2XYOA 2XCGA 2OLOA 1L9CA 2AAQA 3GDNA 1VDCA 3EAOA 2CULA 2VVLG 2YAUA 5IPYA 4GAVA 2OLNA 1PBBA 2GQWA 2V6OA 2YLTA 4NNJA 2OA1A 1CL0A 1F8RA 2XLRA 1ZX9A 4TLXA 3G5QA 3GMBA 4H2RA 2XVJA 2RGHA 2V3AA 4LA1A 2XDOA 3SZ0A 2V5ZA 3K7MX 4H4YA 3CPIG 3QFAA 4GF7A 1KNPA 1CJ4A 4X4JA 2XLTA 1YY5A 2IVDA 1KSSA 4E0VA 2C4CA 3RP6A 3FG2P 1KNRA 1GRFA 2CFYA 3GMCA 1H84A 5M0ZA 1GEUA 2WDQA 3AWIA 1EL7A 1TDFA 2BK5A 4EMWA 2GH5A 2YVGA 4TLZA 1Y56A 1JNRA 4JNAA 2WPCA 1TDOA 2R0PA 3K7QX 4J31A 3REDA 2Z5XA 3T2KA 2XLUA 3UP4A 3SM8A 1Q1RA 3AE6A 4IA6A 4X9MA 3AE2A 3RP8A 2FBWA 3ALMA 4NTDA 2B9YA 2H89A 4A7AA 2Q6UA 1RSGA 4EIPA 2WP6A 1D4CA 1H6VA 1LTXR 3KKJA 3ZDNA 2NPXA 3AE5A 3DJDA 1D7YA 1VG0A 3DK9A 5FS7A 2JBVA 2GR2A 4C74A 1GERA 4B65A 2R9ZA 1ZY8A 5BVAA 4NZHA 4FK1A 2XVIA 4D04A 3V3NA 3UOZA 1GREA 4H4WA 2C67A 3NK1X 5KNLA 2WU2A 2VRLA 2FJDA 3T2YA 3S5WA 2JB1A 2Y6QA 4OPUA 4CY8A 2C72A 3GYXA 4H4SA 2VQ7A 3ICSA 4EM4A 3KVEA 2YR6A 1F3PA 2B9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOV A;  2B7S A;  1KF6 A;  3CNT A;  4B1B A;  5IQ4 A;  2ZZ0 A;  3AYL A;  4CY6 A;  2B9X A;  4IA5 A;  4O5Q A;  2QCU A;  3KA7 A;  2YM2 A;  4K5S A;  1PHH A;  3LZX A;  1FCD A;  2JK6 A;  1N4U A;  4H4R A;  4U8J A;  3H8I A;  4K7Z A;  5KRQ A;  1GAL A;  2QA1 A;  4H2Q A;  2BA9 A;  3BNM A;  4J2W A;  4ADW A;  1E7P A;  4K22 A;  3VR8 A;  2RGO A;  4DSG A;  2H88 A;  2BCG G;  2Q7V A;  4BUR A;  3NT6 A;  1H81 A;  3QSE A;  5U25 A;  2E1M A;  3NKS A;  4UDR A;  2RGJ A;  1MXT A;  5KWF A;  4Z24 A;  4BV6 A;  4H50 A;  3R9U A;  4YTN A;  4YXD A;  1YQZ A;  5U63 A;  4U8I A;  2Q0K A;  2VQB A;  1S3E A;  2YVJ A;  4MJW A;  2Z5Y A;  2WPF A;  4CNJ A;  1ZOY A;  2C3D A;  1JRY A;  3PO7 A;  4YWO A;  4B69 A;  5HY5 A;  4Z2U A;  1Y0P A;  4Z25 A;  1NEN A;  3AD9 B;  3SFE A;  4K5R A;  4YSZ A;  1MOK A;  5BUL A;  2XVE A;  3NNE A;  2W0H A;  2EQ7 A;  4GRT A;  3FIM B;  3C4N A;  5BRT A;  1GND A;  1TRB A;  5FS8 A;  4AT2 A;  1VQW A;  1GPE A;  4OPG A;  2XFP A;  1PJ6 A;  4DGK A;  4U2L A;  1GXF A;  2WOV A;  1LJ1 A;  4DSH A;  3ADA B;  3AYJ A;  5M10 A;  1NHS A;  2R45 A;  4Y4L A;  1ZMC A;  1XDI A;  5GRT A;  1PBC A;  1COY A;  1OJA A;  2XLS A;  3ALL A;  4J57 A;  4YSH A;  3M12 A;  1E39 A;  1LV0 A;  2BK3 A;  2GV8 A;  2GAH B;  1K0J A;  3NG7 X;  1GES A;  1JRX A;  3FBS A;  5KOW A;  2X99 A;  2Y6R A;  1H7W A;  4XWZ A;  4FX9 A;  1XAN A;  4NTC A;  5EB5 A;  5EB4 A;  5JCM A;  3IWA A;  4YSX A;  3F8D A;  3V76 A;  4ZCD A;  4NEW A;  3BHK A;  1JRZ A;  3O0H A;  2YG5 A;  3H8L A;  2X8C A;  3VRA A;  1TDE A;  3P1W A;  5CKU A;  2VOU A;  3CNJ A;  1PBE A;  2WBA A;  3AE1 A;  3NGC X;  3KU9 A;  3AEB A;  3UOX A;  4AOS A;  1JEH A;  1GV4 A;  3CGC A;  1GET A;  1GOS A;  1NEK A;  2V60 A;  4EMI A;  2JB2 A;  3IHM A;  2XVH A;  1H83 A;  1XPQ A;  1H86 A;  2C65 A;  2UZZ A;  3CIR A;  4RG4 A;  4GR1 A;  2C76 A;  4GUV A;  4H4Z A;  1BF3 A;  5IQ1 A;  4BJZ A;  1H82 A;  4H4V A;  3CGB A;  4BK2 A;  3F8P A;  2E4G A;  4HB9 A;  4A99 A;  5JCL A;  1DJQ A;  3GD3 A;  5ER0 A;  2FJB A;  2YM1 A;  3UTH A;  1L9D A;  3AYI A;  4NTE A;  2WPE A;  4OPD A;  1CC2 A;  4REK A;  3GWF A;  1L0V A;  4XXG A;  1E6E A;  3HZL A;  2YG6 A;  1B37 A;  2BAC A;  2VZ2 A;  2X3N A;  1QJD A;  4OPI A;  3ICR A;  3D1C A;  1IUW A;  3T37 A;  1CC6 A;  2WET A;  2RAB A;  3GRT A;  4U2S A;  3AEE A;  3C96 A;  3NYC A;  5CQF A;  3H4K A;  1KFY A;  2YQU A;  1QO8 A;  5C3J A;  1MO9 A;  1IUS A;  5TR3 A;  2BXS A;  3QVR A;  2FJA A;  1CHU A;  1Y56 B;  3ABV A;  4A6N B;  4RSL A;  3S61 A;  3NN0 X;  3WE0 A;  4OVI A;  1E1N A;  1O5W A;  3Q9T A;  3FPZ A;  1D5T A;  1V59 A;  2R0C A;  5FS9 A;  3NTD A;  1CJ3 A;  1Q9I A;  3QVP A;  4J36 A;  2WQY A;  2VVM A;  1RYI A;  3M0O A;  5C2T A;  3DJE A;  1AOG A;  1DNC A;  2A87 A;  1YQ3 A;  3UKL A;  3UP5 A;  4YTP A;  2I0Z A;  3ITJ A;  2GVC A;  1CC4 A;  4FDC B;  2GAG B;  2JKC A;  4BK1 A;  3NIX A;  3AD8 B;  1OJC A;  2WEU A;  2C70 A;  1DOB A;  4TM1 A;  2R4J A;  1BWC A;  3AE7 A;  4Z2T A;  3LJP A;  1ONF A;  2ACZ A;  1TYP A;  2GR1 A;  2WDV A;  2BK4 A;  1H7X A;  4UP3 A;  3AB1 A;  1E1M A;  2VRM A;  4A9W A;  3LAD A;  1LVL A;  1W4X A;  2GRT A;  3DA1 A;  4CCQ A;  1PXA A;  1PJ5 A;  1X31 B;  1S2Q A;  3I3L A;  5JCI A;  3CPJ G;  4IVM B;  2AR8 A;  1IJH A;  1VRQ B;  2GMJ A;  3P4R A;  4PAA A;  4WX1 A;  4OPT A;  3GD4 A;  3UTF A;  1S3B A;  4JY2 A;  1IUV A;  1ZP0 A;  1D7L A;  5KVH A;  4H4T A;  3RHA A;  1ZDL A;  3P4S A;  2B76 A;  1NHP A;  3CGD A;  3DGH A;  4H4P A;  1DOE A;  2B7R A;  3PVC A;  1YQ4 A;  2TPR A;  4U8L A;  3AEC A;  4CRT A;  1IUX A;  1DOC A;  1GTE A;  2GR0 A;  4C3X A;  2R4E A;  1GRA A;  1N1P A;  2GEW A;  3DJJ A;  2BS4 A;  3JSK A;  4J56 A;  4RG3 A;  1NHQ A;  3DJG X;  3UKQ A;  4H2P A;  2EQ6 A;  5KXJ A;  3UOY A;  4Y4N A;  3VRB A;  4I58 A;  1GRG A;  5J60 A;  4C77 A;  2AQJ A;  5EOW A;  1TDN A;  5LV9 A;  2PYX A;  1DOD A;  2GMH A;  2WOW A;  3ISH A;  4U8K A;  2BCP A;  4EMJ A;  3SQP A;  2BXR A;  5U1O A;  1F8S A;  1NG3 A;  2WES A;  4J33 A;  2YVF A;  2YR5 A;  3NH3 X;  3AE8 A;  4BK3 A;  2X8G A;  3CND A;  4U8O A;  1B8S A;  3K7T A;  2XFU A;  1YKJ A;  2EQ8 A;  3GYJ A;  3GYI A;  3ALJ A;  4U8N A;  2JB3 A;  4YTM A;  1QLB A;  1N4W A;  3L1R A;  4IV9 A;  1XHC A;  4EQX A;  4CBQ A;  2YLR A;  4KX6 A;  1TYT A;  3EPT A;  3IF9 A;  3AE3 A;  4EQS A;  1F6M A;  1GRH A;  4FK1 C;  4CNK A;  5L46 A;  1NDA A;  2CVJ A;  1B4V A;  4K2X A;  4KPR A;  5HXI A;  2WS3 A;  3DK4 A;  2V61 A;  4USQ A;  1PBF A;  2FJE A;  3Q6J A;  3SGL A;  4OPL A;  2XVF A;  3M13 A;  3RP7 A;  1LPF A;  3QSM A;  4H4U A;  2C73 A;  1O95 A;  2OAM A;  2ZBW A;  2X50 A;  2QA2 A;  1DXL A;  1EL8 A;  3ATQ A;  1FOH A;  1B5Q A;  1PN0 A;  3AE4 A;  4ZN0 A;  5FS6 A;  1KSU A;  4JQ9 A;  1ZKQ A;  2WU5 A;  3F8R A;  3B6D A;  3DME A;  4GDE A;  2YWL A;  4U2T A;  2GQF A;  4B66 A;  3AED A;  4AOX A;  3PS9 A;  4HA6 A;  3B3R A;  1NAA A;  1PXB A;  2C66 A;  1F8W A;  2HQM A;  1PS9 A;  1NG4 A;  3UTE A;  4APN A;  1Z6L A;  4XWR A;  5DBJ A;  4UDQ A;  1PJ7 A;  3ICT A;  5JCK A;  2APG A;  4H4Q A;  3DGZ A;  2YLZ A;  4AT0 A;  2GF3 A;  3CN8 A;  2DKI A;  3E1T A;  4GDP A;  4C5O A;  2OAL A;  4UDP A;  1NHR A;  2XFO A;  3BNU A;  4O5U A;  3UCL A;  4H2N A;  1IUT A;  3AEG A;  2A89 A;  3NYE A;  4YKF A;  1GTH A;  3COX A;  1N4V A;  3C4A A;  1UKV G;  4EQR A;  3QJ4 A;  1FEC A;  4B63 A;  4M52 A;  3IHG A;  3VR9 A;  4EIQ A;  1GRT A;  3G5R A;  2WHD A;  4ZCC A;  3G5S A;  5GSN A;  2YG3 A;  1ZOV A;  2O9Z A;  1CF3 A;  2BC1 A;  3VRD B;  3UKP A;  3QSS A;  5HYM A;  1CJ2 A;  5FMH A;  4LU6 A;  4A5L A;  3GSI A;  5J7X A;  4J34 A;  4X9N A;  1BGJ A;  4A6N A;  4B67 A;  2PHH A;  1NPX A;  3BI2 A;  3NTA A;  1GRB A;  4AP1 A;  1ZK7 A;  2WOI A;  1BZL A;  4YT0 A;  1FEA A;  1KDG A;  3I6D A;  2BC0 A;  1OJD A;  2XFN A;  3P4P A;  2TMD A;  4U8P A;  5JCN A;  3GWD A;  1K4Q A;  4I59 A;  1O94 A;  4IVO B;  3P9U A;  4USR A;  4JNQ A;  2GR3 A;  3CTY A;  2C3C A;  3BI4 A;  3NHO X;  3UKF A;  1P2H A;  2YR4 A;  4U8M A;  1K0I A;  3NN6 X;  1BGN A;  3BI5 A;  4GCM A;  3OC4 A;  3KPF A;  3AXB A;  1OJ9 A;  2EQ9 A;  3AEA A;  3CNS A;  3DH9 A;  4C3Y A;  4H7U A;  4TM4 A;  2C64 A;  2IID A;  2WDR A;  4Y4M A;  4ICY A;  3V3O A;  2NVK X;  3ZYX A;  4JN9 A;  1EL5 A;  1IUU A;  1ZMD A;  3DK8 A;  4LII A;  2XFQ A;  4Z2R A;  5HHF A;  2WP9 A;  1ELI A;  1CBO A;  3KLJ A;  3L8K A;  5KOX A;  1LQU A;  4YSY A;  2Q0L A;  2XLP A;  3IC9 A;  2YLX A;  3NLC A;  4Z44 A;  3UKH A;  1VG9 A;  4DNA A;  1HYU A;  4B64 A;  2BS3 A;  4EM3 A;  4PAB A;  3OZ2 A;  1E1L A;  4D03 A;  2BYB A;  3NK0 X;  1PBD A;  2R0G A;  5KVI A;  3NYF A;  4BJY A;  4JY3 A;  1FEB A;  3EAN A;  1RP0 A;  2YG4 A;  3CGE A;  1REO A;  4TM0 A;  3FMW A;  2A8X A;  4YKG A;  3LXD A;  1EBD A;  3SFD A;  3BHF A;  3CNP A;  1BKW A;  4TM3 A;  2QAE A;  3GDP A;  4ECH A;  1M6I A;  1SEZ A;  2E5V A;  1FL2 A;  2JAE A;  3QFB A;  1D4D A;  1EL9 A;  1TDK A;  2J3N A;  3UOV A;  2ARD A;  2GB0 A;  4OCG A;  1M64 A;  4JDR A;  4B68 A;  1JNZ A;  2C75 A;  2X8H A;  2YLW A;  1L9E A;  3GRS A;  3LZW A;  1P2E A;  4K8D A;  3KD9 A;  2YLS A;  2F5Z A;  2YG7 A;  4NEV A;  4OPC A;  1JOA A;  1PDH A;  2VVL A;  3NRN A;  4WCT A;  1Q1W A;  1GSN A;  2WP5 A;  2ZZB A;  2CDU A;  1LQT A;  1D4E A;  3P4Q A;  4P9S A;  2V3B A;  3AEF A;  1K0L A;  1DJN A;  3CPH G;  4N9X A;  4AP3 A;  3II4 A;  4H4X A;  1E1K A;  1S2Y A;  3AD7 B;  1PXC A;  3NK2 X;  2BS2 A;  3URH A;  4Z43 A;  3UKK A;  5EBK A;  3UTG A;  3D8X A;  3LB8 A;  1JU2 A;  4A65 A;  4A79 A;  4CCR A;  3EF6 A;  2ZZC A;  1CJC A;  3AE9 A;  3RNM A;  2IVE A;  3UKA A;  2BAB A;  4EQW A;  3VQR A;  1OJT A;  2DKH A;  1GT8 A;  2R46 A;  5BUK A;  3K30 A;  2C7G A;  3ATR A;  4Z26 A;  2XYO A;  2XCG A;  2OLO A;  1L9C A;  2AAQ A;  3GDN A;  1VDC A;  3EAO A;  2CUL A;  2VVL G;  2YAU A;  5IPY A;  2OLN A;  1PBB A;  2GQW A;  2V6O A;  2YLT A;  2OA1 A;  1CL0 A;  1F8R A;  2XLR A;  1ZX9 A;  4TLX A;  3G5Q A;  3GMB A;  4H2R A;  2XVJ A;  2RGH A;  2V3A A;  4LA1 A;  2XDO A;  2V5Z A;  3K7M X;  4H4Y A;  3CPI G;  3QFA A;  4GF7 A;  1KNP A;  1CJ4 A;  4X4J A;  2XLT A;  1YY5 A;  2IVD A;  1KSS A;  4E0V A;  3RP6 A;  3FG2 P;  1KNR A;  1GRF A;  2CFY A;  3GMC A;  1H84 A;  5M0Z A;  1GEU A;  2WDQ A;  3AWI A;  1EL7 A;  1TDF A;  2BK5 A;  4EMW A;  2GH5 A;  2YVG A;  4TLZ A;  1Y56 A;  1JNR A;  4JNA A;  2WPC A;  1TDO A;  2R0P A;  3K7Q X;  4J31 A;  3RED A;  2Z5X A;  2XLU A;  3UP4 A;  3SM8 A;  1Q1R A;  3AE6 A;  4IA6 A;  4X9M A;  3AE2 A;  3RP8 A;  2FBW A;  3ALM A;  4NTD A;  2B9Y A;  2H89 A;  4A7A A;  2Q6U A;  1RSG A;  4EIP A;  2WP6 A;  1D4C A;  1H6V A;  1LTX R;  3KKJ A;  3ZDN A;  2NPX A;  3AE5 A;  3DJD A;  1D7Y A;  1VG0 A;  3DK9 A;  5FS7 A;  2JBV A;  2GR2 A;  4C74 A;  1GER A;  4B65 A;  2R9Z A;  1ZY8 A;  5BVA A;  4NZH A;  4FK1 A;  2XVI A;  4D04 A;  3V3N A;  3UOZ A;  1GRE A;  4H4W A;  2C67 A;  3NK1 X;  2WU2 A;  2VRL A;  2FJD A;  3S5W A;  2JB1 A;  2Y6Q A;  4OPU A;  4CY8 A;  2C72 A;  4H4S A;  4EM4 A;  2VQ7 A;  3ICS A;  3KVE A;  2YR6 A;  1F3P A;  2B9W A; 
#chains in the Genus database with same CATH topology
 3LOV A;  2B7S A;  1KF6 A;  3CNT A;  4B1B A;  5IQ4 A;  2ZZ0 A;  3AYL A;  4CY6 A;  2B9X A;  4IA5 A;  4O5Q A;  2QCU A;  3KA7 A;  2YM2 A;  4K5S A;  3T0K A;  1PHH A;  3LZX A;  1FCD A;  2JK6 A;  1N4U A;  4H4R A;  4U8J A;  3H8I A;  4K7Z A;  5KRQ A;  1GAL A;  2QA1 A;  4H2Q A;  2BA9 A;  3BNM A;  4J2W A;  4ADW A;  1E7P A;  4K22 A;  3VR8 A;  2RGO A;  4DSG A;  2H88 A;  2BCG G;  2Q7V A;  4BUR A;  3NT6 A;  1H81 A;  3QSE A;  5U25 A;  2E1M A;  3NKS A;  4UDR A;  2RGJ A;  1MXT A;  2BRY A;  4Z24 A;  5KWF A;  4BV6 A;  3SY4 A;  4H50 A;  3R9U A;  4YTN A;  4YXD A;  1YQZ A;  5U63 A;  3T31 A;  4U8I A;  2Q0K A;  2VQB A;  1S3E A;  2YVJ A;  4MJW A;  2Z5Y A;  2WPF A;  4CNJ A;  1ZOY A;  2C3D A;  1JRY A;  3PO7 A;  4YWO A;  4B69 A;  5HY5 A;  4Z2U A;  1Y0P A;  4Z25 A;  1NEN A;  3AD9 B;  3SFE A;  4K5R A;  4YSZ A;  3T14 A;  1MOK A;  5BUL A;  2XVE A;  3NNE A;  2W0H A;  2EQ7 A;  4GRT A;  3FIM B;  3C4N A;  5BRT A;  5KMR A;  1GND A;  1TRB A;  5FS8 A;  4AT2 A;  1VQW A;  1GPE A;  4OPG A;  2XFP A;  1PJ6 A;  4DGK A;  4U2L A;  1GXF A;  2WOV A;  3KPK A;  1LJ1 A;  4DSH A;  3ADA B;  3AYJ A;  5M10 A;  1NHS A;  2R45 A;  4Y4L A;  1ZMC A;  1XDI A;  5GRT A;  1PBC A;  1COY A;  1OJA A;  2XLS A;  3ALL A;  4J57 A;  4YSH A;  3M12 A;  1E39 A;  1LV0 A;  2BK3 A;  3HYV A;  2GV8 A;  2GAH B;  1K0J A;  3NG7 X;  1GES A;  1JRX A;  3FBS A;  5KOW A;  2X99 A;  2Y6R A;  1H7W A;  4XWZ A;  4FX9 A;  1XAN A;  4NTC A;  5EB5 A;  5EB4 A;  5JCM A;  3IWA A;  4YSX A;  3F8D A;  3V76 A;  4ZCD A;  4NEW A;  3BHK A;  1JRZ A;  3O0H A;  2YG5 A;  3H8L A;  2X8C A;  3VRA A;  1TDE A;  3P1W A;  5CKU A;  2VOU A;  3CNJ A;  1PBE A;  2WBA A;  3AE1 A;  3NGC X;  3KU9 A;  3AEB A;  3UOX A;  4AOS A;  1JEH A;  1GV4 A;  3CGC A;  3SXI A;  1GET A;  1GOS A;  1NEK A;  2V60 A;  4EMI A;  2JB2 A;  3IHM A;  2XVH A;  1H83 A;  1XPQ A;  1H86 A;  2C65 A;  2UZZ A;  3CIR A;  4RG4 A;  4GR1 A;  2C76 A;  4GUV A;  4H4Z A;  1BF3 A;  5IQ1 A;  4BJZ A;  1H82 A;  4H4V A;  3CGB A;  4BK2 A;  3F8P A;  2E4G A;  4HB9 A;  4A99 A;  5JCL A;  1DJQ A;  3GD3 A;  5ER0 A;  2FJB A;  2YM1 A;  3UTH A;  1L9D A;  3AYI A;  4NTE A;  2WPE A;  4OPD A;  1CC2 A;  4REK A;  3GWF A;  1L0V A;  4XXG A;  1E6E A;  3HZL A;  2YG6 A;  1B37 A;  2BAC A;  2VZ2 A;  2X3N A;  1QJD A;  4OPI A;  3ICR A;  3D1C A;  1IUW A;  3T37 A;  1CC6 A;  2WET A;  2RAB A;  3GRT A;  4U2S A;  3AEE A;  3C96 A;  3NYC A;  5CQF A;  3H4K A;  1KFY A;  2YQU A;  1QO8 A;  5C3J A;  1MO9 A;  1IUS A;  5TR3 A;  2BXS A;  3QVR A;  2FJA A;  1CHU A;  1Y56 B;  3ABV A;  4A6N B;  4RSL A;  3S61 A;  3NN0 X;  3WE0 A;  4OVI A;  1E1N A;  1O5W A;  3Q9T A;  3FPZ A;  1D5T A;  1V59 A;  2R0C A;  3HYW A;  5FS9 A;  3NTD A;  1CJ3 A;  1Q9I A;  3QVP A;  4J36 A;  2WQY A;  2VVM A;  4NWZ A;  1RYI A;  3M0O A;  5C2T A;  3DJE A;  1AOG A;  1DNC A;  2A87 A;  3SZC A;  1YQ3 A;  3UKL A;  3UP5 A;  4YTP A;  2I0Z A;  3ITJ A;  2GVC A;  1CC4 A;  4FDC B;  2GAG B;  2JKC A;  4BK1 A;  3NIX A;  3AD8 B;  1OJC A;  2WEU A;  3CMM A;  2C70 A;  1DOB A;  4TM1 A;  2R4J A;  1BWC A;  3AE7 A;  4Z2T A;  3LJP A;  1ONF A;  2ACZ A;  1TYP A;  2GR1 A;  2WDV A;  2BK4 A;  1H7X A;  4UP3 A;  3AB1 A;  1E1M A;  2VRM A;  4A9W A;  3LAD A;  1LVL A;  1W4X A;  2GRT A;  3DA1 A;  4CCQ A;  1PXA A;  1PJ5 A;  1X31 B;  1S2Q A;  3I3L A;  5JCI A;  3CPJ G;  4IVM B;  2AR8 A;  1IJH A;  1VRQ B;  2GMJ A;  3P4R A;  4PAA A;  4WX1 A;  4OPT A;  3GD4 A;  3UTF A;  1S3B A;  4JY2 A;  1IUV A;  1ZP0 A;  1D7L A;  5KVH A;  4H4T A;  3RHA A;  1ZDL A;  3P4S A;  2B76 A;  1NHP A;  3CGD A;  3DGH A;  4G6G A;  4H4P A;  1DOE A;  2B7R A;  3PVC A;  1YQ4 A;  2TPR A;  4U8L A;  3AEC A;  4CRT A;  1IUX A;  1DOC A;  1GTE A;  2GR0 A;  4C3X A;  2R4E A;  1GRA A;  1N1P A;  2GEW A;  3DJJ A;  2BS4 A;  3JSK A;  4J56 A;  4RG3 A;  1NHQ A;  3DJG X;  3UKQ A;  4H2P A;  2EQ6 A;  5KXJ A;  3UOY A;  4Y4N A;  3VRB A;  4I58 A;  1GRG A;  5J60 A;  4C77 A;  3HYX A;  2AQJ A;  5EOW A;  1TDN A;  5LV9 A;  2PYX A;  1DOD A;  2GMH A;  2WOW A;  3ISH A;  4U8K A;  2BCP A;  4EMJ A;  3SQP A;  2BXR A;  5U1O A;  1F8S A;  1NG3 A;  2WES A;  4J33 A;  2YVF A;  2YR5 A;  3NH3 X;  3AE8 A;  4BK3 A;  2X8G A;  3CND A;  4U8O A;  1B8S A;  3K7T A;  2XFU A;  1YKJ A;  2EQ8 A;  3GYJ A;  3GYI A;  3ALJ A;  4U8N A;  2JB3 A;  4YTM A;  4G6H A;  1QLB A;  1N4W A;  3L1R A;  4IV9 A;  1XHC A;  4EQX A;  4CBQ A;  2YLR A;  4KX6 A;  1TYT A;  3EPT A;  3IF9 A;  3AE3 A;  4EQS A;  1F6M A;  1GRH A;  4FK1 C;  4CNK A;  5L46 A;  1NDA A;  2CVJ A;  1B4V A;  4K2X A;  4KPR A;  5HXI A;  2WS3 A;  3DK4 A;  2V61 A;  4USQ A;  1PBF A;  2FJE A;  3Q6J A;  3SGL A;  4OPL A;  2XVF A;  3M13 A;  3RP7 A;  1LPF A;  3QSM A;  4H4U A;  2C73 A;  1O95 A;  2OAM A;  2ZBW A;  2X50 A;  2QA2 A;  1DXL A;  1EL8 A;  3ATQ A;  1FOH A;  1B5Q A;  1PN0 A;  3AE4 A;  4ZN0 A;  5FS6 A;  1KSU A;  4JQ9 A;  1ZKQ A;  2WU5 A;  3F8R A;  3B6D A;  3DME A;  4GDE A;  2YWL A;  4U2T A;  2GQF A;  4B66 A;  3AED A;  4AOX A;  3PS9 A;  5KMP A;  4HA6 A;  3B3R A;  1NAA A;  1PXB A;  2C66 A;  1F8W A;  2HQM A;  1PS9 A;  1NG4 A;  3UTE A;  4APN A;  1Z6L A;  4XWR A;  5DBJ A;  4GAP A;  4UDQ A;  1PJ7 A;  3ICT A;  5JCK A;  2APG A;  4H4Q A;  3DGZ A;  2YLZ A;  4AT0 A;  2GF3 A;  3CN8 A;  2DKI A;  3E1T A;  4GDP A;  4C5O A;  2OAL A;  4UDP A;  1NHR A;  2XFO A;  3BNU A;  4O5U A;  3UCL A;  4H2N A;  1IUT A;  3AEG A;  2A89 A;  3NYE A;  4YKF A;  1GTH A;  3COX A;  1N4V A;  3C4A A;  1UKV G;  4G74 A;  3QJ4 A;  1FEC A;  4EQR A;  4B63 A;  4M52 A;  3IHG A;  3VR9 A;  4EIQ A;  1GRT A;  5KMS A;  3G5R A;  2WHD A;  4ZCC A;  3G5S A;  5GSN A;  2YG3 A;  1ZOV A;  2O9Z A;  1CF3 A;  2BC1 A;  3SYI A;  3VRD B;  3UKP A;  3QSS A;  5HYM A;  1CJ2 A;  5FMH A;  4LU6 A;  4A5L A;  3GSI A;  3SZW A;  5J7X A;  4J34 A;  4X9N A;  1BGJ A;  4A6N A;  4B67 A;  2BRA A;  2PHH A;  1NPX A;  3BI2 A;  3NTA A;  1GRB A;  4II2 A;  1ZK7 A;  2WOI A;  1BZL A;  4AP1 A;  4YT0 A;  1FEA A;  1KDG A;  3I6D A;  2BC0 A;  1OJD A;  2XFN A;  3P4P A;  2TMD A;  4U8P A;  5JCN A;  3GWD A;  1K4Q A;  4I59 A;  1O94 A;  4IVO B;  3P9U A;  4USR A;  4JNQ A;  2GR3 A;  3CTY A;  2C3C A;  3BI4 A;  3NHO X;  3UKF A;  1P2H A;  2YR4 A;  4U8M A;  1K0I A;  3NN6 X;  1BGN A;  3BI5 A;  4GCM A;  3OC4 A;  3KPF A;  3AXB A;  1OJ9 A;  2EQ9 A;  3AEA A;  3CNS A;  3DH9 A;  4C3Y A;  4H7U A;  4TM4 A;  2C64 A;  2IID A;  2WDR A;  4Y4M A;  4ICY A;  3V3O A;  4G9K A;  2NVK X;  3ZYX A;  4JN9 A;  1EL5 A;  1IUU A;  1ZMD A;  3DK8 A;  4LII A;  2XFQ A;  4Z2R A;  5HHF A;  2WP9 A;  1ELI A;  1CBO A;  3KLJ A;  3L8K A;  5KOX A;  1LQU A;  3SZF A;  4YSY A;  2Q0L A;  2XLP A;  3IC9 A;  2YLX A;  3NLC A;  4Z44 A;  3UKH A;  1VG9 A;  4DNA A;  1HYU A;  4B64 A;  2BS3 A;  4EM3 A;  4PAB A;  3OZ2 A;  1E1L A;  4D03 A;  2BYB A;  3NK0 X;  1PBD A;  2R0G A;  5KVI A;  3NYF A;  4BJY A;  4JY3 A;  1FEB A;  3EAN A;  1RP0 A;  2YG4 A;  3CGE A;  4II3 A;  1REO A;  4TM0 A;  3FMW A;  2A8X A;  4YKG A;  3LXD A;  1EBD A;  3SFD A;  3BHF A;  3CNP A;  1BKW A;  4TM3 A;  2QAE A;  3GDP A;  4ECH A;  1M6I A;  1SEZ A;  2E5V A;  3T2Z A;  1FL2 A;  2JAE A;  3QFB A;  1D4D A;  1EL9 A;  1TDK A;  2J3N A;  3UOV A;  2ARD A;  2GB0 A;  4OCG A;  1M64 A;  4JDR A;  4B68 A;  1JNZ A;  2C75 A;  2X8H A;  2YLW A;  1L9E A;  3GRS A;  3LZW A;  1P2E A;  4K8D A;  3KD9 A;  2YLS A;  2F5Z A;  2YG7 A;  4NEV A;  4OPC A;  1JOA A;  1PDH A;  2VVL A;  3NRN A;  4WCT A;  1Q1W A;  1GSN A;  2WP5 A;  2ZZB A;  2CDU A;  1LQT A;  1D4E A;  3P4Q A;  4P9S A;  2V3B A;  3AEF A;  1K0L A;  1DJN A;  3CPH G;  4N9X A;  4AP3 A;  3II4 A;  4H4X A;  1E1K A;  1S2Y A;  5KMQ A;  3SX6 A;  3AD7 B;  1PXC A;  3NK2 X;  2BS2 A;  3URH A;  4Z43 A;  3UKK A;  4G73 A;  5EBK A;  3UTG A;  3D8X A;  3LB8 A;  1JU2 A;  4A65 A;  4A79 A;  4CCR A;  3EF6 A;  2ZZC A;  1CJC A;  3AE9 A;  3RNM A;  2IVE A;  3UKA A;  2BAB A;  4EQW A;  3VQR A;  1OJT A;  2DKH A;  1GT8 A;  2R46 A;  5BUK A;  3K30 A;  2C7G A;  3ATR A;  4Z26 A;  2XYO A;  2XCG A;  2OLO A;  1L9C A;  2AAQ A;  3GDN A;  1VDC A;  3EAO A;  2CUL A;  2VVL G;  2YAU A;  5IPY A;  4GAV A;  2OLN A;  1PBB A;  2GQW A;  2V6O A;  2YLT A;  4NNJ A;  2OA1 A;  1CL0 A;  1F8R A;  2XLR A;  1ZX9 A;  4TLX A;  3G5Q A;  3GMB A;  4H2R A;  2XVJ A;  2RGH A;  2V3A A;  4LA1 A;  2XDO A;  3SZ0 A;  2V5Z A;  3K7M X;  4H4Y A;  3CPI G;  3QFA A;  4GF7 A;  1KNP A;  1CJ4 A;  4X4J A;  2XLT A;  1YY5 A;  2IVD A;  1KSS A;  4E0V A;  2C4C A;  3RP6 A;  3FG2 P;  1KNR A;  1GRF A;  2CFY A;  3GMC A;  1H84 A;  5M0Z A;  1GEU A;  2WDQ A;  3AWI A;  1EL7 A;  1TDF A;  2BK5 A;  4EMW A;  2GH5 A;  2YVG A;  4TLZ A;  1Y56 A;  1JNR A;  4JNA A;  2WPC A;  1TDO A;  2R0P A;  3K7Q X;  4J31 A;  3RED A;  2Z5X A;  3T2K A;  2XLU A;  3UP4 A;  3SM8 A;  1Q1R A;  3AE6 A;  4IA6 A;  4X9M A;  3AE2 A;  3RP8 A;  2FBW A;  3ALM A;  4NTD A;  2B9Y A;  2H89 A;  4A7A A;  2Q6U A;  1RSG A;  4EIP A;  2WP6 A;  1D4C A;  1H6V A;  1LTX R;  3KKJ A;  3ZDN A;  2NPX A;  3AE5 A;  3DJD A;  1D7Y A;  1VG0 A;  3DK9 A;  5FS7 A;  2JBV A;  2GR2 A;  4C74 A;  1GER A;  4B65 A;  2R9Z A;  1ZY8 A;  5BVA A;  4NZH A;  4FK1 A;  2XVI A;  4D04 A;  3V3N A;  3UOZ A;  1GRE A;  4H4W A;  2C67 A;  3NK1 X;  5KNL A;  2WU2 A;  2VRL A;  2FJD A;  3T2Y A;  3S5W A;  2JB1 A;  2Y6Q A;  4OPU A;  4CY8 A;  2C72 A;  3GYX A;  4H4S A;  2VQ7 A;  3ICS A;  4EM4 A;  3KVE A;  2YR6 A;  1F3P A;  2B9W A; 
#chains in the Genus database with same CATH homology
 3LOV A;  2B7S A;  1KF6 A;  3CNT A;  4B1B A;  5IQ4 A;  2ZZ0 A;  3AYL A;  4CY6 A;  2B9X A;  4IA5 A;  4O5Q A;  2QCU A;  3KA7 A;  2YM2 A;  4K5S A;  3T0K A;  1PHH A;  3LZX A;  1FCD A;  2JK6 A;  1N4U A;  4H4R A;  4U8J A;  3H8I A;  4K7Z A;  5KRQ A;  1GAL A;  2QA1 A;  4H2Q A;  2BA9 A;  3BNM A;  4J2W A;  4ADW A;  1E7P A;  4K22 A;  3VR8 A;  2RGO A;  4DSG A;  2H88 A;  2BCG G;  2Q7V A;  4BUR A;  3NT6 A;  1H81 A;  3QSE A;  5U25 A;  2E1M A;  3NKS A;  4UDR A;  2RGJ A;  1MXT A;  2BRY A;  4Z24 A;  5KWF A;  4BV6 A;  3SY4 A;  4H50 A;  3R9U A;  4YTN A;  4YXD A;  1YQZ A;  5U63 A;  3T31 A;  4U8I A;  2Q0K A;  2VQB A;  1S3E A;  2YVJ A;  4MJW A;  2Z5Y A;  2WPF A;  4CNJ A;  1ZOY A;  2C3D A;  1JRY A;  3PO7 A;  4YWO A;  4B69 A;  5HY5 A;  4Z2U A;  1Y0P A;  4Z25 A;  1NEN A;  3AD9 B;  3SFE A;  4K5R A;  4YSZ A;  3T14 A;  1MOK A;  5BUL A;  2XVE A;  3NNE A;  2W0H A;  2EQ7 A;  4GRT A;  3FIM B;  3C4N A;  5BRT A;  5KMR A;  1GND A;  1TRB A;  5FS8 A;  4AT2 A;  1VQW A;  1GPE A;  4OPG A;  2XFP A;  1PJ6 A;  4DGK A;  4U2L A;  1GXF A;  2WOV A;  3KPK A;  1LJ1 A;  4DSH A;  3ADA B;  3AYJ A;  5M10 A;  1NHS A;  2R45 A;  4Y4L A;  1ZMC A;  1XDI A;  5GRT A;  1PBC A;  1COY A;  1OJA A;  2XLS A;  3ALL A;  4J57 A;  4YSH A;  3M12 A;  1E39 A;  1LV0 A;  2BK3 A;  3HYV A;  2GV8 A;  2GAH B;  1K0J A;  3NG7 X;  1GES A;  1JRX A;  3FBS A;  5KOW A;  2X99 A;  2Y6R A;  1H7W A;  4XWZ A;  4FX9 A;  1XAN A;  4NTC A;  5EB5 A;  5EB4 A;  5JCM A;  3IWA A;  4YSX A;  3F8D A;  3V76 A;  4ZCD A;  4NEW A;  3BHK A;  1JRZ A;  3O0H A;  2YG5 A;  3H8L A;  2X8C A;  3VRA A;  1TDE A;  3P1W A;  5CKU A;  2VOU A;  3CNJ A;  1PBE A;  2WBA A;  3AE1 A;  3NGC X;  3KU9 A;  3AEB A;  3UOX A;  4AOS A;  1JEH A;  1GV4 A;  3CGC A;  3SXI A;  1GET A;  1GOS A;  1NEK A;  2V60 A;  4EMI A;  2JB2 A;  3IHM A;  2XVH A;  1H83 A;  1XPQ A;  1H86 A;  2C65 A;  2UZZ A;  3CIR A;  4RG4 A;  4GR1 A;  2C76 A;  4GUV A;  4H4Z A;  1BF3 A;  5IQ1 A;  4BJZ A;  1H82 A;  4H4V A;  3CGB A;  4BK2 A;  3F8P A;  2E4G A;  4HB9 A;  4A99 A;  5JCL A;  1DJQ A;  3GD3 A;  5ER0 A;  2FJB A;  2YM1 A;  3UTH A;  1L9D A;  3AYI A;  4NTE A;  2WPE A;  4OPD A;  1CC2 A;  4REK A;  3GWF A;  1L0V A;  4XXG A;  1E6E A;  3HZL A;  2YG6 A;  1B37 A;  2BAC A;  2VZ2 A;  2X3N A;  1QJD A;  4OPI A;  3ICR A;  3D1C A;  1IUW A;  3T37 A;  1CC6 A;  2WET A;  2RAB A;  3GRT A;  4U2S A;  3AEE A;  3C96 A;  3NYC A;  5CQF A;  3H4K A;  1KFY A;  2YQU A;  1QO8 A;  5C3J A;  1MO9 A;  1IUS A;  5TR3 A;  2BXS A;  3QVR A;  2FJA A;  1CHU A;  1Y56 B;  3ABV A;  4A6N B;  4RSL A;  3S61 A;  3NN0 X;  3WE0 A;  4OVI A;  1E1N A;  1O5W A;  3Q9T A;  3FPZ A;  1D5T A;  1V59 A;  2R0C A;  3HYW A;  5FS9 A;  3NTD A;  1CJ3 A;  1Q9I A;  3QVP A;  4J36 A;  2WQY A;  2VVM A;  4NWZ A;  1RYI A;  3M0O A;  5C2T A;  3DJE A;  1AOG A;  1DNC A;  2A87 A;  3SZC A;  1YQ3 A;  3UKL A;  3UP5 A;  4YTP A;  2I0Z A;  3ITJ A;  2GVC A;  1CC4 A;  4FDC B;  2GAG B;  2JKC A;  4BK1 A;  3NIX A;  3AD8 B;  1OJC A;  2WEU A;  3CMM A;  2C70 A;  1DOB A;  4TM1 A;  2R4J A;  1BWC A;  3AE7 A;  4Z2T A;  3LJP A;  1ONF A;  2ACZ A;  1TYP A;  2GR1 A;  2WDV A;  2BK4 A;  1H7X A;  4UP3 A;  3AB1 A;  1E1M A;  2VRM A;  4A9W A;  3LAD A;  1LVL A;  1W4X A;  2GRT A;  3DA1 A;  4CCQ A;  1PXA A;  1PJ5 A;  1X31 B;  1S2Q A;  3I3L A;  5JCI A;  3CPJ G;  4IVM B;  2AR8 A;  1IJH A;  1VRQ B;  2GMJ A;  3P4R A;  4PAA A;  4WX1 A;  4OPT A;  3GD4 A;  3UTF A;  1S3B A;  4JY2 A;  1IUV A;  1ZP0 A;  1D7L A;  5KVH A;  4H4T A;  3RHA A;  1ZDL A;  3P4S A;  2B76 A;  1NHP A;  3CGD A;  3DGH A;  4G6G A;  4H4P A;  1DOE A;  2B7R A;  3PVC A;  1YQ4 A;  2TPR A;  4U8L A;  3AEC A;  4CRT A;  1IUX A;  1DOC A;  1GTE A;  2GR0 A;  4C3X A;  2R4E A;  1GRA A;  1N1P A;  2GEW A;  3DJJ A;  2BS4 A;  3JSK A;  4J56 A;  4RG3 A;  1NHQ A;  3DJG X;  3UKQ A;  4H2P A;  2EQ6 A;  5KXJ A;  3UOY A;  4Y4N A;  3VRB A;  4I58 A;  1GRG A;  5J60 A;  4C77 A;  3HYX A;  2AQJ A;  5EOW A;  1TDN A;  5LV9 A;  2PYX A;  1DOD A;  2GMH A;  2WOW A;  3ISH A;  4U8K A;  2BCP A;  4EMJ A;  3SQP A;  2BXR A;  5U1O A;  1F8S A;  1NG3 A;  2WES A;  4J33 A;  2YVF A;  2YR5 A;  3NH3 X;  3AE8 A;  4BK3 A;  2X8G A;  3CND A;  4U8O A;  1B8S A;  3K7T A;  2XFU A;  1YKJ A;  2EQ8 A;  3GYJ A;  3GYI A;  3ALJ A;  4U8N A;  2JB3 A;  4YTM A;  4G6H A;  1QLB A;  1N4W A;  3L1R A;  4IV9 A;  1XHC A;  4EQX A;  4CBQ A;  2YLR A;  4KX6 A;  1TYT A;  3EPT A;  3IF9 A;  3AE3 A;  4EQS A;  1F6M A;  1GRH A;  4FK1 C;  4CNK A;  5L46 A;  1NDA A;  2CVJ A;  1B4V A;  4K2X A;  4KPR A;  5HXI A;  2WS3 A;  3DK4 A;  2V61 A;  4USQ A;  1PBF A;  2FJE A;  3Q6J A;  3SGL A;  4OPL A;  2XVF A;  3M13 A;  3RP7 A;  1LPF A;  3QSM A;  4H4U A;  2C73 A;  1O95 A;  2OAM A;  2ZBW A;  2X50 A;  2QA2 A;  1DXL A;  1EL8 A;  3ATQ A;  1FOH A;  1B5Q A;  1PN0 A;  3AE4 A;  4ZN0 A;  5FS6 A;  1KSU A;  4JQ9 A;  1ZKQ A;  2WU5 A;  3F8R A;  3B6D A;  3DME A;  4GDE A;  2YWL A;  4U2T A;  2GQF A;  4B66 A;  3AED A;  4AOX A;  3PS9 A;  5KMP A;  4HA6 A;  3B3R A;  1NAA A;  1PXB A;  2C66 A;  1F8W A;  2HQM A;  1PS9 A;  1NG4 A;  3UTE A;  4APN A;  1Z6L A;  4XWR A;  5DBJ A;  4GAP A;  4UDQ A;  1PJ7 A;  3ICT A;  5JCK A;  2APG A;  4H4Q A;  3DGZ A;  2YLZ A;  4AT0 A;  2GF3 A;  3CN8 A;  2DKI A;  3E1T A;  4GDP A;  4C5O A;  2OAL A;  4UDP A;  1NHR A;  2XFO A;  3BNU A;  4O5U A;  3UCL A;  4H2N A;  1IUT A;  3AEG A;  2A89 A;  3NYE A;  4YKF A;  1GTH A;  3COX A;  1N4V A;  3C4A A;  1UKV G;  4G74 A;  3QJ4 A;  1FEC A;  4EQR A;  4B63 A;  4M52 A;  3IHG A;  3VR9 A;  4EIQ A;  1GRT A;  5KMS A;  3G5R A;  2WHD A;  4ZCC A;  3G5S A;  5GSN A;  2YG3 A;  1ZOV A;  2O9Z A;  1CF3 A;  2BC1 A;  3SYI A;  3VRD B;  3UKP A;  3QSS A;  5HYM A;  1CJ2 A;  5FMH A;  4LU6 A;  4A5L A;  3GSI A;  3SZW A;  5J7X A;  4J34 A;  4X9N A;  1BGJ A;  4A6N A;  4B67 A;  2BRA A;  2PHH A;  1NPX A;  3BI2 A;  3NTA A;  1GRB A;  4II2 A;  1ZK7 A;  2WOI A;  1BZL A;  4AP1 A;  4YT0 A;  1FEA A;  1KDG A;  3I6D A;  2BC0 A;  1OJD A;  2XFN A;  3P4P A;  2TMD A;  4U8P A;  5JCN A;  3GWD A;  1K4Q A;  4I59 A;  1O94 A;  4IVO B;  3P9U A;  4USR A;  4JNQ A;  2GR3 A;  3CTY A;  2C3C A;  3BI4 A;  3NHO X;  3UKF A;  1P2H A;  2YR4 A;  4U8M A;  1K0I A;  3NN6 X;  1BGN A;  3BI5 A;  4GCM A;  3OC4 A;  3KPF A;  3AXB A;  1OJ9 A;  2EQ9 A;  3AEA A;  3CNS A;  3DH9 A;  4C3Y A;  4H7U A;  4TM4 A;  2C64 A;  2IID A;  2WDR A;  4Y4M A;  4ICY A;  3V3O A;  4G9K A;  2NVK X;  3ZYX A;  4JN9 A;  1EL5 A;  1IUU A;  1ZMD A;  3DK8 A;  4LII A;  2XFQ A;  4Z2R A;  5HHF A;  2WP9 A;  1ELI A;  1CBO A;  3KLJ A;  3L8K A;  5KOX A;  1LQU A;  3SZF A;  4YSY A;  2Q0L A;  2XLP A;  3IC9 A;  2YLX A;  3NLC A;  4Z44 A;  3UKH A;  1VG9 A;  4DNA A;  1HYU A;  4B64 A;  2BS3 A;  4EM3 A;  4PAB A;  3OZ2 A;  1E1L A;  4D03 A;  2BYB A;  3NK0 X;  1PBD A;  2R0G A;  5KVI A;  3NYF A;  4BJY A;  4JY3 A;  1FEB A;  3EAN A;  1RP0 A;  2YG4 A;  3CGE A;  4II3 A;  1REO A;  4TM0 A;  3FMW A;  2A8X A;  4YKG A;  3LXD A;  1EBD A;  3SFD A;  3BHF A;  3CNP A;  1BKW A;  4TM3 A;  2QAE A;  3GDP A;  4ECH A;  1M6I A;  1SEZ A;  2E5V A;  3T2Z A;  1FL2 A;  2JAE A;  3QFB A;  1D4D A;  1EL9 A;  1TDK A;  2J3N A;  3UOV A;  2ARD A;  2GB0 A;  4OCG A;  1M64 A;  4JDR A;  4B68 A;  1JNZ A;  2C75 A;  2X8H A;  2YLW A;  1L9E A;  3GRS A;  3LZW A;  1P2E A;  4K8D A;  3KD9 A;  2YLS A;  2F5Z A;  2YG7 A;  4NEV A;  4OPC A;  1JOA A;  1PDH A;  2VVL A;  3NRN A;  4WCT A;  1Q1W A;  1GSN A;  2WP5 A;  2ZZB A;  2CDU A;  1LQT A;  1D4E A;  3P4Q A;  4P9S A;  2V3B A;  3AEF A;  1K0L A;  1DJN A;  3CPH G;  4N9X A;  4AP3 A;  3II4 A;  4H4X A;  1E1K A;  1S2Y A;  5KMQ A;  3SX6 A;  3AD7 B;  1PXC A;  3NK2 X;  2BS2 A;  3URH A;  4Z43 A;  3UKK A;  4G73 A;  5EBK A;  3UTG A;  3D8X A;  3LB8 A;  1JU2 A;  4A65 A;  4A79 A;  4CCR A;  3EF6 A;  2ZZC A;  1CJC A;  3AE9 A;  3RNM A;  2IVE A;  3UKA A;  2BAB A;  4EQW A;  3VQR A;  1OJT A;  2DKH A;  1GT8 A;  2R46 A;  5BUK A;  3K30 A;  2C7G A;  3ATR A;  4Z26 A;  2XYO A;  2XCG A;  2OLO A;  1L9C A;  2AAQ A;  3GDN A;  1VDC A;  3EAO A;  2CUL A;  2VVL G;  2YAU A;  5IPY A;  4GAV A;  2OLN A;  1PBB A;  2GQW A;  2V6O A;  2YLT A;  4NNJ A;  2OA1 A;  1CL0 A;  1F8R A;  2XLR A;  1ZX9 A;  4TLX A;  3G5Q A;  3GMB A;  4H2R A;  2XVJ A;  2RGH A;  2V3A A;  4LA1 A;  2XDO A;  3SZ0 A;  2V5Z A;  3K7M X;  4H4Y A;  3CPI G;  3QFA A;  4GF7 A;  1KNP A;  1CJ4 A;  4X4J A;  2XLT A;  1YY5 A;  2IVD A;  1KSS A;  4E0V A;  2C4C A;  3RP6 A;  3FG2 P;  1KNR A;  1GRF A;  2CFY A;  3GMC A;  1H84 A;  5M0Z A;  1GEU A;  2WDQ A;  3AWI A;  1EL7 A;  1TDF A;  2BK5 A;  4EMW A;  2GH5 A;  2YVG A;  4TLZ A;  1Y56 A;  1JNR A;  4JNA A;  2WPC A;  1TDO A;  2R0P A;  3K7Q X;  4J31 A;  3RED A;  2Z5X A;  3T2K A;  2XLU A;  3UP4 A;  3SM8 A;  1Q1R A;  3AE6 A;  4IA6 A;  4X9M A;  3AE2 A;  3RP8 A;  2FBW A;  3ALM A;  4NTD A;  2B9Y A;  2H89 A;  4A7A A;  2Q6U A;  1RSG A;  4EIP A;  2WP6 A;  1D4C A;  1H6V A;  1LTX R;  3KKJ A;  3ZDN A;  2NPX A;  3AE5 A;  3DJD A;  1D7Y A;  1VG0 A;  3DK9 A;  5FS7 A;  2JBV A;  2GR2 A;  4C74 A;  1GER A;  4B65 A;  2R9Z A;  1ZY8 A;  5BVA A;  4NZH A;  4FK1 A;  2XVI A;  4D04 A;  3V3N A;  3UOZ A;  1GRE A;  4H4W A;  2C67 A;  3NK1 X;  5KNL A;  2WU2 A;  2VRL A;  2FJD A;  3T2Y A;  3S5W A;  2JB1 A;  2Y6Q A;  4OPU A;  4CY8 A;  2C72 A;  3GYX A;  4H4S A;  2VQ7 A;  3ICS A;  4EM4 A;  3KVE A;  2YR6 A;  1F3P A;  2B9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...