3GMCA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase with substrate bound
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
369
structure length
369
Chain Sequence
b'TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Structure of the PLP degradative enzyme 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti MAFF303099 and its mechanistic implications.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 118
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3gmcA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gmcA01
4KX6A 4GDPA 1BKWA 2R4JA 5CKUA 5KWFA 2YR4A 1B5QA 2A8XA 2C67A 2VQBA 3D1CA 2QCUA 1LTXR 1OJAA 1P2EA 1IUXA 3PVCA 4IA5A 3AE2A 4E0VA 4K22A 4C3XA 4H4SA 2XVJA 4H2QA 1GTHA 3FG2P 4JDRA 4A7AA 2YAUA 5M10A 2YG5A 2GMJA 4UP3A 5JCKA 3DMEA 1KDGA 2WESA 3GRSA 2GAHB 3KKJA 2BK4A 2TPRA 3KU9A 1CC6A 4TM3A 4OVIA 1KSUA 1N1PA 3NN0X 4A65A 2H88A 3GSIA 4J56A 1GALA 2B9XA 1L9EA 3GWDA 3CGEA 4AT2A 4OPIA 3O0HA 1DOEA 1FCDA 1GT8A 4USRA 5FMHA 4AT0A 2YLWA 3PS9A 4NZHA 1DXLA 3GD4A 1PDHA 4FDCB 2C3CA 4YKFA 1DOBA 3Q6JA 3UKAA 4H2PA 3P4SA 3AE1A 1KF6A 1O5WA 2JB3A 5FS6A 3M12A 3M0OA 4Z2RA 4J57A 2YWLA 4JNQA 3C4NA 1KSSA 1L0VA 1FL2A 3LOVA 3UOYA 4AOSA 2X99A 3QSEA 4BJYA 4OPLA 4A5LA 2WETA 1EL7A 2Z5XA 4B66A 4EIPA 2XCGA 3NH3X 3B3RA 5L46A 1S3BA 3CNSA 2JKCA 4U8PA 3LZXA 2V61A 4Z2TA 5ER0A 4TM1A 2IVDA 4CNKA 2JK6A 3KLJA 3UTHA 5LV9A 2GEWA 2YG4A 4BK2A 1B4VA 2C65A 1PJ7A 1IUTA 2Q7VA 3OZ2A 4ZCDA 4EM3A 4H4VA 4XWRA 4TM0A 1V59A 2EQ8A 1F8WA 1SEZA 1JEHA 2C7GA 1TYPA 2WPEA 2GB0A 5BULA 2BS2A 1GESA 1M6IA 3QSSA 2BYBA 3QVPA 4C5OA 2WBAA 5TR3A 1F8SA 1BGJA 2EQ6A 3CNDA 3KD9A 4K5SA 3UOZA 3V3NA 2B76A 4BURA 3AYJA 4TLZA 4EQXA 3H8LA 4JN9A 1MOKA 1EL5A 4OPDA 3DJJA 3IHGA 4JQ9A 3NHOX 4Y4LA 2J3NA 2JB2A 2B9WA 1CC2A 4P9SA 3NNEA 4I59A 1GRTA 3BNMA 1GSNA 3CIRA 2VQ7A 4ZCCA 5HHFA 5U1OA 4U2SA 2R45A 2GH5A 2XLSA 4K8DA 4CBQA 3AD8B 3P1WA 3RHAA 5KRQA 3LB8A 1GOSA 1GRBA 1TDOA 1TDKA 2E4GA 1K0IA 3CPIG 4H50A 4XWZA 2GV8A 2R9ZA 3WE0A 2WHDA 2C73A 2OLNA 1CJ4A 1H84A 1BGNA 3FIMB 4H4TA 3F8DA 4U8MA 3GD3A 1VDCA 2VVMA 4A9WA 2WS3A 2X8CA 4ECHA 1YQ3A 3VQRA 1PJ5A 5CQFA 1CJCA 2A87A 1GREA 3QJ4A 1EL8A 2WP5A 2YLZA 2YVJA 1KNPA 1NENA 4H4PA 3AYIA 3RP6A 1BF3A 2PHHA 2Y6RA 1K0LA 3QFBA 3IF9A 1GRFA 1ONFA 3LXDA 2C3DA 2NVKX 4UDPA 5JCMA 1H7XA 2ZBWA 1E1MA 3SQPA 2GVCA 3V3OA 3GMCA 4EMIA 4FX9A 4IVMB 4A99A 3ALJA 5BUKA 1D4CA 3DK9A 3G5RA 3T37A 4Y4NA 4OPGA 2BA9A 1LVLA 3VRBA 4GF7A 1PBCA 4J2WA 4Z26A 2YG7A 4H7UA 2BXRA 2YLXA 3G5SA 1ZY8A 2OAMA 4Z2UA 3M13A 2ZZCA 2BACA 4EIQA 2GRTA 2Z5YA 3K7MX 1ZMDA 4AP1A 3LZWA 4YTMA 5EOWA 3QVRA 4IVOB 1JNZA 5GSNA 2XLRA 2X50A 4NEWA 3AE5A 1HYUA 1L9CA 4H4YA 3UKHA 2RABA 1IUUA 3BNUA 4DSHA 1TYTA 4C77A 4B69A 5FS8A 4Z43A 2GR1A 1FOHA 2WEUA 4JNAA 3NN6X 2UZZA 4H4RA 3R9UA 3UTFA 1LQTA 1CJ2A 1RSGA 1FEBA 3NIXA 3NK2X 4OPUA 5KXJA 3ICRA 3COXA 4Z44A 1MXTA 2R0CA 3ALLA 1H82A 4LU6A 4DGKA 4YSYA 2GR0A 3LJPA 3S5WA 1PN0A 3ZYXA 3VR8A 4H4WA 2C72A 5HXIA 1GEUA 1ZKQA 3NK1X 2V3BA 4MJWA 2XLTA 2V3AA 3GDPA 1D5TA 2A89A 4GRTA 4YSZA 1PS9A 2ACZA 1FEAA 4O5UA 4HA6A 3VRAA 4M52A 4K7ZA 1QJDA 1PBBA 2C76A 4REKA 4RG3A 1GRHA 3I6DA 2BCGG 3GDNA 1GERA 1VG9A 1VRQB 2BC0A 4ZN0A 1N4WA 1YY5A 4U8OA 4YSHA 2YQUA 2IIDA 3BHKA 2XLPA 2BC1A 2YVFA 3E1TA 4EQWA 2XFQA 2GAGB 4EMJA 3SM8A 2TMDA 1VQWA 1D4EA 2BK5A 3UP4A 4BJZA 3NYFA 1O95A 4KPRA 3AE6A 2C64A 2WU2A 4B68A 3ZDNA 4U8KA 3AEEA 1PJ6A 1ZK7A 3CNJA 1OJTA 2QAEA 2YR5A 4WX1A 5C3JA 2VVLG 4Y4MA 3UKPA 1PBEA 3IWAA 1DOCA 3L8KA 3AEAA 2VRMA 3DH9A 2GR2A 1ZOVA 3LADA 1YKJA 3DGHA 3NLCA 4XXGA 1NPXA 2XLUA 2DKIA 2AQJA 5IQ1A 3ALMA 5JCLA 4B67A 2WPCA 3K30A 4X9NA 4ICYA 1EBDA 5M0ZA 1E1LA 3H4KA 1LV0A 3S61A 4B64A 1GTEA 2JB1A 2OALA 3GRTA 3UP5A 4YT0A 2GF3A 1CC4A 4DNAA 4Z25A 1PXBA 1OJCA 2WP6A 2V60A 3GWFA 1CJ3A 2R4EA 2R0PA 1DNCA 5KVIA 4K5RA 1E6EA 3GYJA 3K7QX 2BXSA 1CBOA 2B7RA 2ZZ0A 4EQSA 4K2XA 2O9ZA 5U25A 4OPTA 2YR6A 3RP8A 5HY5A 2XVHA 1E1NA 4TM4A 4AP3A 2R46A 1E7PA 3UKKA 1IUVA 4D03A 3NRNA 3AE4A 4H2RA 1TDEA 2PYXA 3AEDA 3AXBA 1Q9IA 4GUVA 2W0HA 3AYLA 2FJAA 2QA2A 2HQMA 4RSLA 2BS4A 4NTEA 1N4UA 4YWOA 3EPTA 2Q0LA 1ZP0A 1N4VA 1ELIA 1QLBA 1GETA 1ZMCA 3ITJA 1E39A 1PBFA 1NHSA 1JRXA 5JCNA 2XFPA 2FJBA 3NTAA 3FPZA 1ZX9A 4NTDA 3URHA 5JCIA 2RGJA 2VOUA 2YLRA 3F8PA 3ATQA 1JNRA 2GQFA 4DSGA 2WDRA 3SGLA 1TDFA 4OCGA 5KOWA 2GQWA 4GCMA 3C96A 1L9DA 2BCPA 2XFOA 1S2QA 3AEGA 1MO9A 1QO8A 1P2HA 4CCQA 2XVEA 2V5ZA 3OC4A 5KOXA 4BK1A 4CY8A 4EM4A 3QSMA 1GPEA 2NPXA 4UDQA 1IUSA 2OLOA 4JY2A 1IJHA 4RG4A 3AE8A 1JRZA 3GMBA 4CY6A 2WDQA 3NKSA 1AOGA 4LIIA 3NT6A 3JSKA 3ISHA 2CFYA 1BWCA 1JU2A 5EB4A 1RP0A 1H81A 3AE9A 3KA7A 1LPFA 3ADAB 1PXCA 1X31B 1Q1WA 3AB1A 3K7TA 4U8IA 5FS9A 1REOA 2YLTA 3REDA 1W4XA 2WDVA 4USQA 3RP7A 4PAAA 1GRGA 2GMHA 1S3EA 2E5VA 4LA1A 4X4JA 1NAAA 3IHMA 1NEKA 4U2LA 2YM2A 1NHQA 5U63A 2VVLA 2H89A 1CL0A 2C66A 1E1KA 3FBSA 4N9XA 1F6MA 3NG7X 3UTEA 3G5QA 4JY3A 1PHHA 3DJEA 1D7LA 2WOVA 1H83A 3F8RA 3AEBA 3ATRA 3BI2A 3RNMA 1XHCA 4FK1C 3CN8A 3VRDB 2BK3A 1NHRA 1XPQA 5KVHA 1CHUA 4WCTA 2VZ2A 3EF6A 3NK0X 2EQ7A 3CGDA 5J60A 4U8NA 3UTGA 3AECA 3SFDA 3NYCA 2C75A 1FECA 2XVFA 2YG3A 2CDUA 1NG4A 1H7WA 4APNA 1S2YA 4IV9A 1DJNA 3P9UA 1DJQA 4NEVA 4PABA 3DJGX 4BV6A 4H4QA 3DA1A 1JRYA 3CPHG 2WP9A 2F5ZA 4CNJA 4C74A 2JBVA 2WOWA 2XDOA 5DBJA 2C70A 3EANA 3P4QA 1TDNA 4H4UA 2EQ9A 4NTCA 2WPFA 1NDAA 4ADWA 3NTDA 1UKVG 5J7XA 3CTYA 1H86A 4J33A 2I0ZA 1XANA 3CGBA 4IA6A 4OPCA 3Q9TA 1JOAA 1F8RA 2CVJA 1EL9A 1VG0A 2E1MA 3IC9A 3UKFA 3AE7A 2Y6QA 1NHPA 3DGZA 5C2TA 3I3LA 4U2TA 2VRLA 1GRAA 3V76A 3HZLA 2RGOA 2X3NA 3GYIA 3CNPA 3VR9A 5IPYA 1K0JA 1Y0PA 2YVGA 4YTNA 2OA1A 3UKLA 1K4QA 4I58A 4O5QA 1O94A 1YQZA 3UOXA 4YSXA 1KNRA 4H2NA 2AAQA 3AEFA 3DK4A 1F3PA 1D7YA 4HB9A 3ICTA 1CF3A 1LJ1A 1M64A 2QA1A 4B63A 2JAEA 2FJEA 5HYMA 3SFEA 3H8IA 2XVIA 2WOIA 4B65A 5IQ4A 1Y56B 1NG3A 1LQUA 2BS3A 2Q0KA 3UOVA 2X8GA 2FBWA 3AWIA 4U8LA 4UDRA 2WU5A 2YLSA 2BABA 2R0GA 1GV4A 1OJ9A 2Q6UA 4Z24A 2GR3A 4CRTA 3NGCX 1ZOYA 3CGCA 3CNTA 3NYEA 2ARDA 2WQYA 2XFUA 4H4ZA 3CPJG 2IVEA 5EBKA 4C3YA 1KFYA 4YKGA 5FS7A 1Y56A 3BHFA 4YTPA 4BK3A 5GRTA 1B8SA 4FK1A 1IUWA 3KPFA 2APGA 2B7SA 1XDIA 2FJDA 4J36A 3KVEA 3FMWA 2V6OA 4D04A 3UKQA 3QFAA 1PXAA 3C4AA 1D4DA 2X8HA 2YM1A 1GNDA 3B6DA 4A6NB 1COYA 3AD9B 2XFNA 1B37A 3EAOA 4GDEA 3P4RA 3PO7A 4A79A 1PBDA 1RYIA 5BVAA 5BRTA 1ZDLA 2XYOA 4X9MA 3UCLA 3BI5A 4TLXA 4EQRA 1TRBA 1GXFA 4AOXA 4B1BA 3D8XA 5EB5A 1Q1RA 3DK8A 2B9YA 4A6NA 4J31A 2YG6A 3ICSA 3P4PA 3AD7B 1H6VA 4CCRA 2RGHA 3II4A 1Z6LA 3BI4A 1BZLA 1YQ4A 2ZZBA 3ABVA 1DODA 4EMWA 3DJDA 1OJDA 2DKHA 4U8JA 3AE3A 2CULA 2AR8A 3L1RA 4GR1A 4YXDA 4H4XA 4J34A
chains in the Genus database with same CATH superfamily
4KX6A 3W4KA 4GDPA 1BKWA 2R4JA 5CKUA 1EVIA 5KWFA 2YR4A 1B5QA 2A8XA 2C67A 2VQBA 3ZNQA 3D1CA 2QCUA 1LTXR 1DDOA 1OJAA 1P2EA 1IUXA 3PVCA 4IA5A 3AE2A 4E0VA 4K22A 4C3XA 4H4SA 2XVJA 4H2QA 1GTHA 3FG2P 4JDRA 4A7AA 2YAUA 5M10A 2YG5A 2GMJA 4UP3A 5JCKA 3DMEA 1KDGA 2WESA 3CMMA 2GAHB 3GRSA 3KKJA 2BK4A 2TPRA 3KU9A 1CC6A 3ZNOA 4TM3A 4OVIA 1KSUA 1N1PA 3NN0X 4A65A 3GSIA 2H88A 4J56A 1GALA 2B9XA 1L9EA 3GWDA 3CGEA 4AT2A 4OPIA 3O0HA 1DOEA 1FCDA 1GT8A 4USRA 5FMHA 4AT0A 3PS9A 2YLWA 4NZHA 1DXLA 3GD4A 1PDHA 4FDCB 2C3CA 4YKFA 1DOBA 3Q6JA 3UKAA 4H2PA 3P4SA 4YJDA 3AE1A 1KF6A 1O5WA 2JB3A 5FS6A 3M12A 3M0OA 4Z2RA 4J57A 2YWLA 4JNQA 3C4NA 1KSSA 1L0VA 1FL2A 3LOVA 3UOYA 4AOSA 4BJYA 3QSEA 2X99A 1C0KA 4OPLA 4A5LA 2WETA 1EL7A 2Z5XA 4B66A 4EIPA 3HYVA 2XCGA 5L46A 2BRAA 3B3RA 3NH3X 1S3BA 3CNSA 4G6GA 2JKCA 2DU8A 4U8PA 3LZXA 2V61A 4Z2TA 5ER0A 4TM1A 2IVDA 3G3EA 3ZNPA 4CNKA 2JK6A 3KLJA 3UTHA 5LV9A 2GEWA 2YG4A 4BK2A 1B4VA 2C65A 1PJ7A 1IUTA 3OZ2A 2Q7VA 4ZCDA 4EM3A 3T2YA 4H4VA 4XWRA 4TM0A 1V59A 2EQ8A 1F8WA 1SEZA 1JEHA 2C7GA 1TYPA 2WPEA 2GB0A 5BULA 2BS2A 1GESA 1M6IA 3QSSA 2BYBA 3QVPA 4C5OA 2WBAA 5TR3A 1F8SA 1BGJA 2EQ6A 3CNDA 3KD9A 4K5SA 3UOZA 3V3NA 2B76A 4BURA 3AYJA 4TLZA 4EQXA 3H8LA 4JN9A 5KMPA 1MOKA 1EL5A 4OPDA 3DJJA 3IHGA 4JQ9A 3NHOX 4Y4LA 2J3NA 2JB2A 4P9SA 1CC2A 2B9WA 3NNEA 4I59A 1GRTA 3BNMA 1GSNA 3CIRA 2VQ7A 4ZCCA 5HHFA 5U1OA 4U2SA 2R45A 2E49A 2GH5A 2XLSA 4G6HA 4K8DA 3AD8B 3P1WA 3RHAA 4CBQA 5KRQA 3LB8A 1GOSA 1GRBA 1TDOA 1TDKA 2E4GA 1K0IA 4XWZA 3CPIG 4H50A 2GV8A 2R9ZA 3WE0A 2WHDA 2C73A 2OLNA 1CJ4A 1H84A 1BGNA 3FIMB 4H4TA 3F8DA 4U8MA 3GD3A 1VDCA 2VVMA 4A9WA 2WS3A 2X8CA 4ECHA 3VQRA 1YQ3A 1PJ5A 5CQFA 1CJCA 1GREA 2A87A 3QJ4A 1EL8A 2WP5A 2YLZA 2YVJA 2E82A 1KNPA 1NENA 4H4PA 3AYIA 3RP6A 1BF3A 2PHHA 2Y6RA 1K0LA 3QFBA 3SZCA 3IF9A 1GRFA 1ONFA 3LXDA 2C3DA 2NVKX 4UDPA 5JCMA 1H7XA 2ZBWA 1E1MA 3SQPA 2GVCA 3V3OA 3GMCA 4EMIA 4FX9A 4IVMB 4A99A 3ALJA 5BUKA 1D4CA 4YJHB 3DK9A 3G5RA 3T37A 4Y4NA 4OPGA 2BA9A 1LVLA 3VRBA 4GF7A 1PBCA 4J2WA 4Z26A 2YG7A 4H7UA 2BXRA 2YLXA 3G5SA 1ZY8A 2OAMA 4Z2UA 3M13A 4YJHA 2ZZCA 2BACA 2BRYA 4EIQA 2GRTA 2Z5YA 3K7MX 4QFDA 1ZMDA 3SXIA 3LZWA 4YTMA 4AP1A 5EOWA 3QVRA 4IVOB 1JNZA 5GSNA 2XLRA 2X50A 4NEWA 3AE5A 1HYUA 1L9CA 4H4YA 3UKHA 2RABA 1IUUA 3BNUA 4DSHA 1TYTA 4C77A 4B69A 5FS8A 4Z43A 2GR1A 1FOHA 2WEUA 4JNAA 3NN6X 2UZZA 4H4RA 3R9UA 3UTFA 1LQTA 4NNJA 1CJ2A 1RSGA 1FEBA 3NIXA 3NK2X 4OPUA 5KMRA 5KXJA 3ICRA 3T31A 3COXA 4Z44A 4G9KA 1MXTA 3SY4A 2R0CA 3ALLA 1H82A 4LU6A 4DGKA 4YSYA 2GR0A 3LJPA 3S5WA 1PN0A 3ZYXA 3VR8A 4H4WA 2C72A 5HXIA 1GEUA 1ZKQA 3NK1X 2V3BA 3GYXA 2XLTA 2V3AA 3GDPA 1D5TA 4MJWA 2A89A 4GRTA 4YSZA 1PS9A 2ACZA 1FEAA 4O5UA 4HA6A 3VRAA 4M52A 4K7ZA 1QJDA 1PBBA 2C76A 4REKA 4RG3A 1GRHA 3WGTA 3I6DA 2BCGG 3GDNA 1GERA 1VG9A 1VRQB 2BC0A 4ZN0A 4YSHA 1N4WA 1YY5A 4U8OA 2YQUA 2IIDA 3BHKA 2XLPA 3E1TA 2BC1A 2YVFA 4EQWA 2XFQA 2GAGB 4EMJA 3SM8A 2TMDA 1VQWA 1D4EA 2BK5A 4BJZA 3UP4A 3NYFA 1O95A 4KPRA 3AE6A 4II2A 2C64A 2WU2A 4B68A 3ZDNA 4U8KA 3AEEA 1PJ6A 1ZK7A 3CNJA 1OJTA 2QAEA 2YR5A 4WX1A 5C3JA 2VVLG 4Y4MA 3UKPA 1PBEA 3IWAA 1DOCA 3L8KA 3AEAA 2VRMA 3DH9A 2GR2A 1ZOVA 3LADA 1YKJA 3DGHA 3NLCA 4XXGA 1NPXA 2XLUA 2DKIA 2AQJA 5IQ1A 3ALMA 5JCLA 4B67A 4X9NA 1C0LA 2WPCA 3K30A 4ICYA 1EBDA 5M0ZA 1E1LA 3H4KA 1LV0A 3S61A 4B64A 1GTEA 2JB1A 2OALA 3GRTA 4NWZA 3UP5A 2GF3A 4YT0A 1CC4A 4DNAA 4H4XA 1PXBA 4Z25A 1OJCA 2WP6A 2V60A 3GWFA 1CJ3A 4QFCA 2R4EA 2R0PA 1DNCA 5KVIA 4K5RA 1E6EA 3GYJA 3K7QX 2BXSA 1CBOA 2B7RA 2ZZ0A 4G74A 4K2XA 2O9ZA 5U25A 4EQSA 3RP8A 2YR6A 4OPTA 5HY5A 2XVHA 1E1NA 4TM4A 4AP3A 2R46A 1E7PA 3UKKA 1IUVA 4D03A 3NRNA 3AE4A 4H2RA 1TDEA 2PYXA 3AEDA 3AXBA 1Q9IA 4GUVA 2W0HA 3AYLA 2FJAA 2QA2A 2HQMA 4RSLA 2BS4A 4NTEA 1N4UA 4YWOA 3T2KA 3EPTA 2Q0LA 1ZP0A 1N4VA 1ELIA 1QLBA 1GETA 1ZMCA 3ITJA 1PBFA 1E39A 1NHSA 1JRXA 5JCNA 2XFPA 2FJBA 3NTAA 3FPZA 1ZX9A 4NTDA 3URHA 5JCIA 2RGJA 5KMSA 2VOUA 2YLRA 3F8PA 3ATQA 1JNRA 2GQFA 4DSGA 2WDRA 3SGLA 1TDFA 4OCGA 5KOWA 2GQWA 4GCMA 3C96A 1L9DA 2BCPA 2XFOA 1S2QA 3AEGA 1MO9A 1QO8A 1P2HA 4CCQA 2XVEA 2V5ZA 3OC4A 5KOXA 4BK1A 4CY8A 1VE9A 4EM4A 3QSMA 1GPEA 2NPXA 4UDQA 1IUSA 2OLOA 3CUKA 4JY2A 1IJHA 4RG4A 1AN9A 3AE8A 1JRZA 3ZNNA 3GMBA 4CY6A 3SX6A 2WDQA 3NKSA 1AOGA 4LIIA 3NT6A 3JSKA 3ISHA 2CFYA 1BWCA 1JU2A 5EB4A 1RP0A 1H81A 3AE9A 3KA7A 1LPFA 3ADAB 1PXCA 2E48A 1X31B 1Q1WA 3AB1A 3K7TA 4U8IA 5FS9A 3T0KA 1REOA 2YLTA 3REDA 1W4XA 2WDVA 4USQA 3RP7A 4PAAA 1GRGA 2GMHA 1S3EA 2E5VA 4LA1A 4X4JA 1NAAA 3IHMA 1NEKA 3KPKA 4U2LA 2YM2A 1NHQA 5U63A 2VVLA 2H89A 4YJGB 1CL0A 1E1KA 2C66A 3FBSA 4GAVA 4N9XA 1F6MA 3NG7X 3UTEA 3G5QA 4JY3A 1PHHA 3DJEA 1D7LA 2WOVA 1H83A 1DAOA 3F8RA 3AEBA 3ATRA 3BI2A 3RNMA 1XHCA 4FK1C 3SZFA 3CN8A 3VRDB 2BK3A 1NHRA 4II3A 1XPQA 5KVHA 1CHUA 4WCTA 4YJGA 2VZ2A 3EF6A 3NK0X 2EQ7A 3CGDA 5J60A 4U8NA 3UTGA 3W4IA 3AECA 3NYCA 2C75A 3SFDA 1FECA 2XVFA 2YG3A 5KMQA 2CDUA 1NG4A 1H7WA 3HYXA 4APNA 1S2YA 4IV9A 1DJNA 3P9UA 4GAPA 4PABA 1DJQA 3HYWA 3DJGX 4NEVA 4BV6A 4H4QA 3DA1A 1JRYA 3CPHG 2WP9A 2F5ZA 1KIFA 4CNJA 4C74A 2JBVA 2WOWA 2XDOA 5DBJA 2C70A 3T14A 3W4JA 3EANA 3P4QA 1TDNA 4H4UA 2EQ9A 4NTCA 2WPFA 1NDAA 4ADWA 3NTDA 1UKVG 5J7XA 3CTYA 1H86A 4J33A 2I0ZA 1XANA 3CGBA 4IA6A 4OPCA 3Q9TA 1JOAA 1F8RA 2CVJA 1EL9A 1VG0A 2E1MA 3IC9A 3UKFA 3AE7A 2Y6QA 1NHPA 3DGZA 5C2TA 3I3LA 4U2TA 2VRLA 1GRAA 3SZ0A 3SYIA 3V76A 3HZLA 4G73A 2RGOA 2X3NA 2C4CA 3CNPA 3GYIA 3VR9A 5IPYA 1K0JA 1Y0PA 2YVGA 4YTNA 2OA1A 3UKLA 1K4QA 4I58A 4O5QA 1O94A 1YQZA 3UOXA 4YSXA 1KNRA 4H2NA 2AAQA 3AEFA 3DK4A 1F3PA 1D7YA 4HB9A 3ICTA 1CF3A 1LJ1A 1M64A 2QA1A 4B63A 2JAEA 2FJEA 5HYMA 3SFEA 3H8IA 2XVIA 2WOIA 4B65A 5IQ4A 1Y56B 1NG3A 1LQUA 2BS3A 2Q0KA 3UOVA 2X8GA 2FBWA 2E4AA 3AWIA 4U8LA 2WU5A 2YLSA 4UDRA 2BABA 2R0GA 2Q6UA 1GV4A 1OJ9A 4Z24A 2GR3A 4CRTA 3NGCX 1ZOYA 3CGCA 3NYEA 3CNTA 2ARDA 2WQYA 2XFUA 4H4ZA 3CPJG 2IVEA 5EBKA 4C3YA 1KFYA 4YKGA 5FS7A 1Y56A 3BHFA 4YTPA 4BK3A 5GRTA 1B8SA 4FK1A 1IUWA 3KPFA 2APGA 2B7SA 1XDIA 2FJDA 4J36A 3KVEA 3FMWA 2V6OA 4D04A 3UKQA 3QFAA 1PXAA 3C4AA 1D4DA 2X8HA 2YM1A 1GNDA 3B6DA 4A6NB 3AD9B 1COYA 2XFNA 1B37A 3EAOA 4GDEA 3P4RA 3PO7A 4A79A 1C0IA 1PBDA 1RYIA 5BVAA 5BRTA 1ZDLA 4X9MA 2XYOA 3UCLA 3BI5A 3SZWA 4TLXA 4EQRA 1TRBA 1GXFA 4AOXA 4B1BA 3D8XA 5EB5A 1Q1RA 3DK8A 2B9YA 4A6NA 4J31A 2YG6A 3ICSA 3P4PA 3AD7B 4YJFB 5KNLA 1H6VA 4CCRA 2RGHA 3II4A 1Z6LA 3BI4A 1BZLA 1YQ4A 2ZZBA 3ABVA 1DODA 1C0PA 4EMWA 3DJDA 1OJDA 2DKHA 4U8JA 3AE3A 2CULA 2AR8A 3L1RA 4GR1A 4YXDA 3T2ZA 4YJFA 4J34A
chains in the Genus database with same CATH topology
4KX6A 4GDPA 1BKWA 2R4JA 5CKUA 5KWFA 2YR4A 1B5QA 2A8XA 2C67A 2VQBA 3D1CA 2QCUA 1LTXR 1OJAA 1P2EA 4IA5A 1IUXA 3PVCA 3AE2A 4E0VA 4K22A 4C3XA 4H4SA 2XVJA 4H2QA 1GTHA 3FG2P 4JDRA 4A7AA 2YAUA 5M10A 2YG5A 2GMJA 4UP3A 5JCKA 3DMEA 1KDGA 2WESA 3CMMA 2GAHB 3GRSA 3KKJA 2BK4A 2TPRA 3KU9A 1CC6A 4TM3A 4OVIA 1KSUA 1N1PA 3NN0X 4A65A 2H88A 3GSIA 4J56A 1GALA 2B9XA 1L9EA 3GWDA 3CGEA 4AT2A 4OPIA 3O0HA 1DOEA 1FCDA 1GT8A 4USRA 5FMHA 4AT0A 2YLWA 3PS9A 4NZHA 1DXLA 3GD4A 1PDHA 4FDCB 2C3CA 4YKFA 1DOBA 3Q6JA 3UKAA 4H2PA 3P4SA 3AE1A 1KF6A 1O5WA 2JB3A 5FS6A 3M12A 3M0OA 4Z2RA 4J57A 2YWLA 4JNQA 3C4NA 1KSSA 1L0VA 1FL2A 3LOVA 3UOYA 4AOSA 4BJYA 2X99A 3QSEA 4OPLA 4A5LA 2WETA 1EL7A 2Z5XA 4B66A 4EIPA 3HYVA 2XCGA 2BRAA 3B3RA 3NH3X 5L46A 1S3BA 3CNSA 4G6GA 2JKCA 4U8PA 3LZXA 2V61A 4Z2TA 5ER0A 4TM1A 2IVDA 4CNKA 2JK6A 3KLJA 3UTHA 5LV9A 2GEWA 2YG4A 4BK2A 1B4VA 2C65A 1PJ7A 1IUTA 2Q7VA 3OZ2A 4ZCDA 4EM3A 3T2YA 4H4VA 4XWRA 4TM0A 1V59A 2EQ8A 1F8WA 1SEZA 1JEHA 2C7GA 1TYPA 2WPEA 2GB0A 5BULA 2BS2A 1GESA 1M6IA 3QSSA 2BYBA 3QVPA 4C5OA 2WBAA 5TR3A 1F8SA 1BGJA 2EQ6A 3CNDA 3KD9A 4K5SA 3UOZA 3V3NA 2B76A 4BURA 3AYJA 4TLZA 4EQXA 3H8LA 4JN9A 5KMPA 1MOKA 1EL5A 4OPDA 3DJJA 3IHGA 4JQ9A 3NHOX 4Y4LA 2J3NA 2JB2A 2B9WA 1CC2A 4P9SA 3NNEA 4I59A 1GRTA 3BNMA 1GSNA 3CIRA 2VQ7A 4ZCCA 5HHFA 5U1OA 4U2SA 2R45A 2GH5A 2XLSA 4G6HA 4K8DA 3AD8B 3P1WA 3RHAA 4CBQA 5KRQA 3LB8A 1GOSA 1GRBA 1TDOA 1TDKA 2E4GA 1K0IA 3CPIG 4H50A 4XWZA 2GV8A 2R9ZA 3WE0A 2WHDA 2C73A 2OLNA 1CJ4A 1H84A 1BGNA 3FIMB 4H4TA 3F8DA 4U8MA 3GD3A 1VDCA 2VVMA 4A9WA 2WS3A 2X8CA 4ECHA 1YQ3A 3VQRA 1PJ5A 5CQFA 1CJCA 2A87A 1GREA 3QJ4A 1EL8A 2WP5A 2YLZA 2YVJA 1KNPA 1NENA 4H4PA 3AYIA 3RP6A 1BF3A 2PHHA 2Y6RA 1K0LA 3QFBA 3SZCA 3IF9A 1GRFA 1ONFA 3LXDA 2C3DA 2NVKX 4UDPA 5JCMA 1H7XA 2ZBWA 1E1MA 3SQPA 2GVCA 3V3OA 3GMCA 4EMIA 4FX9A 4IVMB 4A99A 3ALJA 5BUKA 1D4CA 3DK9A 3G5RA 3T37A 4Y4NA 4OPGA 2BA9A 1LVLA 3VRBA 4GF7A 1PBCA 4J2WA 4Z26A 2YG7A 4H7UA 2BXRA 2YLXA 3G5SA 1ZY8A 2OAMA 4Z2UA 3M13A 2ZZCA 2BACA 2BRYA 4EIQA 2GRTA 2Z5YA 3K7MX 1ZMDA 3SXIA 3LZWA 4YTMA 4AP1A 5EOWA 3QVRA 4IVOB 1JNZA 5GSNA 2XLRA 2X50A 4NEWA 3AE5A 1HYUA 1L9CA 4H4YA 3UKHA 2RABA 1IUUA 3BNUA 4DSHA 1TYTA 4C77A 4B69A 5FS8A 4Z43A 2GR1A 1FOHA 2WEUA 4JNAA 3NN6X 2UZZA 4H4RA 3R9UA 3UTFA 1LQTA 4NNJA 1CJ2A 1RSGA 1FEBA 3NIXA 3NK2X 4OPUA 5KMRA 5KXJA 3ICRA 3T31A 3COXA 4Z44A 4G9KA 1MXTA 3SY4A 2R0CA 3ALLA 1H82A 4LU6A 4DGKA 4YSYA 2GR0A 3LJPA 3S5WA 1PN0A 3ZYXA 3VR8A 4H4WA 2C72A 5HXIA 1GEUA 1ZKQA 3NK1X 2V3BA 3GYXA 2XLTA 2V3AA 3GDPA 1D5TA 4MJWA 2A89A 4GRTA 4YSZA 1PS9A 2ACZA 1FEAA 4O5UA 4HA6A 3VRAA 4M52A 4K7ZA 1QJDA 1PBBA 2C76A 4REKA 4RG3A 1GRHA 3I6DA 2BCGG 3GDNA 1GERA 1VG9A 1VRQB 2BC0A 4ZN0A 1N4WA 1YY5A 4U8OA 4YSHA 2YQUA 2IIDA 3BHKA 2XLPA 3E1TA 2BC1A 2YVFA 4EQWA 2XFQA 2GAGB 4EMJA 3SM8A 2TMDA 1VQWA 1D4EA 2BK5A 4BJZA 3UP4A 3NYFA 1O95A 4KPRA 3AE6A 4II2A 2C64A 2WU2A 4B68A 3ZDNA 4U8KA 3AEEA 1PJ6A 1ZK7A 3CNJA 1OJTA 2QAEA 2YR5A 4WX1A 5C3JA 2VVLG 4Y4MA 3UKPA 1PBEA 3IWAA 1DOCA 3L8KA 3AEAA 2VRMA 3DH9A 2GR2A 1ZOVA 3LADA 1YKJA 3DGHA 3NLCA 4XXGA 1NPXA 2XLUA 2DKIA 2AQJA 5IQ1A 3ALMA 5JCLA 4B67A 2WPCA 3K30A 4X9NA 4ICYA 1EBDA 5M0ZA 1E1LA 3H4KA 1LV0A 3S61A 4B64A 1GTEA 2JB1A 2OALA 3GRTA 4NWZA 3UP5A 2GF3A 4YT0A 1CC4A 4DNAA 4Z25A 1PXBA 1OJCA 2WP6A 2V60A 3GWFA 1CJ3A 2R4EA 2R0PA 1DNCA 5KVIA 4K5RA 1E6EA 3GYJA 3K7QX 2BXSA 1CBOA 2B7RA 2ZZ0A 4G74A 4K2XA 2O9ZA 5U25A 4EQSA 3RP8A 2YR6A 4OPTA 5HY5A 2XVHA 1E1NA 4TM4A 4AP3A 2R46A 1E7PA 3UKKA 1IUVA 4D03A 3NRNA 3AE4A 4H2RA 1TDEA 2PYXA 3AEDA 3AXBA 1Q9IA 4GUVA 2W0HA 3AYLA 2FJAA 2QA2A 2HQMA 4RSLA 2BS4A 4NTEA 1N4UA 4YWOA 3T2KA 3EPTA 2Q0LA 1ZP0A 1N4VA 1ELIA 1QLBA 1GETA 1ZMCA 3ITJA 1E39A 1PBFA 1NHSA 1JRXA 5JCNA 2XFPA 2FJBA 3NTAA 3FPZA 1ZX9A 4NTDA 3URHA 5JCIA 2RGJA 5KMSA 2VOUA 2YLRA 3F8PA 3ATQA 1JNRA 2GQFA 4DSGA 2WDRA 3SGLA 1TDFA 4OCGA 5KOWA 2GQWA 4GCMA 3C96A 1L9DA 2BCPA 2XFOA 1S2QA 3AEGA 1MO9A 1QO8A 1P2HA 4CCQA 2XVEA 2V5ZA 3OC4A 5KOXA 4BK1A 4CY8A 4EM4A 3QSMA 1GPEA 2NPXA 4UDQA 1IUSA 2OLOA 4JY2A 1IJHA 4RG4A 3AE8A 1JRZA 3GMBA 4CY6A 3SX6A 2WDQA 3NKSA 1AOGA 4LIIA 3NT6A 3JSKA 3ISHA 2CFYA 1BWCA 1JU2A 5EB4A 1RP0A 1H81A 3AE9A 3KA7A 1LPFA 3ADAB 1PXCA 1X31B 1Q1WA 3AB1A 3K7TA 4U8IA 5FS9A 3T0KA 1REOA 2YLTA 3REDA 1W4XA 2WDVA 4USQA 3RP7A 4PAAA 1GRGA 2GMHA 1S3EA 2E5VA 4LA1A 4X4JA 1NAAA 3IHMA 1NEKA 3KPKA 4U2LA 2YM2A 1NHQA 5U63A 2VVLA 2H89A 1CL0A 2C66A 1E1KA 3FBSA 4GAVA 4N9XA 1F6MA 3NG7X 3UTEA 3G5QA 4JY3A 1PHHA 3DJEA 1D7LA 2WOVA 1H83A 3F8RA 3AEBA 3ATRA 3BI2A 3RNMA 1XHCA 4FK1C 3SZFA 3CN8A 3VRDB 2BK3A 1NHRA 4II3A 1XPQA 5KVHA 1CHUA 4WCTA 2VZ2A 3EF6A 3NK0X 2EQ7A 3CGDA 5J60A 4U8NA 3UTGA 3AECA 3SFDA 3NYCA 2C75A 1FECA 2XVFA 2YG3A 5KMQA 2CDUA 1NG4A 1H7WA 3HYXA 4APNA 1S2YA 4IV9A 1DJNA 3P9UA 4GAPA 1DJQA 3HYWA 4NEVA 3DJGX 4PABA 4BV6A 4H4QA 3DA1A 1JRYA 3CPHG 2WP9A 2F5ZA 4CNJA 4C74A 2JBVA 2WOWA 2XDOA 5DBJA 2C70A 3T14A 3EANA 3P4QA 1TDNA 4H4UA 2EQ9A 4NTCA 2WPFA 1NDAA 4ADWA 3NTDA 1UKVG 5J7XA 3CTYA 1H86A 4J33A 2I0ZA 1XANA 3CGBA 4IA6A 4OPCA 3Q9TA 1JOAA 1F8RA 2CVJA 1EL9A 1VG0A 2E1MA 3IC9A 3UKFA 3AE7A 2Y6QA 1NHPA 3DGZA 5C2TA 3I3LA 4U2TA 2VRLA 1GRAA 3SZ0A 3SYIA 3V76A 3HZLA 4G73A 2RGOA 2X3NA 2C4CA 3CNPA 3GYIA 3VR9A 5IPYA 1K0JA 1Y0PA 2YVGA 4YTNA 2OA1A 3UKLA 1K4QA 4I58A 4O5QA 1O94A 1YQZA 3UOXA 4YSXA 1KNRA 4H2NA 2AAQA 3AEFA 3DK4A 1F3PA 1D7YA 4HB9A 3ICTA 1CF3A 1LJ1A 1M64A 2QA1A 4B63A 2JAEA 2FJEA 5HYMA 3SFEA 3H8IA 2XVIA 2WOIA 4B65A 5IQ4A 1Y56B 1NG3A 1LQUA 2BS3A 2Q0KA 3UOVA 2X8GA 2FBWA 3AWIA 4U8LA 4UDRA 2WU5A 2YLSA 2BABA 2R0GA 1GV4A 1OJ9A 2Q6UA 4Z24A 2GR3A 4CRTA 3NGCX 1ZOYA 3CGCA 3CNTA 3NYEA 2ARDA 2WQYA 2XFUA 4H4ZA 3CPJG 2IVEA 5EBKA 4C3YA 1KFYA 4YKGA 5FS7A 1Y56A 3BHFA 4YTPA 4BK3A 5GRTA 1B8SA 4FK1A 1IUWA 3KPFA 2APGA 2B7SA 1XDIA 2FJDA 4J36A 3KVEA 3FMWA 2V6OA 4D04A 3UKQA 3QFAA 1PXAA 3C4AA 1D4DA 2X8HA 2YM1A 1GNDA 3B6DA 4A6NB 1COYA 3AD9B 2XFNA 1B37A 3EAOA 4GDEA 3P4RA 3PO7A 4A79A 1PBDA 1RYIA 5BVAA 5BRTA 1ZDLA 2XYOA 4X9MA 3UCLA 3BI5A 3SZWA 4TLXA 4EQRA 1TRBA 1GXFA 4AOXA 4B1BA 3D8XA 5EB5A 1Q1RA 3DK8A 2B9YA 4A6NA 4J31A 2YG6A 3ICSA 3P4PA 3AD7B 5KNLA 1H6VA 4CCRA 2RGHA 3II4A 1Z6LA 3BI4A 1BZLA 1YQ4A 2ZZBA 3ABVA 1DODA 4EMWA 3DJDA 1OJDA 2DKHA 4U8JA 3AE3A 2CULA 2AR8A 3L1RA 4GR1A 4YXDA 3T2ZA 4H4XA 4J34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KX6 A;  4GDP A;  1BKW A;  2R4J A;  5CKU A;  5KWF A;  2YR4 A;  1B5Q A;  2A8X A;  2C67 A;  2VQB A;  3D1C A;  2QCU A;  1LTX R;  1OJA A;  1P2E A;  1IUX A;  3PVC A;  4IA5 A;  3AE2 A;  4E0V A;  4K22 A;  4C3X A;  4H4S A;  2XVJ A;  4H2Q A;  1GTH A;  3FG2 P;  4JDR A;  4A7A A;  2YAU A;  5M10 A;  2YG5 A;  2GMJ A;  4UP3 A;  5JCK A;  3DME A;  1KDG A;  2WES A;  3GRS A;  2GAH B;  3KKJ A;  2BK4 A;  2TPR A;  3KU9 A;  1CC6 A;  4TM3 A;  4OVI A;  1KSU A;  1N1P A;  3NN0 X;  4A65 A;  2H88 A;  3GSI A;  4J56 A;  1GAL A;  2B9X A;  1L9E A;  3GWD A;  3CGE A;  4AT2 A;  4OPI A;  3O0H A;  1DOE A;  1FCD A;  1GT8 A;  4USR A;  5FMH A;  4AT0 A;  2YLW A;  3PS9 A;  4NZH A;  1DXL A;  3GD4 A;  1PDH A;  4FDC B;  2C3C A;  4YKF A;  1DOB A;  3Q6J A;  3UKA A;  4H2P A;  3P4S A;  3AE1 A;  1KF6 A;  1O5W A;  2JB3 A;  5FS6 A;  3M12 A;  3M0O A;  4Z2R A;  4J57 A;  2YWL A;  4JNQ A;  3C4N A;  1KSS A;  1L0V A;  1FL2 A;  3LOV A;  3UOY A;  4AOS A;  2X99 A;  3QSE A;  4BJY A;  4OPL A;  4A5L A;  2WET A;  1EL7 A;  2Z5X A;  4B66 A;  4EIP A;  2XCG A;  3NH3 X;  3B3R A;  5L46 A;  1S3B A;  3CNS A;  2JKC A;  4U8P A;  3LZX A;  2V61 A;  4Z2T A;  5ER0 A;  4TM1 A;  2IVD A;  4CNK A;  2JK6 A;  3KLJ A;  3UTH A;  5LV9 A;  2GEW A;  2YG4 A;  4BK2 A;  1B4V A;  2C65 A;  1PJ7 A;  1IUT A;  2Q7V A;  3OZ2 A;  4ZCD A;  4EM3 A;  4H4V A;  4XWR A;  4TM0 A;  1V59 A;  2EQ8 A;  1F8W A;  1SEZ A;  1JEH A;  2C7G A;  1TYP A;  2WPE A;  2GB0 A;  5BUL A;  2BS2 A;  1GES A;  1M6I A;  3QSS A;  2BYB A;  3QVP A;  4C5O A;  2WBA A;  5TR3 A;  1F8S A;  1BGJ A;  2EQ6 A;  3CND A;  3KD9 A;  4K5S A;  3UOZ A;  3V3N A;  2B76 A;  4BUR A;  3AYJ A;  4TLZ A;  4EQX A;  3H8L A;  4JN9 A;  1MOK A;  1EL5 A;  4OPD A;  3DJJ A;  3IHG A;  4JQ9 A;  3NHO X;  4Y4L A;  2J3N A;  2JB2 A;  2B9W A;  1CC2 A;  4P9S A;  3NNE A;  4I59 A;  1GRT A;  3BNM A;  1GSN A;  3CIR A;  2VQ7 A;  4ZCC A;  5HHF A;  5U1O A;  4U2S A;  2R45 A;  2GH5 A;  2XLS A;  4K8D A;  4CBQ A;  3AD8 B;  3P1W A;  3RHA A;  5KRQ A;  3LB8 A;  1GOS A;  1GRB A;  1TDO A;  1TDK A;  2E4G A;  1K0I A;  3CPI G;  4H50 A;  4XWZ A;  2GV8 A;  2R9Z A;  3WE0 A;  2WHD A;  2C73 A;  2OLN A;  1CJ4 A;  1H84 A;  1BGN A;  3FIM B;  4H4T A;  3F8D A;  4U8M A;  3GD3 A;  1VDC A;  2VVM A;  4A9W A;  2WS3 A;  2X8C A;  4ECH A;  1YQ3 A;  3VQR A;  1PJ5 A;  5CQF A;  1CJC A;  2A87 A;  1GRE A;  3QJ4 A;  1EL8 A;  2WP5 A;  2YLZ A;  2YVJ A;  1KNP A;  1NEN A;  4H4P A;  3AYI A;  3RP6 A;  1BF3 A;  2PHH A;  2Y6R A;  1K0L A;  3QFB A;  3IF9 A;  1GRF A;  1ONF A;  3LXD A;  2C3D A;  2NVK X;  4UDP A;  5JCM A;  1H7X A;  2ZBW A;  1E1M A;  3SQP A;  2GVC A;  3V3O A;  3GMC A;  4EMI A;  4FX9 A;  4IVM B;  4A99 A;  3ALJ A;  5BUK A;  1D4C A;  3DK9 A;  3G5R A;  3T37 A;  4Y4N A;  4OPG A;  2BA9 A;  1LVL A;  3VRB A;  4GF7 A;  1PBC A;  4J2W A;  4Z26 A;  2YG7 A;  4H7U A;  2BXR A;  2YLX A;  3G5S A;  1ZY8 A;  2OAM A;  4Z2U A;  3M13 A;  2ZZC A;  2BAC A;  4EIQ A;  2GRT A;  2Z5Y A;  3K7M X;  1ZMD A;  4AP1 A;  3LZW A;  4YTM A;  5EOW A;  3QVR A;  4IVO B;  1JNZ A;  5GSN A;  2XLR A;  2X50 A;  4NEW A;  3AE5 A;  1HYU A;  1L9C A;  4H4Y A;  3UKH A;  2RAB A;  1IUU A;  3BNU A;  4DSH A;  1TYT A;  4C77 A;  4B69 A;  5FS8 A;  4Z43 A;  2GR1 A;  1FOH A;  2WEU A;  4JNA A;  3NN6 X;  2UZZ A;  4H4R A;  3R9U A;  3UTF A;  1LQT A;  1CJ2 A;  1RSG A;  1FEB A;  3NIX A;  3NK2 X;  4OPU A;  5KXJ A;  3ICR A;  3COX A;  4Z44 A;  1MXT A;  2R0C A;  3ALL A;  1H82 A;  4LU6 A;  4DGK A;  4YSY A;  2GR0 A;  3LJP A;  3S5W A;  1PN0 A;  3ZYX A;  3VR8 A;  4H4W A;  2C72 A;  5HXI A;  1GEU A;  1ZKQ A;  3NK1 X;  2V3B A;  4MJW A;  2XLT A;  2V3A A;  3GDP A;  1D5T A;  2A89 A;  4GRT A;  4YSZ A;  1PS9 A;  2ACZ A;  1FEA A;  4O5U A;  4HA6 A;  3VRA A;  4M52 A;  4K7Z A;  1QJD A;  1PBB A;  2C76 A;  4REK A;  4RG3 A;  1GRH A;  3I6D A;  2BCG G;  3GDN A;  1GER A;  1VG9 A;  1VRQ B;  2BC0 A;  4ZN0 A;  1N4W A;  1YY5 A;  4U8O A;  4YSH A;  2YQU A;  2IID A;  3BHK A;  2XLP A;  2BC1 A;  2YVF A;  3E1T A;  4EQW A;  2XFQ A;  2GAG B;  4EMJ A;  3SM8 A;  2TMD A;  1VQW A;  1D4E A;  2BK5 A;  3UP4 A;  4BJZ A;  3NYF A;  1O95 A;  4KPR A;  3AE6 A;  2C64 A;  2WU2 A;  4B68 A;  3ZDN A;  4U8K A;  3AEE A;  1PJ6 A;  1ZK7 A;  3CNJ A;  1OJT A;  2QAE A;  2YR5 A;  4WX1 A;  5C3J A;  2VVL G;  4Y4M A;  3UKP A;  1PBE A;  3IWA A;  1DOC A;  3L8K A;  3AEA A;  2VRM A;  3DH9 A;  2GR2 A;  1ZOV A;  3LAD A;  1YKJ A;  3DGH A;  3NLC A;  4XXG A;  1NPX A;  2XLU A;  2DKI A;  2AQJ A;  5IQ1 A;  3ALM A;  5JCL A;  4B67 A;  2WPC A;  3K30 A;  4X9N A;  4ICY A;  1EBD A;  5M0Z A;  1E1L A;  3H4K A;  1LV0 A;  3S61 A;  4B64 A;  1GTE A;  2JB1 A;  2OAL A;  3GRT A;  3UP5 A;  4YT0 A;  2GF3 A;  1CC4 A;  4DNA A;  4Z25 A;  1PXB A;  1OJC A;  2WP6 A;  2V60 A;  3GWF A;  1CJ3 A;  2R4E A;  2R0P A;  1DNC A;  5KVI A;  4K5R A;  1E6E A;  3GYJ A;  3K7Q X;  2BXS A;  1CBO A;  2B7R A;  2ZZ0 A;  4EQS A;  4K2X A;  2O9Z A;  5U25 A;  4OPT A;  2YR6 A;  3RP8 A;  5HY5 A;  2XVH A;  1E1N A;  4TM4 A;  4AP3 A;  2R46 A;  1E7P A;  3UKK A;  1IUV A;  4D03 A;  3NRN A;  3AE4 A;  4H2R A;  1TDE A;  2PYX A;  3AED A;  3AXB A;  1Q9I A;  4GUV A;  2W0H A;  3AYL A;  2FJA A;  2QA2 A;  2HQM A;  4RSL A;  2BS4 A;  4NTE A;  1N4U A;  4YWO A;  3EPT A;  2Q0L A;  1ZP0 A;  1N4V A;  1ELI A;  1QLB A;  1GET A;  1ZMC A;  3ITJ A;  1E39 A;  1PBF A;  1NHS A;  1JRX A;  5JCN A;  2XFP A;  2FJB A;  3NTA A;  3FPZ A;  1ZX9 A;  4NTD A;  3URH A;  5JCI A;  2RGJ A;  2VOU A;  2YLR A;  3F8P A;  3ATQ A;  1JNR A;  2GQF A;  4DSG A;  2WDR A;  3SGL A;  1TDF A;  4OCG A;  5KOW A;  2GQW A;  4GCM A;  3C96 A;  1L9D A;  2BCP A;  2XFO A;  1S2Q A;  3AEG A;  1MO9 A;  1QO8 A;  1P2H A;  4CCQ A;  2XVE A;  2V5Z A;  3OC4 A;  5KOX A;  4BK1 A;  4CY8 A;  4EM4 A;  3QSM A;  1GPE A;  2NPX A;  4UDQ A;  1IUS A;  2OLO A;  4JY2 A;  1IJH A;  4RG4 A;  3AE8 A;  1JRZ A;  3GMB A;  4CY6 A;  2WDQ A;  3NKS A;  1AOG A;  4LII A;  3NT6 A;  3JSK A;  3ISH A;  2CFY A;  1BWC A;  1JU2 A;  5EB4 A;  1RP0 A;  1H81 A;  3AE9 A;  3KA7 A;  1LPF A;  3ADA B;  1PXC A;  1X31 B;  1Q1W A;  3AB1 A;  3K7T A;  4U8I A;  5FS9 A;  1REO A;  2YLT A;  3RED A;  1W4X A;  2WDV A;  4USQ A;  3RP7 A;  4PAA A;  1GRG A;  2GMH A;  1S3E A;  2E5V A;  4LA1 A;  4X4J A;  1NAA A;  3IHM A;  1NEK A;  4U2L A;  2YM2 A;  1NHQ A;  5U63 A;  2VVL A;  2H89 A;  1CL0 A;  2C66 A;  1E1K A;  3FBS A;  4N9X A;  1F6M A;  3NG7 X;  3UTE A;  3G5Q A;  4JY3 A;  1PHH A;  3DJE A;  1D7L A;  2WOV A;  1H83 A;  3F8R A;  3AEB A;  3ATR A;  3BI2 A;  3RNM A;  1XHC A;  4FK1 C;  3CN8 A;  3VRD B;  2BK3 A;  1NHR A;  1XPQ A;  5KVH A;  1CHU A;  4WCT A;  2VZ2 A;  3EF6 A;  3NK0 X;  2EQ7 A;  3CGD A;  5J60 A;  4U8N A;  3UTG A;  3AEC A;  3SFD A;  3NYC A;  2C75 A;  1FEC A;  2XVF A;  2YG3 A;  2CDU A;  1NG4 A;  1H7W A;  4APN A;  1S2Y A;  4IV9 A;  1DJN A;  3P9U A;  1DJQ A;  4NEV A;  4PAB A;  3DJG X;  4BV6 A;  4H4Q A;  3DA1 A;  1JRY A;  3CPH G;  2WP9 A;  2F5Z A;  4CNJ A;  4C74 A;  2JBV A;  2WOW A;  2XDO A;  5DBJ A;  2C70 A;  3EAN A;  3P4Q A;  1TDN A;  4H4U A;  2EQ9 A;  4NTC A;  2WPF A;  1NDA A;  4ADW A;  3NTD A;  1UKV G;  5J7X A;  3CTY A;  1H86 A;  4J33 A;  2I0Z A;  1XAN A;  3CGB A;  4IA6 A;  4OPC A;  3Q9T A;  1JOA A;  1F8R A;  2CVJ A;  1EL9 A;  1VG0 A;  2E1M A;  3IC9 A;  3UKF A;  3AE7 A;  2Y6Q A;  1NHP A;  3DGZ A;  5C2T A;  3I3L A;  4U2T A;  2VRL A;  1GRA A;  3V76 A;  3HZL A;  2RGO A;  2X3N A;  3GYI A;  3CNP A;  3VR9 A;  5IPY A;  1K0J A;  1Y0P A;  2YVG A;  4YTN A;  2OA1 A;  3UKL A;  1K4Q A;  4I58 A;  4O5Q A;  1O94 A;  1YQZ A;  3UOX A;  4YSX A;  1KNR A;  4H2N A;  2AAQ A;  3AEF A;  3DK4 A;  1F3P A;  1D7Y A;  4HB9 A;  3ICT A;  1CF3 A;  1LJ1 A;  1M64 A;  2QA1 A;  4B63 A;  2JAE A;  2FJE A;  5HYM A;  3SFE A;  3H8I A;  2XVI A;  2WOI A;  4B65 A;  5IQ4 A;  1Y56 B;  1NG3 A;  1LQU A;  2BS3 A;  2Q0K A;  3UOV A;  2X8G A;  2FBW A;  3AWI A;  4U8L A;  4UDR A;  2WU5 A;  2YLS A;  2BAB A;  2R0G A;  1GV4 A;  1OJ9 A;  2Q6U A;  4Z24 A;  2GR3 A;  4CRT A;  3NGC X;  1ZOY A;  3CGC A;  3CNT A;  3NYE A;  2ARD A;  2WQY A;  2XFU A;  4H4Z A;  3CPJ G;  2IVE A;  5EBK A;  4C3Y A;  1KFY A;  4YKG A;  5FS7 A;  1Y56 A;  3BHF A;  4YTP A;  4BK3 A;  5GRT A;  1B8S A;  4FK1 A;  1IUW A;  3KPF A;  2APG A;  2B7S A;  1XDI A;  2FJD A;  4J36 A;  3KVE A;  3FMW A;  2V6O A;  4D04 A;  3UKQ A;  3QFA A;  1PXA A;  3C4A A;  1D4D A;  2X8H A;  2YM1 A;  1GND A;  3B6D A;  4A6N B;  1COY A;  3AD9 B;  2XFN A;  1B37 A;  3EAO A;  4GDE A;  3P4R A;  3PO7 A;  4A79 A;  1PBD A;  1RYI A;  5BVA A;  5BRT A;  1ZDL A;  2XYO A;  4X9M A;  3UCL A;  3BI5 A;  4TLX A;  4EQR A;  1TRB A;  1GXF A;  4AOX A;  4B1B A;  3D8X A;  5EB5 A;  1Q1R A;  3DK8 A;  2B9Y A;  4A6N A;  4J31 A;  2YG6 A;  3ICS A;  3P4P A;  3AD7 B;  1H6V A;  4CCR A;  2RGH A;  3II4 A;  1Z6L A;  3BI4 A;  1BZL A;  1YQ4 A;  2ZZB A;  3ABV A;  1DOD A;  4EMW A;  3DJD A;  1OJD A;  2DKH A;  4U8J A;  3AE3 A;  2CUL A;  2AR8 A;  3L1R A;  4GR1 A;  4YXD A;  4H4X A;  4J34 A; 
#chains in the Genus database with same CATH topology
 4KX6 A;  3W4K A;  4GDP A;  1BKW A;  2R4J A;  5CKU A;  1EVI A;  5KWF A;  2YR4 A;  1B5Q A;  2A8X A;  2C67 A;  2VQB A;  3ZNQ A;  3D1C A;  2QCU A;  1LTX R;  1DDO A;  1OJA A;  1P2E A;  1IUX A;  3PVC A;  4IA5 A;  3AE2 A;  4E0V A;  4K22 A;  4C3X A;  4H4S A;  2XVJ A;  4H2Q A;  1GTH A;  3FG2 P;  4JDR A;  4A7A A;  2YAU A;  5M10 A;  2YG5 A;  2GMJ A;  4UP3 A;  5JCK A;  3DME A;  1KDG A;  2WES A;  3CMM A;  2GAH B;  3GRS A;  3KKJ A;  2BK4 A;  2TPR A;  3KU9 A;  1CC6 A;  3ZNO A;  4TM3 A;  4OVI A;  1KSU A;  1N1P A;  3NN0 X;  4A65 A;  3GSI A;  2H88 A;  4J56 A;  1GAL A;  2B9X A;  1L9E A;  3GWD A;  3CGE A;  4AT2 A;  4OPI A;  3O0H A;  1DOE A;  1FCD A;  1GT8 A;  4USR A;  5FMH A;  4AT0 A;  3PS9 A;  2YLW A;  4NZH A;  1DXL A;  3GD4 A;  1PDH A;  4FDC B;  2C3C A;  4YKF A;  1DOB A;  3Q6J A;  3UKA A;  4H2P A;  3P4S A;  4YJD A;  3AE1 A;  1KF6 A;  1O5W A;  2JB3 A;  5FS6 A;  3M12 A;  3M0O A;  4Z2R A;  4J57 A;  2YWL A;  4JNQ A;  3C4N A;  1KSS A;  1L0V A;  1FL2 A;  3LOV A;  3UOY A;  4AOS A;  4BJY A;  3QSE A;  2X99 A;  1C0K A;  4OPL A;  4A5L A;  2WET A;  1EL7 A;  2Z5X A;  4B66 A;  4EIP A;  3HYV A;  2XCG A;  5L46 A;  2BRA A;  3B3R A;  3NH3 X;  1S3B A;  3CNS A;  4G6G A;  2JKC A;  2DU8 A;  4U8P A;  3LZX A;  2V61 A;  4Z2T A;  5ER0 A;  4TM1 A;  2IVD A;  3G3E A;  3ZNP A;  4CNK A;  2JK6 A;  3KLJ A;  3UTH A;  5LV9 A;  2GEW A;  2YG4 A;  4BK2 A;  1B4V A;  2C65 A;  1PJ7 A;  1IUT A;  3OZ2 A;  2Q7V A;  4ZCD A;  4EM3 A;  3T2Y A;  4H4V A;  4XWR A;  4TM0 A;  1V59 A;  2EQ8 A;  1F8W A;  1SEZ A;  1JEH A;  2C7G A;  1TYP A;  2WPE A;  2GB0 A;  5BUL A;  2BS2 A;  1GES A;  1M6I A;  3QSS A;  2BYB A;  3QVP A;  4C5O A;  2WBA A;  5TR3 A;  1F8S A;  1BGJ A;  2EQ6 A;  3CND A;  3KD9 A;  4K5S A;  3UOZ A;  3V3N A;  2B76 A;  4BUR A;  3AYJ A;  4TLZ A;  4EQX A;  3H8L A;  4JN9 A;  5KMP A;  1MOK A;  1EL5 A;  4OPD A;  3DJJ A;  3IHG A;  4JQ9 A;  3NHO X;  4Y4L A;  2J3N A;  2JB2 A;  4P9S A;  1CC2 A;  2B9W A;  3NNE A;  4I59 A;  1GRT A;  3BNM A;  1GSN A;  3CIR A;  2VQ7 A;  4ZCC A;  5HHF A;  5U1O A;  4U2S A;  2R45 A;  2E49 A;  2GH5 A;  2XLS A;  4G6H A;  4K8D A;  3AD8 B;  3P1W A;  3RHA A;  4CBQ A;  5KRQ A;  3LB8 A;  1GOS A;  1GRB A;  1TDO A;  1TDK A;  2E4G A;  1K0I A;  4XWZ A;  3CPI G;  4H50 A;  2GV8 A;  2R9Z A;  3WE0 A;  2WHD A;  2C73 A;  2OLN A;  1CJ4 A;  1H84 A;  1BGN A;  3FIM B;  4H4T A;  3F8D A;  4U8M A;  3GD3 A;  1VDC A;  2VVM A;  4A9W A;  2WS3 A;  2X8C A;  4ECH A;  3VQR A;  1YQ3 A;  1PJ5 A;  5CQF A;  1CJC A;  1GRE A;  2A87 A;  3QJ4 A;  1EL8 A;  2WP5 A;  2YLZ A;  2YVJ A;  2E82 A;  1KNP A;  1NEN A;  4H4P A;  3AYI A;  3RP6 A;  1BF3 A;  2PHH A;  2Y6R A;  1K0L A;  3QFB A;  3SZC A;  3IF9 A;  1GRF A;  1ONF A;  3LXD A;  2C3D A;  2NVK X;  4UDP A;  5JCM A;  1H7X A;  2ZBW A;  1E1M A;  3SQP A;  2GVC A;  3V3O A;  3GMC A;  4EMI A;  4FX9 A;  4IVM B;  4A99 A;  3ALJ A;  5BUK A;  1D4C A;  4YJH B;  3DK9 A;  3G5R A;  3T37 A;  4Y4N A;  4OPG A;  2BA9 A;  1LVL A;  3VRB A;  4GF7 A;  1PBC A;  4J2W A;  4Z26 A;  2YG7 A;  4H7U A;  2BXR A;  2YLX A;  3G5S A;  1ZY8 A;  2OAM A;  4Z2U A;  3M13 A;  4YJH A;  2ZZC A;  2BAC A;  2BRY A;  4EIQ A;  2GRT A;  2Z5Y A;  3K7M X;  4QFD A;  1ZMD A;  3SXI A;  3LZW A;  4YTM A;  4AP1 A;  5EOW A;  3QVR A;  4IVO B;  1JNZ A;  5GSN A;  2XLR A;  2X50 A;  4NEW A;  3AE5 A;  1HYU A;  1L9C A;  4H4Y A;  3UKH A;  2RAB A;  1IUU A;  3BNU A;  4DSH A;  1TYT A;  4C77 A;  4B69 A;  5FS8 A;  4Z43 A;  2GR1 A;  1FOH A;  2WEU A;  4JNA A;  3NN6 X;  2UZZ A;  4H4R A;  3R9U A;  3UTF A;  1LQT A;  4NNJ A;  1CJ2 A;  1RSG A;  1FEB A;  3NIX A;  3NK2 X;  4OPU A;  5KMR A;  5KXJ A;  3ICR A;  3T31 A;  3COX A;  4Z44 A;  4G9K A;  1MXT A;  3SY4 A;  2R0C A;  3ALL A;  1H82 A;  4LU6 A;  4DGK A;  4YSY A;  2GR0 A;  3LJP A;  3S5W A;  1PN0 A;  3ZYX A;  3VR8 A;  4H4W A;  2C72 A;  5HXI A;  1GEU A;  1ZKQ A;  3NK1 X;  2V3B A;  3GYX A;  2XLT A;  2V3A A;  3GDP A;  1D5T A;  4MJW A;  2A89 A;  4GRT A;  4YSZ A;  1PS9 A;  2ACZ A;  1FEA A;  4O5U A;  4HA6 A;  3VRA A;  4M52 A;  4K7Z A;  1QJD A;  1PBB A;  2C76 A;  4REK A;  4RG3 A;  1GRH A;  3WGT A;  3I6D A;  2BCG G;  3GDN A;  1GER A;  1VG9 A;  1VRQ B;  2BC0 A;  4ZN0 A;  4YSH A;  1N4W A;  1YY5 A;  4U8O A;  2YQU A;  2IID A;  3BHK A;  2XLP A;  3E1T A;  2BC1 A;  2YVF A;  4EQW A;  2XFQ A;  2GAG B;  4EMJ A;  3SM8 A;  2TMD A;  1VQW A;  1D4E A;  2BK5 A;  4BJZ A;  3UP4 A;  3NYF A;  1O95 A;  4KPR A;  3AE6 A;  4II2 A;  2C64 A;  2WU2 A;  4B68 A;  3ZDN A;  4U8K A;  3AEE A;  1PJ6 A;  1ZK7 A;  3CNJ A;  1OJT A;  2QAE A;  2YR5 A;  4WX1 A;  5C3J A;  2VVL G;  4Y4M A;  3UKP A;  1PBE A;  3IWA A;  1DOC A;  3L8K A;  3AEA A;  2VRM A;  3DH9 A;  2GR2 A;  1ZOV A;  3LAD A;  1YKJ A;  3DGH A;  3NLC A;  4XXG A;  1NPX A;  2XLU A;  2DKI A;  2AQJ A;  5IQ1 A;  3ALM A;  5JCL A;  4B67 A;  4X9N A;  1C0L A;  2WPC A;  3K30 A;  4ICY A;  1EBD A;  5M0Z A;  1E1L A;  3H4K A;  1LV0 A;  3S61 A;  4B64 A;  1GTE A;  2JB1 A;  2OAL A;  3GRT A;  4NWZ A;  3UP5 A;  2GF3 A;  4YT0 A;  1CC4 A;  4DNA A;  4H4X A;  1PXB A;  4Z25 A;  1OJC A;  2WP6 A;  2V60 A;  3GWF A;  1CJ3 A;  4QFC A;  2R4E A;  2R0P A;  1DNC A;  5KVI A;  4K5R A;  1E6E A;  3GYJ A;  3K7Q X;  2BXS A;  1CBO A;  2B7R A;  2ZZ0 A;  4G74 A;  4K2X A;  2O9Z A;  5U25 A;  4EQS A;  3RP8 A;  2YR6 A;  4OPT A;  5HY5 A;  2XVH A;  1E1N A;  4TM4 A;  4AP3 A;  2R46 A;  1E7P A;  3UKK A;  1IUV A;  4D03 A;  3NRN A;  3AE4 A;  4H2R A;  1TDE A;  2PYX A;  3AED A;  3AXB A;  1Q9I A;  4GUV A;  2W0H A;  3AYL A;  2FJA A;  2QA2 A;  2HQM A;  4RSL A;  2BS4 A;  4NTE A;  1N4U A;  4YWO A;  3T2K A;  3EPT A;  2Q0L A;  1ZP0 A;  1N4V A;  1ELI A;  1QLB A;  1GET A;  1ZMC A;  3ITJ A;  1PBF A;  1E39 A;  1NHS A;  1JRX A;  5JCN A;  2XFP A;  2FJB A;  3NTA A;  3FPZ A;  1ZX9 A;  4NTD A;  3URH A;  5JCI A;  2RGJ A;  5KMS A;  2VOU A;  2YLR A;  3F8P A;  3ATQ A;  1JNR A;  2GQF A;  4DSG A;  2WDR A;  3SGL A;  1TDF A;  4OCG A;  5KOW A;  2GQW A;  4GCM A;  3C96 A;  1L9D A;  2BCP A;  2XFO A;  1S2Q A;  3AEG A;  1MO9 A;  1QO8 A;  1P2H A;  4CCQ A;  2XVE A;  2V5Z A;  3OC4 A;  5KOX A;  4BK1 A;  4CY8 A;  1VE9 A;  4EM4 A;  3QSM A;  1GPE A;  2NPX A;  4UDQ A;  1IUS A;  2OLO A;  3CUK A;  4JY2 A;  1IJH A;  4RG4 A;  1AN9 A;  3AE8 A;  1JRZ A;  3ZNN A;  3GMB A;  4CY6 A;  3SX6 A;  2WDQ A;  3NKS A;  1AOG A;  4LII A;  3NT6 A;  3JSK A;  3ISH A;  2CFY A;  1BWC A;  1JU2 A;  5EB4 A;  1RP0 A;  1H81 A;  3AE9 A;  3KA7 A;  1LPF A;  3ADA B;  1PXC A;  2E48 A;  1X31 B;  1Q1W A;  3AB1 A;  3K7T A;  4U8I A;  5FS9 A;  3T0K A;  1REO A;  2YLT A;  3RED A;  1W4X A;  2WDV A;  4USQ A;  3RP7 A;  4PAA A;  1GRG A;  2GMH A;  1S3E A;  2E5V A;  4LA1 A;  4X4J A;  1NAA A;  3IHM A;  1NEK A;  3KPK A;  4U2L A;  2YM2 A;  1NHQ A;  5U63 A;  2VVL A;  2H89 A;  4YJG B;  1CL0 A;  1E1K A;  2C66 A;  3FBS A;  4GAV A;  4N9X A;  1F6M A;  3NG7 X;  3UTE A;  3G5Q A;  4JY3 A;  1PHH A;  3DJE A;  1D7L A;  2WOV A;  1H83 A;  1DAO A;  3F8R A;  3AEB A;  3ATR A;  3BI2 A;  3RNM A;  1XHC A;  4FK1 C;  3SZF A;  3CN8 A;  3VRD B;  2BK3 A;  1NHR A;  4II3 A;  1XPQ A;  5KVH A;  1CHU A;  4WCT A;  4YJG A;  2VZ2 A;  3EF6 A;  3NK0 X;  2EQ7 A;  3CGD A;  5J60 A;  4U8N A;  3UTG A;  3W4I A;  3AEC A;  3NYC A;  2C75 A;  3SFD A;  1FEC A;  2XVF A;  2YG3 A;  5KMQ A;  2CDU A;  1NG4 A;  1H7W A;  3HYX A;  4APN A;  1S2Y A;  4IV9 A;  1DJN A;  3P9U A;  4GAP A;  4PAB A;  1DJQ A;  3HYW A;  3DJG X;  4NEV A;  4BV6 A;  4H4Q A;  3DA1 A;  1JRY A;  3CPH G;  2WP9 A;  2F5Z A;  1KIF A;  4CNJ A;  4C74 A;  2JBV A;  2WOW A;  2XDO A;  5DBJ A;  2C70 A;  3T14 A;  3W4J A;  3EAN A;  3P4Q A;  1TDN A;  4H4U A;  2EQ9 A;  4NTC A;  2WPF A;  1NDA A;  4ADW A;  3NTD A;  1UKV G;  5J7X A;  3CTY A;  1H86 A;  4J33 A;  2I0Z A;  1XAN A;  3CGB A;  4IA6 A;  4OPC A;  3Q9T A;  1JOA A;  1F8R A;  2CVJ A;  1EL9 A;  1VG0 A;  2E1M A;  3IC9 A;  3UKF A;  3AE7 A;  2Y6Q A;  1NHP A;  3DGZ A;  5C2T A;  3I3L A;  4U2T A;  2VRL A;  1GRA A;  3SZ0 A;  3SYI A;  3V76 A;  3HZL A;  4G73 A;  2RGO A;  2X3N A;  2C4C A;  3CNP A;  3GYI A;  3VR9 A;  5IPY A;  1K0J A;  1Y0P A;  2YVG A;  4YTN A;  2OA1 A;  3UKL A;  1K4Q A;  4I58 A;  4O5Q A;  1O94 A;  1YQZ A;  3UOX A;  4YSX A;  1KNR A;  4H2N A;  2AAQ A;  3AEF A;  3DK4 A;  1F3P A;  1D7Y A;  4HB9 A;  3ICT A;  1CF3 A;  1LJ1 A;  1M64 A;  2QA1 A;  4B63 A;  2JAE A;  2FJE A;  5HYM A;  3SFE A;  3H8I A;  2XVI A;  2WOI A;  4B65 A;  5IQ4 A;  1Y56 B;  1NG3 A;  1LQU A;  2BS3 A;  2Q0K A;  3UOV A;  2X8G A;  2FBW A;  2E4A A;  3AWI A;  4U8L A;  2WU5 A;  2YLS A;  4UDR A;  2BAB A;  2R0G A;  2Q6U A;  1GV4 A;  1OJ9 A;  4Z24 A;  2GR3 A;  4CRT A;  3NGC X;  1ZOY A;  3CGC A;  3NYE A;  3CNT A;  2ARD A;  2WQY A;  2XFU A;  4H4Z A;  3CPJ G;  2IVE A;  5EBK A;  4C3Y A;  1KFY A;  4YKG A;  5FS7 A;  1Y56 A;  3BHF A;  4YTP A;  4BK3 A;  5GRT A;  1B8S A;  4FK1 A;  1IUW A;  3KPF A;  2APG A;  2B7S A;  1XDI A;  2FJD A;  4J36 A;  3KVE A;  3FMW A;  2V6O A;  4D04 A;  3UKQ A;  3QFA A;  1PXA A;  3C4A A;  1D4D A;  2X8H A;  2YM1 A;  1GND A;  3B6D A;  4A6N B;  3AD9 B;  1COY A;  2XFN A;  1B37 A;  3EAO A;  4GDE A;  3P4R A;  3PO7 A;  4A79 A;  1C0I A;  1PBD A;  1RYI A;  5BVA A;  5BRT A;  1ZDL A;  4X9M A;  2XYO A;  3UCL A;  3BI5 A;  3SZW A;  4TLX A;  4EQR A;  1TRB A;  1GXF A;  4AOX A;  4B1B A;  3D8X A;  5EB5 A;  1Q1R A;  3DK8 A;  2B9Y A;  4A6N A;  4J31 A;  2YG6 A;  3ICS A;  3P4P A;  3AD7 B;  4YJF B;  5KNL A;  1H6V A;  4CCR A;  2RGH A;  3II4 A;  1Z6L A;  3BI4 A;  1BZL A;  1YQ4 A;  2ZZB A;  3ABV A;  1DOD A;  1C0P A;  4EMW A;  3DJD A;  1OJD A;  2DKH A;  4U8J A;  3AE3 A;  2CUL A;  2AR8 A;  3L1R A;  4GR1 A;  4YXD A;  3T2Z A;  4YJF A;  4J34 A; 
#chains in the Genus database with same CATH homology
 4KX6 A;  4GDP A;  1BKW A;  2R4J A;  5CKU A;  5KWF A;  2YR4 A;  1B5Q A;  2A8X A;  2C67 A;  2VQB A;  3D1C A;  2QCU A;  1LTX R;  1OJA A;  1P2E A;  4IA5 A;  1IUX A;  3PVC A;  3AE2 A;  4E0V A;  4K22 A;  4C3X A;  4H4S A;  2XVJ A;  4H2Q A;  1GTH A;  3FG2 P;  4JDR A;  4A7A A;  2YAU A;  5M10 A;  2YG5 A;  2GMJ A;  4UP3 A;  5JCK A;  3DME A;  1KDG A;  2WES A;  3CMM A;  2GAH B;  3GRS A;  3KKJ A;  2BK4 A;  2TPR A;  3KU9 A;  1CC6 A;  4TM3 A;  4OVI A;  1KSU A;  1N1P A;  3NN0 X;  4A65 A;  2H88 A;  3GSI A;  4J56 A;  1GAL A;  2B9X A;  1L9E A;  3GWD A;  3CGE A;  4AT2 A;  4OPI A;  3O0H A;  1DOE A;  1FCD A;  1GT8 A;  4USR A;  5FMH A;  4AT0 A;  2YLW A;  3PS9 A;  4NZH A;  1DXL A;  3GD4 A;  1PDH A;  4FDC B;  2C3C A;  4YKF A;  1DOB A;  3Q6J A;  3UKA A;  4H2P A;  3P4S A;  3AE1 A;  1KF6 A;  1O5W A;  2JB3 A;  5FS6 A;  3M12 A;  3M0O A;  4Z2R A;  4J57 A;  2YWL A;  4JNQ A;  3C4N A;  1KSS A;  1L0V A;  1FL2 A;  3LOV A;  3UOY A;  4AOS A;  4BJY A;  2X99 A;  3QSE A;  4OPL A;  4A5L A;  2WET A;  1EL7 A;  2Z5X A;  4B66 A;  4EIP A;  3HYV A;  2XCG A;  2BRA A;  3B3R A;  3NH3 X;  5L46 A;  1S3B A;  3CNS A;  4G6G A;  2JKC A;  4U8P A;  3LZX A;  2V61 A;  4Z2T A;  5ER0 A;  4TM1 A;  2IVD A;  4CNK A;  2JK6 A;  3KLJ A;  3UTH A;  5LV9 A;  2GEW A;  2YG4 A;  4BK2 A;  1B4V A;  2C65 A;  1PJ7 A;  1IUT A;  2Q7V A;  3OZ2 A;  4ZCD A;  4EM3 A;  3T2Y A;  4H4V A;  4XWR A;  4TM0 A;  1V59 A;  2EQ8 A;  1F8W A;  1SEZ A;  1JEH A;  2C7G A;  1TYP A;  2WPE A;  2GB0 A;  5BUL A;  2BS2 A;  1GES A;  1M6I A;  3QSS A;  2BYB A;  3QVP A;  4C5O A;  2WBA A;  5TR3 A;  1F8S A;  1BGJ A;  2EQ6 A;  3CND A;  3KD9 A;  4K5S A;  3UOZ A;  3V3N A;  2B76 A;  4BUR A;  3AYJ A;  4TLZ A;  4EQX A;  3H8L A;  4JN9 A;  5KMP A;  1MOK A;  1EL5 A;  4OPD A;  3DJJ A;  3IHG A;  4JQ9 A;  3NHO X;  4Y4L A;  2J3N A;  2JB2 A;  2B9W A;  1CC2 A;  4P9S A;  3NNE A;  4I59 A;  1GRT A;  3BNM A;  1GSN A;  3CIR A;  2VQ7 A;  4ZCC A;  5HHF A;  5U1O A;  4U2S A;  2R45 A;  2GH5 A;  2XLS A;  4G6H A;  4K8D A;  3AD8 B;  3P1W A;  3RHA A;  4CBQ A;  5KRQ A;  3LB8 A;  1GOS A;  1GRB A;  1TDO A;  1TDK A;  2E4G A;  1K0I A;  3CPI G;  4H50 A;  4XWZ A;  2GV8 A;  2R9Z A;  3WE0 A;  2WHD A;  2C73 A;  2OLN A;  1CJ4 A;  1H84 A;  1BGN A;  3FIM B;  4H4T A;  3F8D A;  4U8M A;  3GD3 A;  1VDC A;  2VVM A;  4A9W A;  2WS3 A;  2X8C A;  4ECH A;  1YQ3 A;  3VQR A;  1PJ5 A;  5CQF A;  1CJC A;  2A87 A;  1GRE A;  3QJ4 A;  1EL8 A;  2WP5 A;  2YLZ A;  2YVJ A;  1KNP A;  1NEN A;  4H4P A;  3AYI A;  3RP6 A;  1BF3 A;  2PHH A;  2Y6R A;  1K0L A;  3QFB A;  3SZC A;  3IF9 A;  1GRF A;  1ONF A;  3LXD A;  2C3D A;  2NVK X;  4UDP A;  5JCM A;  1H7X A;  2ZBW A;  1E1M A;  3SQP A;  2GVC A;  3V3O A;  3GMC A;  4EMI A;  4FX9 A;  4IVM B;  4A99 A;  3ALJ A;  5BUK A;  1D4C A;  3DK9 A;  3G5R A;  3T37 A;  4Y4N A;  4OPG A;  2BA9 A;  1LVL A;  3VRB A;  4GF7 A;  1PBC A;  4J2W A;  4Z26 A;  2YG7 A;  4H7U A;  2BXR A;  2YLX A;  3G5S A;  1ZY8 A;  2OAM A;  4Z2U A;  3M13 A;  2ZZC A;  2BAC A;  2BRY A;  4EIQ A;  2GRT A;  2Z5Y A;  3K7M X;  1ZMD A;  3SXI A;  3LZW A;  4YTM A;  4AP1 A;  5EOW A;  3QVR A;  4IVO B;  1JNZ A;  5GSN A;  2XLR A;  2X50 A;  4NEW A;  3AE5 A;  1HYU A;  1L9C A;  4H4Y A;  3UKH A;  2RAB A;  1IUU A;  3BNU A;  4DSH A;  1TYT A;  4C77 A;  4B69 A;  5FS8 A;  4Z43 A;  2GR1 A;  1FOH A;  2WEU A;  4JNA A;  3NN6 X;  2UZZ A;  4H4R A;  3R9U A;  3UTF A;  1LQT A;  4NNJ A;  1CJ2 A;  1RSG A;  1FEB A;  3NIX A;  3NK2 X;  4OPU A;  5KMR A;  5KXJ A;  3ICR A;  3T31 A;  3COX A;  4Z44 A;  4G9K A;  1MXT A;  3SY4 A;  2R0C A;  3ALL A;  1H82 A;  4LU6 A;  4DGK A;  4YSY A;  2GR0 A;  3LJP A;  3S5W A;  1PN0 A;  3ZYX A;  3VR8 A;  4H4W A;  2C72 A;  5HXI A;  1GEU A;  1ZKQ A;  3NK1 X;  2V3B A;  3GYX A;  2XLT A;  2V3A A;  3GDP A;  1D5T A;  4MJW A;  2A89 A;  4GRT A;  4YSZ A;  1PS9 A;  2ACZ A;  1FEA A;  4O5U A;  4HA6 A;  3VRA A;  4M52 A;  4K7Z A;  1QJD A;  1PBB A;  2C76 A;  4REK A;  4RG3 A;  1GRH A;  3I6D A;  2BCG G;  3GDN A;  1GER A;  1VG9 A;  1VRQ B;  2BC0 A;  4ZN0 A;  1N4W A;  1YY5 A;  4U8O A;  4YSH A;  2YQU A;  2IID A;  3BHK A;  2XLP A;  3E1T A;  2BC1 A;  2YVF A;  4EQW A;  2XFQ A;  2GAG B;  4EMJ A;  3SM8 A;  2TMD A;  1VQW A;  1D4E A;  2BK5 A;  4BJZ A;  3UP4 A;  3NYF A;  1O95 A;  4KPR A;  3AE6 A;  4II2 A;  2C64 A;  2WU2 A;  4B68 A;  3ZDN A;  4U8K A;  3AEE A;  1PJ6 A;  1ZK7 A;  3CNJ A;  1OJT A;  2QAE A;  2YR5 A;  4WX1 A;  5C3J A;  2VVL G;  4Y4M A;  3UKP A;  1PBE A;  3IWA A;  1DOC A;  3L8K A;  3AEA A;  2VRM A;  3DH9 A;  2GR2 A;  1ZOV A;  3LAD A;  1YKJ A;  3DGH A;  3NLC A;  4XXG A;  1NPX A;  2XLU A;  2DKI A;  2AQJ A;  5IQ1 A;  3ALM A;  5JCL A;  4B67 A;  2WPC A;  3K30 A;  4X9N A;  4ICY A;  1EBD A;  5M0Z A;  1E1L A;  3H4K A;  1LV0 A;  3S61 A;  4B64 A;  1GTE A;  2JB1 A;  2OAL A;  3GRT A;  4NWZ A;  3UP5 A;  2GF3 A;  4YT0 A;  1CC4 A;  4DNA A;  4Z25 A;  1PXB A;  1OJC A;  2WP6 A;  2V60 A;  3GWF A;  1CJ3 A;  2R4E A;  2R0P A;  1DNC A;  5KVI A;  4K5R A;  1E6E A;  3GYJ A;  3K7Q X;  2BXS A;  1CBO A;  2B7R A;  2ZZ0 A;  4G74 A;  4K2X A;  2O9Z A;  5U25 A;  4EQS A;  3RP8 A;  2YR6 A;  4OPT A;  5HY5 A;  2XVH A;  1E1N A;  4TM4 A;  4AP3 A;  2R46 A;  1E7P A;  3UKK A;  1IUV A;  4D03 A;  3NRN A;  3AE4 A;  4H2R A;  1TDE A;  2PYX A;  3AED A;  3AXB A;  1Q9I A;  4GUV A;  2W0H A;  3AYL A;  2FJA A;  2QA2 A;  2HQM A;  4RSL A;  2BS4 A;  4NTE A;  1N4U A;  4YWO A;  3T2K A;  3EPT A;  2Q0L A;  1ZP0 A;  1N4V A;  1ELI A;  1QLB A;  1GET A;  1ZMC A;  3ITJ A;  1E39 A;  1PBF A;  1NHS A;  1JRX A;  5JCN A;  2XFP A;  2FJB A;  3NTA A;  3FPZ A;  1ZX9 A;  4NTD A;  3URH A;  5JCI A;  2RGJ A;  5KMS A;  2VOU A;  2YLR A;  3F8P A;  3ATQ A;  1JNR A;  2GQF A;  4DSG A;  2WDR A;  3SGL A;  1TDF A;  4OCG A;  5KOW A;  2GQW A;  4GCM A;  3C96 A;  1L9D A;  2BCP A;  2XFO A;  1S2Q A;  3AEG A;  1MO9 A;  1QO8 A;  1P2H A;  4CCQ A;  2XVE A;  2V5Z A;  3OC4 A;  5KOX A;  4BK1 A;  4CY8 A;  4EM4 A;  3QSM A;  1GPE A;  2NPX A;  4UDQ A;  1IUS A;  2OLO A;  4JY2 A;  1IJH A;  4RG4 A;  3AE8 A;  1JRZ A;  3GMB A;  4CY6 A;  3SX6 A;  2WDQ A;  3NKS A;  1AOG A;  4LII A;  3NT6 A;  3JSK A;  3ISH A;  2CFY A;  1BWC A;  1JU2 A;  5EB4 A;  1RP0 A;  1H81 A;  3AE9 A;  3KA7 A;  1LPF A;  3ADA B;  1PXC A;  1X31 B;  1Q1W A;  3AB1 A;  3K7T A;  4U8I A;  5FS9 A;  3T0K A;  1REO A;  2YLT A;  3RED A;  1W4X A;  2WDV A;  4USQ A;  3RP7 A;  4PAA A;  1GRG A;  2GMH A;  1S3E A;  2E5V A;  4LA1 A;  4X4J A;  1NAA A;  3IHM A;  1NEK A;  3KPK A;  4U2L A;  2YM2 A;  1NHQ A;  5U63 A;  2VVL A;  2H89 A;  1CL0 A;  2C66 A;  1E1K A;  3FBS A;  4GAV A;  4N9X A;  1F6M A;  3NG7 X;  3UTE A;  3G5Q A;  4JY3 A;  1PHH A;  3DJE A;  1D7L A;  2WOV A;  1H83 A;  3F8R A;  3AEB A;  3ATR A;  3BI2 A;  3RNM A;  1XHC A;  4FK1 C;  3SZF A;  3CN8 A;  3VRD B;  2BK3 A;  1NHR A;  4II3 A;  1XPQ A;  5KVH A;  1CHU A;  4WCT A;  2VZ2 A;  3EF6 A;  3NK0 X;  2EQ7 A;  3CGD A;  5J60 A;  4U8N A;  3UTG A;  3AEC A;  3SFD A;  3NYC A;  2C75 A;  1FEC A;  2XVF A;  2YG3 A;  5KMQ A;  2CDU A;  1NG4 A;  1H7W A;  3HYX A;  4APN A;  1S2Y A;  4IV9 A;  1DJN A;  3P9U A;  4GAP A;  1DJQ A;  3HYW A;  4NEV A;  3DJG X;  4PAB A;  4BV6 A;  4H4Q A;  3DA1 A;  1JRY A;  3CPH G;  2WP9 A;  2F5Z A;  4CNJ A;  4C74 A;  2JBV A;  2WOW A;  2XDO A;  5DBJ A;  2C70 A;  3T14 A;  3EAN A;  3P4Q A;  1TDN A;  4H4U A;  2EQ9 A;  4NTC A;  2WPF A;  1NDA A;  4ADW A;  3NTD A;  1UKV G;  5J7X A;  3CTY A;  1H86 A;  4J33 A;  2I0Z A;  1XAN A;  3CGB A;  4IA6 A;  4OPC A;  3Q9T A;  1JOA A;  1F8R A;  2CVJ A;  1EL9 A;  1VG0 A;  2E1M A;  3IC9 A;  3UKF A;  3AE7 A;  2Y6Q A;  1NHP A;  3DGZ A;  5C2T A;  3I3L A;  4U2T A;  2VRL A;  1GRA A;  3SZ0 A;  3SYI A;  3V76 A;  3HZL A;  4G73 A;  2RGO A;  2X3N A;  2C4C A;  3CNP A;  3GYI A;  3VR9 A;  5IPY A;  1K0J A;  1Y0P A;  2YVG A;  4YTN A;  2OA1 A;  3UKL A;  1K4Q A;  4I58 A;  4O5Q A;  1O94 A;  1YQZ A;  3UOX A;  4YSX A;  1KNR A;  4H2N A;  2AAQ A;  3AEF A;  3DK4 A;  1F3P A;  1D7Y A;  4HB9 A;  3ICT A;  1CF3 A;  1LJ1 A;  1M64 A;  2QA1 A;  4B63 A;  2JAE A;  2FJE A;  5HYM A;  3SFE A;  3H8I A;  2XVI A;  2WOI A;  4B65 A;  5IQ4 A;  1Y56 B;  1NG3 A;  1LQU A;  2BS3 A;  2Q0K A;  3UOV A;  2X8G A;  2FBW A;  3AWI A;  4U8L A;  4UDR A;  2WU5 A;  2YLS A;  2BAB A;  2R0G A;  1GV4 A;  1OJ9 A;  2Q6U A;  4Z24 A;  2GR3 A;  4CRT A;  3NGC X;  1ZOY A;  3CGC A;  3CNT A;  3NYE A;  2ARD A;  2WQY A;  2XFU A;  4H4Z A;  3CPJ G;  2IVE A;  5EBK A;  4C3Y A;  1KFY A;  4YKG A;  5FS7 A;  1Y56 A;  3BHF A;  4YTP A;  4BK3 A;  5GRT A;  1B8S A;  4FK1 A;  1IUW A;  3KPF A;  2APG A;  2B7S A;  1XDI A;  2FJD A;  4J36 A;  3KVE A;  3FMW A;  2V6O A;  4D04 A;  3UKQ A;  3QFA A;  1PXA A;  3C4A A;  1D4D A;  2X8H A;  2YM1 A;  1GND A;  3B6D A;  4A6N B;  1COY A;  3AD9 B;  2XFN A;  1B37 A;  3EAO A;  4GDE A;  3P4R A;  3PO7 A;  4A79 A;  1PBD A;  1RYI A;  5BVA A;  5BRT A;  1ZDL A;  2XYO A;  4X9M A;  3UCL A;  3BI5 A;  3SZW A;  4TLX A;  4EQR A;  1TRB A;  1GXF A;  4AOX A;  4B1B A;  3D8X A;  5EB5 A;  1Q1R A;  3DK8 A;  2B9Y A;  4A6N A;  4J31 A;  2YG6 A;  3ICS A;  3P4P A;  3AD7 B;  5KNL A;  1H6V A;  4CCR A;  2RGH A;  3II4 A;  1Z6L A;  3BI4 A;  1BZL A;  1YQ4 A;  2ZZB A;  3ABV A;  1DOD A;  4EMW A;  3DJD A;  1OJD A;  2DKH A;  4U8J A;  3AE3 A;  2CUL A;  2AR8 A;  3L1R A;  4GR1 A;  4YXD A;  3T2Z A;  4H4X A;  4J34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...