3K7QX

Crystal structure of substrate-bound 6-hydroxy-l-nicotine oxidase from arthrobacter nicotinovorans
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 147
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7qX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7qX02
2WPEA 3NIXA 1E6EA 1K0JA 2GRTA 2VOUA 1PXAA 2GR0A 2YVFA 3GYJA 4C3XA 5HXIA 2VQ7A 2R4EA 5EB5A 4UDQA 3QVPA 5TR3A 2Q7VA 3DH9A 3LOVA 2YLSA 2XLPA 1NG3A 1N1PA 3LXDA 1DXLA 2GAGB 3QSSA 1TDFA 2FJDA 4OPUA 2XVEA 4CRTA 1BF3A 2VZ2A 1PDHA 4H50A 2J3NA 3L8KA 2BC1A 1XDIA 4TLZA 2JB2A 2B7SA 3CGDA 3BI2A 3FG2P 4H4TA 3SQPA 4A5LA 1Y56A 2XVHA 1DOBA 2FJBA 4XWZA 3DA1A 5KOXA 4BJZA 3H8IA 5GSNA 3GYIA 2GR2A 3ICRA 1LPFA 1GETA 1NHPA 3CNPA 2C3CA 5IQ1A 2YG7A 1OJCA 2ZZBA 5CKUA 1CJCA 2WDVA 2A8XA 3T37A 2VRMA 3UTGA 3Q9TA 4LA1A 2C67A 4GR1A 1KSSA 1JEHA 2EQ6A 5BUKA 4X4JA 1VQWA 3R9UA 1H81A 2JB3A 2B9WA 2JK6A 2B7RA 4HB9A 4H4YA 4LIIA 3B6DA 4Y4LA 1PBEA 2BK3A 2XVIA 3BHKA 3L1RA 2DKHA 1ZP0A 4YSZA 5BRTA 4D03A 4J31A 4Z25A 2YLRA 4EM3A 1GALA 2R9ZA 3S61A 4B65A 1EL5A 3AEGA 3RP8A 2JBVA 5FS8A 3ADAB 1GTHA 1N4VA 2VQBA 1IUWA 1S3BA 3AE6A 3QFAA 1ZY8A 5HY5A 1YKJA 1ZMDA 2X50A 3AEBA 1IUVA 3VR8A 2C72A 3Q6JA 3ITJA 4OPIA 2BS3A 3ABVA 3QVRA 3DK4A 4H2NA 4U8KA 2NVKX 3UOVA 3LJPA 4GUVA 3AYLA 4Z2TA 3IC9A 3AE5A 2BC0A 4NEVA 4EQXA 2WPCA 2YG6A 4YSHA 1DOEA 1VDCA 2XFNA 3P4SA 3VRBA 4IVMB 3F8RA 3BI5A 4Z26A 1BGJA 3CNJA 1D4CA 4ICYA 3KKJA 4NZHA 4EQSA 3REDA 4TM1A 1ELIA 1ZX9A 2R4JA 2WOWA 3DGZA 2WEUA 3QSMA 4X9NA 2Y6QA 3G5SA 4REKA 4EM4A 3H4KA 3UCLA 3NYCA 3V3NA 5KXJA 1JRYA 4CY6A 4BV6A 1TDKA 1L9DA 2BACA 3AEEA 4Y4MA 3UTFA 3AEFA 3RNMA 3ZYXA 4NTCA 4B1BA 3BNUA 3QSEA 4RSLA 1COYA 5KVIA 1H6VA 4B69A 1B5QA 3CPJG 1GSNA 1CC4A 1K0IA 4LU6A 4BURA 2YR5A 3GMCA 2IVDA 2Q6UA 4AP3A 3KD9A 5KOWA 4JY2A 4A7AA 5DBJA 4A79A 2QA2A 4CNJA 2TMDA 3CGCA 3ISHA 4GDPA 1NHSA 4J57A 3NYEA 4ZCCA 1DJQA 1PJ7A 5JCMA 3H8LA 3IWAA 2XLUA 1KF6A 2JAEA 1AOGA 2QA1A 2QCUA 4U2TA 4WX1A 1Q1WA 1PBFA 1L9EA 2V5ZA 5J60A 3GWDA 2AR8A 2B76A 2UZZA 3DJJA 1KNRA 3DK8A 4OPGA 5JCNA 4NTEA 2CFYA 1F8WA 2BS4A 5EOWA 2YAUA 4EMJA 1H84A 3BNMA 4K22A 1B8SA 1GRBA 1VRQB 2VRLA 3CNSA 4YTPA 2RGHA 1PBCA 3ICSA 3EAOA 4RG4A 5BULA 2OLNA 1FEAA 4UDRA 4A65A 2YR6A 1ZK7A 2V6OA 3URHA 2I0ZA 3KPFA 3UKHA 1JRZA 1PJ6A 4ADWA 2BXSA 1LTXR 3ALMA 1QO8A 2YG4A 4U8IA 3RP7A 1NHQA 1W4XA 2GB0A 2YG3A 2X8CA 4XWRA 1E1LA 5M0ZA 2WS3A 3ALJA 1NENA 5LV9A 1EL8A 2ZZCA 1PXCA 3ATQA 2GMHA 3ALLA 4P9SA 4YXDA 4U8MA 1M6IA 3DMEA 2GAHB 5U63A 3F8PA 2ZBWA 2WP6A 1Y56B 3NT6A 3SFDA 3DGHA 3GRTA 3D1CA 3HZLA 1PHHA 1L0VA 2IVEA 3AE1A 2VVLA 3NTDA 3AYIA 1O95A 4Z2RA 2GQWA 1O5WA 3UTEA 3KVEA 3O0HA 3UKFA 3E1TA 1NG4A 3IHMA 4JQ9A 1Q1RA 2NPXA 1KSUA 1IUXA 2WESA 1GXFA 2AQJA 2Z5YA 1NEKA 4DSHA 5EB4A 3K7QX 3GSIA 4M52A 3AD7B 3ATRA 3NG7X 4CCRA 4A9WA 2WP9A 2O9ZA 4PABA 4WCTA 1FCDA 3AE9A 4K8DA 3UKKA 4H4ZA 1VG0A 1TDEA 2GH5A 2OALA 2HQMA 4FX9A 3G5QA 1F8SA 2GMJA 4MJWA 3OC4A 2XFQA 3COXA 5FS7A 2Y6RA 1E1KA 5IPYA 4JNAA 4YWOA 2Q0KA 2XDOA 3NKSA 3AB1A 1H82A 1PJ5A 2GEWA 3IF9A 4H4QA 1GT8A 2YLTA 1OJ9A 2RGOA 3LB8A 1GREA 3AWIA 4JDRA 1GESA 1BGNA 1H83A 4U8JA 1OJTA 1CBOA 1CL0A 2E5VA 3C4AA 5C3JA 4BK2A 2RABA 4U2LA 4ZCDA 2YWLA 5GRTA 4CY8A 3NK0X 1XPQA 2XVFA 4TM0A 3UOXA 2CVJA 4JNQA 2APGA 3DJDA 3NYFA 4A99A 3CPHG 2B9XA 2C3DA 3FIMB 3LADA 4FK1C 2XFPA 4H4XA 4K5SA 2C66A 4N9XA 4B67A 3AEAA 4K2XA 2GVCA 4C74A 1GRAA 1GRTA 2FBWA 1F3PA 3P4PA 1B4VA 1K0LA 1YQ4A 3PS9A 2GR3A 4J34A 2YR4A 1TYTA 4IA6A 3ZDNA 3DJEA 1BWCA 3UKPA 1CJ4A 5HHFA 1YQZA 1REOA 4IV9A 3GD4A 3AE3A 4B66A 1LQUA 4H2PA 5M10A 1JNRA 2ACZA 2YLWA 4OPTA 1DNCA 3S5WA 4EMWA 2WP5A 1IUUA 4HA6A 2H89A 1MXTA 3VQRA 1QLBA 4BK1A 2WU5A 4CCQA 3EF6A 5FMHA 1ZOYA 1VG9A 1NPXA 1Z6LA 2R0PA 2C76A 4B64A 4JN9A 2R0GA 2XCGA 1RSGA 1BKWA 1FECA 1HYUA 2PYXA 2VVLG 3P9UA 3BHFA 2FJAA 4DGKA 4U2SA 4YSXA 1EBDA 2IIDA 3PVCA 1OJDA 2EQ7A 4K5RA 4OPLA 4UP3A 2QAEA 2RGJA 3UKLA 3UP5A 4OPDA 4CNKA 5BVAA 3CN8A 3NH3X 3UKAA 1TYPA 2WU2A 4TLXA 2TPRA 4H4VA 4XXGA 3UOZA 2GF3A 2XFUA 4DSGA 4H4PA 2WHDA 4IVOB 5FS6A 1H7WA 3K7MX 1CF3A 1TDNA 3EANA 2DKIA 3UOYA 1GPEA 5JCLA 3K30A 3NTAA 2OAMA 2R46A 4EIPA 1CC2A 2WPFA 1B37A 1Q9IA 4BJYA 2XLTA 3G5RA 1GOSA 1JNZA 3V76A 3F8DA 1S2QA 3II4A 4AP1A 4I58A 4A6NA 4RG3A 4A6NB 2VVMA 1DODA 1X31B 3GD3A 2F5ZA 3KLJA 4AOSA 1Y0PA 5EBKA 5JCIA 1TRBA 2GR1A 3PO7A 2V3BA 1YY5A 4AT2A 1L9CA 4U8NA 3UKQA 1JRXA 3NHOX 3UP4A 4EIQA 5U1OA 2WOIA 4H4UA 1XHCA 2YVGA 2WOVA 3BI4A 3VRDB 4AOXA 1UKVG 4YTNA 3NK2X 3CNTA 4H2RA 3GDPA 3AYJA 4J56A 2B9YA 4GDEA 5KWFA 1KNPA 1CC6A 4D04A 1KFYA 2JB1A 4H2QA 1E1MA 4YKFA 4U8OA 3SM8A 2C73A 4Z2UA 4TM3A 2XLRA 1LV0A 1LJ1A 1KDGA 4DNAA 5KVHA 1S2YA 1D4EA 2YLXA 1EL7A 1GEUA 4H4SA 4PAAA 3EPTA 1D5TA 3M0OA 1D7LA 4NEWA 2XLSA 1CJ2A 1D4DA 3C96A 3DK9A 1PBDA 3NN6X 5IQ4A 4J2WA 1DOCA 2BS2A 1P2HA 2EQ9A 3K7TA 2R45A 4K7ZA 4AT0A 1OJAA 2OA1A 1P2EA 3OZ2A 3AE7A 1V59A 3GRSA 5JCKA 4GCMA 2YG5A 3KU9A 3SGLA 1FOHA 3M13A 4APNA 2C7GA 2X3NA 2ZZ0A 3M12A 3QJ4A 3GDNA 4USRA 1S3EA 1PBBA 2EQ8A 1EL9A 3LZXA 1GNDA 4KPRA 1CHUA 2CULA 3NNEA 4Z43A 1O94A 1GERA 2E1MA 4H4RA 3SFEA 1TDOA 2H88A 2BA9A 3NK1X 4GRTA 3FMWA 3FPZA 1XANA 3AE4A 4J33A 3AE8A 1H86A 4BK3A 4OCGA 2YM1A 2YVJA 3QFBA 3AD9B 4B63A 1F6MA 4ZN0A 5HYMA 1NHRA 3I3LA 1K4QA 5J7XA 1LVLA 4GF7A 4UDPA 1ZDLA 3VRAA 1RP0A 2BYBA 3VR9A 2C64A 1YQ3A 1GTEA 4B68A 4C77A 3CIRA 4USQA 1BZLA 3FBSA 4TM4A 2FJEA 3AECA 3P1WA 3CTYA 1RYIA 3B3RA 4YSYA 5CQFA 4U8PA 4EQWA 3AEDA 1H7XA 2R0CA 3GMBA 4Z24A 1IUTA 3CNDA 1CJ3A 2PHHA 2BXRA 3GWFA 1N4UA 3RHAA 4ECHA 5KRQA 2YLZA 1ONFA 4J36A 1SEZA 3CPIG 1LQTA 1GRGA 1E1NA 4O5UA 4EMIA 4EQRA 2Z5XA 2BCPA 1PS9A 1E7PA 1E39A 3AD8B 3I6DA 1M64A 3NRNA 2BCGG 1GRHA 2BK4A 2XFOA 4U8LA 1JU2A 5C2TA 2C65A 2V60A 3P4QA 2XVJA 2YQUA 3ICTA 4OVIA 3CGEA 4YT0A 5ER0A 1F8RA 4E0VA 1MO9A 1NAAA 1PN0A 1ZOVA 4NTDA 2V3AA 1N4WA 5U25A 4KX6A 3DJGX 2X8GA 4H7UA 4Z44A 2WETA 3NLCA 4CBQA 1IUSA 3RP6A 3WE0A 4C5OA 1PXBA 3UTHA 4O5QA 2GV8A 2A87A 4JY3A 3AE2A 4OPCA 2E4GA 2WQYA 2BK5A 2ARDA 5L46A 3D8XA 2W0HA 2OLOA 2WBAA 5FS9A 1FEBA 3LZWA 4FDCB 1FL2A 3V3OA 2CDUA 2BABA 3NN0X 2V61A 2C75A 2X8HA 2AAQA 4FK1A 2GQFA 3IHGA 1JOAA 3KA7A 4H4WA 4YKGA 1GRFA 3AXBA 2C70A 2Q0LA 2YM2A 1MOKA 3JSKA 3P4RA 3NGCX 1D7YA 1ZKQA 2WDQA 1GV4A 1ZMCA 2WDRA 4YTMA 1DJNA 4Y4NA 2JKCA 3CGBA 3C4NA 2A89A 4IA5A 4I59A 1NDAA 2X99A 1IJHA 4X9MA 2XYOA 1QJDA 4C3YA
chains in the Genus database with same CATH superfamily
2WPEA 3NIXA 1E6EA 1K0JA 2GRTA 2VOUA 1PXAA 2GR0A 2YVFA 3GYJA 3GYXA 4C3XA 5HXIA 2VQ7A 2R4EA 5EB5A 4UDQA 3QVPA 5TR3A 2Q7VA 3DH9A 3LOVA 2YLSA 2XLPA 1NG3A 3HYVA 1N1PA 3LXDA 1DXLA 2GAGB 3QSSA 4NWZA 1TDFA 2FJDA 4OPUA 2XVEA 4CRTA 1BF3A 2VZ2A 1PDHA 4H50A 2J3NA 3L8KA 2BC1A 1XDIA 4TLZA 2JB2A 2B7SA 3CGDA 3BI2A 3FG2P 4H4TA 3SQPA 3SY4A 1Y56A 4A5LA 2XVHA 1DOBA 2FJBA 4XWZA 3DA1A 5KOXA 4BJZA 3H8IA 5GSNA 3GYIA 2GR2A 3ICRA 1LPFA 1GETA 3SXIA 1NHPA 3CNPA 2C3CA 5IQ1A 2YG7A 1OJCA 2ZZBA 5CKUA 1CJCA 2WDVA 2A8XA 3T37A 2VRMA 3UTGA 3Q9TA 4LA1A 2C67A 4GR1A 1KSSA 1JEHA 2EQ6A 5BUKA 4X4JA 1VQWA 3R9UA 1H81A 2JB3A 2B9WA 2JK6A 2B7RA 4HB9A 4H4YA 4LIIA 3B6DA 4Y4LA 1PBEA 2BK3A 2XVIA 3BHKA 3L1RA 2DKHA 1ZP0A 4YSZA 5BRTA 3HYWA 4D03A 4J31A 4Z25A 2YLRA 4EM3A 1GALA 2R9ZA 3S61A 2BRAA 4B65A 1EL5A 3AEGA 3RP8A 2JBVA 5FS8A 3ADAB 1GTHA 1N4VA 2VQBA 1IUWA 1S3BA 3AE6A 3QFAA 1ZY8A 3SZFA 5HY5A 1YKJA 1ZMDA 2X50A 3CMMA 3AEBA 1IUVA 3VR8A 2C72A 3Q6JA 3ITJA 4OPIA 2BS3A 3ABVA 3QVRA 3DK4A 4H2NA 4U8KA 2NVKX 3UOVA 3LJPA 4GUVA 3AYLA 4Z2TA 3IC9A 3AE5A 2BC0A 4NEVA 4EQXA 2WPCA 2YG6A 4YSHA 1DOEA 1VDCA 2XFNA 3P4SA 3VRBA 4IVMB 3F8RA 3BI5A 4Z26A 4G74A 1BGJA 3CNJA 1D4CA 5KMQA 4ICYA 3KKJA 4NZHA 4EQSA 3REDA 4TM1A 1ELIA 1ZX9A 2R4JA 2WOWA 3DGZA 2WEUA 3QSMA 4X9NA 2Y6QA 3G5SA 4REKA 4EM4A 3H4KA 3UCLA 3NYCA 3V3NA 5KXJA 1JRYA 4CY6A 4BV6A 1TDKA 1L9DA 2BACA 3AEEA 4Y4MA 3UTFA 3AEFA 3RNMA 3ZYXA 4NTCA 4B1BA 3BNUA 3QSEA 4RSLA 1COYA 5KVIA 1H6VA 4B69A 1B5QA 3CPJG 1GSNA 1CC4A 1K0IA 4LU6A 4BURA 2YR5A 3GMCA 2IVDA 2Q6UA 4AP3A 3KD9A 5KOWA 4JY2A 4A7AA 5DBJA 4A79A 2QA2A 4CNJA 2TMDA 3CGCA 3ISHA 4GDPA 1NHSA 4J57A 3NYEA 4ZCCA 1DJQA 1PJ7A 5JCMA 3H8LA 3T14A 3IWAA 2XLUA 1KF6A 2JAEA 1AOGA 2QA1A 2QCUA 4G6GA 4U2TA 4WX1A 1Q1WA 1PBFA 4GAPA 1L9EA 2V5ZA 5J60A 3GWDA 2AR8A 2B76A 2UZZA 3DJJA 1KNRA 3DK8A 4OPGA 5JCNA 4NTEA 2CFYA 1F8WA 2BS4A 5EOWA 2YAUA 3SYIA 4EMJA 1H84A 3BNMA 4K22A 1B8SA 1GRBA 1VRQB 2VRLA 3CNSA 4YTPA 2RGHA 1PBCA 3ICSA 3EAOA 4RG4A 5BULA 2OLNA 1FEAA 4UDRA 4A65A 2YR6A 1ZK7A 2V6OA 3URHA 2I0ZA 3KPFA 3UKHA 1JRZA 1PJ6A 4ADWA 2BXSA 1LTXR 3ALMA 1QO8A 2YG4A 4U8IA 3RP7A 1NHQA 1W4XA 2GB0A 2YG3A 2X8CA 4XWRA 1E1LA 5M0ZA 2WS3A 3ALJA 1NENA 5LV9A 1EL8A 2ZZCA 1PXCA 3ATQA 2GMHA 4II3A 3ALLA 4P9SA 4YXDA 4U8MA 1M6IA 3DMEA 2GAHB 5U63A 3F8PA 2ZBWA 2WP6A 1Y56B 3NT6A 3SFDA 3DGHA 3GRTA 3D1CA 3HZLA 1PHHA 1L0VA 2IVEA 3AE1A 2VVLA 3NTDA 3AYIA 1O95A 4Z2RA 2GQWA 1O5WA 3UTEA 3KVEA 3O0HA 3UKFA 3E1TA 1NG4A 3IHMA 4JQ9A 1Q1RA 2NPXA 1KSUA 1IUXA 2WESA 1GXFA 2AQJA 2Z5YA 1NEKA 4DSHA 5EB4A 5KMPA 3K7QX 4G6HA 5KNLA 3GSIA 4M52A 3AD7B 3ATRA 3NG7X 4CCRA 4A9WA 5KMSA 2WP9A 2O9ZA 4PABA 4WCTA 1FCDA 3AE9A 4K8DA 3UKKA 4H4ZA 1VG0A 1TDEA 2GH5A 2OALA 3SZCA 2HQMA 4FX9A 3G5QA 1F8SA 2GMJA 4MJWA 3OC4A 2XFQA 3COXA 5FS7A 2Y6RA 1E1KA 5IPYA 4JNAA 4YWOA 2Q0KA 2XDOA 3NKSA 3T0KA 3AB1A 1H82A 1PJ5A 2GEWA 3IF9A 4H4QA 1GT8A 2YLTA 1OJ9A 2RGOA 3LB8A 1GREA 3AWIA 4JDRA 1GESA 1BGNA 1H83A 4U8JA 1OJTA 1CBOA 1CL0A 2E5VA 3C4AA 5C3JA 4BK2A 3HYXA 2RABA 4U2LA 4ZCDA 2YWLA 5GRTA 4CY8A 3NK0X 1XPQA 2XVFA 4TM0A 3UOXA 2CVJA 4JNQA 2APGA 3DJDA 3NYFA 4A99A 3CPHG 2B9XA 2C3DA 3FIMB 3LADA 4FK1C 2XFPA 4H4XA 4K5SA 2C66A 4N9XA 4B67A 3AEAA 4K2XA 2GVCA 4C74A 1GRAA 1GRTA 2FBWA 1F3PA 3P4PA 1B4VA 1K0LA 1YQ4A 3PS9A 2GR3A 4J34A 2YR4A 1TYTA 4IA6A 3ZDNA 3DJEA 1BWCA 3UKPA 1CJ4A 5HHFA 1YQZA 1REOA 4IV9A 3GD4A 3AE3A 3SX6A 4B66A 1LQUA 4H2PA 5M10A 1JNRA 2ACZA 2YLWA 4OPTA 1DNCA 3S5WA 4EMWA 2WP5A 1IUUA 4HA6A 2H89A 1MXTA 3VQRA 1QLBA 3T2YA 2WU5A 4BK1A 4CCQA 3EF6A 5FMHA 1ZOYA 1VG9A 1NPXA 1Z6LA 2R0PA 2C76A 4B64A 4JN9A 2R0GA 2XCGA 1RSGA 1BKWA 1FECA 1HYUA 2PYXA 2VVLG 3P9UA 3KPKA 3BHFA 2FJAA 4DGKA 4U2SA 4YSXA 1EBDA 2IIDA 3PVCA 1OJDA 2EQ7A 4K5RA 4OPLA 4UP3A 2QAEA 2RGJA 3UKLA 3UP5A 4OPDA 4CNKA 5BVAA 3CN8A 3NH3X 3UKAA 1TYPA 2WU2A 4TLXA 2TPRA 4H4VA 4XXGA 3UOZA 2GF3A 2XFUA 4DSGA 4H4PA 2WHDA 4IVOB 2C4CA 5FS6A 1H7WA 3K7MX 1CF3A 1TDNA 3EANA 2DKIA 3UOYA 1GPEA 5JCLA 3K30A 3NTAA 2OAMA 2R46A 4EIPA 1CC2A 2WPFA 1B37A 1Q9IA 4BJYA 2XLTA 3G5RA 1GOSA 1JNZA 3V76A 3F8DA 1S2QA 3II4A 4AP1A 4I58A 4A6NA 4RG3A 4A6NB 2VVMA 1DODA 1X31B 3GD3A 2F5ZA 3KLJA 4AOSA 1Y0PA 5EBKA 5JCIA 1TRBA 2GR1A 3PO7A 2V3BA 1YY5A 4AT2A 1L9CA 4U8NA 3UKQA 1JRXA 3NHOX 3UP4A 4EIQA 5U1OA 2WOIA 4H4UA 1XHCA 2YVGA 2WOVA 3BI4A 4G9KA 3VRDB 4AOXA 1UKVG 4YTNA 3NK2X 3CNTA 4H2RA 3GDPA 3AYJA 4J56A 2B9YA 4GDEA 5KWFA 1KNPA 1CC6A 4GAVA 3SZ0A 4D04A 1KFYA 2JB1A 4H2QA 1E1MA 3T2ZA 4YKFA 4U8OA 3SM8A 2C73A 4Z2UA 4TM3A 2XLRA 1LV0A 1LJ1A 1KDGA 4DNAA 5KVHA 1S2YA 1D4EA 2YLXA 1EL7A 1GEUA 4H4SA 4PAAA 3EPTA 1D5TA 3M0OA 3T2KA 1D7LA 4NEWA 2XLSA 1CJ2A 1D4DA 3C96A 3DK9A 1PBDA 3NN6X 3SZWA 5IQ4A 4J2WA 4II2A 1DOCA 2BS2A 1P2HA 2EQ9A 3K7TA 2R45A 4K7ZA 4AT0A 1OJAA 2OA1A 1P2EA 5KMRA 3OZ2A 3AE7A 1V59A 3GRSA 5JCKA 4GCMA 2YG5A 3KU9A 3SGLA 1FOHA 3M13A 4APNA 2C7GA 2X3NA 2ZZ0A 2BRYA 3M12A 3QJ4A 3GDNA 4USRA 1S3EA 1PBBA 2EQ8A 4NNJA 1EL9A 3LZXA 1GNDA 4KPRA 1CHUA 2CULA 3NNEA 4Z43A 1O94A 1GERA 2E1MA 4H4RA 3SFEA 1TDOA 2H88A 2BA9A 3NK1X 4GRTA 3FMWA 3FPZA 1XANA 3AE4A 4J33A 3AE8A 1H86A 4BK3A 4OCGA 2YM1A 2YVJA 3QFBA 3AD9B 4B63A 1F6MA 4ZN0A 5HYMA 1NHRA 3I3LA 1K4QA 5J7XA 1LVLA 4GF7A 4UDPA 1ZDLA 3VRAA 1RP0A 2BYBA 3VR9A 2C64A 1YQ3A 1GTEA 4B68A 4C77A 3CIRA 4USQA 1BZLA 3FBSA 4TM4A 2FJEA 3AECA 3P1WA 3CTYA 1RYIA 3B3RA 4YSYA 5CQFA 4U8PA 4EQWA 3AEDA 1H7XA 2R0CA 3GMBA 4Z24A 1IUTA 3CNDA 1CJ3A 2PHHA 2BXRA 3GWFA 1N4UA 3RHAA 4ECHA 5KRQA 2YLZA 1ONFA 4J36A 1SEZA 3CPIG 1LQTA 1GRGA 1E1NA 4O5UA 4EMIA 4EQRA 2Z5XA 2BCPA 1PS9A 1E7PA 1E39A 3AD8B 3I6DA 1M64A 3NRNA 4C3YA 2BCGG 1GRHA 2BK4A 2XFOA 4U8LA 1JU2A 5C2TA 2C65A 2V60A 3P4QA 2XVJA 2YQUA 3ICTA 4OVIA 3CGEA 4YT0A 5ER0A 1F8RA 4E0VA 1MO9A 1NAAA 1PN0A 1ZOVA 4NTDA 2V3AA 1N4WA 5U25A 4KX6A 3DJGX 2X8GA 4H7UA 4Z44A 2WETA 3NLCA 4CBQA 1IUSA 3RP6A 3WE0A 4C5OA 1PXBA 3UTHA 4O5QA 2GV8A 2A87A 4JY3A 3AE2A 4OPCA 2E4GA 2WQYA 2BK5A 2ARDA 5L46A 3D8XA 2W0HA 2OLOA 2WBAA 5FS9A 1FEBA 3LZWA 4FDCB 1FL2A 3V3OA 2CDUA 2BABA 3NN0X 2V61A 2C75A 2X8HA 2AAQA 4FK1A 2GQFA 3IHGA 1JOAA 3KA7A 4H4WA 4YKGA 1GRFA 3AXBA 3T31A 2C70A 2Q0LA 2YM2A 1MOKA 3JSKA 3P4RA 3NGCX 1D7YA 1ZKQA 2WDQA 1GV4A 1ZMCA 2WDRA 4YTMA 1DJNA 4Y4NA 2JKCA 3CGBA 3C4NA 2A89A 4IA5A 4I59A 1NDAA 2X99A 1IJHA 4X9MA 2XYOA 1QJDA 4G73A
chains in the Genus database with same CATH topology
2WPEA 3NIXA 1E6EA 1K0JA 2GRTA 2VOUA 1PXAA 2GR0A 2YVFA 3GYJA 3GYXA 4C3XA 5HXIA 2VQ7A 2R4EA 5EB5A 4UDQA 3QVPA 5TR3A 2Q7VA 3DH9A 3LOVA 2YLSA 2XLPA 1NG3A 3HYVA 1N1PA 3LXDA 1DXLA 2GAGB 3QSSA 4NWZA 1TDFA 2FJDA 4OPUA 2XVEA 4CRTA 1BF3A 2VZ2A 1PDHA 4H50A 2J3NA 3L8KA 2BC1A 1XDIA 4TLZA 2JB2A 2B7SA 3CGDA 3BI2A 3FG2P 4H4TA 3SQPA 3SY4A 1Y56A 4A5LA 2XVHA 1DOBA 2FJBA 4XWZA 3DA1A 5KOXA 4BJZA 3H8IA 5GSNA 3GYIA 2GR2A 3ICRA 1LPFA 1GETA 3SXIA 1NHPA 3CNPA 2C3CA 5IQ1A 2YG7A 1OJCA 2ZZBA 5CKUA 1CJCA 2WDVA 2A8XA 3T37A 2VRMA 3UTGA 3Q9TA 4LA1A 2C67A 4GR1A 1KSSA 1JEHA 2EQ6A 5BUKA 4X4JA 1VQWA 3R9UA 1H81A 2JB3A 2B9WA 2JK6A 2B7RA 4HB9A 4H4YA 4LIIA 3B6DA 4Y4LA 1PBEA 2BK3A 2XVIA 3BHKA 3L1RA 2DKHA 1ZP0A 4YSZA 5BRTA 3HYWA 4D03A 4J31A 4Z25A 2YLRA 4EM3A 1GALA 2R9ZA 3S61A 2BRAA 4B65A 1EL5A 3AEGA 3RP8A 2JBVA 5FS8A 3ADAB 1GTHA 1N4VA 2VQBA 1IUWA 1S3BA 3AE6A 3QFAA 1ZY8A 3SZFA 5HY5A 1YKJA 1ZMDA 2X50A 3CMMA 3AEBA 1IUVA 3VR8A 2C72A 3Q6JA 3ITJA 4OPIA 2BS3A 3ABVA 3QVRA 3DK4A 4H2NA 4U8KA 2NVKX 3UOVA 3LJPA 4GUVA 3AYLA 4Z2TA 3IC9A 3AE5A 2BC0A 4NEVA 4EQXA 2WPCA 2YG6A 4YSHA 1DOEA 1VDCA 2XFNA 3P4SA 3VRBA 4IVMB 3F8RA 3BI5A 4Z26A 4G74A 1BGJA 3CNJA 1D4CA 5KMQA 4ICYA 3KKJA 4NZHA 4EQSA 3REDA 4TM1A 1ELIA 1ZX9A 2R4JA 2WOWA 3DGZA 2WEUA 3QSMA 4X9NA 2Y6QA 3G5SA 4REKA 4EM4A 3H4KA 3UCLA 3NYCA 3V3NA 5KXJA 1JRYA 4CY6A 4BV6A 1TDKA 1L9DA 2BACA 3AEEA 4Y4MA 3UTFA 3AEFA 3RNMA 3ZYXA 4NTCA 4B1BA 3BNUA 3QSEA 4RSLA 1COYA 5KVIA 1H6VA 4B69A 1B5QA 3CPJG 1GSNA 1CC4A 1K0IA 4LU6A 4BURA 2YR5A 3GMCA 2IVDA 2Q6UA 4AP3A 3KD9A 5KOWA 4JY2A 4A7AA 5DBJA 4A79A 2QA2A 4CNJA 2TMDA 3CGCA 3ISHA 4GDPA 1NHSA 4J57A 3NYEA 4ZCCA 1DJQA 1PJ7A 5JCMA 3H8LA 3T14A 3IWAA 2XLUA 1KF6A 2JAEA 1AOGA 2QA1A 2QCUA 4G6GA 4U2TA 4WX1A 1Q1WA 1PBFA 4GAPA 1L9EA 2V5ZA 5J60A 3GWDA 2AR8A 2B76A 2UZZA 3DJJA 1KNRA 3DK8A 4OPGA 5JCNA 4NTEA 2CFYA 1F8WA 2BS4A 5EOWA 2YAUA 3SYIA 4EMJA 1H84A 3BNMA 4K22A 1B8SA 1GRBA 1VRQB 2VRLA 3CNSA 4YTPA 2RGHA 1PBCA 3ICSA 3EAOA 4RG4A 5BULA 2OLNA 1FEAA 4UDRA 4A65A 2YR6A 1ZK7A 2V6OA 3URHA 2I0ZA 3KPFA 3UKHA 1JRZA 1PJ6A 4ADWA 2BXSA 1LTXR 3ALMA 1QO8A 2YG4A 4U8IA 3RP7A 1NHQA 1W4XA 2GB0A 2YG3A 2X8CA 4XWRA 1E1LA 5M0ZA 2WS3A 3ALJA 1NENA 5LV9A 1EL8A 2ZZCA 1PXCA 3ATQA 2GMHA 4II3A 3ALLA 4P9SA 4YXDA 4U8MA 1M6IA 3DMEA 2GAHB 5U63A 3F8PA 2ZBWA 2WP6A 1Y56B 3NT6A 3SFDA 3DGHA 3GRTA 3D1CA 3HZLA 1PHHA 1L0VA 2IVEA 3AE1A 2VVLA 3NTDA 3AYIA 1O95A 4Z2RA 2GQWA 1O5WA 3UTEA 3KVEA 3O0HA 3UKFA 3E1TA 1NG4A 3IHMA 4JQ9A 1Q1RA 2NPXA 1KSUA 1IUXA 2WESA 1GXFA 2AQJA 2Z5YA 1NEKA 4DSHA 5EB4A 5KMPA 3K7QX 4G6HA 5KNLA 3GSIA 4M52A 3AD7B 3ATRA 3NG7X 4CCRA 4A9WA 5KMSA 2WP9A 2O9ZA 4PABA 4WCTA 1FCDA 3AE9A 4K8DA 3UKKA 4H4ZA 1VG0A 1TDEA 2GH5A 2OALA 3SZCA 2HQMA 4FX9A 3G5QA 1F8SA 2GMJA 4MJWA 3OC4A 2XFQA 3COXA 5FS7A 2Y6RA 1E1KA 5IPYA 4JNAA 4YWOA 2Q0KA 2XDOA 3NKSA 3T0KA 3AB1A 1H82A 1PJ5A 2GEWA 3IF9A 4H4QA 1GT8A 2YLTA 1OJ9A 2RGOA 3LB8A 1GREA 3AWIA 4JDRA 1GESA 1BGNA 1H83A 4U8JA 1OJTA 1CBOA 1CL0A 2E5VA 3C4AA 5C3JA 4BK2A 3HYXA 2RABA 4U2LA 4ZCDA 2YWLA 5GRTA 4CY8A 3NK0X 1XPQA 2XVFA 4TM0A 3UOXA 2CVJA 4JNQA 2APGA 3DJDA 3NYFA 4A99A 3CPHG 2B9XA 2C3DA 3FIMB 3LADA 4FK1C 2XFPA 4H4XA 4K5SA 2C66A 4N9XA 4B67A 3AEAA 4K2XA 2GVCA 4C74A 1GRAA 1GRTA 2FBWA 1F3PA 3P4PA 1B4VA 1K0LA 1YQ4A 3PS9A 2GR3A 4J34A 2YR4A 1TYTA 4IA6A 3ZDNA 3DJEA 1BWCA 3UKPA 1CJ4A 5HHFA 1YQZA 1REOA 4IV9A 3GD4A 3AE3A 3SX6A 4B66A 1LQUA 4H2PA 5M10A 1JNRA 2ACZA 2YLWA 4OPTA 1DNCA 3S5WA 4EMWA 2WP5A 1IUUA 4HA6A 2H89A 1MXTA 3VQRA 1QLBA 3T2YA 2WU5A 4BK1A 4CCQA 3EF6A 5FMHA 1ZOYA 1VG9A 1NPXA 1Z6LA 2R0PA 2C76A 4B64A 4JN9A 2R0GA 2XCGA 1RSGA 1BKWA 1FECA 1HYUA 2PYXA 2VVLG 3P9UA 3KPKA 3BHFA 2FJAA 4DGKA 4U2SA 4YSXA 1EBDA 2IIDA 3PVCA 1OJDA 2EQ7A 4K5RA 4OPLA 4UP3A 2QAEA 2RGJA 3UKLA 3UP5A 4OPDA 4CNKA 5BVAA 3CN8A 3NH3X 3UKAA 1TYPA 2WU2A 4TLXA 2TPRA 4H4VA 4XXGA 3UOZA 2GF3A 2XFUA 4DSGA 4H4PA 2WHDA 4IVOB 2C4CA 5FS6A 1H7WA 3K7MX 1CF3A 1TDNA 3EANA 2DKIA 3UOYA 1GPEA 5JCLA 3K30A 3NTAA 2OAMA 2R46A 4EIPA 1CC2A 2WPFA 1B37A 1Q9IA 4BJYA 2XLTA 3G5RA 1GOSA 1JNZA 3V76A 3F8DA 1S2QA 3II4A 4AP1A 4I58A 4A6NA 4RG3A 4A6NB 2VVMA 1DODA 1X31B 3GD3A 2F5ZA 3KLJA 4AOSA 1Y0PA 5EBKA 5JCIA 1TRBA 2GR1A 3PO7A 2V3BA 1YY5A 4AT2A 1L9CA 4U8NA 3UKQA 1JRXA 3NHOX 3UP4A 4EIQA 5U1OA 2WOIA 4H4UA 1XHCA 2YVGA 2WOVA 3BI4A 4G9KA 3VRDB 4AOXA 1UKVG 4YTNA 3NK2X 3CNTA 4H2RA 3GDPA 3AYJA 4J56A 2B9YA 4GDEA 5KWFA 1KNPA 1CC6A 4GAVA 3SZ0A 4D04A 1KFYA 2JB1A 4H2QA 1E1MA 3T2ZA 4YKFA 4U8OA 3SM8A 2C73A 4Z2UA 4TM3A 2XLRA 1LV0A 1LJ1A 1KDGA 4DNAA 5KVHA 1S2YA 1D4EA 2YLXA 1EL7A 1GEUA 4H4SA 4PAAA 3EPTA 1D5TA 3M0OA 3T2KA 1D7LA 4NEWA 2XLSA 1CJ2A 1D4DA 3C96A 3DK9A 1PBDA 3NN6X 3SZWA 5IQ4A 4J2WA 4II2A 1DOCA 2BS2A 1P2HA 2EQ9A 3K7TA 2R45A 4K7ZA 4AT0A 1OJAA 2OA1A 1P2EA 5KMRA 3OZ2A 3AE7A 1V59A 3GRSA 5JCKA 4GCMA 2YG5A 3KU9A 3SGLA 1FOHA 3M13A 4APNA 2C7GA 2X3NA 2ZZ0A 2BRYA 3M12A 3QJ4A 3GDNA 4USRA 1S3EA 1PBBA 2EQ8A 4NNJA 1EL9A 3LZXA 1GNDA 4KPRA 1CHUA 2CULA 3NNEA 4Z43A 1O94A 1GERA 2E1MA 4H4RA 3SFEA 1TDOA 2H88A 2BA9A 3NK1X 4GRTA 3FMWA 3FPZA 1XANA 3AE4A 4J33A 3AE8A 1H86A 4BK3A 4OCGA 2YM1A 2YVJA 3QFBA 3AD9B 4B63A 1F6MA 4ZN0A 5HYMA 1NHRA 3I3LA 1K4QA 5J7XA 1LVLA 4GF7A 4UDPA 1ZDLA 3VRAA 1RP0A 2BYBA 3VR9A 2C64A 1YQ3A 1GTEA 4B68A 4C77A 3CIRA 4USQA 1BZLA 3FBSA 4TM4A 2FJEA 3AECA 3P1WA 3CTYA 1RYIA 3B3RA 4YSYA 5CQFA 4U8PA 4EQWA 3AEDA 1H7XA 2R0CA 3GMBA 4Z24A 1IUTA 3CNDA 1CJ3A 2PHHA 2BXRA 3GWFA 1N4UA 3RHAA 4ECHA 5KRQA 2YLZA 1ONFA 4J36A 1SEZA 3CPIG 1LQTA 1GRGA 1E1NA 4O5UA 4EMIA 4EQRA 2Z5XA 2BCPA 1PS9A 1E7PA 1E39A 3AD8B 3I6DA 1M64A 3NRNA 4C3YA 2BCGG 1GRHA 2BK4A 2XFOA 4U8LA 1JU2A 5C2TA 2C65A 2V60A 3P4QA 2XVJA 2YQUA 3ICTA 4OVIA 3CGEA 4YT0A 5ER0A 1F8RA 4E0VA 1MO9A 1NAAA 1PN0A 1ZOVA 4NTDA 2V3AA 1N4WA 5U25A 4KX6A 3DJGX 2X8GA 4H7UA 4Z44A 2WETA 3NLCA 4CBQA 1IUSA 3RP6A 3WE0A 4C5OA 1PXBA 3UTHA 4O5QA 2GV8A 2A87A 4JY3A 3AE2A 4OPCA 2E4GA 2WQYA 2BK5A 2ARDA 5L46A 3D8XA 2W0HA 2OLOA 2WBAA 5FS9A 1FEBA 3LZWA 4FDCB 1FL2A 3V3OA 2CDUA 2BABA 3NN0X 2V61A 2C75A 2X8HA 2AAQA 4FK1A 2GQFA 3IHGA 1JOAA 3KA7A 4H4WA 4YKGA 1GRFA 3AXBA 3T31A 2C70A 2Q0LA 2YM2A 1MOKA 3JSKA 3P4RA 3NGCX 1D7YA 1ZKQA 2WDQA 1GV4A 1ZMCA 2WDRA 4YTMA 1DJNA 4Y4NA 2JKCA 3CGBA 3C4NA 2A89A 4IA5A 4I59A 1NDAA 2X99A 1IJHA 4X9MA 2XYOA 1QJDA 4G73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPE A;  3NIX A;  1E6E A;  1K0J A;  2GRT A;  2VOU A;  1PXA A;  2GR0 A;  2YVF A;  3GYJ A;  4C3X A;  5HXI A;  2VQ7 A;  2R4E A;  5EB5 A;  4UDQ A;  3QVP A;  5TR3 A;  2Q7V A;  3DH9 A;  3LOV A;  2YLS A;  2XLP A;  1NG3 A;  1N1P A;  3LXD A;  1DXL A;  2GAG B;  3QSS A;  1TDF A;  2FJD A;  4OPU A;  2XVE A;  4CRT A;  1BF3 A;  2VZ2 A;  1PDH A;  4H50 A;  2J3N A;  3L8K A;  2BC1 A;  1XDI A;  4TLZ A;  2JB2 A;  2B7S A;  3CGD A;  3BI2 A;  3FG2 P;  4H4T A;  3SQP A;  4A5L A;  1Y56 A;  2XVH A;  1DOB A;  2FJB A;  4XWZ A;  3DA1 A;  5KOX A;  4BJZ A;  3H8I A;  5GSN A;  3GYI A;  2GR2 A;  3ICR A;  1LPF A;  1GET A;  1NHP A;  3CNP A;  2C3C A;  5IQ1 A;  2YG7 A;  1OJC A;  2ZZB A;  5CKU A;  1CJC A;  2WDV A;  2A8X A;  3T37 A;  2VRM A;  3UTG A;  3Q9T A;  4LA1 A;  2C67 A;  4GR1 A;  1KSS A;  1JEH A;  2EQ6 A;  5BUK A;  4X4J A;  1VQW A;  3R9U A;  1H81 A;  2JB3 A;  2B9W A;  2JK6 A;  2B7R A;  4HB9 A;  4H4Y A;  4LII A;  3B6D A;  4Y4L A;  1PBE A;  2BK3 A;  2XVI A;  3BHK A;  3L1R A;  2DKH A;  1ZP0 A;  4YSZ A;  5BRT A;  4D03 A;  4J31 A;  4Z25 A;  2YLR A;  4EM3 A;  1GAL A;  2R9Z A;  3S61 A;  4B65 A;  1EL5 A;  3AEG A;  3RP8 A;  2JBV A;  5FS8 A;  3ADA B;  1GTH A;  1N4V A;  2VQB A;  1IUW A;  1S3B A;  3AE6 A;  3QFA A;  1ZY8 A;  5HY5 A;  1YKJ A;  1ZMD A;  2X50 A;  3AEB A;  1IUV A;  3VR8 A;  2C72 A;  3Q6J A;  3ITJ A;  4OPI A;  2BS3 A;  3ABV A;  3QVR A;  3DK4 A;  4H2N A;  4U8K A;  2NVK X;  3UOV A;  3LJP A;  4GUV A;  3AYL A;  4Z2T A;  3IC9 A;  3AE5 A;  2BC0 A;  4NEV A;  4EQX A;  2WPC A;  2YG6 A;  4YSH A;  1DOE A;  1VDC A;  2XFN A;  3P4S A;  3VRB A;  4IVM B;  3F8R A;  3BI5 A;  4Z26 A;  1BGJ A;  3CNJ A;  1D4C A;  4ICY A;  3KKJ A;  4NZH A;  4EQS A;  3RED A;  4TM1 A;  1ELI A;  1ZX9 A;  2R4J A;  2WOW A;  3DGZ A;  2WEU A;  3QSM A;  4X9N A;  2Y6Q A;  3G5S A;  4REK A;  4EM4 A;  3H4K A;  3UCL A;  3NYC A;  3V3N A;  5KXJ A;  1JRY A;  4CY6 A;  4BV6 A;  1TDK A;  1L9D A;  2BAC A;  3AEE A;  4Y4M A;  3UTF A;  3AEF A;  3RNM A;  3ZYX A;  4NTC A;  4B1B A;  3BNU A;  3QSE A;  4RSL A;  1COY A;  5KVI A;  1H6V A;  4B69 A;  1B5Q A;  3CPJ G;  1GSN A;  1CC4 A;  1K0I A;  4LU6 A;  4BUR A;  2YR5 A;  3GMC A;  2IVD A;  2Q6U A;  4AP3 A;  3KD9 A;  5KOW A;  4JY2 A;  4A7A A;  5DBJ A;  4A79 A;  2QA2 A;  4CNJ A;  2TMD A;  3CGC A;  3ISH A;  4GDP A;  1NHS A;  4J57 A;  3NYE A;  4ZCC A;  1DJQ A;  1PJ7 A;  5JCM A;  3H8L A;  3IWA A;  2XLU A;  1KF6 A;  2JAE A;  1AOG A;  2QA1 A;  2QCU A;  4U2T A;  4WX1 A;  1Q1W A;  1PBF A;  1L9E A;  2V5Z A;  5J60 A;  3GWD A;  2AR8 A;  2B76 A;  2UZZ A;  3DJJ A;  1KNR A;  3DK8 A;  4OPG A;  5JCN A;  4NTE A;  2CFY A;  1F8W A;  2BS4 A;  5EOW A;  2YAU A;  4EMJ A;  1H84 A;  3BNM A;  4K22 A;  1B8S A;  1GRB A;  1VRQ B;  2VRL A;  3CNS A;  4YTP A;  2RGH A;  1PBC A;  3ICS A;  3EAO A;  4RG4 A;  5BUL A;  2OLN A;  1FEA A;  4UDR A;  4A65 A;  2YR6 A;  1ZK7 A;  2V6O A;  3URH A;  2I0Z A;  3KPF A;  3UKH A;  1JRZ A;  1PJ6 A;  4ADW A;  2BXS A;  1LTX R;  3ALM A;  1QO8 A;  2YG4 A;  4U8I A;  3RP7 A;  1NHQ A;  1W4X A;  2GB0 A;  2YG3 A;  2X8C A;  4XWR A;  1E1L A;  5M0Z A;  2WS3 A;  3ALJ A;  1NEN A;  5LV9 A;  1EL8 A;  2ZZC A;  1PXC A;  3ATQ A;  2GMH A;  3ALL A;  4P9S A;  4YXD A;  4U8M A;  1M6I A;  3DME A;  2GAH B;  5U63 A;  3F8P A;  2ZBW A;  2WP6 A;  1Y56 B;  3NT6 A;  3SFD A;  3DGH A;  3GRT A;  3D1C A;  3HZL A;  1PHH A;  1L0V A;  2IVE A;  3AE1 A;  2VVL A;  3NTD A;  3AYI A;  1O95 A;  4Z2R A;  2GQW A;  1O5W A;  3UTE A;  3KVE A;  3O0H A;  3UKF A;  3E1T A;  1NG4 A;  3IHM A;  4JQ9 A;  1Q1R A;  2NPX A;  1KSU A;  1IUX A;  2WES A;  1GXF A;  2AQJ A;  2Z5Y A;  1NEK A;  4DSH A;  5EB4 A;  3K7Q X;  3GSI A;  4M52 A;  3AD7 B;  3ATR A;  3NG7 X;  4CCR A;  4A9W A;  2WP9 A;  2O9Z A;  4PAB A;  4WCT A;  1FCD A;  3AE9 A;  4K8D A;  3UKK A;  4H4Z A;  1VG0 A;  1TDE A;  2GH5 A;  2OAL A;  2HQM A;  4FX9 A;  3G5Q A;  1F8S A;  2GMJ A;  4MJW A;  3OC4 A;  2XFQ A;  3COX A;  5FS7 A;  2Y6R A;  1E1K A;  5IPY A;  4JNA A;  4YWO A;  2Q0K A;  2XDO A;  3NKS A;  3AB1 A;  1H82 A;  1PJ5 A;  2GEW A;  3IF9 A;  4H4Q A;  1GT8 A;  2YLT A;  1OJ9 A;  2RGO A;  3LB8 A;  1GRE A;  3AWI A;  4JDR A;  1GES A;  1BGN A;  1H83 A;  4U8J A;  1OJT A;  1CBO A;  1CL0 A;  2E5V A;  3C4A A;  5C3J A;  4BK2 A;  2RAB A;  4U2L A;  4ZCD A;  2YWL A;  5GRT A;  4CY8 A;  3NK0 X;  1XPQ A;  2XVF A;  4TM0 A;  3UOX A;  2CVJ A;  4JNQ A;  2APG A;  3DJD A;  3NYF A;  4A99 A;  3CPH G;  2B9X A;  2C3D A;  3FIM B;  3LAD A;  4FK1 C;  2XFP A;  4H4X A;  4K5S A;  2C66 A;  4N9X A;  4B67 A;  3AEA A;  4K2X A;  2GVC A;  4C74 A;  1GRA A;  1GRT A;  2FBW A;  1F3P A;  3P4P A;  1B4V A;  1K0L A;  1YQ4 A;  3PS9 A;  2GR3 A;  4J34 A;  2YR4 A;  1TYT A;  4IA6 A;  3ZDN A;  3DJE A;  1BWC A;  3UKP A;  1CJ4 A;  5HHF A;  1YQZ A;  1REO A;  4IV9 A;  3GD4 A;  3AE3 A;  4B66 A;  1LQU A;  4H2P A;  5M10 A;  1JNR A;  2ACZ A;  2YLW A;  4OPT A;  1DNC A;  3S5W A;  4EMW A;  2WP5 A;  1IUU A;  4HA6 A;  2H89 A;  1MXT A;  3VQR A;  1QLB A;  4BK1 A;  2WU5 A;  4CCQ A;  3EF6 A;  5FMH A;  1ZOY A;  1VG9 A;  1NPX A;  1Z6L A;  2R0P A;  2C76 A;  4B64 A;  4JN9 A;  2R0G A;  2XCG A;  1RSG A;  1BKW A;  1FEC A;  1HYU A;  2PYX A;  2VVL G;  3P9U A;  3BHF A;  2FJA A;  4DGK A;  4U2S A;  4YSX A;  1EBD A;  2IID A;  3PVC A;  1OJD A;  2EQ7 A;  4K5R A;  4OPL A;  4UP3 A;  2QAE A;  2RGJ A;  3UKL A;  3UP5 A;  4OPD A;  4CNK A;  5BVA A;  3CN8 A;  3NH3 X;  3UKA A;  1TYP A;  2WU2 A;  4TLX A;  2TPR A;  4H4V A;  4XXG A;  3UOZ A;  2GF3 A;  2XFU A;  4DSG A;  4H4P A;  2WHD A;  4IVO B;  5FS6 A;  1H7W A;  3K7M X;  1CF3 A;  1TDN A;  3EAN A;  2DKI A;  3UOY A;  1GPE A;  5JCL A;  3K30 A;  3NTA A;  2OAM A;  2R46 A;  4EIP A;  1CC2 A;  2WPF A;  1B37 A;  1Q9I A;  4BJY A;  2XLT A;  3G5R A;  1GOS A;  1JNZ A;  3V76 A;  3F8D A;  1S2Q A;  3II4 A;  4AP1 A;  4I58 A;  4A6N A;  4RG3 A;  4A6N B;  2VVM A;  1DOD A;  1X31 B;  3GD3 A;  2F5Z A;  3KLJ A;  4AOS A;  1Y0P A;  5EBK A;  5JCI A;  1TRB A;  2GR1 A;  3PO7 A;  2V3B A;  1YY5 A;  4AT2 A;  1L9C A;  4U8N A;  3UKQ A;  1JRX A;  3NHO X;  3UP4 A;  4EIQ A;  5U1O A;  2WOI A;  4H4U A;  1XHC A;  2YVG A;  2WOV A;  3BI4 A;  3VRD B;  4AOX A;  1UKV G;  4YTN A;  3NK2 X;  3CNT A;  4H2R A;  3GDP A;  3AYJ A;  4J56 A;  2B9Y A;  4GDE A;  5KWF A;  1KNP A;  1CC6 A;  4D04 A;  1KFY A;  2JB1 A;  4H2Q A;  1E1M A;  4YKF A;  4U8O A;  3SM8 A;  2C73 A;  4Z2U A;  4TM3 A;  2XLR A;  1LV0 A;  1LJ1 A;  1KDG A;  4DNA A;  5KVH A;  1S2Y A;  1D4E A;  2YLX A;  1EL7 A;  1GEU A;  4H4S A;  4PAA A;  3EPT A;  1D5T A;  3M0O A;  1D7L A;  4NEW A;  2XLS A;  1CJ2 A;  1D4D A;  3C96 A;  3DK9 A;  1PBD A;  3NN6 X;  5IQ4 A;  4J2W A;  1DOC A;  2BS2 A;  1P2H A;  2EQ9 A;  3K7T A;  2R45 A;  4K7Z A;  4AT0 A;  1OJA A;  2OA1 A;  1P2E A;  3OZ2 A;  3AE7 A;  1V59 A;  3GRS A;  5JCK A;  4GCM A;  2YG5 A;  3KU9 A;  3SGL A;  1FOH A;  3M13 A;  4APN A;  2C7G A;  2X3N A;  2ZZ0 A;  3M12 A;  3QJ4 A;  3GDN A;  4USR A;  1S3E A;  1PBB A;  2EQ8 A;  1EL9 A;  3LZX A;  1GND A;  4KPR A;  1CHU A;  2CUL A;  3NNE A;  4Z43 A;  1O94 A;  1GER A;  2E1M A;  4H4R A;  3SFE A;  1TDO A;  2H88 A;  2BA9 A;  3NK1 X;  4GRT A;  3FMW A;  3FPZ A;  1XAN A;  3AE4 A;  4J33 A;  3AE8 A;  1H86 A;  4BK3 A;  4OCG A;  2YM1 A;  2YVJ A;  3QFB A;  3AD9 B;  4B63 A;  1F6M A;  4ZN0 A;  5HYM A;  1NHR A;  3I3L A;  1K4Q A;  5J7X A;  1LVL A;  4GF7 A;  4UDP A;  1ZDL A;  3VRA A;  1RP0 A;  2BYB A;  3VR9 A;  2C64 A;  1YQ3 A;  1GTE A;  4B68 A;  4C77 A;  3CIR A;  4USQ A;  1BZL A;  3FBS A;  4TM4 A;  2FJE A;  3AEC A;  3P1W A;  3CTY A;  1RYI A;  3B3R A;  4YSY A;  5CQF A;  4U8P A;  4EQW A;  3AED A;  1H7X A;  2R0C A;  3GMB A;  4Z24 A;  1IUT A;  3CND A;  1CJ3 A;  2PHH A;  2BXR A;  3GWF A;  1N4U A;  3RHA A;  4ECH A;  5KRQ A;  2YLZ A;  1ONF A;  4J36 A;  1SEZ A;  3CPI G;  1LQT A;  1GRG A;  1E1N A;  4O5U A;  4EMI A;  4EQR A;  2Z5X A;  2BCP A;  1PS9 A;  1E7P A;  1E39 A;  3AD8 B;  3I6D A;  1M64 A;  3NRN A;  2BCG G;  1GRH A;  2BK4 A;  2XFO A;  4U8L A;  1JU2 A;  5C2T A;  2C65 A;  2V60 A;  3P4Q A;  2XVJ A;  2YQU A;  3ICT A;  4OVI A;  3CGE A;  4YT0 A;  5ER0 A;  1F8R A;  4E0V A;  1MO9 A;  1NAA A;  1PN0 A;  1ZOV A;  4NTD A;  2V3A A;  1N4W A;  5U25 A;  4KX6 A;  3DJG X;  2X8G A;  4H7U A;  4Z44 A;  2WET A;  3NLC A;  4CBQ A;  1IUS A;  3RP6 A;  3WE0 A;  4C5O A;  1PXB A;  3UTH A;  4O5Q A;  2GV8 A;  2A87 A;  4JY3 A;  3AE2 A;  4OPC A;  2E4G A;  2WQY A;  2BK5 A;  2ARD A;  5L46 A;  3D8X A;  2W0H A;  2OLO A;  2WBA A;  5FS9 A;  1FEB A;  3LZW A;  4FDC B;  1FL2 A;  3V3O A;  2CDU A;  2BAB A;  3NN0 X;  2V61 A;  2C75 A;  2X8H A;  2AAQ A;  4FK1 A;  2GQF A;  3IHG A;  1JOA A;  3KA7 A;  4H4W A;  4YKG A;  1GRF A;  3AXB A;  2C70 A;  2Q0L A;  2YM2 A;  1MOK A;  3JSK A;  3P4R A;  3NGC X;  1D7Y A;  1ZKQ A;  2WDQ A;  1GV4 A;  1ZMC A;  2WDR A;  4YTM A;  1DJN A;  4Y4N A;  2JKC A;  3CGB A;  3C4N A;  2A89 A;  4IA5 A;  4I59 A;  1NDA A;  2X99 A;  1IJH A;  4X9M A;  2XYO A;  1QJD A;  4C3Y A; 
#chains in the Genus database with same CATH topology
 2WPE A;  3NIX A;  1E6E A;  1K0J A;  2GRT A;  2VOU A;  1PXA A;  2GR0 A;  2YVF A;  3GYJ A;  3GYX A;  4C3X A;  5HXI A;  2VQ7 A;  2R4E A;  5EB5 A;  4UDQ A;  3QVP A;  5TR3 A;  2Q7V A;  3DH9 A;  3LOV A;  2YLS A;  2XLP A;  1NG3 A;  3HYV A;  1N1P A;  3LXD A;  1DXL A;  2GAG B;  3QSS A;  4NWZ A;  1TDF A;  2FJD A;  4OPU A;  2XVE A;  4CRT A;  1BF3 A;  2VZ2 A;  1PDH A;  4H50 A;  2J3N A;  3L8K A;  2BC1 A;  1XDI A;  4TLZ A;  2JB2 A;  2B7S A;  3CGD A;  3BI2 A;  3FG2 P;  4H4T A;  3SQP A;  3SY4 A;  1Y56 A;  4A5L A;  2XVH A;  1DOB A;  2FJB A;  4XWZ A;  3DA1 A;  5KOX A;  4BJZ A;  3H8I A;  5GSN A;  3GYI A;  2GR2 A;  3ICR A;  1LPF A;  1GET A;  3SXI A;  1NHP A;  3CNP A;  2C3C A;  5IQ1 A;  2YG7 A;  1OJC A;  2ZZB A;  5CKU A;  1CJC A;  2WDV A;  2A8X A;  3T37 A;  2VRM A;  3UTG A;  3Q9T A;  4LA1 A;  2C67 A;  4GR1 A;  1KSS A;  1JEH A;  2EQ6 A;  5BUK A;  4X4J A;  1VQW A;  3R9U A;  1H81 A;  2JB3 A;  2B9W A;  2JK6 A;  2B7R A;  4HB9 A;  4H4Y A;  4LII A;  3B6D A;  4Y4L A;  1PBE A;  2BK3 A;  2XVI A;  3BHK A;  3L1R A;  2DKH A;  1ZP0 A;  4YSZ A;  5BRT A;  3HYW A;  4D03 A;  4J31 A;  4Z25 A;  2YLR A;  4EM3 A;  1GAL A;  2R9Z A;  3S61 A;  2BRA A;  4B65 A;  1EL5 A;  3AEG A;  3RP8 A;  2JBV A;  5FS8 A;  3ADA B;  1GTH A;  1N4V A;  2VQB A;  1IUW A;  1S3B A;  3AE6 A;  3QFA A;  1ZY8 A;  3SZF A;  5HY5 A;  1YKJ A;  1ZMD A;  2X50 A;  3CMM A;  3AEB A;  1IUV A;  3VR8 A;  2C72 A;  3Q6J A;  3ITJ A;  4OPI A;  2BS3 A;  3ABV A;  3QVR A;  3DK4 A;  4H2N A;  4U8K A;  2NVK X;  3UOV A;  3LJP A;  4GUV A;  3AYL A;  4Z2T A;  3IC9 A;  3AE5 A;  2BC0 A;  4NEV A;  4EQX A;  2WPC A;  2YG6 A;  4YSH A;  1DOE A;  1VDC A;  2XFN A;  3P4S A;  3VRB A;  4IVM B;  3F8R A;  3BI5 A;  4Z26 A;  4G74 A;  1BGJ A;  3CNJ A;  1D4C A;  5KMQ A;  4ICY A;  3KKJ A;  4NZH A;  4EQS A;  3RED A;  4TM1 A;  1ELI A;  1ZX9 A;  2R4J A;  2WOW A;  3DGZ A;  2WEU A;  3QSM A;  4X9N A;  2Y6Q A;  3G5S A;  4REK A;  4EM4 A;  3H4K A;  3UCL A;  3NYC A;  3V3N A;  5KXJ A;  1JRY A;  4CY6 A;  4BV6 A;  1TDK A;  1L9D A;  2BAC A;  3AEE A;  4Y4M A;  3UTF A;  3AEF A;  3RNM A;  3ZYX A;  4NTC A;  4B1B A;  3BNU A;  3QSE A;  4RSL A;  1COY A;  5KVI A;  1H6V A;  4B69 A;  1B5Q A;  3CPJ G;  1GSN A;  1CC4 A;  1K0I A;  4LU6 A;  4BUR A;  2YR5 A;  3GMC A;  2IVD A;  2Q6U A;  4AP3 A;  3KD9 A;  5KOW A;  4JY2 A;  4A7A A;  5DBJ A;  4A79 A;  2QA2 A;  4CNJ A;  2TMD A;  3CGC A;  3ISH A;  4GDP A;  1NHS A;  4J57 A;  3NYE A;  4ZCC A;  1DJQ A;  1PJ7 A;  5JCM A;  3H8L A;  3T14 A;  3IWA A;  2XLU A;  1KF6 A;  2JAE A;  1AOG A;  2QA1 A;  2QCU A;  4G6G A;  4U2T A;  4WX1 A;  1Q1W A;  1PBF A;  4GAP A;  1L9E A;  2V5Z A;  5J60 A;  3GWD A;  2AR8 A;  2B76 A;  2UZZ A;  3DJJ A;  1KNR A;  3DK8 A;  4OPG A;  5JCN A;  4NTE A;  2CFY A;  1F8W A;  2BS4 A;  5EOW A;  2YAU A;  3SYI A;  4EMJ A;  1H84 A;  3BNM A;  4K22 A;  1B8S A;  1GRB A;  1VRQ B;  2VRL A;  3CNS A;  4YTP A;  2RGH A;  1PBC A;  3ICS A;  3EAO A;  4RG4 A;  5BUL A;  2OLN A;  1FEA A;  4UDR A;  4A65 A;  2YR6 A;  1ZK7 A;  2V6O A;  3URH A;  2I0Z A;  3KPF A;  3UKH A;  1JRZ A;  1PJ6 A;  4ADW A;  2BXS A;  1LTX R;  3ALM A;  1QO8 A;  2YG4 A;  4U8I A;  3RP7 A;  1NHQ A;  1W4X A;  2GB0 A;  2YG3 A;  2X8C A;  4XWR A;  1E1L A;  5M0Z A;  2WS3 A;  3ALJ A;  1NEN A;  5LV9 A;  1EL8 A;  2ZZC A;  1PXC A;  3ATQ A;  2GMH A;  4II3 A;  3ALL A;  4P9S A;  4YXD A;  4U8M A;  1M6I A;  3DME A;  2GAH B;  5U63 A;  3F8P A;  2ZBW A;  2WP6 A;  1Y56 B;  3NT6 A;  3SFD A;  3DGH A;  3GRT A;  3D1C A;  3HZL A;  1PHH A;  1L0V A;  2IVE A;  3AE1 A;  2VVL A;  3NTD A;  3AYI A;  1O95 A;  4Z2R A;  2GQW A;  1O5W A;  3UTE A;  3KVE A;  3O0H A;  3UKF A;  3E1T A;  1NG4 A;  3IHM A;  4JQ9 A;  1Q1R A;  2NPX A;  1KSU A;  1IUX A;  2WES A;  1GXF A;  2AQJ A;  2Z5Y A;  1NEK A;  4DSH A;  5EB4 A;  5KMP A;  3K7Q X;  4G6H A;  5KNL A;  3GSI A;  4M52 A;  3AD7 B;  3ATR A;  3NG7 X;  4CCR A;  4A9W A;  5KMS A;  2WP9 A;  2O9Z A;  4PAB A;  4WCT A;  1FCD A;  3AE9 A;  4K8D A;  3UKK A;  4H4Z A;  1VG0 A;  1TDE A;  2GH5 A;  2OAL A;  3SZC A;  2HQM A;  4FX9 A;  3G5Q A;  1F8S A;  2GMJ A;  4MJW A;  3OC4 A;  2XFQ A;  3COX A;  5FS7 A;  2Y6R A;  1E1K A;  5IPY A;  4JNA A;  4YWO A;  2Q0K A;  2XDO A;  3NKS A;  3T0K A;  3AB1 A;  1H82 A;  1PJ5 A;  2GEW A;  3IF9 A;  4H4Q A;  1GT8 A;  2YLT A;  1OJ9 A;  2RGO A;  3LB8 A;  1GRE A;  3AWI A;  4JDR A;  1GES A;  1BGN A;  1H83 A;  4U8J A;  1OJT A;  1CBO A;  1CL0 A;  2E5V A;  3C4A A;  5C3J A;  4BK2 A;  3HYX A;  2RAB A;  4U2L A;  4ZCD A;  2YWL A;  5GRT A;  4CY8 A;  3NK0 X;  1XPQ A;  2XVF A;  4TM0 A;  3UOX A;  2CVJ A;  4JNQ A;  2APG A;  3DJD A;  3NYF A;  4A99 A;  3CPH G;  2B9X A;  2C3D A;  3FIM B;  3LAD A;  4FK1 C;  2XFP A;  4H4X A;  4K5S A;  2C66 A;  4N9X A;  4B67 A;  3AEA A;  4K2X A;  2GVC A;  4C74 A;  1GRA A;  1GRT A;  2FBW A;  1F3P A;  3P4P A;  1B4V A;  1K0L A;  1YQ4 A;  3PS9 A;  2GR3 A;  4J34 A;  2YR4 A;  1TYT A;  4IA6 A;  3ZDN A;  3DJE A;  1BWC A;  3UKP A;  1CJ4 A;  5HHF A;  1YQZ A;  1REO A;  4IV9 A;  3GD4 A;  3AE3 A;  3SX6 A;  4B66 A;  1LQU A;  4H2P A;  5M10 A;  1JNR A;  2ACZ A;  2YLW A;  4OPT A;  1DNC A;  3S5W A;  4EMW A;  2WP5 A;  1IUU A;  4HA6 A;  2H89 A;  1MXT A;  3VQR A;  1QLB A;  3T2Y A;  2WU5 A;  4BK1 A;  4CCQ A;  3EF6 A;  5FMH A;  1ZOY A;  1VG9 A;  1NPX A;  1Z6L A;  2R0P A;  2C76 A;  4B64 A;  4JN9 A;  2R0G A;  2XCG A;  1RSG A;  1BKW A;  1FEC A;  1HYU A;  2PYX A;  2VVL G;  3P9U A;  3KPK A;  3BHF A;  2FJA A;  4DGK A;  4U2S A;  4YSX A;  1EBD A;  2IID A;  3PVC A;  1OJD A;  2EQ7 A;  4K5R A;  4OPL A;  4UP3 A;  2QAE A;  2RGJ A;  3UKL A;  3UP5 A;  4OPD A;  4CNK A;  5BVA A;  3CN8 A;  3NH3 X;  3UKA A;  1TYP A;  2WU2 A;  4TLX A;  2TPR A;  4H4V A;  4XXG A;  3UOZ A;  2GF3 A;  2XFU A;  4DSG A;  4H4P A;  2WHD A;  4IVO B;  2C4C A;  5FS6 A;  1H7W A;  3K7M X;  1CF3 A;  1TDN A;  3EAN A;  2DKI A;  3UOY A;  1GPE A;  5JCL A;  3K30 A;  3NTA A;  2OAM A;  2R46 A;  4EIP A;  1CC2 A;  2WPF A;  1B37 A;  1Q9I A;  4BJY A;  2XLT A;  3G5R A;  1GOS A;  1JNZ A;  3V76 A;  3F8D A;  1S2Q A;  3II4 A;  4AP1 A;  4I58 A;  4A6N A;  4RG3 A;  4A6N B;  2VVM A;  1DOD A;  1X31 B;  3GD3 A;  2F5Z A;  3KLJ A;  4AOS A;  1Y0P A;  5EBK A;  5JCI A;  1TRB A;  2GR1 A;  3PO7 A;  2V3B A;  1YY5 A;  4AT2 A;  1L9C A;  4U8N A;  3UKQ A;  1JRX A;  3NHO X;  3UP4 A;  4EIQ A;  5U1O A;  2WOI A;  4H4U A;  1XHC A;  2YVG A;  2WOV A;  3BI4 A;  4G9K A;  3VRD B;  4AOX A;  1UKV G;  4YTN A;  3NK2 X;  3CNT A;  4H2R A;  3GDP A;  3AYJ A;  4J56 A;  2B9Y A;  4GDE A;  5KWF A;  1KNP A;  1CC6 A;  4GAV A;  3SZ0 A;  4D04 A;  1KFY A;  2JB1 A;  4H2Q A;  1E1M A;  3T2Z A;  4YKF A;  4U8O A;  3SM8 A;  2C73 A;  4Z2U A;  4TM3 A;  2XLR A;  1LV0 A;  1LJ1 A;  1KDG A;  4DNA A;  5KVH A;  1S2Y A;  1D4E A;  2YLX A;  1EL7 A;  1GEU A;  4H4S A;  4PAA A;  3EPT A;  1D5T A;  3M0O A;  3T2K A;  1D7L A;  4NEW A;  2XLS A;  1CJ2 A;  1D4D A;  3C96 A;  3DK9 A;  1PBD A;  3NN6 X;  3SZW A;  5IQ4 A;  4J2W A;  4II2 A;  1DOC A;  2BS2 A;  1P2H A;  2EQ9 A;  3K7T A;  2R45 A;  4K7Z A;  4AT0 A;  1OJA A;  2OA1 A;  1P2E A;  5KMR A;  3OZ2 A;  3AE7 A;  1V59 A;  3GRS A;  5JCK A;  4GCM A;  2YG5 A;  3KU9 A;  3SGL A;  1FOH A;  3M13 A;  4APN A;  2C7G A;  2X3N A;  2ZZ0 A;  2BRY A;  3M12 A;  3QJ4 A;  3GDN A;  4USR A;  1S3E A;  1PBB A;  2EQ8 A;  4NNJ A;  1EL9 A;  3LZX A;  1GND A;  4KPR A;  1CHU A;  2CUL A;  3NNE A;  4Z43 A;  1O94 A;  1GER A;  2E1M A;  4H4R A;  3SFE A;  1TDO A;  2H88 A;  2BA9 A;  3NK1 X;  4GRT A;  3FMW A;  3FPZ A;  1XAN A;  3AE4 A;  4J33 A;  3AE8 A;  1H86 A;  4BK3 A;  4OCG A;  2YM1 A;  2YVJ A;  3QFB A;  3AD9 B;  4B63 A;  1F6M A;  4ZN0 A;  5HYM A;  1NHR A;  3I3L A;  1K4Q A;  5J7X A;  1LVL A;  4GF7 A;  4UDP A;  1ZDL A;  3VRA A;  1RP0 A;  2BYB A;  3VR9 A;  2C64 A;  1YQ3 A;  1GTE A;  4B68 A;  4C77 A;  3CIR A;  4USQ A;  1BZL A;  3FBS A;  4TM4 A;  2FJE A;  3AEC A;  3P1W A;  3CTY A;  1RYI A;  3B3R A;  4YSY A;  5CQF A;  4U8P A;  4EQW A;  3AED A;  1H7X A;  2R0C A;  3GMB A;  4Z24 A;  1IUT A;  3CND A;  1CJ3 A;  2PHH A;  2BXR A;  3GWF A;  1N4U A;  3RHA A;  4ECH A;  5KRQ A;  2YLZ A;  1ONF A;  4J36 A;  1SEZ A;  3CPI G;  1LQT A;  1GRG A;  1E1N A;  4O5U A;  4EMI A;  4EQR A;  2Z5X A;  2BCP A;  1PS9 A;  1E7P A;  1E39 A;  3AD8 B;  3I6D A;  1M64 A;  3NRN A;  4C3Y A;  2BCG G;  1GRH A;  2BK4 A;  2XFO A;  4U8L A;  1JU2 A;  5C2T A;  2C65 A;  2V60 A;  3P4Q A;  2XVJ A;  2YQU A;  3ICT A;  4OVI A;  3CGE A;  4YT0 A;  5ER0 A;  1F8R A;  4E0V A;  1MO9 A;  1NAA A;  1PN0 A;  1ZOV A;  4NTD A;  2V3A A;  1N4W A;  5U25 A;  4KX6 A;  3DJG X;  2X8G A;  4H7U A;  4Z44 A;  2WET A;  3NLC A;  4CBQ A;  1IUS A;  3RP6 A;  3WE0 A;  4C5O A;  1PXB A;  3UTH A;  4O5Q A;  2GV8 A;  2A87 A;  4JY3 A;  3AE2 A;  4OPC A;  2E4G A;  2WQY A;  2BK5 A;  2ARD A;  5L46 A;  3D8X A;  2W0H A;  2OLO A;  2WBA A;  5FS9 A;  1FEB A;  3LZW A;  4FDC B;  1FL2 A;  3V3O A;  2CDU A;  2BAB A;  3NN0 X;  2V61 A;  2C75 A;  2X8H A;  2AAQ A;  4FK1 A;  2GQF A;  3IHG A;  1JOA A;  3KA7 A;  4H4W A;  4YKG A;  1GRF A;  3AXB A;  3T31 A;  2C70 A;  2Q0L A;  2YM2 A;  1MOK A;  3JSK A;  3P4R A;  3NGC X;  1D7Y A;  1ZKQ A;  2WDQ A;  1GV4 A;  1ZMC A;  2WDR A;  4YTM A;  1DJN A;  4Y4N A;  2JKC A;  3CGB A;  3C4N A;  2A89 A;  4IA5 A;  4I59 A;  1NDA A;  2X99 A;  1IJH A;  4X9M A;  2XYO A;  1QJD A;  4G73 A; 
#chains in the Genus database with same CATH homology
 2WPE A;  3NIX A;  1E6E A;  1K0J A;  2GRT A;  2VOU A;  1PXA A;  2GR0 A;  2YVF A;  3GYJ A;  3GYX A;  4C3X A;  5HXI A;  2VQ7 A;  2R4E A;  5EB5 A;  4UDQ A;  3QVP A;  5TR3 A;  2Q7V A;  3DH9 A;  3LOV A;  2YLS A;  2XLP A;  1NG3 A;  3HYV A;  1N1P A;  3LXD A;  1DXL A;  2GAG B;  3QSS A;  4NWZ A;  1TDF A;  2FJD A;  4OPU A;  2XVE A;  4CRT A;  1BF3 A;  2VZ2 A;  1PDH A;  4H50 A;  2J3N A;  3L8K A;  2BC1 A;  1XDI A;  4TLZ A;  2JB2 A;  2B7S A;  3CGD A;  3BI2 A;  3FG2 P;  4H4T A;  3SQP A;  3SY4 A;  1Y56 A;  4A5L A;  2XVH A;  1DOB A;  2FJB A;  4XWZ A;  3DA1 A;  5KOX A;  4BJZ A;  3H8I A;  5GSN A;  3GYI A;  2GR2 A;  3ICR A;  1LPF A;  1GET A;  3SXI A;  1NHP A;  3CNP A;  2C3C A;  5IQ1 A;  2YG7 A;  1OJC A;  2ZZB A;  5CKU A;  1CJC A;  2WDV A;  2A8X A;  3T37 A;  2VRM A;  3UTG A;  3Q9T A;  4LA1 A;  2C67 A;  4GR1 A;  1KSS A;  1JEH A;  2EQ6 A;  5BUK A;  4X4J A;  1VQW A;  3R9U A;  1H81 A;  2JB3 A;  2B9W A;  2JK6 A;  2B7R A;  4HB9 A;  4H4Y A;  4LII A;  3B6D A;  4Y4L A;  1PBE A;  2BK3 A;  2XVI A;  3BHK A;  3L1R A;  2DKH A;  1ZP0 A;  4YSZ A;  5BRT A;  3HYW A;  4D03 A;  4J31 A;  4Z25 A;  2YLR A;  4EM3 A;  1GAL A;  2R9Z A;  3S61 A;  2BRA A;  4B65 A;  1EL5 A;  3AEG A;  3RP8 A;  2JBV A;  5FS8 A;  3ADA B;  1GTH A;  1N4V A;  2VQB A;  1IUW A;  1S3B A;  3AE6 A;  3QFA A;  1ZY8 A;  3SZF A;  5HY5 A;  1YKJ A;  1ZMD A;  2X50 A;  3CMM A;  3AEB A;  1IUV A;  3VR8 A;  2C72 A;  3Q6J A;  3ITJ A;  4OPI A;  2BS3 A;  3ABV A;  3QVR A;  3DK4 A;  4H2N A;  4U8K A;  2NVK X;  3UOV A;  3LJP A;  4GUV A;  3AYL A;  4Z2T A;  3IC9 A;  3AE5 A;  2BC0 A;  4NEV A;  4EQX A;  2WPC A;  2YG6 A;  4YSH A;  1DOE A;  1VDC A;  2XFN A;  3P4S A;  3VRB A;  4IVM B;  3F8R A;  3BI5 A;  4Z26 A;  4G74 A;  1BGJ A;  3CNJ A;  1D4C A;  5KMQ A;  4ICY A;  3KKJ A;  4NZH A;  4EQS A;  3RED A;  4TM1 A;  1ELI A;  1ZX9 A;  2R4J A;  2WOW A;  3DGZ A;  2WEU A;  3QSM A;  4X9N A;  2Y6Q A;  3G5S A;  4REK A;  4EM4 A;  3H4K A;  3UCL A;  3NYC A;  3V3N A;  5KXJ A;  1JRY A;  4CY6 A;  4BV6 A;  1TDK A;  1L9D A;  2BAC A;  3AEE A;  4Y4M A;  3UTF A;  3AEF A;  3RNM A;  3ZYX A;  4NTC A;  4B1B A;  3BNU A;  3QSE A;  4RSL A;  1COY A;  5KVI A;  1H6V A;  4B69 A;  1B5Q A;  3CPJ G;  1GSN A;  1CC4 A;  1K0I A;  4LU6 A;  4BUR A;  2YR5 A;  3GMC A;  2IVD A;  2Q6U A;  4AP3 A;  3KD9 A;  5KOW A;  4JY2 A;  4A7A A;  5DBJ A;  4A79 A;  2QA2 A;  4CNJ A;  2TMD A;  3CGC A;  3ISH A;  4GDP A;  1NHS A;  4J57 A;  3NYE A;  4ZCC A;  1DJQ A;  1PJ7 A;  5JCM A;  3H8L A;  3T14 A;  3IWA A;  2XLU A;  1KF6 A;  2JAE A;  1AOG A;  2QA1 A;  2QCU A;  4G6G A;  4U2T A;  4WX1 A;  1Q1W A;  1PBF A;  4GAP A;  1L9E A;  2V5Z A;  5J60 A;  3GWD A;  2AR8 A;  2B76 A;  2UZZ A;  3DJJ A;  1KNR A;  3DK8 A;  4OPG A;  5JCN A;  4NTE A;  2CFY A;  1F8W A;  2BS4 A;  5EOW A;  2YAU A;  3SYI A;  4EMJ A;  1H84 A;  3BNM A;  4K22 A;  1B8S A;  1GRB A;  1VRQ B;  2VRL A;  3CNS A;  4YTP A;  2RGH A;  1PBC A;  3ICS A;  3EAO A;  4RG4 A;  5BUL A;  2OLN A;  1FEA A;  4UDR A;  4A65 A;  2YR6 A;  1ZK7 A;  2V6O A;  3URH A;  2I0Z A;  3KPF A;  3UKH A;  1JRZ A;  1PJ6 A;  4ADW A;  2BXS A;  1LTX R;  3ALM A;  1QO8 A;  2YG4 A;  4U8I A;  3RP7 A;  1NHQ A;  1W4X A;  2GB0 A;  2YG3 A;  2X8C A;  4XWR A;  1E1L A;  5M0Z A;  2WS3 A;  3ALJ A;  1NEN A;  5LV9 A;  1EL8 A;  2ZZC A;  1PXC A;  3ATQ A;  2GMH A;  4II3 A;  3ALL A;  4P9S A;  4YXD A;  4U8M A;  1M6I A;  3DME A;  2GAH B;  5U63 A;  3F8P A;  2ZBW A;  2WP6 A;  1Y56 B;  3NT6 A;  3SFD A;  3DGH A;  3GRT A;  3D1C A;  3HZL A;  1PHH A;  1L0V A;  2IVE A;  3AE1 A;  2VVL A;  3NTD A;  3AYI A;  1O95 A;  4Z2R A;  2GQW A;  1O5W A;  3UTE A;  3KVE A;  3O0H A;  3UKF A;  3E1T A;  1NG4 A;  3IHM A;  4JQ9 A;  1Q1R A;  2NPX A;  1KSU A;  1IUX A;  2WES A;  1GXF A;  2AQJ A;  2Z5Y A;  1NEK A;  4DSH A;  5EB4 A;  5KMP A;  3K7Q X;  4G6H A;  5KNL A;  3GSI A;  4M52 A;  3AD7 B;  3ATR A;  3NG7 X;  4CCR A;  4A9W A;  5KMS A;  2WP9 A;  2O9Z A;  4PAB A;  4WCT A;  1FCD A;  3AE9 A;  4K8D A;  3UKK A;  4H4Z A;  1VG0 A;  1TDE A;  2GH5 A;  2OAL A;  3SZC A;  2HQM A;  4FX9 A;  3G5Q A;  1F8S A;  2GMJ A;  4MJW A;  3OC4 A;  2XFQ A;  3COX A;  5FS7 A;  2Y6R A;  1E1K A;  5IPY A;  4JNA A;  4YWO A;  2Q0K A;  2XDO A;  3NKS A;  3T0K A;  3AB1 A;  1H82 A;  1PJ5 A;  2GEW A;  3IF9 A;  4H4Q A;  1GT8 A;  2YLT A;  1OJ9 A;  2RGO A;  3LB8 A;  1GRE A;  3AWI A;  4JDR A;  1GES A;  1BGN A;  1H83 A;  4U8J A;  1OJT A;  1CBO A;  1CL0 A;  2E5V A;  3C4A A;  5C3J A;  4BK2 A;  3HYX A;  2RAB A;  4U2L A;  4ZCD A;  2YWL A;  5GRT A;  4CY8 A;  3NK0 X;  1XPQ A;  2XVF A;  4TM0 A;  3UOX A;  2CVJ A;  4JNQ A;  2APG A;  3DJD A;  3NYF A;  4A99 A;  3CPH G;  2B9X A;  2C3D A;  3FIM B;  3LAD A;  4FK1 C;  2XFP A;  4H4X A;  4K5S A;  2C66 A;  4N9X A;  4B67 A;  3AEA A;  4K2X A;  2GVC A;  4C74 A;  1GRA A;  1GRT A;  2FBW A;  1F3P A;  3P4P A;  1B4V A;  1K0L A;  1YQ4 A;  3PS9 A;  2GR3 A;  4J34 A;  2YR4 A;  1TYT A;  4IA6 A;  3ZDN A;  3DJE A;  1BWC A;  3UKP A;  1CJ4 A;  5HHF A;  1YQZ A;  1REO A;  4IV9 A;  3GD4 A;  3AE3 A;  3SX6 A;  4B66 A;  1LQU A;  4H2P A;  5M10 A;  1JNR A;  2ACZ A;  2YLW A;  4OPT A;  1DNC A;  3S5W A;  4EMW A;  2WP5 A;  1IUU A;  4HA6 A;  2H89 A;  1MXT A;  3VQR A;  1QLB A;  3T2Y A;  2WU5 A;  4BK1 A;  4CCQ A;  3EF6 A;  5FMH A;  1ZOY A;  1VG9 A;  1NPX A;  1Z6L A;  2R0P A;  2C76 A;  4B64 A;  4JN9 A;  2R0G A;  2XCG A;  1RSG A;  1BKW A;  1FEC A;  1HYU A;  2PYX A;  2VVL G;  3P9U A;  3KPK A;  3BHF A;  2FJA A;  4DGK A;  4U2S A;  4YSX A;  1EBD A;  2IID A;  3PVC A;  1OJD A;  2EQ7 A;  4K5R A;  4OPL A;  4UP3 A;  2QAE A;  2RGJ A;  3UKL A;  3UP5 A;  4OPD A;  4CNK A;  5BVA A;  3CN8 A;  3NH3 X;  3UKA A;  1TYP A;  2WU2 A;  4TLX A;  2TPR A;  4H4V A;  4XXG A;  3UOZ A;  2GF3 A;  2XFU A;  4DSG A;  4H4P A;  2WHD A;  4IVO B;  2C4C A;  5FS6 A;  1H7W A;  3K7M X;  1CF3 A;  1TDN A;  3EAN A;  2DKI A;  3UOY A;  1GPE A;  5JCL A;  3K30 A;  3NTA A;  2OAM A;  2R46 A;  4EIP A;  1CC2 A;  2WPF A;  1B37 A;  1Q9I A;  4BJY A;  2XLT A;  3G5R A;  1GOS A;  1JNZ A;  3V76 A;  3F8D A;  1S2Q A;  3II4 A;  4AP1 A;  4I58 A;  4A6N A;  4RG3 A;  4A6N B;  2VVM A;  1DOD A;  1X31 B;  3GD3 A;  2F5Z A;  3KLJ A;  4AOS A;  1Y0P A;  5EBK A;  5JCI A;  1TRB A;  2GR1 A;  3PO7 A;  2V3B A;  1YY5 A;  4AT2 A;  1L9C A;  4U8N A;  3UKQ A;  1JRX A;  3NHO X;  3UP4 A;  4EIQ A;  5U1O A;  2WOI A;  4H4U A;  1XHC A;  2YVG A;  2WOV A;  3BI4 A;  4G9K A;  3VRD B;  4AOX A;  1UKV G;  4YTN A;  3NK2 X;  3CNT A;  4H2R A;  3GDP A;  3AYJ A;  4J56 A;  2B9Y A;  4GDE A;  5KWF A;  1KNP A;  1CC6 A;  4GAV A;  3SZ0 A;  4D04 A;  1KFY A;  2JB1 A;  4H2Q A;  1E1M A;  3T2Z A;  4YKF A;  4U8O A;  3SM8 A;  2C73 A;  4Z2U A;  4TM3 A;  2XLR A;  1LV0 A;  1LJ1 A;  1KDG A;  4DNA A;  5KVH A;  1S2Y A;  1D4E A;  2YLX A;  1EL7 A;  1GEU A;  4H4S A;  4PAA A;  3EPT A;  1D5T A;  3M0O A;  3T2K A;  1D7L A;  4NEW A;  2XLS A;  1CJ2 A;  1D4D A;  3C96 A;  3DK9 A;  1PBD A;  3NN6 X;  3SZW A;  5IQ4 A;  4J2W A;  4II2 A;  1DOC A;  2BS2 A;  1P2H A;  2EQ9 A;  3K7T A;  2R45 A;  4K7Z A;  4AT0 A;  1OJA A;  2OA1 A;  1P2E A;  5KMR A;  3OZ2 A;  3AE7 A;  1V59 A;  3GRS A;  5JCK A;  4GCM A;  2YG5 A;  3KU9 A;  3SGL A;  1FOH A;  3M13 A;  4APN A;  2C7G A;  2X3N A;  2ZZ0 A;  2BRY A;  3M12 A;  3QJ4 A;  3GDN A;  4USR A;  1S3E A;  1PBB A;  2EQ8 A;  4NNJ A;  1EL9 A;  3LZX A;  1GND A;  4KPR A;  1CHU A;  2CUL A;  3NNE A;  4Z43 A;  1O94 A;  1GER A;  2E1M A;  4H4R A;  3SFE A;  1TDO A;  2H88 A;  2BA9 A;  3NK1 X;  4GRT A;  3FMW A;  3FPZ A;  1XAN A;  3AE4 A;  4J33 A;  3AE8 A;  1H86 A;  4BK3 A;  4OCG A;  2YM1 A;  2YVJ A;  3QFB A;  3AD9 B;  4B63 A;  1F6M A;  4ZN0 A;  5HYM A;  1NHR A;  3I3L A;  1K4Q A;  5J7X A;  1LVL A;  4GF7 A;  4UDP A;  1ZDL A;  3VRA A;  1RP0 A;  2BYB A;  3VR9 A;  2C64 A;  1YQ3 A;  1GTE A;  4B68 A;  4C77 A;  3CIR A;  4USQ A;  1BZL A;  3FBS A;  4TM4 A;  2FJE A;  3AEC A;  3P1W A;  3CTY A;  1RYI A;  3B3R A;  4YSY A;  5CQF A;  4U8P A;  4EQW A;  3AED A;  1H7X A;  2R0C A;  3GMB A;  4Z24 A;  1IUT A;  3CND A;  1CJ3 A;  2PHH A;  2BXR A;  3GWF A;  1N4U A;  3RHA A;  4ECH A;  5KRQ A;  2YLZ A;  1ONF A;  4J36 A;  1SEZ A;  3CPI G;  1LQT A;  1GRG A;  1E1N A;  4O5U A;  4EMI A;  4EQR A;  2Z5X A;  2BCP A;  1PS9 A;  1E7P A;  1E39 A;  3AD8 B;  3I6D A;  1M64 A;  3NRN A;  4C3Y A;  2BCG G;  1GRH A;  2BK4 A;  2XFO A;  4U8L A;  1JU2 A;  5C2T A;  2C65 A;  2V60 A;  3P4Q A;  2XVJ A;  2YQU A;  3ICT A;  4OVI A;  3CGE A;  4YT0 A;  5ER0 A;  1F8R A;  4E0V A;  1MO9 A;  1NAA A;  1PN0 A;  1ZOV A;  4NTD A;  2V3A A;  1N4W A;  5U25 A;  4KX6 A;  3DJG X;  2X8G A;  4H7U A;  4Z44 A;  2WET A;  3NLC A;  4CBQ A;  1IUS A;  3RP6 A;  3WE0 A;  4C5O A;  1PXB A;  3UTH A;  4O5Q A;  2GV8 A;  2A87 A;  4JY3 A;  3AE2 A;  4OPC A;  2E4G A;  2WQY A;  2BK5 A;  2ARD A;  5L46 A;  3D8X A;  2W0H A;  2OLO A;  2WBA A;  5FS9 A;  1FEB A;  3LZW A;  4FDC B;  1FL2 A;  3V3O A;  2CDU A;  2BAB A;  3NN0 X;  2V61 A;  2C75 A;  2X8H A;  2AAQ A;  4FK1 A;  2GQF A;  3IHG A;  1JOA A;  3KA7 A;  4H4W A;  4YKG A;  1GRF A;  3AXB A;  3T31 A;  2C70 A;  2Q0L A;  2YM2 A;  1MOK A;  3JSK A;  3P4R A;  3NGC X;  1D7Y A;  1ZKQ A;  2WDQ A;  1GV4 A;  1ZMC A;  2WDR A;  4YTM A;  1DJN A;  4Y4N A;  2JKC A;  3CGB A;  3C4N A;  2A89 A;  4IA5 A;  4I59 A;  1NDA A;  2X99 A;  1IJH A;  4X9M A;  2XYO A;  1QJD A;  4G73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...