3GMCA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase with substrate bound
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the PLP degradative enzyme 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti MAFF303099 and its mechanistic implications.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
total genus 118
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3gmcA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gmcA01
4IVMB 1IUSA 1H84A 2RABA 2XVEA 1OJAA 4U2SA 1VDCA 2XLUA 2ZZBA 3FBSA 3GSIA 4B69A 1VQWA 1H7WA 3GRSA 4GUVA 4IA6A 4ADWA 2ACZA 4LIIA 2X8HA 3NGCX 3UTFA 4Z2RA 4REKA 2YG7A 3FIMB 4AOSA 1GV4A 1QLBA 3ATRA 3ISHA 1KFYA 2OALA 1N4WA 1Y56A 1GPEA 4APNA 1GTHA 3GD3A 4C3YA 2WESA 2WP6A 3K30A 3UP5A 1OJ9A 3SM8A 2ZZ0A 4RSLA 5BUKA 3AE8A 1BGJA 2WU5A 2A89A 1GRAA 4A6NA 2V6OA 4XXGA 3ADAB 1PBEA 2RGJA 3AXBA 3RHAA 4Y4LA 5U63A 2C66A 2QA1A 1N4UA 4ICYA 2C65A 4DSGA 4I58A 2BACA 1GERA 1DODA 1YKJA 2NPXA 1D4CA 4AT2A 1D4DA 4J36A 4U8LA 4BK2A 2JBVA 2IIDA 2YLSA 3DJEA 3ITJA 3UTEA 1UKVG 4CY6A 2IVDA 1XPQA 4GCMA 4O5QA 1ZX9A 4B1BA 3REDA 2YLTA 3KA7A 1L9CA 2DKHA 3F8DA 4BK1A 3PS9A 1GESA 1DOBA 1Q9IA 3AE1A 2C73A 1D7YA 1F8SA 2WOVA 5EOWA 2WOIA 4D03A 1CF3A 1S2QA 3AYLA 3L8KA 1GEUA 1Y56B 2C64A 3ZYXA 2XFOA 4J34A 3KKJA 3H8LA 3CGDA 2GQWA 2QAEA 2JAEA 4JDRA 3VRAA 5BULA 5J60A 1V59A 3DMEA 3UKPA 4EMIA 4Z43A 1DJNA 3RNMA 4C74A 2YQUA 4HA6A 1KF6A 1YQ3A 3AE6A 1CC6A 3KU9A 2X8GA 1KNPA 4B63A 2GR3A 3NK2X 3M12A 2ZZCA 3DGZA 2YVJA 3GYJA 5C3JA 4H2PA 3UKKA 4J57A 2IVEA 3K7QX 3KVEA 4A65A 4H4WA 2YG6A 4UDQA 4USQA 1FCDA 3VRBA 3GD4A 3P4PA 5EBKA 1XANA 1LJ1A 4JY3A 2FJEA 3HZLA 3AE9A 3LADA 4Z24A 2WDQA 1D5TA 1PDHA 3C4NA 4A7AA 3VR9A 4EMWA 1OJDA 4K2XA 1MOKA 3I3LA 4GRTA 2CDUA 4B66A 1HYUA 2AR8A 2O9ZA 4CCQA 4PABA 2WU2A 1LTXR 4U8IA 2BK3A 2C75A 3AEEA 3CTYA 3G5SA 4X4JA 4H4YA 1SEZA 2B7SA 3K7MX 1IUXA 4WCTA 3OZ2A 3KD9A 1H82A 2BK5A 2VVLA 5IQ4A 3NLCA 1QJDA 4FDCB 2EQ6A 2ZBWA 1TYTA 1P2HA 2YWLA 3BNUA 4K7ZA 3IC9A 4AP1A 2I0ZA 4BK3A 4UDPA 2WDRA 2YR6A 1VG9A 3AD8B 1VG0A 2EQ9A 1QO8A 1FEAA 3C96A 4J2WA 1GOSA 2WPEA 3B6DA 1E1MA 3NTDA 4RG3A 1KNRA 5JCNA 2UZZA 3SQPA 3NRNA 1CC2A 4K5SA 2GMJA 4NEWA 3DK4A 3BI2A 5DBJA 1CC4A 1K0IA 4ZCDA 1L0VA 1KSUA 5FS8A 3ICSA 3D1CA 3CIRA 5M0ZA 2XLPA 3NK0X 2YVFA 3H4KA 1YQ4A 4YXDA 5EB5A 1S3EA 1PBBA 2X50A 5ER0A 2XVHA 3GRTA 1ONFA 4YKGA 4YSHA 2VRMA 3D8XA 1NHPA 2J3NA 4YT0A 4JNAA 4EMJA 3GDNA 3NG7X 2Q0LA 4XWRA 3IHGA 4AT0A 4TM1A 4DNAA 1ZMDA 3AE3A 1ZDLA 1E6EA 1H81A 2GMHA 4H50A 3NKSA 1ZMCA 2V5ZA 4U8KA 5KOWA 1E7PA 2XFUA 3M13A 4EM3A 1CJ2A 2XCGA 3GWDA 3AD9B 1RP0A 1TRBA 4OVIA 1FOHA 2WOWA 2Y6QA 3IWAA 5BRTA 3CNDA 3QSSA 3AYJA 3NYFA 4OPCA 3I6DA 4CBQA 1D7LA 3F8PA 3RP6A 3KPFA 4BURA 1YY5A 2Z5YA 1BWCA 4NTDA 5TR3A 2R4JA 1PS9A 3CPHG 3GYIA 1FEBA 1GREA 2ARDA 2WP9A 4TM3A 1BKWA 2VRLA 5IQ1A 4H4VA 2JB1A 5FS7A 3ZDNA 3LB8A 4H2QA 1NAAA 1O95A 3BI4A 1KDGA 3NT6A 3P4QA 4Z44A 5KWFA 4OPLA 1NHQA 2WBAA 2WPCA 3NYEA 4RG4A 3KLJA 2B9YA 1W4XA 1ZOVA 2C70A 2H89A 2F5ZA 3G5QA 1NDAA 4NTCA 4U2TA 5KRQA 1ELIA 1B5QA 1K4QA 2Z5XA 2B9WA 1PJ7A 3LZWA 3VQRA 2GF3A 3AWIA 3UKQA 3SFDA 1CHUA 4H4QA 4TM4A 5J7XA 4DGKA 1L9DA 5KVHA 3LJPA 4AOXA 4FK1A 2YG5A 2GB0A 1PBFA 4P9SA 4U2LA 3AE2A 4A6NB 1TDOA 3FMWA 1F8WA 1XHCA 2GAHB 2OA1A 4I59A 1Q1RA 3UOYA 2GVCA 1TDNA 2V60A 3II4A 2BCGG 3Q9TA 5U1OA 4IV9A 5FS6A 1GRTA 4N9XA 2X8CA 3FG2P 5JCIA 1F6MA 4TLZA 4J33A 2FJBA 3Q6JA 1LV0A 4Y4MA 3AYIA 1GRGA 1ZOYA 3ICRA 1XDIA 2Q0KA 1K0JA 2C67A 3CGBA 4K8DA 4NEVA 1K0LA 4CCRA 1BF3A 2BA9A 2APGA 3CGEA 3P1WA 4WX1A 2XYOA 2NVKX 4CNKA 2XVIA 2YR5A 2BCPA 3DK9A 4IA5A 4GF7A 2R0CA 1Y0PA 2GH5A 2YLRA 3AECA 3FPZA 4M52A 5CQFA 3V3NA 3SFEA 4ECHA 1ZK7A 2WS3A 1D4EA 2Q6UA 1ZY8A 2E1MA 2GAGB 3DK8A 4U8PA 1LQTA 2YVGA 4YKFA 5FS9A 4HB9A 2BXRA 4Z2UA 2W0HA 2R45A 3K7TA 1NHSA 4D04A 1L9EA 1DOCA 2JK6A 3AEDA 3NN6X 4TM0A 1N4VA 3T37A 4KX6A 1COYA 1PXAA 3UTHA 1CJ3A 1DNCA 1REOA 1B8SA 1F8RA 2BC1A 2YM1A 1PXBA 4A99A 1GRHA 5JCLA 1PXCA 2GRTA 2QA2A 2WP5A 1OJTA 2WHDA 4K5RA 2R4EA 1JNRA 3CNJA 4A79A 1IUWA 3QSEA 2PYXA 3LXDA 3AE4A 1PJ6A 4DSHA 3BHKA 1NG3A 2BXSA 3EPTA 1YQZA 2BYBA 2C76A 4YTNA 1LVLA 3QVPA 1GTEA 2XLTA 3ALMA 2JB3A 4E0VA 2BS3A 5EB4A 3L1RA 4OCGA 1E1NA 4JN9A 4LU6A 1E1LA 1M64A 4EIPA 3BHFA 2A87A 4JQ9A 1P2EA 4YSYA 1ZP0A 3URHA 1EL8A 4B65A 4U8OA 1H83A 2Y6RA 4H4PA 2XVJA 3E1TA 4H4XA 2XVFA 1GRFA 2YR4A 3LOVA 2C7GA 3AEBA 4YTMA 2GR2A 3COXA 2JKCA 1DXLA 3JSKA 4GDEA 3P9UA 4UP3A 1GT8A 4H2NA 3UKFA 1GSNA 3CNTA 2XFNA 3NK1X 4K22A 1PBCA 3UP4A 2BS2A 1GRBA 1MO9A 4C3XA 2WDVA 1NG4A 2VZ2A 2HQMA 4H7UA 2V3BA 4C77A 3OC4A 1RSGA 2YLXA 4YSXA 1H86A 1E39A 3C4AA 3AEAA 4B64A 5C2TA 2TMDA 3B3RA 3VR8A 4U8NA 3EAOA 3GDPA 3ALJA 3UKLA 4Z26A 1TDKA 2GR1A 1JOAA 3H8IA 4EQSA 4YWOA 5BVAA 3IF9A 4OPUA 3EF6A 1JRXA 1VRQB 1NEKA 1CJ4A 4JNQA 3F8RA 2BK4A 3BNMA 3RP7A 1CJCA 4UDRA 4FX9A 4U8JA 1B37A 5JCMA 2CFYA 2X3NA 1CBOA 4YSZA 1EL9A 3SGLA 4ZN0A 2XLSA 3G5RA 1N1PA 1NENA 3CPIG 1OJCA 1EL5A 1BGNA 1RYIA 2VVLG 2YLZA 1JNZA 3DJJA 2XFQA 4A5LA 4AP3A 2CULA 5L46A 3ICTA 1PBDA 1ZKQA 3P4SA 2B9XA 1IJHA 1MXTA 2GR0A 1PHHA 3AD7B 4H4ZA 3QFBA 2OAMA 2TPRA 3NIXA 3NNEA 4XWZA 4EIQA 3GWFA 2R46A 4KPRA 3QVRA 3CN8A 5HY5A 2GEWA 4C5OA 5GSNA 1TDFA 1JEHA 5HYMA 4ZCCA 3V3OA 4JY2A 2A8XA 2FBWA 3UKHA 1S3BA 2XFPA 2WQYA 2YG3A 4FK1C 1E1KA 2H88A 4J56A 3CPJG 4GDPA 5LV9A 2YG4A 3QJ4A 1NPXA 1AOGA 5FMHA 3EANA 4H2RA 3UOVA 2VOUA 4H4UA 4EM4A 2XDOA 5IPYA 4MJWA 4Z25A 5HHFA 2GV8A 2YLWA 3QFAA 3S5WA 2BC0A 4H4SA 3UCLA 3AEFA 2VQBA 3DJDA 2BABA 2WETA 1F3PA 2CVJA 4H4RA 1FECA 4X9NA 4OPTA 1IUUA 2C3CA 2R9ZA 2WEUA 3NN0X 2BS4A 4OPGA 2YM2A 3NHOX 3P4RA 3VRDB 5M10A 1O94A 1DJQA 1B4VA 3DJGX 4EQWA 1KSSA 3ATQA 2V61A 2AAQA 1PN0A 1IUVA 3DGHA 5U25A 2B76A 3UKAA 4PAAA 3PO7A 4EQXA 2OLOA 3PVCA 4B68A 2VVMA 2RGOA 2JB2A 4CNJA 1M6IA 3AE7A 5GRTA 4Z2TA 3GMBA 4Y4NA 1EBDA 2DKIA 2V3AA 1FL2A 2Q7VA 3DH9A 3CNPA 4U8MA 4NTEA 4OPIA 5KXJA 2WPFA 3AEGA 3R9UA 1JRZA 3NYCA 1Q1WA 4H4TA 2XLRA 4CY8A 2E4GA 4GR1A 4X9MA 3BI5A 5CKUA 5KOXA 3UTGA 1GETA 3LZXA 2FJAA 3WE0A 3V76A 2OLNA 5HXIA 5KVIA 1O5WA 1TYPA 4IVOB 1BZLA 4BJZA 4B67A 1IUTA 2QCUA 1EL7A 2R0GA 2PHHA 3UOZA 1CL0A 1X31B 2C3DA 1GXFA 1JU2A 2EQ7A 5JCKA 3UOXA 2FJDA 4BJYA 1H7XA 2X99A 1PJ5A 4OPDA 3RP8A 3IHMA 3GMCA 1GALA 1GNDA 1H6VA 1NHRA 3AE5A 4NZHA 1Z6LA 3S61A 3NTAA 4O5UA 1DOEA 2B7RA 3DA1A 3CGCA 3QSMA 4CRTA 1S2YA 2AQJA 2RGHA 1LPFA 4J31A 3NH3X 3ALLA 2R0PA 2YAUA 4USRA 3ABVA 3AB1A 4BV6A 2GQFA 2E5VA 4EQRA 2EQ8A 1TDEA 3M0OA 2VQ7A 3CNSA 1LQUA 3O0HA 4TLXA 4YTPA 2C72A 1JRYA 4A9WA 4LA1A
chains in the Genus database with same CATH superfamily
4IVMB 1IUSA 1H84A 2RABA 2XVEA 1OJAA 4U2SA 1VDCA 2XLUA 3GSIA 2ZZBA 3FBSA 4B69A 1VQWA 4IA6A 1H7WA 3GRSA 4GUVA 4ADWA 2ACZA 4LIIA 2X8HA 3NGCX 3UTFA 4Z2RA 4REKA 2YG7A 3FIMB 4AOSA 1GV4A 1QLBA 3ATRA 3ISHA 4GAPA 1KFYA 2OALA 1N4WA 1Y56A 1GPEA 4APNA 1GTHA 3GD3A 4C3YA 2WESA 2WP6A 3K30A 3UP5A 1OJ9A 3SM8A 2ZZ0A 4RSLA 3T2YA 5BUKA 3AE8A 1BGJA 2WU5A 2A89A 1GRAA 4A6NA 2V6OA 4XXGA 3ADAB 1PBEA 2RGJA 3AXBA 3RHAA 4Y4LA 5U63A 2C66A 2QA1A 1N4UA 4ICYA 2C65A 4DSGA 4I58A 2BACA 1GERA 1DODA 1YKJA 2NPXA 1D4CA 4AT2A 1D4DA 4J36A 4BK2A 4U8LA 2JBVA 2IIDA 3DJEA 2YLSA 3ITJA 3UTEA 1UKVG 4CY6A 2IVDA 1XPQA 4GCMA 4O5QA 1ZX9A 4B1BA 3REDA 2YLTA 3KA7A 1L9CA 2DKHA 3F8DA 4BK1A 3PS9A 1GESA 1DOBA 2E4AA 1Q9IA 2C73A 1D7YA 1F8SA 2WOVA 3AE1A 4NNJA 5EOWA 2WOIA 4D03A 1CF3A 1S2QA 3AYLA 3L8KA 1Y56B 1GEUA 2C64A 3ZYXA 2XFOA 4J34A 3KKJA 3H8LA 3CGDA 2GQWA 2QAEA 2JAEA 4JDRA 3VRAA 5BULA 5J60A 1V59A 3DMEA 3UKPA 4EMIA 4Z43A 1DJNA 3RNMA 4C74A 2YQUA 4HA6A 1KF6A 1YQ3A 3AE6A 1CC6A 3KU9A 2X8GA 1KNPA 4B63A 2GR3A 3NK2X 3M12A 2ZZCA 3DGZA 2YVJA 3GYJA 5C3JA 4H2PA 3UKKA 4J57A 2IVEA 3K7QX 3KVEA 4A65A 5KMRA 4H4WA 2YG6A 4UDQA 4USQA 1FCDA 3VRBA 3GD4A 3P4PA 5EBKA 1XANA 1LJ1A 4JY3A 1C0PA 2FJEA 3HZLA 3AE9A 3LADA 4Z24A 2WDQA 1PDHA 1D5TA 5KMQA 3C4NA 4A7AA 3VR9A 4EMWA 1OJDA 3T14A 1VE9A 4K2XA 1MOKA 3I3LA 4GRTA 2CDUA 4B66A 1HYUA 2AR8A 2O9ZA 4CCQA 4PABA 2WU2A 1LTXR 4U8IA 2BK3A 2C75A 3AEEA 3CTYA 4G74A 3G5SA 3T2KA 4X4JA 4H4YA 1SEZA 2B7SA 3K7MX 4YJHA 1IUXA 4WCTA 3OZ2A 3KD9A 1H82A 2BK5A 2VVLA 5IQ4A 3NLCA 1QJDA 4FDCB 2EQ6A 2ZBWA 1TYTA 4GAVA 1P2HA 2YWLA 3BNUA 4K7ZA 3IC9A 4AP1A 2I0ZA 4BK3A 4UDPA 3HYXA 2WDRA 2YR6A 3AD8B 1VG9A 1VG0A 2EQ9A 1QO8A 1FEAA 3C96A 4J2WA 1GOSA 2WPEA 3B6DA 1E1MA 3NTDA 4RG3A 1KNRA 5JCNA 2UZZA 3SQPA 3NRNA 1DAOA 1CC2A 4K5SA 2GMJA 4NEWA 3DK4A 3BI2A 5DBJA 1CC4A 1K0IA 4ZCDA 1L0VA 1KSUA 5FS8A 5KNLA 3ICSA 3D1CA 3SZ0A 3CIRA 5M0ZA 2XLPA 3NK0X 2YVFA 3SZFA 4YJHB 3H4KA 1YQ4A 4YXDA 5EB5A 1S3EA 1PBBA 2X50A 5ER0A 2XVHA 4YSHA 1ONFA 3GRTA 4YKGA 2VRMA 3D8XA 1NHPA 2J3NA 3SZWA 4YT0A 4JNAA 4EMJA 3GDNA 3NG7X 2Q0LA 4XWRA 3IHGA 4AT0A 4TM1A 4DNAA 1ZMDA 3AE3A 1ZDLA 2GMHA 1E6EA 1H81A 4H50A 3NKSA 1ZMCA 2V5ZA 4U8KA 4QFDA 3HYVA 5KOWA 1E7PA 2XFUA 3M13A 4EM3A 1CJ2A 2XCGA 3GWDA 3AD9B 1RP0A 1TRBA 4OVIA 1FOHA 2WOWA 2Y6QA 3IWAA 5BRTA 3W4JA 3CNDA 3QSSA 4YJGB 3AYJA 3NYFA 4OPCA 3I6DA 2BRYA 1D7LA 4CBQA 3F8PA 3T2ZA 3RP6A 3KPFA 4BURA 1YY5A 2Z5YA 1BWCA 4NTDA 5TR3A 2R4JA 1PS9A 3CPHG 3GYIA 1FEBA 1GREA 2ARDA 2WP9A 4TM3A 1BKWA 2VRLA 5IQ1A 4H4VA 2JB1A 5FS7A 3ZDNA 3LB8A 4H2QA 1NAAA 1O95A 3BI4A 1KDGA 3NT6A 3P4QA 4Z44A 5KWFA 4OPLA 1NHQA 2WBAA 2WPCA 3NYEA 4RG4A 3KLJA 2B9YA 4EQRA 4II3A 1ZOVA 1W4XA 2C70A 2F5ZA 2H89A 3G5QA 1NDAA 4NTCA 4U2TA 5KRQA 1ELIA 1B5QA 4G6GA 1K4QA 2Z5XA 2B9WA 1PJ7A 3LZWA 3VQRA 2GF3A 3AWIA 3UKQA 3SFDA 1CHUA 4H4QA 4TM4A 5J7XA 4DGKA 1L9DA 5KVHA 3LJPA 4AOXA 4FK1A 2YG5A 2BRAA 2GB0A 1PBFA 4P9SA 4U2LA 3AE2A 4A6NB 1TDOA 3FMWA 2GAHB 1F8WA 3ZNNA 1XHCA 2OA1A 4I59A 1Q1RA 1C0IA 1TDNA 2GVCA 3UOYA 2V60A 3II4A 2BCGG 3Q9TA 5U1OA 4IV9A 5FS6A 1GRTA 4N9XA 2X8CA 3FG2P 5JCIA 1F6MA 4TLZA 4J33A 2FJBA 3Q6JA 1LV0A 4Y4MA 3AYIA 1GRGA 1ZOYA 3ICRA 1XDIA 2Q0KA 1K0JA 2C67A 3CGBA 4K8DA 4NEVA 1K0LA 4CCRA 1BF3A 2BA9A 3ZNOA 2APGA 3CGEA 3KPKA 3P1WA 4WX1A 2XYOA 2NVKX 4CNKA 2XVIA 2YR5A 4IA5A 2BCPA 3DK9A 4GF7A 2R0CA 1Y0PA 2GH5A 2YLRA 3AECA 3FPZA 4M52A 4G9KA 5CQFA 3V3NA 1AN9A 3SFEA 4ECHA 3HYWA 1ZK7A 2WS3A 1D4EA 2Q6UA 1ZY8A 2E1MA 2GAGB 3DK8A 4U8PA 1LQTA 2YVGA 4YKFA 5FS9A 4HB9A 2BXRA 4Z2UA 2W0HA 3T31A 2R45A 3K7TA 3WGTA 1NHSA 4D04A 1L9EA 1DOCA 2JK6A 3AEDA 3NN6X 4TM0A 1N4VA 3T37A 4KX6A 1PXAA 3CUKA 1COYA 3UTHA 1CJ3A 1DNCA 1REOA 1B8SA 1F8RA 2BC1A 2YM1A 1PXBA 4A99A 1GRHA 5JCLA 1PXCA 2GRTA 2QA2A 2WP5A 1OJTA 2WHDA 4K5RA 5KMPA 2R4EA 1JNRA 3CNJA 4A79A 1IUWA 3QSEA 2PYXA 3LXDA 3AE4A 1PJ6A 4DSHA 3BHKA 1NG3A 3EPTA 1YQZA 2BYBA 2BXSA 2C76A 4YTNA 1LVLA 3QVPA 3SZCA 1GTEA 2XLTA 3ALMA 2JB3A 4E0VA 2BS3A 5EB4A 3L1RA 4OCGA 1E1NA 4JN9A 4LU6A 1E1LA 1M64A 4EIPA 3BHFA 2A87A 4JQ9A 3G3EA 1P2EA 4YSYA 1ZP0A 3URHA 1EL8A 4B65A 4U8OA 1H83A 2Y6RA 4H4PA 2XVJA 3E1TA 4H4XA 2XVFA 1GRFA 2YR4A 3LOVA 2C7GA 3AEBA 4YTMA 2GR2A 3COXA 2JKCA 1DXLA 3JSKA 4GDEA 3P9UA 4UP3A 1GT8A 4H2NA 3UKFA 1GSNA 3CNTA 2XFNA 3NK1X 4K22A 1PBCA 5KMSA 3UP4A 2BS2A 1GRBA 1MO9A 4C3XA 2WDVA 1NG4A 2VZ2A 2HQMA 4H7UA 3ZNPA 2V3BA 4II2A 4C77A 3OC4A 1RSGA 2YLXA 4YSXA 1H86A 1E39A 3C4AA 3AEAA 4B64A 5C2TA 3T0KA 2TMDA 3B3RA 3VR8A 4U8NA 3EAOA 3GDPA 3ALJA 3SX6A 3UKLA 1TDKA 2GR1A 4Z26A 1JOAA 3H8IA 4EQSA 4YWOA 5BVAA 3IF9A 3CMMA 4OPUA 3EF6A 1VRQB 1JRXA 4NWZA 1NEKA 1CJ4A 4JNQA 3F8RA 2BK4A 3BNMA 3RP7A 1CJCA 4UDRA 4FX9A 4U8JA 1B37A 1KIFA 5JCMA 2X3NA 1CBOA 2CFYA 4YSZA 1EL9A 3SGLA 4ZN0A 2XLSA 3G5RA 1N1PA 1NENA 3CPIG 1OJCA 1EL5A 1BGNA 1RYIA 2VVLG 2YLZA 5L46A 1JNZA 2XFQA 3DJJA 4A5LA 2CULA 4AP3A 3ICTA 1PBDA 4G73A 1ZKQA 3P4SA 2B9XA 1PHHA 1IJHA 1MXTA 3AD7B 2GR0A 4H4ZA 3QFBA 2OAMA 2TPRA 4XWZA 3NIXA 3NNEA 4EIQA 1EVIA 3GWFA 2R46A 4KPRA 4YJDA 3CN8A 3QVRA 5HY5A 2GEWA 4C5OA 5GSNA 1TDFA 1JEHA 5HYMA 4ZCCA 3V3OA 4JY2A 2A8XA 2FBWA 3UKHA 3W4IA 2DU8A 1S3BA 2XFPA 2E49A 2WQYA 2YG3A 4FK1C 1E1KA 2H88A 4J56A 3CPJG 4GDPA 3SYIA 5LV9A 2YG4A 3QJ4A 1NPXA 1AOGA 3W4KA 3EANA 5FMHA 4H2RA 3UOVA 2VOUA 4H4UA 4EM4A 2XDOA 5IPYA 4QFCA 4MJWA 4Z25A 5HHFA 2GV8A 2YLWA 3QFAA 3S5WA 2BC0A 4H4SA 3UCLA 3AEFA 3DJDA 4YJFB 2BABA 2VQBA 2WETA 1F3PA 2CVJA 4H4RA 1FECA 4X9NA 4OPTA 1IUUA 2C3CA 2R9ZA 2WEUA 3SY4A 3NN0X 2BS4A 4OPGA 2YM2A 3NHOX 3P4RA 3VRDB 5M10A 1O94A 1DJQA 1B4VA 3DJGX 4EQWA 1KSSA 3ATQA 2V61A 2AAQA 1PN0A 1IUVA 3DGHA 5U25A 2B76A 3UKAA 4PAAA 3PO7A 1C0KA 4EQXA 2C4CA 2OLOA 3PVCA 4B68A 3ZNQA 2VVMA 2RGOA 2JB2A 2E48A 4CNJA 1M6IA 3AE7A 5GRTA 4Z2TA 3GMBA 4Y4NA 1EBDA 2DKIA 2V3AA 1FL2A 2Q7VA 3DH9A 3CNPA 4U8MA 4NTEA 4OPIA 5KXJA 2WPFA 3AEGA 3R9UA 1JRZA 3NYCA 1Q1WA 4H4TA 2XLRA 4CY8A 4X9MA 2E4GA 4GR1A 3BI5A 5CKUA 5KOXA 4YJFA 3UTGA 1GETA 3LZXA 2FJAA 3WE0A 3V76A 2OLNA 5HXIA 5KVIA 1O5WA 1TYPA 4IVOB 1BZLA 4BJZA 4B67A 2QCUA 1IUTA 1EL7A 2R0GA 1C0LA 2PHHA 1CL0A 1X31B 4G6HA 1DDOA 3UOZA 2C3DA 3SXIA 1GXFA 3GYXA 1JU2A 2EQ7A 5JCKA 3UOXA 4BJYA 2FJDA 1H7XA 4YJGA 1PJ5A 2X99A 3RP8A 4OPDA 3IHMA 3GMCA 1GALA 1GNDA 1H6VA 1NHRA 3AE5A 4NZHA 1Z6LA 3S61A 3NTAA 4O5UA 1DOEA 2B7RA 3DA1A 3QSMA 3CGCA 4CRTA 1S2YA 2AQJA 2RGHA 1LPFA 4J31A 3NH3X 3ALLA 2R0PA 2YAUA 4USRA 3ABVA 3AB1A 4BV6A 2E82A 2E5VA 2GQFA 3M0OA 1TDEA 2EQ8A 2VQ7A 3CNSA 1LQUA 3O0HA 4TLXA 4YTPA 2C72A 1JRYA 4A9WA 4LA1A
chains in the Genus database with same CATH topology
4IVMB 1IUSA 1H84A 2RABA 2XVEA 1OJAA 4U2SA 1VDCA 2XLUA 2ZZBA 3FBSA 3GSIA 4B69A 1VQWA 4IA6A 1H7WA 3GRSA 4GUVA 4ADWA 2ACZA 4LIIA 2X8HA 3NGCX 3UTFA 4Z2RA 4REKA 2YG7A 3FIMB 4AOSA 1GV4A 1QLBA 3ATRA 3ISHA 4GAPA 1KFYA 2OALA 1N4WA 1Y56A 1GPEA 4APNA 1GTHA 3GD3A 4C3YA 2WESA 2WP6A 3K30A 3UP5A 1OJ9A 3SM8A 2ZZ0A 4RSLA 3T2YA 5BUKA 3AE8A 1BGJA 2WU5A 2A89A 1GRAA 4A6NA 2V6OA 4XXGA 3ADAB 1PBEA 2RGJA 3AXBA 3RHAA 4Y4LA 5U63A 2C66A 2QA1A 1N4UA 4ICYA 2C65A 4DSGA 4I58A 2BACA 1GERA 1DODA 1YKJA 2NPXA 1D4CA 4AT2A 1D4DA 4J36A 4BK2A 4U8LA 2JBVA 2IIDA 2YLSA 3DJEA 3ITJA 3UTEA 1UKVG 4CY6A 2IVDA 1XPQA 4GCMA 4O5QA 1ZX9A 4B1BA 3REDA 2YLTA 3KA7A 1L9CA 2DKHA 3F8DA 4BK1A 3PS9A 1GESA 1DOBA 1Q9IA 3AE1A 2C73A 1D7YA 1F8SA 2WOVA 4NNJA 5EOWA 2WOIA 4D03A 1CF3A 1S2QA 3AYLA 3L8KA 1GEUA 1Y56B 2C64A 3ZYXA 2XFOA 4J34A 3KKJA 3H8LA 3CGDA 2GQWA 2QAEA 2JAEA 4JDRA 3VRAA 5BULA 5J60A 1V59A 3DMEA 3UKPA 4EMIA 4Z43A 1DJNA 3RNMA 4C74A 2YQUA 4HA6A 1KF6A 1YQ3A 3AE6A 1CC6A 3KU9A 2X8GA 1KNPA 4B63A 2GR3A 3NK2X 3M12A 2ZZCA 3DGZA 2YVJA 3GYJA 5C3JA 4H2PA 3UKKA 4J57A 2IVEA 3K7QX 3KVEA 4A65A 5KMRA 4H4WA 2YG6A 4UDQA 4USQA 1FCDA 3VRBA 3GD4A 3P4PA 5EBKA 1XANA 1LJ1A 4JY3A 2FJEA 3HZLA 3AE9A 3LADA 4Z24A 2WDQA 1D5TA 1PDHA 5KMQA 3C4NA 4A7AA 3VR9A 4EMWA 1OJDA 3T14A 4K2XA 1MOKA 3I3LA 4GRTA 2CDUA 4B66A 2AR8A 1HYUA 2O9ZA 4CCQA 4PABA 2WU2A 1LTXR 4U8IA 2BK3A 2C75A 3AEEA 3CTYA 4G74A 3G5SA 3T2KA 4X4JA 4H4YA 1SEZA 2B7SA 3K7MX 1IUXA 4WCTA 3OZ2A 3KD9A 1H82A 2BK5A 2VVLA 5IQ4A 3NLCA 1QJDA 4FDCB 2EQ6A 2ZBWA 1TYTA 4GAVA 1P2HA 2YWLA 3BNUA 4K7ZA 3IC9A 4AP1A 2I0ZA 4BK3A 4UDPA 3HYXA 2WDRA 2YR6A 1VG9A 3AD8B 1VG0A 2EQ9A 1QO8A 1FEAA 3C96A 4J2WA 1GOSA 2WPEA 3B6DA 1E1MA 3NTDA 4RG3A 1KNRA 5JCNA 2UZZA 3SQPA 3NRNA 1CC2A 4K5SA 2GMJA 4NEWA 3DK4A 3BI2A 5DBJA 1CC4A 1K0IA 4ZCDA 1L0VA 1KSUA 5FS8A 5KNLA 3ICSA 3D1CA 3SZ0A 3CIRA 5M0ZA 2XLPA 3NK0X 2YVFA 3SZFA 3H4KA 1YQ4A 4YXDA 5EB5A 1S3EA 1PBBA 2X50A 5ER0A 2XVHA 3GRTA 1ONFA 4YKGA 4YSHA 2VRMA 3D8XA 1NHPA 2J3NA 3SZWA 4YT0A 4JNAA 4EMJA 3GDNA 3NG7X 2Q0LA 4XWRA 3IHGA 4AT0A 4TM1A 4DNAA 1ZMDA 3AE3A 1ZDLA 2GMHA 1E6EA 1H81A 4H50A 3NKSA 1ZMCA 2V5ZA 4U8KA 3HYVA 5KOWA 1E7PA 2XFUA 3M13A 4EM3A 1CJ2A 2XCGA 3GWDA 3AD9B 1RP0A 1TRBA 4OVIA 1FOHA 2WOWA 2Y6QA 3IWAA 5BRTA 3CNDA 3QSSA 3AYJA 3NYFA 4OPCA 3I6DA 2BRYA 1D7LA 4CBQA 3F8PA 3T2ZA 3RP6A 3KPFA 4BURA 1YY5A 2Z5YA 1BWCA 4NTDA 5TR3A 2R4JA 1PS9A 3CPHG 3GYIA 1FEBA 1GREA 2ARDA 2WP9A 4TM3A 1BKWA 2VRLA 5IQ1A 4H4VA 2JB1A 5FS7A 3ZDNA 3LB8A 4H2QA 1NAAA 1O95A 3BI4A 1KDGA 3NT6A 3P4QA 4Z44A 5KWFA 4OPLA 1NHQA 2WBAA 2WPCA 3NYEA 4RG4A 3KLJA 2B9YA 4II3A 1W4XA 1ZOVA 2C70A 2F5ZA 2H89A 3G5QA 1NDAA 4NTCA 4U2TA 5KRQA 1ELIA 1B5QA 4G6GA 1K4QA 2Z5XA 2B9WA 1PJ7A 3LZWA 3VQRA 2GF3A 3AWIA 3UKQA 3SFDA 1CHUA 4H4QA 4TM4A 5J7XA 4DGKA 1L9DA 5KVHA 3LJPA 4AOXA 4FK1A 2YG5A 2BRAA 2GB0A 1PBFA 4P9SA 4U2LA 3AE2A 4A6NB 1TDOA 3FMWA 1F8WA 1XHCA 2GAHB 2OA1A 4I59A 1Q1RA 3UOYA 1TDNA 2GVCA 2V60A 3II4A 2BCGG 3Q9TA 5U1OA 4IV9A 5FS6A 1GRTA 4N9XA 2X8CA 3FG2P 5JCIA 1F6MA 4TLZA 4J33A 2FJBA 3Q6JA 1LV0A 4Y4MA 3AYIA 1GRGA 1ZOYA 3ICRA 1XDIA 2Q0KA 1K0JA 2C67A 3CGBA 4K8DA 4NEVA 1K0LA 4CCRA 1BF3A 2BA9A 2APGA 3CGEA 3KPKA 3P1WA 4WX1A 2XYOA 2NVKX 4CNKA 2XVIA 2YR5A 4IA5A 2BCPA 3DK9A 4GF7A 2R0CA 1Y0PA 2GH5A 2YLRA 3AECA 3FPZA 4M52A 4G9KA 5CQFA 3V3NA 3SFEA 4ECHA 3HYWA 1ZK7A 2WS3A 1D4EA 2Q6UA 1ZY8A 2E1MA 2GAGB 3DK8A 4U8PA 1LQTA 2YVGA 4YKFA 5FS9A 4HB9A 2BXRA 4Z2UA 2W0HA 3T31A 2R45A 3K7TA 1NHSA 4D04A 1L9EA 1DOCA 2JK6A 3AEDA 3NN6X 4TM0A 1N4VA 3T37A 4KX6A 1COYA 1PXAA 3UTHA 1CJ3A 1DNCA 1REOA 1B8SA 1F8RA 2BC1A 2YM1A 1PXBA 4A99A 1GRHA 5JCLA 1PXCA 2GRTA 2QA2A 2WP5A 1OJTA 2WHDA 4K5RA 5KMPA 2R4EA 1JNRA 3CNJA 4A79A 1IUWA 3QSEA 2PYXA 3LXDA 3AE4A 1PJ6A 4DSHA 3BHKA 1NG3A 2BXSA 3EPTA 1YQZA 2BYBA 2C76A 4YTNA 1LVLA 3QVPA 3SZCA 1GTEA 2XLTA 3ALMA 2JB3A 4E0VA 2BS3A 5EB4A 3L1RA 4OCGA 1E1NA 4JN9A 4LU6A 1E1LA 1M64A 4EIPA 3BHFA 2A87A 4JQ9A 1P2EA 4YSYA 1ZP0A 3URHA 1EL8A 4B65A 4U8OA 1H83A 2Y6RA 4H4PA 2XVJA 3E1TA 4H4XA 2XVFA 1GRFA 2YR4A 3LOVA 2C7GA 3AEBA 4YTMA 2GR2A 3COXA 2JKCA 1DXLA 3JSKA 4GDEA 3P9UA 4UP3A 1GT8A 4H2NA 3UKFA 1GSNA 3CNTA 2XFNA 3NK1X 4K22A 1PBCA 5KMSA 3UP4A 2BS2A 1GRBA 1MO9A 4C3XA 2WDVA 1NG4A 2VZ2A 2HQMA 4H7UA 2V3BA 4II2A 4C77A 3OC4A 1RSGA 2YLXA 4YSXA 1H86A 1E39A 3C4AA 3AEAA 4B64A 5C2TA 3T0KA 2TMDA 3B3RA 3VR8A 4U8NA 3EAOA 3GDPA 3ALJA 3SX6A 3UKLA 1TDKA 2GR1A 4Z26A 1JOAA 3H8IA 4EQSA 4YWOA 5BVAA 3IF9A 3CMMA 4OPUA 3EF6A 1JRXA 1VRQB 4NWZA 1NEKA 1CJ4A 4JNQA 3F8RA 2BK4A 3BNMA 3RP7A 1CJCA 4UDRA 4FX9A 4U8JA 1B37A 5JCMA 2CFYA 2X3NA 1CBOA 4YSZA 1EL9A 3SGLA 4ZN0A 2XLSA 3G5RA 1N1PA 1NENA 3CPIG 1OJCA 1EL5A 1BGNA 1RYIA 2VVLG 2YLZA 1JNZA 3DJJA 2XFQA 4A5LA 4AP3A 2CULA 5L46A 3ICTA 1PBDA 4G73A 1ZKQA 3P4SA 2B9XA 1IJHA 1MXTA 2GR0A 1PHHA 3AD7B 4H4ZA 3QFBA 2OAMA 2TPRA 3NIXA 3NNEA 4XWZA 4EIQA 3GWFA 2R46A 4KPRA 3QVRA 3CN8A 5HY5A 2GEWA 4C5OA 5GSNA 1TDFA 1JEHA 5HYMA 4ZCCA 3V3OA 4JY2A 2A8XA 2FBWA 3UKHA 1S3BA 2XFPA 2WQYA 2YG3A 4FK1C 1E1KA 2H88A 4J56A 3CPJG 4GDPA 3SYIA 5LV9A 2YG4A 3QJ4A 1NPXA 1AOGA 5FMHA 3EANA 4H2RA 3UOVA 2VOUA 4H4UA 4EM4A 2XDOA 5IPYA 4MJWA 4Z25A 5HHFA 2GV8A 2YLWA 3QFAA 3S5WA 2BC0A 4H4SA 3UCLA 3AEFA 2VQBA 3DJDA 2BABA 2WETA 1F3PA 2CVJA 4H4RA 1FECA 4X9NA 4OPTA 1IUUA 2C3CA 2R9ZA 2WEUA 3SY4A 3NN0X 2BS4A 4OPGA 2YM2A 3NHOX 3P4RA 3VRDB 5M10A 1O94A 1DJQA 1B4VA 3DJGX 4EQWA 1KSSA 3ATQA 2V61A 2AAQA 1PN0A 1IUVA 3DGHA 5U25A 2B76A 3UKAA 4PAAA 3PO7A 4EQXA 2C4CA 2OLOA 3PVCA 4B68A 2VVMA 2RGOA 2JB2A 4CNJA 1M6IA 3AE7A 5GRTA 4Z2TA 3GMBA 4Y4NA 1EBDA 2DKIA 2V3AA 1FL2A 2Q7VA 3DH9A 3CNPA 4U8MA 4NTEA 4OPIA 5KXJA 2WPFA 3AEGA 3R9UA 1JRZA 3NYCA 1Q1WA 4H4TA 2XLRA 4CY8A 2E4GA 4GR1A 4X9MA 3BI5A 5CKUA 5KOXA 3UTGA 1GETA 3LZXA 2FJAA 3WE0A 3V76A 2OLNA 5HXIA 5KVIA 1O5WA 1TYPA 4IVOB 1BZLA 4BJZA 4B67A 1IUTA 2QCUA 1EL7A 2R0GA 2PHHA 3UOZA 1CL0A 1X31B 4G6HA 2C3DA 3SXIA 1GXFA 3GYXA 1JU2A 2EQ7A 5JCKA 3UOXA 2FJDA 4BJYA 1H7XA 2X99A 1PJ5A 4OPDA 3RP8A 3IHMA 3GMCA 1GALA 1GNDA 1H6VA 1NHRA 3AE5A 4NZHA 1Z6LA 3S61A 3NTAA 4O5UA 1DOEA 2B7RA 3DA1A 3CGCA 3QSMA 4CRTA 1S2YA 2AQJA 2RGHA 1LPFA 4J31A 3NH3X 3ALLA 2R0PA 2YAUA 4USRA 3ABVA 3AB1A 4BV6A 2GQFA 2E5VA 4EQRA 2EQ8A 1TDEA 3M0OA 2VQ7A 3CNSA 1LQUA 3O0HA 4TLXA 4YTPA 2C72A 1JRYA 4A9WA 4LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVM B;  1IUS A;  1H84 A;  2RAB A;  2XVE A;  1OJA A;  4U2S A;  1VDC A;  2XLU A;  2ZZB A;  3FBS A;  3GSI A;  4B69 A;  1VQW A;  1H7W A;  3GRS A;  4GUV A;  4IA6 A;  4ADW A;  2ACZ A;  4LII A;  2X8H A;  3NGC X;  3UTF A;  4Z2R A;  4REK A;  2YG7 A;  3FIM B;  4AOS A;  1GV4 A;  1QLB A;  3ATR A;  3ISH A;  1KFY A;  2OAL A;  1N4W A;  1Y56 A;  1GPE A;  4APN A;  1GTH A;  3GD3 A;  4C3Y A;  2WES A;  2WP6 A;  3K30 A;  3UP5 A;  1OJ9 A;  3SM8 A;  2ZZ0 A;  4RSL A;  5BUK A;  3AE8 A;  1BGJ A;  2WU5 A;  2A89 A;  1GRA A;  4A6N A;  2V6O A;  4XXG A;  3ADA B;  1PBE A;  2RGJ A;  3AXB A;  3RHA A;  4Y4L A;  5U63 A;  2C66 A;  2QA1 A;  1N4U A;  4ICY A;  2C65 A;  4DSG A;  4I58 A;  2BAC A;  1GER A;  1DOD A;  1YKJ A;  2NPX A;  1D4C A;  4AT2 A;  1D4D A;  4J36 A;  4U8L A;  4BK2 A;  2JBV A;  2IID A;  2YLS A;  3DJE A;  3ITJ A;  3UTE A;  1UKV G;  4CY6 A;  2IVD A;  1XPQ A;  4GCM A;  4O5Q A;  1ZX9 A;  4B1B A;  3RED A;  2YLT A;  3KA7 A;  1L9C A;  2DKH A;  3F8D A;  4BK1 A;  3PS9 A;  1GES A;  1DOB A;  1Q9I A;  3AE1 A;  2C73 A;  1D7Y A;  1F8S A;  2WOV A;  5EOW A;  2WOI A;  4D03 A;  1CF3 A;  1S2Q A;  3AYL A;  3L8K A;  1GEU A;  1Y56 B;  2C64 A;  3ZYX A;  2XFO A;  4J34 A;  3KKJ A;  3H8L A;  3CGD A;  2GQW A;  2QAE A;  2JAE A;  4JDR A;  3VRA A;  5BUL A;  5J60 A;  1V59 A;  3DME A;  3UKP A;  4EMI A;  4Z43 A;  1DJN A;  3RNM A;  4C74 A;  2YQU A;  4HA6 A;  1KF6 A;  1YQ3 A;  3AE6 A;  1CC6 A;  3KU9 A;  2X8G A;  1KNP A;  4B63 A;  2GR3 A;  3NK2 X;  3M12 A;  2ZZC A;  3DGZ A;  2YVJ A;  3GYJ A;  5C3J A;  4H2P A;  3UKK A;  4J57 A;  2IVE A;  3K7Q X;  3KVE A;  4A65 A;  4H4W A;  2YG6 A;  4UDQ A;  4USQ A;  1FCD A;  3VRB A;  3GD4 A;  3P4P A;  5EBK A;  1XAN A;  1LJ1 A;  4JY3 A;  2FJE A;  3HZL A;  3AE9 A;  3LAD A;  4Z24 A;  2WDQ A;  1D5T A;  1PDH A;  3C4N A;  4A7A A;  3VR9 A;  4EMW A;  1OJD A;  4K2X A;  1MOK A;  3I3L A;  4GRT A;  2CDU A;  4B66 A;  1HYU A;  2AR8 A;  2O9Z A;  4CCQ A;  4PAB A;  2WU2 A;  1LTX R;  4U8I A;  2BK3 A;  2C75 A;  3AEE A;  3CTY A;  3G5S A;  4X4J A;  4H4Y A;  1SEZ A;  2B7S A;  3K7M X;  1IUX A;  4WCT A;  3OZ2 A;  3KD9 A;  1H82 A;  2BK5 A;  2VVL A;  5IQ4 A;  3NLC A;  1QJD A;  4FDC B;  2EQ6 A;  2ZBW A;  1TYT A;  1P2H A;  2YWL A;  3BNU A;  4K7Z A;  3IC9 A;  4AP1 A;  2I0Z A;  4BK3 A;  4UDP A;  2WDR A;  2YR6 A;  1VG9 A;  3AD8 B;  1VG0 A;  2EQ9 A;  1QO8 A;  1FEA A;  3C96 A;  4J2W A;  1GOS A;  2WPE A;  3B6D A;  1E1M A;  3NTD A;  4RG3 A;  1KNR A;  5JCN A;  2UZZ A;  3SQP A;  3NRN A;  1CC2 A;  4K5S A;  2GMJ A;  4NEW A;  3DK4 A;  3BI2 A;  5DBJ A;  1CC4 A;  1K0I A;  4ZCD A;  1L0V A;  1KSU A;  5FS8 A;  3ICS A;  3D1C A;  3CIR A;  5M0Z A;  2XLP A;  3NK0 X;  2YVF A;  3H4K A;  1YQ4 A;  4YXD A;  5EB5 A;  1S3E A;  1PBB A;  2X50 A;  5ER0 A;  2XVH A;  3GRT A;  1ONF A;  4YKG A;  4YSH A;  2VRM A;  3D8X A;  1NHP A;  2J3N A;  4YT0 A;  4JNA A;  4EMJ A;  3GDN A;  3NG7 X;  2Q0L A;  4XWR A;  3IHG A;  4AT0 A;  4TM1 A;  4DNA A;  1ZMD A;  3AE3 A;  1ZDL A;  1E6E A;  1H81 A;  2GMH A;  4H50 A;  3NKS A;  1ZMC A;  2V5Z A;  4U8K A;  5KOW A;  1E7P A;  2XFU A;  3M13 A;  4EM3 A;  1CJ2 A;  2XCG A;  3GWD A;  3AD9 B;  1RP0 A;  1TRB A;  4OVI A;  1FOH A;  2WOW A;  2Y6Q A;  3IWA A;  5BRT A;  3CND A;  3QSS A;  3AYJ A;  3NYF A;  4OPC A;  3I6D A;  4CBQ A;  1D7L A;  3F8P A;  3RP6 A;  3KPF A;  4BUR A;  1YY5 A;  2Z5Y A;  1BWC A;  4NTD A;  5TR3 A;  2R4J A;  1PS9 A;  3CPH G;  3GYI A;  1FEB A;  1GRE A;  2ARD A;  2WP9 A;  4TM3 A;  1BKW A;  2VRL A;  5IQ1 A;  4H4V A;  2JB1 A;  5FS7 A;  3ZDN A;  3LB8 A;  4H2Q A;  1NAA A;  1O95 A;  3BI4 A;  1KDG A;  3NT6 A;  3P4Q A;  4Z44 A;  5KWF A;  4OPL A;  1NHQ A;  2WBA A;  2WPC A;  3NYE A;  4RG4 A;  3KLJ A;  2B9Y A;  1W4X A;  1ZOV A;  2C70 A;  2H89 A;  2F5Z A;  3G5Q A;  1NDA A;  4NTC A;  4U2T A;  5KRQ A;  1ELI A;  1B5Q A;  1K4Q A;  2Z5X A;  2B9W A;  1PJ7 A;  3LZW A;  3VQR A;  2GF3 A;  3AWI A;  3UKQ A;  3SFD A;  1CHU A;  4H4Q A;  4TM4 A;  5J7X A;  4DGK A;  1L9D A;  5KVH A;  3LJP A;  4AOX A;  4FK1 A;  2YG5 A;  2GB0 A;  1PBF A;  4P9S A;  4U2L A;  3AE2 A;  4A6N B;  1TDO A;  3FMW A;  1F8W A;  1XHC A;  2GAH B;  2OA1 A;  4I59 A;  1Q1R A;  3UOY A;  2GVC A;  1TDN A;  2V60 A;  3II4 A;  2BCG G;  3Q9T A;  5U1O A;  4IV9 A;  5FS6 A;  1GRT A;  4N9X A;  2X8C A;  3FG2 P;  5JCI A;  1F6M A;  4TLZ A;  4J33 A;  2FJB A;  3Q6J A;  1LV0 A;  4Y4M A;  3AYI A;  1GRG A;  1ZOY A;  3ICR A;  1XDI A;  2Q0K A;  1K0J A;  2C67 A;  3CGB A;  4K8D A;  4NEV A;  1K0L A;  4CCR A;  1BF3 A;  2BA9 A;  2APG A;  3CGE A;  3P1W A;  4WX1 A;  2XYO A;  2NVK X;  4CNK A;  2XVI A;  2YR5 A;  2BCP A;  3DK9 A;  4IA5 A;  4GF7 A;  2R0C A;  1Y0P A;  2GH5 A;  2YLR A;  3AEC A;  3FPZ A;  4M52 A;  5CQF A;  3V3N A;  3SFE A;  4ECH A;  1ZK7 A;  2WS3 A;  1D4E A;  2Q6U A;  1ZY8 A;  2E1M A;  2GAG B;  3DK8 A;  4U8P A;  1LQT A;  2YVG A;  4YKF A;  5FS9 A;  4HB9 A;  2BXR A;  4Z2U A;  2W0H A;  2R45 A;  3K7T A;  1NHS A;  4D04 A;  1L9E A;  1DOC A;  2JK6 A;  3AED A;  3NN6 X;  4TM0 A;  1N4V A;  3T37 A;  4KX6 A;  1COY A;  1PXA A;  3UTH A;  1CJ3 A;  1DNC A;  1REO A;  1B8S A;  1F8R A;  2BC1 A;  2YM1 A;  1PXB A;  4A99 A;  1GRH A;  5JCL A;  1PXC A;  2GRT A;  2QA2 A;  2WP5 A;  1OJT A;  2WHD A;  4K5R A;  2R4E A;  1JNR A;  3CNJ A;  4A79 A;  1IUW A;  3QSE A;  2PYX A;  3LXD A;  3AE4 A;  1PJ6 A;  4DSH A;  3BHK A;  1NG3 A;  2BXS A;  3EPT A;  1YQZ A;  2BYB A;  2C76 A;  4YTN A;  1LVL A;  3QVP A;  1GTE A;  2XLT A;  3ALM A;  2JB3 A;  4E0V A;  2BS3 A;  5EB4 A;  3L1R A;  4OCG A;  1E1N A;  4JN9 A;  4LU6 A;  1E1L A;  1M64 A;  4EIP A;  3BHF A;  2A87 A;  4JQ9 A;  1P2E A;  4YSY A;  1ZP0 A;  3URH A;  1EL8 A;  4B65 A;  4U8O A;  1H83 A;  2Y6R A;  4H4P A;  2XVJ A;  3E1T A;  4H4X A;  2XVF A;  1GRF A;  2YR4 A;  3LOV A;  2C7G A;  3AEB A;  4YTM A;  2GR2 A;  3COX A;  2JKC A;  1DXL A;  3JSK A;  4GDE A;  3P9U A;  4UP3 A;  1GT8 A;  4H2N A;  3UKF A;  1GSN A;  3CNT A;  2XFN A;  3NK1 X;  4K22 A;  1PBC A;  3UP4 A;  2BS2 A;  1GRB A;  1MO9 A;  4C3X A;  2WDV A;  1NG4 A;  2VZ2 A;  2HQM A;  4H7U A;  2V3B A;  4C77 A;  3OC4 A;  1RSG A;  2YLX A;  4YSX A;  1H86 A;  1E39 A;  3C4A A;  3AEA A;  4B64 A;  5C2T A;  2TMD A;  3B3R A;  3VR8 A;  4U8N A;  3EAO A;  3GDP A;  3ALJ A;  3UKL A;  4Z26 A;  1TDK A;  2GR1 A;  1JOA A;  3H8I A;  4EQS A;  4YWO A;  5BVA A;  3IF9 A;  4OPU A;  3EF6 A;  1JRX A;  1VRQ B;  1NEK A;  1CJ4 A;  4JNQ A;  3F8R A;  2BK4 A;  3BNM A;  3RP7 A;  1CJC A;  4UDR A;  4FX9 A;  4U8J A;  1B37 A;  5JCM A;  2CFY A;  2X3N A;  1CBO A;  4YSZ A;  1EL9 A;  3SGL A;  4ZN0 A;  2XLS A;  3G5R A;  1N1P A;  1NEN A;  3CPI G;  1OJC A;  1EL5 A;  1BGN A;  1RYI A;  2VVL G;  2YLZ A;  1JNZ A;  3DJJ A;  2XFQ A;  4A5L A;  4AP3 A;  2CUL A;  5L46 A;  3ICT A;  1PBD A;  1ZKQ A;  3P4S A;  2B9X A;  1IJH A;  1MXT A;  2GR0 A;  1PHH A;  3AD7 B;  4H4Z A;  3QFB A;  2OAM A;  2TPR A;  3NIX A;  3NNE A;  4XWZ A;  4EIQ A;  3GWF A;  2R46 A;  4KPR A;  3QVR A;  3CN8 A;  5HY5 A;  2GEW A;  4C5O A;  5GSN A;  1TDF A;  1JEH A;  5HYM A;  4ZCC A;  3V3O A;  4JY2 A;  2A8X A;  2FBW A;  3UKH A;  1S3B A;  2XFP A;  2WQY A;  2YG3 A;  4FK1 C;  1E1K A;  2H88 A;  4J56 A;  3CPJ G;  4GDP A;  5LV9 A;  2YG4 A;  3QJ4 A;  1NPX A;  1AOG A;  5FMH A;  3EAN A;  4H2R A;  3UOV A;  2VOU A;  4H4U A;  4EM4 A;  2XDO A;  5IPY A;  4MJW A;  4Z25 A;  5HHF A;  2GV8 A;  2YLW A;  3QFA A;  3S5W A;  2BC0 A;  4H4S A;  3UCL A;  3AEF A;  2VQB A;  3DJD A;  2BAB A;  2WET A;  1F3P A;  2CVJ A;  4H4R A;  1FEC A;  4X9N A;  4OPT A;  1IUU A;  2C3C A;  2R9Z A;  2WEU A;  3NN0 X;  2BS4 A;  4OPG A;  2YM2 A;  3NHO X;  3P4R A;  3VRD B;  5M10 A;  1O94 A;  1DJQ A;  1B4V A;  3DJG X;  4EQW A;  1KSS A;  3ATQ A;  2V61 A;  2AAQ A;  1PN0 A;  1IUV A;  3DGH A;  5U25 A;  2B76 A;  3UKA A;  4PAA A;  3PO7 A;  4EQX A;  2OLO A;  3PVC A;  4B68 A;  2VVM A;  2RGO A;  2JB2 A;  4CNJ A;  1M6I A;  3AE7 A;  5GRT A;  4Z2T A;  3GMB A;  4Y4N A;  1EBD A;  2DKI A;  2V3A A;  1FL2 A;  2Q7V A;  3DH9 A;  3CNP A;  4U8M A;  4NTE A;  4OPI A;  5KXJ A;  2WPF A;  3AEG A;  3R9U A;  1JRZ A;  3NYC A;  1Q1W A;  4H4T A;  2XLR A;  4CY8 A;  2E4G A;  4GR1 A;  4X9M A;  3BI5 A;  5CKU A;  5KOX A;  3UTG A;  1GET A;  3LZX A;  2FJA A;  3WE0 A;  3V76 A;  2OLN A;  5HXI A;  5KVI A;  1O5W A;  1TYP A;  4IVO B;  1BZL A;  4BJZ A;  4B67 A;  1IUT A;  2QCU A;  1EL7 A;  2R0G A;  2PHH A;  3UOZ A;  1CL0 A;  1X31 B;  2C3D A;  1GXF A;  1JU2 A;  2EQ7 A;  5JCK A;  3UOX A;  2FJD A;  4BJY A;  1H7X A;  2X99 A;  1PJ5 A;  4OPD A;  3RP8 A;  3IHM A;  3GMC A;  1GAL A;  1GND A;  1H6V A;  1NHR A;  3AE5 A;  4NZH A;  1Z6L A;  3S61 A;  3NTA A;  4O5U A;  1DOE A;  2B7R A;  3DA1 A;  3CGC A;  3QSM A;  4CRT A;  1S2Y A;  2AQJ A;  2RGH A;  1LPF A;  4J31 A;  3NH3 X;  3ALL A;  2R0P A;  2YAU A;  4USR A;  3ABV A;  3AB1 A;  4BV6 A;  2GQF A;  2E5V A;  4EQR A;  2EQ8 A;  1TDE A;  3M0O A;  2VQ7 A;  3CNS A;  1LQU A;  3O0H A;  4TLX A;  4YTP A;  2C72 A;  1JRY A;  4A9W A;  4LA1 A; 
#chains in the Genus database with same CATH topology
 4IVM B;  1IUS A;  1H84 A;  2RAB A;  2XVE A;  1OJA A;  4U2S A;  1VDC A;  2XLU A;  3GSI A;  2ZZB A;  3FBS A;  4B69 A;  1VQW A;  4IA6 A;  1H7W A;  3GRS A;  4GUV A;  4ADW A;  2ACZ A;  4LII A;  2X8H A;  3NGC X;  3UTF A;  4Z2R A;  4REK A;  2YG7 A;  3FIM B;  4AOS A;  1GV4 A;  1QLB A;  3ATR A;  3ISH A;  4GAP A;  1KFY A;  2OAL A;  1N4W A;  1Y56 A;  1GPE A;  4APN A;  1GTH A;  3GD3 A;  4C3Y A;  2WES A;  2WP6 A;  3K30 A;  3UP5 A;  1OJ9 A;  3SM8 A;  2ZZ0 A;  4RSL A;  3T2Y A;  5BUK A;  3AE8 A;  1BGJ A;  2WU5 A;  2A89 A;  1GRA A;  4A6N A;  2V6O A;  4XXG A;  3ADA B;  1PBE A;  2RGJ A;  3AXB A;  3RHA A;  4Y4L A;  5U63 A;  2C66 A;  2QA1 A;  1N4U A;  4ICY A;  2C65 A;  4DSG A;  4I58 A;  2BAC A;  1GER A;  1DOD A;  1YKJ A;  2NPX A;  1D4C A;  4AT2 A;  1D4D A;  4J36 A;  4BK2 A;  4U8L A;  2JBV A;  2IID A;  3DJE A;  2YLS A;  3ITJ A;  3UTE A;  1UKV G;  4CY6 A;  2IVD A;  1XPQ A;  4GCM A;  4O5Q A;  1ZX9 A;  4B1B A;  3RED A;  2YLT A;  3KA7 A;  1L9C A;  2DKH A;  3F8D A;  4BK1 A;  3PS9 A;  1GES A;  1DOB A;  2E4A A;  1Q9I A;  2C73 A;  1D7Y A;  1F8S A;  2WOV A;  3AE1 A;  4NNJ A;  5EOW A;  2WOI A;  4D03 A;  1CF3 A;  1S2Q A;  3AYL A;  3L8K A;  1Y56 B;  1GEU A;  2C64 A;  3ZYX A;  2XFO A;  4J34 A;  3KKJ A;  3H8L A;  3CGD A;  2GQW A;  2QAE A;  2JAE A;  4JDR A;  3VRA A;  5BUL A;  5J60 A;  1V59 A;  3DME A;  3UKP A;  4EMI A;  4Z43 A;  1DJN A;  3RNM A;  4C74 A;  2YQU A;  4HA6 A;  1KF6 A;  1YQ3 A;  3AE6 A;  1CC6 A;  3KU9 A;  2X8G A;  1KNP A;  4B63 A;  2GR3 A;  3NK2 X;  3M12 A;  2ZZC A;  3DGZ A;  2YVJ A;  3GYJ A;  5C3J A;  4H2P A;  3UKK A;  4J57 A;  2IVE A;  3K7Q X;  3KVE A;  4A65 A;  5KMR A;  4H4W A;  2YG6 A;  4UDQ A;  4USQ A;  1FCD A;  3VRB A;  3GD4 A;  3P4P A;  5EBK A;  1XAN A;  1LJ1 A;  4JY3 A;  1C0P A;  2FJE A;  3HZL A;  3AE9 A;  3LAD A;  4Z24 A;  2WDQ A;  1PDH A;  1D5T A;  5KMQ A;  3C4N A;  4A7A A;  3VR9 A;  4EMW A;  1OJD A;  3T14 A;  1VE9 A;  4K2X A;  1MOK A;  3I3L A;  4GRT A;  2CDU A;  4B66 A;  1HYU A;  2AR8 A;  2O9Z A;  4CCQ A;  4PAB A;  2WU2 A;  1LTX R;  4U8I A;  2BK3 A;  2C75 A;  3AEE A;  3CTY A;  4G74 A;  3G5S A;  3T2K A;  4X4J A;  4H4Y A;  1SEZ A;  2B7S A;  3K7M X;  4YJH A;  1IUX A;  4WCT A;  3OZ2 A;  3KD9 A;  1H82 A;  2BK5 A;  2VVL A;  5IQ4 A;  3NLC A;  1QJD A;  4FDC B;  2EQ6 A;  2ZBW A;  1TYT A;  4GAV A;  1P2H A;  2YWL A;  3BNU A;  4K7Z A;  3IC9 A;  4AP1 A;  2I0Z A;  4BK3 A;  4UDP A;  3HYX A;  2WDR A;  2YR6 A;  3AD8 B;  1VG9 A;  1VG0 A;  2EQ9 A;  1QO8 A;  1FEA A;  3C96 A;  4J2W A;  1GOS A;  2WPE A;  3B6D A;  1E1M A;  3NTD A;  4RG3 A;  1KNR A;  5JCN A;  2UZZ A;  3SQP A;  3NRN A;  1DAO A;  1CC2 A;  4K5S A;  2GMJ A;  4NEW A;  3DK4 A;  3BI2 A;  5DBJ A;  1CC4 A;  1K0I A;  4ZCD A;  1L0V A;  1KSU A;  5FS8 A;  5KNL A;  3ICS A;  3D1C A;  3SZ0 A;  3CIR A;  5M0Z A;  2XLP A;  3NK0 X;  2YVF A;  3SZF A;  4YJH B;  3H4K A;  1YQ4 A;  4YXD A;  5EB5 A;  1S3E A;  1PBB A;  2X50 A;  5ER0 A;  2XVH A;  4YSH A;  1ONF A;  3GRT A;  4YKG A;  2VRM A;  3D8X A;  1NHP A;  2J3N A;  3SZW A;  4YT0 A;  4JNA A;  4EMJ A;  3GDN A;  3NG7 X;  2Q0L A;  4XWR A;  3IHG A;  4AT0 A;  4TM1 A;  4DNA A;  1ZMD A;  3AE3 A;  1ZDL A;  2GMH A;  1E6E A;  1H81 A;  4H50 A;  3NKS A;  1ZMC A;  2V5Z A;  4U8K A;  4QFD A;  3HYV A;  5KOW A;  1E7P A;  2XFU A;  3M13 A;  4EM3 A;  1CJ2 A;  2XCG A;  3GWD A;  3AD9 B;  1RP0 A;  1TRB A;  4OVI A;  1FOH A;  2WOW A;  2Y6Q A;  3IWA A;  5BRT A;  3W4J A;  3CND A;  3QSS A;  4YJG B;  3AYJ A;  3NYF A;  4OPC A;  3I6D A;  2BRY A;  1D7L A;  4CBQ A;  3F8P A;  3T2Z A;  3RP6 A;  3KPF A;  4BUR A;  1YY5 A;  2Z5Y A;  1BWC A;  4NTD A;  5TR3 A;  2R4J A;  1PS9 A;  3CPH G;  3GYI A;  1FEB A;  1GRE A;  2ARD A;  2WP9 A;  4TM3 A;  1BKW A;  2VRL A;  5IQ1 A;  4H4V A;  2JB1 A;  5FS7 A;  3ZDN A;  3LB8 A;  4H2Q A;  1NAA A;  1O95 A;  3BI4 A;  1KDG A;  3NT6 A;  3P4Q A;  4Z44 A;  5KWF A;  4OPL A;  1NHQ A;  2WBA A;  2WPC A;  3NYE A;  4RG4 A;  3KLJ A;  2B9Y A;  4EQR A;  4II3 A;  1ZOV A;  1W4X A;  2C70 A;  2F5Z A;  2H89 A;  3G5Q A;  1NDA A;  4NTC A;  4U2T A;  5KRQ A;  1ELI A;  1B5Q A;  4G6G A;  1K4Q A;  2Z5X A;  2B9W A;  1PJ7 A;  3LZW A;  3VQR A;  2GF3 A;  3AWI A;  3UKQ A;  3SFD A;  1CHU A;  4H4Q A;  4TM4 A;  5J7X A;  4DGK A;  1L9D A;  5KVH A;  3LJP A;  4AOX A;  4FK1 A;  2YG5 A;  2BRA A;  2GB0 A;  1PBF A;  4P9S A;  4U2L A;  3AE2 A;  4A6N B;  1TDO A;  3FMW A;  2GAH B;  1F8W A;  3ZNN A;  1XHC A;  2OA1 A;  4I59 A;  1Q1R A;  1C0I A;  1TDN A;  2GVC A;  3UOY A;  2V60 A;  3II4 A;  2BCG G;  3Q9T A;  5U1O A;  4IV9 A;  5FS6 A;  1GRT A;  4N9X A;  2X8C A;  3FG2 P;  5JCI A;  1F6M A;  4TLZ A;  4J33 A;  2FJB A;  3Q6J A;  1LV0 A;  4Y4M A;  3AYI A;  1GRG A;  1ZOY A;  3ICR A;  1XDI A;  2Q0K A;  1K0J A;  2C67 A;  3CGB A;  4K8D A;  4NEV A;  1K0L A;  4CCR A;  1BF3 A;  2BA9 A;  3ZNO A;  2APG A;  3CGE A;  3KPK A;  3P1W A;  4WX1 A;  2XYO A;  2NVK X;  4CNK A;  2XVI A;  2YR5 A;  4IA5 A;  2BCP A;  3DK9 A;  4GF7 A;  2R0C A;  1Y0P A;  2GH5 A;  2YLR A;  3AEC A;  3FPZ A;  4M52 A;  4G9K A;  5CQF A;  3V3N A;  1AN9 A;  3SFE A;  4ECH A;  3HYW A;  1ZK7 A;  2WS3 A;  1D4E A;  2Q6U A;  1ZY8 A;  2E1M A;  2GAG B;  3DK8 A;  4U8P A;  1LQT A;  2YVG A;  4YKF A;  5FS9 A;  4HB9 A;  2BXR A;  4Z2U A;  2W0H A;  3T31 A;  2R45 A;  3K7T A;  3WGT A;  1NHS A;  4D04 A;  1L9E A;  1DOC A;  2JK6 A;  3AED A;  3NN6 X;  4TM0 A;  1N4V A;  3T37 A;  4KX6 A;  1PXA A;  3CUK A;  1COY A;  3UTH A;  1CJ3 A;  1DNC A;  1REO A;  1B8S A;  1F8R A;  2BC1 A;  2YM1 A;  1PXB A;  4A99 A;  1GRH A;  5JCL A;  1PXC A;  2GRT A;  2QA2 A;  2WP5 A;  1OJT A;  2WHD A;  4K5R A;  5KMP A;  2R4E A;  1JNR A;  3CNJ A;  4A79 A;  1IUW A;  3QSE A;  2PYX A;  3LXD A;  3AE4 A;  1PJ6 A;  4DSH A;  3BHK A;  1NG3 A;  3EPT A;  1YQZ A;  2BYB A;  2BXS A;  2C76 A;  4YTN A;  1LVL A;  3QVP A;  3SZC A;  1GTE A;  2XLT A;  3ALM A;  2JB3 A;  4E0V A;  2BS3 A;  5EB4 A;  3L1R A;  4OCG A;  1E1N A;  4JN9 A;  4LU6 A;  1E1L A;  1M64 A;  4EIP A;  3BHF A;  2A87 A;  4JQ9 A;  3G3E A;  1P2E A;  4YSY A;  1ZP0 A;  3URH A;  1EL8 A;  4B65 A;  4U8O A;  1H83 A;  2Y6R A;  4H4P A;  2XVJ A;  3E1T A;  4H4X A;  2XVF A;  1GRF A;  2YR4 A;  3LOV A;  2C7G A;  3AEB A;  4YTM A;  2GR2 A;  3COX A;  2JKC A;  1DXL A;  3JSK A;  4GDE A;  3P9U A;  4UP3 A;  1GT8 A;  4H2N A;  3UKF A;  1GSN A;  3CNT A;  2XFN A;  3NK1 X;  4K22 A;  1PBC A;  5KMS A;  3UP4 A;  2BS2 A;  1GRB A;  1MO9 A;  4C3X A;  2WDV A;  1NG4 A;  2VZ2 A;  2HQM A;  4H7U A;  3ZNP A;  2V3B A;  4II2 A;  4C77 A;  3OC4 A;  1RSG A;  2YLX A;  4YSX A;  1H86 A;  1E39 A;  3C4A A;  3AEA A;  4B64 A;  5C2T A;  3T0K A;  2TMD A;  3B3R A;  3VR8 A;  4U8N A;  3EAO A;  3GDP A;  3ALJ A;  3SX6 A;  3UKL A;  1TDK A;  2GR1 A;  4Z26 A;  1JOA A;  3H8I A;  4EQS A;  4YWO A;  5BVA A;  3IF9 A;  3CMM A;  4OPU A;  3EF6 A;  1VRQ B;  1JRX A;  4NWZ A;  1NEK A;  1CJ4 A;  4JNQ A;  3F8R A;  2BK4 A;  3BNM A;  3RP7 A;  1CJC A;  4UDR A;  4FX9 A;  4U8J A;  1B37 A;  1KIF A;  5JCM A;  2X3N A;  1CBO A;  2CFY A;  4YSZ A;  1EL9 A;  3SGL A;  4ZN0 A;  2XLS A;  3G5R A;  1N1P A;  1NEN A;  3CPI G;  1OJC A;  1EL5 A;  1BGN A;  1RYI A;  2VVL G;  2YLZ A;  5L46 A;  1JNZ A;  2XFQ A;  3DJJ A;  4A5L A;  2CUL A;  4AP3 A;  3ICT A;  1PBD A;  4G73 A;  1ZKQ A;  3P4S A;  2B9X A;  1PHH A;  1IJH A;  1MXT A;  3AD7 B;  2GR0 A;  4H4Z A;  3QFB A;  2OAM A;  2TPR A;  4XWZ A;  3NIX A;  3NNE A;  4EIQ A;  1EVI A;  3GWF A;  2R46 A;  4KPR A;  4YJD A;  3CN8 A;  3QVR A;  5HY5 A;  2GEW A;  4C5O A;  5GSN A;  1TDF A;  1JEH A;  5HYM A;  4ZCC A;  3V3O A;  4JY2 A;  2A8X A;  2FBW A;  3UKH A;  3W4I A;  2DU8 A;  1S3B A;  2XFP A;  2E49 A;  2WQY A;  2YG3 A;  4FK1 C;  1E1K A;  2H88 A;  4J56 A;  3CPJ G;  4GDP A;  3SYI A;  5LV9 A;  2YG4 A;  3QJ4 A;  1NPX A;  1AOG A;  3W4K A;  3EAN A;  5FMH A;  4H2R A;  3UOV A;  2VOU A;  4H4U A;  4EM4 A;  2XDO A;  5IPY A;  4QFC A;  4MJW A;  4Z25 A;  5HHF A;  2GV8 A;  2YLW A;  3QFA A;  3S5W A;  2BC0 A;  4H4S A;  3UCL A;  3AEF A;  3DJD A;  4YJF B;  2BAB A;  2VQB A;  2WET A;  1F3P A;  2CVJ A;  4H4R A;  1FEC A;  4X9N A;  4OPT A;  1IUU A;  2C3C A;  2R9Z A;  2WEU A;  3SY4 A;  3NN0 X;  2BS4 A;  4OPG A;  2YM2 A;  3NHO X;  3P4R A;  3VRD B;  5M10 A;  1O94 A;  1DJQ A;  1B4V A;  3DJG X;  4EQW A;  1KSS A;  3ATQ A;  2V61 A;  2AAQ A;  1PN0 A;  1IUV A;  3DGH A;  5U25 A;  2B76 A;  3UKA A;  4PAA A;  3PO7 A;  1C0K A;  4EQX A;  2C4C A;  2OLO A;  3PVC A;  4B68 A;  3ZNQ A;  2VVM A;  2RGO A;  2JB2 A;  2E48 A;  4CNJ A;  1M6I A;  3AE7 A;  5GRT A;  4Z2T A;  3GMB A;  4Y4N A;  1EBD A;  2DKI A;  2V3A A;  1FL2 A;  2Q7V A;  3DH9 A;  3CNP A;  4U8M A;  4NTE A;  4OPI A;  5KXJ A;  2WPF A;  3AEG A;  3R9U A;  1JRZ A;  3NYC A;  1Q1W A;  4H4T A;  2XLR A;  4CY8 A;  4X9M A;  2E4G A;  4GR1 A;  3BI5 A;  5CKU A;  5KOX A;  4YJF A;  3UTG A;  1GET A;  3LZX A;  2FJA A;  3WE0 A;  3V76 A;  2OLN A;  5HXI A;  5KVI A;  1O5W A;  1TYP A;  4IVO B;  1BZL A;  4BJZ A;  4B67 A;  2QCU A;  1IUT A;  1EL7 A;  2R0G A;  1C0L A;  2PHH A;  1CL0 A;  1X31 B;  4G6H A;  1DDO A;  3UOZ A;  2C3D A;  3SXI A;  1GXF A;  3GYX A;  1JU2 A;  2EQ7 A;  5JCK A;  3UOX A;  4BJY A;  2FJD A;  1H7X A;  4YJG A;  1PJ5 A;  2X99 A;  3RP8 A;  4OPD A;  3IHM A;  3GMC A;  1GAL A;  1GND A;  1H6V A;  1NHR A;  3AE5 A;  4NZH A;  1Z6L A;  3S61 A;  3NTA A;  4O5U A;  1DOE A;  2B7R A;  3DA1 A;  3QSM A;  3CGC A;  4CRT A;  1S2Y A;  2AQJ A;  2RGH A;  1LPF A;  4J31 A;  3NH3 X;  3ALL A;  2R0P A;  2YAU A;  4USR A;  3ABV A;  3AB1 A;  4BV6 A;  2E82 A;  2E5V A;  2GQF A;  3M0O A;  1TDE A;  2EQ8 A;  2VQ7 A;  3CNS A;  1LQU A;  3O0H A;  4TLX A;  4YTP A;  2C72 A;  1JRY A;  4A9W A;  4LA1 A; 
#chains in the Genus database with same CATH homology
 4IVM B;  1IUS A;  1H84 A;  2RAB A;  2XVE A;  1OJA A;  4U2S A;  1VDC A;  2XLU A;  2ZZB A;  3FBS A;  3GSI A;  4B69 A;  1VQW A;  4IA6 A;  1H7W A;  3GRS A;  4GUV A;  4ADW A;  2ACZ A;  4LII A;  2X8H A;  3NGC X;  3UTF A;  4Z2R A;  4REK A;  2YG7 A;  3FIM B;  4AOS A;  1GV4 A;  1QLB A;  3ATR A;  3ISH A;  4GAP A;  1KFY A;  2OAL A;  1N4W A;  1Y56 A;  1GPE A;  4APN A;  1GTH A;  3GD3 A;  4C3Y A;  2WES A;  2WP6 A;  3K30 A;  3UP5 A;  1OJ9 A;  3SM8 A;  2ZZ0 A;  4RSL A;  3T2Y A;  5BUK A;  3AE8 A;  1BGJ A;  2WU5 A;  2A89 A;  1GRA A;  4A6N A;  2V6O A;  4XXG A;  3ADA B;  1PBE A;  2RGJ A;  3AXB A;  3RHA A;  4Y4L A;  5U63 A;  2C66 A;  2QA1 A;  1N4U A;  4ICY A;  2C65 A;  4DSG A;  4I58 A;  2BAC A;  1GER A;  1DOD A;  1YKJ A;  2NPX A;  1D4C A;  4AT2 A;  1D4D A;  4J36 A;  4BK2 A;  4U8L A;  2JBV A;  2IID A;  2YLS A;  3DJE A;  3ITJ A;  3UTE A;  1UKV G;  4CY6 A;  2IVD A;  1XPQ A;  4GCM A;  4O5Q A;  1ZX9 A;  4B1B A;  3RED A;  2YLT A;  3KA7 A;  1L9C A;  2DKH A;  3F8D A;  4BK1 A;  3PS9 A;  1GES A;  1DOB A;  1Q9I A;  3AE1 A;  2C73 A;  1D7Y A;  1F8S A;  2WOV A;  4NNJ A;  5EOW A;  2WOI A;  4D03 A;  1CF3 A;  1S2Q A;  3AYL A;  3L8K A;  1GEU A;  1Y56 B;  2C64 A;  3ZYX A;  2XFO A;  4J34 A;  3KKJ A;  3H8L A;  3CGD A;  2GQW A;  2QAE A;  2JAE A;  4JDR A;  3VRA A;  5BUL A;  5J60 A;  1V59 A;  3DME A;  3UKP A;  4EMI A;  4Z43 A;  1DJN A;  3RNM A;  4C74 A;  2YQU A;  4HA6 A;  1KF6 A;  1YQ3 A;  3AE6 A;  1CC6 A;  3KU9 A;  2X8G A;  1KNP A;  4B63 A;  2GR3 A;  3NK2 X;  3M12 A;  2ZZC A;  3DGZ A;  2YVJ A;  3GYJ A;  5C3J A;  4H2P A;  3UKK A;  4J57 A;  2IVE A;  3K7Q X;  3KVE A;  4A65 A;  5KMR A;  4H4W A;  2YG6 A;  4UDQ A;  4USQ A;  1FCD A;  3VRB A;  3GD4 A;  3P4P A;  5EBK A;  1XAN A;  1LJ1 A;  4JY3 A;  2FJE A;  3HZL A;  3AE9 A;  3LAD A;  4Z24 A;  2WDQ A;  1D5T A;  1PDH A;  5KMQ A;  3C4N A;  4A7A A;  3VR9 A;  4EMW A;  1OJD A;  3T14 A;  4K2X A;  1MOK A;  3I3L A;  4GRT A;  2CDU A;  4B66 A;  2AR8 A;  1HYU A;  2O9Z A;  4CCQ A;  4PAB A;  2WU2 A;  1LTX R;  4U8I A;  2BK3 A;  2C75 A;  3AEE A;  3CTY A;  4G74 A;  3G5S A;  3T2K A;  4X4J A;  4H4Y A;  1SEZ A;  2B7S A;  3K7M X;  1IUX A;  4WCT A;  3OZ2 A;  3KD9 A;  1H82 A;  2BK5 A;  2VVL A;  5IQ4 A;  3NLC A;  1QJD A;  4FDC B;  2EQ6 A;  2ZBW A;  1TYT A;  4GAV A;  1P2H A;  2YWL A;  3BNU A;  4K7Z A;  3IC9 A;  4AP1 A;  2I0Z A;  4BK3 A;  4UDP A;  3HYX A;  2WDR A;  2YR6 A;  1VG9 A;  3AD8 B;  1VG0 A;  2EQ9 A;  1QO8 A;  1FEA A;  3C96 A;  4J2W A;  1GOS A;  2WPE A;  3B6D A;  1E1M A;  3NTD A;  4RG3 A;  1KNR A;  5JCN A;  2UZZ A;  3SQP A;  3NRN A;  1CC2 A;  4K5S A;  2GMJ A;  4NEW A;  3DK4 A;  3BI2 A;  5DBJ A;  1CC4 A;  1K0I A;  4ZCD A;  1L0V A;  1KSU A;  5FS8 A;  5KNL A;  3ICS A;  3D1C A;  3SZ0 A;  3CIR A;  5M0Z A;  2XLP A;  3NK0 X;  2YVF A;  3SZF A;  3H4K A;  1YQ4 A;  4YXD A;  5EB5 A;  1S3E A;  1PBB A;  2X50 A;  5ER0 A;  2XVH A;  3GRT A;  1ONF A;  4YKG A;  4YSH A;  2VRM A;  3D8X A;  1NHP A;  2J3N A;  3SZW A;  4YT0 A;  4JNA A;  4EMJ A;  3GDN A;  3NG7 X;  2Q0L A;  4XWR A;  3IHG A;  4AT0 A;  4TM1 A;  4DNA A;  1ZMD A;  3AE3 A;  1ZDL A;  2GMH A;  1E6E A;  1H81 A;  4H50 A;  3NKS A;  1ZMC A;  2V5Z A;  4U8K A;  3HYV A;  5KOW A;  1E7P A;  2XFU A;  3M13 A;  4EM3 A;  1CJ2 A;  2XCG A;  3GWD A;  3AD9 B;  1RP0 A;  1TRB A;  4OVI A;  1FOH A;  2WOW A;  2Y6Q A;  3IWA A;  5BRT A;  3CND A;  3QSS A;  3AYJ A;  3NYF A;  4OPC A;  3I6D A;  2BRY A;  1D7L A;  4CBQ A;  3F8P A;  3T2Z A;  3RP6 A;  3KPF A;  4BUR A;  1YY5 A;  2Z5Y A;  1BWC A;  4NTD A;  5TR3 A;  2R4J A;  1PS9 A;  3CPH G;  3GYI A;  1FEB A;  1GRE A;  2ARD A;  2WP9 A;  4TM3 A;  1BKW A;  2VRL A;  5IQ1 A;  4H4V A;  2JB1 A;  5FS7 A;  3ZDN A;  3LB8 A;  4H2Q A;  1NAA A;  1O95 A;  3BI4 A;  1KDG A;  3NT6 A;  3P4Q A;  4Z44 A;  5KWF A;  4OPL A;  1NHQ A;  2WBA A;  2WPC A;  3NYE A;  4RG4 A;  3KLJ A;  2B9Y A;  4II3 A;  1W4X A;  1ZOV A;  2C70 A;  2F5Z A;  2H89 A;  3G5Q A;  1NDA A;  4NTC A;  4U2T A;  5KRQ A;  1ELI A;  1B5Q A;  4G6G A;  1K4Q A;  2Z5X A;  2B9W A;  1PJ7 A;  3LZW A;  3VQR A;  2GF3 A;  3AWI A;  3UKQ A;  3SFD A;  1CHU A;  4H4Q A;  4TM4 A;  5J7X A;  4DGK A;  1L9D A;  5KVH A;  3LJP A;  4AOX A;  4FK1 A;  2YG5 A;  2BRA A;  2GB0 A;  1PBF A;  4P9S A;  4U2L A;  3AE2 A;  4A6N B;  1TDO A;  3FMW A;  1F8W A;  1XHC A;  2GAH B;  2OA1 A;  4I59 A;  1Q1R A;  3UOY A;  1TDN A;  2GVC A;  2V60 A;  3II4 A;  2BCG G;  3Q9T A;  5U1O A;  4IV9 A;  5FS6 A;  1GRT A;  4N9X A;  2X8C A;  3FG2 P;  5JCI A;  1F6M A;  4TLZ A;  4J33 A;  2FJB A;  3Q6J A;  1LV0 A;  4Y4M A;  3AYI A;  1GRG A;  1ZOY A;  3ICR A;  1XDI A;  2Q0K A;  1K0J A;  2C67 A;  3CGB A;  4K8D A;  4NEV A;  1K0L A;  4CCR A;  1BF3 A;  2BA9 A;  2APG A;  3CGE A;  3KPK A;  3P1W A;  4WX1 A;  2XYO A;  2NVK X;  4CNK A;  2XVI A;  2YR5 A;  4IA5 A;  2BCP A;  3DK9 A;  4GF7 A;  2R0C A;  1Y0P A;  2GH5 A;  2YLR A;  3AEC A;  3FPZ A;  4M52 A;  4G9K A;  5CQF A;  3V3N A;  3SFE A;  4ECH A;  3HYW A;  1ZK7 A;  2WS3 A;  1D4E A;  2Q6U A;  1ZY8 A;  2E1M A;  2GAG B;  3DK8 A;  4U8P A;  1LQT A;  2YVG A;  4YKF A;  5FS9 A;  4HB9 A;  2BXR A;  4Z2U A;  2W0H A;  3T31 A;  2R45 A;  3K7T A;  1NHS A;  4D04 A;  1L9E A;  1DOC A;  2JK6 A;  3AED A;  3NN6 X;  4TM0 A;  1N4V A;  3T37 A;  4KX6 A;  1COY A;  1PXA A;  3UTH A;  1CJ3 A;  1DNC A;  1REO A;  1B8S A;  1F8R A;  2BC1 A;  2YM1 A;  1PXB A;  4A99 A;  1GRH A;  5JCL A;  1PXC A;  2GRT A;  2QA2 A;  2WP5 A;  1OJT A;  2WHD A;  4K5R A;  5KMP A;  2R4E A;  1JNR A;  3CNJ A;  4A79 A;  1IUW A;  3QSE A;  2PYX A;  3LXD A;  3AE4 A;  1PJ6 A;  4DSH A;  3BHK A;  1NG3 A;  2BXS A;  3EPT A;  1YQZ A;  2BYB A;  2C76 A;  4YTN A;  1LVL A;  3QVP A;  3SZC A;  1GTE A;  2XLT A;  3ALM A;  2JB3 A;  4E0V A;  2BS3 A;  5EB4 A;  3L1R A;  4OCG A;  1E1N A;  4JN9 A;  4LU6 A;  1E1L A;  1M64 A;  4EIP A;  3BHF A;  2A87 A;  4JQ9 A;  1P2E A;  4YSY A;  1ZP0 A;  3URH A;  1EL8 A;  4B65 A;  4U8O A;  1H83 A;  2Y6R A;  4H4P A;  2XVJ A;  3E1T A;  4H4X A;  2XVF A;  1GRF A;  2YR4 A;  3LOV A;  2C7G A;  3AEB A;  4YTM A;  2GR2 A;  3COX A;  2JKC A;  1DXL A;  3JSK A;  4GDE A;  3P9U A;  4UP3 A;  1GT8 A;  4H2N A;  3UKF A;  1GSN A;  3CNT A;  2XFN A;  3NK1 X;  4K22 A;  1PBC A;  5KMS A;  3UP4 A;  2BS2 A;  1GRB A;  1MO9 A;  4C3X A;  2WDV A;  1NG4 A;  2VZ2 A;  2HQM A;  4H7U A;  2V3B A;  4II2 A;  4C77 A;  3OC4 A;  1RSG A;  2YLX A;  4YSX A;  1H86 A;  1E39 A;  3C4A A;  3AEA A;  4B64 A;  5C2T A;  3T0K A;  2TMD A;  3B3R A;  3VR8 A;  4U8N A;  3EAO A;  3GDP A;  3ALJ A;  3SX6 A;  3UKL A;  1TDK A;  2GR1 A;  4Z26 A;  1JOA A;  3H8I A;  4EQS A;  4YWO A;  5BVA A;  3IF9 A;  3CMM A;  4OPU A;  3EF6 A;  1JRX A;  1VRQ B;  4NWZ A;  1NEK A;  1CJ4 A;  4JNQ A;  3F8R A;  2BK4 A;  3BNM A;  3RP7 A;  1CJC A;  4UDR A;  4FX9 A;  4U8J A;  1B37 A;  5JCM A;  2CFY A;  2X3N A;  1CBO A;  4YSZ A;  1EL9 A;  3SGL A;  4ZN0 A;  2XLS A;  3G5R A;  1N1P A;  1NEN A;  3CPI G;  1OJC A;  1EL5 A;  1BGN A;  1RYI A;  2VVL G;  2YLZ A;  1JNZ A;  3DJJ A;  2XFQ A;  4A5L A;  4AP3 A;  2CUL A;  5L46 A;  3ICT A;  1PBD A;  4G73 A;  1ZKQ A;  3P4S A;  2B9X A;  1IJH A;  1MXT A;  2GR0 A;  1PHH A;  3AD7 B;  4H4Z A;  3QFB A;  2OAM A;  2TPR A;  3NIX A;  3NNE A;  4XWZ A;  4EIQ A;  3GWF A;  2R46 A;  4KPR A;  3QVR A;  3CN8 A;  5HY5 A;  2GEW A;  4C5O A;  5GSN A;  1TDF A;  1JEH A;  5HYM A;  4ZCC A;  3V3O A;  4JY2 A;  2A8X A;  2FBW A;  3UKH A;  1S3B A;  2XFP A;  2WQY A;  2YG3 A;  4FK1 C;  1E1K A;  2H88 A;  4J56 A;  3CPJ G;  4GDP A;  3SYI A;  5LV9 A;  2YG4 A;  3QJ4 A;  1NPX A;  1AOG A;  5FMH A;  3EAN A;  4H2R A;  3UOV A;  2VOU A;  4H4U A;  4EM4 A;  2XDO A;  5IPY A;  4MJW A;  4Z25 A;  5HHF A;  2GV8 A;  2YLW A;  3QFA A;  3S5W A;  2BC0 A;  4H4S A;  3UCL A;  3AEF A;  2VQB A;  3DJD A;  2BAB A;  2WET A;  1F3P A;  2CVJ A;  4H4R A;  1FEC A;  4X9N A;  4OPT A;  1IUU A;  2C3C A;  2R9Z A;  2WEU A;  3SY4 A;  3NN0 X;  2BS4 A;  4OPG A;  2YM2 A;  3NHO X;  3P4R A;  3VRD B;  5M10 A;  1O94 A;  1DJQ A;  1B4V A;  3DJG X;  4EQW A;  1KSS A;  3ATQ A;  2V61 A;  2AAQ A;  1PN0 A;  1IUV A;  3DGH A;  5U25 A;  2B76 A;  3UKA A;  4PAA A;  3PO7 A;  4EQX A;  2C4C A;  2OLO A;  3PVC A;  4B68 A;  2VVM A;  2RGO A;  2JB2 A;  4CNJ A;  1M6I A;  3AE7 A;  5GRT A;  4Z2T A;  3GMB A;  4Y4N A;  1EBD A;  2DKI A;  2V3A A;  1FL2 A;  2Q7V A;  3DH9 A;  3CNP A;  4U8M A;  4NTE A;  4OPI A;  5KXJ A;  2WPF A;  3AEG A;  3R9U A;  1JRZ A;  3NYC A;  1Q1W A;  4H4T A;  2XLR A;  4CY8 A;  2E4G A;  4GR1 A;  4X9M A;  3BI5 A;  5CKU A;  5KOX A;  3UTG A;  1GET A;  3LZX A;  2FJA A;  3WE0 A;  3V76 A;  2OLN A;  5HXI A;  5KVI A;  1O5W A;  1TYP A;  4IVO B;  1BZL A;  4BJZ A;  4B67 A;  1IUT A;  2QCU A;  1EL7 A;  2R0G A;  2PHH A;  3UOZ A;  1CL0 A;  1X31 B;  4G6H A;  2C3D A;  3SXI A;  1GXF A;  3GYX A;  1JU2 A;  2EQ7 A;  5JCK A;  3UOX A;  2FJD A;  4BJY A;  1H7X A;  2X99 A;  1PJ5 A;  4OPD A;  3RP8 A;  3IHM A;  3GMC A;  1GAL A;  1GND A;  1H6V A;  1NHR A;  3AE5 A;  4NZH A;  1Z6L A;  3S61 A;  3NTA A;  4O5U A;  1DOE A;  2B7R A;  3DA1 A;  3CGC A;  3QSM A;  4CRT A;  1S2Y A;  2AQJ A;  2RGH A;  1LPF A;  4J31 A;  3NH3 X;  3ALL A;  2R0P A;  2YAU A;  4USR A;  3ABV A;  3AB1 A;  4BV6 A;  2GQF A;  2E5V A;  4EQR A;  2EQ8 A;  1TDE A;  3M0O A;  2VQ7 A;  3CNS A;  1LQU A;  3O0H A;  4TLX A;  4YTP A;  2C72 A;  1JRY A;  4A9W A;  4LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...