2UZZA

X-ray structure of n-methyl-l-tryptophan oxidase (mtox)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
KYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKYVPLVLRAQMLWDELSRHNEDDPIFVRSGVINLGPADSTFLANVAHSAEQWQLNVEKLDAQGIMARWPEIRVPDNYIGLFETDSGFLRSELAIKTWIQLAKEAGCAQLFNCPVTAIRHDDDGVTIETADGEYQAKKAIVCAGTWVKDLLPELPVQPVRKVFAWYQADGRYSVKNKFPAFTGELPNGDQYYGFPAENDALKIGKHNGGQVIHSADERVPFAEVVSDGSEAFPFLRNVLPGIGCCLYGAACTYDNSPDEDFIIDTLPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSDFDLTPFRLSRFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords N-METHYL-L-TRYPTOPHAN OXIDASE
total genus 97
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.5.3.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 2uzzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2uzzA01
3DJEA 3G3EA 1LPFA 4IA5A 4AOXA 1S3BA 5CQFA 1M6IA 2J3NA 3NG7X 1H83A 3QFBA 2Z5XA 1PJ5A 3SGLA 2Q0LA 3ALJA 3NNEA 4BV6A 5JCKA 1ONFA 3K7MX 4BURA 2VZ2A 4YSXA 1OJAA 1RSGA 3I6DA 3R9UA 1PXAA 3AD8B 3LJPA 5HY5A 4XXGA 4X4JA 4USQA 2YLTA 1Q1WA 1GTHA 1O94A 3GYJA 2GQWA 1EBDA 2JB1A 2A8XA 1K0IA 5C2TA 2WDVA 1CBOA 3UOXA 1FEAA 4YJHB 1TDOA 3OZ2A 3P4SA 4YWOA 1IJHA 1GSNA 3NHOX 2FJEA 2WU5A 4GR1A 4YJGB 5TR3A 3CIRA 5BRTA 5EB5A 4C74A 2WPEA 2H88A 1D4DA 4HA6A 4TLXA 4EMWA 2XLPA 2XLRA 3IWAA 3UTHA 3FG2P 2XFPA 1E39A 3ICRA 1TYTA 5HHFA 4QFDA 3O0HA 3AEEA 4YTMA 4RG4A 3NYCA 1YQZA 2WU2A 3UKKA 4A6NB 1KNRA 3UOZA 3LOVA 3UOVA 4Y4NA 1CJCA 4J56A 4Z43A 3G5RA 1PJ7A 3L8KA 4NEVA 1DNCA 3UP4A 1NDAA 1BGJA 2ZZBA 3VQRA 2DU8A 2V3AA 3CPHG 3GMBA 3F8PA 4H50A 1CL0A 4H4XA 5LV9A 5GSNA 3QVPA 4IA6A 4Z24A 4OPLA 4H4UA 3IF9A 2R0CA 1Q9IA 2XVFA 3KD9A 3V76A 3UOYA 4H2RA 2BC1A 3B3RA 4JNAA 2AAQA 1GETA 4JY2A 5EBKA 5FS6A 3RNMA 2Q7VA 3ATRA 2AQJA 1IUTA 4OPCA 1CF3A 3LB8A 2HQMA 3AE2A 3RP8A 4A9WA 1VG0A 2R0PA 3AEFA 4K8DA 2OA1A 4BK1A 3UKPA 1GV4A 3F8RA 2B76A 5KVHA 2YG7A 2YM2A 4JDRA 3AE1A 1Z6LA 2Y6RA 4YJFA 4BK2A 1YY5A 3DGHA 1DJNA 2UZZA 4YJDA 3AEBA 4CCQA 1ZKQA 3EANA 1Q1RA 4X9NA 1TYPA 1D7LA 4K5RA 1CJ3A 4YTPA 5U1OA 1VRQB 3V3OA 3SFDA 2IVDA 5BUKA 3G5SA 3C96A 4H2NA 2R4JA 5KRQA 5EB4A 1PJ6A 1LTXR 1NHPA 2IVEA 2AR8A 3AEAA 1BGNA 3NYEA 1SEZA 4ICYA 4IVOB 4JNQA 2GF3A 2GAHB 1H84A 2XLSA 4OPGA 2GEWA 5HYMA 2YVJA 4A7AA 2YR4A 4YKFA 2BS2A 3M0OA 1AN9A 1NG4A 4BJYA 1ELIA 4U8OA 4C3XA 2QAEA 3CPIG 3WGTA 3ALMA 3GDNA 3S5WA 3AXBA 1BWCA 4U8JA 1NHSA 1IUWA 1DAOA 5FMHA 1GESA 4BK3A 1O5WA 3ADAB 4KX6A 3BI2A 4K5SA 1COYA 3KU9A 1KFYA 1JU2A 3CNDA 4Z2RA 3EF6A 1Y56B 2ZBWA 1NEKA 3COXA 1GOSA 3G5QA 4RG3A 1GRHA 3UKQA 1NG3A 5BULA 2DKHA 3P4QA 2CDUA 4UDPA 1N4VA 1DDOA 3M12A 4HB9A 2E1MA 2Q0KA 4NTCA 2JK6A 1PXCA 1NPXA 4OCGA 4LA1A 1ZY8A 2YLRA 3NIXA 4FK1A 5CKUA 2XFNA 1KIFA 5L46A 3L1RA 4IV9A 4ZN0A 1GALA 2VRLA 3DJJA 3P1WA 1CC2A 2FJBA 4X9MA 3CPJG 3P4PA 4I58A 3AD9B 4NZHA 4OPIA 4U2SA 5FS8A 3W4IA 4Z25A 3AD7B 1YKJA 1IUXA 1B4VA 1N4UA 4DSHA 2GR2A 4O5UA 4N9XA 1H82A 4D03A 3HZLA 4TM0A 2B7SA 1MOKA 1LJ1A 2XFQA 1VE9A 2X99A 2R45A 1HYUA 5HXIA 3UTEA 1GERA 4E0VA 4EQSA 2YR6A 1OJ9A 1B8SA 1GRGA 2BS3A 1S3EA 4U8NA 1E6EA 3ZNNA 2CULA 4U8IA 3H4KA 4YKGA 1JRXA 2PHHA 1S2YA 3B6DA 5KXJA 4LU6A 1F3PA 3GWFA 4YSZA 2C66A 4D04A 4OPTA 4B69A 5M0ZA 4Z44A 1GRFA 4B63A 2B9YA 3CNJA 3ITJA 1E1MA 3GRTA 5EOWA 3FIMB 3RHAA 4BJZA 4XWZA 4UDQA 3AYJA 2BYBA 3D1CA 2Z5YA 4NEWA 2EQ6A 4YJHA 2EQ7A 3DJDA 2FJAA 2VOUA 4A6NA 4EIQA 2BK5A 2TMDA 2YG5A 1F8RA 1ZMDA 1FCDA 1D7YA 2ACZA 2WP5A 3PO7A 2JBVA 4NTDA 1ZOYA 4EM4A 1P2EA 2YAUA 4TM3A 3UKFA 1N4WA 1FOHA 2V6OA 1GXFA 3H8LA 2NVKX 3DJGX 5IQ1A 2C76A 2W0HA 1P2HA 3AB1A 4Y4LA 3LZWA 4FX9A 1S2QA 4H4SA 2X8CA 3UTFA 2VVMA 3CGEA 1XHCA 4JY3A 4CNJA 3DH9A 1PBDA 2GR0A 1L0VA 3BHFA 1TRBA 4LIIA 1CJ4A 3ATQA 1OJCA 3WE0A 4A5LA 4H4RA 2BA9A 4B64A 3K7QX 4RSLA 1OJTA 3W4JA 3KVEA 4TM4A 2YLWA 4KPRA 1GRBA 3UP5A 1PBEA 1NHRA 3QSEA 2GR1A 3S61A 4YXDA 1CC6A 2FBWA 3PS9A 2BCPA 2VRMA 1KDGA 1JRYA 3UTGA 4J2WA 2GRTA 4UP3A 2CVJA 4EQXA 2VVLG 4Z2UA 2WQYA 3AE9A 4JQ9A 2XDOA 1BF3A 4A65A 1IUSA 4A79A 1FECA 2X8GA 3C4AA 2YG6A 2WP9A 3CN8A 4AT2A 4AOSA 1PXBA 3NYFA 2C73A 3GWDA 1OJDA 4J36A 3QSMA 5M10A 4FK1C 4A99A 2GB0A 4C77A 1B5QA 1FL2A 2C67A 1E7PA 4K2XA 4U8MA 3ZYXA 3ZNQA 1F6MA 1ZX9A 2BXSA 4TM1A 5KOWA 4EMJA 1H81A 4H4ZA 5KOXA 4QFCA 1CHUA 4EMIA 3CUKA 3E1TA 2Q6UA 1RP0A 4H2QA 3EPTA 1EL7A 3GYIA 2WESA 3NT6A 1GNDA 2GAGB 1NENA 4ZCCA 2ZZ0A 5KWFA 1EL8A 4GRTA 2YVFA 1KSUA 1C0LA 2RABA 2X50A 1QJDA 1PDHA 4EIPA 3D8XA 2JKCA 3M13A 3VRAA 3AE7A 5U25A 2PYXA 3NN6X 2OLOA 3AECA 1ZMCA 3UCLA 1LQTA 2C75A 4U2LA 3UKHA 3PVCA 1DODA 2E82A 4J33A 3SQPA 4OPUA 3T37A 2GR3A 2YG4A 2RGOA 2WOWA 1E1NA 1Y56A 2XLTA 3VRDB 3BNUA 1DOEA 2WDQA 4J57A 2EQ8A 3NK2X 1ZP0A 3AE5A 1L9CA 4OVIA 2VQBA 2I0ZA 2VVLA 3BI5A 3AE4A 3NGCX 4GF7A 1PBFA 1REOA 2YLZA 4Y4MA 3ABVA 1MXTA 2C7GA 3NTDA 2VQ7A 2BC0A 1K4QA 5FS9A 4B66A 1TDNA 1VQWA 4OPDA 1PHHA 3AYLA 2XCGA 1KNPA 2JB3A 2ARDA 2NPXA 2C64A 2E4GA 3K7TA 2JB2A 2O9ZA 1PS9A 1DJQA 4C5OA 4YSHA 3KA7A 3FBSA 4DGKA 1CC4A 4DNAA 1GRAA 3IC9A 4U8LA 2XVIA 3BI4A 2YM1A 2R4EA 2WDRA 2V60A 2TPRA 2APGA 2V61A 3BNMA 3GRSA 3DMEA 4YSYA 3VRBA 3NK1X 4UDRA 5JCMA 2BS4A 2GMJA 1UKVG 3CGDA 1DOBA 3GSIA 4PAAA 2BK3A 3C4NA 3AYIA 4TLZA 4YTNA 4O5QA 1RYIA 2E49A 4CY8A 3ISHA 4K7ZA 4IVMB 5KVIA 4MJWA 3QVRA 3NKSA 4APNA 2XVEA 3NK0X 4REKA 3EAOA 1Y0PA 4CY6A 3LADA 5DBJA 2WS3A 2X8HA 4USRA 4YJGA 4PABA 3DGZA 4JN9A 4B67A 4H4QA 3OC4A 3NN0X 1BZLA 2YR5A 1EVIA 5J7XA 2BACA 2BK4A 3AEDA 2WBAA 2OAMA 2YQUA 4H4WA 5ER0A 1L9EA 1JNZA 3CNPA 3ZNOA 1X31B 4WCTA 1NAAA 1MO9A 4C3YA 3DA1A 1ZDLA 3LXDA 3F8DA 4GDEA 1JOAA 3CTYA 1JRZA 4FDCB 3DK8A 4Z26A 4J34A 1IUUA 4EQRA 1JEHA 4ADWA 2RGJA 2X3NA 1GRTA 3GD4A 5C3JA 1EL5A 2E48A 2YLSA 3UKLA 3QJ4A 4CNKA 3UKAA 4U8PA 3CGCA 5GRTA 3REDA 1CJ2A 1QO8A 3FMWA 1D5TA 2RGHA 4H4VA 3AWIA 3ZNPA 4U2TA 4CCRA 1H7WA 1PBBA 1C0IA 1D4EA 2H89A 2QA2A 5U63A 3CNSA 3FPZA 2WETA 4H4PA 1TDEA 2IIDA 4J31A 1W4XA 2GVCA 3LZXA 4P9SA 5JCLA 1DXLA 3AE3A 2EQ9A 4AP1A 1TDFA 2OALA 2C70A 4NTEA 4YJFB 2BXRA 3NLCA 1E1KA 3ICSA 1AOGA 3AE8A 4B65A 4CRTA 1ZOVA 4H4YA 5IPYA 2QCUA 3W4KA 2GMHA 3NTAA 2YG3A 1F8SA 3ZDNA 3I3LA 1GREA 3ICTA 3QFAA 4ECHA 1GTEA 1YQ4A 3H8IA 1B37A 1JNRA 3SFEA 1YQ3A 2BABA 1PBCA 1K0LA 1GT8A 1PN0A 2BCGG 2A89A 2A87A 2FJDA 2WOIA 2Y6QA 3AEGA 4B1BA 4EM3A 2XYOA 1KSSA 3GD3A 2WPCA 3CNTA 2JAEA 3URHA 2R9ZA 2V5ZA 4GCMA 5FS7A 5J60A 2E5VA 2WEUA 2E4AA 2YVGA 3DK9A 1FEBA 1F8WA 4DSGA 5JCNA 3BHKA 3JSKA 2GQFA 3VR9A 3QSSA 4GUVA 4I59A 4WX1A 3IHMA 4AP3A 2F5ZA 1QLBA 2GV8A 1V59A 2XFOA 2XVHA 3VR8A 2C65A 4H7UA 1VG9A 2XLUA 2R0GA 5BVAA 4ZCDA 4AT0A 1EL9A 2WP6A 3KLJA 1DOCA 2CFYA 1BKWA 1K0JA 2R46A 1GEUA 3ALLA 2YWLA 3KKJA 2XFUA 4B68A 4K22A 1ZK7A 2B7RA 3IHGA 4GDPA 1C0KA 4XWRA 1LVLA 1GPEA 1H6VA 3KPFA 2C72A 3P9UA 2V3BA 1IUVA 2WPFA 3Q6JA 4M52A 1O95A 2OLNA 1LV0A 2XVJA 3GMCA 2B9WA 4Z2TA 1XDIA 1NHQA 3RP6A 3K30A 2B9XA 1E1LA 3II4A 1H86A 2YLXA 4U8KA 2C3CA 2WOVA 2ZZCA 3P4RA 4H4TA 4EQWA 2GH5A 1C0PA 3DK4A 1N1PA 2C3DA 3V3NA 1KF6A 2QA1A 3Q9TA 3NH3X 2WHDA 3NRNA 4CBQA 4YT0A 3GDPA 3CGBA 1M64A 1D4CA 1XPQA 1XANA 2DKIA 3SM8A 4H2PA 1LQUA 5JCIA 3AE6A 1H7XA 1VDCA 1L9DA 3RP7A 1TDKA 5IQ4A
chains in the Genus database with same CATH superfamily
3DJEA 3G3EA 1LPFA 4IA5A 4AOXA 1S3BA 5CQFA 1M6IA 2J3NA 3NG7X 1H83A 3QFBA 2Z5XA 1PJ5A 3ALJA 3SGLA 2Q0LA 3NNEA 4BV6A 5JCKA 1ONFA 3K7MX 4BURA 2VZ2A 4YSXA 1OJAA 1RSGA 3I6DA 3R9UA 1PXAA 3AD8B 3LJPA 5HY5A 4XXGA 4X4JA 4USQA 2YLTA 1Q1WA 1GTHA 1O94A 3GYJA 2GQWA 1EBDA 2JB1A 2A8XA 1K0IA 5C2TA 2WDVA 1CBOA 3UOXA 1FEAA 4YJHB 1TDOA 3OZ2A 3P4SA 4YWOA 1IJHA 1GSNA 3NHOX 2FJEA 2WU5A 4GR1A 4YJGB 5TR3A 3CIRA 5BRTA 5EB5A 4C74A 2WPEA 2H88A 1D4DA 4HA6A 4TLXA 4EMWA 2XLPA 2XLRA 3IWAA 3UTHA 3FG2P 2XFPA 1E39A 3ICRA 1TYTA 5HHFA 4QFDA 3O0HA 3AEEA 4YTMA 4RG4A 3NYCA 1YQZA 2WU2A 3UKKA 4A6NB 1KNRA 3UOZA 3LOVA 3UOVA 4Y4NA 1CJCA 4J56A 4Z43A 3G5RA 1PJ7A 3L8KA 4NEVA 1DNCA 3UP4A 1NDAA 1BGJA 2ZZBA 3GMBA 2DU8A 3VQRA 2V3AA 3CPHG 3F8PA 3KPKA 4H50A 1CL0A 4H4XA 5LV9A 5GSNA 3QVPA 4IA6A 4Z24A 4OPLA 4H4UA 3IF9A 2R0CA 1Q9IA 2XVFA 3KD9A 3V76A 3SZCA 3UOYA 4H2RA 2BC1A 3B3RA 4JNAA 2AAQA 1GETA 4JY2A 5EBKA 5FS6A 3RNMA 2Q7VA 3ATRA 4G74A 2AQJA 1IUTA 3RP8A 1CF3A 3LB8A 2HQMA 3AE2A 4OPCA 4A9WA 1VG0A 2R0PA 3AEFA 4K8DA 2OA1A 3T2KA 4BK1A 3UKPA 1GV4A 3F8RA 2B76A 5KVHA 2YG7A 2YM2A 4JDRA 3AE1A 1Z6LA 2Y6RA 4YJFA 4BK2A 1YY5A 3DGHA 1DJNA 2UZZA 4YJDA 3AEBA 3SZ0A 4CCQA 1ZKQA 3EANA 1Q1RA 2C4CA 4X9NA 1TYPA 1D7LA 3SZWA 4K5RA 1CJ3A 4YTPA 5U1OA 1VRQB 3V3OA 3SFDA 3SY4A 2IVDA 5BUKA 3G5SA 3C96A 4H2NA 2R4JA 5KRQA 5EB4A 1PJ6A 1LTXR 1NHPA 2IVEA 2AR8A 3AEAA 1BGNA 3NYEA 1SEZA 4ICYA 4IVOB 4JNQA 2GF3A 2GAHB 5HYMA 1H84A 2XLSA 2GEWA 4OPGA 2YVJA 4A7AA 2YR4A 4YKFA 2BS2A 4G73A 3M0OA 1AN9A 1NG4A 4BJYA 1ELIA 4U8OA 4C3XA 2QAEA 3CPIG 5KNLA 3WGTA 3SZFA 3ALMA 3GDNA 3S5WA 3AXBA 1BWCA 4U8JA 1NHSA 1IUWA 1DAOA 4BK3A 1GESA 5FMHA 1O5WA 3ADAB 4KX6A 3BI2A 4K5SA 1COYA 3KU9A 1KFYA 1JU2A 3CNDA 4Z2RA 3EF6A 1Y56B 2ZBWA 1NEKA 3COXA 1GOSA 3G5QA 4RG3A 1GRHA 3UKQA 1NG3A 5BULA 2DKHA 3P4QA 2CDUA 4UDPA 3T2ZA 1N4VA 1DDOA 3M12A 4HB9A 2E1MA 2Q0KA 4NTCA 3HYVA 2JK6A 1PXCA 1NPXA 4OCGA 4LA1A 1ZY8A 2YLRA 3NIXA 4FK1A 5CKUA 2XFNA 1KIFA 5L46A 3L1RA 4IV9A 4ZN0A 1GALA 2VRLA 3DJJA 3P1WA 1CC2A 2FJBA 4X9MA 3CPJG 3P4PA 4I58A 3AD9B 4NZHA 4OPIA 4U2SA 5FS8A 3W4IA 4Z25A 3AD7B 1YKJA 1IUXA 1B4VA 1N4UA 4GAVA 4DSHA 2GR2A 4O5UA 4N9XA 1H82A 4D03A 3HZLA 4TM0A 2B7SA 1MOKA 1LJ1A 2XFQA 1VE9A 2X99A 2R45A 5HXIA 1HYUA 3UTEA 1GERA 4E0VA 4EQSA 2YR6A 1OJ9A 1B8SA 1GRGA 2BS3A 1S3EA 4U8NA 1E6EA 3ZNNA 2CULA 4U8IA 3H4KA 4YKGA 1JRXA 2PHHA 1S2YA 3B6DA 5KXJA 4LU6A 1F3PA 3GWFA 4YSZA 2C66A 3T0KA 4D04A 4OPTA 4B69A 5M0ZA 4Z44A 1GRFA 4B63A 2B9YA 3CNJA 3ITJA 1E1MA 3GRTA 5EOWA 3FIMB 3RHAA 4BJZA 4XWZA 4UDQA 3AYJA 2BYBA 3D1CA 2Z5YA 4NEWA 2EQ6A 2VOUA 4YJHA 3DJDA 4EIQA 2EQ7A 2FJAA 4A6NA 2BK5A 2TMDA 2YG5A 1F8RA 1ZMDA 2BRYA 1FCDA 1D7YA 2ACZA 2WP5A 3PO7A 2JBVA 4NTDA 1ZOYA 4EM4A 1P2EA 2YAUA 4TM3A 3UKFA 1N4WA 1FOHA 2V6OA 1GXFA 3H8LA 2NVKX 3DJGX 5IQ1A 2C76A 2W0HA 1P2HA 3AB1A 4Y4LA 4NNJA 3LZWA 4FX9A 1S2QA 4H4SA 2X8CA 3T31A 3UTFA 2VVMA 5KMRA 4JY3A 1XHCA 3CGEA 4CNJA 3DH9A 1PBDA 2GR0A 1L0VA 3BHFA 1TRBA 4LIIA 1CJ4A 3ATQA 1OJCA 3WE0A 4A5LA 4H4RA 2BA9A 4B64A 3K7QX 4RSLA 1OJTA 3W4JA 3KVEA 4TM4A 2YLWA 4KPRA 1GRBA 3SX6A 3UP5A 1PBEA 1NHRA 3QSEA 2GR1A 3S61A 4YXDA 1CC6A 2FBWA 3PS9A 2BCPA 2VRMA 1KDGA 3T14A 1JRYA 3UTGA 4J2WA 2GRTA 4UP3A 2CVJA 4EQXA 2VVLG 4Z2UA 2WQYA 3AE9A 4JQ9A 2XDOA 1BF3A 4A65A 1IUSA 4A79A 1FECA 2X8GA 3C4AA 2YG6A 2WP9A 3CN8A 4AT2A 4AOSA 1PXBA 3NYFA 2C73A 3GWDA 1OJDA 4J36A 3QSMA 5M10A 4FK1C 4A99A 2GB0A 4C77A 1B5QA 1FL2A 2C67A 1E7PA 4K2XA 4U8MA 3ZYXA 3ZNQA 1F6MA 1ZX9A 2BXSA 4TM1A 5KOWA 4EMJA 1H81A 4H4ZA 5KOXA 4QFCA 1CHUA 4EMIA 3CUKA 3E1TA 2Q6UA 1RP0A 4H2QA 3EPTA 1EL7A 3GYIA 2WESA 3NT6A 1GNDA 2GAGB 1NENA 4ZCCA 2ZZ0A 5KWFA 1EL8A 3HYXA 4GRTA 2YVFA 1KSUA 1C0LA 2RABA 2X50A 4II2A 3SXIA 1QJDA 1PDHA 4EIPA 3D8XA 2JKCA 3M13A 3VRAA 3AE7A 5U25A 2PYXA 3NN6X 2OLOA 3AECA 1ZMCA 3UCLA 1LQTA 2C75A 4U2LA 3UKHA 3PVCA 1DODA 2E82A 4J33A 3SQPA 4OPUA 3T37A 2GR3A 2YG4A 2RGOA 2WOWA 1E1NA 1Y56A 2XLTA 3VRDB 3BNUA 1DOEA 2WDQA 4J57A 2EQ8A 3NK2X 1ZP0A 3AE5A 1L9CA 4OVIA 2VQBA 2I0ZA 2VVLA 3BI5A 3AE4A 3NGCX 4GF7A 1PBFA 1REOA 2YLZA 4Y4MA 3ABVA 1MXTA 2C7GA 3NTDA 2VQ7A 2BC0A 1K4QA 5FS9A 4B66A 1TDNA 3CMMA 1VQWA 4OPDA 1PHHA 3AYLA 2XCGA 1KNPA 2JB3A 2ARDA 2NPXA 2C64A 2E4GA 3K7TA 2JB2A 2O9ZA 1PS9A 1DJQA 4C5OA 4YSHA 3KA7A 3FBSA 4DGKA 1CC4A 4G6GA 4DNAA 1GRAA 3IC9A 4U8LA 2XVIA 3BI4A 2YM1A 2R4EA 2WDRA 2V60A 2TPRA 2APGA 2V61A 3BNMA 3GRSA 3DMEA 4YSYA 3VRBA 3NK1X 4UDRA 5JCMA 2BS4A 2GMJA 1UKVG 3CGDA 1DOBA 3GYXA 3GSIA 4PAAA 2BK3A 3C4NA 3AYIA 4TLZA 4YTNA 4O5QA 1RYIA 2E49A 4CY8A 3ISHA 4K7ZA 4IVMB 5KVIA 4MJWA 3QVRA 3NKSA 5KMQA 4APNA 2XVEA 3NK0X 4REKA 3EAOA 1Y0PA 4CY6A 3LADA 5DBJA 2WS3A 2X8HA 4USRA 4YJGA 4PABA 3DGZA 4JN9A 4B67A 4H4QA 3OC4A 3T2YA 3NN0X 1BZLA 2YR5A 4GAPA 1EVIA 5J7XA 2BACA 2BK4A 3AEDA 2WBAA 2OAMA 2YQUA 4H4WA 5ER0A 1L9EA 1JNZA 3CNPA 3ZNOA 1X31B 4WCTA 1NAAA 1MO9A 4C3YA 3DA1A 1ZDLA 3LXDA 3F8DA 4GDEA 1JOAA 3CTYA 1JRZA 4FDCB 3DK8A 4Z26A 3SYIA 4J34A 1IUUA 4EQRA 1JEHA 2BRAA 4ADWA 2RGJA 2X3NA 1GRTA 3GD4A 5C3JA 1EL5A 2E48A 2YLSA 3UKLA 3QJ4A 4CNKA 3UKAA 4U8PA 3CGCA 5GRTA 3REDA 1CJ2A 1QO8A 3FMWA 4NWZA 1D5TA 2RGHA 4H4VA 3AWIA 3ZNPA 4U2TA 4CCRA 1H7WA 1PBBA 1C0IA 1D4EA 2H89A 2QA2A 5U63A 3CNSA 3FPZA 2WETA 4H4PA 1TDEA 2IIDA 4J31A 1W4XA 2GVCA 3LZXA 4P9SA 5JCLA 1DXLA 3AE3A 2EQ9A 4AP1A 4II3A 1TDFA 2OALA 2C70A 4NTEA 5KMSA 4YJFB 2BXRA 3NLCA 1E1KA 3ICSA 1AOGA 3AE8A 4B65A 4CRTA 1ZOVA 4H4YA 5IPYA 2GMHA 2QCUA 3W4KA 3NTAA 2YG3A 1F8SA 3ZDNA 3I3LA 1GREA 3ICTA 3QFAA 4ECHA 1GTEA 1YQ4A 3H8IA 1B37A 1JNRA 3SFEA 1YQ3A 2BABA 1PBCA 1K0LA 1GT8A 1PN0A 2BCGG 2A89A 2A87A 2FJDA 2WOIA 2Y6QA 3AEGA 4B1BA 4EM3A 2XYOA 1KSSA 3GD3A 2WPCA 3CNTA 2JAEA 3URHA 2R9ZA 2V5ZA 4GCMA 5FS7A 5J60A 2E5VA 2WEUA 2E4AA 2YVGA 3DK9A 1FEBA 1F8WA 4DSGA 5JCNA 3BHKA 3JSKA 2GQFA 3VR9A 3QSSA 4GUVA 4I59A 4WX1A 3IHMA 4AP3A 2F5ZA 1QLBA 2GV8A 1V59A 2XFOA 2XVHA 3VR8A 2C65A 4H7UA 1VG9A 2XLUA 2R0GA 5BVAA 4ZCDA 4AT0A 1EL9A 2WP6A 3KLJA 1DOCA 2CFYA 1BKWA 1K0JA 2R46A 3ALLA 1GEUA 2YWLA 3HYWA 2XFUA 3KKJA 4K22A 4B68A 1ZK7A 2B7RA 3IHGA 4GDPA 1C0KA 4XWRA 1LVLA 1GPEA 1H6VA 3KPFA 2C72A 3P9UA 2V3BA 1IUVA 2WPFA 3Q6JA 4M52A 1O95A 2OLNA 1LV0A 2XVJA 3GMCA 2B9WA 4Z2TA 1XDIA 1NHQA 3RP6A 3K30A 4G6HA 2B9XA 1E1LA 3II4A 1H86A 2YLXA 4U8KA 2C3CA 2WOVA 2ZZCA 4G9KA 3P4RA 4H4TA 4EQWA 2GH5A 1C0PA 3DK4A 1N1PA 2C3DA 3V3NA 1KF6A 2QA1A 3Q9TA 3NH3X 2WHDA 3NRNA 4CBQA 4YT0A 3GDPA 3CGBA 1M64A 1D4CA 1XPQA 1XANA 2DKIA 4H2PA 3SM8A 1LQUA 5JCIA 3AE6A 1H7XA 1VDCA 1L9DA 3RP7A 1TDKA 5KMPA 5IQ4A
chains in the Genus database with same CATH topology
3DJEA 3G3EA 1LPFA 4IA5A 4AOXA 1S3BA 5CQFA 1M6IA 2J3NA 3NG7X 1H83A 3QFBA 2Z5XA 1PJ5A 3SGLA 2Q0LA 3ALJA 3NNEA 4BV6A 5JCKA 1ONFA 3K7MX 4BURA 2VZ2A 4YSXA 1OJAA 1RSGA 3I6DA 3R9UA 1PXAA 3AD8B 3LJPA 5HY5A 4XXGA 4X4JA 4USQA 2YLTA 1Q1WA 1GTHA 1O94A 3GYJA 2GQWA 1EBDA 2JB1A 2A8XA 1K0IA 5C2TA 2WDVA 1CBOA 3UOXA 1FEAA 4YJHB 1TDOA 3OZ2A 3P4SA 4YWOA 1IJHA 1GSNA 3NHOX 2FJEA 2WU5A 4GR1A 4YJGB 5TR3A 3CIRA 5BRTA 5EB5A 4C74A 2WPEA 2H88A 1D4DA 4HA6A 4TLXA 4EMWA 2XLPA 2XLRA 3IWAA 3UTHA 3FG2P 2XFPA 1E39A 3ICRA 1TYTA 5HHFA 4QFDA 3O0HA 3AEEA 4YTMA 4RG4A 3NYCA 1YQZA 2WU2A 3UKKA 4A6NB 1KNRA 3UOZA 3LOVA 3UOVA 4Y4NA 1CJCA 4J56A 4Z43A 3G5RA 1PJ7A 3L8KA 4NEVA 1DNCA 3UP4A 1NDAA 1BGJA 2ZZBA 3VQRA 2DU8A 2V3AA 3CPHG 3GMBA 3F8PA 3KPKA 4H50A 1CL0A 4H4XA 5LV9A 5GSNA 3QVPA 4IA6A 4Z24A 4OPLA 4H4UA 3IF9A 2R0CA 1Q9IA 2XVFA 3KD9A 3V76A 3SZCA 3UOYA 4H2RA 2BC1A 3B3RA 4JNAA 2AAQA 1GETA 4JY2A 5EBKA 5FS6A 3RNMA 2Q7VA 3ATRA 4G74A 2AQJA 1IUTA 4OPCA 1CF3A 3LB8A 2HQMA 3AE2A 3RP8A 4A9WA 1VG0A 2R0PA 3AEFA 4K8DA 2OA1A 3T2KA 4BK1A 3UKPA 1GV4A 3F8RA 2B76A 5KVHA 2YG7A 2YM2A 4JDRA 3AE1A 1Z6LA 2Y6RA 4YJFA 4BK2A 1YY5A 3DGHA 1DJNA 2UZZA 4YJDA 3AEBA 3SZ0A 4CCQA 1ZKQA 3EANA 1Q1RA 2C4CA 4X9NA 1TYPA 1D7LA 3SZWA 4K5RA 1CJ3A 4YTPA 5U1OA 1VRQB 3V3OA 3SFDA 3SY4A 2IVDA 5BUKA 3G5SA 3C96A 4H2NA 2R4JA 5KRQA 5EB4A 1PJ6A 1LTXR 1NHPA 2IVEA 2AR8A 3AEAA 1BGNA 3NYEA 1SEZA 4ICYA 4IVOB 4JNQA 2GF3A 2GAHB 1H84A 2XLSA 4OPGA 2GEWA 5HYMA 2YVJA 4A7AA 2YR4A 4YKFA 2BS2A 4G73A 3M0OA 1AN9A 1NG4A 4BJYA 1ELIA 4U8OA 4C3XA 2QAEA 3CPIG 5KNLA 3WGTA 3SZFA 3ALMA 3GDNA 3S5WA 3AXBA 1BWCA 4U8JA 1NHSA 1IUWA 1DAOA 5FMHA 1GESA 4BK3A 1O5WA 3ADAB 4KX6A 3BI2A 4K5SA 1COYA 3KU9A 1KFYA 1JU2A 3CNDA 4Z2RA 3EF6A 1Y56B 2ZBWA 1NEKA 3COXA 1GOSA 3G5QA 4RG3A 1GRHA 3UKQA 1NG3A 5BULA 2DKHA 3P4QA 2CDUA 4UDPA 3T2ZA 1N4VA 1DDOA 3M12A 4HB9A 2E1MA 2Q0KA 4NTCA 3HYVA 2JK6A 1PXCA 1NPXA 4OCGA 4LA1A 1ZY8A 2YLRA 3NIXA 4FK1A 5CKUA 2XFNA 1KIFA 5L46A 3L1RA 4IV9A 4ZN0A 1GALA 2VRLA 3DJJA 3P1WA 1CC2A 2FJBA 4X9MA 3CPJG 3P4PA 4I58A 3AD9B 4NZHA 4OPIA 4U2SA 5FS8A 3W4IA 4Z25A 3AD7B 1YKJA 1IUXA 1B4VA 1N4UA 4GAVA 4DSHA 2GR2A 4O5UA 4N9XA 1H82A 4D03A 3HZLA 4TM0A 2B7SA 1MOKA 1LJ1A 2XFQA 1VE9A 2X99A 2R45A 1HYUA 5HXIA 3UTEA 1GERA 4E0VA 4EQSA 2YR6A 1OJ9A 1B8SA 1GRGA 2BS3A 1S3EA 4U8NA 1E6EA 3ZNNA 2CULA 4U8IA 3H4KA 4YKGA 1JRXA 2PHHA 1S2YA 3B6DA 5KXJA 4LU6A 1F3PA 3GWFA 4YSZA 2C66A 3T0KA 4D04A 4OPTA 4B69A 5M0ZA 4Z44A 1GRFA 4B63A 2B9YA 3CNJA 3ITJA 1E1MA 3GRTA 5EOWA 3FIMB 3RHAA 4BJZA 4XWZA 4UDQA 3AYJA 2BYBA 3D1CA 2Z5YA 4NEWA 2EQ6A 4YJHA 2EQ7A 3DJDA 2FJAA 2VOUA 4A6NA 4EIQA 2BK5A 2TMDA 2YG5A 1F8RA 1ZMDA 2BRYA 1FCDA 1D7YA 2ACZA 2WP5A 3PO7A 2JBVA 4NTDA 1ZOYA 4EM4A 1P2EA 2YAUA 4TM3A 3UKFA 1N4WA 1FOHA 2V6OA 1GXFA 3H8LA 2NVKX 3DJGX 5IQ1A 2C76A 2W0HA 1P2HA 3AB1A 4Y4LA 4NNJA 3LZWA 4FX9A 1S2QA 4H4SA 2X8CA 3T31A 3UTFA 2VVMA 5KMRA 3CGEA 1XHCA 4JY3A 4CNJA 3DH9A 1PBDA 2GR0A 1L0VA 3BHFA 1TRBA 4LIIA 1CJ4A 3ATQA 1OJCA 3WE0A 4A5LA 4H4RA 2BA9A 4B64A 3K7QX 4RSLA 1OJTA 3W4JA 3KVEA 4TM4A 2YLWA 4KPRA 1GRBA 3SX6A 3UP5A 1PBEA 1NHRA 3QSEA 2GR1A 3S61A 4YXDA 1CC6A 2FBWA 3PS9A 2BCPA 2VRMA 1KDGA 3T14A 1JRYA 3UTGA 4J2WA 2GRTA 4UP3A 2CVJA 4EQXA 2VVLG 4Z2UA 2WQYA 3AE9A 4JQ9A 2XDOA 1BF3A 4A65A 1IUSA 4A79A 1FECA 2X8GA 3C4AA 2YG6A 2WP9A 3CN8A 4AT2A 4AOSA 1PXBA 3NYFA 2C73A 3GWDA 1OJDA 4J36A 3QSMA 5M10A 4FK1C 4A99A 2GB0A 4C77A 1B5QA 1FL2A 2C67A 1E7PA 4K2XA 4U8MA 3ZYXA 3ZNQA 1F6MA 1ZX9A 2BXSA 4TM1A 5KOWA 4EMJA 1H81A 4H4ZA 5KOXA 4QFCA 1CHUA 4EMIA 3CUKA 3E1TA 2Q6UA 1RP0A 4H2QA 3EPTA 1EL7A 3GYIA 2WESA 3NT6A 1GNDA 2GAGB 1NENA 4ZCCA 2ZZ0A 5KWFA 1EL8A 3HYXA 4GRTA 2YVFA 1KSUA 1C0LA 2RABA 2X50A 4II2A 3SXIA 1QJDA 1PDHA 4EIPA 3D8XA 2JKCA 3M13A 3VRAA 3AE7A 5U25A 2PYXA 3NN6X 2OLOA 3AECA 1ZMCA 3UCLA 1LQTA 2C75A 4U2LA 3UKHA 3PVCA 1DODA 2E82A 4J33A 3SQPA 4OPUA 3T37A 2GR3A 2YG4A 2RGOA 2WOWA 1E1NA 1Y56A 2XLTA 3VRDB 3BNUA 1DOEA 2WDQA 4J57A 2EQ8A 3NK2X 1ZP0A 3AE5A 1L9CA 4OVIA 2VQBA 2I0ZA 2VVLA 3BI5A 3AE4A 3NGCX 4GF7A 1PBFA 1REOA 2YLZA 4Y4MA 3ABVA 1MXTA 2C7GA 3NTDA 2VQ7A 2BC0A 1K4QA 5FS9A 4B66A 1TDNA 3CMMA 1VQWA 4OPDA 1PHHA 3AYLA 2XCGA 1KNPA 2JB3A 2ARDA 2NPXA 2C64A 2E4GA 3K7TA 2JB2A 2O9ZA 1PS9A 1DJQA 4C5OA 4YSHA 3KA7A 3FBSA 4DGKA 1CC4A 4G6GA 4DNAA 1GRAA 3IC9A 4U8LA 2XVIA 3BI4A 2YM1A 2R4EA 2WDRA 2V60A 2TPRA 2APGA 2V61A 3BNMA 3GRSA 3DMEA 4YSYA 3VRBA 3NK1X 4UDRA 5JCMA 2BS4A 2GMJA 1UKVG 3CGDA 1DOBA 3GYXA 3GSIA 4PAAA 2BK3A 3C4NA 3AYIA 4TLZA 4YTNA 4O5QA 1RYIA 2E49A 4CY8A 3ISHA 4K7ZA 4IVMB 5KVIA 4MJWA 3QVRA 3NKSA 5KMQA 4APNA 2XVEA 3NK0X 4REKA 3EAOA 1Y0PA 4CY6A 3LADA 5DBJA 2WS3A 2X8HA 4USRA 4YJGA 4PABA 3DGZA 4JN9A 4B67A 4H4QA 3OC4A 3T2YA 3NN0X 1BZLA 2YR5A 4GAPA 1EVIA 5J7XA 2BACA 2BK4A 3AEDA 2WBAA 2OAMA 2YQUA 4H4WA 5ER0A 1L9EA 1JNZA 3CNPA 3ZNOA 1X31B 4WCTA 1NAAA 1MO9A 4C3YA 3DA1A 1ZDLA 3LXDA 3F8DA 4GDEA 1JOAA 3CTYA 1JRZA 4FDCB 3DK8A 4Z26A 3SYIA 4J34A 1IUUA 4EQRA 1JEHA 2BRAA 4ADWA 2RGJA 2X3NA 1GRTA 3GD4A 5C3JA 1EL5A 2E48A 2YLSA 3UKLA 3QJ4A 4CNKA 3UKAA 4U8PA 3CGCA 5GRTA 3REDA 1CJ2A 1QO8A 3FMWA 4NWZA 1D5TA 2RGHA 4H4VA 3AWIA 3ZNPA 4U2TA 4CCRA 1H7WA 1PBBA 1C0IA 1D4EA 2H89A 2QA2A 5U63A 3CNSA 3FPZA 2WETA 4H4PA 1TDEA 2IIDA 4J31A 1W4XA 2GVCA 3LZXA 4P9SA 5JCLA 1DXLA 3AE3A 2EQ9A 4AP1A 4II3A 1TDFA 2OALA 2C70A 4NTEA 5KMSA 4YJFB 2BXRA 3NLCA 1E1KA 3ICSA 1AOGA 3AE8A 4B65A 4CRTA 1ZOVA 4H4YA 5IPYA 2QCUA 3W4KA 2GMHA 3NTAA 2YG3A 1F8SA 3ZDNA 3I3LA 1GREA 3ICTA 3QFAA 4ECHA 1GTEA 1YQ4A 3H8IA 1B37A 1JNRA 3SFEA 1YQ3A 2BABA 1PBCA 1K0LA 1GT8A 1PN0A 2BCGG 2A89A 2A87A 2FJDA 2WOIA 2Y6QA 3AEGA 4B1BA 4EM3A 2XYOA 1KSSA 3GD3A 2WPCA 3CNTA 2JAEA 3URHA 2R9ZA 2V5ZA 4GCMA 5FS7A 5J60A 2E5VA 2WEUA 2E4AA 2YVGA 3DK9A 1FEBA 1F8WA 4DSGA 5JCNA 3BHKA 3JSKA 2GQFA 3VR9A 3QSSA 4GUVA 4I59A 4WX1A 3IHMA 4AP3A 2F5ZA 1QLBA 2GV8A 1V59A 2XFOA 2XVHA 3VR8A 2C65A 4H7UA 1VG9A 2XLUA 2R0GA 5BVAA 4ZCDA 4AT0A 1EL9A 2WP6A 3KLJA 1DOCA 2CFYA 1BKWA 1K0JA 2R46A 1GEUA 3ALLA 2YWLA 3HYWA 2XFUA 3KKJA 4K22A 4B68A 1ZK7A 2B7RA 3IHGA 4GDPA 1C0KA 4XWRA 1LVLA 1GPEA 1H6VA 3KPFA 2C72A 3P9UA 2V3BA 1IUVA 2WPFA 3Q6JA 4M52A 1O95A 2OLNA 1LV0A 2XVJA 3GMCA 2B9WA 4Z2TA 1XDIA 1NHQA 3RP6A 3K30A 4G6HA 2B9XA 1E1LA 3II4A 1H86A 2YLXA 4U8KA 2C3CA 2WOVA 2ZZCA 4G9KA 3P4RA 4H4TA 4EQWA 2GH5A 1C0PA 3DK4A 1N1PA 2C3DA 3V3NA 1KF6A 2QA1A 3Q9TA 3NH3X 2WHDA 3NRNA 4CBQA 4YT0A 3GDPA 3CGBA 1M64A 1D4CA 1XPQA 1XANA 2DKIA 3SM8A 4H2PA 1LQUA 5JCIA 3AE6A 1H7XA 1VDCA 1L9DA 3RP7A 1TDKA 5KMPA 5IQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJE A;  3G3E A;  1LPF A;  4IA5 A;  4AOX A;  1S3B A;  5CQF A;  1M6I A;  2J3N A;  3NG7 X;  1H83 A;  3QFB A;  2Z5X A;  1PJ5 A;  3SGL A;  2Q0L A;  3ALJ A;  3NNE A;  4BV6 A;  5JCK A;  1ONF A;  3K7M X;  4BUR A;  2VZ2 A;  4YSX A;  1OJA A;  1RSG A;  3I6D A;  3R9U A;  1PXA A;  3AD8 B;  3LJP A;  5HY5 A;  4XXG A;  4X4J A;  4USQ A;  2YLT A;  1Q1W A;  1GTH A;  1O94 A;  3GYJ A;  2GQW A;  1EBD A;  2JB1 A;  2A8X A;  1K0I A;  5C2T A;  2WDV A;  1CBO A;  3UOX A;  1FEA A;  4YJH B;  1TDO A;  3OZ2 A;  3P4S A;  4YWO A;  1IJH A;  1GSN A;  3NHO X;  2FJE A;  2WU5 A;  4GR1 A;  4YJG B;  5TR3 A;  3CIR A;  5BRT A;  5EB5 A;  4C74 A;  2WPE A;  2H88 A;  1D4D A;  4HA6 A;  4TLX A;  4EMW A;  2XLP A;  2XLR A;  3IWA A;  3UTH A;  3FG2 P;  2XFP A;  1E39 A;  3ICR A;  1TYT A;  5HHF A;  4QFD A;  3O0H A;  3AEE A;  4YTM A;  4RG4 A;  3NYC A;  1YQZ A;  2WU2 A;  3UKK A;  4A6N B;  1KNR A;  3UOZ A;  3LOV A;  3UOV A;  4Y4N A;  1CJC A;  4J56 A;  4Z43 A;  3G5R A;  1PJ7 A;  3L8K A;  4NEV A;  1DNC A;  3UP4 A;  1NDA A;  1BGJ A;  2ZZB A;  3VQR A;  2DU8 A;  2V3A A;  3CPH G;  3GMB A;  3F8P A;  4H50 A;  1CL0 A;  4H4X A;  5LV9 A;  5GSN A;  3QVP A;  4IA6 A;  4Z24 A;  4OPL A;  4H4U A;  3IF9 A;  2R0C A;  1Q9I A;  2XVF A;  3KD9 A;  3V76 A;  3UOY A;  4H2R A;  2BC1 A;  3B3R A;  4JNA A;  2AAQ A;  1GET A;  4JY2 A;  5EBK A;  5FS6 A;  3RNM A;  2Q7V A;  3ATR A;  2AQJ A;  1IUT A;  4OPC A;  1CF3 A;  3LB8 A;  2HQM A;  3AE2 A;  3RP8 A;  4A9W A;  1VG0 A;  2R0P A;  3AEF A;  4K8D A;  2OA1 A;  4BK1 A;  3UKP A;  1GV4 A;  3F8R A;  2B76 A;  5KVH A;  2YG7 A;  2YM2 A;  4JDR A;  3AE1 A;  1Z6L A;  2Y6R A;  4YJF A;  4BK2 A;  1YY5 A;  3DGH A;  1DJN A;  2UZZ A;  4YJD A;  3AEB A;  4CCQ A;  1ZKQ A;  3EAN A;  1Q1R A;  4X9N A;  1TYP A;  1D7L A;  4K5R A;  1CJ3 A;  4YTP A;  5U1O A;  1VRQ B;  3V3O A;  3SFD A;  2IVD A;  5BUK A;  3G5S A;  3C96 A;  4H2N A;  2R4J A;  5KRQ A;  5EB4 A;  1PJ6 A;  1LTX R;  1NHP A;  2IVE A;  2AR8 A;  3AEA A;  1BGN A;  3NYE A;  1SEZ A;  4ICY A;  4IVO B;  4JNQ A;  2GF3 A;  2GAH B;  1H84 A;  2XLS A;  4OPG A;  2GEW A;  5HYM A;  2YVJ A;  4A7A A;  2YR4 A;  4YKF A;  2BS2 A;  3M0O A;  1AN9 A;  1NG4 A;  4BJY A;  1ELI A;  4U8O A;  4C3X A;  2QAE A;  3CPI G;  3WGT A;  3ALM A;  3GDN A;  3S5W A;  3AXB A;  1BWC A;  4U8J A;  1NHS A;  1IUW A;  1DAO A;  5FMH A;  1GES A;  4BK3 A;  1O5W A;  3ADA B;  4KX6 A;  3BI2 A;  4K5S A;  1COY A;  3KU9 A;  1KFY A;  1JU2 A;  3CND A;  4Z2R A;  3EF6 A;  1Y56 B;  2ZBW A;  1NEK A;  3COX A;  1GOS A;  3G5Q A;  4RG3 A;  1GRH A;  3UKQ A;  1NG3 A;  5BUL A;  2DKH A;  3P4Q A;  2CDU A;  4UDP A;  1N4V A;  1DDO A;  3M12 A;  4HB9 A;  2E1M A;  2Q0K A;  4NTC A;  2JK6 A;  1PXC A;  1NPX A;  4OCG A;  4LA1 A;  1ZY8 A;  2YLR A;  3NIX A;  4FK1 A;  5CKU A;  2XFN A;  1KIF A;  5L46 A;  3L1R A;  4IV9 A;  4ZN0 A;  1GAL A;  2VRL A;  3DJJ A;  3P1W A;  1CC2 A;  2FJB A;  4X9M A;  3CPJ G;  3P4P A;  4I58 A;  3AD9 B;  4NZH A;  4OPI A;  4U2S A;  5FS8 A;  3W4I A;  4Z25 A;  3AD7 B;  1YKJ A;  1IUX A;  1B4V A;  1N4U A;  4DSH A;  2GR2 A;  4O5U A;  4N9X A;  1H82 A;  4D03 A;  3HZL A;  4TM0 A;  2B7S A;  1MOK A;  1LJ1 A;  2XFQ A;  1VE9 A;  2X99 A;  2R45 A;  1HYU A;  5HXI A;  3UTE A;  1GER A;  4E0V A;  4EQS A;  2YR6 A;  1OJ9 A;  1B8S A;  1GRG A;  2BS3 A;  1S3E A;  4U8N A;  1E6E A;  3ZNN A;  2CUL A;  4U8I A;  3H4K A;  4YKG A;  1JRX A;  2PHH A;  1S2Y A;  3B6D A;  5KXJ A;  4LU6 A;  1F3P A;  3GWF A;  4YSZ A;  2C66 A;  4D04 A;  4OPT A;  4B69 A;  5M0Z A;  4Z44 A;  1GRF A;  4B63 A;  2B9Y A;  3CNJ A;  3ITJ A;  1E1M A;  3GRT A;  5EOW A;  3FIM B;  3RHA A;  4BJZ A;  4XWZ A;  4UDQ A;  3AYJ A;  2BYB A;  3D1C A;  2Z5Y A;  4NEW A;  2EQ6 A;  4YJH A;  2EQ7 A;  3DJD A;  2FJA A;  2VOU A;  4A6N A;  4EIQ A;  2BK5 A;  2TMD A;  2YG5 A;  1F8R A;  1ZMD A;  1FCD A;  1D7Y A;  2ACZ A;  2WP5 A;  3PO7 A;  2JBV A;  4NTD A;  1ZOY A;  4EM4 A;  1P2E A;  2YAU A;  4TM3 A;  3UKF A;  1N4W A;  1FOH A;  2V6O A;  1GXF A;  3H8L A;  2NVK X;  3DJG X;  5IQ1 A;  2C76 A;  2W0H A;  1P2H A;  3AB1 A;  4Y4L A;  3LZW A;  4FX9 A;  1S2Q A;  4H4S A;  2X8C A;  3UTF A;  2VVM A;  3CGE A;  1XHC A;  4JY3 A;  4CNJ A;  3DH9 A;  1PBD A;  2GR0 A;  1L0V A;  3BHF A;  1TRB A;  4LII A;  1CJ4 A;  3ATQ A;  1OJC A;  3WE0 A;  4A5L A;  4H4R A;  2BA9 A;  4B64 A;  3K7Q X;  4RSL A;  1OJT A;  3W4J A;  3KVE A;  4TM4 A;  2YLW A;  4KPR A;  1GRB A;  3UP5 A;  1PBE A;  1NHR A;  3QSE A;  2GR1 A;  3S61 A;  4YXD A;  1CC6 A;  2FBW A;  3PS9 A;  2BCP A;  2VRM A;  1KDG A;  1JRY A;  3UTG A;  4J2W A;  2GRT A;  4UP3 A;  2CVJ A;  4EQX A;  2VVL G;  4Z2U A;  2WQY A;  3AE9 A;  4JQ9 A;  2XDO A;  1BF3 A;  4A65 A;  1IUS A;  4A79 A;  1FEC A;  2X8G A;  3C4A A;  2YG6 A;  2WP9 A;  3CN8 A;  4AT2 A;  4AOS A;  1PXB A;  3NYF A;  2C73 A;  3GWD A;  1OJD A;  4J36 A;  3QSM A;  5M10 A;  4FK1 C;  4A99 A;  2GB0 A;  4C77 A;  1B5Q A;  1FL2 A;  2C67 A;  1E7P A;  4K2X A;  4U8M A;  3ZYX A;  3ZNQ A;  1F6M A;  1ZX9 A;  2BXS A;  4TM1 A;  5KOW A;  4EMJ A;  1H81 A;  4H4Z A;  5KOX A;  4QFC A;  1CHU A;  4EMI A;  3CUK A;  3E1T A;  2Q6U A;  1RP0 A;  4H2Q A;  3EPT A;  1EL7 A;  3GYI A;  2WES A;  3NT6 A;  1GND A;  2GAG B;  1NEN A;  4ZCC A;  2ZZ0 A;  5KWF A;  1EL8 A;  4GRT A;  2YVF A;  1KSU A;  1C0L A;  2RAB A;  2X50 A;  1QJD A;  1PDH A;  4EIP A;  3D8X A;  2JKC A;  3M13 A;  3VRA A;  3AE7 A;  5U25 A;  2PYX A;  3NN6 X;  2OLO A;  3AEC A;  1ZMC A;  3UCL A;  1LQT A;  2C75 A;  4U2L A;  3UKH A;  3PVC A;  1DOD A;  2E82 A;  4J33 A;  3SQP A;  4OPU A;  3T37 A;  2GR3 A;  2YG4 A;  2RGO A;  2WOW A;  1E1N A;  1Y56 A;  2XLT A;  3VRD B;  3BNU A;  1DOE A;  2WDQ A;  4J57 A;  2EQ8 A;  3NK2 X;  1ZP0 A;  3AE5 A;  1L9C A;  4OVI A;  2VQB A;  2I0Z A;  2VVL A;  3BI5 A;  3AE4 A;  3NGC X;  4GF7 A;  1PBF A;  1REO A;  2YLZ A;  4Y4M A;  3ABV A;  1MXT A;  2C7G A;  3NTD A;  2VQ7 A;  2BC0 A;  1K4Q A;  5FS9 A;  4B66 A;  1TDN A;  1VQW A;  4OPD A;  1PHH A;  3AYL A;  2XCG A;  1KNP A;  2JB3 A;  2ARD A;  2NPX A;  2C64 A;  2E4G A;  3K7T A;  2JB2 A;  2O9Z A;  1PS9 A;  1DJQ A;  4C5O A;  4YSH A;  3KA7 A;  3FBS A;  4DGK A;  1CC4 A;  4DNA A;  1GRA A;  3IC9 A;  4U8L A;  2XVI A;  3BI4 A;  2YM1 A;  2R4E A;  2WDR A;  2V60 A;  2TPR A;  2APG A;  2V61 A;  3BNM A;  3GRS A;  3DME A;  4YSY A;  3VRB A;  3NK1 X;  4UDR A;  5JCM A;  2BS4 A;  2GMJ A;  1UKV G;  3CGD A;  1DOB A;  3GSI A;  4PAA A;  2BK3 A;  3C4N A;  3AYI A;  4TLZ A;  4YTN A;  4O5Q A;  1RYI A;  2E49 A;  4CY8 A;  3ISH A;  4K7Z A;  4IVM B;  5KVI A;  4MJW A;  3QVR A;  3NKS A;  4APN A;  2XVE A;  3NK0 X;  4REK A;  3EAO A;  1Y0P A;  4CY6 A;  3LAD A;  5DBJ A;  2WS3 A;  2X8H A;  4USR A;  4YJG A;  4PAB A;  3DGZ A;  4JN9 A;  4B67 A;  4H4Q A;  3OC4 A;  3NN0 X;  1BZL A;  2YR5 A;  1EVI A;  5J7X A;  2BAC A;  2BK4 A;  3AED A;  2WBA A;  2OAM A;  2YQU A;  4H4W A;  5ER0 A;  1L9E A;  1JNZ A;  3CNP A;  3ZNO A;  1X31 B;  4WCT A;  1NAA A;  1MO9 A;  4C3Y A;  3DA1 A;  1ZDL A;  3LXD A;  3F8D A;  4GDE A;  1JOA A;  3CTY A;  1JRZ A;  4FDC B;  3DK8 A;  4Z26 A;  4J34 A;  1IUU A;  4EQR A;  1JEH A;  4ADW A;  2RGJ A;  2X3N A;  1GRT A;  3GD4 A;  5C3J A;  1EL5 A;  2E48 A;  2YLS A;  3UKL A;  3QJ4 A;  4CNK A;  3UKA A;  4U8P A;  3CGC A;  5GRT A;  3RED A;  1CJ2 A;  1QO8 A;  3FMW A;  1D5T A;  2RGH A;  4H4V A;  3AWI A;  3ZNP A;  4U2T A;  4CCR A;  1H7W A;  1PBB A;  1C0I A;  1D4E A;  2H89 A;  2QA2 A;  5U63 A;  3CNS A;  3FPZ A;  2WET A;  4H4P A;  1TDE A;  2IID A;  4J31 A;  1W4X A;  2GVC A;  3LZX A;  4P9S A;  5JCL A;  1DXL A;  3AE3 A;  2EQ9 A;  4AP1 A;  1TDF A;  2OAL A;  2C70 A;  4NTE A;  4YJF B;  2BXR A;  3NLC A;  1E1K A;  3ICS A;  1AOG A;  3AE8 A;  4B65 A;  4CRT A;  1ZOV A;  4H4Y A;  5IPY A;  2QCU A;  3W4K A;  2GMH A;  3NTA A;  2YG3 A;  1F8S A;  3ZDN A;  3I3L A;  1GRE A;  3ICT A;  3QFA A;  4ECH A;  1GTE A;  1YQ4 A;  3H8I A;  1B37 A;  1JNR A;  3SFE A;  1YQ3 A;  2BAB A;  1PBC A;  1K0L A;  1GT8 A;  1PN0 A;  2BCG G;  2A89 A;  2A87 A;  2FJD A;  2WOI A;  2Y6Q A;  3AEG A;  4B1B A;  4EM3 A;  2XYO A;  1KSS A;  3GD3 A;  2WPC A;  3CNT A;  2JAE A;  3URH A;  2R9Z A;  2V5Z A;  4GCM A;  5FS7 A;  5J60 A;  2E5V A;  2WEU A;  2E4A A;  2YVG A;  3DK9 A;  1FEB A;  1F8W A;  4DSG A;  5JCN A;  3BHK A;  3JSK A;  2GQF A;  3VR9 A;  3QSS A;  4GUV A;  4I59 A;  4WX1 A;  3IHM A;  4AP3 A;  2F5Z A;  1QLB A;  2GV8 A;  1V59 A;  2XFO A;  2XVH A;  3VR8 A;  2C65 A;  4H7U A;  1VG9 A;  2XLU A;  2R0G A;  5BVA A;  4ZCD A;  4AT0 A;  1EL9 A;  2WP6 A;  3KLJ A;  1DOC A;  2CFY A;  1BKW A;  1K0J A;  2R46 A;  1GEU A;  3ALL A;  2YWL A;  3KKJ A;  2XFU A;  4B68 A;  4K22 A;  1ZK7 A;  2B7R A;  3IHG A;  4GDP A;  1C0K A;  4XWR A;  1LVL A;  1GPE A;  1H6V A;  3KPF A;  2C72 A;  3P9U A;  2V3B A;  1IUV A;  2WPF A;  3Q6J A;  4M52 A;  1O95 A;  2OLN A;  1LV0 A;  2XVJ A;  3GMC A;  2B9W A;  4Z2T A;  1XDI A;  1NHQ A;  3RP6 A;  3K30 A;  2B9X A;  1E1L A;  3II4 A;  1H86 A;  2YLX A;  4U8K A;  2C3C A;  2WOV A;  2ZZC A;  3P4R A;  4H4T A;  4EQW A;  2GH5 A;  1C0P A;  3DK4 A;  1N1P A;  2C3D A;  3V3N A;  1KF6 A;  2QA1 A;  3Q9T A;  3NH3 X;  2WHD A;  3NRN A;  4CBQ A;  4YT0 A;  3GDP A;  3CGB A;  1M64 A;  1D4C A;  1XPQ A;  1XAN A;  2DKI A;  3SM8 A;  4H2P A;  1LQU A;  5JCI A;  3AE6 A;  1H7X A;  1VDC A;  1L9D A;  3RP7 A;  1TDK A;  5IQ4 A; 
#chains in the Genus database with same CATH topology
 3DJE A;  3G3E A;  1LPF A;  4IA5 A;  4AOX A;  1S3B A;  5CQF A;  1M6I A;  2J3N A;  3NG7 X;  1H83 A;  3QFB A;  2Z5X A;  1PJ5 A;  3ALJ A;  3SGL A;  2Q0L A;  3NNE A;  4BV6 A;  5JCK A;  1ONF A;  3K7M X;  4BUR A;  2VZ2 A;  4YSX A;  1OJA A;  1RSG A;  3I6D A;  3R9U A;  1PXA A;  3AD8 B;  3LJP A;  5HY5 A;  4XXG A;  4X4J A;  4USQ A;  2YLT A;  1Q1W A;  1GTH A;  1O94 A;  3GYJ A;  2GQW A;  1EBD A;  2JB1 A;  2A8X A;  1K0I A;  5C2T A;  2WDV A;  1CBO A;  3UOX A;  1FEA A;  4YJH B;  1TDO A;  3OZ2 A;  3P4S A;  4YWO A;  1IJH A;  1GSN A;  3NHO X;  2FJE A;  2WU5 A;  4GR1 A;  4YJG B;  5TR3 A;  3CIR A;  5BRT A;  5EB5 A;  4C74 A;  2WPE A;  2H88 A;  1D4D A;  4HA6 A;  4TLX A;  4EMW A;  2XLP A;  2XLR A;  3IWA A;  3UTH A;  3FG2 P;  2XFP A;  1E39 A;  3ICR A;  1TYT A;  5HHF A;  4QFD A;  3O0H A;  3AEE A;  4YTM A;  4RG4 A;  3NYC A;  1YQZ A;  2WU2 A;  3UKK A;  4A6N B;  1KNR A;  3UOZ A;  3LOV A;  3UOV A;  4Y4N A;  1CJC A;  4J56 A;  4Z43 A;  3G5R A;  1PJ7 A;  3L8K A;  4NEV A;  1DNC A;  3UP4 A;  1NDA A;  1BGJ A;  2ZZB A;  3GMB A;  2DU8 A;  3VQR A;  2V3A A;  3CPH G;  3F8P A;  3KPK A;  4H50 A;  1CL0 A;  4H4X A;  5LV9 A;  5GSN A;  3QVP A;  4IA6 A;  4Z24 A;  4OPL A;  4H4U A;  3IF9 A;  2R0C A;  1Q9I A;  2XVF A;  3KD9 A;  3V76 A;  3SZC A;  3UOY A;  4H2R A;  2BC1 A;  3B3R A;  4JNA A;  2AAQ A;  1GET A;  4JY2 A;  5EBK A;  5FS6 A;  3RNM A;  2Q7V A;  3ATR A;  4G74 A;  2AQJ A;  1IUT A;  3RP8 A;  1CF3 A;  3LB8 A;  2HQM A;  3AE2 A;  4OPC A;  4A9W A;  1VG0 A;  2R0P A;  3AEF A;  4K8D A;  2OA1 A;  3T2K A;  4BK1 A;  3UKP A;  1GV4 A;  3F8R A;  2B76 A;  5KVH A;  2YG7 A;  2YM2 A;  4JDR A;  3AE1 A;  1Z6L A;  2Y6R A;  4YJF A;  4BK2 A;  1YY5 A;  3DGH A;  1DJN A;  2UZZ A;  4YJD A;  3AEB A;  3SZ0 A;  4CCQ A;  1ZKQ A;  3EAN A;  1Q1R A;  2C4C A;  4X9N A;  1TYP A;  1D7L A;  3SZW A;  4K5R A;  1CJ3 A;  4YTP A;  5U1O A;  1VRQ B;  3V3O A;  3SFD A;  3SY4 A;  2IVD A;  5BUK A;  3G5S A;  3C96 A;  4H2N A;  2R4J A;  5KRQ A;  5EB4 A;  1PJ6 A;  1LTX R;  1NHP A;  2IVE A;  2AR8 A;  3AEA A;  1BGN A;  3NYE A;  1SEZ A;  4ICY A;  4IVO B;  4JNQ A;  2GF3 A;  2GAH B;  5HYM A;  1H84 A;  2XLS A;  2GEW A;  4OPG A;  2YVJ A;  4A7A A;  2YR4 A;  4YKF A;  2BS2 A;  4G73 A;  3M0O A;  1AN9 A;  1NG4 A;  4BJY A;  1ELI A;  4U8O A;  4C3X A;  2QAE A;  3CPI G;  5KNL A;  3WGT A;  3SZF A;  3ALM A;  3GDN A;  3S5W A;  3AXB A;  1BWC A;  4U8J A;  1NHS A;  1IUW A;  1DAO A;  4BK3 A;  1GES A;  5FMH A;  1O5W A;  3ADA B;  4KX6 A;  3BI2 A;  4K5S A;  1COY A;  3KU9 A;  1KFY A;  1JU2 A;  3CND A;  4Z2R A;  3EF6 A;  1Y56 B;  2ZBW A;  1NEK A;  3COX A;  1GOS A;  3G5Q A;  4RG3 A;  1GRH A;  3UKQ A;  1NG3 A;  5BUL A;  2DKH A;  3P4Q A;  2CDU A;  4UDP A;  3T2Z A;  1N4V A;  1DDO A;  3M12 A;  4HB9 A;  2E1M A;  2Q0K A;  4NTC A;  3HYV A;  2JK6 A;  1PXC A;  1NPX A;  4OCG A;  4LA1 A;  1ZY8 A;  2YLR A;  3NIX A;  4FK1 A;  5CKU A;  2XFN A;  1KIF A;  5L46 A;  3L1R A;  4IV9 A;  4ZN0 A;  1GAL A;  2VRL A;  3DJJ A;  3P1W A;  1CC2 A;  2FJB A;  4X9M A;  3CPJ G;  3P4P A;  4I58 A;  3AD9 B;  4NZH A;  4OPI A;  4U2S A;  5FS8 A;  3W4I A;  4Z25 A;  3AD7 B;  1YKJ A;  1IUX A;  1B4V A;  1N4U A;  4GAV A;  4DSH A;  2GR2 A;  4O5U A;  4N9X A;  1H82 A;  4D03 A;  3HZL A;  4TM0 A;  2B7S A;  1MOK A;  1LJ1 A;  2XFQ A;  1VE9 A;  2X99 A;  2R45 A;  5HXI A;  1HYU A;  3UTE A;  1GER A;  4E0V A;  4EQS A;  2YR6 A;  1OJ9 A;  1B8S A;  1GRG A;  2BS3 A;  1S3E A;  4U8N A;  1E6E A;  3ZNN A;  2CUL A;  4U8I A;  3H4K A;  4YKG A;  1JRX A;  2PHH A;  1S2Y A;  3B6D A;  5KXJ A;  4LU6 A;  1F3P A;  3GWF A;  4YSZ A;  2C66 A;  3T0K A;  4D04 A;  4OPT A;  4B69 A;  5M0Z A;  4Z44 A;  1GRF A;  4B63 A;  2B9Y A;  3CNJ A;  3ITJ A;  1E1M A;  3GRT A;  5EOW A;  3FIM B;  3RHA A;  4BJZ A;  4XWZ A;  4UDQ A;  3AYJ A;  2BYB A;  3D1C A;  2Z5Y A;  4NEW A;  2EQ6 A;  2VOU A;  4YJH A;  3DJD A;  4EIQ A;  2EQ7 A;  2FJA A;  4A6N A;  2BK5 A;  2TMD A;  2YG5 A;  1F8R A;  1ZMD A;  2BRY A;  1FCD A;  1D7Y A;  2ACZ A;  2WP5 A;  3PO7 A;  2JBV A;  4NTD A;  1ZOY A;  4EM4 A;  1P2E A;  2YAU A;  4TM3 A;  3UKF A;  1N4W A;  1FOH A;  2V6O A;  1GXF A;  3H8L A;  2NVK X;  3DJG X;  5IQ1 A;  2C76 A;  2W0H A;  1P2H A;  3AB1 A;  4Y4L A;  4NNJ A;  3LZW A;  4FX9 A;  1S2Q A;  4H4S A;  2X8C A;  3T31 A;  3UTF A;  2VVM A;  5KMR A;  4JY3 A;  1XHC A;  3CGE A;  4CNJ A;  3DH9 A;  1PBD A;  2GR0 A;  1L0V A;  3BHF A;  1TRB A;  4LII A;  1CJ4 A;  3ATQ A;  1OJC A;  3WE0 A;  4A5L A;  4H4R A;  2BA9 A;  4B64 A;  3K7Q X;  4RSL A;  1OJT A;  3W4J A;  3KVE A;  4TM4 A;  2YLW A;  4KPR A;  1GRB A;  3SX6 A;  3UP5 A;  1PBE A;  1NHR A;  3QSE A;  2GR1 A;  3S61 A;  4YXD A;  1CC6 A;  2FBW A;  3PS9 A;  2BCP A;  2VRM A;  1KDG A;  3T14 A;  1JRY A;  3UTG A;  4J2W A;  2GRT A;  4UP3 A;  2CVJ A;  4EQX A;  2VVL G;  4Z2U A;  2WQY A;  3AE9 A;  4JQ9 A;  2XDO A;  1BF3 A;  4A65 A;  1IUS A;  4A79 A;  1FEC A;  2X8G A;  3C4A A;  2YG6 A;  2WP9 A;  3CN8 A;  4AT2 A;  4AOS A;  1PXB A;  3NYF A;  2C73 A;  3GWD A;  1OJD A;  4J36 A;  3QSM A;  5M10 A;  4FK1 C;  4A99 A;  2GB0 A;  4C77 A;  1B5Q A;  1FL2 A;  2C67 A;  1E7P A;  4K2X A;  4U8M A;  3ZYX A;  3ZNQ A;  1F6M A;  1ZX9 A;  2BXS A;  4TM1 A;  5KOW A;  4EMJ A;  1H81 A;  4H4Z A;  5KOX A;  4QFC A;  1CHU A;  4EMI A;  3CUK A;  3E1T A;  2Q6U A;  1RP0 A;  4H2Q A;  3EPT A;  1EL7 A;  3GYI A;  2WES A;  3NT6 A;  1GND A;  2GAG B;  1NEN A;  4ZCC A;  2ZZ0 A;  5KWF A;  1EL8 A;  3HYX A;  4GRT A;  2YVF A;  1KSU A;  1C0L A;  2RAB A;  2X50 A;  4II2 A;  3SXI A;  1QJD A;  1PDH A;  4EIP A;  3D8X A;  2JKC A;  3M13 A;  3VRA A;  3AE7 A;  5U25 A;  2PYX A;  3NN6 X;  2OLO A;  3AEC A;  1ZMC A;  3UCL A;  1LQT A;  2C75 A;  4U2L A;  3UKH A;  3PVC A;  1DOD A;  2E82 A;  4J33 A;  3SQP A;  4OPU A;  3T37 A;  2GR3 A;  2YG4 A;  2RGO A;  2WOW A;  1E1N A;  1Y56 A;  2XLT A;  3VRD B;  3BNU A;  1DOE A;  2WDQ A;  4J57 A;  2EQ8 A;  3NK2 X;  1ZP0 A;  3AE5 A;  1L9C A;  4OVI A;  2VQB A;  2I0Z A;  2VVL A;  3BI5 A;  3AE4 A;  3NGC X;  4GF7 A;  1PBF A;  1REO A;  2YLZ A;  4Y4M A;  3ABV A;  1MXT A;  2C7G A;  3NTD A;  2VQ7 A;  2BC0 A;  1K4Q A;  5FS9 A;  4B66 A;  1TDN A;  3CMM A;  1VQW A;  4OPD A;  1PHH A;  3AYL A;  2XCG A;  1KNP A;  2JB3 A;  2ARD A;  2NPX A;  2C64 A;  2E4G A;  3K7T A;  2JB2 A;  2O9Z A;  1PS9 A;  1DJQ A;  4C5O A;  4YSH A;  3KA7 A;  3FBS A;  4DGK A;  1CC4 A;  4G6G A;  4DNA A;  1GRA A;  3IC9 A;  4U8L A;  2XVI A;  3BI4 A;  2YM1 A;  2R4E A;  2WDR A;  2V60 A;  2TPR A;  2APG A;  2V61 A;  3BNM A;  3GRS A;  3DME A;  4YSY A;  3VRB A;  3NK1 X;  4UDR A;  5JCM A;  2BS4 A;  2GMJ A;  1UKV G;  3CGD A;  1DOB A;  3GYX A;  3GSI A;  4PAA A;  2BK3 A;  3C4N A;  3AYI A;  4TLZ A;  4YTN A;  4O5Q A;  1RYI A;  2E49 A;  4CY8 A;  3ISH A;  4K7Z A;  4IVM B;  5KVI A;  4MJW A;  3QVR A;  3NKS A;  5KMQ A;  4APN A;  2XVE A;  3NK0 X;  4REK A;  3EAO A;  1Y0P A;  4CY6 A;  3LAD A;  5DBJ A;  2WS3 A;  2X8H A;  4USR A;  4YJG A;  4PAB A;  3DGZ A;  4JN9 A;  4B67 A;  4H4Q A;  3OC4 A;  3T2Y A;  3NN0 X;  1BZL A;  2YR5 A;  4GAP A;  1EVI A;  5J7X A;  2BAC A;  2BK4 A;  3AED A;  2WBA A;  2OAM A;  2YQU A;  4H4W A;  5ER0 A;  1L9E A;  1JNZ A;  3CNP A;  3ZNO A;  1X31 B;  4WCT A;  1NAA A;  1MO9 A;  4C3Y A;  3DA1 A;  1ZDL A;  3LXD A;  3F8D A;  4GDE A;  1JOA A;  3CTY A;  1JRZ A;  4FDC B;  3DK8 A;  4Z26 A;  3SYI A;  4J34 A;  1IUU A;  4EQR A;  1JEH A;  2BRA A;  4ADW A;  2RGJ A;  2X3N A;  1GRT A;  3GD4 A;  5C3J A;  1EL5 A;  2E48 A;  2YLS A;  3UKL A;  3QJ4 A;  4CNK A;  3UKA A;  4U8P A;  3CGC A;  5GRT A;  3RED A;  1CJ2 A;  1QO8 A;  3FMW A;  4NWZ A;  1D5T A;  2RGH A;  4H4V A;  3AWI A;  3ZNP A;  4U2T A;  4CCR A;  1H7W A;  1PBB A;  1C0I A;  1D4E A;  2H89 A;  2QA2 A;  5U63 A;  3CNS A;  3FPZ A;  2WET A;  4H4P A;  1TDE A;  2IID A;  4J31 A;  1W4X A;  2GVC A;  3LZX A;  4P9S A;  5JCL A;  1DXL A;  3AE3 A;  2EQ9 A;  4AP1 A;  4II3 A;  1TDF A;  2OAL A;  2C70 A;  4NTE A;  5KMS A;  4YJF B;  2BXR A;  3NLC A;  1E1K A;  3ICS A;  1AOG A;  3AE8 A;  4B65 A;  4CRT A;  1ZOV A;  4H4Y A;  5IPY A;  2GMH A;  2QCU A;  3W4K A;  3NTA A;  2YG3 A;  1F8S A;  3ZDN A;  3I3L A;  1GRE A;  3ICT A;  3QFA A;  4ECH A;  1GTE A;  1YQ4 A;  3H8I A;  1B37 A;  1JNR A;  3SFE A;  1YQ3 A;  2BAB A;  1PBC A;  1K0L A;  1GT8 A;  1PN0 A;  2BCG G;  2A89 A;  2A87 A;  2FJD A;  2WOI A;  2Y6Q A;  3AEG A;  4B1B A;  4EM3 A;  2XYO A;  1KSS A;  3GD3 A;  2WPC A;  3CNT A;  2JAE A;  3URH A;  2R9Z A;  2V5Z A;  4GCM A;  5FS7 A;  5J60 A;  2E5V A;  2WEU A;  2E4A A;  2YVG A;  3DK9 A;  1FEB A;  1F8W A;  4DSG A;  5JCN A;  3BHK A;  3JSK A;  2GQF A;  3VR9 A;  3QSS A;  4GUV A;  4I59 A;  4WX1 A;  3IHM A;  4AP3 A;  2F5Z A;  1QLB A;  2GV8 A;  1V59 A;  2XFO A;  2XVH A;  3VR8 A;  2C65 A;  4H7U A;  1VG9 A;  2XLU A;  2R0G A;  5BVA A;  4ZCD A;  4AT0 A;  1EL9 A;  2WP6 A;  3KLJ A;  1DOC A;  2CFY A;  1BKW A;  1K0J A;  2R46 A;  3ALL A;  1GEU A;  2YWL A;  3HYW A;  2XFU A;  3KKJ A;  4K22 A;  4B68 A;  1ZK7 A;  2B7R A;  3IHG A;  4GDP A;  1C0K A;  4XWR A;  1LVL A;  1GPE A;  1H6V A;  3KPF A;  2C72 A;  3P9U A;  2V3B A;  1IUV A;  2WPF A;  3Q6J A;  4M52 A;  1O95 A;  2OLN A;  1LV0 A;  2XVJ A;  3GMC A;  2B9W A;  4Z2T A;  1XDI A;  1NHQ A;  3RP6 A;  3K30 A;  4G6H A;  2B9X A;  1E1L A;  3II4 A;  1H86 A;  2YLX A;  4U8K A;  2C3C A;  2WOV A;  2ZZC A;  4G9K A;  3P4R A;  4H4T A;  4EQW A;  2GH5 A;  1C0P A;  3DK4 A;  1N1P A;  2C3D A;  3V3N A;  1KF6 A;  2QA1 A;  3Q9T A;  3NH3 X;  2WHD A;  3NRN A;  4CBQ A;  4YT0 A;  3GDP A;  3CGB A;  1M64 A;  1D4C A;  1XPQ A;  1XAN A;  2DKI A;  4H2P A;  3SM8 A;  1LQU A;  5JCI A;  3AE6 A;  1H7X A;  1VDC A;  1L9D A;  3RP7 A;  1TDK A;  5KMP A;  5IQ4 A; 
#chains in the Genus database with same CATH homology
 3DJE A;  3G3E A;  1LPF A;  4IA5 A;  4AOX A;  1S3B A;  5CQF A;  1M6I A;  2J3N A;  3NG7 X;  1H83 A;  3QFB A;  2Z5X A;  1PJ5 A;  3SGL A;  2Q0L A;  3ALJ A;  3NNE A;  4BV6 A;  5JCK A;  1ONF A;  3K7M X;  4BUR A;  2VZ2 A;  4YSX A;  1OJA A;  1RSG A;  3I6D A;  3R9U A;  1PXA A;  3AD8 B;  3LJP A;  5HY5 A;  4XXG A;  4X4J A;  4USQ A;  2YLT A;  1Q1W A;  1GTH A;  1O94 A;  3GYJ A;  2GQW A;  1EBD A;  2JB1 A;  2A8X A;  1K0I A;  5C2T A;  2WDV A;  1CBO A;  3UOX A;  1FEA A;  4YJH B;  1TDO A;  3OZ2 A;  3P4S A;  4YWO A;  1IJH A;  1GSN A;  3NHO X;  2FJE A;  2WU5 A;  4GR1 A;  4YJG B;  5TR3 A;  3CIR A;  5BRT A;  5EB5 A;  4C74 A;  2WPE A;  2H88 A;  1D4D A;  4HA6 A;  4TLX A;  4EMW A;  2XLP A;  2XLR A;  3IWA A;  3UTH A;  3FG2 P;  2XFP A;  1E39 A;  3ICR A;  1TYT A;  5HHF A;  4QFD A;  3O0H A;  3AEE A;  4YTM A;  4RG4 A;  3NYC A;  1YQZ A;  2WU2 A;  3UKK A;  4A6N B;  1KNR A;  3UOZ A;  3LOV A;  3UOV A;  4Y4N A;  1CJC A;  4J56 A;  4Z43 A;  3G5R A;  1PJ7 A;  3L8K A;  4NEV A;  1DNC A;  3UP4 A;  1NDA A;  1BGJ A;  2ZZB A;  3VQR A;  2DU8 A;  2V3A A;  3CPH G;  3GMB A;  3F8P A;  3KPK A;  4H50 A;  1CL0 A;  4H4X A;  5LV9 A;  5GSN A;  3QVP A;  4IA6 A;  4Z24 A;  4OPL A;  4H4U A;  3IF9 A;  2R0C A;  1Q9I A;  2XVF A;  3KD9 A;  3V76 A;  3SZC A;  3UOY A;  4H2R A;  2BC1 A;  3B3R A;  4JNA A;  2AAQ A;  1GET A;  4JY2 A;  5EBK A;  5FS6 A;  3RNM A;  2Q7V A;  3ATR A;  4G74 A;  2AQJ A;  1IUT A;  4OPC A;  1CF3 A;  3LB8 A;  2HQM A;  3AE2 A;  3RP8 A;  4A9W A;  1VG0 A;  2R0P A;  3AEF A;  4K8D A;  2OA1 A;  3T2K A;  4BK1 A;  3UKP A;  1GV4 A;  3F8R A;  2B76 A;  5KVH A;  2YG7 A;  2YM2 A;  4JDR A;  3AE1 A;  1Z6L A;  2Y6R A;  4YJF A;  4BK2 A;  1YY5 A;  3DGH A;  1DJN A;  2UZZ A;  4YJD A;  3AEB A;  3SZ0 A;  4CCQ A;  1ZKQ A;  3EAN A;  1Q1R A;  2C4C A;  4X9N A;  1TYP A;  1D7L A;  3SZW A;  4K5R A;  1CJ3 A;  4YTP A;  5U1O A;  1VRQ B;  3V3O A;  3SFD A;  3SY4 A;  2IVD A;  5BUK A;  3G5S A;  3C96 A;  4H2N A;  2R4J A;  5KRQ A;  5EB4 A;  1PJ6 A;  1LTX R;  1NHP A;  2IVE A;  2AR8 A;  3AEA A;  1BGN A;  3NYE A;  1SEZ A;  4ICY A;  4IVO B;  4JNQ A;  2GF3 A;  2GAH B;  1H84 A;  2XLS A;  4OPG A;  2GEW A;  5HYM A;  2YVJ A;  4A7A A;  2YR4 A;  4YKF A;  2BS2 A;  4G73 A;  3M0O A;  1AN9 A;  1NG4 A;  4BJY A;  1ELI A;  4U8O A;  4C3X A;  2QAE A;  3CPI G;  5KNL A;  3WGT A;  3SZF A;  3ALM A;  3GDN A;  3S5W A;  3AXB A;  1BWC A;  4U8J A;  1NHS A;  1IUW A;  1DAO A;  5FMH A;  1GES A;  4BK3 A;  1O5W A;  3ADA B;  4KX6 A;  3BI2 A;  4K5S A;  1COY A;  3KU9 A;  1KFY A;  1JU2 A;  3CND A;  4Z2R A;  3EF6 A;  1Y56 B;  2ZBW A;  1NEK A;  3COX A;  1GOS A;  3G5Q A;  4RG3 A;  1GRH A;  3UKQ A;  1NG3 A;  5BUL A;  2DKH A;  3P4Q A;  2CDU A;  4UDP A;  3T2Z A;  1N4V A;  1DDO A;  3M12 A;  4HB9 A;  2E1M A;  2Q0K A;  4NTC A;  3HYV A;  2JK6 A;  1PXC A;  1NPX A;  4OCG A;  4LA1 A;  1ZY8 A;  2YLR A;  3NIX A;  4FK1 A;  5CKU A;  2XFN A;  1KIF A;  5L46 A;  3L1R A;  4IV9 A;  4ZN0 A;  1GAL A;  2VRL A;  3DJJ A;  3P1W A;  1CC2 A;  2FJB A;  4X9M A;  3CPJ G;  3P4P A;  4I58 A;  3AD9 B;  4NZH A;  4OPI A;  4U2S A;  5FS8 A;  3W4I A;  4Z25 A;  3AD7 B;  1YKJ A;  1IUX A;  1B4V A;  1N4U A;  4GAV A;  4DSH A;  2GR2 A;  4O5U A;  4N9X A;  1H82 A;  4D03 A;  3HZL A;  4TM0 A;  2B7S A;  1MOK A;  1LJ1 A;  2XFQ A;  1VE9 A;  2X99 A;  2R45 A;  1HYU A;  5HXI A;  3UTE A;  1GER A;  4E0V A;  4EQS A;  2YR6 A;  1OJ9 A;  1B8S A;  1GRG A;  2BS3 A;  1S3E A;  4U8N A;  1E6E A;  3ZNN A;  2CUL A;  4U8I A;  3H4K A;  4YKG A;  1JRX A;  2PHH A;  1S2Y A;  3B6D A;  5KXJ A;  4LU6 A;  1F3P A;  3GWF A;  4YSZ A;  2C66 A;  3T0K A;  4D04 A;  4OPT A;  4B69 A;  5M0Z A;  4Z44 A;  1GRF A;  4B63 A;  2B9Y A;  3CNJ A;  3ITJ A;  1E1M A;  3GRT A;  5EOW A;  3FIM B;  3RHA A;  4BJZ A;  4XWZ A;  4UDQ A;  3AYJ A;  2BYB A;  3D1C A;  2Z5Y A;  4NEW A;  2EQ6 A;  4YJH A;  2EQ7 A;  3DJD A;  2FJA A;  2VOU A;  4A6N A;  4EIQ A;  2BK5 A;  2TMD A;  2YG5 A;  1F8R A;  1ZMD A;  2BRY A;  1FCD A;  1D7Y A;  2ACZ A;  2WP5 A;  3PO7 A;  2JBV A;  4NTD A;  1ZOY A;  4EM4 A;  1P2E A;  2YAU A;  4TM3 A;  3UKF A;  1N4W A;  1FOH A;  2V6O A;  1GXF A;  3H8L A;  2NVK X;  3DJG X;  5IQ1 A;  2C76 A;  2W0H A;  1P2H A;  3AB1 A;  4Y4L A;  4NNJ A;  3LZW A;  4FX9 A;  1S2Q A;  4H4S A;  2X8C A;  3T31 A;  3UTF A;  2VVM A;  5KMR A;  3CGE A;  1XHC A;  4JY3 A;  4CNJ A;  3DH9 A;  1PBD A;  2GR0 A;  1L0V A;  3BHF A;  1TRB A;  4LII A;  1CJ4 A;  3ATQ A;  1OJC A;  3WE0 A;  4A5L A;  4H4R A;  2BA9 A;  4B64 A;  3K7Q X;  4RSL A;  1OJT A;  3W4J A;  3KVE A;  4TM4 A;  2YLW A;  4KPR A;  1GRB A;  3SX6 A;  3UP5 A;  1PBE A;  1NHR A;  3QSE A;  2GR1 A;  3S61 A;  4YXD A;  1CC6 A;  2FBW A;  3PS9 A;  2BCP A;  2VRM A;  1KDG A;  3T14 A;  1JRY A;  3UTG A;  4J2W A;  2GRT A;  4UP3 A;  2CVJ A;  4EQX A;  2VVL G;  4Z2U A;  2WQY A;  3AE9 A;  4JQ9 A;  2XDO A;  1BF3 A;  4A65 A;  1IUS A;  4A79 A;  1FEC A;  2X8G A;  3C4A A;  2YG6 A;  2WP9 A;  3CN8 A;  4AT2 A;  4AOS A;  1PXB A;  3NYF A;  2C73 A;  3GWD A;  1OJD A;  4J36 A;  3QSM A;  5M10 A;  4FK1 C;  4A99 A;  2GB0 A;  4C77 A;  1B5Q A;  1FL2 A;  2C67 A;  1E7P A;  4K2X A;  4U8M A;  3ZYX A;  3ZNQ A;  1F6M A;  1ZX9 A;  2BXS A;  4TM1 A;  5KOW A;  4EMJ A;  1H81 A;  4H4Z A;  5KOX A;  4QFC A;  1CHU A;  4EMI A;  3CUK A;  3E1T A;  2Q6U A;  1RP0 A;  4H2Q A;  3EPT A;  1EL7 A;  3GYI A;  2WES A;  3NT6 A;  1GND A;  2GAG B;  1NEN A;  4ZCC A;  2ZZ0 A;  5KWF A;  1EL8 A;  3HYX A;  4GRT A;  2YVF A;  1KSU A;  1C0L A;  2RAB A;  2X50 A;  4II2 A;  3SXI A;  1QJD A;  1PDH A;  4EIP A;  3D8X A;  2JKC A;  3M13 A;  3VRA A;  3AE7 A;  5U25 A;  2PYX A;  3NN6 X;  2OLO A;  3AEC A;  1ZMC A;  3UCL A;  1LQT A;  2C75 A;  4U2L A;  3UKH A;  3PVC A;  1DOD A;  2E82 A;  4J33 A;  3SQP A;  4OPU A;  3T37 A;  2GR3 A;  2YG4 A;  2RGO A;  2WOW A;  1E1N A;  1Y56 A;  2XLT A;  3VRD B;  3BNU A;  1DOE A;  2WDQ A;  4J57 A;  2EQ8 A;  3NK2 X;  1ZP0 A;  3AE5 A;  1L9C A;  4OVI A;  2VQB A;  2I0Z A;  2VVL A;  3BI5 A;  3AE4 A;  3NGC X;  4GF7 A;  1PBF A;  1REO A;  2YLZ A;  4Y4M A;  3ABV A;  1MXT A;  2C7G A;  3NTD A;  2VQ7 A;  2BC0 A;  1K4Q A;  5FS9 A;  4B66 A;  1TDN A;  3CMM A;  1VQW A;  4OPD A;  1PHH A;  3AYL A;  2XCG A;  1KNP A;  2JB3 A;  2ARD A;  2NPX A;  2C64 A;  2E4G A;  3K7T A;  2JB2 A;  2O9Z A;  1PS9 A;  1DJQ A;  4C5O A;  4YSH A;  3KA7 A;  3FBS A;  4DGK A;  1CC4 A;  4G6G A;  4DNA A;  1GRA A;  3IC9 A;  4U8L A;  2XVI A;  3BI4 A;  2YM1 A;  2R4E A;  2WDR A;  2V60 A;  2TPR A;  2APG A;  2V61 A;  3BNM A;  3GRS A;  3DME A;  4YSY A;  3VRB A;  3NK1 X;  4UDR A;  5JCM A;  2BS4 A;  2GMJ A;  1UKV G;  3CGD A;  1DOB A;  3GYX A;  3GSI A;  4PAA A;  2BK3 A;  3C4N A;  3AYI A;  4TLZ A;  4YTN A;  4O5Q A;  1RYI A;  2E49 A;  4CY8 A;  3ISH A;  4K7Z A;  4IVM B;  5KVI A;  4MJW A;  3QVR A;  3NKS A;  5KMQ A;  4APN A;  2XVE A;  3NK0 X;  4REK A;  3EAO A;  1Y0P A;  4CY6 A;  3LAD A;  5DBJ A;  2WS3 A;  2X8H A;  4USR A;  4YJG A;  4PAB A;  3DGZ A;  4JN9 A;  4B67 A;  4H4Q A;  3OC4 A;  3T2Y A;  3NN0 X;  1BZL A;  2YR5 A;  4GAP A;  1EVI A;  5J7X A;  2BAC A;  2BK4 A;  3AED A;  2WBA A;  2OAM A;  2YQU A;  4H4W A;  5ER0 A;  1L9E A;  1JNZ A;  3CNP A;  3ZNO A;  1X31 B;  4WCT A;  1NAA A;  1MO9 A;  4C3Y A;  3DA1 A;  1ZDL A;  3LXD A;  3F8D A;  4GDE A;  1JOA A;  3CTY A;  1JRZ A;  4FDC B;  3DK8 A;  4Z26 A;  3SYI A;  4J34 A;  1IUU A;  4EQR A;  1JEH A;  2BRA A;  4ADW A;  2RGJ A;  2X3N A;  1GRT A;  3GD4 A;  5C3J A;  1EL5 A;  2E48 A;  2YLS A;  3UKL A;  3QJ4 A;  4CNK A;  3UKA A;  4U8P A;  3CGC A;  5GRT A;  3RED A;  1CJ2 A;  1QO8 A;  3FMW A;  4NWZ A;  1D5T A;  2RGH A;  4H4V A;  3AWI A;  3ZNP A;  4U2T A;  4CCR A;  1H7W A;  1PBB A;  1C0I A;  1D4E A;  2H89 A;  2QA2 A;  5U63 A;  3CNS A;  3FPZ A;  2WET A;  4H4P A;  1TDE A;  2IID A;  4J31 A;  1W4X A;  2GVC A;  3LZX A;  4P9S A;  5JCL A;  1DXL A;  3AE3 A;  2EQ9 A;  4AP1 A;  4II3 A;  1TDF A;  2OAL A;  2C70 A;  4NTE A;  5KMS A;  4YJF B;  2BXR A;  3NLC A;  1E1K A;  3ICS A;  1AOG A;  3AE8 A;  4B65 A;  4CRT A;  1ZOV A;  4H4Y A;  5IPY A;  2QCU A;  3W4K A;  2GMH A;  3NTA A;  2YG3 A;  1F8S A;  3ZDN A;  3I3L A;  1GRE A;  3ICT A;  3QFA A;  4ECH A;  1GTE A;  1YQ4 A;  3H8I A;  1B37 A;  1JNR A;  3SFE A;  1YQ3 A;  2BAB A;  1PBC A;  1K0L A;  1GT8 A;  1PN0 A;  2BCG G;  2A89 A;  2A87 A;  2FJD A;  2WOI A;  2Y6Q A;  3AEG A;  4B1B A;  4EM3 A;  2XYO A;  1KSS A;  3GD3 A;  2WPC A;  3CNT A;  2JAE A;  3URH A;  2R9Z A;  2V5Z A;  4GCM A;  5FS7 A;  5J60 A;  2E5V A;  2WEU A;  2E4A A;  2YVG A;  3DK9 A;  1FEB A;  1F8W A;  4DSG A;  5JCN A;  3BHK A;  3JSK A;  2GQF A;  3VR9 A;  3QSS A;  4GUV A;  4I59 A;  4WX1 A;  3IHM A;  4AP3 A;  2F5Z A;  1QLB A;  2GV8 A;  1V59 A;  2XFO A;  2XVH A;  3VR8 A;  2C65 A;  4H7U A;  1VG9 A;  2XLU A;  2R0G A;  5BVA A;  4ZCD A;  4AT0 A;  1EL9 A;  2WP6 A;  3KLJ A;  1DOC A;  2CFY A;  1BKW A;  1K0J A;  2R46 A;  1GEU A;  3ALL A;  2YWL A;  3HYW A;  2XFU A;  3KKJ A;  4K22 A;  4B68 A;  1ZK7 A;  2B7R A;  3IHG A;  4GDP A;  1C0K A;  4XWR A;  1LVL A;  1GPE A;  1H6V A;  3KPF A;  2C72 A;  3P9U A;  2V3B A;  1IUV A;  2WPF A;  3Q6J A;  4M52 A;  1O95 A;  2OLN A;  1LV0 A;  2XVJ A;  3GMC A;  2B9W A;  4Z2T A;  1XDI A;  1NHQ A;  3RP6 A;  3K30 A;  4G6H A;  2B9X A;  1E1L A;  3II4 A;  1H86 A;  2YLX A;  4U8K A;  2C3C A;  2WOV A;  2ZZC A;  4G9K A;  3P4R A;  4H4T A;  4EQW A;  2GH5 A;  1C0P A;  3DK4 A;  1N1P A;  2C3D A;  3V3N A;  1KF6 A;  2QA1 A;  3Q9T A;  3NH3 X;  2WHD A;  3NRN A;  4CBQ A;  4YT0 A;  3GDP A;  3CGB A;  1M64 A;  1D4C A;  1XPQ A;  1XAN A;  2DKI A;  3SM8 A;  4H2P A;  1LQU A;  5JCI A;  3AE6 A;  1H7X A;  1VDC A;  1L9D A;  3RP7 A;  1TDK A;  5KMP A;  5IQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...