3K7QX

Crystal structure of substrate-bound 6-hydroxy-l-nicotine oxidase from arthrobacter nicotinovorans
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 147
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7qX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7qX02
2UZZA 3QJ4A 2QAEA 3ICTA 1OJTA 2GH5A 2YQUA 2XLPA 4DGKA 3CNDA 4UDQA 5J60A 2V60A 4U2TA 2YLSA 4AP3A 1KF6A 4AP1A 1DJQA 3Q9TA 3UKQA 1RP0A 4Y4LA 3ICSA 1N1PA 2VVLA 2NPXA 1ZDLA 2WQYA 4GUVA 5DBJA 2I0ZA 2VOUA 3QSSA 3SM8A 4P9SA 3K7QX 4A9WA 3AE7A 2FJDA 4EMWA 4FK1C 3NN0X 4RG3A 1H82A 2BK3A 3CNTA 1F8RA 2BABA 2YVGA 3UOYA 5JCIA 2JB2A 1CC4A 2XFOA 4YSYA 1Z6LA 1PXAA 3ZDNA 1EL8A 4JY2A 3R9UA 5C2TA 1N4UA 1FECA 1MO9A 1M6IA 1GOSA 3UOXA 4J33A 4IA5A 4TM0A 3F8PA 3GMBA 1RSGA 3L1RA 4CNJA 5JCKA 2JBVA 3UKAA 3UKHA 3B3RA 2GMJA 3ATQA 1E7PA 3LZXA 2X3NA 4U8LA 3NTAA 3GYIA 5BUKA 1EL5A 2WOVA 1QO8A 3CGCA 5L46A 4LIIA 4FDCB 1IUWA 1NHRA 2APGA 4JQ9A 1NAAA 2GQWA 4CY8A 3LADA 2C70A 5IQ1A 4EQSA 2GAHB 4OPDA 4ZCDA 3H4KA 3LXDA 5BRTA 2VZ2A 3KVEA 3COXA 1F8WA 2YVJA 4DSHA 5KVHA 2ZZ0A 5HXIA 3IC9A 3O0HA 4C77A 2IIDA 4C3XA 2X99A 3KA7A 3CPJG 2B7RA 5GRTA 5U1OA 3DGZA 1TDEA 3HZLA 2IVDA 1CF3A 2C75A 1XANA 1VQWA 3GYJA 1CJ2A 4RG4A 2FJBA 4LA1A 1XPQA 2V3BA 3NKSA 4GF7A 4H4QA 4Z44A 1DOEA 3SFEA 3GWDA 3UKPA 2WOWA 2BXSA 3DMEA 2XVEA 1BZLA 3RP7A 1RYIA 4OPGA 4CY6A 4E0VA 1DXLA 1LVLA 2B9XA 3AWIA 4USRA 5U63A 4Z2UA 1JNRA 3NIXA 1UKVG 3KLJA 2RGOA 4AOXA 2QA1A 1IUUA 3S5WA 5LV9A 4H2QA 2ARDA 2Q7VA 3EAOA 3AEEA 4H2PA 1GRFA 4ZCCA 1PN0A 3ALMA 4Z24A 2R9ZA 5C3JA 2GV8A 3AE3A 1B8SA 1BGJA 2BK5A 3GMCA 1NDAA 2DKIA 2XFPA 3AE6A 4B63A 3IHGA 4N9XA 4CNKA 1ZMCA 4BURA 4YT0A 3ICRA 4OPTA 3H8LA 4A5LA 3CPIG 4U8OA 1REOA 2GF3A 1JEHA 4B1BA 4B65A 1PJ5A 5TR3A 4C3YA 3BNUA 2WDVA 4B68A 4H4PA 2A89A 1PBBA 1TDOA 4DNAA 3UTGA 1OJCA 4YKGA 1QLBA 5CQFA 4UP3A 5FS9A 1BGNA 1GPEA 4KPRA 1H6VA 3KU9A 3ALLA 4A7AA 1P2EA 3II4A 4Y4NA 1ZX9A 1O94A 4M52A 4K7ZA 2B9YA 4H4RA 4J34A 4GR1A 2YLWA 1CL0A 2YVFA 3RP8A 2OAMA 1L9DA 2NVKX 2RGHA 3ATRA 4ECHA 3UOZA 2XVFA 1LQTA 4H2NA 4A99A 4BV6A 4EQRA 3QSMA 1JOAA 2JB3A 3CIRA 2WP6A 1BKWA 3L8KA 1PBDA 1Y0PA 3NK1X 3AEFA 4EIQA 1E6EA 1Q1WA 2WPCA 5JCLA 1L9EA 3BI4A 2GR3A 3RNMA 1VG9A 3NT6A 4USQA 1PS9A 1PBCA 3V3OA 2B76A 2C76A 1B4VA 4LU6A 1FL2A 4D04A 2V5ZA 3CN8A 3AE4A 1ZK7A 4TM4A 4BJYA 1O95A 4JNQA 1HYUA 1CHUA 4NTCA 3NYCA 2YR6A 3RP6A 4EMIA 2X8HA 2XFNA 2CFYA 1E1KA 5FMHA 3M0OA 1CBOA 1TDFA 2BCPA 2OLNA 2YG7A 1N4WA 2Y6RA 1KFYA 3P4QA 4EQXA 2R0GA 3D1CA 1TYPA 1IUVA 3T37A 3ZYXA 2XVIA 1JRXA 2X8CA 1GETA 1S3BA 2WEUA 3VRBA 3C4NA 4PABA 3DK9A 3VR8A 2OLOA 2WPFA 2Z5YA 1F3PA 3CGBA 4XWZA 1N4VA 1CC6A 1H84A 4EM4A 1V59A 1AOGA 4GDPA 4U8PA 1YKJA 2XLTA 3ISHA 1EL9A 4NTDA 4H4TA 3VRDB 3DK4A 2RABA 4IVOB 2BXRA 5IQ4A 2BS4A 1GREA 2YG5A 3QVRA 4J31A 1NENA 1K0IA 2A87A 1LJ1A 2VRMA 2VVLG 3G5QA 4TM1A 2C73A 2EQ9A 2WESA 3AB1A 3I3LA 1PDHA 4YWOA 1ONFA 3LOVA 3QSEA 2BS2A 4YTNA 5HYMA 4H2RA 1D7LA 2GRTA 2X8GA 2GVCA 5ER0A 5M10A 4J57A 2BK4A 3AEDA 1L0VA 3UKFA 3LJPA 2EQ6A 2WS3A 5EBKA 2IVEA 2VQBA 3EF6A 4Z25A 1TRBA 4WX1A 2R45A 2YG6A 3NHOX 4K5SA 5BULA 3UOVA 2W0HA 1YQZA 4FK1A 4YXDA 2PYXA 1KNPA 1GEUA 2XFQA 3I6DA 3P9UA 4UDPA 4EMJA 3E1TA 1KNRA 3PO7A 3GRTA 1GSNA 4Z26A 2XFUA 3B6DA 4GDEA 4TM3A 3EPTA 4BK2A 2JKCA 3IHMA 3REDA 2GR0A 1ELIA 3ABVA 3D8XA 3GD3A 2C3DA 1PXCA 2Q0KA 1Q9IA 1M64A 4H4UA 4WCTA 4DSGA 5KOXA 3CGDA 2OALA 1LV0A 3AE1A 2V3AA 5M0ZA 2GMHA 2TMDA 5CKUA 4OPUA 3DK8A 4A6NA 1FCDA 3CNJA 1K0LA 1ZKQA 2ACZA 2R0PA 3DJJA 2Y6QA 3CGEA 2V61A 1OJAA 3AE2A 2YLZA 5KXJA 2FBWA 2H88A 1GERA 2Q6UA 2WDQA 4BK3A 1ZP0A 2EQ7A 3KD9A 5FS8A 2A8XA 2ZZCA 2AAQA 1O5WA 1D4CA 4EIPA 4J2WA 2FJAA 3F8DA 1PJ6A 4JDRA 3P4RA 2TPRA 3SGLA 3LZWA 1B5QA 2B7SA 4YKFA 2AQJA 2YM1A 3AXBA 4OVIA 1GTHA 1PBFA 1F8SA 4CBQA 3G5RA 1VDCA 4NTEA 2GB0A 4U2LA 4EQWA 1OJ9A 3GRSA 3GWFA 3UTHA 1ZY8A 2XDOA 2R0CA 3AD7B 2WHDA 1S2YA 3BNMA 1H86A 3S61A 4YSZA 1NHPA 3V76A 3QFBA 2GR2A 1NHQA 4D03A 4ZN0A 3G5SA 3C4AA 3NH3X 1DNCA 1GRBA 4H4SA 3NK0X 3PS9A 4BJZA 3M12A 2C67A 4K5RA 1DJNA 2Z5XA 3K30A 3BHFA 1NEKA 2PHHA 3CNPA 2DKHA 3SQPA 1LTXR 3P4PA 2WU5A 5EB5A 3FPZA 1S2QA 4IV9A 1EBDA 2E5VA 2WDRA 4CCQA 3ALJA 3NYEA 1LQUA 3NTDA 2CDUA 1ZOVA 3K7MX 4ICYA 4J56A 4TLZA 2C65A 2XCGA 2YLRA 2OA1A 3RHAA 3UKLA 3CNSA 2CVJA 2R46A 4NEVA 4X9NA 1L9CA 2R4EA 4B67A 2GQFA 4HA6A 3KKJA 3NYFA 3UKKA 1CJ3A 4AT0A 1DODA 2GR1A 2EQ8A 4C5OA 3AEAA 5KRQA 3NK2X 2WETA 4OPLA 1GRGA 4APNA 1GNDA 1E1NA 1W4XA 2YG4A 4YSXA 3DA1A 4C74A 1OJDA 1EL7A 4REKA 4X9MA 2XVHA 4Z2RA 1E1LA 3AECA 3UTEA 5KVIA 3WE0A 3BI2A 2C72A 1QJDA 2FJEA 4RSLA 1PBEA 3FIMB 1JRZA 3VR9A 3QFAA 1GTEA 1TYTA 1DOCA 2XLUA 4GCMA 4B66A 2JK6A 2WBAA 2BA9A 3CTYA 2X50A 3AEGA 2CULA 2BC1A 4EM3A 2E1MA 1PHHA 2GAGB 4YSHA 1GRTA 1FEAA 1JU2A 2JAEA 1NHSA 2Q0LA 2BC0A 1P2HA 2QA2A 3FBSA 3SFDA 3GDPA 1FEBA 5HHFA 2XLRA 4ADWA 2H89A 4OCGA 4A6NB 4H4XA 2VQ7A 1KDGA 5KOWA 2BYBA 4AT2A 5FS7A 1B37A 2ZBWA 1FOHA 2YM2A 3AYIA 1DOBA 3NRNA 2C64A 4OPIA 2B9WA 1GT8A 1GALA 3FG2P 4CCRA 1E1MA 1LPFA 3M13A 3ADAB 3PVCA 1IUSA 2F5ZA 2E4GA 5HY5A 1MOKA 1NG3A 3AE9A 5EB4A 4K2XA 1E39A 4YTPA 1SEZA 3BI5A 3QVPA 2RGJA 3GSIA 5U25A 2ZZBA 3V3NA 2AR8A 4XXGA 3P1WA 4U2SA 3AE5A 3UCLA 2XLSA 3Q6JA 4MJWA 1S3EA 2C3CA 5KWFA 2O9ZA 4U8NA 1JRYA 2J3NA 4O5UA 2BCGG 1VRQB 3JSKA 4U8KA 4NZHA 2YR4A 4U8MA 3VRAA 3CPHG 3DJEA 2GEWA 1X31B 1YY5A 2C7GA 5IPYA 4K8DA 4U8IA 1H81A 1ZOYA 3NNEA 1CC2A 3NGCX 2BS3A 2HQMA 1GXFA 4O5QA 1D4DA 1GRHA 2V6OA 1Y56A 1TDNA 2WU2A 4KX6A 4XWRA 2WP9A 4GRTA 3DJGX 1TDKA 1D4EA 4J36A 2WP5A 4I59A 2C66A 3AE8A 4I58A 2YR5A 1KSUA 2XVJA 3H8IA 1JNZA 4OPCA 1IJHA 1D7YA 1PXBA 4BK1A 1IUTA 4Z2TA 1IUXA 3GDNA 5JCNA 3IF9A 3KPFA 4JN9A 1COYA 1XHCA 1YQ4A 3OC4A 1NG4A 4H4VA 4B69A 4X4JA 3VQRA 5JCMA 1BWCA 2YLTA 4U8JA 4Z43A 1CJCA 3FMWA 1GRAA 4H4YA 2YLXA 1GV4A 2QCUA 4JY3A 4JNAA 5GSNA 5EOWA 4UDRA 4Y4MA 1Y56B 3EANA 4PAAA 4A79A 4H4WA 3LB8A 5BVAA 1H7WA 2BACA 3NG7X 3BHKA 1PJ7A 4NEWA 2R4JA 3P4SA 1ZMDA 3AEBA 4AOSA 1H7XA 1NPXA 4A65A 3OZ2A 3UP4A 4YTMA 1K0JA 1KSSA 3AD8B 1VG0A 3F8RA 1F6MA 4H50A 2YWLA 3AYJA 3DJDA 2VVMA 4B64A 3DH9A 5FS6A 3NN6X 3URHA 4IA6A 2YG3A 4CRTA 4TLXA 3AD9B 4IVMB 1XDIA 1K4QA 3UTFA 5J7XA 1Q1RA 1GESA 1YQ3A 3UP5A 1BF3A 3NLCA 1H83A 3AYLA 3DGHA 3C96A 2VRLA 3K7TA 4FX9A 2YAUA 4H4ZA 1MXTA 4K22A 3ITJA 3GD4A 2XYOA 2JB1A 2WPEA 2WOIA 3IWAA 1D5TA 4HB9A 1CJ4A 4H7UA
chains in the Genus database with same CATH superfamily
2UZZA 3QJ4A 2QAEA 3ICTA 1OJTA 2GH5A 2YQUA 2XLPA 4DGKA 3CNDA 4UDQA 5J60A 2V60A 4U2TA 2YLSA 4AP3A 1KF6A 4AP1A 1DJQA 3Q9TA 3UKQA 1RP0A 4Y4LA 3ICSA 1N1PA 2VVLA 2NPXA 1ZDLA 2WQYA 4GUVA 5DBJA 2I0ZA 2VOUA 3QSSA 3SM8A 4P9SA 3K7QX 4A9WA 3AE7A 2FJDA 4EMWA 4G6HA 4FK1C 3NN0X 4RG3A 1H82A 2BK3A 3CNTA 1F8RA 2BABA 2YVGA 3UOYA 5JCIA 2JB2A 1CC4A 2XFOA 4YSYA 1Z6LA 4II2A 1PXAA 3ZDNA 1EL8A 4JY2A 3R9UA 5C2TA 1N4UA 1FECA 1MO9A 1M6IA 1GOSA 3UOXA 4J33A 3SXIA 4IA5A 4TM0A 3F8PA 3GMBA 1RSGA 3L1RA 4CNJA 5JCKA 2JBVA 3UKAA 3UKHA 3B3RA 2GMJA 3ATQA 1E7PA 3LZXA 2X3NA 4U8LA 3NTAA 3GYIA 5BUKA 1EL5A 2WOVA 1QO8A 3CGCA 5L46A 4LIIA 4FDCB 1IUWA 1NHRA 2APGA 4JQ9A 1NAAA 2GQWA 4CY8A 3LADA 2C70A 5IQ1A 4EQSA 2GAHB 4OPDA 4ZCDA 3H4KA 3LXDA 5BRTA 2VZ2A 3KVEA 3COXA 1F8WA 2YVJA 4DSHA 5KVHA 2ZZ0A 4G74A 5HXIA 3IC9A 3O0HA 4C77A 2IIDA 4C3XA 3HYVA 2X99A 3KA7A 3CPJG 2B7RA 5GRTA 5U1OA 3DGZA 1TDEA 3HZLA 2IVDA 1CF3A 2C75A 1XANA 1VQWA 3GYJA 1CJ2A 4RG4A 2FJBA 4LA1A 1XPQA 2V3BA 3NKSA 4GF7A 4H4QA 4Z44A 1DOEA 4NWZA 3SFEA 3GWDA 3SX6A 3UKPA 2WOWA 2BXSA 3DMEA 2XVEA 1BZLA 3RP7A 1RYIA 4OPGA 4CY6A 4E0VA 1DXLA 1LVLA 2B9XA 3AWIA 4USRA 5U63A 4Z2UA 1JNRA 3NIXA 1UKVG 3KLJA 2RGOA 4AOXA 2QA1A 1IUUA 3S5WA 5LV9A 4H2QA 2ARDA 2Q7VA 3EAOA 3AEEA 4H2PA 1GRFA 4ZCCA 1PN0A 3ALMA 4Z24A 2R9ZA 5C3JA 2GV8A 3AE3A 1B8SA 1BGJA 2BK5A 3GMCA 1NDAA 2DKIA 2XFPA 3AE6A 4B63A 3IHGA 4N9XA 4CNKA 1ZMCA 4BURA 4YT0A 3ICRA 4OPTA 3H8LA 4A5LA 3CPIG 4U8OA 1REOA 2GF3A 1JEHA 4NNJA 4B1BA 4B65A 1PJ5A 5TR3A 4C3YA 3BNUA 2WDVA 4B68A 4H4PA 2A89A 1PBBA 1TDOA 4DNAA 3UTGA 1OJCA 4YKGA 1QLBA 5CQFA 4UP3A 5FS9A 1BGNA 1GPEA 4KPRA 1H6VA 3KU9A 3ALLA 3SY4A 4A7AA 1P2EA 3II4A 4Y4NA 1ZX9A 1O94A 4M52A 4K7ZA 2B9YA 4H4RA 4J34A 4GR1A 2YLWA 1CL0A 2YVFA 3RP8A 2OAMA 1L9DA 2NVKX 2RGHA 3ATRA 4ECHA 3UOZA 2XVFA 1LQTA 4H2NA 4A99A 4BV6A 4EQRA 3QSMA 3HYXA 1JOAA 2JB3A 3CIRA 2WP6A 1BKWA 3L8KA 1PBDA 1Y0PA 3NK1X 3AEFA 4EIQA 1E6EA 1Q1WA 2WPCA 5JCLA 1L9EA 3BI4A 2GR3A 3RNMA 1VG9A 3NT6A 4USQA 1PS9A 1PBCA 3V3OA 2B76A 2C76A 1B4VA 4LU6A 1FL2A 4D04A 2V5ZA 3CN8A 3AE4A 1ZK7A 4TM4A 4BJYA 1O95A 4JNQA 1HYUA 1CHUA 4NTCA 3NYCA 2YR6A 3RP6A 4EMIA 2X8HA 2XFNA 2CFYA 1E1KA 5FMHA 3M0OA 1CBOA 1TDFA 2BCPA 2OLNA 2YG7A 1N4WA 2Y6RA 1KFYA 3P4QA 4EQXA 2R0GA 3D1CA 1TYPA 1IUVA 3T37A 3ZYXA 2XVIA 1JRXA 2X8CA 1GETA 1S3BA 2WEUA 3SZWA 3C4NA 3VRBA 4PABA 3DK9A 3VR8A 2OLOA 2WPFA 2Z5YA 1F3PA 3CGBA 4XWZA 1N4VA 1CC6A 1H84A 4EM4A 1V59A 1AOGA 4GDPA 4U8PA 1YKJA 2XLTA 3ISHA 1EL9A 4NTDA 4H4TA 3VRDB 3DK4A 2RABA 4IVOB 2BXRA 5IQ4A 2BS4A 1GREA 2YG5A 3QVRA 4J31A 1NENA 1K0IA 2A87A 1LJ1A 2VRMA 2VVLG 3G5QA 4TM1A 2C73A 2EQ9A 2WESA 3AB1A 3I3LA 1PDHA 4YWOA 1ONFA 3LOVA 3QSEA 2BS2A 4YTNA 5HYMA 4H2RA 1D7LA 2GRTA 2X8GA 2GVCA 5ER0A 5M10A 4J57A 2BK4A 3AEDA 1L0VA 3UKFA 3LJPA 2EQ6A 2WS3A 5EBKA 2IVEA 2VQBA 3EF6A 4Z25A 1TRBA 4WX1A 2R45A 2YG6A 3NHOX 4K5SA 5BULA 3UOVA 2W0HA 1YQZA 4FK1A 4YXDA 2PYXA 1KNPA 1GEUA 2XFQA 3I6DA 3P9UA 4UDPA 4EMJA 3E1TA 1KNRA 3PO7A 3GRTA 1GSNA 4Z26A 2XFUA 3B6DA 4GDEA 4TM3A 3EPTA 4BK2A 3HYWA 2JKCA 3IHMA 3REDA 2GR0A 1ELIA 3ABVA 3D8XA 3GD3A 2C3DA 1PXCA 2Q0KA 1Q9IA 1M64A 4H4UA 4WCTA 4DSGA 5KOXA 3CGDA 2OALA 1LV0A 3AE1A 2V3AA 5M0ZA 2GMHA 2TMDA 5CKUA 4OPUA 3DK8A 4A6NA 1FCDA 3CNJA 1K0LA 1ZKQA 2ACZA 2R0PA 3DJJA 2Y6QA 3CGEA 2V61A 1OJAA 3AE2A 2YLZA 5KXJA 2FBWA 2H88A 1GERA 2Q6UA 2WDQA 4BK3A 1ZP0A 2EQ7A 3KD9A 5FS8A 2A8XA 2ZZCA 2AAQA 1O5WA 1D4CA 4EIPA 4II3A 4J2WA 2FJAA 3F8DA 1PJ6A 4JDRA 3P4RA 2TPRA 3SGLA 3LZWA 1B5QA 2B7SA 4YKFA 2AQJA 2YM1A 3AXBA 4OVIA 1GTHA 1PBFA 1F8SA 4CBQA 3G5RA 1VDCA 4NTEA 2GB0A 4U2LA 4EQWA 1OJ9A 3GRSA 3GWFA 3UTHA 1ZY8A 2XDOA 2R0CA 3AD7B 2WHDA 1S2YA 3BNMA 1H86A 3S61A 4YSZA 3GYXA 1NHPA 3V76A 3QFBA 2GR2A 1NHQA 4D03A 4ZN0A 5KMRA 3G5SA 3C4AA 3NH3X 1DNCA 1GRBA 4H4SA 3NK0X 3PS9A 4BJZA 3M12A 2C67A 4K5RA 1DJNA 2Z5XA 3K30A 3BHFA 1NEKA 2PHHA 3CNPA 2DKHA 3SQPA 1LTXR 3P4PA 2WU5A 5EB5A 3FPZA 1S2QA 4IV9A 1EBDA 2E5VA 2WDRA 4CCQA 3ALJA 3NYEA 1LQUA 3NTDA 2CDUA 1ZOVA 3K7MX 4ICYA 4J56A 4TLZA 2C65A 2XCGA 2YLRA 2OA1A 3RHAA 3UKLA 3CNSA 2CVJA 2R46A 4NEVA 4X9NA 1L9CA 2R4EA 4B67A 2GQFA 5KMPA 3T2ZA 4HA6A 3KKJA 3NYFA 3UKKA 1CJ3A 4AT0A 1DODA 2GR1A 4GAPA 4GAVA 2EQ8A 4C5OA 3AEAA 5KRQA 3NK2X 2WETA 4OPLA 1GRGA 4APNA 1GNDA 1E1NA 1W4XA 2YG4A 4YSXA 3DA1A 4C74A 1OJDA 1EL7A 4REKA 4X9MA 2XVHA 4Z2RA 3SZ0A 1E1LA 3AECA 3UTEA 5KVIA 3WE0A 3BI2A 2C72A 1QJDA 2FJEA 5KMSA 4RSLA 1PBEA 3FIMB 1JRZA 3VR9A 3QFAA 1GTEA 1TYTA 1DOCA 2XLUA 4GCMA 4B66A 2JK6A 2WBAA 2BA9A 3CTYA 2X50A 3AEGA 2CULA 2BC1A 4EM3A 2E1MA 1PHHA 2GAGB 4YSHA 1GRTA 1FEAA 1JU2A 2JAEA 1NHSA 2Q0LA 2BC0A 1P2HA 2QA2A 3FBSA 3SFDA 3GDPA 1FEBA 5HHFA 2XLRA 4ADWA 2H89A 4OCGA 4A6NB 4H4XA 2VQ7A 1KDGA 5KOWA 2BYBA 5KMQA 4AT2A 5FS7A 1B37A 2ZBWA 1FOHA 2YM2A 3AYIA 1DOBA 3NRNA 2C64A 4OPIA 2B9WA 2C4CA 1GT8A 1GALA 3FG2P 4CCRA 1E1MA 1LPFA 3M13A 3ADAB 3PVCA 1IUSA 2F5ZA 2E4GA 3KPKA 5HY5A 1MOKA 1NG3A 3AE9A 5EB4A 4K2XA 1E39A 4YTPA 1SEZA 3BI5A 3QVPA 2RGJA 3GSIA 5U25A 2ZZBA 3V3NA 2AR8A 4XXGA 3P1WA 4U2SA 3AE5A 3UCLA 2XLSA 5KNLA 3Q6JA 4MJWA 1S3EA 2C3CA 5KWFA 2O9ZA 4U8NA 4G73A 1JRYA 3SZCA 2J3NA 4O5UA 2BCGG 1VRQB 3JSKA 4U8KA 4NZHA 2YR4A 4U8MA 3VRAA 3CPHG 3DJEA 2GEWA 1X31B 1YY5A 2C7GA 5IPYA 3SZFA 4K8DA 4U8IA 1H81A 1ZOYA 3NNEA 1CC2A 3NGCX 3T31A 2BS3A 3T2KA 2HQMA 1GXFA 4O5QA 1D4DA 1GRHA 2V6OA 1Y56A 1TDNA 2WU2A 4KX6A 4XWRA 2WP9A 4GRTA 3DJGX 1TDKA 1D4EA 4G9KA 4J36A 2WP5A 4I59A 2C66A 3AE8A 4I58A 2YR5A 1KSUA 2XVJA 3H8IA 1JNZA 4OPCA 1IJHA 1D7YA 1PXBA 4BK1A 1IUTA 4Z2TA 1IUXA 3GDNA 5JCNA 3IF9A 3KPFA 4JN9A 1COYA 1XHCA 1YQ4A 3T2YA 3OC4A 1NG4A 4H4VA 4B69A 4X4JA 3VQRA 5JCMA 1BWCA 2YLTA 3SYIA 4U8JA 4Z43A 1CJCA 3FMWA 1GRAA 4H4YA 2YLXA 1GV4A 2QCUA 4JY3A 4JNAA 5GSNA 5EOWA 4UDRA 2BRYA 4Y4MA 1Y56B 3EANA 4PAAA 4A79A 4H4WA 3LB8A 5BVAA 1H7WA 2BACA 3NG7X 3BHKA 1PJ7A 4NEWA 2R4JA 3P4SA 1ZMDA 3AEBA 4AOSA 1H7XA 1NPXA 4A65A 3OZ2A 3UP4A 4YTMA 1K0JA 1KSSA 3AD8B 1VG0A 3F8RA 1F6MA 4H50A 3T14A 2YWLA 3AYJA 3DJDA 2VVMA 4B64A 3DH9A 5FS6A 3NN6X 3URHA 4IA6A 2YG3A 4CRTA 4TLXA 3AD9B 4IVMB 1XDIA 1K4QA 3UTFA 3CMMA 5J7XA 1Q1RA 1GESA 1YQ3A 3UP5A 1BF3A 3NLCA 1H83A 3AYLA 3DGHA 3C96A 2VRLA 3K7TA 4FX9A 2YAUA 4H4ZA 1MXTA 4K22A 3ITJA 3GD4A 2XYOA 2JB1A 2WPEA 2WOIA 3IWAA 1D5TA 4HB9A 1CJ4A 4H7UA 4G6GA 2BRAA 3T0KA
chains in the Genus database with same CATH topology
2UZZA 3QJ4A 2QAEA 3ICTA 1OJTA 2GH5A 2YQUA 2XLPA 4DGKA 3CNDA 4UDQA 5J60A 2V60A 4U2TA 2YLSA 4AP3A 1KF6A 4AP1A 1DJQA 3Q9TA 3UKQA 1RP0A 4Y4LA 3ICSA 1N1PA 2VVLA 2NPXA 1ZDLA 2WQYA 4GUVA 5DBJA 2I0ZA 2VOUA 3QSSA 3SM8A 4P9SA 3K7QX 4A9WA 3AE7A 2FJDA 4EMWA 4G6HA 4FK1C 3NN0X 4RG3A 1H82A 2BK3A 3CNTA 1F8RA 2BABA 2YVGA 3UOYA 5JCIA 2JB2A 1CC4A 2XFOA 4YSYA 1Z6LA 4II2A 1PXAA 3ZDNA 1EL8A 4JY2A 3R9UA 5C2TA 1N4UA 1FECA 1MO9A 1M6IA 1GOSA 3UOXA 4J33A 3SXIA 4IA5A 4TM0A 3F8PA 3GMBA 1RSGA 3L1RA 4CNJA 5JCKA 2JBVA 3UKAA 3UKHA 3B3RA 2GMJA 3ATQA 1E7PA 3LZXA 2X3NA 4U8LA 3NTAA 3GYIA 5BUKA 1EL5A 2WOVA 1QO8A 3CGCA 5L46A 4LIIA 4FDCB 1IUWA 1NHRA 2APGA 4JQ9A 1NAAA 2GQWA 4CY8A 3LADA 2C70A 5IQ1A 4EQSA 2GAHB 4OPDA 4ZCDA 3H4KA 3LXDA 5BRTA 2VZ2A 3KVEA 3COXA 1F8WA 2YVJA 4DSHA 5KVHA 2ZZ0A 4G74A 5HXIA 3IC9A 3O0HA 4C77A 2IIDA 4C3XA 3HYVA 2X99A 3KA7A 3CPJG 2B7RA 5GRTA 5U1OA 3DGZA 1TDEA 3HZLA 2IVDA 1CF3A 2C75A 1XANA 1VQWA 3GYJA 1CJ2A 4RG4A 2FJBA 4LA1A 1XPQA 2V3BA 3NKSA 4GF7A 4H4QA 4Z44A 1DOEA 4NWZA 3SFEA 3GWDA 3SX6A 3UKPA 2WOWA 2BXSA 3DMEA 2XVEA 1BZLA 3RP7A 1RYIA 4OPGA 4CY6A 4E0VA 1DXLA 1LVLA 2B9XA 3AWIA 4USRA 5U63A 4Z2UA 1JNRA 3NIXA 1UKVG 3KLJA 2RGOA 4AOXA 2QA1A 1IUUA 3S5WA 5LV9A 4H2QA 2ARDA 2Q7VA 3EAOA 3AEEA 4H2PA 1GRFA 4ZCCA 1PN0A 3ALMA 4Z24A 2R9ZA 5C3JA 2GV8A 3AE3A 1B8SA 1BGJA 2BK5A 3GMCA 1NDAA 2DKIA 2XFPA 3AE6A 4B63A 3IHGA 4N9XA 4CNKA 1ZMCA 4BURA 4YT0A 3ICRA 4OPTA 3H8LA 4A5LA 3CPIG 4U8OA 1REOA 2GF3A 1JEHA 4NNJA 4B1BA 4B65A 1PJ5A 5TR3A 4C3YA 3BNUA 2WDVA 4B68A 4H4PA 2A89A 1PBBA 1TDOA 4DNAA 3UTGA 1OJCA 4YKGA 1QLBA 5CQFA 4UP3A 5FS9A 1BGNA 1GPEA 4KPRA 1H6VA 3KU9A 3ALLA 3SY4A 4A7AA 1P2EA 3II4A 4Y4NA 1ZX9A 1O94A 4M52A 4K7ZA 2B9YA 4H4RA 4J34A 4GR1A 2YLWA 1CL0A 2YVFA 3RP8A 2OAMA 1L9DA 2NVKX 2RGHA 3ATRA 4ECHA 3UOZA 2XVFA 1LQTA 4H2NA 4A99A 4BV6A 4EQRA 3QSMA 3HYXA 1JOAA 2JB3A 3CIRA 2WP6A 1BKWA 3L8KA 1PBDA 1Y0PA 3NK1X 3AEFA 4EIQA 1E6EA 1Q1WA 2WPCA 5JCLA 1L9EA 3BI4A 2GR3A 3RNMA 1VG9A 3NT6A 4USQA 1PS9A 1PBCA 3V3OA 2B76A 2C76A 1B4VA 4LU6A 1FL2A 4D04A 2V5ZA 3CN8A 3AE4A 1ZK7A 4TM4A 4BJYA 1O95A 4JNQA 1HYUA 1CHUA 4NTCA 3NYCA 2YR6A 3RP6A 4EMIA 2X8HA 2XFNA 2CFYA 1E1KA 5FMHA 3M0OA 1CBOA 1TDFA 2BCPA 2OLNA 2YG7A 1N4WA 2Y6RA 1KFYA 3P4QA 4EQXA 2R0GA 3D1CA 1TYPA 1IUVA 3T37A 3ZYXA 2XVIA 1JRXA 2X8CA 1GETA 1S3BA 2WEUA 3SZWA 3C4NA 3VRBA 4PABA 3DK9A 3VR8A 2OLOA 2WPFA 2Z5YA 1F3PA 3CGBA 4XWZA 1N4VA 1CC6A 1H84A 4EM4A 1V59A 1AOGA 4GDPA 4U8PA 1YKJA 2XLTA 3ISHA 1EL9A 4NTDA 4H4TA 3VRDB 3DK4A 2RABA 4IVOB 2BXRA 5IQ4A 2BS4A 1GREA 2YG5A 3QVRA 4J31A 1NENA 1K0IA 2A87A 1LJ1A 2VRMA 2VVLG 3G5QA 4TM1A 2C73A 2EQ9A 2WESA 3AB1A 3I3LA 1PDHA 4YWOA 1ONFA 3LOVA 3QSEA 2BS2A 4YTNA 5HYMA 4H2RA 1D7LA 2GRTA 2X8GA 2GVCA 5ER0A 5M10A 4J57A 2BK4A 3AEDA 1L0VA 3UKFA 3LJPA 2EQ6A 2WS3A 5EBKA 2IVEA 2VQBA 3EF6A 4Z25A 1TRBA 4WX1A 2R45A 2YG6A 3NHOX 4K5SA 5BULA 3UOVA 2W0HA 1YQZA 4FK1A 4YXDA 2PYXA 1KNPA 1GEUA 2XFQA 3I6DA 3P9UA 4UDPA 4EMJA 3E1TA 1KNRA 3PO7A 3GRTA 1GSNA 4Z26A 2XFUA 3B6DA 4GDEA 4TM3A 3EPTA 4BK2A 3HYWA 2JKCA 3IHMA 3REDA 2GR0A 1ELIA 3ABVA 3D8XA 3GD3A 2C3DA 1PXCA 2Q0KA 1Q9IA 1M64A 4H4UA 4WCTA 4DSGA 5KOXA 3CGDA 2OALA 1LV0A 3AE1A 2V3AA 5M0ZA 2GMHA 2TMDA 5CKUA 4OPUA 3DK8A 4A6NA 1FCDA 3CNJA 1K0LA 1ZKQA 2ACZA 2R0PA 3DJJA 2Y6QA 3CGEA 2V61A 1OJAA 3AE2A 2YLZA 5KXJA 2FBWA 2H88A 1GERA 2Q6UA 2WDQA 4BK3A 1ZP0A 2EQ7A 3KD9A 5FS8A 2A8XA 2ZZCA 2AAQA 1O5WA 1D4CA 4EIPA 4II3A 4J2WA 2FJAA 3F8DA 1PJ6A 4JDRA 3P4RA 2TPRA 3SGLA 3LZWA 1B5QA 2B7SA 4YKFA 2AQJA 2YM1A 3AXBA 4OVIA 1GTHA 1PBFA 1F8SA 4CBQA 3G5RA 1VDCA 4NTEA 2GB0A 4U2LA 4EQWA 1OJ9A 3GRSA 3GWFA 3UTHA 1ZY8A 2XDOA 2R0CA 3AD7B 2WHDA 1S2YA 3BNMA 1H86A 3S61A 4YSZA 3GYXA 1NHPA 3V76A 3QFBA 2GR2A 1NHQA 4D03A 4ZN0A 5KMRA 3G5SA 3C4AA 3NH3X 1DNCA 1GRBA 4H4SA 3NK0X 3PS9A 4BJZA 3M12A 2C67A 4K5RA 1DJNA 2Z5XA 3K30A 3BHFA 1NEKA 2PHHA 3CNPA 2DKHA 3SQPA 1LTXR 3P4PA 2WU5A 5EB5A 3FPZA 1S2QA 4IV9A 1EBDA 2E5VA 2WDRA 4CCQA 3ALJA 3NYEA 1LQUA 3NTDA 2CDUA 1ZOVA 3K7MX 4ICYA 4J56A 4TLZA 2C65A 2XCGA 2YLRA 2OA1A 3RHAA 3UKLA 3CNSA 2CVJA 2R46A 4NEVA 4X9NA 1L9CA 2R4EA 4B67A 2GQFA 5KMPA 3T2ZA 4HA6A 3KKJA 3NYFA 3UKKA 1CJ3A 4AT0A 1DODA 2GR1A 4GAPA 4GAVA 2EQ8A 4C5OA 3AEAA 5KRQA 3NK2X 2WETA 4OPLA 1GRGA 4APNA 1GNDA 1E1NA 1W4XA 2YG4A 4YSXA 3DA1A 4C74A 1OJDA 1EL7A 4REKA 4X9MA 2XVHA 4Z2RA 3SZ0A 1E1LA 3AECA 3UTEA 5KVIA 3WE0A 3BI2A 2C72A 1QJDA 2FJEA 5KMSA 4RSLA 1PBEA 3FIMB 1JRZA 3VR9A 3QFAA 1GTEA 1TYTA 1DOCA 2XLUA 4GCMA 4B66A 2JK6A 2WBAA 2BA9A 3CTYA 2X50A 3AEGA 2CULA 2BC1A 4EM3A 2E1MA 1PHHA 2GAGB 4YSHA 1GRTA 1FEAA 1JU2A 2JAEA 1NHSA 2Q0LA 2BC0A 1P2HA 2QA2A 3FBSA 3SFDA 3GDPA 1FEBA 5HHFA 2XLRA 4ADWA 2H89A 4OCGA 4A6NB 4H4XA 2VQ7A 1KDGA 5KOWA 2BYBA 5KMQA 4AT2A 5FS7A 1B37A 2ZBWA 1FOHA 2YM2A 3AYIA 1DOBA 3NRNA 2C64A 4OPIA 2B9WA 2C4CA 1GT8A 1GALA 3FG2P 4CCRA 1E1MA 1LPFA 3M13A 3ADAB 3PVCA 1IUSA 2F5ZA 2E4GA 3KPKA 5HY5A 1MOKA 1NG3A 3AE9A 5EB4A 4K2XA 1E39A 4YTPA 1SEZA 3BI5A 3QVPA 2RGJA 3GSIA 5U25A 2ZZBA 3V3NA 2AR8A 4XXGA 3P1WA 4U2SA 3AE5A 3UCLA 2XLSA 5KNLA 3Q6JA 4MJWA 1S3EA 2C3CA 5KWFA 2O9ZA 4U8NA 4G73A 1JRYA 3SZCA 2J3NA 4O5UA 2BCGG 1VRQB 3JSKA 4U8KA 4NZHA 2YR4A 4U8MA 3VRAA 3CPHG 3DJEA 2GEWA 1X31B 1YY5A 2C7GA 5IPYA 3SZFA 4K8DA 4U8IA 1H81A 1ZOYA 3NNEA 1CC2A 3NGCX 3T31A 2BS3A 3T2KA 2HQMA 1GXFA 4O5QA 1D4DA 1GRHA 2V6OA 1Y56A 1TDNA 2WU2A 4KX6A 4XWRA 2WP9A 4GRTA 3DJGX 1TDKA 1D4EA 4G9KA 4J36A 2WP5A 4I59A 2C66A 3AE8A 4I58A 2YR5A 1KSUA 2XVJA 3H8IA 1JNZA 4OPCA 1IJHA 1D7YA 1PXBA 4BK1A 1IUTA 4Z2TA 1IUXA 3GDNA 5JCNA 3IF9A 3KPFA 4JN9A 1COYA 1XHCA 1YQ4A 3T2YA 3OC4A 1NG4A 4H4VA 4B69A 4X4JA 3VQRA 5JCMA 1BWCA 2YLTA 3SYIA 4U8JA 4Z43A 1CJCA 3FMWA 1GRAA 4H4YA 2YLXA 1GV4A 2QCUA 4JY3A 4JNAA 5GSNA 5EOWA 4UDRA 2BRYA 4Y4MA 1Y56B 3EANA 4PAAA 4A79A 4H4WA 3LB8A 5BVAA 1H7WA 2BACA 3NG7X 3BHKA 1PJ7A 4NEWA 2R4JA 3P4SA 1ZMDA 3AEBA 4AOSA 1H7XA 1NPXA 4A65A 3OZ2A 3UP4A 4YTMA 1K0JA 1KSSA 3AD8B 1VG0A 3F8RA 1F6MA 4H50A 3T14A 2YWLA 3AYJA 3DJDA 2VVMA 4B64A 3DH9A 5FS6A 3NN6X 3URHA 4IA6A 2YG3A 4CRTA 4TLXA 3AD9B 4IVMB 1XDIA 1K4QA 3UTFA 3CMMA 5J7XA 1Q1RA 1GESA 1YQ3A 3UP5A 1BF3A 3NLCA 1H83A 3AYLA 3DGHA 3C96A 2VRLA 3K7TA 4FX9A 2YAUA 4H4ZA 1MXTA 4K22A 3ITJA 3GD4A 2XYOA 2JB1A 2WPEA 2WOIA 3IWAA 1D5TA 4HB9A 1CJ4A 4H7UA 4G6GA 2BRAA 3T0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZZ A;  3QJ4 A;  2QAE A;  3ICT A;  1OJT A;  2GH5 A;  2YQU A;  2XLP A;  4DGK A;  3CND A;  4UDQ A;  5J60 A;  2V60 A;  4U2T A;  2YLS A;  4AP3 A;  1KF6 A;  4AP1 A;  1DJQ A;  3Q9T A;  3UKQ A;  1RP0 A;  4Y4L A;  3ICS A;  1N1P A;  2VVL A;  2NPX A;  1ZDL A;  2WQY A;  4GUV A;  5DBJ A;  2I0Z A;  2VOU A;  3QSS A;  3SM8 A;  4P9S A;  3K7Q X;  4A9W A;  3AE7 A;  2FJD A;  4EMW A;  4FK1 C;  3NN0 X;  4RG3 A;  1H82 A;  2BK3 A;  3CNT A;  1F8R A;  2BAB A;  2YVG A;  3UOY A;  5JCI A;  2JB2 A;  1CC4 A;  2XFO A;  4YSY A;  1Z6L A;  1PXA A;  3ZDN A;  1EL8 A;  4JY2 A;  3R9U A;  5C2T A;  1N4U A;  1FEC A;  1MO9 A;  1M6I A;  1GOS A;  3UOX A;  4J33 A;  4IA5 A;  4TM0 A;  3F8P A;  3GMB A;  1RSG A;  3L1R A;  4CNJ A;  5JCK A;  2JBV A;  3UKA A;  3UKH A;  3B3R A;  2GMJ A;  3ATQ A;  1E7P A;  3LZX A;  2X3N A;  4U8L A;  3NTA A;  3GYI A;  5BUK A;  1EL5 A;  2WOV A;  1QO8 A;  3CGC A;  5L46 A;  4LII A;  4FDC B;  1IUW A;  1NHR A;  2APG A;  4JQ9 A;  1NAA A;  2GQW A;  4CY8 A;  3LAD A;  2C70 A;  5IQ1 A;  4EQS A;  2GAH B;  4OPD A;  4ZCD A;  3H4K A;  3LXD A;  5BRT A;  2VZ2 A;  3KVE A;  3COX A;  1F8W A;  2YVJ A;  4DSH A;  5KVH A;  2ZZ0 A;  5HXI A;  3IC9 A;  3O0H A;  4C77 A;  2IID A;  4C3X A;  2X99 A;  3KA7 A;  3CPJ G;  2B7R A;  5GRT A;  5U1O A;  3DGZ A;  1TDE A;  3HZL A;  2IVD A;  1CF3 A;  2C75 A;  1XAN A;  1VQW A;  3GYJ A;  1CJ2 A;  4RG4 A;  2FJB A;  4LA1 A;  1XPQ A;  2V3B A;  3NKS A;  4GF7 A;  4H4Q A;  4Z44 A;  1DOE A;  3SFE A;  3GWD A;  3UKP A;  2WOW A;  2BXS A;  3DME A;  2XVE A;  1BZL A;  3RP7 A;  1RYI A;  4OPG A;  4CY6 A;  4E0V A;  1DXL A;  1LVL A;  2B9X A;  3AWI A;  4USR A;  5U63 A;  4Z2U A;  1JNR A;  3NIX A;  1UKV G;  3KLJ A;  2RGO A;  4AOX A;  2QA1 A;  1IUU A;  3S5W A;  5LV9 A;  4H2Q A;  2ARD A;  2Q7V A;  3EAO A;  3AEE A;  4H2P A;  1GRF A;  4ZCC A;  1PN0 A;  3ALM A;  4Z24 A;  2R9Z A;  5C3J A;  2GV8 A;  3AE3 A;  1B8S A;  1BGJ A;  2BK5 A;  3GMC A;  1NDA A;  2DKI A;  2XFP A;  3AE6 A;  4B63 A;  3IHG A;  4N9X A;  4CNK A;  1ZMC A;  4BUR A;  4YT0 A;  3ICR A;  4OPT A;  3H8L A;  4A5L A;  3CPI G;  4U8O A;  1REO A;  2GF3 A;  1JEH A;  4B1B A;  4B65 A;  1PJ5 A;  5TR3 A;  4C3Y A;  3BNU A;  2WDV A;  4B68 A;  4H4P A;  2A89 A;  1PBB A;  1TDO A;  4DNA A;  3UTG A;  1OJC A;  4YKG A;  1QLB A;  5CQF A;  4UP3 A;  5FS9 A;  1BGN A;  1GPE A;  4KPR A;  1H6V A;  3KU9 A;  3ALL A;  4A7A A;  1P2E A;  3II4 A;  4Y4N A;  1ZX9 A;  1O94 A;  4M52 A;  4K7Z A;  2B9Y A;  4H4R A;  4J34 A;  4GR1 A;  2YLW A;  1CL0 A;  2YVF A;  3RP8 A;  2OAM A;  1L9D A;  2NVK X;  2RGH A;  3ATR A;  4ECH A;  3UOZ A;  2XVF A;  1LQT A;  4H2N A;  4A99 A;  4BV6 A;  4EQR A;  3QSM A;  1JOA A;  2JB3 A;  3CIR A;  2WP6 A;  1BKW A;  3L8K A;  1PBD A;  1Y0P A;  3NK1 X;  3AEF A;  4EIQ A;  1E6E A;  1Q1W A;  2WPC A;  5JCL A;  1L9E A;  3BI4 A;  2GR3 A;  3RNM A;  1VG9 A;  3NT6 A;  4USQ A;  1PS9 A;  1PBC A;  3V3O A;  2B76 A;  2C76 A;  1B4V A;  4LU6 A;  1FL2 A;  4D04 A;  2V5Z A;  3CN8 A;  3AE4 A;  1ZK7 A;  4TM4 A;  4BJY A;  1O95 A;  4JNQ A;  1HYU A;  1CHU A;  4NTC A;  3NYC A;  2YR6 A;  3RP6 A;  4EMI A;  2X8H A;  2XFN A;  2CFY A;  1E1K A;  5FMH A;  3M0O A;  1CBO A;  1TDF A;  2BCP A;  2OLN A;  2YG7 A;  1N4W A;  2Y6R A;  1KFY A;  3P4Q A;  4EQX A;  2R0G A;  3D1C A;  1TYP A;  1IUV A;  3T37 A;  3ZYX A;  2XVI A;  1JRX A;  2X8C A;  1GET A;  1S3B A;  2WEU A;  3VRB A;  3C4N A;  4PAB A;  3DK9 A;  3VR8 A;  2OLO A;  2WPF A;  2Z5Y A;  1F3P A;  3CGB A;  4XWZ A;  1N4V A;  1CC6 A;  1H84 A;  4EM4 A;  1V59 A;  1AOG A;  4GDP A;  4U8P A;  1YKJ A;  2XLT A;  3ISH A;  1EL9 A;  4NTD A;  4H4T A;  3VRD B;  3DK4 A;  2RAB A;  4IVO B;  2BXR A;  5IQ4 A;  2BS4 A;  1GRE A;  2YG5 A;  3QVR A;  4J31 A;  1NEN A;  1K0I A;  2A87 A;  1LJ1 A;  2VRM A;  2VVL G;  3G5Q A;  4TM1 A;  2C73 A;  2EQ9 A;  2WES A;  3AB1 A;  3I3L A;  1PDH A;  4YWO A;  1ONF A;  3LOV A;  3QSE A;  2BS2 A;  4YTN A;  5HYM A;  4H2R A;  1D7L A;  2GRT A;  2X8G A;  2GVC A;  5ER0 A;  5M10 A;  4J57 A;  2BK4 A;  3AED A;  1L0V A;  3UKF A;  3LJP A;  2EQ6 A;  2WS3 A;  5EBK A;  2IVE A;  2VQB A;  3EF6 A;  4Z25 A;  1TRB A;  4WX1 A;  2R45 A;  2YG6 A;  3NHO X;  4K5S A;  5BUL A;  3UOV A;  2W0H A;  1YQZ A;  4FK1 A;  4YXD A;  2PYX A;  1KNP A;  1GEU A;  2XFQ A;  3I6D A;  3P9U A;  4UDP A;  4EMJ A;  3E1T A;  1KNR A;  3PO7 A;  3GRT A;  1GSN A;  4Z26 A;  2XFU A;  3B6D A;  4GDE A;  4TM3 A;  3EPT A;  4BK2 A;  2JKC A;  3IHM A;  3RED A;  2GR0 A;  1ELI A;  3ABV A;  3D8X A;  3GD3 A;  2C3D A;  1PXC A;  2Q0K A;  1Q9I A;  1M64 A;  4H4U A;  4WCT A;  4DSG A;  5KOX A;  3CGD A;  2OAL A;  1LV0 A;  3AE1 A;  2V3A A;  5M0Z A;  2GMH A;  2TMD A;  5CKU A;  4OPU A;  3DK8 A;  4A6N A;  1FCD A;  3CNJ A;  1K0L A;  1ZKQ A;  2ACZ A;  2R0P A;  3DJJ A;  2Y6Q A;  3CGE A;  2V61 A;  1OJA A;  3AE2 A;  2YLZ A;  5KXJ A;  2FBW A;  2H88 A;  1GER A;  2Q6U A;  2WDQ A;  4BK3 A;  1ZP0 A;  2EQ7 A;  3KD9 A;  5FS8 A;  2A8X A;  2ZZC A;  2AAQ A;  1O5W A;  1D4C A;  4EIP A;  4J2W A;  2FJA A;  3F8D A;  1PJ6 A;  4JDR A;  3P4R A;  2TPR A;  3SGL A;  3LZW A;  1B5Q A;  2B7S A;  4YKF A;  2AQJ A;  2YM1 A;  3AXB A;  4OVI A;  1GTH A;  1PBF A;  1F8S A;  4CBQ A;  3G5R A;  1VDC A;  4NTE A;  2GB0 A;  4U2L A;  4EQW A;  1OJ9 A;  3GRS A;  3GWF A;  3UTH A;  1ZY8 A;  2XDO A;  2R0C A;  3AD7 B;  2WHD A;  1S2Y A;  3BNM A;  1H86 A;  3S61 A;  4YSZ A;  1NHP A;  3V76 A;  3QFB A;  2GR2 A;  1NHQ A;  4D03 A;  4ZN0 A;  3G5S A;  3C4A A;  3NH3 X;  1DNC A;  1GRB A;  4H4S A;  3NK0 X;  3PS9 A;  4BJZ A;  3M12 A;  2C67 A;  4K5R A;  1DJN A;  2Z5X A;  3K30 A;  3BHF A;  1NEK A;  2PHH A;  3CNP A;  2DKH A;  3SQP A;  1LTX R;  3P4P A;  2WU5 A;  5EB5 A;  3FPZ A;  1S2Q A;  4IV9 A;  1EBD A;  2E5V A;  2WDR A;  4CCQ A;  3ALJ A;  3NYE A;  1LQU A;  3NTD A;  2CDU A;  1ZOV A;  3K7M X;  4ICY A;  4J56 A;  4TLZ A;  2C65 A;  2XCG A;  2YLR A;  2OA1 A;  3RHA A;  3UKL A;  3CNS A;  2CVJ A;  2R46 A;  4NEV A;  4X9N A;  1L9C A;  2R4E A;  4B67 A;  2GQF A;  4HA6 A;  3KKJ A;  3NYF A;  3UKK A;  1CJ3 A;  4AT0 A;  1DOD A;  2GR1 A;  2EQ8 A;  4C5O A;  3AEA A;  5KRQ A;  3NK2 X;  2WET A;  4OPL A;  1GRG A;  4APN A;  1GND A;  1E1N A;  1W4X A;  2YG4 A;  4YSX A;  3DA1 A;  4C74 A;  1OJD A;  1EL7 A;  4REK A;  4X9M A;  2XVH A;  4Z2R A;  1E1L A;  3AEC A;  3UTE A;  5KVI A;  3WE0 A;  3BI2 A;  2C72 A;  1QJD A;  2FJE A;  4RSL A;  1PBE A;  3FIM B;  1JRZ A;  3VR9 A;  3QFA A;  1GTE A;  1TYT A;  1DOC A;  2XLU A;  4GCM A;  4B66 A;  2JK6 A;  2WBA A;  2BA9 A;  3CTY A;  2X50 A;  3AEG A;  2CUL A;  2BC1 A;  4EM3 A;  2E1M A;  1PHH A;  2GAG B;  4YSH A;  1GRT A;  1FEA A;  1JU2 A;  2JAE A;  1NHS A;  2Q0L A;  2BC0 A;  1P2H A;  2QA2 A;  3FBS A;  3SFD A;  3GDP A;  1FEB A;  5HHF A;  2XLR A;  4ADW A;  2H89 A;  4OCG A;  4A6N B;  4H4X A;  2VQ7 A;  1KDG A;  5KOW A;  2BYB A;  4AT2 A;  5FS7 A;  1B37 A;  2ZBW A;  1FOH A;  2YM2 A;  3AYI A;  1DOB A;  3NRN A;  2C64 A;  4OPI A;  2B9W A;  1GT8 A;  1GAL A;  3FG2 P;  4CCR A;  1E1M A;  1LPF A;  3M13 A;  3ADA B;  3PVC A;  1IUS A;  2F5Z A;  2E4G A;  5HY5 A;  1MOK A;  1NG3 A;  3AE9 A;  5EB4 A;  4K2X A;  1E39 A;  4YTP A;  1SEZ A;  3BI5 A;  3QVP A;  2RGJ A;  3GSI A;  5U25 A;  2ZZB A;  3V3N A;  2AR8 A;  4XXG A;  3P1W A;  4U2S A;  3AE5 A;  3UCL A;  2XLS A;  3Q6J A;  4MJW A;  1S3E A;  2C3C A;  5KWF A;  2O9Z A;  4U8N A;  1JRY A;  2J3N A;  4O5U A;  2BCG G;  1VRQ B;  3JSK A;  4U8K A;  4NZH A;  2YR4 A;  4U8M A;  3VRA A;  3CPH G;  3DJE A;  2GEW A;  1X31 B;  1YY5 A;  2C7G A;  5IPY A;  4K8D A;  4U8I A;  1H81 A;  1ZOY A;  3NNE A;  1CC2 A;  3NGC X;  2BS3 A;  2HQM A;  1GXF A;  4O5Q A;  1D4D A;  1GRH A;  2V6O A;  1Y56 A;  1TDN A;  2WU2 A;  4KX6 A;  4XWR A;  2WP9 A;  4GRT A;  3DJG X;  1TDK A;  1D4E A;  4J36 A;  2WP5 A;  4I59 A;  2C66 A;  3AE8 A;  4I58 A;  2YR5 A;  1KSU A;  2XVJ A;  3H8I A;  1JNZ A;  4OPC A;  1IJH A;  1D7Y A;  1PXB A;  4BK1 A;  1IUT A;  4Z2T A;  1IUX A;  3GDN A;  5JCN A;  3IF9 A;  3KPF A;  4JN9 A;  1COY A;  1XHC A;  1YQ4 A;  3OC4 A;  1NG4 A;  4H4V A;  4B69 A;  4X4J A;  3VQR A;  5JCM A;  1BWC A;  2YLT A;  4U8J A;  4Z43 A;  1CJC A;  3FMW A;  1GRA A;  4H4Y A;  2YLX A;  1GV4 A;  2QCU A;  4JY3 A;  4JNA A;  5GSN A;  5EOW A;  4UDR A;  4Y4M A;  1Y56 B;  3EAN A;  4PAA A;  4A79 A;  4H4W A;  3LB8 A;  5BVA A;  1H7W A;  2BAC A;  3NG7 X;  3BHK A;  1PJ7 A;  4NEW A;  2R4J A;  3P4S A;  1ZMD A;  3AEB A;  4AOS A;  1H7X A;  1NPX A;  4A65 A;  3OZ2 A;  3UP4 A;  4YTM A;  1K0J A;  1KSS A;  3AD8 B;  1VG0 A;  3F8R A;  1F6M A;  4H50 A;  2YWL A;  3AYJ A;  3DJD A;  2VVM A;  4B64 A;  3DH9 A;  5FS6 A;  3NN6 X;  3URH A;  4IA6 A;  2YG3 A;  4CRT A;  4TLX A;  3AD9 B;  4IVM B;  1XDI A;  1K4Q A;  3UTF A;  5J7X A;  1Q1R A;  1GES A;  1YQ3 A;  3UP5 A;  1BF3 A;  3NLC A;  1H83 A;  3AYL A;  3DGH A;  3C96 A;  2VRL A;  3K7T A;  4FX9 A;  2YAU A;  4H4Z A;  1MXT A;  4K22 A;  3ITJ A;  3GD4 A;  2XYO A;  2JB1 A;  2WPE A;  2WOI A;  3IWA A;  1D5T A;  4HB9 A;  1CJ4 A;  4H7U A; 
#chains in the Genus database with same CATH topology
 2UZZ A;  3QJ4 A;  2QAE A;  3ICT A;  1OJT A;  2GH5 A;  2YQU A;  2XLP A;  4DGK A;  3CND A;  4UDQ A;  5J60 A;  2V60 A;  4U2T A;  2YLS A;  4AP3 A;  1KF6 A;  4AP1 A;  1DJQ A;  3Q9T A;  3UKQ A;  1RP0 A;  4Y4L A;  3ICS A;  1N1P A;  2VVL A;  2NPX A;  1ZDL A;  2WQY A;  4GUV A;  5DBJ A;  2I0Z A;  2VOU A;  3QSS A;  3SM8 A;  4P9S A;  3K7Q X;  4A9W A;  3AE7 A;  2FJD A;  4EMW A;  4G6H A;  4FK1 C;  3NN0 X;  4RG3 A;  1H82 A;  2BK3 A;  3CNT A;  1F8R A;  2BAB A;  2YVG A;  3UOY A;  5JCI A;  2JB2 A;  1CC4 A;  2XFO A;  4YSY A;  1Z6L A;  4II2 A;  1PXA A;  3ZDN A;  1EL8 A;  4JY2 A;  3R9U A;  5C2T A;  1N4U A;  1FEC A;  1MO9 A;  1M6I A;  1GOS A;  3UOX A;  4J33 A;  3SXI A;  4IA5 A;  4TM0 A;  3F8P A;  3GMB A;  1RSG A;  3L1R A;  4CNJ A;  5JCK A;  2JBV A;  3UKA A;  3UKH A;  3B3R A;  2GMJ A;  3ATQ A;  1E7P A;  3LZX A;  2X3N A;  4U8L A;  3NTA A;  3GYI A;  5BUK A;  1EL5 A;  2WOV A;  1QO8 A;  3CGC A;  5L46 A;  4LII A;  4FDC B;  1IUW A;  1NHR A;  2APG A;  4JQ9 A;  1NAA A;  2GQW A;  4CY8 A;  3LAD A;  2C70 A;  5IQ1 A;  4EQS A;  2GAH B;  4OPD A;  4ZCD A;  3H4K A;  3LXD A;  5BRT A;  2VZ2 A;  3KVE A;  3COX A;  1F8W A;  2YVJ A;  4DSH A;  5KVH A;  2ZZ0 A;  4G74 A;  5HXI A;  3IC9 A;  3O0H A;  4C77 A;  2IID A;  4C3X A;  3HYV A;  2X99 A;  3KA7 A;  3CPJ G;  2B7R A;  5GRT A;  5U1O A;  3DGZ A;  1TDE A;  3HZL A;  2IVD A;  1CF3 A;  2C75 A;  1XAN A;  1VQW A;  3GYJ A;  1CJ2 A;  4RG4 A;  2FJB A;  4LA1 A;  1XPQ A;  2V3B A;  3NKS A;  4GF7 A;  4H4Q A;  4Z44 A;  1DOE A;  4NWZ A;  3SFE A;  3GWD A;  3SX6 A;  3UKP A;  2WOW A;  2BXS A;  3DME A;  2XVE A;  1BZL A;  3RP7 A;  1RYI A;  4OPG A;  4CY6 A;  4E0V A;  1DXL A;  1LVL A;  2B9X A;  3AWI A;  4USR A;  5U63 A;  4Z2U A;  1JNR A;  3NIX A;  1UKV G;  3KLJ A;  2RGO A;  4AOX A;  2QA1 A;  1IUU A;  3S5W A;  5LV9 A;  4H2Q A;  2ARD A;  2Q7V A;  3EAO A;  3AEE A;  4H2P A;  1GRF A;  4ZCC A;  1PN0 A;  3ALM A;  4Z24 A;  2R9Z A;  5C3J A;  2GV8 A;  3AE3 A;  1B8S A;  1BGJ A;  2BK5 A;  3GMC A;  1NDA A;  2DKI A;  2XFP A;  3AE6 A;  4B63 A;  3IHG A;  4N9X A;  4CNK A;  1ZMC A;  4BUR A;  4YT0 A;  3ICR A;  4OPT A;  3H8L A;  4A5L A;  3CPI G;  4U8O A;  1REO A;  2GF3 A;  1JEH A;  4NNJ A;  4B1B A;  4B65 A;  1PJ5 A;  5TR3 A;  4C3Y A;  3BNU A;  2WDV A;  4B68 A;  4H4P A;  2A89 A;  1PBB A;  1TDO A;  4DNA A;  3UTG A;  1OJC A;  4YKG A;  1QLB A;  5CQF A;  4UP3 A;  5FS9 A;  1BGN A;  1GPE A;  4KPR A;  1H6V A;  3KU9 A;  3ALL A;  3SY4 A;  4A7A A;  1P2E A;  3II4 A;  4Y4N A;  1ZX9 A;  1O94 A;  4M52 A;  4K7Z A;  2B9Y A;  4H4R A;  4J34 A;  4GR1 A;  2YLW A;  1CL0 A;  2YVF A;  3RP8 A;  2OAM A;  1L9D A;  2NVK X;  2RGH A;  3ATR A;  4ECH A;  3UOZ A;  2XVF A;  1LQT A;  4H2N A;  4A99 A;  4BV6 A;  4EQR A;  3QSM A;  3HYX A;  1JOA A;  2JB3 A;  3CIR A;  2WP6 A;  1BKW A;  3L8K A;  1PBD A;  1Y0P A;  3NK1 X;  3AEF A;  4EIQ A;  1E6E A;  1Q1W A;  2WPC A;  5JCL A;  1L9E A;  3BI4 A;  2GR3 A;  3RNM A;  1VG9 A;  3NT6 A;  4USQ A;  1PS9 A;  1PBC A;  3V3O A;  2B76 A;  2C76 A;  1B4V A;  4LU6 A;  1FL2 A;  4D04 A;  2V5Z A;  3CN8 A;  3AE4 A;  1ZK7 A;  4TM4 A;  4BJY A;  1O95 A;  4JNQ A;  1HYU A;  1CHU A;  4NTC A;  3NYC A;  2YR6 A;  3RP6 A;  4EMI A;  2X8H A;  2XFN A;  2CFY A;  1E1K A;  5FMH A;  3M0O A;  1CBO A;  1TDF A;  2BCP A;  2OLN A;  2YG7 A;  1N4W A;  2Y6R A;  1KFY A;  3P4Q A;  4EQX A;  2R0G A;  3D1C A;  1TYP A;  1IUV A;  3T37 A;  3ZYX A;  2XVI A;  1JRX A;  2X8C A;  1GET A;  1S3B A;  2WEU A;  3SZW A;  3C4N A;  3VRB A;  4PAB A;  3DK9 A;  3VR8 A;  2OLO A;  2WPF A;  2Z5Y A;  1F3P A;  3CGB A;  4XWZ A;  1N4V A;  1CC6 A;  1H84 A;  4EM4 A;  1V59 A;  1AOG A;  4GDP A;  4U8P A;  1YKJ A;  2XLT A;  3ISH A;  1EL9 A;  4NTD A;  4H4T A;  3VRD B;  3DK4 A;  2RAB A;  4IVO B;  2BXR A;  5IQ4 A;  2BS4 A;  1GRE A;  2YG5 A;  3QVR A;  4J31 A;  1NEN A;  1K0I A;  2A87 A;  1LJ1 A;  2VRM A;  2VVL G;  3G5Q A;  4TM1 A;  2C73 A;  2EQ9 A;  2WES A;  3AB1 A;  3I3L A;  1PDH A;  4YWO A;  1ONF A;  3LOV A;  3QSE A;  2BS2 A;  4YTN A;  5HYM A;  4H2R A;  1D7L A;  2GRT A;  2X8G A;  2GVC A;  5ER0 A;  5M10 A;  4J57 A;  2BK4 A;  3AED A;  1L0V A;  3UKF A;  3LJP A;  2EQ6 A;  2WS3 A;  5EBK A;  2IVE A;  2VQB A;  3EF6 A;  4Z25 A;  1TRB A;  4WX1 A;  2R45 A;  2YG6 A;  3NHO X;  4K5S A;  5BUL A;  3UOV A;  2W0H A;  1YQZ A;  4FK1 A;  4YXD A;  2PYX A;  1KNP A;  1GEU A;  2XFQ A;  3I6D A;  3P9U A;  4UDP A;  4EMJ A;  3E1T A;  1KNR A;  3PO7 A;  3GRT A;  1GSN A;  4Z26 A;  2XFU A;  3B6D A;  4GDE A;  4TM3 A;  3EPT A;  4BK2 A;  3HYW A;  2JKC A;  3IHM A;  3RED A;  2GR0 A;  1ELI A;  3ABV A;  3D8X A;  3GD3 A;  2C3D A;  1PXC A;  2Q0K A;  1Q9I A;  1M64 A;  4H4U A;  4WCT A;  4DSG A;  5KOX A;  3CGD A;  2OAL A;  1LV0 A;  3AE1 A;  2V3A A;  5M0Z A;  2GMH A;  2TMD A;  5CKU A;  4OPU A;  3DK8 A;  4A6N A;  1FCD A;  3CNJ A;  1K0L A;  1ZKQ A;  2ACZ A;  2R0P A;  3DJJ A;  2Y6Q A;  3CGE A;  2V61 A;  1OJA A;  3AE2 A;  2YLZ A;  5KXJ A;  2FBW A;  2H88 A;  1GER A;  2Q6U A;  2WDQ A;  4BK3 A;  1ZP0 A;  2EQ7 A;  3KD9 A;  5FS8 A;  2A8X A;  2ZZC A;  2AAQ A;  1O5W A;  1D4C A;  4EIP A;  4II3 A;  4J2W A;  2FJA A;  3F8D A;  1PJ6 A;  4JDR A;  3P4R A;  2TPR A;  3SGL A;  3LZW A;  1B5Q A;  2B7S A;  4YKF A;  2AQJ A;  2YM1 A;  3AXB A;  4OVI A;  1GTH A;  1PBF A;  1F8S A;  4CBQ A;  3G5R A;  1VDC A;  4NTE A;  2GB0 A;  4U2L A;  4EQW A;  1OJ9 A;  3GRS A;  3GWF A;  3UTH A;  1ZY8 A;  2XDO A;  2R0C A;  3AD7 B;  2WHD A;  1S2Y A;  3BNM A;  1H86 A;  3S61 A;  4YSZ A;  3GYX A;  1NHP A;  3V76 A;  3QFB A;  2GR2 A;  1NHQ A;  4D03 A;  4ZN0 A;  5KMR A;  3G5S A;  3C4A A;  3NH3 X;  1DNC A;  1GRB A;  4H4S A;  3NK0 X;  3PS9 A;  4BJZ A;  3M12 A;  2C67 A;  4K5R A;  1DJN A;  2Z5X A;  3K30 A;  3BHF A;  1NEK A;  2PHH A;  3CNP A;  2DKH A;  3SQP A;  1LTX R;  3P4P A;  2WU5 A;  5EB5 A;  3FPZ A;  1S2Q A;  4IV9 A;  1EBD A;  2E5V A;  2WDR A;  4CCQ A;  3ALJ A;  3NYE A;  1LQU A;  3NTD A;  2CDU A;  1ZOV A;  3K7M X;  4ICY A;  4J56 A;  4TLZ A;  2C65 A;  2XCG A;  2YLR A;  2OA1 A;  3RHA A;  3UKL A;  3CNS A;  2CVJ A;  2R46 A;  4NEV A;  4X9N A;  1L9C A;  2R4E A;  4B67 A;  2GQF A;  5KMP A;  3T2Z A;  4HA6 A;  3KKJ A;  3NYF A;  3UKK A;  1CJ3 A;  4AT0 A;  1DOD A;  2GR1 A;  4GAP A;  4GAV A;  2EQ8 A;  4C5O A;  3AEA A;  5KRQ A;  3NK2 X;  2WET A;  4OPL A;  1GRG A;  4APN A;  1GND A;  1E1N A;  1W4X A;  2YG4 A;  4YSX A;  3DA1 A;  4C74 A;  1OJD A;  1EL7 A;  4REK A;  4X9M A;  2XVH A;  4Z2R A;  3SZ0 A;  1E1L A;  3AEC A;  3UTE A;  5KVI A;  3WE0 A;  3BI2 A;  2C72 A;  1QJD A;  2FJE A;  5KMS A;  4RSL A;  1PBE A;  3FIM B;  1JRZ A;  3VR9 A;  3QFA A;  1GTE A;  1TYT A;  1DOC A;  2XLU A;  4GCM A;  4B66 A;  2JK6 A;  2WBA A;  2BA9 A;  3CTY A;  2X50 A;  3AEG A;  2CUL A;  2BC1 A;  4EM3 A;  2E1M A;  1PHH A;  2GAG B;  4YSH A;  1GRT A;  1FEA A;  1JU2 A;  2JAE A;  1NHS A;  2Q0L A;  2BC0 A;  1P2H A;  2QA2 A;  3FBS A;  3SFD A;  3GDP A;  1FEB A;  5HHF A;  2XLR A;  4ADW A;  2H89 A;  4OCG A;  4A6N B;  4H4X A;  2VQ7 A;  1KDG A;  5KOW A;  2BYB A;  5KMQ A;  4AT2 A;  5FS7 A;  1B37 A;  2ZBW A;  1FOH A;  2YM2 A;  3AYI A;  1DOB A;  3NRN A;  2C64 A;  4OPI A;  2B9W A;  2C4C A;  1GT8 A;  1GAL A;  3FG2 P;  4CCR A;  1E1M A;  1LPF A;  3M13 A;  3ADA B;  3PVC A;  1IUS A;  2F5Z A;  2E4G A;  3KPK A;  5HY5 A;  1MOK A;  1NG3 A;  3AE9 A;  5EB4 A;  4K2X A;  1E39 A;  4YTP A;  1SEZ A;  3BI5 A;  3QVP A;  2RGJ A;  3GSI A;  5U25 A;  2ZZB A;  3V3N A;  2AR8 A;  4XXG A;  3P1W A;  4U2S A;  3AE5 A;  3UCL A;  2XLS A;  5KNL A;  3Q6J A;  4MJW A;  1S3E A;  2C3C A;  5KWF A;  2O9Z A;  4U8N A;  4G73 A;  1JRY A;  3SZC A;  2J3N A;  4O5U A;  2BCG G;  1VRQ B;  3JSK A;  4U8K A;  4NZH A;  2YR4 A;  4U8M A;  3VRA A;  3CPH G;  3DJE A;  2GEW A;  1X31 B;  1YY5 A;  2C7G A;  5IPY A;  3SZF A;  4K8D A;  4U8I A;  1H81 A;  1ZOY A;  3NNE A;  1CC2 A;  3NGC X;  3T31 A;  2BS3 A;  3T2K A;  2HQM A;  1GXF A;  4O5Q A;  1D4D A;  1GRH A;  2V6O A;  1Y56 A;  1TDN A;  2WU2 A;  4KX6 A;  4XWR A;  2WP9 A;  4GRT A;  3DJG X;  1TDK A;  1D4E A;  4G9K A;  4J36 A;  2WP5 A;  4I59 A;  2C66 A;  3AE8 A;  4I58 A;  2YR5 A;  1KSU A;  2XVJ A;  3H8I A;  1JNZ A;  4OPC A;  1IJH A;  1D7Y A;  1PXB A;  4BK1 A;  1IUT A;  4Z2T A;  1IUX A;  3GDN A;  5JCN A;  3IF9 A;  3KPF A;  4JN9 A;  1COY A;  1XHC A;  1YQ4 A;  3T2Y A;  3OC4 A;  1NG4 A;  4H4V A;  4B69 A;  4X4J A;  3VQR A;  5JCM A;  1BWC A;  2YLT A;  3SYI A;  4U8J A;  4Z43 A;  1CJC A;  3FMW A;  1GRA A;  4H4Y A;  2YLX A;  1GV4 A;  2QCU A;  4JY3 A;  4JNA A;  5GSN A;  5EOW A;  4UDR A;  2BRY A;  4Y4M A;  1Y56 B;  3EAN A;  4PAA A;  4A79 A;  4H4W A;  3LB8 A;  5BVA A;  1H7W A;  2BAC A;  3NG7 X;  3BHK A;  1PJ7 A;  4NEW A;  2R4J A;  3P4S A;  1ZMD A;  3AEB A;  4AOS A;  1H7X A;  1NPX A;  4A65 A;  3OZ2 A;  3UP4 A;  4YTM A;  1K0J A;  1KSS A;  3AD8 B;  1VG0 A;  3F8R A;  1F6M A;  4H50 A;  3T14 A;  2YWL A;  3AYJ A;  3DJD A;  2VVM A;  4B64 A;  3DH9 A;  5FS6 A;  3NN6 X;  3URH A;  4IA6 A;  2YG3 A;  4CRT A;  4TLX A;  3AD9 B;  4IVM B;  1XDI A;  1K4Q A;  3UTF A;  3CMM A;  5J7X A;  1Q1R A;  1GES A;  1YQ3 A;  3UP5 A;  1BF3 A;  3NLC A;  1H83 A;  3AYL A;  3DGH A;  3C96 A;  2VRL A;  3K7T A;  4FX9 A;  2YAU A;  4H4Z A;  1MXT A;  4K22 A;  3ITJ A;  3GD4 A;  2XYO A;  2JB1 A;  2WPE A;  2WOI A;  3IWA A;  1D5T A;  4HB9 A;  1CJ4 A;  4H7U A;  4G6G A;  2BRA A;  3T0K A; 
#chains in the Genus database with same CATH homology
 2UZZ A;  3QJ4 A;  2QAE A;  3ICT A;  1OJT A;  2GH5 A;  2YQU A;  2XLP A;  4DGK A;  3CND A;  4UDQ A;  5J60 A;  2V60 A;  4U2T A;  2YLS A;  4AP3 A;  1KF6 A;  4AP1 A;  1DJQ A;  3Q9T A;  3UKQ A;  1RP0 A;  4Y4L A;  3ICS A;  1N1P A;  2VVL A;  2NPX A;  1ZDL A;  2WQY A;  4GUV A;  5DBJ A;  2I0Z A;  2VOU A;  3QSS A;  3SM8 A;  4P9S A;  3K7Q X;  4A9W A;  3AE7 A;  2FJD A;  4EMW A;  4G6H A;  4FK1 C;  3NN0 X;  4RG3 A;  1H82 A;  2BK3 A;  3CNT A;  1F8R A;  2BAB A;  2YVG A;  3UOY A;  5JCI A;  2JB2 A;  1CC4 A;  2XFO A;  4YSY A;  1Z6L A;  4II2 A;  1PXA A;  3ZDN A;  1EL8 A;  4JY2 A;  3R9U A;  5C2T A;  1N4U A;  1FEC A;  1MO9 A;  1M6I A;  1GOS A;  3UOX A;  4J33 A;  3SXI A;  4IA5 A;  4TM0 A;  3F8P A;  3GMB A;  1RSG A;  3L1R A;  4CNJ A;  5JCK A;  2JBV A;  3UKA A;  3UKH A;  3B3R A;  2GMJ A;  3ATQ A;  1E7P A;  3LZX A;  2X3N A;  4U8L A;  3NTA A;  3GYI A;  5BUK A;  1EL5 A;  2WOV A;  1QO8 A;  3CGC A;  5L46 A;  4LII A;  4FDC B;  1IUW A;  1NHR A;  2APG A;  4JQ9 A;  1NAA A;  2GQW A;  4CY8 A;  3LAD A;  2C70 A;  5IQ1 A;  4EQS A;  2GAH B;  4OPD A;  4ZCD A;  3H4K A;  3LXD A;  5BRT A;  2VZ2 A;  3KVE A;  3COX A;  1F8W A;  2YVJ A;  4DSH A;  5KVH A;  2ZZ0 A;  4G74 A;  5HXI A;  3IC9 A;  3O0H A;  4C77 A;  2IID A;  4C3X A;  3HYV A;  2X99 A;  3KA7 A;  3CPJ G;  2B7R A;  5GRT A;  5U1O A;  3DGZ A;  1TDE A;  3HZL A;  2IVD A;  1CF3 A;  2C75 A;  1XAN A;  1VQW A;  3GYJ A;  1CJ2 A;  4RG4 A;  2FJB A;  4LA1 A;  1XPQ A;  2V3B A;  3NKS A;  4GF7 A;  4H4Q A;  4Z44 A;  1DOE A;  4NWZ A;  3SFE A;  3GWD A;  3SX6 A;  3UKP A;  2WOW A;  2BXS A;  3DME A;  2XVE A;  1BZL A;  3RP7 A;  1RYI A;  4OPG A;  4CY6 A;  4E0V A;  1DXL A;  1LVL A;  2B9X A;  3AWI A;  4USR A;  5U63 A;  4Z2U A;  1JNR A;  3NIX A;  1UKV G;  3KLJ A;  2RGO A;  4AOX A;  2QA1 A;  1IUU A;  3S5W A;  5LV9 A;  4H2Q A;  2ARD A;  2Q7V A;  3EAO A;  3AEE A;  4H2P A;  1GRF A;  4ZCC A;  1PN0 A;  3ALM A;  4Z24 A;  2R9Z A;  5C3J A;  2GV8 A;  3AE3 A;  1B8S A;  1BGJ A;  2BK5 A;  3GMC A;  1NDA A;  2DKI A;  2XFP A;  3AE6 A;  4B63 A;  3IHG A;  4N9X A;  4CNK A;  1ZMC A;  4BUR A;  4YT0 A;  3ICR A;  4OPT A;  3H8L A;  4A5L A;  3CPI G;  4U8O A;  1REO A;  2GF3 A;  1JEH A;  4NNJ A;  4B1B A;  4B65 A;  1PJ5 A;  5TR3 A;  4C3Y A;  3BNU A;  2WDV A;  4B68 A;  4H4P A;  2A89 A;  1PBB A;  1TDO A;  4DNA A;  3UTG A;  1OJC A;  4YKG A;  1QLB A;  5CQF A;  4UP3 A;  5FS9 A;  1BGN A;  1GPE A;  4KPR A;  1H6V A;  3KU9 A;  3ALL A;  3SY4 A;  4A7A A;  1P2E A;  3II4 A;  4Y4N A;  1ZX9 A;  1O94 A;  4M52 A;  4K7Z A;  2B9Y A;  4H4R A;  4J34 A;  4GR1 A;  2YLW A;  1CL0 A;  2YVF A;  3RP8 A;  2OAM A;  1L9D A;  2NVK X;  2RGH A;  3ATR A;  4ECH A;  3UOZ A;  2XVF A;  1LQT A;  4H2N A;  4A99 A;  4BV6 A;  4EQR A;  3QSM A;  3HYX A;  1JOA A;  2JB3 A;  3CIR A;  2WP6 A;  1BKW A;  3L8K A;  1PBD A;  1Y0P A;  3NK1 X;  3AEF A;  4EIQ A;  1E6E A;  1Q1W A;  2WPC A;  5JCL A;  1L9E A;  3BI4 A;  2GR3 A;  3RNM A;  1VG9 A;  3NT6 A;  4USQ A;  1PS9 A;  1PBC A;  3V3O A;  2B76 A;  2C76 A;  1B4V A;  4LU6 A;  1FL2 A;  4D04 A;  2V5Z A;  3CN8 A;  3AE4 A;  1ZK7 A;  4TM4 A;  4BJY A;  1O95 A;  4JNQ A;  1HYU A;  1CHU A;  4NTC A;  3NYC A;  2YR6 A;  3RP6 A;  4EMI A;  2X8H A;  2XFN A;  2CFY A;  1E1K A;  5FMH A;  3M0O A;  1CBO A;  1TDF A;  2BCP A;  2OLN A;  2YG7 A;  1N4W A;  2Y6R A;  1KFY A;  3P4Q A;  4EQX A;  2R0G A;  3D1C A;  1TYP A;  1IUV A;  3T37 A;  3ZYX A;  2XVI A;  1JRX A;  2X8C A;  1GET A;  1S3B A;  2WEU A;  3SZW A;  3C4N A;  3VRB A;  4PAB A;  3DK9 A;  3VR8 A;  2OLO A;  2WPF A;  2Z5Y A;  1F3P A;  3CGB A;  4XWZ A;  1N4V A;  1CC6 A;  1H84 A;  4EM4 A;  1V59 A;  1AOG A;  4GDP A;  4U8P A;  1YKJ A;  2XLT A;  3ISH A;  1EL9 A;  4NTD A;  4H4T A;  3VRD B;  3DK4 A;  2RAB A;  4IVO B;  2BXR A;  5IQ4 A;  2BS4 A;  1GRE A;  2YG5 A;  3QVR A;  4J31 A;  1NEN A;  1K0I A;  2A87 A;  1LJ1 A;  2VRM A;  2VVL G;  3G5Q A;  4TM1 A;  2C73 A;  2EQ9 A;  2WES A;  3AB1 A;  3I3L A;  1PDH A;  4YWO A;  1ONF A;  3LOV A;  3QSE A;  2BS2 A;  4YTN A;  5HYM A;  4H2R A;  1D7L A;  2GRT A;  2X8G A;  2GVC A;  5ER0 A;  5M10 A;  4J57 A;  2BK4 A;  3AED A;  1L0V A;  3UKF A;  3LJP A;  2EQ6 A;  2WS3 A;  5EBK A;  2IVE A;  2VQB A;  3EF6 A;  4Z25 A;  1TRB A;  4WX1 A;  2R45 A;  2YG6 A;  3NHO X;  4K5S A;  5BUL A;  3UOV A;  2W0H A;  1YQZ A;  4FK1 A;  4YXD A;  2PYX A;  1KNP A;  1GEU A;  2XFQ A;  3I6D A;  3P9U A;  4UDP A;  4EMJ A;  3E1T A;  1KNR A;  3PO7 A;  3GRT A;  1GSN A;  4Z26 A;  2XFU A;  3B6D A;  4GDE A;  4TM3 A;  3EPT A;  4BK2 A;  3HYW A;  2JKC A;  3IHM A;  3RED A;  2GR0 A;  1ELI A;  3ABV A;  3D8X A;  3GD3 A;  2C3D A;  1PXC A;  2Q0K A;  1Q9I A;  1M64 A;  4H4U A;  4WCT A;  4DSG A;  5KOX A;  3CGD A;  2OAL A;  1LV0 A;  3AE1 A;  2V3A A;  5M0Z A;  2GMH A;  2TMD A;  5CKU A;  4OPU A;  3DK8 A;  4A6N A;  1FCD A;  3CNJ A;  1K0L A;  1ZKQ A;  2ACZ A;  2R0P A;  3DJJ A;  2Y6Q A;  3CGE A;  2V61 A;  1OJA A;  3AE2 A;  2YLZ A;  5KXJ A;  2FBW A;  2H88 A;  1GER A;  2Q6U A;  2WDQ A;  4BK3 A;  1ZP0 A;  2EQ7 A;  3KD9 A;  5FS8 A;  2A8X A;  2ZZC A;  2AAQ A;  1O5W A;  1D4C A;  4EIP A;  4II3 A;  4J2W A;  2FJA A;  3F8D A;  1PJ6 A;  4JDR A;  3P4R A;  2TPR A;  3SGL A;  3LZW A;  1B5Q A;  2B7S A;  4YKF A;  2AQJ A;  2YM1 A;  3AXB A;  4OVI A;  1GTH A;  1PBF A;  1F8S A;  4CBQ A;  3G5R A;  1VDC A;  4NTE A;  2GB0 A;  4U2L A;  4EQW A;  1OJ9 A;  3GRS A;  3GWF A;  3UTH A;  1ZY8 A;  2XDO A;  2R0C A;  3AD7 B;  2WHD A;  1S2Y A;  3BNM A;  1H86 A;  3S61 A;  4YSZ A;  3GYX A;  1NHP A;  3V76 A;  3QFB A;  2GR2 A;  1NHQ A;  4D03 A;  4ZN0 A;  5KMR A;  3G5S A;  3C4A A;  3NH3 X;  1DNC A;  1GRB A;  4H4S A;  3NK0 X;  3PS9 A;  4BJZ A;  3M12 A;  2C67 A;  4K5R A;  1DJN A;  2Z5X A;  3K30 A;  3BHF A;  1NEK A;  2PHH A;  3CNP A;  2DKH A;  3SQP A;  1LTX R;  3P4P A;  2WU5 A;  5EB5 A;  3FPZ A;  1S2Q A;  4IV9 A;  1EBD A;  2E5V A;  2WDR A;  4CCQ A;  3ALJ A;  3NYE A;  1LQU A;  3NTD A;  2CDU A;  1ZOV A;  3K7M X;  4ICY A;  4J56 A;  4TLZ A;  2C65 A;  2XCG A;  2YLR A;  2OA1 A;  3RHA A;  3UKL A;  3CNS A;  2CVJ A;  2R46 A;  4NEV A;  4X9N A;  1L9C A;  2R4E A;  4B67 A;  2GQF A;  5KMP A;  3T2Z A;  4HA6 A;  3KKJ A;  3NYF A;  3UKK A;  1CJ3 A;  4AT0 A;  1DOD A;  2GR1 A;  4GAP A;  4GAV A;  2EQ8 A;  4C5O A;  3AEA A;  5KRQ A;  3NK2 X;  2WET A;  4OPL A;  1GRG A;  4APN A;  1GND A;  1E1N A;  1W4X A;  2YG4 A;  4YSX A;  3DA1 A;  4C74 A;  1OJD A;  1EL7 A;  4REK A;  4X9M A;  2XVH A;  4Z2R A;  3SZ0 A;  1E1L A;  3AEC A;  3UTE A;  5KVI A;  3WE0 A;  3BI2 A;  2C72 A;  1QJD A;  2FJE A;  5KMS A;  4RSL A;  1PBE A;  3FIM B;  1JRZ A;  3VR9 A;  3QFA A;  1GTE A;  1TYT A;  1DOC A;  2XLU A;  4GCM A;  4B66 A;  2JK6 A;  2WBA A;  2BA9 A;  3CTY A;  2X50 A;  3AEG A;  2CUL A;  2BC1 A;  4EM3 A;  2E1M A;  1PHH A;  2GAG B;  4YSH A;  1GRT A;  1FEA A;  1JU2 A;  2JAE A;  1NHS A;  2Q0L A;  2BC0 A;  1P2H A;  2QA2 A;  3FBS A;  3SFD A;  3GDP A;  1FEB A;  5HHF A;  2XLR A;  4ADW A;  2H89 A;  4OCG A;  4A6N B;  4H4X A;  2VQ7 A;  1KDG A;  5KOW A;  2BYB A;  5KMQ A;  4AT2 A;  5FS7 A;  1B37 A;  2ZBW A;  1FOH A;  2YM2 A;  3AYI A;  1DOB A;  3NRN A;  2C64 A;  4OPI A;  2B9W A;  2C4C A;  1GT8 A;  1GAL A;  3FG2 P;  4CCR A;  1E1M A;  1LPF A;  3M13 A;  3ADA B;  3PVC A;  1IUS A;  2F5Z A;  2E4G A;  3KPK A;  5HY5 A;  1MOK A;  1NG3 A;  3AE9 A;  5EB4 A;  4K2X A;  1E39 A;  4YTP A;  1SEZ A;  3BI5 A;  3QVP A;  2RGJ A;  3GSI A;  5U25 A;  2ZZB A;  3V3N A;  2AR8 A;  4XXG A;  3P1W A;  4U2S A;  3AE5 A;  3UCL A;  2XLS A;  5KNL A;  3Q6J A;  4MJW A;  1S3E A;  2C3C A;  5KWF A;  2O9Z A;  4U8N A;  4G73 A;  1JRY A;  3SZC A;  2J3N A;  4O5U A;  2BCG G;  1VRQ B;  3JSK A;  4U8K A;  4NZH A;  2YR4 A;  4U8M A;  3VRA A;  3CPH G;  3DJE A;  2GEW A;  1X31 B;  1YY5 A;  2C7G A;  5IPY A;  3SZF A;  4K8D A;  4U8I A;  1H81 A;  1ZOY A;  3NNE A;  1CC2 A;  3NGC X;  3T31 A;  2BS3 A;  3T2K A;  2HQM A;  1GXF A;  4O5Q A;  1D4D A;  1GRH A;  2V6O A;  1Y56 A;  1TDN A;  2WU2 A;  4KX6 A;  4XWR A;  2WP9 A;  4GRT A;  3DJG X;  1TDK A;  1D4E A;  4G9K A;  4J36 A;  2WP5 A;  4I59 A;  2C66 A;  3AE8 A;  4I58 A;  2YR5 A;  1KSU A;  2XVJ A;  3H8I A;  1JNZ A;  4OPC A;  1IJH A;  1D7Y A;  1PXB A;  4BK1 A;  1IUT A;  4Z2T A;  1IUX A;  3GDN A;  5JCN A;  3IF9 A;  3KPF A;  4JN9 A;  1COY A;  1XHC A;  1YQ4 A;  3T2Y A;  3OC4 A;  1NG4 A;  4H4V A;  4B69 A;  4X4J A;  3VQR A;  5JCM A;  1BWC A;  2YLT A;  3SYI A;  4U8J A;  4Z43 A;  1CJC A;  3FMW A;  1GRA A;  4H4Y A;  2YLX A;  1GV4 A;  2QCU A;  4JY3 A;  4JNA A;  5GSN A;  5EOW A;  4UDR A;  2BRY A;  4Y4M A;  1Y56 B;  3EAN A;  4PAA A;  4A79 A;  4H4W A;  3LB8 A;  5BVA A;  1H7W A;  2BAC A;  3NG7 X;  3BHK A;  1PJ7 A;  4NEW A;  2R4J A;  3P4S A;  1ZMD A;  3AEB A;  4AOS A;  1H7X A;  1NPX A;  4A65 A;  3OZ2 A;  3UP4 A;  4YTM A;  1K0J A;  1KSS A;  3AD8 B;  1VG0 A;  3F8R A;  1F6M A;  4H50 A;  3T14 A;  2YWL A;  3AYJ A;  3DJD A;  2VVM A;  4B64 A;  3DH9 A;  5FS6 A;  3NN6 X;  3URH A;  4IA6 A;  2YG3 A;  4CRT A;  4TLX A;  3AD9 B;  4IVM B;  1XDI A;  1K4Q A;  3UTF A;  3CMM A;  5J7X A;  1Q1R A;  1GES A;  1YQ3 A;  3UP5 A;  1BF3 A;  3NLC A;  1H83 A;  3AYL A;  3DGH A;  3C96 A;  2VRL A;  3K7T A;  4FX9 A;  2YAU A;  4H4Z A;  1MXT A;  4K22 A;  3ITJ A;  3GD4 A;  2XYO A;  2JB1 A;  2WPE A;  2WOI A;  3IWA A;  1D5T A;  4HB9 A;  1CJ4 A;  4H7U A;  4G6G A;  2BRA A;  3T0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...