4CBQA

Crystal structure of the thioredoxin reductase from entamoeba histolytica with auranofin au(i) bound to cys286
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
total genus 94
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA02
1S2QA 1GRFA 4OPLA 2YWLA 4ADWA 5U1OA 3COXA 2AAQA 4C5OA 1O5WA 3BI2A 2OAMA 4BURA 5JCMA 2VQBA 4X9MA 3KD9A 1GRBA 3M0OA 3NG7X 3AEAA 3M12A 4IA6A 3CGDA 3KU9A 3NKSA 1S2YA 1VDCA 1XDIA 4HA6A 1N4VA 3AYLA 3DK4A 4IVMB 3NH3X 4N9XA 4UDPA 3ATQA 4H4XA 1CL0A 4I58A 1LV0A 2YLSA 3CGBA 3UCLA 2WOIA 3EAOA 3FPZA 4AOXA 1BF3A 4YSXA 2YG7A 5HYMA 1IUSA 4U2SA 1NDAA 2XFPA 5M0ZA 1M6IA 3AYJA 3AE8A 3FIMB 2R0PA 2RGJA 1LQUA 2XVHA 3UKPA 4Z2RA 3K30A 2WPFA 3ISHA 5KRQA 1CJ4A 2R4EA 4OPGA 3G5SA 3II4A 2OLNA 3CPJG 2GQFA 1GERA 5LV9A 1E1LA 2TPRA 3H8LA 4B68A 1PXAA 3DK8A 1NHPA 5ER0A 1D4EA 1JU2A 4Y4NA 3BHFA 1FOHA 4H2RA 4DNAA 2BYBA 3H8IA 1FEAA 3CNJA 3QJ4A 3VRBA 4K2XA 3UTEA 4X9NA 4IV9A 4BV6A 3Q6JA 3FMWA 1H83A 1YY5A 2FJBA 3B3RA 4J33A 2B7SA 4DSHA 3ALLA 4BJZA 3DJDA 3CGEA 4EMWA 1D5TA 4ZCCA 1ZMCA 4H50A 1S3EA 4TM4A 2C73A 3AD8B 2YR4A 1ZP0A 4B64A 4LU6A 1COYA 3S5WA 2XDOA 5HY5A 2FBWA 2VRMA 4B69A 1DJNA 2FJAA 4H7UA 1Q1RA 2V60A 3NLCA 4TLXA 3GWDA 2WPCA 4KX6A 3AXBA 1DOEA 1H81A 4J57A 4EIPA 2WOVA 3DK9A 3QFBA 1ZKQA 4O5UA 5EB5A 1L0VA 4H4YA 2B7RA 2R0GA 3CN8A 4USRA 1NHQA 1H82A 5JCIA 4Z25A 3GMCA 4B65A 1YKJA 1KNRA 2YLXA 2TMDA 3AE7A 3HZLA 2BCPA 1TDNA 3NRNA 2CVJA 5BVAA 1V59A 3ZYXA 3BI5A 3CNTA 4JNQA 5IPYA 2RABA 4H2QA 4U2LA 4YTNA 4C74A 2GMJA 3C96A 3UOYA 1TDKA 3GYJA 1F3PA 2YG6A 4K8DA 3AB1A 3DH9A 1GRGA 3AEEA 4U8JA 3G5RA 1B5QA 1ZK7A 1D7YA 3D1CA 2V3AA 1LTXR 2WU2A 5L46A 1CJ3A 2YAUA 2O9ZA 1CBOA 1DODA 1GV4A 3GDNA 1H84A 3NK2X 3GD4A 4H4WA 4Y4LA 2X8GA 3ICRA 3AE6A 2C65A 3AE3A 3UP4A 2PHHA 1TRBA 1Q1WA 2XLUA 2YVFA 1REOA 2ZZBA 3SM8A 1XANA 4YTMA 4H4QA 4I59A 4Z2UA 5FS8A 1KDGA 3OC4A 4J2WA 4U8KA 4AT0A 3P4SA 1ELIA 2YG5A 4NTEA 2OA1A 2WDRA 3GWFA 3FBSA 2WPEA 2A89A 2QA1A 4A99A 1OJCA 2GVCA 4EQXA 1ZDLA 1ZOYA 1QLBA 1XHCA 2OLOA 3UOZA 4GRTA 4BK1A 3UOXA 3CPHG 3R9UA 2IVEA 3LOVA 1OJDA 2XLSA 3K7MX 2JK6A 1NPXA 1UKVG 3BNUA 3CNSA 4K5RA 1CJCA 2XFUA 1X31B 2BS4A 3AE2A 3GMBA 4K5SA 1JRYA 3UKLA 4A79A 1H7WA 2WP6A 1VG0A 1YQZA 4CBQA 1B37A 1PHHA 3IWAA 1K0JA 1IUWA 5J7XA 5JCKA 3QVPA 1VQWA 3K7TA 1RP0A 1JRXA 2R45A 2EQ7A 1KFYA 3NTDA 1Q9IA 3C4AA 3CIRA 3M13A 3RNMA 3V3NA 2B9WA 1O94A 4MJWA 3AE5A 2EQ6A 1TYPA 4Z2TA 2X99A 2YM1A 4EM4A 5JCNA 1ZY8A 2VOUA 2RGHA 2DKIA 4UP3A 5EBKA 2ZBWA 1JNRA 1NHSA 3AYIA 4FX9A 2IIDA 1EL9A 4RSLA 1OJAA 2J3NA 2R4JA 3CPIG 4GDEA 2GF3A 5KVHA 2GR0A 2Y6QA 1L9EA 1GSNA 2VVLG 1YQ4A 3WE0A 2APGA 3F8PA 2XLRA 4FDCB 3L1RA 2C67A 2YLTA 1GOSA 3D8XA 2BACA 1NG4A 4OPDA 4YSHA 2VRLA 2YG4A 4U2TA 4E0VA 4CY6A 3QVRA 2BS2A 2YLZA 3UOVA 1CJ2A 4C77A 3KA7A 3NYEA 4CNJA 3SQPA 4U8MA 1GTEA 2E1MA 4IA5A 4YSYA 4YWOA 2YG3A 1E6EA 1HYUA 2A8XA 1QO8A 2H89A 3KVEA 1FECA 2VQ7A 2C3DA 5J60A 5KOXA 4USQA 3NN6X 2B9XA 4H2PA 2CULA 4J34A 4TLZA 2WU5A 4PAAA 4AT2A 1PDHA 1CHUA 2VVLA 2C7GA 1PBEA 4DGKA 4EQWA 1BWCA 2FJDA 3ADAB 3DGHA 3QSMA 2XVFA 3URHA 1L9DA 2WHDA 2GR2A 2YM2A 3F8DA 1KSSA 5CKUA 1PBFA 3G5QA 3RP8A 1BZLA 5CQFA 3AE9A 3VQRA 3NGCX 5HHFA 4ECHA 3RP7A 2V6OA 2YVJA 1Z6LA 1DOCA 4H4RA 1PJ6A 1GNDA 4GF7A 3NYFA 2BA9A 4TM0A 4A9WA 2WEUA 2VVMA 3AD9B 3VR8A 4ZCDA 3AEGA 4AP1A 3LXDA 3OZ2A 2JB2A 3NNEA 3PO7A 3DA1A 1F8SA 2E5VA 1MOKA 3DGZA 2B9YA 3QSSA 3RP6A 5GSNA 1LPFA 4U8NA 2YLWA 5IQ1A 2E4GA 2BXSA 2WBAA 3GRTA 3QFAA 1FL2A 2DKHA 1Y0PA 3CTYA 2C75A 3EF6A 5EB4A 3LJPA 4OPIA 2GR1A 3KKJA 1ONFA 1VRQB 3UKHA 3SFEA 4FK1A 5HXIA 2GEWA 4JDRA 4FK1C 2EQ8A 1CC6A 1H86A 1EBDA 2X50A 4J31A 5EOWA 1E1MA 3ICTA 3E1TA 4WX1A 2V5ZA 3RHAA 1IUUA 4UDQA 2EQ9A 3NIXA 4J36A 4Z24A 1D4CA 5KOWA 4HB9A 2GAGB 2OALA 3DJGX 1ZX9A 4REKA 4ZN0A 2XFQA 1PXCA 3VR9A 3LB8A 1DOBA 5JCLA 3ITJA 2R9ZA 1KF6A 2BC1A 4DSGA 3UKKA 2BABA 2XLTA 1TDOA 2VZ2A 2AR8A 3BNMA 4B63A 4U8OA 1DXLA 1FEBA 1W4XA 4CCRA 2BK4A 3H4KA 2Y6RA 1RSGA 4JQ9A 4RG4A 1NENA 2XVJA 2GB0A 2XVEA 3NYCA 1BGJA 1GESA 4YKGA 2C76A 2XCGA 3V76A 1JEHA 1VG9A 1E1KA 2X8CA 3I6DA 2GH5A 2ZZCA 3DMEA 1CC2A 2GR3A 1PXBA 4H4UA 4U8IA 1GRTA 3VRAA 1F6MA 1GPEA 3F8RA 1O95A 4RG3A 2Z5YA 1EL8A 2JB3A 1MXTA 1IJHA 4AP3A 4CNKA 4BK2A 5FMHA 4UDRA 2AQJA 3GRSA 3V3OA 1H6VA 2GMHA 1KSUA 2YLRA 3ALJA 3LZXA 4YXDA 4Z43A 3IHMA 1ZMDA 2QCUA 3Q9TA 4B67A 3CGCA 4JY2A 1GRHA 2YVGA 4EQRA 2ZZ0A 4X4JA 2BCGG 1CC4A 3SGLA 1NG3A 2V61A 2XFOA 3DJEA 2BC0A 1H7XA 1QJDA 2R0CA 1PJ7A 3C4NA 3NN0X 5GRTA 4H4SA 2C66A 1TDEA 4NEWA 4Z44A 2QA2A 2JKCA 4H4ZA 4C3XA 5BRTA 2GV8A 4D04A 1PBBA 1IUVA 4A65A 1LVLA 3S61A 4EMIA 2C70A 2BK5A 4YT0A 1KNPA 2RGOA 4K22A 3REDA 3BHKA 3PS9A 3P4PA 3QSEA 1NEKA 3UTHA 4A6NB 1DJQA 2GQWA 2UZZA 3AEBA 1GT8A 4GR1A 1AOGA 2F5ZA 4LA1A 2JBVA 4OPTA 4H4TA 1PBDA 1D7LA 1JOAA 2H88A 4TM3A 1K0LA 3AE1A 3P1WA 5FS6A 2ARDA 2Z5XA 1YQ3A 2XFNA 2Q6UA 4KPRA 2WQYA 3NK0X 3L8KA 4M52A 3UTGA 4CY8A 1LQTA 2QAEA 1GETA 2WETA 3AWIA 5DBJA 1BKWA 1RYIA 1B8SA 1PN0A 2BXRA 1F8RA 4GDPA 3KPFA 4OPCA 2C3CA 3P9UA 4B1BA 3IC9A 3I3LA 1IUXA 3NK1X 3UTFA 2WOWA 1D4DA 2NPXA 2WS3A 4OVIA 3NT6A 2IVDA 2NVKX 1Y56B 4B66A 4U8PA 3P4QA 3O0HA 4NTCA 2W0HA 3PVCA 1NAAA 2GAHB 3NHOX 3SFDA 2GRTA 1LJ1A 2BK3A 2C72A 5KXJA 1EL5A 1XPQA 2WP5A 4U8LA 2YR6A 4C3YA 3GYIA 3AECA 3LZWA 1SEZA 2WP9A 4BJYA 3CNDA 4O5QA 1N4WA 3K7QX 4D03A 4ICYA 5U25A 3P4RA 5KWFA 3GSIA 4JN9A 4CRTA 1OJTA 3ZDNA 2R46A 4JNAA 4BK3A 1TDFA 2Q7VA 1GRAA 3KLJA 5TR3A 4XWRA 2CDUA 3AEDA 3ATRA 3DJJA 4APNA 1GXFA 2WESA 1IUTA 2BS3A 1S3BA 1PJ5A 2V3BA 1BGNA 3T37A 1P2HA 3IF9A 4H4VA 4J56A 2PYXA 2XLPA 3FG2P 4P9SA 5U63A 1E7PA 1JRZA 4GUVA 3UKFA 4A7AA 1PS9A 3EANA 2WDVA 3ICSA 1E39A 5C2TA 1K0IA 3UKQA 4YTPA 4NZHA 2YR5A 3ALMA 2X8HA 5FS7A 4OCGA 1ZOVA 3UKAA 4IVOB 4YKFA 4CCQA 2YQUA 2I0ZA 4YSZA 4EIQA 2ACZA 5KVIA 1CF3A 5BULA 2A87A 5M10A 2X3NA 4Z26A 5C3JA 1F8WA 2JAEA 3LADA 2CFYA 3B6DA 2B76A 2WDQA 3EPTA 1GREA 3AE4A 1M64A 4NTDA 4WCTA 3GD3A 1NHRA 3GDPA 3JSKA 4A5LA 2HQMA 2Q0KA 1Y56A 1DNCA 5IQ4A 1E1NA 4EMJA 4PABA 1TYTA 4Y4MA 1JNZA 1GALA 2C64A 4K7ZA 1L9CA 1P2EA 2Q0LA 4H2NA 4XXGA 2XVIA 5BUKA 4EQSA 3ABVA 1EL7A 1OJ9A 3AEFA 1PBCA 3BI4A 4GCMA 4XWZA 3AD7B 3NTAA 4AOSA 4NEVA 4EM3A 3VRDB 5FS9A 4LIIA 1GEUA 2FJEA 1GTHA 3IHGA 1FCDA 2XYOA 1N4UA 4H4PA 2JB1A 4JY3A 1B4VA 1N1PA 3CNPA 4OPUA 1K4QA 1MO9A 4A6NA 4TM1A 3UP5A
chains in the Genus database with same CATH superfamily
1S2QA 1GRFA 4OPLA 2YWLA 4ADWA 5U1OA 3COXA 2AAQA 4C5OA 1O5WA 4G6GA 3BI2A 2OAMA 4BURA 5JCMA 2VQBA 4X9MA 3KD9A 1GRBA 3M0OA 3HYWA 3NG7X 3AEAA 3M12A 4IA6A 3CGDA 3KU9A 3NKSA 1S2YA 1VDCA 1XDIA 4HA6A 1N4VA 3AYLA 3DK4A 4IVMB 3NH3X 4N9XA 4UDPA 3ATQA 4H4XA 1CL0A 4I58A 1LV0A 2YLSA 2C4CA 3CGBA 3UCLA 2WOIA 3EAOA 3FPZA 4AOXA 1BF3A 4YSXA 2YG7A 5HYMA 1IUSA 4U2SA 1NDAA 2XFPA 5M0ZA 1M6IA 3AYJA 4NNJA 3AE8A 3FIMB 2R0PA 2RGJA 1LQUA 2XVHA 3UKPA 4GAPA 3K30A 2WPFA 3ISHA 4Z2RA 5KRQA 1CJ4A 2R4EA 4OPGA 3G5SA 3II4A 2OLNA 3CPJG 2GQFA 1GERA 5LV9A 1E1LA 2TPRA 3H8LA 4B68A 1PXAA 3DK8A 1NHPA 5ER0A 1D4EA 1JU2A 4Y4NA 3BHFA 1FOHA 4H2RA 4DNAA 2BYBA 3H8IA 1FEAA 3CNJA 3QJ4A 3VRBA 4K2XA 3UTEA 4G9KA 4X9NA 4IV9A 4BV6A 3Q6JA 3FMWA 1H83A 1YY5A 2FJBA 3B3RA 4J33A 2B7SA 4DSHA 3ALLA 4BJZA 3DJDA 3CGEA 4EMWA 1D5TA 4ZCCA 1ZMCA 4H50A 1S3EA 4TM4A 2C73A 3AD8B 2YR4A 1ZP0A 4B64A 4LU6A 1COYA 3S5WA 2XDOA 5HY5A 2FBWA 2VRMA 4B69A 1DJNA 2FJAA 4H7UA 1Q1RA 2V60A 3NLCA 4TLXA 3GWDA 2WPCA 4KX6A 3AXBA 1DOEA 1H81A 4J57A 4EIPA 2WOVA 3DK9A 3QFBA 1ZKQA 4O5UA 5EB5A 1L0VA 4H4YA 2B7RA 2R0GA 3CN8A 4USRA 1NHQA 1H82A 5JCIA 4Z25A 3GMCA 4B65A 4G73A 1YKJA 1KNRA 2YLXA 3SX6A 2TMDA 3AE7A 3HZLA 2BCPA 1TDNA 3NRNA 3CMMA 2CVJA 3SZFA 5BVAA 1V59A 3ZYXA 3BI5A 3CNTA 4JNQA 5IPYA 2RABA 3SZ0A 4H2QA 4U2LA 4YTNA 4C74A 2GMJA 3C96A 3UOYA 1TDKA 3GYJA 1F3PA 2YG6A 4K8DA 3AB1A 3DH9A 1GRGA 3AEEA 3HYXA 3G5RA 4U8JA 1B5QA 1ZK7A 1D7YA 3D1CA 2V3AA 1LTXR 2WU2A 5L46A 1CJ3A 2YAUA 2O9ZA 1CBOA 1DODA 1GV4A 3GDNA 1H84A 3NK2X 3GD4A 4H4WA 4Y4LA 2X8GA 3ICRA 3AE6A 2C65A 3AE3A 3UP4A 2PHHA 1TRBA 1Q1WA 2XLUA 2YVFA 1REOA 2ZZBA 3SM8A 1XANA 4YTMA 4H4QA 4I59A 4Z2UA 5FS8A 1KDGA 3OC4A 4J2WA 4U8KA 4AT0A 3P4SA 1ELIA 2YG5A 4NTEA 2OA1A 2WDRA 3GWFA 5KMRA 3FBSA 2WPEA 2A89A 2QA1A 4A99A 1OJCA 3KPKA 2GVCA 4EQXA 1ZDLA 1ZOYA 1QLBA 1XHCA 2OLOA 3UOZA 4GRTA 4BK1A 3UOXA 3CPHG 3R9UA 2IVEA 3LOVA 1OJDA 2XLSA 3K7MX 2JK6A 1NPXA 1UKVG 3BNUA 3CNSA 4K5RA 1CJCA 2XFUA 1X31B 2BS4A 3AE2A 3GMBA 4K5SA 1JRYA 3UKLA 4A79A 1H7WA 2WP6A 1VG0A 1YQZA 4CBQA 1B37A 1PHHA 3IWAA 1K0JA 1IUWA 5J7XA 5JCKA 3QVPA 1VQWA 3K7TA 1RP0A 1JRXA 2R45A 2EQ7A 1KFYA 3NTDA 1Q9IA 3C4AA 3CIRA 3M13A 3RNMA 3V3NA 2B9WA 1O94A 4MJWA 3AE5A 2EQ6A 1TYPA 3T2ZA 4Z2TA 2X99A 3SYIA 2YM1A 4EM4A 3T2KA 5JCNA 1ZY8A 2VOUA 2RGHA 2DKIA 4UP3A 5EBKA 2ZBWA 1JNRA 1NHSA 3AYIA 4FX9A 2IIDA 1EL9A 4RSLA 1OJAA 2J3NA 2R4JA 3CPIG 4GDEA 2GF3A 5KVHA 2GR0A 2Y6QA 1L9EA 1GSNA 2VVLG 1YQ4A 3WE0A 2APGA 3F8PA 2XLRA 4FDCB 3L1RA 2C67A 2YLTA 1GOSA 3D8XA 2BACA 1NG4A 4OPDA 4YSHA 2VRLA 2YG4A 4U2TA 4E0VA 4CY6A 4NWZA 3QVRA 2BS2A 2YLZA 3UOVA 1CJ2A 4C77A 3KA7A 3NYEA 4CNJA 3SQPA 4U8MA 1GTEA 5KMQA 2E1MA 4IA5A 4YSYA 4YWOA 2YG3A 1E6EA 1HYUA 2A8XA 1QO8A 2H89A 3KVEA 1FECA 2VQ7A 2C3DA 5J60A 5KOXA 4USQA 3NN6X 2B9XA 4H2PA 2CULA 4J34A 4TLZA 2WU5A 4PAAA 4AT2A 1PDHA 1CHUA 2VVLA 2C7GA 1PBEA 4DGKA 4EQWA 1BWCA 2FJDA 3ADAB 3DGHA 3QSMA 2XVFA 3URHA 1L9DA 2WHDA 2GR2A 2YM2A 3F8DA 1KSSA 5CKUA 1PBFA 3SY4A 3G5QA 3RP8A 1BZLA 5CQFA 3AE9A 3VQRA 3NGCX 5HHFA 4ECHA 3RP7A 2V6OA 2YVJA 1Z6LA 1DOCA 4H4RA 1PJ6A 1GNDA 4GF7A 3NYFA 2BA9A 4TM0A 4A9WA 2WEUA 2VVMA 3AD9B 4II2A 3VR8A 4ZCDA 3AEGA 4AP1A 3LXDA 3OZ2A 2JB2A 3NNEA 3PO7A 3DA1A 1F8SA 2E5VA 3HYVA 1MOKA 3DGZA 2B9YA 3QSSA 3RP6A 5GSNA 1LPFA 4U8NA 2YLWA 5IQ1A 2E4GA 2BXSA 2WBAA 3GRTA 3QFAA 1FL2A 2DKHA 1Y0PA 3CTYA 2C75A 5KMSA 3EF6A 5EB4A 3LJPA 4OPIA 2GR1A 3KKJA 1ONFA 1VRQB 3UKHA 3SFEA 4FK1A 5HXIA 2BRYA 2GEWA 4JDRA 4FK1C 2EQ8A 1CC6A 1H86A 1EBDA 2X50A 4J31A 5EOWA 1E1MA 3ICTA 3E1TA 4WX1A 2V5ZA 3RHAA 1IUUA 4UDQA 2EQ9A 3NIXA 4J36A 4Z24A 1D4CA 5KOWA 4HB9A 2GAGB 2OALA 3DJGX 1ZX9A 4REKA 4ZN0A 2XFQA 1PXCA 3VR9A 3LB8A 1DOBA 5JCLA 3ITJA 2R9ZA 1KF6A 2BC1A 4DSGA 3UKKA 2BABA 2XLTA 1TDOA 2BRAA 2VZ2A 2AR8A 3BNMA 4B63A 4U8OA 1DXLA 1FEBA 1W4XA 4CCRA 2BK4A 3H4KA 2Y6RA 1RSGA 4JQ9A 4RG4A 1NENA 2XVJA 2GB0A 2XVEA 3NYCA 1BGJA 1GESA 3SZWA 4YKGA 2C76A 2XCGA 3V76A 1JEHA 1VG9A 1E1KA 2X8CA 3I6DA 2GH5A 3SZCA 2ZZCA 3DMEA 1CC2A 2GR3A 1PXBA 4H4UA 4U8IA 1GRTA 3VRAA 1F6MA 1GPEA 3F8RA 1O95A 4RG3A 2Z5YA 1EL8A 2JB3A 1MXTA 1IJHA 4AP3A 4CNKA 4BK2A 5FMHA 4UDRA 2AQJA 3GRSA 3V3OA 1H6VA 2GMHA 1KSUA 2YLRA 3ALJA 3LZXA 4YXDA 4Z43A 3IHMA 1ZMDA 2QCUA 3Q9TA 4B67A 3CGCA 4JY2A 1GRHA 2YVGA 4EQRA 2ZZ0A 4X4JA 2BCGG 1CC4A 3SGLA 1NG3A 2V61A 2XFOA 3DJEA 2BC0A 1H7XA 1QJDA 2R0CA 1PJ7A 3C4NA 3NN0X 5GRTA 4H4SA 2C66A 1TDEA 4NEWA 4Z44A 3SXIA 2QA2A 2JKCA 4H4ZA 4C3XA 5BRTA 2GV8A 4D04A 1PBBA 1IUVA 4A65A 5KNLA 1LVLA 3S61A 4EMIA 2C70A 2BK5A 4YT0A 1KNPA 2RGOA 4K22A 3REDA 3BHKA 3PS9A 3P4PA 3QSEA 1NEKA 3UTHA 4A6NB 1DJQA 2GQWA 2UZZA 3AEBA 1GT8A 4GR1A 1AOGA 2F5ZA 4LA1A 2JBVA 4GAVA 4OPTA 4H4TA 1PBDA 1D7LA 1JOAA 2H88A 4TM3A 1K0LA 3AE1A 3P1WA 5FS6A 2ARDA 2Z5XA 1YQ3A 2XFNA 2Q6UA 4KPRA 2WQYA 3NK0X 3L8KA 4M52A 3UTGA 4CY8A 1LQTA 2QAEA 1GETA 4G74A 2WETA 3AWIA 5DBJA 1BKWA 4II3A 1RYIA 1B8SA 1PN0A 2BXRA 1F8RA 3T0KA 4GDPA 3KPFA 4OPCA 2C3CA 3P9UA 4B1BA 3IC9A 3I3LA 1IUXA 3NK1X 3UTFA 2WOWA 1D4DA 2NPXA 2WS3A 4OVIA 3NT6A 2IVDA 2NVKX 1Y56B 4B66A 4U8PA 3P4QA 3O0HA 4NTCA 2W0HA 3PVCA 1NAAA 2GAHB 3NHOX 3SFDA 2GRTA 1LJ1A 2BK3A 2C72A 5KXJA 1EL5A 1XPQA 2WP5A 4U8LA 2YR6A 4C3YA 3GYIA 3AECA 3LZWA 1SEZA 2WP9A 4BJYA 3CNDA 4O5QA 1N4WA 3K7QX 4D03A 4ICYA 5U25A 3P4RA 5KWFA 3GSIA 4JN9A 4CRTA 1OJTA 3ZDNA 2R46A 4JNAA 4BK3A 1TDFA 2Q7VA 3GYXA 1GRAA 3KLJA 5TR3A 4XWRA 2CDUA 3AEDA 3ATRA 3DJJA 4APNA 1GXFA 2WESA 1IUTA 2BS3A 1S3BA 1PJ5A 2V3BA 1BGNA 3T37A 1P2HA 3IF9A 4H4VA 4J56A 2PYXA 2XLPA 5KMPA 3FG2P 4P9SA 5U63A 1E7PA 1JRZA 4GUVA 3UKFA 4A7AA 1PS9A 3EANA 2WDVA 3ICSA 1E39A 5C2TA 1K0IA 3UKQA 4YTPA 4NZHA 2YR5A 3ALMA 2X8HA 5FS7A 4OCGA 1ZOVA 3UKAA 4IVOB 4YKFA 4CCQA 2YQUA 2I0ZA 4YSZA 4EIQA 2ACZA 5KVIA 1CF3A 3T14A 5BULA 2A87A 5M10A 2X3NA 4Z26A 5C3JA 1F8WA 2JAEA 3LADA 2CFYA 3B6DA 2B76A 3T31A 2WDQA 3EPTA 1GREA 3AE4A 1M64A 4NTDA 4WCTA 3GD3A 1NHRA 3GDPA 3JSKA 4A5LA 2HQMA 2Q0KA 1Y56A 1DNCA 5IQ4A 1E1NA 4EMJA 4PABA 1TYTA 4Y4MA 1JNZA 1GALA 2C64A 4K7ZA 1L9CA 1P2EA 2Q0LA 4H2NA 4XXGA 2XVIA 5BUKA 4EQSA 4G6HA 3ABVA 1EL7A 1OJ9A 3AEFA 1PBCA 3BI4A 4GCMA 4XWZA 3AD7B 3NTAA 4AOSA 4NEVA 4EM3A 3VRDB 3T2YA 5FS9A 4LIIA 1GEUA 2FJEA 1GTHA 3IHGA 1FCDA 2XYOA 1N4UA 4H4PA 2JB1A 4JY3A 1B4VA 1N1PA 3CNPA 4OPUA 1K4QA 1MO9A 4A6NA 4TM1A 3UP5A
chains in the Genus database with same CATH topology
1S2QA 1GRFA 4OPLA 2YWLA 4ADWA 5U1OA 3COXA 2AAQA 4C5OA 1O5WA 4G6GA 3BI2A 2OAMA 4BURA 5JCMA 2VQBA 4X9MA 3KD9A 1GRBA 3M0OA 3HYWA 3NG7X 3AEAA 3M12A 4IA6A 3CGDA 3KU9A 3NKSA 1S2YA 1VDCA 1XDIA 4HA6A 1N4VA 3AYLA 3DK4A 4IVMB 3NH3X 4N9XA 4UDPA 3ATQA 4H4XA 1CL0A 4I58A 1LV0A 2YLSA 2C4CA 3CGBA 3UCLA 2WOIA 3EAOA 3FPZA 4AOXA 1BF3A 4YSXA 2YG7A 5HYMA 1IUSA 4U2SA 1NDAA 2XFPA 5M0ZA 1M6IA 3AYJA 4NNJA 3AE8A 3FIMB 2R0PA 2RGJA 1LQUA 2XVHA 3UKPA 4GAPA 3K30A 2WPFA 3ISHA 4Z2RA 5KRQA 1CJ4A 2R4EA 4OPGA 3G5SA 3II4A 2OLNA 3CPJG 2GQFA 1GERA 5LV9A 1E1LA 2TPRA 3H8LA 4B68A 1PXAA 3DK8A 1NHPA 5ER0A 1D4EA 1JU2A 4Y4NA 3BHFA 1FOHA 4H2RA 4DNAA 2BYBA 3H8IA 1FEAA 3CNJA 3QJ4A 3VRBA 4K2XA 3UTEA 4G9KA 4X9NA 4IV9A 4BV6A 3Q6JA 3FMWA 1H83A 1YY5A 2FJBA 3B3RA 4J33A 2B7SA 4DSHA 3ALLA 4BJZA 3DJDA 3CGEA 4EMWA 1D5TA 4ZCCA 1ZMCA 4H50A 1S3EA 4TM4A 2C73A 3AD8B 2YR4A 1ZP0A 4B64A 4LU6A 1COYA 3S5WA 2XDOA 5HY5A 2FBWA 2VRMA 4B69A 1DJNA 2FJAA 4H7UA 1Q1RA 2V60A 3NLCA 4TLXA 3GWDA 2WPCA 4KX6A 3AXBA 1DOEA 1H81A 4J57A 4EIPA 2WOVA 3DK9A 3QFBA 1ZKQA 4O5UA 5EB5A 1L0VA 4H4YA 2B7RA 2R0GA 3CN8A 4USRA 1NHQA 1H82A 5JCIA 4Z25A 3GMCA 4B65A 4G73A 1YKJA 1KNRA 2YLXA 3SX6A 2TMDA 3AE7A 3HZLA 2BCPA 1TDNA 3NRNA 3CMMA 2CVJA 3SZFA 5BVAA 1V59A 3ZYXA 3BI5A 3CNTA 4JNQA 5IPYA 2RABA 3SZ0A 4H2QA 4U2LA 4YTNA 4C74A 2GMJA 3C96A 3UOYA 1TDKA 3GYJA 1F3PA 2YG6A 4K8DA 3AB1A 3DH9A 1GRGA 3AEEA 3HYXA 3G5RA 4U8JA 1B5QA 1ZK7A 1D7YA 3D1CA 2V3AA 1LTXR 2WU2A 5L46A 1CJ3A 2YAUA 2O9ZA 1CBOA 1DODA 1GV4A 3GDNA 1H84A 3NK2X 3GD4A 4H4WA 4Y4LA 2X8GA 3ICRA 3AE6A 2C65A 3AE3A 3UP4A 2PHHA 1TRBA 1Q1WA 2XLUA 2YVFA 1REOA 2ZZBA 3SM8A 1XANA 4YTMA 4H4QA 4I59A 4Z2UA 5FS8A 1KDGA 3OC4A 4J2WA 4U8KA 4AT0A 3P4SA 1ELIA 2YG5A 4NTEA 2OA1A 2WDRA 3GWFA 5KMRA 3FBSA 2WPEA 2A89A 2QA1A 4A99A 1OJCA 3KPKA 2GVCA 4EQXA 1ZDLA 1ZOYA 1QLBA 1XHCA 2OLOA 3UOZA 4GRTA 4BK1A 3UOXA 3CPHG 3R9UA 2IVEA 3LOVA 1OJDA 2XLSA 3K7MX 2JK6A 1NPXA 1UKVG 3BNUA 3CNSA 4K5RA 1CJCA 2XFUA 1X31B 2BS4A 3AE2A 3GMBA 4K5SA 1JRYA 3UKLA 4A79A 1H7WA 2WP6A 1VG0A 1YQZA 4CBQA 1B37A 1PHHA 3IWAA 1K0JA 1IUWA 5J7XA 5JCKA 3QVPA 1VQWA 3K7TA 1RP0A 1JRXA 2R45A 2EQ7A 1KFYA 3NTDA 1Q9IA 3C4AA 3CIRA 3M13A 3RNMA 3V3NA 2B9WA 1O94A 4MJWA 3AE5A 2EQ6A 1TYPA 3T2ZA 4Z2TA 2X99A 3SYIA 2YM1A 4EM4A 3T2KA 5JCNA 1ZY8A 2VOUA 2RGHA 2DKIA 4UP3A 5EBKA 2ZBWA 1JNRA 1NHSA 3AYIA 4FX9A 2IIDA 1EL9A 4RSLA 1OJAA 2J3NA 2R4JA 3CPIG 4GDEA 2GF3A 5KVHA 2GR0A 2Y6QA 1L9EA 1GSNA 2VVLG 1YQ4A 3WE0A 2APGA 3F8PA 2XLRA 4FDCB 3L1RA 2C67A 2YLTA 1GOSA 3D8XA 2BACA 1NG4A 4OPDA 4YSHA 2VRLA 2YG4A 4U2TA 4E0VA 4CY6A 4NWZA 3QVRA 2BS2A 2YLZA 3UOVA 1CJ2A 4C77A 3KA7A 3NYEA 4CNJA 3SQPA 4U8MA 1GTEA 5KMQA 2E1MA 4IA5A 4YSYA 4YWOA 2YG3A 1E6EA 1HYUA 2A8XA 1QO8A 2H89A 3KVEA 1FECA 2VQ7A 2C3DA 5J60A 5KOXA 4USQA 3NN6X 2B9XA 4H2PA 2CULA 4J34A 4TLZA 2WU5A 4PAAA 4AT2A 1PDHA 1CHUA 2VVLA 2C7GA 1PBEA 4DGKA 4EQWA 1BWCA 2FJDA 3ADAB 3DGHA 3QSMA 2XVFA 3URHA 1L9DA 2WHDA 2GR2A 2YM2A 3F8DA 1KSSA 5CKUA 1PBFA 3SY4A 3G5QA 3RP8A 1BZLA 5CQFA 3AE9A 3VQRA 3NGCX 5HHFA 4ECHA 3RP7A 2V6OA 2YVJA 1Z6LA 1DOCA 4H4RA 1PJ6A 1GNDA 4GF7A 3NYFA 2BA9A 4TM0A 4A9WA 2WEUA 2VVMA 3AD9B 4II2A 3VR8A 4ZCDA 3AEGA 4AP1A 3LXDA 3OZ2A 2JB2A 3NNEA 3PO7A 3DA1A 1F8SA 2E5VA 3HYVA 1MOKA 3DGZA 2B9YA 3QSSA 3RP6A 5GSNA 1LPFA 4U8NA 2YLWA 5IQ1A 2E4GA 2BXSA 2WBAA 3GRTA 3QFAA 1FL2A 2DKHA 1Y0PA 3CTYA 2C75A 5KMSA 3EF6A 5EB4A 3LJPA 4OPIA 2GR1A 3KKJA 1ONFA 1VRQB 3UKHA 3SFEA 4FK1A 5HXIA 2BRYA 2GEWA 4JDRA 4FK1C 2EQ8A 1CC6A 1H86A 1EBDA 2X50A 4J31A 5EOWA 1E1MA 3ICTA 3E1TA 4WX1A 2V5ZA 3RHAA 1IUUA 4UDQA 2EQ9A 3NIXA 4J36A 4Z24A 1D4CA 5KOWA 4HB9A 2GAGB 2OALA 3DJGX 1ZX9A 4REKA 4ZN0A 2XFQA 1PXCA 3VR9A 3LB8A 1DOBA 5JCLA 3ITJA 2R9ZA 1KF6A 2BC1A 4DSGA 3UKKA 2BABA 2XLTA 1TDOA 2BRAA 2VZ2A 2AR8A 3BNMA 4B63A 4U8OA 1DXLA 1FEBA 1W4XA 4CCRA 2BK4A 3H4KA 2Y6RA 1RSGA 4JQ9A 4RG4A 1NENA 2XVJA 2GB0A 2XVEA 3NYCA 1BGJA 1GESA 3SZWA 4YKGA 2C76A 2XCGA 3V76A 1JEHA 1VG9A 1E1KA 2X8CA 3I6DA 2GH5A 3SZCA 2ZZCA 3DMEA 1CC2A 2GR3A 1PXBA 4H4UA 4U8IA 1GRTA 3VRAA 1F6MA 1GPEA 3F8RA 1O95A 4RG3A 2Z5YA 1EL8A 2JB3A 1MXTA 1IJHA 4AP3A 4CNKA 4BK2A 5FMHA 4UDRA 2AQJA 3GRSA 3V3OA 1H6VA 2GMHA 1KSUA 2YLRA 3ALJA 3LZXA 4YXDA 4Z43A 3IHMA 1ZMDA 2QCUA 3Q9TA 4B67A 3CGCA 4JY2A 1GRHA 2YVGA 4EQRA 2ZZ0A 4X4JA 2BCGG 1CC4A 3SGLA 1NG3A 2V61A 2XFOA 3DJEA 2BC0A 1H7XA 1QJDA 2R0CA 1PJ7A 3C4NA 3NN0X 5GRTA 4H4SA 2C66A 1TDEA 4NEWA 4Z44A 3SXIA 2QA2A 2JKCA 4H4ZA 4C3XA 5BRTA 2GV8A 4D04A 1PBBA 1IUVA 4A65A 5KNLA 1LVLA 3S61A 4EMIA 2C70A 2BK5A 4YT0A 1KNPA 2RGOA 4K22A 3REDA 3BHKA 3PS9A 3P4PA 3QSEA 1NEKA 3UTHA 4A6NB 1DJQA 2GQWA 2UZZA 3AEBA 1GT8A 4GR1A 1AOGA 2F5ZA 4LA1A 2JBVA 4GAVA 4OPTA 4H4TA 1PBDA 1D7LA 1JOAA 2H88A 4TM3A 1K0LA 3AE1A 3P1WA 5FS6A 2ARDA 2Z5XA 1YQ3A 2XFNA 2Q6UA 4KPRA 2WQYA 3NK0X 3L8KA 4M52A 3UTGA 4CY8A 1LQTA 2QAEA 1GETA 4G74A 2WETA 3AWIA 5DBJA 1BKWA 4II3A 1RYIA 1B8SA 1PN0A 2BXRA 1F8RA 3T0KA 4GDPA 3KPFA 4OPCA 2C3CA 3P9UA 4B1BA 3IC9A 3I3LA 1IUXA 3NK1X 3UTFA 2WOWA 1D4DA 2NPXA 2WS3A 4OVIA 3NT6A 2IVDA 2NVKX 1Y56B 4B66A 4U8PA 3P4QA 3O0HA 4NTCA 2W0HA 3PVCA 1NAAA 2GAHB 3NHOX 3SFDA 2GRTA 1LJ1A 2BK3A 2C72A 5KXJA 1EL5A 1XPQA 2WP5A 4U8LA 2YR6A 4C3YA 3GYIA 3AECA 3LZWA 1SEZA 2WP9A 4BJYA 3CNDA 4O5QA 1N4WA 3K7QX 4D03A 4ICYA 5U25A 3P4RA 5KWFA 3GSIA 4JN9A 4CRTA 1OJTA 3ZDNA 2R46A 4JNAA 4BK3A 1TDFA 2Q7VA 3GYXA 1GRAA 3KLJA 5TR3A 4XWRA 2CDUA 3AEDA 3ATRA 3DJJA 4APNA 1GXFA 2WESA 1IUTA 2BS3A 1S3BA 1PJ5A 2V3BA 1BGNA 3T37A 1P2HA 3IF9A 4H4VA 4J56A 2PYXA 2XLPA 5KMPA 3FG2P 4P9SA 5U63A 1E7PA 1JRZA 4GUVA 3UKFA 4A7AA 1PS9A 3EANA 2WDVA 3ICSA 1E39A 5C2TA 1K0IA 3UKQA 4YTPA 4NZHA 2YR5A 3ALMA 2X8HA 5FS7A 4OCGA 1ZOVA 3UKAA 4IVOB 4YKFA 4CCQA 2YQUA 2I0ZA 4YSZA 4EIQA 2ACZA 5KVIA 1CF3A 3T14A 5BULA 2A87A 5M10A 2X3NA 4Z26A 5C3JA 1F8WA 2JAEA 3LADA 2CFYA 3B6DA 2B76A 3T31A 2WDQA 3EPTA 1GREA 3AE4A 1M64A 4NTDA 4WCTA 3GD3A 1NHRA 3GDPA 3JSKA 4A5LA 2HQMA 2Q0KA 1Y56A 1DNCA 5IQ4A 1E1NA 4EMJA 4PABA 1TYTA 4Y4MA 1JNZA 1GALA 2C64A 4K7ZA 1L9CA 1P2EA 2Q0LA 4H2NA 4XXGA 2XVIA 5BUKA 4EQSA 4G6HA 3ABVA 1EL7A 1OJ9A 3AEFA 1PBCA 3BI4A 4GCMA 4XWZA 3AD7B 3NTAA 4AOSA 4NEVA 4EM3A 3VRDB 3T2YA 5FS9A 4LIIA 1GEUA 2FJEA 1GTHA 3IHGA 1FCDA 2XYOA 1N4UA 4H4PA 2JB1A 4JY3A 1B4VA 1N1PA 3CNPA 4OPUA 1K4QA 1MO9A 4A6NA 4TM1A 3UP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S2Q A;  1GRF A;  4OPL A;  2YWL A;  4ADW A;  5U1O A;  3COX A;  2AAQ A;  4C5O A;  1O5W A;  3BI2 A;  2OAM A;  4BUR A;  5JCM A;  2VQB A;  4X9M A;  3KD9 A;  1GRB A;  3M0O A;  3NG7 X;  3AEA A;  3M12 A;  4IA6 A;  3CGD A;  3KU9 A;  3NKS A;  1S2Y A;  1VDC A;  1XDI A;  4HA6 A;  1N4V A;  3AYL A;  3DK4 A;  4IVM B;  3NH3 X;  4N9X A;  4UDP A;  3ATQ A;  4H4X A;  1CL0 A;  4I58 A;  1LV0 A;  2YLS A;  3CGB A;  3UCL A;  2WOI A;  3EAO A;  3FPZ A;  4AOX A;  1BF3 A;  4YSX A;  2YG7 A;  5HYM A;  1IUS A;  4U2S A;  1NDA A;  2XFP A;  5M0Z A;  1M6I A;  3AYJ A;  3AE8 A;  3FIM B;  2R0P A;  2RGJ A;  1LQU A;  2XVH A;  3UKP A;  4Z2R A;  3K30 A;  2WPF A;  3ISH A;  5KRQ A;  1CJ4 A;  2R4E A;  4OPG A;  3G5S A;  3II4 A;  2OLN A;  3CPJ G;  2GQF A;  1GER A;  5LV9 A;  1E1L A;  2TPR A;  3H8L A;  4B68 A;  1PXA A;  3DK8 A;  1NHP A;  5ER0 A;  1D4E A;  1JU2 A;  4Y4N A;  3BHF A;  1FOH A;  4H2R A;  4DNA A;  2BYB A;  3H8I A;  1FEA A;  3CNJ A;  3QJ4 A;  3VRB A;  4K2X A;  3UTE A;  4X9N A;  4IV9 A;  4BV6 A;  3Q6J A;  3FMW A;  1H83 A;  1YY5 A;  2FJB A;  3B3R A;  4J33 A;  2B7S A;  4DSH A;  3ALL A;  4BJZ A;  3DJD A;  3CGE A;  4EMW A;  1D5T A;  4ZCC A;  1ZMC A;  4H50 A;  1S3E A;  4TM4 A;  2C73 A;  3AD8 B;  2YR4 A;  1ZP0 A;  4B64 A;  4LU6 A;  1COY A;  3S5W A;  2XDO A;  5HY5 A;  2FBW A;  2VRM A;  4B69 A;  1DJN A;  2FJA A;  4H7U A;  1Q1R A;  2V60 A;  3NLC A;  4TLX A;  3GWD A;  2WPC A;  4KX6 A;  3AXB A;  1DOE A;  1H81 A;  4J57 A;  4EIP A;  2WOV A;  3DK9 A;  3QFB A;  1ZKQ A;  4O5U A;  5EB5 A;  1L0V A;  4H4Y A;  2B7R A;  2R0G A;  3CN8 A;  4USR A;  1NHQ A;  1H82 A;  5JCI A;  4Z25 A;  3GMC A;  4B65 A;  1YKJ A;  1KNR A;  2YLX A;  2TMD A;  3AE7 A;  3HZL A;  2BCP A;  1TDN A;  3NRN A;  2CVJ A;  5BVA A;  1V59 A;  3ZYX A;  3BI5 A;  3CNT A;  4JNQ A;  5IPY A;  2RAB A;  4H2Q A;  4U2L A;  4YTN A;  4C74 A;  2GMJ A;  3C96 A;  3UOY A;  1TDK A;  3GYJ A;  1F3P A;  2YG6 A;  4K8D A;  3AB1 A;  3DH9 A;  1GRG A;  3AEE A;  4U8J A;  3G5R A;  1B5Q A;  1ZK7 A;  1D7Y A;  3D1C A;  2V3A A;  1LTX R;  2WU2 A;  5L46 A;  1CJ3 A;  2YAU A;  2O9Z A;  1CBO A;  1DOD A;  1GV4 A;  3GDN A;  1H84 A;  3NK2 X;  3GD4 A;  4H4W A;  4Y4L A;  2X8G A;  3ICR A;  3AE6 A;  2C65 A;  3AE3 A;  3UP4 A;  2PHH A;  1TRB A;  1Q1W A;  2XLU A;  2YVF A;  1REO A;  2ZZB A;  3SM8 A;  1XAN A;  4YTM A;  4H4Q A;  4I59 A;  4Z2U A;  5FS8 A;  1KDG A;  3OC4 A;  4J2W A;  4U8K A;  4AT0 A;  3P4S A;  1ELI A;  2YG5 A;  4NTE A;  2OA1 A;  2WDR A;  3GWF A;  3FBS A;  2WPE A;  2A89 A;  2QA1 A;  4A99 A;  1OJC A;  2GVC A;  4EQX A;  1ZDL A;  1ZOY A;  1QLB A;  1XHC A;  2OLO A;  3UOZ A;  4GRT A;  4BK1 A;  3UOX A;  3CPH G;  3R9U A;  2IVE A;  3LOV A;  1OJD A;  2XLS A;  3K7M X;  2JK6 A;  1NPX A;  1UKV G;  3BNU A;  3CNS A;  4K5R A;  1CJC A;  2XFU A;  1X31 B;  2BS4 A;  3AE2 A;  3GMB A;  4K5S A;  1JRY A;  3UKL A;  4A79 A;  1H7W A;  2WP6 A;  1VG0 A;  1YQZ A;  4CBQ A;  1B37 A;  1PHH A;  3IWA A;  1K0J A;  1IUW A;  5J7X A;  5JCK A;  3QVP A;  1VQW A;  3K7T A;  1RP0 A;  1JRX A;  2R45 A;  2EQ7 A;  1KFY A;  3NTD A;  1Q9I A;  3C4A A;  3CIR A;  3M13 A;  3RNM A;  3V3N A;  2B9W A;  1O94 A;  4MJW A;  3AE5 A;  2EQ6 A;  1TYP A;  4Z2T A;  2X99 A;  2YM1 A;  4EM4 A;  5JCN A;  1ZY8 A;  2VOU A;  2RGH A;  2DKI A;  4UP3 A;  5EBK A;  2ZBW A;  1JNR A;  1NHS A;  3AYI A;  4FX9 A;  2IID A;  1EL9 A;  4RSL A;  1OJA A;  2J3N A;  2R4J A;  3CPI G;  4GDE A;  2GF3 A;  5KVH A;  2GR0 A;  2Y6Q A;  1L9E A;  1GSN A;  2VVL G;  1YQ4 A;  3WE0 A;  2APG A;  3F8P A;  2XLR A;  4FDC B;  3L1R A;  2C67 A;  2YLT A;  1GOS A;  3D8X A;  2BAC A;  1NG4 A;  4OPD A;  4YSH A;  2VRL A;  2YG4 A;  4U2T A;  4E0V A;  4CY6 A;  3QVR A;  2BS2 A;  2YLZ A;  3UOV A;  1CJ2 A;  4C77 A;  3KA7 A;  3NYE A;  4CNJ A;  3SQP A;  4U8M A;  1GTE A;  2E1M A;  4IA5 A;  4YSY A;  4YWO A;  2YG3 A;  1E6E A;  1HYU A;  2A8X A;  1QO8 A;  2H89 A;  3KVE A;  1FEC A;  2VQ7 A;  2C3D A;  5J60 A;  5KOX A;  4USQ A;  3NN6 X;  2B9X A;  4H2P A;  2CUL A;  4J34 A;  4TLZ A;  2WU5 A;  4PAA A;  4AT2 A;  1PDH A;  1CHU A;  2VVL A;  2C7G A;  1PBE A;  4DGK A;  4EQW A;  1BWC A;  2FJD A;  3ADA B;  3DGH A;  3QSM A;  2XVF A;  3URH A;  1L9D A;  2WHD A;  2GR2 A;  2YM2 A;  3F8D A;  1KSS A;  5CKU A;  1PBF A;  3G5Q A;  3RP8 A;  1BZL A;  5CQF A;  3AE9 A;  3VQR A;  3NGC X;  5HHF A;  4ECH A;  3RP7 A;  2V6O A;  2YVJ A;  1Z6L A;  1DOC A;  4H4R A;  1PJ6 A;  1GND A;  4GF7 A;  3NYF A;  2BA9 A;  4TM0 A;  4A9W A;  2WEU A;  2VVM A;  3AD9 B;  3VR8 A;  4ZCD A;  3AEG A;  4AP1 A;  3LXD A;  3OZ2 A;  2JB2 A;  3NNE A;  3PO7 A;  3DA1 A;  1F8S A;  2E5V A;  1MOK A;  3DGZ A;  2B9Y A;  3QSS A;  3RP6 A;  5GSN A;  1LPF A;  4U8N A;  2YLW A;  5IQ1 A;  2E4G A;  2BXS A;  2WBA A;  3GRT A;  3QFA A;  1FL2 A;  2DKH A;  1Y0P A;  3CTY A;  2C75 A;  3EF6 A;  5EB4 A;  3LJP A;  4OPI A;  2GR1 A;  3KKJ A;  1ONF A;  1VRQ B;  3UKH A;  3SFE A;  4FK1 A;  5HXI A;  2GEW A;  4JDR A;  4FK1 C;  2EQ8 A;  1CC6 A;  1H86 A;  1EBD A;  2X50 A;  4J31 A;  5EOW A;  1E1M A;  3ICT A;  3E1T A;  4WX1 A;  2V5Z A;  3RHA A;  1IUU A;  4UDQ A;  2EQ9 A;  3NIX A;  4J36 A;  4Z24 A;  1D4C A;  5KOW A;  4HB9 A;  2GAG B;  2OAL A;  3DJG X;  1ZX9 A;  4REK A;  4ZN0 A;  2XFQ A;  1PXC A;  3VR9 A;  3LB8 A;  1DOB A;  5JCL A;  3ITJ A;  2R9Z A;  1KF6 A;  2BC1 A;  4DSG A;  3UKK A;  2BAB A;  2XLT A;  1TDO A;  2VZ2 A;  2AR8 A;  3BNM A;  4B63 A;  4U8O A;  1DXL A;  1FEB A;  1W4X A;  4CCR A;  2BK4 A;  3H4K A;  2Y6R A;  1RSG A;  4JQ9 A;  4RG4 A;  1NEN A;  2XVJ A;  2GB0 A;  2XVE A;  3NYC A;  1BGJ A;  1GES A;  4YKG A;  2C76 A;  2XCG A;  3V76 A;  1JEH A;  1VG9 A;  1E1K A;  2X8C A;  3I6D A;  2GH5 A;  2ZZC A;  3DME A;  1CC2 A;  2GR3 A;  1PXB A;  4H4U A;  4U8I A;  1GRT A;  3VRA A;  1F6M A;  1GPE A;  3F8R A;  1O95 A;  4RG3 A;  2Z5Y A;  1EL8 A;  2JB3 A;  1MXT A;  1IJH A;  4AP3 A;  4CNK A;  4BK2 A;  5FMH A;  4UDR A;  2AQJ A;  3GRS A;  3V3O A;  1H6V A;  2GMH A;  1KSU A;  2YLR A;  3ALJ A;  3LZX A;  4YXD A;  4Z43 A;  3IHM A;  1ZMD A;  2QCU A;  3Q9T A;  4B67 A;  3CGC A;  4JY2 A;  1GRH A;  2YVG A;  4EQR A;  2ZZ0 A;  4X4J A;  2BCG G;  1CC4 A;  3SGL A;  1NG3 A;  2V61 A;  2XFO A;  3DJE A;  2BC0 A;  1H7X A;  1QJD A;  2R0C A;  1PJ7 A;  3C4N A;  3NN0 X;  5GRT A;  4H4S A;  2C66 A;  1TDE A;  4NEW A;  4Z44 A;  2QA2 A;  2JKC A;  4H4Z A;  4C3X A;  5BRT A;  2GV8 A;  4D04 A;  1PBB A;  1IUV A;  4A65 A;  1LVL A;  3S61 A;  4EMI A;  2C70 A;  2BK5 A;  4YT0 A;  1KNP A;  2RGO A;  4K22 A;  3RED A;  3BHK A;  3PS9 A;  3P4P A;  3QSE A;  1NEK A;  3UTH A;  4A6N B;  1DJQ A;  2GQW A;  2UZZ A;  3AEB A;  1GT8 A;  4GR1 A;  1AOG A;  2F5Z A;  4LA1 A;  2JBV A;  4OPT A;  4H4T A;  1PBD A;  1D7L A;  1JOA A;  2H88 A;  4TM3 A;  1K0L A;  3AE1 A;  3P1W A;  5FS6 A;  2ARD A;  2Z5X A;  1YQ3 A;  2XFN A;  2Q6U A;  4KPR A;  2WQY A;  3NK0 X;  3L8K A;  4M52 A;  3UTG A;  4CY8 A;  1LQT A;  2QAE A;  1GET A;  2WET A;  3AWI A;  5DBJ A;  1BKW A;  1RYI A;  1B8S A;  1PN0 A;  2BXR A;  1F8R A;  4GDP A;  3KPF A;  4OPC A;  2C3C A;  3P9U A;  4B1B A;  3IC9 A;  3I3L A;  1IUX A;  3NK1 X;  3UTF A;  2WOW A;  1D4D A;  2NPX A;  2WS3 A;  4OVI A;  3NT6 A;  2IVD A;  2NVK X;  1Y56 B;  4B66 A;  4U8P A;  3P4Q A;  3O0H A;  4NTC A;  2W0H A;  3PVC A;  1NAA A;  2GAH B;  3NHO X;  3SFD A;  2GRT A;  1LJ1 A;  2BK3 A;  2C72 A;  5KXJ A;  1EL5 A;  1XPQ A;  2WP5 A;  4U8L A;  2YR6 A;  4C3Y A;  3GYI A;  3AEC A;  3LZW A;  1SEZ A;  2WP9 A;  4BJY A;  3CND A;  4O5Q A;  1N4W A;  3K7Q X;  4D03 A;  4ICY A;  5U25 A;  3P4R A;  5KWF A;  3GSI A;  4JN9 A;  4CRT A;  1OJT A;  3ZDN A;  2R46 A;  4JNA A;  4BK3 A;  1TDF A;  2Q7V A;  1GRA A;  3KLJ A;  5TR3 A;  4XWR A;  2CDU A;  3AED A;  3ATR A;  3DJJ A;  4APN A;  1GXF A;  2WES A;  1IUT A;  2BS3 A;  1S3B A;  1PJ5 A;  2V3B A;  1BGN A;  3T37 A;  1P2H A;  3IF9 A;  4H4V A;  4J56 A;  2PYX A;  2XLP A;  3FG2 P;  4P9S A;  5U63 A;  1E7P A;  1JRZ A;  4GUV A;  3UKF A;  4A7A A;  1PS9 A;  3EAN A;  2WDV A;  3ICS A;  1E39 A;  5C2T A;  1K0I A;  3UKQ A;  4YTP A;  4NZH A;  2YR5 A;  3ALM A;  2X8H A;  5FS7 A;  4OCG A;  1ZOV A;  3UKA A;  4IVO B;  4YKF A;  4CCQ A;  2YQU A;  2I0Z A;  4YSZ A;  4EIQ A;  2ACZ A;  5KVI A;  1CF3 A;  5BUL A;  2A87 A;  5M10 A;  2X3N A;  4Z26 A;  5C3J A;  1F8W A;  2JAE A;  3LAD A;  2CFY A;  3B6D A;  2B76 A;  2WDQ A;  3EPT A;  1GRE A;  3AE4 A;  1M64 A;  4NTD A;  4WCT A;  3GD3 A;  1NHR A;  3GDP A;  3JSK A;  4A5L A;  2HQM A;  2Q0K A;  1Y56 A;  1DNC A;  5IQ4 A;  1E1N A;  4EMJ A;  4PAB A;  1TYT A;  4Y4M A;  1JNZ A;  1GAL A;  2C64 A;  4K7Z A;  1L9C A;  1P2E A;  2Q0L A;  4H2N A;  4XXG A;  2XVI A;  5BUK A;  4EQS A;  3ABV A;  1EL7 A;  1OJ9 A;  3AEF A;  1PBC A;  3BI4 A;  4GCM A;  4XWZ A;  3AD7 B;  3NTA A;  4AOS A;  4NEV A;  4EM3 A;  3VRD B;  5FS9 A;  4LII A;  1GEU A;  2FJE A;  1GTH A;  3IHG A;  1FCD A;  2XYO A;  1N4U A;  4H4P A;  2JB1 A;  4JY3 A;  1B4V A;  1N1P A;  3CNP A;  4OPU A;  1K4Q A;  1MO9 A;  4A6N A;  4TM1 A;  3UP5 A; 
#chains in the Genus database with same CATH topology
 1S2Q A;  1GRF A;  4OPL A;  2YWL A;  4ADW A;  5U1O A;  3COX A;  2AAQ A;  4C5O A;  1O5W A;  4G6G A;  3BI2 A;  2OAM A;  4BUR A;  5JCM A;  2VQB A;  4X9M A;  3KD9 A;  1GRB A;  3M0O A;  3HYW A;  3NG7 X;  3AEA A;  3M12 A;  4IA6 A;  3CGD A;  3KU9 A;  3NKS A;  1S2Y A;  1VDC A;  1XDI A;  4HA6 A;  1N4V A;  3AYL A;  3DK4 A;  4IVM B;  3NH3 X;  4N9X A;  4UDP A;  3ATQ A;  4H4X A;  1CL0 A;  4I58 A;  1LV0 A;  2YLS A;  2C4C A;  3CGB A;  3UCL A;  2WOI A;  3EAO A;  3FPZ A;  4AOX A;  1BF3 A;  4YSX A;  2YG7 A;  5HYM A;  1IUS A;  4U2S A;  1NDA A;  2XFP A;  5M0Z A;  1M6I A;  3AYJ A;  4NNJ A;  3AE8 A;  3FIM B;  2R0P A;  2RGJ A;  1LQU A;  2XVH A;  3UKP A;  4GAP A;  3K30 A;  2WPF A;  3ISH A;  4Z2R A;  5KRQ A;  1CJ4 A;  2R4E A;  4OPG A;  3G5S A;  3II4 A;  2OLN A;  3CPJ G;  2GQF A;  1GER A;  5LV9 A;  1E1L A;  2TPR A;  3H8L A;  4B68 A;  1PXA A;  3DK8 A;  1NHP A;  5ER0 A;  1D4E A;  1JU2 A;  4Y4N A;  3BHF A;  1FOH A;  4H2R A;  4DNA A;  2BYB A;  3H8I A;  1FEA A;  3CNJ A;  3QJ4 A;  3VRB A;  4K2X A;  3UTE A;  4G9K A;  4X9N A;  4IV9 A;  4BV6 A;  3Q6J A;  3FMW A;  1H83 A;  1YY5 A;  2FJB A;  3B3R A;  4J33 A;  2B7S A;  4DSH A;  3ALL A;  4BJZ A;  3DJD A;  3CGE A;  4EMW A;  1D5T A;  4ZCC A;  1ZMC A;  4H50 A;  1S3E A;  4TM4 A;  2C73 A;  3AD8 B;  2YR4 A;  1ZP0 A;  4B64 A;  4LU6 A;  1COY A;  3S5W A;  2XDO A;  5HY5 A;  2FBW A;  2VRM A;  4B69 A;  1DJN A;  2FJA A;  4H7U A;  1Q1R A;  2V60 A;  3NLC A;  4TLX A;  3GWD A;  2WPC A;  4KX6 A;  3AXB A;  1DOE A;  1H81 A;  4J57 A;  4EIP A;  2WOV A;  3DK9 A;  3QFB A;  1ZKQ A;  4O5U A;  5EB5 A;  1L0V A;  4H4Y A;  2B7R A;  2R0G A;  3CN8 A;  4USR A;  1NHQ A;  1H82 A;  5JCI A;  4Z25 A;  3GMC A;  4B65 A;  4G73 A;  1YKJ A;  1KNR A;  2YLX A;  3SX6 A;  2TMD A;  3AE7 A;  3HZL A;  2BCP A;  1TDN A;  3NRN A;  3CMM A;  2CVJ A;  3SZF A;  5BVA A;  1V59 A;  3ZYX A;  3BI5 A;  3CNT A;  4JNQ A;  5IPY A;  2RAB A;  3SZ0 A;  4H2Q A;  4U2L A;  4YTN A;  4C74 A;  2GMJ A;  3C96 A;  3UOY A;  1TDK A;  3GYJ A;  1F3P A;  2YG6 A;  4K8D A;  3AB1 A;  3DH9 A;  1GRG A;  3AEE A;  3HYX A;  3G5R A;  4U8J A;  1B5Q A;  1ZK7 A;  1D7Y A;  3D1C A;  2V3A A;  1LTX R;  2WU2 A;  5L46 A;  1CJ3 A;  2YAU A;  2O9Z A;  1CBO A;  1DOD A;  1GV4 A;  3GDN A;  1H84 A;  3NK2 X;  3GD4 A;  4H4W A;  4Y4L A;  2X8G A;  3ICR A;  3AE6 A;  2C65 A;  3AE3 A;  3UP4 A;  2PHH A;  1TRB A;  1Q1W A;  2XLU A;  2YVF A;  1REO A;  2ZZB A;  3SM8 A;  1XAN A;  4YTM A;  4H4Q A;  4I59 A;  4Z2U A;  5FS8 A;  1KDG A;  3OC4 A;  4J2W A;  4U8K A;  4AT0 A;  3P4S A;  1ELI A;  2YG5 A;  4NTE A;  2OA1 A;  2WDR A;  3GWF A;  5KMR A;  3FBS A;  2WPE A;  2A89 A;  2QA1 A;  4A99 A;  1OJC A;  3KPK A;  2GVC A;  4EQX A;  1ZDL A;  1ZOY A;  1QLB A;  1XHC A;  2OLO A;  3UOZ A;  4GRT A;  4BK1 A;  3UOX A;  3CPH G;  3R9U A;  2IVE A;  3LOV A;  1OJD A;  2XLS A;  3K7M X;  2JK6 A;  1NPX A;  1UKV G;  3BNU A;  3CNS A;  4K5R A;  1CJC A;  2XFU A;  1X31 B;  2BS4 A;  3AE2 A;  3GMB A;  4K5S A;  1JRY A;  3UKL A;  4A79 A;  1H7W A;  2WP6 A;  1VG0 A;  1YQZ A;  4CBQ A;  1B37 A;  1PHH A;  3IWA A;  1K0J A;  1IUW A;  5J7X A;  5JCK A;  3QVP A;  1VQW A;  3K7T A;  1RP0 A;  1JRX A;  2R45 A;  2EQ7 A;  1KFY A;  3NTD A;  1Q9I A;  3C4A A;  3CIR A;  3M13 A;  3RNM A;  3V3N A;  2B9W A;  1O94 A;  4MJW A;  3AE5 A;  2EQ6 A;  1TYP A;  3T2Z A;  4Z2T A;  2X99 A;  3SYI A;  2YM1 A;  4EM4 A;  3T2K A;  5JCN A;  1ZY8 A;  2VOU A;  2RGH A;  2DKI A;  4UP3 A;  5EBK A;  2ZBW A;  1JNR A;  1NHS A;  3AYI A;  4FX9 A;  2IID A;  1EL9 A;  4RSL A;  1OJA A;  2J3N A;  2R4J A;  3CPI G;  4GDE A;  2GF3 A;  5KVH A;  2GR0 A;  2Y6Q A;  1L9E A;  1GSN A;  2VVL G;  1YQ4 A;  3WE0 A;  2APG A;  3F8P A;  2XLR A;  4FDC B;  3L1R A;  2C67 A;  2YLT A;  1GOS A;  3D8X A;  2BAC A;  1NG4 A;  4OPD A;  4YSH A;  2VRL A;  2YG4 A;  4U2T A;  4E0V A;  4CY6 A;  4NWZ A;  3QVR A;  2BS2 A;  2YLZ A;  3UOV A;  1CJ2 A;  4C77 A;  3KA7 A;  3NYE A;  4CNJ A;  3SQP A;  4U8M A;  1GTE A;  5KMQ A;  2E1M A;  4IA5 A;  4YSY A;  4YWO A;  2YG3 A;  1E6E A;  1HYU A;  2A8X A;  1QO8 A;  2H89 A;  3KVE A;  1FEC A;  2VQ7 A;  2C3D A;  5J60 A;  5KOX A;  4USQ A;  3NN6 X;  2B9X A;  4H2P A;  2CUL A;  4J34 A;  4TLZ A;  2WU5 A;  4PAA A;  4AT2 A;  1PDH A;  1CHU A;  2VVL A;  2C7G A;  1PBE A;  4DGK A;  4EQW A;  1BWC A;  2FJD A;  3ADA B;  3DGH A;  3QSM A;  2XVF A;  3URH A;  1L9D A;  2WHD A;  2GR2 A;  2YM2 A;  3F8D A;  1KSS A;  5CKU A;  1PBF A;  3SY4 A;  3G5Q A;  3RP8 A;  1BZL A;  5CQF A;  3AE9 A;  3VQR A;  3NGC X;  5HHF A;  4ECH A;  3RP7 A;  2V6O A;  2YVJ A;  1Z6L A;  1DOC A;  4H4R A;  1PJ6 A;  1GND A;  4GF7 A;  3NYF A;  2BA9 A;  4TM0 A;  4A9W A;  2WEU A;  2VVM A;  3AD9 B;  4II2 A;  3VR8 A;  4ZCD A;  3AEG A;  4AP1 A;  3LXD A;  3OZ2 A;  2JB2 A;  3NNE A;  3PO7 A;  3DA1 A;  1F8S A;  2E5V A;  3HYV A;  1MOK A;  3DGZ A;  2B9Y A;  3QSS A;  3RP6 A;  5GSN A;  1LPF A;  4U8N A;  2YLW A;  5IQ1 A;  2E4G A;  2BXS A;  2WBA A;  3GRT A;  3QFA A;  1FL2 A;  2DKH A;  1Y0P A;  3CTY A;  2C75 A;  5KMS A;  3EF6 A;  5EB4 A;  3LJP A;  4OPI A;  2GR1 A;  3KKJ A;  1ONF A;  1VRQ B;  3UKH A;  3SFE A;  4FK1 A;  5HXI A;  2BRY A;  2GEW A;  4JDR A;  4FK1 C;  2EQ8 A;  1CC6 A;  1H86 A;  1EBD A;  2X50 A;  4J31 A;  5EOW A;  1E1M A;  3ICT A;  3E1T A;  4WX1 A;  2V5Z A;  3RHA A;  1IUU A;  4UDQ A;  2EQ9 A;  3NIX A;  4J36 A;  4Z24 A;  1D4C A;  5KOW A;  4HB9 A;  2GAG B;  2OAL A;  3DJG X;  1ZX9 A;  4REK A;  4ZN0 A;  2XFQ A;  1PXC A;  3VR9 A;  3LB8 A;  1DOB A;  5JCL A;  3ITJ A;  2R9Z A;  1KF6 A;  2BC1 A;  4DSG A;  3UKK A;  2BAB A;  2XLT A;  1TDO A;  2BRA A;  2VZ2 A;  2AR8 A;  3BNM A;  4B63 A;  4U8O A;  1DXL A;  1FEB A;  1W4X A;  4CCR A;  2BK4 A;  3H4K A;  2Y6R A;  1RSG A;  4JQ9 A;  4RG4 A;  1NEN A;  2XVJ A;  2GB0 A;  2XVE A;  3NYC A;  1BGJ A;  1GES A;  3SZW A;  4YKG A;  2C76 A;  2XCG A;  3V76 A;  1JEH A;  1VG9 A;  1E1K A;  2X8C A;  3I6D A;  2GH5 A;  3SZC A;  2ZZC A;  3DME A;  1CC2 A;  2GR3 A;  1PXB A;  4H4U A;  4U8I A;  1GRT A;  3VRA A;  1F6M A;  1GPE A;  3F8R A;  1O95 A;  4RG3 A;  2Z5Y A;  1EL8 A;  2JB3 A;  1MXT A;  1IJH A;  4AP3 A;  4CNK A;  4BK2 A;  5FMH A;  4UDR A;  2AQJ A;  3GRS A;  3V3O A;  1H6V A;  2GMH A;  1KSU A;  2YLR A;  3ALJ A;  3LZX A;  4YXD A;  4Z43 A;  3IHM A;  1ZMD A;  2QCU A;  3Q9T A;  4B67 A;  3CGC A;  4JY2 A;  1GRH A;  2YVG A;  4EQR A;  2ZZ0 A;  4X4J A;  2BCG G;  1CC4 A;  3SGL A;  1NG3 A;  2V61 A;  2XFO A;  3DJE A;  2BC0 A;  1H7X A;  1QJD A;  2R0C A;  1PJ7 A;  3C4N A;  3NN0 X;  5GRT A;  4H4S A;  2C66 A;  1TDE A;  4NEW A;  4Z44 A;  3SXI A;  2QA2 A;  2JKC A;  4H4Z A;  4C3X A;  5BRT A;  2GV8 A;  4D04 A;  1PBB A;  1IUV A;  4A65 A;  5KNL A;  1LVL A;  3S61 A;  4EMI A;  2C70 A;  2BK5 A;  4YT0 A;  1KNP A;  2RGO A;  4K22 A;  3RED A;  3BHK A;  3PS9 A;  3P4P A;  3QSE A;  1NEK A;  3UTH A;  4A6N B;  1DJQ A;  2GQW A;  2UZZ A;  3AEB A;  1GT8 A;  4GR1 A;  1AOG A;  2F5Z A;  4LA1 A;  2JBV A;  4GAV A;  4OPT A;  4H4T A;  1PBD A;  1D7L A;  1JOA A;  2H88 A;  4TM3 A;  1K0L A;  3AE1 A;  3P1W A;  5FS6 A;  2ARD A;  2Z5X A;  1YQ3 A;  2XFN A;  2Q6U A;  4KPR A;  2WQY A;  3NK0 X;  3L8K A;  4M52 A;  3UTG A;  4CY8 A;  1LQT A;  2QAE A;  1GET A;  4G74 A;  2WET A;  3AWI A;  5DBJ A;  1BKW A;  4II3 A;  1RYI A;  1B8S A;  1PN0 A;  2BXR A;  1F8R A;  3T0K A;  4GDP A;  3KPF A;  4OPC A;  2C3C A;  3P9U A;  4B1B A;  3IC9 A;  3I3L A;  1IUX A;  3NK1 X;  3UTF A;  2WOW A;  1D4D A;  2NPX A;  2WS3 A;  4OVI A;  3NT6 A;  2IVD A;  2NVK X;  1Y56 B;  4B66 A;  4U8P A;  3P4Q A;  3O0H A;  4NTC A;  2W0H A;  3PVC A;  1NAA A;  2GAH B;  3NHO X;  3SFD A;  2GRT A;  1LJ1 A;  2BK3 A;  2C72 A;  5KXJ A;  1EL5 A;  1XPQ A;  2WP5 A;  4U8L A;  2YR6 A;  4C3Y A;  3GYI A;  3AEC A;  3LZW A;  1SEZ A;  2WP9 A;  4BJY A;  3CND A;  4O5Q A;  1N4W A;  3K7Q X;  4D03 A;  4ICY A;  5U25 A;  3P4R A;  5KWF A;  3GSI A;  4JN9 A;  4CRT A;  1OJT A;  3ZDN A;  2R46 A;  4JNA A;  4BK3 A;  1TDF A;  2Q7V A;  3GYX A;  1GRA A;  3KLJ A;  5TR3 A;  4XWR A;  2CDU A;  3AED A;  3ATR A;  3DJJ A;  4APN A;  1GXF A;  2WES A;  1IUT A;  2BS3 A;  1S3B A;  1PJ5 A;  2V3B A;  1BGN A;  3T37 A;  1P2H A;  3IF9 A;  4H4V A;  4J56 A;  2PYX A;  2XLP A;  5KMP A;  3FG2 P;  4P9S A;  5U63 A;  1E7P A;  1JRZ A;  4GUV A;  3UKF A;  4A7A A;  1PS9 A;  3EAN A;  2WDV A;  3ICS A;  1E39 A;  5C2T A;  1K0I A;  3UKQ A;  4YTP A;  4NZH A;  2YR5 A;  3ALM A;  2X8H A;  5FS7 A;  4OCG A;  1ZOV A;  3UKA A;  4IVO B;  4YKF A;  4CCQ A;  2YQU A;  2I0Z A;  4YSZ A;  4EIQ A;  2ACZ A;  5KVI A;  1CF3 A;  3T14 A;  5BUL A;  2A87 A;  5M10 A;  2X3N A;  4Z26 A;  5C3J A;  1F8W A;  2JAE A;  3LAD A;  2CFY A;  3B6D A;  2B76 A;  3T31 A;  2WDQ A;  3EPT A;  1GRE A;  3AE4 A;  1M64 A;  4NTD A;  4WCT A;  3GD3 A;  1NHR A;  3GDP A;  3JSK A;  4A5L A;  2HQM A;  2Q0K A;  1Y56 A;  1DNC A;  5IQ4 A;  1E1N A;  4EMJ A;  4PAB A;  1TYT A;  4Y4M A;  1JNZ A;  1GAL A;  2C64 A;  4K7Z A;  1L9C A;  1P2E A;  2Q0L A;  4H2N A;  4XXG A;  2XVI A;  5BUK A;  4EQS A;  4G6H A;  3ABV A;  1EL7 A;  1OJ9 A;  3AEF A;  1PBC A;  3BI4 A;  4GCM A;  4XWZ A;  3AD7 B;  3NTA A;  4AOS A;  4NEV A;  4EM3 A;  3VRD B;  3T2Y A;  5FS9 A;  4LII A;  1GEU A;  2FJE A;  1GTH A;  3IHG A;  1FCD A;  2XYO A;  1N4U A;  4H4P A;  2JB1 A;  4JY3 A;  1B4V A;  1N1P A;  3CNP A;  4OPU A;  1K4Q A;  1MO9 A;  4A6N A;  4TM1 A;  3UP5 A; 
#chains in the Genus database with same CATH homology
 1S2Q A;  1GRF A;  4OPL A;  2YWL A;  4ADW A;  5U1O A;  3COX A;  2AAQ A;  4C5O A;  1O5W A;  4G6G A;  3BI2 A;  2OAM A;  4BUR A;  5JCM A;  2VQB A;  4X9M A;  3KD9 A;  1GRB A;  3M0O A;  3HYW A;  3NG7 X;  3AEA A;  3M12 A;  4IA6 A;  3CGD A;  3KU9 A;  3NKS A;  1S2Y A;  1VDC A;  1XDI A;  4HA6 A;  1N4V A;  3AYL A;  3DK4 A;  4IVM B;  3NH3 X;  4N9X A;  4UDP A;  3ATQ A;  4H4X A;  1CL0 A;  4I58 A;  1LV0 A;  2YLS A;  2C4C A;  3CGB A;  3UCL A;  2WOI A;  3EAO A;  3FPZ A;  4AOX A;  1BF3 A;  4YSX A;  2YG7 A;  5HYM A;  1IUS A;  4U2S A;  1NDA A;  2XFP A;  5M0Z A;  1M6I A;  3AYJ A;  4NNJ A;  3AE8 A;  3FIM B;  2R0P A;  2RGJ A;  1LQU A;  2XVH A;  3UKP A;  4GAP A;  3K30 A;  2WPF A;  3ISH A;  4Z2R A;  5KRQ A;  1CJ4 A;  2R4E A;  4OPG A;  3G5S A;  3II4 A;  2OLN A;  3CPJ G;  2GQF A;  1GER A;  5LV9 A;  1E1L A;  2TPR A;  3H8L A;  4B68 A;  1PXA A;  3DK8 A;  1NHP A;  5ER0 A;  1D4E A;  1JU2 A;  4Y4N A;  3BHF A;  1FOH A;  4H2R A;  4DNA A;  2BYB A;  3H8I A;  1FEA A;  3CNJ A;  3QJ4 A;  3VRB A;  4K2X A;  3UTE A;  4G9K A;  4X9N A;  4IV9 A;  4BV6 A;  3Q6J A;  3FMW A;  1H83 A;  1YY5 A;  2FJB A;  3B3R A;  4J33 A;  2B7S A;  4DSH A;  3ALL A;  4BJZ A;  3DJD A;  3CGE A;  4EMW A;  1D5T A;  4ZCC A;  1ZMC A;  4H50 A;  1S3E A;  4TM4 A;  2C73 A;  3AD8 B;  2YR4 A;  1ZP0 A;  4B64 A;  4LU6 A;  1COY A;  3S5W A;  2XDO A;  5HY5 A;  2FBW A;  2VRM A;  4B69 A;  1DJN A;  2FJA A;  4H7U A;  1Q1R A;  2V60 A;  3NLC A;  4TLX A;  3GWD A;  2WPC A;  4KX6 A;  3AXB A;  1DOE A;  1H81 A;  4J57 A;  4EIP A;  2WOV A;  3DK9 A;  3QFB A;  1ZKQ A;  4O5U A;  5EB5 A;  1L0V A;  4H4Y A;  2B7R A;  2R0G A;  3CN8 A;  4USR A;  1NHQ A;  1H82 A;  5JCI A;  4Z25 A;  3GMC A;  4B65 A;  4G73 A;  1YKJ A;  1KNR A;  2YLX A;  3SX6 A;  2TMD A;  3AE7 A;  3HZL A;  2BCP A;  1TDN A;  3NRN A;  3CMM A;  2CVJ A;  3SZF A;  5BVA A;  1V59 A;  3ZYX A;  3BI5 A;  3CNT A;  4JNQ A;  5IPY A;  2RAB A;  3SZ0 A;  4H2Q A;  4U2L A;  4YTN A;  4C74 A;  2GMJ A;  3C96 A;  3UOY A;  1TDK A;  3GYJ A;  1F3P A;  2YG6 A;  4K8D A;  3AB1 A;  3DH9 A;  1GRG A;  3AEE A;  3HYX A;  3G5R A;  4U8J A;  1B5Q A;  1ZK7 A;  1D7Y A;  3D1C A;  2V3A A;  1LTX R;  2WU2 A;  5L46 A;  1CJ3 A;  2YAU A;  2O9Z A;  1CBO A;  1DOD A;  1GV4 A;  3GDN A;  1H84 A;  3NK2 X;  3GD4 A;  4H4W A;  4Y4L A;  2X8G A;  3ICR A;  3AE6 A;  2C65 A;  3AE3 A;  3UP4 A;  2PHH A;  1TRB A;  1Q1W A;  2XLU A;  2YVF A;  1REO A;  2ZZB A;  3SM8 A;  1XAN A;  4YTM A;  4H4Q A;  4I59 A;  4Z2U A;  5FS8 A;  1KDG A;  3OC4 A;  4J2W A;  4U8K A;  4AT0 A;  3P4S A;  1ELI A;  2YG5 A;  4NTE A;  2OA1 A;  2WDR A;  3GWF A;  5KMR A;  3FBS A;  2WPE A;  2A89 A;  2QA1 A;  4A99 A;  1OJC A;  3KPK A;  2GVC A;  4EQX A;  1ZDL A;  1ZOY A;  1QLB A;  1XHC A;  2OLO A;  3UOZ A;  4GRT A;  4BK1 A;  3UOX A;  3CPH G;  3R9U A;  2IVE A;  3LOV A;  1OJD A;  2XLS A;  3K7M X;  2JK6 A;  1NPX A;  1UKV G;  3BNU A;  3CNS A;  4K5R A;  1CJC A;  2XFU A;  1X31 B;  2BS4 A;  3AE2 A;  3GMB A;  4K5S A;  1JRY A;  3UKL A;  4A79 A;  1H7W A;  2WP6 A;  1VG0 A;  1YQZ A;  4CBQ A;  1B37 A;  1PHH A;  3IWA A;  1K0J A;  1IUW A;  5J7X A;  5JCK A;  3QVP A;  1VQW A;  3K7T A;  1RP0 A;  1JRX A;  2R45 A;  2EQ7 A;  1KFY A;  3NTD A;  1Q9I A;  3C4A A;  3CIR A;  3M13 A;  3RNM A;  3V3N A;  2B9W A;  1O94 A;  4MJW A;  3AE5 A;  2EQ6 A;  1TYP A;  3T2Z A;  4Z2T A;  2X99 A;  3SYI A;  2YM1 A;  4EM4 A;  3T2K A;  5JCN A;  1ZY8 A;  2VOU A;  2RGH A;  2DKI A;  4UP3 A;  5EBK A;  2ZBW A;  1JNR A;  1NHS A;  3AYI A;  4FX9 A;  2IID A;  1EL9 A;  4RSL A;  1OJA A;  2J3N A;  2R4J A;  3CPI G;  4GDE A;  2GF3 A;  5KVH A;  2GR0 A;  2Y6Q A;  1L9E A;  1GSN A;  2VVL G;  1YQ4 A;  3WE0 A;  2APG A;  3F8P A;  2XLR A;  4FDC B;  3L1R A;  2C67 A;  2YLT A;  1GOS A;  3D8X A;  2BAC A;  1NG4 A;  4OPD A;  4YSH A;  2VRL A;  2YG4 A;  4U2T A;  4E0V A;  4CY6 A;  4NWZ A;  3QVR A;  2BS2 A;  2YLZ A;  3UOV A;  1CJ2 A;  4C77 A;  3KA7 A;  3NYE A;  4CNJ A;  3SQP A;  4U8M A;  1GTE A;  5KMQ A;  2E1M A;  4IA5 A;  4YSY A;  4YWO A;  2YG3 A;  1E6E A;  1HYU A;  2A8X A;  1QO8 A;  2H89 A;  3KVE A;  1FEC A;  2VQ7 A;  2C3D A;  5J60 A;  5KOX A;  4USQ A;  3NN6 X;  2B9X A;  4H2P A;  2CUL A;  4J34 A;  4TLZ A;  2WU5 A;  4PAA A;  4AT2 A;  1PDH A;  1CHU A;  2VVL A;  2C7G A;  1PBE A;  4DGK A;  4EQW A;  1BWC A;  2FJD A;  3ADA B;  3DGH A;  3QSM A;  2XVF A;  3URH A;  1L9D A;  2WHD A;  2GR2 A;  2YM2 A;  3F8D A;  1KSS A;  5CKU A;  1PBF A;  3SY4 A;  3G5Q A;  3RP8 A;  1BZL A;  5CQF A;  3AE9 A;  3VQR A;  3NGC X;  5HHF A;  4ECH A;  3RP7 A;  2V6O A;  2YVJ A;  1Z6L A;  1DOC A;  4H4R A;  1PJ6 A;  1GND A;  4GF7 A;  3NYF A;  2BA9 A;  4TM0 A;  4A9W A;  2WEU A;  2VVM A;  3AD9 B;  4II2 A;  3VR8 A;  4ZCD A;  3AEG A;  4AP1 A;  3LXD A;  3OZ2 A;  2JB2 A;  3NNE A;  3PO7 A;  3DA1 A;  1F8S A;  2E5V A;  3HYV A;  1MOK A;  3DGZ A;  2B9Y A;  3QSS A;  3RP6 A;  5GSN A;  1LPF A;  4U8N A;  2YLW A;  5IQ1 A;  2E4G A;  2BXS A;  2WBA A;  3GRT A;  3QFA A;  1FL2 A;  2DKH A;  1Y0P A;  3CTY A;  2C75 A;  5KMS A;  3EF6 A;  5EB4 A;  3LJP A;  4OPI A;  2GR1 A;  3KKJ A;  1ONF A;  1VRQ B;  3UKH A;  3SFE A;  4FK1 A;  5HXI A;  2BRY A;  2GEW A;  4JDR A;  4FK1 C;  2EQ8 A;  1CC6 A;  1H86 A;  1EBD A;  2X50 A;  4J31 A;  5EOW A;  1E1M A;  3ICT A;  3E1T A;  4WX1 A;  2V5Z A;  3RHA A;  1IUU A;  4UDQ A;  2EQ9 A;  3NIX A;  4J36 A;  4Z24 A;  1D4C A;  5KOW A;  4HB9 A;  2GAG B;  2OAL A;  3DJG X;  1ZX9 A;  4REK A;  4ZN0 A;  2XFQ A;  1PXC A;  3VR9 A;  3LB8 A;  1DOB A;  5JCL A;  3ITJ A;  2R9Z A;  1KF6 A;  2BC1 A;  4DSG A;  3UKK A;  2BAB A;  2XLT A;  1TDO A;  2BRA A;  2VZ2 A;  2AR8 A;  3BNM A;  4B63 A;  4U8O A;  1DXL A;  1FEB A;  1W4X A;  4CCR A;  2BK4 A;  3H4K A;  2Y6R A;  1RSG A;  4JQ9 A;  4RG4 A;  1NEN A;  2XVJ A;  2GB0 A;  2XVE A;  3NYC A;  1BGJ A;  1GES A;  3SZW A;  4YKG A;  2C76 A;  2XCG A;  3V76 A;  1JEH A;  1VG9 A;  1E1K A;  2X8C A;  3I6D A;  2GH5 A;  3SZC A;  2ZZC A;  3DME A;  1CC2 A;  2GR3 A;  1PXB A;  4H4U A;  4U8I A;  1GRT A;  3VRA A;  1F6M A;  1GPE A;  3F8R A;  1O95 A;  4RG3 A;  2Z5Y A;  1EL8 A;  2JB3 A;  1MXT A;  1IJH A;  4AP3 A;  4CNK A;  4BK2 A;  5FMH A;  4UDR A;  2AQJ A;  3GRS A;  3V3O A;  1H6V A;  2GMH A;  1KSU A;  2YLR A;  3ALJ A;  3LZX A;  4YXD A;  4Z43 A;  3IHM A;  1ZMD A;  2QCU A;  3Q9T A;  4B67 A;  3CGC A;  4JY2 A;  1GRH A;  2YVG A;  4EQR A;  2ZZ0 A;  4X4J A;  2BCG G;  1CC4 A;  3SGL A;  1NG3 A;  2V61 A;  2XFO A;  3DJE A;  2BC0 A;  1H7X A;  1QJD A;  2R0C A;  1PJ7 A;  3C4N A;  3NN0 X;  5GRT A;  4H4S A;  2C66 A;  1TDE A;  4NEW A;  4Z44 A;  3SXI A;  2QA2 A;  2JKC A;  4H4Z A;  4C3X A;  5BRT A;  2GV8 A;  4D04 A;  1PBB A;  1IUV A;  4A65 A;  5KNL A;  1LVL A;  3S61 A;  4EMI A;  2C70 A;  2BK5 A;  4YT0 A;  1KNP A;  2RGO A;  4K22 A;  3RED A;  3BHK A;  3PS9 A;  3P4P A;  3QSE A;  1NEK A;  3UTH A;  4A6N B;  1DJQ A;  2GQW A;  2UZZ A;  3AEB A;  1GT8 A;  4GR1 A;  1AOG A;  2F5Z A;  4LA1 A;  2JBV A;  4GAV A;  4OPT A;  4H4T A;  1PBD A;  1D7L A;  1JOA A;  2H88 A;  4TM3 A;  1K0L A;  3AE1 A;  3P1W A;  5FS6 A;  2ARD A;  2Z5X A;  1YQ3 A;  2XFN A;  2Q6U A;  4KPR A;  2WQY A;  3NK0 X;  3L8K A;  4M52 A;  3UTG A;  4CY8 A;  1LQT A;  2QAE A;  1GET A;  4G74 A;  2WET A;  3AWI A;  5DBJ A;  1BKW A;  4II3 A;  1RYI A;  1B8S A;  1PN0 A;  2BXR A;  1F8R A;  3T0K A;  4GDP A;  3KPF A;  4OPC A;  2C3C A;  3P9U A;  4B1B A;  3IC9 A;  3I3L A;  1IUX A;  3NK1 X;  3UTF A;  2WOW A;  1D4D A;  2NPX A;  2WS3 A;  4OVI A;  3NT6 A;  2IVD A;  2NVK X;  1Y56 B;  4B66 A;  4U8P A;  3P4Q A;  3O0H A;  4NTC A;  2W0H A;  3PVC A;  1NAA A;  2GAH B;  3NHO X;  3SFD A;  2GRT A;  1LJ1 A;  2BK3 A;  2C72 A;  5KXJ A;  1EL5 A;  1XPQ A;  2WP5 A;  4U8L A;  2YR6 A;  4C3Y A;  3GYI A;  3AEC A;  3LZW A;  1SEZ A;  2WP9 A;  4BJY A;  3CND A;  4O5Q A;  1N4W A;  3K7Q X;  4D03 A;  4ICY A;  5U25 A;  3P4R A;  5KWF A;  3GSI A;  4JN9 A;  4CRT A;  1OJT A;  3ZDN A;  2R46 A;  4JNA A;  4BK3 A;  1TDF A;  2Q7V A;  3GYX A;  1GRA A;  3KLJ A;  5TR3 A;  4XWR A;  2CDU A;  3AED A;  3ATR A;  3DJJ A;  4APN A;  1GXF A;  2WES A;  1IUT A;  2BS3 A;  1S3B A;  1PJ5 A;  2V3B A;  1BGN A;  3T37 A;  1P2H A;  3IF9 A;  4H4V A;  4J56 A;  2PYX A;  2XLP A;  5KMP A;  3FG2 P;  4P9S A;  5U63 A;  1E7P A;  1JRZ A;  4GUV A;  3UKF A;  4A7A A;  1PS9 A;  3EAN A;  2WDV A;  3ICS A;  1E39 A;  5C2T A;  1K0I A;  3UKQ A;  4YTP A;  4NZH A;  2YR5 A;  3ALM A;  2X8H A;  5FS7 A;  4OCG A;  1ZOV A;  3UKA A;  4IVO B;  4YKF A;  4CCQ A;  2YQU A;  2I0Z A;  4YSZ A;  4EIQ A;  2ACZ A;  5KVI A;  1CF3 A;  3T14 A;  5BUL A;  2A87 A;  5M10 A;  2X3N A;  4Z26 A;  5C3J A;  1F8W A;  2JAE A;  3LAD A;  2CFY A;  3B6D A;  2B76 A;  3T31 A;  2WDQ A;  3EPT A;  1GRE A;  3AE4 A;  1M64 A;  4NTD A;  4WCT A;  3GD3 A;  1NHR A;  3GDP A;  3JSK A;  4A5L A;  2HQM A;  2Q0K A;  1Y56 A;  1DNC A;  5IQ4 A;  1E1N A;  4EMJ A;  4PAB A;  1TYT A;  4Y4M A;  1JNZ A;  1GAL A;  2C64 A;  4K7Z A;  1L9C A;  1P2E A;  2Q0L A;  4H2N A;  4XXG A;  2XVI A;  5BUK A;  4EQS A;  4G6H A;  3ABV A;  1EL7 A;  1OJ9 A;  3AEF A;  1PBC A;  3BI4 A;  4GCM A;  4XWZ A;  3AD7 B;  3NTA A;  4AOS A;  4NEV A;  4EM3 A;  3VRD B;  3T2Y A;  5FS9 A;  4LII A;  1GEU A;  2FJE A;  1GTH A;  3IHG A;  1FCD A;  2XYO A;  1N4U A;  4H4P A;  2JB1 A;  4JY3 A;  1B4V A;  1N1P A;  3CNP A;  4OPU A;  1K4Q A;  1MO9 A;  4A6N A;  4TM1 A;  3UP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...