3GMCA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase with substrate bound
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Structure of the PLP degradative enzyme 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti MAFF303099 and its mechanistic implications.
pubmed doi rcsb
source organism Mesorhizobium loti
total genus 118
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3gmcA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gmcA01
3AWIA 3GYJA 2ZBWA 1L9CA 2F5ZA 3GWDA 1CL0A 2GR0A 2WS3A 5GSNA 5KXJA 1GT8A 5IQ1A 1NHSA 3UKFA 1DOEA 4ADWA 4YTNA 3UOYA 5JCLA 1VG9A 4K7ZA 4U8OA 4KPRA 4ICYA 3NGCX 2GR3A 1NAAA 2XDOA 3NHOX 3UKQA 2WDRA 4EQSA 1SEZA 1PBFA 2XVJA 4H4RA 5FS8A 2H89A 2OLOA 1JOAA 1NENA 1XANA 2I0ZA 2C7GA 4GDPA 2GAHB 5FS6A 4ZCCA 2TMDA 1D5TA 3IF9A 4A7AA 4K5RA 2YQUA 4OPUA 3WE0A 1YQZA 2X8CA 4Y4LA 2WU5A 3NNEA 3AD7B 3UKKA 1Y56A 3E1TA 4K22A 1GOSA 2GB0A 2X3NA 5KRQA 4H4ZA 1JRYA 3NTAA 3UKAA 2YR4A 2V5ZA 2YR5A 2BC1A 5U1OA 5KWFA 1ZOYA 3M13A 1RYIA 2BS4A 3VRBA 3BHKA 1EL5A 1L0VA 4A99A 2H88A 2ZZ0A 3CNTA 1BWCA 4I59A 3PS9A 1GRGA 4J56A 2BC0A 2R0CA 1B4VA 5BRTA 3AXBA 2WDVA 3LXDA 3NK1X 3UKPA 1OJCA 2C64A 3ISHA 4DSGA 1ZDLA 1CF3A 2AQJA 3KU9A 4LIIA 1F3PA 1PBDA 2OLNA 1Z6LA 2XCGA 3R9UA 4TLXA 2C67A 2JAEA 4K2XA 1PHHA 1KFYA 2C72A 3GSIA 1IUXA 2FJBA 2BK5A 2XVIA 2RGJA 3AECA 1KDGA 3K7QX 2C65A 4TM1A 1PJ7A 3QSMA 5CKUA 5BUKA 3CNSA 4C3YA 1TDNA 1ONFA 1OJAA 2ZZCA 2YLZA 2C3DA 2BK4A 2YLRA 4J2WA 3QVRA 2VQBA 2IVDA 1Y56B 4AOXA 5FS9A 2YG5A 1CJ4A 4BJYA 1NHRA 4K8DA 4YKFA 2GH5A 1EBDA 3LZXA 4NZHA 3AE8A 3DK9A 3SFEA 3GDPA 5JCMA 3URHA 1NDAA 3CIRA 4A79A 3DJEA 1BKWA 3DJDA 1LTXR 3P9UA 1MOKA 4X9NA 3ABVA 3NIXA 4H4XA 2WETA 4GRTA 4FX9A 3F8PA 2V3AA 4GUVA 3L8KA 4BK1A 1EL8A 4D04A 4Z2UA 3B3RA 5HHFA 2BA9A 1M64A 4H4UA 4JQ9A 4U8PA 3QJ4A 3RHAA 4A5LA 3AE1A 2BK3A 4RG4A 5J60A 2CDUA 3ZDNA 1OJTA 4OPCA 1ELIA 3C96A 2C75A 2IIDA 4B68A 4U8MA 2BYBA 1IJHA 2PHHA 2UZZA 1ZKQA 2XLUA 3Q9TA 3AB1A 2AAQA 3DH9A 4Z2TA 1NHQA 2AR8A 1AOGA 3AYLA 3ICTA 3AE9A 4CNKA 3AEGA 1LVLA 1XDIA 2Q6UA 2XFPA 4YSYA 3GYIA 5FS7A 3NK2X 2NPXA 2R4JA 3NYFA 1OJDA 1BGNA 1IUTA 2BS2A 2FJDA 4NEVA 4O5QA 4REKA 3SQPA 1D4DA 2QAEA 4TM4A 1CHUA 1NG3A 1H86A 2GR2A 4BK2A 4A6NA 4MJWA 2XVHA 3CPJG 3CGCA 1GV4A 4E0VA 1DJQA 1H83A 3GMCA 3IHMA 3H8IA 4YSXA 2JB1A 1D4CA 1CC4A 2GV8A 2JKCA 3AEFA 1RSGA 3P1WA 1XHCA 2QCUA 3KA7A 2JK6A 4USQA 4DSHA 2R45A 2YG7A 3FBSA 2Q0LA 4AT0A 4EIPA 1H84A 2WP6A 2XYOA 2V3BA 1F8SA 1GXFA 4WCTA 2EQ9A 1E1NA 4UDQA 1JRZA 4AP3A 3CGEA 2V61A 2XVFA 1K0IA 2DKIA 4JY3A 1QO8A 3QVPA 3NTDA 1NHPA 4JN9A 3SM8A 1Q1WA 4NTDA 4YSHA 4DGKA 2HQMA 1GTHA 3AE2A 1F6MA 2WU2A 3DA1A 4Y4NA 1EL7A 2GF3A 3FG2P 2GMHA 3UKLA 3GD3A 4XWZA 1PXAA 3BHFA 4U8IA 4B65A 2XLPA 1LPFA 1D7LA 1GRTA 3ATRA 1H82A 1E1MA 3HZLA 3P4SA 3KD9A 1O5WA 2OALA 3KPFA 4KX6A 2BCGG 3L1RA 1IUSA 4Z44A 4A9WA 5L46A 3CNDA 2ZZBA 3NT6A 4ZN0A 1KF6A 1MO9A 2O9ZA 3AEEA 1TDFA 5EBKA 3VR9A 1B37A 3H8LA 1GREA 1VQWA 1LV0A 2X8GA 4A6NB 2XVEA 1LJ1A 2YVJA 3NN6X 3FPZA 1CC6A 3AD9B 3DGZA 3AEDA 2GVCA 1CBOA 5M0ZA 2XLSA 2XFQA 5KOWA 1GTEA 4GF7A 5CQFA 3UKHA 1CJ3A 2E1MA 3QFAA 4OPLA 4Y4MA 5KVIA 1PDHA 3NYEA 1GRFA 4JDRA 2WDQA 4IA5A 1IUVA 1JNRA 3K7MX 3LOVA 1UKVG 2RGOA 2FJAA 4IV9A 3EANA 4JNAA 3CNPA 1TDOA 4EMWA 3FIMB 1N4UA 3AYJA 3AD8B 2EQ6A 1ZP0A 4OPGA 2CULA 2X8HA 3KKJA 3D8XA 4HB9A 1GEUA 3DGHA 5BULA 4XXGA 4U8LA 2BXSA 4HA6A 2XFOA 1E7PA 1N4VA 3UTFA 3M12A 3DK8A 2GRTA 2WOVA 4NEWA 4H4PA 4WX1A 3UP5A 4BK3A 4JY2A 3QSEA 1X31B 5LV9A 3LB8A 4PABA 1B5QA 2R46A 3O0HA 3IWAA 4YWOA 1F8RA 1PJ5A 1O94A 4EQWA 2WOWA 4FDCB 3T37A 1TYTA 4H4QA 3NLCA 5JCIA 4YSZA 2GEWA 4CCQA 3ATQA 3C4AA 3AEAA 3P4QA 2VRMA 4TM3A 3DJGX 3OC4A 4I58A 1PXCA 2WPCA 1BF3A 2ACZA 2WP9A 1P2EA 3BI4A 2E5VA 3AE5A 1PN0A 3IC9A 3UOXA 2YM1A 3S5WA 3VRAA 3M0OA 5EOWA 4H4WA 2V6OA 3SFDA 4H50A 4GDEA 4Z24A 1GESA 1TDKA 3BNUA 4YXDA 2YLXA 3DMEA 2R0PA 2B9WA 2B76A 2WP5A 2YVGA 1ZMDA 4Z25A 4H2NA 1O95A 2WPFA 4H7UA 5JCKA 1GRAA 3D1CA 4X9MA 4U2LA 1YY5A 2EQ8A 2DKHA 1GNDA 1YKJA 3UOVA 1CJ2A 1E39A 1QLBA 4BV6A 4H4VA 4Z2RA 3CGBA 1VG0A 2C70A 4GCMA 2VRLA 2XLRA 3VRDB 3RNMA 4H2QA 1JU2A 1NG4A 2Q7VA 2BS3A 2ARDA 3AYIA 2VOUA 2TPRA 4K5SA 2VVMA 4OPDA 3EF6A 4JNQA 4OPIA 2GR1A 3UTEA 4LU6A 2BABA 1Q1RA 2GAGB 2Y6RA 2YG6A 3I6DA 5GRTA 2R4EA 1L9EA 5EB5A 4TM0A 3K30A 2WESA 4M52A 3ALLA 3RP7A 2C73A 4N9XA 3K7TA 1H7XA 1FL2A 1TYPA 1MXTA 1LQTA 2YAUA 1GETA 1VDCA 4AT2A 1DOBA 1FCDA 4B67A 4H2PA 1PBBA 2QA2A 3ALMA 4X4JA 1S2QA 2YR6A 4UDPA 3OZ2A 3CGDA 4CBQA 2BCPA 4DNAA 4H4YA 3REDA 5FMHA 1KSUA 3CPIG 1JNZA 4B1BA 2Y6QA 2NVKX 2Q0KA 1BZLA 1M6IA 4NTCA 5HXIA 4EM3A 1N4WA 1ZOVA 4H2RA 2JBVA 1L9DA 1V59A 3NYCA 4BURA 1N1PA 2FBWA 2WOIA 3AE6A 2C76A 1Y0PA 4YKGA 1D4EA 4YTPA 2C66A 3G5SA 3P4RA 2W0HA 2XFNA 3RP6A 3NH3X 1PBCA 1PBEA 2XLTA 4IVMB 1NEKA 4YTMA 4C77A 5DBJA 1GPEA 4CCRA 4CRTA 3UP4A 2Z5XA 4B64A 2GMJA 2YVFA 2WPEA 3QSSA 4B69A 2GQFA 3G5QA 3SGLA 3UCLA 3CTYA 1FEAA 1OJ9A 3NG7X 3CN8A 1XPQA 1JRXA 3GDNA 4B66A 1GRHA 1QJDA 1S3BA 2VVLG 1DNCA 3CNJA 3LADA 1GRBA 4PAAA 2EQ7A 4ECHA 1ZX9A 3AE3A 1B8SA 5ER0A 1KSSA 3LZWA 4EM4A 2CFYA 1D7YA 2YG3A 3FMWA 4RSLA 1W4XA 3CPHG 3PVCA 2JB3A 1CC2A 1EL9A 4USRA 3UOZA 3EAOA 2JB2A 4NTEA 1LQUA 1DODA 1PXBA 5EB4A 2A89A 2WHDA 2OA1A 2WBAA 5IQ4A 3G5RA 2APGA 2YWLA 5KOXA 5IPYA 3P4PA 2R0GA 4AOSA 1E1KA 1BGJA 4Z43A 1REOA 3QFBA 4U2SA 3DK4A 3NKSA 4U8KA 1FOHA 2QA1A 2YLTA 3UTHA 1PJ6A 2B7RA 3JSKA 3KVEA 3NRNA 2B7SA 4H4SA 1E1LA 4J57A 1IUWA 3V3OA 1K0LA 4CY6A 2IVEA 2RABA 4FK1A 2C3CA 4P9SA 4EQRA 2VZ2A 4A65A 1CJCA 4EMJA 2E4GA 4Z26A 5U25A 1ZY8A 3EPTA 3GD4A 3ZYXA 4C3XA 1KNRA 3F8DA 1ZMCA 1FECA 1RP0A 3II4A 4RG3A 5U63A 3ADAB 1S2YA 4APNA 1ZK7A 4U8JA 5JCNA 5M10A 2A87A 4U2TA 3AE7A 3LJPA 3BI2A 1TRBA 5HYMA 3V3NA 3DJJA 2Z5YA 3GRTA 1PS9A 3GRSA 4J31A 4C74A 3AEBA 1Q9IA 3COXA 4B63A 1GERA 3Q6JA 4ZCDA 2YLWA 4AP1A 4EMIA 1COYA 1JEHA 4H4TA 1H7WA 1S3EA 5TR3A 5C3JA 1DOCA 1DJNA 1VRQB 3NN0X 3S61A 4J34A 2VVLA 2PYXA 1YQ3A 2A8XA 5J7XA 3F8RA 4U8NA 4GR1A 3KLJA 1YQ4A 3VQRA 4YT0A 4UP3A 1K4QA 4LA1A 4CNJA 2YM2A 4FK1C 2GQWA 1IUUA 2J3NA 3I3LA 1K0JA 4CY8A 1HYUA 4C5OA 5KVHA 1GALA 2B9XA 4BJZA 4J33A 4D03A 1GSNA 2V60A 4OCGA 2OAMA 2VQ7A 2X99A 3UTGA 3H4KA 2WQYA 2B9YA 5BVAA 3ICSA 2BACA 3V76A 1H81A 1H6VA 3GMBA 3ALJA 3BI5A 2CVJA 3GWFA 1E6EA 4IA6A 3IHGA 3PO7A 2RGHA 1NPXA 3B6DA 1KNPA 3C4NA 3AE4A 4J36A 4O5UA 4OVIA 2XFUA 1TDEA 4IVOB 2YG4A 1F8WA 3VR8A 2YLSA 2BXRA 3RP8A 4EIQA 2X50A 2R9ZA 3ITJA 3ICRA 1FEBA 4OPTA 4EQXA 2WEUA 4XWRA 4UDRA 3BNMA 5C2TA 4TLZA 2FJEA 1P2HA 1DXLA 3NK0X 5HY5A
chains in the Genus database with same CATH superfamily
3AWIA 3GYJA 2ZBWA 1L9CA 2F5ZA 3GWDA 1CL0A 2GR0A 2WS3A 5GSNA 5KXJA 1GT8A 5IQ1A 3UKFA 1DOEA 3T2YA 4ADWA 4YTNA 3UOYA 5JCLA 1VG9A 4K7ZA 4U8OA 3CUKA 1VE9A 4KPRA 4ICYA 3NGCX 2GR3A 1NAAA 4G9KA 2XDOA 3NHOX 3UKQA 2WDRA 4EQSA 1SEZA 1PBFA 3W4KA 2XVJA 1P2HA 4H4RA 5FS8A 2OLOA 2H89A 1JOAA 1NENA 1XANA 2I0ZA 2C7GA 4GDPA 2GAHB 5FS6A 4II2A 4G74A 4ZCCA 2TMDA 3IF9A 1D5TA 4A7AA 4K5RA 2YQUA 4OPUA 3WE0A 1C0IA 1YQZA 2X8CA 4Y4LA 2WU5A 3NNEA 3AD7B 3UKKA 1Y56A 3E1TA 4K22A 2GB0A 1GOSA 2X3NA 5KRQA 4H4ZA 1JRYA 3NTAA 3UKAA 2YR4A 2V5ZA 2YR5A 2BC1A 5U1OA 5KWFA 1ZOYA 3SY4A 3M13A 1RYIA 2BS4A 3VRBA 3BHKA 4YJFA 1EL5A 1L0VA 4GAVA 4A99A 2H88A 2ZZ0A 3CNTA 1BWCA 4I59A 3PS9A 1GRGA 4J56A 2BC0A 2R0CA 1B4VA 5BRTA 3AXBA 2WDVA 3LXDA 3NK1X 3UKPA 5KNLA 1OJCA 2C64A 3T2ZA 3ISHA 4DSGA 1ZDLA 1CF3A 2AQJA 3KU9A 4LIIA 1F3PA 1PBDA 1C0KA 2OLNA 1Z6LA 2XCGA 3SX6A 3R9UA 4TLXA 2C67A 2JAEA 4K2XA 1PHHA 1KFYA 2C72A 3GSIA 1IUXA 2FJBA 2BK5A 2XVIA 2RGJA 3AECA 1KDGA 3K7QX 2C65A 4TM1A 1PJ7A 3QSMA 5CKUA 5BUKA 3CNSA 4C3YA 1TDNA 1ONFA 1OJAA 2ZZCA 2YLZA 2C3DA 2BK4A 2YLRA 4J2WA 1DDOA 3QVRA 2VQBA 2IVDA 1Y56B 4AOXA 5FS9A 2YG5A 1CJ4A 4BJYA 1NHRA 4K8DA 4YKFA 2GH5A 1EBDA 3LZXA 4NZHA 3AE8A 3DK9A 3SFEA 3GDPA 5JCMA 3URHA 1NDAA 3T2KA 3CIRA 4A79A 3DJEA 1BKWA 3DJDA 1LTXR 3P9UA 1MOKA 4X9NA 3ABVA 3NIXA 4H4XA 2WETA 4G6HA 4GRTA 4FX9A 4YJHA 3F8PA 2V3AA 4GUVA 3L8KA 4BK1A 1EL8A 4D04A 4Z2UA 2E49A 3B3RA 5HHFA 2BA9A 1M64A 4H4UA 4JQ9A 3HYWA 4U8PA 3QJ4A 3RHAA 4A5LA 3AE1A 2BK3A 3KPKA 4RG4A 5J60A 2CDUA 3ZDNA 1OJTA 4OPCA 1ELIA 3C96A 2C75A 2IIDA 4B68A 4U8MA 2BYBA 1IJHA 2PHHA 2UZZA 1ZKQA 2XLUA 3Q9TA 3AB1A 2AAQA 3DH9A 4Z2TA 1NHQA 2AR8A 1AOGA 3AYLA 3SZ0A 3ICTA 2DU8A 3AE9A 4CNKA 3AEGA 1LVLA 1XDIA 2Q6UA 2XFPA 3ZNQA 3GYIA 5FS7A 3NK2X 4YSYA 2NPXA 2R4JA 3NYFA 1OJDA 1BGNA 1IUTA 2BS2A 2FJDA 4NEVA 4O5QA 4BK2A 4REKA 1D4DA 2QAEA 4TM4A 1CHUA 1NG3A 1H86A 2GR2A 3SQPA 4A6NA 4MJWA 2XVHA 3CPJG 3CGCA 1GV4A 4E0VA 2BRAA 1DJQA 1H83A 3GMCA 3IHMA 3H8IA 4YSXA 2JB1A 1D4CA 1CC4A 2GV8A 2JKCA 3AEFA 1RSGA 3P1WA 2QCUA 1XHCA 3KA7A 2JK6A 4USQA 4DSHA 2R45A 2YG7A 3FBSA 2Q0LA 4AT0A 4EIPA 1H84A 2WP6A 2BRYA 2XYOA 4WCTA 1F8SA 1GXFA 2V3BA 2EQ9A 1E1NA 4UDQA 1JRZA 4AP3A 3CGEA 2V61A 2XVFA 4YJGA 1K0IA 2DKIA 4JY3A 1QO8A 3QVPA 3NTDA 1NHPA 4JN9A 3SM8A 1Q1WA 4NTDA 4YSHA 4DGKA 2HQMA 1GTHA 3AE2A 3DA1A 1F6MA 2WU2A 4Y4NA 1EL7A 2GF3A 3FG2P 2GMHA 3UKLA 4XWZA 3GD3A 1PXAA 3BHFA 4U8IA 3CMMA 4B65A 2XLPA 1LPFA 1D7LA 1GRTA 3ATRA 1H82A 1E1MA 3HZLA 3P4SA 3KD9A 5L46A 1O5WA 2OALA 3WGTA 2BCGG 3KPFA 1IUSA 3L1RA 4KX6A 4Z44A 4A9WA 3CNDA 2ZZBA 3NT6A 4ZN0A 1KF6A 1MO9A 2O9ZA 3AEEA 1TDFA 5EBKA 3VR9A 1B37A 3H8LA 1GREA 4G6GA 1VQWA 1LV0A 2X8GA 4A6NB 2XVEA 1LJ1A 2YVJA 3NN6X 3FPZA 1CC6A 3AD9B 3DGZA 3AEDA 2GVCA 1CBOA 5M0ZA 2XLSA 2XFQA 3SZWA 5KOWA 2E48A 4GF7A 1GTEA 5CQFA 1CJ3A 2E1MA 3QFAA 4OPLA 4Y4MA 5KVIA 3UKHA 1PDHA 3NYEA 1GRFA 4JDRA 2WDQA 4IA5A 1IUVA 1JNRA 3K7MX 3LOVA 1UKVG 2RGOA 2FJAA 4IV9A 3SZFA 4YJGB 3EANA 4JNAA 3CNPA 1TDOA 4EMWA 3FIMB 1N4UA 3AYJA 3AD8B 2EQ6A 1ZP0A 4OPGA 2CULA 2X8HA 3KKJA 3D8XA 4HB9A 1GEUA 3DGHA 5BULA 4XXGA 4U8LA 2BXSA 4HA6A 2XFOA 1E7PA 1N4VA 3UTFA 3M12A 3SXIA 3DK8A 2GRTA 1EVIA 2WOVA 4NEWA 4H4PA 4WX1A 3UP5A 4BK3A 3QSEA 4JY2A 1X31B 5LV9A 3LB8A 4PABA 2R46A 1B5QA 3O0HA 3IWAA 4YWOA 1F8RA 1PJ5A 1O94A 4EQWA 2WOWA 4FDCB 3T37A 1TYTA 4H4QA 3NLCA 5JCIA 4YSZA 2E82A 2GEWA 4CCQA 3C4AA 3ATQA 3AEAA 3P4QA 2VRMA 4TM3A 4YJFB 3DJGX 3OC4A 4I58A 1PXCA 2WPCA 1BF3A 2ACZA 2WP9A 5KMSA 1P2EA 3BI4A 2E5VA 3AE5A 1PN0A 3IC9A 3UOXA 2YM1A 3S5WA 3VRAA 3M0OA 5EOWA 4H4WA 2V6OA 3SFDA 4H50A 4GDEA 4Z24A 1GESA 1TDKA 3BNUA 4YXDA 2YLXA 3DMEA 2R0PA 2B9WA 2B76A 2WP5A 2YVGA 1ZMDA 4Z25A 4H2NA 4YJDA 1O95A 2WPFA 4QFCA 4H7UA 5JCKA 1GRAA 3D1CA 4X9MA 4U2LA 1YY5A 2EQ8A 1YKJA 2DKHA 1GNDA 3UOVA 1CJ2A 1E39A 3W4JA 1QLBA 4BV6A 4H4VA 4Z2RA 3CGBA 1VG0A 2C70A 4GCMA 2VRLA 3HYXA 2XLRA 3VRDB 3RNMA 4H2QA 1JU2A 2E4AA 1NG4A 2Q7VA 2BS3A 2ARDA 3AYIA 2VOUA 2TPRA 4K5SA 2VVMA 4OPDA 3EF6A 4JNQA 3W4IA 4OPIA 2GR1A 3UTEA 4LU6A 2BABA 2GAGB 1Q1RA 2Y6RA 4YJHB 2YG6A 3I6DA 5GRTA 2R4EA 1L9EA 5EB5A 4QFDA 3K30A 4TM0A 3RP7A 2WESA 3ALLA 4M52A 2C73A 4N9XA 3K7TA 1H7XA 1FL2A 1TYPA 1MXTA 1LQTA 2YAUA 1GETA 1VDCA 4AT2A 1DOBA 1FCDA 4B67A 4H2PA 1PBBA 2QA2A 5KMPA 3ALMA 4X4JA 1S2QA 2YR6A 4UDPA 3OZ2A 3CGDA 4CBQA 2BCPA 4DNAA 4H4YA 3GYXA 3REDA 5FMHA 1KSUA 3CPIG 2C4CA 1JNZA 4B1BA 2Y6QA 2NVKX 2Q0KA 1BZLA 1M6IA 4NTCA 5HXIA 1AN9A 1C0PA 4EM3A 1N4WA 1ZOVA 4H2RA 2JBVA 3ZNPA 1L9DA 1V59A 3NYCA 4NNJA 4BURA 1N1PA 2FBWA 2WOIA 3AE6A 2C76A 3G3EA 1Y0PA 1D4EA 4YKGA 2C66A 3G5SA 3P4RA 2W0HA 3RP6A 2XFNA 3NH3X 1PBCA 1PBEA 2XLTA 4IVMB 1NEKA 4YTMA 4C77A 5DBJA 1GPEA 4CCRA 4CRTA 3UP4A 2Z5XA 4B64A 2GMJA 3QSSA 2WPEA 2YVFA 4B69A 2GQFA 3SGLA 3G5QA 3UCLA 5KMRA 3CTYA 1FEAA 1OJ9A 3NG7X 3CN8A 1XPQA 3T14A 1JRXA 3GDNA 4B66A 1GRHA 1QJDA 1S3BA 2VVLG 4PAAA 1DNCA 3CNJA 1GRBA 3LADA 2EQ7A 4ECHA 1ZX9A 3AE3A 1B8SA 5ER0A 1KSSA 3LZWA 4EM4A 2CFYA 1D7YA 2YG3A 3FMWA 4RSLA 1W4XA 3PVCA 3CPHG 2JB3A 1EL9A 1CC2A 4USRA 3UOZA 3EAOA 2JB2A 1DAOA 4NTEA 1LQUA 1DODA 1PXBA 5EB4A 2A89A 2WHDA 2OA1A 2WBAA 5IQ4A 3G5RA 2APGA 2YWLA 5KOXA 5IPYA 3P4PA 2R0GA 4AOSA 1E1KA 1BGJA 1C0LA 4Z43A 1REOA 3QFBA 4U2SA 3DK4A 3NKSA 4U8KA 1FOHA 2QA1A 2YLTA 3UTHA 4GAPA 1PJ6A 2B7RA 3JSKA 3KVEA 3NRNA 2B7SA 4H4SA 1E1LA 4J57A 1IUWA 3V3OA 1K0LA 4CY6A 2IVEA 2RABA 4FK1A 2C3CA 4P9SA 3T31A 4EQRA 2VZ2A 4A65A 1CJCA 3T0KA 4EMJA 2E4GA 4Z26A 5U25A 1ZY8A 3EPTA 3GD4A 3ZYXA 4C3XA 1KNRA 3F8DA 1ZMCA 1FECA 1RP0A 3II4A 4RG3A 5U63A 3ADAB 1S2YA 4APNA 1ZK7A 4U8JA 5JCNA 3SZCA 5M10A 2A87A 4U2TA 3AE7A 4NWZA 3LJPA 3BI2A 5HYMA 1TRBA 4YTPA 3V3NA 3DJJA 2Z5YA 3GRTA 1PS9A 3GRSA 4J31A 4C74A 3AEBA 1Q9IA 3COXA 4II3A 4B63A 1GERA 3Q6JA 4ZCDA 4G73A 2YLWA 4AP1A 4EMIA 1COYA 1JEHA 4H4TA 1H7WA 3HYVA 1S3EA 5TR3A 5C3JA 3SYIA 1DOCA 1VRQB 1DJNA 3NN0X 3S61A 4J34A 2VVLA 2PYXA 1YQ3A 2A8XA 5J7XA 3F8RA 4U8NA 4GR1A 3KLJA 1YQ4A 3VQRA 4YT0A 4UP3A 1K4QA 4LA1A 4CNJA 2YM2A 4FK1C 2GQWA 1IUUA 2J3NA 3I3LA 1K0JA 4CY8A 1HYUA 4C5OA 5KVHA 1GALA 2B9XA 4BJZA 4J33A 4D03A 1GSNA 2V60A 4OCGA 2OAMA 2VQ7A 2X99A 3UTGA 3ZNOA 3H4KA 2WQYA 2B9YA 5BVAA 3ICSA 3ZNNA 2BACA 3V76A 1H81A 1H6VA 3GMBA 3ALJA 3BI5A 2CVJA 3GWFA 1E6EA 4IA6A 3IHGA 3PO7A 2RGHA 1NPXA 3B6DA 1KNPA 3C4NA 3AE4A 4J36A 4O5UA 1KIFA 4OVIA 2XFUA 1TDEA 4IVOB 2YG4A 1F8WA 3VR8A 2YLSA 2BXRA 3RP8A 4EIQA 2X50A 2R9ZA 3ITJA 3ICRA 1FEBA 4OPTA 4EQXA 2WEUA 4XWRA 4UDRA 3BNMA 5C2TA 4TLZA 5KMQA 2FJEA 1NHSA 1DXLA 3NK0X 5HY5A
chains in the Genus database with same CATH topology
3AWIA 3GYJA 2ZBWA 1L9CA 2F5ZA 3GWDA 1CL0A 2GR0A 2WS3A 5GSNA 5KXJA 1GT8A 5IQ1A 1NHSA 3UKFA 1DOEA 3T2YA 4ADWA 4YTNA 3UOYA 5JCLA 1VG9A 4K7ZA 4U8OA 4KPRA 4ICYA 3NGCX 2GR3A 1NAAA 4G9KA 2XDOA 3NHOX 3UKQA 2WDRA 4EQSA 1SEZA 1PBFA 2XVJA 4H4RA 5FS8A 2H89A 2OLOA 1JOAA 1NENA 1XANA 2I0ZA 2C7GA 4GDPA 2GAHB 5FS6A 4II2A 4G74A 4ZCCA 2TMDA 1D5TA 3IF9A 4A7AA 4K5RA 2YQUA 4OPUA 3WE0A 1YQZA 2X8CA 4Y4LA 2WU5A 3NNEA 3AD7B 3UKKA 1Y56A 3E1TA 4K22A 1GOSA 2GB0A 2X3NA 5KRQA 4H4ZA 1JRYA 3NTAA 3UKAA 2YR4A 2V5ZA 2YR5A 2BC1A 5U1OA 5KWFA 1ZOYA 3SY4A 3M13A 1RYIA 2BS4A 3VRBA 3BHKA 1EL5A 1L0VA 4GAVA 4A99A 2H88A 2ZZ0A 3CNTA 1BWCA 4I59A 3PS9A 1GRGA 4J56A 2BC0A 2R0CA 1B4VA 5BRTA 3AXBA 2WDVA 3LXDA 3NK1X 3UKPA 5KNLA 1OJCA 2C64A 3T2ZA 3ISHA 4DSGA 1ZDLA 1CF3A 2AQJA 3KU9A 4LIIA 1F3PA 1PBDA 2OLNA 1Z6LA 2XCGA 3SX6A 3R9UA 4TLXA 2C67A 2JAEA 4K2XA 1PHHA 1KFYA 2C72A 3GSIA 1IUXA 2FJBA 2BK5A 2XVIA 2RGJA 3AECA 1KDGA 3K7QX 2C65A 4TM1A 1PJ7A 3QSMA 5CKUA 5BUKA 3CNSA 4C3YA 1TDNA 1ONFA 1OJAA 2ZZCA 2YLZA 2C3DA 2BK4A 2YLRA 4J2WA 3QVRA 2VQBA 2IVDA 1Y56B 4AOXA 5FS9A 2YG5A 4BJYA 1CJ4A 1NHRA 4K8DA 4YKFA 2GH5A 1EBDA 3LZXA 4NZHA 3AE8A 3DK9A 3SFEA 3GDPA 5JCMA 3URHA 1NDAA 3T2KA 3CIRA 4A79A 3DJEA 1BKWA 3DJDA 1LTXR 3P9UA 1MOKA 4X9NA 3ABVA 3NIXA 4H4XA 2WETA 4G6HA 4GRTA 4FX9A 3F8PA 2V3AA 4GUVA 3L8KA 4BK1A 1EL8A 4D04A 4Z2UA 3B3RA 5HHFA 2BA9A 1M64A 4H4UA 4JQ9A 3HYWA 4U8PA 3QJ4A 3RHAA 4A5LA 3AE1A 2BK3A 3KPKA 4RG4A 5J60A 2CDUA 3ZDNA 1OJTA 4OPCA 1ELIA 3C96A 2C75A 2IIDA 4B68A 4U8MA 2BYBA 1IJHA 2PHHA 2UZZA 1ZKQA 2XLUA 3Q9TA 3AB1A 2AAQA 3DH9A 4Z2TA 1NHQA 2AR8A 1AOGA 3AYLA 3SZ0A 3ICTA 3AE9A 4CNKA 3AEGA 1LVLA 1XDIA 2Q6UA 2XFPA 4YSYA 3GYIA 5FS7A 3NK2X 2NPXA 2R4JA 3NYFA 1OJDA 1BGNA 1IUTA 2BS2A 2FJDA 4NEVA 4O5QA 4BK2A 4REKA 1D4DA 2QAEA 4TM4A 1CHUA 1NG3A 1H86A 2GR2A 3SQPA 4A6NA 4MJWA 2XVHA 3CPJG 3CGCA 1GV4A 4E0VA 2BRAA 1DJQA 1H83A 3GMCA 3IHMA 3H8IA 4YSXA 2JB1A 1D4CA 1CC4A 2GV8A 2JKCA 3AEFA 1RSGA 3P1WA 1XHCA 2QCUA 3KA7A 2JK6A 4USQA 4DSHA 2R45A 2YG7A 3FBSA 2Q0LA 4AT0A 4EIPA 1H84A 2WP6A 2BRYA 2XYOA 2V3BA 1F8SA 1GXFA 4WCTA 2EQ9A 1E1NA 4UDQA 1JRZA 4AP3A 3CGEA 2V61A 2XVFA 1K0IA 2DKIA 4JY3A 1QO8A 3QVPA 3NTDA 1NHPA 4JN9A 3SM8A 1Q1WA 4NTDA 4YSHA 4DGKA 2HQMA 1GTHA 3AE2A 1F6MA 2WU2A 3DA1A 4Y4NA 1EL7A 2GF3A 3FG2P 2GMHA 3UKLA 3GD3A 4XWZA 1PXAA 3BHFA 4U8IA 3CMMA 4B65A 2XLPA 1LPFA 1D7LA 1GRTA 3ATRA 1H82A 1E1MA 3HZLA 3P4SA 3KD9A 1O5WA 2OALA 3KPFA 4KX6A 2BCGG 3L1RA 1IUSA 4Z44A 4A9WA 5L46A 3CNDA 2ZZBA 3NT6A 4ZN0A 1KF6A 1MO9A 2O9ZA 3AEEA 1TDFA 5EBKA 3VR9A 1B37A 3H8LA 1GREA 4G6GA 1VQWA 1LV0A 2X8GA 4A6NB 2XVEA 1LJ1A 2YVJA 3NN6X 3FPZA 1CC6A 3AD9B 3DGZA 3AEDA 2GVCA 1CBOA 5M0ZA 2XLSA 2XFQA 3SZWA 5KOWA 1GTEA 4GF7A 5CQFA 3UKHA 1CJ3A 2E1MA 3QFAA 4OPLA 4Y4MA 5KVIA 1PDHA 3NYEA 1GRFA 4JDRA 2WDQA 4IA5A 1IUVA 1JNRA 3K7MX 3LOVA 1UKVG 2RGOA 2FJAA 4IV9A 3SZFA 3EANA 4JNAA 3CNPA 1TDOA 4EMWA 3FIMB 1N4UA 3AYJA 3AD8B 2EQ6A 1ZP0A 4OPGA 2CULA 2X8HA 3KKJA 3D8XA 4HB9A 1GEUA 3DGHA 5BULA 4XXGA 4U8LA 2BXSA 4HA6A 2XFOA 1E7PA 1N4VA 3UTFA 3M12A 3SXIA 3DK8A 2GRTA 2WOVA 4NEWA 4H4PA 4WX1A 3UP5A 4BK3A 4JY2A 3QSEA 1X31B 5LV9A 3LB8A 4PABA 1B5QA 2R46A 3O0HA 3IWAA 4YWOA 1F8RA 1PJ5A 1O94A 4EQWA 2WOWA 4FDCB 3T37A 1TYTA 4H4QA 3NLCA 5JCIA 4YSZA 2GEWA 4CCQA 3C4AA 3ATQA 3AEAA 3P4QA 2VRMA 4TM3A 3DJGX 3OC4A 4I58A 1PXCA 2WPCA 1BF3A 2ACZA 2WP9A 5KMSA 1P2EA 3BI4A 2E5VA 3AE5A 1PN0A 3IC9A 3UOXA 2YM1A 3S5WA 3VRAA 3M0OA 5EOWA 4H4WA 2V6OA 3SFDA 4H50A 4GDEA 4Z24A 1GESA 1TDKA 3BNUA 4YXDA 2YLXA 3DMEA 2R0PA 2B9WA 2B76A 2WP5A 2YVGA 1ZMDA 4Z25A 4H2NA 1O95A 2WPFA 4H7UA 5JCKA 1GRAA 3D1CA 4X9MA 4U2LA 1YY5A 2EQ8A 2DKHA 1GNDA 1YKJA 3UOVA 1CJ2A 1E39A 1QLBA 4BV6A 4H4VA 4Z2RA 3CGBA 1VG0A 2C70A 4GCMA 2VRLA 3HYXA 2XLRA 3VRDB 3RNMA 4H2QA 1JU2A 1NG4A 2Q7VA 2BS3A 2ARDA 3AYIA 2VOUA 2TPRA 4K5SA 2VVMA 4OPDA 3EF6A 4JNQA 4OPIA 2GR1A 3UTEA 4LU6A 2BABA 1Q1RA 2GAGB 2Y6RA 2YG6A 3I6DA 5GRTA 2R4EA 1L9EA 5EB5A 4TM0A 3K30A 3RP7A 2WESA 3ALLA 4M52A 2C73A 4N9XA 3K7TA 1H7XA 1FL2A 1TYPA 1MXTA 1LQTA 2YAUA 1GETA 1VDCA 4AT2A 1DOBA 1FCDA 4B67A 4H2PA 1PBBA 2QA2A 5KMPA 3ALMA 4X4JA 1S2QA 2YR6A 4UDPA 3OZ2A 3CGDA 4CBQA 2BCPA 4DNAA 4H4YA 3GYXA 3REDA 5FMHA 1KSUA 3CPIG 2C4CA 1JNZA 4B1BA 2Y6QA 2NVKX 2Q0KA 1BZLA 1M6IA 4NTCA 5HXIA 4EM3A 1N4WA 1ZOVA 4H2RA 2JBVA 1L9DA 1V59A 3NYCA 4NNJA 4BURA 1N1PA 2FBWA 2WOIA 3AE6A 2C76A 1Y0PA 4YKGA 1D4EA 4YTPA 2C66A 3G5SA 3P4RA 2W0HA 3RP6A 2XFNA 3NH3X 1PBCA 1PBEA 2XLTA 4IVMB 1NEKA 4YTMA 4C77A 5DBJA 1GPEA 4CCRA 4CRTA 3UP4A 2Z5XA 4B64A 2GMJA 2YVFA 2WPEA 3QSSA 4B69A 2GQFA 3G5QA 3SGLA 3UCLA 5KMRA 3CTYA 1FEAA 1OJ9A 3NG7X 3CN8A 1XPQA 3T14A 1JRXA 3GDNA 4B66A 1GRHA 1QJDA 1S3BA 2VVLG 1DNCA 3CNJA 3LADA 1GRBA 4PAAA 2EQ7A 4ECHA 1ZX9A 3AE3A 1B8SA 5ER0A 1KSSA 3LZWA 4EM4A 2CFYA 1D7YA 2YG3A 3FMWA 4RSLA 1W4XA 3CPHG 3PVCA 2JB3A 1CC2A 1EL9A 4USRA 3UOZA 3EAOA 2JB2A 4NTEA 1LQUA 1DODA 1PXBA 5EB4A 2A89A 2WHDA 2OA1A 2WBAA 5IQ4A 3G5RA 2APGA 2YWLA 5KOXA 5IPYA 3P4PA 2R0GA 4AOSA 1E1KA 1BGJA 4Z43A 1REOA 3QFBA 4U2SA 3DK4A 3NKSA 4U8KA 1FOHA 2QA1A 2YLTA 3UTHA 4GAPA 1PJ6A 2B7RA 3JSKA 3KVEA 3NRNA 2B7SA 4H4SA 1E1LA 4J57A 1IUWA 3V3OA 1K0LA 4CY6A 2IVEA 2RABA 4FK1A 2C3CA 4P9SA 3T31A 4EQRA 2VZ2A 4A65A 1CJCA 3T0KA 4EMJA 2E4GA 4Z26A 5U25A 1ZY8A 3EPTA 3GD4A 3ZYXA 4C3XA 1KNRA 3F8DA 1ZMCA 1FECA 1RP0A 3II4A 4RG3A 5U63A 3ADAB 1S2YA 4APNA 1ZK7A 4U8JA 5JCNA 3SZCA 5M10A 2A87A 4U2TA 3AE7A 4NWZA 3LJPA 3BI2A 5HYMA 1TRBA 3V3NA 3DJJA 2Z5YA 3GRTA 1PS9A 3GRSA 4J31A 4C74A 3AEBA 1Q9IA 3COXA 4II3A 4B63A 1GERA 3Q6JA 4ZCDA 4G73A 2YLWA 4AP1A 4EMIA 1COYA 1JEHA 4H4TA 1H7WA 3HYVA 1S3EA 5TR3A 5C3JA 3SYIA 1DOCA 1DJNA 1VRQB 3NN0X 3S61A 4J34A 2VVLA 2PYXA 1YQ3A 2A8XA 5J7XA 3F8RA 4U8NA 4GR1A 3KLJA 1YQ4A 3VQRA 4YT0A 4UP3A 1K4QA 4LA1A 4CNJA 2YM2A 4FK1C 2GQWA 1IUUA 2J3NA 3I3LA 1K0JA 4CY8A 1HYUA 4C5OA 5KVHA 1GALA 2B9XA 4BJZA 4J33A 4D03A 1GSNA 2V60A 4OCGA 2OAMA 2VQ7A 2X99A 3UTGA 3H4KA 2WQYA 2B9YA 5BVAA 3ICSA 2BACA 3V76A 1H81A 1H6VA 3GMBA 3ALJA 3BI5A 2CVJA 3GWFA 1E6EA 4IA6A 3IHGA 3PO7A 2RGHA 1NPXA 3B6DA 1KNPA 3C4NA 3AE4A 4J36A 4O5UA 4OVIA 2XFUA 1TDEA 4IVOB 2YG4A 1F8WA 3VR8A 2YLSA 2BXRA 3RP8A 4EIQA 2X50A 2R9ZA 3ITJA 3ICRA 1FEBA 4OPTA 4EQXA 2WEUA 4XWRA 4UDRA 3BNMA 5C2TA 4TLZA 5KMQA 2FJEA 1P2HA 1DXLA 3NK0X 5HY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWI A;  3GYJ A;  2ZBW A;  1L9C A;  2F5Z A;  3GWD A;  1CL0 A;  2GR0 A;  2WS3 A;  5GSN A;  5KXJ A;  1GT8 A;  5IQ1 A;  1NHS A;  3UKF A;  1DOE A;  4ADW A;  4YTN A;  3UOY A;  5JCL A;  1VG9 A;  4K7Z A;  4U8O A;  4KPR A;  4ICY A;  3NGC X;  2GR3 A;  1NAA A;  2XDO A;  3NHO X;  3UKQ A;  2WDR A;  4EQS A;  1SEZ A;  1PBF A;  2XVJ A;  4H4R A;  5FS8 A;  2H89 A;  2OLO A;  1JOA A;  1NEN A;  1XAN A;  2I0Z A;  2C7G A;  4GDP A;  2GAH B;  5FS6 A;  4ZCC A;  2TMD A;  1D5T A;  3IF9 A;  4A7A A;  4K5R A;  2YQU A;  4OPU A;  3WE0 A;  1YQZ A;  2X8C A;  4Y4L A;  2WU5 A;  3NNE A;  3AD7 B;  3UKK A;  1Y56 A;  3E1T A;  4K22 A;  1GOS A;  2GB0 A;  2X3N A;  5KRQ A;  4H4Z A;  1JRY A;  3NTA A;  3UKA A;  2YR4 A;  2V5Z A;  2YR5 A;  2BC1 A;  5U1O A;  5KWF A;  1ZOY A;  3M13 A;  1RYI A;  2BS4 A;  3VRB A;  3BHK A;  1EL5 A;  1L0V A;  4A99 A;  2H88 A;  2ZZ0 A;  3CNT A;  1BWC A;  4I59 A;  3PS9 A;  1GRG A;  4J56 A;  2BC0 A;  2R0C A;  1B4V A;  5BRT A;  3AXB A;  2WDV A;  3LXD A;  3NK1 X;  3UKP A;  1OJC A;  2C64 A;  3ISH A;  4DSG A;  1ZDL A;  1CF3 A;  2AQJ A;  3KU9 A;  4LII A;  1F3P A;  1PBD A;  2OLN A;  1Z6L A;  2XCG A;  3R9U A;  4TLX A;  2C67 A;  2JAE A;  4K2X A;  1PHH A;  1KFY A;  2C72 A;  3GSI A;  1IUX A;  2FJB A;  2BK5 A;  2XVI A;  2RGJ A;  3AEC A;  1KDG A;  3K7Q X;  2C65 A;  4TM1 A;  1PJ7 A;  3QSM A;  5CKU A;  5BUK A;  3CNS A;  4C3Y A;  1TDN A;  1ONF A;  1OJA A;  2ZZC A;  2YLZ A;  2C3D A;  2BK4 A;  2YLR A;  4J2W A;  3QVR A;  2VQB A;  2IVD A;  1Y56 B;  4AOX A;  5FS9 A;  2YG5 A;  1CJ4 A;  4BJY A;  1NHR A;  4K8D A;  4YKF A;  2GH5 A;  1EBD A;  3LZX A;  4NZH A;  3AE8 A;  3DK9 A;  3SFE A;  3GDP A;  5JCM A;  3URH A;  1NDA A;  3CIR A;  4A79 A;  3DJE A;  1BKW A;  3DJD A;  1LTX R;  3P9U A;  1MOK A;  4X9N A;  3ABV A;  3NIX A;  4H4X A;  2WET A;  4GRT A;  4FX9 A;  3F8P A;  2V3A A;  4GUV A;  3L8K A;  4BK1 A;  1EL8 A;  4D04 A;  4Z2U A;  3B3R A;  5HHF A;  2BA9 A;  1M64 A;  4H4U A;  4JQ9 A;  4U8P A;  3QJ4 A;  3RHA A;  4A5L A;  3AE1 A;  2BK3 A;  4RG4 A;  5J60 A;  2CDU A;  3ZDN A;  1OJT A;  4OPC A;  1ELI A;  3C96 A;  2C75 A;  2IID A;  4B68 A;  4U8M A;  2BYB A;  1IJH A;  2PHH A;  2UZZ A;  1ZKQ A;  2XLU A;  3Q9T A;  3AB1 A;  2AAQ A;  3DH9 A;  4Z2T A;  1NHQ A;  2AR8 A;  1AOG A;  3AYL A;  3ICT A;  3AE9 A;  4CNK A;  3AEG A;  1LVL A;  1XDI A;  2Q6U A;  2XFP A;  4YSY A;  3GYI A;  5FS7 A;  3NK2 X;  2NPX A;  2R4J A;  3NYF A;  1OJD A;  1BGN A;  1IUT A;  2BS2 A;  2FJD A;  4NEV A;  4O5Q A;  4REK A;  3SQP A;  1D4D A;  2QAE A;  4TM4 A;  1CHU A;  1NG3 A;  1H86 A;  2GR2 A;  4BK2 A;  4A6N A;  4MJW A;  2XVH A;  3CPJ G;  3CGC A;  1GV4 A;  4E0V A;  1DJQ A;  1H83 A;  3GMC A;  3IHM A;  3H8I A;  4YSX A;  2JB1 A;  1D4C A;  1CC4 A;  2GV8 A;  2JKC A;  3AEF A;  1RSG A;  3P1W A;  1XHC A;  2QCU A;  3KA7 A;  2JK6 A;  4USQ A;  4DSH A;  2R45 A;  2YG7 A;  3FBS A;  2Q0L A;  4AT0 A;  4EIP A;  1H84 A;  2WP6 A;  2XYO A;  2V3B A;  1F8S A;  1GXF A;  4WCT A;  2EQ9 A;  1E1N A;  4UDQ A;  1JRZ A;  4AP3 A;  3CGE A;  2V61 A;  2XVF A;  1K0I A;  2DKI A;  4JY3 A;  1QO8 A;  3QVP A;  3NTD A;  1NHP A;  4JN9 A;  3SM8 A;  1Q1W A;  4NTD A;  4YSH A;  4DGK A;  2HQM A;  1GTH A;  3AE2 A;  1F6M A;  2WU2 A;  3DA1 A;  4Y4N A;  1EL7 A;  2GF3 A;  3FG2 P;  2GMH A;  3UKL A;  3GD3 A;  4XWZ A;  1PXA A;  3BHF A;  4U8I A;  4B65 A;  2XLP A;  1LPF A;  1D7L A;  1GRT A;  3ATR A;  1H82 A;  1E1M A;  3HZL A;  3P4S A;  3KD9 A;  1O5W A;  2OAL A;  3KPF A;  4KX6 A;  2BCG G;  3L1R A;  1IUS A;  4Z44 A;  4A9W A;  5L46 A;  3CND A;  2ZZB A;  3NT6 A;  4ZN0 A;  1KF6 A;  1MO9 A;  2O9Z A;  3AEE A;  1TDF A;  5EBK A;  3VR9 A;  1B37 A;  3H8L A;  1GRE A;  1VQW A;  1LV0 A;  2X8G A;  4A6N B;  2XVE A;  1LJ1 A;  2YVJ A;  3NN6 X;  3FPZ A;  1CC6 A;  3AD9 B;  3DGZ A;  3AED A;  2GVC A;  1CBO A;  5M0Z A;  2XLS A;  2XFQ A;  5KOW A;  1GTE A;  4GF7 A;  5CQF A;  3UKH A;  1CJ3 A;  2E1M A;  3QFA A;  4OPL A;  4Y4M A;  5KVI A;  1PDH A;  3NYE A;  1GRF A;  4JDR A;  2WDQ A;  4IA5 A;  1IUV A;  1JNR A;  3K7M X;  3LOV A;  1UKV G;  2RGO A;  2FJA A;  4IV9 A;  3EAN A;  4JNA A;  3CNP A;  1TDO A;  4EMW A;  3FIM B;  1N4U A;  3AYJ A;  3AD8 B;  2EQ6 A;  1ZP0 A;  4OPG A;  2CUL A;  2X8H A;  3KKJ A;  3D8X A;  4HB9 A;  1GEU A;  3DGH A;  5BUL A;  4XXG A;  4U8L A;  2BXS A;  4HA6 A;  2XFO A;  1E7P A;  1N4V A;  3UTF A;  3M12 A;  3DK8 A;  2GRT A;  2WOV A;  4NEW A;  4H4P A;  4WX1 A;  3UP5 A;  4BK3 A;  4JY2 A;  3QSE A;  1X31 B;  5LV9 A;  3LB8 A;  4PAB A;  1B5Q A;  2R46 A;  3O0H A;  3IWA A;  4YWO A;  1F8R A;  1PJ5 A;  1O94 A;  4EQW A;  2WOW A;  4FDC B;  3T37 A;  1TYT A;  4H4Q A;  3NLC A;  5JCI A;  4YSZ A;  2GEW A;  4CCQ A;  3ATQ A;  3C4A A;  3AEA A;  3P4Q A;  2VRM A;  4TM3 A;  3DJG X;  3OC4 A;  4I58 A;  1PXC A;  2WPC A;  1BF3 A;  2ACZ A;  2WP9 A;  1P2E A;  3BI4 A;  2E5V A;  3AE5 A;  1PN0 A;  3IC9 A;  3UOX A;  2YM1 A;  3S5W A;  3VRA A;  3M0O A;  5EOW A;  4H4W A;  2V6O A;  3SFD A;  4H50 A;  4GDE A;  4Z24 A;  1GES A;  1TDK A;  3BNU A;  4YXD A;  2YLX A;  3DME A;  2R0P A;  2B9W A;  2B76 A;  2WP5 A;  2YVG A;  1ZMD A;  4Z25 A;  4H2N A;  1O95 A;  2WPF A;  4H7U A;  5JCK A;  1GRA A;  3D1C A;  4X9M A;  4U2L A;  1YY5 A;  2EQ8 A;  2DKH A;  1GND A;  1YKJ A;  3UOV A;  1CJ2 A;  1E39 A;  1QLB A;  4BV6 A;  4H4V A;  4Z2R A;  3CGB A;  1VG0 A;  2C70 A;  4GCM A;  2VRL A;  2XLR A;  3VRD B;  3RNM A;  4H2Q A;  1JU2 A;  1NG4 A;  2Q7V A;  2BS3 A;  2ARD A;  3AYI A;  2VOU A;  2TPR A;  4K5S A;  2VVM A;  4OPD A;  3EF6 A;  4JNQ A;  4OPI A;  2GR1 A;  3UTE A;  4LU6 A;  2BAB A;  1Q1R A;  2GAG B;  2Y6R A;  2YG6 A;  3I6D A;  5GRT A;  2R4E A;  1L9E A;  5EB5 A;  4TM0 A;  3K30 A;  2WES A;  4M52 A;  3ALL A;  3RP7 A;  2C73 A;  4N9X A;  3K7T A;  1H7X A;  1FL2 A;  1TYP A;  1MXT A;  1LQT A;  2YAU A;  1GET A;  1VDC A;  4AT2 A;  1DOB A;  1FCD A;  4B67 A;  4H2P A;  1PBB A;  2QA2 A;  3ALM A;  4X4J A;  1S2Q A;  2YR6 A;  4UDP A;  3OZ2 A;  3CGD A;  4CBQ A;  2BCP A;  4DNA A;  4H4Y A;  3RED A;  5FMH A;  1KSU A;  3CPI G;  1JNZ A;  4B1B A;  2Y6Q A;  2NVK X;  2Q0K A;  1BZL A;  1M6I A;  4NTC A;  5HXI A;  4EM3 A;  1N4W A;  1ZOV A;  4H2R A;  2JBV A;  1L9D A;  1V59 A;  3NYC A;  4BUR A;  1N1P A;  2FBW A;  2WOI A;  3AE6 A;  2C76 A;  1Y0P A;  4YKG A;  1D4E A;  4YTP A;  2C66 A;  3G5S A;  3P4R A;  2W0H A;  2XFN A;  3RP6 A;  3NH3 X;  1PBC A;  1PBE A;  2XLT A;  4IVM B;  1NEK A;  4YTM A;  4C77 A;  5DBJ A;  1GPE A;  4CCR A;  4CRT A;  3UP4 A;  2Z5X A;  4B64 A;  2GMJ A;  2YVF A;  2WPE A;  3QSS A;  4B69 A;  2GQF A;  3G5Q A;  3SGL A;  3UCL A;  3CTY A;  1FEA A;  1OJ9 A;  3NG7 X;  3CN8 A;  1XPQ A;  1JRX A;  3GDN A;  4B66 A;  1GRH A;  1QJD A;  1S3B A;  2VVL G;  1DNC A;  3CNJ A;  3LAD A;  1GRB A;  4PAA A;  2EQ7 A;  4ECH A;  1ZX9 A;  3AE3 A;  1B8S A;  5ER0 A;  1KSS A;  3LZW A;  4EM4 A;  2CFY A;  1D7Y A;  2YG3 A;  3FMW A;  4RSL A;  1W4X A;  3CPH G;  3PVC A;  2JB3 A;  1CC2 A;  1EL9 A;  4USR A;  3UOZ A;  3EAO A;  2JB2 A;  4NTE A;  1LQU A;  1DOD A;  1PXB A;  5EB4 A;  2A89 A;  2WHD A;  2OA1 A;  2WBA A;  5IQ4 A;  3G5R A;  2APG A;  2YWL A;  5KOX A;  5IPY A;  3P4P A;  2R0G A;  4AOS A;  1E1K A;  1BGJ A;  4Z43 A;  1REO A;  3QFB A;  4U2S A;  3DK4 A;  3NKS A;  4U8K A;  1FOH A;  2QA1 A;  2YLT A;  3UTH A;  1PJ6 A;  2B7R A;  3JSK A;  3KVE A;  3NRN A;  2B7S A;  4H4S A;  1E1L A;  4J57 A;  1IUW A;  3V3O A;  1K0L A;  4CY6 A;  2IVE A;  2RAB A;  4FK1 A;  2C3C A;  4P9S A;  4EQR A;  2VZ2 A;  4A65 A;  1CJC A;  4EMJ A;  2E4G A;  4Z26 A;  5U25 A;  1ZY8 A;  3EPT A;  3GD4 A;  3ZYX A;  4C3X A;  1KNR A;  3F8D A;  1ZMC A;  1FEC A;  1RP0 A;  3II4 A;  4RG3 A;  5U63 A;  3ADA B;  1S2Y A;  4APN A;  1ZK7 A;  4U8J A;  5JCN A;  5M10 A;  2A87 A;  4U2T A;  3AE7 A;  3LJP A;  3BI2 A;  1TRB A;  5HYM A;  3V3N A;  3DJJ A;  2Z5Y A;  3GRT A;  1PS9 A;  3GRS A;  4J31 A;  4C74 A;  3AEB A;  1Q9I A;  3COX A;  4B63 A;  1GER A;  3Q6J A;  4ZCD A;  2YLW A;  4AP1 A;  4EMI A;  1COY A;  1JEH A;  4H4T A;  1H7W A;  1S3E A;  5TR3 A;  5C3J A;  1DOC A;  1DJN A;  1VRQ B;  3NN0 X;  3S61 A;  4J34 A;  2VVL A;  2PYX A;  1YQ3 A;  2A8X A;  5J7X A;  3F8R A;  4U8N A;  4GR1 A;  3KLJ A;  1YQ4 A;  3VQR A;  4YT0 A;  4UP3 A;  1K4Q A;  4LA1 A;  4CNJ A;  2YM2 A;  4FK1 C;  2GQW A;  1IUU A;  2J3N A;  3I3L A;  1K0J A;  4CY8 A;  1HYU A;  4C5O A;  5KVH A;  1GAL A;  2B9X A;  4BJZ A;  4J33 A;  4D03 A;  1GSN A;  2V60 A;  4OCG A;  2OAM A;  2VQ7 A;  2X99 A;  3UTG A;  3H4K A;  2WQY A;  2B9Y A;  5BVA A;  3ICS A;  2BAC A;  3V76 A;  1H81 A;  1H6V A;  3GMB A;  3ALJ A;  3BI5 A;  2CVJ A;  3GWF A;  1E6E A;  4IA6 A;  3IHG A;  3PO7 A;  2RGH A;  1NPX A;  3B6D A;  1KNP A;  3C4N A;  3AE4 A;  4J36 A;  4O5U A;  4OVI A;  2XFU A;  1TDE A;  4IVO B;  2YG4 A;  1F8W A;  3VR8 A;  2YLS A;  2BXR A;  3RP8 A;  4EIQ A;  2X50 A;  2R9Z A;  3ITJ A;  3ICR A;  1FEB A;  4OPT A;  4EQX A;  2WEU A;  4XWR A;  4UDR A;  3BNM A;  5C2T A;  4TLZ A;  2FJE A;  1P2H A;  1DXL A;  3NK0 X;  5HY5 A; 
#chains in the Genus database with same CATH topology
 3AWI A;  3GYJ A;  2ZBW A;  1L9C A;  2F5Z A;  3GWD A;  1CL0 A;  2GR0 A;  2WS3 A;  5GSN A;  5KXJ A;  1GT8 A;  5IQ1 A;  3UKF A;  1DOE A;  3T2Y A;  4ADW A;  4YTN A;  3UOY A;  5JCL A;  1VG9 A;  4K7Z A;  4U8O A;  3CUK A;  1VE9 A;  4KPR A;  4ICY A;  3NGC X;  2GR3 A;  1NAA A;  4G9K A;  2XDO A;  3NHO X;  3UKQ A;  2WDR A;  4EQS A;  1SEZ A;  1PBF A;  3W4K A;  2XVJ A;  1P2H A;  4H4R A;  5FS8 A;  2OLO A;  2H89 A;  1JOA A;  1NEN A;  1XAN A;  2I0Z A;  2C7G A;  4GDP A;  2GAH B;  5FS6 A;  4II2 A;  4G74 A;  4ZCC A;  2TMD A;  3IF9 A;  1D5T A;  4A7A A;  4K5R A;  2YQU A;  4OPU A;  3WE0 A;  1C0I A;  1YQZ A;  2X8C A;  4Y4L A;  2WU5 A;  3NNE A;  3AD7 B;  3UKK A;  1Y56 A;  3E1T A;  4K22 A;  2GB0 A;  1GOS A;  2X3N A;  5KRQ A;  4H4Z A;  1JRY A;  3NTA A;  3UKA A;  2YR4 A;  2V5Z A;  2YR5 A;  2BC1 A;  5U1O A;  5KWF A;  1ZOY A;  3SY4 A;  3M13 A;  1RYI A;  2BS4 A;  3VRB A;  3BHK A;  4YJF A;  1EL5 A;  1L0V A;  4GAV A;  4A99 A;  2H88 A;  2ZZ0 A;  3CNT A;  1BWC A;  4I59 A;  3PS9 A;  1GRG A;  4J56 A;  2BC0 A;  2R0C A;  1B4V A;  5BRT A;  3AXB A;  2WDV A;  3LXD A;  3NK1 X;  3UKP A;  5KNL A;  1OJC A;  2C64 A;  3T2Z A;  3ISH A;  4DSG A;  1ZDL A;  1CF3 A;  2AQJ A;  3KU9 A;  4LII A;  1F3P A;  1PBD A;  1C0K A;  2OLN A;  1Z6L A;  2XCG A;  3SX6 A;  3R9U A;  4TLX A;  2C67 A;  2JAE A;  4K2X A;  1PHH A;  1KFY A;  2C72 A;  3GSI A;  1IUX A;  2FJB A;  2BK5 A;  2XVI A;  2RGJ A;  3AEC A;  1KDG A;  3K7Q X;  2C65 A;  4TM1 A;  1PJ7 A;  3QSM A;  5CKU A;  5BUK A;  3CNS A;  4C3Y A;  1TDN A;  1ONF A;  1OJA A;  2ZZC A;  2YLZ A;  2C3D A;  2BK4 A;  2YLR A;  4J2W A;  1DDO A;  3QVR A;  2VQB A;  2IVD A;  1Y56 B;  4AOX A;  5FS9 A;  2YG5 A;  1CJ4 A;  4BJY A;  1NHR A;  4K8D A;  4YKF A;  2GH5 A;  1EBD A;  3LZX A;  4NZH A;  3AE8 A;  3DK9 A;  3SFE A;  3GDP A;  5JCM A;  3URH A;  1NDA A;  3T2K A;  3CIR A;  4A79 A;  3DJE A;  1BKW A;  3DJD A;  1LTX R;  3P9U A;  1MOK A;  4X9N A;  3ABV A;  3NIX A;  4H4X A;  2WET A;  4G6H A;  4GRT A;  4FX9 A;  4YJH A;  3F8P A;  2V3A A;  4GUV A;  3L8K A;  4BK1 A;  1EL8 A;  4D04 A;  4Z2U A;  2E49 A;  3B3R A;  5HHF A;  2BA9 A;  1M64 A;  4H4U A;  4JQ9 A;  3HYW A;  4U8P A;  3QJ4 A;  3RHA A;  4A5L A;  3AE1 A;  2BK3 A;  3KPK A;  4RG4 A;  5J60 A;  2CDU A;  3ZDN A;  1OJT A;  4OPC A;  1ELI A;  3C96 A;  2C75 A;  2IID A;  4B68 A;  4U8M A;  2BYB A;  1IJH A;  2PHH A;  2UZZ A;  1ZKQ A;  2XLU A;  3Q9T A;  3AB1 A;  2AAQ A;  3DH9 A;  4Z2T A;  1NHQ A;  2AR8 A;  1AOG A;  3AYL A;  3SZ0 A;  3ICT A;  2DU8 A;  3AE9 A;  4CNK A;  3AEG A;  1LVL A;  1XDI A;  2Q6U A;  2XFP A;  3ZNQ A;  3GYI A;  5FS7 A;  3NK2 X;  4YSY A;  2NPX A;  2R4J A;  3NYF A;  1OJD A;  1BGN A;  1IUT A;  2BS2 A;  2FJD A;  4NEV A;  4O5Q A;  4BK2 A;  4REK A;  1D4D A;  2QAE A;  4TM4 A;  1CHU A;  1NG3 A;  1H86 A;  2GR2 A;  3SQP A;  4A6N A;  4MJW A;  2XVH A;  3CPJ G;  3CGC A;  1GV4 A;  4E0V A;  2BRA A;  1DJQ A;  1H83 A;  3GMC A;  3IHM A;  3H8I A;  4YSX A;  2JB1 A;  1D4C A;  1CC4 A;  2GV8 A;  2JKC A;  3AEF A;  1RSG A;  3P1W A;  2QCU A;  1XHC A;  3KA7 A;  2JK6 A;  4USQ A;  4DSH A;  2R45 A;  2YG7 A;  3FBS A;  2Q0L A;  4AT0 A;  4EIP A;  1H84 A;  2WP6 A;  2BRY A;  2XYO A;  4WCT A;  1F8S A;  1GXF A;  2V3B A;  2EQ9 A;  1E1N A;  4UDQ A;  1JRZ A;  4AP3 A;  3CGE A;  2V61 A;  2XVF A;  4YJG A;  1K0I A;  2DKI A;  4JY3 A;  1QO8 A;  3QVP A;  3NTD A;  1NHP A;  4JN9 A;  3SM8 A;  1Q1W A;  4NTD A;  4YSH A;  4DGK A;  2HQM A;  1GTH A;  3AE2 A;  3DA1 A;  1F6M A;  2WU2 A;  4Y4N A;  1EL7 A;  2GF3 A;  3FG2 P;  2GMH A;  3UKL A;  4XWZ A;  3GD3 A;  1PXA A;  3BHF A;  4U8I A;  3CMM A;  4B65 A;  2XLP A;  1LPF A;  1D7L A;  1GRT A;  3ATR A;  1H82 A;  1E1M A;  3HZL A;  3P4S A;  3KD9 A;  5L46 A;  1O5W A;  2OAL A;  3WGT A;  2BCG G;  3KPF A;  1IUS A;  3L1R A;  4KX6 A;  4Z44 A;  4A9W A;  3CND A;  2ZZB A;  3NT6 A;  4ZN0 A;  1KF6 A;  1MO9 A;  2O9Z A;  3AEE A;  1TDF A;  5EBK A;  3VR9 A;  1B37 A;  3H8L A;  1GRE A;  4G6G A;  1VQW A;  1LV0 A;  2X8G A;  4A6N B;  2XVE A;  1LJ1 A;  2YVJ A;  3NN6 X;  3FPZ A;  1CC6 A;  3AD9 B;  3DGZ A;  3AED A;  2GVC A;  1CBO A;  5M0Z A;  2XLS A;  2XFQ A;  3SZW A;  5KOW A;  2E48 A;  4GF7 A;  1GTE A;  5CQF A;  1CJ3 A;  2E1M A;  3QFA A;  4OPL A;  4Y4M A;  5KVI A;  3UKH A;  1PDH A;  3NYE A;  1GRF A;  4JDR A;  2WDQ A;  4IA5 A;  1IUV A;  1JNR A;  3K7M X;  3LOV A;  1UKV G;  2RGO A;  2FJA A;  4IV9 A;  3SZF A;  4YJG B;  3EAN A;  4JNA A;  3CNP A;  1TDO A;  4EMW A;  3FIM B;  1N4U A;  3AYJ A;  3AD8 B;  2EQ6 A;  1ZP0 A;  4OPG A;  2CUL A;  2X8H A;  3KKJ A;  3D8X A;  4HB9 A;  1GEU A;  3DGH A;  5BUL A;  4XXG A;  4U8L A;  2BXS A;  4HA6 A;  2XFO A;  1E7P A;  1N4V A;  3UTF A;  3M12 A;  3SXI A;  3DK8 A;  2GRT A;  1EVI A;  2WOV A;  4NEW A;  4H4P A;  4WX1 A;  3UP5 A;  4BK3 A;  3QSE A;  4JY2 A;  1X31 B;  5LV9 A;  3LB8 A;  4PAB A;  2R46 A;  1B5Q A;  3O0H A;  3IWA A;  4YWO A;  1F8R A;  1PJ5 A;  1O94 A;  4EQW A;  2WOW A;  4FDC B;  3T37 A;  1TYT A;  4H4Q A;  3NLC A;  5JCI A;  4YSZ A;  2E82 A;  2GEW A;  4CCQ A;  3C4A A;  3ATQ A;  3AEA A;  3P4Q A;  2VRM A;  4TM3 A;  4YJF B;  3DJG X;  3OC4 A;  4I58 A;  1PXC A;  2WPC A;  1BF3 A;  2ACZ A;  2WP9 A;  5KMS A;  1P2E A;  3BI4 A;  2E5V A;  3AE5 A;  1PN0 A;  3IC9 A;  3UOX A;  2YM1 A;  3S5W A;  3VRA A;  3M0O A;  5EOW A;  4H4W A;  2V6O A;  3SFD A;  4H50 A;  4GDE A;  4Z24 A;  1GES A;  1TDK A;  3BNU A;  4YXD A;  2YLX A;  3DME A;  2R0P A;  2B9W A;  2B76 A;  2WP5 A;  2YVG A;  1ZMD A;  4Z25 A;  4H2N A;  4YJD A;  1O95 A;  2WPF A;  4QFC A;  4H7U A;  5JCK A;  1GRA A;  3D1C A;  4X9M A;  4U2L A;  1YY5 A;  2EQ8 A;  1YKJ A;  2DKH A;  1GND A;  3UOV A;  1CJ2 A;  1E39 A;  3W4J A;  1QLB A;  4BV6 A;  4H4V A;  4Z2R A;  3CGB A;  1VG0 A;  2C70 A;  4GCM A;  2VRL A;  3HYX A;  2XLR A;  3VRD B;  3RNM A;  4H2Q A;  1JU2 A;  2E4A A;  1NG4 A;  2Q7V A;  2BS3 A;  2ARD A;  3AYI A;  2VOU A;  2TPR A;  4K5S A;  2VVM A;  4OPD A;  3EF6 A;  4JNQ A;  3W4I A;  4OPI A;  2GR1 A;  3UTE A;  4LU6 A;  2BAB A;  2GAG B;  1Q1R A;  2Y6R A;  4YJH B;  2YG6 A;  3I6D A;  5GRT A;  2R4E A;  1L9E A;  5EB5 A;  4QFD A;  3K30 A;  4TM0 A;  3RP7 A;  2WES A;  3ALL A;  4M52 A;  2C73 A;  4N9X A;  3K7T A;  1H7X A;  1FL2 A;  1TYP A;  1MXT A;  1LQT A;  2YAU A;  1GET A;  1VDC A;  4AT2 A;  1DOB A;  1FCD A;  4B67 A;  4H2P A;  1PBB A;  2QA2 A;  5KMP A;  3ALM A;  4X4J A;  1S2Q A;  2YR6 A;  4UDP A;  3OZ2 A;  3CGD A;  4CBQ A;  2BCP A;  4DNA A;  4H4Y A;  3GYX A;  3RED A;  5FMH A;  1KSU A;  3CPI G;  2C4C A;  1JNZ A;  4B1B A;  2Y6Q A;  2NVK X;  2Q0K A;  1BZL A;  1M6I A;  4NTC A;  5HXI A;  1AN9 A;  1C0P A;  4EM3 A;  1N4W A;  1ZOV A;  4H2R A;  2JBV A;  3ZNP A;  1L9D A;  1V59 A;  3NYC A;  4NNJ A;  4BUR A;  1N1P A;  2FBW A;  2WOI A;  3AE6 A;  2C76 A;  3G3E A;  1Y0P A;  1D4E A;  4YKG A;  2C66 A;  3G5S A;  3P4R A;  2W0H A;  3RP6 A;  2XFN A;  3NH3 X;  1PBC A;  1PBE A;  2XLT A;  4IVM B;  1NEK A;  4YTM A;  4C77 A;  5DBJ A;  1GPE A;  4CCR A;  4CRT A;  3UP4 A;  2Z5X A;  4B64 A;  2GMJ A;  3QSS A;  2WPE A;  2YVF A;  4B69 A;  2GQF A;  3SGL A;  3G5Q A;  3UCL A;  5KMR A;  3CTY A;  1FEA A;  1OJ9 A;  3NG7 X;  3CN8 A;  1XPQ A;  3T14 A;  1JRX A;  3GDN A;  4B66 A;  1GRH A;  1QJD A;  1S3B A;  2VVL G;  4PAA A;  1DNC A;  3CNJ A;  1GRB A;  3LAD A;  2EQ7 A;  4ECH A;  1ZX9 A;  3AE3 A;  1B8S A;  5ER0 A;  1KSS A;  3LZW A;  4EM4 A;  2CFY A;  1D7Y A;  2YG3 A;  3FMW A;  4RSL A;  1W4X A;  3PVC A;  3CPH G;  2JB3 A;  1EL9 A;  1CC2 A;  4USR A;  3UOZ A;  3EAO A;  2JB2 A;  1DAO A;  4NTE A;  1LQU A;  1DOD A;  1PXB A;  5EB4 A;  2A89 A;  2WHD A;  2OA1 A;  2WBA A;  5IQ4 A;  3G5R A;  2APG A;  2YWL A;  5KOX A;  5IPY A;  3P4P A;  2R0G A;  4AOS A;  1E1K A;  1BGJ A;  1C0L A;  4Z43 A;  1REO A;  3QFB A;  4U2S A;  3DK4 A;  3NKS A;  4U8K A;  1FOH A;  2QA1 A;  2YLT A;  3UTH A;  4GAP A;  1PJ6 A;  2B7R A;  3JSK A;  3KVE A;  3NRN A;  2B7S A;  4H4S A;  1E1L A;  4J57 A;  1IUW A;  3V3O A;  1K0L A;  4CY6 A;  2IVE A;  2RAB A;  4FK1 A;  2C3C A;  4P9S A;  3T31 A;  4EQR A;  2VZ2 A;  4A65 A;  1CJC A;  3T0K A;  4EMJ A;  2E4G A;  4Z26 A;  5U25 A;  1ZY8 A;  3EPT A;  3GD4 A;  3ZYX A;  4C3X A;  1KNR A;  3F8D A;  1ZMC A;  1FEC A;  1RP0 A;  3II4 A;  4RG3 A;  5U63 A;  3ADA B;  1S2Y A;  4APN A;  1ZK7 A;  4U8J A;  5JCN A;  3SZC A;  5M10 A;  2A87 A;  4U2T A;  3AE7 A;  4NWZ A;  3LJP A;  3BI2 A;  5HYM A;  1TRB A;  4YTP A;  3V3N A;  3DJJ A;  2Z5Y A;  3GRT A;  1PS9 A;  3GRS A;  4J31 A;  4C74 A;  3AEB A;  1Q9I A;  3COX A;  4II3 A;  4B63 A;  1GER A;  3Q6J A;  4ZCD A;  4G73 A;  2YLW A;  4AP1 A;  4EMI A;  1COY A;  1JEH A;  4H4T A;  1H7W A;  3HYV A;  1S3E A;  5TR3 A;  5C3J A;  3SYI A;  1DOC A;  1VRQ B;  1DJN A;  3NN0 X;  3S61 A;  4J34 A;  2VVL A;  2PYX A;  1YQ3 A;  2A8X A;  5J7X A;  3F8R A;  4U8N A;  4GR1 A;  3KLJ A;  1YQ4 A;  3VQR A;  4YT0 A;  4UP3 A;  1K4Q A;  4LA1 A;  4CNJ A;  2YM2 A;  4FK1 C;  2GQW A;  1IUU A;  2J3N A;  3I3L A;  1K0J A;  4CY8 A;  1HYU A;  4C5O A;  5KVH A;  1GAL A;  2B9X A;  4BJZ A;  4J33 A;  4D03 A;  1GSN A;  2V60 A;  4OCG A;  2OAM A;  2VQ7 A;  2X99 A;  3UTG A;  3ZNO A;  3H4K A;  2WQY A;  2B9Y A;  5BVA A;  3ICS A;  3ZNN A;  2BAC A;  3V76 A;  1H81 A;  1H6V A;  3GMB A;  3ALJ A;  3BI5 A;  2CVJ A;  3GWF A;  1E6E A;  4IA6 A;  3IHG A;  3PO7 A;  2RGH A;  1NPX A;  3B6D A;  1KNP A;  3C4N A;  3AE4 A;  4J36 A;  4O5U A;  1KIF A;  4OVI A;  2XFU A;  1TDE A;  4IVO B;  2YG4 A;  1F8W A;  3VR8 A;  2YLS A;  2BXR A;  3RP8 A;  4EIQ A;  2X50 A;  2R9Z A;  3ITJ A;  3ICR A;  1FEB A;  4OPT A;  4EQX A;  2WEU A;  4XWR A;  4UDR A;  3BNM A;  5C2T A;  4TLZ A;  5KMQ A;  2FJE A;  1NHS A;  1DXL A;  3NK0 X;  5HY5 A; 
#chains in the Genus database with same CATH homology
 3AWI A;  3GYJ A;  2ZBW A;  1L9C A;  2F5Z A;  3GWD A;  1CL0 A;  2GR0 A;  2WS3 A;  5GSN A;  5KXJ A;  1GT8 A;  5IQ1 A;  1NHS A;  3UKF A;  1DOE A;  3T2Y A;  4ADW A;  4YTN A;  3UOY A;  5JCL A;  1VG9 A;  4K7Z A;  4U8O A;  4KPR A;  4ICY A;  3NGC X;  2GR3 A;  1NAA A;  4G9K A;  2XDO A;  3NHO X;  3UKQ A;  2WDR A;  4EQS A;  1SEZ A;  1PBF A;  2XVJ A;  4H4R A;  5FS8 A;  2H89 A;  2OLO A;  1JOA A;  1NEN A;  1XAN A;  2I0Z A;  2C7G A;  4GDP A;  2GAH B;  5FS6 A;  4II2 A;  4G74 A;  4ZCC A;  2TMD A;  1D5T A;  3IF9 A;  4A7A A;  4K5R A;  2YQU A;  4OPU A;  3WE0 A;  1YQZ A;  2X8C A;  4Y4L A;  2WU5 A;  3NNE A;  3AD7 B;  3UKK A;  1Y56 A;  3E1T A;  4K22 A;  1GOS A;  2GB0 A;  2X3N A;  5KRQ A;  4H4Z A;  1JRY A;  3NTA A;  3UKA A;  2YR4 A;  2V5Z A;  2YR5 A;  2BC1 A;  5U1O A;  5KWF A;  1ZOY A;  3SY4 A;  3M13 A;  1RYI A;  2BS4 A;  3VRB A;  3BHK A;  1EL5 A;  1L0V A;  4GAV A;  4A99 A;  2H88 A;  2ZZ0 A;  3CNT A;  1BWC A;  4I59 A;  3PS9 A;  1GRG A;  4J56 A;  2BC0 A;  2R0C A;  1B4V A;  5BRT A;  3AXB A;  2WDV A;  3LXD A;  3NK1 X;  3UKP A;  5KNL A;  1OJC A;  2C64 A;  3T2Z A;  3ISH A;  4DSG A;  1ZDL A;  1CF3 A;  2AQJ A;  3KU9 A;  4LII A;  1F3P A;  1PBD A;  2OLN A;  1Z6L A;  2XCG A;  3SX6 A;  3R9U A;  4TLX A;  2C67 A;  2JAE A;  4K2X A;  1PHH A;  1KFY A;  2C72 A;  3GSI A;  1IUX A;  2FJB A;  2BK5 A;  2XVI A;  2RGJ A;  3AEC A;  1KDG A;  3K7Q X;  2C65 A;  4TM1 A;  1PJ7 A;  3QSM A;  5CKU A;  5BUK A;  3CNS A;  4C3Y A;  1TDN A;  1ONF A;  1OJA A;  2ZZC A;  2YLZ A;  2C3D A;  2BK4 A;  2YLR A;  4J2W A;  3QVR A;  2VQB A;  2IVD A;  1Y56 B;  4AOX A;  5FS9 A;  2YG5 A;  4BJY A;  1CJ4 A;  1NHR A;  4K8D A;  4YKF A;  2GH5 A;  1EBD A;  3LZX A;  4NZH A;  3AE8 A;  3DK9 A;  3SFE A;  3GDP A;  5JCM A;  3URH A;  1NDA A;  3T2K A;  3CIR A;  4A79 A;  3DJE A;  1BKW A;  3DJD A;  1LTX R;  3P9U A;  1MOK A;  4X9N A;  3ABV A;  3NIX A;  4H4X A;  2WET A;  4G6H A;  4GRT A;  4FX9 A;  3F8P A;  2V3A A;  4GUV A;  3L8K A;  4BK1 A;  1EL8 A;  4D04 A;  4Z2U A;  3B3R A;  5HHF A;  2BA9 A;  1M64 A;  4H4U A;  4JQ9 A;  3HYW A;  4U8P A;  3QJ4 A;  3RHA A;  4A5L A;  3AE1 A;  2BK3 A;  3KPK A;  4RG4 A;  5J60 A;  2CDU A;  3ZDN A;  1OJT A;  4OPC A;  1ELI A;  3C96 A;  2C75 A;  2IID A;  4B68 A;  4U8M A;  2BYB A;  1IJH A;  2PHH A;  2UZZ A;  1ZKQ A;  2XLU A;  3Q9T A;  3AB1 A;  2AAQ A;  3DH9 A;  4Z2T A;  1NHQ A;  2AR8 A;  1AOG A;  3AYL A;  3SZ0 A;  3ICT A;  3AE9 A;  4CNK A;  3AEG A;  1LVL A;  1XDI A;  2Q6U A;  2XFP A;  4YSY A;  3GYI A;  5FS7 A;  3NK2 X;  2NPX A;  2R4J A;  3NYF A;  1OJD A;  1BGN A;  1IUT A;  2BS2 A;  2FJD A;  4NEV A;  4O5Q A;  4BK2 A;  4REK A;  1D4D A;  2QAE A;  4TM4 A;  1CHU A;  1NG3 A;  1H86 A;  2GR2 A;  3SQP A;  4A6N A;  4MJW A;  2XVH A;  3CPJ G;  3CGC A;  1GV4 A;  4E0V A;  2BRA A;  1DJQ A;  1H83 A;  3GMC A;  3IHM A;  3H8I A;  4YSX A;  2JB1 A;  1D4C A;  1CC4 A;  2GV8 A;  2JKC A;  3AEF A;  1RSG A;  3P1W A;  1XHC A;  2QCU A;  3KA7 A;  2JK6 A;  4USQ A;  4DSH A;  2R45 A;  2YG7 A;  3FBS A;  2Q0L A;  4AT0 A;  4EIP A;  1H84 A;  2WP6 A;  2BRY A;  2XYO A;  2V3B A;  1F8S A;  1GXF A;  4WCT A;  2EQ9 A;  1E1N A;  4UDQ A;  1JRZ A;  4AP3 A;  3CGE A;  2V61 A;  2XVF A;  1K0I A;  2DKI A;  4JY3 A;  1QO8 A;  3QVP A;  3NTD A;  1NHP A;  4JN9 A;  3SM8 A;  1Q1W A;  4NTD A;  4YSH A;  4DGK A;  2HQM A;  1GTH A;  3AE2 A;  1F6M A;  2WU2 A;  3DA1 A;  4Y4N A;  1EL7 A;  2GF3 A;  3FG2 P;  2GMH A;  3UKL A;  3GD3 A;  4XWZ A;  1PXA A;  3BHF A;  4U8I A;  3CMM A;  4B65 A;  2XLP A;  1LPF A;  1D7L A;  1GRT A;  3ATR A;  1H82 A;  1E1M A;  3HZL A;  3P4S A;  3KD9 A;  1O5W A;  2OAL A;  3KPF A;  4KX6 A;  2BCG G;  3L1R A;  1IUS A;  4Z44 A;  4A9W A;  5L46 A;  3CND A;  2ZZB A;  3NT6 A;  4ZN0 A;  1KF6 A;  1MO9 A;  2O9Z A;  3AEE A;  1TDF A;  5EBK A;  3VR9 A;  1B37 A;  3H8L A;  1GRE A;  4G6G A;  1VQW A;  1LV0 A;  2X8G A;  4A6N B;  2XVE A;  1LJ1 A;  2YVJ A;  3NN6 X;  3FPZ A;  1CC6 A;  3AD9 B;  3DGZ A;  3AED A;  2GVC A;  1CBO A;  5M0Z A;  2XLS A;  2XFQ A;  3SZW A;  5KOW A;  1GTE A;  4GF7 A;  5CQF A;  3UKH A;  1CJ3 A;  2E1M A;  3QFA A;  4OPL A;  4Y4M A;  5KVI A;  1PDH A;  3NYE A;  1GRF A;  4JDR A;  2WDQ A;  4IA5 A;  1IUV A;  1JNR A;  3K7M X;  3LOV A;  1UKV G;  2RGO A;  2FJA A;  4IV9 A;  3SZF A;  3EAN A;  4JNA A;  3CNP A;  1TDO A;  4EMW A;  3FIM B;  1N4U A;  3AYJ A;  3AD8 B;  2EQ6 A;  1ZP0 A;  4OPG A;  2CUL A;  2X8H A;  3KKJ A;  3D8X A;  4HB9 A;  1GEU A;  3DGH A;  5BUL A;  4XXG A;  4U8L A;  2BXS A;  4HA6 A;  2XFO A;  1E7P A;  1N4V A;  3UTF A;  3M12 A;  3SXI A;  3DK8 A;  2GRT A;  2WOV A;  4NEW A;  4H4P A;  4WX1 A;  3UP5 A;  4BK3 A;  4JY2 A;  3QSE A;  1X31 B;  5LV9 A;  3LB8 A;  4PAB A;  1B5Q A;  2R46 A;  3O0H A;  3IWA A;  4YWO A;  1F8R A;  1PJ5 A;  1O94 A;  4EQW A;  2WOW A;  4FDC B;  3T37 A;  1TYT A;  4H4Q A;  3NLC A;  5JCI A;  4YSZ A;  2GEW A;  4CCQ A;  3C4A A;  3ATQ A;  3AEA A;  3P4Q A;  2VRM A;  4TM3 A;  3DJG X;  3OC4 A;  4I58 A;  1PXC A;  2WPC A;  1BF3 A;  2ACZ A;  2WP9 A;  5KMS A;  1P2E A;  3BI4 A;  2E5V A;  3AE5 A;  1PN0 A;  3IC9 A;  3UOX A;  2YM1 A;  3S5W A;  3VRA A;  3M0O A;  5EOW A;  4H4W A;  2V6O A;  3SFD A;  4H50 A;  4GDE A;  4Z24 A;  1GES A;  1TDK A;  3BNU A;  4YXD A;  2YLX A;  3DME A;  2R0P A;  2B9W A;  2B76 A;  2WP5 A;  2YVG A;  1ZMD A;  4Z25 A;  4H2N A;  1O95 A;  2WPF A;  4H7U A;  5JCK A;  1GRA A;  3D1C A;  4X9M A;  4U2L A;  1YY5 A;  2EQ8 A;  2DKH A;  1GND A;  1YKJ A;  3UOV A;  1CJ2 A;  1E39 A;  1QLB A;  4BV6 A;  4H4V A;  4Z2R A;  3CGB A;  1VG0 A;  2C70 A;  4GCM A;  2VRL A;  3HYX A;  2XLR A;  3VRD B;  3RNM A;  4H2Q A;  1JU2 A;  1NG4 A;  2Q7V A;  2BS3 A;  2ARD A;  3AYI A;  2VOU A;  2TPR A;  4K5S A;  2VVM A;  4OPD A;  3EF6 A;  4JNQ A;  4OPI A;  2GR1 A;  3UTE A;  4LU6 A;  2BAB A;  1Q1R A;  2GAG B;  2Y6R A;  2YG6 A;  3I6D A;  5GRT A;  2R4E A;  1L9E A;  5EB5 A;  4TM0 A;  3K30 A;  3RP7 A;  2WES A;  3ALL A;  4M52 A;  2C73 A;  4N9X A;  3K7T A;  1H7X A;  1FL2 A;  1TYP A;  1MXT A;  1LQT A;  2YAU A;  1GET A;  1VDC A;  4AT2 A;  1DOB A;  1FCD A;  4B67 A;  4H2P A;  1PBB A;  2QA2 A;  5KMP A;  3ALM A;  4X4J A;  1S2Q A;  2YR6 A;  4UDP A;  3OZ2 A;  3CGD A;  4CBQ A;  2BCP A;  4DNA A;  4H4Y A;  3GYX A;  3RED A;  5FMH A;  1KSU A;  3CPI G;  2C4C A;  1JNZ A;  4B1B A;  2Y6Q A;  2NVK X;  2Q0K A;  1BZL A;  1M6I A;  4NTC A;  5HXI A;  4EM3 A;  1N4W A;  1ZOV A;  4H2R A;  2JBV A;  1L9D A;  1V59 A;  3NYC A;  4NNJ A;  4BUR A;  1N1P A;  2FBW A;  2WOI A;  3AE6 A;  2C76 A;  1Y0P A;  4YKG A;  1D4E A;  4YTP A;  2C66 A;  3G5S A;  3P4R A;  2W0H A;  3RP6 A;  2XFN A;  3NH3 X;  1PBC A;  1PBE A;  2XLT A;  4IVM B;  1NEK A;  4YTM A;  4C77 A;  5DBJ A;  1GPE A;  4CCR A;  4CRT A;  3UP4 A;  2Z5X A;  4B64 A;  2GMJ A;  2YVF A;  2WPE A;  3QSS A;  4B69 A;  2GQF A;  3G5Q A;  3SGL A;  3UCL A;  5KMR A;  3CTY A;  1FEA A;  1OJ9 A;  3NG7 X;  3CN8 A;  1XPQ A;  3T14 A;  1JRX A;  3GDN A;  4B66 A;  1GRH A;  1QJD A;  1S3B A;  2VVL G;  1DNC A;  3CNJ A;  3LAD A;  1GRB A;  4PAA A;  2EQ7 A;  4ECH A;  1ZX9 A;  3AE3 A;  1B8S A;  5ER0 A;  1KSS A;  3LZW A;  4EM4 A;  2CFY A;  1D7Y A;  2YG3 A;  3FMW A;  4RSL A;  1W4X A;  3CPH G;  3PVC A;  2JB3 A;  1CC2 A;  1EL9 A;  4USR A;  3UOZ A;  3EAO A;  2JB2 A;  4NTE A;  1LQU A;  1DOD A;  1PXB A;  5EB4 A;  2A89 A;  2WHD A;  2OA1 A;  2WBA A;  5IQ4 A;  3G5R A;  2APG A;  2YWL A;  5KOX A;  5IPY A;  3P4P A;  2R0G A;  4AOS A;  1E1K A;  1BGJ A;  4Z43 A;  1REO A;  3QFB A;  4U2S A;  3DK4 A;  3NKS A;  4U8K A;  1FOH A;  2QA1 A;  2YLT A;  3UTH A;  4GAP A;  1PJ6 A;  2B7R A;  3JSK A;  3KVE A;  3NRN A;  2B7S A;  4H4S A;  1E1L A;  4J57 A;  1IUW A;  3V3O A;  1K0L A;  4CY6 A;  2IVE A;  2RAB A;  4FK1 A;  2C3C A;  4P9S A;  3T31 A;  4EQR A;  2VZ2 A;  4A65 A;  1CJC A;  3T0K A;  4EMJ A;  2E4G A;  4Z26 A;  5U25 A;  1ZY8 A;  3EPT A;  3GD4 A;  3ZYX A;  4C3X A;  1KNR A;  3F8D A;  1ZMC A;  1FEC A;  1RP0 A;  3II4 A;  4RG3 A;  5U63 A;  3ADA B;  1S2Y A;  4APN A;  1ZK7 A;  4U8J A;  5JCN A;  3SZC A;  5M10 A;  2A87 A;  4U2T A;  3AE7 A;  4NWZ A;  3LJP A;  3BI2 A;  5HYM A;  1TRB A;  3V3N A;  3DJJ A;  2Z5Y A;  3GRT A;  1PS9 A;  3GRS A;  4J31 A;  4C74 A;  3AEB A;  1Q9I A;  3COX A;  4II3 A;  4B63 A;  1GER A;  3Q6J A;  4ZCD A;  4G73 A;  2YLW A;  4AP1 A;  4EMI A;  1COY A;  1JEH A;  4H4T A;  1H7W A;  3HYV A;  1S3E A;  5TR3 A;  5C3J A;  3SYI A;  1DOC A;  1DJN A;  1VRQ B;  3NN0 X;  3S61 A;  4J34 A;  2VVL A;  2PYX A;  1YQ3 A;  2A8X A;  5J7X A;  3F8R A;  4U8N A;  4GR1 A;  3KLJ A;  1YQ4 A;  3VQR A;  4YT0 A;  4UP3 A;  1K4Q A;  4LA1 A;  4CNJ A;  2YM2 A;  4FK1 C;  2GQW A;  1IUU A;  2J3N A;  3I3L A;  1K0J A;  4CY8 A;  1HYU A;  4C5O A;  5KVH A;  1GAL A;  2B9X A;  4BJZ A;  4J33 A;  4D03 A;  1GSN A;  2V60 A;  4OCG A;  2OAM A;  2VQ7 A;  2X99 A;  3UTG A;  3H4K A;  2WQY A;  2B9Y A;  5BVA A;  3ICS A;  2BAC A;  3V76 A;  1H81 A;  1H6V A;  3GMB A;  3ALJ A;  3BI5 A;  2CVJ A;  3GWF A;  1E6E A;  4IA6 A;  3IHG A;  3PO7 A;  2RGH A;  1NPX A;  3B6D A;  1KNP A;  3C4N A;  3AE4 A;  4J36 A;  4O5U A;  4OVI A;  2XFU A;  1TDE A;  4IVO B;  2YG4 A;  1F8W A;  3VR8 A;  2YLS A;  2BXR A;  3RP8 A;  4EIQ A;  2X50 A;  2R9Z A;  3ITJ A;  3ICR A;  1FEB A;  4OPT A;  4EQX A;  2WEU A;  4XWR A;  4UDR A;  3BNM A;  5C2T A;  4TLZ A;  5KMQ A;  2FJE A;  1P2H A;  1DXL A;  3NK0 X;  5HY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...