1TDNA

L-amino acid oxidase from agkistrodon halys in complex with l-leucine
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of L-amino acid oxidase in complex with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
molecule keywords L-amino acid oxidase
total genus 172
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdnA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdnA01
3NT6A 2FBWA 3C4AA 1EL9A 1IUVA 1DOCA 4H7UA 2V3BA 3NH3X 5U63A 3V3OA 4H4SA 5IPYA 1JRZA 4UP3A 2B9YA 2E4GA 1PBEA 2HQMA 1YQ4A 2YLSA 3AE4A 5U1OA 1F3PA 2OA1A 1DOEA 2JB2A 1GRTA 3ADAB 5KOXA 5HY5A 2DKHA 3AE6A 3NKSA 2WEUA 3AE8A 1OJCA 4GDEA 4U8JA 1OJTA 3ALLA 3NHOX 4YSHA 3UKQA 1GREA 2W0HA 4GF7A 1GTHA 1LJ1A 2R46A 1E6EA 2NPXA 3II4A 1PDHA 3F8DA 3DGZA 3NGCX 3K7TA 4EM3A 2XFOA 2IVEA 1H6VA 2BK5A 1ZMDA 3F8RA 5FS7A 4USRA 3UKPA 1DJQA 4MJWA 4U2SA 3NYFA 4KX6A 2WDQA 2R4EA 4OPUA 2GAGB 2B7SA 3KD9A 2XCGA 1TYTA 3KA7A 3NIXA 4KPRA 4Y4NA 3GMBA 4J56A 3NYCA 1IUWA 3NK0X 2C3CA 5U25A 4BURA 2Q7VA 1EL5A 3BI5A 5FS6A 1PBBA 4WCTA 4U2TA 4YSYA 4A7AA 1L9CA 2Y6QA 3BHFA 2BK4A 3AWIA 4ZCDA 2V61A 4C5OA 4USQA 1GALA 2GAHB 3L8KA 4RSLA 1NDAA 2BXSA 3AB1A 1RYIA 3LZWA 1Q1WA 1S2YA 2B9WA 3E1TA 4GUVA 3REDA 4C74A 2C65A 3LXDA 3NN0X 1D4DA 2C75A 1FECA 2VRMA 1F8WA 1DOBA 3SGLA 1ZX9A 4B69A 4B68A 1PJ5A 1PBDA 3QJ4A 2EQ9A 4A6NA 3GSIA 2JB1A 1O94A 1SEZA 1ZMCA 3EAOA 3EPTA 1NHQA 4IVMB 3CPJG 1NEKA 2AQJA 3CGBA 2C7GA 2Q6UA 4H2QA 3H8IA 1HYUA 2RABA 1COYA 4YTMA 3I6DA 4GCMA 2WDVA 2WS3A 3FBSA 3ISHA 4JDRA 2XLTA 3AD7B 3ALJA 4X9NA 1CJ4A 1K0JA 5EB4A 1L9EA 3LZXA 1N4WA 2R0PA 4O5UA 1QJDA 1ZP0A 3IHMA 2FJAA 1D5TA 4OPTA 2WPFA 4H4RA 3B6DA 1BZLA 1RSGA 2VQBA 3AXBA 1YQ3A 1GESA 2WOVA 3S5WA 1DODA 4U8OA 1GPEA 2F5ZA 4TM4A 2XFNA 4A79A 3BNMA 2J3NA 2R4JA 1ONFA 4A99A 3C96A 2BC0A 1BKWA 4K7ZA 1YKJA 4B67A 2C72A 4Z44A 3AEEA 4RG4A 4I59A 4OPGA 4P9SA 3DGHA 4ECHA 4D04A 4JNAA 3K7MX 3UKLA 5HYMA 3G5QA 3GD3A 2YWLA 3FMWA 2BC1A 2JBVA 3CNJA 3UCLA 4OCGA 1H81A 3UKFA 4K5RA 5JCKA 1TDFA 1IUTA 2YM1A 2XVEA 3PO7A 4BV6A 2GVCA 3AE5A 3P4RA 4PAAA 4DSHA 1H7WA 3UOZA 1ELIA 2B7RA 5GSNA 4J57A 2C73A 4AP3A 4E0VA 2YVJA 3NNEA 1YY5A 2XDOA 1K4QA 2I0ZA 4K2XA 5BUKA 5KRQA 4WX1A 3P4PA 3RP6A 1BF3A 3AEFA 1BGNA 2XVFA 3UP5A 4Z26A 3V3NA 2FJEA 3D8XA 1LPFA 1OJ9A 2VRLA 3RHAA 2WPCA 2V6OA 2A87A 2Z5XA 3NLCA 5C2TA 3NYEA 4ICYA 2WP6A 5JCNA 1S2QA 4BK1A 5FS8A 3FIMB 1GRHA 1MXTA 2Z5YA 3CNSA 3ATQA 3KKJA 4UDPA 3DJJA 1OJAA 2X99A 1PXCA 1PS9A 1IUXA 3KVEA 4AOSA 5BVAA 2RGHA 1NG4A 3NK2X 3M12A 4J34A 1CL0A 2BS3A 3LB8A 3AE2A 2C66A 2XFUA 1DXLA 1GSNA 2B76A 2V5ZA 2YR4A 4GDPA 4HA6A 3QVRA 5HHFA 4EIQA 2BS2A 2DKIA 1H82A 1CJCA 3UOXA 5EBKA 4EQRA 4OVIA 4UDQA 4TM0A 4BJZA 2H88A 1S3BA 1OJDA 5HXIA 4H4YA 3VQRA 2OLOA 3NK1X 5KOWA 4K5SA 4Z43A 4FK1C 2APGA 2GEWA 1GT8A 3RP7A 1CC2A 1O95A 1B4VA 5EOWA 1K0IA 3LJPA 3KLJA 5ER0A 1NHSA 5GRTA 3QSMA 2QCUA 3VRBA 3NN6X 2XVJA 3COXA 4K22A 2R45A 4OPCA 1H84A 3L1RA 4TLXA 1NG3A 2YG6A 4J31A 4AT2A 1PXBA 3AE3A 3GD4A 1GV4A 3DK9A 2BS4A 2QA2A 3AEGA 1L9DA 4OPLA 3H4KA 2PHHA 3P1WA 5KWFA 4IA5A 2OLNA 3AE7A 3G5SA 4EMWA 1NHPA 1TDEA 2CULA 1N4UA 4ADWA 3T37A 3M0OA 3FG2P 5FMHA 4Z2UA 4IVOB 2Y6RA 4CCRA 4A5LA 3CGDA 2VVLG 1GNDA 5LV9A 2C70A 1GRGA 2WPEA 3IHGA 2WP5A 4NEVA 4OPDA 2XLPA 2XVIA 1UKVG 3AYJA 4CCQA 1Y56B 2AR8A 1D4EA 4YWOA 5BRTA 4GR1A 2C3DA 2X50A 3CNPA 3GYJA 1E39A 4H4TA 1M64A 1NAAA 2GF3A 3UKHA 3V76A 2ZZCA 2YLWA 3K30A 5KVIA 4J36A 5JCLA 1PBFA 4XWRA 2ZZBA 1QO8A 1DJNA 2IIDA 1K0LA 1KFYA 2X8GA 3ABVA 3DA1A 4O5QA 3NRNA 4BK3A 1KDGA 4NTCA 4Y4LA 1TDKA 2GR1A 3QSSA 4DGKA 4XWZA 4NZHA 1E1MA 2FJBA 4LA1A 4K8DA 1QLBA 3LADA 1JNZA 3UTEA 5CQFA 3ZYXA 2GQFA 5J7XA 4M52A 3CN8A 4LIIA 5C3JA 4U2LA 2TPRA 4JY2A 3DMEA 3UKKA 1E1NA 2YQUA 3M13A 4NTDA 4EQXA 1FEAA 4AOXA 1E7PA 4OPIA 2YG5A 2X3NA 2JK6A 4EQWA 3CPHG 3CNTA 3C4NA 2BYBA 2CFYA 2BK3A 4FK1A 1IUSA 4CNJA 1P2EA 2YR5A 3O0HA 2JAEA 1DNCA 1TDOA 2VOUA 3DH9A 1LVLA 4J2WA 1L0VA 3UP4A 1TDNA 2UZZA 3CGEA 1E1KA 4H4XA 1GRBA 4RG3A 3G5RA 4TM3A 4X9MA 5KXJA 4X4JA 1N1PA 2WU5A 3GYIA 4U8KA 2R9ZA 3DJDA 4H4VA 1P2HA 2ZBWA 4Z2TA 2JKCA 4B1BA 4Z2RA 4YT0A 3NTDA 4Y4MA 1GETA 2OALA 4H4UA 3AE1A 3GRTA 3P4QA 2WU2A 3ICRA 1M6IA 1ZDLA 4Z24A 1AOGA 3AD8B 4JNQA 1FEBA 2ACZA 2CVJA 1N4VA 3QVPA 4NTEA 3UKAA 4XXGA 3NTAA 1MOKA 3UTGA 5L46A 4CRTA 1KNRA 2PYXA 2YLZA 4ZN0A 1V59A 5DBJA 4LU6A 2IVDA 3R9UA 4GRTA 3WE0A 2YVGA 3CTYA 3VRAA 2GH5A 2WESA 2X8CA 4U8PA 5IQ1A 1CC6A 2C64A 4J33A 1XANA 4A6NB 2XFPA 2ZZ0A 3D1CA 4U8IA 4BK2A 2C67A 3IF9A 2XVHA 2YVFA 2YM2A 1RP0A 1EBDA 1XDIA 4HB9A 5M0ZA 1D4CA 3GWFA 4N9XA 1NPXA 1VG9A 1MO9A 2BCPA 2R0CA 2YAUA 5J60A 3ITJA 1ZOYA 3GMCA 3KPFA 3LOVA 2WHDA 2R0GA 1GTEA 2YLXA 3UTHA 2WOWA 4TLZA 2BACA 2WETA 4C77A 5CKUA 4JN9A 3AECA 2BA9A 4U8NA 1Q9IA 4NEWA 2GQWA 3RNMA 2V60A 4YTNA 2EQ8A 2GRTA 4EQSA 2WOIA 1NENA 1JEHA 4DNAA 3CPIG 2VVMA 3P9UA 1GEUA 1YQZA 2WP9A 4CNKA 4AP1A 2YG7A 2BXRA 4JY3A 4ZCCA 2YG4A 1PJ7A 3UTFA 1FL2A 3DJGX 4Z25A 3GWDA 3AD9B 3IWAA 4U8LA 4D03A 3EANA 1ZKQA 2CDUA 2E5VA 3QFAA 3VR9A 4CY6A 3DK4A 1FOHA 3UOVA 2VQ7A 1E1LA 4I58A 4H2NA 1ZY8A 2X8HA 3Q9TA 3DJEA 3URHA 1NHRA 1VDCA 3AYIA 3SFDA 4B66A 2GB0A 2B9XA 2GV8A 4H2PA 4A9WA 1KF6A 2XLUA 4JQ9A 3AEBA 1CJ2A 1Q1RA 1VRQB 4YTPA 3VRDB 1PXAA 2ARDA 2QA1A 1D7LA 2O9ZA 1LQUA 3I3LA 5M10A 3AYLA 4C3YA 2XFQA 1XHCA 3GDPA 1ZK7A 2WDRA 1F8SA 5EB5A 4PABA 1B5QA 3OZ2A 4YXDA 2XYOA 3F8PA 1H83A 4TM1A 5TR3A 4YSXA 4H4WA 4H2RA 3RP8A 1Z6LA 1GRFA 2YLRA 2BABA 4H4ZA 3OC4A 4B63A 3QFBA 4B65A 4EMJA 3DK8A 3K7QX 3BNUA 4C3XA 4IV9A 2WQYA 4YSZA 3CGCA 2RGJA 1O5WA 3UOYA 4YKGA 2H89A 2WBAA 1PHHA 3BI2A 3CNDA 1BGJA 4CBQA 1XPQA 3BI4A 3ICSA 1W4XA 1PJ6A 2GMHA 2GMJA 1VG0A 2NVKX 2AAQA 4IA6A 3AE9A 2GR2A 1KNPA 1S3EA 1VQWA 1KSUA 3ALMA 2VZ2A 1REOA 2BCGG 2YLTA 3GDNA 3ICTA 3SM8A 5JCIA 1X31B 3JSKA 1EL7A 2GR0A 1H7XA 3CIRA 1LTXR 1IJHA 1D7YA 4H4QA 4YKFA 1Y0PA 2EQ6A 3QSEA 2C76A 3HZLA 2XLRA 1TYPA 1B37A 2FJDA 2QAEA 5JCMA 1JRXA 4DSGA 2A89A 1JRYA 3GRSA 4B64A 1CJ3A 3PS9A 2A8XA 1GOSA 1CF3A 1TRBA 3B3RA 3VR8A 1BWCA 1GXFA 4EMIA 3FPZA 2YR6A 3IC9A 1JU2A 4BJYA 1GERA 3ZDNA 4EIPA 4APNA 1B8SA 1F8RA 2Q0LA 5BULA 3S61A 4AT0A 3AEDA 1JOAA 2EQ7A 2RGOA 2TMDA 5FS9A 2YG3A 1CC4A 2Q0KA 3Q6JA 3SFEA 4CY8A 1EL8A 1CHUA 1Y56A 3KU9A 3AEAA 1ZOVA 3NG7X 1PN0A 3H8LA 1H86A 4FX9A 5KVHA 1CBOA 1LQTA 4EM4A 1FCDA 2VVLA 1IUUA 3BHKA 4FDCB 1GRAA 2OAMA 2V3AA 4H50A 4REKA 4U8MA 1KSSA 2GR3A 1JNRA 3P4SA 1LV0A 5IQ4A 4H4PA 1PBCA 4A65A 2E1MA 1F6MA 2JB3A 2XLSA 3PVCA 4UDRA 3SQPA 3EF6A 3ATRA
chains in the Genus database with same CATH superfamily
3NT6A 2FBWA 3C4AA 1EL9A 1IUVA 1DOCA 4H7UA 2V3BA 3NH3X 5U63A 3V3OA 4H4SA 5IPYA 1JRZA 4UP3A 2B9YA 2E4GA 1PBEA 2HQMA 1YQ4A 2YLSA 3AE4A 5U1OA 1F3PA 2OA1A 1DOEA 2JB2A 1GRTA 3ADAB 5KOXA 5HY5A 2DKHA 3AE6A 3NKSA 2WEUA 3AE8A 1OJCA 4GDEA 4U8JA 1OJTA 3ALLA 3NHOX 4YSHA 3UKQA 1GREA 2W0HA 4GF7A 1GTHA 1LJ1A 2R46A 1E6EA 2NPXA 3II4A 1PDHA 3F8DA 3DGZA 3NGCX 3K7TA 4NNJA 4EM3A 2XFOA 2IVEA 3T0KA 1H6VA 2BK5A 1ZMDA 3F8RA 5FS7A 4USRA 3T2YA 3UKPA 1DJQA 4MJWA 4U2SA 3NYFA 4KX6A 2WDQA 2R4EA 4OPUA 2GAGB 2B7SA 3KD9A 2XCGA 1TYTA 3KA7A 3NIXA 4KPRA 4Y4NA 3GMBA 4J56A 3NYCA 1IUWA 3NK0X 2C3CA 5U25A 3SY4A 2Q7VA 1EL5A 3BI5A 5FS6A 1PBBA 4WCTA 4U2TA 4YSYA 4A7AA 1L9CA 2Y6QA 3BHFA 2BK4A 3AWIA 4ZCDA 2V61A 4C5OA 4USQA 1GALA 2GAHB 3L8KA 4RSLA 1NDAA 2BXSA 3AB1A 1RYIA 3LZWA 2B9WA 1S2YA 1Q1WA 3E1TA 4GUVA 3REDA 4C74A 2C65A 3LXDA 3NN0X 1D4DA 2C75A 3T2KA 1FECA 2VRMA 1F8WA 1DOBA 3SGLA 1ZX9A 4B69A 4B68A 1PJ5A 1PBDA 3QJ4A 2EQ9A 4A6NA 3GSIA 2JB1A 1O94A 1SEZA 1ZMCA 3EAOA 3EPTA 1NHQA 4IVMB 3CPJG 1NEKA 2AQJA 3CGBA 2C7GA 2Q6UA 4H2QA 3H8IA 1HYUA 2RABA 1COYA 4YTMA 3I6DA 4GCMA 2WDVA 2WS3A 3FBSA 3ISHA 4JDRA 2XLTA 3AD7B 3ALJA 4X9NA 1CJ4A 1K0JA 5EB4A 1L9EA 3LZXA 1N4WA 2R0PA 4O5UA 1QJDA 1ZP0A 3IHMA 2FJAA 1D5TA 4OPTA 2WPFA 4H4RA 3B6DA 1BZLA 1RSGA 2VQBA 3AXBA 1YQ3A 1GESA 2WOVA 3S5WA 1DODA 4U8OA 1GPEA 2F5ZA 4TM4A 2XFNA 4A79A 3BNMA 2J3NA 2R4JA 1ONFA 4A99A 3C96A 2BC0A 1BKWA 4GAPA 4K7ZA 1YKJA 4B67A 2C72A 4Z44A 3AEEA 4RG4A 4I59A 4OPGA 3SX6A 4P9SA 3DGHA 4ECHA 4D04A 4JNAA 3K7MX 3UKLA 5HYMA 3G5QA 3GD3A 2YWLA 3FMWA 2BC1A 2JBVA 3CNJA 3UCLA 4OCGA 1H81A 3UKFA 4K5RA 5JCKA 1TDFA 1IUTA 2YM1A 2XVEA 3PO7A 4BV6A 2GVCA 3AE5A 3P4RA 4PAAA 4DSHA 1H7WA 3UOZA 1ELIA 2B7RA 5GSNA 4J57A 2C73A 4AP3A 4E0VA 2YVJA 3NNEA 1YY5A 2XDOA 1K4QA 2I0ZA 4K2XA 5BUKA 5KRQA 4WX1A 3P4PA 3RP6A 1BF3A 3AEFA 1BGNA 2XVFA 3UP5A 4G74A 3V3NA 2FJEA 3D8XA 1LPFA 4Z26A 1OJ9A 2VRLA 3RHAA 2WPCA 2V6OA 2A87A 2Z5XA 3NLCA 5C2TA 3HYXA 3NYEA 4ICYA 2WP6A 5JCNA 1S2QA 4BK1A 5FS8A 3FIMB 1GRHA 1MXTA 2Z5YA 3CNSA 3ATQA 3KKJA 4UDPA 3DJJA 1OJAA 2X99A 1PXCA 1PS9A 1IUXA 3KVEA 4AOSA 5BVAA 2RGHA 1NG4A 3NK2X 3M12A 4J34A 1CL0A 2BS3A 3LB8A 3AE2A 2C66A 5KMPA 2XFUA 1DXLA 1GSNA 2B76A 2V5ZA 2YR4A 4GDPA 4HA6A 3QVRA 5HHFA 4EIQA 2BS2A 2DKIA 1H82A 1CJCA 3UOXA 2C4CA 5EBKA 4EQRA 4OVIA 4UDQA 4TM0A 4BJZA 2H88A 1S3BA 1OJDA 5HXIA 4H4YA 3VQRA 2OLOA 3NK1X 5KOWA 4K5SA 4Z43A 4FK1C 2APGA 2GEWA 1GT8A 3RP7A 3SZWA 1CC2A 1O95A 1B4VA 5EOWA 1K0IA 3LJPA 3SYIA 3KLJA 5ER0A 1NHSA 5GRTA 3SZ0A 3QSMA 2QCUA 3VRBA 3NN6X 2XVJA 3COXA 4K22A 2R45A 4II2A 1H84A 3L1RA 4OPCA 4TLXA 1NG3A 2YG6A 4J31A 4AT2A 1PXBA 3AE3A 3GD4A 1GV4A 3DK9A 2BS4A 2QA2A 3AEGA 1L9DA 4OPLA 3H4KA 2PHHA 3P1WA 5KWFA 3T14A 4IA5A 2OLNA 3AE7A 3G5SA 4EMWA 1NHPA 1TDEA 2CULA 1N4UA 4ADWA 3T37A 3M0OA 3FG2P 5FMHA 4Z2UA 4IVOB 2Y6RA 4CCRA 4A5LA 3CGDA 2VVLG 1GNDA 5LV9A 2C70A 1GRGA 2WPEA 3IHGA 2WP5A 4NEVA 4OPDA 2XLPA 2XVIA 1UKVG 3AYJA 4CCQA 1Y56B 2AR8A 1D4EA 4YWOA 5BRTA 4GR1A 2C3DA 2X50A 3CNPA 3GYJA 1E39A 4H4TA 1M64A 1NAAA 2GF3A 3UKHA 3V76A 2ZZCA 2YLWA 3K30A 5KVIA 4J36A 5JCLA 1PBFA 4XWRA 2ZZBA 1QO8A 1DJNA 2IIDA 1K0LA 1KFYA 2X8GA 3ABVA 3DA1A 4O5QA 3NRNA 4BK3A 1KDGA 4NTCA 4Y4LA 1TDKA 2GR1A 3QSSA 4DGKA 4XWZA 4NZHA 1E1MA 2FJBA 4LA1A 4K8DA 1QLBA 3LADA 1JNZA 3UTEA 5CQFA 3ZYXA 2GQFA 5J7XA 4M52A 3CN8A 4LIIA 5C3JA 4U2LA 2TPRA 4JY2A 3DMEA 3UKKA 1E1NA 2YQUA 3M13A 4NTDA 4EQXA 1FEAA 4AOXA 3CMMA 1E7PA 4OPIA 2YG5A 2X3NA 2JK6A 4GAVA 4EQWA 3CPHG 3CNTA 3C4NA 2BYBA 2CFYA 2BK3A 4FK1A 1IUSA 4CNJA 1P2EA 2YR5A 3O0HA 2JAEA 1DNCA 1TDOA 2VOUA 3DH9A 1LVLA 3HYVA 4J2WA 1L0VA 3UP4A 1TDNA 2UZZA 3CGEA 1E1KA 4H4XA 1GRBA 4RG3A 3G5RA 4TM3A 4X9MA 5KXJA 2BRAA 4X4JA 1N1PA 2WU5A 3GYIA 4U8KA 2R9ZA 3DJDA 4H4VA 1P2HA 3SZCA 2ZBWA 4Z2TA 2JKCA 4B1BA 4Z2RA 4YT0A 3NTDA 4Y4MA 1GETA 2OALA 4H4UA 3AE1A 3GRTA 3P4QA 2WU2A 3ICRA 1M6IA 1ZDLA 4Z24A 1AOGA 3AD8B 4JNQA 5KMRA 1FEBA 2ACZA 2CVJA 1N4VA 3QVPA 4NTEA 3UKAA 4XXGA 3NTAA 1MOKA 3UTGA 5L46A 4CRTA 1KNRA 2PYXA 2YLZA 4ZN0A 1V59A 5DBJA 4LU6A 2IVDA 3R9UA 4GRTA 3WE0A 2YVGA 3CTYA 3VRAA 2GH5A 2WESA 2X8CA 4U8PA 5IQ1A 1CC6A 2C64A 4G6GA 4J33A 1XANA 4A6NB 2XFPA 2ZZ0A 3D1CA 4U8IA 4BK2A 2C67A 4BURA 3IF9A 2XVHA 2YVFA 2YM2A 1RP0A 1EBDA 1XDIA 4HB9A 5M0ZA 1D4CA 3GWFA 4G73A 4N9XA 1NPXA 1VG9A 1MO9A 2BCPA 2R0CA 2YAUA 5J60A 3ITJA 1ZOYA 3GMCA 3KPFA 3LOVA 2WHDA 2R0GA 1GTEA 2YLXA 3UTHA 2WOWA 4TLZA 2BACA 2WETA 4C77A 5CKUA 4JN9A 3AECA 2BA9A 4U8NA 1Q9IA 3KPKA 4NEWA 2GQWA 3RNMA 2V60A 4YTNA 2EQ8A 2GRTA 4EQSA 2WOIA 1NENA 1JEHA 4DNAA 3CPIG 2VVMA 3P9UA 1GEUA 1YQZA 2WP9A 4CNKA 4AP1A 2YG7A 2BXRA 4JY3A 4ZCCA 2YG4A 1PJ7A 3UTFA 1FL2A 3DJGX 4Z25A 3GWDA 3AD9B 3IWAA 4NWZA 4U8LA 4D03A 3EANA 1ZKQA 2CDUA 2E5VA 3QFAA 3VR9A 4CY6A 3DK4A 1FOHA 2BRYA 2VQ7A 1E1LA 4I58A 4H2NA 1ZY8A 3SZFA 3UOVA 2X8HA 3GYXA 3DJEA 3Q9TA 3URHA 1NHRA 1VDCA 3AYIA 3SFDA 4B66A 2GB0A 2B9XA 2GV8A 4H2PA 4A9WA 1KF6A 2XLUA 4JQ9A 3AEBA 1CJ2A 1Q1RA 1VRQB 4YTPA 3VRDB 1PXAA 2ARDA 2QA1A 1D7LA 4G6HA 2O9ZA 1LQUA 3I3LA 5M10A 3AYLA 4C3YA 2XFQA 1XHCA 3GDPA 1ZK7A 2WDRA 1F8SA 5EB5A 5KMSA 4PABA 1B5QA 3OZ2A 4YXDA 2XYOA 3F8PA 1H83A 4TM1A 5TR3A 4YSXA 4H4WA 4H2RA 3RP8A 1Z6LA 1GRFA 2YLRA 2BABA 4H4ZA 3OC4A 4B63A 5KNLA 3QFBA 4B65A 4EMJA 3DK8A 3K7QX 3BNUA 4C3XA 4IV9A 2WQYA 3T31A 4YSZA 3CGCA 2RGJA 1O5WA 3UOYA 4YKGA 2H89A 2WBAA 1PHHA 3BI2A 3CNDA 1BGJA 4CBQA 1XPQA 3BI4A 3ICSA 1W4XA 4G9KA 1PJ6A 2GMHA 2GMJA 1VG0A 2NVKX 2AAQA 4IA6A 3AE9A 2GR2A 1KNPA 1S3EA 1VQWA 1KSUA 3ALMA 2VZ2A 1REOA 2BCGG 2YLTA 3GDNA 3ICTA 3SM8A 3SXIA 3T2ZA 5JCIA 1X31B 3JSKA 1EL7A 2GR0A 1H7XA 3CIRA 1LTXR 1IJHA 1D7YA 4H4QA 4YKFA 1Y0PA 2EQ6A 3QSEA 2C76A 3HZLA 4II3A 2XLRA 1TYPA 1B37A 2FJDA 2QAEA 5JCMA 1JRXA 4DSGA 2A89A 1JRYA 3GRSA 4B64A 1CJ3A 3PS9A 2A8XA 1GOSA 1CF3A 1TRBA 3B3RA 3VR8A 1BWCA 1GXFA 4EMIA 5KMQA 3FPZA 2YR6A 3IC9A 1JU2A 4BJYA 1GERA 3ZDNA 4EIPA 4APNA 1B8SA 1F8RA 2Q0LA 5BULA 3S61A 4AT0A 3AEDA 1JOAA 2EQ7A 2RGOA 2TMDA 3HYWA 2YG3A 1CC4A 5FS9A 2Q0KA 3Q6JA 3SFEA 4CY8A 1EL8A 1CHUA 1Y56A 3KU9A 3AEAA 1ZOVA 3NG7X 1PN0A 3H8LA 1H86A 4FX9A 5KVHA 1CBOA 1LQTA 4EM4A 1FCDA 2VVLA 1IUUA 3BHKA 4FDCB 1GRAA 2OAMA 2V3AA 4H50A 4REKA 4U8MA 1KSSA 2GR3A 1JNRA 3P4SA 1LV0A 5IQ4A 4H4PA 1PBCA 4A65A 2E1MA 1F6MA 2JB3A 2XLSA 3PVCA 4UDRA 3SQPA 3EF6A 3ATRA
chains in the Genus database with same CATH topology
3NT6A 2FBWA 3C4AA 1EL9A 1IUVA 1DOCA 4H7UA 2V3BA 3NH3X 5U63A 3V3OA 4H4SA 5IPYA 1JRZA 4UP3A 2B9YA 2E4GA 1PBEA 2HQMA 1YQ4A 2YLSA 3AE4A 5U1OA 1F3PA 2OA1A 1DOEA 2JB2A 1GRTA 3ADAB 5KOXA 5HY5A 2DKHA 3AE6A 3NKSA 2WEUA 3AE8A 1OJCA 4GDEA 4U8JA 1OJTA 3ALLA 3NHOX 4YSHA 3UKQA 1GREA 2W0HA 4GF7A 1GTHA 1LJ1A 2R46A 1E6EA 2NPXA 3II4A 1PDHA 3F8DA 3DGZA 3NGCX 3K7TA 4NNJA 4EM3A 2XFOA 2IVEA 3T0KA 1H6VA 2BK5A 1ZMDA 3F8RA 5FS7A 4USRA 3T2YA 3UKPA 1DJQA 4MJWA 4U2SA 3NYFA 4KX6A 2WDQA 2R4EA 4OPUA 2GAGB 2B7SA 3KD9A 2XCGA 1TYTA 3KA7A 3NIXA 4KPRA 4Y4NA 3GMBA 4J56A 3NYCA 1IUWA 3NK0X 2C3CA 5U25A 3SY4A 2Q7VA 1EL5A 3BI5A 5FS6A 1PBBA 4WCTA 4U2TA 4YSYA 4A7AA 1L9CA 2Y6QA 3BHFA 2BK4A 3AWIA 4ZCDA 2V61A 4C5OA 4USQA 1GALA 2GAHB 3L8KA 4RSLA 1NDAA 2BXSA 3AB1A 1RYIA 3LZWA 1Q1WA 1S2YA 2B9WA 3E1TA 4GUVA 3REDA 4C74A 2C65A 3LXDA 3NN0X 1D4DA 2C75A 3T2KA 1FECA 2VRMA 1F8WA 1DOBA 3SGLA 1ZX9A 4B69A 4B68A 1PJ5A 1PBDA 3QJ4A 2EQ9A 4A6NA 3GSIA 2JB1A 1O94A 1SEZA 1ZMCA 3EAOA 3EPTA 1NHQA 4IVMB 3CPJG 1NEKA 2AQJA 3CGBA 2C7GA 2Q6UA 4H2QA 3H8IA 1HYUA 2RABA 1COYA 4YTMA 3I6DA 4GCMA 2WDVA 2WS3A 3FBSA 3ISHA 4JDRA 2XLTA 3AD7B 3ALJA 4X9NA 1CJ4A 1K0JA 5EB4A 1L9EA 3LZXA 1N4WA 2R0PA 4O5UA 1QJDA 1ZP0A 3IHMA 2FJAA 1D5TA 4OPTA 2WPFA 4H4RA 3B6DA 1BZLA 1RSGA 2VQBA 3AXBA 1YQ3A 1GESA 2WOVA 3S5WA 1DODA 4U8OA 1GPEA 2F5ZA 4TM4A 2XFNA 4A79A 3BNMA 2J3NA 2R4JA 1ONFA 4A99A 3C96A 2BC0A 1BKWA 4GAPA 4K7ZA 1YKJA 4B67A 2C72A 4Z44A 3AEEA 4RG4A 4I59A 4OPGA 3SX6A 4P9SA 3DGHA 4ECHA 4D04A 4JNAA 3K7MX 3UKLA 5HYMA 3G5QA 3GD3A 2YWLA 3FMWA 2BC1A 2JBVA 3CNJA 3UCLA 4OCGA 1H81A 3UKFA 4K5RA 5JCKA 1TDFA 1IUTA 2YM1A 2XVEA 3PO7A 4BV6A 2GVCA 3AE5A 3P4RA 4PAAA 4DSHA 1H7WA 3UOZA 1ELIA 2B7RA 5GSNA 4J57A 2C73A 4AP3A 4E0VA 2YVJA 3NNEA 1YY5A 2XDOA 1K4QA 2I0ZA 4K2XA 5BUKA 5KRQA 4WX1A 3P4PA 3RP6A 1BF3A 3AEFA 1BGNA 2XVFA 3UP5A 4G74A 3V3NA 2FJEA 3D8XA 1LPFA 4Z26A 1OJ9A 2VRLA 3RHAA 2WPCA 2V6OA 2A87A 2Z5XA 3NLCA 5C2TA 3HYXA 3NYEA 4ICYA 2WP6A 5JCNA 1S2QA 4BK1A 5FS8A 3FIMB 1GRHA 1MXTA 2Z5YA 3CNSA 3ATQA 3KKJA 4UDPA 3DJJA 1OJAA 2X99A 1PXCA 1PS9A 1IUXA 3KVEA 4AOSA 5BVAA 2RGHA 1NG4A 3NK2X 3M12A 4J34A 1CL0A 2BS3A 3LB8A 3AE2A 2C66A 5KMPA 2XFUA 1DXLA 1GSNA 2B76A 2V5ZA 2YR4A 4GDPA 4HA6A 3QVRA 5HHFA 4EIQA 2BS2A 2DKIA 1H82A 1CJCA 3UOXA 2C4CA 5EBKA 4EQRA 4OVIA 4UDQA 4TM0A 4BJZA 2H88A 1S3BA 1OJDA 5HXIA 4H4YA 3VQRA 2OLOA 3NK1X 5KOWA 4K5SA 4Z43A 4FK1C 2APGA 2GEWA 1GT8A 3RP7A 3SZWA 1CC2A 1O95A 1B4VA 5EOWA 1K0IA 3LJPA 3SYIA 3KLJA 5ER0A 1NHSA 5GRTA 3SZ0A 3QSMA 2QCUA 3VRBA 3NN6X 2XVJA 3COXA 4K22A 2R45A 4II2A 1H84A 3L1RA 4OPCA 4TLXA 1NG3A 2YG6A 4J31A 4AT2A 1PXBA 3AE3A 3GD4A 1GV4A 3DK9A 2BS4A 2QA2A 3AEGA 1L9DA 4OPLA 3H4KA 2PHHA 3P1WA 5KWFA 3T14A 4IA5A 2OLNA 3AE7A 3G5SA 4EMWA 1NHPA 1TDEA 2CULA 1N4UA 4ADWA 3T37A 3M0OA 3FG2P 5FMHA 4Z2UA 4IVOB 2Y6RA 4CCRA 4A5LA 3CGDA 2VVLG 1GNDA 5LV9A 2C70A 1GRGA 2WPEA 3IHGA 2WP5A 4NEVA 4OPDA 2XLPA 2XVIA 1UKVG 3AYJA 4CCQA 1Y56B 2AR8A 1D4EA 4YWOA 5BRTA 4GR1A 2C3DA 2X50A 3CNPA 3GYJA 1E39A 4H4TA 1M64A 1NAAA 2GF3A 3UKHA 3V76A 2ZZCA 2YLWA 3K30A 5KVIA 4J36A 5JCLA 1PBFA 4XWRA 2ZZBA 1QO8A 1DJNA 2IIDA 1K0LA 1KFYA 2X8GA 3ABVA 3DA1A 4O5QA 3NRNA 4BK3A 1KDGA 4NTCA 4Y4LA 1TDKA 2GR1A 3QSSA 4DGKA 4XWZA 4NZHA 1E1MA 2FJBA 4LA1A 4K8DA 1QLBA 3LADA 1JNZA 3UTEA 5CQFA 3ZYXA 2GQFA 5J7XA 4M52A 3CN8A 4LIIA 5C3JA 4U2LA 2TPRA 4JY2A 3DMEA 3UKKA 1E1NA 2YQUA 3M13A 4NTDA 4EQXA 1FEAA 4AOXA 3CMMA 1E7PA 4OPIA 2YG5A 2X3NA 2JK6A 4GAVA 4EQWA 3CPHG 3CNTA 3C4NA 2BYBA 2CFYA 2BK3A 4FK1A 1IUSA 4CNJA 1P2EA 2YR5A 3O0HA 2JAEA 1DNCA 1TDOA 2VOUA 3DH9A 1LVLA 3HYVA 4J2WA 1L0VA 3UP4A 1TDNA 2UZZA 3CGEA 1E1KA 4H4XA 1GRBA 4RG3A 3G5RA 4TM3A 4X9MA 5KXJA 2BRAA 4X4JA 1N1PA 2WU5A 3GYIA 4U8KA 2R9ZA 3DJDA 4H4VA 1P2HA 3SZCA 2ZBWA 4Z2TA 2JKCA 4B1BA 4Z2RA 4YT0A 3NTDA 4Y4MA 1GETA 2OALA 4H4UA 3AE1A 3GRTA 3P4QA 2WU2A 3ICRA 1M6IA 1ZDLA 4Z24A 1AOGA 3AD8B 4JNQA 5KMRA 1FEBA 2ACZA 2CVJA 1N4VA 3QVPA 4NTEA 3UKAA 4XXGA 3NTAA 1MOKA 3UTGA 5L46A 4CRTA 1KNRA 2PYXA 2YLZA 4ZN0A 1V59A 5DBJA 4LU6A 2IVDA 3R9UA 4GRTA 3WE0A 2YVGA 3CTYA 3VRAA 2GH5A 2WESA 2X8CA 4U8PA 5IQ1A 1CC6A 2C64A 4G6GA 4J33A 1XANA 4A6NB 2XFPA 2ZZ0A 3D1CA 4U8IA 4BK2A 2C67A 4BURA 3IF9A 2XVHA 2YVFA 2YM2A 1RP0A 1EBDA 1XDIA 4HB9A 5M0ZA 1D4CA 3GWFA 4G73A 4N9XA 1NPXA 1VG9A 1MO9A 2BCPA 2R0CA 2YAUA 5J60A 3ITJA 1ZOYA 3GMCA 3KPFA 3LOVA 2WHDA 2R0GA 1GTEA 2YLXA 3UTHA 2WOWA 4TLZA 2BACA 2WETA 4C77A 5CKUA 4JN9A 3AECA 2BA9A 4U8NA 1Q9IA 3KPKA 4NEWA 2GQWA 3RNMA 2V60A 4YTNA 2EQ8A 2GRTA 4EQSA 2WOIA 1NENA 1JEHA 4DNAA 3CPIG 2VVMA 3P9UA 1GEUA 1YQZA 2WP9A 4CNKA 4AP1A 2YG7A 2BXRA 4JY3A 4ZCCA 2YG4A 1PJ7A 3UTFA 1FL2A 3DJGX 4Z25A 3GWDA 3AD9B 3IWAA 4NWZA 4U8LA 4D03A 3EANA 1ZKQA 2CDUA 2E5VA 3QFAA 3VR9A 4CY6A 3DK4A 1FOHA 2BRYA 2VQ7A 1E1LA 4I58A 4H2NA 1ZY8A 3SZFA 3UOVA 2X8HA 3GYXA 3DJEA 3Q9TA 3URHA 1NHRA 1VDCA 3AYIA 3SFDA 4B66A 2GB0A 2B9XA 2GV8A 4H2PA 4A9WA 1KF6A 2XLUA 4JQ9A 3AEBA 1CJ2A 1Q1RA 1VRQB 4YTPA 3VRDB 1PXAA 2ARDA 2QA1A 1D7LA 4G6HA 2O9ZA 1LQUA 3I3LA 5M10A 3AYLA 4C3YA 2XFQA 1XHCA 3GDPA 1ZK7A 2WDRA 1F8SA 5EB5A 5KMSA 4PABA 1B5QA 3OZ2A 4YXDA 2XYOA 3F8PA 1H83A 4TM1A 5TR3A 4YSXA 4H4WA 4H2RA 3RP8A 1Z6LA 1GRFA 2YLRA 2BABA 4H4ZA 3OC4A 4B63A 5KNLA 3QFBA 4B65A 4EMJA 3DK8A 3K7QX 3BNUA 4C3XA 4IV9A 2WQYA 3T31A 4YSZA 3CGCA 2RGJA 1O5WA 3UOYA 4YKGA 2H89A 2WBAA 1PHHA 3BI2A 3CNDA 1BGJA 4CBQA 1XPQA 3BI4A 3ICSA 1W4XA 4G9KA 1PJ6A 2GMHA 2GMJA 1VG0A 2NVKX 2AAQA 4IA6A 3AE9A 2GR2A 1KNPA 1S3EA 1VQWA 1KSUA 3ALMA 2VZ2A 1REOA 2BCGG 2YLTA 3GDNA 3ICTA 3SM8A 3SXIA 3T2ZA 5JCIA 1X31B 3JSKA 1EL7A 2GR0A 1H7XA 3CIRA 1LTXR 1IJHA 1D7YA 4H4QA 4YKFA 1Y0PA 2EQ6A 3QSEA 2C76A 3HZLA 4II3A 2XLRA 1TYPA 1B37A 2FJDA 2QAEA 5JCMA 1JRXA 4DSGA 2A89A 1JRYA 3GRSA 4B64A 1CJ3A 3PS9A 2A8XA 1GOSA 1CF3A 1TRBA 3B3RA 3VR8A 1BWCA 1GXFA 4EMIA 5KMQA 3FPZA 2YR6A 3IC9A 1JU2A 4BJYA 1GERA 3ZDNA 4EIPA 4APNA 1B8SA 1F8RA 2Q0LA 5BULA 3S61A 4AT0A 3AEDA 1JOAA 2EQ7A 2RGOA 2TMDA 3HYWA 2YG3A 1CC4A 5FS9A 2Q0KA 3Q6JA 3SFEA 4CY8A 1EL8A 1CHUA 1Y56A 3KU9A 3AEAA 1ZOVA 3NG7X 1PN0A 3H8LA 1H86A 4FX9A 5KVHA 1CBOA 1LQTA 4EM4A 1FCDA 2VVLA 1IUUA 3BHKA 4FDCB 1GRAA 2OAMA 2V3AA 4H50A 4REKA 4U8MA 1KSSA 2GR3A 1JNRA 3P4SA 1LV0A 5IQ4A 4H4PA 1PBCA 4A65A 2E1MA 1F6MA 2JB3A 2XLSA 3PVCA 4UDRA 3SQPA 3EF6A 3ATRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NT6 A;  2FBW A;  3C4A A;  1EL9 A;  1IUV A;  1DOC A;  4H7U A;  2V3B A;  3NH3 X;  5U63 A;  3V3O A;  4H4S A;  5IPY A;  1JRZ A;  4UP3 A;  2B9Y A;  2E4G A;  1PBE A;  2HQM A;  1YQ4 A;  2YLS A;  3AE4 A;  5U1O A;  1F3P A;  2OA1 A;  1DOE A;  2JB2 A;  1GRT A;  3ADA B;  5KOX A;  5HY5 A;  2DKH A;  3AE6 A;  3NKS A;  2WEU A;  3AE8 A;  1OJC A;  4GDE A;  4U8J A;  1OJT A;  3ALL A;  3NHO X;  4YSH A;  3UKQ A;  1GRE A;  2W0H A;  4GF7 A;  1GTH A;  1LJ1 A;  2R46 A;  1E6E A;  2NPX A;  3II4 A;  1PDH A;  3F8D A;  3DGZ A;  3NGC X;  3K7T A;  4EM3 A;  2XFO A;  2IVE A;  1H6V A;  2BK5 A;  1ZMD A;  3F8R A;  5FS7 A;  4USR A;  3UKP A;  1DJQ A;  4MJW A;  4U2S A;  3NYF A;  4KX6 A;  2WDQ A;  2R4E A;  4OPU A;  2GAG B;  2B7S A;  3KD9 A;  2XCG A;  1TYT A;  3KA7 A;  3NIX A;  4KPR A;  4Y4N A;  3GMB A;  4J56 A;  3NYC A;  1IUW A;  3NK0 X;  2C3C A;  5U25 A;  4BUR A;  2Q7V A;  1EL5 A;  3BI5 A;  5FS6 A;  1PBB A;  4WCT A;  4U2T A;  4YSY A;  4A7A A;  1L9C A;  2Y6Q A;  3BHF A;  2BK4 A;  3AWI A;  4ZCD A;  2V61 A;  4C5O A;  4USQ A;  1GAL A;  2GAH B;  3L8K A;  4RSL A;  1NDA A;  2BXS A;  3AB1 A;  1RYI A;  3LZW A;  1Q1W A;  1S2Y A;  2B9W A;  3E1T A;  4GUV A;  3RED A;  4C74 A;  2C65 A;  3LXD A;  3NN0 X;  1D4D A;  2C75 A;  1FEC A;  2VRM A;  1F8W A;  1DOB A;  3SGL A;  1ZX9 A;  4B69 A;  4B68 A;  1PJ5 A;  1PBD A;  3QJ4 A;  2EQ9 A;  4A6N A;  3GSI A;  2JB1 A;  1O94 A;  1SEZ A;  1ZMC A;  3EAO A;  3EPT A;  1NHQ A;  4IVM B;  3CPJ G;  1NEK A;  2AQJ A;  3CGB A;  2C7G A;  2Q6U A;  4H2Q A;  3H8I A;  1HYU A;  2RAB A;  1COY A;  4YTM A;  3I6D A;  4GCM A;  2WDV A;  2WS3 A;  3FBS A;  3ISH A;  4JDR A;  2XLT A;  3AD7 B;  3ALJ A;  4X9N A;  1CJ4 A;  1K0J A;  5EB4 A;  1L9E A;  3LZX A;  1N4W A;  2R0P A;  4O5U A;  1QJD A;  1ZP0 A;  3IHM A;  2FJA A;  1D5T A;  4OPT A;  2WPF A;  4H4R A;  3B6D A;  1BZL A;  1RSG A;  2VQB A;  3AXB A;  1YQ3 A;  1GES A;  2WOV A;  3S5W A;  1DOD A;  4U8O A;  1GPE A;  2F5Z A;  4TM4 A;  2XFN A;  4A79 A;  3BNM A;  2J3N A;  2R4J A;  1ONF A;  4A99 A;  3C96 A;  2BC0 A;  1BKW A;  4K7Z A;  1YKJ A;  4B67 A;  2C72 A;  4Z44 A;  3AEE A;  4RG4 A;  4I59 A;  4OPG A;  4P9S A;  3DGH A;  4ECH A;  4D04 A;  4JNA A;  3K7M X;  3UKL A;  5HYM A;  3G5Q A;  3GD3 A;  2YWL A;  3FMW A;  2BC1 A;  2JBV A;  3CNJ A;  3UCL A;  4OCG A;  1H81 A;  3UKF A;  4K5R A;  5JCK A;  1TDF A;  1IUT A;  2YM1 A;  2XVE A;  3PO7 A;  4BV6 A;  2GVC A;  3AE5 A;  3P4R A;  4PAA A;  4DSH A;  1H7W A;  3UOZ A;  1ELI A;  2B7R A;  5GSN A;  4J57 A;  2C73 A;  4AP3 A;  4E0V A;  2YVJ A;  3NNE A;  1YY5 A;  2XDO A;  1K4Q A;  2I0Z A;  4K2X A;  5BUK A;  5KRQ A;  4WX1 A;  3P4P A;  3RP6 A;  1BF3 A;  3AEF A;  1BGN A;  2XVF A;  3UP5 A;  4Z26 A;  3V3N A;  2FJE A;  3D8X A;  1LPF A;  1OJ9 A;  2VRL A;  3RHA A;  2WPC A;  2V6O A;  2A87 A;  2Z5X A;  3NLC A;  5C2T A;  3NYE A;  4ICY A;  2WP6 A;  5JCN A;  1S2Q A;  4BK1 A;  5FS8 A;  3FIM B;  1GRH A;  1MXT A;  2Z5Y A;  3CNS A;  3ATQ A;  3KKJ A;  4UDP A;  3DJJ A;  1OJA A;  2X99 A;  1PXC A;  1PS9 A;  1IUX A;  3KVE A;  4AOS A;  5BVA A;  2RGH A;  1NG4 A;  3NK2 X;  3M12 A;  4J34 A;  1CL0 A;  2BS3 A;  3LB8 A;  3AE2 A;  2C66 A;  2XFU A;  1DXL A;  1GSN A;  2B76 A;  2V5Z A;  2YR4 A;  4GDP A;  4HA6 A;  3QVR A;  5HHF A;  4EIQ A;  2BS2 A;  2DKI A;  1H82 A;  1CJC A;  3UOX A;  5EBK A;  4EQR A;  4OVI A;  4UDQ A;  4TM0 A;  4BJZ A;  2H88 A;  1S3B A;  1OJD A;  5HXI A;  4H4Y A;  3VQR A;  2OLO A;  3NK1 X;  5KOW A;  4K5S A;  4Z43 A;  4FK1 C;  2APG A;  2GEW A;  1GT8 A;  3RP7 A;  1CC2 A;  1O95 A;  1B4V A;  5EOW A;  1K0I A;  3LJP A;  3KLJ A;  5ER0 A;  1NHS A;  5GRT A;  3QSM A;  2QCU A;  3VRB A;  3NN6 X;  2XVJ A;  3COX A;  4K22 A;  2R45 A;  4OPC A;  1H84 A;  3L1R A;  4TLX A;  1NG3 A;  2YG6 A;  4J31 A;  4AT2 A;  1PXB A;  3AE3 A;  3GD4 A;  1GV4 A;  3DK9 A;  2BS4 A;  2QA2 A;  3AEG A;  1L9D A;  4OPL A;  3H4K A;  2PHH A;  3P1W A;  5KWF A;  4IA5 A;  2OLN A;  3AE7 A;  3G5S A;  4EMW A;  1NHP A;  1TDE A;  2CUL A;  1N4U A;  4ADW A;  3T37 A;  3M0O A;  3FG2 P;  5FMH A;  4Z2U A;  4IVO B;  2Y6R A;  4CCR A;  4A5L A;  3CGD A;  2VVL G;  1GND A;  5LV9 A;  2C70 A;  1GRG A;  2WPE A;  3IHG A;  2WP5 A;  4NEV A;  4OPD A;  2XLP A;  2XVI A;  1UKV G;  3AYJ A;  4CCQ A;  1Y56 B;  2AR8 A;  1D4E A;  4YWO A;  5BRT A;  4GR1 A;  2C3D A;  2X50 A;  3CNP A;  3GYJ A;  1E39 A;  4H4T A;  1M64 A;  1NAA A;  2GF3 A;  3UKH A;  3V76 A;  2ZZC A;  2YLW A;  3K30 A;  5KVI A;  4J36 A;  5JCL A;  1PBF A;  4XWR A;  2ZZB A;  1QO8 A;  1DJN A;  2IID A;  1K0L A;  1KFY A;  2X8G A;  3ABV A;  3DA1 A;  4O5Q A;  3NRN A;  4BK3 A;  1KDG A;  4NTC A;  4Y4L A;  1TDK A;  2GR1 A;  3QSS A;  4DGK A;  4XWZ A;  4NZH A;  1E1M A;  2FJB A;  4LA1 A;  4K8D A;  1QLB A;  3LAD A;  1JNZ A;  3UTE A;  5CQF A;  3ZYX A;  2GQF A;  5J7X A;  4M52 A;  3CN8 A;  4LII A;  5C3J A;  4U2L A;  2TPR A;  4JY2 A;  3DME A;  3UKK A;  1E1N A;  2YQU A;  3M13 A;  4NTD A;  4EQX A;  1FEA A;  4AOX A;  1E7P A;  4OPI A;  2YG5 A;  2X3N A;  2JK6 A;  4EQW A;  3CPH G;  3CNT A;  3C4N A;  2BYB A;  2CFY A;  2BK3 A;  4FK1 A;  1IUS A;  4CNJ A;  1P2E A;  2YR5 A;  3O0H A;  2JAE A;  1DNC A;  1TDO A;  2VOU A;  3DH9 A;  1LVL A;  4J2W A;  1L0V A;  3UP4 A;  1TDN A;  2UZZ A;  3CGE A;  1E1K A;  4H4X A;  1GRB A;  4RG3 A;  3G5R A;  4TM3 A;  4X9M A;  5KXJ A;  4X4J A;  1N1P A;  2WU5 A;  3GYI A;  4U8K A;  2R9Z A;  3DJD A;  4H4V A;  1P2H A;  2ZBW A;  4Z2T A;  2JKC A;  4B1B A;  4Z2R A;  4YT0 A;  3NTD A;  4Y4M A;  1GET A;  2OAL A;  4H4U A;  3AE1 A;  3GRT A;  3P4Q A;  2WU2 A;  3ICR A;  1M6I A;  1ZDL A;  4Z24 A;  1AOG A;  3AD8 B;  4JNQ A;  1FEB A;  2ACZ A;  2CVJ A;  1N4V A;  3QVP A;  4NTE A;  3UKA A;  4XXG A;  3NTA A;  1MOK A;  3UTG A;  5L46 A;  4CRT A;  1KNR A;  2PYX A;  2YLZ A;  4ZN0 A;  1V59 A;  5DBJ A;  4LU6 A;  2IVD A;  3R9U A;  4GRT A;  3WE0 A;  2YVG A;  3CTY A;  3VRA A;  2GH5 A;  2WES A;  2X8C A;  4U8P A;  5IQ1 A;  1CC6 A;  2C64 A;  4J33 A;  1XAN A;  4A6N B;  2XFP A;  2ZZ0 A;  3D1C A;  4U8I A;  4BK2 A;  2C67 A;  3IF9 A;  2XVH A;  2YVF A;  2YM2 A;  1RP0 A;  1EBD A;  1XDI A;  4HB9 A;  5M0Z A;  1D4C A;  3GWF A;  4N9X A;  1NPX A;  1VG9 A;  1MO9 A;  2BCP A;  2R0C A;  2YAU A;  5J60 A;  3ITJ A;  1ZOY A;  3GMC A;  3KPF A;  3LOV A;  2WHD A;  2R0G A;  1GTE A;  2YLX A;  3UTH A;  2WOW A;  4TLZ A;  2BAC A;  2WET A;  4C77 A;  5CKU A;  4JN9 A;  3AEC A;  2BA9 A;  4U8N A;  1Q9I A;  4NEW A;  2GQW A;  3RNM A;  2V60 A;  4YTN A;  2EQ8 A;  2GRT A;  4EQS A;  2WOI A;  1NEN A;  1JEH A;  4DNA A;  3CPI G;  2VVM A;  3P9U A;  1GEU A;  1YQZ A;  2WP9 A;  4CNK A;  4AP1 A;  2YG7 A;  2BXR A;  4JY3 A;  4ZCC A;  2YG4 A;  1PJ7 A;  3UTF A;  1FL2 A;  3DJG X;  4Z25 A;  3GWD A;  3AD9 B;  3IWA A;  4U8L A;  4D03 A;  3EAN A;  1ZKQ A;  2CDU A;  2E5V A;  3QFA A;  3VR9 A;  4CY6 A;  3DK4 A;  1FOH A;  3UOV A;  2VQ7 A;  1E1L A;  4I58 A;  4H2N A;  1ZY8 A;  2X8H A;  3Q9T A;  3DJE A;  3URH A;  1NHR A;  1VDC A;  3AYI A;  3SFD A;  4B66 A;  2GB0 A;  2B9X A;  2GV8 A;  4H2P A;  4A9W A;  1KF6 A;  2XLU A;  4JQ9 A;  3AEB A;  1CJ2 A;  1Q1R A;  1VRQ B;  4YTP A;  3VRD B;  1PXA A;  2ARD A;  2QA1 A;  1D7L A;  2O9Z A;  1LQU A;  3I3L A;  5M10 A;  3AYL A;  4C3Y A;  2XFQ A;  1XHC A;  3GDP A;  1ZK7 A;  2WDR A;  1F8S A;  5EB5 A;  4PAB A;  1B5Q A;  3OZ2 A;  4YXD A;  2XYO A;  3F8P A;  1H83 A;  4TM1 A;  5TR3 A;  4YSX A;  4H4W A;  4H2R A;  3RP8 A;  1Z6L A;  1GRF A;  2YLR A;  2BAB A;  4H4Z A;  3OC4 A;  4B63 A;  3QFB A;  4B65 A;  4EMJ A;  3DK8 A;  3K7Q X;  3BNU A;  4C3X A;  4IV9 A;  2WQY A;  4YSZ A;  3CGC A;  2RGJ A;  1O5W A;  3UOY A;  4YKG A;  2H89 A;  2WBA A;  1PHH A;  3BI2 A;  3CND A;  1BGJ A;  4CBQ A;  1XPQ A;  3BI4 A;  3ICS A;  1W4X A;  1PJ6 A;  2GMH A;  2GMJ A;  1VG0 A;  2NVK X;  2AAQ A;  4IA6 A;  3AE9 A;  2GR2 A;  1KNP A;  1S3E A;  1VQW A;  1KSU A;  3ALM A;  2VZ2 A;  1REO A;  2BCG G;  2YLT A;  3GDN A;  3ICT A;  3SM8 A;  5JCI A;  1X31 B;  3JSK A;  1EL7 A;  2GR0 A;  1H7X A;  3CIR A;  1LTX R;  1IJH A;  1D7Y A;  4H4Q A;  4YKF A;  1Y0P A;  2EQ6 A;  3QSE A;  2C76 A;  3HZL A;  2XLR A;  1TYP A;  1B37 A;  2FJD A;  2QAE A;  5JCM A;  1JRX A;  4DSG A;  2A89 A;  1JRY A;  3GRS A;  4B64 A;  1CJ3 A;  3PS9 A;  2A8X A;  1GOS A;  1CF3 A;  1TRB A;  3B3R A;  3VR8 A;  1BWC A;  1GXF A;  4EMI A;  3FPZ A;  2YR6 A;  3IC9 A;  1JU2 A;  4BJY A;  1GER A;  3ZDN A;  4EIP A;  4APN A;  1B8S A;  1F8R A;  2Q0L A;  5BUL A;  3S61 A;  4AT0 A;  3AED A;  1JOA A;  2EQ7 A;  2RGO A;  2TMD A;  5FS9 A;  2YG3 A;  1CC4 A;  2Q0K A;  3Q6J A;  3SFE A;  4CY8 A;  1EL8 A;  1CHU A;  1Y56 A;  3KU9 A;  3AEA A;  1ZOV A;  3NG7 X;  1PN0 A;  3H8L A;  1H86 A;  4FX9 A;  5KVH A;  1CBO A;  1LQT A;  4EM4 A;  1FCD A;  2VVL A;  1IUU A;  3BHK A;  4FDC B;  1GRA A;  2OAM A;  2V3A A;  4H50 A;  4REK A;  4U8M A;  1KSS A;  2GR3 A;  1JNR A;  3P4S A;  1LV0 A;  5IQ4 A;  4H4P A;  1PBC A;  4A65 A;  2E1M A;  1F6M A;  2JB3 A;  2XLS A;  3PVC A;  4UDR A;  3SQP A;  3EF6 A;  3ATR A; 
#chains in the Genus database with same CATH topology
 3NT6 A;  2FBW A;  3C4A A;  1EL9 A;  1IUV A;  1DOC A;  4H7U A;  2V3B A;  3NH3 X;  5U63 A;  3V3O A;  4H4S A;  5IPY A;  1JRZ A;  4UP3 A;  2B9Y A;  2E4G A;  1PBE A;  2HQM A;  1YQ4 A;  2YLS A;  3AE4 A;  5U1O A;  1F3P A;  2OA1 A;  1DOE A;  2JB2 A;  1GRT A;  3ADA B;  5KOX A;  5HY5 A;  2DKH A;  3AE6 A;  3NKS A;  2WEU A;  3AE8 A;  1OJC A;  4GDE A;  4U8J A;  1OJT A;  3ALL A;  3NHO X;  4YSH A;  3UKQ A;  1GRE A;  2W0H A;  4GF7 A;  1GTH A;  1LJ1 A;  2R46 A;  1E6E A;  2NPX A;  3II4 A;  1PDH A;  3F8D A;  3DGZ A;  3NGC X;  3K7T A;  4NNJ A;  4EM3 A;  2XFO A;  2IVE A;  3T0K A;  1H6V A;  2BK5 A;  1ZMD A;  3F8R A;  5FS7 A;  4USR A;  3T2Y A;  3UKP A;  1DJQ A;  4MJW A;  4U2S A;  3NYF A;  4KX6 A;  2WDQ A;  2R4E A;  4OPU A;  2GAG B;  2B7S A;  3KD9 A;  2XCG A;  1TYT A;  3KA7 A;  3NIX A;  4KPR A;  4Y4N A;  3GMB A;  4J56 A;  3NYC A;  1IUW A;  3NK0 X;  2C3C A;  5U25 A;  3SY4 A;  2Q7V A;  1EL5 A;  3BI5 A;  5FS6 A;  1PBB A;  4WCT A;  4U2T A;  4YSY A;  4A7A A;  1L9C A;  2Y6Q A;  3BHF A;  2BK4 A;  3AWI A;  4ZCD A;  2V61 A;  4C5O A;  4USQ A;  1GAL A;  2GAH B;  3L8K A;  4RSL A;  1NDA A;  2BXS A;  3AB1 A;  1RYI A;  3LZW A;  2B9W A;  1S2Y A;  1Q1W A;  3E1T A;  4GUV A;  3RED A;  4C74 A;  2C65 A;  3LXD A;  3NN0 X;  1D4D A;  2C75 A;  3T2K A;  1FEC A;  2VRM A;  1F8W A;  1DOB A;  3SGL A;  1ZX9 A;  4B69 A;  4B68 A;  1PJ5 A;  1PBD A;  3QJ4 A;  2EQ9 A;  4A6N A;  3GSI A;  2JB1 A;  1O94 A;  1SEZ A;  1ZMC A;  3EAO A;  3EPT A;  1NHQ A;  4IVM B;  3CPJ G;  1NEK A;  2AQJ A;  3CGB A;  2C7G A;  2Q6U A;  4H2Q A;  3H8I A;  1HYU A;  2RAB A;  1COY A;  4YTM A;  3I6D A;  4GCM A;  2WDV A;  2WS3 A;  3FBS A;  3ISH A;  4JDR A;  2XLT A;  3AD7 B;  3ALJ A;  4X9N A;  1CJ4 A;  1K0J A;  5EB4 A;  1L9E A;  3LZX A;  1N4W A;  2R0P A;  4O5U A;  1QJD A;  1ZP0 A;  3IHM A;  2FJA A;  1D5T A;  4OPT A;  2WPF A;  4H4R A;  3B6D A;  1BZL A;  1RSG A;  2VQB A;  3AXB A;  1YQ3 A;  1GES A;  2WOV A;  3S5W A;  1DOD A;  4U8O A;  1GPE A;  2F5Z A;  4TM4 A;  2XFN A;  4A79 A;  3BNM A;  2J3N A;  2R4J A;  1ONF A;  4A99 A;  3C96 A;  2BC0 A;  1BKW A;  4GAP A;  4K7Z A;  1YKJ A;  4B67 A;  2C72 A;  4Z44 A;  3AEE A;  4RG4 A;  4I59 A;  4OPG A;  3SX6 A;  4P9S A;  3DGH A;  4ECH A;  4D04 A;  4JNA A;  3K7M X;  3UKL A;  5HYM A;  3G5Q A;  3GD3 A;  2YWL A;  3FMW A;  2BC1 A;  2JBV A;  3CNJ A;  3UCL A;  4OCG A;  1H81 A;  3UKF A;  4K5R A;  5JCK A;  1TDF A;  1IUT A;  2YM1 A;  2XVE A;  3PO7 A;  4BV6 A;  2GVC A;  3AE5 A;  3P4R A;  4PAA A;  4DSH A;  1H7W A;  3UOZ A;  1ELI A;  2B7R A;  5GSN A;  4J57 A;  2C73 A;  4AP3 A;  4E0V A;  2YVJ A;  3NNE A;  1YY5 A;  2XDO A;  1K4Q A;  2I0Z A;  4K2X A;  5BUK A;  5KRQ A;  4WX1 A;  3P4P A;  3RP6 A;  1BF3 A;  3AEF A;  1BGN A;  2XVF A;  3UP5 A;  4G74 A;  3V3N A;  2FJE A;  3D8X A;  1LPF A;  4Z26 A;  1OJ9 A;  2VRL A;  3RHA A;  2WPC A;  2V6O A;  2A87 A;  2Z5X A;  3NLC A;  5C2T A;  3HYX A;  3NYE A;  4ICY A;  2WP6 A;  5JCN A;  1S2Q A;  4BK1 A;  5FS8 A;  3FIM B;  1GRH A;  1MXT A;  2Z5Y A;  3CNS A;  3ATQ A;  3KKJ A;  4UDP A;  3DJJ A;  1OJA A;  2X99 A;  1PXC A;  1PS9 A;  1IUX A;  3KVE A;  4AOS A;  5BVA A;  2RGH A;  1NG4 A;  3NK2 X;  3M12 A;  4J34 A;  1CL0 A;  2BS3 A;  3LB8 A;  3AE2 A;  2C66 A;  5KMP A;  2XFU A;  1DXL A;  1GSN A;  2B76 A;  2V5Z A;  2YR4 A;  4GDP A;  4HA6 A;  3QVR A;  5HHF A;  4EIQ A;  2BS2 A;  2DKI A;  1H82 A;  1CJC A;  3UOX A;  2C4C A;  5EBK A;  4EQR A;  4OVI A;  4UDQ A;  4TM0 A;  4BJZ A;  2H88 A;  1S3B A;  1OJD A;  5HXI A;  4H4Y A;  3VQR A;  2OLO A;  3NK1 X;  5KOW A;  4K5S A;  4Z43 A;  4FK1 C;  2APG A;  2GEW A;  1GT8 A;  3RP7 A;  3SZW A;  1CC2 A;  1O95 A;  1B4V A;  5EOW A;  1K0I A;  3LJP A;  3SYI A;  3KLJ A;  5ER0 A;  1NHS A;  5GRT A;  3SZ0 A;  3QSM A;  2QCU A;  3VRB A;  3NN6 X;  2XVJ A;  3COX A;  4K22 A;  2R45 A;  4II2 A;  1H84 A;  3L1R A;  4OPC A;  4TLX A;  1NG3 A;  2YG6 A;  4J31 A;  4AT2 A;  1PXB A;  3AE3 A;  3GD4 A;  1GV4 A;  3DK9 A;  2BS4 A;  2QA2 A;  3AEG A;  1L9D A;  4OPL A;  3H4K A;  2PHH A;  3P1W A;  5KWF A;  3T14 A;  4IA5 A;  2OLN A;  3AE7 A;  3G5S A;  4EMW A;  1NHP A;  1TDE A;  2CUL A;  1N4U A;  4ADW A;  3T37 A;  3M0O A;  3FG2 P;  5FMH A;  4Z2U A;  4IVO B;  2Y6R A;  4CCR A;  4A5L A;  3CGD A;  2VVL G;  1GND A;  5LV9 A;  2C70 A;  1GRG A;  2WPE A;  3IHG A;  2WP5 A;  4NEV A;  4OPD A;  2XLP A;  2XVI A;  1UKV G;  3AYJ A;  4CCQ A;  1Y56 B;  2AR8 A;  1D4E A;  4YWO A;  5BRT A;  4GR1 A;  2C3D A;  2X50 A;  3CNP A;  3GYJ A;  1E39 A;  4H4T A;  1M64 A;  1NAA A;  2GF3 A;  3UKH A;  3V76 A;  2ZZC A;  2YLW A;  3K30 A;  5KVI A;  4J36 A;  5JCL A;  1PBF A;  4XWR A;  2ZZB A;  1QO8 A;  1DJN A;  2IID A;  1K0L A;  1KFY A;  2X8G A;  3ABV A;  3DA1 A;  4O5Q A;  3NRN A;  4BK3 A;  1KDG A;  4NTC A;  4Y4L A;  1TDK A;  2GR1 A;  3QSS A;  4DGK A;  4XWZ A;  4NZH A;  1E1M A;  2FJB A;  4LA1 A;  4K8D A;  1QLB A;  3LAD A;  1JNZ A;  3UTE A;  5CQF A;  3ZYX A;  2GQF A;  5J7X A;  4M52 A;  3CN8 A;  4LII A;  5C3J A;  4U2L A;  2TPR A;  4JY2 A;  3DME A;  3UKK A;  1E1N A;  2YQU A;  3M13 A;  4NTD A;  4EQX A;  1FEA A;  4AOX A;  3CMM A;  1E7P A;  4OPI A;  2YG5 A;  2X3N A;  2JK6 A;  4GAV A;  4EQW A;  3CPH G;  3CNT A;  3C4N A;  2BYB A;  2CFY A;  2BK3 A;  4FK1 A;  1IUS A;  4CNJ A;  1P2E A;  2YR5 A;  3O0H A;  2JAE A;  1DNC A;  1TDO A;  2VOU A;  3DH9 A;  1LVL A;  3HYV A;  4J2W A;  1L0V A;  3UP4 A;  1TDN A;  2UZZ A;  3CGE A;  1E1K A;  4H4X A;  1GRB A;  4RG3 A;  3G5R A;  4TM3 A;  4X9M A;  5KXJ A;  2BRA A;  4X4J A;  1N1P A;  2WU5 A;  3GYI A;  4U8K A;  2R9Z A;  3DJD A;  4H4V A;  1P2H A;  3SZC A;  2ZBW A;  4Z2T A;  2JKC A;  4B1B A;  4Z2R A;  4YT0 A;  3NTD A;  4Y4M A;  1GET A;  2OAL A;  4H4U A;  3AE1 A;  3GRT A;  3P4Q A;  2WU2 A;  3ICR A;  1M6I A;  1ZDL A;  4Z24 A;  1AOG A;  3AD8 B;  4JNQ A;  5KMR A;  1FEB A;  2ACZ A;  2CVJ A;  1N4V A;  3QVP A;  4NTE A;  3UKA A;  4XXG A;  3NTA A;  1MOK A;  3UTG A;  5L46 A;  4CRT A;  1KNR A;  2PYX A;  2YLZ A;  4ZN0 A;  1V59 A;  5DBJ A;  4LU6 A;  2IVD A;  3R9U A;  4GRT A;  3WE0 A;  2YVG A;  3CTY A;  3VRA A;  2GH5 A;  2WES A;  2X8C A;  4U8P A;  5IQ1 A;  1CC6 A;  2C64 A;  4G6G A;  4J33 A;  1XAN A;  4A6N B;  2XFP A;  2ZZ0 A;  3D1C A;  4U8I A;  4BK2 A;  2C67 A;  4BUR A;  3IF9 A;  2XVH A;  2YVF A;  2YM2 A;  1RP0 A;  1EBD A;  1XDI A;  4HB9 A;  5M0Z A;  1D4C A;  3GWF A;  4G73 A;  4N9X A;  1NPX A;  1VG9 A;  1MO9 A;  2BCP A;  2R0C A;  2YAU A;  5J60 A;  3ITJ A;  1ZOY A;  3GMC A;  3KPF A;  3LOV A;  2WHD A;  2R0G A;  1GTE A;  2YLX A;  3UTH A;  2WOW A;  4TLZ A;  2BAC A;  2WET A;  4C77 A;  5CKU A;  4JN9 A;  3AEC A;  2BA9 A;  4U8N A;  1Q9I A;  3KPK A;  4NEW A;  2GQW A;  3RNM A;  2V60 A;  4YTN A;  2EQ8 A;  2GRT A;  4EQS A;  2WOI A;  1NEN A;  1JEH A;  4DNA A;  3CPI G;  2VVM A;  3P9U A;  1GEU A;  1YQZ A;  2WP9 A;  4CNK A;  4AP1 A;  2YG7 A;  2BXR A;  4JY3 A;  4ZCC A;  2YG4 A;  1PJ7 A;  3UTF A;  1FL2 A;  3DJG X;  4Z25 A;  3GWD A;  3AD9 B;  3IWA A;  4NWZ A;  4U8L A;  4D03 A;  3EAN A;  1ZKQ A;  2CDU A;  2E5V A;  3QFA A;  3VR9 A;  4CY6 A;  3DK4 A;  1FOH A;  2BRY A;  2VQ7 A;  1E1L A;  4I58 A;  4H2N A;  1ZY8 A;  3SZF A;  3UOV A;  2X8H A;  3GYX A;  3DJE A;  3Q9T A;  3URH A;  1NHR A;  1VDC A;  3AYI A;  3SFD A;  4B66 A;  2GB0 A;  2B9X A;  2GV8 A;  4H2P A;  4A9W A;  1KF6 A;  2XLU A;  4JQ9 A;  3AEB A;  1CJ2 A;  1Q1R A;  1VRQ B;  4YTP A;  3VRD B;  1PXA A;  2ARD A;  2QA1 A;  1D7L A;  4G6H A;  2O9Z A;  1LQU A;  3I3L A;  5M10 A;  3AYL A;  4C3Y A;  2XFQ A;  1XHC A;  3GDP A;  1ZK7 A;  2WDR A;  1F8S A;  5EB5 A;  5KMS A;  4PAB A;  1B5Q A;  3OZ2 A;  4YXD A;  2XYO A;  3F8P A;  1H83 A;  4TM1 A;  5TR3 A;  4YSX A;  4H4W A;  4H2R A;  3RP8 A;  1Z6L A;  1GRF A;  2YLR A;  2BAB A;  4H4Z A;  3OC4 A;  4B63 A;  5KNL A;  3QFB A;  4B65 A;  4EMJ A;  3DK8 A;  3K7Q X;  3BNU A;  4C3X A;  4IV9 A;  2WQY A;  3T31 A;  4YSZ A;  3CGC A;  2RGJ A;  1O5W A;  3UOY A;  4YKG A;  2H89 A;  2WBA A;  1PHH A;  3BI2 A;  3CND A;  1BGJ A;  4CBQ A;  1XPQ A;  3BI4 A;  3ICS A;  1W4X A;  4G9K A;  1PJ6 A;  2GMH A;  2GMJ A;  1VG0 A;  2NVK X;  2AAQ A;  4IA6 A;  3AE9 A;  2GR2 A;  1KNP A;  1S3E A;  1VQW A;  1KSU A;  3ALM A;  2VZ2 A;  1REO A;  2BCG G;  2YLT A;  3GDN A;  3ICT A;  3SM8 A;  3SXI A;  3T2Z A;  5JCI A;  1X31 B;  3JSK A;  1EL7 A;  2GR0 A;  1H7X A;  3CIR A;  1LTX R;  1IJH A;  1D7Y A;  4H4Q A;  4YKF A;  1Y0P A;  2EQ6 A;  3QSE A;  2C76 A;  3HZL A;  4II3 A;  2XLR A;  1TYP A;  1B37 A;  2FJD A;  2QAE A;  5JCM A;  1JRX A;  4DSG A;  2A89 A;  1JRY A;  3GRS A;  4B64 A;  1CJ3 A;  3PS9 A;  2A8X A;  1GOS A;  1CF3 A;  1TRB A;  3B3R A;  3VR8 A;  1BWC A;  1GXF A;  4EMI A;  5KMQ A;  3FPZ A;  2YR6 A;  3IC9 A;  1JU2 A;  4BJY A;  1GER A;  3ZDN A;  4EIP A;  4APN A;  1B8S A;  1F8R A;  2Q0L A;  5BUL A;  3S61 A;  4AT0 A;  3AED A;  1JOA A;  2EQ7 A;  2RGO A;  2TMD A;  3HYW A;  2YG3 A;  1CC4 A;  5FS9 A;  2Q0K A;  3Q6J A;  3SFE A;  4CY8 A;  1EL8 A;  1CHU A;  1Y56 A;  3KU9 A;  3AEA A;  1ZOV A;  3NG7 X;  1PN0 A;  3H8L A;  1H86 A;  4FX9 A;  5KVH A;  1CBO A;  1LQT A;  4EM4 A;  1FCD A;  2VVL A;  1IUU A;  3BHK A;  4FDC B;  1GRA A;  2OAM A;  2V3A A;  4H50 A;  4REK A;  4U8M A;  1KSS A;  2GR3 A;  1JNR A;  3P4S A;  1LV0 A;  5IQ4 A;  4H4P A;  1PBC A;  4A65 A;  2E1M A;  1F6M A;  2JB3 A;  2XLS A;  3PVC A;  4UDR A;  3SQP A;  3EF6 A;  3ATR A; 
#chains in the Genus database with same CATH homology
 3NT6 A;  2FBW A;  3C4A A;  1EL9 A;  1IUV A;  1DOC A;  4H7U A;  2V3B A;  3NH3 X;  5U63 A;  3V3O A;  4H4S A;  5IPY A;  1JRZ A;  4UP3 A;  2B9Y A;  2E4G A;  1PBE A;  2HQM A;  1YQ4 A;  2YLS A;  3AE4 A;  5U1O A;  1F3P A;  2OA1 A;  1DOE A;  2JB2 A;  1GRT A;  3ADA B;  5KOX A;  5HY5 A;  2DKH A;  3AE6 A;  3NKS A;  2WEU A;  3AE8 A;  1OJC A;  4GDE A;  4U8J A;  1OJT A;  3ALL A;  3NHO X;  4YSH A;  3UKQ A;  1GRE A;  2W0H A;  4GF7 A;  1GTH A;  1LJ1 A;  2R46 A;  1E6E A;  2NPX A;  3II4 A;  1PDH A;  3F8D A;  3DGZ A;  3NGC X;  3K7T A;  4NNJ A;  4EM3 A;  2XFO A;  2IVE A;  3T0K A;  1H6V A;  2BK5 A;  1ZMD A;  3F8R A;  5FS7 A;  4USR A;  3T2Y A;  3UKP A;  1DJQ A;  4MJW A;  4U2S A;  3NYF A;  4KX6 A;  2WDQ A;  2R4E A;  4OPU A;  2GAG B;  2B7S A;  3KD9 A;  2XCG A;  1TYT A;  3KA7 A;  3NIX A;  4KPR A;  4Y4N A;  3GMB A;  4J56 A;  3NYC A;  1IUW A;  3NK0 X;  2C3C A;  5U25 A;  3SY4 A;  2Q7V A;  1EL5 A;  3BI5 A;  5FS6 A;  1PBB A;  4WCT A;  4U2T A;  4YSY A;  4A7A A;  1L9C A;  2Y6Q A;  3BHF A;  2BK4 A;  3AWI A;  4ZCD A;  2V61 A;  4C5O A;  4USQ A;  1GAL A;  2GAH B;  3L8K A;  4RSL A;  1NDA A;  2BXS A;  3AB1 A;  1RYI A;  3LZW A;  1Q1W A;  1S2Y A;  2B9W A;  3E1T A;  4GUV A;  3RED A;  4C74 A;  2C65 A;  3LXD A;  3NN0 X;  1D4D A;  2C75 A;  3T2K A;  1FEC A;  2VRM A;  1F8W A;  1DOB A;  3SGL A;  1ZX9 A;  4B69 A;  4B68 A;  1PJ5 A;  1PBD A;  3QJ4 A;  2EQ9 A;  4A6N A;  3GSI A;  2JB1 A;  1O94 A;  1SEZ A;  1ZMC A;  3EAO A;  3EPT A;  1NHQ A;  4IVM B;  3CPJ G;  1NEK A;  2AQJ A;  3CGB A;  2C7G A;  2Q6U A;  4H2Q A;  3H8I A;  1HYU A;  2RAB A;  1COY A;  4YTM A;  3I6D A;  4GCM A;  2WDV A;  2WS3 A;  3FBS A;  3ISH A;  4JDR A;  2XLT A;  3AD7 B;  3ALJ A;  4X9N A;  1CJ4 A;  1K0J A;  5EB4 A;  1L9E A;  3LZX A;  1N4W A;  2R0P A;  4O5U A;  1QJD A;  1ZP0 A;  3IHM A;  2FJA A;  1D5T A;  4OPT A;  2WPF A;  4H4R A;  3B6D A;  1BZL A;  1RSG A;  2VQB A;  3AXB A;  1YQ3 A;  1GES A;  2WOV A;  3S5W A;  1DOD A;  4U8O A;  1GPE A;  2F5Z A;  4TM4 A;  2XFN A;  4A79 A;  3BNM A;  2J3N A;  2R4J A;  1ONF A;  4A99 A;  3C96 A;  2BC0 A;  1BKW A;  4GAP A;  4K7Z A;  1YKJ A;  4B67 A;  2C72 A;  4Z44 A;  3AEE A;  4RG4 A;  4I59 A;  4OPG A;  3SX6 A;  4P9S A;  3DGH A;  4ECH A;  4D04 A;  4JNA A;  3K7M X;  3UKL A;  5HYM A;  3G5Q A;  3GD3 A;  2YWL A;  3FMW A;  2BC1 A;  2JBV A;  3CNJ A;  3UCL A;  4OCG A;  1H81 A;  3UKF A;  4K5R A;  5JCK A;  1TDF A;  1IUT A;  2YM1 A;  2XVE A;  3PO7 A;  4BV6 A;  2GVC A;  3AE5 A;  3P4R A;  4PAA A;  4DSH A;  1H7W A;  3UOZ A;  1ELI A;  2B7R A;  5GSN A;  4J57 A;  2C73 A;  4AP3 A;  4E0V A;  2YVJ A;  3NNE A;  1YY5 A;  2XDO A;  1K4Q A;  2I0Z A;  4K2X A;  5BUK A;  5KRQ A;  4WX1 A;  3P4P A;  3RP6 A;  1BF3 A;  3AEF A;  1BGN A;  2XVF A;  3UP5 A;  4G74 A;  3V3N A;  2FJE A;  3D8X A;  1LPF A;  4Z26 A;  1OJ9 A;  2VRL A;  3RHA A;  2WPC A;  2V6O A;  2A87 A;  2Z5X A;  3NLC A;  5C2T A;  3HYX A;  3NYE A;  4ICY A;  2WP6 A;  5JCN A;  1S2Q A;  4BK1 A;  5FS8 A;  3FIM B;  1GRH A;  1MXT A;  2Z5Y A;  3CNS A;  3ATQ A;  3KKJ A;  4UDP A;  3DJJ A;  1OJA A;  2X99 A;  1PXC A;  1PS9 A;  1IUX A;  3KVE A;  4AOS A;  5BVA A;  2RGH A;  1NG4 A;  3NK2 X;  3M12 A;  4J34 A;  1CL0 A;  2BS3 A;  3LB8 A;  3AE2 A;  2C66 A;  5KMP A;  2XFU A;  1DXL A;  1GSN A;  2B76 A;  2V5Z A;  2YR4 A;  4GDP A;  4HA6 A;  3QVR A;  5HHF A;  4EIQ A;  2BS2 A;  2DKI A;  1H82 A;  1CJC A;  3UOX A;  2C4C A;  5EBK A;  4EQR A;  4OVI A;  4UDQ A;  4TM0 A;  4BJZ A;  2H88 A;  1S3B A;  1OJD A;  5HXI A;  4H4Y A;  3VQR A;  2OLO A;  3NK1 X;  5KOW A;  4K5S A;  4Z43 A;  4FK1 C;  2APG A;  2GEW A;  1GT8 A;  3RP7 A;  3SZW A;  1CC2 A;  1O95 A;  1B4V A;  5EOW A;  1K0I A;  3LJP A;  3SYI A;  3KLJ A;  5ER0 A;  1NHS A;  5GRT A;  3SZ0 A;  3QSM A;  2QCU A;  3VRB A;  3NN6 X;  2XVJ A;  3COX A;  4K22 A;  2R45 A;  4II2 A;  1H84 A;  3L1R A;  4OPC A;  4TLX A;  1NG3 A;  2YG6 A;  4J31 A;  4AT2 A;  1PXB A;  3AE3 A;  3GD4 A;  1GV4 A;  3DK9 A;  2BS4 A;  2QA2 A;  3AEG A;  1L9D A;  4OPL A;  3H4K A;  2PHH A;  3P1W A;  5KWF A;  3T14 A;  4IA5 A;  2OLN A;  3AE7 A;  3G5S A;  4EMW A;  1NHP A;  1TDE A;  2CUL A;  1N4U A;  4ADW A;  3T37 A;  3M0O A;  3FG2 P;  5FMH A;  4Z2U A;  4IVO B;  2Y6R A;  4CCR A;  4A5L A;  3CGD A;  2VVL G;  1GND A;  5LV9 A;  2C70 A;  1GRG A;  2WPE A;  3IHG A;  2WP5 A;  4NEV A;  4OPD A;  2XLP A;  2XVI A;  1UKV G;  3AYJ A;  4CCQ A;  1Y56 B;  2AR8 A;  1D4E A;  4YWO A;  5BRT A;  4GR1 A;  2C3D A;  2X50 A;  3CNP A;  3GYJ A;  1E39 A;  4H4T A;  1M64 A;  1NAA A;  2GF3 A;  3UKH A;  3V76 A;  2ZZC A;  2YLW A;  3K30 A;  5KVI A;  4J36 A;  5JCL A;  1PBF A;  4XWR A;  2ZZB A;  1QO8 A;  1DJN A;  2IID A;  1K0L A;  1KFY A;  2X8G A;  3ABV A;  3DA1 A;  4O5Q A;  3NRN A;  4BK3 A;  1KDG A;  4NTC A;  4Y4L A;  1TDK A;  2GR1 A;  3QSS A;  4DGK A;  4XWZ A;  4NZH A;  1E1M A;  2FJB A;  4LA1 A;  4K8D A;  1QLB A;  3LAD A;  1JNZ A;  3UTE A;  5CQF A;  3ZYX A;  2GQF A;  5J7X A;  4M52 A;  3CN8 A;  4LII A;  5C3J A;  4U2L A;  2TPR A;  4JY2 A;  3DME A;  3UKK A;  1E1N A;  2YQU A;  3M13 A;  4NTD A;  4EQX A;  1FEA A;  4AOX A;  3CMM A;  1E7P A;  4OPI A;  2YG5 A;  2X3N A;  2JK6 A;  4GAV A;  4EQW A;  3CPH G;  3CNT A;  3C4N A;  2BYB A;  2CFY A;  2BK3 A;  4FK1 A;  1IUS A;  4CNJ A;  1P2E A;  2YR5 A;  3O0H A;  2JAE A;  1DNC A;  1TDO A;  2VOU A;  3DH9 A;  1LVL A;  3HYV A;  4J2W A;  1L0V A;  3UP4 A;  1TDN A;  2UZZ A;  3CGE A;  1E1K A;  4H4X A;  1GRB A;  4RG3 A;  3G5R A;  4TM3 A;  4X9M A;  5KXJ A;  2BRA A;  4X4J A;  1N1P A;  2WU5 A;  3GYI A;  4U8K A;  2R9Z A;  3DJD A;  4H4V A;  1P2H A;  3SZC A;  2ZBW A;  4Z2T A;  2JKC A;  4B1B A;  4Z2R A;  4YT0 A;  3NTD A;  4Y4M A;  1GET A;  2OAL A;  4H4U A;  3AE1 A;  3GRT A;  3P4Q A;  2WU2 A;  3ICR A;  1M6I A;  1ZDL A;  4Z24 A;  1AOG A;  3AD8 B;  4JNQ A;  5KMR A;  1FEB A;  2ACZ A;  2CVJ A;  1N4V A;  3QVP A;  4NTE A;  3UKA A;  4XXG A;  3NTA A;  1MOK A;  3UTG A;  5L46 A;  4CRT A;  1KNR A;  2PYX A;  2YLZ A;  4ZN0 A;  1V59 A;  5DBJ A;  4LU6 A;  2IVD A;  3R9U A;  4GRT A;  3WE0 A;  2YVG A;  3CTY A;  3VRA A;  2GH5 A;  2WES A;  2X8C A;  4U8P A;  5IQ1 A;  1CC6 A;  2C64 A;  4G6G A;  4J33 A;  1XAN A;  4A6N B;  2XFP A;  2ZZ0 A;  3D1C A;  4U8I A;  4BK2 A;  2C67 A;  4BUR A;  3IF9 A;  2XVH A;  2YVF A;  2YM2 A;  1RP0 A;  1EBD A;  1XDI A;  4HB9 A;  5M0Z A;  1D4C A;  3GWF A;  4G73 A;  4N9X A;  1NPX A;  1VG9 A;  1MO9 A;  2BCP A;  2R0C A;  2YAU A;  5J60 A;  3ITJ A;  1ZOY A;  3GMC A;  3KPF A;  3LOV A;  2WHD A;  2R0G A;  1GTE A;  2YLX A;  3UTH A;  2WOW A;  4TLZ A;  2BAC A;  2WET A;  4C77 A;  5CKU A;  4JN9 A;  3AEC A;  2BA9 A;  4U8N A;  1Q9I A;  3KPK A;  4NEW A;  2GQW A;  3RNM A;  2V60 A;  4YTN A;  2EQ8 A;  2GRT A;  4EQS A;  2WOI A;  1NEN A;  1JEH A;  4DNA A;  3CPI G;  2VVM A;  3P9U A;  1GEU A;  1YQZ A;  2WP9 A;  4CNK A;  4AP1 A;  2YG7 A;  2BXR A;  4JY3 A;  4ZCC A;  2YG4 A;  1PJ7 A;  3UTF A;  1FL2 A;  3DJG X;  4Z25 A;  3GWD A;  3AD9 B;  3IWA A;  4NWZ A;  4U8L A;  4D03 A;  3EAN A;  1ZKQ A;  2CDU A;  2E5V A;  3QFA A;  3VR9 A;  4CY6 A;  3DK4 A;  1FOH A;  2BRY A;  2VQ7 A;  1E1L A;  4I58 A;  4H2N A;  1ZY8 A;  3SZF A;  3UOV A;  2X8H A;  3GYX A;  3DJE A;  3Q9T A;  3URH A;  1NHR A;  1VDC A;  3AYI A;  3SFD A;  4B66 A;  2GB0 A;  2B9X A;  2GV8 A;  4H2P A;  4A9W A;  1KF6 A;  2XLU A;  4JQ9 A;  3AEB A;  1CJ2 A;  1Q1R A;  1VRQ B;  4YTP A;  3VRD B;  1PXA A;  2ARD A;  2QA1 A;  1D7L A;  4G6H A;  2O9Z A;  1LQU A;  3I3L A;  5M10 A;  3AYL A;  4C3Y A;  2XFQ A;  1XHC A;  3GDP A;  1ZK7 A;  2WDR A;  1F8S A;  5EB5 A;  5KMS A;  4PAB A;  1B5Q A;  3OZ2 A;  4YXD A;  2XYO A;  3F8P A;  1H83 A;  4TM1 A;  5TR3 A;  4YSX A;  4H4W A;  4H2R A;  3RP8 A;  1Z6L A;  1GRF A;  2YLR A;  2BAB A;  4H4Z A;  3OC4 A;  4B63 A;  5KNL A;  3QFB A;  4B65 A;  4EMJ A;  3DK8 A;  3K7Q X;  3BNU A;  4C3X A;  4IV9 A;  2WQY A;  3T31 A;  4YSZ A;  3CGC A;  2RGJ A;  1O5W A;  3UOY A;  4YKG A;  2H89 A;  2WBA A;  1PHH A;  3BI2 A;  3CND A;  1BGJ A;  4CBQ A;  1XPQ A;  3BI4 A;  3ICS A;  1W4X A;  4G9K A;  1PJ6 A;  2GMH A;  2GMJ A;  1VG0 A;  2NVK X;  2AAQ A;  4IA6 A;  3AE9 A;  2GR2 A;  1KNP A;  1S3E A;  1VQW A;  1KSU A;  3ALM A;  2VZ2 A;  1REO A;  2BCG G;  2YLT A;  3GDN A;  3ICT A;  3SM8 A;  3SXI A;  3T2Z A;  5JCI A;  1X31 B;  3JSK A;  1EL7 A;  2GR0 A;  1H7X A;  3CIR A;  1LTX R;  1IJH A;  1D7Y A;  4H4Q A;  4YKF A;  1Y0P A;  2EQ6 A;  3QSE A;  2C76 A;  3HZL A;  4II3 A;  2XLR A;  1TYP A;  1B37 A;  2FJD A;  2QAE A;  5JCM A;  1JRX A;  4DSG A;  2A89 A;  1JRY A;  3GRS A;  4B64 A;  1CJ3 A;  3PS9 A;  2A8X A;  1GOS A;  1CF3 A;  1TRB A;  3B3R A;  3VR8 A;  1BWC A;  1GXF A;  4EMI A;  5KMQ A;  3FPZ A;  2YR6 A;  3IC9 A;  1JU2 A;  4BJY A;  1GER A;  3ZDN A;  4EIP A;  4APN A;  1B8S A;  1F8R A;  2Q0L A;  5BUL A;  3S61 A;  4AT0 A;  3AED A;  1JOA A;  2EQ7 A;  2RGO A;  2TMD A;  3HYW A;  2YG3 A;  1CC4 A;  5FS9 A;  2Q0K A;  3Q6J A;  3SFE A;  4CY8 A;  1EL8 A;  1CHU A;  1Y56 A;  3KU9 A;  3AEA A;  1ZOV A;  3NG7 X;  1PN0 A;  3H8L A;  1H86 A;  4FX9 A;  5KVH A;  1CBO A;  1LQT A;  4EM4 A;  1FCD A;  2VVL A;  1IUU A;  3BHK A;  4FDC B;  1GRA A;  2OAM A;  2V3A A;  4H50 A;  4REK A;  4U8M A;  1KSS A;  2GR3 A;  1JNR A;  3P4S A;  1LV0 A;  5IQ4 A;  4H4P A;  1PBC A;  4A65 A;  2E1M A;  1F6M A;  2JB3 A;  2XLS A;  3PVC A;  4UDR A;  3SQP A;  3EF6 A;  3ATR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...