3K7QX

Crystal structure of substrate-bound 6-hydroxy-l-nicotine oxidase from arthrobacter nicotinovorans
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 147
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7qX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7qX02
4OPLA 1TDFA 1PJ5A 2GAGB 2XLUA 2XVFA 2Q7VA 2V6OA 4UDRA 3NNEA 4NTCA 4X9NA 1IUSA 3DK9A 1NAAA 4H4XA 4YWOA 4CCRA 1YKJA 4CRTA 4JY2A 4EQXA 4K2XA 1CBOA 3UOVA 4YSZA 2VRLA 3ISHA 1P2HA 1Z6LA 3KKJA 4J33A 2NPXA 3NKSA 5C3JA 4U8IA 4XXGA 2JAEA 4I58A 1EL5A 2YVFA 2XYOA 4Z24A 1YY5A 4OPGA 1E39A 4H50A 1PBFA 4U8LA 1TDKA 1VG9A 3F8DA 3S5WA 2Y6RA 3KA7A 1O95A 3OC4A 3AEGA 3KVEA 1IUWA 1DXLA 4H4RA 4OPDA 2VQBA 4Y4NA 1ELIA 5U63A 2XLTA 4AOXA 3K7TA 5BUKA 4J31A 2RABA 3DGZA 4U8JA 4FDCB 2YR6A 3ALLA 4K5RA 5C2TA 4HB9A 4RG4A 1HYUA 2OA1A 3GD3A 2VVLG 2X50A 3O0HA 1GXFA 3FBSA 2RGHA 1QLBA 2XFNA 1ZOVA 2YLWA 3DMEA 2EQ8A 3DGHA 3RNMA 3BHKA 2BXSA 2TMDA 2RGOA 1NHPA 1E1NA 1RP0A 1GETA 4A6NB 2GMHA 4B69A 3LZXA 1S3BA 2CDUA 3AE4A 4JQ9A 2WP9A 4BK2A 1YQZA 5JCIA 4EM3A 2X8GA 5FS7A 3OZ2A 4GDPA 1CJ4A 2AAQA 1EL9A 4ZCDA 4H7UA 5LV9A 4TM1A 2XLPA 4LU6A 4YKFA 4H4ZA 3CGDA 4EIQA 4WX1A 4A99A 4U8NA 5IQ4A 2GEWA 1NG3A 4N9XA 4TLXA 2BS3A 4AT0A 4Z26A 3RP6A 1K0JA 3GDPA 1L9DA 4U8PA 1D4DA 2JB3A 1JNRA 4H4WA 2B9XA 2ZZBA 1QO8A 2ZZCA 4PABA 4TM4A 3C4NA 2BA9A 5J7XA 2ARDA 3PS9A 1F8SA 3LZWA 1N4WA 5BRTA 1DJQA 1O94A 3AE6A 1JOAA 3Q6JA 3R9UA 2JKCA 3CPIG 2A89A 4O5QA 1CF3A 2C66A 3NLCA 2BABA 1H84A 1OJTA 2YLZA 5CQFA 1P2EA 4H2RA 3S61A 2WOWA 5M10A 1MXTA 3DJGX 1MOKA 2XDOA 1VG0A 5EB4A 4EQWA 1PXAA 3CNPA 4P9SA 4ZCCA 1B4VA 2R9ZA 1KSUA 2J3NA 3AB1A 3IF9A 4USQA 2OLNA 4BK1A 4PAAA 5DBJA 4ZN0A 1PBDA 1KDGA 1CJ3A 2W0HA 1H83A 1M64A 3C4AA 4BK3A 1KSSA 1UKVG 2C3CA 3ITJA 2WHDA 4CCQA 2BACA 2YG3A 3P4PA 2CULA 3CNSA 3VR8A 5U1OA 4B63A 2GAHB 1CC6A 2GV8A 2V3AA 2WU2A 2O9ZA 3DJJA 3AE2A 1ZDLA 4UDPA 3AE9A 3QVRA 3SQPA 2GMJA 4Y4LA 4EMWA 4A5LA 3V76A 2WOIA 2GR3A 1L9CA 2JK6A 3KPFA 2GR1A 4Z44A 4OPUA 2Z5XA 4Z2TA 2C65A 1B8SA 2R0GA 2YM2A 2NVKX 3D8XA 3F8PA 3NT6A 3PO7A 1BZLA 3VRAA 2YLRA 1LQUA 3CGBA 4EIPA 3ICRA 4H4PA 3UTHA 5BULA 4AOSA 5HYMA 2YG6A 4YTMA 3SGLA 2YR4A 3UP4A 2WOVA 3QSSA 4TM0A 2WPEA 1CC4A 2R4JA 3EF6A 4I59A 4KPRA 4USRA 2C67A 4UP3A 3M12A 1F8WA 1VRQB 3LADA 1GRTA 1Y56A 2AR8A 2X99A 2VOUA 3AEAA 3GRSA 1L0VA 3NHOX 1EL8A 1OJDA 2VVLA 3H8IA 1XANA 4XWZA 2BCPA 1PHHA 1N4VA 2RGJA 2YWLA 3DA1A 5FS6A 3UTEA 2BC1A 3IC9A 2JB1A 3P9UA 4IA5A 4CY6A 1TDNA 1FECA 1PBEA 1PBBA 4H4SA 4UDQA 1ZP0A 2YM1A 3ATQA 1IJHA 2C76A 2GR2A 2WDQA 1LQTA 3SM8A 2GQWA 3CNDA 1BWCA 1YQ3A 3ABVA 3FPZA 4LA1A 1H7WA 4O5UA 4C3YA 4D04A 1EBDA 3QSMA 1GOSA 1ZK7A 1K0IA 1YQ4A 3UKFA 4JY3A 1B5QA 2YG7A 3RP8A 3CPJG 2V60A 1Q1WA 5FS8A 1LPFA 3AXBA 2I0ZA 1LV0A 3IWAA 3LB8A 3NIXA 4YSHA 2GF3A 2XLSA 3IHMA 4K7ZA 3GWFA 1MO9A 1NENA 2WPFA 3AEBA 3H8LA 2FBWA 5JCLA 1GT8A 2QA1A 2B76A 1O5WA 4OPTA 5HHFA 4B68A 1S2YA 3UOXA 4EM4A 1KNPA 4J34A 4AP1A 4IA6A 1M6IA 5FS9A 3NTAA 1K0LA 3QFAA 4EQSA 2WPCA 3ATRA 3UCLA 1LVLA 1GRHA 2VRMA 4K22A 5KOXA 2XVEA 3WE0A 3DK8A 3VR9A 3NN6X 1GRFA 2R45A 4OVIA 3ZDNA 2X3NA 1BF3A 4GRTA 1GEUA 3II4A 1Q9IA 3CGEA 3G5SA 1GRAA 4JDRA 1LJ1A 1NHRA 2EQ6A 5M0ZA 1DOEA 3DH9A 2DKIA 3NK0X 1GV4A 3SFEA 1CC2A 3BI2A 2H88A 4GCMA 4OPIA 1D7YA 2QA2A 2A87A 2BK5A 2CFYA 3EPTA 2EQ7A 2WP5A 2WDVA 1S2QA 4TLZA 4B65A 2R0CA 4YKGA 2WU5A 3GD4A 3COXA 3UTGA 3VRDB 1NHQA 3E1TA 3NK1X 1NG4A 3NTDA 2WQYA 4TM3A 5U25A 1PXBA 2WBAA 4M52A 1ZX9A 2Q6UA 4J56A 1ONFA 1E7PA 1ZMCA 3AYLA 1DOCA 5GSNA 3AE3A 4HA6A 4B1BA 1GSNA 1H6VA 3K7QX 1KFYA 3P4SA 4OPCA 3K30A 4XWRA 2BC0A 4U2TA 1JNZA 3BNMA 4B64A 2C70A 2OALA 3QJ4A 3P4RA 4H4TA 1JU2A 2QAEA 2QCUA 2A8XA 4APNA 2E4GA 4H4UA 2YQUA 3GWDA 1D4CA 1D7LA 1IUTA 2BYBA 5EB5A 4X4JA 2FJAA 1L9EA 2GR0A 3ALJA 3CN8A 4K5SA 1W4XA 1JRXA 1GPEA 4EQRA 3AYJA 4NTDA 3JSKA 2YG4A 3UKLA 1GTEA 2VZ2A 4ADWA 5JCNA 3NK2X 1TDOA 2R46A 5L46A 1BGJA 2BS2A 5FMHA 5BVAA 1PJ7A 4RG3A 2GRTA 3L1RA 1E1MA 2PHHA 2V3BA 2VVMA 3QSEA 5TR3A 2V61A 4B67A 1RSGA 3KU9A 1NDAA 2B9WA 4ICYA 4A65A 2BK4A 3LOVA 1H82A 4YTPA 1TRBA 2C3DA 2R0PA 3M13A 2Q0KA 2WS3A 2IIDA 1TDEA 4GF7A 1GERA 1B37A 3GMBA 1JRZA 4OCGA 3UOYA 4BJYA 1NPXA 4DSGA 4J2WA 2OLOA 1KNRA 4CBQA 4Z43A 4DSHA 3NRNA 3Q9TA 3UP5A 1F6MA 1QJDA 1E1LA 2YLXA 3AE1A 3GSIA 5KRQA 3AE7A 2F5ZA 3ALMA 3NN0X 1GNDA 3UOZA 3LJPA 4FX9A 1GESA 2HQMA 4AP3A 3QFBA 2E1MA 2YLSA 4Z2RA 4WCTA 2X8CA 3I6DA 1PBCA 4REKA 1PJ6A 2BS4A 2CVJA 1N1PA 2WESA 1K4QA 3F8RA 4H4VA 4LIIA 3UTFA 1ZKQA 3KD9A 3FIMB 2C7GA 1PDHA 1F8RA 2PYXA 2AQJA 5ER0A 4C5OA 4J57A 2GVCA 1XDIA 1FL2A 3PVCA 5GRTA 4CNKA 2C73A 2BXRA 4H2QA 3QVPA 5JCKA 4A6NA 1LTXR 3ICSA 1PN0A 1GREA 1E6EA 3AD9B 4C74A 3L8KA 4KX6A 1S3EA 5KVIA 2B7RA 4X9MA 3ADAB 2B7SA 4Y4MA 2C75A 2IVEA 4FK1A 4NEWA 3FG2P 4EMIA 4IVMB 5IQ1A 3DK4A 1GRBA 3G5QA 4CY8A 4U8KA 4YSXA 3CNTA 3GRTA 3EAOA 5HY5A 1Y56B 4NZHA 1REOA 3P4QA 4ECHA 1AOGA 2FJBA 4YTNA 3GYIA 1D4EA 4IV9A 4Z25A 3UKQA 1IUVA 3BNUA 2YR5A 1Y0PA 1X31B 1IUXA 2XCGA 3B6DA 1CJCA 1F3PA 3K7MX 3M0OA 2XVIA 5HXIA 4JNQA 3UKPA 2R4EA 5EOWA 1TYTA 2XFPA 3CPHG 4GUVA 3RHAA 4B66A 5CKUA 1H86A 1PS9A 4MJWA 3NG7X 4U8MA 4A9WA 3AD7B 2YVJA 1GTHA 3DJDA 4H4QA 3AEEA 1JEHA 3AE5A 3AEDA 3HZLA 4GDEA 4RSLA 3REDA 3GYJA 2ACZA 2C64A 3RP7A 1DJNA 1PXCA 1SEZA 1TYPA 2ZBWA 4DGKA 1GRGA 4NEVA 3AD8B 3UKKA 2GB0A 3BHFA 4Z2UA 1ZY8A 1IUUA 4DNAA 3NH3X 1H81A 2IVDA 3VQRA 1OJ9A 2YLTA 1RYIA 3CTYA 5IPYA 1KF6A 2XVJA 2JBVA 4YT0A 5KXJA 1EL7A 3URHA 1V59A 1NEKA 2JB2A 3CIRA 4U2LA 3AYIA 4YSYA 3CGCA 4H2NA 2C72A 1ZOYA 5KOWA 4C77A 2DKHA 2XVHA 2XFOA 3UKHA 4JN9A 3DJEA 3G5RA 4BV6A 2EQ9A 5KVHA 3V3NA 5J60A 1ZMDA 4D03A 2OAMA 2BCGG 2YG5A 5EBKA 3UKAA 1DOBA 1CL0A 3KLJA 3ICTA 4YXDA 2Z5YA 3GDNA 2B9YA 4U2SA 4J36A 4H4YA 2APGA 3B3RA 4GR1A 2UZZA 4C3XA 2FJDA 3H4KA 1GALA 4NTEA 2V5ZA 3C96A 3AE8A 3ZYXA 3I3LA 1FEBA 2WETA 5KWFA 3EANA 1OJCA 1COYA 1VQWA 4A7AA 4BURA 1DODA 1VDCA 3SFDA 4JNAA 4A79A 3D1CA 3T37A 4U8OA 4BJZA 3LXDA 1CHUA 2GQFA 2ZZ0A 4H2PA 1D5TA 2XFUA 2TPRA 3BI5A 2E5VA 3FMWA 2BK3A 3V3OA 1E1KA 1JRYA 3NYFA 4AT2A 3AWIA 1N4UA 2H89A 4K8DA 1H7XA 1FCDA 1XHCA 2Q0LA 2WEUA 3AEFA 1DNCA 3BI4A 1OJAA 2FJEA 2X8HA 2GH5A 3NGCX 2XFQA 4FK1C 1CJ2A 1FOHA 4CNJA 3AECA 4IVOB 3VRBA 1BGNA 1XPQA 4EMJA 1FEAA 3CNJA 5JCMA 3NYEA 4E0VA 2XLRA 2Y6QA 2YVGA 1BKWA 2YAUA 3P1WA 3GMCA 1NHSA 2WDRA 1Q1RA 2WP6A 2VQ7A 3IHGA 3NYCA
chains in the Genus database with same CATH superfamily
4OPLA 1TDFA 1PJ5A 2GAGB 2XLUA 2XVFA 2Q7VA 2V6OA 4UDRA 3NNEA 4NTCA 4X9NA 1IUSA 3DK9A 4G6HA 1NAAA 4H4XA 4YWOA 4CCRA 1YKJA 4CRTA 4JY2A 4EQXA 4K2XA 1CBOA 3UOVA 4YSZA 2VRLA 3ISHA 1P2HA 1Z6LA 3KKJA 4J33A 2NPXA 3NKSA 5C3JA 4U8IA 4G74A 4XXGA 2JAEA 4I58A 1EL5A 2YVFA 2XYOA 4Z24A 3KPKA 1YY5A 4OPGA 1E39A 4H50A 1PBFA 4U8LA 1TDKA 1VG9A 3F8DA 3S5WA 2Y6RA 3KA7A 1O95A 3OC4A 3AEGA 3KVEA 1IUWA 1DXLA 4H4RA 4OPDA 2VQBA 3T14A 3T2ZA 4Y4NA 1ELIA 5U63A 2XLTA 4AOXA 3K7TA 5BUKA 4J31A 2RABA 3DGZA 4U8JA 4FDCB 2YR6A 3ALLA 4K5RA 5C2TA 4HB9A 5KMPA 4RG4A 1HYUA 2OA1A 3GD3A 2VVLG 2X50A 3O0HA 1GXFA 3FBSA 2RGHA 1QLBA 2XFNA 1ZOVA 2YLWA 3DMEA 2EQ8A 3DGHA 3RNMA 3BHKA 2BXSA 2TMDA 2RGOA 1NHPA 1E1NA 1RP0A 1GETA 4A6NB 2GMHA 4B69A 3LZXA 1S3BA 2CDUA 3AE4A 4JQ9A 2WP9A 4BK2A 1YQZA 5JCIA 4EM3A 2X8GA 5FS7A 3OZ2A 4GDPA 1CJ4A 2AAQA 1EL9A 4ZCDA 3T2YA 4H7UA 5LV9A 4TM1A 2XLPA 4LU6A 4YKFA 4H4ZA 3CGDA 4EIQA 4G6GA 4WX1A 4A99A 4U8NA 5IQ4A 2GEWA 1NG3A 4N9XA 4TLXA 2BS3A 4AT0A 4Z26A 3RP6A 1K0JA 3GDPA 1L9DA 4U8PA 1D4DA 2JB3A 1JNRA 4H4WA 2B9XA 2ZZBA 1QO8A 2ZZCA 4PABA 4TM4A 3C4NA 2BA9A 5J7XA 2ARDA 3PS9A 1F8SA 3LZWA 1N4WA 5BRTA 1DJQA 1O94A 3AE6A 1JOAA 3Q6JA 3R9UA 2JKCA 3SZFA 3CPIG 2A89A 4O5QA 1CF3A 2C66A 3NLCA 2BABA 1H84A 1OJTA 2YLZA 5CQFA 1P2EA 4H2RA 3S61A 2WOWA 5M10A 1MXTA 3DJGX 1MOKA 2XDOA 1VG0A 5EB4A 4EQWA 1PXAA 3CNPA 4P9SA 4ZCCA 1B4VA 2R9ZA 1KSUA 2J3NA 3AB1A 3IF9A 4USQA 2OLNA 4BK1A 4PAAA 5DBJA 4ZN0A 1PBDA 1KDGA 1CJ3A 2W0HA 1H83A 1M64A 3C4AA 4BK3A 4NNJA 1KSSA 1UKVG 2C3CA 3ITJA 2WHDA 4CCQA 2BACA 2YG3A 3P4PA 2CULA 3CNSA 3VR8A 5U1OA 4B63A 2GAHB 1CC6A 2GV8A 2V3AA 2WU2A 2O9ZA 3DJJA 3AE2A 1ZDLA 4UDPA 3AE9A 3QVRA 3SQPA 2GMJA 4Y4LA 4EMWA 4A5LA 3V76A 2WOIA 2GR3A 1L9CA 2JK6A 3KPFA 2GR1A 4Z44A 4OPUA 2Z5XA 4Z2TA 2C65A 1B8SA 2R0GA 2YM2A 2NVKX 3D8XA 3F8PA 3NT6A 3PO7A 1BZLA 3VRAA 2YLRA 1LQUA 3CGBA 4EIPA 3ICRA 4H4PA 3UTHA 5BULA 4AOSA 5HYMA 2YG6A 4YTMA 3SGLA 2YR4A 3UP4A 2WOVA 3QSSA 3SYIA 4TM0A 2WPEA 1CC4A 2R4JA 3EF6A 4I59A 4KPRA 4USRA 2C67A 4UP3A 3M12A 1F8WA 1VRQB 3LADA 1GRTA 1Y56A 2AR8A 2X99A 2VOUA 3AEAA 3GRSA 4G73A 3NHOX 1EL8A 1L0VA 1OJDA 2VVLA 3H8IA 3SZ0A 1XANA 4XWZA 2BCPA 1PHHA 1N4VA 2RGJA 2YWLA 3DA1A 5FS6A 3UTEA 2BC1A 3IC9A 2JB1A 3P9UA 4IA5A 4CY6A 1TDNA 1FECA 1PBEA 1PBBA 4H4SA 4UDQA 1ZP0A 2YM1A 3ATQA 1IJHA 2C76A 2GR2A 2WDQA 1LQTA 3SM8A 2GQWA 3CNDA 1BWCA 1YQ3A 3ABVA 3FPZA 4LA1A 1H7WA 4O5UA 4C3YA 4D04A 1EBDA 3QSMA 4NWZA 1GOSA 1ZK7A 3T0KA 1K0IA 1YQ4A 3UKFA 4JY3A 1B5QA 2YG7A 3RP8A 3CPJG 2V60A 1Q1WA 5FS8A 1LPFA 3AXBA 2I0ZA 1LV0A 5KNLA 3IWAA 3LB8A 3NIXA 4YSHA 2GF3A 2XLSA 3IHMA 4K7ZA 3GWFA 1MO9A 1NENA 2WPFA 3AEBA 3H8LA 2FBWA 5JCLA 1GT8A 2QA1A 2B76A 1O5WA 4OPTA 3T2KA 5HHFA 4B68A 1S2YA 3UOXA 4EM4A 1KNPA 4J34A 4AP1A 4IA6A 1M6IA 5FS9A 3NTAA 1K0LA 3QFAA 4EQSA 2WPCA 3ATRA 3UCLA 1LVLA 1GRHA 2VRMA 4K22A 5KOXA 2XVEA 3WE0A 3DK8A 2BRAA 3VR9A 5KMQA 3NN6X 1GRFA 2R45A 4OVIA 3ZDNA 2X3NA 1BF3A 4GRTA 1GEUA 3II4A 1Q9IA 3CGEA 3G5SA 3SXIA 1GRAA 4JDRA 1LJ1A 1NHRA 2EQ6A 5M0ZA 1DOEA 3DH9A 3HYVA 2DKIA 3NK0X 1GV4A 5KMRA 4GAVA 3SFEA 1CC2A 3BI2A 2H88A 4GCMA 4OPIA 1D7YA 2QA2A 2A87A 2BK5A 2CFYA 3EPTA 4II3A 2EQ7A 2WP5A 2WDVA 1S2QA 4TLZA 4B65A 2R0CA 4YKGA 2WU5A 3GD4A 3COXA 3CMMA 3UTGA 4G9KA 1NHQA 3E1TA 3NK1X 1NG4A 3NTDA 2WQYA 4TM3A 3VRDB 5U25A 1PXBA 2WBAA 4M52A 1ZX9A 2Q6UA 4J56A 1ONFA 1E7PA 1ZMCA 3AYLA 1DOCA 5GSNA 3AE3A 4HA6A 4B1BA 1GSNA 1H6VA 3K7QX 1KFYA 3P4SA 4OPCA 3K30A 4XWRA 2BC0A 4U2TA 1JNZA 3BNMA 4B64A 2C70A 2OALA 3QJ4A 3P4RA 4H4TA 1JU2A 2QAEA 2QCUA 2A8XA 4GAPA 3SZCA 4APNA 2E4GA 4H4UA 2YQUA 3GWDA 1D4CA 1D7LA 1IUTA 2BYBA 5EB5A 4X4JA 2FJAA 1L9EA 2GR0A 3ALJA 3CN8A 4K5SA 1W4XA 1JRXA 1GPEA 4EQRA 3AYJA 4NTDA 3JSKA 2YG4A 3UKLA 1GTEA 2VZ2A 4ADWA 5JCNA 3NK2X 1TDOA 2R46A 5L46A 1BGJA 2BS2A 5FMHA 5BVAA 1PJ7A 4RG3A 2GRTA 3L1RA 1E1MA 2PHHA 2V3BA 2VVMA 3QSEA 5TR3A 2V61A 4B67A 3SZWA 1RSGA 3KU9A 1NDAA 2B9WA 4ICYA 4A65A 2BK4A 3LOVA 1H82A 4YTPA 1TRBA 2C3DA 2R0PA 3M13A 2Q0KA 2WS3A 2IIDA 1TDEA 4GF7A 1GERA 1B37A 3GMBA 1JRZA 4OCGA 3UOYA 4BJYA 1NPXA 4DSGA 4J2WA 3SX6A 2OLOA 1KNRA 4CBQA 4Z43A 4DSHA 3NRNA 3Q9TA 3UP5A 1F6MA 1QJDA 1E1LA 2YLXA 3AE1A 3GSIA 5KRQA 3AE7A 2F5ZA 3ALMA 3NN0X 1GNDA 3UOZA 3LJPA 4FX9A 1GESA 2HQMA 4AP3A 3QFBA 2E1MA 3T31A 2YLSA 4Z2RA 4WCTA 2X8CA 3I6DA 1PBCA 4REKA 1PJ6A 2BS4A 2CVJA 1N1PA 2WESA 1K4QA 3F8RA 4H4VA 4LIIA 3UTFA 1ZKQA 3KD9A 3FIMB 2C7GA 1PDHA 1F8RA 2PYXA 2AQJA 5ER0A 4C5OA 4J57A 2GVCA 1XDIA 1FL2A 3PVCA 5GRTA 4CNKA 2C73A 2BXRA 4H2QA 3QVPA 5JCKA 4A6NA 1LTXR 3ICSA 1PN0A 1GREA 1E6EA 3AD9B 4C74A 3L8KA 4KX6A 1S3EA 5KVIA 3HYWA 2B7RA 4X9MA 3ADAB 2B7SA 4Y4MA 2C75A 2IVEA 4FK1A 4NEWA 3FG2P 4EMIA 4IVMB 5IQ1A 3DK4A 1GRBA 3G5QA 4CY8A 4U8KA 4YSXA 3CNTA 3GRTA 3EAOA 5HY5A 1Y56B 4NZHA 1REOA 3P4QA 4ECHA 1AOGA 2FJBA 4YTNA 3GYIA 1D4EA 4IV9A 4Z25A 3UKQA 1IUVA 3BNUA 2YR5A 1Y0PA 1X31B 1IUXA 2XCGA 3B6DA 1CJCA 1F3PA 3K7MX 3M0OA 2XVIA 5HXIA 4JNQA 3UKPA 2R4EA 5EOWA 1TYTA 2XFPA 3CPHG 4GUVA 3SY4A 3RHAA 4B66A 5CKUA 1H86A 1PS9A 4MJWA 3NG7X 4U8MA 4A9WA 3AD7B 2YVJA 1GTHA 3DJDA 4H4QA 3AEEA 1JEHA 3AE5A 3AEDA 3HZLA 4GDEA 4RSLA 3REDA 3GYJA 2ACZA 2C64A 3RP7A 1DJNA 1PXCA 1SEZA 1TYPA 2ZBWA 4DGKA 1GRGA 4NEVA 3AD8B 3UKKA 2GB0A 3BHFA 4Z2UA 1ZY8A 1IUUA 4DNAA 3NH3X 1H81A 2IVDA 3VQRA 1OJ9A 2YLTA 1RYIA 3CTYA 5IPYA 1KF6A 2XVJA 2JBVA 4YT0A 5KXJA 1EL7A 5KMSA 3URHA 1V59A 1NEKA 2JB2A 3CIRA 4U2LA 3AYIA 4YSYA 3CGCA 4H2NA 2C72A 1ZOYA 5KOWA 4C77A 2DKHA 2XVHA 2XFOA 3UKHA 4JN9A 3DJEA 3G5RA 4BV6A 2EQ9A 5KVHA 3V3NA 5J60A 1ZMDA 4D03A 2OAMA 2BCGG 2YG5A 5EBKA 3UKAA 1DOBA 1CL0A 3KLJA 3ICTA 4YXDA 2Z5YA 3GDNA 2B9YA 4U2SA 4J36A 4H4YA 2APGA 3B3RA 4GR1A 2UZZA 4II2A 4C3XA 2FJDA 3H4KA 1GALA 4NTEA 2V5ZA 3C96A 3AE8A 3ZYXA 3I3LA 1FEBA 2WETA 5KWFA 3EANA 1OJCA 1COYA 1VQWA 4A7AA 4BURA 1DODA 1VDCA 3SFDA 4JNAA 4A79A 3D1CA 3T37A 4U8OA 4BJZA 3LXDA 1CHUA 2GQFA 2ZZ0A 4H2PA 1D5TA 2XFUA 2TPRA 3BI5A 2E5VA 3FMWA 2BK3A 3HYXA 3V3OA 1E1KA 1JRYA 3NYFA 4AT2A 3AWIA 1N4UA 2H89A 4K8DA 1H7XA 1FCDA 1XHCA 2Q0LA 2WEUA 3AEFA 1DNCA 3BI4A 1OJAA 2FJEA 2X8HA 2GH5A 3NGCX 2XFQA 4FK1C 1CJ2A 1FOHA 3GYXA 4CNJA 3AECA 4IVOB 3VRBA 1BGNA 1XPQA 4EMJA 1FEAA 3CNJA 5JCMA 3NYEA 4E0VA 2BRYA 2XLRA 2Y6QA 2YVGA 1BKWA 2YAUA 3P1WA 3GMCA 1NHSA 2WDRA 1Q1RA 2C4CA 2WP6A 2VQ7A 3IHGA 3NYCA
chains in the Genus database with same CATH topology
4OPLA 1TDFA 1PJ5A 2GAGB 2XLUA 2XVFA 2Q7VA 2V6OA 4UDRA 3NNEA 4NTCA 4X9NA 1IUSA 3DK9A 4G6HA 1NAAA 4H4XA 4YWOA 4CCRA 1YKJA 4CRTA 4JY2A 4EQXA 4K2XA 1CBOA 3UOVA 4YSZA 2VRLA 3ISHA 1P2HA 1Z6LA 3KKJA 4J33A 2NPXA 3NKSA 5C3JA 4U8IA 4G74A 4XXGA 2JAEA 4I58A 1EL5A 2YVFA 2XYOA 4Z24A 3KPKA 1YY5A 4OPGA 1E39A 4H50A 1PBFA 4U8LA 1TDKA 1VG9A 3F8DA 3S5WA 2Y6RA 3KA7A 1O95A 3OC4A 3AEGA 3KVEA 1IUWA 1DXLA 4H4RA 4OPDA 2VQBA 3T14A 3T2ZA 4Y4NA 1ELIA 5U63A 2XLTA 4AOXA 3K7TA 5BUKA 4J31A 2RABA 3DGZA 4U8JA 4FDCB 2YR6A 3ALLA 4K5RA 5C2TA 4HB9A 5KMPA 4RG4A 1HYUA 2OA1A 3GD3A 2VVLG 2X50A 3O0HA 1GXFA 3FBSA 2RGHA 1QLBA 2XFNA 1ZOVA 2YLWA 3DMEA 2EQ8A 3DGHA 3RNMA 3BHKA 2BXSA 2TMDA 2RGOA 1NHPA 1E1NA 1RP0A 1GETA 4A6NB 2GMHA 4B69A 3LZXA 1S3BA 2CDUA 3AE4A 4JQ9A 2WP9A 4BK2A 1YQZA 5JCIA 4EM3A 2X8GA 5FS7A 3OZ2A 4GDPA 1CJ4A 2AAQA 1EL9A 4ZCDA 3T2YA 4H7UA 5LV9A 4TM1A 2XLPA 4LU6A 4YKFA 4H4ZA 3CGDA 4EIQA 4G6GA 4WX1A 4A99A 4U8NA 5IQ4A 2GEWA 1NG3A 4N9XA 4TLXA 2BS3A 4AT0A 4Z26A 3RP6A 1K0JA 3GDPA 1L9DA 4U8PA 1D4DA 2JB3A 1JNRA 4H4WA 2B9XA 2ZZBA 1QO8A 2ZZCA 4PABA 4TM4A 3C4NA 2BA9A 5J7XA 2ARDA 3PS9A 1F8SA 3LZWA 1N4WA 5BRTA 1DJQA 1O94A 3AE6A 1JOAA 3Q6JA 3R9UA 2JKCA 3SZFA 3CPIG 2A89A 4O5QA 1CF3A 2C66A 3NLCA 2BABA 1H84A 1OJTA 2YLZA 5CQFA 1P2EA 4H2RA 3S61A 2WOWA 5M10A 1MXTA 3DJGX 1MOKA 2XDOA 1VG0A 5EB4A 4EQWA 1PXAA 3CNPA 4P9SA 4ZCCA 1B4VA 2R9ZA 1KSUA 2J3NA 3AB1A 3IF9A 4USQA 2OLNA 4BK1A 4PAAA 5DBJA 4ZN0A 1PBDA 1KDGA 1CJ3A 2W0HA 1H83A 1M64A 3C4AA 4BK3A 4NNJA 1KSSA 1UKVG 2C3CA 3ITJA 2WHDA 4CCQA 2BACA 2YG3A 3P4PA 2CULA 3CNSA 3VR8A 5U1OA 4B63A 2GAHB 1CC6A 2GV8A 2V3AA 2WU2A 2O9ZA 3DJJA 3AE2A 1ZDLA 4UDPA 3AE9A 3QVRA 3SQPA 2GMJA 4Y4LA 4EMWA 4A5LA 3V76A 2WOIA 2GR3A 1L9CA 2JK6A 3KPFA 2GR1A 4Z44A 4OPUA 2Z5XA 4Z2TA 2C65A 1B8SA 2R0GA 2YM2A 2NVKX 3D8XA 3F8PA 3NT6A 3PO7A 1BZLA 3VRAA 2YLRA 1LQUA 3CGBA 4EIPA 3ICRA 4H4PA 3UTHA 5BULA 4AOSA 5HYMA 2YG6A 4YTMA 3SGLA 2YR4A 3UP4A 2WOVA 3QSSA 3SYIA 4TM0A 2WPEA 1CC4A 2R4JA 3EF6A 4I59A 4KPRA 4USRA 2C67A 4UP3A 3M12A 1F8WA 1VRQB 3LADA 1GRTA 1Y56A 2AR8A 2X99A 2VOUA 3AEAA 3GRSA 4G73A 3NHOX 1EL8A 1L0VA 1OJDA 2VVLA 3H8IA 3SZ0A 1XANA 4XWZA 2BCPA 1PHHA 1N4VA 2RGJA 2YWLA 3DA1A 5FS6A 3UTEA 2BC1A 3IC9A 2JB1A 3P9UA 4IA5A 4CY6A 1TDNA 1FECA 1PBEA 1PBBA 4H4SA 4UDQA 1ZP0A 2YM1A 3ATQA 1IJHA 2C76A 2GR2A 2WDQA 1LQTA 3SM8A 2GQWA 3CNDA 1BWCA 1YQ3A 3ABVA 3FPZA 4LA1A 1H7WA 4O5UA 4C3YA 4D04A 1EBDA 3QSMA 4NWZA 1GOSA 1ZK7A 3T0KA 1K0IA 1YQ4A 3UKFA 4JY3A 1B5QA 2YG7A 3RP8A 3CPJG 2V60A 1Q1WA 5FS8A 1LPFA 3AXBA 2I0ZA 1LV0A 5KNLA 3IWAA 3LB8A 3NIXA 4YSHA 2GF3A 2XLSA 3IHMA 4K7ZA 3GWFA 1MO9A 1NENA 2WPFA 3AEBA 3H8LA 2FBWA 5JCLA 1GT8A 2QA1A 2B76A 1O5WA 4OPTA 3T2KA 5HHFA 4B68A 1S2YA 3UOXA 4EM4A 1KNPA 4J34A 4AP1A 4IA6A 1M6IA 5FS9A 3NTAA 1K0LA 3QFAA 4EQSA 2WPCA 3ATRA 3UCLA 1LVLA 1GRHA 2VRMA 4K22A 5KOXA 2XVEA 3WE0A 3DK8A 2BRAA 3VR9A 5KMQA 3NN6X 1GRFA 2R45A 4OVIA 3ZDNA 2X3NA 1BF3A 4GRTA 1GEUA 3II4A 1Q9IA 3CGEA 3G5SA 3SXIA 1GRAA 4JDRA 1LJ1A 1NHRA 2EQ6A 5M0ZA 1DOEA 3DH9A 3HYVA 2DKIA 3NK0X 1GV4A 5KMRA 4GAVA 3SFEA 1CC2A 3BI2A 2H88A 4GCMA 4OPIA 1D7YA 2QA2A 2A87A 2BK5A 2CFYA 3EPTA 4II3A 2EQ7A 2WP5A 2WDVA 1S2QA 4TLZA 4B65A 2R0CA 4YKGA 2WU5A 3GD4A 3COXA 3CMMA 3UTGA 4G9KA 1NHQA 3E1TA 3NK1X 1NG4A 3NTDA 2WQYA 4TM3A 3VRDB 5U25A 1PXBA 2WBAA 4M52A 1ZX9A 2Q6UA 4J56A 1ONFA 1E7PA 1ZMCA 3AYLA 1DOCA 5GSNA 3AE3A 4HA6A 4B1BA 1GSNA 1H6VA 3K7QX 1KFYA 3P4SA 4OPCA 3K30A 4XWRA 2BC0A 4U2TA 1JNZA 3BNMA 4B64A 2C70A 2OALA 3QJ4A 3P4RA 4H4TA 1JU2A 2QAEA 2QCUA 2A8XA 4GAPA 3SZCA 4APNA 2E4GA 4H4UA 2YQUA 3GWDA 1D4CA 1D7LA 1IUTA 2BYBA 5EB5A 4X4JA 2FJAA 1L9EA 2GR0A 3ALJA 3CN8A 4K5SA 1W4XA 1JRXA 1GPEA 4EQRA 3AYJA 4NTDA 3JSKA 2YG4A 3UKLA 1GTEA 2VZ2A 4ADWA 5JCNA 3NK2X 1TDOA 2R46A 5L46A 1BGJA 2BS2A 5FMHA 5BVAA 1PJ7A 4RG3A 2GRTA 3L1RA 1E1MA 2PHHA 2V3BA 2VVMA 3QSEA 5TR3A 2V61A 4B67A 3SZWA 1RSGA 3KU9A 1NDAA 2B9WA 4ICYA 4A65A 2BK4A 3LOVA 1H82A 4YTPA 1TRBA 2C3DA 2R0PA 3M13A 2Q0KA 2WS3A 2IIDA 1TDEA 4GF7A 1GERA 1B37A 3GMBA 1JRZA 4OCGA 3UOYA 4BJYA 1NPXA 4DSGA 4J2WA 3SX6A 2OLOA 1KNRA 4CBQA 4Z43A 4DSHA 3NRNA 3Q9TA 3UP5A 1F6MA 1QJDA 1E1LA 2YLXA 3AE1A 3GSIA 5KRQA 3AE7A 2F5ZA 3ALMA 3NN0X 1GNDA 3UOZA 3LJPA 4FX9A 1GESA 2HQMA 4AP3A 3QFBA 2E1MA 3T31A 2YLSA 4Z2RA 4WCTA 2X8CA 3I6DA 1PBCA 4REKA 1PJ6A 2BS4A 2CVJA 1N1PA 2WESA 1K4QA 3F8RA 4H4VA 4LIIA 3UTFA 1ZKQA 3KD9A 3FIMB 2C7GA 1PDHA 1F8RA 2PYXA 2AQJA 5ER0A 4C5OA 4J57A 2GVCA 1XDIA 1FL2A 3PVCA 5GRTA 4CNKA 2C73A 2BXRA 4H2QA 3QVPA 5JCKA 4A6NA 1LTXR 3ICSA 1PN0A 1GREA 1E6EA 3AD9B 4C74A 3L8KA 4KX6A 1S3EA 5KVIA 3HYWA 2B7RA 4X9MA 3ADAB 2B7SA 4Y4MA 2C75A 2IVEA 4FK1A 4NEWA 3FG2P 4EMIA 4IVMB 5IQ1A 3DK4A 1GRBA 3G5QA 4CY8A 4U8KA 4YSXA 3CNTA 3GRTA 3EAOA 5HY5A 1Y56B 4NZHA 1REOA 3P4QA 4ECHA 1AOGA 2FJBA 4YTNA 3GYIA 1D4EA 4IV9A 4Z25A 3UKQA 1IUVA 3BNUA 2YR5A 1Y0PA 1X31B 1IUXA 2XCGA 3B6DA 1CJCA 1F3PA 3K7MX 3M0OA 2XVIA 5HXIA 4JNQA 3UKPA 2R4EA 5EOWA 1TYTA 2XFPA 3CPHG 4GUVA 3SY4A 3RHAA 4B66A 5CKUA 1H86A 1PS9A 4MJWA 3NG7X 4U8MA 4A9WA 3AD7B 2YVJA 1GTHA 3DJDA 4H4QA 3AEEA 1JEHA 3AE5A 3AEDA 3HZLA 4GDEA 4RSLA 3REDA 3GYJA 2ACZA 2C64A 3RP7A 1DJNA 1PXCA 1SEZA 1TYPA 2ZBWA 4DGKA 1GRGA 4NEVA 3AD8B 3UKKA 2GB0A 3BHFA 4Z2UA 1ZY8A 1IUUA 4DNAA 3NH3X 1H81A 2IVDA 3VQRA 1OJ9A 2YLTA 1RYIA 3CTYA 5IPYA 1KF6A 2XVJA 2JBVA 4YT0A 5KXJA 1EL7A 5KMSA 3URHA 1V59A 1NEKA 2JB2A 3CIRA 4U2LA 3AYIA 4YSYA 3CGCA 4H2NA 2C72A 1ZOYA 5KOWA 4C77A 2DKHA 2XVHA 2XFOA 3UKHA 4JN9A 3DJEA 3G5RA 4BV6A 2EQ9A 5KVHA 3V3NA 5J60A 1ZMDA 4D03A 2OAMA 2BCGG 2YG5A 5EBKA 3UKAA 1DOBA 1CL0A 3KLJA 3ICTA 4YXDA 2Z5YA 3GDNA 2B9YA 4U2SA 4J36A 4H4YA 2APGA 3B3RA 4GR1A 2UZZA 4II2A 4C3XA 2FJDA 3H4KA 1GALA 4NTEA 2V5ZA 3C96A 3AE8A 3ZYXA 3I3LA 1FEBA 2WETA 5KWFA 3EANA 1OJCA 1COYA 1VQWA 4A7AA 4BURA 1DODA 1VDCA 3SFDA 4JNAA 4A79A 3D1CA 3T37A 4U8OA 4BJZA 3LXDA 1CHUA 2GQFA 2ZZ0A 4H2PA 1D5TA 2XFUA 2TPRA 3BI5A 2E5VA 3FMWA 2BK3A 3HYXA 3V3OA 1E1KA 1JRYA 3NYFA 4AT2A 3AWIA 1N4UA 2H89A 4K8DA 1H7XA 1FCDA 1XHCA 2Q0LA 2WEUA 3AEFA 1DNCA 3BI4A 1OJAA 2FJEA 2X8HA 2GH5A 3NGCX 2XFQA 4FK1C 1CJ2A 1FOHA 3GYXA 4CNJA 3AECA 4IVOB 3VRBA 1BGNA 1XPQA 4EMJA 1FEAA 3CNJA 5JCMA 3NYEA 4E0VA 2BRYA 2XLRA 2Y6QA 2YVGA 1BKWA 2YAUA 3P1WA 3GMCA 1NHSA 2WDRA 1Q1RA 2C4CA 2WP6A 2VQ7A 3IHGA 3NYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPL A;  1TDF A;  1PJ5 A;  2GAG B;  2XLU A;  2XVF A;  2Q7V A;  2V6O A;  4UDR A;  3NNE A;  4NTC A;  4X9N A;  1IUS A;  3DK9 A;  1NAA A;  4H4X A;  4YWO A;  4CCR A;  1YKJ A;  4CRT A;  4JY2 A;  4EQX A;  4K2X A;  1CBO A;  3UOV A;  4YSZ A;  2VRL A;  3ISH A;  1P2H A;  1Z6L A;  3KKJ A;  4J33 A;  2NPX A;  3NKS A;  5C3J A;  4U8I A;  4XXG A;  2JAE A;  4I58 A;  1EL5 A;  2YVF A;  2XYO A;  4Z24 A;  1YY5 A;  4OPG A;  1E39 A;  4H50 A;  1PBF A;  4U8L A;  1TDK A;  1VG9 A;  3F8D A;  3S5W A;  2Y6R A;  3KA7 A;  1O95 A;  3OC4 A;  3AEG A;  3KVE A;  1IUW A;  1DXL A;  4H4R A;  4OPD A;  2VQB A;  4Y4N A;  1ELI A;  5U63 A;  2XLT A;  4AOX A;  3K7T A;  5BUK A;  4J31 A;  2RAB A;  3DGZ A;  4U8J A;  4FDC B;  2YR6 A;  3ALL A;  4K5R A;  5C2T A;  4HB9 A;  4RG4 A;  1HYU A;  2OA1 A;  3GD3 A;  2VVL G;  2X50 A;  3O0H A;  1GXF A;  3FBS A;  2RGH A;  1QLB A;  2XFN A;  1ZOV A;  2YLW A;  3DME A;  2EQ8 A;  3DGH A;  3RNM A;  3BHK A;  2BXS A;  2TMD A;  2RGO A;  1NHP A;  1E1N A;  1RP0 A;  1GET A;  4A6N B;  2GMH A;  4B69 A;  3LZX A;  1S3B A;  2CDU A;  3AE4 A;  4JQ9 A;  2WP9 A;  4BK2 A;  1YQZ A;  5JCI A;  4EM3 A;  2X8G A;  5FS7 A;  3OZ2 A;  4GDP A;  1CJ4 A;  2AAQ A;  1EL9 A;  4ZCD A;  4H7U A;  5LV9 A;  4TM1 A;  2XLP A;  4LU6 A;  4YKF A;  4H4Z A;  3CGD A;  4EIQ A;  4WX1 A;  4A99 A;  4U8N A;  5IQ4 A;  2GEW A;  1NG3 A;  4N9X A;  4TLX A;  2BS3 A;  4AT0 A;  4Z26 A;  3RP6 A;  1K0J A;  3GDP A;  1L9D A;  4U8P A;  1D4D A;  2JB3 A;  1JNR A;  4H4W A;  2B9X A;  2ZZB A;  1QO8 A;  2ZZC A;  4PAB A;  4TM4 A;  3C4N A;  2BA9 A;  5J7X A;  2ARD A;  3PS9 A;  1F8S A;  3LZW A;  1N4W A;  5BRT A;  1DJQ A;  1O94 A;  3AE6 A;  1JOA A;  3Q6J A;  3R9U A;  2JKC A;  3CPI G;  2A89 A;  4O5Q A;  1CF3 A;  2C66 A;  3NLC A;  2BAB A;  1H84 A;  1OJT A;  2YLZ A;  5CQF A;  1P2E A;  4H2R A;  3S61 A;  2WOW A;  5M10 A;  1MXT A;  3DJG X;  1MOK A;  2XDO A;  1VG0 A;  5EB4 A;  4EQW A;  1PXA A;  3CNP A;  4P9S A;  4ZCC A;  1B4V A;  2R9Z A;  1KSU A;  2J3N A;  3AB1 A;  3IF9 A;  4USQ A;  2OLN A;  4BK1 A;  4PAA A;  5DBJ A;  4ZN0 A;  1PBD A;  1KDG A;  1CJ3 A;  2W0H A;  1H83 A;  1M64 A;  3C4A A;  4BK3 A;  1KSS A;  1UKV G;  2C3C A;  3ITJ A;  2WHD A;  4CCQ A;  2BAC A;  2YG3 A;  3P4P A;  2CUL A;  3CNS A;  3VR8 A;  5U1O A;  4B63 A;  2GAH B;  1CC6 A;  2GV8 A;  2V3A A;  2WU2 A;  2O9Z A;  3DJJ A;  3AE2 A;  1ZDL A;  4UDP A;  3AE9 A;  3QVR A;  3SQP A;  2GMJ A;  4Y4L A;  4EMW A;  4A5L A;  3V76 A;  2WOI A;  2GR3 A;  1L9C A;  2JK6 A;  3KPF A;  2GR1 A;  4Z44 A;  4OPU A;  2Z5X A;  4Z2T A;  2C65 A;  1B8S A;  2R0G A;  2YM2 A;  2NVK X;  3D8X A;  3F8P A;  3NT6 A;  3PO7 A;  1BZL A;  3VRA A;  2YLR A;  1LQU A;  3CGB A;  4EIP A;  3ICR A;  4H4P A;  3UTH A;  5BUL A;  4AOS A;  5HYM A;  2YG6 A;  4YTM A;  3SGL A;  2YR4 A;  3UP4 A;  2WOV A;  3QSS A;  4TM0 A;  2WPE A;  1CC4 A;  2R4J A;  3EF6 A;  4I59 A;  4KPR A;  4USR A;  2C67 A;  4UP3 A;  3M12 A;  1F8W A;  1VRQ B;  3LAD A;  1GRT A;  1Y56 A;  2AR8 A;  2X99 A;  2VOU A;  3AEA A;  3GRS A;  1L0V A;  3NHO X;  1EL8 A;  1OJD A;  2VVL A;  3H8I A;  1XAN A;  4XWZ A;  2BCP A;  1PHH A;  1N4V A;  2RGJ A;  2YWL A;  3DA1 A;  5FS6 A;  3UTE A;  2BC1 A;  3IC9 A;  2JB1 A;  3P9U A;  4IA5 A;  4CY6 A;  1TDN A;  1FEC A;  1PBE A;  1PBB A;  4H4S A;  4UDQ A;  1ZP0 A;  2YM1 A;  3ATQ A;  1IJH A;  2C76 A;  2GR2 A;  2WDQ A;  1LQT A;  3SM8 A;  2GQW A;  3CND A;  1BWC A;  1YQ3 A;  3ABV A;  3FPZ A;  4LA1 A;  1H7W A;  4O5U A;  4C3Y A;  4D04 A;  1EBD A;  3QSM A;  1GOS A;  1ZK7 A;  1K0I A;  1YQ4 A;  3UKF A;  4JY3 A;  1B5Q A;  2YG7 A;  3RP8 A;  3CPJ G;  2V60 A;  1Q1W A;  5FS8 A;  1LPF A;  3AXB A;  2I0Z A;  1LV0 A;  3IWA A;  3LB8 A;  3NIX A;  4YSH A;  2GF3 A;  2XLS A;  3IHM A;  4K7Z A;  3GWF A;  1MO9 A;  1NEN A;  2WPF A;  3AEB A;  3H8L A;  2FBW A;  5JCL A;  1GT8 A;  2QA1 A;  2B76 A;  1O5W A;  4OPT A;  5HHF A;  4B68 A;  1S2Y A;  3UOX A;  4EM4 A;  1KNP A;  4J34 A;  4AP1 A;  4IA6 A;  1M6I A;  5FS9 A;  3NTA A;  1K0L A;  3QFA A;  4EQS A;  2WPC A;  3ATR A;  3UCL A;  1LVL A;  1GRH A;  2VRM A;  4K22 A;  5KOX A;  2XVE A;  3WE0 A;  3DK8 A;  3VR9 A;  3NN6 X;  1GRF A;  2R45 A;  4OVI A;  3ZDN A;  2X3N A;  1BF3 A;  4GRT A;  1GEU A;  3II4 A;  1Q9I A;  3CGE A;  3G5S A;  1GRA A;  4JDR A;  1LJ1 A;  1NHR A;  2EQ6 A;  5M0Z A;  1DOE A;  3DH9 A;  2DKI A;  3NK0 X;  1GV4 A;  3SFE A;  1CC2 A;  3BI2 A;  2H88 A;  4GCM A;  4OPI A;  1D7Y A;  2QA2 A;  2A87 A;  2BK5 A;  2CFY A;  3EPT A;  2EQ7 A;  2WP5 A;  2WDV A;  1S2Q A;  4TLZ A;  4B65 A;  2R0C A;  4YKG A;  2WU5 A;  3GD4 A;  3COX A;  3UTG A;  3VRD B;  1NHQ A;  3E1T A;  3NK1 X;  1NG4 A;  3NTD A;  2WQY A;  4TM3 A;  5U25 A;  1PXB A;  2WBA A;  4M52 A;  1ZX9 A;  2Q6U A;  4J56 A;  1ONF A;  1E7P A;  1ZMC A;  3AYL A;  1DOC A;  5GSN A;  3AE3 A;  4HA6 A;  4B1B A;  1GSN A;  1H6V A;  3K7Q X;  1KFY A;  3P4S A;  4OPC A;  3K30 A;  4XWR A;  2BC0 A;  4U2T A;  1JNZ A;  3BNM A;  4B64 A;  2C70 A;  2OAL A;  3QJ4 A;  3P4R A;  4H4T A;  1JU2 A;  2QAE A;  2QCU A;  2A8X A;  4APN A;  2E4G A;  4H4U A;  2YQU A;  3GWD A;  1D4C A;  1D7L A;  1IUT A;  2BYB A;  5EB5 A;  4X4J A;  2FJA A;  1L9E A;  2GR0 A;  3ALJ A;  3CN8 A;  4K5S A;  1W4X A;  1JRX A;  1GPE A;  4EQR A;  3AYJ A;  4NTD A;  3JSK A;  2YG4 A;  3UKL A;  1GTE A;  2VZ2 A;  4ADW A;  5JCN A;  3NK2 X;  1TDO A;  2R46 A;  5L46 A;  1BGJ A;  2BS2 A;  5FMH A;  5BVA A;  1PJ7 A;  4RG3 A;  2GRT A;  3L1R A;  1E1M A;  2PHH A;  2V3B A;  2VVM A;  3QSE A;  5TR3 A;  2V61 A;  4B67 A;  1RSG A;  3KU9 A;  1NDA A;  2B9W A;  4ICY A;  4A65 A;  2BK4 A;  3LOV A;  1H82 A;  4YTP A;  1TRB A;  2C3D A;  2R0P A;  3M13 A;  2Q0K A;  2WS3 A;  2IID A;  1TDE A;  4GF7 A;  1GER A;  1B37 A;  3GMB A;  1JRZ A;  4OCG A;  3UOY A;  4BJY A;  1NPX A;  4DSG A;  4J2W A;  2OLO A;  1KNR A;  4CBQ A;  4Z43 A;  4DSH A;  3NRN A;  3Q9T A;  3UP5 A;  1F6M A;  1QJD A;  1E1L A;  2YLX A;  3AE1 A;  3GSI A;  5KRQ A;  3AE7 A;  2F5Z A;  3ALM A;  3NN0 X;  1GND A;  3UOZ A;  3LJP A;  4FX9 A;  1GES A;  2HQM A;  4AP3 A;  3QFB A;  2E1M A;  2YLS A;  4Z2R A;  4WCT A;  2X8C A;  3I6D A;  1PBC A;  4REK A;  1PJ6 A;  2BS4 A;  2CVJ A;  1N1P A;  2WES A;  1K4Q A;  3F8R A;  4H4V A;  4LII A;  3UTF A;  1ZKQ A;  3KD9 A;  3FIM B;  2C7G A;  1PDH A;  1F8R A;  2PYX A;  2AQJ A;  5ER0 A;  4C5O A;  4J57 A;  2GVC A;  1XDI A;  1FL2 A;  3PVC A;  5GRT A;  4CNK A;  2C73 A;  2BXR A;  4H2Q A;  3QVP A;  5JCK A;  4A6N A;  1LTX R;  3ICS A;  1PN0 A;  1GRE A;  1E6E A;  3AD9 B;  4C74 A;  3L8K A;  4KX6 A;  1S3E A;  5KVI A;  2B7R A;  4X9M A;  3ADA B;  2B7S A;  4Y4M A;  2C75 A;  2IVE A;  4FK1 A;  4NEW A;  3FG2 P;  4EMI A;  4IVM B;  5IQ1 A;  3DK4 A;  1GRB A;  3G5Q A;  4CY8 A;  4U8K A;  4YSX A;  3CNT A;  3GRT A;  3EAO A;  5HY5 A;  1Y56 B;  4NZH A;  1REO A;  3P4Q A;  4ECH A;  1AOG A;  2FJB A;  4YTN A;  3GYI A;  1D4E A;  4IV9 A;  4Z25 A;  3UKQ A;  1IUV A;  3BNU A;  2YR5 A;  1Y0P A;  1X31 B;  1IUX A;  2XCG A;  3B6D A;  1CJC A;  1F3P A;  3K7M X;  3M0O A;  2XVI A;  5HXI A;  4JNQ A;  3UKP A;  2R4E A;  5EOW A;  1TYT A;  2XFP A;  3CPH G;  4GUV A;  3RHA A;  4B66 A;  5CKU A;  1H86 A;  1PS9 A;  4MJW A;  3NG7 X;  4U8M A;  4A9W A;  3AD7 B;  2YVJ A;  1GTH A;  3DJD A;  4H4Q A;  3AEE A;  1JEH A;  3AE5 A;  3AED A;  3HZL A;  4GDE A;  4RSL A;  3RED A;  3GYJ A;  2ACZ A;  2C64 A;  3RP7 A;  1DJN A;  1PXC A;  1SEZ A;  1TYP A;  2ZBW A;  4DGK A;  1GRG A;  4NEV A;  3AD8 B;  3UKK A;  2GB0 A;  3BHF A;  4Z2U A;  1ZY8 A;  1IUU A;  4DNA A;  3NH3 X;  1H81 A;  2IVD A;  3VQR A;  1OJ9 A;  2YLT A;  1RYI A;  3CTY A;  5IPY A;  1KF6 A;  2XVJ A;  2JBV A;  4YT0 A;  5KXJ A;  1EL7 A;  3URH A;  1V59 A;  1NEK A;  2JB2 A;  3CIR A;  4U2L A;  3AYI A;  4YSY A;  3CGC A;  4H2N A;  2C72 A;  1ZOY A;  5KOW A;  4C77 A;  2DKH A;  2XVH A;  2XFO A;  3UKH A;  4JN9 A;  3DJE A;  3G5R A;  4BV6 A;  2EQ9 A;  5KVH A;  3V3N A;  5J60 A;  1ZMD A;  4D03 A;  2OAM A;  2BCG G;  2YG5 A;  5EBK A;  3UKA A;  1DOB A;  1CL0 A;  3KLJ A;  3ICT A;  4YXD A;  2Z5Y A;  3GDN A;  2B9Y A;  4U2S A;  4J36 A;  4H4Y A;  2APG A;  3B3R A;  4GR1 A;  2UZZ A;  4C3X A;  2FJD A;  3H4K A;  1GAL A;  4NTE A;  2V5Z A;  3C96 A;  3AE8 A;  3ZYX A;  3I3L A;  1FEB A;  2WET A;  5KWF A;  3EAN A;  1OJC A;  1COY A;  1VQW A;  4A7A A;  4BUR A;  1DOD A;  1VDC A;  3SFD A;  4JNA A;  4A79 A;  3D1C A;  3T37 A;  4U8O A;  4BJZ A;  3LXD A;  1CHU A;  2GQF A;  2ZZ0 A;  4H2P A;  1D5T A;  2XFU A;  2TPR A;  3BI5 A;  2E5V A;  3FMW A;  2BK3 A;  3V3O A;  1E1K A;  1JRY A;  3NYF A;  4AT2 A;  3AWI A;  1N4U A;  2H89 A;  4K8D A;  1H7X A;  1FCD A;  1XHC A;  2Q0L A;  2WEU A;  3AEF A;  1DNC A;  3BI4 A;  1OJA A;  2FJE A;  2X8H A;  2GH5 A;  3NGC X;  2XFQ A;  4FK1 C;  1CJ2 A;  1FOH A;  4CNJ A;  3AEC A;  4IVO B;  3VRB A;  1BGN A;  1XPQ A;  4EMJ A;  1FEA A;  3CNJ A;  5JCM A;  3NYE A;  4E0V A;  2XLR A;  2Y6Q A;  2YVG A;  1BKW A;  2YAU A;  3P1W A;  3GMC A;  1NHS A;  2WDR A;  1Q1R A;  2WP6 A;  2VQ7 A;  3IHG A;  3NYC A; 
#chains in the Genus database with same CATH topology
 4OPL A;  1TDF A;  1PJ5 A;  2GAG B;  2XLU A;  2XVF A;  2Q7V A;  2V6O A;  4UDR A;  3NNE A;  4NTC A;  4X9N A;  1IUS A;  3DK9 A;  4G6H A;  1NAA A;  4H4X A;  4YWO A;  4CCR A;  1YKJ A;  4CRT A;  4JY2 A;  4EQX A;  4K2X A;  1CBO A;  3UOV A;  4YSZ A;  2VRL A;  3ISH A;  1P2H A;  1Z6L A;  3KKJ A;  4J33 A;  2NPX A;  3NKS A;  5C3J A;  4U8I A;  4G74 A;  4XXG A;  2JAE A;  4I58 A;  1EL5 A;  2YVF A;  2XYO A;  4Z24 A;  3KPK A;  1YY5 A;  4OPG A;  1E39 A;  4H50 A;  1PBF A;  4U8L A;  1TDK A;  1VG9 A;  3F8D A;  3S5W A;  2Y6R A;  3KA7 A;  1O95 A;  3OC4 A;  3AEG A;  3KVE A;  1IUW A;  1DXL A;  4H4R A;  4OPD A;  2VQB A;  3T14 A;  3T2Z A;  4Y4N A;  1ELI A;  5U63 A;  2XLT A;  4AOX A;  3K7T A;  5BUK A;  4J31 A;  2RAB A;  3DGZ A;  4U8J A;  4FDC B;  2YR6 A;  3ALL A;  4K5R A;  5C2T A;  4HB9 A;  5KMP A;  4RG4 A;  1HYU A;  2OA1 A;  3GD3 A;  2VVL G;  2X50 A;  3O0H A;  1GXF A;  3FBS A;  2RGH A;  1QLB A;  2XFN A;  1ZOV A;  2YLW A;  3DME A;  2EQ8 A;  3DGH A;  3RNM A;  3BHK A;  2BXS A;  2TMD A;  2RGO A;  1NHP A;  1E1N A;  1RP0 A;  1GET A;  4A6N B;  2GMH A;  4B69 A;  3LZX A;  1S3B A;  2CDU A;  3AE4 A;  4JQ9 A;  2WP9 A;  4BK2 A;  1YQZ A;  5JCI A;  4EM3 A;  2X8G A;  5FS7 A;  3OZ2 A;  4GDP A;  1CJ4 A;  2AAQ A;  1EL9 A;  4ZCD A;  3T2Y A;  4H7U A;  5LV9 A;  4TM1 A;  2XLP A;  4LU6 A;  4YKF A;  4H4Z A;  3CGD A;  4EIQ A;  4G6G A;  4WX1 A;  4A99 A;  4U8N A;  5IQ4 A;  2GEW A;  1NG3 A;  4N9X A;  4TLX A;  2BS3 A;  4AT0 A;  4Z26 A;  3RP6 A;  1K0J A;  3GDP A;  1L9D A;  4U8P A;  1D4D A;  2JB3 A;  1JNR A;  4H4W A;  2B9X A;  2ZZB A;  1QO8 A;  2ZZC A;  4PAB A;  4TM4 A;  3C4N A;  2BA9 A;  5J7X A;  2ARD A;  3PS9 A;  1F8S A;  3LZW A;  1N4W A;  5BRT A;  1DJQ A;  1O94 A;  3AE6 A;  1JOA A;  3Q6J A;  3R9U A;  2JKC A;  3SZF A;  3CPI G;  2A89 A;  4O5Q A;  1CF3 A;  2C66 A;  3NLC A;  2BAB A;  1H84 A;  1OJT A;  2YLZ A;  5CQF A;  1P2E A;  4H2R A;  3S61 A;  2WOW A;  5M10 A;  1MXT A;  3DJG X;  1MOK A;  2XDO A;  1VG0 A;  5EB4 A;  4EQW A;  1PXA A;  3CNP A;  4P9S A;  4ZCC A;  1B4V A;  2R9Z A;  1KSU A;  2J3N A;  3AB1 A;  3IF9 A;  4USQ A;  2OLN A;  4BK1 A;  4PAA A;  5DBJ A;  4ZN0 A;  1PBD A;  1KDG A;  1CJ3 A;  2W0H A;  1H83 A;  1M64 A;  3C4A A;  4BK3 A;  4NNJ A;  1KSS A;  1UKV G;  2C3C A;  3ITJ A;  2WHD A;  4CCQ A;  2BAC A;  2YG3 A;  3P4P A;  2CUL A;  3CNS A;  3VR8 A;  5U1O A;  4B63 A;  2GAH B;  1CC6 A;  2GV8 A;  2V3A A;  2WU2 A;  2O9Z A;  3DJJ A;  3AE2 A;  1ZDL A;  4UDP A;  3AE9 A;  3QVR A;  3SQP A;  2GMJ A;  4Y4L A;  4EMW A;  4A5L A;  3V76 A;  2WOI A;  2GR3 A;  1L9C A;  2JK6 A;  3KPF A;  2GR1 A;  4Z44 A;  4OPU A;  2Z5X A;  4Z2T A;  2C65 A;  1B8S A;  2R0G A;  2YM2 A;  2NVK X;  3D8X A;  3F8P A;  3NT6 A;  3PO7 A;  1BZL A;  3VRA A;  2YLR A;  1LQU A;  3CGB A;  4EIP A;  3ICR A;  4H4P A;  3UTH A;  5BUL A;  4AOS A;  5HYM A;  2YG6 A;  4YTM A;  3SGL A;  2YR4 A;  3UP4 A;  2WOV A;  3QSS A;  3SYI A;  4TM0 A;  2WPE A;  1CC4 A;  2R4J A;  3EF6 A;  4I59 A;  4KPR A;  4USR A;  2C67 A;  4UP3 A;  3M12 A;  1F8W A;  1VRQ B;  3LAD A;  1GRT A;  1Y56 A;  2AR8 A;  2X99 A;  2VOU A;  3AEA A;  3GRS A;  4G73 A;  3NHO X;  1EL8 A;  1L0V A;  1OJD A;  2VVL A;  3H8I A;  3SZ0 A;  1XAN A;  4XWZ A;  2BCP A;  1PHH A;  1N4V A;  2RGJ A;  2YWL A;  3DA1 A;  5FS6 A;  3UTE A;  2BC1 A;  3IC9 A;  2JB1 A;  3P9U A;  4IA5 A;  4CY6 A;  1TDN A;  1FEC A;  1PBE A;  1PBB A;  4H4S A;  4UDQ A;  1ZP0 A;  2YM1 A;  3ATQ A;  1IJH A;  2C76 A;  2GR2 A;  2WDQ A;  1LQT A;  3SM8 A;  2GQW A;  3CND A;  1BWC A;  1YQ3 A;  3ABV A;  3FPZ A;  4LA1 A;  1H7W A;  4O5U A;  4C3Y A;  4D04 A;  1EBD A;  3QSM A;  4NWZ A;  1GOS A;  1ZK7 A;  3T0K A;  1K0I A;  1YQ4 A;  3UKF A;  4JY3 A;  1B5Q A;  2YG7 A;  3RP8 A;  3CPJ G;  2V60 A;  1Q1W A;  5FS8 A;  1LPF A;  3AXB A;  2I0Z A;  1LV0 A;  5KNL A;  3IWA A;  3LB8 A;  3NIX A;  4YSH A;  2GF3 A;  2XLS A;  3IHM A;  4K7Z A;  3GWF A;  1MO9 A;  1NEN A;  2WPF A;  3AEB A;  3H8L A;  2FBW A;  5JCL A;  1GT8 A;  2QA1 A;  2B76 A;  1O5W A;  4OPT A;  3T2K A;  5HHF A;  4B68 A;  1S2Y A;  3UOX A;  4EM4 A;  1KNP A;  4J34 A;  4AP1 A;  4IA6 A;  1M6I A;  5FS9 A;  3NTA A;  1K0L A;  3QFA A;  4EQS A;  2WPC A;  3ATR A;  3UCL A;  1LVL A;  1GRH A;  2VRM A;  4K22 A;  5KOX A;  2XVE A;  3WE0 A;  3DK8 A;  2BRA A;  3VR9 A;  5KMQ A;  3NN6 X;  1GRF A;  2R45 A;  4OVI A;  3ZDN A;  2X3N A;  1BF3 A;  4GRT A;  1GEU A;  3II4 A;  1Q9I A;  3CGE A;  3G5S A;  3SXI A;  1GRA A;  4JDR A;  1LJ1 A;  1NHR A;  2EQ6 A;  5M0Z A;  1DOE A;  3DH9 A;  3HYV A;  2DKI A;  3NK0 X;  1GV4 A;  5KMR A;  4GAV A;  3SFE A;  1CC2 A;  3BI2 A;  2H88 A;  4GCM A;  4OPI A;  1D7Y A;  2QA2 A;  2A87 A;  2BK5 A;  2CFY A;  3EPT A;  4II3 A;  2EQ7 A;  2WP5 A;  2WDV A;  1S2Q A;  4TLZ A;  4B65 A;  2R0C A;  4YKG A;  2WU5 A;  3GD4 A;  3COX A;  3CMM A;  3UTG A;  4G9K A;  1NHQ A;  3E1T A;  3NK1 X;  1NG4 A;  3NTD A;  2WQY A;  4TM3 A;  3VRD B;  5U25 A;  1PXB A;  2WBA A;  4M52 A;  1ZX9 A;  2Q6U A;  4J56 A;  1ONF A;  1E7P A;  1ZMC A;  3AYL A;  1DOC A;  5GSN A;  3AE3 A;  4HA6 A;  4B1B A;  1GSN A;  1H6V A;  3K7Q X;  1KFY A;  3P4S A;  4OPC A;  3K30 A;  4XWR A;  2BC0 A;  4U2T A;  1JNZ A;  3BNM A;  4B64 A;  2C70 A;  2OAL A;  3QJ4 A;  3P4R A;  4H4T A;  1JU2 A;  2QAE A;  2QCU A;  2A8X A;  4GAP A;  3SZC A;  4APN A;  2E4G A;  4H4U A;  2YQU A;  3GWD A;  1D4C A;  1D7L A;  1IUT A;  2BYB A;  5EB5 A;  4X4J A;  2FJA A;  1L9E A;  2GR0 A;  3ALJ A;  3CN8 A;  4K5S A;  1W4X A;  1JRX A;  1GPE A;  4EQR A;  3AYJ A;  4NTD A;  3JSK A;  2YG4 A;  3UKL A;  1GTE A;  2VZ2 A;  4ADW A;  5JCN A;  3NK2 X;  1TDO A;  2R46 A;  5L46 A;  1BGJ A;  2BS2 A;  5FMH A;  5BVA A;  1PJ7 A;  4RG3 A;  2GRT A;  3L1R A;  1E1M A;  2PHH A;  2V3B A;  2VVM A;  3QSE A;  5TR3 A;  2V61 A;  4B67 A;  3SZW A;  1RSG A;  3KU9 A;  1NDA A;  2B9W A;  4ICY A;  4A65 A;  2BK4 A;  3LOV A;  1H82 A;  4YTP A;  1TRB A;  2C3D A;  2R0P A;  3M13 A;  2Q0K A;  2WS3 A;  2IID A;  1TDE A;  4GF7 A;  1GER A;  1B37 A;  3GMB A;  1JRZ A;  4OCG A;  3UOY A;  4BJY A;  1NPX A;  4DSG A;  4J2W A;  3SX6 A;  2OLO A;  1KNR A;  4CBQ A;  4Z43 A;  4DSH A;  3NRN A;  3Q9T A;  3UP5 A;  1F6M A;  1QJD A;  1E1L A;  2YLX A;  3AE1 A;  3GSI A;  5KRQ A;  3AE7 A;  2F5Z A;  3ALM A;  3NN0 X;  1GND A;  3UOZ A;  3LJP A;  4FX9 A;  1GES A;  2HQM A;  4AP3 A;  3QFB A;  2E1M A;  3T31 A;  2YLS A;  4Z2R A;  4WCT A;  2X8C A;  3I6D A;  1PBC A;  4REK A;  1PJ6 A;  2BS4 A;  2CVJ A;  1N1P A;  2WES A;  1K4Q A;  3F8R A;  4H4V A;  4LII A;  3UTF A;  1ZKQ A;  3KD9 A;  3FIM B;  2C7G A;  1PDH A;  1F8R A;  2PYX A;  2AQJ A;  5ER0 A;  4C5O A;  4J57 A;  2GVC A;  1XDI A;  1FL2 A;  3PVC A;  5GRT A;  4CNK A;  2C73 A;  2BXR A;  4H2Q A;  3QVP A;  5JCK A;  4A6N A;  1LTX R;  3ICS A;  1PN0 A;  1GRE A;  1E6E A;  3AD9 B;  4C74 A;  3L8K A;  4KX6 A;  1S3E A;  5KVI A;  3HYW A;  2B7R A;  4X9M A;  3ADA B;  2B7S A;  4Y4M A;  2C75 A;  2IVE A;  4FK1 A;  4NEW A;  3FG2 P;  4EMI A;  4IVM B;  5IQ1 A;  3DK4 A;  1GRB A;  3G5Q A;  4CY8 A;  4U8K A;  4YSX A;  3CNT A;  3GRT A;  3EAO A;  5HY5 A;  1Y56 B;  4NZH A;  1REO A;  3P4Q A;  4ECH A;  1AOG A;  2FJB A;  4YTN A;  3GYI A;  1D4E A;  4IV9 A;  4Z25 A;  3UKQ A;  1IUV A;  3BNU A;  2YR5 A;  1Y0P A;  1X31 B;  1IUX A;  2XCG A;  3B6D A;  1CJC A;  1F3P A;  3K7M X;  3M0O A;  2XVI A;  5HXI A;  4JNQ A;  3UKP A;  2R4E A;  5EOW A;  1TYT A;  2XFP A;  3CPH G;  4GUV A;  3SY4 A;  3RHA A;  4B66 A;  5CKU A;  1H86 A;  1PS9 A;  4MJW A;  3NG7 X;  4U8M A;  4A9W A;  3AD7 B;  2YVJ A;  1GTH A;  3DJD A;  4H4Q A;  3AEE A;  1JEH A;  3AE5 A;  3AED A;  3HZL A;  4GDE A;  4RSL A;  3RED A;  3GYJ A;  2ACZ A;  2C64 A;  3RP7 A;  1DJN A;  1PXC A;  1SEZ A;  1TYP A;  2ZBW A;  4DGK A;  1GRG A;  4NEV A;  3AD8 B;  3UKK A;  2GB0 A;  3BHF A;  4Z2U A;  1ZY8 A;  1IUU A;  4DNA A;  3NH3 X;  1H81 A;  2IVD A;  3VQR A;  1OJ9 A;  2YLT A;  1RYI A;  3CTY A;  5IPY A;  1KF6 A;  2XVJ A;  2JBV A;  4YT0 A;  5KXJ A;  1EL7 A;  5KMS A;  3URH A;  1V59 A;  1NEK A;  2JB2 A;  3CIR A;  4U2L A;  3AYI A;  4YSY A;  3CGC A;  4H2N A;  2C72 A;  1ZOY A;  5KOW A;  4C77 A;  2DKH A;  2XVH A;  2XFO A;  3UKH A;  4JN9 A;  3DJE A;  3G5R A;  4BV6 A;  2EQ9 A;  5KVH A;  3V3N A;  5J60 A;  1ZMD A;  4D03 A;  2OAM A;  2BCG G;  2YG5 A;  5EBK A;  3UKA A;  1DOB A;  1CL0 A;  3KLJ A;  3ICT A;  4YXD A;  2Z5Y A;  3GDN A;  2B9Y A;  4U2S A;  4J36 A;  4H4Y A;  2APG A;  3B3R A;  4GR1 A;  2UZZ A;  4II2 A;  4C3X A;  2FJD A;  3H4K A;  1GAL A;  4NTE A;  2V5Z A;  3C96 A;  3AE8 A;  3ZYX A;  3I3L A;  1FEB A;  2WET A;  5KWF A;  3EAN A;  1OJC A;  1COY A;  1VQW A;  4A7A A;  4BUR A;  1DOD A;  1VDC A;  3SFD A;  4JNA A;  4A79 A;  3D1C A;  3T37 A;  4U8O A;  4BJZ A;  3LXD A;  1CHU A;  2GQF A;  2ZZ0 A;  4H2P A;  1D5T A;  2XFU A;  2TPR A;  3BI5 A;  2E5V A;  3FMW A;  2BK3 A;  3HYX A;  3V3O A;  1E1K A;  1JRY A;  3NYF A;  4AT2 A;  3AWI A;  1N4U A;  2H89 A;  4K8D A;  1H7X A;  1FCD A;  1XHC A;  2Q0L A;  2WEU A;  3AEF A;  1DNC A;  3BI4 A;  1OJA A;  2FJE A;  2X8H A;  2GH5 A;  3NGC X;  2XFQ A;  4FK1 C;  1CJ2 A;  1FOH A;  3GYX A;  4CNJ A;  3AEC A;  4IVO B;  3VRB A;  1BGN A;  1XPQ A;  4EMJ A;  1FEA A;  3CNJ A;  5JCM A;  3NYE A;  4E0V A;  2BRY A;  2XLR A;  2Y6Q A;  2YVG A;  1BKW A;  2YAU A;  3P1W A;  3GMC A;  1NHS A;  2WDR A;  1Q1R A;  2C4C A;  2WP6 A;  2VQ7 A;  3IHG A;  3NYC A; 
#chains in the Genus database with same CATH homology
 4OPL A;  1TDF A;  1PJ5 A;  2GAG B;  2XLU A;  2XVF A;  2Q7V A;  2V6O A;  4UDR A;  3NNE A;  4NTC A;  4X9N A;  1IUS A;  3DK9 A;  4G6H A;  1NAA A;  4H4X A;  4YWO A;  4CCR A;  1YKJ A;  4CRT A;  4JY2 A;  4EQX A;  4K2X A;  1CBO A;  3UOV A;  4YSZ A;  2VRL A;  3ISH A;  1P2H A;  1Z6L A;  3KKJ A;  4J33 A;  2NPX A;  3NKS A;  5C3J A;  4U8I A;  4G74 A;  4XXG A;  2JAE A;  4I58 A;  1EL5 A;  2YVF A;  2XYO A;  4Z24 A;  3KPK A;  1YY5 A;  4OPG A;  1E39 A;  4H50 A;  1PBF A;  4U8L A;  1TDK A;  1VG9 A;  3F8D A;  3S5W A;  2Y6R A;  3KA7 A;  1O95 A;  3OC4 A;  3AEG A;  3KVE A;  1IUW A;  1DXL A;  4H4R A;  4OPD A;  2VQB A;  3T14 A;  3T2Z A;  4Y4N A;  1ELI A;  5U63 A;  2XLT A;  4AOX A;  3K7T A;  5BUK A;  4J31 A;  2RAB A;  3DGZ A;  4U8J A;  4FDC B;  2YR6 A;  3ALL A;  4K5R A;  5C2T A;  4HB9 A;  5KMP A;  4RG4 A;  1HYU A;  2OA1 A;  3GD3 A;  2VVL G;  2X50 A;  3O0H A;  1GXF A;  3FBS A;  2RGH A;  1QLB A;  2XFN A;  1ZOV A;  2YLW A;  3DME A;  2EQ8 A;  3DGH A;  3RNM A;  3BHK A;  2BXS A;  2TMD A;  2RGO A;  1NHP A;  1E1N A;  1RP0 A;  1GET A;  4A6N B;  2GMH A;  4B69 A;  3LZX A;  1S3B A;  2CDU A;  3AE4 A;  4JQ9 A;  2WP9 A;  4BK2 A;  1YQZ A;  5JCI A;  4EM3 A;  2X8G A;  5FS7 A;  3OZ2 A;  4GDP A;  1CJ4 A;  2AAQ A;  1EL9 A;  4ZCD A;  3T2Y A;  4H7U A;  5LV9 A;  4TM1 A;  2XLP A;  4LU6 A;  4YKF A;  4H4Z A;  3CGD A;  4EIQ A;  4G6G A;  4WX1 A;  4A99 A;  4U8N A;  5IQ4 A;  2GEW A;  1NG3 A;  4N9X A;  4TLX A;  2BS3 A;  4AT0 A;  4Z26 A;  3RP6 A;  1K0J A;  3GDP A;  1L9D A;  4U8P A;  1D4D A;  2JB3 A;  1JNR A;  4H4W A;  2B9X A;  2ZZB A;  1QO8 A;  2ZZC A;  4PAB A;  4TM4 A;  3C4N A;  2BA9 A;  5J7X A;  2ARD A;  3PS9 A;  1F8S A;  3LZW A;  1N4W A;  5BRT A;  1DJQ A;  1O94 A;  3AE6 A;  1JOA A;  3Q6J A;  3R9U A;  2JKC A;  3SZF A;  3CPI G;  2A89 A;  4O5Q A;  1CF3 A;  2C66 A;  3NLC A;  2BAB A;  1H84 A;  1OJT A;  2YLZ A;  5CQF A;  1P2E A;  4H2R A;  3S61 A;  2WOW A;  5M10 A;  1MXT A;  3DJG X;  1MOK A;  2XDO A;  1VG0 A;  5EB4 A;  4EQW A;  1PXA A;  3CNP A;  4P9S A;  4ZCC A;  1B4V A;  2R9Z A;  1KSU A;  2J3N A;  3AB1 A;  3IF9 A;  4USQ A;  2OLN A;  4BK1 A;  4PAA A;  5DBJ A;  4ZN0 A;  1PBD A;  1KDG A;  1CJ3 A;  2W0H A;  1H83 A;  1M64 A;  3C4A A;  4BK3 A;  4NNJ A;  1KSS A;  1UKV G;  2C3C A;  3ITJ A;  2WHD A;  4CCQ A;  2BAC A;  2YG3 A;  3P4P A;  2CUL A;  3CNS A;  3VR8 A;  5U1O A;  4B63 A;  2GAH B;  1CC6 A;  2GV8 A;  2V3A A;  2WU2 A;  2O9Z A;  3DJJ A;  3AE2 A;  1ZDL A;  4UDP A;  3AE9 A;  3QVR A;  3SQP A;  2GMJ A;  4Y4L A;  4EMW A;  4A5L A;  3V76 A;  2WOI A;  2GR3 A;  1L9C A;  2JK6 A;  3KPF A;  2GR1 A;  4Z44 A;  4OPU A;  2Z5X A;  4Z2T A;  2C65 A;  1B8S A;  2R0G A;  2YM2 A;  2NVK X;  3D8X A;  3F8P A;  3NT6 A;  3PO7 A;  1BZL A;  3VRA A;  2YLR A;  1LQU A;  3CGB A;  4EIP A;  3ICR A;  4H4P A;  3UTH A;  5BUL A;  4AOS A;  5HYM A;  2YG6 A;  4YTM A;  3SGL A;  2YR4 A;  3UP4 A;  2WOV A;  3QSS A;  3SYI A;  4TM0 A;  2WPE A;  1CC4 A;  2R4J A;  3EF6 A;  4I59 A;  4KPR A;  4USR A;  2C67 A;  4UP3 A;  3M12 A;  1F8W A;  1VRQ B;  3LAD A;  1GRT A;  1Y56 A;  2AR8 A;  2X99 A;  2VOU A;  3AEA A;  3GRS A;  4G73 A;  3NHO X;  1EL8 A;  1L0V A;  1OJD A;  2VVL A;  3H8I A;  3SZ0 A;  1XAN A;  4XWZ A;  2BCP A;  1PHH A;  1N4V A;  2RGJ A;  2YWL A;  3DA1 A;  5FS6 A;  3UTE A;  2BC1 A;  3IC9 A;  2JB1 A;  3P9U A;  4IA5 A;  4CY6 A;  1TDN A;  1FEC A;  1PBE A;  1PBB A;  4H4S A;  4UDQ A;  1ZP0 A;  2YM1 A;  3ATQ A;  1IJH A;  2C76 A;  2GR2 A;  2WDQ A;  1LQT A;  3SM8 A;  2GQW A;  3CND A;  1BWC A;  1YQ3 A;  3ABV A;  3FPZ A;  4LA1 A;  1H7W A;  4O5U A;  4C3Y A;  4D04 A;  1EBD A;  3QSM A;  4NWZ A;  1GOS A;  1ZK7 A;  3T0K A;  1K0I A;  1YQ4 A;  3UKF A;  4JY3 A;  1B5Q A;  2YG7 A;  3RP8 A;  3CPJ G;  2V60 A;  1Q1W A;  5FS8 A;  1LPF A;  3AXB A;  2I0Z A;  1LV0 A;  5KNL A;  3IWA A;  3LB8 A;  3NIX A;  4YSH A;  2GF3 A;  2XLS A;  3IHM A;  4K7Z A;  3GWF A;  1MO9 A;  1NEN A;  2WPF A;  3AEB A;  3H8L A;  2FBW A;  5JCL A;  1GT8 A;  2QA1 A;  2B76 A;  1O5W A;  4OPT A;  3T2K A;  5HHF A;  4B68 A;  1S2Y A;  3UOX A;  4EM4 A;  1KNP A;  4J34 A;  4AP1 A;  4IA6 A;  1M6I A;  5FS9 A;  3NTA A;  1K0L A;  3QFA A;  4EQS A;  2WPC A;  3ATR A;  3UCL A;  1LVL A;  1GRH A;  2VRM A;  4K22 A;  5KOX A;  2XVE A;  3WE0 A;  3DK8 A;  2BRA A;  3VR9 A;  5KMQ A;  3NN6 X;  1GRF A;  2R45 A;  4OVI A;  3ZDN A;  2X3N A;  1BF3 A;  4GRT A;  1GEU A;  3II4 A;  1Q9I A;  3CGE A;  3G5S A;  3SXI A;  1GRA A;  4JDR A;  1LJ1 A;  1NHR A;  2EQ6 A;  5M0Z A;  1DOE A;  3DH9 A;  3HYV A;  2DKI A;  3NK0 X;  1GV4 A;  5KMR A;  4GAV A;  3SFE A;  1CC2 A;  3BI2 A;  2H88 A;  4GCM A;  4OPI A;  1D7Y A;  2QA2 A;  2A87 A;  2BK5 A;  2CFY A;  3EPT A;  4II3 A;  2EQ7 A;  2WP5 A;  2WDV A;  1S2Q A;  4TLZ A;  4B65 A;  2R0C A;  4YKG A;  2WU5 A;  3GD4 A;  3COX A;  3CMM A;  3UTG A;  4G9K A;  1NHQ A;  3E1T A;  3NK1 X;  1NG4 A;  3NTD A;  2WQY A;  4TM3 A;  3VRD B;  5U25 A;  1PXB A;  2WBA A;  4M52 A;  1ZX9 A;  2Q6U A;  4J56 A;  1ONF A;  1E7P A;  1ZMC A;  3AYL A;  1DOC A;  5GSN A;  3AE3 A;  4HA6 A;  4B1B A;  1GSN A;  1H6V A;  3K7Q X;  1KFY A;  3P4S A;  4OPC A;  3K30 A;  4XWR A;  2BC0 A;  4U2T A;  1JNZ A;  3BNM A;  4B64 A;  2C70 A;  2OAL A;  3QJ4 A;  3P4R A;  4H4T A;  1JU2 A;  2QAE A;  2QCU A;  2A8X A;  4GAP A;  3SZC A;  4APN A;  2E4G A;  4H4U A;  2YQU A;  3GWD A;  1D4C A;  1D7L A;  1IUT A;  2BYB A;  5EB5 A;  4X4J A;  2FJA A;  1L9E A;  2GR0 A;  3ALJ A;  3CN8 A;  4K5S A;  1W4X A;  1JRX A;  1GPE A;  4EQR A;  3AYJ A;  4NTD A;  3JSK A;  2YG4 A;  3UKL A;  1GTE A;  2VZ2 A;  4ADW A;  5JCN A;  3NK2 X;  1TDO A;  2R46 A;  5L46 A;  1BGJ A;  2BS2 A;  5FMH A;  5BVA A;  1PJ7 A;  4RG3 A;  2GRT A;  3L1R A;  1E1M A;  2PHH A;  2V3B A;  2VVM A;  3QSE A;  5TR3 A;  2V61 A;  4B67 A;  3SZW A;  1RSG A;  3KU9 A;  1NDA A;  2B9W A;  4ICY A;  4A65 A;  2BK4 A;  3LOV A;  1H82 A;  4YTP A;  1TRB A;  2C3D A;  2R0P A;  3M13 A;  2Q0K A;  2WS3 A;  2IID A;  1TDE A;  4GF7 A;  1GER A;  1B37 A;  3GMB A;  1JRZ A;  4OCG A;  3UOY A;  4BJY A;  1NPX A;  4DSG A;  4J2W A;  3SX6 A;  2OLO A;  1KNR A;  4CBQ A;  4Z43 A;  4DSH A;  3NRN A;  3Q9T A;  3UP5 A;  1F6M A;  1QJD A;  1E1L A;  2YLX A;  3AE1 A;  3GSI A;  5KRQ A;  3AE7 A;  2F5Z A;  3ALM A;  3NN0 X;  1GND A;  3UOZ A;  3LJP A;  4FX9 A;  1GES A;  2HQM A;  4AP3 A;  3QFB A;  2E1M A;  3T31 A;  2YLS A;  4Z2R A;  4WCT A;  2X8C A;  3I6D A;  1PBC A;  4REK A;  1PJ6 A;  2BS4 A;  2CVJ A;  1N1P A;  2WES A;  1K4Q A;  3F8R A;  4H4V A;  4LII A;  3UTF A;  1ZKQ A;  3KD9 A;  3FIM B;  2C7G A;  1PDH A;  1F8R A;  2PYX A;  2AQJ A;  5ER0 A;  4C5O A;  4J57 A;  2GVC A;  1XDI A;  1FL2 A;  3PVC A;  5GRT A;  4CNK A;  2C73 A;  2BXR A;  4H2Q A;  3QVP A;  5JCK A;  4A6N A;  1LTX R;  3ICS A;  1PN0 A;  1GRE A;  1E6E A;  3AD9 B;  4C74 A;  3L8K A;  4KX6 A;  1S3E A;  5KVI A;  3HYW A;  2B7R A;  4X9M A;  3ADA B;  2B7S A;  4Y4M A;  2C75 A;  2IVE A;  4FK1 A;  4NEW A;  3FG2 P;  4EMI A;  4IVM B;  5IQ1 A;  3DK4 A;  1GRB A;  3G5Q A;  4CY8 A;  4U8K A;  4YSX A;  3CNT A;  3GRT A;  3EAO A;  5HY5 A;  1Y56 B;  4NZH A;  1REO A;  3P4Q A;  4ECH A;  1AOG A;  2FJB A;  4YTN A;  3GYI A;  1D4E A;  4IV9 A;  4Z25 A;  3UKQ A;  1IUV A;  3BNU A;  2YR5 A;  1Y0P A;  1X31 B;  1IUX A;  2XCG A;  3B6D A;  1CJC A;  1F3P A;  3K7M X;  3M0O A;  2XVI A;  5HXI A;  4JNQ A;  3UKP A;  2R4E A;  5EOW A;  1TYT A;  2XFP A;  3CPH G;  4GUV A;  3SY4 A;  3RHA A;  4B66 A;  5CKU A;  1H86 A;  1PS9 A;  4MJW A;  3NG7 X;  4U8M A;  4A9W A;  3AD7 B;  2YVJ A;  1GTH A;  3DJD A;  4H4Q A;  3AEE A;  1JEH A;  3AE5 A;  3AED A;  3HZL A;  4GDE A;  4RSL A;  3RED A;  3GYJ A;  2ACZ A;  2C64 A;  3RP7 A;  1DJN A;  1PXC A;  1SEZ A;  1TYP A;  2ZBW A;  4DGK A;  1GRG A;  4NEV A;  3AD8 B;  3UKK A;  2GB0 A;  3BHF A;  4Z2U A;  1ZY8 A;  1IUU A;  4DNA A;  3NH3 X;  1H81 A;  2IVD A;  3VQR A;  1OJ9 A;  2YLT A;  1RYI A;  3CTY A;  5IPY A;  1KF6 A;  2XVJ A;  2JBV A;  4YT0 A;  5KXJ A;  1EL7 A;  5KMS A;  3URH A;  1V59 A;  1NEK A;  2JB2 A;  3CIR A;  4U2L A;  3AYI A;  4YSY A;  3CGC A;  4H2N A;  2C72 A;  1ZOY A;  5KOW A;  4C77 A;  2DKH A;  2XVH A;  2XFO A;  3UKH A;  4JN9 A;  3DJE A;  3G5R A;  4BV6 A;  2EQ9 A;  5KVH A;  3V3N A;  5J60 A;  1ZMD A;  4D03 A;  2OAM A;  2BCG G;  2YG5 A;  5EBK A;  3UKA A;  1DOB A;  1CL0 A;  3KLJ A;  3ICT A;  4YXD A;  2Z5Y A;  3GDN A;  2B9Y A;  4U2S A;  4J36 A;  4H4Y A;  2APG A;  3B3R A;  4GR1 A;  2UZZ A;  4II2 A;  4C3X A;  2FJD A;  3H4K A;  1GAL A;  4NTE A;  2V5Z A;  3C96 A;  3AE8 A;  3ZYX A;  3I3L A;  1FEB A;  2WET A;  5KWF A;  3EAN A;  1OJC A;  1COY A;  1VQW A;  4A7A A;  4BUR A;  1DOD A;  1VDC A;  3SFD A;  4JNA A;  4A79 A;  3D1C A;  3T37 A;  4U8O A;  4BJZ A;  3LXD A;  1CHU A;  2GQF A;  2ZZ0 A;  4H2P A;  1D5T A;  2XFU A;  2TPR A;  3BI5 A;  2E5V A;  3FMW A;  2BK3 A;  3HYX A;  3V3O A;  1E1K A;  1JRY A;  3NYF A;  4AT2 A;  3AWI A;  1N4U A;  2H89 A;  4K8D A;  1H7X A;  1FCD A;  1XHC A;  2Q0L A;  2WEU A;  3AEF A;  1DNC A;  3BI4 A;  1OJA A;  2FJE A;  2X8H A;  2GH5 A;  3NGC X;  2XFQ A;  4FK1 C;  1CJ2 A;  1FOH A;  3GYX A;  4CNJ A;  3AEC A;  4IVO B;  3VRB A;  1BGN A;  1XPQ A;  4EMJ A;  1FEA A;  3CNJ A;  5JCM A;  3NYE A;  4E0V A;  2BRY A;  2XLR A;  2Y6Q A;  2YVG A;  1BKW A;  2YAU A;  3P1W A;  3GMC A;  1NHS A;  2WDR A;  1Q1R A;  2C4C A;  2WP6 A;  2VQ7 A;  3IHG A;  3NYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...