2UZZA

X-ray structure of n-methyl-l-tryptophan oxidase (mtox)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
KYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKYVPLVLRAQMLWDELSRHNEDDPIFVRSGVINLGPADSTFLANVAHSAEQWQLNVEKLDAQGIMARWPEIRVPDNYIGLFETDSGFLRSELAIKTWIQLAKEAGCAQLFNCPVTAIRHDDDGVTIETADGEYQAKKAIVCAGTWVKDLLPELPVQPVRKVFAWYQADGRYSVKNKFPAFTGELPNGDQYYGFPAENDALKIGKHNGGQVIHSADERVPFAEVVSDGSEAFPFLRNVLPGIGCCLYGAACTYDNSPDEDFIIDTLPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSDFDLTPFRLSRFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-METHYL-L-TRYPTOPHAN OXIDASE
publication title The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 97
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.5.3.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 2uzzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2uzzA01
1F6MA 1IUVA 1D7LA 1LPFA 2ZZBA 4J56A 2CVJA 3AE8A 5KOWA 4AP1A 3DA1A 1M6IA 4J33A 2YG5A 1NHSA 3IHMA 4EQRA 3D8XA 3P1WA 1NEKA 1TRBA 1YY5A 4DGKA 4OPLA 4YJGB 3ZYXA 3UKQA 3CIRA 3VQRA 1JEHA 4Z26A 2GAGB 3FBSA 4EIPA 1XHCA 2WPCA 5IQ1A 5ER0A 4YTNA 4GF7A 2CULA 1C0PA 2B9XA 2ZBWA 2VRMA 2WP6A 1DDOA 3QJ4A 2AR8A 4H7UA 2XVEA 3AE5A 4CNKA 1CHUA 1CC6A 2RGHA 1GESA 4H50A 1NG4A 1F3PA 3PO7A 1BGJA 2JBVA 4TM4A 4EMJA 1GXFA 3BHFA 3CGEA 3ICSA 4BK1A 1M64A 5U63A 3LB8A 3UOXA 2C3CA 3DK9A 4OPCA 5DBJA 2FBWA 3EANA 3REDA 3KVEA 1H7WA 3E1TA 2BS4A 3AECA 3DK4A 1KSUA 4U8OA 2C75A 3QFAA 4JN9A 2BC0A 2JB1A 2YR6A 3M12A 2XYOA 3G5QA 5BULA 1YQZA 3AE4A 1VRQB 2X99A 3AEDA 1ELIA 4YJGA 3NTDA 1CJ4A 3F8RA 1LQTA 4CY8A 1F8SA 2B7SA 3K7MX 2RGOA 5HYMA 1MOKA 4C3XA 2XVIA 4LIIA 3BNUA 3KD9A 1PS9A 4DSHA 3AXBA 2GAHB 3PS9A 1JRXA 1Q1WA 3LJPA 2WOIA 4K5SA 4LU6A 2E82A 3ZNPA 4APNA 4Y4MA 2YM2A 3ZNOA 1DNCA 1QJDA 1GOSA 1X31B 2A89A 5BUKA 3VR8A 2WESA 1SEZA 1NENA 1D4CA 1GV4A 1IUSA 3UTHA 3FIMB 3EAOA 3UKPA 4TLZA 4NTCA 1E1MA 1AOGA 3GWFA 1PBFA 3ADAB 4YJDA 3NYFA 3ITJA 1GREA 1TDOA 2C3DA 4X9MA 2XFQA 2HQMA 4ZCDA 3C4NA 2FJDA 3S5WA 1AN9A 3IWAA 2C76A 3LADA 3QSMA 1D7YA 1KSSA 4HA6A 1EVIA 4A99A 1ZX9A 3SFEA 3AYLA 4OVIA 1H82A 2W0HA 3NN6X 4Y4NA 1PBDA 3UOZA 2J3NA 4Z43A 1KFYA 2EQ9A 4GRTA 1EBDA 4CBQA 2Y6RA 3D1CA 2Y6QA 4I58A 2OALA 4ECHA 4JY2A 4REKA 3AB1A 2UZZA 2GV8A 3AD9B 3ATRA 2FJAA 2C66A 2WDQA 1TDEA 2QA1A 5JCLA 2Q6UA 3ALJA 1OJDA 3CN8A 3KA7A 3L1RA 4GCMA 1TYTA 3GDPA 3RHAA 2AQJA 3AYJA 4D03A 2AAQA 1TYPA 2R45A 3WGTA 2GR3A 1PJ7A 3B6DA 1RYIA 3UKKA 1L9DA 2E48A 5JCNA 4CY6A 2WOVA 2YLTA 3M0OA 3DMEA 2WP5A 3CPJG 3IC9A 4TM0A 1O95A 3I3LA 4K2XA 2E5VA 2C67A 4AP3A 4Z25A 2C72A 4U8KA 4GDPA 1GRFA 5FS7A 2YG4A 4YJHB 1N4WA 2BK3A 2APGA 4TM3A 4PABA 3ALMA 3NIXA 3RP6A 3CGBA 4TLXA 2X8CA 1BZLA 2VVMA 2YVFA 3LZWA 4M52A 1K0IA 2IVEA 1CJ2A 3GYIA 2XVJA 2XLSA 3AYIA 3NT6A 3UKHA 1Z6LA 4H4PA 4B63A 4YSZA 4WCTA 2OLNA 4H4QA 3W4IA 3FG2P 3Q9TA 1COYA 5FS9A 3P4QA 2WQYA 3H8LA 4H2RA 1MO9A 1DOCA 1XANA 1ZDLA 2BCGG 3QFBA 4U2LA 2Z5YA 2XFOA 2WU2A 3DJGX 2VVLA 3LXDA 4RG3A 1NPXA 1VE9A 2B9YA 1LTXR 3CGCA 3H4KA 3FPZA 3K30A 3NK2X 4JQ9A 3V76A 2YLWA 3VR9A 2DKIA 1TDNA 1DJNA 4BK3A 3NK0X 2E1MA 2IVDA 3WE0A 3KKJA 3NNEA 1N1PA 4AOSA 4B69A 2JB3A 1JRZA 3BI2A 4Z44A 4J34A 1DXLA 2GRTA 3UTEA 2GB0A 1XDIA 2GQWA 3Q6JA 4YJHA 1PXAA 2DU8A 3CPIG 3GD4A 2R4JA 1XPQA 1RP0A 3AD8B 2BS3A 1GRTA 2B9WA 3SGLA 4RSLA 2ZZCA 4H4SA 2YAUA 1DOEA 2GR1A 5LV9A 1Y0PA 5BVAA 1YQ4A 4U8IA 5CKUA 1CBOA 1PXCA 4Y4LA 1NAAA 2XCGA 1GNDA 1GTEA 2YM1A 4Z2TA 5KRQA 1IUTA 5FS8A 1ZP0A 4J31A 2V5ZA 3G3EA 4KX6A 5FMHA 2YLZA 1BWCA 4H4VA 2JB2A 3DGHA 3ISHA 1GERA 3BI5A 3QSSA 2YLXA 5IPYA 2JKCA 5JCMA 1KNRA 3GSIA 4B68A 2VZ2A 2E4GA 2A8XA 2RGJA 1VG9A 3UOYA 3ZNNA 4YSHA 1P2EA 2BCPA 1H6VA 3KPFA 3V3NA 1NHQA 1P2HA 1H86A 2BA9A 3I6DA 1BGNA 3AE7A 2YG7A 3AWIA 3P4SA 1CC4A 4YJFB 3CNPA 4B64A 4PAAA 3W4JA 4EMWA 4OPDA 1BKWA 2Z5XA 3OC4A 2RABA 1JOAA 4H4RA 3UKLA 4YT0A 3AEGA 3NRNA 3RP7A 2XVFA 2V61A 5EOWA 1GRHA 2C64A 4TM1A 3S61A 3IF9A 4EM3A 2R46A 1H81A 1GRGA 1Q9IA 4YKFA 3LOVA 1KF6A 1ZMCA 1JRYA 1KDGA 1NG3A 1LJ1A 4FX9A 1L9EA 4H2QA 3UTGA 3CUKA 3G5SA 1S2QA 2WP9A 3R9UA 4Z2RA 3LZXA 2BACA 2ACZA 4ADWA 5JCKA 1FEAA 4LA1A 2CDUA 1GETA 3UP4A 3ZNQA 4IVOB 2VVLG 4KPRA 1YQ3A 4EIQA 4EQXA 2YQUA 1VQWA 3M13A 3B3RA 4NEVA 4YTPA 4A9WA 2XLRA 5IQ4A 4CCQA 5KXJA 2V3AA 2GR0A 1OJAA 2I0ZA 3T37A 4YJFA 3P4PA 1Y56B 1E1LA 5HY5A 1B37A 4BK2A 2NPXA 4MJWA 3EPTA 1PDHA 4UP3A 1ZKQA 2F5ZA 3GYJA 1KNPA 1FEBA 2YR4A 1GRAA 3DK8A 4BURA 3UKAA 4C3YA 4DSGA 2E4AA 2GH5A 2WBAA 3ABVA 4UDRA 2V60A 3VRAA 4CNJA 3BI4A 3AD7B 3CNDA 4E0VA 5KVHA 4Z24A 2XFUA 4RG4A 4I59A 1K0JA 1B5QA 4O5QA 2PHHA 1VG0A 4EQWA 4YWOA 3HZLA 1VDCA 4AT2A 4EQSA 1NHRA 1LV0A 1DODA 3AE6A 3II4A 1KIFA 2X8HA 1JU2A 1QO8A 4Z2UA 3QSEA 2A87A 4A6NB 2YLRA 4AOXA 1F8RA 3AEEA 1GTHA 1HYUA 5M10A 4P9SA 5GSNA 2V3BA 1O5WA 4A5LA 4QFDA 2GMJA 1TDFA 5JCIA 2XVHA 2QAEA 2VRLA 3L8KA 4H2NA 2R4EA 1Y56A 3NHOX 1RSGA 1C0IA 2XFPA 1E6EA 1S3BA 4XWRA 5C2TA 1GRBA 2GMHA 3CNSA 2GR2A 4YSXA 2BXRA 2TMDA 4H4ZA 5U25A 2X50A 4A65A 4C74A 2H89A 4FK1A 5U1OA 2BABA 3RNMA 5HXIA 2VQBA 4WX1A 4QFCA 2R0CA 4GUVA 4IA6A 3KLJA 3ZDNA 1BF3A 1NDAA 3AE1A 1OJCA 4OPGA 1OJTA 1DOBA 4OCGA 3QVPA 2C7GA 1O94A 2YG6A 2Q7VA 3GMCA 1N4VA 3H8IA 1F8WA 1E1NA 1CF3A 4J36A 4X4JA 5CQFA 4U8PA 2TPRA 4EMIA 3C4AA 5EB5A 4A6NA 1C0LA 1JNRA 3CGDA 5TR3A 4FDCB 2BK4A 1IUUA 3GRSA 4JNQA 3NG7X 1LVLA 3P9UA 2R9ZA 4NZHA 2VOUA 1QLBA 3W4KA 4IV9A 1D4EA 1UKVG 2O9ZA 4H4UA 4K7ZA 1GPEA 2OAMA 4U2SA 4H4TA 2WETA 3UKFA 1ZMDA 3CPHG 3JSKA 2CFYA 1FOHA 2GVCA 3AEFA 4BJZA 3QVRA 2FJEA 2GF3A 3CNTA 3ALLA 5EB4A 3DJEA 5EBKA 2WU5A 1L9CA 2X3NA 4OPUA 4B67A 3CTYA 3ICTA 4IVMB 2YVJA 2C73A 3URHA 4BV6A 4K22A 2YVGA 1V59A 5L46A 4U8JA 2EQ7A 3OZ2A 4A79A 2EQ6A 2QCUA 2IIDA 4C5OA 1ZOYA 1GT8A 1GALA 1EL7A 2WDVA 2FJBA 3UOVA 3COXA 1FECA 2XLTA 3P4RA 4YSYA 3GRTA 2XLPA 1B4VA 3SQPA 4DNAA 4U8MA 2WOWA 2WPFA 3SFDA 1PBBA 3NN0X 2R0GA 4C77A 3VRDB 1B8SA 3G5RA 1EL9A 2YWLA 3DH9A 5M0ZA 1FCDA 3EF6A 3FMWA 4NTEA 3O0HA 1EL8A 2YR5A 2VQ7A 1K0LA 1PBEA 3NYCA 3BHKA 3AE2A 3GWDA 1DJQA 5GRTA 4YXDA 4UDPA 1ZK7A 4J2WA 1DAOA 3VRBA 5FS6A 4D04A 3K7TA 4EM4A 3F8PA 2E49A 4X9NA 4JDRA 4JNAA 1H7XA 4UDQA 4OPTA 2Q0KA 2WHDA 1PBCA 2YLSA 3NKSA 4JY3A 5KWFA 4ICYA 2WEUA 1CJCA 1GSNA 3K7QX 2EQ8A 4FK1C 3DJJA 3RP8A 1H84A 1CL0A 2GQFA 2C65A 4YKGA 1C0KA 1E7PA 4NTDA 1D4DA 1L0VA 3NGCX 2XLUA 1E1KA 4N9XA 3GMBA 2XDOA 1D5TA 2YG3A 5J7XA 4GDEA 4H4WA 4U8NA 4CCRA 3AE9A 1NHPA 1S2YA 3BNMA 1PHHA 2XFNA 5C3JA 1S3EA 4B1BA 4HB9A 1ZOVA 1W4XA 1OJ9A 4GR1A 4IA5A 4U2TA 3ATQA 4XXGA 1N4UA 2WS3A 3NTAA 1EL5A 2C70A 4H4YA 4ZN0A 5BRTA 3NK1X 1PJ5A 1ONFA 2DKHA 5KVIA 2H88A 2JK6A 3NLCA 4K5RA 4USRA 4YTMA 2B7RA 2BK5A 2PYXA 1CJ3A 2WPEA 4USQA 2JAEA 3V3OA 3F8DA 1LQUA 1H83A 4A7AA 1YKJA 1IUWA 1K4QA 2Q0LA 2X8GA 3NH3X 3KU9A 2BYBA 3GD3A 3ICRA 2R0PA 2BXSA 2ARDA 3AEAA 3GDNA 2ZZ0A 4CRTA 4B66A 4AT0A 4H4XA 3DGZA 4OPIA 4ZCCA 3NYEA 1ZY8A 2QA2A 1IUXA 4BJYA 2BS2A 1PN0A 2BC1A 2OLOA 2NVKX 4NEWA 3IHGA 2V6OA 5KOXA 3SM8A 4B65A 3AEBA 4J57A 5J60A 2B76A 3UCLA 1FL2A 3UP5A 1Q1RA 2OA1A 2WDRA 4U8LA 4H2PA 4O5UA 1PJ6A 1JNZA 1REOA 3DJDA 1E39A 4K8DA 5HHFA 1IJHA 1GEUA 4XWZA 1MXTA 3AE3A 3UTFA 1PXBA 3PVCA 1TDKA 2GEWA 3C96A 3CNJA 1CC2A
chains in the Genus database with same CATH superfamily
1F6MA 1IUVA 1D7LA 1LPFA 2ZZBA 4J56A 2CVJA 3AE8A 5KOWA 4AP1A 3DA1A 1M6IA 4J33A 2YG5A 3IHMA 1NHSA 3SX6A 3D8XA 4EQRA 3P1WA 1NEKA 1TRBA 1YY5A 4DGKA 4OPLA 4YJGB 3ZYXA 3UKQA 3CIRA 3VQRA 3CMMA 1JEHA 4Z26A 2GAGB 4EIPA 3FBSA 1XHCA 2WPCA 5IQ1A 5ER0A 4YTNA 4GF7A 3SZ0A 2CULA 1C0PA 2B9XA 2ZBWA 2VRMA 2WP6A 1DDOA 3QJ4A 4G6HA 2AR8A 4H7UA 2XVEA 3AE5A 4CNKA 1CHUA 1CC6A 2RGHA 1GESA 4H50A 1NG4A 1F3PA 3PO7A 1BGJA 2JBVA 4TM4A 4EMJA 1GXFA 3BHFA 3CGEA 3ICSA 4BK1A 1M64A 5U63A 3LB8A 3UOXA 2C3CA 3DK9A 4OPCA 5DBJA 2FBWA 3EANA 3REDA 3KVEA 1H7WA 3E1TA 3T2YA 2BS4A 3AECA 3DK4A 1KSUA 4U8OA 2C75A 3QFAA 4JN9A 2BC0A 2JB1A 2YR6A 3M12A 2XYOA 3G5QA 5BULA 1YQZA 3AE4A 1VRQB 2X99A 3AEDA 4NNJA 1ELIA 4YJGA 3NTDA 1CJ4A 3F8RA 1LQTA 4CY8A 1F8SA 2B7SA 3K7MX 2RGOA 5HYMA 1MOKA 4C3XA 2XVIA 4LIIA 3BNUA 3KD9A 1PS9A 3T2KA 3AXBA 2GAHB 4DSHA 3PS9A 1JRXA 1Q1WA 3LJPA 2WOIA 4K5SA 4LU6A 2E82A 3ZNPA 4APNA 4Y4MA 2YM2A 3ZNOA 1DNCA 1QJDA 1GOSA 1X31B 2A89A 5BUKA 3VR8A 2WESA 1SEZA 2C4CA 1NENA 5KNLA 1D4CA 1GV4A 1IUSA 3UTHA 3FIMB 3EAOA 3UKPA 4TLZA 4NTCA 1E1MA 1AOGA 3GWFA 1PBFA 3ADAB 4G6GA 4YJDA 3NYFA 3ITJA 1GREA 1TDOA 2C3DA 4X9MA 2XFQA 2HQMA 4ZCDA 3C4NA 2FJDA 3S5WA 1AN9A 3IWAA 2C76A 3LADA 3QSMA 1D7YA 1KSSA 4HA6A 1EVIA 4A99A 1ZX9A 4GAVA 3SFEA 3AYLA 4OVIA 1H82A 2W0HA 3NN6X 4Y4NA 1PBDA 3UOZA 2J3NA 4Z43A 1KFYA 2EQ9A 4GRTA 1EBDA 4CBQA 2Y6RA 3D1CA 2Y6QA 4I58A 2OALA 4ECHA 4JY2A 4REKA 3AB1A 5KMQA 2UZZA 2GV8A 3AD9B 3ATRA 2FJAA 2C66A 2WDQA 1TDEA 2QA1A 3HYXA 5JCLA 2Q6UA 3ALJA 1OJDA 3CN8A 3KA7A 3L1RA 4GCMA 1TYTA 3GDPA 3RHAA 2AQJA 3AYJA 4D03A 2AAQA 1TYPA 2R45A 3WGTA 2GR3A 1PJ7A 3B6DA 4II2A 1RYIA 3UKKA 1L9DA 2E48A 5JCNA 4CY6A 2WOVA 2YLTA 3M0OA 3DMEA 2WP5A 3CPJG 3IC9A 4TM0A 1O95A 3I3LA 4K2XA 2E5VA 2C67A 4AP3A 4Z25A 2C72A 4U8KA 4GDPA 1GRFA 5FS7A 2YG4A 4YJHB 3RP6A 1N4WA 2APGA 2BK3A 4PABA 3ALMA 3NIXA 4TM3A 3CGBA 4TLXA 2X8CA 1BZLA 2VVMA 2YVFA 3LZWA 4M52A 1K0IA 2IVEA 1CJ2A 3GYIA 2XVJA 2XLSA 3AYIA 3NT6A 3UKHA 1Z6LA 4H4PA 4B63A 4YSZA 4WCTA 2OLNA 4H4QA 3W4IA 3FG2P 3Q9TA 1COYA 5FS9A 4H2RA 2WQYA 3H8LA 3P4QA 1MO9A 1DOCA 1XANA 1ZDLA 2BCGG 3QFBA 4U2LA 3T31A 2Z5YA 2XFOA 3SY4A 2WU2A 3DJGX 2VVLA 3LXDA 4RG3A 1NPXA 1VE9A 2B9YA 1LTXR 3CGCA 3H4KA 3FPZA 3K30A 3NK2X 4JQ9A 3SXIA 3V76A 2YLWA 3VR9A 2DKIA 1TDNA 1DJNA 3NK0X 2E1MA 2IVDA 3WE0A 3KKJA 3NNEA 1N1PA 4AOSA 4B69A 2JB3A 1JRZA 3BI2A 4Z44A 4J34A 1DXLA 2GRTA 3UTEA 2GB0A 1XDIA 2GQWA 3Q6JA 4YJHA 1PXAA 2DU8A 3CPIG 3GD4A 2R4JA 1XPQA 1RP0A 3AD8B 3SZWA 2BS3A 1GRTA 2B9WA 3SGLA 4RSLA 2ZZCA 4H4SA 2YAUA 1DOEA 2GR1A 5LV9A 1Y0PA 5BVAA 1YQ4A 4U8IA 5CKUA 1CBOA 1PXCA 4Y4LA 1NAAA 2XCGA 1GNDA 1GTEA 2YM1A 4Z2TA 5KRQA 1IUTA 5FS8A 1ZP0A 4J31A 2V5ZA 3G3EA 4KX6A 5FMHA 2YLZA 1BWCA 4H4VA 2JB2A 3DGHA 3ISHA 1GERA 3BI5A 3QSSA 2YLXA 5IPYA 2JKCA 5JCMA 1KNRA 3GSIA 4B68A 4BK3A 2E4GA 2A8XA 2RGJA 1VG9A 2VZ2A 3ZNNA 4YSHA 1P2EA 2BCPA 1H6VA 3KPFA 3UOYA 3V3NA 1NHQA 1P2HA 1H86A 2BA9A 3I6DA 1BGNA 3AE7A 2YG7A 3AWIA 3P4SA 1CC4A 4YJFB 3CNPA 4NWZA 4B64A 4PAAA 3W4JA 4EMWA 4OPDA 1BKWA 2Z5XA 3OC4A 2RABA 1JOAA 4H4RA 3UKLA 4YT0A 3RP7A 3AEGA 3NRNA 2XVFA 2V61A 5EOWA 1GRHA 2C64A 4TM1A 3S61A 3IF9A 4EM3A 2R46A 1H81A 1GRGA 1Q9IA 4YKFA 3LOVA 1KF6A 1ZMCA 1JRYA 1KDGA 1NG3A 1LJ1A 3HYWA 4FX9A 1L9EA 3T0KA 4H2QA 3UTGA 3CUKA 3G5SA 1S2QA 2WP9A 3R9UA 4Z2RA 3LZXA 2BACA 2ACZA 4ADWA 5JCKA 1FEAA 4LA1A 2CDUA 1GETA 3UP4A 3ZNQA 4IVOB 2VVLG 4KPRA 1YQ3A 4EIQA 4EQXA 2YQUA 1VQWA 3M13A 3B3RA 4NEVA 4YTPA 4A9WA 2XLRA 2BRYA 5IQ4A 4CCQA 5KXJA 2V3AA 2GR0A 1OJAA 5KMRA 2I0ZA 3T37A 4YJFA 3P4PA 1Y56B 1E1LA 5HY5A 5KMPA 1B37A 4BK2A 2NPXA 4MJWA 3EPTA 1PDHA 4UP3A 1ZKQA 2F5ZA 3GYJA 1KNPA 3KPKA 1FEBA 2YR4A 1GRAA 3DK8A 4BURA 3UKAA 4C3YA 4DSGA 2E4AA 2GH5A 2WBAA 3ABVA 4UDRA 2V60A 3VRAA 4CNJA 3BI4A 3AD7B 3CNDA 4E0VA 5KVHA 4Z24A 2XFUA 4RG4A 4I59A 1K0JA 1B5QA 4O5QA 2PHHA 1VG0A 3HYVA 4EQWA 4YWOA 3HZLA 1VDCA 4AT2A 4EQSA 1NHRA 1LV0A 1DODA 3AE6A 3II4A 1KIFA 2X8HA 1JU2A 1QO8A 4Z2UA 3QSEA 2A87A 4A6NB 2YLRA 4AOXA 1F8RA 3AEEA 1GTHA 1HYUA 5M10A 4P9SA 5GSNA 2V3BA 1O5WA 4A5LA 2GMJA 4QFDA 1TDFA 5JCIA 2XVHA 2QAEA 2VRLA 3L8KA 4H2NA 2R4EA 1Y56A 3NHOX 1RSGA 1C0IA 3SZFA 2XFPA 1E6EA 1S3BA 4G74A 4XWRA 5C2TA 1GRBA 2GMHA 3CNSA 2GR2A 4YSXA 2BXRA 2TMDA 4H4ZA 5U25A 2X50A 4A65A 4C74A 2H89A 4FK1A 5U1OA 5HXIA 2BABA 3RNMA 2VQBA 4WX1A 4QFCA 2R0CA 4IA6A 4GUVA 3KLJA 3ZDNA 1BF3A 1NDAA 3AE1A 1OJCA 4OPGA 1OJTA 1DOBA 4OCGA 3QVPA 2C7GA 1O94A 2YG6A 3GMCA 2Q7VA 1N4VA 3H8IA 1F8WA 1E1NA 1CF3A 4J36A 4X4JA 5CQFA 4U8PA 2TPRA 4EMIA 3C4AA 5EB5A 4A6NA 1C0LA 1JNRA 3CGDA 5TR3A 4FDCB 2BK4A 1IUUA 3GRSA 4JNQA 3NG7X 1LVLA 3P9UA 2R9ZA 4NZHA 2VOUA 1QLBA 3W4KA 4IV9A 1D4EA 1UKVG 2O9ZA 4H4UA 4K7ZA 1GPEA 2OAMA 4U2SA 4H4TA 2WETA 3UKFA 1ZMDA 3CPHG 3JSKA 2CFYA 1FOHA 4BJZA 2GVCA 3AEFA 3QVRA 2FJEA 2GF3A 3CNTA 3ALLA 5EB4A 3DJEA 5EBKA 2WU5A 1L9CA 2X3NA 4OPUA 4B67A 3CTYA 3ICTA 4IVMB 2YVJA 2C73A 3URHA 4BV6A 4K22A 2YVGA 1V59A 5L46A 4U8JA 2EQ7A 3OZ2A 4A79A 2EQ6A 2QCUA 2IIDA 4C5OA 1ZOYA 1GT8A 1GALA 1EL7A 2WDVA 2FJBA 3UOVA 3COXA 1FECA 2XLTA 3P4RA 4YSYA 3GRTA 2XLPA 1B4VA 3SQPA 4DNAA 4U8MA 2WOWA 2WPFA 3SFDA 1PBBA 3NN0X 2R0GA 4G73A 4C77A 3VRDB 1B8SA 3G5RA 1EL9A 2YWLA 3DH9A 5M0ZA 1FCDA 3EF6A 3SZCA 3FMWA 4NTEA 3O0HA 1EL8A 2YR5A 2VQ7A 1K0LA 1PBEA 3NYCA 3BHKA 3AE2A 3GWDA 1DJQA 5GRTA 4YXDA 4UDPA 1ZK7A 4J2WA 1DAOA 3VRBA 5FS6A 4D04A 3K7TA 4EM4A 3F8PA 2E49A 4X9NA 4JDRA 3SYIA 4JNAA 1H7XA 4UDQA 4OPTA 2Q0KA 4JY3A 1PBCA 2WHDA 2YLSA 3NKSA 5KWFA 4ICYA 2WEUA 1CJCA 1GSNA 3K7QX 2EQ8A 4FK1C 3DJJA 4G9KA 3RP8A 1H84A 1CL0A 2GQFA 2C65A 4YKGA 1C0KA 5KMSA 1E7PA 4NTDA 1D4DA 1L0VA 3NGCX 2XLUA 1E1KA 4N9XA 3GMBA 2XDOA 1D5TA 2YG3A 5J7XA 4GDEA 4H4WA 4U8NA 4CCRA 3AE9A 1NHPA 1S2YA 3BNMA 1PHHA 2XFNA 5C3JA 1S3EA 4B1BA 4HB9A 1ZOVA 1W4XA 4IA5A 1OJ9A 4GR1A 4U2TA 3T2ZA 3ATQA 4XXGA 1N4UA 2WS3A 3T14A 3NTAA 1EL5A 2C70A 4H4YA 4ZN0A 5BRTA 4II3A 3NK1X 1PJ5A 1ONFA 2DKHA 5KVIA 2H88A 2JK6A 3NLCA 4K5RA 4USRA 4YTMA 2B7RA 2BK5A 2PYXA 1CJ3A 2WPEA 4USQA 2JAEA 3V3OA 3F8DA 1LQUA 1H83A 4A7AA 1YKJA 1IUWA 1K4QA 2Q0LA 2X8GA 3NH3X 3KU9A 2BYBA 3GD3A 3ICRA 2R0PA 2BXSA 2ARDA 3AEAA 3GDNA 2ZZ0A 4CRTA 4B66A 4AT0A 4H4XA 3DGZA 4OPIA 4ZCCA 3NYEA 1ZY8A 4BJYA 1IUXA 2QA2A 2BS2A 4GAPA 1PN0A 2BC1A 2OLOA 2NVKX 4NEWA 3IHGA 2V6OA 5KOXA 3SM8A 4B65A 3AEBA 4J57A 5J60A 2B76A 3UCLA 1FL2A 3UP5A 1Q1RA 2OA1A 2WDRA 4U8LA 4H2PA 4O5UA 2BRAA 1PJ6A 1JNZA 1REOA 3GYXA 3DJDA 1E39A 4K8DA 5HHFA 1IJHA 1GEUA 4XWZA 1MXTA 3AE3A 3UTFA 1PXBA 3PVCA 1TDKA 2GEWA 3C96A 3CNJA 1CC2A
chains in the Genus database with same CATH topology
1F6MA 1IUVA 1D7LA 1LPFA 2ZZBA 4J56A 2CVJA 3AE8A 5KOWA 4AP1A 3DA1A 1M6IA 4J33A 2YG5A 1NHSA 3IHMA 3SX6A 3D8XA 4EQRA 3P1WA 1NEKA 1TRBA 1YY5A 4DGKA 4OPLA 4YJGB 3ZYXA 3UKQA 3CIRA 3VQRA 3CMMA 1JEHA 4Z26A 2GAGB 3FBSA 4EIPA 1XHCA 2WPCA 5IQ1A 5ER0A 4YTNA 4GF7A 3SZ0A 2CULA 1C0PA 2B9XA 2ZBWA 2VRMA 2WP6A 1DDOA 3QJ4A 4G6HA 2AR8A 4H7UA 2XVEA 3AE5A 4CNKA 1CHUA 1CC6A 2RGHA 1GESA 4H50A 1NG4A 1F3PA 3PO7A 1BGJA 2JBVA 4TM4A 4EMJA 1GXFA 3BHFA 3CGEA 3ICSA 4BK1A 1M64A 5U63A 3LB8A 3UOXA 2C3CA 3DK9A 4OPCA 5DBJA 2FBWA 3EANA 3REDA 3KVEA 1H7WA 3E1TA 3T2YA 2BS4A 3AECA 3DK4A 1KSUA 4U8OA 2C75A 3QFAA 4JN9A 2BC0A 2JB1A 2YR6A 3M12A 2XYOA 3G5QA 5BULA 1YQZA 3AE4A 1VRQB 2X99A 3AEDA 4NNJA 1ELIA 4YJGA 3NTDA 1CJ4A 3F8RA 1LQTA 4CY8A 1F8SA 2B7SA 3K7MX 2RGOA 5HYMA 1MOKA 4C3XA 2XVIA 4LIIA 3BNUA 3KD9A 1PS9A 3T2KA 3AXBA 2GAHB 4DSHA 3PS9A 1JRXA 1Q1WA 3LJPA 2WOIA 4K5SA 4LU6A 2E82A 3ZNPA 4APNA 4Y4MA 2YM2A 3ZNOA 1DNCA 1QJDA 1GOSA 1X31B 2A89A 5BUKA 3VR8A 2WESA 1SEZA 2C4CA 1NENA 5KNLA 1D4CA 1GV4A 1IUSA 3UTHA 3FIMB 3EAOA 3UKPA 4TLZA 4NTCA 1E1MA 1AOGA 3GWFA 1PBFA 3ADAB 4G6GA 4YJDA 3NYFA 3ITJA 1GREA 1TDOA 2C3DA 4X9MA 2XFQA 2HQMA 4ZCDA 3C4NA 2FJDA 3S5WA 1AN9A 3IWAA 2C76A 3LADA 3QSMA 1D7YA 1KSSA 4HA6A 1EVIA 4A99A 1ZX9A 4GAVA 3SFEA 3AYLA 4OVIA 1H82A 2W0HA 3NN6X 4Y4NA 1PBDA 3UOZA 2J3NA 4Z43A 1KFYA 2EQ9A 4GRTA 1EBDA 4CBQA 2Y6RA 3D1CA 2Y6QA 4I58A 2OALA 4ECHA 4JY2A 4REKA 3AB1A 5KMQA 2UZZA 2GV8A 3AD9B 3ATRA 2FJAA 2C66A 2WDQA 1TDEA 2QA1A 3HYXA 5JCLA 2Q6UA 3ALJA 1OJDA 3CN8A 3KA7A 3L1RA 4GCMA 1TYTA 3GDPA 3RHAA 2AQJA 3AYJA 4D03A 2AAQA 1TYPA 2R45A 3WGTA 2GR3A 1PJ7A 3B6DA 4II2A 1RYIA 3UKKA 1L9DA 2E48A 5JCNA 4CY6A 2WOVA 2YLTA 3M0OA 3DMEA 2WP5A 3CPJG 3IC9A 4TM0A 1O95A 3I3LA 4K2XA 2E5VA 2C67A 4AP3A 4Z25A 2C72A 4U8KA 4GDPA 1GRFA 5FS7A 2YG4A 4YJHB 1N4WA 2BK3A 2APGA 4TM3A 4PABA 3ALMA 3NIXA 3RP6A 3CGBA 4TLXA 2X8CA 1BZLA 2VVMA 2YVFA 3LZWA 4M52A 1K0IA 2IVEA 1CJ2A 3GYIA 2XVJA 2XLSA 3AYIA 3NT6A 3UKHA 1Z6LA 4H4PA 4B63A 4YSZA 4WCTA 2OLNA 4H4QA 3W4IA 3FG2P 3Q9TA 1COYA 5FS9A 3P4QA 2WQYA 3H8LA 4H2RA 1MO9A 1DOCA 1XANA 1ZDLA 2BCGG 3QFBA 4U2LA 3T31A 2Z5YA 2XFOA 3SY4A 2WU2A 3DJGX 2VVLA 3LXDA 4RG3A 1NPXA 1VE9A 2B9YA 1LTXR 3CGCA 3H4KA 3FPZA 3K30A 3NK2X 4JQ9A 3SXIA 3V76A 2YLWA 3VR9A 2DKIA 1TDNA 1DJNA 4BK3A 3NK0X 2E1MA 2IVDA 3WE0A 3KKJA 3NNEA 1N1PA 4AOSA 4B69A 2JB3A 1JRZA 3BI2A 4Z44A 4J34A 1DXLA 2GRTA 3UTEA 2GB0A 1XDIA 2GQWA 3Q6JA 4YJHA 1PXAA 2DU8A 3CPIG 3GD4A 2R4JA 1XPQA 1RP0A 3AD8B 3SZWA 2BS3A 1GRTA 2B9WA 3SGLA 4RSLA 2ZZCA 4H4SA 2YAUA 1DOEA 2GR1A 5LV9A 1Y0PA 5BVAA 1YQ4A 4U8IA 5CKUA 1CBOA 1PXCA 4Y4LA 1NAAA 2XCGA 1GNDA 1GTEA 2YM1A 4Z2TA 5KRQA 1IUTA 5FS8A 1ZP0A 4J31A 2V5ZA 3G3EA 4KX6A 5FMHA 2YLZA 1BWCA 4H4VA 2JB2A 3DGHA 3ISHA 1GERA 3BI5A 3QSSA 2YLXA 5IPYA 2JKCA 5JCMA 1KNRA 3GSIA 4B68A 2VZ2A 2E4GA 2A8XA 2RGJA 1VG9A 3SYIA 3ZNNA 4YSHA 1P2EA 2BCPA 1H6VA 3KPFA 3UOYA 3V3NA 1NHQA 1P2HA 1H86A 2BA9A 3I6DA 1BGNA 3AE7A 2YG7A 3AWIA 3P4SA 1CC4A 4YJFB 3CNPA 4NWZA 4B64A 4PAAA 3W4JA 4EMWA 4OPDA 1BKWA 2Z5XA 3OC4A 2RABA 1JOAA 4H4RA 3UKLA 4YT0A 3AEGA 3NRNA 3RP7A 2XVFA 2V61A 5EOWA 1GRHA 2C64A 4TM1A 3S61A 3IF9A 4EM3A 2R46A 1H81A 1GRGA 1Q9IA 4YKFA 3LOVA 1KF6A 1ZMCA 1JRYA 1KDGA 1NG3A 1LJ1A 3HYWA 4FX9A 1L9EA 3T0KA 4H2QA 3UTGA 3CUKA 3G5SA 1S2QA 2WP9A 3R9UA 4Z2RA 3LZXA 2BACA 2ACZA 4ADWA 5JCKA 1FEAA 4LA1A 2CDUA 1GETA 3UP4A 3ZNQA 4IVOB 2VVLG 4KPRA 1YQ3A 4EIQA 4EQXA 2YQUA 1VQWA 3M13A 3B3RA 4NEVA 4YTPA 4A9WA 2XLRA 2BRYA 5IQ4A 4CCQA 5KXJA 2V3AA 2GR0A 1OJAA 5KMRA 2I0ZA 3T37A 4YJFA 3P4PA 1Y56B 1E1LA 5HY5A 5KMPA 1B37A 4BK2A 2NPXA 4MJWA 3EPTA 1PDHA 4UP3A 1ZKQA 2F5ZA 3GYJA 1KNPA 3KPKA 1FEBA 2YR4A 1GRAA 3DK8A 4BURA 3UKAA 4C3YA 4DSGA 2E4AA 2GH5A 2WBAA 3ABVA 4UDRA 2V60A 3VRAA 4CNJA 3BI4A 3AD7B 3CNDA 4E0VA 5KVHA 4Z24A 2XFUA 4RG4A 4I59A 1K0JA 1B5QA 4O5QA 2PHHA 1VG0A 3HYVA 4EQWA 4YWOA 3HZLA 1VDCA 4AT2A 4EQSA 1NHRA 1LV0A 1DODA 3AE6A 3II4A 1KIFA 2X8HA 1JU2A 1QO8A 4Z2UA 3QSEA 2A87A 4A6NB 2YLRA 4AOXA 1F8RA 3AEEA 1GTHA 1HYUA 5M10A 4P9SA 5GSNA 2V3BA 1O5WA 4A5LA 4QFDA 2GMJA 1TDFA 5JCIA 2XVHA 2QAEA 2VRLA 3L8KA 4H2NA 2R4EA 1Y56A 3NHOX 1RSGA 1C0IA 3SZFA 2XFPA 1E6EA 1S3BA 4G74A 4XWRA 5C2TA 1GRBA 2GMHA 3CNSA 2GR2A 4YSXA 2BXRA 2TMDA 4H4ZA 5U25A 2X50A 4A65A 4C74A 2H89A 4FK1A 5U1OA 2BABA 3RNMA 5HXIA 2VQBA 4WX1A 4QFCA 2R0CA 4GUVA 4IA6A 3KLJA 3ZDNA 1BF3A 1NDAA 3AE1A 1OJCA 4OPGA 1OJTA 1DOBA 4OCGA 3QVPA 2C7GA 1O94A 2YG6A 2Q7VA 3GMCA 1N4VA 3H8IA 1F8WA 1E1NA 1CF3A 4J36A 4X4JA 5CQFA 4U8PA 2TPRA 4EMIA 3C4AA 5EB5A 4A6NA 1C0LA 1JNRA 3CGDA 5TR3A 4FDCB 2BK4A 1IUUA 3GRSA 4JNQA 3NG7X 1LVLA 3P9UA 2R9ZA 4NZHA 2VOUA 1QLBA 3W4KA 4IV9A 1D4EA 1UKVG 2O9ZA 4H4UA 4K7ZA 1GPEA 2OAMA 4U2SA 4H4TA 2WETA 3UKFA 1ZMDA 3CPHG 3JSKA 2CFYA 1FOHA 2GVCA 3AEFA 4BJZA 3QVRA 2FJEA 2GF3A 3CNTA 3ALLA 5EB4A 3DJEA 5EBKA 2WU5A 1L9CA 2X3NA 4OPUA 4B67A 3CTYA 3ICTA 4IVMB 2YVJA 2C73A 3URHA 4BV6A 4K22A 2YVGA 1V59A 5L46A 4U8JA 2EQ7A 3OZ2A 4A79A 2EQ6A 2QCUA 2IIDA 4C5OA 1ZOYA 1GT8A 1GALA 1EL7A 2WDVA 2FJBA 3UOVA 3COXA 1FECA 2XLTA 3P4RA 4YSYA 3GRTA 2XLPA 1B4VA 3SQPA 4DNAA 4U8MA 2WOWA 2WPFA 3SFDA 1PBBA 3NN0X 2R0GA 4G73A 4C77A 3VRDB 1B8SA 3G5RA 1EL9A 2YWLA 3DH9A 5M0ZA 1FCDA 3EF6A 3SZCA 3FMWA 4NTEA 3O0HA 1EL8A 2YR5A 2VQ7A 1K0LA 1PBEA 3NYCA 3BHKA 3AE2A 3GWDA 1DJQA 5GRTA 4YXDA 4UDPA 1ZK7A 4J2WA 1DAOA 3VRBA 5FS6A 4D04A 3K7TA 4EM4A 3F8PA 2E49A 4X9NA 4JDRA 4JNAA 1H7XA 4UDQA 4OPTA 2Q0KA 2WHDA 1PBCA 2YLSA 3NKSA 4JY3A 5KWFA 4ICYA 2WEUA 1CJCA 1GSNA 3K7QX 2EQ8A 4FK1C 3DJJA 4G9KA 3RP8A 1H84A 1CL0A 2GQFA 2C65A 4YKGA 1C0KA 5KMSA 1E7PA 4NTDA 1D4DA 1L0VA 3NGCX 2XLUA 1E1KA 4N9XA 3GMBA 2XDOA 1D5TA 2YG3A 5J7XA 4GDEA 4H4WA 4U8NA 4CCRA 3AE9A 1NHPA 1S2YA 3BNMA 1PHHA 2XFNA 5C3JA 1S3EA 4B1BA 4HB9A 1ZOVA 1W4XA 1OJ9A 4GR1A 4IA5A 4U2TA 3T2ZA 3ATQA 4XXGA 1N4UA 2WS3A 3T14A 3NTAA 1EL5A 2C70A 4H4YA 4ZN0A 5BRTA 4II3A 3NK1X 1PJ5A 1ONFA 2DKHA 5KVIA 2H88A 2JK6A 3NLCA 4K5RA 4USRA 4YTMA 2B7RA 2BK5A 2PYXA 1CJ3A 2WPEA 4USQA 2JAEA 3V3OA 3F8DA 1LQUA 1H83A 4A7AA 1YKJA 1IUWA 1K4QA 2Q0LA 2X8GA 3NH3X 3KU9A 2BYBA 3GD3A 3ICRA 2R0PA 2BXSA 2ARDA 3AEAA 3GDNA 2ZZ0A 4CRTA 4B66A 4AT0A 4H4XA 3DGZA 4OPIA 4ZCCA 3NYEA 1ZY8A 2QA2A 1IUXA 4BJYA 2BS2A 4GAPA 1PN0A 2BC1A 2OLOA 2NVKX 4NEWA 3IHGA 2V6OA 5KOXA 3SM8A 4B65A 3AEBA 4J57A 5J60A 2B76A 3UCLA 1FL2A 3UP5A 1Q1RA 2OA1A 2WDRA 4U8LA 4H2PA 4O5UA 2BRAA 1PJ6A 1JNZA 1REOA 3GYXA 3DJDA 1E39A 4K8DA 5HHFA 1IJHA 1GEUA 4XWZA 1MXTA 3AE3A 3UTFA 1PXBA 3PVCA 1TDKA 2GEWA 3C96A 3CNJA 1CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F6M A;  1IUV A;  1D7L A;  1LPF A;  2ZZB A;  4J56 A;  2CVJ A;  3AE8 A;  5KOW A;  4AP1 A;  3DA1 A;  1M6I A;  4J33 A;  2YG5 A;  1NHS A;  3IHM A;  4EQR A;  3D8X A;  3P1W A;  1NEK A;  1TRB A;  1YY5 A;  4DGK A;  4OPL A;  4YJG B;  3ZYX A;  3UKQ A;  3CIR A;  3VQR A;  1JEH A;  4Z26 A;  2GAG B;  3FBS A;  4EIP A;  1XHC A;  2WPC A;  5IQ1 A;  5ER0 A;  4YTN A;  4GF7 A;  2CUL A;  1C0P A;  2B9X A;  2ZBW A;  2VRM A;  2WP6 A;  1DDO A;  3QJ4 A;  2AR8 A;  4H7U A;  2XVE A;  3AE5 A;  4CNK A;  1CHU A;  1CC6 A;  2RGH A;  1GES A;  4H50 A;  1NG4 A;  1F3P A;  3PO7 A;  1BGJ A;  2JBV A;  4TM4 A;  4EMJ A;  1GXF A;  3BHF A;  3CGE A;  3ICS A;  4BK1 A;  1M64 A;  5U63 A;  3LB8 A;  3UOX A;  2C3C A;  3DK9 A;  4OPC A;  5DBJ A;  2FBW A;  3EAN A;  3RED A;  3KVE A;  1H7W A;  3E1T A;  2BS4 A;  3AEC A;  3DK4 A;  1KSU A;  4U8O A;  2C75 A;  3QFA A;  4JN9 A;  2BC0 A;  2JB1 A;  2YR6 A;  3M12 A;  2XYO A;  3G5Q A;  5BUL A;  1YQZ A;  3AE4 A;  1VRQ B;  2X99 A;  3AED A;  1ELI A;  4YJG A;  3NTD A;  1CJ4 A;  3F8R A;  1LQT A;  4CY8 A;  1F8S A;  2B7S A;  3K7M X;  2RGO A;  5HYM A;  1MOK A;  4C3X A;  2XVI A;  4LII A;  3BNU A;  3KD9 A;  1PS9 A;  4DSH A;  3AXB A;  2GAH B;  3PS9 A;  1JRX A;  1Q1W A;  3LJP A;  2WOI A;  4K5S A;  4LU6 A;  2E82 A;  3ZNP A;  4APN A;  4Y4M A;  2YM2 A;  3ZNO A;  1DNC A;  1QJD A;  1GOS A;  1X31 B;  2A89 A;  5BUK A;  3VR8 A;  2WES A;  1SEZ A;  1NEN A;  1D4C A;  1GV4 A;  1IUS A;  3UTH A;  3FIM B;  3EAO A;  3UKP A;  4TLZ A;  4NTC A;  1E1M A;  1AOG A;  3GWF A;  1PBF A;  3ADA B;  4YJD A;  3NYF A;  3ITJ A;  1GRE A;  1TDO A;  2C3D A;  4X9M A;  2XFQ A;  2HQM A;  4ZCD A;  3C4N A;  2FJD A;  3S5W A;  1AN9 A;  3IWA A;  2C76 A;  3LAD A;  3QSM A;  1D7Y A;  1KSS A;  4HA6 A;  1EVI A;  4A99 A;  1ZX9 A;  3SFE A;  3AYL A;  4OVI A;  1H82 A;  2W0H A;  3NN6 X;  4Y4N A;  1PBD A;  3UOZ A;  2J3N A;  4Z43 A;  1KFY A;  2EQ9 A;  4GRT A;  1EBD A;  4CBQ A;  2Y6R A;  3D1C A;  2Y6Q A;  4I58 A;  2OAL A;  4ECH A;  4JY2 A;  4REK A;  3AB1 A;  2UZZ A;  2GV8 A;  3AD9 B;  3ATR A;  2FJA A;  2C66 A;  2WDQ A;  1TDE A;  2QA1 A;  5JCL A;  2Q6U A;  3ALJ A;  1OJD A;  3CN8 A;  3KA7 A;  3L1R A;  4GCM A;  1TYT A;  3GDP A;  3RHA A;  2AQJ A;  3AYJ A;  4D03 A;  2AAQ A;  1TYP A;  2R45 A;  3WGT A;  2GR3 A;  1PJ7 A;  3B6D A;  1RYI A;  3UKK A;  1L9D A;  2E48 A;  5JCN A;  4CY6 A;  2WOV A;  2YLT A;  3M0O A;  3DME A;  2WP5 A;  3CPJ G;  3IC9 A;  4TM0 A;  1O95 A;  3I3L A;  4K2X A;  2E5V A;  2C67 A;  4AP3 A;  4Z25 A;  2C72 A;  4U8K A;  4GDP A;  1GRF A;  5FS7 A;  2YG4 A;  4YJH B;  1N4W A;  2BK3 A;  2APG A;  4TM3 A;  4PAB A;  3ALM A;  3NIX A;  3RP6 A;  3CGB A;  4TLX A;  2X8C A;  1BZL A;  2VVM A;  2YVF A;  3LZW A;  4M52 A;  1K0I A;  2IVE A;  1CJ2 A;  3GYI A;  2XVJ A;  2XLS A;  3AYI A;  3NT6 A;  3UKH A;  1Z6L A;  4H4P A;  4B63 A;  4YSZ A;  4WCT A;  2OLN A;  4H4Q A;  3W4I A;  3FG2 P;  3Q9T A;  1COY A;  5FS9 A;  3P4Q A;  2WQY A;  3H8L A;  4H2R A;  1MO9 A;  1DOC A;  1XAN A;  1ZDL A;  2BCG G;  3QFB A;  4U2L A;  2Z5Y A;  2XFO A;  2WU2 A;  3DJG X;  2VVL A;  3LXD A;  4RG3 A;  1NPX A;  1VE9 A;  2B9Y A;  1LTX R;  3CGC A;  3H4K A;  3FPZ A;  3K30 A;  3NK2 X;  4JQ9 A;  3V76 A;  2YLW A;  3VR9 A;  2DKI A;  1TDN A;  1DJN A;  4BK3 A;  3NK0 X;  2E1M A;  2IVD A;  3WE0 A;  3KKJ A;  3NNE A;  1N1P A;  4AOS A;  4B69 A;  2JB3 A;  1JRZ A;  3BI2 A;  4Z44 A;  4J34 A;  1DXL A;  2GRT A;  3UTE A;  2GB0 A;  1XDI A;  2GQW A;  3Q6J A;  4YJH A;  1PXA A;  2DU8 A;  3CPI G;  3GD4 A;  2R4J A;  1XPQ A;  1RP0 A;  3AD8 B;  2BS3 A;  1GRT A;  2B9W A;  3SGL A;  4RSL A;  2ZZC A;  4H4S A;  2YAU A;  1DOE A;  2GR1 A;  5LV9 A;  1Y0P A;  5BVA A;  1YQ4 A;  4U8I A;  5CKU A;  1CBO A;  1PXC A;  4Y4L A;  1NAA A;  2XCG A;  1GND A;  1GTE A;  2YM1 A;  4Z2T A;  5KRQ A;  1IUT A;  5FS8 A;  1ZP0 A;  4J31 A;  2V5Z A;  3G3E A;  4KX6 A;  5FMH A;  2YLZ A;  1BWC A;  4H4V A;  2JB2 A;  3DGH A;  3ISH A;  1GER A;  3BI5 A;  3QSS A;  2YLX A;  5IPY A;  2JKC A;  5JCM A;  1KNR A;  3GSI A;  4B68 A;  2VZ2 A;  2E4G A;  2A8X A;  2RGJ A;  1VG9 A;  3UOY A;  3ZNN A;  4YSH A;  1P2E A;  2BCP A;  1H6V A;  3KPF A;  3V3N A;  1NHQ A;  1P2H A;  1H86 A;  2BA9 A;  3I6D A;  1BGN A;  3AE7 A;  2YG7 A;  3AWI A;  3P4S A;  1CC4 A;  4YJF B;  3CNP A;  4B64 A;  4PAA A;  3W4J A;  4EMW A;  4OPD A;  1BKW A;  2Z5X A;  3OC4 A;  2RAB A;  1JOA A;  4H4R A;  3UKL A;  4YT0 A;  3AEG A;  3NRN A;  3RP7 A;  2XVF A;  2V61 A;  5EOW A;  1GRH A;  2C64 A;  4TM1 A;  3S61 A;  3IF9 A;  4EM3 A;  2R46 A;  1H81 A;  1GRG A;  1Q9I A;  4YKF A;  3LOV A;  1KF6 A;  1ZMC A;  1JRY A;  1KDG A;  1NG3 A;  1LJ1 A;  4FX9 A;  1L9E A;  4H2Q A;  3UTG A;  3CUK A;  3G5S A;  1S2Q A;  2WP9 A;  3R9U A;  4Z2R A;  3LZX A;  2BAC A;  2ACZ A;  4ADW A;  5JCK A;  1FEA A;  4LA1 A;  2CDU A;  1GET A;  3UP4 A;  3ZNQ A;  4IVO B;  2VVL G;  4KPR A;  1YQ3 A;  4EIQ A;  4EQX A;  2YQU A;  1VQW A;  3M13 A;  3B3R A;  4NEV A;  4YTP A;  4A9W A;  2XLR A;  5IQ4 A;  4CCQ A;  5KXJ A;  2V3A A;  2GR0 A;  1OJA A;  2I0Z A;  3T37 A;  4YJF A;  3P4P A;  1Y56 B;  1E1L A;  5HY5 A;  1B37 A;  4BK2 A;  2NPX A;  4MJW A;  3EPT A;  1PDH A;  4UP3 A;  1ZKQ A;  2F5Z A;  3GYJ A;  1KNP A;  1FEB A;  2YR4 A;  1GRA A;  3DK8 A;  4BUR A;  3UKA A;  4C3Y A;  4DSG A;  2E4A A;  2GH5 A;  2WBA A;  3ABV A;  4UDR A;  2V60 A;  3VRA A;  4CNJ A;  3BI4 A;  3AD7 B;  3CND A;  4E0V A;  5KVH A;  4Z24 A;  2XFU A;  4RG4 A;  4I59 A;  1K0J A;  1B5Q A;  4O5Q A;  2PHH A;  1VG0 A;  4EQW A;  4YWO A;  3HZL A;  1VDC A;  4AT2 A;  4EQS A;  1NHR A;  1LV0 A;  1DOD A;  3AE6 A;  3II4 A;  1KIF A;  2X8H A;  1JU2 A;  1QO8 A;  4Z2U A;  3QSE A;  2A87 A;  4A6N B;  2YLR A;  4AOX A;  1F8R A;  3AEE A;  1GTH A;  1HYU A;  5M10 A;  4P9S A;  5GSN A;  2V3B A;  1O5W A;  4A5L A;  4QFD A;  2GMJ A;  1TDF A;  5JCI A;  2XVH A;  2QAE A;  2VRL A;  3L8K A;  4H2N A;  2R4E A;  1Y56 A;  3NHO X;  1RSG A;  1C0I A;  2XFP A;  1E6E A;  1S3B A;  4XWR A;  5C2T A;  1GRB A;  2GMH A;  3CNS A;  2GR2 A;  4YSX A;  2BXR A;  2TMD A;  4H4Z A;  5U25 A;  2X50 A;  4A65 A;  4C74 A;  2H89 A;  4FK1 A;  5U1O A;  2BAB A;  3RNM A;  5HXI A;  2VQB A;  4WX1 A;  4QFC A;  2R0C A;  4GUV A;  4IA6 A;  3KLJ A;  3ZDN A;  1BF3 A;  1NDA A;  3AE1 A;  1OJC A;  4OPG A;  1OJT A;  1DOB A;  4OCG A;  3QVP A;  2C7G A;  1O94 A;  2YG6 A;  2Q7V A;  3GMC A;  1N4V A;  3H8I A;  1F8W A;  1E1N A;  1CF3 A;  4J36 A;  4X4J A;  5CQF A;  4U8P A;  2TPR A;  4EMI A;  3C4A A;  5EB5 A;  4A6N A;  1C0L A;  1JNR A;  3CGD A;  5TR3 A;  4FDC B;  2BK4 A;  1IUU A;  3GRS A;  4JNQ A;  3NG7 X;  1LVL A;  3P9U A;  2R9Z A;  4NZH A;  2VOU A;  1QLB A;  3W4K A;  4IV9 A;  1D4E A;  1UKV G;  2O9Z A;  4H4U A;  4K7Z A;  1GPE A;  2OAM A;  4U2S A;  4H4T A;  2WET A;  3UKF A;  1ZMD A;  3CPH G;  3JSK A;  2CFY A;  1FOH A;  2GVC A;  3AEF A;  4BJZ A;  3QVR A;  2FJE A;  2GF3 A;  3CNT A;  3ALL A;  5EB4 A;  3DJE A;  5EBK A;  2WU5 A;  1L9C A;  2X3N A;  4OPU A;  4B67 A;  3CTY A;  3ICT A;  4IVM B;  2YVJ A;  2C73 A;  3URH A;  4BV6 A;  4K22 A;  2YVG A;  1V59 A;  5L46 A;  4U8J A;  2EQ7 A;  3OZ2 A;  4A79 A;  2EQ6 A;  2QCU A;  2IID A;  4C5O A;  1ZOY A;  1GT8 A;  1GAL A;  1EL7 A;  2WDV A;  2FJB A;  3UOV A;  3COX A;  1FEC A;  2XLT A;  3P4R A;  4YSY A;  3GRT A;  2XLP A;  1B4V A;  3SQP A;  4DNA A;  4U8M A;  2WOW A;  2WPF A;  3SFD A;  1PBB A;  3NN0 X;  2R0G A;  4C77 A;  3VRD B;  1B8S A;  3G5R A;  1EL9 A;  2YWL A;  3DH9 A;  5M0Z A;  1FCD A;  3EF6 A;  3FMW A;  4NTE A;  3O0H A;  1EL8 A;  2YR5 A;  2VQ7 A;  1K0L A;  1PBE A;  3NYC A;  3BHK A;  3AE2 A;  3GWD A;  1DJQ A;  5GRT A;  4YXD A;  4UDP A;  1ZK7 A;  4J2W A;  1DAO A;  3VRB A;  5FS6 A;  4D04 A;  3K7T A;  4EM4 A;  3F8P A;  2E49 A;  4X9N A;  4JDR A;  4JNA A;  1H7X A;  4UDQ A;  4OPT A;  2Q0K A;  2WHD A;  1PBC A;  2YLS A;  3NKS A;  4JY3 A;  5KWF A;  4ICY A;  2WEU A;  1CJC A;  1GSN A;  3K7Q X;  2EQ8 A;  4FK1 C;  3DJJ A;  3RP8 A;  1H84 A;  1CL0 A;  2GQF A;  2C65 A;  4YKG A;  1C0K A;  1E7P A;  4NTD A;  1D4D A;  1L0V A;  3NGC X;  2XLU A;  1E1K A;  4N9X A;  3GMB A;  2XDO A;  1D5T A;  2YG3 A;  5J7X A;  4GDE A;  4H4W A;  4U8N A;  4CCR A;  3AE9 A;  1NHP A;  1S2Y A;  3BNM A;  1PHH A;  2XFN A;  5C3J A;  1S3E A;  4B1B A;  4HB9 A;  1ZOV A;  1W4X A;  1OJ9 A;  4GR1 A;  4IA5 A;  4U2T A;  3ATQ A;  4XXG A;  1N4U A;  2WS3 A;  3NTA A;  1EL5 A;  2C70 A;  4H4Y A;  4ZN0 A;  5BRT A;  3NK1 X;  1PJ5 A;  1ONF A;  2DKH A;  5KVI A;  2H88 A;  2JK6 A;  3NLC A;  4K5R A;  4USR A;  4YTM A;  2B7R A;  2BK5 A;  2PYX A;  1CJ3 A;  2WPE A;  4USQ A;  2JAE A;  3V3O A;  3F8D A;  1LQU A;  1H83 A;  4A7A A;  1YKJ A;  1IUW A;  1K4Q A;  2Q0L A;  2X8G A;  3NH3 X;  3KU9 A;  2BYB A;  3GD3 A;  3ICR A;  2R0P A;  2BXS A;  2ARD A;  3AEA A;  3GDN A;  2ZZ0 A;  4CRT A;  4B66 A;  4AT0 A;  4H4X A;  3DGZ A;  4OPI A;  4ZCC A;  3NYE A;  1ZY8 A;  2QA2 A;  1IUX A;  4BJY A;  2BS2 A;  1PN0 A;  2BC1 A;  2OLO A;  2NVK X;  4NEW A;  3IHG A;  2V6O A;  5KOX A;  3SM8 A;  4B65 A;  3AEB A;  4J57 A;  5J60 A;  2B76 A;  3UCL A;  1FL2 A;  3UP5 A;  1Q1R A;  2OA1 A;  2WDR A;  4U8L A;  4H2P A;  4O5U A;  1PJ6 A;  1JNZ A;  1REO A;  3DJD A;  1E39 A;  4K8D A;  5HHF A;  1IJH A;  1GEU A;  4XWZ A;  1MXT A;  3AE3 A;  3UTF A;  1PXB A;  3PVC A;  1TDK A;  2GEW A;  3C96 A;  3CNJ A;  1CC2 A; 
#chains in the Genus database with same CATH topology
 1F6M A;  1IUV A;  1D7L A;  1LPF A;  2ZZB A;  4J56 A;  2CVJ A;  3AE8 A;  5KOW A;  4AP1 A;  3DA1 A;  1M6I A;  4J33 A;  2YG5 A;  3IHM A;  1NHS A;  3SX6 A;  3D8X A;  4EQR A;  3P1W A;  1NEK A;  1TRB A;  1YY5 A;  4DGK A;  4OPL A;  4YJG B;  3ZYX A;  3UKQ A;  3CIR A;  3VQR A;  3CMM A;  1JEH A;  4Z26 A;  2GAG B;  4EIP A;  3FBS A;  1XHC A;  2WPC A;  5IQ1 A;  5ER0 A;  4YTN A;  4GF7 A;  3SZ0 A;  2CUL A;  1C0P A;  2B9X A;  2ZBW A;  2VRM A;  2WP6 A;  1DDO A;  3QJ4 A;  4G6H A;  2AR8 A;  4H7U A;  2XVE A;  3AE5 A;  4CNK A;  1CHU A;  1CC6 A;  2RGH A;  1GES A;  4H50 A;  1NG4 A;  1F3P A;  3PO7 A;  1BGJ A;  2JBV A;  4TM4 A;  4EMJ A;  1GXF A;  3BHF A;  3CGE A;  3ICS A;  4BK1 A;  1M64 A;  5U63 A;  3LB8 A;  3UOX A;  2C3C A;  3DK9 A;  4OPC A;  5DBJ A;  2FBW A;  3EAN A;  3RED A;  3KVE A;  1H7W A;  3E1T A;  3T2Y A;  2BS4 A;  3AEC A;  3DK4 A;  1KSU A;  4U8O A;  2C75 A;  3QFA A;  4JN9 A;  2BC0 A;  2JB1 A;  2YR6 A;  3M12 A;  2XYO A;  3G5Q A;  5BUL A;  1YQZ A;  3AE4 A;  1VRQ B;  2X99 A;  3AED A;  4NNJ A;  1ELI A;  4YJG A;  3NTD A;  1CJ4 A;  3F8R A;  1LQT A;  4CY8 A;  1F8S A;  2B7S A;  3K7M X;  2RGO A;  5HYM A;  1MOK A;  4C3X A;  2XVI A;  4LII A;  3BNU A;  3KD9 A;  1PS9 A;  3T2K A;  3AXB A;  2GAH B;  4DSH A;  3PS9 A;  1JRX A;  1Q1W A;  3LJP A;  2WOI A;  4K5S A;  4LU6 A;  2E82 A;  3ZNP A;  4APN A;  4Y4M A;  2YM2 A;  3ZNO A;  1DNC A;  1QJD A;  1GOS A;  1X31 B;  2A89 A;  5BUK A;  3VR8 A;  2WES A;  1SEZ A;  2C4C A;  1NEN A;  5KNL A;  1D4C A;  1GV4 A;  1IUS A;  3UTH A;  3FIM B;  3EAO A;  3UKP A;  4TLZ A;  4NTC A;  1E1M A;  1AOG A;  3GWF A;  1PBF A;  3ADA B;  4G6G A;  4YJD A;  3NYF A;  3ITJ A;  1GRE A;  1TDO A;  2C3D A;  4X9M A;  2XFQ A;  2HQM A;  4ZCD A;  3C4N A;  2FJD A;  3S5W A;  1AN9 A;  3IWA A;  2C76 A;  3LAD A;  3QSM A;  1D7Y A;  1KSS A;  4HA6 A;  1EVI A;  4A99 A;  1ZX9 A;  4GAV A;  3SFE A;  3AYL A;  4OVI A;  1H82 A;  2W0H A;  3NN6 X;  4Y4N A;  1PBD A;  3UOZ A;  2J3N A;  4Z43 A;  1KFY A;  2EQ9 A;  4GRT A;  1EBD A;  4CBQ A;  2Y6R A;  3D1C A;  2Y6Q A;  4I58 A;  2OAL A;  4ECH A;  4JY2 A;  4REK A;  3AB1 A;  5KMQ A;  2UZZ A;  2GV8 A;  3AD9 B;  3ATR A;  2FJA A;  2C66 A;  2WDQ A;  1TDE A;  2QA1 A;  3HYX A;  5JCL A;  2Q6U A;  3ALJ A;  1OJD A;  3CN8 A;  3KA7 A;  3L1R A;  4GCM A;  1TYT A;  3GDP A;  3RHA A;  2AQJ A;  3AYJ A;  4D03 A;  2AAQ A;  1TYP A;  2R45 A;  3WGT A;  2GR3 A;  1PJ7 A;  3B6D A;  4II2 A;  1RYI A;  3UKK A;  1L9D A;  2E48 A;  5JCN A;  4CY6 A;  2WOV A;  2YLT A;  3M0O A;  3DME A;  2WP5 A;  3CPJ G;  3IC9 A;  4TM0 A;  1O95 A;  3I3L A;  4K2X A;  2E5V A;  2C67 A;  4AP3 A;  4Z25 A;  2C72 A;  4U8K A;  4GDP A;  1GRF A;  5FS7 A;  2YG4 A;  4YJH B;  3RP6 A;  1N4W A;  2APG A;  2BK3 A;  4PAB A;  3ALM A;  3NIX A;  4TM3 A;  3CGB A;  4TLX A;  2X8C A;  1BZL A;  2VVM A;  2YVF A;  3LZW A;  4M52 A;  1K0I A;  2IVE A;  1CJ2 A;  3GYI A;  2XVJ A;  2XLS A;  3AYI A;  3NT6 A;  3UKH A;  1Z6L A;  4H4P A;  4B63 A;  4YSZ A;  4WCT A;  2OLN A;  4H4Q A;  3W4I A;  3FG2 P;  3Q9T A;  1COY A;  5FS9 A;  4H2R A;  2WQY A;  3H8L A;  3P4Q A;  1MO9 A;  1DOC A;  1XAN A;  1ZDL A;  2BCG G;  3QFB A;  4U2L A;  3T31 A;  2Z5Y A;  2XFO A;  3SY4 A;  2WU2 A;  3DJG X;  2VVL A;  3LXD A;  4RG3 A;  1NPX A;  1VE9 A;  2B9Y A;  1LTX R;  3CGC A;  3H4K A;  3FPZ A;  3K30 A;  3NK2 X;  4JQ9 A;  3SXI A;  3V76 A;  2YLW A;  3VR9 A;  2DKI A;  1TDN A;  1DJN A;  3NK0 X;  2E1M A;  2IVD A;  3WE0 A;  3KKJ A;  3NNE A;  1N1P A;  4AOS A;  4B69 A;  2JB3 A;  1JRZ A;  3BI2 A;  4Z44 A;  4J34 A;  1DXL A;  2GRT A;  3UTE A;  2GB0 A;  1XDI A;  2GQW A;  3Q6J A;  4YJH A;  1PXA A;  2DU8 A;  3CPI G;  3GD4 A;  2R4J A;  1XPQ A;  1RP0 A;  3AD8 B;  3SZW A;  2BS3 A;  1GRT A;  2B9W A;  3SGL A;  4RSL A;  2ZZC A;  4H4S A;  2YAU A;  1DOE A;  2GR1 A;  5LV9 A;  1Y0P A;  5BVA A;  1YQ4 A;  4U8I A;  5CKU A;  1CBO A;  1PXC A;  4Y4L A;  1NAA A;  2XCG A;  1GND A;  1GTE A;  2YM1 A;  4Z2T A;  5KRQ A;  1IUT A;  5FS8 A;  1ZP0 A;  4J31 A;  2V5Z A;  3G3E A;  4KX6 A;  5FMH A;  2YLZ A;  1BWC A;  4H4V A;  2JB2 A;  3DGH A;  3ISH A;  1GER A;  3BI5 A;  3QSS A;  2YLX A;  5IPY A;  2JKC A;  5JCM A;  1KNR A;  3GSI A;  4B68 A;  4BK3 A;  2E4G A;  2A8X A;  2RGJ A;  1VG9 A;  2VZ2 A;  3ZNN A;  4YSH A;  1P2E A;  2BCP A;  1H6V A;  3KPF A;  3UOY A;  3V3N A;  1NHQ A;  1P2H A;  1H86 A;  2BA9 A;  3I6D A;  1BGN A;  3AE7 A;  2YG7 A;  3AWI A;  3P4S A;  1CC4 A;  4YJF B;  3CNP A;  4NWZ A;  4B64 A;  4PAA A;  3W4J A;  4EMW A;  4OPD A;  1BKW A;  2Z5X A;  3OC4 A;  2RAB A;  1JOA A;  4H4R A;  3UKL A;  4YT0 A;  3RP7 A;  3AEG A;  3NRN A;  2XVF A;  2V61 A;  5EOW A;  1GRH A;  2C64 A;  4TM1 A;  3S61 A;  3IF9 A;  4EM3 A;  2R46 A;  1H81 A;  1GRG A;  1Q9I A;  4YKF A;  3LOV A;  1KF6 A;  1ZMC A;  1JRY A;  1KDG A;  1NG3 A;  1LJ1 A;  3HYW A;  4FX9 A;  1L9E A;  3T0K A;  4H2Q A;  3UTG A;  3CUK A;  3G5S A;  1S2Q A;  2WP9 A;  3R9U A;  4Z2R A;  3LZX A;  2BAC A;  2ACZ A;  4ADW A;  5JCK A;  1FEA A;  4LA1 A;  2CDU A;  1GET A;  3UP4 A;  3ZNQ A;  4IVO B;  2VVL G;  4KPR A;  1YQ3 A;  4EIQ A;  4EQX A;  2YQU A;  1VQW A;  3M13 A;  3B3R A;  4NEV A;  4YTP A;  4A9W A;  2XLR A;  2BRY A;  5IQ4 A;  4CCQ A;  5KXJ A;  2V3A A;  2GR0 A;  1OJA A;  5KMR A;  2I0Z A;  3T37 A;  4YJF A;  3P4P A;  1Y56 B;  1E1L A;  5HY5 A;  5KMP A;  1B37 A;  4BK2 A;  2NPX A;  4MJW A;  3EPT A;  1PDH A;  4UP3 A;  1ZKQ A;  2F5Z A;  3GYJ A;  1KNP A;  3KPK A;  1FEB A;  2YR4 A;  1GRA A;  3DK8 A;  4BUR A;  3UKA A;  4C3Y A;  4DSG A;  2E4A A;  2GH5 A;  2WBA A;  3ABV A;  4UDR A;  2V60 A;  3VRA A;  4CNJ A;  3BI4 A;  3AD7 B;  3CND A;  4E0V A;  5KVH A;  4Z24 A;  2XFU A;  4RG4 A;  4I59 A;  1K0J A;  1B5Q A;  4O5Q A;  2PHH A;  1VG0 A;  3HYV A;  4EQW A;  4YWO A;  3HZL A;  1VDC A;  4AT2 A;  4EQS A;  1NHR A;  1LV0 A;  1DOD A;  3AE6 A;  3II4 A;  1KIF A;  2X8H A;  1JU2 A;  1QO8 A;  4Z2U A;  3QSE A;  2A87 A;  4A6N B;  2YLR A;  4AOX A;  1F8R A;  3AEE A;  1GTH A;  1HYU A;  5M10 A;  4P9S A;  5GSN A;  2V3B A;  1O5W A;  4A5L A;  2GMJ A;  4QFD A;  1TDF A;  5JCI A;  2XVH A;  2QAE A;  2VRL A;  3L8K A;  4H2N A;  2R4E A;  1Y56 A;  3NHO X;  1RSG A;  1C0I A;  3SZF A;  2XFP A;  1E6E A;  1S3B A;  4G74 A;  4XWR A;  5C2T A;  1GRB A;  2GMH A;  3CNS A;  2GR2 A;  4YSX A;  2BXR A;  2TMD A;  4H4Z A;  5U25 A;  2X50 A;  4A65 A;  4C74 A;  2H89 A;  4FK1 A;  5U1O A;  5HXI A;  2BAB A;  3RNM A;  2VQB A;  4WX1 A;  4QFC A;  2R0C A;  4IA6 A;  4GUV A;  3KLJ A;  3ZDN A;  1BF3 A;  1NDA A;  3AE1 A;  1OJC A;  4OPG A;  1OJT A;  1DOB A;  4OCG A;  3QVP A;  2C7G A;  1O94 A;  2YG6 A;  3GMC A;  2Q7V A;  1N4V A;  3H8I A;  1F8W A;  1E1N A;  1CF3 A;  4J36 A;  4X4J A;  5CQF A;  4U8P A;  2TPR A;  4EMI A;  3C4A A;  5EB5 A;  4A6N A;  1C0L A;  1JNR A;  3CGD A;  5TR3 A;  4FDC B;  2BK4 A;  1IUU A;  3GRS A;  4JNQ A;  3NG7 X;  1LVL A;  3P9U A;  2R9Z A;  4NZH A;  2VOU A;  1QLB A;  3W4K A;  4IV9 A;  1D4E A;  1UKV G;  2O9Z A;  4H4U A;  4K7Z A;  1GPE A;  2OAM A;  4U2S A;  4H4T A;  2WET A;  3UKF A;  1ZMD A;  3CPH G;  3JSK A;  2CFY A;  1FOH A;  4BJZ A;  2GVC A;  3AEF A;  3QVR A;  2FJE A;  2GF3 A;  3CNT A;  3ALL A;  5EB4 A;  3DJE A;  5EBK A;  2WU5 A;  1L9C A;  2X3N A;  4OPU A;  4B67 A;  3CTY A;  3ICT A;  4IVM B;  2YVJ A;  2C73 A;  3URH A;  4BV6 A;  4K22 A;  2YVG A;  1V59 A;  5L46 A;  4U8J A;  2EQ7 A;  3OZ2 A;  4A79 A;  2EQ6 A;  2QCU A;  2IID A;  4C5O A;  1ZOY A;  1GT8 A;  1GAL A;  1EL7 A;  2WDV A;  2FJB A;  3UOV A;  3COX A;  1FEC A;  2XLT A;  3P4R A;  4YSY A;  3GRT A;  2XLP A;  1B4V A;  3SQP A;  4DNA A;  4U8M A;  2WOW A;  2WPF A;  3SFD A;  1PBB A;  3NN0 X;  2R0G A;  4G73 A;  4C77 A;  3VRD B;  1B8S A;  3G5R A;  1EL9 A;  2YWL A;  3DH9 A;  5M0Z A;  1FCD A;  3EF6 A;  3SZC A;  3FMW A;  4NTE A;  3O0H A;  1EL8 A;  2YR5 A;  2VQ7 A;  1K0L A;  1PBE A;  3NYC A;  3BHK A;  3AE2 A;  3GWD A;  1DJQ A;  5GRT A;  4YXD A;  4UDP A;  1ZK7 A;  4J2W A;  1DAO A;  3VRB A;  5FS6 A;  4D04 A;  3K7T A;  4EM4 A;  3F8P A;  2E49 A;  4X9N A;  4JDR A;  3SYI A;  4JNA A;  1H7X A;  4UDQ A;  4OPT A;  2Q0K A;  4JY3 A;  1PBC A;  2WHD A;  2YLS A;  3NKS A;  5KWF A;  4ICY A;  2WEU A;  1CJC A;  1GSN A;  3K7Q X;  2EQ8 A;  4FK1 C;  3DJJ A;  4G9K A;  3RP8 A;  1H84 A;  1CL0 A;  2GQF A;  2C65 A;  4YKG A;  1C0K A;  5KMS A;  1E7P A;  4NTD A;  1D4D A;  1L0V A;  3NGC X;  2XLU A;  1E1K A;  4N9X A;  3GMB A;  2XDO A;  1D5T A;  2YG3 A;  5J7X A;  4GDE A;  4H4W A;  4U8N A;  4CCR A;  3AE9 A;  1NHP A;  1S2Y A;  3BNM A;  1PHH A;  2XFN A;  5C3J A;  1S3E A;  4B1B A;  4HB9 A;  1ZOV A;  1W4X A;  4IA5 A;  1OJ9 A;  4GR1 A;  4U2T A;  3T2Z A;  3ATQ A;  4XXG A;  1N4U A;  2WS3 A;  3T14 A;  3NTA A;  1EL5 A;  2C70 A;  4H4Y A;  4ZN0 A;  5BRT A;  4II3 A;  3NK1 X;  1PJ5 A;  1ONF A;  2DKH A;  5KVI A;  2H88 A;  2JK6 A;  3NLC A;  4K5R A;  4USR A;  4YTM A;  2B7R A;  2BK5 A;  2PYX A;  1CJ3 A;  2WPE A;  4USQ A;  2JAE A;  3V3O A;  3F8D A;  1LQU A;  1H83 A;  4A7A A;  1YKJ A;  1IUW A;  1K4Q A;  2Q0L A;  2X8G A;  3NH3 X;  3KU9 A;  2BYB A;  3GD3 A;  3ICR A;  2R0P A;  2BXS A;  2ARD A;  3AEA A;  3GDN A;  2ZZ0 A;  4CRT A;  4B66 A;  4AT0 A;  4H4X A;  3DGZ A;  4OPI A;  4ZCC A;  3NYE A;  1ZY8 A;  4BJY A;  1IUX A;  2QA2 A;  2BS2 A;  4GAP A;  1PN0 A;  2BC1 A;  2OLO A;  2NVK X;  4NEW A;  3IHG A;  2V6O A;  5KOX A;  3SM8 A;  4B65 A;  3AEB A;  4J57 A;  5J60 A;  2B76 A;  3UCL A;  1FL2 A;  3UP5 A;  1Q1R A;  2OA1 A;  2WDR A;  4U8L A;  4H2P A;  4O5U A;  2BRA A;  1PJ6 A;  1JNZ A;  1REO A;  3GYX A;  3DJD A;  1E39 A;  4K8D A;  5HHF A;  1IJH A;  1GEU A;  4XWZ A;  1MXT A;  3AE3 A;  3UTF A;  1PXB A;  3PVC A;  1TDK A;  2GEW A;  3C96 A;  3CNJ A;  1CC2 A; 
#chains in the Genus database with same CATH homology
 1F6M A;  1IUV A;  1D7L A;  1LPF A;  2ZZB A;  4J56 A;  2CVJ A;  3AE8 A;  5KOW A;  4AP1 A;  3DA1 A;  1M6I A;  4J33 A;  2YG5 A;  1NHS A;  3IHM A;  3SX6 A;  3D8X A;  4EQR A;  3P1W A;  1NEK A;  1TRB A;  1YY5 A;  4DGK A;  4OPL A;  4YJG B;  3ZYX A;  3UKQ A;  3CIR A;  3VQR A;  3CMM A;  1JEH A;  4Z26 A;  2GAG B;  3FBS A;  4EIP A;  1XHC A;  2WPC A;  5IQ1 A;  5ER0 A;  4YTN A;  4GF7 A;  3SZ0 A;  2CUL A;  1C0P A;  2B9X A;  2ZBW A;  2VRM A;  2WP6 A;  1DDO A;  3QJ4 A;  4G6H A;  2AR8 A;  4H7U A;  2XVE A;  3AE5 A;  4CNK A;  1CHU A;  1CC6 A;  2RGH A;  1GES A;  4H50 A;  1NG4 A;  1F3P A;  3PO7 A;  1BGJ A;  2JBV A;  4TM4 A;  4EMJ A;  1GXF A;  3BHF A;  3CGE A;  3ICS A;  4BK1 A;  1M64 A;  5U63 A;  3LB8 A;  3UOX A;  2C3C A;  3DK9 A;  4OPC A;  5DBJ A;  2FBW A;  3EAN A;  3RED A;  3KVE A;  1H7W A;  3E1T A;  3T2Y A;  2BS4 A;  3AEC A;  3DK4 A;  1KSU A;  4U8O A;  2C75 A;  3QFA A;  4JN9 A;  2BC0 A;  2JB1 A;  2YR6 A;  3M12 A;  2XYO A;  3G5Q A;  5BUL A;  1YQZ A;  3AE4 A;  1VRQ B;  2X99 A;  3AED A;  4NNJ A;  1ELI A;  4YJG A;  3NTD A;  1CJ4 A;  3F8R A;  1LQT A;  4CY8 A;  1F8S A;  2B7S A;  3K7M X;  2RGO A;  5HYM A;  1MOK A;  4C3X A;  2XVI A;  4LII A;  3BNU A;  3KD9 A;  1PS9 A;  3T2K A;  3AXB A;  2GAH B;  4DSH A;  3PS9 A;  1JRX A;  1Q1W A;  3LJP A;  2WOI A;  4K5S A;  4LU6 A;  2E82 A;  3ZNP A;  4APN A;  4Y4M A;  2YM2 A;  3ZNO A;  1DNC A;  1QJD A;  1GOS A;  1X31 B;  2A89 A;  5BUK A;  3VR8 A;  2WES A;  1SEZ A;  2C4C A;  1NEN A;  5KNL A;  1D4C A;  1GV4 A;  1IUS A;  3UTH A;  3FIM B;  3EAO A;  3UKP A;  4TLZ A;  4NTC A;  1E1M A;  1AOG A;  3GWF A;  1PBF A;  3ADA B;  4G6G A;  4YJD A;  3NYF A;  3ITJ A;  1GRE A;  1TDO A;  2C3D A;  4X9M A;  2XFQ A;  2HQM A;  4ZCD A;  3C4N A;  2FJD A;  3S5W A;  1AN9 A;  3IWA A;  2C76 A;  3LAD A;  3QSM A;  1D7Y A;  1KSS A;  4HA6 A;  1EVI A;  4A99 A;  1ZX9 A;  4GAV A;  3SFE A;  3AYL A;  4OVI A;  1H82 A;  2W0H A;  3NN6 X;  4Y4N A;  1PBD A;  3UOZ A;  2J3N A;  4Z43 A;  1KFY A;  2EQ9 A;  4GRT A;  1EBD A;  4CBQ A;  2Y6R A;  3D1C A;  2Y6Q A;  4I58 A;  2OAL A;  4ECH A;  4JY2 A;  4REK A;  3AB1 A;  5KMQ A;  2UZZ A;  2GV8 A;  3AD9 B;  3ATR A;  2FJA A;  2C66 A;  2WDQ A;  1TDE A;  2QA1 A;  3HYX A;  5JCL A;  2Q6U A;  3ALJ A;  1OJD A;  3CN8 A;  3KA7 A;  3L1R A;  4GCM A;  1TYT A;  3GDP A;  3RHA A;  2AQJ A;  3AYJ A;  4D03 A;  2AAQ A;  1TYP A;  2R45 A;  3WGT A;  2GR3 A;  1PJ7 A;  3B6D A;  4II2 A;  1RYI A;  3UKK A;  1L9D A;  2E48 A;  5JCN A;  4CY6 A;  2WOV A;  2YLT A;  3M0O A;  3DME A;  2WP5 A;  3CPJ G;  3IC9 A;  4TM0 A;  1O95 A;  3I3L A;  4K2X A;  2E5V A;  2C67 A;  4AP3 A;  4Z25 A;  2C72 A;  4U8K A;  4GDP A;  1GRF A;  5FS7 A;  2YG4 A;  4YJH B;  1N4W A;  2BK3 A;  2APG A;  4TM3 A;  4PAB A;  3ALM A;  3NIX A;  3RP6 A;  3CGB A;  4TLX A;  2X8C A;  1BZL A;  2VVM A;  2YVF A;  3LZW A;  4M52 A;  1K0I A;  2IVE A;  1CJ2 A;  3GYI A;  2XVJ A;  2XLS A;  3AYI A;  3NT6 A;  3UKH A;  1Z6L A;  4H4P A;  4B63 A;  4YSZ A;  4WCT A;  2OLN A;  4H4Q A;  3W4I A;  3FG2 P;  3Q9T A;  1COY A;  5FS9 A;  3P4Q A;  2WQY A;  3H8L A;  4H2R A;  1MO9 A;  1DOC A;  1XAN A;  1ZDL A;  2BCG G;  3QFB A;  4U2L A;  3T31 A;  2Z5Y A;  2XFO A;  3SY4 A;  2WU2 A;  3DJG X;  2VVL A;  3LXD A;  4RG3 A;  1NPX A;  1VE9 A;  2B9Y A;  1LTX R;  3CGC A;  3H4K A;  3FPZ A;  3K30 A;  3NK2 X;  4JQ9 A;  3SXI A;  3V76 A;  2YLW A;  3VR9 A;  2DKI A;  1TDN A;  1DJN A;  4BK3 A;  3NK0 X;  2E1M A;  2IVD A;  3WE0 A;  3KKJ A;  3NNE A;  1N1P A;  4AOS A;  4B69 A;  2JB3 A;  1JRZ A;  3BI2 A;  4Z44 A;  4J34 A;  1DXL A;  2GRT A;  3UTE A;  2GB0 A;  1XDI A;  2GQW A;  3Q6J A;  4YJH A;  1PXA A;  2DU8 A;  3CPI G;  3GD4 A;  2R4J A;  1XPQ A;  1RP0 A;  3AD8 B;  3SZW A;  2BS3 A;  1GRT A;  2B9W A;  3SGL A;  4RSL A;  2ZZC A;  4H4S A;  2YAU A;  1DOE A;  2GR1 A;  5LV9 A;  1Y0P A;  5BVA A;  1YQ4 A;  4U8I A;  5CKU A;  1CBO A;  1PXC A;  4Y4L A;  1NAA A;  2XCG A;  1GND A;  1GTE A;  2YM1 A;  4Z2T A;  5KRQ A;  1IUT A;  5FS8 A;  1ZP0 A;  4J31 A;  2V5Z A;  3G3E A;  4KX6 A;  5FMH A;  2YLZ A;  1BWC A;  4H4V A;  2JB2 A;  3DGH A;  3ISH A;  1GER A;  3BI5 A;  3QSS A;  2YLX A;  5IPY A;  2JKC A;  5JCM A;  1KNR A;  3GSI A;  4B68 A;  2VZ2 A;  2E4G A;  2A8X A;  2RGJ A;  1VG9 A;  3SYI A;  3ZNN A;  4YSH A;  1P2E A;  2BCP A;  1H6V A;  3KPF A;  3UOY A;  3V3N A;  1NHQ A;  1P2H A;  1H86 A;  2BA9 A;  3I6D A;  1BGN A;  3AE7 A;  2YG7 A;  3AWI A;  3P4S A;  1CC4 A;  4YJF B;  3CNP A;  4NWZ A;  4B64 A;  4PAA A;  3W4J A;  4EMW A;  4OPD A;  1BKW A;  2Z5X A;  3OC4 A;  2RAB A;  1JOA A;  4H4R A;  3UKL A;  4YT0 A;  3AEG A;  3NRN A;  3RP7 A;  2XVF A;  2V61 A;  5EOW A;  1GRH A;  2C64 A;  4TM1 A;  3S61 A;  3IF9 A;  4EM3 A;  2R46 A;  1H81 A;  1GRG A;  1Q9I A;  4YKF A;  3LOV A;  1KF6 A;  1ZMC A;  1JRY A;  1KDG A;  1NG3 A;  1LJ1 A;  3HYW A;  4FX9 A;  1L9E A;  3T0K A;  4H2Q A;  3UTG A;  3CUK A;  3G5S A;  1S2Q A;  2WP9 A;  3R9U A;  4Z2R A;  3LZX A;  2BAC A;  2ACZ A;  4ADW A;  5JCK A;  1FEA A;  4LA1 A;  2CDU A;  1GET A;  3UP4 A;  3ZNQ A;  4IVO B;  2VVL G;  4KPR A;  1YQ3 A;  4EIQ A;  4EQX A;  2YQU A;  1VQW A;  3M13 A;  3B3R A;  4NEV A;  4YTP A;  4A9W A;  2XLR A;  2BRY A;  5IQ4 A;  4CCQ A;  5KXJ A;  2V3A A;  2GR0 A;  1OJA A;  5KMR A;  2I0Z A;  3T37 A;  4YJF A;  3P4P A;  1Y56 B;  1E1L A;  5HY5 A;  5KMP A;  1B37 A;  4BK2 A;  2NPX A;  4MJW A;  3EPT A;  1PDH A;  4UP3 A;  1ZKQ A;  2F5Z A;  3GYJ A;  1KNP A;  3KPK A;  1FEB A;  2YR4 A;  1GRA A;  3DK8 A;  4BUR A;  3UKA A;  4C3Y A;  4DSG A;  2E4A A;  2GH5 A;  2WBA A;  3ABV A;  4UDR A;  2V60 A;  3VRA A;  4CNJ A;  3BI4 A;  3AD7 B;  3CND A;  4E0V A;  5KVH A;  4Z24 A;  2XFU A;  4RG4 A;  4I59 A;  1K0J A;  1B5Q A;  4O5Q A;  2PHH A;  1VG0 A;  3HYV A;  4EQW A;  4YWO A;  3HZL A;  1VDC A;  4AT2 A;  4EQS A;  1NHR A;  1LV0 A;  1DOD A;  3AE6 A;  3II4 A;  1KIF A;  2X8H A;  1JU2 A;  1QO8 A;  4Z2U A;  3QSE A;  2A87 A;  4A6N B;  2YLR A;  4AOX A;  1F8R A;  3AEE A;  1GTH A;  1HYU A;  5M10 A;  4P9S A;  5GSN A;  2V3B A;  1O5W A;  4A5L A;  4QFD A;  2GMJ A;  1TDF A;  5JCI A;  2XVH A;  2QAE A;  2VRL A;  3L8K A;  4H2N A;  2R4E A;  1Y56 A;  3NHO X;  1RSG A;  1C0I A;  3SZF A;  2XFP A;  1E6E A;  1S3B A;  4G74 A;  4XWR A;  5C2T A;  1GRB A;  2GMH A;  3CNS A;  2GR2 A;  4YSX A;  2BXR A;  2TMD A;  4H4Z A;  5U25 A;  2X50 A;  4A65 A;  4C74 A;  2H89 A;  4FK1 A;  5U1O A;  2BAB A;  3RNM A;  5HXI A;  2VQB A;  4WX1 A;  4QFC A;  2R0C A;  4GUV A;  4IA6 A;  3KLJ A;  3ZDN A;  1BF3 A;  1NDA A;  3AE1 A;  1OJC A;  4OPG A;  1OJT A;  1DOB A;  4OCG A;  3QVP A;  2C7G A;  1O94 A;  2YG6 A;  2Q7V A;  3GMC A;  1N4V A;  3H8I A;  1F8W A;  1E1N A;  1CF3 A;  4J36 A;  4X4J A;  5CQF A;  4U8P A;  2TPR A;  4EMI A;  3C4A A;  5EB5 A;  4A6N A;  1C0L A;  1JNR A;  3CGD A;  5TR3 A;  4FDC B;  2BK4 A;  1IUU A;  3GRS A;  4JNQ A;  3NG7 X;  1LVL A;  3P9U A;  2R9Z A;  4NZH A;  2VOU A;  1QLB A;  3W4K A;  4IV9 A;  1D4E A;  1UKV G;  2O9Z A;  4H4U A;  4K7Z A;  1GPE A;  2OAM A;  4U2S A;  4H4T A;  2WET A;  3UKF A;  1ZMD A;  3CPH G;  3JSK A;  2CFY A;  1FOH A;  2GVC A;  3AEF A;  4BJZ A;  3QVR A;  2FJE A;  2GF3 A;  3CNT A;  3ALL A;  5EB4 A;  3DJE A;  5EBK A;  2WU5 A;  1L9C A;  2X3N A;  4OPU A;  4B67 A;  3CTY A;  3ICT A;  4IVM B;  2YVJ A;  2C73 A;  3URH A;  4BV6 A;  4K22 A;  2YVG A;  1V59 A;  5L46 A;  4U8J A;  2EQ7 A;  3OZ2 A;  4A79 A;  2EQ6 A;  2QCU A;  2IID A;  4C5O A;  1ZOY A;  1GT8 A;  1GAL A;  1EL7 A;  2WDV A;  2FJB A;  3UOV A;  3COX A;  1FEC A;  2XLT A;  3P4R A;  4YSY A;  3GRT A;  2XLP A;  1B4V A;  3SQP A;  4DNA A;  4U8M A;  2WOW A;  2WPF A;  3SFD A;  1PBB A;  3NN0 X;  2R0G A;  4G73 A;  4C77 A;  3VRD B;  1B8S A;  3G5R A;  1EL9 A;  2YWL A;  3DH9 A;  5M0Z A;  1FCD A;  3EF6 A;  3SZC A;  3FMW A;  4NTE A;  3O0H A;  1EL8 A;  2YR5 A;  2VQ7 A;  1K0L A;  1PBE A;  3NYC A;  3BHK A;  3AE2 A;  3GWD A;  1DJQ A;  5GRT A;  4YXD A;  4UDP A;  1ZK7 A;  4J2W A;  1DAO A;  3VRB A;  5FS6 A;  4D04 A;  3K7T A;  4EM4 A;  3F8P A;  2E49 A;  4X9N A;  4JDR A;  4JNA A;  1H7X A;  4UDQ A;  4OPT A;  2Q0K A;  2WHD A;  1PBC A;  2YLS A;  3NKS A;  4JY3 A;  5KWF A;  4ICY A;  2WEU A;  1CJC A;  1GSN A;  3K7Q X;  2EQ8 A;  4FK1 C;  3DJJ A;  4G9K A;  3RP8 A;  1H84 A;  1CL0 A;  2GQF A;  2C65 A;  4YKG A;  1C0K A;  5KMS A;  1E7P A;  4NTD A;  1D4D A;  1L0V A;  3NGC X;  2XLU A;  1E1K A;  4N9X A;  3GMB A;  2XDO A;  1D5T A;  2YG3 A;  5J7X A;  4GDE A;  4H4W A;  4U8N A;  4CCR A;  3AE9 A;  1NHP A;  1S2Y A;  3BNM A;  1PHH A;  2XFN A;  5C3J A;  1S3E A;  4B1B A;  4HB9 A;  1ZOV A;  1W4X A;  1OJ9 A;  4GR1 A;  4IA5 A;  4U2T A;  3T2Z A;  3ATQ A;  4XXG A;  1N4U A;  2WS3 A;  3T14 A;  3NTA A;  1EL5 A;  2C70 A;  4H4Y A;  4ZN0 A;  5BRT A;  4II3 A;  3NK1 X;  1PJ5 A;  1ONF A;  2DKH A;  5KVI A;  2H88 A;  2JK6 A;  3NLC A;  4K5R A;  4USR A;  4YTM A;  2B7R A;  2BK5 A;  2PYX A;  1CJ3 A;  2WPE A;  4USQ A;  2JAE A;  3V3O A;  3F8D A;  1LQU A;  1H83 A;  4A7A A;  1YKJ A;  1IUW A;  1K4Q A;  2Q0L A;  2X8G A;  3NH3 X;  3KU9 A;  2BYB A;  3GD3 A;  3ICR A;  2R0P A;  2BXS A;  2ARD A;  3AEA A;  3GDN A;  2ZZ0 A;  4CRT A;  4B66 A;  4AT0 A;  4H4X A;  3DGZ A;  4OPI A;  4ZCC A;  3NYE A;  1ZY8 A;  2QA2 A;  1IUX A;  4BJY A;  2BS2 A;  4GAP A;  1PN0 A;  2BC1 A;  2OLO A;  2NVK X;  4NEW A;  3IHG A;  2V6O A;  5KOX A;  3SM8 A;  4B65 A;  3AEB A;  4J57 A;  5J60 A;  2B76 A;  3UCL A;  1FL2 A;  3UP5 A;  1Q1R A;  2OA1 A;  2WDR A;  4U8L A;  4H2P A;  4O5U A;  2BRA A;  1PJ6 A;  1JNZ A;  1REO A;  3GYX A;  3DJD A;  1E39 A;  4K8D A;  5HHF A;  1IJH A;  1GEU A;  4XWZ A;  1MXT A;  3AE3 A;  3UTF A;  1PXB A;  3PVC A;  1TDK A;  2GEW A;  3C96 A;  3CNJ A;  1CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...