1H86A

Covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 7.0
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h86A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h86A02
3QJ4A 1H82A 3CTYA 4B68A 2QAEA 3QSMA 3CIRA 1EL7A 1EBDA 2BK4A 2XVFA 3G5RA 2XFNA 1YKJA 5JCMA 4NTDA 1GRFA 2BK3A 5CKUA 1VG0A 3FBSA 4H2NA 3CNPA 3QSEA 4U8LA 3M0OA 4A9WA 1BZLA 4BK2A 1IJHA 1GT8A 5CQFA 2VZ2A 4TM1A 2B9WA 3JSKA 2OALA 2Q6UA 2BA9A 2RGOA 1O5WA 1YQZA 4RG3A 2GMJA 5KOWA 1BKWA 1B5QA 2PYXA 1LQUA 4XWZA 1LJ1A 4U2LA 2ARDA 1ELIA 2C66A 1XPQA 1TDFA 2GR0A 3AEFA 3PO7A 1NDAA 3UKLA 4RG4A 5IPYA 4DNAA 1UKVG 3AB1A 1FECA 1JNZA 3LXDA 1NG3A 1JU2A 4OPGA 5U25A 2XVIA 2B76A 2GV8A 4H4YA 2WHDA 1TYTA 2WP5A 1VQWA 2BS3A 1PXAA 2WS3A 3KU9A 3ITJA 4YTNA 1P2HA 1JRYA 3DJGX 5HY5A 4H2PA 1QLBA 4YTMA 1CL0A 3V3NA 1FOHA 4B66A 4NTCA 4OPTA 1LQTA 4IV9A 4P9SA 1TDOA 3AEEA 2ZZBA 3UTHA 5JCNA 1X31B 2VRMA 1Q1RA 3G5SA 3P4PA 1AOGA 1ZMDA 4KX6A 3C4AA 3KA7A 1BGNA 2YR5A 4YSXA 1GPEA 2FJBA 3CGDA 2VVLA 2YLRA 1GNDA 4X9MA 1GREA 4N9XA 3B3RA 3OC4A 1S3EA 3NYEA 3LZXA 4REKA 3DA1A 5TR3A 1KFYA 3OZ2A 3VRDB 1H83A 2XLTA 2H89A 5U63A 1OJAA 2TMDA 2FBWA 1Z6LA 3UTEA 3SQPA 2VOUA 1DOEA 3UKAA 4WCTA 3EANA 2GF3A 2WETA 4U8MA 5ER0A 3K30A 4Z26A 5IQ1A 2WDQA 4YKFA 3S61A 2VVLG 4HA6A 4OCGA 1D4EA 3AE5A 1PN0A 1Q9IA 1RYIA 1DNCA 3F8PA 5GRTA 1VG9A 3BNUA 5LV9A 1ZX9A 4U8PA 4JY2A 2XVEA 4AT0A 2XFOA 2AAQA 2QA1A 2IVDA 2CDUA 4RSLA 2Z5XA 1HYUA 2XDOA 2YG4A 3AWIA 4H4UA 2WPFA 3ISHA 4H7UA 1W4XA 4TLZA 3CGBA 5IQ4A 2V6OA 3P4SA 4J56A 2I0ZA 3RP7A 2IIDA 3NIXA 3VQRA 3M12A 3AEDA 2A89A 5KXJA 3ATRA 1M6IA 2C64A 2J3NA 4A6NB 1ZDLA 1TDNA 3O0HA 2C67A 1FCDA 4MJWA 3LB8A 4H4QA 5HYMA 2DKIA 4ZCCA 4EIPA 3AE3A 3ATQA 3CN8A 3NGCX 4GCMA 1S2QA 2YG6A 3BNMA 2JK6A 2FJEA 3C4NA 2C75A 3NTDA 4Z24A 1EL5A 3GD4A 2Y6QA 2YAUA 2YVFA 2GVCA 2V60A 1E1KA 1D7YA 1B4VA 3ICTA 5EB5A 4CY8A 4U8JA 2JBVA 3AE2A 1PXCA 2YLXA 3GWFA 4AOSA 1PXBA 2V5ZA 4BJYA 1NPXA 4XXGA 5KOXA 1CF3A 2CULA 4CRTA 1D4DA 4EIQA 3NG7X 2JB3A 3NNEA 4OPIA 3REDA 2CFYA 4GR1A 3T37A 3BI4A 4ZCDA 4JNQA 5M10A 4Y4NA 1TDKA 1TDEA 3GSIA 3COXA 1GRAA 2R0GA 4UDRA 4E0VA 2OLOA 1VDCA 2XFQA 3AYIA 3UP4A 3CPJG 3GDNA 3RP8A 1CC6A 1DOBA 1N4VA 1E1LA 3ABVA 3SM8A 1PJ5A 3PVCA 4CNJA 3ALJA 1L9EA 3K7QX 4GF7A 4H4ZA 2A8XA 2WBAA 5FS7A 2GQFA 1MOKA 4WX1A 5BRTA 3K7MX 1XDIA 3H4KA 4OPCA 4A6NA 1YY5A 2IVEA 3UKKA 3DJDA 3H8LA 3VRAA 1B37A 3UOVA 2GRTA 4CNKA 4Z2UA 1DOCA 1OJDA 2E1MA 3P1WA 4H4WA 1PBCA 4CCQA 4U8NA 3DJJA 1OJCA 2EQ8A 1F8SA 4UDPA 4J36A 2RABA 2XFPA 2X50A 5HHFA 2BCGG 2GMHA 2WQYA 5GSNA 4I59A 1COYA 2R9ZA 3UOYA 4ZN0A 1F8RA 1H6VA 4U2SA 4CCRA 1K0JA 5FS8A 3P4QA 4H4SA 5BVAA 3DJEA 2ZZCA 1GETA 4YT0A 3GDPA 4ECHA 1FEAA 4XWRA 4AP3A 4Z43A 1YQ3A 4YKGA 3I3LA 3SFDA 1GRBA 1DODA 1NHPA 2C3CA 1GALA 2Q7VA 4B64A 4B1BA 4EQSA 3AD7B 4CY6A 4BK1A 1DJNA 2OLNA 3ICSA 3GD3A 4Z25A 1MO9A 2FJDA 1GEUA 4J34A 1NENA 2BK5A 3NKSA 1VRQB 4IVOB 1RSGA 3QSSA 2R46A 3LADA 4J33A 5FMHA 1GXFA 2WOWA 3CPHG 5EB4A 4C74A 3LOVA 1K0LA 2V61A 4C77A 1N4WA 2BC1A 3NTAA 2RGHA 1B8SA 3AE7A 4K2XA 4CBQA 2YG7A 3L8KA 3NN0X 2Q0KA 4HB9A 3ICRA 1EL8A 1KSSA 2YLTA 4EQWA 3AEBA 3KD9A 4IVMB 1GRHA 4A7AA 4ADWA 3E1TA 4C3XA 2Q0LA 3CNTA 2C70A 1KNRA 2R4EA 4J57A 3R9UA 2AQJA 1XHCA 1GTEA 3I6DA 2GH5A 4H2QA 1H81A 4C3YA 1LTXR 2BACA 2GQWA 3CPIG 2A87A 3QFAA 3AE6A 1ZMCA 4B69A 1GSNA 1CJ3A 1F8WA 4U2TA 2YR6A 3NHOX 2VQBA 3FPZA 4TM3A 1JEHA 2UZZA 4UP3A 1PS9A 4GDPA 2B9XA 2BCPA 2VVMA 3AE8A 2XLSA 3IF9A 5U1OA 2V3AA 3V3OA 3GYIA 2WDRA 3UTFA 1IUUA 1Q1WA 3ALMA 4APNA 4JNAA 1EL9A 5EBKA 4X4JA 1CBOA 2WU2A 2ACZA 3UKFA 3URHA 1DJQA 1PBFA 4NTEA 4Y4MA 1MXTA 4GUVA 1S2YA 4B63A 4EQXA 2BABA 4M52A 5M0ZA 5FS6A 3RP6A 2ZBWA 3GMBA 3KVEA 1L9DA 4Y4LA 3VR9A 2B9YA 2PHHA 2C72A 2ZZ0A 3GWDA 2BC0A 4I58A 4H2RA 3GYJA 3SFEA 4C5OA 4D03A 1YQ4A 3ZDNA 3DGZA 3DK8A 3NH3X 1PBEA 2BYBA 3C96A 2JAEA 2OAMA 3Q6JA 4A99A 3UKHA 4Z2TA 2GEWA 2BS2A 2X8GA 3EPTA 2XYOA 4IA6A 2X8CA 4FK1A 1KSUA 2DKHA 2WDVA 1CJ2A 2R4JA 3F8DA 1JNRA 2B7SA 4EQRA 4DSGA 3AXBA 2X8HA 4A79A 1E39A 3P9UA 3AE1A 4J2WA 2GR2A 4K5RA 1M64A 1ZOVA 3IHGA 4YSHA 2JB2A 2CVJA 3S5WA 4YXDA 1LPFA 3PS9A 3IHMA 4H4VA 3VRBA 4Z44A 1XANA 1H7XA 2WU5A 3CNDA 2YLZA 4K5SA 2YLWA 1D5TA 1PJ6A 3G5QA 4EM3A 3QVPA 2Y6RA 3BI5A 1TYPA 3UKQA 3UTGA 3D8XA 5EOWA 1CJ4A 2V3BA 3KLJA 2AR8A 4TM4A 3KKJA 3V76A 1JOAA 2GAHB 1OJTA 1IUTA 2WP6A 2E4GA 4X9NA 1E6EA 1KDGA 2RGJA 4FX9A 4BJZA 2GR1A 4YSZA 3QFBA 1GV4A 4B67A 4YSYA 2B7RA 2OA1A 1CC2A 4YWOA 2X99A 2O9ZA 1IUVA 2F5ZA 1BGJA 4H4XA 1NHSA 1PDHA 2WPCA 3AEAA 3NK0X 5L46A 2WP9A 4USRA 4H4TA 5BULA 2C76A 3RHAA 1IUWA 4GDEA 4LU6A 2YG5A 1GESA 1NG4A 4JQ9A 5BUKA 3UCLA 3CGEA 3WE0A 3DK4A 1SEZA 2NVKX 4B65A 3FIMB 4LIIA 3LZWA 1FL2A 4JN9A 1GRGA 1GTHA 1JRZA 3BHFA 4J31A 1CC4A 1H86A 3GRSA 2EQ6A 3ADAB 3F8RA 1NAAA 1ZP0A 2VQ7A 4H50A 3L1RA 1CHUA 1OJ9A 2BS4A 4UDQA 5JCKA 5KVIA 4EM4A 3DK9A 3IWAA 3SGLA 3NYCA 1S3BA 2XFUA 2YVGA 4NZHA 4NEWA 4BURA 1P2EA 5JCLA 1PHHA 3HZLA 2R0CA 3NK1X 3BI2A 4U8IA 2E5VA 3AECA 4KPRA 4JDRA 4ICYA 2Z5YA 2APGA 4GRTA 2C65A 3FMWA 4FK1C 3ZYXA 2XLRA 4OPUA 4NEVA 3D1CA 4AT2A 2TPRA 1QO8A 1E7PA 3EAOA 1H7WA 2XVHA 3CNSA 3AE9A 3P4RA 2BXRA 1LVLA 4A65A 4LA1A 4USQA 5C3JA 1F6MA 3M13A 2QCUA 3DGHA 4K7ZA 4A5LA 4EMIA 1KNPA 2WESA 1PJ7A 1L0VA 3DMEA 4TLXA 1F3PA 3II4A 4IA5A 3FG2P 4O5QA 4EMWA 1K0IA 3NK2X 2C73A 1NHRA 1Y0PA 1IUSA 1N4UA 3AD8B 2WPEA 1GOSA 3CGCA 4K22A 3UOZA 4DSHA 1NEKA 4JY3A 5KWFA 4Z2RA 3Q9TA 4FDCB 1Y56B 1ZOYA 2WOIA 1PBBA 3GMCA 3NN6X 5DBJA 2YLSA 1RP0A 3H8IA 1JRXA 2NPXA 1TRBA 3UOXA 5J60A 1O94A 4O5UA 4TM0A 2BXSA 1NHQA 1PBDA 2VRLA 3UP5A 4OPDA 3GRTA 3DH9A 1ZKQA 2GAGB 4BK3A 5KRQA 2JKCA 2YM2A 3AYJA 3CNJA 2EQ9A 3NRNA 1QJDA 2R0PA 4K8DA 3KPFA 5JCIA 1H84A 2R45A 3NYFA 3B6DA 4PAAA 1GERA 3VR8A 4DGKA 1ZY8A 1D4CA 2YR4A 3NLCA 2XVJA 2GR3A 1CJCA 2WEUA 3UKPA 2H88A 1V59A 2YVJA 1E1MA 3BHKA 1GRTA 3ALLA 2HQMA 4YTPA 2X3NA 1K4QA 4D04A 4AOXA 4U8OA 4BV6A 4H4PA 2C3DA 2QA2A 3AEGA 3NT6A 4U8KA 1E1NA 2YWLA 2YQUA 3QVRA 3AD9B 3LJPA 2XLUA 3K7TA 3AE4A 2WOVA 2YM1A 2FJAA 2XLPA 3EF6A 3IC9A 1BF3A 4H4RA 5C2TA 1BWCA 3RNMA 4PABA 5FS9A 2GB0A 1DXLA 1D7LA 1O95A 1Y56A 1REOA 1ONFA 1L9CA 4OVIA 4AP1A 5J7XA 2C7GA 1N1PA 2EQ7A 1KF6A 1ZK7A 3AYLA 2YG3A 2JB1A 4OPLA 1IUXA 5KVHA 1FEBA 2W0HA 5HXIA 1LV0A 2XCGA 4EMJA
chains in the Genus database with same CATH superfamily
3QJ4A 1H82A 3CTYA 4B68A 2QAEA 3QSMA 3CIRA 1EL7A 1EBDA 2BK4A 2XVFA 3SZ0A 3G5RA 2XFNA 1YKJA 5JCMA 4NTDA 1GRFA 2BK3A 5CKUA 1VG0A 3FBSA 4H2NA 3CNPA 3QSEA 4U8LA 3M0OA 4A9WA 1BZLA 4BK2A 1IJHA 1GT8A 5CQFA 2VZ2A 4TM1A 2B9WA 3JSKA 2OALA 2Q6UA 2BA9A 3SX6A 2RGOA 1O5WA 3SXIA 1YQZA 4RG3A 2GMJA 5KOWA 1BKWA 1B5QA 2PYXA 1LQUA 4XWZA 1LJ1A 4U2LA 2ARDA 1ELIA 2C66A 1XPQA 1TDFA 2GR0A 3AEFA 3PO7A 1NDAA 3UKLA 4RG4A 5IPYA 4DNAA 1UKVG 3AB1A 1FECA 1JNZA 3LXDA 1NG3A 1JU2A 4OPGA 5U25A 2XVIA 2B76A 2GV8A 4H4YA 2WHDA 4G9KA 1TYTA 2WP5A 1VQWA 2BS3A 1PXAA 2WS3A 3KU9A 3ITJA 4YTNA 1P2HA 1JRYA 3DJGX 5HY5A 4H2PA 1QLBA 4YTMA 1CL0A 3V3NA 5KMPA 1FOHA 4B66A 4NTCA 4OPTA 1LQTA 4IV9A 4P9SA 1TDOA 3AEEA 2ZZBA 3UTHA 5JCNA 1X31B 2VRMA 1Q1RA 3G5SA 3P4PA 1AOGA 3CMMA 1ZMDA 4KX6A 3C4AA 3KA7A 5KMQA 1BGNA 2YR5A 4YSXA 1GPEA 2FJBA 3CGDA 2VVLA 2YLRA 1GNDA 4X9MA 1GREA 4N9XA 3B3RA 3OC4A 1S3EA 3NYEA 3LZXA 4REKA 3DA1A 5TR3A 1KFYA 3OZ2A 3VRDB 1H83A 2XLTA 2H89A 5U63A 1OJAA 2TMDA 2FBWA 3SYIA 1Z6LA 3UTEA 3SQPA 2VOUA 1DOEA 3T0KA 3UKAA 4WCTA 3EANA 2GF3A 2WETA 4U8MA 5ER0A 3K30A 4Z26A 5IQ1A 2WDQA 4YKFA 3S61A 2VVLG 4HA6A 4OCGA 1D4EA 3AE5A 1PN0A 1Q9IA 1RYIA 1DNCA 3F8PA 5GRTA 1VG9A 3BNUA 5LV9A 1ZX9A 4U8PA 4JY2A 2XVEA 4AT0A 2XFOA 2AAQA 2QA1A 2IVDA 2CDUA 4RSLA 2Z5XA 1HYUA 2XDOA 2YG4A 3AWIA 4H4UA 2WPFA 3ISHA 4H7UA 1W4XA 4TLZA 3CGBA 5IQ4A 2V6OA 3P4SA 4J56A 2I0ZA 3RP7A 2IIDA 3NIXA 3VQRA 3M12A 3AEDA 2A89A 5KXJA 3ATRA 1M6IA 2C64A 2J3NA 4A6NB 1ZDLA 1TDNA 3O0HA 2C67A 1FCDA 4MJWA 3LB8A 4H4QA 5HYMA 2DKIA 4ZCCA 4EIPA 3AE3A 3ATQA 3CN8A 3NGCX 4GCMA 1S2QA 2YG6A 3BNMA 2JK6A 2FJEA 3C4NA 2C75A 3NTDA 4Z24A 1EL5A 4G6HA 5KNLA 3GD4A 2Y6QA 2YAUA 2YVFA 2GVCA 2V60A 1E1KA 1D7YA 1B4VA 3ICTA 5EB5A 4CY8A 4U8JA 2JBVA 3AE2A 1PXCA 2YLXA 3GWFA 3GYXA 4AOSA 1PXBA 2V5ZA 4BJYA 1NPXA 4XXGA 5KOXA 1CF3A 2CULA 4CRTA 1D4DA 4EIQA 3NG7X 2JB3A 3NNEA 4OPIA 3REDA 2CFYA 4GR1A 3T37A 3BI4A 4ZCDA 4JNQA 5M10A 4Y4NA 1TDKA 1TDEA 3GSIA 3COXA 1GRAA 2R0GA 4UDRA 4E0VA 2OLOA 1VDCA 2XFQA 3AYIA 3UP4A 3CPJG 3GDNA 3RP8A 1CC6A 1DOBA 1N4VA 1E1LA 3ABVA 3SM8A 1PJ5A 3PVCA 4CNJA 3ALJA 1L9EA 3K7QX 4GF7A 2BRAA 2A8XA 2WBAA 4H4ZA 5FS7A 2GQFA 1MOKA 4WX1A 5BRTA 3K7MX 1XDIA 3H4KA 4OPCA 4A6NA 1YY5A 2IVEA 3UKKA 3DJDA 3H8LA 3VRAA 1B37A 3UOVA 2GRTA 4CNKA 4Z2UA 1DOCA 1OJDA 2E1MA 3P1WA 4H4WA 1PBCA 4CCQA 4U8NA 3DJJA 1OJCA 2EQ8A 1F8SA 4UDPA 4J36A 2RABA 2XFPA 2X50A 5HHFA 2BCGG 2GMHA 2WQYA 5GSNA 4I59A 1COYA 2R9ZA 3UOYA 4ZN0A 1F8RA 1H6VA 4U2SA 4CCRA 1K0JA 5FS8A 3P4QA 4H4SA 5BVAA 3DJEA 2ZZCA 1GETA 4YT0A 3GDPA 4ECHA 1FEAA 4XWRA 4AP3A 4Z43A 1YQ3A 4YKGA 2BRYA 3I3LA 3SFDA 1GRBA 1DODA 1NHPA 2C3CA 1GALA 2Q7VA 4B64A 4B1BA 4EQSA 3AD7B 3T2KA 4CY6A 4BK1A 1DJNA 2OLNA 3ICSA 3GD3A 4G73A 4Z25A 1MO9A 2FJDA 1GEUA 4J34A 1NENA 2BK5A 3NKSA 1VRQB 4IVOB 1RSGA 3QSSA 2R46A 3LADA 4J33A 5FMHA 1GXFA 2WOWA 3CPHG 5EB4A 4C74A 3LOVA 1K0LA 2V61A 4C77A 1N4WA 2BC1A 3SY4A 3NTAA 2RGHA 1B8SA 3AE7A 4K2XA 4CBQA 2YG7A 3L8KA 3NN0X 2Q0KA 4HB9A 3ICRA 1EL8A 1KSSA 2YLTA 3T2ZA 4EQWA 3AEBA 3KD9A 4IVMB 1GRHA 4A7AA 4ADWA 3E1TA 4C3XA 2Q0LA 3CNTA 2C70A 1KNRA 2R4EA 4J57A 3R9UA 2AQJA 1XHCA 1GTEA 3I6DA 2GH5A 4H2QA 1H81A 4C3YA 1LTXR 2BACA 2GQWA 3CPIG 2A87A 3QFAA 4II3A 3AE6A 1ZMCA 4B69A 1GSNA 1CJ3A 1F8WA 4U2TA 2YR6A 3NHOX 2VQBA 3FPZA 4TM3A 1JEHA 2UZZA 4UP3A 1PS9A 4GDPA 2B9XA 2BCPA 2VVMA 3AE8A 2XLSA 3IF9A 5U1OA 2V3AA 3V3OA 3GYIA 2WDRA 3UTFA 1IUUA 1Q1WA 3ALMA 4APNA 4JNAA 1EL9A 5EBKA 4X4JA 1CBOA 2WU2A 2ACZA 3UKFA 3URHA 1DJQA 1PBFA 3HYXA 4NTEA 4Y4MA 1MXTA 4GUVA 1S2YA 4B63A 4EQXA 2BABA 4M52A 5M0ZA 5FS6A 3RP6A 2ZBWA 3GMBA 3KVEA 1L9DA 4Y4LA 3VR9A 2B9YA 2PHHA 2C72A 2ZZ0A 3GWDA 2BC0A 4I58A 4H2RA 3GYJA 3SFEA 4C5OA 4D03A 1YQ4A 3ZDNA 3DGZA 3DK8A 3NH3X 1PBEA 2BYBA 3C96A 2JAEA 2OAMA 3Q6JA 4A99A 3UKHA 4Z2TA 2GEWA 2BS2A 2X8GA 3EPTA 2XYOA 4IA6A 2X8CA 4FK1A 1KSUA 2DKHA 2WDVA 1CJ2A 2R4JA 3F8DA 1JNRA 2B7SA 4EQRA 4DSGA 3AXBA 2X8HA 4A79A 1E39A 3P9UA 3AE1A 4J2WA 2GR2A 4K5RA 1M64A 1ZOVA 3IHGA 4YSHA 2JB2A 2CVJA 3S5WA 4YXDA 1LPFA 3PS9A 3IHMA 4H4VA 3VRBA 4Z44A 1XANA 1H7XA 2WU5A 3CNDA 2YLZA 4K5SA 2YLWA 1D5TA 1PJ6A 3G5QA 4EM3A 3QVPA 2Y6RA 3BI5A 1TYPA 3UKQA 3UTGA 3D8XA 5EOWA 1CJ4A 2V3BA 3KLJA 2AR8A 4TM4A 3KKJA 3V76A 1JOAA 2GAHB 1OJTA 1IUTA 2WP6A 2E4GA 4X9NA 1E6EA 1KDGA 4NWZA 2RGJA 4FX9A 4BJZA 2GR1A 4YSZA 3QFBA 1GV4A 4B67A 4YSYA 2B7RA 2OA1A 1CC2A 4YWOA 2X99A 2O9ZA 1IUVA 2F5ZA 1BGJA 4H4XA 1NHSA 1PDHA 2WPCA 3AEAA 3NK0X 5L46A 2WP9A 4USRA 4H4TA 5BULA 2C76A 3RHAA 1IUWA 4GDEA 4LU6A 2YG5A 1GESA 3HYWA 1NG4A 4JQ9A 5BUKA 3UCLA 3CGEA 3WE0A 3DK4A 1SEZA 2NVKX 4B65A 3FIMB 4LIIA 5KMSA 3LZWA 1FL2A 4JN9A 1GRGA 3KPKA 1GTHA 1JRZA 3BHFA 4J31A 1CC4A 1H86A 3GRSA 2EQ6A 3ADAB 3F8RA 1NAAA 1ZP0A 2VQ7A 4H50A 3L1RA 1CHUA 1OJ9A 2BS4A 4UDQA 5JCKA 5KVIA 4EM4A 3SZCA 3DK9A 3IWAA 3SGLA 3NYCA 1S3BA 2XFUA 4G6GA 2YVGA 4NZHA 4NEWA 4BURA 1P2EA 5JCLA 1PHHA 3HZLA 2R0CA 3NK1X 3BI2A 4U8IA 2E5VA 3SZWA 3AECA 4KPRA 4JDRA 4ICYA 2Z5YA 2APGA 4GRTA 2C65A 3FMWA 4FK1C 3ZYXA 2XLRA 4OPUA 4NEVA 3D1CA 4AT2A 2TPRA 1QO8A 1E7PA 3EAOA 1H7WA 2XVHA 3CNSA 3AE9A 3P4RA 2BXRA 4G74A 1LVLA 4A65A 4LA1A 4USQA 5C3JA 1F6MA 3M13A 2QCUA 3DGHA 4K7ZA 4A5LA 4EMIA 1KNPA 2WESA 1PJ7A 1L0VA 5KMRA 3DMEA 4TLXA 1F3PA 3II4A 4IA5A 3FG2P 4GAPA 4O5QA 1K0IA 3NK2X 4EMWA 2C73A 1NHRA 1Y0PA 1IUSA 1N4UA 3AD8B 2WPEA 1GOSA 3CGCA 4K22A 3UOZA 4DSHA 1NEKA 4JY3A 5KWFA 4Z2RA 3Q9TA 4FDCB 1Y56B 1ZOYA 2WOIA 1PBBA 3GMCA 3NN6X 5DBJA 2YLSA 1RP0A 3H8IA 1JRXA 2NPXA 1TRBA 3UOXA 5J60A 1O94A 4O5UA 4GAVA 4TM0A 2BXSA 3T2YA 1NHQA 1PBDA 2VRLA 3UP5A 4OPDA 3GRTA 3DH9A 1ZKQA 2GAGB 4BK3A 5KRQA 2JKCA 3T31A 2YM2A 3AYJA 3CNJA 2EQ9A 3NRNA 1QJDA 2R0PA 4K8DA 3KPFA 5JCIA 1H84A 2R45A 3NYFA 3B6DA 4PAAA 1GERA 3VR8A 4DGKA 1ZY8A 1D4CA 2YR4A 3NLCA 2XVJA 2GR3A 1CJCA 2WEUA 3UKPA 2H88A 1V59A 2YVJA 1E1MA 3BHKA 1GRTA 3ALLA 2HQMA 4YTPA 2X3NA 1K4QA 3SZFA 4D04A 4AOXA 4U8OA 4BV6A 2C4CA 4H4PA 4II2A 2C3DA 2QA2A 3AEGA 3NT6A 4NNJA 4U8KA 1E1NA 2YWLA 2YQUA 3QVRA 3AD9B 3LJPA 2XLUA 3K7TA 3AE4A 2WOVA 2YM1A 2FJAA 2XLPA 3EF6A 3IC9A 1BF3A 4H4RA 5C2TA 1BWCA 3RNMA 4PABA 5FS9A 2GB0A 1DXLA 1D7LA 3T14A 1O95A 1Y56A 1REOA 1ONFA 1L9CA 4OVIA 4AP1A 5J7XA 2C7GA 1N1PA 2EQ7A 1KF6A 1ZK7A 3AYLA 2YG3A 2JB1A 4OPLA 1IUXA 5KVHA 1FEBA 2W0HA 3HYVA 5HXIA 1LV0A 2XCGA 4EMJA
chains in the Genus database with same CATH topology
3QJ4A 1H82A 3CTYA 4B68A 2QAEA 3QSMA 3CIRA 1EL7A 1EBDA 2BK4A 2XVFA 3SZ0A 3G5RA 2XFNA 1YKJA 5JCMA 4NTDA 1GRFA 2BK3A 5CKUA 1VG0A 3FBSA 4H2NA 3CNPA 3QSEA 4U8LA 3M0OA 4A9WA 1BZLA 4BK2A 1IJHA 1GT8A 5CQFA 2VZ2A 4TM1A 2B9WA 3JSKA 2OALA 2Q6UA 2BA9A 3SX6A 2RGOA 1O5WA 3SXIA 1YQZA 4RG3A 2GMJA 5KOWA 1BKWA 1B5QA 2PYXA 1LQUA 4XWZA 1LJ1A 4U2LA 2ARDA 1ELIA 2C66A 1XPQA 1TDFA 2GR0A 3AEFA 3PO7A 1NDAA 3UKLA 4RG4A 5IPYA 4DNAA 1UKVG 3AB1A 1FECA 1JNZA 3LXDA 1NG3A 1JU2A 4OPGA 5U25A 2XVIA 2B76A 2GV8A 4H4YA 2WHDA 4G9KA 1TYTA 2WP5A 1VQWA 2BS3A 1PXAA 2WS3A 3KU9A 3ITJA 4YTNA 1P2HA 1JRYA 3DJGX 5HY5A 4H2PA 1QLBA 4YTMA 1CL0A 3V3NA 5KMPA 1FOHA 4B66A 4NTCA 4OPTA 1LQTA 4IV9A 4P9SA 1TDOA 3AEEA 2ZZBA 3UTHA 5JCNA 1X31B 2VRMA 1Q1RA 3G5SA 3P4PA 1AOGA 3CMMA 1ZMDA 4KX6A 3C4AA 3KA7A 5KMQA 1BGNA 2YR5A 4YSXA 1GPEA 2FJBA 3CGDA 2VVLA 2YLRA 1GNDA 4X9MA 1GREA 4N9XA 3B3RA 3OC4A 1S3EA 3NYEA 3LZXA 4REKA 3DA1A 5TR3A 1KFYA 3OZ2A 3VRDB 1H83A 2XLTA 2H89A 5U63A 1OJAA 2TMDA 2FBWA 3SYIA 1Z6LA 3UTEA 3SQPA 2VOUA 1DOEA 3T0KA 3UKAA 4WCTA 3EANA 2GF3A 2WETA 4U8MA 5ER0A 3K30A 4Z26A 5IQ1A 2WDQA 4YKFA 3S61A 2VVLG 4HA6A 4OCGA 1D4EA 3AE5A 1PN0A 1Q9IA 1RYIA 1DNCA 3F8PA 5GRTA 1VG9A 3BNUA 5LV9A 1ZX9A 4U8PA 4JY2A 2XVEA 4AT0A 2XFOA 2AAQA 2QA1A 2IVDA 2CDUA 4RSLA 2Z5XA 1HYUA 2XDOA 2YG4A 3AWIA 4H4UA 2WPFA 3ISHA 4H7UA 1W4XA 4TLZA 3CGBA 5IQ4A 2V6OA 3P4SA 4J56A 2I0ZA 3RP7A 2IIDA 3NIXA 3VQRA 3M12A 3AEDA 2A89A 5KXJA 3ATRA 1M6IA 2C64A 2J3NA 4A6NB 1ZDLA 1TDNA 3O0HA 2C67A 1FCDA 4MJWA 3LB8A 4H4QA 5HYMA 2DKIA 4ZCCA 4EIPA 3AE3A 3ATQA 3CN8A 3NGCX 4GCMA 1S2QA 2YG6A 3BNMA 2JK6A 2FJEA 3C4NA 2C75A 3NTDA 4Z24A 1EL5A 4G6HA 5KNLA 3GD4A 2Y6QA 2YAUA 2YVFA 2GVCA 2V60A 1E1KA 1D7YA 1B4VA 3ICTA 5EB5A 4CY8A 4U8JA 2JBVA 3AE2A 1PXCA 2YLXA 3GWFA 3GYXA 4AOSA 1PXBA 2V5ZA 4BJYA 1NPXA 4XXGA 5KOXA 1CF3A 2CULA 4CRTA 1D4DA 4EIQA 3NG7X 2JB3A 3NNEA 4OPIA 3REDA 2CFYA 4GR1A 3T37A 3BI4A 4ZCDA 4JNQA 5M10A 4Y4NA 1TDKA 1TDEA 3GSIA 3COXA 1GRAA 2R0GA 4UDRA 4E0VA 2OLOA 1VDCA 2XFQA 3AYIA 3UP4A 3CPJG 3GDNA 3RP8A 1CC6A 1DOBA 1N4VA 1E1LA 3ABVA 3SM8A 1PJ5A 3PVCA 4CNJA 3ALJA 1L9EA 3K7QX 4GF7A 2BRAA 2A8XA 2WBAA 4H4ZA 5FS7A 2GQFA 1MOKA 4WX1A 5BRTA 3K7MX 1XDIA 3H4KA 4OPCA 4A6NA 1YY5A 2IVEA 3UKKA 3DJDA 3H8LA 3VRAA 1B37A 3UOVA 2GRTA 4CNKA 4Z2UA 1DOCA 1OJDA 2E1MA 3P1WA 4H4WA 1PBCA 4CCQA 4U8NA 3DJJA 1OJCA 2EQ8A 1F8SA 4UDPA 4J36A 2RABA 2XFPA 2X50A 5HHFA 2BCGG 2GMHA 2WQYA 5GSNA 4I59A 1COYA 2R9ZA 3UOYA 4ZN0A 1F8RA 1H6VA 4U2SA 4CCRA 1K0JA 5FS8A 3P4QA 4H4SA 5BVAA 3DJEA 2ZZCA 1GETA 4YT0A 3GDPA 4ECHA 1FEAA 4XWRA 4AP3A 4Z43A 1YQ3A 4YKGA 2BRYA 3I3LA 3SFDA 1GRBA 1DODA 1NHPA 2C3CA 1GALA 2Q7VA 4B64A 4B1BA 4EQSA 3AD7B 3T2KA 4CY6A 4BK1A 1DJNA 2OLNA 3ICSA 3GD3A 4G73A 4Z25A 1MO9A 2FJDA 1GEUA 4J34A 1NENA 2BK5A 3NKSA 1VRQB 4IVOB 1RSGA 3QSSA 2R46A 3LADA 4J33A 5FMHA 1GXFA 2WOWA 3CPHG 5EB4A 4C74A 3LOVA 1K0LA 2V61A 4C77A 1N4WA 2BC1A 3SY4A 3NTAA 2RGHA 1B8SA 3AE7A 4K2XA 4CBQA 2YG7A 3L8KA 3NN0X 2Q0KA 4HB9A 3ICRA 1EL8A 1KSSA 2YLTA 3T2ZA 4EQWA 3AEBA 3KD9A 4IVMB 1GRHA 4A7AA 4ADWA 3E1TA 4C3XA 2Q0LA 3CNTA 2C70A 1KNRA 2R4EA 4J57A 3R9UA 2AQJA 1XHCA 1GTEA 3I6DA 2GH5A 4H2QA 1H81A 4C3YA 1LTXR 2BACA 2GQWA 3CPIG 2A87A 3QFAA 4II3A 3AE6A 1ZMCA 4B69A 1GSNA 1CJ3A 1F8WA 4U2TA 2YR6A 3NHOX 2VQBA 3FPZA 4TM3A 1JEHA 2UZZA 4UP3A 1PS9A 4GDPA 2B9XA 2BCPA 2VVMA 3AE8A 2XLSA 3IF9A 5U1OA 2V3AA 3V3OA 3GYIA 2WDRA 3UTFA 1IUUA 1Q1WA 3ALMA 4APNA 4JNAA 1EL9A 5EBKA 4X4JA 1CBOA 2WU2A 2ACZA 3UKFA 3URHA 1DJQA 1PBFA 3HYXA 4NTEA 4Y4MA 1MXTA 4GUVA 1S2YA 4B63A 4EQXA 2BABA 4M52A 5M0ZA 5FS6A 3RP6A 2ZBWA 3GMBA 3KVEA 1L9DA 4Y4LA 3VR9A 2B9YA 2PHHA 2C72A 2ZZ0A 3GWDA 2BC0A 4I58A 4H2RA 3GYJA 3SFEA 4C5OA 4D03A 1YQ4A 3ZDNA 3DGZA 3DK8A 3NH3X 1PBEA 2BYBA 3C96A 2JAEA 2OAMA 3Q6JA 4A99A 3UKHA 4Z2TA 2GEWA 2BS2A 2X8GA 3EPTA 2XYOA 4IA6A 2X8CA 4FK1A 1KSUA 2DKHA 2WDVA 1CJ2A 2R4JA 3F8DA 1JNRA 2B7SA 4EQRA 4DSGA 3AXBA 2X8HA 4A79A 1E39A 3P9UA 3AE1A 4J2WA 2GR2A 4K5RA 1M64A 1ZOVA 3IHGA 4YSHA 2JB2A 2CVJA 3S5WA 4YXDA 1LPFA 3PS9A 3IHMA 4H4VA 3VRBA 4Z44A 1XANA 1H7XA 2WU5A 3CNDA 2YLZA 4K5SA 2YLWA 1D5TA 1PJ6A 3G5QA 4EM3A 3QVPA 2Y6RA 3BI5A 1TYPA 3UKQA 3UTGA 3D8XA 5EOWA 1CJ4A 2V3BA 3KLJA 2AR8A 4TM4A 3KKJA 3V76A 1JOAA 2GAHB 1OJTA 1IUTA 2WP6A 2E4GA 4X9NA 1E6EA 1KDGA 4NWZA 2RGJA 4FX9A 4BJZA 2GR1A 4YSZA 3QFBA 1GV4A 4B67A 4YSYA 2B7RA 2OA1A 1CC2A 4YWOA 2X99A 2O9ZA 1IUVA 2F5ZA 1BGJA 4H4XA 1NHSA 1PDHA 2WPCA 3AEAA 3NK0X 5L46A 2WP9A 4USRA 4H4TA 5BULA 2C76A 3RHAA 1IUWA 4GDEA 4LU6A 2YG5A 1GESA 3HYWA 1NG4A 4JQ9A 5BUKA 3UCLA 3CGEA 3WE0A 3DK4A 1SEZA 2NVKX 4B65A 3FIMB 4LIIA 5KMSA 3LZWA 1FL2A 4JN9A 1GRGA 3KPKA 1GTHA 1JRZA 3BHFA 4J31A 1CC4A 1H86A 3GRSA 2EQ6A 3ADAB 3F8RA 1NAAA 1ZP0A 2VQ7A 4H50A 3L1RA 1CHUA 1OJ9A 2BS4A 4UDQA 5JCKA 5KVIA 4EM4A 3SZCA 3DK9A 3IWAA 3SGLA 3NYCA 1S3BA 2XFUA 4G6GA 2YVGA 4NZHA 4NEWA 4BURA 1P2EA 5JCLA 1PHHA 3HZLA 2R0CA 3NK1X 3BI2A 4U8IA 2E5VA 3SZWA 3AECA 4KPRA 4JDRA 4ICYA 2Z5YA 2APGA 4GRTA 2C65A 3FMWA 4FK1C 3ZYXA 2XLRA 4OPUA 4NEVA 3D1CA 4AT2A 2TPRA 1QO8A 1E7PA 3EAOA 1H7WA 2XVHA 3CNSA 3AE9A 3P4RA 2BXRA 4G74A 1LVLA 4A65A 4LA1A 4USQA 5C3JA 1F6MA 3M13A 2QCUA 3DGHA 4K7ZA 4A5LA 4EMIA 1KNPA 2WESA 1PJ7A 1L0VA 5KMRA 3DMEA 4TLXA 1F3PA 3II4A 4IA5A 3FG2P 4GAPA 4O5QA 1K0IA 3NK2X 4EMWA 2C73A 1NHRA 1Y0PA 1IUSA 1N4UA 3AD8B 2WPEA 1GOSA 3CGCA 4K22A 3UOZA 4DSHA 1NEKA 4JY3A 5KWFA 4Z2RA 3Q9TA 4FDCB 1Y56B 1ZOYA 2WOIA 1PBBA 3GMCA 3NN6X 5DBJA 2YLSA 1RP0A 3H8IA 1JRXA 2NPXA 1TRBA 3UOXA 5J60A 1O94A 4O5UA 4GAVA 4TM0A 2BXSA 3T2YA 1NHQA 1PBDA 2VRLA 3UP5A 4OPDA 3GRTA 3DH9A 1ZKQA 2GAGB 4BK3A 5KRQA 2JKCA 3T31A 2YM2A 3AYJA 3CNJA 2EQ9A 3NRNA 1QJDA 2R0PA 4K8DA 3KPFA 5JCIA 1H84A 2R45A 3NYFA 3B6DA 4PAAA 1GERA 3VR8A 4DGKA 1ZY8A 1D4CA 2YR4A 3NLCA 2XVJA 2GR3A 1CJCA 2WEUA 3UKPA 2H88A 1V59A 2YVJA 1E1MA 3BHKA 1GRTA 3ALLA 2HQMA 4YTPA 2X3NA 1K4QA 3SZFA 4D04A 4AOXA 4U8OA 4BV6A 2C4CA 4H4PA 4II2A 2C3DA 2QA2A 3AEGA 3NT6A 4NNJA 4U8KA 1E1NA 2YWLA 2YQUA 3QVRA 3AD9B 3LJPA 2XLUA 3K7TA 3AE4A 2WOVA 2YM1A 2FJAA 2XLPA 3EF6A 3IC9A 1BF3A 4H4RA 5C2TA 1BWCA 3RNMA 4PABA 5FS9A 2GB0A 1DXLA 1D7LA 3T14A 1O95A 1Y56A 1REOA 1ONFA 1L9CA 4OVIA 4AP1A 5J7XA 2C7GA 1N1PA 2EQ7A 1KF6A 1ZK7A 3AYLA 2YG3A 2JB1A 4OPLA 1IUXA 5KVHA 1FEBA 2W0HA 3HYVA 5HXIA 1LV0A 2XCGA 4EMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QJ4 A;  1H82 A;  3CTY A;  4B68 A;  2QAE A;  3QSM A;  3CIR A;  1EL7 A;  1EBD A;  2BK4 A;  2XVF A;  3G5R A;  2XFN A;  1YKJ A;  5JCM A;  4NTD A;  1GRF A;  2BK3 A;  5CKU A;  1VG0 A;  3FBS A;  4H2N A;  3CNP A;  3QSE A;  4U8L A;  3M0O A;  4A9W A;  1BZL A;  4BK2 A;  1IJH A;  1GT8 A;  5CQF A;  2VZ2 A;  4TM1 A;  2B9W A;  3JSK A;  2OAL A;  2Q6U A;  2BA9 A;  2RGO A;  1O5W A;  1YQZ A;  4RG3 A;  2GMJ A;  5KOW A;  1BKW A;  1B5Q A;  2PYX A;  1LQU A;  4XWZ A;  1LJ1 A;  4U2L A;  2ARD A;  1ELI A;  2C66 A;  1XPQ A;  1TDF A;  2GR0 A;  3AEF A;  3PO7 A;  1NDA A;  3UKL A;  4RG4 A;  5IPY A;  4DNA A;  1UKV G;  3AB1 A;  1FEC A;  1JNZ A;  3LXD A;  1NG3 A;  1JU2 A;  4OPG A;  5U25 A;  2XVI A;  2B76 A;  2GV8 A;  4H4Y A;  2WHD A;  1TYT A;  2WP5 A;  1VQW A;  2BS3 A;  1PXA A;  2WS3 A;  3KU9 A;  3ITJ A;  4YTN A;  1P2H A;  1JRY A;  3DJG X;  5HY5 A;  4H2P A;  1QLB A;  4YTM A;  1CL0 A;  3V3N A;  1FOH A;  4B66 A;  4NTC A;  4OPT A;  1LQT A;  4IV9 A;  4P9S A;  1TDO A;  3AEE A;  2ZZB A;  3UTH A;  5JCN A;  1X31 B;  2VRM A;  1Q1R A;  3G5S A;  3P4P A;  1AOG A;  1ZMD A;  4KX6 A;  3C4A A;  3KA7 A;  1BGN A;  2YR5 A;  4YSX A;  1GPE A;  2FJB A;  3CGD A;  2VVL A;  2YLR A;  1GND A;  4X9M A;  1GRE A;  4N9X A;  3B3R A;  3OC4 A;  1S3E A;  3NYE A;  3LZX A;  4REK A;  3DA1 A;  5TR3 A;  1KFY A;  3OZ2 A;  3VRD B;  1H83 A;  2XLT A;  2H89 A;  5U63 A;  1OJA A;  2TMD A;  2FBW A;  1Z6L A;  3UTE A;  3SQP A;  2VOU A;  1DOE A;  3UKA A;  4WCT A;  3EAN A;  2GF3 A;  2WET A;  4U8M A;  5ER0 A;  3K30 A;  4Z26 A;  5IQ1 A;  2WDQ A;  4YKF A;  3S61 A;  2VVL G;  4HA6 A;  4OCG A;  1D4E A;  3AE5 A;  1PN0 A;  1Q9I A;  1RYI A;  1DNC A;  3F8P A;  5GRT A;  1VG9 A;  3BNU A;  5LV9 A;  1ZX9 A;  4U8P A;  4JY2 A;  2XVE A;  4AT0 A;  2XFO A;  2AAQ A;  2QA1 A;  2IVD A;  2CDU A;  4RSL A;  2Z5X A;  1HYU A;  2XDO A;  2YG4 A;  3AWI A;  4H4U A;  2WPF A;  3ISH A;  4H7U A;  1W4X A;  4TLZ A;  3CGB A;  5IQ4 A;  2V6O A;  3P4S A;  4J56 A;  2I0Z A;  3RP7 A;  2IID A;  3NIX A;  3VQR A;  3M12 A;  3AED A;  2A89 A;  5KXJ A;  3ATR A;  1M6I A;  2C64 A;  2J3N A;  4A6N B;  1ZDL A;  1TDN A;  3O0H A;  2C67 A;  1FCD A;  4MJW A;  3LB8 A;  4H4Q A;  5HYM A;  2DKI A;  4ZCC A;  4EIP A;  3AE3 A;  3ATQ A;  3CN8 A;  3NGC X;  4GCM A;  1S2Q A;  2YG6 A;  3BNM A;  2JK6 A;  2FJE A;  3C4N A;  2C75 A;  3NTD A;  4Z24 A;  1EL5 A;  3GD4 A;  2Y6Q A;  2YAU A;  2YVF A;  2GVC A;  2V60 A;  1E1K A;  1D7Y A;  1B4V A;  3ICT A;  5EB5 A;  4CY8 A;  4U8J A;  2JBV A;  3AE2 A;  1PXC A;  2YLX A;  3GWF A;  4AOS A;  1PXB A;  2V5Z A;  4BJY A;  1NPX A;  4XXG A;  5KOX A;  1CF3 A;  2CUL A;  4CRT A;  1D4D A;  4EIQ A;  3NG7 X;  2JB3 A;  3NNE A;  4OPI A;  3RED A;  2CFY A;  4GR1 A;  3T37 A;  3BI4 A;  4ZCD A;  4JNQ A;  5M10 A;  4Y4N A;  1TDK A;  1TDE A;  3GSI A;  3COX A;  1GRA A;  2R0G A;  4UDR A;  4E0V A;  2OLO A;  1VDC A;  2XFQ A;  3AYI A;  3UP4 A;  3CPJ G;  3GDN A;  3RP8 A;  1CC6 A;  1DOB A;  1N4V A;  1E1L A;  3ABV A;  3SM8 A;  1PJ5 A;  3PVC A;  4CNJ A;  3ALJ A;  1L9E A;  3K7Q X;  4GF7 A;  4H4Z A;  2A8X A;  2WBA A;  5FS7 A;  2GQF A;  1MOK A;  4WX1 A;  5BRT A;  3K7M X;  1XDI A;  3H4K A;  4OPC A;  4A6N A;  1YY5 A;  2IVE A;  3UKK A;  3DJD A;  3H8L A;  3VRA A;  1B37 A;  3UOV A;  2GRT A;  4CNK A;  4Z2U A;  1DOC A;  1OJD A;  2E1M A;  3P1W A;  4H4W A;  1PBC A;  4CCQ A;  4U8N A;  3DJJ A;  1OJC A;  2EQ8 A;  1F8S A;  4UDP A;  4J36 A;  2RAB A;  2XFP A;  2X50 A;  5HHF A;  2BCG G;  2GMH A;  2WQY A;  5GSN A;  4I59 A;  1COY A;  2R9Z A;  3UOY A;  4ZN0 A;  1F8R A;  1H6V A;  4U2S A;  4CCR A;  1K0J A;  5FS8 A;  3P4Q A;  4H4S A;  5BVA A;  3DJE A;  2ZZC A;  1GET A;  4YT0 A;  3GDP A;  4ECH A;  1FEA A;  4XWR A;  4AP3 A;  4Z43 A;  1YQ3 A;  4YKG A;  3I3L A;  3SFD A;  1GRB A;  1DOD A;  1NHP A;  2C3C A;  1GAL A;  2Q7V A;  4B64 A;  4B1B A;  4EQS A;  3AD7 B;  4CY6 A;  4BK1 A;  1DJN A;  2OLN A;  3ICS A;  3GD3 A;  4Z25 A;  1MO9 A;  2FJD A;  1GEU A;  4J34 A;  1NEN A;  2BK5 A;  3NKS A;  1VRQ B;  4IVO B;  1RSG A;  3QSS A;  2R46 A;  3LAD A;  4J33 A;  5FMH A;  1GXF A;  2WOW A;  3CPH G;  5EB4 A;  4C74 A;  3LOV A;  1K0L A;  2V61 A;  4C77 A;  1N4W A;  2BC1 A;  3NTA A;  2RGH A;  1B8S A;  3AE7 A;  4K2X A;  4CBQ A;  2YG7 A;  3L8K A;  3NN0 X;  2Q0K A;  4HB9 A;  3ICR A;  1EL8 A;  1KSS A;  2YLT A;  4EQW A;  3AEB A;  3KD9 A;  4IVM B;  1GRH A;  4A7A A;  4ADW A;  3E1T A;  4C3X A;  2Q0L A;  3CNT A;  2C70 A;  1KNR A;  2R4E A;  4J57 A;  3R9U A;  2AQJ A;  1XHC A;  1GTE A;  3I6D A;  2GH5 A;  4H2Q A;  1H81 A;  4C3Y A;  1LTX R;  2BAC A;  2GQW A;  3CPI G;  2A87 A;  3QFA A;  3AE6 A;  1ZMC A;  4B69 A;  1GSN A;  1CJ3 A;  1F8W A;  4U2T A;  2YR6 A;  3NHO X;  2VQB A;  3FPZ A;  4TM3 A;  1JEH A;  2UZZ A;  4UP3 A;  1PS9 A;  4GDP A;  2B9X A;  2BCP A;  2VVM A;  3AE8 A;  2XLS A;  3IF9 A;  5U1O A;  2V3A A;  3V3O A;  3GYI A;  2WDR A;  3UTF A;  1IUU A;  1Q1W A;  3ALM A;  4APN A;  4JNA A;  1EL9 A;  5EBK A;  4X4J A;  1CBO A;  2WU2 A;  2ACZ A;  3UKF A;  3URH A;  1DJQ A;  1PBF A;  4NTE A;  4Y4M A;  1MXT A;  4GUV A;  1S2Y A;  4B63 A;  4EQX A;  2BAB A;  4M52 A;  5M0Z A;  5FS6 A;  3RP6 A;  2ZBW A;  3GMB A;  3KVE A;  1L9D A;  4Y4L A;  3VR9 A;  2B9Y A;  2PHH A;  2C72 A;  2ZZ0 A;  3GWD A;  2BC0 A;  4I58 A;  4H2R A;  3GYJ A;  3SFE A;  4C5O A;  4D03 A;  1YQ4 A;  3ZDN A;  3DGZ A;  3DK8 A;  3NH3 X;  1PBE A;  2BYB A;  3C96 A;  2JAE A;  2OAM A;  3Q6J A;  4A99 A;  3UKH A;  4Z2T A;  2GEW A;  2BS2 A;  2X8G A;  3EPT A;  2XYO A;  4IA6 A;  2X8C A;  4FK1 A;  1KSU A;  2DKH A;  2WDV A;  1CJ2 A;  2R4J A;  3F8D A;  1JNR A;  2B7S A;  4EQR A;  4DSG A;  3AXB A;  2X8H A;  4A79 A;  1E39 A;  3P9U A;  3AE1 A;  4J2W A;  2GR2 A;  4K5R A;  1M64 A;  1ZOV A;  3IHG A;  4YSH A;  2JB2 A;  2CVJ A;  3S5W A;  4YXD A;  1LPF A;  3PS9 A;  3IHM A;  4H4V A;  3VRB A;  4Z44 A;  1XAN A;  1H7X A;  2WU5 A;  3CND A;  2YLZ A;  4K5S A;  2YLW A;  1D5T A;  1PJ6 A;  3G5Q A;  4EM3 A;  3QVP A;  2Y6R A;  3BI5 A;  1TYP A;  3UKQ A;  3UTG A;  3D8X A;  5EOW A;  1CJ4 A;  2V3B A;  3KLJ A;  2AR8 A;  4TM4 A;  3KKJ A;  3V76 A;  1JOA A;  2GAH B;  1OJT A;  1IUT A;  2WP6 A;  2E4G A;  4X9N A;  1E6E A;  1KDG A;  2RGJ A;  4FX9 A;  4BJZ A;  2GR1 A;  4YSZ A;  3QFB A;  1GV4 A;  4B67 A;  4YSY A;  2B7R A;  2OA1 A;  1CC2 A;  4YWO A;  2X99 A;  2O9Z A;  1IUV A;  2F5Z A;  1BGJ A;  4H4X A;  1NHS A;  1PDH A;  2WPC A;  3AEA A;  3NK0 X;  5L46 A;  2WP9 A;  4USR A;  4H4T A;  5BUL A;  2C76 A;  3RHA A;  1IUW A;  4GDE A;  4LU6 A;  2YG5 A;  1GES A;  1NG4 A;  4JQ9 A;  5BUK A;  3UCL A;  3CGE A;  3WE0 A;  3DK4 A;  1SEZ A;  2NVK X;  4B65 A;  3FIM B;  4LII A;  3LZW A;  1FL2 A;  4JN9 A;  1GRG A;  1GTH A;  1JRZ A;  3BHF A;  4J31 A;  1CC4 A;  1H86 A;  3GRS A;  2EQ6 A;  3ADA B;  3F8R A;  1NAA A;  1ZP0 A;  2VQ7 A;  4H50 A;  3L1R A;  1CHU A;  1OJ9 A;  2BS4 A;  4UDQ A;  5JCK A;  5KVI A;  4EM4 A;  3DK9 A;  3IWA A;  3SGL A;  3NYC A;  1S3B A;  2XFU A;  2YVG A;  4NZH A;  4NEW A;  4BUR A;  1P2E A;  5JCL A;  1PHH A;  3HZL A;  2R0C A;  3NK1 X;  3BI2 A;  4U8I A;  2E5V A;  3AEC A;  4KPR A;  4JDR A;  4ICY A;  2Z5Y A;  2APG A;  4GRT A;  2C65 A;  3FMW A;  4FK1 C;  3ZYX A;  2XLR A;  4OPU A;  4NEV A;  3D1C A;  4AT2 A;  2TPR A;  1QO8 A;  1E7P A;  3EAO A;  1H7W A;  2XVH A;  3CNS A;  3AE9 A;  3P4R A;  2BXR A;  1LVL A;  4A65 A;  4LA1 A;  4USQ A;  5C3J A;  1F6M A;  3M13 A;  2QCU A;  3DGH A;  4K7Z A;  4A5L A;  4EMI A;  1KNP A;  2WES A;  1PJ7 A;  1L0V A;  3DME A;  4TLX A;  1F3P A;  3II4 A;  4IA5 A;  3FG2 P;  4O5Q A;  4EMW A;  1K0I A;  3NK2 X;  2C73 A;  1NHR A;  1Y0P A;  1IUS A;  1N4U A;  3AD8 B;  2WPE A;  1GOS A;  3CGC A;  4K22 A;  3UOZ A;  4DSH A;  1NEK A;  4JY3 A;  5KWF A;  4Z2R A;  3Q9T A;  4FDC B;  1Y56 B;  1ZOY A;  2WOI A;  1PBB A;  3GMC A;  3NN6 X;  5DBJ A;  2YLS A;  1RP0 A;  3H8I A;  1JRX A;  2NPX A;  1TRB A;  3UOX A;  5J60 A;  1O94 A;  4O5U A;  4TM0 A;  2BXS A;  1NHQ A;  1PBD A;  2VRL A;  3UP5 A;  4OPD A;  3GRT A;  3DH9 A;  1ZKQ A;  2GAG B;  4BK3 A;  5KRQ A;  2JKC A;  2YM2 A;  3AYJ A;  3CNJ A;  2EQ9 A;  3NRN A;  1QJD A;  2R0P A;  4K8D A;  3KPF A;  5JCI A;  1H84 A;  2R45 A;  3NYF A;  3B6D A;  4PAA A;  1GER A;  3VR8 A;  4DGK A;  1ZY8 A;  1D4C A;  2YR4 A;  3NLC A;  2XVJ A;  2GR3 A;  1CJC A;  2WEU A;  3UKP A;  2H88 A;  1V59 A;  2YVJ A;  1E1M A;  3BHK A;  1GRT A;  3ALL A;  2HQM A;  4YTP A;  2X3N A;  1K4Q A;  4D04 A;  4AOX A;  4U8O A;  4BV6 A;  4H4P A;  2C3D A;  2QA2 A;  3AEG A;  3NT6 A;  4U8K A;  1E1N A;  2YWL A;  2YQU A;  3QVR A;  3AD9 B;  3LJP A;  2XLU A;  3K7T A;  3AE4 A;  2WOV A;  2YM1 A;  2FJA A;  2XLP A;  3EF6 A;  3IC9 A;  1BF3 A;  4H4R A;  5C2T A;  1BWC A;  3RNM A;  4PAB A;  5FS9 A;  2GB0 A;  1DXL A;  1D7L A;  1O95 A;  1Y56 A;  1REO A;  1ONF A;  1L9C A;  4OVI A;  4AP1 A;  5J7X A;  2C7G A;  1N1P A;  2EQ7 A;  1KF6 A;  1ZK7 A;  3AYL A;  2YG3 A;  2JB1 A;  4OPL A;  1IUX A;  5KVH A;  1FEB A;  2W0H A;  5HXI A;  1LV0 A;  2XCG A;  4EMJ A; 
#chains in the Genus database with same CATH topology
 3QJ4 A;  1H82 A;  3CTY A;  4B68 A;  2QAE A;  3QSM A;  3CIR A;  1EL7 A;  1EBD A;  2BK4 A;  2XVF A;  3SZ0 A;  3G5R A;  2XFN A;  1YKJ A;  5JCM A;  4NTD A;  1GRF A;  2BK3 A;  5CKU A;  1VG0 A;  3FBS A;  4H2N A;  3CNP A;  3QSE A;  4U8L A;  3M0O A;  4A9W A;  1BZL A;  4BK2 A;  1IJH A;  1GT8 A;  5CQF A;  2VZ2 A;  4TM1 A;  2B9W A;  3JSK A;  2OAL A;  2Q6U A;  2BA9 A;  3SX6 A;  2RGO A;  1O5W A;  3SXI A;  1YQZ A;  4RG3 A;  2GMJ A;  5KOW A;  1BKW A;  1B5Q A;  2PYX A;  1LQU A;  4XWZ A;  1LJ1 A;  4U2L A;  2ARD A;  1ELI A;  2C66 A;  1XPQ A;  1TDF A;  2GR0 A;  3AEF A;  3PO7 A;  1NDA A;  3UKL A;  4RG4 A;  5IPY A;  4DNA A;  1UKV G;  3AB1 A;  1FEC A;  1JNZ A;  3LXD A;  1NG3 A;  1JU2 A;  4OPG A;  5U25 A;  2XVI A;  2B76 A;  2GV8 A;  4H4Y A;  2WHD A;  4G9K A;  1TYT A;  2WP5 A;  1VQW A;  2BS3 A;  1PXA A;  2WS3 A;  3KU9 A;  3ITJ A;  4YTN A;  1P2H A;  1JRY A;  3DJG X;  5HY5 A;  4H2P A;  1QLB A;  4YTM A;  1CL0 A;  3V3N A;  5KMP A;  1FOH A;  4B66 A;  4NTC A;  4OPT A;  1LQT A;  4IV9 A;  4P9S A;  1TDO A;  3AEE A;  2ZZB A;  3UTH A;  5JCN A;  1X31 B;  2VRM A;  1Q1R A;  3G5S A;  3P4P A;  1AOG A;  3CMM A;  1ZMD A;  4KX6 A;  3C4A A;  3KA7 A;  5KMQ A;  1BGN A;  2YR5 A;  4YSX A;  1GPE A;  2FJB A;  3CGD A;  2VVL A;  2YLR A;  1GND A;  4X9M A;  1GRE A;  4N9X A;  3B3R A;  3OC4 A;  1S3E A;  3NYE A;  3LZX A;  4REK A;  3DA1 A;  5TR3 A;  1KFY A;  3OZ2 A;  3VRD B;  1H83 A;  2XLT A;  2H89 A;  5U63 A;  1OJA A;  2TMD A;  2FBW A;  3SYI A;  1Z6L A;  3UTE A;  3SQP A;  2VOU A;  1DOE A;  3T0K A;  3UKA A;  4WCT A;  3EAN A;  2GF3 A;  2WET A;  4U8M A;  5ER0 A;  3K30 A;  4Z26 A;  5IQ1 A;  2WDQ A;  4YKF A;  3S61 A;  2VVL G;  4HA6 A;  4OCG A;  1D4E A;  3AE5 A;  1PN0 A;  1Q9I A;  1RYI A;  1DNC A;  3F8P A;  5GRT A;  1VG9 A;  3BNU A;  5LV9 A;  1ZX9 A;  4U8P A;  4JY2 A;  2XVE A;  4AT0 A;  2XFO A;  2AAQ A;  2QA1 A;  2IVD A;  2CDU A;  4RSL A;  2Z5X A;  1HYU A;  2XDO A;  2YG4 A;  3AWI A;  4H4U A;  2WPF A;  3ISH A;  4H7U A;  1W4X A;  4TLZ A;  3CGB A;  5IQ4 A;  2V6O A;  3P4S A;  4J56 A;  2I0Z A;  3RP7 A;  2IID A;  3NIX A;  3VQR A;  3M12 A;  3AED A;  2A89 A;  5KXJ A;  3ATR A;  1M6I A;  2C64 A;  2J3N A;  4A6N B;  1ZDL A;  1TDN A;  3O0H A;  2C67 A;  1FCD A;  4MJW A;  3LB8 A;  4H4Q A;  5HYM A;  2DKI A;  4ZCC A;  4EIP A;  3AE3 A;  3ATQ A;  3CN8 A;  3NGC X;  4GCM A;  1S2Q A;  2YG6 A;  3BNM A;  2JK6 A;  2FJE A;  3C4N A;  2C75 A;  3NTD A;  4Z24 A;  1EL5 A;  4G6H A;  5KNL A;  3GD4 A;  2Y6Q A;  2YAU A;  2YVF A;  2GVC A;  2V60 A;  1E1K A;  1D7Y A;  1B4V A;  3ICT A;  5EB5 A;  4CY8 A;  4U8J A;  2JBV A;  3AE2 A;  1PXC A;  2YLX A;  3GWF A;  3GYX A;  4AOS A;  1PXB A;  2V5Z A;  4BJY A;  1NPX A;  4XXG A;  5KOX A;  1CF3 A;  2CUL A;  4CRT A;  1D4D A;  4EIQ A;  3NG7 X;  2JB3 A;  3NNE A;  4OPI A;  3RED A;  2CFY A;  4GR1 A;  3T37 A;  3BI4 A;  4ZCD A;  4JNQ A;  5M10 A;  4Y4N A;  1TDK A;  1TDE A;  3GSI A;  3COX A;  1GRA A;  2R0G A;  4UDR A;  4E0V A;  2OLO A;  1VDC A;  2XFQ A;  3AYI A;  3UP4 A;  3CPJ G;  3GDN A;  3RP8 A;  1CC6 A;  1DOB A;  1N4V A;  1E1L A;  3ABV A;  3SM8 A;  1PJ5 A;  3PVC A;  4CNJ A;  3ALJ A;  1L9E A;  3K7Q X;  4GF7 A;  2BRA A;  2A8X A;  2WBA A;  4H4Z A;  5FS7 A;  2GQF A;  1MOK A;  4WX1 A;  5BRT A;  3K7M X;  1XDI A;  3H4K A;  4OPC A;  4A6N A;  1YY5 A;  2IVE A;  3UKK A;  3DJD A;  3H8L A;  3VRA A;  1B37 A;  3UOV A;  2GRT A;  4CNK A;  4Z2U A;  1DOC A;  1OJD A;  2E1M A;  3P1W A;  4H4W A;  1PBC A;  4CCQ A;  4U8N A;  3DJJ A;  1OJC A;  2EQ8 A;  1F8S A;  4UDP A;  4J36 A;  2RAB A;  2XFP A;  2X50 A;  5HHF A;  2BCG G;  2GMH A;  2WQY A;  5GSN A;  4I59 A;  1COY A;  2R9Z A;  3UOY A;  4ZN0 A;  1F8R A;  1H6V A;  4U2S A;  4CCR A;  1K0J A;  5FS8 A;  3P4Q A;  4H4S A;  5BVA A;  3DJE A;  2ZZC A;  1GET A;  4YT0 A;  3GDP A;  4ECH A;  1FEA A;  4XWR A;  4AP3 A;  4Z43 A;  1YQ3 A;  4YKG A;  2BRY A;  3I3L A;  3SFD A;  1GRB A;  1DOD A;  1NHP A;  2C3C A;  1GAL A;  2Q7V A;  4B64 A;  4B1B A;  4EQS A;  3AD7 B;  3T2K A;  4CY6 A;  4BK1 A;  1DJN A;  2OLN A;  3ICS A;  3GD3 A;  4G73 A;  4Z25 A;  1MO9 A;  2FJD A;  1GEU A;  4J34 A;  1NEN A;  2BK5 A;  3NKS A;  1VRQ B;  4IVO B;  1RSG A;  3QSS A;  2R46 A;  3LAD A;  4J33 A;  5FMH A;  1GXF A;  2WOW A;  3CPH G;  5EB4 A;  4C74 A;  3LOV A;  1K0L A;  2V61 A;  4C77 A;  1N4W A;  2BC1 A;  3SY4 A;  3NTA A;  2RGH A;  1B8S A;  3AE7 A;  4K2X A;  4CBQ A;  2YG7 A;  3L8K A;  3NN0 X;  2Q0K A;  4HB9 A;  3ICR A;  1EL8 A;  1KSS A;  2YLT A;  3T2Z A;  4EQW A;  3AEB A;  3KD9 A;  4IVM B;  1GRH A;  4A7A A;  4ADW A;  3E1T A;  4C3X A;  2Q0L A;  3CNT A;  2C70 A;  1KNR A;  2R4E A;  4J57 A;  3R9U A;  2AQJ A;  1XHC A;  1GTE A;  3I6D A;  2GH5 A;  4H2Q A;  1H81 A;  4C3Y A;  1LTX R;  2BAC A;  2GQW A;  3CPI G;  2A87 A;  3QFA A;  4II3 A;  3AE6 A;  1ZMC A;  4B69 A;  1GSN A;  1CJ3 A;  1F8W A;  4U2T A;  2YR6 A;  3NHO X;  2VQB A;  3FPZ A;  4TM3 A;  1JEH A;  2UZZ A;  4UP3 A;  1PS9 A;  4GDP A;  2B9X A;  2BCP A;  2VVM A;  3AE8 A;  2XLS A;  3IF9 A;  5U1O A;  2V3A A;  3V3O A;  3GYI A;  2WDR A;  3UTF A;  1IUU A;  1Q1W A;  3ALM A;  4APN A;  4JNA A;  1EL9 A;  5EBK A;  4X4J A;  1CBO A;  2WU2 A;  2ACZ A;  3UKF A;  3URH A;  1DJQ A;  1PBF A;  3HYX A;  4NTE A;  4Y4M A;  1MXT A;  4GUV A;  1S2Y A;  4B63 A;  4EQX A;  2BAB A;  4M52 A;  5M0Z A;  5FS6 A;  3RP6 A;  2ZBW A;  3GMB A;  3KVE A;  1L9D A;  4Y4L A;  3VR9 A;  2B9Y A;  2PHH A;  2C72 A;  2ZZ0 A;  3GWD A;  2BC0 A;  4I58 A;  4H2R A;  3GYJ A;  3SFE A;  4C5O A;  4D03 A;  1YQ4 A;  3ZDN A;  3DGZ A;  3DK8 A;  3NH3 X;  1PBE A;  2BYB A;  3C96 A;  2JAE A;  2OAM A;  3Q6J A;  4A99 A;  3UKH A;  4Z2T A;  2GEW A;  2BS2 A;  2X8G A;  3EPT A;  2XYO A;  4IA6 A;  2X8C A;  4FK1 A;  1KSU A;  2DKH A;  2WDV A;  1CJ2 A;  2R4J A;  3F8D A;  1JNR A;  2B7S A;  4EQR A;  4DSG A;  3AXB A;  2X8H A;  4A79 A;  1E39 A;  3P9U A;  3AE1 A;  4J2W A;  2GR2 A;  4K5R A;  1M64 A;  1ZOV A;  3IHG A;  4YSH A;  2JB2 A;  2CVJ A;  3S5W A;  4YXD A;  1LPF A;  3PS9 A;  3IHM A;  4H4V A;  3VRB A;  4Z44 A;  1XAN A;  1H7X A;  2WU5 A;  3CND A;  2YLZ A;  4K5S A;  2YLW A;  1D5T A;  1PJ6 A;  3G5Q A;  4EM3 A;  3QVP A;  2Y6R A;  3BI5 A;  1TYP A;  3UKQ A;  3UTG A;  3D8X A;  5EOW A;  1CJ4 A;  2V3B A;  3KLJ A;  2AR8 A;  4TM4 A;  3KKJ A;  3V76 A;  1JOA A;  2GAH B;  1OJT A;  1IUT A;  2WP6 A;  2E4G A;  4X9N A;  1E6E A;  1KDG A;  4NWZ A;  2RGJ A;  4FX9 A;  4BJZ A;  2GR1 A;  4YSZ A;  3QFB A;  1GV4 A;  4B67 A;  4YSY A;  2B7R A;  2OA1 A;  1CC2 A;  4YWO A;  2X99 A;  2O9Z A;  1IUV A;  2F5Z A;  1BGJ A;  4H4X A;  1NHS A;  1PDH A;  2WPC A;  3AEA A;  3NK0 X;  5L46 A;  2WP9 A;  4USR A;  4H4T A;  5BUL A;  2C76 A;  3RHA A;  1IUW A;  4GDE A;  4LU6 A;  2YG5 A;  1GES A;  3HYW A;  1NG4 A;  4JQ9 A;  5BUK A;  3UCL A;  3CGE A;  3WE0 A;  3DK4 A;  1SEZ A;  2NVK X;  4B65 A;  3FIM B;  4LII A;  5KMS A;  3LZW A;  1FL2 A;  4JN9 A;  1GRG A;  3KPK A;  1GTH A;  1JRZ A;  3BHF A;  4J31 A;  1CC4 A;  1H86 A;  3GRS A;  2EQ6 A;  3ADA B;  3F8R A;  1NAA A;  1ZP0 A;  2VQ7 A;  4H50 A;  3L1R A;  1CHU A;  1OJ9 A;  2BS4 A;  4UDQ A;  5JCK A;  5KVI A;  4EM4 A;  3SZC A;  3DK9 A;  3IWA A;  3SGL A;  3NYC A;  1S3B A;  2XFU A;  4G6G A;  2YVG A;  4NZH A;  4NEW A;  4BUR A;  1P2E A;  5JCL A;  1PHH A;  3HZL A;  2R0C A;  3NK1 X;  3BI2 A;  4U8I A;  2E5V A;  3SZW A;  3AEC A;  4KPR A;  4JDR A;  4ICY A;  2Z5Y A;  2APG A;  4GRT A;  2C65 A;  3FMW A;  4FK1 C;  3ZYX A;  2XLR A;  4OPU A;  4NEV A;  3D1C A;  4AT2 A;  2TPR A;  1QO8 A;  1E7P A;  3EAO A;  1H7W A;  2XVH A;  3CNS A;  3AE9 A;  3P4R A;  2BXR A;  4G74 A;  1LVL A;  4A65 A;  4LA1 A;  4USQ A;  5C3J A;  1F6M A;  3M13 A;  2QCU A;  3DGH A;  4K7Z A;  4A5L A;  4EMI A;  1KNP A;  2WES A;  1PJ7 A;  1L0V A;  5KMR A;  3DME A;  4TLX A;  1F3P A;  3II4 A;  4IA5 A;  3FG2 P;  4GAP A;  4O5Q A;  1K0I A;  3NK2 X;  4EMW A;  2C73 A;  1NHR A;  1Y0P A;  1IUS A;  1N4U A;  3AD8 B;  2WPE A;  1GOS A;  3CGC A;  4K22 A;  3UOZ A;  4DSH A;  1NEK A;  4JY3 A;  5KWF A;  4Z2R A;  3Q9T A;  4FDC B;  1Y56 B;  1ZOY A;  2WOI A;  1PBB A;  3GMC A;  3NN6 X;  5DBJ A;  2YLS A;  1RP0 A;  3H8I A;  1JRX A;  2NPX A;  1TRB A;  3UOX A;  5J60 A;  1O94 A;  4O5U A;  4GAV A;  4TM0 A;  2BXS A;  3T2Y A;  1NHQ A;  1PBD A;  2VRL A;  3UP5 A;  4OPD A;  3GRT A;  3DH9 A;  1ZKQ A;  2GAG B;  4BK3 A;  5KRQ A;  2JKC A;  3T31 A;  2YM2 A;  3AYJ A;  3CNJ A;  2EQ9 A;  3NRN A;  1QJD A;  2R0P A;  4K8D A;  3KPF A;  5JCI A;  1H84 A;  2R45 A;  3NYF A;  3B6D A;  4PAA A;  1GER A;  3VR8 A;  4DGK A;  1ZY8 A;  1D4C A;  2YR4 A;  3NLC A;  2XVJ A;  2GR3 A;  1CJC A;  2WEU A;  3UKP A;  2H88 A;  1V59 A;  2YVJ A;  1E1M A;  3BHK A;  1GRT A;  3ALL A;  2HQM A;  4YTP A;  2X3N A;  1K4Q A;  3SZF A;  4D04 A;  4AOX A;  4U8O A;  4BV6 A;  2C4C A;  4H4P A;  4II2 A;  2C3D A;  2QA2 A;  3AEG A;  3NT6 A;  4NNJ A;  4U8K A;  1E1N A;  2YWL A;  2YQU A;  3QVR A;  3AD9 B;  3LJP A;  2XLU A;  3K7T A;  3AE4 A;  2WOV A;  2YM1 A;  2FJA A;  2XLP A;  3EF6 A;  3IC9 A;  1BF3 A;  4H4R A;  5C2T A;  1BWC A;  3RNM A;  4PAB A;  5FS9 A;  2GB0 A;  1DXL A;  1D7L A;  3T14 A;  1O95 A;  1Y56 A;  1REO A;  1ONF A;  1L9C A;  4OVI A;  4AP1 A;  5J7X A;  2C7G A;  1N1P A;  2EQ7 A;  1KF6 A;  1ZK7 A;  3AYL A;  2YG3 A;  2JB1 A;  4OPL A;  1IUX A;  5KVH A;  1FEB A;  2W0H A;  3HYV A;  5HXI A;  1LV0 A;  2XCG A;  4EMJ A; 
#chains in the Genus database with same CATH homology
 3QJ4 A;  1H82 A;  3CTY A;  4B68 A;  2QAE A;  3QSM A;  3CIR A;  1EL7 A;  1EBD A;  2BK4 A;  2XVF A;  3SZ0 A;  3G5R A;  2XFN A;  1YKJ A;  5JCM A;  4NTD A;  1GRF A;  2BK3 A;  5CKU A;  1VG0 A;  3FBS A;  4H2N A;  3CNP A;  3QSE A;  4U8L A;  3M0O A;  4A9W A;  1BZL A;  4BK2 A;  1IJH A;  1GT8 A;  5CQF A;  2VZ2 A;  4TM1 A;  2B9W A;  3JSK A;  2OAL A;  2Q6U A;  2BA9 A;  3SX6 A;  2RGO A;  1O5W A;  3SXI A;  1YQZ A;  4RG3 A;  2GMJ A;  5KOW A;  1BKW A;  1B5Q A;  2PYX A;  1LQU A;  4XWZ A;  1LJ1 A;  4U2L A;  2ARD A;  1ELI A;  2C66 A;  1XPQ A;  1TDF A;  2GR0 A;  3AEF A;  3PO7 A;  1NDA A;  3UKL A;  4RG4 A;  5IPY A;  4DNA A;  1UKV G;  3AB1 A;  1FEC A;  1JNZ A;  3LXD A;  1NG3 A;  1JU2 A;  4OPG A;  5U25 A;  2XVI A;  2B76 A;  2GV8 A;  4H4Y A;  2WHD A;  4G9K A;  1TYT A;  2WP5 A;  1VQW A;  2BS3 A;  1PXA A;  2WS3 A;  3KU9 A;  3ITJ A;  4YTN A;  1P2H A;  1JRY A;  3DJG X;  5HY5 A;  4H2P A;  1QLB A;  4YTM A;  1CL0 A;  3V3N A;  5KMP A;  1FOH A;  4B66 A;  4NTC A;  4OPT A;  1LQT A;  4IV9 A;  4P9S A;  1TDO A;  3AEE A;  2ZZB A;  3UTH A;  5JCN A;  1X31 B;  2VRM A;  1Q1R A;  3G5S A;  3P4P A;  1AOG A;  3CMM A;  1ZMD A;  4KX6 A;  3C4A A;  3KA7 A;  5KMQ A;  1BGN A;  2YR5 A;  4YSX A;  1GPE A;  2FJB A;  3CGD A;  2VVL A;  2YLR A;  1GND A;  4X9M A;  1GRE A;  4N9X A;  3B3R A;  3OC4 A;  1S3E A;  3NYE A;  3LZX A;  4REK A;  3DA1 A;  5TR3 A;  1KFY A;  3OZ2 A;  3VRD B;  1H83 A;  2XLT A;  2H89 A;  5U63 A;  1OJA A;  2TMD A;  2FBW A;  3SYI A;  1Z6L A;  3UTE A;  3SQP A;  2VOU A;  1DOE A;  3T0K A;  3UKA A;  4WCT A;  3EAN A;  2GF3 A;  2WET A;  4U8M A;  5ER0 A;  3K30 A;  4Z26 A;  5IQ1 A;  2WDQ A;  4YKF A;  3S61 A;  2VVL G;  4HA6 A;  4OCG A;  1D4E A;  3AE5 A;  1PN0 A;  1Q9I A;  1RYI A;  1DNC A;  3F8P A;  5GRT A;  1VG9 A;  3BNU A;  5LV9 A;  1ZX9 A;  4U8P A;  4JY2 A;  2XVE A;  4AT0 A;  2XFO A;  2AAQ A;  2QA1 A;  2IVD A;  2CDU A;  4RSL A;  2Z5X A;  1HYU A;  2XDO A;  2YG4 A;  3AWI A;  4H4U A;  2WPF A;  3ISH A;  4H7U A;  1W4X A;  4TLZ A;  3CGB A;  5IQ4 A;  2V6O A;  3P4S A;  4J56 A;  2I0Z A;  3RP7 A;  2IID A;  3NIX A;  3VQR A;  3M12 A;  3AED A;  2A89 A;  5KXJ A;  3ATR A;  1M6I A;  2C64 A;  2J3N A;  4A6N B;  1ZDL A;  1TDN A;  3O0H A;  2C67 A;  1FCD A;  4MJW A;  3LB8 A;  4H4Q A;  5HYM A;  2DKI A;  4ZCC A;  4EIP A;  3AE3 A;  3ATQ A;  3CN8 A;  3NGC X;  4GCM A;  1S2Q A;  2YG6 A;  3BNM A;  2JK6 A;  2FJE A;  3C4N A;  2C75 A;  3NTD A;  4Z24 A;  1EL5 A;  4G6H A;  5KNL A;  3GD4 A;  2Y6Q A;  2YAU A;  2YVF A;  2GVC A;  2V60 A;  1E1K A;  1D7Y A;  1B4V A;  3ICT A;  5EB5 A;  4CY8 A;  4U8J A;  2JBV A;  3AE2 A;  1PXC A;  2YLX A;  3GWF A;  3GYX A;  4AOS A;  1PXB A;  2V5Z A;  4BJY A;  1NPX A;  4XXG A;  5KOX A;  1CF3 A;  2CUL A;  4CRT A;  1D4D A;  4EIQ A;  3NG7 X;  2JB3 A;  3NNE A;  4OPI A;  3RED A;  2CFY A;  4GR1 A;  3T37 A;  3BI4 A;  4ZCD A;  4JNQ A;  5M10 A;  4Y4N A;  1TDK A;  1TDE A;  3GSI A;  3COX A;  1GRA A;  2R0G A;  4UDR A;  4E0V A;  2OLO A;  1VDC A;  2XFQ A;  3AYI A;  3UP4 A;  3CPJ G;  3GDN A;  3RP8 A;  1CC6 A;  1DOB A;  1N4V A;  1E1L A;  3ABV A;  3SM8 A;  1PJ5 A;  3PVC A;  4CNJ A;  3ALJ A;  1L9E A;  3K7Q X;  4GF7 A;  2BRA A;  2A8X A;  2WBA A;  4H4Z A;  5FS7 A;  2GQF A;  1MOK A;  4WX1 A;  5BRT A;  3K7M X;  1XDI A;  3H4K A;  4OPC A;  4A6N A;  1YY5 A;  2IVE A;  3UKK A;  3DJD A;  3H8L A;  3VRA A;  1B37 A;  3UOV A;  2GRT A;  4CNK A;  4Z2U A;  1DOC A;  1OJD A;  2E1M A;  3P1W A;  4H4W A;  1PBC A;  4CCQ A;  4U8N A;  3DJJ A;  1OJC A;  2EQ8 A;  1F8S A;  4UDP A;  4J36 A;  2RAB A;  2XFP A;  2X50 A;  5HHF A;  2BCG G;  2GMH A;  2WQY A;  5GSN A;  4I59 A;  1COY A;  2R9Z A;  3UOY A;  4ZN0 A;  1F8R A;  1H6V A;  4U2S A;  4CCR A;  1K0J A;  5FS8 A;  3P4Q A;  4H4S A;  5BVA A;  3DJE A;  2ZZC A;  1GET A;  4YT0 A;  3GDP A;  4ECH A;  1FEA A;  4XWR A;  4AP3 A;  4Z43 A;  1YQ3 A;  4YKG A;  2BRY A;  3I3L A;  3SFD A;  1GRB A;  1DOD A;  1NHP A;  2C3C A;  1GAL A;  2Q7V A;  4B64 A;  4B1B A;  4EQS A;  3AD7 B;  3T2K A;  4CY6 A;  4BK1 A;  1DJN A;  2OLN A;  3ICS A;  3GD3 A;  4G73 A;  4Z25 A;  1MO9 A;  2FJD A;  1GEU A;  4J34 A;  1NEN A;  2BK5 A;  3NKS A;  1VRQ B;  4IVO B;  1RSG A;  3QSS A;  2R46 A;  3LAD A;  4J33 A;  5FMH A;  1GXF A;  2WOW A;  3CPH G;  5EB4 A;  4C74 A;  3LOV A;  1K0L A;  2V61 A;  4C77 A;  1N4W A;  2BC1 A;  3SY4 A;  3NTA A;  2RGH A;  1B8S A;  3AE7 A;  4K2X A;  4CBQ A;  2YG7 A;  3L8K A;  3NN0 X;  2Q0K A;  4HB9 A;  3ICR A;  1EL8 A;  1KSS A;  2YLT A;  3T2Z A;  4EQW A;  3AEB A;  3KD9 A;  4IVM B;  1GRH A;  4A7A A;  4ADW A;  3E1T A;  4C3X A;  2Q0L A;  3CNT A;  2C70 A;  1KNR A;  2R4E A;  4J57 A;  3R9U A;  2AQJ A;  1XHC A;  1GTE A;  3I6D A;  2GH5 A;  4H2Q A;  1H81 A;  4C3Y A;  1LTX R;  2BAC A;  2GQW A;  3CPI G;  2A87 A;  3QFA A;  4II3 A;  3AE6 A;  1ZMC A;  4B69 A;  1GSN A;  1CJ3 A;  1F8W A;  4U2T A;  2YR6 A;  3NHO X;  2VQB A;  3FPZ A;  4TM3 A;  1JEH A;  2UZZ A;  4UP3 A;  1PS9 A;  4GDP A;  2B9X A;  2BCP A;  2VVM A;  3AE8 A;  2XLS A;  3IF9 A;  5U1O A;  2V3A A;  3V3O A;  3GYI A;  2WDR A;  3UTF A;  1IUU A;  1Q1W A;  3ALM A;  4APN A;  4JNA A;  1EL9 A;  5EBK A;  4X4J A;  1CBO A;  2WU2 A;  2ACZ A;  3UKF A;  3URH A;  1DJQ A;  1PBF A;  3HYX A;  4NTE A;  4Y4M A;  1MXT A;  4GUV A;  1S2Y A;  4B63 A;  4EQX A;  2BAB A;  4M52 A;  5M0Z A;  5FS6 A;  3RP6 A;  2ZBW A;  3GMB A;  3KVE A;  1L9D A;  4Y4L A;  3VR9 A;  2B9Y A;  2PHH A;  2C72 A;  2ZZ0 A;  3GWD A;  2BC0 A;  4I58 A;  4H2R A;  3GYJ A;  3SFE A;  4C5O A;  4D03 A;  1YQ4 A;  3ZDN A;  3DGZ A;  3DK8 A;  3NH3 X;  1PBE A;  2BYB A;  3C96 A;  2JAE A;  2OAM A;  3Q6J A;  4A99 A;  3UKH A;  4Z2T A;  2GEW A;  2BS2 A;  2X8G A;  3EPT A;  2XYO A;  4IA6 A;  2X8C A;  4FK1 A;  1KSU A;  2DKH A;  2WDV A;  1CJ2 A;  2R4J A;  3F8D A;  1JNR A;  2B7S A;  4EQR A;  4DSG A;  3AXB A;  2X8H A;  4A79 A;  1E39 A;  3P9U A;  3AE1 A;  4J2W A;  2GR2 A;  4K5R A;  1M64 A;  1ZOV A;  3IHG A;  4YSH A;  2JB2 A;  2CVJ A;  3S5W A;  4YXD A;  1LPF A;  3PS9 A;  3IHM A;  4H4V A;  3VRB A;  4Z44 A;  1XAN A;  1H7X A;  2WU5 A;  3CND A;  2YLZ A;  4K5S A;  2YLW A;  1D5T A;  1PJ6 A;  3G5Q A;  4EM3 A;  3QVP A;  2Y6R A;  3BI5 A;  1TYP A;  3UKQ A;  3UTG A;  3D8X A;  5EOW A;  1CJ4 A;  2V3B A;  3KLJ A;  2AR8 A;  4TM4 A;  3KKJ A;  3V76 A;  1JOA A;  2GAH B;  1OJT A;  1IUT A;  2WP6 A;  2E4G A;  4X9N A;  1E6E A;  1KDG A;  4NWZ A;  2RGJ A;  4FX9 A;  4BJZ A;  2GR1 A;  4YSZ A;  3QFB A;  1GV4 A;  4B67 A;  4YSY A;  2B7R A;  2OA1 A;  1CC2 A;  4YWO A;  2X99 A;  2O9Z A;  1IUV A;  2F5Z A;  1BGJ A;  4H4X A;  1NHS A;  1PDH A;  2WPC A;  3AEA A;  3NK0 X;  5L46 A;  2WP9 A;  4USR A;  4H4T A;  5BUL A;  2C76 A;  3RHA A;  1IUW A;  4GDE A;  4LU6 A;  2YG5 A;  1GES A;  3HYW A;  1NG4 A;  4JQ9 A;  5BUK A;  3UCL A;  3CGE A;  3WE0 A;  3DK4 A;  1SEZ A;  2NVK X;  4B65 A;  3FIM B;  4LII A;  5KMS A;  3LZW A;  1FL2 A;  4JN9 A;  1GRG A;  3KPK A;  1GTH A;  1JRZ A;  3BHF A;  4J31 A;  1CC4 A;  1H86 A;  3GRS A;  2EQ6 A;  3ADA B;  3F8R A;  1NAA A;  1ZP0 A;  2VQ7 A;  4H50 A;  3L1R A;  1CHU A;  1OJ9 A;  2BS4 A;  4UDQ A;  5JCK A;  5KVI A;  4EM4 A;  3SZC A;  3DK9 A;  3IWA A;  3SGL A;  3NYC A;  1S3B A;  2XFU A;  4G6G A;  2YVG A;  4NZH A;  4NEW A;  4BUR A;  1P2E A;  5JCL A;  1PHH A;  3HZL A;  2R0C A;  3NK1 X;  3BI2 A;  4U8I A;  2E5V A;  3SZW A;  3AEC A;  4KPR A;  4JDR A;  4ICY A;  2Z5Y A;  2APG A;  4GRT A;  2C65 A;  3FMW A;  4FK1 C;  3ZYX A;  2XLR A;  4OPU A;  4NEV A;  3D1C A;  4AT2 A;  2TPR A;  1QO8 A;  1E7P A;  3EAO A;  1H7W A;  2XVH A;  3CNS A;  3AE9 A;  3P4R A;  2BXR A;  4G74 A;  1LVL A;  4A65 A;  4LA1 A;  4USQ A;  5C3J A;  1F6M A;  3M13 A;  2QCU A;  3DGH A;  4K7Z A;  4A5L A;  4EMI A;  1KNP A;  2WES A;  1PJ7 A;  1L0V A;  5KMR A;  3DME A;  4TLX A;  1F3P A;  3II4 A;  4IA5 A;  3FG2 P;  4GAP A;  4O5Q A;  1K0I A;  3NK2 X;  4EMW A;  2C73 A;  1NHR A;  1Y0P A;  1IUS A;  1N4U A;  3AD8 B;  2WPE A;  1GOS A;  3CGC A;  4K22 A;  3UOZ A;  4DSH A;  1NEK A;  4JY3 A;  5KWF A;  4Z2R A;  3Q9T A;  4FDC B;  1Y56 B;  1ZOY A;  2WOI A;  1PBB A;  3GMC A;  3NN6 X;  5DBJ A;  2YLS A;  1RP0 A;  3H8I A;  1JRX A;  2NPX A;  1TRB A;  3UOX A;  5J60 A;  1O94 A;  4O5U A;  4GAV A;  4TM0 A;  2BXS A;  3T2Y A;  1NHQ A;  1PBD A;  2VRL A;  3UP5 A;  4OPD A;  3GRT A;  3DH9 A;  1ZKQ A;  2GAG B;  4BK3 A;  5KRQ A;  2JKC A;  3T31 A;  2YM2 A;  3AYJ A;  3CNJ A;  2EQ9 A;  3NRN A;  1QJD A;  2R0P A;  4K8D A;  3KPF A;  5JCI A;  1H84 A;  2R45 A;  3NYF A;  3B6D A;  4PAA A;  1GER A;  3VR8 A;  4DGK A;  1ZY8 A;  1D4C A;  2YR4 A;  3NLC A;  2XVJ A;  2GR3 A;  1CJC A;  2WEU A;  3UKP A;  2H88 A;  1V59 A;  2YVJ A;  1E1M A;  3BHK A;  1GRT A;  3ALL A;  2HQM A;  4YTP A;  2X3N A;  1K4Q A;  3SZF A;  4D04 A;  4AOX A;  4U8O A;  4BV6 A;  2C4C A;  4H4P A;  4II2 A;  2C3D A;  2QA2 A;  3AEG A;  3NT6 A;  4NNJ A;  4U8K A;  1E1N A;  2YWL A;  2YQU A;  3QVR A;  3AD9 B;  3LJP A;  2XLU A;  3K7T A;  3AE4 A;  2WOV A;  2YM1 A;  2FJA A;  2XLP A;  3EF6 A;  3IC9 A;  1BF3 A;  4H4R A;  5C2T A;  1BWC A;  3RNM A;  4PAB A;  5FS9 A;  2GB0 A;  1DXL A;  1D7L A;  3T14 A;  1O95 A;  1Y56 A;  1REO A;  1ONF A;  1L9C A;  4OVI A;  4AP1 A;  5J7X A;  2C7G A;  1N1P A;  2EQ7 A;  1KF6 A;  1ZK7 A;  3AYL A;  2YG3 A;  2JB1 A;  4OPL A;  1IUX A;  5KVH A;  1FEB A;  2W0H A;  3HYV A;  5HXI A;  1LV0 A;  2XCG A;  4EMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...