2I0ZA

Crystal structure of a fad binding protein from bacillus cereus, a putative nad(fad)-utilizing dehydrogenases
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
420
structure length
416
Chain Sequence
MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNNEDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVVIAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLNAIISHKMDMLFTHFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNEIDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYNITSALVTGRIAGTTAGENAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD(FAD)-utilizing dehydrogenases
publication title Crystal structure of a FAD binding protein from Bacillus cereus, a putative NAD(FAD)-utilizing dehydrogenases
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
total genus 144
structure length 416
sequence length 420
ec nomenclature
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03486 HI0933_like HI0933-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2i0zA01
1H6VA 4YT0A 4GUVA 4AT0A 4B66A 1W4XA 3BI2A 2YLSA 3NYFA 4JY2A 2BC0A 5J60A 3ICRA 5HHFA 2C66A 1DOCA 2BK3A 4RG3A 3NT6A 1B37A 1CJCA 2VQBA 3IHGA 3AEAA 2CVJA 5KOXA 5L46A 1YQZA 3EAOA 4CCQA 1EL9A 2ARDA 2YAUA 1ZOYA 3AE8A 4H4WA 4I59A 4Z43A 3P4SA 1ELIA 4U2SA 4PABA 1H7WA 2YR6A 2RGHA 2WETA 3ATQA 3F8PA 3ZDNA 2VRMA 1GRFA 4NEWA 4JNAA 4B69A 1DJQA 2WP6A 2E5VA 3AD8B 1LPFA 1CJ2A 4YTPA 1PS9A 4YWOA 1OJ9A 2XVJA 1KDGA 2GQWA 1H83A 3QSMA 5JCKA 1JEHA 3VQRA 2C70A 1BGNA 3KD9A 3HZLA 3KU9A 3B3RA 4OVIA 1OJDA 1FEBA 4IA6A 3B6DA 3SFDA 2XLRA 2YVJA 4AP3A 1Q9IA 4H2PA 2JKCA 4EM4A 1K0JA 4U8NA 2BA9A 2CULA 2B7SA 1KNPA 5BVAA 2GRTA 3H8IA 1NDAA 1L9EA 1FEAA 2YWLA 4BURA 3AYLA 1SEZA 3AWIA 1PJ7A 3C4AA 4OPTA 1AOGA 2Z5YA 1GPEA 2OALA 2YLTA 2AQJA 2BYBA 3CNTA 3CPIG 1KSUA 5EB5A 3UOYA 3NN6X 5JCIA 1N4VA 1GTHA 2A8XA 2YG6A 2VQ7A 4A5LA 1MO9A 3ITJA 2FJDA 4C3XA 5FMHA 3M13A 3AEEA 1S2YA 2WESA 4BK2A 4FX9A 2XDOA 3URHA 3D8XA 1DXLA 1GXFA 1Z6LA 5ER0A 1H81A 2B76A 4JN9A 4YKGA 1O5WA 4E0VA 4YSZA 1LTXR 2V6OA 3DK9A 3SQPA 4A6NA 5JCMA 1QO8A 4CNKA 4EQSA 2GMHA 4EIQA 4H4RA 3AE2A 2FJAA 2Q0KA 1CC4A 3II4A 3UKAA 4ZCDA 3UKQA 2IVDA 2GR3A 4J36A 2DKHA 2YLXA 4H7UA 1YQ3A 5GRTA 3DA1A 3NLCA 3K7TA 2XVEA 3I6DA 1PHHA 3CPJG 2QA2A 2E4GA 3VRBA 4C5OA 4TM1A 2YR5A 5KXJA 3NRNA 4YTNA 5FS6A 4H4ZA 3AEBA 4YSHA 2C7GA 1GRAA 1JNZA 1Y56A 1LJ1A 3GYJA 3SGLA 3UKFA 3P4QA 2XFOA 4A9WA 2GAGB 4YKFA 2CFYA 2ACZA 4IV9A 1IUUA 5TR3A 3NK1X 3UKPA 3KLJA 3AYIA 3P4RA 1PJ5A 3D1CA 2EQ7A 2XLUA 1H82A 3FG2P 4EQXA 2XVIA 1EL7A 2HQMA 1S3BA 3O0HA 3CGDA 2NVKX 4UDQA 4ZCCA 1PBFA 1BF3A 3GD4A 4K7ZA 3G5QA 3UTFA 2BCPA 2X8GA 1QLBA 2R9ZA 3JSKA 1ZMDA 2OLNA 3ABVA 3FIMB 1X31B 2BXRA 4GCMA 1CJ4A 2X8HA 3NTDA 2R4EA 4JNQA 2R0PA 4EMWA 2EQ9A 1FL2A 3ICSA 3LXDA 1TYPA 3V3OA 1P2HA 4GRTA 3AEDA 4H4QA 3BNUA 2B9YA 4EQRA 3AE3A 3AXBA 1YQ4A 2YG3A 2F5ZA 2OA1A 4B64A 5KWFA 1GV4A 3OC4A 1NG3A 2YLWA 4AT2A 1IUVA 3E1TA 3CGBA 3Q6JA 2FBWA 1B8SA 4AOSA 4HB9A 4Y4LA 4UDPA 1E1MA 2TMDA 2APGA 4ECHA 2E1MA 4BJYA 4USRA 2GVCA 1F8WA 4X4JA 1GTEA 3GDNA 4TM0A 1JRYA 1TDOA 2YLZA 5LV9A 3VRAA 4LIIA 3Q9TA 1VG9A 1KSSA 4CY8A 1XANA 3CNDA 1E39A 1LQTA 2GEWA 3UP4A 3ZYXA 4EIPA 1GRBA 3EANA 1TDKA 5CQFA 2NPXA 1ZK7A 3AE5A 3F8RA 4H4YA 3UCLA 1K0LA 4B65A 3L1RA 2UZZA 4OCGA 2XLPA 1JOAA 4OPLA 1NHRA 3UOXA 1VQWA 5EBKA 2X50A 4H4VA 1ZP0A 2XFQA 5C3JA 3M0OA 3NKSA 1VRQB 2RGJA 4GR1A 2WU5A 1NHPA 2CDUA 1KNRA 2ZZBA 3K7MX 3UKLA 4Z2RA 1Y0PA 1IUXA 3UTGA 2JBVA 1VG0A 3FMWA 3NK2X 4WX1A 5GSNA 3RHAA 2R0CA 4U8MA 3KKJA 1S2QA 1CL0A 1PBCA 2C72A 2WBAA 4U8PA 5KVHA 1DJNA 4DSGA 3AEFA 3RP6A 5HY5A 1PDHA 3DJGX 3EPTA 1F6MA 2WOIA 1NENA 3GMCA 1NG4A 3I3LA 5M0ZA 2EQ8A 4A99A 1TYTA 2YM2A 1GSNA 4DSHA 2WPCA 4A6NB 3UTEA 1JNRA 3REDA 1O94A 3RP7A 3DH9A 4H4SA 1GALA 2YLRA 2Z5XA 1MOKA 2B9WA 1D7YA 1DOEA 4H2QA 3NH3X 3QVPA 2GH5A 4JQ9A 2C65A 2WOVA 1IUWA 1NHSA 1P2EA 4CCRA 1JRZA 1RSGA 3ATRA 2BABA 3AE6A 3PVCA 3QJ4A 1S3EA 4J34A 4GDPA 3AECA 4M52A 1TRBA 2JB1A 2PYXA 2Q6UA 2VVLG 4Z2UA 4U8IA 2GV8A 1TDEA 4U8OA 1H7XA 4H2RA 3CPHG 3K7QX 3GWDA 4BK3A 3NK0X 3PO7A 1NHQA 1PBDA 3QFAA 4HA6A 4J57A 3DGHA 3AYJA 4LU6A 3K30A 1OJAA 3GMBA 4U2LA 1DODA 2VVMA 4KX6A 4RG4A 1CC6A 4B63A 4BJZA 4DNAA 3KPFA 1XHCA 4H2NA 1Y56B 3SFEA 3P4PA 4ZN0A 2V3AA 1COYA 1F3PA 1F8SA 2BK5A 2ZZCA 3ALMA 1ONFA 5KOWA 2C76A 2WDQA 4EQWA 2BCGG 3RP8A 2Y6QA 4J31A 2YG5A 4GDEA 3ALLA 4Y4MA 1PXCA 2X99A 3AE4A 1D5TA 2WEUA 3QVRA 2BK4A 3EF6A 3BNMA 4XWZA 1L9CA 4NZHA 4MJWA 2BC1A 1H84A 3NIXA 1IUTA 1PN0A 2BS4A 5DBJA 4EMJA 4EM3A 4U8LA 4IVOB 2JB3A 1GEUA 1PJ6A 4EMIA 1ZMCA 5HXIA 3GSIA 3AE1A 2C3CA 4X9NA 2XFUA 2R45A 5JCNA 1EL5A 2A89A 1CHUA 2QCUA 2JAEA 2C75A 4K22A 5IPYA 1HYUA 3VRDB 2R4JA 1K4QA 4BV6A 5KRQA 2DKIA 2TPRA 2GB0A 2YR4A 3F8DA 5EB4A 3T37A 1JRXA 4H50A 4OPCA 3DJEA 4FDCB 1ZKQA 2WPEA 2VOUA 3ADAB 1E6EA 1D7LA 2GF3A 4NTCA 4D03A 3FBSA 4CBQA 1GREA 1GRGA 1NEKA 1RYIA 3CTYA 1V59A 2GQFA 4A65A 1GNDA 4OPGA 4Z24A 4AP1A 1L0VA 1K0IA 1VDCA 3AD7B 4PAAA 5FS9A 1CBOA 4WCTA 4XXGA 4Z44A 2RABA 1FOHA 4UDRA 3IC9A 1DNCA 3GD3A 4J56A 4A79A 1JU2A 4JDRA 4YSYA 4Z25A 1N4UA 4IA5A 1YKJA 4I58A 3LZWA 1M64A 1NPXA 4CY6A 1OJCA 2VRLA 3QSEA 1TDFA 4Z2TA 2XYOA 2OAMA 2YVGA 2XFNA 4NTDA 4UP3A 2A87A 1D4DA 3FPZA 2GR1A 3AB1A 2RGOA 1IJHA 3G5RA 1E1LA 2IIDA 1PXAA 2WPFA 2GR0A 2H89A 3CN8A 2B7RA 4ADWA 2GAHB 1GESA 1F8RA 2Q0LA 3R9UA 1BZLA 1FECA 1EBDA 2WOWA 3DK4A 3DK8A 4TM3A 3DJJA 3CNJA 4P9SA 3BI4A 4CRTA 2BACA 2C3DA 1D4EA 1XDIA 3NYCA 5IQ1A 2R46A 4K2XA 2AR8A 1EL8A 1RP0A 3AE7A 3IWAA 4YSXA 4YTMA 2IVEA 1CC2A 4X9MA 2WU2A 3COXA 4OPDA 3UP5A 1GOSA 2FJEA 1BGJA 4YXDA 1H86A 4Y4NA 1GETA 1GERA 2XFPA 2XVHA 4FK1A 5KVIA 5BUKA 4B1BA 1D4CA 3DJDA 3UKHA 3S61A 3BHKA 4K8DA 4C77A 1L9DA 4AOXA 2Y6RA 1B4VA 2WS3A 4C3YA 5EOWA 2C67A 1N4WA 1NAAA 1BWCA 3AD9B 2QA1A 3BHFA 3RNMA 4D04A 3G5SA 2WDRA 3LB8A 3IF9A 1PBEA 4K5SA 4KPRA 4DGKA 4BK1A 1IUSA 1LQUA 4H4PA 4U2TA 4TLZA 1E7PA 3LZXA 3P9UA 3C96A 3AEGA 5M10A 1REOA 2XVFA 3DMEA 1Q1WA 1GRTA 3NYEA 1DOBA 4C74A 4JY3A 1OJTA 4REKA 1QJDA 2ZBWA 3SM8A 2XLTA 4OPUA 2JB2A 3IHMA 3LJPA 3CGCA 3UTHA 2B9XA 2V3BA 3GRSA 2QAEA 1ZOVA 1M6IA 5CKUA 4Z26A 1CJ3A 3H4KA 3ICTA 2YVFA 2J3NA 3UOVA 2W0HA 5BULA 3GRTA 3ISHA 2YQUA 3S5WA 2FJBA 3CIRA 3GWFA 1TDNA 2YG7A 4J2WA 3KVEA 2WHDA 3CNPA 4N9XA 4NTEA 2ZZ0A 3NNEA 4U8JA 3KA7A 1Q1RA 3PS9A 1B5QA 2BS3A 2WP5A 3DGZA 2EQ6A 3M12A 2X3NA 1LVLA 2XLSA 2YG4A 4APNA 2V60A 5FS7A 1KFYA 4NEVA 4USQA 1UKVG 3NGCX 3P1WA 1KF6A 3NN0X 2R0GA 5BRTA 3ALJA 2V5ZA 2BXSA 2PHHA 1CF3A 3OZ2A 2YM1A 4TM4A 4IVMB 3CNSA 4B68A 3BI5A 2V61A 4RSLA 5FS8A 3LOVA 1ZX9A 3QFBA 1XPQA 4ICYA 3QSSA 3V76A 3UKKA 1N1PA 1O95A 2AAQA 4FK1C 2I0ZA 3L8KA 2GR2A 4GF7A 4H4TA 4XWRA 5U63A 3NTAA 2JK6A 3AE9A 2X8CA 3C4NA 4H4UA 4OPIA 1FCDA 4H4XA 2BS2A 4B67A 2WQYA 2XCGA 1PBBA 1MXTA 3WE0A 5HYMA 5U25A 3NG7X 1ZDLA 1LV0A 2O9ZA 4U8KA 1ZY8A 4J33A 5U1OA 2Q7VA 4CNJA 5IQ4A 2WDVA 2C73A 3H8LA 4K5RA 3VR8A 5JCLA 2GMJA 2VZ2A 3CGEA 2OLOA 4O5UA 4O5QA 3GDPA 1PXBA 1E1NA 1YY5A 2WP9A 3NHOX 5C2TA 2VVLA 2C64A 3GYIA 4A7AA 1GRHA 1GT8A 4LA1A 1E1KA 5J7XA 3V3NA 3VR9A 1BKWA 2H88A 3UOZA 3LADA 4TLXA
chains in the Genus database with same CATH superfamily
3HYWA 1H6VA 4YT0A 4GUVA 4AT0A 4B66A 1W4XA 3BI2A 2YLSA 3NYFA 4JY2A 2BC0A 5J60A 3ICRA 5HHFA 2C66A 1DOCA 2BK3A 4RG3A 3NT6A 1B37A 1CJCA 2VQBA 3IHGA 3AEAA 2CVJA 5KOXA 5L46A 1YQZA 3EAOA 4CCQA 1EL9A 2ARDA 2YAUA 1ZOYA 3AE8A 4H4WA 4I59A 4Z43A 3P4SA 1ELIA 4U2SA 4PABA 1H7WA 2YR6A 2RGHA 2WETA 3ATQA 3F8PA 4II3A 3ZDNA 2VRMA 1GRFA 4NEWA 4JNAA 4GAVA 4B69A 1DJQA 2WP6A 2E5VA 3AD8B 1LPFA 1CJ2A 4YTPA 1PS9A 4YWOA 1OJ9A 4G6GA 2XVJA 1KDGA 2GQWA 1H83A 3QSMA 5JCKA 1JEHA 3VQRA 2C70A 1BGNA 3KD9A 3HZLA 3KU9A 3B3RA 4OVIA 1OJDA 1FEBA 4IA6A 3B6DA 3SFDA 2XLRA 2YVJA 4AP3A 3T2ZA 1Q9IA 4H2PA 2JKCA 4EM4A 1K0JA 4U8NA 2BA9A 2CULA 2B7SA 1KNPA 5BVAA 2GRTA 3H8IA 1NDAA 1L9EA 1FEAA 2YWLA 3SY4A 3AYLA 4BURA 1SEZA 3AWIA 1PJ7A 3C4AA 4OPTA 1AOGA 2Z5YA 3HYXA 1GPEA 2OALA 2YLTA 2AQJA 2BYBA 3CNTA 3CPIG 1KSUA 5EB5A 3UOYA 3NN6X 5JCIA 1N4VA 1GTHA 2A8XA 2YG6A 2VQ7A 4A5LA 1MO9A 3ITJA 2FJDA 4C3XA 5FMHA 5KMPA 3M13A 3AEEA 1S2YA 2WESA 4BK2A 4FX9A 2XDOA 3URHA 3D8XA 1DXLA 1GXFA 1Z6LA 5ER0A 1H81A 2B76A 4JN9A 4YKGA 1O5WA 4E0VA 4YSZA 1LTXR 2V6OA 3DK9A 3SQPA 4A6NA 5JCMA 1QO8A 4CNKA 4EQSA 2GMHA 4EIQA 4H4RA 3AE2A 2FJAA 2Q0KA 1CC4A 3II4A 3UKAA 4ZCDA 3UKQA 2IVDA 2GR3A 4J36A 2DKHA 2YLXA 4H7UA 1YQ3A 5GRTA 3DA1A 3NLCA 3K7TA 2XVEA 3I6DA 1PHHA 3CPJG 2QA2A 2E4GA 3VRBA 4C5OA 4TM1A 2YR5A 5KXJA 3NRNA 5KMRA 4YTNA 5FS6A 4H4ZA 3AEBA 4YSHA 2C7GA 1GRAA 1JNZA 1Y56A 1LJ1A 3GYJA 3SGLA 3UKFA 3P4QA 2XFOA 4A9WA 2GAGB 4YKFA 2CFYA 2ACZA 4IV9A 1IUUA 5TR3A 3NK1X 3CMMA 3UKPA 3KLJA 3AYIA 3P4RA 1PJ5A 3D1CA 2EQ7A 2XLUA 1H82A 3FG2P 4EQXA 2XVIA 1EL7A 2HQMA 1S3BA 3O0HA 3CGDA 2NVKX 4UDQA 4ZCCA 1PBFA 1BF3A 3GD4A 4K7ZA 3G5QA 3UTFA 2BCPA 2X8GA 1QLBA 2R9ZA 3JSKA 1ZMDA 2OLNA 3ABVA 3FIMB 1X31B 2BXRA 4GCMA 1CJ4A 2X8HA 3NTDA 2R4EA 4JNQA 2R0PA 4EMWA 2EQ9A 2BRYA 1FL2A 3ICSA 3LXDA 1TYPA 3V3OA 1P2HA 4G73A 4GRTA 3AEDA 4H4QA 3BNUA 2B9YA 4EQRA 3AE3A 3AXBA 1YQ4A 2YG3A 2F5ZA 2OA1A 4B64A 5KWFA 1GV4A 3OC4A 1NG3A 4GAPA 2YLWA 4AT2A 1IUVA 3E1TA 3CGBA 3Q6JA 2FBWA 1B8SA 4AOSA 4HB9A 4Y4LA 4UDPA 1E1MA 2TMDA 2APGA 4ECHA 2E1MA 4BJYA 4USRA 2GVCA 1F8WA 4X4JA 1GTEA 3GDNA 4TM0A 1JRYA 1TDOA 2YLZA 5LV9A 3SZCA 3VRAA 4LIIA 3Q9TA 1VG9A 1KSSA 4CY8A 1XANA 3CNDA 1E39A 1LQTA 2GEWA 3UP4A 3ZYXA 4EIPA 1GRBA 3EANA 1TDKA 5CQFA 2NPXA 1ZK7A 3AE5A 3F8RA 4H4YA 3UCLA 1K0LA 4B65A 3L1RA 2UZZA 4OCGA 2XLPA 1JOAA 4OPLA 1NHRA 3UOXA 1VQWA 5EBKA 2X50A 4H4VA 1ZP0A 2XFQA 5C3JA 3M0OA 3NKSA 1VRQB 2RGJA 4GR1A 2WU5A 1NHPA 2CDUA 1KNRA 2ZZBA 3K7MX 3SYIA 3UKLA 1Y0PA 1IUXA 3UTGA 4Z2RA 2JBVA 3KPKA 1VG0A 3FMWA 3NK2X 4WX1A 5GSNA 3RHAA 2R0CA 4U8MA 3KKJA 1S2QA 1CL0A 1PBCA 2C72A 2WBAA 4U8PA 5KVHA 1DJNA 4DSGA 3AEFA 3RP6A 5HY5A 1PDHA 3DJGX 3EPTA 1F6MA 2WOIA 1NENA 3GMCA 1NG4A 3I3LA 5M0ZA 2EQ8A 4A99A 1TYTA 2YM2A 1GSNA 4DSHA 2WPCA 4A6NB 3UTEA 1JNRA 3REDA 1O94A 3RP7A 3DH9A 4H4SA 1GALA 2YLRA 4G74A 2Z5XA 1MOKA 2B9WA 1D7YA 1DOEA 4H2QA 3NH3X 3QVPA 2GH5A 4JQ9A 2C65A 2WOVA 1IUWA 1NHSA 1P2EA 4CCRA 1JRZA 1RSGA 5KNLA 3ATRA 2BABA 3AE6A 3PVCA 3QJ4A 1S3EA 4J34A 4GDPA 3AECA 4M52A 1TRBA 2JB1A 2PYXA 2Q6UA 2VVLG 4Z2UA 3GYXA 4U8IA 2GV8A 1TDEA 4U8OA 1H7XA 4H2RA 3CPHG 3K7QX 3GWDA 4BK3A 3NK0X 3PO7A 1NHQA 1PBDA 3QFAA 3SZFA 4HA6A 4J57A 3DGHA 3AYJA 4LU6A 3K30A 1OJAA 3GMBA 4U2LA 1DODA 2VVMA 4KX6A 4RG4A 1CC6A 5KMQA 4B63A 4BJZA 4DNAA 3KPFA 1XHCA 4H2NA 1Y56B 3SFEA 3P4PA 4G9KA 4ZN0A 2V3AA 1COYA 1F3PA 1F8SA 2BK5A 2ZZCA 3ALMA 1ONFA 5KOWA 2C76A 2WDQA 3T0KA 4EQWA 2BCGG 3RP8A 2Y6QA 4J31A 2YG5A 4GDEA 3ALLA 4Y4MA 5KMSA 1PXCA 2X99A 3AE4A 1D5TA 2WEUA 3QVRA 2BK4A 3EF6A 3BNMA 4XWZA 1L9CA 4NZHA 4MJWA 2BC1A 1H84A 3NIXA 1IUTA 1PN0A 2BS4A 5DBJA 4EMJA 4EM3A 4U8LA 4IVOB 2JB3A 1GEUA 1PJ6A 4EMIA 1ZMCA 3SXIA 5HXIA 3GSIA 3AE1A 2C3CA 4X9NA 2XFUA 2R45A 5JCNA 1EL5A 2A89A 1CHUA 2QCUA 2JAEA 2C75A 4K22A 5IPYA 1HYUA 3VRDB 2R4JA 1K4QA 4BV6A 5KRQA 2DKIA 2TPRA 2GB0A 2YR4A 3F8DA 5EB4A 3T37A 1JRXA 4H50A 4OPCA 3DJEA 4FDCB 2BRAA 1ZKQA 2WPEA 2VOUA 3ADAB 1E6EA 1D7LA 2GF3A 4NTCA 4D03A 3FBSA 4CBQA 1GREA 1GRGA 1NEKA 1RYIA 3CTYA 1V59A 2GQFA 4A65A 1GNDA 4OPGA 4Z24A 4AP1A 1L0VA 1K0IA 1VDCA 3AD7B 4PAAA 5FS9A 1CBOA 4WCTA 3HYVA 4XXGA 4Z44A 2RABA 1FOHA 4UDRA 3IC9A 1DNCA 3GD3A 4J56A 4A79A 1JU2A 4JDRA 4YSYA 4Z25A 1N4UA 4IA5A 1YKJA 4I58A 4II2A 3LZWA 1M64A 1NPXA 3T14A 1OJCA 2VRLA 4CY6A 3QSEA 1TDFA 4Z2TA 2XYOA 2OAMA 2YVGA 2XFNA 4NTDA 4UP3A 3SZ0A 2A87A 1D4DA 3FPZA 2GR1A 3AB1A 2RGOA 1IJHA 3G5RA 1E1LA 2IIDA 1PXAA 2WPFA 2GR0A 2H89A 3CN8A 2B7RA 4ADWA 2GAHB 1GESA 1F8RA 2Q0LA 3R9UA 1BZLA 1FECA 1EBDA 2WOWA 3DK4A 3DK8A 4TM3A 3DJJA 3CNJA 4P9SA 3BI4A 4CRTA 2BACA 2C3DA 1D4EA 1XDIA 3NYCA 5IQ1A 2R46A 4K2XA 2AR8A 1EL8A 1RP0A 3AE7A 3IWAA 4YSXA 4YTMA 2IVEA 1CC2A 4X9MA 2WU2A 3COXA 4OPDA 3UP5A 1GOSA 2FJEA 1BGJA 4YXDA 1H86A 4Y4NA 1GETA 1GERA 2XFPA 2XVHA 4FK1A 5KVIA 3SX6A 5BUKA 4B1BA 1D4CA 3DJDA 3UKHA 3S61A 3BHKA 4K8DA 4C77A 1L9DA 4AOXA 2Y6RA 1B4VA 2WS3A 4C3YA 5EOWA 2C67A 1N4WA 1NAAA 1BWCA 3AD9B 2QA1A 3BHFA 3RNMA 3T31A 4D04A 3G5SA 2WDRA 3LB8A 3IF9A 3T2YA 1PBEA 4K5SA 4KPRA 4DGKA 4G6HA 4BK1A 1IUSA 1LQUA 4H4PA 4U2TA 4TLZA 1E7PA 3LZXA 3P9UA 3C96A 3AEGA 5M10A 1REOA 2XVFA 3DMEA 1Q1WA 3T2KA 1GRTA 3NYEA 1DOBA 4C74A 4JY3A 1OJTA 4REKA 1QJDA 2ZBWA 3SM8A 2XLTA 4OPUA 2JB2A 3IHMA 3LJPA 3CGCA 3UTHA 2B9XA 2V3BA 3GRSA 2QAEA 1ZOVA 1M6IA 5CKUA 4Z26A 1CJ3A 3H4KA 3ICTA 2YVFA 2J3NA 3UOVA 2W0HA 5BULA 3GRTA 3ISHA 2YQUA 3S5WA 2FJBA 3CIRA 3GWFA 1TDNA 2YG7A 4J2WA 3KVEA 2WHDA 3CNPA 4N9XA 4NTEA 2ZZ0A 3NNEA 4U8JA 3KA7A 1Q1RA 3PS9A 4NWZA 1B5QA 2BS3A 2WP5A 3DGZA 2EQ6A 3M12A 2X3NA 1LVLA 2XLSA 2YG4A 4APNA 2V60A 5FS7A 3SZWA 1KFYA 4NEVA 4USQA 1UKVG 3NGCX 3P1WA 1KF6A 3NN0X 2R0GA 5BRTA 3ALJA 2V5ZA 2BXSA 2PHHA 1CF3A 3OZ2A 2YM1A 4TM4A 4IVMB 3CNSA 4B68A 3BI5A 2V61A 4RSLA 5FS8A 3LOVA 1ZX9A 3QFBA 1XPQA 4ICYA 3QSSA 3V76A 3UKKA 1N1PA 1O95A 2AAQA 4FK1C 2I0ZA 3L8KA 2GR2A 4GF7A 4H4TA 4XWRA 5U63A 3NTAA 2JK6A 3AE9A 2X8CA 3C4NA 4H4UA 4OPIA 1FCDA 4H4XA 2BS2A 4B67A 2C4CA 2WQYA 1PBBA 1MXTA 2XCGA 3WE0A 5U25A 3NG7X 5HYMA 1ZDLA 1LV0A 2O9ZA 4U8KA 1ZY8A 4J33A 5U1OA 2Q7VA 4CNJA 5IQ4A 2WDVA 2C73A 3H8LA 4K5RA 3VR8A 5JCLA 2GMJA 2VZ2A 3CGEA 2OLOA 4O5UA 4O5QA 3GDPA 1PXBA 1E1NA 1YY5A 2WP9A 3NHOX 5C2TA 4NNJA 2VVLA 2C64A 3GYIA 4A7AA 1GRHA 1GT8A 4LA1A 1E1KA 5J7XA 3V3NA 3VR9A 1BKWA 2H88A 3UOZA 3LADA 4TLXA
chains in the Genus database with same CATH topology
3HYWA 1H6VA 4YT0A 4GUVA 4AT0A 4B66A 1W4XA 3BI2A 2YLSA 3NYFA 4JY2A 2BC0A 5J60A 3ICRA 5HHFA 2C66A 1DOCA 2BK3A 4RG3A 3NT6A 1B37A 1CJCA 2VQBA 3IHGA 3AEAA 2CVJA 5KOXA 5L46A 1YQZA 3EAOA 4CCQA 1EL9A 2ARDA 2YAUA 1ZOYA 3AE8A 4H4WA 4I59A 4Z43A 3P4SA 1ELIA 4U2SA 4PABA 1H7WA 2YR6A 2RGHA 2WETA 3ATQA 3F8PA 4II3A 3ZDNA 2VRMA 1GRFA 4NEWA 4JNAA 4GAVA 4B69A 1DJQA 2WP6A 2E5VA 3AD8B 1LPFA 1CJ2A 4YTPA 1PS9A 4YWOA 1OJ9A 4G6GA 2XVJA 1KDGA 2GQWA 1H83A 3QSMA 5JCKA 1JEHA 3VQRA 2C70A 1BGNA 3KD9A 3HZLA 3KU9A 3B3RA 4OVIA 1OJDA 1FEBA 4IA6A 3B6DA 3SFDA 2XLRA 2YVJA 4AP3A 3T2ZA 1Q9IA 4H2PA 2JKCA 4EM4A 1K0JA 4U8NA 2BA9A 2CULA 2B7SA 1KNPA 5BVAA 2GRTA 3H8IA 1NDAA 1L9EA 1FEAA 2YWLA 3SY4A 3AYLA 4BURA 1SEZA 3AWIA 1PJ7A 3C4AA 4OPTA 1AOGA 2Z5YA 3HYXA 1GPEA 2OALA 2YLTA 2AQJA 2BYBA 3CNTA 3CPIG 1KSUA 5EB5A 3UOYA 3NN6X 5JCIA 1N4VA 1GTHA 2A8XA 2YG6A 2VQ7A 4A5LA 1MO9A 3ITJA 2FJDA 4C3XA 5FMHA 5KMPA 3M13A 3AEEA 1S2YA 2WESA 4BK2A 4FX9A 2XDOA 3URHA 3D8XA 1DXLA 1GXFA 1Z6LA 5ER0A 1H81A 2B76A 4JN9A 4YKGA 1O5WA 4E0VA 4YSZA 1LTXR 2V6OA 3DK9A 3SQPA 4A6NA 5JCMA 1QO8A 4CNKA 4EQSA 2GMHA 4EIQA 4H4RA 3AE2A 2FJAA 2Q0KA 1CC4A 3II4A 3UKAA 4ZCDA 3UKQA 2IVDA 2GR3A 4J36A 2DKHA 2YLXA 4H7UA 1YQ3A 5GRTA 3DA1A 3NLCA 3K7TA 2XVEA 3I6DA 1PHHA 3CPJG 2QA2A 2E4GA 3VRBA 4C5OA 4TM1A 2YR5A 5KXJA 3NRNA 5KMRA 4YTNA 5FS6A 4H4ZA 3AEBA 4YSHA 2C7GA 1GRAA 1JNZA 1Y56A 1LJ1A 3GYJA 3SGLA 3UKFA 3P4QA 2XFOA 4A9WA 2GAGB 4YKFA 2CFYA 2ACZA 4IV9A 1IUUA 5TR3A 3NK1X 3CMMA 3UKPA 3KLJA 3AYIA 3P4RA 1PJ5A 3D1CA 2EQ7A 2XLUA 1H82A 3FG2P 4EQXA 2XVIA 1EL7A 2HQMA 1S3BA 3O0HA 3CGDA 2NVKX 4UDQA 4ZCCA 1PBFA 1BF3A 3GD4A 4K7ZA 3G5QA 3UTFA 2BCPA 2X8GA 1QLBA 2R9ZA 3JSKA 1ZMDA 2OLNA 3ABVA 3FIMB 1X31B 2BXRA 4GCMA 1CJ4A 2X8HA 3NTDA 2R4EA 4JNQA 2R0PA 4EMWA 2EQ9A 2BRYA 1FL2A 3ICSA 3LXDA 1TYPA 3V3OA 1P2HA 4G73A 4GRTA 3AEDA 4H4QA 3BNUA 2B9YA 4EQRA 3AE3A 3AXBA 1YQ4A 2YG3A 2F5ZA 2OA1A 4B64A 5KWFA 1GV4A 3OC4A 1NG3A 4GAPA 2YLWA 4AT2A 1IUVA 3E1TA 3CGBA 3Q6JA 2FBWA 1B8SA 4AOSA 4HB9A 4Y4LA 4UDPA 1E1MA 2TMDA 2APGA 4ECHA 2E1MA 4BJYA 4USRA 2GVCA 1F8WA 4X4JA 1GTEA 3GDNA 4TM0A 1JRYA 1TDOA 2YLZA 5LV9A 3SZCA 3VRAA 4LIIA 3Q9TA 1VG9A 1KSSA 4CY8A 1XANA 3CNDA 1E39A 1LQTA 2GEWA 3UP4A 3ZYXA 4EIPA 1GRBA 3EANA 1TDKA 5CQFA 2NPXA 1ZK7A 3AE5A 3F8RA 4H4YA 3UCLA 1K0LA 4B65A 3L1RA 2UZZA 4OCGA 2XLPA 1JOAA 4OPLA 1NHRA 3UOXA 1VQWA 5EBKA 2X50A 4H4VA 1ZP0A 2XFQA 5C3JA 3M0OA 3NKSA 1VRQB 2RGJA 4GR1A 2WU5A 1NHPA 2CDUA 1KNRA 2ZZBA 3K7MX 3SYIA 3UKLA 1Y0PA 1IUXA 3UTGA 4Z2RA 2JBVA 3KPKA 1VG0A 3FMWA 3NK2X 4WX1A 5GSNA 3RHAA 2R0CA 4U8MA 3KKJA 1S2QA 1CL0A 1PBCA 2C72A 2WBAA 4U8PA 5KVHA 1DJNA 4DSGA 3AEFA 3RP6A 5HY5A 1PDHA 3DJGX 3EPTA 1F6MA 2WOIA 1NENA 3GMCA 1NG4A 3I3LA 5M0ZA 2EQ8A 4A99A 1TYTA 2YM2A 1GSNA 4DSHA 2WPCA 4A6NB 3UTEA 1JNRA 3REDA 1O94A 3RP7A 3DH9A 4H4SA 1GALA 2YLRA 4G74A 2Z5XA 1MOKA 2B9WA 1D7YA 1DOEA 4H2QA 3NH3X 3QVPA 2GH5A 4JQ9A 2C65A 2WOVA 1IUWA 1NHSA 1P2EA 4CCRA 1JRZA 1RSGA 5KNLA 3ATRA 2BABA 3AE6A 3PVCA 3QJ4A 1S3EA 4J34A 4GDPA 3AECA 4M52A 1TRBA 2JB1A 2PYXA 2Q6UA 2VVLG 4Z2UA 3GYXA 4U8IA 2GV8A 1TDEA 4U8OA 1H7XA 4H2RA 3CPHG 3K7QX 3GWDA 4BK3A 3NK0X 3PO7A 1NHQA 1PBDA 3QFAA 3SZFA 4HA6A 4J57A 3DGHA 3AYJA 4LU6A 3K30A 1OJAA 3GMBA 4U2LA 1DODA 2VVMA 4KX6A 4RG4A 1CC6A 5KMQA 4B63A 4BJZA 4DNAA 3KPFA 1XHCA 4H2NA 1Y56B 3SFEA 3P4PA 4G9KA 4ZN0A 2V3AA 1COYA 1F3PA 1F8SA 2BK5A 2ZZCA 3ALMA 1ONFA 5KOWA 2C76A 2WDQA 3T0KA 4EQWA 2BCGG 3RP8A 2Y6QA 4J31A 2YG5A 4GDEA 3ALLA 4Y4MA 5KMSA 1PXCA 2X99A 3AE4A 1D5TA 2WEUA 3QVRA 2BK4A 3EF6A 3BNMA 4XWZA 1L9CA 4NZHA 4MJWA 2BC1A 1H84A 3NIXA 1IUTA 1PN0A 2BS4A 5DBJA 4EMJA 4EM3A 4U8LA 4IVOB 2JB3A 1GEUA 1PJ6A 4EMIA 1ZMCA 3SXIA 5HXIA 3GSIA 3AE1A 2C3CA 4X9NA 2XFUA 2R45A 5JCNA 1EL5A 2A89A 1CHUA 2QCUA 2JAEA 2C75A 4K22A 5IPYA 1HYUA 3VRDB 2R4JA 1K4QA 4BV6A 5KRQA 2DKIA 2TPRA 2GB0A 2YR4A 3F8DA 5EB4A 3T37A 1JRXA 4H50A 4OPCA 3DJEA 4FDCB 2BRAA 1ZKQA 2WPEA 2VOUA 3ADAB 1E6EA 1D7LA 2GF3A 4NTCA 4D03A 3FBSA 4CBQA 1GREA 1GRGA 1NEKA 1RYIA 3CTYA 1V59A 2GQFA 4A65A 1GNDA 4OPGA 4Z24A 4AP1A 1L0VA 1K0IA 1VDCA 3AD7B 4PAAA 5FS9A 1CBOA 4WCTA 3HYVA 4XXGA 4Z44A 2RABA 1FOHA 4UDRA 3IC9A 1DNCA 3GD3A 4J56A 4A79A 1JU2A 4JDRA 4YSYA 4Z25A 1N4UA 4IA5A 1YKJA 4I58A 4II2A 3LZWA 1M64A 1NPXA 3T14A 1OJCA 2VRLA 4CY6A 3QSEA 1TDFA 4Z2TA 2XYOA 2OAMA 2YVGA 2XFNA 4NTDA 4UP3A 3SZ0A 2A87A 1D4DA 3FPZA 2GR1A 3AB1A 2RGOA 1IJHA 3G5RA 1E1LA 2IIDA 1PXAA 2WPFA 2GR0A 2H89A 3CN8A 2B7RA 4ADWA 2GAHB 1GESA 1F8RA 2Q0LA 3R9UA 1BZLA 1FECA 1EBDA 2WOWA 3DK4A 3DK8A 4TM3A 3DJJA 3CNJA 4P9SA 3BI4A 4CRTA 2BACA 2C3DA 1D4EA 1XDIA 3NYCA 5IQ1A 2R46A 4K2XA 2AR8A 1EL8A 1RP0A 3AE7A 3IWAA 4YSXA 4YTMA 2IVEA 1CC2A 4X9MA 2WU2A 3COXA 4OPDA 3UP5A 1GOSA 2FJEA 1BGJA 4YXDA 1H86A 4Y4NA 1GETA 1GERA 2XFPA 2XVHA 4FK1A 5KVIA 3SX6A 5BUKA 4B1BA 1D4CA 3DJDA 3UKHA 3S61A 3BHKA 4K8DA 4C77A 1L9DA 4AOXA 2Y6RA 1B4VA 2WS3A 4C3YA 5EOWA 2C67A 1N4WA 1NAAA 1BWCA 3AD9B 2QA1A 3BHFA 3RNMA 3T31A 4D04A 3G5SA 2WDRA 3LB8A 3IF9A 3T2YA 1PBEA 4K5SA 4KPRA 4DGKA 4G6HA 4BK1A 1IUSA 1LQUA 4H4PA 4U2TA 4TLZA 1E7PA 3LZXA 3P9UA 3C96A 3AEGA 5M10A 1REOA 2XVFA 3DMEA 1Q1WA 3T2KA 1GRTA 3NYEA 1DOBA 4C74A 4JY3A 1OJTA 4REKA 1QJDA 2ZBWA 3SM8A 2XLTA 4OPUA 2JB2A 3IHMA 3LJPA 3CGCA 3UTHA 2B9XA 2V3BA 3GRSA 2QAEA 1ZOVA 1M6IA 5CKUA 4Z26A 1CJ3A 3H4KA 3ICTA 2YVFA 2J3NA 3UOVA 2W0HA 5BULA 3GRTA 3ISHA 2YQUA 3S5WA 2FJBA 3CIRA 3GWFA 1TDNA 2YG7A 4J2WA 3KVEA 2WHDA 3CNPA 4N9XA 4NTEA 2ZZ0A 3NNEA 4U8JA 3KA7A 1Q1RA 3PS9A 4NWZA 1B5QA 2BS3A 2WP5A 3DGZA 2EQ6A 3M12A 2X3NA 1LVLA 2XLSA 2YG4A 4APNA 2V60A 5FS7A 3SZWA 1KFYA 4NEVA 4USQA 1UKVG 3NGCX 3P1WA 1KF6A 3NN0X 2R0GA 5BRTA 3ALJA 2V5ZA 2BXSA 2PHHA 1CF3A 3OZ2A 2YM1A 4TM4A 4IVMB 3CNSA 4B68A 3BI5A 2V61A 4RSLA 5FS8A 3LOVA 1ZX9A 3QFBA 1XPQA 4ICYA 3QSSA 3V76A 3UKKA 1N1PA 1O95A 2AAQA 4FK1C 2I0ZA 3L8KA 2GR2A 4GF7A 4H4TA 4XWRA 5U63A 3NTAA 2JK6A 3AE9A 2X8CA 3C4NA 4H4UA 4OPIA 1FCDA 4H4XA 2BS2A 4B67A 2C4CA 2WQYA 1PBBA 1MXTA 2XCGA 3WE0A 5U25A 3NG7X 5HYMA 1ZDLA 1LV0A 2O9ZA 4U8KA 1ZY8A 4J33A 5U1OA 2Q7VA 4CNJA 5IQ4A 2WDVA 2C73A 3H8LA 4K5RA 3VR8A 5JCLA 2GMJA 2VZ2A 3CGEA 2OLOA 4O5UA 4O5QA 3GDPA 1PXBA 1E1NA 1YY5A 2WP9A 3NHOX 5C2TA 4NNJA 2VVLA 2C64A 3GYIA 4A7AA 1GRHA 1GT8A 4LA1A 1E1KA 5J7XA 3V3NA 3VR9A 1BKWA 2H88A 3UOZA 3LADA 4TLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6V A;  4YT0 A;  4GUV A;  4AT0 A;  4B66 A;  1W4X A;  3BI2 A;  2YLS A;  3NYF A;  4JY2 A;  2BC0 A;  5J60 A;  3ICR A;  5HHF A;  2C66 A;  1DOC A;  2BK3 A;  4RG3 A;  3NT6 A;  1B37 A;  1CJC A;  2VQB A;  3IHG A;  3AEA A;  2CVJ A;  5KOX A;  5L46 A;  1YQZ A;  3EAO A;  4CCQ A;  1EL9 A;  2ARD A;  2YAU A;  1ZOY A;  3AE8 A;  4H4W A;  4I59 A;  4Z43 A;  3P4S A;  1ELI A;  4U2S A;  4PAB A;  1H7W A;  2YR6 A;  2RGH A;  2WET A;  3ATQ A;  3F8P A;  3ZDN A;  2VRM A;  1GRF A;  4NEW A;  4JNA A;  4B69 A;  1DJQ A;  2WP6 A;  2E5V A;  3AD8 B;  1LPF A;  1CJ2 A;  4YTP A;  1PS9 A;  4YWO A;  1OJ9 A;  2XVJ A;  1KDG A;  2GQW A;  1H83 A;  3QSM A;  5JCK A;  1JEH A;  3VQR A;  2C70 A;  1BGN A;  3KD9 A;  3HZL A;  3KU9 A;  3B3R A;  4OVI A;  1OJD A;  1FEB A;  4IA6 A;  3B6D A;  3SFD A;  2XLR A;  2YVJ A;  4AP3 A;  1Q9I A;  4H2P A;  2JKC A;  4EM4 A;  1K0J A;  4U8N A;  2BA9 A;  2CUL A;  2B7S A;  1KNP A;  5BVA A;  2GRT A;  3H8I A;  1NDA A;  1L9E A;  1FEA A;  2YWL A;  4BUR A;  3AYL A;  1SEZ A;  3AWI A;  1PJ7 A;  3C4A A;  4OPT A;  1AOG A;  2Z5Y A;  1GPE A;  2OAL A;  2YLT A;  2AQJ A;  2BYB A;  3CNT A;  3CPI G;  1KSU A;  5EB5 A;  3UOY A;  3NN6 X;  5JCI A;  1N4V A;  1GTH A;  2A8X A;  2YG6 A;  2VQ7 A;  4A5L A;  1MO9 A;  3ITJ A;  2FJD A;  4C3X A;  5FMH A;  3M13 A;  3AEE A;  1S2Y A;  2WES A;  4BK2 A;  4FX9 A;  2XDO A;  3URH A;  3D8X A;  1DXL A;  1GXF A;  1Z6L A;  5ER0 A;  1H81 A;  2B76 A;  4JN9 A;  4YKG A;  1O5W A;  4E0V A;  4YSZ A;  1LTX R;  2V6O A;  3DK9 A;  3SQP A;  4A6N A;  5JCM A;  1QO8 A;  4CNK A;  4EQS A;  2GMH A;  4EIQ A;  4H4R A;  3AE2 A;  2FJA A;  2Q0K A;  1CC4 A;  3II4 A;  3UKA A;  4ZCD A;  3UKQ A;  2IVD A;  2GR3 A;  4J36 A;  2DKH A;  2YLX A;  4H7U A;  1YQ3 A;  5GRT A;  3DA1 A;  3NLC A;  3K7T A;  2XVE A;  3I6D A;  1PHH A;  3CPJ G;  2QA2 A;  2E4G A;  3VRB A;  4C5O A;  4TM1 A;  2YR5 A;  5KXJ A;  3NRN A;  4YTN A;  5FS6 A;  4H4Z A;  3AEB A;  4YSH A;  2C7G A;  1GRA A;  1JNZ A;  1Y56 A;  1LJ1 A;  3GYJ A;  3SGL A;  3UKF A;  3P4Q A;  2XFO A;  4A9W A;  2GAG B;  4YKF A;  2CFY A;  2ACZ A;  4IV9 A;  1IUU A;  5TR3 A;  3NK1 X;  3UKP A;  3KLJ A;  3AYI A;  3P4R A;  1PJ5 A;  3D1C A;  2EQ7 A;  2XLU A;  1H82 A;  3FG2 P;  4EQX A;  2XVI A;  1EL7 A;  2HQM A;  1S3B A;  3O0H A;  3CGD A;  2NVK X;  4UDQ A;  4ZCC A;  1PBF A;  1BF3 A;  3GD4 A;  4K7Z A;  3G5Q A;  3UTF A;  2BCP A;  2X8G A;  1QLB A;  2R9Z A;  3JSK A;  1ZMD A;  2OLN A;  3ABV A;  3FIM B;  1X31 B;  2BXR A;  4GCM A;  1CJ4 A;  2X8H A;  3NTD A;  2R4E A;  4JNQ A;  2R0P A;  4EMW A;  2EQ9 A;  1FL2 A;  3ICS A;  3LXD A;  1TYP A;  3V3O A;  1P2H A;  4GRT A;  3AED A;  4H4Q A;  3BNU A;  2B9Y A;  4EQR A;  3AE3 A;  3AXB A;  1YQ4 A;  2YG3 A;  2F5Z A;  2OA1 A;  4B64 A;  5KWF A;  1GV4 A;  3OC4 A;  1NG3 A;  2YLW A;  4AT2 A;  1IUV A;  3E1T A;  3CGB A;  3Q6J A;  2FBW A;  1B8S A;  4AOS A;  4HB9 A;  4Y4L A;  4UDP A;  1E1M A;  2TMD A;  2APG A;  4ECH A;  2E1M A;  4BJY A;  4USR A;  2GVC A;  1F8W A;  4X4J A;  1GTE A;  3GDN A;  4TM0 A;  1JRY A;  1TDO A;  2YLZ A;  5LV9 A;  3VRA A;  4LII A;  3Q9T A;  1VG9 A;  1KSS A;  4CY8 A;  1XAN A;  3CND A;  1E39 A;  1LQT A;  2GEW A;  3UP4 A;  3ZYX A;  4EIP A;  1GRB A;  3EAN A;  1TDK A;  5CQF A;  2NPX A;  1ZK7 A;  3AE5 A;  3F8R A;  4H4Y A;  3UCL A;  1K0L A;  4B65 A;  3L1R A;  2UZZ A;  4OCG A;  2XLP A;  1JOA A;  4OPL A;  1NHR A;  3UOX A;  1VQW A;  5EBK A;  2X50 A;  4H4V A;  1ZP0 A;  2XFQ A;  5C3J A;  3M0O A;  3NKS A;  1VRQ B;  2RGJ A;  4GR1 A;  2WU5 A;  1NHP A;  2CDU A;  1KNR A;  2ZZB A;  3K7M X;  3UKL A;  4Z2R A;  1Y0P A;  1IUX A;  3UTG A;  2JBV A;  1VG0 A;  3FMW A;  3NK2 X;  4WX1 A;  5GSN A;  3RHA A;  2R0C A;  4U8M A;  3KKJ A;  1S2Q A;  1CL0 A;  1PBC A;  2C72 A;  2WBA A;  4U8P A;  5KVH A;  1DJN A;  4DSG A;  3AEF A;  3RP6 A;  5HY5 A;  1PDH A;  3DJG X;  3EPT A;  1F6M A;  2WOI A;  1NEN A;  3GMC A;  1NG4 A;  3I3L A;  5M0Z A;  2EQ8 A;  4A99 A;  1TYT A;  2YM2 A;  1GSN A;  4DSH A;  2WPC A;  4A6N B;  3UTE A;  1JNR A;  3RED A;  1O94 A;  3RP7 A;  3DH9 A;  4H4S A;  1GAL A;  2YLR A;  2Z5X A;  1MOK A;  2B9W A;  1D7Y A;  1DOE A;  4H2Q A;  3NH3 X;  3QVP A;  2GH5 A;  4JQ9 A;  2C65 A;  2WOV A;  1IUW A;  1NHS A;  1P2E A;  4CCR A;  1JRZ A;  1RSG A;  3ATR A;  2BAB A;  3AE6 A;  3PVC A;  3QJ4 A;  1S3E A;  4J34 A;  4GDP A;  3AEC A;  4M52 A;  1TRB A;  2JB1 A;  2PYX A;  2Q6U A;  2VVL G;  4Z2U A;  4U8I A;  2GV8 A;  1TDE A;  4U8O A;  1H7X A;  4H2R A;  3CPH G;  3K7Q X;  3GWD A;  4BK3 A;  3NK0 X;  3PO7 A;  1NHQ A;  1PBD A;  3QFA A;  4HA6 A;  4J57 A;  3DGH A;  3AYJ A;  4LU6 A;  3K30 A;  1OJA A;  3GMB A;  4U2L A;  1DOD A;  2VVM A;  4KX6 A;  4RG4 A;  1CC6 A;  4B63 A;  4BJZ A;  4DNA A;  3KPF A;  1XHC A;  4H2N A;  1Y56 B;  3SFE A;  3P4P A;  4ZN0 A;  2V3A A;  1COY A;  1F3P A;  1F8S A;  2BK5 A;  2ZZC A;  3ALM A;  1ONF A;  5KOW A;  2C76 A;  2WDQ A;  4EQW A;  2BCG G;  3RP8 A;  2Y6Q A;  4J31 A;  2YG5 A;  4GDE A;  3ALL A;  4Y4M A;  1PXC A;  2X99 A;  3AE4 A;  1D5T A;  2WEU A;  3QVR A;  2BK4 A;  3EF6 A;  3BNM A;  4XWZ A;  1L9C A;  4NZH A;  4MJW A;  2BC1 A;  1H84 A;  3NIX A;  1IUT A;  1PN0 A;  2BS4 A;  5DBJ A;  4EMJ A;  4EM3 A;  4U8L A;  4IVO B;  2JB3 A;  1GEU A;  1PJ6 A;  4EMI A;  1ZMC A;  5HXI A;  3GSI A;  3AE1 A;  2C3C A;  4X9N A;  2XFU A;  2R45 A;  5JCN A;  1EL5 A;  2A89 A;  1CHU A;  2QCU A;  2JAE A;  2C75 A;  4K22 A;  5IPY A;  1HYU A;  3VRD B;  2R4J A;  1K4Q A;  4BV6 A;  5KRQ A;  2DKI A;  2TPR A;  2GB0 A;  2YR4 A;  3F8D A;  5EB4 A;  3T37 A;  1JRX A;  4H50 A;  4OPC A;  3DJE A;  4FDC B;  1ZKQ A;  2WPE A;  2VOU A;  3ADA B;  1E6E A;  1D7L A;  2GF3 A;  4NTC A;  4D03 A;  3FBS A;  4CBQ A;  1GRE A;  1GRG A;  1NEK A;  1RYI A;  3CTY A;  1V59 A;  2GQF A;  4A65 A;  1GND A;  4OPG A;  4Z24 A;  4AP1 A;  1L0V A;  1K0I A;  1VDC A;  3AD7 B;  4PAA A;  5FS9 A;  1CBO A;  4WCT A;  4XXG A;  4Z44 A;  2RAB A;  1FOH A;  4UDR A;  3IC9 A;  1DNC A;  3GD3 A;  4J56 A;  4A79 A;  1JU2 A;  4JDR A;  4YSY A;  4Z25 A;  1N4U A;  4IA5 A;  1YKJ A;  4I58 A;  3LZW A;  1M64 A;  1NPX A;  4CY6 A;  1OJC A;  2VRL A;  3QSE A;  1TDF A;  4Z2T A;  2XYO A;  2OAM A;  2YVG A;  2XFN A;  4NTD A;  4UP3 A;  2A87 A;  1D4D A;  3FPZ A;  2GR1 A;  3AB1 A;  2RGO A;  1IJH A;  3G5R A;  1E1L A;  2IID A;  1PXA A;  2WPF A;  2GR0 A;  2H89 A;  3CN8 A;  2B7R A;  4ADW A;  2GAH B;  1GES A;  1F8R A;  2Q0L A;  3R9U A;  1BZL A;  1FEC A;  1EBD A;  2WOW A;  3DK4 A;  3DK8 A;  4TM3 A;  3DJJ A;  3CNJ A;  4P9S A;  3BI4 A;  4CRT A;  2BAC A;  2C3D A;  1D4E A;  1XDI A;  3NYC A;  5IQ1 A;  2R46 A;  4K2X A;  2AR8 A;  1EL8 A;  1RP0 A;  3AE7 A;  3IWA A;  4YSX A;  4YTM A;  2IVE A;  1CC2 A;  4X9M A;  2WU2 A;  3COX A;  4OPD A;  3UP5 A;  1GOS A;  2FJE A;  1BGJ A;  4YXD A;  1H86 A;  4Y4N A;  1GET A;  1GER A;  2XFP A;  2XVH A;  4FK1 A;  5KVI A;  5BUK A;  4B1B A;  1D4C A;  3DJD A;  3UKH A;  3S61 A;  3BHK A;  4K8D A;  4C77 A;  1L9D A;  4AOX A;  2Y6R A;  1B4V A;  2WS3 A;  4C3Y A;  5EOW A;  2C67 A;  1N4W A;  1NAA A;  1BWC A;  3AD9 B;  2QA1 A;  3BHF A;  3RNM A;  4D04 A;  3G5S A;  2WDR A;  3LB8 A;  3IF9 A;  1PBE A;  4K5S A;  4KPR A;  4DGK A;  4BK1 A;  1IUS A;  1LQU A;  4H4P A;  4U2T A;  4TLZ A;  1E7P A;  3LZX A;  3P9U A;  3C96 A;  3AEG A;  5M10 A;  1REO A;  2XVF A;  3DME A;  1Q1W A;  1GRT A;  3NYE A;  1DOB A;  4C74 A;  4JY3 A;  1OJT A;  4REK A;  1QJD A;  2ZBW A;  3SM8 A;  2XLT A;  4OPU A;  2JB2 A;  3IHM A;  3LJP A;  3CGC A;  3UTH A;  2B9X A;  2V3B A;  3GRS A;  2QAE A;  1ZOV A;  1M6I A;  5CKU A;  4Z26 A;  1CJ3 A;  3H4K A;  3ICT A;  2YVF A;  2J3N A;  3UOV A;  2W0H A;  5BUL A;  3GRT A;  3ISH A;  2YQU A;  3S5W A;  2FJB A;  3CIR A;  3GWF A;  1TDN A;  2YG7 A;  4J2W A;  3KVE A;  2WHD A;  3CNP A;  4N9X A;  4NTE A;  2ZZ0 A;  3NNE A;  4U8J A;  3KA7 A;  1Q1R A;  3PS9 A;  1B5Q A;  2BS3 A;  2WP5 A;  3DGZ A;  2EQ6 A;  3M12 A;  2X3N A;  1LVL A;  2XLS A;  2YG4 A;  4APN A;  2V60 A;  5FS7 A;  1KFY A;  4NEV A;  4USQ A;  1UKV G;  3NGC X;  3P1W A;  1KF6 A;  3NN0 X;  2R0G A;  5BRT A;  3ALJ A;  2V5Z A;  2BXS A;  2PHH A;  1CF3 A;  3OZ2 A;  2YM1 A;  4TM4 A;  4IVM B;  3CNS A;  4B68 A;  3BI5 A;  2V61 A;  4RSL A;  5FS8 A;  3LOV A;  1ZX9 A;  3QFB A;  1XPQ A;  4ICY A;  3QSS A;  3V76 A;  3UKK A;  1N1P A;  1O95 A;  2AAQ A;  4FK1 C;  2I0Z A;  3L8K A;  2GR2 A;  4GF7 A;  4H4T A;  4XWR A;  5U63 A;  3NTA A;  2JK6 A;  3AE9 A;  2X8C A;  3C4N A;  4H4U A;  4OPI A;  1FCD A;  4H4X A;  2BS2 A;  4B67 A;  2WQY A;  2XCG A;  1PBB A;  1MXT A;  3WE0 A;  5HYM A;  5U25 A;  3NG7 X;  1ZDL A;  1LV0 A;  2O9Z A;  4U8K A;  1ZY8 A;  4J33 A;  5U1O A;  2Q7V A;  4CNJ A;  5IQ4 A;  2WDV A;  2C73 A;  3H8L A;  4K5R A;  3VR8 A;  5JCL A;  2GMJ A;  2VZ2 A;  3CGE A;  2OLO A;  4O5U A;  4O5Q A;  3GDP A;  1PXB A;  1E1N A;  1YY5 A;  2WP9 A;  3NHO X;  5C2T A;  2VVL A;  2C64 A;  3GYI A;  4A7A A;  1GRH A;  1GT8 A;  4LA1 A;  1E1K A;  5J7X A;  3V3N A;  3VR9 A;  1BKW A;  2H88 A;  3UOZ A;  3LAD A;  4TLX A; 
#chains in the Genus database with same CATH topology
 3HYW A;  1H6V A;  4YT0 A;  4GUV A;  4AT0 A;  4B66 A;  1W4X A;  3BI2 A;  2YLS A;  3NYF A;  4JY2 A;  2BC0 A;  5J60 A;  3ICR A;  5HHF A;  2C66 A;  1DOC A;  2BK3 A;  4RG3 A;  3NT6 A;  1B37 A;  1CJC A;  2VQB A;  3IHG A;  3AEA A;  2CVJ A;  5KOX A;  5L46 A;  1YQZ A;  3EAO A;  4CCQ A;  1EL9 A;  2ARD A;  2YAU A;  1ZOY A;  3AE8 A;  4H4W A;  4I59 A;  4Z43 A;  3P4S A;  1ELI A;  4U2S A;  4PAB A;  1H7W A;  2YR6 A;  2RGH A;  2WET A;  3ATQ A;  3F8P A;  4II3 A;  3ZDN A;  2VRM A;  1GRF A;  4NEW A;  4JNA A;  4GAV A;  4B69 A;  1DJQ A;  2WP6 A;  2E5V A;  3AD8 B;  1LPF A;  1CJ2 A;  4YTP A;  1PS9 A;  4YWO A;  1OJ9 A;  4G6G A;  2XVJ A;  1KDG A;  2GQW A;  1H83 A;  3QSM A;  5JCK A;  1JEH A;  3VQR A;  2C70 A;  1BGN A;  3KD9 A;  3HZL A;  3KU9 A;  3B3R A;  4OVI A;  1OJD A;  1FEB A;  4IA6 A;  3B6D A;  3SFD A;  2XLR A;  2YVJ A;  4AP3 A;  3T2Z A;  1Q9I A;  4H2P A;  2JKC A;  4EM4 A;  1K0J A;  4U8N A;  2BA9 A;  2CUL A;  2B7S A;  1KNP A;  5BVA A;  2GRT A;  3H8I A;  1NDA A;  1L9E A;  1FEA A;  2YWL A;  3SY4 A;  3AYL A;  4BUR A;  1SEZ A;  3AWI A;  1PJ7 A;  3C4A A;  4OPT A;  1AOG A;  2Z5Y A;  3HYX A;  1GPE A;  2OAL A;  2YLT A;  2AQJ A;  2BYB A;  3CNT A;  3CPI G;  1KSU A;  5EB5 A;  3UOY A;  3NN6 X;  5JCI A;  1N4V A;  1GTH A;  2A8X A;  2YG6 A;  2VQ7 A;  4A5L A;  1MO9 A;  3ITJ A;  2FJD A;  4C3X A;  5FMH A;  5KMP A;  3M13 A;  3AEE A;  1S2Y A;  2WES A;  4BK2 A;  4FX9 A;  2XDO A;  3URH A;  3D8X A;  1DXL A;  1GXF A;  1Z6L A;  5ER0 A;  1H81 A;  2B76 A;  4JN9 A;  4YKG A;  1O5W A;  4E0V A;  4YSZ A;  1LTX R;  2V6O A;  3DK9 A;  3SQP A;  4A6N A;  5JCM A;  1QO8 A;  4CNK A;  4EQS A;  2GMH A;  4EIQ A;  4H4R A;  3AE2 A;  2FJA A;  2Q0K A;  1CC4 A;  3II4 A;  3UKA A;  4ZCD A;  3UKQ A;  2IVD A;  2GR3 A;  4J36 A;  2DKH A;  2YLX A;  4H7U A;  1YQ3 A;  5GRT A;  3DA1 A;  3NLC A;  3K7T A;  2XVE A;  3I6D A;  1PHH A;  3CPJ G;  2QA2 A;  2E4G A;  3VRB A;  4C5O A;  4TM1 A;  2YR5 A;  5KXJ A;  3NRN A;  5KMR A;  4YTN A;  5FS6 A;  4H4Z A;  3AEB A;  4YSH A;  2C7G A;  1GRA A;  1JNZ A;  1Y56 A;  1LJ1 A;  3GYJ A;  3SGL A;  3UKF A;  3P4Q A;  2XFO A;  4A9W A;  2GAG B;  4YKF A;  2CFY A;  2ACZ A;  4IV9 A;  1IUU A;  5TR3 A;  3NK1 X;  3CMM A;  3UKP A;  3KLJ A;  3AYI A;  3P4R A;  1PJ5 A;  3D1C A;  2EQ7 A;  2XLU A;  1H82 A;  3FG2 P;  4EQX A;  2XVI A;  1EL7 A;  2HQM A;  1S3B A;  3O0H A;  3CGD A;  2NVK X;  4UDQ A;  4ZCC A;  1PBF A;  1BF3 A;  3GD4 A;  4K7Z A;  3G5Q A;  3UTF A;  2BCP A;  2X8G A;  1QLB A;  2R9Z A;  3JSK A;  1ZMD A;  2OLN A;  3ABV A;  3FIM B;  1X31 B;  2BXR A;  4GCM A;  1CJ4 A;  2X8H A;  3NTD A;  2R4E A;  4JNQ A;  2R0P A;  4EMW A;  2EQ9 A;  2BRY A;  1FL2 A;  3ICS A;  3LXD A;  1TYP A;  3V3O A;  1P2H A;  4G73 A;  4GRT A;  3AED A;  4H4Q A;  3BNU A;  2B9Y A;  4EQR A;  3AE3 A;  3AXB A;  1YQ4 A;  2YG3 A;  2F5Z A;  2OA1 A;  4B64 A;  5KWF A;  1GV4 A;  3OC4 A;  1NG3 A;  4GAP A;  2YLW A;  4AT2 A;  1IUV A;  3E1T A;  3CGB A;  3Q6J A;  2FBW A;  1B8S A;  4AOS A;  4HB9 A;  4Y4L A;  4UDP A;  1E1M A;  2TMD A;  2APG A;  4ECH A;  2E1M A;  4BJY A;  4USR A;  2GVC A;  1F8W A;  4X4J A;  1GTE A;  3GDN A;  4TM0 A;  1JRY A;  1TDO A;  2YLZ A;  5LV9 A;  3SZC A;  3VRA A;  4LII A;  3Q9T A;  1VG9 A;  1KSS A;  4CY8 A;  1XAN A;  3CND A;  1E39 A;  1LQT A;  2GEW A;  3UP4 A;  3ZYX A;  4EIP A;  1GRB A;  3EAN A;  1TDK A;  5CQF A;  2NPX A;  1ZK7 A;  3AE5 A;  3F8R A;  4H4Y A;  3UCL A;  1K0L A;  4B65 A;  3L1R A;  2UZZ A;  4OCG A;  2XLP A;  1JOA A;  4OPL A;  1NHR A;  3UOX A;  1VQW A;  5EBK A;  2X50 A;  4H4V A;  1ZP0 A;  2XFQ A;  5C3J A;  3M0O A;  3NKS A;  1VRQ B;  2RGJ A;  4GR1 A;  2WU5 A;  1NHP A;  2CDU A;  1KNR A;  2ZZB A;  3K7M X;  3SYI A;  3UKL A;  1Y0P A;  1IUX A;  3UTG A;  4Z2R A;  2JBV A;  3KPK A;  1VG0 A;  3FMW A;  3NK2 X;  4WX1 A;  5GSN A;  3RHA A;  2R0C A;  4U8M A;  3KKJ A;  1S2Q A;  1CL0 A;  1PBC A;  2C72 A;  2WBA A;  4U8P A;  5KVH A;  1DJN A;  4DSG A;  3AEF A;  3RP6 A;  5HY5 A;  1PDH A;  3DJG X;  3EPT A;  1F6M A;  2WOI A;  1NEN A;  3GMC A;  1NG4 A;  3I3L A;  5M0Z A;  2EQ8 A;  4A99 A;  1TYT A;  2YM2 A;  1GSN A;  4DSH A;  2WPC A;  4A6N B;  3UTE A;  1JNR A;  3RED A;  1O94 A;  3RP7 A;  3DH9 A;  4H4S A;  1GAL A;  2YLR A;  4G74 A;  2Z5X A;  1MOK A;  2B9W A;  1D7Y A;  1DOE A;  4H2Q A;  3NH3 X;  3QVP A;  2GH5 A;  4JQ9 A;  2C65 A;  2WOV A;  1IUW A;  1NHS A;  1P2E A;  4CCR A;  1JRZ A;  1RSG A;  5KNL A;  3ATR A;  2BAB A;  3AE6 A;  3PVC A;  3QJ4 A;  1S3E A;  4J34 A;  4GDP A;  3AEC A;  4M52 A;  1TRB A;  2JB1 A;  2PYX A;  2Q6U A;  2VVL G;  4Z2U A;  3GYX A;  4U8I A;  2GV8 A;  1TDE A;  4U8O A;  1H7X A;  4H2R A;  3CPH G;  3K7Q X;  3GWD A;  4BK3 A;  3NK0 X;  3PO7 A;  1NHQ A;  1PBD A;  3QFA A;  3SZF A;  4HA6 A;  4J57 A;  3DGH A;  3AYJ A;  4LU6 A;  3K30 A;  1OJA A;  3GMB A;  4U2L A;  1DOD A;  2VVM A;  4KX6 A;  4RG4 A;  1CC6 A;  5KMQ A;  4B63 A;  4BJZ A;  4DNA A;  3KPF A;  1XHC A;  4H2N A;  1Y56 B;  3SFE A;  3P4P A;  4G9K A;  4ZN0 A;  2V3A A;  1COY A;  1F3P A;  1F8S A;  2BK5 A;  2ZZC A;  3ALM A;  1ONF A;  5KOW A;  2C76 A;  2WDQ A;  3T0K A;  4EQW A;  2BCG G;  3RP8 A;  2Y6Q A;  4J31 A;  2YG5 A;  4GDE A;  3ALL A;  4Y4M A;  5KMS A;  1PXC A;  2X99 A;  3AE4 A;  1D5T A;  2WEU A;  3QVR A;  2BK4 A;  3EF6 A;  3BNM A;  4XWZ A;  1L9C A;  4NZH A;  4MJW A;  2BC1 A;  1H84 A;  3NIX A;  1IUT A;  1PN0 A;  2BS4 A;  5DBJ A;  4EMJ A;  4EM3 A;  4U8L A;  4IVO B;  2JB3 A;  1GEU A;  1PJ6 A;  4EMI A;  1ZMC A;  3SXI A;  5HXI A;  3GSI A;  3AE1 A;  2C3C A;  4X9N A;  2XFU A;  2R45 A;  5JCN A;  1EL5 A;  2A89 A;  1CHU A;  2QCU A;  2JAE A;  2C75 A;  4K22 A;  5IPY A;  1HYU A;  3VRD B;  2R4J A;  1K4Q A;  4BV6 A;  5KRQ A;  2DKI A;  2TPR A;  2GB0 A;  2YR4 A;  3F8D A;  5EB4 A;  3T37 A;  1JRX A;  4H50 A;  4OPC A;  3DJE A;  4FDC B;  2BRA A;  1ZKQ A;  2WPE A;  2VOU A;  3ADA B;  1E6E A;  1D7L A;  2GF3 A;  4NTC A;  4D03 A;  3FBS A;  4CBQ A;  1GRE A;  1GRG A;  1NEK A;  1RYI A;  3CTY A;  1V59 A;  2GQF A;  4A65 A;  1GND A;  4OPG A;  4Z24 A;  4AP1 A;  1L0V A;  1K0I A;  1VDC A;  3AD7 B;  4PAA A;  5FS9 A;  1CBO A;  4WCT A;  3HYV A;  4XXG A;  4Z44 A;  2RAB A;  1FOH A;  4UDR A;  3IC9 A;  1DNC A;  3GD3 A;  4J56 A;  4A79 A;  1JU2 A;  4JDR A;  4YSY A;  4Z25 A;  1N4U A;  4IA5 A;  1YKJ A;  4I58 A;  4II2 A;  3LZW A;  1M64 A;  1NPX A;  3T14 A;  1OJC A;  2VRL A;  4CY6 A;  3QSE A;  1TDF A;  4Z2T A;  2XYO A;  2OAM A;  2YVG A;  2XFN A;  4NTD A;  4UP3 A;  3SZ0 A;  2A87 A;  1D4D A;  3FPZ A;  2GR1 A;  3AB1 A;  2RGO A;  1IJH A;  3G5R A;  1E1L A;  2IID A;  1PXA A;  2WPF A;  2GR0 A;  2H89 A;  3CN8 A;  2B7R A;  4ADW A;  2GAH B;  1GES A;  1F8R A;  2Q0L A;  3R9U A;  1BZL A;  1FEC A;  1EBD A;  2WOW A;  3DK4 A;  3DK8 A;  4TM3 A;  3DJJ A;  3CNJ A;  4P9S A;  3BI4 A;  4CRT A;  2BAC A;  2C3D A;  1D4E A;  1XDI A;  3NYC A;  5IQ1 A;  2R46 A;  4K2X A;  2AR8 A;  1EL8 A;  1RP0 A;  3AE7 A;  3IWA A;  4YSX A;  4YTM A;  2IVE A;  1CC2 A;  4X9M A;  2WU2 A;  3COX A;  4OPD A;  3UP5 A;  1GOS A;  2FJE A;  1BGJ A;  4YXD A;  1H86 A;  4Y4N A;  1GET A;  1GER A;  2XFP A;  2XVH A;  4FK1 A;  5KVI A;  3SX6 A;  5BUK A;  4B1B A;  1D4C A;  3DJD A;  3UKH A;  3S61 A;  3BHK A;  4K8D A;  4C77 A;  1L9D A;  4AOX A;  2Y6R A;  1B4V A;  2WS3 A;  4C3Y A;  5EOW A;  2C67 A;  1N4W A;  1NAA A;  1BWC A;  3AD9 B;  2QA1 A;  3BHF A;  3RNM A;  3T31 A;  4D04 A;  3G5S A;  2WDR A;  3LB8 A;  3IF9 A;  3T2Y A;  1PBE A;  4K5S A;  4KPR A;  4DGK A;  4G6H A;  4BK1 A;  1IUS A;  1LQU A;  4H4P A;  4U2T A;  4TLZ A;  1E7P A;  3LZX A;  3P9U A;  3C96 A;  3AEG A;  5M10 A;  1REO A;  2XVF A;  3DME A;  1Q1W A;  3T2K A;  1GRT A;  3NYE A;  1DOB A;  4C74 A;  4JY3 A;  1OJT A;  4REK A;  1QJD A;  2ZBW A;  3SM8 A;  2XLT A;  4OPU A;  2JB2 A;  3IHM A;  3LJP A;  3CGC A;  3UTH A;  2B9X A;  2V3B A;  3GRS A;  2QAE A;  1ZOV A;  1M6I A;  5CKU A;  4Z26 A;  1CJ3 A;  3H4K A;  3ICT A;  2YVF A;  2J3N A;  3UOV A;  2W0H A;  5BUL A;  3GRT A;  3ISH A;  2YQU A;  3S5W A;  2FJB A;  3CIR A;  3GWF A;  1TDN A;  2YG7 A;  4J2W A;  3KVE A;  2WHD A;  3CNP A;  4N9X A;  4NTE A;  2ZZ0 A;  3NNE A;  4U8J A;  3KA7 A;  1Q1R A;  3PS9 A;  4NWZ A;  1B5Q A;  2BS3 A;  2WP5 A;  3DGZ A;  2EQ6 A;  3M12 A;  2X3N A;  1LVL A;  2XLS A;  2YG4 A;  4APN A;  2V60 A;  5FS7 A;  3SZW A;  1KFY A;  4NEV A;  4USQ A;  1UKV G;  3NGC X;  3P1W A;  1KF6 A;  3NN0 X;  2R0G A;  5BRT A;  3ALJ A;  2V5Z A;  2BXS A;  2PHH A;  1CF3 A;  3OZ2 A;  2YM1 A;  4TM4 A;  4IVM B;  3CNS A;  4B68 A;  3BI5 A;  2V61 A;  4RSL A;  5FS8 A;  3LOV A;  1ZX9 A;  3QFB A;  1XPQ A;  4ICY A;  3QSS A;  3V76 A;  3UKK A;  1N1P A;  1O95 A;  2AAQ A;  4FK1 C;  2I0Z A;  3L8K A;  2GR2 A;  4GF7 A;  4H4T A;  4XWR A;  5U63 A;  3NTA A;  2JK6 A;  3AE9 A;  2X8C A;  3C4N A;  4H4U A;  4OPI A;  1FCD A;  4H4X A;  2BS2 A;  4B67 A;  2C4C A;  2WQY A;  1PBB A;  1MXT A;  2XCG A;  3WE0 A;  5U25 A;  3NG7 X;  5HYM A;  1ZDL A;  1LV0 A;  2O9Z A;  4U8K A;  1ZY8 A;  4J33 A;  5U1O A;  2Q7V A;  4CNJ A;  5IQ4 A;  2WDV A;  2C73 A;  3H8L A;  4K5R A;  3VR8 A;  5JCL A;  2GMJ A;  2VZ2 A;  3CGE A;  2OLO A;  4O5U A;  4O5Q A;  3GDP A;  1PXB A;  1E1N A;  1YY5 A;  2WP9 A;  3NHO X;  5C2T A;  4NNJ A;  2VVL A;  2C64 A;  3GYI A;  4A7A A;  1GRH A;  1GT8 A;  4LA1 A;  1E1K A;  5J7X A;  3V3N A;  3VR9 A;  1BKW A;  2H88 A;  3UOZ A;  3LAD A;  4TLX A; 
#chains in the Genus database with same CATH homology
 3HYW A;  1H6V A;  4YT0 A;  4GUV A;  4AT0 A;  4B66 A;  1W4X A;  3BI2 A;  2YLS A;  3NYF A;  4JY2 A;  2BC0 A;  5J60 A;  3ICR A;  5HHF A;  2C66 A;  1DOC A;  2BK3 A;  4RG3 A;  3NT6 A;  1B37 A;  1CJC A;  2VQB A;  3IHG A;  3AEA A;  2CVJ A;  5KOX A;  5L46 A;  1YQZ A;  3EAO A;  4CCQ A;  1EL9 A;  2ARD A;  2YAU A;  1ZOY A;  3AE8 A;  4H4W A;  4I59 A;  4Z43 A;  3P4S A;  1ELI A;  4U2S A;  4PAB A;  1H7W A;  2YR6 A;  2RGH A;  2WET A;  3ATQ A;  3F8P A;  4II3 A;  3ZDN A;  2VRM A;  1GRF A;  4NEW A;  4JNA A;  4GAV A;  4B69 A;  1DJQ A;  2WP6 A;  2E5V A;  3AD8 B;  1LPF A;  1CJ2 A;  4YTP A;  1PS9 A;  4YWO A;  1OJ9 A;  4G6G A;  2XVJ A;  1KDG A;  2GQW A;  1H83 A;  3QSM A;  5JCK A;  1JEH A;  3VQR A;  2C70 A;  1BGN A;  3KD9 A;  3HZL A;  3KU9 A;  3B3R A;  4OVI A;  1OJD A;  1FEB A;  4IA6 A;  3B6D A;  3SFD A;  2XLR A;  2YVJ A;  4AP3 A;  3T2Z A;  1Q9I A;  4H2P A;  2JKC A;  4EM4 A;  1K0J A;  4U8N A;  2BA9 A;  2CUL A;  2B7S A;  1KNP A;  5BVA A;  2GRT A;  3H8I A;  1NDA A;  1L9E A;  1FEA A;  2YWL A;  3SY4 A;  3AYL A;  4BUR A;  1SEZ A;  3AWI A;  1PJ7 A;  3C4A A;  4OPT A;  1AOG A;  2Z5Y A;  3HYX A;  1GPE A;  2OAL A;  2YLT A;  2AQJ A;  2BYB A;  3CNT A;  3CPI G;  1KSU A;  5EB5 A;  3UOY A;  3NN6 X;  5JCI A;  1N4V A;  1GTH A;  2A8X A;  2YG6 A;  2VQ7 A;  4A5L A;  1MO9 A;  3ITJ A;  2FJD A;  4C3X A;  5FMH A;  5KMP A;  3M13 A;  3AEE A;  1S2Y A;  2WES A;  4BK2 A;  4FX9 A;  2XDO A;  3URH A;  3D8X A;  1DXL A;  1GXF A;  1Z6L A;  5ER0 A;  1H81 A;  2B76 A;  4JN9 A;  4YKG A;  1O5W A;  4E0V A;  4YSZ A;  1LTX R;  2V6O A;  3DK9 A;  3SQP A;  4A6N A;  5JCM A;  1QO8 A;  4CNK A;  4EQS A;  2GMH A;  4EIQ A;  4H4R A;  3AE2 A;  2FJA A;  2Q0K A;  1CC4 A;  3II4 A;  3UKA A;  4ZCD A;  3UKQ A;  2IVD A;  2GR3 A;  4J36 A;  2DKH A;  2YLX A;  4H7U A;  1YQ3 A;  5GRT A;  3DA1 A;  3NLC A;  3K7T A;  2XVE A;  3I6D A;  1PHH A;  3CPJ G;  2QA2 A;  2E4G A;  3VRB A;  4C5O A;  4TM1 A;  2YR5 A;  5KXJ A;  3NRN A;  5KMR A;  4YTN A;  5FS6 A;  4H4Z A;  3AEB A;  4YSH A;  2C7G A;  1GRA A;  1JNZ A;  1Y56 A;  1LJ1 A;  3GYJ A;  3SGL A;  3UKF A;  3P4Q A;  2XFO A;  4A9W A;  2GAG B;  4YKF A;  2CFY A;  2ACZ A;  4IV9 A;  1IUU A;  5TR3 A;  3NK1 X;  3CMM A;  3UKP A;  3KLJ A;  3AYI A;  3P4R A;  1PJ5 A;  3D1C A;  2EQ7 A;  2XLU A;  1H82 A;  3FG2 P;  4EQX A;  2XVI A;  1EL7 A;  2HQM A;  1S3B A;  3O0H A;  3CGD A;  2NVK X;  4UDQ A;  4ZCC A;  1PBF A;  1BF3 A;  3GD4 A;  4K7Z A;  3G5Q A;  3UTF A;  2BCP A;  2X8G A;  1QLB A;  2R9Z A;  3JSK A;  1ZMD A;  2OLN A;  3ABV A;  3FIM B;  1X31 B;  2BXR A;  4GCM A;  1CJ4 A;  2X8H A;  3NTD A;  2R4E A;  4JNQ A;  2R0P A;  4EMW A;  2EQ9 A;  2BRY A;  1FL2 A;  3ICS A;  3LXD A;  1TYP A;  3V3O A;  1P2H A;  4G73 A;  4GRT A;  3AED A;  4H4Q A;  3BNU A;  2B9Y A;  4EQR A;  3AE3 A;  3AXB A;  1YQ4 A;  2YG3 A;  2F5Z A;  2OA1 A;  4B64 A;  5KWF A;  1GV4 A;  3OC4 A;  1NG3 A;  4GAP A;  2YLW A;  4AT2 A;  1IUV A;  3E1T A;  3CGB A;  3Q6J A;  2FBW A;  1B8S A;  4AOS A;  4HB9 A;  4Y4L A;  4UDP A;  1E1M A;  2TMD A;  2APG A;  4ECH A;  2E1M A;  4BJY A;  4USR A;  2GVC A;  1F8W A;  4X4J A;  1GTE A;  3GDN A;  4TM0 A;  1JRY A;  1TDO A;  2YLZ A;  5LV9 A;  3SZC A;  3VRA A;  4LII A;  3Q9T A;  1VG9 A;  1KSS A;  4CY8 A;  1XAN A;  3CND A;  1E39 A;  1LQT A;  2GEW A;  3UP4 A;  3ZYX A;  4EIP A;  1GRB A;  3EAN A;  1TDK A;  5CQF A;  2NPX A;  1ZK7 A;  3AE5 A;  3F8R A;  4H4Y A;  3UCL A;  1K0L A;  4B65 A;  3L1R A;  2UZZ A;  4OCG A;  2XLP A;  1JOA A;  4OPL A;  1NHR A;  3UOX A;  1VQW A;  5EBK A;  2X50 A;  4H4V A;  1ZP0 A;  2XFQ A;  5C3J A;  3M0O A;  3NKS A;  1VRQ B;  2RGJ A;  4GR1 A;  2WU5 A;  1NHP A;  2CDU A;  1KNR A;  2ZZB A;  3K7M X;  3SYI A;  3UKL A;  1Y0P A;  1IUX A;  3UTG A;  4Z2R A;  2JBV A;  3KPK A;  1VG0 A;  3FMW A;  3NK2 X;  4WX1 A;  5GSN A;  3RHA A;  2R0C A;  4U8M A;  3KKJ A;  1S2Q A;  1CL0 A;  1PBC A;  2C72 A;  2WBA A;  4U8P A;  5KVH A;  1DJN A;  4DSG A;  3AEF A;  3RP6 A;  5HY5 A;  1PDH A;  3DJG X;  3EPT A;  1F6M A;  2WOI A;  1NEN A;  3GMC A;  1NG4 A;  3I3L A;  5M0Z A;  2EQ8 A;  4A99 A;  1TYT A;  2YM2 A;  1GSN A;  4DSH A;  2WPC A;  4A6N B;  3UTE A;  1JNR A;  3RED A;  1O94 A;  3RP7 A;  3DH9 A;  4H4S A;  1GAL A;  2YLR A;  4G74 A;  2Z5X A;  1MOK A;  2B9W A;  1D7Y A;  1DOE A;  4H2Q A;  3NH3 X;  3QVP A;  2GH5 A;  4JQ9 A;  2C65 A;  2WOV A;  1IUW A;  1NHS A;  1P2E A;  4CCR A;  1JRZ A;  1RSG A;  5KNL A;  3ATR A;  2BAB A;  3AE6 A;  3PVC A;  3QJ4 A;  1S3E A;  4J34 A;  4GDP A;  3AEC A;  4M52 A;  1TRB A;  2JB1 A;  2PYX A;  2Q6U A;  2VVL G;  4Z2U A;  3GYX A;  4U8I A;  2GV8 A;  1TDE A;  4U8O A;  1H7X A;  4H2R A;  3CPH G;  3K7Q X;  3GWD A;  4BK3 A;  3NK0 X;  3PO7 A;  1NHQ A;  1PBD A;  3QFA A;  3SZF A;  4HA6 A;  4J57 A;  3DGH A;  3AYJ A;  4LU6 A;  3K30 A;  1OJA A;  3GMB A;  4U2L A;  1DOD A;  2VVM A;  4KX6 A;  4RG4 A;  1CC6 A;  5KMQ A;  4B63 A;  4BJZ A;  4DNA A;  3KPF A;  1XHC A;  4H2N A;  1Y56 B;  3SFE A;  3P4P A;  4G9K A;  4ZN0 A;  2V3A A;  1COY A;  1F3P A;  1F8S A;  2BK5 A;  2ZZC A;  3ALM A;  1ONF A;  5KOW A;  2C76 A;  2WDQ A;  3T0K A;  4EQW A;  2BCG G;  3RP8 A;  2Y6Q A;  4J31 A;  2YG5 A;  4GDE A;  3ALL A;  4Y4M A;  5KMS A;  1PXC A;  2X99 A;  3AE4 A;  1D5T A;  2WEU A;  3QVR A;  2BK4 A;  3EF6 A;  3BNM A;  4XWZ A;  1L9C A;  4NZH A;  4MJW A;  2BC1 A;  1H84 A;  3NIX A;  1IUT A;  1PN0 A;  2BS4 A;  5DBJ A;  4EMJ A;  4EM3 A;  4U8L A;  4IVO B;  2JB3 A;  1GEU A;  1PJ6 A;  4EMI A;  1ZMC A;  3SXI A;  5HXI A;  3GSI A;  3AE1 A;  2C3C A;  4X9N A;  2XFU A;  2R45 A;  5JCN A;  1EL5 A;  2A89 A;  1CHU A;  2QCU A;  2JAE A;  2C75 A;  4K22 A;  5IPY A;  1HYU A;  3VRD B;  2R4J A;  1K4Q A;  4BV6 A;  5KRQ A;  2DKI A;  2TPR A;  2GB0 A;  2YR4 A;  3F8D A;  5EB4 A;  3T37 A;  1JRX A;  4H50 A;  4OPC A;  3DJE A;  4FDC B;  2BRA A;  1ZKQ A;  2WPE A;  2VOU A;  3ADA B;  1E6E A;  1D7L A;  2GF3 A;  4NTC A;  4D03 A;  3FBS A;  4CBQ A;  1GRE A;  1GRG A;  1NEK A;  1RYI A;  3CTY A;  1V59 A;  2GQF A;  4A65 A;  1GND A;  4OPG A;  4Z24 A;  4AP1 A;  1L0V A;  1K0I A;  1VDC A;  3AD7 B;  4PAA A;  5FS9 A;  1CBO A;  4WCT A;  3HYV A;  4XXG A;  4Z44 A;  2RAB A;  1FOH A;  4UDR A;  3IC9 A;  1DNC A;  3GD3 A;  4J56 A;  4A79 A;  1JU2 A;  4JDR A;  4YSY A;  4Z25 A;  1N4U A;  4IA5 A;  1YKJ A;  4I58 A;  4II2 A;  3LZW A;  1M64 A;  1NPX A;  3T14 A;  1OJC A;  2VRL A;  4CY6 A;  3QSE A;  1TDF A;  4Z2T A;  2XYO A;  2OAM A;  2YVG A;  2XFN A;  4NTD A;  4UP3 A;  3SZ0 A;  2A87 A;  1D4D A;  3FPZ A;  2GR1 A;  3AB1 A;  2RGO A;  1IJH A;  3G5R A;  1E1L A;  2IID A;  1PXA A;  2WPF A;  2GR0 A;  2H89 A;  3CN8 A;  2B7R A;  4ADW A;  2GAH B;  1GES A;  1F8R A;  2Q0L A;  3R9U A;  1BZL A;  1FEC A;  1EBD A;  2WOW A;  3DK4 A;  3DK8 A;  4TM3 A;  3DJJ A;  3CNJ A;  4P9S A;  3BI4 A;  4CRT A;  2BAC A;  2C3D A;  1D4E A;  1XDI A;  3NYC A;  5IQ1 A;  2R46 A;  4K2X A;  2AR8 A;  1EL8 A;  1RP0 A;  3AE7 A;  3IWA A;  4YSX A;  4YTM A;  2IVE A;  1CC2 A;  4X9M A;  2WU2 A;  3COX A;  4OPD A;  3UP5 A;  1GOS A;  2FJE A;  1BGJ A;  4YXD A;  1H86 A;  4Y4N A;  1GET A;  1GER A;  2XFP A;  2XVH A;  4FK1 A;  5KVI A;  3SX6 A;  5BUK A;  4B1B A;  1D4C A;  3DJD A;  3UKH A;  3S61 A;  3BHK A;  4K8D A;  4C77 A;  1L9D A;  4AOX A;  2Y6R A;  1B4V A;  2WS3 A;  4C3Y A;  5EOW A;  2C67 A;  1N4W A;  1NAA A;  1BWC A;  3AD9 B;  2QA1 A;  3BHF A;  3RNM A;  3T31 A;  4D04 A;  3G5S A;  2WDR A;  3LB8 A;  3IF9 A;  3T2Y A;  1PBE A;  4K5S A;  4KPR A;  4DGK A;  4G6H A;  4BK1 A;  1IUS A;  1LQU A;  4H4P A;  4U2T A;  4TLZ A;  1E7P A;  3LZX A;  3P9U A;  3C96 A;  3AEG A;  5M10 A;  1REO A;  2XVF A;  3DME A;  1Q1W A;  3T2K A;  1GRT A;  3NYE A;  1DOB A;  4C74 A;  4JY3 A;  1OJT A;  4REK A;  1QJD A;  2ZBW A;  3SM8 A;  2XLT A;  4OPU A;  2JB2 A;  3IHM A;  3LJP A;  3CGC A;  3UTH A;  2B9X A;  2V3B A;  3GRS A;  2QAE A;  1ZOV A;  1M6I A;  5CKU A;  4Z26 A;  1CJ3 A;  3H4K A;  3ICT A;  2YVF A;  2J3N A;  3UOV A;  2W0H A;  5BUL A;  3GRT A;  3ISH A;  2YQU A;  3S5W A;  2FJB A;  3CIR A;  3GWF A;  1TDN A;  2YG7 A;  4J2W A;  3KVE A;  2WHD A;  3CNP A;  4N9X A;  4NTE A;  2ZZ0 A;  3NNE A;  4U8J A;  3KA7 A;  1Q1R A;  3PS9 A;  4NWZ A;  1B5Q A;  2BS3 A;  2WP5 A;  3DGZ A;  2EQ6 A;  3M12 A;  2X3N A;  1LVL A;  2XLS A;  2YG4 A;  4APN A;  2V60 A;  5FS7 A;  3SZW A;  1KFY A;  4NEV A;  4USQ A;  1UKV G;  3NGC X;  3P1W A;  1KF6 A;  3NN0 X;  2R0G A;  5BRT A;  3ALJ A;  2V5Z A;  2BXS A;  2PHH A;  1CF3 A;  3OZ2 A;  2YM1 A;  4TM4 A;  4IVM B;  3CNS A;  4B68 A;  3BI5 A;  2V61 A;  4RSL A;  5FS8 A;  3LOV A;  1ZX9 A;  3QFB A;  1XPQ A;  4ICY A;  3QSS A;  3V76 A;  3UKK A;  1N1P A;  1O95 A;  2AAQ A;  4FK1 C;  2I0Z A;  3L8K A;  2GR2 A;  4GF7 A;  4H4T A;  4XWR A;  5U63 A;  3NTA A;  2JK6 A;  3AE9 A;  2X8C A;  3C4N A;  4H4U A;  4OPI A;  1FCD A;  4H4X A;  2BS2 A;  4B67 A;  2C4C A;  2WQY A;  1PBB A;  1MXT A;  2XCG A;  3WE0 A;  5U25 A;  3NG7 X;  5HYM A;  1ZDL A;  1LV0 A;  2O9Z A;  4U8K A;  1ZY8 A;  4J33 A;  5U1O A;  2Q7V A;  4CNJ A;  5IQ4 A;  2WDV A;  2C73 A;  3H8L A;  4K5R A;  3VR8 A;  5JCL A;  2GMJ A;  2VZ2 A;  3CGE A;  2OLO A;  4O5U A;  4O5Q A;  3GDP A;  1PXB A;  1E1N A;  1YY5 A;  2WP9 A;  3NHO X;  5C2T A;  4NNJ A;  2VVL A;  2C64 A;  3GYI A;  4A7A A;  1GRH A;  1GT8 A;  4LA1 A;  1E1K A;  5J7X A;  3V3N A;  3VR9 A;  1BKW A;  2H88 A;  3UOZ A;  3LAD A;  4TLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...