2UZZA

X-ray structure of n-methyl-l-tryptophan oxidase (mtox)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
b'KYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKYVPLVLRAQMLWDELSRHNEDDPIFVRSGVINLGPADSTFLANVAHSAEQWQLNVEKLDAQGIMARWPEIRVPDNYIGLFETDSGFLRSELAIKTWIQLAKEAGCAQLFNCPVTAIRHDDDGVTIETADGEYQAKKAIVCAGTWVKDLLPELPVQPVRKVFAWYQADGRYSVKNKFPAFTGELPNGDQYYGFPAENDALKIGKHNGGQVIHSADERVPFAEVVSDGSEAFPFLRNVLPGIGCCLYGAACTYDNSPDEDFIIDTLPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSDFDLTPFRLSRFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-METHYL-L-TRYPTOPHAN OXIDASE
publication title The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 97
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.5.3.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 2uzzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2uzzA01
2YWLA 4UDQA 4EM4A 3CNDA 1N4WA 1REOA 3UOZA 1D5TA 3UTGA 4AP3A 4CCQA 1DJNA 1B8SA 1NHPA 1NG4A 1Y56A 4TM4A 1KF6A 1ZP0A 3P4PA 3ZNOA 1YQ4A 4ECHA 2F5ZA 3V3OA 2C66A 2B9YA 1OJTA 3G5QA 1ZK7A 1KIFA 2X8GA 3DK8A 1B4VA 4BK2A 2WDQA 3QVPA 4JNQA 3ATQA 2JAEA 4K8DA 2WQYA 3H8LA 4O5UA 4K7ZA 2C75A 4NTEA 4U8IA 3R9UA 2XFOA 1IUVA 3VR8A 4CCRA 4A9WA 1D4EA 1DDOA 2A87A 3UCLA 2BS2A 2GVCA 2WESA 4RG3A 4YJHB 1Y0PA 5FS8A 1KFYA 2YG3A 4Z2UA 2WP9A 5J7XA 3ISHA 2WU2A 3F8RA 3AE4A 1IUTA 4M52A 5GRTA 4DGKA 1OJ9A 3FBSA 4B64A 2VQBA 2BS4A 3NN6X 1CC6A 4X9NA 2FJBA 4GR1A 3C4NA 2WP5A 2I0ZA 2XFQA 2GV8A 4JN9A 4REKA 4PABA 2EQ9A 3SFEA 4C3YA 1B37A 4EM3A 3S5WA 3M0OA 2R0GA 1VE9A 4K5RA 1S3BA 3AEFA 4YWOA 1C0KA 3IWAA 2V6OA 3LADA 3SFDA 1P2EA 3CTYA 1GRTA 1PXAA 1N1PA 1H83A 1ELIA 1XPQA 3ZNQA 1CL0A 2YVGA 2R46A 3UTHA 4XWRA 3SQPA 4CRTA 1EL9A 1K0LA 5CQFA 5M0ZA 3UP4A 4YSHA 1PBDA 1M6IA 4GCMA 4B68A 3CPHG 5L46A 4C3XA 1GTHA 3BHKA 4ZCDA 3F8PA 1DOBA 2C3DA 1BWCA 4YJDA 4IVMB 2YLWA 1AOGA 3CNJA 4GDPA 2VVLA 2YG5A 3AD8B 2BK3A 3LZWA 4OPGA 3RP8A 2XLUA 1K0IA 1XANA 4JNAA 2VVLG 3VR9A 2XFUA 4AT0A 2WPFA 1D4DA 3C4AA 3CGCA 3UKLA 3LJPA 3FMWA 2AR8A 1GPEA 3IC9A 1NPXA 2V3AA 3H8IA 4NZHA 1BGNA 4DSHA 1N4UA 1CHUA 1VG0A 2V5ZA 3ZYXA 2YLXA 1CJ3A 1PJ7A 3NNEA 3B3RA 1NEKA 2RGHA 3NTDA 4OPCA 5IQ4A 1BZLA 4U2LA 4C77A 4H50A 2B76A 1ZOYA 2Q7VA 1E39A 3GDNA 5JCIA 2C76A 3FPZA 3KA7A 2JB3A 4U8PA 1GNDA 1H86A 1TYPA 3S61A 2YM2A 3GMBA 3NH3X 2BXSA 3CUKA 3AEGA 5HY5A 3NK0X 1O95A 5HYMA 4P9SA 1L9CA 1VRQB 1ZX9A 1F8WA 1FEAA 3AD9B 3K7TA 3P4RA 2OALA 2YG4A 4Z44A 1JNRA 1JOAA 4H4VA 4USQA 3ALLA 3UP5A 1S2QA 5ER0A 1QO8A 1PBEA 1W4XA 5IPYA 1P2HA 3EAOA 5CKUA 1PS9A 2WOIA 2XFNA 1CC2A 1IUUA 1TDFA 4QFDA 3BNUA 4H7UA 4AOXA 3UKAA 3OC4A 3L8KA 3AE1A 5FS6A 1H82A 3SM8A 2GR2A 2NVKX 2V61A 3URHA 1RSGA 4NTCA 4J34A 2BC1A 5JCMA 3AEEA 1RYIA 2H89A 3RNMA 3CNPA 3KD9A 2C67A 2RGOA 2WOWA 4U8OA 4CY8A 3G3EA 1CJ4A 1KDGA 4D04A 4WX1A 2WDRA 1M64A 1GREA 4J57A 4TLXA 4A65A 2B7RA 4YJHA 1OJDA 3W4JA 1JEHA 2WOVA 3GYIA 2GAGB 3CGEA 4B66A 2R4JA 2A89A 3DA1A 3CN8A 5EB5A 3VRDB 1LVLA 5KWFA 1OJCA 5BUKA 2PYXA 1CJ2A 4ZN0A 2E4AA 2YM1A 2VQ7A 3GRTA 5BVAA 3GD4A 2C73A 2WHDA 1GRFA 2R4EA 4YJGA 1EBDA 1KSSA 4EQXA 4USRA 1V59A 3K7QX 3UTFA 2BK4A 2X3NA 3UOYA 5LV9A 1CJCA 1BF3A 1TRBA 3RP7A 5C2TA 2C3CA 3CNSA 1TYTA 3V76A 5U1OA 3ICRA 4C5OA 1D4CA 3EPTA 4RG4A 4N9XA 1QJDA 1GERA 5JCNA 1F3PA 1PBCA 1F8RA 2XLRA 3IHMA 3REDA 5GSNA 2R0CA 3W4IA 1GXFA 3GSIA 1RP0A 2Y6RA 4H2QA 1PN0A 1GESA 3H4KA 4H4SA 4H4QA 4JY3A 3KKJA 1PJ6A 1FL2A 1GOSA 4GUVA 4AP1A 1K0JA 5EBKA 1GRHA 3AXBA 4B69A 1PDHA 2R9ZA 2X8CA 4H2PA 3ATRA 2IVDA 4RSLA 5KOWA 3P9UA 2ZZ0A 1MXTA 1COYA 4YJGB 1XHCA 4K2XA 3KVEA 1E1LA 1GT8A 2RABA 5U25A 3PVCA 1FCDA 2JKCA 1NDAA 1NG3A 3GYJA 4ADWA 3ZDNA 3P4QA 3ADAB 3GD3A 3BI4A 2WDVA 2B9WA 2BCPA 2XYOA 3AE8A 3B6DA 4H4PA 2YAUA 3RHAA 3KLJA 5KVHA 4WCTA 1MOKA 2VZ2A 4EQRA 2JBVA 3SGLA 4IVOB 3AWIA 2O9ZA 1YY5A 2VOUA 4J33A 4EQSA 2EQ8A 2OLNA 4UDRA 5BRTA 4GDEA 2DU8A 4J31A 1BGJA 3DJEA 3EANA 3PO7A 3DH9A 2YVJA 4I58A 2GRTA 1SEZA 2B9XA 3NKSA 3NK1X 1H6VA 2FBWA 1EVIA 1BKWA 2BC0A 4GF7A 4LIIA 2FJEA 4C74A 1F8SA 2GQWA 4TM1A 4CBQA 2HQMA 1IJHA 4J2WA 1O94A 4MJWA 3I6DA 3II4A 2QA1A 3NT6A 4Z24A 4K22A 1Q9IA 2IIDA 4Y4NA 1NHSA 1GTEA 5EOWA 2B7SA 2X8HA 1E6EA 2XVFA 2ZBWA 3EF6A 3NHOX 3ZNNA 3D8XA 3UKHA 3QSMA 2VVMA 2R45A 1Q1WA 4DSGA 2YR6A 1H84A 3W4KA 4EMJA 2EQ6A 4IA6A 3AYJA 1DODA 2XVHA 2DKIA 3AYIA 1JU2A 3BI2A 4IA5A 3UKKA 2UZZA 2WETA 4YSXA 3BNMA 4YTPA 1LQTA 2APGA 2BA9A 4U8NA 4U8JA 2J3NA 5J60A 1JRXA 1TDEA 1YKJA 3F8DA 2X99A 1JRYA 5KOXA 1KNPA 3VRAA 4NEVA 1LPFA 3BI5A 2YG7A 1AN9A 3AEDA 1DXLA 3AE5A 3FG2P 3NIXA 2YLRA 3UKPA 4NEWA 3UOVA 4ZCCA 1HYUA 3QSSA 3UKQA 2C7GA 3P4SA 4O5QA 4A5LA 4BURA 2YR4A 2GEWA 3GRSA 4Y4LA 1ZMCA 1E1NA 2ARDA 3AE2A 3Q9TA 4NTDA 2CULA 5U63A 2QA2A 2V3BA 2XVEA 3GWFA 2OA1A 3JSKA 5TR3A 4Z2TA 1LJ1A 2YLTA 5KXJA 2E4GA 1CBOA 1D7YA 3DK9A 4U8KA 4LA1A 3O0HA 4BJZA 4H4UA 4EMIA 3IHGA 2AAQA 4TM0A 1DJQA 1FOHA 2DKHA 3G5SA 4FK1A 4YKGA 2WU5A 3AECA 1GRGA 4OPIA 4B67A 3AB1A 4H4RA 1NHRA 3NGCX 4ICYA 3PS9A 3AEAA 3LZXA 1VQWA 1Q1RA 4EIPA 1GALA 4Z43A 2FJAA 4X9MA 2IVEA 2WBAA 3UTEA 2Y6QA 2WPCA 3VQRA 3CIRA 1TDOA 3DK4A 1GRAA 5IQ1A 4J56A 1TDKA 2AQJA 1VDCA 3NK2X 2C64A 2BABA 2W0HA 4YXDA 4XWZA 5M10A 1NAAA 2Q0KA 5FMHA 4A7AA 5HHFA 4OCGA 1EL5A 3P1WA 2WPEA 3NYEA 2YQUA 4I59A 2YLSA 2TMDA 3G5RA 1PBFA 4AOSA 1D7LA 3ZNPA 4BJYA 1B5QA 2Z5YA 3ABVA 2VRMA 2GR1A 2ZZBA 4AT2A 4YTNA 2GMJA 4Z26A 2WEUA 4U8MA 2GB0A 2JK6A 3AEBA 2EQ7A 5DBJA 1GEUA 5HXIA 3ALJA 2ZZCA 4IV9A 5C3JA 3NG7X 3AE9A 2JB2A 3Q6JA 1FEBA 3WE0A 3QVRA 4YSYA 2XVJA 2XLTA 1F6MA 2H88A 1JNZA 3K7MX 2BCGG 3LOVA 3L1RA 1C0PA 1GRBA 2BACA 3BHFA 1IUSA 1EL8A 3OZ2A 3IF9A 2GMHA 1FECA 1ZY8A 4TM3A 2XDOA 2YR5A 1KSUA 5KRQA 2Q0LA 1TDNA 1OJAA 2Q6UA 1L9EA 1JRZA 3ICTA 1GSNA 3CPJG 2A8XA 1X31B 4YJFB 4EQWA 1KNRA 3K30A 2E49A 2GH5A 1LV0A 3DMEA 4H4WA 3DGZA 2BS3A 4U2SA 4BK1A 4YSZA 2GAHB 2XCGA 2E82A 3DJJA 1S2YA 4OPTA 4H4XA 2X50A 3NTAA 4A79A 4YTMA 4YKFA 1UKVG 2BYBA 1Y56B 3LB8A 4A99A 4HB9A 2C65A 3DJGX 1ZDLA 3QJ4A 4GRTA 4APNA 4U2TA 1NHQA 1K4QA 4HA6A 3RP6A 1YQ3A 3NRNA 3UKFA 1S3EA 1Z6LA 2JB1A 4CNKA 3M13A 1PXBA 1GETA 4Z2RA 3QFAA 4OPLA 3E1TA 2ACZA 2E1MA 4H4YA 4JQ9A 1QLBA 3NN0X 1E1KA 2C70A 3GDPA 4CY6A 4OPDA 1ZOVA 3DGHA 5JCKA 1CC4A 2CVJA 1IUWA 3HZLA 2GR0A 3AD7B 2E48A 3T37A 1PJ5A 2V60A 4A6NA 4H2RA 2XLPA 1DAOA 1E7PA 5FS7A 5EB4A 2GR3A 2TPRA 4TLZA 1LTXR 4CNJA 5JCLA 2OLOA 2QAEA 4BV6A 1MO9A 3VRBA 2E5VA 3CPIG 1C0LA 2WS3A 1VG9A 4KPRA 3UOXA 1PBBA 4H4TA 1H81A 4XXGA 4KX6A 3FIMB 4B1BA 4X4JA 3GWDA 4FX9A 2PHHA 2R0PA 2GF3A 2VRLA 4UDPA 3C96A 3QFBA 2XVIA 1L9DA 2QCUA 4FK1C 2BK5A 3CGDA 4B65A 3ALMA 1L0VA 4DNAA 4JDRA 1E1MA 1EL7A 2BXRA 2XLSA 1PHHA 4QFCA 2RGJA 4K5SA 1ONFA 4OPUA 5BULA 3I3LA 2FJDA 1IUXA 2XFPA 2WP6A 3AE7A 3NLCA 4J36A 4JY2A 3NYFA 4EIQA 1DNCA 3CGBA 2YG6A 3LXDA 1CF3A 2YLZA 4A6NB 3ICSA 4E0VA 1GV4A 1DOCA 1PXCA 1N4VA 2C72A 2GQFA 3GMCA 4Y4MA 1LQUA 5KVIA 4YT0A 4UP3A 1NENA 1H7XA 2Z5XA 2NPXA 3NYCA 3ITJA 3V3NA 4PAAA 3CNTA 1C0IA 3D1CA 4EMWA 1O5WA 4H2NA 1XDIA 2CFYA 3COXA 4FDCB 4OVIA 1DOEA 2CDUA 2YVFA 3AYLA 4U8LA 4B63A 4Z25A 3AE6A 1YQZA 2OAMA 3KPFA 1ZMDA 3KU9A 5FS9A 4H4ZA 3QSEA 4D03A 1H7WA 4BK3A 1ZKQA 3DJDA 4LU6A 3M12A 3AE3A 3WGTA 4YJFA
chains in the Genus database with same CATH superfamily
2YWLA 4UDQA 4EM4A 3CNDA 1N4WA 1REOA 3UOZA 1D5TA 3UTGA 4AP3A 4CCQA 1DJNA 1B8SA 1NHPA 1NG4A 1Y56A 4TM4A 1KF6A 1ZP0A 3P4PA 3ZNOA 1YQ4A 4ECHA 2F5ZA 3V3OA 2C66A 2B9YA 1OJTA 3G5QA 1ZK7A 1KIFA 4BK2A 2X8GA 1B4VA 3DK8A 2WDQA 3QVPA 4JNQA 4G9KA 3ATQA 4G6HA 2JAEA 4K8DA 2WQYA 3H8LA 2BRAA 4K7ZA 4O5UA 2C75A 4NTEA 4U8IA 3R9UA 2XFOA 1IUVA 3VR8A 4CCRA 4A9WA 1D4EA 1DDOA 2A87A 3UCLA 2BS2A 2GVCA 2WESA 4RG3A 4YJHB 1Y0PA 5FS8A 1KFYA 2YG3A 4Z2UA 2WP9A 4GAVA 5J7XA 3ISHA 2WU2A 3SZCA 3F8RA 3AE4A 1IUTA 4M52A 5GRTA 4DGKA 1OJ9A 3FBSA 4B64A 2VQBA 2BS4A 3NN6X 1CC6A 4X9NA 2FJBA 4GR1A 3C4NA 2WP5A 2I0ZA 2XFQA 2GV8A 4JN9A 4REKA 4PABA 2EQ9A 3SFEA 4C3YA 1B37A 4EM3A 3S5WA 2R0GA 3M0OA 1VE9A 4K5RA 1S3BA 3AEFA 4YWOA 1C0KA 3IWAA 2V6OA 3LADA 3SFDA 1P2EA 4G6GA 3CTYA 1GRTA 1PXAA 1N1PA 1H83A 1ELIA 3KPKA 1XPQA 3ZNQA 1CL0A 2YVGA 4GAPA 2R46A 3UTHA 4XWRA 3SQPA 4CRTA 1EL9A 1K0LA 5CQFA 5M0ZA 3UP4A 4YSHA 1PBDA 1M6IA 4GCMA 4B68A 3CPHG 5L46A 4C3XA 1GTHA 3BHKA 4ZCDA 3F8PA 1DOBA 2C3DA 1BWCA 4YJDA 4IVMB 2YLWA 1AOGA 3CNJA 4GDPA 2VVLA 2YG5A 3AD8B 3RP8A 2BK3A 3LZWA 4OPGA 2XLUA 1K0IA 1XANA 4JNAA 2VVLG 3VR9A 2XFUA 4AT0A 2WPFA 3C4AA 1D4DA 3CGCA 3UKLA 3LJPA 3FMWA 2AR8A 1GPEA 3IC9A 1NPXA 2V3AA 3H8IA 4NZHA 1BGNA 4DSHA 1N4UA 1CHUA 1VG0A 2V5ZA 3ZYXA 2YLXA 1CJ3A 1PJ7A 3NNEA 3B3RA 1NEKA 2RGHA 3NTDA 4OPCA 5IQ4A 1BZLA 4U2LA 4C77A 4H50A 2B76A 1ZOYA 2Q7VA 1E39A 3GDNA 3T2ZA 5JCIA 2C76A 3FPZA 3KA7A 2JB3A 4U8PA 1GNDA 1H86A 1TYPA 3S61A 3GMBA 2YM2A 3NH3X 2BXSA 3CUKA 3AEGA 5HY5A 3NK0X 5HYMA 1O95A 4P9SA 1L9CA 1VRQB 1ZX9A 1F8WA 1FEAA 3AD9B 3K7TA 3P4RA 2OALA 2YG4A 4Z44A 1JNRA 1JOAA 4H4VA 4USQA 3ALLA 3UP5A 1S2QA 5ER0A 1QO8A 1PBEA 1W4XA 5IPYA 1P2HA 3EAOA 5CKUA 1PS9A 2WOIA 2XFNA 1CC2A 1IUUA 1TDFA 4QFDA 3BNUA 4H7UA 4AOXA 3UKAA 3OC4A 3L8KA 3AE1A 5FS6A 1H82A 3SM8A 2GR2A 2NVKX 2V61A 3URHA 1RSGA 4NTCA 4J34A 2BC1A 5JCMA 3AEEA 1RYIA 2H89A 3RNMA 3CNPA 3KD9A 2C67A 2RGOA 2WOWA 4U8OA 4CY8A 3G3EA 1CJ4A 1KDGA 4D04A 4WX1A 2WDRA 1M64A 1GREA 4J57A 4TLXA 4A65A 2B7RA 4YJHA 1OJDA 3W4JA 1JEHA 2WOVA 3GYIA 2GAGB 3CGEA 4B66A 2R4JA 2A89A 3DA1A 3CN8A 5EB5A 3VRDB 1LVLA 5KWFA 1OJCA 5BUKA 2PYXA 1CJ2A 4ZN0A 3SXIA 2E4AA 2YM1A 2VQ7A 3GRTA 5BVAA 3GD4A 2C73A 2WHDA 1GRFA 2R4EA 4YJGA 1EBDA 1KSSA 4EQXA 4USRA 1V59A 3K7QX 3UTFA 2BK4A 2X3NA 3UOYA 5LV9A 1CJCA 1BF3A 3RP7A 1TRBA 5C2TA 2C3CA 3CNSA 1TYTA 3V76A 5U1OA 3ICRA 3SY4A 4C5OA 3EPTA 1D4CA 4RG4A 4N9XA 1QJDA 1GERA 5JCNA 1F3PA 1PBCA 1F8RA 2XLRA 3IHMA 3REDA 5GSNA 3SYIA 2R0CA 3W4IA 1GXFA 3GSIA 1RP0A 2Y6RA 4H2QA 1PN0A 1GESA 3H4KA 4H4SA 4H4QA 4JY3A 3KKJA 1PJ6A 1FL2A 1GOSA 4GUVA 2C4CA 3CMMA 1K0JA 4AP1A 5EBKA 1GRHA 3AXBA 4B69A 1PDHA 2R9ZA 2X8CA 4H2PA 3ATRA 2IVDA 4RSLA 5KOWA 3P9UA 2ZZ0A 1MXTA 1COYA 4YJGB 1XHCA 4K2XA 3KVEA 1E1LA 1GT8A 2RABA 5U25A 3PVCA 1FCDA 2JKCA 1NDAA 1NG3A 3GYJA 4ADWA 3ZDNA 3P4QA 3ADAB 3GD3A 3BI4A 2WDVA 2B9WA 2BCPA 2XYOA 3AE8A 3B6DA 4H4PA 2YAUA 3RHAA 3KLJA 5KVHA 4WCTA 1MOKA 2VZ2A 4EQRA 2JBVA 3SGLA 4IVOB 3AWIA 3T14A 2VOUA 1YY5A 2O9ZA 4J33A 4EQSA 2EQ8A 3T2KA 2OLNA 4UDRA 5BRTA 4GDEA 2DU8A 4J31A 1BGJA 3DJEA 3EANA 3PO7A 3DH9A 2YVJA 4I58A 2GRTA 1SEZA 2B9XA 4NNJA 3NKSA 3NK1X 3T31A 4GF7A 1H6VA 1EVIA 1BKWA 2BC0A 2FBWA 4LIIA 2FJEA 4C74A 1F8SA 2GQWA 4TM1A 4CBQA 2HQMA 1IJHA 4J2WA 1O94A 4MJWA 3I6DA 3II4A 3SX6A 2QA1A 3NT6A 4Z24A 4K22A 1Q9IA 2IIDA 4Y4NA 1NHSA 1GTEA 5EOWA 2B7SA 2X8HA 1E6EA 2XVFA 2ZBWA 3EF6A 3NHOX 3ZNNA 3D8XA 3UKHA 3QSMA 2VVMA 2R45A 1Q1WA 4DSGA 2YR6A 1H84A 3W4KA 4EMJA 2EQ6A 4IA6A 3AYJA 1DODA 2XVHA 2DKIA 3AYIA 1JU2A 3BI2A 4IA5A 3UKKA 2UZZA 2WETA 4YSXA 3BNMA 4YTPA 5KMRA 1LQTA 2APGA 2BA9A 4U8NA 4U8JA 2J3NA 5J60A 1JRXA 1TDEA 1YKJA 3F8DA 2X99A 1JRYA 5KOXA 1KNPA 3VRAA 4NEVA 1LPFA 3BI5A 2YG7A 4II3A 1AN9A 3AEDA 1DXLA 3AE5A 3FG2P 3NIXA 2YLRA 4II2A 3UKPA 4NEWA 3UOVA 4ZCCA 1HYUA 3QSSA 3UKQA 2C7GA 3P4SA 4O5QA 4A5LA 4BURA 3SZFA 2YR4A 2GEWA 3GRSA 4Y4LA 1ZMCA 1E1NA 2ARDA 3AE2A 3Q9TA 4NTDA 2CULA 5U63A 2QA2A 2V3BA 2XVEA 3GWFA 2OA1A 3JSKA 5TR3A 4Z2TA 1LJ1A 2YLTA 5KXJA 2E4GA 1CBOA 1D7YA 3DK9A 4G73A 4U8KA 4LA1A 3O0HA 4BJZA 4H4UA 4EMIA 3IHGA 2AAQA 4TM0A 1DJQA 3HYXA 1FOHA 2DKHA 3G5SA 4FK1A 4YKGA 2WU5A 3AECA 1GRGA 4OPIA 4B67A 3AB1A 4H4RA 1NHRA 3NGCX 4ICYA 3PS9A 3AEAA 3LZXA 1VQWA 1Q1RA 4EIPA 1GALA 4Z43A 2FJAA 4X9MA 2IVEA 2WBAA 3UTEA 2Y6QA 2WPCA 3VQRA 3CIRA 1TDOA 3DK4A 1GRAA 5IQ1A 4J56A 1TDKA 2AQJA 1VDCA 3NK2X 2C64A 2BABA 2W0HA 4YXDA 4XWZA 5M10A 1NAAA 2Q0KA 5FMHA 4A7AA 5HHFA 4OCGA 1EL5A 3P1WA 2WPEA 3NYEA 2YQUA 4I59A 2YLSA 2TMDA 3G5RA 1PBFA 4AOSA 1D7LA 3ZNPA 4BJYA 1B5QA 2Z5YA 3ABVA 2VRMA 2GR1A 2ZZBA 4AT2A 4YTNA 2GMJA 4Z26A 2WEUA 4U8MA 2GB0A 2JK6A 3AEBA 5HXIA 2EQ7A 1GEUA 5DBJA 3ALJA 2ZZCA 4IV9A 5C3JA 3NG7X 3AE9A 2JB2A 3Q6JA 1FEBA 3WE0A 5KMPA 3QVRA 4YSYA 2XVJA 2XLTA 1F6MA 2H88A 1JNZA 3K7MX 2BCGG 3LOVA 3L1RA 4G74A 1C0PA 1GRBA 2BACA 3BHFA 1IUSA 1EL8A 3OZ2A 3IF9A 2GMHA 1FECA 1ZY8A 4TM3A 2XDOA 2YR5A 1KSUA 5KRQA 2Q0LA 1TDNA 1OJAA 2Q6UA 1L9EA 1JRZA 3ICTA 1GSNA 3CPJG 2A8XA 1X31B 4YJFB 4EQWA 1KNRA 3K30A 2E49A 2GH5A 1LV0A 3DMEA 4H4WA 3DGZA 2BS3A 4BK1A 4U2SA 4YSZA 2GAHB 2XCGA 2E82A 3DJJA 1S2YA 4OPTA 3HYWA 4H4XA 2X50A 3NTAA 4A79A 4YTMA 4YKFA 1UKVG 2BYBA 1Y56B 3LB8A 4A99A 4HB9A 2C65A 3DJGX 1ZDLA 3QJ4A 4GRTA 4APNA 4U2TA 1NHQA 1K4QA 3RP6A 4HA6A 1YQ3A 3NRNA 3UKFA 1S3EA 1Z6LA 2JB1A 4CNKA 3M13A 1PXBA 1GETA 4Z2RA 3QFAA 4OPLA 3E1TA 2ACZA 2E1MA 4H4YA 4JQ9A 1QLBA 3NN0X 1E1KA 2C70A 3GDPA 2BRYA 4CY6A 4OPDA 1ZOVA 3DGHA 5JCKA 1CC4A 2CVJA 1IUWA 3HZLA 5KNLA 2GR0A 3AD7B 2E48A 3T37A 1PJ5A 2V60A 4A6NA 4H2RA 2XLPA 1DAOA 1E7PA 5FS7A 5EB4A 2GR3A 2TPRA 4TLZA 1LTXR 4CNJA 5JCLA 2OLOA 2QAEA 3SZ0A 1MO9A 3VRBA 4BV6A 2E5VA 3CPIG 1C0LA 2WS3A 1VG9A 4KPRA 3UOXA 1PBBA 4H4TA 1H81A 4XXGA 4KX6A 3FIMB 4B1BA 4X4JA 3GWDA 4FX9A 2PHHA 2R0PA 2GF3A 2VRLA 4UDPA 3C96A 3QFBA 2XVIA 1L9DA 2QCUA 4FK1C 2BK5A 3CGDA 4B65A 5KMSA 3ALMA 1L0VA 4DNAA 4JDRA 1E1MA 1EL7A 2BXRA 2XLSA 1PHHA 2RGJA 4QFCA 4K5SA 1ONFA 4OPUA 5BULA 3HYVA 3I3LA 2FJDA 1IUXA 2XFPA 2WP6A 3AE7A 3NLCA 4JY2A 4EIQA 3NYFA 4J36A 1DNCA 3CGBA 2YG6A 3LXDA 1CF3A 2YLZA 4A6NB 3ICSA 4E0VA 3GMCA 1DOCA 1PXCA 1GV4A 1N4VA 2C72A 2GQFA 4Y4MA 1LQUA 5KVIA 4YT0A 4UP3A 1NENA 1H7XA 2Z5XA 2NPXA 3NYCA 3ITJA 3V3NA 4PAAA 3CNTA 1C0IA 3D1CA 4EMWA 4NWZA 3SZWA 1O5WA 4H2NA 1XDIA 2CFYA 3COXA 4FDCB 4OVIA 1DOEA 2CDUA 2YVFA 3AYLA 3GYXA 4U8LA 5KMQA 4B63A 4Z25A 3AE6A 1YQZA 2OAMA 3KPFA 1ZMDA 3KU9A 5FS9A 4H4ZA 3T2YA 3QSEA 4D03A 4BK3A 1H7WA 1ZKQA 3DJDA 4LU6A 3M12A 3AE3A 3WGTA 4YJFA 3T0KA
chains in the Genus database with same CATH topology
2YWLA 4UDQA 4EM4A 3CNDA 1N4WA 1REOA 3UOZA 1D5TA 3UTGA 4AP3A 4CCQA 1DJNA 1B8SA 1NHPA 1NG4A 1Y56A 4TM4A 1KF6A 1ZP0A 3P4PA 3ZNOA 1YQ4A 4ECHA 2F5ZA 3V3OA 2C66A 2B9YA 1OJTA 3G5QA 1ZK7A 1KIFA 2X8GA 3DK8A 1B4VA 4BK2A 2WDQA 3QVPA 4JNQA 4G9KA 3ATQA 4G6HA 2JAEA 4K8DA 2WQYA 3H8LA 2BRAA 4K7ZA 4O5UA 2C75A 4NTEA 4U8IA 3R9UA 2XFOA 1IUVA 3VR8A 4CCRA 4A9WA 1D4EA 1DDOA 2A87A 3UCLA 2BS2A 2GVCA 2WESA 4RG3A 4YJHB 1Y0PA 5FS8A 1KFYA 2YG3A 4Z2UA 2WP9A 4GAVA 5J7XA 3ISHA 2WU2A 3SZCA 3F8RA 3AE4A 1IUTA 4M52A 5GRTA 4DGKA 1OJ9A 3FBSA 4B64A 2VQBA 2BS4A 3NN6X 1CC6A 4X9NA 2FJBA 4GR1A 3C4NA 2WP5A 2I0ZA 2XFQA 2GV8A 4JN9A 4REKA 4PABA 2EQ9A 3SFEA 4C3YA 1B37A 4EM3A 3S5WA 3M0OA 2R0GA 1VE9A 4K5RA 1S3BA 3AEFA 4YWOA 1C0KA 3IWAA 2V6OA 3LADA 3SFDA 1P2EA 4G6GA 3CTYA 1GRTA 1PXAA 1N1PA 1H83A 1ELIA 3KPKA 1XPQA 3ZNQA 1CL0A 2YVGA 4GAPA 2R46A 3UTHA 4XWRA 3SQPA 4CRTA 1EL9A 1K0LA 5CQFA 5M0ZA 3UP4A 4YSHA 1PBDA 1M6IA 4GCMA 4B68A 3CPHG 5L46A 4C3XA 1GTHA 3BHKA 4ZCDA 3F8PA 1DOBA 2C3DA 1BWCA 4YJDA 4IVMB 2YLWA 1AOGA 3CNJA 4GDPA 2VVLA 2YG5A 3AD8B 2BK3A 3LZWA 4OPGA 3RP8A 2XLUA 1K0IA 1XANA 4JNAA 2VVLG 3VR9A 2XFUA 4AT0A 2WPFA 1D4DA 3C4AA 3CGCA 3UKLA 3LJPA 3FMWA 2AR8A 1GPEA 3IC9A 1NPXA 2V3AA 3H8IA 4NZHA 1BGNA 4DSHA 1N4UA 1CHUA 1VG0A 2V5ZA 3ZYXA 2YLXA 1CJ3A 1PJ7A 3NNEA 3B3RA 1NEKA 2RGHA 3NTDA 4OPCA 5IQ4A 1BZLA 4U2LA 4C77A 4H50A 2B76A 1ZOYA 2Q7VA 1E39A 3GDNA 3T2ZA 5JCIA 2C76A 3FPZA 3KA7A 2JB3A 4U8PA 1GNDA 1H86A 1TYPA 3S61A 2YM2A 3GMBA 3NH3X 2BXSA 3CUKA 3AEGA 5HY5A 3NK0X 1O95A 5HYMA 4P9SA 1L9CA 1VRQB 1ZX9A 1F8WA 1FEAA 3AD9B 3K7TA 3P4RA 2OALA 2YG4A 4Z44A 1JNRA 1JOAA 4H4VA 4USQA 3ALLA 3UP5A 1S2QA 5ER0A 1QO8A 1PBEA 1W4XA 5IPYA 1P2HA 3EAOA 5CKUA 1PS9A 2WOIA 2XFNA 1CC2A 1IUUA 1TDFA 4QFDA 3BNUA 4H7UA 4AOXA 3UKAA 3OC4A 3L8KA 3AE1A 5FS6A 1H82A 3SM8A 2GR2A 2NVKX 2V61A 3URHA 1RSGA 4NTCA 4J34A 2BC1A 5JCMA 3AEEA 1RYIA 2H89A 3RNMA 3CNPA 3KD9A 2C67A 2RGOA 2WOWA 4U8OA 4CY8A 3G3EA 1CJ4A 1KDGA 4D04A 4WX1A 2WDRA 1M64A 1GREA 4J57A 4TLXA 4A65A 2B7RA 4YJHA 1OJDA 3W4JA 1JEHA 2WOVA 3GYIA 2GAGB 3CGEA 4B66A 2R4JA 2A89A 3DA1A 3CN8A 5EB5A 3VRDB 1LVLA 5KWFA 1OJCA 5BUKA 2PYXA 1CJ2A 4ZN0A 3SXIA 2E4AA 2YM1A 2VQ7A 3GRTA 5BVAA 3GD4A 2C73A 2WHDA 1GRFA 2R4EA 4YJGA 1EBDA 1KSSA 4EQXA 4USRA 1V59A 3K7QX 3UTFA 2BK4A 2X3NA 3UOYA 5LV9A 1CJCA 1BF3A 1TRBA 3RP7A 5C2TA 2C3CA 3CNSA 1TYTA 3V76A 5U1OA 3ICRA 3SY4A 4C5OA 1D4CA 3EPTA 4RG4A 4N9XA 1QJDA 1GERA 5JCNA 1F3PA 1PBCA 1F8RA 2XLRA 3IHMA 3REDA 5GSNA 3SYIA 2R0CA 3W4IA 1GXFA 3GSIA 1RP0A 2Y6RA 4H2QA 1PN0A 1GESA 3H4KA 4H4SA 4H4QA 4JY3A 3KKJA 1PJ6A 1FL2A 1GOSA 4GUVA 2C4CA 3CMMA 1K0JA 4AP1A 5EBKA 1GRHA 3AXBA 4B69A 1PDHA 2R9ZA 2X8CA 4H2PA 3ATRA 2IVDA 4RSLA 5KOWA 3P9UA 2ZZ0A 1MXTA 1COYA 4YJGB 1XHCA 4K2XA 3KVEA 1E1LA 1GT8A 2RABA 5U25A 3PVCA 1FCDA 2JKCA 1NDAA 1NG3A 3GYJA 4ADWA 3ZDNA 3P4QA 3ADAB 3GD3A 3BI4A 2WDVA 2B9WA 2BCPA 2XYOA 3AE8A 3B6DA 4H4PA 2YAUA 3RHAA 3KLJA 5KVHA 4WCTA 1MOKA 2VZ2A 4EQRA 2JBVA 3SGLA 4IVOB 3AWIA 3T14A 2O9ZA 1YY5A 2VOUA 4J33A 4EQSA 2EQ8A 3T2KA 2OLNA 4UDRA 5BRTA 4GDEA 2DU8A 4J31A 1BGJA 3DJEA 3EANA 3PO7A 3DH9A 2YVJA 4I58A 2GRTA 1SEZA 2B9XA 4NNJA 3NKSA 3NK1X 3T31A 1H6VA 2FBWA 1EVIA 1BKWA 2BC0A 4GF7A 4LIIA 2FJEA 4C74A 1F8SA 2GQWA 4TM1A 4CBQA 2HQMA 1IJHA 4J2WA 1O94A 4MJWA 3I6DA 3II4A 3SX6A 2QA1A 3NT6A 4Z24A 4K22A 1Q9IA 2IIDA 4Y4NA 1NHSA 1GTEA 5EOWA 2B7SA 2X8HA 1E6EA 2XVFA 2ZBWA 3EF6A 3NHOX 3ZNNA 3D8XA 3UKHA 3QSMA 2VVMA 2R45A 1Q1WA 4DSGA 2YR6A 1H84A 3W4KA 4EMJA 2EQ6A 4IA6A 3AYJA 1DODA 2XVHA 2DKIA 3AYIA 1JU2A 3BI2A 4IA5A 3UKKA 2UZZA 2WETA 4YSXA 3BNMA 4YTPA 5KMRA 1LQTA 2APGA 2BA9A 4U8NA 4U8JA 2J3NA 5J60A 1JRXA 1TDEA 1YKJA 3F8DA 2X99A 1JRYA 5KOXA 1KNPA 3VRAA 4NEVA 1LPFA 3BI5A 2YG7A 4II3A 1AN9A 3AEDA 1DXLA 3AE5A 3FG2P 3NIXA 2YLRA 4II2A 3UKPA 4NEWA 3UOVA 4ZCCA 1HYUA 3QSSA 3UKQA 2C7GA 3P4SA 4O5QA 4A5LA 4BURA 3SZFA 2YR4A 2GEWA 3GRSA 4Y4LA 1ZMCA 1E1NA 2ARDA 3AE2A 3Q9TA 4NTDA 2CULA 5U63A 2QA2A 2V3BA 2XVEA 3GWFA 2OA1A 3JSKA 5TR3A 4Z2TA 1LJ1A 2YLTA 5KXJA 2E4GA 1CBOA 1D7YA 3DK9A 4G73A 4U8KA 4LA1A 3O0HA 4BJZA 4H4UA 4EMIA 3IHGA 2AAQA 4TM0A 1DJQA 3HYXA 1FOHA 2DKHA 3G5SA 4FK1A 4YKGA 2WU5A 3AECA 1GRGA 4OPIA 4B67A 3AB1A 4H4RA 1NHRA 3NGCX 4ICYA 3PS9A 3AEAA 3LZXA 1VQWA 1Q1RA 4EIPA 1GALA 4Z43A 2FJAA 4X9MA 2IVEA 2WBAA 3UTEA 2Y6QA 2WPCA 3VQRA 3CIRA 1TDOA 3DK4A 1GRAA 5IQ1A 4J56A 1TDKA 2AQJA 1VDCA 3NK2X 2C64A 2BABA 2W0HA 4YXDA 4XWZA 5M10A 1NAAA 2Q0KA 5FMHA 4A7AA 5HHFA 4OCGA 1EL5A 3P1WA 2WPEA 3NYEA 2YQUA 4I59A 2YLSA 2TMDA 3G5RA 1PBFA 4AOSA 1D7LA 3ZNPA 4BJYA 1B5QA 2Z5YA 3ABVA 2VRMA 2GR1A 2ZZBA 4AT2A 4YTNA 2GMJA 4Z26A 2WEUA 4U8MA 2GB0A 2JK6A 3AEBA 2EQ7A 5DBJA 1GEUA 5HXIA 3ALJA 2ZZCA 4IV9A 5C3JA 3NG7X 3AE9A 2JB2A 3Q6JA 1FEBA 3WE0A 5KMPA 3QVRA 4YSYA 2XVJA 2XLTA 1F6MA 2H88A 1JNZA 3K7MX 2BCGG 3LOVA 3L1RA 4G74A 1C0PA 1GRBA 2BACA 3BHFA 1IUSA 1EL8A 3OZ2A 3IF9A 2GMHA 1FECA 1ZY8A 4TM3A 2XDOA 2YR5A 1KSUA 5KRQA 2Q0LA 1TDNA 1OJAA 2Q6UA 1L9EA 1JRZA 3ICTA 1GSNA 3CPJG 2A8XA 1X31B 4YJFB 4EQWA 1KNRA 3K30A 2E49A 2GH5A 1LV0A 3DMEA 4H4WA 3DGZA 2BS3A 4U2SA 4BK1A 4YSZA 2GAHB 2XCGA 2E82A 3DJJA 1S2YA 4OPTA 3HYWA 4H4XA 2X50A 3NTAA 4A79A 4YTMA 4YKFA 1UKVG 2BYBA 1Y56B 3LB8A 4A99A 4HB9A 2C65A 3DJGX 1ZDLA 3QJ4A 4GRTA 4APNA 4U2TA 1NHQA 1K4QA 4HA6A 3RP6A 1YQ3A 3NRNA 3UKFA 1S3EA 1Z6LA 2JB1A 4CNKA 3M13A 1PXBA 1GETA 4Z2RA 3QFAA 4OPLA 3E1TA 2ACZA 2E1MA 4H4YA 4JQ9A 1QLBA 3NN0X 1E1KA 2C70A 3GDPA 2BRYA 4CY6A 4OPDA 1ZOVA 3DGHA 5JCKA 1CC4A 2CVJA 1IUWA 3HZLA 5KNLA 2GR0A 3AD7B 2E48A 3T37A 1PJ5A 2V60A 4A6NA 4H2RA 2XLPA 1DAOA 1E7PA 5FS7A 5EB4A 2GR3A 2TPRA 4TLZA 1LTXR 4CNJA 5JCLA 2OLOA 2QAEA 3SZ0A 1MO9A 3VRBA 4BV6A 2E5VA 3CPIG 1C0LA 2WS3A 1VG9A 4KPRA 3UOXA 1PBBA 4H4TA 1H81A 4XXGA 4KX6A 3FIMB 4B1BA 4X4JA 3GWDA 4FX9A 2PHHA 2R0PA 2GF3A 2VRLA 4UDPA 3C96A 3QFBA 2XVIA 1L9DA 2QCUA 4FK1C 2BK5A 3CGDA 4B65A 5KMSA 3ALMA 1L0VA 4DNAA 4JDRA 1E1MA 1EL7A 2BXRA 2XLSA 1PHHA 4QFCA 2RGJA 4K5SA 1ONFA 4OPUA 5BULA 3HYVA 3I3LA 2FJDA 1IUXA 2XFPA 2WP6A 3AE7A 3NLCA 4J36A 4JY2A 3NYFA 4EIQA 1DNCA 3CGBA 2YG6A 3LXDA 1CF3A 2YLZA 4A6NB 3ICSA 4E0VA 1GV4A 1DOCA 1PXCA 1N4VA 2C72A 2GQFA 3GMCA 4Y4MA 1LQUA 5KVIA 4YT0A 4UP3A 1NENA 1H7XA 2Z5XA 2NPXA 3NYCA 3ITJA 3V3NA 4PAAA 3CNTA 1C0IA 3D1CA 4EMWA 4NWZA 3SZWA 1O5WA 4H2NA 1XDIA 2CFYA 3COXA 4FDCB 4OVIA 1DOEA 2CDUA 2YVFA 3AYLA 3GYXA 4U8LA 5KMQA 4B63A 4Z25A 3AE6A 1YQZA 2OAMA 3KPFA 1ZMDA 3KU9A 5FS9A 4H4ZA 3T2YA 3QSEA 4D03A 1H7WA 4BK3A 1ZKQA 3DJDA 4LU6A 3M12A 3AE3A 3WGTA 4YJFA 3T0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWL A;  4UDQ A;  4EM4 A;  3CND A;  1N4W A;  1REO A;  3UOZ A;  1D5T A;  3UTG A;  4AP3 A;  4CCQ A;  1DJN A;  1B8S A;  1NHP A;  1NG4 A;  1Y56 A;  4TM4 A;  1KF6 A;  1ZP0 A;  3P4P A;  3ZNO A;  1YQ4 A;  4ECH A;  2F5Z A;  3V3O A;  2C66 A;  2B9Y A;  1OJT A;  3G5Q A;  1ZK7 A;  1KIF A;  2X8G A;  3DK8 A;  1B4V A;  4BK2 A;  2WDQ A;  3QVP A;  4JNQ A;  3ATQ A;  2JAE A;  4K8D A;  2WQY A;  3H8L A;  4O5U A;  4K7Z A;  2C75 A;  4NTE A;  4U8I A;  3R9U A;  2XFO A;  1IUV A;  3VR8 A;  4CCR A;  4A9W A;  1D4E A;  1DDO A;  2A87 A;  3UCL A;  2BS2 A;  2GVC A;  2WES A;  4RG3 A;  4YJH B;  1Y0P A;  5FS8 A;  1KFY A;  2YG3 A;  4Z2U A;  2WP9 A;  5J7X A;  3ISH A;  2WU2 A;  3F8R A;  3AE4 A;  1IUT A;  4M52 A;  5GRT A;  4DGK A;  1OJ9 A;  3FBS A;  4B64 A;  2VQB A;  2BS4 A;  3NN6 X;  1CC6 A;  4X9N A;  2FJB A;  4GR1 A;  3C4N A;  2WP5 A;  2I0Z A;  2XFQ A;  2GV8 A;  4JN9 A;  4REK A;  4PAB A;  2EQ9 A;  3SFE A;  4C3Y A;  1B37 A;  4EM3 A;  3S5W A;  3M0O A;  2R0G A;  1VE9 A;  4K5R A;  1S3B A;  3AEF A;  4YWO A;  1C0K A;  3IWA A;  2V6O A;  3LAD A;  3SFD A;  1P2E A;  3CTY A;  1GRT A;  1PXA A;  1N1P A;  1H83 A;  1ELI A;  1XPQ A;  3ZNQ A;  1CL0 A;  2YVG A;  2R46 A;  3UTH A;  4XWR A;  3SQP A;  4CRT A;  1EL9 A;  1K0L A;  5CQF A;  5M0Z A;  3UP4 A;  4YSH A;  1PBD A;  1M6I A;  4GCM A;  4B68 A;  3CPH G;  5L46 A;  4C3X A;  1GTH A;  3BHK A;  4ZCD A;  3F8P A;  1DOB A;  2C3D A;  1BWC A;  4YJD A;  4IVM B;  2YLW A;  1AOG A;  3CNJ A;  4GDP A;  2VVL A;  2YG5 A;  3AD8 B;  2BK3 A;  3LZW A;  4OPG A;  3RP8 A;  2XLU A;  1K0I A;  1XAN A;  4JNA A;  2VVL G;  3VR9 A;  2XFU A;  4AT0 A;  2WPF A;  1D4D A;  3C4A A;  3CGC A;  3UKL A;  3LJP A;  3FMW A;  2AR8 A;  1GPE A;  3IC9 A;  1NPX A;  2V3A A;  3H8I A;  4NZH A;  1BGN A;  4DSH A;  1N4U A;  1CHU A;  1VG0 A;  2V5Z A;  3ZYX A;  2YLX A;  1CJ3 A;  1PJ7 A;  3NNE A;  3B3R A;  1NEK A;  2RGH A;  3NTD A;  4OPC A;  5IQ4 A;  1BZL A;  4U2L A;  4C77 A;  4H50 A;  2B76 A;  1ZOY A;  2Q7V A;  1E39 A;  3GDN A;  5JCI A;  2C76 A;  3FPZ A;  3KA7 A;  2JB3 A;  4U8P A;  1GND A;  1H86 A;  1TYP A;  3S61 A;  2YM2 A;  3GMB A;  3NH3 X;  2BXS A;  3CUK A;  3AEG A;  5HY5 A;  3NK0 X;  1O95 A;  5HYM A;  4P9S A;  1L9C A;  1VRQ B;  1ZX9 A;  1F8W A;  1FEA A;  3AD9 B;  3K7T A;  3P4R A;  2OAL A;  2YG4 A;  4Z44 A;  1JNR A;  1JOA A;  4H4V A;  4USQ A;  3ALL A;  3UP5 A;  1S2Q A;  5ER0 A;  1QO8 A;  1PBE A;  1W4X A;  5IPY A;  1P2H A;  3EAO A;  5CKU A;  1PS9 A;  2WOI A;  2XFN A;  1CC2 A;  1IUU A;  1TDF A;  4QFD A;  3BNU A;  4H7U A;  4AOX A;  3UKA A;  3OC4 A;  3L8K A;  3AE1 A;  5FS6 A;  1H82 A;  3SM8 A;  2GR2 A;  2NVK X;  2V61 A;  3URH A;  1RSG A;  4NTC A;  4J34 A;  2BC1 A;  5JCM A;  3AEE A;  1RYI A;  2H89 A;  3RNM A;  3CNP A;  3KD9 A;  2C67 A;  2RGO A;  2WOW A;  4U8O A;  4CY8 A;  3G3E A;  1CJ4 A;  1KDG A;  4D04 A;  4WX1 A;  2WDR A;  1M64 A;  1GRE A;  4J57 A;  4TLX A;  4A65 A;  2B7R A;  4YJH A;  1OJD A;  3W4J A;  1JEH A;  2WOV A;  3GYI A;  2GAG B;  3CGE A;  4B66 A;  2R4J A;  2A89 A;  3DA1 A;  3CN8 A;  5EB5 A;  3VRD B;  1LVL A;  5KWF A;  1OJC A;  5BUK A;  2PYX A;  1CJ2 A;  4ZN0 A;  2E4A A;  2YM1 A;  2VQ7 A;  3GRT A;  5BVA A;  3GD4 A;  2C73 A;  2WHD A;  1GRF A;  2R4E A;  4YJG A;  1EBD A;  1KSS A;  4EQX A;  4USR A;  1V59 A;  3K7Q X;  3UTF A;  2BK4 A;  2X3N A;  3UOY A;  5LV9 A;  1CJC A;  1BF3 A;  1TRB A;  3RP7 A;  5C2T A;  2C3C A;  3CNS A;  1TYT A;  3V76 A;  5U1O A;  3ICR A;  4C5O A;  1D4C A;  3EPT A;  4RG4 A;  4N9X A;  1QJD A;  1GER A;  5JCN A;  1F3P A;  1PBC A;  1F8R A;  2XLR A;  3IHM A;  3RED A;  5GSN A;  2R0C A;  3W4I A;  1GXF A;  3GSI A;  1RP0 A;  2Y6R A;  4H2Q A;  1PN0 A;  1GES A;  3H4K A;  4H4S A;  4H4Q A;  4JY3 A;  3KKJ A;  1PJ6 A;  1FL2 A;  1GOS A;  4GUV A;  4AP1 A;  1K0J A;  5EBK A;  1GRH A;  3AXB A;  4B69 A;  1PDH A;  2R9Z A;  2X8C A;  4H2P A;  3ATR A;  2IVD A;  4RSL A;  5KOW A;  3P9U A;  2ZZ0 A;  1MXT A;  1COY A;  4YJG B;  1XHC A;  4K2X A;  3KVE A;  1E1L A;  1GT8 A;  2RAB A;  5U25 A;  3PVC A;  1FCD A;  2JKC A;  1NDA A;  1NG3 A;  3GYJ A;  4ADW A;  3ZDN A;  3P4Q A;  3ADA B;  3GD3 A;  3BI4 A;  2WDV A;  2B9W A;  2BCP A;  2XYO A;  3AE8 A;  3B6D A;  4H4P A;  2YAU A;  3RHA A;  3KLJ A;  5KVH A;  4WCT A;  1MOK A;  2VZ2 A;  4EQR A;  2JBV A;  3SGL A;  4IVO B;  3AWI A;  2O9Z A;  1YY5 A;  2VOU A;  4J33 A;  4EQS A;  2EQ8 A;  2OLN A;  4UDR A;  5BRT A;  4GDE A;  2DU8 A;  4J31 A;  1BGJ A;  3DJE A;  3EAN A;  3PO7 A;  3DH9 A;  2YVJ A;  4I58 A;  2GRT A;  1SEZ A;  2B9X A;  3NKS A;  3NK1 X;  1H6V A;  2FBW A;  1EVI A;  1BKW A;  2BC0 A;  4GF7 A;  4LII A;  2FJE A;  4C74 A;  1F8S A;  2GQW A;  4TM1 A;  4CBQ A;  2HQM A;  1IJH A;  4J2W A;  1O94 A;  4MJW A;  3I6D A;  3II4 A;  2QA1 A;  3NT6 A;  4Z24 A;  4K22 A;  1Q9I A;  2IID A;  4Y4N A;  1NHS A;  1GTE A;  5EOW A;  2B7S A;  2X8H A;  1E6E A;  2XVF A;  2ZBW A;  3EF6 A;  3NHO X;  3ZNN A;  3D8X A;  3UKH A;  3QSM A;  2VVM A;  2R45 A;  1Q1W A;  4DSG A;  2YR6 A;  1H84 A;  3W4K A;  4EMJ A;  2EQ6 A;  4IA6 A;  3AYJ A;  1DOD A;  2XVH A;  2DKI A;  3AYI A;  1JU2 A;  3BI2 A;  4IA5 A;  3UKK A;  2UZZ A;  2WET A;  4YSX A;  3BNM A;  4YTP A;  1LQT A;  2APG A;  2BA9 A;  4U8N A;  4U8J A;  2J3N A;  5J60 A;  1JRX A;  1TDE A;  1YKJ A;  3F8D A;  2X99 A;  1JRY A;  5KOX A;  1KNP A;  3VRA A;  4NEV A;  1LPF A;  3BI5 A;  2YG7 A;  1AN9 A;  3AED A;  1DXL A;  3AE5 A;  3FG2 P;  3NIX A;  2YLR A;  3UKP A;  4NEW A;  3UOV A;  4ZCC A;  1HYU A;  3QSS A;  3UKQ A;  2C7G A;  3P4S A;  4O5Q A;  4A5L A;  4BUR A;  2YR4 A;  2GEW A;  3GRS A;  4Y4L A;  1ZMC A;  1E1N A;  2ARD A;  3AE2 A;  3Q9T A;  4NTD A;  2CUL A;  5U63 A;  2QA2 A;  2V3B A;  2XVE A;  3GWF A;  2OA1 A;  3JSK A;  5TR3 A;  4Z2T A;  1LJ1 A;  2YLT A;  5KXJ A;  2E4G A;  1CBO A;  1D7Y A;  3DK9 A;  4U8K A;  4LA1 A;  3O0H A;  4BJZ A;  4H4U A;  4EMI A;  3IHG A;  2AAQ A;  4TM0 A;  1DJQ A;  1FOH A;  2DKH A;  3G5S A;  4FK1 A;  4YKG A;  2WU5 A;  3AEC A;  1GRG A;  4OPI A;  4B67 A;  3AB1 A;  4H4R A;  1NHR A;  3NGC X;  4ICY A;  3PS9 A;  3AEA A;  3LZX A;  1VQW A;  1Q1R A;  4EIP A;  1GAL A;  4Z43 A;  2FJA A;  4X9M A;  2IVE A;  2WBA A;  3UTE A;  2Y6Q A;  2WPC A;  3VQR A;  3CIR A;  1TDO A;  3DK4 A;  1GRA A;  5IQ1 A;  4J56 A;  1TDK A;  2AQJ A;  1VDC A;  3NK2 X;  2C64 A;  2BAB A;  2W0H A;  4YXD A;  4XWZ A;  5M10 A;  1NAA A;  2Q0K A;  5FMH A;  4A7A A;  5HHF A;  4OCG A;  1EL5 A;  3P1W A;  2WPE A;  3NYE A;  2YQU A;  4I59 A;  2YLS A;  2TMD A;  3G5R A;  1PBF A;  4AOS A;  1D7L A;  3ZNP A;  4BJY A;  1B5Q A;  2Z5Y A;  3ABV A;  2VRM A;  2GR1 A;  2ZZB A;  4AT2 A;  4YTN A;  2GMJ A;  4Z26 A;  2WEU A;  4U8M A;  2GB0 A;  2JK6 A;  3AEB A;  2EQ7 A;  5DBJ A;  1GEU A;  5HXI A;  3ALJ A;  2ZZC A;  4IV9 A;  5C3J A;  3NG7 X;  3AE9 A;  2JB2 A;  3Q6J A;  1FEB A;  3WE0 A;  3QVR A;  4YSY A;  2XVJ A;  2XLT A;  1F6M A;  2H88 A;  1JNZ A;  3K7M X;  2BCG G;  3LOV A;  3L1R A;  1C0P A;  1GRB A;  2BAC A;  3BHF A;  1IUS A;  1EL8 A;  3OZ2 A;  3IF9 A;  2GMH A;  1FEC A;  1ZY8 A;  4TM3 A;  2XDO A;  2YR5 A;  1KSU A;  5KRQ A;  2Q0L A;  1TDN A;  1OJA A;  2Q6U A;  1L9E A;  1JRZ A;  3ICT A;  1GSN A;  3CPJ G;  2A8X A;  1X31 B;  4YJF B;  4EQW A;  1KNR A;  3K30 A;  2E49 A;  2GH5 A;  1LV0 A;  3DME A;  4H4W A;  3DGZ A;  2BS3 A;  4U2S A;  4BK1 A;  4YSZ A;  2GAH B;  2XCG A;  2E82 A;  3DJJ A;  1S2Y A;  4OPT A;  4H4X A;  2X50 A;  3NTA A;  4A79 A;  4YTM A;  4YKF A;  1UKV G;  2BYB A;  1Y56 B;  3LB8 A;  4A99 A;  4HB9 A;  2C65 A;  3DJG X;  1ZDL A;  3QJ4 A;  4GRT A;  4APN A;  4U2T A;  1NHQ A;  1K4Q A;  4HA6 A;  3RP6 A;  1YQ3 A;  3NRN A;  3UKF A;  1S3E A;  1Z6L A;  2JB1 A;  4CNK A;  3M13 A;  1PXB A;  1GET A;  4Z2R A;  3QFA A;  4OPL A;  3E1T A;  2ACZ A;  2E1M A;  4H4Y A;  4JQ9 A;  1QLB A;  3NN0 X;  1E1K A;  2C70 A;  3GDP A;  4CY6 A;  4OPD A;  1ZOV A;  3DGH A;  5JCK A;  1CC4 A;  2CVJ A;  1IUW A;  3HZL A;  2GR0 A;  3AD7 B;  2E48 A;  3T37 A;  1PJ5 A;  2V60 A;  4A6N A;  4H2R A;  2XLP A;  1DAO A;  1E7P A;  5FS7 A;  5EB4 A;  2GR3 A;  2TPR A;  4TLZ A;  1LTX R;  4CNJ A;  5JCL A;  2OLO A;  2QAE A;  4BV6 A;  1MO9 A;  3VRB A;  2E5V A;  3CPI G;  1C0L A;  2WS3 A;  1VG9 A;  4KPR A;  3UOX A;  1PBB A;  4H4T A;  1H81 A;  4XXG A;  4KX6 A;  3FIM B;  4B1B A;  4X4J A;  3GWD A;  4FX9 A;  2PHH A;  2R0P A;  2GF3 A;  2VRL A;  4UDP A;  3C96 A;  3QFB A;  2XVI A;  1L9D A;  2QCU A;  4FK1 C;  2BK5 A;  3CGD A;  4B65 A;  3ALM A;  1L0V A;  4DNA A;  4JDR A;  1E1M A;  1EL7 A;  2BXR A;  2XLS A;  1PHH A;  4QFC A;  2RGJ A;  4K5S A;  1ONF A;  4OPU A;  5BUL A;  3I3L A;  2FJD A;  1IUX A;  2XFP A;  2WP6 A;  3AE7 A;  3NLC A;  4J36 A;  4JY2 A;  3NYF A;  4EIQ A;  1DNC A;  3CGB A;  2YG6 A;  3LXD A;  1CF3 A;  2YLZ A;  4A6N B;  3ICS A;  4E0V A;  1GV4 A;  1DOC A;  1PXC A;  1N4V A;  2C72 A;  2GQF A;  3GMC A;  4Y4M A;  1LQU A;  5KVI A;  4YT0 A;  4UP3 A;  1NEN A;  1H7X A;  2Z5X A;  2NPX A;  3NYC A;  3ITJ A;  3V3N A;  4PAA A;  3CNT A;  1C0I A;  3D1C A;  4EMW A;  1O5W A;  4H2N A;  1XDI A;  2CFY A;  3COX A;  4FDC B;  4OVI A;  1DOE A;  2CDU A;  2YVF A;  3AYL A;  4U8L A;  4B63 A;  4Z25 A;  3AE6 A;  1YQZ A;  2OAM A;  3KPF A;  1ZMD A;  3KU9 A;  5FS9 A;  4H4Z A;  3QSE A;  4D03 A;  1H7W A;  4BK3 A;  1ZKQ A;  3DJD A;  4LU6 A;  3M12 A;  3AE3 A;  3WGT A;  4YJF A; 
#chains in the Genus database with same CATH topology
 2YWL A;  4UDQ A;  4EM4 A;  3CND A;  1N4W A;  1REO A;  3UOZ A;  1D5T A;  3UTG A;  4AP3 A;  4CCQ A;  1DJN A;  1B8S A;  1NHP A;  1NG4 A;  1Y56 A;  4TM4 A;  1KF6 A;  1ZP0 A;  3P4P A;  3ZNO A;  1YQ4 A;  4ECH A;  2F5Z A;  3V3O A;  2C66 A;  2B9Y A;  1OJT A;  3G5Q A;  1ZK7 A;  1KIF A;  4BK2 A;  2X8G A;  1B4V A;  3DK8 A;  2WDQ A;  3QVP A;  4JNQ A;  4G9K A;  3ATQ A;  4G6H A;  2JAE A;  4K8D A;  2WQY A;  3H8L A;  2BRA A;  4K7Z A;  4O5U A;  2C75 A;  4NTE A;  4U8I A;  3R9U A;  2XFO A;  1IUV A;  3VR8 A;  4CCR A;  4A9W A;  1D4E A;  1DDO A;  2A87 A;  3UCL A;  2BS2 A;  2GVC A;  2WES A;  4RG3 A;  4YJH B;  1Y0P A;  5FS8 A;  1KFY A;  2YG3 A;  4Z2U A;  2WP9 A;  4GAV A;  5J7X A;  3ISH A;  2WU2 A;  3SZC A;  3F8R A;  3AE4 A;  1IUT A;  4M52 A;  5GRT A;  4DGK A;  1OJ9 A;  3FBS A;  4B64 A;  2VQB A;  2BS4 A;  3NN6 X;  1CC6 A;  4X9N A;  2FJB A;  4GR1 A;  3C4N A;  2WP5 A;  2I0Z A;  2XFQ A;  2GV8 A;  4JN9 A;  4REK A;  4PAB A;  2EQ9 A;  3SFE A;  4C3Y A;  1B37 A;  4EM3 A;  3S5W A;  2R0G A;  3M0O A;  1VE9 A;  4K5R A;  1S3B A;  3AEF A;  4YWO A;  1C0K A;  3IWA A;  2V6O A;  3LAD A;  3SFD A;  1P2E A;  4G6G A;  3CTY A;  1GRT A;  1PXA A;  1N1P A;  1H83 A;  1ELI A;  3KPK A;  1XPQ A;  3ZNQ A;  1CL0 A;  2YVG A;  4GAP A;  2R46 A;  3UTH A;  4XWR A;  3SQP A;  4CRT A;  1EL9 A;  1K0L A;  5CQF A;  5M0Z A;  3UP4 A;  4YSH A;  1PBD A;  1M6I A;  4GCM A;  4B68 A;  3CPH G;  5L46 A;  4C3X A;  1GTH A;  3BHK A;  4ZCD A;  3F8P A;  1DOB A;  2C3D A;  1BWC A;  4YJD A;  4IVM B;  2YLW A;  1AOG A;  3CNJ A;  4GDP A;  2VVL A;  2YG5 A;  3AD8 B;  3RP8 A;  2BK3 A;  3LZW A;  4OPG A;  2XLU A;  1K0I A;  1XAN A;  4JNA A;  2VVL G;  3VR9 A;  2XFU A;  4AT0 A;  2WPF A;  3C4A A;  1D4D A;  3CGC A;  3UKL A;  3LJP A;  3FMW A;  2AR8 A;  1GPE A;  3IC9 A;  1NPX A;  2V3A A;  3H8I A;  4NZH A;  1BGN A;  4DSH A;  1N4U A;  1CHU A;  1VG0 A;  2V5Z A;  3ZYX A;  2YLX A;  1CJ3 A;  1PJ7 A;  3NNE A;  3B3R A;  1NEK A;  2RGH A;  3NTD A;  4OPC A;  5IQ4 A;  1BZL A;  4U2L A;  4C77 A;  4H50 A;  2B76 A;  1ZOY A;  2Q7V A;  1E39 A;  3GDN A;  3T2Z A;  5JCI A;  2C76 A;  3FPZ A;  3KA7 A;  2JB3 A;  4U8P A;  1GND A;  1H86 A;  1TYP A;  3S61 A;  3GMB A;  2YM2 A;  3NH3 X;  2BXS A;  3CUK A;  3AEG A;  5HY5 A;  3NK0 X;  5HYM A;  1O95 A;  4P9S A;  1L9C A;  1VRQ B;  1ZX9 A;  1F8W A;  1FEA A;  3AD9 B;  3K7T A;  3P4R A;  2OAL A;  2YG4 A;  4Z44 A;  1JNR A;  1JOA A;  4H4V A;  4USQ A;  3ALL A;  3UP5 A;  1S2Q A;  5ER0 A;  1QO8 A;  1PBE A;  1W4X A;  5IPY A;  1P2H A;  3EAO A;  5CKU A;  1PS9 A;  2WOI A;  2XFN A;  1CC2 A;  1IUU A;  1TDF A;  4QFD A;  3BNU A;  4H7U A;  4AOX A;  3UKA A;  3OC4 A;  3L8K A;  3AE1 A;  5FS6 A;  1H82 A;  3SM8 A;  2GR2 A;  2NVK X;  2V61 A;  3URH A;  1RSG A;  4NTC A;  4J34 A;  2BC1 A;  5JCM A;  3AEE A;  1RYI A;  2H89 A;  3RNM A;  3CNP A;  3KD9 A;  2C67 A;  2RGO A;  2WOW A;  4U8O A;  4CY8 A;  3G3E A;  1CJ4 A;  1KDG A;  4D04 A;  4WX1 A;  2WDR A;  1M64 A;  1GRE A;  4J57 A;  4TLX A;  4A65 A;  2B7R A;  4YJH A;  1OJD A;  3W4J A;  1JEH A;  2WOV A;  3GYI A;  2GAG B;  3CGE A;  4B66 A;  2R4J A;  2A89 A;  3DA1 A;  3CN8 A;  5EB5 A;  3VRD B;  1LVL A;  5KWF A;  1OJC A;  5BUK A;  2PYX A;  1CJ2 A;  4ZN0 A;  3SXI A;  2E4A A;  2YM1 A;  2VQ7 A;  3GRT A;  5BVA A;  3GD4 A;  2C73 A;  2WHD A;  1GRF A;  2R4E A;  4YJG A;  1EBD A;  1KSS A;  4EQX A;  4USR A;  1V59 A;  3K7Q X;  3UTF A;  2BK4 A;  2X3N A;  3UOY A;  5LV9 A;  1CJC A;  1BF3 A;  3RP7 A;  1TRB A;  5C2T A;  2C3C A;  3CNS A;  1TYT A;  3V76 A;  5U1O A;  3ICR A;  3SY4 A;  4C5O A;  3EPT A;  1D4C A;  4RG4 A;  4N9X A;  1QJD A;  1GER A;  5JCN A;  1F3P A;  1PBC A;  1F8R A;  2XLR A;  3IHM A;  3RED A;  5GSN A;  3SYI A;  2R0C A;  3W4I A;  1GXF A;  3GSI A;  1RP0 A;  2Y6R A;  4H2Q A;  1PN0 A;  1GES A;  3H4K A;  4H4S A;  4H4Q A;  4JY3 A;  3KKJ A;  1PJ6 A;  1FL2 A;  1GOS A;  4GUV A;  2C4C A;  3CMM A;  1K0J A;  4AP1 A;  5EBK A;  1GRH A;  3AXB A;  4B69 A;  1PDH A;  2R9Z A;  2X8C A;  4H2P A;  3ATR A;  2IVD A;  4RSL A;  5KOW A;  3P9U A;  2ZZ0 A;  1MXT A;  1COY A;  4YJG B;  1XHC A;  4K2X A;  3KVE A;  1E1L A;  1GT8 A;  2RAB A;  5U25 A;  3PVC A;  1FCD A;  2JKC A;  1NDA A;  1NG3 A;  3GYJ A;  4ADW A;  3ZDN A;  3P4Q A;  3ADA B;  3GD3 A;  3BI4 A;  2WDV A;  2B9W A;  2BCP A;  2XYO A;  3AE8 A;  3B6D A;  4H4P A;  2YAU A;  3RHA A;  3KLJ A;  5KVH A;  4WCT A;  1MOK A;  2VZ2 A;  4EQR A;  2JBV A;  3SGL A;  4IVO B;  3AWI A;  3T14 A;  2VOU A;  1YY5 A;  2O9Z A;  4J33 A;  4EQS A;  2EQ8 A;  3T2K A;  2OLN A;  4UDR A;  5BRT A;  4GDE A;  2DU8 A;  4J31 A;  1BGJ A;  3DJE A;  3EAN A;  3PO7 A;  3DH9 A;  2YVJ A;  4I58 A;  2GRT A;  1SEZ A;  2B9X A;  4NNJ A;  3NKS A;  3NK1 X;  3T31 A;  4GF7 A;  1H6V A;  1EVI A;  1BKW A;  2BC0 A;  2FBW A;  4LII A;  2FJE A;  4C74 A;  1F8S A;  2GQW A;  4TM1 A;  4CBQ A;  2HQM A;  1IJH A;  4J2W A;  1O94 A;  4MJW A;  3I6D A;  3II4 A;  3SX6 A;  2QA1 A;  3NT6 A;  4Z24 A;  4K22 A;  1Q9I A;  2IID A;  4Y4N A;  1NHS A;  1GTE A;  5EOW A;  2B7S A;  2X8H A;  1E6E A;  2XVF A;  2ZBW A;  3EF6 A;  3NHO X;  3ZNN A;  3D8X A;  3UKH A;  3QSM A;  2VVM A;  2R45 A;  1Q1W A;  4DSG A;  2YR6 A;  1H84 A;  3W4K A;  4EMJ A;  2EQ6 A;  4IA6 A;  3AYJ A;  1DOD A;  2XVH A;  2DKI A;  3AYI A;  1JU2 A;  3BI2 A;  4IA5 A;  3UKK A;  2UZZ A;  2WET A;  4YSX A;  3BNM A;  4YTP A;  5KMR A;  1LQT A;  2APG A;  2BA9 A;  4U8N A;  4U8J A;  2J3N A;  5J60 A;  1JRX A;  1TDE A;  1YKJ A;  3F8D A;  2X99 A;  1JRY A;  5KOX A;  1KNP A;  3VRA A;  4NEV A;  1LPF A;  3BI5 A;  2YG7 A;  4II3 A;  1AN9 A;  3AED A;  1DXL A;  3AE5 A;  3FG2 P;  3NIX A;  2YLR A;  4II2 A;  3UKP A;  4NEW A;  3UOV A;  4ZCC A;  1HYU A;  3QSS A;  3UKQ A;  2C7G A;  3P4S A;  4O5Q A;  4A5L A;  4BUR A;  3SZF A;  2YR4 A;  2GEW A;  3GRS A;  4Y4L A;  1ZMC A;  1E1N A;  2ARD A;  3AE2 A;  3Q9T A;  4NTD A;  2CUL A;  5U63 A;  2QA2 A;  2V3B A;  2XVE A;  3GWF A;  2OA1 A;  3JSK A;  5TR3 A;  4Z2T A;  1LJ1 A;  2YLT A;  5KXJ A;  2E4G A;  1CBO A;  1D7Y A;  3DK9 A;  4G73 A;  4U8K A;  4LA1 A;  3O0H A;  4BJZ A;  4H4U A;  4EMI A;  3IHG A;  2AAQ A;  4TM0 A;  1DJQ A;  3HYX A;  1FOH A;  2DKH A;  3G5S A;  4FK1 A;  4YKG A;  2WU5 A;  3AEC A;  1GRG A;  4OPI A;  4B67 A;  3AB1 A;  4H4R A;  1NHR A;  3NGC X;  4ICY A;  3PS9 A;  3AEA A;  3LZX A;  1VQW A;  1Q1R A;  4EIP A;  1GAL A;  4Z43 A;  2FJA A;  4X9M A;  2IVE A;  2WBA A;  3UTE A;  2Y6Q A;  2WPC A;  3VQR A;  3CIR A;  1TDO A;  3DK4 A;  1GRA A;  5IQ1 A;  4J56 A;  1TDK A;  2AQJ A;  1VDC A;  3NK2 X;  2C64 A;  2BAB A;  2W0H A;  4YXD A;  4XWZ A;  5M10 A;  1NAA A;  2Q0K A;  5FMH A;  4A7A A;  5HHF A;  4OCG A;  1EL5 A;  3P1W A;  2WPE A;  3NYE A;  2YQU A;  4I59 A;  2YLS A;  2TMD A;  3G5R A;  1PBF A;  4AOS A;  1D7L A;  3ZNP A;  4BJY A;  1B5Q A;  2Z5Y A;  3ABV A;  2VRM A;  2GR1 A;  2ZZB A;  4AT2 A;  4YTN A;  2GMJ A;  4Z26 A;  2WEU A;  4U8M A;  2GB0 A;  2JK6 A;  3AEB A;  5HXI A;  2EQ7 A;  1GEU A;  5DBJ A;  3ALJ A;  2ZZC A;  4IV9 A;  5C3J A;  3NG7 X;  3AE9 A;  2JB2 A;  3Q6J A;  1FEB A;  3WE0 A;  5KMP A;  3QVR A;  4YSY A;  2XVJ A;  2XLT A;  1F6M A;  2H88 A;  1JNZ A;  3K7M X;  2BCG G;  3LOV A;  3L1R A;  4G74 A;  1C0P A;  1GRB A;  2BAC A;  3BHF A;  1IUS A;  1EL8 A;  3OZ2 A;  3IF9 A;  2GMH A;  1FEC A;  1ZY8 A;  4TM3 A;  2XDO A;  2YR5 A;  1KSU A;  5KRQ A;  2Q0L A;  1TDN A;  1OJA A;  2Q6U A;  1L9E A;  1JRZ A;  3ICT A;  1GSN A;  3CPJ G;  2A8X A;  1X31 B;  4YJF B;  4EQW A;  1KNR A;  3K30 A;  2E49 A;  2GH5 A;  1LV0 A;  3DME A;  4H4W A;  3DGZ A;  2BS3 A;  4BK1 A;  4U2S A;  4YSZ A;  2GAH B;  2XCG A;  2E82 A;  3DJJ A;  1S2Y A;  4OPT A;  3HYW A;  4H4X A;  2X50 A;  3NTA A;  4A79 A;  4YTM A;  4YKF A;  1UKV G;  2BYB A;  1Y56 B;  3LB8 A;  4A99 A;  4HB9 A;  2C65 A;  3DJG X;  1ZDL A;  3QJ4 A;  4GRT A;  4APN A;  4U2T A;  1NHQ A;  1K4Q A;  3RP6 A;  4HA6 A;  1YQ3 A;  3NRN A;  3UKF A;  1S3E A;  1Z6L A;  2JB1 A;  4CNK A;  3M13 A;  1PXB A;  1GET A;  4Z2R A;  3QFA A;  4OPL A;  3E1T A;  2ACZ A;  2E1M A;  4H4Y A;  4JQ9 A;  1QLB A;  3NN0 X;  1E1K A;  2C70 A;  3GDP A;  2BRY A;  4CY6 A;  4OPD A;  1ZOV A;  3DGH A;  5JCK A;  1CC4 A;  2CVJ A;  1IUW A;  3HZL A;  5KNL A;  2GR0 A;  3AD7 B;  2E48 A;  3T37 A;  1PJ5 A;  2V60 A;  4A6N A;  4H2R A;  2XLP A;  1DAO A;  1E7P A;  5FS7 A;  5EB4 A;  2GR3 A;  2TPR A;  4TLZ A;  1LTX R;  4CNJ A;  5JCL A;  2OLO A;  2QAE A;  3SZ0 A;  1MO9 A;  3VRB A;  4BV6 A;  2E5V A;  3CPI G;  1C0L A;  2WS3 A;  1VG9 A;  4KPR A;  3UOX A;  1PBB A;  4H4T A;  1H81 A;  4XXG A;  4KX6 A;  3FIM B;  4B1B A;  4X4J A;  3GWD A;  4FX9 A;  2PHH A;  2R0P A;  2GF3 A;  2VRL A;  4UDP A;  3C96 A;  3QFB A;  2XVI A;  1L9D A;  2QCU A;  4FK1 C;  2BK5 A;  3CGD A;  4B65 A;  5KMS A;  3ALM A;  1L0V A;  4DNA A;  4JDR A;  1E1M A;  1EL7 A;  2BXR A;  2XLS A;  1PHH A;  2RGJ A;  4QFC A;  4K5S A;  1ONF A;  4OPU A;  5BUL A;  3HYV A;  3I3L A;  2FJD A;  1IUX A;  2XFP A;  2WP6 A;  3AE7 A;  3NLC A;  4JY2 A;  4EIQ A;  3NYF A;  4J36 A;  1DNC A;  3CGB A;  2YG6 A;  3LXD A;  1CF3 A;  2YLZ A;  4A6N B;  3ICS A;  4E0V A;  3GMC A;  1DOC A;  1PXC A;  1GV4 A;  1N4V A;  2C72 A;  2GQF A;  4Y4M A;  1LQU A;  5KVI A;  4YT0 A;  4UP3 A;  1NEN A;  1H7X A;  2Z5X A;  2NPX A;  3NYC A;  3ITJ A;  3V3N A;  4PAA A;  3CNT A;  1C0I A;  3D1C A;  4EMW A;  4NWZ A;  3SZW A;  1O5W A;  4H2N A;  1XDI A;  2CFY A;  3COX A;  4FDC B;  4OVI A;  1DOE A;  2CDU A;  2YVF A;  3AYL A;  3GYX A;  4U8L A;  5KMQ A;  4B63 A;  4Z25 A;  3AE6 A;  1YQZ A;  2OAM A;  3KPF A;  1ZMD A;  3KU9 A;  5FS9 A;  4H4Z A;  3T2Y A;  3QSE A;  4D03 A;  4BK3 A;  1H7W A;  1ZKQ A;  3DJD A;  4LU6 A;  3M12 A;  3AE3 A;  3WGT A;  4YJF A;  3T0K A; 
#chains in the Genus database with same CATH homology
 2YWL A;  4UDQ A;  4EM4 A;  3CND A;  1N4W A;  1REO A;  3UOZ A;  1D5T A;  3UTG A;  4AP3 A;  4CCQ A;  1DJN A;  1B8S A;  1NHP A;  1NG4 A;  1Y56 A;  4TM4 A;  1KF6 A;  1ZP0 A;  3P4P A;  3ZNO A;  1YQ4 A;  4ECH A;  2F5Z A;  3V3O A;  2C66 A;  2B9Y A;  1OJT A;  3G5Q A;  1ZK7 A;  1KIF A;  2X8G A;  3DK8 A;  1B4V A;  4BK2 A;  2WDQ A;  3QVP A;  4JNQ A;  4G9K A;  3ATQ A;  4G6H A;  2JAE A;  4K8D A;  2WQY A;  3H8L A;  2BRA A;  4K7Z A;  4O5U A;  2C75 A;  4NTE A;  4U8I A;  3R9U A;  2XFO A;  1IUV A;  3VR8 A;  4CCR A;  4A9W A;  1D4E A;  1DDO A;  2A87 A;  3UCL A;  2BS2 A;  2GVC A;  2WES A;  4RG3 A;  4YJH B;  1Y0P A;  5FS8 A;  1KFY A;  2YG3 A;  4Z2U A;  2WP9 A;  4GAV A;  5J7X A;  3ISH A;  2WU2 A;  3SZC A;  3F8R A;  3AE4 A;  1IUT A;  4M52 A;  5GRT A;  4DGK A;  1OJ9 A;  3FBS A;  4B64 A;  2VQB A;  2BS4 A;  3NN6 X;  1CC6 A;  4X9N A;  2FJB A;  4GR1 A;  3C4N A;  2WP5 A;  2I0Z A;  2XFQ A;  2GV8 A;  4JN9 A;  4REK A;  4PAB A;  2EQ9 A;  3SFE A;  4C3Y A;  1B37 A;  4EM3 A;  3S5W A;  3M0O A;  2R0G A;  1VE9 A;  4K5R A;  1S3B A;  3AEF A;  4YWO A;  1C0K A;  3IWA A;  2V6O A;  3LAD A;  3SFD A;  1P2E A;  4G6G A;  3CTY A;  1GRT A;  1PXA A;  1N1P A;  1H83 A;  1ELI A;  3KPK A;  1XPQ A;  3ZNQ A;  1CL0 A;  2YVG A;  4GAP A;  2R46 A;  3UTH A;  4XWR A;  3SQP A;  4CRT A;  1EL9 A;  1K0L A;  5CQF A;  5M0Z A;  3UP4 A;  4YSH A;  1PBD A;  1M6I A;  4GCM A;  4B68 A;  3CPH G;  5L46 A;  4C3X A;  1GTH A;  3BHK A;  4ZCD A;  3F8P A;  1DOB A;  2C3D A;  1BWC A;  4YJD A;  4IVM B;  2YLW A;  1AOG A;  3CNJ A;  4GDP A;  2VVL A;  2YG5 A;  3AD8 B;  2BK3 A;  3LZW A;  4OPG A;  3RP8 A;  2XLU A;  1K0I A;  1XAN A;  4JNA A;  2VVL G;  3VR9 A;  2XFU A;  4AT0 A;  2WPF A;  1D4D A;  3C4A A;  3CGC A;  3UKL A;  3LJP A;  3FMW A;  2AR8 A;  1GPE A;  3IC9 A;  1NPX A;  2V3A A;  3H8I A;  4NZH A;  1BGN A;  4DSH A;  1N4U A;  1CHU A;  1VG0 A;  2V5Z A;  3ZYX A;  2YLX A;  1CJ3 A;  1PJ7 A;  3NNE A;  3B3R A;  1NEK A;  2RGH A;  3NTD A;  4OPC A;  5IQ4 A;  1BZL A;  4U2L A;  4C77 A;  4H50 A;  2B76 A;  1ZOY A;  2Q7V A;  1E39 A;  3GDN A;  3T2Z A;  5JCI A;  2C76 A;  3FPZ A;  3KA7 A;  2JB3 A;  4U8P A;  1GND A;  1H86 A;  1TYP A;  3S61 A;  2YM2 A;  3GMB A;  3NH3 X;  2BXS A;  3CUK A;  3AEG A;  5HY5 A;  3NK0 X;  1O95 A;  5HYM A;  4P9S A;  1L9C A;  1VRQ B;  1ZX9 A;  1F8W A;  1FEA A;  3AD9 B;  3K7T A;  3P4R A;  2OAL A;  2YG4 A;  4Z44 A;  1JNR A;  1JOA A;  4H4V A;  4USQ A;  3ALL A;  3UP5 A;  1S2Q A;  5ER0 A;  1QO8 A;  1PBE A;  1W4X A;  5IPY A;  1P2H A;  3EAO A;  5CKU A;  1PS9 A;  2WOI A;  2XFN A;  1CC2 A;  1IUU A;  1TDF A;  4QFD A;  3BNU A;  4H7U A;  4AOX A;  3UKA A;  3OC4 A;  3L8K A;  3AE1 A;  5FS6 A;  1H82 A;  3SM8 A;  2GR2 A;  2NVK X;  2V61 A;  3URH A;  1RSG A;  4NTC A;  4J34 A;  2BC1 A;  5JCM A;  3AEE A;  1RYI A;  2H89 A;  3RNM A;  3CNP A;  3KD9 A;  2C67 A;  2RGO A;  2WOW A;  4U8O A;  4CY8 A;  3G3E A;  1CJ4 A;  1KDG A;  4D04 A;  4WX1 A;  2WDR A;  1M64 A;  1GRE A;  4J57 A;  4TLX A;  4A65 A;  2B7R A;  4YJH A;  1OJD A;  3W4J A;  1JEH A;  2WOV A;  3GYI A;  2GAG B;  3CGE A;  4B66 A;  2R4J A;  2A89 A;  3DA1 A;  3CN8 A;  5EB5 A;  3VRD B;  1LVL A;  5KWF A;  1OJC A;  5BUK A;  2PYX A;  1CJ2 A;  4ZN0 A;  3SXI A;  2E4A A;  2YM1 A;  2VQ7 A;  3GRT A;  5BVA A;  3GD4 A;  2C73 A;  2WHD A;  1GRF A;  2R4E A;  4YJG A;  1EBD A;  1KSS A;  4EQX A;  4USR A;  1V59 A;  3K7Q X;  3UTF A;  2BK4 A;  2X3N A;  3UOY A;  5LV9 A;  1CJC A;  1BF3 A;  1TRB A;  3RP7 A;  5C2T A;  2C3C A;  3CNS A;  1TYT A;  3V76 A;  5U1O A;  3ICR A;  3SY4 A;  4C5O A;  1D4C A;  3EPT A;  4RG4 A;  4N9X A;  1QJD A;  1GER A;  5JCN A;  1F3P A;  1PBC A;  1F8R A;  2XLR A;  3IHM A;  3RED A;  5GSN A;  3SYI A;  2R0C A;  3W4I A;  1GXF A;  3GSI A;  1RP0 A;  2Y6R A;  4H2Q A;  1PN0 A;  1GES A;  3H4K A;  4H4S A;  4H4Q A;  4JY3 A;  3KKJ A;  1PJ6 A;  1FL2 A;  1GOS A;  4GUV A;  2C4C A;  3CMM A;  1K0J A;  4AP1 A;  5EBK A;  1GRH A;  3AXB A;  4B69 A;  1PDH A;  2R9Z A;  2X8C A;  4H2P A;  3ATR A;  2IVD A;  4RSL A;  5KOW A;  3P9U A;  2ZZ0 A;  1MXT A;  1COY A;  4YJG B;  1XHC A;  4K2X A;  3KVE A;  1E1L A;  1GT8 A;  2RAB A;  5U25 A;  3PVC A;  1FCD A;  2JKC A;  1NDA A;  1NG3 A;  3GYJ A;  4ADW A;  3ZDN A;  3P4Q A;  3ADA B;  3GD3 A;  3BI4 A;  2WDV A;  2B9W A;  2BCP A;  2XYO A;  3AE8 A;  3B6D A;  4H4P A;  2YAU A;  3RHA A;  3KLJ A;  5KVH A;  4WCT A;  1MOK A;  2VZ2 A;  4EQR A;  2JBV A;  3SGL A;  4IVO B;  3AWI A;  3T14 A;  2O9Z A;  1YY5 A;  2VOU A;  4J33 A;  4EQS A;  2EQ8 A;  3T2K A;  2OLN A;  4UDR A;  5BRT A;  4GDE A;  2DU8 A;  4J31 A;  1BGJ A;  3DJE A;  3EAN A;  3PO7 A;  3DH9 A;  2YVJ A;  4I58 A;  2GRT A;  1SEZ A;  2B9X A;  4NNJ A;  3NKS A;  3NK1 X;  3T31 A;  1H6V A;  2FBW A;  1EVI A;  1BKW A;  2BC0 A;  4GF7 A;  4LII A;  2FJE A;  4C74 A;  1F8S A;  2GQW A;  4TM1 A;  4CBQ A;  2HQM A;  1IJH A;  4J2W A;  1O94 A;  4MJW A;  3I6D A;  3II4 A;  3SX6 A;  2QA1 A;  3NT6 A;  4Z24 A;  4K22 A;  1Q9I A;  2IID A;  4Y4N A;  1NHS A;  1GTE A;  5EOW A;  2B7S A;  2X8H A;  1E6E A;  2XVF A;  2ZBW A;  3EF6 A;  3NHO X;  3ZNN A;  3D8X A;  3UKH A;  3QSM A;  2VVM A;  2R45 A;  1Q1W A;  4DSG A;  2YR6 A;  1H84 A;  3W4K A;  4EMJ A;  2EQ6 A;  4IA6 A;  3AYJ A;  1DOD A;  2XVH A;  2DKI A;  3AYI A;  1JU2 A;  3BI2 A;  4IA5 A;  3UKK A;  2UZZ A;  2WET A;  4YSX A;  3BNM A;  4YTP A;  5KMR A;  1LQT A;  2APG A;  2BA9 A;  4U8N A;  4U8J A;  2J3N A;  5J60 A;  1JRX A;  1TDE A;  1YKJ A;  3F8D A;  2X99 A;  1JRY A;  5KOX A;  1KNP A;  3VRA A;  4NEV A;  1LPF A;  3BI5 A;  2YG7 A;  4II3 A;  1AN9 A;  3AED A;  1DXL A;  3AE5 A;  3FG2 P;  3NIX A;  2YLR A;  4II2 A;  3UKP A;  4NEW A;  3UOV A;  4ZCC A;  1HYU A;  3QSS A;  3UKQ A;  2C7G A;  3P4S A;  4O5Q A;  4A5L A;  4BUR A;  3SZF A;  2YR4 A;  2GEW A;  3GRS A;  4Y4L A;  1ZMC A;  1E1N A;  2ARD A;  3AE2 A;  3Q9T A;  4NTD A;  2CUL A;  5U63 A;  2QA2 A;  2V3B A;  2XVE A;  3GWF A;  2OA1 A;  3JSK A;  5TR3 A;  4Z2T A;  1LJ1 A;  2YLT A;  5KXJ A;  2E4G A;  1CBO A;  1D7Y A;  3DK9 A;  4G73 A;  4U8K A;  4LA1 A;  3O0H A;  4BJZ A;  4H4U A;  4EMI A;  3IHG A;  2AAQ A;  4TM0 A;  1DJQ A;  3HYX A;  1FOH A;  2DKH A;  3G5S A;  4FK1 A;  4YKG A;  2WU5 A;  3AEC A;  1GRG A;  4OPI A;  4B67 A;  3AB1 A;  4H4R A;  1NHR A;  3NGC X;  4ICY A;  3PS9 A;  3AEA A;  3LZX A;  1VQW A;  1Q1R A;  4EIP A;  1GAL A;  4Z43 A;  2FJA A;  4X9M A;  2IVE A;  2WBA A;  3UTE A;  2Y6Q A;  2WPC A;  3VQR A;  3CIR A;  1TDO A;  3DK4 A;  1GRA A;  5IQ1 A;  4J56 A;  1TDK A;  2AQJ A;  1VDC A;  3NK2 X;  2C64 A;  2BAB A;  2W0H A;  4YXD A;  4XWZ A;  5M10 A;  1NAA A;  2Q0K A;  5FMH A;  4A7A A;  5HHF A;  4OCG A;  1EL5 A;  3P1W A;  2WPE A;  3NYE A;  2YQU A;  4I59 A;  2YLS A;  2TMD A;  3G5R A;  1PBF A;  4AOS A;  1D7L A;  3ZNP A;  4BJY A;  1B5Q A;  2Z5Y A;  3ABV A;  2VRM A;  2GR1 A;  2ZZB A;  4AT2 A;  4YTN A;  2GMJ A;  4Z26 A;  2WEU A;  4U8M A;  2GB0 A;  2JK6 A;  3AEB A;  2EQ7 A;  5DBJ A;  1GEU A;  5HXI A;  3ALJ A;  2ZZC A;  4IV9 A;  5C3J A;  3NG7 X;  3AE9 A;  2JB2 A;  3Q6J A;  1FEB A;  3WE0 A;  5KMP A;  3QVR A;  4YSY A;  2XVJ A;  2XLT A;  1F6M A;  2H88 A;  1JNZ A;  3K7M X;  2BCG G;  3LOV A;  3L1R A;  4G74 A;  1C0P A;  1GRB A;  2BAC A;  3BHF A;  1IUS A;  1EL8 A;  3OZ2 A;  3IF9 A;  2GMH A;  1FEC A;  1ZY8 A;  4TM3 A;  2XDO A;  2YR5 A;  1KSU A;  5KRQ A;  2Q0L A;  1TDN A;  1OJA A;  2Q6U A;  1L9E A;  1JRZ A;  3ICT A;  1GSN A;  3CPJ G;  2A8X A;  1X31 B;  4YJF B;  4EQW A;  1KNR A;  3K30 A;  2E49 A;  2GH5 A;  1LV0 A;  3DME A;  4H4W A;  3DGZ A;  2BS3 A;  4U2S A;  4BK1 A;  4YSZ A;  2GAH B;  2XCG A;  2E82 A;  3DJJ A;  1S2Y A;  4OPT A;  3HYW A;  4H4X A;  2X50 A;  3NTA A;  4A79 A;  4YTM A;  4YKF A;  1UKV G;  2BYB A;  1Y56 B;  3LB8 A;  4A99 A;  4HB9 A;  2C65 A;  3DJG X;  1ZDL A;  3QJ4 A;  4GRT A;  4APN A;  4U2T A;  1NHQ A;  1K4Q A;  4HA6 A;  3RP6 A;  1YQ3 A;  3NRN A;  3UKF A;  1S3E A;  1Z6L A;  2JB1 A;  4CNK A;  3M13 A;  1PXB A;  1GET A;  4Z2R A;  3QFA A;  4OPL A;  3E1T A;  2ACZ A;  2E1M A;  4H4Y A;  4JQ9 A;  1QLB A;  3NN0 X;  1E1K A;  2C70 A;  3GDP A;  2BRY A;  4CY6 A;  4OPD A;  1ZOV A;  3DGH A;  5JCK A;  1CC4 A;  2CVJ A;  1IUW A;  3HZL A;  5KNL A;  2GR0 A;  3AD7 B;  2E48 A;  3T37 A;  1PJ5 A;  2V60 A;  4A6N A;  4H2R A;  2XLP A;  1DAO A;  1E7P A;  5FS7 A;  5EB4 A;  2GR3 A;  2TPR A;  4TLZ A;  1LTX R;  4CNJ A;  5JCL A;  2OLO A;  2QAE A;  3SZ0 A;  1MO9 A;  3VRB A;  4BV6 A;  2E5V A;  3CPI G;  1C0L A;  2WS3 A;  1VG9 A;  4KPR A;  3UOX A;  1PBB A;  4H4T A;  1H81 A;  4XXG A;  4KX6 A;  3FIM B;  4B1B A;  4X4J A;  3GWD A;  4FX9 A;  2PHH A;  2R0P A;  2GF3 A;  2VRL A;  4UDP A;  3C96 A;  3QFB A;  2XVI A;  1L9D A;  2QCU A;  4FK1 C;  2BK5 A;  3CGD A;  4B65 A;  5KMS A;  3ALM A;  1L0V A;  4DNA A;  4JDR A;  1E1M A;  1EL7 A;  2BXR A;  2XLS A;  1PHH A;  4QFC A;  2RGJ A;  4K5S A;  1ONF A;  4OPU A;  5BUL A;  3HYV A;  3I3L A;  2FJD A;  1IUX A;  2XFP A;  2WP6 A;  3AE7 A;  3NLC A;  4J36 A;  4JY2 A;  3NYF A;  4EIQ A;  1DNC A;  3CGB A;  2YG6 A;  3LXD A;  1CF3 A;  2YLZ A;  4A6N B;  3ICS A;  4E0V A;  1GV4 A;  1DOC A;  1PXC A;  1N4V A;  2C72 A;  2GQF A;  3GMC A;  4Y4M A;  1LQU A;  5KVI A;  4YT0 A;  4UP3 A;  1NEN A;  1H7X A;  2Z5X A;  2NPX A;  3NYC A;  3ITJ A;  3V3N A;  4PAA A;  3CNT A;  1C0I A;  3D1C A;  4EMW A;  4NWZ A;  3SZW A;  1O5W A;  4H2N A;  1XDI A;  2CFY A;  3COX A;  4FDC B;  4OVI A;  1DOE A;  2CDU A;  2YVF A;  3AYL A;  3GYX A;  4U8L A;  5KMQ A;  4B63 A;  4Z25 A;  3AE6 A;  1YQZ A;  2OAM A;  3KPF A;  1ZMD A;  3KU9 A;  5FS9 A;  4H4Z A;  3T2Y A;  3QSE A;  4D03 A;  1H7W A;  4BK3 A;  1ZKQ A;  3DJD A;  4LU6 A;  3M12 A;  3AE3 A;  3WGT A;  4YJF A;  3T0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...