2UZZA

X-ray structure of n-methyl-l-tryptophan oxidase (mtox)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
KYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKYVPLVLRAQMLWDELSRHNEDDPIFVRSGVINLGPADSTFLANVAHSAEQWQLNVEKLDAQGIMARWPEIRVPDNYIGLFETDSGFLRSELAIKTWIQLAKEAGCAQLFNCPVTAIRHDDDGVTIETADGEYQAKKAIVCAGTWVKDLLPELPVQPVRKVFAWYQADGRYSVKNKFPAFTGELPNGDQYYGFPAENDALKIGKHNGGQVIHSADERVPFAEVVSDGSEAFPFLRNVLPGIGCCLYGAACTYDNSPDEDFIIDTLPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSDFDLTPFRLSRFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords N-METHYL-L-TRYPTOPHAN OXIDASE
publication title The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.5.3.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 2uzzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2uzzA01
1PS9A 2BK3A 1LQTA 3DH9A 1C0KA 4EIPA 5JCMA 1O5WA 3B3RA 4C3XA 2ZBWA 1W4XA 1UKVG 2QAEA 1XPQA 4H4TA 1NEKA 2OLOA 3UTEA 1B37A 3R9UA 3GYIA 4J34A 3DGHA 4Y4LA 3EANA 1KNPA 3EF6A 4IA6A 1AN9A 2VZ2A 2WEUA 4NTCA 3ZYXA 4DSHA 3UTHA 3NYEA 2Y6RA 2YR4A 3IHGA 4OVIA 5FS7A 2GMJA 1DXLA 1IJHA 2JB1A 1CL0A 1JEHA 1N4UA 2XVFA 1GALA 3AD8B 4H4UA 4UDQA 3AEGA 1F6MA 2ACZA 3NG7X 4O5UA 1K0LA 4D03A 3BHKA 1FECA 1TDNA 1D7LA 2XVJA 4DNAA 3DA1A 3AE9A 1JOAA 1VDCA 2V3AA 4J33A 4X4JA 2XFQA 2GH5A 1GSNA 3GD3A 1PDHA 5L46A 4X9MA 3UP4A 4YSHA 4M52A 4B69A 1P2EA 2BS4A 2H88A 2E4GA 1LJ1A 4NEWA 1YY5A 4OPCA 4REKA 5HY5A 4Z24A 3CGBA 3G5RA 4U8PA 3FMWA 2BK4A 3W4KA 1CC6A 4QFDA 1P2HA 1XDIA 2XFUA 2YLTA 4H4XA 4IA5A 4JNQA 3FIMB 5EBKA 2OLNA 2JB3A 3UOVA 1FEBA 2XVIA 3AEFA 4TM1A 4JN9A 1FEAA 2ARDA 1E39A 4GDPA 4YTMA 2R4EA 1ZMDA 4H2PA 1PXBA 3KA7A 3V3OA 4DSGA 1K0JA 2VVMA 4CRTA 2GR2A 3NK1X 4OPTA 3VRAA 1H6VA 1GNDA 3PO7A 3SQPA 5IPYA 3II4A 4GDEA 2OA1A 1NHRA 3EAOA 4BK1A 2JBVA 2W0HA 3ICRA 1EL5A 3NRNA 4A9WA 4D04A 3NN0X 4U8NA 5U1OA 5HHFA 2R45A 1DNCA 1B4VA 1S2YA 3UKPA 3NH3X 1LV0A 1H7WA 2RGJA 3QJ4A 3DJGX 2WPEA 4E0VA 2JK6A 3M13A 1GRGA 1Q9IA 3KPFA 4B64A 2J3NA 4UP3A 4LU6A 4NZHA 1JRYA 2F5ZA 3CNDA 2YLRA 1ZK7A 1E1NA 2CVJA 2IVDA 4C74A 3G3EA 1D4EA 4YKFA 4H4SA 1FL2A 1TDFA 4U8MA 3UKQA 5M10A 2X50A 2YLXA 4OPGA 4H4QA 4FK1C 2C70A 5GSNA 2FJBA 3AEEA 3SM8A 2DKIA 1MO9A 4AOSA 1JRXA 1VQWA 1OJDA 3ABVA 2XLSA 3GMCA 5KRQA 1LTXR 1SEZA 2GAHB 4YWOA 3ALJA 2Q0KA 3D8XA 4U8OA 1K4QA 4UDPA 1NENA 3GYJA 1BGJA 2FJDA 5KVIA 1TRBA 4TLXA 4RSLA 2B7RA 3CNPA 2E82A 2WOIA 4GRTA 1DAOA 1X31B 2IVEA 4LIIA 3PS9A 4YJHB 3CNSA 3G5QA 2EQ9A 2YG3A 2Q6UA 1M64A 3EPTA 4J56A 1GTEA 1YQ3A 4Z25A 1K0IA 1H84A 4CCRA 3DMEA 3LZXA 3UKLA 1PJ6A 1E1KA 1YQ4A 3P4PA 3H8LA 4GCMA 3GDNA 2YLSA 4YSZA 1KSSA 4Z26A 5IQ1A 3DJJA 1S2QA 3CGCA 1GRTA 2BA9A 1GREA 2XLUA 4Z2RA 3AB1A 1Y56B 2UZZA 1Q1WA 3GMBA 5J7XA 5CKUA 5FS6A 1ZP0A 3AXBA 2WETA 4KX6A 1CC4A 3GWDA 4NEVA 2WBAA 2XYOA 2JKCA 3O0HA 3Q9TA 1E7PA 2V6OA 4YXDA 3GRSA 3UTFA 3F8PA 4B63A 1H7XA 3OC4A 4TM0A 4EMJA 5JCLA 4AT2A 5KVHA 1IUWA 3NTDA 1CC2A 2BS2A 1F3PA 2R0CA 2X8GA 1DOBA 2B9WA 2NVKX 2Q7VA 1KDGA 2E4AA 1C0IA 1FCDA 3CPJG 2GF3A 3LB8A 2C76A 2DKHA 3AEBA 4PABA 3JSKA 2WU5A 3VQRA 3Q6JA 4K5RA 4XWZA 4MJWA 1N4WA 4FDCB 4OCGA 5BVAA 1RP0A 2VVLG 2XVHA 1PBBA 4BJYA 1L9DA 3RNMA 1GOSA 4GR1A 2WP5A 4B65A 2PHHA 2RABA 3AYLA 3NK2X 3KD9A 3FG2P 1OJTA 2E5VA 4A79A 4AP1A 1OJAA 2AAQA 1TDEA 2WESA 4YJHA 2GR3A 3K7TA 4H2NA 4Y4MA 2XLTA 1TYTA 3FBSA 4RG4A 1JNRA 4YJDA 1Z6LA 4HA6A 5HYMA 3L1RA 4I58A 3K7QX 3W4JA 2B7SA 1C0LA 1DOCA 1E1MA 2VRMA 3CNJA 4QFCA 3NGCX 4YJGB 2GMHA 3KVEA 2WPCA 5C3JA 3ATRA 2E1MA 4H7UA 1ZKQA 1IUSA 3AD9B 3GDPA 4U8LA 3NHOX 5EB4A 4EQXA 1VG9A 2ZZ0A 3AE6A 4J2WA 4UDRA 4CY6A 2C75A 3IF9A 2B9XA 5IQ4A 1ZX9A 1ZOVA 1Y56A 2YG4A 3RP7A 4A65A 3RHAA 5FS8A 1GV4A 2BC0A 3WGTA 1GPEA 2A89A 2BXRA 1RSGA 1S3EA 4K22A 1GTHA 2A87A 2C7GA 2GVCA 3QVPA 2WQYA 4K2XA 3UOYA 3DJDA 1DJNA 3ATQA 4KPRA 4Z44A 1PJ7A 4JNAA 2C3DA 2XFOA 3FPZA 1BF3A 4H2RA 5JCIA 3G5SA 5HXIA 3BHFA 3BI4A 3REDA 5CQFA 1O94A 2CFYA 2AQJA 2WU2A 4K5SA 1GXFA 3E1TA 4BURA 1PBDA 2RGHA 5FS9A 1F8SA 5JCNA 4B68A 3C4NA 2APGA 1H81A 3SFEA 2ZZBA 4N9XA 3CGEA 3NYFA 4EQSA 5KXJA 1NHPA 3L8KA 4APNA 1GRHA 3C4AA 2WP9A 3C96A 3CPHG 2TMDA 3GD4A 3AD7B 3DGZA 3NK0X 4J57A 3HZLA 4H2QA 4K8DA 4OPLA 3IHMA 4K7ZA 2GAGB 1KSUA 4JQ9A 1L0VA 1OJ9A 4X9NA 3I3LA 2XCGA 4C3YA 2E48A 4DGKA 4YJFB 3UOZA 4U2LA 5TR3A 4YJGA 1GRFA 1ONFA 2WS3A 4O5QA 1EL9A 1BWCA 3DJEA 4XWRA 3IWAA 1CJ4A 3ZNQA 1XANA 3QSMA 1NHQA 1ZY8A 2WDVA 3WE0A 3KU9A 1L9EA 1VG0A 4IVOB 2FJEA 4H4VA 3F8RA 3QSEA 5BULA 2HQMA 3AE1A 3QSSA 2JB2A 2GQWA 4ADWA 4Z43A 3AE7A 3AECA 3ALMA 4YSXA 4TM3A 2H89A 2X8HA 1CHUA 2X3NA 2XFPA 4USQA 1PHHA 5DBJA 1L9CA 3B6DA 1ELIA 1NG3A 2YM2A 4WCTA 3DK9A 4EMIA 2XLRA 1B8SA 2YLZA 2Z5YA 3P4RA 3P9UA 4BK2A 1ZDLA 1PXCA 2X8CA 2TPRA 3GSIA 2BACA 2V3BA 1JU2A 4PAAA 5BRTA 3QVRA 4AOXA 3LJPA 3P4QA 3DK4A 2WHDA 3T37A 2Q0LA 1Q1RA 1YKJA 1LQUA 1YQZA 3V76A 3SFDA 2YAUA 2IIDA 4AP3A 2PYXA 1AOGA 2OAMA 1DOEA 1E1LA 4AT0A 3CTYA 1TDOA 1F8WA 1IUTA 2X99A 2B9YA 1REOA 3D1CA 3UKKA 1KFYA 2XLPA 4IV9A 5EOWA 4U8KA 4CNKA 3CUKA 4WX1A 1COYA 1D4CA 4U2SA 1GEUA 4YJFA 2QA1A 3UKAA 2C66A 1QO8A 1BKWA 1HYUA 4TLZA 3W4IA 2R46A 1PJ5A 3ICSA 1QJDA 3NTAA 1EL7A 1D5TA 3COXA 1KF6A 5M0ZA 1TYPA 2XFNA 2JAEA 2XDOA 2YR5A 3UCLA 2NPXA 3SGLA 2GEWA 2YVJA 2WPFA 2V60A 2EQ8A 1D7YA 3V3NA 3LZWA 3K7MX 4BJZA 5BUKA 5GRTA 4EQRA 3NN6X 3AE8A 4LA1A 1B5QA 3KKJA 2VRLA 4U8JA 1LVLA 4U8IA 2GR1A 4CY8A 1MOKA 3P1WA 4OPUA 3NT6A 2E49A 2Y6QA 1GETA 1OJCA 3AWIA 2XVEA 2R0GA 3AE5A 2YG5A 4OPIA 3UOXA 4J31A 3ICTA 4Z2UA 1KNRA 1BGNA 1CJCA 3M12A 2GV8A 3NYCA 1GERA 2OALA 3ZDNA 1N1PA 3F8DA 1C0PA 4FK1A 1QLBA 1GESA 5J60A 1NDAA 2BXSA 2QCUA 5KOXA 1XHCA 4Z2TA 2BK5A 2R0PA 3H8IA 4RG3A 3ZNOA 3LOVA 3K30A 1DJQA 3AYIA 3DK8A 1FOHA 3RP8A 5C2TA 4Y4NA 2GQFA 1PBEA 2YVFA 4USRA 1Y0PA 1NHSA 3AE4A 1IUUA 1ZOYA 4NTEA 2C3CA 3I6DA 4JY2A 4BK3A 4BV6A 4YSYA 1KIFA 3CN8A 5KOWA 4EMWA 4YTPA 4CNJA 1H83A 3GWFA 4A6NA 4CCQA 2WDRA 2YVGA 2A8XA 1E6EA 1IUXA 2FJAA 2YG6A 3ADAB 4A5LA 2EQ6A 3CNTA 1GT8A 4C5OA 3RP6A 3ISHA 3URHA 4A99A 4B67A 4J36A 2C65A 3NNEA 1CF3A 1TDKA 4B1BA 4C77A 1PN0A 1H82A 4ICYA 4OPDA 3AEAA 4HB9A 4YKGA 1PXAA 2ZZCA 3BNMA 4ZCDA 2BC1A 2BYBA 4EM3A 1DDOA 1D4DA 3P4SA 3VRDB 2WOWA 1CJ3A 3IC9A 3AE3A 2R4JA 3S5WA 1VRQB 1BZLA 2YG7A 3AEDA 1MXTA 2WDQA 2WP6A 3ITJA 2C67A 3NLCA 3BI5A 1NAAA 4JY3A 3GRTA 2EQ7A 4B66A 3OZ2A 2V5ZA 2YQUA 1RYIA 1S3BA 2YM1A 4U2TA 4EM4A 1CBOA 2YLWA 3CGDA 3VRBA 2VVLA 3VR8A 4EIQA 2BCPA 2YWLA 3BNUA 5KWFA 3QFAA 2GR0A 2CULA 3AYJA 2BS3A 4H4ZA 3ZNNA 1NG4A 2V61A 5EB5A 1PBCA 1GRAA 1PBFA 2C72A 1ZMCA 2O9ZA 2VQ7A 4H4WA 3UKFA 2CDUA 2WOVA 2AR8A 3LXDA 4FX9A 3UP5A 4H4PA 2R9ZA 1V59A 4I59A 4H4RA 2DU8A 5LV9A 2BCGG 2QA2A 2VOUA 3KLJA 1H86A 4IVMB 5FMHA 1JNZA 1N4VA 3H4KA 3UTGA 2GRTA 3NIXA 5JCKA 1VE9A 1F8RA 3CPIG 4JDRA 2Z5XA 3UKHA 3NKSA 2RGOA 4YT0A 3LADA 1M6IA 3QFBA 4H4YA 4YTNA 4GUVA 5U63A 4EQWA 1GRBA 1DODA 2C64A 3PVCA 3S61A 2VQBA 4GF7A 4A7AA 1EL8A 4ZN0A 2C73A 3ALLA 4XXGA 4P9SA 2I0ZA 2FBWA 1JRZA 1CJ2A 3M0OA 5U25A 1EBDA 1EVIA 4NTDA 3ZNPA 4ZCCA 3CIRA 4A6NB 2YR6A 3BI2A 4ECHA 1O95A 3AE2A 4H50A 2B76A 2BABA 2GB0A 4TM4A 1LPFA 4CBQA 3VR9A 1IUVA 1NPXA 5ER0A
chains in the Genus database with same CATH superfamily
1PS9A 4EIPA 1LQTA 2BK3A 1C0KA 3DH9A 5JCMA 1O5WA 3B3RA 4C3XA 2ZBWA 1W4XA 1UKVG 2QAEA 1XPQA 4H4TA 1NEKA 2OLOA 3UTEA 1B37A 3R9UA 3GYIA 4J34A 3DGHA 4Y4LA 3EANA 1KNPA 4IA6A 3EF6A 1AN9A 2VZ2A 2WEUA 4NTCA 3ZYXA 4DSHA 3UTHA 3NYEA 2Y6RA 2YR4A 3IHGA 4OVIA 5FS7A 3GYXA 2GMJA 1DXLA 1IJHA 2JB1A 1CL0A 1JEHA 1N4UA 2XVFA 1GALA 3AD8B 4H4UA 4UDQA 3AEGA 1F6MA 2ACZA 3NG7X 4O5UA 1K0LA 4D03A 3BHKA 1FECA 1TDNA 1D7LA 2XVJA 4DNAA 3DA1A 3AE9A 1JOAA 1VDCA 2V3AA 4J33A 4X4JA 2XFQA 2GH5A 1GSNA 3GD3A 1PDHA 5L46A 4X9MA 3UP4A 4YSHA 4M52A 4B69A 1P2EA 2BS4A 2H88A 2E4GA 1LJ1A 4NEWA 1YY5A 4OPCA 4REKA 5HY5A 4Z24A 3SZFA 3CGBA 3G5RA 4U8PA 3FMWA 2BK4A 4IA5A 1CC6A 4QFDA 3W4KA 1P2HA 1XDIA 2XFUA 2YLTA 4H4XA 4JNQA 3FIMB 5EBKA 3T0KA 2OLNA 2JB3A 3UOVA 1FEBA 2XVIA 3AEFA 4TM1A 4JN9A 1FEAA 2ARDA 1E39A 4GDPA 4YTMA 2R4EA 1ZMDA 4H2PA 1PXBA 3KA7A 3V3OA 4DSGA 1K0JA 2VVMA 4CRTA 2GR2A 3NK1X 4OPTA 3VRAA 5KMPA 1H6VA 1GNDA 3PO7A 3SQPA 5IPYA 3II4A 4GDEA 2OA1A 4BK1A 1NHRA 3EAOA 2JBVA 2W0HA 3ICRA 1EL5A 3NRNA 4A9WA 4D04A 3NN0X 3SZ0A 4U8NA 5U1OA 3T14A 5HHFA 2R45A 1DNCA 1B4VA 1S2YA 3UKPA 3NH3X 1LV0A 1H7WA 2RGJA 3QJ4A 3DJGX 2WPEA 4E0VA 2JK6A 3HYXA 3M13A 1GRGA 1Q9IA 3KPFA 4B64A 2J3NA 4UP3A 4LU6A 3V3NA 4NZHA 1JRYA 2F5ZA 3CNDA 2YLRA 1ZK7A 1E1NA 2CVJA 2IVDA 4C74A 3G3EA 1D4EA 4YKFA 4H4SA 1FL2A 1TDFA 4U8MA 3UKQA 5M10A 2X50A 2YLXA 4OPGA 4H4QA 4FK1C 2C70A 5GSNA 2FJBA 3AEEA 3SM8A 2DKIA 1MO9A 4AOSA 1JRXA 1VQWA 1OJDA 3GMCA 2XLSA 3ABVA 5KRQA 1LTXR 1SEZA 2GAHB 4YWOA 3ALJA 2Q0KA 3D8XA 4U8OA 1K4QA 3SZCA 4UDPA 1NENA 3GYJA 1BGJA 2FJDA 5KVIA 1TRBA 4TLXA 4RSLA 2B7RA 3CNPA 2E82A 2WOIA 4GRTA 1DAOA 1X31B 2IVEA 4LIIA 3PS9A 4YJHB 3CNSA 3G5QA 2EQ9A 2YG3A 2Q6UA 3EPTA 1M64A 4J56A 1GTEA 1YQ3A 4Z25A 1K0IA 1H84A 4CCRA 3DMEA 3LZXA 3UKLA 1PJ6A 1E1KA 1YQ4A 3P4PA 3H8LA 4GCMA 3GDNA 2YLSA 4YSZA 1KSSA 4Z26A 5IQ1A 3DJJA 1S2QA 3CGCA 1GRTA 2BA9A 1GREA 2XLUA 4G74A 4Z2RA 3AB1A 1Y56B 2UZZA 1Q1WA 3GMBA 5J7XA 5CKUA 5FS6A 1ZP0A 3AXBA 2WETA 4KX6A 1CC4A 3GWDA 4NEVA 2WBAA 2XYOA 2JKCA 3O0HA 3Q9TA 1E7PA 2V6OA 4YXDA 3GRSA 3UTFA 3F8PA 4B63A 1H7XA 3OC4A 4TM0A 4EMJA 5JCLA 3T2YA 4AT2A 5KVHA 1IUWA 3NTDA 1CC2A 2BS2A 1F3PA 2R0CA 2X8GA 1DOBA 2B9WA 2NVKX 2Q7VA 1KDGA 2E4AA 1C0IA 1FCDA 3CPJG 2GF3A 3LB8A 2DKHA 2C76A 3AEBA 4PABA 3JSKA 2WU5A 3VQRA 3Q6JA 4K5RA 4XWZA 4MJWA 1N4WA 2C4CA 4FDCB 4OCGA 3SY4A 5BVAA 4NWZA 3SXIA 1RP0A 2VVLG 2XVHA 1PBBA 4BJYA 1L9DA 3RNMA 1GOSA 4GR1A 2WP5A 4B65A 2PHHA 2RABA 3AYLA 3NK2X 3KD9A 3FG2P 1OJTA 2E5VA 4A79A 4AP1A 1OJAA 2AAQA 1TDEA 2WESA 4YJHA 2GR3A 3K7TA 4H2NA 4Y4MA 2XLTA 1TYTA 3FBSA 4RG4A 5HYMA 4YJDA 1JNRA 1Z6LA 4HA6A 3L1RA 4I58A 3K7QX 3W4JA 2B7SA 1C0LA 1DOCA 1E1MA 2VRMA 3CNJA 4QFCA 3NGCX 4YJGB 2GMHA 3KVEA 2WPCA 5C3JA 3ATRA 2E1MA 4H7UA 1ZKQA 1IUSA 3AD9B 3GDPA 4U8LA 3NHOX 5EB4A 4EQXA 1VG9A 2ZZ0A 3AE6A 4J2WA 4UDRA 4CY6A 2C75A 3IF9A 2B9XA 5IQ4A 1ZX9A 1ZOVA 3RP7A 1Y56A 2YG4A 4A65A 3RHAA 5FS8A 1GV4A 2BC0A 3WGTA 1GPEA 2A89A 2BXRA 4K22A 1RSGA 1S3EA 1GTHA 2A87A 2C7GA 2GVCA 3QVPA 2WQYA 4K2XA 3UOYA 3DJDA 1DJNA 3ATQA 4KPRA 4Z44A 1PJ7A 4JNAA 2C3DA 2XFOA 3FPZA 1BF3A 4H2RA 5JCIA 5HXIA 3G5SA 3BHFA 3BI4A 3REDA 5CQFA 1O94A 2CFYA 2AQJA 2WU2A 4K5SA 1GXFA 3E1TA 4BURA 1PBDA 2RGHA 5FS9A 1F8SA 5JCNA 4B68A 3C4NA 2APGA 1H81A 3SFEA 2ZZBA 4N9XA 3CGEA 3NYFA 4EQSA 5KXJA 3T31A 1NHPA 3L8KA 4APNA 3C4AA 1GRHA 2WP9A 3C96A 3CPHG 2TMDA 3GD4A 3AD7B 3DGZA 3NK0X 4J57A 4H2QA 3HZLA 4K8DA 4OPLA 3IHMA 4K7ZA 2GAGB 1KSUA 4JQ9A 1L0VA 1OJ9A 4X9NA 3I3LA 2XCGA 4C3YA 2E48A 4DGKA 4YJFB 3UOZA 4U2LA 5TR3A 4YJGA 1GRFA 1ONFA 2WS3A 4O5QA 1EL9A 1BWCA 3DJEA 4XWRA 3IWAA 1CJ4A 3ZNQA 1XANA 3QSMA 1NHQA 1ZY8A 2WDVA 3WE0A 3KU9A 1L9EA 1VG0A 4IVOB 2FJEA 4H4VA 3F8RA 3QSEA 5BULA 2HQMA 3CMMA 3AE1A 3QSSA 2JB2A 2GQWA 4ADWA 4Z43A 3ALMA 3AE7A 3AECA 4YSXA 3T2ZA 4TM3A 2H89A 2X8HA 1CHUA 2X3NA 2XFPA 4USQA 1PHHA 5DBJA 1L9CA 3B6DA 1ELIA 1NG3A 2YM2A 4WCTA 3DK9A 4EMIA 2XLRA 1B8SA 2YLZA 2Z5YA 4BK2A 3P9UA 3P4RA 1ZDLA 1PXCA 2X8CA 2TPRA 3GSIA 2BACA 2V3BA 1JU2A 4PAAA 5BRTA 3QVRA 4AOXA 3LJPA 3P4QA 3DK4A 2WHDA 3T37A 2Q0LA 1Q1RA 1YKJA 1LQUA 1YQZA 4II2A 3SFDA 3V76A 2YAUA 2IIDA 4AP3A 2PYXA 1AOGA 2OAMA 1DOEA 1E1LA 4AT0A 3CTYA 1TDOA 1F8WA 1IUTA 2X99A 2B9YA 1REOA 3D1CA 3UKKA 1KFYA 2XLPA 4IV9A 5EOWA 4U8KA 4CNKA 3CUKA 2BRYA 4WX1A 1COYA 1D4CA 4U2SA 1GEUA 4YJFA 2QA1A 3UKAA 2C66A 1QO8A 1BKWA 1HYUA 4TLZA 3W4IA 2R46A 1PJ5A 3ICSA 1QJDA 3NTAA 1EL7A 1D5TA 3COXA 1KF6A 5M0ZA 1TYPA 2XFNA 2JAEA 2XDOA 3SYIA 2YR5A 3UCLA 2NPXA 3SGLA 2GEWA 4BJZA 2WPFA 2V60A 2EQ8A 1D7YA 2YVJA 3LZWA 3K7MX 5BUKA 5GRTA 4EQRA 3NN6X 3AE8A 4LA1A 2BRAA 1B5QA 3KKJA 3KPKA 2VRLA 4U8JA 1LVLA 4U8IA 2GR1A 4CY8A 1MOKA 3P1WA 4OPUA 3NT6A 2E49A 2Y6QA 1GETA 1OJCA 3AWIA 2XVEA 2R0GA 3AE5A 2YG5A 4OPIA 3UOXA 4J31A 3ICTA 4Z2UA 1KNRA 1BGNA 1CJCA 3M12A 2GV8A 3NYCA 1GERA 2OALA 3ZDNA 1N1PA 3F8DA 1C0PA 4FK1A 1QLBA 1GESA 4G73A 5J60A 1NDAA 2BXSA 2QCUA 5KMRA 5KOXA 1XHCA 4Z2TA 2R0PA 2BK5A 3H8IA 4RG3A 3ZNOA 3LOVA 3K30A 1DJQA 3AYIA 4G9KA 3DK8A 1FOHA 3RP8A 5C2TA 4Y4NA 2GQFA 1PBEA 2YVFA 4USRA 1Y0PA 1NHSA 3AE4A 1IUUA 1ZOYA 4NTEA 2C3CA 3I6DA 4JY2A 4BK3A 4BV6A 4YSYA 1KIFA 3CN8A 5KOWA 4EMWA 4YTPA 4CNJA 1H83A 3GWFA 4A6NA 4CCQA 2WDRA 2YVGA 3HYVA 2A8XA 1E6EA 1IUXA 2FJAA 2YG6A 3ADAB 4A5LA 2EQ6A 3CNTA 1GT8A 4C5OA 3RP6A 3ISHA 3URHA 4A99A 4B67A 4J36A 2C65A 3NNEA 1CF3A 1TDKA 4B1BA 4C77A 1PN0A 1H82A 4ICYA 4OPDA 3AEAA 4HB9A 4YKGA 1PXAA 2ZZCA 3BNMA 4ZCDA 2BC1A 2BYBA 4EM3A 1DDOA 1D4DA 3P4SA 4NNJA 3VRDB 2WOWA 1CJ3A 3IC9A 3AE3A 2R4JA 3S5WA 1VRQB 1BZLA 2YG7A 3AEDA 1MXTA 2WDQA 2WP6A 3ITJA 2C67A 3NLCA 3SX6A 3BI5A 1NAAA 4JY3A 3GRTA 2EQ7A 4B66A 3OZ2A 2V5ZA 2YQUA 1RYIA 1S3BA 2YM1A 4U2TA 4EM4A 5KMSA 1CBOA 2YLWA 3CGDA 3VRBA 2VVLA 3VR8A 4EIQA 2BCPA 2YWLA 3BNUA 5KWFA 3QFAA 4GAVA 2GR0A 2CULA 3AYJA 2BS3A 4H4ZA 3ZNNA 4G6HA 1NG4A 2V61A 5EB5A 1PBCA 1GRAA 1PBFA 2C72A 1ZMCA 2O9ZA 2VQ7A 4H4WA 3UKFA 2CDUA 2WOVA 2AR8A 3LXDA 4FX9A 3UP5A 4H4PA 2R9ZA 1V59A 4I59A 4H4RA 2DU8A 5LV9A 2BCGG 2VOUA 2QA2A 3KLJA 1H86A 4IVMB 5FMHA 1JNZA 1N4VA 3H4KA 3UTGA 2GRTA 3NIXA 5JCKA 1VE9A 1F8RA 3CPIG 4JDRA 2Z5XA 3T2KA 3NKSA 2RGOA 3UKHA 5KNLA 4YT0A 3LADA 1M6IA 3QFBA 4H4YA 4YTNA 4GUVA 5U63A 5KMQA 4EQWA 1GRBA 1DODA 2C64A 3PVCA 3S61A 4GF7A 2VQBA 4A7AA 3HYWA 1EL8A 4ZN0A 3ALLA 2C73A 4XXGA 4P9SA 2I0ZA 2FBWA 1JRZA 1CJ2A 3M0OA 5U25A 1EBDA 1EVIA 4GAPA 4NTDA 3ZNPA 4ZCCA 4G6GA 3CIRA 4A6NB 2YR6A 3BI2A 4ECHA 1O95A 3AE2A 4H50A 2B76A 2BABA 2GB0A 4TM4A 1LPFA 3SZWA 4CBQA 3VR9A 1IUVA 1NPXA 5ER0A 4II3A
chains in the Genus database with same CATH topology
1PS9A 2BK3A 1LQTA 3DH9A 1C0KA 4EIPA 5JCMA 1O5WA 3B3RA 4C3XA 2ZBWA 1W4XA 1UKVG 2QAEA 1XPQA 4H4TA 1NEKA 2OLOA 3UTEA 1B37A 3R9UA 3GYIA 4J34A 3DGHA 4Y4LA 3EANA 1KNPA 3EF6A 4IA6A 1AN9A 2VZ2A 2WEUA 4NTCA 3ZYXA 4DSHA 3UTHA 3NYEA 2Y6RA 2YR4A 3IHGA 4OVIA 5FS7A 3GYXA 2GMJA 1DXLA 1IJHA 2JB1A 1CL0A 1JEHA 1N4UA 2XVFA 1GALA 3AD8B 4H4UA 4UDQA 3AEGA 1F6MA 2ACZA 3NG7X 4O5UA 1K0LA 4D03A 3BHKA 1FECA 1TDNA 1D7LA 2XVJA 4DNAA 3DA1A 3AE9A 1JOAA 1VDCA 2V3AA 4J33A 4X4JA 2XFQA 2GH5A 1GSNA 3GD3A 1PDHA 5L46A 4X9MA 3UP4A 4YSHA 4M52A 4B69A 1P2EA 2BS4A 2H88A 2E4GA 1LJ1A 4NEWA 1YY5A 4OPCA 4REKA 5HY5A 4Z24A 3SZFA 3CGBA 3G5RA 4U8PA 3FMWA 2BK4A 3W4KA 1CC6A 4QFDA 1P2HA 1XDIA 2XFUA 2YLTA 4H4XA 4IA5A 4JNQA 3FIMB 5EBKA 3T0KA 2OLNA 2JB3A 3UOVA 1FEBA 2XVIA 3AEFA 4TM1A 4JN9A 1FEAA 2ARDA 1E39A 4GDPA 4YTMA 2R4EA 1ZMDA 4H2PA 1PXBA 3KA7A 3V3OA 4DSGA 1K0JA 2VVMA 4CRTA 2GR2A 3NK1X 4OPTA 3VRAA 5KMPA 1H6VA 1GNDA 3PO7A 3SQPA 5IPYA 3II4A 4GDEA 2OA1A 1NHRA 3EAOA 4BK1A 2JBVA 2W0HA 3ICRA 1EL5A 3NRNA 4A9WA 4D04A 3NN0X 3SZ0A 4U8NA 5U1OA 3T14A 5HHFA 2R45A 1DNCA 1B4VA 1S2YA 3UKPA 3NH3X 1LV0A 1H7WA 2RGJA 3QJ4A 3DJGX 2WPEA 4E0VA 2JK6A 3HYXA 3M13A 1GRGA 1Q9IA 3KPFA 4B64A 2J3NA 4UP3A 4LU6A 4NZHA 1JRYA 2F5ZA 3CNDA 2YLRA 1ZK7A 1E1NA 2CVJA 2IVDA 4C74A 3G3EA 1D4EA 4YKFA 4H4SA 1FL2A 1TDFA 4U8MA 3UKQA 5M10A 2X50A 2YLXA 4OPGA 4H4QA 4FK1C 2C70A 5GSNA 2FJBA 3AEEA 3SM8A 2DKIA 1MO9A 4AOSA 1JRXA 1VQWA 1OJDA 3ABVA 2XLSA 3GMCA 5KRQA 1LTXR 1SEZA 2GAHB 4YWOA 3ALJA 2Q0KA 3D8XA 4U8OA 1K4QA 3SZCA 4UDPA 1NENA 3GYJA 1BGJA 2FJDA 5KVIA 1TRBA 4TLXA 4RSLA 2B7RA 3CNPA 2E82A 2WOIA 4GRTA 1DAOA 1X31B 2IVEA 4LIIA 3PS9A 4YJHB 3CNSA 3G5QA 2EQ9A 2YG3A 2Q6UA 1M64A 3EPTA 4J56A 1GTEA 1YQ3A 4Z25A 1K0IA 1H84A 4CCRA 3DMEA 3LZXA 3UKLA 1PJ6A 1E1KA 1YQ4A 3P4PA 3H8LA 4GCMA 3GDNA 2YLSA 4YSZA 1KSSA 4Z26A 5IQ1A 3DJJA 1S2QA 3CGCA 1GRTA 2BA9A 1GREA 2XLUA 4G74A 4Z2RA 3AB1A 1Y56B 2UZZA 1Q1WA 3GMBA 5J7XA 5CKUA 5FS6A 1ZP0A 3AXBA 2WETA 4KX6A 1CC4A 3GWDA 4NEVA 2WBAA 2XYOA 2JKCA 3O0HA 3Q9TA 1E7PA 2V6OA 4YXDA 3GRSA 3UTFA 3F8PA 4B63A 1H7XA 3OC4A 4TM0A 4EMJA 5JCLA 3T2YA 4AT2A 5KVHA 1IUWA 3NTDA 1CC2A 2BS2A 1F3PA 2R0CA 2X8GA 1DOBA 2B9WA 2NVKX 2Q7VA 1KDGA 2E4AA 1C0IA 1FCDA 3CPJG 2GF3A 3LB8A 2C76A 2DKHA 3AEBA 4PABA 3JSKA 2WU5A 3VQRA 3Q6JA 4K5RA 4XWZA 4MJWA 1N4WA 2C4CA 4FDCB 4OCGA 3SY4A 5BVAA 4NWZA 3SXIA 1RP0A 2VVLG 2XVHA 1PBBA 4BJYA 1L9DA 3RNMA 1GOSA 4GR1A 2WP5A 4B65A 2PHHA 2RABA 3AYLA 3NK2X 3KD9A 3FG2P 1OJTA 2E5VA 4A79A 4AP1A 1OJAA 2AAQA 1TDEA 2WESA 4YJHA 2GR3A 3K7TA 4H2NA 4Y4MA 2XLTA 1TYTA 3FBSA 4RG4A 1JNRA 4YJDA 1Z6LA 4HA6A 5HYMA 3L1RA 4I58A 3K7QX 3W4JA 2B7SA 1C0LA 1DOCA 1E1MA 2VRMA 3CNJA 4QFCA 3NGCX 4YJGB 2GMHA 3KVEA 2WPCA 5C3JA 3ATRA 2E1MA 4H7UA 1ZKQA 1IUSA 3AD9B 3GDPA 4U8LA 3NHOX 5EB4A 4EQXA 1VG9A 2ZZ0A 3AE6A 4J2WA 4UDRA 4CY6A 2C75A 3IF9A 2B9XA 5IQ4A 1ZX9A 1ZOVA 1Y56A 2YG4A 3RP7A 4A65A 3RHAA 5FS8A 1GV4A 2BC0A 3WGTA 1GPEA 2A89A 2BXRA 1RSGA 1S3EA 4K22A 1GTHA 2A87A 2C7GA 2GVCA 3QVPA 2WQYA 4K2XA 3UOYA 3DJDA 1DJNA 3ATQA 4KPRA 4Z44A 1PJ7A 4JNAA 2C3DA 2XFOA 3FPZA 1BF3A 4H2RA 5JCIA 3G5SA 5HXIA 3BHFA 3BI4A 3REDA 5CQFA 1O94A 2CFYA 2AQJA 2WU2A 4K5SA 1GXFA 3E1TA 4BURA 1PBDA 2RGHA 5FS9A 1F8SA 5JCNA 4B68A 3C4NA 2APGA 1H81A 3SFEA 2ZZBA 4N9XA 3CGEA 3NYFA 4EQSA 5KXJA 3T31A 1NHPA 3L8KA 4APNA 1GRHA 3C4AA 2WP9A 3C96A 3CPHG 2TMDA 3GD4A 3AD7B 3DGZA 3NK0X 4J57A 3HZLA 4H2QA 4K8DA 4OPLA 3IHMA 4K7ZA 2GAGB 1KSUA 4JQ9A 1L0VA 1OJ9A 4X9NA 3I3LA 2XCGA 4C3YA 2E48A 4DGKA 4YJFB 3UOZA 4U2LA 5TR3A 4YJGA 1GRFA 1ONFA 2WS3A 4O5QA 1EL9A 1BWCA 3DJEA 4XWRA 3IWAA 1CJ4A 3ZNQA 1XANA 3QSMA 1NHQA 1ZY8A 2WDVA 3WE0A 3KU9A 1L9EA 1VG0A 4IVOB 2FJEA 4H4VA 3F8RA 3QSEA 5BULA 2HQMA 3CMMA 3AE1A 3QSSA 2JB2A 2GQWA 4ADWA 4Z43A 3AE7A 3AECA 3ALMA 4YSXA 3T2ZA 4TM3A 2H89A 2X8HA 1CHUA 2X3NA 2XFPA 4USQA 1PHHA 5DBJA 1L9CA 3B6DA 1ELIA 1NG3A 2YM2A 4WCTA 3DK9A 4EMIA 2XLRA 1B8SA 2YLZA 2Z5YA 3P4RA 3P9UA 4BK2A 1ZDLA 1PXCA 2X8CA 2TPRA 3GSIA 2BACA 2V3BA 1JU2A 4PAAA 5BRTA 3QVRA 4AOXA 3LJPA 3P4QA 3DK4A 2WHDA 3T37A 2Q0LA 1Q1RA 1YKJA 1LQUA 1YQZA 4II2A 3SFDA 3V76A 2YAUA 2IIDA 4AP3A 2PYXA 1AOGA 2OAMA 1DOEA 1E1LA 4AT0A 3CTYA 1TDOA 1F8WA 1IUTA 2X99A 2B9YA 1REOA 3D1CA 3UKKA 1KFYA 2XLPA 4IV9A 5EOWA 4U8KA 4CNKA 3CUKA 2BRYA 4WX1A 1COYA 1D4CA 4U2SA 1GEUA 4YJFA 2QA1A 3UKAA 2C66A 1QO8A 1BKWA 1HYUA 4TLZA 3W4IA 2R46A 1PJ5A 3ICSA 1QJDA 3NTAA 1EL7A 1D5TA 3COXA 1KF6A 5M0ZA 1TYPA 2XFNA 2JAEA 2XDOA 3SYIA 2YR5A 3UCLA 2NPXA 3SGLA 2GEWA 2YVJA 2WPFA 2V60A 2EQ8A 1D7YA 3V3NA 3LZWA 3K7MX 4BJZA 5BUKA 5GRTA 4EQRA 3NN6X 3AE8A 4LA1A 2BRAA 1B5QA 3KKJA 3KPKA 2VRLA 4U8JA 1LVLA 4U8IA 2GR1A 4CY8A 1MOKA 3P1WA 4OPUA 3NT6A 2E49A 2Y6QA 1GETA 1OJCA 3AWIA 2XVEA 2R0GA 3AE5A 2YG5A 4OPIA 3UOXA 4J31A 3ICTA 4Z2UA 1KNRA 1BGNA 1CJCA 3M12A 2GV8A 3NYCA 1GERA 2OALA 3ZDNA 1N1PA 3F8DA 1C0PA 4FK1A 1QLBA 1GESA 4G73A 5J60A 1NDAA 2BXSA 2QCUA 5KMRA 5KOXA 1XHCA 4Z2TA 2BK5A 2R0PA 3H8IA 4RG3A 3ZNOA 3LOVA 3K30A 1DJQA 3AYIA 4G9KA 3DK8A 1FOHA 3RP8A 5C2TA 4Y4NA 2GQFA 1PBEA 2YVFA 4USRA 1Y0PA 1NHSA 3AE4A 1IUUA 1ZOYA 4NTEA 2C3CA 3I6DA 4JY2A 4BK3A 4BV6A 4YSYA 1KIFA 3CN8A 5KOWA 4EMWA 4YTPA 4CNJA 1H83A 3GWFA 4A6NA 4CCQA 2WDRA 2YVGA 3HYVA 2A8XA 1E6EA 1IUXA 2FJAA 2YG6A 3ADAB 4A5LA 2EQ6A 3CNTA 1GT8A 4C5OA 3RP6A 3ISHA 3URHA 4A99A 4B67A 4J36A 2C65A 3NNEA 1CF3A 1TDKA 4B1BA 4C77A 1PN0A 1H82A 4ICYA 4OPDA 3AEAA 4HB9A 4YKGA 1PXAA 2ZZCA 3BNMA 4ZCDA 2BC1A 2BYBA 4EM3A 1DDOA 1D4DA 3P4SA 4NNJA 3VRDB 2WOWA 1CJ3A 3IC9A 3AE3A 2R4JA 3S5WA 1VRQB 1BZLA 2YG7A 3AEDA 1MXTA 2WDQA 2WP6A 3ITJA 2C67A 3NLCA 3SX6A 3BI5A 1NAAA 4JY3A 3GRTA 2EQ7A 4B66A 3OZ2A 2V5ZA 2YQUA 1RYIA 1S3BA 2YM1A 4U2TA 4EM4A 5KMSA 1CBOA 2YLWA 3CGDA 3VRBA 2VVLA 3VR8A 4EIQA 2BCPA 2YWLA 3BNUA 5KWFA 3QFAA 4GAVA 2GR0A 2CULA 3AYJA 2BS3A 4H4ZA 3ZNNA 4G6HA 1NG4A 2V61A 5EB5A 1PBCA 1GRAA 1PBFA 2C72A 1ZMCA 2O9ZA 2VQ7A 4H4WA 3UKFA 2CDUA 2WOVA 2AR8A 3LXDA 4FX9A 3UP5A 4H4PA 2R9ZA 1V59A 4I59A 4H4RA 2DU8A 5LV9A 2BCGG 2QA2A 2VOUA 3KLJA 1H86A 4IVMB 5FMHA 1JNZA 1N4VA 3H4KA 3UTGA 2GRTA 3NIXA 5JCKA 1VE9A 1F8RA 3CPIG 4JDRA 2Z5XA 3T2KA 3NKSA 2RGOA 3UKHA 5KNLA 4YT0A 3LADA 1M6IA 3QFBA 4H4YA 4YTNA 4GUVA 5U63A 5KMQA 4EQWA 1GRBA 1DODA 2C64A 3PVCA 3S61A 2VQBA 4GF7A 4A7AA 3HYWA 1EL8A 4ZN0A 2C73A 3ALLA 4XXGA 4P9SA 2I0ZA 2FBWA 1JRZA 1CJ2A 3M0OA 5U25A 1EBDA 1EVIA 4GAPA 4NTDA 3ZNPA 4ZCCA 4G6GA 3CIRA 4A6NB 2YR6A 3BI2A 4ECHA 1O95A 3AE2A 4H50A 2B76A 2BABA 2GB0A 4TM4A 1LPFA 3SZWA 4CBQA 3VR9A 1IUVA 1NPXA 5ER0A 4II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PS9 A;  2BK3 A;  1LQT A;  3DH9 A;  1C0K A;  4EIP A;  5JCM A;  1O5W A;  3B3R A;  4C3X A;  2ZBW A;  1W4X A;  1UKV G;  2QAE A;  1XPQ A;  4H4T A;  1NEK A;  2OLO A;  3UTE A;  1B37 A;  3R9U A;  3GYI A;  4J34 A;  3DGH A;  4Y4L A;  3EAN A;  1KNP A;  3EF6 A;  4IA6 A;  1AN9 A;  2VZ2 A;  2WEU A;  4NTC A;  3ZYX A;  4DSH A;  3UTH A;  3NYE A;  2Y6R A;  2YR4 A;  3IHG A;  4OVI A;  5FS7 A;  2GMJ A;  1DXL A;  1IJH A;  2JB1 A;  1CL0 A;  1JEH A;  1N4U A;  2XVF A;  1GAL A;  3AD8 B;  4H4U A;  4UDQ A;  3AEG A;  1F6M A;  2ACZ A;  3NG7 X;  4O5U A;  1K0L A;  4D03 A;  3BHK A;  1FEC A;  1TDN A;  1D7L A;  2XVJ A;  4DNA A;  3DA1 A;  3AE9 A;  1JOA A;  1VDC A;  2V3A A;  4J33 A;  4X4J A;  2XFQ A;  2GH5 A;  1GSN A;  3GD3 A;  1PDH A;  5L46 A;  4X9M A;  3UP4 A;  4YSH A;  4M52 A;  4B69 A;  1P2E A;  2BS4 A;  2H88 A;  2E4G A;  1LJ1 A;  4NEW A;  1YY5 A;  4OPC A;  4REK A;  5HY5 A;  4Z24 A;  3CGB A;  3G5R A;  4U8P A;  3FMW A;  2BK4 A;  3W4K A;  1CC6 A;  4QFD A;  1P2H A;  1XDI A;  2XFU A;  2YLT A;  4H4X A;  4IA5 A;  4JNQ A;  3FIM B;  5EBK A;  2OLN A;  2JB3 A;  3UOV A;  1FEB A;  2XVI A;  3AEF A;  4TM1 A;  4JN9 A;  1FEA A;  2ARD A;  1E39 A;  4GDP A;  4YTM A;  2R4E A;  1ZMD A;  4H2P A;  1PXB A;  3KA7 A;  3V3O A;  4DSG A;  1K0J A;  2VVM A;  4CRT A;  2GR2 A;  3NK1 X;  4OPT A;  3VRA A;  1H6V A;  1GND A;  3PO7 A;  3SQP A;  5IPY A;  3II4 A;  4GDE A;  2OA1 A;  1NHR A;  3EAO A;  4BK1 A;  2JBV A;  2W0H A;  3ICR A;  1EL5 A;  3NRN A;  4A9W A;  4D04 A;  3NN0 X;  4U8N A;  5U1O A;  5HHF A;  2R45 A;  1DNC A;  1B4V A;  1S2Y A;  3UKP A;  3NH3 X;  1LV0 A;  1H7W A;  2RGJ A;  3QJ4 A;  3DJG X;  2WPE A;  4E0V A;  2JK6 A;  3M13 A;  1GRG A;  1Q9I A;  3KPF A;  4B64 A;  2J3N A;  4UP3 A;  4LU6 A;  4NZH A;  1JRY A;  2F5Z A;  3CND A;  2YLR A;  1ZK7 A;  1E1N A;  2CVJ A;  2IVD A;  4C74 A;  3G3E A;  1D4E A;  4YKF A;  4H4S A;  1FL2 A;  1TDF A;  4U8M A;  3UKQ A;  5M10 A;  2X50 A;  2YLX A;  4OPG A;  4H4Q A;  4FK1 C;  2C70 A;  5GSN A;  2FJB A;  3AEE A;  3SM8 A;  2DKI A;  1MO9 A;  4AOS A;  1JRX A;  1VQW A;  1OJD A;  3ABV A;  2XLS A;  3GMC A;  5KRQ A;  1LTX R;  1SEZ A;  2GAH B;  4YWO A;  3ALJ A;  2Q0K A;  3D8X A;  4U8O A;  1K4Q A;  4UDP A;  1NEN A;  3GYJ A;  1BGJ A;  2FJD A;  5KVI A;  1TRB A;  4TLX A;  4RSL A;  2B7R A;  3CNP A;  2E82 A;  2WOI A;  4GRT A;  1DAO A;  1X31 B;  2IVE A;  4LII A;  3PS9 A;  4YJH B;  3CNS A;  3G5Q A;  2EQ9 A;  2YG3 A;  2Q6U A;  1M64 A;  3EPT A;  4J56 A;  1GTE A;  1YQ3 A;  4Z25 A;  1K0I A;  1H84 A;  4CCR A;  3DME A;  3LZX A;  3UKL A;  1PJ6 A;  1E1K A;  1YQ4 A;  3P4P A;  3H8L A;  4GCM A;  3GDN A;  2YLS A;  4YSZ A;  1KSS A;  4Z26 A;  5IQ1 A;  3DJJ A;  1S2Q A;  3CGC A;  1GRT A;  2BA9 A;  1GRE A;  2XLU A;  4Z2R A;  3AB1 A;  1Y56 B;  2UZZ A;  1Q1W A;  3GMB A;  5J7X A;  5CKU A;  5FS6 A;  1ZP0 A;  3AXB A;  2WET A;  4KX6 A;  1CC4 A;  3GWD A;  4NEV A;  2WBA A;  2XYO A;  2JKC A;  3O0H A;  3Q9T A;  1E7P A;  2V6O A;  4YXD A;  3GRS A;  3UTF A;  3F8P A;  4B63 A;  1H7X A;  3OC4 A;  4TM0 A;  4EMJ A;  5JCL A;  4AT2 A;  5KVH A;  1IUW A;  3NTD A;  1CC2 A;  2BS2 A;  1F3P A;  2R0C A;  2X8G A;  1DOB A;  2B9W A;  2NVK X;  2Q7V A;  1KDG A;  2E4A A;  1C0I A;  1FCD A;  3CPJ G;  2GF3 A;  3LB8 A;  2C76 A;  2DKH A;  3AEB A;  4PAB A;  3JSK A;  2WU5 A;  3VQR A;  3Q6J A;  4K5R A;  4XWZ A;  4MJW A;  1N4W A;  4FDC B;  4OCG A;  5BVA A;  1RP0 A;  2VVL G;  2XVH A;  1PBB A;  4BJY A;  1L9D A;  3RNM A;  1GOS A;  4GR1 A;  2WP5 A;  4B65 A;  2PHH A;  2RAB A;  3AYL A;  3NK2 X;  3KD9 A;  3FG2 P;  1OJT A;  2E5V A;  4A79 A;  4AP1 A;  1OJA A;  2AAQ A;  1TDE A;  2WES A;  4YJH A;  2GR3 A;  3K7T A;  4H2N A;  4Y4M A;  2XLT A;  1TYT A;  3FBS A;  4RG4 A;  1JNR A;  4YJD A;  1Z6L A;  4HA6 A;  5HYM A;  3L1R A;  4I58 A;  3K7Q X;  3W4J A;  2B7S A;  1C0L A;  1DOC A;  1E1M A;  2VRM A;  3CNJ A;  4QFC A;  3NGC X;  4YJG B;  2GMH A;  3KVE A;  2WPC A;  5C3J A;  3ATR A;  2E1M A;  4H7U A;  1ZKQ A;  1IUS A;  3AD9 B;  3GDP A;  4U8L A;  3NHO X;  5EB4 A;  4EQX A;  1VG9 A;  2ZZ0 A;  3AE6 A;  4J2W A;  4UDR A;  4CY6 A;  2C75 A;  3IF9 A;  2B9X A;  5IQ4 A;  1ZX9 A;  1ZOV A;  1Y56 A;  2YG4 A;  3RP7 A;  4A65 A;  3RHA A;  5FS8 A;  1GV4 A;  2BC0 A;  3WGT A;  1GPE A;  2A89 A;  2BXR A;  1RSG A;  1S3E A;  4K22 A;  1GTH A;  2A87 A;  2C7G A;  2GVC A;  3QVP A;  2WQY A;  4K2X A;  3UOY A;  3DJD A;  1DJN A;  3ATQ A;  4KPR A;  4Z44 A;  1PJ7 A;  4JNA A;  2C3D A;  2XFO A;  3FPZ A;  1BF3 A;  4H2R A;  5JCI A;  3G5S A;  5HXI A;  3BHF A;  3BI4 A;  3RED A;  5CQF A;  1O94 A;  2CFY A;  2AQJ A;  2WU2 A;  4K5S A;  1GXF A;  3E1T A;  4BUR A;  1PBD A;  2RGH A;  5FS9 A;  1F8S A;  5JCN A;  4B68 A;  3C4N A;  2APG A;  1H81 A;  3SFE A;  2ZZB A;  4N9X A;  3CGE A;  3NYF A;  4EQS A;  5KXJ A;  1NHP A;  3L8K A;  4APN A;  1GRH A;  3C4A A;  2WP9 A;  3C96 A;  3CPH G;  2TMD A;  3GD4 A;  3AD7 B;  3DGZ A;  3NK0 X;  4J57 A;  3HZL A;  4H2Q A;  4K8D A;  4OPL A;  3IHM A;  4K7Z A;  2GAG B;  1KSU A;  4JQ9 A;  1L0V A;  1OJ9 A;  4X9N A;  3I3L A;  2XCG A;  4C3Y A;  2E48 A;  4DGK A;  4YJF B;  3UOZ A;  4U2L A;  5TR3 A;  4YJG A;  1GRF A;  1ONF A;  2WS3 A;  4O5Q A;  1EL9 A;  1BWC A;  3DJE A;  4XWR A;  3IWA A;  1CJ4 A;  3ZNQ A;  1XAN A;  3QSM A;  1NHQ A;  1ZY8 A;  2WDV A;  3WE0 A;  3KU9 A;  1L9E A;  1VG0 A;  4IVO B;  2FJE A;  4H4V A;  3F8R A;  3QSE A;  5BUL A;  2HQM A;  3AE1 A;  3QSS A;  2JB2 A;  2GQW A;  4ADW A;  4Z43 A;  3AE7 A;  3AEC A;  3ALM A;  4YSX A;  4TM3 A;  2H89 A;  2X8H A;  1CHU A;  2X3N A;  2XFP A;  4USQ A;  1PHH A;  5DBJ A;  1L9C A;  3B6D A;  1ELI A;  1NG3 A;  2YM2 A;  4WCT A;  3DK9 A;  4EMI A;  2XLR A;  1B8S A;  2YLZ A;  2Z5Y A;  3P4R A;  3P9U A;  4BK2 A;  1ZDL A;  1PXC A;  2X8C A;  2TPR A;  3GSI A;  2BAC A;  2V3B A;  1JU2 A;  4PAA A;  5BRT A;  3QVR A;  4AOX A;  3LJP A;  3P4Q A;  3DK4 A;  2WHD A;  3T37 A;  2Q0L A;  1Q1R A;  1YKJ A;  1LQU A;  1YQZ A;  3V76 A;  3SFD A;  2YAU A;  2IID A;  4AP3 A;  2PYX A;  1AOG A;  2OAM A;  1DOE A;  1E1L A;  4AT0 A;  3CTY A;  1TDO A;  1F8W A;  1IUT A;  2X99 A;  2B9Y A;  1REO A;  3D1C A;  3UKK A;  1KFY A;  2XLP A;  4IV9 A;  5EOW A;  4U8K A;  4CNK A;  3CUK A;  4WX1 A;  1COY A;  1D4C A;  4U2S A;  1GEU A;  4YJF A;  2QA1 A;  3UKA A;  2C66 A;  1QO8 A;  1BKW A;  1HYU A;  4TLZ A;  3W4I A;  2R46 A;  1PJ5 A;  3ICS A;  1QJD A;  3NTA A;  1EL7 A;  1D5T A;  3COX A;  1KF6 A;  5M0Z A;  1TYP A;  2XFN A;  2JAE A;  2XDO A;  2YR5 A;  3UCL A;  2NPX A;  3SGL A;  2GEW A;  2YVJ A;  2WPF A;  2V60 A;  2EQ8 A;  1D7Y A;  3V3N A;  3LZW A;  3K7M X;  4BJZ A;  5BUK A;  5GRT A;  4EQR A;  3NN6 X;  3AE8 A;  4LA1 A;  1B5Q A;  3KKJ A;  2VRL A;  4U8J A;  1LVL A;  4U8I A;  2GR1 A;  4CY8 A;  1MOK A;  3P1W A;  4OPU A;  3NT6 A;  2E49 A;  2Y6Q A;  1GET A;  1OJC A;  3AWI A;  2XVE A;  2R0G A;  3AE5 A;  2YG5 A;  4OPI A;  3UOX A;  4J31 A;  3ICT A;  4Z2U A;  1KNR A;  1BGN A;  1CJC A;  3M12 A;  2GV8 A;  3NYC A;  1GER A;  2OAL A;  3ZDN A;  1N1P A;  3F8D A;  1C0P A;  4FK1 A;  1QLB A;  1GES A;  5J60 A;  1NDA A;  2BXS A;  2QCU A;  5KOX A;  1XHC A;  4Z2T A;  2BK5 A;  2R0P A;  3H8I A;  4RG3 A;  3ZNO A;  3LOV A;  3K30 A;  1DJQ A;  3AYI A;  3DK8 A;  1FOH A;  3RP8 A;  5C2T A;  4Y4N A;  2GQF A;  1PBE A;  2YVF A;  4USR A;  1Y0P A;  1NHS A;  3AE4 A;  1IUU A;  1ZOY A;  4NTE A;  2C3C A;  3I6D A;  4JY2 A;  4BK3 A;  4BV6 A;  4YSY A;  1KIF A;  3CN8 A;  5KOW A;  4EMW A;  4YTP A;  4CNJ A;  1H83 A;  3GWF A;  4A6N A;  4CCQ A;  2WDR A;  2YVG A;  2A8X A;  1E6E A;  1IUX A;  2FJA A;  2YG6 A;  3ADA B;  4A5L A;  2EQ6 A;  3CNT A;  1GT8 A;  4C5O A;  3RP6 A;  3ISH A;  3URH A;  4A99 A;  4B67 A;  4J36 A;  2C65 A;  3NNE A;  1CF3 A;  1TDK A;  4B1B A;  4C77 A;  1PN0 A;  1H82 A;  4ICY A;  4OPD A;  3AEA A;  4HB9 A;  4YKG A;  1PXA A;  2ZZC A;  3BNM A;  4ZCD A;  2BC1 A;  2BYB A;  4EM3 A;  1DDO A;  1D4D A;  3P4S A;  3VRD B;  2WOW A;  1CJ3 A;  3IC9 A;  3AE3 A;  2R4J A;  3S5W A;  1VRQ B;  1BZL A;  2YG7 A;  3AED A;  1MXT A;  2WDQ A;  2WP6 A;  3ITJ A;  2C67 A;  3NLC A;  3BI5 A;  1NAA A;  4JY3 A;  3GRT A;  2EQ7 A;  4B66 A;  3OZ2 A;  2V5Z A;  2YQU A;  1RYI A;  1S3B A;  2YM1 A;  4U2T A;  4EM4 A;  1CBO A;  2YLW A;  3CGD A;  3VRB A;  2VVL A;  3VR8 A;  4EIQ A;  2BCP A;  2YWL A;  3BNU A;  5KWF A;  3QFA A;  2GR0 A;  2CUL A;  3AYJ A;  2BS3 A;  4H4Z A;  3ZNN A;  1NG4 A;  2V61 A;  5EB5 A;  1PBC A;  1GRA A;  1PBF A;  2C72 A;  1ZMC A;  2O9Z A;  2VQ7 A;  4H4W A;  3UKF A;  2CDU A;  2WOV A;  2AR8 A;  3LXD A;  4FX9 A;  3UP5 A;  4H4P A;  2R9Z A;  1V59 A;  4I59 A;  4H4R A;  2DU8 A;  5LV9 A;  2BCG G;  2QA2 A;  2VOU A;  3KLJ A;  1H86 A;  4IVM B;  5FMH A;  1JNZ A;  1N4V A;  3H4K A;  3UTG A;  2GRT A;  3NIX A;  5JCK A;  1VE9 A;  1F8R A;  3CPI G;  4JDR A;  2Z5X A;  3UKH A;  3NKS A;  2RGO A;  4YT0 A;  3LAD A;  1M6I A;  3QFB A;  4H4Y A;  4YTN A;  4GUV A;  5U63 A;  4EQW A;  1GRB A;  1DOD A;  2C64 A;  3PVC A;  3S61 A;  2VQB A;  4GF7 A;  4A7A A;  1EL8 A;  4ZN0 A;  2C73 A;  3ALL A;  4XXG A;  4P9S A;  2I0Z A;  2FBW A;  1JRZ A;  1CJ2 A;  3M0O A;  5U25 A;  1EBD A;  1EVI A;  4NTD A;  3ZNP A;  4ZCC A;  3CIR A;  4A6N B;  2YR6 A;  3BI2 A;  4ECH A;  1O95 A;  3AE2 A;  4H50 A;  2B76 A;  2BAB A;  2GB0 A;  4TM4 A;  1LPF A;  4CBQ A;  3VR9 A;  1IUV A;  1NPX A;  5ER0 A; 
#chains in the Genus database with same CATH topology
 1PS9 A;  4EIP A;  1LQT A;  2BK3 A;  1C0K A;  3DH9 A;  5JCM A;  1O5W A;  3B3R A;  4C3X A;  2ZBW A;  1W4X A;  1UKV G;  2QAE A;  1XPQ A;  4H4T A;  1NEK A;  2OLO A;  3UTE A;  1B37 A;  3R9U A;  3GYI A;  4J34 A;  3DGH A;  4Y4L A;  3EAN A;  1KNP A;  4IA6 A;  3EF6 A;  1AN9 A;  2VZ2 A;  2WEU A;  4NTC A;  3ZYX A;  4DSH A;  3UTH A;  3NYE A;  2Y6R A;  2YR4 A;  3IHG A;  4OVI A;  5FS7 A;  3GYX A;  2GMJ A;  1DXL A;  1IJH A;  2JB1 A;  1CL0 A;  1JEH A;  1N4U A;  2XVF A;  1GAL A;  3AD8 B;  4H4U A;  4UDQ A;  3AEG A;  1F6M A;  2ACZ A;  3NG7 X;  4O5U A;  1K0L A;  4D03 A;  3BHK A;  1FEC A;  1TDN A;  1D7L A;  2XVJ A;  4DNA A;  3DA1 A;  3AE9 A;  1JOA A;  1VDC A;  2V3A A;  4J33 A;  4X4J A;  2XFQ A;  2GH5 A;  1GSN A;  3GD3 A;  1PDH A;  5L46 A;  4X9M A;  3UP4 A;  4YSH A;  4M52 A;  4B69 A;  1P2E A;  2BS4 A;  2H88 A;  2E4G A;  1LJ1 A;  4NEW A;  1YY5 A;  4OPC A;  4REK A;  5HY5 A;  4Z24 A;  3SZF A;  3CGB A;  3G5R A;  4U8P A;  3FMW A;  2BK4 A;  4IA5 A;  1CC6 A;  4QFD A;  3W4K A;  1P2H A;  1XDI A;  2XFU A;  2YLT A;  4H4X A;  4JNQ A;  3FIM B;  5EBK A;  3T0K A;  2OLN A;  2JB3 A;  3UOV A;  1FEB A;  2XVI A;  3AEF A;  4TM1 A;  4JN9 A;  1FEA A;  2ARD A;  1E39 A;  4GDP A;  4YTM A;  2R4E A;  1ZMD A;  4H2P A;  1PXB A;  3KA7 A;  3V3O A;  4DSG A;  1K0J A;  2VVM A;  4CRT A;  2GR2 A;  3NK1 X;  4OPT A;  3VRA A;  5KMP A;  1H6V A;  1GND A;  3PO7 A;  3SQP A;  5IPY A;  3II4 A;  4GDE A;  2OA1 A;  4BK1 A;  1NHR A;  3EAO A;  2JBV A;  2W0H A;  3ICR A;  1EL5 A;  3NRN A;  4A9W A;  4D04 A;  3NN0 X;  3SZ0 A;  4U8N A;  5U1O A;  3T14 A;  5HHF A;  2R45 A;  1DNC A;  1B4V A;  1S2Y A;  3UKP A;  3NH3 X;  1LV0 A;  1H7W A;  2RGJ A;  3QJ4 A;  3DJG X;  2WPE A;  4E0V A;  2JK6 A;  3HYX A;  3M13 A;  1GRG A;  1Q9I A;  3KPF A;  4B64 A;  2J3N A;  4UP3 A;  4LU6 A;  3V3N A;  4NZH A;  1JRY A;  2F5Z A;  3CND A;  2YLR A;  1ZK7 A;  1E1N A;  2CVJ A;  2IVD A;  4C74 A;  3G3E A;  1D4E A;  4YKF A;  4H4S A;  1FL2 A;  1TDF A;  4U8M A;  3UKQ A;  5M10 A;  2X50 A;  2YLX A;  4OPG A;  4H4Q A;  4FK1 C;  2C70 A;  5GSN A;  2FJB A;  3AEE A;  3SM8 A;  2DKI A;  1MO9 A;  4AOS A;  1JRX A;  1VQW A;  1OJD A;  3GMC A;  2XLS A;  3ABV A;  5KRQ A;  1LTX R;  1SEZ A;  2GAH B;  4YWO A;  3ALJ A;  2Q0K A;  3D8X A;  4U8O A;  1K4Q A;  3SZC A;  4UDP A;  1NEN A;  3GYJ A;  1BGJ A;  2FJD A;  5KVI A;  1TRB A;  4TLX A;  4RSL A;  2B7R A;  3CNP A;  2E82 A;  2WOI A;  4GRT A;  1DAO A;  1X31 B;  2IVE A;  4LII A;  3PS9 A;  4YJH B;  3CNS A;  3G5Q A;  2EQ9 A;  2YG3 A;  2Q6U A;  3EPT A;  1M64 A;  4J56 A;  1GTE A;  1YQ3 A;  4Z25 A;  1K0I A;  1H84 A;  4CCR A;  3DME A;  3LZX A;  3UKL A;  1PJ6 A;  1E1K A;  1YQ4 A;  3P4P A;  3H8L A;  4GCM A;  3GDN A;  2YLS A;  4YSZ A;  1KSS A;  4Z26 A;  5IQ1 A;  3DJJ A;  1S2Q A;  3CGC A;  1GRT A;  2BA9 A;  1GRE A;  2XLU A;  4G74 A;  4Z2R A;  3AB1 A;  1Y56 B;  2UZZ A;  1Q1W A;  3GMB A;  5J7X A;  5CKU A;  5FS6 A;  1ZP0 A;  3AXB A;  2WET A;  4KX6 A;  1CC4 A;  3GWD A;  4NEV A;  2WBA A;  2XYO A;  2JKC A;  3O0H A;  3Q9T A;  1E7P A;  2V6O A;  4YXD A;  3GRS A;  3UTF A;  3F8P A;  4B63 A;  1H7X A;  3OC4 A;  4TM0 A;  4EMJ A;  5JCL A;  3T2Y A;  4AT2 A;  5KVH A;  1IUW A;  3NTD A;  1CC2 A;  2BS2 A;  1F3P A;  2R0C A;  2X8G A;  1DOB A;  2B9W A;  2NVK X;  2Q7V A;  1KDG A;  2E4A A;  1C0I A;  1FCD A;  3CPJ G;  2GF3 A;  3LB8 A;  2DKH A;  2C76 A;  3AEB A;  4PAB A;  3JSK A;  2WU5 A;  3VQR A;  3Q6J A;  4K5R A;  4XWZ A;  4MJW A;  1N4W A;  2C4C A;  4FDC B;  4OCG A;  3SY4 A;  5BVA A;  4NWZ A;  3SXI A;  1RP0 A;  2VVL G;  2XVH A;  1PBB A;  4BJY A;  1L9D A;  3RNM A;  1GOS A;  4GR1 A;  2WP5 A;  4B65 A;  2PHH A;  2RAB A;  3AYL A;  3NK2 X;  3KD9 A;  3FG2 P;  1OJT A;  2E5V A;  4A79 A;  4AP1 A;  1OJA A;  2AAQ A;  1TDE A;  2WES A;  4YJH A;  2GR3 A;  3K7T A;  4H2N A;  4Y4M A;  2XLT A;  1TYT A;  3FBS A;  4RG4 A;  5HYM A;  4YJD A;  1JNR A;  1Z6L A;  4HA6 A;  3L1R A;  4I58 A;  3K7Q X;  3W4J A;  2B7S A;  1C0L A;  1DOC A;  1E1M A;  2VRM A;  3CNJ A;  4QFC A;  3NGC X;  4YJG B;  2GMH A;  3KVE A;  2WPC A;  5C3J A;  3ATR A;  2E1M A;  4H7U A;  1ZKQ A;  1IUS A;  3AD9 B;  3GDP A;  4U8L A;  3NHO X;  5EB4 A;  4EQX A;  1VG9 A;  2ZZ0 A;  3AE6 A;  4J2W A;  4UDR A;  4CY6 A;  2C75 A;  3IF9 A;  2B9X A;  5IQ4 A;  1ZX9 A;  1ZOV A;  3RP7 A;  1Y56 A;  2YG4 A;  4A65 A;  3RHA A;  5FS8 A;  1GV4 A;  2BC0 A;  3WGT A;  1GPE A;  2A89 A;  2BXR A;  4K22 A;  1RSG A;  1S3E A;  1GTH A;  2A87 A;  2C7G A;  2GVC A;  3QVP A;  2WQY A;  4K2X A;  3UOY A;  3DJD A;  1DJN A;  3ATQ A;  4KPR A;  4Z44 A;  1PJ7 A;  4JNA A;  2C3D A;  2XFO A;  3FPZ A;  1BF3 A;  4H2R A;  5JCI A;  5HXI A;  3G5S A;  3BHF A;  3BI4 A;  3RED A;  5CQF A;  1O94 A;  2CFY A;  2AQJ A;  2WU2 A;  4K5S A;  1GXF A;  3E1T A;  4BUR A;  1PBD A;  2RGH A;  5FS9 A;  1F8S A;  5JCN A;  4B68 A;  3C4N A;  2APG A;  1H81 A;  3SFE A;  2ZZB A;  4N9X A;  3CGE A;  3NYF A;  4EQS A;  5KXJ A;  3T31 A;  1NHP A;  3L8K A;  4APN A;  3C4A A;  1GRH A;  2WP9 A;  3C96 A;  3CPH G;  2TMD A;  3GD4 A;  3AD7 B;  3DGZ A;  3NK0 X;  4J57 A;  4H2Q A;  3HZL A;  4K8D A;  4OPL A;  3IHM A;  4K7Z A;  2GAG B;  1KSU A;  4JQ9 A;  1L0V A;  1OJ9 A;  4X9N A;  3I3L A;  2XCG A;  4C3Y A;  2E48 A;  4DGK A;  4YJF B;  3UOZ A;  4U2L A;  5TR3 A;  4YJG A;  1GRF A;  1ONF A;  2WS3 A;  4O5Q A;  1EL9 A;  1BWC A;  3DJE A;  4XWR A;  3IWA A;  1CJ4 A;  3ZNQ A;  1XAN A;  3QSM A;  1NHQ A;  1ZY8 A;  2WDV A;  3WE0 A;  3KU9 A;  1L9E A;  1VG0 A;  4IVO B;  2FJE A;  4H4V A;  3F8R A;  3QSE A;  5BUL A;  2HQM A;  3CMM A;  3AE1 A;  3QSS A;  2JB2 A;  2GQW A;  4ADW A;  4Z43 A;  3ALM A;  3AE7 A;  3AEC A;  4YSX A;  3T2Z A;  4TM3 A;  2H89 A;  2X8H A;  1CHU A;  2X3N A;  2XFP A;  4USQ A;  1PHH A;  5DBJ A;  1L9C A;  3B6D A;  1ELI A;  1NG3 A;  2YM2 A;  4WCT A;  3DK9 A;  4EMI A;  2XLR A;  1B8S A;  2YLZ A;  2Z5Y A;  4BK2 A;  3P9U A;  3P4R A;  1ZDL A;  1PXC A;  2X8C A;  2TPR A;  3GSI A;  2BAC A;  2V3B A;  1JU2 A;  4PAA A;  5BRT A;  3QVR A;  4AOX A;  3LJP A;  3P4Q A;  3DK4 A;  2WHD A;  3T37 A;  2Q0L A;  1Q1R A;  1YKJ A;  1LQU A;  1YQZ A;  4II2 A;  3SFD A;  3V76 A;  2YAU A;  2IID A;  4AP3 A;  2PYX A;  1AOG A;  2OAM A;  1DOE A;  1E1L A;  4AT0 A;  3CTY A;  1TDO A;  1F8W A;  1IUT A;  2X99 A;  2B9Y A;  1REO A;  3D1C A;  3UKK A;  1KFY A;  2XLP A;  4IV9 A;  5EOW A;  4U8K A;  4CNK A;  3CUK A;  2BRY A;  4WX1 A;  1COY A;  1D4C A;  4U2S A;  1GEU A;  4YJF A;  2QA1 A;  3UKA A;  2C66 A;  1QO8 A;  1BKW A;  1HYU A;  4TLZ A;  3W4I A;  2R46 A;  1PJ5 A;  3ICS A;  1QJD A;  3NTA A;  1EL7 A;  1D5T A;  3COX A;  1KF6 A;  5M0Z A;  1TYP A;  2XFN A;  2JAE A;  2XDO A;  3SYI A;  2YR5 A;  3UCL A;  2NPX A;  3SGL A;  2GEW A;  4BJZ A;  2WPF A;  2V60 A;  2EQ8 A;  1D7Y A;  2YVJ A;  3LZW A;  3K7M X;  5BUK A;  5GRT A;  4EQR A;  3NN6 X;  3AE8 A;  4LA1 A;  2BRA A;  1B5Q A;  3KKJ A;  3KPK A;  2VRL A;  4U8J A;  1LVL A;  4U8I A;  2GR1 A;  4CY8 A;  1MOK A;  3P1W A;  4OPU A;  3NT6 A;  2E49 A;  2Y6Q A;  1GET A;  1OJC A;  3AWI A;  2XVE A;  2R0G A;  3AE5 A;  2YG5 A;  4OPI A;  3UOX A;  4J31 A;  3ICT A;  4Z2U A;  1KNR A;  1BGN A;  1CJC A;  3M12 A;  2GV8 A;  3NYC A;  1GER A;  2OAL A;  3ZDN A;  1N1P A;  3F8D A;  1C0P A;  4FK1 A;  1QLB A;  1GES A;  4G73 A;  5J60 A;  1NDA A;  2BXS A;  2QCU A;  5KMR A;  5KOX A;  1XHC A;  4Z2T A;  2R0P A;  2BK5 A;  3H8I A;  4RG3 A;  3ZNO A;  3LOV A;  3K30 A;  1DJQ A;  3AYI A;  4G9K A;  3DK8 A;  1FOH A;  3RP8 A;  5C2T A;  4Y4N A;  2GQF A;  1PBE A;  2YVF A;  4USR A;  1Y0P A;  1NHS A;  3AE4 A;  1IUU A;  1ZOY A;  4NTE A;  2C3C A;  3I6D A;  4JY2 A;  4BK3 A;  4BV6 A;  4YSY A;  1KIF A;  3CN8 A;  5KOW A;  4EMW A;  4YTP A;  4CNJ A;  1H83 A;  3GWF A;  4A6N A;  4CCQ A;  2WDR A;  2YVG A;  3HYV A;  2A8X A;  1E6E A;  1IUX A;  2FJA A;  2YG6 A;  3ADA B;  4A5L A;  2EQ6 A;  3CNT A;  1GT8 A;  4C5O A;  3RP6 A;  3ISH A;  3URH A;  4A99 A;  4B67 A;  4J36 A;  2C65 A;  3NNE A;  1CF3 A;  1TDK A;  4B1B A;  4C77 A;  1PN0 A;  1H82 A;  4ICY A;  4OPD A;  3AEA A;  4HB9 A;  4YKG A;  1PXA A;  2ZZC A;  3BNM A;  4ZCD A;  2BC1 A;  2BYB A;  4EM3 A;  1DDO A;  1D4D A;  3P4S A;  4NNJ A;  3VRD B;  2WOW A;  1CJ3 A;  3IC9 A;  3AE3 A;  2R4J A;  3S5W A;  1VRQ B;  1BZL A;  2YG7 A;  3AED A;  1MXT A;  2WDQ A;  2WP6 A;  3ITJ A;  2C67 A;  3NLC A;  3SX6 A;  3BI5 A;  1NAA A;  4JY3 A;  3GRT A;  2EQ7 A;  4B66 A;  3OZ2 A;  2V5Z A;  2YQU A;  1RYI A;  1S3B A;  2YM1 A;  4U2T A;  4EM4 A;  5KMS A;  1CBO A;  2YLW A;  3CGD A;  3VRB A;  2VVL A;  3VR8 A;  4EIQ A;  2BCP A;  2YWL A;  3BNU A;  5KWF A;  3QFA A;  4GAV A;  2GR0 A;  2CUL A;  3AYJ A;  2BS3 A;  4H4Z A;  3ZNN A;  4G6H A;  1NG4 A;  2V61 A;  5EB5 A;  1PBC A;  1GRA A;  1PBF A;  2C72 A;  1ZMC A;  2O9Z A;  2VQ7 A;  4H4W A;  3UKF A;  2CDU A;  2WOV A;  2AR8 A;  3LXD A;  4FX9 A;  3UP5 A;  4H4P A;  2R9Z A;  1V59 A;  4I59 A;  4H4R A;  2DU8 A;  5LV9 A;  2BCG G;  2VOU A;  2QA2 A;  3KLJ A;  1H86 A;  4IVM B;  5FMH A;  1JNZ A;  1N4V A;  3H4K A;  3UTG A;  2GRT A;  3NIX A;  5JCK A;  1VE9 A;  1F8R A;  3CPI G;  4JDR A;  2Z5X A;  3T2K A;  3NKS A;  2RGO A;  3UKH A;  5KNL A;  4YT0 A;  3LAD A;  1M6I A;  3QFB A;  4H4Y A;  4YTN A;  4GUV A;  5U63 A;  5KMQ A;  4EQW A;  1GRB A;  1DOD A;  2C64 A;  3PVC A;  3S61 A;  4GF7 A;  2VQB A;  4A7A A;  3HYW A;  1EL8 A;  4ZN0 A;  3ALL A;  2C73 A;  4XXG A;  4P9S A;  2I0Z A;  2FBW A;  1JRZ A;  1CJ2 A;  3M0O A;  5U25 A;  1EBD A;  1EVI A;  4GAP A;  4NTD A;  3ZNP A;  4ZCC A;  4G6G A;  3CIR A;  4A6N B;  2YR6 A;  3BI2 A;  4ECH A;  1O95 A;  3AE2 A;  4H50 A;  2B76 A;  2BAB A;  2GB0 A;  4TM4 A;  1LPF A;  3SZW A;  4CBQ A;  3VR9 A;  1IUV A;  1NPX A;  5ER0 A;  4II3 A; 
#chains in the Genus database with same CATH homology
 1PS9 A;  2BK3 A;  1LQT A;  3DH9 A;  1C0K A;  4EIP A;  5JCM A;  1O5W A;  3B3R A;  4C3X A;  2ZBW A;  1W4X A;  1UKV G;  2QAE A;  1XPQ A;  4H4T A;  1NEK A;  2OLO A;  3UTE A;  1B37 A;  3R9U A;  3GYI A;  4J34 A;  3DGH A;  4Y4L A;  3EAN A;  1KNP A;  3EF6 A;  4IA6 A;  1AN9 A;  2VZ2 A;  2WEU A;  4NTC A;  3ZYX A;  4DSH A;  3UTH A;  3NYE A;  2Y6R A;  2YR4 A;  3IHG A;  4OVI A;  5FS7 A;  3GYX A;  2GMJ A;  1DXL A;  1IJH A;  2JB1 A;  1CL0 A;  1JEH A;  1N4U A;  2XVF A;  1GAL A;  3AD8 B;  4H4U A;  4UDQ A;  3AEG A;  1F6M A;  2ACZ A;  3NG7 X;  4O5U A;  1K0L A;  4D03 A;  3BHK A;  1FEC A;  1TDN A;  1D7L A;  2XVJ A;  4DNA A;  3DA1 A;  3AE9 A;  1JOA A;  1VDC A;  2V3A A;  4J33 A;  4X4J A;  2XFQ A;  2GH5 A;  1GSN A;  3GD3 A;  1PDH A;  5L46 A;  4X9M A;  3UP4 A;  4YSH A;  4M52 A;  4B69 A;  1P2E A;  2BS4 A;  2H88 A;  2E4G A;  1LJ1 A;  4NEW A;  1YY5 A;  4OPC A;  4REK A;  5HY5 A;  4Z24 A;  3SZF A;  3CGB A;  3G5R A;  4U8P A;  3FMW A;  2BK4 A;  3W4K A;  1CC6 A;  4QFD A;  1P2H A;  1XDI A;  2XFU A;  2YLT A;  4H4X A;  4IA5 A;  4JNQ A;  3FIM B;  5EBK A;  3T0K A;  2OLN A;  2JB3 A;  3UOV A;  1FEB A;  2XVI A;  3AEF A;  4TM1 A;  4JN9 A;  1FEA A;  2ARD A;  1E39 A;  4GDP A;  4YTM A;  2R4E A;  1ZMD A;  4H2P A;  1PXB A;  3KA7 A;  3V3O A;  4DSG A;  1K0J A;  2VVM A;  4CRT A;  2GR2 A;  3NK1 X;  4OPT A;  3VRA A;  5KMP A;  1H6V A;  1GND A;  3PO7 A;  3SQP A;  5IPY A;  3II4 A;  4GDE A;  2OA1 A;  1NHR A;  3EAO A;  4BK1 A;  2JBV A;  2W0H A;  3ICR A;  1EL5 A;  3NRN A;  4A9W A;  4D04 A;  3NN0 X;  3SZ0 A;  4U8N A;  5U1O A;  3T14 A;  5HHF A;  2R45 A;  1DNC A;  1B4V A;  1S2Y A;  3UKP A;  3NH3 X;  1LV0 A;  1H7W A;  2RGJ A;  3QJ4 A;  3DJG X;  2WPE A;  4E0V A;  2JK6 A;  3HYX A;  3M13 A;  1GRG A;  1Q9I A;  3KPF A;  4B64 A;  2J3N A;  4UP3 A;  4LU6 A;  4NZH A;  1JRY A;  2F5Z A;  3CND A;  2YLR A;  1ZK7 A;  1E1N A;  2CVJ A;  2IVD A;  4C74 A;  3G3E A;  1D4E A;  4YKF A;  4H4S A;  1FL2 A;  1TDF A;  4U8M A;  3UKQ A;  5M10 A;  2X50 A;  2YLX A;  4OPG A;  4H4Q A;  4FK1 C;  2C70 A;  5GSN A;  2FJB A;  3AEE A;  3SM8 A;  2DKI A;  1MO9 A;  4AOS A;  1JRX A;  1VQW A;  1OJD A;  3ABV A;  2XLS A;  3GMC A;  5KRQ A;  1LTX R;  1SEZ A;  2GAH B;  4YWO A;  3ALJ A;  2Q0K A;  3D8X A;  4U8O A;  1K4Q A;  3SZC A;  4UDP A;  1NEN A;  3GYJ A;  1BGJ A;  2FJD A;  5KVI A;  1TRB A;  4TLX A;  4RSL A;  2B7R A;  3CNP A;  2E82 A;  2WOI A;  4GRT A;  1DAO A;  1X31 B;  2IVE A;  4LII A;  3PS9 A;  4YJH B;  3CNS A;  3G5Q A;  2EQ9 A;  2YG3 A;  2Q6U A;  1M64 A;  3EPT A;  4J56 A;  1GTE A;  1YQ3 A;  4Z25 A;  1K0I A;  1H84 A;  4CCR A;  3DME A;  3LZX A;  3UKL A;  1PJ6 A;  1E1K A;  1YQ4 A;  3P4P A;  3H8L A;  4GCM A;  3GDN A;  2YLS A;  4YSZ A;  1KSS A;  4Z26 A;  5IQ1 A;  3DJJ A;  1S2Q A;  3CGC A;  1GRT A;  2BA9 A;  1GRE A;  2XLU A;  4G74 A;  4Z2R A;  3AB1 A;  1Y56 B;  2UZZ A;  1Q1W A;  3GMB A;  5J7X A;  5CKU A;  5FS6 A;  1ZP0 A;  3AXB A;  2WET A;  4KX6 A;  1CC4 A;  3GWD A;  4NEV A;  2WBA A;  2XYO A;  2JKC A;  3O0H A;  3Q9T A;  1E7P A;  2V6O A;  4YXD A;  3GRS A;  3UTF A;  3F8P A;  4B63 A;  1H7X A;  3OC4 A;  4TM0 A;  4EMJ A;  5JCL A;  3T2Y A;  4AT2 A;  5KVH A;  1IUW A;  3NTD A;  1CC2 A;  2BS2 A;  1F3P A;  2R0C A;  2X8G A;  1DOB A;  2B9W A;  2NVK X;  2Q7V A;  1KDG A;  2E4A A;  1C0I A;  1FCD A;  3CPJ G;  2GF3 A;  3LB8 A;  2C76 A;  2DKH A;  3AEB A;  4PAB A;  3JSK A;  2WU5 A;  3VQR A;  3Q6J A;  4K5R A;  4XWZ A;  4MJW A;  1N4W A;  2C4C A;  4FDC B;  4OCG A;  3SY4 A;  5BVA A;  4NWZ A;  3SXI A;  1RP0 A;  2VVL G;  2XVH A;  1PBB A;  4BJY A;  1L9D A;  3RNM A;  1GOS A;  4GR1 A;  2WP5 A;  4B65 A;  2PHH A;  2RAB A;  3AYL A;  3NK2 X;  3KD9 A;  3FG2 P;  1OJT A;  2E5V A;  4A79 A;  4AP1 A;  1OJA A;  2AAQ A;  1TDE A;  2WES A;  4YJH A;  2GR3 A;  3K7T A;  4H2N A;  4Y4M A;  2XLT A;  1TYT A;  3FBS A;  4RG4 A;  1JNR A;  4YJD A;  1Z6L A;  4HA6 A;  5HYM A;  3L1R A;  4I58 A;  3K7Q X;  3W4J A;  2B7S A;  1C0L A;  1DOC A;  1E1M A;  2VRM A;  3CNJ A;  4QFC A;  3NGC X;  4YJG B;  2GMH A;  3KVE A;  2WPC A;  5C3J A;  3ATR A;  2E1M A;  4H7U A;  1ZKQ A;  1IUS A;  3AD9 B;  3GDP A;  4U8L A;  3NHO X;  5EB4 A;  4EQX A;  1VG9 A;  2ZZ0 A;  3AE6 A;  4J2W A;  4UDR A;  4CY6 A;  2C75 A;  3IF9 A;  2B9X A;  5IQ4 A;  1ZX9 A;  1ZOV A;  1Y56 A;  2YG4 A;  3RP7 A;  4A65 A;  3RHA A;  5FS8 A;  1GV4 A;  2BC0 A;  3WGT A;  1GPE A;  2A89 A;  2BXR A;  1RSG A;  1S3E A;  4K22 A;  1GTH A;  2A87 A;  2C7G A;  2GVC A;  3QVP A;  2WQY A;  4K2X A;  3UOY A;  3DJD A;  1DJN A;  3ATQ A;  4KPR A;  4Z44 A;  1PJ7 A;  4JNA A;  2C3D A;  2XFO A;  3FPZ A;  1BF3 A;  4H2R A;  5JCI A;  3G5S A;  5HXI A;  3BHF A;  3BI4 A;  3RED A;  5CQF A;  1O94 A;  2CFY A;  2AQJ A;  2WU2 A;  4K5S A;  1GXF A;  3E1T A;  4BUR A;  1PBD A;  2RGH A;  5FS9 A;  1F8S A;  5JCN A;  4B68 A;  3C4N A;  2APG A;  1H81 A;  3SFE A;  2ZZB A;  4N9X A;  3CGE A;  3NYF A;  4EQS A;  5KXJ A;  3T31 A;  1NHP A;  3L8K A;  4APN A;  1GRH A;  3C4A A;  2WP9 A;  3C96 A;  3CPH G;  2TMD A;  3GD4 A;  3AD7 B;  3DGZ A;  3NK0 X;  4J57 A;  3HZL A;  4H2Q A;  4K8D A;  4OPL A;  3IHM A;  4K7Z A;  2GAG B;  1KSU A;  4JQ9 A;  1L0V A;  1OJ9 A;  4X9N A;  3I3L A;  2XCG A;  4C3Y A;  2E48 A;  4DGK A;  4YJF B;  3UOZ A;  4U2L A;  5TR3 A;  4YJG A;  1GRF A;  1ONF A;  2WS3 A;  4O5Q A;  1EL9 A;  1BWC A;  3DJE A;  4XWR A;  3IWA A;  1CJ4 A;  3ZNQ A;  1XAN A;  3QSM A;  1NHQ A;  1ZY8 A;  2WDV A;  3WE0 A;  3KU9 A;  1L9E A;  1VG0 A;  4IVO B;  2FJE A;  4H4V A;  3F8R A;  3QSE A;  5BUL A;  2HQM A;  3CMM A;  3AE1 A;  3QSS A;  2JB2 A;  2GQW A;  4ADW A;  4Z43 A;  3AE7 A;  3AEC A;  3ALM A;  4YSX A;  3T2Z A;  4TM3 A;  2H89 A;  2X8H A;  1CHU A;  2X3N A;  2XFP A;  4USQ A;  1PHH A;  5DBJ A;  1L9C A;  3B6D A;  1ELI A;  1NG3 A;  2YM2 A;  4WCT A;  3DK9 A;  4EMI A;  2XLR A;  1B8S A;  2YLZ A;  2Z5Y A;  3P4R A;  3P9U A;  4BK2 A;  1ZDL A;  1PXC A;  2X8C A;  2TPR A;  3GSI A;  2BAC A;  2V3B A;  1JU2 A;  4PAA A;  5BRT A;  3QVR A;  4AOX A;  3LJP A;  3P4Q A;  3DK4 A;  2WHD A;  3T37 A;  2Q0L A;  1Q1R A;  1YKJ A;  1LQU A;  1YQZ A;  4II2 A;  3SFD A;  3V76 A;  2YAU A;  2IID A;  4AP3 A;  2PYX A;  1AOG A;  2OAM A;  1DOE A;  1E1L A;  4AT0 A;  3CTY A;  1TDO A;  1F8W A;  1IUT A;  2X99 A;  2B9Y A;  1REO A;  3D1C A;  3UKK A;  1KFY A;  2XLP A;  4IV9 A;  5EOW A;  4U8K A;  4CNK A;  3CUK A;  2BRY A;  4WX1 A;  1COY A;  1D4C A;  4U2S A;  1GEU A;  4YJF A;  2QA1 A;  3UKA A;  2C66 A;  1QO8 A;  1BKW A;  1HYU A;  4TLZ A;  3W4I A;  2R46 A;  1PJ5 A;  3ICS A;  1QJD A;  3NTA A;  1EL7 A;  1D5T A;  3COX A;  1KF6 A;  5M0Z A;  1TYP A;  2XFN A;  2JAE A;  2XDO A;  3SYI A;  2YR5 A;  3UCL A;  2NPX A;  3SGL A;  2GEW A;  2YVJ A;  2WPF A;  2V60 A;  2EQ8 A;  1D7Y A;  3V3N A;  3LZW A;  3K7M X;  4BJZ A;  5BUK A;  5GRT A;  4EQR A;  3NN6 X;  3AE8 A;  4LA1 A;  2BRA A;  1B5Q A;  3KKJ A;  3KPK A;  2VRL A;  4U8J A;  1LVL A;  4U8I A;  2GR1 A;  4CY8 A;  1MOK A;  3P1W A;  4OPU A;  3NT6 A;  2E49 A;  2Y6Q A;  1GET A;  1OJC A;  3AWI A;  2XVE A;  2R0G A;  3AE5 A;  2YG5 A;  4OPI A;  3UOX A;  4J31 A;  3ICT A;  4Z2U A;  1KNR A;  1BGN A;  1CJC A;  3M12 A;  2GV8 A;  3NYC A;  1GER A;  2OAL A;  3ZDN A;  1N1P A;  3F8D A;  1C0P A;  4FK1 A;  1QLB A;  1GES A;  4G73 A;  5J60 A;  1NDA A;  2BXS A;  2QCU A;  5KMR A;  5KOX A;  1XHC A;  4Z2T A;  2BK5 A;  2R0P A;  3H8I A;  4RG3 A;  3ZNO A;  3LOV A;  3K30 A;  1DJQ A;  3AYI A;  4G9K A;  3DK8 A;  1FOH A;  3RP8 A;  5C2T A;  4Y4N A;  2GQF A;  1PBE A;  2YVF A;  4USR A;  1Y0P A;  1NHS A;  3AE4 A;  1IUU A;  1ZOY A;  4NTE A;  2C3C A;  3I6D A;  4JY2 A;  4BK3 A;  4BV6 A;  4YSY A;  1KIF A;  3CN8 A;  5KOW A;  4EMW A;  4YTP A;  4CNJ A;  1H83 A;  3GWF A;  4A6N A;  4CCQ A;  2WDR A;  2YVG A;  3HYV A;  2A8X A;  1E6E A;  1IUX A;  2FJA A;  2YG6 A;  3ADA B;  4A5L A;  2EQ6 A;  3CNT A;  1GT8 A;  4C5O A;  3RP6 A;  3ISH A;  3URH A;  4A99 A;  4B67 A;  4J36 A;  2C65 A;  3NNE A;  1CF3 A;  1TDK A;  4B1B A;  4C77 A;  1PN0 A;  1H82 A;  4ICY A;  4OPD A;  3AEA A;  4HB9 A;  4YKG A;  1PXA A;  2ZZC A;  3BNM A;  4ZCD A;  2BC1 A;  2BYB A;  4EM3 A;  1DDO A;  1D4D A;  3P4S A;  4NNJ A;  3VRD B;  2WOW A;  1CJ3 A;  3IC9 A;  3AE3 A;  2R4J A;  3S5W A;  1VRQ B;  1BZL A;  2YG7 A;  3AED A;  1MXT A;  2WDQ A;  2WP6 A;  3ITJ A;  2C67 A;  3NLC A;  3SX6 A;  3BI5 A;  1NAA A;  4JY3 A;  3GRT A;  2EQ7 A;  4B66 A;  3OZ2 A;  2V5Z A;  2YQU A;  1RYI A;  1S3B A;  2YM1 A;  4U2T A;  4EM4 A;  5KMS A;  1CBO A;  2YLW A;  3CGD A;  3VRB A;  2VVL A;  3VR8 A;  4EIQ A;  2BCP A;  2YWL A;  3BNU A;  5KWF A;  3QFA A;  4GAV A;  2GR0 A;  2CUL A;  3AYJ A;  2BS3 A;  4H4Z A;  3ZNN A;  4G6H A;  1NG4 A;  2V61 A;  5EB5 A;  1PBC A;  1GRA A;  1PBF A;  2C72 A;  1ZMC A;  2O9Z A;  2VQ7 A;  4H4W A;  3UKF A;  2CDU A;  2WOV A;  2AR8 A;  3LXD A;  4FX9 A;  3UP5 A;  4H4P A;  2R9Z A;  1V59 A;  4I59 A;  4H4R A;  2DU8 A;  5LV9 A;  2BCG G;  2QA2 A;  2VOU A;  3KLJ A;  1H86 A;  4IVM B;  5FMH A;  1JNZ A;  1N4V A;  3H4K A;  3UTG A;  2GRT A;  3NIX A;  5JCK A;  1VE9 A;  1F8R A;  3CPI G;  4JDR A;  2Z5X A;  3T2K A;  3NKS A;  2RGO A;  3UKH A;  5KNL A;  4YT0 A;  3LAD A;  1M6I A;  3QFB A;  4H4Y A;  4YTN A;  4GUV A;  5U63 A;  5KMQ A;  4EQW A;  1GRB A;  1DOD A;  2C64 A;  3PVC A;  3S61 A;  2VQB A;  4GF7 A;  4A7A A;  3HYW A;  1EL8 A;  4ZN0 A;  2C73 A;  3ALL A;  4XXG A;  4P9S A;  2I0Z A;  2FBW A;  1JRZ A;  1CJ2 A;  3M0O A;  5U25 A;  1EBD A;  1EVI A;  4GAP A;  4NTD A;  3ZNP A;  4ZCC A;  4G6G A;  3CIR A;  4A6N B;  2YR6 A;  3BI2 A;  4ECH A;  1O95 A;  3AE2 A;  4H50 A;  2B76 A;  2BAB A;  2GB0 A;  4TM4 A;  1LPF A;  3SZW A;  4CBQ A;  3VR9 A;  1IUV A;  1NPX A;  5ER0 A;  4II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...