2I0ZA

Crystal structure of a fad binding protein from bacillus cereus, a putative nad(fad)-utilizing dehydrogenases
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
420
structure length
416
Chain Sequence
MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNNEDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVVIAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLNAIISHKMDMLFTHFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNEIDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYNITSALVTGRIAGTTAGENAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAD(FAD)-utilizing dehydrogenases
publication title Crystal structure of a FAD binding protein from Bacillus cereus, a putative NAD(FAD)-utilizing dehydrogenases
rcsb
source organism Bacillus cereus
total genus 144
structure length 416
sequence length 420
ec nomenclature
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03486 HI0933_like HI0933-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2i0zA01
2VQ7A 3GRTA 3M13A 4U8JA 2BABA 2R0GA 2V6OA 4B69A 1ZMCA 1IJHA 4EIPA 2WOIA 1JRXA 3UOXA 1LVLA 4EQWA 4WCTA 2GAHB 5HYMA 2WETA 4JNQA 2BK4A 4Z24A 2XDOA 2OAMA 4YKFA 1GRFA 2V61A 3K7TA 5EB4A 2F5ZA 2C66A 1JU2A 4APNA 4H4WA 5CQFA 1PXCA 5JCIA 3DK4A 4OVIA 4BJZA 3CNPA 4UDQA 1X31B 4ZCDA 2GR3A 1JOAA 3RP7A 3AECA 1ZX9A 3KU9A 2FJAA 1NHQA 1OJDA 2QA1A 2B7SA 2GF3A 4Z2RA 1PBCA 2RGHA 3GMCA 4GDPA 5ER0A 4EMIA 1CF3A 4ADWA 2NVKX 1NDAA 2A87A 4YWOA 4CBQA 1CC6A 2XCGA 2R4JA 2WP5A 2WU5A 3Q9TA 4B63A 2VRLA 1KNPA 1ZP0A 2V3BA 1ZY8A 3NNEA 4DGKA 2QA2A 2WDRA 3OC4A 2XYOA 4ZN0A 3SGLA 3ALJA 4U8KA 1FEAA 3AEEA 2X50A 4B67A 4D03A 4GDEA 1Y56B 2BA9A 2OLNA 1D4CA 3UKKA 4ECHA 1EL5A 4YSZA 3AEFA 2AAQA 5KRQA 4XXGA 3R9UA 4Y4MA 4YKGA 3QJ4A 2GR1A 3NYCA 5HHFA 4OCGA 2FBWA 2YG4A 2CULA 5FS7A 1HYUA 2VVMA 2WHDA 3AE1A 1CC2A 1Q9IA 1IUVA 1L9CA 3C4NA 3C4AA 2Q0LA 1H84A 3NLCA 2GR2A 1TRBA 1KSSA 2YLRA 4C3YA 4K7ZA 1H7XA 4XWZA 1E39A 2HQMA 4H7UA 2BC0A 4JNAA 1N4VA 2GH5A 1VG0A 4RG4A 4B68A 2YLTA 3UKHA 2WDQA 1S3EA 4J36A 3QSMA 5TR3A 5KOWA 4DNAA 4H4RA 1PXBA 4EQSA 3UKPA 3UOYA 3K30A 2EQ7A 1YQ3A 4YTNA 4TM1A 1OJCA 3S5WA 1K0IA 3K7MX 5IPYA 1VG9A 2WPCA 3M0OA 1FL2A 1JEHA 1IUXA 5EBKA 1TDOA 2X8HA 4LIIA 4USQA 3ALLA 2H89A 4I59A 4JQ9A 3AE4A 1M64A 3PVCA 2YM2A 2WQYA 1P2HA 5C3JA 2EQ8A 4J56A 3UKFA 1GSNA 2YG6A 3C96A 4OPDA 1CHUA 3D1CA 5J60A 1JRYA 2X3NA 3AD8B 3JSKA 4J57A 4U2TA 5JCMA 2XVEA 2YVFA 2Y6RA 1GOSA 2WESA 2XVJA 4CNJA 4H50A 4Z26A 2VVLA 4H4YA 4C77A 1D5TA 4P9SA 2YQUA 3BNUA 4RSLA 2QAEA 1TYPA 3NTAA 4B66A 3UTGA 4C74A 1GRTA 4TM3A 1ZK7A 1M6IA 1Q1WA 2CVJA 3KPFA 4K8DA 4MJWA 4DSGA 3S61A 2C70A 1FOHA 2WPFA 2GR0A 5M10A 4CY8A 1CL0A 1FEBA 2Q6UA 1JNRA 4B65A 4Z2TA 1GPEA 1PXAA 3DA1A 4ZCCA 3GRSA 2R0PA 1F8RA 2RABA 2FJDA 1D7LA 1D7YA 1LQTA 2CFYA 3DH9A 3IHMA 4H4UA 3I6DA 4KX6A 1GV4A 2Z5XA 4H4PA 2WU2A 4EMJA 2Q7VA 4BJYA 4Z43A 4GCMA 3O0HA 3P9UA 1BGJA 2FJBA 3GSIA 2GAGB 4O5UA 1BZLA 4TLZA 1BKWA 1OJ9A 2YLWA 4H4QA 3ADAB 1B37A 2ZZ0A 5GRTA 4AP3A 3CNJA 4K5SA 3GWFA 1NG3A 3AB1A 2ACZA 1PBBA 4H2PA 3GWDA 1GERA 3BNMA 3IWAA 5LV9A 3E1TA 3NIXA 1IUUA 3COXA 5FS9A 1RYIA 4AT2A 1GRHA 3PO7A 2ARDA 1E1KA 2BK5A 3AYJA 3CPIG 3GDPA 1S2YA 3BI5A 2EQ6A 1L9EA 3SFDA 4A5LA 5KWFA 1DODA 4U8PA 1D4DA 2TPRA 2Q0KA 3DJJA 4U8OA 4YSHA 2WP6A 2ZZBA 3QVPA 1L9DA 1O95A 3ZYXA 2TMDA 1REOA 2XVHA 1LPFA 1GTEA 5BUKA 1K0JA 3AEDA 3KVEA 2VVLG 3DJGX 1IUWA 3NKSA 2OALA 2C3CA 3B6DA 2YWLA 4A79A 4U8LA 2ZZCA 5U25A 3QSSA 2BS4A 2WEUA 3AE7A 4J31A 1TDEA 3NN6X 3P4SA 1ZDLA 3AE5A 3QFBA 2R0CA 3L1RA 3ISHA 4EMWA 1E1MA 2XFNA 3AYIA 3NH3X 1H6VA 3REDA 5FS6A 4IVOB 3CGCA 4CCQA 2QCUA 2DKHA 4YSXA 1IUTA 3QSEA 3CGDA 1EL9A 2E1MA 1S2QA 1YY5A 3V3OA 4A6NB 1CBOA 1E1LA 1O94A 2JAEA 1GRGA 1GEUA 4TLXA 2X99A 3G5SA 5C2TA 1DOCA 5IQ1A 1F3PA 2BCGG 5EOWA 3I3LA 1GREA 2RGJA 3D8XA 3FPZA 2BS3A 2JB2A 3LJPA 3NTDA 4IA5A 1RSGA 3NK0X 2GV8A 4ICYA 3VR9A 2I0ZA 2BACA 3AEBA 3BHKA 3Q6JA 4FDCB 4NTEA 1Y56A 4X9NA 4TM4A 2XVIA 5FS8A 1GTHA 1F8SA 1NHPA 1H81A 1CJ2A 1TDFA 2WBAA 3AD7B 4DSHA 1B4VA 5JCLA 3SFEA 5U63A 1GT8A 1RP0A 3IF9A 2VZ2A 2YLZA 1B5QA 1EBDA 4GF7A 1CJ4A 3DGZA 1XPQA 2VRMA 2B7RA 3CNDA 2YVGA 1PBDA 4UDRA 4LU6A 1K4QA 4Z25A 1NHRA 3VRBA 2WOVA 2YVJA 3ITJA 2AQJA 1E1NA 2RGOA 1N1PA 2GMHA 4IA6A 3DGHA 2XLUA 1DJQA 1PBFA 2VOUA 3CPHG 4NEWA 1COYA 3BHFA 4C3XA 3LB8A 1PBEA 1PS9A 1BGNA 1S3BA 4UDPA 2C65A 2XFPA 4M52A 2WOWA 4H4TA 4Y4NA 4BK3A 1ZOVA 2YLSA 1E6EA 3AE9A 3F8PA 1TDKA 1TYTA 3GDNA 4H2QA 2XFUA 3ATRA 3NYFA 3GMBA 3NT6A 4JY2A 1JNZA 3BI4A 2OA1A 1EL8A 2WS3A 3P4RA 2W0HA 3FBSA 3NHOX 4PAAA 1PHHA 2OLOA 3AWIA 1QLBA 3LOVA 4CRTA 2R45A 3GD4A 3G5RA 2DKIA 3CNTA 2E4GA 1QJDA 4OPIA 2APGA 4LA1A 2BXRA 3BI2A 4GRTA 4YTMA 2YM1A 3LADA 3AEGA 1P2EA 2YR4A 3P4QA 3DMEA 4NTDA 5EB5A 3KA7A 1Y0PA 4OPGA 1KFYA 1PJ5A 3KLJA 5KXJA 4EM4A 3UOVA 2C72A 4HA6A 3VQRA 3B3RA 3RHAA 1LV0A 2WP9A 1N4WA 2BS2A 1PDHA 4Y4LA 4JY3A 1ELIA 5J7XA 3PS9A 5JCKA 3DK9A 2R46A 3ALMA 4H4ZA 3UP5A 3UTFA 1H83A 1MOKA 3ICRA 1BF3A 2EQ9A 1FECA 4C5OA 2Z5YA 4O5QA 3V3NA 3UKLA 5BVAA 4GUVA 2XLPA 1QO8A 2C7GA 2XLSA 3AE2A 1H82A 1DNCA 4H2NA 2GQWA 3AD9B 1VRQB 2XFOA 3ATQA 4A99A 4REKA 1Q1RA 4K2XA 3URHA 3RP8A 3WE0A 1GESA 3T37A 4RG3A 4NZHA 5BRTA 4H4VA 4A9WA 4NEVA 5JCNA 4TM0A 2UZZA 2JB1A 4U8MA 4AOXA 3NYEA 1GALA 2C75A 2O9ZA 3AYLA 1GRAA 2B76A 2FJEA 3GD3A 1EL7A 4FK1A 2PYXA 3G5QA 3NK2X 5BULA 3AXBA 1F8WA 3CTYA 2YR6A 2PHHA 5IQ4A 1PN0A 4H2RA 2VQBA 4EQXA 3P4PA 2C73A 2BK3A 3LXDA 1D4EA 1ONFA 3DK8A 5CKUA 3NG7X 1KDGA 3L8KA 4H4XA 4PABA 4J34A 5FMHA 4A7AA 2YLXA 2C3DA 3K7QX 1W4XA 4JDRA 1NAAA 1DXLA 1E7PA 4XWRA 4U2SA 4N9XA 2BC1A 1NPXA 1H86A 3CNSA 1N4UA 1MXTA 2YG7A 1GRBA 2ZBWA 4BK2A 4CY6A 2BCPA 4AP1A 1O5WA 1LJ1A 3KKJA 1AOGA 3SQPA 2A8XA 3FG2P 3DJEA 2XLTA 3VRDB 4B1BA 1CC4A 3F8RA 4USRA 2V5ZA 2XFQA 3DJDA 2GVCA 3UP4A 3LZXA 3CPJG 2JKCA 3ICSA 3UKAA 2GB0A 3OZ2A 2B9WA 3HZLA 4OPTA 5DBJA 3CGEA 2V60A 1YKJA 1IUSA 4A6NA 4GR1A 1VDCA 4X9MA 3FIMB 1YQ4A 2BYBA 2JBVA 4BV6A 2IVEA 3QVRA 4IV9A 1KF6A 3RNMA 2J3NA 4I58A 3QFAA 3FMWA 1FCDA 1YQZA 3KD9A 4EM3A 1DOEA 3CN8A 1DJNA 2B9XA 2E5VA 4HB9A 4U8NA 2BXSA 3IHGA 3V76A 3ICTA 1XHCA 2YG3A 3VRAA 1LQUA 1TDNA 3H8IA 2C64A 4E0VA 4OPUA 5U1OA 1GETA 1MO9A 1OJTA 4CNKA 2AR8A 2WPEA 3CIRA 1F6MA 4YSYA 4D04A 2C76A 1KSUA 2X8GA 3II4A 4UP3A 3UCLA 3GYIA 5HY5A 4EIQA 3F8DA 2JK6A 2H88A 4BURA 2V3AA 4U8IA 4OPLA 2GEWA 4Z2UA 5KOXA 4H4SA 1NENA 3AE8A 5M0ZA 4YTPA 1XANA 3CGBA 2CDUA 2Y6QA 1NHSA 4NTCA 4IVMB 4JN9A 4KPRA 3UOZA 4AOSA 2GRTA 1CJCA 3EAOA 2YAUA 1K0LA 2GQFA 1BWCA 5KVIA 3AEAA 4K22A 3SM8A 4J33A 2YR5A 3UKQA 3M12A 1NEKA 1SEZA 4EQRA 3UTEA 1ZMDA 3NRNA 1H7WA 2IIDA 4K5RA 2X8CA 2A89A 2R9ZA 1DOBA 3GYJA 1V59A 1GNDA 2WDVA 3EANA 3AE6A 3UTHA 2XLRA 1GXFA 4FX9A 2R4EA 4J2WA 1JRZA 2JB3A 5KVHA 1OJAA 3RP6A 1ZOYA 2XVFA 3EF6A 1Z6LA 1VQWA 3AE3A 4A65A 1NG4A 1ZKQA 2B9YA 4X4JA 1XDIA 3H4KA 3LZWA 3IC9A 1KNRA 1LTXR 3NN0X 4AT0A 4WX1A 4B64A 3NK1X 4U2LA 3ZDNA 3P1WA 3ABVA 4BK1A 4YT0A 2NPXA 2YG5A 1UKVG 4OPCA 4Z44A 2C67A 3H8LA 3VR8A 4FK1C 5GSNA 5L46A 2GMJA 3NGCX 3EPTA 2IVDA 4YXDA 5HXIA 1B8SA 1PJ6A 1PJ7A 1L0VA 4CCRA 1CJ3A
chains in the Genus database with same CATH superfamily
2VQ7A 3GRTA 3M13A 4U8JA 2BABA 2R0GA 2V6OA 4B69A 1ZMCA 1IJHA 4EIPA 2WOIA 1JRXA 3UOXA 1LVLA 4EQWA 4WCTA 2GAHB 5HYMA 2WETA 4JNQA 2BK4A 4Z24A 2XDOA 2OAMA 4YKFA 1GRFA 2V61A 3K7TA 5EB4A 2F5ZA 2C66A 1JU2A 4APNA 4H4WA 5CQFA 1PXCA 5JCIA 3DK4A 4OVIA 4BJZA 3CNPA 4UDQA 1X31B 4ZCDA 2GR3A 1JOAA 3RP7A 4G73A 3AECA 1ZX9A 3KU9A 2C4CA 2FJAA 1NHQA 1OJDA 2QA1A 2B7SA 2GF3A 4Z2RA 1PBCA 2RGHA 3GMCA 4GDPA 5ER0A 4EMIA 1CF3A 4ADWA 2NVKX 1NDAA 2A87A 4YWOA 4CBQA 1CC6A 2XCGA 2R4JA 2WP5A 2WU5A 3Q9TA 4B63A 2VRLA 1KNPA 1ZP0A 2V3BA 1ZY8A 3NNEA 4DGKA 2QA2A 2WDRA 3OC4A 2XYOA 4ZN0A 3SGLA 3ALJA 4U8KA 1FEAA 3AEEA 2X50A 4B67A 3KPKA 4D03A 4GDEA 1Y56B 2BA9A 2OLNA 1D4CA 3UKKA 4ECHA 1EL5A 4YSZA 3AEFA 2AAQA 5KRQA 3T0KA 4XXGA 3R9UA 4Y4MA 4YKGA 3T31A 3QJ4A 2GR1A 3NYCA 5HHFA 4OCGA 2FBWA 2YG4A 2CULA 5FS7A 4II2A 1HYUA 2VVMA 2WHDA 3AE1A 1CC2A 1Q9IA 1IUVA 1L9CA 3C4NA 3C4AA 3HYWA 2Q0LA 1H84A 3NLCA 2GR2A 1TRBA 1KSSA 2YLRA 4C3YA 4K7ZA 1H7XA 4XWZA 1E39A 2HQMA 4H7UA 2BC0A 4JNAA 1N4VA 2GH5A 1VG0A 4RG4A 3SXIA 4B68A 2YLTA 3UKHA 2WDQA 1S3EA 4J36A 3QSMA 5TR3A 5KOWA 4DNAA 4H4RA 1PXBA 4EQSA 3UKPA 3UOYA 3K30A 2EQ7A 1YQ3A 4YTNA 4TM1A 1OJCA 3T2KA 3S5WA 1K0IA 3K7MX 5IPYA 1VG9A 2WPCA 3M0OA 1FL2A 1JEHA 1IUXA 5EBKA 1TDOA 2X8HA 4LIIA 4USQA 3ALLA 2H89A 4I59A 4JQ9A 3AE4A 1M64A 3PVCA 2YM2A 2WQYA 1P2HA 5C3JA 2EQ8A 4J56A 3UKFA 1GSNA 5KMQA 2YG6A 3C96A 4OPDA 1CHUA 3D1CA 5J60A 1JRYA 2X3NA 3AD8B 3JSKA 4J57A 4U2TA 5JCMA 2XVEA 2YVFA 2Y6RA 1GOSA 2WESA 2XVJA 4CNJA 4H50A 4Z26A 2VVLA 4H4YA 4C77A 1D5TA 4P9SA 2YQUA 3BNUA 4RSLA 2QAEA 1TYPA 3NTAA 4B66A 3UTGA 4C74A 1GRTA 4TM3A 1ZK7A 1M6IA 1Q1WA 2CVJA 3KPFA 4K8DA 4MJWA 4DSGA 3S61A 2C70A 1FOHA 2WPFA 2GR0A 5M10A 4CY8A 1CL0A 1FEBA 2Q6UA 1JNRA 4B65A 4Z2TA 1GPEA 1PXAA 3DA1A 4ZCCA 3GRSA 2R0PA 1F8RA 2RABA 2FJDA 1D7LA 1D7YA 1LQTA 2CFYA 3DH9A 3IHMA 4H4UA 3I6DA 4KX6A 1GV4A 2Z5XA 5KMSA 4G6HA 4H4PA 2WU2A 4EMJA 2Q7VA 4BJYA 4Z43A 4GCMA 3O0HA 3P9UA 1BGJA 2FJBA 3GSIA 2GAGB 4O5UA 1BZLA 4TLZA 1BKWA 1OJ9A 2YLWA 4GAVA 4H4QA 3ADAB 1B37A 2ZZ0A 5GRTA 4AP3A 3CNJA 4K5SA 3GWFA 1NG3A 3AB1A 2ACZA 1PBBA 4H2PA 3T2YA 3GWDA 1GERA 3BNMA 3IWAA 5LV9A 3E1TA 3NIXA 1IUUA 3COXA 5FS9A 1RYIA 4AT2A 1GRHA 3PO7A 2ARDA 1E1KA 2BK5A 3AYJA 3CPIG 3GDPA 1S2YA 3BI5A 2EQ6A 1L9EA 3SFDA 4A5LA 5KWFA 1DODA 4U8PA 1D4DA 2TPRA 2Q0KA 3DJJA 4U8OA 4YSHA 2WP6A 2ZZBA 3QVPA 1L9DA 1O95A 3ZYXA 2TMDA 1REOA 2XVHA 1LPFA 1GTEA 5BUKA 1K0JA 3AEDA 3KVEA 2VVLG 3DJGX 1IUWA 3NKSA 2OALA 2C3CA 3B6DA 2YWLA 4A79A 4U8LA 2ZZCA 5U25A 3QSSA 2BS4A 2WEUA 3AE7A 4J31A 1TDEA 3NN6X 3P4SA 1ZDLA 3AE5A 3QFBA 2R0CA 3L1RA 3ISHA 4EMWA 1E1MA 2XFNA 3AYIA 3NH3X 1H6VA 3REDA 4G6GA 5FS6A 4IVOB 3CGCA 4CCQA 2QCUA 2DKHA 4YSXA 1IUTA 3QSEA 3CGDA 4II3A 1EL9A 2E1MA 1S2QA 1YY5A 3V3OA 4A6NB 1CBOA 1E1LA 1O94A 2JAEA 1GRGA 3T2ZA 1GEUA 4TLXA 2X99A 3G5SA 5C2TA 1DOCA 5IQ1A 1F3PA 2BCGG 5EOWA 3I3LA 1GREA 2RGJA 3D8XA 3FPZA 2BS3A 2JB2A 3LJPA 3NTDA 4IA5A 1RSGA 3NK0X 2GV8A 4ICYA 3VR9A 2I0ZA 2BACA 3AEBA 3BHKA 3Q6JA 4FDCB 4NTEA 1Y56A 4X9NA 4TM4A 2XVIA 5FS8A 1GTHA 1F8SA 1NHPA 1H81A 1CJ2A 1TDFA 2WBAA 3AD7B 3GYXA 1B4VA 4DSHA 5JCLA 3SFEA 5U63A 1GT8A 1RP0A 3IF9A 2VZ2A 2YLZA 1B5QA 1EBDA 4GF7A 1CJ4A 3DGZA 1XPQA 2VRMA 2B7RA 3CNDA 2YVGA 1PBDA 4UDRA 4LU6A 1K4QA 4Z25A 1NHRA 3VRBA 2WOVA 2YVJA 3ITJA 2AQJA 1E1NA 2RGOA 1N1PA 2GMHA 4IA6A 3DGHA 2XLUA 1DJQA 1PBFA 2VOUA 3CPHG 4NEWA 1COYA 3BHFA 4C3XA 3LB8A 1PBEA 1PS9A 1BGNA 1S3BA 4UDPA 2C65A 2XFPA 4M52A 2WOWA 4H4TA 4Y4NA 4BK3A 1ZOVA 2YLSA 1E6EA 3AE9A 3F8PA 1TDKA 1TYTA 3GDNA 4H2QA 2XFUA 3ATRA 3NYFA 3GMBA 3NT6A 4NWZA 4JY2A 1JNZA 3BI4A 2OA1A 1EL8A 2WS3A 3P4RA 2W0HA 3FBSA 3NHOX 4PAAA 1PHHA 2OLOA 3AWIA 1QLBA 3LOVA 4CRTA 2R45A 3GD4A 3G5RA 2DKIA 3CNTA 2E4GA 1QJDA 4OPIA 2APGA 4LA1A 2BXRA 3BI2A 4GRTA 4YTMA 2YM1A 3LADA 3HYVA 3AEGA 1P2EA 2YR4A 3P4QA 3DMEA 3SZFA 4NTDA 5EB5A 3KA7A 1Y0PA 4OPGA 1KFYA 1PJ5A 3KLJA 5KXJA 4EM4A 3T14A 3UOVA 2C72A 4HA6A 3VQRA 3B3RA 3RHAA 1LV0A 2WP9A 1N4WA 2BS2A 1PDHA 4G74A 4Y4LA 4JY3A 1ELIA 5J7XA 3PS9A 5JCKA 3DK9A 2R46A 3ALMA 4H4ZA 3UP5A 3UTFA 1H83A 1MOKA 3ICRA 1BF3A 2EQ9A 1FECA 4C5OA 2Z5YA 4O5QA 3V3NA 3UKLA 5BVAA 4GUVA 2XLPA 1QO8A 2C7GA 2XLSA 3AE2A 1H82A 1DNCA 4H2NA 2GQWA 3AD9B 4NNJA 1VRQB 2XFOA 3ATQA 4A99A 4REKA 1Q1RA 4K2XA 3URHA 3RP8A 3WE0A 1GESA 3T37A 4RG3A 4NZHA 4G9KA 4H4VA 5BRTA 4A9WA 2BRYA 4NEVA 5JCNA 4TM0A 2UZZA 2JB1A 4U8MA 4AOXA 3NYEA 1GALA 2C75A 5KMPA 2O9ZA 3AYLA 1GRAA 2B76A 2FJEA 3GD3A 1EL7A 4FK1A 2PYXA 3G5QA 3NK2X 5BULA 3AXBA 1F8WA 3CTYA 3SYIA 3CMMA 2YR6A 2PHHA 5IQ4A 1PN0A 4H2RA 2VQBA 4EQXA 2BRAA 3P4PA 2C73A 2BK3A 3LXDA 1D4EA 1ONFA 3DK8A 5CKUA 3NG7X 1KDGA 3L8KA 4H4XA 4PABA 4J34A 5FMHA 4A7AA 2YLXA 2C3DA 3K7QX 1W4XA 3HYXA 4JDRA 1NAAA 5KMRA 1DXLA 1E7PA 4XWRA 4U2SA 4N9XA 2BC1A 1NPXA 1H86A 3CNSA 1N4UA 1MXTA 2YG7A 1GRBA 2ZBWA 4BK2A 4CY6A 2BCPA 4AP1A 1O5WA 1LJ1A 3KKJA 1AOGA 3SQPA 2A8XA 3FG2P 3DJEA 2XLTA 3VRDB 4B1BA 1CC4A 3F8RA 4USRA 2V5ZA 2XFQA 3DJDA 2GVCA 3UP4A 3LZXA 3CPJG 2JKCA 3ICSA 3UKAA 2GB0A 3OZ2A 2B9WA 3HZLA 4OPTA 5DBJA 3CGEA 2V60A 1YKJA 1IUSA 4A6NA 4GR1A 1VDCA 4X9MA 3FIMB 1YQ4A 2BYBA 2JBVA 4BV6A 2IVEA 3QVRA 4IV9A 1KF6A 3RNMA 2J3NA 4I58A 3SZCA 3QFAA 3FMWA 1FCDA 1YQZA 3KD9A 4EM3A 1DOEA 3CN8A 1DJNA 2B9XA 2E5VA 4HB9A 4U8NA 2BXSA 3IHGA 3V76A 3ICTA 1XHCA 2YG3A 3VRAA 1LQUA 1TDNA 3H8IA 4GAPA 2C64A 4E0VA 4OPUA 5U1OA 1GETA 1MO9A 1OJTA 4CNKA 2AR8A 2WPEA 3CIRA 1F6MA 4YSYA 4D04A 2C76A 1KSUA 2X8GA 3II4A 4UP3A 3UCLA 3GYIA 5HY5A 4EIQA 3F8DA 2JK6A 2H88A 4BURA 2V3AA 4U8IA 4OPLA 2GEWA 4Z2UA 5KOXA 4H4SA 1NENA 3AE8A 5M0ZA 3SY4A 4YTPA 1XANA 3CGBA 2CDUA 2Y6QA 1NHSA 4NTCA 5KNLA 4IVMB 4JN9A 4KPRA 3UOZA 4AOSA 2GRTA 1CJCA 3EAOA 2YAUA 1K0LA 2GQFA 3SZ0A 1BWCA 5KVIA 3AEAA 4K22A 3SM8A 4J33A 2YR5A 3UKQA 3M12A 1NEKA 1SEZA 4EQRA 3UTEA 1ZMDA 3NRNA 1H7WA 2IIDA 4K5RA 2X8CA 2A89A 2R9ZA 1DOBA 3GYJA 1V59A 1GNDA 2WDVA 3EANA 3AE6A 3UTHA 2XLRA 1GXFA 4FX9A 2R4EA 4J2WA 1JRZA 2JB3A 5KVHA 1OJAA 3RP6A 1ZOYA 2XVFA 3EF6A 1Z6LA 1VQWA 3AE3A 4A65A 1NG4A 1ZKQA 2B9YA 4X4JA 1XDIA 3H4KA 3LZWA 3IC9A 1KNRA 1LTXR 3NN0X 4AT0A 4WX1A 4B64A 3NK1X 4U2LA 3ZDNA 3P1WA 3SZWA 3ABVA 3SX6A 4BK1A 4YT0A 2NPXA 2YG5A 1UKVG 4OPCA 4Z44A 2C67A 3H8LA 3VR8A 4FK1C 5GSNA 5L46A 2GMJA 3NGCX 3EPTA 2IVDA 4YXDA 5HXIA 1B8SA 1PJ6A 1PJ7A 1L0VA 4CCRA 1CJ3A
chains in the Genus database with same CATH topology
2VQ7A 3GRTA 3M13A 4U8JA 2BABA 2R0GA 2V6OA 4B69A 1ZMCA 1IJHA 4EIPA 2WOIA 1JRXA 3UOXA 1LVLA 4EQWA 4WCTA 2GAHB 5HYMA 2WETA 4JNQA 2BK4A 4Z24A 2XDOA 2OAMA 4YKFA 1GRFA 2V61A 3K7TA 5EB4A 2F5ZA 2C66A 1JU2A 4APNA 4H4WA 5CQFA 1PXCA 5JCIA 3DK4A 4OVIA 4BJZA 3CNPA 4UDQA 1X31B 4ZCDA 2GR3A 1JOAA 3RP7A 4G73A 3AECA 1ZX9A 3KU9A 2C4CA 2FJAA 1NHQA 1OJDA 2QA1A 2B7SA 2GF3A 4Z2RA 1PBCA 2RGHA 3GMCA 4GDPA 5ER0A 4EMIA 1CF3A 4ADWA 2NVKX 1NDAA 2A87A 4YWOA 4CBQA 1CC6A 2XCGA 2R4JA 2WP5A 2WU5A 3Q9TA 4B63A 2VRLA 1KNPA 1ZP0A 2V3BA 1ZY8A 3NNEA 4DGKA 2QA2A 2WDRA 3OC4A 2XYOA 4ZN0A 3SGLA 3ALJA 4U8KA 1FEAA 3AEEA 2X50A 4B67A 3KPKA 4D03A 4GDEA 1Y56B 2BA9A 2OLNA 1D4CA 3UKKA 4ECHA 1EL5A 4YSZA 3AEFA 2AAQA 5KRQA 3T0KA 4XXGA 3R9UA 4Y4MA 4YKGA 3T31A 3QJ4A 2GR1A 3NYCA 5HHFA 4OCGA 2FBWA 2YG4A 2CULA 5FS7A 4II2A 1HYUA 2VVMA 2WHDA 3AE1A 1CC2A 1Q9IA 1IUVA 1L9CA 3C4NA 3C4AA 3HYWA 2Q0LA 1H84A 3NLCA 2GR2A 1TRBA 1KSSA 2YLRA 4C3YA 4K7ZA 1H7XA 4XWZA 1E39A 2HQMA 4H7UA 2BC0A 4JNAA 1N4VA 2GH5A 1VG0A 4RG4A 3SXIA 4B68A 2YLTA 3UKHA 2WDQA 1S3EA 4J36A 3QSMA 5TR3A 5KOWA 4DNAA 4H4RA 1PXBA 4EQSA 3UKPA 3UOYA 3K30A 2EQ7A 1YQ3A 4YTNA 4TM1A 1OJCA 3T2KA 3S5WA 1K0IA 3K7MX 5IPYA 1VG9A 2WPCA 3M0OA 1FL2A 1JEHA 1IUXA 5EBKA 1TDOA 2X8HA 4LIIA 4USQA 3ALLA 2H89A 4I59A 4JQ9A 3AE4A 1M64A 3PVCA 2YM2A 2WQYA 1P2HA 5C3JA 2EQ8A 4J56A 3UKFA 1GSNA 5KMQA 2YG6A 3C96A 4OPDA 1CHUA 3D1CA 5J60A 1JRYA 2X3NA 3AD8B 3JSKA 4J57A 4U2TA 5JCMA 2XVEA 2YVFA 2Y6RA 1GOSA 2WESA 2XVJA 4CNJA 4H50A 4Z26A 2VVLA 4H4YA 4C77A 1D5TA 4P9SA 2YQUA 3BNUA 4RSLA 2QAEA 1TYPA 3NTAA 4B66A 3UTGA 4C74A 1GRTA 4TM3A 1ZK7A 1M6IA 1Q1WA 2CVJA 3KPFA 4K8DA 4MJWA 4DSGA 3S61A 2C70A 1FOHA 2WPFA 2GR0A 5M10A 4CY8A 1CL0A 1FEBA 2Q6UA 1JNRA 4B65A 4Z2TA 1GPEA 1PXAA 3DA1A 4ZCCA 3GRSA 2R0PA 1F8RA 2RABA 2FJDA 1D7LA 1D7YA 1LQTA 2CFYA 3DH9A 3IHMA 4H4UA 3I6DA 4KX6A 1GV4A 2Z5XA 5KMSA 4G6HA 4H4PA 2WU2A 4EMJA 2Q7VA 4BJYA 4Z43A 4GCMA 3O0HA 3P9UA 1BGJA 2FJBA 3GSIA 2GAGB 4O5UA 1BZLA 4TLZA 1BKWA 1OJ9A 2YLWA 4GAVA 4H4QA 3ADAB 1B37A 2ZZ0A 5GRTA 4AP3A 3CNJA 4K5SA 3GWFA 1NG3A 3AB1A 2ACZA 1PBBA 4H2PA 3T2YA 3GWDA 1GERA 3BNMA 3IWAA 5LV9A 3E1TA 3NIXA 1IUUA 3COXA 5FS9A 1RYIA 4AT2A 1GRHA 3PO7A 2ARDA 1E1KA 2BK5A 3AYJA 3CPIG 3GDPA 1S2YA 3BI5A 2EQ6A 1L9EA 3SFDA 4A5LA 5KWFA 1DODA 4U8PA 1D4DA 2TPRA 2Q0KA 3DJJA 4U8OA 4YSHA 2WP6A 2ZZBA 3QVPA 1L9DA 1O95A 3ZYXA 2TMDA 1REOA 2XVHA 1LPFA 1GTEA 5BUKA 1K0JA 3AEDA 3KVEA 2VVLG 3DJGX 1IUWA 3NKSA 2OALA 2C3CA 3B6DA 2YWLA 4A79A 4U8LA 2ZZCA 5U25A 3QSSA 2BS4A 2WEUA 3AE7A 4J31A 1TDEA 3NN6X 3P4SA 1ZDLA 3AE5A 3QFBA 2R0CA 3L1RA 3ISHA 4EMWA 1E1MA 2XFNA 3AYIA 3NH3X 1H6VA 3REDA 4G6GA 5FS6A 4IVOB 3CGCA 4CCQA 2QCUA 2DKHA 4YSXA 1IUTA 3QSEA 3CGDA 4II3A 1EL9A 2E1MA 1S2QA 1YY5A 3V3OA 4A6NB 1CBOA 1E1LA 1O94A 2JAEA 1GRGA 3T2ZA 1GEUA 4TLXA 2X99A 3G5SA 5C2TA 1DOCA 5IQ1A 1F3PA 2BCGG 5EOWA 3I3LA 1GREA 2RGJA 3D8XA 3FPZA 2BS3A 2JB2A 3LJPA 3NTDA 4IA5A 1RSGA 3NK0X 2GV8A 4ICYA 3VR9A 2I0ZA 2BACA 3AEBA 3BHKA 3Q6JA 4FDCB 4NTEA 1Y56A 4X9NA 4TM4A 2XVIA 5FS8A 1GTHA 1F8SA 1NHPA 1H81A 1CJ2A 1TDFA 2WBAA 3AD7B 3GYXA 1B4VA 4DSHA 5JCLA 3SFEA 5U63A 1GT8A 1RP0A 3IF9A 2VZ2A 2YLZA 1B5QA 1EBDA 4GF7A 1CJ4A 3DGZA 1XPQA 2VRMA 2B7RA 3CNDA 2YVGA 1PBDA 4UDRA 4LU6A 1K4QA 4Z25A 1NHRA 3VRBA 2WOVA 2YVJA 3ITJA 2AQJA 1E1NA 2RGOA 1N1PA 2GMHA 4IA6A 3DGHA 2XLUA 1DJQA 1PBFA 2VOUA 3CPHG 4NEWA 1COYA 3BHFA 4C3XA 3LB8A 1PBEA 1PS9A 1BGNA 1S3BA 4UDPA 2C65A 2XFPA 4M52A 2WOWA 4H4TA 4Y4NA 4BK3A 1ZOVA 2YLSA 1E6EA 3AE9A 3F8PA 1TDKA 1TYTA 3GDNA 4H2QA 2XFUA 3ATRA 3NYFA 3GMBA 3NT6A 4NWZA 4JY2A 1JNZA 3BI4A 2OA1A 1EL8A 2WS3A 3P4RA 2W0HA 3FBSA 3NHOX 4PAAA 1PHHA 2OLOA 3AWIA 1QLBA 3LOVA 4CRTA 2R45A 3GD4A 3G5RA 2DKIA 3CNTA 2E4GA 1QJDA 4OPIA 2APGA 4LA1A 2BXRA 3BI2A 4GRTA 4YTMA 2YM1A 3LADA 3HYVA 3AEGA 1P2EA 2YR4A 3P4QA 3DMEA 3SZFA 4NTDA 5EB5A 3KA7A 1Y0PA 4OPGA 1KFYA 1PJ5A 3KLJA 5KXJA 4EM4A 3T14A 3UOVA 2C72A 4HA6A 3VQRA 3B3RA 3RHAA 1LV0A 2WP9A 1N4WA 2BS2A 1PDHA 4G74A 4Y4LA 4JY3A 1ELIA 5J7XA 3PS9A 5JCKA 3DK9A 2R46A 3ALMA 4H4ZA 3UP5A 3UTFA 1H83A 1MOKA 3ICRA 1BF3A 2EQ9A 1FECA 4C5OA 2Z5YA 4O5QA 3V3NA 3UKLA 5BVAA 4GUVA 2XLPA 1QO8A 2C7GA 2XLSA 3AE2A 1H82A 1DNCA 4H2NA 2GQWA 3AD9B 4NNJA 1VRQB 2XFOA 3ATQA 4A99A 4REKA 1Q1RA 4K2XA 3URHA 3RP8A 3WE0A 1GESA 3T37A 4RG3A 4NZHA 4G9KA 4H4VA 5BRTA 4A9WA 2BRYA 4NEVA 5JCNA 4TM0A 2UZZA 2JB1A 4U8MA 4AOXA 3NYEA 1GALA 2C75A 5KMPA 2O9ZA 3AYLA 1GRAA 2B76A 2FJEA 3GD3A 1EL7A 4FK1A 2PYXA 3G5QA 3NK2X 5BULA 3AXBA 1F8WA 3CTYA 3SYIA 3CMMA 2YR6A 2PHHA 5IQ4A 1PN0A 4H2RA 2VQBA 4EQXA 2BRAA 3P4PA 2C73A 2BK3A 3LXDA 1D4EA 1ONFA 3DK8A 5CKUA 3NG7X 1KDGA 3L8KA 4H4XA 4PABA 4J34A 5FMHA 4A7AA 2YLXA 2C3DA 3K7QX 1W4XA 3HYXA 4JDRA 1NAAA 5KMRA 1DXLA 1E7PA 4XWRA 4U2SA 4N9XA 2BC1A 1NPXA 1H86A 3CNSA 1N4UA 1MXTA 2YG7A 1GRBA 2ZBWA 4BK2A 4CY6A 2BCPA 4AP1A 1O5WA 1LJ1A 3KKJA 1AOGA 3SQPA 2A8XA 3FG2P 3DJEA 2XLTA 3VRDB 4B1BA 1CC4A 3F8RA 4USRA 2V5ZA 2XFQA 3DJDA 2GVCA 3UP4A 3LZXA 3CPJG 2JKCA 3ICSA 3UKAA 2GB0A 3OZ2A 2B9WA 3HZLA 4OPTA 5DBJA 3CGEA 2V60A 1YKJA 1IUSA 4A6NA 4GR1A 1VDCA 4X9MA 3FIMB 1YQ4A 2BYBA 2JBVA 4BV6A 2IVEA 3QVRA 4IV9A 1KF6A 3RNMA 2J3NA 4I58A 3SZCA 3QFAA 3FMWA 1FCDA 1YQZA 3KD9A 4EM3A 1DOEA 3CN8A 1DJNA 2B9XA 2E5VA 4HB9A 4U8NA 2BXSA 3IHGA 3V76A 3ICTA 1XHCA 2YG3A 3VRAA 1LQUA 1TDNA 3H8IA 4GAPA 2C64A 4E0VA 4OPUA 5U1OA 1GETA 1MO9A 1OJTA 4CNKA 2AR8A 2WPEA 3CIRA 1F6MA 4YSYA 4D04A 2C76A 1KSUA 2X8GA 3II4A 4UP3A 3UCLA 3GYIA 5HY5A 4EIQA 3F8DA 2JK6A 2H88A 4BURA 2V3AA 4U8IA 4OPLA 2GEWA 4Z2UA 5KOXA 4H4SA 1NENA 3AE8A 5M0ZA 3SY4A 4YTPA 1XANA 3CGBA 2CDUA 2Y6QA 1NHSA 4NTCA 5KNLA 4IVMB 4JN9A 4KPRA 3UOZA 4AOSA 2GRTA 1CJCA 3EAOA 2YAUA 1K0LA 2GQFA 3SZ0A 1BWCA 5KVIA 3AEAA 4K22A 3SM8A 4J33A 2YR5A 3UKQA 3M12A 1NEKA 1SEZA 4EQRA 3UTEA 1ZMDA 3NRNA 1H7WA 2IIDA 4K5RA 2X8CA 2A89A 2R9ZA 1DOBA 3GYJA 1V59A 1GNDA 2WDVA 3EANA 3AE6A 3UTHA 2XLRA 1GXFA 4FX9A 2R4EA 4J2WA 1JRZA 2JB3A 5KVHA 1OJAA 3RP6A 1ZOYA 2XVFA 3EF6A 1Z6LA 1VQWA 3AE3A 4A65A 1NG4A 1ZKQA 2B9YA 4X4JA 1XDIA 3H4KA 3LZWA 3IC9A 1KNRA 1LTXR 3NN0X 4AT0A 4WX1A 4B64A 3NK1X 4U2LA 3ZDNA 3P1WA 3SZWA 3ABVA 3SX6A 4BK1A 4YT0A 2NPXA 2YG5A 1UKVG 4OPCA 4Z44A 2C67A 3H8LA 3VR8A 4FK1C 5GSNA 5L46A 2GMJA 3NGCX 3EPTA 2IVDA 4YXDA 5HXIA 1B8SA 1PJ6A 1PJ7A 1L0VA 4CCRA 1CJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQ7 A;  3GRT A;  3M13 A;  4U8J A;  2BAB A;  2R0G A;  2V6O A;  4B69 A;  1ZMC A;  1IJH A;  4EIP A;  2WOI A;  1JRX A;  3UOX A;  1LVL A;  4EQW A;  4WCT A;  2GAH B;  5HYM A;  2WET A;  4JNQ A;  2BK4 A;  4Z24 A;  2XDO A;  2OAM A;  4YKF A;  1GRF A;  2V61 A;  3K7T A;  5EB4 A;  2F5Z A;  2C66 A;  1JU2 A;  4APN A;  4H4W A;  5CQF A;  1PXC A;  5JCI A;  3DK4 A;  4OVI A;  4BJZ A;  3CNP A;  4UDQ A;  1X31 B;  4ZCD A;  2GR3 A;  1JOA A;  3RP7 A;  3AEC A;  1ZX9 A;  3KU9 A;  2FJA A;  1NHQ A;  1OJD A;  2QA1 A;  2B7S A;  2GF3 A;  4Z2R A;  1PBC A;  2RGH A;  3GMC A;  4GDP A;  5ER0 A;  4EMI A;  1CF3 A;  4ADW A;  2NVK X;  1NDA A;  2A87 A;  4YWO A;  4CBQ A;  1CC6 A;  2XCG A;  2R4J A;  2WP5 A;  2WU5 A;  3Q9T A;  4B63 A;  2VRL A;  1KNP A;  1ZP0 A;  2V3B A;  1ZY8 A;  3NNE A;  4DGK A;  2QA2 A;  2WDR A;  3OC4 A;  2XYO A;  4ZN0 A;  3SGL A;  3ALJ A;  4U8K A;  1FEA A;  3AEE A;  2X50 A;  4B67 A;  4D03 A;  4GDE A;  1Y56 B;  2BA9 A;  2OLN A;  1D4C A;  3UKK A;  4ECH A;  1EL5 A;  4YSZ A;  3AEF A;  2AAQ A;  5KRQ A;  4XXG A;  3R9U A;  4Y4M A;  4YKG A;  3QJ4 A;  2GR1 A;  3NYC A;  5HHF A;  4OCG A;  2FBW A;  2YG4 A;  2CUL A;  5FS7 A;  1HYU A;  2VVM A;  2WHD A;  3AE1 A;  1CC2 A;  1Q9I A;  1IUV A;  1L9C A;  3C4N A;  3C4A A;  2Q0L A;  1H84 A;  3NLC A;  2GR2 A;  1TRB A;  1KSS A;  2YLR A;  4C3Y A;  4K7Z A;  1H7X A;  4XWZ A;  1E39 A;  2HQM A;  4H7U A;  2BC0 A;  4JNA A;  1N4V A;  2GH5 A;  1VG0 A;  4RG4 A;  4B68 A;  2YLT A;  3UKH A;  2WDQ A;  1S3E A;  4J36 A;  3QSM A;  5TR3 A;  5KOW A;  4DNA A;  4H4R A;  1PXB A;  4EQS A;  3UKP A;  3UOY A;  3K30 A;  2EQ7 A;  1YQ3 A;  4YTN A;  4TM1 A;  1OJC A;  3S5W A;  1K0I A;  3K7M X;  5IPY A;  1VG9 A;  2WPC A;  3M0O A;  1FL2 A;  1JEH A;  1IUX A;  5EBK A;  1TDO A;  2X8H A;  4LII A;  4USQ A;  3ALL A;  2H89 A;  4I59 A;  4JQ9 A;  3AE4 A;  1M64 A;  3PVC A;  2YM2 A;  2WQY A;  1P2H A;  5C3J A;  2EQ8 A;  4J56 A;  3UKF A;  1GSN A;  2YG6 A;  3C96 A;  4OPD A;  1CHU A;  3D1C A;  5J60 A;  1JRY A;  2X3N A;  3AD8 B;  3JSK A;  4J57 A;  4U2T A;  5JCM A;  2XVE A;  2YVF A;  2Y6R A;  1GOS A;  2WES A;  2XVJ A;  4CNJ A;  4H50 A;  4Z26 A;  2VVL A;  4H4Y A;  4C77 A;  1D5T A;  4P9S A;  2YQU A;  3BNU A;  4RSL A;  2QAE A;  1TYP A;  3NTA A;  4B66 A;  3UTG A;  4C74 A;  1GRT A;  4TM3 A;  1ZK7 A;  1M6I A;  1Q1W A;  2CVJ A;  3KPF A;  4K8D A;  4MJW A;  4DSG A;  3S61 A;  2C70 A;  1FOH A;  2WPF A;  2GR0 A;  5M10 A;  4CY8 A;  1CL0 A;  1FEB A;  2Q6U A;  1JNR A;  4B65 A;  4Z2T A;  1GPE A;  1PXA A;  3DA1 A;  4ZCC A;  3GRS A;  2R0P A;  1F8R A;  2RAB A;  2FJD A;  1D7L A;  1D7Y A;  1LQT A;  2CFY A;  3DH9 A;  3IHM A;  4H4U A;  3I6D A;  4KX6 A;  1GV4 A;  2Z5X A;  4H4P A;  2WU2 A;  4EMJ A;  2Q7V A;  4BJY A;  4Z43 A;  4GCM A;  3O0H A;  3P9U A;  1BGJ A;  2FJB A;  3GSI A;  2GAG B;  4O5U A;  1BZL A;  4TLZ A;  1BKW A;  1OJ9 A;  2YLW A;  4H4Q A;  3ADA B;  1B37 A;  2ZZ0 A;  5GRT A;  4AP3 A;  3CNJ A;  4K5S A;  3GWF A;  1NG3 A;  3AB1 A;  2ACZ A;  1PBB A;  4H2P A;  3GWD A;  1GER A;  3BNM A;  3IWA A;  5LV9 A;  3E1T A;  3NIX A;  1IUU A;  3COX A;  5FS9 A;  1RYI A;  4AT2 A;  1GRH A;  3PO7 A;  2ARD A;  1E1K A;  2BK5 A;  3AYJ A;  3CPI G;  3GDP A;  1S2Y A;  3BI5 A;  2EQ6 A;  1L9E A;  3SFD A;  4A5L A;  5KWF A;  1DOD A;  4U8P A;  1D4D A;  2TPR A;  2Q0K A;  3DJJ A;  4U8O A;  4YSH A;  2WP6 A;  2ZZB A;  3QVP A;  1L9D A;  1O95 A;  3ZYX A;  2TMD A;  1REO A;  2XVH A;  1LPF A;  1GTE A;  5BUK A;  1K0J A;  3AED A;  3KVE A;  2VVL G;  3DJG X;  1IUW A;  3NKS A;  2OAL A;  2C3C A;  3B6D A;  2YWL A;  4A79 A;  4U8L A;  2ZZC A;  5U25 A;  3QSS A;  2BS4 A;  2WEU A;  3AE7 A;  4J31 A;  1TDE A;  3NN6 X;  3P4S A;  1ZDL A;  3AE5 A;  3QFB A;  2R0C A;  3L1R A;  3ISH A;  4EMW A;  1E1M A;  2XFN A;  3AYI A;  3NH3 X;  1H6V A;  3RED A;  5FS6 A;  4IVO B;  3CGC A;  4CCQ A;  2QCU A;  2DKH A;  4YSX A;  1IUT A;  3QSE A;  3CGD A;  1EL9 A;  2E1M A;  1S2Q A;  1YY5 A;  3V3O A;  4A6N B;  1CBO A;  1E1L A;  1O94 A;  2JAE A;  1GRG A;  1GEU A;  4TLX A;  2X99 A;  3G5S A;  5C2T A;  1DOC A;  5IQ1 A;  1F3P A;  2BCG G;  5EOW A;  3I3L A;  1GRE A;  2RGJ A;  3D8X A;  3FPZ A;  2BS3 A;  2JB2 A;  3LJP A;  3NTD A;  4IA5 A;  1RSG A;  3NK0 X;  2GV8 A;  4ICY A;  3VR9 A;  2I0Z A;  2BAC A;  3AEB A;  3BHK A;  3Q6J A;  4FDC B;  4NTE A;  1Y56 A;  4X9N A;  4TM4 A;  2XVI A;  5FS8 A;  1GTH A;  1F8S A;  1NHP A;  1H81 A;  1CJ2 A;  1TDF A;  2WBA A;  3AD7 B;  4DSH A;  1B4V A;  5JCL A;  3SFE A;  5U63 A;  1GT8 A;  1RP0 A;  3IF9 A;  2VZ2 A;  2YLZ A;  1B5Q A;  1EBD A;  4GF7 A;  1CJ4 A;  3DGZ A;  1XPQ A;  2VRM A;  2B7R A;  3CND A;  2YVG A;  1PBD A;  4UDR A;  4LU6 A;  1K4Q A;  4Z25 A;  1NHR A;  3VRB A;  2WOV A;  2YVJ A;  3ITJ A;  2AQJ A;  1E1N A;  2RGO A;  1N1P A;  2GMH A;  4IA6 A;  3DGH A;  2XLU A;  1DJQ A;  1PBF A;  2VOU A;  3CPH G;  4NEW A;  1COY A;  3BHF A;  4C3X A;  3LB8 A;  1PBE A;  1PS9 A;  1BGN A;  1S3B A;  4UDP A;  2C65 A;  2XFP A;  4M52 A;  2WOW A;  4H4T A;  4Y4N A;  4BK3 A;  1ZOV A;  2YLS A;  1E6E A;  3AE9 A;  3F8P A;  1TDK A;  1TYT A;  3GDN A;  4H2Q A;  2XFU A;  3ATR A;  3NYF A;  3GMB A;  3NT6 A;  4JY2 A;  1JNZ A;  3BI4 A;  2OA1 A;  1EL8 A;  2WS3 A;  3P4R A;  2W0H A;  3FBS A;  3NHO X;  4PAA A;  1PHH A;  2OLO A;  3AWI A;  1QLB A;  3LOV A;  4CRT A;  2R45 A;  3GD4 A;  3G5R A;  2DKI A;  3CNT A;  2E4G A;  1QJD A;  4OPI A;  2APG A;  4LA1 A;  2BXR A;  3BI2 A;  4GRT A;  4YTM A;  2YM1 A;  3LAD A;  3AEG A;  1P2E A;  2YR4 A;  3P4Q A;  3DME A;  4NTD A;  5EB5 A;  3KA7 A;  1Y0P A;  4OPG A;  1KFY A;  1PJ5 A;  3KLJ A;  5KXJ A;  4EM4 A;  3UOV A;  2C72 A;  4HA6 A;  3VQR A;  3B3R A;  3RHA A;  1LV0 A;  2WP9 A;  1N4W A;  2BS2 A;  1PDH A;  4Y4L A;  4JY3 A;  1ELI A;  5J7X A;  3PS9 A;  5JCK A;  3DK9 A;  2R46 A;  3ALM A;  4H4Z A;  3UP5 A;  3UTF A;  1H83 A;  1MOK A;  3ICR A;  1BF3 A;  2EQ9 A;  1FEC A;  4C5O A;  2Z5Y A;  4O5Q A;  3V3N A;  3UKL A;  5BVA A;  4GUV A;  2XLP A;  1QO8 A;  2C7G A;  2XLS A;  3AE2 A;  1H82 A;  1DNC A;  4H2N A;  2GQW A;  3AD9 B;  1VRQ B;  2XFO A;  3ATQ A;  4A99 A;  4REK A;  1Q1R A;  4K2X A;  3URH A;  3RP8 A;  3WE0 A;  1GES A;  3T37 A;  4RG3 A;  4NZH A;  5BRT A;  4H4V A;  4A9W A;  4NEV A;  5JCN A;  4TM0 A;  2UZZ A;  2JB1 A;  4U8M A;  4AOX A;  3NYE A;  1GAL A;  2C75 A;  2O9Z A;  3AYL A;  1GRA A;  2B76 A;  2FJE A;  3GD3 A;  1EL7 A;  4FK1 A;  2PYX A;  3G5Q A;  3NK2 X;  5BUL A;  3AXB A;  1F8W A;  3CTY A;  2YR6 A;  2PHH A;  5IQ4 A;  1PN0 A;  4H2R A;  2VQB A;  4EQX A;  3P4P A;  2C73 A;  2BK3 A;  3LXD A;  1D4E A;  1ONF A;  3DK8 A;  5CKU A;  3NG7 X;  1KDG A;  3L8K A;  4H4X A;  4PAB A;  4J34 A;  5FMH A;  4A7A A;  2YLX A;  2C3D A;  3K7Q X;  1W4X A;  4JDR A;  1NAA A;  1DXL A;  1E7P A;  4XWR A;  4U2S A;  4N9X A;  2BC1 A;  1NPX A;  1H86 A;  3CNS A;  1N4U A;  1MXT A;  2YG7 A;  1GRB A;  2ZBW A;  4BK2 A;  4CY6 A;  2BCP A;  4AP1 A;  1O5W A;  1LJ1 A;  3KKJ A;  1AOG A;  3SQP A;  2A8X A;  3FG2 P;  3DJE A;  2XLT A;  3VRD B;  4B1B A;  1CC4 A;  3F8R A;  4USR A;  2V5Z A;  2XFQ A;  3DJD A;  2GVC A;  3UP4 A;  3LZX A;  3CPJ G;  2JKC A;  3ICS A;  3UKA A;  2GB0 A;  3OZ2 A;  2B9W A;  3HZL A;  4OPT A;  5DBJ A;  3CGE A;  2V60 A;  1YKJ A;  1IUS A;  4A6N A;  4GR1 A;  1VDC A;  4X9M A;  3FIM B;  1YQ4 A;  2BYB A;  2JBV A;  4BV6 A;  2IVE A;  3QVR A;  4IV9 A;  1KF6 A;  3RNM A;  2J3N A;  4I58 A;  3QFA A;  3FMW A;  1FCD A;  1YQZ A;  3KD9 A;  4EM3 A;  1DOE A;  3CN8 A;  1DJN A;  2B9X A;  2E5V A;  4HB9 A;  4U8N A;  2BXS A;  3IHG A;  3V76 A;  3ICT A;  1XHC A;  2YG3 A;  3VRA A;  1LQU A;  1TDN A;  3H8I A;  2C64 A;  4E0V A;  4OPU A;  5U1O A;  1GET A;  1MO9 A;  1OJT A;  4CNK A;  2AR8 A;  2WPE A;  3CIR A;  1F6M A;  4YSY A;  4D04 A;  2C76 A;  1KSU A;  2X8G A;  3II4 A;  4UP3 A;  3UCL A;  3GYI A;  5HY5 A;  4EIQ A;  3F8D A;  2JK6 A;  2H88 A;  4BUR A;  2V3A A;  4U8I A;  4OPL A;  2GEW A;  4Z2U A;  5KOX A;  4H4S A;  1NEN A;  3AE8 A;  5M0Z A;  4YTP A;  1XAN A;  3CGB A;  2CDU A;  2Y6Q A;  1NHS A;  4NTC A;  4IVM B;  4JN9 A;  4KPR A;  3UOZ A;  4AOS A;  2GRT A;  1CJC A;  3EAO A;  2YAU A;  1K0L A;  2GQF A;  1BWC A;  5KVI A;  3AEA A;  4K22 A;  3SM8 A;  4J33 A;  2YR5 A;  3UKQ A;  3M12 A;  1NEK A;  1SEZ A;  4EQR A;  3UTE A;  1ZMD A;  3NRN A;  1H7W A;  2IID A;  4K5R A;  2X8C A;  2A89 A;  2R9Z A;  1DOB A;  3GYJ A;  1V59 A;  1GND A;  2WDV A;  3EAN A;  3AE6 A;  3UTH A;  2XLR A;  1GXF A;  4FX9 A;  2R4E A;  4J2W A;  1JRZ A;  2JB3 A;  5KVH A;  1OJA A;  3RP6 A;  1ZOY A;  2XVF A;  3EF6 A;  1Z6L A;  1VQW A;  3AE3 A;  4A65 A;  1NG4 A;  1ZKQ A;  2B9Y A;  4X4J A;  1XDI A;  3H4K A;  3LZW A;  3IC9 A;  1KNR A;  1LTX R;  3NN0 X;  4AT0 A;  4WX1 A;  4B64 A;  3NK1 X;  4U2L A;  3ZDN A;  3P1W A;  3ABV A;  4BK1 A;  4YT0 A;  2NPX A;  2YG5 A;  1UKV G;  4OPC A;  4Z44 A;  2C67 A;  3H8L A;  3VR8 A;  4FK1 C;  5GSN A;  5L46 A;  2GMJ A;  3NGC X;  3EPT A;  2IVD A;  4YXD A;  5HXI A;  1B8S A;  1PJ6 A;  1PJ7 A;  1L0V A;  4CCR A;  1CJ3 A; 
#chains in the Genus database with same CATH topology
 2VQ7 A;  3GRT A;  3M13 A;  4U8J A;  2BAB A;  2R0G A;  2V6O A;  4B69 A;  1ZMC A;  1IJH A;  4EIP A;  2WOI A;  1JRX A;  3UOX A;  1LVL A;  4EQW A;  4WCT A;  2GAH B;  5HYM A;  2WET A;  4JNQ A;  2BK4 A;  4Z24 A;  2XDO A;  2OAM A;  4YKF A;  1GRF A;  2V61 A;  3K7T A;  5EB4 A;  2F5Z A;  2C66 A;  1JU2 A;  4APN A;  4H4W A;  5CQF A;  1PXC A;  5JCI A;  3DK4 A;  4OVI A;  4BJZ A;  3CNP A;  4UDQ A;  1X31 B;  4ZCD A;  2GR3 A;  1JOA A;  3RP7 A;  4G73 A;  3AEC A;  1ZX9 A;  3KU9 A;  2C4C A;  2FJA A;  1NHQ A;  1OJD A;  2QA1 A;  2B7S A;  2GF3 A;  4Z2R A;  1PBC A;  2RGH A;  3GMC A;  4GDP A;  5ER0 A;  4EMI A;  1CF3 A;  4ADW A;  2NVK X;  1NDA A;  2A87 A;  4YWO A;  4CBQ A;  1CC6 A;  2XCG A;  2R4J A;  2WP5 A;  2WU5 A;  3Q9T A;  4B63 A;  2VRL A;  1KNP A;  1ZP0 A;  2V3B A;  1ZY8 A;  3NNE A;  4DGK A;  2QA2 A;  2WDR A;  3OC4 A;  2XYO A;  4ZN0 A;  3SGL A;  3ALJ A;  4U8K A;  1FEA A;  3AEE A;  2X50 A;  4B67 A;  3KPK A;  4D03 A;  4GDE A;  1Y56 B;  2BA9 A;  2OLN A;  1D4C A;  3UKK A;  4ECH A;  1EL5 A;  4YSZ A;  3AEF A;  2AAQ A;  5KRQ A;  3T0K A;  4XXG A;  3R9U A;  4Y4M A;  4YKG A;  3T31 A;  3QJ4 A;  2GR1 A;  3NYC A;  5HHF A;  4OCG A;  2FBW A;  2YG4 A;  2CUL A;  5FS7 A;  4II2 A;  1HYU A;  2VVM A;  2WHD A;  3AE1 A;  1CC2 A;  1Q9I A;  1IUV A;  1L9C A;  3C4N A;  3C4A A;  3HYW A;  2Q0L A;  1H84 A;  3NLC A;  2GR2 A;  1TRB A;  1KSS A;  2YLR A;  4C3Y A;  4K7Z A;  1H7X A;  4XWZ A;  1E39 A;  2HQM A;  4H7U A;  2BC0 A;  4JNA A;  1N4V A;  2GH5 A;  1VG0 A;  4RG4 A;  3SXI A;  4B68 A;  2YLT A;  3UKH A;  2WDQ A;  1S3E A;  4J36 A;  3QSM A;  5TR3 A;  5KOW A;  4DNA A;  4H4R A;  1PXB A;  4EQS A;  3UKP A;  3UOY A;  3K30 A;  2EQ7 A;  1YQ3 A;  4YTN A;  4TM1 A;  1OJC A;  3T2K A;  3S5W A;  1K0I A;  3K7M X;  5IPY A;  1VG9 A;  2WPC A;  3M0O A;  1FL2 A;  1JEH A;  1IUX A;  5EBK A;  1TDO A;  2X8H A;  4LII A;  4USQ A;  3ALL A;  2H89 A;  4I59 A;  4JQ9 A;  3AE4 A;  1M64 A;  3PVC A;  2YM2 A;  2WQY A;  1P2H A;  5C3J A;  2EQ8 A;  4J56 A;  3UKF A;  1GSN A;  5KMQ A;  2YG6 A;  3C96 A;  4OPD A;  1CHU A;  3D1C A;  5J60 A;  1JRY A;  2X3N A;  3AD8 B;  3JSK A;  4J57 A;  4U2T A;  5JCM A;  2XVE A;  2YVF A;  2Y6R A;  1GOS A;  2WES A;  2XVJ A;  4CNJ A;  4H50 A;  4Z26 A;  2VVL A;  4H4Y A;  4C77 A;  1D5T A;  4P9S A;  2YQU A;  3BNU A;  4RSL A;  2QAE A;  1TYP A;  3NTA A;  4B66 A;  3UTG A;  4C74 A;  1GRT A;  4TM3 A;  1ZK7 A;  1M6I A;  1Q1W A;  2CVJ A;  3KPF A;  4K8D A;  4MJW A;  4DSG A;  3S61 A;  2C70 A;  1FOH A;  2WPF A;  2GR0 A;  5M10 A;  4CY8 A;  1CL0 A;  1FEB A;  2Q6U A;  1JNR A;  4B65 A;  4Z2T A;  1GPE A;  1PXA A;  3DA1 A;  4ZCC A;  3GRS A;  2R0P A;  1F8R A;  2RAB A;  2FJD A;  1D7L A;  1D7Y A;  1LQT A;  2CFY A;  3DH9 A;  3IHM A;  4H4U A;  3I6D A;  4KX6 A;  1GV4 A;  2Z5X A;  5KMS A;  4G6H A;  4H4P A;  2WU2 A;  4EMJ A;  2Q7V A;  4BJY A;  4Z43 A;  4GCM A;  3O0H A;  3P9U A;  1BGJ A;  2FJB A;  3GSI A;  2GAG B;  4O5U A;  1BZL A;  4TLZ A;  1BKW A;  1OJ9 A;  2YLW A;  4GAV A;  4H4Q A;  3ADA B;  1B37 A;  2ZZ0 A;  5GRT A;  4AP3 A;  3CNJ A;  4K5S A;  3GWF A;  1NG3 A;  3AB1 A;  2ACZ A;  1PBB A;  4H2P A;  3T2Y A;  3GWD A;  1GER A;  3BNM A;  3IWA A;  5LV9 A;  3E1T A;  3NIX A;  1IUU A;  3COX A;  5FS9 A;  1RYI A;  4AT2 A;  1GRH A;  3PO7 A;  2ARD A;  1E1K A;  2BK5 A;  3AYJ A;  3CPI G;  3GDP A;  1S2Y A;  3BI5 A;  2EQ6 A;  1L9E A;  3SFD A;  4A5L A;  5KWF A;  1DOD A;  4U8P A;  1D4D A;  2TPR A;  2Q0K A;  3DJJ A;  4U8O A;  4YSH A;  2WP6 A;  2ZZB A;  3QVP A;  1L9D A;  1O95 A;  3ZYX A;  2TMD A;  1REO A;  2XVH A;  1LPF A;  1GTE A;  5BUK A;  1K0J A;  3AED A;  3KVE A;  2VVL G;  3DJG X;  1IUW A;  3NKS A;  2OAL A;  2C3C A;  3B6D A;  2YWL A;  4A79 A;  4U8L A;  2ZZC A;  5U25 A;  3QSS A;  2BS4 A;  2WEU A;  3AE7 A;  4J31 A;  1TDE A;  3NN6 X;  3P4S A;  1ZDL A;  3AE5 A;  3QFB A;  2R0C A;  3L1R A;  3ISH A;  4EMW A;  1E1M A;  2XFN A;  3AYI A;  3NH3 X;  1H6V A;  3RED A;  4G6G A;  5FS6 A;  4IVO B;  3CGC A;  4CCQ A;  2QCU A;  2DKH A;  4YSX A;  1IUT A;  3QSE A;  3CGD A;  4II3 A;  1EL9 A;  2E1M A;  1S2Q A;  1YY5 A;  3V3O A;  4A6N B;  1CBO A;  1E1L A;  1O94 A;  2JAE A;  1GRG A;  3T2Z A;  1GEU A;  4TLX A;  2X99 A;  3G5S A;  5C2T A;  1DOC A;  5IQ1 A;  1F3P A;  2BCG G;  5EOW A;  3I3L A;  1GRE A;  2RGJ A;  3D8X A;  3FPZ A;  2BS3 A;  2JB2 A;  3LJP A;  3NTD A;  4IA5 A;  1RSG A;  3NK0 X;  2GV8 A;  4ICY A;  3VR9 A;  2I0Z A;  2BAC A;  3AEB A;  3BHK A;  3Q6J A;  4FDC B;  4NTE A;  1Y56 A;  4X9N A;  4TM4 A;  2XVI A;  5FS8 A;  1GTH A;  1F8S A;  1NHP A;  1H81 A;  1CJ2 A;  1TDF A;  2WBA A;  3AD7 B;  3GYX A;  1B4V A;  4DSH A;  5JCL A;  3SFE A;  5U63 A;  1GT8 A;  1RP0 A;  3IF9 A;  2VZ2 A;  2YLZ A;  1B5Q A;  1EBD A;  4GF7 A;  1CJ4 A;  3DGZ A;  1XPQ A;  2VRM A;  2B7R A;  3CND A;  2YVG A;  1PBD A;  4UDR A;  4LU6 A;  1K4Q A;  4Z25 A;  1NHR A;  3VRB A;  2WOV A;  2YVJ A;  3ITJ A;  2AQJ A;  1E1N A;  2RGO A;  1N1P A;  2GMH A;  4IA6 A;  3DGH A;  2XLU A;  1DJQ A;  1PBF A;  2VOU A;  3CPH G;  4NEW A;  1COY A;  3BHF A;  4C3X A;  3LB8 A;  1PBE A;  1PS9 A;  1BGN A;  1S3B A;  4UDP A;  2C65 A;  2XFP A;  4M52 A;  2WOW A;  4H4T A;  4Y4N A;  4BK3 A;  1ZOV A;  2YLS A;  1E6E A;  3AE9 A;  3F8P A;  1TDK A;  1TYT A;  3GDN A;  4H2Q A;  2XFU A;  3ATR A;  3NYF A;  3GMB A;  3NT6 A;  4NWZ A;  4JY2 A;  1JNZ A;  3BI4 A;  2OA1 A;  1EL8 A;  2WS3 A;  3P4R A;  2W0H A;  3FBS A;  3NHO X;  4PAA A;  1PHH A;  2OLO A;  3AWI A;  1QLB A;  3LOV A;  4CRT A;  2R45 A;  3GD4 A;  3G5R A;  2DKI A;  3CNT A;  2E4G A;  1QJD A;  4OPI A;  2APG A;  4LA1 A;  2BXR A;  3BI2 A;  4GRT A;  4YTM A;  2YM1 A;  3LAD A;  3HYV A;  3AEG A;  1P2E A;  2YR4 A;  3P4Q A;  3DME A;  3SZF A;  4NTD A;  5EB5 A;  3KA7 A;  1Y0P A;  4OPG A;  1KFY A;  1PJ5 A;  3KLJ A;  5KXJ A;  4EM4 A;  3T14 A;  3UOV A;  2C72 A;  4HA6 A;  3VQR A;  3B3R A;  3RHA A;  1LV0 A;  2WP9 A;  1N4W A;  2BS2 A;  1PDH A;  4G74 A;  4Y4L A;  4JY3 A;  1ELI A;  5J7X A;  3PS9 A;  5JCK A;  3DK9 A;  2R46 A;  3ALM A;  4H4Z A;  3UP5 A;  3UTF A;  1H83 A;  1MOK A;  3ICR A;  1BF3 A;  2EQ9 A;  1FEC A;  4C5O A;  2Z5Y A;  4O5Q A;  3V3N A;  3UKL A;  5BVA A;  4GUV A;  2XLP A;  1QO8 A;  2C7G A;  2XLS A;  3AE2 A;  1H82 A;  1DNC A;  4H2N A;  2GQW A;  3AD9 B;  4NNJ A;  1VRQ B;  2XFO A;  3ATQ A;  4A99 A;  4REK A;  1Q1R A;  4K2X A;  3URH A;  3RP8 A;  3WE0 A;  1GES A;  3T37 A;  4RG3 A;  4NZH A;  4G9K A;  4H4V A;  5BRT A;  4A9W A;  2BRY A;  4NEV A;  5JCN A;  4TM0 A;  2UZZ A;  2JB1 A;  4U8M A;  4AOX A;  3NYE A;  1GAL A;  2C75 A;  5KMP A;  2O9Z A;  3AYL A;  1GRA A;  2B76 A;  2FJE A;  3GD3 A;  1EL7 A;  4FK1 A;  2PYX A;  3G5Q A;  3NK2 X;  5BUL A;  3AXB A;  1F8W A;  3CTY A;  3SYI A;  3CMM A;  2YR6 A;  2PHH A;  5IQ4 A;  1PN0 A;  4H2R A;  2VQB A;  4EQX A;  2BRA A;  3P4P A;  2C73 A;  2BK3 A;  3LXD A;  1D4E A;  1ONF A;  3DK8 A;  5CKU A;  3NG7 X;  1KDG A;  3L8K A;  4H4X A;  4PAB A;  4J34 A;  5FMH A;  4A7A A;  2YLX A;  2C3D A;  3K7Q X;  1W4X A;  3HYX A;  4JDR A;  1NAA A;  5KMR A;  1DXL A;  1E7P A;  4XWR A;  4U2S A;  4N9X A;  2BC1 A;  1NPX A;  1H86 A;  3CNS A;  1N4U A;  1MXT A;  2YG7 A;  1GRB A;  2ZBW A;  4BK2 A;  4CY6 A;  2BCP A;  4AP1 A;  1O5W A;  1LJ1 A;  3KKJ A;  1AOG A;  3SQP A;  2A8X A;  3FG2 P;  3DJE A;  2XLT A;  3VRD B;  4B1B A;  1CC4 A;  3F8R A;  4USR A;  2V5Z A;  2XFQ A;  3DJD A;  2GVC A;  3UP4 A;  3LZX A;  3CPJ G;  2JKC A;  3ICS A;  3UKA A;  2GB0 A;  3OZ2 A;  2B9W A;  3HZL A;  4OPT A;  5DBJ A;  3CGE A;  2V60 A;  1YKJ A;  1IUS A;  4A6N A;  4GR1 A;  1VDC A;  4X9M A;  3FIM B;  1YQ4 A;  2BYB A;  2JBV A;  4BV6 A;  2IVE A;  3QVR A;  4IV9 A;  1KF6 A;  3RNM A;  2J3N A;  4I58 A;  3SZC A;  3QFA A;  3FMW A;  1FCD A;  1YQZ A;  3KD9 A;  4EM3 A;  1DOE A;  3CN8 A;  1DJN A;  2B9X A;  2E5V A;  4HB9 A;  4U8N A;  2BXS A;  3IHG A;  3V76 A;  3ICT A;  1XHC A;  2YG3 A;  3VRA A;  1LQU A;  1TDN A;  3H8I A;  4GAP A;  2C64 A;  4E0V A;  4OPU A;  5U1O A;  1GET A;  1MO9 A;  1OJT A;  4CNK A;  2AR8 A;  2WPE A;  3CIR A;  1F6M A;  4YSY A;  4D04 A;  2C76 A;  1KSU A;  2X8G A;  3II4 A;  4UP3 A;  3UCL A;  3GYI A;  5HY5 A;  4EIQ A;  3F8D A;  2JK6 A;  2H88 A;  4BUR A;  2V3A A;  4U8I A;  4OPL A;  2GEW A;  4Z2U A;  5KOX A;  4H4S A;  1NEN A;  3AE8 A;  5M0Z A;  3SY4 A;  4YTP A;  1XAN A;  3CGB A;  2CDU A;  2Y6Q A;  1NHS A;  4NTC A;  5KNL A;  4IVM B;  4JN9 A;  4KPR A;  3UOZ A;  4AOS A;  2GRT A;  1CJC A;  3EAO A;  2YAU A;  1K0L A;  2GQF A;  3SZ0 A;  1BWC A;  5KVI A;  3AEA A;  4K22 A;  3SM8 A;  4J33 A;  2YR5 A;  3UKQ A;  3M12 A;  1NEK A;  1SEZ A;  4EQR A;  3UTE A;  1ZMD A;  3NRN A;  1H7W A;  2IID A;  4K5R A;  2X8C A;  2A89 A;  2R9Z A;  1DOB A;  3GYJ A;  1V59 A;  1GND A;  2WDV A;  3EAN A;  3AE6 A;  3UTH A;  2XLR A;  1GXF A;  4FX9 A;  2R4E A;  4J2W A;  1JRZ A;  2JB3 A;  5KVH A;  1OJA A;  3RP6 A;  1ZOY A;  2XVF A;  3EF6 A;  1Z6L A;  1VQW A;  3AE3 A;  4A65 A;  1NG4 A;  1ZKQ A;  2B9Y A;  4X4J A;  1XDI A;  3H4K A;  3LZW A;  3IC9 A;  1KNR A;  1LTX R;  3NN0 X;  4AT0 A;  4WX1 A;  4B64 A;  3NK1 X;  4U2L A;  3ZDN A;  3P1W A;  3SZW A;  3ABV A;  3SX6 A;  4BK1 A;  4YT0 A;  2NPX A;  2YG5 A;  1UKV G;  4OPC A;  4Z44 A;  2C67 A;  3H8L A;  3VR8 A;  4FK1 C;  5GSN A;  5L46 A;  2GMJ A;  3NGC X;  3EPT A;  2IVD A;  4YXD A;  5HXI A;  1B8S A;  1PJ6 A;  1PJ7 A;  1L0V A;  4CCR A;  1CJ3 A; 
#chains in the Genus database with same CATH homology
 2VQ7 A;  3GRT A;  3M13 A;  4U8J A;  2BAB A;  2R0G A;  2V6O A;  4B69 A;  1ZMC A;  1IJH A;  4EIP A;  2WOI A;  1JRX A;  3UOX A;  1LVL A;  4EQW A;  4WCT A;  2GAH B;  5HYM A;  2WET A;  4JNQ A;  2BK4 A;  4Z24 A;  2XDO A;  2OAM A;  4YKF A;  1GRF A;  2V61 A;  3K7T A;  5EB4 A;  2F5Z A;  2C66 A;  1JU2 A;  4APN A;  4H4W A;  5CQF A;  1PXC A;  5JCI A;  3DK4 A;  4OVI A;  4BJZ A;  3CNP A;  4UDQ A;  1X31 B;  4ZCD A;  2GR3 A;  1JOA A;  3RP7 A;  4G73 A;  3AEC A;  1ZX9 A;  3KU9 A;  2C4C A;  2FJA A;  1NHQ A;  1OJD A;  2QA1 A;  2B7S A;  2GF3 A;  4Z2R A;  1PBC A;  2RGH A;  3GMC A;  4GDP A;  5ER0 A;  4EMI A;  1CF3 A;  4ADW A;  2NVK X;  1NDA A;  2A87 A;  4YWO A;  4CBQ A;  1CC6 A;  2XCG A;  2R4J A;  2WP5 A;  2WU5 A;  3Q9T A;  4B63 A;  2VRL A;  1KNP A;  1ZP0 A;  2V3B A;  1ZY8 A;  3NNE A;  4DGK A;  2QA2 A;  2WDR A;  3OC4 A;  2XYO A;  4ZN0 A;  3SGL A;  3ALJ A;  4U8K A;  1FEA A;  3AEE A;  2X50 A;  4B67 A;  3KPK A;  4D03 A;  4GDE A;  1Y56 B;  2BA9 A;  2OLN A;  1D4C A;  3UKK A;  4ECH A;  1EL5 A;  4YSZ A;  3AEF A;  2AAQ A;  5KRQ A;  3T0K A;  4XXG A;  3R9U A;  4Y4M A;  4YKG A;  3T31 A;  3QJ4 A;  2GR1 A;  3NYC A;  5HHF A;  4OCG A;  2FBW A;  2YG4 A;  2CUL A;  5FS7 A;  4II2 A;  1HYU A;  2VVM A;  2WHD A;  3AE1 A;  1CC2 A;  1Q9I A;  1IUV A;  1L9C A;  3C4N A;  3C4A A;  3HYW A;  2Q0L A;  1H84 A;  3NLC A;  2GR2 A;  1TRB A;  1KSS A;  2YLR A;  4C3Y A;  4K7Z A;  1H7X A;  4XWZ A;  1E39 A;  2HQM A;  4H7U A;  2BC0 A;  4JNA A;  1N4V A;  2GH5 A;  1VG0 A;  4RG4 A;  3SXI A;  4B68 A;  2YLT A;  3UKH A;  2WDQ A;  1S3E A;  4J36 A;  3QSM A;  5TR3 A;  5KOW A;  4DNA A;  4H4R A;  1PXB A;  4EQS A;  3UKP A;  3UOY A;  3K30 A;  2EQ7 A;  1YQ3 A;  4YTN A;  4TM1 A;  1OJC A;  3T2K A;  3S5W A;  1K0I A;  3K7M X;  5IPY A;  1VG9 A;  2WPC A;  3M0O A;  1FL2 A;  1JEH A;  1IUX A;  5EBK A;  1TDO A;  2X8H A;  4LII A;  4USQ A;  3ALL A;  2H89 A;  4I59 A;  4JQ9 A;  3AE4 A;  1M64 A;  3PVC A;  2YM2 A;  2WQY A;  1P2H A;  5C3J A;  2EQ8 A;  4J56 A;  3UKF A;  1GSN A;  5KMQ A;  2YG6 A;  3C96 A;  4OPD A;  1CHU A;  3D1C A;  5J60 A;  1JRY A;  2X3N A;  3AD8 B;  3JSK A;  4J57 A;  4U2T A;  5JCM A;  2XVE A;  2YVF A;  2Y6R A;  1GOS A;  2WES A;  2XVJ A;  4CNJ A;  4H50 A;  4Z26 A;  2VVL A;  4H4Y A;  4C77 A;  1D5T A;  4P9S A;  2YQU A;  3BNU A;  4RSL A;  2QAE A;  1TYP A;  3NTA A;  4B66 A;  3UTG A;  4C74 A;  1GRT A;  4TM3 A;  1ZK7 A;  1M6I A;  1Q1W A;  2CVJ A;  3KPF A;  4K8D A;  4MJW A;  4DSG A;  3S61 A;  2C70 A;  1FOH A;  2WPF A;  2GR0 A;  5M10 A;  4CY8 A;  1CL0 A;  1FEB A;  2Q6U A;  1JNR A;  4B65 A;  4Z2T A;  1GPE A;  1PXA A;  3DA1 A;  4ZCC A;  3GRS A;  2R0P A;  1F8R A;  2RAB A;  2FJD A;  1D7L A;  1D7Y A;  1LQT A;  2CFY A;  3DH9 A;  3IHM A;  4H4U A;  3I6D A;  4KX6 A;  1GV4 A;  2Z5X A;  5KMS A;  4G6H A;  4H4P A;  2WU2 A;  4EMJ A;  2Q7V A;  4BJY A;  4Z43 A;  4GCM A;  3O0H A;  3P9U A;  1BGJ A;  2FJB A;  3GSI A;  2GAG B;  4O5U A;  1BZL A;  4TLZ A;  1BKW A;  1OJ9 A;  2YLW A;  4GAV A;  4H4Q A;  3ADA B;  1B37 A;  2ZZ0 A;  5GRT A;  4AP3 A;  3CNJ A;  4K5S A;  3GWF A;  1NG3 A;  3AB1 A;  2ACZ A;  1PBB A;  4H2P A;  3T2Y A;  3GWD A;  1GER A;  3BNM A;  3IWA A;  5LV9 A;  3E1T A;  3NIX A;  1IUU A;  3COX A;  5FS9 A;  1RYI A;  4AT2 A;  1GRH A;  3PO7 A;  2ARD A;  1E1K A;  2BK5 A;  3AYJ A;  3CPI G;  3GDP A;  1S2Y A;  3BI5 A;  2EQ6 A;  1L9E A;  3SFD A;  4A5L A;  5KWF A;  1DOD A;  4U8P A;  1D4D A;  2TPR A;  2Q0K A;  3DJJ A;  4U8O A;  4YSH A;  2WP6 A;  2ZZB A;  3QVP A;  1L9D A;  1O95 A;  3ZYX A;  2TMD A;  1REO A;  2XVH A;  1LPF A;  1GTE A;  5BUK A;  1K0J A;  3AED A;  3KVE A;  2VVL G;  3DJG X;  1IUW A;  3NKS A;  2OAL A;  2C3C A;  3B6D A;  2YWL A;  4A79 A;  4U8L A;  2ZZC A;  5U25 A;  3QSS A;  2BS4 A;  2WEU A;  3AE7 A;  4J31 A;  1TDE A;  3NN6 X;  3P4S A;  1ZDL A;  3AE5 A;  3QFB A;  2R0C A;  3L1R A;  3ISH A;  4EMW A;  1E1M A;  2XFN A;  3AYI A;  3NH3 X;  1H6V A;  3RED A;  4G6G A;  5FS6 A;  4IVO B;  3CGC A;  4CCQ A;  2QCU A;  2DKH A;  4YSX A;  1IUT A;  3QSE A;  3CGD A;  4II3 A;  1EL9 A;  2E1M A;  1S2Q A;  1YY5 A;  3V3O A;  4A6N B;  1CBO A;  1E1L A;  1O94 A;  2JAE A;  1GRG A;  3T2Z A;  1GEU A;  4TLX A;  2X99 A;  3G5S A;  5C2T A;  1DOC A;  5IQ1 A;  1F3P A;  2BCG G;  5EOW A;  3I3L A;  1GRE A;  2RGJ A;  3D8X A;  3FPZ A;  2BS3 A;  2JB2 A;  3LJP A;  3NTD A;  4IA5 A;  1RSG A;  3NK0 X;  2GV8 A;  4ICY A;  3VR9 A;  2I0Z A;  2BAC A;  3AEB A;  3BHK A;  3Q6J A;  4FDC B;  4NTE A;  1Y56 A;  4X9N A;  4TM4 A;  2XVI A;  5FS8 A;  1GTH A;  1F8S A;  1NHP A;  1H81 A;  1CJ2 A;  1TDF A;  2WBA A;  3AD7 B;  3GYX A;  1B4V A;  4DSH A;  5JCL A;  3SFE A;  5U63 A;  1GT8 A;  1RP0 A;  3IF9 A;  2VZ2 A;  2YLZ A;  1B5Q A;  1EBD A;  4GF7 A;  1CJ4 A;  3DGZ A;  1XPQ A;  2VRM A;  2B7R A;  3CND A;  2YVG A;  1PBD A;  4UDR A;  4LU6 A;  1K4Q A;  4Z25 A;  1NHR A;  3VRB A;  2WOV A;  2YVJ A;  3ITJ A;  2AQJ A;  1E1N A;  2RGO A;  1N1P A;  2GMH A;  4IA6 A;  3DGH A;  2XLU A;  1DJQ A;  1PBF A;  2VOU A;  3CPH G;  4NEW A;  1COY A;  3BHF A;  4C3X A;  3LB8 A;  1PBE A;  1PS9 A;  1BGN A;  1S3B A;  4UDP A;  2C65 A;  2XFP A;  4M52 A;  2WOW A;  4H4T A;  4Y4N A;  4BK3 A;  1ZOV A;  2YLS A;  1E6E A;  3AE9 A;  3F8P A;  1TDK A;  1TYT A;  3GDN A;  4H2Q A;  2XFU A;  3ATR A;  3NYF A;  3GMB A;  3NT6 A;  4NWZ A;  4JY2 A;  1JNZ A;  3BI4 A;  2OA1 A;  1EL8 A;  2WS3 A;  3P4R A;  2W0H A;  3FBS A;  3NHO X;  4PAA A;  1PHH A;  2OLO A;  3AWI A;  1QLB A;  3LOV A;  4CRT A;  2R45 A;  3GD4 A;  3G5R A;  2DKI A;  3CNT A;  2E4G A;  1QJD A;  4OPI A;  2APG A;  4LA1 A;  2BXR A;  3BI2 A;  4GRT A;  4YTM A;  2YM1 A;  3LAD A;  3HYV A;  3AEG A;  1P2E A;  2YR4 A;  3P4Q A;  3DME A;  3SZF A;  4NTD A;  5EB5 A;  3KA7 A;  1Y0P A;  4OPG A;  1KFY A;  1PJ5 A;  3KLJ A;  5KXJ A;  4EM4 A;  3T14 A;  3UOV A;  2C72 A;  4HA6 A;  3VQR A;  3B3R A;  3RHA A;  1LV0 A;  2WP9 A;  1N4W A;  2BS2 A;  1PDH A;  4G74 A;  4Y4L A;  4JY3 A;  1ELI A;  5J7X A;  3PS9 A;  5JCK A;  3DK9 A;  2R46 A;  3ALM A;  4H4Z A;  3UP5 A;  3UTF A;  1H83 A;  1MOK A;  3ICR A;  1BF3 A;  2EQ9 A;  1FEC A;  4C5O A;  2Z5Y A;  4O5Q A;  3V3N A;  3UKL A;  5BVA A;  4GUV A;  2XLP A;  1QO8 A;  2C7G A;  2XLS A;  3AE2 A;  1H82 A;  1DNC A;  4H2N A;  2GQW A;  3AD9 B;  4NNJ A;  1VRQ B;  2XFO A;  3ATQ A;  4A99 A;  4REK A;  1Q1R A;  4K2X A;  3URH A;  3RP8 A;  3WE0 A;  1GES A;  3T37 A;  4RG3 A;  4NZH A;  4G9K A;  4H4V A;  5BRT A;  4A9W A;  2BRY A;  4NEV A;  5JCN A;  4TM0 A;  2UZZ A;  2JB1 A;  4U8M A;  4AOX A;  3NYE A;  1GAL A;  2C75 A;  5KMP A;  2O9Z A;  3AYL A;  1GRA A;  2B76 A;  2FJE A;  3GD3 A;  1EL7 A;  4FK1 A;  2PYX A;  3G5Q A;  3NK2 X;  5BUL A;  3AXB A;  1F8W A;  3CTY A;  3SYI A;  3CMM A;  2YR6 A;  2PHH A;  5IQ4 A;  1PN0 A;  4H2R A;  2VQB A;  4EQX A;  2BRA A;  3P4P A;  2C73 A;  2BK3 A;  3LXD A;  1D4E A;  1ONF A;  3DK8 A;  5CKU A;  3NG7 X;  1KDG A;  3L8K A;  4H4X A;  4PAB A;  4J34 A;  5FMH A;  4A7A A;  2YLX A;  2C3D A;  3K7Q X;  1W4X A;  3HYX A;  4JDR A;  1NAA A;  5KMR A;  1DXL A;  1E7P A;  4XWR A;  4U2S A;  4N9X A;  2BC1 A;  1NPX A;  1H86 A;  3CNS A;  1N4U A;  1MXT A;  2YG7 A;  1GRB A;  2ZBW A;  4BK2 A;  4CY6 A;  2BCP A;  4AP1 A;  1O5W A;  1LJ1 A;  3KKJ A;  1AOG A;  3SQP A;  2A8X A;  3FG2 P;  3DJE A;  2XLT A;  3VRD B;  4B1B A;  1CC4 A;  3F8R A;  4USR A;  2V5Z A;  2XFQ A;  3DJD A;  2GVC A;  3UP4 A;  3LZX A;  3CPJ G;  2JKC A;  3ICS A;  3UKA A;  2GB0 A;  3OZ2 A;  2B9W A;  3HZL A;  4OPT A;  5DBJ A;  3CGE A;  2V60 A;  1YKJ A;  1IUS A;  4A6N A;  4GR1 A;  1VDC A;  4X9M A;  3FIM B;  1YQ4 A;  2BYB A;  2JBV A;  4BV6 A;  2IVE A;  3QVR A;  4IV9 A;  1KF6 A;  3RNM A;  2J3N A;  4I58 A;  3SZC A;  3QFA A;  3FMW A;  1FCD A;  1YQZ A;  3KD9 A;  4EM3 A;  1DOE A;  3CN8 A;  1DJN A;  2B9X A;  2E5V A;  4HB9 A;  4U8N A;  2BXS A;  3IHG A;  3V76 A;  3ICT A;  1XHC A;  2YG3 A;  3VRA A;  1LQU A;  1TDN A;  3H8I A;  4GAP A;  2C64 A;  4E0V A;  4OPU A;  5U1O A;  1GET A;  1MO9 A;  1OJT A;  4CNK A;  2AR8 A;  2WPE A;  3CIR A;  1F6M A;  4YSY A;  4D04 A;  2C76 A;  1KSU A;  2X8G A;  3II4 A;  4UP3 A;  3UCL A;  3GYI A;  5HY5 A;  4EIQ A;  3F8D A;  2JK6 A;  2H88 A;  4BUR A;  2V3A A;  4U8I A;  4OPL A;  2GEW A;  4Z2U A;  5KOX A;  4H4S A;  1NEN A;  3AE8 A;  5M0Z A;  3SY4 A;  4YTP A;  1XAN A;  3CGB A;  2CDU A;  2Y6Q A;  1NHS A;  4NTC A;  5KNL A;  4IVM B;  4JN9 A;  4KPR A;  3UOZ A;  4AOS A;  2GRT A;  1CJC A;  3EAO A;  2YAU A;  1K0L A;  2GQF A;  3SZ0 A;  1BWC A;  5KVI A;  3AEA A;  4K22 A;  3SM8 A;  4J33 A;  2YR5 A;  3UKQ A;  3M12 A;  1NEK A;  1SEZ A;  4EQR A;  3UTE A;  1ZMD A;  3NRN A;  1H7W A;  2IID A;  4K5R A;  2X8C A;  2A89 A;  2R9Z A;  1DOB A;  3GYJ A;  1V59 A;  1GND A;  2WDV A;  3EAN A;  3AE6 A;  3UTH A;  2XLR A;  1GXF A;  4FX9 A;  2R4E A;  4J2W A;  1JRZ A;  2JB3 A;  5KVH A;  1OJA A;  3RP6 A;  1ZOY A;  2XVF A;  3EF6 A;  1Z6L A;  1VQW A;  3AE3 A;  4A65 A;  1NG4 A;  1ZKQ A;  2B9Y A;  4X4J A;  1XDI A;  3H4K A;  3LZW A;  3IC9 A;  1KNR A;  1LTX R;  3NN0 X;  4AT0 A;  4WX1 A;  4B64 A;  3NK1 X;  4U2L A;  3ZDN A;  3P1W A;  3SZW A;  3ABV A;  3SX6 A;  4BK1 A;  4YT0 A;  2NPX A;  2YG5 A;  1UKV G;  4OPC A;  4Z44 A;  2C67 A;  3H8L A;  3VR8 A;  4FK1 C;  5GSN A;  5L46 A;  2GMJ A;  3NGC X;  3EPT A;  2IVD A;  4YXD A;  5HXI A;  1B8S A;  1PJ6 A;  1PJ7 A;  1L0V A;  4CCR A;  1CJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...