4GAPA

Structure of the ndi1 protein from saccharomyces cerevisiae in complex with nad+
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 143
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gapA00
3SX6A 3SYIA 4GAVA 5KMQA 3SZCA 4G74A 3T14A 3HYXA 3SZFA 5KMSA 4G73A 5KMPA 3HYWA 3T31A 3T2ZA 4G9KA 3T2YA 4GAPA 3HYVA 3T0KA 3T2KA 3SXIA 3SZ0A 5KMRA 4G6GA 4G6HA 3SZWA 3SY4A 3KPKA 4NWZA
chains in the Genus database with same CATH superfamily
1OJCA 1V59A 1PXBA 2R46A 2QA2A 2XDOA 3ICTA 3AEDA 4GAVA 3Q6JA 2YAUA 3ATRA 4J33A 4BJZA 4H4ZA 1CL0A 3CN8A 4I59A 4H4PA 3DJGX 4IA5A 3G5QA 4NTCA 3UKLA 2CFYA 2Q6UA 4EIQA 1ZKQA 3EPTA 1PS9A 2TPRA 3NLCA 4DGKA 1TDOA 1MOKA 1BKWA 3CGBA 4GUVA 4TM0A 3G5SA 2BK4A 1GRTA 1FOHA 2GR1A 3P1WA 4AT2A 1B37A 3LADA 1AOGA 3II4A 2WDVA 4JDRA 3UTFA 5BUKA 4G6HA 2X99A 2XCGA 2Y6QA 1JOAA 3G5RA 4O5QA 3IC9A 2X8HA 3NK2X 1L0VA 2R4EA 3NRNA 4Z2RA 1B4VA 2XLPA 2GH5A 2C4CA 1E1LA 1RYIA 1XDIA 3AXBA 2BC1A 3CNJA 3BI2A 4Z2TA 5C2TA 1YQ3A 5HHFA 2B76A 2X3NA 3AE2A 3LZXA 4ICYA 4U2LA 5BRTA 1LPFA 1GETA 3ICRA 4B68A 3VRAA 5CQFA 2GF3A 3GDPA 1Q1RA 1X31B 4YSYA 2WPFA 1IUTA 3GDNA 3AE3A 2BS4A 2XLTA 2BRYA 4Z25A 2BC0A 2WESA 4J2WA 3AE5A 1F8RA 3JSKA 2WPCA 4K22A 4U2SA 5KWFA 3LOVA 4K5RA 3URHA 4KX6A 3SX6A 4Z43A 5TR3A 1D5TA 1LV0A 3D1CA 4ZCDA 2WP6A 3QFAA 4CBQA 3ITJA 3AECA 1BGJA 1ELIA 4JY3A 4RSLA 2V60A 4EQXA 3GYXA 2WS3A 5KNLA 2VQ7A 2X50A 4X9NA 4YSHA 4B63A 3CTYA 1NG3A 1D7YA 3HYVA 3CPIG 3CGCA 3B3RA 5KVIA 4JNQA 2PHHA 1DJQA 2WPEA 1E1MA 2WOIA 4P9SA 1S3EA 3GRSA 2C67A 2GV8A 3E1TA 4XXGA 5L46A 5KMRA 1NHPA 2AQJA 2O9ZA 2VVMA 2YG7A 3AB1A 3K7QX 2XFNA 5JCIA 3DK9A 1NHRA 2IIDA 4M52A 4NEWA 2WQYA 3DGHA 2XYOA 3VR9A 1QJDA 4H2RA 3NN6X 3UKHA 2YG4A 2YM2A 1GTHA 4OCGA 4A5LA 1GREA 2BK3A 2PYXA 1S2QA 3O0HA 3NH3X 4EMIA 1H7XA 1NENA 2EQ7A 3FIMB 5EB4A 1O5WA 1OJTA 2Q7VA 4EM3A 1Y56B 2WDRA 3HZLA 3SXIA 1GTEA 1N1PA 5FMHA 4PABA 4RG4A 4TM1A 3GWFA 1CF3A 4NWZA 4A99A 3NN0X 4AOXA 4DSHA 4YSXA 1PBCA 3UKAA 1GT8A 4K8DA 2R0GA 3GD4A 3LB8A 5KXJA 3ALMA 1BGNA 1JRYA 3CNPA 4ADWA 3S5WA 1EL8A 1GALA 3CNDA 5CKUA 3GMBA 3QVPA 1H86A 1VRQB 4OPCA 4DNAA 3QVRA 5HXIA 4UDQA 1COYA 4NNJA 2ZZ0A 2GB0A 2W0HA 3UKQA 4GRTA 2GR3A 4JNAA 2FBWA 1VG9A 2CDUA 3BI5A 1PBEA 2F5ZA 1D4DA 4DSGA 2XVJA 5BVAA 2C70A 4H4RA 3UP4A 3V3OA 5HY5A 3GYJA 3L1RA 1XHCA 3DH9A 4OPLA 3AD8B 1NHSA 2XLSA 3C4NA 3K7TA 2CVJA 3P9UA 2B9WA 1PJ7A 2V61A 4IVMB 1EL9A 1MO9A 2YG3A 4USRA 1NAAA 3K7MX 4USQA 4C74A 3KVEA 4HA6A 3SZFA 5LV9A 5M10A 5GSNA 3NT6A 3Q9TA 3PVCA 4BK3A 3PO7A 3QSMA 2QCUA 4IVOB 1F3PA 3T37A 3SQPA 5U25A 3ADAB 2ZBWA 2VQBA 5FS8A 2XVEA 1H84A 4C5OA 1JNZA 3OC4A 1GSNA 4U2TA 4GDEA 2YLWA 1LQTA 2B7RA 2GQWA 1PJ6A 2JK6A 3GWDA 3OZ2A 3H8IA 3AYIA 4H4SA 4K5SA 4A9WA 4A79A 4H4YA 3FG2P 4JY2A 3IHGA 4NTEA 4YTMA 1GRBA 4CY8A 2XLUA 3SFDA 2Y6RA 4AT0A 2C66A 4B66A 1NDAA 1PBDA 2YVFA 4H4VA 4ZN0A 4OPDA 1KDGA 4G73A 3COXA 3LJPA 4H4TA 4NZHA 3VR8A 1L9CA 2EQ8A 3F8PA 5KMPA 1UKVG 2RGJA 3NTDA 1TDKA 3T2ZA 3GD3A 2IVEA 3QSSA 2A89A 3EAOA 1K0JA 4X9MA 1REOA 1ZP0A 1QLBA 3DJEA 4IV9A 2WU5A 4KPRA 3UKPA 2OLNA 3R9UA 1O95A 3KA7A 3UKKA 2YLSA 2BK5A 1ZMDA 4Z26A 2XVFA 2GMJA 1IJHA 1IUWA 3DA1A 4HB9A 4OVIA 4FX9A 2RGOA 2YQUA 2BXSA 3BI4A 3FPZA 3IF9A 2WBAA 3NNEA 1LTXR 1ZDLA 2V6OA 4E0VA 2XVIA 4CNJA 4U8MA 1EL5A 4H2NA 4B64A 4H7UA 3DJJA 4LIIA 2A87A 1CJ3A 2FJEA 3QJ4A 1YQZA 1NPXA 3RNMA 3ATQA 1JRXA 2Q0LA 4II2A 2BACA 3SM8A 2XVHA 3M13A 4H4QA 4II3A 4EQWA 2VZ2A 1GEUA 4EQSA 3S61A 1GESA 3REDA 1TDNA 2H89A 1DXLA 2BCGG 2JB2A 3AYJA 2XLRA 2J3NA 1CJCA 2YLZA 2GRTA 2BXRA 3AE1A 3V3NA 4A6NA 1O94A 3P4PA 1N4VA 1E1NA 3RP6A 3SY4A 3UTHA 3NYFA 1BZLA 3QSEA 4BURA 2C72A 4Y4NA 3SYIA 2VVLG 3KD9A 3NTAA 1JRZA 2C65A 1D7LA 3WE0A 2R0CA 5JCNA 2FJDA 2OLOA 1GRAA 1M64A 3ICSA 4H2QA 3SFEA 1N4UA 3NYEA 1YQ4A 3FBSA 3GRTA 3T31A 3M12A 2JKCA 4B69A 1K0LA 1FL2A 2B7SA 3D8XA 1KFYA 1CJ4A 3CPJG 1SEZA 4N9XA 1BWCA 4FK1C 5IQ1A 4B1BA 5JCMA 1Q9IA 4XWZA 4TLXA 3GMCA 4GR1A 1RP0A 2XFPA 1H6VA 1CJ2A 5FS9A 4UP3A 3KU9A 4EMWA 2GQFA 4RG3A 1TYTA 2YLXA 1GNDA 2YR5A 2NPXA 2A8XA 4MJWA 4AP3A 4CCRA 3VRBA 1PBFA 4G74A 3T14A 4YSZA 4I58A 5BULA 2JB3A 3VQRA 5EOWA 4YKFA 5JCLA 2OALA 3CGEA 4J56A 2WOVA 2R45A 3EF6A 4REKA 2OA1A 2H88A 4UDPA 1H81A 1FEAA 1L9EA 4Y4MA 1CC6A 1P2EA 4FDCB 2B9XA 2WOWA 3UTEA 1D4EA 4C77A 3NK1X 3V76A 2C75A 1TRBA 2TMDA 4K2XA 3T2KA 5KRQA 3I3LA 5IQ4A 3M0OA 3SZ0A 3AD7B 4J31A 1BF3A 4X4JA 5KOWA 1ONFA 1N4WA 1E6EA 3AD9B 3IWAA 3RP7A 1ZOVA 3SZCA 3DMEA 2E5VA 3DK8A 1HYUA 1E7PA 3AE8A 3HYXA 3UTGA 3UP5A 4H50A 5J7XA 4EIPA 3AWIA 2FJAA 4GF7A 2JBVA 4LA1A 1DOBA 2C76A 5EB5A 5EBKA 4GAPA 3B6DA 1GRGA 1H83A 5IPYA 1TYPA 2YLTA 2YR4A 1XANA 2JB1A 2WEUA 4K7ZA 3RP8A 1DODA 1DJNA 4U8OA 4OPGA 3ABVA 3NKSA 1RSGA 1H82A 1F8WA 2BCPA 4LU6A 2IVDA 3AEGA 1PXCA 2YM1A 1LVLA 3FMWA 2GVCA 1LQUA 4AOSA 3VRDB 3UKFA 1Y0PA 3F8DA 4TM4A 3UOYA 2Z5YA 4H4UA 2YG6A 1YY5A 1MXTA 2X8CA 3H4KA 4IA6A 1KNPA 2VOUA 4U8IA 5GRTA 3KKJA 4JQ9A 1PDHA 2VRMA 1PN0A 2FJBA 2OAMA 4J36A 4YTPA 2V3AA 2CULA 3ALLA 1ZY8A 2DKHA 3C96A 3PS9A 2R0PA 4H4WA 3CGDA 1FECA 4OPTA 4B67A 4C3XA 1DOEA 4O5UA 1M6IA 3LXDA 4JN9A 3NYCA 4BJYA 1F8SA 4FK1A 3K30A 4AP1A 1GV4A 2QA1A 5JCKA 2X8GA 2C64A 4YT0A 4PAAA 3AE7A 2WP9A 4EMJA 3AEAA 4A65A 1IUVA 4GCMA 3BHFA 5J60A 2UZZA 2GEWA 5KMQA 1VQWA 1KSUA 3AEBA 1KSSA 1XPQA 1QO8A 3DK4A 1PXAA 3P4RA 4TLZA 4A7AA 3DJDA 2GR0A 1CC4A 1FCDA 4U8PA 1NG4A 2R4JA 2YLRA 3AE4A 4G9KA 2V5ZA 3KPFA 1JNRA 5ER0A 3ALJA 4ECHA 3CMMA 2C73A 4D04A 1KNRA 2EQ9A 2NVKX 5U1OA 1FEBA 3H8LA 4BK1A 2I0ZA 1D4CA 3RHAA 1P2HA 2DKIA 4CNKA 2WP5A 4OPIA 4U8KA 5FS7A 3UOZA 1OJAA 4EM4A 1DOCA 1Y56A 4YWOA 1H7WA 1Z6LA 2ZZBA 4Z24A 2R9ZA 4U8LA 1ZX9A 3SGLA 1JU2A 2RABA 4TM3A 5KMSA 1TDFA 3GYIA 2V3BA 3NG7X 1GRFA 2B9YA 1S3BA 2XFQA 4U8NA 4BV6A 3HYWA 5HYMA 4U8JA 5DBJA 1EBDA 1Q1WA 2YG5A 5U63A 2BABA 3T2YA 2VVLA 4Z2UA 1PBBA 4CRTA 3NGCX 2E4GA 1DNCA 1L9DA 3GSIA 3BNUA 3ISHA 3L8KA 2BYBA 2JAEA 3ZDNA 4UDRA 2APGA 1PJ5A 3DGZA 1IUXA 1W4XA 1K4QA 1TDEA 2GR2A 3EANA 4YTNA 3AEFA 3SZWA 1OJ9A 1GPEA 2YVGA 4YKGA 5KVHA 2C3CA 4NTDA 2ARDA 5KOXA 2ACZA 2BS3A 2XFUA 3QFBA 1E39A 1OJDA 4WX1A 2YR6A 2WDQA 4D03A 1ZMCA 2GAGB 4OPUA 3CNSA 4ZCCA 4C3YA 2C7GA 3C4AA 1NEKA 2WHDA 1VG0A 2YVJA 1CHUA 1LJ1A 4A6NB 1GERA 2EQ6A 3CPHG 3P4QA 3UOVA 3AYLA 1ZK7A 4EQRA 4GDPA 2YWLA 2BS2A 3ZYXA 1E1KA 3NK0X 4Y4LA 3KLJA 4APNA 1S2YA 3IHMA 2QAEA 4G6GA 2ZZCA 2Q0KA 5FS6A 3NIXA 1CC2A 1GXFA 4CCQA 2WU2A 1NHQA 2Z5XA 2AR8A 3BHKA 3LZWA 1B5QA 4Z44A 2BRAA 1CBOA 1VDCA 3AE6A 2C3DA 1K0IA 2GAHB 4B65A 4J57A 2XFOA 2HQMA 2BA9A 2RGHA 3UCLA 3CNTA 1F6MA 4H4XA 1PHHA 4J34A 5M0ZA 1IUSA 4YXDA 1JEHA 2GMHA 3NHOX 1GOSA 3AE9A 4XWRA 3CIRA 3T0KA 1ZOYA 3BNMA 1IUUA 2AAQA 1GRHA 1B8SA 1KF6A 2VRLA 4NEVA 4CY6A 5C3JA 2WETA 3P4SA 3I6DA 4H2PA 3AEEA 3F8RA 4BK2A 1EL7A 2E1MA 4WCTA 3UOXA 1YKJA 3KPKA
chains in the Genus database with same CATH topology
1OJCA 1V59A 1PXBA 2R46A 2QA2A 2XDOA 3ICTA 3AEDA 4GAVA 3Q6JA 2YAUA 3ATRA 4J33A 4BJZA 4H4ZA 1CL0A 3CN8A 4I59A 4H4PA 3DJGX 4IA5A 3G5QA 4NTCA 3UKLA 2CFYA 2Q6UA 4EIQA 1ZKQA 3EPTA 1PS9A 2TPRA 3NLCA 4DGKA 1TDOA 1MOKA 1BKWA 3CGBA 4GUVA 4TM0A 3G5SA 2BK4A 1GRTA 1FOHA 2GR1A 3P1WA 4AT2A 1B37A 3LADA 1AOGA 3II4A 2WDVA 4JDRA 3UTFA 5BUKA 4G6HA 2X99A 2XCGA 2Y6QA 1JOAA 3G5RA 4O5QA 3IC9A 2X8HA 3NK2X 1L0VA 2R4EA 3NRNA 4Z2RA 1B4VA 2XLPA 2GH5A 2C4CA 1E1LA 1RYIA 1XDIA 3AXBA 2BC1A 3CNJA 3BI2A 4Z2TA 5C2TA 1YQ3A 5HHFA 2B76A 2X3NA 3AE2A 3LZXA 4ICYA 4U2LA 5BRTA 1LPFA 1GETA 3ICRA 4B68A 3VRAA 5CQFA 2GF3A 3GDPA 1Q1RA 1X31B 4YSYA 2WPFA 1IUTA 3GDNA 3AE3A 2BS4A 2XLTA 2BRYA 4Z25A 2BC0A 2WESA 4J2WA 3AE5A 1F8RA 3JSKA 2WPCA 4K22A 4U2SA 5KWFA 3LOVA 4K5RA 3URHA 4KX6A 3SX6A 4Z43A 5TR3A 1D5TA 1LV0A 3D1CA 4ZCDA 2WP6A 3QFAA 4CBQA 3ITJA 3AECA 1BGJA 1ELIA 4JY3A 4RSLA 2V60A 4EQXA 3GYXA 2WS3A 5KNLA 2VQ7A 2X50A 4X9NA 4YSHA 4B63A 3CTYA 1NG3A 1D7YA 3HYVA 3CPIG 3CGCA 3B3RA 5KVIA 4JNQA 2PHHA 1DJQA 2WPEA 1E1MA 2WOIA 4P9SA 1S3EA 3GRSA 2C67A 2GV8A 3E1TA 4XXGA 5L46A 5KMRA 1NHPA 2AQJA 2O9ZA 2VVMA 2YG7A 3AB1A 3K7QX 2XFNA 5JCIA 3DK9A 1NHRA 2IIDA 4M52A 4NEWA 2WQYA 3DGHA 2XYOA 3VR9A 1QJDA 4H2RA 3NN6X 3UKHA 2YG4A 2YM2A 1GTHA 4OCGA 4A5LA 1GREA 2BK3A 2PYXA 1S2QA 3O0HA 3NH3X 4EMIA 1H7XA 1NENA 2EQ7A 3FIMB 5EB4A 1O5WA 1OJTA 2Q7VA 4EM3A 1Y56B 2WDRA 3HZLA 3SXIA 1GTEA 1N1PA 5FMHA 4PABA 4RG4A 4TM1A 3GWFA 1CF3A 4NWZA 4A99A 3NN0X 4AOXA 4DSHA 4YSXA 1PBCA 3UKAA 1GT8A 4K8DA 2R0GA 3GD4A 3LB8A 5KXJA 3ALMA 1BGNA 1JRYA 3CNPA 4ADWA 3S5WA 1EL8A 1GALA 3CNDA 5CKUA 3GMBA 3QVPA 1H86A 1VRQB 4OPCA 4DNAA 3QVRA 5HXIA 4UDQA 1COYA 4NNJA 2ZZ0A 2GB0A 2W0HA 3UKQA 4GRTA 2GR3A 4JNAA 2FBWA 1VG9A 2CDUA 3BI5A 1PBEA 2F5ZA 1D4DA 4DSGA 2XVJA 5BVAA 2C70A 4H4RA 3UP4A 3V3OA 5HY5A 3GYJA 3L1RA 1XHCA 3DH9A 4OPLA 3AD8B 1NHSA 2XLSA 3C4NA 3K7TA 2CVJA 3P9UA 2B9WA 1PJ7A 2V61A 4IVMB 1EL9A 1MO9A 2YG3A 4USRA 1NAAA 3K7MX 4USQA 4C74A 3KVEA 4HA6A 3SZFA 5LV9A 5M10A 5GSNA 3NT6A 3Q9TA 3PVCA 4BK3A 3PO7A 3QSMA 2QCUA 4IVOB 1F3PA 3T37A 3SQPA 5U25A 3ADAB 2ZBWA 2VQBA 5FS8A 2XVEA 1H84A 4C5OA 1JNZA 3OC4A 1GSNA 4U2TA 4GDEA 2YLWA 1LQTA 2B7RA 2GQWA 1PJ6A 2JK6A 3GWDA 3OZ2A 3H8IA 3AYIA 4H4SA 4K5SA 4A9WA 4A79A 4H4YA 3FG2P 4JY2A 3IHGA 4NTEA 4YTMA 1GRBA 4CY8A 2XLUA 3SFDA 2Y6RA 4AT0A 2C66A 4B66A 1NDAA 1PBDA 2YVFA 4H4VA 4ZN0A 4OPDA 1KDGA 4G73A 3COXA 3LJPA 4H4TA 4NZHA 3VR8A 1L9CA 2EQ8A 3F8PA 5KMPA 1UKVG 2RGJA 3NTDA 1TDKA 3T2ZA 3GD3A 2IVEA 3QSSA 2A89A 3EAOA 1K0JA 4X9MA 1REOA 1ZP0A 1QLBA 3DJEA 4IV9A 2WU5A 4KPRA 3UKPA 2OLNA 3R9UA 1O95A 3KA7A 3UKKA 2YLSA 2BK5A 1ZMDA 4Z26A 2XVFA 2GMJA 1IJHA 1IUWA 3DA1A 4HB9A 4OVIA 4FX9A 2RGOA 2YQUA 2BXSA 3BI4A 3FPZA 3IF9A 2WBAA 3NNEA 1LTXR 1ZDLA 2V6OA 4E0VA 2XVIA 4CNJA 4U8MA 1EL5A 4H2NA 4B64A 4H7UA 3DJJA 4LIIA 2A87A 1CJ3A 2FJEA 3QJ4A 1YQZA 1NPXA 3RNMA 3ATQA 1JRXA 2Q0LA 4II2A 2BACA 3SM8A 2XVHA 3M13A 4H4QA 4II3A 4EQWA 2VZ2A 1GEUA 4EQSA 3S61A 1GESA 3REDA 1TDNA 2H89A 1DXLA 2BCGG 2JB2A 3AYJA 2XLRA 2J3NA 1CJCA 2YLZA 2GRTA 2BXRA 3AE1A 3V3NA 4A6NA 1O94A 3P4PA 1N4VA 1E1NA 3RP6A 3SY4A 3UTHA 3NYFA 1BZLA 3QSEA 4BURA 2C72A 4Y4NA 3SYIA 2VVLG 3KD9A 3NTAA 1JRZA 2C65A 1D7LA 3WE0A 2R0CA 5JCNA 2FJDA 2OLOA 1GRAA 1M64A 3ICSA 4H2QA 3SFEA 1N4UA 3NYEA 1YQ4A 3FBSA 3GRTA 3T31A 3M12A 2JKCA 4B69A 1K0LA 1FL2A 2B7SA 3D8XA 1KFYA 1CJ4A 3CPJG 1SEZA 4N9XA 1BWCA 4FK1C 5IQ1A 4B1BA 5JCMA 1Q9IA 4XWZA 4TLXA 3GMCA 4GR1A 1RP0A 2XFPA 1H6VA 1CJ2A 5FS9A 4UP3A 3KU9A 4EMWA 2GQFA 4RG3A 1TYTA 2YLXA 1GNDA 2YR5A 2NPXA 2A8XA 4MJWA 4AP3A 4CCRA 3VRBA 1PBFA 4G74A 3T14A 4YSZA 4I58A 5BULA 2JB3A 3VQRA 5EOWA 4YKFA 5JCLA 2OALA 3CGEA 4J56A 2WOVA 2R45A 3EF6A 4REKA 2OA1A 2H88A 4UDPA 1H81A 1FEAA 1L9EA 4Y4MA 1CC6A 1P2EA 4FDCB 2B9XA 2WOWA 3UTEA 1D4EA 4C77A 3NK1X 3V76A 2C75A 1TRBA 2TMDA 4K2XA 3T2KA 5KRQA 3I3LA 5IQ4A 3M0OA 3SZ0A 3AD7B 4J31A 1BF3A 4X4JA 5KOWA 1ONFA 1N4WA 1E6EA 3AD9B 3IWAA 3RP7A 1ZOVA 3SZCA 3DMEA 2E5VA 3DK8A 1HYUA 1E7PA 3AE8A 3HYXA 3UTGA 3UP5A 4H50A 5J7XA 4EIPA 3AWIA 2FJAA 4GF7A 2JBVA 4LA1A 1DOBA 2C76A 5EB5A 5EBKA 4GAPA 3B6DA 1GRGA 1H83A 5IPYA 1TYPA 2YLTA 2YR4A 1XANA 2JB1A 2WEUA 4K7ZA 3RP8A 1DODA 1DJNA 4U8OA 4OPGA 3ABVA 3NKSA 1RSGA 1H82A 1F8WA 2BCPA 4LU6A 2IVDA 3AEGA 1PXCA 2YM1A 1LVLA 3FMWA 2GVCA 1LQUA 4AOSA 3VRDB 3UKFA 1Y0PA 3F8DA 4TM4A 3UOYA 2Z5YA 4H4UA 2YG6A 1YY5A 1MXTA 2X8CA 3H4KA 4IA6A 1KNPA 2VOUA 4U8IA 5GRTA 3KKJA 4JQ9A 1PDHA 2VRMA 1PN0A 2FJBA 2OAMA 4J36A 4YTPA 2V3AA 2CULA 3ALLA 1ZY8A 2DKHA 3C96A 3PS9A 2R0PA 4H4WA 3CGDA 1FECA 4OPTA 4B67A 4C3XA 1DOEA 4O5UA 1M6IA 3LXDA 4JN9A 3NYCA 4BJYA 1F8SA 4FK1A 3K30A 4AP1A 1GV4A 2QA1A 5JCKA 2X8GA 2C64A 4YT0A 4PAAA 3AE7A 2WP9A 4EMJA 3AEAA 4A65A 1IUVA 4GCMA 3BHFA 5J60A 2UZZA 2GEWA 5KMQA 1VQWA 1KSUA 3AEBA 1KSSA 1XPQA 1QO8A 3DK4A 1PXAA 3P4RA 4TLZA 4A7AA 3DJDA 2GR0A 1CC4A 1FCDA 4U8PA 1NG4A 2R4JA 2YLRA 3AE4A 4G9KA 2V5ZA 3KPFA 1JNRA 5ER0A 3ALJA 4ECHA 3CMMA 2C73A 4D04A 1KNRA 2EQ9A 2NVKX 5U1OA 1FEBA 3H8LA 4BK1A 2I0ZA 1D4CA 3RHAA 1P2HA 2DKIA 4CNKA 2WP5A 4OPIA 4U8KA 5FS7A 3UOZA 1OJAA 4EM4A 1DOCA 1Y56A 4YWOA 1H7WA 1Z6LA 2ZZBA 4Z24A 2R9ZA 4U8LA 1ZX9A 3SGLA 1JU2A 2RABA 4TM3A 5KMSA 1TDFA 3GYIA 2V3BA 3NG7X 1GRFA 2B9YA 1S3BA 2XFQA 4U8NA 4BV6A 3HYWA 5HYMA 4U8JA 5DBJA 1EBDA 1Q1WA 2YG5A 5U63A 2BABA 3T2YA 2VVLA 4Z2UA 1PBBA 4CRTA 3NGCX 2E4GA 1DNCA 1L9DA 3GSIA 3BNUA 3ISHA 3L8KA 2BYBA 2JAEA 3ZDNA 4UDRA 2APGA 1PJ5A 3DGZA 1IUXA 1W4XA 1K4QA 1TDEA 2GR2A 3EANA 4YTNA 3AEFA 3SZWA 1OJ9A 1GPEA 2YVGA 4YKGA 5KVHA 2C3CA 4NTDA 2ARDA 5KOXA 2ACZA 2BS3A 2XFUA 3QFBA 1E39A 1OJDA 4WX1A 2YR6A 2WDQA 4D03A 1ZMCA 2GAGB 4OPUA 3CNSA 4ZCCA 4C3YA 2C7GA 3C4AA 1NEKA 2WHDA 1VG0A 2YVJA 1CHUA 1LJ1A 4A6NB 1GERA 2EQ6A 3CPHG 3P4QA 3UOVA 3AYLA 1ZK7A 4EQRA 4GDPA 2YWLA 2BS2A 3ZYXA 1E1KA 3NK0X 4Y4LA 3KLJA 4APNA 1S2YA 3IHMA 2QAEA 4G6GA 2ZZCA 2Q0KA 5FS6A 3NIXA 1CC2A 1GXFA 4CCQA 2WU2A 1NHQA 2Z5XA 2AR8A 3BHKA 3LZWA 1B5QA 4Z44A 2BRAA 1CBOA 1VDCA 3AE6A 2C3DA 1K0IA 2GAHB 4B65A 4J57A 2XFOA 2HQMA 2BA9A 2RGHA 3UCLA 3CNTA 1F6MA 4H4XA 1PHHA 4J34A 5M0ZA 1IUSA 4YXDA 1JEHA 2GMHA 3NHOX 1GOSA 3AE9A 4XWRA 3CIRA 3T0KA 1ZOYA 3BNMA 1IUUA 2AAQA 1GRHA 1B8SA 1KF6A 2VRLA 4NEVA 4CY6A 5C3JA 2WETA 3P4SA 3I6DA 4H2PA 3AEEA 3F8RA 4BK2A 1EL7A 2E1MA 4WCTA 3UOXA 1YKJA 3KPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SX6 A;  3SYI A;  4GAV A;  5KMQ A;  3SZC A;  4G74 A;  3T14 A;  3HYX A;  3SZF A;  5KMS A;  4G73 A;  5KMP A;  3HYW A;  3T31 A;  3T2Z A;  4G9K A;  3T2Y A;  4GAP A;  3HYV A;  3T0K A;  3T2K A;  3SXI A;  3SZ0 A;  5KMR A;  4G6G A;  4G6H A;  3SZW A;  3SY4 A;  3KPK A;  4NWZ A; 
#chains in the Genus database with same CATH topology
 1OJC A;  1V59 A;  1PXB A;  2R46 A;  2QA2 A;  2XDO A;  3ICT A;  3AED A;  4GAV A;  3Q6J A;  2YAU A;  3ATR A;  4J33 A;  4BJZ A;  4H4Z A;  1CL0 A;  3CN8 A;  4I59 A;  4H4P A;  3DJG X;  4IA5 A;  3G5Q A;  4NTC A;  3UKL A;  2CFY A;  2Q6U A;  4EIQ A;  1ZKQ A;  3EPT A;  1PS9 A;  2TPR A;  3NLC A;  4DGK A;  1TDO A;  1MOK A;  1BKW A;  3CGB A;  4GUV A;  4TM0 A;  3G5S A;  2BK4 A;  1GRT A;  1FOH A;  2GR1 A;  3P1W A;  4AT2 A;  1B37 A;  3LAD A;  1AOG A;  3II4 A;  2WDV A;  4JDR A;  3UTF A;  5BUK A;  4G6H A;  2X99 A;  2XCG A;  2Y6Q A;  1JOA A;  3G5R A;  4O5Q A;  3IC9 A;  2X8H A;  3NK2 X;  1L0V A;  2R4E A;  3NRN A;  4Z2R A;  1B4V A;  2XLP A;  2GH5 A;  2C4C A;  1E1L A;  1RYI A;  1XDI A;  3AXB A;  2BC1 A;  3CNJ A;  3BI2 A;  4Z2T A;  5C2T A;  1YQ3 A;  5HHF A;  2B76 A;  2X3N A;  3AE2 A;  3LZX A;  4ICY A;  4U2L A;  5BRT A;  1LPF A;  1GET A;  3ICR A;  4B68 A;  3VRA A;  5CQF A;  2GF3 A;  3GDP A;  1Q1R A;  1X31 B;  4YSY A;  2WPF A;  1IUT A;  3GDN A;  3AE3 A;  2BS4 A;  2XLT A;  2BRY A;  4Z25 A;  2BC0 A;  2WES A;  4J2W A;  3AE5 A;  1F8R A;  3JSK A;  2WPC A;  4K22 A;  4U2S A;  5KWF A;  3LOV A;  4K5R A;  3URH A;  4KX6 A;  3SX6 A;  4Z43 A;  5TR3 A;  1D5T A;  1LV0 A;  3D1C A;  4ZCD A;  2WP6 A;  3QFA A;  4CBQ A;  3ITJ A;  3AEC A;  1BGJ A;  1ELI A;  4JY3 A;  4RSL A;  2V60 A;  4EQX A;  3GYX A;  2WS3 A;  5KNL A;  2VQ7 A;  2X50 A;  4X9N A;  4YSH A;  4B63 A;  3CTY A;  1NG3 A;  1D7Y A;  3HYV A;  3CPI G;  3CGC A;  3B3R A;  5KVI A;  4JNQ A;  2PHH A;  1DJQ A;  2WPE A;  1E1M A;  2WOI A;  4P9S A;  1S3E A;  3GRS A;  2C67 A;  2GV8 A;  3E1T A;  4XXG A;  5L46 A;  5KMR A;  1NHP A;  2AQJ A;  2O9Z A;  2VVM A;  2YG7 A;  3AB1 A;  3K7Q X;  2XFN A;  5JCI A;  3DK9 A;  1NHR A;  2IID A;  4M52 A;  4NEW A;  2WQY A;  3DGH A;  2XYO A;  3VR9 A;  1QJD A;  4H2R A;  3NN6 X;  3UKH A;  2YG4 A;  2YM2 A;  1GTH A;  4OCG A;  4A5L A;  1GRE A;  2BK3 A;  2PYX A;  1S2Q A;  3O0H A;  3NH3 X;  4EMI A;  1H7X A;  1NEN A;  2EQ7 A;  3FIM B;  5EB4 A;  1O5W A;  1OJT A;  2Q7V A;  4EM3 A;  1Y56 B;  2WDR A;  3HZL A;  3SXI A;  1GTE A;  1N1P A;  5FMH A;  4PAB A;  4RG4 A;  4TM1 A;  3GWF A;  1CF3 A;  4NWZ A;  4A99 A;  3NN0 X;  4AOX A;  4DSH A;  4YSX A;  1PBC A;  3UKA A;  1GT8 A;  4K8D A;  2R0G A;  3GD4 A;  3LB8 A;  5KXJ A;  3ALM A;  1BGN A;  1JRY A;  3CNP A;  4ADW A;  3S5W A;  1EL8 A;  1GAL A;  3CND A;  5CKU A;  3GMB A;  3QVP A;  1H86 A;  1VRQ B;  4OPC A;  4DNA A;  3QVR A;  5HXI A;  4UDQ A;  1COY A;  4NNJ A;  2ZZ0 A;  2GB0 A;  2W0H A;  3UKQ A;  4GRT A;  2GR3 A;  4JNA A;  2FBW A;  1VG9 A;  2CDU A;  3BI5 A;  1PBE A;  2F5Z A;  1D4D A;  4DSG A;  2XVJ A;  5BVA A;  2C70 A;  4H4R A;  3UP4 A;  3V3O A;  5HY5 A;  3GYJ A;  3L1R A;  1XHC A;  3DH9 A;  4OPL A;  3AD8 B;  1NHS A;  2XLS A;  3C4N A;  3K7T A;  2CVJ A;  3P9U A;  2B9W A;  1PJ7 A;  2V61 A;  4IVM B;  1EL9 A;  1MO9 A;  2YG3 A;  4USR A;  1NAA A;  3K7M X;  4USQ A;  4C74 A;  3KVE A;  4HA6 A;  3SZF A;  5LV9 A;  5M10 A;  5GSN A;  3NT6 A;  3Q9T A;  3PVC A;  4BK3 A;  3PO7 A;  3QSM A;  2QCU A;  4IVO B;  1F3P A;  3T37 A;  3SQP A;  5U25 A;  3ADA B;  2ZBW A;  2VQB A;  5FS8 A;  2XVE A;  1H84 A;  4C5O A;  1JNZ A;  3OC4 A;  1GSN A;  4U2T A;  4GDE A;  2YLW A;  1LQT A;  2B7R A;  2GQW A;  1PJ6 A;  2JK6 A;  3GWD A;  3OZ2 A;  3H8I A;  3AYI A;  4H4S A;  4K5S A;  4A9W A;  4A79 A;  4H4Y A;  3FG2 P;  4JY2 A;  3IHG A;  4NTE A;  4YTM A;  1GRB A;  4CY8 A;  2XLU A;  3SFD A;  2Y6R A;  4AT0 A;  2C66 A;  4B66 A;  1NDA A;  1PBD A;  2YVF A;  4H4V A;  4ZN0 A;  4OPD A;  1KDG A;  4G73 A;  3COX A;  3LJP A;  4H4T A;  4NZH A;  3VR8 A;  1L9C A;  2EQ8 A;  3F8P A;  5KMP A;  1UKV G;  2RGJ A;  3NTD A;  1TDK A;  3T2Z A;  3GD3 A;  2IVE A;  3QSS A;  2A89 A;  3EAO A;  1K0J A;  4X9M A;  1REO A;  1ZP0 A;  1QLB A;  3DJE A;  4IV9 A;  2WU5 A;  4KPR A;  3UKP A;  2OLN A;  3R9U A;  1O95 A;  3KA7 A;  3UKK A;  2YLS A;  2BK5 A;  1ZMD A;  4Z26 A;  2XVF A;  2GMJ A;  1IJH A;  1IUW A;  3DA1 A;  4HB9 A;  4OVI A;  4FX9 A;  2RGO A;  2YQU A;  2BXS A;  3BI4 A;  3FPZ A;  3IF9 A;  2WBA A;  3NNE A;  1LTX R;  1ZDL A;  2V6O A;  4E0V A;  2XVI A;  4CNJ A;  4U8M A;  1EL5 A;  4H2N A;  4B64 A;  4H7U A;  3DJJ A;  4LII A;  2A87 A;  1CJ3 A;  2FJE A;  3QJ4 A;  1YQZ A;  1NPX A;  3RNM A;  3ATQ A;  1JRX A;  2Q0L A;  4II2 A;  2BAC A;  3SM8 A;  2XVH A;  3M13 A;  4H4Q A;  4II3 A;  4EQW A;  2VZ2 A;  1GEU A;  4EQS A;  3S61 A;  1GES A;  3RED A;  1TDN A;  2H89 A;  1DXL A;  2BCG G;  2JB2 A;  3AYJ A;  2XLR A;  2J3N A;  1CJC A;  2YLZ A;  2GRT A;  2BXR A;  3AE1 A;  3V3N A;  4A6N A;  1O94 A;  3P4P A;  1N4V A;  1E1N A;  3RP6 A;  3SY4 A;  3UTH A;  3NYF A;  1BZL A;  3QSE A;  4BUR A;  2C72 A;  4Y4N A;  3SYI A;  2VVL G;  3KD9 A;  3NTA A;  1JRZ A;  2C65 A;  1D7L A;  3WE0 A;  2R0C A;  5JCN A;  2FJD A;  2OLO A;  1GRA A;  1M64 A;  3ICS A;  4H2Q A;  3SFE A;  1N4U A;  3NYE A;  1YQ4 A;  3FBS A;  3GRT A;  3T31 A;  3M12 A;  2JKC A;  4B69 A;  1K0L A;  1FL2 A;  2B7S A;  3D8X A;  1KFY A;  1CJ4 A;  3CPJ G;  1SEZ A;  4N9X A;  1BWC A;  4FK1 C;  5IQ1 A;  4B1B A;  5JCM A;  1Q9I A;  4XWZ A;  4TLX A;  3GMC A;  4GR1 A;  1RP0 A;  2XFP A;  1H6V A;  1CJ2 A;  5FS9 A;  4UP3 A;  3KU9 A;  4EMW A;  2GQF A;  4RG3 A;  1TYT A;  2YLX A;  1GND A;  2YR5 A;  2NPX A;  2A8X A;  4MJW A;  4AP3 A;  4CCR A;  3VRB A;  1PBF A;  4G74 A;  3T14 A;  4YSZ A;  4I58 A;  5BUL A;  2JB3 A;  3VQR A;  5EOW A;  4YKF A;  5JCL A;  2OAL A;  3CGE A;  4J56 A;  2WOV A;  2R45 A;  3EF6 A;  4REK A;  2OA1 A;  2H88 A;  4UDP A;  1H81 A;  1FEA A;  1L9E A;  4Y4M A;  1CC6 A;  1P2E A;  4FDC B;  2B9X A;  2WOW A;  3UTE A;  1D4E A;  4C77 A;  3NK1 X;  3V76 A;  2C75 A;  1TRB A;  2TMD A;  4K2X A;  3T2K A;  5KRQ A;  3I3L A;  5IQ4 A;  3M0O A;  3SZ0 A;  3AD7 B;  4J31 A;  1BF3 A;  4X4J A;  5KOW A;  1ONF A;  1N4W A;  1E6E A;  3AD9 B;  3IWA A;  3RP7 A;  1ZOV A;  3SZC A;  3DME A;  2E5V A;  3DK8 A;  1HYU A;  1E7P A;  3AE8 A;  3HYX A;  3UTG A;  3UP5 A;  4H50 A;  5J7X A;  4EIP A;  3AWI A;  2FJA A;  4GF7 A;  2JBV A;  4LA1 A;  1DOB A;  2C76 A;  5EB5 A;  5EBK A;  4GAP A;  3B6D A;  1GRG A;  1H83 A;  5IPY A;  1TYP A;  2YLT A;  2YR4 A;  1XAN A;  2JB1 A;  2WEU A;  4K7Z A;  3RP8 A;  1DOD A;  1DJN A;  4U8O A;  4OPG A;  3ABV A;  3NKS A;  1RSG A;  1H82 A;  1F8W A;  2BCP A;  4LU6 A;  2IVD A;  3AEG A;  1PXC A;  2YM1 A;  1LVL A;  3FMW A;  2GVC A;  1LQU A;  4AOS A;  3VRD B;  3UKF A;  1Y0P A;  3F8D A;  4TM4 A;  3UOY A;  2Z5Y A;  4H4U A;  2YG6 A;  1YY5 A;  1MXT A;  2X8C A;  3H4K A;  4IA6 A;  1KNP A;  2VOU A;  4U8I A;  5GRT A;  3KKJ A;  4JQ9 A;  1PDH A;  2VRM A;  1PN0 A;  2FJB A;  2OAM A;  4J36 A;  4YTP A;  2V3A A;  2CUL A;  3ALL A;  1ZY8 A;  2DKH A;  3C96 A;  3PS9 A;  2R0P A;  4H4W A;  3CGD A;  1FEC A;  4OPT A;  4B67 A;  4C3X A;  1DOE A;  4O5U A;  1M6I A;  3LXD A;  4JN9 A;  3NYC A;  4BJY A;  1F8S A;  4FK1 A;  3K30 A;  4AP1 A;  1GV4 A;  2QA1 A;  5JCK A;  2X8G A;  2C64 A;  4YT0 A;  4PAA A;  3AE7 A;  2WP9 A;  4EMJ A;  3AEA A;  4A65 A;  1IUV A;  4GCM A;  3BHF A;  5J60 A;  2UZZ A;  2GEW A;  5KMQ A;  1VQW A;  1KSU A;  3AEB A;  1KSS A;  1XPQ A;  1QO8 A;  3DK4 A;  1PXA A;  3P4R A;  4TLZ A;  4A7A A;  3DJD A;  2GR0 A;  1CC4 A;  1FCD A;  4U8P A;  1NG4 A;  2R4J A;  2YLR A;  3AE4 A;  4G9K A;  2V5Z A;  3KPF A;  1JNR A;  5ER0 A;  3ALJ A;  4ECH A;  3CMM A;  2C73 A;  4D04 A;  1KNR A;  2EQ9 A;  2NVK X;  5U1O A;  1FEB A;  3H8L A;  4BK1 A;  2I0Z A;  1D4C A;  3RHA A;  1P2H A;  2DKI A;  4CNK A;  2WP5 A;  4OPI A;  4U8K A;  5FS7 A;  3UOZ A;  1OJA A;  4EM4 A;  1DOC A;  1Y56 A;  4YWO A;  1H7W A;  1Z6L A;  2ZZB A;  4Z24 A;  2R9Z A;  4U8L A;  1ZX9 A;  3SGL A;  1JU2 A;  2RAB A;  4TM3 A;  5KMS A;  1TDF A;  3GYI A;  2V3B A;  3NG7 X;  1GRF A;  2B9Y A;  1S3B A;  2XFQ A;  4U8N A;  4BV6 A;  3HYW A;  5HYM A;  4U8J A;  5DBJ A;  1EBD A;  1Q1W A;  2YG5 A;  5U63 A;  2BAB A;  3T2Y A;  2VVL A;  4Z2U A;  1PBB A;  4CRT A;  3NGC X;  2E4G A;  1DNC A;  1L9D A;  3GSI A;  3BNU A;  3ISH A;  3L8K A;  2BYB A;  2JAE A;  3ZDN A;  4UDR A;  2APG A;  1PJ5 A;  3DGZ A;  1IUX A;  1W4X A;  1K4Q A;  1TDE A;  2GR2 A;  3EAN A;  4YTN A;  3AEF A;  3SZW A;  1OJ9 A;  1GPE A;  2YVG A;  4YKG A;  5KVH A;  2C3C A;  4NTD A;  2ARD A;  5KOX A;  2ACZ A;  2BS3 A;  2XFU A;  3QFB A;  1E39 A;  1OJD A;  4WX1 A;  2YR6 A;  2WDQ A;  4D03 A;  1ZMC A;  2GAG B;  4OPU A;  3CNS A;  4ZCC A;  4C3Y A;  2C7G A;  3C4A A;  1NEK A;  2WHD A;  1VG0 A;  2YVJ A;  1CHU A;  1LJ1 A;  4A6N B;  1GER A;  2EQ6 A;  3CPH G;  3P4Q A;  3UOV A;  3AYL A;  1ZK7 A;  4EQR A;  4GDP A;  2YWL A;  2BS2 A;  3ZYX A;  1E1K A;  3NK0 X;  4Y4L A;  3KLJ A;  4APN A;  1S2Y A;  3IHM A;  2QAE A;  4G6G A;  2ZZC A;  2Q0K A;  5FS6 A;  3NIX A;  1CC2 A;  1GXF A;  4CCQ A;  2WU2 A;  1NHQ A;  2Z5X A;  2AR8 A;  3BHK A;  3LZW A;  1B5Q A;  4Z44 A;  2BRA A;  1CBO A;  1VDC A;  3AE6 A;  2C3D A;  1K0I A;  2GAH B;  4B65 A;  4J57 A;  2XFO A;  2HQM A;  2BA9 A;  2RGH A;  3UCL A;  3CNT A;  1F6M A;  4H4X A;  1PHH A;  4J34 A;  5M0Z A;  1IUS A;  4YXD A;  1JEH A;  2GMH A;  3NHO X;  1GOS A;  3AE9 A;  4XWR A;  3CIR A;  3T0K A;  1ZOY A;  3BNM A;  1IUU A;  2AAQ A;  1GRH A;  1B8S A;  1KF6 A;  2VRL A;  4NEV A;  4CY6 A;  5C3J A;  2WET A;  3P4S A;  3I6D A;  4H2P A;  3AEE A;  3F8R A;  4BK2 A;  1EL7 A;  2E1M A;  4WCT A;  3UOX A;  1YKJ A;  3KPK A; 
#chains in the Genus database with same CATH homology
 1OJC A;  1V59 A;  1PXB A;  2R46 A;  2QA2 A;  2XDO A;  3ICT A;  3AED A;  4GAV A;  3Q6J A;  2YAU A;  3ATR A;  4J33 A;  4BJZ A;  4H4Z A;  1CL0 A;  3CN8 A;  4I59 A;  4H4P A;  3DJG X;  4IA5 A;  3G5Q A;  4NTC A;  3UKL A;  2CFY A;  2Q6U A;  4EIQ A;  1ZKQ A;  3EPT A;  1PS9 A;  2TPR A;  3NLC A;  4DGK A;  1TDO A;  1MOK A;  1BKW A;  3CGB A;  4GUV A;  4TM0 A;  3G5S A;  2BK4 A;  1GRT A;  1FOH A;  2GR1 A;  3P1W A;  4AT2 A;  1B37 A;  3LAD A;  1AOG A;  3II4 A;  2WDV A;  4JDR A;  3UTF A;  5BUK A;  4G6H A;  2X99 A;  2XCG A;  2Y6Q A;  1JOA A;  3G5R A;  4O5Q A;  3IC9 A;  2X8H A;  3NK2 X;  1L0V A;  2R4E A;  3NRN A;  4Z2R A;  1B4V A;  2XLP A;  2GH5 A;  2C4C A;  1E1L A;  1RYI A;  1XDI A;  3AXB A;  2BC1 A;  3CNJ A;  3BI2 A;  4Z2T A;  5C2T A;  1YQ3 A;  5HHF A;  2B76 A;  2X3N A;  3AE2 A;  3LZX A;  4ICY A;  4U2L A;  5BRT A;  1LPF A;  1GET A;  3ICR A;  4B68 A;  3VRA A;  5CQF A;  2GF3 A;  3GDP A;  1Q1R A;  1X31 B;  4YSY A;  2WPF A;  1IUT A;  3GDN A;  3AE3 A;  2BS4 A;  2XLT A;  2BRY A;  4Z25 A;  2BC0 A;  2WES A;  4J2W A;  3AE5 A;  1F8R A;  3JSK A;  2WPC A;  4K22 A;  4U2S A;  5KWF A;  3LOV A;  4K5R A;  3URH A;  4KX6 A;  3SX6 A;  4Z43 A;  5TR3 A;  1D5T A;  1LV0 A;  3D1C A;  4ZCD A;  2WP6 A;  3QFA A;  4CBQ A;  3ITJ A;  3AEC A;  1BGJ A;  1ELI A;  4JY3 A;  4RSL A;  2V60 A;  4EQX A;  3GYX A;  2WS3 A;  5KNL A;  2VQ7 A;  2X50 A;  4X9N A;  4YSH A;  4B63 A;  3CTY A;  1NG3 A;  1D7Y A;  3HYV A;  3CPI G;  3CGC A;  3B3R A;  5KVI A;  4JNQ A;  2PHH A;  1DJQ A;  2WPE A;  1E1M A;  2WOI A;  4P9S A;  1S3E A;  3GRS A;  2C67 A;  2GV8 A;  3E1T A;  4XXG A;  5L46 A;  5KMR A;  1NHP A;  2AQJ A;  2O9Z A;  2VVM A;  2YG7 A;  3AB1 A;  3K7Q X;  2XFN A;  5JCI A;  3DK9 A;  1NHR A;  2IID A;  4M52 A;  4NEW A;  2WQY A;  3DGH A;  2XYO A;  3VR9 A;  1QJD A;  4H2R A;  3NN6 X;  3UKH A;  2YG4 A;  2YM2 A;  1GTH A;  4OCG A;  4A5L A;  1GRE A;  2BK3 A;  2PYX A;  1S2Q A;  3O0H A;  3NH3 X;  4EMI A;  1H7X A;  1NEN A;  2EQ7 A;  3FIM B;  5EB4 A;  1O5W A;  1OJT A;  2Q7V A;  4EM3 A;  1Y56 B;  2WDR A;  3HZL A;  3SXI A;  1GTE A;  1N1P A;  5FMH A;  4PAB A;  4RG4 A;  4TM1 A;  3GWF A;  1CF3 A;  4NWZ A;  4A99 A;  3NN0 X;  4AOX A;  4DSH A;  4YSX A;  1PBC A;  3UKA A;  1GT8 A;  4K8D A;  2R0G A;  3GD4 A;  3LB8 A;  5KXJ A;  3ALM A;  1BGN A;  1JRY A;  3CNP A;  4ADW A;  3S5W A;  1EL8 A;  1GAL A;  3CND A;  5CKU A;  3GMB A;  3QVP A;  1H86 A;  1VRQ B;  4OPC A;  4DNA A;  3QVR A;  5HXI A;  4UDQ A;  1COY A;  4NNJ A;  2ZZ0 A;  2GB0 A;  2W0H A;  3UKQ A;  4GRT A;  2GR3 A;  4JNA A;  2FBW A;  1VG9 A;  2CDU A;  3BI5 A;  1PBE A;  2F5Z A;  1D4D A;  4DSG A;  2XVJ A;  5BVA A;  2C70 A;  4H4R A;  3UP4 A;  3V3O A;  5HY5 A;  3GYJ A;  3L1R A;  1XHC A;  3DH9 A;  4OPL A;  3AD8 B;  1NHS A;  2XLS A;  3C4N A;  3K7T A;  2CVJ A;  3P9U A;  2B9W A;  1PJ7 A;  2V61 A;  4IVM B;  1EL9 A;  1MO9 A;  2YG3 A;  4USR A;  1NAA A;  3K7M X;  4USQ A;  4C74 A;  3KVE A;  4HA6 A;  3SZF A;  5LV9 A;  5M10 A;  5GSN A;  3NT6 A;  3Q9T A;  3PVC A;  4BK3 A;  3PO7 A;  3QSM A;  2QCU A;  4IVO B;  1F3P A;  3T37 A;  3SQP A;  5U25 A;  3ADA B;  2ZBW A;  2VQB A;  5FS8 A;  2XVE A;  1H84 A;  4C5O A;  1JNZ A;  3OC4 A;  1GSN A;  4U2T A;  4GDE A;  2YLW A;  1LQT A;  2B7R A;  2GQW A;  1PJ6 A;  2JK6 A;  3GWD A;  3OZ2 A;  3H8I A;  3AYI A;  4H4S A;  4K5S A;  4A9W A;  4A79 A;  4H4Y A;  3FG2 P;  4JY2 A;  3IHG A;  4NTE A;  4YTM A;  1GRB A;  4CY8 A;  2XLU A;  3SFD A;  2Y6R A;  4AT0 A;  2C66 A;  4B66 A;  1NDA A;  1PBD A;  2YVF A;  4H4V A;  4ZN0 A;  4OPD A;  1KDG A;  4G73 A;  3COX A;  3LJP A;  4H4T A;  4NZH A;  3VR8 A;  1L9C A;  2EQ8 A;  3F8P A;  5KMP A;  1UKV G;  2RGJ A;  3NTD A;  1TDK A;  3T2Z A;  3GD3 A;  2IVE A;  3QSS A;  2A89 A;  3EAO A;  1K0J A;  4X9M A;  1REO A;  1ZP0 A;  1QLB A;  3DJE A;  4IV9 A;  2WU5 A;  4KPR A;  3UKP A;  2OLN A;  3R9U A;  1O95 A;  3KA7 A;  3UKK A;  2YLS A;  2BK5 A;  1ZMD A;  4Z26 A;  2XVF A;  2GMJ A;  1IJH A;  1IUW A;  3DA1 A;  4HB9 A;  4OVI A;  4FX9 A;  2RGO A;  2YQU A;  2BXS A;  3BI4 A;  3FPZ A;  3IF9 A;  2WBA A;  3NNE A;  1LTX R;  1ZDL A;  2V6O A;  4E0V A;  2XVI A;  4CNJ A;  4U8M A;  1EL5 A;  4H2N A;  4B64 A;  4H7U A;  3DJJ A;  4LII A;  2A87 A;  1CJ3 A;  2FJE A;  3QJ4 A;  1YQZ A;  1NPX A;  3RNM A;  3ATQ A;  1JRX A;  2Q0L A;  4II2 A;  2BAC A;  3SM8 A;  2XVH A;  3M13 A;  4H4Q A;  4II3 A;  4EQW A;  2VZ2 A;  1GEU A;  4EQS A;  3S61 A;  1GES A;  3RED A;  1TDN A;  2H89 A;  1DXL A;  2BCG G;  2JB2 A;  3AYJ A;  2XLR A;  2J3N A;  1CJC A;  2YLZ A;  2GRT A;  2BXR A;  3AE1 A;  3V3N A;  4A6N A;  1O94 A;  3P4P A;  1N4V A;  1E1N A;  3RP6 A;  3SY4 A;  3UTH A;  3NYF A;  1BZL A;  3QSE A;  4BUR A;  2C72 A;  4Y4N A;  3SYI A;  2VVL G;  3KD9 A;  3NTA A;  1JRZ A;  2C65 A;  1D7L A;  3WE0 A;  2R0C A;  5JCN A;  2FJD A;  2OLO A;  1GRA A;  1M64 A;  3ICS A;  4H2Q A;  3SFE A;  1N4U A;  3NYE A;  1YQ4 A;  3FBS A;  3GRT A;  3T31 A;  3M12 A;  2JKC A;  4B69 A;  1K0L A;  1FL2 A;  2B7S A;  3D8X A;  1KFY A;  1CJ4 A;  3CPJ G;  1SEZ A;  4N9X A;  1BWC A;  4FK1 C;  5IQ1 A;  4B1B A;  5JCM A;  1Q9I A;  4XWZ A;  4TLX A;  3GMC A;  4GR1 A;  1RP0 A;  2XFP A;  1H6V A;  1CJ2 A;  5FS9 A;  4UP3 A;  3KU9 A;  4EMW A;  2GQF A;  4RG3 A;  1TYT A;  2YLX A;  1GND A;  2YR5 A;  2NPX A;  2A8X A;  4MJW A;  4AP3 A;  4CCR A;  3VRB A;  1PBF A;  4G74 A;  3T14 A;  4YSZ A;  4I58 A;  5BUL A;  2JB3 A;  3VQR A;  5EOW A;  4YKF A;  5JCL A;  2OAL A;  3CGE A;  4J56 A;  2WOV A;  2R45 A;  3EF6 A;  4REK A;  2OA1 A;  2H88 A;  4UDP A;  1H81 A;  1FEA A;  1L9E A;  4Y4M A;  1CC6 A;  1P2E A;  4FDC B;  2B9X A;  2WOW A;  3UTE A;  1D4E A;  4C77 A;  3NK1 X;  3V76 A;  2C75 A;  1TRB A;  2TMD A;  4K2X A;  3T2K A;  5KRQ A;  3I3L A;  5IQ4 A;  3M0O A;  3SZ0 A;  3AD7 B;  4J31 A;  1BF3 A;  4X4J A;  5KOW A;  1ONF A;  1N4W A;  1E6E A;  3AD9 B;  3IWA A;  3RP7 A;  1ZOV A;  3SZC A;  3DME A;  2E5V A;  3DK8 A;  1HYU A;  1E7P A;  3AE8 A;  3HYX A;  3UTG A;  3UP5 A;  4H50 A;  5J7X A;  4EIP A;  3AWI A;  2FJA A;  4GF7 A;  2JBV A;  4LA1 A;  1DOB A;  2C76 A;  5EB5 A;  5EBK A;  4GAP A;  3B6D A;  1GRG A;  1H83 A;  5IPY A;  1TYP A;  2YLT A;  2YR4 A;  1XAN A;  2JB1 A;  2WEU A;  4K7Z A;  3RP8 A;  1DOD A;  1DJN A;  4U8O A;  4OPG A;  3ABV A;  3NKS A;  1RSG A;  1H82 A;  1F8W A;  2BCP A;  4LU6 A;  2IVD A;  3AEG A;  1PXC A;  2YM1 A;  1LVL A;  3FMW A;  2GVC A;  1LQU A;  4AOS A;  3VRD B;  3UKF A;  1Y0P A;  3F8D A;  4TM4 A;  3UOY A;  2Z5Y A;  4H4U A;  2YG6 A;  1YY5 A;  1MXT A;  2X8C A;  3H4K A;  4IA6 A;  1KNP A;  2VOU A;  4U8I A;  5GRT A;  3KKJ A;  4JQ9 A;  1PDH A;  2VRM A;  1PN0 A;  2FJB A;  2OAM A;  4J36 A;  4YTP A;  2V3A A;  2CUL A;  3ALL A;  1ZY8 A;  2DKH A;  3C96 A;  3PS9 A;  2R0P A;  4H4W A;  3CGD A;  1FEC A;  4OPT A;  4B67 A;  4C3X A;  1DOE A;  4O5U A;  1M6I A;  3LXD A;  4JN9 A;  3NYC A;  4BJY A;  1F8S A;  4FK1 A;  3K30 A;  4AP1 A;  1GV4 A;  2QA1 A;  5JCK A;  2X8G A;  2C64 A;  4YT0 A;  4PAA A;  3AE7 A;  2WP9 A;  4EMJ A;  3AEA A;  4A65 A;  1IUV A;  4GCM A;  3BHF A;  5J60 A;  2UZZ A;  2GEW A;  5KMQ A;  1VQW A;  1KSU A;  3AEB A;  1KSS A;  1XPQ A;  1QO8 A;  3DK4 A;  1PXA A;  3P4R A;  4TLZ A;  4A7A A;  3DJD A;  2GR0 A;  1CC4 A;  1FCD A;  4U8P A;  1NG4 A;  2R4J A;  2YLR A;  3AE4 A;  4G9K A;  2V5Z A;  3KPF A;  1JNR A;  5ER0 A;  3ALJ A;  4ECH A;  3CMM A;  2C73 A;  4D04 A;  1KNR A;  2EQ9 A;  2NVK X;  5U1O A;  1FEB A;  3H8L A;  4BK1 A;  2I0Z A;  1D4C A;  3RHA A;  1P2H A;  2DKI A;  4CNK A;  2WP5 A;  4OPI A;  4U8K A;  5FS7 A;  3UOZ A;  1OJA A;  4EM4 A;  1DOC A;  1Y56 A;  4YWO A;  1H7W A;  1Z6L A;  2ZZB A;  4Z24 A;  2R9Z A;  4U8L A;  1ZX9 A;  3SGL A;  1JU2 A;  2RAB A;  4TM3 A;  5KMS A;  1TDF A;  3GYI A;  2V3B A;  3NG7 X;  1GRF A;  2B9Y A;  1S3B A;  2XFQ A;  4U8N A;  4BV6 A;  3HYW A;  5HYM A;  4U8J A;  5DBJ A;  1EBD A;  1Q1W A;  2YG5 A;  5U63 A;  2BAB A;  3T2Y A;  2VVL A;  4Z2U A;  1PBB A;  4CRT A;  3NGC X;  2E4G A;  1DNC A;  1L9D A;  3GSI A;  3BNU A;  3ISH A;  3L8K A;  2BYB A;  2JAE A;  3ZDN A;  4UDR A;  2APG A;  1PJ5 A;  3DGZ A;  1IUX A;  1W4X A;  1K4Q A;  1TDE A;  2GR2 A;  3EAN A;  4YTN A;  3AEF A;  3SZW A;  1OJ9 A;  1GPE A;  2YVG A;  4YKG A;  5KVH A;  2C3C A;  4NTD A;  2ARD A;  5KOX A;  2ACZ A;  2BS3 A;  2XFU A;  3QFB A;  1E39 A;  1OJD A;  4WX1 A;  2YR6 A;  2WDQ A;  4D03 A;  1ZMC A;  2GAG B;  4OPU A;  3CNS A;  4ZCC A;  4C3Y A;  2C7G A;  3C4A A;  1NEK A;  2WHD A;  1VG0 A;  2YVJ A;  1CHU A;  1LJ1 A;  4A6N B;  1GER A;  2EQ6 A;  3CPH G;  3P4Q A;  3UOV A;  3AYL A;  1ZK7 A;  4EQR A;  4GDP A;  2YWL A;  2BS2 A;  3ZYX A;  1E1K A;  3NK0 X;  4Y4L A;  3KLJ A;  4APN A;  1S2Y A;  3IHM A;  2QAE A;  4G6G A;  2ZZC A;  2Q0K A;  5FS6 A;  3NIX A;  1CC2 A;  1GXF A;  4CCQ A;  2WU2 A;  1NHQ A;  2Z5X A;  2AR8 A;  3BHK A;  3LZW A;  1B5Q A;  4Z44 A;  2BRA A;  1CBO A;  1VDC A;  3AE6 A;  2C3D A;  1K0I A;  2GAH B;  4B65 A;  4J57 A;  2XFO A;  2HQM A;  2BA9 A;  2RGH A;  3UCL A;  3CNT A;  1F6M A;  4H4X A;  1PHH A;  4J34 A;  5M0Z A;  1IUS A;  4YXD A;  1JEH A;  2GMH A;  3NHO X;  1GOS A;  3AE9 A;  4XWR A;  3CIR A;  3T0K A;  1ZOY A;  3BNM A;  1IUU A;  2AAQ A;  1GRH A;  1B8S A;  1KF6 A;  2VRL A;  4NEV A;  4CY6 A;  5C3J A;  2WET A;  3P4S A;  3I6D A;  4H2P A;  3AEE A;  3F8R A;  4BK2 A;  1EL7 A;  2E1M A;  4WCT A;  3UOX A;  1YKJ A;  3KPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...