2UZZA

X-ray structure of n-methyl-l-tryptophan oxidase (mtox)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
KYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKYVPLVLRAQMLWDELSRHNEDDPIFVRSGVINLGPADSTFLANVAHSAEQWQLNVEKLDAQGIMARWPEIRVPDNYIGLFETDSGFLRSELAIKTWIQLAKEAGCAQLFNCPVTAIRHDDDGVTIETADGEYQAKKAIVCAGTWVKDLLPELPVQPVRKVFAWYQADGRYSVKNKFPAFTGELPNGDQYYGFPAENDALKIGKHNGGQVIHSADERVPFAEVVSDGSEAFPFLRNVLPGIGCCLYGAACTYDNSPDEDFIIDTLPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSDFDLTPFRLSRFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-METHYL-L-TRYPTOPHAN OXIDASE
publication title The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 97
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.5.3.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 2uzzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2uzzA01
2EQ8A 3OZ2A 3F8PA 1Y56B 3W4KA 4K5SA 4B66A 5KWFA 2VRLA 2VVLG 2J3NA 1OJAA 4X9NA 3CN8A 3AE5A 2NPXA 3GWFA 3NGCX 1FEBA 2RGOA 4H2RA 3ZNNA 4N9XA 1DAOA 2B9XA 3COXA 3GRTA 2WQYA 3NYFA 2OA1A 2GRTA 4CNJA 2XCGA 1DOEA 3AEEA 4OPCA 2BK3A 1TDOA 1O94A 3ABVA 3AB1A 3IC9A 4OPIA 1BKWA 1H81A 1KDGA 1HYUA 2BXRA 5FS8A 5CKUA 3UOZA 1KF6A 1PJ5A 1F8WA 1NHRA 2H89A 1TDKA 3K30A 4U8MA 3C96A 4Y4MA 1NEKA 3S5WA 3URHA 2YM1A 1RYIA 2E82A 2BC1A 3CNJA 3GYJA 1GOSA 4J36A 4I58A 4CRTA 2CDUA 2CFYA 4Z43A 1NHPA 5EB4A 1QJDA 3QVPA 3DGHA 3P4PA 1E1LA 1NENA 2C3DA 3K7QX 2BCGG 1AOGA 4IVOB 2X8CA 3DJGX 4ECHA 5M10A 2XVIA 4EQSA 1PBBA 4YJFA 2WPFA 1H84A 2V60A 2XFOA 2YVJA 3ICRA 3T37A 5BVAA 1GERA 3UP5A 4EQXA 2GAHB 4J57A 3AYLA 2RGHA 4YJGA 4PAAA 1B37A 3G5QA 4IA5A 5J7XA 4BK1A 1PBFA 1B8SA 1TYPA 3SQPA 1NHSA 4AOSA 2C75A 2RGJA 2DKIA 3AE9A 2OLOA 2BXSA 4A7AA 1ONFA 3DJDA 3LOVA 3AD8B 1GSNA 1GEUA 4U8IA 4AT2A 1C0PA 1TYTA 3CNDA 2BK5A 4OPLA 2WDRA 3UOYA 1FL2A 1ZY8A 3GD3A 2EQ9A 2QA2A 4DGKA 2RABA 2R0GA 2XFNA 1EL8A 2JB3A 4K2XA 5HYMA 3KU9A 1ELIA 1LQUA 2OALA 4H4XA 3RP8A 3ICTA 5JCKA 1GTHA 1XPQA 4USQA 1AN9A 1NG3A 1CL0A 2ZZBA 3AE8A 4YSHA 1PBEA 2WESA 5M0ZA 4E0VA 2BA9A 1QO8A 2XDOA 3KA7A 4YXDA 5BRTA 4U2TA 4NZHA 3WGTA 2YG6A 4U2SA 4FDCB 2YG5A 1GESA 1EBDA 3UTEA 1DJQA 1JNRA 1IUTA 3ISHA 4B67A 1GT8A 3FPZA 2B7SA 3AE7A 3L1RA 3AEFA 4H4ZA 4JN9A 2BABA 4JQ9A 2JK6A 5EOWA 5JCIA 2YLTA 4WX1A 3II4A 1ZP0A 2WPEA 3CIRA 1P2EA 2HQMA 1PXBA 3EAOA 3CNPA 5IQ4A 1VE9A 3AE6A 4Z26A 3K7TA 4JY3A 5FS6A 3DK4A 1GETA 4JDRA 4B63A 1PXAA 1D4EA 4DSHA 3W4JA 2BACA 4FK1C 1PJ7A 5HY5A 1F8SA 5IQ1A 3CNTA 2IVDA 3PS9A 1IJHA 3UOXA 1B5QA 2C70A 3G5SA 1N4VA 4K8DA 4NEWA 3GRSA 2OAMA 2YLZA 3SGLA 2ARDA 3AEDA 4IA6A 3GD4A 5KOXA 1H6VA 2YG4A 1OJCA 2AQJA 2O9ZA 2Z5XA 2C65A 3DGZA 3REDA 1ZK7A 3CTYA 3NNEA 1S2QA 2V6OA 3ZDNA 1PHHA 3NTDA 3IF9A 3PO7A 5DBJA 4GDPA 3AEAA 4U8NA 2C76A 4H4UA 1XHCA 3CUKA 4K22A 4C3YA 2WS3A 2WU5A 3OC4A 1B4VA 3UTGA 3AD7B 3LJPA 5KVHA 2IVEA 3IWAA 1RP0A 2FJAA 5KVIA 3GMCA 4U8JA 3ATRA 3RP7A 1GRTA 1GTEA 2B9WA 1IUXA 1FOHA 1CJ3A 1N4WA 4CY8A 5TR3A 2QAEA 1IUUA 3M12A 3EPTA 4A6NA 2JB2A 4EMIA 2VVLA 1H7WA 1ZX9A 2F5ZA 2XVFA 4OCGA 3FMWA 2R0CA 4NTDA 4TM3A 4YTMA 3UCLA 1DODA 2GB0A 3P4QA 1DDOA 4O5QA 1GALA 3RP6A 5KOWA 3UKAA 2Y6QA 3SFDA 1D4CA 1BGNA 1GV4A 4B64A 3D8XA 4H4WA 4ZN0A 3C4AA 4H4SA 4LIIA 1TDFA 2BC0A 3VRBA 2GVCA 4RSLA 2Q0LA 4MJWA 2X3NA 3NN0X 4J34A 4DNAA 5EBKA 1EL7A 2XLRA 4TM1A 4EIPA 2GQFA 3F8DA 5HHFA 2XLTA 2C64A 2Q6UA 3Q9TA 1CJCA 3K7MX 2ACZA 4FK1A 2ZBWA 4EM3A 3UKLA 2VQBA 3KKJA 1DJNA 4LA1A 2V61A 4YJDA 3AE1A 1K4QA 1CC4A 2GH5A 3GDPA 4Y4NA 2BS3A 1TDEA 4IV9A 5U1OA 3DMEA 4BK3A 3GDNA 5KXJA 1COYA 5U63A 2FJDA 4APNA 1S2YA 2XFQA 1OJDA 5FS9A 2E4AA 3NK0X 1LJ1A 1KNPA 1E1MA 1FECA 3UTHA 1KIFA 3AWIA 4PABA 3P9UA 3DJEA 3ITJA 3AYJA 3NRNA 1GREA 1Y56A 2BYBA 3FIMB 2WDVA 1EL5A 3SM8A 2BCPA 1MOKA 4YTNA 3QFBA 2B7RA 2XVHA 3L8KA 3E1TA 4AOXA 4X9MA 4GUVA 1KSUA 1D7LA 5BULA 1GXFA 3BHFA 2WHDA 3M0OA 1M6IA 4Z44A 3GWDA 3S61A 3M13A 2Q7VA 1IUSA 1GRHA 4H4TA 5CQFA 2EQ6A 4UDQA 4YJHB 4JY2A 1NPXA 4X4JA 5KRQA 1GRBA 3CPHG 4OVIA 2C72A 1GRAA 4OPUA 2X8GA 1JEHA 3UP4A 3B6DA 2UZZA 1E1KA 4D03A 1BGJA 3UKKA 4UP3A 5C3JA 3CGBA 4EMWA 1YKJA 3AE4A 1K0JA 1RSGA 2WP6A 4Y4LA 3UTFA 2WOIA 1YQ4A 2FJBA 4CCQA 2AR8A 3RNMA 4H2NA 3F8RA 4NTEA 1CBOA 3QSSA 2GR1A 3AEGA 1D4DA 4H4RA 3QFAA 2XLUA 4ZCDA 2C67A 4RG3A 1FEAA 1N4UA 1KFYA 1VRQB 3FG2P 3UKPA 1NAAA 1TRBA 2YQUA 1DOCA 1L9CA 3KPFA 1PXCA 2V5ZA 4TM0A 1ZOVA 2GV8A 2VRMA 3NTAA 3VRDB 4A99A 2DKHA 2YVFA 3GYIA 5JCNA 2WBAA 3W4IA 1JOAA 2BS2A 4Z24A 3Q6JA 1JRYA 2C3CA 2GMHA 3NIXA 2XFUA 4B1BA 4C3XA 3BI5A 4U2LA 1UKVG 3EF6A 1X31B 2YLSA 2JBVA 1K0IA 4XWRA 2JB1A 2Q0KA 2YR4A 4BJYA 3VR8A 4J31A 2IIDA 2Y6RA 4KPRA 1MO9A 4UDRA 1JU2A 5EB5A 4CCRA 3H8LA 1K0LA 2YLXA 3ZNPA 1N1PA 2NVKX 4GCMA 4TLXA 1QLBA 1JNZA 3UKFA 2XLPA 3QVRA 5HXIA 1YY5A 2GMJA 4TM4A 5JCLA 4DSGA 2GF3A 4JNAA 3EANA 1GRFA 1MXTA 4XWZA 2GR0A 4GDEA 3NT6A 3C4NA 3DK9A 4Z25A 4K7ZA 2E5VA 1XDIA 1Z6LA 5J60A 1Q1RA 4Z2TA 3G5RA 3GMBA 2C73A 4WCTA 1DXLA 1NHQA 1ZOYA 1KNRA 2ZZCA 5L46A 1VQWA 5BUKA 1REOA 5FMHA 3ALLA 1CC6A 4C5OA 3VR9A 3GSIA 1IUWA 4YJFB 1D5TA 3VRAA 1OJ9A 2VZ2A 2YM2A 3UKQA 2YLWA 3ATQA 1GRGA 1VDCA 4YT0A 4NTCA 1EVIA 4YJGB 1DNCA 4BV6A 4Z2UA 3BNMA 4H4VA 1H86A 1XANA 2YWLA 3NG7X 1D7YA 2PHHA 2B9YA 2JAEA 3BI2A 5C2TA 1O5WA 3VQRA 3V3OA 2VQ7A 1KSSA 1BZLA 1PJ6A 4OPDA 3ZNOA 1H82A 3AE3A 3AYIA 3NHOX 2DU8A 2W0HA 4M52A 2CULA 2YG7A 2YVGA 4U8OA 4C77A 4A5LA 2WP9A 4EIQA 2WEUA 2X50A 3LZWA 1VG9A 1E6EA 3CGDA 4HB9A 4KX6A 3DH9A 1CF3A 2WOWA 3LB8A 4YKGA 1EL9A 1BF3A 2E1MA 5FS7A 2C7GA 3ALMA 2B76A 3IHGA 2R46A 2R4JA 1F8RA 1LQTA 1PS9A 1PN0A 3UOVA 4ZCCA 4YWOA 1H7XA 1IUVA 1NG4A 3NK1X 4USRA 4FX9A 2QA1A 4JNQA 3ZYXA 4H4YA 4H4PA 3RHAA 5IPYA 3CGCA 4I59A 2PYXA 2YR6A 4BURA 2GR2A 1NDAA 4Z2RA 3I6DA 1JRXA 3NN6X 1LTXR 4OPTA 2OLNA 2CVJA 2JKCA 4IVMB 1YQZA 2TPRA 2WDQA 1H83A 2YAUA 3LXDA 4B69A 1BWCA 1YQ3A 4CY6A 4YSZA 1L0VA 1LV0A 3AEBA 1E39A 2VOUA 2WU2A 3AE2A 4GF7A 1W4XA 1Y0PA 2I0ZA 3ZNQA 2XVJA 3G3EA 4HA6A 2WP5A 3ALJA 1LPFA 3NYEA 3NLCA 4QFCA 2XFPA 3QJ4A 2WETA 3I3LA 2XYOA 1PBCA 1C0LA 4D04A 4EM4A 4EQRA 2FBWA 2GQWA 4YSYA 3AECA 2TMDA 1PDHA 2WOVA 3P1WA 4H50A 3LADA 4GR1A 4K5RA 1E1NA 1S3EA 3V76A 2BK4A 2VVMA 2WPCA 5GRTA 1L9EA 2R0PA 2XVEA 3NYCA 3B3RA 3JSKA 3ICSA 3R9UA 3NH3X 4AP1A 1GNDA 5GSNA 2X8HA 4AP3A 3P4SA 3H4KA 2FJEA 1M64A 2E49A 2GR3A 3HZLA 4ICYA 3NK2X 4YKFA 2E4GA 3LZXA 3KVEA 3BHKA 4U8KA 1O95A 4BJZA 4J56A 4ADWA 1ZDLA 3BNUA 3D1CA 4EQWA 3DJJA 2YLRA 4A6NB 4EMJA 2GAGB 2X99A 2APGA 2A8XA 2ZZ0A 3NKSA 4CNKA 5ER0A 2YR5A 3H8IA 4J2WA 5U25A 2EQ7A 2BS4A 3QSEA 1L9DA 2A89A 4H2PA 5JCMA 4RG4A 3AXBA 1SEZA 1ZMDA 3P4RA 3CPJG 4TLZA 4YJHA 1C0IA 2A87A 4C74A 4QFDA 2C66A 2H88A 4A9WA 1ZMCA 4YTPA 1Q1WA 2XLSA 3DK8A 3IHMA 1ZKQA 2V3AA 4J33A 3ADAB 4NEVA 4XXGA 1Q9IA 3KLJA 2Z5YA 3O0HA 1F6MA 3V3NA 1JRZA 4OPGA 1LVLA 1CJ2A 4U8PA 3FBSA 1F3PA 3DA1A 2R4EA 2AAQA 4H2QA 1VG0A 3BI4A 4H4QA 2R9ZA 4B65A 4BK2A 1TDNA 4A79A 4AT0A 4O5UA 3CGEA 2V3BA 1GPEA 1CJ4A 2QCUA 2R45A 4H7UA 3PVCA 2GEWA 4CBQA 2E48A 1V59A 2YG3A 4GRTA 4LU6A 4U8LA 4YSXA 4P9SA 1E7PA 1S3BA 4UDPA 3SFEA 3WE0A 1C0KA 1PBDA 3CPIG 4REKA 1CC2A 3AD9B 1FCDA 4B68A 3KD9A 1P2HA 5LV9A 3UKHA 3CNSA 1DOBA 3QSMA 1OJTA 1CHUA 4A65A
chains in the Genus database with same CATH superfamily
2EQ8A 3OZ2A 3F8PA 1Y56B 3W4KA 4K5SA 4B66A 5KWFA 3T31A 2VRLA 2VVLG 2J3NA 1OJAA 4X9NA 3CN8A 3AE5A 2NPXA 3GWFA 3NGCX 1FEBA 2RGOA 4H2RA 3ZNNA 4N9XA 1DAOA 2B9XA 3COXA 3GRTA 2WQYA 3NYFA 2OA1A 2GRTA 4CNJA 2XCGA 1DOEA 3AEEA 4OPCA 2BK3A 1TDOA 1O94A 3ABVA 3AB1A 3IC9A 4OPIA 1BKWA 1H81A 1KDGA 1HYUA 2BXRA 5FS8A 5CKUA 3UOZA 1KF6A 1PJ5A 1F8WA 1NHRA 2H89A 1TDKA 3K30A 4U8MA 3SZ0A 3T2ZA 3C96A 4Y4MA 1NEKA 3S5WA 3URHA 2YM1A 1RYIA 2E82A 2BC1A 3CNJA 3GYJA 1GOSA 4J36A 4I58A 4CRTA 2CDUA 2CFYA 4Z43A 1NHPA 5EB4A 1QJDA 3QVPA 3DGHA 3P4PA 1E1LA 1NENA 2C3DA 3K7QX 2BCGG 1AOGA 4IVOB 2X8CA 3DJGX 4ECHA 5M10A 2XVIA 4EQSA 1PBBA 4YJFA 2WPFA 1H84A 2V60A 2XFOA 2YVJA 3ICRA 3T37A 5BVAA 1GERA 3UP5A 4EQXA 2GAHB 4J57A 3AYLA 3SX6A 2RGHA 4YJGA 4PAAA 4IA5A 1B37A 3G5QA 5J7XA 4BK1A 1PBFA 1B8SA 1TYPA 3SQPA 1NHSA 4G9KA 2C75A 3SZCA 3SZFA 4AOSA 2RGJA 2DKIA 3AE9A 2OLOA 2BXSA 4A7AA 1ONFA 3GYXA 3DJDA 3LOVA 3AD8B 1GSNA 1GEUA 4U8IA 4AT2A 1C0PA 1TYTA 3T0KA 3CNDA 2BK5A 4OPLA 2WDRA 3UOYA 1FL2A 1ZY8A 3GD3A 2EQ9A 2QA2A 4DGKA 2RABA 2R0GA 2XFNA 1EL8A 5HYMA 2JB3A 4K2XA 3KU9A 1ELIA 1LQUA 2OALA 4H4XA 3RP8A 5KMQA 3ICTA 5JCKA 1GTHA 1XPQA 4USQA 1AN9A 1NG3A 1CL0A 2ZZBA 3AE8A 4YSHA 1PBEA 2WESA 5M0ZA 4E0VA 2BA9A 1QO8A 2XDOA 3KA7A 4YXDA 5BRTA 4U2TA 4NZHA 3WGTA 2YG6A 4NWZA 4U2SA 4FDCB 2YG5A 1GESA 1EBDA 3UTEA 1DJQA 1JNRA 1IUTA 3ISHA 4B67A 1GT8A 3FPZA 2B7SA 3AE7A 3L1RA 3AEFA 4H4ZA 4JN9A 2BABA 4JQ9A 2JK6A 5EOWA 5JCIA 2YLTA 4WX1A 3II4A 1ZP0A 2WPEA 3CIRA 1P2EA 2HQMA 1PXBA 3EAOA 3CNPA 5IQ4A 1VE9A 3AE6A 4Z26A 3K7TA 4JY3A 5FS6A 3DK4A 1GETA 4JDRA 4B63A 1PXAA 1D4EA 4DSHA 3W4JA 2BACA 3KPKA 1PJ7A 4FK1C 5HY5A 1F8SA 5IQ1A 3CNTA 2IVDA 3PS9A 1IJHA 3UOXA 1B5QA 2C70A 3G5SA 1N4VA 4K8DA 4NEWA 3GRSA 2OAMA 2YLZA 3SGLA 4IA6A 2ARDA 3AEDA 3GD4A 5KOXA 1H6VA 2YG4A 1OJCA 2AQJA 2O9ZA 2Z5XA 2C65A 3DGZA 3REDA 1ZK7A 3CTYA 3NNEA 1S2QA 2V6OA 2BRAA 3ZDNA 1PHHA 3NTDA 3IF9A 3PO7A 5DBJA 4GDPA 3AEAA 4U8NA 2C76A 4K22A 1XHCA 3CUKA 4H4UA 4C3YA 5KNLA 2WS3A 2WU5A 3OC4A 1B4VA 3UTGA 3AD7B 3LJPA 5KVHA 2IVEA 3IWAA 1RP0A 2FJAA 5KVIA 3GMCA 4U8JA 3RP7A 3ATRA 1GRTA 1GTEA 2B9WA 1IUXA 1FOHA 1CJ3A 1N4WA 4CY8A 5TR3A 2QAEA 1IUUA 3EPTA 3M12A 4A6NA 2JB2A 4EMIA 2VVLA 1H7WA 1ZX9A 2F5ZA 2XVFA 4OCGA 3FMWA 2R0CA 4NTDA 4TM3A 4YTMA 3UCLA 1DODA 2GB0A 3P4QA 1DDOA 4O5QA 1GALA 3RP6A 5KOWA 3UKAA 2Y6QA 3SFDA 1D4CA 1BGNA 1GV4A 4B64A 3D8XA 4H4WA 4KX6A 4ZN0A 5KMPA 3C4AA 4H4SA 4LIIA 1TDFA 2BC0A 3VRBA 2GVCA 4RSLA 4G73A 2Q0LA 4MJWA 2X3NA 3NN0X 4J34A 4DNAA 5EBKA 2BRYA 1EL7A 4EIPA 2XLRA 4TM1A 2GQFA 3F8DA 4GAVA 5HHFA 2XLTA 2C64A 2Q6UA 3Q9TA 1CJCA 3K7MX 2ACZA 4FK1A 2ZBWA 4EM3A 3UKLA 2VQBA 3KKJA 1DJNA 4LA1A 2V61A 4YJDA 3AE1A 1K4QA 1CC4A 2GH5A 3GDPA 4Y4NA 2BS3A 1TDEA 4BK3A 4IV9A 3DMEA 5U1OA 3SXIA 3GDNA 5KXJA 1COYA 5U63A 2FJDA 4APNA 1S2YA 2XFQA 1OJDA 3CMMA 5FS9A 2E4AA 3NK0X 1LJ1A 1KNPA 1E1MA 1FECA 3UTHA 1KIFA 3AWIA 4PABA 3P9UA 3DJEA 3ITJA 3AYJA 3NRNA 1GREA 1Y56A 2BYBA 3FIMB 2WDVA 1EL5A 3SM8A 2BCPA 1MOKA 4YTNA 3QFBA 2B7RA 2XVHA 3L8KA 3E1TA 4AOXA 4X9MA 4GUVA 1KSUA 1D7LA 4NNJA 5BULA 1GXFA 3BHFA 2WHDA 3M0OA 1M6IA 4Z44A 3GWDA 4G74A 3S61A 3M13A 4II3A 2Q7VA 1IUSA 1GRHA 4H4TA 5CQFA 2EQ6A 4UDQA 4YJHB 4JY2A 1NPXA 4X4JA 5KRQA 1GRBA 3CPHG 4OVIA 2C72A 1GRAA 4OPUA 2X8GA 1JEHA 3UP4A 3B6DA 2UZZA 1E1KA 4D03A 1BGJA 3UKKA 4UP3A 5C3JA 3CGBA 4EMWA 1YKJA 3AE4A 1K0JA 1RSGA 2WP6A 4Y4LA 3UTFA 2WOIA 1YQ4A 2FJBA 4CCQA 2AR8A 3RNMA 4H2NA 3F8RA 4NTEA 1CBOA 3QSSA 2GR1A 3AEGA 1D4DA 4H4RA 3QFAA 2XLUA 4ZCDA 2C67A 4RG3A 2C4CA 1N4UA 1FEAA 1KFYA 4II2A 1VRQB 3FG2P 3UKPA 1NAAA 1TRBA 2YQUA 1DOCA 1L9CA 3KPFA 1PXCA 2V5ZA 4TM0A 1ZOVA 2GV8A 2VRMA 3NTAA 3VRDB 4A99A 2DKHA 2YVFA 3GYIA 5JCNA 2WBAA 3W4IA 1JOAA 2BS2A 4Z24A 3Q6JA 1JRYA 2C3CA 2GMHA 3NIXA 2XFUA 4B1BA 4C3XA 3BI5A 4U2LA 1UKVG 3EF6A 1X31B 2YLSA 2JBVA 1K0IA 4XWRA 2JB1A 4BJYA 2Q0KA 2YR4A 3VR8A 4J31A 2IIDA 2Y6RA 4KPRA 1MO9A 4UDRA 1JU2A 5EB5A 4CCRA 3H8LA 1K0LA 2YLXA 3ZNPA 1N1PA 3T2KA 2NVKX 4GCMA 4TLXA 1QLBA 1JNZA 3UKFA 3SYIA 5HXIA 2XLPA 3QVRA 1YY5A 2GMJA 4GAPA 4TM4A 5JCLA 4DSGA 2GF3A 4JNAA 3EANA 1GRFA 1MXTA 4XWZA 2GR0A 4GDEA 3NT6A 3C4NA 3DK9A 4Z25A 4K7ZA 2E5VA 1XDIA 3HYWA 1Z6LA 5J60A 1Q1RA 4Z2TA 3G5RA 3GMBA 2C73A 4WCTA 1DXLA 1NHQA 1ZOYA 1KNRA 2ZZCA 5L46A 1VQWA 5BUKA 1REOA 5FMHA 3ALLA 1CC6A 4C5OA 3VR9A 3GSIA 1IUWA 4YJFB 1D5TA 3VRAA 1OJ9A 2VZ2A 2YM2A 3UKQA 2YLWA 3ATQA 1GRGA 1VDCA 4YT0A 4NTCA 1EVIA 4YJGB 1DNCA 4BV6A 4Z2UA 3BNMA 4H4VA 1H86A 1XANA 2YWLA 3NG7X 1D7YA 2PHHA 2B9YA 2JAEA 3BI2A 5C2TA 1O5WA 3VQRA 3V3OA 2VQ7A 1KSSA 1BZLA 1PJ6A 4OPDA 3ZNOA 1H82A 3AE3A 3AYIA 3NHOX 2DU8A 2W0HA 4M52A 2CULA 2YG7A 2YVGA 4U8OA 4C77A 4EIQA 2WP9A 4A5LA 2WEUA 2X50A 3LZWA 1VG9A 1E6EA 3CGDA 4G6GA 4G6HA 3DH9A 1CF3A 2WOWA 3LB8A 4HB9A 1EL9A 1BF3A 2E1MA 5FS7A 3ALMA 2C7GA 2B76A 3IHGA 2R46A 2R4JA 1F8RA 1LQTA 1PS9A 1PN0A 3UOVA 4ZCCA 4YWOA 1H7XA 1IUVA 1NG4A 3NK1X 4USRA 4FX9A 2QA1A 4JNQA 3ZYXA 4H4YA 4H4PA 3RHAA 5IPYA 3CGCA 4I59A 2PYXA 2YR6A 4BURA 2GR2A 1NDAA 4Z2RA 3I6DA 1JRXA 3NN6X 1LTXR 4OPTA 2OLNA 2CVJA 2JKCA 4IVMB 1YQZA 2TPRA 2WDQA 1H83A 2YAUA 3LXDA 4B69A 1BWCA 1YQ3A 4CY6A 4YSZA 1L0VA 4GF7A 1LV0A 1E39A 2VOUA 2WU2A 3AEBA 3AE2A 1W4XA 1Y0PA 2I0ZA 3ZNQA 2XVJA 3SY4A 3G3EA 4HA6A 2WP5A 3ALJA 1LPFA 3NYEA 3NLCA 4QFCA 2XFPA 3QJ4A 2WETA 3I3LA 2XYOA 1PBCA 1C0LA 4D04A 4EM4A 4EQRA 2FBWA 2GQWA 4YSYA 3AECA 2TMDA 1PDHA 2WOVA 3P1WA 4H50A 3LADA 4GR1A 4K5RA 1E1NA 1S3EA 3SZWA 2BK4A 3V76A 2VVMA 2WPCA 5GRTA 1L9EA 2R0PA 2XVEA 3NYCA 3B3RA 3T14A 3JSKA 3ICSA 3R9UA 3NH3X 4AP1A 1GNDA 5GSNA 2X8HA 4AP3A 3P4SA 3H4KA 2FJEA 5KMSA 1M64A 2E49A 2GR3A 3HZLA 4ICYA 3NK2X 4YKFA 2E4GA 4BJZA 3KVEA 3BHKA 3LZXA 1O95A 4U8KA 4J56A 4ADWA 1ZDLA 3BNUA 3D1CA 4EQWA 3DJJA 2YLRA 4A6NB 4EMJA 2GAGB 2X99A 2APGA 2A8XA 2ZZ0A 3NKSA 4CNKA 5ER0A 2YR5A 3H8IA 4J2WA 5U25A 2EQ7A 2BS4A 3QSEA 1L9DA 2A89A 4H2PA 5JCMA 4RG4A 3AXBA 1SEZA 1ZMDA 3P4RA 3CPJG 4TLZA 4YJHA 1C0IA 2A87A 4C74A 4QFDA 2C66A 2H88A 4A9WA 1ZMCA 4YTPA 1Q1WA 2XLSA 3DK8A 3IHMA 1ZKQA 2V3AA 4J33A 3ADAB 4NEVA 3T2YA 4XXGA 1Q9IA 4A65A 3KLJA 2Z5YA 3O0HA 1F6MA 3V3NA 1JRZA 4OPGA 1LVLA 1CJ2A 4U8PA 3FBSA 1F3PA 3DA1A 2R4EA 4H2QA 2AAQA 4BK2A 1VG0A 3BI4A 2R9ZA 4H4QA 4B65A 1TDNA 4A79A 4AT0A 5KMRA 4O5UA 3CGEA 2V3BA 1GPEA 1CJ4A 2QCUA 2R45A 4H7UA 3PVCA 3HYXA 2GEWA 4CBQA 2E48A 1V59A 2YG3A 4GRTA 4LU6A 4U8LA 4YSXA 4P9SA 1E7PA 1S3BA 4UDPA 3SFEA 3WE0A 1C0KA 1PBDA 3CPIG 4REKA 4YKGA 1CC2A 3AD9B 1FCDA 4B68A 3KD9A 1P2HA 5LV9A 3UKHA 3CNSA 1DOBA 3QSMA 1OJTA 1CHUA 3HYVA
chains in the Genus database with same CATH topology
2EQ8A 3OZ2A 3F8PA 1Y56B 3W4KA 4K5SA 4B66A 5KWFA 3T31A 2VRLA 2VVLG 2J3NA 1OJAA 4X9NA 3CN8A 3AE5A 2NPXA 3GWFA 3NGCX 1FEBA 2RGOA 4H2RA 3ZNNA 4N9XA 1DAOA 2B9XA 3COXA 3GRTA 2WQYA 3NYFA 2OA1A 2GRTA 4CNJA 2XCGA 1DOEA 3AEEA 4OPCA 2BK3A 1TDOA 1O94A 3ABVA 3AB1A 3IC9A 4OPIA 1BKWA 1H81A 1KDGA 1HYUA 2BXRA 5FS8A 5CKUA 3UOZA 1KF6A 1PJ5A 1F8WA 1NHRA 2H89A 1TDKA 3K30A 4U8MA 3SZ0A 3T2ZA 3C96A 4Y4MA 1NEKA 3S5WA 3URHA 2YM1A 1RYIA 2E82A 2BC1A 3CNJA 3GYJA 1GOSA 4J36A 4I58A 4CRTA 2CDUA 2CFYA 4Z43A 1NHPA 5EB4A 1QJDA 3QVPA 3DGHA 3P4PA 1E1LA 1NENA 2C3DA 3K7QX 2BCGG 1AOGA 4IVOB 2X8CA 3DJGX 4ECHA 5M10A 2XVIA 4EQSA 1PBBA 4YJFA 2WPFA 1H84A 2V60A 2XFOA 2YVJA 3ICRA 3T37A 5BVAA 1GERA 3UP5A 4EQXA 2GAHB 4J57A 3AYLA 3SX6A 2RGHA 4YJGA 4PAAA 1B37A 3G5QA 4IA5A 5J7XA 4BK1A 1PBFA 1B8SA 1TYPA 3SQPA 1NHSA 4G9KA 2C75A 3SZCA 3SZFA 4AOSA 2RGJA 2DKIA 3AE9A 2OLOA 2BXSA 4A7AA 1ONFA 3GYXA 3DJDA 3LOVA 3AD8B 1GSNA 1GEUA 4U8IA 4AT2A 1C0PA 1TYTA 3T0KA 3CNDA 2BK5A 4OPLA 2WDRA 3UOYA 1FL2A 1ZY8A 3GD3A 2EQ9A 2QA2A 4DGKA 2RABA 2R0GA 2XFNA 1EL8A 2JB3A 4K2XA 5HYMA 3KU9A 1ELIA 1LQUA 2OALA 4H4XA 5KMQA 3RP8A 3ICTA 5JCKA 1GTHA 1XPQA 4USQA 1AN9A 1NG3A 1CL0A 2ZZBA 3AE8A 4YSHA 1PBEA 2WESA 5M0ZA 4E0VA 2BA9A 1QO8A 2XDOA 3KA7A 4YXDA 5BRTA 4U2TA 4NZHA 3WGTA 2YG6A 4NWZA 4U2SA 4FDCB 2YG5A 1GESA 1EBDA 3UTEA 1DJQA 1JNRA 1IUTA 3ISHA 4B67A 1GT8A 3FPZA 2B7SA 3AE7A 3L1RA 3AEFA 4H4ZA 4JN9A 2BABA 4JQ9A 2JK6A 5EOWA 5JCIA 2YLTA 4WX1A 3II4A 1ZP0A 2WPEA 3CIRA 1P2EA 2HQMA 1PXBA 3EAOA 3CNPA 5IQ4A 1VE9A 3AE6A 4Z26A 3K7TA 4JY3A 5FS6A 3DK4A 1GETA 4JDRA 4B63A 1PXAA 1D4EA 4DSHA 3W4JA 2BACA 3KPKA 1PJ7A 4FK1C 5HY5A 1F8SA 5IQ1A 3CNTA 2IVDA 3PS9A 1IJHA 3UOXA 1B5QA 2C70A 3G5SA 1N4VA 4K8DA 4NEWA 3GRSA 2OAMA 2YLZA 3SGLA 2ARDA 3AEDA 4IA6A 3GD4A 5KOXA 1H6VA 2YG4A 1OJCA 2AQJA 2O9ZA 2Z5XA 2C65A 3DGZA 3REDA 1ZK7A 3CTYA 3NNEA 1S2QA 2V6OA 2BRAA 3ZDNA 1PHHA 3NTDA 3IF9A 3PO7A 5DBJA 4GDPA 3AEAA 4U8NA 2C76A 4H4UA 1XHCA 3CUKA 4K22A 4C3YA 5KNLA 2WS3A 2WU5A 3OC4A 1B4VA 3UTGA 3AD7B 3LJPA 5KVHA 2IVEA 3IWAA 1RP0A 2FJAA 5KVIA 3GMCA 4U8JA 3ATRA 3RP7A 1GRTA 1GTEA 2B9WA 1IUXA 1FOHA 1CJ3A 1N4WA 4CY8A 5TR3A 2QAEA 1IUUA 3M12A 3EPTA 4A6NA 2JB2A 4EMIA 2VVLA 1H7WA 1ZX9A 2F5ZA 2XVFA 4OCGA 3FMWA 2R0CA 4NTDA 4TM3A 4YTMA 3UCLA 1DODA 2GB0A 3P4QA 1DDOA 4O5QA 1GALA 3RP6A 5KOWA 3UKAA 2Y6QA 3SFDA 1D4CA 1BGNA 1GV4A 4B64A 3D8XA 4H4WA 4KX6A 4ZN0A 5KMPA 3C4AA 4H4SA 4LIIA 1TDFA 2BC0A 3VRBA 2GVCA 4RSLA 4G73A 2Q0LA 4MJWA 2X3NA 3NN0X 4J34A 4DNAA 5EBKA 2BRYA 1EL7A 2XLRA 4TM1A 4EIPA 2GQFA 3F8DA 4GAVA 5HHFA 2XLTA 2C64A 2Q6UA 3Q9TA 1CJCA 3K7MX 2ACZA 4FK1A 2ZBWA 4EM3A 3UKLA 2VQBA 3KKJA 1DJNA 4LA1A 2V61A 4YJDA 3AE1A 1K4QA 1CC4A 2GH5A 3GDPA 4Y4NA 2BS3A 1TDEA 4IV9A 5U1OA 3DMEA 3SXIA 4BK3A 3GDNA 5KXJA 1COYA 5U63A 2FJDA 4APNA 1S2YA 2XFQA 1OJDA 3CMMA 5FS9A 2E4AA 3NK0X 1LJ1A 1KNPA 1E1MA 1FECA 3UTHA 1KIFA 3AWIA 4PABA 3P9UA 3DJEA 3ITJA 3AYJA 3NRNA 1GREA 1Y56A 2BYBA 3FIMB 2WDVA 1EL5A 3SM8A 2BCPA 1MOKA 4YTNA 3QFBA 2B7RA 2XVHA 3L8KA 3E1TA 4AOXA 4X9MA 4GUVA 1KSUA 1D7LA 4NNJA 5BULA 1GXFA 3BHFA 2WHDA 3M0OA 1M6IA 4Z44A 3GWDA 4G74A 3S61A 3M13A 4II3A 2Q7VA 1IUSA 1GRHA 4H4TA 5CQFA 2EQ6A 4UDQA 4YJHB 4JY2A 1NPXA 4X4JA 5KRQA 1GRBA 3CPHG 4OVIA 2C72A 1GRAA 4OPUA 2X8GA 1JEHA 3UP4A 3B6DA 2UZZA 1E1KA 4D03A 1BGJA 3UKKA 4UP3A 5C3JA 3CGBA 4EMWA 1YKJA 3AE4A 1K0JA 1RSGA 2WP6A 4Y4LA 3UTFA 2WOIA 1YQ4A 2FJBA 4CCQA 2AR8A 3RNMA 4H2NA 3F8RA 4NTEA 1CBOA 3QSSA 2GR1A 3AEGA 1D4DA 4H4RA 3QFAA 2XLUA 4ZCDA 2C67A 4RG3A 2C4CA 1FEAA 1N4UA 1KFYA 4II2A 1VRQB 3FG2P 3UKPA 1NAAA 1TRBA 2YQUA 1DOCA 1L9CA 3KPFA 1PXCA 2V5ZA 4TM0A 1ZOVA 2GV8A 2VRMA 3NTAA 3VRDB 4A99A 2DKHA 2YVFA 3GYIA 5JCNA 2WBAA 3W4IA 1JOAA 2BS2A 4Z24A 3Q6JA 1JRYA 2C3CA 2GMHA 3NIXA 2XFUA 4B1BA 4C3XA 3BI5A 4U2LA 1UKVG 3EF6A 1X31B 2YLSA 2JBVA 1K0IA 4XWRA 2JB1A 2Q0KA 2YR4A 4BJYA 3VR8A 4J31A 2IIDA 2Y6RA 4KPRA 1MO9A 4UDRA 1JU2A 5EB5A 4CCRA 3H8LA 1K0LA 2YLXA 3ZNPA 1N1PA 3T2KA 2NVKX 4GCMA 4TLXA 1QLBA 1JNZA 3UKFA 3SYIA 2XLPA 3QVRA 5HXIA 1YY5A 2GMJA 4GAPA 4TM4A 5JCLA 4DSGA 2GF3A 4JNAA 3EANA 1GRFA 1MXTA 4XWZA 2GR0A 4GDEA 3NT6A 3C4NA 3DK9A 4Z25A 4K7ZA 2E5VA 1XDIA 3HYWA 1Z6LA 5J60A 1Q1RA 4Z2TA 3G5RA 3GMBA 2C73A 4WCTA 1DXLA 1NHQA 1ZOYA 1KNRA 2ZZCA 5L46A 1VQWA 5BUKA 1REOA 5FMHA 3ALLA 1CC6A 4C5OA 3VR9A 3GSIA 1IUWA 4YJFB 1D5TA 3VRAA 1OJ9A 2VZ2A 2YM2A 3UKQA 2YLWA 3ATQA 1GRGA 1VDCA 4YT0A 4NTCA 1EVIA 4YJGB 1DNCA 4BV6A 4Z2UA 3BNMA 4H4VA 1H86A 1XANA 2YWLA 3NG7X 1D7YA 2PHHA 2B9YA 2JAEA 3BI2A 5C2TA 1O5WA 3VQRA 3V3OA 2VQ7A 1KSSA 1BZLA 1PJ6A 4OPDA 3ZNOA 1H82A 3AE3A 3AYIA 3NHOX 2DU8A 2W0HA 4M52A 2CULA 2YG7A 2YVGA 4U8OA 4C77A 4A5LA 2WP9A 4EIQA 2WEUA 2X50A 3LZWA 1VG9A 1E6EA 3CGDA 4G6GA 4G6HA 3DH9A 1CF3A 2WOWA 3LB8A 4HB9A 1EL9A 1BF3A 2E1MA 5FS7A 2C7GA 3ALMA 2B76A 3IHGA 2R46A 2R4JA 1F8RA 1LQTA 1PS9A 1PN0A 3UOVA 4ZCCA 4YWOA 1H7XA 1IUVA 1NG4A 3NK1X 4USRA 4FX9A 2QA1A 4JNQA 3ZYXA 4H4YA 4H4PA 3RHAA 5IPYA 3CGCA 4I59A 2PYXA 2YR6A 4BURA 2GR2A 1NDAA 4Z2RA 3I6DA 1JRXA 3NN6X 1LTXR 4OPTA 2OLNA 2CVJA 2JKCA 4IVMB 1YQZA 2TPRA 2WDQA 1H83A 2YAUA 3LXDA 4B69A 1BWCA 1YQ3A 4CY6A 4YSZA 1L0VA 1LV0A 3AEBA 1E39A 2VOUA 2WU2A 3AE2A 4GF7A 1W4XA 1Y0PA 2I0ZA 3ZNQA 2XVJA 3SY4A 3G3EA 4HA6A 2WP5A 3ALJA 1LPFA 3NYEA 3NLCA 4QFCA 2XFPA 3QJ4A 2WETA 3I3LA 2XYOA 1PBCA 1C0LA 4D04A 4EM4A 4EQRA 2FBWA 2GQWA 4YSYA 3AECA 2TMDA 1PDHA 2WOVA 3P1WA 4H50A 3LADA 4GR1A 4K5RA 1E1NA 1S3EA 3SZWA 2BK4A 3V76A 2VVMA 2WPCA 5GRTA 1L9EA 2R0PA 2XVEA 3NYCA 3B3RA 3T14A 3JSKA 3ICSA 3R9UA 3NH3X 4AP1A 1GNDA 5GSNA 2X8HA 4AP3A 3P4SA 3H4KA 2FJEA 5KMSA 1M64A 2E49A 2GR3A 3HZLA 4ICYA 3NK2X 4YKFA 2E4GA 3LZXA 3KVEA 3BHKA 4U8KA 1O95A 4BJZA 4J56A 4ADWA 1ZDLA 3BNUA 3D1CA 4EQWA 3DJJA 2YLRA 4A6NB 4EMJA 2GAGB 2X99A 2APGA 2A8XA 2ZZ0A 3NKSA 4CNKA 5ER0A 2YR5A 3H8IA 4J2WA 5U25A 2EQ7A 2BS4A 3QSEA 1L9DA 2A89A 4H2PA 5JCMA 4RG4A 3AXBA 1SEZA 1ZMDA 3P4RA 3CPJG 4TLZA 4YJHA 1C0IA 2A87A 4C74A 4QFDA 2C66A 2H88A 4A9WA 1ZMCA 4YTPA 1Q1WA 2XLSA 3DK8A 3IHMA 1ZKQA 2V3AA 4J33A 3ADAB 4NEVA 3T2YA 4XXGA 1Q9IA 4A65A 3KLJA 2Z5YA 3O0HA 1F6MA 3V3NA 1JRZA 4OPGA 1LVLA 1CJ2A 4U8PA 3FBSA 1F3PA 3DA1A 2R4EA 2AAQA 4H2QA 1VG0A 3BI4A 4H4QA 2R9ZA 4B65A 4BK2A 1TDNA 4A79A 4AT0A 5KMRA 4O5UA 3CGEA 2V3BA 1GPEA 1CJ4A 2QCUA 2R45A 4H7UA 3PVCA 3HYXA 2GEWA 4CBQA 2E48A 1V59A 2YG3A 4GRTA 4LU6A 4U8LA 4YSXA 4P9SA 1E7PA 1S3BA 4UDPA 3SFEA 3WE0A 1C0KA 1PBDA 3CPIG 4REKA 4YKGA 1CC2A 3AD9B 1FCDA 4B68A 3KD9A 1P2HA 5LV9A 3UKHA 3CNSA 1DOBA 3QSMA 1OJTA 1CHUA 3HYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ8 A;  3OZ2 A;  3F8P A;  1Y56 B;  3W4K A;  4K5S A;  4B66 A;  5KWF A;  2VRL A;  2VVL G;  2J3N A;  1OJA A;  4X9N A;  3CN8 A;  3AE5 A;  2NPX A;  3GWF A;  3NGC X;  1FEB A;  2RGO A;  4H2R A;  3ZNN A;  4N9X A;  1DAO A;  2B9X A;  3COX A;  3GRT A;  2WQY A;  3NYF A;  2OA1 A;  2GRT A;  4CNJ A;  2XCG A;  1DOE A;  3AEE A;  4OPC A;  2BK3 A;  1TDO A;  1O94 A;  3ABV A;  3AB1 A;  3IC9 A;  4OPI A;  1BKW A;  1H81 A;  1KDG A;  1HYU A;  2BXR A;  5FS8 A;  5CKU A;  3UOZ A;  1KF6 A;  1PJ5 A;  1F8W A;  1NHR A;  2H89 A;  1TDK A;  3K30 A;  4U8M A;  3C96 A;  4Y4M A;  1NEK A;  3S5W A;  3URH A;  2YM1 A;  1RYI A;  2E82 A;  2BC1 A;  3CNJ A;  3GYJ A;  1GOS A;  4J36 A;  4I58 A;  4CRT A;  2CDU A;  2CFY A;  4Z43 A;  1NHP A;  5EB4 A;  1QJD A;  3QVP A;  3DGH A;  3P4P A;  1E1L A;  1NEN A;  2C3D A;  3K7Q X;  2BCG G;  1AOG A;  4IVO B;  2X8C A;  3DJG X;  4ECH A;  5M10 A;  2XVI A;  4EQS A;  1PBB A;  4YJF A;  2WPF A;  1H84 A;  2V60 A;  2XFO A;  2YVJ A;  3ICR A;  3T37 A;  5BVA A;  1GER A;  3UP5 A;  4EQX A;  2GAH B;  4J57 A;  3AYL A;  2RGH A;  4YJG A;  4PAA A;  1B37 A;  3G5Q A;  4IA5 A;  5J7X A;  4BK1 A;  1PBF A;  1B8S A;  1TYP A;  3SQP A;  1NHS A;  4AOS A;  2C75 A;  2RGJ A;  2DKI A;  3AE9 A;  2OLO A;  2BXS A;  4A7A A;  1ONF A;  3DJD A;  3LOV A;  3AD8 B;  1GSN A;  1GEU A;  4U8I A;  4AT2 A;  1C0P A;  1TYT A;  3CND A;  2BK5 A;  4OPL A;  2WDR A;  3UOY A;  1FL2 A;  1ZY8 A;  3GD3 A;  2EQ9 A;  2QA2 A;  4DGK A;  2RAB A;  2R0G A;  2XFN A;  1EL8 A;  2JB3 A;  4K2X A;  5HYM A;  3KU9 A;  1ELI A;  1LQU A;  2OAL A;  4H4X A;  3RP8 A;  3ICT A;  5JCK A;  1GTH A;  1XPQ A;  4USQ A;  1AN9 A;  1NG3 A;  1CL0 A;  2ZZB A;  3AE8 A;  4YSH A;  1PBE A;  2WES A;  5M0Z A;  4E0V A;  2BA9 A;  1QO8 A;  2XDO A;  3KA7 A;  4YXD A;  5BRT A;  4U2T A;  4NZH A;  3WGT A;  2YG6 A;  4U2S A;  4FDC B;  2YG5 A;  1GES A;  1EBD A;  3UTE A;  1DJQ A;  1JNR A;  1IUT A;  3ISH A;  4B67 A;  1GT8 A;  3FPZ A;  2B7S A;  3AE7 A;  3L1R A;  3AEF A;  4H4Z A;  4JN9 A;  2BAB A;  4JQ9 A;  2JK6 A;  5EOW A;  5JCI A;  2YLT A;  4WX1 A;  3II4 A;  1ZP0 A;  2WPE A;  3CIR A;  1P2E A;  2HQM A;  1PXB A;  3EAO A;  3CNP A;  5IQ4 A;  1VE9 A;  3AE6 A;  4Z26 A;  3K7T A;  4JY3 A;  5FS6 A;  3DK4 A;  1GET A;  4JDR A;  4B63 A;  1PXA A;  1D4E A;  4DSH A;  3W4J A;  2BAC A;  4FK1 C;  1PJ7 A;  5HY5 A;  1F8S A;  5IQ1 A;  3CNT A;  2IVD A;  3PS9 A;  1IJH A;  3UOX A;  1B5Q A;  2C70 A;  3G5S A;  1N4V A;  4K8D A;  4NEW A;  3GRS A;  2OAM A;  2YLZ A;  3SGL A;  2ARD A;  3AED A;  4IA6 A;  3GD4 A;  5KOX A;  1H6V A;  2YG4 A;  1OJC A;  2AQJ A;  2O9Z A;  2Z5X A;  2C65 A;  3DGZ A;  3RED A;  1ZK7 A;  3CTY A;  3NNE A;  1S2Q A;  2V6O A;  3ZDN A;  1PHH A;  3NTD A;  3IF9 A;  3PO7 A;  5DBJ A;  4GDP A;  3AEA A;  4U8N A;  2C76 A;  4H4U A;  1XHC A;  3CUK A;  4K22 A;  4C3Y A;  2WS3 A;  2WU5 A;  3OC4 A;  1B4V A;  3UTG A;  3AD7 B;  3LJP A;  5KVH A;  2IVE A;  3IWA A;  1RP0 A;  2FJA A;  5KVI A;  3GMC A;  4U8J A;  3ATR A;  3RP7 A;  1GRT A;  1GTE A;  2B9W A;  1IUX A;  1FOH A;  1CJ3 A;  1N4W A;  4CY8 A;  5TR3 A;  2QAE A;  1IUU A;  3M12 A;  3EPT A;  4A6N A;  2JB2 A;  4EMI A;  2VVL A;  1H7W A;  1ZX9 A;  2F5Z A;  2XVF A;  4OCG A;  3FMW A;  2R0C A;  4NTD A;  4TM3 A;  4YTM A;  3UCL A;  1DOD A;  2GB0 A;  3P4Q A;  1DDO A;  4O5Q A;  1GAL A;  3RP6 A;  5KOW A;  3UKA A;  2Y6Q A;  3SFD A;  1D4C A;  1BGN A;  1GV4 A;  4B64 A;  3D8X A;  4H4W A;  4ZN0 A;  3C4A A;  4H4S A;  4LII A;  1TDF A;  2BC0 A;  3VRB A;  2GVC A;  4RSL A;  2Q0L A;  4MJW A;  2X3N A;  3NN0 X;  4J34 A;  4DNA A;  5EBK A;  1EL7 A;  2XLR A;  4TM1 A;  4EIP A;  2GQF A;  3F8D A;  5HHF A;  2XLT A;  2C64 A;  2Q6U A;  3Q9T A;  1CJC A;  3K7M X;  2ACZ A;  4FK1 A;  2ZBW A;  4EM3 A;  3UKL A;  2VQB A;  3KKJ A;  1DJN A;  4LA1 A;  2V61 A;  4YJD A;  3AE1 A;  1K4Q A;  1CC4 A;  2GH5 A;  3GDP A;  4Y4N A;  2BS3 A;  1TDE A;  4IV9 A;  5U1O A;  3DME A;  4BK3 A;  3GDN A;  5KXJ A;  1COY A;  5U63 A;  2FJD A;  4APN A;  1S2Y A;  2XFQ A;  1OJD A;  5FS9 A;  2E4A A;  3NK0 X;  1LJ1 A;  1KNP A;  1E1M A;  1FEC A;  3UTH A;  1KIF A;  3AWI A;  4PAB A;  3P9U A;  3DJE A;  3ITJ A;  3AYJ A;  3NRN A;  1GRE A;  1Y56 A;  2BYB A;  3FIM B;  2WDV A;  1EL5 A;  3SM8 A;  2BCP A;  1MOK A;  4YTN A;  3QFB A;  2B7R A;  2XVH A;  3L8K A;  3E1T A;  4AOX A;  4X9M A;  4GUV A;  1KSU A;  1D7L A;  5BUL A;  1GXF A;  3BHF A;  2WHD A;  3M0O A;  1M6I A;  4Z44 A;  3GWD A;  3S61 A;  3M13 A;  2Q7V A;  1IUS A;  1GRH A;  4H4T A;  5CQF A;  2EQ6 A;  4UDQ A;  4YJH B;  4JY2 A;  1NPX A;  4X4J A;  5KRQ A;  1GRB A;  3CPH G;  4OVI A;  2C72 A;  1GRA A;  4OPU A;  2X8G A;  1JEH A;  3UP4 A;  3B6D A;  2UZZ A;  1E1K A;  4D03 A;  1BGJ A;  3UKK A;  4UP3 A;  5C3J A;  3CGB A;  4EMW A;  1YKJ A;  3AE4 A;  1K0J A;  1RSG A;  2WP6 A;  4Y4L A;  3UTF A;  2WOI A;  1YQ4 A;  2FJB A;  4CCQ A;  2AR8 A;  3RNM A;  4H2N A;  3F8R A;  4NTE A;  1CBO A;  3QSS A;  2GR1 A;  3AEG A;  1D4D A;  4H4R A;  3QFA A;  2XLU A;  4ZCD A;  2C67 A;  4RG3 A;  1FEA A;  1N4U A;  1KFY A;  1VRQ B;  3FG2 P;  3UKP A;  1NAA A;  1TRB A;  2YQU A;  1DOC A;  1L9C A;  3KPF A;  1PXC A;  2V5Z A;  4TM0 A;  1ZOV A;  2GV8 A;  2VRM A;  3NTA A;  3VRD B;  4A99 A;  2DKH A;  2YVF A;  3GYI A;  5JCN A;  2WBA A;  3W4I A;  1JOA A;  2BS2 A;  4Z24 A;  3Q6J A;  1JRY A;  2C3C A;  2GMH A;  3NIX A;  2XFU A;  4B1B A;  4C3X A;  3BI5 A;  4U2L A;  1UKV G;  3EF6 A;  1X31 B;  2YLS A;  2JBV A;  1K0I A;  4XWR A;  2JB1 A;  2Q0K A;  2YR4 A;  4BJY A;  3VR8 A;  4J31 A;  2IID A;  2Y6R A;  4KPR A;  1MO9 A;  4UDR A;  1JU2 A;  5EB5 A;  4CCR A;  3H8L A;  1K0L A;  2YLX A;  3ZNP A;  1N1P A;  2NVK X;  4GCM A;  4TLX A;  1QLB A;  1JNZ A;  3UKF A;  2XLP A;  3QVR A;  5HXI A;  1YY5 A;  2GMJ A;  4TM4 A;  5JCL A;  4DSG A;  2GF3 A;  4JNA A;  3EAN A;  1GRF A;  1MXT A;  4XWZ A;  2GR0 A;  4GDE A;  3NT6 A;  3C4N A;  3DK9 A;  4Z25 A;  4K7Z A;  2E5V A;  1XDI A;  1Z6L A;  5J60 A;  1Q1R A;  4Z2T A;  3G5R A;  3GMB A;  2C73 A;  4WCT A;  1DXL A;  1NHQ A;  1ZOY A;  1KNR A;  2ZZC A;  5L46 A;  1VQW A;  5BUK A;  1REO A;  5FMH A;  3ALL A;  1CC6 A;  4C5O A;  3VR9 A;  3GSI A;  1IUW A;  4YJF B;  1D5T A;  3VRA A;  1OJ9 A;  2VZ2 A;  2YM2 A;  3UKQ A;  2YLW A;  3ATQ A;  1GRG A;  1VDC A;  4YT0 A;  4NTC A;  1EVI A;  4YJG B;  1DNC A;  4BV6 A;  4Z2U A;  3BNM A;  4H4V A;  1H86 A;  1XAN A;  2YWL A;  3NG7 X;  1D7Y A;  2PHH A;  2B9Y A;  2JAE A;  3BI2 A;  5C2T A;  1O5W A;  3VQR A;  3V3O A;  2VQ7 A;  1KSS A;  1BZL A;  1PJ6 A;  4OPD A;  3ZNO A;  1H82 A;  3AE3 A;  3AYI A;  3NHO X;  2DU8 A;  2W0H A;  4M52 A;  2CUL A;  2YG7 A;  2YVG A;  4U8O A;  4C77 A;  4A5L A;  2WP9 A;  4EIQ A;  2WEU A;  2X50 A;  3LZW A;  1VG9 A;  1E6E A;  3CGD A;  4HB9 A;  4KX6 A;  3DH9 A;  1CF3 A;  2WOW A;  3LB8 A;  4YKG A;  1EL9 A;  1BF3 A;  2E1M A;  5FS7 A;  2C7G A;  3ALM A;  2B76 A;  3IHG A;  2R46 A;  2R4J A;  1F8R A;  1LQT A;  1PS9 A;  1PN0 A;  3UOV A;  4ZCC A;  4YWO A;  1H7X A;  1IUV A;  1NG4 A;  3NK1 X;  4USR A;  4FX9 A;  2QA1 A;  4JNQ A;  3ZYX A;  4H4Y A;  4H4P A;  3RHA A;  5IPY A;  3CGC A;  4I59 A;  2PYX A;  2YR6 A;  4BUR A;  2GR2 A;  1NDA A;  4Z2R A;  3I6D A;  1JRX A;  3NN6 X;  1LTX R;  4OPT A;  2OLN A;  2CVJ A;  2JKC A;  4IVM B;  1YQZ A;  2TPR A;  2WDQ A;  1H83 A;  2YAU A;  3LXD A;  4B69 A;  1BWC A;  1YQ3 A;  4CY6 A;  4YSZ A;  1L0V A;  1LV0 A;  3AEB A;  1E39 A;  2VOU A;  2WU2 A;  3AE2 A;  4GF7 A;  1W4X A;  1Y0P A;  2I0Z A;  3ZNQ A;  2XVJ A;  3G3E A;  4HA6 A;  2WP5 A;  3ALJ A;  1LPF A;  3NYE A;  3NLC A;  4QFC A;  2XFP A;  3QJ4 A;  2WET A;  3I3L A;  2XYO A;  1PBC A;  1C0L A;  4D04 A;  4EM4 A;  4EQR A;  2FBW A;  2GQW A;  4YSY A;  3AEC A;  2TMD A;  1PDH A;  2WOV A;  3P1W A;  4H50 A;  3LAD A;  4GR1 A;  4K5R A;  1E1N A;  1S3E A;  3V76 A;  2BK4 A;  2VVM A;  2WPC A;  5GRT A;  1L9E A;  2R0P A;  2XVE A;  3NYC A;  3B3R A;  3JSK A;  3ICS A;  3R9U A;  3NH3 X;  4AP1 A;  1GND A;  5GSN A;  2X8H A;  4AP3 A;  3P4S A;  3H4K A;  2FJE A;  1M64 A;  2E49 A;  2GR3 A;  3HZL A;  4ICY A;  3NK2 X;  4YKF A;  2E4G A;  3LZX A;  3KVE A;  3BHK A;  4U8K A;  1O95 A;  4BJZ A;  4J56 A;  4ADW A;  1ZDL A;  3BNU A;  3D1C A;  4EQW A;  3DJJ A;  2YLR A;  4A6N B;  4EMJ A;  2GAG B;  2X99 A;  2APG A;  2A8X A;  2ZZ0 A;  3NKS A;  4CNK A;  5ER0 A;  2YR5 A;  3H8I A;  4J2W A;  5U25 A;  2EQ7 A;  2BS4 A;  3QSE A;  1L9D A;  2A89 A;  4H2P A;  5JCM A;  4RG4 A;  3AXB A;  1SEZ A;  1ZMD A;  3P4R A;  3CPJ G;  4TLZ A;  4YJH A;  1C0I A;  2A87 A;  4C74 A;  4QFD A;  2C66 A;  2H88 A;  4A9W A;  1ZMC A;  4YTP A;  1Q1W A;  2XLS A;  3DK8 A;  3IHM A;  1ZKQ A;  2V3A A;  4J33 A;  3ADA B;  4NEV A;  4XXG A;  1Q9I A;  3KLJ A;  2Z5Y A;  3O0H A;  1F6M A;  3V3N A;  1JRZ A;  4OPG A;  1LVL A;  1CJ2 A;  4U8P A;  3FBS A;  1F3P A;  3DA1 A;  2R4E A;  2AAQ A;  4H2Q A;  1VG0 A;  3BI4 A;  4H4Q A;  2R9Z A;  4B65 A;  4BK2 A;  1TDN A;  4A79 A;  4AT0 A;  4O5U A;  3CGE A;  2V3B A;  1GPE A;  1CJ4 A;  2QCU A;  2R45 A;  4H7U A;  3PVC A;  2GEW A;  4CBQ A;  2E48 A;  1V59 A;  2YG3 A;  4GRT A;  4LU6 A;  4U8L A;  4YSX A;  4P9S A;  1E7P A;  1S3B A;  4UDP A;  3SFE A;  3WE0 A;  1C0K A;  1PBD A;  3CPI G;  4REK A;  1CC2 A;  3AD9 B;  1FCD A;  4B68 A;  3KD9 A;  1P2H A;  5LV9 A;  3UKH A;  3CNS A;  1DOB A;  3QSM A;  1OJT A;  1CHU A;  4A65 A; 
#chains in the Genus database with same CATH topology
 2EQ8 A;  3OZ2 A;  3F8P A;  1Y56 B;  3W4K A;  4K5S A;  4B66 A;  5KWF A;  3T31 A;  2VRL A;  2VVL G;  2J3N A;  1OJA A;  4X9N A;  3CN8 A;  3AE5 A;  2NPX A;  3GWF A;  3NGC X;  1FEB A;  2RGO A;  4H2R A;  3ZNN A;  4N9X A;  1DAO A;  2B9X A;  3COX A;  3GRT A;  2WQY A;  3NYF A;  2OA1 A;  2GRT A;  4CNJ A;  2XCG A;  1DOE A;  3AEE A;  4OPC A;  2BK3 A;  1TDO A;  1O94 A;  3ABV A;  3AB1 A;  3IC9 A;  4OPI A;  1BKW A;  1H81 A;  1KDG A;  1HYU A;  2BXR A;  5FS8 A;  5CKU A;  3UOZ A;  1KF6 A;  1PJ5 A;  1F8W A;  1NHR A;  2H89 A;  1TDK A;  3K30 A;  4U8M A;  3SZ0 A;  3T2Z A;  3C96 A;  4Y4M A;  1NEK A;  3S5W A;  3URH A;  2YM1 A;  1RYI A;  2E82 A;  2BC1 A;  3CNJ A;  3GYJ A;  1GOS A;  4J36 A;  4I58 A;  4CRT A;  2CDU A;  2CFY A;  4Z43 A;  1NHP A;  5EB4 A;  1QJD A;  3QVP A;  3DGH A;  3P4P A;  1E1L A;  1NEN A;  2C3D A;  3K7Q X;  2BCG G;  1AOG A;  4IVO B;  2X8C A;  3DJG X;  4ECH A;  5M10 A;  2XVI A;  4EQS A;  1PBB A;  4YJF A;  2WPF A;  1H84 A;  2V60 A;  2XFO A;  2YVJ A;  3ICR A;  3T37 A;  5BVA A;  1GER A;  3UP5 A;  4EQX A;  2GAH B;  4J57 A;  3AYL A;  3SX6 A;  2RGH A;  4YJG A;  4PAA A;  4IA5 A;  1B37 A;  3G5Q A;  5J7X A;  4BK1 A;  1PBF A;  1B8S A;  1TYP A;  3SQP A;  1NHS A;  4G9K A;  2C75 A;  3SZC A;  3SZF A;  4AOS A;  2RGJ A;  2DKI A;  3AE9 A;  2OLO A;  2BXS A;  4A7A A;  1ONF A;  3GYX A;  3DJD A;  3LOV A;  3AD8 B;  1GSN A;  1GEU A;  4U8I A;  4AT2 A;  1C0P A;  1TYT A;  3T0K A;  3CND A;  2BK5 A;  4OPL A;  2WDR A;  3UOY A;  1FL2 A;  1ZY8 A;  3GD3 A;  2EQ9 A;  2QA2 A;  4DGK A;  2RAB A;  2R0G A;  2XFN A;  1EL8 A;  5HYM A;  2JB3 A;  4K2X A;  3KU9 A;  1ELI A;  1LQU A;  2OAL A;  4H4X A;  3RP8 A;  5KMQ A;  3ICT A;  5JCK A;  1GTH A;  1XPQ A;  4USQ A;  1AN9 A;  1NG3 A;  1CL0 A;  2ZZB A;  3AE8 A;  4YSH A;  1PBE A;  2WES A;  5M0Z A;  4E0V A;  2BA9 A;  1QO8 A;  2XDO A;  3KA7 A;  4YXD A;  5BRT A;  4U2T A;  4NZH A;  3WGT A;  2YG6 A;  4NWZ A;  4U2S A;  4FDC B;  2YG5 A;  1GES A;  1EBD A;  3UTE A;  1DJQ A;  1JNR A;  1IUT A;  3ISH A;  4B67 A;  1GT8 A;  3FPZ A;  2B7S A;  3AE7 A;  3L1R A;  3AEF A;  4H4Z A;  4JN9 A;  2BAB A;  4JQ9 A;  2JK6 A;  5EOW A;  5JCI A;  2YLT A;  4WX1 A;  3II4 A;  1ZP0 A;  2WPE A;  3CIR A;  1P2E A;  2HQM A;  1PXB A;  3EAO A;  3CNP A;  5IQ4 A;  1VE9 A;  3AE6 A;  4Z26 A;  3K7T A;  4JY3 A;  5FS6 A;  3DK4 A;  1GET A;  4JDR A;  4B63 A;  1PXA A;  1D4E A;  4DSH A;  3W4J A;  2BAC A;  3KPK A;  1PJ7 A;  4FK1 C;  5HY5 A;  1F8S A;  5IQ1 A;  3CNT A;  2IVD A;  3PS9 A;  1IJH A;  3UOX A;  1B5Q A;  2C70 A;  3G5S A;  1N4V A;  4K8D A;  4NEW A;  3GRS A;  2OAM A;  2YLZ A;  3SGL A;  4IA6 A;  2ARD A;  3AED A;  3GD4 A;  5KOX A;  1H6V A;  2YG4 A;  1OJC A;  2AQJ A;  2O9Z A;  2Z5X A;  2C65 A;  3DGZ A;  3RED A;  1ZK7 A;  3CTY A;  3NNE A;  1S2Q A;  2V6O A;  2BRA A;  3ZDN A;  1PHH A;  3NTD A;  3IF9 A;  3PO7 A;  5DBJ A;  4GDP A;  3AEA A;  4U8N A;  2C76 A;  4K22 A;  1XHC A;  3CUK A;  4H4U A;  4C3Y A;  5KNL A;  2WS3 A;  2WU5 A;  3OC4 A;  1B4V A;  3UTG A;  3AD7 B;  3LJP A;  5KVH A;  2IVE A;  3IWA A;  1RP0 A;  2FJA A;  5KVI A;  3GMC A;  4U8J A;  3RP7 A;  3ATR A;  1GRT A;  1GTE A;  2B9W A;  1IUX A;  1FOH A;  1CJ3 A;  1N4W A;  4CY8 A;  5TR3 A;  2QAE A;  1IUU A;  3EPT A;  3M12 A;  4A6N A;  2JB2 A;  4EMI A;  2VVL A;  1H7W A;  1ZX9 A;  2F5Z A;  2XVF A;  4OCG A;  3FMW A;  2R0C A;  4NTD A;  4TM3 A;  4YTM A;  3UCL A;  1DOD A;  2GB0 A;  3P4Q A;  1DDO A;  4O5Q A;  1GAL A;  3RP6 A;  5KOW A;  3UKA A;  2Y6Q A;  3SFD A;  1D4C A;  1BGN A;  1GV4 A;  4B64 A;  3D8X A;  4H4W A;  4KX6 A;  4ZN0 A;  5KMP A;  3C4A A;  4H4S A;  4LII A;  1TDF A;  2BC0 A;  3VRB A;  2GVC A;  4RSL A;  4G73 A;  2Q0L A;  4MJW A;  2X3N A;  3NN0 X;  4J34 A;  4DNA A;  5EBK A;  2BRY A;  1EL7 A;  4EIP A;  2XLR A;  4TM1 A;  2GQF A;  3F8D A;  4GAV A;  5HHF A;  2XLT A;  2C64 A;  2Q6U A;  3Q9T A;  1CJC A;  3K7M X;  2ACZ A;  4FK1 A;  2ZBW A;  4EM3 A;  3UKL A;  2VQB A;  3KKJ A;  1DJN A;  4LA1 A;  2V61 A;  4YJD A;  3AE1 A;  1K4Q A;  1CC4 A;  2GH5 A;  3GDP A;  4Y4N A;  2BS3 A;  1TDE A;  4BK3 A;  4IV9 A;  3DME A;  5U1O A;  3SXI A;  3GDN A;  5KXJ A;  1COY A;  5U63 A;  2FJD A;  4APN A;  1S2Y A;  2XFQ A;  1OJD A;  3CMM A;  5FS9 A;  2E4A A;  3NK0 X;  1LJ1 A;  1KNP A;  1E1M A;  1FEC A;  3UTH A;  1KIF A;  3AWI A;  4PAB A;  3P9U A;  3DJE A;  3ITJ A;  3AYJ A;  3NRN A;  1GRE A;  1Y56 A;  2BYB A;  3FIM B;  2WDV A;  1EL5 A;  3SM8 A;  2BCP A;  1MOK A;  4YTN A;  3QFB A;  2B7R A;  2XVH A;  3L8K A;  3E1T A;  4AOX A;  4X9M A;  4GUV A;  1KSU A;  1D7L A;  4NNJ A;  5BUL A;  1GXF A;  3BHF A;  2WHD A;  3M0O A;  1M6I A;  4Z44 A;  3GWD A;  4G74 A;  3S61 A;  3M13 A;  4II3 A;  2Q7V A;  1IUS A;  1GRH A;  4H4T A;  5CQF A;  2EQ6 A;  4UDQ A;  4YJH B;  4JY2 A;  1NPX A;  4X4J A;  5KRQ A;  1GRB A;  3CPH G;  4OVI A;  2C72 A;  1GRA A;  4OPU A;  2X8G A;  1JEH A;  3UP4 A;  3B6D A;  2UZZ A;  1E1K A;  4D03 A;  1BGJ A;  3UKK A;  4UP3 A;  5C3J A;  3CGB A;  4EMW A;  1YKJ A;  3AE4 A;  1K0J A;  1RSG A;  2WP6 A;  4Y4L A;  3UTF A;  2WOI A;  1YQ4 A;  2FJB A;  4CCQ A;  2AR8 A;  3RNM A;  4H2N A;  3F8R A;  4NTE A;  1CBO A;  3QSS A;  2GR1 A;  3AEG A;  1D4D A;  4H4R A;  3QFA A;  2XLU A;  4ZCD A;  2C67 A;  4RG3 A;  2C4C A;  1N4U A;  1FEA A;  1KFY A;  4II2 A;  1VRQ B;  3FG2 P;  3UKP A;  1NAA A;  1TRB A;  2YQU A;  1DOC A;  1L9C A;  3KPF A;  1PXC A;  2V5Z A;  4TM0 A;  1ZOV A;  2GV8 A;  2VRM A;  3NTA A;  3VRD B;  4A99 A;  2DKH A;  2YVF A;  3GYI A;  5JCN A;  2WBA A;  3W4I A;  1JOA A;  2BS2 A;  4Z24 A;  3Q6J A;  1JRY A;  2C3C A;  2GMH A;  3NIX A;  2XFU A;  4B1B A;  4C3X A;  3BI5 A;  4U2L A;  1UKV G;  3EF6 A;  1X31 B;  2YLS A;  2JBV A;  1K0I A;  4XWR A;  2JB1 A;  4BJY A;  2Q0K A;  2YR4 A;  3VR8 A;  4J31 A;  2IID A;  2Y6R A;  4KPR A;  1MO9 A;  4UDR A;  1JU2 A;  5EB5 A;  4CCR A;  3H8L A;  1K0L A;  2YLX A;  3ZNP A;  1N1P A;  3T2K A;  2NVK X;  4GCM A;  4TLX A;  1QLB A;  1JNZ A;  3UKF A;  3SYI A;  5HXI A;  2XLP A;  3QVR A;  1YY5 A;  2GMJ A;  4GAP A;  4TM4 A;  5JCL A;  4DSG A;  2GF3 A;  4JNA A;  3EAN A;  1GRF A;  1MXT A;  4XWZ A;  2GR0 A;  4GDE A;  3NT6 A;  3C4N A;  3DK9 A;  4Z25 A;  4K7Z A;  2E5V A;  1XDI A;  3HYW A;  1Z6L A;  5J60 A;  1Q1R A;  4Z2T A;  3G5R A;  3GMB A;  2C73 A;  4WCT A;  1DXL A;  1NHQ A;  1ZOY A;  1KNR A;  2ZZC A;  5L46 A;  1VQW A;  5BUK A;  1REO A;  5FMH A;  3ALL A;  1CC6 A;  4C5O A;  3VR9 A;  3GSI A;  1IUW A;  4YJF B;  1D5T A;  3VRA A;  1OJ9 A;  2VZ2 A;  2YM2 A;  3UKQ A;  2YLW A;  3ATQ A;  1GRG A;  1VDC A;  4YT0 A;  4NTC A;  1EVI A;  4YJG B;  1DNC A;  4BV6 A;  4Z2U A;  3BNM A;  4H4V A;  1H86 A;  1XAN A;  2YWL A;  3NG7 X;  1D7Y A;  2PHH A;  2B9Y A;  2JAE A;  3BI2 A;  5C2T A;  1O5W A;  3VQR A;  3V3O A;  2VQ7 A;  1KSS A;  1BZL A;  1PJ6 A;  4OPD A;  3ZNO A;  1H82 A;  3AE3 A;  3AYI A;  3NHO X;  2DU8 A;  2W0H A;  4M52 A;  2CUL A;  2YG7 A;  2YVG A;  4U8O A;  4C77 A;  4EIQ A;  2WP9 A;  4A5L A;  2WEU A;  2X50 A;  3LZW A;  1VG9 A;  1E6E A;  3CGD A;  4G6G A;  4G6H A;  3DH9 A;  1CF3 A;  2WOW A;  3LB8 A;  4HB9 A;  1EL9 A;  1BF3 A;  2E1M A;  5FS7 A;  3ALM A;  2C7G A;  2B76 A;  3IHG A;  2R46 A;  2R4J A;  1F8R A;  1LQT A;  1PS9 A;  1PN0 A;  3UOV A;  4ZCC A;  4YWO A;  1H7X A;  1IUV A;  1NG4 A;  3NK1 X;  4USR A;  4FX9 A;  2QA1 A;  4JNQ A;  3ZYX A;  4H4Y A;  4H4P A;  3RHA A;  5IPY A;  3CGC A;  4I59 A;  2PYX A;  2YR6 A;  4BUR A;  2GR2 A;  1NDA A;  4Z2R A;  3I6D A;  1JRX A;  3NN6 X;  1LTX R;  4OPT A;  2OLN A;  2CVJ A;  2JKC A;  4IVM B;  1YQZ A;  2TPR A;  2WDQ A;  1H83 A;  2YAU A;  3LXD A;  4B69 A;  1BWC A;  1YQ3 A;  4CY6 A;  4YSZ A;  1L0V A;  4GF7 A;  1LV0 A;  1E39 A;  2VOU A;  2WU2 A;  3AEB A;  3AE2 A;  1W4X A;  1Y0P A;  2I0Z A;  3ZNQ A;  2XVJ A;  3SY4 A;  3G3E A;  4HA6 A;  2WP5 A;  3ALJ A;  1LPF A;  3NYE A;  3NLC A;  4QFC A;  2XFP A;  3QJ4 A;  2WET A;  3I3L A;  2XYO A;  1PBC A;  1C0L A;  4D04 A;  4EM4 A;  4EQR A;  2FBW A;  2GQW A;  4YSY A;  3AEC A;  2TMD A;  1PDH A;  2WOV A;  3P1W A;  4H50 A;  3LAD A;  4GR1 A;  4K5R A;  1E1N A;  1S3E A;  3SZW A;  2BK4 A;  3V76 A;  2VVM A;  2WPC A;  5GRT A;  1L9E A;  2R0P A;  2XVE A;  3NYC A;  3B3R A;  3T14 A;  3JSK A;  3ICS A;  3R9U A;  3NH3 X;  4AP1 A;  1GND A;  5GSN A;  2X8H A;  4AP3 A;  3P4S A;  3H4K A;  2FJE A;  5KMS A;  1M64 A;  2E49 A;  2GR3 A;  3HZL A;  4ICY A;  3NK2 X;  4YKF A;  2E4G A;  4BJZ A;  3KVE A;  3BHK A;  3LZX A;  1O95 A;  4U8K A;  4J56 A;  4ADW A;  1ZDL A;  3BNU A;  3D1C A;  4EQW A;  3DJJ A;  2YLR A;  4A6N B;  4EMJ A;  2GAG B;  2X99 A;  2APG A;  2A8X A;  2ZZ0 A;  3NKS A;  4CNK A;  5ER0 A;  2YR5 A;  3H8I A;  4J2W A;  5U25 A;  2EQ7 A;  2BS4 A;  3QSE A;  1L9D A;  2A89 A;  4H2P A;  5JCM A;  4RG4 A;  3AXB A;  1SEZ A;  1ZMD A;  3P4R A;  3CPJ G;  4TLZ A;  4YJH A;  1C0I A;  2A87 A;  4C74 A;  4QFD A;  2C66 A;  2H88 A;  4A9W A;  1ZMC A;  4YTP A;  1Q1W A;  2XLS A;  3DK8 A;  3IHM A;  1ZKQ A;  2V3A A;  4J33 A;  3ADA B;  4NEV A;  3T2Y A;  4XXG A;  1Q9I A;  4A65 A;  3KLJ A;  2Z5Y A;  3O0H A;  1F6M A;  3V3N A;  1JRZ A;  4OPG A;  1LVL A;  1CJ2 A;  4U8P A;  3FBS A;  1F3P A;  3DA1 A;  2R4E A;  4H2Q A;  2AAQ A;  4BK2 A;  1VG0 A;  3BI4 A;  2R9Z A;  4H4Q A;  4B65 A;  1TDN A;  4A79 A;  4AT0 A;  5KMR A;  4O5U A;  3CGE A;  2V3B A;  1GPE A;  1CJ4 A;  2QCU A;  2R45 A;  4H7U A;  3PVC A;  3HYX A;  2GEW A;  4CBQ A;  2E48 A;  1V59 A;  2YG3 A;  4GRT A;  4LU6 A;  4U8L A;  4YSX A;  4P9S A;  1E7P A;  1S3B A;  4UDP A;  3SFE A;  3WE0 A;  1C0K A;  1PBD A;  3CPI G;  4REK A;  4YKG A;  1CC2 A;  3AD9 B;  1FCD A;  4B68 A;  3KD9 A;  1P2H A;  5LV9 A;  3UKH A;  3CNS A;  1DOB A;  3QSM A;  1OJT A;  1CHU A;  3HYV A; 
#chains in the Genus database with same CATH homology
 2EQ8 A;  3OZ2 A;  3F8P A;  1Y56 B;  3W4K A;  4K5S A;  4B66 A;  5KWF A;  3T31 A;  2VRL A;  2VVL G;  2J3N A;  1OJA A;  4X9N A;  3CN8 A;  3AE5 A;  2NPX A;  3GWF A;  3NGC X;  1FEB A;  2RGO A;  4H2R A;  3ZNN A;  4N9X A;  1DAO A;  2B9X A;  3COX A;  3GRT A;  2WQY A;  3NYF A;  2OA1 A;  2GRT A;  4CNJ A;  2XCG A;  1DOE A;  3AEE A;  4OPC A;  2BK3 A;  1TDO A;  1O94 A;  3ABV A;  3AB1 A;  3IC9 A;  4OPI A;  1BKW A;  1H81 A;  1KDG A;  1HYU A;  2BXR A;  5FS8 A;  5CKU A;  3UOZ A;  1KF6 A;  1PJ5 A;  1F8W A;  1NHR A;  2H89 A;  1TDK A;  3K30 A;  4U8M A;  3SZ0 A;  3T2Z A;  3C96 A;  4Y4M A;  1NEK A;  3S5W A;  3URH A;  2YM1 A;  1RYI A;  2E82 A;  2BC1 A;  3CNJ A;  3GYJ A;  1GOS A;  4J36 A;  4I58 A;  4CRT A;  2CDU A;  2CFY A;  4Z43 A;  1NHP A;  5EB4 A;  1QJD A;  3QVP A;  3DGH A;  3P4P A;  1E1L A;  1NEN A;  2C3D A;  3K7Q X;  2BCG G;  1AOG A;  4IVO B;  2X8C A;  3DJG X;  4ECH A;  5M10 A;  2XVI A;  4EQS A;  1PBB A;  4YJF A;  2WPF A;  1H84 A;  2V60 A;  2XFO A;  2YVJ A;  3ICR A;  3T37 A;  5BVA A;  1GER A;  3UP5 A;  4EQX A;  2GAH B;  4J57 A;  3AYL A;  3SX6 A;  2RGH A;  4YJG A;  4PAA A;  1B37 A;  3G5Q A;  4IA5 A;  5J7X A;  4BK1 A;  1PBF A;  1B8S A;  1TYP A;  3SQP A;  1NHS A;  4G9K A;  2C75 A;  3SZC A;  3SZF A;  4AOS A;  2RGJ A;  2DKI A;  3AE9 A;  2OLO A;  2BXS A;  4A7A A;  1ONF A;  3GYX A;  3DJD A;  3LOV A;  3AD8 B;  1GSN A;  1GEU A;  4U8I A;  4AT2 A;  1C0P A;  1TYT A;  3T0K A;  3CND A;  2BK5 A;  4OPL A;  2WDR A;  3UOY A;  1FL2 A;  1ZY8 A;  3GD3 A;  2EQ9 A;  2QA2 A;  4DGK A;  2RAB A;  2R0G A;  2XFN A;  1EL8 A;  2JB3 A;  4K2X A;  5HYM A;  3KU9 A;  1ELI A;  1LQU A;  2OAL A;  4H4X A;  5KMQ A;  3RP8 A;  3ICT A;  5JCK A;  1GTH A;  1XPQ A;  4USQ A;  1AN9 A;  1NG3 A;  1CL0 A;  2ZZB A;  3AE8 A;  4YSH A;  1PBE A;  2WES A;  5M0Z A;  4E0V A;  2BA9 A;  1QO8 A;  2XDO A;  3KA7 A;  4YXD A;  5BRT A;  4U2T A;  4NZH A;  3WGT A;  2YG6 A;  4NWZ A;  4U2S A;  4FDC B;  2YG5 A;  1GES A;  1EBD A;  3UTE A;  1DJQ A;  1JNR A;  1IUT A;  3ISH A;  4B67 A;  1GT8 A;  3FPZ A;  2B7S A;  3AE7 A;  3L1R A;  3AEF A;  4H4Z A;  4JN9 A;  2BAB A;  4JQ9 A;  2JK6 A;  5EOW A;  5JCI A;  2YLT A;  4WX1 A;  3II4 A;  1ZP0 A;  2WPE A;  3CIR A;  1P2E A;  2HQM A;  1PXB A;  3EAO A;  3CNP A;  5IQ4 A;  1VE9 A;  3AE6 A;  4Z26 A;  3K7T A;  4JY3 A;  5FS6 A;  3DK4 A;  1GET A;  4JDR A;  4B63 A;  1PXA A;  1D4E A;  4DSH A;  3W4J A;  2BAC A;  3KPK A;  1PJ7 A;  4FK1 C;  5HY5 A;  1F8S A;  5IQ1 A;  3CNT A;  2IVD A;  3PS9 A;  1IJH A;  3UOX A;  1B5Q A;  2C70 A;  3G5S A;  1N4V A;  4K8D A;  4NEW A;  3GRS A;  2OAM A;  2YLZ A;  3SGL A;  2ARD A;  3AED A;  4IA6 A;  3GD4 A;  5KOX A;  1H6V A;  2YG4 A;  1OJC A;  2AQJ A;  2O9Z A;  2Z5X A;  2C65 A;  3DGZ A;  3RED A;  1ZK7 A;  3CTY A;  3NNE A;  1S2Q A;  2V6O A;  2BRA A;  3ZDN A;  1PHH A;  3NTD A;  3IF9 A;  3PO7 A;  5DBJ A;  4GDP A;  3AEA A;  4U8N A;  2C76 A;  4H4U A;  1XHC A;  3CUK A;  4K22 A;  4C3Y A;  5KNL A;  2WS3 A;  2WU5 A;  3OC4 A;  1B4V A;  3UTG A;  3AD7 B;  3LJP A;  5KVH A;  2IVE A;  3IWA A;  1RP0 A;  2FJA A;  5KVI A;  3GMC A;  4U8J A;  3ATR A;  3RP7 A;  1GRT A;  1GTE A;  2B9W A;  1IUX A;  1FOH A;  1CJ3 A;  1N4W A;  4CY8 A;  5TR3 A;  2QAE A;  1IUU A;  3M12 A;  3EPT A;  4A6N A;  2JB2 A;  4EMI A;  2VVL A;  1H7W A;  1ZX9 A;  2F5Z A;  2XVF A;  4OCG A;  3FMW A;  2R0C A;  4NTD A;  4TM3 A;  4YTM A;  3UCL A;  1DOD A;  2GB0 A;  3P4Q A;  1DDO A;  4O5Q A;  1GAL A;  3RP6 A;  5KOW A;  3UKA A;  2Y6Q A;  3SFD A;  1D4C A;  1BGN A;  1GV4 A;  4B64 A;  3D8X A;  4H4W A;  4KX6 A;  4ZN0 A;  5KMP A;  3C4A A;  4H4S A;  4LII A;  1TDF A;  2BC0 A;  3VRB A;  2GVC A;  4RSL A;  4G73 A;  2Q0L A;  4MJW A;  2X3N A;  3NN0 X;  4J34 A;  4DNA A;  5EBK A;  2BRY A;  1EL7 A;  2XLR A;  4TM1 A;  4EIP A;  2GQF A;  3F8D A;  4GAV A;  5HHF A;  2XLT A;  2C64 A;  2Q6U A;  3Q9T A;  1CJC A;  3K7M X;  2ACZ A;  4FK1 A;  2ZBW A;  4EM3 A;  3UKL A;  2VQB A;  3KKJ A;  1DJN A;  4LA1 A;  2V61 A;  4YJD A;  3AE1 A;  1K4Q A;  1CC4 A;  2GH5 A;  3GDP A;  4Y4N A;  2BS3 A;  1TDE A;  4IV9 A;  5U1O A;  3DME A;  3SXI A;  4BK3 A;  3GDN A;  5KXJ A;  1COY A;  5U63 A;  2FJD A;  4APN A;  1S2Y A;  2XFQ A;  1OJD A;  3CMM A;  5FS9 A;  2E4A A;  3NK0 X;  1LJ1 A;  1KNP A;  1E1M A;  1FEC A;  3UTH A;  1KIF A;  3AWI A;  4PAB A;  3P9U A;  3DJE A;  3ITJ A;  3AYJ A;  3NRN A;  1GRE A;  1Y56 A;  2BYB A;  3FIM B;  2WDV A;  1EL5 A;  3SM8 A;  2BCP A;  1MOK A;  4YTN A;  3QFB A;  2B7R A;  2XVH A;  3L8K A;  3E1T A;  4AOX A;  4X9M A;  4GUV A;  1KSU A;  1D7L A;  4NNJ A;  5BUL A;  1GXF A;  3BHF A;  2WHD A;  3M0O A;  1M6I A;  4Z44 A;  3GWD A;  4G74 A;  3S61 A;  3M13 A;  4II3 A;  2Q7V A;  1IUS A;  1GRH A;  4H4T A;  5CQF A;  2EQ6 A;  4UDQ A;  4YJH B;  4JY2 A;  1NPX A;  4X4J A;  5KRQ A;  1GRB A;  3CPH G;  4OVI A;  2C72 A;  1GRA A;  4OPU A;  2X8G A;  1JEH A;  3UP4 A;  3B6D A;  2UZZ A;  1E1K A;  4D03 A;  1BGJ A;  3UKK A;  4UP3 A;  5C3J A;  3CGB A;  4EMW A;  1YKJ A;  3AE4 A;  1K0J A;  1RSG A;  2WP6 A;  4Y4L A;  3UTF A;  2WOI A;  1YQ4 A;  2FJB A;  4CCQ A;  2AR8 A;  3RNM A;  4H2N A;  3F8R A;  4NTE A;  1CBO A;  3QSS A;  2GR1 A;  3AEG A;  1D4D A;  4H4R A;  3QFA A;  2XLU A;  4ZCD A;  2C67 A;  4RG3 A;  2C4C A;  1FEA A;  1N4U A;  1KFY A;  4II2 A;  1VRQ B;  3FG2 P;  3UKP A;  1NAA A;  1TRB A;  2YQU A;  1DOC A;  1L9C A;  3KPF A;  1PXC A;  2V5Z A;  4TM0 A;  1ZOV A;  2GV8 A;  2VRM A;  3NTA A;  3VRD B;  4A99 A;  2DKH A;  2YVF A;  3GYI A;  5JCN A;  2WBA A;  3W4I A;  1JOA A;  2BS2 A;  4Z24 A;  3Q6J A;  1JRY A;  2C3C A;  2GMH A;  3NIX A;  2XFU A;  4B1B A;  4C3X A;  3BI5 A;  4U2L A;  1UKV G;  3EF6 A;  1X31 B;  2YLS A;  2JBV A;  1K0I A;  4XWR A;  2JB1 A;  2Q0K A;  2YR4 A;  4BJY A;  3VR8 A;  4J31 A;  2IID A;  2Y6R A;  4KPR A;  1MO9 A;  4UDR A;  1JU2 A;  5EB5 A;  4CCR A;  3H8L A;  1K0L A;  2YLX A;  3ZNP A;  1N1P A;  3T2K A;  2NVK X;  4GCM A;  4TLX A;  1QLB A;  1JNZ A;  3UKF A;  3SYI A;  2XLP A;  3QVR A;  5HXI A;  1YY5 A;  2GMJ A;  4GAP A;  4TM4 A;  5JCL A;  4DSG A;  2GF3 A;  4JNA A;  3EAN A;  1GRF A;  1MXT A;  4XWZ A;  2GR0 A;  4GDE A;  3NT6 A;  3C4N A;  3DK9 A;  4Z25 A;  4K7Z A;  2E5V A;  1XDI A;  3HYW A;  1Z6L A;  5J60 A;  1Q1R A;  4Z2T A;  3G5R A;  3GMB A;  2C73 A;  4WCT A;  1DXL A;  1NHQ A;  1ZOY A;  1KNR A;  2ZZC A;  5L46 A;  1VQW A;  5BUK A;  1REO A;  5FMH A;  3ALL A;  1CC6 A;  4C5O A;  3VR9 A;  3GSI A;  1IUW A;  4YJF B;  1D5T A;  3VRA A;  1OJ9 A;  2VZ2 A;  2YM2 A;  3UKQ A;  2YLW A;  3ATQ A;  1GRG A;  1VDC A;  4YT0 A;  4NTC A;  1EVI A;  4YJG B;  1DNC A;  4BV6 A;  4Z2U A;  3BNM A;  4H4V A;  1H86 A;  1XAN A;  2YWL A;  3NG7 X;  1D7Y A;  2PHH A;  2B9Y A;  2JAE A;  3BI2 A;  5C2T A;  1O5W A;  3VQR A;  3V3O A;  2VQ7 A;  1KSS A;  1BZL A;  1PJ6 A;  4OPD A;  3ZNO A;  1H82 A;  3AE3 A;  3AYI A;  3NHO X;  2DU8 A;  2W0H A;  4M52 A;  2CUL A;  2YG7 A;  2YVG A;  4U8O A;  4C77 A;  4A5L A;  2WP9 A;  4EIQ A;  2WEU A;  2X50 A;  3LZW A;  1VG9 A;  1E6E A;  3CGD A;  4G6G A;  4G6H A;  3DH9 A;  1CF3 A;  2WOW A;  3LB8 A;  4HB9 A;  1EL9 A;  1BF3 A;  2E1M A;  5FS7 A;  2C7G A;  3ALM A;  2B76 A;  3IHG A;  2R46 A;  2R4J A;  1F8R A;  1LQT A;  1PS9 A;  1PN0 A;  3UOV A;  4ZCC A;  4YWO A;  1H7X A;  1IUV A;  1NG4 A;  3NK1 X;  4USR A;  4FX9 A;  2QA1 A;  4JNQ A;  3ZYX A;  4H4Y A;  4H4P A;  3RHA A;  5IPY A;  3CGC A;  4I59 A;  2PYX A;  2YR6 A;  4BUR A;  2GR2 A;  1NDA A;  4Z2R A;  3I6D A;  1JRX A;  3NN6 X;  1LTX R;  4OPT A;  2OLN A;  2CVJ A;  2JKC A;  4IVM B;  1YQZ A;  2TPR A;  2WDQ A;  1H83 A;  2YAU A;  3LXD A;  4B69 A;  1BWC A;  1YQ3 A;  4CY6 A;  4YSZ A;  1L0V A;  1LV0 A;  3AEB A;  1E39 A;  2VOU A;  2WU2 A;  3AE2 A;  4GF7 A;  1W4X A;  1Y0P A;  2I0Z A;  3ZNQ A;  2XVJ A;  3SY4 A;  3G3E A;  4HA6 A;  2WP5 A;  3ALJ A;  1LPF A;  3NYE A;  3NLC A;  4QFC A;  2XFP A;  3QJ4 A;  2WET A;  3I3L A;  2XYO A;  1PBC A;  1C0L A;  4D04 A;  4EM4 A;  4EQR A;  2FBW A;  2GQW A;  4YSY A;  3AEC A;  2TMD A;  1PDH A;  2WOV A;  3P1W A;  4H50 A;  3LAD A;  4GR1 A;  4K5R A;  1E1N A;  1S3E A;  3SZW A;  2BK4 A;  3V76 A;  2VVM A;  2WPC A;  5GRT A;  1L9E A;  2R0P A;  2XVE A;  3NYC A;  3B3R A;  3T14 A;  3JSK A;  3ICS A;  3R9U A;  3NH3 X;  4AP1 A;  1GND A;  5GSN A;  2X8H A;  4AP3 A;  3P4S A;  3H4K A;  2FJE A;  5KMS A;  1M64 A;  2E49 A;  2GR3 A;  3HZL A;  4ICY A;  3NK2 X;  4YKF A;  2E4G A;  3LZX A;  3KVE A;  3BHK A;  4U8K A;  1O95 A;  4BJZ A;  4J56 A;  4ADW A;  1ZDL A;  3BNU A;  3D1C A;  4EQW A;  3DJJ A;  2YLR A;  4A6N B;  4EMJ A;  2GAG B;  2X99 A;  2APG A;  2A8X A;  2ZZ0 A;  3NKS A;  4CNK A;  5ER0 A;  2YR5 A;  3H8I A;  4J2W A;  5U25 A;  2EQ7 A;  2BS4 A;  3QSE A;  1L9D A;  2A89 A;  4H2P A;  5JCM A;  4RG4 A;  3AXB A;  1SEZ A;  1ZMD A;  3P4R A;  3CPJ G;  4TLZ A;  4YJH A;  1C0I A;  2A87 A;  4C74 A;  4QFD A;  2C66 A;  2H88 A;  4A9W A;  1ZMC A;  4YTP A;  1Q1W A;  2XLS A;  3DK8 A;  3IHM A;  1ZKQ A;  2V3A A;  4J33 A;  3ADA B;  4NEV A;  3T2Y A;  4XXG A;  1Q9I A;  4A65 A;  3KLJ A;  2Z5Y A;  3O0H A;  1F6M A;  3V3N A;  1JRZ A;  4OPG A;  1LVL A;  1CJ2 A;  4U8P A;  3FBS A;  1F3P A;  3DA1 A;  2R4E A;  2AAQ A;  4H2Q A;  1VG0 A;  3BI4 A;  4H4Q A;  2R9Z A;  4B65 A;  4BK2 A;  1TDN A;  4A79 A;  4AT0 A;  5KMR A;  4O5U A;  3CGE A;  2V3B A;  1GPE A;  1CJ4 A;  2QCU A;  2R45 A;  4H7U A;  3PVC A;  3HYX A;  2GEW A;  4CBQ A;  2E48 A;  1V59 A;  2YG3 A;  4GRT A;  4LU6 A;  4U8L A;  4YSX A;  4P9S A;  1E7P A;  1S3B A;  4UDP A;  3SFE A;  3WE0 A;  1C0K A;  1PBD A;  3CPI G;  4REK A;  4YKG A;  1CC2 A;  3AD9 B;  1FCD A;  4B68 A;  3KD9 A;  1P2H A;  5LV9 A;  3UKH A;  3CNS A;  1DOB A;  3QSM A;  1OJT A;  1CHU A;  3HYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...