2I0ZA

Crystal structure of a fad binding protein from bacillus cereus, a putative nad(fad)-utilizing dehydrogenases
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
420
structure length
416
Chain Sequence
MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNNEDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVVIAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLNAIISHKMDMLFTHFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNEIDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYNITSALVTGRIAGTTAGENAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a FAD binding protein from Bacillus cereus, a putative NAD(FAD)-utilizing dehydrogenases
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords NAD(FAD)-utilizing dehydrogenases
total genus 144
structure length 416
sequence length 420
ec nomenclature
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03486 HI0933_like HI0933-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2i0zA01
1IUVA 1D7LA 2EQ8A 2ZBWA 3Q6JA 3V76A 3NTAA 3AEAA 3QFBA 3SFDA 2WPCA 2JBVA 3AEFA 3LXDA 3F8PA 2C64A 1ZOYA 1DOEA 1FOHA 2VRMA 3F8RA 4K2XA 5KOWA 3F8DA 1LPFA 1OJ9A 4OVIA 1TRBA 4OPIA 3AD7B 2CDUA 3PVCA 4EM4A 3DJEA 2UZZA 3NK0X 2PYXA 1NDAA 4J33A 2GR0A 3NNEA 5U1OA 3R9UA 1CJ4A 3UKFA 3IHGA 3UOVA 2WPFA 2GF3A 4JY3A 4LU6A 2YG4A 1E1MA 3CGBA 3RP7A 4YSHA 3AB1A 4UP3A 4U8NA 2DKIA 2R4EA 1JRYA 2R0PA 3LJPA 4B64A 1GRTA 2TPRA 1S2YA 2GB0A 2GRTA 2WU5A 3B6DA 2VOUA 3PS9A 1H86A 1PBCA 4FDCB 3SFEA 3CNTA 2GVCA 4J57A 1YQ3A 4J31A 4TM1A 2R46A 4AOSA 3AE3A 1CC6A 4EMWA 2DKHA 3IWAA 1Z6LA 2XDOA 1IUUA 4A99A 2C7GA 4GRTA 2ZZCA 3DH9A 4WCTA 2VVLA 2WU2A 2NPXA 4PABA 4EQXA 1KSSA 1LQUA 2C73A 4B68A 1VRQB 4B63A 3CTYA 3H4KA 3EPTA 1PBEA 1GTHA 4GF7A 3T37A 1N1PA 3B3RA 2Z5XA 1VG0A 4H4RA 3VRBA 1Y0PA 2XLPA 3BNMA 4A6NA 1H7XA 4YT0A 2XFUA 1GETA 3S61A 1D4CA 4ZCDA 2V3AA 1FEAA 1H6VA 3ALLA 4USQA 2BK5A 2FJAA 4CCQA 1DOBA 1GRGA 1H84A 1OJDA 4OPCA 2WEUA 4Z25A 5BRTA 2V3BA 2V6OA 1CBOA 1EBDA 3KVEA 1TDEA 2ACZA 3NLCA 3O0HA 2CFYA 3P9UA 4RSLA 4KPRA 2XFOA 4K5SA 3NIXA 4KX6A 4REKA 4Z26A 1H83A 4H4XA 1D7YA 2WOWA 2YR5A 4U8PA 3AXBA 4WX1A 5BUKA 1GRAA 1PBBA 2IVEA 3AEGA 3GMCA 2WP5A 3GMBA 4DGKA 3AE6A 4J2WA 5FMHA 2GR2A 1GXFA 1KSUA 5BULA 1M64A 4FX9A 2E5VA 1PXBA 2QA1A 3FMWA 2VRLA 2GAGB 4A7AA 2GH5A 3SGLA 2I0ZA 4AT0A 4ECHA 2YM1A 1IUSA 3AYJA 2VVLG 4H4PA 5U63A 1CJ2A 4YSXA 1H81A 5CQFA 1PJ6A 5HY5A 1E1NA 3QSEA 3CPHG 2C75A 2XVHA 3M0OA 4Z2RA 3UTEA 5IQ1A 3PO7A 1Q1RA 1ZDLA 3NN0X 1GPEA 1N4UA 4B67A 1D4DA 1P2HA 4AP1A 5C2TA 4EMJA 2XCGA 5U25A 3GSIA 2C3DA 4IA5A 2ARDA 2C66A 1LTXR 2YLXA 3K7QX 4A6NB 2GMJA 1GTEA 1BF3A 1ZK7A 2OALA 4NEWA 4CNKA 1H82A 1PBFA 4FK1A 4H4YA 1YQ4A 3D1CA 2BS3A 1EL8A 3KD9A 3ICTA 4BJYA 4OPTA 1K0LA 4H4UA 1K0IA 2GQFA 4H2QA 3EANA 2V61A 4FK1C 3RNMA 4E0VA 3WE0A 3P4PA 4BK3A 4NTEA 4U8LA 3UTFA 5IPYA 3EF6A 3UTGA 3VQRA 5HXIA 2V5ZA 4AT2A 5GRTA 2BXRA 4I58A 3KU9A 4K5RA 2JB3A 3UKAA 1Q1WA 2Z5YA 1NAAA 3K7TA 1GALA 3NRNA 2R0GA 3NH3X 2YG3A 1E1LA 4B1BA 3LOVA 2B9YA 4XWRA 4NTCA 2VQ7A 4C3YA 5L46A 1OJTA 5KOXA 5KRQA 1EL5A 4CY8A 2GR1A 3GWFA 3COXA 1KDGA 1FCDA 2BS4A 2GV8A 3QVRA 2CULA 2WP6A 2XLUA 1K0JA 2X8HA 3KKJA 4ADWA 4Y4MA 4EQRA 3M12A 4YSZA 4EQWA 3ISHA 1E39A 3CN8A 3FG2P 2GAHB 2C70A 4EIPA 1GRHA 4YTMA 2O9ZA 3UKHA 1LQTA 4H4QA 1ZY8A 4U8MA 1NHPA 2Y6QA 4YKGA 1LV0A 3Q9TA 2H88A 1DNCA 4U2TA 3K7MX 3GWDA 1NENA 2WDQA 3NK1X 2BYBA 2OLNA 2A87A 2Q7VA 3DJGX 3AYLA 1JRXA 1N4VA 2XFQA 5M0ZA 1VQWA 3QJ4A 4B65A 5LV9A 2Q0LA 4OPGA 1L9CA 4H2PA 3AEDA 3CNPA 3NYCA 1QO8A 1JNRA 2X50A 2XLTA 3C96A 3AD9B 1ZMCA 2YLSA 4ZCCA 1NG4A 1Q9IA 4TLZA 4K22A 2F5ZA 3DK4A 4DSHA 2YLWA 1DJQA 2ZZBA 1NG3A 2EQ9A 1GRBA 2WBAA 4IA6A 5JCMA 4LIIA 2C72A 4JNQA 1JRZA 1VDCA 1PN0A 2WDVA 2XFNA 2BXSA 1SEZA 3RP8A 5HYMA 3NTDA 3C4AA 2W0HA 3CNJA 1LJ1A 1TDOA 3S5WA 2VQBA 4DNAA 1GRFA 2C67A 4H4ZA 1L0VA 4A9WA 3BHKA 2FJDA 2TMDA 3NYFA 4H4VA 3ZDNA 4C5OA 2JK6A 3ATQA 3L1RA 3IC9A 1FECA 2YWLA 5TR3A 3REDA 2XFPA 2BACA 3NHOX 3BI4A 3BHFA 3NT6A 2R45A 3NK2X 3GD3A 1GV4A 4IVOB 2QCUA 1L9DA 1PJ5A 5JCKA 3AE5A 2YR6A 1PDHA 1KNRA 1W4XA 3AEBA 3BI2A 1N4WA 4H4WA 4Y4LA 3ALJA 4UDQA 4U8OA 3K30A 2BS2A 5J7XA 2JKCA 4NEVA 4HB9A 1IUTA 3C4NA 5EB5A 2GEWA 4RG3A 1ELIA 3LZXA 4OPDA 5KWFA 4JDRA 4X4JA 3UKQA 2X8GA 3UOYA 3UOZA 3CPIG 1NHSA 1O94A 4J34A 4GCMA 4U8JA 5ER0A 4CRTA 3GYJA 2RABA 2WP9A 2WHDA 3DGHA 1GT8A 1CL0A 1EL9A 3AE1A 4UDPA 3IHMA 1XHCA 1GEUA 4B69A 2OAMA 1KF6A 2XLRA 1Y56B 3H8IA 2IIDA 3FPZA 2NVKX 4H2RA 3URHA 4EM3A 4LA1A 2WS3A 3CNSA 1MOKA 4C74A 1S3BA 3DK9A 2BK4A 1GNDA 1TDFA 2BA9A 3GRSA 1H7WA 4DSGA 1F8SA 4H7UA 4A65A 1CHUA 1CC2A 4APNA 4D03A 2B7RA 4OPUA 1CJCA 1O95A 3AYIA 4TLXA 2BCPA 3ALMA 5EOWA 4JNAA 3UTHA 4I59A 4ZN0A 4A5LA 1BWCA 2J3NA 1GREA 4RG4A 1QLBA 4NTDA 4BK1A 2Y6RA 1DODA 1QJDA 3KA7A 2B7SA 4AOXA 3QVPA 5C3JA 1CF3A 1KFYA 1PHHA 2RGJA 3AE8A 1PBDA 1NEKA 3AECA 3D8XA 1BGNA 3V3NA 3I6DA 2X3NA 3AD8B 1S3EA 3AE4A 2WPEA 1PXCA 2OA1A 3P1WA 4GR1A 1ZMDA 5BVAA 4TM0A 1S2QA 1F8RA 1P2EA 1XANA 3GDNA 1ZKQA 1YQZA 4OPLA 5HHFA 4EQSA 1MXTA 5KVIA 1VG9A 2EQ6A 3DK8A 3UP4A 1NHQA 4XXGA 1X31B 2C76A 2E1MA 4BV6A 3VRAA 4EMIA 4IVMB 3SQPA 1IUWA 1NPXA 2PHHA 4Y4NA 2IVDA 3UOXA 1F8WA 2YQUA 1B5QA 3DJDA 2R0CA 2X8CA 3UCLA 4M52A 3G5SA 2FJEA 2FJBA 1XPQA 5JCIA 2GQWA 2YVFA 5J60A 2RGHA 4TM4A 3DA1A 4CNJA 4U8IA 1CC4A 2XVFA 3ITJA 2BABA 2GR3A 1KNPA 3JSKA 4YXDA 1V59A 1GOSA 2JB2A 1F6MA 1D4EA 3II4A 4YTNA 1E6EA 3UKKA 5JCLA 2OLOA 3AWIA 3HZLA 3ICRA 4H2NA 2B76A 3UP5A 5FS8A 1REOA 2WETA 1YY5A 3ADAB 1B37A 1M6IA 1TYTA 2A89A 3AE7A 1JEHA 5CKUA 4JN9A 4BJZA 4D04A 2XVEA 1L9EA 2APGA 1TDKA 4BURA 2C65A 1CJ3A 4TM3A 4Z43A 4J36A 3BNUA 1NHRA 2E4GA 4EIQA 4GUVA 2WQYA 3OC4A 1OJCA 3RHAA 2EQ7A 2YM2A 3FIMB 1HYUA 1PJ7A 2JB1A 2XLSA 2YVJA 3LB8A 1BGJA 5FS6A 2BC0A 2XVIA 4NZHA 5FS9A 1ZOVA 1GESA 3BI5A 3EAOA 1FEBA 4O5QA 2GMHA 1JU2A 1IUXA 3ATRA 4P9SA 5EBKA 4AP3A 1GSNA 2FBWA 2YG5A 4MJWA 3ABVA 3E1TA 2C3CA 2YLTA 2WESA 4YKFA 2YR4A 4JQ9A 4H4TA 2HQMA 5JCNA 3LZWA 3NGCX 2YG7A 3G5QA 3G5RA 2YVGA 4HA6A 3LADA 3CPJG 2ZZ0A 2H89A 1E7PA 3KPFA 2AAQA 1ONFA 3VR9A 4X9NA 2R4JA 3CNDA 4ICYA 1LVLA 3DMEA 2WOIA 3CGDA 2XYOA 1MO9A 3ZYXA 2Q0KA 3I3LA 3L8KA 4USRA 4CY6A 1RYIA 4J56A 1BZLA 1ZX9A 3V3OA 1JNZA 3DGZA 1B8SA 1B4VA 2YLZA 1PXAA 3CIRA 4O5UA 1DOCA 3NKSA 2RGOA 5GSNA 2WOVA 3VR8A 2QA2A 4JY2A 4OCGA 5IQ4A 1UKVG 3GYIA 4K7ZA 4GDPA 3UKPA 4YWOA 3GRTA 1OJAA 2BC1A 1BKWA 1DJNA 1TDNA 2QAEA 4B66A 1O5WA 1RP0A 4PAAA 4X9MA 5DBJA 1ZP0A 4Z24A 1F3PA 3AE9A 2R9ZA 3QSSA 1IJHA 2AR8A 3CGCA 4XWZA 3NG7X 1Y56A 1AOGA 1DXLA 2V60A 4H50A 4Z2UA 3QSMA 2Q6UA 3ICSA 2JAEA 3P4SA 4N9XA 4C77A 5KVHA 4Z2TA 2X99A 4C3XA 3AEEA 2XVJA 1GERA 4BK2A 1FL2A 1EL7A 3OZ2A 5EB4A 1RSGA 4YTPA 2BCGG 3H8LA 3P4RA 3IF9A 2A8XA 4Z44A 3NYEA 2CVJA 3KLJA 2WDRA 2AQJA 3QFAA 4GDEA 3AE2A 4H4SA 5KXJA 2VVMA 1K4QA 2B9WA 3GD4A 4U8KA 2B9XA 3UKLA 1JOAA 4A79A 2BK3A 2VZ2A 3NN6X 4U2SA 1D5TA 4K8DA 2YG6A 3VRDB 1COYA 4IV9A 1E1KA 3P4QA 1TYPA 5FS7A 3SM8A 4CCRA 3GDPA 4U2LA 3M13A 4UDRA 2YAUA 2YLRA 1XDIA 3RP6A 1YKJA 1PS9A 3FBSA 4CBQA 3CGEA 3DJJA 4YSYA 5M10A
chains in the Genus database with same CATH superfamily
1IUVA 1D7LA 2EQ8A 2ZBWA 3Q6JA 3V76A 3NTAA 3AEAA 3QFBA 3SFDA 2WPCA 2JBVA 3AEFA 3LXDA 3F8PA 2C64A 1ZOYA 1DOEA 1FOHA 2VRMA 3F8RA 4K2XA 5KOWA 3F8DA 1LPFA 1OJ9A 5KMRA 4OVIA 1TRBA 4OPIA 3AD7B 2CDUA 3PVCA 4EM4A 3DJEA 2UZZA 3NK0X 2PYXA 1NDAA 4J33A 2GR0A 3NNEA 5U1OA 3R9UA 1CJ4A 3UKFA 3IHGA 3UOVA 2WPFA 2GF3A 4JY3A 4LU6A 2YG4A 1E1MA 3CGBA 3RP7A 4YSHA 3AB1A 4UP3A 4U8NA 2DKIA 4II2A 2R4EA 1JRYA 2R0PA 2C4CA 3LJPA 4B64A 1GRTA 2TPRA 1S2YA 2GB0A 2GRTA 2WU5A 3B6DA 2VOUA 3PS9A 1H86A 1PBCA 4FDCB 3SFEA 3CNTA 2GVCA 4J57A 1YQ3A 4J31A 4TM1A 2R46A 4AOSA 3AE3A 1CC6A 4EMWA 2DKHA 3IWAA 1Z6LA 2XDOA 1IUUA 4A99A 2C7GA 4GRTA 2ZZCA 3DH9A 4WCTA 2VVLA 2WU2A 2NPXA 4PABA 4EQXA 1KSSA 1LQUA 2C73A 4B68A 1VRQB 4B63A 3CTYA 3H4KA 3EPTA 1PBEA 1GTHA 4GF7A 3SYIA 1N1PA 3B3RA 3T37A 2Z5XA 1VG0A 4H4RA 3VRBA 1Y0PA 2XLPA 3BNMA 4A6NA 1H7XA 4YT0A 2XFUA 1GETA 3S61A 1D4CA 4ZCDA 2V3AA 1FEAA 1H6VA 3ALLA 4USQA 2BK5A 2FJAA 4CCQA 1DOBA 1GRGA 1H84A 1OJDA 4OPCA 2WEUA 4Z25A 5BRTA 2V3BA 2V6OA 1CBOA 1EBDA 3KVEA 1TDEA 2ACZA 3NLCA 3O0HA 2CFYA 3P9UA 4RSLA 4KPRA 2XFOA 4K5SA 3NIXA 4KX6A 4REKA 4Z26A 1H83A 4H4XA 1D7YA 2WOWA 2YR5A 4U8PA 3AXBA 4WX1A 5BUKA 1GRAA 1PBBA 2IVEA 3AEGA 3GMCA 3T2KA 2WP5A 3GMBA 4DGKA 3AE6A 4J2WA 5FMHA 2GR2A 1GXFA 1KSUA 5BULA 1M64A 4FX9A 2E5VA 1PXBA 2QA1A 3FMWA 2VRLA 2GAGB 2BRAA 4A7AA 2GH5A 3SGLA 2I0ZA 4AT0A 4ECHA 2YM1A 1IUSA 3AYJA 2VVLG 3SZCA 4H4PA 5U63A 3T0KA 1CJ2A 4YSXA 1H81A 5CQFA 1PJ6A 5HY5A 1E1NA 3QSEA 4II3A 3CPHG 2C75A 2XVHA 3M0OA 4Z2RA 3UTEA 5IQ1A 3PO7A 1Q1RA 1ZDLA 3NN0X 1GPEA 1N4UA 5KNLA 4B67A 1D4DA 1P2HA 4AP1A 5C2TA 4EMJA 2XCGA 5U25A 3GSIA 2C3DA 4IA5A 2ARDA 2C66A 1LTXR 2YLXA 3K7QX 4A6NB 2GMJA 1GTEA 1BF3A 1ZK7A 2OALA 4NEWA 4CNKA 1H82A 1PBFA 4FK1A 4H4YA 1YQ4A 3D1CA 2BS3A 1EL8A 3KD9A 3ICTA 4BJYA 4OPTA 1K0LA 4H4UA 1K0IA 2GQFA 4H2QA 3EANA 2V61A 4FK1C 3RNMA 4E0VA 3WE0A 3P4PA 4BK3A 4NTEA 4U8LA 3SZWA 3UTFA 5IPYA 3EF6A 3UTGA 3VQRA 5HXIA 2V5ZA 4AT2A 5GRTA 2BXRA 4I58A 3KU9A 4K5RA 2JB3A 3UKAA 1Q1WA 2Z5YA 1NAAA 3K7TA 1GALA 3NRNA 2R0GA 3NH3X 2YG3A 1E1LA 4B1BA 3LOVA 2B9YA 4XWRA 4NTCA 2VQ7A 4C3YA 5L46A 1OJTA 5KOXA 5KRQA 1EL5A 4CY8A 2GR1A 3GWFA 3COXA 1KDGA 1FCDA 2BS4A 2GV8A 3T31A 3QVRA 2CULA 2WP6A 2XLUA 1K0JA 2X8HA 3KKJA 4ADWA 4GAPA 4Y4MA 4EQRA 3M12A 4YSZA 4EQWA 3ISHA 1E39A 3CN8A 3FG2P 2GAHB 2C70A 4EIPA 1GRHA 4YTMA 2O9ZA 3UKHA 1LQTA 4H4QA 1ZY8A 4U8MA 1NHPA 2Y6QA 4YKGA 1LV0A 3Q9TA 2H88A 1DNCA 4U2TA 3K7MX 3GWDA 1NENA 2WDQA 3NK1X 2BYBA 2OLNA 2A87A 2Q7VA 3DJGX 3AYLA 1JRXA 3T2ZA 3HYVA 1N4VA 2XFQA 5M0ZA 1VQWA 3QJ4A 4B65A 5LV9A 2Q0LA 4OPGA 1L9CA 4H2PA 3AEDA 3CNPA 3NYCA 1QO8A 1JNRA 2X50A 2XLTA 3C96A 3AD9B 1ZMCA 2YLSA 4ZCCA 1NG4A 1Q9IA 4TLZA 4K22A 2F5ZA 3DK4A 4DSHA 2YLWA 3KPKA 1DJQA 2ZZBA 1NG3A 2EQ9A 1GRBA 2WBAA 3SY4A 4IA6A 5JCMA 4LIIA 2C72A 4JNQA 1JRZA 1VDCA 1PN0A 2WDVA 2XFNA 2BXSA 1SEZA 3RP8A 5HYMA 3NTDA 3C4AA 2W0HA 3CNJA 1LJ1A 1TDOA 3S5WA 2VQBA 4DNAA 1GRFA 2C67A 4H4ZA 1L0VA 4A9WA 3BHKA 2FJDA 2TMDA 3NYFA 4H4VA 3ZDNA 4C5OA 2JK6A 3ATQA 3L1RA 3IC9A 1FECA 2YWLA 5TR3A 3REDA 2XFPA 2BACA 3NHOX 3BI4A 3BHFA 3NT6A 2R45A 3NK2X 3GD3A 1GV4A 4IVOB 2QCUA 1L9DA 1PJ5A 5JCKA 3AE5A 2YR6A 1PDHA 1KNRA 1W4XA 3AEBA 3BI2A 1N4WA 4H4WA 4Y4LA 3ALJA 4UDQA 4U8OA 3K30A 2BS2A 5J7XA 2JKCA 4NEVA 4HB9A 1IUTA 3C4NA 5EB5A 2GEWA 4G6GA 4RG3A 1ELIA 3HYXA 3LZXA 4OPDA 5KWFA 4JDRA 4X4JA 3UKQA 2X8GA 3UOYA 3UOZA 3CPIG 1NHSA 1O94A 4J34A 4GCMA 4U8JA 5ER0A 3SX6A 4CRTA 3GYJA 2RABA 2WP9A 2WHDA 3DGHA 1GT8A 1CL0A 1EL9A 3AE1A 4NWZA 4UDPA 3IHMA 4G9KA 1XHCA 1GEUA 4B69A 2OAMA 1KF6A 2XLRA 1Y56B 3H8IA 2IIDA 3FPZA 2NVKX 4H2RA 3URHA 4EM3A 4LA1A 4G73A 2WS3A 3CNSA 1MOKA 4C74A 1S3BA 3DK9A 2BK4A 1GNDA 1TDFA 2BA9A 3GRSA 1H7WA 4DSGA 1F8SA 2BRYA 4H7UA 1CHUA 1CC2A 4A65A 4APNA 4D03A 2B7RA 4OPUA 1CJCA 1O95A 3AYIA 4TLXA 2BCPA 3ALMA 5EOWA 4JNAA 3UTHA 4I59A 4ZN0A 4A5LA 1BWCA 3SZ0A 2J3NA 1GREA 4RG4A 1QLBA 4NTDA 4BK1A 2Y6RA 1DODA 1QJDA 3KA7A 2B7SA 4AOXA 3QVPA 5C3JA 1CF3A 1KFYA 1PHHA 3HYWA 2RGJA 3AE8A 1PBDA 1NEKA 3AECA 3D8XA 1BGNA 3V3NA 3I6DA 2X3NA 3AD8B 1S3EA 3AE4A 2WPEA 1PXCA 2OA1A 3P1WA 4GR1A 1ZMDA 5BVAA 5KMSA 4TM0A 1S2QA 1F8RA 3SXIA 1P2EA 1XANA 3GDNA 1ZKQA 1YQZA 4OPLA 5HHFA 4EQSA 3T2YA 1MXTA 5KVIA 1VG9A 2EQ6A 3DK8A 3UP4A 1NHQA 4XXGA 1X31B 2C76A 2E1MA 4BV6A 3VRAA 4EMIA 4IVMB 3SQPA 1IUWA 1NPXA 2PHHA 4Y4NA 2IVDA 3UOXA 1F8WA 2YQUA 1B5QA 3DJDA 2R0CA 2X8CA 3UCLA 4M52A 3G5SA 2FJEA 2FJBA 1XPQA 5JCIA 2GQWA 2YVFA 5J60A 2RGHA 4TM4A 3DA1A 4CNJA 4U8IA 1CC4A 2XVFA 3ITJA 2BABA 2GR3A 3T14A 1KNPA 3JSKA 4YXDA 1V59A 1GOSA 2JB2A 1F6MA 1D4EA 3II4A 4YTNA 5KMPA 1E6EA 3UKKA 5JCLA 2OLOA 3AWIA 3HZLA 3ICRA 4H2NA 2B76A 4G6HA 3UP5A 5FS8A 1REOA 2WETA 1YY5A 3ADAB 1B37A 1M6IA 1TYTA 2A89A 3AE7A 1JEHA 5CKUA 4JN9A 4BJZA 4D04A 2XVEA 1L9EA 2APGA 1TDKA 4BURA 2C65A 4NNJA 1CJ3A 4TM3A 4Z43A 4J36A 3BNUA 1NHRA 2E4GA 4EIQA 4GUVA 2WQYA 3OC4A 1OJCA 3RHAA 2EQ7A 2YM2A 3FIMB 1HYUA 1PJ7A 2JB1A 2XLSA 2YVJA 3LB8A 1BGJA 5FS6A 2BC0A 2XVIA 4NZHA 5FS9A 1ZOVA 1GESA 3BI5A 3EAOA 1FEBA 4O5QA 2GMHA 1JU2A 1IUXA 3ATRA 3CMMA 4P9SA 5EBKA 1GSNA 4AP3A 2FBWA 2YG5A 4MJWA 3ABVA 3E1TA 2C3CA 2YLTA 2WESA 4YKFA 2YR4A 4JQ9A 4H4TA 2HQMA 5JCNA 3LZWA 3NGCX 2YG7A 4G74A 3G5QA 3G5RA 2YVGA 4HA6A 3LADA 3CPJG 2ZZ0A 2H89A 1E7PA 3KPFA 5KMQA 2AAQA 1ONFA 3VR9A 4X9NA 2R4JA 3CNDA 4ICYA 1LVLA 3DMEA 2WOIA 3CGDA 2XYOA 1MO9A 3ZYXA 2Q0KA 3I3LA 3L8KA 4USRA 4CY6A 1RYIA 4J56A 3GYXA 1BZLA 1ZX9A 3V3OA 1JNZA 3DGZA 1B8SA 1B4VA 2YLZA 1PXAA 3CIRA 4O5UA 1DOCA 3NKSA 2RGOA 5GSNA 2WOVA 3VR8A 2QA2A 4JY2A 4OCGA 5IQ4A 1UKVG 3GYIA 4K7ZA 4GDPA 3UKPA 4YWOA 3GRTA 1OJAA 2BC1A 1BKWA 1DJNA 1TDNA 2QAEA 4B66A 1O5WA 1RP0A 4PAAA 4X9MA 5DBJA 1ZP0A 4Z24A 1F3PA 3AE9A 2R9ZA 3QSSA 1IJHA 2AR8A 3CGCA 4XWZA 3NG7X 1Y56A 1AOGA 1DXLA 2V60A 4H50A 4Z2UA 3QSMA 2Q6UA 3ICSA 2JAEA 3P4SA 4N9XA 4C77A 5KVHA 4Z2TA 2X99A 4C3XA 3AEEA 2XVJA 1GERA 4BK2A 1FL2A 1EL7A 3OZ2A 5EB4A 1RSGA 4YTPA 2BCGG 3H8LA 3P4RA 3IF9A 2A8XA 4Z44A 3NYEA 2CVJA 3SZFA 3KLJA 2WDRA 2AQJA 3QFAA 4GDEA 3AE2A 4H4SA 5KXJA 2VVMA 1K4QA 2B9WA 3GD4A 4U8KA 2B9XA 3UKLA 1JOAA 4A79A 2BK3A 2VZ2A 3NN6X 4U2SA 1D5TA 4K8DA 2YG6A 3VRDB 1COYA 4IV9A 1E1KA 3P4QA 1TYPA 5FS7A 3SM8A 4CCRA 3GDPA 4U2LA 3M13A 4UDRA 2YAUA 2YLRA 4GAVA 1XDIA 3RP6A 1YKJA 1PS9A 3FBSA 4CBQA 3CGEA 3DJJA 4YSYA 5M10A
chains in the Genus database with same CATH topology
1IUVA 1D7LA 2EQ8A 2ZBWA 3Q6JA 3V76A 3NTAA 3AEAA 3QFBA 3SFDA 2WPCA 2JBVA 3AEFA 3LXDA 3F8PA 2C64A 1ZOYA 1DOEA 1FOHA 2VRMA 3F8RA 4K2XA 5KOWA 3F8DA 1LPFA 1OJ9A 5KMRA 4OVIA 1TRBA 4OPIA 3AD7B 2CDUA 3PVCA 4EM4A 3DJEA 2UZZA 3NK0X 2PYXA 1NDAA 4J33A 2GR0A 3NNEA 5U1OA 3R9UA 1CJ4A 3UKFA 3IHGA 3UOVA 2WPFA 2GF3A 4JY3A 4LU6A 2YG4A 1E1MA 3CGBA 3RP7A 4YSHA 3AB1A 4UP3A 4U8NA 2DKIA 4II2A 2R4EA 1JRYA 2R0PA 2C4CA 3LJPA 4B64A 1GRTA 2TPRA 1S2YA 2GB0A 2GRTA 2WU5A 3B6DA 2VOUA 3PS9A 1H86A 1PBCA 4FDCB 3SFEA 3CNTA 2GVCA 4J57A 1YQ3A 4J31A 4TM1A 2R46A 4AOSA 3AE3A 1CC6A 4EMWA 2DKHA 3IWAA 1Z6LA 2XDOA 1IUUA 4A99A 2C7GA 4GRTA 2ZZCA 3DH9A 4WCTA 2VVLA 2WU2A 2NPXA 4PABA 4EQXA 1KSSA 1LQUA 2C73A 4B68A 1VRQB 4B63A 3CTYA 3H4KA 3EPTA 1PBEA 1GTHA 4GF7A 3SYIA 1N1PA 3B3RA 3T37A 2Z5XA 1VG0A 4H4RA 3VRBA 1Y0PA 2XLPA 3BNMA 4A6NA 1H7XA 4YT0A 2XFUA 1GETA 3S61A 1D4CA 4ZCDA 2V3AA 1FEAA 1H6VA 3ALLA 4USQA 2BK5A 2FJAA 4CCQA 1DOBA 1GRGA 1H84A 1OJDA 4OPCA 2WEUA 4Z25A 5BRTA 2V3BA 2V6OA 1CBOA 1EBDA 3KVEA 1TDEA 2ACZA 3NLCA 3O0HA 2CFYA 3P9UA 4RSLA 4KPRA 2XFOA 4K5SA 3NIXA 4KX6A 4REKA 4Z26A 1H83A 4H4XA 1D7YA 2WOWA 2YR5A 4U8PA 3AXBA 4WX1A 5BUKA 1GRAA 1PBBA 2IVEA 3AEGA 3GMCA 3T2KA 2WP5A 3GMBA 4DGKA 3AE6A 4J2WA 5FMHA 2GR2A 1GXFA 1KSUA 5BULA 1M64A 4FX9A 2E5VA 1PXBA 2QA1A 3FMWA 2VRLA 2GAGB 2BRAA 4A7AA 2GH5A 3SGLA 2I0ZA 4AT0A 4ECHA 2YM1A 1IUSA 3AYJA 2VVLG 3SZCA 4H4PA 5U63A 3T0KA 1CJ2A 4YSXA 1H81A 5CQFA 1PJ6A 5HY5A 1E1NA 3QSEA 4II3A 3CPHG 2C75A 2XVHA 3M0OA 4Z2RA 3UTEA 5IQ1A 3PO7A 1Q1RA 1ZDLA 3NN0X 1GPEA 1N4UA 5KNLA 4B67A 1D4DA 1P2HA 4AP1A 5C2TA 4EMJA 2XCGA 5U25A 3GSIA 2C3DA 4IA5A 2ARDA 2C66A 1LTXR 2YLXA 3K7QX 4A6NB 2GMJA 1GTEA 1BF3A 1ZK7A 2OALA 4NEWA 4CNKA 1H82A 1PBFA 4FK1A 4H4YA 1YQ4A 3D1CA 2BS3A 1EL8A 3KD9A 3ICTA 4BJYA 4OPTA 1K0LA 4H4UA 1K0IA 2GQFA 4H2QA 3EANA 2V61A 4FK1C 3RNMA 4E0VA 3WE0A 3P4PA 4BK3A 4NTEA 4U8LA 3SZWA 3UTFA 5IPYA 3EF6A 3UTGA 3VQRA 5HXIA 2V5ZA 4AT2A 5GRTA 2BXRA 4I58A 3KU9A 4K5RA 2JB3A 3UKAA 1Q1WA 2Z5YA 1NAAA 3K7TA 1GALA 3NRNA 2R0GA 3NH3X 2YG3A 1E1LA 4B1BA 3LOVA 2B9YA 4XWRA 4NTCA 2VQ7A 4C3YA 5L46A 1OJTA 5KOXA 5KRQA 1EL5A 4CY8A 2GR1A 3GWFA 3COXA 1KDGA 1FCDA 2BS4A 2GV8A 3T31A 3QVRA 2CULA 2WP6A 2XLUA 1K0JA 2X8HA 3KKJA 4ADWA 4GAPA 4Y4MA 4EQRA 3M12A 4YSZA 4EQWA 3ISHA 1E39A 3CN8A 3FG2P 2GAHB 2C70A 4EIPA 1GRHA 4YTMA 2O9ZA 3UKHA 1LQTA 4H4QA 1ZY8A 4U8MA 1NHPA 2Y6QA 4YKGA 1LV0A 3Q9TA 2H88A 1DNCA 4U2TA 3K7MX 3GWDA 1NENA 2WDQA 3NK1X 2BYBA 2OLNA 2A87A 2Q7VA 3DJGX 3AYLA 1JRXA 3T2ZA 3HYVA 1N4VA 2XFQA 5M0ZA 1VQWA 3QJ4A 4B65A 5LV9A 2Q0LA 4OPGA 1L9CA 4H2PA 3AEDA 3CNPA 3NYCA 1QO8A 1JNRA 2X50A 2XLTA 3C96A 3AD9B 1ZMCA 2YLSA 4ZCCA 1NG4A 1Q9IA 4TLZA 4K22A 2F5ZA 3DK4A 4DSHA 2YLWA 3KPKA 1DJQA 2ZZBA 1NG3A 2EQ9A 1GRBA 2WBAA 3SY4A 4IA6A 5JCMA 4LIIA 2C72A 4JNQA 1JRZA 1VDCA 1PN0A 2WDVA 2XFNA 2BXSA 1SEZA 3RP8A 5HYMA 3NTDA 3C4AA 2W0HA 3CNJA 1LJ1A 1TDOA 3S5WA 2VQBA 4DNAA 1GRFA 2C67A 4H4ZA 1L0VA 4A9WA 3BHKA 2FJDA 2TMDA 3NYFA 4H4VA 3ZDNA 4C5OA 2JK6A 3ATQA 3L1RA 3IC9A 1FECA 2YWLA 5TR3A 3REDA 2XFPA 2BACA 3NHOX 3BI4A 3BHFA 3NT6A 2R45A 3NK2X 3GD3A 1GV4A 4IVOB 2QCUA 1L9DA 1PJ5A 5JCKA 3AE5A 2YR6A 1PDHA 1KNRA 1W4XA 3AEBA 3BI2A 1N4WA 4H4WA 4Y4LA 3ALJA 4UDQA 4U8OA 3K30A 2BS2A 5J7XA 2JKCA 4NEVA 4HB9A 1IUTA 3C4NA 5EB5A 2GEWA 4G6GA 4RG3A 1ELIA 3HYXA 3LZXA 4OPDA 5KWFA 4JDRA 4X4JA 3UKQA 2X8GA 3UOYA 3UOZA 3CPIG 1NHSA 1O94A 4J34A 4GCMA 4U8JA 5ER0A 3SX6A 4CRTA 3GYJA 2RABA 2WP9A 2WHDA 3DGHA 1GT8A 1CL0A 1EL9A 3AE1A 4NWZA 4UDPA 3IHMA 4G9KA 1XHCA 1GEUA 4B69A 2OAMA 1KF6A 2XLRA 1Y56B 3H8IA 2IIDA 3FPZA 2NVKX 4H2RA 3URHA 4EM3A 4LA1A 4G73A 2WS3A 3CNSA 1MOKA 4C74A 1S3BA 3DK9A 2BK4A 1GNDA 1TDFA 2BA9A 3GRSA 1H7WA 4DSGA 1F8SA 2BRYA 4H7UA 1CHUA 1CC2A 4A65A 4APNA 4D03A 2B7RA 4OPUA 1CJCA 1O95A 3AYIA 4TLXA 2BCPA 3ALMA 5EOWA 4JNAA 3UTHA 4I59A 4ZN0A 4A5LA 1BWCA 3SZ0A 2J3NA 1GREA 4RG4A 1QLBA 4NTDA 4BK1A 2Y6RA 1DODA 1QJDA 3KA7A 2B7SA 4AOXA 3QVPA 5C3JA 1CF3A 1KFYA 1PHHA 3HYWA 2RGJA 3AE8A 1PBDA 1NEKA 3AECA 3D8XA 1BGNA 3V3NA 3I6DA 2X3NA 3AD8B 1S3EA 3AE4A 2WPEA 1PXCA 2OA1A 3P1WA 4GR1A 1ZMDA 5BVAA 5KMSA 4TM0A 1S2QA 1F8RA 3SXIA 1P2EA 1XANA 3GDNA 1ZKQA 1YQZA 4OPLA 5HHFA 4EQSA 3T2YA 1MXTA 5KVIA 1VG9A 2EQ6A 3DK8A 3UP4A 1NHQA 4XXGA 1X31B 2C76A 2E1MA 4BV6A 3VRAA 4EMIA 4IVMB 3SQPA 1IUWA 1NPXA 2PHHA 4Y4NA 2IVDA 3UOXA 1F8WA 2YQUA 1B5QA 3DJDA 2R0CA 2X8CA 3UCLA 4M52A 3G5SA 2FJEA 2FJBA 1XPQA 5JCIA 2GQWA 2YVFA 5J60A 2RGHA 4TM4A 3DA1A 4CNJA 4U8IA 1CC4A 2XVFA 3ITJA 2BABA 2GR3A 3T14A 1KNPA 3JSKA 4YXDA 1V59A 1GOSA 2JB2A 1F6MA 1D4EA 3II4A 4YTNA 5KMPA 1E6EA 3UKKA 5JCLA 2OLOA 3AWIA 3HZLA 3ICRA 4H2NA 2B76A 4G6HA 3UP5A 5FS8A 1REOA 2WETA 1YY5A 3ADAB 1B37A 1M6IA 1TYTA 2A89A 3AE7A 1JEHA 5CKUA 4JN9A 4BJZA 4D04A 2XVEA 1L9EA 2APGA 1TDKA 4BURA 2C65A 4NNJA 1CJ3A 4TM3A 4Z43A 4J36A 3BNUA 1NHRA 2E4GA 4EIQA 4GUVA 2WQYA 3OC4A 1OJCA 3RHAA 2EQ7A 2YM2A 3FIMB 1HYUA 1PJ7A 2JB1A 2XLSA 2YVJA 3LB8A 1BGJA 5FS6A 2BC0A 2XVIA 4NZHA 5FS9A 1ZOVA 1GESA 3BI5A 3EAOA 1FEBA 4O5QA 2GMHA 1JU2A 1IUXA 3ATRA 3CMMA 4P9SA 5EBKA 1GSNA 4AP3A 2FBWA 2YG5A 4MJWA 3ABVA 3E1TA 2C3CA 2YLTA 2WESA 4YKFA 2YR4A 4JQ9A 4H4TA 2HQMA 5JCNA 3LZWA 3NGCX 2YG7A 4G74A 3G5QA 3G5RA 2YVGA 4HA6A 3LADA 3CPJG 2ZZ0A 2H89A 1E7PA 3KPFA 5KMQA 2AAQA 1ONFA 3VR9A 4X9NA 2R4JA 3CNDA 4ICYA 1LVLA 3DMEA 2WOIA 3CGDA 2XYOA 1MO9A 3ZYXA 2Q0KA 3I3LA 3L8KA 4USRA 4CY6A 1RYIA 4J56A 3GYXA 1BZLA 1ZX9A 3V3OA 1JNZA 3DGZA 1B8SA 1B4VA 2YLZA 1PXAA 3CIRA 4O5UA 1DOCA 3NKSA 2RGOA 5GSNA 2WOVA 3VR8A 2QA2A 4JY2A 4OCGA 5IQ4A 1UKVG 3GYIA 4K7ZA 4GDPA 3UKPA 4YWOA 3GRTA 1OJAA 2BC1A 1BKWA 1DJNA 1TDNA 2QAEA 4B66A 1O5WA 1RP0A 4PAAA 4X9MA 5DBJA 1ZP0A 4Z24A 1F3PA 3AE9A 2R9ZA 3QSSA 1IJHA 2AR8A 3CGCA 4XWZA 3NG7X 1Y56A 1AOGA 1DXLA 2V60A 4H50A 4Z2UA 3QSMA 2Q6UA 3ICSA 2JAEA 3P4SA 4N9XA 4C77A 5KVHA 4Z2TA 2X99A 4C3XA 3AEEA 2XVJA 1GERA 4BK2A 1FL2A 1EL7A 3OZ2A 5EB4A 1RSGA 4YTPA 2BCGG 3H8LA 3P4RA 3IF9A 2A8XA 4Z44A 3NYEA 2CVJA 3SZFA 3KLJA 2WDRA 2AQJA 3QFAA 4GDEA 3AE2A 4H4SA 5KXJA 2VVMA 1K4QA 2B9WA 3GD4A 4U8KA 2B9XA 3UKLA 1JOAA 4A79A 2BK3A 2VZ2A 3NN6X 4U2SA 1D5TA 4K8DA 2YG6A 3VRDB 1COYA 4IV9A 1E1KA 3P4QA 1TYPA 5FS7A 3SM8A 4CCRA 3GDPA 4U2LA 3M13A 4UDRA 2YAUA 2YLRA 4GAVA 1XDIA 3RP6A 1YKJA 1PS9A 3FBSA 4CBQA 3CGEA 3DJJA 4YSYA 5M10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUV A;  1D7L A;  2EQ8 A;  2ZBW A;  3Q6J A;  3V76 A;  3NTA A;  3AEA A;  3QFB A;  3SFD A;  2WPC A;  2JBV A;  3AEF A;  3LXD A;  3F8P A;  2C64 A;  1ZOY A;  1DOE A;  1FOH A;  2VRM A;  3F8R A;  4K2X A;  5KOW A;  3F8D A;  1LPF A;  1OJ9 A;  4OVI A;  1TRB A;  4OPI A;  3AD7 B;  2CDU A;  3PVC A;  4EM4 A;  3DJE A;  2UZZ A;  3NK0 X;  2PYX A;  1NDA A;  4J33 A;  2GR0 A;  3NNE A;  5U1O A;  3R9U A;  1CJ4 A;  3UKF A;  3IHG A;  3UOV A;  2WPF A;  2GF3 A;  4JY3 A;  4LU6 A;  2YG4 A;  1E1M A;  3CGB A;  3RP7 A;  4YSH A;  3AB1 A;  4UP3 A;  4U8N A;  2DKI A;  2R4E A;  1JRY A;  2R0P A;  3LJP A;  4B64 A;  1GRT A;  2TPR A;  1S2Y A;  2GB0 A;  2GRT A;  2WU5 A;  3B6D A;  2VOU A;  3PS9 A;  1H86 A;  1PBC A;  4FDC B;  3SFE A;  3CNT A;  2GVC A;  4J57 A;  1YQ3 A;  4J31 A;  4TM1 A;  2R46 A;  4AOS A;  3AE3 A;  1CC6 A;  4EMW A;  2DKH A;  3IWA A;  1Z6L A;  2XDO A;  1IUU A;  4A99 A;  2C7G A;  4GRT A;  2ZZC A;  3DH9 A;  4WCT A;  2VVL A;  2WU2 A;  2NPX A;  4PAB A;  4EQX A;  1KSS A;  1LQU A;  2C73 A;  4B68 A;  1VRQ B;  4B63 A;  3CTY A;  3H4K A;  3EPT A;  1PBE A;  1GTH A;  4GF7 A;  3T37 A;  1N1P A;  3B3R A;  2Z5X A;  1VG0 A;  4H4R A;  3VRB A;  1Y0P A;  2XLP A;  3BNM A;  4A6N A;  1H7X A;  4YT0 A;  2XFU A;  1GET A;  3S61 A;  1D4C A;  4ZCD A;  2V3A A;  1FEA A;  1H6V A;  3ALL A;  4USQ A;  2BK5 A;  2FJA A;  4CCQ A;  1DOB A;  1GRG A;  1H84 A;  1OJD A;  4OPC A;  2WEU A;  4Z25 A;  5BRT A;  2V3B A;  2V6O A;  1CBO A;  1EBD A;  3KVE A;  1TDE A;  2ACZ A;  3NLC A;  3O0H A;  2CFY A;  3P9U A;  4RSL A;  4KPR A;  2XFO A;  4K5S A;  3NIX A;  4KX6 A;  4REK A;  4Z26 A;  1H83 A;  4H4X A;  1D7Y A;  2WOW A;  2YR5 A;  4U8P A;  3AXB A;  4WX1 A;  5BUK A;  1GRA A;  1PBB A;  2IVE A;  3AEG A;  3GMC A;  2WP5 A;  3GMB A;  4DGK A;  3AE6 A;  4J2W A;  5FMH A;  2GR2 A;  1GXF A;  1KSU A;  5BUL A;  1M64 A;  4FX9 A;  2E5V A;  1PXB A;  2QA1 A;  3FMW A;  2VRL A;  2GAG B;  4A7A A;  2GH5 A;  3SGL A;  2I0Z A;  4AT0 A;  4ECH A;  2YM1 A;  1IUS A;  3AYJ A;  2VVL G;  4H4P A;  5U63 A;  1CJ2 A;  4YSX A;  1H81 A;  5CQF A;  1PJ6 A;  5HY5 A;  1E1N A;  3QSE A;  3CPH G;  2C75 A;  2XVH A;  3M0O A;  4Z2R A;  3UTE A;  5IQ1 A;  3PO7 A;  1Q1R A;  1ZDL A;  3NN0 X;  1GPE A;  1N4U A;  4B67 A;  1D4D A;  1P2H A;  4AP1 A;  5C2T A;  4EMJ A;  2XCG A;  5U25 A;  3GSI A;  2C3D A;  4IA5 A;  2ARD A;  2C66 A;  1LTX R;  2YLX A;  3K7Q X;  4A6N B;  2GMJ A;  1GTE A;  1BF3 A;  1ZK7 A;  2OAL A;  4NEW A;  4CNK A;  1H82 A;  1PBF A;  4FK1 A;  4H4Y A;  1YQ4 A;  3D1C A;  2BS3 A;  1EL8 A;  3KD9 A;  3ICT A;  4BJY A;  4OPT A;  1K0L A;  4H4U A;  1K0I A;  2GQF A;  4H2Q A;  3EAN A;  2V61 A;  4FK1 C;  3RNM A;  4E0V A;  3WE0 A;  3P4P A;  4BK3 A;  4NTE A;  4U8L A;  3UTF A;  5IPY A;  3EF6 A;  3UTG A;  3VQR A;  5HXI A;  2V5Z A;  4AT2 A;  5GRT A;  2BXR A;  4I58 A;  3KU9 A;  4K5R A;  2JB3 A;  3UKA A;  1Q1W A;  2Z5Y A;  1NAA A;  3K7T A;  1GAL A;  3NRN A;  2R0G A;  3NH3 X;  2YG3 A;  1E1L A;  4B1B A;  3LOV A;  2B9Y A;  4XWR A;  4NTC A;  2VQ7 A;  4C3Y A;  5L46 A;  1OJT A;  5KOX A;  5KRQ A;  1EL5 A;  4CY8 A;  2GR1 A;  3GWF A;  3COX A;  1KDG A;  1FCD A;  2BS4 A;  2GV8 A;  3QVR A;  2CUL A;  2WP6 A;  2XLU A;  1K0J A;  2X8H A;  3KKJ A;  4ADW A;  4Y4M A;  4EQR A;  3M12 A;  4YSZ A;  4EQW A;  3ISH A;  1E39 A;  3CN8 A;  3FG2 P;  2GAH B;  2C70 A;  4EIP A;  1GRH A;  4YTM A;  2O9Z A;  3UKH A;  1LQT A;  4H4Q A;  1ZY8 A;  4U8M A;  1NHP A;  2Y6Q A;  4YKG A;  1LV0 A;  3Q9T A;  2H88 A;  1DNC A;  4U2T A;  3K7M X;  3GWD A;  1NEN A;  2WDQ A;  3NK1 X;  2BYB A;  2OLN A;  2A87 A;  2Q7V A;  3DJG X;  3AYL A;  1JRX A;  1N4V A;  2XFQ A;  5M0Z A;  1VQW A;  3QJ4 A;  4B65 A;  5LV9 A;  2Q0L A;  4OPG A;  1L9C A;  4H2P A;  3AED A;  3CNP A;  3NYC A;  1QO8 A;  1JNR A;  2X50 A;  2XLT A;  3C96 A;  3AD9 B;  1ZMC A;  2YLS A;  4ZCC A;  1NG4 A;  1Q9I A;  4TLZ A;  4K22 A;  2F5Z A;  3DK4 A;  4DSH A;  2YLW A;  1DJQ A;  2ZZB A;  1NG3 A;  2EQ9 A;  1GRB A;  2WBA A;  4IA6 A;  5JCM A;  4LII A;  2C72 A;  4JNQ A;  1JRZ A;  1VDC A;  1PN0 A;  2WDV A;  2XFN A;  2BXS A;  1SEZ A;  3RP8 A;  5HYM A;  3NTD A;  3C4A A;  2W0H A;  3CNJ A;  1LJ1 A;  1TDO A;  3S5W A;  2VQB A;  4DNA A;  1GRF A;  2C67 A;  4H4Z A;  1L0V A;  4A9W A;  3BHK A;  2FJD A;  2TMD A;  3NYF A;  4H4V A;  3ZDN A;  4C5O A;  2JK6 A;  3ATQ A;  3L1R A;  3IC9 A;  1FEC A;  2YWL A;  5TR3 A;  3RED A;  2XFP A;  2BAC A;  3NHO X;  3BI4 A;  3BHF A;  3NT6 A;  2R45 A;  3NK2 X;  3GD3 A;  1GV4 A;  4IVO B;  2QCU A;  1L9D A;  1PJ5 A;  5JCK A;  3AE5 A;  2YR6 A;  1PDH A;  1KNR A;  1W4X A;  3AEB A;  3BI2 A;  1N4W A;  4H4W A;  4Y4L A;  3ALJ A;  4UDQ A;  4U8O A;  3K30 A;  2BS2 A;  5J7X A;  2JKC A;  4NEV A;  4HB9 A;  1IUT A;  3C4N A;  5EB5 A;  2GEW A;  4RG3 A;  1ELI A;  3LZX A;  4OPD A;  5KWF A;  4JDR A;  4X4J A;  3UKQ A;  2X8G A;  3UOY A;  3UOZ A;  3CPI G;  1NHS A;  1O94 A;  4J34 A;  4GCM A;  4U8J A;  5ER0 A;  4CRT A;  3GYJ A;  2RAB A;  2WP9 A;  2WHD A;  3DGH A;  1GT8 A;  1CL0 A;  1EL9 A;  3AE1 A;  4UDP A;  3IHM A;  1XHC A;  1GEU A;  4B69 A;  2OAM A;  1KF6 A;  2XLR A;  1Y56 B;  3H8I A;  2IID A;  3FPZ A;  2NVK X;  4H2R A;  3URH A;  4EM3 A;  4LA1 A;  2WS3 A;  3CNS A;  1MOK A;  4C74 A;  1S3B A;  3DK9 A;  2BK4 A;  1GND A;  1TDF A;  2BA9 A;  3GRS A;  1H7W A;  4DSG A;  1F8S A;  4H7U A;  4A65 A;  1CHU A;  1CC2 A;  4APN A;  4D03 A;  2B7R A;  4OPU A;  1CJC A;  1O95 A;  3AYI A;  4TLX A;  2BCP A;  3ALM A;  5EOW A;  4JNA A;  3UTH A;  4I59 A;  4ZN0 A;  4A5L A;  1BWC A;  2J3N A;  1GRE A;  4RG4 A;  1QLB A;  4NTD A;  4BK1 A;  2Y6R A;  1DOD A;  1QJD A;  3KA7 A;  2B7S A;  4AOX A;  3QVP A;  5C3J A;  1CF3 A;  1KFY A;  1PHH A;  2RGJ A;  3AE8 A;  1PBD A;  1NEK A;  3AEC A;  3D8X A;  1BGN A;  3V3N A;  3I6D A;  2X3N A;  3AD8 B;  1S3E A;  3AE4 A;  2WPE A;  1PXC A;  2OA1 A;  3P1W A;  4GR1 A;  1ZMD A;  5BVA A;  4TM0 A;  1S2Q A;  1F8R A;  1P2E A;  1XAN A;  3GDN A;  1ZKQ A;  1YQZ A;  4OPL A;  5HHF A;  4EQS A;  1MXT A;  5KVI A;  1VG9 A;  2EQ6 A;  3DK8 A;  3UP4 A;  1NHQ A;  4XXG A;  1X31 B;  2C76 A;  2E1M A;  4BV6 A;  3VRA A;  4EMI A;  4IVM B;  3SQP A;  1IUW A;  1NPX A;  2PHH A;  4Y4N A;  2IVD A;  3UOX A;  1F8W A;  2YQU A;  1B5Q A;  3DJD A;  2R0C A;  2X8C A;  3UCL A;  4M52 A;  3G5S A;  2FJE A;  2FJB A;  1XPQ A;  5JCI A;  2GQW A;  2YVF A;  5J60 A;  2RGH A;  4TM4 A;  3DA1 A;  4CNJ A;  4U8I A;  1CC4 A;  2XVF A;  3ITJ A;  2BAB A;  2GR3 A;  1KNP A;  3JSK A;  4YXD A;  1V59 A;  1GOS A;  2JB2 A;  1F6M A;  1D4E A;  3II4 A;  4YTN A;  1E6E A;  3UKK A;  5JCL A;  2OLO A;  3AWI A;  3HZL A;  3ICR A;  4H2N A;  2B76 A;  3UP5 A;  5FS8 A;  1REO A;  2WET A;  1YY5 A;  3ADA B;  1B37 A;  1M6I A;  1TYT A;  2A89 A;  3AE7 A;  1JEH A;  5CKU A;  4JN9 A;  4BJZ A;  4D04 A;  2XVE A;  1L9E A;  2APG A;  1TDK A;  4BUR A;  2C65 A;  1CJ3 A;  4TM3 A;  4Z43 A;  4J36 A;  3BNU A;  1NHR A;  2E4G A;  4EIQ A;  4GUV A;  2WQY A;  3OC4 A;  1OJC A;  3RHA A;  2EQ7 A;  2YM2 A;  3FIM B;  1HYU A;  1PJ7 A;  2JB1 A;  2XLS A;  2YVJ A;  3LB8 A;  1BGJ A;  5FS6 A;  2BC0 A;  2XVI A;  4NZH A;  5FS9 A;  1ZOV A;  1GES A;  3BI5 A;  3EAO A;  1FEB A;  4O5Q A;  2GMH A;  1JU2 A;  1IUX A;  3ATR A;  4P9S A;  5EBK A;  4AP3 A;  1GSN A;  2FBW A;  2YG5 A;  4MJW A;  3ABV A;  3E1T A;  2C3C A;  2YLT A;  2WES A;  4YKF A;  2YR4 A;  4JQ9 A;  4H4T A;  2HQM A;  5JCN A;  3LZW A;  3NGC X;  2YG7 A;  3G5Q A;  3G5R A;  2YVG A;  4HA6 A;  3LAD A;  3CPJ G;  2ZZ0 A;  2H89 A;  1E7P A;  3KPF A;  2AAQ A;  1ONF A;  3VR9 A;  4X9N A;  2R4J A;  3CND A;  4ICY A;  1LVL A;  3DME A;  2WOI A;  3CGD A;  2XYO A;  1MO9 A;  3ZYX A;  2Q0K A;  3I3L A;  3L8K A;  4USR A;  4CY6 A;  1RYI A;  4J56 A;  1BZL A;  1ZX9 A;  3V3O A;  1JNZ A;  3DGZ A;  1B8S A;  1B4V A;  2YLZ A;  1PXA A;  3CIR A;  4O5U A;  1DOC A;  3NKS A;  2RGO A;  5GSN A;  2WOV A;  3VR8 A;  2QA2 A;  4JY2 A;  4OCG A;  5IQ4 A;  1UKV G;  3GYI A;  4K7Z A;  4GDP A;  3UKP A;  4YWO A;  3GRT A;  1OJA A;  2BC1 A;  1BKW A;  1DJN A;  1TDN A;  2QAE A;  4B66 A;  1O5W A;  1RP0 A;  4PAA A;  4X9M A;  5DBJ A;  1ZP0 A;  4Z24 A;  1F3P A;  3AE9 A;  2R9Z A;  3QSS A;  1IJH A;  2AR8 A;  3CGC A;  4XWZ A;  3NG7 X;  1Y56 A;  1AOG A;  1DXL A;  2V60 A;  4H50 A;  4Z2U A;  3QSM A;  2Q6U A;  3ICS A;  2JAE A;  3P4S A;  4N9X A;  4C77 A;  5KVH A;  4Z2T A;  2X99 A;  4C3X A;  3AEE A;  2XVJ A;  1GER A;  4BK2 A;  1FL2 A;  1EL7 A;  3OZ2 A;  5EB4 A;  1RSG A;  4YTP A;  2BCG G;  3H8L A;  3P4R A;  3IF9 A;  2A8X A;  4Z44 A;  3NYE A;  2CVJ A;  3KLJ A;  2WDR A;  2AQJ A;  3QFA A;  4GDE A;  3AE2 A;  4H4S A;  5KXJ A;  2VVM A;  1K4Q A;  2B9W A;  3GD4 A;  4U8K A;  2B9X A;  3UKL A;  1JOA A;  4A79 A;  2BK3 A;  2VZ2 A;  3NN6 X;  4U2S A;  1D5T A;  4K8D A;  2YG6 A;  3VRD B;  1COY A;  4IV9 A;  1E1K A;  3P4Q A;  1TYP A;  5FS7 A;  3SM8 A;  4CCR A;  3GDP A;  4U2L A;  3M13 A;  4UDR A;  2YAU A;  2YLR A;  1XDI A;  3RP6 A;  1YKJ A;  1PS9 A;  3FBS A;  4CBQ A;  3CGE A;  3DJJ A;  4YSY A;  5M10 A; 
#chains in the Genus database with same CATH topology
 1IUV A;  1D7L A;  2EQ8 A;  2ZBW A;  3Q6J A;  3V76 A;  3NTA A;  3AEA A;  3QFB A;  3SFD A;  2WPC A;  2JBV A;  3AEF A;  3LXD A;  3F8P A;  2C64 A;  1ZOY A;  1DOE A;  1FOH A;  2VRM A;  3F8R A;  4K2X A;  5KOW A;  3F8D A;  1LPF A;  1OJ9 A;  5KMR A;  4OVI A;  1TRB A;  4OPI A;  3AD7 B;  2CDU A;  3PVC A;  4EM4 A;  3DJE A;  2UZZ A;  3NK0 X;  2PYX A;  1NDA A;  4J33 A;  2GR0 A;  3NNE A;  5U1O A;  3R9U A;  1CJ4 A;  3UKF A;  3IHG A;  3UOV A;  2WPF A;  2GF3 A;  4JY3 A;  4LU6 A;  2YG4 A;  1E1M A;  3CGB A;  3RP7 A;  4YSH A;  3AB1 A;  4UP3 A;  4U8N A;  2DKI A;  4II2 A;  2R4E A;  1JRY A;  2R0P A;  2C4C A;  3LJP A;  4B64 A;  1GRT A;  2TPR A;  1S2Y A;  2GB0 A;  2GRT A;  2WU5 A;  3B6D A;  2VOU A;  3PS9 A;  1H86 A;  1PBC A;  4FDC B;  3SFE A;  3CNT A;  2GVC A;  4J57 A;  1YQ3 A;  4J31 A;  4TM1 A;  2R46 A;  4AOS A;  3AE3 A;  1CC6 A;  4EMW A;  2DKH A;  3IWA A;  1Z6L A;  2XDO A;  1IUU A;  4A99 A;  2C7G A;  4GRT A;  2ZZC A;  3DH9 A;  4WCT A;  2VVL A;  2WU2 A;  2NPX A;  4PAB A;  4EQX A;  1KSS A;  1LQU A;  2C73 A;  4B68 A;  1VRQ B;  4B63 A;  3CTY A;  3H4K A;  3EPT A;  1PBE A;  1GTH A;  4GF7 A;  3SYI A;  1N1P A;  3B3R A;  3T37 A;  2Z5X A;  1VG0 A;  4H4R A;  3VRB A;  1Y0P A;  2XLP A;  3BNM A;  4A6N A;  1H7X A;  4YT0 A;  2XFU A;  1GET A;  3S61 A;  1D4C A;  4ZCD A;  2V3A A;  1FEA A;  1H6V A;  3ALL A;  4USQ A;  2BK5 A;  2FJA A;  4CCQ A;  1DOB A;  1GRG A;  1H84 A;  1OJD A;  4OPC A;  2WEU A;  4Z25 A;  5BRT A;  2V3B A;  2V6O A;  1CBO A;  1EBD A;  3KVE A;  1TDE A;  2ACZ A;  3NLC A;  3O0H A;  2CFY A;  3P9U A;  4RSL A;  4KPR A;  2XFO A;  4K5S A;  3NIX A;  4KX6 A;  4REK A;  4Z26 A;  1H83 A;  4H4X A;  1D7Y A;  2WOW A;  2YR5 A;  4U8P A;  3AXB A;  4WX1 A;  5BUK A;  1GRA A;  1PBB A;  2IVE A;  3AEG A;  3GMC A;  3T2K A;  2WP5 A;  3GMB A;  4DGK A;  3AE6 A;  4J2W A;  5FMH A;  2GR2 A;  1GXF A;  1KSU A;  5BUL A;  1M64 A;  4FX9 A;  2E5V A;  1PXB A;  2QA1 A;  3FMW A;  2VRL A;  2GAG B;  2BRA A;  4A7A A;  2GH5 A;  3SGL A;  2I0Z A;  4AT0 A;  4ECH A;  2YM1 A;  1IUS A;  3AYJ A;  2VVL G;  3SZC A;  4H4P A;  5U63 A;  3T0K A;  1CJ2 A;  4YSX A;  1H81 A;  5CQF A;  1PJ6 A;  5HY5 A;  1E1N A;  3QSE A;  4II3 A;  3CPH G;  2C75 A;  2XVH A;  3M0O A;  4Z2R A;  3UTE A;  5IQ1 A;  3PO7 A;  1Q1R A;  1ZDL A;  3NN0 X;  1GPE A;  1N4U A;  5KNL A;  4B67 A;  1D4D A;  1P2H A;  4AP1 A;  5C2T A;  4EMJ A;  2XCG A;  5U25 A;  3GSI A;  2C3D A;  4IA5 A;  2ARD A;  2C66 A;  1LTX R;  2YLX A;  3K7Q X;  4A6N B;  2GMJ A;  1GTE A;  1BF3 A;  1ZK7 A;  2OAL A;  4NEW A;  4CNK A;  1H82 A;  1PBF A;  4FK1 A;  4H4Y A;  1YQ4 A;  3D1C A;  2BS3 A;  1EL8 A;  3KD9 A;  3ICT A;  4BJY A;  4OPT A;  1K0L A;  4H4U A;  1K0I A;  2GQF A;  4H2Q A;  3EAN A;  2V61 A;  4FK1 C;  3RNM A;  4E0V A;  3WE0 A;  3P4P A;  4BK3 A;  4NTE A;  4U8L A;  3SZW A;  3UTF A;  5IPY A;  3EF6 A;  3UTG A;  3VQR A;  5HXI A;  2V5Z A;  4AT2 A;  5GRT A;  2BXR A;  4I58 A;  3KU9 A;  4K5R A;  2JB3 A;  3UKA A;  1Q1W A;  2Z5Y A;  1NAA A;  3K7T A;  1GAL A;  3NRN A;  2R0G A;  3NH3 X;  2YG3 A;  1E1L A;  4B1B A;  3LOV A;  2B9Y A;  4XWR A;  4NTC A;  2VQ7 A;  4C3Y A;  5L46 A;  1OJT A;  5KOX A;  5KRQ A;  1EL5 A;  4CY8 A;  2GR1 A;  3GWF A;  3COX A;  1KDG A;  1FCD A;  2BS4 A;  2GV8 A;  3T31 A;  3QVR A;  2CUL A;  2WP6 A;  2XLU A;  1K0J A;  2X8H A;  3KKJ A;  4ADW A;  4GAP A;  4Y4M A;  4EQR A;  3M12 A;  4YSZ A;  4EQW A;  3ISH A;  1E39 A;  3CN8 A;  3FG2 P;  2GAH B;  2C70 A;  4EIP A;  1GRH A;  4YTM A;  2O9Z A;  3UKH A;  1LQT A;  4H4Q A;  1ZY8 A;  4U8M A;  1NHP A;  2Y6Q A;  4YKG A;  1LV0 A;  3Q9T A;  2H88 A;  1DNC A;  4U2T A;  3K7M X;  3GWD A;  1NEN A;  2WDQ A;  3NK1 X;  2BYB A;  2OLN A;  2A87 A;  2Q7V A;  3DJG X;  3AYL A;  1JRX A;  3T2Z A;  3HYV A;  1N4V A;  2XFQ A;  5M0Z A;  1VQW A;  3QJ4 A;  4B65 A;  5LV9 A;  2Q0L A;  4OPG A;  1L9C A;  4H2P A;  3AED A;  3CNP A;  3NYC A;  1QO8 A;  1JNR A;  2X50 A;  2XLT A;  3C96 A;  3AD9 B;  1ZMC A;  2YLS A;  4ZCC A;  1NG4 A;  1Q9I A;  4TLZ A;  4K22 A;  2F5Z A;  3DK4 A;  4DSH A;  2YLW A;  3KPK A;  1DJQ A;  2ZZB A;  1NG3 A;  2EQ9 A;  1GRB A;  2WBA A;  3SY4 A;  4IA6 A;  5JCM A;  4LII A;  2C72 A;  4JNQ A;  1JRZ A;  1VDC A;  1PN0 A;  2WDV A;  2XFN A;  2BXS A;  1SEZ A;  3RP8 A;  5HYM A;  3NTD A;  3C4A A;  2W0H A;  3CNJ A;  1LJ1 A;  1TDO A;  3S5W A;  2VQB A;  4DNA A;  1GRF A;  2C67 A;  4H4Z A;  1L0V A;  4A9W A;  3BHK A;  2FJD A;  2TMD A;  3NYF A;  4H4V A;  3ZDN A;  4C5O A;  2JK6 A;  3ATQ A;  3L1R A;  3IC9 A;  1FEC A;  2YWL A;  5TR3 A;  3RED A;  2XFP A;  2BAC A;  3NHO X;  3BI4 A;  3BHF A;  3NT6 A;  2R45 A;  3NK2 X;  3GD3 A;  1GV4 A;  4IVO B;  2QCU A;  1L9D A;  1PJ5 A;  5JCK A;  3AE5 A;  2YR6 A;  1PDH A;  1KNR A;  1W4X A;  3AEB A;  3BI2 A;  1N4W A;  4H4W A;  4Y4L A;  3ALJ A;  4UDQ A;  4U8O A;  3K30 A;  2BS2 A;  5J7X A;  2JKC A;  4NEV A;  4HB9 A;  1IUT A;  3C4N A;  5EB5 A;  2GEW A;  4G6G A;  4RG3 A;  1ELI A;  3HYX A;  3LZX A;  4OPD A;  5KWF A;  4JDR A;  4X4J A;  3UKQ A;  2X8G A;  3UOY A;  3UOZ A;  3CPI G;  1NHS A;  1O94 A;  4J34 A;  4GCM A;  4U8J A;  5ER0 A;  3SX6 A;  4CRT A;  3GYJ A;  2RAB A;  2WP9 A;  2WHD A;  3DGH A;  1GT8 A;  1CL0 A;  1EL9 A;  3AE1 A;  4NWZ A;  4UDP A;  3IHM A;  4G9K A;  1XHC A;  1GEU A;  4B69 A;  2OAM A;  1KF6 A;  2XLR A;  1Y56 B;  3H8I A;  2IID A;  3FPZ A;  2NVK X;  4H2R A;  3URH A;  4EM3 A;  4LA1 A;  4G73 A;  2WS3 A;  3CNS A;  1MOK A;  4C74 A;  1S3B A;  3DK9 A;  2BK4 A;  1GND A;  1TDF A;  2BA9 A;  3GRS A;  1H7W A;  4DSG A;  1F8S A;  2BRY A;  4H7U A;  1CHU A;  1CC2 A;  4A65 A;  4APN A;  4D03 A;  2B7R A;  4OPU A;  1CJC A;  1O95 A;  3AYI A;  4TLX A;  2BCP A;  3ALM A;  5EOW A;  4JNA A;  3UTH A;  4I59 A;  4ZN0 A;  4A5L A;  1BWC A;  3SZ0 A;  2J3N A;  1GRE A;  4RG4 A;  1QLB A;  4NTD A;  4BK1 A;  2Y6R A;  1DOD A;  1QJD A;  3KA7 A;  2B7S A;  4AOX A;  3QVP A;  5C3J A;  1CF3 A;  1KFY A;  1PHH A;  3HYW A;  2RGJ A;  3AE8 A;  1PBD A;  1NEK A;  3AEC A;  3D8X A;  1BGN A;  3V3N A;  3I6D A;  2X3N A;  3AD8 B;  1S3E A;  3AE4 A;  2WPE A;  1PXC A;  2OA1 A;  3P1W A;  4GR1 A;  1ZMD A;  5BVA A;  5KMS A;  4TM0 A;  1S2Q A;  1F8R A;  3SXI A;  1P2E A;  1XAN A;  3GDN A;  1ZKQ A;  1YQZ A;  4OPL A;  5HHF A;  4EQS A;  3T2Y A;  1MXT A;  5KVI A;  1VG9 A;  2EQ6 A;  3DK8 A;  3UP4 A;  1NHQ A;  4XXG A;  1X31 B;  2C76 A;  2E1M A;  4BV6 A;  3VRA A;  4EMI A;  4IVM B;  3SQP A;  1IUW A;  1NPX A;  2PHH A;  4Y4N A;  2IVD A;  3UOX A;  1F8W A;  2YQU A;  1B5Q A;  3DJD A;  2R0C A;  2X8C A;  3UCL A;  4M52 A;  3G5S A;  2FJE A;  2FJB A;  1XPQ A;  5JCI A;  2GQW A;  2YVF A;  5J60 A;  2RGH A;  4TM4 A;  3DA1 A;  4CNJ A;  4U8I A;  1CC4 A;  2XVF A;  3ITJ A;  2BAB A;  2GR3 A;  3T14 A;  1KNP A;  3JSK A;  4YXD A;  1V59 A;  1GOS A;  2JB2 A;  1F6M A;  1D4E A;  3II4 A;  4YTN A;  5KMP A;  1E6E A;  3UKK A;  5JCL A;  2OLO A;  3AWI A;  3HZL A;  3ICR A;  4H2N A;  2B76 A;  4G6H A;  3UP5 A;  5FS8 A;  1REO A;  2WET A;  1YY5 A;  3ADA B;  1B37 A;  1M6I A;  1TYT A;  2A89 A;  3AE7 A;  1JEH A;  5CKU A;  4JN9 A;  4BJZ A;  4D04 A;  2XVE A;  1L9E A;  2APG A;  1TDK A;  4BUR A;  2C65 A;  4NNJ A;  1CJ3 A;  4TM3 A;  4Z43 A;  4J36 A;  3BNU A;  1NHR A;  2E4G A;  4EIQ A;  4GUV A;  2WQY A;  3OC4 A;  1OJC A;  3RHA A;  2EQ7 A;  2YM2 A;  3FIM B;  1HYU A;  1PJ7 A;  2JB1 A;  2XLS A;  2YVJ A;  3LB8 A;  1BGJ A;  5FS6 A;  2BC0 A;  2XVI A;  4NZH A;  5FS9 A;  1ZOV A;  1GES A;  3BI5 A;  3EAO A;  1FEB A;  4O5Q A;  2GMH A;  1JU2 A;  1IUX A;  3ATR A;  3CMM A;  4P9S A;  5EBK A;  1GSN A;  4AP3 A;  2FBW A;  2YG5 A;  4MJW A;  3ABV A;  3E1T A;  2C3C A;  2YLT A;  2WES A;  4YKF A;  2YR4 A;  4JQ9 A;  4H4T A;  2HQM A;  5JCN A;  3LZW A;  3NGC X;  2YG7 A;  4G74 A;  3G5Q A;  3G5R A;  2YVG A;  4HA6 A;  3LAD A;  3CPJ G;  2ZZ0 A;  2H89 A;  1E7P A;  3KPF A;  5KMQ A;  2AAQ A;  1ONF A;  3VR9 A;  4X9N A;  2R4J A;  3CND A;  4ICY A;  1LVL A;  3DME A;  2WOI A;  3CGD A;  2XYO A;  1MO9 A;  3ZYX A;  2Q0K A;  3I3L A;  3L8K A;  4USR A;  4CY6 A;  1RYI A;  4J56 A;  3GYX A;  1BZL A;  1ZX9 A;  3V3O A;  1JNZ A;  3DGZ A;  1B8S A;  1B4V A;  2YLZ A;  1PXA A;  3CIR A;  4O5U A;  1DOC A;  3NKS A;  2RGO A;  5GSN A;  2WOV A;  3VR8 A;  2QA2 A;  4JY2 A;  4OCG A;  5IQ4 A;  1UKV G;  3GYI A;  4K7Z A;  4GDP A;  3UKP A;  4YWO A;  3GRT A;  1OJA A;  2BC1 A;  1BKW A;  1DJN A;  1TDN A;  2QAE A;  4B66 A;  1O5W A;  1RP0 A;  4PAA A;  4X9M A;  5DBJ A;  1ZP0 A;  4Z24 A;  1F3P A;  3AE9 A;  2R9Z A;  3QSS A;  1IJH A;  2AR8 A;  3CGC A;  4XWZ A;  3NG7 X;  1Y56 A;  1AOG A;  1DXL A;  2V60 A;  4H50 A;  4Z2U A;  3QSM A;  2Q6U A;  3ICS A;  2JAE A;  3P4S A;  4N9X A;  4C77 A;  5KVH A;  4Z2T A;  2X99 A;  4C3X A;  3AEE A;  2XVJ A;  1GER A;  4BK2 A;  1FL2 A;  1EL7 A;  3OZ2 A;  5EB4 A;  1RSG A;  4YTP A;  2BCG G;  3H8L A;  3P4R A;  3IF9 A;  2A8X A;  4Z44 A;  3NYE A;  2CVJ A;  3SZF A;  3KLJ A;  2WDR A;  2AQJ A;  3QFA A;  4GDE A;  3AE2 A;  4H4S A;  5KXJ A;  2VVM A;  1K4Q A;  2B9W A;  3GD4 A;  4U8K A;  2B9X A;  3UKL A;  1JOA A;  4A79 A;  2BK3 A;  2VZ2 A;  3NN6 X;  4U2S A;  1D5T A;  4K8D A;  2YG6 A;  3VRD B;  1COY A;  4IV9 A;  1E1K A;  3P4Q A;  1TYP A;  5FS7 A;  3SM8 A;  4CCR A;  3GDP A;  4U2L A;  3M13 A;  4UDR A;  2YAU A;  2YLR A;  4GAV A;  1XDI A;  3RP6 A;  1YKJ A;  1PS9 A;  3FBS A;  4CBQ A;  3CGE A;  3DJJ A;  4YSY A;  5M10 A; 
#chains in the Genus database with same CATH homology
 1IUV A;  1D7L A;  2EQ8 A;  2ZBW A;  3Q6J A;  3V76 A;  3NTA A;  3AEA A;  3QFB A;  3SFD A;  2WPC A;  2JBV A;  3AEF A;  3LXD A;  3F8P A;  2C64 A;  1ZOY A;  1DOE A;  1FOH A;  2VRM A;  3F8R A;  4K2X A;  5KOW A;  3F8D A;  1LPF A;  1OJ9 A;  5KMR A;  4OVI A;  1TRB A;  4OPI A;  3AD7 B;  2CDU A;  3PVC A;  4EM4 A;  3DJE A;  2UZZ A;  3NK0 X;  2PYX A;  1NDA A;  4J33 A;  2GR0 A;  3NNE A;  5U1O A;  3R9U A;  1CJ4 A;  3UKF A;  3IHG A;  3UOV A;  2WPF A;  2GF3 A;  4JY3 A;  4LU6 A;  2YG4 A;  1E1M A;  3CGB A;  3RP7 A;  4YSH A;  3AB1 A;  4UP3 A;  4U8N A;  2DKI A;  4II2 A;  2R4E A;  1JRY A;  2R0P A;  2C4C A;  3LJP A;  4B64 A;  1GRT A;  2TPR A;  1S2Y A;  2GB0 A;  2GRT A;  2WU5 A;  3B6D A;  2VOU A;  3PS9 A;  1H86 A;  1PBC A;  4FDC B;  3SFE A;  3CNT A;  2GVC A;  4J57 A;  1YQ3 A;  4J31 A;  4TM1 A;  2R46 A;  4AOS A;  3AE3 A;  1CC6 A;  4EMW A;  2DKH A;  3IWA A;  1Z6L A;  2XDO A;  1IUU A;  4A99 A;  2C7G A;  4GRT A;  2ZZC A;  3DH9 A;  4WCT A;  2VVL A;  2WU2 A;  2NPX A;  4PAB A;  4EQX A;  1KSS A;  1LQU A;  2C73 A;  4B68 A;  1VRQ B;  4B63 A;  3CTY A;  3H4K A;  3EPT A;  1PBE A;  1GTH A;  4GF7 A;  3SYI A;  1N1P A;  3B3R A;  3T37 A;  2Z5X A;  1VG0 A;  4H4R A;  3VRB A;  1Y0P A;  2XLP A;  3BNM A;  4A6N A;  1H7X A;  4YT0 A;  2XFU A;  1GET A;  3S61 A;  1D4C A;  4ZCD A;  2V3A A;  1FEA A;  1H6V A;  3ALL A;  4USQ A;  2BK5 A;  2FJA A;  4CCQ A;  1DOB A;  1GRG A;  1H84 A;  1OJD A;  4OPC A;  2WEU A;  4Z25 A;  5BRT A;  2V3B A;  2V6O A;  1CBO A;  1EBD A;  3KVE A;  1TDE A;  2ACZ A;  3NLC A;  3O0H A;  2CFY A;  3P9U A;  4RSL A;  4KPR A;  2XFO A;  4K5S A;  3NIX A;  4KX6 A;  4REK A;  4Z26 A;  1H83 A;  4H4X A;  1D7Y A;  2WOW A;  2YR5 A;  4U8P A;  3AXB A;  4WX1 A;  5BUK A;  1GRA A;  1PBB A;  2IVE A;  3AEG A;  3GMC A;  3T2K A;  2WP5 A;  3GMB A;  4DGK A;  3AE6 A;  4J2W A;  5FMH A;  2GR2 A;  1GXF A;  1KSU A;  5BUL A;  1M64 A;  4FX9 A;  2E5V A;  1PXB A;  2QA1 A;  3FMW A;  2VRL A;  2GAG B;  2BRA A;  4A7A A;  2GH5 A;  3SGL A;  2I0Z A;  4AT0 A;  4ECH A;  2YM1 A;  1IUS A;  3AYJ A;  2VVL G;  3SZC A;  4H4P A;  5U63 A;  3T0K A;  1CJ2 A;  4YSX A;  1H81 A;  5CQF A;  1PJ6 A;  5HY5 A;  1E1N A;  3QSE A;  4II3 A;  3CPH G;  2C75 A;  2XVH A;  3M0O A;  4Z2R A;  3UTE A;  5IQ1 A;  3PO7 A;  1Q1R A;  1ZDL A;  3NN0 X;  1GPE A;  1N4U A;  5KNL A;  4B67 A;  1D4D A;  1P2H A;  4AP1 A;  5C2T A;  4EMJ A;  2XCG A;  5U25 A;  3GSI A;  2C3D A;  4IA5 A;  2ARD A;  2C66 A;  1LTX R;  2YLX A;  3K7Q X;  4A6N B;  2GMJ A;  1GTE A;  1BF3 A;  1ZK7 A;  2OAL A;  4NEW A;  4CNK A;  1H82 A;  1PBF A;  4FK1 A;  4H4Y A;  1YQ4 A;  3D1C A;  2BS3 A;  1EL8 A;  3KD9 A;  3ICT A;  4BJY A;  4OPT A;  1K0L A;  4H4U A;  1K0I A;  2GQF A;  4H2Q A;  3EAN A;  2V61 A;  4FK1 C;  3RNM A;  4E0V A;  3WE0 A;  3P4P A;  4BK3 A;  4NTE A;  4U8L A;  3SZW A;  3UTF A;  5IPY A;  3EF6 A;  3UTG A;  3VQR A;  5HXI A;  2V5Z A;  4AT2 A;  5GRT A;  2BXR A;  4I58 A;  3KU9 A;  4K5R A;  2JB3 A;  3UKA A;  1Q1W A;  2Z5Y A;  1NAA A;  3K7T A;  1GAL A;  3NRN A;  2R0G A;  3NH3 X;  2YG3 A;  1E1L A;  4B1B A;  3LOV A;  2B9Y A;  4XWR A;  4NTC A;  2VQ7 A;  4C3Y A;  5L46 A;  1OJT A;  5KOX A;  5KRQ A;  1EL5 A;  4CY8 A;  2GR1 A;  3GWF A;  3COX A;  1KDG A;  1FCD A;  2BS4 A;  2GV8 A;  3T31 A;  3QVR A;  2CUL A;  2WP6 A;  2XLU A;  1K0J A;  2X8H A;  3KKJ A;  4ADW A;  4GAP A;  4Y4M A;  4EQR A;  3M12 A;  4YSZ A;  4EQW A;  3ISH A;  1E39 A;  3CN8 A;  3FG2 P;  2GAH B;  2C70 A;  4EIP A;  1GRH A;  4YTM A;  2O9Z A;  3UKH A;  1LQT A;  4H4Q A;  1ZY8 A;  4U8M A;  1NHP A;  2Y6Q A;  4YKG A;  1LV0 A;  3Q9T A;  2H88 A;  1DNC A;  4U2T A;  3K7M X;  3GWD A;  1NEN A;  2WDQ A;  3NK1 X;  2BYB A;  2OLN A;  2A87 A;  2Q7V A;  3DJG X;  3AYL A;  1JRX A;  3T2Z A;  3HYV A;  1N4V A;  2XFQ A;  5M0Z A;  1VQW A;  3QJ4 A;  4B65 A;  5LV9 A;  2Q0L A;  4OPG A;  1L9C A;  4H2P A;  3AED A;  3CNP A;  3NYC A;  1QO8 A;  1JNR A;  2X50 A;  2XLT A;  3C96 A;  3AD9 B;  1ZMC A;  2YLS A;  4ZCC A;  1NG4 A;  1Q9I A;  4TLZ A;  4K22 A;  2F5Z A;  3DK4 A;  4DSH A;  2YLW A;  3KPK A;  1DJQ A;  2ZZB A;  1NG3 A;  2EQ9 A;  1GRB A;  2WBA A;  3SY4 A;  4IA6 A;  5JCM A;  4LII A;  2C72 A;  4JNQ A;  1JRZ A;  1VDC A;  1PN0 A;  2WDV A;  2XFN A;  2BXS A;  1SEZ A;  3RP8 A;  5HYM A;  3NTD A;  3C4A A;  2W0H A;  3CNJ A;  1LJ1 A;  1TDO A;  3S5W A;  2VQB A;  4DNA A;  1GRF A;  2C67 A;  4H4Z A;  1L0V A;  4A9W A;  3BHK A;  2FJD A;  2TMD A;  3NYF A;  4H4V A;  3ZDN A;  4C5O A;  2JK6 A;  3ATQ A;  3L1R A;  3IC9 A;  1FEC A;  2YWL A;  5TR3 A;  3RED A;  2XFP A;  2BAC A;  3NHO X;  3BI4 A;  3BHF A;  3NT6 A;  2R45 A;  3NK2 X;  3GD3 A;  1GV4 A;  4IVO B;  2QCU A;  1L9D A;  1PJ5 A;  5JCK A;  3AE5 A;  2YR6 A;  1PDH A;  1KNR A;  1W4X A;  3AEB A;  3BI2 A;  1N4W A;  4H4W A;  4Y4L A;  3ALJ A;  4UDQ A;  4U8O A;  3K30 A;  2BS2 A;  5J7X A;  2JKC A;  4NEV A;  4HB9 A;  1IUT A;  3C4N A;  5EB5 A;  2GEW A;  4G6G A;  4RG3 A;  1ELI A;  3HYX A;  3LZX A;  4OPD A;  5KWF A;  4JDR A;  4X4J A;  3UKQ A;  2X8G A;  3UOY A;  3UOZ A;  3CPI G;  1NHS A;  1O94 A;  4J34 A;  4GCM A;  4U8J A;  5ER0 A;  3SX6 A;  4CRT A;  3GYJ A;  2RAB A;  2WP9 A;  2WHD A;  3DGH A;  1GT8 A;  1CL0 A;  1EL9 A;  3AE1 A;  4NWZ A;  4UDP A;  3IHM A;  4G9K A;  1XHC A;  1GEU A;  4B69 A;  2OAM A;  1KF6 A;  2XLR A;  1Y56 B;  3H8I A;  2IID A;  3FPZ A;  2NVK X;  4H2R A;  3URH A;  4EM3 A;  4LA1 A;  4G73 A;  2WS3 A;  3CNS A;  1MOK A;  4C74 A;  1S3B A;  3DK9 A;  2BK4 A;  1GND A;  1TDF A;  2BA9 A;  3GRS A;  1H7W A;  4DSG A;  1F8S A;  2BRY A;  4H7U A;  1CHU A;  1CC2 A;  4A65 A;  4APN A;  4D03 A;  2B7R A;  4OPU A;  1CJC A;  1O95 A;  3AYI A;  4TLX A;  2BCP A;  3ALM A;  5EOW A;  4JNA A;  3UTH A;  4I59 A;  4ZN0 A;  4A5L A;  1BWC A;  3SZ0 A;  2J3N A;  1GRE A;  4RG4 A;  1QLB A;  4NTD A;  4BK1 A;  2Y6R A;  1DOD A;  1QJD A;  3KA7 A;  2B7S A;  4AOX A;  3QVP A;  5C3J A;  1CF3 A;  1KFY A;  1PHH A;  3HYW A;  2RGJ A;  3AE8 A;  1PBD A;  1NEK A;  3AEC A;  3D8X A;  1BGN A;  3V3N A;  3I6D A;  2X3N A;  3AD8 B;  1S3E A;  3AE4 A;  2WPE A;  1PXC A;  2OA1 A;  3P1W A;  4GR1 A;  1ZMD A;  5BVA A;  5KMS A;  4TM0 A;  1S2Q A;  1F8R A;  3SXI A;  1P2E A;  1XAN A;  3GDN A;  1ZKQ A;  1YQZ A;  4OPL A;  5HHF A;  4EQS A;  3T2Y A;  1MXT A;  5KVI A;  1VG9 A;  2EQ6 A;  3DK8 A;  3UP4 A;  1NHQ A;  4XXG A;  1X31 B;  2C76 A;  2E1M A;  4BV6 A;  3VRA A;  4EMI A;  4IVM B;  3SQP A;  1IUW A;  1NPX A;  2PHH A;  4Y4N A;  2IVD A;  3UOX A;  1F8W A;  2YQU A;  1B5Q A;  3DJD A;  2R0C A;  2X8C A;  3UCL A;  4M52 A;  3G5S A;  2FJE A;  2FJB A;  1XPQ A;  5JCI A;  2GQW A;  2YVF A;  5J60 A;  2RGH A;  4TM4 A;  3DA1 A;  4CNJ A;  4U8I A;  1CC4 A;  2XVF A;  3ITJ A;  2BAB A;  2GR3 A;  3T14 A;  1KNP A;  3JSK A;  4YXD A;  1V59 A;  1GOS A;  2JB2 A;  1F6M A;  1D4E A;  3II4 A;  4YTN A;  5KMP A;  1E6E A;  3UKK A;  5JCL A;  2OLO A;  3AWI A;  3HZL A;  3ICR A;  4H2N A;  2B76 A;  4G6H A;  3UP5 A;  5FS8 A;  1REO A;  2WET A;  1YY5 A;  3ADA B;  1B37 A;  1M6I A;  1TYT A;  2A89 A;  3AE7 A;  1JEH A;  5CKU A;  4JN9 A;  4BJZ A;  4D04 A;  2XVE A;  1L9E A;  2APG A;  1TDK A;  4BUR A;  2C65 A;  4NNJ A;  1CJ3 A;  4TM3 A;  4Z43 A;  4J36 A;  3BNU A;  1NHR A;  2E4G A;  4EIQ A;  4GUV A;  2WQY A;  3OC4 A;  1OJC A;  3RHA A;  2EQ7 A;  2YM2 A;  3FIM B;  1HYU A;  1PJ7 A;  2JB1 A;  2XLS A;  2YVJ A;  3LB8 A;  1BGJ A;  5FS6 A;  2BC0 A;  2XVI A;  4NZH A;  5FS9 A;  1ZOV A;  1GES A;  3BI5 A;  3EAO A;  1FEB A;  4O5Q A;  2GMH A;  1JU2 A;  1IUX A;  3ATR A;  3CMM A;  4P9S A;  5EBK A;  1GSN A;  4AP3 A;  2FBW A;  2YG5 A;  4MJW A;  3ABV A;  3E1T A;  2C3C A;  2YLT A;  2WES A;  4YKF A;  2YR4 A;  4JQ9 A;  4H4T A;  2HQM A;  5JCN A;  3LZW A;  3NGC X;  2YG7 A;  4G74 A;  3G5Q A;  3G5R A;  2YVG A;  4HA6 A;  3LAD A;  3CPJ G;  2ZZ0 A;  2H89 A;  1E7P A;  3KPF A;  5KMQ A;  2AAQ A;  1ONF A;  3VR9 A;  4X9N A;  2R4J A;  3CND A;  4ICY A;  1LVL A;  3DME A;  2WOI A;  3CGD A;  2XYO A;  1MO9 A;  3ZYX A;  2Q0K A;  3I3L A;  3L8K A;  4USR A;  4CY6 A;  1RYI A;  4J56 A;  3GYX A;  1BZL A;  1ZX9 A;  3V3O A;  1JNZ A;  3DGZ A;  1B8S A;  1B4V A;  2YLZ A;  1PXA A;  3CIR A;  4O5U A;  1DOC A;  3NKS A;  2RGO A;  5GSN A;  2WOV A;  3VR8 A;  2QA2 A;  4JY2 A;  4OCG A;  5IQ4 A;  1UKV G;  3GYI A;  4K7Z A;  4GDP A;  3UKP A;  4YWO A;  3GRT A;  1OJA A;  2BC1 A;  1BKW A;  1DJN A;  1TDN A;  2QAE A;  4B66 A;  1O5W A;  1RP0 A;  4PAA A;  4X9M A;  5DBJ A;  1ZP0 A;  4Z24 A;  1F3P A;  3AE9 A;  2R9Z A;  3QSS A;  1IJH A;  2AR8 A;  3CGC A;  4XWZ A;  3NG7 X;  1Y56 A;  1AOG A;  1DXL A;  2V60 A;  4H50 A;  4Z2U A;  3QSM A;  2Q6U A;  3ICS A;  2JAE A;  3P4S A;  4N9X A;  4C77 A;  5KVH A;  4Z2T A;  2X99 A;  4C3X A;  3AEE A;  2XVJ A;  1GER A;  4BK2 A;  1FL2 A;  1EL7 A;  3OZ2 A;  5EB4 A;  1RSG A;  4YTP A;  2BCG G;  3H8L A;  3P4R A;  3IF9 A;  2A8X A;  4Z44 A;  3NYE A;  2CVJ A;  3SZF A;  3KLJ A;  2WDR A;  2AQJ A;  3QFA A;  4GDE A;  3AE2 A;  4H4S A;  5KXJ A;  2VVM A;  1K4Q A;  2B9W A;  3GD4 A;  4U8K A;  2B9X A;  3UKL A;  1JOA A;  4A79 A;  2BK3 A;  2VZ2 A;  3NN6 X;  4U2S A;  1D5T A;  4K8D A;  2YG6 A;  3VRD B;  1COY A;  4IV9 A;  1E1K A;  3P4Q A;  1TYP A;  5FS7 A;  3SM8 A;  4CCR A;  3GDP A;  4U2L A;  3M13 A;  4UDR A;  2YAU A;  2YLR A;  4GAV A;  1XDI A;  3RP6 A;  1YKJ A;  1PS9 A;  3FBS A;  4CBQ A;  3CGE A;  3DJJ A;  4YSY A;  5M10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...