3K7QX

Crystal structure of substrate-bound 6-hydroxy-l-nicotine oxidase from arthrobacter nicotinovorans
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 147
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7qX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7qX02
5HYMA 2VQBA 4D04A 1FEBA 3P4PA 3QFBA 1H6VA 4GCMA 2X8GA 2ZZBA 4EQWA 3P4SA 4CCQA 2XVIA 3L1RA 4LU6A 3B6DA 3UKQA 4YSZA 5BVAA 1KDGA 2BXRA 4H4WA 3G5RA 1QLBA 3SM8A 2FJEA 3M0OA 1NG4A 5J7XA 1GTEA 3PS9A 1EL5A 1GESA 2JB2A 2FBWA 4USQA 4B69A 2V6OA 1HYUA 3AE8A 2J3NA 5HXIA 2XFQA 2WQYA 5U63A 1LQTA 4H4UA 4AP3A 2GAGB 2XYOA 3QSSA 2BS4A 1PBBA 1ZDLA 2WOVA 1VG9A 3JSKA 1DNCA 3IHGA 1PBDA 4YT0A 2C76A 4J31A 3UTFA 1E1KA 1TDOA 3ITJA 4TM3A 1Q1WA 4U8NA 3URHA 1QO8A 2TMDA 2YLWA 3GD4A 4UDRA 1TDNA 4EIQA 1D5TA 2C75A 1GRHA 2EQ6A 3LOVA 3C4AA 4U8IA 4AOSA 4Z2TA 2VVMA 4TM0A 2YM1A 3LADA 3ZYXA 4CRTA 1N4VA 3QSMA 3CNDA 5FS8A 3BNUA 3NNEA 1D7LA 3CPHG 3EF6A 4AP1A 4EM3A 1TYPA 2Y6RA 2ARDA 2RGOA 4C74A 1JOAA 1CJ4A 1MO9A 3AB1A 1VDCA 2B7SA 4EQRA 2YWLA 4J34A 4J57A 2FJAA 1QJDA 3C4NA 3DMEA 4B65A 3KVEA 5FS7A 1H86A 2QAEA 4C3YA 4LA1A 3AE3A 3DK9A 3UOXA 3BI5A 1DXLA 2YVGA 1Y0PA 3F8RA 4Y4NA 4U2TA 2C70A 3CGEA 4NEWA 3NTDA 3K30A 1SEZA 1TYTA 2QA2A 4PABA 4A5LA 4B1BA 2X99A 1H7WA 4AOXA 2IVEA 4KPRA 5KOWA 1F8RA 1X31B 4K2XA 1CBOA 2C67A 4H50A 4YSYA 2H88A 2B9XA 2YVFA 3CIRA 1GTHA 1NHRA 2XLTA 3K7TA 1JNRA 1N4UA 3PVCA 3C96A 1IUTA 1FCDA 1ZMCA 2WOWA 2HQMA 3V3OA 2GVCA 2YM2A 4CNKA 2ACZA 3UOZA 2WDVA 1KNRA 3NYFA 1B5QA 1GRFA 2BC0A 1H82A 3EANA 4FX9A 2GQWA 2BK4A 2GR0A 2TPRA 1DJNA 3SGLA 2V3BA 1YQ4A 2X50A 1OJTA 3KPFA 4RG3A 2XFOA 3DGZA 1K0IA 2R46A 4WCTA 4JY3A 3LJPA 4OPIA 3ALMA 5C3JA 1E7PA 4Z44A 1XANA 1JRXA 2Q0LA 3CGDA 1GALA 3GMBA 1NHSA 1ZKQA 3DGHA 3NK1X 3ABVA 3AE5A 3P9UA 3B3RA 3AYJA 4HA6A 2RGJA 2XFNA 3AD7B 4A99A 4XXGA 4YTMA 4X9NA 3HZLA 4CY8A 4X9MA 1O5WA 3DA1A 4OCGA 3ALJA 3COXA 2BYBA 2XFUA 4Y4LA 2VRLA 2A8XA 3CNPA 3LZXA 5KVIA 1EL7A 1S2YA 4MJWA 1F3PA 2I0ZA 3RHAA 2NPXA 3IF9A 1OJAA 1LPFA 1YKJA 3QFAA 1B4VA 1NPXA 2XLPA 3Q6JA 4GDEA 4YTPA 4H4PA 2VQ7A 1TDEA 3D1CA 3DJJA 2YG4A 4RSLA 1PBFA 1GPEA 3NTAA 5IPYA 1REOA 2B76A 3AYIA 4Z2RA 4N9XA 1RSGA 2PYXA 2YR5A 2WPEA 4DGKA 2NVKX 5L46A 1COYA 1L9EA 1S2QA 3UP4A 2YR6A 2H89A 3F8DA 1MXTA 5KVHA 4GF7A 1IUSA 3CPIG 3DJEA 3VRDB 2Y6QA 3L8KA 4TM4A 3K7MX 1ELIA 3NN0X 1NHQA 3ICTA 5U1OA 3SFEA 4K5SA 3M13A 3F8PA 4IA5A 4K7ZA 4UDPA 3FPZA 4GR1A 1VG0A 4B66A 1JNZA 3GWDA 3ISHA 1XPQA 4XWZA 1FECA 3LZWA 3KLJA 1B37A 1PJ5A 3FIMB 4K5RA 4A7AA 1Z6LA 2GR3A 4HB9A 5KOXA 1OJDA 1NG3A 2XFPA 2E4GA 1GETA 2XDOA 3GRSA 4Y4MA 3RP7A 2C7GA 3P4RA 1RYIA 1OJ9A 4AT0A 2BACA 3S5WA 1NDAA 3RNMA 1DOEA 4TLXA 4JDRA 3VR8A 4CNJA 2YG7A 2CVJA 3K7QX 3OZ2A 2X8HA 4IVMB 2BS2A 4YWOA 3AE9A 4D03A 2WHDA 1DOCA 4NTEA 2GAHB 1LQUA 1N4WA 3AXBA 4YSXA 3VR9A 1BWCA 2R0PA 2YG6A 2B9WA 2GB0A 2IIDA 3H8LA 3NLCA 2V5ZA 1JRYA 4FDCB 2BCPA 3CGCA 4REKA 1FL2A 1V59A 2VVLG 4OPUA 1S3BA 2JAEA 3KKJA 4H4VA 4Z24A 1LVLA 1D4CA 3UP5A 4YTNA 4FK1A 3Q9TA 4B68A 4H4TA 1E1LA 5TR3A 1EL9A 2C3CA 4P9SA 4NTCA 3FG2P 4FK1C 2R45A 4YKFA 4GUVA 2GRTA 1B8SA 2W0HA 1O94A 1PHHA 3NK2X 3NKSA 5DBJA 1IUWA 3CNTA 3E1TA 1ZX9A 4TLZA 5BULA 3O0HA 1KSUA 3QSEA 4RG4A 4UDQA 4BK1A 4DNAA 4H2RA 4K22A 4OPCA 1EBDA 2Q7VA 2O9ZA 3GWFA 1ZY8A 2BXSA 2QA1A 3EPTA 2WESA 3KD9A 5GRTA 1E39A 2AR8A 2VOUA 4APNA 3GYIA 3ICSA 2OALA 2ZZ0A 1YQZA 3AWIA 3P4QA 1D4DA 3BHFA 4BURA 4XWRA 5FS6A 3OC4A 3UCLA 1K4QA 5IQ1A 1VQWA 2R4JA 3ZDNA 3BNMA 4TM1A 4A79A 1LJ1A 5LV9A 1H7XA 1M6IA 2UZZA 2WDQA 1PN0A 3II4A 2WP6A 1ZMDA 3VQRA 1PJ7A 2WBAA 4U8LA 4BV6A 3GD3A 4BK2A 1NAAA 3LB8A 2BABA 1BF3A 1L9CA 4I58A 2PHHA 2XVJA 4BJYA 4USRA 4JQ9A 1N1PA 1IUVA 2FJDA 1KNPA 3EAOA 2OAMA 1PJ6A 1ZOVA 1TRBA 4H2NA 4J36A 3WE0A 5CQFA 3R9UA 1F8SA 1AOGA 2GMJA 1KF6A 3LXDA 1E1MA 2OA1A 1BZLA 1LV0A 4EMWA 1NHPA 3AE1A 1EL8A 1GT8A 4ZCCA 3G5QA 1PDHA 5EBKA 2C64A 2IVDA 3IHMA 2WETA 2V60A 2BC1A 1H81A 1O95A 1L0VA 3UTGA 2EQ9A 1KSSA 2YR4A 3NT6A 5M10A 2R4EA 3AECA 3ICRA 4AT2A 4H7UA 3AYLA 1GEUA 1XDIA 3GDPA 2WDRA 1CJ3A 4A65A 3S61A 1ONFA 2V3AA 4B67A 2YVJA 4H2QA 4OPTA 2JBVA 3GMCA 3UTEA 2ZZCA 1D7YA 3DH9A 3FMWA 4A6NB 5IQ4A 1DODA 2AAQA 3ALLA 4IV9A 3CNSA 2C65A 4UP3A 1GRAA 1K0JA 1L9DA 5GSNA 4GRTA 4IVOB 4YXDA 5U25A 1KFYA 4U2SA 1OJCA 3GYJA 4JNAA 4EQSA 5JCKA 3P1WA 3H4KA 2X3NA 3AD9B 3M12A 4C77A 4YSHA 5JCIA 2V61A 3CPJG 3NK0X 4H4QA 1TDFA 1UKVG 2CULA 2X8CA 5CKUA 3UKFA 4EMIA 3IWAA 1Y56B 5M0ZA 3KA7A 4OPGA 4CCRA 1TDKA 3NGCX 1BGNA 2RGHA 1IUXA 1JRZA 2CFYA 4H4RA 2XVHA 2ZBWA 5BRTA 2YG5A 2Q0KA 2DKHA 1GSNA 4JNQA 2WP9A 5EOWA 2JKCA 1PBEA 5J60A 3NG7X 5HHFA 1PBCA 4U8JA 3SFDA 2WOIA 1Q1RA 3NRNA 4EIPA 2XLRA 2GH5A 2Q6UA 4IA6A 2WS3A 4X4JA 2WEUA 2Z5YA 1NENA 4GDPA 3REDA 1PXAA 4H2PA 2AQJA 3UKKA 3UKAA 2WP5A 3UOYA 1YY5A 2GMHA 2XLSA 3CNJA 1RP0A 4Z43A 3QJ4A 3ATRA 4I59A 4C5OA 4CY6A 4CBQA 1PS9A 1D4EA 2RABA 3BI4A 2E1MA 1CF3A 2QCUA 3AE2A 5JCMA 2GF3A 3GDNA 3VRBA 2GV8A 5BUKA 1NEKA 4DSHA 2BCGG 3DK4A 4U8KA 1FOHA 2JB3A 4KX6A 4Z26A 2VZ2A 2XCGA 1YQ3A 4O5UA 3H8IA 4EM4A 2C73A 4U8PA 2R0CA 4YKGA 4B63A 4Z25A 4EQXA 1GXFA 1XHCA 1GOSA 3FBSA 5FMHA 2EQ8A 5JCNA 4NTDA 1DOBA 4ZCDA 4A6NA 5KXJA 1FEAA 5FS9A 4BJZA 1IUUA 1S3EA 1GNDA 2DKIA 2GQFA 4H4YA 3T37A 1CC4A 1P2EA 4DSGA 2EQ7A 5HY5A 2YLZA 2OLNA 4M52A 2GR2A 1JU2A 2JB1A 3I3LA 4OPLA 4OVIA 2YLSA 4H4ZA 3UKLA 2WU5A 3AE7A 1Y56A 1CJCA 2BK3A 4C3XA 4ADWA 4J2WA 3DJGX 4H4XA 3PO7A 5EB4A 1VRQB 1F8WA 1PXCA 3AEAA 3AEFA 3BHKA 3CTYA 2YLXA 4ICYA 3AE6A 4JN9A 4EMJA 1JEHA 2APGA 1P2HA 1W4XA 1IJHA 3NYEA 1MOKA 2C72A 1BKWA 2YQUA 3NH3X 4U8MA 4WX1A 1GV4A 3UOVA 2B7RA 2VRMA 4BK3A 1GRBA 3DK8A 3QVPA 1H84A 1GERA 3BI2A 3DJDA 4K8DA 1ZOYA 2A87A 2YG3A 4H4SA 3AEEA 4NEVA 4U2LA 5KWFA 2YLRA 3UKPA 1E1NA 3I6DA 1CJ2A 2VVLA 1DJQA 3SQPA 4ZN0A 5KRQA 4LIIA 1ZK7A 3RP6A 3AD8B 1GRTA 4J56A 3CN8A 2R0GA 3RP8A 3AE4A 2C3DA 2WU2A 3NHOX 3CGBA 2E5VA 3AEDA 1E6EA 3ATQA 2BS3A 3G5SA 3GSIA 4U8OA 3V3NA 2BK5A 1CHUA 2OLOA 1CC2A 2XLUA 2GR1A 4NZHA 2C66A 3V76A 2XVFA 4O5QA 4Z2UA 1BGJA 1CC6A 3AEGA 2FJBA 3NYCA 3VRAA 1CL0A 4JY2A 5ER0A 2R9ZA 5JCLA 1K0LA 3UKHA 2WPCA 1H83A 4E0VA 1Q9IA 1ZP0A 2CDUA 3NIXA 1F6MA 4B64A 1M64A 3AEBA 3IC9A 2XVEA 1GRGA 3D8XA 3UTHA 3NN6X 4A9WA 2JK6A 4ECHA 4J33A 2A89A 3KU9A 5C2TA 4PAAA 2Z5XA 2YAUA 1GREA 2YLTA 3GRTA 2GEWA 2WPFA 2BA9A 1PXBA 2F5ZA 1LTXR 3ADAB 2B9YA 3QVRA 4OPDA 5EB5A
chains in the Genus database with same CATH superfamily
5HYMA 2VQBA 4D04A 1FEBA 3P4PA 3QFBA 1H6VA 4GCMA 2X8GA 2ZZBA 4EQWA 3P4SA 4CCQA 2XVIA 3L1RA 4LU6A 3B6DA 3SXIA 3UKQA 4YSZA 5BVAA 1KDGA 2BXRA 4H4WA 3G5RA 1QLBA 3SM8A 2FJEA 3M0OA 1NG4A 5J7XA 1GTEA 3PS9A 1EL5A 1GESA 2JB2A 2FBWA 4USQA 4B69A 2V6OA 1HYUA 3AE8A 2J3NA 5HXIA 2XFQA 2WQYA 5U63A 1LQTA 4H4UA 4AP3A 2GAGB 2XYOA 3QSSA 2BS4A 1PBBA 1ZDLA 2WOVA 1VG9A 3JSKA 1DNCA 3IHGA 1PBDA 4YT0A 2C76A 4J31A 3UTFA 1E1KA 1TDOA 3ITJA 4TM3A 1Q1WA 4U8NA 3URHA 1QO8A 2TMDA 2YLWA 3GD4A 4UDRA 1TDNA 4EIQA 1D5TA 2C75A 1GRHA 2EQ6A 3LOVA 3C4AA 4U8IA 4AOSA 4Z2TA 2VVMA 4TM0A 2YM1A 3LADA 3ZYXA 4CRTA 1N4VA 3QSMA 3CNDA 5FS8A 3BNUA 3NNEA 1D7LA 3CPHG 3EF6A 4AP1A 4EM3A 1TYPA 2Y6RA 2ARDA 2RGOA 4C74A 1JOAA 1CJ4A 1MO9A 3AB1A 4GAPA 1VDCA 2B7SA 4EQRA 2YWLA 4J34A 4J57A 2FJAA 1QJDA 3C4NA 3DMEA 4B65A 3KVEA 5FS7A 1H86A 4G74A 2QAEA 4C3YA 4LA1A 3AE3A 3DK9A 3UOXA 3BI5A 1DXLA 2YVGA 5KMQA 1Y0PA 3F8RA 4Y4NA 4U2TA 2C70A 3CGEA 4NEWA 3NTDA 3K30A 1SEZA 1TYTA 2QA2A 4PABA 3SZFA 4A5LA 4B1BA 2X99A 1H7WA 4AOXA 2IVEA 4KPRA 5KOWA 1F8RA 1X31B 4K2XA 1CBOA 2C67A 5KMSA 4H50A 4YSYA 2H88A 2B9XA 2YVFA 3CIRA 1GTHA 1NHRA 2XLTA 3K7TA 1JNRA 1N4UA 3PVCA 3C96A 1IUTA 1FCDA 1ZMCA 2WOWA 2HQMA 3V3OA 2GVCA 2YM2A 4CNKA 2ACZA 3UOZA 2WDVA 1KNRA 3NYFA 3SZ0A 1B5QA 1GRFA 2BC0A 1H82A 3EANA 4FX9A 2GQWA 2BK4A 2GR0A 2TPRA 1DJNA 3SGLA 2V3BA 1YQ4A 2X50A 1OJTA 3KPFA 3T31A 4RG3A 2XFOA 3DGZA 1K0IA 2R46A 4WCTA 4JY3A 3LJPA 4OPIA 3ALMA 4EMJA 5C3JA 1E7PA 4Z44A 1XANA 1JRXA 2Q0LA 3CGDA 1GALA 3GMBA 3T0KA 1NHSA 1ZKQA 3DGHA 3NK1X 3ABVA 3AE5A 3P9UA 3B3RA 3AYJA 4HA6A 2RGJA 2XFNA 3AD7B 3T2YA 4A99A 4XXGA 4YTMA 4X9NA 3HZLA 4CY8A 4X9MA 1O5WA 3DA1A 4OCGA 3ALJA 3COXA 2BYBA 2XFUA 4Y4LA 2VRLA 2A8XA 3CNPA 3LZXA 5KVIA 5KNLA 1EL7A 1S2YA 4MJWA 1F3PA 2I0ZA 3RHAA 2NPXA 3IF9A 1OJAA 1LPFA 1YKJA 3QFAA 1B4VA 1NPXA 2XLPA 3Q6JA 4GDEA 4YTPA 4H4PA 2VQ7A 1TDEA 3D1CA 3DJJA 2YG4A 4RSLA 1PBFA 1GPEA 3NTAA 5IPYA 1REOA 2B76A 3AYIA 4Z2RA 4N9XA 1RSGA 2PYXA 4G9KA 3SZCA 2YR5A 2WPEA 4DGKA 2NVKX 5L46A 1COYA 1L9EA 1S2QA 3UP4A 2YR6A 2H89A 3F8DA 1MXTA 5KVHA 4GF7A 3SYIA 1IUSA 3CPIG 3DJEA 3VRDB 2Y6QA 3L8KA 4TM4A 3K7MX 1ELIA 3NN0X 1NHQA 3ICTA 5U1OA 3SFEA 4K5SA 3M13A 3F8PA 4IA5A 4K7ZA 4UDPA 3FPZA 4GR1A 1VG0A 4B66A 1JNZA 3GWDA 3ISHA 1XPQA 4XWZA 1FECA 3LZWA 3KLJA 1B37A 1PJ5A 3FIMB 4K5RA 4A7AA 1Z6LA 2GR3A 4HB9A 5KOXA 1OJDA 1NG3A 2XFPA 2E4GA 1GETA 2XDOA 3GRSA 4Y4MA 3RP7A 2C7GA 3P4RA 1RYIA 1OJ9A 4AT0A 2BACA 3S5WA 1NDAA 3RNMA 1DOEA 4TLXA 4G6GA 4JDRA 3VR8A 4CNJA 2YG7A 2CVJA 3K7QX 3OZ2A 2X8HA 4IVMB 2BS2A 4YWOA 3AE9A 4D03A 2WHDA 1DOCA 4NTEA 2GAHB 1LQUA 1N4WA 3AXBA 4YSXA 3VR9A 1BWCA 2R0PA 2YG6A 2B9WA 2GB0A 2IIDA 3H8LA 3NLCA 2V5ZA 1JRYA 4GAVA 4FDCB 2BCPA 3CGCA 4REKA 1FL2A 1V59A 2VVLG 4OPUA 1S3BA 2JAEA 3KKJA 4G6HA 4H4VA 1LVLA 1D4CA 4Z24A 3UP5A 4YTNA 4FK1A 3Q9TA 4B68A 4H4TA 1E1LA 5TR3A 1EL9A 2C3CA 4P9SA 4NTCA 3FG2P 4FK1C 2R45A 4YKFA 4GUVA 2GRTA 1B8SA 2W0HA 1O94A 1PHHA 3NK2X 3NKSA 5DBJA 1IUWA 4II2A 3CNTA 3E1TA 1ZX9A 4TLZA 5BULA 3O0HA 1KSUA 3QSEA 4RG4A 4UDQA 4BK1A 4DNAA 4H2RA 4K22A 4OPCA 1EBDA 2Q7VA 2O9ZA 3GWFA 1ZY8A 2BXSA 2QA1A 3EPTA 2WESA 3KD9A 5GRTA 1E39A 2AR8A 2VOUA 4APNA 3GYIA 3ICSA 2OALA 2ZZ0A 1YQZA 3AWIA 3P4QA 1D4DA 3SZWA 3BHFA 4BURA 4XWRA 5FS6A 3OC4A 3UCLA 1K4QA 5IQ1A 1VQWA 2R4JA 3KPKA 3ZDNA 3BNMA 4TM1A 4A79A 1LJ1A 5LV9A 1H7XA 1M6IA 2UZZA 2WDQA 1PN0A 3II4A 2WP6A 1ZMDA 3VQRA 1PJ7A 2WBAA 4U8LA 4BV6A 3GD3A 4BK2A 1NAAA 3LB8A 2BABA 1BF3A 1L9CA 4I58A 2PHHA 2XVJA 4BJYA 4USRA 4JQ9A 1N1PA 1IUVA 2FJDA 1KNPA 3EAOA 2OAMA 1PJ6A 1ZOVA 1TRBA 4H2NA 4J36A 3WE0A 5CQFA 3R9UA 1F8SA 1AOGA 2GMJA 1KF6A 3LXDA 3T2KA 1E1MA 2OA1A 1BZLA 1LV0A 4EMWA 1NHPA 3AE1A 1EL8A 1GT8A 4ZCCA 3G5QA 1PDHA 5EBKA 2C64A 2IVDA 3HYWA 3IHMA 2WETA 2V60A 2BC1A 1H81A 1O95A 3GYXA 1L0VA 3UTGA 2EQ9A 1KSSA 2YR4A 3NT6A 5M10A 2R4EA 3AECA 3ICRA 4AT2A 4H7UA 3AYLA 5KMRA 1GEUA 1XDIA 3GDPA 2WDRA 1CJ3A 4A65A 3S61A 1ONFA 2V3AA 4B67A 2YVJA 4H2QA 4OPTA 2JBVA 3GMCA 3UTEA 2ZZCA 1D7YA 3DH9A 3FMWA 4A6NB 5IQ4A 1DODA 2AAQA 3ALLA 4IV9A 3T2ZA 3CNSA 2C65A 4UP3A 1GRAA 1K0JA 1L9DA 5GSNA 4GRTA 4IVOB 4YXDA 5U25A 1KFYA 4U2SA 1OJCA 3GYJA 4JNAA 4EQSA 5JCKA 3P1WA 3H4KA 2X3NA 3AD9B 3HYXA 3M12A 4C77A 4YSHA 5JCIA 2V61A 3CPJG 3NK0X 4H4QA 1TDFA 1UKVG 2CULA 2X8CA 5CKUA 3UKFA 4EMIA 3IWAA 1Y56B 5M0ZA 3KA7A 4OPGA 3SY4A 4CCRA 1TDKA 3NGCX 1BGNA 2RGHA 1IUXA 4NWZA 1JRZA 2CFYA 4H4RA 2XVHA 2ZBWA 5BRTA 2YG5A 2Q0KA 2DKHA 1GSNA 4JNQA 2WP9A 5EOWA 2JKCA 1PBEA 5J60A 3NG7X 5HHFA 1PBCA 4U8JA 3SFDA 2WOIA 1Q1RA 3NRNA 4EIPA 2XLRA 2GH5A 2Q6UA 4IA6A 2WS3A 4X4JA 2WEUA 2Z5YA 1NENA 4GDPA 3REDA 1PXAA 4H2PA 2AQJA 3UKKA 3UKAA 2WP5A 3UOYA 1YY5A 2GMHA 2XLSA 3CNJA 1RP0A 4Z43A 3QJ4A 3ATRA 4I59A 2BRAA 4C5OA 4CY6A 4CBQA 1PS9A 1D4EA 2RABA 3BI4A 2E1MA 1CF3A 2QCUA 3AE2A 5JCMA 2GF3A 3GDNA 3VRBA 2GV8A 5BUKA 1NEKA 4DSHA 2BCGG 3DK4A 4U8KA 1FOHA 2JB3A 4KX6A 4Z26A 2VZ2A 2XCGA 1YQ3A 4O5UA 3H8IA 4EM4A 2C73A 4U8PA 2R0CA 4YKGA 4B63A 5KMPA 4Z25A 4EQXA 1GXFA 1XHCA 1GOSA 3FBSA 5FMHA 2EQ8A 5JCNA 4NTDA 1DOBA 4ZCDA 4A6NA 5KXJA 1FEAA 5FS9A 4BJZA 1IUUA 1S3EA 1GNDA 2DKIA 2GQFA 4H4YA 3T37A 1CC4A 1P2EA 4DSGA 2EQ7A 5HY5A 2YLZA 2OLNA 4M52A 2GR2A 1JU2A 2JB1A 3I3LA 4OPLA 4OVIA 2YLSA 4H4ZA 3UKLA 2WU5A 3AE7A 1Y56A 1CJCA 2BK3A 4C3XA 4ADWA 4J2WA 3DJGX 4H4XA 3PO7A 5EB4A 1VRQB 1F8WA 1PXCA 3AEAA 3AEFA 3BHKA 3CTYA 2YLXA 3HYVA 3AE6A 4ICYA 4JN9A 1JEHA 2APGA 3T14A 1P2HA 1W4XA 1IJHA 3NYEA 3SX6A 1MOKA 2C72A 1BKWA 2YQUA 3NH3X 4U8MA 4WX1A 1GV4A 3UOVA 2B7RA 2VRMA 4BK3A 1GRBA 3DK8A 3QVPA 1H84A 1GERA 3BI2A 3DJDA 4K8DA 4NNJA 1ZOYA 2A87A 2C4CA 2YG3A 3AEEA 4H4SA 4NEVA 4U2LA 5KWFA 2YLRA 3UKPA 1E1NA 3I6DA 1CJ2A 2VVLA 1DJQA 3SQPA 4ZN0A 5KRQA 4LIIA 1ZK7A 3RP6A 3AD8B 1GRTA 4J56A 3CN8A 2R0GA 3RP8A 3AE4A 2C3DA 2WU2A 3NHOX 3CGBA 2E5VA 3AEDA 1E6EA 3ATQA 2BS3A 3G5SA 3GSIA 4U8OA 3V3NA 2BK5A 1CHUA 2OLOA 1CC2A 2XLUA 4II3A 2GR1A 4NZHA 2C66A 3V76A 2XVFA 4O5QA 4Z2UA 1BGJA 1CC6A 3AEGA 2FJBA 3NYCA 3VRAA 1CL0A 4JY2A 5ER0A 2R9ZA 2BRYA 5JCLA 1K0LA 3UKHA 2WPCA 1H83A 3CMMA 4E0VA 1Q9IA 1ZP0A 2CDUA 3NIXA 1F6MA 4B64A 1M64A 3AEBA 3IC9A 2XVEA 1GRGA 3D8XA 3UTHA 3NN6X 4G73A 2JK6A 4A9WA 4ECHA 4J33A 2A89A 3KU9A 5C2TA 4PAAA 2Z5XA 2YAUA 1GREA 2YLTA 3GRTA 2GEWA 2WPFA 2BA9A 1PXBA 2F5ZA 1LTXR 3ADAB 2B9YA 3QVRA 4OPDA 5EB5A
chains in the Genus database with same CATH topology
5HYMA 2VQBA 4D04A 1FEBA 3P4PA 3QFBA 1H6VA 4GCMA 2X8GA 2ZZBA 4EQWA 3P4SA 4CCQA 2XVIA 3L1RA 4LU6A 3B6DA 3SXIA 3UKQA 4YSZA 5BVAA 1KDGA 2BXRA 4H4WA 3G5RA 1QLBA 3SM8A 2FJEA 3M0OA 1NG4A 5J7XA 1GTEA 3PS9A 1EL5A 1GESA 2JB2A 2FBWA 4USQA 4B69A 2V6OA 1HYUA 3AE8A 2J3NA 5HXIA 2XFQA 2WQYA 5U63A 1LQTA 4H4UA 4AP3A 2GAGB 2XYOA 3QSSA 2BS4A 1PBBA 1ZDLA 2WOVA 1VG9A 3JSKA 1DNCA 3IHGA 1PBDA 4YT0A 2C76A 4J31A 3UTFA 1E1KA 1TDOA 3ITJA 4TM3A 1Q1WA 4U8NA 3URHA 1QO8A 2TMDA 2YLWA 3GD4A 4UDRA 1TDNA 4EIQA 1D5TA 2C75A 1GRHA 2EQ6A 3LOVA 3C4AA 4U8IA 4AOSA 4Z2TA 2VVMA 4TM0A 2YM1A 3LADA 3ZYXA 4CRTA 1N4VA 3QSMA 3CNDA 5FS8A 3BNUA 3NNEA 1D7LA 3CPHG 3EF6A 4AP1A 4EM3A 1TYPA 2Y6RA 2ARDA 2RGOA 4C74A 1JOAA 1CJ4A 1MO9A 3AB1A 4GAPA 1VDCA 2B7SA 4EQRA 2YWLA 4J34A 4J57A 2FJAA 1QJDA 3C4NA 3DMEA 4B65A 3KVEA 5FS7A 1H86A 4G74A 2QAEA 4C3YA 4LA1A 3AE3A 3DK9A 3UOXA 3BI5A 1DXLA 2YVGA 5KMQA 1Y0PA 3F8RA 4Y4NA 4U2TA 2C70A 3CGEA 4NEWA 3NTDA 3K30A 1SEZA 1TYTA 2QA2A 4PABA 3SZFA 4A5LA 4B1BA 2X99A 1H7WA 4AOXA 2IVEA 4KPRA 5KOWA 1F8RA 1X31B 4K2XA 1CBOA 2C67A 5KMSA 4H50A 4YSYA 2H88A 2B9XA 2YVFA 3CIRA 1GTHA 1NHRA 2XLTA 3K7TA 1JNRA 1N4UA 3PVCA 3C96A 1IUTA 1FCDA 1ZMCA 2WOWA 2HQMA 3V3OA 2GVCA 2YM2A 4CNKA 2ACZA 3UOZA 2WDVA 1KNRA 3NYFA 3SZ0A 1B5QA 1GRFA 2BC0A 1H82A 3EANA 4FX9A 2GQWA 2BK4A 2GR0A 2TPRA 1DJNA 3SGLA 2V3BA 1YQ4A 2X50A 1OJTA 3KPFA 3T31A 4RG3A 2XFOA 3DGZA 1K0IA 2R46A 4WCTA 4JY3A 3LJPA 4OPIA 3ALMA 4EMJA 5C3JA 1E7PA 4Z44A 1XANA 1JRXA 2Q0LA 3CGDA 1GALA 3GMBA 3T0KA 1NHSA 1ZKQA 3DGHA 3NK1X 3ABVA 3AE5A 3P9UA 3B3RA 3AYJA 4HA6A 2RGJA 2XFNA 3AD7B 3T2YA 4A99A 4XXGA 4YTMA 4X9NA 3HZLA 4CY8A 4X9MA 1O5WA 3DA1A 4OCGA 3ALJA 3COXA 2BYBA 2XFUA 4Y4LA 2VRLA 2A8XA 3CNPA 3LZXA 5KVIA 5KNLA 1EL7A 1S2YA 4MJWA 1F3PA 2I0ZA 3RHAA 2NPXA 3IF9A 1OJAA 1LPFA 1YKJA 3QFAA 1B4VA 1NPXA 2XLPA 3Q6JA 4GDEA 4YTPA 4H4PA 2VQ7A 1TDEA 3D1CA 3DJJA 2YG4A 4RSLA 1PBFA 1GPEA 3NTAA 5IPYA 1REOA 2B76A 3AYIA 4Z2RA 4N9XA 1RSGA 2PYXA 4G9KA 3SZCA 2YR5A 2WPEA 4DGKA 2NVKX 5L46A 1COYA 1L9EA 1S2QA 3UP4A 2YR6A 2H89A 3F8DA 1MXTA 5KVHA 4GF7A 3SYIA 1IUSA 3CPIG 3DJEA 3VRDB 2Y6QA 3L8KA 4TM4A 3K7MX 1ELIA 3NN0X 1NHQA 3ICTA 5U1OA 3SFEA 4K5SA 3M13A 3F8PA 4IA5A 4K7ZA 4UDPA 3FPZA 4GR1A 1VG0A 4B66A 1JNZA 3GWDA 3ISHA 1XPQA 4XWZA 1FECA 3LZWA 3KLJA 1B37A 1PJ5A 3FIMB 4K5RA 4A7AA 1Z6LA 2GR3A 4HB9A 5KOXA 1OJDA 1NG3A 2XFPA 2E4GA 1GETA 2XDOA 3GRSA 4Y4MA 3RP7A 2C7GA 3P4RA 1RYIA 1OJ9A 4AT0A 2BACA 3S5WA 1NDAA 3RNMA 1DOEA 4TLXA 4G6GA 4JDRA 3VR8A 4CNJA 2YG7A 2CVJA 3K7QX 3OZ2A 2X8HA 4IVMB 2BS2A 4YWOA 3AE9A 4D03A 2WHDA 1DOCA 4NTEA 2GAHB 1LQUA 1N4WA 3AXBA 4YSXA 3VR9A 1BWCA 2R0PA 2YG6A 2B9WA 2GB0A 2IIDA 3H8LA 3NLCA 2V5ZA 1JRYA 4GAVA 4FDCB 2BCPA 3CGCA 4REKA 1FL2A 1V59A 2VVLG 4OPUA 1S3BA 2JAEA 3KKJA 4G6HA 4H4VA 1LVLA 1D4CA 4Z24A 3UP5A 4YTNA 4FK1A 3Q9TA 4B68A 4H4TA 1E1LA 5TR3A 1EL9A 2C3CA 4P9SA 4NTCA 3FG2P 4FK1C 2R45A 4YKFA 4GUVA 2GRTA 1B8SA 2W0HA 1O94A 1PHHA 3NK2X 3NKSA 5DBJA 1IUWA 4II2A 3CNTA 3E1TA 1ZX9A 4TLZA 5BULA 3O0HA 1KSUA 3QSEA 4RG4A 4UDQA 4BK1A 4DNAA 4H2RA 4K22A 4OPCA 1EBDA 2Q7VA 2O9ZA 3GWFA 1ZY8A 2BXSA 2QA1A 3EPTA 2WESA 3KD9A 5GRTA 1E39A 2AR8A 2VOUA 4APNA 3GYIA 3ICSA 2OALA 2ZZ0A 1YQZA 3AWIA 3P4QA 1D4DA 3SZWA 3BHFA 4BURA 4XWRA 5FS6A 3OC4A 3UCLA 1K4QA 5IQ1A 1VQWA 2R4JA 3KPKA 3ZDNA 3BNMA 4TM1A 4A79A 1LJ1A 5LV9A 1H7XA 1M6IA 2UZZA 2WDQA 1PN0A 3II4A 2WP6A 1ZMDA 3VQRA 1PJ7A 2WBAA 4U8LA 4BV6A 3GD3A 4BK2A 1NAAA 3LB8A 2BABA 1BF3A 1L9CA 4I58A 2PHHA 2XVJA 4BJYA 4USRA 4JQ9A 1N1PA 1IUVA 2FJDA 1KNPA 3EAOA 2OAMA 1PJ6A 1ZOVA 1TRBA 4H2NA 4J36A 3WE0A 5CQFA 3R9UA 1F8SA 1AOGA 2GMJA 1KF6A 3LXDA 3T2KA 1E1MA 2OA1A 1BZLA 1LV0A 4EMWA 1NHPA 3AE1A 1EL8A 1GT8A 4ZCCA 3G5QA 1PDHA 5EBKA 2C64A 2IVDA 3HYWA 3IHMA 2WETA 2V60A 2BC1A 1H81A 1O95A 3GYXA 1L0VA 3UTGA 2EQ9A 1KSSA 2YR4A 3NT6A 5M10A 2R4EA 3AECA 3ICRA 4AT2A 4H7UA 3AYLA 5KMRA 1GEUA 1XDIA 3GDPA 2WDRA 1CJ3A 4A65A 3S61A 1ONFA 2V3AA 4B67A 2YVJA 4H2QA 4OPTA 2JBVA 3GMCA 3UTEA 2ZZCA 1D7YA 3DH9A 3FMWA 4A6NB 5IQ4A 1DODA 2AAQA 3ALLA 4IV9A 3T2ZA 3CNSA 2C65A 4UP3A 1GRAA 1K0JA 1L9DA 5GSNA 4GRTA 4IVOB 4YXDA 5U25A 1KFYA 4U2SA 1OJCA 3GYJA 4JNAA 4EQSA 5JCKA 3P1WA 3H4KA 2X3NA 3AD9B 3HYXA 3M12A 4C77A 4YSHA 5JCIA 2V61A 3CPJG 3NK0X 4H4QA 1TDFA 1UKVG 2CULA 2X8CA 5CKUA 3UKFA 4EMIA 3IWAA 1Y56B 5M0ZA 3KA7A 4OPGA 3SY4A 4CCRA 1TDKA 3NGCX 1BGNA 2RGHA 1IUXA 4NWZA 1JRZA 2CFYA 4H4RA 2XVHA 2ZBWA 5BRTA 2YG5A 2Q0KA 2DKHA 1GSNA 4JNQA 2WP9A 5EOWA 2JKCA 1PBEA 5J60A 3NG7X 5HHFA 1PBCA 4U8JA 3SFDA 2WOIA 1Q1RA 3NRNA 4EIPA 2XLRA 2GH5A 2Q6UA 4IA6A 2WS3A 4X4JA 2WEUA 2Z5YA 1NENA 4GDPA 3REDA 1PXAA 4H2PA 2AQJA 3UKKA 3UKAA 2WP5A 3UOYA 1YY5A 2GMHA 2XLSA 3CNJA 1RP0A 4Z43A 3QJ4A 3ATRA 4I59A 2BRAA 4C5OA 4CY6A 4CBQA 1PS9A 1D4EA 2RABA 3BI4A 2E1MA 1CF3A 2QCUA 3AE2A 5JCMA 2GF3A 3GDNA 3VRBA 2GV8A 5BUKA 1NEKA 4DSHA 2BCGG 3DK4A 4U8KA 1FOHA 2JB3A 4KX6A 4Z26A 2VZ2A 2XCGA 1YQ3A 4O5UA 3H8IA 4EM4A 2C73A 4U8PA 2R0CA 4YKGA 4B63A 5KMPA 4Z25A 4EQXA 1GXFA 1XHCA 1GOSA 3FBSA 5FMHA 2EQ8A 5JCNA 4NTDA 1DOBA 4ZCDA 4A6NA 5KXJA 1FEAA 5FS9A 4BJZA 1IUUA 1S3EA 1GNDA 2DKIA 2GQFA 4H4YA 3T37A 1CC4A 1P2EA 4DSGA 2EQ7A 5HY5A 2YLZA 2OLNA 4M52A 2GR2A 1JU2A 2JB1A 3I3LA 4OPLA 4OVIA 2YLSA 4H4ZA 3UKLA 2WU5A 3AE7A 1Y56A 1CJCA 2BK3A 4C3XA 4ADWA 4J2WA 3DJGX 4H4XA 3PO7A 5EB4A 1VRQB 1F8WA 1PXCA 3AEAA 3AEFA 3BHKA 3CTYA 2YLXA 3HYVA 3AE6A 4ICYA 4JN9A 1JEHA 2APGA 3T14A 1P2HA 1W4XA 1IJHA 3NYEA 3SX6A 1MOKA 2C72A 1BKWA 2YQUA 3NH3X 4U8MA 4WX1A 1GV4A 3UOVA 2B7RA 2VRMA 4BK3A 1GRBA 3DK8A 3QVPA 1H84A 1GERA 3BI2A 3DJDA 4K8DA 4NNJA 1ZOYA 2A87A 2C4CA 2YG3A 3AEEA 4H4SA 4NEVA 4U2LA 5KWFA 2YLRA 3UKPA 1E1NA 3I6DA 1CJ2A 2VVLA 1DJQA 3SQPA 4ZN0A 5KRQA 4LIIA 1ZK7A 3RP6A 3AD8B 1GRTA 4J56A 3CN8A 2R0GA 3RP8A 3AE4A 2C3DA 2WU2A 3NHOX 3CGBA 2E5VA 3AEDA 1E6EA 3ATQA 2BS3A 3G5SA 3GSIA 4U8OA 3V3NA 2BK5A 1CHUA 2OLOA 1CC2A 2XLUA 4II3A 2GR1A 4NZHA 2C66A 3V76A 2XVFA 4O5QA 4Z2UA 1BGJA 1CC6A 3AEGA 2FJBA 3NYCA 3VRAA 1CL0A 4JY2A 5ER0A 2R9ZA 2BRYA 5JCLA 1K0LA 3UKHA 2WPCA 1H83A 3CMMA 4E0VA 1Q9IA 1ZP0A 2CDUA 3NIXA 1F6MA 4B64A 1M64A 3AEBA 3IC9A 2XVEA 1GRGA 3D8XA 3UTHA 3NN6X 4G73A 2JK6A 4A9WA 4ECHA 4J33A 2A89A 3KU9A 5C2TA 4PAAA 2Z5XA 2YAUA 1GREA 2YLTA 3GRTA 2GEWA 2WPFA 2BA9A 1PXBA 2F5ZA 1LTXR 3ADAB 2B9YA 3QVRA 4OPDA 5EB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYM A;  2VQB A;  4D04 A;  1FEB A;  3P4P A;  3QFB A;  1H6V A;  4GCM A;  2X8G A;  2ZZB A;  4EQW A;  3P4S A;  4CCQ A;  2XVI A;  3L1R A;  4LU6 A;  3B6D A;  3UKQ A;  4YSZ A;  5BVA A;  1KDG A;  2BXR A;  4H4W A;  3G5R A;  1QLB A;  3SM8 A;  2FJE A;  3M0O A;  1NG4 A;  5J7X A;  1GTE A;  3PS9 A;  1EL5 A;  1GES A;  2JB2 A;  2FBW A;  4USQ A;  4B69 A;  2V6O A;  1HYU A;  3AE8 A;  2J3N A;  5HXI A;  2XFQ A;  2WQY A;  5U63 A;  1LQT A;  4H4U A;  4AP3 A;  2GAG B;  2XYO A;  3QSS A;  2BS4 A;  1PBB A;  1ZDL A;  2WOV A;  1VG9 A;  3JSK A;  1DNC A;  3IHG A;  1PBD A;  4YT0 A;  2C76 A;  4J31 A;  3UTF A;  1E1K A;  1TDO A;  3ITJ A;  4TM3 A;  1Q1W A;  4U8N A;  3URH A;  1QO8 A;  2TMD A;  2YLW A;  3GD4 A;  4UDR A;  1TDN A;  4EIQ A;  1D5T A;  2C75 A;  1GRH A;  2EQ6 A;  3LOV A;  3C4A A;  4U8I A;  4AOS A;  4Z2T A;  2VVM A;  4TM0 A;  2YM1 A;  3LAD A;  3ZYX A;  4CRT A;  1N4V A;  3QSM A;  3CND A;  5FS8 A;  3BNU A;  3NNE A;  1D7L A;  3CPH G;  3EF6 A;  4AP1 A;  4EM3 A;  1TYP A;  2Y6R A;  2ARD A;  2RGO A;  4C74 A;  1JOA A;  1CJ4 A;  1MO9 A;  3AB1 A;  1VDC A;  2B7S A;  4EQR A;  2YWL A;  4J34 A;  4J57 A;  2FJA A;  1QJD A;  3C4N A;  3DME A;  4B65 A;  3KVE A;  5FS7 A;  1H86 A;  2QAE A;  4C3Y A;  4LA1 A;  3AE3 A;  3DK9 A;  3UOX A;  3BI5 A;  1DXL A;  2YVG A;  1Y0P A;  3F8R A;  4Y4N A;  4U2T A;  2C70 A;  3CGE A;  4NEW A;  3NTD A;  3K30 A;  1SEZ A;  1TYT A;  2QA2 A;  4PAB A;  4A5L A;  4B1B A;  2X99 A;  1H7W A;  4AOX A;  2IVE A;  4KPR A;  5KOW A;  1F8R A;  1X31 B;  4K2X A;  1CBO A;  2C67 A;  4H50 A;  4YSY A;  2H88 A;  2B9X A;  2YVF A;  3CIR A;  1GTH A;  1NHR A;  2XLT A;  3K7T A;  1JNR A;  1N4U A;  3PVC A;  3C96 A;  1IUT A;  1FCD A;  1ZMC A;  2WOW A;  2HQM A;  3V3O A;  2GVC A;  2YM2 A;  4CNK A;  2ACZ A;  3UOZ A;  2WDV A;  1KNR A;  3NYF A;  1B5Q A;  1GRF A;  2BC0 A;  1H82 A;  3EAN A;  4FX9 A;  2GQW A;  2BK4 A;  2GR0 A;  2TPR A;  1DJN A;  3SGL A;  2V3B A;  1YQ4 A;  2X50 A;  1OJT A;  3KPF A;  4RG3 A;  2XFO A;  3DGZ A;  1K0I A;  2R46 A;  4WCT A;  4JY3 A;  3LJP A;  4OPI A;  3ALM A;  5C3J A;  1E7P A;  4Z44 A;  1XAN A;  1JRX A;  2Q0L A;  3CGD A;  1GAL A;  3GMB A;  1NHS A;  1ZKQ A;  3DGH A;  3NK1 X;  3ABV A;  3AE5 A;  3P9U A;  3B3R A;  3AYJ A;  4HA6 A;  2RGJ A;  2XFN A;  3AD7 B;  4A99 A;  4XXG A;  4YTM A;  4X9N A;  3HZL A;  4CY8 A;  4X9M A;  1O5W A;  3DA1 A;  4OCG A;  3ALJ A;  3COX A;  2BYB A;  2XFU A;  4Y4L A;  2VRL A;  2A8X A;  3CNP A;  3LZX A;  5KVI A;  1EL7 A;  1S2Y A;  4MJW A;  1F3P A;  2I0Z A;  3RHA A;  2NPX A;  3IF9 A;  1OJA A;  1LPF A;  1YKJ A;  3QFA A;  1B4V A;  1NPX A;  2XLP A;  3Q6J A;  4GDE A;  4YTP A;  4H4P A;  2VQ7 A;  1TDE A;  3D1C A;  3DJJ A;  2YG4 A;  4RSL A;  1PBF A;  1GPE A;  3NTA A;  5IPY A;  1REO A;  2B76 A;  3AYI A;  4Z2R A;  4N9X A;  1RSG A;  2PYX A;  2YR5 A;  2WPE A;  4DGK A;  2NVK X;  5L46 A;  1COY A;  1L9E A;  1S2Q A;  3UP4 A;  2YR6 A;  2H89 A;  3F8D A;  1MXT A;  5KVH A;  4GF7 A;  1IUS A;  3CPI G;  3DJE A;  3VRD B;  2Y6Q A;  3L8K A;  4TM4 A;  3K7M X;  1ELI A;  3NN0 X;  1NHQ A;  3ICT A;  5U1O A;  3SFE A;  4K5S A;  3M13 A;  3F8P A;  4IA5 A;  4K7Z A;  4UDP A;  3FPZ A;  4GR1 A;  1VG0 A;  4B66 A;  1JNZ A;  3GWD A;  3ISH A;  1XPQ A;  4XWZ A;  1FEC A;  3LZW A;  3KLJ A;  1B37 A;  1PJ5 A;  3FIM B;  4K5R A;  4A7A A;  1Z6L A;  2GR3 A;  4HB9 A;  5KOX A;  1OJD A;  1NG3 A;  2XFP A;  2E4G A;  1GET A;  2XDO A;  3GRS A;  4Y4M A;  3RP7 A;  2C7G A;  3P4R A;  1RYI A;  1OJ9 A;  4AT0 A;  2BAC A;  3S5W A;  1NDA A;  3RNM A;  1DOE A;  4TLX A;  4JDR A;  3VR8 A;  4CNJ A;  2YG7 A;  2CVJ A;  3K7Q X;  3OZ2 A;  2X8H A;  4IVM B;  2BS2 A;  4YWO A;  3AE9 A;  4D03 A;  2WHD A;  1DOC A;  4NTE A;  2GAH B;  1LQU A;  1N4W A;  3AXB A;  4YSX A;  3VR9 A;  1BWC A;  2R0P A;  2YG6 A;  2B9W A;  2GB0 A;  2IID A;  3H8L A;  3NLC A;  2V5Z A;  1JRY A;  4FDC B;  2BCP A;  3CGC A;  4REK A;  1FL2 A;  1V59 A;  2VVL G;  4OPU A;  1S3B A;  2JAE A;  3KKJ A;  4H4V A;  4Z24 A;  1LVL A;  1D4C A;  3UP5 A;  4YTN A;  4FK1 A;  3Q9T A;  4B68 A;  4H4T A;  1E1L A;  5TR3 A;  1EL9 A;  2C3C A;  4P9S A;  4NTC A;  3FG2 P;  4FK1 C;  2R45 A;  4YKF A;  4GUV A;  2GRT A;  1B8S A;  2W0H A;  1O94 A;  1PHH A;  3NK2 X;  3NKS A;  5DBJ A;  1IUW A;  3CNT A;  3E1T A;  1ZX9 A;  4TLZ A;  5BUL A;  3O0H A;  1KSU A;  3QSE A;  4RG4 A;  4UDQ A;  4BK1 A;  4DNA A;  4H2R A;  4K22 A;  4OPC A;  1EBD A;  2Q7V A;  2O9Z A;  3GWF A;  1ZY8 A;  2BXS A;  2QA1 A;  3EPT A;  2WES A;  3KD9 A;  5GRT A;  1E39 A;  2AR8 A;  2VOU A;  4APN A;  3GYI A;  3ICS A;  2OAL A;  2ZZ0 A;  1YQZ A;  3AWI A;  3P4Q A;  1D4D A;  3BHF A;  4BUR A;  4XWR A;  5FS6 A;  3OC4 A;  3UCL A;  1K4Q A;  5IQ1 A;  1VQW A;  2R4J A;  3ZDN A;  3BNM A;  4TM1 A;  4A79 A;  1LJ1 A;  5LV9 A;  1H7X A;  1M6I A;  2UZZ A;  2WDQ A;  1PN0 A;  3II4 A;  2WP6 A;  1ZMD A;  3VQR A;  1PJ7 A;  2WBA A;  4U8L A;  4BV6 A;  3GD3 A;  4BK2 A;  1NAA A;  3LB8 A;  2BAB A;  1BF3 A;  1L9C A;  4I58 A;  2PHH A;  2XVJ A;  4BJY A;  4USR A;  4JQ9 A;  1N1P A;  1IUV A;  2FJD A;  1KNP A;  3EAO A;  2OAM A;  1PJ6 A;  1ZOV A;  1TRB A;  4H2N A;  4J36 A;  3WE0 A;  5CQF A;  3R9U A;  1F8S A;  1AOG A;  2GMJ A;  1KF6 A;  3LXD A;  1E1M A;  2OA1 A;  1BZL A;  1LV0 A;  4EMW A;  1NHP A;  3AE1 A;  1EL8 A;  1GT8 A;  4ZCC A;  3G5Q A;  1PDH A;  5EBK A;  2C64 A;  2IVD A;  3IHM A;  2WET A;  2V60 A;  2BC1 A;  1H81 A;  1O95 A;  1L0V A;  3UTG A;  2EQ9 A;  1KSS A;  2YR4 A;  3NT6 A;  5M10 A;  2R4E A;  3AEC A;  3ICR A;  4AT2 A;  4H7U A;  3AYL A;  1GEU A;  1XDI A;  3GDP A;  2WDR A;  1CJ3 A;  4A65 A;  3S61 A;  1ONF A;  2V3A A;  4B67 A;  2YVJ A;  4H2Q A;  4OPT A;  2JBV A;  3GMC A;  3UTE A;  2ZZC A;  1D7Y A;  3DH9 A;  3FMW A;  4A6N B;  5IQ4 A;  1DOD A;  2AAQ A;  3ALL A;  4IV9 A;  3CNS A;  2C65 A;  4UP3 A;  1GRA A;  1K0J A;  1L9D A;  5GSN A;  4GRT A;  4IVO B;  4YXD A;  5U25 A;  1KFY A;  4U2S A;  1OJC A;  3GYJ A;  4JNA A;  4EQS A;  5JCK A;  3P1W A;  3H4K A;  2X3N A;  3AD9 B;  3M12 A;  4C77 A;  4YSH A;  5JCI A;  2V61 A;  3CPJ G;  3NK0 X;  4H4Q A;  1TDF A;  1UKV G;  2CUL A;  2X8C A;  5CKU A;  3UKF A;  4EMI A;  3IWA A;  1Y56 B;  5M0Z A;  3KA7 A;  4OPG A;  4CCR A;  1TDK A;  3NGC X;  1BGN A;  2RGH A;  1IUX A;  1JRZ A;  2CFY A;  4H4R A;  2XVH A;  2ZBW A;  5BRT A;  2YG5 A;  2Q0K A;  2DKH A;  1GSN A;  4JNQ A;  2WP9 A;  5EOW A;  2JKC A;  1PBE A;  5J60 A;  3NG7 X;  5HHF A;  1PBC A;  4U8J A;  3SFD A;  2WOI A;  1Q1R A;  3NRN A;  4EIP A;  2XLR A;  2GH5 A;  2Q6U A;  4IA6 A;  2WS3 A;  4X4J A;  2WEU A;  2Z5Y A;  1NEN A;  4GDP A;  3RED A;  1PXA A;  4H2P A;  2AQJ A;  3UKK A;  3UKA A;  2WP5 A;  3UOY A;  1YY5 A;  2GMH A;  2XLS A;  3CNJ A;  1RP0 A;  4Z43 A;  3QJ4 A;  3ATR A;  4I59 A;  4C5O A;  4CY6 A;  4CBQ A;  1PS9 A;  1D4E A;  2RAB A;  3BI4 A;  2E1M A;  1CF3 A;  2QCU A;  3AE2 A;  5JCM A;  2GF3 A;  3GDN A;  3VRB A;  2GV8 A;  5BUK A;  1NEK A;  4DSH A;  2BCG G;  3DK4 A;  4U8K A;  1FOH A;  2JB3 A;  4KX6 A;  4Z26 A;  2VZ2 A;  2XCG A;  1YQ3 A;  4O5U A;  3H8I A;  4EM4 A;  2C73 A;  4U8P A;  2R0C A;  4YKG A;  4B63 A;  4Z25 A;  4EQX A;  1GXF A;  1XHC A;  1GOS A;  3FBS A;  5FMH A;  2EQ8 A;  5JCN A;  4NTD A;  1DOB A;  4ZCD A;  4A6N A;  5KXJ A;  1FEA A;  5FS9 A;  4BJZ A;  1IUU A;  1S3E A;  1GND A;  2DKI A;  2GQF A;  4H4Y A;  3T37 A;  1CC4 A;  1P2E A;  4DSG A;  2EQ7 A;  5HY5 A;  2YLZ A;  2OLN A;  4M52 A;  2GR2 A;  1JU2 A;  2JB1 A;  3I3L A;  4OPL A;  4OVI A;  2YLS A;  4H4Z A;  3UKL A;  2WU5 A;  3AE7 A;  1Y56 A;  1CJC A;  2BK3 A;  4C3X A;  4ADW A;  4J2W A;  3DJG X;  4H4X A;  3PO7 A;  5EB4 A;  1VRQ B;  1F8W A;  1PXC A;  3AEA A;  3AEF A;  3BHK A;  3CTY A;  2YLX A;  4ICY A;  3AE6 A;  4JN9 A;  4EMJ A;  1JEH A;  2APG A;  1P2H A;  1W4X A;  1IJH A;  3NYE A;  1MOK A;  2C72 A;  1BKW A;  2YQU A;  3NH3 X;  4U8M A;  4WX1 A;  1GV4 A;  3UOV A;  2B7R A;  2VRM A;  4BK3 A;  1GRB A;  3DK8 A;  3QVP A;  1H84 A;  1GER A;  3BI2 A;  3DJD A;  4K8D A;  1ZOY A;  2A87 A;  2YG3 A;  4H4S A;  3AEE A;  4NEV A;  4U2L A;  5KWF A;  2YLR A;  3UKP A;  1E1N A;  3I6D A;  1CJ2 A;  2VVL A;  1DJQ A;  3SQP A;  4ZN0 A;  5KRQ A;  4LII A;  1ZK7 A;  3RP6 A;  3AD8 B;  1GRT A;  4J56 A;  3CN8 A;  2R0G A;  3RP8 A;  3AE4 A;  2C3D A;  2WU2 A;  3NHO X;  3CGB A;  2E5V A;  3AED A;  1E6E A;  3ATQ A;  2BS3 A;  3G5S A;  3GSI A;  4U8O A;  3V3N A;  2BK5 A;  1CHU A;  2OLO A;  1CC2 A;  2XLU A;  2GR1 A;  4NZH A;  2C66 A;  3V76 A;  2XVF A;  4O5Q A;  4Z2U A;  1BGJ A;  1CC6 A;  3AEG A;  2FJB A;  3NYC A;  3VRA A;  1CL0 A;  4JY2 A;  5ER0 A;  2R9Z A;  5JCL A;  1K0L A;  3UKH A;  2WPC A;  1H83 A;  4E0V A;  1Q9I A;  1ZP0 A;  2CDU A;  3NIX A;  1F6M A;  4B64 A;  1M64 A;  3AEB A;  3IC9 A;  2XVE A;  1GRG A;  3D8X A;  3UTH A;  3NN6 X;  4A9W A;  2JK6 A;  4ECH A;  4J33 A;  2A89 A;  3KU9 A;  5C2T A;  4PAA A;  2Z5X A;  2YAU A;  1GRE A;  2YLT A;  3GRT A;  2GEW A;  2WPF A;  2BA9 A;  1PXB A;  2F5Z A;  1LTX R;  3ADA B;  2B9Y A;  3QVR A;  4OPD A;  5EB5 A; 
#chains in the Genus database with same CATH topology
 5HYM A;  2VQB A;  4D04 A;  1FEB A;  3P4P A;  3QFB A;  1H6V A;  4GCM A;  2X8G A;  2ZZB A;  4EQW A;  3P4S A;  4CCQ A;  2XVI A;  3L1R A;  4LU6 A;  3B6D A;  3SXI A;  3UKQ A;  4YSZ A;  5BVA A;  1KDG A;  2BXR A;  4H4W A;  3G5R A;  1QLB A;  3SM8 A;  2FJE A;  3M0O A;  1NG4 A;  5J7X A;  1GTE A;  3PS9 A;  1EL5 A;  1GES A;  2JB2 A;  2FBW A;  4USQ A;  4B69 A;  2V6O A;  1HYU A;  3AE8 A;  2J3N A;  5HXI A;  2XFQ A;  2WQY A;  5U63 A;  1LQT A;  4H4U A;  4AP3 A;  2GAG B;  2XYO A;  3QSS A;  2BS4 A;  1PBB A;  1ZDL A;  2WOV A;  1VG9 A;  3JSK A;  1DNC A;  3IHG A;  1PBD A;  4YT0 A;  2C76 A;  4J31 A;  3UTF A;  1E1K A;  1TDO A;  3ITJ A;  4TM3 A;  1Q1W A;  4U8N A;  3URH A;  1QO8 A;  2TMD A;  2YLW A;  3GD4 A;  4UDR A;  1TDN A;  4EIQ A;  1D5T A;  2C75 A;  1GRH A;  2EQ6 A;  3LOV A;  3C4A A;  4U8I A;  4AOS A;  4Z2T A;  2VVM A;  4TM0 A;  2YM1 A;  3LAD A;  3ZYX A;  4CRT A;  1N4V A;  3QSM A;  3CND A;  5FS8 A;  3BNU A;  3NNE A;  1D7L A;  3CPH G;  3EF6 A;  4AP1 A;  4EM3 A;  1TYP A;  2Y6R A;  2ARD A;  2RGO A;  4C74 A;  1JOA A;  1CJ4 A;  1MO9 A;  3AB1 A;  4GAP A;  1VDC A;  2B7S A;  4EQR A;  2YWL A;  4J34 A;  4J57 A;  2FJA A;  1QJD A;  3C4N A;  3DME A;  4B65 A;  3KVE A;  5FS7 A;  1H86 A;  4G74 A;  2QAE A;  4C3Y A;  4LA1 A;  3AE3 A;  3DK9 A;  3UOX A;  3BI5 A;  1DXL A;  2YVG A;  5KMQ A;  1Y0P A;  3F8R A;  4Y4N A;  4U2T A;  2C70 A;  3CGE A;  4NEW A;  3NTD A;  3K30 A;  1SEZ A;  1TYT A;  2QA2 A;  4PAB A;  3SZF A;  4A5L A;  4B1B A;  2X99 A;  1H7W A;  4AOX A;  2IVE A;  4KPR A;  5KOW A;  1F8R A;  1X31 B;  4K2X A;  1CBO A;  2C67 A;  5KMS A;  4H50 A;  4YSY A;  2H88 A;  2B9X A;  2YVF A;  3CIR A;  1GTH A;  1NHR A;  2XLT A;  3K7T A;  1JNR A;  1N4U A;  3PVC A;  3C96 A;  1IUT A;  1FCD A;  1ZMC A;  2WOW A;  2HQM A;  3V3O A;  2GVC A;  2YM2 A;  4CNK A;  2ACZ A;  3UOZ A;  2WDV A;  1KNR A;  3NYF A;  3SZ0 A;  1B5Q A;  1GRF A;  2BC0 A;  1H82 A;  3EAN A;  4FX9 A;  2GQW A;  2BK4 A;  2GR0 A;  2TPR A;  1DJN A;  3SGL A;  2V3B A;  1YQ4 A;  2X50 A;  1OJT A;  3KPF A;  3T31 A;  4RG3 A;  2XFO A;  3DGZ A;  1K0I A;  2R46 A;  4WCT A;  4JY3 A;  3LJP A;  4OPI A;  3ALM A;  4EMJ A;  5C3J A;  1E7P A;  4Z44 A;  1XAN A;  1JRX A;  2Q0L A;  3CGD A;  1GAL A;  3GMB A;  3T0K A;  1NHS A;  1ZKQ A;  3DGH A;  3NK1 X;  3ABV A;  3AE5 A;  3P9U A;  3B3R A;  3AYJ A;  4HA6 A;  2RGJ A;  2XFN A;  3AD7 B;  3T2Y A;  4A99 A;  4XXG A;  4YTM A;  4X9N A;  3HZL A;  4CY8 A;  4X9M A;  1O5W A;  3DA1 A;  4OCG A;  3ALJ A;  3COX A;  2BYB A;  2XFU A;  4Y4L A;  2VRL A;  2A8X A;  3CNP A;  3LZX A;  5KVI A;  5KNL A;  1EL7 A;  1S2Y A;  4MJW A;  1F3P A;  2I0Z A;  3RHA A;  2NPX A;  3IF9 A;  1OJA A;  1LPF A;  1YKJ A;  3QFA A;  1B4V A;  1NPX A;  2XLP A;  3Q6J A;  4GDE A;  4YTP A;  4H4P A;  2VQ7 A;  1TDE A;  3D1C A;  3DJJ A;  2YG4 A;  4RSL A;  1PBF A;  1GPE A;  3NTA A;  5IPY A;  1REO A;  2B76 A;  3AYI A;  4Z2R A;  4N9X A;  1RSG A;  2PYX A;  4G9K A;  3SZC A;  2YR5 A;  2WPE A;  4DGK A;  2NVK X;  5L46 A;  1COY A;  1L9E A;  1S2Q A;  3UP4 A;  2YR6 A;  2H89 A;  3F8D A;  1MXT A;  5KVH A;  4GF7 A;  3SYI A;  1IUS A;  3CPI G;  3DJE A;  3VRD B;  2Y6Q A;  3L8K A;  4TM4 A;  3K7M X;  1ELI A;  3NN0 X;  1NHQ A;  3ICT A;  5U1O A;  3SFE A;  4K5S A;  3M13 A;  3F8P A;  4IA5 A;  4K7Z A;  4UDP A;  3FPZ A;  4GR1 A;  1VG0 A;  4B66 A;  1JNZ A;  3GWD A;  3ISH A;  1XPQ A;  4XWZ A;  1FEC A;  3LZW A;  3KLJ A;  1B37 A;  1PJ5 A;  3FIM B;  4K5R A;  4A7A A;  1Z6L A;  2GR3 A;  4HB9 A;  5KOX A;  1OJD A;  1NG3 A;  2XFP A;  2E4G A;  1GET A;  2XDO A;  3GRS A;  4Y4M A;  3RP7 A;  2C7G A;  3P4R A;  1RYI A;  1OJ9 A;  4AT0 A;  2BAC A;  3S5W A;  1NDA A;  3RNM A;  1DOE A;  4TLX A;  4G6G A;  4JDR A;  3VR8 A;  4CNJ A;  2YG7 A;  2CVJ A;  3K7Q X;  3OZ2 A;  2X8H A;  4IVM B;  2BS2 A;  4YWO A;  3AE9 A;  4D03 A;  2WHD A;  1DOC A;  4NTE A;  2GAH B;  1LQU A;  1N4W A;  3AXB A;  4YSX A;  3VR9 A;  1BWC A;  2R0P A;  2YG6 A;  2B9W A;  2GB0 A;  2IID A;  3H8L A;  3NLC A;  2V5Z A;  1JRY A;  4GAV A;  4FDC B;  2BCP A;  3CGC A;  4REK A;  1FL2 A;  1V59 A;  2VVL G;  4OPU A;  1S3B A;  2JAE A;  3KKJ A;  4G6H A;  4H4V A;  1LVL A;  1D4C A;  4Z24 A;  3UP5 A;  4YTN A;  4FK1 A;  3Q9T A;  4B68 A;  4H4T A;  1E1L A;  5TR3 A;  1EL9 A;  2C3C A;  4P9S A;  4NTC A;  3FG2 P;  4FK1 C;  2R45 A;  4YKF A;  4GUV A;  2GRT A;  1B8S A;  2W0H A;  1O94 A;  1PHH A;  3NK2 X;  3NKS A;  5DBJ A;  1IUW A;  4II2 A;  3CNT A;  3E1T A;  1ZX9 A;  4TLZ A;  5BUL A;  3O0H A;  1KSU A;  3QSE A;  4RG4 A;  4UDQ A;  4BK1 A;  4DNA A;  4H2R A;  4K22 A;  4OPC A;  1EBD A;  2Q7V A;  2O9Z A;  3GWF A;  1ZY8 A;  2BXS A;  2QA1 A;  3EPT A;  2WES A;  3KD9 A;  5GRT A;  1E39 A;  2AR8 A;  2VOU A;  4APN A;  3GYI A;  3ICS A;  2OAL A;  2ZZ0 A;  1YQZ A;  3AWI A;  3P4Q A;  1D4D A;  3SZW A;  3BHF A;  4BUR A;  4XWR A;  5FS6 A;  3OC4 A;  3UCL A;  1K4Q A;  5IQ1 A;  1VQW A;  2R4J A;  3KPK A;  3ZDN A;  3BNM A;  4TM1 A;  4A79 A;  1LJ1 A;  5LV9 A;  1H7X A;  1M6I A;  2UZZ A;  2WDQ A;  1PN0 A;  3II4 A;  2WP6 A;  1ZMD A;  3VQR A;  1PJ7 A;  2WBA A;  4U8L A;  4BV6 A;  3GD3 A;  4BK2 A;  1NAA A;  3LB8 A;  2BAB A;  1BF3 A;  1L9C A;  4I58 A;  2PHH A;  2XVJ A;  4BJY A;  4USR A;  4JQ9 A;  1N1P A;  1IUV A;  2FJD A;  1KNP A;  3EAO A;  2OAM A;  1PJ6 A;  1ZOV A;  1TRB A;  4H2N A;  4J36 A;  3WE0 A;  5CQF A;  3R9U A;  1F8S A;  1AOG A;  2GMJ A;  1KF6 A;  3LXD A;  3T2K A;  1E1M A;  2OA1 A;  1BZL A;  1LV0 A;  4EMW A;  1NHP A;  3AE1 A;  1EL8 A;  1GT8 A;  4ZCC A;  3G5Q A;  1PDH A;  5EBK A;  2C64 A;  2IVD A;  3HYW A;  3IHM A;  2WET A;  2V60 A;  2BC1 A;  1H81 A;  1O95 A;  3GYX A;  1L0V A;  3UTG A;  2EQ9 A;  1KSS A;  2YR4 A;  3NT6 A;  5M10 A;  2R4E A;  3AEC A;  3ICR A;  4AT2 A;  4H7U A;  3AYL A;  5KMR A;  1GEU A;  1XDI A;  3GDP A;  2WDR A;  1CJ3 A;  4A65 A;  3S61 A;  1ONF A;  2V3A A;  4B67 A;  2YVJ A;  4H2Q A;  4OPT A;  2JBV A;  3GMC A;  3UTE A;  2ZZC A;  1D7Y A;  3DH9 A;  3FMW A;  4A6N B;  5IQ4 A;  1DOD A;  2AAQ A;  3ALL A;  4IV9 A;  3T2Z A;  3CNS A;  2C65 A;  4UP3 A;  1GRA A;  1K0J A;  1L9D A;  5GSN A;  4GRT A;  4IVO B;  4YXD A;  5U25 A;  1KFY A;  4U2S A;  1OJC A;  3GYJ A;  4JNA A;  4EQS A;  5JCK A;  3P1W A;  3H4K A;  2X3N A;  3AD9 B;  3HYX A;  3M12 A;  4C77 A;  4YSH A;  5JCI A;  2V61 A;  3CPJ G;  3NK0 X;  4H4Q A;  1TDF A;  1UKV G;  2CUL A;  2X8C A;  5CKU A;  3UKF A;  4EMI A;  3IWA A;  1Y56 B;  5M0Z A;  3KA7 A;  4OPG A;  3SY4 A;  4CCR A;  1TDK A;  3NGC X;  1BGN A;  2RGH A;  1IUX A;  4NWZ A;  1JRZ A;  2CFY A;  4H4R A;  2XVH A;  2ZBW A;  5BRT A;  2YG5 A;  2Q0K A;  2DKH A;  1GSN A;  4JNQ A;  2WP9 A;  5EOW A;  2JKC A;  1PBE A;  5J60 A;  3NG7 X;  5HHF A;  1PBC A;  4U8J A;  3SFD A;  2WOI A;  1Q1R A;  3NRN A;  4EIP A;  2XLR A;  2GH5 A;  2Q6U A;  4IA6 A;  2WS3 A;  4X4J A;  2WEU A;  2Z5Y A;  1NEN A;  4GDP A;  3RED A;  1PXA A;  4H2P A;  2AQJ A;  3UKK A;  3UKA A;  2WP5 A;  3UOY A;  1YY5 A;  2GMH A;  2XLS A;  3CNJ A;  1RP0 A;  4Z43 A;  3QJ4 A;  3ATR A;  4I59 A;  2BRA A;  4C5O A;  4CY6 A;  4CBQ A;  1PS9 A;  1D4E A;  2RAB A;  3BI4 A;  2E1M A;  1CF3 A;  2QCU A;  3AE2 A;  5JCM A;  2GF3 A;  3GDN A;  3VRB A;  2GV8 A;  5BUK A;  1NEK A;  4DSH A;  2BCG G;  3DK4 A;  4U8K A;  1FOH A;  2JB3 A;  4KX6 A;  4Z26 A;  2VZ2 A;  2XCG A;  1YQ3 A;  4O5U A;  3H8I A;  4EM4 A;  2C73 A;  4U8P A;  2R0C A;  4YKG A;  4B63 A;  5KMP A;  4Z25 A;  4EQX A;  1GXF A;  1XHC A;  1GOS A;  3FBS A;  5FMH A;  2EQ8 A;  5JCN A;  4NTD A;  1DOB A;  4ZCD A;  4A6N A;  5KXJ A;  1FEA A;  5FS9 A;  4BJZ A;  1IUU A;  1S3E A;  1GND A;  2DKI A;  2GQF A;  4H4Y A;  3T37 A;  1CC4 A;  1P2E A;  4DSG A;  2EQ7 A;  5HY5 A;  2YLZ A;  2OLN A;  4M52 A;  2GR2 A;  1JU2 A;  2JB1 A;  3I3L A;  4OPL A;  4OVI A;  2YLS A;  4H4Z A;  3UKL A;  2WU5 A;  3AE7 A;  1Y56 A;  1CJC A;  2BK3 A;  4C3X A;  4ADW A;  4J2W A;  3DJG X;  4H4X A;  3PO7 A;  5EB4 A;  1VRQ B;  1F8W A;  1PXC A;  3AEA A;  3AEF A;  3BHK A;  3CTY A;  2YLX A;  3HYV A;  3AE6 A;  4ICY A;  4JN9 A;  1JEH A;  2APG A;  3T14 A;  1P2H A;  1W4X A;  1IJH A;  3NYE A;  3SX6 A;  1MOK A;  2C72 A;  1BKW A;  2YQU A;  3NH3 X;  4U8M A;  4WX1 A;  1GV4 A;  3UOV A;  2B7R A;  2VRM A;  4BK3 A;  1GRB A;  3DK8 A;  3QVP A;  1H84 A;  1GER A;  3BI2 A;  3DJD A;  4K8D A;  4NNJ A;  1ZOY A;  2A87 A;  2C4C A;  2YG3 A;  3AEE A;  4H4S A;  4NEV A;  4U2L A;  5KWF A;  2YLR A;  3UKP A;  1E1N A;  3I6D A;  1CJ2 A;  2VVL A;  1DJQ A;  3SQP A;  4ZN0 A;  5KRQ A;  4LII A;  1ZK7 A;  3RP6 A;  3AD8 B;  1GRT A;  4J56 A;  3CN8 A;  2R0G A;  3RP8 A;  3AE4 A;  2C3D A;  2WU2 A;  3NHO X;  3CGB A;  2E5V A;  3AED A;  1E6E A;  3ATQ A;  2BS3 A;  3G5S A;  3GSI A;  4U8O A;  3V3N A;  2BK5 A;  1CHU A;  2OLO A;  1CC2 A;  2XLU A;  4II3 A;  2GR1 A;  4NZH A;  2C66 A;  3V76 A;  2XVF A;  4O5Q A;  4Z2U A;  1BGJ A;  1CC6 A;  3AEG A;  2FJB A;  3NYC A;  3VRA A;  1CL0 A;  4JY2 A;  5ER0 A;  2R9Z A;  2BRY A;  5JCL A;  1K0L A;  3UKH A;  2WPC A;  1H83 A;  3CMM A;  4E0V A;  1Q9I A;  1ZP0 A;  2CDU A;  3NIX A;  1F6M A;  4B64 A;  1M64 A;  3AEB A;  3IC9 A;  2XVE A;  1GRG A;  3D8X A;  3UTH A;  3NN6 X;  4G73 A;  2JK6 A;  4A9W A;  4ECH A;  4J33 A;  2A89 A;  3KU9 A;  5C2T A;  4PAA A;  2Z5X A;  2YAU A;  1GRE A;  2YLT A;  3GRT A;  2GEW A;  2WPF A;  2BA9 A;  1PXB A;  2F5Z A;  1LTX R;  3ADA B;  2B9Y A;  3QVR A;  4OPD A;  5EB5 A; 
#chains in the Genus database with same CATH homology
 5HYM A;  2VQB A;  4D04 A;  1FEB A;  3P4P A;  3QFB A;  1H6V A;  4GCM A;  2X8G A;  2ZZB A;  4EQW A;  3P4S A;  4CCQ A;  2XVI A;  3L1R A;  4LU6 A;  3B6D A;  3SXI A;  3UKQ A;  4YSZ A;  5BVA A;  1KDG A;  2BXR A;  4H4W A;  3G5R A;  1QLB A;  3SM8 A;  2FJE A;  3M0O A;  1NG4 A;  5J7X A;  1GTE A;  3PS9 A;  1EL5 A;  1GES A;  2JB2 A;  2FBW A;  4USQ A;  4B69 A;  2V6O A;  1HYU A;  3AE8 A;  2J3N A;  5HXI A;  2XFQ A;  2WQY A;  5U63 A;  1LQT A;  4H4U A;  4AP3 A;  2GAG B;  2XYO A;  3QSS A;  2BS4 A;  1PBB A;  1ZDL A;  2WOV A;  1VG9 A;  3JSK A;  1DNC A;  3IHG A;  1PBD A;  4YT0 A;  2C76 A;  4J31 A;  3UTF A;  1E1K A;  1TDO A;  3ITJ A;  4TM3 A;  1Q1W A;  4U8N A;  3URH A;  1QO8 A;  2TMD A;  2YLW A;  3GD4 A;  4UDR A;  1TDN A;  4EIQ A;  1D5T A;  2C75 A;  1GRH A;  2EQ6 A;  3LOV A;  3C4A A;  4U8I A;  4AOS A;  4Z2T A;  2VVM A;  4TM0 A;  2YM1 A;  3LAD A;  3ZYX A;  4CRT A;  1N4V A;  3QSM A;  3CND A;  5FS8 A;  3BNU A;  3NNE A;  1D7L A;  3CPH G;  3EF6 A;  4AP1 A;  4EM3 A;  1TYP A;  2Y6R A;  2ARD A;  2RGO A;  4C74 A;  1JOA A;  1CJ4 A;  1MO9 A;  3AB1 A;  4GAP A;  1VDC A;  2B7S A;  4EQR A;  2YWL A;  4J34 A;  4J57 A;  2FJA A;  1QJD A;  3C4N A;  3DME A;  4B65 A;  3KVE A;  5FS7 A;  1H86 A;  4G74 A;  2QAE A;  4C3Y A;  4LA1 A;  3AE3 A;  3DK9 A;  3UOX A;  3BI5 A;  1DXL A;  2YVG A;  5KMQ A;  1Y0P A;  3F8R A;  4Y4N A;  4U2T A;  2C70 A;  3CGE A;  4NEW A;  3NTD A;  3K30 A;  1SEZ A;  1TYT A;  2QA2 A;  4PAB A;  3SZF A;  4A5L A;  4B1B A;  2X99 A;  1H7W A;  4AOX A;  2IVE A;  4KPR A;  5KOW A;  1F8R A;  1X31 B;  4K2X A;  1CBO A;  2C67 A;  5KMS A;  4H50 A;  4YSY A;  2H88 A;  2B9X A;  2YVF A;  3CIR A;  1GTH A;  1NHR A;  2XLT A;  3K7T A;  1JNR A;  1N4U A;  3PVC A;  3C96 A;  1IUT A;  1FCD A;  1ZMC A;  2WOW A;  2HQM A;  3V3O A;  2GVC A;  2YM2 A;  4CNK A;  2ACZ A;  3UOZ A;  2WDV A;  1KNR A;  3NYF A;  3SZ0 A;  1B5Q A;  1GRF A;  2BC0 A;  1H82 A;  3EAN A;  4FX9 A;  2GQW A;  2BK4 A;  2GR0 A;  2TPR A;  1DJN A;  3SGL A;  2V3B A;  1YQ4 A;  2X50 A;  1OJT A;  3KPF A;  3T31 A;  4RG3 A;  2XFO A;  3DGZ A;  1K0I A;  2R46 A;  4WCT A;  4JY3 A;  3LJP A;  4OPI A;  3ALM A;  4EMJ A;  5C3J A;  1E7P A;  4Z44 A;  1XAN A;  1JRX A;  2Q0L A;  3CGD A;  1GAL A;  3GMB A;  3T0K A;  1NHS A;  1ZKQ A;  3DGH A;  3NK1 X;  3ABV A;  3AE5 A;  3P9U A;  3B3R A;  3AYJ A;  4HA6 A;  2RGJ A;  2XFN A;  3AD7 B;  3T2Y A;  4A99 A;  4XXG A;  4YTM A;  4X9N A;  3HZL A;  4CY8 A;  4X9M A;  1O5W A;  3DA1 A;  4OCG A;  3ALJ A;  3COX A;  2BYB A;  2XFU A;  4Y4L A;  2VRL A;  2A8X A;  3CNP A;  3LZX A;  5KVI A;  5KNL A;  1EL7 A;  1S2Y A;  4MJW A;  1F3P A;  2I0Z A;  3RHA A;  2NPX A;  3IF9 A;  1OJA A;  1LPF A;  1YKJ A;  3QFA A;  1B4V A;  1NPX A;  2XLP A;  3Q6J A;  4GDE A;  4YTP A;  4H4P A;  2VQ7 A;  1TDE A;  3D1C A;  3DJJ A;  2YG4 A;  4RSL A;  1PBF A;  1GPE A;  3NTA A;  5IPY A;  1REO A;  2B76 A;  3AYI A;  4Z2R A;  4N9X A;  1RSG A;  2PYX A;  4G9K A;  3SZC A;  2YR5 A;  2WPE A;  4DGK A;  2NVK X;  5L46 A;  1COY A;  1L9E A;  1S2Q A;  3UP4 A;  2YR6 A;  2H89 A;  3F8D A;  1MXT A;  5KVH A;  4GF7 A;  3SYI A;  1IUS A;  3CPI G;  3DJE A;  3VRD B;  2Y6Q A;  3L8K A;  4TM4 A;  3K7M X;  1ELI A;  3NN0 X;  1NHQ A;  3ICT A;  5U1O A;  3SFE A;  4K5S A;  3M13 A;  3F8P A;  4IA5 A;  4K7Z A;  4UDP A;  3FPZ A;  4GR1 A;  1VG0 A;  4B66 A;  1JNZ A;  3GWD A;  3ISH A;  1XPQ A;  4XWZ A;  1FEC A;  3LZW A;  3KLJ A;  1B37 A;  1PJ5 A;  3FIM B;  4K5R A;  4A7A A;  1Z6L A;  2GR3 A;  4HB9 A;  5KOX A;  1OJD A;  1NG3 A;  2XFP A;  2E4G A;  1GET A;  2XDO A;  3GRS A;  4Y4M A;  3RP7 A;  2C7G A;  3P4R A;  1RYI A;  1OJ9 A;  4AT0 A;  2BAC A;  3S5W A;  1NDA A;  3RNM A;  1DOE A;  4TLX A;  4G6G A;  4JDR A;  3VR8 A;  4CNJ A;  2YG7 A;  2CVJ A;  3K7Q X;  3OZ2 A;  2X8H A;  4IVM B;  2BS2 A;  4YWO A;  3AE9 A;  4D03 A;  2WHD A;  1DOC A;  4NTE A;  2GAH B;  1LQU A;  1N4W A;  3AXB A;  4YSX A;  3VR9 A;  1BWC A;  2R0P A;  2YG6 A;  2B9W A;  2GB0 A;  2IID A;  3H8L A;  3NLC A;  2V5Z A;  1JRY A;  4GAV A;  4FDC B;  2BCP A;  3CGC A;  4REK A;  1FL2 A;  1V59 A;  2VVL G;  4OPU A;  1S3B A;  2JAE A;  3KKJ A;  4G6H A;  4H4V A;  1LVL A;  1D4C A;  4Z24 A;  3UP5 A;  4YTN A;  4FK1 A;  3Q9T A;  4B68 A;  4H4T A;  1E1L A;  5TR3 A;  1EL9 A;  2C3C A;  4P9S A;  4NTC A;  3FG2 P;  4FK1 C;  2R45 A;  4YKF A;  4GUV A;  2GRT A;  1B8S A;  2W0H A;  1O94 A;  1PHH A;  3NK2 X;  3NKS A;  5DBJ A;  1IUW A;  4II2 A;  3CNT A;  3E1T A;  1ZX9 A;  4TLZ A;  5BUL A;  3O0H A;  1KSU A;  3QSE A;  4RG4 A;  4UDQ A;  4BK1 A;  4DNA A;  4H2R A;  4K22 A;  4OPC A;  1EBD A;  2Q7V A;  2O9Z A;  3GWF A;  1ZY8 A;  2BXS A;  2QA1 A;  3EPT A;  2WES A;  3KD9 A;  5GRT A;  1E39 A;  2AR8 A;  2VOU A;  4APN A;  3GYI A;  3ICS A;  2OAL A;  2ZZ0 A;  1YQZ A;  3AWI A;  3P4Q A;  1D4D A;  3SZW A;  3BHF A;  4BUR A;  4XWR A;  5FS6 A;  3OC4 A;  3UCL A;  1K4Q A;  5IQ1 A;  1VQW A;  2R4J A;  3KPK A;  3ZDN A;  3BNM A;  4TM1 A;  4A79 A;  1LJ1 A;  5LV9 A;  1H7X A;  1M6I A;  2UZZ A;  2WDQ A;  1PN0 A;  3II4 A;  2WP6 A;  1ZMD A;  3VQR A;  1PJ7 A;  2WBA A;  4U8L A;  4BV6 A;  3GD3 A;  4BK2 A;  1NAA A;  3LB8 A;  2BAB A;  1BF3 A;  1L9C A;  4I58 A;  2PHH A;  2XVJ A;  4BJY A;  4USR A;  4JQ9 A;  1N1P A;  1IUV A;  2FJD A;  1KNP A;  3EAO A;  2OAM A;  1PJ6 A;  1ZOV A;  1TRB A;  4H2N A;  4J36 A;  3WE0 A;  5CQF A;  3R9U A;  1F8S A;  1AOG A;  2GMJ A;  1KF6 A;  3LXD A;  3T2K A;  1E1M A;  2OA1 A;  1BZL A;  1LV0 A;  4EMW A;  1NHP A;  3AE1 A;  1EL8 A;  1GT8 A;  4ZCC A;  3G5Q A;  1PDH A;  5EBK A;  2C64 A;  2IVD A;  3HYW A;  3IHM A;  2WET A;  2V60 A;  2BC1 A;  1H81 A;  1O95 A;  3GYX A;  1L0V A;  3UTG A;  2EQ9 A;  1KSS A;  2YR4 A;  3NT6 A;  5M10 A;  2R4E A;  3AEC A;  3ICR A;  4AT2 A;  4H7U A;  3AYL A;  5KMR A;  1GEU A;  1XDI A;  3GDP A;  2WDR A;  1CJ3 A;  4A65 A;  3S61 A;  1ONF A;  2V3A A;  4B67 A;  2YVJ A;  4H2Q A;  4OPT A;  2JBV A;  3GMC A;  3UTE A;  2ZZC A;  1D7Y A;  3DH9 A;  3FMW A;  4A6N B;  5IQ4 A;  1DOD A;  2AAQ A;  3ALL A;  4IV9 A;  3T2Z A;  3CNS A;  2C65 A;  4UP3 A;  1GRA A;  1K0J A;  1L9D A;  5GSN A;  4GRT A;  4IVO B;  4YXD A;  5U25 A;  1KFY A;  4U2S A;  1OJC A;  3GYJ A;  4JNA A;  4EQS A;  5JCK A;  3P1W A;  3H4K A;  2X3N A;  3AD9 B;  3HYX A;  3M12 A;  4C77 A;  4YSH A;  5JCI A;  2V61 A;  3CPJ G;  3NK0 X;  4H4Q A;  1TDF A;  1UKV G;  2CUL A;  2X8C A;  5CKU A;  3UKF A;  4EMI A;  3IWA A;  1Y56 B;  5M0Z A;  3KA7 A;  4OPG A;  3SY4 A;  4CCR A;  1TDK A;  3NGC X;  1BGN A;  2RGH A;  1IUX A;  4NWZ A;  1JRZ A;  2CFY A;  4H4R A;  2XVH A;  2ZBW A;  5BRT A;  2YG5 A;  2Q0K A;  2DKH A;  1GSN A;  4JNQ A;  2WP9 A;  5EOW A;  2JKC A;  1PBE A;  5J60 A;  3NG7 X;  5HHF A;  1PBC A;  4U8J A;  3SFD A;  2WOI A;  1Q1R A;  3NRN A;  4EIP A;  2XLR A;  2GH5 A;  2Q6U A;  4IA6 A;  2WS3 A;  4X4J A;  2WEU A;  2Z5Y A;  1NEN A;  4GDP A;  3RED A;  1PXA A;  4H2P A;  2AQJ A;  3UKK A;  3UKA A;  2WP5 A;  3UOY A;  1YY5 A;  2GMH A;  2XLS A;  3CNJ A;  1RP0 A;  4Z43 A;  3QJ4 A;  3ATR A;  4I59 A;  2BRA A;  4C5O A;  4CY6 A;  4CBQ A;  1PS9 A;  1D4E A;  2RAB A;  3BI4 A;  2E1M A;  1CF3 A;  2QCU A;  3AE2 A;  5JCM A;  2GF3 A;  3GDN A;  3VRB A;  2GV8 A;  5BUK A;  1NEK A;  4DSH A;  2BCG G;  3DK4 A;  4U8K A;  1FOH A;  2JB3 A;  4KX6 A;  4Z26 A;  2VZ2 A;  2XCG A;  1YQ3 A;  4O5U A;  3H8I A;  4EM4 A;  2C73 A;  4U8P A;  2R0C A;  4YKG A;  4B63 A;  5KMP A;  4Z25 A;  4EQX A;  1GXF A;  1XHC A;  1GOS A;  3FBS A;  5FMH A;  2EQ8 A;  5JCN A;  4NTD A;  1DOB A;  4ZCD A;  4A6N A;  5KXJ A;  1FEA A;  5FS9 A;  4BJZ A;  1IUU A;  1S3E A;  1GND A;  2DKI A;  2GQF A;  4H4Y A;  3T37 A;  1CC4 A;  1P2E A;  4DSG A;  2EQ7 A;  5HY5 A;  2YLZ A;  2OLN A;  4M52 A;  2GR2 A;  1JU2 A;  2JB1 A;  3I3L A;  4OPL A;  4OVI A;  2YLS A;  4H4Z A;  3UKL A;  2WU5 A;  3AE7 A;  1Y56 A;  1CJC A;  2BK3 A;  4C3X A;  4ADW A;  4J2W A;  3DJG X;  4H4X A;  3PO7 A;  5EB4 A;  1VRQ B;  1F8W A;  1PXC A;  3AEA A;  3AEF A;  3BHK A;  3CTY A;  2YLX A;  3HYV A;  3AE6 A;  4ICY A;  4JN9 A;  1JEH A;  2APG A;  3T14 A;  1P2H A;  1W4X A;  1IJH A;  3NYE A;  3SX6 A;  1MOK A;  2C72 A;  1BKW A;  2YQU A;  3NH3 X;  4U8M A;  4WX1 A;  1GV4 A;  3UOV A;  2B7R A;  2VRM A;  4BK3 A;  1GRB A;  3DK8 A;  3QVP A;  1H84 A;  1GER A;  3BI2 A;  3DJD A;  4K8D A;  4NNJ A;  1ZOY A;  2A87 A;  2C4C A;  2YG3 A;  3AEE A;  4H4S A;  4NEV A;  4U2L A;  5KWF A;  2YLR A;  3UKP A;  1E1N A;  3I6D A;  1CJ2 A;  2VVL A;  1DJQ A;  3SQP A;  4ZN0 A;  5KRQ A;  4LII A;  1ZK7 A;  3RP6 A;  3AD8 B;  1GRT A;  4J56 A;  3CN8 A;  2R0G A;  3RP8 A;  3AE4 A;  2C3D A;  2WU2 A;  3NHO X;  3CGB A;  2E5V A;  3AED A;  1E6E A;  3ATQ A;  2BS3 A;  3G5S A;  3GSI A;  4U8O A;  3V3N A;  2BK5 A;  1CHU A;  2OLO A;  1CC2 A;  2XLU A;  4II3 A;  2GR1 A;  4NZH A;  2C66 A;  3V76 A;  2XVF A;  4O5Q A;  4Z2U A;  1BGJ A;  1CC6 A;  3AEG A;  2FJB A;  3NYC A;  3VRA A;  1CL0 A;  4JY2 A;  5ER0 A;  2R9Z A;  2BRY A;  5JCL A;  1K0L A;  3UKH A;  2WPC A;  1H83 A;  3CMM A;  4E0V A;  1Q9I A;  1ZP0 A;  2CDU A;  3NIX A;  1F6M A;  4B64 A;  1M64 A;  3AEB A;  3IC9 A;  2XVE A;  1GRG A;  3D8X A;  3UTH A;  3NN6 X;  4G73 A;  2JK6 A;  4A9W A;  4ECH A;  4J33 A;  2A89 A;  3KU9 A;  5C2T A;  4PAA A;  2Z5X A;  2YAU A;  1GRE A;  2YLT A;  3GRT A;  2GEW A;  2WPF A;  2BA9 A;  1PXB A;  2F5Z A;  1LTX R;  3ADA B;  2B9Y A;  3QVR A;  4OPD A;  5EB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...