4CBQA

Crystal structure of the thioredoxin reductase from entamoeba histolytica with auranofin au(i) bound to cys286
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
312
structure length
312
Chain Sequence
NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 94
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4cbqA02
2XFOA 4YTPA 1Y56B 1ZK7A 3P1WA 2V61A 2GQWA 1P2EA 5U25A 2Q0KA 3VR8A 2TMDA 1EL8A 3DK8A 3UKAA 2XLRA 3ITJA 4M52A 4OPLA 3NK1X 3CGEA 1OJTA 3B6DA 1LJ1A 3UKLA 1NDAA 2FJEA 2ZBWA 3P4QA 1TDNA 1M6IA 2CDUA 1DOBA 4H4YA 1DOCA 1JU2A 3I3LA 1IUWA 3K7TA 2GR1A 4LA1A 1VQWA 3DGHA 5FS9A 3LOVA 4TLXA 2YG6A 1CHUA 3BHFA 2FJDA 2RGJA 3EPTA 4K5RA 3EANA 4XWRA 4OPDA 1K0JA 4HA6A 1NHSA 2WDVA 2BABA 1CC4A 3GYIA 3ATRA 2B76A 1LQTA 1PJ7A 2NVKX 1H84A 3P4PA 2C65A 3OZ2A 3AEBA 5HY5A 2RGHA 3WE0A 1AOGA 2R4JA 3GWDA 2B7SA 1GV4A 5LV9A 1E1MA 3P4SA 4JNAA 4OPTA 1JEHA 2C76A 4EQXA 1GPEA 2C3CA 3KVEA 5C2TA 2ZZ0A 3B3RA 2WPCA 3BNUA 1S3EA 2YG5A 1FOHA 4YKFA 1YQ3A 3VRAA 2VVLA 4TM4A 1BWCA 2EQ9A 3NIXA 4J33A 1NEKA 3ICRA 3AE2A 2JB3A 4ADWA 1NHPA 4IA5A 5KOWA 3AD7B 1VG9A 2RABA 4REKA 4B66A 5C3JA 1EL5A 4IVMB 3DK9A 4BURA 1TDKA 2B9XA 4B69A 4GDPA 1DJNA 3CPIG 1COYA 3AE4A 3DK4A 3ISHA 4H4ZA 4WCTA 3M0OA 4AOSA 1YY5A 2JB2A 1JNRA 3CNPA 1CL0A 2GF3A 4Z2RA 5JCNA 2BACA 1B5QA 1K4QA 1L9DA 2BC1A 2V3BA 4YKGA 3CNDA 4USQA 1TRBA 2I0ZA 5J7XA 1GXFA 3RP8A 1GESA 2A89A 3ALJA 3DMEA 1FL2A 4Y4MA 1BGJA 4X9NA 1RP0A 5JCLA 3GMBA 1H81A 2H89A 4UP3A 4FDCB 1N1PA 4APNA 4Y4NA 4K7ZA 2YAUA 1CBOA 1GTEA 3S5WA 1F8RA 2BCGG 2YVFA 2V5ZA 1CF3A 1N4WA 5BULA 2W0HA 1IUSA 1OJCA 2WDQA 1PJ5A 2RGOA 3ICTA 4J56A 2CFYA 3DJEA 4JNQA 2JB1A 1E1NA 1E1KA 3P9UA 4H50A 4EMIA 1GREA 3GSIA 2PYXA 2YLWA 4NTEA 1JRZA 4JY2A 3ICSA 4OVIA 5FS7A 2E1MA 3QFAA 3V76A 1ZKQA 5M10A 2BK4A 1RYIA 3NK2X 1NG3A 5ER0A 3OC4A 3S61A 4EMJA 4E0VA 3NYCA 4TLZA 1Y56A 3GRTA 1GRBA 4Z44A 2VQ7A 3UP4A 4Z25A 3P4RA 4U2LA 3F8DA 3QFBA 4TM1A 1CC2A 1NENA 2WEUA 4GCMA 4AT0A 1L0VA 1GRTA 1GNDA 1ZOVA 1M64A 1K0IA 1PBFA 2EQ7A 3FPZA 2E4GA 1YKJA 1RSGA 1N4VA 2YLRA 3ALMA 2J3NA 3CPJG 1NHRA 4Z2UA 3V3NA 1H7XA 4B65A 4A65A 1B4VA 4KX6A 4CCRA 5JCIA 5EOWA 4I58A 4BK1A 1D7LA 1E39A 3PS9A 2BS2A 2Q6UA 4YTMA 3RNMA 5L46A 1O94A 2GMHA 4TM3A 4U2SA 4X9MA 2X8GA 3H8IA 4B63A 3GDNA 2C70A 1OJDA 1ZDLA 2GAHB 2R0PA 2YLSA 3AWIA 3C4AA 2R46A 2YLTA 3QSSA 4LIIA 2YM1A 2XVHA 1K0LA 2YM2A 1BF3A 1Z6LA 1D4EA 1S3BA 3CGBA 3G5QA 4U8IA 1KDGA 2C72A 4DGKA 5IQ4A 1XPQA 5TR3A 3UP5A 5HHFA 3AE6A 3C96A 2VVLG 1NG4A 2GH5A 2XLTA 2ZZCA 2GVCA 2V3AA 1D4CA 3II4A 1PDHA 2PHHA 3H4KA 4H2RA 3SFEA 3E1TA 5JCMA 5KWFA 2BA9A 4Z24A 3AYJA 2GB0A 2XVFA 3K30A 1BZLA 3CNSA 4RG4A 2APGA 2Q0LA 3NN6X 3DH9A 3DJGX 3SQPA 4YSYA 3CGCA 1F3PA 3NTAA 3RP7A 3DGZA 2FBWA 4A79A 2B7RA 4TM0A 3EAOA 3UCLA 5IPYA 3JSKA 3Q6JA 1V59A 2Y6QA 2GR2A 2VQBA 3UKQA 4EM4A 4Y4LA 1LTXR 3CIRA 3UTGA 2YG4A 4C3XA 4Z43A 4H4TA 1D7YA 1JRYA 3T37A 3FG2P 4CRTA 1ZMCA 2EQ8A 5GRTA 2OAMA 4DSHA 1GRAA 3AD8B 4XXGA 1QJDA 5CKUA 1CJ3A 2QA1A 4BJYA 2GR3A 1NPXA 1PBEA 3UOYA 1DJQA 3RP6A 3DJJA 3ADAB 1ZY8A 1BGNA 3SGLA 4AT2A 3KPFA 5FMHA 4K22A 1N4UA 3COXA 3CNJA 4OPIA 4AP3A 3G5SA 2YLZA 4C5OA 5CQFA 2ACZA 2IVDA 1IUXA 3I6DA 4K8DA 1ZP0A 1JRXA 1VDCA 1MXTA 3KU9A 3R9UA 2AR8A 5JCKA 4H4QA 2XFQA 1XDIA 4H2NA 4U8NA 5BRTA 3AEAA 2JAEA 4AOXA 5HXIA 1DXLA 3C4NA 4ECHA 2GAGB 3AE5A 3BHKA 3CTYA 2BS4A 2IVEA 2B9WA 1IUVA 2AAQA 3UOZA 1B8SA 1KSUA 2V6OA 4H7UA 3EF6A 2WPEA 3AE9A 2GV8A 1GEUA 1PXBA 3UKFA 2DKHA 2BC0A 3IHGA 3BI4A 4GDEA 4NTDA 4JN9A 2VVMA 4A99A 1F8SA 2R0GA 4OCGA 4JQ9A 1REOA 2JBVA 2YLXA 2R9ZA 3NNEA 2BS3A 4CY8A 1EL7A 2C7GA 2YVJA 1H86A 3ALLA 3LZXA 4KPRA 4MJWA 4U8OA 4GUVA 4DNAA 5BUKA 2WDRA 2UZZA 3FMWA 4K2XA 1E7PA 2WOIA 2YR5A 3GYJA 1VRQB 4A9WA 1FECA 1GRGA 4CY6A 1KF6A 2GRTA 2WOWA 5IQ1A 2WU2A 4C74A 3NYEA 1DNCA 4H4XA 3NK0X 4EIPA 3AYIA 1ZMDA 2WP9A 4YSZA 4I59A 1EL9A 1L9CA 3PO7A 1ELIA 1SEZA 4O5UA 3BI2A 1GT8A 1D4DA 1NAAA 2JK6A 3QVPA 3K7QX 2BXSA 1TDOA 2BCPA 1B37A 2OLNA 2Z5YA 3GD4A 1KNPA 1H6VA 5HYMA 3NKSA 4UDRA 2VOUA 1H7WA 3REDA 1YQZA 2R4EA 4BK2A 1PBDA 3AEDA 3GMCA 4NZHA 4U8MA 1QO8A 1CJ4A 1KSSA 4WX1A 2QAEA 4J34A 1EBDA 4ICYA 2C73A 2Y6RA 2XYOA 2X50A 3DJDA 3NT6A 4GF7A 4LU6A 2H88A 4U8JA 1FEAA 3UKHA 3NH3X 3AEEA 2NPXA 3SFDA 2C64A 1GETA 3RHAA 5DBJA 3CPHG 4GR1A 3UKPA 2IIDA 4B64A 4USRA 1CJ2A 2F5ZA 4HB9A 2FJBA 4JY3A 2WPFA 1P2HA 4EM3A 2WS3A 4U8PA 2EQ6A 2CULA 2XDOA 3AYLA 3M13A 3QVRA 2XFPA 2WHDA 1PHHA 2WU5A 4IVOB 4P9SA 2YR6A 4A5LA 1TDEA 2JKCA 4J31A 4C77A 4EQSA 3AB1A 4EQWA 1KNRA 1GOSA 3GRSA 5BVAA 3UTEA 4IA6A 2GR0A 1Q1WA 3L1RA 1CC6A 4H4VA 2C67A 4OPCA 3VRDB 4CCQA 3G5RA 1F8WA 4H2PA 4D03A 3AEFA 2ARDA 5EBKA 4ZN0A 4U8LA 2C75A 3PVCA 1H82A 1JNZA 4RSLA 3D8XA 3K7MX 4Z2TA 2XFNA 3NGCX 4EMWA 1LVLA 1BKWA 3AEGA 3GD3A 1W4XA 4XWZA 4A6NB 1LPFA 1MOKA 4H4SA 4PABA 3NTDA 5FS6A 5KRQA 1O95A 4H4PA 2V60A 4NTCA 1IUUA 3CGDA 2R0CA 3M12A 3QSEA 1F6MA 3VR9A 3BNMA 1DOEA 3KKJA 2XCGA 4ZCCA 4D04A 2VRMA 1L9EA 3ZYXA 1X31B 1FEBA 2GEWA 3UKKA 4J57A 5U63A 5M0ZA 3V3OA 3UTFA 1FCDA 2BYBA 1H83A 3AE8A 2BXRA 2FJAA 1GSNA 3DA1A 1GRFA 5KVIA 2OALA 4NEVA 2BK5A 1GTHA 3D1CA 1Q9IA 1QLBA 4YWOA 3VRBA 4YTNA 1PXAA 3UOVA 3NHOX 4FK1A 4NEWA 1YQ4A 2WOVA 2O9ZA 4J36A 1S2QA 1UKVG 1PN0A 4GRTA 2XLUA 2R45A 2YVGA 1GALA 3UTHA 2WP6A 4RG3A 3FIMB 1GERA 3URHA 4X4JA 3KD9A 3F8PA 3CNTA 3GDPA 4BJZA 4JDRA 4J2WA 3NLCA 3LADA 1E6EA 1IJHA 4OPGA 4B1BA 3IC9A 1KFYA 4C3YA 3AE1A 3CN8A 4YSHA 5KOXA 1TDFA 5U1OA 1E1LA 1MO9A 4EQRA 2C66A 1CJCA 3AXBA 3AE7A 2WETA 4N9XA 4UDQA 1PBCA 1DODA 1TYTA 2B9YA 2WESA 4B68A 4H4RA 4A7AA 3QSMA 1PS9A 4Z26A 3LXDA 1NHQA 3HZLA 4OPUA 2DKIA 4YT0A 3O0HA 3NYFA 2OLOA 4CBQA 1HYUA 1TYPA 2YWLA 2YR4A 3FBSA 3VQRA 3ZDNA 2CVJA 4H4WA 2QCUA 5EB4A 4O5QA 1IUTA 4IV9A 1PXCA 3IF9A 2A87A 2QA2A 2Z5XA 2X3NA 1LQUA 1ZOYA 1S2YA 2GQFA 2XLPA 2YG7A 1Y0PA 4FK1C 3AECA 3IWAA 2TPRA 2X8HA 2HQMA 1ONFA 4UDPA 3SM8A 4BK3A 2YQUA 1XHCA 1GRHA 2ZZBA 5KVHA 4EIQA 1PBBA 4CNKA 2X99A 2GMJA 4K5SA 3LJPA 4DSGA 1XANA 3NRNA 4ZCDA 4BV6A 3QJ4A 2BK3A 3ATQA 2E5VA 1Q1RA 4YXDA 4YSXA 4U2TA 3H8LA 3KLJA 5GSNA 1JOAA 4PAAA 2XLSA 1O5WA 3F8RA 2VRLA 4FX9A 3NG7X 3L8KA 3LB8A 2X8CA 5FS8A 2WBAA 2XVJA 3NN0X 3BI5A 1OJAA 2VZ2A 2WP5A 4U8KA 5EB5A 3ABVA 1ZX9A 4AP1A 4H4UA 2OA1A 1D5TA 2C3DA 2YG3A 4A6NA 3UOXA 4CNJA 1LV0A 4B67A 5KXJA 1PJ6A 3GWFA 4H2QA 2WQYA 1VG0A 3AD9B 2XVIA 3IHMA 2A8XA 3KA7A 3Q9TA 2XFUA 5J60A 2Q7VA 2AQJA 2XVEA 1OJ9A 3AE3A 3LZWA
chains in the Genus database with same CATH superfamily
2XFOA 4YTPA 1Y56B 1ZK7A 3P1WA 2V61A 2GQWA 1P2EA 5U25A 2Q0KA 3VR8A 2TMDA 1EL8A 4G73A 3DK8A 3UKAA 2XLRA 3ITJA 4M52A 4OPLA 3NK1X 3CGEA 1OJTA 3B6DA 1LJ1A 3UKLA 1NDAA 2FJEA 2ZBWA 3P4QA 1TDNA 1M6IA 2CDUA 1DOBA 4H4YA 1DOCA 1JU2A 3I3LA 1IUWA 3K7TA 2GR1A 4LA1A 1VQWA 3DGHA 5FS9A 3LOVA 4TLXA 2YG6A 1CHUA 3BHFA 2FJDA 2RGJA 3EPTA 4K5RA 3EANA 4XWRA 4OPDA 1K0JA 4HA6A 1NHSA 2WDVA 2BABA 1CC4A 3GYIA 3ATRA 2B76A 1LQTA 1PJ7A 2NVKX 1H84A 3P4PA 2C65A 3OZ2A 3AEBA 3KPKA 5HY5A 2RGHA 3WE0A 1AOGA 2R4JA 3GWDA 2B7SA 1GV4A 5LV9A 1E1MA 3P4SA 4JNAA 4OPTA 1JEHA 2C76A 4EQXA 1GPEA 2C3CA 3KVEA 5C2TA 2ZZ0A 3B3RA 2WPCA 3BNUA 1S3EA 2YG5A 1FOHA 4YKFA 1YQ3A 3VRAA 2VVLA 4TM4A 1BWCA 2EQ9A 3NIXA 4J33A 1NEKA 3ICRA 3AE2A 2JB3A 4ADWA 1NHPA 4IA5A 5KOWA 3AD7B 1VG9A 2RABA 4REKA 4B66A 5C3JA 1EL5A 4IVMB 3DK9A 4BURA 1TDKA 2B9XA 4B69A 4GDPA 1DJNA 3CPIG 1COYA 3AE4A 3DK4A 3ISHA 4H4ZA 4WCTA 3M0OA 4AOSA 1YY5A 2JB2A 1JNRA 3CNPA 4G74A 1CL0A 2GF3A 4Z2RA 5JCNA 2BACA 1B5QA 4G9KA 1K4QA 1L9DA 2BC1A 2V3BA 4YKGA 3CNDA 4USQA 1TRBA 2I0ZA 5J7XA 1GXFA 3RP8A 1GESA 2A89A 3ALJA 3DMEA 1FL2A 4Y4MA 1BGJA 4X9NA 1RP0A 5JCLA 3GMBA 1H81A 2H89A 4UP3A 4FDCB 1N1PA 4APNA 4Y4NA 4K7ZA 2YAUA 1CBOA 1GTEA 3S5WA 1F8RA 2BCGG 2YVFA 2V5ZA 1CF3A 1N4WA 5BULA 2W0HA 1IUSA 1OJCA 2WDQA 1PJ5A 2RGOA 3ICTA 4J56A 4NWZA 2CFYA 3DJEA 4JNQA 2JB1A 1E1NA 1E1KA 3P9UA 4H50A 4EMIA 1GREA 3GSIA 2PYXA 3GYXA 2YLWA 4NTEA 1JRZA 4JY2A 3ICSA 4OVIA 5FS7A 2E1MA 3QFAA 3V76A 1ZKQA 5M10A 2BK4A 1RYIA 3NK2X 1NG3A 5ER0A 3OC4A 3S61A 4EMJA 4E0VA 3NYCA 4TLZA 1Y56A 3GRTA 1GRBA 4Z44A 2VQ7A 3UP4A 4Z25A 3P4RA 4U2LA 3F8DA 3QFBA 4TM1A 1CC2A 1NENA 2WEUA 4GCMA 4AT0A 1L0VA 1GRTA 1GNDA 1ZOVA 1M64A 1K0IA 1PBFA 2EQ7A 3FPZA 2E4GA 1YKJA 1RSGA 1N4VA 2YLRA 3ALMA 2J3NA 3CPJG 1NHRA 4Z2UA 3V3NA 1H7XA 4B65A 4A65A 1B4VA 4KX6A 4CCRA 5JCIA 5EOWA 4I58A 4BK1A 1D7LA 1E39A 3PS9A 2BS2A 2Q6UA 4YTMA 3SY4A 3RNMA 5L46A 1O94A 2GMHA 4TM3A 4GAVA 4U2SA 2X8GA 3H8IA 4X9MA 4B63A 3GDNA 3T2KA 2C70A 1OJDA 1ZDLA 2GAHB 2R0PA 2YLSA 3AWIA 3C4AA 2R46A 2YLTA 3QSSA 4LIIA 3T31A 2YM1A 2XVHA 1K0LA 2BRYA 2YM2A 3HYVA 1BF3A 1Z6LA 1D4EA 1S3BA 3CGBA 3G5QA 4U8IA 1KDGA 2C72A 4DGKA 5IQ4A 1XPQA 5KNLA 5TR3A 3UP5A 5HHFA 3AE6A 3C96A 2VVLG 1NG4A 2GH5A 2XLTA 2ZZCA 2GVCA 2V3AA 1D4CA 3II4A 1PDHA 2PHHA 3H4KA 4H2RA 3SFEA 3E1TA 5JCMA 5KWFA 2BA9A 4Z24A 3AYJA 3CMMA 2GB0A 2XVFA 3K30A 1BZLA 3CNSA 4RG4A 2APGA 2Q0LA 3NN6X 3DH9A 3DJGX 3SQPA 4YSYA 3CGCA 1F3PA 3NTAA 3RP7A 3DGZA 2FBWA 4A79A 2B7RA 4TM0A 3EAOA 3UCLA 5IPYA 3JSKA 3Q6JA 1V59A 2Y6QA 2GR2A 2VQBA 3UKQA 4EM4A 4Y4LA 1LTXR 3CIRA 3UTGA 2YG4A 3T2ZA 4C3XA 4Z43A 4H4TA 1D7YA 1JRYA 3T37A 3FG2P 4CRTA 1ZMCA 2EQ8A 5GRTA 2OAMA 4DSHA 1GRAA 3AD8B 4XXGA 1QJDA 5CKUA 1CJ3A 2QA1A 4BJYA 2GR3A 1NPXA 1PBEA 3UOYA 1DJQA 3RP6A 3DJJA 3ADAB 1ZY8A 1BGNA 3SGLA 4AT2A 3KPFA 5FMHA 4K22A 1N4UA 3COXA 3CNJA 4OPIA 4AP3A 3G5SA 2YLZA 4C5OA 5CQFA 2ACZA 2IVDA 1IUXA 3I6DA 4K8DA 1ZP0A 1JRXA 1VDCA 1MXTA 3KU9A 3R9UA 2AR8A 5JCKA 4H4QA 2XFQA 1XDIA 4H2NA 4U8NA 5BRTA 3AEAA 2JAEA 4AOXA 5HXIA 1DXLA 3C4NA 3SZCA 2GAGB 4ECHA 3AE5A 3BHKA 3CTYA 2BS4A 2IVEA 2B9WA 1IUVA 2AAQA 4NNJA 1B8SA 1KSUA 2V6OA 4H7UA 3UOZA 3EF6A 2WPEA 2C4CA 3AE9A 2GV8A 1GEUA 1PXBA 3UKFA 2DKHA 2BC0A 3IHGA 3BI4A 4GDEA 4NTDA 4JN9A 2VVMA 4A99A 1F8SA 2R0GA 4OCGA 4JQ9A 1REOA 2JBVA 2YLXA 2R9ZA 3NNEA 2BS3A 4CY8A 1EL7A 2C7GA 2YVJA 1H86A 3ALLA 3LZXA 4KPRA 4MJWA 4U8OA 4GUVA 4DNAA 5BUKA 2WDRA 2UZZA 3FMWA 4K2XA 1E7PA 2WOIA 2YR5A 3GYJA 1VRQB 4A9WA 1FECA 1GRGA 4CY6A 1KF6A 2GRTA 2WOWA 5IQ1A 2WU2A 4C74A 3NYEA 1DNCA 4H4XA 3NK0X 4EIPA 3AYIA 1ZMDA 2WP9A 4YSZA 4I59A 1EL9A 1L9CA 3PO7A 1ELIA 1SEZA 4O5UA 3BI2A 3HYWA 1GT8A 4II2A 1D4DA 1NAAA 2JK6A 3QVPA 3K7QX 2BXSA 1TDOA 2BCPA 1B37A 2OLNA 2Z5YA 3GD4A 1KNPA 1H6VA 5HYMA 3NKSA 4UDRA 2VOUA 1H7WA 3REDA 1YQZA 2R4EA 4BK2A 1PBDA 3AEDA 4G6HA 3GMCA 4NZHA 4U8MA 1QO8A 3SZWA 1CJ4A 1KSSA 4II3A 3SYIA 2BRAA 4WX1A 2QAEA 4J34A 1EBDA 4ICYA 2C73A 2Y6RA 2XYOA 2X50A 3DJDA 3NT6A 4GF7A 4LU6A 2H88A 4U8JA 1FEAA 3UKHA 3NH3X 3AEEA 2NPXA 3SFDA 2C64A 1GETA 3RHAA 5DBJA 3CPHG 4GR1A 3UKPA 2IIDA 3SX6A 4B64A 4USRA 5KMRA 1CJ2A 2F5ZA 4HB9A 2FJBA 4JY3A 2WPFA 1P2HA 4EM3A 2WS3A 4U8PA 2EQ6A 2CULA 2XDOA 3AYLA 3M13A 3QVRA 2XFPA 2WHDA 1PHHA 2WU5A 4IVOB 4P9SA 2YR6A 4A5LA 1TDEA 2JKCA 4J31A 4C77A 4EQSA 3AB1A 4EQWA 1KNRA 1GOSA 3GRSA 5BVAA 3UTEA 4IA6A 2GR0A 3T14A 4GAPA 1Q1WA 3L1RA 1CC6A 4H4VA 2C67A 4OPCA 3VRDB 4CCQA 3G5RA 1F8WA 4H2PA 4D03A 3AEFA 2ARDA 5EBKA 3SZFA 4ZN0A 4U8LA 2C75A 3PVCA 1H82A 1JNZA 4RSLA 3SXIA 3D8XA 3K7MX 4Z2TA 2XFNA 3NGCX 4EMWA 1LVLA 1BKWA 3AEGA 3GD3A 1W4XA 4XWZA 4A6NB 1LPFA 1MOKA 4H4SA 4PABA 3NTDA 5FS6A 5KRQA 1O95A 4H4PA 2V60A 4NTCA 1IUUA 3CGDA 2R0CA 3M12A 3QSEA 5KMSA 1F6MA 3VR9A 3BNMA 1DOEA 3KKJA 2XCGA 4ZCCA 4D04A 2VRMA 1L9EA 3ZYXA 1X31B 1FEBA 2GEWA 3UKKA 4J57A 5U63A 5M0ZA 3V3OA 3UTFA 1FCDA 2BYBA 1H83A 3AE8A 2BXRA 2FJAA 1GSNA 3DA1A 1GRFA 5KVIA 2OALA 4NEVA 2BK5A 1GTHA 3D1CA 1Q9IA 1QLBA 4YWOA 4G6GA 3VRBA 4YTNA 1PXAA 3UOVA 3NHOX 4FK1A 4NEWA 1YQ4A 2WOVA 2O9ZA 4J36A 1S2QA 1UKVG 1PN0A 4GRTA 2XLUA 2R45A 2YVGA 1GALA 3UTHA 2WP6A 4RG3A 3FIMB 1GERA 3URHA 4X4JA 3KD9A 3F8PA 3CNTA 3GDPA 4BJZA 3HYXA 4JDRA 4J2WA 3NLCA 3LADA 1E6EA 1IJHA 4OPGA 4B1BA 3IC9A 1KFYA 4C3YA 3AE1A 3CN8A 4YSHA 5KOXA 1TDFA 5U1OA 1E1LA 1MO9A 4EQRA 2C66A 3T0KA 3SZ0A 1CJCA 3AXBA 3AE7A 2WETA 4N9XA 4UDQA 1PBCA 1DODA 1TYTA 2B9YA 2WESA 4B68A 4H4RA 4A7AA 3QSMA 1PS9A 4Z26A 3LXDA 1NHQA 3HZLA 4OPUA 2DKIA 4YT0A 3O0HA 3NYFA 2OLOA 4CBQA 1HYUA 1TYPA 2YWLA 2YR4A 3FBSA 3VQRA 3ZDNA 2CVJA 4H4WA 2QCUA 5EB4A 4O5QA 1IUTA 4IV9A 1PXCA 3IF9A 2A87A 2QA2A 2Z5XA 2X3NA 1LQUA 1ZOYA 1S2YA 2GQFA 2XLPA 2YG7A 1Y0PA 4FK1C 3AECA 3IWAA 2TPRA 2X8HA 2HQMA 1ONFA 4UDPA 3SM8A 4BK3A 2YQUA 1XHCA 1GRHA 2ZZBA 5KVHA 4EIQA 1PBBA 4CNKA 2X99A 2GMJA 4K5SA 3LJPA 4DSGA 1XANA 3NRNA 4ZCDA 5KMQA 4BV6A 3QJ4A 2BK3A 3ATQA 2E5VA 1Q1RA 4YXDA 4YSXA 4U2TA 3H8LA 3KLJA 5GSNA 1JOAA 4PAAA 2XLSA 1O5WA 3F8RA 2VRLA 4FX9A 5KMPA 3NG7X 3L8KA 3LB8A 2X8CA 5FS8A 2WBAA 3T2YA 2XVJA 3NN0X 3BI5A 1OJAA 2VZ2A 2WP5A 4U8KA 5EB5A 3ABVA 1ZX9A 4AP1A 4H4UA 2OA1A 1D5TA 2C3DA 2YG3A 4A6NA 3UOXA 4CNJA 1LV0A 4B67A 5KXJA 1PJ6A 3GWFA 4H2QA 2WQYA 1VG0A 3AD9B 2XVIA 3IHMA 2A8XA 3KA7A 3Q9TA 2XFUA 5J60A 2Q7VA 2AQJA 2XVEA 1OJ9A 3AE3A 3LZWA
chains in the Genus database with same CATH topology
2XFOA 4YTPA 1Y56B 1ZK7A 3P1WA 2V61A 2GQWA 1P2EA 5U25A 2Q0KA 3VR8A 2TMDA 1EL8A 4G73A 3DK8A 3UKAA 2XLRA 3ITJA 4M52A 4OPLA 3NK1X 3CGEA 1OJTA 3B6DA 1LJ1A 3UKLA 1NDAA 2FJEA 2ZBWA 3P4QA 1TDNA 1M6IA 2CDUA 1DOBA 4H4YA 1DOCA 1JU2A 3I3LA 1IUWA 3K7TA 2GR1A 4LA1A 1VQWA 3DGHA 5FS9A 3LOVA 4TLXA 2YG6A 1CHUA 3BHFA 2FJDA 2RGJA 3EPTA 4K5RA 3EANA 4XWRA 4OPDA 1K0JA 4HA6A 1NHSA 2WDVA 2BABA 1CC4A 3GYIA 3ATRA 2B76A 1LQTA 1PJ7A 2NVKX 1H84A 3P4PA 2C65A 3OZ2A 3AEBA 3KPKA 5HY5A 2RGHA 3WE0A 1AOGA 2R4JA 3GWDA 2B7SA 1GV4A 5LV9A 1E1MA 3P4SA 4JNAA 4OPTA 1JEHA 2C76A 4EQXA 1GPEA 2C3CA 3KVEA 5C2TA 2ZZ0A 3B3RA 2WPCA 3BNUA 1S3EA 2YG5A 1FOHA 4YKFA 1YQ3A 3VRAA 2VVLA 4TM4A 1BWCA 2EQ9A 3NIXA 4J33A 1NEKA 3ICRA 3AE2A 2JB3A 4ADWA 1NHPA 4IA5A 5KOWA 3AD7B 1VG9A 2RABA 4REKA 4B66A 5C3JA 1EL5A 4IVMB 3DK9A 4BURA 1TDKA 2B9XA 4B69A 4GDPA 1DJNA 3CPIG 1COYA 3AE4A 3DK4A 3ISHA 4H4ZA 4WCTA 3M0OA 4AOSA 1YY5A 2JB2A 1JNRA 3CNPA 4G74A 1CL0A 2GF3A 4Z2RA 5JCNA 2BACA 1B5QA 4G9KA 1K4QA 1L9DA 2BC1A 2V3BA 4YKGA 3CNDA 4USQA 1TRBA 2I0ZA 5J7XA 1GXFA 3RP8A 1GESA 2A89A 3ALJA 3DMEA 1FL2A 4Y4MA 1BGJA 4X9NA 1RP0A 5JCLA 3GMBA 1H81A 2H89A 4UP3A 4FDCB 1N1PA 4APNA 4Y4NA 4K7ZA 2YAUA 1CBOA 1GTEA 3S5WA 1F8RA 2BCGG 2YVFA 2V5ZA 1CF3A 1N4WA 5BULA 2W0HA 1IUSA 1OJCA 2WDQA 1PJ5A 2RGOA 3ICTA 4J56A 4NWZA 2CFYA 3DJEA 4JNQA 2JB1A 1E1NA 1E1KA 3P9UA 4H50A 4EMIA 1GREA 3GSIA 2PYXA 3GYXA 2YLWA 4NTEA 1JRZA 4JY2A 3ICSA 4OVIA 5FS7A 2E1MA 3QFAA 3V76A 1ZKQA 5M10A 2BK4A 1RYIA 3NK2X 1NG3A 5ER0A 3OC4A 3S61A 4EMJA 4E0VA 3NYCA 4TLZA 1Y56A 3GRTA 1GRBA 4Z44A 2VQ7A 3UP4A 4Z25A 3P4RA 4U2LA 3F8DA 3QFBA 4TM1A 1CC2A 1NENA 2WEUA 4GCMA 4AT0A 1L0VA 1GRTA 1GNDA 1ZOVA 1M64A 1K0IA 1PBFA 2EQ7A 3FPZA 2E4GA 1YKJA 1RSGA 1N4VA 2YLRA 3ALMA 2J3NA 3CPJG 1NHRA 4Z2UA 3V3NA 1H7XA 4B65A 4A65A 1B4VA 4KX6A 4CCRA 5JCIA 5EOWA 4I58A 4BK1A 1D7LA 1E39A 3PS9A 2BS2A 2Q6UA 4YTMA 3SY4A 3RNMA 5L46A 1O94A 2GMHA 4TM3A 4GAVA 4U2SA 2X8GA 3H8IA 4X9MA 4B63A 3GDNA 3T2KA 2C70A 1OJDA 1ZDLA 2GAHB 2R0PA 2YLSA 3AWIA 3C4AA 2R46A 2YLTA 3QSSA 4LIIA 3T31A 2YM1A 2XVHA 1K0LA 2BRYA 2YM2A 3HYVA 1BF3A 1Z6LA 1D4EA 1S3BA 3CGBA 3G5QA 4U8IA 1KDGA 2C72A 4DGKA 5IQ4A 1XPQA 5KNLA 5TR3A 3UP5A 5HHFA 3AE6A 3C96A 2VVLG 1NG4A 2GH5A 2XLTA 2ZZCA 2GVCA 2V3AA 1D4CA 3II4A 1PDHA 2PHHA 3H4KA 4H2RA 3SFEA 3E1TA 5JCMA 5KWFA 2BA9A 4Z24A 3AYJA 3CMMA 2GB0A 2XVFA 3K30A 1BZLA 3CNSA 4RG4A 2APGA 2Q0LA 3NN6X 3DH9A 3DJGX 3SQPA 4YSYA 3CGCA 1F3PA 3NTAA 3RP7A 3DGZA 2FBWA 4A79A 2B7RA 4TM0A 3EAOA 3UCLA 5IPYA 3JSKA 3Q6JA 1V59A 2Y6QA 2GR2A 2VQBA 3UKQA 4EM4A 4Y4LA 1LTXR 3CIRA 3UTGA 2YG4A 3T2ZA 4C3XA 4Z43A 4H4TA 1D7YA 1JRYA 3T37A 3FG2P 4CRTA 1ZMCA 2EQ8A 5GRTA 2OAMA 4DSHA 1GRAA 3AD8B 4XXGA 1QJDA 5CKUA 1CJ3A 2QA1A 4BJYA 2GR3A 1NPXA 1PBEA 3UOYA 1DJQA 3RP6A 3DJJA 3ADAB 1ZY8A 1BGNA 3SGLA 4AT2A 3KPFA 5FMHA 4K22A 1N4UA 3COXA 3CNJA 4OPIA 4AP3A 3G5SA 2YLZA 4C5OA 5CQFA 2ACZA 2IVDA 1IUXA 3I6DA 4K8DA 1ZP0A 1JRXA 1VDCA 1MXTA 3KU9A 3R9UA 2AR8A 5JCKA 4H4QA 2XFQA 1XDIA 4H2NA 4U8NA 5BRTA 3AEAA 2JAEA 4AOXA 5HXIA 1DXLA 3C4NA 3SZCA 2GAGB 4ECHA 3AE5A 3BHKA 3CTYA 2BS4A 2IVEA 2B9WA 1IUVA 2AAQA 4NNJA 1B8SA 1KSUA 2V6OA 4H7UA 3UOZA 3EF6A 2WPEA 2C4CA 3AE9A 2GV8A 1GEUA 1PXBA 3UKFA 2DKHA 2BC0A 3IHGA 3BI4A 4GDEA 4NTDA 4JN9A 2VVMA 4A99A 1F8SA 2R0GA 4OCGA 4JQ9A 1REOA 2JBVA 2YLXA 2R9ZA 3NNEA 2BS3A 4CY8A 1EL7A 2C7GA 2YVJA 1H86A 3ALLA 3LZXA 4KPRA 4MJWA 4U8OA 4GUVA 4DNAA 5BUKA 2WDRA 2UZZA 3FMWA 4K2XA 1E7PA 2WOIA 2YR5A 3GYJA 1VRQB 4A9WA 1FECA 1GRGA 4CY6A 1KF6A 2GRTA 2WOWA 5IQ1A 2WU2A 4C74A 3NYEA 1DNCA 4H4XA 3NK0X 4EIPA 3AYIA 1ZMDA 2WP9A 4YSZA 4I59A 1EL9A 1L9CA 3PO7A 1ELIA 1SEZA 4O5UA 3BI2A 3HYWA 1GT8A 4II2A 1D4DA 1NAAA 2JK6A 3QVPA 3K7QX 2BXSA 1TDOA 2BCPA 1B37A 2OLNA 2Z5YA 3GD4A 1KNPA 1H6VA 5HYMA 3NKSA 4UDRA 2VOUA 1H7WA 3REDA 1YQZA 2R4EA 4BK2A 1PBDA 3AEDA 4G6HA 3GMCA 4NZHA 4U8MA 1QO8A 3SZWA 1CJ4A 1KSSA 4II3A 3SYIA 2BRAA 4WX1A 2QAEA 4J34A 1EBDA 4ICYA 2C73A 2Y6RA 2XYOA 2X50A 3DJDA 3NT6A 4GF7A 4LU6A 2H88A 4U8JA 1FEAA 3UKHA 3NH3X 3AEEA 2NPXA 3SFDA 2C64A 1GETA 3RHAA 5DBJA 3CPHG 4GR1A 3UKPA 2IIDA 3SX6A 4B64A 4USRA 5KMRA 1CJ2A 2F5ZA 4HB9A 2FJBA 4JY3A 2WPFA 1P2HA 4EM3A 2WS3A 4U8PA 2EQ6A 2CULA 2XDOA 3AYLA 3M13A 3QVRA 2XFPA 2WHDA 1PHHA 2WU5A 4IVOB 4P9SA 2YR6A 4A5LA 1TDEA 2JKCA 4J31A 4C77A 4EQSA 3AB1A 4EQWA 1KNRA 1GOSA 3GRSA 5BVAA 3UTEA 4IA6A 2GR0A 3T14A 4GAPA 1Q1WA 3L1RA 1CC6A 4H4VA 2C67A 4OPCA 3VRDB 4CCQA 3G5RA 1F8WA 4H2PA 4D03A 3AEFA 2ARDA 5EBKA 3SZFA 4ZN0A 4U8LA 2C75A 3PVCA 1H82A 1JNZA 4RSLA 3SXIA 3D8XA 3K7MX 4Z2TA 2XFNA 3NGCX 4EMWA 1LVLA 1BKWA 3AEGA 3GD3A 1W4XA 4XWZA 4A6NB 1LPFA 1MOKA 4H4SA 4PABA 3NTDA 5FS6A 5KRQA 1O95A 4H4PA 2V60A 4NTCA 1IUUA 3CGDA 2R0CA 3M12A 3QSEA 5KMSA 1F6MA 3VR9A 3BNMA 1DOEA 3KKJA 2XCGA 4ZCCA 4D04A 2VRMA 1L9EA 3ZYXA 1X31B 1FEBA 2GEWA 3UKKA 4J57A 5U63A 5M0ZA 3V3OA 3UTFA 1FCDA 2BYBA 1H83A 3AE8A 2BXRA 2FJAA 1GSNA 3DA1A 1GRFA 5KVIA 2OALA 4NEVA 2BK5A 1GTHA 3D1CA 1Q9IA 1QLBA 4YWOA 4G6GA 3VRBA 4YTNA 1PXAA 3UOVA 3NHOX 4FK1A 4NEWA 1YQ4A 2WOVA 2O9ZA 4J36A 1S2QA 1UKVG 1PN0A 4GRTA 2XLUA 2R45A 2YVGA 1GALA 3UTHA 2WP6A 4RG3A 3FIMB 1GERA 3URHA 4X4JA 3KD9A 3F8PA 3CNTA 3GDPA 4BJZA 3HYXA 4JDRA 4J2WA 3NLCA 3LADA 1E6EA 1IJHA 4OPGA 4B1BA 3IC9A 1KFYA 4C3YA 3AE1A 3CN8A 4YSHA 5KOXA 1TDFA 5U1OA 1E1LA 1MO9A 4EQRA 2C66A 3T0KA 3SZ0A 1CJCA 3AXBA 3AE7A 2WETA 4N9XA 4UDQA 1PBCA 1DODA 1TYTA 2B9YA 2WESA 4B68A 4H4RA 4A7AA 3QSMA 1PS9A 4Z26A 3LXDA 1NHQA 3HZLA 4OPUA 2DKIA 4YT0A 3O0HA 3NYFA 2OLOA 4CBQA 1HYUA 1TYPA 2YWLA 2YR4A 3FBSA 3VQRA 3ZDNA 2CVJA 4H4WA 2QCUA 5EB4A 4O5QA 1IUTA 4IV9A 1PXCA 3IF9A 2A87A 2QA2A 2Z5XA 2X3NA 1LQUA 1ZOYA 1S2YA 2GQFA 2XLPA 2YG7A 1Y0PA 4FK1C 3AECA 3IWAA 2TPRA 2X8HA 2HQMA 1ONFA 4UDPA 3SM8A 4BK3A 2YQUA 1XHCA 1GRHA 2ZZBA 5KVHA 4EIQA 1PBBA 4CNKA 2X99A 2GMJA 4K5SA 3LJPA 4DSGA 1XANA 3NRNA 4ZCDA 5KMQA 4BV6A 3QJ4A 2BK3A 3ATQA 2E5VA 1Q1RA 4YXDA 4YSXA 4U2TA 3H8LA 3KLJA 5GSNA 1JOAA 4PAAA 2XLSA 1O5WA 3F8RA 2VRLA 4FX9A 5KMPA 3NG7X 3L8KA 3LB8A 2X8CA 5FS8A 2WBAA 3T2YA 2XVJA 3NN0X 3BI5A 1OJAA 2VZ2A 2WP5A 4U8KA 5EB5A 3ABVA 1ZX9A 4AP1A 4H4UA 2OA1A 1D5TA 2C3DA 2YG3A 4A6NA 3UOXA 4CNJA 1LV0A 4B67A 5KXJA 1PJ6A 3GWFA 4H2QA 2WQYA 1VG0A 3AD9B 2XVIA 3IHMA 2A8XA 3KA7A 3Q9TA 2XFUA 5J60A 2Q7VA 2AQJA 2XVEA 1OJ9A 3AE3A 3LZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFO A;  4YTP A;  1Y56 B;  1ZK7 A;  3P1W A;  2V61 A;  2GQW A;  1P2E A;  5U25 A;  2Q0K A;  3VR8 A;  2TMD A;  1EL8 A;  3DK8 A;  3UKA A;  2XLR A;  3ITJ A;  4M52 A;  4OPL A;  3NK1 X;  3CGE A;  1OJT A;  3B6D A;  1LJ1 A;  3UKL A;  1NDA A;  2FJE A;  2ZBW A;  3P4Q A;  1TDN A;  1M6I A;  2CDU A;  1DOB A;  4H4Y A;  1DOC A;  1JU2 A;  3I3L A;  1IUW A;  3K7T A;  2GR1 A;  4LA1 A;  1VQW A;  3DGH A;  5FS9 A;  3LOV A;  4TLX A;  2YG6 A;  1CHU A;  3BHF A;  2FJD A;  2RGJ A;  3EPT A;  4K5R A;  3EAN A;  4XWR A;  4OPD A;  1K0J A;  4HA6 A;  1NHS A;  2WDV A;  2BAB A;  1CC4 A;  3GYI A;  3ATR A;  2B76 A;  1LQT A;  1PJ7 A;  2NVK X;  1H84 A;  3P4P A;  2C65 A;  3OZ2 A;  3AEB A;  5HY5 A;  2RGH A;  3WE0 A;  1AOG A;  2R4J A;  3GWD A;  2B7S A;  1GV4 A;  5LV9 A;  1E1M A;  3P4S A;  4JNA A;  4OPT A;  1JEH A;  2C76 A;  4EQX A;  1GPE A;  2C3C A;  3KVE A;  5C2T A;  2ZZ0 A;  3B3R A;  2WPC A;  3BNU A;  1S3E A;  2YG5 A;  1FOH A;  4YKF A;  1YQ3 A;  3VRA A;  2VVL A;  4TM4 A;  1BWC A;  2EQ9 A;  3NIX A;  4J33 A;  1NEK A;  3ICR A;  3AE2 A;  2JB3 A;  4ADW A;  1NHP A;  4IA5 A;  5KOW A;  3AD7 B;  1VG9 A;  2RAB A;  4REK A;  4B66 A;  5C3J A;  1EL5 A;  4IVM B;  3DK9 A;  4BUR A;  1TDK A;  2B9X A;  4B69 A;  4GDP A;  1DJN A;  3CPI G;  1COY A;  3AE4 A;  3DK4 A;  3ISH A;  4H4Z A;  4WCT A;  3M0O A;  4AOS A;  1YY5 A;  2JB2 A;  1JNR A;  3CNP A;  1CL0 A;  2GF3 A;  4Z2R A;  5JCN A;  2BAC A;  1B5Q A;  1K4Q A;  1L9D A;  2BC1 A;  2V3B A;  4YKG A;  3CND A;  4USQ A;  1TRB A;  2I0Z A;  5J7X A;  1GXF A;  3RP8 A;  1GES A;  2A89 A;  3ALJ A;  3DME A;  1FL2 A;  4Y4M A;  1BGJ A;  4X9N A;  1RP0 A;  5JCL A;  3GMB A;  1H81 A;  2H89 A;  4UP3 A;  4FDC B;  1N1P A;  4APN A;  4Y4N A;  4K7Z A;  2YAU A;  1CBO A;  1GTE A;  3S5W A;  1F8R A;  2BCG G;  2YVF A;  2V5Z A;  1CF3 A;  1N4W A;  5BUL A;  2W0H A;  1IUS A;  1OJC A;  2WDQ A;  1PJ5 A;  2RGO A;  3ICT A;  4J56 A;  2CFY A;  3DJE A;  4JNQ A;  2JB1 A;  1E1N A;  1E1K A;  3P9U A;  4H50 A;  4EMI A;  1GRE A;  3GSI A;  2PYX A;  2YLW A;  4NTE A;  1JRZ A;  4JY2 A;  3ICS A;  4OVI A;  5FS7 A;  2E1M A;  3QFA A;  3V76 A;  1ZKQ A;  5M10 A;  2BK4 A;  1RYI A;  3NK2 X;  1NG3 A;  5ER0 A;  3OC4 A;  3S61 A;  4EMJ A;  4E0V A;  3NYC A;  4TLZ A;  1Y56 A;  3GRT A;  1GRB A;  4Z44 A;  2VQ7 A;  3UP4 A;  4Z25 A;  3P4R A;  4U2L A;  3F8D A;  3QFB A;  4TM1 A;  1CC2 A;  1NEN A;  2WEU A;  4GCM A;  4AT0 A;  1L0V A;  1GRT A;  1GND A;  1ZOV A;  1M64 A;  1K0I A;  1PBF A;  2EQ7 A;  3FPZ A;  2E4G A;  1YKJ A;  1RSG A;  1N4V A;  2YLR A;  3ALM A;  2J3N A;  3CPJ G;  1NHR A;  4Z2U A;  3V3N A;  1H7X A;  4B65 A;  4A65 A;  1B4V A;  4KX6 A;  4CCR A;  5JCI A;  5EOW A;  4I58 A;  4BK1 A;  1D7L A;  1E39 A;  3PS9 A;  2BS2 A;  2Q6U A;  4YTM A;  3RNM A;  5L46 A;  1O94 A;  2GMH A;  4TM3 A;  4U2S A;  4X9M A;  2X8G A;  3H8I A;  4B63 A;  3GDN A;  2C70 A;  1OJD A;  1ZDL A;  2GAH B;  2R0P A;  2YLS A;  3AWI A;  3C4A A;  2R46 A;  2YLT A;  3QSS A;  4LII A;  2YM1 A;  2XVH A;  1K0L A;  2YM2 A;  1BF3 A;  1Z6L A;  1D4E A;  1S3B A;  3CGB A;  3G5Q A;  4U8I A;  1KDG A;  2C72 A;  4DGK A;  5IQ4 A;  1XPQ A;  5TR3 A;  3UP5 A;  5HHF A;  3AE6 A;  3C96 A;  2VVL G;  1NG4 A;  2GH5 A;  2XLT A;  2ZZC A;  2GVC A;  2V3A A;  1D4C A;  3II4 A;  1PDH A;  2PHH A;  3H4K A;  4H2R A;  3SFE A;  3E1T A;  5JCM A;  5KWF A;  2BA9 A;  4Z24 A;  3AYJ A;  2GB0 A;  2XVF A;  3K30 A;  1BZL A;  3CNS A;  4RG4 A;  2APG A;  2Q0L A;  3NN6 X;  3DH9 A;  3DJG X;  3SQP A;  4YSY A;  3CGC A;  1F3P A;  3NTA A;  3RP7 A;  3DGZ A;  2FBW A;  4A79 A;  2B7R A;  4TM0 A;  3EAO A;  3UCL A;  5IPY A;  3JSK A;  3Q6J A;  1V59 A;  2Y6Q A;  2GR2 A;  2VQB A;  3UKQ A;  4EM4 A;  4Y4L A;  1LTX R;  3CIR A;  3UTG A;  2YG4 A;  4C3X A;  4Z43 A;  4H4T A;  1D7Y A;  1JRY A;  3T37 A;  3FG2 P;  4CRT A;  1ZMC A;  2EQ8 A;  5GRT A;  2OAM A;  4DSH A;  1GRA A;  3AD8 B;  4XXG A;  1QJD A;  5CKU A;  1CJ3 A;  2QA1 A;  4BJY A;  2GR3 A;  1NPX A;  1PBE A;  3UOY A;  1DJQ A;  3RP6 A;  3DJJ A;  3ADA B;  1ZY8 A;  1BGN A;  3SGL A;  4AT2 A;  3KPF A;  5FMH A;  4K22 A;  1N4U A;  3COX A;  3CNJ A;  4OPI A;  4AP3 A;  3G5S A;  2YLZ A;  4C5O A;  5CQF A;  2ACZ A;  2IVD A;  1IUX A;  3I6D A;  4K8D A;  1ZP0 A;  1JRX A;  1VDC A;  1MXT A;  3KU9 A;  3R9U A;  2AR8 A;  5JCK A;  4H4Q A;  2XFQ A;  1XDI A;  4H2N A;  4U8N A;  5BRT A;  3AEA A;  2JAE A;  4AOX A;  5HXI A;  1DXL A;  3C4N A;  4ECH A;  2GAG B;  3AE5 A;  3BHK A;  3CTY A;  2BS4 A;  2IVE A;  2B9W A;  1IUV A;  2AAQ A;  3UOZ A;  1B8S A;  1KSU A;  2V6O A;  4H7U A;  3EF6 A;  2WPE A;  3AE9 A;  2GV8 A;  1GEU A;  1PXB A;  3UKF A;  2DKH A;  2BC0 A;  3IHG A;  3BI4 A;  4GDE A;  4NTD A;  4JN9 A;  2VVM A;  4A99 A;  1F8S A;  2R0G A;  4OCG A;  4JQ9 A;  1REO A;  2JBV A;  2YLX A;  2R9Z A;  3NNE A;  2BS3 A;  4CY8 A;  1EL7 A;  2C7G A;  2YVJ A;  1H86 A;  3ALL A;  3LZX A;  4KPR A;  4MJW A;  4U8O A;  4GUV A;  4DNA A;  5BUK A;  2WDR A;  2UZZ A;  3FMW A;  4K2X A;  1E7P A;  2WOI A;  2YR5 A;  3GYJ A;  1VRQ B;  4A9W A;  1FEC A;  1GRG A;  4CY6 A;  1KF6 A;  2GRT A;  2WOW A;  5IQ1 A;  2WU2 A;  4C74 A;  3NYE A;  1DNC A;  4H4X A;  3NK0 X;  4EIP A;  3AYI A;  1ZMD A;  2WP9 A;  4YSZ A;  4I59 A;  1EL9 A;  1L9C A;  3PO7 A;  1ELI A;  1SEZ A;  4O5U A;  3BI2 A;  1GT8 A;  1D4D A;  1NAA A;  2JK6 A;  3QVP A;  3K7Q X;  2BXS A;  1TDO A;  2BCP A;  1B37 A;  2OLN A;  2Z5Y A;  3GD4 A;  1KNP A;  1H6V A;  5HYM A;  3NKS A;  4UDR A;  2VOU A;  1H7W A;  3RED A;  1YQZ A;  2R4E A;  4BK2 A;  1PBD A;  3AED A;  3GMC A;  4NZH A;  4U8M A;  1QO8 A;  1CJ4 A;  1KSS A;  4WX1 A;  2QAE A;  4J34 A;  1EBD A;  4ICY A;  2C73 A;  2Y6R A;  2XYO A;  2X50 A;  3DJD A;  3NT6 A;  4GF7 A;  4LU6 A;  2H88 A;  4U8J A;  1FEA A;  3UKH A;  3NH3 X;  3AEE A;  2NPX A;  3SFD A;  2C64 A;  1GET A;  3RHA A;  5DBJ A;  3CPH G;  4GR1 A;  3UKP A;  2IID A;  4B64 A;  4USR A;  1CJ2 A;  2F5Z A;  4HB9 A;  2FJB A;  4JY3 A;  2WPF A;  1P2H A;  4EM3 A;  2WS3 A;  4U8P A;  2EQ6 A;  2CUL A;  2XDO A;  3AYL A;  3M13 A;  3QVR A;  2XFP A;  2WHD A;  1PHH A;  2WU5 A;  4IVO B;  4P9S A;  2YR6 A;  4A5L A;  1TDE A;  2JKC A;  4J31 A;  4C77 A;  4EQS A;  3AB1 A;  4EQW A;  1KNR A;  1GOS A;  3GRS A;  5BVA A;  3UTE A;  4IA6 A;  2GR0 A;  1Q1W A;  3L1R A;  1CC6 A;  4H4V A;  2C67 A;  4OPC A;  3VRD B;  4CCQ A;  3G5R A;  1F8W A;  4H2P A;  4D03 A;  3AEF A;  2ARD A;  5EBK A;  4ZN0 A;  4U8L A;  2C75 A;  3PVC A;  1H82 A;  1JNZ A;  4RSL A;  3D8X A;  3K7M X;  4Z2T A;  2XFN A;  3NGC X;  4EMW A;  1LVL A;  1BKW A;  3AEG A;  3GD3 A;  1W4X A;  4XWZ A;  4A6N B;  1LPF A;  1MOK A;  4H4S A;  4PAB A;  3NTD A;  5FS6 A;  5KRQ A;  1O95 A;  4H4P A;  2V60 A;  4NTC A;  1IUU A;  3CGD A;  2R0C A;  3M12 A;  3QSE A;  1F6M A;  3VR9 A;  3BNM A;  1DOE A;  3KKJ A;  2XCG A;  4ZCC A;  4D04 A;  2VRM A;  1L9E A;  3ZYX A;  1X31 B;  1FEB A;  2GEW A;  3UKK A;  4J57 A;  5U63 A;  5M0Z A;  3V3O A;  3UTF A;  1FCD A;  2BYB A;  1H83 A;  3AE8 A;  2BXR A;  2FJA A;  1GSN A;  3DA1 A;  1GRF A;  5KVI A;  2OAL A;  4NEV A;  2BK5 A;  1GTH A;  3D1C A;  1Q9I A;  1QLB A;  4YWO A;  3VRB A;  4YTN A;  1PXA A;  3UOV A;  3NHO X;  4FK1 A;  4NEW A;  1YQ4 A;  2WOV A;  2O9Z A;  4J36 A;  1S2Q A;  1UKV G;  1PN0 A;  4GRT A;  2XLU A;  2R45 A;  2YVG A;  1GAL A;  3UTH A;  2WP6 A;  4RG3 A;  3FIM B;  1GER A;  3URH A;  4X4J A;  3KD9 A;  3F8P A;  3CNT A;  3GDP A;  4BJZ A;  4JDR A;  4J2W A;  3NLC A;  3LAD A;  1E6E A;  1IJH A;  4OPG A;  4B1B A;  3IC9 A;  1KFY A;  4C3Y A;  3AE1 A;  3CN8 A;  4YSH A;  5KOX A;  1TDF A;  5U1O A;  1E1L A;  1MO9 A;  4EQR A;  2C66 A;  1CJC A;  3AXB A;  3AE7 A;  2WET A;  4N9X A;  4UDQ A;  1PBC A;  1DOD A;  1TYT A;  2B9Y A;  2WES A;  4B68 A;  4H4R A;  4A7A A;  3QSM A;  1PS9 A;  4Z26 A;  3LXD A;  1NHQ A;  3HZL A;  4OPU A;  2DKI A;  4YT0 A;  3O0H A;  3NYF A;  2OLO A;  4CBQ A;  1HYU A;  1TYP A;  2YWL A;  2YR4 A;  3FBS A;  3VQR A;  3ZDN A;  2CVJ A;  4H4W A;  2QCU A;  5EB4 A;  4O5Q A;  1IUT A;  4IV9 A;  1PXC A;  3IF9 A;  2A87 A;  2QA2 A;  2Z5X A;  2X3N A;  1LQU A;  1ZOY A;  1S2Y A;  2GQF A;  2XLP A;  2YG7 A;  1Y0P A;  4FK1 C;  3AEC A;  3IWA A;  2TPR A;  2X8H A;  2HQM A;  1ONF A;  4UDP A;  3SM8 A;  4BK3 A;  2YQU A;  1XHC A;  1GRH A;  2ZZB A;  5KVH A;  4EIQ A;  1PBB A;  4CNK A;  2X99 A;  2GMJ A;  4K5S A;  3LJP A;  4DSG A;  1XAN A;  3NRN A;  4ZCD A;  4BV6 A;  3QJ4 A;  2BK3 A;  3ATQ A;  2E5V A;  1Q1R A;  4YXD A;  4YSX A;  4U2T A;  3H8L A;  3KLJ A;  5GSN A;  1JOA A;  4PAA A;  2XLS A;  1O5W A;  3F8R A;  2VRL A;  4FX9 A;  3NG7 X;  3L8K A;  3LB8 A;  2X8C A;  5FS8 A;  2WBA A;  2XVJ A;  3NN0 X;  3BI5 A;  1OJA A;  2VZ2 A;  2WP5 A;  4U8K A;  5EB5 A;  3ABV A;  1ZX9 A;  4AP1 A;  4H4U A;  2OA1 A;  1D5T A;  2C3D A;  2YG3 A;  4A6N A;  3UOX A;  4CNJ A;  1LV0 A;  4B67 A;  5KXJ A;  1PJ6 A;  3GWF A;  4H2Q A;  2WQY A;  1VG0 A;  3AD9 B;  2XVI A;  3IHM A;  2A8X A;  3KA7 A;  3Q9T A;  2XFU A;  5J60 A;  2Q7V A;  2AQJ A;  2XVE A;  1OJ9 A;  3AE3 A;  3LZW A; 
#chains in the Genus database with same CATH topology
 2XFO A;  4YTP A;  1Y56 B;  1ZK7 A;  3P1W A;  2V61 A;  2GQW A;  1P2E A;  5U25 A;  2Q0K A;  3VR8 A;  2TMD A;  1EL8 A;  4G73 A;  3DK8 A;  3UKA A;  2XLR A;  3ITJ A;  4M52 A;  4OPL A;  3NK1 X;  3CGE A;  1OJT A;  3B6D A;  1LJ1 A;  3UKL A;  1NDA A;  2FJE A;  2ZBW A;  3P4Q A;  1TDN A;  1M6I A;  2CDU A;  1DOB A;  4H4Y A;  1DOC A;  1JU2 A;  3I3L A;  1IUW A;  3K7T A;  2GR1 A;  4LA1 A;  1VQW A;  3DGH A;  5FS9 A;  3LOV A;  4TLX A;  2YG6 A;  1CHU A;  3BHF A;  2FJD A;  2RGJ A;  3EPT A;  4K5R A;  3EAN A;  4XWR A;  4OPD A;  1K0J A;  4HA6 A;  1NHS A;  2WDV A;  2BAB A;  1CC4 A;  3GYI A;  3ATR A;  2B76 A;  1LQT A;  1PJ7 A;  2NVK X;  1H84 A;  3P4P A;  2C65 A;  3OZ2 A;  3AEB A;  3KPK A;  5HY5 A;  2RGH A;  3WE0 A;  1AOG A;  2R4J A;  3GWD A;  2B7S A;  1GV4 A;  5LV9 A;  1E1M A;  3P4S A;  4JNA A;  4OPT A;  1JEH A;  2C76 A;  4EQX A;  1GPE A;  2C3C A;  3KVE A;  5C2T A;  2ZZ0 A;  3B3R A;  2WPC A;  3BNU A;  1S3E A;  2YG5 A;  1FOH A;  4YKF A;  1YQ3 A;  3VRA A;  2VVL A;  4TM4 A;  1BWC A;  2EQ9 A;  3NIX A;  4J33 A;  1NEK A;  3ICR A;  3AE2 A;  2JB3 A;  4ADW A;  1NHP A;  4IA5 A;  5KOW A;  3AD7 B;  1VG9 A;  2RAB A;  4REK A;  4B66 A;  5C3J A;  1EL5 A;  4IVM B;  3DK9 A;  4BUR A;  1TDK A;  2B9X A;  4B69 A;  4GDP A;  1DJN A;  3CPI G;  1COY A;  3AE4 A;  3DK4 A;  3ISH A;  4H4Z A;  4WCT A;  3M0O A;  4AOS A;  1YY5 A;  2JB2 A;  1JNR A;  3CNP A;  4G74 A;  1CL0 A;  2GF3 A;  4Z2R A;  5JCN A;  2BAC A;  1B5Q A;  4G9K A;  1K4Q A;  1L9D A;  2BC1 A;  2V3B A;  4YKG A;  3CND A;  4USQ A;  1TRB A;  2I0Z A;  5J7X A;  1GXF A;  3RP8 A;  1GES A;  2A89 A;  3ALJ A;  3DME A;  1FL2 A;  4Y4M A;  1BGJ A;  4X9N A;  1RP0 A;  5JCL A;  3GMB A;  1H81 A;  2H89 A;  4UP3 A;  4FDC B;  1N1P A;  4APN A;  4Y4N A;  4K7Z A;  2YAU A;  1CBO A;  1GTE A;  3S5W A;  1F8R A;  2BCG G;  2YVF A;  2V5Z A;  1CF3 A;  1N4W A;  5BUL A;  2W0H A;  1IUS A;  1OJC A;  2WDQ A;  1PJ5 A;  2RGO A;  3ICT A;  4J56 A;  4NWZ A;  2CFY A;  3DJE A;  4JNQ A;  2JB1 A;  1E1N A;  1E1K A;  3P9U A;  4H50 A;  4EMI A;  1GRE A;  3GSI A;  2PYX A;  3GYX A;  2YLW A;  4NTE A;  1JRZ A;  4JY2 A;  3ICS A;  4OVI A;  5FS7 A;  2E1M A;  3QFA A;  3V76 A;  1ZKQ A;  5M10 A;  2BK4 A;  1RYI A;  3NK2 X;  1NG3 A;  5ER0 A;  3OC4 A;  3S61 A;  4EMJ A;  4E0V A;  3NYC A;  4TLZ A;  1Y56 A;  3GRT A;  1GRB A;  4Z44 A;  2VQ7 A;  3UP4 A;  4Z25 A;  3P4R A;  4U2L A;  3F8D A;  3QFB A;  4TM1 A;  1CC2 A;  1NEN A;  2WEU A;  4GCM A;  4AT0 A;  1L0V A;  1GRT A;  1GND A;  1ZOV A;  1M64 A;  1K0I A;  1PBF A;  2EQ7 A;  3FPZ A;  2E4G A;  1YKJ A;  1RSG A;  1N4V A;  2YLR A;  3ALM A;  2J3N A;  3CPJ G;  1NHR A;  4Z2U A;  3V3N A;  1H7X A;  4B65 A;  4A65 A;  1B4V A;  4KX6 A;  4CCR A;  5JCI A;  5EOW A;  4I58 A;  4BK1 A;  1D7L A;  1E39 A;  3PS9 A;  2BS2 A;  2Q6U A;  4YTM A;  3SY4 A;  3RNM A;  5L46 A;  1O94 A;  2GMH A;  4TM3 A;  4GAV A;  4U2S A;  2X8G A;  3H8I A;  4X9M A;  4B63 A;  3GDN A;  3T2K A;  2C70 A;  1OJD A;  1ZDL A;  2GAH B;  2R0P A;  2YLS A;  3AWI A;  3C4A A;  2R46 A;  2YLT A;  3QSS A;  4LII A;  3T31 A;  2YM1 A;  2XVH A;  1K0L A;  2BRY A;  2YM2 A;  3HYV A;  1BF3 A;  1Z6L A;  1D4E A;  1S3B A;  3CGB A;  3G5Q A;  4U8I A;  1KDG A;  2C72 A;  4DGK A;  5IQ4 A;  1XPQ A;  5KNL A;  5TR3 A;  3UP5 A;  5HHF A;  3AE6 A;  3C96 A;  2VVL G;  1NG4 A;  2GH5 A;  2XLT A;  2ZZC A;  2GVC A;  2V3A A;  1D4C A;  3II4 A;  1PDH A;  2PHH A;  3H4K A;  4H2R A;  3SFE A;  3E1T A;  5JCM A;  5KWF A;  2BA9 A;  4Z24 A;  3AYJ A;  3CMM A;  2GB0 A;  2XVF A;  3K30 A;  1BZL A;  3CNS A;  4RG4 A;  2APG A;  2Q0L A;  3NN6 X;  3DH9 A;  3DJG X;  3SQP A;  4YSY A;  3CGC A;  1F3P A;  3NTA A;  3RP7 A;  3DGZ A;  2FBW A;  4A79 A;  2B7R A;  4TM0 A;  3EAO A;  3UCL A;  5IPY A;  3JSK A;  3Q6J A;  1V59 A;  2Y6Q A;  2GR2 A;  2VQB A;  3UKQ A;  4EM4 A;  4Y4L A;  1LTX R;  3CIR A;  3UTG A;  2YG4 A;  3T2Z A;  4C3X A;  4Z43 A;  4H4T A;  1D7Y A;  1JRY A;  3T37 A;  3FG2 P;  4CRT A;  1ZMC A;  2EQ8 A;  5GRT A;  2OAM A;  4DSH A;  1GRA A;  3AD8 B;  4XXG A;  1QJD A;  5CKU A;  1CJ3 A;  2QA1 A;  4BJY A;  2GR3 A;  1NPX A;  1PBE A;  3UOY A;  1DJQ A;  3RP6 A;  3DJJ A;  3ADA B;  1ZY8 A;  1BGN A;  3SGL A;  4AT2 A;  3KPF A;  5FMH A;  4K22 A;  1N4U A;  3COX A;  3CNJ A;  4OPI A;  4AP3 A;  3G5S A;  2YLZ A;  4C5O A;  5CQF A;  2ACZ A;  2IVD A;  1IUX A;  3I6D A;  4K8D A;  1ZP0 A;  1JRX A;  1VDC A;  1MXT A;  3KU9 A;  3R9U A;  2AR8 A;  5JCK A;  4H4Q A;  2XFQ A;  1XDI A;  4H2N A;  4U8N A;  5BRT A;  3AEA A;  2JAE A;  4AOX A;  5HXI A;  1DXL A;  3C4N A;  3SZC A;  2GAG B;  4ECH A;  3AE5 A;  3BHK A;  3CTY A;  2BS4 A;  2IVE A;  2B9W A;  1IUV A;  2AAQ A;  4NNJ A;  1B8S A;  1KSU A;  2V6O A;  4H7U A;  3UOZ A;  3EF6 A;  2WPE A;  2C4C A;  3AE9 A;  2GV8 A;  1GEU A;  1PXB A;  3UKF A;  2DKH A;  2BC0 A;  3IHG A;  3BI4 A;  4GDE A;  4NTD A;  4JN9 A;  2VVM A;  4A99 A;  1F8S A;  2R0G A;  4OCG A;  4JQ9 A;  1REO A;  2JBV A;  2YLX A;  2R9Z A;  3NNE A;  2BS3 A;  4CY8 A;  1EL7 A;  2C7G A;  2YVJ A;  1H86 A;  3ALL A;  3LZX A;  4KPR A;  4MJW A;  4U8O A;  4GUV A;  4DNA A;  5BUK A;  2WDR A;  2UZZ A;  3FMW A;  4K2X A;  1E7P A;  2WOI A;  2YR5 A;  3GYJ A;  1VRQ B;  4A9W A;  1FEC A;  1GRG A;  4CY6 A;  1KF6 A;  2GRT A;  2WOW A;  5IQ1 A;  2WU2 A;  4C74 A;  3NYE A;  1DNC A;  4H4X A;  3NK0 X;  4EIP A;  3AYI A;  1ZMD A;  2WP9 A;  4YSZ A;  4I59 A;  1EL9 A;  1L9C A;  3PO7 A;  1ELI A;  1SEZ A;  4O5U A;  3BI2 A;  3HYW A;  1GT8 A;  4II2 A;  1D4D A;  1NAA A;  2JK6 A;  3QVP A;  3K7Q X;  2BXS A;  1TDO A;  2BCP A;  1B37 A;  2OLN A;  2Z5Y A;  3GD4 A;  1KNP A;  1H6V A;  5HYM A;  3NKS A;  4UDR A;  2VOU A;  1H7W A;  3RED A;  1YQZ A;  2R4E A;  4BK2 A;  1PBD A;  3AED A;  4G6H A;  3GMC A;  4NZH A;  4U8M A;  1QO8 A;  3SZW A;  1CJ4 A;  1KSS A;  4II3 A;  3SYI A;  2BRA A;  4WX1 A;  2QAE A;  4J34 A;  1EBD A;  4ICY A;  2C73 A;  2Y6R A;  2XYO A;  2X50 A;  3DJD A;  3NT6 A;  4GF7 A;  4LU6 A;  2H88 A;  4U8J A;  1FEA A;  3UKH A;  3NH3 X;  3AEE A;  2NPX A;  3SFD A;  2C64 A;  1GET A;  3RHA A;  5DBJ A;  3CPH G;  4GR1 A;  3UKP A;  2IID A;  3SX6 A;  4B64 A;  4USR A;  5KMR A;  1CJ2 A;  2F5Z A;  4HB9 A;  2FJB A;  4JY3 A;  2WPF A;  1P2H A;  4EM3 A;  2WS3 A;  4U8P A;  2EQ6 A;  2CUL A;  2XDO A;  3AYL A;  3M13 A;  3QVR A;  2XFP A;  2WHD A;  1PHH A;  2WU5 A;  4IVO B;  4P9S A;  2YR6 A;  4A5L A;  1TDE A;  2JKC A;  4J31 A;  4C77 A;  4EQS A;  3AB1 A;  4EQW A;  1KNR A;  1GOS A;  3GRS A;  5BVA A;  3UTE A;  4IA6 A;  2GR0 A;  3T14 A;  4GAP A;  1Q1W A;  3L1R A;  1CC6 A;  4H4V A;  2C67 A;  4OPC A;  3VRD B;  4CCQ A;  3G5R A;  1F8W A;  4H2P A;  4D03 A;  3AEF A;  2ARD A;  5EBK A;  3SZF A;  4ZN0 A;  4U8L A;  2C75 A;  3PVC A;  1H82 A;  1JNZ A;  4RSL A;  3SXI A;  3D8X A;  3K7M X;  4Z2T A;  2XFN A;  3NGC X;  4EMW A;  1LVL A;  1BKW A;  3AEG A;  3GD3 A;  1W4X A;  4XWZ A;  4A6N B;  1LPF A;  1MOK A;  4H4S A;  4PAB A;  3NTD A;  5FS6 A;  5KRQ A;  1O95 A;  4H4P A;  2V60 A;  4NTC A;  1IUU A;  3CGD A;  2R0C A;  3M12 A;  3QSE A;  5KMS A;  1F6M A;  3VR9 A;  3BNM A;  1DOE A;  3KKJ A;  2XCG A;  4ZCC A;  4D04 A;  2VRM A;  1L9E A;  3ZYX A;  1X31 B;  1FEB A;  2GEW A;  3UKK A;  4J57 A;  5U63 A;  5M0Z A;  3V3O A;  3UTF A;  1FCD A;  2BYB A;  1H83 A;  3AE8 A;  2BXR A;  2FJA A;  1GSN A;  3DA1 A;  1GRF A;  5KVI A;  2OAL A;  4NEV A;  2BK5 A;  1GTH A;  3D1C A;  1Q9I A;  1QLB A;  4YWO A;  4G6G A;  3VRB A;  4YTN A;  1PXA A;  3UOV A;  3NHO X;  4FK1 A;  4NEW A;  1YQ4 A;  2WOV A;  2O9Z A;  4J36 A;  1S2Q A;  1UKV G;  1PN0 A;  4GRT A;  2XLU A;  2R45 A;  2YVG A;  1GAL A;  3UTH A;  2WP6 A;  4RG3 A;  3FIM B;  1GER A;  3URH A;  4X4J A;  3KD9 A;  3F8P A;  3CNT A;  3GDP A;  4BJZ A;  3HYX A;  4JDR A;  4J2W A;  3NLC A;  3LAD A;  1E6E A;  1IJH A;  4OPG A;  4B1B A;  3IC9 A;  1KFY A;  4C3Y A;  3AE1 A;  3CN8 A;  4YSH A;  5KOX A;  1TDF A;  5U1O A;  1E1L A;  1MO9 A;  4EQR A;  2C66 A;  3T0K A;  3SZ0 A;  1CJC A;  3AXB A;  3AE7 A;  2WET A;  4N9X A;  4UDQ A;  1PBC A;  1DOD A;  1TYT A;  2B9Y A;  2WES A;  4B68 A;  4H4R A;  4A7A A;  3QSM A;  1PS9 A;  4Z26 A;  3LXD A;  1NHQ A;  3HZL A;  4OPU A;  2DKI A;  4YT0 A;  3O0H A;  3NYF A;  2OLO A;  4CBQ A;  1HYU A;  1TYP A;  2YWL A;  2YR4 A;  3FBS A;  3VQR A;  3ZDN A;  2CVJ A;  4H4W A;  2QCU A;  5EB4 A;  4O5Q A;  1IUT A;  4IV9 A;  1PXC A;  3IF9 A;  2A87 A;  2QA2 A;  2Z5X A;  2X3N A;  1LQU A;  1ZOY A;  1S2Y A;  2GQF A;  2XLP A;  2YG7 A;  1Y0P A;  4FK1 C;  3AEC A;  3IWA A;  2TPR A;  2X8H A;  2HQM A;  1ONF A;  4UDP A;  3SM8 A;  4BK3 A;  2YQU A;  1XHC A;  1GRH A;  2ZZB A;  5KVH A;  4EIQ A;  1PBB A;  4CNK A;  2X99 A;  2GMJ A;  4K5S A;  3LJP A;  4DSG A;  1XAN A;  3NRN A;  4ZCD A;  5KMQ A;  4BV6 A;  3QJ4 A;  2BK3 A;  3ATQ A;  2E5V A;  1Q1R A;  4YXD A;  4YSX A;  4U2T A;  3H8L A;  3KLJ A;  5GSN A;  1JOA A;  4PAA A;  2XLS A;  1O5W A;  3F8R A;  2VRL A;  4FX9 A;  5KMP A;  3NG7 X;  3L8K A;  3LB8 A;  2X8C A;  5FS8 A;  2WBA A;  3T2Y A;  2XVJ A;  3NN0 X;  3BI5 A;  1OJA A;  2VZ2 A;  2WP5 A;  4U8K A;  5EB5 A;  3ABV A;  1ZX9 A;  4AP1 A;  4H4U A;  2OA1 A;  1D5T A;  2C3D A;  2YG3 A;  4A6N A;  3UOX A;  4CNJ A;  1LV0 A;  4B67 A;  5KXJ A;  1PJ6 A;  3GWF A;  4H2Q A;  2WQY A;  1VG0 A;  3AD9 B;  2XVI A;  3IHM A;  2A8X A;  3KA7 A;  3Q9T A;  2XFU A;  5J60 A;  2Q7V A;  2AQJ A;  2XVE A;  1OJ9 A;  3AE3 A;  3LZW A; 
#chains in the Genus database with same CATH homology
 2XFO A;  4YTP A;  1Y56 B;  1ZK7 A;  3P1W A;  2V61 A;  2GQW A;  1P2E A;  5U25 A;  2Q0K A;  3VR8 A;  2TMD A;  1EL8 A;  4G73 A;  3DK8 A;  3UKA A;  2XLR A;  3ITJ A;  4M52 A;  4OPL A;  3NK1 X;  3CGE A;  1OJT A;  3B6D A;  1LJ1 A;  3UKL A;  1NDA A;  2FJE A;  2ZBW A;  3P4Q A;  1TDN A;  1M6I A;  2CDU A;  1DOB A;  4H4Y A;  1DOC A;  1JU2 A;  3I3L A;  1IUW A;  3K7T A;  2GR1 A;  4LA1 A;  1VQW A;  3DGH A;  5FS9 A;  3LOV A;  4TLX A;  2YG6 A;  1CHU A;  3BHF A;  2FJD A;  2RGJ A;  3EPT A;  4K5R A;  3EAN A;  4XWR A;  4OPD A;  1K0J A;  4HA6 A;  1NHS A;  2WDV A;  2BAB A;  1CC4 A;  3GYI A;  3ATR A;  2B76 A;  1LQT A;  1PJ7 A;  2NVK X;  1H84 A;  3P4P A;  2C65 A;  3OZ2 A;  3AEB A;  3KPK A;  5HY5 A;  2RGH A;  3WE0 A;  1AOG A;  2R4J A;  3GWD A;  2B7S A;  1GV4 A;  5LV9 A;  1E1M A;  3P4S A;  4JNA A;  4OPT A;  1JEH A;  2C76 A;  4EQX A;  1GPE A;  2C3C A;  3KVE A;  5C2T A;  2ZZ0 A;  3B3R A;  2WPC A;  3BNU A;  1S3E A;  2YG5 A;  1FOH A;  4YKF A;  1YQ3 A;  3VRA A;  2VVL A;  4TM4 A;  1BWC A;  2EQ9 A;  3NIX A;  4J33 A;  1NEK A;  3ICR A;  3AE2 A;  2JB3 A;  4ADW A;  1NHP A;  4IA5 A;  5KOW A;  3AD7 B;  1VG9 A;  2RAB A;  4REK A;  4B66 A;  5C3J A;  1EL5 A;  4IVM B;  3DK9 A;  4BUR A;  1TDK A;  2B9X A;  4B69 A;  4GDP A;  1DJN A;  3CPI G;  1COY A;  3AE4 A;  3DK4 A;  3ISH A;  4H4Z A;  4WCT A;  3M0O A;  4AOS A;  1YY5 A;  2JB2 A;  1JNR A;  3CNP A;  4G74 A;  1CL0 A;  2GF3 A;  4Z2R A;  5JCN A;  2BAC A;  1B5Q A;  4G9K A;  1K4Q A;  1L9D A;  2BC1 A;  2V3B A;  4YKG A;  3CND A;  4USQ A;  1TRB A;  2I0Z A;  5J7X A;  1GXF A;  3RP8 A;  1GES A;  2A89 A;  3ALJ A;  3DME A;  1FL2 A;  4Y4M A;  1BGJ A;  4X9N A;  1RP0 A;  5JCL A;  3GMB A;  1H81 A;  2H89 A;  4UP3 A;  4FDC B;  1N1P A;  4APN A;  4Y4N A;  4K7Z A;  2YAU A;  1CBO A;  1GTE A;  3S5W A;  1F8R A;  2BCG G;  2YVF A;  2V5Z A;  1CF3 A;  1N4W A;  5BUL A;  2W0H A;  1IUS A;  1OJC A;  2WDQ A;  1PJ5 A;  2RGO A;  3ICT A;  4J56 A;  4NWZ A;  2CFY A;  3DJE A;  4JNQ A;  2JB1 A;  1E1N A;  1E1K A;  3P9U A;  4H50 A;  4EMI A;  1GRE A;  3GSI A;  2PYX A;  3GYX A;  2YLW A;  4NTE A;  1JRZ A;  4JY2 A;  3ICS A;  4OVI A;  5FS7 A;  2E1M A;  3QFA A;  3V76 A;  1ZKQ A;  5M10 A;  2BK4 A;  1RYI A;  3NK2 X;  1NG3 A;  5ER0 A;  3OC4 A;  3S61 A;  4EMJ A;  4E0V A;  3NYC A;  4TLZ A;  1Y56 A;  3GRT A;  1GRB A;  4Z44 A;  2VQ7 A;  3UP4 A;  4Z25 A;  3P4R A;  4U2L A;  3F8D A;  3QFB A;  4TM1 A;  1CC2 A;  1NEN A;  2WEU A;  4GCM A;  4AT0 A;  1L0V A;  1GRT A;  1GND A;  1ZOV A;  1M64 A;  1K0I A;  1PBF A;  2EQ7 A;  3FPZ A;  2E4G A;  1YKJ A;  1RSG A;  1N4V A;  2YLR A;  3ALM A;  2J3N A;  3CPJ G;  1NHR A;  4Z2U A;  3V3N A;  1H7X A;  4B65 A;  4A65 A;  1B4V A;  4KX6 A;  4CCR A;  5JCI A;  5EOW A;  4I58 A;  4BK1 A;  1D7L A;  1E39 A;  3PS9 A;  2BS2 A;  2Q6U A;  4YTM A;  3SY4 A;  3RNM A;  5L46 A;  1O94 A;  2GMH A;  4TM3 A;  4GAV A;  4U2S A;  2X8G A;  3H8I A;  4X9M A;  4B63 A;  3GDN A;  3T2K A;  2C70 A;  1OJD A;  1ZDL A;  2GAH B;  2R0P A;  2YLS A;  3AWI A;  3C4A A;  2R46 A;  2YLT A;  3QSS A;  4LII A;  3T31 A;  2YM1 A;  2XVH A;  1K0L A;  2BRY A;  2YM2 A;  3HYV A;  1BF3 A;  1Z6L A;  1D4E A;  1S3B A;  3CGB A;  3G5Q A;  4U8I A;  1KDG A;  2C72 A;  4DGK A;  5IQ4 A;  1XPQ A;  5KNL A;  5TR3 A;  3UP5 A;  5HHF A;  3AE6 A;  3C96 A;  2VVL G;  1NG4 A;  2GH5 A;  2XLT A;  2ZZC A;  2GVC A;  2V3A A;  1D4C A;  3II4 A;  1PDH A;  2PHH A;  3H4K A;  4H2R A;  3SFE A;  3E1T A;  5JCM A;  5KWF A;  2BA9 A;  4Z24 A;  3AYJ A;  3CMM A;  2GB0 A;  2XVF A;  3K30 A;  1BZL A;  3CNS A;  4RG4 A;  2APG A;  2Q0L A;  3NN6 X;  3DH9 A;  3DJG X;  3SQP A;  4YSY A;  3CGC A;  1F3P A;  3NTA A;  3RP7 A;  3DGZ A;  2FBW A;  4A79 A;  2B7R A;  4TM0 A;  3EAO A;  3UCL A;  5IPY A;  3JSK A;  3Q6J A;  1V59 A;  2Y6Q A;  2GR2 A;  2VQB A;  3UKQ A;  4EM4 A;  4Y4L A;  1LTX R;  3CIR A;  3UTG A;  2YG4 A;  3T2Z A;  4C3X A;  4Z43 A;  4H4T A;  1D7Y A;  1JRY A;  3T37 A;  3FG2 P;  4CRT A;  1ZMC A;  2EQ8 A;  5GRT A;  2OAM A;  4DSH A;  1GRA A;  3AD8 B;  4XXG A;  1QJD A;  5CKU A;  1CJ3 A;  2QA1 A;  4BJY A;  2GR3 A;  1NPX A;  1PBE A;  3UOY A;  1DJQ A;  3RP6 A;  3DJJ A;  3ADA B;  1ZY8 A;  1BGN A;  3SGL A;  4AT2 A;  3KPF A;  5FMH A;  4K22 A;  1N4U A;  3COX A;  3CNJ A;  4OPI A;  4AP3 A;  3G5S A;  2YLZ A;  4C5O A;  5CQF A;  2ACZ A;  2IVD A;  1IUX A;  3I6D A;  4K8D A;  1ZP0 A;  1JRX A;  1VDC A;  1MXT A;  3KU9 A;  3R9U A;  2AR8 A;  5JCK A;  4H4Q A;  2XFQ A;  1XDI A;  4H2N A;  4U8N A;  5BRT A;  3AEA A;  2JAE A;  4AOX A;  5HXI A;  1DXL A;  3C4N A;  3SZC A;  2GAG B;  4ECH A;  3AE5 A;  3BHK A;  3CTY A;  2BS4 A;  2IVE A;  2B9W A;  1IUV A;  2AAQ A;  4NNJ A;  1B8S A;  1KSU A;  2V6O A;  4H7U A;  3UOZ A;  3EF6 A;  2WPE A;  2C4C A;  3AE9 A;  2GV8 A;  1GEU A;  1PXB A;  3UKF A;  2DKH A;  2BC0 A;  3IHG A;  3BI4 A;  4GDE A;  4NTD A;  4JN9 A;  2VVM A;  4A99 A;  1F8S A;  2R0G A;  4OCG A;  4JQ9 A;  1REO A;  2JBV A;  2YLX A;  2R9Z A;  3NNE A;  2BS3 A;  4CY8 A;  1EL7 A;  2C7G A;  2YVJ A;  1H86 A;  3ALL A;  3LZX A;  4KPR A;  4MJW A;  4U8O A;  4GUV A;  4DNA A;  5BUK A;  2WDR A;  2UZZ A;  3FMW A;  4K2X A;  1E7P A;  2WOI A;  2YR5 A;  3GYJ A;  1VRQ B;  4A9W A;  1FEC A;  1GRG A;  4CY6 A;  1KF6 A;  2GRT A;  2WOW A;  5IQ1 A;  2WU2 A;  4C74 A;  3NYE A;  1DNC A;  4H4X A;  3NK0 X;  4EIP A;  3AYI A;  1ZMD A;  2WP9 A;  4YSZ A;  4I59 A;  1EL9 A;  1L9C A;  3PO7 A;  1ELI A;  1SEZ A;  4O5U A;  3BI2 A;  3HYW A;  1GT8 A;  4II2 A;  1D4D A;  1NAA A;  2JK6 A;  3QVP A;  3K7Q X;  2BXS A;  1TDO A;  2BCP A;  1B37 A;  2OLN A;  2Z5Y A;  3GD4 A;  1KNP A;  1H6V A;  5HYM A;  3NKS A;  4UDR A;  2VOU A;  1H7W A;  3RED A;  1YQZ A;  2R4E A;  4BK2 A;  1PBD A;  3AED A;  4G6H A;  3GMC A;  4NZH A;  4U8M A;  1QO8 A;  3SZW A;  1CJ4 A;  1KSS A;  4II3 A;  3SYI A;  2BRA A;  4WX1 A;  2QAE A;  4J34 A;  1EBD A;  4ICY A;  2C73 A;  2Y6R A;  2XYO A;  2X50 A;  3DJD A;  3NT6 A;  4GF7 A;  4LU6 A;  2H88 A;  4U8J A;  1FEA A;  3UKH A;  3NH3 X;  3AEE A;  2NPX A;  3SFD A;  2C64 A;  1GET A;  3RHA A;  5DBJ A;  3CPH G;  4GR1 A;  3UKP A;  2IID A;  3SX6 A;  4B64 A;  4USR A;  5KMR A;  1CJ2 A;  2F5Z A;  4HB9 A;  2FJB A;  4JY3 A;  2WPF A;  1P2H A;  4EM3 A;  2WS3 A;  4U8P A;  2EQ6 A;  2CUL A;  2XDO A;  3AYL A;  3M13 A;  3QVR A;  2XFP A;  2WHD A;  1PHH A;  2WU5 A;  4IVO B;  4P9S A;  2YR6 A;  4A5L A;  1TDE A;  2JKC A;  4J31 A;  4C77 A;  4EQS A;  3AB1 A;  4EQW A;  1KNR A;  1GOS A;  3GRS A;  5BVA A;  3UTE A;  4IA6 A;  2GR0 A;  3T14 A;  4GAP A;  1Q1W A;  3L1R A;  1CC6 A;  4H4V A;  2C67 A;  4OPC A;  3VRD B;  4CCQ A;  3G5R A;  1F8W A;  4H2P A;  4D03 A;  3AEF A;  2ARD A;  5EBK A;  3SZF A;  4ZN0 A;  4U8L A;  2C75 A;  3PVC A;  1H82 A;  1JNZ A;  4RSL A;  3SXI A;  3D8X A;  3K7M X;  4Z2T A;  2XFN A;  3NGC X;  4EMW A;  1LVL A;  1BKW A;  3AEG A;  3GD3 A;  1W4X A;  4XWZ A;  4A6N B;  1LPF A;  1MOK A;  4H4S A;  4PAB A;  3NTD A;  5FS6 A;  5KRQ A;  1O95 A;  4H4P A;  2V60 A;  4NTC A;  1IUU A;  3CGD A;  2R0C A;  3M12 A;  3QSE A;  5KMS A;  1F6M A;  3VR9 A;  3BNM A;  1DOE A;  3KKJ A;  2XCG A;  4ZCC A;  4D04 A;  2VRM A;  1L9E A;  3ZYX A;  1X31 B;  1FEB A;  2GEW A;  3UKK A;  4J57 A;  5U63 A;  5M0Z A;  3V3O A;  3UTF A;  1FCD A;  2BYB A;  1H83 A;  3AE8 A;  2BXR A;  2FJA A;  1GSN A;  3DA1 A;  1GRF A;  5KVI A;  2OAL A;  4NEV A;  2BK5 A;  1GTH A;  3D1C A;  1Q9I A;  1QLB A;  4YWO A;  4G6G A;  3VRB A;  4YTN A;  1PXA A;  3UOV A;  3NHO X;  4FK1 A;  4NEW A;  1YQ4 A;  2WOV A;  2O9Z A;  4J36 A;  1S2Q A;  1UKV G;  1PN0 A;  4GRT A;  2XLU A;  2R45 A;  2YVG A;  1GAL A;  3UTH A;  2WP6 A;  4RG3 A;  3FIM B;  1GER A;  3URH A;  4X4J A;  3KD9 A;  3F8P A;  3CNT A;  3GDP A;  4BJZ A;  3HYX A;  4JDR A;  4J2W A;  3NLC A;  3LAD A;  1E6E A;  1IJH A;  4OPG A;  4B1B A;  3IC9 A;  1KFY A;  4C3Y A;  3AE1 A;  3CN8 A;  4YSH A;  5KOX A;  1TDF A;  5U1O A;  1E1L A;  1MO9 A;  4EQR A;  2C66 A;  3T0K A;  3SZ0 A;  1CJC A;  3AXB A;  3AE7 A;  2WET A;  4N9X A;  4UDQ A;  1PBC A;  1DOD A;  1TYT A;  2B9Y A;  2WES A;  4B68 A;  4H4R A;  4A7A A;  3QSM A;  1PS9 A;  4Z26 A;  3LXD A;  1NHQ A;  3HZL A;  4OPU A;  2DKI A;  4YT0 A;  3O0H A;  3NYF A;  2OLO A;  4CBQ A;  1HYU A;  1TYP A;  2YWL A;  2YR4 A;  3FBS A;  3VQR A;  3ZDN A;  2CVJ A;  4H4W A;  2QCU A;  5EB4 A;  4O5Q A;  1IUT A;  4IV9 A;  1PXC A;  3IF9 A;  2A87 A;  2QA2 A;  2Z5X A;  2X3N A;  1LQU A;  1ZOY A;  1S2Y A;  2GQF A;  2XLP A;  2YG7 A;  1Y0P A;  4FK1 C;  3AEC A;  3IWA A;  2TPR A;  2X8H A;  2HQM A;  1ONF A;  4UDP A;  3SM8 A;  4BK3 A;  2YQU A;  1XHC A;  1GRH A;  2ZZB A;  5KVH A;  4EIQ A;  1PBB A;  4CNK A;  2X99 A;  2GMJ A;  4K5S A;  3LJP A;  4DSG A;  1XAN A;  3NRN A;  4ZCD A;  5KMQ A;  4BV6 A;  3QJ4 A;  2BK3 A;  3ATQ A;  2E5V A;  1Q1R A;  4YXD A;  4YSX A;  4U2T A;  3H8L A;  3KLJ A;  5GSN A;  1JOA A;  4PAA A;  2XLS A;  1O5W A;  3F8R A;  2VRL A;  4FX9 A;  5KMP A;  3NG7 X;  3L8K A;  3LB8 A;  2X8C A;  5FS8 A;  2WBA A;  3T2Y A;  2XVJ A;  3NN0 X;  3BI5 A;  1OJA A;  2VZ2 A;  2WP5 A;  4U8K A;  5EB5 A;  3ABV A;  1ZX9 A;  4AP1 A;  4H4U A;  2OA1 A;  1D5T A;  2C3D A;  2YG3 A;  4A6N A;  3UOX A;  4CNJ A;  1LV0 A;  4B67 A;  5KXJ A;  1PJ6 A;  3GWF A;  4H2Q A;  2WQY A;  1VG0 A;  3AD9 B;  2XVI A;  3IHM A;  2A8X A;  3KA7 A;  3Q9T A;  2XFU A;  5J60 A;  2Q7V A;  2AQJ A;  2XVE A;  1OJ9 A;  3AE3 A;  3LZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...