4CBQA

Crystal structure of the thioredoxin reductase from entamoeba histolytica with auranofin au(i) bound to cys286
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 94
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA02
3AEAA 2F5ZA 4EMIA 3DJGX 3NK0X 2JB2A 2RGJA 1H82A 1PDHA 4WX1A 3SGLA 5HYMA 2C76A 2ZZCA 3S61A 2YVFA 3M0OA 3CGBA 1JU2A 3DMEA 2RGHA 1H7WA 2VVLA 4NTCA 1RP0A 3KPFA 1TDFA 3VQRA 3QSSA 3CGCA 1F6MA 2XFOA 3V3NA 2GR1A 1H6VA 4A9WA 2V5ZA 4RG3A 2GR3A 1K0JA 2XDOA 1P2HA 3ISHA 1F8WA 3FBSA 4OPGA 3UOZA 4B68A 5M10A 1TDOA 2V60A 3K30A 1CJ3A 2WETA 1DOCA 5J60A 5EBKA 2UZZA 3SQPA 1PN0A 4E0VA 3NTDA 4DGKA 2C70A 4U8JA 4A99A 1V59A 4FDCB 3H4KA 4ECHA 3UTHA 4GF7A 1K0LA 3DK9A 3P4QA 4YWOA 2C75A 3UKLA 1IUTA 1PHHA 4CY8A 2GQWA 3NK2X 1PXBA 1E1MA 1DOEA 1YQZA 2WDQA 4CCRA 3CTYA 4GRTA 3ALMA 4IV9A 4WCTA 4J34A 5JCMA 2XFPA 3DJJA 2B9YA 4OCGA 2WDRA 3C96A 1LQTA 1NHPA 3PS9A 3ICRA 4CY6A 5JCLA 4BK3A 2BS2A 1TRBA 5KRQA 4U2TA 3UP5A 1BF3A 3FPZA 2A8XA 1O5WA 2WOIA 3M12A 3M13A 2YLRA 3KKJA 3CPIG 4U2SA 1XHCA 4J57A 4B66A 1FEBA 1COYA 5KVHA 2CDUA 4REKA 1PXCA 3AD9B 4B69A 3EF6A 2GR2A 3AD7B 3AE3A 4J33A 5JCNA 1CJ4A 3H8IA 4YTNA 4XWRA 3RP8A 3AWIA 4X9MA 2R45A 1QO8A 3BI4A 4BV6A 2GF3A 1KF6A 2Q7VA 2WDVA 5BUKA 3NK1X 2X8CA 4M52A 4J36A 3QVPA 3BHKA 2Y6QA 4U8NA 2Q6UA 1LTXR 1YY5A 3KA7A 4Z25A 1VG9A 2OA1A 2XVHA 2JBVA 3CNJA 1N4WA 5KOXA 2BK5A 2R4EA 1S2YA 1DNCA 4BURA 4C3YA 3BNUA 5BVAA 4EQRA 3AEDA 2BS4A 3ATRA 2V6OA 3DJEA 4DNAA 1H84A 1N4UA 4C74A 3CGEA 2H89A 5C2TA 1M6IA 3NH3X 4Z24A 3CN8A 1N4VA 1GRHA 4K5SA 3IHGA 3T37A 2E5VA 2BA9A 1YQ4A 2QA1A 3AE6A 1KDGA 3BI5A 3PVCA 4FK1A 1XANA 5JCIA 5C3JA 1H81A 1S2QA 4YT0A 2YR6A 1GRBA 1Q1WA 1VG0A 1F8SA 4YKFA 3LOVA 4B65A 1KSSA 2YLTA 3DJDA 1X31B 1NHQA 3ALJA 2GR0A 2YR5A 3QFBA 3UKPA 2GRTA 3GD3A 2JKCA 1VDCA 2YVJA 4I59A 3LJPA 4UDQA 1KNRA 1ZOYA 2C67A 2DKHA 1GXFA 2YM2A 1FEAA 4XXGA 2W0HA 1ZX9A 5U63A 3HZLA 5KXJA 4YSHA 3DGHA 4YSXA 3KU9A 2VVLG 1GNDA 2H88A 3DK4A 3UKFA 2TMDA 2AQJA 4AOSA 1N1PA 2IIDA 1GOSA 2EQ8A 3CNSA 5M0ZA 3E1TA 4EQXA 4JDRA 1E1KA 1GSNA 4A65A 5JCKA 5KOWA 2R4JA 2YLWA 2BK4A 2VZ2A 3QFAA 1IJHA 3V3OA 2RGOA 1MOKA 1CL0A 1PBFA 2XVEA 3UCLA 1ZOVA 1NHSA 4C77A 1OJ9A 1DJNA 5GSNA 4ZCCA 4Z44A 2BABA 2YG3A 3FIMB 3D8XA 1E7PA 3C4AA 2ZZ0A 1B8SA 3GYJA 5EOWA 2IVEA 3NGCX 1L9EA 2VQBA 4PAAA 4DSGA 1TYTA 4Z2TA 1GT8A 2GB0A 2X50A 4H2NA 4H4WA 3UP4A 4NTEA 2FJDA 3VR8A 1B4VA 4P9SA 1PJ6A 2I0ZA 1IUWA 1PBDA 1ZMDA 1QJDA 1E39A 3LZWA 2OLOA 3KLJA 2YVGA 3ABVA 3L1RA 2B7SA 4MJWA 2WBAA 4NEWA 1IUUA 4A5LA 2WU5A 2WOWA 5U25A 4AT2A 4ADWA 1ZKQA 3ZDNA 4AP3A 1CC6A 2CFYA 4TM3A 1REOA 3ALLA 4I58A 1CJCA 3II4A 4EQSA 2PYXA 2YG7A 2C72A 4EM3A 2XVIA 1LPFA 2ZZBA 5KVIA 3VRBA 3RHAA 4CRTA 3L8KA 2B9WA 2YLSA 2GMHA 2OALA 3QJ4A 4RSLA 4U8PA 4H7UA 1TDEA 2C64A 1OJDA 4X4JA 2BACA 4YSZA 1PJ7A 2AR8A 3BNMA 3DK8A 4B64A 4Z43A 3EPTA 4APNA 1M64A 1E1LA 3GDNA 3UTFA 2ARDA 1PS9A 4UDRA 2WU2A 1GV4A 1EL9A 2FJEA 4H4ZA 4OPUA 1D5TA 4H50A 4N9XA 2Y6RA 3AEBA 4Y4MA 2OAMA 4FX9A 5TR3A 4A6NA 1F8RA 4BK1A 3AYIA 4Z2RA 4PABA 2V3BA 3GWFA 2Q0LA 2E4GA 1LVLA 4EMJA 3K7QX 2JB1A 3AYLA 3FG2P 4U8IA 4K22A 5BRTA 1IUXA 3UTGA 5HXIA 5GRTA 3NN0X 1TDKA 1JNRA 1BGJA 5KWFA 1KFYA 2FJAA 2OLNA 4CNKA 1ELIA 2XLUA 3NT6A 2CULA 1HYUA 3G5SA 4IVMB 2B7RA 2C66A 1PXAA 2Z5YA 2WP5A 2GEWA 3B6DA 2WESA 4TLZA 1H86A 2EQ9A 2YR4A 3F8RA 1O94A 1GALA 4A79A 3AE2A 4Y4LA 1NPXA 2WHDA 2XLTA 3AE4A 2C65A 2EQ7A 3B3RA 3GRTA 4Y4NA 4HA6A 3AE5A 2GQFA 3P4PA 4BJYA 1PBBA 2WP9A 3AECA 3V76A 4KX6A 1Q1RA 1ZY8A 2ZBWA 3LXDA 2BYBA 3NRNA 3GYIA 3I6DA 4JY2A 1GRTA 1NENA 3ITJA 1E1NA 2C3CA 1D7LA 4ZCDA 4K2XA 1XDIA 5BULA 1GPEA 3CNTA 4GR1A 4K7ZA 1FL2A 1KNPA 3RP7A 3UKHA 1CC2A 2NPXA 3P4RA 1GREA 4H4RA 3S5WA 1GRAA 3FMWA 1BKWA 1E6EA 1ONFA 2E1MA 1D4CA 1JEHA 1YQ3A 1IUVA 2X8HA 4USQA 4TM1A 1CBOA 3URHA 1GRGA 4YKGA 2PHHA 2AAQA 2QCUA 3I3LA 3UOYA 4Z26A 2YWLA 3REDA 4BK2A 2O9ZA 3Q9TA 5FS8A 3RP6A 4OPCA 1PJ5A 3SFEA 4TM4A 4OPIA 4A6NB 5FS7A 1Q9IA 1F3PA 5EB5A 3GD4A 3BHFA 4Z2UA 2FJBA 3COXA 5HY5A 1JNZA 3IHMA 3NYFA 2Q0KA 1JOAA 1W4XA 2FBWA 2XCGA 2Z5XA 3LADA 2BXRA 1TDNA 4C5OA 3K7MX 1LJ1A 2A87A 2R0CA 4EIPA 4TM0A 1JRZA 1ZDLA 5FMHA 4D04A 3QSEA 2BC1A 3CPHG 2X8GA 3EANA 1DODA 1K4QA 3NKSA 1ZMCA 1Y56A 4NTDA 4DSHA 4IA5A 1PBEA 5HHFA 3AE1A 1QLBA 3VR9A 3KD9A 1OJTA 4GDEA 1EL7A 4NEVA 2YLXA 3AEFA 3AXBA 3CNPA 3AB1A 3AE8A 3GMBA 3GWDA 3UKAA 2XFUA 3VRAA 4H4VA 1GESA 5FS9A 1DJQA 3QVRA 4YTPA 5IQ1A 3NYCA 3GSIA 4EMWA 2GMJA 2YQUA 3GRSA 1NHRA 3PO7A 2DKIA 2BS3A 4H2PA 3ICTA 3NNEA 2WP6A 4XWZA 1GRFA 2R9ZA 4GCMA 1P2EA 1VQWA 2V3AA 1BWCA 1D4EA 4JQ9A 4U8OA 3SFDA 2EQ6A 2GVCA 3EAOA 4U8KA 3UOXA 4AT0A 3ZYXA 3G5RA 1H7XA 3LB8A 4JN9A 1YKJA 4GDPA 4LIIA 3NN6X 4AP1A 1LQUA 2IVDA 1B37A 2YAUA 3UOVA 4BJZA 1SEZA 1JRYA 1NG4A 4K5RA 1ZP0A 3NYEA 4X9NA 4U8LA 3NTAA 1GTEA 1MO9A 1DOBA 1L9CA 3IWAA 2YLZA 4RG4A 2A89A 1MXTA 2WEUA 1GETA 4U8MA 4K8DA 4O5QA 4B1BA 3NG7X 3D1CA 2XVFA 3VRDB 1D7YA 4YXDA 2WS3A 4CBQA 3ATQA 1RSGA 3UKQA 4NZHA 2BCGG 4OPTA 4ICYA 4LU6A 2XLSA 2QAEA 3H8LA 1FECA 2GH5A 2GAGB 1KSUA 4YTMA 2C3DA 3F8DA 4HB9A 1CF3A 1XPQA 1BGNA 2VVMA 5CQFA 2QA2A 2C73A 3ADAB 1CHUA 4UP3A 4ZN0A 1Y56B 2VOUA 2YG5A 4UDPA 4TLXA 2XFQA 4CCQA 2ACZA 3DA1A 3BI2A 4JY3A 1L9DA 4H4QA 4USRA 1D4DA 2R46A 4C3XA 2V61A 1TYPA 3LZXA 4KPRA 2JB3A 4H2QA 5CKUA 1DXLA 2B9XA 5U1OA 2CVJA 4H4YA 3NLCA 3AEEA 4D03A 2RABA 4EM4A 1FOHA 1GERA 1H83A 2WPCA 3AD8B 3G5QA 1L0VA 3P4SA 2X3NA 4H4TA 5IQ4A 5LV9A 3UTEA 1GEUA 4H2RA 2C7GA 1CC4A 3R9UA 2BCPA 1GTHA 1FCDA 4LA1A 2XLPA 3ICSA 2YG6A 5FS6A 4YSYA 4B67A 4FK1C 3WE0A 3NIXA 4OPDA 1NDAA 4GUVA 3DH9A 2X99A 1NAAA 3AEGA 4H4PA 4JNQA 1AOGA 1S3EA 4IVOB 2VRLA 1NEKA 3CPJG 1S3BA 5EB4A 4EQWA 5J7XA 1EL5A 4O5UA 2XLRA 2JK6A 2XFNA 2NVKX 3NHOX 1VRQB 1LV0A 2APGA 3P9UA 2GAHB 3CGDA 4JNAA 2B76A 3IF9A 2VRMA 4IA6A 4OPLA 2J3NA 5ER0A 1B5QA 1BZLA 2R0PA 3JSKA 3K7TA 1CJ2A 1UKVG 4CNJA 1RYIA 1Y0PA 4A7AA 3OZ2A 3QSMA 1O95A 3Q6JA 4H4XA 3CIRA 2BK3A 3P1WA 1K0IA 3F8PA 3SM8A 2HQMA 3CNDA 3IC9A 1NG3A 2R0GA 1EBDA 1OJCA 1IUSA 3GDPA 4OVIA 2TPRA 4H4SA 3GMCA 2BC0A 3AE9A 2WPEA 5DBJA 1JRXA 2YG4A 2JAEA 2XVJA 2WPFA 1Z6LA 2VQ7A 5IPYA 1EL8A 3UKKA 3C4NA 4EIQA 4H4UA 3O0HA 4J2WA 2GV8A 2BXSA 4B63A 3KVEA 5L46A 1OJAA 1PBCA 3DGZA 2WQYA 2WOVA 3RNMA 2XYOA 3AYJA 4J56A 4AOXA 4J31A 4U2LA 2YM1A 3OC4A 3AE7A 1ZK7A
chains in the Genus database with same CATH superfamily
3AEAA 2F5ZA 4EMIA 3DJGX 3NK0X 2JB2A 2RGJA 1H82A 1PDHA 4WX1A 3SGLA 3CMMA 3T2KA 4G74A 5HYMA 2C76A 2ZZCA 3S61A 2YVFA 3M0OA 3CGBA 1JU2A 3DMEA 2RGHA 1H7WA 2VVLA 4NTCA 1RP0A 4G6GA 3KPFA 1TDFA 3VQRA 3T0KA 3QSSA 3CGCA 1F6MA 2XFOA 3V3NA 2GR1A 1H6VA 4A9WA 2V5ZA 4RG3A 2GR3A 1K0JA 2XDOA 1P2HA 3ISHA 1F8WA 3FBSA 4OPGA 3UOZA 4B68A 5M10A 1TDOA 2V60A 3K30A 1CJ3A 2WETA 1DOCA 5J60A 5EBKA 2BRYA 2UZZA 3SQPA 1PN0A 4E0VA 3NTDA 4DGKA 2C70A 4U8JA 4A99A 1V59A 4FDCB 3H4KA 4ECHA 3UTHA 4GF7A 1K0LA 3DK9A 3P4QA 4YWOA 2C75A 3UKLA 1IUTA 1PHHA 4CY8A 2GQWA 3NK2X 1PXBA 1E1MA 1DOEA 3GYXA 1YQZA 2WDQA 4CCRA 3CTYA 4GRTA 3ALMA 4IV9A 4WCTA 3T2YA 4J34A 5JCMA 2XFPA 3DJJA 2B9YA 4OCGA 5KMRA 2WDRA 3C96A 1LQTA 1NHPA 3PS9A 3ICRA 4CY6A 5JCLA 4BK3A 2BS2A 1TRBA 4G73A 5KRQA 4U2TA 3UP5A 1BF3A 3FPZA 2A8XA 1O5WA 2WOIA 3M12A 3M13A 2YLRA 3KKJA 3CPIG 4U2SA 1XHCA 4J57A 4B66A 1FEBA 1COYA 5KVHA 2CDUA 4REKA 1PXCA 3AD9B 4B69A 3EF6A 2GR2A 3AD7B 3AE3A 4J33A 5JCNA 1CJ4A 3H8IA 4YTNA 4XWRA 3RP8A 3AWIA 4X9MA 2R45A 1QO8A 3BI4A 4BV6A 2GF3A 1KF6A 2Q7VA 2WDVA 5BUKA 3NK1X 2X8CA 4M52A 4J36A 3QVPA 3BHKA 2Y6QA 4U8NA 2Q6UA 1LTXR 1YY5A 3KA7A 4Z25A 1VG9A 2OA1A 2XVHA 2JBVA 3CNJA 1N4WA 5KOXA 2BK5A 2R4EA 1S2YA 1DNCA 4BURA 4C3YA 3BNUA 5BVAA 4EQRA 3AEDA 2BS4A 3ATRA 2V6OA 3DJEA 4DNAA 1H84A 1N4UA 4C74A 3CGEA 2H89A 5C2TA 1M6IA 3NH3X 4Z24A 3CN8A 1N4VA 1GRHA 4K5SA 5KMSA 3IHGA 4NWZA 3T37A 2E5VA 2BA9A 1YQ4A 2QA1A 3AE6A 1KDGA 3BI5A 3PVCA 4FK1A 1XANA 5JCIA 5C3JA 1H81A 1S2QA 4YT0A 2YR6A 1GRBA 1Q1WA 1VG0A 1F8SA 4YKFA 3LOVA 4B65A 1KSSA 2YLTA 3DJDA 1X31B 1NHQA 3ALJA 2GR0A 2YR5A 3QFBA 3T31A 2GRTA 3UKPA 3GD3A 2JKCA 1VDCA 2YVJA 4I59A 3LJPA 4UDQA 1KNRA 1ZOYA 2C67A 2DKHA 1GXFA 2YM2A 1FEAA 4XXGA 2W0HA 1ZX9A 5U63A 3HZLA 5KXJA 4YSHA 3DGHA 4YSXA 3KU9A 3SXIA 2VVLG 1GNDA 2H88A 3DK4A 3UKFA 2TMDA 2AQJA 4AOSA 1N1PA 2IIDA 1GOSA 2EQ8A 3CNSA 5M0ZA 3E1TA 4EQXA 4JDRA 1E1KA 1GSNA 4A65A 5JCKA 5KOWA 2R4JA 2YLWA 2BK4A 2VZ2A 3QFAA 1IJHA 3V3OA 2RGOA 1MOKA 1CL0A 1PBFA 2XVEA 3UCLA 1ZOVA 1NHSA 4C77A 1OJ9A 1DJNA 5GSNA 4ZCCA 4Z44A 2BABA 2YG3A 3FIMB 3D8XA 1E7PA 3C4AA 2ZZ0A 1B8SA 3GYJA 5EOWA 2IVEA 3NGCX 1L9EA 2VQBA 4PAAA 3SZFA 1TYTA 4DSGA 4Z2TA 1GT8A 2GB0A 2X50A 4H2NA 4H4WA 3UP4A 4NTEA 2FJDA 3VR8A 1B4VA 4P9SA 1PJ6A 2I0ZA 1IUWA 1PBDA 1ZMDA 1QJDA 1E39A 3LZWA 2OLOA 3KLJA 2YVGA 3ABVA 3L1RA 2B7SA 4MJWA 2WBAA 4NEWA 1IUUA 4A5LA 2WU5A 2WOWA 5U25A 4AT2A 4ADWA 1ZKQA 3ZDNA 4AP3A 1CC6A 2CFYA 4TM3A 5KNLA 1REOA 3ALLA 4I58A 1CJCA 3II4A 4II2A 4EQSA 2PYXA 2YG7A 2C72A 4EM3A 2XVIA 1LPFA 2ZZBA 5KVIA 3VRBA 3RHAA 4CRTA 3L8KA 2B9WA 2YLSA 2GMHA 2OALA 3QJ4A 4RSLA 4U8PA 4H7UA 1TDEA 2C64A 1OJDA 2BRAA 4X4JA 3SYIA 2BACA 4YSZA 1PJ7A 2AR8A 3BNMA 3DK8A 4B64A 4Z43A 3EPTA 4APNA 1M64A 1E1LA 3GDNA 3UTFA 2ARDA 1PS9A 4UDRA 2WU2A 3T14A 1GV4A 1EL9A 2FJEA 4H4ZA 4OPUA 1D5TA 4H50A 4N9XA 2Y6RA 3AEBA 4Y4MA 2OAMA 4FX9A 5TR3A 4A6NA 1F8RA 4BK1A 3AYIA 4Z2RA 4PABA 2V3BA 3GWFA 2Q0LA 2E4GA 1LVLA 4EMJA 3K7QX 2JB1A 3AYLA 3FG2P 4U8IA 4K22A 5BRTA 1IUXA 3UTGA 5HXIA 5GRTA 3NN0X 1TDKA 1JNRA 1BGJA 5KWFA 1KFYA 2FJAA 2OLNA 4CNKA 1ELIA 2XLUA 3NT6A 2CULA 1HYUA 3G5SA 3T2ZA 4IVMB 2B7RA 2C66A 1PXAA 2Z5YA 2WP5A 2GEWA 3B6DA 3HYVA 2WESA 4TLZA 3SZWA 1H86A 2EQ9A 2YR4A 3F8RA 1O94A 1GALA 4A79A 3AE2A 4Y4LA 1NPXA 2WHDA 2XLTA 3AE4A 2C65A 2EQ7A 3B3RA 3GRTA 4Y4NA 4HA6A 3AE5A 2GQFA 3P4PA 4BJYA 1PBBA 2WP9A 3AECA 3V76A 4KX6A 1Q1RA 1ZY8A 2ZBWA 3LXDA 2BYBA 3NRNA 3GYIA 3I6DA 4JY2A 1GRTA 1NENA 3ITJA 1E1NA 2C3CA 1D7LA 4ZCDA 4K2XA 1XDIA 5BULA 1GPEA 3CNTA 4GAVA 4GR1A 4K7ZA 1FL2A 1KNPA 3RP7A 3UKHA 1CC2A 2NPXA 3P4RA 1GREA 4GAPA 4H4RA 3S5WA 1GRAA 3FMWA 1BKWA 1E6EA 1ONFA 2E1MA 1D4CA 1JEHA 1YQ3A 1IUVA 2X8HA 4USQA 4TM1A 1CBOA 3URHA 1GRGA 4YKGA 2PHHA 2AAQA 2QCUA 3I3LA 3UOYA 4Z26A 2YWLA 3REDA 4BK2A 2O9ZA 3Q9TA 5FS8A 3RP6A 4OPCA 1PJ5A 3SFEA 4TM4A 4OPIA 4A6NB 3KPKA 1Q9IA 4II3A 1F3PA 5FS7A 5EB5A 3GD4A 3BHFA 4Z2UA 2FJBA 3COXA 5HY5A 1JNZA 3IHMA 3NYFA 2Q0KA 1JOAA 1W4XA 2FBWA 2XCGA 2Z5XA 3LADA 2BXRA 1TDNA 4C5OA 3K7MX 1LJ1A 2A87A 2R0CA 4EIPA 4TM0A 1JRZA 1ZDLA 5FMHA 4D04A 3QSEA 2BC1A 3CPHG 2X8GA 3EANA 1DODA 5KMQA 1K4QA 3NKSA 1ZMCA 1Y56A 4NTDA 4DSHA 3HYWA 4IA5A 1PBEA 5HHFA 3AE1A 1QLBA 3VR9A 3KD9A 1OJTA 4GDEA 1EL7A 4NEVA 2YLXA 3AEFA 3AXBA 3CNPA 3AB1A 3AE8A 3GMBA 3GWDA 3UKAA 2XFUA 3VRAA 4H4VA 1GESA 5FS9A 1DJQA 3QVRA 4YTPA 5IQ1A 3NYCA 3GSIA 4EMWA 2GMJA 2YQUA 3GRSA 1NHRA 3PO7A 2DKIA 2BS3A 4H2PA 3ICTA 3NNEA 2WP6A 4XWZA 1GRFA 2R9ZA 4GCMA 1P2EA 1VQWA 2V3AA 1BWCA 1D4EA 4JQ9A 4U8OA 3SFDA 2EQ6A 2GVCA 3EAOA 4U8KA 3UOXA 4AT0A 3ZYXA 3G5RA 1H7XA 3LB8A 4JN9A 1YKJA 4GDPA 4LIIA 3NN6X 4AP1A 1LQUA 2IVDA 1B37A 2YAUA 3UOVA 4BJZA 1SEZA 1JRYA 1NG4A 4K5RA 1ZP0A 3NYEA 4X9NA 4U8LA 3NTAA 1GTEA 1MO9A 1DOBA 1L9CA 3IWAA 2YLZA 4RG4A 2A89A 1MXTA 2WEUA 1GETA 4U8MA 4K8DA 4O5QA 4B1BA 3NG7X 3D1CA 2XVFA 3VRDB 1D7YA 4YXDA 2WS3A 4CBQA 3ATQA 1RSGA 3UKQA 4NZHA 2BCGG 4OPTA 4ICYA 4LU6A 2XLSA 2QAEA 3H8LA 1FECA 2GH5A 3SZ0A 2GAGB 1KSUA 4YTMA 2C3DA 3F8DA 4HB9A 1CF3A 1XPQA 1BGNA 2VVMA 5CQFA 3SY4A 2QA2A 2C73A 3ADAB 1CHUA 4UP3A 4ZN0A 1Y56B 2VOUA 2YG5A 4UDPA 4TLXA 2XFQA 4CCQA 2ACZA 3DA1A 3BI2A 4JY3A 1L9DA 4H4QA 4USRA 1D4DA 2R46A 3HYXA 4C3XA 2V61A 1TYPA 3LZXA 4KPRA 2JB3A 4H2QA 5CKUA 1DXLA 2B9XA 5U1OA 2CVJA 4H4YA 3NLCA 3AEEA 4D03A 2RABA 4EM4A 1FOHA 1GERA 1H83A 2WPCA 3AD8B 3G5QA 1L0VA 3P4SA 2X3NA 4H4TA 5IQ4A 5LV9A 3UTEA 1GEUA 4H2RA 2C7GA 1CC4A 3R9UA 2BCPA 1GTHA 1FCDA 4LA1A 2XLPA 3ICSA 2YG6A 5FS6A 4YSYA 4B67A 4FK1C 3WE0A 3NIXA 4OPDA 1NDAA 4GUVA 3DH9A 2X99A 1NAAA 3AEGA 4H4PA 4JNQA 1AOGA 1S3EA 4IVOB 2VRLA 1NEKA 3CPJG 1S3BA 5EB4A 4EQWA 5J7XA 1EL5A 4O5UA 2XLRA 3SX6A 2JK6A 2XFNA 2NVKX 3NHOX 1VRQB 1LV0A 2APGA 3P9UA 2GAHB 3CGDA 4JNAA 2B76A 3IF9A 2VRMA 4IA6A 4OPLA 4G9KA 2J3NA 3SZCA 5ER0A 1B5QA 1BZLA 2R0PA 3JSKA 3K7TA 1CJ2A 1UKVG 4CNJA 1RYIA 1Y0PA 4NNJA 3OZ2A 3QSMA 4A7AA 1O95A 3Q6JA 4H4XA 3CIRA 2BK3A 3P1WA 1K0IA 3F8PA 3SM8A 2HQMA 3CNDA 3IC9A 4G6HA 1NG3A 2R0GA 5KMPA 1EBDA 1OJCA 1IUSA 3GDPA 4OVIA 2TPRA 4H4SA 3GMCA 2BC0A 3AE9A 2WPEA 5DBJA 1JRXA 2YG4A 2JAEA 2XVJA 2WPFA 1Z6LA 2VQ7A 5IPYA 1EL8A 3UKKA 3C4NA 4EIQA 4H4UA 2C4CA 3O0HA 4J2WA 2GV8A 2BXSA 4B63A 3KVEA 5L46A 1OJAA 1PBCA 3DGZA 2WQYA 2WOVA 3RNMA 2XYOA 3AYJA 4J56A 4AOXA 4J31A 4U2LA 2YM1A 3OC4A 3AE7A 1ZK7A
chains in the Genus database with same CATH topology
3AEAA 2F5ZA 4EMIA 3DJGX 3NK0X 2JB2A 2RGJA 1H82A 1PDHA 4WX1A 3SGLA 3CMMA 3T2KA 4G74A 5HYMA 2C76A 2ZZCA 3S61A 2YVFA 3M0OA 3CGBA 1JU2A 3DMEA 2RGHA 1H7WA 2VVLA 4NTCA 1RP0A 4G6GA 3KPFA 1TDFA 3VQRA 3T0KA 3QSSA 3CGCA 1F6MA 2XFOA 3V3NA 2GR1A 1H6VA 4A9WA 2V5ZA 4RG3A 2GR3A 1K0JA 2XDOA 1P2HA 3ISHA 1F8WA 3FBSA 4OPGA 3UOZA 4B68A 5M10A 1TDOA 2V60A 3K30A 1CJ3A 2WETA 1DOCA 5J60A 5EBKA 2BRYA 2UZZA 3SQPA 1PN0A 4E0VA 3NTDA 4DGKA 2C70A 4U8JA 4A99A 1V59A 4FDCB 3H4KA 4ECHA 3UTHA 4GF7A 1K0LA 3DK9A 3P4QA 4YWOA 2C75A 3UKLA 1IUTA 1PHHA 4CY8A 2GQWA 3NK2X 1PXBA 1E1MA 1DOEA 3GYXA 1YQZA 2WDQA 4CCRA 3CTYA 4GRTA 3ALMA 4IV9A 4WCTA 3T2YA 4J34A 5JCMA 2XFPA 3DJJA 2B9YA 4OCGA 5KMRA 2WDRA 3C96A 1LQTA 1NHPA 3PS9A 3ICRA 4CY6A 5JCLA 4BK3A 2BS2A 1TRBA 4G73A 5KRQA 4U2TA 3UP5A 1BF3A 3FPZA 2A8XA 1O5WA 2WOIA 3M12A 3M13A 2YLRA 3KKJA 3CPIG 4U2SA 1XHCA 4J57A 4B66A 1FEBA 1COYA 5KVHA 2CDUA 4REKA 1PXCA 3AD9B 4B69A 3EF6A 2GR2A 3AD7B 3AE3A 4J33A 5JCNA 1CJ4A 3H8IA 4YTNA 4XWRA 3RP8A 3AWIA 4X9MA 2R45A 1QO8A 3BI4A 4BV6A 2GF3A 1KF6A 2Q7VA 2WDVA 5BUKA 3NK1X 2X8CA 4M52A 4J36A 3QVPA 3BHKA 2Y6QA 4U8NA 2Q6UA 1LTXR 1YY5A 3KA7A 4Z25A 1VG9A 2OA1A 2XVHA 2JBVA 3CNJA 1N4WA 5KOXA 2BK5A 2R4EA 1S2YA 1DNCA 4BURA 4C3YA 3BNUA 5BVAA 4EQRA 3AEDA 2BS4A 3ATRA 2V6OA 3DJEA 4DNAA 1H84A 1N4UA 4C74A 3CGEA 2H89A 5C2TA 1M6IA 3NH3X 4Z24A 3CN8A 1N4VA 1GRHA 4K5SA 5KMSA 3IHGA 4NWZA 3T37A 2E5VA 2BA9A 1YQ4A 2QA1A 3AE6A 1KDGA 3BI5A 3PVCA 4FK1A 1XANA 5JCIA 5C3JA 1H81A 1S2QA 4YT0A 2YR6A 1GRBA 1Q1WA 1VG0A 1F8SA 4YKFA 3LOVA 4B65A 1KSSA 2YLTA 3DJDA 1X31B 1NHQA 3ALJA 2GR0A 2YR5A 3QFBA 3T31A 2GRTA 3UKPA 3GD3A 2JKCA 1VDCA 2YVJA 4I59A 3LJPA 4UDQA 1KNRA 1ZOYA 2C67A 2DKHA 1GXFA 2YM2A 1FEAA 4XXGA 2W0HA 1ZX9A 5U63A 3HZLA 5KXJA 4YSHA 3DGHA 4YSXA 3KU9A 3SXIA 2VVLG 1GNDA 2H88A 3DK4A 3UKFA 2TMDA 2AQJA 4AOSA 1N1PA 2IIDA 1GOSA 2EQ8A 3CNSA 5M0ZA 3E1TA 4EQXA 4JDRA 1E1KA 1GSNA 4A65A 5JCKA 5KOWA 2R4JA 2YLWA 2BK4A 2VZ2A 3QFAA 1IJHA 3V3OA 2RGOA 1MOKA 1CL0A 1PBFA 2XVEA 3UCLA 1ZOVA 1NHSA 4C77A 1OJ9A 1DJNA 5GSNA 4ZCCA 4Z44A 2BABA 2YG3A 3FIMB 3D8XA 1E7PA 3C4AA 2ZZ0A 1B8SA 3GYJA 5EOWA 2IVEA 3NGCX 1L9EA 2VQBA 4PAAA 3SZFA 1TYTA 4DSGA 4Z2TA 1GT8A 2GB0A 2X50A 4H2NA 4H4WA 3UP4A 4NTEA 2FJDA 3VR8A 1B4VA 4P9SA 1PJ6A 2I0ZA 1IUWA 1PBDA 1ZMDA 1QJDA 1E39A 3LZWA 2OLOA 3KLJA 2YVGA 3ABVA 3L1RA 2B7SA 4MJWA 2WBAA 4NEWA 1IUUA 4A5LA 2WU5A 2WOWA 5U25A 4AT2A 4ADWA 1ZKQA 3ZDNA 4AP3A 1CC6A 2CFYA 4TM3A 5KNLA 1REOA 3ALLA 4I58A 1CJCA 3II4A 4II2A 4EQSA 2PYXA 2YG7A 2C72A 4EM3A 2XVIA 1LPFA 2ZZBA 5KVIA 3VRBA 3RHAA 4CRTA 3L8KA 2B9WA 2YLSA 2GMHA 2OALA 3QJ4A 4RSLA 4U8PA 4H7UA 1TDEA 2C64A 1OJDA 2BRAA 4X4JA 3SYIA 2BACA 4YSZA 1PJ7A 2AR8A 3BNMA 3DK8A 4B64A 4Z43A 3EPTA 4APNA 1M64A 1E1LA 3GDNA 3UTFA 2ARDA 1PS9A 4UDRA 2WU2A 3T14A 1GV4A 1EL9A 2FJEA 4H4ZA 4OPUA 1D5TA 4H50A 4N9XA 2Y6RA 3AEBA 4Y4MA 2OAMA 4FX9A 5TR3A 4A6NA 1F8RA 4BK1A 3AYIA 4Z2RA 4PABA 2V3BA 3GWFA 2Q0LA 2E4GA 1LVLA 4EMJA 3K7QX 2JB1A 3AYLA 3FG2P 4U8IA 4K22A 5BRTA 1IUXA 3UTGA 5HXIA 5GRTA 3NN0X 1TDKA 1JNRA 1BGJA 5KWFA 1KFYA 2FJAA 2OLNA 4CNKA 1ELIA 2XLUA 3NT6A 2CULA 1HYUA 3G5SA 3T2ZA 4IVMB 2B7RA 2C66A 1PXAA 2Z5YA 2WP5A 2GEWA 3B6DA 3HYVA 2WESA 4TLZA 3SZWA 1H86A 2EQ9A 2YR4A 3F8RA 1O94A 1GALA 4A79A 3AE2A 4Y4LA 1NPXA 2WHDA 2XLTA 3AE4A 2C65A 2EQ7A 3B3RA 3GRTA 4Y4NA 4HA6A 3AE5A 2GQFA 3P4PA 4BJYA 1PBBA 2WP9A 3AECA 3V76A 4KX6A 1Q1RA 1ZY8A 2ZBWA 3LXDA 2BYBA 3NRNA 3GYIA 3I6DA 4JY2A 1GRTA 1NENA 3ITJA 1E1NA 2C3CA 1D7LA 4ZCDA 4K2XA 1XDIA 5BULA 1GPEA 3CNTA 4GAVA 4GR1A 4K7ZA 1FL2A 1KNPA 3RP7A 3UKHA 1CC2A 2NPXA 3P4RA 1GREA 4GAPA 4H4RA 3S5WA 1GRAA 3FMWA 1BKWA 1E6EA 1ONFA 2E1MA 1D4CA 1JEHA 1YQ3A 1IUVA 2X8HA 4USQA 4TM1A 1CBOA 3URHA 1GRGA 4YKGA 2PHHA 2AAQA 2QCUA 3I3LA 3UOYA 4Z26A 2YWLA 3REDA 4BK2A 2O9ZA 3Q9TA 5FS8A 3RP6A 4OPCA 1PJ5A 3SFEA 4TM4A 4OPIA 4A6NB 3KPKA 1Q9IA 4II3A 1F3PA 5FS7A 5EB5A 3GD4A 3BHFA 4Z2UA 2FJBA 3COXA 5HY5A 1JNZA 3IHMA 3NYFA 2Q0KA 1JOAA 1W4XA 2FBWA 2XCGA 2Z5XA 3LADA 2BXRA 1TDNA 4C5OA 3K7MX 1LJ1A 2A87A 2R0CA 4EIPA 4TM0A 1JRZA 1ZDLA 5FMHA 4D04A 3QSEA 2BC1A 3CPHG 2X8GA 3EANA 1DODA 5KMQA 1K4QA 3NKSA 1ZMCA 1Y56A 4NTDA 4DSHA 3HYWA 4IA5A 1PBEA 5HHFA 3AE1A 1QLBA 3VR9A 3KD9A 1OJTA 4GDEA 1EL7A 4NEVA 2YLXA 3AEFA 3AXBA 3CNPA 3AB1A 3AE8A 3GMBA 3GWDA 3UKAA 2XFUA 3VRAA 4H4VA 1GESA 5FS9A 1DJQA 3QVRA 4YTPA 5IQ1A 3NYCA 3GSIA 4EMWA 2GMJA 2YQUA 3GRSA 1NHRA 3PO7A 2DKIA 2BS3A 4H2PA 3ICTA 3NNEA 2WP6A 4XWZA 1GRFA 2R9ZA 4GCMA 1P2EA 1VQWA 2V3AA 1BWCA 1D4EA 4JQ9A 4U8OA 3SFDA 2EQ6A 2GVCA 3EAOA 4U8KA 3UOXA 4AT0A 3ZYXA 3G5RA 1H7XA 3LB8A 4JN9A 1YKJA 4GDPA 4LIIA 3NN6X 4AP1A 1LQUA 2IVDA 1B37A 2YAUA 3UOVA 4BJZA 1SEZA 1JRYA 1NG4A 4K5RA 1ZP0A 3NYEA 4X9NA 4U8LA 3NTAA 1GTEA 1MO9A 1DOBA 1L9CA 3IWAA 2YLZA 4RG4A 2A89A 1MXTA 2WEUA 1GETA 4U8MA 4K8DA 4O5QA 4B1BA 3NG7X 3D1CA 2XVFA 3VRDB 1D7YA 4YXDA 2WS3A 4CBQA 3ATQA 1RSGA 3UKQA 4NZHA 2BCGG 4OPTA 4ICYA 4LU6A 2XLSA 2QAEA 3H8LA 1FECA 2GH5A 3SZ0A 2GAGB 1KSUA 4YTMA 2C3DA 3F8DA 4HB9A 1CF3A 1XPQA 1BGNA 2VVMA 5CQFA 3SY4A 2QA2A 2C73A 3ADAB 1CHUA 4UP3A 4ZN0A 1Y56B 2VOUA 2YG5A 4UDPA 4TLXA 2XFQA 4CCQA 2ACZA 3DA1A 3BI2A 4JY3A 1L9DA 4H4QA 4USRA 1D4DA 2R46A 3HYXA 4C3XA 2V61A 1TYPA 3LZXA 4KPRA 2JB3A 4H2QA 5CKUA 1DXLA 2B9XA 5U1OA 2CVJA 4H4YA 3NLCA 3AEEA 4D03A 2RABA 4EM4A 1FOHA 1GERA 1H83A 2WPCA 3AD8B 3G5QA 1L0VA 3P4SA 2X3NA 4H4TA 5IQ4A 5LV9A 3UTEA 1GEUA 4H2RA 2C7GA 1CC4A 3R9UA 2BCPA 1GTHA 1FCDA 4LA1A 2XLPA 3ICSA 2YG6A 5FS6A 4YSYA 4B67A 4FK1C 3WE0A 3NIXA 4OPDA 1NDAA 4GUVA 3DH9A 2X99A 1NAAA 3AEGA 4H4PA 4JNQA 1AOGA 1S3EA 4IVOB 2VRLA 1NEKA 3CPJG 1S3BA 5EB4A 4EQWA 5J7XA 1EL5A 4O5UA 2XLRA 3SX6A 2JK6A 2XFNA 2NVKX 3NHOX 1VRQB 1LV0A 2APGA 3P9UA 2GAHB 3CGDA 4JNAA 2B76A 3IF9A 2VRMA 4IA6A 4OPLA 4G9KA 2J3NA 3SZCA 5ER0A 1B5QA 1BZLA 2R0PA 3JSKA 3K7TA 1CJ2A 1UKVG 4CNJA 1RYIA 1Y0PA 4NNJA 3OZ2A 3QSMA 4A7AA 1O95A 3Q6JA 4H4XA 3CIRA 2BK3A 3P1WA 1K0IA 3F8PA 3SM8A 2HQMA 3CNDA 3IC9A 4G6HA 1NG3A 2R0GA 5KMPA 1EBDA 1OJCA 1IUSA 3GDPA 4OVIA 2TPRA 4H4SA 3GMCA 2BC0A 3AE9A 2WPEA 5DBJA 1JRXA 2YG4A 2JAEA 2XVJA 2WPFA 1Z6LA 2VQ7A 5IPYA 1EL8A 3UKKA 3C4NA 4EIQA 4H4UA 2C4CA 3O0HA 4J2WA 2GV8A 2BXSA 4B63A 3KVEA 5L46A 1OJAA 1PBCA 3DGZA 2WQYA 2WOVA 3RNMA 2XYOA 3AYJA 4J56A 4AOXA 4J31A 4U2LA 2YM1A 3OC4A 3AE7A 1ZK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA A;  2F5Z A;  4EMI A;  3DJG X;  3NK0 X;  2JB2 A;  2RGJ A;  1H82 A;  1PDH A;  4WX1 A;  3SGL A;  5HYM A;  2C76 A;  2ZZC A;  3S61 A;  2YVF A;  3M0O A;  3CGB A;  1JU2 A;  3DME A;  2RGH A;  1H7W A;  2VVL A;  4NTC A;  1RP0 A;  3KPF A;  1TDF A;  3VQR A;  3QSS A;  3CGC A;  1F6M A;  2XFO A;  3V3N A;  2GR1 A;  1H6V A;  4A9W A;  2V5Z A;  4RG3 A;  2GR3 A;  1K0J A;  2XDO A;  1P2H A;  3ISH A;  1F8W A;  3FBS A;  4OPG A;  3UOZ A;  4B68 A;  5M10 A;  1TDO A;  2V60 A;  3K30 A;  1CJ3 A;  2WET A;  1DOC A;  5J60 A;  5EBK A;  2UZZ A;  3SQP A;  1PN0 A;  4E0V A;  3NTD A;  4DGK A;  2C70 A;  4U8J A;  4A99 A;  1V59 A;  4FDC B;  3H4K A;  4ECH A;  3UTH A;  4GF7 A;  1K0L A;  3DK9 A;  3P4Q A;  4YWO A;  2C75 A;  3UKL A;  1IUT A;  1PHH A;  4CY8 A;  2GQW A;  3NK2 X;  1PXB A;  1E1M A;  1DOE A;  1YQZ A;  2WDQ A;  4CCR A;  3CTY A;  4GRT A;  3ALM A;  4IV9 A;  4WCT A;  4J34 A;  5JCM A;  2XFP A;  3DJJ A;  2B9Y A;  4OCG A;  2WDR A;  3C96 A;  1LQT A;  1NHP A;  3PS9 A;  3ICR A;  4CY6 A;  5JCL A;  4BK3 A;  2BS2 A;  1TRB A;  5KRQ A;  4U2T A;  3UP5 A;  1BF3 A;  3FPZ A;  2A8X A;  1O5W A;  2WOI A;  3M12 A;  3M13 A;  2YLR A;  3KKJ A;  3CPI G;  4U2S A;  1XHC A;  4J57 A;  4B66 A;  1FEB A;  1COY A;  5KVH A;  2CDU A;  4REK A;  1PXC A;  3AD9 B;  4B69 A;  3EF6 A;  2GR2 A;  3AD7 B;  3AE3 A;  4J33 A;  5JCN A;  1CJ4 A;  3H8I A;  4YTN A;  4XWR A;  3RP8 A;  3AWI A;  4X9M A;  2R45 A;  1QO8 A;  3BI4 A;  4BV6 A;  2GF3 A;  1KF6 A;  2Q7V A;  2WDV A;  5BUK A;  3NK1 X;  2X8C A;  4M52 A;  4J36 A;  3QVP A;  3BHK A;  2Y6Q A;  4U8N A;  2Q6U A;  1LTX R;  1YY5 A;  3KA7 A;  4Z25 A;  1VG9 A;  2OA1 A;  2XVH A;  2JBV A;  3CNJ A;  1N4W A;  5KOX A;  2BK5 A;  2R4E A;  1S2Y A;  1DNC A;  4BUR A;  4C3Y A;  3BNU A;  5BVA A;  4EQR A;  3AED A;  2BS4 A;  3ATR A;  2V6O A;  3DJE A;  4DNA A;  1H84 A;  1N4U A;  4C74 A;  3CGE A;  2H89 A;  5C2T A;  1M6I A;  3NH3 X;  4Z24 A;  3CN8 A;  1N4V A;  1GRH A;  4K5S A;  3IHG A;  3T37 A;  2E5V A;  2BA9 A;  1YQ4 A;  2QA1 A;  3AE6 A;  1KDG A;  3BI5 A;  3PVC A;  4FK1 A;  1XAN A;  5JCI A;  5C3J A;  1H81 A;  1S2Q A;  4YT0 A;  2YR6 A;  1GRB A;  1Q1W A;  1VG0 A;  1F8S A;  4YKF A;  3LOV A;  4B65 A;  1KSS A;  2YLT A;  3DJD A;  1X31 B;  1NHQ A;  3ALJ A;  2GR0 A;  2YR5 A;  3QFB A;  3UKP A;  2GRT A;  3GD3 A;  2JKC A;  1VDC A;  2YVJ A;  4I59 A;  3LJP A;  4UDQ A;  1KNR A;  1ZOY A;  2C67 A;  2DKH A;  1GXF A;  2YM2 A;  1FEA A;  4XXG A;  2W0H A;  1ZX9 A;  5U63 A;  3HZL A;  5KXJ A;  4YSH A;  3DGH A;  4YSX A;  3KU9 A;  2VVL G;  1GND A;  2H88 A;  3DK4 A;  3UKF A;  2TMD A;  2AQJ A;  4AOS A;  1N1P A;  2IID A;  1GOS A;  2EQ8 A;  3CNS A;  5M0Z A;  3E1T A;  4EQX A;  4JDR A;  1E1K A;  1GSN A;  4A65 A;  5JCK A;  5KOW A;  2R4J A;  2YLW A;  2BK4 A;  2VZ2 A;  3QFA A;  1IJH A;  3V3O A;  2RGO A;  1MOK A;  1CL0 A;  1PBF A;  2XVE A;  3UCL A;  1ZOV A;  1NHS A;  4C77 A;  1OJ9 A;  1DJN A;  5GSN A;  4ZCC A;  4Z44 A;  2BAB A;  2YG3 A;  3FIM B;  3D8X A;  1E7P A;  3C4A A;  2ZZ0 A;  1B8S A;  3GYJ A;  5EOW A;  2IVE A;  3NGC X;  1L9E A;  2VQB A;  4PAA A;  4DSG A;  1TYT A;  4Z2T A;  1GT8 A;  2GB0 A;  2X50 A;  4H2N A;  4H4W A;  3UP4 A;  4NTE A;  2FJD A;  3VR8 A;  1B4V A;  4P9S A;  1PJ6 A;  2I0Z A;  1IUW A;  1PBD A;  1ZMD A;  1QJD A;  1E39 A;  3LZW A;  2OLO A;  3KLJ A;  2YVG A;  3ABV A;  3L1R A;  2B7S A;  4MJW A;  2WBA A;  4NEW A;  1IUU A;  4A5L A;  2WU5 A;  2WOW A;  5U25 A;  4AT2 A;  4ADW A;  1ZKQ A;  3ZDN A;  4AP3 A;  1CC6 A;  2CFY A;  4TM3 A;  1REO A;  3ALL A;  4I58 A;  1CJC A;  3II4 A;  4EQS A;  2PYX A;  2YG7 A;  2C72 A;  4EM3 A;  2XVI A;  1LPF A;  2ZZB A;  5KVI A;  3VRB A;  3RHA A;  4CRT A;  3L8K A;  2B9W A;  2YLS A;  2GMH A;  2OAL A;  3QJ4 A;  4RSL A;  4U8P A;  4H7U A;  1TDE A;  2C64 A;  1OJD A;  4X4J A;  2BAC A;  4YSZ A;  1PJ7 A;  2AR8 A;  3BNM A;  3DK8 A;  4B64 A;  4Z43 A;  3EPT A;  4APN A;  1M64 A;  1E1L A;  3GDN A;  3UTF A;  2ARD A;  1PS9 A;  4UDR A;  2WU2 A;  1GV4 A;  1EL9 A;  2FJE A;  4H4Z A;  4OPU A;  1D5T A;  4H50 A;  4N9X A;  2Y6R A;  3AEB A;  4Y4M A;  2OAM A;  4FX9 A;  5TR3 A;  4A6N A;  1F8R A;  4BK1 A;  3AYI A;  4Z2R A;  4PAB A;  2V3B A;  3GWF A;  2Q0L A;  2E4G A;  1LVL A;  4EMJ A;  3K7Q X;  2JB1 A;  3AYL A;  3FG2 P;  4U8I A;  4K22 A;  5BRT A;  1IUX A;  3UTG A;  5HXI A;  5GRT A;  3NN0 X;  1TDK A;  1JNR A;  1BGJ A;  5KWF A;  1KFY A;  2FJA A;  2OLN A;  4CNK A;  1ELI A;  2XLU A;  3NT6 A;  2CUL A;  1HYU A;  3G5S A;  4IVM B;  2B7R A;  2C66 A;  1PXA A;  2Z5Y A;  2WP5 A;  2GEW A;  3B6D A;  2WES A;  4TLZ A;  1H86 A;  2EQ9 A;  2YR4 A;  3F8R A;  1O94 A;  1GAL A;  4A79 A;  3AE2 A;  4Y4L A;  1NPX A;  2WHD A;  2XLT A;  3AE4 A;  2C65 A;  2EQ7 A;  3B3R A;  3GRT A;  4Y4N A;  4HA6 A;  3AE5 A;  2GQF A;  3P4P A;  4BJY A;  1PBB A;  2WP9 A;  3AEC A;  3V76 A;  4KX6 A;  1Q1R A;  1ZY8 A;  2ZBW A;  3LXD A;  2BYB A;  3NRN A;  3GYI A;  3I6D A;  4JY2 A;  1GRT A;  1NEN A;  3ITJ A;  1E1N A;  2C3C A;  1D7L A;  4ZCD A;  4K2X A;  1XDI A;  5BUL A;  1GPE A;  3CNT A;  4GR1 A;  4K7Z A;  1FL2 A;  1KNP A;  3RP7 A;  3UKH A;  1CC2 A;  2NPX A;  3P4R A;  1GRE A;  4H4R A;  3S5W A;  1GRA A;  3FMW A;  1BKW A;  1E6E A;  1ONF A;  2E1M A;  1D4C A;  1JEH A;  1YQ3 A;  1IUV A;  2X8H A;  4USQ A;  4TM1 A;  1CBO A;  3URH A;  1GRG A;  4YKG A;  2PHH A;  2AAQ A;  2QCU A;  3I3L A;  3UOY A;  4Z26 A;  2YWL A;  3RED A;  4BK2 A;  2O9Z A;  3Q9T A;  5FS8 A;  3RP6 A;  4OPC A;  1PJ5 A;  3SFE A;  4TM4 A;  4OPI A;  4A6N B;  5FS7 A;  1Q9I A;  1F3P A;  5EB5 A;  3GD4 A;  3BHF A;  4Z2U A;  2FJB A;  3COX A;  5HY5 A;  1JNZ A;  3IHM A;  3NYF A;  2Q0K A;  1JOA A;  1W4X A;  2FBW A;  2XCG A;  2Z5X A;  3LAD A;  2BXR A;  1TDN A;  4C5O A;  3K7M X;  1LJ1 A;  2A87 A;  2R0C A;  4EIP A;  4TM0 A;  1JRZ A;  1ZDL A;  5FMH A;  4D04 A;  3QSE A;  2BC1 A;  3CPH G;  2X8G A;  3EAN A;  1DOD A;  1K4Q A;  3NKS A;  1ZMC A;  1Y56 A;  4NTD A;  4DSH A;  4IA5 A;  1PBE A;  5HHF A;  3AE1 A;  1QLB A;  3VR9 A;  3KD9 A;  1OJT A;  4GDE A;  1EL7 A;  4NEV A;  2YLX A;  3AEF A;  3AXB A;  3CNP A;  3AB1 A;  3AE8 A;  3GMB A;  3GWD A;  3UKA A;  2XFU A;  3VRA A;  4H4V A;  1GES A;  5FS9 A;  1DJQ A;  3QVR A;  4YTP A;  5IQ1 A;  3NYC A;  3GSI A;  4EMW A;  2GMJ A;  2YQU A;  3GRS A;  1NHR A;  3PO7 A;  2DKI A;  2BS3 A;  4H2P A;  3ICT A;  3NNE A;  2WP6 A;  4XWZ A;  1GRF A;  2R9Z A;  4GCM A;  1P2E A;  1VQW A;  2V3A A;  1BWC A;  1D4E A;  4JQ9 A;  4U8O A;  3SFD A;  2EQ6 A;  2GVC A;  3EAO A;  4U8K A;  3UOX A;  4AT0 A;  3ZYX A;  3G5R A;  1H7X A;  3LB8 A;  4JN9 A;  1YKJ A;  4GDP A;  4LII A;  3NN6 X;  4AP1 A;  1LQU A;  2IVD A;  1B37 A;  2YAU A;  3UOV A;  4BJZ A;  1SEZ A;  1JRY A;  1NG4 A;  4K5R A;  1ZP0 A;  3NYE A;  4X9N A;  4U8L A;  3NTA A;  1GTE A;  1MO9 A;  1DOB A;  1L9C A;  3IWA A;  2YLZ A;  4RG4 A;  2A89 A;  1MXT A;  2WEU A;  1GET A;  4U8M A;  4K8D A;  4O5Q A;  4B1B A;  3NG7 X;  3D1C A;  2XVF A;  3VRD B;  1D7Y A;  4YXD A;  2WS3 A;  4CBQ A;  3ATQ A;  1RSG A;  3UKQ A;  4NZH A;  2BCG G;  4OPT A;  4ICY A;  4LU6 A;  2XLS A;  2QAE A;  3H8L A;  1FEC A;  2GH5 A;  2GAG B;  1KSU A;  4YTM A;  2C3D A;  3F8D A;  4HB9 A;  1CF3 A;  1XPQ A;  1BGN A;  2VVM A;  5CQF A;  2QA2 A;  2C73 A;  3ADA B;  1CHU A;  4UP3 A;  4ZN0 A;  1Y56 B;  2VOU A;  2YG5 A;  4UDP A;  4TLX A;  2XFQ A;  4CCQ A;  2ACZ A;  3DA1 A;  3BI2 A;  4JY3 A;  1L9D A;  4H4Q A;  4USR A;  1D4D A;  2R46 A;  4C3X A;  2V61 A;  1TYP A;  3LZX A;  4KPR A;  2JB3 A;  4H2Q A;  5CKU A;  1DXL A;  2B9X A;  5U1O A;  2CVJ A;  4H4Y A;  3NLC A;  3AEE A;  4D03 A;  2RAB A;  4EM4 A;  1FOH A;  1GER A;  1H83 A;  2WPC A;  3AD8 B;  3G5Q A;  1L0V A;  3P4S A;  2X3N A;  4H4T A;  5IQ4 A;  5LV9 A;  3UTE A;  1GEU A;  4H2R A;  2C7G A;  1CC4 A;  3R9U A;  2BCP A;  1GTH A;  1FCD A;  4LA1 A;  2XLP A;  3ICS A;  2YG6 A;  5FS6 A;  4YSY A;  4B67 A;  4FK1 C;  3WE0 A;  3NIX A;  4OPD A;  1NDA A;  4GUV A;  3DH9 A;  2X99 A;  1NAA A;  3AEG A;  4H4P A;  4JNQ A;  1AOG A;  1S3E A;  4IVO B;  2VRL A;  1NEK A;  3CPJ G;  1S3B A;  5EB4 A;  4EQW A;  5J7X A;  1EL5 A;  4O5U A;  2XLR A;  2JK6 A;  2XFN A;  2NVK X;  3NHO X;  1VRQ B;  1LV0 A;  2APG A;  3P9U A;  2GAH B;  3CGD A;  4JNA A;  2B76 A;  3IF9 A;  2VRM A;  4IA6 A;  4OPL A;  2J3N A;  5ER0 A;  1B5Q A;  1BZL A;  2R0P A;  3JSK A;  3K7T A;  1CJ2 A;  1UKV G;  4CNJ A;  1RYI A;  1Y0P A;  4A7A A;  3OZ2 A;  3QSM A;  1O95 A;  3Q6J A;  4H4X A;  3CIR A;  2BK3 A;  3P1W A;  1K0I A;  3F8P A;  3SM8 A;  2HQM A;  3CND A;  3IC9 A;  1NG3 A;  2R0G A;  1EBD A;  1OJC A;  1IUS A;  3GDP A;  4OVI A;  2TPR A;  4H4S A;  3GMC A;  2BC0 A;  3AE9 A;  2WPE A;  5DBJ A;  1JRX A;  2YG4 A;  2JAE A;  2XVJ A;  2WPF A;  1Z6L A;  2VQ7 A;  5IPY A;  1EL8 A;  3UKK A;  3C4N A;  4EIQ A;  4H4U A;  3O0H A;  4J2W A;  2GV8 A;  2BXS A;  4B63 A;  3KVE A;  5L46 A;  1OJA A;  1PBC A;  3DGZ A;  2WQY A;  2WOV A;  3RNM A;  2XYO A;  3AYJ A;  4J56 A;  4AOX A;  4J31 A;  4U2L A;  2YM1 A;  3OC4 A;  3AE7 A;  1ZK7 A; 
#chains in the Genus database with same CATH topology
 3AEA A;  2F5Z A;  4EMI A;  3DJG X;  3NK0 X;  2JB2 A;  2RGJ A;  1H82 A;  1PDH A;  4WX1 A;  3SGL A;  3CMM A;  3T2K A;  4G74 A;  5HYM A;  2C76 A;  2ZZC A;  3S61 A;  2YVF A;  3M0O A;  3CGB A;  1JU2 A;  3DME A;  2RGH A;  1H7W A;  2VVL A;  4NTC A;  1RP0 A;  4G6G A;  3KPF A;  1TDF A;  3VQR A;  3T0K A;  3QSS A;  3CGC A;  1F6M A;  2XFO A;  3V3N A;  2GR1 A;  1H6V A;  4A9W A;  2V5Z A;  4RG3 A;  2GR3 A;  1K0J A;  2XDO A;  1P2H A;  3ISH A;  1F8W A;  3FBS A;  4OPG A;  3UOZ A;  4B68 A;  5M10 A;  1TDO A;  2V60 A;  3K30 A;  1CJ3 A;  2WET A;  1DOC A;  5J60 A;  5EBK A;  2BRY A;  2UZZ A;  3SQP A;  1PN0 A;  4E0V A;  3NTD A;  4DGK A;  2C70 A;  4U8J A;  4A99 A;  1V59 A;  4FDC B;  3H4K A;  4ECH A;  3UTH A;  4GF7 A;  1K0L A;  3DK9 A;  3P4Q A;  4YWO A;  2C75 A;  3UKL A;  1IUT A;  1PHH A;  4CY8 A;  2GQW A;  3NK2 X;  1PXB A;  1E1M A;  1DOE A;  3GYX A;  1YQZ A;  2WDQ A;  4CCR A;  3CTY A;  4GRT A;  3ALM A;  4IV9 A;  4WCT A;  3T2Y A;  4J34 A;  5JCM A;  2XFP A;  3DJJ A;  2B9Y A;  4OCG A;  5KMR A;  2WDR A;  3C96 A;  1LQT A;  1NHP A;  3PS9 A;  3ICR A;  4CY6 A;  5JCL A;  4BK3 A;  2BS2 A;  1TRB A;  4G73 A;  5KRQ A;  4U2T A;  3UP5 A;  1BF3 A;  3FPZ A;  2A8X A;  1O5W A;  2WOI A;  3M12 A;  3M13 A;  2YLR A;  3KKJ A;  3CPI G;  4U2S A;  1XHC A;  4J57 A;  4B66 A;  1FEB A;  1COY A;  5KVH A;  2CDU A;  4REK A;  1PXC A;  3AD9 B;  4B69 A;  3EF6 A;  2GR2 A;  3AD7 B;  3AE3 A;  4J33 A;  5JCN A;  1CJ4 A;  3H8I A;  4YTN A;  4XWR A;  3RP8 A;  3AWI A;  4X9M A;  2R45 A;  1QO8 A;  3BI4 A;  4BV6 A;  2GF3 A;  1KF6 A;  2Q7V A;  2WDV A;  5BUK A;  3NK1 X;  2X8C A;  4M52 A;  4J36 A;  3QVP A;  3BHK A;  2Y6Q A;  4U8N A;  2Q6U A;  1LTX R;  1YY5 A;  3KA7 A;  4Z25 A;  1VG9 A;  2OA1 A;  2XVH A;  2JBV A;  3CNJ A;  1N4W A;  5KOX A;  2BK5 A;  2R4E A;  1S2Y A;  1DNC A;  4BUR A;  4C3Y A;  3BNU A;  5BVA A;  4EQR A;  3AED A;  2BS4 A;  3ATR A;  2V6O A;  3DJE A;  4DNA A;  1H84 A;  1N4U A;  4C74 A;  3CGE A;  2H89 A;  5C2T A;  1M6I A;  3NH3 X;  4Z24 A;  3CN8 A;  1N4V A;  1GRH A;  4K5S A;  5KMS A;  3IHG A;  4NWZ A;  3T37 A;  2E5V A;  2BA9 A;  1YQ4 A;  2QA1 A;  3AE6 A;  1KDG A;  3BI5 A;  3PVC A;  4FK1 A;  1XAN A;  5JCI A;  5C3J A;  1H81 A;  1S2Q A;  4YT0 A;  2YR6 A;  1GRB A;  1Q1W A;  1VG0 A;  1F8S A;  4YKF A;  3LOV A;  4B65 A;  1KSS A;  2YLT A;  3DJD A;  1X31 B;  1NHQ A;  3ALJ A;  2GR0 A;  2YR5 A;  3QFB A;  3T31 A;  2GRT A;  3UKP A;  3GD3 A;  2JKC A;  1VDC A;  2YVJ A;  4I59 A;  3LJP A;  4UDQ A;  1KNR A;  1ZOY A;  2C67 A;  2DKH A;  1GXF A;  2YM2 A;  1FEA A;  4XXG A;  2W0H A;  1ZX9 A;  5U63 A;  3HZL A;  5KXJ A;  4YSH A;  3DGH A;  4YSX A;  3KU9 A;  3SXI A;  2VVL G;  1GND A;  2H88 A;  3DK4 A;  3UKF A;  2TMD A;  2AQJ A;  4AOS A;  1N1P A;  2IID A;  1GOS A;  2EQ8 A;  3CNS A;  5M0Z A;  3E1T A;  4EQX A;  4JDR A;  1E1K A;  1GSN A;  4A65 A;  5JCK A;  5KOW A;  2R4J A;  2YLW A;  2BK4 A;  2VZ2 A;  3QFA A;  1IJH A;  3V3O A;  2RGO A;  1MOK A;  1CL0 A;  1PBF A;  2XVE A;  3UCL A;  1ZOV A;  1NHS A;  4C77 A;  1OJ9 A;  1DJN A;  5GSN A;  4ZCC A;  4Z44 A;  2BAB A;  2YG3 A;  3FIM B;  3D8X A;  1E7P A;  3C4A A;  2ZZ0 A;  1B8S A;  3GYJ A;  5EOW A;  2IVE A;  3NGC X;  1L9E A;  2VQB A;  4PAA A;  3SZF A;  1TYT A;  4DSG A;  4Z2T A;  1GT8 A;  2GB0 A;  2X50 A;  4H2N A;  4H4W A;  3UP4 A;  4NTE A;  2FJD A;  3VR8 A;  1B4V A;  4P9S A;  1PJ6 A;  2I0Z A;  1IUW A;  1PBD A;  1ZMD A;  1QJD A;  1E39 A;  3LZW A;  2OLO A;  3KLJ A;  2YVG A;  3ABV A;  3L1R A;  2B7S A;  4MJW A;  2WBA A;  4NEW A;  1IUU A;  4A5L A;  2WU5 A;  2WOW A;  5U25 A;  4AT2 A;  4ADW A;  1ZKQ A;  3ZDN A;  4AP3 A;  1CC6 A;  2CFY A;  4TM3 A;  5KNL A;  1REO A;  3ALL A;  4I58 A;  1CJC A;  3II4 A;  4II2 A;  4EQS A;  2PYX A;  2YG7 A;  2C72 A;  4EM3 A;  2XVI A;  1LPF A;  2ZZB A;  5KVI A;  3VRB A;  3RHA A;  4CRT A;  3L8K A;  2B9W A;  2YLS A;  2GMH A;  2OAL A;  3QJ4 A;  4RSL A;  4U8P A;  4H7U A;  1TDE A;  2C64 A;  1OJD A;  2BRA A;  4X4J A;  3SYI A;  2BAC A;  4YSZ A;  1PJ7 A;  2AR8 A;  3BNM A;  3DK8 A;  4B64 A;  4Z43 A;  3EPT A;  4APN A;  1M64 A;  1E1L A;  3GDN A;  3UTF A;  2ARD A;  1PS9 A;  4UDR A;  2WU2 A;  3T14 A;  1GV4 A;  1EL9 A;  2FJE A;  4H4Z A;  4OPU A;  1D5T A;  4H50 A;  4N9X A;  2Y6R A;  3AEB A;  4Y4M A;  2OAM A;  4FX9 A;  5TR3 A;  4A6N A;  1F8R A;  4BK1 A;  3AYI A;  4Z2R A;  4PAB A;  2V3B A;  3GWF A;  2Q0L A;  2E4G A;  1LVL A;  4EMJ A;  3K7Q X;  2JB1 A;  3AYL A;  3FG2 P;  4U8I A;  4K22 A;  5BRT A;  1IUX A;  3UTG A;  5HXI A;  5GRT A;  3NN0 X;  1TDK A;  1JNR A;  1BGJ A;  5KWF A;  1KFY A;  2FJA A;  2OLN A;  4CNK A;  1ELI A;  2XLU A;  3NT6 A;  2CUL A;  1HYU A;  3G5S A;  3T2Z A;  4IVM B;  2B7R A;  2C66 A;  1PXA A;  2Z5Y A;  2WP5 A;  2GEW A;  3B6D A;  3HYV A;  2WES A;  4TLZ A;  3SZW A;  1H86 A;  2EQ9 A;  2YR4 A;  3F8R A;  1O94 A;  1GAL A;  4A79 A;  3AE2 A;  4Y4L A;  1NPX A;  2WHD A;  2XLT A;  3AE4 A;  2C65 A;  2EQ7 A;  3B3R A;  3GRT A;  4Y4N A;  4HA6 A;  3AE5 A;  2GQF A;  3P4P A;  4BJY A;  1PBB A;  2WP9 A;  3AEC A;  3V76 A;  4KX6 A;  1Q1R A;  1ZY8 A;  2ZBW A;  3LXD A;  2BYB A;  3NRN A;  3GYI A;  3I6D A;  4JY2 A;  1GRT A;  1NEN A;  3ITJ A;  1E1N A;  2C3C A;  1D7L A;  4ZCD A;  4K2X A;  1XDI A;  5BUL A;  1GPE A;  3CNT A;  4GAV A;  4GR1 A;  4K7Z A;  1FL2 A;  1KNP A;  3RP7 A;  3UKH A;  1CC2 A;  2NPX A;  3P4R A;  1GRE A;  4GAP A;  4H4R A;  3S5W A;  1GRA A;  3FMW A;  1BKW A;  1E6E A;  1ONF A;  2E1M A;  1D4C A;  1JEH A;  1YQ3 A;  1IUV A;  2X8H A;  4USQ A;  4TM1 A;  1CBO A;  3URH A;  1GRG A;  4YKG A;  2PHH A;  2AAQ A;  2QCU A;  3I3L A;  3UOY A;  4Z26 A;  2YWL A;  3RED A;  4BK2 A;  2O9Z A;  3Q9T A;  5FS8 A;  3RP6 A;  4OPC A;  1PJ5 A;  3SFE A;  4TM4 A;  4OPI A;  4A6N B;  3KPK A;  1Q9I A;  4II3 A;  1F3P A;  5FS7 A;  5EB5 A;  3GD4 A;  3BHF A;  4Z2U A;  2FJB A;  3COX A;  5HY5 A;  1JNZ A;  3IHM A;  3NYF A;  2Q0K A;  1JOA A;  1W4X A;  2FBW A;  2XCG A;  2Z5X A;  3LAD A;  2BXR A;  1TDN A;  4C5O A;  3K7M X;  1LJ1 A;  2A87 A;  2R0C A;  4EIP A;  4TM0 A;  1JRZ A;  1ZDL A;  5FMH A;  4D04 A;  3QSE A;  2BC1 A;  3CPH G;  2X8G A;  3EAN A;  1DOD A;  5KMQ A;  1K4Q A;  3NKS A;  1ZMC A;  1Y56 A;  4NTD A;  4DSH A;  3HYW A;  4IA5 A;  1PBE A;  5HHF A;  3AE1 A;  1QLB A;  3VR9 A;  3KD9 A;  1OJT A;  4GDE A;  1EL7 A;  4NEV A;  2YLX A;  3AEF A;  3AXB A;  3CNP A;  3AB1 A;  3AE8 A;  3GMB A;  3GWD A;  3UKA A;  2XFU A;  3VRA A;  4H4V A;  1GES A;  5FS9 A;  1DJQ A;  3QVR A;  4YTP A;  5IQ1 A;  3NYC A;  3GSI A;  4EMW A;  2GMJ A;  2YQU A;  3GRS A;  1NHR A;  3PO7 A;  2DKI A;  2BS3 A;  4H2P A;  3ICT A;  3NNE A;  2WP6 A;  4XWZ A;  1GRF A;  2R9Z A;  4GCM A;  1P2E A;  1VQW A;  2V3A A;  1BWC A;  1D4E A;  4JQ9 A;  4U8O A;  3SFD A;  2EQ6 A;  2GVC A;  3EAO A;  4U8K A;  3UOX A;  4AT0 A;  3ZYX A;  3G5R A;  1H7X A;  3LB8 A;  4JN9 A;  1YKJ A;  4GDP A;  4LII A;  3NN6 X;  4AP1 A;  1LQU A;  2IVD A;  1B37 A;  2YAU A;  3UOV A;  4BJZ A;  1SEZ A;  1JRY A;  1NG4 A;  4K5R A;  1ZP0 A;  3NYE A;  4X9N A;  4U8L A;  3NTA A;  1GTE A;  1MO9 A;  1DOB A;  1L9C A;  3IWA A;  2YLZ A;  4RG4 A;  2A89 A;  1MXT A;  2WEU A;  1GET A;  4U8M A;  4K8D A;  4O5Q A;  4B1B A;  3NG7 X;  3D1C A;  2XVF A;  3VRD B;  1D7Y A;  4YXD A;  2WS3 A;  4CBQ A;  3ATQ A;  1RSG A;  3UKQ A;  4NZH A;  2BCG G;  4OPT A;  4ICY A;  4LU6 A;  2XLS A;  2QAE A;  3H8L A;  1FEC A;  2GH5 A;  3SZ0 A;  2GAG B;  1KSU A;  4YTM A;  2C3D A;  3F8D A;  4HB9 A;  1CF3 A;  1XPQ A;  1BGN A;  2VVM A;  5CQF A;  3SY4 A;  2QA2 A;  2C73 A;  3ADA B;  1CHU A;  4UP3 A;  4ZN0 A;  1Y56 B;  2VOU A;  2YG5 A;  4UDP A;  4TLX A;  2XFQ A;  4CCQ A;  2ACZ A;  3DA1 A;  3BI2 A;  4JY3 A;  1L9D A;  4H4Q A;  4USR A;  1D4D A;  2R46 A;  3HYX A;  4C3X A;  2V61 A;  1TYP A;  3LZX A;  4KPR A;  2JB3 A;  4H2Q A;  5CKU A;  1DXL A;  2B9X A;  5U1O A;  2CVJ A;  4H4Y A;  3NLC A;  3AEE A;  4D03 A;  2RAB A;  4EM4 A;  1FOH A;  1GER A;  1H83 A;  2WPC A;  3AD8 B;  3G5Q A;  1L0V A;  3P4S A;  2X3N A;  4H4T A;  5IQ4 A;  5LV9 A;  3UTE A;  1GEU A;  4H2R A;  2C7G A;  1CC4 A;  3R9U A;  2BCP A;  1GTH A;  1FCD A;  4LA1 A;  2XLP A;  3ICS A;  2YG6 A;  5FS6 A;  4YSY A;  4B67 A;  4FK1 C;  3WE0 A;  3NIX A;  4OPD A;  1NDA A;  4GUV A;  3DH9 A;  2X99 A;  1NAA A;  3AEG A;  4H4P A;  4JNQ A;  1AOG A;  1S3E A;  4IVO B;  2VRL A;  1NEK A;  3CPJ G;  1S3B A;  5EB4 A;  4EQW A;  5J7X A;  1EL5 A;  4O5U A;  2XLR A;  3SX6 A;  2JK6 A;  2XFN A;  2NVK X;  3NHO X;  1VRQ B;  1LV0 A;  2APG A;  3P9U A;  2GAH B;  3CGD A;  4JNA A;  2B76 A;  3IF9 A;  2VRM A;  4IA6 A;  4OPL A;  4G9K A;  2J3N A;  3SZC A;  5ER0 A;  1B5Q A;  1BZL A;  2R0P A;  3JSK A;  3K7T A;  1CJ2 A;  1UKV G;  4CNJ A;  1RYI A;  1Y0P A;  4NNJ A;  3OZ2 A;  3QSM A;  4A7A A;  1O95 A;  3Q6J A;  4H4X A;  3CIR A;  2BK3 A;  3P1W A;  1K0I A;  3F8P A;  3SM8 A;  2HQM A;  3CND A;  3IC9 A;  4G6H A;  1NG3 A;  2R0G A;  5KMP A;  1EBD A;  1OJC A;  1IUS A;  3GDP A;  4OVI A;  2TPR A;  4H4S A;  3GMC A;  2BC0 A;  3AE9 A;  2WPE A;  5DBJ A;  1JRX A;  2YG4 A;  2JAE A;  2XVJ A;  2WPF A;  1Z6L A;  2VQ7 A;  5IPY A;  1EL8 A;  3UKK A;  3C4N A;  4EIQ A;  4H4U A;  2C4C A;  3O0H A;  4J2W A;  2GV8 A;  2BXS A;  4B63 A;  3KVE A;  5L46 A;  1OJA A;  1PBC A;  3DGZ A;  2WQY A;  2WOV A;  3RNM A;  2XYO A;  3AYJ A;  4J56 A;  4AOX A;  4J31 A;  4U2L A;  2YM1 A;  3OC4 A;  3AE7 A;  1ZK7 A; 
#chains in the Genus database with same CATH homology
 3AEA A;  2F5Z A;  4EMI A;  3DJG X;  3NK0 X;  2JB2 A;  2RGJ A;  1H82 A;  1PDH A;  4WX1 A;  3SGL A;  3CMM A;  3T2K A;  4G74 A;  5HYM A;  2C76 A;  2ZZC A;  3S61 A;  2YVF A;  3M0O A;  3CGB A;  1JU2 A;  3DME A;  2RGH A;  1H7W A;  2VVL A;  4NTC A;  1RP0 A;  4G6G A;  3KPF A;  1TDF A;  3VQR A;  3T0K A;  3QSS A;  3CGC A;  1F6M A;  2XFO A;  3V3N A;  2GR1 A;  1H6V A;  4A9W A;  2V5Z A;  4RG3 A;  2GR3 A;  1K0J A;  2XDO A;  1P2H A;  3ISH A;  1F8W A;  3FBS A;  4OPG A;  3UOZ A;  4B68 A;  5M10 A;  1TDO A;  2V60 A;  3K30 A;  1CJ3 A;  2WET A;  1DOC A;  5J60 A;  5EBK A;  2BRY A;  2UZZ A;  3SQP A;  1PN0 A;  4E0V A;  3NTD A;  4DGK A;  2C70 A;  4U8J A;  4A99 A;  1V59 A;  4FDC B;  3H4K A;  4ECH A;  3UTH A;  4GF7 A;  1K0L A;  3DK9 A;  3P4Q A;  4YWO A;  2C75 A;  3UKL A;  1IUT A;  1PHH A;  4CY8 A;  2GQW A;  3NK2 X;  1PXB A;  1E1M A;  1DOE A;  3GYX A;  1YQZ A;  2WDQ A;  4CCR A;  3CTY A;  4GRT A;  3ALM A;  4IV9 A;  4WCT A;  3T2Y A;  4J34 A;  5JCM A;  2XFP A;  3DJJ A;  2B9Y A;  4OCG A;  5KMR A;  2WDR A;  3C96 A;  1LQT A;  1NHP A;  3PS9 A;  3ICR A;  4CY6 A;  5JCL A;  4BK3 A;  2BS2 A;  1TRB A;  4G73 A;  5KRQ A;  4U2T A;  3UP5 A;  1BF3 A;  3FPZ A;  2A8X A;  1O5W A;  2WOI A;  3M12 A;  3M13 A;  2YLR A;  3KKJ A;  3CPI G;  4U2S A;  1XHC A;  4J57 A;  4B66 A;  1FEB A;  1COY A;  5KVH A;  2CDU A;  4REK A;  1PXC A;  3AD9 B;  4B69 A;  3EF6 A;  2GR2 A;  3AD7 B;  3AE3 A;  4J33 A;  5JCN A;  1CJ4 A;  3H8I A;  4YTN A;  4XWR A;  3RP8 A;  3AWI A;  4X9M A;  2R45 A;  1QO8 A;  3BI4 A;  4BV6 A;  2GF3 A;  1KF6 A;  2Q7V A;  2WDV A;  5BUK A;  3NK1 X;  2X8C A;  4M52 A;  4J36 A;  3QVP A;  3BHK A;  2Y6Q A;  4U8N A;  2Q6U A;  1LTX R;  1YY5 A;  3KA7 A;  4Z25 A;  1VG9 A;  2OA1 A;  2XVH A;  2JBV A;  3CNJ A;  1N4W A;  5KOX A;  2BK5 A;  2R4E A;  1S2Y A;  1DNC A;  4BUR A;  4C3Y A;  3BNU A;  5BVA A;  4EQR A;  3AED A;  2BS4 A;  3ATR A;  2V6O A;  3DJE A;  4DNA A;  1H84 A;  1N4U A;  4C74 A;  3CGE A;  2H89 A;  5C2T A;  1M6I A;  3NH3 X;  4Z24 A;  3CN8 A;  1N4V A;  1GRH A;  4K5S A;  5KMS A;  3IHG A;  4NWZ A;  3T37 A;  2E5V A;  2BA9 A;  1YQ4 A;  2QA1 A;  3AE6 A;  1KDG A;  3BI5 A;  3PVC A;  4FK1 A;  1XAN A;  5JCI A;  5C3J A;  1H81 A;  1S2Q A;  4YT0 A;  2YR6 A;  1GRB A;  1Q1W A;  1VG0 A;  1F8S A;  4YKF A;  3LOV A;  4B65 A;  1KSS A;  2YLT A;  3DJD A;  1X31 B;  1NHQ A;  3ALJ A;  2GR0 A;  2YR5 A;  3QFB A;  3T31 A;  2GRT A;  3UKP A;  3GD3 A;  2JKC A;  1VDC A;  2YVJ A;  4I59 A;  3LJP A;  4UDQ A;  1KNR A;  1ZOY A;  2C67 A;  2DKH A;  1GXF A;  2YM2 A;  1FEA A;  4XXG A;  2W0H A;  1ZX9 A;  5U63 A;  3HZL A;  5KXJ A;  4YSH A;  3DGH A;  4YSX A;  3KU9 A;  3SXI A;  2VVL G;  1GND A;  2H88 A;  3DK4 A;  3UKF A;  2TMD A;  2AQJ A;  4AOS A;  1N1P A;  2IID A;  1GOS A;  2EQ8 A;  3CNS A;  5M0Z A;  3E1T A;  4EQX A;  4JDR A;  1E1K A;  1GSN A;  4A65 A;  5JCK A;  5KOW A;  2R4J A;  2YLW A;  2BK4 A;  2VZ2 A;  3QFA A;  1IJH A;  3V3O A;  2RGO A;  1MOK A;  1CL0 A;  1PBF A;  2XVE A;  3UCL A;  1ZOV A;  1NHS A;  4C77 A;  1OJ9 A;  1DJN A;  5GSN A;  4ZCC A;  4Z44 A;  2BAB A;  2YG3 A;  3FIM B;  3D8X A;  1E7P A;  3C4A A;  2ZZ0 A;  1B8S A;  3GYJ A;  5EOW A;  2IVE A;  3NGC X;  1L9E A;  2VQB A;  4PAA A;  3SZF A;  1TYT A;  4DSG A;  4Z2T A;  1GT8 A;  2GB0 A;  2X50 A;  4H2N A;  4H4W A;  3UP4 A;  4NTE A;  2FJD A;  3VR8 A;  1B4V A;  4P9S A;  1PJ6 A;  2I0Z A;  1IUW A;  1PBD A;  1ZMD A;  1QJD A;  1E39 A;  3LZW A;  2OLO A;  3KLJ A;  2YVG A;  3ABV A;  3L1R A;  2B7S A;  4MJW A;  2WBA A;  4NEW A;  1IUU A;  4A5L A;  2WU5 A;  2WOW A;  5U25 A;  4AT2 A;  4ADW A;  1ZKQ A;  3ZDN A;  4AP3 A;  1CC6 A;  2CFY A;  4TM3 A;  5KNL A;  1REO A;  3ALL A;  4I58 A;  1CJC A;  3II4 A;  4II2 A;  4EQS A;  2PYX A;  2YG7 A;  2C72 A;  4EM3 A;  2XVI A;  1LPF A;  2ZZB A;  5KVI A;  3VRB A;  3RHA A;  4CRT A;  3L8K A;  2B9W A;  2YLS A;  2GMH A;  2OAL A;  3QJ4 A;  4RSL A;  4U8P A;  4H7U A;  1TDE A;  2C64 A;  1OJD A;  2BRA A;  4X4J A;  3SYI A;  2BAC A;  4YSZ A;  1PJ7 A;  2AR8 A;  3BNM A;  3DK8 A;  4B64 A;  4Z43 A;  3EPT A;  4APN A;  1M64 A;  1E1L A;  3GDN A;  3UTF A;  2ARD A;  1PS9 A;  4UDR A;  2WU2 A;  3T14 A;  1GV4 A;  1EL9 A;  2FJE A;  4H4Z A;  4OPU A;  1D5T A;  4H50 A;  4N9X A;  2Y6R A;  3AEB A;  4Y4M A;  2OAM A;  4FX9 A;  5TR3 A;  4A6N A;  1F8R A;  4BK1 A;  3AYI A;  4Z2R A;  4PAB A;  2V3B A;  3GWF A;  2Q0L A;  2E4G A;  1LVL A;  4EMJ A;  3K7Q X;  2JB1 A;  3AYL A;  3FG2 P;  4U8I A;  4K22 A;  5BRT A;  1IUX A;  3UTG A;  5HXI A;  5GRT A;  3NN0 X;  1TDK A;  1JNR A;  1BGJ A;  5KWF A;  1KFY A;  2FJA A;  2OLN A;  4CNK A;  1ELI A;  2XLU A;  3NT6 A;  2CUL A;  1HYU A;  3G5S A;  3T2Z A;  4IVM B;  2B7R A;  2C66 A;  1PXA A;  2Z5Y A;  2WP5 A;  2GEW A;  3B6D A;  3HYV A;  2WES A;  4TLZ A;  3SZW A;  1H86 A;  2EQ9 A;  2YR4 A;  3F8R A;  1O94 A;  1GAL A;  4A79 A;  3AE2 A;  4Y4L A;  1NPX A;  2WHD A;  2XLT A;  3AE4 A;  2C65 A;  2EQ7 A;  3B3R A;  3GRT A;  4Y4N A;  4HA6 A;  3AE5 A;  2GQF A;  3P4P A;  4BJY A;  1PBB A;  2WP9 A;  3AEC A;  3V76 A;  4KX6 A;  1Q1R A;  1ZY8 A;  2ZBW A;  3LXD A;  2BYB A;  3NRN A;  3GYI A;  3I6D A;  4JY2 A;  1GRT A;  1NEN A;  3ITJ A;  1E1N A;  2C3C A;  1D7L A;  4ZCD A;  4K2X A;  1XDI A;  5BUL A;  1GPE A;  3CNT A;  4GAV A;  4GR1 A;  4K7Z A;  1FL2 A;  1KNP A;  3RP7 A;  3UKH A;  1CC2 A;  2NPX A;  3P4R A;  1GRE A;  4GAP A;  4H4R A;  3S5W A;  1GRA A;  3FMW A;  1BKW A;  1E6E A;  1ONF A;  2E1M A;  1D4C A;  1JEH A;  1YQ3 A;  1IUV A;  2X8H A;  4USQ A;  4TM1 A;  1CBO A;  3URH A;  1GRG A;  4YKG A;  2PHH A;  2AAQ A;  2QCU A;  3I3L A;  3UOY A;  4Z26 A;  2YWL A;  3RED A;  4BK2 A;  2O9Z A;  3Q9T A;  5FS8 A;  3RP6 A;  4OPC A;  1PJ5 A;  3SFE A;  4TM4 A;  4OPI A;  4A6N B;  3KPK A;  1Q9I A;  4II3 A;  1F3P A;  5FS7 A;  5EB5 A;  3GD4 A;  3BHF A;  4Z2U A;  2FJB A;  3COX A;  5HY5 A;  1JNZ A;  3IHM A;  3NYF A;  2Q0K A;  1JOA A;  1W4X A;  2FBW A;  2XCG A;  2Z5X A;  3LAD A;  2BXR A;  1TDN A;  4C5O A;  3K7M X;  1LJ1 A;  2A87 A;  2R0C A;  4EIP A;  4TM0 A;  1JRZ A;  1ZDL A;  5FMH A;  4D04 A;  3QSE A;  2BC1 A;  3CPH G;  2X8G A;  3EAN A;  1DOD A;  5KMQ A;  1K4Q A;  3NKS A;  1ZMC A;  1Y56 A;  4NTD A;  4DSH A;  3HYW A;  4IA5 A;  1PBE A;  5HHF A;  3AE1 A;  1QLB A;  3VR9 A;  3KD9 A;  1OJT A;  4GDE A;  1EL7 A;  4NEV A;  2YLX A;  3AEF A;  3AXB A;  3CNP A;  3AB1 A;  3AE8 A;  3GMB A;  3GWD A;  3UKA A;  2XFU A;  3VRA A;  4H4V A;  1GES A;  5FS9 A;  1DJQ A;  3QVR A;  4YTP A;  5IQ1 A;  3NYC A;  3GSI A;  4EMW A;  2GMJ A;  2YQU A;  3GRS A;  1NHR A;  3PO7 A;  2DKI A;  2BS3 A;  4H2P A;  3ICT A;  3NNE A;  2WP6 A;  4XWZ A;  1GRF A;  2R9Z A;  4GCM A;  1P2E A;  1VQW A;  2V3A A;  1BWC A;  1D4E A;  4JQ9 A;  4U8O A;  3SFD A;  2EQ6 A;  2GVC A;  3EAO A;  4U8K A;  3UOX A;  4AT0 A;  3ZYX A;  3G5R A;  1H7X A;  3LB8 A;  4JN9 A;  1YKJ A;  4GDP A;  4LII A;  3NN6 X;  4AP1 A;  1LQU A;  2IVD A;  1B37 A;  2YAU A;  3UOV A;  4BJZ A;  1SEZ A;  1JRY A;  1NG4 A;  4K5R A;  1ZP0 A;  3NYE A;  4X9N A;  4U8L A;  3NTA A;  1GTE A;  1MO9 A;  1DOB A;  1L9C A;  3IWA A;  2YLZ A;  4RG4 A;  2A89 A;  1MXT A;  2WEU A;  1GET A;  4U8M A;  4K8D A;  4O5Q A;  4B1B A;  3NG7 X;  3D1C A;  2XVF A;  3VRD B;  1D7Y A;  4YXD A;  2WS3 A;  4CBQ A;  3ATQ A;  1RSG A;  3UKQ A;  4NZH A;  2BCG G;  4OPT A;  4ICY A;  4LU6 A;  2XLS A;  2QAE A;  3H8L A;  1FEC A;  2GH5 A;  3SZ0 A;  2GAG B;  1KSU A;  4YTM A;  2C3D A;  3F8D A;  4HB9 A;  1CF3 A;  1XPQ A;  1BGN A;  2VVM A;  5CQF A;  3SY4 A;  2QA2 A;  2C73 A;  3ADA B;  1CHU A;  4UP3 A;  4ZN0 A;  1Y56 B;  2VOU A;  2YG5 A;  4UDP A;  4TLX A;  2XFQ A;  4CCQ A;  2ACZ A;  3DA1 A;  3BI2 A;  4JY3 A;  1L9D A;  4H4Q A;  4USR A;  1D4D A;  2R46 A;  3HYX A;  4C3X A;  2V61 A;  1TYP A;  3LZX A;  4KPR A;  2JB3 A;  4H2Q A;  5CKU A;  1DXL A;  2B9X A;  5U1O A;  2CVJ A;  4H4Y A;  3NLC A;  3AEE A;  4D03 A;  2RAB A;  4EM4 A;  1FOH A;  1GER A;  1H83 A;  2WPC A;  3AD8 B;  3G5Q A;  1L0V A;  3P4S A;  2X3N A;  4H4T A;  5IQ4 A;  5LV9 A;  3UTE A;  1GEU A;  4H2R A;  2C7G A;  1CC4 A;  3R9U A;  2BCP A;  1GTH A;  1FCD A;  4LA1 A;  2XLP A;  3ICS A;  2YG6 A;  5FS6 A;  4YSY A;  4B67 A;  4FK1 C;  3WE0 A;  3NIX A;  4OPD A;  1NDA A;  4GUV A;  3DH9 A;  2X99 A;  1NAA A;  3AEG A;  4H4P A;  4JNQ A;  1AOG A;  1S3E A;  4IVO B;  2VRL A;  1NEK A;  3CPJ G;  1S3B A;  5EB4 A;  4EQW A;  5J7X A;  1EL5 A;  4O5U A;  2XLR A;  3SX6 A;  2JK6 A;  2XFN A;  2NVK X;  3NHO X;  1VRQ B;  1LV0 A;  2APG A;  3P9U A;  2GAH B;  3CGD A;  4JNA A;  2B76 A;  3IF9 A;  2VRM A;  4IA6 A;  4OPL A;  4G9K A;  2J3N A;  3SZC A;  5ER0 A;  1B5Q A;  1BZL A;  2R0P A;  3JSK A;  3K7T A;  1CJ2 A;  1UKV G;  4CNJ A;  1RYI A;  1Y0P A;  4NNJ A;  3OZ2 A;  3QSM A;  4A7A A;  1O95 A;  3Q6J A;  4H4X A;  3CIR A;  2BK3 A;  3P1W A;  1K0I A;  3F8P A;  3SM8 A;  2HQM A;  3CND A;  3IC9 A;  4G6H A;  1NG3 A;  2R0G A;  5KMP A;  1EBD A;  1OJC A;  1IUS A;  3GDP A;  4OVI A;  2TPR A;  4H4S A;  3GMC A;  2BC0 A;  3AE9 A;  2WPE A;  5DBJ A;  1JRX A;  2YG4 A;  2JAE A;  2XVJ A;  2WPF A;  1Z6L A;  2VQ7 A;  5IPY A;  1EL8 A;  3UKK A;  3C4N A;  4EIQ A;  4H4U A;  2C4C A;  3O0H A;  4J2W A;  2GV8 A;  2BXS A;  4B63 A;  3KVE A;  5L46 A;  1OJA A;  1PBC A;  3DGZ A;  2WQY A;  2WOV A;  3RNM A;  2XYO A;  3AYJ A;  4J56 A;  4AOX A;  4J31 A;  4U2L A;  2YM1 A;  3OC4 A;  3AE7 A;  1ZK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...