1TDNA

L-amino acid oxidase from agkistrodon halys in complex with l-leucine
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complex with substrates and substrate analogue
rcsb
total genus 172
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdnA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdnA01
4REKA 1GRGA 2UZZA 2XVFA 2WOVA 2XVJA 3PVCA 1NG4A 4Z2RA 4HA6A 1IUTA 2BYBA 1DODA 1Z6LA 2WDVA 2GR0A 3AE1A 2CDUA 3M13A 2R0CA 4BK2A 1MXTA 4WCTA 2XLUA 1E1NA 1NHRA 1KSUA 1FEBA 3ATRA 3UKQA 1NHSA 5HHFA 1F6MA 2Q0LA 4OPGA 2R4JA 3AEAA 3AD9B 4IV9A 2XVIA 2A8XA 3ALLA 3K7TA 3D8XA 1OJCA 1GRBA 4O5UA 1Y56B 1O95A 1ZKQA 4U8JA 4Y4LA 2YLTA 4LA1A 4U2SA 3C4AA 3BI5A 5DBJA 3ATQA 4U2TA 1LPFA 1E1LA 3LJPA 4BJZA 3CGCA 2A89A 1PBEA 4BURA 3F8RA 5U1OA 3ICRA 1CC4A 1E6EA 2V3BA 4C74A 2WPFA 1NAAA 3T37A 1L9CA 2VZ2A 3HZLA 1FECA 4JY2A 2YLWA 2YG7A 4GRTA 4A99A 3NT6A 3P4RA 3AE2A 1W4XA 4PABA 4EM4A 3PO7A 1FEAA 3GRTA 2YG5A 3CGEA 4A65A 2PHHA 1OJDA 1S3BA 4H4XA 4YSYA 3CGDA 1GALA 1TYPA 4DNAA 1Q9IA 2FJDA 2GV8A 4YSHA 1LQUA 4TLXA 3P4PA 2AAQA 3RP7A 2Q7VA 4A6NB 4AT2A 5JCMA 1X31B 3JSKA 2QA2A 2ZBWA 1D7LA 3LZXA 4IA5A 2YR6A 1VDCA 3DA1A 4A5LA 2XFQA 2Q0KA 3C96A 4TM1A 1D7YA 2R46A 2C73A 3DGZA 2BS3A 1VG9A 1COYA 1D5TA 1K0LA 3EANA 4NTDA 3UTGA 3VR8A 4C5OA 2YM1A 4AT0A 4AOXA 4USQA 2BK3A 3AEBA 4K2XA 2CULA 2X8GA 3CGBA 2YLZA 3DH9A 3H4KA 4CNJA 5HXIA 1O5WA 3GDPA 5EBKA 3SQPA 1DOEA 1CJ3A 5EB4A 1PBDA 1BF3A 2TMDA 1CC6A 3BNUA 4TM3A 5JCIA 1CF3A 1JNZA 4J34A 2EQ9A 2R4EA 2WESA 4GF7A 2GH5A 1CBOA 3AYLA 4X9MA 4H7UA 3CPIG 4J31A 4NEWA 3K7MX 4MJWA 3ISHA 4RG3A 2B9XA 3OC4A 1EL7A 4U2LA 4Z43A 3KD9A 5FS7A 1JRXA 4UP3A 1PJ7A 2VOUA 3UKKA 3UKLA 3NKSA 4EMJA 1Y56A 1Y0PA 4DGKA 4A79A 2BC1A 4OCGA 4U8KA 1MO9A 3G5RA 1NDAA 3GSIA 2GF3A 3RP6A 4YTNA 5JCLA 2GRTA 2YWLA 3AYIA 4OPTA 2WP6A 4UDQA 1YQ3A 4H2PA 3UKHA 1ZK7A 4H4SA 1XPQA 3LZWA 4EQXA 4H4UA 4TM0A 2EQ7A 3CTYA 4K8DA 1PXBA 4GCMA 1IUXA 3NGCX 1VRQB 3NK1X 1M64A 3QJ4A 1S2QA 2YLXA 1BWCA 1NEKA 3CNJA 3AWIA 3SGLA 1OJTA 2X8HA 5KOXA 2OAMA 2FJAA 2DKHA 2VVLG 4DSGA 2QA1A 3UOYA 4JDRA 2C7GA 4K7ZA 3URHA 2GR3A 2WBAA 4WX1A 1KFYA 2GQWA 2AR8A 1Q1RA 3I6DA 2GR2A 1E39A 3LB8A 2DKIA 4ECHA 4EQRA 3K7QX 3KKJA 3NYEA 2WQYA 2X50A 3WE0A 2V61A 4KPRA 1GXFA 4H4PA 3AE9A 2YG6A 1K4QA 1GV4A 4C3YA 3QFAA 1XANA 4K22A 1D4DA 1TDOA 4O5QA 2BS2A 3AEFA 3H8LA 1XDIA 2BK4A 3GWDA 3CPJG 3VR9A 5M10A 4CBQA 3NTAA 3B6DA 2XFOA 2VVLA 1JNRA 2YVJA 1GT8A 5BULA 1PBCA 2WU2A 1IUUA 2OALA 4Z44A 3GYIA 3NN0X 3ICTA 1B8SA 2AQJA 2XLRA 4H4WA 4Z26A 1AOGA 2YAUA 2Z5XA 3DJJA 1CJCA 4A9WA 3AE8A 2RABA 4CY8A 2H89A 3GMBA 4H50A 1P2EA 1ZX9A 2FBWA 3NH3X 5ER0A 2WP5A 2XLTA 1IUVA 2NPXA 2JBVA 2C76A 5M0ZA 4NZHA 1BKWA 2WEUA 2FJBA 3UKAA 2E4GA 5FS6A 2WU5A 3KLJA 4GDEA 3NYCA 4N9XA 3ALJA 2WP9A 1K0IA 3DK4A 1ONFA 4U8IA 3UTEA 2XVEA 4CY6A 2WETA 4IA6A 4FX9A 2YM2A 5GSNA 1NPXA 2GMHA 2W0HA 1DNCA 3E1TA 1FCDA 1H7XA 2IIDA 3AE7A 3NHOX 1EL5A 2JKCA 1JRYA 4TLZA 2XCGA 2C66A 3OZ2A 4U8PA 4UDPA 3GMCA 3UOVA 4YTPA 1DXLA 3COXA 3VQRA 2Q6UA 4YKGA 1B37A 2APGA 3RP8A 5EB5A 4EMIA 3H8IA 2R45A 2QAEA 3NYFA 3BNMA 4ZN0A 1M6IA 4NTEA 1PXCA 1DJNA 2B7SA 1GETA 4HB9A 1PN0A 3ALMA 3F8PA 2GEWA 3CN8A 2E1MA 4XXGA 3IC9A 5BRTA 2GR1A 1TDKA 2YR4A 4U8NA 2YQUA 4Y4MA 4YT0A 5GRTA 1GOSA 2BCGG 1PHHA 2B9WA 2BXSA 2F5ZA 2XYOA 3CNTA 3QSSA 4I59A 1H82A 4OPIA 3UTFA 1VG0A 1GPEA 1ZDLA 4P9SA 2V5ZA 1F8SA 2Z5YA 3UOZA 1REOA 3DMEA 5C2TA 1PJ5A 3AD7B 3NG7X 3FIMB 1E1KA 1KF6A 1H83A 3KVEA 1TYTA 2WPCA 2XLSA 2Y6QA 1DOBA 3DJEA 3LADA 3VRDB 4EMWA 1NENA 4AP3A 4Z25A 4UDRA 3NNEA 3QFBA 1B4VA 3Q9TA 2A87A 4EQWA 2VQBA 3AYJA 1RSGA 4B68A 1MOKA 2O9ZA 1KDGA 4YSZA 1NHPA 1FL2A 3O0HA 3PS9A 2CVJA 4K5RA 1PXAA 3UOXA 1ZOYA 1GERA 4BV6A 4GR1A 4X4JA 1CJ4A 5TR3A 4B66A 3V3NA 3ICSA 1NHQA 4B63A 2C72A 2C3CA 3ITJA 4EIQA 5FS8A 4X9NA 3R9UA 2BA9A 1D4EA 3DGHA 4B64A 1S3EA 4H4ZA 5KOWA 4RG4A 3S5WA 3BI4A 3V76A 4BK3A 2NVKX 3ADAB 2RGJA 1IUSA 3AEDA 1QLBA 1DJQA 3RNMA 3UCLA 3KPFA 2WOWA 2R0PA 4B1BA 4IVMB 4NTCA 1LV0A 4BJYA 1OJAA 1ELIA 3NLCA 2GMJA 3NRNA 5KVHA 5BVAA 3L8KA 3FG2P 3II4A 4GDPA 4C3XA 4JNAA 3AB1A 4J57A 4OPLA 1HYUA 1PJ6A 2ARDA 2ZZ0A 4RSLA 1JOAA 4A6NA 4EIPA 1E7PA 4OPUA 4YWOA 3NTDA 1GREA 1GTEA 2IVEA 2C65A 3K30A 2BABA 3CPHG 3IF9A 1H81A 2BC0A 3EF6A 1OJ9A 2C75A 2OLOA 1GRFA 4H4QA 4Y4NA 3ZDNA 5JCKA 4H2NA 3AEGA 3AE6A 4D03A 4IVOB 4Z2TA 5HY5A 1PBBA 1O94A 1DOCA 1GESA 2ACZA 3AE5A 1BZLA 1E1MA 1YY5A 1PS9A 3P9UA 1GEUA 1GNDA 3AE4A 3AEEA 3AE3A 3BHKA 3NK2X 1RYIA 3BI2A 3ZYXA 1LVLA 1N4VA 1KNPA 1L9EA 2GVCA 2QCUA 2WPEA 2IVDA 3UP4A 4AP1A 2YVFA 1BGNA 2R9ZA 2YR5A 1XHCA 4Z24A 1IJHA 1SEZA 5U25A 4YSXA 4K5SA 1YQ4A 3L1RA 4APNA 1H86A 1F8WA 3KU9A 4J2WA 3G5SA 4KX6A 4OPCA 2BCPA 3IWAA 4YXDA 2BXRA 3KA7A 5KXJA 4JN9A 2FJEA 5CKUA 1VQWA 1ZP0A 4J33A 3NN6X 1H84A 1YKJA 3AECA 3BHFA 1CC2A 4CNKA 4B65A 4J56A 5IPYA 1QO8A 2BS4A 3D1CA 5KVIA 4U8MA 4FK1A 4D04A 3Q6JA 2WDRA 3DJDA 3QVPA 1FOHA 2VRMA 1F3PA 3FPZA 1LTXR 2YVGA 5LV9A 1D4CA 2C64A 2EQ8A 4H4VA 1EBDA 4U8OA 2R0GA 2GAHB 4E0VA 2YLSA 1GSNA 2BACA 3P1WA 3CNSA 4ZCCA 3GD4A 3UKPA 5HYMA 1EL8A 2GQFA 3AXBA 3EAOA 5EOWA 3F8DA 2YLRA 4ICYA 2RGHA 1N1PA 2XVHA 2ZZBA 1GRTA 3UP5A 4FDCB 1P2HA 2JK6A 1RP0A 3DK8A 4EQSA 2VRLA 1PDHA 3DK9A 1BGJA 2V60A 3GD3A 4GUVA 2E5VA 3SM8A 1YQZA 1KSSA 2EQ6A 2V3AA 2ZZCA 3M0OA 1KNRA 1Q1WA 1TDEA 3QVRA 4XWZA 4H2RA 4I58A 1CJ2A 3IHMA 4ADWA 2CFYA 2XLPA 3IHGA 1H7WA 2Y6RA 2BK5A 5IQ1A 3ABVA 3QSMA 4J36A 3UKFA 1H6VA 3CNPA 4C77A 3VRBA 2JB2A 2WHDA 3GWFA 4DSHA 2XFPA 1QJDA 4XWRA 3RHAA 4CCQA 2V6OA 3I3LA 5IQ4A 2HQMA 2YG3A 2GAGB 1V59A 2B7RA 3EPTA 5KWFA 2X8CA 1CHUA 5KRQA 4CCRA 1JEHA 5J7XA 2JB3A 3UTHA 5BUKA 1S2YA 4LIIA 2TPRA 3SFDA 4PAAA 5JCNA 2VVMA 3G5QA 4FK1C 4JY3A 1JRZA 4NEVA 4USRA 2B76A 3FMWA 3SFEA 3REDA 1GRHA 1LJ1A 3GDNA 2XFNA 2C3DA 3P4QA 2X99A 3VRAA 3AD8B 4ZCDA 5J60A 3P4SA 2XFUA 4JNQA 5CQFA 1N4WA 2OLNA 2I0ZA 2WOIA 1TDNA 3M12A 3CNDA 4YTMA 3NK0X 3GYJA 3QSEA 1F8RA 4CRTA 2PYXA 4JQ9A 2C70A 4U8LA 3LXDA 2YG4A 3DJGX 4Z2UA 2XDOA 4OVIA 3C4NA 1NG3A 1PBFA 2J3NA 1ZY8A 2GB0A 5L46A 2C67A 1ZMCA 2B9YA 1K0JA 5FS9A 4B69A 4B67A 3FBSA 5U63A 1CL0A 4OPDA 4TM4A 3NIXA 5FMHA 3CIRA 3V3OA 4BK1A 1GTHA 3S61A 5C3JA 1ZMDA 1ZOVA 4M52A 2WS3A 4H2QA 4LU6A 4H4YA 1JU2A 2VQ7A 1N4UA 1GRAA 1L9DA 1TDFA 2OA1A 4H4RA 1EL9A 4YKFA 4EM3A 2JB1A 4AOSA 2JAEA 1UKVG 2WDQA 1L0VA 1IUWA 2H88A 4A7AA 1TRBA 3GRSA 1B5QA 3B3RA 2RGOA 4H4TA 1LQTA 2X3NA 3LOVA
chains in the Genus database with same CATH superfamily
4REKA 1GRGA 2UZZA 4II2A 2XVFA 2WOVA 2XVJA 3PVCA 1NG4A 4Z2RA 4HA6A 1IUTA 2BYBA 1DODA 1Z6LA 2WDVA 2GR0A 3AE1A 2CDUA 3M13A 2R0CA 4BK2A 1MXTA 4WCTA 2XLUA 1E1NA 1NHRA 1KSUA 1FEBA 3ATRA 3UKQA 1NHSA 5HHFA 1F6MA 2Q0LA 4OPGA 2R4JA 3AEAA 4IV9A 3AD9B 2XVIA 2A8XA 3ALLA 3K7TA 3D8XA 1OJCA 1GRBA 4O5UA 1Y56B 1O95A 1ZKQA 4U8JA 4Y4LA 2YLTA 4LA1A 4U2SA 3C4AA 3HYVA 3BI5A 5DBJA 3ATQA 4U2TA 1LPFA 1E1LA 3LJPA 4BJZA 3CGCA 2A89A 1PBEA 4BURA 3F8RA 5U1OA 3ICRA 1CC4A 1E6EA 2V3BA 4C74A 2WPFA 1NAAA 3T37A 1L9CA 2VZ2A 3HZLA 1FECA 4JY2A 2YLWA 3SZ0A 2YG7A 4GRTA 4A99A 3NT6A 3P4RA 3AE2A 1W4XA 4PABA 4EM4A 3PO7A 1FEAA 3GRTA 3T2KA 3T0KA 2YG5A 3CGEA 4A65A 4GAPA 2PHHA 1OJDA 1S3BA 4H4XA 3T2ZA 4YSYA 3CGDA 1GALA 1TYPA 4DNAA 1Q9IA 2FJDA 2GV8A 4YSHA 1LQUA 4TLXA 3P4PA 2AAQA 3RP7A 2Q7VA 4A6NB 4AT2A 5JCMA 1X31B 3JSKA 2QA2A 2ZBWA 1D7LA 3LZXA 4IA5A 2YR6A 1VDCA 3DA1A 4A5LA 2XFQA 2Q0KA 3C96A 4TM1A 1D7YA 2R46A 2C73A 3DGZA 2BS3A 1VG9A 1COYA 1D5TA 1K0LA 3EANA 4NTDA 3UTGA 3VR8A 4C5OA 2YM1A 4AT0A 4AOXA 4USQA 2BK3A 3AEBA 4K2XA 2CULA 2X8GA 3CGBA 2YLZA 3DH9A 3H4KA 4CNJA 5HXIA 1O5WA 3GDPA 5EBKA 3SQPA 1DOEA 1CJ3A 5EB4A 1PBDA 3SX6A 1BF3A 2TMDA 1CC6A 3BNUA 4TM3A 5JCIA 1CF3A 1JNZA 4J34A 2EQ9A 2R4EA 2WESA 4GF7A 2GH5A 1CBOA 3AYLA 4X9MA 4H7UA 3CPIG 4J31A 4NEWA 3K7MX 4MJWA 3ISHA 4RG3A 2B9XA 3OC4A 1EL7A 4U2LA 4Z43A 3KD9A 5FS7A 1JRXA 4UP3A 1PJ7A 2BRYA 2VOUA 4GAVA 3UKKA 3UKLA 3NKSA 4EMJA 1Y56A 1Y0PA 4DGKA 4A79A 2BC1A 4OCGA 4U8KA 1MO9A 3G5RA 1NDAA 3GSIA 2GF3A 3RP6A 4YTNA 5JCLA 2GRTA 2YWLA 3AYIA 4OPTA 2WP6A 4UDQA 1YQ3A 4H2PA 3UKHA 1ZK7A 4H4SA 1XPQA 3LZWA 4EQXA 4G9KA 4H4UA 4TM0A 2EQ7A 3CTYA 4K8DA 1PXBA 4GCMA 1IUXA 3NGCX 1VRQB 3NK1X 1M64A 3QJ4A 1S2QA 2YLXA 1BWCA 1NEKA 3CNJA 3AWIA 3SGLA 1OJTA 2X8HA 5KOXA 2OAMA 2FJAA 2DKHA 2VVLG 4DSGA 2QA1A 3UOYA 4JDRA 3SZCA 2C7GA 4K7ZA 3URHA 2GR3A 2WBAA 4WX1A 1KFYA 2GQWA 2AR8A 1Q1RA 3I6DA 2GR2A 1E39A 3LB8A 2DKIA 4ECHA 4EQRA 3K7QX 3KKJA 3NYEA 2WQYA 2X50A 3WE0A 2V61A 4G6GA 4KPRA 1GXFA 4H4PA 3AE9A 2YG6A 1K4QA 1GV4A 4C3YA 3QFAA 1XANA 4K22A 1D4DA 1TDOA 4O5QA 2BS2A 3AEFA 3H8LA 3SZFA 1XDIA 2BK4A 3GWDA 3CPJG 3VR9A 5M10A 4CBQA 3NTAA 3B6DA 2XFOA 2VVLA 1JNRA 2YVJA 1GT8A 5BULA 1PBCA 2WU2A 1IUUA 2OALA 4Z44A 3GYIA 3NN0X 3ICTA 1B8SA 2AQJA 2XLRA 4H4WA 4Z26A 1AOGA 2YAUA 2Z5XA 3DJJA 1CJCA 4A9WA 3AE8A 2RABA 4CY8A 2H89A 3GMBA 4H50A 1P2EA 1ZX9A 2FBWA 3NH3X 5ER0A 2WP5A 2XLTA 1IUVA 2NPXA 3SYIA 5KMQA 2JBVA 2C76A 5M0ZA 4NZHA 1BKWA 2WEUA 2FJBA 3UKAA 2E4GA 5FS6A 2WU5A 3KLJA 4GDEA 3NYCA 4N9XA 3ALJA 2WP9A 1K0IA 3DK4A 1ONFA 4U8IA 3UTEA 2XVEA 4CY6A 2WETA 3HYWA 4IA6A 4FX9A 2YM2A 5GSNA 1NPXA 2GMHA 2W0HA 1DNCA 3E1TA 1FCDA 1H7XA 2IIDA 3AE7A 3NHOX 1EL5A 2JKCA 1JRYA 4TLZA 2XCGA 2C66A 3OZ2A 4U8PA 4UDPA 3GMCA 3UOVA 4YTPA 1DXLA 3COXA 3VQRA 5KMRA 2Q6UA 4YKGA 1B37A 2APGA 3RP8A 5EB5A 4EMIA 3H8IA 2R45A 2QAEA 3NYFA 3BNMA 4ZN0A 1M6IA 4NTEA 1PXCA 1DJNA 2B7SA 1GETA 4HB9A 1PN0A 3ALMA 3F8PA 2GEWA 3CN8A 2E1MA 4XXGA 3IC9A 5BRTA 2GR1A 1TDKA 2YR4A 4U8NA 2YQUA 4Y4MA 4YT0A 5GRTA 1GOSA 2BCGG 1PHHA 2B9WA 2BXSA 2F5ZA 2XYOA 3CNTA 3QSSA 4I59A 1H82A 4OPIA 3UTFA 1VG0A 1GPEA 1ZDLA 4P9SA 2V5ZA 1F8SA 2Z5YA 3UOZA 1REOA 3DMEA 5C2TA 1PJ5A 3AD7B 3NG7X 3FIMB 1E1KA 1KF6A 1H83A 3KVEA 1TYTA 2WPCA 2XLSA 2Y6QA 1DOBA 3DJEA 3LADA 3VRDB 4EMWA 1NENA 4AP3A 4Z25A 4UDRA 3NNEA 3QFBA 1B4VA 3Q9TA 2A87A 4EQWA 2VQBA 3AYJA 1RSGA 4B68A 1MOKA 2O9ZA 1KDGA 4YSZA 1NHPA 1FL2A 3O0HA 3PS9A 2CVJA 4K5RA 1PXAA 3UOXA 1ZOYA 1GERA 4BV6A 4GR1A 4X4JA 1CJ4A 5TR3A 4B66A 3V3NA 3ICSA 1NHQA 4B63A 2C72A 2C3CA 3ITJA 4EIQA 5FS8A 4X9NA 3R9UA 5KMPA 2BA9A 1D4EA 3DGHA 4B64A 1S3EA 4H4ZA 5KOWA 4RG4A 3S5WA 3BI4A 3V76A 4BK3A 2NVKX 3ADAB 2RGJA 1IUSA 3AEDA 1QLBA 1DJQA 3RNMA 3UCLA 3KPFA 2WOWA 2R0PA 4B1BA 4IVMB 4NTCA 1LV0A 4BJYA 1OJAA 1ELIA 3NLCA 2GMJA 3NRNA 5KVHA 5BVAA 3L8KA 3FG2P 3II4A 4GDPA 4C3XA 4JNAA 3AB1A 4J57A 4OPLA 1HYUA 1PJ6A 2ARDA 2ZZ0A 4RSLA 1JOAA 4A6NA 4EIPA 1E7PA 4OPUA 4YWOA 3NTDA 1GREA 1GTEA 2IVEA 2C65A 3K30A 2BABA 4G74A 3CPHG 3IF9A 1H81A 2BC0A 3EF6A 1OJ9A 2C75A 3SY4A 2OLOA 1GRFA 4H4QA 4Y4NA 3ZDNA 5JCKA 4H2NA 3AEGA 3AE6A 4D03A 4IVOB 4Z2TA 5HY5A 1PBBA 1O94A 1DOCA 1GESA 2ACZA 3AE5A 1BZLA 1E1MA 3CMMA 1YY5A 1PS9A 3P9UA 1GEUA 1GNDA 3AE4A 3AEEA 3AE3A 3BHKA 3NK2X 1RYIA 3BI2A 3ZYXA 1LVLA 1N4VA 1KNPA 1L9EA 2GVCA 2QCUA 2WPEA 2IVDA 3UP4A 4AP1A 2YVFA 1BGNA 2R9ZA 2YR5A 1XHCA 4Z24A 1IJHA 1SEZA 5U25A 3KPKA 4K5SA 4YSXA 1YQ4A 3L1RA 3SZWA 4APNA 1H86A 1F8WA 3KU9A 4J2WA 3G5SA 4KX6A 4OPCA 2BCPA 3IWAA 4YXDA 2BXRA 3KA7A 5KXJA 4JN9A 2FJEA 5CKUA 1VQWA 1ZP0A 4J33A 3NN6X 1H84A 1YKJA 3AECA 3BHFA 1CC2A 4CNKA 4G73A 4J56A 4B65A 5IPYA 1QO8A 2BS4A 3D1CA 5KVIA 4U8MA 4FK1A 4D04A 3Q6JA 2WDRA 3DJDA 3QVPA 1FOHA 2VRMA 1F3PA 3FPZA 1LTXR 2YVGA 5LV9A 1D4CA 2C64A 2EQ8A 4H4VA 1EBDA 4NWZA 4U8OA 2R0GA 2GAHB 4E0VA 2YLSA 1GSNA 2BACA 3P1WA 3CNSA 4ZCCA 3GD4A 3UKPA 5HYMA 1EL8A 2GQFA 3AXBA 3EAOA 5EOWA 3F8DA 2YLRA 4ICYA 2RGHA 1N1PA 2XVHA 2ZZBA 1GRTA 3UP5A 4FDCB 1P2HA 2JK6A 1RP0A 3DK8A 3T14A 2VRLA 4EQSA 1PDHA 3DK9A 1BGJA 2V60A 3GD3A 4GUVA 2E5VA 3SM8A 1YQZA 1KSSA 2EQ6A 2V3AA 2ZZCA 3M0OA 1KNRA 1Q1WA 1TDEA 3QVRA 4XWZA 4H2RA 4I58A 1CJ2A 3IHMA 4ADWA 2CFYA 2XLPA 3IHGA 1H7WA 2Y6RA 3T2YA 2BK5A 5IQ1A 3ABVA 3QSMA 4J36A 3SXIA 3UKFA 1H6VA 3CNPA 4C77A 3VRBA 2JB2A 2WHDA 3GWFA 4DSHA 2XFPA 1QJDA 4XWRA 3RHAA 4CCQA 2V6OA 3I3LA 5IQ4A 2HQMA 2YG3A 2GAGB 1V59A 2B7RA 3EPTA 5KWFA 2X8CA 1CHUA 5KRQA 4CCRA 1JEHA 5J7XA 2JB3A 3UTHA 5BUKA 1S2YA 4LIIA 2TPRA 3SFDA 4PAAA 5JCNA 2VVMA 3G5QA 3T31A 5KNLA 4NNJA 4FK1C 4JY3A 1JRZA 4NEVA 4USRA 2B76A 3FMWA 3SFEA 3REDA 1GRHA 1LJ1A 3GDNA 2XFNA 2C3DA 3P4QA 2X99A 3VRAA 3AD8B 4ZCDA 5J60A 3P4SA 2XFUA 4JNQA 5CQFA 1N4WA 2OLNA 2I0ZA 2WOIA 1TDNA 3M12A 3CNDA 4YTMA 2C4CA 3NK0X 5KMSA 3GYJA 3QSEA 1F8RA 4CRTA 2PYXA 4JQ9A 2C70A 4U8LA 3LXDA 2YG4A 3DJGX 4Z2UA 2XDOA 4OVIA 3C4NA 1NG3A 1PBFA 2J3NA 4II3A 1ZY8A 2GB0A 5L46A 2C67A 1ZMCA 2B9YA 1K0JA 5FS9A 4B69A 4B67A 3FBSA 5U63A 1CL0A 4OPDA 4TM4A 3NIXA 5FMHA 3CIRA 3V3OA 4BK1A 1GTHA 4G6HA 3S61A 5C3JA 1ZMDA 1ZOVA 4M52A 2WS3A 4H2QA 4LU6A 4H4YA 1JU2A 2VQ7A 1N4UA 1GRAA 1L9DA 1TDFA 2OA1A 4H4RA 1EL9A 4YKFA 4EM3A 2JB1A 4AOSA 2JAEA 1UKVG 2WDQA 1L0VA 1IUWA 2H88A 4A7AA 1TRBA 3GRSA 1B5QA 3GYXA 3B3RA 2RGOA 4H4TA 3HYXA 1LQTA 2X3NA 3LOVA 2BRAA
chains in the Genus database with same CATH topology
4REKA 1GRGA 2UZZA 4II2A 2XVFA 2WOVA 2XVJA 3PVCA 1NG4A 4Z2RA 4HA6A 1IUTA 2BYBA 1DODA 1Z6LA 2WDVA 2GR0A 3AE1A 2CDUA 3M13A 2R0CA 4BK2A 1MXTA 4WCTA 2XLUA 1E1NA 1NHRA 1KSUA 1FEBA 3ATRA 3UKQA 1NHSA 5HHFA 1F6MA 2Q0LA 4OPGA 2R4JA 3AEAA 3AD9B 4IV9A 2XVIA 2A8XA 3ALLA 3K7TA 3D8XA 1OJCA 1GRBA 4O5UA 1Y56B 1O95A 1ZKQA 4U8JA 4Y4LA 2YLTA 4LA1A 4U2SA 3C4AA 3HYVA 3BI5A 5DBJA 3ATQA 4U2TA 1LPFA 1E1LA 3LJPA 4BJZA 3CGCA 2A89A 1PBEA 4BURA 3F8RA 5U1OA 3ICRA 1CC4A 1E6EA 2V3BA 4C74A 2WPFA 1NAAA 3T37A 1L9CA 2VZ2A 3HZLA 1FECA 4JY2A 2YLWA 3SZ0A 2YG7A 4GRTA 4A99A 3NT6A 3P4RA 3AE2A 1W4XA 4PABA 4EM4A 3PO7A 1FEAA 3GRTA 3T2KA 3T0KA 2YG5A 3CGEA 4A65A 4GAPA 2PHHA 1OJDA 1S3BA 4H4XA 3T2ZA 4YSYA 3CGDA 1GALA 1TYPA 4DNAA 1Q9IA 2FJDA 2GV8A 4YSHA 1LQUA 4TLXA 3P4PA 2AAQA 3RP7A 2Q7VA 4A6NB 4AT2A 5JCMA 1X31B 3JSKA 2QA2A 2ZBWA 1D7LA 3LZXA 4IA5A 2YR6A 1VDCA 3DA1A 4A5LA 2XFQA 2Q0KA 3C96A 4TM1A 1D7YA 2R46A 2C73A 3DGZA 2BS3A 1VG9A 1COYA 1D5TA 1K0LA 3EANA 4NTDA 3UTGA 3VR8A 4C5OA 2YM1A 4AT0A 4AOXA 4USQA 2BK3A 3AEBA 4K2XA 2CULA 2X8GA 3CGBA 2YLZA 3DH9A 3H4KA 4CNJA 5HXIA 1O5WA 3GDPA 5EBKA 3SQPA 1DOEA 1CJ3A 5EB4A 1PBDA 3SX6A 1BF3A 2TMDA 1CC6A 3BNUA 4TM3A 5JCIA 1CF3A 1JNZA 4J34A 2EQ9A 2R4EA 2WESA 4GF7A 2GH5A 1CBOA 3AYLA 4X9MA 4H7UA 3CPIG 4J31A 4NEWA 3K7MX 4MJWA 3ISHA 4RG3A 2B9XA 3OC4A 1EL7A 4U2LA 4Z43A 3KD9A 5FS7A 1JRXA 4UP3A 1PJ7A 2BRYA 2VOUA 4GAVA 3UKKA 3UKLA 3NKSA 4EMJA 1Y56A 1Y0PA 4DGKA 4A79A 2BC1A 4OCGA 4U8KA 1MO9A 3G5RA 1NDAA 3GSIA 2GF3A 3RP6A 4YTNA 5JCLA 2GRTA 2YWLA 3AYIA 4OPTA 2WP6A 4UDQA 1YQ3A 4H2PA 3UKHA 1ZK7A 4H4SA 1XPQA 3LZWA 4EQXA 4G9KA 4H4UA 4TM0A 2EQ7A 3CTYA 4K8DA 1PXBA 4GCMA 1IUXA 3NGCX 1VRQB 3NK1X 1M64A 3QJ4A 1S2QA 2YLXA 1BWCA 1NEKA 3CNJA 3AWIA 3SGLA 1OJTA 2X8HA 5KOXA 2OAMA 2FJAA 2DKHA 2VVLG 4DSGA 2QA1A 3UOYA 4JDRA 3SZCA 2C7GA 4K7ZA 3URHA 2GR3A 2WBAA 4WX1A 1KFYA 2GQWA 2AR8A 1Q1RA 3I6DA 2GR2A 1E39A 3LB8A 2DKIA 4ECHA 4EQRA 3K7QX 3KKJA 3NYEA 2WQYA 2X50A 3WE0A 2V61A 4G6GA 4KPRA 1GXFA 4H4PA 3AE9A 2YG6A 1K4QA 1GV4A 4C3YA 3QFAA 1XANA 4K22A 1D4DA 1TDOA 4O5QA 2BS2A 3AEFA 3H8LA 3SZFA 1XDIA 2BK4A 3GWDA 3CPJG 3VR9A 5M10A 4CBQA 3NTAA 3B6DA 2XFOA 2VVLA 1JNRA 2YVJA 1GT8A 5BULA 1PBCA 2WU2A 1IUUA 2OALA 4Z44A 3GYIA 3NN0X 3ICTA 1B8SA 2AQJA 2XLRA 4H4WA 4Z26A 1AOGA 2YAUA 2Z5XA 3DJJA 1CJCA 4A9WA 3AE8A 2RABA 4CY8A 2H89A 3GMBA 4H50A 1P2EA 1ZX9A 2FBWA 3NH3X 5ER0A 2WP5A 2XLTA 1IUVA 2NPXA 3SYIA 5KMQA 2JBVA 2C76A 5M0ZA 4NZHA 1BKWA 2WEUA 2FJBA 3UKAA 2E4GA 5FS6A 2WU5A 3KLJA 4GDEA 3NYCA 4N9XA 3ALJA 2WP9A 1K0IA 3DK4A 1ONFA 4U8IA 3UTEA 2XVEA 4CY6A 2WETA 3HYWA 4IA6A 4FX9A 2YM2A 5GSNA 1NPXA 2GMHA 2W0HA 1DNCA 3E1TA 1FCDA 1H7XA 2IIDA 3AE7A 3NHOX 1EL5A 2JKCA 1JRYA 4TLZA 2XCGA 2C66A 3OZ2A 4U8PA 4UDPA 3GMCA 3UOVA 4YTPA 1DXLA 3COXA 3VQRA 5KMRA 2Q6UA 4YKGA 1B37A 2APGA 3RP8A 5EB5A 4EMIA 3H8IA 2R45A 2QAEA 3NYFA 3BNMA 4ZN0A 1M6IA 4NTEA 1PXCA 1DJNA 2B7SA 1GETA 4HB9A 1PN0A 3ALMA 3F8PA 2GEWA 3CN8A 2E1MA 4XXGA 3IC9A 5BRTA 2GR1A 1TDKA 2YR4A 4U8NA 2YQUA 4Y4MA 4YT0A 5GRTA 1GOSA 2BCGG 1PHHA 2B9WA 2BXSA 2F5ZA 2XYOA 3CNTA 3QSSA 4I59A 1H82A 4OPIA 3UTFA 1VG0A 1GPEA 1ZDLA 4P9SA 2V5ZA 1F8SA 2Z5YA 3UOZA 1REOA 3DMEA 5C2TA 1PJ5A 3AD7B 3NG7X 3FIMB 1E1KA 1KF6A 1H83A 3KVEA 1TYTA 2WPCA 2XLSA 2Y6QA 1DOBA 3DJEA 3LADA 3VRDB 4EMWA 1NENA 4AP3A 4Z25A 4UDRA 3NNEA 3QFBA 1B4VA 3Q9TA 2A87A 4EQWA 2VQBA 3AYJA 1RSGA 4B68A 1MOKA 2O9ZA 1KDGA 4YSZA 1NHPA 1FL2A 3O0HA 3PS9A 2CVJA 4K5RA 1PXAA 3UOXA 1ZOYA 1GERA 4BV6A 4GR1A 4X4JA 1CJ4A 5TR3A 4B66A 3V3NA 3ICSA 1NHQA 4B63A 2C72A 2C3CA 3ITJA 4EIQA 5FS8A 4X9NA 3R9UA 5KMPA 2BA9A 1D4EA 3DGHA 4B64A 1S3EA 4H4ZA 5KOWA 4RG4A 3S5WA 3BI4A 3V76A 4BK3A 2NVKX 3ADAB 2RGJA 1IUSA 3AEDA 1QLBA 1DJQA 3RNMA 3UCLA 3KPFA 2WOWA 2R0PA 4B1BA 4IVMB 4NTCA 1LV0A 4BJYA 1OJAA 1ELIA 3NLCA 2GMJA 3NRNA 5KVHA 5BVAA 3L8KA 3FG2P 3II4A 4GDPA 4C3XA 4JNAA 3AB1A 4J57A 4OPLA 1HYUA 1PJ6A 2ARDA 2ZZ0A 4RSLA 1JOAA 4A6NA 4EIPA 1E7PA 4OPUA 4YWOA 3NTDA 1GREA 1GTEA 2IVEA 2C65A 3K30A 2BABA 4G74A 3CPHG 3IF9A 1H81A 2BC0A 3EF6A 1OJ9A 2C75A 3SY4A 2OLOA 1GRFA 4H4QA 4Y4NA 3ZDNA 5JCKA 4H2NA 3AEGA 3AE6A 4D03A 4IVOB 4Z2TA 5HY5A 1PBBA 1O94A 1DOCA 1GESA 2ACZA 3AE5A 1BZLA 1E1MA 3CMMA 1YY5A 1PS9A 3P9UA 1GEUA 1GNDA 3AE4A 3AEEA 3AE3A 3BHKA 3NK2X 1RYIA 3BI2A 3ZYXA 1LVLA 1N4VA 1KNPA 1L9EA 2GVCA 2QCUA 2WPEA 2IVDA 3UP4A 4AP1A 2YVFA 1BGNA 2R9ZA 2YR5A 1XHCA 4Z24A 1IJHA 1SEZA 5U25A 3KPKA 4K5SA 4YSXA 1YQ4A 3L1RA 3SZWA 4APNA 1H86A 1F8WA 3KU9A 4J2WA 3G5SA 4KX6A 4OPCA 2BCPA 3IWAA 4YXDA 2BXRA 3KA7A 5KXJA 4JN9A 2FJEA 5CKUA 1VQWA 1ZP0A 4J33A 3NN6X 1H84A 1YKJA 3AECA 3BHFA 1CC2A 4CNKA 4G73A 4J56A 4B65A 5IPYA 1QO8A 2BS4A 3D1CA 5KVIA 4U8MA 4FK1A 4D04A 3Q6JA 2WDRA 3DJDA 3QVPA 1FOHA 2VRMA 1F3PA 3FPZA 1LTXR 2YVGA 5LV9A 1D4CA 2C64A 2EQ8A 4H4VA 1EBDA 4NWZA 4U8OA 2R0GA 2GAHB 4E0VA 2YLSA 1GSNA 2BACA 3P1WA 3CNSA 4ZCCA 3GD4A 3UKPA 5HYMA 1EL8A 2GQFA 3AXBA 3EAOA 5EOWA 3F8DA 2YLRA 4ICYA 2RGHA 1N1PA 2XVHA 2ZZBA 1GRTA 3UP5A 4FDCB 1P2HA 2JK6A 1RP0A 3DK8A 3T14A 2VRLA 4EQSA 1PDHA 3DK9A 1BGJA 2V60A 3GD3A 4GUVA 2E5VA 3SM8A 1YQZA 1KSSA 2EQ6A 2V3AA 2ZZCA 3M0OA 1KNRA 1Q1WA 1TDEA 3QVRA 4XWZA 4H2RA 4I58A 1CJ2A 3IHMA 4ADWA 2CFYA 2XLPA 3IHGA 1H7WA 2Y6RA 3T2YA 2BK5A 5IQ1A 3ABVA 3QSMA 4J36A 3SXIA 3UKFA 1H6VA 3CNPA 4C77A 3VRBA 2JB2A 2WHDA 3GWFA 4DSHA 2XFPA 1QJDA 4XWRA 3RHAA 4CCQA 2V6OA 3I3LA 5IQ4A 2HQMA 2YG3A 2GAGB 1V59A 2B7RA 3EPTA 5KWFA 2X8CA 1CHUA 5KRQA 4CCRA 1JEHA 5J7XA 2JB3A 3UTHA 5BUKA 1S2YA 4LIIA 2TPRA 3SFDA 4PAAA 5JCNA 2VVMA 3G5QA 3T31A 5KNLA 4NNJA 4FK1C 4JY3A 1JRZA 4NEVA 4USRA 2B76A 3FMWA 3SFEA 3REDA 1GRHA 1LJ1A 3GDNA 2XFNA 2C3DA 3P4QA 2X99A 3VRAA 3AD8B 4ZCDA 5J60A 3P4SA 2XFUA 4JNQA 5CQFA 1N4WA 2OLNA 2I0ZA 2WOIA 1TDNA 3M12A 3CNDA 4YTMA 2C4CA 3NK0X 5KMSA 3GYJA 3QSEA 1F8RA 4CRTA 2PYXA 4JQ9A 2C70A 4U8LA 3LXDA 2YG4A 3DJGX 4Z2UA 2XDOA 4OVIA 3C4NA 1NG3A 1PBFA 2J3NA 4II3A 1ZY8A 2GB0A 5L46A 2C67A 1ZMCA 2B9YA 1K0JA 5FS9A 4B69A 4B67A 3FBSA 5U63A 1CL0A 4OPDA 4TM4A 3NIXA 5FMHA 3CIRA 3V3OA 4BK1A 1GTHA 4G6HA 3S61A 5C3JA 1ZMDA 1ZOVA 4M52A 2WS3A 4H2QA 4LU6A 4H4YA 1JU2A 2VQ7A 1N4UA 1GRAA 1L9DA 1TDFA 2OA1A 4H4RA 1EL9A 4YKFA 4EM3A 2JB1A 4AOSA 2JAEA 1UKVG 2WDQA 1L0VA 1IUWA 2H88A 4A7AA 1TRBA 3GRSA 1B5QA 3GYXA 3B3RA 2RGOA 4H4TA 3HYXA 1LQTA 2X3NA 3LOVA 2BRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4REK A;  1GRG A;  2UZZ A;  2XVF A;  2WOV A;  2XVJ A;  3PVC A;  1NG4 A;  4Z2R A;  4HA6 A;  1IUT A;  2BYB A;  1DOD A;  1Z6L A;  2WDV A;  2GR0 A;  3AE1 A;  2CDU A;  3M13 A;  2R0C A;  4BK2 A;  1MXT A;  4WCT A;  2XLU A;  1E1N A;  1NHR A;  1KSU A;  1FEB A;  3ATR A;  3UKQ A;  1NHS A;  5HHF A;  1F6M A;  2Q0L A;  4OPG A;  2R4J A;  3AEA A;  3AD9 B;  4IV9 A;  2XVI A;  2A8X A;  3ALL A;  3K7T A;  3D8X A;  1OJC A;  1GRB A;  4O5U A;  1Y56 B;  1O95 A;  1ZKQ A;  4U8J A;  4Y4L A;  2YLT A;  4LA1 A;  4U2S A;  3C4A A;  3BI5 A;  5DBJ A;  3ATQ A;  4U2T A;  1LPF A;  1E1L A;  3LJP A;  4BJZ A;  3CGC A;  2A89 A;  1PBE A;  4BUR A;  3F8R A;  5U1O A;  3ICR A;  1CC4 A;  1E6E A;  2V3B A;  4C74 A;  2WPF A;  1NAA A;  3T37 A;  1L9C A;  2VZ2 A;  3HZL A;  1FEC A;  4JY2 A;  2YLW A;  2YG7 A;  4GRT A;  4A99 A;  3NT6 A;  3P4R A;  3AE2 A;  1W4X A;  4PAB A;  4EM4 A;  3PO7 A;  1FEA A;  3GRT A;  2YG5 A;  3CGE A;  4A65 A;  2PHH A;  1OJD A;  1S3B A;  4H4X A;  4YSY A;  3CGD A;  1GAL A;  1TYP A;  4DNA A;  1Q9I A;  2FJD A;  2GV8 A;  4YSH A;  1LQU A;  4TLX A;  3P4P A;  2AAQ A;  3RP7 A;  2Q7V A;  4A6N B;  4AT2 A;  5JCM A;  1X31 B;  3JSK A;  2QA2 A;  2ZBW A;  1D7L A;  3LZX A;  4IA5 A;  2YR6 A;  1VDC A;  3DA1 A;  4A5L A;  2XFQ A;  2Q0K A;  3C96 A;  4TM1 A;  1D7Y A;  2R46 A;  2C73 A;  3DGZ A;  2BS3 A;  1VG9 A;  1COY A;  1D5T A;  1K0L A;  3EAN A;  4NTD A;  3UTG A;  3VR8 A;  4C5O A;  2YM1 A;  4AT0 A;  4AOX A;  4USQ A;  2BK3 A;  3AEB A;  4K2X A;  2CUL A;  2X8G A;  3CGB A;  2YLZ A;  3DH9 A;  3H4K A;  4CNJ A;  5HXI A;  1O5W A;  3GDP A;  5EBK A;  3SQP A;  1DOE A;  1CJ3 A;  5EB4 A;  1PBD A;  1BF3 A;  2TMD A;  1CC6 A;  3BNU A;  4TM3 A;  5JCI A;  1CF3 A;  1JNZ A;  4J34 A;  2EQ9 A;  2R4E A;  2WES A;  4GF7 A;  2GH5 A;  1CBO A;  3AYL A;  4X9M A;  4H7U A;  3CPI G;  4J31 A;  4NEW A;  3K7M X;  4MJW A;  3ISH A;  4RG3 A;  2B9X A;  3OC4 A;  1EL7 A;  4U2L A;  4Z43 A;  3KD9 A;  5FS7 A;  1JRX A;  4UP3 A;  1PJ7 A;  2VOU A;  3UKK A;  3UKL A;  3NKS A;  4EMJ A;  1Y56 A;  1Y0P A;  4DGK A;  4A79 A;  2BC1 A;  4OCG A;  4U8K A;  1MO9 A;  3G5R A;  1NDA A;  3GSI A;  2GF3 A;  3RP6 A;  4YTN A;  5JCL A;  2GRT A;  2YWL A;  3AYI A;  4OPT A;  2WP6 A;  4UDQ A;  1YQ3 A;  4H2P A;  3UKH A;  1ZK7 A;  4H4S A;  1XPQ A;  3LZW A;  4EQX A;  4H4U A;  4TM0 A;  2EQ7 A;  3CTY A;  4K8D A;  1PXB A;  4GCM A;  1IUX A;  3NGC X;  1VRQ B;  3NK1 X;  1M64 A;  3QJ4 A;  1S2Q A;  2YLX A;  1BWC A;  1NEK A;  3CNJ A;  3AWI A;  3SGL A;  1OJT A;  2X8H A;  5KOX A;  2OAM A;  2FJA A;  2DKH A;  2VVL G;  4DSG A;  2QA1 A;  3UOY A;  4JDR A;  2C7G A;  4K7Z A;  3URH A;  2GR3 A;  2WBA A;  4WX1 A;  1KFY A;  2GQW A;  2AR8 A;  1Q1R A;  3I6D A;  2GR2 A;  1E39 A;  3LB8 A;  2DKI A;  4ECH A;  4EQR A;  3K7Q X;  3KKJ A;  3NYE A;  2WQY A;  2X50 A;  3WE0 A;  2V61 A;  4KPR A;  1GXF A;  4H4P A;  3AE9 A;  2YG6 A;  1K4Q A;  1GV4 A;  4C3Y A;  3QFA A;  1XAN A;  4K22 A;  1D4D A;  1TDO A;  4O5Q A;  2BS2 A;  3AEF A;  3H8L A;  1XDI A;  2BK4 A;  3GWD A;  3CPJ G;  3VR9 A;  5M10 A;  4CBQ A;  3NTA A;  3B6D A;  2XFO A;  2VVL A;  1JNR A;  2YVJ A;  1GT8 A;  5BUL A;  1PBC A;  2WU2 A;  1IUU A;  2OAL A;  4Z44 A;  3GYI A;  3NN0 X;  3ICT A;  1B8S A;  2AQJ A;  2XLR A;  4H4W A;  4Z26 A;  1AOG A;  2YAU A;  2Z5X A;  3DJJ A;  1CJC A;  4A9W A;  3AE8 A;  2RAB A;  4CY8 A;  2H89 A;  3GMB A;  4H50 A;  1P2E A;  1ZX9 A;  2FBW A;  3NH3 X;  5ER0 A;  2WP5 A;  2XLT A;  1IUV A;  2NPX A;  2JBV A;  2C76 A;  5M0Z A;  4NZH A;  1BKW A;  2WEU A;  2FJB A;  3UKA A;  2E4G A;  5FS6 A;  2WU5 A;  3KLJ A;  4GDE A;  3NYC A;  4N9X A;  3ALJ A;  2WP9 A;  1K0I A;  3DK4 A;  1ONF A;  4U8I A;  3UTE A;  2XVE A;  4CY6 A;  2WET A;  4IA6 A;  4FX9 A;  2YM2 A;  5GSN A;  1NPX A;  2GMH A;  2W0H A;  1DNC A;  3E1T A;  1FCD A;  1H7X A;  2IID A;  3AE7 A;  3NHO X;  1EL5 A;  2JKC A;  1JRY A;  4TLZ A;  2XCG A;  2C66 A;  3OZ2 A;  4U8P A;  4UDP A;  3GMC A;  3UOV A;  4YTP A;  1DXL A;  3COX A;  3VQR A;  2Q6U A;  4YKG A;  1B37 A;  2APG A;  3RP8 A;  5EB5 A;  4EMI A;  3H8I A;  2R45 A;  2QAE A;  3NYF A;  3BNM A;  4ZN0 A;  1M6I A;  4NTE A;  1PXC A;  1DJN A;  2B7S A;  1GET A;  4HB9 A;  1PN0 A;  3ALM A;  3F8P A;  2GEW A;  3CN8 A;  2E1M A;  4XXG A;  3IC9 A;  5BRT A;  2GR1 A;  1TDK A;  2YR4 A;  4U8N A;  2YQU A;  4Y4M A;  4YT0 A;  5GRT A;  1GOS A;  2BCG G;  1PHH A;  2B9W A;  2BXS A;  2F5Z A;  2XYO A;  3CNT A;  3QSS A;  4I59 A;  1H82 A;  4OPI A;  3UTF A;  1VG0 A;  1GPE A;  1ZDL A;  4P9S A;  2V5Z A;  1F8S A;  2Z5Y A;  3UOZ A;  1REO A;  3DME A;  5C2T A;  1PJ5 A;  3AD7 B;  3NG7 X;  3FIM B;  1E1K A;  1KF6 A;  1H83 A;  3KVE A;  1TYT A;  2WPC A;  2XLS A;  2Y6Q A;  1DOB A;  3DJE A;  3LAD A;  3VRD B;  4EMW A;  1NEN A;  4AP3 A;  4Z25 A;  4UDR A;  3NNE A;  3QFB A;  1B4V A;  3Q9T A;  2A87 A;  4EQW A;  2VQB A;  3AYJ A;  1RSG A;  4B68 A;  1MOK A;  2O9Z A;  1KDG A;  4YSZ A;  1NHP A;  1FL2 A;  3O0H A;  3PS9 A;  2CVJ A;  4K5R A;  1PXA A;  3UOX A;  1ZOY A;  1GER A;  4BV6 A;  4GR1 A;  4X4J A;  1CJ4 A;  5TR3 A;  4B66 A;  3V3N A;  3ICS A;  1NHQ A;  4B63 A;  2C72 A;  2C3C A;  3ITJ A;  4EIQ A;  5FS8 A;  4X9N A;  3R9U A;  2BA9 A;  1D4E A;  3DGH A;  4B64 A;  1S3E A;  4H4Z A;  5KOW A;  4RG4 A;  3S5W A;  3BI4 A;  3V76 A;  4BK3 A;  2NVK X;  3ADA B;  2RGJ A;  1IUS A;  3AED A;  1QLB A;  1DJQ A;  3RNM A;  3UCL A;  3KPF A;  2WOW A;  2R0P A;  4B1B A;  4IVM B;  4NTC A;  1LV0 A;  4BJY A;  1OJA A;  1ELI A;  3NLC A;  2GMJ A;  3NRN A;  5KVH A;  5BVA A;  3L8K A;  3FG2 P;  3II4 A;  4GDP A;  4C3X A;  4JNA A;  3AB1 A;  4J57 A;  4OPL A;  1HYU A;  1PJ6 A;  2ARD A;  2ZZ0 A;  4RSL A;  1JOA A;  4A6N A;  4EIP A;  1E7P A;  4OPU A;  4YWO A;  3NTD A;  1GRE A;  1GTE A;  2IVE A;  2C65 A;  3K30 A;  2BAB A;  3CPH G;  3IF9 A;  1H81 A;  2BC0 A;  3EF6 A;  1OJ9 A;  2C75 A;  2OLO A;  1GRF A;  4H4Q A;  4Y4N A;  3ZDN A;  5JCK A;  4H2N A;  3AEG A;  3AE6 A;  4D03 A;  4IVO B;  4Z2T A;  5HY5 A;  1PBB A;  1O94 A;  1DOC A;  1GES A;  2ACZ A;  3AE5 A;  1BZL A;  1E1M A;  1YY5 A;  1PS9 A;  3P9U A;  1GEU A;  1GND A;  3AE4 A;  3AEE A;  3AE3 A;  3BHK A;  3NK2 X;  1RYI A;  3BI2 A;  3ZYX A;  1LVL A;  1N4V A;  1KNP A;  1L9E A;  2GVC A;  2QCU A;  2WPE A;  2IVD A;  3UP4 A;  4AP1 A;  2YVF A;  1BGN A;  2R9Z A;  2YR5 A;  1XHC A;  4Z24 A;  1IJH A;  1SEZ A;  5U25 A;  4YSX A;  4K5S A;  1YQ4 A;  3L1R A;  4APN A;  1H86 A;  1F8W A;  3KU9 A;  4J2W A;  3G5S A;  4KX6 A;  4OPC A;  2BCP A;  3IWA A;  4YXD A;  2BXR A;  3KA7 A;  5KXJ A;  4JN9 A;  2FJE A;  5CKU A;  1VQW A;  1ZP0 A;  4J33 A;  3NN6 X;  1H84 A;  1YKJ A;  3AEC A;  3BHF A;  1CC2 A;  4CNK A;  4B65 A;  4J56 A;  5IPY A;  1QO8 A;  2BS4 A;  3D1C A;  5KVI A;  4U8M A;  4FK1 A;  4D04 A;  3Q6J A;  2WDR A;  3DJD A;  3QVP A;  1FOH A;  2VRM A;  1F3P A;  3FPZ A;  1LTX R;  2YVG A;  5LV9 A;  1D4C A;  2C64 A;  2EQ8 A;  4H4V A;  1EBD A;  4U8O A;  2R0G A;  2GAH B;  4E0V A;  2YLS A;  1GSN A;  2BAC A;  3P1W A;  3CNS A;  4ZCC A;  3GD4 A;  3UKP A;  5HYM A;  1EL8 A;  2GQF A;  3AXB A;  3EAO A;  5EOW A;  3F8D A;  2YLR A;  4ICY A;  2RGH A;  1N1P A;  2XVH A;  2ZZB A;  1GRT A;  3UP5 A;  4FDC B;  1P2H A;  2JK6 A;  1RP0 A;  3DK8 A;  4EQS A;  2VRL A;  1PDH A;  3DK9 A;  1BGJ A;  2V60 A;  3GD3 A;  4GUV A;  2E5V A;  3SM8 A;  1YQZ A;  1KSS A;  2EQ6 A;  2V3A A;  2ZZC A;  3M0O A;  1KNR A;  1Q1W A;  1TDE A;  3QVR A;  4XWZ A;  4H2R A;  4I58 A;  1CJ2 A;  3IHM A;  4ADW A;  2CFY A;  2XLP A;  3IHG A;  1H7W A;  2Y6R A;  2BK5 A;  5IQ1 A;  3ABV A;  3QSM A;  4J36 A;  3UKF A;  1H6V A;  3CNP A;  4C77 A;  3VRB A;  2JB2 A;  2WHD A;  3GWF A;  4DSH A;  2XFP A;  1QJD A;  4XWR A;  3RHA A;  4CCQ A;  2V6O A;  3I3L A;  5IQ4 A;  2HQM A;  2YG3 A;  2GAG B;  1V59 A;  2B7R A;  3EPT A;  5KWF A;  2X8C A;  1CHU A;  5KRQ A;  4CCR A;  1JEH A;  5J7X A;  2JB3 A;  3UTH A;  5BUK A;  1S2Y A;  4LII A;  2TPR A;  3SFD A;  4PAA A;  5JCN A;  2VVM A;  3G5Q A;  4FK1 C;  4JY3 A;  1JRZ A;  4NEV A;  4USR A;  2B76 A;  3FMW A;  3SFE A;  3RED A;  1GRH A;  1LJ1 A;  3GDN A;  2XFN A;  2C3D A;  3P4Q A;  2X99 A;  3VRA A;  3AD8 B;  4ZCD A;  5J60 A;  3P4S A;  2XFU A;  4JNQ A;  5CQF A;  1N4W A;  2OLN A;  2I0Z A;  2WOI A;  1TDN A;  3M12 A;  3CND A;  4YTM A;  3NK0 X;  3GYJ A;  3QSE A;  1F8R A;  4CRT A;  2PYX A;  4JQ9 A;  2C70 A;  4U8L A;  3LXD A;  2YG4 A;  3DJG X;  4Z2U A;  2XDO A;  4OVI A;  3C4N A;  1NG3 A;  1PBF A;  2J3N A;  1ZY8 A;  2GB0 A;  5L46 A;  2C67 A;  1ZMC A;  2B9Y A;  1K0J A;  5FS9 A;  4B69 A;  4B67 A;  3FBS A;  5U63 A;  1CL0 A;  4OPD A;  4TM4 A;  3NIX A;  5FMH A;  3CIR A;  3V3O A;  4BK1 A;  1GTH A;  3S61 A;  5C3J A;  1ZMD A;  1ZOV A;  4M52 A;  2WS3 A;  4H2Q A;  4LU6 A;  4H4Y A;  1JU2 A;  2VQ7 A;  1N4U A;  1GRA A;  1L9D A;  1TDF A;  2OA1 A;  4H4R A;  1EL9 A;  4YKF A;  4EM3 A;  2JB1 A;  4AOS A;  2JAE A;  1UKV G;  2WDQ A;  1L0V A;  1IUW A;  2H88 A;  4A7A A;  1TRB A;  3GRS A;  1B5Q A;  3B3R A;  2RGO A;  4H4T A;  1LQT A;  2X3N A;  3LOV A; 
#chains in the Genus database with same CATH topology
 4REK A;  1GRG A;  2UZZ A;  4II2 A;  2XVF A;  2WOV A;  2XVJ A;  3PVC A;  1NG4 A;  4Z2R A;  4HA6 A;  1IUT A;  2BYB A;  1DOD A;  1Z6L A;  2WDV A;  2GR0 A;  3AE1 A;  2CDU A;  3M13 A;  2R0C A;  4BK2 A;  1MXT A;  4WCT A;  2XLU A;  1E1N A;  1NHR A;  1KSU A;  1FEB A;  3ATR A;  3UKQ A;  1NHS A;  5HHF A;  1F6M A;  2Q0L A;  4OPG A;  2R4J A;  3AEA A;  4IV9 A;  3AD9 B;  2XVI A;  2A8X A;  3ALL A;  3K7T A;  3D8X A;  1OJC A;  1GRB A;  4O5U A;  1Y56 B;  1O95 A;  1ZKQ A;  4U8J A;  4Y4L A;  2YLT A;  4LA1 A;  4U2S A;  3C4A A;  3HYV A;  3BI5 A;  5DBJ A;  3ATQ A;  4U2T A;  1LPF A;  1E1L A;  3LJP A;  4BJZ A;  3CGC A;  2A89 A;  1PBE A;  4BUR A;  3F8R A;  5U1O A;  3ICR A;  1CC4 A;  1E6E A;  2V3B A;  4C74 A;  2WPF A;  1NAA A;  3T37 A;  1L9C A;  2VZ2 A;  3HZL A;  1FEC A;  4JY2 A;  2YLW A;  3SZ0 A;  2YG7 A;  4GRT A;  4A99 A;  3NT6 A;  3P4R A;  3AE2 A;  1W4X A;  4PAB A;  4EM4 A;  3PO7 A;  1FEA A;  3GRT A;  3T2K A;  3T0K A;  2YG5 A;  3CGE A;  4A65 A;  4GAP A;  2PHH A;  1OJD A;  1S3B A;  4H4X A;  3T2Z A;  4YSY A;  3CGD A;  1GAL A;  1TYP A;  4DNA A;  1Q9I A;  2FJD A;  2GV8 A;  4YSH A;  1LQU A;  4TLX A;  3P4P A;  2AAQ A;  3RP7 A;  2Q7V A;  4A6N B;  4AT2 A;  5JCM A;  1X31 B;  3JSK A;  2QA2 A;  2ZBW A;  1D7L A;  3LZX A;  4IA5 A;  2YR6 A;  1VDC A;  3DA1 A;  4A5L A;  2XFQ A;  2Q0K A;  3C96 A;  4TM1 A;  1D7Y A;  2R46 A;  2C73 A;  3DGZ A;  2BS3 A;  1VG9 A;  1COY A;  1D5T A;  1K0L A;  3EAN A;  4NTD A;  3UTG A;  3VR8 A;  4C5O A;  2YM1 A;  4AT0 A;  4AOX A;  4USQ A;  2BK3 A;  3AEB A;  4K2X A;  2CUL A;  2X8G A;  3CGB A;  2YLZ A;  3DH9 A;  3H4K A;  4CNJ A;  5HXI A;  1O5W A;  3GDP A;  5EBK A;  3SQP A;  1DOE A;  1CJ3 A;  5EB4 A;  1PBD A;  3SX6 A;  1BF3 A;  2TMD A;  1CC6 A;  3BNU A;  4TM3 A;  5JCI A;  1CF3 A;  1JNZ A;  4J34 A;  2EQ9 A;  2R4E A;  2WES A;  4GF7 A;  2GH5 A;  1CBO A;  3AYL A;  4X9M A;  4H7U A;  3CPI G;  4J31 A;  4NEW A;  3K7M X;  4MJW A;  3ISH A;  4RG3 A;  2B9X A;  3OC4 A;  1EL7 A;  4U2L A;  4Z43 A;  3KD9 A;  5FS7 A;  1JRX A;  4UP3 A;  1PJ7 A;  2BRY A;  2VOU A;  4GAV A;  3UKK A;  3UKL A;  3NKS A;  4EMJ A;  1Y56 A;  1Y0P A;  4DGK A;  4A79 A;  2BC1 A;  4OCG A;  4U8K A;  1MO9 A;  3G5R A;  1NDA A;  3GSI A;  2GF3 A;  3RP6 A;  4YTN A;  5JCL A;  2GRT A;  2YWL A;  3AYI A;  4OPT A;  2WP6 A;  4UDQ A;  1YQ3 A;  4H2P A;  3UKH A;  1ZK7 A;  4H4S A;  1XPQ A;  3LZW A;  4EQX A;  4G9K A;  4H4U A;  4TM0 A;  2EQ7 A;  3CTY A;  4K8D A;  1PXB A;  4GCM A;  1IUX A;  3NGC X;  1VRQ B;  3NK1 X;  1M64 A;  3QJ4 A;  1S2Q A;  2YLX A;  1BWC A;  1NEK A;  3CNJ A;  3AWI A;  3SGL A;  1OJT A;  2X8H A;  5KOX A;  2OAM A;  2FJA A;  2DKH A;  2VVL G;  4DSG A;  2QA1 A;  3UOY A;  4JDR A;  3SZC A;  2C7G A;  4K7Z A;  3URH A;  2GR3 A;  2WBA A;  4WX1 A;  1KFY A;  2GQW A;  2AR8 A;  1Q1R A;  3I6D A;  2GR2 A;  1E39 A;  3LB8 A;  2DKI A;  4ECH A;  4EQR A;  3K7Q X;  3KKJ A;  3NYE A;  2WQY A;  2X50 A;  3WE0 A;  2V61 A;  4G6G A;  4KPR A;  1GXF A;  4H4P A;  3AE9 A;  2YG6 A;  1K4Q A;  1GV4 A;  4C3Y A;  3QFA A;  1XAN A;  4K22 A;  1D4D A;  1TDO A;  4O5Q A;  2BS2 A;  3AEF A;  3H8L A;  3SZF A;  1XDI A;  2BK4 A;  3GWD A;  3CPJ G;  3VR9 A;  5M10 A;  4CBQ A;  3NTA A;  3B6D A;  2XFO A;  2VVL A;  1JNR A;  2YVJ A;  1GT8 A;  5BUL A;  1PBC A;  2WU2 A;  1IUU A;  2OAL A;  4Z44 A;  3GYI A;  3NN0 X;  3ICT A;  1B8S A;  2AQJ A;  2XLR A;  4H4W A;  4Z26 A;  1AOG A;  2YAU A;  2Z5X A;  3DJJ A;  1CJC A;  4A9W A;  3AE8 A;  2RAB A;  4CY8 A;  2H89 A;  3GMB A;  4H50 A;  1P2E A;  1ZX9 A;  2FBW A;  3NH3 X;  5ER0 A;  2WP5 A;  2XLT A;  1IUV A;  2NPX A;  3SYI A;  5KMQ A;  2JBV A;  2C76 A;  5M0Z A;  4NZH A;  1BKW A;  2WEU A;  2FJB A;  3UKA A;  2E4G A;  5FS6 A;  2WU5 A;  3KLJ A;  4GDE A;  3NYC A;  4N9X A;  3ALJ A;  2WP9 A;  1K0I A;  3DK4 A;  1ONF A;  4U8I A;  3UTE A;  2XVE A;  4CY6 A;  2WET A;  3HYW A;  4IA6 A;  4FX9 A;  2YM2 A;  5GSN A;  1NPX A;  2GMH A;  2W0H A;  1DNC A;  3E1T A;  1FCD A;  1H7X A;  2IID A;  3AE7 A;  3NHO X;  1EL5 A;  2JKC A;  1JRY A;  4TLZ A;  2XCG A;  2C66 A;  3OZ2 A;  4U8P A;  4UDP A;  3GMC A;  3UOV A;  4YTP A;  1DXL A;  3COX A;  3VQR A;  5KMR A;  2Q6U A;  4YKG A;  1B37 A;  2APG A;  3RP8 A;  5EB5 A;  4EMI A;  3H8I A;  2R45 A;  2QAE A;  3NYF A;  3BNM A;  4ZN0 A;  1M6I A;  4NTE A;  1PXC A;  1DJN A;  2B7S A;  1GET A;  4HB9 A;  1PN0 A;  3ALM A;  3F8P A;  2GEW A;  3CN8 A;  2E1M A;  4XXG A;  3IC9 A;  5BRT A;  2GR1 A;  1TDK A;  2YR4 A;  4U8N A;  2YQU A;  4Y4M A;  4YT0 A;  5GRT A;  1GOS A;  2BCG G;  1PHH A;  2B9W A;  2BXS A;  2F5Z A;  2XYO A;  3CNT A;  3QSS A;  4I59 A;  1H82 A;  4OPI A;  3UTF A;  1VG0 A;  1GPE A;  1ZDL A;  4P9S A;  2V5Z A;  1F8S A;  2Z5Y A;  3UOZ A;  1REO A;  3DME A;  5C2T A;  1PJ5 A;  3AD7 B;  3NG7 X;  3FIM B;  1E1K A;  1KF6 A;  1H83 A;  3KVE A;  1TYT A;  2WPC A;  2XLS A;  2Y6Q A;  1DOB A;  3DJE A;  3LAD A;  3VRD B;  4EMW A;  1NEN A;  4AP3 A;  4Z25 A;  4UDR A;  3NNE A;  3QFB A;  1B4V A;  3Q9T A;  2A87 A;  4EQW A;  2VQB A;  3AYJ A;  1RSG A;  4B68 A;  1MOK A;  2O9Z A;  1KDG A;  4YSZ A;  1NHP A;  1FL2 A;  3O0H A;  3PS9 A;  2CVJ A;  4K5R A;  1PXA A;  3UOX A;  1ZOY A;  1GER A;  4BV6 A;  4GR1 A;  4X4J A;  1CJ4 A;  5TR3 A;  4B66 A;  3V3N A;  3ICS A;  1NHQ A;  4B63 A;  2C72 A;  2C3C A;  3ITJ A;  4EIQ A;  5FS8 A;  4X9N A;  3R9U A;  5KMP A;  2BA9 A;  1D4E A;  3DGH A;  4B64 A;  1S3E A;  4H4Z A;  5KOW A;  4RG4 A;  3S5W A;  3BI4 A;  3V76 A;  4BK3 A;  2NVK X;  3ADA B;  2RGJ A;  1IUS A;  3AED A;  1QLB A;  1DJQ A;  3RNM A;  3UCL A;  3KPF A;  2WOW A;  2R0P A;  4B1B A;  4IVM B;  4NTC A;  1LV0 A;  4BJY A;  1OJA A;  1ELI A;  3NLC A;  2GMJ A;  3NRN A;  5KVH A;  5BVA A;  3L8K A;  3FG2 P;  3II4 A;  4GDP A;  4C3X A;  4JNA A;  3AB1 A;  4J57 A;  4OPL A;  1HYU A;  1PJ6 A;  2ARD A;  2ZZ0 A;  4RSL A;  1JOA A;  4A6N A;  4EIP A;  1E7P A;  4OPU A;  4YWO A;  3NTD A;  1GRE A;  1GTE A;  2IVE A;  2C65 A;  3K30 A;  2BAB A;  4G74 A;  3CPH G;  3IF9 A;  1H81 A;  2BC0 A;  3EF6 A;  1OJ9 A;  2C75 A;  3SY4 A;  2OLO A;  1GRF A;  4H4Q A;  4Y4N A;  3ZDN A;  5JCK A;  4H2N A;  3AEG A;  3AE6 A;  4D03 A;  4IVO B;  4Z2T A;  5HY5 A;  1PBB A;  1O94 A;  1DOC A;  1GES A;  2ACZ A;  3AE5 A;  1BZL A;  1E1M A;  3CMM A;  1YY5 A;  1PS9 A;  3P9U A;  1GEU A;  1GND A;  3AE4 A;  3AEE A;  3AE3 A;  3BHK A;  3NK2 X;  1RYI A;  3BI2 A;  3ZYX A;  1LVL A;  1N4V A;  1KNP A;  1L9E A;  2GVC A;  2QCU A;  2WPE A;  2IVD A;  3UP4 A;  4AP1 A;  2YVF A;  1BGN A;  2R9Z A;  2YR5 A;  1XHC A;  4Z24 A;  1IJH A;  1SEZ A;  5U25 A;  3KPK A;  4K5S A;  4YSX A;  1YQ4 A;  3L1R A;  3SZW A;  4APN A;  1H86 A;  1F8W A;  3KU9 A;  4J2W A;  3G5S A;  4KX6 A;  4OPC A;  2BCP A;  3IWA A;  4YXD A;  2BXR A;  3KA7 A;  5KXJ A;  4JN9 A;  2FJE A;  5CKU A;  1VQW A;  1ZP0 A;  4J33 A;  3NN6 X;  1H84 A;  1YKJ A;  3AEC A;  3BHF A;  1CC2 A;  4CNK A;  4G73 A;  4J56 A;  4B65 A;  5IPY A;  1QO8 A;  2BS4 A;  3D1C A;  5KVI A;  4U8M A;  4FK1 A;  4D04 A;  3Q6J A;  2WDR A;  3DJD A;  3QVP A;  1FOH A;  2VRM A;  1F3P A;  3FPZ A;  1LTX R;  2YVG A;  5LV9 A;  1D4C A;  2C64 A;  2EQ8 A;  4H4V A;  1EBD A;  4NWZ A;  4U8O A;  2R0G A;  2GAH B;  4E0V A;  2YLS A;  1GSN A;  2BAC A;  3P1W A;  3CNS A;  4ZCC A;  3GD4 A;  3UKP A;  5HYM A;  1EL8 A;  2GQF A;  3AXB A;  3EAO A;  5EOW A;  3F8D A;  2YLR A;  4ICY A;  2RGH A;  1N1P A;  2XVH A;  2ZZB A;  1GRT A;  3UP5 A;  4FDC B;  1P2H A;  2JK6 A;  1RP0 A;  3DK8 A;  3T14 A;  2VRL A;  4EQS A;  1PDH A;  3DK9 A;  1BGJ A;  2V60 A;  3GD3 A;  4GUV A;  2E5V A;  3SM8 A;  1YQZ A;  1KSS A;  2EQ6 A;  2V3A A;  2ZZC A;  3M0O A;  1KNR A;  1Q1W A;  1TDE A;  3QVR A;  4XWZ A;  4H2R A;  4I58 A;  1CJ2 A;  3IHM A;  4ADW A;  2CFY A;  2XLP A;  3IHG A;  1H7W A;  2Y6R A;  3T2Y A;  2BK5 A;  5IQ1 A;  3ABV A;  3QSM A;  4J36 A;  3SXI A;  3UKF A;  1H6V A;  3CNP A;  4C77 A;  3VRB A;  2JB2 A;  2WHD A;  3GWF A;  4DSH A;  2XFP A;  1QJD A;  4XWR A;  3RHA A;  4CCQ A;  2V6O A;  3I3L A;  5IQ4 A;  2HQM A;  2YG3 A;  2GAG B;  1V59 A;  2B7R A;  3EPT A;  5KWF A;  2X8C A;  1CHU A;  5KRQ A;  4CCR A;  1JEH A;  5J7X A;  2JB3 A;  3UTH A;  5BUK A;  1S2Y A;  4LII A;  2TPR A;  3SFD A;  4PAA A;  5JCN A;  2VVM A;  3G5Q A;  3T31 A;  5KNL A;  4NNJ A;  4FK1 C;  4JY3 A;  1JRZ A;  4NEV A;  4USR A;  2B76 A;  3FMW A;  3SFE A;  3RED A;  1GRH A;  1LJ1 A;  3GDN A;  2XFN A;  2C3D A;  3P4Q A;  2X99 A;  3VRA A;  3AD8 B;  4ZCD A;  5J60 A;  3P4S A;  2XFU A;  4JNQ A;  5CQF A;  1N4W A;  2OLN A;  2I0Z A;  2WOI A;  1TDN A;  3M12 A;  3CND A;  4YTM A;  2C4C A;  3NK0 X;  5KMS A;  3GYJ A;  3QSE A;  1F8R A;  4CRT A;  2PYX A;  4JQ9 A;  2C70 A;  4U8L A;  3LXD A;  2YG4 A;  3DJG X;  4Z2U A;  2XDO A;  4OVI A;  3C4N A;  1NG3 A;  1PBF A;  2J3N A;  4II3 A;  1ZY8 A;  2GB0 A;  5L46 A;  2C67 A;  1ZMC A;  2B9Y A;  1K0J A;  5FS9 A;  4B69 A;  4B67 A;  3FBS A;  5U63 A;  1CL0 A;  4OPD A;  4TM4 A;  3NIX A;  5FMH A;  3CIR A;  3V3O A;  4BK1 A;  1GTH A;  4G6H A;  3S61 A;  5C3J A;  1ZMD A;  1ZOV A;  4M52 A;  2WS3 A;  4H2Q A;  4LU6 A;  4H4Y A;  1JU2 A;  2VQ7 A;  1N4U A;  1GRA A;  1L9D A;  1TDF A;  2OA1 A;  4H4R A;  1EL9 A;  4YKF A;  4EM3 A;  2JB1 A;  4AOS A;  2JAE A;  1UKV G;  2WDQ A;  1L0V A;  1IUW A;  2H88 A;  4A7A A;  1TRB A;  3GRS A;  1B5Q A;  3GYX A;  3B3R A;  2RGO A;  4H4T A;  3HYX A;  1LQT A;  2X3N A;  3LOV A;  2BRA A; 
#chains in the Genus database with same CATH homology
 4REK A;  1GRG A;  2UZZ A;  4II2 A;  2XVF A;  2WOV A;  2XVJ A;  3PVC A;  1NG4 A;  4Z2R A;  4HA6 A;  1IUT A;  2BYB A;  1DOD A;  1Z6L A;  2WDV A;  2GR0 A;  3AE1 A;  2CDU A;  3M13 A;  2R0C A;  4BK2 A;  1MXT A;  4WCT A;  2XLU A;  1E1N A;  1NHR A;  1KSU A;  1FEB A;  3ATR A;  3UKQ A;  1NHS A;  5HHF A;  1F6M A;  2Q0L A;  4OPG A;  2R4J A;  3AEA A;  3AD9 B;  4IV9 A;  2XVI A;  2A8X A;  3ALL A;  3K7T A;  3D8X A;  1OJC A;  1GRB A;  4O5U A;  1Y56 B;  1O95 A;  1ZKQ A;  4U8J A;  4Y4L A;  2YLT A;  4LA1 A;  4U2S A;  3C4A A;  3HYV A;  3BI5 A;  5DBJ A;  3ATQ A;  4U2T A;  1LPF A;  1E1L A;  3LJP A;  4BJZ A;  3CGC A;  2A89 A;  1PBE A;  4BUR A;  3F8R A;  5U1O A;  3ICR A;  1CC4 A;  1E6E A;  2V3B A;  4C74 A;  2WPF A;  1NAA A;  3T37 A;  1L9C A;  2VZ2 A;  3HZL A;  1FEC A;  4JY2 A;  2YLW A;  3SZ0 A;  2YG7 A;  4GRT A;  4A99 A;  3NT6 A;  3P4R A;  3AE2 A;  1W4X A;  4PAB A;  4EM4 A;  3PO7 A;  1FEA A;  3GRT A;  3T2K A;  3T0K A;  2YG5 A;  3CGE A;  4A65 A;  4GAP A;  2PHH A;  1OJD A;  1S3B A;  4H4X A;  3T2Z A;  4YSY A;  3CGD A;  1GAL A;  1TYP A;  4DNA A;  1Q9I A;  2FJD A;  2GV8 A;  4YSH A;  1LQU A;  4TLX A;  3P4P A;  2AAQ A;  3RP7 A;  2Q7V A;  4A6N B;  4AT2 A;  5JCM A;  1X31 B;  3JSK A;  2QA2 A;  2ZBW A;  1D7L A;  3LZX A;  4IA5 A;  2YR6 A;  1VDC A;  3DA1 A;  4A5L A;  2XFQ A;  2Q0K A;  3C96 A;  4TM1 A;  1D7Y A;  2R46 A;  2C73 A;  3DGZ A;  2BS3 A;  1VG9 A;  1COY A;  1D5T A;  1K0L A;  3EAN A;  4NTD A;  3UTG A;  3VR8 A;  4C5O A;  2YM1 A;  4AT0 A;  4AOX A;  4USQ A;  2BK3 A;  3AEB A;  4K2X A;  2CUL A;  2X8G A;  3CGB A;  2YLZ A;  3DH9 A;  3H4K A;  4CNJ A;  5HXI A;  1O5W A;  3GDP A;  5EBK A;  3SQP A;  1DOE A;  1CJ3 A;  5EB4 A;  1PBD A;  3SX6 A;  1BF3 A;  2TMD A;  1CC6 A;  3BNU A;  4TM3 A;  5JCI A;  1CF3 A;  1JNZ A;  4J34 A;  2EQ9 A;  2R4E A;  2WES A;  4GF7 A;  2GH5 A;  1CBO A;  3AYL A;  4X9M A;  4H7U A;  3CPI G;  4J31 A;  4NEW A;  3K7M X;  4MJW A;  3ISH A;  4RG3 A;  2B9X A;  3OC4 A;  1EL7 A;  4U2L A;  4Z43 A;  3KD9 A;  5FS7 A;  1JRX A;  4UP3 A;  1PJ7 A;  2BRY A;  2VOU A;  4GAV A;  3UKK A;  3UKL A;  3NKS A;  4EMJ A;  1Y56 A;  1Y0P A;  4DGK A;  4A79 A;  2BC1 A;  4OCG A;  4U8K A;  1MO9 A;  3G5R A;  1NDA A;  3GSI A;  2GF3 A;  3RP6 A;  4YTN A;  5JCL A;  2GRT A;  2YWL A;  3AYI A;  4OPT A;  2WP6 A;  4UDQ A;  1YQ3 A;  4H2P A;  3UKH A;  1ZK7 A;  4H4S A;  1XPQ A;  3LZW A;  4EQX A;  4G9K A;  4H4U A;  4TM0 A;  2EQ7 A;  3CTY A;  4K8D A;  1PXB A;  4GCM A;  1IUX A;  3NGC X;  1VRQ B;  3NK1 X;  1M64 A;  3QJ4 A;  1S2Q A;  2YLX A;  1BWC A;  1NEK A;  3CNJ A;  3AWI A;  3SGL A;  1OJT A;  2X8H A;  5KOX A;  2OAM A;  2FJA A;  2DKH A;  2VVL G;  4DSG A;  2QA1 A;  3UOY A;  4JDR A;  3SZC A;  2C7G A;  4K7Z A;  3URH A;  2GR3 A;  2WBA A;  4WX1 A;  1KFY A;  2GQW A;  2AR8 A;  1Q1R A;  3I6D A;  2GR2 A;  1E39 A;  3LB8 A;  2DKI A;  4ECH A;  4EQR A;  3K7Q X;  3KKJ A;  3NYE A;  2WQY A;  2X50 A;  3WE0 A;  2V61 A;  4G6G A;  4KPR A;  1GXF A;  4H4P A;  3AE9 A;  2YG6 A;  1K4Q A;  1GV4 A;  4C3Y A;  3QFA A;  1XAN A;  4K22 A;  1D4D A;  1TDO A;  4O5Q A;  2BS2 A;  3AEF A;  3H8L A;  3SZF A;  1XDI A;  2BK4 A;  3GWD A;  3CPJ G;  3VR9 A;  5M10 A;  4CBQ A;  3NTA A;  3B6D A;  2XFO A;  2VVL A;  1JNR A;  2YVJ A;  1GT8 A;  5BUL A;  1PBC A;  2WU2 A;  1IUU A;  2OAL A;  4Z44 A;  3GYI A;  3NN0 X;  3ICT A;  1B8S A;  2AQJ A;  2XLR A;  4H4W A;  4Z26 A;  1AOG A;  2YAU A;  2Z5X A;  3DJJ A;  1CJC A;  4A9W A;  3AE8 A;  2RAB A;  4CY8 A;  2H89 A;  3GMB A;  4H50 A;  1P2E A;  1ZX9 A;  2FBW A;  3NH3 X;  5ER0 A;  2WP5 A;  2XLT A;  1IUV A;  2NPX A;  3SYI A;  5KMQ A;  2JBV A;  2C76 A;  5M0Z A;  4NZH A;  1BKW A;  2WEU A;  2FJB A;  3UKA A;  2E4G A;  5FS6 A;  2WU5 A;  3KLJ A;  4GDE A;  3NYC A;  4N9X A;  3ALJ A;  2WP9 A;  1K0I A;  3DK4 A;  1ONF A;  4U8I A;  3UTE A;  2XVE A;  4CY6 A;  2WET A;  3HYW A;  4IA6 A;  4FX9 A;  2YM2 A;  5GSN A;  1NPX A;  2GMH A;  2W0H A;  1DNC A;  3E1T A;  1FCD A;  1H7X A;  2IID A;  3AE7 A;  3NHO X;  1EL5 A;  2JKC A;  1JRY A;  4TLZ A;  2XCG A;  2C66 A;  3OZ2 A;  4U8P A;  4UDP A;  3GMC A;  3UOV A;  4YTP A;  1DXL A;  3COX A;  3VQR A;  5KMR A;  2Q6U A;  4YKG A;  1B37 A;  2APG A;  3RP8 A;  5EB5 A;  4EMI A;  3H8I A;  2R45 A;  2QAE A;  3NYF A;  3BNM A;  4ZN0 A;  1M6I A;  4NTE A;  1PXC A;  1DJN A;  2B7S A;  1GET A;  4HB9 A;  1PN0 A;  3ALM A;  3F8P A;  2GEW A;  3CN8 A;  2E1M A;  4XXG A;  3IC9 A;  5BRT A;  2GR1 A;  1TDK A;  2YR4 A;  4U8N A;  2YQU A;  4Y4M A;  4YT0 A;  5GRT A;  1GOS A;  2BCG G;  1PHH A;  2B9W A;  2BXS A;  2F5Z A;  2XYO A;  3CNT A;  3QSS A;  4I59 A;  1H82 A;  4OPI A;  3UTF A;  1VG0 A;  1GPE A;  1ZDL A;  4P9S A;  2V5Z A;  1F8S A;  2Z5Y A;  3UOZ A;  1REO A;  3DME A;  5C2T A;  1PJ5 A;  3AD7 B;  3NG7 X;  3FIM B;  1E1K A;  1KF6 A;  1H83 A;  3KVE A;  1TYT A;  2WPC A;  2XLS A;  2Y6Q A;  1DOB A;  3DJE A;  3LAD A;  3VRD B;  4EMW A;  1NEN A;  4AP3 A;  4Z25 A;  4UDR A;  3NNE A;  3QFB A;  1B4V A;  3Q9T A;  2A87 A;  4EQW A;  2VQB A;  3AYJ A;  1RSG A;  4B68 A;  1MOK A;  2O9Z A;  1KDG A;  4YSZ A;  1NHP A;  1FL2 A;  3O0H A;  3PS9 A;  2CVJ A;  4K5R A;  1PXA A;  3UOX A;  1ZOY A;  1GER A;  4BV6 A;  4GR1 A;  4X4J A;  1CJ4 A;  5TR3 A;  4B66 A;  3V3N A;  3ICS A;  1NHQ A;  4B63 A;  2C72 A;  2C3C A;  3ITJ A;  4EIQ A;  5FS8 A;  4X9N A;  3R9U A;  5KMP A;  2BA9 A;  1D4E A;  3DGH A;  4B64 A;  1S3E A;  4H4Z A;  5KOW A;  4RG4 A;  3S5W A;  3BI4 A;  3V76 A;  4BK3 A;  2NVK X;  3ADA B;  2RGJ A;  1IUS A;  3AED A;  1QLB A;  1DJQ A;  3RNM A;  3UCL A;  3KPF A;  2WOW A;  2R0P A;  4B1B A;  4IVM B;  4NTC A;  1LV0 A;  4BJY A;  1OJA A;  1ELI A;  3NLC A;  2GMJ A;  3NRN A;  5KVH A;  5BVA A;  3L8K A;  3FG2 P;  3II4 A;  4GDP A;  4C3X A;  4JNA A;  3AB1 A;  4J57 A;  4OPL A;  1HYU A;  1PJ6 A;  2ARD A;  2ZZ0 A;  4RSL A;  1JOA A;  4A6N A;  4EIP A;  1E7P A;  4OPU A;  4YWO A;  3NTD A;  1GRE A;  1GTE A;  2IVE A;  2C65 A;  3K30 A;  2BAB A;  4G74 A;  3CPH G;  3IF9 A;  1H81 A;  2BC0 A;  3EF6 A;  1OJ9 A;  2C75 A;  3SY4 A;  2OLO A;  1GRF A;  4H4Q A;  4Y4N A;  3ZDN A;  5JCK A;  4H2N A;  3AEG A;  3AE6 A;  4D03 A;  4IVO B;  4Z2T A;  5HY5 A;  1PBB A;  1O94 A;  1DOC A;  1GES A;  2ACZ A;  3AE5 A;  1BZL A;  1E1M A;  3CMM A;  1YY5 A;  1PS9 A;  3P9U A;  1GEU A;  1GND A;  3AE4 A;  3AEE A;  3AE3 A;  3BHK A;  3NK2 X;  1RYI A;  3BI2 A;  3ZYX A;  1LVL A;  1N4V A;  1KNP A;  1L9E A;  2GVC A;  2QCU A;  2WPE A;  2IVD A;  3UP4 A;  4AP1 A;  2YVF A;  1BGN A;  2R9Z A;  2YR5 A;  1XHC A;  4Z24 A;  1IJH A;  1SEZ A;  5U25 A;  3KPK A;  4K5S A;  4YSX A;  1YQ4 A;  3L1R A;  3SZW A;  4APN A;  1H86 A;  1F8W A;  3KU9 A;  4J2W A;  3G5S A;  4KX6 A;  4OPC A;  2BCP A;  3IWA A;  4YXD A;  2BXR A;  3KA7 A;  5KXJ A;  4JN9 A;  2FJE A;  5CKU A;  1VQW A;  1ZP0 A;  4J33 A;  3NN6 X;  1H84 A;  1YKJ A;  3AEC A;  3BHF A;  1CC2 A;  4CNK A;  4G73 A;  4J56 A;  4B65 A;  5IPY A;  1QO8 A;  2BS4 A;  3D1C A;  5KVI A;  4U8M A;  4FK1 A;  4D04 A;  3Q6J A;  2WDR A;  3DJD A;  3QVP A;  1FOH A;  2VRM A;  1F3P A;  3FPZ A;  1LTX R;  2YVG A;  5LV9 A;  1D4C A;  2C64 A;  2EQ8 A;  4H4V A;  1EBD A;  4NWZ A;  4U8O A;  2R0G A;  2GAH B;  4E0V A;  2YLS A;  1GSN A;  2BAC A;  3P1W A;  3CNS A;  4ZCC A;  3GD4 A;  3UKP A;  5HYM A;  1EL8 A;  2GQF A;  3AXB A;  3EAO A;  5EOW A;  3F8D A;  2YLR A;  4ICY A;  2RGH A;  1N1P A;  2XVH A;  2ZZB A;  1GRT A;  3UP5 A;  4FDC B;  1P2H A;  2JK6 A;  1RP0 A;  3DK8 A;  3T14 A;  2VRL A;  4EQS A;  1PDH A;  3DK9 A;  1BGJ A;  2V60 A;  3GD3 A;  4GUV A;  2E5V A;  3SM8 A;  1YQZ A;  1KSS A;  2EQ6 A;  2V3A A;  2ZZC A;  3M0O A;  1KNR A;  1Q1W A;  1TDE A;  3QVR A;  4XWZ A;  4H2R A;  4I58 A;  1CJ2 A;  3IHM A;  4ADW A;  2CFY A;  2XLP A;  3IHG A;  1H7W A;  2Y6R A;  3T2Y A;  2BK5 A;  5IQ1 A;  3ABV A;  3QSM A;  4J36 A;  3SXI A;  3UKF A;  1H6V A;  3CNP A;  4C77 A;  3VRB A;  2JB2 A;  2WHD A;  3GWF A;  4DSH A;  2XFP A;  1QJD A;  4XWR A;  3RHA A;  4CCQ A;  2V6O A;  3I3L A;  5IQ4 A;  2HQM A;  2YG3 A;  2GAG B;  1V59 A;  2B7R A;  3EPT A;  5KWF A;  2X8C A;  1CHU A;  5KRQ A;  4CCR A;  1JEH A;  5J7X A;  2JB3 A;  3UTH A;  5BUK A;  1S2Y A;  4LII A;  2TPR A;  3SFD A;  4PAA A;  5JCN A;  2VVM A;  3G5Q A;  3T31 A;  5KNL A;  4NNJ A;  4FK1 C;  4JY3 A;  1JRZ A;  4NEV A;  4USR A;  2B76 A;  3FMW A;  3SFE A;  3RED A;  1GRH A;  1LJ1 A;  3GDN A;  2XFN A;  2C3D A;  3P4Q A;  2X99 A;  3VRA A;  3AD8 B;  4ZCD A;  5J60 A;  3P4S A;  2XFU A;  4JNQ A;  5CQF A;  1N4W A;  2OLN A;  2I0Z A;  2WOI A;  1TDN A;  3M12 A;  3CND A;  4YTM A;  2C4C A;  3NK0 X;  5KMS A;  3GYJ A;  3QSE A;  1F8R A;  4CRT A;  2PYX A;  4JQ9 A;  2C70 A;  4U8L A;  3LXD A;  2YG4 A;  3DJG X;  4Z2U A;  2XDO A;  4OVI A;  3C4N A;  1NG3 A;  1PBF A;  2J3N A;  4II3 A;  1ZY8 A;  2GB0 A;  5L46 A;  2C67 A;  1ZMC A;  2B9Y A;  1K0J A;  5FS9 A;  4B69 A;  4B67 A;  3FBS A;  5U63 A;  1CL0 A;  4OPD A;  4TM4 A;  3NIX A;  5FMH A;  3CIR A;  3V3O A;  4BK1 A;  1GTH A;  4G6H A;  3S61 A;  5C3J A;  1ZMD A;  1ZOV A;  4M52 A;  2WS3 A;  4H2Q A;  4LU6 A;  4H4Y A;  1JU2 A;  2VQ7 A;  1N4U A;  1GRA A;  1L9D A;  1TDF A;  2OA1 A;  4H4R A;  1EL9 A;  4YKF A;  4EM3 A;  2JB1 A;  4AOS A;  2JAE A;  1UKV G;  2WDQ A;  1L0V A;  1IUW A;  2H88 A;  4A7A A;  1TRB A;  3GRS A;  1B5Q A;  3GYX A;  3B3R A;  2RGO A;  4H4T A;  3HYX A;  1LQT A;  2X3N A;  3LOV A;  2BRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...