1TDNA

L-amino acid oxidase from agkistrodon halys in complex with l-leucine
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complex with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
total genus 172
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdnA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdnA01
4BV6A 4B1BA 4H4QA 1ZDLA 2E4GA 3AEAA 1JRYA 1IUWA 4CRTA 1ZKQA 4UP3A 4YXDA 2XFNA 5IQ4A 4Z24A 2FJEA 1JRXA 1TRBA 3LJPA 3NLCA 3NYCA 3CN8A 2R0GA 4JN9A 4RG3A 2AAQA 4DNAA 3CGBA 4NEVA 2B9YA 4FK1C 1PS9A 3C4AA 3UKFA 4O5UA 1NHQA 1PXCA 2YAUA 3KD9A 3UOXA 1JNRA 3CNJA 2R4EA 2WPFA 3SM8A 3EF6A 4U8KA 1CC6A 2YM2A 3IC9A 4C3YA 3LXDA 5EB5A 1Z6LA 4NEWA 1IUXA 2C76A 3AB1A 3T37A 1ELIA 4OPUA 1MXTA 2BXSA 2BS2A 2CFYA 4GR1A 5JCNA 2XVEA 1H81A 4K8DA 1FEBA 3NIXA 3P4RA 1FCDA 4D04A 3KKJA 3AEBA 3GSIA 1GV4A 3NK0X 2GR3A 3CNDA 4U8IA 5GSNA 4DGKA 1NG3A 1IUVA 2ZZCA 3AE7A 3I3LA 3K7MX 5EBKA 3SFEA 4DSHA 1CJ2A 1VRQB 2TPRA 2BYBA 2R0PA 3C96A 4U8OA 4NTCA 4EIQA 2WU5A 3P4PA 1GETA 2RABA 2WP5A 2R9ZA 2AR8A 2H88A 3LB8A 3DJJA 3NK2X 4X9NA 5EOWA 2JBVA 1FOHA 4AT0A 1BKWA 4C74A 3CNTA 3VQRA 1IUUA 2QA1A 5M10A 5FS6A 4OCGA 1VG9A 4H4RA 2C64A 2AQJA 2V3AA 3M13A 2TMDA 2YR4A 1M64A 2BXRA 2YG3A 2BS3A 2X3NA 2XLRA 2GV8A 4EQWA 3PS9A 4GDPA 4XWRA 1IJHA 2WOIA 1GREA 2DKHA 1L9EA 1SEZA 4BJYA 1D5TA 1H84A 4Z26A 4OPIA 5DBJA 1F8SA 1BGNA 1PBCA 3HZLA 1E1MA 2XLPA 1NG4A 2WP6A 2X8GA 2X8HA 3GD4A 4MJWA 1O95A 4USRA 3S5WA 3UTFA 2Q7VA 5CQFA 3DJDA 3VRAA 1DOEA 3KU9A 4K5SA 3UOVA 1OJAA 3QVPA 2BC1A 1CJCA 1JOAA 3KA7A 1IUSA 2Y6QA 1L9CA 1B37A 3URHA 4C3XA 2EQ6A 5EB4A 5BUKA 1JU2A 2H89A 1BWCA 2XFQA 1YQ3A 2WDVA 4H4TA 4WX1A 2EQ8A 1F8RA 1EL9A 3RNMA 3UTGA 2WESA 3FPZA 1BGJA 2XDOA 4A5LA 1GRBA 3QJ4A 1OJCA 4RG4A 4C77A 4AOSA 4EIPA 4H4ZA 3DGZA 1D4EA 3SQPA 3UP4A 4NTDA 1GRFA 3LZWA 1NDAA 3DH9A 4EM4A 1GRGA 1NEKA 3NRNA 3ICRA 1K0IA 4EMIA 4TLZA 3GRTA 4J34A 3AEGA 2C72A 3UKKA 2X50A 2F5ZA 1YQZA 4USQA 4KX6A 3QSMA 4Z2RA 4LA1A 1H83A 3COXA 1L0VA 3BI5A 2A87A 3ABVA 2YR5A 2GF3A 3IHGA 4TLXA 1MOKA 3SFDA 2YG4A 3UKPA 1GEUA 2R45A 3UKHA 3DA1A 1S3BA 3ITJA 2BACA 1PBEA 3GWFA 1PBFA 3AXBA 3EAOA 5KOWA 3G5SA 4FK1A 2GEWA 2YLSA 1GRAA 1YY5A 4EM3A 1LQUA 4NZHA 1REOA 2OALA 2ACZA 3ALJA 2B76A 3P9UA 3KPFA 1DOCA 1Y56A 3PO7A 4TM3A 4B66A 2X99A 4GF7A 4Z2TA 4PABA 1NHSA 4YSXA 1EL8A 1KDGA 3ALLA 3QSSA 3AYJA 2FBWA 3K30A 1K4QA 5U25A 5JCLA 3UCLA 2QCUA 3H8LA 1LVLA 1D4DA 4U8PA 2C67A 1PN0A 1JEHA 2WS3A 3AE8A 1RP0A 3LOVA 2YVGA 4YTMA 1CJ3A 2IVDA 5ER0A 3AE4A 3NHOX 1BF3A 2EQ7A 1PBBA 4J33A 2BK4A 1JNZA 3NN6X 1ZMCA 4J31A 2C70A 3K7TA 2FJDA 1K0LA 3NYFA 1CF3A 5HY5A 2C75A 4ZCDA 3AE5A 3F8RA 4YKFA 4P9SA 3RHAA 4EMJA 3BHKA 2JB1A 2VVLA 2QAEA 4U2SA 1GOSA 4H2NA 3GWDA 3LZXA 1W4XA 3CGDA 4Y4MA 4AP3A 3O0HA 2XFUA 1XANA 1F3PA 4IVOB 2GR2A 2BCGG 4J36A 3AECA 1DOBA 3RP6A 2XLTA 1S2YA 3CGCA 4TM4A 3AD8B 5U63A 1NHRA 1VDCA 2Q0KA 4H2RA 1Q9IA 1Y0PA 1F8WA 1DODA 1ZK7A 4EQSA 1IUTA 2XLUA 4KPRA 5KWFA 1LV0A 1ZX9A 2ZZBA 3IF9A 3GMBA 4U8NA 3AD9B 1NAAA 3II4A 3AE2A 1YKJA 1NPXA 3P4SA 1N4UA 5CKUA 1UKVG 2YWLA 1XDIA 4B63A 3CTYA 1NENA 3UKAA 1XPQA 4ECHA 2OA1A 1DJNA 1DXLA 1FECA 4GRTA 3AE3A 2B9WA 3V76A 4UDQA 1VG0A 4K7ZA 3KLJA 1LTXR 2YLXA 3FBSA 5BVAA 3B3RA 3UTEA 3ATQA 1E1LA 3IWAA 4J2WA 5FS8A 4Z44A 1Y56B 4H2QA 4FDCB 2YG7A 1D7YA 3NT6A 5JCMA 3Q6JA 4YSZA 2Q0LA 3AYLA 4H4WA 4Y4LA 1ZOYA 4HB9A 4XXGA 3GRSA 4K22A 4AOXA 4M52A 3UOZA 2EQ9A 2ARDA 2APGA 2GQFA 1E1NA 1GESA 2XVIA 3CPJG 3DJEA 4JY3A 2R4JA 3DJGX 2C65A 3DGHA 3VR9A 3NK1X 4CBQA 1XHCA 4UDRA 5HHFA 1S3EA 3AE1A 1KNRA 3NKSA 1ZP0A 4YWOA 4AP1A 3FG2P 2VVLG 4H4SA 1CBOA 4IVMB 4B67A 1TYTA 1GT8A 1H7WA 2WQYA 1H82A 4BURA 5JCIA 4EMWA 3V3NA 2RGOA 1RYIA 2V3BA 2BS4A 2WP9A 3GYJA 2J3NA 4TM1A 3CIRA 4LU6A 2GB0A 2NPXA 1FL2A 1KNPA 2GAGB 2WEUA 1DJQA 3K7QX 4GDEA 4K5RA 1JRZA 4JDRA 2OAMA 1PJ5A 1N4WA 5KOXA 5KVIA 2Z5YA 1VQWA 3UTHA 2WETA 4EQRA 2BA9A 4JNAA 1LPFA 3L1RA 4U2TA 3E1TA 1E1KA 3F8PA 1TYPA 4ZCCA 2YLZA 3UP5A 2RGJA 4EQXA 2YR6A 3GYIA 2B7SA 2V61A 3AEDA 1TDEA 4RSLA 4XWZA 2C3DA 3NN0X 1N4VA 3JSKA 4BK1A 3S61A 2WBAA 3KVEA 5GRTA 5FS9A 2R46A 4D03A 3RP7A 2BK3A 2JB3A 2XVFA 1BZLA 4Z2UA 1ZOVA 3R9UA 3ISHA 2JKCA 2WHDA 4H7UA 1QLBA 2DKIA 1CHUA 1ZMDA 1PJ6A 3UKQA 3AEFA 2V60A 2VOUA 1O5WA 2VVMA 3AE9A 3G5RA 3QFAA 3LADA 1TDFA 2E1MA 2BCPA 5IPYA 2YLRA 5KXJA 1B5QA 2GRTA 2HQMA 4TM0A 4NTEA 2QA2A 5J7XA 3OZ2A 3UKLA 3P1WA 3BNMA 4PAAA 3C4NA 4A79A 1CC2A 4B64A 4GCMA 2XYOA 4CCRA 1K0JA 2YM1A 2RGHA 2YLWA 2GR0A 2OLOA 4CCQA 1GERA 3BNUA 4H50A 3ATRA 4ZN0A 3F8DA 4HA6A 2VZ2A 4A9WA 4A65A 1Q1WA 5U1OA 4Z25A 1PHHA 4IA6A 1CL0A 1QJDA 2JB2A 2WU2A 3D1CA 3PVCA 4H4XA 3GD3A 3AEEA 3DMEA 2ZBWA 2NVKX 1H86A 4H4YA 1S2QA 2YQUA 2CVJA 4A7AA 1KF6A 2XVJA 1GPEA 2IIDA 3P4QA 4YT0A 1B8SA 1PJ7A 3AE6A 3AWIA 4H4PA 4ADWA 3SGLA 4I59A 4H4VA 5FMHA 3NG7X 1GRTA 1GRHA 2C3CA 2UZZA 2E5VA 3G5QA 1E7PA 5HXIA 3L8KA 1ONFA 2Q6UA 1OJTA 3H8IA 1DNCA 2WPEA 3AD7B 1MO9A 1COYA 3I6DA 1LQTA 2GAHB 1P2HA 2FJAA 2I0ZA 2YVFA 4O5QA 1O94A 4OVIA 4I58A 3ALMA 4OPCA 1KSUA 3D8XA 2GVCA 2BK5A 1TDNA 3Q9TA 1GXFA 3GMCA 3BI4A 3EPTA 4U8LA 4A6NA 4A99A 1OJ9A 3NH3X 4H2PA 2W0HA 2B9XA 4BK3A 2VQ7A 2GMJA 2C7GA 3V3OA 4Z43A 1EBDA 3ADAB 4OPTA 4X4JA 4BK2A 3ZYXA 3IHMA 1QO8A 4IA5A 2V5ZA 4OPDA 1PXBA 2VRMA 4YTNA 2OLNA 3DK4A 4CNJA 2CDUA 4X9MA 3FIMB 4AT2A 3QSEA 5FS7A 1F6MA 3CGEA 1NHPA 4U8MA 4J57A 3ICTA 2Z5XA 2O9ZA 3CNPA 3FMWA 2IVEA 4JQ9A 2XFPA 1EL5A 1LJ1A 3H4KA 4JNQA 5L46A 3GDPA 5C2TA 2V6OA 4B65A 2GQWA 2FJBA 1M6IA 2YG6A 2BC0A 2WPCA 3GDNA 4YTPA 1N1PA 2WDRA 3BI2A 4Y4NA 1ZY8A 2VQBA 4WCTA 2YVJA 2R0CA 3CPHG 3NGCX 3BHFA 2PYXA 5HYMA 2GH5A 1B4VA 1TDKA 2XFOA 3DK9A 4OPGA 1V59A 2CULA 3QFBA 1Q1RA 4YSYA 3ZDNA 1OJDA 3REDA 5KRQA 3UOYA 1YQ4A 3NTAA 2XCGA 4C5OA 1TDOA 4K2XA 4U8JA 1X31B 2B7RA 4UDPA 4ICYA 4YSHA 5C3JA 1L9DA 3RP8A 1EL7A 5M0ZA 1FEAA 1D4CA 2XLSA 3CNSA 2JAEA 1H7XA 4CY6A 5KVHA 2WOWA 2ZZ0A 2GMHA 1GTHA 1D7LA 4E0VA 2YG5A 4H4UA 1AOGA 3B6DA 2WDQA 2C73A 1PXAA 4APNA 4CNKA 4FX9A 4YKGA 5IQ1A 2BABA 1HYUA 2GR1A 4N9XA 4OPLA 4IV9A 5TR3A 3AYIA 4GUVA 4B68A 3CPIG 4U2LA 3VR8A 3M12A 2XVHA 1GSNA 1CJ4A 3M0OA 4B69A 1GNDA 1PDHA 2WOVA 5LV9A 4A6NB 4DSGA 1PBDA 2X8CA 3NNEA 1GTEA 3OC4A 3VRDB 3DK8A 1E39A 4LIIA 1H6VA 5JCKA 2Y6RA 3WE0A 1P2EA 1RSGA 2C66A 2PHHA 3ICSA 4CY8A 2A89A 3NYEA 3VRBA 5BRTA 4BJZA 1KFYA 1E6EA 2VRLA 2A8XA 5BULA 5J60A 4J56A 2YLTA 1KSSA 1CC4A 2JK6A 3EANA 3QVRA 4JY2A 1GALA 4REKA 3NTDA
chains in the Genus database with same CATH superfamily
4BV6A 4B1BA 4H4QA 1ZDLA 2E4GA 3AEAA 1JRYA 1IUWA 4CRTA 1ZKQA 4UP3A 4YXDA 2XFNA 5IQ4A 4Z24A 2FJEA 1JRXA 1TRBA 4G73A 3LJPA 3NLCA 3NYCA 3CN8A 2R0GA 4JN9A 4RG3A 2AAQA 3GYXA 4DNAA 3CGBA 4NEVA 2B9YA 4FK1C 1PS9A 3C4AA 3UKFA 4O5UA 1NHQA 1PXCA 2YAUA 3KD9A 3UOXA 1JNRA 3CNJA 2R4EA 2WPFA 3SM8A 3EF6A 4U8KA 1CC6A 2YM2A 3IC9A 4GAPA 3LXDA 4C3YA 5EB5A 1Z6LA 4NEWA 1IUXA 2C76A 3AB1A 3T37A 1ELIA 4OPUA 1MXTA 2BXSA 2BS2A 2CFYA 4GR1A 5JCNA 2XVEA 1H81A 4K8DA 1FEBA 3NIXA 3P4RA 1FCDA 4D04A 3KKJA 3AEBA 3GSIA 1GV4A 3NK0X 2GR3A 3CNDA 4U8IA 5GSNA 4DGKA 1NG3A 1IUVA 2ZZCA 3AE7A 3I3LA 3K7MX 5EBKA 3SFEA 4DSHA 1CJ2A 1VRQB 2TPRA 2BYBA 2R0PA 3C96A 4U8OA 4NTCA 4EIQA 2WU5A 3P4PA 1GETA 2RABA 2WP5A 2R9ZA 2AR8A 2H88A 3LB8A 3DJJA 3NK2X 4X9NA 5EOWA 2JBVA 1FOHA 4AT0A 1BKWA 4C74A 3CNTA 4G6HA 3VQRA 1IUUA 2QA1A 5M10A 5FS6A 4OCGA 1VG9A 4H4RA 2C64A 2AQJA 2V3AA 3M13A 2TMDA 2YR4A 1M64A 2BXRA 2YG3A 2BS3A 2X3NA 2XLRA 2GV8A 3SZWA 4EQWA 3PS9A 4GDPA 4XWRA 1IJHA 3HYWA 2WOIA 1GREA 2DKHA 1L9EA 1SEZA 4BJYA 1D5TA 1H84A 4Z26A 4OPIA 5DBJA 1F8SA 1BGNA 1PBCA 3HZLA 1E1MA 2XLPA 1NG4A 2WP6A 2X8GA 2X8HA 3GD4A 4MJWA 1O95A 4USRA 3S5WA 3UTFA 2Q7VA 5CQFA 3DJDA 3VRAA 1DOEA 3KU9A 4K5SA 3UOVA 1OJAA 3QVPA 2BC1A 1CJCA 1JOAA 3CMMA 3KA7A 1IUSA 2Y6QA 1L9CA 1B37A 3URHA 4C3XA 2EQ6A 5EB4A 5BUKA 1JU2A 2H89A 1BWCA 2XFQA 1YQ3A 2WDVA 4H4TA 4WX1A 2EQ8A 1F8RA 1EL9A 3RNMA 3UTGA 2WESA 3FPZA 1BGJA 2XDOA 4A5LA 1GRBA 3QJ4A 1OJCA 4RG4A 4C77A 4AOSA 3T2ZA 4H4ZA 4EIPA 3DGZA 1D4EA 3SQPA 3UP4A 4NTDA 1GRFA 3LZWA 1NDAA 3DH9A 4EM4A 1GRGA 1NEKA 3NRNA 3ICRA 1K0IA 4EMIA 4TLZA 3GRTA 4J34A 3AEGA 2C72A 4NNJA 2X50A 3UKKA 2F5ZA 1YQZA 4USQA 4KX6A 3QSMA 3SY4A 4Z2RA 4LA1A 1H83A 3COXA 1L0VA 3BI5A 2A87A 3ABVA 2YR5A 2GF3A 3IHGA 4TLXA 1MOKA 3SFDA 2YG4A 3UKPA 1GEUA 2R45A 3UKHA 3DA1A 1S3BA 3ITJA 2BACA 1PBEA 3GWFA 1PBFA 3AXBA 3EAOA 4II2A 5KOWA 3G5SA 4FK1A 2GEWA 2YLSA 1GRAA 1YY5A 4EM3A 1LQUA 4NZHA 1REOA 2OALA 2ACZA 3ALJA 2B76A 3P9UA 3KPFA 1DOCA 1Y56A 3PO7A 4TM3A 4B66A 2X99A 4GF7A 4Z2TA 4PABA 1NHSA 4YSXA 1EL8A 1KDGA 3ALLA 3QSSA 3AYJA 3KPKA 2FBWA 3K30A 1K4QA 5U25A 5JCLA 3UCLA 2QCUA 3H8LA 1LVLA 2BRAA 1D4DA 4U8PA 3SZFA 2C67A 1PN0A 1JEHA 2WS3A 3AE8A 1RP0A 3LOVA 2YVGA 4YTMA 1CJ3A 2IVDA 5ER0A 3AE4A 3NHOX 1BF3A 2EQ7A 1PBBA 4J33A 2BK4A 1JNZA 3NN6X 3SZ0A 1ZMCA 4J31A 2C70A 3K7TA 2FJDA 1K0LA 3NYFA 1CF3A 5HY5A 2C75A 4ZCDA 3AE5A 3F8RA 4YKFA 4P9SA 3RHAA 4EMJA 3BHKA 2JB1A 2VVLA 3T31A 2QAEA 4U2SA 1GOSA 4H2NA 3GWDA 3LZXA 1W4XA 3CGDA 4Y4MA 4AP3A 3O0HA 2XFUA 1XANA 1F3PA 4IVOB 2GR2A 2BCGG 4J36A 3AECA 1DOBA 3T2YA 3SYIA 3HYXA 3RP6A 2XLTA 1S2YA 3CGCA 4TM4A 3AD8B 5U63A 1NHRA 1VDCA 2Q0KA 4H2RA 1Q9IA 1Y0PA 1F8WA 1DODA 1ZK7A 4EQSA 1IUTA 2XLUA 4KPRA 5KWFA 1LV0A 1ZX9A 2ZZBA 3IF9A 3GMBA 4U8NA 3AD9B 1NAAA 3II4A 3AE2A 1YKJA 4GAVA 1NPXA 3P4SA 1N4UA 5CKUA 1UKVG 2YWLA 1XDIA 4B63A 3CTYA 1NENA 3UKAA 1XPQA 4ECHA 2OA1A 1DJNA 1DXLA 1FECA 4GRTA 3AE3A 2B9WA 3V76A 4UDQA 1VG0A 4K7ZA 3KLJA 1LTXR 2YLXA 3FBSA 5BVAA 3B3RA 5KMSA 3UTEA 3ATQA 1E1LA 3IWAA 4J2WA 5FS8A 4Z44A 1Y56B 4H2QA 4FDCB 2YG7A 1D7YA 3NT6A 5JCMA 5KMQA 3Q6JA 4YSZA 2Q0LA 3AYLA 4H4WA 4Y4LA 1ZOYA 4HB9A 4XXGA 3GRSA 4K22A 4AOXA 4M52A 3UOZA 2EQ9A 2ARDA 2APGA 2GQFA 1E1NA 1GESA 2XVIA 3CPJG 3DJEA 4JY3A 2R4JA 3DJGX 2C65A 3DGHA 3VR9A 3NK1X 4CBQA 1XHCA 4UDRA 5HHFA 1S3EA 3AE1A 1KNRA 3NKSA 1ZP0A 4YWOA 4AP1A 3FG2P 2VVLG 4H4SA 1CBOA 4IVMB 4B67A 1TYTA 1GT8A 1H7WA 2WQYA 1H82A 4BURA 5JCIA 4EMWA 3V3NA 2RGOA 1RYIA 2V3BA 2BS4A 2WP9A 3GYJA 2J3NA 4TM1A 3CIRA 4LU6A 2GB0A 2NPXA 1FL2A 1KNPA 2GAGB 2WEUA 1DJQA 3K7QX 4GDEA 4K5RA 1JRZA 4JDRA 2OAMA 1PJ5A 1N4WA 5KOXA 5KVIA 2Z5YA 3SZCA 1VQWA 3UTHA 2WETA 2BRYA 4EQRA 3SX6A 2BA9A 4JNAA 1LPFA 3L1RA 4U2TA 3E1TA 1E1KA 3F8PA 1TYPA 4ZCCA 2YLZA 3UP5A 2RGJA 4EQXA 2YR6A 3GYIA 2B7SA 2V61A 3AEDA 1TDEA 4RSLA 4XWZA 2C3DA 3NN0X 1N4VA 3JSKA 4BK1A 3S61A 2WBAA 3KVEA 5GRTA 5FS9A 2R46A 4D03A 3RP7A 2BK3A 2JB3A 2XVFA 1BZLA 4Z2UA 1ZOVA 3R9UA 3ISHA 2JKCA 2WHDA 4H7UA 1QLBA 2DKIA 1CHUA 1ZMDA 1PJ6A 3UKQA 3AEFA 2V60A 2VOUA 1O5WA 2VVMA 3AE9A 3G5RA 3QFAA 3LADA 1TDFA 2E1MA 2BCPA 5IPYA 2YLRA 5KXJA 1B5QA 2GRTA 2HQMA 4TM0A 4NTEA 2QA2A 5J7XA 3OZ2A 3UKLA 3P1WA 3BNMA 4PAAA 3C4NA 4A79A 1CC2A 4B64A 4GCMA 3SXIA 2XYOA 4CCRA 1K0JA 2YM1A 2RGHA 2YLWA 2GR0A 2OLOA 4CCQA 1GERA 3BNUA 4H50A 3ATRA 4ZN0A 3F8DA 4HA6A 2VZ2A 4G74A 4A9WA 4A65A 1Q1WA 5U1OA 4Z25A 1PHHA 4IA6A 1CL0A 1QJDA 2JB2A 2WU2A 3D1CA 3PVCA 4H4XA 3GD3A 3AEEA 3DMEA 2ZBWA 2NVKX 1H86A 4H4YA 1S2QA 2YQUA 5KMPA 2CVJA 4A7AA 1KF6A 2XVJA 3T2KA 1GPEA 2IIDA 3P4QA 4YT0A 1B8SA 1PJ7A 3AE6A 3AWIA 4H4PA 4ADWA 3SGLA 4I59A 4H4VA 5FMHA 4G6GA 3NG7X 1GRTA 1GRHA 2C3CA 2UZZA 2E5VA 3G5QA 1E7PA 5HXIA 3L8KA 1ONFA 2Q6UA 1OJTA 3H8IA 1DNCA 2WPEA 3AD7B 1MO9A 1COYA 3I6DA 1LQTA 2GAHB 1P2HA 2FJAA 2I0ZA 2YVFA 4O5QA 1O94A 4OVIA 4I58A 3ALMA 4OPCA 1KSUA 3D8XA 2GVCA 2BK5A 1TDNA 3Q9TA 1GXFA 3GMCA 3BI4A 3EPTA 4U8LA 4A6NA 4A99A 1OJ9A 3NH3X 4H2PA 2W0HA 2B9XA 4BK3A 2VQ7A 2GMJA 2C7GA 3V3OA 4Z43A 1EBDA 3ADAB 4OPTA 4X4JA 4BK2A 3ZYXA 3IHMA 1QO8A 4IA5A 2V5ZA 4OPDA 4NWZA 1PXBA 2VRMA 5KMRA 4YTNA 2C4CA 2OLNA 3DK4A 4CNJA 2CDUA 4X9MA 3FIMB 4AT2A 3QSEA 5FS7A 1F6MA 3CGEA 1NHPA 4U8MA 4J57A 3ICTA 2Z5XA 2O9ZA 3CNPA 3FMWA 2IVEA 4JQ9A 2XFPA 1EL5A 1LJ1A 3H4KA 4JNQA 5L46A 3GDPA 5C2TA 2V6OA 4B65A 2GQWA 2FJBA 1M6IA 2YG6A 2BC0A 2WPCA 3GDNA 4YTPA 1N1PA 2WDRA 3BI2A 4Y4NA 1ZY8A 2VQBA 4WCTA 5KNLA 2YVJA 2R0CA 3CPHG 3NGCX 3BHFA 2PYXA 3T14A 2GH5A 5HYMA 1B4VA 1TDKA 2XFOA 3DK9A 4OPGA 1V59A 2CULA 3QFBA 1Q1RA 4YSYA 3ZDNA 1OJDA 3REDA 5KRQA 3UOYA 1YQ4A 3NTAA 2XCGA 4C5OA 1TDOA 4K2XA 4U8JA 1X31B 2B7RA 4UDPA 4ICYA 4YSHA 5C3JA 1L9DA 3RP8A 1EL7A 3HYVA 5M0ZA 1FEAA 1D4CA 2XLSA 3CNSA 2JAEA 1H7XA 4CY6A 5KVHA 2WOWA 2ZZ0A 2GMHA 1GTHA 1D7LA 4E0VA 2YG5A 4H4UA 1AOGA 3B6DA 2WDQA 2C73A 1PXAA 4APNA 4CNKA 4FX9A 4YKGA 5IQ1A 2BABA 1HYUA 2GR1A 4N9XA 4OPLA 4IV9A 5TR3A 3AYIA 4GUVA 4B68A 3CPIG 4U2LA 3VR8A 3M12A 2XVHA 1GSNA 1CJ4A 3M0OA 4B69A 1GNDA 1PDHA 2WOVA 5LV9A 4A6NB 4DSGA 1PBDA 2X8CA 3NNEA 1GTEA 3OC4A 4II3A 3VRDB 3DK8A 1E39A 4LIIA 1H6VA 5JCKA 3WE0A 2Y6RA 1P2EA 1RSGA 2C66A 2PHHA 3ICSA 3T0KA 2A89A 3NYEA 4CY8A 3VRBA 5BRTA 4BJZA 1KFYA 1E6EA 2VRLA 2A8XA 5BULA 5J60A 4J56A 2YLTA 4G9KA 1KSSA 1CC4A 2JK6A 3EANA 3QVRA 4JY2A 1GALA 4REKA 3NTDA
chains in the Genus database with same CATH topology
4BV6A 4B1BA 4H4QA 1ZDLA 2E4GA 3AEAA 1JRYA 1IUWA 4CRTA 1ZKQA 4UP3A 4YXDA 2XFNA 5IQ4A 4Z24A 2FJEA 1JRXA 1TRBA 4G73A 3LJPA 3NLCA 3NYCA 3CN8A 2R0GA 4JN9A 4RG3A 2AAQA 3GYXA 4DNAA 3CGBA 4NEVA 2B9YA 4FK1C 1PS9A 3C4AA 3UKFA 4O5UA 1NHQA 1PXCA 2YAUA 3KD9A 3UOXA 1JNRA 3CNJA 2R4EA 2WPFA 3SM8A 3EF6A 4U8KA 1CC6A 2YM2A 3IC9A 4GAPA 3LXDA 4C3YA 5EB5A 1Z6LA 4NEWA 1IUXA 2C76A 3AB1A 3T37A 1ELIA 4OPUA 1MXTA 2BXSA 2BS2A 2CFYA 4GR1A 5JCNA 2XVEA 1H81A 4K8DA 1FEBA 3NIXA 3P4RA 1FCDA 4D04A 3KKJA 3AEBA 3GSIA 1GV4A 3NK0X 2GR3A 3CNDA 4U8IA 5GSNA 4DGKA 1NG3A 1IUVA 2ZZCA 3AE7A 3I3LA 3K7MX 5EBKA 3SFEA 4DSHA 1CJ2A 1VRQB 2TPRA 2BYBA 2R0PA 3C96A 4U8OA 4NTCA 4EIQA 2WU5A 3P4PA 1GETA 2RABA 2WP5A 2R9ZA 2AR8A 2H88A 3LB8A 3DJJA 3NK2X 4X9NA 5EOWA 2JBVA 1FOHA 4AT0A 1BKWA 4C74A 3CNTA 4G6HA 3VQRA 1IUUA 2QA1A 5M10A 5FS6A 4OCGA 1VG9A 4H4RA 2C64A 2AQJA 2V3AA 3M13A 2TMDA 2YR4A 1M64A 2BXRA 2YG3A 2BS3A 2X3NA 2XLRA 2GV8A 3SZWA 4EQWA 3PS9A 4GDPA 4XWRA 1IJHA 3HYWA 2WOIA 1GREA 2DKHA 1L9EA 1SEZA 4BJYA 1D5TA 1H84A 4Z26A 4OPIA 5DBJA 1F8SA 1BGNA 1PBCA 3HZLA 1E1MA 2XLPA 1NG4A 2WP6A 2X8GA 2X8HA 3GD4A 4MJWA 1O95A 4USRA 3S5WA 3UTFA 2Q7VA 5CQFA 3DJDA 3VRAA 1DOEA 3KU9A 4K5SA 3UOVA 1OJAA 3QVPA 2BC1A 1CJCA 1JOAA 3CMMA 3KA7A 1IUSA 2Y6QA 1L9CA 1B37A 3URHA 4C3XA 2EQ6A 5EB4A 5BUKA 1JU2A 2H89A 1BWCA 2XFQA 1YQ3A 2WDVA 4H4TA 4WX1A 2EQ8A 1F8RA 1EL9A 3RNMA 3UTGA 2WESA 3FPZA 1BGJA 2XDOA 4A5LA 1GRBA 3QJ4A 1OJCA 4RG4A 4C77A 4AOSA 3T2ZA 4H4ZA 4EIPA 3DGZA 1D4EA 3SQPA 3UP4A 4NTDA 1GRFA 3LZWA 1NDAA 3DH9A 4EM4A 1GRGA 1NEKA 3NRNA 3ICRA 1K0IA 4EMIA 4TLZA 3GRTA 4J34A 3AEGA 2C72A 4NNJA 2X50A 3UKKA 2F5ZA 1YQZA 4USQA 4KX6A 3QSMA 3SY4A 4Z2RA 4LA1A 1H83A 3COXA 1L0VA 3BI5A 2A87A 3ABVA 2YR5A 2GF3A 3IHGA 4TLXA 1MOKA 3SFDA 2YG4A 3UKPA 1GEUA 2R45A 3UKHA 3DA1A 1S3BA 3ITJA 2BACA 1PBEA 3GWFA 1PBFA 3AXBA 3EAOA 4II2A 5KOWA 3G5SA 4FK1A 2GEWA 2YLSA 1GRAA 1YY5A 4EM3A 1LQUA 4NZHA 1REOA 2OALA 2ACZA 3ALJA 2B76A 3P9UA 3KPFA 1DOCA 1Y56A 3PO7A 4TM3A 4B66A 2X99A 4GF7A 4Z2TA 4PABA 1NHSA 4YSXA 1EL8A 1KDGA 3ALLA 3QSSA 3AYJA 3KPKA 2FBWA 3K30A 1K4QA 5U25A 5JCLA 3UCLA 2QCUA 3H8LA 1LVLA 2BRAA 1D4DA 4U8PA 3SZFA 2C67A 1PN0A 1JEHA 2WS3A 3AE8A 1RP0A 3LOVA 2YVGA 4YTMA 1CJ3A 2IVDA 5ER0A 3AE4A 3NHOX 1BF3A 2EQ7A 1PBBA 4J33A 2BK4A 1JNZA 3NN6X 3SZ0A 1ZMCA 4J31A 2C70A 3K7TA 2FJDA 1K0LA 3NYFA 1CF3A 5HY5A 2C75A 4ZCDA 3AE5A 3F8RA 4YKFA 4P9SA 3RHAA 4EMJA 3BHKA 2JB1A 2VVLA 3T31A 2QAEA 4U2SA 1GOSA 4H2NA 3GWDA 3LZXA 1W4XA 3CGDA 4Y4MA 4AP3A 3O0HA 2XFUA 1XANA 1F3PA 4IVOB 2GR2A 2BCGG 4J36A 3AECA 1DOBA 3T2YA 3SYIA 3HYXA 3RP6A 2XLTA 1S2YA 3CGCA 4TM4A 3AD8B 5U63A 1NHRA 1VDCA 2Q0KA 4H2RA 1Q9IA 1Y0PA 1F8WA 1DODA 1ZK7A 4EQSA 1IUTA 2XLUA 4KPRA 5KWFA 1LV0A 1ZX9A 2ZZBA 3IF9A 3GMBA 4U8NA 3AD9B 1NAAA 3II4A 3AE2A 1YKJA 4GAVA 1NPXA 3P4SA 1N4UA 5CKUA 1UKVG 2YWLA 1XDIA 4B63A 3CTYA 1NENA 3UKAA 1XPQA 4ECHA 2OA1A 1DJNA 1DXLA 1FECA 4GRTA 3AE3A 2B9WA 3V76A 4UDQA 1VG0A 4K7ZA 3KLJA 1LTXR 2YLXA 3FBSA 5BVAA 3B3RA 5KMSA 3UTEA 3ATQA 1E1LA 3IWAA 4J2WA 5FS8A 4Z44A 1Y56B 4H2QA 4FDCB 2YG7A 1D7YA 3NT6A 5JCMA 5KMQA 3Q6JA 4YSZA 2Q0LA 3AYLA 4H4WA 4Y4LA 1ZOYA 4HB9A 4XXGA 3GRSA 4K22A 4AOXA 4M52A 3UOZA 2EQ9A 2ARDA 2APGA 2GQFA 1E1NA 1GESA 2XVIA 3CPJG 3DJEA 4JY3A 2R4JA 3DJGX 2C65A 3DGHA 3VR9A 3NK1X 4CBQA 1XHCA 4UDRA 5HHFA 1S3EA 3AE1A 1KNRA 3NKSA 1ZP0A 4YWOA 4AP1A 3FG2P 2VVLG 4H4SA 1CBOA 4IVMB 4B67A 1TYTA 1GT8A 1H7WA 2WQYA 1H82A 4BURA 5JCIA 4EMWA 3V3NA 2RGOA 1RYIA 2V3BA 2BS4A 2WP9A 3GYJA 2J3NA 4TM1A 3CIRA 4LU6A 2GB0A 2NPXA 1FL2A 1KNPA 2GAGB 2WEUA 1DJQA 3K7QX 4GDEA 4K5RA 1JRZA 4JDRA 2OAMA 1PJ5A 1N4WA 5KOXA 5KVIA 2Z5YA 3SZCA 1VQWA 3UTHA 2WETA 2BRYA 4EQRA 3SX6A 2BA9A 4JNAA 1LPFA 3L1RA 4U2TA 3E1TA 1E1KA 3F8PA 1TYPA 4ZCCA 2YLZA 3UP5A 2RGJA 4EQXA 2YR6A 3GYIA 2B7SA 2V61A 3AEDA 1TDEA 4RSLA 4XWZA 2C3DA 3NN0X 1N4VA 3JSKA 4BK1A 3S61A 2WBAA 3KVEA 5GRTA 5FS9A 2R46A 4D03A 3RP7A 2BK3A 2JB3A 2XVFA 1BZLA 4Z2UA 1ZOVA 3R9UA 3ISHA 2JKCA 2WHDA 4H7UA 1QLBA 2DKIA 1CHUA 1ZMDA 1PJ6A 3UKQA 3AEFA 2V60A 2VOUA 1O5WA 2VVMA 3AE9A 3G5RA 3QFAA 3LADA 1TDFA 2E1MA 2BCPA 5IPYA 2YLRA 5KXJA 1B5QA 2GRTA 2HQMA 4TM0A 4NTEA 2QA2A 5J7XA 3OZ2A 3UKLA 3P1WA 3BNMA 4PAAA 3C4NA 4A79A 1CC2A 4B64A 4GCMA 3SXIA 2XYOA 4CCRA 1K0JA 2YM1A 2RGHA 2YLWA 2GR0A 2OLOA 4CCQA 1GERA 3BNUA 4H50A 3ATRA 4ZN0A 3F8DA 4HA6A 2VZ2A 4G74A 4A9WA 4A65A 1Q1WA 5U1OA 4Z25A 1PHHA 4IA6A 1CL0A 1QJDA 2JB2A 2WU2A 3D1CA 3PVCA 4H4XA 3GD3A 3AEEA 3DMEA 2ZBWA 2NVKX 1H86A 4H4YA 1S2QA 2YQUA 5KMPA 2CVJA 4A7AA 1KF6A 2XVJA 3T2KA 1GPEA 2IIDA 3P4QA 4YT0A 1B8SA 1PJ7A 3AE6A 3AWIA 4H4PA 4ADWA 3SGLA 4I59A 4H4VA 5FMHA 4G6GA 3NG7X 1GRTA 1GRHA 2C3CA 2UZZA 2E5VA 3G5QA 1E7PA 5HXIA 3L8KA 1ONFA 2Q6UA 1OJTA 3H8IA 1DNCA 2WPEA 3AD7B 1MO9A 1COYA 3I6DA 1LQTA 2GAHB 1P2HA 2FJAA 2I0ZA 2YVFA 4O5QA 1O94A 4OVIA 4I58A 3ALMA 4OPCA 1KSUA 3D8XA 2GVCA 2BK5A 1TDNA 3Q9TA 1GXFA 3GMCA 3BI4A 3EPTA 4U8LA 4A6NA 4A99A 1OJ9A 3NH3X 4H2PA 2W0HA 2B9XA 4BK3A 2VQ7A 2GMJA 2C7GA 3V3OA 4Z43A 1EBDA 3ADAB 4OPTA 4X4JA 4BK2A 3ZYXA 3IHMA 1QO8A 4IA5A 2V5ZA 4OPDA 4NWZA 1PXBA 2VRMA 5KMRA 4YTNA 2C4CA 2OLNA 3DK4A 4CNJA 2CDUA 4X9MA 3FIMB 4AT2A 3QSEA 5FS7A 1F6MA 3CGEA 1NHPA 4U8MA 4J57A 3ICTA 2Z5XA 2O9ZA 3CNPA 3FMWA 2IVEA 4JQ9A 2XFPA 1EL5A 1LJ1A 3H4KA 4JNQA 5L46A 3GDPA 5C2TA 2V6OA 4B65A 2GQWA 2FJBA 1M6IA 2YG6A 2BC0A 2WPCA 3GDNA 4YTPA 1N1PA 2WDRA 3BI2A 4Y4NA 1ZY8A 2VQBA 4WCTA 5KNLA 2YVJA 2R0CA 3CPHG 3NGCX 3BHFA 2PYXA 3T14A 2GH5A 5HYMA 1B4VA 1TDKA 2XFOA 3DK9A 4OPGA 1V59A 2CULA 3QFBA 1Q1RA 4YSYA 3ZDNA 1OJDA 3REDA 5KRQA 3UOYA 1YQ4A 3NTAA 2XCGA 4C5OA 1TDOA 4K2XA 4U8JA 1X31B 2B7RA 4UDPA 4ICYA 4YSHA 5C3JA 1L9DA 3RP8A 1EL7A 3HYVA 5M0ZA 1FEAA 1D4CA 2XLSA 3CNSA 2JAEA 1H7XA 4CY6A 5KVHA 2WOWA 2ZZ0A 2GMHA 1GTHA 1D7LA 4E0VA 2YG5A 4H4UA 1AOGA 3B6DA 2WDQA 2C73A 1PXAA 4APNA 4CNKA 4FX9A 4YKGA 5IQ1A 2BABA 1HYUA 2GR1A 4N9XA 4OPLA 4IV9A 5TR3A 3AYIA 4GUVA 4B68A 3CPIG 4U2LA 3VR8A 3M12A 2XVHA 1GSNA 1CJ4A 3M0OA 4B69A 1GNDA 1PDHA 2WOVA 5LV9A 4A6NB 4DSGA 1PBDA 2X8CA 3NNEA 1GTEA 3OC4A 4II3A 3VRDB 3DK8A 1E39A 4LIIA 1H6VA 5JCKA 2Y6RA 3WE0A 1P2EA 1RSGA 2C66A 2PHHA 3ICSA 3T0KA 2A89A 3NYEA 4CY8A 3VRBA 5BRTA 4BJZA 1KFYA 1E6EA 2VRLA 2A8XA 5BULA 5J60A 4J56A 2YLTA 4G9KA 1KSSA 1CC4A 2JK6A 3EANA 3QVRA 4JY2A 1GALA 4REKA 3NTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BV6 A;  4B1B A;  4H4Q A;  1ZDL A;  2E4G A;  3AEA A;  1JRY A;  1IUW A;  4CRT A;  1ZKQ A;  4UP3 A;  4YXD A;  2XFN A;  5IQ4 A;  4Z24 A;  2FJE A;  1JRX A;  1TRB A;  3LJP A;  3NLC A;  3NYC A;  3CN8 A;  2R0G A;  4JN9 A;  4RG3 A;  2AAQ A;  4DNA A;  3CGB A;  4NEV A;  2B9Y A;  4FK1 C;  1PS9 A;  3C4A A;  3UKF A;  4O5U A;  1NHQ A;  1PXC A;  2YAU A;  3KD9 A;  3UOX A;  1JNR A;  3CNJ A;  2R4E A;  2WPF A;  3SM8 A;  3EF6 A;  4U8K A;  1CC6 A;  2YM2 A;  3IC9 A;  4C3Y A;  3LXD A;  5EB5 A;  1Z6L A;  4NEW A;  1IUX A;  2C76 A;  3AB1 A;  3T37 A;  1ELI A;  4OPU A;  1MXT A;  2BXS A;  2BS2 A;  2CFY A;  4GR1 A;  5JCN A;  2XVE A;  1H81 A;  4K8D A;  1FEB A;  3NIX A;  3P4R A;  1FCD A;  4D04 A;  3KKJ A;  3AEB A;  3GSI A;  1GV4 A;  3NK0 X;  2GR3 A;  3CND A;  4U8I A;  5GSN A;  4DGK A;  1NG3 A;  1IUV A;  2ZZC A;  3AE7 A;  3I3L A;  3K7M X;  5EBK A;  3SFE A;  4DSH A;  1CJ2 A;  1VRQ B;  2TPR A;  2BYB A;  2R0P A;  3C96 A;  4U8O A;  4NTC A;  4EIQ A;  2WU5 A;  3P4P A;  1GET A;  2RAB A;  2WP5 A;  2R9Z A;  2AR8 A;  2H88 A;  3LB8 A;  3DJJ A;  3NK2 X;  4X9N A;  5EOW A;  2JBV A;  1FOH A;  4AT0 A;  1BKW A;  4C74 A;  3CNT A;  3VQR A;  1IUU A;  2QA1 A;  5M10 A;  5FS6 A;  4OCG A;  1VG9 A;  4H4R A;  2C64 A;  2AQJ A;  2V3A A;  3M13 A;  2TMD A;  2YR4 A;  1M64 A;  2BXR A;  2YG3 A;  2BS3 A;  2X3N A;  2XLR A;  2GV8 A;  4EQW A;  3PS9 A;  4GDP A;  4XWR A;  1IJH A;  2WOI A;  1GRE A;  2DKH A;  1L9E A;  1SEZ A;  4BJY A;  1D5T A;  1H84 A;  4Z26 A;  4OPI A;  5DBJ A;  1F8S A;  1BGN A;  1PBC A;  3HZL A;  1E1M A;  2XLP A;  1NG4 A;  2WP6 A;  2X8G A;  2X8H A;  3GD4 A;  4MJW A;  1O95 A;  4USR A;  3S5W A;  3UTF A;  2Q7V A;  5CQF A;  3DJD A;  3VRA A;  1DOE A;  3KU9 A;  4K5S A;  3UOV A;  1OJA A;  3QVP A;  2BC1 A;  1CJC A;  1JOA A;  3KA7 A;  1IUS A;  2Y6Q A;  1L9C A;  1B37 A;  3URH A;  4C3X A;  2EQ6 A;  5EB4 A;  5BUK A;  1JU2 A;  2H89 A;  1BWC A;  2XFQ A;  1YQ3 A;  2WDV A;  4H4T A;  4WX1 A;  2EQ8 A;  1F8R A;  1EL9 A;  3RNM A;  3UTG A;  2WES A;  3FPZ A;  1BGJ A;  2XDO A;  4A5L A;  1GRB A;  3QJ4 A;  1OJC A;  4RG4 A;  4C77 A;  4AOS A;  4EIP A;  4H4Z A;  3DGZ A;  1D4E A;  3SQP A;  3UP4 A;  4NTD A;  1GRF A;  3LZW A;  1NDA A;  3DH9 A;  4EM4 A;  1GRG A;  1NEK A;  3NRN A;  3ICR A;  1K0I A;  4EMI A;  4TLZ A;  3GRT A;  4J34 A;  3AEG A;  2C72 A;  3UKK A;  2X50 A;  2F5Z A;  1YQZ A;  4USQ A;  4KX6 A;  3QSM A;  4Z2R A;  4LA1 A;  1H83 A;  3COX A;  1L0V A;  3BI5 A;  2A87 A;  3ABV A;  2YR5 A;  2GF3 A;  3IHG A;  4TLX A;  1MOK A;  3SFD A;  2YG4 A;  3UKP A;  1GEU A;  2R45 A;  3UKH A;  3DA1 A;  1S3B A;  3ITJ A;  2BAC A;  1PBE A;  3GWF A;  1PBF A;  3AXB A;  3EAO A;  5KOW A;  3G5S A;  4FK1 A;  2GEW A;  2YLS A;  1GRA A;  1YY5 A;  4EM3 A;  1LQU A;  4NZH A;  1REO A;  2OAL A;  2ACZ A;  3ALJ A;  2B76 A;  3P9U A;  3KPF A;  1DOC A;  1Y56 A;  3PO7 A;  4TM3 A;  4B66 A;  2X99 A;  4GF7 A;  4Z2T A;  4PAB A;  1NHS A;  4YSX A;  1EL8 A;  1KDG A;  3ALL A;  3QSS A;  3AYJ A;  2FBW A;  3K30 A;  1K4Q A;  5U25 A;  5JCL A;  3UCL A;  2QCU A;  3H8L A;  1LVL A;  1D4D A;  4U8P A;  2C67 A;  1PN0 A;  1JEH A;  2WS3 A;  3AE8 A;  1RP0 A;  3LOV A;  2YVG A;  4YTM A;  1CJ3 A;  2IVD A;  5ER0 A;  3AE4 A;  3NHO X;  1BF3 A;  2EQ7 A;  1PBB A;  4J33 A;  2BK4 A;  1JNZ A;  3NN6 X;  1ZMC A;  4J31 A;  2C70 A;  3K7T A;  2FJD A;  1K0L A;  3NYF A;  1CF3 A;  5HY5 A;  2C75 A;  4ZCD A;  3AE5 A;  3F8R A;  4YKF A;  4P9S A;  3RHA A;  4EMJ A;  3BHK A;  2JB1 A;  2VVL A;  2QAE A;  4U2S A;  1GOS A;  4H2N A;  3GWD A;  3LZX A;  1W4X A;  3CGD A;  4Y4M A;  4AP3 A;  3O0H A;  2XFU A;  1XAN A;  1F3P A;  4IVO B;  2GR2 A;  2BCG G;  4J36 A;  3AEC A;  1DOB A;  3RP6 A;  2XLT A;  1S2Y A;  3CGC A;  4TM4 A;  3AD8 B;  5U63 A;  1NHR A;  1VDC A;  2Q0K A;  4H2R A;  1Q9I A;  1Y0P A;  1F8W A;  1DOD A;  1ZK7 A;  4EQS A;  1IUT A;  2XLU A;  4KPR A;  5KWF A;  1LV0 A;  1ZX9 A;  2ZZB A;  3IF9 A;  3GMB A;  4U8N A;  3AD9 B;  1NAA A;  3II4 A;  3AE2 A;  1YKJ A;  1NPX A;  3P4S A;  1N4U A;  5CKU A;  1UKV G;  2YWL A;  1XDI A;  4B63 A;  3CTY A;  1NEN A;  3UKA A;  1XPQ A;  4ECH A;  2OA1 A;  1DJN A;  1DXL A;  1FEC A;  4GRT A;  3AE3 A;  2B9W A;  3V76 A;  4UDQ A;  1VG0 A;  4K7Z A;  3KLJ A;  1LTX R;  2YLX A;  3FBS A;  5BVA A;  3B3R A;  3UTE A;  3ATQ A;  1E1L A;  3IWA A;  4J2W A;  5FS8 A;  4Z44 A;  1Y56 B;  4H2Q A;  4FDC B;  2YG7 A;  1D7Y A;  3NT6 A;  5JCM A;  3Q6J A;  4YSZ A;  2Q0L A;  3AYL A;  4H4W A;  4Y4L A;  1ZOY A;  4HB9 A;  4XXG A;  3GRS A;  4K22 A;  4AOX A;  4M52 A;  3UOZ A;  2EQ9 A;  2ARD A;  2APG A;  2GQF A;  1E1N A;  1GES A;  2XVI A;  3CPJ G;  3DJE A;  4JY3 A;  2R4J A;  3DJG X;  2C65 A;  3DGH A;  3VR9 A;  3NK1 X;  4CBQ A;  1XHC A;  4UDR A;  5HHF A;  1S3E A;  3AE1 A;  1KNR A;  3NKS A;  1ZP0 A;  4YWO A;  4AP1 A;  3FG2 P;  2VVL G;  4H4S A;  1CBO A;  4IVM B;  4B67 A;  1TYT A;  1GT8 A;  1H7W A;  2WQY A;  1H82 A;  4BUR A;  5JCI A;  4EMW A;  3V3N A;  2RGO A;  1RYI A;  2V3B A;  2BS4 A;  2WP9 A;  3GYJ A;  2J3N A;  4TM1 A;  3CIR A;  4LU6 A;  2GB0 A;  2NPX A;  1FL2 A;  1KNP A;  2GAG B;  2WEU A;  1DJQ A;  3K7Q X;  4GDE A;  4K5R A;  1JRZ A;  4JDR A;  2OAM A;  1PJ5 A;  1N4W A;  5KOX A;  5KVI A;  2Z5Y A;  1VQW A;  3UTH A;  2WET A;  4EQR A;  2BA9 A;  4JNA A;  1LPF A;  3L1R A;  4U2T A;  3E1T A;  1E1K A;  3F8P A;  1TYP A;  4ZCC A;  2YLZ A;  3UP5 A;  2RGJ A;  4EQX A;  2YR6 A;  3GYI A;  2B7S A;  2V61 A;  3AED A;  1TDE A;  4RSL A;  4XWZ A;  2C3D A;  3NN0 X;  1N4V A;  3JSK A;  4BK1 A;  3S61 A;  2WBA A;  3KVE A;  5GRT A;  5FS9 A;  2R46 A;  4D03 A;  3RP7 A;  2BK3 A;  2JB3 A;  2XVF A;  1BZL A;  4Z2U A;  1ZOV A;  3R9U A;  3ISH A;  2JKC A;  2WHD A;  4H7U A;  1QLB A;  2DKI A;  1CHU A;  1ZMD A;  1PJ6 A;  3UKQ A;  3AEF A;  2V60 A;  2VOU A;  1O5W A;  2VVM A;  3AE9 A;  3G5R A;  3QFA A;  3LAD A;  1TDF A;  2E1M A;  2BCP A;  5IPY A;  2YLR A;  5KXJ A;  1B5Q A;  2GRT A;  2HQM A;  4TM0 A;  4NTE A;  2QA2 A;  5J7X A;  3OZ2 A;  3UKL A;  3P1W A;  3BNM A;  4PAA A;  3C4N A;  4A79 A;  1CC2 A;  4B64 A;  4GCM A;  2XYO A;  4CCR A;  1K0J A;  2YM1 A;  2RGH A;  2YLW A;  2GR0 A;  2OLO A;  4CCQ A;  1GER A;  3BNU A;  4H50 A;  3ATR A;  4ZN0 A;  3F8D A;  4HA6 A;  2VZ2 A;  4A9W A;  4A65 A;  1Q1W A;  5U1O A;  4Z25 A;  1PHH A;  4IA6 A;  1CL0 A;  1QJD A;  2JB2 A;  2WU2 A;  3D1C A;  3PVC A;  4H4X A;  3GD3 A;  3AEE A;  3DME A;  2ZBW A;  2NVK X;  1H86 A;  4H4Y A;  1S2Q A;  2YQU A;  2CVJ A;  4A7A A;  1KF6 A;  2XVJ A;  1GPE A;  2IID A;  3P4Q A;  4YT0 A;  1B8S A;  1PJ7 A;  3AE6 A;  3AWI A;  4H4P A;  4ADW A;  3SGL A;  4I59 A;  4H4V A;  5FMH A;  3NG7 X;  1GRT A;  1GRH A;  2C3C A;  2UZZ A;  2E5V A;  3G5Q A;  1E7P A;  5HXI A;  3L8K A;  1ONF A;  2Q6U A;  1OJT A;  3H8I A;  1DNC A;  2WPE A;  3AD7 B;  1MO9 A;  1COY A;  3I6D A;  1LQT A;  2GAH B;  1P2H A;  2FJA A;  2I0Z A;  2YVF A;  4O5Q A;  1O94 A;  4OVI A;  4I58 A;  3ALM A;  4OPC A;  1KSU A;  3D8X A;  2GVC A;  2BK5 A;  1TDN A;  3Q9T A;  1GXF A;  3GMC A;  3BI4 A;  3EPT A;  4U8L A;  4A6N A;  4A99 A;  1OJ9 A;  3NH3 X;  4H2P A;  2W0H A;  2B9X A;  4BK3 A;  2VQ7 A;  2GMJ A;  2C7G A;  3V3O A;  4Z43 A;  1EBD A;  3ADA B;  4OPT A;  4X4J A;  4BK2 A;  3ZYX A;  3IHM A;  1QO8 A;  4IA5 A;  2V5Z A;  4OPD A;  1PXB A;  2VRM A;  4YTN A;  2OLN A;  3DK4 A;  4CNJ A;  2CDU A;  4X9M A;  3FIM B;  4AT2 A;  3QSE A;  5FS7 A;  1F6M A;  3CGE A;  1NHP A;  4U8M A;  4J57 A;  3ICT A;  2Z5X A;  2O9Z A;  3CNP A;  3FMW A;  2IVE A;  4JQ9 A;  2XFP A;  1EL5 A;  1LJ1 A;  3H4K A;  4JNQ A;  5L46 A;  3GDP A;  5C2T A;  2V6O A;  4B65 A;  2GQW A;  2FJB A;  1M6I A;  2YG6 A;  2BC0 A;  2WPC A;  3GDN A;  4YTP A;  1N1P A;  2WDR A;  3BI2 A;  4Y4N A;  1ZY8 A;  2VQB A;  4WCT A;  2YVJ A;  2R0C A;  3CPH G;  3NGC X;  3BHF A;  2PYX A;  5HYM A;  2GH5 A;  1B4V A;  1TDK A;  2XFO A;  3DK9 A;  4OPG A;  1V59 A;  2CUL A;  3QFB A;  1Q1R A;  4YSY A;  3ZDN A;  1OJD A;  3RED A;  5KRQ A;  3UOY A;  1YQ4 A;  3NTA A;  2XCG A;  4C5O A;  1TDO A;  4K2X A;  4U8J A;  1X31 B;  2B7R A;  4UDP A;  4ICY A;  4YSH A;  5C3J A;  1L9D A;  3RP8 A;  1EL7 A;  5M0Z A;  1FEA A;  1D4C A;  2XLS A;  3CNS A;  2JAE A;  1H7X A;  4CY6 A;  5KVH A;  2WOW A;  2ZZ0 A;  2GMH A;  1GTH A;  1D7L A;  4E0V A;  2YG5 A;  4H4U A;  1AOG A;  3B6D A;  2WDQ A;  2C73 A;  1PXA A;  4APN A;  4CNK A;  4FX9 A;  4YKG A;  5IQ1 A;  2BAB A;  1HYU A;  2GR1 A;  4N9X A;  4OPL A;  4IV9 A;  5TR3 A;  3AYI A;  4GUV A;  4B68 A;  3CPI G;  4U2L A;  3VR8 A;  3M12 A;  2XVH A;  1GSN A;  1CJ4 A;  3M0O A;  4B69 A;  1GND A;  1PDH A;  2WOV A;  5LV9 A;  4A6N B;  4DSG A;  1PBD A;  2X8C A;  3NNE A;  1GTE A;  3OC4 A;  3VRD B;  3DK8 A;  1E39 A;  4LII A;  1H6V A;  5JCK A;  2Y6R A;  3WE0 A;  1P2E A;  1RSG A;  2C66 A;  2PHH A;  3ICS A;  4CY8 A;  2A89 A;  3NYE A;  3VRB A;  5BRT A;  4BJZ A;  1KFY A;  1E6E A;  2VRL A;  2A8X A;  5BUL A;  5J60 A;  4J56 A;  2YLT A;  1KSS A;  1CC4 A;  2JK6 A;  3EAN A;  3QVR A;  4JY2 A;  1GAL A;  4REK A;  3NTD A; 
#chains in the Genus database with same CATH topology
 4BV6 A;  4B1B A;  4H4Q A;  1ZDL A;  2E4G A;  3AEA A;  1JRY A;  1IUW A;  4CRT A;  1ZKQ A;  4UP3 A;  4YXD A;  2XFN A;  5IQ4 A;  4Z24 A;  2FJE A;  1JRX A;  1TRB A;  4G73 A;  3LJP A;  3NLC A;  3NYC A;  3CN8 A;  2R0G A;  4JN9 A;  4RG3 A;  2AAQ A;  3GYX A;  4DNA A;  3CGB A;  4NEV A;  2B9Y A;  4FK1 C;  1PS9 A;  3C4A A;  3UKF A;  4O5U A;  1NHQ A;  1PXC A;  2YAU A;  3KD9 A;  3UOX A;  1JNR A;  3CNJ A;  2R4E A;  2WPF A;  3SM8 A;  3EF6 A;  4U8K A;  1CC6 A;  2YM2 A;  3IC9 A;  4GAP A;  3LXD A;  4C3Y A;  5EB5 A;  1Z6L A;  4NEW A;  1IUX A;  2C76 A;  3AB1 A;  3T37 A;  1ELI A;  4OPU A;  1MXT A;  2BXS A;  2BS2 A;  2CFY A;  4GR1 A;  5JCN A;  2XVE A;  1H81 A;  4K8D A;  1FEB A;  3NIX A;  3P4R A;  1FCD A;  4D04 A;  3KKJ A;  3AEB A;  3GSI A;  1GV4 A;  3NK0 X;  2GR3 A;  3CND A;  4U8I A;  5GSN A;  4DGK A;  1NG3 A;  1IUV A;  2ZZC A;  3AE7 A;  3I3L A;  3K7M X;  5EBK A;  3SFE A;  4DSH A;  1CJ2 A;  1VRQ B;  2TPR A;  2BYB A;  2R0P A;  3C96 A;  4U8O A;  4NTC A;  4EIQ A;  2WU5 A;  3P4P A;  1GET A;  2RAB A;  2WP5 A;  2R9Z A;  2AR8 A;  2H88 A;  3LB8 A;  3DJJ A;  3NK2 X;  4X9N A;  5EOW A;  2JBV A;  1FOH A;  4AT0 A;  1BKW A;  4C74 A;  3CNT A;  4G6H A;  3VQR A;  1IUU A;  2QA1 A;  5M10 A;  5FS6 A;  4OCG A;  1VG9 A;  4H4R A;  2C64 A;  2AQJ A;  2V3A A;  3M13 A;  2TMD A;  2YR4 A;  1M64 A;  2BXR A;  2YG3 A;  2BS3 A;  2X3N A;  2XLR A;  2GV8 A;  3SZW A;  4EQW A;  3PS9 A;  4GDP A;  4XWR A;  1IJH A;  3HYW A;  2WOI A;  1GRE A;  2DKH A;  1L9E A;  1SEZ A;  4BJY A;  1D5T A;  1H84 A;  4Z26 A;  4OPI A;  5DBJ A;  1F8S A;  1BGN A;  1PBC A;  3HZL A;  1E1M A;  2XLP A;  1NG4 A;  2WP6 A;  2X8G A;  2X8H A;  3GD4 A;  4MJW A;  1O95 A;  4USR A;  3S5W A;  3UTF A;  2Q7V A;  5CQF A;  3DJD A;  3VRA A;  1DOE A;  3KU9 A;  4K5S A;  3UOV A;  1OJA A;  3QVP A;  2BC1 A;  1CJC A;  1JOA A;  3CMM A;  3KA7 A;  1IUS A;  2Y6Q A;  1L9C A;  1B37 A;  3URH A;  4C3X A;  2EQ6 A;  5EB4 A;  5BUK A;  1JU2 A;  2H89 A;  1BWC A;  2XFQ A;  1YQ3 A;  2WDV A;  4H4T A;  4WX1 A;  2EQ8 A;  1F8R A;  1EL9 A;  3RNM A;  3UTG A;  2WES A;  3FPZ A;  1BGJ A;  2XDO A;  4A5L A;  1GRB A;  3QJ4 A;  1OJC A;  4RG4 A;  4C77 A;  4AOS A;  3T2Z A;  4H4Z A;  4EIP A;  3DGZ A;  1D4E A;  3SQP A;  3UP4 A;  4NTD A;  1GRF A;  3LZW A;  1NDA A;  3DH9 A;  4EM4 A;  1GRG A;  1NEK A;  3NRN A;  3ICR A;  1K0I A;  4EMI A;  4TLZ A;  3GRT A;  4J34 A;  3AEG A;  2C72 A;  4NNJ A;  2X50 A;  3UKK A;  2F5Z A;  1YQZ A;  4USQ A;  4KX6 A;  3QSM A;  3SY4 A;  4Z2R A;  4LA1 A;  1H83 A;  3COX A;  1L0V A;  3BI5 A;  2A87 A;  3ABV A;  2YR5 A;  2GF3 A;  3IHG A;  4TLX A;  1MOK A;  3SFD A;  2YG4 A;  3UKP A;  1GEU A;  2R45 A;  3UKH A;  3DA1 A;  1S3B A;  3ITJ A;  2BAC A;  1PBE A;  3GWF A;  1PBF A;  3AXB A;  3EAO A;  4II2 A;  5KOW A;  3G5S A;  4FK1 A;  2GEW A;  2YLS A;  1GRA A;  1YY5 A;  4EM3 A;  1LQU A;  4NZH A;  1REO A;  2OAL A;  2ACZ A;  3ALJ A;  2B76 A;  3P9U A;  3KPF A;  1DOC A;  1Y56 A;  3PO7 A;  4TM3 A;  4B66 A;  2X99 A;  4GF7 A;  4Z2T A;  4PAB A;  1NHS A;  4YSX A;  1EL8 A;  1KDG A;  3ALL A;  3QSS A;  3AYJ A;  3KPK A;  2FBW A;  3K30 A;  1K4Q A;  5U25 A;  5JCL A;  3UCL A;  2QCU A;  3H8L A;  1LVL A;  2BRA A;  1D4D A;  4U8P A;  3SZF A;  2C67 A;  1PN0 A;  1JEH A;  2WS3 A;  3AE8 A;  1RP0 A;  3LOV A;  2YVG A;  4YTM A;  1CJ3 A;  2IVD A;  5ER0 A;  3AE4 A;  3NHO X;  1BF3 A;  2EQ7 A;  1PBB A;  4J33 A;  2BK4 A;  1JNZ A;  3NN6 X;  3SZ0 A;  1ZMC A;  4J31 A;  2C70 A;  3K7T A;  2FJD A;  1K0L A;  3NYF A;  1CF3 A;  5HY5 A;  2C75 A;  4ZCD A;  3AE5 A;  3F8R A;  4YKF A;  4P9S A;  3RHA A;  4EMJ A;  3BHK A;  2JB1 A;  2VVL A;  3T31 A;  2QAE A;  4U2S A;  1GOS A;  4H2N A;  3GWD A;  3LZX A;  1W4X A;  3CGD A;  4Y4M A;  4AP3 A;  3O0H A;  2XFU A;  1XAN A;  1F3P A;  4IVO B;  2GR2 A;  2BCG G;  4J36 A;  3AEC A;  1DOB A;  3T2Y A;  3SYI A;  3HYX A;  3RP6 A;  2XLT A;  1S2Y A;  3CGC A;  4TM4 A;  3AD8 B;  5U63 A;  1NHR A;  1VDC A;  2Q0K A;  4H2R A;  1Q9I A;  1Y0P A;  1F8W A;  1DOD A;  1ZK7 A;  4EQS A;  1IUT A;  2XLU A;  4KPR A;  5KWF A;  1LV0 A;  1ZX9 A;  2ZZB A;  3IF9 A;  3GMB A;  4U8N A;  3AD9 B;  1NAA A;  3II4 A;  3AE2 A;  1YKJ A;  4GAV A;  1NPX A;  3P4S A;  1N4U A;  5CKU A;  1UKV G;  2YWL A;  1XDI A;  4B63 A;  3CTY A;  1NEN A;  3UKA A;  1XPQ A;  4ECH A;  2OA1 A;  1DJN A;  1DXL A;  1FEC A;  4GRT A;  3AE3 A;  2B9W A;  3V76 A;  4UDQ A;  1VG0 A;  4K7Z A;  3KLJ A;  1LTX R;  2YLX A;  3FBS A;  5BVA A;  3B3R A;  5KMS A;  3UTE A;  3ATQ A;  1E1L A;  3IWA A;  4J2W A;  5FS8 A;  4Z44 A;  1Y56 B;  4H2Q A;  4FDC B;  2YG7 A;  1D7Y A;  3NT6 A;  5JCM A;  5KMQ A;  3Q6J A;  4YSZ A;  2Q0L A;  3AYL A;  4H4W A;  4Y4L A;  1ZOY A;  4HB9 A;  4XXG A;  3GRS A;  4K22 A;  4AOX A;  4M52 A;  3UOZ A;  2EQ9 A;  2ARD A;  2APG A;  2GQF A;  1E1N A;  1GES A;  2XVI A;  3CPJ G;  3DJE A;  4JY3 A;  2R4J A;  3DJG X;  2C65 A;  3DGH A;  3VR9 A;  3NK1 X;  4CBQ A;  1XHC A;  4UDR A;  5HHF A;  1S3E A;  3AE1 A;  1KNR A;  3NKS A;  1ZP0 A;  4YWO A;  4AP1 A;  3FG2 P;  2VVL G;  4H4S A;  1CBO A;  4IVM B;  4B67 A;  1TYT A;  1GT8 A;  1H7W A;  2WQY A;  1H82 A;  4BUR A;  5JCI A;  4EMW A;  3V3N A;  2RGO A;  1RYI A;  2V3B A;  2BS4 A;  2WP9 A;  3GYJ A;  2J3N A;  4TM1 A;  3CIR A;  4LU6 A;  2GB0 A;  2NPX A;  1FL2 A;  1KNP A;  2GAG B;  2WEU A;  1DJQ A;  3K7Q X;  4GDE A;  4K5R A;  1JRZ A;  4JDR A;  2OAM A;  1PJ5 A;  1N4W A;  5KOX A;  5KVI A;  2Z5Y A;  3SZC A;  1VQW A;  3UTH A;  2WET A;  2BRY A;  4EQR A;  3SX6 A;  2BA9 A;  4JNA A;  1LPF A;  3L1R A;  4U2T A;  3E1T A;  1E1K A;  3F8P A;  1TYP A;  4ZCC A;  2YLZ A;  3UP5 A;  2RGJ A;  4EQX A;  2YR6 A;  3GYI A;  2B7S A;  2V61 A;  3AED A;  1TDE A;  4RSL A;  4XWZ A;  2C3D A;  3NN0 X;  1N4V A;  3JSK A;  4BK1 A;  3S61 A;  2WBA A;  3KVE A;  5GRT A;  5FS9 A;  2R46 A;  4D03 A;  3RP7 A;  2BK3 A;  2JB3 A;  2XVF A;  1BZL A;  4Z2U A;  1ZOV A;  3R9U A;  3ISH A;  2JKC A;  2WHD A;  4H7U A;  1QLB A;  2DKI A;  1CHU A;  1ZMD A;  1PJ6 A;  3UKQ A;  3AEF A;  2V60 A;  2VOU A;  1O5W A;  2VVM A;  3AE9 A;  3G5R A;  3QFA A;  3LAD A;  1TDF A;  2E1M A;  2BCP A;  5IPY A;  2YLR A;  5KXJ A;  1B5Q A;  2GRT A;  2HQM A;  4TM0 A;  4NTE A;  2QA2 A;  5J7X A;  3OZ2 A;  3UKL A;  3P1W A;  3BNM A;  4PAA A;  3C4N A;  4A79 A;  1CC2 A;  4B64 A;  4GCM A;  3SXI A;  2XYO A;  4CCR A;  1K0J A;  2YM1 A;  2RGH A;  2YLW A;  2GR0 A;  2OLO A;  4CCQ A;  1GER A;  3BNU A;  4H50 A;  3ATR A;  4ZN0 A;  3F8D A;  4HA6 A;  2VZ2 A;  4G74 A;  4A9W A;  4A65 A;  1Q1W A;  5U1O A;  4Z25 A;  1PHH A;  4IA6 A;  1CL0 A;  1QJD A;  2JB2 A;  2WU2 A;  3D1C A;  3PVC A;  4H4X A;  3GD3 A;  3AEE A;  3DME A;  2ZBW A;  2NVK X;  1H86 A;  4H4Y A;  1S2Q A;  2YQU A;  5KMP A;  2CVJ A;  4A7A A;  1KF6 A;  2XVJ A;  3T2K A;  1GPE A;  2IID A;  3P4Q A;  4YT0 A;  1B8S A;  1PJ7 A;  3AE6 A;  3AWI A;  4H4P A;  4ADW A;  3SGL A;  4I59 A;  4H4V A;  5FMH A;  4G6G A;  3NG7 X;  1GRT A;  1GRH A;  2C3C A;  2UZZ A;  2E5V A;  3G5Q A;  1E7P A;  5HXI A;  3L8K A;  1ONF A;  2Q6U A;  1OJT A;  3H8I A;  1DNC A;  2WPE A;  3AD7 B;  1MO9 A;  1COY A;  3I6D A;  1LQT A;  2GAH B;  1P2H A;  2FJA A;  2I0Z A;  2YVF A;  4O5Q A;  1O94 A;  4OVI A;  4I58 A;  3ALM A;  4OPC A;  1KSU A;  3D8X A;  2GVC A;  2BK5 A;  1TDN A;  3Q9T A;  1GXF A;  3GMC A;  3BI4 A;  3EPT A;  4U8L A;  4A6N A;  4A99 A;  1OJ9 A;  3NH3 X;  4H2P A;  2W0H A;  2B9X A;  4BK3 A;  2VQ7 A;  2GMJ A;  2C7G A;  3V3O A;  4Z43 A;  1EBD A;  3ADA B;  4OPT A;  4X4J A;  4BK2 A;  3ZYX A;  3IHM A;  1QO8 A;  4IA5 A;  2V5Z A;  4OPD A;  4NWZ A;  1PXB A;  2VRM A;  5KMR A;  4YTN A;  2C4C A;  2OLN A;  3DK4 A;  4CNJ A;  2CDU A;  4X9M A;  3FIM B;  4AT2 A;  3QSE A;  5FS7 A;  1F6M A;  3CGE A;  1NHP A;  4U8M A;  4J57 A;  3ICT A;  2Z5X A;  2O9Z A;  3CNP A;  3FMW A;  2IVE A;  4JQ9 A;  2XFP A;  1EL5 A;  1LJ1 A;  3H4K A;  4JNQ A;  5L46 A;  3GDP A;  5C2T A;  2V6O A;  4B65 A;  2GQW A;  2FJB A;  1M6I A;  2YG6 A;  2BC0 A;  2WPC A;  3GDN A;  4YTP A;  1N1P A;  2WDR A;  3BI2 A;  4Y4N A;  1ZY8 A;  2VQB A;  4WCT A;  5KNL A;  2YVJ A;  2R0C A;  3CPH G;  3NGC X;  3BHF A;  2PYX A;  3T14 A;  2GH5 A;  5HYM A;  1B4V A;  1TDK A;  2XFO A;  3DK9 A;  4OPG A;  1V59 A;  2CUL A;  3QFB A;  1Q1R A;  4YSY A;  3ZDN A;  1OJD A;  3RED A;  5KRQ A;  3UOY A;  1YQ4 A;  3NTA A;  2XCG A;  4C5O A;  1TDO A;  4K2X A;  4U8J A;  1X31 B;  2B7R A;  4UDP A;  4ICY A;  4YSH A;  5C3J A;  1L9D A;  3RP8 A;  1EL7 A;  3HYV A;  5M0Z A;  1FEA A;  1D4C A;  2XLS A;  3CNS A;  2JAE A;  1H7X A;  4CY6 A;  5KVH A;  2WOW A;  2ZZ0 A;  2GMH A;  1GTH A;  1D7L A;  4E0V A;  2YG5 A;  4H4U A;  1AOG A;  3B6D A;  2WDQ A;  2C73 A;  1PXA A;  4APN A;  4CNK A;  4FX9 A;  4YKG A;  5IQ1 A;  2BAB A;  1HYU A;  2GR1 A;  4N9X A;  4OPL A;  4IV9 A;  5TR3 A;  3AYI A;  4GUV A;  4B68 A;  3CPI G;  4U2L A;  3VR8 A;  3M12 A;  2XVH A;  1GSN A;  1CJ4 A;  3M0O A;  4B69 A;  1GND A;  1PDH A;  2WOV A;  5LV9 A;  4A6N B;  4DSG A;  1PBD A;  2X8C A;  3NNE A;  1GTE A;  3OC4 A;  4II3 A;  3VRD B;  3DK8 A;  1E39 A;  4LII A;  1H6V A;  5JCK A;  3WE0 A;  2Y6R A;  1P2E A;  1RSG A;  2C66 A;  2PHH A;  3ICS A;  3T0K A;  2A89 A;  3NYE A;  4CY8 A;  3VRB A;  5BRT A;  4BJZ A;  1KFY A;  1E6E A;  2VRL A;  2A8X A;  5BUL A;  5J60 A;  4J56 A;  2YLT A;  4G9K A;  1KSS A;  1CC4 A;  2JK6 A;  3EAN A;  3QVR A;  4JY2 A;  1GAL A;  4REK A;  3NTD A; 
#chains in the Genus database with same CATH homology
 4BV6 A;  4B1B A;  4H4Q A;  1ZDL A;  2E4G A;  3AEA A;  1JRY A;  1IUW A;  4CRT A;  1ZKQ A;  4UP3 A;  4YXD A;  2XFN A;  5IQ4 A;  4Z24 A;  2FJE A;  1JRX A;  1TRB A;  4G73 A;  3LJP A;  3NLC A;  3NYC A;  3CN8 A;  2R0G A;  4JN9 A;  4RG3 A;  2AAQ A;  3GYX A;  4DNA A;  3CGB A;  4NEV A;  2B9Y A;  4FK1 C;  1PS9 A;  3C4A A;  3UKF A;  4O5U A;  1NHQ A;  1PXC A;  2YAU A;  3KD9 A;  3UOX A;  1JNR A;  3CNJ A;  2R4E A;  2WPF A;  3SM8 A;  3EF6 A;  4U8K A;  1CC6 A;  2YM2 A;  3IC9 A;  4GAP A;  3LXD A;  4C3Y A;  5EB5 A;  1Z6L A;  4NEW A;  1IUX A;  2C76 A;  3AB1 A;  3T37 A;  1ELI A;  4OPU A;  1MXT A;  2BXS A;  2BS2 A;  2CFY A;  4GR1 A;  5JCN A;  2XVE A;  1H81 A;  4K8D A;  1FEB A;  3NIX A;  3P4R A;  1FCD A;  4D04 A;  3KKJ A;  3AEB A;  3GSI A;  1GV4 A;  3NK0 X;  2GR3 A;  3CND A;  4U8I A;  5GSN A;  4DGK A;  1NG3 A;  1IUV A;  2ZZC A;  3AE7 A;  3I3L A;  3K7M X;  5EBK A;  3SFE A;  4DSH A;  1CJ2 A;  1VRQ B;  2TPR A;  2BYB A;  2R0P A;  3C96 A;  4U8O A;  4NTC A;  4EIQ A;  2WU5 A;  3P4P A;  1GET A;  2RAB A;  2WP5 A;  2R9Z A;  2AR8 A;  2H88 A;  3LB8 A;  3DJJ A;  3NK2 X;  4X9N A;  5EOW A;  2JBV A;  1FOH A;  4AT0 A;  1BKW A;  4C74 A;  3CNT A;  4G6H A;  3VQR A;  1IUU A;  2QA1 A;  5M10 A;  5FS6 A;  4OCG A;  1VG9 A;  4H4R A;  2C64 A;  2AQJ A;  2V3A A;  3M13 A;  2TMD A;  2YR4 A;  1M64 A;  2BXR A;  2YG3 A;  2BS3 A;  2X3N A;  2XLR A;  2GV8 A;  3SZW A;  4EQW A;  3PS9 A;  4GDP A;  4XWR A;  1IJH A;  3HYW A;  2WOI A;  1GRE A;  2DKH A;  1L9E A;  1SEZ A;  4BJY A;  1D5T A;  1H84 A;  4Z26 A;  4OPI A;  5DBJ A;  1F8S A;  1BGN A;  1PBC A;  3HZL A;  1E1M A;  2XLP A;  1NG4 A;  2WP6 A;  2X8G A;  2X8H A;  3GD4 A;  4MJW A;  1O95 A;  4USR A;  3S5W A;  3UTF A;  2Q7V A;  5CQF A;  3DJD A;  3VRA A;  1DOE A;  3KU9 A;  4K5S A;  3UOV A;  1OJA A;  3QVP A;  2BC1 A;  1CJC A;  1JOA A;  3CMM A;  3KA7 A;  1IUS A;  2Y6Q A;  1L9C A;  1B37 A;  3URH A;  4C3X A;  2EQ6 A;  5EB4 A;  5BUK A;  1JU2 A;  2H89 A;  1BWC A;  2XFQ A;  1YQ3 A;  2WDV A;  4H4T A;  4WX1 A;  2EQ8 A;  1F8R A;  1EL9 A;  3RNM A;  3UTG A;  2WES A;  3FPZ A;  1BGJ A;  2XDO A;  4A5L A;  1GRB A;  3QJ4 A;  1OJC A;  4RG4 A;  4C77 A;  4AOS A;  3T2Z A;  4H4Z A;  4EIP A;  3DGZ A;  1D4E A;  3SQP A;  3UP4 A;  4NTD A;  1GRF A;  3LZW A;  1NDA A;  3DH9 A;  4EM4 A;  1GRG A;  1NEK A;  3NRN A;  3ICR A;  1K0I A;  4EMI A;  4TLZ A;  3GRT A;  4J34 A;  3AEG A;  2C72 A;  4NNJ A;  2X50 A;  3UKK A;  2F5Z A;  1YQZ A;  4USQ A;  4KX6 A;  3QSM A;  3SY4 A;  4Z2R A;  4LA1 A;  1H83 A;  3COX A;  1L0V A;  3BI5 A;  2A87 A;  3ABV A;  2YR5 A;  2GF3 A;  3IHG A;  4TLX A;  1MOK A;  3SFD A;  2YG4 A;  3UKP A;  1GEU A;  2R45 A;  3UKH A;  3DA1 A;  1S3B A;  3ITJ A;  2BAC A;  1PBE A;  3GWF A;  1PBF A;  3AXB A;  3EAO A;  4II2 A;  5KOW A;  3G5S A;  4FK1 A;  2GEW A;  2YLS A;  1GRA A;  1YY5 A;  4EM3 A;  1LQU A;  4NZH A;  1REO A;  2OAL A;  2ACZ A;  3ALJ A;  2B76 A;  3P9U A;  3KPF A;  1DOC A;  1Y56 A;  3PO7 A;  4TM3 A;  4B66 A;  2X99 A;  4GF7 A;  4Z2T A;  4PAB A;  1NHS A;  4YSX A;  1EL8 A;  1KDG A;  3ALL A;  3QSS A;  3AYJ A;  3KPK A;  2FBW A;  3K30 A;  1K4Q A;  5U25 A;  5JCL A;  3UCL A;  2QCU A;  3H8L A;  1LVL A;  2BRA A;  1D4D A;  4U8P A;  3SZF A;  2C67 A;  1PN0 A;  1JEH A;  2WS3 A;  3AE8 A;  1RP0 A;  3LOV A;  2YVG A;  4YTM A;  1CJ3 A;  2IVD A;  5ER0 A;  3AE4 A;  3NHO X;  1BF3 A;  2EQ7 A;  1PBB A;  4J33 A;  2BK4 A;  1JNZ A;  3NN6 X;  3SZ0 A;  1ZMC A;  4J31 A;  2C70 A;  3K7T A;  2FJD A;  1K0L A;  3NYF A;  1CF3 A;  5HY5 A;  2C75 A;  4ZCD A;  3AE5 A;  3F8R A;  4YKF A;  4P9S A;  3RHA A;  4EMJ A;  3BHK A;  2JB1 A;  2VVL A;  3T31 A;  2QAE A;  4U2S A;  1GOS A;  4H2N A;  3GWD A;  3LZX A;  1W4X A;  3CGD A;  4Y4M A;  4AP3 A;  3O0H A;  2XFU A;  1XAN A;  1F3P A;  4IVO B;  2GR2 A;  2BCG G;  4J36 A;  3AEC A;  1DOB A;  3T2Y A;  3SYI A;  3HYX A;  3RP6 A;  2XLT A;  1S2Y A;  3CGC A;  4TM4 A;  3AD8 B;  5U63 A;  1NHR A;  1VDC A;  2Q0K A;  4H2R A;  1Q9I A;  1Y0P A;  1F8W A;  1DOD A;  1ZK7 A;  4EQS A;  1IUT A;  2XLU A;  4KPR A;  5KWF A;  1LV0 A;  1ZX9 A;  2ZZB A;  3IF9 A;  3GMB A;  4U8N A;  3AD9 B;  1NAA A;  3II4 A;  3AE2 A;  1YKJ A;  4GAV A;  1NPX A;  3P4S A;  1N4U A;  5CKU A;  1UKV G;  2YWL A;  1XDI A;  4B63 A;  3CTY A;  1NEN A;  3UKA A;  1XPQ A;  4ECH A;  2OA1 A;  1DJN A;  1DXL A;  1FEC A;  4GRT A;  3AE3 A;  2B9W A;  3V76 A;  4UDQ A;  1VG0 A;  4K7Z A;  3KLJ A;  1LTX R;  2YLX A;  3FBS A;  5BVA A;  3B3R A;  5KMS A;  3UTE A;  3ATQ A;  1E1L A;  3IWA A;  4J2W A;  5FS8 A;  4Z44 A;  1Y56 B;  4H2Q A;  4FDC B;  2YG7 A;  1D7Y A;  3NT6 A;  5JCM A;  5KMQ A;  3Q6J A;  4YSZ A;  2Q0L A;  3AYL A;  4H4W A;  4Y4L A;  1ZOY A;  4HB9 A;  4XXG A;  3GRS A;  4K22 A;  4AOX A;  4M52 A;  3UOZ A;  2EQ9 A;  2ARD A;  2APG A;  2GQF A;  1E1N A;  1GES A;  2XVI A;  3CPJ G;  3DJE A;  4JY3 A;  2R4J A;  3DJG X;  2C65 A;  3DGH A;  3VR9 A;  3NK1 X;  4CBQ A;  1XHC A;  4UDR A;  5HHF A;  1S3E A;  3AE1 A;  1KNR A;  3NKS A;  1ZP0 A;  4YWO A;  4AP1 A;  3FG2 P;  2VVL G;  4H4S A;  1CBO A;  4IVM B;  4B67 A;  1TYT A;  1GT8 A;  1H7W A;  2WQY A;  1H82 A;  4BUR A;  5JCI A;  4EMW A;  3V3N A;  2RGO A;  1RYI A;  2V3B A;  2BS4 A;  2WP9 A;  3GYJ A;  2J3N A;  4TM1 A;  3CIR A;  4LU6 A;  2GB0 A;  2NPX A;  1FL2 A;  1KNP A;  2GAG B;  2WEU A;  1DJQ A;  3K7Q X;  4GDE A;  4K5R A;  1JRZ A;  4JDR A;  2OAM A;  1PJ5 A;  1N4W A;  5KOX A;  5KVI A;  2Z5Y A;  3SZC A;  1VQW A;  3UTH A;  2WET A;  2BRY A;  4EQR A;  3SX6 A;  2BA9 A;  4JNA A;  1LPF A;  3L1R A;  4U2T A;  3E1T A;  1E1K A;  3F8P A;  1TYP A;  4ZCC A;  2YLZ A;  3UP5 A;  2RGJ A;  4EQX A;  2YR6 A;  3GYI A;  2B7S A;  2V61 A;  3AED A;  1TDE A;  4RSL A;  4XWZ A;  2C3D A;  3NN0 X;  1N4V A;  3JSK A;  4BK1 A;  3S61 A;  2WBA A;  3KVE A;  5GRT A;  5FS9 A;  2R46 A;  4D03 A;  3RP7 A;  2BK3 A;  2JB3 A;  2XVF A;  1BZL A;  4Z2U A;  1ZOV A;  3R9U A;  3ISH A;  2JKC A;  2WHD A;  4H7U A;  1QLB A;  2DKI A;  1CHU A;  1ZMD A;  1PJ6 A;  3UKQ A;  3AEF A;  2V60 A;  2VOU A;  1O5W A;  2VVM A;  3AE9 A;  3G5R A;  3QFA A;  3LAD A;  1TDF A;  2E1M A;  2BCP A;  5IPY A;  2YLR A;  5KXJ A;  1B5Q A;  2GRT A;  2HQM A;  4TM0 A;  4NTE A;  2QA2 A;  5J7X A;  3OZ2 A;  3UKL A;  3P1W A;  3BNM A;  4PAA A;  3C4N A;  4A79 A;  1CC2 A;  4B64 A;  4GCM A;  3SXI A;  2XYO A;  4CCR A;  1K0J A;  2YM1 A;  2RGH A;  2YLW A;  2GR0 A;  2OLO A;  4CCQ A;  1GER A;  3BNU A;  4H50 A;  3ATR A;  4ZN0 A;  3F8D A;  4HA6 A;  2VZ2 A;  4G74 A;  4A9W A;  4A65 A;  1Q1W A;  5U1O A;  4Z25 A;  1PHH A;  4IA6 A;  1CL0 A;  1QJD A;  2JB2 A;  2WU2 A;  3D1C A;  3PVC A;  4H4X A;  3GD3 A;  3AEE A;  3DME A;  2ZBW A;  2NVK X;  1H86 A;  4H4Y A;  1S2Q A;  2YQU A;  5KMP A;  2CVJ A;  4A7A A;  1KF6 A;  2XVJ A;  3T2K A;  1GPE A;  2IID A;  3P4Q A;  4YT0 A;  1B8S A;  1PJ7 A;  3AE6 A;  3AWI A;  4H4P A;  4ADW A;  3SGL A;  4I59 A;  4H4V A;  5FMH A;  4G6G A;  3NG7 X;  1GRT A;  1GRH A;  2C3C A;  2UZZ A;  2E5V A;  3G5Q A;  1E7P A;  5HXI A;  3L8K A;  1ONF A;  2Q6U A;  1OJT A;  3H8I A;  1DNC A;  2WPE A;  3AD7 B;  1MO9 A;  1COY A;  3I6D A;  1LQT A;  2GAH B;  1P2H A;  2FJA A;  2I0Z A;  2YVF A;  4O5Q A;  1O94 A;  4OVI A;  4I58 A;  3ALM A;  4OPC A;  1KSU A;  3D8X A;  2GVC A;  2BK5 A;  1TDN A;  3Q9T A;  1GXF A;  3GMC A;  3BI4 A;  3EPT A;  4U8L A;  4A6N A;  4A99 A;  1OJ9 A;  3NH3 X;  4H2P A;  2W0H A;  2B9X A;  4BK3 A;  2VQ7 A;  2GMJ A;  2C7G A;  3V3O A;  4Z43 A;  1EBD A;  3ADA B;  4OPT A;  4X4J A;  4BK2 A;  3ZYX A;  3IHM A;  1QO8 A;  4IA5 A;  2V5Z A;  4OPD A;  4NWZ A;  1PXB A;  2VRM A;  5KMR A;  4YTN A;  2C4C A;  2OLN A;  3DK4 A;  4CNJ A;  2CDU A;  4X9M A;  3FIM B;  4AT2 A;  3QSE A;  5FS7 A;  1F6M A;  3CGE A;  1NHP A;  4U8M A;  4J57 A;  3ICT A;  2Z5X A;  2O9Z A;  3CNP A;  3FMW A;  2IVE A;  4JQ9 A;  2XFP A;  1EL5 A;  1LJ1 A;  3H4K A;  4JNQ A;  5L46 A;  3GDP A;  5C2T A;  2V6O A;  4B65 A;  2GQW A;  2FJB A;  1M6I A;  2YG6 A;  2BC0 A;  2WPC A;  3GDN A;  4YTP A;  1N1P A;  2WDR A;  3BI2 A;  4Y4N A;  1ZY8 A;  2VQB A;  4WCT A;  5KNL A;  2YVJ A;  2R0C A;  3CPH G;  3NGC X;  3BHF A;  2PYX A;  3T14 A;  2GH5 A;  5HYM A;  1B4V A;  1TDK A;  2XFO A;  3DK9 A;  4OPG A;  1V59 A;  2CUL A;  3QFB A;  1Q1R A;  4YSY A;  3ZDN A;  1OJD A;  3RED A;  5KRQ A;  3UOY A;  1YQ4 A;  3NTA A;  2XCG A;  4C5O A;  1TDO A;  4K2X A;  4U8J A;  1X31 B;  2B7R A;  4UDP A;  4ICY A;  4YSH A;  5C3J A;  1L9D A;  3RP8 A;  1EL7 A;  3HYV A;  5M0Z A;  1FEA A;  1D4C A;  2XLS A;  3CNS A;  2JAE A;  1H7X A;  4CY6 A;  5KVH A;  2WOW A;  2ZZ0 A;  2GMH A;  1GTH A;  1D7L A;  4E0V A;  2YG5 A;  4H4U A;  1AOG A;  3B6D A;  2WDQ A;  2C73 A;  1PXA A;  4APN A;  4CNK A;  4FX9 A;  4YKG A;  5IQ1 A;  2BAB A;  1HYU A;  2GR1 A;  4N9X A;  4OPL A;  4IV9 A;  5TR3 A;  3AYI A;  4GUV A;  4B68 A;  3CPI G;  4U2L A;  3VR8 A;  3M12 A;  2XVH A;  1GSN A;  1CJ4 A;  3M0O A;  4B69 A;  1GND A;  1PDH A;  2WOV A;  5LV9 A;  4A6N B;  4DSG A;  1PBD A;  2X8C A;  3NNE A;  1GTE A;  3OC4 A;  4II3 A;  3VRD B;  3DK8 A;  1E39 A;  4LII A;  1H6V A;  5JCK A;  2Y6R A;  3WE0 A;  1P2E A;  1RSG A;  2C66 A;  2PHH A;  3ICS A;  3T0K A;  2A89 A;  3NYE A;  4CY8 A;  3VRB A;  5BRT A;  4BJZ A;  1KFY A;  1E6E A;  2VRL A;  2A8X A;  5BUL A;  5J60 A;  4J56 A;  2YLT A;  4G9K A;  1KSS A;  1CC4 A;  2JK6 A;  3EAN A;  3QVR A;  4JY2 A;  1GAL A;  4REK A;  3NTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...