4GAPA

Structure of the ndi1 protein from saccharomyces cerevisiae in complex with nad+
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 143
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gapA00
3SZCA 3HYWA 4G9KA 5KMPA 4GAVA 3T0KA 4G6HA 5KMRA 5KMSA 3KPKA 4NWZA 3SXIA 3T31A 4G73A 3SX6A 3T2YA 3SZWA 4G6GA 3SY4A 3SZ0A 4GAPA 3HYXA 4G74A 3T2KA 3T2ZA 3SZFA 3HYVA 5KMQA 3SYIA 3T14A
chains in the Genus database with same CATH superfamily
3P4PA 5KWFA 2FJDA 4Z44A 3D8XA 3DMEA 2GR2A 1RYIA 1XANA 2XFOA 3NH3X 4N9XA 4ZCDA 2XFPA 3KPKA 3NGCX 4Z24A 3LADA 2BCPA 3BNUA 3NN6X 4BK2A 1DJQA 2R0GA 5GSNA 3SFEA 4X9NA 2BK3A 3NN0X 2VQ7A 1GALA 5EB4A 3LZXA 4G6GA 5ER0A 4B67A 1MOKA 1FEAA 3OZ2A 4MJWA 3UKHA 1PS9A 2C65A 1GTEA 2YVGA 2YLRA 1Q9IA 2W0HA 1KSUA 1DNCA 1QO8A 1PXCA 3P4SA 3DK8A 4GDPA 2Q0KA 2OLNA 4U8PA 5HYMA 5FMHA 5KMRA 1KNRA 2YR5A 4EQRA 2YR6A 2BK4A 1RP0A 1D7YA 3FPZA 2CFYA 3KVEA 1E1KA 3GDPA 4K8DA 4A65A 1BGNA 2JB2A 1E39A 2WOWA 3CNSA 1EL8A 4OPTA 4YKFA 1ZOYA 1D4CA 3RP6A 5EB5A 4YWOA 4K5SA 4K7ZA 1P2EA 2YVJA 3Q6JA 3QSEA 3AECA 3AE1A 5U25A 2C75A 2GF3A 3HYVA 5JCIA 1ZDLA 3AE4A 1TDOA 2GEWA 5KVHA 4WCTA 4O5QA 4U8KA 4CCRA 1KNPA 4HB9A 2GB0A 4PABA 3GRTA 3T0KA 1ZY8A 2B9WA 2B9YA 1NHRA 1DXLA 3AEGA 1L9CA 2R46A 1BF3A 4U8MA 5DBJA 3NK2X 2BRAA 4H4YA 3S5WA 4B63A 4EMJA 1VG9A 4H4WA 4J57A 2XFQA 4J2WA 1O95A 2WS3A 2GR1A 4FDCB 4NTDA 3KD9A 2V5ZA 2GVCA 4FK1C 2YQUA 4H4XA 3M13A 1FOHA 2RABA 4ICYA 4Y4MA 3H8IA 4I59A 4A7AA 2BYBA 2GV8A 2YLWA 1N4VA 3II4A 5JCKA 1O94A 3FG2P 1GSNA 2WQYA 1KFYA 4YTMA 4GCMA 4X4JA 3HYWA 4K22A 2XFUA 1GESA 2GAGB 2OLOA 3KPFA 3NYCA 1CC6A 3UP5A 3BI2A 3NK1X 1JRYA 1PJ7A 1XDIA 3AE6A 4LA1A 3SXIA 3UP4A 4ADWA 2X99A 4DSGA 2BS2A 4A9WA 4TLXA 4A99A 2XVHA 4HA6A 4OVIA 5KRQA 1Z6LA 3UKPA 1CC4A 1GETA 1BWCA 2ARDA 3UTHA 4OPIA 2WDRA 5CKUA 1EL7A 2RGOA 1D5TA 4OPDA 4U8JA 1CHUA 4K5RA 4KX6A 4GDEA 3T2KA 4CNJA 4YXDA 2V61A 1F8RA 3NYFA 1NDAA 4H7UA 3UTEA 2BXRA 1E7PA 1Y56A 1PBEA 2WEUA 2XDOA 2YG7A 4GF7A 2WU2A 2BC0A 2WOIA 2YLSA 2AQJA 3IC9A 4B66A 2YVFA 5L46A 1EL9A 1D7LA 4OPUA 1D4DA 3C4NA 5KXJA 3WE0A 2Y6QA 4H4VA 2F5ZA 1PN0A 2JB1A 2BXSA 2XFNA 3ITJA 3NRNA 4IVOB 2B7SA 4EMIA 4H4SA 2C70A 3I3LA 1DJNA 2FJAA 4NNJA 3UOYA 3P4QA 5JCNA 1OJTA 3GSIA 3ICTA 1VQWA 1ZOVA 2YAUA 3RP8A 4UDRA 1S3EA 1PHHA 4X9MA 3SFDA 4U2SA 1B8SA 3AYIA 1DOCA 1S2QA 1L9DA 3NTDA 4JY3A 4AP1A 3FMWA 1L9EA 2JB3A 2GQWA 2YG5A 3ICRA 1XHCA 2EQ6A 5KMSA 2IIDA 4Z43A 4H4RA 3AXBA 1GNDA 3GD3A 3DA1A 1CJ3A 1REOA 3AD9B 2QA1A 2XLTA 1NAAA 1E1MA 2YLTA 1CJ2A 2V60A 4B69A 2WP6A 3R9UA 3NG7X 1GTHA 4USRA 4NZHA 1Y0PA 3DJEA 4AOXA 3AEDA 1FL2A 2GMJA 5KOWA 1YQ4A 2YG3A 3HYXA 3T2ZA 2WHDA 4IVMB 4ZCCA 4CY6A 2R4EA 2V6OA 3K7TA 4YTNA 3QJ4A 3OC4A 4TM3A 5IQ4A 3KKJA 3VR9A 4CRTA 3KU9A 3NYEA 1NPXA 1O5WA 1GPEA 2E5VA 4O5UA 2WBAA 1KSSA 2WP5A 2VVLA 3NLCA 1H81A 4EQSA 3B3RA 4EM4A 1LQUA 3CGCA 4EQXA 3CPIG 3UKFA 3L8KA 1QJDA 3VRDB 3B6DA 5LV9A 4TM0A 2H88A 1UKVG 4RG3A 2WPEA 3DK9A 2Q0LA 2X8HA 3Q9TA 4Y4LA 3BHFA 3O0HA 2WPFA 1JNRA 2WOVA 3CNTA 1W4XA 4J34A 1HYUA 3UTFA 2WESA 2BK5A 3GMBA 3AYJA 4H2RA 4YSYA 1GRBA 2R0CA 1F8SA 3UOZA 1VDCA 2R9ZA 1TDFA 3DH9A 2A89A 4II2A 1MO9A 5HY5A 2C76A 4LIIA 3UKLA 1ONFA 4H50A 4D04A 1NHQA 2XLUA 5EOWA 5JCLA 5KMPA 4DNAA 1GERA 1PBFA 1ZX9A 2VQBA 1JU2A 2EQ8A 1D4EA 1H7XA 1B37A 2R45A 1TDKA 4II3A 1TYTA 3CNJA 3DJJA 1ZKQA 2E4GA 4C3YA 3SGLA 1PBCA 4Z2UA 1DODA 1B4VA 1FEBA 2C4CA 3GYXA 4NEWA 4J31A 4H2QA 4OPCA 1OJ9A 2QA2A 2BACA 3ALMA 1IUWA 4GAPA 4ECHA 3QVPA 3LB8A 4XWRA 2Z5YA 1IJHA 3NK0X 4XXGA 2ZZ0A 1S3BA 5C3JA 1ZP0A 4I58A 4OPLA 3V3OA 4UDQA 2GMHA 4M52A 1Y56B 5EBKA 5M10A 2RGHA 2Z5XA 2R0PA 1QLBA 4U8LA 4OCGA 4G6HA 3IHMA 5KOXA 2O9ZA 1TYPA 3LOVA 3F8RA 3T31A 1ZMCA 3M0OA 1PDHA 2C3DA 4U2LA 3G5QA 1BKWA 4KPRA 2GAHB 2GH5A 2XLRA 1N4WA 1Q1RA 3P4RA 3T37A 2BS4A 2HQMA 1K0IA 2WU5A 4GRTA 1GXFA 3CNPA 3SZFA 2XCGA 1X31B 3BHKA 4RG4A 4CBQA 3F8PA 3CGDA 5BUKA 2NVKX 3CTYA 3GWFA 3QSSA 2J3NA 3KLJA 1E6EA 1F8WA 2X3NA 3AD7B 2C7GA 3RNMA 4TLZA 4WX1A 4A79A 3SZCA 4G9KA 1GT8A 3GWDA 3NT6A 1RSGA 4DSHA 5U1OA 3QVRA 2X8CA 4YTPA 3VQRA 1GOSA 4NTEA 4IA5A 4CCQA 4JNAA 2CULA 3EF6A 1P2HA 2BRYA 2BS3A 2PYXA 2YM1A 2XYOA 2C66A 2BABA 3EANA 1NHSA 2XLPA 2IVEA 1NHPA 1FECA 2ACZA 4YSHA 2YLXA 2WP9A 5FS6A 4A6NA 4K2XA 1VG0A 3AYLA 4Z2RA 2FJEA 2AAQA 2RGJA 4TM4A 1TDNA 3K7MX 1K4QA 4EMWA 4YKGA 4FX9A 1LVLA 1IUUA 1LV0A 1OJCA 2Q6UA 4J56A 2I0ZA 3VRBA 3UOXA 3AD8B 2APGA 1PXAA 4GUVA 1JEHA 4IV9A 1PXBA 1YY5A 2XVJA 1PJ6A 3M12A 1IUSA 1EL5A 1PBBA 1CBOA 5FS7A 2BCGG 2JBVA 2C67A 3AEEA 3FIMB 3NKSA 4USQA 1GRTA 1V59A 1DOBA 5IQ1A 1GRGA 3AE9A 3NNEA 3REDA 3GMCA 3AE3A 3G5RA 3SY4A 1NENA 1IUTA 3FBSA 1NG4A 4AOSA 2JKCA 2GRTA 2YG4A 2H89A 3BI4A 3QFAA 1H82A 4RSLA 5CQFA 3AE7A 1CF3A 3C4AA 3AEBA 2VVLG 3LJPA 3DJGX 2OAMA 1N1PA 1F6MA 2XVIA 4NWZA 2VOUA 4NEVA 2VVMA 1JRXA 2A87A 3K30A 3EAOA 3GDNA 3SM8A 4ZN0A 3C96A 2CDUA 3ABVA 4B1BA 2C72A 5BVAA 1GREA 4B65A 4Z25A 2WDVA 2TPRA 1SEZA 1OJDA 3E1TA 1CC2A 1COYA 2VRMA 3GRSA 5JCMA 2DKHA 4H4ZA 3QSMA 4OPGA 4C74A 4E0VA 3D1CA 2YR4A 4BV6A 4TM1A 3K7QX 4H2NA 3H8LA 2XLSA 1IUXA 3URHA 1LTXR 3T14A 2OALA 3DGZA 3NHOX 3SQPA 2EQ9A 2XVFA 1IUVA 1TRBA 1YKJA 4AP3A 2JK6A 4Z2TA 5FS9A 3CMMA 3UTGA 4YSXA 5U63A 5HXIA 1PJ5A 4GR1A 1GRHA 2C73A 1JOAA 2R4JA 3AE5A 3AWIA 3ATQA 1PBDA 3PVCA 1LJ1A 5KVIA 3S61A 3LXDA 2WETA 4BJYA 4BK1A 1XPQA 2WDQA 1GRAA 2GR0A 2CVJA 4B68A 5KMQA 1CL0A 3CPJG 4BURA 4JDRA 3AEFA 3COXA 2C3CA 4AT0A 5KNLA 5FS8A 2V3AA 4BK3A 4H4TA 2YM2A 1Q1WA 4EQWA 4P9SA 2IVDA 2A8XA 4REKA 1L0VA 1CJ4A 3JSKA 4G73A 1BZLA 1GEUA 3UKAA 3T2YA 1OJAA 2FJBA 2DKIA 3GYJA 1TDEA 3IWAA 3CPHG 4UDPA 4A5LA 4EIPA 3P9UA 3UKQA 1ELIA 3SZWA 3ZYXA 2AR8A 1M64A 3SZ0A 3F8DA 1YQZA 1ZK7A 2NPXA 4G74A 3EPTA 5C2TA 3VRAA 4J33A 3UOVA 1YQ3A 4A6NB 4Y4NA 3IHGA 4C3XA 4PAAA 3SYIA 3LZWA 2Q7VA 2VRLA 1E1LA 1BGJA 1E1NA 3AE8A 3NIXA 4AT2A 4BJZA 2WPCA 2ZZCA 2JAEA 4GAVA 3P1WA 2B76A 2X50A 4NTCA 4D03A 5HHFA 5BRTA 2ZBWA 1NG3A 1NEKA 4FK1A 4H4UA 4UP3A 3UCLA 4IA6A 4B64A 2EQ7A 1H86A 1LQTA 1ZMDA 2E1MA 5J60A 3CNDA 2OA1A 3QFBA 2QCUA 1GRFA 3NTAA 1H6VA 4J36A 3G5SA 1CJCA 1H84A 3ATRA 4LU6A 4APNA 4CY8A 1H7WA 5M0ZA 3CGBA 4YT0A 3CGEA 3IF9A 5TR3A 3H4KA 3ICSA 5IPYA 2B9XA 3DJDA 4U8NA 1JNZA 2YG6A 4H2PA 4JN9A 3ADAB 4XWZA 4EM3A 3DGHA 1KDGA 4YSZA 3L1RA 1KF6A 5BULA 3PO7A 1B5QA 3RHAA 1N4UA 3GYIA 5J7XA 3V3NA 4DGKA 1H83A 1MXTA 1LPFA 3V76A 1K0JA 1F3PA 4EIQA 2YWLA 3DK4A 3KA7A 2X8GA 3ZDNA 4U8IA 2YLZA 3ALLA 3AB1A 2B7RA 2ZZBA 4JY2A 4JNQA 2Y6RA 1M6IA 3I6DA 3SX6A 1VRQB 3CIRA 3ISHA 1EBDA 3RP7A 3CN8A 3PS9A 1DOEA 4H4QA 2QAEA 2C64A 4JQ9A 4C77A 2BA9A 3UKKA 2PHHA 2VZ2A 1AOGA 4Z26A 2FBWA 4H4PA 2UZZA 1K0LA 3BI5A 2GR3A 1FCDA 1GV4A 2XVEA 3BNMA 3HZLA 4U8OA 5GRTA 3VR8A 3AE2A 3AEAA 4C5OA 1S2YA 4CNKA 4U2TA 2BC1A 1JRZA 3ALJA 2GQFA 2V3BA 2TMDA 3GD4A
chains in the Genus database with same CATH topology
3P4PA 5KWFA 2FJDA 4Z44A 3D8XA 3DMEA 2GR2A 1RYIA 1XANA 2XFOA 3NH3X 4N9XA 4ZCDA 2XFPA 3KPKA 3NGCX 4Z24A 3LADA 2BCPA 3BNUA 3NN6X 4BK2A 1DJQA 2R0GA 5GSNA 3SFEA 4X9NA 2BK3A 3NN0X 2VQ7A 1GALA 5EB4A 3LZXA 4G6GA 5ER0A 4B67A 1MOKA 1FEAA 3OZ2A 4MJWA 3UKHA 1PS9A 2C65A 1GTEA 2YVGA 2YLRA 1Q9IA 2W0HA 1KSUA 1DNCA 1QO8A 1PXCA 3P4SA 3DK8A 4GDPA 2Q0KA 2OLNA 4U8PA 5HYMA 5FMHA 5KMRA 1KNRA 2YR5A 4EQRA 2YR6A 2BK4A 1RP0A 1D7YA 3FPZA 2CFYA 3KVEA 1E1KA 3GDPA 4K8DA 4A65A 1BGNA 2JB2A 1E39A 2WOWA 3CNSA 1EL8A 4OPTA 4YKFA 1ZOYA 1D4CA 3RP6A 5EB5A 4YWOA 4K5SA 4K7ZA 1P2EA 2YVJA 3Q6JA 3QSEA 3AECA 3AE1A 5U25A 2C75A 2GF3A 3HYVA 5JCIA 1ZDLA 3AE4A 1TDOA 2GEWA 5KVHA 4WCTA 4O5QA 4U8KA 4CCRA 1KNPA 4HB9A 2GB0A 4PABA 3GRTA 3T0KA 1ZY8A 2B9WA 2B9YA 1NHRA 1DXLA 3AEGA 1L9CA 2R46A 1BF3A 4U8MA 5DBJA 3NK2X 2BRAA 4H4YA 3S5WA 4B63A 4EMJA 1VG9A 4H4WA 4J57A 2XFQA 4J2WA 1O95A 2WS3A 2GR1A 4FDCB 4NTDA 3KD9A 2V5ZA 2GVCA 4FK1C 2YQUA 4H4XA 3M13A 1FOHA 2RABA 4ICYA 4Y4MA 3H8IA 4I59A 4A7AA 2BYBA 2GV8A 2YLWA 1N4VA 3II4A 5JCKA 1O94A 3FG2P 1GSNA 2WQYA 1KFYA 4YTMA 4GCMA 4X4JA 3HYWA 4K22A 2XFUA 1GESA 2GAGB 2OLOA 3KPFA 3NYCA 1CC6A 3UP5A 3BI2A 3NK1X 1JRYA 1PJ7A 1XDIA 3AE6A 4LA1A 3SXIA 3UP4A 4ADWA 2X99A 4DSGA 2BS2A 4A9WA 4TLXA 4A99A 2XVHA 4HA6A 4OVIA 5KRQA 1Z6LA 3UKPA 1CC4A 1GETA 1BWCA 2ARDA 3UTHA 4OPIA 2WDRA 5CKUA 1EL7A 2RGOA 1D5TA 4OPDA 4U8JA 1CHUA 4K5RA 4KX6A 4GDEA 3T2KA 4CNJA 4YXDA 2V61A 1F8RA 3NYFA 1NDAA 4H7UA 3UTEA 2BXRA 1E7PA 1Y56A 1PBEA 2WEUA 2XDOA 2YG7A 4GF7A 2WU2A 2BC0A 2WOIA 2YLSA 2AQJA 3IC9A 4B66A 2YVFA 5L46A 1EL9A 1D7LA 4OPUA 1D4DA 3C4NA 5KXJA 3WE0A 2Y6QA 4H4VA 2F5ZA 1PN0A 2JB1A 2BXSA 2XFNA 3ITJA 3NRNA 4IVOB 2B7SA 4EMIA 4H4SA 2C70A 3I3LA 1DJNA 2FJAA 4NNJA 3UOYA 3P4QA 5JCNA 1OJTA 3GSIA 3ICTA 1VQWA 1ZOVA 2YAUA 3RP8A 4UDRA 1S3EA 1PHHA 4X9MA 3SFDA 4U2SA 1B8SA 3AYIA 1DOCA 1S2QA 1L9DA 3NTDA 4JY3A 4AP1A 3FMWA 1L9EA 2JB3A 2GQWA 2YG5A 3ICRA 1XHCA 2EQ6A 5KMSA 2IIDA 4Z43A 4H4RA 3AXBA 1GNDA 3GD3A 3DA1A 1CJ3A 1REOA 3AD9B 2QA1A 2XLTA 1NAAA 1E1MA 2YLTA 1CJ2A 2V60A 4B69A 2WP6A 3R9UA 3NG7X 1GTHA 4USRA 4NZHA 1Y0PA 3DJEA 4AOXA 3AEDA 1FL2A 2GMJA 5KOWA 1YQ4A 2YG3A 3HYXA 3T2ZA 2WHDA 4IVMB 4ZCCA 4CY6A 2R4EA 2V6OA 3K7TA 4YTNA 3QJ4A 3OC4A 4TM3A 5IQ4A 3KKJA 3VR9A 4CRTA 3KU9A 3NYEA 1NPXA 1O5WA 1GPEA 2E5VA 4O5UA 2WBAA 1KSSA 2WP5A 2VVLA 3NLCA 1H81A 4EQSA 3B3RA 4EM4A 1LQUA 3CGCA 4EQXA 3CPIG 3UKFA 3L8KA 1QJDA 3VRDB 3B6DA 5LV9A 4TM0A 2H88A 1UKVG 4RG3A 2WPEA 3DK9A 2Q0LA 2X8HA 3Q9TA 4Y4LA 3BHFA 3O0HA 2WPFA 1JNRA 2WOVA 3CNTA 1W4XA 4J34A 1HYUA 3UTFA 2WESA 2BK5A 3GMBA 3AYJA 4H2RA 4YSYA 1GRBA 2R0CA 1F8SA 3UOZA 1VDCA 2R9ZA 1TDFA 3DH9A 2A89A 4II2A 1MO9A 5HY5A 2C76A 4LIIA 3UKLA 1ONFA 4H50A 4D04A 1NHQA 2XLUA 5EOWA 5JCLA 5KMPA 4DNAA 1GERA 1PBFA 1ZX9A 2VQBA 1JU2A 2EQ8A 1D4EA 1H7XA 1B37A 2R45A 1TDKA 4II3A 1TYTA 3CNJA 3DJJA 1ZKQA 2E4GA 4C3YA 3SGLA 1PBCA 4Z2UA 1DODA 1B4VA 1FEBA 2C4CA 3GYXA 4NEWA 4J31A 4H2QA 4OPCA 1OJ9A 2QA2A 2BACA 3ALMA 1IUWA 4GAPA 4ECHA 3QVPA 3LB8A 4XWRA 2Z5YA 1IJHA 3NK0X 4XXGA 2ZZ0A 1S3BA 5C3JA 1ZP0A 4I58A 4OPLA 3V3OA 4UDQA 2GMHA 4M52A 1Y56B 5EBKA 5M10A 2RGHA 2Z5XA 2R0PA 1QLBA 4U8LA 4OCGA 4G6HA 3IHMA 5KOXA 2O9ZA 1TYPA 3LOVA 3F8RA 3T31A 1ZMCA 3M0OA 1PDHA 2C3DA 4U2LA 3G5QA 1BKWA 4KPRA 2GAHB 2GH5A 2XLRA 1N4WA 1Q1RA 3P4RA 3T37A 2BS4A 2HQMA 1K0IA 2WU5A 4GRTA 1GXFA 3CNPA 3SZFA 2XCGA 1X31B 3BHKA 4RG4A 4CBQA 3F8PA 3CGDA 5BUKA 2NVKX 3CTYA 3GWFA 3QSSA 2J3NA 3KLJA 1E6EA 1F8WA 2X3NA 3AD7B 2C7GA 3RNMA 4TLZA 4WX1A 4A79A 3SZCA 4G9KA 1GT8A 3GWDA 3NT6A 1RSGA 4DSHA 5U1OA 3QVRA 2X8CA 4YTPA 3VQRA 1GOSA 4NTEA 4IA5A 4CCQA 4JNAA 2CULA 3EF6A 1P2HA 2BRYA 2BS3A 2PYXA 2YM1A 2XYOA 2C66A 2BABA 3EANA 1NHSA 2XLPA 2IVEA 1NHPA 1FECA 2ACZA 4YSHA 2YLXA 2WP9A 5FS6A 4A6NA 4K2XA 1VG0A 3AYLA 4Z2RA 2FJEA 2AAQA 2RGJA 4TM4A 1TDNA 3K7MX 1K4QA 4EMWA 4YKGA 4FX9A 1LVLA 1IUUA 1LV0A 1OJCA 2Q6UA 4J56A 2I0ZA 3VRBA 3UOXA 3AD8B 2APGA 1PXAA 4GUVA 1JEHA 4IV9A 1PXBA 1YY5A 2XVJA 1PJ6A 3M12A 1IUSA 1EL5A 1PBBA 1CBOA 5FS7A 2BCGG 2JBVA 2C67A 3AEEA 3FIMB 3NKSA 4USQA 1GRTA 1V59A 1DOBA 5IQ1A 1GRGA 3AE9A 3NNEA 3REDA 3GMCA 3AE3A 3G5RA 3SY4A 1NENA 1IUTA 3FBSA 1NG4A 4AOSA 2JKCA 2GRTA 2YG4A 2H89A 3BI4A 3QFAA 1H82A 4RSLA 5CQFA 3AE7A 1CF3A 3C4AA 3AEBA 2VVLG 3LJPA 3DJGX 2OAMA 1N1PA 1F6MA 2XVIA 4NWZA 2VOUA 4NEVA 2VVMA 1JRXA 2A87A 3K30A 3EAOA 3GDNA 3SM8A 4ZN0A 3C96A 2CDUA 3ABVA 4B1BA 2C72A 5BVAA 1GREA 4B65A 4Z25A 2WDVA 2TPRA 1SEZA 1OJDA 3E1TA 1CC2A 1COYA 2VRMA 3GRSA 5JCMA 2DKHA 4H4ZA 3QSMA 4OPGA 4C74A 4E0VA 3D1CA 2YR4A 4BV6A 4TM1A 3K7QX 4H2NA 3H8LA 2XLSA 1IUXA 3URHA 1LTXR 3T14A 2OALA 3DGZA 3NHOX 3SQPA 2EQ9A 2XVFA 1IUVA 1TRBA 1YKJA 4AP3A 2JK6A 4Z2TA 5FS9A 3CMMA 3UTGA 4YSXA 5U63A 5HXIA 1PJ5A 4GR1A 1GRHA 2C73A 1JOAA 2R4JA 3AE5A 3AWIA 3ATQA 1PBDA 3PVCA 1LJ1A 5KVIA 3S61A 3LXDA 2WETA 4BJYA 4BK1A 1XPQA 2WDQA 1GRAA 2GR0A 2CVJA 4B68A 5KMQA 1CL0A 3CPJG 4BURA 4JDRA 3AEFA 3COXA 2C3CA 4AT0A 5KNLA 5FS8A 2V3AA 4BK3A 4H4TA 2YM2A 1Q1WA 4EQWA 4P9SA 2IVDA 2A8XA 4REKA 1L0VA 1CJ4A 3JSKA 4G73A 1BZLA 1GEUA 3UKAA 3T2YA 1OJAA 2FJBA 2DKIA 3GYJA 1TDEA 3IWAA 3CPHG 4UDPA 4A5LA 4EIPA 3P9UA 3UKQA 1ELIA 3SZWA 3ZYXA 2AR8A 1M64A 3SZ0A 3F8DA 1YQZA 1ZK7A 2NPXA 4G74A 3EPTA 5C2TA 3VRAA 4J33A 3UOVA 1YQ3A 4A6NB 4Y4NA 3IHGA 4C3XA 4PAAA 3SYIA 3LZWA 2Q7VA 2VRLA 1E1LA 1BGJA 1E1NA 3AE8A 3NIXA 4AT2A 4BJZA 2WPCA 2ZZCA 2JAEA 4GAVA 3P1WA 2B76A 2X50A 4NTCA 4D03A 5HHFA 5BRTA 2ZBWA 1NG3A 1NEKA 4FK1A 4H4UA 4UP3A 3UCLA 4IA6A 4B64A 2EQ7A 1H86A 1LQTA 1ZMDA 2E1MA 5J60A 3CNDA 2OA1A 3QFBA 2QCUA 1GRFA 3NTAA 1H6VA 4J36A 3G5SA 1CJCA 1H84A 3ATRA 4LU6A 4APNA 4CY8A 1H7WA 5M0ZA 3CGBA 4YT0A 3CGEA 3IF9A 5TR3A 3H4KA 3ICSA 5IPYA 2B9XA 3DJDA 4U8NA 1JNZA 2YG6A 4H2PA 4JN9A 3ADAB 4XWZA 4EM3A 3DGHA 1KDGA 4YSZA 3L1RA 1KF6A 5BULA 3PO7A 1B5QA 3RHAA 1N4UA 3GYIA 5J7XA 3V3NA 4DGKA 1H83A 1MXTA 1LPFA 3V76A 1K0JA 1F3PA 4EIQA 2YWLA 3DK4A 3KA7A 2X8GA 3ZDNA 4U8IA 2YLZA 3ALLA 3AB1A 2B7RA 2ZZBA 4JY2A 4JNQA 2Y6RA 1M6IA 3I6DA 3SX6A 1VRQB 3CIRA 3ISHA 1EBDA 3RP7A 3CN8A 3PS9A 1DOEA 4H4QA 2QAEA 2C64A 4JQ9A 4C77A 2BA9A 3UKKA 2PHHA 2VZ2A 1AOGA 4Z26A 2FBWA 4H4PA 2UZZA 1K0LA 3BI5A 2GR3A 1FCDA 1GV4A 2XVEA 3BNMA 3HZLA 4U8OA 5GRTA 3VR8A 3AE2A 3AEAA 4C5OA 1S2YA 4CNKA 4U2TA 2BC1A 1JRZA 3ALJA 2GQFA 2V3BA 2TMDA 3GD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZC A;  3HYW A;  4G9K A;  5KMP A;  4GAV A;  3T0K A;  4G6H A;  5KMR A;  5KMS A;  3KPK A;  4NWZ A;  3SXI A;  3T31 A;  4G73 A;  3SX6 A;  3T2Y A;  3SZW A;  4G6G A;  3SY4 A;  3SZ0 A;  4GAP A;  3HYX A;  4G74 A;  3T2K A;  3T2Z A;  3SZF A;  3HYV A;  5KMQ A;  3SYI A;  3T14 A; 
#chains in the Genus database with same CATH topology
 3P4P A;  5KWF A;  2FJD A;  4Z44 A;  3D8X A;  3DME A;  2GR2 A;  1RYI A;  1XAN A;  2XFO A;  3NH3 X;  4N9X A;  4ZCD A;  2XFP A;  3KPK A;  3NGC X;  4Z24 A;  3LAD A;  2BCP A;  3BNU A;  3NN6 X;  4BK2 A;  1DJQ A;  2R0G A;  5GSN A;  3SFE A;  4X9N A;  2BK3 A;  3NN0 X;  2VQ7 A;  1GAL A;  5EB4 A;  3LZX A;  4G6G A;  5ER0 A;  4B67 A;  1MOK A;  1FEA A;  3OZ2 A;  4MJW A;  3UKH A;  1PS9 A;  2C65 A;  1GTE A;  2YVG A;  2YLR A;  1Q9I A;  2W0H A;  1KSU A;  1DNC A;  1QO8 A;  1PXC A;  3P4S A;  3DK8 A;  4GDP A;  2Q0K A;  2OLN A;  4U8P A;  5HYM A;  5FMH A;  5KMR A;  1KNR A;  2YR5 A;  4EQR A;  2YR6 A;  2BK4 A;  1RP0 A;  1D7Y A;  3FPZ A;  2CFY A;  3KVE A;  1E1K A;  3GDP A;  4K8D A;  4A65 A;  1BGN A;  2JB2 A;  1E39 A;  2WOW A;  3CNS A;  1EL8 A;  4OPT A;  4YKF A;  1ZOY A;  1D4C A;  3RP6 A;  5EB5 A;  4YWO A;  4K5S A;  4K7Z A;  1P2E A;  2YVJ A;  3Q6J A;  3QSE A;  3AEC A;  3AE1 A;  5U25 A;  2C75 A;  2GF3 A;  3HYV A;  5JCI A;  1ZDL A;  3AE4 A;  1TDO A;  2GEW A;  5KVH A;  4WCT A;  4O5Q A;  4U8K A;  4CCR A;  1KNP A;  4HB9 A;  2GB0 A;  4PAB A;  3GRT A;  3T0K A;  1ZY8 A;  2B9W A;  2B9Y A;  1NHR A;  1DXL A;  3AEG A;  1L9C A;  2R46 A;  1BF3 A;  4U8M A;  5DBJ A;  3NK2 X;  2BRA A;  4H4Y A;  3S5W A;  4B63 A;  4EMJ A;  1VG9 A;  4H4W A;  4J57 A;  2XFQ A;  4J2W A;  1O95 A;  2WS3 A;  2GR1 A;  4FDC B;  4NTD A;  3KD9 A;  2V5Z A;  2GVC A;  4FK1 C;  2YQU A;  4H4X A;  3M13 A;  1FOH A;  2RAB A;  4ICY A;  4Y4M A;  3H8I A;  4I59 A;  4A7A A;  2BYB A;  2GV8 A;  2YLW A;  1N4V A;  3II4 A;  5JCK A;  1O94 A;  3FG2 P;  1GSN A;  2WQY A;  1KFY A;  4YTM A;  4GCM A;  4X4J A;  3HYW A;  4K22 A;  2XFU A;  1GES A;  2GAG B;  2OLO A;  3KPF A;  3NYC A;  1CC6 A;  3UP5 A;  3BI2 A;  3NK1 X;  1JRY A;  1PJ7 A;  1XDI A;  3AE6 A;  4LA1 A;  3SXI A;  3UP4 A;  4ADW A;  2X99 A;  4DSG A;  2BS2 A;  4A9W A;  4TLX A;  4A99 A;  2XVH A;  4HA6 A;  4OVI A;  5KRQ A;  1Z6L A;  3UKP A;  1CC4 A;  1GET A;  1BWC A;  2ARD A;  3UTH A;  4OPI A;  2WDR A;  5CKU A;  1EL7 A;  2RGO A;  1D5T A;  4OPD A;  4U8J A;  1CHU A;  4K5R A;  4KX6 A;  4GDE A;  3T2K A;  4CNJ A;  4YXD A;  2V61 A;  1F8R A;  3NYF A;  1NDA A;  4H7U A;  3UTE A;  2BXR A;  1E7P A;  1Y56 A;  1PBE A;  2WEU A;  2XDO A;  2YG7 A;  4GF7 A;  2WU2 A;  2BC0 A;  2WOI A;  2YLS A;  2AQJ A;  3IC9 A;  4B66 A;  2YVF A;  5L46 A;  1EL9 A;  1D7L A;  4OPU A;  1D4D A;  3C4N A;  5KXJ A;  3WE0 A;  2Y6Q A;  4H4V A;  2F5Z A;  1PN0 A;  2JB1 A;  2BXS A;  2XFN A;  3ITJ A;  3NRN A;  4IVO B;  2B7S A;  4EMI A;  4H4S A;  2C70 A;  3I3L A;  1DJN A;  2FJA A;  4NNJ A;  3UOY A;  3P4Q A;  5JCN A;  1OJT A;  3GSI A;  3ICT A;  1VQW A;  1ZOV A;  2YAU A;  3RP8 A;  4UDR A;  1S3E A;  1PHH A;  4X9M A;  3SFD A;  4U2S A;  1B8S A;  3AYI A;  1DOC A;  1S2Q A;  1L9D A;  3NTD A;  4JY3 A;  4AP1 A;  3FMW A;  1L9E A;  2JB3 A;  2GQW A;  2YG5 A;  3ICR A;  1XHC A;  2EQ6 A;  5KMS A;  2IID A;  4Z43 A;  4H4R A;  3AXB A;  1GND A;  3GD3 A;  3DA1 A;  1CJ3 A;  1REO A;  3AD9 B;  2QA1 A;  2XLT A;  1NAA A;  1E1M A;  2YLT A;  1CJ2 A;  2V60 A;  4B69 A;  2WP6 A;  3R9U A;  3NG7 X;  1GTH A;  4USR A;  4NZH A;  1Y0P A;  3DJE A;  4AOX A;  3AED A;  1FL2 A;  2GMJ A;  5KOW A;  1YQ4 A;  2YG3 A;  3HYX A;  3T2Z A;  2WHD A;  4IVM B;  4ZCC A;  4CY6 A;  2R4E A;  2V6O A;  3K7T A;  4YTN A;  3QJ4 A;  3OC4 A;  4TM3 A;  5IQ4 A;  3KKJ A;  3VR9 A;  4CRT A;  3KU9 A;  3NYE A;  1NPX A;  1O5W A;  1GPE A;  2E5V A;  4O5U A;  2WBA A;  1KSS A;  2WP5 A;  2VVL A;  3NLC A;  1H81 A;  4EQS A;  3B3R A;  4EM4 A;  1LQU A;  3CGC A;  4EQX A;  3CPI G;  3UKF A;  3L8K A;  1QJD A;  3VRD B;  3B6D A;  5LV9 A;  4TM0 A;  2H88 A;  1UKV G;  4RG3 A;  2WPE A;  3DK9 A;  2Q0L A;  2X8H A;  3Q9T A;  4Y4L A;  3BHF A;  3O0H A;  2WPF A;  1JNR A;  2WOV A;  3CNT A;  1W4X A;  4J34 A;  1HYU A;  3UTF A;  2WES A;  2BK5 A;  3GMB A;  3AYJ A;  4H2R A;  4YSY A;  1GRB A;  2R0C A;  1F8S A;  3UOZ A;  1VDC A;  2R9Z A;  1TDF A;  3DH9 A;  2A89 A;  4II2 A;  1MO9 A;  5HY5 A;  2C76 A;  4LII A;  3UKL A;  1ONF A;  4H50 A;  4D04 A;  1NHQ A;  2XLU A;  5EOW A;  5JCL A;  5KMP A;  4DNA A;  1GER A;  1PBF A;  1ZX9 A;  2VQB A;  1JU2 A;  2EQ8 A;  1D4E A;  1H7X A;  1B37 A;  2R45 A;  1TDK A;  4II3 A;  1TYT A;  3CNJ A;  3DJJ A;  1ZKQ A;  2E4G A;  4C3Y A;  3SGL A;  1PBC A;  4Z2U A;  1DOD A;  1B4V A;  1FEB A;  2C4C A;  3GYX A;  4NEW A;  4J31 A;  4H2Q A;  4OPC A;  1OJ9 A;  2QA2 A;  2BAC A;  3ALM A;  1IUW A;  4GAP A;  4ECH A;  3QVP A;  3LB8 A;  4XWR A;  2Z5Y A;  1IJH A;  3NK0 X;  4XXG A;  2ZZ0 A;  1S3B A;  5C3J A;  1ZP0 A;  4I58 A;  4OPL A;  3V3O A;  4UDQ A;  2GMH A;  4M52 A;  1Y56 B;  5EBK A;  5M10 A;  2RGH A;  2Z5X A;  2R0P A;  1QLB A;  4U8L A;  4OCG A;  4G6H A;  3IHM A;  5KOX A;  2O9Z A;  1TYP A;  3LOV A;  3F8R A;  3T31 A;  1ZMC A;  3M0O A;  1PDH A;  2C3D A;  4U2L A;  3G5Q A;  1BKW A;  4KPR A;  2GAH B;  2GH5 A;  2XLR A;  1N4W A;  1Q1R A;  3P4R A;  3T37 A;  2BS4 A;  2HQM A;  1K0I A;  2WU5 A;  4GRT A;  1GXF A;  3CNP A;  3SZF A;  2XCG A;  1X31 B;  3BHK A;  4RG4 A;  4CBQ A;  3F8P A;  3CGD A;  5BUK A;  2NVK X;  3CTY A;  3GWF A;  3QSS A;  2J3N A;  3KLJ A;  1E6E A;  1F8W A;  2X3N A;  3AD7 B;  2C7G A;  3RNM A;  4TLZ A;  4WX1 A;  4A79 A;  3SZC A;  4G9K A;  1GT8 A;  3GWD A;  3NT6 A;  1RSG A;  4DSH A;  5U1O A;  3QVR A;  2X8C A;  4YTP A;  3VQR A;  1GOS A;  4NTE A;  4IA5 A;  4CCQ A;  4JNA A;  2CUL A;  3EF6 A;  1P2H A;  2BRY A;  2BS3 A;  2PYX A;  2YM1 A;  2XYO A;  2C66 A;  2BAB A;  3EAN A;  1NHS A;  2XLP A;  2IVE A;  1NHP A;  1FEC A;  2ACZ A;  4YSH A;  2YLX A;  2WP9 A;  5FS6 A;  4A6N A;  4K2X A;  1VG0 A;  3AYL A;  4Z2R A;  2FJE A;  2AAQ A;  2RGJ A;  4TM4 A;  1TDN A;  3K7M X;  1K4Q A;  4EMW A;  4YKG A;  4FX9 A;  1LVL A;  1IUU A;  1LV0 A;  1OJC A;  2Q6U A;  4J56 A;  2I0Z A;  3VRB A;  3UOX A;  3AD8 B;  2APG A;  1PXA A;  4GUV A;  1JEH A;  4IV9 A;  1PXB A;  1YY5 A;  2XVJ A;  1PJ6 A;  3M12 A;  1IUS A;  1EL5 A;  1PBB A;  1CBO A;  5FS7 A;  2BCG G;  2JBV A;  2C67 A;  3AEE A;  3FIM B;  3NKS A;  4USQ A;  1GRT A;  1V59 A;  1DOB A;  5IQ1 A;  1GRG A;  3AE9 A;  3NNE A;  3RED A;  3GMC A;  3AE3 A;  3G5R A;  3SY4 A;  1NEN A;  1IUT A;  3FBS A;  1NG4 A;  4AOS A;  2JKC A;  2GRT A;  2YG4 A;  2H89 A;  3BI4 A;  3QFA A;  1H82 A;  4RSL A;  5CQF A;  3AE7 A;  1CF3 A;  3C4A A;  3AEB A;  2VVL G;  3LJP A;  3DJG X;  2OAM A;  1N1P A;  1F6M A;  2XVI A;  4NWZ A;  2VOU A;  4NEV A;  2VVM A;  1JRX A;  2A87 A;  3K30 A;  3EAO A;  3GDN A;  3SM8 A;  4ZN0 A;  3C96 A;  2CDU A;  3ABV A;  4B1B A;  2C72 A;  5BVA A;  1GRE A;  4B65 A;  4Z25 A;  2WDV A;  2TPR A;  1SEZ A;  1OJD A;  3E1T A;  1CC2 A;  1COY A;  2VRM A;  3GRS A;  5JCM A;  2DKH A;  4H4Z A;  3QSM A;  4OPG A;  4C74 A;  4E0V A;  3D1C A;  2YR4 A;  4BV6 A;  4TM1 A;  3K7Q X;  4H2N A;  3H8L A;  2XLS A;  1IUX A;  3URH A;  1LTX R;  3T14 A;  2OAL A;  3DGZ A;  3NHO X;  3SQP A;  2EQ9 A;  2XVF A;  1IUV A;  1TRB A;  1YKJ A;  4AP3 A;  2JK6 A;  4Z2T A;  5FS9 A;  3CMM A;  3UTG A;  4YSX A;  5U63 A;  5HXI A;  1PJ5 A;  4GR1 A;  1GRH A;  2C73 A;  1JOA A;  2R4J A;  3AE5 A;  3AWI A;  3ATQ A;  1PBD A;  3PVC A;  1LJ1 A;  5KVI A;  3S61 A;  3LXD A;  2WET A;  4BJY A;  4BK1 A;  1XPQ A;  2WDQ A;  1GRA A;  2GR0 A;  2CVJ A;  4B68 A;  5KMQ A;  1CL0 A;  3CPJ G;  4BUR A;  4JDR A;  3AEF A;  3COX A;  2C3C A;  4AT0 A;  5KNL A;  5FS8 A;  2V3A A;  4BK3 A;  4H4T A;  2YM2 A;  1Q1W A;  4EQW A;  4P9S A;  2IVD A;  2A8X A;  4REK A;  1L0V A;  1CJ4 A;  3JSK A;  4G73 A;  1BZL A;  1GEU A;  3UKA A;  3T2Y A;  1OJA A;  2FJB A;  2DKI A;  3GYJ A;  1TDE A;  3IWA A;  3CPH G;  4UDP A;  4A5L A;  4EIP A;  3P9U A;  3UKQ A;  1ELI A;  3SZW A;  3ZYX A;  2AR8 A;  1M64 A;  3SZ0 A;  3F8D A;  1YQZ A;  1ZK7 A;  2NPX A;  4G74 A;  3EPT A;  5C2T A;  3VRA A;  4J33 A;  3UOV A;  1YQ3 A;  4A6N B;  4Y4N A;  3IHG A;  4C3X A;  4PAA A;  3SYI A;  3LZW A;  2Q7V A;  2VRL A;  1E1L A;  1BGJ A;  1E1N A;  3AE8 A;  3NIX A;  4AT2 A;  4BJZ A;  2WPC A;  2ZZC A;  2JAE A;  4GAV A;  3P1W A;  2B76 A;  2X50 A;  4NTC A;  4D03 A;  5HHF A;  5BRT A;  2ZBW A;  1NG3 A;  1NEK A;  4FK1 A;  4H4U A;  4UP3 A;  3UCL A;  4IA6 A;  4B64 A;  2EQ7 A;  1H86 A;  1LQT A;  1ZMD A;  2E1M A;  5J60 A;  3CND A;  2OA1 A;  3QFB A;  2QCU A;  1GRF A;  3NTA A;  1H6V A;  4J36 A;  3G5S A;  1CJC A;  1H84 A;  3ATR A;  4LU6 A;  4APN A;  4CY8 A;  1H7W A;  5M0Z A;  3CGB A;  4YT0 A;  3CGE A;  3IF9 A;  5TR3 A;  3H4K A;  3ICS A;  5IPY A;  2B9X A;  3DJD A;  4U8N A;  1JNZ A;  2YG6 A;  4H2P A;  4JN9 A;  3ADA B;  4XWZ A;  4EM3 A;  3DGH A;  1KDG A;  4YSZ A;  3L1R A;  1KF6 A;  5BUL A;  3PO7 A;  1B5Q A;  3RHA A;  1N4U A;  3GYI A;  5J7X A;  3V3N A;  4DGK A;  1H83 A;  1MXT A;  1LPF A;  3V76 A;  1K0J A;  1F3P A;  4EIQ A;  2YWL A;  3DK4 A;  3KA7 A;  2X8G A;  3ZDN A;  4U8I A;  2YLZ A;  3ALL A;  3AB1 A;  2B7R A;  2ZZB A;  4JY2 A;  4JNQ A;  2Y6R A;  1M6I A;  3I6D A;  3SX6 A;  1VRQ B;  3CIR A;  3ISH A;  1EBD A;  3RP7 A;  3CN8 A;  3PS9 A;  1DOE A;  4H4Q A;  2QAE A;  2C64 A;  4JQ9 A;  4C77 A;  2BA9 A;  3UKK A;  2PHH A;  2VZ2 A;  1AOG A;  4Z26 A;  2FBW A;  4H4P A;  2UZZ A;  1K0L A;  3BI5 A;  2GR3 A;  1FCD A;  1GV4 A;  2XVE A;  3BNM A;  3HZL A;  4U8O A;  5GRT A;  3VR8 A;  3AE2 A;  3AEA A;  4C5O A;  1S2Y A;  4CNK A;  4U2T A;  2BC1 A;  1JRZ A;  3ALJ A;  2GQF A;  2V3B A;  2TMD A;  3GD4 A; 
#chains in the Genus database with same CATH homology
 3P4P A;  5KWF A;  2FJD A;  4Z44 A;  3D8X A;  3DME A;  2GR2 A;  1RYI A;  1XAN A;  2XFO A;  3NH3 X;  4N9X A;  4ZCD A;  2XFP A;  3KPK A;  3NGC X;  4Z24 A;  3LAD A;  2BCP A;  3BNU A;  3NN6 X;  4BK2 A;  1DJQ A;  2R0G A;  5GSN A;  3SFE A;  4X9N A;  2BK3 A;  3NN0 X;  2VQ7 A;  1GAL A;  5EB4 A;  3LZX A;  4G6G A;  5ER0 A;  4B67 A;  1MOK A;  1FEA A;  3OZ2 A;  4MJW A;  3UKH A;  1PS9 A;  2C65 A;  1GTE A;  2YVG A;  2YLR A;  1Q9I A;  2W0H A;  1KSU A;  1DNC A;  1QO8 A;  1PXC A;  3P4S A;  3DK8 A;  4GDP A;  2Q0K A;  2OLN A;  4U8P A;  5HYM A;  5FMH A;  5KMR A;  1KNR A;  2YR5 A;  4EQR A;  2YR6 A;  2BK4 A;  1RP0 A;  1D7Y A;  3FPZ A;  2CFY A;  3KVE A;  1E1K A;  3GDP A;  4K8D A;  4A65 A;  1BGN A;  2JB2 A;  1E39 A;  2WOW A;  3CNS A;  1EL8 A;  4OPT A;  4YKF A;  1ZOY A;  1D4C A;  3RP6 A;  5EB5 A;  4YWO A;  4K5S A;  4K7Z A;  1P2E A;  2YVJ A;  3Q6J A;  3QSE A;  3AEC A;  3AE1 A;  5U25 A;  2C75 A;  2GF3 A;  3HYV A;  5JCI A;  1ZDL A;  3AE4 A;  1TDO A;  2GEW A;  5KVH A;  4WCT A;  4O5Q A;  4U8K A;  4CCR A;  1KNP A;  4HB9 A;  2GB0 A;  4PAB A;  3GRT A;  3T0K A;  1ZY8 A;  2B9W A;  2B9Y A;  1NHR A;  1DXL A;  3AEG A;  1L9C A;  2R46 A;  1BF3 A;  4U8M A;  5DBJ A;  3NK2 X;  2BRA A;  4H4Y A;  3S5W A;  4B63 A;  4EMJ A;  1VG9 A;  4H4W A;  4J57 A;  2XFQ A;  4J2W A;  1O95 A;  2WS3 A;  2GR1 A;  4FDC B;  4NTD A;  3KD9 A;  2V5Z A;  2GVC A;  4FK1 C;  2YQU A;  4H4X A;  3M13 A;  1FOH A;  2RAB A;  4ICY A;  4Y4M A;  3H8I A;  4I59 A;  4A7A A;  2BYB A;  2GV8 A;  2YLW A;  1N4V A;  3II4 A;  5JCK A;  1O94 A;  3FG2 P;  1GSN A;  2WQY A;  1KFY A;  4YTM A;  4GCM A;  4X4J A;  3HYW A;  4K22 A;  2XFU A;  1GES A;  2GAG B;  2OLO A;  3KPF A;  3NYC A;  1CC6 A;  3UP5 A;  3BI2 A;  3NK1 X;  1JRY A;  1PJ7 A;  1XDI A;  3AE6 A;  4LA1 A;  3SXI A;  3UP4 A;  4ADW A;  2X99 A;  4DSG A;  2BS2 A;  4A9W A;  4TLX A;  4A99 A;  2XVH A;  4HA6 A;  4OVI A;  5KRQ A;  1Z6L A;  3UKP A;  1CC4 A;  1GET A;  1BWC A;  2ARD A;  3UTH A;  4OPI A;  2WDR A;  5CKU A;  1EL7 A;  2RGO A;  1D5T A;  4OPD A;  4U8J A;  1CHU A;  4K5R A;  4KX6 A;  4GDE A;  3T2K A;  4CNJ A;  4YXD A;  2V61 A;  1F8R A;  3NYF A;  1NDA A;  4H7U A;  3UTE A;  2BXR A;  1E7P A;  1Y56 A;  1PBE A;  2WEU A;  2XDO A;  2YG7 A;  4GF7 A;  2WU2 A;  2BC0 A;  2WOI A;  2YLS A;  2AQJ A;  3IC9 A;  4B66 A;  2YVF A;  5L46 A;  1EL9 A;  1D7L A;  4OPU A;  1D4D A;  3C4N A;  5KXJ A;  3WE0 A;  2Y6Q A;  4H4V A;  2F5Z A;  1PN0 A;  2JB1 A;  2BXS A;  2XFN A;  3ITJ A;  3NRN A;  4IVO B;  2B7S A;  4EMI A;  4H4S A;  2C70 A;  3I3L A;  1DJN A;  2FJA A;  4NNJ A;  3UOY A;  3P4Q A;  5JCN A;  1OJT A;  3GSI A;  3ICT A;  1VQW A;  1ZOV A;  2YAU A;  3RP8 A;  4UDR A;  1S3E A;  1PHH A;  4X9M A;  3SFD A;  4U2S A;  1B8S A;  3AYI A;  1DOC A;  1S2Q A;  1L9D A;  3NTD A;  4JY3 A;  4AP1 A;  3FMW A;  1L9E A;  2JB3 A;  2GQW A;  2YG5 A;  3ICR A;  1XHC A;  2EQ6 A;  5KMS A;  2IID A;  4Z43 A;  4H4R A;  3AXB A;  1GND A;  3GD3 A;  3DA1 A;  1CJ3 A;  1REO A;  3AD9 B;  2QA1 A;  2XLT A;  1NAA A;  1E1M A;  2YLT A;  1CJ2 A;  2V60 A;  4B69 A;  2WP6 A;  3R9U A;  3NG7 X;  1GTH A;  4USR A;  4NZH A;  1Y0P A;  3DJE A;  4AOX A;  3AED A;  1FL2 A;  2GMJ A;  5KOW A;  1YQ4 A;  2YG3 A;  3HYX A;  3T2Z A;  2WHD A;  4IVM B;  4ZCC A;  4CY6 A;  2R4E A;  2V6O A;  3K7T A;  4YTN A;  3QJ4 A;  3OC4 A;  4TM3 A;  5IQ4 A;  3KKJ A;  3VR9 A;  4CRT A;  3KU9 A;  3NYE A;  1NPX A;  1O5W A;  1GPE A;  2E5V A;  4O5U A;  2WBA A;  1KSS A;  2WP5 A;  2VVL A;  3NLC A;  1H81 A;  4EQS A;  3B3R A;  4EM4 A;  1LQU A;  3CGC A;  4EQX A;  3CPI G;  3UKF A;  3L8K A;  1QJD A;  3VRD B;  3B6D A;  5LV9 A;  4TM0 A;  2H88 A;  1UKV G;  4RG3 A;  2WPE A;  3DK9 A;  2Q0L A;  2X8H A;  3Q9T A;  4Y4L A;  3BHF A;  3O0H A;  2WPF A;  1JNR A;  2WOV A;  3CNT A;  1W4X A;  4J34 A;  1HYU A;  3UTF A;  2WES A;  2BK5 A;  3GMB A;  3AYJ A;  4H2R A;  4YSY A;  1GRB A;  2R0C A;  1F8S A;  3UOZ A;  1VDC A;  2R9Z A;  1TDF A;  3DH9 A;  2A89 A;  4II2 A;  1MO9 A;  5HY5 A;  2C76 A;  4LII A;  3UKL A;  1ONF A;  4H50 A;  4D04 A;  1NHQ A;  2XLU A;  5EOW A;  5JCL A;  5KMP A;  4DNA A;  1GER A;  1PBF A;  1ZX9 A;  2VQB A;  1JU2 A;  2EQ8 A;  1D4E A;  1H7X A;  1B37 A;  2R45 A;  1TDK A;  4II3 A;  1TYT A;  3CNJ A;  3DJJ A;  1ZKQ A;  2E4G A;  4C3Y A;  3SGL A;  1PBC A;  4Z2U A;  1DOD A;  1B4V A;  1FEB A;  2C4C A;  3GYX A;  4NEW A;  4J31 A;  4H2Q A;  4OPC A;  1OJ9 A;  2QA2 A;  2BAC A;  3ALM A;  1IUW A;  4GAP A;  4ECH A;  3QVP A;  3LB8 A;  4XWR A;  2Z5Y A;  1IJH A;  3NK0 X;  4XXG A;  2ZZ0 A;  1S3B A;  5C3J A;  1ZP0 A;  4I58 A;  4OPL A;  3V3O A;  4UDQ A;  2GMH A;  4M52 A;  1Y56 B;  5EBK A;  5M10 A;  2RGH A;  2Z5X A;  2R0P A;  1QLB A;  4U8L A;  4OCG A;  4G6H A;  3IHM A;  5KOX A;  2O9Z A;  1TYP A;  3LOV A;  3F8R A;  3T31 A;  1ZMC A;  3M0O A;  1PDH A;  2C3D A;  4U2L A;  3G5Q A;  1BKW A;  4KPR A;  2GAH B;  2GH5 A;  2XLR A;  1N4W A;  1Q1R A;  3P4R A;  3T37 A;  2BS4 A;  2HQM A;  1K0I A;  2WU5 A;  4GRT A;  1GXF A;  3CNP A;  3SZF A;  2XCG A;  1X31 B;  3BHK A;  4RG4 A;  4CBQ A;  3F8P A;  3CGD A;  5BUK A;  2NVK X;  3CTY A;  3GWF A;  3QSS A;  2J3N A;  3KLJ A;  1E6E A;  1F8W A;  2X3N A;  3AD7 B;  2C7G A;  3RNM A;  4TLZ A;  4WX1 A;  4A79 A;  3SZC A;  4G9K A;  1GT8 A;  3GWD A;  3NT6 A;  1RSG A;  4DSH A;  5U1O A;  3QVR A;  2X8C A;  4YTP A;  3VQR A;  1GOS A;  4NTE A;  4IA5 A;  4CCQ A;  4JNA A;  2CUL A;  3EF6 A;  1P2H A;  2BRY A;  2BS3 A;  2PYX A;  2YM1 A;  2XYO A;  2C66 A;  2BAB A;  3EAN A;  1NHS A;  2XLP A;  2IVE A;  1NHP A;  1FEC A;  2ACZ A;  4YSH A;  2YLX A;  2WP9 A;  5FS6 A;  4A6N A;  4K2X A;  1VG0 A;  3AYL A;  4Z2R A;  2FJE A;  2AAQ A;  2RGJ A;  4TM4 A;  1TDN A;  3K7M X;  1K4Q A;  4EMW A;  4YKG A;  4FX9 A;  1LVL A;  1IUU A;  1LV0 A;  1OJC A;  2Q6U A;  4J56 A;  2I0Z A;  3VRB A;  3UOX A;  3AD8 B;  2APG A;  1PXA A;  4GUV A;  1JEH A;  4IV9 A;  1PXB A;  1YY5 A;  2XVJ A;  1PJ6 A;  3M12 A;  1IUS A;  1EL5 A;  1PBB A;  1CBO A;  5FS7 A;  2BCG G;  2JBV A;  2C67 A;  3AEE A;  3FIM B;  3NKS A;  4USQ A;  1GRT A;  1V59 A;  1DOB A;  5IQ1 A;  1GRG A;  3AE9 A;  3NNE A;  3RED A;  3GMC A;  3AE3 A;  3G5R A;  3SY4 A;  1NEN A;  1IUT A;  3FBS A;  1NG4 A;  4AOS A;  2JKC A;  2GRT A;  2YG4 A;  2H89 A;  3BI4 A;  3QFA A;  1H82 A;  4RSL A;  5CQF A;  3AE7 A;  1CF3 A;  3C4A A;  3AEB A;  2VVL G;  3LJP A;  3DJG X;  2OAM A;  1N1P A;  1F6M A;  2XVI A;  4NWZ A;  2VOU A;  4NEV A;  2VVM A;  1JRX A;  2A87 A;  3K30 A;  3EAO A;  3GDN A;  3SM8 A;  4ZN0 A;  3C96 A;  2CDU A;  3ABV A;  4B1B A;  2C72 A;  5BVA A;  1GRE A;  4B65 A;  4Z25 A;  2WDV A;  2TPR A;  1SEZ A;  1OJD A;  3E1T A;  1CC2 A;  1COY A;  2VRM A;  3GRS A;  5JCM A;  2DKH A;  4H4Z A;  3QSM A;  4OPG A;  4C74 A;  4E0V A;  3D1C A;  2YR4 A;  4BV6 A;  4TM1 A;  3K7Q X;  4H2N A;  3H8L A;  2XLS A;  1IUX A;  3URH A;  1LTX R;  3T14 A;  2OAL A;  3DGZ A;  3NHO X;  3SQP A;  2EQ9 A;  2XVF A;  1IUV A;  1TRB A;  1YKJ A;  4AP3 A;  2JK6 A;  4Z2T A;  5FS9 A;  3CMM A;  3UTG A;  4YSX A;  5U63 A;  5HXI A;  1PJ5 A;  4GR1 A;  1GRH A;  2C73 A;  1JOA A;  2R4J A;  3AE5 A;  3AWI A;  3ATQ A;  1PBD A;  3PVC A;  1LJ1 A;  5KVI A;  3S61 A;  3LXD A;  2WET A;  4BJY A;  4BK1 A;  1XPQ A;  2WDQ A;  1GRA A;  2GR0 A;  2CVJ A;  4B68 A;  5KMQ A;  1CL0 A;  3CPJ G;  4BUR A;  4JDR A;  3AEF A;  3COX A;  2C3C A;  4AT0 A;  5KNL A;  5FS8 A;  2V3A A;  4BK3 A;  4H4T A;  2YM2 A;  1Q1W A;  4EQW A;  4P9S A;  2IVD A;  2A8X A;  4REK A;  1L0V A;  1CJ4 A;  3JSK A;  4G73 A;  1BZL A;  1GEU A;  3UKA A;  3T2Y A;  1OJA A;  2FJB A;  2DKI A;  3GYJ A;  1TDE A;  3IWA A;  3CPH G;  4UDP A;  4A5L A;  4EIP A;  3P9U A;  3UKQ A;  1ELI A;  3SZW A;  3ZYX A;  2AR8 A;  1M64 A;  3SZ0 A;  3F8D A;  1YQZ A;  1ZK7 A;  2NPX A;  4G74 A;  3EPT A;  5C2T A;  3VRA A;  4J33 A;  3UOV A;  1YQ3 A;  4A6N B;  4Y4N A;  3IHG A;  4C3X A;  4PAA A;  3SYI A;  3LZW A;  2Q7V A;  2VRL A;  1E1L A;  1BGJ A;  1E1N A;  3AE8 A;  3NIX A;  4AT2 A;  4BJZ A;  2WPC A;  2ZZC A;  2JAE A;  4GAV A;  3P1W A;  2B76 A;  2X50 A;  4NTC A;  4D03 A;  5HHF A;  5BRT A;  2ZBW A;  1NG3 A;  1NEK A;  4FK1 A;  4H4U A;  4UP3 A;  3UCL A;  4IA6 A;  4B64 A;  2EQ7 A;  1H86 A;  1LQT A;  1ZMD A;  2E1M A;  5J60 A;  3CND A;  2OA1 A;  3QFB A;  2QCU A;  1GRF A;  3NTA A;  1H6V A;  4J36 A;  3G5S A;  1CJC A;  1H84 A;  3ATR A;  4LU6 A;  4APN A;  4CY8 A;  1H7W A;  5M0Z A;  3CGB A;  4YT0 A;  3CGE A;  3IF9 A;  5TR3 A;  3H4K A;  3ICS A;  5IPY A;  2B9X A;  3DJD A;  4U8N A;  1JNZ A;  2YG6 A;  4H2P A;  4JN9 A;  3ADA B;  4XWZ A;  4EM3 A;  3DGH A;  1KDG A;  4YSZ A;  3L1R A;  1KF6 A;  5BUL A;  3PO7 A;  1B5Q A;  3RHA A;  1N4U A;  3GYI A;  5J7X A;  3V3N A;  4DGK A;  1H83 A;  1MXT A;  1LPF A;  3V76 A;  1K0J A;  1F3P A;  4EIQ A;  2YWL A;  3DK4 A;  3KA7 A;  2X8G A;  3ZDN A;  4U8I A;  2YLZ A;  3ALL A;  3AB1 A;  2B7R A;  2ZZB A;  4JY2 A;  4JNQ A;  2Y6R A;  1M6I A;  3I6D A;  3SX6 A;  1VRQ B;  3CIR A;  3ISH A;  1EBD A;  3RP7 A;  3CN8 A;  3PS9 A;  1DOE A;  4H4Q A;  2QAE A;  2C64 A;  4JQ9 A;  4C77 A;  2BA9 A;  3UKK A;  2PHH A;  2VZ2 A;  1AOG A;  4Z26 A;  2FBW A;  4H4P A;  2UZZ A;  1K0L A;  3BI5 A;  2GR3 A;  1FCD A;  1GV4 A;  2XVE A;  3BNM A;  3HZL A;  4U8O A;  5GRT A;  3VR8 A;  3AE2 A;  3AEA A;  4C5O A;  1S2Y A;  4CNK A;  4U2T A;  2BC1 A;  1JRZ A;  3ALJ A;  2GQF A;  2V3B A;  2TMD A;  3GD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...