1H86A

Covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 7.0
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h86A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h86A02
5KOWA 2H89A 3NKSA 1L9EA 1XANA 3DJJA 1LQUA 1TDNA 5BVAA 2VVMA 5JCKA 4U2SA 2XYOA 1CC2A 4GDEA 3K7TA 2QA1A 3GRTA 4NTEA 3EF6A 3DJGX 3GWFA 4GF7A 1CF3A 3S5WA 3BNMA 2BABA 2A8XA 1DODA 4CNKA 5DBJA 4NEWA 3AEAA 4DGKA 4WX1A 2YR4A 3AD7B 5KRQA 2DKIA 1PXBA 2EQ8A 2Y6RA 2R9ZA 2WETA 3F8RA 2B7SA 2X8CA 3S61A 4EMWA 3VR8A 1IUTA 4TM0A 4EIPA 2FJBA 4WCTA 1GETA 1LJ1A 4EMJA 2V60A 4JDRA 1F6MA 1H7WA 1LTXR 2XLTA 3AE7A 3IHMA 1PBDA 1PXAA 4IVMB 1V59A 2FJDA 3AD8B 1D7LA 4H2QA 3UKKA 3VR9A 3P9UA 4FK1C 1DXLA 4P9SA 1KF6A 4Y4MA 1DOBA 2VOUA 3DK4A 1E1LA 1YY5A 4C74A 3SFDA 3G5QA 4OPDA 4CY8A 4U8MA 2HQMA 4EQXA 2C70A 4MJWA 2JB3A 2O9ZA 1H7XA 1NHQA 2Q7VA 1M6IA 4JY3A 1CBOA 1GRBA 2XDOA 1B37A 2XVJA 2Z5YA 1E39A 1JRYA 4D04A 2B9WA 1DOCA 4U2LA 2B9YA 2WPEA 3DH9A 2WU2A 1CL0A 4GCMA 2VVLG 1BGNA 2V3AA 3Q6JA 1IUWA 1MOKA 5EOWA 3NTAA 5U1OA 4YKFA 2DKHA 1XDIA 2WOVA 2B76A 3C96A 3K30A 3UKFA 4EQSA 1PXCA 3ALMA 3NRNA 3P4PA 4A7AA 2NPXA 4A79A 4USRA 4OPLA 2R0GA 2XFQA 1E7PA 1O95A 5JCNA 2WEUA 3UKAA 5BUKA 5KVHA 1GRTA 1OJDA 2C7GA 2VQBA 2BACA 3LJPA 1D7YA 1F3PA 3O0HA 4NEVA 2GR3A 3VRDB 2BXSA 1B8SA 1AOGA 2V6OA 4TM3A 3AYLA 4UDQA 1H86A 3FIMB 2C64A 5JCMA 5IQ1A 4Z2TA 1YQ4A 2XFNA 3Q9TA 1O5WA 2YWLA 1H81A 4IVOB 2YG5A 3AE4A 1YKJA 5C2TA 5HXIA 4ZCDA 2GQWA 1ZMDA 2JK6A 3G5RA 1XHCA 2OALA 4H7UA 1KDGA 2BK5A 4K8DA 1ONFA 2RGHA 3CTYA 5TR3A 2R45A 2YLXA 3FMWA 4H4VA 5HY5A 2YG7A 3GMBA 1ZY8A 4EM3A 2JB2A 1XPQA 1UKVG 3P4RA 4H4SA 1E1KA 4A65A 1CHUA 4CCQA 3CGBA 3UCLA 3M12A 4H2PA 4H4UA 3NYCA 3H8IA 4NTCA 1E1MA 4CRTA 1KNPA 1NEKA 1FOHA 1ZKQA 1TYTA 2C67A 1KFYA 4RG3A 3WE0A 2WESA 1L0VA 4DSGA 2FJAA 3BNUA 3CGCA 4OPUA 4HB9A 3RP8A 1D4DA 3EAOA 1GT8A 2OA1A 4B65A 2CFYA 3UOXA 4LA1A 3ATQA 4JNQA 3EANA 1GRFA 3AYIA 1SEZA 4K2XA 5J7XA 4Z44A 4CCRA 3C4AA 3OC4A 1Q1RA 1O94A 1ZOVA 1E6EA 1BGJA 1BWCA 2GAGB 2WU5A 1K0JA 1E1NA 3P4SA 1D4EA 4AT2A 2VZ2A 5C3JA 2AQJA 4CNJA 1OJCA 2OLNA 2B7RA 1S2QA 3AE8A 1MXTA 2GEWA 4GDPA 1FEBA 3AE1A 3QFAA 5U25A 2TPRA 3IC9A 4D03A 4EM4A 5GRTA 5J60A 3SM8A 2YVJA 1JEHA 3EPTA 1RYIA 2FBWA 3NHOX 1NG4A 3M13A 4YKGA 4H4RA 2RGOA 1Q9IA 3ITJA 3BI5A 1TYPA 3NTDA 1TDKA 1PBBA 3KKJA 1TDOA 2C3CA 4ZN0A 4K7ZA 3UTEA 1S3EA 4JNAA 1K4QA 2F5ZA 2WQYA 3RNMA 3VQRA 4RSLA 4FK1A 2YR6A 1NENA 1VQWA 1CJ3A 3ADAB 4HA6A 4IA6A 3URHA 2GMHA 3V3NA 2C73A 4B1BA 4XWRA 3ATRA 1EL7A 4A6NA 1JNZA 3NNEA 3DJEA 3RP6A 1TDFA 1JRZA 3CNSA 3GDNA 3H8LA 3L8KA 4I59A 4U8PA 5U63A 3BI2A 3UP4A 2TMDA 2APGA 2AR8A 4CY6A 1FECA 2JBVA 4ECHA 4C3XA 3UOYA 4B68A 3GWDA 3KA7A 4AOXA 3GSIA 4AOSA 1K0LA 1GSNA 1EBDA 2H88A 1QLBA 2R4JA 3FG2P 4H4XA 4Z2RA 3L1RA 2YVGA 4Z2UA 1N4VA 1Y56A 4DNAA 3FPZA 3C4NA 3DGHA 3AE6A 4EIQA 2BC1A 2YAUA 4OPTA 3NYEA 2GAHB 4C5OA 2E1MA 2BCPA 3AE5A 3AE3A 3ZDNA 5JCIA 1LVLA 2WOWA 3CNPA 2YVFA 2I0ZA 4OCGA 3UP5A 4U8JA 3REDA 4ZCCA 1PJ6A 4UDPA 4J2WA 4YSZA 2ZBWA 2EQ7A 3V3OA 4H50A 4UDRA 1P2HA 4J34A 5EB5A 2OLOA 3QSSA 4BK2A 4EMIA 3GD4A 3GYJA 1ZDLA 3GYIA 4U8OA 4OPGA 3UOVA 5M10A 3T37A 1F8RA 3V76A 3QVPA 5LV9A 3DA1A 2ARDA 1OJ9A 2JAEA 3DK9A 1CJCA 2BC0A 3CPIG 4Z24A 4KPRA 4J36A 2PYXA 4YXDA 4GRTA 1PBCA 3DK8A 1HYUA 2C3DA 5KOXA 5CQFA 3FBSA 3UKQA 3E1TA 2IIDA 3LXDA 1MO9A 4APNA 3PS9A 1PJ5A 1IUSA 5FS9A 2GQFA 5FMHA 1N4UA 2QA2A 2XLUA 3UOZA 3VRBA 1VG9A 2XCGA 3QJ4A 4H4QA 2YM1A 1VDCA 3AEDA 4A6NB 1GTHA 2R4EA 4YT0A 4O5QA 3BHKA 3RP7A 2BK3A 3QVRA 1IJHA 1F8SA 3KD9A 2IVEA 3CGEA 4YSHA 1GOSA 3DMEA 1LPFA 4LU6A 1OJTA 5JCLA 5HYMA 1H6VA 2C72A 3AXBA 4N9XA 2PHHA 1QJDA 2X8HA 5IPYA 1ZK7A 4BJZA 3D1CA 3QFBA 3F8PA 4A5LA 3CGDA 2BK4A 3NIXA 3BI4A 1B4VA 3ICRA 4U8KA 3ISHA 2QCUA 3AB1A 1Y56B 1RSGA 1ZX9A 3ICSA 3CIRA 1N1PA 5FS6A 1GESA 5ER0A 5EB4A 3D8XA 4BJYA 3AEEA 2GB0A 1B5QA 2GF3A 1Y0PA 2YG6A 4X4JA 3G5SA 2WS3A 3KLJA 1IUVA 2W0HA 3NK1X 2GH5A 3P4QA 1YQZA 5EBKA 2GVCA 1DNCA 2BA9A 2R46A 2YQUA 2BS3A 4EQWA 4B66A 3PVCA 2J3NA 1PN0A 2A89A 2X50A 3BHFA 4Z25A 5IQ4A 1GV4A 3UKPA 3NK2X 1GERA 2VRLA 2JB1A 2WPFA 1COYA 4H4TA 2X99A 2NVKX 3AWIA 4UP3A 2YR5A 4Z43A 1JU2A 1KSUA 2YM2A 1GNDA 4H4WA 3NYFA 1CJ4A 2UZZA 2VRMA 2ZZCA 1L9DA 3NH3X 1GRAA 3CPJG 2GR0A 3DGZA 1DOEA 4LIIA 1DJQA 1TRBA 1K0IA 2Q0LA 4O5UA 2XFOA 3UKHA 4X9MA 2YG3A 1L9CA 4GR1A 2WHDA 3GDPA 2WPCA 1ZP0A 3UTGA 3LADA 2WBAA 4TM1A 3VRAA 3GMCA 1H84A 1BF3A 4KX6A 2GR1A 3LOVA 4U8LA 4YTPA 1RP0A 4BK1A 2EQ9A 1Z6LA 2IVDA 3K7QX 1H83A 4RG4A 4USQA 1REOA 1YQ3A 2VQ7A 2CVJA 2GMJA 3NN6X 5KXJA 1GXFA 3AE2A 2ZZ0A 2YG4A 4IA5A 4M52A 2BXRA 1S3BA 1Q1WA 3AYJA 2WOIA 4H4YA 1IUXA 3QSMA 4K5SA 2ACZA 3GRSA 1NG3A 3I3LA 4YTMA 4AP3A 2BCGG 1JRXA 4J56A 4YSYA 2R0PA 5BULA 4EQRA 5BRTA 4OVIA 4E0VA 4YTNA 2GV8A 2WP5A 1GPEA 3NGCX 1CC4A 4H2NA 1VRQB 4B67A 1TDEA 2XVEA 5HHFA 3AD9B 4H4ZA 1W4XA 3AEGA 3OZ2A 2WDQA 3SGLA 2XFUA 2YLTA 3AEFA 2A87A 3CNTA 4I58A 1CC6A 3PO7A 4B64A 3H4KA 3AECA 1OJAA 4DSHA 4J33A 5L46A 3DJDA 2B9XA 1ZMCA 5FS7A 4REKA 2WP9A 4K22A 4FDCB 2GR2A 1NHSA 4TLZA 3KU9A 4J31A 1GTEA 3LB8A 1DJNA 3ICTA 1VG0A 1PJ7A 2YLSA 2CULA 1GREA 3QSEA 4A99A 4B63A 2CDUA 4B69A 3LZXA 3SQPA 3COXA 4ICYA 4U8NA 1PHHA 3R9UA 3AEBA 3I6DA 1PBEA 1ELIA 1EL8A 1EL5A 4J57A 2V5ZA 1S2YA 2C76A 4BV6A 3JSKA 2YLRA 1H82A 1KNRA 4X9NA 1NPXA 2WDRA 1NDAA 3ABVA 1D5TA 2RABA 4BURA 1BZLA 2BS2A 2E5VA 2FJEA 1ZOYA 4IV9A 4XXGA 3SFEA 5M0ZA 3IHGA 4H4PA 5CKUA 2E4GA 1LV0A 3CN8A 3K7MX 1GEUA 4TM4A 4AP1A 1LQTA 5KVIA 3NG7X 2VVLA 2XVHA 4U8IA 4C77A 1D4CA 3AE9A 1PBFA 3NN0X 3KPFA 1PS9A 2C65A 2GRTA 2R0CA 2V61A 2V3BA 1BKWA 2XVIA 1P2EA 2WDVA 4PABA 1GRGA 2JKCA 4U2TA 2OAMA 3UTFA 1CJ2A 3NT6A 3ZYXA 2C75A 3LZWA 2XLRA 4Z26A 1QO8A 2BS4A 4C3YA 1GALA 2XLPA 2AAQA 1KSSA 1JOAA 4JN9A 4Y4NA 2EQ6A 4Y4LA 4K5RA 1JNRA 1NHRA 2XLSA 4CBQA 2XFPA 4NZHA 1X31B 3UKLA 1NHPA 4PAAA 4XWZA 2X3NA 4YWOA 1N4WA 3ALJA 3NLCA 4NTDA 4OPIA 1FCDA 4JQ9A 2C66A 2X8GA 2Y6QA 1FEAA 1FL2A 3B3RA 3CNJA 3KVEA 4OPCA 5KWFA 2Q6UA 3B6DA 2RGJA 1M64A 2YLZA 5FS8A 2ZZBA 1IUUA 2Q0KA 3CNDA 4JY2A 2XVFA 3P1WA 4TLXA 2WP6A 2YLWA 3HZLA 4YSXA 3CPHG 1EL9A 3IWAA 3UTHA 3GD3A 3ALLA 4H2RA 4A9WA 4ADWA 3F8DA 2BYBA 4FX9A 4AT0A 4BK3A 3NK0X 3II4A 4GUVA 2Z5XA 3IF9A 1F8WA 3RHAA 5GSNA 1NAAA 2QAEA 3M0OA 1GRHA 1PDHA
chains in the Genus database with same CATH superfamily
5KOWA 2C4CA 2H89A 3NKSA 1L9EA 1XANA 3DJJA 1LQUA 1TDNA 5BVAA 2VVMA 5JCKA 4U2SA 2XYOA 1CC2A 4GDEA 3K7TA 2QA1A 3GRTA 4NTEA 3EF6A 3DJGX 3GWFA 4GF7A 1CF3A 3S5WA 2BRAA 3BNMA 2BABA 2A8XA 1DODA 4CNKA 5DBJA 4NEWA 3AEAA 4DGKA 4WX1A 2YR4A 3AD7B 5KRQA 2DKIA 1PXBA 2EQ8A 2Y6RA 2R9ZA 2WETA 3F8RA 2B7SA 2X8CA 3S61A 4EMWA 3T31A 3VR8A 1IUTA 4TM0A 4EIPA 2FJBA 4WCTA 5KMPA 1GETA 1LJ1A 4EMJA 2V60A 4JDRA 1F6MA 1H7WA 1LTXR 2XLTA 3AE7A 3IHMA 1PBDA 1PXAA 4IVMB 1V59A 2FJDA 3AD8B 1D7LA 4H2QA 3UKKA 3VR9A 3P9UA 4FK1C 1DXLA 4P9SA 1KF6A 4Y4MA 1DOBA 2VOUA 3DK4A 1E1LA 1YY5A 4C74A 3SFDA 3G5QA 4OPDA 4CY8A 4U8MA 2HQMA 4EQXA 2C70A 4MJWA 2JB3A 2O9ZA 1H7XA 1NHQA 2Q7VA 1M6IA 4JY3A 1CBOA 1GRBA 2XDOA 1B37A 2XVJA 2Z5YA 1E39A 1JRYA 4D04A 2B9WA 1DOCA 4U2LA 2B9YA 2WPEA 3DH9A 2WU2A 1CL0A 4GCMA 2VVLG 1BGNA 2V3AA 3Q6JA 1IUWA 1MOKA 5EOWA 3NTAA 5U1OA 4YKFA 2DKHA 1XDIA 2WOVA 2B76A 3C96A 3K30A 3UKFA 4EQSA 1PXCA 3ALMA 3NRNA 3P4PA 4A7AA 2NPXA 4A79A 4USRA 4OPLA 2R0GA 3T2YA 2XFQA 1E7PA 1O95A 5JCNA 2WEUA 3UKAA 5BUKA 5KVHA 1GRTA 1OJDA 2C7GA 2VQBA 2BACA 3LJPA 1D7YA 1F3PA 3O0HA 4NEVA 2GR3A 3VRDB 2BXSA 1B8SA 1AOGA 2V6OA 4TM3A 3AYLA 4UDQA 1H86A 3FIMB 2C64A 5JCMA 5IQ1A 4Z2TA 1YQ4A 4G73A 2XFNA 3Q9TA 1O5WA 2YWLA 1H81A 4IVOB 2YG5A 3AE4A 1YKJA 5C2TA 5HXIA 4ZCDA 2GQWA 1ZMDA 2JK6A 3G5RA 1XHCA 2OALA 4GAPA 4H7UA 1KDGA 2BK5A 4K8DA 1ONFA 2RGHA 4NNJA 3CTYA 5TR3A 2R45A 2YLXA 3FMWA 4H4VA 5HY5A 2YG7A 3GMBA 1ZY8A 4EM3A 2JB2A 1XPQA 1UKVG 3P4RA 4H4SA 1E1KA 4A65A 1CHUA 4CCQA 3CGBA 3UCLA 2BRYA 3M12A 4H2PA 4H4UA 3NYCA 3H8IA 4NTCA 1E1MA 4CRTA 1KNPA 1NEKA 1FOHA 1ZKQA 1TYTA 2C67A 3KPKA 1KFYA 4RG3A 3WE0A 2WESA 1L0VA 4DSGA 2FJAA 3BNUA 3CGCA 4OPUA 4HB9A 3RP8A 1D4DA 3EAOA 1GT8A 2OA1A 4B65A 2CFYA 3UOXA 4G6HA 4LA1A 3ATQA 4G74A 4JNQA 3EANA 1GRFA 3AYIA 1SEZA 4K2XA 5J7XA 4Z44A 3T0KA 4CCRA 3C4AA 3OC4A 1Q1RA 1O94A 1ZOVA 1E6EA 1BGJA 1BWCA 2GAGB 2WU5A 1K0JA 1E1NA 3P4SA 1D4EA 4AT2A 2VZ2A 5C3JA 2AQJA 4CNJA 1OJCA 2OLNA 2B7RA 1S2QA 3AE8A 1MXTA 2GEWA 4GDPA 1FEBA 3AE1A 3QFAA 5U25A 4II2A 2TPRA 3IC9A 4D03A 4EM4A 5GRTA 5J60A 3SM8A 2YVJA 1JEHA 3EPTA 1RYIA 2FBWA 3NHOX 1NG4A 3M13A 4YKGA 4H4RA 2RGOA 1Q9IA 3ITJA 3BI5A 1TYPA 3NTDA 1TDKA 1PBBA 3KKJA 1TDOA 2C3CA 4ZN0A 4K7ZA 3UTEA 1S3EA 4JNAA 1K4QA 2F5ZA 2WQYA 3RNMA 3VQRA 4RSLA 4FK1A 2YR6A 1NENA 1VQWA 1CJ3A 3ADAB 4HA6A 4IA6A 5KMQA 2GMHA 3URHA 3V3NA 2C73A 4B1BA 4XWRA 3ATRA 3HYVA 1EL7A 4A6NA 1JNZA 3NNEA 3DJEA 3RP6A 1TDFA 1JRZA 3CNSA 3GDNA 3H8LA 3L8KA 4I59A 4U8PA 5U63A 3T2ZA 3BI2A 3UP4A 2TMDA 2APGA 2AR8A 4CY6A 1FECA 2JBVA 3SYIA 4ECHA 4C3XA 3T2KA 3UOYA 4B68A 3GWDA 3KA7A 4AOXA 3GSIA 4AOSA 1K0LA 1GSNA 1EBDA 2H88A 1QLBA 2R4JA 3FG2P 4H4XA 4Z2RA 3L1RA 2YVGA 4Z2UA 5KMSA 1N4VA 1Y56A 3SZ0A 4DNAA 3FPZA 3C4NA 3DGHA 3AE6A 4EIQA 2BC1A 2YAUA 4G6GA 4OPTA 3NYEA 2GAHB 4C5OA 2E1MA 2BCPA 3AE5A 3AE3A 3ZDNA 5JCIA 5KNLA 1LVLA 3HYWA 2WOWA 3CNPA 2YVFA 2I0ZA 4OCGA 3UP5A 3SZFA 4U8JA 3REDA 4ZCCA 1PJ6A 4UDPA 4J2WA 4YSZA 2ZBWA 2EQ7A 3V3OA 4H50A 4UDRA 1P2HA 4J34A 5EB5A 2OLOA 3QSSA 4BK2A 4EMIA 3GD4A 3GYJA 1ZDLA 3GYIA 4U8OA 4OPGA 3UOVA 5M10A 3T37A 1F8RA 3V76A 3QVPA 5LV9A 3DA1A 2ARDA 1OJ9A 2JAEA 3DK9A 1CJCA 2BC0A 3CPIG 4Z24A 4KPRA 4J36A 2PYXA 4YXDA 4GRTA 1PBCA 3DK8A 1HYUA 2C3DA 5KOXA 5CQFA 3FBSA 3UKQA 4NWZA 3E1TA 2IIDA 3LXDA 1MO9A 4GAVA 4APNA 3PS9A 1PJ5A 1IUSA 5FS9A 2GQFA 5FMHA 1N4UA 2QA2A 2XLUA 3UOZA 3VRBA 1VG9A 2XCGA 3QJ4A 4H4QA 2YM1A 1VDCA 3AEDA 4A6NB 1GTHA 2R4EA 4YT0A 4O5QA 3BHKA 3RP7A 5KMRA 2BK3A 3QVRA 1IJHA 1F8SA 3KD9A 2IVEA 3CGEA 4YSHA 1GOSA 3DMEA 1LPFA 4LU6A 1OJTA 5JCLA 5HYMA 1H6VA 2C72A 3AXBA 4N9XA 2PHHA 1QJDA 2X8HA 5IPYA 1ZK7A 4BJZA 3D1CA 3QFBA 3F8PA 4A5LA 3CGDA 2BK4A 3NIXA 3BI4A 1B4VA 3ICRA 4U8KA 3ISHA 2QCUA 3AB1A 1Y56B 1RSGA 1ZX9A 3ICSA 3CIRA 1N1PA 5FS6A 1GESA 5ER0A 5EB4A 3D8XA 4BJYA 3AEEA 2GB0A 1B5QA 2GF3A 1Y0PA 2YG6A 4X4JA 3G5SA 2WS3A 3KLJA 1IUVA 2W0HA 3NK1X 2GH5A 3P4QA 1YQZA 5EBKA 2GVCA 1DNCA 2BA9A 2R46A 2YQUA 2BS3A 4EQWA 4B66A 3PVCA 2J3NA 1PN0A 2A89A 2X50A 3BHFA 4Z25A 5IQ4A 1GV4A 3UKPA 3NK2X 1GERA 3SX6A 2VRLA 2JB1A 2WPFA 1COYA 4H4TA 2X99A 3GYXA 2NVKX 3AWIA 4UP3A 2YR5A 4Z43A 1JU2A 1KSUA 2YM2A 4G9KA 1GNDA 4H4WA 3NYFA 1CJ4A 2UZZA 2VRMA 2ZZCA 1L9DA 3NH3X 1GRAA 3CPJG 2GR0A 3DGZA 1DOEA 4LIIA 1DJQA 1TRBA 1K0IA 2Q0LA 4O5UA 2XFOA 3UKHA 4X9MA 2YG3A 1L9CA 4GR1A 2WHDA 3GDPA 2WPCA 1ZP0A 3UTGA 3LADA 2WBAA 4TM1A 3VRAA 3GMCA 1H84A 1BF3A 4KX6A 2GR1A 3LOVA 4U8LA 4YTPA 1RP0A 4BK1A 2EQ9A 1Z6LA 2IVDA 3K7QX 1H83A 4RG4A 3HYXA 4USQA 1REOA 1YQ3A 2VQ7A 3SZCA 2CVJA 2GMJA 3NN6X 5KXJA 1GXFA 3AE2A 2ZZ0A 2YG4A 4IA5A 4M52A 2BXRA 1S3BA 1Q1WA 3AYJA 3SXIA 2WOIA 4H4YA 1IUXA 3QSMA 4K5SA 2ACZA 3GRSA 3SY4A 1NG3A 3I3LA 4YTMA 4AP3A 2BCGG 1JRXA 4J56A 4YSYA 2R0PA 5BULA 4EQRA 5BRTA 4OVIA 4E0VA 4YTNA 2GV8A 2WP5A 1GPEA 3NGCX 1CC4A 4H2NA 1VRQB 4B67A 1TDEA 2XVEA 5HHFA 3AD9B 4H4ZA 1W4XA 3AEGA 3OZ2A 2WDQA 3SGLA 2XFUA 2YLTA 3AEFA 2A87A 3CNTA 4I58A 1CC6A 3PO7A 4B64A 3H4KA 3AECA 1OJAA 4DSHA 4J33A 5L46A 3DJDA 2B9XA 1ZMCA 5FS7A 4REKA 2WP9A 4K22A 4FDCB 2GR2A 1NHSA 4TLZA 3KU9A 4J31A 1GTEA 3LB8A 1DJNA 3ICTA 1VG0A 1PJ7A 2YLSA 3CMMA 2CULA 1GREA 3QSEA 4A99A 4B63A 2CDUA 4B69A 3LZXA 3SQPA 3COXA 4ICYA 4U8NA 1PHHA 3R9UA 3AEBA 3I6DA 1PBEA 1ELIA 1EL8A 1EL5A 4J57A 2V5ZA 3SZWA 1S2YA 2C76A 4BV6A 3JSKA 2YLRA 1H82A 1KNRA 4X9NA 1NPXA 2WDRA 1NDAA 3ABVA 1D5TA 2RABA 4BURA 1BZLA 2BS2A 2E5VA 2FJEA 1ZOYA 4IV9A 4XXGA 3SFEA 5M0ZA 3IHGA 4H4PA 5CKUA 2E4GA 1LV0A 3CN8A 3K7MX 1GEUA 4TM4A 4AP1A 1LQTA 5KVIA 3NG7X 2VVLA 2XVHA 4U8IA 4C77A 1D4CA 3AE9A 1PBFA 3NN0X 3KPFA 1PS9A 2C65A 2GRTA 2R0CA 2V61A 2V3BA 1BKWA 2XVIA 1P2EA 2WDVA 4PABA 1GRGA 2JKCA 4U2TA 2OAMA 3UTFA 1CJ2A 3NT6A 3ZYXA 2C75A 3LZWA 2XLRA 4Z26A 1QO8A 2BS4A 4C3YA 1GALA 2XLPA 2AAQA 1KSSA 1JOAA 4JN9A 4Y4NA 2EQ6A 4Y4LA 4K5RA 1JNRA 1NHRA 2XLSA 4CBQA 2XFPA 4NZHA 1X31B 3UKLA 1NHPA 4PAAA 4XWZA 3T14A 2X3NA 4YWOA 1N4WA 3ALJA 3NLCA 4NTDA 4OPIA 1FCDA 4JQ9A 2C66A 2X8GA 2Y6QA 1FEAA 1FL2A 3B3RA 3CNJA 3KVEA 4OPCA 5KWFA 2Q6UA 3B6DA 2RGJA 1M64A 2YLZA 5FS8A 2ZZBA 1IUUA 2Q0KA 3CNDA 4JY2A 2XVFA 3P1WA 4TLXA 2WP6A 2YLWA 3HZLA 4YSXA 3CPHG 1EL9A 3IWAA 3UTHA 3GD3A 3ALLA 4II3A 4H2RA 4A9WA 4ADWA 3F8DA 2BYBA 4FX9A 4AT0A 4BK3A 3NK0X 3II4A 4GUVA 2Z5XA 3IF9A 1F8WA 3RHAA 5GSNA 1NAAA 2QAEA 3M0OA 1GRHA 1PDHA
chains in the Genus database with same CATH topology
5KOWA 2C4CA 2H89A 3NKSA 1L9EA 1XANA 3DJJA 1LQUA 1TDNA 5BVAA 2VVMA 5JCKA 4U2SA 2XYOA 1CC2A 4GDEA 3K7TA 2QA1A 3GRTA 4NTEA 3EF6A 3DJGX 3GWFA 4GF7A 1CF3A 3S5WA 2BRAA 3BNMA 2BABA 2A8XA 1DODA 4CNKA 5DBJA 4NEWA 3AEAA 4DGKA 4WX1A 2YR4A 3AD7B 5KRQA 2DKIA 1PXBA 2EQ8A 2Y6RA 2R9ZA 2WETA 3F8RA 2B7SA 2X8CA 3S61A 4EMWA 3T31A 3VR8A 1IUTA 4TM0A 4EIPA 2FJBA 4WCTA 5KMPA 1GETA 1LJ1A 4EMJA 2V60A 4JDRA 1F6MA 1H7WA 1LTXR 2XLTA 3AE7A 3IHMA 1PBDA 1PXAA 4IVMB 1V59A 2FJDA 3AD8B 1D7LA 4H2QA 3UKKA 3VR9A 3P9UA 4FK1C 1DXLA 4P9SA 1KF6A 4Y4MA 1DOBA 2VOUA 3DK4A 1E1LA 1YY5A 4C74A 3SFDA 3G5QA 4OPDA 4CY8A 4U8MA 2HQMA 4EQXA 2C70A 4MJWA 2JB3A 2O9ZA 1H7XA 1NHQA 2Q7VA 1M6IA 4JY3A 1CBOA 1GRBA 2XDOA 1B37A 2XVJA 2Z5YA 1E39A 1JRYA 4D04A 2B9WA 1DOCA 4U2LA 2B9YA 2WPEA 3DH9A 2WU2A 1CL0A 4GCMA 2VVLG 1BGNA 2V3AA 3Q6JA 1IUWA 1MOKA 5EOWA 3NTAA 5U1OA 4YKFA 2DKHA 1XDIA 2WOVA 2B76A 3C96A 3K30A 3UKFA 4EQSA 1PXCA 3ALMA 3NRNA 3P4PA 4A7AA 2NPXA 4A79A 4USRA 4OPLA 2R0GA 3T2YA 2XFQA 1E7PA 1O95A 5JCNA 2WEUA 3UKAA 5BUKA 5KVHA 1GRTA 1OJDA 2C7GA 2VQBA 2BACA 3LJPA 1D7YA 1F3PA 3O0HA 4NEVA 2GR3A 3VRDB 2BXSA 1B8SA 1AOGA 2V6OA 4TM3A 3AYLA 4UDQA 1H86A 3FIMB 2C64A 5JCMA 5IQ1A 4Z2TA 1YQ4A 4G73A 2XFNA 3Q9TA 1O5WA 2YWLA 1H81A 4IVOB 2YG5A 3AE4A 1YKJA 5C2TA 5HXIA 4ZCDA 2GQWA 1ZMDA 2JK6A 3G5RA 1XHCA 2OALA 4GAPA 4H7UA 1KDGA 2BK5A 4K8DA 1ONFA 2RGHA 4NNJA 3CTYA 5TR3A 2R45A 2YLXA 3FMWA 4H4VA 5HY5A 2YG7A 3GMBA 1ZY8A 4EM3A 2JB2A 1XPQA 1UKVG 3P4RA 4H4SA 1E1KA 4A65A 1CHUA 4CCQA 3CGBA 3UCLA 2BRYA 3M12A 4H2PA 4H4UA 3NYCA 3H8IA 4NTCA 1E1MA 4CRTA 1KNPA 1NEKA 1FOHA 1ZKQA 1TYTA 2C67A 3KPKA 1KFYA 4RG3A 3WE0A 2WESA 1L0VA 4DSGA 2FJAA 3BNUA 3CGCA 4OPUA 4HB9A 3RP8A 1D4DA 3EAOA 1GT8A 2OA1A 4B65A 2CFYA 3UOXA 4G6HA 4LA1A 3ATQA 4G74A 4JNQA 3EANA 1GRFA 3AYIA 1SEZA 4K2XA 5J7XA 4Z44A 3T0KA 4CCRA 3C4AA 3OC4A 1Q1RA 1O94A 1ZOVA 1E6EA 1BGJA 1BWCA 2GAGB 2WU5A 1K0JA 1E1NA 3P4SA 1D4EA 4AT2A 2VZ2A 5C3JA 2AQJA 4CNJA 1OJCA 2OLNA 2B7RA 1S2QA 3AE8A 1MXTA 2GEWA 4GDPA 1FEBA 3AE1A 3QFAA 5U25A 4II2A 2TPRA 3IC9A 4D03A 4EM4A 5GRTA 5J60A 3SM8A 2YVJA 1JEHA 3EPTA 1RYIA 2FBWA 3NHOX 1NG4A 3M13A 4YKGA 4H4RA 2RGOA 1Q9IA 3ITJA 3BI5A 1TYPA 3NTDA 1TDKA 1PBBA 3KKJA 1TDOA 2C3CA 4ZN0A 4K7ZA 3UTEA 1S3EA 4JNAA 1K4QA 2F5ZA 2WQYA 3RNMA 3VQRA 4RSLA 4FK1A 2YR6A 1NENA 1VQWA 1CJ3A 3ADAB 4HA6A 4IA6A 5KMQA 2GMHA 3URHA 3V3NA 2C73A 4B1BA 4XWRA 3ATRA 3HYVA 1EL7A 4A6NA 1JNZA 3NNEA 3DJEA 3RP6A 1TDFA 1JRZA 3CNSA 3GDNA 3H8LA 3L8KA 4I59A 4U8PA 5U63A 3T2ZA 3BI2A 3UP4A 2TMDA 2APGA 2AR8A 4CY6A 1FECA 2JBVA 3SYIA 4ECHA 4C3XA 3T2KA 3UOYA 4B68A 3GWDA 3KA7A 4AOXA 3GSIA 4AOSA 1K0LA 1GSNA 1EBDA 2H88A 1QLBA 2R4JA 3FG2P 4H4XA 4Z2RA 3L1RA 2YVGA 4Z2UA 5KMSA 1N4VA 1Y56A 3SZ0A 4DNAA 3FPZA 3C4NA 3DGHA 3AE6A 4EIQA 2BC1A 2YAUA 4G6GA 4OPTA 3NYEA 2GAHB 4C5OA 2E1MA 2BCPA 3AE5A 3AE3A 3ZDNA 5JCIA 5KNLA 1LVLA 3HYWA 2WOWA 3CNPA 2YVFA 2I0ZA 4OCGA 3UP5A 3SZFA 4U8JA 3REDA 4ZCCA 1PJ6A 4UDPA 4J2WA 4YSZA 2ZBWA 2EQ7A 3V3OA 4H50A 4UDRA 1P2HA 4J34A 5EB5A 2OLOA 3QSSA 4BK2A 4EMIA 3GD4A 3GYJA 1ZDLA 3GYIA 4U8OA 4OPGA 3UOVA 5M10A 3T37A 1F8RA 3V76A 3QVPA 5LV9A 3DA1A 2ARDA 1OJ9A 2JAEA 3DK9A 1CJCA 2BC0A 3CPIG 4Z24A 4KPRA 4J36A 2PYXA 4YXDA 4GRTA 1PBCA 3DK8A 1HYUA 2C3DA 5KOXA 5CQFA 3FBSA 3UKQA 4NWZA 3E1TA 2IIDA 3LXDA 1MO9A 4GAVA 4APNA 3PS9A 1PJ5A 1IUSA 5FS9A 2GQFA 5FMHA 1N4UA 2QA2A 2XLUA 3UOZA 3VRBA 1VG9A 2XCGA 3QJ4A 4H4QA 2YM1A 1VDCA 3AEDA 4A6NB 1GTHA 2R4EA 4YT0A 4O5QA 3BHKA 3RP7A 5KMRA 2BK3A 3QVRA 1IJHA 1F8SA 3KD9A 2IVEA 3CGEA 4YSHA 1GOSA 3DMEA 1LPFA 4LU6A 1OJTA 5JCLA 5HYMA 1H6VA 2C72A 3AXBA 4N9XA 2PHHA 1QJDA 2X8HA 5IPYA 1ZK7A 4BJZA 3D1CA 3QFBA 3F8PA 4A5LA 3CGDA 2BK4A 3NIXA 3BI4A 1B4VA 3ICRA 4U8KA 3ISHA 2QCUA 3AB1A 1Y56B 1RSGA 1ZX9A 3ICSA 3CIRA 1N1PA 5FS6A 1GESA 5ER0A 5EB4A 3D8XA 4BJYA 3AEEA 2GB0A 1B5QA 2GF3A 1Y0PA 2YG6A 4X4JA 3G5SA 2WS3A 3KLJA 1IUVA 2W0HA 3NK1X 2GH5A 3P4QA 1YQZA 5EBKA 2GVCA 1DNCA 2BA9A 2R46A 2YQUA 2BS3A 4EQWA 4B66A 3PVCA 2J3NA 1PN0A 2A89A 2X50A 3BHFA 4Z25A 5IQ4A 1GV4A 3UKPA 3NK2X 1GERA 3SX6A 2VRLA 2JB1A 2WPFA 1COYA 4H4TA 2X99A 3GYXA 2NVKX 3AWIA 4UP3A 2YR5A 4Z43A 1JU2A 1KSUA 2YM2A 4G9KA 1GNDA 4H4WA 3NYFA 1CJ4A 2UZZA 2VRMA 2ZZCA 1L9DA 3NH3X 1GRAA 3CPJG 2GR0A 3DGZA 1DOEA 4LIIA 1DJQA 1TRBA 1K0IA 2Q0LA 4O5UA 2XFOA 3UKHA 4X9MA 2YG3A 1L9CA 4GR1A 2WHDA 3GDPA 2WPCA 1ZP0A 3UTGA 3LADA 2WBAA 4TM1A 3VRAA 3GMCA 1H84A 1BF3A 4KX6A 2GR1A 3LOVA 4U8LA 4YTPA 1RP0A 4BK1A 2EQ9A 1Z6LA 2IVDA 3K7QX 1H83A 4RG4A 3HYXA 4USQA 1REOA 1YQ3A 2VQ7A 3SZCA 2CVJA 2GMJA 3NN6X 5KXJA 1GXFA 3AE2A 2ZZ0A 2YG4A 4IA5A 4M52A 2BXRA 1S3BA 1Q1WA 3AYJA 3SXIA 2WOIA 4H4YA 1IUXA 3QSMA 4K5SA 2ACZA 3GRSA 3SY4A 1NG3A 3I3LA 4YTMA 4AP3A 2BCGG 1JRXA 4J56A 4YSYA 2R0PA 5BULA 4EQRA 5BRTA 4OVIA 4E0VA 4YTNA 2GV8A 2WP5A 1GPEA 3NGCX 1CC4A 4H2NA 1VRQB 4B67A 1TDEA 2XVEA 5HHFA 3AD9B 4H4ZA 1W4XA 3AEGA 3OZ2A 2WDQA 3SGLA 2XFUA 2YLTA 3AEFA 2A87A 3CNTA 4I58A 1CC6A 3PO7A 4B64A 3H4KA 3AECA 1OJAA 4DSHA 4J33A 5L46A 3DJDA 2B9XA 1ZMCA 5FS7A 4REKA 2WP9A 4K22A 4FDCB 2GR2A 1NHSA 4TLZA 3KU9A 4J31A 1GTEA 3LB8A 1DJNA 3ICTA 1VG0A 1PJ7A 2YLSA 3CMMA 2CULA 1GREA 3QSEA 4A99A 4B63A 2CDUA 4B69A 3LZXA 3SQPA 3COXA 4ICYA 4U8NA 1PHHA 3R9UA 3AEBA 3I6DA 1PBEA 1ELIA 1EL8A 1EL5A 4J57A 2V5ZA 3SZWA 1S2YA 2C76A 4BV6A 3JSKA 2YLRA 1H82A 1KNRA 4X9NA 1NPXA 2WDRA 1NDAA 3ABVA 1D5TA 2RABA 4BURA 1BZLA 2BS2A 2E5VA 2FJEA 1ZOYA 4IV9A 4XXGA 3SFEA 5M0ZA 3IHGA 4H4PA 5CKUA 2E4GA 1LV0A 3CN8A 3K7MX 1GEUA 4TM4A 4AP1A 1LQTA 5KVIA 3NG7X 2VVLA 2XVHA 4U8IA 4C77A 1D4CA 3AE9A 1PBFA 3NN0X 3KPFA 1PS9A 2C65A 2GRTA 2R0CA 2V61A 2V3BA 1BKWA 2XVIA 1P2EA 2WDVA 4PABA 1GRGA 2JKCA 4U2TA 2OAMA 3UTFA 1CJ2A 3NT6A 3ZYXA 2C75A 3LZWA 2XLRA 4Z26A 1QO8A 2BS4A 4C3YA 1GALA 2XLPA 2AAQA 1KSSA 1JOAA 4JN9A 4Y4NA 2EQ6A 4Y4LA 4K5RA 1JNRA 1NHRA 2XLSA 4CBQA 2XFPA 4NZHA 1X31B 3UKLA 1NHPA 4PAAA 4XWZA 3T14A 2X3NA 4YWOA 1N4WA 3ALJA 3NLCA 4NTDA 4OPIA 1FCDA 4JQ9A 2C66A 2X8GA 2Y6QA 1FEAA 1FL2A 3B3RA 3CNJA 3KVEA 4OPCA 5KWFA 2Q6UA 3B6DA 2RGJA 1M64A 2YLZA 5FS8A 2ZZBA 1IUUA 2Q0KA 3CNDA 4JY2A 2XVFA 3P1WA 4TLXA 2WP6A 2YLWA 3HZLA 4YSXA 3CPHG 1EL9A 3IWAA 3UTHA 3GD3A 3ALLA 4II3A 4H2RA 4A9WA 4ADWA 3F8DA 2BYBA 4FX9A 4AT0A 4BK3A 3NK0X 3II4A 4GUVA 2Z5XA 3IF9A 1F8WA 3RHAA 5GSNA 1NAAA 2QAEA 3M0OA 1GRHA 1PDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KOW A;  2H89 A;  3NKS A;  1L9E A;  1XAN A;  3DJJ A;  1LQU A;  1TDN A;  5BVA A;  2VVM A;  5JCK A;  4U2S A;  2XYO A;  1CC2 A;  4GDE A;  3K7T A;  2QA1 A;  3GRT A;  4NTE A;  3EF6 A;  3DJG X;  3GWF A;  4GF7 A;  1CF3 A;  3S5W A;  3BNM A;  2BAB A;  2A8X A;  1DOD A;  4CNK A;  5DBJ A;  4NEW A;  3AEA A;  4DGK A;  4WX1 A;  2YR4 A;  3AD7 B;  5KRQ A;  2DKI A;  1PXB A;  2EQ8 A;  2Y6R A;  2R9Z A;  2WET A;  3F8R A;  2B7S A;  2X8C A;  3S61 A;  4EMW A;  3VR8 A;  1IUT A;  4TM0 A;  4EIP A;  2FJB A;  4WCT A;  1GET A;  1LJ1 A;  4EMJ A;  2V60 A;  4JDR A;  1F6M A;  1H7W A;  1LTX R;  2XLT A;  3AE7 A;  3IHM A;  1PBD A;  1PXA A;  4IVM B;  1V59 A;  2FJD A;  3AD8 B;  1D7L A;  4H2Q A;  3UKK A;  3VR9 A;  3P9U A;  4FK1 C;  1DXL A;  4P9S A;  1KF6 A;  4Y4M A;  1DOB A;  2VOU A;  3DK4 A;  1E1L A;  1YY5 A;  4C74 A;  3SFD A;  3G5Q A;  4OPD A;  4CY8 A;  4U8M A;  2HQM A;  4EQX A;  2C70 A;  4MJW A;  2JB3 A;  2O9Z A;  1H7X A;  1NHQ A;  2Q7V A;  1M6I A;  4JY3 A;  1CBO A;  1GRB A;  2XDO A;  1B37 A;  2XVJ A;  2Z5Y A;  1E39 A;  1JRY A;  4D04 A;  2B9W A;  1DOC A;  4U2L A;  2B9Y A;  2WPE A;  3DH9 A;  2WU2 A;  1CL0 A;  4GCM A;  2VVL G;  1BGN A;  2V3A A;  3Q6J A;  1IUW A;  1MOK A;  5EOW A;  3NTA A;  5U1O A;  4YKF A;  2DKH A;  1XDI A;  2WOV A;  2B76 A;  3C96 A;  3K30 A;  3UKF A;  4EQS A;  1PXC A;  3ALM A;  3NRN A;  3P4P A;  4A7A A;  2NPX A;  4A79 A;  4USR A;  4OPL A;  2R0G A;  2XFQ A;  1E7P A;  1O95 A;  5JCN A;  2WEU A;  3UKA A;  5BUK A;  5KVH A;  1GRT A;  1OJD A;  2C7G A;  2VQB A;  2BAC A;  3LJP A;  1D7Y A;  1F3P A;  3O0H A;  4NEV A;  2GR3 A;  3VRD B;  2BXS A;  1B8S A;  1AOG A;  2V6O A;  4TM3 A;  3AYL A;  4UDQ A;  1H86 A;  3FIM B;  2C64 A;  5JCM A;  5IQ1 A;  4Z2T A;  1YQ4 A;  2XFN A;  3Q9T A;  1O5W A;  2YWL A;  1H81 A;  4IVO B;  2YG5 A;  3AE4 A;  1YKJ A;  5C2T A;  5HXI A;  4ZCD A;  2GQW A;  1ZMD A;  2JK6 A;  3G5R A;  1XHC A;  2OAL A;  4H7U A;  1KDG A;  2BK5 A;  4K8D A;  1ONF A;  2RGH A;  3CTY A;  5TR3 A;  2R45 A;  2YLX A;  3FMW A;  4H4V A;  5HY5 A;  2YG7 A;  3GMB A;  1ZY8 A;  4EM3 A;  2JB2 A;  1XPQ A;  1UKV G;  3P4R A;  4H4S A;  1E1K A;  4A65 A;  1CHU A;  4CCQ A;  3CGB A;  3UCL A;  3M12 A;  4H2P A;  4H4U A;  3NYC A;  3H8I A;  4NTC A;  1E1M A;  4CRT A;  1KNP A;  1NEK A;  1FOH A;  1ZKQ A;  1TYT A;  2C67 A;  1KFY A;  4RG3 A;  3WE0 A;  2WES A;  1L0V A;  4DSG A;  2FJA A;  3BNU A;  3CGC A;  4OPU A;  4HB9 A;  3RP8 A;  1D4D A;  3EAO A;  1GT8 A;  2OA1 A;  4B65 A;  2CFY A;  3UOX A;  4LA1 A;  3ATQ A;  4JNQ A;  3EAN A;  1GRF A;  3AYI A;  1SEZ A;  4K2X A;  5J7X A;  4Z44 A;  4CCR A;  3C4A A;  3OC4 A;  1Q1R A;  1O94 A;  1ZOV A;  1E6E A;  1BGJ A;  1BWC A;  2GAG B;  2WU5 A;  1K0J A;  1E1N A;  3P4S A;  1D4E A;  4AT2 A;  2VZ2 A;  5C3J A;  2AQJ A;  4CNJ A;  1OJC A;  2OLN A;  2B7R A;  1S2Q A;  3AE8 A;  1MXT A;  2GEW A;  4GDP A;  1FEB A;  3AE1 A;  3QFA A;  5U25 A;  2TPR A;  3IC9 A;  4D03 A;  4EM4 A;  5GRT A;  5J60 A;  3SM8 A;  2YVJ A;  1JEH A;  3EPT A;  1RYI A;  2FBW A;  3NHO X;  1NG4 A;  3M13 A;  4YKG A;  4H4R A;  2RGO A;  1Q9I A;  3ITJ A;  3BI5 A;  1TYP A;  3NTD A;  1TDK A;  1PBB A;  3KKJ A;  1TDO A;  2C3C A;  4ZN0 A;  4K7Z A;  3UTE A;  1S3E A;  4JNA A;  1K4Q A;  2F5Z A;  2WQY A;  3RNM A;  3VQR A;  4RSL A;  4FK1 A;  2YR6 A;  1NEN A;  1VQW A;  1CJ3 A;  3ADA B;  4HA6 A;  4IA6 A;  3URH A;  2GMH A;  3V3N A;  2C73 A;  4B1B A;  4XWR A;  3ATR A;  1EL7 A;  4A6N A;  1JNZ A;  3NNE A;  3DJE A;  3RP6 A;  1TDF A;  1JRZ A;  3CNS A;  3GDN A;  3H8L A;  3L8K A;  4I59 A;  4U8P A;  5U63 A;  3BI2 A;  3UP4 A;  2TMD A;  2APG A;  2AR8 A;  4CY6 A;  1FEC A;  2JBV A;  4ECH A;  4C3X A;  3UOY A;  4B68 A;  3GWD A;  3KA7 A;  4AOX A;  3GSI A;  4AOS A;  1K0L A;  1GSN A;  1EBD A;  2H88 A;  1QLB A;  2R4J A;  3FG2 P;  4H4X A;  4Z2R A;  3L1R A;  2YVG A;  4Z2U A;  1N4V A;  1Y56 A;  4DNA A;  3FPZ A;  3C4N A;  3DGH A;  3AE6 A;  4EIQ A;  2BC1 A;  2YAU A;  4OPT A;  3NYE A;  2GAH B;  4C5O A;  2E1M A;  2BCP A;  3AE5 A;  3AE3 A;  3ZDN A;  5JCI A;  1LVL A;  2WOW A;  3CNP A;  2YVF A;  2I0Z A;  4OCG A;  3UP5 A;  4U8J A;  3RED A;  4ZCC A;  1PJ6 A;  4UDP A;  4J2W A;  4YSZ A;  2ZBW A;  2EQ7 A;  3V3O A;  4H50 A;  4UDR A;  1P2H A;  4J34 A;  5EB5 A;  2OLO A;  3QSS A;  4BK2 A;  4EMI A;  3GD4 A;  3GYJ A;  1ZDL A;  3GYI A;  4U8O A;  4OPG A;  3UOV A;  5M10 A;  3T37 A;  1F8R A;  3V76 A;  3QVP A;  5LV9 A;  3DA1 A;  2ARD A;  1OJ9 A;  2JAE A;  3DK9 A;  1CJC A;  2BC0 A;  3CPI G;  4Z24 A;  4KPR A;  4J36 A;  2PYX A;  4YXD A;  4GRT A;  1PBC A;  3DK8 A;  1HYU A;  2C3D A;  5KOX A;  5CQF A;  3FBS A;  3UKQ A;  3E1T A;  2IID A;  3LXD A;  1MO9 A;  4APN A;  3PS9 A;  1PJ5 A;  1IUS A;  5FS9 A;  2GQF A;  5FMH A;  1N4U A;  2QA2 A;  2XLU A;  3UOZ A;  3VRB A;  1VG9 A;  2XCG A;  3QJ4 A;  4H4Q A;  2YM1 A;  1VDC A;  3AED A;  4A6N B;  1GTH A;  2R4E A;  4YT0 A;  4O5Q A;  3BHK A;  3RP7 A;  2BK3 A;  3QVR A;  1IJH A;  1F8S A;  3KD9 A;  2IVE A;  3CGE A;  4YSH A;  1GOS A;  3DME A;  1LPF A;  4LU6 A;  1OJT A;  5JCL A;  5HYM A;  1H6V A;  2C72 A;  3AXB A;  4N9X A;  2PHH A;  1QJD A;  2X8H A;  5IPY A;  1ZK7 A;  4BJZ A;  3D1C A;  3QFB A;  3F8P A;  4A5L A;  3CGD A;  2BK4 A;  3NIX A;  3BI4 A;  1B4V A;  3ICR A;  4U8K A;  3ISH A;  2QCU A;  3AB1 A;  1Y56 B;  1RSG A;  1ZX9 A;  3ICS A;  3CIR A;  1N1P A;  5FS6 A;  1GES A;  5ER0 A;  5EB4 A;  3D8X A;  4BJY A;  3AEE A;  2GB0 A;  1B5Q A;  2GF3 A;  1Y0P A;  2YG6 A;  4X4J A;  3G5S A;  2WS3 A;  3KLJ A;  1IUV A;  2W0H A;  3NK1 X;  2GH5 A;  3P4Q A;  1YQZ A;  5EBK A;  2GVC A;  1DNC A;  2BA9 A;  2R46 A;  2YQU A;  2BS3 A;  4EQW A;  4B66 A;  3PVC A;  2J3N A;  1PN0 A;  2A89 A;  2X50 A;  3BHF A;  4Z25 A;  5IQ4 A;  1GV4 A;  3UKP A;  3NK2 X;  1GER A;  2VRL A;  2JB1 A;  2WPF A;  1COY A;  4H4T A;  2X99 A;  2NVK X;  3AWI A;  4UP3 A;  2YR5 A;  4Z43 A;  1JU2 A;  1KSU A;  2YM2 A;  1GND A;  4H4W A;  3NYF A;  1CJ4 A;  2UZZ A;  2VRM A;  2ZZC A;  1L9D A;  3NH3 X;  1GRA A;  3CPJ G;  2GR0 A;  3DGZ A;  1DOE A;  4LII A;  1DJQ A;  1TRB A;  1K0I A;  2Q0L A;  4O5U A;  2XFO A;  3UKH A;  4X9M A;  2YG3 A;  1L9C A;  4GR1 A;  2WHD A;  3GDP A;  2WPC A;  1ZP0 A;  3UTG A;  3LAD A;  2WBA A;  4TM1 A;  3VRA A;  3GMC A;  1H84 A;  1BF3 A;  4KX6 A;  2GR1 A;  3LOV A;  4U8L A;  4YTP A;  1RP0 A;  4BK1 A;  2EQ9 A;  1Z6L A;  2IVD A;  3K7Q X;  1H83 A;  4RG4 A;  4USQ A;  1REO A;  1YQ3 A;  2VQ7 A;  2CVJ A;  2GMJ A;  3NN6 X;  5KXJ A;  1GXF A;  3AE2 A;  2ZZ0 A;  2YG4 A;  4IA5 A;  4M52 A;  2BXR A;  1S3B A;  1Q1W A;  3AYJ A;  2WOI A;  4H4Y A;  1IUX A;  3QSM A;  4K5S A;  2ACZ A;  3GRS A;  1NG3 A;  3I3L A;  4YTM A;  4AP3 A;  2BCG G;  1JRX A;  4J56 A;  4YSY A;  2R0P A;  5BUL A;  4EQR A;  5BRT A;  4OVI A;  4E0V A;  4YTN A;  2GV8 A;  2WP5 A;  1GPE A;  3NGC X;  1CC4 A;  4H2N A;  1VRQ B;  4B67 A;  1TDE A;  2XVE A;  5HHF A;  3AD9 B;  4H4Z A;  1W4X A;  3AEG A;  3OZ2 A;  2WDQ A;  3SGL A;  2XFU A;  2YLT A;  3AEF A;  2A87 A;  3CNT A;  4I58 A;  1CC6 A;  3PO7 A;  4B64 A;  3H4K A;  3AEC A;  1OJA A;  4DSH A;  4J33 A;  5L46 A;  3DJD A;  2B9X A;  1ZMC A;  5FS7 A;  4REK A;  2WP9 A;  4K22 A;  4FDC B;  2GR2 A;  1NHS A;  4TLZ A;  3KU9 A;  4J31 A;  1GTE A;  3LB8 A;  1DJN A;  3ICT A;  1VG0 A;  1PJ7 A;  2YLS A;  2CUL A;  1GRE A;  3QSE A;  4A99 A;  4B63 A;  2CDU A;  4B69 A;  3LZX A;  3SQP A;  3COX A;  4ICY A;  4U8N A;  1PHH A;  3R9U A;  3AEB A;  3I6D A;  1PBE A;  1ELI A;  1EL8 A;  1EL5 A;  4J57 A;  2V5Z A;  1S2Y A;  2C76 A;  4BV6 A;  3JSK A;  2YLR A;  1H82 A;  1KNR A;  4X9N A;  1NPX A;  2WDR A;  1NDA A;  3ABV A;  1D5T A;  2RAB A;  4BUR A;  1BZL A;  2BS2 A;  2E5V A;  2FJE A;  1ZOY A;  4IV9 A;  4XXG A;  3SFE A;  5M0Z A;  3IHG A;  4H4P A;  5CKU A;  2E4G A;  1LV0 A;  3CN8 A;  3K7M X;  1GEU A;  4TM4 A;  4AP1 A;  1LQT A;  5KVI A;  3NG7 X;  2VVL A;  2XVH A;  4U8I A;  4C77 A;  1D4C A;  3AE9 A;  1PBF A;  3NN0 X;  3KPF A;  1PS9 A;  2C65 A;  2GRT A;  2R0C A;  2V61 A;  2V3B A;  1BKW A;  2XVI A;  1P2E A;  2WDV A;  4PAB A;  1GRG A;  2JKC A;  4U2T A;  2OAM A;  3UTF A;  1CJ2 A;  3NT6 A;  3ZYX A;  2C75 A;  3LZW A;  2XLR A;  4Z26 A;  1QO8 A;  2BS4 A;  4C3Y A;  1GAL A;  2XLP A;  2AAQ A;  1KSS A;  1JOA A;  4JN9 A;  4Y4N A;  2EQ6 A;  4Y4L A;  4K5R A;  1JNR A;  1NHR A;  2XLS A;  4CBQ A;  2XFP A;  4NZH A;  1X31 B;  3UKL A;  1NHP A;  4PAA A;  4XWZ A;  2X3N A;  4YWO A;  1N4W A;  3ALJ A;  3NLC A;  4NTD A;  4OPI A;  1FCD A;  4JQ9 A;  2C66 A;  2X8G A;  2Y6Q A;  1FEA A;  1FL2 A;  3B3R A;  3CNJ A;  3KVE A;  4OPC A;  5KWF A;  2Q6U A;  3B6D A;  2RGJ A;  1M64 A;  2YLZ A;  5FS8 A;  2ZZB A;  1IUU A;  2Q0K A;  3CND A;  4JY2 A;  2XVF A;  3P1W A;  4TLX A;  2WP6 A;  2YLW A;  3HZL A;  4YSX A;  3CPH G;  1EL9 A;  3IWA A;  3UTH A;  3GD3 A;  3ALL A;  4H2R A;  4A9W A;  4ADW A;  3F8D A;  2BYB A;  4FX9 A;  4AT0 A;  4BK3 A;  3NK0 X;  3II4 A;  4GUV A;  2Z5X A;  3IF9 A;  1F8W A;  3RHA A;  5GSN A;  1NAA A;  2QAE A;  3M0O A;  1GRH A;  1PDH A; 
#chains in the Genus database with same CATH topology
 5KOW A;  2C4C A;  2H89 A;  3NKS A;  1L9E A;  1XAN A;  3DJJ A;  1LQU A;  1TDN A;  5BVA A;  2VVM A;  5JCK A;  4U2S A;  2XYO A;  1CC2 A;  4GDE A;  3K7T A;  2QA1 A;  3GRT A;  4NTE A;  3EF6 A;  3DJG X;  3GWF A;  4GF7 A;  1CF3 A;  3S5W A;  2BRA A;  3BNM A;  2BAB A;  2A8X A;  1DOD A;  4CNK A;  5DBJ A;  4NEW A;  3AEA A;  4DGK A;  4WX1 A;  2YR4 A;  3AD7 B;  5KRQ A;  2DKI A;  1PXB A;  2EQ8 A;  2Y6R A;  2R9Z A;  2WET A;  3F8R A;  2B7S A;  2X8C A;  3S61 A;  4EMW A;  3T31 A;  3VR8 A;  1IUT A;  4TM0 A;  4EIP A;  2FJB A;  4WCT A;  5KMP A;  1GET A;  1LJ1 A;  4EMJ A;  2V60 A;  4JDR A;  1F6M A;  1H7W A;  1LTX R;  2XLT A;  3AE7 A;  3IHM A;  1PBD A;  1PXA A;  4IVM B;  1V59 A;  2FJD A;  3AD8 B;  1D7L A;  4H2Q A;  3UKK A;  3VR9 A;  3P9U A;  4FK1 C;  1DXL A;  4P9S A;  1KF6 A;  4Y4M A;  1DOB A;  2VOU A;  3DK4 A;  1E1L A;  1YY5 A;  4C74 A;  3SFD A;  3G5Q A;  4OPD A;  4CY8 A;  4U8M A;  2HQM A;  4EQX A;  2C70 A;  4MJW A;  2JB3 A;  2O9Z A;  1H7X A;  1NHQ A;  2Q7V A;  1M6I A;  4JY3 A;  1CBO A;  1GRB A;  2XDO A;  1B37 A;  2XVJ A;  2Z5Y A;  1E39 A;  1JRY A;  4D04 A;  2B9W A;  1DOC A;  4U2L A;  2B9Y A;  2WPE A;  3DH9 A;  2WU2 A;  1CL0 A;  4GCM A;  2VVL G;  1BGN A;  2V3A A;  3Q6J A;  1IUW A;  1MOK A;  5EOW A;  3NTA A;  5U1O A;  4YKF A;  2DKH A;  1XDI A;  2WOV A;  2B76 A;  3C96 A;  3K30 A;  3UKF A;  4EQS A;  1PXC A;  3ALM A;  3NRN A;  3P4P A;  4A7A A;  2NPX A;  4A79 A;  4USR A;  4OPL A;  2R0G A;  3T2Y A;  2XFQ A;  1E7P A;  1O95 A;  5JCN A;  2WEU A;  3UKA A;  5BUK A;  5KVH A;  1GRT A;  1OJD A;  2C7G A;  2VQB A;  2BAC A;  3LJP A;  1D7Y A;  1F3P A;  3O0H A;  4NEV A;  2GR3 A;  3VRD B;  2BXS A;  1B8S A;  1AOG A;  2V6O A;  4TM3 A;  3AYL A;  4UDQ A;  1H86 A;  3FIM B;  2C64 A;  5JCM A;  5IQ1 A;  4Z2T A;  1YQ4 A;  4G73 A;  2XFN A;  3Q9T A;  1O5W A;  2YWL A;  1H81 A;  4IVO B;  2YG5 A;  3AE4 A;  1YKJ A;  5C2T A;  5HXI A;  4ZCD A;  2GQW A;  1ZMD A;  2JK6 A;  3G5R A;  1XHC A;  2OAL A;  4GAP A;  4H7U A;  1KDG A;  2BK5 A;  4K8D A;  1ONF A;  2RGH A;  4NNJ A;  3CTY A;  5TR3 A;  2R45 A;  2YLX A;  3FMW A;  4H4V A;  5HY5 A;  2YG7 A;  3GMB A;  1ZY8 A;  4EM3 A;  2JB2 A;  1XPQ A;  1UKV G;  3P4R A;  4H4S A;  1E1K A;  4A65 A;  1CHU A;  4CCQ A;  3CGB A;  3UCL A;  2BRY A;  3M12 A;  4H2P A;  4H4U A;  3NYC A;  3H8I A;  4NTC A;  1E1M A;  4CRT A;  1KNP A;  1NEK A;  1FOH A;  1ZKQ A;  1TYT A;  2C67 A;  3KPK A;  1KFY A;  4RG3 A;  3WE0 A;  2WES A;  1L0V A;  4DSG A;  2FJA A;  3BNU A;  3CGC A;  4OPU A;  4HB9 A;  3RP8 A;  1D4D A;  3EAO A;  1GT8 A;  2OA1 A;  4B65 A;  2CFY A;  3UOX A;  4G6H A;  4LA1 A;  3ATQ A;  4G74 A;  4JNQ A;  3EAN A;  1GRF A;  3AYI A;  1SEZ A;  4K2X A;  5J7X A;  4Z44 A;  3T0K A;  4CCR A;  3C4A A;  3OC4 A;  1Q1R A;  1O94 A;  1ZOV A;  1E6E A;  1BGJ A;  1BWC A;  2GAG B;  2WU5 A;  1K0J A;  1E1N A;  3P4S A;  1D4E A;  4AT2 A;  2VZ2 A;  5C3J A;  2AQJ A;  4CNJ A;  1OJC A;  2OLN A;  2B7R A;  1S2Q A;  3AE8 A;  1MXT A;  2GEW A;  4GDP A;  1FEB A;  3AE1 A;  3QFA A;  5U25 A;  4II2 A;  2TPR A;  3IC9 A;  4D03 A;  4EM4 A;  5GRT A;  5J60 A;  3SM8 A;  2YVJ A;  1JEH A;  3EPT A;  1RYI A;  2FBW A;  3NHO X;  1NG4 A;  3M13 A;  4YKG A;  4H4R A;  2RGO A;  1Q9I A;  3ITJ A;  3BI5 A;  1TYP A;  3NTD A;  1TDK A;  1PBB A;  3KKJ A;  1TDO A;  2C3C A;  4ZN0 A;  4K7Z A;  3UTE A;  1S3E A;  4JNA A;  1K4Q A;  2F5Z A;  2WQY A;  3RNM A;  3VQR A;  4RSL A;  4FK1 A;  2YR6 A;  1NEN A;  1VQW A;  1CJ3 A;  3ADA B;  4HA6 A;  4IA6 A;  5KMQ A;  2GMH A;  3URH A;  3V3N A;  2C73 A;  4B1B A;  4XWR A;  3ATR A;  3HYV A;  1EL7 A;  4A6N A;  1JNZ A;  3NNE A;  3DJE A;  3RP6 A;  1TDF A;  1JRZ A;  3CNS A;  3GDN A;  3H8L A;  3L8K A;  4I59 A;  4U8P A;  5U63 A;  3T2Z A;  3BI2 A;  3UP4 A;  2TMD A;  2APG A;  2AR8 A;  4CY6 A;  1FEC A;  2JBV A;  3SYI A;  4ECH A;  4C3X A;  3T2K A;  3UOY A;  4B68 A;  3GWD A;  3KA7 A;  4AOX A;  3GSI A;  4AOS A;  1K0L A;  1GSN A;  1EBD A;  2H88 A;  1QLB A;  2R4J A;  3FG2 P;  4H4X A;  4Z2R A;  3L1R A;  2YVG A;  4Z2U A;  5KMS A;  1N4V A;  1Y56 A;  3SZ0 A;  4DNA A;  3FPZ A;  3C4N A;  3DGH A;  3AE6 A;  4EIQ A;  2BC1 A;  2YAU A;  4G6G A;  4OPT A;  3NYE A;  2GAH B;  4C5O A;  2E1M A;  2BCP A;  3AE5 A;  3AE3 A;  3ZDN A;  5JCI A;  5KNL A;  1LVL A;  3HYW A;  2WOW A;  3CNP A;  2YVF A;  2I0Z A;  4OCG A;  3UP5 A;  3SZF A;  4U8J A;  3RED A;  4ZCC A;  1PJ6 A;  4UDP A;  4J2W A;  4YSZ A;  2ZBW A;  2EQ7 A;  3V3O A;  4H50 A;  4UDR A;  1P2H A;  4J34 A;  5EB5 A;  2OLO A;  3QSS A;  4BK2 A;  4EMI A;  3GD4 A;  3GYJ A;  1ZDL A;  3GYI A;  4U8O A;  4OPG A;  3UOV A;  5M10 A;  3T37 A;  1F8R A;  3V76 A;  3QVP A;  5LV9 A;  3DA1 A;  2ARD A;  1OJ9 A;  2JAE A;  3DK9 A;  1CJC A;  2BC0 A;  3CPI G;  4Z24 A;  4KPR A;  4J36 A;  2PYX A;  4YXD A;  4GRT A;  1PBC A;  3DK8 A;  1HYU A;  2C3D A;  5KOX A;  5CQF A;  3FBS A;  3UKQ A;  4NWZ A;  3E1T A;  2IID A;  3LXD A;  1MO9 A;  4GAV A;  4APN A;  3PS9 A;  1PJ5 A;  1IUS A;  5FS9 A;  2GQF A;  5FMH A;  1N4U A;  2QA2 A;  2XLU A;  3UOZ A;  3VRB A;  1VG9 A;  2XCG A;  3QJ4 A;  4H4Q A;  2YM1 A;  1VDC A;  3AED A;  4A6N B;  1GTH A;  2R4E A;  4YT0 A;  4O5Q A;  3BHK A;  3RP7 A;  5KMR A;  2BK3 A;  3QVR A;  1IJH A;  1F8S A;  3KD9 A;  2IVE A;  3CGE A;  4YSH A;  1GOS A;  3DME A;  1LPF A;  4LU6 A;  1OJT A;  5JCL A;  5HYM A;  1H6V A;  2C72 A;  3AXB A;  4N9X A;  2PHH A;  1QJD A;  2X8H A;  5IPY A;  1ZK7 A;  4BJZ A;  3D1C A;  3QFB A;  3F8P A;  4A5L A;  3CGD A;  2BK4 A;  3NIX A;  3BI4 A;  1B4V A;  3ICR A;  4U8K A;  3ISH A;  2QCU A;  3AB1 A;  1Y56 B;  1RSG A;  1ZX9 A;  3ICS A;  3CIR A;  1N1P A;  5FS6 A;  1GES A;  5ER0 A;  5EB4 A;  3D8X A;  4BJY A;  3AEE A;  2GB0 A;  1B5Q A;  2GF3 A;  1Y0P A;  2YG6 A;  4X4J A;  3G5S A;  2WS3 A;  3KLJ A;  1IUV A;  2W0H A;  3NK1 X;  2GH5 A;  3P4Q A;  1YQZ A;  5EBK A;  2GVC A;  1DNC A;  2BA9 A;  2R46 A;  2YQU A;  2BS3 A;  4EQW A;  4B66 A;  3PVC A;  2J3N A;  1PN0 A;  2A89 A;  2X50 A;  3BHF A;  4Z25 A;  5IQ4 A;  1GV4 A;  3UKP A;  3NK2 X;  1GER A;  3SX6 A;  2VRL A;  2JB1 A;  2WPF A;  1COY A;  4H4T A;  2X99 A;  3GYX A;  2NVK X;  3AWI A;  4UP3 A;  2YR5 A;  4Z43 A;  1JU2 A;  1KSU A;  2YM2 A;  4G9K A;  1GND A;  4H4W A;  3NYF A;  1CJ4 A;  2UZZ A;  2VRM A;  2ZZC A;  1L9D A;  3NH3 X;  1GRA A;  3CPJ G;  2GR0 A;  3DGZ A;  1DOE A;  4LII A;  1DJQ A;  1TRB A;  1K0I A;  2Q0L A;  4O5U A;  2XFO A;  3UKH A;  4X9M A;  2YG3 A;  1L9C A;  4GR1 A;  2WHD A;  3GDP A;  2WPC A;  1ZP0 A;  3UTG A;  3LAD A;  2WBA A;  4TM1 A;  3VRA A;  3GMC A;  1H84 A;  1BF3 A;  4KX6 A;  2GR1 A;  3LOV A;  4U8L A;  4YTP A;  1RP0 A;  4BK1 A;  2EQ9 A;  1Z6L A;  2IVD A;  3K7Q X;  1H83 A;  4RG4 A;  3HYX A;  4USQ A;  1REO A;  1YQ3 A;  2VQ7 A;  3SZC A;  2CVJ A;  2GMJ A;  3NN6 X;  5KXJ A;  1GXF A;  3AE2 A;  2ZZ0 A;  2YG4 A;  4IA5 A;  4M52 A;  2BXR A;  1S3B A;  1Q1W A;  3AYJ A;  3SXI A;  2WOI A;  4H4Y A;  1IUX A;  3QSM A;  4K5S A;  2ACZ A;  3GRS A;  3SY4 A;  1NG3 A;  3I3L A;  4YTM A;  4AP3 A;  2BCG G;  1JRX A;  4J56 A;  4YSY A;  2R0P A;  5BUL A;  4EQR A;  5BRT A;  4OVI A;  4E0V A;  4YTN A;  2GV8 A;  2WP5 A;  1GPE A;  3NGC X;  1CC4 A;  4H2N A;  1VRQ B;  4B67 A;  1TDE A;  2XVE A;  5HHF A;  3AD9 B;  4H4Z A;  1W4X A;  3AEG A;  3OZ2 A;  2WDQ A;  3SGL A;  2XFU A;  2YLT A;  3AEF A;  2A87 A;  3CNT A;  4I58 A;  1CC6 A;  3PO7 A;  4B64 A;  3H4K A;  3AEC A;  1OJA A;  4DSH A;  4J33 A;  5L46 A;  3DJD A;  2B9X A;  1ZMC A;  5FS7 A;  4REK A;  2WP9 A;  4K22 A;  4FDC B;  2GR2 A;  1NHS A;  4TLZ A;  3KU9 A;  4J31 A;  1GTE A;  3LB8 A;  1DJN A;  3ICT A;  1VG0 A;  1PJ7 A;  2YLS A;  3CMM A;  2CUL A;  1GRE A;  3QSE A;  4A99 A;  4B63 A;  2CDU A;  4B69 A;  3LZX A;  3SQP A;  3COX A;  4ICY A;  4U8N A;  1PHH A;  3R9U A;  3AEB A;  3I6D A;  1PBE A;  1ELI A;  1EL8 A;  1EL5 A;  4J57 A;  2V5Z A;  3SZW A;  1S2Y A;  2C76 A;  4BV6 A;  3JSK A;  2YLR A;  1H82 A;  1KNR A;  4X9N A;  1NPX A;  2WDR A;  1NDA A;  3ABV A;  1D5T A;  2RAB A;  4BUR A;  1BZL A;  2BS2 A;  2E5V A;  2FJE A;  1ZOY A;  4IV9 A;  4XXG A;  3SFE A;  5M0Z A;  3IHG A;  4H4P A;  5CKU A;  2E4G A;  1LV0 A;  3CN8 A;  3K7M X;  1GEU A;  4TM4 A;  4AP1 A;  1LQT A;  5KVI A;  3NG7 X;  2VVL A;  2XVH A;  4U8I A;  4C77 A;  1D4C A;  3AE9 A;  1PBF A;  3NN0 X;  3KPF A;  1PS9 A;  2C65 A;  2GRT A;  2R0C A;  2V61 A;  2V3B A;  1BKW A;  2XVI A;  1P2E A;  2WDV A;  4PAB A;  1GRG A;  2JKC A;  4U2T A;  2OAM A;  3UTF A;  1CJ2 A;  3NT6 A;  3ZYX A;  2C75 A;  3LZW A;  2XLR A;  4Z26 A;  1QO8 A;  2BS4 A;  4C3Y A;  1GAL A;  2XLP A;  2AAQ A;  1KSS A;  1JOA A;  4JN9 A;  4Y4N A;  2EQ6 A;  4Y4L A;  4K5R A;  1JNR A;  1NHR A;  2XLS A;  4CBQ A;  2XFP A;  4NZH A;  1X31 B;  3UKL A;  1NHP A;  4PAA A;  4XWZ A;  3T14 A;  2X3N A;  4YWO A;  1N4W A;  3ALJ A;  3NLC A;  4NTD A;  4OPI A;  1FCD A;  4JQ9 A;  2C66 A;  2X8G A;  2Y6Q A;  1FEA A;  1FL2 A;  3B3R A;  3CNJ A;  3KVE A;  4OPC A;  5KWF A;  2Q6U A;  3B6D A;  2RGJ A;  1M64 A;  2YLZ A;  5FS8 A;  2ZZB A;  1IUU A;  2Q0K A;  3CND A;  4JY2 A;  2XVF A;  3P1W A;  4TLX A;  2WP6 A;  2YLW A;  3HZL A;  4YSX A;  3CPH G;  1EL9 A;  3IWA A;  3UTH A;  3GD3 A;  3ALL A;  4II3 A;  4H2R A;  4A9W A;  4ADW A;  3F8D A;  2BYB A;  4FX9 A;  4AT0 A;  4BK3 A;  3NK0 X;  3II4 A;  4GUV A;  2Z5X A;  3IF9 A;  1F8W A;  3RHA A;  5GSN A;  1NAA A;  2QAE A;  3M0O A;  1GRH A;  1PDH A; 
#chains in the Genus database with same CATH homology
 5KOW A;  2C4C A;  2H89 A;  3NKS A;  1L9E A;  1XAN A;  3DJJ A;  1LQU A;  1TDN A;  5BVA A;  2VVM A;  5JCK A;  4U2S A;  2XYO A;  1CC2 A;  4GDE A;  3K7T A;  2QA1 A;  3GRT A;  4NTE A;  3EF6 A;  3DJG X;  3GWF A;  4GF7 A;  1CF3 A;  3S5W A;  2BRA A;  3BNM A;  2BAB A;  2A8X A;  1DOD A;  4CNK A;  5DBJ A;  4NEW A;  3AEA A;  4DGK A;  4WX1 A;  2YR4 A;  3AD7 B;  5KRQ A;  2DKI A;  1PXB A;  2EQ8 A;  2Y6R A;  2R9Z A;  2WET A;  3F8R A;  2B7S A;  2X8C A;  3S61 A;  4EMW A;  3T31 A;  3VR8 A;  1IUT A;  4TM0 A;  4EIP A;  2FJB A;  4WCT A;  5KMP A;  1GET A;  1LJ1 A;  4EMJ A;  2V60 A;  4JDR A;  1F6M A;  1H7W A;  1LTX R;  2XLT A;  3AE7 A;  3IHM A;  1PBD A;  1PXA A;  4IVM B;  1V59 A;  2FJD A;  3AD8 B;  1D7L A;  4H2Q A;  3UKK A;  3VR9 A;  3P9U A;  4FK1 C;  1DXL A;  4P9S A;  1KF6 A;  4Y4M A;  1DOB A;  2VOU A;  3DK4 A;  1E1L A;  1YY5 A;  4C74 A;  3SFD A;  3G5Q A;  4OPD A;  4CY8 A;  4U8M A;  2HQM A;  4EQX A;  2C70 A;  4MJW A;  2JB3 A;  2O9Z A;  1H7X A;  1NHQ A;  2Q7V A;  1M6I A;  4JY3 A;  1CBO A;  1GRB A;  2XDO A;  1B37 A;  2XVJ A;  2Z5Y A;  1E39 A;  1JRY A;  4D04 A;  2B9W A;  1DOC A;  4U2L A;  2B9Y A;  2WPE A;  3DH9 A;  2WU2 A;  1CL0 A;  4GCM A;  2VVL G;  1BGN A;  2V3A A;  3Q6J A;  1IUW A;  1MOK A;  5EOW A;  3NTA A;  5U1O A;  4YKF A;  2DKH A;  1XDI A;  2WOV A;  2B76 A;  3C96 A;  3K30 A;  3UKF A;  4EQS A;  1PXC A;  3ALM A;  3NRN A;  3P4P A;  4A7A A;  2NPX A;  4A79 A;  4USR A;  4OPL A;  2R0G A;  3T2Y A;  2XFQ A;  1E7P A;  1O95 A;  5JCN A;  2WEU A;  3UKA A;  5BUK A;  5KVH A;  1GRT A;  1OJD A;  2C7G A;  2VQB A;  2BAC A;  3LJP A;  1D7Y A;  1F3P A;  3O0H A;  4NEV A;  2GR3 A;  3VRD B;  2BXS A;  1B8S A;  1AOG A;  2V6O A;  4TM3 A;  3AYL A;  4UDQ A;  1H86 A;  3FIM B;  2C64 A;  5JCM A;  5IQ1 A;  4Z2T A;  1YQ4 A;  4G73 A;  2XFN A;  3Q9T A;  1O5W A;  2YWL A;  1H81 A;  4IVO B;  2YG5 A;  3AE4 A;  1YKJ A;  5C2T A;  5HXI A;  4ZCD A;  2GQW A;  1ZMD A;  2JK6 A;  3G5R A;  1XHC A;  2OAL A;  4GAP A;  4H7U A;  1KDG A;  2BK5 A;  4K8D A;  1ONF A;  2RGH A;  4NNJ A;  3CTY A;  5TR3 A;  2R45 A;  2YLX A;  3FMW A;  4H4V A;  5HY5 A;  2YG7 A;  3GMB A;  1ZY8 A;  4EM3 A;  2JB2 A;  1XPQ A;  1UKV G;  3P4R A;  4H4S A;  1E1K A;  4A65 A;  1CHU A;  4CCQ A;  3CGB A;  3UCL A;  2BRY A;  3M12 A;  4H2P A;  4H4U A;  3NYC A;  3H8I A;  4NTC A;  1E1M A;  4CRT A;  1KNP A;  1NEK A;  1FOH A;  1ZKQ A;  1TYT A;  2C67 A;  3KPK A;  1KFY A;  4RG3 A;  3WE0 A;  2WES A;  1L0V A;  4DSG A;  2FJA A;  3BNU A;  3CGC A;  4OPU A;  4HB9 A;  3RP8 A;  1D4D A;  3EAO A;  1GT8 A;  2OA1 A;  4B65 A;  2CFY A;  3UOX A;  4G6H A;  4LA1 A;  3ATQ A;  4G74 A;  4JNQ A;  3EAN A;  1GRF A;  3AYI A;  1SEZ A;  4K2X A;  5J7X A;  4Z44 A;  3T0K A;  4CCR A;  3C4A A;  3OC4 A;  1Q1R A;  1O94 A;  1ZOV A;  1E6E A;  1BGJ A;  1BWC A;  2GAG B;  2WU5 A;  1K0J A;  1E1N A;  3P4S A;  1D4E A;  4AT2 A;  2VZ2 A;  5C3J A;  2AQJ A;  4CNJ A;  1OJC A;  2OLN A;  2B7R A;  1S2Q A;  3AE8 A;  1MXT A;  2GEW A;  4GDP A;  1FEB A;  3AE1 A;  3QFA A;  5U25 A;  4II2 A;  2TPR A;  3IC9 A;  4D03 A;  4EM4 A;  5GRT A;  5J60 A;  3SM8 A;  2YVJ A;  1JEH A;  3EPT A;  1RYI A;  2FBW A;  3NHO X;  1NG4 A;  3M13 A;  4YKG A;  4H4R A;  2RGO A;  1Q9I A;  3ITJ A;  3BI5 A;  1TYP A;  3NTD A;  1TDK A;  1PBB A;  3KKJ A;  1TDO A;  2C3C A;  4ZN0 A;  4K7Z A;  3UTE A;  1S3E A;  4JNA A;  1K4Q A;  2F5Z A;  2WQY A;  3RNM A;  3VQR A;  4RSL A;  4FK1 A;  2YR6 A;  1NEN A;  1VQW A;  1CJ3 A;  3ADA B;  4HA6 A;  4IA6 A;  5KMQ A;  2GMH A;  3URH A;  3V3N A;  2C73 A;  4B1B A;  4XWR A;  3ATR A;  3HYV A;  1EL7 A;  4A6N A;  1JNZ A;  3NNE A;  3DJE A;  3RP6 A;  1TDF A;  1JRZ A;  3CNS A;  3GDN A;  3H8L A;  3L8K A;  4I59 A;  4U8P A;  5U63 A;  3T2Z A;  3BI2 A;  3UP4 A;  2TMD A;  2APG A;  2AR8 A;  4CY6 A;  1FEC A;  2JBV A;  3SYI A;  4ECH A;  4C3X A;  3T2K A;  3UOY A;  4B68 A;  3GWD A;  3KA7 A;  4AOX A;  3GSI A;  4AOS A;  1K0L A;  1GSN A;  1EBD A;  2H88 A;  1QLB A;  2R4J A;  3FG2 P;  4H4X A;  4Z2R A;  3L1R A;  2YVG A;  4Z2U A;  5KMS A;  1N4V A;  1Y56 A;  3SZ0 A;  4DNA A;  3FPZ A;  3C4N A;  3DGH A;  3AE6 A;  4EIQ A;  2BC1 A;  2YAU A;  4G6G A;  4OPT A;  3NYE A;  2GAH B;  4C5O A;  2E1M A;  2BCP A;  3AE5 A;  3AE3 A;  3ZDN A;  5JCI A;  5KNL A;  1LVL A;  3HYW A;  2WOW A;  3CNP A;  2YVF A;  2I0Z A;  4OCG A;  3UP5 A;  3SZF A;  4U8J A;  3RED A;  4ZCC A;  1PJ6 A;  4UDP A;  4J2W A;  4YSZ A;  2ZBW A;  2EQ7 A;  3V3O A;  4H50 A;  4UDR A;  1P2H A;  4J34 A;  5EB5 A;  2OLO A;  3QSS A;  4BK2 A;  4EMI A;  3GD4 A;  3GYJ A;  1ZDL A;  3GYI A;  4U8O A;  4OPG A;  3UOV A;  5M10 A;  3T37 A;  1F8R A;  3V76 A;  3QVP A;  5LV9 A;  3DA1 A;  2ARD A;  1OJ9 A;  2JAE A;  3DK9 A;  1CJC A;  2BC0 A;  3CPI G;  4Z24 A;  4KPR A;  4J36 A;  2PYX A;  4YXD A;  4GRT A;  1PBC A;  3DK8 A;  1HYU A;  2C3D A;  5KOX A;  5CQF A;  3FBS A;  3UKQ A;  4NWZ A;  3E1T A;  2IID A;  3LXD A;  1MO9 A;  4GAV A;  4APN A;  3PS9 A;  1PJ5 A;  1IUS A;  5FS9 A;  2GQF A;  5FMH A;  1N4U A;  2QA2 A;  2XLU A;  3UOZ A;  3VRB A;  1VG9 A;  2XCG A;  3QJ4 A;  4H4Q A;  2YM1 A;  1VDC A;  3AED A;  4A6N B;  1GTH A;  2R4E A;  4YT0 A;  4O5Q A;  3BHK A;  3RP7 A;  5KMR A;  2BK3 A;  3QVR A;  1IJH A;  1F8S A;  3KD9 A;  2IVE A;  3CGE A;  4YSH A;  1GOS A;  3DME A;  1LPF A;  4LU6 A;  1OJT A;  5JCL A;  5HYM A;  1H6V A;  2C72 A;  3AXB A;  4N9X A;  2PHH A;  1QJD A;  2X8H A;  5IPY A;  1ZK7 A;  4BJZ A;  3D1C A;  3QFB A;  3F8P A;  4A5L A;  3CGD A;  2BK4 A;  3NIX A;  3BI4 A;  1B4V A;  3ICR A;  4U8K A;  3ISH A;  2QCU A;  3AB1 A;  1Y56 B;  1RSG A;  1ZX9 A;  3ICS A;  3CIR A;  1N1P A;  5FS6 A;  1GES A;  5ER0 A;  5EB4 A;  3D8X A;  4BJY A;  3AEE A;  2GB0 A;  1B5Q A;  2GF3 A;  1Y0P A;  2YG6 A;  4X4J A;  3G5S A;  2WS3 A;  3KLJ A;  1IUV A;  2W0H A;  3NK1 X;  2GH5 A;  3P4Q A;  1YQZ A;  5EBK A;  2GVC A;  1DNC A;  2BA9 A;  2R46 A;  2YQU A;  2BS3 A;  4EQW A;  4B66 A;  3PVC A;  2J3N A;  1PN0 A;  2A89 A;  2X50 A;  3BHF A;  4Z25 A;  5IQ4 A;  1GV4 A;  3UKP A;  3NK2 X;  1GER A;  3SX6 A;  2VRL A;  2JB1 A;  2WPF A;  1COY A;  4H4T A;  2X99 A;  3GYX A;  2NVK X;  3AWI A;  4UP3 A;  2YR5 A;  4Z43 A;  1JU2 A;  1KSU A;  2YM2 A;  4G9K A;  1GND A;  4H4W A;  3NYF A;  1CJ4 A;  2UZZ A;  2VRM A;  2ZZC A;  1L9D A;  3NH3 X;  1GRA A;  3CPJ G;  2GR0 A;  3DGZ A;  1DOE A;  4LII A;  1DJQ A;  1TRB A;  1K0I A;  2Q0L A;  4O5U A;  2XFO A;  3UKH A;  4X9M A;  2YG3 A;  1L9C A;  4GR1 A;  2WHD A;  3GDP A;  2WPC A;  1ZP0 A;  3UTG A;  3LAD A;  2WBA A;  4TM1 A;  3VRA A;  3GMC A;  1H84 A;  1BF3 A;  4KX6 A;  2GR1 A;  3LOV A;  4U8L A;  4YTP A;  1RP0 A;  4BK1 A;  2EQ9 A;  1Z6L A;  2IVD A;  3K7Q X;  1H83 A;  4RG4 A;  3HYX A;  4USQ A;  1REO A;  1YQ3 A;  2VQ7 A;  3SZC A;  2CVJ A;  2GMJ A;  3NN6 X;  5KXJ A;  1GXF A;  3AE2 A;  2ZZ0 A;  2YG4 A;  4IA5 A;  4M52 A;  2BXR A;  1S3B A;  1Q1W A;  3AYJ A;  3SXI A;  2WOI A;  4H4Y A;  1IUX A;  3QSM A;  4K5S A;  2ACZ A;  3GRS A;  3SY4 A;  1NG3 A;  3I3L A;  4YTM A;  4AP3 A;  2BCG G;  1JRX A;  4J56 A;  4YSY A;  2R0P A;  5BUL A;  4EQR A;  5BRT A;  4OVI A;  4E0V A;  4YTN A;  2GV8 A;  2WP5 A;  1GPE A;  3NGC X;  1CC4 A;  4H2N A;  1VRQ B;  4B67 A;  1TDE A;  2XVE A;  5HHF A;  3AD9 B;  4H4Z A;  1W4X A;  3AEG A;  3OZ2 A;  2WDQ A;  3SGL A;  2XFU A;  2YLT A;  3AEF A;  2A87 A;  3CNT A;  4I58 A;  1CC6 A;  3PO7 A;  4B64 A;  3H4K A;  3AEC A;  1OJA A;  4DSH A;  4J33 A;  5L46 A;  3DJD A;  2B9X A;  1ZMC A;  5FS7 A;  4REK A;  2WP9 A;  4K22 A;  4FDC B;  2GR2 A;  1NHS A;  4TLZ A;  3KU9 A;  4J31 A;  1GTE A;  3LB8 A;  1DJN A;  3ICT A;  1VG0 A;  1PJ7 A;  2YLS A;  3CMM A;  2CUL A;  1GRE A;  3QSE A;  4A99 A;  4B63 A;  2CDU A;  4B69 A;  3LZX A;  3SQP A;  3COX A;  4ICY A;  4U8N A;  1PHH A;  3R9U A;  3AEB A;  3I6D A;  1PBE A;  1ELI A;  1EL8 A;  1EL5 A;  4J57 A;  2V5Z A;  3SZW A;  1S2Y A;  2C76 A;  4BV6 A;  3JSK A;  2YLR A;  1H82 A;  1KNR A;  4X9N A;  1NPX A;  2WDR A;  1NDA A;  3ABV A;  1D5T A;  2RAB A;  4BUR A;  1BZL A;  2BS2 A;  2E5V A;  2FJE A;  1ZOY A;  4IV9 A;  4XXG A;  3SFE A;  5M0Z A;  3IHG A;  4H4P A;  5CKU A;  2E4G A;  1LV0 A;  3CN8 A;  3K7M X;  1GEU A;  4TM4 A;  4AP1 A;  1LQT A;  5KVI A;  3NG7 X;  2VVL A;  2XVH A;  4U8I A;  4C77 A;  1D4C A;  3AE9 A;  1PBF A;  3NN0 X;  3KPF A;  1PS9 A;  2C65 A;  2GRT A;  2R0C A;  2V61 A;  2V3B A;  1BKW A;  2XVI A;  1P2E A;  2WDV A;  4PAB A;  1GRG A;  2JKC A;  4U2T A;  2OAM A;  3UTF A;  1CJ2 A;  3NT6 A;  3ZYX A;  2C75 A;  3LZW A;  2XLR A;  4Z26 A;  1QO8 A;  2BS4 A;  4C3Y A;  1GAL A;  2XLP A;  2AAQ A;  1KSS A;  1JOA A;  4JN9 A;  4Y4N A;  2EQ6 A;  4Y4L A;  4K5R A;  1JNR A;  1NHR A;  2XLS A;  4CBQ A;  2XFP A;  4NZH A;  1X31 B;  3UKL A;  1NHP A;  4PAA A;  4XWZ A;  3T14 A;  2X3N A;  4YWO A;  1N4W A;  3ALJ A;  3NLC A;  4NTD A;  4OPI A;  1FCD A;  4JQ9 A;  2C66 A;  2X8G A;  2Y6Q A;  1FEA A;  1FL2 A;  3B3R A;  3CNJ A;  3KVE A;  4OPC A;  5KWF A;  2Q6U A;  3B6D A;  2RGJ A;  1M64 A;  2YLZ A;  5FS8 A;  2ZZB A;  1IUU A;  2Q0K A;  3CND A;  4JY2 A;  2XVF A;  3P1W A;  4TLX A;  2WP6 A;  2YLW A;  3HZL A;  4YSX A;  3CPH G;  1EL9 A;  3IWA A;  3UTH A;  3GD3 A;  3ALL A;  4II3 A;  4H2R A;  4A9W A;  4ADW A;  3F8D A;  2BYB A;  4FX9 A;  4AT0 A;  4BK3 A;  3NK0 X;  3II4 A;  4GUV A;  2Z5X A;  3IF9 A;  1F8W A;  3RHA A;  5GSN A;  1NAA A;  2QAE A;  3M0O A;  1GRH A;  1PDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...