4CBQA

Crystal structure of the thioredoxin reductase from entamoeba histolytica with auranofin au(i) bound to cys286
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
total genus 94
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA02
1F6MA 1S3EA 1O95A 3AE3A 1LPFA 4Y4NA 1ZKQA 2C7GA 3AE6A 1E7PA 5U63A 3SFEA 2BS4A 5LV9A 2YVGA 4A7AA 3ALJA 5JCMA 3NYFA 4MJWA 4H4UA 1L9CA 3BHKA 1CC2A 1D7LA 1YQZA 1N4WA 3IF9A 1GNDA 1Q9IA 1Y0PA 4B63A 5JCIA 1B8SA 2ZZCA 3EPTA 3KKJA 2VVLG 4OPDA 5CQFA 2YG4A 1NEKA 1F8WA 3DMEA 3QFAA 1FCDA 4H2PA 2R9ZA 2CVJA 3ALLA 1GTEA 2H89A 2IVDA 1TYPA 1IUUA 3CGBA 1D4CA 3K30A 4J56A 3AEFA 4U2SA 4TLZA 3BNMA 3LZWA 3R9UA 3LOVA 2WBAA 1IUSA 5M0ZA 5JCNA 1PBBA 2XFPA 1ZOVA 1GERA 1S2YA 2B9YA 2WP5A 3OC4A 2YR4A 2J3NA 4KX6A 4XWRA 4K22A 3S5WA 4EMWA 4H4YA 1BWCA 3AE2A 2GR3A 2W0HA 1ZMDA 4YT0A 1VG0A 1E1KA 2QA1A 2BCPA 2R4JA 2YVJA 2VQ7A 3NK1X 4H7UA 2ZZBA 5FS6A 3AEEA 4A99A 3UTHA 2YLZA 4H4XA 1FECA 1AOGA 3S61A 3DGZA 4UDRA 1MOKA 4OPTA 3UOXA 4B64A 4U8MA 3SM8A 3DA1A 2FBWA 4A9WA 3GRSA 1O94A 4U8OA 2XLRA 2GB0A 4BJZA 2X8GA 3LXDA 4LIIA 4DNAA 3AYLA 3EANA 2GR2A 1VG9A 3CPHG 1TDEA 3AEBA 3WE0A 1E6EA 3ABVA 2GQFA 3VR8A 4Z2UA 4CBQA 2BXSA 3AEDA 1F3PA 2GQWA 3QSMA 2WDVA 3G5QA 4C3XA 2VOUA 1DOEA 3B6DA 2XVEA 1D5TA 3FBSA 3AYIA 4YSZA 1CJ3A 1CJ2A 1Y56B 2I0ZA 1GEUA 2YR5A 1D7YA 3ZYXA 1GESA 3F8PA 4AP3A 2OAMA 3NKSA 3IWAA 3NGCX 2YG5A 3H8IA 1P2HA 5EB4A 5ER0A 4ZCCA 1PDHA 1QJDA 3C4NA 4ZCDA 3UTGA 5KRQA 1GRFA 4EIQA 5HY5A 3UTFA 1L0VA 1M6IA 1EBDA 1OJCA 1MXTA 2R0GA 1YY5A 4I58A 3AE8A 1XHCA 3H8LA 2VZ2A 2GH5A 2EQ6A 1CHUA 3COXA 3ATRA 3F8RA 4EMJA 2VVLA 2VRMA 3BI4A 4J2WA 5IQ1A 5L46A 2C76A 3GD3A 3AWIA 1Z6LA 3GDPA 2A8XA 2C73A 2WU2A 3CNTA 3ITJA 3AECA 1ZOYA 2NPXA 1GRTA 2C75A 4U2LA 5C3JA 3T37A 1OJTA 1FEBA 2FJBA 3P4QA 4YSHA 2YLRA 2XFQA 3ALMA 2YVFA 3K7MX 1BGJA 1DOCA 4TM0A 4UDPA 2JAEA 2QA2A 1E1MA 3GSIA 3QVRA 1NHRA 4AOSA 2WOVA 4EQXA 2YG6A 3AE1A 3KD9A 1JRYA 4YSYA 5FS7A 5KOXA 3JSKA 3IHMA 4BURA 2R0PA 2AAQA 3KU9A 4E0VA 3UP4A 5J60A 4B68A 4YKFA 1H86A 1YQ3A 4OPGA 1DXLA 2V3AA 3UKAA 2Z5YA 4YWOA 1UKVG 1BZLA 3I3LA 3VRAA 3GMBA 5C2TA 2WDRA 1H82A 3VRDB 4ADWA 4B69A 4X4JA 1OJAA 3RHAA 3IHGA 1PN0A 4P9SA 4APNA 4NEWA 1P2EA 2WHDA 1XDIA 3NIXA 1COYA 3NRNA 1PXAA 4U8PA 3RP6A 4A65A 3D1CA 4C74A 1N1PA 2BYBA 2GAGB 3CNJA 4Z43A 2TPRA 4USQA 1EL8A 2XLSA 2YLWA 4NEVA 2YM2A 4U8KA 5IQ4A 2WS3A 4H4RA 4C5OA 1GT8A 1QLBA 1YKJA 2C70A 3LADA 3ISHA 3DJGX 4JY2A 5CKUA 4ICYA 5KXJA 1GALA 1ZP0A 2EQ9A 3CNDA 1F8RA 4J31A 1K4QA 3G5SA 2UZZA 1RSGA 2OALA 1H81A 3CGDA 1TYTA 4N9XA 4BK3A 3LZXA 1EL5A 2C64A 4JNAA 3GRTA 1DODA 4Z44A 4C77A 5BUKA 4WX1A 2AQJA 1IUVA 2YLSA 1JRXA 3AEGA 4OPLA 3I6DA 4J57A 1LQTA 2R45A 2C3CA 3UKPA 2XLUA 2YWLA 2IIDA 1GETA 2WP9A 3P4SA 4H4VA 3NG7X 3P4PA 2JB3A 4O5UA 3BHFA 2H88A 4H2NA 1GREA 4H50A 2WOWA 4AT2A 3SFDA 3V3NA 3DJEA 3GDNA 2XVIA 1OJ9A 3GWDA 3RP7A 2Q6UA 3UKFA 4CCRA 3B3RA 5FS9A 1ZX9A 2GR1A 2A89A 2GAHB 5GSNA 1H7XA 2V6OA 2X50A 3UKHA 2X3NA 5EB5A 1TRBA 3URHA 4EMIA 3KPFA 3BI2A 5KVHA 4CCQA 1SEZA 2BK3A 4JNQA 1GRAA 3ICTA 4H4ZA 3UOYA 4BK1A 5HXIA 4GUVA 1PHHA 5J7XA 1H7WA 4A79A 2DKIA 2BABA 3AD9B 4B65A 1GRGA 1H83A 3CPJG 3UP5A 3V3OA 4RG3A 2RGJA 4ZN0A 2BK4A 2CULA 1E1NA 1TDOA 1DNCA 2V60A 1NG3A 1X31B 2C72A 4J33A 3QVPA 3H4KA 2WPFA 2XDOA 4K5SA 2GMJA 2ACZA 4OCGA 1KF6A 4M52A 2WU5A 3UCLA 3NN6X 3M0OA 2GMHA 4JN9A 1NHSA 3CTYA 2JB1A 2DKHA 1K0JA 4OPCA 1L9DA 3FIMB 1Y56A 4U8NA 1IUTA 1NG4A 4WCTA 3AD7B 2B7SA 4X9MA 5JCLA 1S2QA 5KOWA 3AE5A 4CNKA 3IC9A 3E1TA 3Q9TA 3FG2P 2XLPA 2B76A 2YG7A 3C4AA 3UTEA 2BCGG 1D4EA 1KFYA 5GRTA 3UOVA 3II4A 3NYCA 4D04A 4GRTA 1IJHA 1PBFA 1LTXR 1NAAA 4IA6A 1EL9A 1BF3A 3BNUA 4TM4A 4JY3A 1VRQB 3QFBA 4UDQA 1JNZA 2C65A 2OA1A 2RGHA 3RNMA 1FL2A 2YG3A 1H84A 1DOBA 1KDGA 1V59A 2BA9A 4H4WA 2V61A 2C67A 4REKA 5BULA 2O9ZA 4K5RA 4J34A 5JCKA 2BC0A 4CRTA 2BXRA 2PYXA 3AE7A 4HA6A 5BVAA 2BACA 4NZHA 1NENA 1ZY8A 2XFNA 2C66A 1JOAA 3EF6A 1B5QA 2RGOA 4EQWA 3GWFA 4U2TA 2VVMA 3Q6JA 3GYIA 2R46A 1FOHA 1PJ6A 1QO8A 1GXFA 3K7QX 4BJYA 3NT6A 1S3BA 3QSSA 3ICRA 3NTDA 3GMCA 4B1BA 5EOWA 2EQ7A 2VRLA 1GTHA 3NK2X 1JNRA 4IA5A 2E1MA 1YQ4A 2JBVA 2XFOA 3C96A 1HYUA 2YLTA 2BS3A 3ADAB 4U8LA 1ELIA 4Y4LA 3UOZA 1GV4A 3V76A 4YSXA 2NVKX 4GDPA 2WPEA 2A87A 4JQ9A 2BC1A 4BK2A 1B4VA 3D8XA 2GVCA 4OPIA 2F5ZA 4RG4A 1CJ4A 3CNPA 1GPEA 2RABA 1CJCA 3KLJA 4NTEA 4YKGA 4EIPA 1GRBA 2CDUA 1CC4A 3AE4A 1TDNA 2YR6A 1VDCA 4AOXA 3L1RA 4H4TA 2X99A 2Q0KA 3NK0X 5TR3A 4TM1A 3CNSA 2YM1A 3FMWA 4EQSA 2GV8A 4CY8A 4YTNA 1LQUA 2ZBWA 4K7ZA 1CC6A 5U25A 3FPZA 3NH3X 1GOSA 2OLNA 1PBDA 3NLCA 3VRBA 3BI5A 4FDCB 2XVFA 1L9EA 1B37A 3REDA 1JEHA 4Z24A 5DBJA 2WPCA 3ZDNA 3DJJA 1PXBA 1ZK7A 4RSLA 4TM3A 4C3YA 2GRTA 4Z25A 1NPXA 1TDKA 2E5VA 1IUWA 4USRA 5HYMA 2JB2A 2PHHA 2XLTA 2VQBA 1EL7A 4GCMA 1PJ5A 4DGKA 1PXCA 4H4QA 3AE9A 2X8HA 1Q1RA 4Z2TA 3CN8A 1M64A 4CNJA 4NTCA 1O5WA 1ZMCA 4JDRA 4Y4MA 2B7RA 3AXBA 1NHPA 4CY6A 1VQWA 1N4VA 4PAAA 4EM3A 3M12A 1JU2A 1PBEA 1OJDA 3NN0X 4U8JA 3AB1A 3NTAA 1BKWA 3GD4A 3UKQA 2IVEA 1Q1WA 4Z2RA 1GSNA 4H4PA 4DSHA 1GRHA 2ZZ0A 1RYIA 1KSSA 2XFUA 1LJ1A 1ONFA 4X9NA 4A6NA 4OVIA 4K8DA 4LU6A 4K2XA 2WP6A 2R0CA 3CPIG 3OZ2A 4GF7A 1LVLA 4LA1A 3KVEA 4FX9A 4A5LA 2FJEA 2GR0A 4AT0A 2YLXA 1RP0A 3PO7A 5U1OA 4BV6A 2Q0LA 4ECHA 3HZLA 1W4XA 3QSEA 2CFYA 4IVOB 4KPRA 3O0HA 5FMHA 4B67A 4GR1A 1IUXA 1KNPA 2R4EA 5FS8A 1CBOA 3M13A 5EBKA 4YXDA 4XXGA 4PABA 4H2QA 4NTDA 4GDEA 3P1WA 2B9WA 3PVCA 2V3BA 2WESA 1K0LA 1CF3A 1JRZA 1F8SA 3CIRA 4EM4A 3DH9A 3GYJA 1D4DA 3SQPA 1E39A 1PBCA 2Z5XA 5M10A 1BGNA 2C3DA 5KVIA 2AR8A 4I59A 3DK4A 1KNRA 1KSUA 1K0IA 3NNEA 2TMDA 2GF3A 2Y6RA 3ICSA 2WEUA 3CGCA 1N4UA 3VR9A 1NDAA 3CGEA 4FK1A 4U8IA 4A6NB 3LJPA 3QJ4A 2EQ8A 3DK8A 4H4SA 2BK5A 1ZDLA 2QCUA 4H2RA 4XWZA 3NHOX 5HHFA 3VQRA 3G5RA 4OPUA 3AD8B 2XYOA 3P9UA 2JKCA 1REOA 5IPYA 1LV0A 1PS9A 2BS2A 2APGA 3KA7A 2WDQA 4YTMA 3P4RA 4UP3A 4TLXA 2GEWA 2JK6A 5KWFA 3NYEA 3UKKA 4YTPA 1MO9A 1PJ7A 2WQYA 1DJQA 2FJAA 2ARDA 1XANA 2V5ZA 3LB8A 1H6VA 3RP8A 4IVMB 2E4GA 2XVJA 4Z26A 4HB9A 3EAOA 1E1LA 4J36A 2HQMA 3UKLA 2WETA 3DGHA 2YQUA 2X8CA 1TDFA 3L8KA 2Q7VA 4B66A 1NHQA 1DJNA 4FK1C 2FJDA 3DK9A 3F8DA 2XCGA 4IV9A 2QAEA 4AP1A 3ATQA 2B9XA 2YAUA 4DSGA 3AEAA 3DJDA 4D03A 4O5QA 5BRTA 2XVHA 1FEAA 3AYJA 2Y6QA 4EQRA 1XPQA 2OLOA 2WOIA 3K7TA 3PS9A 3SGLA 1CL0A
chains in the Genus database with same CATH superfamily
1F6MA 1S3EA 1O95A 3AE3A 1LPFA 4Y4NA 1ZKQA 2C7GA 3AE6A 1E7PA 5U63A 3SFEA 2BS4A 5LV9A 2YVGA 4A7AA 3ALJA 5JCMA 3NYFA 4GAVA 4MJWA 4H4UA 1L9CA 3BHKA 1CC2A 1D7LA 1YQZA 3HYXA 1N4WA 3IF9A 1GNDA 1Q9IA 1Y0PA 4B63A 5JCIA 1B8SA 2ZZCA 3EPTA 3KKJA 2VVLG 4OPDA 5CQFA 2YG4A 1NEKA 1F8WA 3DMEA 3QFAA 1FCDA 4H2PA 2R9ZA 2CVJA 3ALLA 1GTEA 2H89A 2IVDA 1TYPA 1IUUA 3CGBA 1D4CA 3K30A 4J56A 3AEFA 4U2SA 4TLZA 3BNMA 3LZWA 3R9UA 3LOVA 2WBAA 1IUSA 5M0ZA 5JCNA 1PBBA 2XFPA 1ZOVA 1GERA 1S2YA 2B9YA 2WP5A 3OC4A 2YR4A 2J3NA 4KX6A 4XWRA 4K22A 3S5WA 4EMWA 4G73A 4H4YA 1BWCA 3AE2A 2GR3A 2W0HA 1ZMDA 4YT0A 1VG0A 1E1KA 2QA1A 2BCPA 2R4JA 2YVJA 2VQ7A 3NK1X 4H7UA 2ZZBA 5FS6A 3AEEA 4A99A 3UTHA 2YLZA 4H4XA 1FECA 1AOGA 4II2A 3S61A 3DGZA 4UDRA 1MOKA 4OPTA 3UOXA 4B64A 4U8MA 3SM8A 3DA1A 2FBWA 4A9WA 3GRSA 1O94A 4U8OA 2XLRA 2GB0A 4BJZA 2X8GA 4G6GA 3LXDA 4LIIA 4DNAA 3AYLA 3EANA 2GR2A 1VG9A 3CPHG 1TDEA 3AEBA 3WE0A 1E6EA 3ABVA 2GQFA 3VR8A 4Z2UA 4CBQA 2BXSA 3AEDA 1F3PA 2GQWA 3QSMA 2WDVA 3G5QA 4C3XA 2VOUA 1DOEA 3B6DA 2XVEA 1D5TA 3FBSA 3AYIA 3SZCA 4YSZA 1CJ3A 1CJ2A 1Y56B 2I0ZA 1GEUA 2YR5A 1D7YA 3ZYXA 1GESA 3F8PA 4AP3A 2OAMA 3NKSA 3IWAA 3NGCX 2YG5A 3H8IA 1P2HA 4II3A 5EB4A 5ER0A 1PDHA 1QJDA 3C4NA 4ZCCA 4ZCDA 3UTGA 1GRFA 4EIQA 5KRQA 5HY5A 3UTFA 1L0VA 1M6IA 1EBDA 1OJCA 1MXTA 2R0GA 1YY5A 4I58A 3AE8A 1XHCA 3H8LA 2VZ2A 2GH5A 2EQ6A 1CHUA 3COXA 3ATRA 3F8RA 4EMJA 2VVLA 2VRMA 3BI4A 4J2WA 5IQ1A 5L46A 2C76A 3GD3A 3AWIA 1Z6LA 3GDPA 4G6HA 2A8XA 2C73A 2WU2A 3CNTA 3ITJA 3AECA 1ZOYA 5KMRA 2NPXA 1GRTA 2C75A 4U2LA 5C3JA 5KMPA 3T37A 1OJTA 1FEBA 2FJBA 3P4QA 4YSHA 2YLRA 2XFQA 3ALMA 2YVFA 3K7MX 1BGJA 1DOCA 4TM0A 4UDPA 2JAEA 2QA2A 1E1MA 3GSIA 3QVRA 1NHRA 4AOSA 2WOVA 4EQXA 2YG6A 3SX6A 3AE1A 3KD9A 1JRYA 4YSYA 5FS7A 5KOXA 3JSKA 3IHMA 4BURA 2R0PA 2AAQA 3KU9A 4E0VA 3T14A 3UP4A 5J60A 4B68A 4YKFA 1H86A 1YQ3A 4OPGA 1DXLA 2V3AA 3UKAA 2Z5YA 4YWOA 1UKVG 1BZLA 3I3LA 3VRAA 3GMBA 5C2TA 2WDRA 1H82A 3VRDB 4ADWA 4B69A 4X4JA 1OJAA 3RHAA 3IHGA 1PN0A 4P9SA 4APNA 4NEWA 1P2EA 2WHDA 1XDIA 3NIXA 1COYA 3NRNA 1PXAA 4U8PA 3RP6A 4A65A 3D1CA 4C74A 1N1PA 2BYBA 2GAGB 3CNJA 4Z43A 2TPRA 4USQA 1EL8A 2XLSA 2YLWA 4NEVA 2YM2A 4U8KA 5IQ4A 2WS3A 4H4RA 4C5OA 1GT8A 1QLBA 1YKJA 2C70A 3LADA 3ISHA 3DJGX 4JY2A 5CKUA 4ICYA 5KXJA 1GALA 1ZP0A 2EQ9A 3CNDA 1F8RA 4J31A 2BRAA 1K4QA 3G5SA 2UZZA 1RSGA 2OALA 1H81A 3CGDA 1TYTA 4N9XA 4BK3A 3LZXA 1EL5A 2C64A 4JNAA 3GRTA 1DODA 4Z44A 4C77A 5BUKA 4WX1A 2AQJA 1IUVA 2YLSA 1JRXA 3AEGA 4OPLA 3I6DA 4J57A 1LQTA 2R45A 2C3CA 3UKPA 2XLUA 2YWLA 2IIDA 1GETA 2WP9A 3P4SA 4H4VA 3NG7X 3P4PA 2JB3A 4O5UA 3BHFA 2H88A 4H2NA 1GREA 4H50A 2WOWA 4AT2A 3SFDA 3V3NA 3DJEA 3GDNA 2XVIA 1OJ9A 3GWDA 3RP7A 2Q6UA 3UKFA 4CCRA 3B3RA 5FS9A 1ZX9A 2GR1A 2A89A 2GAHB 5GSNA 1H7XA 2V6OA 2X50A 3UKHA 2X3NA 5EB5A 1TRBA 3URHA 4EMIA 3KPFA 3BI2A 5KVHA 4CCQA 1SEZA 2BK3A 4JNQA 4NWZA 1GRAA 3ICTA 4H4ZA 3UOYA 4BK1A 5HXIA 4GUVA 1PHHA 5J7XA 1H7WA 4A79A 2DKIA 2BABA 3AD9B 4B65A 1GRGA 1H83A 3CPJG 3UP5A 3V3OA 4RG3A 2RGJA 4ZN0A 2BK4A 2CULA 1E1NA 1TDOA 1DNCA 2V60A 1NG3A 1X31B 2C72A 4J33A 3QVPA 3H4KA 2WPFA 2XDOA 4K5SA 5KNLA 2GMJA 2ACZA 4OCGA 1KF6A 4M52A 2WU5A 3UCLA 3NN6X 3M0OA 2GMHA 4JN9A 1NHSA 3CTYA 2JB1A 2DKHA 1K0JA 4OPCA 1L9DA 3FIMB 1Y56A 4U8NA 1IUTA 1NG4A 4WCTA 3AD7B 2B7SA 4X9MA 5JCLA 1S2QA 5KOWA 3AE5A 4CNKA 3IC9A 3E1TA 3Q9TA 3FG2P 2XLPA 2B76A 2YG7A 3C4AA 3UTEA 2BCGG 1D4EA 1KFYA 5GRTA 3UOVA 3II4A 3NYCA 4D04A 5KMSA 4GRTA 1IJHA 1PBFA 1LTXR 1NAAA 4IA6A 1EL9A 1BF3A 3BNUA 4TM4A 4JY3A 1VRQB 3QFBA 4UDQA 3SYIA 1JNZA 2C65A 2OA1A 2RGHA 3RNMA 1FL2A 2YG3A 1H84A 1DOBA 1KDGA 1V59A 2BA9A 4H4WA 2V61A 2C67A 3SXIA 4REKA 5BULA 2O9ZA 4K5RA 3CMMA 4J34A 5JCKA 2BC0A 4CRTA 2BXRA 2PYXA 3AE7A 4HA6A 5BVAA 2BACA 3HYWA 4NZHA 1NENA 1ZY8A 2XFNA 2C66A 1JOAA 3EF6A 1B5QA 2RGOA 4EQWA 3GWFA 4U2TA 2VVMA 3Q6JA 3GYIA 2R46A 1FOHA 3HYVA 1PJ6A 1QO8A 1GXFA 3K7QX 4BJYA 3NT6A 1S3BA 3QSSA 3ICRA 3T2ZA 3NTDA 3GMCA 4B1BA 5EOWA 2EQ7A 2VRLA 1GTHA 3NK2X 1JNRA 4IA5A 2E1MA 1YQ4A 2JBVA 2XFOA 3C96A 1HYUA 2YLTA 2BS3A 3ADAB 4U8LA 1ELIA 4Y4LA 3UOZA 1GV4A 3V76A 4YSXA 2NVKX 4GDPA 2WPEA 2A87A 4JQ9A 3SZ0A 2BC1A 4BK2A 1B4VA 3D8XA 2GVCA 4OPIA 2F5ZA 4RG4A 1CJ4A 3CNPA 1GPEA 2RABA 1CJCA 5KMQA 3KLJA 4NTEA 4YKGA 4EIPA 4NNJA 1GRBA 2CDUA 1CC4A 3AE4A 1TDNA 2YR6A 1VDCA 4AOXA 3L1RA 4H4TA 2X99A 2Q0KA 3NK0X 5TR3A 4TM1A 3CNSA 2YM1A 3FMWA 4EQSA 2GV8A 4CY8A 4YTNA 1LQUA 2ZBWA 4K7ZA 1CC6A 3SY4A 5U25A 3FPZA 3NH3X 1GOSA 2OLNA 1PBDA 3NLCA 3VRBA 3BI5A 4FDCB 2XVFA 1L9EA 1B37A 3REDA 1JEHA 4Z24A 5DBJA 2WPCA 3ZDNA 3DJJA 1PXBA 1ZK7A 4RSLA 4TM3A 4C3YA 2GRTA 4Z25A 1NPXA 1TDKA 2E5VA 1IUWA 4USRA 5HYMA 2JB2A 2PHHA 2XLTA 2VQBA 1EL7A 4GCMA 1PJ5A 4DGKA 1PXCA 4H4QA 3AE9A 2X8HA 1Q1RA 4Z2TA 3CN8A 1M64A 4CNJA 4NTCA 1O5WA 1ZMCA 3SZWA 4JDRA 4Y4MA 2B7RA 3AXBA 1NHPA 4CY6A 1VQWA 1N4VA 4PAAA 4EM3A 3M12A 1JU2A 1PBEA 1OJDA 3NN0X 4U8JA 3AB1A 3NTAA 1BKWA 3GD4A 3UKQA 2IVEA 1Q1WA 4Z2RA 1GSNA 2BRYA 4H4PA 4DSHA 1GRHA 2ZZ0A 1RYIA 1KSSA 2XFUA 1LJ1A 1ONFA 4X9NA 4A6NA 4OVIA 4K8DA 4LU6A 4K2XA 2WP6A 2R0CA 3CPIG 3OZ2A 4GF7A 1LVLA 4LA1A 3KVEA 4FX9A 4A5LA 2FJEA 2GR0A 4G9KA 4AT0A 2YLXA 1RP0A 3PO7A 5U1OA 4BV6A 2Q0LA 4ECHA 3HZLA 1W4XA 3QSEA 2CFYA 4IVOB 4KPRA 3O0HA 5FMHA 4B67A 4GR1A 1IUXA 1KNPA 2R4EA 5FS8A 1CBOA 3M13A 5EBKA 4YXDA 3T31A 4XXGA 4PABA 4H2QA 4NTDA 4GDEA 3P1WA 2B9WA 3PVCA 2V3BA 2WESA 1K0LA 1CF3A 1JRZA 1F8SA 3CIRA 4EM4A 3DH9A 3GYJA 1D4DA 2C4CA 3SQPA 1E39A 1PBCA 2Z5XA 5M10A 1BGNA 2C3DA 5KVIA 2AR8A 4I59A 3DK4A 1KNRA 1KSUA 3T0KA 1K0IA 3NNEA 2TMDA 2GF3A 2Y6RA 3ICSA 2WEUA 3CGCA 1N4UA 3VR9A 3KPKA 1NDAA 3CGEA 4FK1A 4U8IA 4GAPA 4A6NB 3LJPA 3QJ4A 2EQ8A 3DK8A 4H4SA 2BK5A 1ZDLA 2QCUA 4H2RA 4XWZA 3NHOX 5HHFA 3GYXA 3VQRA 3G5RA 4OPUA 3AD8B 2XYOA 3P9UA 3T2KA 2JKCA 1REOA 5IPYA 1LV0A 1PS9A 2BS2A 2APGA 3KA7A 2WDQA 4YTMA 3P4RA 4G74A 4UP3A 4TLXA 2GEWA 2JK6A 5KWFA 3NYEA 3T2YA 3UKKA 4YTPA 1MO9A 1PJ7A 2WQYA 1DJQA 2FJAA 2ARDA 1XANA 2V5ZA 3LB8A 1H6VA 3RP8A 4IVMB 2E4GA 2XVJA 4Z26A 4HB9A 3EAOA 1E1LA 4J36A 3SZFA 2HQMA 3UKLA 2WETA 3DGHA 2YQUA 2X8CA 1TDFA 3L8KA 2Q7VA 4B66A 1NHQA 1DJNA 4FK1C 2FJDA 3DK9A 3F8DA 2XCGA 4IV9A 2QAEA 4AP1A 3ATQA 2B9XA 2YAUA 4DSGA 3AEAA 3DJDA 4D03A 4O5QA 5BRTA 2XVHA 1FEAA 3AYJA 2Y6QA 4EQRA 1XPQA 2OLOA 2WOIA 3K7TA 3PS9A 3SGLA 1CL0A
chains in the Genus database with same CATH topology
1F6MA 1S3EA 1O95A 3AE3A 1LPFA 4Y4NA 1ZKQA 2C7GA 3AE6A 1E7PA 5U63A 3SFEA 2BS4A 5LV9A 2YVGA 4A7AA 3ALJA 5JCMA 3NYFA 4GAVA 4MJWA 4H4UA 1L9CA 3BHKA 1CC2A 1D7LA 1YQZA 3HYXA 1N4WA 3IF9A 1GNDA 1Q9IA 1Y0PA 4B63A 5JCIA 1B8SA 2ZZCA 3EPTA 3KKJA 2VVLG 4OPDA 5CQFA 2YG4A 1NEKA 1F8WA 3DMEA 3QFAA 1FCDA 4H2PA 2R9ZA 2CVJA 3ALLA 1GTEA 2H89A 2IVDA 1TYPA 1IUUA 3CGBA 1D4CA 3K30A 4J56A 3AEFA 4U2SA 4TLZA 3BNMA 3LZWA 3R9UA 3LOVA 2WBAA 1IUSA 5M0ZA 5JCNA 1PBBA 2XFPA 1ZOVA 1GERA 1S2YA 2B9YA 2WP5A 3OC4A 2YR4A 2J3NA 4KX6A 4XWRA 4K22A 3S5WA 4EMWA 4G73A 4H4YA 1BWCA 3AE2A 2GR3A 2W0HA 1ZMDA 4YT0A 1VG0A 1E1KA 2QA1A 2BCPA 2R4JA 2YVJA 2VQ7A 3NK1X 4H7UA 2ZZBA 5FS6A 3AEEA 4A99A 3UTHA 2YLZA 4H4XA 1FECA 1AOGA 4II2A 3S61A 3DGZA 4UDRA 1MOKA 4OPTA 3UOXA 4B64A 4U8MA 3SM8A 3DA1A 2FBWA 4A9WA 3GRSA 1O94A 4U8OA 2XLRA 2GB0A 4BJZA 2X8GA 4G6GA 3LXDA 4LIIA 4DNAA 3AYLA 3EANA 2GR2A 1VG9A 3CPHG 1TDEA 3AEBA 3WE0A 1E6EA 3ABVA 2GQFA 3VR8A 4Z2UA 4CBQA 2BXSA 3AEDA 1F3PA 2GQWA 3QSMA 2WDVA 3G5QA 4C3XA 2VOUA 1DOEA 3B6DA 2XVEA 1D5TA 3FBSA 3AYIA 3SZCA 4YSZA 1CJ3A 1CJ2A 1Y56B 2I0ZA 1GEUA 2YR5A 1D7YA 3ZYXA 1GESA 3F8PA 4AP3A 2OAMA 3NKSA 3IWAA 3NGCX 2YG5A 3H8IA 1P2HA 4II3A 5EB4A 5ER0A 1PDHA 1QJDA 3C4NA 4ZCCA 4ZCDA 3UTGA 1GRFA 4EIQA 5KRQA 5HY5A 3UTFA 1L0VA 1M6IA 1EBDA 1OJCA 1MXTA 2R0GA 1YY5A 4I58A 3AE8A 1XHCA 3H8LA 2VZ2A 2GH5A 2EQ6A 1CHUA 3COXA 3ATRA 3F8RA 4EMJA 2VVLA 2VRMA 3BI4A 4J2WA 5IQ1A 5L46A 2C76A 3GD3A 3AWIA 1Z6LA 3GDPA 4G6HA 2A8XA 2C73A 2WU2A 3CNTA 3ITJA 3AECA 1ZOYA 5KMRA 2NPXA 1GRTA 2C75A 4U2LA 5C3JA 5KMPA 3T37A 1OJTA 1FEBA 2FJBA 3P4QA 4YSHA 2YLRA 2XFQA 3ALMA 2YVFA 3K7MX 1BGJA 1DOCA 4TM0A 4UDPA 2JAEA 2QA2A 1E1MA 3GSIA 3QVRA 1NHRA 4AOSA 2WOVA 4EQXA 2YG6A 3SX6A 3AE1A 3KD9A 1JRYA 4YSYA 5FS7A 5KOXA 3JSKA 3IHMA 4BURA 2R0PA 2AAQA 3KU9A 4E0VA 3T14A 3UP4A 5J60A 4B68A 4YKFA 1H86A 1YQ3A 4OPGA 1DXLA 2V3AA 3UKAA 2Z5YA 4YWOA 1UKVG 1BZLA 3I3LA 3VRAA 3GMBA 5C2TA 2WDRA 1H82A 3VRDB 4ADWA 4B69A 4X4JA 1OJAA 3RHAA 3IHGA 1PN0A 4P9SA 4APNA 4NEWA 1P2EA 2WHDA 1XDIA 3NIXA 1COYA 3NRNA 1PXAA 4U8PA 3RP6A 4A65A 3D1CA 4C74A 1N1PA 2BYBA 2GAGB 3CNJA 4Z43A 2TPRA 4USQA 1EL8A 2XLSA 2YLWA 4NEVA 2YM2A 4U8KA 5IQ4A 2WS3A 4H4RA 4C5OA 1GT8A 1QLBA 1YKJA 2C70A 3LADA 3ISHA 3DJGX 4JY2A 5CKUA 4ICYA 5KXJA 1GALA 1ZP0A 2EQ9A 3CNDA 1F8RA 4J31A 2BRAA 1K4QA 3G5SA 2UZZA 1RSGA 2OALA 1H81A 3CGDA 1TYTA 4N9XA 4BK3A 3LZXA 1EL5A 2C64A 4JNAA 3GRTA 1DODA 4Z44A 4C77A 5BUKA 4WX1A 2AQJA 1IUVA 2YLSA 1JRXA 3AEGA 4OPLA 3I6DA 4J57A 1LQTA 2R45A 2C3CA 3UKPA 2XLUA 2YWLA 2IIDA 1GETA 2WP9A 3P4SA 4H4VA 3NG7X 3P4PA 2JB3A 4O5UA 3BHFA 2H88A 4H2NA 1GREA 4H50A 2WOWA 4AT2A 3SFDA 3V3NA 3DJEA 3GDNA 2XVIA 1OJ9A 3GWDA 3RP7A 2Q6UA 3UKFA 4CCRA 3B3RA 5FS9A 1ZX9A 2GR1A 2A89A 2GAHB 5GSNA 1H7XA 2V6OA 2X50A 3UKHA 2X3NA 5EB5A 1TRBA 3URHA 4EMIA 3KPFA 3BI2A 5KVHA 4CCQA 1SEZA 2BK3A 4JNQA 4NWZA 1GRAA 3ICTA 4H4ZA 3UOYA 4BK1A 5HXIA 4GUVA 1PHHA 5J7XA 1H7WA 4A79A 2DKIA 2BABA 3AD9B 4B65A 1GRGA 1H83A 3CPJG 3UP5A 3V3OA 4RG3A 2RGJA 4ZN0A 2BK4A 2CULA 1E1NA 1TDOA 1DNCA 2V60A 1NG3A 1X31B 2C72A 4J33A 3QVPA 3H4KA 2WPFA 2XDOA 4K5SA 5KNLA 2GMJA 2ACZA 4OCGA 1KF6A 4M52A 2WU5A 3UCLA 3NN6X 3M0OA 2GMHA 4JN9A 1NHSA 3CTYA 2JB1A 2DKHA 1K0JA 4OPCA 1L9DA 3FIMB 1Y56A 4U8NA 1IUTA 1NG4A 4WCTA 3AD7B 2B7SA 4X9MA 5JCLA 1S2QA 5KOWA 3AE5A 4CNKA 3IC9A 3E1TA 3Q9TA 3FG2P 2XLPA 2B76A 2YG7A 3C4AA 3UTEA 2BCGG 1D4EA 1KFYA 5GRTA 3UOVA 3II4A 3NYCA 4D04A 5KMSA 4GRTA 1IJHA 1PBFA 1LTXR 1NAAA 4IA6A 1EL9A 1BF3A 3BNUA 4TM4A 4JY3A 1VRQB 3QFBA 4UDQA 3SYIA 1JNZA 2C65A 2OA1A 2RGHA 3RNMA 1FL2A 2YG3A 1H84A 1DOBA 1KDGA 1V59A 2BA9A 4H4WA 2V61A 2C67A 3SXIA 4REKA 5BULA 2O9ZA 4K5RA 3CMMA 4J34A 5JCKA 2BC0A 4CRTA 2BXRA 2PYXA 3AE7A 4HA6A 5BVAA 2BACA 3HYWA 4NZHA 1NENA 1ZY8A 2XFNA 2C66A 1JOAA 3EF6A 1B5QA 2RGOA 4EQWA 3GWFA 4U2TA 2VVMA 3Q6JA 3GYIA 2R46A 1FOHA 3HYVA 1PJ6A 1QO8A 1GXFA 3K7QX 4BJYA 3NT6A 1S3BA 3QSSA 3ICRA 3T2ZA 3NTDA 3GMCA 4B1BA 5EOWA 2EQ7A 2VRLA 1GTHA 3NK2X 1JNRA 4IA5A 2E1MA 1YQ4A 2JBVA 2XFOA 3C96A 1HYUA 2YLTA 2BS3A 3ADAB 4U8LA 1ELIA 4Y4LA 3UOZA 1GV4A 3V76A 4YSXA 2NVKX 4GDPA 2WPEA 2A87A 4JQ9A 3SZ0A 2BC1A 4BK2A 1B4VA 3D8XA 2GVCA 4OPIA 2F5ZA 4RG4A 1CJ4A 3CNPA 1GPEA 2RABA 1CJCA 5KMQA 3KLJA 4NTEA 4YKGA 4EIPA 4NNJA 1GRBA 2CDUA 1CC4A 3AE4A 1TDNA 2YR6A 1VDCA 4AOXA 3L1RA 4H4TA 2X99A 2Q0KA 3NK0X 5TR3A 4TM1A 3CNSA 2YM1A 3FMWA 4EQSA 2GV8A 4CY8A 4YTNA 1LQUA 2ZBWA 4K7ZA 1CC6A 3SY4A 5U25A 3FPZA 3NH3X 1GOSA 2OLNA 1PBDA 3NLCA 3VRBA 3BI5A 4FDCB 2XVFA 1L9EA 1B37A 3REDA 1JEHA 4Z24A 5DBJA 2WPCA 3ZDNA 3DJJA 1PXBA 1ZK7A 4RSLA 4TM3A 4C3YA 2GRTA 4Z25A 1NPXA 1TDKA 2E5VA 1IUWA 4USRA 5HYMA 2JB2A 2PHHA 2XLTA 2VQBA 1EL7A 4GCMA 1PJ5A 4DGKA 1PXCA 4H4QA 3AE9A 2X8HA 1Q1RA 4Z2TA 3CN8A 1M64A 4CNJA 4NTCA 1O5WA 1ZMCA 3SZWA 4JDRA 4Y4MA 2B7RA 3AXBA 1NHPA 4CY6A 1VQWA 1N4VA 4PAAA 4EM3A 3M12A 1JU2A 1PBEA 1OJDA 3NN0X 4U8JA 3AB1A 3NTAA 1BKWA 3GD4A 3UKQA 2IVEA 1Q1WA 4Z2RA 1GSNA 2BRYA 4H4PA 4DSHA 1GRHA 2ZZ0A 1RYIA 1KSSA 2XFUA 1LJ1A 1ONFA 4X9NA 4A6NA 4OVIA 4K8DA 4LU6A 4K2XA 2WP6A 2R0CA 3CPIG 3OZ2A 4GF7A 1LVLA 4LA1A 3KVEA 4FX9A 4A5LA 2FJEA 2GR0A 4G9KA 4AT0A 2YLXA 1RP0A 3PO7A 5U1OA 4BV6A 2Q0LA 4ECHA 3HZLA 1W4XA 3QSEA 2CFYA 4IVOB 4KPRA 3O0HA 5FMHA 4B67A 4GR1A 1IUXA 1KNPA 2R4EA 5FS8A 1CBOA 3M13A 5EBKA 4YXDA 3T31A 4XXGA 4PABA 4H2QA 4NTDA 4GDEA 3P1WA 2B9WA 3PVCA 2V3BA 2WESA 1K0LA 1CF3A 1JRZA 1F8SA 3CIRA 4EM4A 3DH9A 3GYJA 1D4DA 2C4CA 3SQPA 1E39A 1PBCA 2Z5XA 5M10A 1BGNA 2C3DA 5KVIA 2AR8A 4I59A 3DK4A 1KNRA 1KSUA 3T0KA 1K0IA 3NNEA 2TMDA 2GF3A 2Y6RA 3ICSA 2WEUA 3CGCA 1N4UA 3VR9A 3KPKA 1NDAA 3CGEA 4FK1A 4U8IA 4GAPA 4A6NB 3LJPA 3QJ4A 2EQ8A 3DK8A 4H4SA 2BK5A 1ZDLA 2QCUA 4H2RA 4XWZA 3NHOX 5HHFA 3GYXA 3VQRA 3G5RA 4OPUA 3AD8B 2XYOA 3P9UA 3T2KA 2JKCA 1REOA 5IPYA 1LV0A 1PS9A 2BS2A 2APGA 3KA7A 2WDQA 4YTMA 3P4RA 4G74A 4UP3A 4TLXA 2GEWA 2JK6A 5KWFA 3NYEA 3T2YA 3UKKA 4YTPA 1MO9A 1PJ7A 2WQYA 1DJQA 2FJAA 2ARDA 1XANA 2V5ZA 3LB8A 1H6VA 3RP8A 4IVMB 2E4GA 2XVJA 4Z26A 4HB9A 3EAOA 1E1LA 4J36A 3SZFA 2HQMA 3UKLA 2WETA 3DGHA 2YQUA 2X8CA 1TDFA 3L8KA 2Q7VA 4B66A 1NHQA 1DJNA 4FK1C 2FJDA 3DK9A 3F8DA 2XCGA 4IV9A 2QAEA 4AP1A 3ATQA 2B9XA 2YAUA 4DSGA 3AEAA 3DJDA 4D03A 4O5QA 5BRTA 2XVHA 1FEAA 3AYJA 2Y6QA 4EQRA 1XPQA 2OLOA 2WOIA 3K7TA 3PS9A 3SGLA 1CL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F6M A;  1S3E A;  1O95 A;  3AE3 A;  1LPF A;  4Y4N A;  1ZKQ A;  2C7G A;  3AE6 A;  1E7P A;  5U63 A;  3SFE A;  2BS4 A;  5LV9 A;  2YVG A;  4A7A A;  3ALJ A;  5JCM A;  3NYF A;  4MJW A;  4H4U A;  1L9C A;  3BHK A;  1CC2 A;  1D7L A;  1YQZ A;  1N4W A;  3IF9 A;  1GND A;  1Q9I A;  1Y0P A;  4B63 A;  5JCI A;  1B8S A;  2ZZC A;  3EPT A;  3KKJ A;  2VVL G;  4OPD A;  5CQF A;  2YG4 A;  1NEK A;  1F8W A;  3DME A;  3QFA A;  1FCD A;  4H2P A;  2R9Z A;  2CVJ A;  3ALL A;  1GTE A;  2H89 A;  2IVD A;  1TYP A;  1IUU A;  3CGB A;  1D4C A;  3K30 A;  4J56 A;  3AEF A;  4U2S A;  4TLZ A;  3BNM A;  3LZW A;  3R9U A;  3LOV A;  2WBA A;  1IUS A;  5M0Z A;  5JCN A;  1PBB A;  2XFP A;  1ZOV A;  1GER A;  1S2Y A;  2B9Y A;  2WP5 A;  3OC4 A;  2YR4 A;  2J3N A;  4KX6 A;  4XWR A;  4K22 A;  3S5W A;  4EMW A;  4H4Y A;  1BWC A;  3AE2 A;  2GR3 A;  2W0H A;  1ZMD A;  4YT0 A;  1VG0 A;  1E1K A;  2QA1 A;  2BCP A;  2R4J A;  2YVJ A;  2VQ7 A;  3NK1 X;  4H7U A;  2ZZB A;  5FS6 A;  3AEE A;  4A99 A;  3UTH A;  2YLZ A;  4H4X A;  1FEC A;  1AOG A;  3S61 A;  3DGZ A;  4UDR A;  1MOK A;  4OPT A;  3UOX A;  4B64 A;  4U8M A;  3SM8 A;  3DA1 A;  2FBW A;  4A9W A;  3GRS A;  1O94 A;  4U8O A;  2XLR A;  2GB0 A;  4BJZ A;  2X8G A;  3LXD A;  4LII A;  4DNA A;  3AYL A;  3EAN A;  2GR2 A;  1VG9 A;  3CPH G;  1TDE A;  3AEB A;  3WE0 A;  1E6E A;  3ABV A;  2GQF A;  3VR8 A;  4Z2U A;  4CBQ A;  2BXS A;  3AED A;  1F3P A;  2GQW A;  3QSM A;  2WDV A;  3G5Q A;  4C3X A;  2VOU A;  1DOE A;  3B6D A;  2XVE A;  1D5T A;  3FBS A;  3AYI A;  4YSZ A;  1CJ3 A;  1CJ2 A;  1Y56 B;  2I0Z A;  1GEU A;  2YR5 A;  1D7Y A;  3ZYX A;  1GES A;  3F8P A;  4AP3 A;  2OAM A;  3NKS A;  3IWA A;  3NGC X;  2YG5 A;  3H8I A;  1P2H A;  5EB4 A;  5ER0 A;  4ZCC A;  1PDH A;  1QJD A;  3C4N A;  4ZCD A;  3UTG A;  5KRQ A;  1GRF A;  4EIQ A;  5HY5 A;  3UTF A;  1L0V A;  1M6I A;  1EBD A;  1OJC A;  1MXT A;  2R0G A;  1YY5 A;  4I58 A;  3AE8 A;  1XHC A;  3H8L A;  2VZ2 A;  2GH5 A;  2EQ6 A;  1CHU A;  3COX A;  3ATR A;  3F8R A;  4EMJ A;  2VVL A;  2VRM A;  3BI4 A;  4J2W A;  5IQ1 A;  5L46 A;  2C76 A;  3GD3 A;  3AWI A;  1Z6L A;  3GDP A;  2A8X A;  2C73 A;  2WU2 A;  3CNT A;  3ITJ A;  3AEC A;  1ZOY A;  2NPX A;  1GRT A;  2C75 A;  4U2L A;  5C3J A;  3T37 A;  1OJT A;  1FEB A;  2FJB A;  3P4Q A;  4YSH A;  2YLR A;  2XFQ A;  3ALM A;  2YVF A;  3K7M X;  1BGJ A;  1DOC A;  4TM0 A;  4UDP A;  2JAE A;  2QA2 A;  1E1M A;  3GSI A;  3QVR A;  1NHR A;  4AOS A;  2WOV A;  4EQX A;  2YG6 A;  3AE1 A;  3KD9 A;  1JRY A;  4YSY A;  5FS7 A;  5KOX A;  3JSK A;  3IHM A;  4BUR A;  2R0P A;  2AAQ A;  3KU9 A;  4E0V A;  3UP4 A;  5J60 A;  4B68 A;  4YKF A;  1H86 A;  1YQ3 A;  4OPG A;  1DXL A;  2V3A A;  3UKA A;  2Z5Y A;  4YWO A;  1UKV G;  1BZL A;  3I3L A;  3VRA A;  3GMB A;  5C2T A;  2WDR A;  1H82 A;  3VRD B;  4ADW A;  4B69 A;  4X4J A;  1OJA A;  3RHA A;  3IHG A;  1PN0 A;  4P9S A;  4APN A;  4NEW A;  1P2E A;  2WHD A;  1XDI A;  3NIX A;  1COY A;  3NRN A;  1PXA A;  4U8P A;  3RP6 A;  4A65 A;  3D1C A;  4C74 A;  1N1P A;  2BYB A;  2GAG B;  3CNJ A;  4Z43 A;  2TPR A;  4USQ A;  1EL8 A;  2XLS A;  2YLW A;  4NEV A;  2YM2 A;  4U8K A;  5IQ4 A;  2WS3 A;  4H4R A;  4C5O A;  1GT8 A;  1QLB A;  1YKJ A;  2C70 A;  3LAD A;  3ISH A;  3DJG X;  4JY2 A;  5CKU A;  4ICY A;  5KXJ A;  1GAL A;  1ZP0 A;  2EQ9 A;  3CND A;  1F8R A;  4J31 A;  1K4Q A;  3G5S A;  2UZZ A;  1RSG A;  2OAL A;  1H81 A;  3CGD A;  1TYT A;  4N9X A;  4BK3 A;  3LZX A;  1EL5 A;  2C64 A;  4JNA A;  3GRT A;  1DOD A;  4Z44 A;  4C77 A;  5BUK A;  4WX1 A;  2AQJ A;  1IUV A;  2YLS A;  1JRX A;  3AEG A;  4OPL A;  3I6D A;  4J57 A;  1LQT A;  2R45 A;  2C3C A;  3UKP A;  2XLU A;  2YWL A;  2IID A;  1GET A;  2WP9 A;  3P4S A;  4H4V A;  3NG7 X;  3P4P A;  2JB3 A;  4O5U A;  3BHF A;  2H88 A;  4H2N A;  1GRE A;  4H50 A;  2WOW A;  4AT2 A;  3SFD A;  3V3N A;  3DJE A;  3GDN A;  2XVI A;  1OJ9 A;  3GWD A;  3RP7 A;  2Q6U A;  3UKF A;  4CCR A;  3B3R A;  5FS9 A;  1ZX9 A;  2GR1 A;  2A89 A;  2GAH B;  5GSN A;  1H7X A;  2V6O A;  2X50 A;  3UKH A;  2X3N A;  5EB5 A;  1TRB A;  3URH A;  4EMI A;  3KPF A;  3BI2 A;  5KVH A;  4CCQ A;  1SEZ A;  2BK3 A;  4JNQ A;  1GRA A;  3ICT A;  4H4Z A;  3UOY A;  4BK1 A;  5HXI A;  4GUV A;  1PHH A;  5J7X A;  1H7W A;  4A79 A;  2DKI A;  2BAB A;  3AD9 B;  4B65 A;  1GRG A;  1H83 A;  3CPJ G;  3UP5 A;  3V3O A;  4RG3 A;  2RGJ A;  4ZN0 A;  2BK4 A;  2CUL A;  1E1N A;  1TDO A;  1DNC A;  2V60 A;  1NG3 A;  1X31 B;  2C72 A;  4J33 A;  3QVP A;  3H4K A;  2WPF A;  2XDO A;  4K5S A;  2GMJ A;  2ACZ A;  4OCG A;  1KF6 A;  4M52 A;  2WU5 A;  3UCL A;  3NN6 X;  3M0O A;  2GMH A;  4JN9 A;  1NHS A;  3CTY A;  2JB1 A;  2DKH A;  1K0J A;  4OPC A;  1L9D A;  3FIM B;  1Y56 A;  4U8N A;  1IUT A;  1NG4 A;  4WCT A;  3AD7 B;  2B7S A;  4X9M A;  5JCL A;  1S2Q A;  5KOW A;  3AE5 A;  4CNK A;  3IC9 A;  3E1T A;  3Q9T A;  3FG2 P;  2XLP A;  2B76 A;  2YG7 A;  3C4A A;  3UTE A;  2BCG G;  1D4E A;  1KFY A;  5GRT A;  3UOV A;  3II4 A;  3NYC A;  4D04 A;  4GRT A;  1IJH A;  1PBF A;  1LTX R;  1NAA A;  4IA6 A;  1EL9 A;  1BF3 A;  3BNU A;  4TM4 A;  4JY3 A;  1VRQ B;  3QFB A;  4UDQ A;  1JNZ A;  2C65 A;  2OA1 A;  2RGH A;  3RNM A;  1FL2 A;  2YG3 A;  1H84 A;  1DOB A;  1KDG A;  1V59 A;  2BA9 A;  4H4W A;  2V61 A;  2C67 A;  4REK A;  5BUL A;  2O9Z A;  4K5R A;  4J34 A;  5JCK A;  2BC0 A;  4CRT A;  2BXR A;  2PYX A;  3AE7 A;  4HA6 A;  5BVA A;  2BAC A;  4NZH A;  1NEN A;  1ZY8 A;  2XFN A;  2C66 A;  1JOA A;  3EF6 A;  1B5Q A;  2RGO A;  4EQW A;  3GWF A;  4U2T A;  2VVM A;  3Q6J A;  3GYI A;  2R46 A;  1FOH A;  1PJ6 A;  1QO8 A;  1GXF A;  3K7Q X;  4BJY A;  3NT6 A;  1S3B A;  3QSS A;  3ICR A;  3NTD A;  3GMC A;  4B1B A;  5EOW A;  2EQ7 A;  2VRL A;  1GTH A;  3NK2 X;  1JNR A;  4IA5 A;  2E1M A;  1YQ4 A;  2JBV A;  2XFO A;  3C96 A;  1HYU A;  2YLT A;  2BS3 A;  3ADA B;  4U8L A;  1ELI A;  4Y4L A;  3UOZ A;  1GV4 A;  3V76 A;  4YSX A;  2NVK X;  4GDP A;  2WPE A;  2A87 A;  4JQ9 A;  2BC1 A;  4BK2 A;  1B4V A;  3D8X A;  2GVC A;  4OPI A;  2F5Z A;  4RG4 A;  1CJ4 A;  3CNP A;  1GPE A;  2RAB A;  1CJC A;  3KLJ A;  4NTE A;  4YKG A;  4EIP A;  1GRB A;  2CDU A;  1CC4 A;  3AE4 A;  1TDN A;  2YR6 A;  1VDC A;  4AOX A;  3L1R A;  4H4T A;  2X99 A;  2Q0K A;  3NK0 X;  5TR3 A;  4TM1 A;  3CNS A;  2YM1 A;  3FMW A;  4EQS A;  2GV8 A;  4CY8 A;  4YTN A;  1LQU A;  2ZBW A;  4K7Z A;  1CC6 A;  5U25 A;  3FPZ A;  3NH3 X;  1GOS A;  2OLN A;  1PBD A;  3NLC A;  3VRB A;  3BI5 A;  4FDC B;  2XVF A;  1L9E A;  1B37 A;  3RED A;  1JEH A;  4Z24 A;  5DBJ A;  2WPC A;  3ZDN A;  3DJJ A;  1PXB A;  1ZK7 A;  4RSL A;  4TM3 A;  4C3Y A;  2GRT A;  4Z25 A;  1NPX A;  1TDK A;  2E5V A;  1IUW A;  4USR A;  5HYM A;  2JB2 A;  2PHH A;  2XLT A;  2VQB A;  1EL7 A;  4GCM A;  1PJ5 A;  4DGK A;  1PXC A;  4H4Q A;  3AE9 A;  2X8H A;  1Q1R A;  4Z2T A;  3CN8 A;  1M64 A;  4CNJ A;  4NTC A;  1O5W A;  1ZMC A;  4JDR A;  4Y4M A;  2B7R A;  3AXB A;  1NHP A;  4CY6 A;  1VQW A;  1N4V A;  4PAA A;  4EM3 A;  3M12 A;  1JU2 A;  1PBE A;  1OJD A;  3NN0 X;  4U8J A;  3AB1 A;  3NTA A;  1BKW A;  3GD4 A;  3UKQ A;  2IVE A;  1Q1W A;  4Z2R A;  1GSN A;  4H4P A;  4DSH A;  1GRH A;  2ZZ0 A;  1RYI A;  1KSS A;  2XFU A;  1LJ1 A;  1ONF A;  4X9N A;  4A6N A;  4OVI A;  4K8D A;  4LU6 A;  4K2X A;  2WP6 A;  2R0C A;  3CPI G;  3OZ2 A;  4GF7 A;  1LVL A;  4LA1 A;  3KVE A;  4FX9 A;  4A5L A;  2FJE A;  2GR0 A;  4AT0 A;  2YLX A;  1RP0 A;  3PO7 A;  5U1O A;  4BV6 A;  2Q0L A;  4ECH A;  3HZL A;  1W4X A;  3QSE A;  2CFY A;  4IVO B;  4KPR A;  3O0H A;  5FMH A;  4B67 A;  4GR1 A;  1IUX A;  1KNP A;  2R4E A;  5FS8 A;  1CBO A;  3M13 A;  5EBK A;  4YXD A;  4XXG A;  4PAB A;  4H2Q A;  4NTD A;  4GDE A;  3P1W A;  2B9W A;  3PVC A;  2V3B A;  2WES A;  1K0L A;  1CF3 A;  1JRZ A;  1F8S A;  3CIR A;  4EM4 A;  3DH9 A;  3GYJ A;  1D4D A;  3SQP A;  1E39 A;  1PBC A;  2Z5X A;  5M10 A;  1BGN A;  2C3D A;  5KVI A;  2AR8 A;  4I59 A;  3DK4 A;  1KNR A;  1KSU A;  1K0I A;  3NNE A;  2TMD A;  2GF3 A;  2Y6R A;  3ICS A;  2WEU A;  3CGC A;  1N4U A;  3VR9 A;  1NDA A;  3CGE A;  4FK1 A;  4U8I A;  4A6N B;  3LJP A;  3QJ4 A;  2EQ8 A;  3DK8 A;  4H4S A;  2BK5 A;  1ZDL A;  2QCU A;  4H2R A;  4XWZ A;  3NHO X;  5HHF A;  3VQR A;  3G5R A;  4OPU A;  3AD8 B;  2XYO A;  3P9U A;  2JKC A;  1REO A;  5IPY A;  1LV0 A;  1PS9 A;  2BS2 A;  2APG A;  3KA7 A;  2WDQ A;  4YTM A;  3P4R A;  4UP3 A;  4TLX A;  2GEW A;  2JK6 A;  5KWF A;  3NYE A;  3UKK A;  4YTP A;  1MO9 A;  1PJ7 A;  2WQY A;  1DJQ A;  2FJA A;  2ARD A;  1XAN A;  2V5Z A;  3LB8 A;  1H6V A;  3RP8 A;  4IVM B;  2E4G A;  2XVJ A;  4Z26 A;  4HB9 A;  3EAO A;  1E1L A;  4J36 A;  2HQM A;  3UKL A;  2WET A;  3DGH A;  2YQU A;  2X8C A;  1TDF A;  3L8K A;  2Q7V A;  4B66 A;  1NHQ A;  1DJN A;  4FK1 C;  2FJD A;  3DK9 A;  3F8D A;  2XCG A;  4IV9 A;  2QAE A;  4AP1 A;  3ATQ A;  2B9X A;  2YAU A;  4DSG A;  3AEA A;  3DJD A;  4D03 A;  4O5Q A;  5BRT A;  2XVH A;  1FEA A;  3AYJ A;  2Y6Q A;  4EQR A;  1XPQ A;  2OLO A;  2WOI A;  3K7T A;  3PS9 A;  3SGL A;  1CL0 A; 
#chains in the Genus database with same CATH topology
 1F6M A;  1S3E A;  1O95 A;  3AE3 A;  1LPF A;  4Y4N A;  1ZKQ A;  2C7G A;  3AE6 A;  1E7P A;  5U63 A;  3SFE A;  2BS4 A;  5LV9 A;  2YVG A;  4A7A A;  3ALJ A;  5JCM A;  3NYF A;  4GAV A;  4MJW A;  4H4U A;  1L9C A;  3BHK A;  1CC2 A;  1D7L A;  1YQZ A;  3HYX A;  1N4W A;  3IF9 A;  1GND A;  1Q9I A;  1Y0P A;  4B63 A;  5JCI A;  1B8S A;  2ZZC A;  3EPT A;  3KKJ A;  2VVL G;  4OPD A;  5CQF A;  2YG4 A;  1NEK A;  1F8W A;  3DME A;  3QFA A;  1FCD A;  4H2P A;  2R9Z A;  2CVJ A;  3ALL A;  1GTE A;  2H89 A;  2IVD A;  1TYP A;  1IUU A;  3CGB A;  1D4C A;  3K30 A;  4J56 A;  3AEF A;  4U2S A;  4TLZ A;  3BNM A;  3LZW A;  3R9U A;  3LOV A;  2WBA A;  1IUS A;  5M0Z A;  5JCN A;  1PBB A;  2XFP A;  1ZOV A;  1GER A;  1S2Y A;  2B9Y A;  2WP5 A;  3OC4 A;  2YR4 A;  2J3N A;  4KX6 A;  4XWR A;  4K22 A;  3S5W A;  4EMW A;  4G73 A;  4H4Y A;  1BWC A;  3AE2 A;  2GR3 A;  2W0H A;  1ZMD A;  4YT0 A;  1VG0 A;  1E1K A;  2QA1 A;  2BCP A;  2R4J A;  2YVJ A;  2VQ7 A;  3NK1 X;  4H7U A;  2ZZB A;  5FS6 A;  3AEE A;  4A99 A;  3UTH A;  2YLZ A;  4H4X A;  1FEC A;  1AOG A;  4II2 A;  3S61 A;  3DGZ A;  4UDR A;  1MOK A;  4OPT A;  3UOX A;  4B64 A;  4U8M A;  3SM8 A;  3DA1 A;  2FBW A;  4A9W A;  3GRS A;  1O94 A;  4U8O A;  2XLR A;  2GB0 A;  4BJZ A;  2X8G A;  4G6G A;  3LXD A;  4LII A;  4DNA A;  3AYL A;  3EAN A;  2GR2 A;  1VG9 A;  3CPH G;  1TDE A;  3AEB A;  3WE0 A;  1E6E A;  3ABV A;  2GQF A;  3VR8 A;  4Z2U A;  4CBQ A;  2BXS A;  3AED A;  1F3P A;  2GQW A;  3QSM A;  2WDV A;  3G5Q A;  4C3X A;  2VOU A;  1DOE A;  3B6D A;  2XVE A;  1D5T A;  3FBS A;  3AYI A;  3SZC A;  4YSZ A;  1CJ3 A;  1CJ2 A;  1Y56 B;  2I0Z A;  1GEU A;  2YR5 A;  1D7Y A;  3ZYX A;  1GES A;  3F8P A;  4AP3 A;  2OAM A;  3NKS A;  3IWA A;  3NGC X;  2YG5 A;  3H8I A;  1P2H A;  4II3 A;  5EB4 A;  5ER0 A;  1PDH A;  1QJD A;  3C4N A;  4ZCC A;  4ZCD A;  3UTG A;  1GRF A;  4EIQ A;  5KRQ A;  5HY5 A;  3UTF A;  1L0V A;  1M6I A;  1EBD A;  1OJC A;  1MXT A;  2R0G A;  1YY5 A;  4I58 A;  3AE8 A;  1XHC A;  3H8L A;  2VZ2 A;  2GH5 A;  2EQ6 A;  1CHU A;  3COX A;  3ATR A;  3F8R A;  4EMJ A;  2VVL A;  2VRM A;  3BI4 A;  4J2W A;  5IQ1 A;  5L46 A;  2C76 A;  3GD3 A;  3AWI A;  1Z6L A;  3GDP A;  4G6H A;  2A8X A;  2C73 A;  2WU2 A;  3CNT A;  3ITJ A;  3AEC A;  1ZOY A;  5KMR A;  2NPX A;  1GRT A;  2C75 A;  4U2L A;  5C3J A;  5KMP A;  3T37 A;  1OJT A;  1FEB A;  2FJB A;  3P4Q A;  4YSH A;  2YLR A;  2XFQ A;  3ALM A;  2YVF A;  3K7M X;  1BGJ A;  1DOC A;  4TM0 A;  4UDP A;  2JAE A;  2QA2 A;  1E1M A;  3GSI A;  3QVR A;  1NHR A;  4AOS A;  2WOV A;  4EQX A;  2YG6 A;  3SX6 A;  3AE1 A;  3KD9 A;  1JRY A;  4YSY A;  5FS7 A;  5KOX A;  3JSK A;  3IHM A;  4BUR A;  2R0P A;  2AAQ A;  3KU9 A;  4E0V A;  3T14 A;  3UP4 A;  5J60 A;  4B68 A;  4YKF A;  1H86 A;  1YQ3 A;  4OPG A;  1DXL A;  2V3A A;  3UKA A;  2Z5Y A;  4YWO A;  1UKV G;  1BZL A;  3I3L A;  3VRA A;  3GMB A;  5C2T A;  2WDR A;  1H82 A;  3VRD B;  4ADW A;  4B69 A;  4X4J A;  1OJA A;  3RHA A;  3IHG A;  1PN0 A;  4P9S A;  4APN A;  4NEW A;  1P2E A;  2WHD A;  1XDI A;  3NIX A;  1COY A;  3NRN A;  1PXA A;  4U8P A;  3RP6 A;  4A65 A;  3D1C A;  4C74 A;  1N1P A;  2BYB A;  2GAG B;  3CNJ A;  4Z43 A;  2TPR A;  4USQ A;  1EL8 A;  2XLS A;  2YLW A;  4NEV A;  2YM2 A;  4U8K A;  5IQ4 A;  2WS3 A;  4H4R A;  4C5O A;  1GT8 A;  1QLB A;  1YKJ A;  2C70 A;  3LAD A;  3ISH A;  3DJG X;  4JY2 A;  5CKU A;  4ICY A;  5KXJ A;  1GAL A;  1ZP0 A;  2EQ9 A;  3CND A;  1F8R A;  4J31 A;  2BRA A;  1K4Q A;  3G5S A;  2UZZ A;  1RSG A;  2OAL A;  1H81 A;  3CGD A;  1TYT A;  4N9X A;  4BK3 A;  3LZX A;  1EL5 A;  2C64 A;  4JNA A;  3GRT A;  1DOD A;  4Z44 A;  4C77 A;  5BUK A;  4WX1 A;  2AQJ A;  1IUV A;  2YLS A;  1JRX A;  3AEG A;  4OPL A;  3I6D A;  4J57 A;  1LQT A;  2R45 A;  2C3C A;  3UKP A;  2XLU A;  2YWL A;  2IID A;  1GET A;  2WP9 A;  3P4S A;  4H4V A;  3NG7 X;  3P4P A;  2JB3 A;  4O5U A;  3BHF A;  2H88 A;  4H2N A;  1GRE A;  4H50 A;  2WOW A;  4AT2 A;  3SFD A;  3V3N A;  3DJE A;  3GDN A;  2XVI A;  1OJ9 A;  3GWD A;  3RP7 A;  2Q6U A;  3UKF A;  4CCR A;  3B3R A;  5FS9 A;  1ZX9 A;  2GR1 A;  2A89 A;  2GAH B;  5GSN A;  1H7X A;  2V6O A;  2X50 A;  3UKH A;  2X3N A;  5EB5 A;  1TRB A;  3URH A;  4EMI A;  3KPF A;  3BI2 A;  5KVH A;  4CCQ A;  1SEZ A;  2BK3 A;  4JNQ A;  4NWZ A;  1GRA A;  3ICT A;  4H4Z A;  3UOY A;  4BK1 A;  5HXI A;  4GUV A;  1PHH A;  5J7X A;  1H7W A;  4A79 A;  2DKI A;  2BAB A;  3AD9 B;  4B65 A;  1GRG A;  1H83 A;  3CPJ G;  3UP5 A;  3V3O A;  4RG3 A;  2RGJ A;  4ZN0 A;  2BK4 A;  2CUL A;  1E1N A;  1TDO A;  1DNC A;  2V60 A;  1NG3 A;  1X31 B;  2C72 A;  4J33 A;  3QVP A;  3H4K A;  2WPF A;  2XDO A;  4K5S A;  5KNL A;  2GMJ A;  2ACZ A;  4OCG A;  1KF6 A;  4M52 A;  2WU5 A;  3UCL A;  3NN6 X;  3M0O A;  2GMH A;  4JN9 A;  1NHS A;  3CTY A;  2JB1 A;  2DKH A;  1K0J A;  4OPC A;  1L9D A;  3FIM B;  1Y56 A;  4U8N A;  1IUT A;  1NG4 A;  4WCT A;  3AD7 B;  2B7S A;  4X9M A;  5JCL A;  1S2Q A;  5KOW A;  3AE5 A;  4CNK A;  3IC9 A;  3E1T A;  3Q9T A;  3FG2 P;  2XLP A;  2B76 A;  2YG7 A;  3C4A A;  3UTE A;  2BCG G;  1D4E A;  1KFY A;  5GRT A;  3UOV A;  3II4 A;  3NYC A;  4D04 A;  5KMS A;  4GRT A;  1IJH A;  1PBF A;  1LTX R;  1NAA A;  4IA6 A;  1EL9 A;  1BF3 A;  3BNU A;  4TM4 A;  4JY3 A;  1VRQ B;  3QFB A;  4UDQ A;  3SYI A;  1JNZ A;  2C65 A;  2OA1 A;  2RGH A;  3RNM A;  1FL2 A;  2YG3 A;  1H84 A;  1DOB A;  1KDG A;  1V59 A;  2BA9 A;  4H4W A;  2V61 A;  2C67 A;  3SXI A;  4REK A;  5BUL A;  2O9Z A;  4K5R A;  3CMM A;  4J34 A;  5JCK A;  2BC0 A;  4CRT A;  2BXR A;  2PYX A;  3AE7 A;  4HA6 A;  5BVA A;  2BAC A;  3HYW A;  4NZH A;  1NEN A;  1ZY8 A;  2XFN A;  2C66 A;  1JOA A;  3EF6 A;  1B5Q A;  2RGO A;  4EQW A;  3GWF A;  4U2T A;  2VVM A;  3Q6J A;  3GYI A;  2R46 A;  1FOH A;  3HYV A;  1PJ6 A;  1QO8 A;  1GXF A;  3K7Q X;  4BJY A;  3NT6 A;  1S3B A;  3QSS A;  3ICR A;  3T2Z A;  3NTD A;  3GMC A;  4B1B A;  5EOW A;  2EQ7 A;  2VRL A;  1GTH A;  3NK2 X;  1JNR A;  4IA5 A;  2E1M A;  1YQ4 A;  2JBV A;  2XFO A;  3C96 A;  1HYU A;  2YLT A;  2BS3 A;  3ADA B;  4U8L A;  1ELI A;  4Y4L A;  3UOZ A;  1GV4 A;  3V76 A;  4YSX A;  2NVK X;  4GDP A;  2WPE A;  2A87 A;  4JQ9 A;  3SZ0 A;  2BC1 A;  4BK2 A;  1B4V A;  3D8X A;  2GVC A;  4OPI A;  2F5Z A;  4RG4 A;  1CJ4 A;  3CNP A;  1GPE A;  2RAB A;  1CJC A;  5KMQ A;  3KLJ A;  4NTE A;  4YKG A;  4EIP A;  4NNJ A;  1GRB A;  2CDU A;  1CC4 A;  3AE4 A;  1TDN A;  2YR6 A;  1VDC A;  4AOX A;  3L1R A;  4H4T A;  2X99 A;  2Q0K A;  3NK0 X;  5TR3 A;  4TM1 A;  3CNS A;  2YM1 A;  3FMW A;  4EQS A;  2GV8 A;  4CY8 A;  4YTN A;  1LQU A;  2ZBW A;  4K7Z A;  1CC6 A;  3SY4 A;  5U25 A;  3FPZ A;  3NH3 X;  1GOS A;  2OLN A;  1PBD A;  3NLC A;  3VRB A;  3BI5 A;  4FDC B;  2XVF A;  1L9E A;  1B37 A;  3RED A;  1JEH A;  4Z24 A;  5DBJ A;  2WPC A;  3ZDN A;  3DJJ A;  1PXB A;  1ZK7 A;  4RSL A;  4TM3 A;  4C3Y A;  2GRT A;  4Z25 A;  1NPX A;  1TDK A;  2E5V A;  1IUW A;  4USR A;  5HYM A;  2JB2 A;  2PHH A;  2XLT A;  2VQB A;  1EL7 A;  4GCM A;  1PJ5 A;  4DGK A;  1PXC A;  4H4Q A;  3AE9 A;  2X8H A;  1Q1R A;  4Z2T A;  3CN8 A;  1M64 A;  4CNJ A;  4NTC A;  1O5W A;  1ZMC A;  3SZW A;  4JDR A;  4Y4M A;  2B7R A;  3AXB A;  1NHP A;  4CY6 A;  1VQW A;  1N4V A;  4PAA A;  4EM3 A;  3M12 A;  1JU2 A;  1PBE A;  1OJD A;  3NN0 X;  4U8J A;  3AB1 A;  3NTA A;  1BKW A;  3GD4 A;  3UKQ A;  2IVE A;  1Q1W A;  4Z2R A;  1GSN A;  2BRY A;  4H4P A;  4DSH A;  1GRH A;  2ZZ0 A;  1RYI A;  1KSS A;  2XFU A;  1LJ1 A;  1ONF A;  4X9N A;  4A6N A;  4OVI A;  4K8D A;  4LU6 A;  4K2X A;  2WP6 A;  2R0C A;  3CPI G;  3OZ2 A;  4GF7 A;  1LVL A;  4LA1 A;  3KVE A;  4FX9 A;  4A5L A;  2FJE A;  2GR0 A;  4G9K A;  4AT0 A;  2YLX A;  1RP0 A;  3PO7 A;  5U1O A;  4BV6 A;  2Q0L A;  4ECH A;  3HZL A;  1W4X A;  3QSE A;  2CFY A;  4IVO B;  4KPR A;  3O0H A;  5FMH A;  4B67 A;  4GR1 A;  1IUX A;  1KNP A;  2R4E A;  5FS8 A;  1CBO A;  3M13 A;  5EBK A;  4YXD A;  3T31 A;  4XXG A;  4PAB A;  4H2Q A;  4NTD A;  4GDE A;  3P1W A;  2B9W A;  3PVC A;  2V3B A;  2WES A;  1K0L A;  1CF3 A;  1JRZ A;  1F8S A;  3CIR A;  4EM4 A;  3DH9 A;  3GYJ A;  1D4D A;  2C4C A;  3SQP A;  1E39 A;  1PBC A;  2Z5X A;  5M10 A;  1BGN A;  2C3D A;  5KVI A;  2AR8 A;  4I59 A;  3DK4 A;  1KNR A;  1KSU A;  3T0K A;  1K0I A;  3NNE A;  2TMD A;  2GF3 A;  2Y6R A;  3ICS A;  2WEU A;  3CGC A;  1N4U A;  3VR9 A;  3KPK A;  1NDA A;  3CGE A;  4FK1 A;  4U8I A;  4GAP A;  4A6N B;  3LJP A;  3QJ4 A;  2EQ8 A;  3DK8 A;  4H4S A;  2BK5 A;  1ZDL A;  2QCU A;  4H2R A;  4XWZ A;  3NHO X;  5HHF A;  3GYX A;  3VQR A;  3G5R A;  4OPU A;  3AD8 B;  2XYO A;  3P9U A;  3T2K A;  2JKC A;  1REO A;  5IPY A;  1LV0 A;  1PS9 A;  2BS2 A;  2APG A;  3KA7 A;  2WDQ A;  4YTM A;  3P4R A;  4G74 A;  4UP3 A;  4TLX A;  2GEW A;  2JK6 A;  5KWF A;  3NYE A;  3T2Y A;  3UKK A;  4YTP A;  1MO9 A;  1PJ7 A;  2WQY A;  1DJQ A;  2FJA A;  2ARD A;  1XAN A;  2V5Z A;  3LB8 A;  1H6V A;  3RP8 A;  4IVM B;  2E4G A;  2XVJ A;  4Z26 A;  4HB9 A;  3EAO A;  1E1L A;  4J36 A;  3SZF A;  2HQM A;  3UKL A;  2WET A;  3DGH A;  2YQU A;  2X8C A;  1TDF A;  3L8K A;  2Q7V A;  4B66 A;  1NHQ A;  1DJN A;  4FK1 C;  2FJD A;  3DK9 A;  3F8D A;  2XCG A;  4IV9 A;  2QAE A;  4AP1 A;  3ATQ A;  2B9X A;  2YAU A;  4DSG A;  3AEA A;  3DJD A;  4D03 A;  4O5Q A;  5BRT A;  2XVH A;  1FEA A;  3AYJ A;  2Y6Q A;  4EQR A;  1XPQ A;  2OLO A;  2WOI A;  3K7T A;  3PS9 A;  3SGL A;  1CL0 A; 
#chains in the Genus database with same CATH homology
 1F6M A;  1S3E A;  1O95 A;  3AE3 A;  1LPF A;  4Y4N A;  1ZKQ A;  2C7G A;  3AE6 A;  1E7P A;  5U63 A;  3SFE A;  2BS4 A;  5LV9 A;  2YVG A;  4A7A A;  3ALJ A;  5JCM A;  3NYF A;  4GAV A;  4MJW A;  4H4U A;  1L9C A;  3BHK A;  1CC2 A;  1D7L A;  1YQZ A;  3HYX A;  1N4W A;  3IF9 A;  1GND A;  1Q9I A;  1Y0P A;  4B63 A;  5JCI A;  1B8S A;  2ZZC A;  3EPT A;  3KKJ A;  2VVL G;  4OPD A;  5CQF A;  2YG4 A;  1NEK A;  1F8W A;  3DME A;  3QFA A;  1FCD A;  4H2P A;  2R9Z A;  2CVJ A;  3ALL A;  1GTE A;  2H89 A;  2IVD A;  1TYP A;  1IUU A;  3CGB A;  1D4C A;  3K30 A;  4J56 A;  3AEF A;  4U2S A;  4TLZ A;  3BNM A;  3LZW A;  3R9U A;  3LOV A;  2WBA A;  1IUS A;  5M0Z A;  5JCN A;  1PBB A;  2XFP A;  1ZOV A;  1GER A;  1S2Y A;  2B9Y A;  2WP5 A;  3OC4 A;  2YR4 A;  2J3N A;  4KX6 A;  4XWR A;  4K22 A;  3S5W A;  4EMW A;  4G73 A;  4H4Y A;  1BWC A;  3AE2 A;  2GR3 A;  2W0H A;  1ZMD A;  4YT0 A;  1VG0 A;  1E1K A;  2QA1 A;  2BCP A;  2R4J A;  2YVJ A;  2VQ7 A;  3NK1 X;  4H7U A;  2ZZB A;  5FS6 A;  3AEE A;  4A99 A;  3UTH A;  2YLZ A;  4H4X A;  1FEC A;  1AOG A;  4II2 A;  3S61 A;  3DGZ A;  4UDR A;  1MOK A;  4OPT A;  3UOX A;  4B64 A;  4U8M A;  3SM8 A;  3DA1 A;  2FBW A;  4A9W A;  3GRS A;  1O94 A;  4U8O A;  2XLR A;  2GB0 A;  4BJZ A;  2X8G A;  4G6G A;  3LXD A;  4LII A;  4DNA A;  3AYL A;  3EAN A;  2GR2 A;  1VG9 A;  3CPH G;  1TDE A;  3AEB A;  3WE0 A;  1E6E A;  3ABV A;  2GQF A;  3VR8 A;  4Z2U A;  4CBQ A;  2BXS A;  3AED A;  1F3P A;  2GQW A;  3QSM A;  2WDV A;  3G5Q A;  4C3X A;  2VOU A;  1DOE A;  3B6D A;  2XVE A;  1D5T A;  3FBS A;  3AYI A;  3SZC A;  4YSZ A;  1CJ3 A;  1CJ2 A;  1Y56 B;  2I0Z A;  1GEU A;  2YR5 A;  1D7Y A;  3ZYX A;  1GES A;  3F8P A;  4AP3 A;  2OAM A;  3NKS A;  3IWA A;  3NGC X;  2YG5 A;  3H8I A;  1P2H A;  4II3 A;  5EB4 A;  5ER0 A;  1PDH A;  1QJD A;  3C4N A;  4ZCC A;  4ZCD A;  3UTG A;  1GRF A;  4EIQ A;  5KRQ A;  5HY5 A;  3UTF A;  1L0V A;  1M6I A;  1EBD A;  1OJC A;  1MXT A;  2R0G A;  1YY5 A;  4I58 A;  3AE8 A;  1XHC A;  3H8L A;  2VZ2 A;  2GH5 A;  2EQ6 A;  1CHU A;  3COX A;  3ATR A;  3F8R A;  4EMJ A;  2VVL A;  2VRM A;  3BI4 A;  4J2W A;  5IQ1 A;  5L46 A;  2C76 A;  3GD3 A;  3AWI A;  1Z6L A;  3GDP A;  4G6H A;  2A8X A;  2C73 A;  2WU2 A;  3CNT A;  3ITJ A;  3AEC A;  1ZOY A;  5KMR A;  2NPX A;  1GRT A;  2C75 A;  4U2L A;  5C3J A;  5KMP A;  3T37 A;  1OJT A;  1FEB A;  2FJB A;  3P4Q A;  4YSH A;  2YLR A;  2XFQ A;  3ALM A;  2YVF A;  3K7M X;  1BGJ A;  1DOC A;  4TM0 A;  4UDP A;  2JAE A;  2QA2 A;  1E1M A;  3GSI A;  3QVR A;  1NHR A;  4AOS A;  2WOV A;  4EQX A;  2YG6 A;  3SX6 A;  3AE1 A;  3KD9 A;  1JRY A;  4YSY A;  5FS7 A;  5KOX A;  3JSK A;  3IHM A;  4BUR A;  2R0P A;  2AAQ A;  3KU9 A;  4E0V A;  3T14 A;  3UP4 A;  5J60 A;  4B68 A;  4YKF A;  1H86 A;  1YQ3 A;  4OPG A;  1DXL A;  2V3A A;  3UKA A;  2Z5Y A;  4YWO A;  1UKV G;  1BZL A;  3I3L A;  3VRA A;  3GMB A;  5C2T A;  2WDR A;  1H82 A;  3VRD B;  4ADW A;  4B69 A;  4X4J A;  1OJA A;  3RHA A;  3IHG A;  1PN0 A;  4P9S A;  4APN A;  4NEW A;  1P2E A;  2WHD A;  1XDI A;  3NIX A;  1COY A;  3NRN A;  1PXA A;  4U8P A;  3RP6 A;  4A65 A;  3D1C A;  4C74 A;  1N1P A;  2BYB A;  2GAG B;  3CNJ A;  4Z43 A;  2TPR A;  4USQ A;  1EL8 A;  2XLS A;  2YLW A;  4NEV A;  2YM2 A;  4U8K A;  5IQ4 A;  2WS3 A;  4H4R A;  4C5O A;  1GT8 A;  1QLB A;  1YKJ A;  2C70 A;  3LAD A;  3ISH A;  3DJG X;  4JY2 A;  5CKU A;  4ICY A;  5KXJ A;  1GAL A;  1ZP0 A;  2EQ9 A;  3CND A;  1F8R A;  4J31 A;  2BRA A;  1K4Q A;  3G5S A;  2UZZ A;  1RSG A;  2OAL A;  1H81 A;  3CGD A;  1TYT A;  4N9X A;  4BK3 A;  3LZX A;  1EL5 A;  2C64 A;  4JNA A;  3GRT A;  1DOD A;  4Z44 A;  4C77 A;  5BUK A;  4WX1 A;  2AQJ A;  1IUV A;  2YLS A;  1JRX A;  3AEG A;  4OPL A;  3I6D A;  4J57 A;  1LQT A;  2R45 A;  2C3C A;  3UKP A;  2XLU A;  2YWL A;  2IID A;  1GET A;  2WP9 A;  3P4S A;  4H4V A;  3NG7 X;  3P4P A;  2JB3 A;  4O5U A;  3BHF A;  2H88 A;  4H2N A;  1GRE A;  4H50 A;  2WOW A;  4AT2 A;  3SFD A;  3V3N A;  3DJE A;  3GDN A;  2XVI A;  1OJ9 A;  3GWD A;  3RP7 A;  2Q6U A;  3UKF A;  4CCR A;  3B3R A;  5FS9 A;  1ZX9 A;  2GR1 A;  2A89 A;  2GAH B;  5GSN A;  1H7X A;  2V6O A;  2X50 A;  3UKH A;  2X3N A;  5EB5 A;  1TRB A;  3URH A;  4EMI A;  3KPF A;  3BI2 A;  5KVH A;  4CCQ A;  1SEZ A;  2BK3 A;  4JNQ A;  4NWZ A;  1GRA A;  3ICT A;  4H4Z A;  3UOY A;  4BK1 A;  5HXI A;  4GUV A;  1PHH A;  5J7X A;  1H7W A;  4A79 A;  2DKI A;  2BAB A;  3AD9 B;  4B65 A;  1GRG A;  1H83 A;  3CPJ G;  3UP5 A;  3V3O A;  4RG3 A;  2RGJ A;  4ZN0 A;  2BK4 A;  2CUL A;  1E1N A;  1TDO A;  1DNC A;  2V60 A;  1NG3 A;  1X31 B;  2C72 A;  4J33 A;  3QVP A;  3H4K A;  2WPF A;  2XDO A;  4K5S A;  5KNL A;  2GMJ A;  2ACZ A;  4OCG A;  1KF6 A;  4M52 A;  2WU5 A;  3UCL A;  3NN6 X;  3M0O A;  2GMH A;  4JN9 A;  1NHS A;  3CTY A;  2JB1 A;  2DKH A;  1K0J A;  4OPC A;  1L9D A;  3FIM B;  1Y56 A;  4U8N A;  1IUT A;  1NG4 A;  4WCT A;  3AD7 B;  2B7S A;  4X9M A;  5JCL A;  1S2Q A;  5KOW A;  3AE5 A;  4CNK A;  3IC9 A;  3E1T A;  3Q9T A;  3FG2 P;  2XLP A;  2B76 A;  2YG7 A;  3C4A A;  3UTE A;  2BCG G;  1D4E A;  1KFY A;  5GRT A;  3UOV A;  3II4 A;  3NYC A;  4D04 A;  5KMS A;  4GRT A;  1IJH A;  1PBF A;  1LTX R;  1NAA A;  4IA6 A;  1EL9 A;  1BF3 A;  3BNU A;  4TM4 A;  4JY3 A;  1VRQ B;  3QFB A;  4UDQ A;  3SYI A;  1JNZ A;  2C65 A;  2OA1 A;  2RGH A;  3RNM A;  1FL2 A;  2YG3 A;  1H84 A;  1DOB A;  1KDG A;  1V59 A;  2BA9 A;  4H4W A;  2V61 A;  2C67 A;  3SXI A;  4REK A;  5BUL A;  2O9Z A;  4K5R A;  3CMM A;  4J34 A;  5JCK A;  2BC0 A;  4CRT A;  2BXR A;  2PYX A;  3AE7 A;  4HA6 A;  5BVA A;  2BAC A;  3HYW A;  4NZH A;  1NEN A;  1ZY8 A;  2XFN A;  2C66 A;  1JOA A;  3EF6 A;  1B5Q A;  2RGO A;  4EQW A;  3GWF A;  4U2T A;  2VVM A;  3Q6J A;  3GYI A;  2R46 A;  1FOH A;  3HYV A;  1PJ6 A;  1QO8 A;  1GXF A;  3K7Q X;  4BJY A;  3NT6 A;  1S3B A;  3QSS A;  3ICR A;  3T2Z A;  3NTD A;  3GMC A;  4B1B A;  5EOW A;  2EQ7 A;  2VRL A;  1GTH A;  3NK2 X;  1JNR A;  4IA5 A;  2E1M A;  1YQ4 A;  2JBV A;  2XFO A;  3C96 A;  1HYU A;  2YLT A;  2BS3 A;  3ADA B;  4U8L A;  1ELI A;  4Y4L A;  3UOZ A;  1GV4 A;  3V76 A;  4YSX A;  2NVK X;  4GDP A;  2WPE A;  2A87 A;  4JQ9 A;  3SZ0 A;  2BC1 A;  4BK2 A;  1B4V A;  3D8X A;  2GVC A;  4OPI A;  2F5Z A;  4RG4 A;  1CJ4 A;  3CNP A;  1GPE A;  2RAB A;  1CJC A;  5KMQ A;  3KLJ A;  4NTE A;  4YKG A;  4EIP A;  4NNJ A;  1GRB A;  2CDU A;  1CC4 A;  3AE4 A;  1TDN A;  2YR6 A;  1VDC A;  4AOX A;  3L1R A;  4H4T A;  2X99 A;  2Q0K A;  3NK0 X;  5TR3 A;  4TM1 A;  3CNS A;  2YM1 A;  3FMW A;  4EQS A;  2GV8 A;  4CY8 A;  4YTN A;  1LQU A;  2ZBW A;  4K7Z A;  1CC6 A;  3SY4 A;  5U25 A;  3FPZ A;  3NH3 X;  1GOS A;  2OLN A;  1PBD A;  3NLC A;  3VRB A;  3BI5 A;  4FDC B;  2XVF A;  1L9E A;  1B37 A;  3RED A;  1JEH A;  4Z24 A;  5DBJ A;  2WPC A;  3ZDN A;  3DJJ A;  1PXB A;  1ZK7 A;  4RSL A;  4TM3 A;  4C3Y A;  2GRT A;  4Z25 A;  1NPX A;  1TDK A;  2E5V A;  1IUW A;  4USR A;  5HYM A;  2JB2 A;  2PHH A;  2XLT A;  2VQB A;  1EL7 A;  4GCM A;  1PJ5 A;  4DGK A;  1PXC A;  4H4Q A;  3AE9 A;  2X8H A;  1Q1R A;  4Z2T A;  3CN8 A;  1M64 A;  4CNJ A;  4NTC A;  1O5W A;  1ZMC A;  3SZW A;  4JDR A;  4Y4M A;  2B7R A;  3AXB A;  1NHP A;  4CY6 A;  1VQW A;  1N4V A;  4PAA A;  4EM3 A;  3M12 A;  1JU2 A;  1PBE A;  1OJD A;  3NN0 X;  4U8J A;  3AB1 A;  3NTA A;  1BKW A;  3GD4 A;  3UKQ A;  2IVE A;  1Q1W A;  4Z2R A;  1GSN A;  2BRY A;  4H4P A;  4DSH A;  1GRH A;  2ZZ0 A;  1RYI A;  1KSS A;  2XFU A;  1LJ1 A;  1ONF A;  4X9N A;  4A6N A;  4OVI A;  4K8D A;  4LU6 A;  4K2X A;  2WP6 A;  2R0C A;  3CPI G;  3OZ2 A;  4GF7 A;  1LVL A;  4LA1 A;  3KVE A;  4FX9 A;  4A5L A;  2FJE A;  2GR0 A;  4G9K A;  4AT0 A;  2YLX A;  1RP0 A;  3PO7 A;  5U1O A;  4BV6 A;  2Q0L A;  4ECH A;  3HZL A;  1W4X A;  3QSE A;  2CFY A;  4IVO B;  4KPR A;  3O0H A;  5FMH A;  4B67 A;  4GR1 A;  1IUX A;  1KNP A;  2R4E A;  5FS8 A;  1CBO A;  3M13 A;  5EBK A;  4YXD A;  3T31 A;  4XXG A;  4PAB A;  4H2Q A;  4NTD A;  4GDE A;  3P1W A;  2B9W A;  3PVC A;  2V3B A;  2WES A;  1K0L A;  1CF3 A;  1JRZ A;  1F8S A;  3CIR A;  4EM4 A;  3DH9 A;  3GYJ A;  1D4D A;  2C4C A;  3SQP A;  1E39 A;  1PBC A;  2Z5X A;  5M10 A;  1BGN A;  2C3D A;  5KVI A;  2AR8 A;  4I59 A;  3DK4 A;  1KNR A;  1KSU A;  3T0K A;  1K0I A;  3NNE A;  2TMD A;  2GF3 A;  2Y6R A;  3ICS A;  2WEU A;  3CGC A;  1N4U A;  3VR9 A;  3KPK A;  1NDA A;  3CGE A;  4FK1 A;  4U8I A;  4GAP A;  4A6N B;  3LJP A;  3QJ4 A;  2EQ8 A;  3DK8 A;  4H4S A;  2BK5 A;  1ZDL A;  2QCU A;  4H2R A;  4XWZ A;  3NHO X;  5HHF A;  3GYX A;  3VQR A;  3G5R A;  4OPU A;  3AD8 B;  2XYO A;  3P9U A;  3T2K A;  2JKC A;  1REO A;  5IPY A;  1LV0 A;  1PS9 A;  2BS2 A;  2APG A;  3KA7 A;  2WDQ A;  4YTM A;  3P4R A;  4G74 A;  4UP3 A;  4TLX A;  2GEW A;  2JK6 A;  5KWF A;  3NYE A;  3T2Y A;  3UKK A;  4YTP A;  1MO9 A;  1PJ7 A;  2WQY A;  1DJQ A;  2FJA A;  2ARD A;  1XAN A;  2V5Z A;  3LB8 A;  1H6V A;  3RP8 A;  4IVM B;  2E4G A;  2XVJ A;  4Z26 A;  4HB9 A;  3EAO A;  1E1L A;  4J36 A;  3SZF A;  2HQM A;  3UKL A;  2WET A;  3DGH A;  2YQU A;  2X8C A;  1TDF A;  3L8K A;  2Q7V A;  4B66 A;  1NHQ A;  1DJN A;  4FK1 C;  2FJD A;  3DK9 A;  3F8D A;  2XCG A;  4IV9 A;  2QAE A;  4AP1 A;  3ATQ A;  2B9X A;  2YAU A;  4DSG A;  3AEA A;  3DJD A;  4D03 A;  4O5Q A;  5BRT A;  2XVH A;  1FEA A;  3AYJ A;  2Y6Q A;  4EQR A;  1XPQ A;  2OLO A;  2WOI A;  3K7T A;  3PS9 A;  3SGL A;  1CL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...