1TDNA

L-amino acid oxidase from agkistrodon halys in complex with l-leucine
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complex with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
total genus 172
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdnA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdnA01
2C72A 1XPQA 1JNZA 2BACA 3AEAA 3CTYA 3NYEA 4FX9A 1OJDA 2QAEA 4BURA 1ZX9A 1XDIA 2VQBA 4YTPA 2XVHA 1ZDLA 2FBWA 2GAGB 5JCMA 4X9MA 3ICRA 4NTDA 3B3RA 1CC2A 2IIDA 1PS9A 4B67A 4YTNA 2WDQA 2C7GA 4WX1A 4EIQA 3VRAA 3G5RA 3WE0A 3CIRA 1KF6A 4CY6A 3AE6A 1ZKQA 5TR3A 3SQPA 4GR1A 2XLRA 4GCMA 3P4QA 1F8WA 3AE2A 3NT6A 3DJJA 1FL2A 1CL0A 1YQ3A 2PHHA 3CNPA 2A8XA 3NRNA 4Y4MA 4AOXA 4YT0A 2WU5A 2CVJA 4BV6A 2GR1A 1L9CA 3LJPA 2EQ7A 3K30A 3T37A 3COXA 1Q1RA 4AT2A 4DGKA 4K22A 2WETA 3RP7A 5CKUA 1GETA 4U8OA 4NTEA 4DSHA 4Z2TA 1B8SA 4YKGA 3JSKA 1FECA 3CGDA 2NPXA 1TDOA 3VQRA 4DNAA 3LZWA 1PBDA 3GDNA 2J3NA 3AE9A 1JRXA 2YVGA 4OPTA 4H4TA 1E1MA 2I0ZA 5L46A 2XVJA 1DOEA 3GRTA 1L9DA 1REOA 3QVPA 4CNKA 3RP6A 2BCGG 5ER0A 5KRQA 1CJ4A 2B7RA 1GEUA 4H2RA 3QSSA 1GRHA 1CF3A 1H81A 2YVFA 1GOSA 4NEVA 4PABA 2BABA 1UKVG 4USRA 3URHA 2CDUA 4I58A 4EMIA 1SEZA 3NN6X 3C4NA 1DJQA 2GMJA 3IWAA 3NN0X 1BGJA 3IHMA 3PS9A 2XLSA 3FIMB 2WOVA 2Q0KA 2WHDA 2YAUA 4K8DA 4XWZA 1PJ6A 1GRTA 4IA6A 3BI5A 3AECA 2V5ZA 1IUWA 1Y56B 2R4JA 4H2PA 4JN9A 4D04A 2OALA 1FCDA 2BK3A 1TYTA 3AEFA 2BS3A 3AE8A 4YSHA 1GRFA 2VVLG 4K7ZA 1DODA 1W4XA 2TPRA 5U1OA 2FJBA 3AE1A 3ICTA 4EQXA 1EL5A 1F8RA 4GRTA 5JCIA 1GRAA 1TDKA 4U8JA 4IVMB 1GERA 1CC6A 3P1WA 4OPIA 1BKWA 1KDGA 2YM1A 3UP4A 2YVJA 1EL8A 4ICYA 4GDPA 5IPYA 1BGNA 2XFQA 2QA2A 4O5QA 4BK3A 3KA7A 1IJHA 4WCTA 1PBCA 3RP8A 1H84A 3NKSA 2VVMA 3DH9A 4ADWA 1K4QA 2GQFA 2Z5XA 4EIPA 4JQ9A 2JB3A 3GYJA 4CY8A 2X8CA 1ZK7A 3CGEA 1RP0A 2NVKX 3K7MX 1IUUA 4J34A 2O9ZA 2VRLA 1GPEA 4H4XA 4KPRA 2XVEA 2YLTA 5GRTA 3GRSA 1L9EA 1TDFA 2FJEA 4B69A 4J33A 3LADA 1VQWA 1ZMCA 4U8KA 2C73A 3CGCA 3DGHA 2XFNA 3LXDA 4J31A 4D03A 2GR0A 1YKJA 4Z2RA 3QSMA 3UTGA 2GMHA 2WOIA 3FPZA 1KNRA 2WDRA 3ITJA 1IUSA 1GESA 1Y0PA 5KVIA 3NYCA 2WP6A 3UOYA 4EQSA 4YXDA 3K7QX 1HYUA 1LPFA 4C5OA 2AQJA 3CNJA 5DBJA 1RYIA 2EQ8A 2PYXA 1VRQB 2B7SA 3EPTA 4Z43A 3HZLA 4Z25A 2C3DA 2IVDA 5IQ1A 2GF3A 1KSUA 3CPIG 1CJ2A 4A6NA 2YLRA 1GSNA 3PVCA 4K2XA 5FS8A 2RGOA 4OPDA 1GREA 2R0CA 3GWFA 3GWDA 1NDAA 3BI2A 3CPJG 2FJDA 2XLPA 2OLNA 4NZHA 2OAMA 5BRTA 1NEKA 4A99A 1V59A 3P4RA 1S2QA 5FS9A 3RNMA 4U8PA 1TDNA 4EM4A 2XYOA 4C3YA 1JNRA 2YG5A 2RGHA 2H89A 3SGLA 2C76A 1CJ3A 1Q9IA 3EF6A 3BI4A 4FK1A 2JKCA 2WS3A 3UOVA 3ZYXA 5EB4A 4A9WA 2IVEA 2BS2A 4UP3A 3AXBA 1M64A 1JEHA 1ELIA 3Q6JA 5JCLA 3AD9B 1D5TA 4ZN0A 1EBDA 3CN8A 2OA1A 3LOVA 4U8LA 2XLTA 3NLCA 2C3CA 2YG7A 2EQ9A 2YLZA 3ALJA 4JNQA 1FEBA 1YQZA 2YLWA 5CQFA 1K0LA 3ATRA 2B9XA 1LTXR 2B9WA 3ISHA 1MO9A 1NHPA 2VQ7A 3L8KA 3UCLA 4LA1A 4N9XA 4CRTA 4OCGA 1D4CA 3QFAA 3ALMA 3ZDNA 2VZ2A 3FG2P 3AD7B 4H2QA 4J57A 4Z24A 2C65A 2V6OA 1GV4A 3NIXA 3ALLA 1VG0A 3KD9A 2XFPA 1KSSA 2ACZA 3AEGA 5KOWA 3AEBA 3LB8A 2Y6RA 1GTHA 2WEUA 4MJWA 1IUTA 4NEWA 4X4JA 1K0IA 1CBOA 3EAOA 1O95A 3V3NA 2JB2A 5U25A 3K7TA 3UTHA 1JU2A 2YM2A 2E1MA 3AYIA 1QO8A 3G5QA 4U8MA 4BK2A 3NH3X 2X99A 3B6DA 3ATQA 2FJAA 1YY5A 3AE5A 3NYFA 1AOGA 1S3BA 2BXSA 3IF9A 2A89A 1B5QA 2Q6UA 2YG3A 4H4VA 3NK1X 4J56A 2WQYA 4RSLA 3AE3A 2A87A 1Y56A 2R0PA 2RGJA 5JCNA 2C64A 3F8DA 5EOWA 3UKHA 4U2SA 1O94A 1N4VA 1P2EA 3BHFA 1D4EA 4EMJA 3OZ2A 4APNA 3IHGA 3UKFA 1N4UA 4FDCB 3VR8A 1H82A 1E7PA 1NENA 1Q1WA 3G5SA 3M13A 2GVCA 1GT8A 1IUVA 2C70A 3LZXA 4UDQA 4YSXA 2GH5A 3DGZA 1B4VA 2X3NA 1GRGA 2GRTA 4B68A 4B65A 3I6DA 3ABVA 3DA1A 3D8XA 2WP9A 3DJEA 3QJ4A 4XXGA 2YWLA 2RABA 3DJDA 4CBQA 4HA6A 3SFEA 1BWCA 4O5UA 4DSGA 1ZOVA 1Z6LA 2QCUA 3DK9A 3QFBA 1K0JA 2WPEA 1IUXA 3FBSA 3PO7A 1DOBA 3KU9A 1H83A 2F5ZA 1E6EA 4I59A 4GF7A 4XWRA 3II4A 5J60A 1ZOYA 2VOUA 1DXLA 2YLSA 2V61A 2ZZ0A 3VR9A 1GXFA 1NHSA 2X50A 4YSZA 2YG4A 4Z44A 4HB9A 3NK2X 3M0OA 1CC4A 3KPFA 4PAAA 3UOXA 3VRBA 3CNSA 2GV8A 4H4UA 4YTMA 4AT0A 2YLXA 3GMBA 4GUVA 3AWIA 1ZMDA 2GR3A 2ARDA 1H7XA 3AD8B 4CCRA 4YWOA 2OLOA 3REDA 5U63A 4B63A 4BJYA 4C74A 4UDPA 2UZZA 3GYIA 1JRYA 2CULA 3GDPA 4ZCCA 1S2YA 1XHCA 4J36A 2DKHA 4OPLA 5KXJA 1PJ5A 3GD3A 1BZLA 2XVFA 5FMHA 2B9YA 4H7UA 4Z26A 3H8LA 3NNEA 3IC9A 2YQUA 2APGA 4E0VA 3AEDA 3EANA 2BYBA 4AP3A 3BNMA 4JNAA 2R46A 5J7XA 2Q7VA 5EBKA 4NTCA 3VRDB 4TLZA 3SFDA 2ZZCA 3AB1A 1PJ7A 1FOHA 4JY3A 2BK5A 4TM4A 2WESA 1GTEA 1F6MA 4A6NB 3DMEA 4CCQA 2X8GA 3QSEA 4BK1A 2BXRA 2VRMA 1CHUA 4P9SA 1VDCA 1DJNA 4IV9A 2BC1A 3BNUA 5FS6A 5BUKA 3UKKA 5BULA 5C2TA 5FS7A 1XANA 1VG9A 4B66A 4GDEA 3SM8A 3CNDA 3UKAA 4H4RA 1ONFA 2BA9A 4LU6A 4K5SA 1S3EA 1N1PA 1E1NA 2CFYA 4TM0A 3ADAB 3KLJA 4LIIA 1NAAA 2ZBWA 3NK0X 1F3PA 4A79A 4RG4A 4H4PA 4IA5A 4JY2A 1ZY8A 1OJTA 4A65A 2V3BA 4OPUA 3F8PA 4A7AA 2WOWA 2XLUA 3ICSA 3CGBA 3O0HA 1M6IA 1D7LA 1GRBA 4AP1A 4AOSA 4ZCDA 2WPFA 3UKPA 5C3JA 1MOKA 2JB1A 1ZP0A 3P4PA 3V76A 1O5WA 5HHFA 2BS4A 1GALA 3OC4A 2C67A 2H88A 1PDHA 4C77A 5M10A 1PXBA 4H4YA 5KOXA 2C66A 3F8RA 3KVEA 3FMWA 4M52A 4EM3A 2R45A 3GD4A 1GNDA 1NHQA 3DK4A 4YSYA 4Y4LA 4Y4NA 1B37A 2WBAA 4EMWA 1KNPA 2TMDA 3UKLA 3Q9TA 2GEWA 5M0ZA 3R9UA 2JBVA 2VVLA 3DJGX 4U2TA 2X8HA 1D7YA 1E1KA 1TYPA 4UDRA 2JK6A 4IVOB 3GSIA 2Q0LA 4OPCA 3E1TA 1QJDA 3H8IA 2XCGA 2Z5YA 1E39A 4H50A 1RSGA 3P9UA 4USQA 4X9NA 2W0HA 3QVRA 4REKA 3I3LA 4B1BA 4TM3A 2E5VA 3V3OA 4C3XA 2XDOA 5BVAA 3S61A 2YG6A 2C75A 1D4DA 1EL9A 1LVLA 1NHRA 2BC0A 2R0GA 3AYLA 3L1RA 4ECHA 5KVHA 5LV9A 1BF3A 3AE4A 1MXTA 4BJZA 4Z2UA 5JCKA 2BCPA 1KFYA 4U8NA 3NGCX 2WDVA 4U8IA 3RHAA 4TLXA 1N4WA 3NTDA 2Y6QA 5KWFA 4H4WA 2B76A 1F8SA 2HQMA 2WU2A 2DKIA 4JDRA 1PBEA 4H2NA 2AAQA 2V60A 2YR5A 3AE7A 3NG7X 1EL7A 3AEEA 1E1LA 1X31B 4YKFA 4TM1A 3CPHG 1DOCA 2YR4A 2QA1A 2JAEA 1H86A 3M12A 5HY5A 2R9ZA 1LV0A 2YR6A 4A5LA 4EQRA 5EB5A 1PHHA 3KKJA 1OJAA 1COYA 3BHKA 3UTEA 4RG3A 3S5WA 3NTAA 3GMCA 1PXCA 1OJCA 5GSNA 4B64A 1YQ4A 4EQWA 1L0VA 1NG4A 3UOZA 3NHOX 2ZZBA 2R4EA 1PXAA 3UTFA 2EQ6A 2WP5A 3C4AA 4FK1C 4KX6A 2XFUA 4H4ZA 1NPXA 2XFOA 4H4SA 1CJCA 1LJ1A 2GB0A 4OVIA 5HYMA 2V3AA 1JOAA 4J2WA 2GAHB 1P2HA 2XVIA 1PBFA 1PN0A 1TRBA 3D1CA 5HXIA 3AYJA 1OJ9A 2GQWA 1LQUA 4U2LA 1H6VA 2WPCA 3C96A 1TDEA 1QLBA 3DK8A 4H4QA 3P4SA 5IQ4A 1PBBA 1DNCA 2E4GA 1FEAA 3H4KA 4OPGA 1NG3A 4K5RA 1LQTA 3UKQA 3CNTA 3UP5A 1JRZA 4CNJA 2GR2A 2AR8A 1H7WA 2BK4A
chains in the Genus database with same CATH superfamily
2C72A 1XPQA 1JNZA 2BACA 3AEAA 3CTYA 3NYEA 4NNJA 4FX9A 1OJDA 2QAEA 4BURA 1ZX9A 1XDIA 2VQBA 4YTPA 2XVHA 1ZDLA 2FBWA 2GAGB 5JCMA 4X9MA 3ICRA 4NTDA 3B3RA 1CC2A 2IIDA 1PS9A 4B67A 4YTNA 2WDQA 2C7GA 4WX1A 4EIQA 3VRAA 3G5RA 3WE0A 3CIRA 1KF6A 4CY6A 3AE6A 1ZKQA 5TR3A 3SQPA 4GR1A 2XLRA 4GCMA 3P4QA 1F8WA 3AE2A 3NT6A 3DJJA 1FL2A 1CL0A 1YQ3A 2PHHA 3CNPA 2A8XA 3NRNA 4Y4MA 4AOXA 4YT0A 2WU5A 2CVJA 4BV6A 2GR1A 1L9CA 3LJPA 2EQ7A 3K30A 3T37A 3COXA 1Q1RA 4AT2A 4DGKA 4K22A 2WETA 3RP7A 5CKUA 1GETA 4U8OA 4NTEA 4DSHA 4Z2TA 1B8SA 4YKGA 3JSKA 1FECA 3CGDA 2NPXA 1TDOA 3VQRA 4DNAA 3LZWA 1PBDA 3GDNA 2J3NA 3AE9A 1JRXA 2YVGA 4OPTA 4H4TA 1E1MA 2I0ZA 5L46A 2XVJA 1DOEA 3GRTA 1L9DA 1REOA 3QVPA 4CNKA 3RP6A 2BCGG 5ER0A 5KRQA 1CJ4A 2B7RA 1GEUA 4H2RA 3QSSA 1GRHA 1CF3A 1H81A 2YVFA 1GOSA 4GAVA 4NEVA 2BABA 1UKVG 4PABA 4USRA 3URHA 2CDUA 4I58A 4EMIA 1SEZA 3NN6X 3C4NA 1DJQA 2GMJA 3IWAA 3NN0X 1BGJA 3IHMA 3PS9A 2XLSA 3FIMB 2WOVA 2Q0KA 2WHDA 2YAUA 4K8DA 4XWZA 1PJ6A 1GRTA 4G9KA 4IA6A 3BI5A 3AECA 2V5ZA 1IUWA 1Y56B 2R4JA 4H2PA 4JN9A 4D04A 2OALA 1FCDA 2BK3A 1TYTA 3AEFA 2BS3A 3AE8A 4YSHA 1GRFA 2VVLG 4K7ZA 1DODA 1W4XA 2TPRA 5U1OA 2FJBA 3AE1A 3ICTA 4EQXA 1EL5A 1F8RA 4GRTA 5JCIA 1GRAA 1TDKA 4U8JA 4IVMB 1GERA 1CC6A 3P1WA 4OPIA 1BKWA 1KDGA 2YM1A 3UP4A 2YVJA 1EL8A 4ICYA 4GDPA 5IPYA 1BGNA 2XFQA 2QA2A 4O5QA 4BK3A 3KA7A 1IJHA 3HYWA 4WCTA 3SZCA 1PBCA 3RP8A 1H84A 3NKSA 2VVMA 2C4CA 3DH9A 4ADWA 1K4QA 2GQFA 2Z5XA 4EIPA 4JQ9A 2JB3A 3GYJA 4CY8A 2X8CA 1ZK7A 3CGEA 1RP0A 2NVKX 3K7MX 1IUUA 4J34A 2O9ZA 2VRLA 1GPEA 4H4XA 4KPRA 2XVEA 2YLTA 3CMMA 5GRTA 3GRSA 1L9EA 1TDFA 2FJEA 4B69A 3HYXA 4J33A 3LADA 1VQWA 1ZMCA 4U8KA 2C73A 3CGCA 3DGHA 2XFNA 3LXDA 4J31A 4D03A 2GR0A 1YKJA 4Z2RA 3QSMA 4II2A 3UTGA 2GMHA 2WOIA 3FPZA 1KNRA 2WDRA 3ITJA 1IUSA 1GESA 1Y0PA 5KVIA 3NYCA 2WP6A 3UOYA 4EQSA 4YXDA 3K7QX 1HYUA 1LPFA 4C5OA 2AQJA 5KMPA 3CNJA 5DBJA 1RYIA 2EQ8A 2PYXA 1VRQB 2B7SA 3EPTA 4Z43A 3HZLA 3T0KA 4Z25A 2C3DA 2IVDA 5IQ1A 2GF3A 1KSUA 3CPIG 1CJ2A 4A6NA 2YLRA 3T2YA 3KPKA 1GSNA 3PVCA 4K2XA 5FS8A 2RGOA 4OPDA 1GREA 2R0CA 3GWFA 3GWDA 1NDAA 3BI2A 3CPJG 2FJDA 2XLPA 2OLNA 4NZHA 2OAMA 5BRTA 1NEKA 4A99A 1V59A 3P4RA 1S2QA 5FS9A 3RNMA 4U8PA 1TDNA 3T31A 3SZ0A 4EM4A 2XYOA 4C3YA 1JNRA 2YG5A 2RGHA 2H89A 3SGLA 2C76A 1CJ3A 1Q9IA 3EF6A 3BI4A 4FK1A 2JKCA 2WS3A 4G6HA 3UOVA 3ZYXA 5EB4A 4A9WA 2IVEA 2BS2A 4UP3A 3AXBA 1M64A 1JEHA 1ELIA 3Q6JA 5JCLA 3AD9B 1D5TA 4ZN0A 1EBDA 3CN8A 2OA1A 3LOVA 4U8LA 2XLTA 3NLCA 2C3CA 2YG7A 2EQ9A 2YLZA 3ALJA 4GAPA 1FEBA 1YQZA 2YLWA 4JNQA 1K0LA 5CQFA 3ATRA 2B9XA 1LTXR 2B9WA 3ISHA 1MO9A 1NHPA 2VQ7A 3L8KA 3UCLA 4LA1A 4N9XA 4CRTA 4OCGA 1D4CA 3QFAA 3ALMA 3ZDNA 2VZ2A 3FG2P 3AD7B 4H2QA 4J57A 4Z24A 2C65A 2V6OA 1GV4A 3NIXA 3ALLA 1VG0A 3KD9A 2XFPA 1KSSA 2ACZA 2BRAA 3AEGA 3AEBA 3LB8A 5KOWA 2Y6RA 1GTHA 2WEUA 4MJWA 1IUTA 4NEWA 4X4JA 1K0IA 1CBOA 3EAOA 1O95A 3V3NA 2JB2A 5U25A 3K7TA 3UTHA 1JU2A 2YM2A 2E1MA 3AYIA 1QO8A 3G5QA 4U8MA 4BK2A 3NH3X 2X99A 3B6DA 3ATQA 2FJAA 1YY5A 3AE5A 3NYFA 1AOGA 1S3BA 2BXSA 5KNLA 3IF9A 2A89A 1B5QA 2Q6UA 2YG3A 4H4VA 3NK1X 4J56A 2WQYA 4RSLA 3AE3A 2A87A 1Y56A 2R0PA 2RGJA 5JCNA 2C64A 3F8DA 5EOWA 3UKHA 4U2SA 1O94A 1N4VA 1P2EA 3BHFA 1D4EA 4EMJA 3OZ2A 4APNA 3IHGA 4II3A 3UKFA 1N4UA 4FDCB 3VR8A 1H82A 1E7PA 1NENA 1Q1WA 3G5SA 3M13A 2GVCA 1GT8A 1IUVA 2C70A 3LZXA 4UDQA 4YSXA 2GH5A 3SX6A 3DGZA 1B4VA 2X3NA 1GRGA 2GRTA 4B68A 4B65A 3I6DA 3ABVA 3DA1A 3D8XA 2WP9A 3DJEA 3QJ4A 4XXGA 2YWLA 3SXIA 2RABA 3DJDA 4CBQA 4HA6A 3SFEA 1BWCA 4O5UA 4DSGA 1ZOVA 1Z6LA 2QCUA 3DK9A 3QFBA 1K0JA 2WPEA 1IUXA 3FBSA 3PO7A 1DOBA 3KU9A 1H83A 3SY4A 2F5ZA 1E6EA 4I59A 4GF7A 4XWRA 3II4A 5J60A 1ZOYA 2VOUA 1DXLA 2YLSA 2V61A 2ZZ0A 3VR9A 1GXFA 1NHSA 2X50A 4YSZA 2YG4A 4Z44A 4HB9A 3NK2X 3M0OA 1CC4A 3KPFA 4PAAA 3UOXA 3VRBA 3CNSA 2GV8A 4H4UA 4YTMA 4AT0A 2YLXA 3GMBA 4GUVA 3AWIA 1ZMDA 2GR3A 2ARDA 1H7XA 3AD8B 3GYXA 4CCRA 4YWOA 2OLOA 3REDA 5U63A 4B63A 4BJYA 4C74A 4UDPA 2UZZA 3GYIA 1JRYA 2CULA 3GDPA 4ZCCA 1S2YA 1XHCA 4J36A 3SYIA 2DKHA 4OPLA 5KXJA 1PJ5A 3GD3A 1BZLA 2XVFA 5FMHA 2B9YA 4H7UA 4Z26A 3H8LA 3NNEA 3IC9A 2YQUA 2APGA 4E0VA 3AEDA 3EANA 2BYBA 4AP3A 3BNMA 4JNAA 2R46A 5J7XA 2Q7VA 5EBKA 4NTCA 3VRDB 4TLZA 3SFDA 2ZZCA 3AB1A 1PJ7A 1FOHA 4JY3A 2BK5A 4TM4A 2WESA 1GTEA 1F6MA 4A6NB 3DMEA 4CCQA 5KMRA 2X8GA 3QSEA 4BK1A 2BXRA 2VRMA 1CHUA 4G73A 4P9SA 1VDCA 4G6GA 1DJNA 4IV9A 2BC1A 2BRYA 3BNUA 5FS6A 5BUKA 3UKKA 5BULA 5C2TA 5FS7A 3T2KA 1XANA 1VG9A 4B66A 4GDEA 3SM8A 3CNDA 3UKAA 4H4RA 1ONFA 2BA9A 4LU6A 4K5SA 1S3EA 1N1PA 1E1NA 2CFYA 4TM0A 3ADAB 3KLJA 4LIIA 1NAAA 2ZBWA 3NK0X 1F3PA 4A79A 4RG4A 4H4PA 4IA5A 4JY2A 1ZY8A 1OJTA 4A65A 2V3BA 4OPUA 3F8PA 4A7AA 2WOWA 3SZFA 2XLUA 3ICSA 3CGBA 3O0HA 1M6IA 1D7LA 1GRBA 4AP1A 4AOSA 4ZCDA 2WPFA 3UKPA 5C3JA 1MOKA 2JB1A 1ZP0A 3P4PA 3V76A 1O5WA 5HHFA 3SZWA 2BS4A 1GALA 3OC4A 2C67A 2H88A 1PDHA 4C77A 5M10A 1PXBA 5KMSA 4H4YA 5KOXA 2C66A 3F8RA 3KVEA 3FMWA 4M52A 4EM3A 2R45A 3GD4A 1GNDA 1NHQA 3DK4A 4YSYA 4Y4LA 4Y4NA 1B37A 2WBAA 4EMWA 1KNPA 2TMDA 3UKLA 3Q9TA 2GEWA 5M0ZA 3R9UA 2JBVA 2VVLA 3DJGX 3T2ZA 4U2TA 2X8HA 1D7YA 1E1KA 1TYPA 4UDRA 2JK6A 4IVOB 3GSIA 2Q0LA 4OPCA 3E1TA 1QJDA 3H8IA 2XCGA 2Z5YA 4NWZA 1E39A 4H50A 1RSGA 3P9UA 4USQA 4X9NA 2W0HA 3QVRA 4REKA 3I3LA 4B1BA 4TM3A 2E5VA 3V3OA 4C3XA 2XDOA 5BVAA 3S61A 2YG6A 2C75A 1D4DA 1EL9A 1LVLA 1NHRA 2BC0A 2R0GA 3AYLA 3L1RA 4ECHA 5KVHA 5LV9A 1BF3A 3AE4A 1MXTA 4BJZA 4Z2UA 5JCKA 2BCPA 1KFYA 4U8NA 3NGCX 2WDVA 4U8IA 3RHAA 4TLXA 1N4WA 3NTDA 2Y6QA 5KWFA 4H4WA 2B76A 1F8SA 2HQMA 2WU2A 2DKIA 4JDRA 1PBEA 4H2NA 2AAQA 2V60A 2YR5A 3AE7A 3NG7X 1EL7A 3AEEA 1E1LA 1X31B 4YKFA 4TM1A 3CPHG 1DOCA 2YR4A 2QA1A 2JAEA 1H86A 3M12A 5HY5A 2R9ZA 1LV0A 2YR6A 4A5LA 4EQRA 5EB5A 1PHHA 3KKJA 1OJAA 1COYA 3BHKA 3UTEA 4RG3A 3S5WA 3NTAA 3GMCA 1PXCA 1OJCA 5GSNA 4B64A 5KMQA 1YQ4A 4G74A 4EQWA 1L0VA 1NG4A 3UOZA 3NHOX 2ZZBA 2R4EA 1PXAA 3UTFA 2EQ6A 2WP5A 3C4AA 4FK1C 4KX6A 2XFUA 4H4ZA 1NPXA 2XFOA 4H4SA 1CJCA 1LJ1A 2GB0A 4OVIA 5HYMA 2V3AA 1JOAA 4J2WA 2GAHB 1P2HA 2XVIA 1PBFA 1PN0A 1TRBA 3D1CA 3HYVA 5HXIA 3AYJA 1OJ9A 2GQWA 1LQUA 4U2LA 1H6VA 2WPCA 3C96A 1TDEA 1QLBA 3DK8A 4H4QA 3P4SA 5IQ4A 1PBBA 1DNCA 2E4GA 1FEAA 3H4KA 4OPGA 1NG3A 4K5RA 1LQTA 3UKQA 3CNTA 3UP5A 1JRZA 4CNJA 3T14A 2GR2A 2AR8A 1H7WA 2BK4A
chains in the Genus database with same CATH topology
2C72A 1XPQA 1JNZA 2BACA 3AEAA 3CTYA 3NYEA 4NNJA 4FX9A 1OJDA 2QAEA 4BURA 1ZX9A 1XDIA 2VQBA 4YTPA 2XVHA 1ZDLA 2FBWA 2GAGB 5JCMA 4X9MA 3ICRA 4NTDA 3B3RA 1CC2A 2IIDA 1PS9A 4B67A 4YTNA 2WDQA 2C7GA 4WX1A 4EIQA 3VRAA 3G5RA 3WE0A 3CIRA 1KF6A 4CY6A 3AE6A 1ZKQA 5TR3A 3SQPA 4GR1A 2XLRA 4GCMA 3P4QA 1F8WA 3AE2A 3NT6A 3DJJA 1FL2A 1CL0A 1YQ3A 2PHHA 3CNPA 2A8XA 3NRNA 4Y4MA 4AOXA 4YT0A 2WU5A 2CVJA 4BV6A 2GR1A 1L9CA 3LJPA 2EQ7A 3K30A 3T37A 3COXA 1Q1RA 4AT2A 4DGKA 4K22A 2WETA 3RP7A 5CKUA 1GETA 4U8OA 4NTEA 4DSHA 4Z2TA 1B8SA 4YKGA 3JSKA 1FECA 3CGDA 2NPXA 1TDOA 3VQRA 4DNAA 3LZWA 1PBDA 3GDNA 2J3NA 3AE9A 1JRXA 2YVGA 4OPTA 4H4TA 1E1MA 2I0ZA 5L46A 2XVJA 1DOEA 3GRTA 1L9DA 1REOA 3QVPA 4CNKA 3RP6A 2BCGG 5ER0A 5KRQA 1CJ4A 2B7RA 1GEUA 4H2RA 3QSSA 1GRHA 1CF3A 1H81A 2YVFA 1GOSA 4GAVA 4NEVA 2BABA 1UKVG 4PABA 4USRA 3URHA 2CDUA 4I58A 4EMIA 1SEZA 3NN6X 3C4NA 1DJQA 2GMJA 3IWAA 3NN0X 1BGJA 3IHMA 3PS9A 2XLSA 3FIMB 2WOVA 2Q0KA 2WHDA 2YAUA 4K8DA 4XWZA 1PJ6A 1GRTA 4G9KA 4IA6A 3BI5A 3AECA 2V5ZA 1IUWA 1Y56B 2R4JA 4H2PA 4JN9A 4D04A 2OALA 1FCDA 2BK3A 1TYTA 3AEFA 2BS3A 3AE8A 4YSHA 1GRFA 2VVLG 4K7ZA 1DODA 1W4XA 2TPRA 5U1OA 2FJBA 3AE1A 3ICTA 4EQXA 1EL5A 1F8RA 4GRTA 5JCIA 1GRAA 1TDKA 4U8JA 4IVMB 1GERA 1CC6A 3P1WA 4OPIA 1BKWA 1KDGA 2YM1A 3UP4A 2YVJA 1EL8A 4ICYA 4GDPA 5IPYA 1BGNA 2XFQA 2QA2A 4O5QA 4BK3A 3KA7A 1IJHA 3HYWA 4WCTA 3SZCA 1PBCA 3RP8A 1H84A 3NKSA 2VVMA 2C4CA 3DH9A 4ADWA 1K4QA 2GQFA 2Z5XA 4EIPA 4JQ9A 2JB3A 3GYJA 4CY8A 2X8CA 1ZK7A 3CGEA 1RP0A 2NVKX 3K7MX 1IUUA 4J34A 2O9ZA 2VRLA 1GPEA 4H4XA 4KPRA 2XVEA 2YLTA 3CMMA 5GRTA 3GRSA 1L9EA 1TDFA 2FJEA 4B69A 3HYXA 4J33A 3LADA 1VQWA 1ZMCA 4U8KA 2C73A 3CGCA 3DGHA 2XFNA 3LXDA 4J31A 4D03A 2GR0A 1YKJA 4Z2RA 3QSMA 4II2A 3UTGA 2GMHA 2WOIA 3FPZA 1KNRA 2WDRA 3ITJA 1IUSA 1GESA 1Y0PA 5KVIA 3NYCA 2WP6A 3UOYA 4EQSA 4YXDA 3K7QX 1HYUA 1LPFA 4C5OA 2AQJA 5KMPA 3CNJA 5DBJA 1RYIA 2EQ8A 2PYXA 1VRQB 2B7SA 3EPTA 4Z43A 3HZLA 3T0KA 4Z25A 2C3DA 2IVDA 5IQ1A 2GF3A 1KSUA 3CPIG 1CJ2A 4A6NA 2YLRA 3T2YA 3KPKA 1GSNA 3PVCA 4K2XA 5FS8A 2RGOA 4OPDA 1GREA 2R0CA 3GWFA 3GWDA 1NDAA 3BI2A 3CPJG 2FJDA 2XLPA 2OLNA 4NZHA 2OAMA 5BRTA 1NEKA 4A99A 1V59A 3P4RA 1S2QA 5FS9A 3RNMA 4U8PA 1TDNA 3T31A 3SZ0A 4EM4A 2XYOA 4C3YA 1JNRA 2YG5A 2RGHA 2H89A 3SGLA 2C76A 1CJ3A 1Q9IA 3EF6A 3BI4A 4FK1A 2JKCA 2WS3A 4G6HA 3UOVA 3ZYXA 5EB4A 4A9WA 2IVEA 2BS2A 4UP3A 3AXBA 1M64A 1JEHA 1ELIA 3Q6JA 5JCLA 3AD9B 1D5TA 4ZN0A 1EBDA 3CN8A 2OA1A 3LOVA 4U8LA 2XLTA 3NLCA 2C3CA 2YG7A 2EQ9A 2YLZA 3ALJA 4GAPA 1FEBA 1YQZA 2YLWA 4JNQA 1K0LA 5CQFA 3ATRA 2B9XA 1LTXR 2B9WA 3ISHA 1MO9A 1NHPA 2VQ7A 3L8KA 3UCLA 4LA1A 4N9XA 4CRTA 4OCGA 1D4CA 3QFAA 3ALMA 3ZDNA 2VZ2A 3FG2P 3AD7B 4H2QA 4J57A 4Z24A 2C65A 2V6OA 1GV4A 3NIXA 3ALLA 1VG0A 3KD9A 2XFPA 1KSSA 2ACZA 2BRAA 3AEGA 3AEBA 3LB8A 5KOWA 2Y6RA 1GTHA 2WEUA 4MJWA 1IUTA 4NEWA 4X4JA 1K0IA 1CBOA 3EAOA 1O95A 3V3NA 2JB2A 5U25A 3K7TA 3UTHA 1JU2A 2YM2A 2E1MA 3AYIA 1QO8A 3G5QA 4U8MA 4BK2A 3NH3X 2X99A 3B6DA 3ATQA 2FJAA 1YY5A 3AE5A 3NYFA 1AOGA 1S3BA 2BXSA 5KNLA 3IF9A 2A89A 1B5QA 2Q6UA 2YG3A 4H4VA 3NK1X 4J56A 2WQYA 4RSLA 3AE3A 2A87A 1Y56A 2R0PA 2RGJA 5JCNA 2C64A 3F8DA 5EOWA 3UKHA 4U2SA 1O94A 1N4VA 1P2EA 3BHFA 1D4EA 4EMJA 3OZ2A 4APNA 3IHGA 4II3A 3UKFA 1N4UA 4FDCB 3VR8A 1H82A 1E7PA 1NENA 1Q1WA 3G5SA 3M13A 2GVCA 1GT8A 1IUVA 2C70A 3LZXA 4UDQA 4YSXA 2GH5A 3SX6A 3DGZA 1B4VA 2X3NA 1GRGA 2GRTA 4B68A 4B65A 3I6DA 3ABVA 3DA1A 3D8XA 2WP9A 3DJEA 3QJ4A 4XXGA 2YWLA 3SXIA 2RABA 3DJDA 4CBQA 4HA6A 3SFEA 1BWCA 4O5UA 4DSGA 1ZOVA 1Z6LA 2QCUA 3DK9A 3QFBA 1K0JA 2WPEA 1IUXA 3FBSA 3PO7A 1DOBA 3KU9A 1H83A 3SY4A 2F5ZA 1E6EA 4I59A 4GF7A 4XWRA 3II4A 5J60A 1ZOYA 2VOUA 1DXLA 2YLSA 2V61A 2ZZ0A 3VR9A 1GXFA 1NHSA 2X50A 4YSZA 2YG4A 4Z44A 4HB9A 3NK2X 3M0OA 1CC4A 3KPFA 4PAAA 3UOXA 3VRBA 3CNSA 2GV8A 4H4UA 4YTMA 4AT0A 2YLXA 3GMBA 4GUVA 3AWIA 1ZMDA 2GR3A 2ARDA 1H7XA 3AD8B 3GYXA 4CCRA 4YWOA 2OLOA 3REDA 5U63A 4B63A 4BJYA 4C74A 4UDPA 2UZZA 3GYIA 1JRYA 2CULA 3GDPA 4ZCCA 1S2YA 1XHCA 4J36A 3SYIA 2DKHA 4OPLA 5KXJA 1PJ5A 3GD3A 1BZLA 2XVFA 5FMHA 2B9YA 4H7UA 4Z26A 3H8LA 3NNEA 3IC9A 2YQUA 2APGA 4E0VA 3AEDA 3EANA 2BYBA 4AP3A 3BNMA 4JNAA 2R46A 5J7XA 2Q7VA 5EBKA 4NTCA 3VRDB 4TLZA 3SFDA 2ZZCA 3AB1A 1PJ7A 1FOHA 4JY3A 2BK5A 4TM4A 2WESA 1GTEA 1F6MA 4A6NB 3DMEA 4CCQA 5KMRA 2X8GA 3QSEA 4BK1A 2BXRA 2VRMA 1CHUA 4G73A 4P9SA 1VDCA 4G6GA 1DJNA 4IV9A 2BC1A 2BRYA 3BNUA 5FS6A 5BUKA 3UKKA 5BULA 5C2TA 5FS7A 3T2KA 1XANA 1VG9A 4B66A 4GDEA 3SM8A 3CNDA 3UKAA 4H4RA 1ONFA 2BA9A 4LU6A 4K5SA 1S3EA 1N1PA 1E1NA 2CFYA 4TM0A 3ADAB 3KLJA 4LIIA 1NAAA 2ZBWA 3NK0X 1F3PA 4A79A 4RG4A 4H4PA 4IA5A 4JY2A 1ZY8A 1OJTA 4A65A 2V3BA 4OPUA 3F8PA 4A7AA 2WOWA 3SZFA 2XLUA 3ICSA 3CGBA 3O0HA 1M6IA 1D7LA 1GRBA 4AP1A 4AOSA 4ZCDA 2WPFA 3UKPA 5C3JA 1MOKA 2JB1A 1ZP0A 3P4PA 3V76A 1O5WA 5HHFA 3SZWA 2BS4A 1GALA 3OC4A 2C67A 2H88A 1PDHA 4C77A 5M10A 1PXBA 5KMSA 4H4YA 5KOXA 2C66A 3F8RA 3KVEA 3FMWA 4M52A 4EM3A 2R45A 3GD4A 1GNDA 1NHQA 3DK4A 4YSYA 4Y4LA 4Y4NA 1B37A 2WBAA 4EMWA 1KNPA 2TMDA 3UKLA 3Q9TA 2GEWA 5M0ZA 3R9UA 2JBVA 2VVLA 3DJGX 3T2ZA 4U2TA 2X8HA 1D7YA 1E1KA 1TYPA 4UDRA 2JK6A 4IVOB 3GSIA 2Q0LA 4OPCA 3E1TA 1QJDA 3H8IA 2XCGA 2Z5YA 4NWZA 1E39A 4H50A 1RSGA 3P9UA 4USQA 4X9NA 2W0HA 3QVRA 4REKA 3I3LA 4B1BA 4TM3A 2E5VA 3V3OA 4C3XA 2XDOA 5BVAA 3S61A 2YG6A 2C75A 1D4DA 1EL9A 1LVLA 1NHRA 2BC0A 2R0GA 3AYLA 3L1RA 4ECHA 5KVHA 5LV9A 1BF3A 3AE4A 1MXTA 4BJZA 4Z2UA 5JCKA 2BCPA 1KFYA 4U8NA 3NGCX 2WDVA 4U8IA 3RHAA 4TLXA 1N4WA 3NTDA 2Y6QA 5KWFA 4H4WA 2B76A 1F8SA 2HQMA 2WU2A 2DKIA 4JDRA 1PBEA 4H2NA 2AAQA 2V60A 2YR5A 3AE7A 3NG7X 1EL7A 3AEEA 1E1LA 1X31B 4YKFA 4TM1A 3CPHG 1DOCA 2YR4A 2QA1A 2JAEA 1H86A 3M12A 5HY5A 2R9ZA 1LV0A 2YR6A 4A5LA 4EQRA 5EB5A 1PHHA 3KKJA 1OJAA 1COYA 3BHKA 3UTEA 4RG3A 3S5WA 3NTAA 3GMCA 1PXCA 1OJCA 5GSNA 4B64A 5KMQA 1YQ4A 4G74A 4EQWA 1L0VA 1NG4A 3UOZA 3NHOX 2ZZBA 2R4EA 1PXAA 3UTFA 2EQ6A 2WP5A 3C4AA 4FK1C 4KX6A 2XFUA 4H4ZA 1NPXA 2XFOA 4H4SA 1CJCA 1LJ1A 2GB0A 4OVIA 5HYMA 2V3AA 1JOAA 4J2WA 2GAHB 1P2HA 2XVIA 1PBFA 1PN0A 1TRBA 3D1CA 3HYVA 5HXIA 3AYJA 1OJ9A 2GQWA 1LQUA 4U2LA 1H6VA 2WPCA 3C96A 1TDEA 1QLBA 3DK8A 4H4QA 3P4SA 5IQ4A 1PBBA 1DNCA 2E4GA 1FEAA 3H4KA 4OPGA 1NG3A 4K5RA 1LQTA 3UKQA 3CNTA 3UP5A 1JRZA 4CNJA 3T14A 2GR2A 2AR8A 1H7WA 2BK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C72 A;  1XPQ A;  1JNZ A;  2BAC A;  3AEA A;  3CTY A;  3NYE A;  4FX9 A;  1OJD A;  2QAE A;  4BUR A;  1ZX9 A;  1XDI A;  2VQB A;  4YTP A;  2XVH A;  1ZDL A;  2FBW A;  2GAG B;  5JCM A;  4X9M A;  3ICR A;  4NTD A;  3B3R A;  1CC2 A;  2IID A;  1PS9 A;  4B67 A;  4YTN A;  2WDQ A;  2C7G A;  4WX1 A;  4EIQ A;  3VRA A;  3G5R A;  3WE0 A;  3CIR A;  1KF6 A;  4CY6 A;  3AE6 A;  1ZKQ A;  5TR3 A;  3SQP A;  4GR1 A;  2XLR A;  4GCM A;  3P4Q A;  1F8W A;  3AE2 A;  3NT6 A;  3DJJ A;  1FL2 A;  1CL0 A;  1YQ3 A;  2PHH A;  3CNP A;  2A8X A;  3NRN A;  4Y4M A;  4AOX A;  4YT0 A;  2WU5 A;  2CVJ A;  4BV6 A;  2GR1 A;  1L9C A;  3LJP A;  2EQ7 A;  3K30 A;  3T37 A;  3COX A;  1Q1R A;  4AT2 A;  4DGK A;  4K22 A;  2WET A;  3RP7 A;  5CKU A;  1GET A;  4U8O A;  4NTE A;  4DSH A;  4Z2T A;  1B8S A;  4YKG A;  3JSK A;  1FEC A;  3CGD A;  2NPX A;  1TDO A;  3VQR A;  4DNA A;  3LZW A;  1PBD A;  3GDN A;  2J3N A;  3AE9 A;  1JRX A;  2YVG A;  4OPT A;  4H4T A;  1E1M A;  2I0Z A;  5L46 A;  2XVJ A;  1DOE A;  3GRT A;  1L9D A;  1REO A;  3QVP A;  4CNK A;  3RP6 A;  2BCG G;  5ER0 A;  5KRQ A;  1CJ4 A;  2B7R A;  1GEU A;  4H2R A;  3QSS A;  1GRH A;  1CF3 A;  1H81 A;  2YVF A;  1GOS A;  4NEV A;  4PAB A;  2BAB A;  1UKV G;  4USR A;  3URH A;  2CDU A;  4I58 A;  4EMI A;  1SEZ A;  3NN6 X;  3C4N A;  1DJQ A;  2GMJ A;  3IWA A;  3NN0 X;  1BGJ A;  3IHM A;  3PS9 A;  2XLS A;  3FIM B;  2WOV A;  2Q0K A;  2WHD A;  2YAU A;  4K8D A;  4XWZ A;  1PJ6 A;  1GRT A;  4IA6 A;  3BI5 A;  3AEC A;  2V5Z A;  1IUW A;  1Y56 B;  2R4J A;  4H2P A;  4JN9 A;  4D04 A;  2OAL A;  1FCD A;  2BK3 A;  1TYT A;  3AEF A;  2BS3 A;  3AE8 A;  4YSH A;  1GRF A;  2VVL G;  4K7Z A;  1DOD A;  1W4X A;  2TPR A;  5U1O A;  2FJB A;  3AE1 A;  3ICT A;  4EQX A;  1EL5 A;  1F8R A;  4GRT A;  5JCI A;  1GRA A;  1TDK A;  4U8J A;  4IVM B;  1GER A;  1CC6 A;  3P1W A;  4OPI A;  1BKW A;  1KDG A;  2YM1 A;  3UP4 A;  2YVJ A;  1EL8 A;  4ICY A;  4GDP A;  5IPY A;  1BGN A;  2XFQ A;  2QA2 A;  4O5Q A;  4BK3 A;  3KA7 A;  1IJH A;  4WCT A;  1PBC A;  3RP8 A;  1H84 A;  3NKS A;  2VVM A;  3DH9 A;  4ADW A;  1K4Q A;  2GQF A;  2Z5X A;  4EIP A;  4JQ9 A;  2JB3 A;  3GYJ A;  4CY8 A;  2X8C A;  1ZK7 A;  3CGE A;  1RP0 A;  2NVK X;  3K7M X;  1IUU A;  4J34 A;  2O9Z A;  2VRL A;  1GPE A;  4H4X A;  4KPR A;  2XVE A;  2YLT A;  5GRT A;  3GRS A;  1L9E A;  1TDF A;  2FJE A;  4B69 A;  4J33 A;  3LAD A;  1VQW A;  1ZMC A;  4U8K A;  2C73 A;  3CGC A;  3DGH A;  2XFN A;  3LXD A;  4J31 A;  4D03 A;  2GR0 A;  1YKJ A;  4Z2R A;  3QSM A;  3UTG A;  2GMH A;  2WOI A;  3FPZ A;  1KNR A;  2WDR A;  3ITJ A;  1IUS A;  1GES A;  1Y0P A;  5KVI A;  3NYC A;  2WP6 A;  3UOY A;  4EQS A;  4YXD A;  3K7Q X;  1HYU A;  1LPF A;  4C5O A;  2AQJ A;  3CNJ A;  5DBJ A;  1RYI A;  2EQ8 A;  2PYX A;  1VRQ B;  2B7S A;  3EPT A;  4Z43 A;  3HZL A;  4Z25 A;  2C3D A;  2IVD A;  5IQ1 A;  2GF3 A;  1KSU A;  3CPI G;  1CJ2 A;  4A6N A;  2YLR A;  1GSN A;  3PVC A;  4K2X A;  5FS8 A;  2RGO A;  4OPD A;  1GRE A;  2R0C A;  3GWF A;  3GWD A;  1NDA A;  3BI2 A;  3CPJ G;  2FJD A;  2XLP A;  2OLN A;  4NZH A;  2OAM A;  5BRT A;  1NEK A;  4A99 A;  1V59 A;  3P4R A;  1S2Q A;  5FS9 A;  3RNM A;  4U8P A;  1TDN A;  4EM4 A;  2XYO A;  4C3Y A;  1JNR A;  2YG5 A;  2RGH A;  2H89 A;  3SGL A;  2C76 A;  1CJ3 A;  1Q9I A;  3EF6 A;  3BI4 A;  4FK1 A;  2JKC A;  2WS3 A;  3UOV A;  3ZYX A;  5EB4 A;  4A9W A;  2IVE A;  2BS2 A;  4UP3 A;  3AXB A;  1M64 A;  1JEH A;  1ELI A;  3Q6J A;  5JCL A;  3AD9 B;  1D5T A;  4ZN0 A;  1EBD A;  3CN8 A;  2OA1 A;  3LOV A;  4U8L A;  2XLT A;  3NLC A;  2C3C A;  2YG7 A;  2EQ9 A;  2YLZ A;  3ALJ A;  4JNQ A;  1FEB A;  1YQZ A;  2YLW A;  5CQF A;  1K0L A;  3ATR A;  2B9X A;  1LTX R;  2B9W A;  3ISH A;  1MO9 A;  1NHP A;  2VQ7 A;  3L8K A;  3UCL A;  4LA1 A;  4N9X A;  4CRT A;  4OCG A;  1D4C A;  3QFA A;  3ALM A;  3ZDN A;  2VZ2 A;  3FG2 P;  3AD7 B;  4H2Q A;  4J57 A;  4Z24 A;  2C65 A;  2V6O A;  1GV4 A;  3NIX A;  3ALL A;  1VG0 A;  3KD9 A;  2XFP A;  1KSS A;  2ACZ A;  3AEG A;  5KOW A;  3AEB A;  3LB8 A;  2Y6R A;  1GTH A;  2WEU A;  4MJW A;  1IUT A;  4NEW A;  4X4J A;  1K0I A;  1CBO A;  3EAO A;  1O95 A;  3V3N A;  2JB2 A;  5U25 A;  3K7T A;  3UTH A;  1JU2 A;  2YM2 A;  2E1M A;  3AYI A;  1QO8 A;  3G5Q A;  4U8M A;  4BK2 A;  3NH3 X;  2X99 A;  3B6D A;  3ATQ A;  2FJA A;  1YY5 A;  3AE5 A;  3NYF A;  1AOG A;  1S3B A;  2BXS A;  3IF9 A;  2A89 A;  1B5Q A;  2Q6U A;  2YG3 A;  4H4V A;  3NK1 X;  4J56 A;  2WQY A;  4RSL A;  3AE3 A;  2A87 A;  1Y56 A;  2R0P A;  2RGJ A;  5JCN A;  2C64 A;  3F8D A;  5EOW A;  3UKH A;  4U2S A;  1O94 A;  1N4V A;  1P2E A;  3BHF A;  1D4E A;  4EMJ A;  3OZ2 A;  4APN A;  3IHG A;  3UKF A;  1N4U A;  4FDC B;  3VR8 A;  1H82 A;  1E7P A;  1NEN A;  1Q1W A;  3G5S A;  3M13 A;  2GVC A;  1GT8 A;  1IUV A;  2C70 A;  3LZX A;  4UDQ A;  4YSX A;  2GH5 A;  3DGZ A;  1B4V A;  2X3N A;  1GRG A;  2GRT A;  4B68 A;  4B65 A;  3I6D A;  3ABV A;  3DA1 A;  3D8X A;  2WP9 A;  3DJE A;  3QJ4 A;  4XXG A;  2YWL A;  2RAB A;  3DJD A;  4CBQ A;  4HA6 A;  3SFE A;  1BWC A;  4O5U A;  4DSG A;  1ZOV A;  1Z6L A;  2QCU A;  3DK9 A;  3QFB A;  1K0J A;  2WPE A;  1IUX A;  3FBS A;  3PO7 A;  1DOB A;  3KU9 A;  1H83 A;  2F5Z A;  1E6E A;  4I59 A;  4GF7 A;  4XWR A;  3II4 A;  5J60 A;  1ZOY A;  2VOU A;  1DXL A;  2YLS A;  2V61 A;  2ZZ0 A;  3VR9 A;  1GXF A;  1NHS A;  2X50 A;  4YSZ A;  2YG4 A;  4Z44 A;  4HB9 A;  3NK2 X;  3M0O A;  1CC4 A;  3KPF A;  4PAA A;  3UOX A;  3VRB A;  3CNS A;  2GV8 A;  4H4U A;  4YTM A;  4AT0 A;  2YLX A;  3GMB A;  4GUV A;  3AWI A;  1ZMD A;  2GR3 A;  2ARD A;  1H7X A;  3AD8 B;  4CCR A;  4YWO A;  2OLO A;  3RED A;  5U63 A;  4B63 A;  4BJY A;  4C74 A;  4UDP A;  2UZZ A;  3GYI A;  1JRY A;  2CUL A;  3GDP A;  4ZCC A;  1S2Y A;  1XHC A;  4J36 A;  2DKH A;  4OPL A;  5KXJ A;  1PJ5 A;  3GD3 A;  1BZL A;  2XVF A;  5FMH A;  2B9Y A;  4H7U A;  4Z26 A;  3H8L A;  3NNE A;  3IC9 A;  2YQU A;  2APG A;  4E0V A;  3AED A;  3EAN A;  2BYB A;  4AP3 A;  3BNM A;  4JNA A;  2R46 A;  5J7X A;  2Q7V A;  5EBK A;  4NTC A;  3VRD B;  4TLZ A;  3SFD A;  2ZZC A;  3AB1 A;  1PJ7 A;  1FOH A;  4JY3 A;  2BK5 A;  4TM4 A;  2WES A;  1GTE A;  1F6M A;  4A6N B;  3DME A;  4CCQ A;  2X8G A;  3QSE A;  4BK1 A;  2BXR A;  2VRM A;  1CHU A;  4P9S A;  1VDC A;  1DJN A;  4IV9 A;  2BC1 A;  3BNU A;  5FS6 A;  5BUK A;  3UKK A;  5BUL A;  5C2T A;  5FS7 A;  1XAN A;  1VG9 A;  4B66 A;  4GDE A;  3SM8 A;  3CND A;  3UKA A;  4H4R A;  1ONF A;  2BA9 A;  4LU6 A;  4K5S A;  1S3E A;  1N1P A;  1E1N A;  2CFY A;  4TM0 A;  3ADA B;  3KLJ A;  4LII A;  1NAA A;  2ZBW A;  3NK0 X;  1F3P A;  4A79 A;  4RG4 A;  4H4P A;  4IA5 A;  4JY2 A;  1ZY8 A;  1OJT A;  4A65 A;  2V3B A;  4OPU A;  3F8P A;  4A7A A;  2WOW A;  2XLU A;  3ICS A;  3CGB A;  3O0H A;  1M6I A;  1D7L A;  1GRB A;  4AP1 A;  4AOS A;  4ZCD A;  2WPF A;  3UKP A;  5C3J A;  1MOK A;  2JB1 A;  1ZP0 A;  3P4P A;  3V76 A;  1O5W A;  5HHF A;  2BS4 A;  1GAL A;  3OC4 A;  2C67 A;  2H88 A;  1PDH A;  4C77 A;  5M10 A;  1PXB A;  4H4Y A;  5KOX A;  2C66 A;  3F8R A;  3KVE A;  3FMW A;  4M52 A;  4EM3 A;  2R45 A;  3GD4 A;  1GND A;  1NHQ A;  3DK4 A;  4YSY A;  4Y4L A;  4Y4N A;  1B37 A;  2WBA A;  4EMW A;  1KNP A;  2TMD A;  3UKL A;  3Q9T A;  2GEW A;  5M0Z A;  3R9U A;  2JBV A;  2VVL A;  3DJG X;  4U2T A;  2X8H A;  1D7Y A;  1E1K A;  1TYP A;  4UDR A;  2JK6 A;  4IVO B;  3GSI A;  2Q0L A;  4OPC A;  3E1T A;  1QJD A;  3H8I A;  2XCG A;  2Z5Y A;  1E39 A;  4H50 A;  1RSG A;  3P9U A;  4USQ A;  4X9N A;  2W0H A;  3QVR A;  4REK A;  3I3L A;  4B1B A;  4TM3 A;  2E5V A;  3V3O A;  4C3X A;  2XDO A;  5BVA A;  3S61 A;  2YG6 A;  2C75 A;  1D4D A;  1EL9 A;  1LVL A;  1NHR A;  2BC0 A;  2R0G A;  3AYL A;  3L1R A;  4ECH A;  5KVH A;  5LV9 A;  1BF3 A;  3AE4 A;  1MXT A;  4BJZ A;  4Z2U A;  5JCK A;  2BCP A;  1KFY A;  4U8N A;  3NGC X;  2WDV A;  4U8I A;  3RHA A;  4TLX A;  1N4W A;  3NTD A;  2Y6Q A;  5KWF A;  4H4W A;  2B76 A;  1F8S A;  2HQM A;  2WU2 A;  2DKI A;  4JDR A;  1PBE A;  4H2N A;  2AAQ A;  2V60 A;  2YR5 A;  3AE7 A;  3NG7 X;  1EL7 A;  3AEE A;  1E1L A;  1X31 B;  4YKF A;  4TM1 A;  3CPH G;  1DOC A;  2YR4 A;  2QA1 A;  2JAE A;  1H86 A;  3M12 A;  5HY5 A;  2R9Z A;  1LV0 A;  2YR6 A;  4A5L A;  4EQR A;  5EB5 A;  1PHH A;  3KKJ A;  1OJA A;  1COY A;  3BHK A;  3UTE A;  4RG3 A;  3S5W A;  3NTA A;  3GMC A;  1PXC A;  1OJC A;  5GSN A;  4B64 A;  1YQ4 A;  4EQW A;  1L0V A;  1NG4 A;  3UOZ A;  3NHO X;  2ZZB A;  2R4E A;  1PXA A;  3UTF A;  2EQ6 A;  2WP5 A;  3C4A A;  4FK1 C;  4KX6 A;  2XFU A;  4H4Z A;  1NPX A;  2XFO A;  4H4S A;  1CJC A;  1LJ1 A;  2GB0 A;  4OVI A;  5HYM A;  2V3A A;  1JOA A;  4J2W A;  2GAH B;  1P2H A;  2XVI A;  1PBF A;  1PN0 A;  1TRB A;  3D1C A;  5HXI A;  3AYJ A;  1OJ9 A;  2GQW A;  1LQU A;  4U2L A;  1H6V A;  2WPC A;  3C96 A;  1TDE A;  1QLB A;  3DK8 A;  4H4Q A;  3P4S A;  5IQ4 A;  1PBB A;  1DNC A;  2E4G A;  1FEA A;  3H4K A;  4OPG A;  1NG3 A;  4K5R A;  1LQT A;  3UKQ A;  3CNT A;  3UP5 A;  1JRZ A;  4CNJ A;  2GR2 A;  2AR8 A;  1H7W A;  2BK4 A; 
#chains in the Genus database with same CATH topology
 2C72 A;  1XPQ A;  1JNZ A;  2BAC A;  3AEA A;  3CTY A;  3NYE A;  4NNJ A;  4FX9 A;  1OJD A;  2QAE A;  4BUR A;  1ZX9 A;  1XDI A;  2VQB A;  4YTP A;  2XVH A;  1ZDL A;  2FBW A;  2GAG B;  5JCM A;  4X9M A;  3ICR A;  4NTD A;  3B3R A;  1CC2 A;  2IID A;  1PS9 A;  4B67 A;  4YTN A;  2WDQ A;  2C7G A;  4WX1 A;  4EIQ A;  3VRA A;  3G5R A;  3WE0 A;  3CIR A;  1KF6 A;  4CY6 A;  3AE6 A;  1ZKQ A;  5TR3 A;  3SQP A;  4GR1 A;  2XLR A;  4GCM A;  3P4Q A;  1F8W A;  3AE2 A;  3NT6 A;  3DJJ A;  1FL2 A;  1CL0 A;  1YQ3 A;  2PHH A;  3CNP A;  2A8X A;  3NRN A;  4Y4M A;  4AOX A;  4YT0 A;  2WU5 A;  2CVJ A;  4BV6 A;  2GR1 A;  1L9C A;  3LJP A;  2EQ7 A;  3K30 A;  3T37 A;  3COX A;  1Q1R A;  4AT2 A;  4DGK A;  4K22 A;  2WET A;  3RP7 A;  5CKU A;  1GET A;  4U8O A;  4NTE A;  4DSH A;  4Z2T A;  1B8S A;  4YKG A;  3JSK A;  1FEC A;  3CGD A;  2NPX A;  1TDO A;  3VQR A;  4DNA A;  3LZW A;  1PBD A;  3GDN A;  2J3N A;  3AE9 A;  1JRX A;  2YVG A;  4OPT A;  4H4T A;  1E1M A;  2I0Z A;  5L46 A;  2XVJ A;  1DOE A;  3GRT A;  1L9D A;  1REO A;  3QVP A;  4CNK A;  3RP6 A;  2BCG G;  5ER0 A;  5KRQ A;  1CJ4 A;  2B7R A;  1GEU A;  4H2R A;  3QSS A;  1GRH A;  1CF3 A;  1H81 A;  2YVF A;  1GOS A;  4GAV A;  4NEV A;  2BAB A;  1UKV G;  4PAB A;  4USR A;  3URH A;  2CDU A;  4I58 A;  4EMI A;  1SEZ A;  3NN6 X;  3C4N A;  1DJQ A;  2GMJ A;  3IWA A;  3NN0 X;  1BGJ A;  3IHM A;  3PS9 A;  2XLS A;  3FIM B;  2WOV A;  2Q0K A;  2WHD A;  2YAU A;  4K8D A;  4XWZ A;  1PJ6 A;  1GRT A;  4G9K A;  4IA6 A;  3BI5 A;  3AEC A;  2V5Z A;  1IUW A;  1Y56 B;  2R4J A;  4H2P A;  4JN9 A;  4D04 A;  2OAL A;  1FCD A;  2BK3 A;  1TYT A;  3AEF A;  2BS3 A;  3AE8 A;  4YSH A;  1GRF A;  2VVL G;  4K7Z A;  1DOD A;  1W4X A;  2TPR A;  5U1O A;  2FJB A;  3AE1 A;  3ICT A;  4EQX A;  1EL5 A;  1F8R A;  4GRT A;  5JCI A;  1GRA A;  1TDK A;  4U8J A;  4IVM B;  1GER A;  1CC6 A;  3P1W A;  4OPI A;  1BKW A;  1KDG A;  2YM1 A;  3UP4 A;  2YVJ A;  1EL8 A;  4ICY A;  4GDP A;  5IPY A;  1BGN A;  2XFQ A;  2QA2 A;  4O5Q A;  4BK3 A;  3KA7 A;  1IJH A;  3HYW A;  4WCT A;  3SZC A;  1PBC A;  3RP8 A;  1H84 A;  3NKS A;  2VVM A;  2C4C A;  3DH9 A;  4ADW A;  1K4Q A;  2GQF A;  2Z5X A;  4EIP A;  4JQ9 A;  2JB3 A;  3GYJ A;  4CY8 A;  2X8C A;  1ZK7 A;  3CGE A;  1RP0 A;  2NVK X;  3K7M X;  1IUU A;  4J34 A;  2O9Z A;  2VRL A;  1GPE A;  4H4X A;  4KPR A;  2XVE A;  2YLT A;  3CMM A;  5GRT A;  3GRS A;  1L9E A;  1TDF A;  2FJE A;  4B69 A;  3HYX A;  4J33 A;  3LAD A;  1VQW A;  1ZMC A;  4U8K A;  2C73 A;  3CGC A;  3DGH A;  2XFN A;  3LXD A;  4J31 A;  4D03 A;  2GR0 A;  1YKJ A;  4Z2R A;  3QSM A;  4II2 A;  3UTG A;  2GMH A;  2WOI A;  3FPZ A;  1KNR A;  2WDR A;  3ITJ A;  1IUS A;  1GES A;  1Y0P A;  5KVI A;  3NYC A;  2WP6 A;  3UOY A;  4EQS A;  4YXD A;  3K7Q X;  1HYU A;  1LPF A;  4C5O A;  2AQJ A;  5KMP A;  3CNJ A;  5DBJ A;  1RYI A;  2EQ8 A;  2PYX A;  1VRQ B;  2B7S A;  3EPT A;  4Z43 A;  3HZL A;  3T0K A;  4Z25 A;  2C3D A;  2IVD A;  5IQ1 A;  2GF3 A;  1KSU A;  3CPI G;  1CJ2 A;  4A6N A;  2YLR A;  3T2Y A;  3KPK A;  1GSN A;  3PVC A;  4K2X A;  5FS8 A;  2RGO A;  4OPD A;  1GRE A;  2R0C A;  3GWF A;  3GWD A;  1NDA A;  3BI2 A;  3CPJ G;  2FJD A;  2XLP A;  2OLN A;  4NZH A;  2OAM A;  5BRT A;  1NEK A;  4A99 A;  1V59 A;  3P4R A;  1S2Q A;  5FS9 A;  3RNM A;  4U8P A;  1TDN A;  3T31 A;  3SZ0 A;  4EM4 A;  2XYO A;  4C3Y A;  1JNR A;  2YG5 A;  2RGH A;  2H89 A;  3SGL A;  2C76 A;  1CJ3 A;  1Q9I A;  3EF6 A;  3BI4 A;  4FK1 A;  2JKC A;  2WS3 A;  4G6H A;  3UOV A;  3ZYX A;  5EB4 A;  4A9W A;  2IVE A;  2BS2 A;  4UP3 A;  3AXB A;  1M64 A;  1JEH A;  1ELI A;  3Q6J A;  5JCL A;  3AD9 B;  1D5T A;  4ZN0 A;  1EBD A;  3CN8 A;  2OA1 A;  3LOV A;  4U8L A;  2XLT A;  3NLC A;  2C3C A;  2YG7 A;  2EQ9 A;  2YLZ A;  3ALJ A;  4GAP A;  1FEB A;  1YQZ A;  2YLW A;  4JNQ A;  1K0L A;  5CQF A;  3ATR A;  2B9X A;  1LTX R;  2B9W A;  3ISH A;  1MO9 A;  1NHP A;  2VQ7 A;  3L8K A;  3UCL A;  4LA1 A;  4N9X A;  4CRT A;  4OCG A;  1D4C A;  3QFA A;  3ALM A;  3ZDN A;  2VZ2 A;  3FG2 P;  3AD7 B;  4H2Q A;  4J57 A;  4Z24 A;  2C65 A;  2V6O A;  1GV4 A;  3NIX A;  3ALL A;  1VG0 A;  3KD9 A;  2XFP A;  1KSS A;  2ACZ A;  2BRA A;  3AEG A;  3AEB A;  3LB8 A;  5KOW A;  2Y6R A;  1GTH A;  2WEU A;  4MJW A;  1IUT A;  4NEW A;  4X4J A;  1K0I A;  1CBO A;  3EAO A;  1O95 A;  3V3N A;  2JB2 A;  5U25 A;  3K7T A;  3UTH A;  1JU2 A;  2YM2 A;  2E1M A;  3AYI A;  1QO8 A;  3G5Q A;  4U8M A;  4BK2 A;  3NH3 X;  2X99 A;  3B6D A;  3ATQ A;  2FJA A;  1YY5 A;  3AE5 A;  3NYF A;  1AOG A;  1S3B A;  2BXS A;  5KNL A;  3IF9 A;  2A89 A;  1B5Q A;  2Q6U A;  2YG3 A;  4H4V A;  3NK1 X;  4J56 A;  2WQY A;  4RSL A;  3AE3 A;  2A87 A;  1Y56 A;  2R0P A;  2RGJ A;  5JCN A;  2C64 A;  3F8D A;  5EOW A;  3UKH A;  4U2S A;  1O94 A;  1N4V A;  1P2E A;  3BHF A;  1D4E A;  4EMJ A;  3OZ2 A;  4APN A;  3IHG A;  4II3 A;  3UKF A;  1N4U A;  4FDC B;  3VR8 A;  1H82 A;  1E7P A;  1NEN A;  1Q1W A;  3G5S A;  3M13 A;  2GVC A;  1GT8 A;  1IUV A;  2C70 A;  3LZX A;  4UDQ A;  4YSX A;  2GH5 A;  3SX6 A;  3DGZ A;  1B4V A;  2X3N A;  1GRG A;  2GRT A;  4B68 A;  4B65 A;  3I6D A;  3ABV A;  3DA1 A;  3D8X A;  2WP9 A;  3DJE A;  3QJ4 A;  4XXG A;  2YWL A;  3SXI A;  2RAB A;  3DJD A;  4CBQ A;  4HA6 A;  3SFE A;  1BWC A;  4O5U A;  4DSG A;  1ZOV A;  1Z6L A;  2QCU A;  3DK9 A;  3QFB A;  1K0J A;  2WPE A;  1IUX A;  3FBS A;  3PO7 A;  1DOB A;  3KU9 A;  1H83 A;  3SY4 A;  2F5Z A;  1E6E A;  4I59 A;  4GF7 A;  4XWR A;  3II4 A;  5J60 A;  1ZOY A;  2VOU A;  1DXL A;  2YLS A;  2V61 A;  2ZZ0 A;  3VR9 A;  1GXF A;  1NHS A;  2X50 A;  4YSZ A;  2YG4 A;  4Z44 A;  4HB9 A;  3NK2 X;  3M0O A;  1CC4 A;  3KPF A;  4PAA A;  3UOX A;  3VRB A;  3CNS A;  2GV8 A;  4H4U A;  4YTM A;  4AT0 A;  2YLX A;  3GMB A;  4GUV A;  3AWI A;  1ZMD A;  2GR3 A;  2ARD A;  1H7X A;  3AD8 B;  3GYX A;  4CCR A;  4YWO A;  2OLO A;  3RED A;  5U63 A;  4B63 A;  4BJY A;  4C74 A;  4UDP A;  2UZZ A;  3GYI A;  1JRY A;  2CUL A;  3GDP A;  4ZCC A;  1S2Y A;  1XHC A;  4J36 A;  3SYI A;  2DKH A;  4OPL A;  5KXJ A;  1PJ5 A;  3GD3 A;  1BZL A;  2XVF A;  5FMH A;  2B9Y A;  4H7U A;  4Z26 A;  3H8L A;  3NNE A;  3IC9 A;  2YQU A;  2APG A;  4E0V A;  3AED A;  3EAN A;  2BYB A;  4AP3 A;  3BNM A;  4JNA A;  2R46 A;  5J7X A;  2Q7V A;  5EBK A;  4NTC A;  3VRD B;  4TLZ A;  3SFD A;  2ZZC A;  3AB1 A;  1PJ7 A;  1FOH A;  4JY3 A;  2BK5 A;  4TM4 A;  2WES A;  1GTE A;  1F6M A;  4A6N B;  3DME A;  4CCQ A;  5KMR A;  2X8G A;  3QSE A;  4BK1 A;  2BXR A;  2VRM A;  1CHU A;  4G73 A;  4P9S A;  1VDC A;  4G6G A;  1DJN A;  4IV9 A;  2BC1 A;  2BRY A;  3BNU A;  5FS6 A;  5BUK A;  3UKK A;  5BUL A;  5C2T A;  5FS7 A;  3T2K A;  1XAN A;  1VG9 A;  4B66 A;  4GDE A;  3SM8 A;  3CND A;  3UKA A;  4H4R A;  1ONF A;  2BA9 A;  4LU6 A;  4K5S A;  1S3E A;  1N1P A;  1E1N A;  2CFY A;  4TM0 A;  3ADA B;  3KLJ A;  4LII A;  1NAA A;  2ZBW A;  3NK0 X;  1F3P A;  4A79 A;  4RG4 A;  4H4P A;  4IA5 A;  4JY2 A;  1ZY8 A;  1OJT A;  4A65 A;  2V3B A;  4OPU A;  3F8P A;  4A7A A;  2WOW A;  3SZF A;  2XLU A;  3ICS A;  3CGB A;  3O0H A;  1M6I A;  1D7L A;  1GRB A;  4AP1 A;  4AOS A;  4ZCD A;  2WPF A;  3UKP A;  5C3J A;  1MOK A;  2JB1 A;  1ZP0 A;  3P4P A;  3V76 A;  1O5W A;  5HHF A;  3SZW A;  2BS4 A;  1GAL A;  3OC4 A;  2C67 A;  2H88 A;  1PDH A;  4C77 A;  5M10 A;  1PXB A;  5KMS A;  4H4Y A;  5KOX A;  2C66 A;  3F8R A;  3KVE A;  3FMW A;  4M52 A;  4EM3 A;  2R45 A;  3GD4 A;  1GND A;  1NHQ A;  3DK4 A;  4YSY A;  4Y4L A;  4Y4N A;  1B37 A;  2WBA A;  4EMW A;  1KNP A;  2TMD A;  3UKL A;  3Q9T A;  2GEW A;  5M0Z A;  3R9U A;  2JBV A;  2VVL A;  3DJG X;  3T2Z A;  4U2T A;  2X8H A;  1D7Y A;  1E1K A;  1TYP A;  4UDR A;  2JK6 A;  4IVO B;  3GSI A;  2Q0L A;  4OPC A;  3E1T A;  1QJD A;  3H8I A;  2XCG A;  2Z5Y A;  4NWZ A;  1E39 A;  4H50 A;  1RSG A;  3P9U A;  4USQ A;  4X9N A;  2W0H A;  3QVR A;  4REK A;  3I3L A;  4B1B A;  4TM3 A;  2E5V A;  3V3O A;  4C3X A;  2XDO A;  5BVA A;  3S61 A;  2YG6 A;  2C75 A;  1D4D A;  1EL9 A;  1LVL A;  1NHR A;  2BC0 A;  2R0G A;  3AYL A;  3L1R A;  4ECH A;  5KVH A;  5LV9 A;  1BF3 A;  3AE4 A;  1MXT A;  4BJZ A;  4Z2U A;  5JCK A;  2BCP A;  1KFY A;  4U8N A;  3NGC X;  2WDV A;  4U8I A;  3RHA A;  4TLX A;  1N4W A;  3NTD A;  2Y6Q A;  5KWF A;  4H4W A;  2B76 A;  1F8S A;  2HQM A;  2WU2 A;  2DKI A;  4JDR A;  1PBE A;  4H2N A;  2AAQ A;  2V60 A;  2YR5 A;  3AE7 A;  3NG7 X;  1EL7 A;  3AEE A;  1E1L A;  1X31 B;  4YKF A;  4TM1 A;  3CPH G;  1DOC A;  2YR4 A;  2QA1 A;  2JAE A;  1H86 A;  3M12 A;  5HY5 A;  2R9Z A;  1LV0 A;  2YR6 A;  4A5L A;  4EQR A;  5EB5 A;  1PHH A;  3KKJ A;  1OJA A;  1COY A;  3BHK A;  3UTE A;  4RG3 A;  3S5W A;  3NTA A;  3GMC A;  1PXC A;  1OJC A;  5GSN A;  4B64 A;  5KMQ A;  1YQ4 A;  4G74 A;  4EQW A;  1L0V A;  1NG4 A;  3UOZ A;  3NHO X;  2ZZB A;  2R4E A;  1PXA A;  3UTF A;  2EQ6 A;  2WP5 A;  3C4A A;  4FK1 C;  4KX6 A;  2XFU A;  4H4Z A;  1NPX A;  2XFO A;  4H4S A;  1CJC A;  1LJ1 A;  2GB0 A;  4OVI A;  5HYM A;  2V3A A;  1JOA A;  4J2W A;  2GAH B;  1P2H A;  2XVI A;  1PBF A;  1PN0 A;  1TRB A;  3D1C A;  3HYV A;  5HXI A;  3AYJ A;  1OJ9 A;  2GQW A;  1LQU A;  4U2L A;  1H6V A;  2WPC A;  3C96 A;  1TDE A;  1QLB A;  3DK8 A;  4H4Q A;  3P4S A;  5IQ4 A;  1PBB A;  1DNC A;  2E4G A;  1FEA A;  3H4K A;  4OPG A;  1NG3 A;  4K5R A;  1LQT A;  3UKQ A;  3CNT A;  3UP5 A;  1JRZ A;  4CNJ A;  3T14 A;  2GR2 A;  2AR8 A;  1H7W A;  2BK4 A; 
#chains in the Genus database with same CATH homology
 2C72 A;  1XPQ A;  1JNZ A;  2BAC A;  3AEA A;  3CTY A;  3NYE A;  4NNJ A;  4FX9 A;  1OJD A;  2QAE A;  4BUR A;  1ZX9 A;  1XDI A;  2VQB A;  4YTP A;  2XVH A;  1ZDL A;  2FBW A;  2GAG B;  5JCM A;  4X9M A;  3ICR A;  4NTD A;  3B3R A;  1CC2 A;  2IID A;  1PS9 A;  4B67 A;  4YTN A;  2WDQ A;  2C7G A;  4WX1 A;  4EIQ A;  3VRA A;  3G5R A;  3WE0 A;  3CIR A;  1KF6 A;  4CY6 A;  3AE6 A;  1ZKQ A;  5TR3 A;  3SQP A;  4GR1 A;  2XLR A;  4GCM A;  3P4Q A;  1F8W A;  3AE2 A;  3NT6 A;  3DJJ A;  1FL2 A;  1CL0 A;  1YQ3 A;  2PHH A;  3CNP A;  2A8X A;  3NRN A;  4Y4M A;  4AOX A;  4YT0 A;  2WU5 A;  2CVJ A;  4BV6 A;  2GR1 A;  1L9C A;  3LJP A;  2EQ7 A;  3K30 A;  3T37 A;  3COX A;  1Q1R A;  4AT2 A;  4DGK A;  4K22 A;  2WET A;  3RP7 A;  5CKU A;  1GET A;  4U8O A;  4NTE A;  4DSH A;  4Z2T A;  1B8S A;  4YKG A;  3JSK A;  1FEC A;  3CGD A;  2NPX A;  1TDO A;  3VQR A;  4DNA A;  3LZW A;  1PBD A;  3GDN A;  2J3N A;  3AE9 A;  1JRX A;  2YVG A;  4OPT A;  4H4T A;  1E1M A;  2I0Z A;  5L46 A;  2XVJ A;  1DOE A;  3GRT A;  1L9D A;  1REO A;  3QVP A;  4CNK A;  3RP6 A;  2BCG G;  5ER0 A;  5KRQ A;  1CJ4 A;  2B7R A;  1GEU A;  4H2R A;  3QSS A;  1GRH A;  1CF3 A;  1H81 A;  2YVF A;  1GOS A;  4GAV A;  4NEV A;  2BAB A;  1UKV G;  4PAB A;  4USR A;  3URH A;  2CDU A;  4I58 A;  4EMI A;  1SEZ A;  3NN6 X;  3C4N A;  1DJQ A;  2GMJ A;  3IWA A;  3NN0 X;  1BGJ A;  3IHM A;  3PS9 A;  2XLS A;  3FIM B;  2WOV A;  2Q0K A;  2WHD A;  2YAU A;  4K8D A;  4XWZ A;  1PJ6 A;  1GRT A;  4G9K A;  4IA6 A;  3BI5 A;  3AEC A;  2V5Z A;  1IUW A;  1Y56 B;  2R4J A;  4H2P A;  4JN9 A;  4D04 A;  2OAL A;  1FCD A;  2BK3 A;  1TYT A;  3AEF A;  2BS3 A;  3AE8 A;  4YSH A;  1GRF A;  2VVL G;  4K7Z A;  1DOD A;  1W4X A;  2TPR A;  5U1O A;  2FJB A;  3AE1 A;  3ICT A;  4EQX A;  1EL5 A;  1F8R A;  4GRT A;  5JCI A;  1GRA A;  1TDK A;  4U8J A;  4IVM B;  1GER A;  1CC6 A;  3P1W A;  4OPI A;  1BKW A;  1KDG A;  2YM1 A;  3UP4 A;  2YVJ A;  1EL8 A;  4ICY A;  4GDP A;  5IPY A;  1BGN A;  2XFQ A;  2QA2 A;  4O5Q A;  4BK3 A;  3KA7 A;  1IJH A;  3HYW A;  4WCT A;  3SZC A;  1PBC A;  3RP8 A;  1H84 A;  3NKS A;  2VVM A;  2C4C A;  3DH9 A;  4ADW A;  1K4Q A;  2GQF A;  2Z5X A;  4EIP A;  4JQ9 A;  2JB3 A;  3GYJ A;  4CY8 A;  2X8C A;  1ZK7 A;  3CGE A;  1RP0 A;  2NVK X;  3K7M X;  1IUU A;  4J34 A;  2O9Z A;  2VRL A;  1GPE A;  4H4X A;  4KPR A;  2XVE A;  2YLT A;  3CMM A;  5GRT A;  3GRS A;  1L9E A;  1TDF A;  2FJE A;  4B69 A;  3HYX A;  4J33 A;  3LAD A;  1VQW A;  1ZMC A;  4U8K A;  2C73 A;  3CGC A;  3DGH A;  2XFN A;  3LXD A;  4J31 A;  4D03 A;  2GR0 A;  1YKJ A;  4Z2R A;  3QSM A;  4II2 A;  3UTG A;  2GMH A;  2WOI A;  3FPZ A;  1KNR A;  2WDR A;  3ITJ A;  1IUS A;  1GES A;  1Y0P A;  5KVI A;  3NYC A;  2WP6 A;  3UOY A;  4EQS A;  4YXD A;  3K7Q X;  1HYU A;  1LPF A;  4C5O A;  2AQJ A;  5KMP A;  3CNJ A;  5DBJ A;  1RYI A;  2EQ8 A;  2PYX A;  1VRQ B;  2B7S A;  3EPT A;  4Z43 A;  3HZL A;  3T0K A;  4Z25 A;  2C3D A;  2IVD A;  5IQ1 A;  2GF3 A;  1KSU A;  3CPI G;  1CJ2 A;  4A6N A;  2YLR A;  3T2Y A;  3KPK A;  1GSN A;  3PVC A;  4K2X A;  5FS8 A;  2RGO A;  4OPD A;  1GRE A;  2R0C A;  3GWF A;  3GWD A;  1NDA A;  3BI2 A;  3CPJ G;  2FJD A;  2XLP A;  2OLN A;  4NZH A;  2OAM A;  5BRT A;  1NEK A;  4A99 A;  1V59 A;  3P4R A;  1S2Q A;  5FS9 A;  3RNM A;  4U8P A;  1TDN A;  3T31 A;  3SZ0 A;  4EM4 A;  2XYO A;  4C3Y A;  1JNR A;  2YG5 A;  2RGH A;  2H89 A;  3SGL A;  2C76 A;  1CJ3 A;  1Q9I A;  3EF6 A;  3BI4 A;  4FK1 A;  2JKC A;  2WS3 A;  4G6H A;  3UOV A;  3ZYX A;  5EB4 A;  4A9W A;  2IVE A;  2BS2 A;  4UP3 A;  3AXB A;  1M64 A;  1JEH A;  1ELI A;  3Q6J A;  5JCL A;  3AD9 B;  1D5T A;  4ZN0 A;  1EBD A;  3CN8 A;  2OA1 A;  3LOV A;  4U8L A;  2XLT A;  3NLC A;  2C3C A;  2YG7 A;  2EQ9 A;  2YLZ A;  3ALJ A;  4GAP A;  1FEB A;  1YQZ A;  2YLW A;  4JNQ A;  1K0L A;  5CQF A;  3ATR A;  2B9X A;  1LTX R;  2B9W A;  3ISH A;  1MO9 A;  1NHP A;  2VQ7 A;  3L8K A;  3UCL A;  4LA1 A;  4N9X A;  4CRT A;  4OCG A;  1D4C A;  3QFA A;  3ALM A;  3ZDN A;  2VZ2 A;  3FG2 P;  3AD7 B;  4H2Q A;  4J57 A;  4Z24 A;  2C65 A;  2V6O A;  1GV4 A;  3NIX A;  3ALL A;  1VG0 A;  3KD9 A;  2XFP A;  1KSS A;  2ACZ A;  2BRA A;  3AEG A;  3AEB A;  3LB8 A;  5KOW A;  2Y6R A;  1GTH A;  2WEU A;  4MJW A;  1IUT A;  4NEW A;  4X4J A;  1K0I A;  1CBO A;  3EAO A;  1O95 A;  3V3N A;  2JB2 A;  5U25 A;  3K7T A;  3UTH A;  1JU2 A;  2YM2 A;  2E1M A;  3AYI A;  1QO8 A;  3G5Q A;  4U8M A;  4BK2 A;  3NH3 X;  2X99 A;  3B6D A;  3ATQ A;  2FJA A;  1YY5 A;  3AE5 A;  3NYF A;  1AOG A;  1S3B A;  2BXS A;  5KNL A;  3IF9 A;  2A89 A;  1B5Q A;  2Q6U A;  2YG3 A;  4H4V A;  3NK1 X;  4J56 A;  2WQY A;  4RSL A;  3AE3 A;  2A87 A;  1Y56 A;  2R0P A;  2RGJ A;  5JCN A;  2C64 A;  3F8D A;  5EOW A;  3UKH A;  4U2S A;  1O94 A;  1N4V A;  1P2E A;  3BHF A;  1D4E A;  4EMJ A;  3OZ2 A;  4APN A;  3IHG A;  4II3 A;  3UKF A;  1N4U A;  4FDC B;  3VR8 A;  1H82 A;  1E7P A;  1NEN A;  1Q1W A;  3G5S A;  3M13 A;  2GVC A;  1GT8 A;  1IUV A;  2C70 A;  3LZX A;  4UDQ A;  4YSX A;  2GH5 A;  3SX6 A;  3DGZ A;  1B4V A;  2X3N A;  1GRG A;  2GRT A;  4B68 A;  4B65 A;  3I6D A;  3ABV A;  3DA1 A;  3D8X A;  2WP9 A;  3DJE A;  3QJ4 A;  4XXG A;  2YWL A;  3SXI A;  2RAB A;  3DJD A;  4CBQ A;  4HA6 A;  3SFE A;  1BWC A;  4O5U A;  4DSG A;  1ZOV A;  1Z6L A;  2QCU A;  3DK9 A;  3QFB A;  1K0J A;  2WPE A;  1IUX A;  3FBS A;  3PO7 A;  1DOB A;  3KU9 A;  1H83 A;  3SY4 A;  2F5Z A;  1E6E A;  4I59 A;  4GF7 A;  4XWR A;  3II4 A;  5J60 A;  1ZOY A;  2VOU A;  1DXL A;  2YLS A;  2V61 A;  2ZZ0 A;  3VR9 A;  1GXF A;  1NHS A;  2X50 A;  4YSZ A;  2YG4 A;  4Z44 A;  4HB9 A;  3NK2 X;  3M0O A;  1CC4 A;  3KPF A;  4PAA A;  3UOX A;  3VRB A;  3CNS A;  2GV8 A;  4H4U A;  4YTM A;  4AT0 A;  2YLX A;  3GMB A;  4GUV A;  3AWI A;  1ZMD A;  2GR3 A;  2ARD A;  1H7X A;  3AD8 B;  3GYX A;  4CCR A;  4YWO A;  2OLO A;  3RED A;  5U63 A;  4B63 A;  4BJY A;  4C74 A;  4UDP A;  2UZZ A;  3GYI A;  1JRY A;  2CUL A;  3GDP A;  4ZCC A;  1S2Y A;  1XHC A;  4J36 A;  3SYI A;  2DKH A;  4OPL A;  5KXJ A;  1PJ5 A;  3GD3 A;  1BZL A;  2XVF A;  5FMH A;  2B9Y A;  4H7U A;  4Z26 A;  3H8L A;  3NNE A;  3IC9 A;  2YQU A;  2APG A;  4E0V A;  3AED A;  3EAN A;  2BYB A;  4AP3 A;  3BNM A;  4JNA A;  2R46 A;  5J7X A;  2Q7V A;  5EBK A;  4NTC A;  3VRD B;  4TLZ A;  3SFD A;  2ZZC A;  3AB1 A;  1PJ7 A;  1FOH A;  4JY3 A;  2BK5 A;  4TM4 A;  2WES A;  1GTE A;  1F6M A;  4A6N B;  3DME A;  4CCQ A;  5KMR A;  2X8G A;  3QSE A;  4BK1 A;  2BXR A;  2VRM A;  1CHU A;  4G73 A;  4P9S A;  1VDC A;  4G6G A;  1DJN A;  4IV9 A;  2BC1 A;  2BRY A;  3BNU A;  5FS6 A;  5BUK A;  3UKK A;  5BUL A;  5C2T A;  5FS7 A;  3T2K A;  1XAN A;  1VG9 A;  4B66 A;  4GDE A;  3SM8 A;  3CND A;  3UKA A;  4H4R A;  1ONF A;  2BA9 A;  4LU6 A;  4K5S A;  1S3E A;  1N1P A;  1E1N A;  2CFY A;  4TM0 A;  3ADA B;  3KLJ A;  4LII A;  1NAA A;  2ZBW A;  3NK0 X;  1F3P A;  4A79 A;  4RG4 A;  4H4P A;  4IA5 A;  4JY2 A;  1ZY8 A;  1OJT A;  4A65 A;  2V3B A;  4OPU A;  3F8P A;  4A7A A;  2WOW A;  3SZF A;  2XLU A;  3ICS A;  3CGB A;  3O0H A;  1M6I A;  1D7L A;  1GRB A;  4AP1 A;  4AOS A;  4ZCD A;  2WPF A;  3UKP A;  5C3J A;  1MOK A;  2JB1 A;  1ZP0 A;  3P4P A;  3V76 A;  1O5W A;  5HHF A;  3SZW A;  2BS4 A;  1GAL A;  3OC4 A;  2C67 A;  2H88 A;  1PDH A;  4C77 A;  5M10 A;  1PXB A;  5KMS A;  4H4Y A;  5KOX A;  2C66 A;  3F8R A;  3KVE A;  3FMW A;  4M52 A;  4EM3 A;  2R45 A;  3GD4 A;  1GND A;  1NHQ A;  3DK4 A;  4YSY A;  4Y4L A;  4Y4N A;  1B37 A;  2WBA A;  4EMW A;  1KNP A;  2TMD A;  3UKL A;  3Q9T A;  2GEW A;  5M0Z A;  3R9U A;  2JBV A;  2VVL A;  3DJG X;  3T2Z A;  4U2T A;  2X8H A;  1D7Y A;  1E1K A;  1TYP A;  4UDR A;  2JK6 A;  4IVO B;  3GSI A;  2Q0L A;  4OPC A;  3E1T A;  1QJD A;  3H8I A;  2XCG A;  2Z5Y A;  4NWZ A;  1E39 A;  4H50 A;  1RSG A;  3P9U A;  4USQ A;  4X9N A;  2W0H A;  3QVR A;  4REK A;  3I3L A;  4B1B A;  4TM3 A;  2E5V A;  3V3O A;  4C3X A;  2XDO A;  5BVA A;  3S61 A;  2YG6 A;  2C75 A;  1D4D A;  1EL9 A;  1LVL A;  1NHR A;  2BC0 A;  2R0G A;  3AYL A;  3L1R A;  4ECH A;  5KVH A;  5LV9 A;  1BF3 A;  3AE4 A;  1MXT A;  4BJZ A;  4Z2U A;  5JCK A;  2BCP A;  1KFY A;  4U8N A;  3NGC X;  2WDV A;  4U8I A;  3RHA A;  4TLX A;  1N4W A;  3NTD A;  2Y6Q A;  5KWF A;  4H4W A;  2B76 A;  1F8S A;  2HQM A;  2WU2 A;  2DKI A;  4JDR A;  1PBE A;  4H2N A;  2AAQ A;  2V60 A;  2YR5 A;  3AE7 A;  3NG7 X;  1EL7 A;  3AEE A;  1E1L A;  1X31 B;  4YKF A;  4TM1 A;  3CPH G;  1DOC A;  2YR4 A;  2QA1 A;  2JAE A;  1H86 A;  3M12 A;  5HY5 A;  2R9Z A;  1LV0 A;  2YR6 A;  4A5L A;  4EQR A;  5EB5 A;  1PHH A;  3KKJ A;  1OJA A;  1COY A;  3BHK A;  3UTE A;  4RG3 A;  3S5W A;  3NTA A;  3GMC A;  1PXC A;  1OJC A;  5GSN A;  4B64 A;  5KMQ A;  1YQ4 A;  4G74 A;  4EQW A;  1L0V A;  1NG4 A;  3UOZ A;  3NHO X;  2ZZB A;  2R4E A;  1PXA A;  3UTF A;  2EQ6 A;  2WP5 A;  3C4A A;  4FK1 C;  4KX6 A;  2XFU A;  4H4Z A;  1NPX A;  2XFO A;  4H4S A;  1CJC A;  1LJ1 A;  2GB0 A;  4OVI A;  5HYM A;  2V3A A;  1JOA A;  4J2W A;  2GAH B;  1P2H A;  2XVI A;  1PBF A;  1PN0 A;  1TRB A;  3D1C A;  3HYV A;  5HXI A;  3AYJ A;  1OJ9 A;  2GQW A;  1LQU A;  4U2L A;  1H6V A;  2WPC A;  3C96 A;  1TDE A;  1QLB A;  3DK8 A;  4H4Q A;  3P4S A;  5IQ4 A;  1PBB A;  1DNC A;  2E4G A;  1FEA A;  3H4K A;  4OPG A;  1NG3 A;  4K5R A;  1LQT A;  3UKQ A;  3CNT A;  3UP5 A;  1JRZ A;  4CNJ A;  3T14 A;  2GR2 A;  2AR8 A;  1H7W A;  2BK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...