1TDNA

L-amino acid oxidase from agkistrodon halys in complex with l-leucine
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
484
structure length
484
Chain Sequence
b'DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complex with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
total genus 172
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdnA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdnA01
1GPEA 1FCDA 2E4GA 2QA1A 1S3EA 1IUSA 3H4KA 4DSHA 3C4AA 1OJTA 2FJAA 1H7XA 4CCRA 2Y6QA 2YG4A 3AE9A 3NN6X 2C70A 2R45A 3FG2P 4A9WA 3I6DA 3KU9A 3S5WA 4EIQA 3D1CA 2XFOA 4OCGA 4NTEA 4U8JA 5EB5A 4J57A 2YM1A 3UKAA 4B68A 3GMCA 1ZOYA 1TRBA 4NZHA 1M6IA 2YG5A 1DOEA 2X8HA 3GYIA 1ZX9A 1RYIA 3AE4A 5M10A 2RABA 1ZKQA 2CDUA 3NG7X 3DGHA 3NK1X 4KX6A 2WDVA 1UKVG 2GF3A 3ALJA 4H4RA 2RGOA 1JNRA 2R4JA 4U2TA 2YLZA 5CKUA 1S3BA 1KNRA 1HYUA 1AOGA 1ZK7A 1GT8A 1IUTA 1S2QA 2Q0LA 3ICSA 4TLXA 1JRZA 5KOXA 2WBAA 3QSEA 3CGDA 4H4PA 1VQWA 2F5ZA 3NH3X 4AP1A 3Q6JA 3PVCA 4YXDA 2YLRA 2YVJA 1EBDA 5KXJA 3ISHA 2EQ8A 2C65A 4U8MA 2GR1A 1BF3A 1PBBA 3IF9A 1N1PA 2YM2A 3GWDA 1E7PA 5FMHA 5FS7A 1PHHA 1PXCA 3CN8A 2JKCA 5EOWA 2E5VA 1O95A 1CC2A 1ZMCA 3AE5A 5LV9A 4PAAA 1F6MA 2E1MA 2YWLA 4Z2RA 1BKWA 4EQSA 1CC4A 2YG3A 1GERA 4A5LA 3AYLA 3AEEA 3UOVA 5U1OA 2Y6RA 1BZLA 3UKPA 3R9UA 4BK3A 5L46A 2BACA 3CGBA 5IQ4A 1K0IA 4H2QA 2A8XA 2WQYA 3AE6A 1GALA 3ITJA 1FEBA 5U63A 4E0VA 1H7WA 1LQTA 2DKIA 5HYMA 1ZP0A 3EPTA 4OPIA 5BUKA 2JB1A 2XYOA 4GR1A 3I3LA 4U8NA 1GSNA 3AD8B 1TDOA 3B6DA 2EQ7A 4AOXA 3ICRA 3E1TA 4BK2A 2XDOA 2BABA 3DMEA 2BXSA 5IQ1A 1KDGA 2Q0KA 2IIDA 3GWFA 1ZOVA 4H2NA 2QCUA 2TPRA 1NG3A 3T37A 1DJQA 1E1KA 3NTDA 4USRA 1ZDLA 4YSYA 5BULA 4FX9A 1CL0A 3VRAA 4IA6A 2VRMA 3GMBA 2RGHA 2WESA 2Z5YA 2QA2A 1CJ4A 3O0HA 3DGZA 5JCLA 2R0GA 1E1MA 1D4DA 2JAEA 3BHFA 4JDRA 1OJAA 4AT2A 1CJ2A 1TDKA 3KLJA 4BV6A 1KFYA 3UOYA 1F8SA 4K7ZA 2B9YA 4H4SA 1GESA 4J2WA 3BHKA 1GRTA 2GRTA 5C3JA 4C77A 2BK5A 2V6OA 3BNMA 2V3AA 4K22A 2YQUA 2VVLA 4TM4A 3IWAA 3WE0A 3VR8A 5EB4A 3Q9TA 4ADWA 3CPHG 1CHUA 4GCMA 2IVDA 1D5TA 1IUWA 3AECA 3CGEA 1YQ3A 2YR6A 3CNJA 3L1RA 4IVMB 4CNKA 1V59A 2XFNA 2GMJA 5EBKA 2BS2A 3NK2X 2H89A 3S61A 2BC1A 4AOSA 1RP0A 3UOZA 3UTFA 2WOVA 3DH9A 4C5OA 3DA1A 4TM1A 2HQMA 2X8CA 3FBSA 2GR0A 4Z43A 2XFPA 2CULA 3AXBA 3M12A 2ZZBA 2EQ6A 3QSMA 1BWCA 1K0JA 4PABA 2B9XA 2B76A 2C67A 3AYIA 1JNZA 3GRSA 4H4XA 1TYTA 3BI4A 5CQFA 3SGLA 2OAMA 1PXBA 2GR2A 1GRHA 2JB2A 1GXFA 2C66A 2V3BA 3P4PA 2FBWA 1DNCA 2AQJA 4A65A 2ZBWA 3ATQA 4EMWA 1EL9A 4OPUA 4JNQA 2CFYA 4USQA 3G5RA 4AT0A 3AEGA 3UTGA 1CC6A 4ZCCA 5FS8A 3V3NA 2UZZA 1XDIA 2XLSA 2GQWA 4OPGA 1ELIA 1PBCA 4REKA 1JRYA 2WETA 3CTYA 3P4QA 1GREA 1DODA 3RP8A 1TDEA 3AE8A 4UDRA 4B67A 1F3PA 3LOVA 3V3OA 2X99A 4D04A 1DJNA 1NEKA 2X8GA 2V5ZA 4K5SA 2Z5XA 3UTHA 1P2HA 2WP6A 3P4RA 3II4A 1O94A 4K8DA 4EQRA 1CJCA 1TDNA 2XFQA 2PHHA 3AEDA 1JU2A 2GMHA 2R0CA 5IPYA 1JRXA 4EM3A 4X4JA 5HY5A 2V60A 2B7RA 5JCIA 1CJ3A 1IUVA 2EQ9A 3F8PA 4CY8A 3IC9A 4Z26A 5KVHA 4JNAA 2XVEA 3CNTA 3IHMA 1F8WA 2BS3A 2GH5A 3BNUA 1NDAA 1NENA 5JCNA 3DJEA 4H7UA 4J33A 5ER0A 4YSHA 3P9UA 2NPXA 3H8LA 4B63A 3UOXA 4EMIA 1Q1WA 2FJDA 2NVKX 1B5QA 3DK4A 4EQWA 3DJDA 4NTCA 1H82A 1EL5A 4DNAA 2WPFA 3LJPA 4LIIA 3V76A 1GNDA 3DK9A 1PJ6A 1N4UA 2JK6A 3CPIG 3QVPA 3CGCA 2J3NA 3QSSA 4H4QA 3ZDNA 3P4SA 1D7YA 1IUUA 2WU5A 4H2RA 2GR3A 5HXIA 1ZY8A 3PS9A 4A99A 4EIPA 2WDRA 4RG4A 5J7XA 1BGNA 4IVOB 3SFEA 1XANA 1D4CA 3FPZA 3KKJA 2WDQA 1LVLA 2A89A 3FIMB 1GTEA 3UCLA 1DOBA 4A79A 3AD7B 4XWRA 4Y4MA 3NNEA 2WOIA 2WOWA 4FDCB 1FEAA 4ZN0A 1N4VA 2IVEA 3KD9A 1YY5A 3AE3A 3LXDA 2R0PA 1K0LA 5C2TA 3AB1A 4A7AA 3JSKA 4M52A 4O5UA 1D7LA 4H2PA 4J56A 4ZCDA 3RP7A 3LZWA 3ADAB 3VRBA 1O5WA 4B64A 1JOAA 3QFAA 3NHOX 4YKGA 1VRQB 4OPLA 3RNMA 4YTNA 1H81A 1MOKA 3P1WA 4EQXA 2GV8A 2O9ZA 1NPXA 2GQFA 4H4VA 4AP3A 4C3XA 4WX1A 1L9DA 3UP4A 3F8DA 1FECA 1KSUA 4A6NA 2YLWA 4U8PA 1RSGA 1P2EA 3QFBA 3KA7A 3KVEA 5BVAA 3NKSA 4U8IA 4CY6A 1H84A 4U2SA 2BS4A 1CF3A 4APNA 3DJJA 2X3NA 4YT0A 2BCPA 3GD3A 2GEWA 2VZ2A 3NN0X 4A6NB 1NAAA 2W0HA 3ZYXA 1M64A 2QAEA 4P9SA 2XVJA 3GDNA 1W4XA 1Z6LA 3AYJA 4XWZA 4C3YA 3LADA 4U8KA 1PDHA 2XFUA 3H8IA 1B4VA 3NT6A 4Z25A 4X9MA 1EL7A 1E1NA 3COXA 2BXRA 2RGJA 2DKHA 2WPCA 1PXAA 3LB8A 1OJCA 1QLBA 4BJZA 2XCGA 2C7GA 4BJYA 1B8SA 4EM4A 1BGJA 2WHDA 4TLZA 2XLRA 4YKFA 4B65A 4MJWA 3OZ2A 3GRTA 2B9WA 2CVJA 1XPQA 2R9ZA 2XLUA 1Y56A 4I59A 1CBOA 2R4EA 2YLSA 3C4NA 4U8LA 2V61A 4H4ZA 4K5RA 2AAQA 2FJEA 2GAHB 4IA5A 2APGA 3SM8A 4ICYA 1FL2A 2YAUA 2YR4A 3ABVA 5KWFA 1H6VA 4XXGA 1LTXR 5FS9A 4C74A 1SEZA 3CIRA 1OJ9A 3ATRA 2B7SA 3EF6A 4UP3A 1L0VA 4J36A 2XVIA 2OA1A 3C96A 3GYJA 2C73A 1ZMDA 2GVCA 3UKLA 1YKJA 4U8OA 5GRTA 3G5SA 2FJBA 3DJGX 3RP6A 4YSXA 2TMDA 3CNDA 4DSGA 3B3RA 4I58A 2VVLG 3VQRA 3LZXA 3FMWA 4NEVA 3URHA 2XLPA 2C76A 1DOCA 1VG9A 4GDEA 2ZZCA 3OC4A 3UTEA 4CCQA 2C75A 3IHGA 4Y4NA 3M13A 4UDPA 4Z24A 4H4UA 2JB3A 3ALLA 4HB9A 4N9XA 3RHAA 2R46A 3EANA 5M0ZA 3CNPA 2VRLA 2WP5A 1K4QA 3QJ4A 1LJ1A 1Q1RA 1PN0A 4BK1A 1GV4A 3UKFA 1H83A 2VOUA 3BI2A 1E39A 1NHSA 3PO7A 2BC0A 1YQZA 4OPTA 5KVIA 1PBDA 1Y0PA 4JY3A 4X9NA 5HHFA 4OPDA 1JEHA 2XVFA 3KPFA 3NK0X 4LU6A 4CBQA 1GOSA 1LQUA 1PBEA 3HZLA 1NG4A 4OPCA 4B66A 5KOWA 1PS9A 2Q6UA 4Z44A 4Z2UA 1DXLA 3NTAA 4CNJA 3CNSA 2WEUA 3G5QA 4H4TA 1F8RA 4H4YA 2VVMA 3NYCA 4LA1A 2AR8A 5GSNA 4Z2TA 1GEUA 1COYA 2C72A 1PJ5A 2C3DA 1NHQA 3VR9A 4D03A 1OJDA 2BYBA 3QVRA 2YVGA 1E1LA 4Y4LA 1VG0A 4WCTA 3K7TA 1NHPA 1YQ4A 4H50A 2BK4A 4ECHA 1L9CA 2X50A 2YG6A 3NYEA 1MO9A 2YR5A 1GRGA 1H86A 1PBFA 1TYPA 1QJDA 2VQ7A 2XVHA 3ICTA 2OLNA 2BK3A 1KNPA 2VQBA 4O5QA 4YTMA 2YG7A 2BA9A 4YTPA 1GETA 2C3CA 2OLOA 4J31A 1EL8A 3M0OA 4JN9A 2PYXA 1ONFA 1E6EA 2Q7VA 2JBVA 3VRDB 4YWOA 3REDA 3CPJG 3AE7A 3AEAA 4YSZA 3UKKA 3AEFA 2WP9A 2I0ZA 5DBJA 3EAOA 4CRTA 2GB0A 4B1BA 1PJ7A 3D8XA 3AE2A 4B69A 3NRNA 3ALMA 4NTDA 3UKHA 4FK1C 1VDCA 5KRQA 1MXTA 3AD9B 1FOHA 4RG3A 5JCMA 1IUXA 3UKQA 1X31B 2C64A 5TR3A 5BRTA 2A87A 4TM0A 3GSIA 2ACZA 2YLXA 4FK1A 2WPEA 5FS6A 1LV0A 4UDQA 3DK8A 3SFDA 3BI5A 2GAGB 1TDFA 1KF6A 4U2LA 4JQ9A 3SQPA 4H4WA 4BURA 3L8KA 3GDPA 2WU2A 2WS3A 2ZZ0A 1KSSA 3NLCA 4EMJA 1GRAA 1NHRA 2YLTA 3AWIA 5J60A 3K30A 5U25A 4TM3A 4HA6A 2YVFA 1GRBA 3NGCX 3AE1A 3UP5A 3F8RA 2OALA 1S2YA 3NIXA 4J34A 1IJHA 3AEBA 1GTHA 2XLTA 4GRTA 1N4WA 4NEWA 4OVIA 4JY2A 2BCGG 1QO8A 3NYFA 4KPRA 3GD4A 4RSLA 4GDPA 1B37A 4K2XA 1LPFA 4DGKA 3K7QX 1REOA 2ARDA 2H88A 4GUVA 4GF7A 4IV9A 3K7MX 1Q9IA 1D4EA 1XHCA 1GRFA 5JCKA 1L9EA 1Y56B
chains in the Genus database with same CATH superfamily
1GPEA 1FCDA 2E4GA 2QA1A 1S3EA 1IUSA 3H4KA 4DSHA 3C4AA 1OJTA 2FJAA 1H7XA 4CCRA 2Y6QA 2YG4A 3AE9A 3NN6X 2C70A 2R45A 3FG2P 4A9WA 3I6DA 3KU9A 3S5WA 4EIQA 3D1CA 2XFOA 4OCGA 4NTEA 4U8JA 5EB5A 4J57A 2YM1A 3UKAA 4B68A 3GMCA 1ZOYA 1TRBA 4NZHA 1M6IA 2YG5A 1DOEA 2X8HA 3GYIA 1ZX9A 1RYIA 3AE4A 5M10A 2RABA 1ZKQA 2CDUA 3NG7X 3DGHA 3NK1X 4KX6A 2WDVA 1UKVG 2GF3A 3ALJA 4H4RA 2RGOA 1JNRA 3T2ZA 2R4JA 4U2TA 4NWZA 2YLZA 5CKUA 1S3BA 1KNRA 1HYUA 1AOGA 1ZK7A 1GT8A 1IUTA 1S2QA 2Q0LA 3ICSA 4TLXA 1JRZA 5KOXA 2WBAA 3QSEA 3CGDA 4H4PA 1VQWA 2F5ZA 3NH3X 4AP1A 3Q6JA 3PVCA 4YXDA 2YLRA 2YVJA 1EBDA 5KXJA 3ISHA 2EQ8A 2C65A 4U8MA 2GR1A 1BF3A 1PBBA 3IF9A 1N1PA 2YM2A 3GWDA 1E7PA 5FMHA 5FS7A 1PHHA 1PXCA 3CN8A 2JKCA 5EOWA 2E5VA 1O95A 1CC2A 1ZMCA 3AE5A 5LV9A 4PAAA 1F6MA 2E1MA 2YWLA 4Z2RA 1BKWA 4EQSA 1CC4A 2YG3A 1GERA 4A5LA 3AYLA 3AEEA 3UOVA 5U1OA 2Y6RA 1BZLA 3UKPA 3R9UA 4BK3A 5L46A 2BACA 3CGBA 3GYXA 1K0IA 4H2QA 5IQ4A 2A8XA 2WQYA 3AE6A 1GALA 3ITJA 1FEBA 5U63A 4E0VA 1H7WA 1LQTA 2DKIA 5HYMA 1ZP0A 3EPTA 4OPIA 5BUKA 2JB1A 2XYOA 4GR1A 3I3LA 4U8NA 1GSNA 3AD8B 1TDOA 3B6DA 2EQ7A 4AOXA 3ICRA 4II2A 3E1TA 4BK2A 2XDOA 2BABA 3DMEA 3SZWA 2BXSA 5IQ1A 1KDGA 2Q0KA 4G6HA 2IIDA 3GWFA 1ZOVA 4H2NA 2QCUA 2TPRA 1NG3A 3T37A 1DJQA 1E1KA 3NTDA 4USRA 1ZDLA 4YSYA 5BULA 4FX9A 1CL0A 3VRAA 4IA6A 2VRMA 3GMBA 2RGHA 2WESA 2Z5YA 2QA2A 1CJ4A 3O0HA 3DGZA 5JCLA 2R0GA 1E1MA 1D4DA 2JAEA 3BHFA 3HYVA 1OJAA 4JDRA 1CJ2A 1TDKA 3KLJA 3T31A 4AT2A 4BV6A 1KFYA 3UOYA 1F8SA 4K7ZA 2B9YA 4H4SA 1GESA 4J2WA 3BHKA 1GRTA 2GRTA 5C3JA 4C77A 2BK5A 2V6OA 3BNMA 2V3AA 4K22A 2YQUA 2VVLA 4TM4A 3IWAA 3WE0A 3VR8A 5EB4A 3Q9TA 4ADWA 3CPHG 1CHUA 4GCMA 2IVDA 1D5TA 1IUWA 3AECA 3CGEA 1YQ3A 2YR6A 3CNJA 3L1RA 4IVMB 4CNKA 1V59A 2XFNA 2GMJA 5EBKA 2BS2A 3NK2X 2H89A 3S61A 2BC1A 4AOSA 1RP0A 3T0KA 3UOZA 3UTFA 5KMPA 2WOVA 3DH9A 4C5OA 3DA1A 4TM1A 2HQMA 2X8CA 3FBSA 2GR0A 4Z43A 2XFPA 2CULA 3AXBA 3M12A 2ZZBA 2EQ6A 3QSMA 1BWCA 1K0JA 4PABA 2B9XA 2B76A 2C67A 3AYIA 1JNZA 3GRSA 4H4XA 1TYTA 3BI4A 5CQFA 3SGLA 2OAMA 3T2YA 1PXBA 2GR2A 1GRHA 2JB2A 1GXFA 2C66A 2V3BA 3P4PA 2FBWA 1DNCA 2AQJA 4A65A 2ZBWA 3ATQA 4EMWA 1EL9A 4OPUA 4JNQA 2CFYA 4USQA 3G5RA 4AT0A 3AEGA 4NNJA 3UTGA 1CC6A 4ZCCA 5FS8A 3V3NA 2UZZA 1XDIA 2XLSA 3SZCA 2GQWA 4OPGA 1ELIA 5KMRA 1PBCA 4REKA 1JRYA 2WETA 3CTYA 3P4QA 3SX6A 1GREA 1DODA 3RP8A 1TDEA 3AE8A 4UDRA 4B67A 1F3PA 3LOVA 3V3OA 2X99A 4D04A 1DJNA 1NEKA 2X8GA 2V5ZA 4K5SA 2Z5XA 3UTHA 1P2HA 2WP6A 3P4RA 3II4A 3SY4A 1O94A 4K8DA 4EQRA 1CJCA 1TDNA 2XFQA 2PHHA 3AEDA 1JU2A 2GMHA 2R0CA 5IPYA 1JRXA 4EM3A 4X4JA 5HY5A 2V60A 2B7RA 5JCIA 1CJ3A 1IUVA 2EQ9A 3F8PA 4CY8A 3IC9A 4Z26A 5KVHA 4JNAA 2XVEA 3CNTA 3IHMA 3T14A 1F8WA 2BS3A 2GH5A 3BNUA 1NDAA 1NENA 5JCNA 3DJEA 4H7UA 4J33A 5ER0A 4YSHA 3P9UA 2NPXA 3H8LA 4B63A 3UOXA 4EMIA 1Q1WA 2FJDA 2NVKX 1B5QA 3DK4A 4EQWA 3DJDA 4NTCA 1H82A 1EL5A 4DNAA 2WPFA 3LJPA 4LIIA 4GAVA 3V76A 1GNDA 3DK9A 1PJ6A 1N4UA 2JK6A 3CPIG 3QVPA 3CGCA 2J3NA 3QSSA 4H4QA 3ZDNA 3P4SA 1D7YA 1IUUA 2WU5A 4H2RA 2GR3A 4G74A 5HXIA 1ZY8A 3PS9A 3SYIA 4A99A 4EIPA 2WDRA 4RG4A 5J7XA 1BGNA 4IVOB 3SFEA 1XANA 1D4CA 3FPZA 3KKJA 2WDQA 1LVLA 2A89A 3FIMB 1GTEA 3UCLA 1DOBA 4A79A 3AD7B 4XWRA 4Y4MA 3NNEA 2WOIA 2WOWA 4FDCB 1FEAA 4ZN0A 1N4VA 2IVEA 3KD9A 1YY5A 3AE3A 3LXDA 2R0PA 1K0LA 5C2TA 3AB1A 4A7AA 3JSKA 4M52A 4O5UA 1D7LA 4H2PA 4J56A 4ZCDA 3RP7A 3LZWA 3ADAB 3VRBA 1O5WA 4B64A 1JOAA 3QFAA 3NHOX 4YKGA 3KPKA 1VRQB 4OPLA 3RNMA 4YTNA 1H81A 1MOKA 3P1WA 4EQXA 2GV8A 2O9ZA 1NPXA 2GQFA 4H4VA 4AP3A 4C3XA 4WX1A 1L9DA 3UP4A 3F8DA 1FECA 1KSUA 4A6NA 2YLWA 4U8PA 1RSGA 1P2EA 3QFBA 3KA7A 3KVEA 5BVAA 3NKSA 4U8IA 4CY6A 1H84A 4U2SA 2BS4A 1CF3A 4APNA 3DJJA 2X3NA 4YT0A 3T2KA 2BCPA 3GD3A 2GEWA 2VZ2A 3NN0X 4A6NB 1NAAA 2W0HA 3ZYXA 1M64A 2QAEA 4P9SA 2XVJA 3GDNA 1W4XA 1Z6LA 3AYJA 4XWZA 4C3YA 3LADA 4U8KA 1PDHA 2XFUA 3H8IA 3SZFA 1B4VA 3NT6A 4Z25A 4X9MA 1EL7A 1E1NA 3COXA 2BXRA 2RGJA 2DKHA 2WPCA 1PXAA 3LB8A 1OJCA 1QLBA 4BJZA 2XCGA 2C7GA 4BJYA 1B8SA 4EM4A 1BGJA 2WHDA 4TLZA 2XLRA 4YKFA 4B65A 4MJWA 3OZ2A 3GRTA 2B9WA 2CVJA 1XPQA 2R9ZA 2XLUA 1Y56A 4I59A 1CBOA 2R4EA 2YLSA 3C4NA 3HYWA 4U8LA 5KMSA 2V61A 4H4ZA 4K5RA 2AAQA 2FJEA 2GAHB 4IA5A 2APGA 3SM8A 4ICYA 1FL2A 2YAUA 2YR4A 3ABVA 5KWFA 1H6VA 4XXGA 1LTXR 3CMMA 5FS9A 4C74A 1SEZA 3CIRA 1OJ9A 3ATRA 2B7SA 3EF6A 4UP3A 1L0VA 4J36A 2XVIA 2OA1A 3C96A 3GYJA 2C73A 1ZMDA 4G6GA 2GVCA 3UKLA 1YKJA 4U8OA 5GRTA 3G5SA 2FJBA 3DJGX 3RP6A 4YSXA 2TMDA 3CNDA 4DSGA 3B3RA 4I58A 2VVLG 3VQRA 3LZXA 3FMWA 4NEVA 3URHA 2XLPA 2C76A 1DOCA 1VG9A 4GDEA 5KNLA 2ZZCA 3OC4A 3UTEA 4CCQA 2C75A 3IHGA 4Y4NA 3M13A 3SXIA 4UDPA 4Z24A 5KMQA 4H4UA 2JB3A 3ALLA 4HB9A 4N9XA 3RHAA 2R46A 3EANA 5M0ZA 3CNPA 2VRLA 2WP5A 1K4QA 3QJ4A 1LJ1A 1Q1RA 1PN0A 4BK1A 1GV4A 2C4CA 3HYXA 1H83A 3UKFA 2VOUA 2BRAA 3BI2A 1E39A 1NHSA 3PO7A 2BC0A 1YQZA 4OPTA 5KVIA 1PBDA 1Y0PA 4JY3A 4X9NA 5HHFA 4OPDA 1JEHA 2XVFA 3KPFA 3NK0X 4LU6A 4CBQA 1GOSA 1LQUA 1PBEA 3HZLA 1NG4A 4OPCA 4B66A 5KOWA 1PS9A 2Q6UA 4Z44A 4Z2UA 1DXLA 3NTAA 4CNJA 3CNSA 2WEUA 3G5QA 4H4TA 1F8RA 4H4YA 2VVMA 3NYCA 4LA1A 2AR8A 5GSNA 4Z2TA 1GEUA 1COYA 2C72A 1PJ5A 2C3DA 1NHQA 3VR9A 4D03A 4G9KA 1OJDA 2BYBA 3QVRA 2YVGA 4GAPA 1E1LA 4Y4LA 1VG0A 4WCTA 3K7TA 1NHPA 1YQ4A 4H50A 2BK4A 4ECHA 1L9CA 2X50A 2YG6A 3NYEA 1MO9A 2YR5A 1GRGA 1H86A 1PBFA 1TYPA 1QJDA 2VQ7A 2XVHA 3ICTA 2OLNA 2BK3A 1KNPA 2VQBA 4O5QA 4YTMA 2YG7A 2BA9A 4YTPA 1GETA 2C3CA 2OLOA 4J31A 1EL8A 3M0OA 4JN9A 2PYXA 1ONFA 1E6EA 2Q7VA 2JBVA 3VRDB 4YWOA 3REDA 3CPJG 3AE7A 3AEAA 4YSZA 3UKKA 3AEFA 2WP9A 2I0ZA 5DBJA 3EAOA 4CRTA 2GB0A 4B1BA 1PJ7A 3D8XA 3AE2A 4B69A 4G73A 3NRNA 3ALMA 4NTDA 3UKHA 4FK1C 1VDCA 5KRQA 1MXTA 3AD9B 1FOHA 4RG3A 5JCMA 1IUXA 3UKQA 1X31B 2C64A 5TR3A 5BRTA 2A87A 4TM0A 3GSIA 2ACZA 2YLXA 4FK1A 2WPEA 5FS6A 1LV0A 4UDQA 3DK8A 3SFDA 3BI5A 2GAGB 1TDFA 1KF6A 4U2LA 4JQ9A 3SQPA 4H4WA 4BURA 3L8KA 3GDPA 2WU2A 2WS3A 3SZ0A 2ZZ0A 4II3A 1KSSA 2BRYA 3NLCA 4EMJA 1GRAA 1NHRA 2YLTA 3AWIA 5J60A 3K30A 5U25A 4TM3A 4HA6A 2YVFA 1GRBA 3NGCX 3AE1A 3UP5A 3F8RA 2OALA 1S2YA 3NIXA 4J34A 1IJHA 3AEBA 1GTHA 2XLTA 4GRTA 1N4WA 4NEWA 4OVIA 4JY2A 2BCGG 1QO8A 3NYFA 4KPRA 3GD4A 4RSLA 4GDPA 1B37A 4K2XA 1LPFA 4DGKA 3K7QX 1REOA 2ARDA 2H88A 4GUVA 4GF7A 4IV9A 3K7MX 1Q9IA 1D4EA 1XHCA 1GRFA 5JCKA 1L9EA 1Y56B
chains in the Genus database with same CATH topology
1GPEA 1FCDA 2E4GA 2QA1A 1S3EA 1IUSA 3H4KA 4DSHA 3C4AA 1OJTA 2FJAA 1H7XA 4CCRA 2Y6QA 2YG4A 3AE9A 3NN6X 2C70A 2R45A 3FG2P 4A9WA 3I6DA 3KU9A 3S5WA 4EIQA 3D1CA 2XFOA 4OCGA 4NTEA 4U8JA 5EB5A 4J57A 2YM1A 3UKAA 4B68A 3GMCA 1ZOYA 1TRBA 4NZHA 1M6IA 2YG5A 1DOEA 2X8HA 3GYIA 1ZX9A 1RYIA 3AE4A 5M10A 2RABA 1ZKQA 2CDUA 3NG7X 3DGHA 3NK1X 4KX6A 2WDVA 1UKVG 2GF3A 3ALJA 4H4RA 2RGOA 1JNRA 3T2ZA 2R4JA 4U2TA 4NWZA 2YLZA 5CKUA 1S3BA 1KNRA 1HYUA 1AOGA 1ZK7A 1GT8A 1IUTA 1S2QA 2Q0LA 3ICSA 4TLXA 1JRZA 5KOXA 2WBAA 3QSEA 3CGDA 4H4PA 1VQWA 2F5ZA 3NH3X 4AP1A 3Q6JA 3PVCA 4YXDA 2YLRA 2YVJA 1EBDA 5KXJA 3ISHA 2EQ8A 2C65A 4U8MA 2GR1A 1BF3A 1PBBA 3IF9A 1N1PA 2YM2A 3GWDA 1E7PA 5FMHA 5FS7A 1PHHA 1PXCA 3CN8A 2JKCA 5EOWA 2E5VA 1O95A 1CC2A 1ZMCA 3AE5A 5LV9A 4PAAA 1F6MA 2E1MA 2YWLA 4Z2RA 1BKWA 4EQSA 1CC4A 2YG3A 1GERA 4A5LA 3AYLA 3AEEA 3UOVA 5U1OA 2Y6RA 1BZLA 3UKPA 3R9UA 4BK3A 5L46A 2BACA 3CGBA 3GYXA 1K0IA 4H2QA 5IQ4A 2A8XA 2WQYA 3AE6A 1GALA 3ITJA 1FEBA 5U63A 4E0VA 1H7WA 1LQTA 2DKIA 5HYMA 1ZP0A 3EPTA 4OPIA 5BUKA 2JB1A 2XYOA 4GR1A 3I3LA 4U8NA 1GSNA 3AD8B 1TDOA 3B6DA 2EQ7A 4AOXA 3ICRA 4II2A 3E1TA 4BK2A 2XDOA 2BABA 3DMEA 3SZWA 2BXSA 5IQ1A 1KDGA 2Q0KA 4G6HA 2IIDA 3GWFA 1ZOVA 4H2NA 2QCUA 2TPRA 1NG3A 3T37A 1DJQA 1E1KA 3NTDA 4USRA 1ZDLA 4YSYA 5BULA 4FX9A 1CL0A 3VRAA 4IA6A 2VRMA 3GMBA 2RGHA 2WESA 2Z5YA 2QA2A 1CJ4A 3O0HA 3DGZA 5JCLA 2R0GA 1E1MA 1D4DA 2JAEA 3BHFA 3HYVA 1OJAA 4JDRA 1CJ2A 1TDKA 3KLJA 3T31A 4AT2A 4BV6A 1KFYA 3UOYA 1F8SA 4K7ZA 2B9YA 4H4SA 1GESA 4J2WA 3BHKA 1GRTA 2GRTA 5C3JA 4C77A 2BK5A 2V6OA 3BNMA 2V3AA 4K22A 2YQUA 2VVLA 4TM4A 3IWAA 3WE0A 3VR8A 5EB4A 3Q9TA 4ADWA 3CPHG 1CHUA 4GCMA 2IVDA 1D5TA 1IUWA 3AECA 3CGEA 1YQ3A 2YR6A 3CNJA 3L1RA 4IVMB 4CNKA 1V59A 2XFNA 2GMJA 5EBKA 2BS2A 3NK2X 2H89A 3S61A 2BC1A 4AOSA 1RP0A 3T0KA 3UOZA 3UTFA 5KMPA 2WOVA 3DH9A 4C5OA 3DA1A 4TM1A 2HQMA 2X8CA 3FBSA 2GR0A 4Z43A 2XFPA 2CULA 3AXBA 3M12A 2ZZBA 2EQ6A 3QSMA 1BWCA 1K0JA 4PABA 2B9XA 2B76A 2C67A 3AYIA 1JNZA 3GRSA 4H4XA 1TYTA 3BI4A 5CQFA 3SGLA 2OAMA 3T2YA 1PXBA 2GR2A 1GRHA 2JB2A 1GXFA 2C66A 2V3BA 3P4PA 2FBWA 1DNCA 2AQJA 4A65A 2ZBWA 3ATQA 4EMWA 1EL9A 4OPUA 4JNQA 2CFYA 4USQA 3G5RA 4AT0A 3AEGA 4NNJA 3UTGA 1CC6A 4ZCCA 5FS8A 3V3NA 2UZZA 1XDIA 2XLSA 3SZCA 2GQWA 4OPGA 1ELIA 5KMRA 1PBCA 4REKA 1JRYA 2WETA 3CTYA 3P4QA 3SX6A 1GREA 1DODA 3RP8A 1TDEA 3AE8A 4UDRA 4B67A 1F3PA 3LOVA 3V3OA 2X99A 4D04A 1DJNA 1NEKA 2X8GA 2V5ZA 4K5SA 2Z5XA 3UTHA 1P2HA 2WP6A 3P4RA 3II4A 3SY4A 1O94A 4K8DA 4EQRA 1CJCA 1TDNA 2XFQA 2PHHA 3AEDA 1JU2A 2GMHA 2R0CA 5IPYA 1JRXA 4EM3A 4X4JA 5HY5A 2V60A 2B7RA 5JCIA 1CJ3A 1IUVA 2EQ9A 3F8PA 4CY8A 3IC9A 4Z26A 5KVHA 4JNAA 2XVEA 3CNTA 3IHMA 3T14A 1F8WA 2BS3A 2GH5A 3BNUA 1NDAA 1NENA 5JCNA 3DJEA 4H7UA 4J33A 5ER0A 4YSHA 3P9UA 2NPXA 3H8LA 4B63A 3UOXA 4EMIA 1Q1WA 2FJDA 2NVKX 1B5QA 3DK4A 4EQWA 3DJDA 4NTCA 1H82A 1EL5A 4DNAA 2WPFA 3LJPA 4LIIA 4GAVA 3V76A 1GNDA 3DK9A 1PJ6A 1N4UA 2JK6A 3CPIG 3QVPA 3CGCA 2J3NA 3QSSA 4H4QA 3ZDNA 3P4SA 1D7YA 1IUUA 2WU5A 4H2RA 2GR3A 4G74A 5HXIA 1ZY8A 3PS9A 3SYIA 4A99A 4EIPA 2WDRA 4RG4A 5J7XA 1BGNA 4IVOB 3SFEA 1XANA 1D4CA 3FPZA 3KKJA 2WDQA 1LVLA 2A89A 3FIMB 1GTEA 3UCLA 1DOBA 4A79A 3AD7B 4XWRA 4Y4MA 3NNEA 2WOIA 2WOWA 4FDCB 1FEAA 4ZN0A 1N4VA 2IVEA 3KD9A 1YY5A 3AE3A 3LXDA 2R0PA 1K0LA 5C2TA 3AB1A 4A7AA 3JSKA 4M52A 4O5UA 1D7LA 4H2PA 4J56A 4ZCDA 3RP7A 3LZWA 3ADAB 3VRBA 1O5WA 4B64A 1JOAA 3QFAA 3NHOX 4YKGA 3KPKA 1VRQB 4OPLA 3RNMA 4YTNA 1H81A 1MOKA 3P1WA 4EQXA 2GV8A 2O9ZA 1NPXA 2GQFA 4H4VA 4AP3A 4C3XA 4WX1A 1L9DA 3UP4A 3F8DA 1FECA 1KSUA 4A6NA 2YLWA 4U8PA 1RSGA 1P2EA 3QFBA 3KA7A 3KVEA 5BVAA 3NKSA 4U8IA 4CY6A 1H84A 4U2SA 2BS4A 1CF3A 4APNA 3DJJA 2X3NA 4YT0A 3T2KA 2BCPA 3GD3A 2GEWA 2VZ2A 3NN0X 4A6NB 1NAAA 2W0HA 3ZYXA 1M64A 2QAEA 4P9SA 2XVJA 3GDNA 1W4XA 1Z6LA 3AYJA 4XWZA 4C3YA 3LADA 4U8KA 1PDHA 2XFUA 3H8IA 3SZFA 1B4VA 3NT6A 4Z25A 4X9MA 1EL7A 1E1NA 3COXA 2BXRA 2RGJA 2DKHA 2WPCA 1PXAA 3LB8A 1OJCA 1QLBA 4BJZA 2XCGA 2C7GA 4BJYA 1B8SA 4EM4A 1BGJA 2WHDA 4TLZA 2XLRA 4YKFA 4B65A 4MJWA 3OZ2A 3GRTA 2B9WA 2CVJA 1XPQA 2R9ZA 2XLUA 1Y56A 4I59A 1CBOA 2R4EA 2YLSA 3C4NA 3HYWA 4U8LA 5KMSA 2V61A 4H4ZA 4K5RA 2AAQA 2FJEA 2GAHB 4IA5A 2APGA 3SM8A 4ICYA 1FL2A 2YAUA 2YR4A 3ABVA 5KWFA 1H6VA 4XXGA 1LTXR 3CMMA 5FS9A 4C74A 1SEZA 3CIRA 1OJ9A 3ATRA 2B7SA 3EF6A 4UP3A 1L0VA 4J36A 2XVIA 2OA1A 3C96A 3GYJA 2C73A 1ZMDA 4G6GA 2GVCA 3UKLA 1YKJA 4U8OA 5GRTA 3G5SA 2FJBA 3DJGX 3RP6A 4YSXA 2TMDA 3CNDA 4DSGA 3B3RA 4I58A 2VVLG 3VQRA 3LZXA 3FMWA 4NEVA 3URHA 2XLPA 2C76A 1DOCA 1VG9A 4GDEA 5KNLA 2ZZCA 3OC4A 3UTEA 4CCQA 2C75A 3IHGA 4Y4NA 3M13A 3SXIA 4UDPA 4Z24A 5KMQA 4H4UA 2JB3A 3ALLA 4HB9A 4N9XA 3RHAA 2R46A 3EANA 5M0ZA 3CNPA 2VRLA 2WP5A 1K4QA 3QJ4A 1LJ1A 1Q1RA 1PN0A 4BK1A 1GV4A 2C4CA 3HYXA 1H83A 3UKFA 2VOUA 2BRAA 3BI2A 1E39A 1NHSA 3PO7A 2BC0A 1YQZA 4OPTA 5KVIA 1PBDA 1Y0PA 4JY3A 4X9NA 5HHFA 4OPDA 1JEHA 2XVFA 3KPFA 3NK0X 4LU6A 4CBQA 1GOSA 1LQUA 1PBEA 3HZLA 1NG4A 4OPCA 4B66A 5KOWA 1PS9A 2Q6UA 4Z44A 4Z2UA 1DXLA 3NTAA 4CNJA 3CNSA 2WEUA 3G5QA 4H4TA 1F8RA 4H4YA 2VVMA 3NYCA 4LA1A 2AR8A 5GSNA 4Z2TA 1GEUA 1COYA 2C72A 1PJ5A 2C3DA 1NHQA 3VR9A 4D03A 4G9KA 1OJDA 2BYBA 3QVRA 2YVGA 4GAPA 1E1LA 4Y4LA 1VG0A 4WCTA 3K7TA 1NHPA 1YQ4A 4H50A 2BK4A 4ECHA 1L9CA 2X50A 2YG6A 3NYEA 1MO9A 2YR5A 1GRGA 1H86A 1PBFA 1TYPA 1QJDA 2VQ7A 2XVHA 3ICTA 2OLNA 2BK3A 1KNPA 2VQBA 4O5QA 4YTMA 2YG7A 2BA9A 4YTPA 1GETA 2C3CA 2OLOA 4J31A 1EL8A 3M0OA 4JN9A 2PYXA 1ONFA 1E6EA 2Q7VA 2JBVA 3VRDB 4YWOA 3REDA 3CPJG 3AE7A 3AEAA 4YSZA 3UKKA 3AEFA 2WP9A 2I0ZA 5DBJA 3EAOA 4CRTA 2GB0A 4B1BA 1PJ7A 3D8XA 3AE2A 4B69A 4G73A 3NRNA 3ALMA 4NTDA 3UKHA 4FK1C 1VDCA 5KRQA 1MXTA 3AD9B 1FOHA 4RG3A 5JCMA 1IUXA 3UKQA 1X31B 2C64A 5TR3A 5BRTA 2A87A 4TM0A 3GSIA 2ACZA 2YLXA 4FK1A 2WPEA 5FS6A 1LV0A 4UDQA 3DK8A 3SFDA 3BI5A 2GAGB 1TDFA 1KF6A 4U2LA 4JQ9A 3SQPA 4H4WA 4BURA 3L8KA 3GDPA 2WU2A 2WS3A 3SZ0A 2ZZ0A 4II3A 1KSSA 2BRYA 3NLCA 4EMJA 1GRAA 1NHRA 2YLTA 3AWIA 5J60A 3K30A 5U25A 4TM3A 4HA6A 2YVFA 1GRBA 3NGCX 3AE1A 3UP5A 3F8RA 2OALA 1S2YA 3NIXA 4J34A 1IJHA 3AEBA 1GTHA 2XLTA 4GRTA 1N4WA 4NEWA 4OVIA 4JY2A 2BCGG 1QO8A 3NYFA 4KPRA 3GD4A 4RSLA 4GDPA 1B37A 4K2XA 1LPFA 4DGKA 3K7QX 1REOA 2ARDA 2H88A 4GUVA 4GF7A 4IV9A 3K7MX 1Q9IA 1D4EA 1XHCA 1GRFA 5JCKA 1L9EA 1Y56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPE A;  1FCD A;  2E4G A;  2QA1 A;  1S3E A;  1IUS A;  3H4K A;  4DSH A;  3C4A A;  1OJT A;  2FJA A;  1H7X A;  4CCR A;  2Y6Q A;  2YG4 A;  3AE9 A;  3NN6 X;  2C70 A;  2R45 A;  3FG2 P;  4A9W A;  3I6D A;  3KU9 A;  3S5W A;  4EIQ A;  3D1C A;  2XFO A;  4OCG A;  4NTE A;  4U8J A;  5EB5 A;  4J57 A;  2YM1 A;  3UKA A;  4B68 A;  3GMC A;  1ZOY A;  1TRB A;  4NZH A;  1M6I A;  2YG5 A;  1DOE A;  2X8H A;  3GYI A;  1ZX9 A;  1RYI A;  3AE4 A;  5M10 A;  2RAB A;  1ZKQ A;  2CDU A;  3NG7 X;  3DGH A;  3NK1 X;  4KX6 A;  2WDV A;  1UKV G;  2GF3 A;  3ALJ A;  4H4R A;  2RGO A;  1JNR A;  2R4J A;  4U2T A;  2YLZ A;  5CKU A;  1S3B A;  1KNR A;  1HYU A;  1AOG A;  1ZK7 A;  1GT8 A;  1IUT A;  1S2Q A;  2Q0L A;  3ICS A;  4TLX A;  1JRZ A;  5KOX A;  2WBA A;  3QSE A;  3CGD A;  4H4P A;  1VQW A;  2F5Z A;  3NH3 X;  4AP1 A;  3Q6J A;  3PVC A;  4YXD A;  2YLR A;  2YVJ A;  1EBD A;  5KXJ A;  3ISH A;  2EQ8 A;  2C65 A;  4U8M A;  2GR1 A;  1BF3 A;  1PBB A;  3IF9 A;  1N1P A;  2YM2 A;  3GWD A;  1E7P A;  5FMH A;  5FS7 A;  1PHH A;  1PXC A;  3CN8 A;  2JKC A;  5EOW A;  2E5V A;  1O95 A;  1CC2 A;  1ZMC A;  3AE5 A;  5LV9 A;  4PAA A;  1F6M A;  2E1M A;  2YWL A;  4Z2R A;  1BKW A;  4EQS A;  1CC4 A;  2YG3 A;  1GER A;  4A5L A;  3AYL A;  3AEE A;  3UOV A;  5U1O A;  2Y6R A;  1BZL A;  3UKP A;  3R9U A;  4BK3 A;  5L46 A;  2BAC A;  3CGB A;  5IQ4 A;  1K0I A;  4H2Q A;  2A8X A;  2WQY A;  3AE6 A;  1GAL A;  3ITJ A;  1FEB A;  5U63 A;  4E0V A;  1H7W A;  1LQT A;  2DKI A;  5HYM A;  1ZP0 A;  3EPT A;  4OPI A;  5BUK A;  2JB1 A;  2XYO A;  4GR1 A;  3I3L A;  4U8N A;  1GSN A;  3AD8 B;  1TDO A;  3B6D A;  2EQ7 A;  4AOX A;  3ICR A;  3E1T A;  4BK2 A;  2XDO A;  2BAB A;  3DME A;  2BXS A;  5IQ1 A;  1KDG A;  2Q0K A;  2IID A;  3GWF A;  1ZOV A;  4H2N A;  2QCU A;  2TPR A;  1NG3 A;  3T37 A;  1DJQ A;  1E1K A;  3NTD A;  4USR A;  1ZDL A;  4YSY A;  5BUL A;  4FX9 A;  1CL0 A;  3VRA A;  4IA6 A;  2VRM A;  3GMB A;  2RGH A;  2WES A;  2Z5Y A;  2QA2 A;  1CJ4 A;  3O0H A;  3DGZ A;  5JCL A;  2R0G A;  1E1M A;  1D4D A;  2JAE A;  3BHF A;  4JDR A;  1OJA A;  4AT2 A;  1CJ2 A;  1TDK A;  3KLJ A;  4BV6 A;  1KFY A;  3UOY A;  1F8S A;  4K7Z A;  2B9Y A;  4H4S A;  1GES A;  4J2W A;  3BHK A;  1GRT A;  2GRT A;  5C3J A;  4C77 A;  2BK5 A;  2V6O A;  3BNM A;  2V3A A;  4K22 A;  2YQU A;  2VVL A;  4TM4 A;  3IWA A;  3WE0 A;  3VR8 A;  5EB4 A;  3Q9T A;  4ADW A;  3CPH G;  1CHU A;  4GCM A;  2IVD A;  1D5T A;  1IUW A;  3AEC A;  3CGE A;  1YQ3 A;  2YR6 A;  3CNJ A;  3L1R A;  4IVM B;  4CNK A;  1V59 A;  2XFN A;  2GMJ A;  5EBK A;  2BS2 A;  3NK2 X;  2H89 A;  3S61 A;  2BC1 A;  4AOS A;  1RP0 A;  3UOZ A;  3UTF A;  2WOV A;  3DH9 A;  4C5O A;  3DA1 A;  4TM1 A;  2HQM A;  2X8C A;  3FBS A;  2GR0 A;  4Z43 A;  2XFP A;  2CUL A;  3AXB A;  3M12 A;  2ZZB A;  2EQ6 A;  3QSM A;  1BWC A;  1K0J A;  4PAB A;  2B9X A;  2B76 A;  2C67 A;  3AYI A;  1JNZ A;  3GRS A;  4H4X A;  1TYT A;  3BI4 A;  5CQF A;  3SGL A;  2OAM A;  1PXB A;  2GR2 A;  1GRH A;  2JB2 A;  1GXF A;  2C66 A;  2V3B A;  3P4P A;  2FBW A;  1DNC A;  2AQJ A;  4A65 A;  2ZBW A;  3ATQ A;  4EMW A;  1EL9 A;  4OPU A;  4JNQ A;  2CFY A;  4USQ A;  3G5R A;  4AT0 A;  3AEG A;  3UTG A;  1CC6 A;  4ZCC A;  5FS8 A;  3V3N A;  2UZZ A;  1XDI A;  2XLS A;  2GQW A;  4OPG A;  1ELI A;  1PBC A;  4REK A;  1JRY A;  2WET A;  3CTY A;  3P4Q A;  1GRE A;  1DOD A;  3RP8 A;  1TDE A;  3AE8 A;  4UDR A;  4B67 A;  1F3P A;  3LOV A;  3V3O A;  2X99 A;  4D04 A;  1DJN A;  1NEK A;  2X8G A;  2V5Z A;  4K5S A;  2Z5X A;  3UTH A;  1P2H A;  2WP6 A;  3P4R A;  3II4 A;  1O94 A;  4K8D A;  4EQR A;  1CJC A;  1TDN A;  2XFQ A;  2PHH A;  3AED A;  1JU2 A;  2GMH A;  2R0C A;  5IPY A;  1JRX A;  4EM3 A;  4X4J A;  5HY5 A;  2V60 A;  2B7R A;  5JCI A;  1CJ3 A;  1IUV A;  2EQ9 A;  3F8P A;  4CY8 A;  3IC9 A;  4Z26 A;  5KVH A;  4JNA A;  2XVE A;  3CNT A;  3IHM A;  1F8W A;  2BS3 A;  2GH5 A;  3BNU A;  1NDA A;  1NEN A;  5JCN A;  3DJE A;  4H7U A;  4J33 A;  5ER0 A;  4YSH A;  3P9U A;  2NPX A;  3H8L A;  4B63 A;  3UOX A;  4EMI A;  1Q1W A;  2FJD A;  2NVK X;  1B5Q A;  3DK4 A;  4EQW A;  3DJD A;  4NTC A;  1H82 A;  1EL5 A;  4DNA A;  2WPF A;  3LJP A;  4LII A;  3V76 A;  1GND A;  3DK9 A;  1PJ6 A;  1N4U A;  2JK6 A;  3CPI G;  3QVP A;  3CGC A;  2J3N A;  3QSS A;  4H4Q A;  3ZDN A;  3P4S A;  1D7Y A;  1IUU A;  2WU5 A;  4H2R A;  2GR3 A;  5HXI A;  1ZY8 A;  3PS9 A;  4A99 A;  4EIP A;  2WDR A;  4RG4 A;  5J7X A;  1BGN A;  4IVO B;  3SFE A;  1XAN A;  1D4C A;  3FPZ A;  3KKJ A;  2WDQ A;  1LVL A;  2A89 A;  3FIM B;  1GTE A;  3UCL A;  1DOB A;  4A79 A;  3AD7 B;  4XWR A;  4Y4M A;  3NNE A;  2WOI A;  2WOW A;  4FDC B;  1FEA A;  4ZN0 A;  1N4V A;  2IVE A;  3KD9 A;  1YY5 A;  3AE3 A;  3LXD A;  2R0P A;  1K0L A;  5C2T A;  3AB1 A;  4A7A A;  3JSK A;  4M52 A;  4O5U A;  1D7L A;  4H2P A;  4J56 A;  4ZCD A;  3RP7 A;  3LZW A;  3ADA B;  3VRB A;  1O5W A;  4B64 A;  1JOA A;  3QFA A;  3NHO X;  4YKG A;  1VRQ B;  4OPL A;  3RNM A;  4YTN A;  1H81 A;  1MOK A;  3P1W A;  4EQX A;  2GV8 A;  2O9Z A;  1NPX A;  2GQF A;  4H4V A;  4AP3 A;  4C3X A;  4WX1 A;  1L9D A;  3UP4 A;  3F8D A;  1FEC A;  1KSU A;  4A6N A;  2YLW A;  4U8P A;  1RSG A;  1P2E A;  3QFB A;  3KA7 A;  3KVE A;  5BVA A;  3NKS A;  4U8I A;  4CY6 A;  1H84 A;  4U2S A;  2BS4 A;  1CF3 A;  4APN A;  3DJJ A;  2X3N A;  4YT0 A;  2BCP A;  3GD3 A;  2GEW A;  2VZ2 A;  3NN0 X;  4A6N B;  1NAA A;  2W0H A;  3ZYX A;  1M64 A;  2QAE A;  4P9S A;  2XVJ A;  3GDN A;  1W4X A;  1Z6L A;  3AYJ A;  4XWZ A;  4C3Y A;  3LAD A;  4U8K A;  1PDH A;  2XFU A;  3H8I A;  1B4V A;  3NT6 A;  4Z25 A;  4X9M A;  1EL7 A;  1E1N A;  3COX A;  2BXR A;  2RGJ A;  2DKH A;  2WPC A;  1PXA A;  3LB8 A;  1OJC A;  1QLB A;  4BJZ A;  2XCG A;  2C7G A;  4BJY A;  1B8S A;  4EM4 A;  1BGJ A;  2WHD A;  4TLZ A;  2XLR A;  4YKF A;  4B65 A;  4MJW A;  3OZ2 A;  3GRT A;  2B9W A;  2CVJ A;  1XPQ A;  2R9Z A;  2XLU A;  1Y56 A;  4I59 A;  1CBO A;  2R4E A;  2YLS A;  3C4N A;  4U8L A;  2V61 A;  4H4Z A;  4K5R A;  2AAQ A;  2FJE A;  2GAH B;  4IA5 A;  2APG A;  3SM8 A;  4ICY A;  1FL2 A;  2YAU A;  2YR4 A;  3ABV A;  5KWF A;  1H6V A;  4XXG A;  1LTX R;  5FS9 A;  4C74 A;  1SEZ A;  3CIR A;  1OJ9 A;  3ATR A;  2B7S A;  3EF6 A;  4UP3 A;  1L0V A;  4J36 A;  2XVI A;  2OA1 A;  3C96 A;  3GYJ A;  2C73 A;  1ZMD A;  2GVC A;  3UKL A;  1YKJ A;  4U8O A;  5GRT A;  3G5S A;  2FJB A;  3DJG X;  3RP6 A;  4YSX A;  2TMD A;  3CND A;  4DSG A;  3B3R A;  4I58 A;  2VVL G;  3VQR A;  3LZX A;  3FMW A;  4NEV A;  3URH A;  2XLP A;  2C76 A;  1DOC A;  1VG9 A;  4GDE A;  2ZZC A;  3OC4 A;  3UTE A;  4CCQ A;  2C75 A;  3IHG A;  4Y4N A;  3M13 A;  4UDP A;  4Z24 A;  4H4U A;  2JB3 A;  3ALL A;  4HB9 A;  4N9X A;  3RHA A;  2R46 A;  3EAN A;  5M0Z A;  3CNP A;  2VRL A;  2WP5 A;  1K4Q A;  3QJ4 A;  1LJ1 A;  1Q1R A;  1PN0 A;  4BK1 A;  1GV4 A;  3UKF A;  1H83 A;  2VOU A;  3BI2 A;  1E39 A;  1NHS A;  3PO7 A;  2BC0 A;  1YQZ A;  4OPT A;  5KVI A;  1PBD A;  1Y0P A;  4JY3 A;  4X9N A;  5HHF A;  4OPD A;  1JEH A;  2XVF A;  3KPF A;  3NK0 X;  4LU6 A;  4CBQ A;  1GOS A;  1LQU A;  1PBE A;  3HZL A;  1NG4 A;  4OPC A;  4B66 A;  5KOW A;  1PS9 A;  2Q6U A;  4Z44 A;  4Z2U A;  1DXL A;  3NTA A;  4CNJ A;  3CNS A;  2WEU A;  3G5Q A;  4H4T A;  1F8R A;  4H4Y A;  2VVM A;  3NYC A;  4LA1 A;  2AR8 A;  5GSN A;  4Z2T A;  1GEU A;  1COY A;  2C72 A;  1PJ5 A;  2C3D A;  1NHQ A;  3VR9 A;  4D03 A;  1OJD A;  2BYB A;  3QVR A;  2YVG A;  1E1L A;  4Y4L A;  1VG0 A;  4WCT A;  3K7T A;  1NHP A;  1YQ4 A;  4H50 A;  2BK4 A;  4ECH A;  1L9C A;  2X50 A;  2YG6 A;  3NYE A;  1MO9 A;  2YR5 A;  1GRG A;  1H86 A;  1PBF A;  1TYP A;  1QJD A;  2VQ7 A;  2XVH A;  3ICT A;  2OLN A;  2BK3 A;  1KNP A;  2VQB A;  4O5Q A;  4YTM A;  2YG7 A;  2BA9 A;  4YTP A;  1GET A;  2C3C A;  2OLO A;  4J31 A;  1EL8 A;  3M0O A;  4JN9 A;  2PYX A;  1ONF A;  1E6E A;  2Q7V A;  2JBV A;  3VRD B;  4YWO A;  3RED A;  3CPJ G;  3AE7 A;  3AEA A;  4YSZ A;  3UKK A;  3AEF A;  2WP9 A;  2I0Z A;  5DBJ A;  3EAO A;  4CRT A;  2GB0 A;  4B1B A;  1PJ7 A;  3D8X A;  3AE2 A;  4B69 A;  3NRN A;  3ALM A;  4NTD A;  3UKH A;  4FK1 C;  1VDC A;  5KRQ A;  1MXT A;  3AD9 B;  1FOH A;  4RG3 A;  5JCM A;  1IUX A;  3UKQ A;  1X31 B;  2C64 A;  5TR3 A;  5BRT A;  2A87 A;  4TM0 A;  3GSI A;  2ACZ A;  2YLX A;  4FK1 A;  2WPE A;  5FS6 A;  1LV0 A;  4UDQ A;  3DK8 A;  3SFD A;  3BI5 A;  2GAG B;  1TDF A;  1KF6 A;  4U2L A;  4JQ9 A;  3SQP A;  4H4W A;  4BUR A;  3L8K A;  3GDP A;  2WU2 A;  2WS3 A;  2ZZ0 A;  1KSS A;  3NLC A;  4EMJ A;  1GRA A;  1NHR A;  2YLT A;  3AWI A;  5J60 A;  3K30 A;  5U25 A;  4TM3 A;  4HA6 A;  2YVF A;  1GRB A;  3NGC X;  3AE1 A;  3UP5 A;  3F8R A;  2OAL A;  1S2Y A;  3NIX A;  4J34 A;  1IJH A;  3AEB A;  1GTH A;  2XLT A;  4GRT A;  1N4W A;  4NEW A;  4OVI A;  4JY2 A;  2BCG G;  1QO8 A;  3NYF A;  4KPR A;  3GD4 A;  4RSL A;  4GDP A;  1B37 A;  4K2X A;  1LPF A;  4DGK A;  3K7Q X;  1REO A;  2ARD A;  2H88 A;  4GUV A;  4GF7 A;  4IV9 A;  3K7M X;  1Q9I A;  1D4E A;  1XHC A;  1GRF A;  5JCK A;  1L9E A;  1Y56 B; 
#chains in the Genus database with same CATH topology
 1GPE A;  1FCD A;  2E4G A;  2QA1 A;  1S3E A;  1IUS A;  3H4K A;  4DSH A;  3C4A A;  1OJT A;  2FJA A;  1H7X A;  4CCR A;  2Y6Q A;  2YG4 A;  3AE9 A;  3NN6 X;  2C70 A;  2R45 A;  3FG2 P;  4A9W A;  3I6D A;  3KU9 A;  3S5W A;  4EIQ A;  3D1C A;  2XFO A;  4OCG A;  4NTE A;  4U8J A;  5EB5 A;  4J57 A;  2YM1 A;  3UKA A;  4B68 A;  3GMC A;  1ZOY A;  1TRB A;  4NZH A;  1M6I A;  2YG5 A;  1DOE A;  2X8H A;  3GYI A;  1ZX9 A;  1RYI A;  3AE4 A;  5M10 A;  2RAB A;  1ZKQ A;  2CDU A;  3NG7 X;  3DGH A;  3NK1 X;  4KX6 A;  2WDV A;  1UKV G;  2GF3 A;  3ALJ A;  4H4R A;  2RGO A;  1JNR A;  3T2Z A;  2R4J A;  4U2T A;  4NWZ A;  2YLZ A;  5CKU A;  1S3B A;  1KNR A;  1HYU A;  1AOG A;  1ZK7 A;  1GT8 A;  1IUT A;  1S2Q A;  2Q0L A;  3ICS A;  4TLX A;  1JRZ A;  5KOX A;  2WBA A;  3QSE A;  3CGD A;  4H4P A;  1VQW A;  2F5Z A;  3NH3 X;  4AP1 A;  3Q6J A;  3PVC A;  4YXD A;  2YLR A;  2YVJ A;  1EBD A;  5KXJ A;  3ISH A;  2EQ8 A;  2C65 A;  4U8M A;  2GR1 A;  1BF3 A;  1PBB A;  3IF9 A;  1N1P A;  2YM2 A;  3GWD A;  1E7P A;  5FMH A;  5FS7 A;  1PHH A;  1PXC A;  3CN8 A;  2JKC A;  5EOW A;  2E5V A;  1O95 A;  1CC2 A;  1ZMC A;  3AE5 A;  5LV9 A;  4PAA A;  1F6M A;  2E1M A;  2YWL A;  4Z2R A;  1BKW A;  4EQS A;  1CC4 A;  2YG3 A;  1GER A;  4A5L A;  3AYL A;  3AEE A;  3UOV A;  5U1O A;  2Y6R A;  1BZL A;  3UKP A;  3R9U A;  4BK3 A;  5L46 A;  2BAC A;  3CGB A;  3GYX A;  1K0I A;  4H2Q A;  5IQ4 A;  2A8X A;  2WQY A;  3AE6 A;  1GAL A;  3ITJ A;  1FEB A;  5U63 A;  4E0V A;  1H7W A;  1LQT A;  2DKI A;  5HYM A;  1ZP0 A;  3EPT A;  4OPI A;  5BUK A;  2JB1 A;  2XYO A;  4GR1 A;  3I3L A;  4U8N A;  1GSN A;  3AD8 B;  1TDO A;  3B6D A;  2EQ7 A;  4AOX A;  3ICR A;  4II2 A;  3E1T A;  4BK2 A;  2XDO A;  2BAB A;  3DME A;  3SZW A;  2BXS A;  5IQ1 A;  1KDG A;  2Q0K A;  4G6H A;  2IID A;  3GWF A;  1ZOV A;  4H2N A;  2QCU A;  2TPR A;  1NG3 A;  3T37 A;  1DJQ A;  1E1K A;  3NTD A;  4USR A;  1ZDL A;  4YSY A;  5BUL A;  4FX9 A;  1CL0 A;  3VRA A;  4IA6 A;  2VRM A;  3GMB A;  2RGH A;  2WES A;  2Z5Y A;  2QA2 A;  1CJ4 A;  3O0H A;  3DGZ A;  5JCL A;  2R0G A;  1E1M A;  1D4D A;  2JAE A;  3BHF A;  3HYV A;  1OJA A;  4JDR A;  1CJ2 A;  1TDK A;  3KLJ A;  3T31 A;  4AT2 A;  4BV6 A;  1KFY A;  3UOY A;  1F8S A;  4K7Z A;  2B9Y A;  4H4S A;  1GES A;  4J2W A;  3BHK A;  1GRT A;  2GRT A;  5C3J A;  4C77 A;  2BK5 A;  2V6O A;  3BNM A;  2V3A A;  4K22 A;  2YQU A;  2VVL A;  4TM4 A;  3IWA A;  3WE0 A;  3VR8 A;  5EB4 A;  3Q9T A;  4ADW A;  3CPH G;  1CHU A;  4GCM A;  2IVD A;  1D5T A;  1IUW A;  3AEC A;  3CGE A;  1YQ3 A;  2YR6 A;  3CNJ A;  3L1R A;  4IVM B;  4CNK A;  1V59 A;  2XFN A;  2GMJ A;  5EBK A;  2BS2 A;  3NK2 X;  2H89 A;  3S61 A;  2BC1 A;  4AOS A;  1RP0 A;  3T0K A;  3UOZ A;  3UTF A;  5KMP A;  2WOV A;  3DH9 A;  4C5O A;  3DA1 A;  4TM1 A;  2HQM A;  2X8C A;  3FBS A;  2GR0 A;  4Z43 A;  2XFP A;  2CUL A;  3AXB A;  3M12 A;  2ZZB A;  2EQ6 A;  3QSM A;  1BWC A;  1K0J A;  4PAB A;  2B9X A;  2B76 A;  2C67 A;  3AYI A;  1JNZ A;  3GRS A;  4H4X A;  1TYT A;  3BI4 A;  5CQF A;  3SGL A;  2OAM A;  3T2Y A;  1PXB A;  2GR2 A;  1GRH A;  2JB2 A;  1GXF A;  2C66 A;  2V3B A;  3P4P A;  2FBW A;  1DNC A;  2AQJ A;  4A65 A;  2ZBW A;  3ATQ A;  4EMW A;  1EL9 A;  4OPU A;  4JNQ A;  2CFY A;  4USQ A;  3G5R A;  4AT0 A;  3AEG A;  4NNJ A;  3UTG A;  1CC6 A;  4ZCC A;  5FS8 A;  3V3N A;  2UZZ A;  1XDI A;  2XLS A;  3SZC A;  2GQW A;  4OPG A;  1ELI A;  5KMR A;  1PBC A;  4REK A;  1JRY A;  2WET A;  3CTY A;  3P4Q A;  3SX6 A;  1GRE A;  1DOD A;  3RP8 A;  1TDE A;  3AE8 A;  4UDR A;  4B67 A;  1F3P A;  3LOV A;  3V3O A;  2X99 A;  4D04 A;  1DJN A;  1NEK A;  2X8G A;  2V5Z A;  4K5S A;  2Z5X A;  3UTH A;  1P2H A;  2WP6 A;  3P4R A;  3II4 A;  3SY4 A;  1O94 A;  4K8D A;  4EQR A;  1CJC A;  1TDN A;  2XFQ A;  2PHH A;  3AED A;  1JU2 A;  2GMH A;  2R0C A;  5IPY A;  1JRX A;  4EM3 A;  4X4J A;  5HY5 A;  2V60 A;  2B7R A;  5JCI A;  1CJ3 A;  1IUV A;  2EQ9 A;  3F8P A;  4CY8 A;  3IC9 A;  4Z26 A;  5KVH A;  4JNA A;  2XVE A;  3CNT A;  3IHM A;  3T14 A;  1F8W A;  2BS3 A;  2GH5 A;  3BNU A;  1NDA A;  1NEN A;  5JCN A;  3DJE A;  4H7U A;  4J33 A;  5ER0 A;  4YSH A;  3P9U A;  2NPX A;  3H8L A;  4B63 A;  3UOX A;  4EMI A;  1Q1W A;  2FJD A;  2NVK X;  1B5Q A;  3DK4 A;  4EQW A;  3DJD A;  4NTC A;  1H82 A;  1EL5 A;  4DNA A;  2WPF A;  3LJP A;  4LII A;  4GAV A;  3V76 A;  1GND A;  3DK9 A;  1PJ6 A;  1N4U A;  2JK6 A;  3CPI G;  3QVP A;  3CGC A;  2J3N A;  3QSS A;  4H4Q A;  3ZDN A;  3P4S A;  1D7Y A;  1IUU A;  2WU5 A;  4H2R A;  2GR3 A;  4G74 A;  5HXI A;  1ZY8 A;  3PS9 A;  3SYI A;  4A99 A;  4EIP A;  2WDR A;  4RG4 A;  5J7X A;  1BGN A;  4IVO B;  3SFE A;  1XAN A;  1D4C A;  3FPZ A;  3KKJ A;  2WDQ A;  1LVL A;  2A89 A;  3FIM B;  1GTE A;  3UCL A;  1DOB A;  4A79 A;  3AD7 B;  4XWR A;  4Y4M A;  3NNE A;  2WOI A;  2WOW A;  4FDC B;  1FEA A;  4ZN0 A;  1N4V A;  2IVE A;  3KD9 A;  1YY5 A;  3AE3 A;  3LXD A;  2R0P A;  1K0L A;  5C2T A;  3AB1 A;  4A7A A;  3JSK A;  4M52 A;  4O5U A;  1D7L A;  4H2P A;  4J56 A;  4ZCD A;  3RP7 A;  3LZW A;  3ADA B;  3VRB A;  1O5W A;  4B64 A;  1JOA A;  3QFA A;  3NHO X;  4YKG A;  3KPK A;  1VRQ B;  4OPL A;  3RNM A;  4YTN A;  1H81 A;  1MOK A;  3P1W A;  4EQX A;  2GV8 A;  2O9Z A;  1NPX A;  2GQF A;  4H4V A;  4AP3 A;  4C3X A;  4WX1 A;  1L9D A;  3UP4 A;  3F8D A;  1FEC A;  1KSU A;  4A6N A;  2YLW A;  4U8P A;  1RSG A;  1P2E A;  3QFB A;  3KA7 A;  3KVE A;  5BVA A;  3NKS A;  4U8I A;  4CY6 A;  1H84 A;  4U2S A;  2BS4 A;  1CF3 A;  4APN A;  3DJJ A;  2X3N A;  4YT0 A;  3T2K A;  2BCP A;  3GD3 A;  2GEW A;  2VZ2 A;  3NN0 X;  4A6N B;  1NAA A;  2W0H A;  3ZYX A;  1M64 A;  2QAE A;  4P9S A;  2XVJ A;  3GDN A;  1W4X A;  1Z6L A;  3AYJ A;  4XWZ A;  4C3Y A;  3LAD A;  4U8K A;  1PDH A;  2XFU A;  3H8I A;  3SZF A;  1B4V A;  3NT6 A;  4Z25 A;  4X9M A;  1EL7 A;  1E1N A;  3COX A;  2BXR A;  2RGJ A;  2DKH A;  2WPC A;  1PXA A;  3LB8 A;  1OJC A;  1QLB A;  4BJZ A;  2XCG A;  2C7G A;  4BJY A;  1B8S A;  4EM4 A;  1BGJ A;  2WHD A;  4TLZ A;  2XLR A;  4YKF A;  4B65 A;  4MJW A;  3OZ2 A;  3GRT A;  2B9W A;  2CVJ A;  1XPQ A;  2R9Z A;  2XLU A;  1Y56 A;  4I59 A;  1CBO A;  2R4E A;  2YLS A;  3C4N A;  3HYW A;  4U8L A;  5KMS A;  2V61 A;  4H4Z A;  4K5R A;  2AAQ A;  2FJE A;  2GAH B;  4IA5 A;  2APG A;  3SM8 A;  4ICY A;  1FL2 A;  2YAU A;  2YR4 A;  3ABV A;  5KWF A;  1H6V A;  4XXG A;  1LTX R;  3CMM A;  5FS9 A;  4C74 A;  1SEZ A;  3CIR A;  1OJ9 A;  3ATR A;  2B7S A;  3EF6 A;  4UP3 A;  1L0V A;  4J36 A;  2XVI A;  2OA1 A;  3C96 A;  3GYJ A;  2C73 A;  1ZMD A;  4G6G A;  2GVC A;  3UKL A;  1YKJ A;  4U8O A;  5GRT A;  3G5S A;  2FJB A;  3DJG X;  3RP6 A;  4YSX A;  2TMD A;  3CND A;  4DSG A;  3B3R A;  4I58 A;  2VVL G;  3VQR A;  3LZX A;  3FMW A;  4NEV A;  3URH A;  2XLP A;  2C76 A;  1DOC A;  1VG9 A;  4GDE A;  5KNL A;  2ZZC A;  3OC4 A;  3UTE A;  4CCQ A;  2C75 A;  3IHG A;  4Y4N A;  3M13 A;  3SXI A;  4UDP A;  4Z24 A;  5KMQ A;  4H4U A;  2JB3 A;  3ALL A;  4HB9 A;  4N9X A;  3RHA A;  2R46 A;  3EAN A;  5M0Z A;  3CNP A;  2VRL A;  2WP5 A;  1K4Q A;  3QJ4 A;  1LJ1 A;  1Q1R A;  1PN0 A;  4BK1 A;  1GV4 A;  2C4C A;  3HYX A;  1H83 A;  3UKF A;  2VOU A;  2BRA A;  3BI2 A;  1E39 A;  1NHS A;  3PO7 A;  2BC0 A;  1YQZ A;  4OPT A;  5KVI A;  1PBD A;  1Y0P A;  4JY3 A;  4X9N A;  5HHF A;  4OPD A;  1JEH A;  2XVF A;  3KPF A;  3NK0 X;  4LU6 A;  4CBQ A;  1GOS A;  1LQU A;  1PBE A;  3HZL A;  1NG4 A;  4OPC A;  4B66 A;  5KOW A;  1PS9 A;  2Q6U A;  4Z44 A;  4Z2U A;  1DXL A;  3NTA A;  4CNJ A;  3CNS A;  2WEU A;  3G5Q A;  4H4T A;  1F8R A;  4H4Y A;  2VVM A;  3NYC A;  4LA1 A;  2AR8 A;  5GSN A;  4Z2T A;  1GEU A;  1COY A;  2C72 A;  1PJ5 A;  2C3D A;  1NHQ A;  3VR9 A;  4D03 A;  4G9K A;  1OJD A;  2BYB A;  3QVR A;  2YVG A;  4GAP A;  1E1L A;  4Y4L A;  1VG0 A;  4WCT A;  3K7T A;  1NHP A;  1YQ4 A;  4H50 A;  2BK4 A;  4ECH A;  1L9C A;  2X50 A;  2YG6 A;  3NYE A;  1MO9 A;  2YR5 A;  1GRG A;  1H86 A;  1PBF A;  1TYP A;  1QJD A;  2VQ7 A;  2XVH A;  3ICT A;  2OLN A;  2BK3 A;  1KNP A;  2VQB A;  4O5Q A;  4YTM A;  2YG7 A;  2BA9 A;  4YTP A;  1GET A;  2C3C A;  2OLO A;  4J31 A;  1EL8 A;  3M0O A;  4JN9 A;  2PYX A;  1ONF A;  1E6E A;  2Q7V A;  2JBV A;  3VRD B;  4YWO A;  3RED A;  3CPJ G;  3AE7 A;  3AEA A;  4YSZ A;  3UKK A;  3AEF A;  2WP9 A;  2I0Z A;  5DBJ A;  3EAO A;  4CRT A;  2GB0 A;  4B1B A;  1PJ7 A;  3D8X A;  3AE2 A;  4B69 A;  4G73 A;  3NRN A;  3ALM A;  4NTD A;  3UKH A;  4FK1 C;  1VDC A;  5KRQ A;  1MXT A;  3AD9 B;  1FOH A;  4RG3 A;  5JCM A;  1IUX A;  3UKQ A;  1X31 B;  2C64 A;  5TR3 A;  5BRT A;  2A87 A;  4TM0 A;  3GSI A;  2ACZ A;  2YLX A;  4FK1 A;  2WPE A;  5FS6 A;  1LV0 A;  4UDQ A;  3DK8 A;  3SFD A;  3BI5 A;  2GAG B;  1TDF A;  1KF6 A;  4U2L A;  4JQ9 A;  3SQP A;  4H4W A;  4BUR A;  3L8K A;  3GDP A;  2WU2 A;  2WS3 A;  3SZ0 A;  2ZZ0 A;  4II3 A;  1KSS A;  2BRY A;  3NLC A;  4EMJ A;  1GRA A;  1NHR A;  2YLT A;  3AWI A;  5J60 A;  3K30 A;  5U25 A;  4TM3 A;  4HA6 A;  2YVF A;  1GRB A;  3NGC X;  3AE1 A;  3UP5 A;  3F8R A;  2OAL A;  1S2Y A;  3NIX A;  4J34 A;  1IJH A;  3AEB A;  1GTH A;  2XLT A;  4GRT A;  1N4W A;  4NEW A;  4OVI A;  4JY2 A;  2BCG G;  1QO8 A;  3NYF A;  4KPR A;  3GD4 A;  4RSL A;  4GDP A;  1B37 A;  4K2X A;  1LPF A;  4DGK A;  3K7Q X;  1REO A;  2ARD A;  2H88 A;  4GUV A;  4GF7 A;  4IV9 A;  3K7M X;  1Q9I A;  1D4E A;  1XHC A;  1GRF A;  5JCK A;  1L9E A;  1Y56 B; 
#chains in the Genus database with same CATH homology
 1GPE A;  1FCD A;  2E4G A;  2QA1 A;  1S3E A;  1IUS A;  3H4K A;  4DSH A;  3C4A A;  1OJT A;  2FJA A;  1H7X A;  4CCR A;  2Y6Q A;  2YG4 A;  3AE9 A;  3NN6 X;  2C70 A;  2R45 A;  3FG2 P;  4A9W A;  3I6D A;  3KU9 A;  3S5W A;  4EIQ A;  3D1C A;  2XFO A;  4OCG A;  4NTE A;  4U8J A;  5EB5 A;  4J57 A;  2YM1 A;  3UKA A;  4B68 A;  3GMC A;  1ZOY A;  1TRB A;  4NZH A;  1M6I A;  2YG5 A;  1DOE A;  2X8H A;  3GYI A;  1ZX9 A;  1RYI A;  3AE4 A;  5M10 A;  2RAB A;  1ZKQ A;  2CDU A;  3NG7 X;  3DGH A;  3NK1 X;  4KX6 A;  2WDV A;  1UKV G;  2GF3 A;  3ALJ A;  4H4R A;  2RGO A;  1JNR A;  3T2Z A;  2R4J A;  4U2T A;  4NWZ A;  2YLZ A;  5CKU A;  1S3B A;  1KNR A;  1HYU A;  1AOG A;  1ZK7 A;  1GT8 A;  1IUT A;  1S2Q A;  2Q0L A;  3ICS A;  4TLX A;  1JRZ A;  5KOX A;  2WBA A;  3QSE A;  3CGD A;  4H4P A;  1VQW A;  2F5Z A;  3NH3 X;  4AP1 A;  3Q6J A;  3PVC A;  4YXD A;  2YLR A;  2YVJ A;  1EBD A;  5KXJ A;  3ISH A;  2EQ8 A;  2C65 A;  4U8M A;  2GR1 A;  1BF3 A;  1PBB A;  3IF9 A;  1N1P A;  2YM2 A;  3GWD A;  1E7P A;  5FMH A;  5FS7 A;  1PHH A;  1PXC A;  3CN8 A;  2JKC A;  5EOW A;  2E5V A;  1O95 A;  1CC2 A;  1ZMC A;  3AE5 A;  5LV9 A;  4PAA A;  1F6M A;  2E1M A;  2YWL A;  4Z2R A;  1BKW A;  4EQS A;  1CC4 A;  2YG3 A;  1GER A;  4A5L A;  3AYL A;  3AEE A;  3UOV A;  5U1O A;  2Y6R A;  1BZL A;  3UKP A;  3R9U A;  4BK3 A;  5L46 A;  2BAC A;  3CGB A;  3GYX A;  1K0I A;  4H2Q A;  5IQ4 A;  2A8X A;  2WQY A;  3AE6 A;  1GAL A;  3ITJ A;  1FEB A;  5U63 A;  4E0V A;  1H7W A;  1LQT A;  2DKI A;  5HYM A;  1ZP0 A;  3EPT A;  4OPI A;  5BUK A;  2JB1 A;  2XYO A;  4GR1 A;  3I3L A;  4U8N A;  1GSN A;  3AD8 B;  1TDO A;  3B6D A;  2EQ7 A;  4AOX A;  3ICR A;  4II2 A;  3E1T A;  4BK2 A;  2XDO A;  2BAB A;  3DME A;  3SZW A;  2BXS A;  5IQ1 A;  1KDG A;  2Q0K A;  4G6H A;  2IID A;  3GWF A;  1ZOV A;  4H2N A;  2QCU A;  2TPR A;  1NG3 A;  3T37 A;  1DJQ A;  1E1K A;  3NTD A;  4USR A;  1ZDL A;  4YSY A;  5BUL A;  4FX9 A;  1CL0 A;  3VRA A;  4IA6 A;  2VRM A;  3GMB A;  2RGH A;  2WES A;  2Z5Y A;  2QA2 A;  1CJ4 A;  3O0H A;  3DGZ A;  5JCL A;  2R0G A;  1E1M A;  1D4D A;  2JAE A;  3BHF A;  3HYV A;  1OJA A;  4JDR A;  1CJ2 A;  1TDK A;  3KLJ A;  3T31 A;  4AT2 A;  4BV6 A;  1KFY A;  3UOY A;  1F8S A;  4K7Z A;  2B9Y A;  4H4S A;  1GES A;  4J2W A;  3BHK A;  1GRT A;  2GRT A;  5C3J A;  4C77 A;  2BK5 A;  2V6O A;  3BNM A;  2V3A A;  4K22 A;  2YQU A;  2VVL A;  4TM4 A;  3IWA A;  3WE0 A;  3VR8 A;  5EB4 A;  3Q9T A;  4ADW A;  3CPH G;  1CHU A;  4GCM A;  2IVD A;  1D5T A;  1IUW A;  3AEC A;  3CGE A;  1YQ3 A;  2YR6 A;  3CNJ A;  3L1R A;  4IVM B;  4CNK A;  1V59 A;  2XFN A;  2GMJ A;  5EBK A;  2BS2 A;  3NK2 X;  2H89 A;  3S61 A;  2BC1 A;  4AOS A;  1RP0 A;  3T0K A;  3UOZ A;  3UTF A;  5KMP A;  2WOV A;  3DH9 A;  4C5O A;  3DA1 A;  4TM1 A;  2HQM A;  2X8C A;  3FBS A;  2GR0 A;  4Z43 A;  2XFP A;  2CUL A;  3AXB A;  3M12 A;  2ZZB A;  2EQ6 A;  3QSM A;  1BWC A;  1K0J A;  4PAB A;  2B9X A;  2B76 A;  2C67 A;  3AYI A;  1JNZ A;  3GRS A;  4H4X A;  1TYT A;  3BI4 A;  5CQF A;  3SGL A;  2OAM A;  3T2Y A;  1PXB A;  2GR2 A;  1GRH A;  2JB2 A;  1GXF A;  2C66 A;  2V3B A;  3P4P A;  2FBW A;  1DNC A;  2AQJ A;  4A65 A;  2ZBW A;  3ATQ A;  4EMW A;  1EL9 A;  4OPU A;  4JNQ A;  2CFY A;  4USQ A;  3G5R A;  4AT0 A;  3AEG A;  4NNJ A;  3UTG A;  1CC6 A;  4ZCC A;  5FS8 A;  3V3N A;  2UZZ A;  1XDI A;  2XLS A;  3SZC A;  2GQW A;  4OPG A;  1ELI A;  5KMR A;  1PBC A;  4REK A;  1JRY A;  2WET A;  3CTY A;  3P4Q A;  3SX6 A;  1GRE A;  1DOD A;  3RP8 A;  1TDE A;  3AE8 A;  4UDR A;  4B67 A;  1F3P A;  3LOV A;  3V3O A;  2X99 A;  4D04 A;  1DJN A;  1NEK A;  2X8G A;  2V5Z A;  4K5S A;  2Z5X A;  3UTH A;  1P2H A;  2WP6 A;  3P4R A;  3II4 A;  3SY4 A;  1O94 A;  4K8D A;  4EQR A;  1CJC A;  1TDN A;  2XFQ A;  2PHH A;  3AED A;  1JU2 A;  2GMH A;  2R0C A;  5IPY A;  1JRX A;  4EM3 A;  4X4J A;  5HY5 A;  2V60 A;  2B7R A;  5JCI A;  1CJ3 A;  1IUV A;  2EQ9 A;  3F8P A;  4CY8 A;  3IC9 A;  4Z26 A;  5KVH A;  4JNA A;  2XVE A;  3CNT A;  3IHM A;  3T14 A;  1F8W A;  2BS3 A;  2GH5 A;  3BNU A;  1NDA A;  1NEN A;  5JCN A;  3DJE A;  4H7U A;  4J33 A;  5ER0 A;  4YSH A;  3P9U A;  2NPX A;  3H8L A;  4B63 A;  3UOX A;  4EMI A;  1Q1W A;  2FJD A;  2NVK X;  1B5Q A;  3DK4 A;  4EQW A;  3DJD A;  4NTC A;  1H82 A;  1EL5 A;  4DNA A;  2WPF A;  3LJP A;  4LII A;  4GAV A;  3V76 A;  1GND A;  3DK9 A;  1PJ6 A;  1N4U A;  2JK6 A;  3CPI G;  3QVP A;  3CGC A;  2J3N A;  3QSS A;  4H4Q A;  3ZDN A;  3P4S A;  1D7Y A;  1IUU A;  2WU5 A;  4H2R A;  2GR3 A;  4G74 A;  5HXI A;  1ZY8 A;  3PS9 A;  3SYI A;  4A99 A;  4EIP A;  2WDR A;  4RG4 A;  5J7X A;  1BGN A;  4IVO B;  3SFE A;  1XAN A;  1D4C A;  3FPZ A;  3KKJ A;  2WDQ A;  1LVL A;  2A89 A;  3FIM B;  1GTE A;  3UCL A;  1DOB A;  4A79 A;  3AD7 B;  4XWR A;  4Y4M A;  3NNE A;  2WOI A;  2WOW A;  4FDC B;  1FEA A;  4ZN0 A;  1N4V A;  2IVE A;  3KD9 A;  1YY5 A;  3AE3 A;  3LXD A;  2R0P A;  1K0L A;  5C2T A;  3AB1 A;  4A7A A;  3JSK A;  4M52 A;  4O5U A;  1D7L A;  4H2P A;  4J56 A;  4ZCD A;  3RP7 A;  3LZW A;  3ADA B;  3VRB A;  1O5W A;  4B64 A;  1JOA A;  3QFA A;  3NHO X;  4YKG A;  3KPK A;  1VRQ B;  4OPL A;  3RNM A;  4YTN A;  1H81 A;  1MOK A;  3P1W A;  4EQX A;  2GV8 A;  2O9Z A;  1NPX A;  2GQF A;  4H4V A;  4AP3 A;  4C3X A;  4WX1 A;  1L9D A;  3UP4 A;  3F8D A;  1FEC A;  1KSU A;  4A6N A;  2YLW A;  4U8P A;  1RSG A;  1P2E A;  3QFB A;  3KA7 A;  3KVE A;  5BVA A;  3NKS A;  4U8I A;  4CY6 A;  1H84 A;  4U2S A;  2BS4 A;  1CF3 A;  4APN A;  3DJJ A;  2X3N A;  4YT0 A;  3T2K A;  2BCP A;  3GD3 A;  2GEW A;  2VZ2 A;  3NN0 X;  4A6N B;  1NAA A;  2W0H A;  3ZYX A;  1M64 A;  2QAE A;  4P9S A;  2XVJ A;  3GDN A;  1W4X A;  1Z6L A;  3AYJ A;  4XWZ A;  4C3Y A;  3LAD A;  4U8K A;  1PDH A;  2XFU A;  3H8I A;  3SZF A;  1B4V A;  3NT6 A;  4Z25 A;  4X9M A;  1EL7 A;  1E1N A;  3COX A;  2BXR A;  2RGJ A;  2DKH A;  2WPC A;  1PXA A;  3LB8 A;  1OJC A;  1QLB A;  4BJZ A;  2XCG A;  2C7G A;  4BJY A;  1B8S A;  4EM4 A;  1BGJ A;  2WHD A;  4TLZ A;  2XLR A;  4YKF A;  4B65 A;  4MJW A;  3OZ2 A;  3GRT A;  2B9W A;  2CVJ A;  1XPQ A;  2R9Z A;  2XLU A;  1Y56 A;  4I59 A;  1CBO A;  2R4E A;  2YLS A;  3C4N A;  3HYW A;  4U8L A;  5KMS A;  2V61 A;  4H4Z A;  4K5R A;  2AAQ A;  2FJE A;  2GAH B;  4IA5 A;  2APG A;  3SM8 A;  4ICY A;  1FL2 A;  2YAU A;  2YR4 A;  3ABV A;  5KWF A;  1H6V A;  4XXG A;  1LTX R;  3CMM A;  5FS9 A;  4C74 A;  1SEZ A;  3CIR A;  1OJ9 A;  3ATR A;  2B7S A;  3EF6 A;  4UP3 A;  1L0V A;  4J36 A;  2XVI A;  2OA1 A;  3C96 A;  3GYJ A;  2C73 A;  1ZMD A;  4G6G A;  2GVC A;  3UKL A;  1YKJ A;  4U8O A;  5GRT A;  3G5S A;  2FJB A;  3DJG X;  3RP6 A;  4YSX A;  2TMD A;  3CND A;  4DSG A;  3B3R A;  4I58 A;  2VVL G;  3VQR A;  3LZX A;  3FMW A;  4NEV A;  3URH A;  2XLP A;  2C76 A;  1DOC A;  1VG9 A;  4GDE A;  5KNL A;  2ZZC A;  3OC4 A;  3UTE A;  4CCQ A;  2C75 A;  3IHG A;  4Y4N A;  3M13 A;  3SXI A;  4UDP A;  4Z24 A;  5KMQ A;  4H4U A;  2JB3 A;  3ALL A;  4HB9 A;  4N9X A;  3RHA A;  2R46 A;  3EAN A;  5M0Z A;  3CNP A;  2VRL A;  2WP5 A;  1K4Q A;  3QJ4 A;  1LJ1 A;  1Q1R A;  1PN0 A;  4BK1 A;  1GV4 A;  2C4C A;  3HYX A;  1H83 A;  3UKF A;  2VOU A;  2BRA A;  3BI2 A;  1E39 A;  1NHS A;  3PO7 A;  2BC0 A;  1YQZ A;  4OPT A;  5KVI A;  1PBD A;  1Y0P A;  4JY3 A;  4X9N A;  5HHF A;  4OPD A;  1JEH A;  2XVF A;  3KPF A;  3NK0 X;  4LU6 A;  4CBQ A;  1GOS A;  1LQU A;  1PBE A;  3HZL A;  1NG4 A;  4OPC A;  4B66 A;  5KOW A;  1PS9 A;  2Q6U A;  4Z44 A;  4Z2U A;  1DXL A;  3NTA A;  4CNJ A;  3CNS A;  2WEU A;  3G5Q A;  4H4T A;  1F8R A;  4H4Y A;  2VVM A;  3NYC A;  4LA1 A;  2AR8 A;  5GSN A;  4Z2T A;  1GEU A;  1COY A;  2C72 A;  1PJ5 A;  2C3D A;  1NHQ A;  3VR9 A;  4D03 A;  4G9K A;  1OJD A;  2BYB A;  3QVR A;  2YVG A;  4GAP A;  1E1L A;  4Y4L A;  1VG0 A;  4WCT A;  3K7T A;  1NHP A;  1YQ4 A;  4H50 A;  2BK4 A;  4ECH A;  1L9C A;  2X50 A;  2YG6 A;  3NYE A;  1MO9 A;  2YR5 A;  1GRG A;  1H86 A;  1PBF A;  1TYP A;  1QJD A;  2VQ7 A;  2XVH A;  3ICT A;  2OLN A;  2BK3 A;  1KNP A;  2VQB A;  4O5Q A;  4YTM A;  2YG7 A;  2BA9 A;  4YTP A;  1GET A;  2C3C A;  2OLO A;  4J31 A;  1EL8 A;  3M0O A;  4JN9 A;  2PYX A;  1ONF A;  1E6E A;  2Q7V A;  2JBV A;  3VRD B;  4YWO A;  3RED A;  3CPJ G;  3AE7 A;  3AEA A;  4YSZ A;  3UKK A;  3AEF A;  2WP9 A;  2I0Z A;  5DBJ A;  3EAO A;  4CRT A;  2GB0 A;  4B1B A;  1PJ7 A;  3D8X A;  3AE2 A;  4B69 A;  4G73 A;  3NRN A;  3ALM A;  4NTD A;  3UKH A;  4FK1 C;  1VDC A;  5KRQ A;  1MXT A;  3AD9 B;  1FOH A;  4RG3 A;  5JCM A;  1IUX A;  3UKQ A;  1X31 B;  2C64 A;  5TR3 A;  5BRT A;  2A87 A;  4TM0 A;  3GSI A;  2ACZ A;  2YLX A;  4FK1 A;  2WPE A;  5FS6 A;  1LV0 A;  4UDQ A;  3DK8 A;  3SFD A;  3BI5 A;  2GAG B;  1TDF A;  1KF6 A;  4U2L A;  4JQ9 A;  3SQP A;  4H4W A;  4BUR A;  3L8K A;  3GDP A;  2WU2 A;  2WS3 A;  3SZ0 A;  2ZZ0 A;  4II3 A;  1KSS A;  2BRY A;  3NLC A;  4EMJ A;  1GRA A;  1NHR A;  2YLT A;  3AWI A;  5J60 A;  3K30 A;  5U25 A;  4TM3 A;  4HA6 A;  2YVF A;  1GRB A;  3NGC X;  3AE1 A;  3UP5 A;  3F8R A;  2OAL A;  1S2Y A;  3NIX A;  4J34 A;  1IJH A;  3AEB A;  1GTH A;  2XLT A;  4GRT A;  1N4W A;  4NEW A;  4OVI A;  4JY2 A;  2BCG G;  1QO8 A;  3NYF A;  4KPR A;  3GD4 A;  4RSL A;  4GDP A;  1B37 A;  4K2X A;  1LPF A;  4DGK A;  3K7Q X;  1REO A;  2ARD A;  2H88 A;  4GUV A;  4GF7 A;  4IV9 A;  3K7M X;  1Q9I A;  1D4E A;  1XHC A;  1GRF A;  5JCK A;  1L9E A;  1Y56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...