4GAPA

Structure of the ndi1 protein from saccharomyces cerevisiae in complex with nad+
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 143
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gapA00
3T2KA 3SZWA 3T14A 4GAVA 4GAPA 4G6GA 3SZ0A 3T2ZA 3T2YA 4G6HA 5KMRA 3KPKA 3SXIA 3SYIA 3T0KA 3SY4A 5KMPA 4G73A 5KMQA 3SZFA 5KMSA 3SZCA 3HYXA 3SX6A 4G9KA 4G74A 3T31A 3HYWA 4NWZA 3HYVA
chains in the Genus database with same CATH superfamily
4UDQA 3NHOX 4UP3A 3VRAA 1PXAA 1PJ7A 2V60A 3ADAB 4EIQA 2A8XA 1H6VA 3CGDA 4YSXA 4GF7A 3EPTA 3UKAA 2WP5A 3FG2P 3GMCA 4Z2UA 2WPFA 2R9ZA 5LV9A 3GDPA 1NDAA 3AEDA 1EL5A 5IQ4A 2RGJA 1TDEA 3QFBA 2AAQA 4NEWA 3NYCA 2XFQA 1SEZA 4Z2RA 4CRTA 5HYMA 4A79A 2WQYA 4K5SA 4U8IA 5U63A 1CC6A 3NK2X 1EBDA 1NHSA 2C67A 3AE1A 3LOVA 3PVCA 3UTEA 2WETA 3AEGA 1DOBA 2BS2A 1ZX9A 1AOGA 2WP6A 3T14A 3DJEA 3DGZA 3DK9A 3G5RA 4GR1A 2B9WA 2WOVA 2A89A 5FS9A 3F8RA 2YR4A 5CQFA 5DBJA 5KMPA 4APNA 4AOSA 2R46A 4OCGA 5KOXA 5C3JA 3BHKA 4YSYA 1CJ4A 1GRFA 4EQWA 4H4SA 1CC2A 3FIMB 3REDA 3SX6A 3OZ2A 3T31A 2BCGG 4B68A 4NTEA 2GR3A 1IJHA 2BRAA 2V6OA 4GDEA 4YTMA 3R9UA 2Q7VA 2XYOA 4X9MA 1DJNA 2XLPA 3EF6A 5EB4A 3NLCA 4YSZA 1L9CA 1F8SA 3DJJA 3GDNA 1MOKA 3AEBA 1YQ4A 2GQWA 2X50A 4YTPA 4EM4A 1GRTA 3CGEA 4C3XA 5BVAA 3CPIG 1CHUA 3NH3X 4U8OA 2BACA 1S2QA 3ALLA 3DK4A 4A65A 4K2XA 1XHCA 1F6MA 1F8RA 2X3NA 1TYPA 4OPCA 4Y4LA 2YM1A 3NK1X 2R4EA 3BI5A 1KSSA 4CNKA 1BKWA 2B7SA 1DOCA 4A99A 1H86A 1CJ2A 1S2YA 5BUKA 3AE5A 3GD3A 4J57A 2V3BA 1Z6LA 1PN0A 4OPGA 2ACZA 3RP8A 2ARDA 2BYBA 3GWDA 3SGLA 3T2KA 1FECA 1ELIA 1NHPA 3SZWA 3ICRA 1MO9A 4LU6A 4U2LA 4H2NA 1OJDA 1PBFA 1PBBA 3K7TA 4GAVA 1NHRA 4EQXA 3KVEA 2O9ZA 3F8DA 1N1PA 1OJ9A 3CTYA 4IA5A 1TYTA 5KMRA 2YLRA 1GPEA 3F8PA 4IA6A 3IWAA 2VQBA 4C3YA 2FJDA 4BV6A 4J31A 1GRGA 2C66A 1H7XA 4JDRA 4Z25A 3CIRA 3QVRA 5ER0A 4Z43A 4G9KA 3ICSA 5KWFA 1PHHA 2YQUA 1FCDA 4RG3A 1LJ1A 1TRBA 3AD8B 3AYIA 3LXDA 1N4VA 4DGKA 3CNPA 1CJ3A 4B65A 4RG4A 3EANA 4XXGA 1X31B 4II2A 4BK2A 3PO7A 3ZDNA 2VVMA 1LV0A 3GYJA 1P2HA 1NHQA 2BABA 2GEWA 5KVIA 4A6NA 3I3LA 2C76A 4CCRA 1K0IA 4H4ZA 4U8JA 3AE4A 2AQJA 3KPKA 1E1KA 2H89A 2YG4A 4REKA 2WBAA 3DGHA 3FMWA 3DJGX 2C72A 3GYXA 2XVIA 2R0GA 4B66A 2B9XA 2J3NA 3KKJA 1GESA 4O5UA 1BGJA 2EQ6A 1TDFA 3CGBA 1QO8A 1PDHA 4YXDA 1O5WA 1M6IA 3UKPA 3JSKA 3FPZA 3M13A 4BURA 3AE6A 1GEUA 1GALA 3B3RA 3L1RA 3AE3A 3IF9A 1N4WA 4H2QA 2GH5A 2WPCA 3B6DA 3ATQA 2YVGA 1NPXA 1RSGA 1KNPA 1ZMCA 3AYLA 3QVPA 1K0LA 2XVFA 3NKSA 4GCMA 2C75A 4GDPA 3KA7A 2NVKX 1Q1WA 1E39A 2Z5YA 4II3A 4H4RA 2BS3A 3RNMA 4G6HA 2WHDA 1PBDA 5KNLA 2OA1A 1BWCA 4BJYA 3S61A 2GF3A 3UP5A 1E1LA 2XCGA 2EQ9A 1F3PA 2YR5A 2XLRA 3CMMA 4XWRA 1EL7A 3CPHG 3D8XA 2TPRA 2BK4A 4NEVA 1PBCA 3CNDA 4AOXA 4Z24A 3DK8A 4Z44A 2C3CA 1LQTA 2H88A 1IUWA 2XFNA 5JCIA 2GRTA 4H4TA 4FX9A 2Z5XA 3LZWA 3SFDA 2I0ZA 1PJ5A 2B76A 2XVEA 2YG5A 2PHHA 3NYEA 5EB5A 3M0OA 2C73A 3GRSA 3UOYA 1Q1RA 2QA2A 4HA6A 1JOAA 3ABVA 1H81A 2FJAA 2B9YA 3AWIA 2WDRA 3SYIA 3ZYXA 4BK1A 3T0KA 4H4WA 2ZZBA 3SFEA 4DSGA 5BRTA 5HXIA 1O94A 1GTHA 3SQPA 1YQZA 1ZOYA 4J36A 1JNRA 3P9UA 4J56A 3COXA 2GVCA 3P4QA 4N9XA 4C74A 4TM4A 4PABA 2Y6RA 3WE0A 3AEFA 1PJ6A 4JY3A 1ZMDA 4WX1A 1B37A 3ALMA 3BI2A 2QCUA 3D1CA 3AD9B 5M10A 3URHA 4ZN0A 1D4DA 1N4UA 4WCTA 4A5LA 4XWZA 2JBVA 1GRHA 1ZP0A 2FJEA 3BHFA 4GRTA 5JCLA 2GR1A 4B67A 4H2RA 2WOWA 1CBOA 3NGCX 1NG4A 1KF6A 3GRTA 3K30A 1ZK7A 2FBWA 5KRQA 1IUVA 1B5QA 1JRYA 1CL0A 3H8LA 2RABA 4AP3A 3G5QA 1VDCA 5J7XA 1NAAA 2XVJA 4EQSA 4KX6A 3UCLA 1S3BA 1S3EA 1H83A 2YG7A 4HB9A 3NNEA 4J33A 3ICTA 3L8KA 3NG7X 3P1WA 2YLWA 2GMJA 5J60A 4Y4MA 1JRXA 1IUSA 1OJTA 1H84A 4GAPA 5JCMA 3SZ0A 2GMHA 2XFUA 4NNJA 4BJZA 2BC1A 3KPFA 4ZCCA 3T2ZA 4Z26A 2WU5A 4YKGA 1GOSA 4H4QA 1BZLA 3SXIA 3VQRA 2GR2A 3QSMA 4B69A 3NN0X 2YLTA 4AP1A 3Q9TA 2GAHB 1GV4A 3AB1A 4G73A 4OPTA 3AD7B 4OVIA 4U8NA 5KMQA 4Z2TA 1KDGA 2YLZA 3AEEA 3GWFA 4JY2A 2X8GA 2VZ2A 1YQ3A 1D5TA 3KD9A 5M0ZA 2EQ8A 4FK1C 5JCNA 4IVMB 4U2TA 3CPJG 3E1TA 4AT0A 1H82A 2BK3A 1L0VA 1W4XA 2NPXA 3UOXA 2DKIA 1NG3A 3V3NA 2FJBA 1GERA 4JNAA 4YT0A 4OPIA 3UKLA 1D7YA 2HQMA 3DA1A 4PAAA 1CF3A 3LB8A 3LJPA 2Q0LA 4NTDA 4YKFA 3RP6A 4E0VA 3VR9A 2B7RA 2X8CA 4CCQA 1DJQA 5GSNA 3RP7A 3SZCA 5TR3A 2R4JA 1JNZA 2BS4A 2OAMA 3O0HA 4A6NB 2XLSA 2YG3A 2WS3A 2ZBWA 3H8IA 2IVEA 3AE2A 4RSLA 3UOZA 1D4CA 1HYUA 4J2WA 5CKUA 3G5SA 2C7GA 1ONFA 2GR0A 2X8HA 1TDNA 1Y56A 4U8MA 2C70A 1GSNA 2GAGB 4EMIA 2A87A 2R45A 4TLZA 1Y0PA 4YTNA 3KLJA 5KOWA 3T2YA 2YAUA 1VG0A 5GRTA 3CGCA 3FBSA 1F8WA 1H7WA 2UZZA 1KSUA 3UKHA 2PYXA 3VRBA 3HZLA 3BNUA 1IUTA 1L9DA 2BCPA 1EL8A 5L46A 3SZFA 5KMSA 1PS9A 1ZY8A 1IUXA 3II4A 2WDVA 3UTGA 2BXRA 4ICYA 1XDIA 4OPUA 4B63A 5FS8A 3DH9A 1LVLA 4FDCB 5EOWA 2VVLA 1UKVG 5KXJA 4H4UA 1E1MA 3QJ4A 2VQ7A 2VVLG 3OC4A 1NEKA 2WP9A 4TM3A 1D7LA 4ZCDA 1M64A 4U8KA 4A7AA 1P2EA 2XFPA 4D04A 3AE8A 1COYA 1FEAA 1QJDA 3CNSA 4CY6A 4M52A 2CDUA 3IHGA 1B4VA 2X99A 3QSSA 3IHMA 4B1BA 1Q9IA 2RGOA 3QSEA 4H4PA 4EMWA 2E1MA 4H2PA 4OPLA 1BF3A 1IUUA 3ITJA 3UKFA 1GTEA 3NRNA 5KVHA 1ZOVA 2JB3A 5HY5A 2V5ZA 2JK6A 1OJCA 2GQFA 3CNTA 1DODA 2V3AA 3HYWA 3IC9A 4CNJA 4D03A 4NWZA 2QA1A 3C4NA 1EL9A 2YWLA 4JN9A 4J34A 2R0PA 4JQ9A 3Q6JA 2E5VA 1K0JA 3P4SA 2Y6QA 1GT8A 3LZXA 4LIIA 5FS7A 2BXSA 4IVOB 4DSHA 3VRDB 5C2TA 1GNDA 1OJAA 1E1NA 1KFYA 1REOA 3GSIA 3K7QX 4K7ZA 3DMEA 4U2SA 4CY8A 2OLNA 2CVJA 5HHFA 1L9EA 1TDKA 1JU2A 4H4VA 2YG6A 4UDRA 1V59A 2W0HA 1GRBA 3NN6X 2YVFA 5IQ1A 2R0CA 4G74A 3UP4A 1LQUA 4K5RA 4C77A 1LTXR 3HYVA 3C96A 4DNAA 1VRQB 3NTAA 1K4QA 1XPQA 3DJDA 3UTFA 4A9WA 5JCKA 2IIDA 2XVHA 4TM1A 4YSHA 3ISHA 5BULA 3RHAA 4I59A 1GRAA 1VQWA 1YKJA 4U8LA 3ALJA 4AT2A 4G6GA 3UKQA 4KPRA 2RGHA 1ZDLA 4CBQA 3P4RA 4O5QA 1GREA 2BC0A 2WU2A 2OLOA 3NYFA 3S5WA 1PBEA 3UKKA 3P4PA 1D4EA 4ADWA 2GV8A 2OALA 3AE7A 3BNMA 4BK3A 4EIPA 1GXFA 1DNCA 2EQ7A 1QLBA 3EAOA 5FMHA 4U8PA 1B8SA 3C4AA 3NTDA 2XLTA 2YM2A 2WOIA 3HYXA 2WEUA 2YLXA 1JEHA 4TLXA 1DOEA 1GETA 2F5ZA 2WESA 3AEAA 4K22A 4K8DA 1FL2A 2APGA 4YWOA 1XANA 2ZZ0A 3BI4A 3SM8A 4EQRA 1PXCA 2TMDA 2WPEA 1LPFA 1CC4A 2BA9A 2XDOA 2GB0A 4IV9A 2BK5A 2XLUA 2QAEA 2XFOA 2DKHA 5FS6A 1RP0A 3GMBA 2JAEA 4USRA 2IVDA 2Q6UA 2AR8A 3M12A 4C5OA 3NIXA 1E6EA 2YLSA 4EM3A 3SY4A 2YVJA 3ATRA 3V76A 4MJWA 2E4GA 1E7PA 5U25A 1PXBA 4X9NA 1ZKQA 3GYIA 4JNQA 1NENA 1CJCA 3AXBA 3I6DA 2VRLA 4OPDA 2YR6A 2ZZCA 5EBKA 2JKCA 3UTHA 3NT6A 5U1OA 2Q0KA 1VG9A 1FEBA 4H50A 4ECHA 2CFYA 2C4CA 5IPYA 1RYIA 1BGNA 4EMJA 4USQA 3CNJA 3NK0X 4B64A 3K7MX 4TM0A 2JB2A 2VRMA 2JB1A 3H4KA 4P9SA 3LADA 1KNRA 1FOHA 3AECA 4H4YA 4H4XA 3GD4A 2VOUA 4NTCA 2BRYA 2C3DA 3AE9A 1MXTA 2CULA 1DXLA 1Y56B 3CN8A 2C65A 3VR8A 1JRZA 2WDQA 3AYJA 4LA1A 4FK1A 3PS9A 4UDPA 3QFAA 4GUVA 3UOVA 4Y4NA 4X4JA 2V61A 3KU9A 3V3OA 1YY5A 4I58A 2C64A 3T37A 4H7UA 1TDOA 1O95A 4NZHA
chains in the Genus database with same CATH topology
4UDQA 3NHOX 4UP3A 3VRAA 1PXAA 1PJ7A 2V60A 3ADAB 4EIQA 2A8XA 1H6VA 3CGDA 4YSXA 4GF7A 3EPTA 3UKAA 2WP5A 3FG2P 3GMCA 4Z2UA 2WPFA 2R9ZA 5LV9A 3GDPA 1NDAA 3AEDA 1EL5A 5IQ4A 2RGJA 1TDEA 3QFBA 2AAQA 4NEWA 3NYCA 2XFQA 1SEZA 4Z2RA 4CRTA 5HYMA 4A79A 2WQYA 4K5SA 4U8IA 5U63A 1CC6A 3NK2X 1EBDA 1NHSA 2C67A 3AE1A 3LOVA 3PVCA 3UTEA 2WETA 3AEGA 1DOBA 2BS2A 1ZX9A 1AOGA 2WP6A 3T14A 3DJEA 3DGZA 3DK9A 3G5RA 4GR1A 2B9WA 2WOVA 2A89A 5FS9A 3F8RA 2YR4A 5CQFA 5DBJA 5KMPA 4APNA 4AOSA 2R46A 4OCGA 5KOXA 5C3JA 3BHKA 4YSYA 1CJ4A 1GRFA 4EQWA 4H4SA 1CC2A 3FIMB 3REDA 3SX6A 3OZ2A 3T31A 2BCGG 4B68A 4NTEA 2GR3A 1IJHA 2BRAA 2V6OA 4GDEA 4YTMA 3R9UA 2Q7VA 2XYOA 4X9MA 1DJNA 2XLPA 3EF6A 5EB4A 3NLCA 4YSZA 1L9CA 1F8SA 3DJJA 3GDNA 1MOKA 3AEBA 1YQ4A 2GQWA 2X50A 4YTPA 4EM4A 1GRTA 3CGEA 4C3XA 5BVAA 3CPIG 1CHUA 3NH3X 4U8OA 2BACA 1S2QA 3ALLA 3DK4A 4A65A 4K2XA 1XHCA 1F6MA 1F8RA 2X3NA 1TYPA 4OPCA 4Y4LA 2YM1A 3NK1X 2R4EA 3BI5A 1KSSA 4CNKA 1BKWA 2B7SA 1DOCA 4A99A 1H86A 1CJ2A 1S2YA 5BUKA 3AE5A 3GD3A 4J57A 2V3BA 1Z6LA 1PN0A 4OPGA 2ACZA 3RP8A 2ARDA 2BYBA 3GWDA 3SGLA 3T2KA 1FECA 1ELIA 1NHPA 3SZWA 3ICRA 1MO9A 4LU6A 4U2LA 4H2NA 1OJDA 1PBFA 1PBBA 3K7TA 4GAVA 1NHRA 4EQXA 3KVEA 2O9ZA 3F8DA 1N1PA 1OJ9A 3CTYA 4IA5A 1TYTA 5KMRA 2YLRA 1GPEA 3F8PA 4IA6A 3IWAA 2VQBA 4C3YA 2FJDA 4BV6A 4J31A 1GRGA 2C66A 1H7XA 4JDRA 4Z25A 3CIRA 3QVRA 5ER0A 4Z43A 4G9KA 3ICSA 5KWFA 1PHHA 2YQUA 1FCDA 4RG3A 1LJ1A 1TRBA 3AD8B 3AYIA 3LXDA 1N4VA 4DGKA 3CNPA 1CJ3A 4B65A 4RG4A 3EANA 4XXGA 1X31B 4II2A 4BK2A 3PO7A 3ZDNA 2VVMA 1LV0A 3GYJA 1P2HA 1NHQA 2BABA 2GEWA 5KVIA 4A6NA 3I3LA 2C76A 4CCRA 1K0IA 4H4ZA 4U8JA 3AE4A 2AQJA 3KPKA 1E1KA 2H89A 2YG4A 4REKA 2WBAA 3DGHA 3FMWA 3DJGX 2C72A 3GYXA 2XVIA 2R0GA 4B66A 2B9XA 2J3NA 3KKJA 1GESA 4O5UA 1BGJA 2EQ6A 1TDFA 3CGBA 1QO8A 1PDHA 4YXDA 1O5WA 1M6IA 3UKPA 3JSKA 3FPZA 3M13A 4BURA 3AE6A 1GEUA 1GALA 3B3RA 3L1RA 3AE3A 3IF9A 1N4WA 4H2QA 2GH5A 2WPCA 3B6DA 3ATQA 2YVGA 1NPXA 1RSGA 1KNPA 1ZMCA 3AYLA 3QVPA 1K0LA 2XVFA 3NKSA 4GCMA 2C75A 4GDPA 3KA7A 2NVKX 1Q1WA 1E39A 2Z5YA 4II3A 4H4RA 2BS3A 3RNMA 4G6HA 2WHDA 1PBDA 5KNLA 2OA1A 1BWCA 4BJYA 3S61A 2GF3A 3UP5A 1E1LA 2XCGA 2EQ9A 1F3PA 2YR5A 2XLRA 3CMMA 4XWRA 1EL7A 3CPHG 3D8XA 2TPRA 2BK4A 4NEVA 1PBCA 3CNDA 4AOXA 4Z24A 3DK8A 4Z44A 2C3CA 1LQTA 2H88A 1IUWA 2XFNA 5JCIA 2GRTA 4H4TA 4FX9A 2Z5XA 3LZWA 3SFDA 2I0ZA 1PJ5A 2B76A 2XVEA 2YG5A 2PHHA 3NYEA 5EB5A 3M0OA 2C73A 3GRSA 3UOYA 1Q1RA 2QA2A 4HA6A 1JOAA 3ABVA 1H81A 2FJAA 2B9YA 3AWIA 2WDRA 3SYIA 3ZYXA 4BK1A 3T0KA 4H4WA 2ZZBA 3SFEA 4DSGA 5BRTA 5HXIA 1O94A 1GTHA 3SQPA 1YQZA 1ZOYA 4J36A 1JNRA 3P9UA 4J56A 3COXA 2GVCA 3P4QA 4N9XA 4C74A 4TM4A 4PABA 2Y6RA 3WE0A 3AEFA 1PJ6A 4JY3A 1ZMDA 4WX1A 1B37A 3ALMA 3BI2A 2QCUA 3D1CA 3AD9B 5M10A 3URHA 4ZN0A 1D4DA 1N4UA 4WCTA 4A5LA 4XWZA 2JBVA 1GRHA 1ZP0A 2FJEA 3BHFA 4GRTA 5JCLA 2GR1A 4B67A 4H2RA 2WOWA 1CBOA 3NGCX 1NG4A 1KF6A 3GRTA 3K30A 1ZK7A 2FBWA 5KRQA 1IUVA 1B5QA 1JRYA 1CL0A 3H8LA 2RABA 4AP3A 3G5QA 1VDCA 5J7XA 1NAAA 2XVJA 4EQSA 4KX6A 3UCLA 1S3BA 1S3EA 1H83A 2YG7A 4HB9A 3NNEA 4J33A 3ICTA 3L8KA 3NG7X 3P1WA 2YLWA 2GMJA 5J60A 4Y4MA 1JRXA 1IUSA 1OJTA 1H84A 4GAPA 5JCMA 3SZ0A 2GMHA 2XFUA 4NNJA 4BJZA 2BC1A 3KPFA 4ZCCA 3T2ZA 4Z26A 2WU5A 4YKGA 1GOSA 4H4QA 1BZLA 3SXIA 3VQRA 2GR2A 3QSMA 4B69A 3NN0X 2YLTA 4AP1A 3Q9TA 2GAHB 1GV4A 3AB1A 4G73A 4OPTA 3AD7B 4OVIA 4U8NA 5KMQA 4Z2TA 1KDGA 2YLZA 3AEEA 3GWFA 4JY2A 2X8GA 2VZ2A 1YQ3A 1D5TA 3KD9A 5M0ZA 2EQ8A 4FK1C 5JCNA 4IVMB 4U2TA 3CPJG 3E1TA 4AT0A 1H82A 2BK3A 1L0VA 1W4XA 2NPXA 3UOXA 2DKIA 1NG3A 3V3NA 2FJBA 1GERA 4JNAA 4YT0A 4OPIA 3UKLA 1D7YA 2HQMA 3DA1A 4PAAA 1CF3A 3LB8A 3LJPA 2Q0LA 4NTDA 4YKFA 3RP6A 4E0VA 3VR9A 2B7RA 2X8CA 4CCQA 1DJQA 5GSNA 3RP7A 3SZCA 5TR3A 2R4JA 1JNZA 2BS4A 2OAMA 3O0HA 4A6NB 2XLSA 2YG3A 2WS3A 2ZBWA 3H8IA 2IVEA 3AE2A 4RSLA 3UOZA 1D4CA 1HYUA 4J2WA 5CKUA 3G5SA 2C7GA 1ONFA 2GR0A 2X8HA 1TDNA 1Y56A 4U8MA 2C70A 1GSNA 2GAGB 4EMIA 2A87A 2R45A 4TLZA 1Y0PA 4YTNA 3KLJA 5KOWA 3T2YA 2YAUA 1VG0A 5GRTA 3CGCA 3FBSA 1F8WA 1H7WA 2UZZA 1KSUA 3UKHA 2PYXA 3VRBA 3HZLA 3BNUA 1IUTA 1L9DA 2BCPA 1EL8A 5L46A 3SZFA 5KMSA 1PS9A 1ZY8A 1IUXA 3II4A 2WDVA 3UTGA 2BXRA 4ICYA 1XDIA 4OPUA 4B63A 5FS8A 3DH9A 1LVLA 4FDCB 5EOWA 2VVLA 1UKVG 5KXJA 4H4UA 1E1MA 3QJ4A 2VQ7A 2VVLG 3OC4A 1NEKA 2WP9A 4TM3A 1D7LA 4ZCDA 1M64A 4U8KA 4A7AA 1P2EA 2XFPA 4D04A 3AE8A 1COYA 1FEAA 1QJDA 3CNSA 4CY6A 4M52A 2CDUA 3IHGA 1B4VA 2X99A 3QSSA 3IHMA 4B1BA 1Q9IA 2RGOA 3QSEA 4H4PA 4EMWA 2E1MA 4H2PA 4OPLA 1BF3A 1IUUA 3ITJA 3UKFA 1GTEA 3NRNA 5KVHA 1ZOVA 2JB3A 5HY5A 2V5ZA 2JK6A 1OJCA 2GQFA 3CNTA 1DODA 2V3AA 3HYWA 3IC9A 4CNJA 4D03A 4NWZA 2QA1A 3C4NA 1EL9A 2YWLA 4JN9A 4J34A 2R0PA 4JQ9A 3Q6JA 2E5VA 1K0JA 3P4SA 2Y6QA 1GT8A 3LZXA 4LIIA 5FS7A 2BXSA 4IVOB 4DSHA 3VRDB 5C2TA 1GNDA 1OJAA 1E1NA 1KFYA 1REOA 3GSIA 3K7QX 4K7ZA 3DMEA 4U2SA 4CY8A 2OLNA 2CVJA 5HHFA 1L9EA 1TDKA 1JU2A 4H4VA 2YG6A 4UDRA 1V59A 2W0HA 1GRBA 3NN6X 2YVFA 5IQ1A 2R0CA 4G74A 3UP4A 1LQUA 4K5RA 4C77A 1LTXR 3HYVA 3C96A 4DNAA 1VRQB 3NTAA 1K4QA 1XPQA 3DJDA 3UTFA 4A9WA 5JCKA 2IIDA 2XVHA 4TM1A 4YSHA 3ISHA 5BULA 3RHAA 4I59A 1GRAA 1VQWA 1YKJA 4U8LA 3ALJA 4AT2A 4G6GA 3UKQA 4KPRA 2RGHA 1ZDLA 4CBQA 3P4RA 4O5QA 1GREA 2BC0A 2WU2A 2OLOA 3NYFA 3S5WA 1PBEA 3UKKA 3P4PA 1D4EA 4ADWA 2GV8A 2OALA 3AE7A 3BNMA 4BK3A 4EIPA 1GXFA 1DNCA 2EQ7A 1QLBA 3EAOA 5FMHA 4U8PA 1B8SA 3C4AA 3NTDA 2XLTA 2YM2A 2WOIA 3HYXA 2WEUA 2YLXA 1JEHA 4TLXA 1DOEA 1GETA 2F5ZA 2WESA 3AEAA 4K22A 4K8DA 1FL2A 2APGA 4YWOA 1XANA 2ZZ0A 3BI4A 3SM8A 4EQRA 1PXCA 2TMDA 2WPEA 1LPFA 1CC4A 2BA9A 2XDOA 2GB0A 4IV9A 2BK5A 2XLUA 2QAEA 2XFOA 2DKHA 5FS6A 1RP0A 3GMBA 2JAEA 4USRA 2IVDA 2Q6UA 2AR8A 3M12A 4C5OA 3NIXA 1E6EA 2YLSA 4EM3A 3SY4A 2YVJA 3ATRA 3V76A 4MJWA 2E4GA 1E7PA 5U25A 1PXBA 4X9NA 1ZKQA 3GYIA 4JNQA 1NENA 1CJCA 3AXBA 3I6DA 2VRLA 4OPDA 2YR6A 2ZZCA 5EBKA 2JKCA 3UTHA 3NT6A 5U1OA 2Q0KA 1VG9A 1FEBA 4H50A 4ECHA 2CFYA 2C4CA 5IPYA 1RYIA 1BGNA 4EMJA 4USQA 3CNJA 3NK0X 4B64A 3K7MX 4TM0A 2JB2A 2VRMA 2JB1A 3H4KA 4P9SA 3LADA 1KNRA 1FOHA 3AECA 4H4YA 4H4XA 3GD4A 2VOUA 4NTCA 2BRYA 2C3DA 3AE9A 1MXTA 2CULA 1DXLA 1Y56B 3CN8A 2C65A 3VR8A 1JRZA 2WDQA 3AYJA 4LA1A 4FK1A 3PS9A 4UDPA 3QFAA 4GUVA 3UOVA 4Y4NA 4X4JA 2V61A 3KU9A 3V3OA 1YY5A 4I58A 2C64A 3T37A 4H7UA 1TDOA 1O95A 4NZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2K A;  3SZW A;  3T14 A;  4GAV A;  4GAP A;  4G6G A;  3SZ0 A;  3T2Z A;  3T2Y A;  4G6H A;  5KMR A;  3KPK A;  3SXI A;  3SYI A;  3T0K A;  3SY4 A;  5KMP A;  4G73 A;  5KMQ A;  3SZF A;  5KMS A;  3SZC A;  3HYX A;  3SX6 A;  4G9K A;  4G74 A;  3T31 A;  3HYW A;  4NWZ A;  3HYV A; 
#chains in the Genus database with same CATH topology
 4UDQ A;  3NHO X;  4UP3 A;  3VRA A;  1PXA A;  1PJ7 A;  2V60 A;  3ADA B;  4EIQ A;  2A8X A;  1H6V A;  3CGD A;  4YSX A;  4GF7 A;  3EPT A;  3UKA A;  2WP5 A;  3FG2 P;  3GMC A;  4Z2U A;  2WPF A;  2R9Z A;  5LV9 A;  3GDP A;  1NDA A;  3AED A;  1EL5 A;  5IQ4 A;  2RGJ A;  1TDE A;  3QFB A;  2AAQ A;  4NEW A;  3NYC A;  2XFQ A;  1SEZ A;  4Z2R A;  4CRT A;  5HYM A;  4A79 A;  2WQY A;  4K5S A;  4U8I A;  5U63 A;  1CC6 A;  3NK2 X;  1EBD A;  1NHS A;  2C67 A;  3AE1 A;  3LOV A;  3PVC A;  3UTE A;  2WET A;  3AEG A;  1DOB A;  2BS2 A;  1ZX9 A;  1AOG A;  2WP6 A;  3T14 A;  3DJE A;  3DGZ A;  3DK9 A;  3G5R A;  4GR1 A;  2B9W A;  2WOV A;  2A89 A;  5FS9 A;  3F8R A;  2YR4 A;  5CQF A;  5DBJ A;  5KMP A;  4APN A;  4AOS A;  2R46 A;  4OCG A;  5KOX A;  5C3J A;  3BHK A;  4YSY A;  1CJ4 A;  1GRF A;  4EQW A;  4H4S A;  1CC2 A;  3FIM B;  3RED A;  3SX6 A;  3OZ2 A;  3T31 A;  2BCG G;  4B68 A;  4NTE A;  2GR3 A;  1IJH A;  2BRA A;  2V6O A;  4GDE A;  4YTM A;  3R9U A;  2Q7V A;  2XYO A;  4X9M A;  1DJN A;  2XLP A;  3EF6 A;  5EB4 A;  3NLC A;  4YSZ A;  1L9C A;  1F8S A;  3DJJ A;  3GDN A;  1MOK A;  3AEB A;  1YQ4 A;  2GQW A;  2X50 A;  4YTP A;  4EM4 A;  1GRT A;  3CGE A;  4C3X A;  5BVA A;  3CPI G;  1CHU A;  3NH3 X;  4U8O A;  2BAC A;  1S2Q A;  3ALL A;  3DK4 A;  4A65 A;  4K2X A;  1XHC A;  1F6M A;  1F8R A;  2X3N A;  1TYP A;  4OPC A;  4Y4L A;  2YM1 A;  3NK1 X;  2R4E A;  3BI5 A;  1KSS A;  4CNK A;  1BKW A;  2B7S A;  1DOC A;  4A99 A;  1H86 A;  1CJ2 A;  1S2Y A;  5BUK A;  3AE5 A;  3GD3 A;  4J57 A;  2V3B A;  1Z6L A;  1PN0 A;  4OPG A;  2ACZ A;  3RP8 A;  2ARD A;  2BYB A;  3GWD A;  3SGL A;  3T2K A;  1FEC A;  1ELI A;  1NHP A;  3SZW A;  3ICR A;  1MO9 A;  4LU6 A;  4U2L A;  4H2N A;  1OJD A;  1PBF A;  1PBB A;  3K7T A;  4GAV A;  1NHR A;  4EQX A;  3KVE A;  2O9Z A;  3F8D A;  1N1P A;  1OJ9 A;  3CTY A;  4IA5 A;  1TYT A;  5KMR A;  2YLR A;  1GPE A;  3F8P A;  4IA6 A;  3IWA A;  2VQB A;  4C3Y A;  2FJD A;  4BV6 A;  4J31 A;  1GRG A;  2C66 A;  1H7X A;  4JDR A;  4Z25 A;  3CIR A;  3QVR A;  5ER0 A;  4Z43 A;  4G9K A;  3ICS A;  5KWF A;  1PHH A;  2YQU A;  1FCD A;  4RG3 A;  1LJ1 A;  1TRB A;  3AD8 B;  3AYI A;  3LXD A;  1N4V A;  4DGK A;  3CNP A;  1CJ3 A;  4B65 A;  4RG4 A;  3EAN A;  4XXG A;  1X31 B;  4II2 A;  4BK2 A;  3PO7 A;  3ZDN A;  2VVM A;  1LV0 A;  3GYJ A;  1P2H A;  1NHQ A;  2BAB A;  2GEW A;  5KVI A;  4A6N A;  3I3L A;  2C76 A;  4CCR A;  1K0I A;  4H4Z A;  4U8J A;  3AE4 A;  2AQJ A;  3KPK A;  1E1K A;  2H89 A;  2YG4 A;  4REK A;  2WBA A;  3DGH A;  3FMW A;  3DJG X;  2C72 A;  3GYX A;  2XVI A;  2R0G A;  4B66 A;  2B9X A;  2J3N A;  3KKJ A;  1GES A;  4O5U A;  1BGJ A;  2EQ6 A;  1TDF A;  3CGB A;  1QO8 A;  1PDH A;  4YXD A;  1O5W A;  1M6I A;  3UKP A;  3JSK A;  3FPZ A;  3M13 A;  4BUR A;  3AE6 A;  1GEU A;  1GAL A;  3B3R A;  3L1R A;  3AE3 A;  3IF9 A;  1N4W A;  4H2Q A;  2GH5 A;  2WPC A;  3B6D A;  3ATQ A;  2YVG A;  1NPX A;  1RSG A;  1KNP A;  1ZMC A;  3AYL A;  3QVP A;  1K0L A;  2XVF A;  3NKS A;  4GCM A;  2C75 A;  4GDP A;  3KA7 A;  2NVK X;  1Q1W A;  1E39 A;  2Z5Y A;  4II3 A;  4H4R A;  2BS3 A;  3RNM A;  4G6H A;  2WHD A;  1PBD A;  5KNL A;  2OA1 A;  1BWC A;  4BJY A;  3S61 A;  2GF3 A;  3UP5 A;  1E1L A;  2XCG A;  2EQ9 A;  1F3P A;  2YR5 A;  2XLR A;  3CMM A;  4XWR A;  1EL7 A;  3CPH G;  3D8X A;  2TPR A;  2BK4 A;  4NEV A;  1PBC A;  3CND A;  4AOX A;  4Z24 A;  3DK8 A;  4Z44 A;  2C3C A;  1LQT A;  2H88 A;  1IUW A;  2XFN A;  5JCI A;  2GRT A;  4H4T A;  4FX9 A;  2Z5X A;  3LZW A;  3SFD A;  2I0Z A;  1PJ5 A;  2B76 A;  2XVE A;  2YG5 A;  2PHH A;  3NYE A;  5EB5 A;  3M0O A;  2C73 A;  3GRS A;  3UOY A;  1Q1R A;  2QA2 A;  4HA6 A;  1JOA A;  3ABV A;  1H81 A;  2FJA A;  2B9Y A;  3AWI A;  2WDR A;  3SYI A;  3ZYX A;  4BK1 A;  3T0K A;  4H4W A;  2ZZB A;  3SFE A;  4DSG A;  5BRT A;  5HXI A;  1O94 A;  1GTH A;  3SQP A;  1YQZ A;  1ZOY A;  4J36 A;  1JNR A;  3P9U A;  4J56 A;  3COX A;  2GVC A;  3P4Q A;  4N9X A;  4C74 A;  4TM4 A;  4PAB A;  2Y6R A;  3WE0 A;  3AEF A;  1PJ6 A;  4JY3 A;  1ZMD A;  4WX1 A;  1B37 A;  3ALM A;  3BI2 A;  2QCU A;  3D1C A;  3AD9 B;  5M10 A;  3URH A;  4ZN0 A;  1D4D A;  1N4U A;  4WCT A;  4A5L A;  4XWZ A;  2JBV A;  1GRH A;  1ZP0 A;  2FJE A;  3BHF A;  4GRT A;  5JCL A;  2GR1 A;  4B67 A;  4H2R A;  2WOW A;  1CBO A;  3NGC X;  1NG4 A;  1KF6 A;  3GRT A;  3K30 A;  1ZK7 A;  2FBW A;  5KRQ A;  1IUV A;  1B5Q A;  1JRY A;  1CL0 A;  3H8L A;  2RAB A;  4AP3 A;  3G5Q A;  1VDC A;  5J7X A;  1NAA A;  2XVJ A;  4EQS A;  4KX6 A;  3UCL A;  1S3B A;  1S3E A;  1H83 A;  2YG7 A;  4HB9 A;  3NNE A;  4J33 A;  3ICT A;  3L8K A;  3NG7 X;  3P1W A;  2YLW A;  2GMJ A;  5J60 A;  4Y4M A;  1JRX A;  1IUS A;  1OJT A;  1H84 A;  4GAP A;  5JCM A;  3SZ0 A;  2GMH A;  2XFU A;  4NNJ A;  4BJZ A;  2BC1 A;  3KPF A;  4ZCC A;  3T2Z A;  4Z26 A;  2WU5 A;  4YKG A;  1GOS A;  4H4Q A;  1BZL A;  3SXI A;  3VQR A;  2GR2 A;  3QSM A;  4B69 A;  3NN0 X;  2YLT A;  4AP1 A;  3Q9T A;  2GAH B;  1GV4 A;  3AB1 A;  4G73 A;  4OPT A;  3AD7 B;  4OVI A;  4U8N A;  5KMQ A;  4Z2T A;  1KDG A;  2YLZ A;  3AEE A;  3GWF A;  4JY2 A;  2X8G A;  2VZ2 A;  1YQ3 A;  1D5T A;  3KD9 A;  5M0Z A;  2EQ8 A;  4FK1 C;  5JCN A;  4IVM B;  4U2T A;  3CPJ G;  3E1T A;  4AT0 A;  1H82 A;  2BK3 A;  1L0V A;  1W4X A;  2NPX A;  3UOX A;  2DKI A;  1NG3 A;  3V3N A;  2FJB A;  1GER A;  4JNA A;  4YT0 A;  4OPI A;  3UKL A;  1D7Y A;  2HQM A;  3DA1 A;  4PAA A;  1CF3 A;  3LB8 A;  3LJP A;  2Q0L A;  4NTD A;  4YKF A;  3RP6 A;  4E0V A;  3VR9 A;  2B7R A;  2X8C A;  4CCQ A;  1DJQ A;  5GSN A;  3RP7 A;  3SZC A;  5TR3 A;  2R4J A;  1JNZ A;  2BS4 A;  2OAM A;  3O0H A;  4A6N B;  2XLS A;  2YG3 A;  2WS3 A;  2ZBW A;  3H8I A;  2IVE A;  3AE2 A;  4RSL A;  3UOZ A;  1D4C A;  1HYU A;  4J2W A;  5CKU A;  3G5S A;  2C7G A;  1ONF A;  2GR0 A;  2X8H A;  1TDN A;  1Y56 A;  4U8M A;  2C70 A;  1GSN A;  2GAG B;  4EMI A;  2A87 A;  2R45 A;  4TLZ A;  1Y0P A;  4YTN A;  3KLJ A;  5KOW A;  3T2Y A;  2YAU A;  1VG0 A;  5GRT A;  3CGC A;  3FBS A;  1F8W A;  1H7W A;  2UZZ A;  1KSU A;  3UKH A;  2PYX A;  3VRB A;  3HZL A;  3BNU A;  1IUT A;  1L9D A;  2BCP A;  1EL8 A;  5L46 A;  3SZF A;  5KMS A;  1PS9 A;  1ZY8 A;  1IUX A;  3II4 A;  2WDV A;  3UTG A;  2BXR A;  4ICY A;  1XDI A;  4OPU A;  4B63 A;  5FS8 A;  3DH9 A;  1LVL A;  4FDC B;  5EOW A;  2VVL A;  1UKV G;  5KXJ A;  4H4U A;  1E1M A;  3QJ4 A;  2VQ7 A;  2VVL G;  3OC4 A;  1NEK A;  2WP9 A;  4TM3 A;  1D7L A;  4ZCD A;  1M64 A;  4U8K A;  4A7A A;  1P2E A;  2XFP A;  4D04 A;  3AE8 A;  1COY A;  1FEA A;  1QJD A;  3CNS A;  4CY6 A;  4M52 A;  2CDU A;  3IHG A;  1B4V A;  2X99 A;  3QSS A;  3IHM A;  4B1B A;  1Q9I A;  2RGO A;  3QSE A;  4H4P A;  4EMW A;  2E1M A;  4H2P A;  4OPL A;  1BF3 A;  1IUU A;  3ITJ A;  3UKF A;  1GTE A;  3NRN A;  5KVH A;  1ZOV A;  2JB3 A;  5HY5 A;  2V5Z A;  2JK6 A;  1OJC A;  2GQF A;  3CNT A;  1DOD A;  2V3A A;  3HYW A;  3IC9 A;  4CNJ A;  4D03 A;  4NWZ A;  2QA1 A;  3C4N A;  1EL9 A;  2YWL A;  4JN9 A;  4J34 A;  2R0P A;  4JQ9 A;  3Q6J A;  2E5V A;  1K0J A;  3P4S A;  2Y6Q A;  1GT8 A;  3LZX A;  4LII A;  5FS7 A;  2BXS A;  4IVO B;  4DSH A;  3VRD B;  5C2T A;  1GND A;  1OJA A;  1E1N A;  1KFY A;  1REO A;  3GSI A;  3K7Q X;  4K7Z A;  3DME A;  4U2S A;  4CY8 A;  2OLN A;  2CVJ A;  5HHF A;  1L9E A;  1TDK A;  1JU2 A;  4H4V A;  2YG6 A;  4UDR A;  1V59 A;  2W0H A;  1GRB A;  3NN6 X;  2YVF A;  5IQ1 A;  2R0C A;  4G74 A;  3UP4 A;  1LQU A;  4K5R A;  4C77 A;  1LTX R;  3HYV A;  3C96 A;  4DNA A;  1VRQ B;  3NTA A;  1K4Q A;  1XPQ A;  3DJD A;  3UTF A;  4A9W A;  5JCK A;  2IID A;  2XVH A;  4TM1 A;  4YSH A;  3ISH A;  5BUL A;  3RHA A;  4I59 A;  1GRA A;  1VQW A;  1YKJ A;  4U8L A;  3ALJ A;  4AT2 A;  4G6G A;  3UKQ A;  4KPR A;  2RGH A;  1ZDL A;  4CBQ A;  3P4R A;  4O5Q A;  1GRE A;  2BC0 A;  2WU2 A;  2OLO A;  3NYF A;  3S5W A;  1PBE A;  3UKK A;  3P4P A;  1D4E A;  4ADW A;  2GV8 A;  2OAL A;  3AE7 A;  3BNM A;  4BK3 A;  4EIP A;  1GXF A;  1DNC A;  2EQ7 A;  1QLB A;  3EAO A;  5FMH A;  4U8P A;  1B8S A;  3C4A A;  3NTD A;  2XLT A;  2YM2 A;  2WOI A;  3HYX A;  2WEU A;  2YLX A;  1JEH A;  4TLX A;  1DOE A;  1GET A;  2F5Z A;  2WES A;  3AEA A;  4K22 A;  4K8D A;  1FL2 A;  2APG A;  4YWO A;  1XAN A;  2ZZ0 A;  3BI4 A;  3SM8 A;  4EQR A;  1PXC A;  2TMD A;  2WPE A;  1LPF A;  1CC4 A;  2BA9 A;  2XDO A;  2GB0 A;  4IV9 A;  2BK5 A;  2XLU A;  2QAE A;  2XFO A;  2DKH A;  5FS6 A;  1RP0 A;  3GMB A;  2JAE A;  4USR A;  2IVD A;  2Q6U A;  2AR8 A;  3M12 A;  4C5O A;  3NIX A;  1E6E A;  2YLS A;  4EM3 A;  3SY4 A;  2YVJ A;  3ATR A;  3V76 A;  4MJW A;  2E4G A;  1E7P A;  5U25 A;  1PXB A;  4X9N A;  1ZKQ A;  3GYI A;  4JNQ A;  1NEN A;  1CJC A;  3AXB A;  3I6D A;  2VRL A;  4OPD A;  2YR6 A;  2ZZC A;  5EBK A;  2JKC A;  3UTH A;  3NT6 A;  5U1O A;  2Q0K A;  1VG9 A;  1FEB A;  4H50 A;  4ECH A;  2CFY A;  2C4C A;  5IPY A;  1RYI A;  1BGN A;  4EMJ A;  4USQ A;  3CNJ A;  3NK0 X;  4B64 A;  3K7M X;  4TM0 A;  2JB2 A;  2VRM A;  2JB1 A;  3H4K A;  4P9S A;  3LAD A;  1KNR A;  1FOH A;  3AEC A;  4H4Y A;  4H4X A;  3GD4 A;  2VOU A;  4NTC A;  2BRY A;  2C3D A;  3AE9 A;  1MXT A;  2CUL A;  1DXL A;  1Y56 B;  3CN8 A;  2C65 A;  3VR8 A;  1JRZ A;  2WDQ A;  3AYJ A;  4LA1 A;  4FK1 A;  3PS9 A;  4UDP A;  3QFA A;  4GUV A;  3UOV A;  4Y4N A;  4X4J A;  2V61 A;  3KU9 A;  3V3O A;  1YY5 A;  4I58 A;  2C64 A;  3T37 A;  4H7U A;  1TDO A;  1O95 A;  4NZH A; 
#chains in the Genus database with same CATH homology
 4UDQ A;  3NHO X;  4UP3 A;  3VRA A;  1PXA A;  1PJ7 A;  2V60 A;  3ADA B;  4EIQ A;  2A8X A;  1H6V A;  3CGD A;  4YSX A;  4GF7 A;  3EPT A;  3UKA A;  2WP5 A;  3FG2 P;  3GMC A;  4Z2U A;  2WPF A;  2R9Z A;  5LV9 A;  3GDP A;  1NDA A;  3AED A;  1EL5 A;  5IQ4 A;  2RGJ A;  1TDE A;  3QFB A;  2AAQ A;  4NEW A;  3NYC A;  2XFQ A;  1SEZ A;  4Z2R A;  4CRT A;  5HYM A;  4A79 A;  2WQY A;  4K5S A;  4U8I A;  5U63 A;  1CC6 A;  3NK2 X;  1EBD A;  1NHS A;  2C67 A;  3AE1 A;  3LOV A;  3PVC A;  3UTE A;  2WET A;  3AEG A;  1DOB A;  2BS2 A;  1ZX9 A;  1AOG A;  2WP6 A;  3T14 A;  3DJE A;  3DGZ A;  3DK9 A;  3G5R A;  4GR1 A;  2B9W A;  2WOV A;  2A89 A;  5FS9 A;  3F8R A;  2YR4 A;  5CQF A;  5DBJ A;  5KMP A;  4APN A;  4AOS A;  2R46 A;  4OCG A;  5KOX A;  5C3J A;  3BHK A;  4YSY A;  1CJ4 A;  1GRF A;  4EQW A;  4H4S A;  1CC2 A;  3FIM B;  3RED A;  3SX6 A;  3OZ2 A;  3T31 A;  2BCG G;  4B68 A;  4NTE A;  2GR3 A;  1IJH A;  2BRA A;  2V6O A;  4GDE A;  4YTM A;  3R9U A;  2Q7V A;  2XYO A;  4X9M A;  1DJN A;  2XLP A;  3EF6 A;  5EB4 A;  3NLC A;  4YSZ A;  1L9C A;  1F8S A;  3DJJ A;  3GDN A;  1MOK A;  3AEB A;  1YQ4 A;  2GQW A;  2X50 A;  4YTP A;  4EM4 A;  1GRT A;  3CGE A;  4C3X A;  5BVA A;  3CPI G;  1CHU A;  3NH3 X;  4U8O A;  2BAC A;  1S2Q A;  3ALL A;  3DK4 A;  4A65 A;  4K2X A;  1XHC A;  1F6M A;  1F8R A;  2X3N A;  1TYP A;  4OPC A;  4Y4L A;  2YM1 A;  3NK1 X;  2R4E A;  3BI5 A;  1KSS A;  4CNK A;  1BKW A;  2B7S A;  1DOC A;  4A99 A;  1H86 A;  1CJ2 A;  1S2Y A;  5BUK A;  3AE5 A;  3GD3 A;  4J57 A;  2V3B A;  1Z6L A;  1PN0 A;  4OPG A;  2ACZ A;  3RP8 A;  2ARD A;  2BYB A;  3GWD A;  3SGL A;  3T2K A;  1FEC A;  1ELI A;  1NHP A;  3SZW A;  3ICR A;  1MO9 A;  4LU6 A;  4U2L A;  4H2N A;  1OJD A;  1PBF A;  1PBB A;  3K7T A;  4GAV A;  1NHR A;  4EQX A;  3KVE A;  2O9Z A;  3F8D A;  1N1P A;  1OJ9 A;  3CTY A;  4IA5 A;  1TYT A;  5KMR A;  2YLR A;  1GPE A;  3F8P A;  4IA6 A;  3IWA A;  2VQB A;  4C3Y A;  2FJD A;  4BV6 A;  4J31 A;  1GRG A;  2C66 A;  1H7X A;  4JDR A;  4Z25 A;  3CIR A;  3QVR A;  5ER0 A;  4Z43 A;  4G9K A;  3ICS A;  5KWF A;  1PHH A;  2YQU A;  1FCD A;  4RG3 A;  1LJ1 A;  1TRB A;  3AD8 B;  3AYI A;  3LXD A;  1N4V A;  4DGK A;  3CNP A;  1CJ3 A;  4B65 A;  4RG4 A;  3EAN A;  4XXG A;  1X31 B;  4II2 A;  4BK2 A;  3PO7 A;  3ZDN A;  2VVM A;  1LV0 A;  3GYJ A;  1P2H A;  1NHQ A;  2BAB A;  2GEW A;  5KVI A;  4A6N A;  3I3L A;  2C76 A;  4CCR A;  1K0I A;  4H4Z A;  4U8J A;  3AE4 A;  2AQJ A;  3KPK A;  1E1K A;  2H89 A;  2YG4 A;  4REK A;  2WBA A;  3DGH A;  3FMW A;  3DJG X;  2C72 A;  3GYX A;  2XVI A;  2R0G A;  4B66 A;  2B9X A;  2J3N A;  3KKJ A;  1GES A;  4O5U A;  1BGJ A;  2EQ6 A;  1TDF A;  3CGB A;  1QO8 A;  1PDH A;  4YXD A;  1O5W A;  1M6I A;  3UKP A;  3JSK A;  3FPZ A;  3M13 A;  4BUR A;  3AE6 A;  1GEU A;  1GAL A;  3B3R A;  3L1R A;  3AE3 A;  3IF9 A;  1N4W A;  4H2Q A;  2GH5 A;  2WPC A;  3B6D A;  3ATQ A;  2YVG A;  1NPX A;  1RSG A;  1KNP A;  1ZMC A;  3AYL A;  3QVP A;  1K0L A;  2XVF A;  3NKS A;  4GCM A;  2C75 A;  4GDP A;  3KA7 A;  2NVK X;  1Q1W A;  1E39 A;  2Z5Y A;  4II3 A;  4H4R A;  2BS3 A;  3RNM A;  4G6H A;  2WHD A;  1PBD A;  5KNL A;  2OA1 A;  1BWC A;  4BJY A;  3S61 A;  2GF3 A;  3UP5 A;  1E1L A;  2XCG A;  2EQ9 A;  1F3P A;  2YR5 A;  2XLR A;  3CMM A;  4XWR A;  1EL7 A;  3CPH G;  3D8X A;  2TPR A;  2BK4 A;  4NEV A;  1PBC A;  3CND A;  4AOX A;  4Z24 A;  3DK8 A;  4Z44 A;  2C3C A;  1LQT A;  2H88 A;  1IUW A;  2XFN A;  5JCI A;  2GRT A;  4H4T A;  4FX9 A;  2Z5X A;  3LZW A;  3SFD A;  2I0Z A;  1PJ5 A;  2B76 A;  2XVE A;  2YG5 A;  2PHH A;  3NYE A;  5EB5 A;  3M0O A;  2C73 A;  3GRS A;  3UOY A;  1Q1R A;  2QA2 A;  4HA6 A;  1JOA A;  3ABV A;  1H81 A;  2FJA A;  2B9Y A;  3AWI A;  2WDR A;  3SYI A;  3ZYX A;  4BK1 A;  3T0K A;  4H4W A;  2ZZB A;  3SFE A;  4DSG A;  5BRT A;  5HXI A;  1O94 A;  1GTH A;  3SQP A;  1YQZ A;  1ZOY A;  4J36 A;  1JNR A;  3P9U A;  4J56 A;  3COX A;  2GVC A;  3P4Q A;  4N9X A;  4C74 A;  4TM4 A;  4PAB A;  2Y6R A;  3WE0 A;  3AEF A;  1PJ6 A;  4JY3 A;  1ZMD A;  4WX1 A;  1B37 A;  3ALM A;  3BI2 A;  2QCU A;  3D1C A;  3AD9 B;  5M10 A;  3URH A;  4ZN0 A;  1D4D A;  1N4U A;  4WCT A;  4A5L A;  4XWZ A;  2JBV A;  1GRH A;  1ZP0 A;  2FJE A;  3BHF A;  4GRT A;  5JCL A;  2GR1 A;  4B67 A;  4H2R A;  2WOW A;  1CBO A;  3NGC X;  1NG4 A;  1KF6 A;  3GRT A;  3K30 A;  1ZK7 A;  2FBW A;  5KRQ A;  1IUV A;  1B5Q A;  1JRY A;  1CL0 A;  3H8L A;  2RAB A;  4AP3 A;  3G5Q A;  1VDC A;  5J7X A;  1NAA A;  2XVJ A;  4EQS A;  4KX6 A;  3UCL A;  1S3B A;  1S3E A;  1H83 A;  2YG7 A;  4HB9 A;  3NNE A;  4J33 A;  3ICT A;  3L8K A;  3NG7 X;  3P1W A;  2YLW A;  2GMJ A;  5J60 A;  4Y4M A;  1JRX A;  1IUS A;  1OJT A;  1H84 A;  4GAP A;  5JCM A;  3SZ0 A;  2GMH A;  2XFU A;  4NNJ A;  4BJZ A;  2BC1 A;  3KPF A;  4ZCC A;  3T2Z A;  4Z26 A;  2WU5 A;  4YKG A;  1GOS A;  4H4Q A;  1BZL A;  3SXI A;  3VQR A;  2GR2 A;  3QSM A;  4B69 A;  3NN0 X;  2YLT A;  4AP1 A;  3Q9T A;  2GAH B;  1GV4 A;  3AB1 A;  4G73 A;  4OPT A;  3AD7 B;  4OVI A;  4U8N A;  5KMQ A;  4Z2T A;  1KDG A;  2YLZ A;  3AEE A;  3GWF A;  4JY2 A;  2X8G A;  2VZ2 A;  1YQ3 A;  1D5T A;  3KD9 A;  5M0Z A;  2EQ8 A;  4FK1 C;  5JCN A;  4IVM B;  4U2T A;  3CPJ G;  3E1T A;  4AT0 A;  1H82 A;  2BK3 A;  1L0V A;  1W4X A;  2NPX A;  3UOX A;  2DKI A;  1NG3 A;  3V3N A;  2FJB A;  1GER A;  4JNA A;  4YT0 A;  4OPI A;  3UKL A;  1D7Y A;  2HQM A;  3DA1 A;  4PAA A;  1CF3 A;  3LB8 A;  3LJP A;  2Q0L A;  4NTD A;  4YKF A;  3RP6 A;  4E0V A;  3VR9 A;  2B7R A;  2X8C A;  4CCQ A;  1DJQ A;  5GSN A;  3RP7 A;  3SZC A;  5TR3 A;  2R4J A;  1JNZ A;  2BS4 A;  2OAM A;  3O0H A;  4A6N B;  2XLS A;  2YG3 A;  2WS3 A;  2ZBW A;  3H8I A;  2IVE A;  3AE2 A;  4RSL A;  3UOZ A;  1D4C A;  1HYU A;  4J2W A;  5CKU A;  3G5S A;  2C7G A;  1ONF A;  2GR0 A;  2X8H A;  1TDN A;  1Y56 A;  4U8M A;  2C70 A;  1GSN A;  2GAG B;  4EMI A;  2A87 A;  2R45 A;  4TLZ A;  1Y0P A;  4YTN A;  3KLJ A;  5KOW A;  3T2Y A;  2YAU A;  1VG0 A;  5GRT A;  3CGC A;  3FBS A;  1F8W A;  1H7W A;  2UZZ A;  1KSU A;  3UKH A;  2PYX A;  3VRB A;  3HZL A;  3BNU A;  1IUT A;  1L9D A;  2BCP A;  1EL8 A;  5L46 A;  3SZF A;  5KMS A;  1PS9 A;  1ZY8 A;  1IUX A;  3II4 A;  2WDV A;  3UTG A;  2BXR A;  4ICY A;  1XDI A;  4OPU A;  4B63 A;  5FS8 A;  3DH9 A;  1LVL A;  4FDC B;  5EOW A;  2VVL A;  1UKV G;  5KXJ A;  4H4U A;  1E1M A;  3QJ4 A;  2VQ7 A;  2VVL G;  3OC4 A;  1NEK A;  2WP9 A;  4TM3 A;  1D7L A;  4ZCD A;  1M64 A;  4U8K A;  4A7A A;  1P2E A;  2XFP A;  4D04 A;  3AE8 A;  1COY A;  1FEA A;  1QJD A;  3CNS A;  4CY6 A;  4M52 A;  2CDU A;  3IHG A;  1B4V A;  2X99 A;  3QSS A;  3IHM A;  4B1B A;  1Q9I A;  2RGO A;  3QSE A;  4H4P A;  4EMW A;  2E1M A;  4H2P A;  4OPL A;  1BF3 A;  1IUU A;  3ITJ A;  3UKF A;  1GTE A;  3NRN A;  5KVH A;  1ZOV A;  2JB3 A;  5HY5 A;  2V5Z A;  2JK6 A;  1OJC A;  2GQF A;  3CNT A;  1DOD A;  2V3A A;  3HYW A;  3IC9 A;  4CNJ A;  4D03 A;  4NWZ A;  2QA1 A;  3C4N A;  1EL9 A;  2YWL A;  4JN9 A;  4J34 A;  2R0P A;  4JQ9 A;  3Q6J A;  2E5V A;  1K0J A;  3P4S A;  2Y6Q A;  1GT8 A;  3LZX A;  4LII A;  5FS7 A;  2BXS A;  4IVO B;  4DSH A;  3VRD B;  5C2T A;  1GND A;  1OJA A;  1E1N A;  1KFY A;  1REO A;  3GSI A;  3K7Q X;  4K7Z A;  3DME A;  4U2S A;  4CY8 A;  2OLN A;  2CVJ A;  5HHF A;  1L9E A;  1TDK A;  1JU2 A;  4H4V A;  2YG6 A;  4UDR A;  1V59 A;  2W0H A;  1GRB A;  3NN6 X;  2YVF A;  5IQ1 A;  2R0C A;  4G74 A;  3UP4 A;  1LQU A;  4K5R A;  4C77 A;  1LTX R;  3HYV A;  3C96 A;  4DNA A;  1VRQ B;  3NTA A;  1K4Q A;  1XPQ A;  3DJD A;  3UTF A;  4A9W A;  5JCK A;  2IID A;  2XVH A;  4TM1 A;  4YSH A;  3ISH A;  5BUL A;  3RHA A;  4I59 A;  1GRA A;  1VQW A;  1YKJ A;  4U8L A;  3ALJ A;  4AT2 A;  4G6G A;  3UKQ A;  4KPR A;  2RGH A;  1ZDL A;  4CBQ A;  3P4R A;  4O5Q A;  1GRE A;  2BC0 A;  2WU2 A;  2OLO A;  3NYF A;  3S5W A;  1PBE A;  3UKK A;  3P4P A;  1D4E A;  4ADW A;  2GV8 A;  2OAL A;  3AE7 A;  3BNM A;  4BK3 A;  4EIP A;  1GXF A;  1DNC A;  2EQ7 A;  1QLB A;  3EAO A;  5FMH A;  4U8P A;  1B8S A;  3C4A A;  3NTD A;  2XLT A;  2YM2 A;  2WOI A;  3HYX A;  2WEU A;  2YLX A;  1JEH A;  4TLX A;  1DOE A;  1GET A;  2F5Z A;  2WES A;  3AEA A;  4K22 A;  4K8D A;  1FL2 A;  2APG A;  4YWO A;  1XAN A;  2ZZ0 A;  3BI4 A;  3SM8 A;  4EQR A;  1PXC A;  2TMD A;  2WPE A;  1LPF A;  1CC4 A;  2BA9 A;  2XDO A;  2GB0 A;  4IV9 A;  2BK5 A;  2XLU A;  2QAE A;  2XFO A;  2DKH A;  5FS6 A;  1RP0 A;  3GMB A;  2JAE A;  4USR A;  2IVD A;  2Q6U A;  2AR8 A;  3M12 A;  4C5O A;  3NIX A;  1E6E A;  2YLS A;  4EM3 A;  3SY4 A;  2YVJ A;  3ATR A;  3V76 A;  4MJW A;  2E4G A;  1E7P A;  5U25 A;  1PXB A;  4X9N A;  1ZKQ A;  3GYI A;  4JNQ A;  1NEN A;  1CJC A;  3AXB A;  3I6D A;  2VRL A;  4OPD A;  2YR6 A;  2ZZC A;  5EBK A;  2JKC A;  3UTH A;  3NT6 A;  5U1O A;  2Q0K A;  1VG9 A;  1FEB A;  4H50 A;  4ECH A;  2CFY A;  2C4C A;  5IPY A;  1RYI A;  1BGN A;  4EMJ A;  4USQ A;  3CNJ A;  3NK0 X;  4B64 A;  3K7M X;  4TM0 A;  2JB2 A;  2VRM A;  2JB1 A;  3H4K A;  4P9S A;  3LAD A;  1KNR A;  1FOH A;  3AEC A;  4H4Y A;  4H4X A;  3GD4 A;  2VOU A;  4NTC A;  2BRY A;  2C3D A;  3AE9 A;  1MXT A;  2CUL A;  1DXL A;  1Y56 B;  3CN8 A;  2C65 A;  3VR8 A;  1JRZ A;  2WDQ A;  3AYJ A;  4LA1 A;  4FK1 A;  3PS9 A;  4UDP A;  3QFA A;  4GUV A;  3UOV A;  4Y4N A;  4X4J A;  2V61 A;  3KU9 A;  3V3O A;  1YY5 A;  4I58 A;  2C64 A;  3T37 A;  4H7U A;  1TDO A;  1O95 A;  4NZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...