1H86A

Covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 7.0
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h86A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h86A02
3DK9A 4H2QA 2X99A 4FK1C 2BK3A 4TM4A 4DSHA 2YM2A 4H4ZA 3GDPA 3VR8A 2V61A 1MXTA 1GNDA 3I6DA 3PS9A 2BC0A 3AEGA 2Z5YA 3E1TA 1FEAA 1PS9A 1IUTA 5KOWA 2C3DA 2VVMA 5HYMA 1JOAA 3CGCA 2WP9A 4OPUA 4B68A 1PBDA 4K5RA 4EQSA 3EAOA 4M52A 4NEVA 2RABA 2OAMA 4GDPA 4REKA 2R0PA 4JDRA 4LA1A 3NG7X 4MJWA 3T37A 2YVFA 4Z43A 2BA9A 1GTEA 5KRQA 1ZK7A 4IA5A 3P4SA 3M0OA 3QJ4A 5FMHA 3DA1A 3ICTA 3GYJA 5CKUA 2O9ZA 1D7YA 1PHHA 2WPCA 2C7GA 1EBDA 1NHPA 5BVAA 2V6OA 2WPEA 2R45A 3KLJA 4XWZA 5JCIA 4APNA 3BI5A 5IQ1A 1E7PA 2AAQA 3BNUA 1IUVA 4GR1A 4Z44A 2YG6A 5L46A 4H4TA 1E6EA 2V3BA 3ICRA 2GAGB 3AE4A 3NH3X 3S5WA 4EM3A 2W0HA 3CNSA 5GSNA 1GALA 1MO9A 1PXCA 1DJNA 2YG5A 2TPRA 1F8SA 2YAUA 2WOVA 3CPIG 3QSMA 1IUXA 3R9UA 5J60A 1H84A 1LPFA 3M12A 3UP4A 1CJ3A 1DODA 1QO8A 1Y0PA 4AT2A 1PJ6A 2BS3A 1GTHA 4AP3A 1RSGA 2JKCA 3RP7A 2ZZBA 2R0CA 2TMDA 3CNTA 3BHKA 2OLOA 3GMBA 3WE0A 3NTDA 4U8KA 1KNRA 2CVJA 4A99A 4B64A 3AE1A 2VRMA 2BXRA 2J3NA 3DK4A 3P4RA 3V3NA 1FOHA 4NTDA 5HXIA 2CFYA 5C2TA 3B3RA 2C65A 4KPRA 3UKHA 1H7WA 2B7RA 3QSEA 2GB0A 3UTGA 3NTAA 2C64A 3LZWA 3OC4A 1GRGA 1FL2A 2C76A 4GRTA 1KDGA 2BS2A 4H4PA 4Z2RA 3H4KA 3P4QA 4H2NA 4Z24A 3NK2X 4YKGA 2Q6UA 1QLBA 3H8LA 1CJ2A 3CIRA 3IWAA 1BKWA 1TDEA 4K2XA 4ADWA 2X50A 1P2EA 2C70A 3GSIA 4YTNA 3VR9A 2BK5A 4I59A 1E1KA 1CHUA 2GV8A 2XLSA 3GRSA 1Y56A 2BABA 4CY6A 4LIIA 3NKSA 4CCQA 1GOSA 5KXJA 2QA2A 2GR2A 2RGHA 3DMEA 3REDA 5BULA 2JB2A 1L9CA 1K0JA 3AE9A 4UDPA 4YWOA 3NN6X 2XCGA 4OVIA 2QAEA 1JNZA 4B69A 3JSKA 3LOVA 2BYBA 2A87A 3L1RA 2XFPA 2B9XA 1KNPA 4ZCCA 2A89A 1GREA 1D4EA 4WX1A 1ZMCA 4Y4LA 2IVEA 3P1WA 1PJ5A 4X9MA 1M6IA 2FBWA 2VQBA 2X8GA 3IC9A 1W4XA 4BV6A 2XLTA 1LQUA 4IV9A 1JRYA 4FX9A 2AQJA 2R9ZA 3AEAA 4JY2A 2B7SA 3C96A 1PBEA 3VRDB 1FEBA 3L8KA 3AE5A 3DH9A 3QSSA 3UKAA 1F6MA 4E0VA 2H89A 3F8PA 1CJ4A 4ZN0A 4FK1A 2NPXA 2WU2A 4TLXA 1XPQA 3VRBA 4H4YA 1IJHA 3EPTA 2WPFA 3HZLA 2WDQA 3QVRA 3VQRA 4B63A 3NYEA 5HY5A 3RP8A 2WP6A 4CRTA 4OPGA 1H81A 4D04A 3ICSA 5C3JA 1E1NA 1LJ1A 3UKKA 4Z2TA 1IUWA 2R4JA 4HB9A 4N9XA 5JCNA 1IUSA 2ZBWA 4D03A 1YQ3A 3AD9B 3IHMA 4H4VA 1JU2A 1TDKA 4EQXA 1O95A 4J57A 3AEBA 4OPCA 2GMJA 4C77A 3G5RA 4LU6A 5U1OA 4Z26A 1B5QA 2YG3A 1ZKQA 1E39A 1ZY8A 2Z5XA 3CPHG 3GD4A 3AEFA 3DJEA 3LXDA 2YWLA 5ER0A 2BK4A 4JNAA 1VDCA 3SFEA 4C5OA 4A79A 1TRBA 2XFOA 1LVLA 4YSYA 4U8LA 4U8PA 2WOIA 1QJDA 2GRTA 3NIXA 1PXBA 4YSZA 3ALLA 4B67A 3NGCX 3G5QA 2UZZA 4U2TA 1CC4A 3D8XA 3SFDA 1DXLA 1O94A 4AOSA 4K5SA 1ZP0A 3LZXA 4X4JA 3OZ2A 4YT0A 2QCUA 3SQPA 1PBCA 1CC6A 2RGJA 1N4VA 5TR3A 1S3BA 1BF3A 2VRLA 3DGZA 3ISHA 1GPEA 4JQ9A 4Y4NA 5EB4A 3BI4A 3DGHA 4OPLA 3K7MX 3GDNA 3NN0X 2R46A 4Z25A 1TYPA 1PJ7A 1CC2A 1TYTA 5JCMA 1KFYA 1ZOVA 4YTMA 2AR8A 4YSXA 2YG7A 4DNAA 2VOUA 4OPDA 5CQFA 4NTCA 2CDUA 2GH5A 1H86A 3PVCA 5KVHA 2JB3A 3EF6A 1JRXA 5EOWA 1OJCA 4C3XA 3CGDA 3GRTA 2BC1A 2WU5A 2YLXA 3COXA 2X8CA 4K22A 4USQA 2YQUA 4A5LA 1ZOYA 2XLRA 2R0GA 2XVHA 1ONFA 1K0IA 3IHGA 4DGKA 1GRBA 2XVIA 1NENA 1OJTA 2ACZA 5U63A 4XXGA 2WOWA 1PN0A 1S2YA 2VVLG 1K4QA 1NHSA 3CTYA 3BI2A 5FS9A 3RP6A 1KSSA 3FMWA 2E1MA 1JRZA 2H88A 2XDOA 4UDQA 5FS6A 2GF3A 4BK3A 1GV4A 4OPIA 4RG3A 3ZDNA 2WDRA 4O5QA 3P9UA 1CF3A 3GYIA 2WS3A 4H4RA 1B37A 1Z6LA 1H6VA 1B8SA 1Q9IA 3ABVA 4AOXA 5DBJA 1F8RA 4JNQA 1YY5A 1DJQA 2YLWA 3FBSA 3UKFA 1D4DA 1NEKA 4ECHA 4ICYA 4TLZA 1GERA 3QVPA 3AYLA 5JCKA 1NG4A 4XWRA 2FJAA 2FJDA 1NPXA 2WP5A 2WDVA 2WETA 1XANA 2VVLA 2YLTA 2I0ZA 2WQYA 4BJZA 1YQ4A 2EQ9A 3K7TA 4J34A 3GD3A 4K7ZA 3Q6JA 3UTFA 3ATRA 1HYUA 1VQWA 2IVDA 2GQWA 3NYFA 1E1LA 1FECA 4JY3A 4ZCDA 2BS4A 1Y56B 4WCTA 1X31B 3Q9TA 4U8JA 3KD9A 4AP1A 1EL9A 2WBAA 4BK1A 1DNCA 1AOGA 4J56A 1ELIA 3NNEA 3F8RA 4A6NA 3I3LA 4A65A 1FCDA 2X8HA 2XFUA 2XFQA 1NDAA 2GR3A 2YM1A 4RSLA 2DKHA 2E4GA 2B76A 3M13A 3SM8A 1DOCA 3AXBA 4H2RA 3S61A 4YXDA 1M64A 2B9YA 4EMJA 3V3OA 2VZ2A 4OCGA 1EL8A 1MOKA 3LJPA 1YQZA 2GEWA 1NG3A 4U8MA 1PBFA 1OJDA 2Q7VA 2XYOA 1UKVG 2A8XA 1VG9A 3KU9A 4P9SA 1NHQA 2OLNA 2ZZ0A 1GRAA 1PDHA 3G5SA 2NVKX 2WESA 2YVJA 3CN8A 2WEUA 3FIMB 1PBBA 3F8DA 4EM4A 1COYA 5IQ4A 1VRQB 2XVJA 4H4SA 5GRTA 1P2HA 3AECA 4B65A 1OJAA 3AE3A 4B66A 4FDCB 2BACA 2HQMA 1EL7A 4H4QA 4U8NA 4EIPA 1CL0A 2EQ7A 1NAAA 2ZZCA 3AEEA 3EANA 4USRA 4O5UA 4K8DA 2XVEA 3ADAB 2YG4A 1S2QA 3BHFA 4Y4MA 4U8OA 3AYIA 2XLPA 3PO7A 4BURA 2QA1A 1TDNA 5LV9A 4NTEA 1SEZA 4I58A 4CCRA 4J2WA 1BWCA 4OPTA 1H83A 2CULA 4H2PA 4HA6A 4AT0A 4RG4A 4TM3A 2C67A 4B1BA 1JNRA 4BJYA 4CNJA 4CBQA 5BRTA 1XDIA 3CPJG 4U2LA 1ZMDA 2OALA 1E1MA 3AE8A 2IIDA 2FJBA 3UTHA 4EIQA 2GQFA 3AWIA 4CY8A 2C72A 1GRHA 5EBKA 1GXFA 5BUKA 3NK1X 3AEDA 4H4UA 3H8IA 5HHFA 2JBVA 2JB1A 3IF9A 5FS8A 2VQ7A 3QFAA 2EQ8A 3UKPA 2X3NA 2JK6A 4YKFA 1TDFA 3SGLA 3C4AA 4PABA 3UOXA 1S3EA 2GR1A 3RNMA 1EL5A 3C4NA 3UKQA 1BGNA 1Q1WA 4H50A 3LB8A 4YTPA 2YLRA 4IVMB 1GSNA 4GUVA 4BK2A 4H4XA 1BZLA 3CNDA 4JN9A 2V3AA 3AE6A 1L9DA 3UOZA 1F8WA 1N1PA 3KKJA 3VRAA 4EQRA 1GT8A 4CNKA 3AE2A 1K0LA 3GWFA 3NHOX 1GESA 5FS7A 1ZDLA 2GAHB 1VG0A 3NRNA 1LTXR 1OJ9A 3K30A 3NYCA 3DJDA 1KSUA 4H4WA 2Y6QA 4PAAA 1PXAA 2XVFA 3BNMA 1XHCA 4EMIA 4H7UA 3CNJA 3UKLA 2C73A 2R4EA 2GVCA 1Q1RA 3LADA 3GMCA 2Q0KA 2YLSA 1CBOA 1KF6A 2YR6A 3P4PA 3AD8B 3II4A 3KVEA 3NT6A 4J36A 1GEUA 1N4WA 1O5WA 1RP0A 1H82A 2DKIA 2EQ6A 1D4CA 2BXSA 1JEHA 3AYJA 5M10A 4U2SA 4YSHA 1B4VA 2XFNA 2OA1A 2C3CA 3ALJA 2APGA 2GMHA 4GCMA 1D7LA 4Z2UA 2C66A 3UCLA 3CNPA 3D1CA 1D5TA 1RYIA 3ITJA 4U8IA 3KA7A 5J7XA 2Q0LA 1DOBA 5KOXA 1IUUA 3UOVA 4GF7A 4GDEA 3NLCA 3UOYA 1V59A 1BGJA 2YR5A 2YVGA 2WHDA 4J31A 3UTEA 2XLUA 4A9WA 4IVOB 3URHA 1TDOA 1N4UA 3FG2P 2YR4A 2ARDA 5EB5A 4X9NA 4EMWA 5IPYA 4J33A 1GRTA 4A6NB 1REOA 4KX6A 4A7AA 4EQWA 4C74A 3GWDA 3QFBA 3AE7A 1H7XA 2PHHA 3B6DA 2GR0A 2C75A 3AB1A 3CGEA 2E5VA 3KPFA 1NHRA 3DJGX 2RGOA 1DOEA 5KVIA 2V5ZA 1CJCA 3ATQA 3CGBA 4NEWA 4UP3A 1ZX9A 1L0VA 2JAEA 3K7QX 3DK8A 2Y6RA 4TM1A 2BCGG 3ALMA 3NK0X 2YLZA 2V60A 1YKJA 1LQTA 2B9WA 4TM0A 5JCLA 3O0HA 5U25A 3UP5A 2BCPA 4NZHA 3DJJA 4DSGA 5M0ZA 3RHAA 4UDRA 1LV0A 1GETA 3AD7B 4C3YA 3ZYXA 1L9EA 1GRFA 3FPZA 4IA6A 2F5ZA 5KWFA 2FJEA 2PYXA 1F3PA 3V76A
chains in the Genus database with same CATH superfamily
3DK9A 4H2QA 2X99A 4FK1C 2BK3A 4TM4A 4DSHA 2YM2A 4H4ZA 3GDPA 3VR8A 2V61A 1MXTA 1GNDA 3I6DA 3PS9A 2BC0A 3AEGA 2Z5YA 3E1TA 1FEAA 1PS9A 1IUTA 5KOWA 2C3DA 2VVMA 5HYMA 1JOAA 3CGCA 2BRAA 2WP9A 4OPUA 4B68A 1PBDA 4K5RA 4EQSA 3EAOA 4M52A 4NEVA 2RABA 2OAMA 4GDPA 4II3A 4REKA 2R0PA 4JDRA 4LA1A 3NG7X 4MJWA 3T37A 2YVFA 4Z43A 2BA9A 1GTEA 5KRQA 1ZK7A 4IA5A 3P4SA 3M0OA 3QJ4A 5FMHA 3DA1A 3ICTA 3GYJA 5CKUA 2O9ZA 1D7YA 1PHHA 2WPCA 2C7GA 1EBDA 1NHPA 5BVAA 2V6OA 2WPEA 2R45A 3KLJA 4XWZA 5JCIA 4APNA 3BI5A 5IQ1A 1E7PA 2AAQA 3BNUA 1IUVA 4GR1A 4Z44A 2YG6A 5L46A 4H4TA 1E6EA 2V3BA 3ICRA 2GAGB 3AE4A 3NH3X 3SZWA 3S5WA 4EM3A 2W0HA 3CNSA 5GSNA 1GALA 1MO9A 1PXCA 1DJNA 2YG5A 2TPRA 1F8SA 2YAUA 2WOVA 3CPIG 3QSMA 1IUXA 3R9UA 5J60A 1H84A 1LPFA 3M12A 3UP4A 1CJ3A 1DODA 1QO8A 1Y0PA 4AT2A 1PJ6A 2BS3A 1GTHA 4AP3A 1RSGA 2JKCA 3RP7A 2ZZBA 2R0CA 2TMDA 3CNTA 3BHKA 2OLOA 3GMBA 3WE0A 3NTDA 4U8KA 1KNRA 2CVJA 4A99A 4B64A 3AE1A 2VRMA 2BXRA 2J3NA 3DK4A 3P4RA 3V3NA 1FOHA 4NTDA 3T14A 5HXIA 2CFYA 5C2TA 3B3RA 2C65A 4KPRA 3UKHA 1H7WA 2B7RA 3QSEA 2GB0A 3UTGA 3NTAA 2C64A 3LZWA 3OC4A 1GRGA 1FL2A 2C76A 3HYWA 1KDGA 2BS2A 4GRTA 4H4PA 4Z2RA 3H4KA 3P4QA 4H2NA 4Z24A 3NK2X 4YKGA 2Q6UA 1QLBA 3H8LA 1CJ2A 3CIRA 3IWAA 1BKWA 1TDEA 4K2XA 4ADWA 2X50A 1P2EA 2C70A 3GSIA 4YTNA 3VR9A 2BK5A 4I59A 1E1KA 1CHUA 2GV8A 2XLSA 3GRSA 1Y56A 2BABA 4CY6A 4LIIA 3NKSA 4CCQA 1GOSA 5KXJA 2QA2A 2GR2A 2RGHA 3DMEA 3REDA 5BULA 2JB2A 1L9CA 1K0JA 3AE9A 4UDPA 4YWOA 3NN6X 2XCGA 4OVIA 2QAEA 1JNZA 4B69A 3JSKA 3LOVA 2BYBA 2A87A 3L1RA 2XFPA 2B9XA 1KNPA 4ZCCA 2A89A 1GREA 1D4EA 4WX1A 1ZMCA 4Y4LA 2IVEA 3P1WA 1PJ5A 4X9MA 1M6IA 2FBWA 2VQBA 2X8GA 3IC9A 1W4XA 4BV6A 2XLTA 1LQUA 4IV9A 1JRYA 4FX9A 2AQJA 2R9ZA 3AEAA 4JY2A 2B7SA 3C96A 1PBEA 3SYIA 3VRDB 1FEBA 3L8KA 3AE5A 3DH9A 3QSSA 3UKAA 1F6MA 4E0VA 2H89A 3F8PA 1CJ4A 4ZN0A 4FK1A 2NPXA 2WU2A 4TLXA 1XPQA 3VRBA 4H4YA 1IJHA 3EPTA 2WPFA 3HZLA 2WDQA 3QVRA 3VQRA 4B63A 4NWZA 3NYEA 5HY5A 3RP8A 2WP6A 4CRTA 4OPGA 1H81A 4D04A 3ICSA 5C3JA 1E1NA 1LJ1A 3UKKA 4Z2TA 1IUWA 2R4JA 4HB9A 4N9XA 5JCNA 1IUSA 2ZBWA 4D03A 1YQ3A 3AD9B 3IHMA 4H4VA 1JU2A 1TDKA 4EQXA 1O95A 4J57A 3AEBA 4OPCA 2GMJA 4C77A 3G5RA 4LU6A 5U1OA 4Z26A 1B5QA 2YG3A 1ZKQA 1E39A 1ZY8A 2Z5XA 3CPHG 3T2KA 3GD4A 3AEFA 3DJEA 3LXDA 2YWLA 5ER0A 2BK4A 4JNAA 3T31A 1VDCA 3SFEA 4C5OA 4A79A 1TRBA 2XFOA 1LVLA 3SXIA 4U8LA 4YSYA 4U8PA 2WOIA 1QJDA 2GRTA 3NIXA 1PXBA 4YSZA 3ALLA 4B67A 3NGCX 3G5QA 2UZZA 4U2TA 3GYXA 1CC4A 3D8XA 3SFDA 1DXLA 1O94A 4AOSA 4K5SA 1ZP0A 3LZXA 4X4JA 3OZ2A 4YT0A 2QCUA 3SQPA 1PBCA 1CC6A 2RGJA 1N4VA 5TR3A 1S3BA 1BF3A 2VRLA 3DGZA 3ISHA 1GPEA 4JQ9A 4Y4NA 5EB4A 3BI4A 3DGHA 4OPLA 3K7MX 3GDNA 3NN0X 2R46A 4Z25A 1TYPA 1PJ7A 1CC2A 3T2ZA 1TYTA 5JCMA 1KFYA 1ZOVA 4YTMA 2AR8A 4YSXA 2YG7A 4DNAA 2VOUA 4OPDA 5CQFA 4NTCA 2CDUA 2GH5A 1H86A 3PVCA 5KVHA 2JB3A 3EF6A 1JRXA 5EOWA 1OJCA 4C3XA 3CGDA 3GRTA 2BC1A 2WU5A 2YLXA 3COXA 2X8CA 4K22A 4USQA 2YQUA 4A5LA 1ZOYA 2XLRA 2R0GA 2XVHA 1ONFA 1K0IA 3IHGA 4DGKA 1GRBA 2XVIA 1NENA 1OJTA 2ACZA 3SY4A 5U63A 4XXGA 2WOWA 1PN0A 1S2YA 2VVLG 1K4QA 1NHSA 3CTYA 3BI2A 5FS9A 2C4CA 3RP6A 1KSSA 3FMWA 2E1MA 1JRZA 2H88A 2XDOA 4UDQA 5FS6A 2GF3A 3SZFA 4BK3A 1GV4A 4OPIA 4RG3A 3ZDNA 2WDRA 4O5QA 3P9UA 1CF3A 3GYIA 2WS3A 4H4RA 1B37A 1Z6LA 1H6VA 1B8SA 1Q9IA 3ABVA 4AOXA 5DBJA 1F8RA 4JNQA 1YY5A 1DJQA 2YLWA 3FBSA 3UKFA 1D4DA 1NEKA 4ECHA 4ICYA 4TLZA 1GERA 3QVPA 3AYLA 5JCKA 3SZ0A 1NG4A 4XWRA 2FJAA 2FJDA 1NPXA 2WP5A 2WDVA 2WETA 1XANA 4G74A 2VVLA 2YLTA 2I0ZA 2WQYA 3KPKA 4BJZA 1YQ4A 2EQ9A 3K7TA 4J34A 4G73A 3GD3A 4K7ZA 3Q6JA 3UTFA 3ATRA 1HYUA 1VQWA 2IVDA 2BRYA 2GQWA 3NYFA 1E1LA 1FECA 4JY3A 4ZCDA 2BS4A 1Y56B 4WCTA 1X31B 3Q9TA 4U8JA 3KD9A 4AP1A 1EL9A 2WBAA 4BK1A 1DNCA 1AOGA 4J56A 1ELIA 3NNEA 3F8RA 4A6NA 3I3LA 4A65A 1FCDA 2X8HA 4G9KA 5KMPA 2XFUA 2XFQA 1NDAA 2GR3A 2YM1A 4RSLA 2DKHA 2E4GA 2B76A 3M13A 3SM8A 1DOCA 3AXBA 4H2RA 3S61A 4YXDA 1M64A 2B9YA 4EMJA 3V3OA 2VZ2A 4OCGA 1EL8A 1MOKA 3LJPA 1YQZA 2GEWA 1NG3A 4U8MA 1PBFA 1OJDA 2Q7VA 2XYOA 1UKVG 2A8XA 1VG9A 3KU9A 4P9SA 1NHQA 2OLNA 2ZZ0A 1GRAA 1PDHA 3G5SA 2NVKX 2WESA 2YVJA 3CN8A 2WEUA 3FIMB 1PBBA 3F8DA 4EM4A 1COYA 5IQ4A 1VRQB 2XVJA 4H4SA 5GRTA 1P2HA 3AECA 4B65A 1OJAA 3AE3A 4B66A 4FDCB 2BACA 2HQMA 1EL7A 4H4QA 4U8NA 3SX6A 1CL0A 4EIPA 2EQ7A 1NAAA 2ZZCA 3AEEA 3EANA 4USRA 4O5UA 4K8DA 4G6HA 2XVEA 3ADAB 2YG4A 1S2QA 3BHFA 4Y4MA 4U8OA 3AYIA 2XLPA 3PO7A 5KMQA 5KMRA 3T0KA 4BURA 2QA1A 1TDNA 5LV9A 4NTEA 1SEZA 4I58A 4CCRA 4J2WA 1BWCA 4OPTA 1H83A 2CULA 4H2PA 4HA6A 4AT0A 4RG4A 4TM3A 2C67A 4B1BA 1JNRA 4BJYA 4CNJA 4CBQA 5BRTA 1XDIA 3CPJG 4U2LA 1ZMDA 2OALA 1E1MA 3AE8A 2IIDA 2FJBA 3UTHA 4EIQA 2GQFA 3AWIA 4CY8A 2C72A 1GRHA 5EBKA 1GXFA 5BUKA 3NK1X 3AEDA 4H4UA 3H8IA 5HHFA 2JBVA 2JB1A 3IF9A 5FS8A 2VQ7A 3QFAA 2EQ8A 3UKPA 2X3NA 5KMSA 2JK6A 4YKFA 1TDFA 3SGLA 3C4AA 4PABA 3UOXA 1S3EA 2GR1A 4G6GA 3RNMA 1EL5A 3C4NA 3UKQA 1BGNA 1Q1WA 4H50A 3LB8A 4YTPA 2YLRA 4IVMB 1GSNA 4GUVA 4BK2A 4H4XA 1BZLA 3CNDA 4JN9A 2V3AA 3AE6A 1L9DA 3UOZA 1F8WA 1N1PA 3KKJA 3VRAA 4EQRA 1GT8A 4CNKA 3AE2A 1K0LA 3GWFA 3NHOX 4GAVA 1GESA 5FS7A 1ZDLA 2GAHB 1VG0A 3NRNA 1LTXR 1OJ9A 3K30A 3NYCA 3DJDA 1KSUA 4H4WA 2Y6QA 4PAAA 1PXAA 2XVFA 3BNMA 1XHCA 4EMIA 5KNLA 4H7UA 3CNJA 3UKLA 2C73A 2R4EA 2GVCA 1Q1RA 3LADA 3GMCA 2Q0KA 2YLSA 1CBOA 1KF6A 2YR6A 3P4PA 3AD8B 3II4A 3KVEA 3NT6A 4J36A 1GEUA 1N4WA 1O5WA 1RP0A 1H82A 2DKIA 2EQ6A 1D4CA 2BXSA 1JEHA 3AYJA 5M10A 4U2SA 4YSHA 1B4VA 2XFNA 2OA1A 2C3CA 3ALJA 2APGA 2GMHA 4GCMA 1D7LA 4Z2UA 2C66A 3UCLA 3CNPA 3D1CA 1D5TA 1RYIA 3ITJA 4U8IA 3KA7A 5J7XA 2Q0LA 1DOBA 5KOXA 4II2A 1IUUA 3UOVA 4GF7A 4GDEA 3T2YA 3NLCA 3UOYA 1V59A 1BGJA 2YR5A 2YVGA 2WHDA 3HYVA 4J31A 2XLUA 3UTEA 4IVOB 3URHA 4A9WA 1TDOA 1N4UA 3FG2P 2YR4A 2ARDA 5EB5A 4X9NA 4EMWA 5IPYA 4J33A 1GRTA 3SZCA 1REOA 4KX6A 4A6NB 4A7AA 4EQWA 4C74A 3GWDA 3QFBA 3AE7A 1H7XA 2PHHA 3B6DA 2GR0A 2C75A 3AB1A 3CGEA 2E5VA 3KPFA 1NHRA 3DJGX 3HYXA 2RGOA 1DOEA 5KVIA 2V5ZA 1CJCA 3ATQA 3CGBA 4NEWA 4UP3A 1ZX9A 1L0VA 2JAEA 3K7QX 3DK8A 2Y6RA 4GAPA 4TM1A 2BCGG 3ALMA 3NK0X 2YLZA 2V60A 4NNJA 1YKJA 1LQTA 2B9WA 4TM0A 5JCLA 3O0HA 5U25A 3UP5A 2BCPA 4NZHA 3DJJA 4DSGA 5M0ZA 3RHAA 4UDRA 1LV0A 1GETA 3AD7B 4C3YA 3ZYXA 1L9EA 1GRFA 3FPZA 4IA6A 2F5ZA 5KWFA 2FJEA 2PYXA 3CMMA 1F3PA 3V76A
chains in the Genus database with same CATH topology
3DK9A 4H2QA 2X99A 4FK1C 2BK3A 4TM4A 4DSHA 2YM2A 4H4ZA 3GDPA 3VR8A 2V61A 1MXTA 1GNDA 3I6DA 3PS9A 2BC0A 3AEGA 2Z5YA 3E1TA 1FEAA 1PS9A 1IUTA 5KOWA 2C3DA 2VVMA 5HYMA 1JOAA 3CGCA 2BRAA 2WP9A 4OPUA 4B68A 1PBDA 4K5RA 4EQSA 3EAOA 4M52A 4NEVA 2RABA 2OAMA 4GDPA 4II3A 4REKA 2R0PA 4JDRA 4LA1A 3NG7X 4MJWA 3T37A 2YVFA 4Z43A 2BA9A 1GTEA 5KRQA 1ZK7A 4IA5A 3P4SA 3M0OA 3QJ4A 5FMHA 3DA1A 3ICTA 3GYJA 5CKUA 2O9ZA 1D7YA 1PHHA 2WPCA 2C7GA 1EBDA 1NHPA 5BVAA 2V6OA 2WPEA 2R45A 3KLJA 4XWZA 5JCIA 4APNA 3BI5A 5IQ1A 1E7PA 2AAQA 3BNUA 1IUVA 4GR1A 4Z44A 2YG6A 5L46A 4H4TA 1E6EA 2V3BA 3ICRA 2GAGB 3AE4A 3NH3X 3SZWA 3S5WA 4EM3A 2W0HA 3CNSA 5GSNA 1GALA 1MO9A 1PXCA 1DJNA 2YG5A 2TPRA 1F8SA 2YAUA 2WOVA 3CPIG 3QSMA 1IUXA 3R9UA 5J60A 1H84A 1LPFA 3M12A 3UP4A 1CJ3A 1DODA 1QO8A 1Y0PA 4AT2A 1PJ6A 2BS3A 1GTHA 4AP3A 1RSGA 2JKCA 3RP7A 2ZZBA 2R0CA 2TMDA 3CNTA 3BHKA 2OLOA 3GMBA 3WE0A 3NTDA 4U8KA 1KNRA 2CVJA 4A99A 4B64A 3AE1A 2VRMA 2BXRA 2J3NA 3DK4A 3P4RA 3V3NA 1FOHA 4NTDA 3T14A 5HXIA 2CFYA 5C2TA 3B3RA 2C65A 4KPRA 3UKHA 1H7WA 2B7RA 3QSEA 2GB0A 3UTGA 3NTAA 2C64A 3LZWA 3OC4A 1GRGA 1FL2A 2C76A 3HYWA 1KDGA 2BS2A 4GRTA 4H4PA 4Z2RA 3H4KA 3P4QA 4H2NA 4Z24A 3NK2X 4YKGA 2Q6UA 1QLBA 3H8LA 1CJ2A 3CIRA 3IWAA 1BKWA 1TDEA 4K2XA 4ADWA 2X50A 1P2EA 2C70A 3GSIA 4YTNA 3VR9A 2BK5A 4I59A 1E1KA 1CHUA 2GV8A 2XLSA 3GRSA 1Y56A 2BABA 4CY6A 4LIIA 3NKSA 4CCQA 1GOSA 5KXJA 2QA2A 2GR2A 2RGHA 3DMEA 3REDA 5BULA 2JB2A 1L9CA 1K0JA 3AE9A 4UDPA 4YWOA 3NN6X 2XCGA 4OVIA 2QAEA 1JNZA 4B69A 3JSKA 3LOVA 2BYBA 2A87A 3L1RA 2XFPA 2B9XA 1KNPA 4ZCCA 2A89A 1GREA 1D4EA 4WX1A 1ZMCA 4Y4LA 2IVEA 3P1WA 1PJ5A 4X9MA 1M6IA 2FBWA 2VQBA 2X8GA 3IC9A 1W4XA 4BV6A 2XLTA 1LQUA 4IV9A 1JRYA 4FX9A 2AQJA 2R9ZA 3AEAA 4JY2A 2B7SA 3C96A 1PBEA 3SYIA 3VRDB 1FEBA 3L8KA 3AE5A 3DH9A 3QSSA 3UKAA 1F6MA 4E0VA 2H89A 3F8PA 1CJ4A 4ZN0A 4FK1A 2NPXA 2WU2A 4TLXA 1XPQA 3VRBA 4H4YA 1IJHA 3EPTA 2WPFA 3HZLA 2WDQA 3QVRA 3VQRA 4B63A 4NWZA 3NYEA 5HY5A 3RP8A 2WP6A 4CRTA 4OPGA 1H81A 4D04A 3ICSA 5C3JA 1E1NA 1LJ1A 3UKKA 4Z2TA 1IUWA 2R4JA 4HB9A 4N9XA 5JCNA 1IUSA 2ZBWA 4D03A 1YQ3A 3AD9B 3IHMA 4H4VA 1JU2A 1TDKA 4EQXA 1O95A 4J57A 3AEBA 4OPCA 2GMJA 4C77A 3G5RA 4LU6A 5U1OA 4Z26A 1B5QA 2YG3A 1ZKQA 1E39A 1ZY8A 2Z5XA 3CPHG 3T2KA 3GD4A 3AEFA 3DJEA 3LXDA 2YWLA 5ER0A 2BK4A 4JNAA 3T31A 1VDCA 3SFEA 4C5OA 4A79A 1TRBA 2XFOA 1LVLA 3SXIA 4U8LA 4YSYA 4U8PA 2WOIA 1QJDA 2GRTA 3NIXA 1PXBA 4YSZA 3ALLA 4B67A 3NGCX 3G5QA 2UZZA 4U2TA 3GYXA 1CC4A 3D8XA 3SFDA 1DXLA 1O94A 4AOSA 4K5SA 1ZP0A 3LZXA 4X4JA 3OZ2A 4YT0A 2QCUA 3SQPA 1PBCA 1CC6A 2RGJA 1N4VA 5TR3A 1S3BA 1BF3A 2VRLA 3DGZA 3ISHA 1GPEA 4JQ9A 4Y4NA 5EB4A 3BI4A 3DGHA 4OPLA 3K7MX 3GDNA 3NN0X 2R46A 4Z25A 1TYPA 1PJ7A 1CC2A 3T2ZA 1TYTA 5JCMA 1KFYA 1ZOVA 4YTMA 2AR8A 4YSXA 2YG7A 4DNAA 2VOUA 4OPDA 5CQFA 4NTCA 2CDUA 2GH5A 1H86A 3PVCA 5KVHA 2JB3A 3EF6A 1JRXA 5EOWA 1OJCA 4C3XA 3CGDA 3GRTA 2BC1A 2WU5A 2YLXA 3COXA 2X8CA 4K22A 4USQA 2YQUA 4A5LA 1ZOYA 2XLRA 2R0GA 2XVHA 1ONFA 1K0IA 3IHGA 4DGKA 1GRBA 2XVIA 1NENA 1OJTA 2ACZA 3SY4A 5U63A 4XXGA 2WOWA 1PN0A 1S2YA 2VVLG 1K4QA 1NHSA 3CTYA 3BI2A 5FS9A 2C4CA 3RP6A 1KSSA 3FMWA 2E1MA 1JRZA 2H88A 2XDOA 4UDQA 5FS6A 2GF3A 3SZFA 4BK3A 1GV4A 4OPIA 4RG3A 3ZDNA 2WDRA 4O5QA 3P9UA 1CF3A 3GYIA 2WS3A 4H4RA 1B37A 1Z6LA 1H6VA 1B8SA 1Q9IA 3ABVA 4AOXA 5DBJA 1F8RA 4JNQA 1YY5A 1DJQA 2YLWA 3FBSA 3UKFA 1D4DA 1NEKA 4ECHA 4ICYA 4TLZA 1GERA 3QVPA 3AYLA 5JCKA 3SZ0A 1NG4A 4XWRA 2FJAA 2FJDA 1NPXA 2WP5A 2WDVA 2WETA 1XANA 4G74A 2VVLA 2YLTA 2I0ZA 2WQYA 3KPKA 4BJZA 1YQ4A 2EQ9A 3K7TA 4J34A 4G73A 3GD3A 4K7ZA 3Q6JA 3UTFA 3ATRA 1HYUA 1VQWA 2IVDA 2BRYA 2GQWA 3NYFA 1E1LA 1FECA 4JY3A 4ZCDA 2BS4A 1Y56B 4WCTA 1X31B 3Q9TA 4U8JA 3KD9A 4AP1A 1EL9A 2WBAA 4BK1A 1DNCA 1AOGA 4J56A 1ELIA 3NNEA 3F8RA 4A6NA 3I3LA 4A65A 1FCDA 2X8HA 4G9KA 5KMPA 2XFUA 2XFQA 1NDAA 2GR3A 2YM1A 4RSLA 2DKHA 2E4GA 2B76A 3M13A 3SM8A 1DOCA 3AXBA 4H2RA 3S61A 4YXDA 1M64A 2B9YA 4EMJA 3V3OA 2VZ2A 4OCGA 1EL8A 1MOKA 3LJPA 1YQZA 2GEWA 1NG3A 4U8MA 1PBFA 1OJDA 2Q7VA 2XYOA 1UKVG 2A8XA 1VG9A 3KU9A 4P9SA 1NHQA 2OLNA 2ZZ0A 1GRAA 1PDHA 3G5SA 2NVKX 2WESA 2YVJA 3CN8A 2WEUA 3FIMB 1PBBA 3F8DA 4EM4A 1COYA 5IQ4A 1VRQB 2XVJA 4H4SA 5GRTA 1P2HA 3AECA 4B65A 1OJAA 3AE3A 4B66A 4FDCB 2BACA 2HQMA 1EL7A 4H4QA 4U8NA 3SX6A 1CL0A 4EIPA 2EQ7A 1NAAA 2ZZCA 3AEEA 3EANA 4USRA 4O5UA 4K8DA 4G6HA 2XVEA 3ADAB 2YG4A 1S2QA 3BHFA 4Y4MA 4U8OA 3AYIA 2XLPA 3PO7A 5KMQA 5KMRA 3T0KA 4BURA 2QA1A 1TDNA 5LV9A 4NTEA 1SEZA 4I58A 4CCRA 4J2WA 1BWCA 4OPTA 1H83A 2CULA 4H2PA 4HA6A 4AT0A 4RG4A 4TM3A 2C67A 4B1BA 1JNRA 4BJYA 4CNJA 4CBQA 5BRTA 1XDIA 3CPJG 4U2LA 1ZMDA 2OALA 1E1MA 3AE8A 2IIDA 2FJBA 3UTHA 4EIQA 2GQFA 3AWIA 4CY8A 2C72A 1GRHA 5EBKA 1GXFA 5BUKA 3NK1X 3AEDA 4H4UA 3H8IA 5HHFA 2JBVA 2JB1A 3IF9A 5FS8A 2VQ7A 3QFAA 2EQ8A 3UKPA 2X3NA 5KMSA 2JK6A 4YKFA 1TDFA 3SGLA 3C4AA 4PABA 3UOXA 1S3EA 2GR1A 4G6GA 3RNMA 1EL5A 3C4NA 3UKQA 1BGNA 1Q1WA 4H50A 3LB8A 4YTPA 2YLRA 4IVMB 1GSNA 4GUVA 4BK2A 4H4XA 1BZLA 3CNDA 4JN9A 2V3AA 3AE6A 1L9DA 3UOZA 1F8WA 1N1PA 3KKJA 3VRAA 4EQRA 1GT8A 4CNKA 3AE2A 1K0LA 3GWFA 3NHOX 4GAVA 1GESA 5FS7A 1ZDLA 2GAHB 1VG0A 3NRNA 1LTXR 1OJ9A 3K30A 3NYCA 3DJDA 1KSUA 4H4WA 2Y6QA 4PAAA 1PXAA 2XVFA 3BNMA 1XHCA 4EMIA 5KNLA 4H7UA 3CNJA 3UKLA 2C73A 2R4EA 2GVCA 1Q1RA 3LADA 3GMCA 2Q0KA 2YLSA 1CBOA 1KF6A 2YR6A 3P4PA 3AD8B 3II4A 3KVEA 3NT6A 4J36A 1GEUA 1N4WA 1O5WA 1RP0A 1H82A 2DKIA 2EQ6A 1D4CA 2BXSA 1JEHA 3AYJA 5M10A 4U2SA 4YSHA 1B4VA 2XFNA 2OA1A 2C3CA 3ALJA 2APGA 2GMHA 4GCMA 1D7LA 4Z2UA 2C66A 3UCLA 3CNPA 3D1CA 1D5TA 1RYIA 3ITJA 4U8IA 3KA7A 5J7XA 2Q0LA 1DOBA 5KOXA 4II2A 1IUUA 3UOVA 4GF7A 4GDEA 3T2YA 3NLCA 3UOYA 1V59A 1BGJA 2YR5A 2YVGA 2WHDA 3HYVA 4J31A 2XLUA 3UTEA 4IVOB 3URHA 4A9WA 1TDOA 1N4UA 3FG2P 2YR4A 2ARDA 5EB5A 4X9NA 4EMWA 5IPYA 4J33A 1GRTA 3SZCA 1REOA 4KX6A 4A6NB 4A7AA 4EQWA 4C74A 3GWDA 3QFBA 3AE7A 1H7XA 2PHHA 3B6DA 2GR0A 2C75A 3AB1A 3CGEA 2E5VA 3KPFA 1NHRA 3DJGX 3HYXA 2RGOA 1DOEA 5KVIA 2V5ZA 1CJCA 3ATQA 3CGBA 4NEWA 4UP3A 1ZX9A 1L0VA 2JAEA 3K7QX 3DK8A 2Y6RA 4GAPA 4TM1A 2BCGG 3ALMA 3NK0X 2YLZA 2V60A 4NNJA 1YKJA 1LQTA 2B9WA 4TM0A 5JCLA 3O0HA 5U25A 3UP5A 2BCPA 4NZHA 3DJJA 4DSGA 5M0ZA 3RHAA 4UDRA 1LV0A 1GETA 3AD7B 4C3YA 3ZYXA 1L9EA 1GRFA 3FPZA 4IA6A 2F5ZA 5KWFA 2FJEA 2PYXA 3CMMA 1F3PA 3V76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DK9 A;  4H2Q A;  2X99 A;  4FK1 C;  2BK3 A;  4TM4 A;  4DSH A;  2YM2 A;  4H4Z A;  3GDP A;  3VR8 A;  2V61 A;  1MXT A;  1GND A;  3I6D A;  3PS9 A;  2BC0 A;  3AEG A;  2Z5Y A;  3E1T A;  1FEA A;  1PS9 A;  1IUT A;  5KOW A;  2C3D A;  2VVM A;  5HYM A;  1JOA A;  3CGC A;  2WP9 A;  4OPU A;  4B68 A;  1PBD A;  4K5R A;  4EQS A;  3EAO A;  4M52 A;  4NEV A;  2RAB A;  2OAM A;  4GDP A;  4REK A;  2R0P A;  4JDR A;  4LA1 A;  3NG7 X;  4MJW A;  3T37 A;  2YVF A;  4Z43 A;  2BA9 A;  1GTE A;  5KRQ A;  1ZK7 A;  4IA5 A;  3P4S A;  3M0O A;  3QJ4 A;  5FMH A;  3DA1 A;  3ICT A;  3GYJ A;  5CKU A;  2O9Z A;  1D7Y A;  1PHH A;  2WPC A;  2C7G A;  1EBD A;  1NHP A;  5BVA A;  2V6O A;  2WPE A;  2R45 A;  3KLJ A;  4XWZ A;  5JCI A;  4APN A;  3BI5 A;  5IQ1 A;  1E7P A;  2AAQ A;  3BNU A;  1IUV A;  4GR1 A;  4Z44 A;  2YG6 A;  5L46 A;  4H4T A;  1E6E A;  2V3B A;  3ICR A;  2GAG B;  3AE4 A;  3NH3 X;  3S5W A;  4EM3 A;  2W0H A;  3CNS A;  5GSN A;  1GAL A;  1MO9 A;  1PXC A;  1DJN A;  2YG5 A;  2TPR A;  1F8S A;  2YAU A;  2WOV A;  3CPI G;  3QSM A;  1IUX A;  3R9U A;  5J60 A;  1H84 A;  1LPF A;  3M12 A;  3UP4 A;  1CJ3 A;  1DOD A;  1QO8 A;  1Y0P A;  4AT2 A;  1PJ6 A;  2BS3 A;  1GTH A;  4AP3 A;  1RSG A;  2JKC A;  3RP7 A;  2ZZB A;  2R0C A;  2TMD A;  3CNT A;  3BHK A;  2OLO A;  3GMB A;  3WE0 A;  3NTD A;  4U8K A;  1KNR A;  2CVJ A;  4A99 A;  4B64 A;  3AE1 A;  2VRM A;  2BXR A;  2J3N A;  3DK4 A;  3P4R A;  3V3N A;  1FOH A;  4NTD A;  5HXI A;  2CFY A;  5C2T A;  3B3R A;  2C65 A;  4KPR A;  3UKH A;  1H7W A;  2B7R A;  3QSE A;  2GB0 A;  3UTG A;  3NTA A;  2C64 A;  3LZW A;  3OC4 A;  1GRG A;  1FL2 A;  2C76 A;  4GRT A;  1KDG A;  2BS2 A;  4H4P A;  4Z2R A;  3H4K A;  3P4Q A;  4H2N A;  4Z24 A;  3NK2 X;  4YKG A;  2Q6U A;  1QLB A;  3H8L A;  1CJ2 A;  3CIR A;  3IWA A;  1BKW A;  1TDE A;  4K2X A;  4ADW A;  2X50 A;  1P2E A;  2C70 A;  3GSI A;  4YTN A;  3VR9 A;  2BK5 A;  4I59 A;  1E1K A;  1CHU A;  2GV8 A;  2XLS A;  3GRS A;  1Y56 A;  2BAB A;  4CY6 A;  4LII A;  3NKS A;  4CCQ A;  1GOS A;  5KXJ A;  2QA2 A;  2GR2 A;  2RGH A;  3DME A;  3RED A;  5BUL A;  2JB2 A;  1L9C A;  1K0J A;  3AE9 A;  4UDP A;  4YWO A;  3NN6 X;  2XCG A;  4OVI A;  2QAE A;  1JNZ A;  4B69 A;  3JSK A;  3LOV A;  2BYB A;  2A87 A;  3L1R A;  2XFP A;  2B9X A;  1KNP A;  4ZCC A;  2A89 A;  1GRE A;  1D4E A;  4WX1 A;  1ZMC A;  4Y4L A;  2IVE A;  3P1W A;  1PJ5 A;  4X9M A;  1M6I A;  2FBW A;  2VQB A;  2X8G A;  3IC9 A;  1W4X A;  4BV6 A;  2XLT A;  1LQU A;  4IV9 A;  1JRY A;  4FX9 A;  2AQJ A;  2R9Z A;  3AEA A;  4JY2 A;  2B7S A;  3C96 A;  1PBE A;  3VRD B;  1FEB A;  3L8K A;  3AE5 A;  3DH9 A;  3QSS A;  3UKA A;  1F6M A;  4E0V A;  2H89 A;  3F8P A;  1CJ4 A;  4ZN0 A;  4FK1 A;  2NPX A;  2WU2 A;  4TLX A;  1XPQ A;  3VRB A;  4H4Y A;  1IJH A;  3EPT A;  2WPF A;  3HZL A;  2WDQ A;  3QVR A;  3VQR A;  4B63 A;  3NYE A;  5HY5 A;  3RP8 A;  2WP6 A;  4CRT A;  4OPG A;  1H81 A;  4D04 A;  3ICS A;  5C3J A;  1E1N A;  1LJ1 A;  3UKK A;  4Z2T A;  1IUW A;  2R4J A;  4HB9 A;  4N9X A;  5JCN A;  1IUS A;  2ZBW A;  4D03 A;  1YQ3 A;  3AD9 B;  3IHM A;  4H4V A;  1JU2 A;  1TDK A;  4EQX A;  1O95 A;  4J57 A;  3AEB A;  4OPC A;  2GMJ A;  4C77 A;  3G5R A;  4LU6 A;  5U1O A;  4Z26 A;  1B5Q A;  2YG3 A;  1ZKQ A;  1E39 A;  1ZY8 A;  2Z5X A;  3CPH G;  3GD4 A;  3AEF A;  3DJE A;  3LXD A;  2YWL A;  5ER0 A;  2BK4 A;  4JNA A;  1VDC A;  3SFE A;  4C5O A;  4A79 A;  1TRB A;  2XFO A;  1LVL A;  4YSY A;  4U8L A;  4U8P A;  2WOI A;  1QJD A;  2GRT A;  3NIX A;  1PXB A;  4YSZ A;  3ALL A;  4B67 A;  3NGC X;  3G5Q A;  2UZZ A;  4U2T A;  1CC4 A;  3D8X A;  3SFD A;  1DXL A;  1O94 A;  4AOS A;  4K5S A;  1ZP0 A;  3LZX A;  4X4J A;  3OZ2 A;  4YT0 A;  2QCU A;  3SQP A;  1PBC A;  1CC6 A;  2RGJ A;  1N4V A;  5TR3 A;  1S3B A;  1BF3 A;  2VRL A;  3DGZ A;  3ISH A;  1GPE A;  4JQ9 A;  4Y4N A;  5EB4 A;  3BI4 A;  3DGH A;  4OPL A;  3K7M X;  3GDN A;  3NN0 X;  2R46 A;  4Z25 A;  1TYP A;  1PJ7 A;  1CC2 A;  1TYT A;  5JCM A;  1KFY A;  1ZOV A;  4YTM A;  2AR8 A;  4YSX A;  2YG7 A;  4DNA A;  2VOU A;  4OPD A;  5CQF A;  4NTC A;  2CDU A;  2GH5 A;  1H86 A;  3PVC A;  5KVH A;  2JB3 A;  3EF6 A;  1JRX A;  5EOW A;  1OJC A;  4C3X A;  3CGD A;  3GRT A;  2BC1 A;  2WU5 A;  2YLX A;  3COX A;  2X8C A;  4K22 A;  4USQ A;  2YQU A;  4A5L A;  1ZOY A;  2XLR A;  2R0G A;  2XVH A;  1ONF A;  1K0I A;  3IHG A;  4DGK A;  1GRB A;  2XVI A;  1NEN A;  1OJT A;  2ACZ A;  5U63 A;  4XXG A;  2WOW A;  1PN0 A;  1S2Y A;  2VVL G;  1K4Q A;  1NHS A;  3CTY A;  3BI2 A;  5FS9 A;  3RP6 A;  1KSS A;  3FMW A;  2E1M A;  1JRZ A;  2H88 A;  2XDO A;  4UDQ A;  5FS6 A;  2GF3 A;  4BK3 A;  1GV4 A;  4OPI A;  4RG3 A;  3ZDN A;  2WDR A;  4O5Q A;  3P9U A;  1CF3 A;  3GYI A;  2WS3 A;  4H4R A;  1B37 A;  1Z6L A;  1H6V A;  1B8S A;  1Q9I A;  3ABV A;  4AOX A;  5DBJ A;  1F8R A;  4JNQ A;  1YY5 A;  1DJQ A;  2YLW A;  3FBS A;  3UKF A;  1D4D A;  1NEK A;  4ECH A;  4ICY A;  4TLZ A;  1GER A;  3QVP A;  3AYL A;  5JCK A;  1NG4 A;  4XWR A;  2FJA A;  2FJD A;  1NPX A;  2WP5 A;  2WDV A;  2WET A;  1XAN A;  2VVL A;  2YLT A;  2I0Z A;  2WQY A;  4BJZ A;  1YQ4 A;  2EQ9 A;  3K7T A;  4J34 A;  3GD3 A;  4K7Z A;  3Q6J A;  3UTF A;  3ATR A;  1HYU A;  1VQW A;  2IVD A;  2GQW A;  3NYF A;  1E1L A;  1FEC A;  4JY3 A;  4ZCD A;  2BS4 A;  1Y56 B;  4WCT A;  1X31 B;  3Q9T A;  4U8J A;  3KD9 A;  4AP1 A;  1EL9 A;  2WBA A;  4BK1 A;  1DNC A;  1AOG A;  4J56 A;  1ELI A;  3NNE A;  3F8R A;  4A6N A;  3I3L A;  4A65 A;  1FCD A;  2X8H A;  2XFU A;  2XFQ A;  1NDA A;  2GR3 A;  2YM1 A;  4RSL A;  2DKH A;  2E4G A;  2B76 A;  3M13 A;  3SM8 A;  1DOC A;  3AXB A;  4H2R A;  3S61 A;  4YXD A;  1M64 A;  2B9Y A;  4EMJ A;  3V3O A;  2VZ2 A;  4OCG A;  1EL8 A;  1MOK A;  3LJP A;  1YQZ A;  2GEW A;  1NG3 A;  4U8M A;  1PBF A;  1OJD A;  2Q7V A;  2XYO A;  1UKV G;  2A8X A;  1VG9 A;  3KU9 A;  4P9S A;  1NHQ A;  2OLN A;  2ZZ0 A;  1GRA A;  1PDH A;  3G5S A;  2NVK X;  2WES A;  2YVJ A;  3CN8 A;  2WEU A;  3FIM B;  1PBB A;  3F8D A;  4EM4 A;  1COY A;  5IQ4 A;  1VRQ B;  2XVJ A;  4H4S A;  5GRT A;  1P2H A;  3AEC A;  4B65 A;  1OJA A;  3AE3 A;  4B66 A;  4FDC B;  2BAC A;  2HQM A;  1EL7 A;  4H4Q A;  4U8N A;  4EIP A;  1CL0 A;  2EQ7 A;  1NAA A;  2ZZC A;  3AEE A;  3EAN A;  4USR A;  4O5U A;  4K8D A;  2XVE A;  3ADA B;  2YG4 A;  1S2Q A;  3BHF A;  4Y4M A;  4U8O A;  3AYI A;  2XLP A;  3PO7 A;  4BUR A;  2QA1 A;  1TDN A;  5LV9 A;  4NTE A;  1SEZ A;  4I58 A;  4CCR A;  4J2W A;  1BWC A;  4OPT A;  1H83 A;  2CUL A;  4H2P A;  4HA6 A;  4AT0 A;  4RG4 A;  4TM3 A;  2C67 A;  4B1B A;  1JNR A;  4BJY A;  4CNJ A;  4CBQ A;  5BRT A;  1XDI A;  3CPJ G;  4U2L A;  1ZMD A;  2OAL A;  1E1M A;  3AE8 A;  2IID A;  2FJB A;  3UTH A;  4EIQ A;  2GQF A;  3AWI A;  4CY8 A;  2C72 A;  1GRH A;  5EBK A;  1GXF A;  5BUK A;  3NK1 X;  3AED A;  4H4U A;  3H8I A;  5HHF A;  2JBV A;  2JB1 A;  3IF9 A;  5FS8 A;  2VQ7 A;  3QFA A;  2EQ8 A;  3UKP A;  2X3N A;  2JK6 A;  4YKF A;  1TDF A;  3SGL A;  3C4A A;  4PAB A;  3UOX A;  1S3E A;  2GR1 A;  3RNM A;  1EL5 A;  3C4N A;  3UKQ A;  1BGN A;  1Q1W A;  4H50 A;  3LB8 A;  4YTP A;  2YLR A;  4IVM B;  1GSN A;  4GUV A;  4BK2 A;  4H4X A;  1BZL A;  3CND A;  4JN9 A;  2V3A A;  3AE6 A;  1L9D A;  3UOZ A;  1F8W A;  1N1P A;  3KKJ A;  3VRA A;  4EQR A;  1GT8 A;  4CNK A;  3AE2 A;  1K0L A;  3GWF A;  3NHO X;  1GES A;  5FS7 A;  1ZDL A;  2GAH B;  1VG0 A;  3NRN A;  1LTX R;  1OJ9 A;  3K30 A;  3NYC A;  3DJD A;  1KSU A;  4H4W A;  2Y6Q A;  4PAA A;  1PXA A;  2XVF A;  3BNM A;  1XHC A;  4EMI A;  4H7U A;  3CNJ A;  3UKL A;  2C73 A;  2R4E A;  2GVC A;  1Q1R A;  3LAD A;  3GMC A;  2Q0K A;  2YLS A;  1CBO A;  1KF6 A;  2YR6 A;  3P4P A;  3AD8 B;  3II4 A;  3KVE A;  3NT6 A;  4J36 A;  1GEU A;  1N4W A;  1O5W A;  1RP0 A;  1H82 A;  2DKI A;  2EQ6 A;  1D4C A;  2BXS A;  1JEH A;  3AYJ A;  5M10 A;  4U2S A;  4YSH A;  1B4V A;  2XFN A;  2OA1 A;  2C3C A;  3ALJ A;  2APG A;  2GMH A;  4GCM A;  1D7L A;  4Z2U A;  2C66 A;  3UCL A;  3CNP A;  3D1C A;  1D5T A;  1RYI A;  3ITJ A;  4U8I A;  3KA7 A;  5J7X A;  2Q0L A;  1DOB A;  5KOX A;  1IUU A;  3UOV A;  4GF7 A;  4GDE A;  3NLC A;  3UOY A;  1V59 A;  1BGJ A;  2YR5 A;  2YVG A;  2WHD A;  4J31 A;  3UTE A;  2XLU A;  4A9W A;  4IVO B;  3URH A;  1TDO A;  1N4U A;  3FG2 P;  2YR4 A;  2ARD A;  5EB5 A;  4X9N A;  4EMW A;  5IPY A;  4J33 A;  1GRT A;  4A6N B;  1REO A;  4KX6 A;  4A7A A;  4EQW A;  4C74 A;  3GWD A;  3QFB A;  3AE7 A;  1H7X A;  2PHH A;  3B6D A;  2GR0 A;  2C75 A;  3AB1 A;  3CGE A;  2E5V A;  3KPF A;  1NHR A;  3DJG X;  2RGO A;  1DOE A;  5KVI A;  2V5Z A;  1CJC A;  3ATQ A;  3CGB A;  4NEW A;  4UP3 A;  1ZX9 A;  1L0V A;  2JAE A;  3K7Q X;  3DK8 A;  2Y6R A;  4TM1 A;  2BCG G;  3ALM A;  3NK0 X;  2YLZ A;  2V60 A;  1YKJ A;  1LQT A;  2B9W A;  4TM0 A;  5JCL A;  3O0H A;  5U25 A;  3UP5 A;  2BCP A;  4NZH A;  3DJJ A;  4DSG A;  5M0Z A;  3RHA A;  4UDR A;  1LV0 A;  1GET A;  3AD7 B;  4C3Y A;  3ZYX A;  1L9E A;  1GRF A;  3FPZ A;  4IA6 A;  2F5Z A;  5KWF A;  2FJE A;  2PYX A;  1F3P A;  3V76 A; 
#chains in the Genus database with same CATH topology
 3DK9 A;  4H2Q A;  2X99 A;  4FK1 C;  2BK3 A;  4TM4 A;  4DSH A;  2YM2 A;  4H4Z A;  3GDP A;  3VR8 A;  2V61 A;  1MXT A;  1GND A;  3I6D A;  3PS9 A;  2BC0 A;  3AEG A;  2Z5Y A;  3E1T A;  1FEA A;  1PS9 A;  1IUT A;  5KOW A;  2C3D A;  2VVM A;  5HYM A;  1JOA A;  3CGC A;  2BRA A;  2WP9 A;  4OPU A;  4B68 A;  1PBD A;  4K5R A;  4EQS A;  3EAO A;  4M52 A;  4NEV A;  2RAB A;  2OAM A;  4GDP A;  4II3 A;  4REK A;  2R0P A;  4JDR A;  4LA1 A;  3NG7 X;  4MJW A;  3T37 A;  2YVF A;  4Z43 A;  2BA9 A;  1GTE A;  5KRQ A;  1ZK7 A;  4IA5 A;  3P4S A;  3M0O A;  3QJ4 A;  5FMH A;  3DA1 A;  3ICT A;  3GYJ A;  5CKU A;  2O9Z A;  1D7Y A;  1PHH A;  2WPC A;  2C7G A;  1EBD A;  1NHP A;  5BVA A;  2V6O A;  2WPE A;  2R45 A;  3KLJ A;  4XWZ A;  5JCI A;  4APN A;  3BI5 A;  5IQ1 A;  1E7P A;  2AAQ A;  3BNU A;  1IUV A;  4GR1 A;  4Z44 A;  2YG6 A;  5L46 A;  4H4T A;  1E6E A;  2V3B A;  3ICR A;  2GAG B;  3AE4 A;  3NH3 X;  3SZW A;  3S5W A;  4EM3 A;  2W0H A;  3CNS A;  5GSN A;  1GAL A;  1MO9 A;  1PXC A;  1DJN A;  2YG5 A;  2TPR A;  1F8S A;  2YAU A;  2WOV A;  3CPI G;  3QSM A;  1IUX A;  3R9U A;  5J60 A;  1H84 A;  1LPF A;  3M12 A;  3UP4 A;  1CJ3 A;  1DOD A;  1QO8 A;  1Y0P A;  4AT2 A;  1PJ6 A;  2BS3 A;  1GTH A;  4AP3 A;  1RSG A;  2JKC A;  3RP7 A;  2ZZB A;  2R0C A;  2TMD A;  3CNT A;  3BHK A;  2OLO A;  3GMB A;  3WE0 A;  3NTD A;  4U8K A;  1KNR A;  2CVJ A;  4A99 A;  4B64 A;  3AE1 A;  2VRM A;  2BXR A;  2J3N A;  3DK4 A;  3P4R A;  3V3N A;  1FOH A;  4NTD A;  3T14 A;  5HXI A;  2CFY A;  5C2T A;  3B3R A;  2C65 A;  4KPR A;  3UKH A;  1H7W A;  2B7R A;  3QSE A;  2GB0 A;  3UTG A;  3NTA A;  2C64 A;  3LZW A;  3OC4 A;  1GRG A;  1FL2 A;  2C76 A;  3HYW A;  1KDG A;  2BS2 A;  4GRT A;  4H4P A;  4Z2R A;  3H4K A;  3P4Q A;  4H2N A;  4Z24 A;  3NK2 X;  4YKG A;  2Q6U A;  1QLB A;  3H8L A;  1CJ2 A;  3CIR A;  3IWA A;  1BKW A;  1TDE A;  4K2X A;  4ADW A;  2X50 A;  1P2E A;  2C70 A;  3GSI A;  4YTN A;  3VR9 A;  2BK5 A;  4I59 A;  1E1K A;  1CHU A;  2GV8 A;  2XLS A;  3GRS A;  1Y56 A;  2BAB A;  4CY6 A;  4LII A;  3NKS A;  4CCQ A;  1GOS A;  5KXJ A;  2QA2 A;  2GR2 A;  2RGH A;  3DME A;  3RED A;  5BUL A;  2JB2 A;  1L9C A;  1K0J A;  3AE9 A;  4UDP A;  4YWO A;  3NN6 X;  2XCG A;  4OVI A;  2QAE A;  1JNZ A;  4B69 A;  3JSK A;  3LOV A;  2BYB A;  2A87 A;  3L1R A;  2XFP A;  2B9X A;  1KNP A;  4ZCC A;  2A89 A;  1GRE A;  1D4E A;  4WX1 A;  1ZMC A;  4Y4L A;  2IVE A;  3P1W A;  1PJ5 A;  4X9M A;  1M6I A;  2FBW A;  2VQB A;  2X8G A;  3IC9 A;  1W4X A;  4BV6 A;  2XLT A;  1LQU A;  4IV9 A;  1JRY A;  4FX9 A;  2AQJ A;  2R9Z A;  3AEA A;  4JY2 A;  2B7S A;  3C96 A;  1PBE A;  3SYI A;  3VRD B;  1FEB A;  3L8K A;  3AE5 A;  3DH9 A;  3QSS A;  3UKA A;  1F6M A;  4E0V A;  2H89 A;  3F8P A;  1CJ4 A;  4ZN0 A;  4FK1 A;  2NPX A;  2WU2 A;  4TLX A;  1XPQ A;  3VRB A;  4H4Y A;  1IJH A;  3EPT A;  2WPF A;  3HZL A;  2WDQ A;  3QVR A;  3VQR A;  4B63 A;  4NWZ A;  3NYE A;  5HY5 A;  3RP8 A;  2WP6 A;  4CRT A;  4OPG A;  1H81 A;  4D04 A;  3ICS A;  5C3J A;  1E1N A;  1LJ1 A;  3UKK A;  4Z2T A;  1IUW A;  2R4J A;  4HB9 A;  4N9X A;  5JCN A;  1IUS A;  2ZBW A;  4D03 A;  1YQ3 A;  3AD9 B;  3IHM A;  4H4V A;  1JU2 A;  1TDK A;  4EQX A;  1O95 A;  4J57 A;  3AEB A;  4OPC A;  2GMJ A;  4C77 A;  3G5R A;  4LU6 A;  5U1O A;  4Z26 A;  1B5Q A;  2YG3 A;  1ZKQ A;  1E39 A;  1ZY8 A;  2Z5X A;  3CPH G;  3T2K A;  3GD4 A;  3AEF A;  3DJE A;  3LXD A;  2YWL A;  5ER0 A;  2BK4 A;  4JNA A;  3T31 A;  1VDC A;  3SFE A;  4C5O A;  4A79 A;  1TRB A;  2XFO A;  1LVL A;  3SXI A;  4U8L A;  4YSY A;  4U8P A;  2WOI A;  1QJD A;  2GRT A;  3NIX A;  1PXB A;  4YSZ A;  3ALL A;  4B67 A;  3NGC X;  3G5Q A;  2UZZ A;  4U2T A;  3GYX A;  1CC4 A;  3D8X A;  3SFD A;  1DXL A;  1O94 A;  4AOS A;  4K5S A;  1ZP0 A;  3LZX A;  4X4J A;  3OZ2 A;  4YT0 A;  2QCU A;  3SQP A;  1PBC A;  1CC6 A;  2RGJ A;  1N4V A;  5TR3 A;  1S3B A;  1BF3 A;  2VRL A;  3DGZ A;  3ISH A;  1GPE A;  4JQ9 A;  4Y4N A;  5EB4 A;  3BI4 A;  3DGH A;  4OPL A;  3K7M X;  3GDN A;  3NN0 X;  2R46 A;  4Z25 A;  1TYP A;  1PJ7 A;  1CC2 A;  3T2Z A;  1TYT A;  5JCM A;  1KFY A;  1ZOV A;  4YTM A;  2AR8 A;  4YSX A;  2YG7 A;  4DNA A;  2VOU A;  4OPD A;  5CQF A;  4NTC A;  2CDU A;  2GH5 A;  1H86 A;  3PVC A;  5KVH A;  2JB3 A;  3EF6 A;  1JRX A;  5EOW A;  1OJC A;  4C3X A;  3CGD A;  3GRT A;  2BC1 A;  2WU5 A;  2YLX A;  3COX A;  2X8C A;  4K22 A;  4USQ A;  2YQU A;  4A5L A;  1ZOY A;  2XLR A;  2R0G A;  2XVH A;  1ONF A;  1K0I A;  3IHG A;  4DGK A;  1GRB A;  2XVI A;  1NEN A;  1OJT A;  2ACZ A;  3SY4 A;  5U63 A;  4XXG A;  2WOW A;  1PN0 A;  1S2Y A;  2VVL G;  1K4Q A;  1NHS A;  3CTY A;  3BI2 A;  5FS9 A;  2C4C A;  3RP6 A;  1KSS A;  3FMW A;  2E1M A;  1JRZ A;  2H88 A;  2XDO A;  4UDQ A;  5FS6 A;  2GF3 A;  3SZF A;  4BK3 A;  1GV4 A;  4OPI A;  4RG3 A;  3ZDN A;  2WDR A;  4O5Q A;  3P9U A;  1CF3 A;  3GYI A;  2WS3 A;  4H4R A;  1B37 A;  1Z6L A;  1H6V A;  1B8S A;  1Q9I A;  3ABV A;  4AOX A;  5DBJ A;  1F8R A;  4JNQ A;  1YY5 A;  1DJQ A;  2YLW A;  3FBS A;  3UKF A;  1D4D A;  1NEK A;  4ECH A;  4ICY A;  4TLZ A;  1GER A;  3QVP A;  3AYL A;  5JCK A;  3SZ0 A;  1NG4 A;  4XWR A;  2FJA A;  2FJD A;  1NPX A;  2WP5 A;  2WDV A;  2WET A;  1XAN A;  4G74 A;  2VVL A;  2YLT A;  2I0Z A;  2WQY A;  3KPK A;  4BJZ A;  1YQ4 A;  2EQ9 A;  3K7T A;  4J34 A;  4G73 A;  3GD3 A;  4K7Z A;  3Q6J A;  3UTF A;  3ATR A;  1HYU A;  1VQW A;  2IVD A;  2BRY A;  2GQW A;  3NYF A;  1E1L A;  1FEC A;  4JY3 A;  4ZCD A;  2BS4 A;  1Y56 B;  4WCT A;  1X31 B;  3Q9T A;  4U8J A;  3KD9 A;  4AP1 A;  1EL9 A;  2WBA A;  4BK1 A;  1DNC A;  1AOG A;  4J56 A;  1ELI A;  3NNE A;  3F8R A;  4A6N A;  3I3L A;  4A65 A;  1FCD A;  2X8H A;  4G9K A;  5KMP A;  2XFU A;  2XFQ A;  1NDA A;  2GR3 A;  2YM1 A;  4RSL A;  2DKH A;  2E4G A;  2B76 A;  3M13 A;  3SM8 A;  1DOC A;  3AXB A;  4H2R A;  3S61 A;  4YXD A;  1M64 A;  2B9Y A;  4EMJ A;  3V3O A;  2VZ2 A;  4OCG A;  1EL8 A;  1MOK A;  3LJP A;  1YQZ A;  2GEW A;  1NG3 A;  4U8M A;  1PBF A;  1OJD A;  2Q7V A;  2XYO A;  1UKV G;  2A8X A;  1VG9 A;  3KU9 A;  4P9S A;  1NHQ A;  2OLN A;  2ZZ0 A;  1GRA A;  1PDH A;  3G5S A;  2NVK X;  2WES A;  2YVJ A;  3CN8 A;  2WEU A;  3FIM B;  1PBB A;  3F8D A;  4EM4 A;  1COY A;  5IQ4 A;  1VRQ B;  2XVJ A;  4H4S A;  5GRT A;  1P2H A;  3AEC A;  4B65 A;  1OJA A;  3AE3 A;  4B66 A;  4FDC B;  2BAC A;  2HQM A;  1EL7 A;  4H4Q A;  4U8N A;  3SX6 A;  1CL0 A;  4EIP A;  2EQ7 A;  1NAA A;  2ZZC A;  3AEE A;  3EAN A;  4USR A;  4O5U A;  4K8D A;  4G6H A;  2XVE A;  3ADA B;  2YG4 A;  1S2Q A;  3BHF A;  4Y4M A;  4U8O A;  3AYI A;  2XLP A;  3PO7 A;  5KMQ A;  5KMR A;  3T0K A;  4BUR A;  2QA1 A;  1TDN A;  5LV9 A;  4NTE A;  1SEZ A;  4I58 A;  4CCR A;  4J2W A;  1BWC A;  4OPT A;  1H83 A;  2CUL A;  4H2P A;  4HA6 A;  4AT0 A;  4RG4 A;  4TM3 A;  2C67 A;  4B1B A;  1JNR A;  4BJY A;  4CNJ A;  4CBQ A;  5BRT A;  1XDI A;  3CPJ G;  4U2L A;  1ZMD A;  2OAL A;  1E1M A;  3AE8 A;  2IID A;  2FJB A;  3UTH A;  4EIQ A;  2GQF A;  3AWI A;  4CY8 A;  2C72 A;  1GRH A;  5EBK A;  1GXF A;  5BUK A;  3NK1 X;  3AED A;  4H4U A;  3H8I A;  5HHF A;  2JBV A;  2JB1 A;  3IF9 A;  5FS8 A;  2VQ7 A;  3QFA A;  2EQ8 A;  3UKP A;  2X3N A;  5KMS A;  2JK6 A;  4YKF A;  1TDF A;  3SGL A;  3C4A A;  4PAB A;  3UOX A;  1S3E A;  2GR1 A;  4G6G A;  3RNM A;  1EL5 A;  3C4N A;  3UKQ A;  1BGN A;  1Q1W A;  4H50 A;  3LB8 A;  4YTP A;  2YLR A;  4IVM B;  1GSN A;  4GUV A;  4BK2 A;  4H4X A;  1BZL A;  3CND A;  4JN9 A;  2V3A A;  3AE6 A;  1L9D A;  3UOZ A;  1F8W A;  1N1P A;  3KKJ A;  3VRA A;  4EQR A;  1GT8 A;  4CNK A;  3AE2 A;  1K0L A;  3GWF A;  3NHO X;  4GAV A;  1GES A;  5FS7 A;  1ZDL A;  2GAH B;  1VG0 A;  3NRN A;  1LTX R;  1OJ9 A;  3K30 A;  3NYC A;  3DJD A;  1KSU A;  4H4W A;  2Y6Q A;  4PAA A;  1PXA A;  2XVF A;  3BNM A;  1XHC A;  4EMI A;  5KNL A;  4H7U A;  3CNJ A;  3UKL A;  2C73 A;  2R4E A;  2GVC A;  1Q1R A;  3LAD A;  3GMC A;  2Q0K A;  2YLS A;  1CBO A;  1KF6 A;  2YR6 A;  3P4P A;  3AD8 B;  3II4 A;  3KVE A;  3NT6 A;  4J36 A;  1GEU A;  1N4W A;  1O5W A;  1RP0 A;  1H82 A;  2DKI A;  2EQ6 A;  1D4C A;  2BXS A;  1JEH A;  3AYJ A;  5M10 A;  4U2S A;  4YSH A;  1B4V A;  2XFN A;  2OA1 A;  2C3C A;  3ALJ A;  2APG A;  2GMH A;  4GCM A;  1D7L A;  4Z2U A;  2C66 A;  3UCL A;  3CNP A;  3D1C A;  1D5T A;  1RYI A;  3ITJ A;  4U8I A;  3KA7 A;  5J7X A;  2Q0L A;  1DOB A;  5KOX A;  4II2 A;  1IUU A;  3UOV A;  4GF7 A;  4GDE A;  3T2Y A;  3NLC A;  3UOY A;  1V59 A;  1BGJ A;  2YR5 A;  2YVG A;  2WHD A;  3HYV A;  4J31 A;  2XLU A;  3UTE A;  4IVO B;  3URH A;  4A9W A;  1TDO A;  1N4U A;  3FG2 P;  2YR4 A;  2ARD A;  5EB5 A;  4X9N A;  4EMW A;  5IPY A;  4J33 A;  1GRT A;  3SZC A;  1REO A;  4KX6 A;  4A6N B;  4A7A A;  4EQW A;  4C74 A;  3GWD A;  3QFB A;  3AE7 A;  1H7X A;  2PHH A;  3B6D A;  2GR0 A;  2C75 A;  3AB1 A;  3CGE A;  2E5V A;  3KPF A;  1NHR A;  3DJG X;  3HYX A;  2RGO A;  1DOE A;  5KVI A;  2V5Z A;  1CJC A;  3ATQ A;  3CGB A;  4NEW A;  4UP3 A;  1ZX9 A;  1L0V A;  2JAE A;  3K7Q X;  3DK8 A;  2Y6R A;  4GAP A;  4TM1 A;  2BCG G;  3ALM A;  3NK0 X;  2YLZ A;  2V60 A;  4NNJ A;  1YKJ A;  1LQT A;  2B9W A;  4TM0 A;  5JCL A;  3O0H A;  5U25 A;  3UP5 A;  2BCP A;  4NZH A;  3DJJ A;  4DSG A;  5M0Z A;  3RHA A;  4UDR A;  1LV0 A;  1GET A;  3AD7 B;  4C3Y A;  3ZYX A;  1L9E A;  1GRF A;  3FPZ A;  4IA6 A;  2F5Z A;  5KWF A;  2FJE A;  2PYX A;  3CMM A;  1F3P A;  3V76 A; 
#chains in the Genus database with same CATH homology
 3DK9 A;  4H2Q A;  2X99 A;  4FK1 C;  2BK3 A;  4TM4 A;  4DSH A;  2YM2 A;  4H4Z A;  3GDP A;  3VR8 A;  2V61 A;  1MXT A;  1GND A;  3I6D A;  3PS9 A;  2BC0 A;  3AEG A;  2Z5Y A;  3E1T A;  1FEA A;  1PS9 A;  1IUT A;  5KOW A;  2C3D A;  2VVM A;  5HYM A;  1JOA A;  3CGC A;  2BRA A;  2WP9 A;  4OPU A;  4B68 A;  1PBD A;  4K5R A;  4EQS A;  3EAO A;  4M52 A;  4NEV A;  2RAB A;  2OAM A;  4GDP A;  4II3 A;  4REK A;  2R0P A;  4JDR A;  4LA1 A;  3NG7 X;  4MJW A;  3T37 A;  2YVF A;  4Z43 A;  2BA9 A;  1GTE A;  5KRQ A;  1ZK7 A;  4IA5 A;  3P4S A;  3M0O A;  3QJ4 A;  5FMH A;  3DA1 A;  3ICT A;  3GYJ A;  5CKU A;  2O9Z A;  1D7Y A;  1PHH A;  2WPC A;  2C7G A;  1EBD A;  1NHP A;  5BVA A;  2V6O A;  2WPE A;  2R45 A;  3KLJ A;  4XWZ A;  5JCI A;  4APN A;  3BI5 A;  5IQ1 A;  1E7P A;  2AAQ A;  3BNU A;  1IUV A;  4GR1 A;  4Z44 A;  2YG6 A;  5L46 A;  4H4T A;  1E6E A;  2V3B A;  3ICR A;  2GAG B;  3AE4 A;  3NH3 X;  3SZW A;  3S5W A;  4EM3 A;  2W0H A;  3CNS A;  5GSN A;  1GAL A;  1MO9 A;  1PXC A;  1DJN A;  2YG5 A;  2TPR A;  1F8S A;  2YAU A;  2WOV A;  3CPI G;  3QSM A;  1IUX A;  3R9U A;  5J60 A;  1H84 A;  1LPF A;  3M12 A;  3UP4 A;  1CJ3 A;  1DOD A;  1QO8 A;  1Y0P A;  4AT2 A;  1PJ6 A;  2BS3 A;  1GTH A;  4AP3 A;  1RSG A;  2JKC A;  3RP7 A;  2ZZB A;  2R0C A;  2TMD A;  3CNT A;  3BHK A;  2OLO A;  3GMB A;  3WE0 A;  3NTD A;  4U8K A;  1KNR A;  2CVJ A;  4A99 A;  4B64 A;  3AE1 A;  2VRM A;  2BXR A;  2J3N A;  3DK4 A;  3P4R A;  3V3N A;  1FOH A;  4NTD A;  3T14 A;  5HXI A;  2CFY A;  5C2T A;  3B3R A;  2C65 A;  4KPR A;  3UKH A;  1H7W A;  2B7R A;  3QSE A;  2GB0 A;  3UTG A;  3NTA A;  2C64 A;  3LZW A;  3OC4 A;  1GRG A;  1FL2 A;  2C76 A;  3HYW A;  1KDG A;  2BS2 A;  4GRT A;  4H4P A;  4Z2R A;  3H4K A;  3P4Q A;  4H2N A;  4Z24 A;  3NK2 X;  4YKG A;  2Q6U A;  1QLB A;  3H8L A;  1CJ2 A;  3CIR A;  3IWA A;  1BKW A;  1TDE A;  4K2X A;  4ADW A;  2X50 A;  1P2E A;  2C70 A;  3GSI A;  4YTN A;  3VR9 A;  2BK5 A;  4I59 A;  1E1K A;  1CHU A;  2GV8 A;  2XLS A;  3GRS A;  1Y56 A;  2BAB A;  4CY6 A;  4LII A;  3NKS A;  4CCQ A;  1GOS A;  5KXJ A;  2QA2 A;  2GR2 A;  2RGH A;  3DME A;  3RED A;  5BUL A;  2JB2 A;  1L9C A;  1K0J A;  3AE9 A;  4UDP A;  4YWO A;  3NN6 X;  2XCG A;  4OVI A;  2QAE A;  1JNZ A;  4B69 A;  3JSK A;  3LOV A;  2BYB A;  2A87 A;  3L1R A;  2XFP A;  2B9X A;  1KNP A;  4ZCC A;  2A89 A;  1GRE A;  1D4E A;  4WX1 A;  1ZMC A;  4Y4L A;  2IVE A;  3P1W A;  1PJ5 A;  4X9M A;  1M6I A;  2FBW A;  2VQB A;  2X8G A;  3IC9 A;  1W4X A;  4BV6 A;  2XLT A;  1LQU A;  4IV9 A;  1JRY A;  4FX9 A;  2AQJ A;  2R9Z A;  3AEA A;  4JY2 A;  2B7S A;  3C96 A;  1PBE A;  3SYI A;  3VRD B;  1FEB A;  3L8K A;  3AE5 A;  3DH9 A;  3QSS A;  3UKA A;  1F6M A;  4E0V A;  2H89 A;  3F8P A;  1CJ4 A;  4ZN0 A;  4FK1 A;  2NPX A;  2WU2 A;  4TLX A;  1XPQ A;  3VRB A;  4H4Y A;  1IJH A;  3EPT A;  2WPF A;  3HZL A;  2WDQ A;  3QVR A;  3VQR A;  4B63 A;  4NWZ A;  3NYE A;  5HY5 A;  3RP8 A;  2WP6 A;  4CRT A;  4OPG A;  1H81 A;  4D04 A;  3ICS A;  5C3J A;  1E1N A;  1LJ1 A;  3UKK A;  4Z2T A;  1IUW A;  2R4J A;  4HB9 A;  4N9X A;  5JCN A;  1IUS A;  2ZBW A;  4D03 A;  1YQ3 A;  3AD9 B;  3IHM A;  4H4V A;  1JU2 A;  1TDK A;  4EQX A;  1O95 A;  4J57 A;  3AEB A;  4OPC A;  2GMJ A;  4C77 A;  3G5R A;  4LU6 A;  5U1O A;  4Z26 A;  1B5Q A;  2YG3 A;  1ZKQ A;  1E39 A;  1ZY8 A;  2Z5X A;  3CPH G;  3T2K A;  3GD4 A;  3AEF A;  3DJE A;  3LXD A;  2YWL A;  5ER0 A;  2BK4 A;  4JNA A;  3T31 A;  1VDC A;  3SFE A;  4C5O A;  4A79 A;  1TRB A;  2XFO A;  1LVL A;  3SXI A;  4U8L A;  4YSY A;  4U8P A;  2WOI A;  1QJD A;  2GRT A;  3NIX A;  1PXB A;  4YSZ A;  3ALL A;  4B67 A;  3NGC X;  3G5Q A;  2UZZ A;  4U2T A;  3GYX A;  1CC4 A;  3D8X A;  3SFD A;  1DXL A;  1O94 A;  4AOS A;  4K5S A;  1ZP0 A;  3LZX A;  4X4J A;  3OZ2 A;  4YT0 A;  2QCU A;  3SQP A;  1PBC A;  1CC6 A;  2RGJ A;  1N4V A;  5TR3 A;  1S3B A;  1BF3 A;  2VRL A;  3DGZ A;  3ISH A;  1GPE A;  4JQ9 A;  4Y4N A;  5EB4 A;  3BI4 A;  3DGH A;  4OPL A;  3K7M X;  3GDN A;  3NN0 X;  2R46 A;  4Z25 A;  1TYP A;  1PJ7 A;  1CC2 A;  3T2Z A;  1TYT A;  5JCM A;  1KFY A;  1ZOV A;  4YTM A;  2AR8 A;  4YSX A;  2YG7 A;  4DNA A;  2VOU A;  4OPD A;  5CQF A;  4NTC A;  2CDU A;  2GH5 A;  1H86 A;  3PVC A;  5KVH A;  2JB3 A;  3EF6 A;  1JRX A;  5EOW A;  1OJC A;  4C3X A;  3CGD A;  3GRT A;  2BC1 A;  2WU5 A;  2YLX A;  3COX A;  2X8C A;  4K22 A;  4USQ A;  2YQU A;  4A5L A;  1ZOY A;  2XLR A;  2R0G A;  2XVH A;  1ONF A;  1K0I A;  3IHG A;  4DGK A;  1GRB A;  2XVI A;  1NEN A;  1OJT A;  2ACZ A;  3SY4 A;  5U63 A;  4XXG A;  2WOW A;  1PN0 A;  1S2Y A;  2VVL G;  1K4Q A;  1NHS A;  3CTY A;  3BI2 A;  5FS9 A;  2C4C A;  3RP6 A;  1KSS A;  3FMW A;  2E1M A;  1JRZ A;  2H88 A;  2XDO A;  4UDQ A;  5FS6 A;  2GF3 A;  3SZF A;  4BK3 A;  1GV4 A;  4OPI A;  4RG3 A;  3ZDN A;  2WDR A;  4O5Q A;  3P9U A;  1CF3 A;  3GYI A;  2WS3 A;  4H4R A;  1B37 A;  1Z6L A;  1H6V A;  1B8S A;  1Q9I A;  3ABV A;  4AOX A;  5DBJ A;  1F8R A;  4JNQ A;  1YY5 A;  1DJQ A;  2YLW A;  3FBS A;  3UKF A;  1D4D A;  1NEK A;  4ECH A;  4ICY A;  4TLZ A;  1GER A;  3QVP A;  3AYL A;  5JCK A;  3SZ0 A;  1NG4 A;  4XWR A;  2FJA A;  2FJD A;  1NPX A;  2WP5 A;  2WDV A;  2WET A;  1XAN A;  4G74 A;  2VVL A;  2YLT A;  2I0Z A;  2WQY A;  3KPK A;  4BJZ A;  1YQ4 A;  2EQ9 A;  3K7T A;  4J34 A;  4G73 A;  3GD3 A;  4K7Z A;  3Q6J A;  3UTF A;  3ATR A;  1HYU A;  1VQW A;  2IVD A;  2BRY A;  2GQW A;  3NYF A;  1E1L A;  1FEC A;  4JY3 A;  4ZCD A;  2BS4 A;  1Y56 B;  4WCT A;  1X31 B;  3Q9T A;  4U8J A;  3KD9 A;  4AP1 A;  1EL9 A;  2WBA A;  4BK1 A;  1DNC A;  1AOG A;  4J56 A;  1ELI A;  3NNE A;  3F8R A;  4A6N A;  3I3L A;  4A65 A;  1FCD A;  2X8H A;  4G9K A;  5KMP A;  2XFU A;  2XFQ A;  1NDA A;  2GR3 A;  2YM1 A;  4RSL A;  2DKH A;  2E4G A;  2B76 A;  3M13 A;  3SM8 A;  1DOC A;  3AXB A;  4H2R A;  3S61 A;  4YXD A;  1M64 A;  2B9Y A;  4EMJ A;  3V3O A;  2VZ2 A;  4OCG A;  1EL8 A;  1MOK A;  3LJP A;  1YQZ A;  2GEW A;  1NG3 A;  4U8M A;  1PBF A;  1OJD A;  2Q7V A;  2XYO A;  1UKV G;  2A8X A;  1VG9 A;  3KU9 A;  4P9S A;  1NHQ A;  2OLN A;  2ZZ0 A;  1GRA A;  1PDH A;  3G5S A;  2NVK X;  2WES A;  2YVJ A;  3CN8 A;  2WEU A;  3FIM B;  1PBB A;  3F8D A;  4EM4 A;  1COY A;  5IQ4 A;  1VRQ B;  2XVJ A;  4H4S A;  5GRT A;  1P2H A;  3AEC A;  4B65 A;  1OJA A;  3AE3 A;  4B66 A;  4FDC B;  2BAC A;  2HQM A;  1EL7 A;  4H4Q A;  4U8N A;  3SX6 A;  1CL0 A;  4EIP A;  2EQ7 A;  1NAA A;  2ZZC A;  3AEE A;  3EAN A;  4USR A;  4O5U A;  4K8D A;  4G6H A;  2XVE A;  3ADA B;  2YG4 A;  1S2Q A;  3BHF A;  4Y4M A;  4U8O A;  3AYI A;  2XLP A;  3PO7 A;  5KMQ A;  5KMR A;  3T0K A;  4BUR A;  2QA1 A;  1TDN A;  5LV9 A;  4NTE A;  1SEZ A;  4I58 A;  4CCR A;  4J2W A;  1BWC A;  4OPT A;  1H83 A;  2CUL A;  4H2P A;  4HA6 A;  4AT0 A;  4RG4 A;  4TM3 A;  2C67 A;  4B1B A;  1JNR A;  4BJY A;  4CNJ A;  4CBQ A;  5BRT A;  1XDI A;  3CPJ G;  4U2L A;  1ZMD A;  2OAL A;  1E1M A;  3AE8 A;  2IID A;  2FJB A;  3UTH A;  4EIQ A;  2GQF A;  3AWI A;  4CY8 A;  2C72 A;  1GRH A;  5EBK A;  1GXF A;  5BUK A;  3NK1 X;  3AED A;  4H4U A;  3H8I A;  5HHF A;  2JBV A;  2JB1 A;  3IF9 A;  5FS8 A;  2VQ7 A;  3QFA A;  2EQ8 A;  3UKP A;  2X3N A;  5KMS A;  2JK6 A;  4YKF A;  1TDF A;  3SGL A;  3C4A A;  4PAB A;  3UOX A;  1S3E A;  2GR1 A;  4G6G A;  3RNM A;  1EL5 A;  3C4N A;  3UKQ A;  1BGN A;  1Q1W A;  4H50 A;  3LB8 A;  4YTP A;  2YLR A;  4IVM B;  1GSN A;  4GUV A;  4BK2 A;  4H4X A;  1BZL A;  3CND A;  4JN9 A;  2V3A A;  3AE6 A;  1L9D A;  3UOZ A;  1F8W A;  1N1P A;  3KKJ A;  3VRA A;  4EQR A;  1GT8 A;  4CNK A;  3AE2 A;  1K0L A;  3GWF A;  3NHO X;  4GAV A;  1GES A;  5FS7 A;  1ZDL A;  2GAH B;  1VG0 A;  3NRN A;  1LTX R;  1OJ9 A;  3K30 A;  3NYC A;  3DJD A;  1KSU A;  4H4W A;  2Y6Q A;  4PAA A;  1PXA A;  2XVF A;  3BNM A;  1XHC A;  4EMI A;  5KNL A;  4H7U A;  3CNJ A;  3UKL A;  2C73 A;  2R4E A;  2GVC A;  1Q1R A;  3LAD A;  3GMC A;  2Q0K A;  2YLS A;  1CBO A;  1KF6 A;  2YR6 A;  3P4P A;  3AD8 B;  3II4 A;  3KVE A;  3NT6 A;  4J36 A;  1GEU A;  1N4W A;  1O5W A;  1RP0 A;  1H82 A;  2DKI A;  2EQ6 A;  1D4C A;  2BXS A;  1JEH A;  3AYJ A;  5M10 A;  4U2S A;  4YSH A;  1B4V A;  2XFN A;  2OA1 A;  2C3C A;  3ALJ A;  2APG A;  2GMH A;  4GCM A;  1D7L A;  4Z2U A;  2C66 A;  3UCL A;  3CNP A;  3D1C A;  1D5T A;  1RYI A;  3ITJ A;  4U8I A;  3KA7 A;  5J7X A;  2Q0L A;  1DOB A;  5KOX A;  4II2 A;  1IUU A;  3UOV A;  4GF7 A;  4GDE A;  3T2Y A;  3NLC A;  3UOY A;  1V59 A;  1BGJ A;  2YR5 A;  2YVG A;  2WHD A;  3HYV A;  4J31 A;  2XLU A;  3UTE A;  4IVO B;  3URH A;  4A9W A;  1TDO A;  1N4U A;  3FG2 P;  2YR4 A;  2ARD A;  5EB5 A;  4X9N A;  4EMW A;  5IPY A;  4J33 A;  1GRT A;  3SZC A;  1REO A;  4KX6 A;  4A6N B;  4A7A A;  4EQW A;  4C74 A;  3GWD A;  3QFB A;  3AE7 A;  1H7X A;  2PHH A;  3B6D A;  2GR0 A;  2C75 A;  3AB1 A;  3CGE A;  2E5V A;  3KPF A;  1NHR A;  3DJG X;  3HYX A;  2RGO A;  1DOE A;  5KVI A;  2V5Z A;  1CJC A;  3ATQ A;  3CGB A;  4NEW A;  4UP3 A;  1ZX9 A;  1L0V A;  2JAE A;  3K7Q X;  3DK8 A;  2Y6R A;  4GAP A;  4TM1 A;  2BCG G;  3ALM A;  3NK0 X;  2YLZ A;  2V60 A;  4NNJ A;  1YKJ A;  1LQT A;  2B9W A;  4TM0 A;  5JCL A;  3O0H A;  5U25 A;  3UP5 A;  2BCP A;  4NZH A;  3DJJ A;  4DSG A;  5M0Z A;  3RHA A;  4UDR A;  1LV0 A;  1GET A;  3AD7 B;  4C3Y A;  3ZYX A;  1L9E A;  1GRF A;  3FPZ A;  4IA6 A;  2F5Z A;  5KWF A;  2FJE A;  2PYX A;  3CMM A;  1F3P A;  3V76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...