1H86A

Covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 7.0
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h86A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h86A02
4EQRA 3AE2A 4REKA 2BS2A 2GH5A 3II4A 5ER0A 1L0VA 3AE1A 3CIRA 4GDPA 5EOWA 1B4VA 4EM4A 4OPUA 4X4JA 3C4AA 2XLSA 3Q9TA 1GRGA 1PXBA 1GT8A 4H2NA 1LQTA 2RGJA 4EQWA 4D04A 2V3AA 4EM3A 4OCGA 2X50A 1TDOA 4H4RA 3IC9A 4A65A 3I3LA 2BK3A 5M0ZA 4B69A 5U25A 3COXA 2B9YA 1P2EA 3FMWA 1EBDA 1CC2A 5KVIA 3EANA 2F5ZA 4JN9A 2FJDA 5GRTA 1IUWA 4K22A 4BURA 5HXIA 5JCKA 1E1KA 1E1LA 1LJ1A 1XANA 2GR2A 4JQ9A 2RGHA 4B66A 3VQRA 4O5UA 1N4UA 4TM1A 2VRMA 3L1RA 3LOVA 2TPRA 4A7AA 1PJ5A 3DGZA 3NRNA 3QFAA 2YWLA 3P4QA 4NTCA 2FJEA 1ONFA 4Z44A 5C3JA 1O95A 3URHA 5KWFA 3DH9A 1ZK7A 3UP5A 1CHUA 1NHRA 2DKHA 3PO7A 4LA1A 3AE3A 2WQYA 4NEWA 1FECA 1QO8A 3DK8A 3QVPA 1D7LA 2IIDA 3BI2A 4PABA 4YTNA 2QAEA 4DSGA 4MJWA 5BVAA 2OLNA 4KX6A 2XVEA 3AWIA 1IUUA 1H7WA 2ZZ0A 2HQMA 2YLWA 3FIMB 2FBWA 4UDQA 3AXBA 1F8RA 2B7RA 3AEDA 1YKJA 2WU2A 1F6MA 3AE8A 4GUVA 2XLPA 4YTMA 4AP1A 4C3XA 3CNJA 4IV9A 1KNRA 4TLZA 3VR9A 4YSYA 2XFNA 1XHCA 3GYIA 2JB2A 4GDEA 2A87A 4DNAA 2BCPA 4PAAA 2YQUA 2WOIA 3P9UA 2GMHA 4IA5A 1IUSA 3AYJA 1KF6A 1O94A 1M6IA 1TDEA 2WDVA 4TM3A 3E1TA 3JSKA 1GRBA 2C73A 4KPRA 1PHHA 3LADA 1EL5A 1CC6A 3VRDB 5IPYA 1VQWA 1KSSA 3BI4A 3RP6A 4USRA 3GYJA 2YAUA 4U8KA 2TMDA 2YR6A 2ARDA 2X3NA 1JNRA 3PS9A 3CNTA 1DNCA 1X31B 3NYEA 1GETA 2AAQA 4H4TA 4HA6A 4U8LA 2OAMA 1PDHA 2C65A 4WX1A 2X8CA 3DJDA 1D4DA 4H2RA 2Y6RA 2BABA 1PXAA 1H82A 4JY2A 2CFYA 1K0LA 1Q1WA 2IVDA 3NNEA 3GDPA 4YT0A 2YLXA 1TYPA 1GTHA 1L9CA 1NHPA 1BGJA 1TDNA 2RABA 3G5QA 1ZOVA 4U8OA 2ACZA 1D7YA 1MO9A 1OJCA 3KA7A 5CKUA 3GWDA 2GAHB 1B37A 2YLRA 3LZXA 4H4WA 1IUTA 2WU5A 2JAEA 4H4UA 1FOHA 1YQ3A 3ATRA 5KVHA 5C2TA 1Q1RA 1H7XA 1GERA 4IVOB 3AE6A 1KFYA 4K7ZA 2GF3A 1N1PA 2BK5A 2VQ7A 3M0OA 4EQSA 5J60A 2GQWA 3CPIG 3SQPA 3H8IA 2BK4A 2R45A 4M52A 4U8MA 1NEKA 1GRTA 3IWAA 1F8SA 1K0JA 1DOBA 3AECA 1CL0A 3KKJA 2WOWA 3FG2P 4C3YA 3BI5A 2OA1A 1GRAA 4OVIA 1TRBA 4J36A 1BWCA 1MXTA 2Q7VA 3CPJG 3VRBA 2C3DA 2VVLG 1S3BA 4AT2A 2JKCA 3O0HA 3GD3A 1GALA 3DJJA 3UP4A 3NGCX 2DKIA 4OPTA 3K7MX 4GF7A 2FJBA 3CNSA 4X9NA 1COYA 3ALLA 2XLRA 4ADWA 1NDAA 3DJEA 2WETA 3LZWA 3KLJA 2E4GA 1LV0A 4UP3A 2Z5YA 4H2PA 4RSLA 4Z2TA 1LQUA 1Q9IA 3GSIA 2A8XA 2E1MA 4IVMB 4O5QA 2YG4A 3NHOX 2YVJA 4A5LA 1V59A 5IQ1A 4AOSA 4HB9A 3CGDA 5HHFA 3BHFA 1E7PA 4P9SA 1TDFA 1ZY8A 3UKLA 1ZMCA 3V3NA 4J34A 1RYIA 3CGBA 1RSGA 3QSSA 2OALA 3F8DA 3P1WA 1PS9A 3ALMA 4Z25A 1K0IA 5HY5A 5JCMA 3AB1A 4OPCA 1DOCA 4CY8A 1ELIA 3UCLA 4B1BA 3GMCA 3QFBA 3UKAA 1NHQA 3AEEA 4YSZA 1GEUA 3VRAA 3ABVA 5BRTA 2C66A 2BXSA 2IVEA 2Z5XA 4EQXA 3B3RA 1O5WA 1PBCA 3QSMA 1ZMDA 1GXFA 3H8LA 3UTGA 2YLTA 2JBVA 4EMJA 4ECHA 1DJNA 5U63A 1BF3A 2WOVA 4ICYA 4EIQA 5KOWA 1HYUA 2WESA 2CDUA 2VQBA 4NZHA 3UKKA 4BJYA 3AE4A 1REOA 1IUVA 2BC1A 3AD8B 2O9ZA 3SM8A 3K30A 3KPFA 4YSHA 4XXGA 4YSXA 1JNZA 3CNDA 4H4XA 3NN0X 1E39A 4FX9A 3NK0X 4GCMA 3UOZA 2AR8A 2XFPA 2NVKX 1GRFA 3K7QX 1GV4A 2EQ8A 1FEBA 1JOAA 2QA1A 2GB0A 3DK9A 4J56A 3UTHA 4BJZA 3VR8A 1OJTA 2CULA 2B76A 4U8NA 2GR3A 4FK1A 2BC0A 2H88A 3QSEA 1JRYA 1Y0PA 1NG4A 2V5ZA 2YR4A 3NKSA 4D03A 4OPIA 1EL9A 4U2TA 2VVMA 4A79A 1N4VA 1EL8A 2BS3A 1W4XA 2B7SA 2YM1A 4U8JA 1KSUA 4TLXA 5EB5A 3V3OA 4YXDA 4K5SA 1PJ7A 3P4RA 2VVLA 4ZN0A 1H86A 4DGKA 4JNAA 4YKGA 4AT0A 2GRTA 4I59A 3QVRA 3NIXA 2YLZA 3NN6X 1ZDLA 2QCUA 1L9EA 4C74A 1FL2A 2PYXA 2YG3A 4NTDA 2GEWA 1H84A 3CPHG 3FBSA 1PN0A 2R4JA 1QJDA 3AE9A 1CJCA 3EF6A 5JCLA 3AEGA 4A6NB 5M10A 4K2XA 5FS8A 4Y4NA 2R46A 3FPZA 3B6DA 1NG3A 2YR5A 4JY3A 4NTEA 3NYFA 4B67A 1PJ6A 3UTFA 3SGLA 2YG5A 3WE0A 2YG7A 3ISHA 3AEAA 4RG3A 2WBAA 3G5RA 4GR1A 4U8IA 1CF3A 2YG6A 2YVGA 3AYIA 2Q6UA 3CGEA 5KXJA 4BK3A 2C64A 2JK6A 3AE7A 3LB8A 5JCNA 2JB1A 3F8RA 2GVCA 2H89A 2WP9A 4U2LA 1KNPA 2A89A 4U2SA 4H50A 1H83A 2C70A 1YQZA 2WEUA 2WPEA 3ICRA 3NTDA 4RG4A 3T37A 4APNA 4AOXA 3NG7X 3NTAA 4Z43A 2WP6A 3NK2X 4U8PA 4C77A 1DJQA 5BULA 1LPFA 2C75A 3ICSA 4YWOA 1GREA 1LVLA 3S61A 1FCDA 2WHDA 4E0VA 4XWZA 1PXCA 1B8SA 4A6NA 4H4QA 2JB3A 4X9MA 1D4CA 1DODA 3L8KA 2Q0LA 3IHMA 3NLCA 1NHSA 2C72A 1PBDA 1D4EA 1ZP0A 1ZOYA 3HZLA 3PVCA 3GRSA 4Y4LA 3UOYA 4JNQA 2XLTA 5KOXA 3ADAB 3F8PA 3UOVA 3NK1X 1CJ3A 3K7TA 2WP5A 3CTYA 4DSHA 1NENA 1NAAA 2GQFA 1CJ2A 2XCGA 4ZCDA 4BK2A 5L46A 3IF9A 1FEAA 2B9XA 2V6OA 4TM4A 2E5VA 2C7GA 3M13A 1P2HA 4H4ZA 2V60A 2J3NA 4J2WA 4YTPA 2CVJA 4N9XA 1IUXA 1RP0A 3LJPA 4FK1C 3R9UA 3M12A 4YKFA 1L9DA 4LIIA 5EBKA 2X99A 1DXLA 4NEVA 1ZX9A 3AD7B 1JEHA 2XVJA 4J57A 3EPTA 1Y56B 4EMWA 1XPQA 4OPDA 3UTEA 5J7XA 2R0GA 5FS9A 5BUKA 3DMEA 3OC4A 2APGA 1M64A 1GPEA 2WS3A 4TM0A 1GSNA 4B65A 2XVIA 3G5SA 1LTXR 4USQA 5JCIA 1S2QA 2QA2A 2VOUA 1NPXA 3AEFA 4K8DA 3REDA 4Y4MA 1JRZA 4B68A 2ZZBA 3UOXA 2WDRA 2BCGG 3DJGX 4H4VA 4OPGA 5GSNA 1PBFA 3UKHA 3ITJA 3V76A 4A99A 2XLUA 2GAGB 3GD4A 1BKWA 1PBEA 2X8HA 3KD9A 2BA9A 2ZZCA 3SFEA 3AE5A 1B5QA 2EQ6A 3UKFA 2FJAA 3EAOA 4H4PA 2RGOA 3SFDA 1CBOA 1Z6LA 1OJ9A 1Y56A 1H6VA 5TR3A 5DBJA 3ATQA 3RNMA 3RHAA 4Z2UA 3UKQA 2GV8A 3ALJA 1E1MA 1KDGA 1XDIA 1AOGA 2YM2A 3NYCA 1E6EA 3BNMA 1DOEA 2I0ZA 1F3PA 3DK4A 3S5WA 2Y6QA 2XFQA 3CGCA 3RP7A 3GMBA 5LV9A 3BHKA 5EB4A 2GMJA 1OJAA 5CQFA 2B9WA 4K5RA 2XFOA 4CBQA 1EL7A 1GRHA 3KU9A 1H81A 3ICTA 2EQ9A 3LXDA 2VZ2A 1VDCA 2XVHA 1ZKQA 4IA6A 4JDRA 3CNPA 2OLOA 3KVEA 3AYLA 5HYMA 3D8XA 4EMIA 4Z24A 2WDQA 2XYOA 1GOSA 2XVFA 3C4NA 1SEZA 3IHGA 5KRQA 4FDCB 4H2QA 4XWRA 2WPFA 2R9ZA 3AD9B 4H4SA 4OPLA 1S3EA 2UZZA 2C3CA 3BNUA 4C5OA 3QJ4A 1BZLA 2BXRA 2XDOA 3OZ2A 5FMHA 4LU6A 2R4EA 2V61A 3D1CA 1QLBA 3C96A 2AQJA 4Z26A 2R0PA 1JU2A 1VRQB 3P4SA 1F8WA 2BS4A 2X8GA 1JRXA 2YVFA 4ZCCA 2GR0A 3ZYXA 4CCRA 1VG9A 1YQ4A 5FS7A 1UKVG 5IQ4A 4UDRA 2YLSA 3DA1A 1GESA 4CNJA 4A9WA 3DGHA 3CN8A 4I58A 4BK1A 1S2YA 2EQ7A 2Q0KA 3GRTA 1BGNA 2PHHA 4B64A 4CCQA 4CRTA 4CY6A 2C76A 2GR1A 4EIPA 4J33A 4CNKA 3RP8A 3UKPA 2R0CA 3H4KA 4UDPA 4WCTA 4J31A 1D5TA 4B63A 3I6DA 1OJDA 1VG0A 2NPXA 3NT6A 4H4YA 1YY5A 1E1NA 2WPCA 5FS6A 2W0HA 4H7UA 1GTEA 3ZDNA 3P4PA 4Z2RA 2XFUA 3NH3X 1PBBA 1TYTA 1CJ4A 2C67A 3Q6JA 1GNDA 3AEBA 1K4QA 1IJHA 2V3BA 2VRLA 2ZBWA 1CC4A 5U1OA 1TDKA 4BV6A 2BYBA 1N4WA 3GWFA 4GRTA 1MOKA 4AP3A 2BACA 3GDNA
chains in the Genus database with same CATH superfamily
4EQRA 3AE2A 4REKA 2BS2A 2GH5A 3II4A 5ER0A 1L0VA 3AE1A 3CIRA 4GDPA 5EOWA 1B4VA 4EM4A 4OPUA 4X4JA 3C4AA 2XLSA 3Q9TA 1GRGA 1PXBA 1GT8A 4H2NA 1LQTA 4G74A 2RGJA 4EQWA 4D04A 2V3AA 4EM3A 4OCGA 2X50A 1TDOA 4H4RA 3IC9A 4A65A 3I3LA 2BK3A 5M0ZA 4B69A 5U25A 3COXA 2B9YA 1P2EA 3FMWA 3T14A 1EBDA 1CC2A 5KVIA 3EANA 2F5ZA 4JN9A 2FJDA 5GRTA 1IUWA 4K22A 4BURA 5HXIA 3GYXA 1E1KA 1E1LA 1LJ1A 1XANA 2GR2A 4JQ9A 5JCKA 2RGHA 4B66A 3VQRA 4O5UA 1N4UA 4TM1A 2VRMA 3L1RA 3LOVA 2TPRA 4A7AA 1PJ5A 3DGZA 3NRNA 3QFAA 2YWLA 3P4QA 4NTCA 2FJEA 1ONFA 4Z44A 5C3JA 1O95A 3URHA 5KWFA 3DH9A 1ZK7A 3UP5A 1CHUA 1NHRA 2DKHA 3PO7A 4LA1A 3AE3A 2WQYA 4NEWA 3SX6A 1FECA 1QO8A 3DK8A 3QVPA 1D7LA 2IIDA 3BI2A 5KNLA 4PABA 4YTNA 2QAEA 4DSGA 4MJWA 5BVAA 2OLNA 4KX6A 2XVEA 3AWIA 1IUUA 1H7WA 2ZZ0A 2HQMA 2YLWA 3FIMB 2FBWA 4UDQA 3AXBA 1F8RA 3SZCA 2B7RA 3AEDA 1YKJA 2WU2A 1F6MA 3AE8A 4GUVA 2XLPA 4YTMA 4AP1A 4C3XA 3CNJA 4IV9A 1KNRA 4TLZA 3VR9A 4G6HA 4YSYA 2XFNA 1XHCA 3GYIA 2JB2A 4GDEA 2A87A 4DNAA 2BCPA 4PAAA 2YQUA 2WOIA 3P9UA 2GMHA 4IA5A 1IUSA 3AYJA 1KF6A 1O94A 1M6IA 1TDEA 2WDVA 4TM3A 3E1TA 3JSKA 1GRBA 2C73A 4KPRA 2BRAA 1PHHA 3LADA 1EL5A 1CC6A 3VRDB 5IPYA 1VQWA 1KSSA 3BI4A 4G73A 4USRA 3GYJA 2YAUA 3RP6A 3SZ0A 4U8KA 2TMDA 2YR6A 3SYIA 2ARDA 2X3NA 1JNRA 3PS9A 3CNTA 1DNCA 1X31B 3NYEA 1GETA 2AAQA 4H4TA 3HYXA 4HA6A 3T2YA 4U8LA 2OAMA 1PDHA 2C65A 4WX1A 2X8CA 3DJDA 1D4DA 4H2RA 2Y6RA 2BABA 1PXAA 1H82A 4JY2A 2CFYA 1K0LA 1Q1WA 2IVDA 3NNEA 3GDPA 5KMPA 4YT0A 2YLXA 1TYPA 1GTHA 1L9CA 1NHPA 1BGJA 1TDNA 2RABA 3G5QA 1ZOVA 4U8OA 2ACZA 1D7YA 1MO9A 1OJCA 3KA7A 5CKUA 3GWDA 2GAHB 1B37A 2YLRA 3LZXA 4H4WA 1IUTA 2WU5A 2JAEA 4H4UA 1FOHA 1YQ3A 3ATRA 5KVHA 5C2TA 1Q1RA 1H7XA 1GERA 4IVOB 3AE6A 4GAPA 1KFYA 4K7ZA 2GF3A 1N1PA 2BK5A 2VQ7A 3M0OA 4EQSA 5J60A 2GQWA 3CPIG 3SQPA 3H8IA 2BK4A 2R45A 4M52A 4U8MA 1NEKA 1GRTA 3IWAA 1F8SA 1K0JA 1DOBA 3AECA 1CL0A 3KKJA 2WOWA 3FG2P 4C3YA 3BI5A 2OA1A 1GRAA 4OVIA 1TRBA 4J36A 1BWCA 1MXTA 2Q7VA 3CPJG 3VRBA 2C3DA 2VVLG 1S3BA 4AT2A 2JKCA 3O0HA 3GD3A 1GALA 3DJJA 3UP4A 3NGCX 2DKIA 4OPTA 3K7MX 4GF7A 2FJBA 3CNSA 4NNJA 4X9NA 1COYA 3ALLA 2XLRA 4ADWA 1NDAA 3DJEA 2WETA 3LZWA 3KLJA 2E4GA 1LV0A 4UP3A 2Z5YA 4H2PA 4RSLA 4Z2TA 1LQUA 1Q9IA 3GSIA 2A8XA 2E1MA 4IVMB 4O5QA 2YG4A 3NHOX 2YVJA 4A5LA 1V59A 5IQ1A 4AOSA 4HB9A 3CGDA 5HHFA 3BHFA 1E7PA 4P9SA 1TDFA 1ZY8A 3UKLA 1ZMCA 3V3NA 4J34A 1RYIA 3CGBA 1RSGA 3QSSA 2OALA 3F8DA 3P1WA 1PS9A 3ALMA 4Z25A 1K0IA 5HY5A 5JCMA 3AB1A 5KMRA 4OPCA 1DOCA 3KPKA 4CY8A 1ELIA 3UCLA 4B1BA 3GMCA 3QFBA 3UKAA 1NHQA 3AEEA 4YSZA 1GEUA 3VRAA 3ABVA 5BRTA 2C66A 2BXSA 2IVEA 2Z5XA 4EQXA 3B3RA 1O5WA 1PBCA 3QSMA 1ZMDA 1GXFA 3H8LA 3UTGA 2YLTA 2JBVA 4EMJA 4ECHA 1DJNA 5U63A 1BF3A 2WOVA 4ICYA 4EIQA 5KOWA 1HYUA 2WESA 2CDUA 2VQBA 4NZHA 3UKKA 4BJYA 3AE4A 1REOA 1IUVA 2BC1A 3AD8B 2O9ZA 3SM8A 3K30A 3KPFA 3T2KA 4YSHA 4XXGA 4YSXA 1JNZA 3CNDA 4H4XA 3NN0X 1E39A 4FX9A 3NK0X 4GCMA 3UOZA 2AR8A 2XFPA 2NVKX 1GRFA 3K7QX 1GV4A 2EQ8A 1FEBA 1JOAA 2QA1A 2GB0A 3DK9A 4J56A 3UTHA 4BJZA 3VR8A 1OJTA 2CULA 2B76A 4U8NA 2GR3A 4FK1A 2BC0A 2H88A 3QSEA 1JRYA 1Y0PA 1NG4A 2V5ZA 2YR4A 3NKSA 4D03A 4OPIA 1EL9A 4U2TA 2VVMA 4A79A 1N4VA 1EL8A 2BS3A 1W4XA 2B7SA 2YM1A 4U8JA 1KSUA 4TLXA 5EB5A 3V3OA 4YXDA 3SY4A 4K5SA 1PJ7A 3P4RA 2VVLA 4ZN0A 1H86A 4DGKA 4JNAA 4YKGA 4AT0A 2GRTA 4I59A 3QVRA 3NIXA 2YLZA 3NN6X 1ZDLA 2QCUA 1L9EA 4C74A 1FL2A 2PYXA 2YG3A 4NTDA 2GEWA 1H84A 3CPHG 3FBSA 3T0KA 1PN0A 2R4JA 1QJDA 3AE9A 1CJCA 3EF6A 5JCLA 3AEGA 4A6NB 5M10A 4K2XA 5FS8A 4Y4NA 2R46A 3FPZA 3B6DA 1NG3A 2YR5A 4JY3A 4NTEA 3NYFA 4B67A 1PJ6A 3UTFA 3SGLA 2YG5A 3WE0A 2YG7A 3ISHA 3SZWA 3AEAA 4RG3A 2WBAA 3G5RA 4GR1A 4U8IA 1CF3A 2YG6A 2YVGA 3AYIA 2Q6UA 3CGEA 5KXJA 4BK3A 2C64A 2JK6A 3AE7A 3LB8A 5JCNA 2JB1A 3F8RA 2GVCA 2H89A 2WP9A 4U2LA 1KNPA 2A89A 4U2SA 4H50A 1H83A 2C70A 1YQZA 2WEUA 2WPEA 3ICRA 3NTDA 4RG4A 3T37A 4APNA 4AOXA 3NG7X 3NTAA 4Z43A 2WP6A 3NK2X 4U8PA 4C77A 1DJQA 5BULA 1LPFA 2C75A 3ICSA 4YWOA 1GREA 1LVLA 3S61A 1FCDA 2WHDA 4E0VA 4XWZA 1PXCA 1B8SA 4A6NA 4H4QA 2JB3A 4X9MA 1D4CA 1DODA 3L8KA 2Q0LA 3IHMA 3NLCA 1NHSA 2C72A 1PBDA 3HYWA 1D4EA 1ZP0A 1ZOYA 3HZLA 3PVCA 3GRSA 4Y4LA 3UOYA 4JNQA 2XLTA 5KOXA 3ADAB 3F8PA 3UOVA 3NK1X 1CJ3A 3K7TA 2WP5A 3CTYA 4DSHA 1NENA 1NAAA 2GQFA 1CJ2A 2XCGA 4ZCDA 4BK2A 5L46A 3IF9A 1FEAA 2B9XA 2V6OA 4TM4A 2E5VA 2C7GA 3M13A 1P2HA 4H4ZA 2V60A 2J3NA 4J2WA 4YTPA 2CVJA 3T2ZA 4N9XA 1IUXA 1RP0A 3LJPA 4FK1C 3R9UA 3M12A 4YKFA 4NWZA 1L9DA 4LIIA 5EBKA 2X99A 1DXLA 4NEVA 1ZX9A 3AD7B 1JEHA 2XVJA 4J57A 3EPTA 1Y56B 4EMWA 1XPQA 4OPDA 3UTEA 5J7XA 2R0GA 5FS9A 5BUKA 3DMEA 3OC4A 2APGA 1M64A 1GPEA 2WS3A 4TM0A 1GSNA 4B65A 2XVIA 3G5SA 1LTXR 4USQA 5JCIA 1S2QA 2QA2A 2VOUA 1NPXA 3AEFA 4II3A 4K8DA 3REDA 4Y4MA 1JRZA 4B68A 2ZZBA 3UOXA 2WDRA 4G9KA 2BCGG 3DJGX 2BRYA 4H4VA 4OPGA 3SXIA 5GSNA 1PBFA 3UKHA 3ITJA 3V76A 4A99A 2XLUA 2GAGB 3GD4A 5KMQA 1BKWA 1PBEA 2X8HA 3KD9A 2BA9A 2ZZCA 3SFEA 2C4CA 3AE5A 1B5QA 2EQ6A 3UKFA 2FJAA 3EAOA 4H4PA 2RGOA 3SFDA 1CBOA 1Z6LA 1OJ9A 1Y56A 5KMSA 1H6VA 5TR3A 5DBJA 3ATQA 4II2A 3RNMA 3RHAA 4Z2UA 3UKQA 2GV8A 3ALJA 1E1MA 1KDGA 1XDIA 1AOGA 2YM2A 3NYCA 1E6EA 3BNMA 1DOEA 2I0ZA 1F3PA 3DK4A 3S5WA 2Y6QA 2XFQA 3CGCA 3RP7A 3GMBA 5LV9A 3BHKA 5EB4A 2GMJA 1OJAA 5CQFA 2B9WA 4K5RA 2XFOA 4CBQA 1EL7A 1GRHA 3KU9A 1H81A 3ICTA 2EQ9A 3LXDA 2VZ2A 1VDCA 2XVHA 4GAVA 1ZKQA 4IA6A 4JDRA 3CNPA 2OLOA 3KVEA 3AYLA 4G6GA 3D8XA 5HYMA 4EMIA 4Z24A 2WDQA 2XYOA 1GOSA 2XVFA 3C4NA 1SEZA 3IHGA 5KRQA 4FDCB 4H2QA 4XWRA 2WPFA 2R9ZA 3T31A 3AD9B 4H4SA 4OPLA 1S3EA 2UZZA 2C3CA 3BNUA 4C5OA 3QJ4A 1BZLA 2BXRA 2XDOA 3OZ2A 5FMHA 4LU6A 2R4EA 2V61A 3D1CA 1QLBA 3C96A 2AQJA 4Z26A 2R0PA 1JU2A 1VRQB 3P4SA 1F8WA 2BS4A 2X8GA 1JRXA 2YVFA 3HYVA 2GR0A 4ZCCA 3ZYXA 4CCRA 1VG9A 1YQ4A 5FS7A 1UKVG 5IQ4A 4UDRA 2YLSA 3DA1A 1GESA 4CNJA 4A9WA 3DGHA 3CN8A 4I58A 4BK1A 1S2YA 2EQ7A 2Q0KA 3GRTA 1BGNA 2PHHA 4B64A 4CCQA 4CRTA 4CY6A 2C76A 2GR1A 4EIPA 4J33A 4CNKA 3RP8A 3UKPA 2R0CA 3H4KA 4UDPA 4WCTA 4J31A 1D5TA 4B63A 3I6DA 1OJDA 1VG0A 2NPXA 3NT6A 4H4YA 1YY5A 1E1NA 2WPCA 5FS6A 2W0HA 4H7UA 1GTEA 3SZFA 3P4PA 3ZDNA 4Z2RA 2XFUA 3NH3X 1PBBA 1TYTA 1CJ4A 2C67A 3Q6JA 1GNDA 3CMMA 3AEBA 1K4QA 1IJHA 2V3BA 2VRLA 2ZBWA 1CC4A 5U1OA 1TDKA 4BV6A 2BYBA 1N4WA 3GWFA 4GRTA 1MOKA 4AP3A 2BACA 3GDNA
chains in the Genus database with same CATH topology
4EQRA 3AE2A 4REKA 2BS2A 2GH5A 3II4A 5ER0A 1L0VA 3AE1A 3CIRA 4GDPA 5EOWA 1B4VA 4EM4A 4OPUA 4X4JA 3C4AA 2XLSA 3Q9TA 1GRGA 1PXBA 1GT8A 4H2NA 1LQTA 4G74A 2RGJA 4EQWA 4D04A 2V3AA 4EM3A 4OCGA 2X50A 1TDOA 4H4RA 3IC9A 4A65A 3I3LA 2BK3A 5M0ZA 4B69A 5U25A 3COXA 2B9YA 1P2EA 3FMWA 3T14A 1EBDA 1CC2A 5KVIA 3EANA 2F5ZA 4JN9A 2FJDA 5GRTA 1IUWA 4K22A 4BURA 5HXIA 3GYXA 1E1KA 1E1LA 1LJ1A 1XANA 2GR2A 4JQ9A 5JCKA 2RGHA 4B66A 3VQRA 4O5UA 1N4UA 4TM1A 2VRMA 3L1RA 3LOVA 2TPRA 4A7AA 1PJ5A 3DGZA 3NRNA 3QFAA 2YWLA 3P4QA 4NTCA 2FJEA 1ONFA 4Z44A 5C3JA 1O95A 3URHA 5KWFA 3DH9A 1ZK7A 3UP5A 1CHUA 1NHRA 2DKHA 3PO7A 4LA1A 3AE3A 2WQYA 4NEWA 3SX6A 1FECA 1QO8A 3DK8A 3QVPA 1D7LA 2IIDA 3BI2A 5KNLA 4PABA 4YTNA 2QAEA 4DSGA 4MJWA 5BVAA 2OLNA 4KX6A 2XVEA 3AWIA 1IUUA 1H7WA 2ZZ0A 2HQMA 2YLWA 3FIMB 2FBWA 4UDQA 3AXBA 1F8RA 3SZCA 2B7RA 3AEDA 1YKJA 2WU2A 1F6MA 3AE8A 4GUVA 2XLPA 4YTMA 4AP1A 4C3XA 3CNJA 4IV9A 1KNRA 4TLZA 3VR9A 4G6HA 4YSYA 2XFNA 1XHCA 3GYIA 2JB2A 4GDEA 2A87A 4DNAA 2BCPA 4PAAA 2YQUA 2WOIA 3P9UA 2GMHA 4IA5A 1IUSA 3AYJA 1KF6A 1O94A 1M6IA 1TDEA 2WDVA 4TM3A 3E1TA 3JSKA 1GRBA 2C73A 4KPRA 2BRAA 1PHHA 3LADA 1EL5A 1CC6A 3VRDB 5IPYA 1VQWA 1KSSA 3BI4A 4G73A 4USRA 3GYJA 2YAUA 3RP6A 3SZ0A 4U8KA 2TMDA 2YR6A 3SYIA 2ARDA 2X3NA 1JNRA 3PS9A 3CNTA 1DNCA 1X31B 3NYEA 1GETA 2AAQA 4H4TA 3HYXA 4HA6A 3T2YA 4U8LA 2OAMA 1PDHA 2C65A 4WX1A 2X8CA 3DJDA 1D4DA 4H2RA 2Y6RA 2BABA 1PXAA 1H82A 4JY2A 2CFYA 1K0LA 1Q1WA 2IVDA 3NNEA 3GDPA 5KMPA 4YT0A 2YLXA 1TYPA 1GTHA 1L9CA 1NHPA 1BGJA 1TDNA 2RABA 3G5QA 1ZOVA 4U8OA 2ACZA 1D7YA 1MO9A 1OJCA 3KA7A 5CKUA 3GWDA 2GAHB 1B37A 2YLRA 3LZXA 4H4WA 1IUTA 2WU5A 2JAEA 4H4UA 1FOHA 1YQ3A 3ATRA 5KVHA 5C2TA 1Q1RA 1H7XA 1GERA 4IVOB 3AE6A 4GAPA 1KFYA 4K7ZA 2GF3A 1N1PA 2BK5A 2VQ7A 3M0OA 4EQSA 5J60A 2GQWA 3CPIG 3SQPA 3H8IA 2BK4A 2R45A 4M52A 4U8MA 1NEKA 1GRTA 3IWAA 1F8SA 1K0JA 1DOBA 3AECA 1CL0A 3KKJA 2WOWA 3FG2P 4C3YA 3BI5A 2OA1A 1GRAA 4OVIA 1TRBA 4J36A 1BWCA 1MXTA 2Q7VA 3CPJG 3VRBA 2C3DA 2VVLG 1S3BA 4AT2A 2JKCA 3O0HA 3GD3A 1GALA 3DJJA 3UP4A 3NGCX 2DKIA 4OPTA 3K7MX 4GF7A 2FJBA 3CNSA 4NNJA 4X9NA 1COYA 3ALLA 2XLRA 4ADWA 1NDAA 3DJEA 2WETA 3LZWA 3KLJA 2E4GA 1LV0A 4UP3A 2Z5YA 4H2PA 4RSLA 4Z2TA 1LQUA 1Q9IA 3GSIA 2A8XA 2E1MA 4IVMB 4O5QA 2YG4A 3NHOX 2YVJA 4A5LA 1V59A 5IQ1A 4AOSA 4HB9A 3CGDA 5HHFA 3BHFA 1E7PA 4P9SA 1TDFA 1ZY8A 3UKLA 1ZMCA 3V3NA 4J34A 1RYIA 3CGBA 1RSGA 3QSSA 2OALA 3F8DA 3P1WA 1PS9A 3ALMA 4Z25A 1K0IA 5HY5A 5JCMA 3AB1A 5KMRA 4OPCA 1DOCA 3KPKA 4CY8A 1ELIA 3UCLA 4B1BA 3GMCA 3QFBA 3UKAA 1NHQA 3AEEA 4YSZA 1GEUA 3VRAA 3ABVA 5BRTA 2C66A 2BXSA 2IVEA 2Z5XA 4EQXA 3B3RA 1O5WA 1PBCA 3QSMA 1ZMDA 1GXFA 3H8LA 3UTGA 2YLTA 2JBVA 4EMJA 4ECHA 1DJNA 5U63A 1BF3A 2WOVA 4ICYA 4EIQA 5KOWA 1HYUA 2WESA 2CDUA 2VQBA 4NZHA 3UKKA 4BJYA 3AE4A 1REOA 1IUVA 2BC1A 3AD8B 2O9ZA 3SM8A 3K30A 3KPFA 3T2KA 4YSHA 4XXGA 4YSXA 1JNZA 3CNDA 4H4XA 3NN0X 1E39A 4FX9A 3NK0X 4GCMA 3UOZA 2AR8A 2XFPA 2NVKX 1GRFA 3K7QX 1GV4A 2EQ8A 1FEBA 1JOAA 2QA1A 2GB0A 3DK9A 4J56A 3UTHA 4BJZA 3VR8A 1OJTA 2CULA 2B76A 4U8NA 2GR3A 4FK1A 2BC0A 2H88A 3QSEA 1JRYA 1Y0PA 1NG4A 2V5ZA 2YR4A 3NKSA 4D03A 4OPIA 1EL9A 4U2TA 2VVMA 4A79A 1N4VA 1EL8A 2BS3A 1W4XA 2B7SA 2YM1A 4U8JA 1KSUA 4TLXA 5EB5A 3V3OA 4YXDA 3SY4A 4K5SA 1PJ7A 3P4RA 2VVLA 4ZN0A 1H86A 4DGKA 4JNAA 4YKGA 4AT0A 2GRTA 4I59A 3QVRA 3NIXA 2YLZA 3NN6X 1ZDLA 2QCUA 1L9EA 4C74A 1FL2A 2PYXA 2YG3A 4NTDA 2GEWA 1H84A 3CPHG 3FBSA 3T0KA 1PN0A 2R4JA 1QJDA 3AE9A 1CJCA 3EF6A 5JCLA 3AEGA 4A6NB 5M10A 4K2XA 5FS8A 4Y4NA 2R46A 3FPZA 3B6DA 1NG3A 2YR5A 4JY3A 4NTEA 3NYFA 4B67A 1PJ6A 3UTFA 3SGLA 2YG5A 3WE0A 2YG7A 3ISHA 3SZWA 3AEAA 4RG3A 2WBAA 3G5RA 4GR1A 4U8IA 1CF3A 2YG6A 2YVGA 3AYIA 2Q6UA 3CGEA 5KXJA 4BK3A 2C64A 2JK6A 3AE7A 3LB8A 5JCNA 2JB1A 3F8RA 2GVCA 2H89A 2WP9A 4U2LA 1KNPA 2A89A 4U2SA 4H50A 1H83A 2C70A 1YQZA 2WEUA 2WPEA 3ICRA 3NTDA 4RG4A 3T37A 4APNA 4AOXA 3NG7X 3NTAA 4Z43A 2WP6A 3NK2X 4U8PA 4C77A 1DJQA 5BULA 1LPFA 2C75A 3ICSA 4YWOA 1GREA 1LVLA 3S61A 1FCDA 2WHDA 4E0VA 4XWZA 1PXCA 1B8SA 4A6NA 4H4QA 2JB3A 4X9MA 1D4CA 1DODA 3L8KA 2Q0LA 3IHMA 3NLCA 1NHSA 2C72A 1PBDA 3HYWA 1D4EA 1ZP0A 1ZOYA 3HZLA 3PVCA 3GRSA 4Y4LA 3UOYA 4JNQA 2XLTA 5KOXA 3ADAB 3F8PA 3UOVA 3NK1X 1CJ3A 3K7TA 2WP5A 3CTYA 4DSHA 1NENA 1NAAA 2GQFA 1CJ2A 2XCGA 4ZCDA 4BK2A 5L46A 3IF9A 1FEAA 2B9XA 2V6OA 4TM4A 2E5VA 2C7GA 3M13A 1P2HA 4H4ZA 2V60A 2J3NA 4J2WA 4YTPA 2CVJA 3T2ZA 4N9XA 1IUXA 1RP0A 3LJPA 4FK1C 3R9UA 3M12A 4YKFA 4NWZA 1L9DA 4LIIA 5EBKA 2X99A 1DXLA 4NEVA 1ZX9A 3AD7B 1JEHA 2XVJA 4J57A 3EPTA 1Y56B 4EMWA 1XPQA 4OPDA 3UTEA 5J7XA 2R0GA 5FS9A 5BUKA 3DMEA 3OC4A 2APGA 1M64A 1GPEA 2WS3A 4TM0A 1GSNA 4B65A 2XVIA 3G5SA 1LTXR 4USQA 5JCIA 1S2QA 2QA2A 2VOUA 1NPXA 3AEFA 4II3A 4K8DA 3REDA 4Y4MA 1JRZA 4B68A 2ZZBA 3UOXA 2WDRA 4G9KA 2BCGG 3DJGX 2BRYA 4H4VA 4OPGA 3SXIA 5GSNA 1PBFA 3UKHA 3ITJA 3V76A 4A99A 2XLUA 2GAGB 3GD4A 5KMQA 1BKWA 1PBEA 2X8HA 3KD9A 2BA9A 2ZZCA 3SFEA 2C4CA 3AE5A 1B5QA 2EQ6A 3UKFA 2FJAA 3EAOA 4H4PA 2RGOA 3SFDA 1CBOA 1Z6LA 1OJ9A 1Y56A 5KMSA 1H6VA 5TR3A 5DBJA 3ATQA 4II2A 3RNMA 3RHAA 4Z2UA 3UKQA 2GV8A 3ALJA 1E1MA 1KDGA 1XDIA 1AOGA 2YM2A 3NYCA 1E6EA 3BNMA 1DOEA 2I0ZA 1F3PA 3DK4A 3S5WA 2Y6QA 2XFQA 3CGCA 3RP7A 3GMBA 5LV9A 3BHKA 5EB4A 2GMJA 1OJAA 5CQFA 2B9WA 4K5RA 2XFOA 4CBQA 1EL7A 1GRHA 3KU9A 1H81A 3ICTA 2EQ9A 3LXDA 2VZ2A 1VDCA 2XVHA 4GAVA 1ZKQA 4IA6A 4JDRA 3CNPA 2OLOA 3KVEA 3AYLA 4G6GA 3D8XA 5HYMA 4EMIA 4Z24A 2WDQA 2XYOA 1GOSA 2XVFA 3C4NA 1SEZA 3IHGA 5KRQA 4FDCB 4H2QA 4XWRA 2WPFA 2R9ZA 3T31A 3AD9B 4H4SA 4OPLA 1S3EA 2UZZA 2C3CA 3BNUA 4C5OA 3QJ4A 1BZLA 2BXRA 2XDOA 3OZ2A 5FMHA 4LU6A 2R4EA 2V61A 3D1CA 1QLBA 3C96A 2AQJA 4Z26A 2R0PA 1JU2A 1VRQB 3P4SA 1F8WA 2BS4A 2X8GA 1JRXA 2YVFA 3HYVA 2GR0A 4ZCCA 3ZYXA 4CCRA 1VG9A 1YQ4A 5FS7A 1UKVG 5IQ4A 4UDRA 2YLSA 3DA1A 1GESA 4CNJA 4A9WA 3DGHA 3CN8A 4I58A 4BK1A 1S2YA 2EQ7A 2Q0KA 3GRTA 1BGNA 2PHHA 4B64A 4CCQA 4CRTA 4CY6A 2C76A 2GR1A 4EIPA 4J33A 4CNKA 3RP8A 3UKPA 2R0CA 3H4KA 4UDPA 4WCTA 4J31A 1D5TA 4B63A 3I6DA 1OJDA 1VG0A 2NPXA 3NT6A 4H4YA 1YY5A 1E1NA 2WPCA 5FS6A 2W0HA 4H7UA 1GTEA 3SZFA 3P4PA 3ZDNA 4Z2RA 2XFUA 3NH3X 1PBBA 1TYTA 1CJ4A 2C67A 3Q6JA 1GNDA 3CMMA 3AEBA 1K4QA 1IJHA 2V3BA 2VRLA 2ZBWA 1CC4A 5U1OA 1TDKA 4BV6A 2BYBA 1N4WA 3GWFA 4GRTA 1MOKA 4AP3A 2BACA 3GDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQR A;  3AE2 A;  4REK A;  2BS2 A;  2GH5 A;  3II4 A;  5ER0 A;  1L0V A;  3AE1 A;  3CIR A;  4GDP A;  5EOW A;  1B4V A;  4EM4 A;  4OPU A;  4X4J A;  3C4A A;  2XLS A;  3Q9T A;  1GRG A;  1PXB A;  1GT8 A;  4H2N A;  1LQT A;  2RGJ A;  4EQW A;  4D04 A;  2V3A A;  4EM3 A;  4OCG A;  2X50 A;  1TDO A;  4H4R A;  3IC9 A;  4A65 A;  3I3L A;  2BK3 A;  5M0Z A;  4B69 A;  5U25 A;  3COX A;  2B9Y A;  1P2E A;  3FMW A;  1EBD A;  1CC2 A;  5KVI A;  3EAN A;  2F5Z A;  4JN9 A;  2FJD A;  5GRT A;  1IUW A;  4K22 A;  4BUR A;  5HXI A;  5JCK A;  1E1K A;  1E1L A;  1LJ1 A;  1XAN A;  2GR2 A;  4JQ9 A;  2RGH A;  4B66 A;  3VQR A;  4O5U A;  1N4U A;  4TM1 A;  2VRM A;  3L1R A;  3LOV A;  2TPR A;  4A7A A;  1PJ5 A;  3DGZ A;  3NRN A;  3QFA A;  2YWL A;  3P4Q A;  4NTC A;  2FJE A;  1ONF A;  4Z44 A;  5C3J A;  1O95 A;  3URH A;  5KWF A;  3DH9 A;  1ZK7 A;  3UP5 A;  1CHU A;  1NHR A;  2DKH A;  3PO7 A;  4LA1 A;  3AE3 A;  2WQY A;  4NEW A;  1FEC A;  1QO8 A;  3DK8 A;  3QVP A;  1D7L A;  2IID A;  3BI2 A;  4PAB A;  4YTN A;  2QAE A;  4DSG A;  4MJW A;  5BVA A;  2OLN A;  4KX6 A;  2XVE A;  3AWI A;  1IUU A;  1H7W A;  2ZZ0 A;  2HQM A;  2YLW A;  3FIM B;  2FBW A;  4UDQ A;  3AXB A;  1F8R A;  2B7R A;  3AED A;  1YKJ A;  2WU2 A;  1F6M A;  3AE8 A;  4GUV A;  2XLP A;  4YTM A;  4AP1 A;  4C3X A;  3CNJ A;  4IV9 A;  1KNR A;  4TLZ A;  3VR9 A;  4YSY A;  2XFN A;  1XHC A;  3GYI A;  2JB2 A;  4GDE A;  2A87 A;  4DNA A;  2BCP A;  4PAA A;  2YQU A;  2WOI A;  3P9U A;  2GMH A;  4IA5 A;  1IUS A;  3AYJ A;  1KF6 A;  1O94 A;  1M6I A;  1TDE A;  2WDV A;  4TM3 A;  3E1T A;  3JSK A;  1GRB A;  2C73 A;  4KPR A;  1PHH A;  3LAD A;  1EL5 A;  1CC6 A;  3VRD B;  5IPY A;  1VQW A;  1KSS A;  3BI4 A;  3RP6 A;  4USR A;  3GYJ A;  2YAU A;  4U8K A;  2TMD A;  2YR6 A;  2ARD A;  2X3N A;  1JNR A;  3PS9 A;  3CNT A;  1DNC A;  1X31 B;  3NYE A;  1GET A;  2AAQ A;  4H4T A;  4HA6 A;  4U8L A;  2OAM A;  1PDH A;  2C65 A;  4WX1 A;  2X8C A;  3DJD A;  1D4D A;  4H2R A;  2Y6R A;  2BAB A;  1PXA A;  1H82 A;  4JY2 A;  2CFY A;  1K0L A;  1Q1W A;  2IVD A;  3NNE A;  3GDP A;  4YT0 A;  2YLX A;  1TYP A;  1GTH A;  1L9C A;  1NHP A;  1BGJ A;  1TDN A;  2RAB A;  3G5Q A;  1ZOV A;  4U8O A;  2ACZ A;  1D7Y A;  1MO9 A;  1OJC A;  3KA7 A;  5CKU A;  3GWD A;  2GAH B;  1B37 A;  2YLR A;  3LZX A;  4H4W A;  1IUT A;  2WU5 A;  2JAE A;  4H4U A;  1FOH A;  1YQ3 A;  3ATR A;  5KVH A;  5C2T A;  1Q1R A;  1H7X A;  1GER A;  4IVO B;  3AE6 A;  1KFY A;  4K7Z A;  2GF3 A;  1N1P A;  2BK5 A;  2VQ7 A;  3M0O A;  4EQS A;  5J60 A;  2GQW A;  3CPI G;  3SQP A;  3H8I A;  2BK4 A;  2R45 A;  4M52 A;  4U8M A;  1NEK A;  1GRT A;  3IWA A;  1F8S A;  1K0J A;  1DOB A;  3AEC A;  1CL0 A;  3KKJ A;  2WOW A;  3FG2 P;  4C3Y A;  3BI5 A;  2OA1 A;  1GRA A;  4OVI A;  1TRB A;  4J36 A;  1BWC A;  1MXT A;  2Q7V A;  3CPJ G;  3VRB A;  2C3D A;  2VVL G;  1S3B A;  4AT2 A;  2JKC A;  3O0H A;  3GD3 A;  1GAL A;  3DJJ A;  3UP4 A;  3NGC X;  2DKI A;  4OPT A;  3K7M X;  4GF7 A;  2FJB A;  3CNS A;  4X9N A;  1COY A;  3ALL A;  2XLR A;  4ADW A;  1NDA A;  3DJE A;  2WET A;  3LZW A;  3KLJ A;  2E4G A;  1LV0 A;  4UP3 A;  2Z5Y A;  4H2P A;  4RSL A;  4Z2T A;  1LQU A;  1Q9I A;  3GSI A;  2A8X A;  2E1M A;  4IVM B;  4O5Q A;  2YG4 A;  3NHO X;  2YVJ A;  4A5L A;  1V59 A;  5IQ1 A;  4AOS A;  4HB9 A;  3CGD A;  5HHF A;  3BHF A;  1E7P A;  4P9S A;  1TDF A;  1ZY8 A;  3UKL A;  1ZMC A;  3V3N A;  4J34 A;  1RYI A;  3CGB A;  1RSG A;  3QSS A;  2OAL A;  3F8D A;  3P1W A;  1PS9 A;  3ALM A;  4Z25 A;  1K0I A;  5HY5 A;  5JCM A;  3AB1 A;  4OPC A;  1DOC A;  4CY8 A;  1ELI A;  3UCL A;  4B1B A;  3GMC A;  3QFB A;  3UKA A;  1NHQ A;  3AEE A;  4YSZ A;  1GEU A;  3VRA A;  3ABV A;  5BRT A;  2C66 A;  2BXS A;  2IVE A;  2Z5X A;  4EQX A;  3B3R A;  1O5W A;  1PBC A;  3QSM A;  1ZMD A;  1GXF A;  3H8L A;  3UTG A;  2YLT A;  2JBV A;  4EMJ A;  4ECH A;  1DJN A;  5U63 A;  1BF3 A;  2WOV A;  4ICY A;  4EIQ A;  5KOW A;  1HYU A;  2WES A;  2CDU A;  2VQB A;  4NZH A;  3UKK A;  4BJY A;  3AE4 A;  1REO A;  1IUV A;  2BC1 A;  3AD8 B;  2O9Z A;  3SM8 A;  3K30 A;  3KPF A;  4YSH A;  4XXG A;  4YSX A;  1JNZ A;  3CND A;  4H4X A;  3NN0 X;  1E39 A;  4FX9 A;  3NK0 X;  4GCM A;  3UOZ A;  2AR8 A;  2XFP A;  2NVK X;  1GRF A;  3K7Q X;  1GV4 A;  2EQ8 A;  1FEB A;  1JOA A;  2QA1 A;  2GB0 A;  3DK9 A;  4J56 A;  3UTH A;  4BJZ A;  3VR8 A;  1OJT A;  2CUL A;  2B76 A;  4U8N A;  2GR3 A;  4FK1 A;  2BC0 A;  2H88 A;  3QSE A;  1JRY A;  1Y0P A;  1NG4 A;  2V5Z A;  2YR4 A;  3NKS A;  4D03 A;  4OPI A;  1EL9 A;  4U2T A;  2VVM A;  4A79 A;  1N4V A;  1EL8 A;  2BS3 A;  1W4X A;  2B7S A;  2YM1 A;  4U8J A;  1KSU A;  4TLX A;  5EB5 A;  3V3O A;  4YXD A;  4K5S A;  1PJ7 A;  3P4R A;  2VVL A;  4ZN0 A;  1H86 A;  4DGK A;  4JNA A;  4YKG A;  4AT0 A;  2GRT A;  4I59 A;  3QVR A;  3NIX A;  2YLZ A;  3NN6 X;  1ZDL A;  2QCU A;  1L9E A;  4C74 A;  1FL2 A;  2PYX A;  2YG3 A;  4NTD A;  2GEW A;  1H84 A;  3CPH G;  3FBS A;  1PN0 A;  2R4J A;  1QJD A;  3AE9 A;  1CJC A;  3EF6 A;  5JCL A;  3AEG A;  4A6N B;  5M10 A;  4K2X A;  5FS8 A;  4Y4N A;  2R46 A;  3FPZ A;  3B6D A;  1NG3 A;  2YR5 A;  4JY3 A;  4NTE A;  3NYF A;  4B67 A;  1PJ6 A;  3UTF A;  3SGL A;  2YG5 A;  3WE0 A;  2YG7 A;  3ISH A;  3AEA A;  4RG3 A;  2WBA A;  3G5R A;  4GR1 A;  4U8I A;  1CF3 A;  2YG6 A;  2YVG A;  3AYI A;  2Q6U A;  3CGE A;  5KXJ A;  4BK3 A;  2C64 A;  2JK6 A;  3AE7 A;  3LB8 A;  5JCN A;  2JB1 A;  3F8R A;  2GVC A;  2H89 A;  2WP9 A;  4U2L A;  1KNP A;  2A89 A;  4U2S A;  4H50 A;  1H83 A;  2C70 A;  1YQZ A;  2WEU A;  2WPE A;  3ICR A;  3NTD A;  4RG4 A;  3T37 A;  4APN A;  4AOX A;  3NG7 X;  3NTA A;  4Z43 A;  2WP6 A;  3NK2 X;  4U8P A;  4C77 A;  1DJQ A;  5BUL A;  1LPF A;  2C75 A;  3ICS A;  4YWO A;  1GRE A;  1LVL A;  3S61 A;  1FCD A;  2WHD A;  4E0V A;  4XWZ A;  1PXC A;  1B8S A;  4A6N A;  4H4Q A;  2JB3 A;  4X9M A;  1D4C A;  1DOD A;  3L8K A;  2Q0L A;  3IHM A;  3NLC A;  1NHS A;  2C72 A;  1PBD A;  1D4E A;  1ZP0 A;  1ZOY A;  3HZL A;  3PVC A;  3GRS A;  4Y4L A;  3UOY A;  4JNQ A;  2XLT A;  5KOX A;  3ADA B;  3F8P A;  3UOV A;  3NK1 X;  1CJ3 A;  3K7T A;  2WP5 A;  3CTY A;  4DSH A;  1NEN A;  1NAA A;  2GQF A;  1CJ2 A;  2XCG A;  4ZCD A;  4BK2 A;  5L46 A;  3IF9 A;  1FEA A;  2B9X A;  2V6O A;  4TM4 A;  2E5V A;  2C7G A;  3M13 A;  1P2H A;  4H4Z A;  2V60 A;  2J3N A;  4J2W A;  4YTP A;  2CVJ A;  4N9X A;  1IUX A;  1RP0 A;  3LJP A;  4FK1 C;  3R9U A;  3M12 A;  4YKF A;  1L9D A;  4LII A;  5EBK A;  2X99 A;  1DXL A;  4NEV A;  1ZX9 A;  3AD7 B;  1JEH A;  2XVJ A;  4J57 A;  3EPT A;  1Y56 B;  4EMW A;  1XPQ A;  4OPD A;  3UTE A;  5J7X A;  2R0G A;  5FS9 A;  5BUK A;  3DME A;  3OC4 A;  2APG A;  1M64 A;  1GPE A;  2WS3 A;  4TM0 A;  1GSN A;  4B65 A;  2XVI A;  3G5S A;  1LTX R;  4USQ A;  5JCI A;  1S2Q A;  2QA2 A;  2VOU A;  1NPX A;  3AEF A;  4K8D A;  3RED A;  4Y4M A;  1JRZ A;  4B68 A;  2ZZB A;  3UOX A;  2WDR A;  2BCG G;  3DJG X;  4H4V A;  4OPG A;  5GSN A;  1PBF A;  3UKH A;  3ITJ A;  3V76 A;  4A99 A;  2XLU A;  2GAG B;  3GD4 A;  1BKW A;  1PBE A;  2X8H A;  3KD9 A;  2BA9 A;  2ZZC A;  3SFE A;  3AE5 A;  1B5Q A;  2EQ6 A;  3UKF A;  2FJA A;  3EAO A;  4H4P A;  2RGO A;  3SFD A;  1CBO A;  1Z6L A;  1OJ9 A;  1Y56 A;  1H6V A;  5TR3 A;  5DBJ A;  3ATQ A;  3RNM A;  3RHA A;  4Z2U A;  3UKQ A;  2GV8 A;  3ALJ A;  1E1M A;  1KDG A;  1XDI A;  1AOG A;  2YM2 A;  3NYC A;  1E6E A;  3BNM A;  1DOE A;  2I0Z A;  1F3P A;  3DK4 A;  3S5W A;  2Y6Q A;  2XFQ A;  3CGC A;  3RP7 A;  3GMB A;  5LV9 A;  3BHK A;  5EB4 A;  2GMJ A;  1OJA A;  5CQF A;  2B9W A;  4K5R A;  2XFO A;  4CBQ A;  1EL7 A;  1GRH A;  3KU9 A;  1H81 A;  3ICT A;  2EQ9 A;  3LXD A;  2VZ2 A;  1VDC A;  2XVH A;  1ZKQ A;  4IA6 A;  4JDR A;  3CNP A;  2OLO A;  3KVE A;  3AYL A;  5HYM A;  3D8X A;  4EMI A;  4Z24 A;  2WDQ A;  2XYO A;  1GOS A;  2XVF A;  3C4N A;  1SEZ A;  3IHG A;  5KRQ A;  4FDC B;  4H2Q A;  4XWR A;  2WPF A;  2R9Z A;  3AD9 B;  4H4S A;  4OPL A;  1S3E A;  2UZZ A;  2C3C A;  3BNU A;  4C5O A;  3QJ4 A;  1BZL A;  2BXR A;  2XDO A;  3OZ2 A;  5FMH A;  4LU6 A;  2R4E A;  2V61 A;  3D1C A;  1QLB A;  3C96 A;  2AQJ A;  4Z26 A;  2R0P A;  1JU2 A;  1VRQ B;  3P4S A;  1F8W A;  2BS4 A;  2X8G A;  1JRX A;  2YVF A;  4ZCC A;  2GR0 A;  3ZYX A;  4CCR A;  1VG9 A;  1YQ4 A;  5FS7 A;  1UKV G;  5IQ4 A;  4UDR A;  2YLS A;  3DA1 A;  1GES A;  4CNJ A;  4A9W A;  3DGH A;  3CN8 A;  4I58 A;  4BK1 A;  1S2Y A;  2EQ7 A;  2Q0K A;  3GRT A;  1BGN A;  2PHH A;  4B64 A;  4CCQ A;  4CRT A;  4CY6 A;  2C76 A;  2GR1 A;  4EIP A;  4J33 A;  4CNK A;  3RP8 A;  3UKP A;  2R0C A;  3H4K A;  4UDP A;  4WCT A;  4J31 A;  1D5T A;  4B63 A;  3I6D A;  1OJD A;  1VG0 A;  2NPX A;  3NT6 A;  4H4Y A;  1YY5 A;  1E1N A;  2WPC A;  5FS6 A;  2W0H A;  4H7U A;  1GTE A;  3ZDN A;  3P4P A;  4Z2R A;  2XFU A;  3NH3 X;  1PBB A;  1TYT A;  1CJ4 A;  2C67 A;  3Q6J A;  1GND A;  3AEB A;  1K4Q A;  1IJH A;  2V3B A;  2VRL A;  2ZBW A;  1CC4 A;  5U1O A;  1TDK A;  4BV6 A;  2BYB A;  1N4W A;  3GWF A;  4GRT A;  1MOK A;  4AP3 A;  2BAC A;  3GDN A; 
#chains in the Genus database with same CATH topology
 4EQR A;  3AE2 A;  4REK A;  2BS2 A;  2GH5 A;  3II4 A;  5ER0 A;  1L0V A;  3AE1 A;  3CIR A;  4GDP A;  5EOW A;  1B4V A;  4EM4 A;  4OPU A;  4X4J A;  3C4A A;  2XLS A;  3Q9T A;  1GRG A;  1PXB A;  1GT8 A;  4H2N A;  1LQT A;  4G74 A;  2RGJ A;  4EQW A;  4D04 A;  2V3A A;  4EM3 A;  4OCG A;  2X50 A;  1TDO A;  4H4R A;  3IC9 A;  4A65 A;  3I3L A;  2BK3 A;  5M0Z A;  4B69 A;  5U25 A;  3COX A;  2B9Y A;  1P2E A;  3FMW A;  3T14 A;  1EBD A;  1CC2 A;  5KVI A;  3EAN A;  2F5Z A;  4JN9 A;  2FJD A;  5GRT A;  1IUW A;  4K22 A;  4BUR A;  5HXI A;  3GYX A;  1E1K A;  1E1L A;  1LJ1 A;  1XAN A;  2GR2 A;  4JQ9 A;  5JCK A;  2RGH A;  4B66 A;  3VQR A;  4O5U A;  1N4U A;  4TM1 A;  2VRM A;  3L1R A;  3LOV A;  2TPR A;  4A7A A;  1PJ5 A;  3DGZ A;  3NRN A;  3QFA A;  2YWL A;  3P4Q A;  4NTC A;  2FJE A;  1ONF A;  4Z44 A;  5C3J A;  1O95 A;  3URH A;  5KWF A;  3DH9 A;  1ZK7 A;  3UP5 A;  1CHU A;  1NHR A;  2DKH A;  3PO7 A;  4LA1 A;  3AE3 A;  2WQY A;  4NEW A;  3SX6 A;  1FEC A;  1QO8 A;  3DK8 A;  3QVP A;  1D7L A;  2IID A;  3BI2 A;  5KNL A;  4PAB A;  4YTN A;  2QAE A;  4DSG A;  4MJW A;  5BVA A;  2OLN A;  4KX6 A;  2XVE A;  3AWI A;  1IUU A;  1H7W A;  2ZZ0 A;  2HQM A;  2YLW A;  3FIM B;  2FBW A;  4UDQ A;  3AXB A;  1F8R A;  3SZC A;  2B7R A;  3AED A;  1YKJ A;  2WU2 A;  1F6M A;  3AE8 A;  4GUV A;  2XLP A;  4YTM A;  4AP1 A;  4C3X A;  3CNJ A;  4IV9 A;  1KNR A;  4TLZ A;  3VR9 A;  4G6H A;  4YSY A;  2XFN A;  1XHC A;  3GYI A;  2JB2 A;  4GDE A;  2A87 A;  4DNA A;  2BCP A;  4PAA A;  2YQU A;  2WOI A;  3P9U A;  2GMH A;  4IA5 A;  1IUS A;  3AYJ A;  1KF6 A;  1O94 A;  1M6I A;  1TDE A;  2WDV A;  4TM3 A;  3E1T A;  3JSK A;  1GRB A;  2C73 A;  4KPR A;  2BRA A;  1PHH A;  3LAD A;  1EL5 A;  1CC6 A;  3VRD B;  5IPY A;  1VQW A;  1KSS A;  3BI4 A;  4G73 A;  4USR A;  3GYJ A;  2YAU A;  3RP6 A;  3SZ0 A;  4U8K A;  2TMD A;  2YR6 A;  3SYI A;  2ARD A;  2X3N A;  1JNR A;  3PS9 A;  3CNT A;  1DNC A;  1X31 B;  3NYE A;  1GET A;  2AAQ A;  4H4T A;  3HYX A;  4HA6 A;  3T2Y A;  4U8L A;  2OAM A;  1PDH A;  2C65 A;  4WX1 A;  2X8C A;  3DJD A;  1D4D A;  4H2R A;  2Y6R A;  2BAB A;  1PXA A;  1H82 A;  4JY2 A;  2CFY A;  1K0L A;  1Q1W A;  2IVD A;  3NNE A;  3GDP A;  5KMP A;  4YT0 A;  2YLX A;  1TYP A;  1GTH A;  1L9C A;  1NHP A;  1BGJ A;  1TDN A;  2RAB A;  3G5Q A;  1ZOV A;  4U8O A;  2ACZ A;  1D7Y A;  1MO9 A;  1OJC A;  3KA7 A;  5CKU A;  3GWD A;  2GAH B;  1B37 A;  2YLR A;  3LZX A;  4H4W A;  1IUT A;  2WU5 A;  2JAE A;  4H4U A;  1FOH A;  1YQ3 A;  3ATR A;  5KVH A;  5C2T A;  1Q1R A;  1H7X A;  1GER A;  4IVO B;  3AE6 A;  4GAP A;  1KFY A;  4K7Z A;  2GF3 A;  1N1P A;  2BK5 A;  2VQ7 A;  3M0O A;  4EQS A;  5J60 A;  2GQW A;  3CPI G;  3SQP A;  3H8I A;  2BK4 A;  2R45 A;  4M52 A;  4U8M A;  1NEK A;  1GRT A;  3IWA A;  1F8S A;  1K0J A;  1DOB A;  3AEC A;  1CL0 A;  3KKJ A;  2WOW A;  3FG2 P;  4C3Y A;  3BI5 A;  2OA1 A;  1GRA A;  4OVI A;  1TRB A;  4J36 A;  1BWC A;  1MXT A;  2Q7V A;  3CPJ G;  3VRB A;  2C3D A;  2VVL G;  1S3B A;  4AT2 A;  2JKC A;  3O0H A;  3GD3 A;  1GAL A;  3DJJ A;  3UP4 A;  3NGC X;  2DKI A;  4OPT A;  3K7M X;  4GF7 A;  2FJB A;  3CNS A;  4NNJ A;  4X9N A;  1COY A;  3ALL A;  2XLR A;  4ADW A;  1NDA A;  3DJE A;  2WET A;  3LZW A;  3KLJ A;  2E4G A;  1LV0 A;  4UP3 A;  2Z5Y A;  4H2P A;  4RSL A;  4Z2T A;  1LQU A;  1Q9I A;  3GSI A;  2A8X A;  2E1M A;  4IVM B;  4O5Q A;  2YG4 A;  3NHO X;  2YVJ A;  4A5L A;  1V59 A;  5IQ1 A;  4AOS A;  4HB9 A;  3CGD A;  5HHF A;  3BHF A;  1E7P A;  4P9S A;  1TDF A;  1ZY8 A;  3UKL A;  1ZMC A;  3V3N A;  4J34 A;  1RYI A;  3CGB A;  1RSG A;  3QSS A;  2OAL A;  3F8D A;  3P1W A;  1PS9 A;  3ALM A;  4Z25 A;  1K0I A;  5HY5 A;  5JCM A;  3AB1 A;  5KMR A;  4OPC A;  1DOC A;  3KPK A;  4CY8 A;  1ELI A;  3UCL A;  4B1B A;  3GMC A;  3QFB A;  3UKA A;  1NHQ A;  3AEE A;  4YSZ A;  1GEU A;  3VRA A;  3ABV A;  5BRT A;  2C66 A;  2BXS A;  2IVE A;  2Z5X A;  4EQX A;  3B3R A;  1O5W A;  1PBC A;  3QSM A;  1ZMD A;  1GXF A;  3H8L A;  3UTG A;  2YLT A;  2JBV A;  4EMJ A;  4ECH A;  1DJN A;  5U63 A;  1BF3 A;  2WOV A;  4ICY A;  4EIQ A;  5KOW A;  1HYU A;  2WES A;  2CDU A;  2VQB A;  4NZH A;  3UKK A;  4BJY A;  3AE4 A;  1REO A;  1IUV A;  2BC1 A;  3AD8 B;  2O9Z A;  3SM8 A;  3K30 A;  3KPF A;  3T2K A;  4YSH A;  4XXG A;  4YSX A;  1JNZ A;  3CND A;  4H4X A;  3NN0 X;  1E39 A;  4FX9 A;  3NK0 X;  4GCM A;  3UOZ A;  2AR8 A;  2XFP A;  2NVK X;  1GRF A;  3K7Q X;  1GV4 A;  2EQ8 A;  1FEB A;  1JOA A;  2QA1 A;  2GB0 A;  3DK9 A;  4J56 A;  3UTH A;  4BJZ A;  3VR8 A;  1OJT A;  2CUL A;  2B76 A;  4U8N A;  2GR3 A;  4FK1 A;  2BC0 A;  2H88 A;  3QSE A;  1JRY A;  1Y0P A;  1NG4 A;  2V5Z A;  2YR4 A;  3NKS A;  4D03 A;  4OPI A;  1EL9 A;  4U2T A;  2VVM A;  4A79 A;  1N4V A;  1EL8 A;  2BS3 A;  1W4X A;  2B7S A;  2YM1 A;  4U8J A;  1KSU A;  4TLX A;  5EB5 A;  3V3O A;  4YXD A;  3SY4 A;  4K5S A;  1PJ7 A;  3P4R A;  2VVL A;  4ZN0 A;  1H86 A;  4DGK A;  4JNA A;  4YKG A;  4AT0 A;  2GRT A;  4I59 A;  3QVR A;  3NIX A;  2YLZ A;  3NN6 X;  1ZDL A;  2QCU A;  1L9E A;  4C74 A;  1FL2 A;  2PYX A;  2YG3 A;  4NTD A;  2GEW A;  1H84 A;  3CPH G;  3FBS A;  3T0K A;  1PN0 A;  2R4J A;  1QJD A;  3AE9 A;  1CJC A;  3EF6 A;  5JCL A;  3AEG A;  4A6N B;  5M10 A;  4K2X A;  5FS8 A;  4Y4N A;  2R46 A;  3FPZ A;  3B6D A;  1NG3 A;  2YR5 A;  4JY3 A;  4NTE A;  3NYF A;  4B67 A;  1PJ6 A;  3UTF A;  3SGL A;  2YG5 A;  3WE0 A;  2YG7 A;  3ISH A;  3SZW A;  3AEA A;  4RG3 A;  2WBA A;  3G5R A;  4GR1 A;  4U8I A;  1CF3 A;  2YG6 A;  2YVG A;  3AYI A;  2Q6U A;  3CGE A;  5KXJ A;  4BK3 A;  2C64 A;  2JK6 A;  3AE7 A;  3LB8 A;  5JCN A;  2JB1 A;  3F8R A;  2GVC A;  2H89 A;  2WP9 A;  4U2L A;  1KNP A;  2A89 A;  4U2S A;  4H50 A;  1H83 A;  2C70 A;  1YQZ A;  2WEU A;  2WPE A;  3ICR A;  3NTD A;  4RG4 A;  3T37 A;  4APN A;  4AOX A;  3NG7 X;  3NTA A;  4Z43 A;  2WP6 A;  3NK2 X;  4U8P A;  4C77 A;  1DJQ A;  5BUL A;  1LPF A;  2C75 A;  3ICS A;  4YWO A;  1GRE A;  1LVL A;  3S61 A;  1FCD A;  2WHD A;  4E0V A;  4XWZ A;  1PXC A;  1B8S A;  4A6N A;  4H4Q A;  2JB3 A;  4X9M A;  1D4C A;  1DOD A;  3L8K A;  2Q0L A;  3IHM A;  3NLC A;  1NHS A;  2C72 A;  1PBD A;  3HYW A;  1D4E A;  1ZP0 A;  1ZOY A;  3HZL A;  3PVC A;  3GRS A;  4Y4L A;  3UOY A;  4JNQ A;  2XLT A;  5KOX A;  3ADA B;  3F8P A;  3UOV A;  3NK1 X;  1CJ3 A;  3K7T A;  2WP5 A;  3CTY A;  4DSH A;  1NEN A;  1NAA A;  2GQF A;  1CJ2 A;  2XCG A;  4ZCD A;  4BK2 A;  5L46 A;  3IF9 A;  1FEA A;  2B9X A;  2V6O A;  4TM4 A;  2E5V A;  2C7G A;  3M13 A;  1P2H A;  4H4Z A;  2V60 A;  2J3N A;  4J2W A;  4YTP A;  2CVJ A;  3T2Z A;  4N9X A;  1IUX A;  1RP0 A;  3LJP A;  4FK1 C;  3R9U A;  3M12 A;  4YKF A;  4NWZ A;  1L9D A;  4LII A;  5EBK A;  2X99 A;  1DXL A;  4NEV A;  1ZX9 A;  3AD7 B;  1JEH A;  2XVJ A;  4J57 A;  3EPT A;  1Y56 B;  4EMW A;  1XPQ A;  4OPD A;  3UTE A;  5J7X A;  2R0G A;  5FS9 A;  5BUK A;  3DME A;  3OC4 A;  2APG A;  1M64 A;  1GPE A;  2WS3 A;  4TM0 A;  1GSN A;  4B65 A;  2XVI A;  3G5S A;  1LTX R;  4USQ A;  5JCI A;  1S2Q A;  2QA2 A;  2VOU A;  1NPX A;  3AEF A;  4II3 A;  4K8D A;  3RED A;  4Y4M A;  1JRZ A;  4B68 A;  2ZZB A;  3UOX A;  2WDR A;  4G9K A;  2BCG G;  3DJG X;  2BRY A;  4H4V A;  4OPG A;  3SXI A;  5GSN A;  1PBF A;  3UKH A;  3ITJ A;  3V76 A;  4A99 A;  2XLU A;  2GAG B;  3GD4 A;  5KMQ A;  1BKW A;  1PBE A;  2X8H A;  3KD9 A;  2BA9 A;  2ZZC A;  3SFE A;  2C4C A;  3AE5 A;  1B5Q A;  2EQ6 A;  3UKF A;  2FJA A;  3EAO A;  4H4P A;  2RGO A;  3SFD A;  1CBO A;  1Z6L A;  1OJ9 A;  1Y56 A;  5KMS A;  1H6V A;  5TR3 A;  5DBJ A;  3ATQ A;  4II2 A;  3RNM A;  3RHA A;  4Z2U A;  3UKQ A;  2GV8 A;  3ALJ A;  1E1M A;  1KDG A;  1XDI A;  1AOG A;  2YM2 A;  3NYC A;  1E6E A;  3BNM A;  1DOE A;  2I0Z A;  1F3P A;  3DK4 A;  3S5W A;  2Y6Q A;  2XFQ A;  3CGC A;  3RP7 A;  3GMB A;  5LV9 A;  3BHK A;  5EB4 A;  2GMJ A;  1OJA A;  5CQF A;  2B9W A;  4K5R A;  2XFO A;  4CBQ A;  1EL7 A;  1GRH A;  3KU9 A;  1H81 A;  3ICT A;  2EQ9 A;  3LXD A;  2VZ2 A;  1VDC A;  2XVH A;  4GAV A;  1ZKQ A;  4IA6 A;  4JDR A;  3CNP A;  2OLO A;  3KVE A;  3AYL A;  4G6G A;  3D8X A;  5HYM A;  4EMI A;  4Z24 A;  2WDQ A;  2XYO A;  1GOS A;  2XVF A;  3C4N A;  1SEZ A;  3IHG A;  5KRQ A;  4FDC B;  4H2Q A;  4XWR A;  2WPF A;  2R9Z A;  3T31 A;  3AD9 B;  4H4S A;  4OPL A;  1S3E A;  2UZZ A;  2C3C A;  3BNU A;  4C5O A;  3QJ4 A;  1BZL A;  2BXR A;  2XDO A;  3OZ2 A;  5FMH A;  4LU6 A;  2R4E A;  2V61 A;  3D1C A;  1QLB A;  3C96 A;  2AQJ A;  4Z26 A;  2R0P A;  1JU2 A;  1VRQ B;  3P4S A;  1F8W A;  2BS4 A;  2X8G A;  1JRX A;  2YVF A;  3HYV A;  2GR0 A;  4ZCC A;  3ZYX A;  4CCR A;  1VG9 A;  1YQ4 A;  5FS7 A;  1UKV G;  5IQ4 A;  4UDR A;  2YLS A;  3DA1 A;  1GES A;  4CNJ A;  4A9W A;  3DGH A;  3CN8 A;  4I58 A;  4BK1 A;  1S2Y A;  2EQ7 A;  2Q0K A;  3GRT A;  1BGN A;  2PHH A;  4B64 A;  4CCQ A;  4CRT A;  4CY6 A;  2C76 A;  2GR1 A;  4EIP A;  4J33 A;  4CNK A;  3RP8 A;  3UKP A;  2R0C A;  3H4K A;  4UDP A;  4WCT A;  4J31 A;  1D5T A;  4B63 A;  3I6D A;  1OJD A;  1VG0 A;  2NPX A;  3NT6 A;  4H4Y A;  1YY5 A;  1E1N A;  2WPC A;  5FS6 A;  2W0H A;  4H7U A;  1GTE A;  3SZF A;  3P4P A;  3ZDN A;  4Z2R A;  2XFU A;  3NH3 X;  1PBB A;  1TYT A;  1CJ4 A;  2C67 A;  3Q6J A;  1GND A;  3CMM A;  3AEB A;  1K4Q A;  1IJH A;  2V3B A;  2VRL A;  2ZBW A;  1CC4 A;  5U1O A;  1TDK A;  4BV6 A;  2BYB A;  1N4W A;  3GWF A;  4GRT A;  1MOK A;  4AP3 A;  2BAC A;  3GDN A; 
#chains in the Genus database with same CATH homology
 4EQR A;  3AE2 A;  4REK A;  2BS2 A;  2GH5 A;  3II4 A;  5ER0 A;  1L0V A;  3AE1 A;  3CIR A;  4GDP A;  5EOW A;  1B4V A;  4EM4 A;  4OPU A;  4X4J A;  3C4A A;  2XLS A;  3Q9T A;  1GRG A;  1PXB A;  1GT8 A;  4H2N A;  1LQT A;  4G74 A;  2RGJ A;  4EQW A;  4D04 A;  2V3A A;  4EM3 A;  4OCG A;  2X50 A;  1TDO A;  4H4R A;  3IC9 A;  4A65 A;  3I3L A;  2BK3 A;  5M0Z A;  4B69 A;  5U25 A;  3COX A;  2B9Y A;  1P2E A;  3FMW A;  3T14 A;  1EBD A;  1CC2 A;  5KVI A;  3EAN A;  2F5Z A;  4JN9 A;  2FJD A;  5GRT A;  1IUW A;  4K22 A;  4BUR A;  5HXI A;  3GYX A;  1E1K A;  1E1L A;  1LJ1 A;  1XAN A;  2GR2 A;  4JQ9 A;  5JCK A;  2RGH A;  4B66 A;  3VQR A;  4O5U A;  1N4U A;  4TM1 A;  2VRM A;  3L1R A;  3LOV A;  2TPR A;  4A7A A;  1PJ5 A;  3DGZ A;  3NRN A;  3QFA A;  2YWL A;  3P4Q A;  4NTC A;  2FJE A;  1ONF A;  4Z44 A;  5C3J A;  1O95 A;  3URH A;  5KWF A;  3DH9 A;  1ZK7 A;  3UP5 A;  1CHU A;  1NHR A;  2DKH A;  3PO7 A;  4LA1 A;  3AE3 A;  2WQY A;  4NEW A;  3SX6 A;  1FEC A;  1QO8 A;  3DK8 A;  3QVP A;  1D7L A;  2IID A;  3BI2 A;  5KNL A;  4PAB A;  4YTN A;  2QAE A;  4DSG A;  4MJW A;  5BVA A;  2OLN A;  4KX6 A;  2XVE A;  3AWI A;  1IUU A;  1H7W A;  2ZZ0 A;  2HQM A;  2YLW A;  3FIM B;  2FBW A;  4UDQ A;  3AXB A;  1F8R A;  3SZC A;  2B7R A;  3AED A;  1YKJ A;  2WU2 A;  1F6M A;  3AE8 A;  4GUV A;  2XLP A;  4YTM A;  4AP1 A;  4C3X A;  3CNJ A;  4IV9 A;  1KNR A;  4TLZ A;  3VR9 A;  4G6H A;  4YSY A;  2XFN A;  1XHC A;  3GYI A;  2JB2 A;  4GDE A;  2A87 A;  4DNA A;  2BCP A;  4PAA A;  2YQU A;  2WOI A;  3P9U A;  2GMH A;  4IA5 A;  1IUS A;  3AYJ A;  1KF6 A;  1O94 A;  1M6I A;  1TDE A;  2WDV A;  4TM3 A;  3E1T A;  3JSK A;  1GRB A;  2C73 A;  4KPR A;  2BRA A;  1PHH A;  3LAD A;  1EL5 A;  1CC6 A;  3VRD B;  5IPY A;  1VQW A;  1KSS A;  3BI4 A;  4G73 A;  4USR A;  3GYJ A;  2YAU A;  3RP6 A;  3SZ0 A;  4U8K A;  2TMD A;  2YR6 A;  3SYI A;  2ARD A;  2X3N A;  1JNR A;  3PS9 A;  3CNT A;  1DNC A;  1X31 B;  3NYE A;  1GET A;  2AAQ A;  4H4T A;  3HYX A;  4HA6 A;  3T2Y A;  4U8L A;  2OAM A;  1PDH A;  2C65 A;  4WX1 A;  2X8C A;  3DJD A;  1D4D A;  4H2R A;  2Y6R A;  2BAB A;  1PXA A;  1H82 A;  4JY2 A;  2CFY A;  1K0L A;  1Q1W A;  2IVD A;  3NNE A;  3GDP A;  5KMP A;  4YT0 A;  2YLX A;  1TYP A;  1GTH A;  1L9C A;  1NHP A;  1BGJ A;  1TDN A;  2RAB A;  3G5Q A;  1ZOV A;  4U8O A;  2ACZ A;  1D7Y A;  1MO9 A;  1OJC A;  3KA7 A;  5CKU A;  3GWD A;  2GAH B;  1B37 A;  2YLR A;  3LZX A;  4H4W A;  1IUT A;  2WU5 A;  2JAE A;  4H4U A;  1FOH A;  1YQ3 A;  3ATR A;  5KVH A;  5C2T A;  1Q1R A;  1H7X A;  1GER A;  4IVO B;  3AE6 A;  4GAP A;  1KFY A;  4K7Z A;  2GF3 A;  1N1P A;  2BK5 A;  2VQ7 A;  3M0O A;  4EQS A;  5J60 A;  2GQW A;  3CPI G;  3SQP A;  3H8I A;  2BK4 A;  2R45 A;  4M52 A;  4U8M A;  1NEK A;  1GRT A;  3IWA A;  1F8S A;  1K0J A;  1DOB A;  3AEC A;  1CL0 A;  3KKJ A;  2WOW A;  3FG2 P;  4C3Y A;  3BI5 A;  2OA1 A;  1GRA A;  4OVI A;  1TRB A;  4J36 A;  1BWC A;  1MXT A;  2Q7V A;  3CPJ G;  3VRB A;  2C3D A;  2VVL G;  1S3B A;  4AT2 A;  2JKC A;  3O0H A;  3GD3 A;  1GAL A;  3DJJ A;  3UP4 A;  3NGC X;  2DKI A;  4OPT A;  3K7M X;  4GF7 A;  2FJB A;  3CNS A;  4NNJ A;  4X9N A;  1COY A;  3ALL A;  2XLR A;  4ADW A;  1NDA A;  3DJE A;  2WET A;  3LZW A;  3KLJ A;  2E4G A;  1LV0 A;  4UP3 A;  2Z5Y A;  4H2P A;  4RSL A;  4Z2T A;  1LQU A;  1Q9I A;  3GSI A;  2A8X A;  2E1M A;  4IVM B;  4O5Q A;  2YG4 A;  3NHO X;  2YVJ A;  4A5L A;  1V59 A;  5IQ1 A;  4AOS A;  4HB9 A;  3CGD A;  5HHF A;  3BHF A;  1E7P A;  4P9S A;  1TDF A;  1ZY8 A;  3UKL A;  1ZMC A;  3V3N A;  4J34 A;  1RYI A;  3CGB A;  1RSG A;  3QSS A;  2OAL A;  3F8D A;  3P1W A;  1PS9 A;  3ALM A;  4Z25 A;  1K0I A;  5HY5 A;  5JCM A;  3AB1 A;  5KMR A;  4OPC A;  1DOC A;  3KPK A;  4CY8 A;  1ELI A;  3UCL A;  4B1B A;  3GMC A;  3QFB A;  3UKA A;  1NHQ A;  3AEE A;  4YSZ A;  1GEU A;  3VRA A;  3ABV A;  5BRT A;  2C66 A;  2BXS A;  2IVE A;  2Z5X A;  4EQX A;  3B3R A;  1O5W A;  1PBC A;  3QSM A;  1ZMD A;  1GXF A;  3H8L A;  3UTG A;  2YLT A;  2JBV A;  4EMJ A;  4ECH A;  1DJN A;  5U63 A;  1BF3 A;  2WOV A;  4ICY A;  4EIQ A;  5KOW A;  1HYU A;  2WES A;  2CDU A;  2VQB A;  4NZH A;  3UKK A;  4BJY A;  3AE4 A;  1REO A;  1IUV A;  2BC1 A;  3AD8 B;  2O9Z A;  3SM8 A;  3K30 A;  3KPF A;  3T2K A;  4YSH A;  4XXG A;  4YSX A;  1JNZ A;  3CND A;  4H4X A;  3NN0 X;  1E39 A;  4FX9 A;  3NK0 X;  4GCM A;  3UOZ A;  2AR8 A;  2XFP A;  2NVK X;  1GRF A;  3K7Q X;  1GV4 A;  2EQ8 A;  1FEB A;  1JOA A;  2QA1 A;  2GB0 A;  3DK9 A;  4J56 A;  3UTH A;  4BJZ A;  3VR8 A;  1OJT A;  2CUL A;  2B76 A;  4U8N A;  2GR3 A;  4FK1 A;  2BC0 A;  2H88 A;  3QSE A;  1JRY A;  1Y0P A;  1NG4 A;  2V5Z A;  2YR4 A;  3NKS A;  4D03 A;  4OPI A;  1EL9 A;  4U2T A;  2VVM A;  4A79 A;  1N4V A;  1EL8 A;  2BS3 A;  1W4X A;  2B7S A;  2YM1 A;  4U8J A;  1KSU A;  4TLX A;  5EB5 A;  3V3O A;  4YXD A;  3SY4 A;  4K5S A;  1PJ7 A;  3P4R A;  2VVL A;  4ZN0 A;  1H86 A;  4DGK A;  4JNA A;  4YKG A;  4AT0 A;  2GRT A;  4I59 A;  3QVR A;  3NIX A;  2YLZ A;  3NN6 X;  1ZDL A;  2QCU A;  1L9E A;  4C74 A;  1FL2 A;  2PYX A;  2YG3 A;  4NTD A;  2GEW A;  1H84 A;  3CPH G;  3FBS A;  3T0K A;  1PN0 A;  2R4J A;  1QJD A;  3AE9 A;  1CJC A;  3EF6 A;  5JCL A;  3AEG A;  4A6N B;  5M10 A;  4K2X A;  5FS8 A;  4Y4N A;  2R46 A;  3FPZ A;  3B6D A;  1NG3 A;  2YR5 A;  4JY3 A;  4NTE A;  3NYF A;  4B67 A;  1PJ6 A;  3UTF A;  3SGL A;  2YG5 A;  3WE0 A;  2YG7 A;  3ISH A;  3SZW A;  3AEA A;  4RG3 A;  2WBA A;  3G5R A;  4GR1 A;  4U8I A;  1CF3 A;  2YG6 A;  2YVG A;  3AYI A;  2Q6U A;  3CGE A;  5KXJ A;  4BK3 A;  2C64 A;  2JK6 A;  3AE7 A;  3LB8 A;  5JCN A;  2JB1 A;  3F8R A;  2GVC A;  2H89 A;  2WP9 A;  4U2L A;  1KNP A;  2A89 A;  4U2S A;  4H50 A;  1H83 A;  2C70 A;  1YQZ A;  2WEU A;  2WPE A;  3ICR A;  3NTD A;  4RG4 A;  3T37 A;  4APN A;  4AOX A;  3NG7 X;  3NTA A;  4Z43 A;  2WP6 A;  3NK2 X;  4U8P A;  4C77 A;  1DJQ A;  5BUL A;  1LPF A;  2C75 A;  3ICS A;  4YWO A;  1GRE A;  1LVL A;  3S61 A;  1FCD A;  2WHD A;  4E0V A;  4XWZ A;  1PXC A;  1B8S A;  4A6N A;  4H4Q A;  2JB3 A;  4X9M A;  1D4C A;  1DOD A;  3L8K A;  2Q0L A;  3IHM A;  3NLC A;  1NHS A;  2C72 A;  1PBD A;  3HYW A;  1D4E A;  1ZP0 A;  1ZOY A;  3HZL A;  3PVC A;  3GRS A;  4Y4L A;  3UOY A;  4JNQ A;  2XLT A;  5KOX A;  3ADA B;  3F8P A;  3UOV A;  3NK1 X;  1CJ3 A;  3K7T A;  2WP5 A;  3CTY A;  4DSH A;  1NEN A;  1NAA A;  2GQF A;  1CJ2 A;  2XCG A;  4ZCD A;  4BK2 A;  5L46 A;  3IF9 A;  1FEA A;  2B9X A;  2V6O A;  4TM4 A;  2E5V A;  2C7G A;  3M13 A;  1P2H A;  4H4Z A;  2V60 A;  2J3N A;  4J2W A;  4YTP A;  2CVJ A;  3T2Z A;  4N9X A;  1IUX A;  1RP0 A;  3LJP A;  4FK1 C;  3R9U A;  3M12 A;  4YKF A;  4NWZ A;  1L9D A;  4LII A;  5EBK A;  2X99 A;  1DXL A;  4NEV A;  1ZX9 A;  3AD7 B;  1JEH A;  2XVJ A;  4J57 A;  3EPT A;  1Y56 B;  4EMW A;  1XPQ A;  4OPD A;  3UTE A;  5J7X A;  2R0G A;  5FS9 A;  5BUK A;  3DME A;  3OC4 A;  2APG A;  1M64 A;  1GPE A;  2WS3 A;  4TM0 A;  1GSN A;  4B65 A;  2XVI A;  3G5S A;  1LTX R;  4USQ A;  5JCI A;  1S2Q A;  2QA2 A;  2VOU A;  1NPX A;  3AEF A;  4II3 A;  4K8D A;  3RED A;  4Y4M A;  1JRZ A;  4B68 A;  2ZZB A;  3UOX A;  2WDR A;  4G9K A;  2BCG G;  3DJG X;  2BRY A;  4H4V A;  4OPG A;  3SXI A;  5GSN A;  1PBF A;  3UKH A;  3ITJ A;  3V76 A;  4A99 A;  2XLU A;  2GAG B;  3GD4 A;  5KMQ A;  1BKW A;  1PBE A;  2X8H A;  3KD9 A;  2BA9 A;  2ZZC A;  3SFE A;  2C4C A;  3AE5 A;  1B5Q A;  2EQ6 A;  3UKF A;  2FJA A;  3EAO A;  4H4P A;  2RGO A;  3SFD A;  1CBO A;  1Z6L A;  1OJ9 A;  1Y56 A;  5KMS A;  1H6V A;  5TR3 A;  5DBJ A;  3ATQ A;  4II2 A;  3RNM A;  3RHA A;  4Z2U A;  3UKQ A;  2GV8 A;  3ALJ A;  1E1M A;  1KDG A;  1XDI A;  1AOG A;  2YM2 A;  3NYC A;  1E6E A;  3BNM A;  1DOE A;  2I0Z A;  1F3P A;  3DK4 A;  3S5W A;  2Y6Q A;  2XFQ A;  3CGC A;  3RP7 A;  3GMB A;  5LV9 A;  3BHK A;  5EB4 A;  2GMJ A;  1OJA A;  5CQF A;  2B9W A;  4K5R A;  2XFO A;  4CBQ A;  1EL7 A;  1GRH A;  3KU9 A;  1H81 A;  3ICT A;  2EQ9 A;  3LXD A;  2VZ2 A;  1VDC A;  2XVH A;  4GAV A;  1ZKQ A;  4IA6 A;  4JDR A;  3CNP A;  2OLO A;  3KVE A;  3AYL A;  4G6G A;  3D8X A;  5HYM A;  4EMI A;  4Z24 A;  2WDQ A;  2XYO A;  1GOS A;  2XVF A;  3C4N A;  1SEZ A;  3IHG A;  5KRQ A;  4FDC B;  4H2Q A;  4XWR A;  2WPF A;  2R9Z A;  3T31 A;  3AD9 B;  4H4S A;  4OPL A;  1S3E A;  2UZZ A;  2C3C A;  3BNU A;  4C5O A;  3QJ4 A;  1BZL A;  2BXR A;  2XDO A;  3OZ2 A;  5FMH A;  4LU6 A;  2R4E A;  2V61 A;  3D1C A;  1QLB A;  3C96 A;  2AQJ A;  4Z26 A;  2R0P A;  1JU2 A;  1VRQ B;  3P4S A;  1F8W A;  2BS4 A;  2X8G A;  1JRX A;  2YVF A;  3HYV A;  2GR0 A;  4ZCC A;  3ZYX A;  4CCR A;  1VG9 A;  1YQ4 A;  5FS7 A;  1UKV G;  5IQ4 A;  4UDR A;  2YLS A;  3DA1 A;  1GES A;  4CNJ A;  4A9W A;  3DGH A;  3CN8 A;  4I58 A;  4BK1 A;  1S2Y A;  2EQ7 A;  2Q0K A;  3GRT A;  1BGN A;  2PHH A;  4B64 A;  4CCQ A;  4CRT A;  4CY6 A;  2C76 A;  2GR1 A;  4EIP A;  4J33 A;  4CNK A;  3RP8 A;  3UKP A;  2R0C A;  3H4K A;  4UDP A;  4WCT A;  4J31 A;  1D5T A;  4B63 A;  3I6D A;  1OJD A;  1VG0 A;  2NPX A;  3NT6 A;  4H4Y A;  1YY5 A;  1E1N A;  2WPC A;  5FS6 A;  2W0H A;  4H7U A;  1GTE A;  3SZF A;  3P4P A;  3ZDN A;  4Z2R A;  2XFU A;  3NH3 X;  1PBB A;  1TYT A;  1CJ4 A;  2C67 A;  3Q6J A;  1GND A;  3CMM A;  3AEB A;  1K4Q A;  1IJH A;  2V3B A;  2VRL A;  2ZBW A;  1CC4 A;  5U1O A;  1TDK A;  4BV6 A;  2BYB A;  1N4W A;  3GWF A;  4GRT A;  1MOK A;  4AP3 A;  2BAC A;  3GDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...