2UZZA

X-ray structure of n-methyl-l-tryptophan oxidase (mtox)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
KYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKYVPLVLRAQMLWDELSRHNEDDPIFVRSGVINLGPADSTFLANVAHSAEQWQLNVEKLDAQGIMARWPEIRVPDNYIGLFETDSGFLRSELAIKTWIQLAKEAGCAQLFNCPVTAIRHDDDGVTIETADGEYQAKKAIVCAGTWVKDLLPELPVQPVRKVFAWYQADGRYSVKNKFPAFTGELPNGDQYYGFPAENDALKIGKHNGGQVIHSADERVPFAEVVSDGSEAFPFLRNVLPGIGCCLYGAACTYDNSPDEDFIIDTLPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSDFDLTPFRLSRFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords N-METHYL-L-TRYPTOPHAN OXIDASE
total genus 97
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.5.3.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 2uzzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2uzzA01
2XLSA 1LQTA 1IUSA 4MJWA 2OLOA 1B4VA 4H2PA 2XFUA 2ARDA 4XXGA 1GERA 4AP1A 2XVHA 3ISHA 3CPJG 3DJJA 3AD9B 3DMEA 1M64A 3AE4A 3DK9A 4OPIA 1RYIA 1ZP0A 3DA1A 2YVJA 3S5WA 4X4JA 3ZDNA 2R9ZA 4YKFA 5IQ1A 2V6OA 4J2WA 4YT0A 1S3EA 2B9YA 2EQ6A 1C0IA 2EQ9A 2XFQA 5JCKA 4EMIA 1F8RA 3VRAA 4EM3A 3O0HA 2YVFA 4EMJA 2F5ZA 4H4TA 3W4IA 2V61A 2C66A 1DODA 3GD3A 4HB9A 1FOHA 3GRTA 3AECA 3NK0X 4AOXA 3CPHG 1VG9A 2B9XA 1NENA 2JBVA 4H4RA 3L1RA 2APGA 3SM8A 2GRTA 2YWLA 4A5LA 1D4CA 4YSZA 3NYEA 1F8WA 1XDIA 4K5RA 2CULA 2E1MA 1NAAA 2WHDA 3VRBA 3AE9A 3DK4A 2ACZA 3FG2P 4J57A 2B9WA 4A65A 3COXA 4JNAA 1CJ2A 1DDOA 1RP0A 1LJ1A 2CVJA 5FS9A 1CBOA 4J56A 4OPUA 4H4UA 1Y56B 2GR2A 2X99A 1S2QA 4O5QA 4TM4A 4QFCA 3GMBA 5JCIA 3B6DA 2BABA 2XVFA 1DOBA 2WPCA 4AP3A 4YJDA 1M6IA 2XVIA 3G3EA 5BULA 5KXJA 1F6MA 1PJ6A 1IUUA 5KWFA 4YTMA 2WESA 4YTPA 4B67A 2FJDA 1F3PA 2WOWA 1KF6A 2VZ2A 2IVDA 1D7LA 2BA9A 4NTEA 3CIRA 1TDFA 1CJCA 1YKJA 1JNZA 3UTFA 2C3DA 4TM3A 4J33A 4REKA 5GSNA 1GRTA 4BV6A 3CGCA 1JRYA 3REDA 1CC2A 3CNPA 2E5VA 3FBSA 3JSKA 3L8KA 4NZHA 3UOYA 3UTHA 4YKGA 5J60A 2PYXA 4YSHA 1DOCA 3UTEA 3AB1A 1KNRA 3CNJA 2YR4A 3K7MX 4J31A 1K0IA 5L46A 1L9EA 1FCDA 5M0ZA 1E1KA 3GRSA 5JCNA 4Y4NA 1GETA 2BXRA 3OZ2A 3UKPA 2R4EA 1BGJA 4IVOB 1E6EA 2WPFA 3I6DA 1O5WA 3AEBA 3G5QA 3G5SA 2Z5XA 2YQUA 1PXAA 1GRHA 2TMDA 4E0VA 1SEZA 2WDRA 5FS8A 4ZN0A 3ZYXA 1QO8A 2WP9A 3NH3X 4GUVA 3WGTA 4H4VA 2R0PA 3CTYA 2JB1A 4U8KA 4YJGB 5JCLA 2YM2A 1VRQB 3D1CA 4CY8A 4EQSA 1EBDA 1LVLA 2C72A 1PBCA 3QSMA 1H86A 1TYTA 3PO7A 1YY5A 3C96A 1C0PA 3CPIG 3NIXA 4H4SA 3SFDA 2V60A 4APNA 1REOA 1ZK7A 3CNDA 3NYCA 3T37A 2ZZCA 4EIPA 1GT8A 2BK4A 2X50A 3UTGA 1PBFA 2X3NA 3E1TA 3RP6A 3DGHA 2XLUA 3UKAA 2YLTA 1AN9A 1JU2A 2YG3A 1ZX9A 3BI2A 4B66A 1CJ3A 4C5OA 1N4WA 3IWAA 3AE8A 2EQ8A 4C77A 4HA6A 2XFPA 3EF6A 4USQA 3ALMA 4IV9A 3DJEA 3V3OA 4A9WA 2WEUA 5KOWA 1H81A 3I3LA 2XDOA 3AD7B 4U2LA 4CBQA 4H4PA 3VQRA 2NPXA 3KU9A 1H7WA 1MO9A 4A6NB 2GQFA 4YXDA 3GWDA 1E1LA 2O9ZA 1OJDA 3ZNNA 3K30A 3NTAA 2C73A 1B5QA 1S3BA 1IUVA 3P9UA 3C4NA 2C65A 1GNDA 4CNKA 3UKFA 3ABVA 3GMCA 3UP4A 1CL0A 1TRBA 3SQPA 4OVIA 4AT0A 3PVCA 2WETA 3AE3A 1MXTA 2FJEA 2AAQA 2YG4A 1ONFA 4QFDA 3AEAA 4UDPA 5EBKA 2Q6UA 1ELIA 3W4KA 3NHOX 3NTDA 4IA5A 3LB8A 4I58A 1FECA 2Z5YA 1GRGA 2GV8A 3QJ4A 3QVPA 4FDCB 2R4JA 3BI4A 4PABA 4OCGA 2C7GA 2B7RA 3KD9A 4H4ZA 4RG3A 2JAEA 3M12A 4GCMA 4U8MA 4Y4LA 1E7PA 2BC0A 4YJGA 3ZNOA 1V59A 4JDRA 3SGLA 4BK1A 1KDGA 1Q9IA 1AOGA 4DNAA 2QA1A 3NYFA 4K8DA 3UCLA 2BS2A 3IHMA 1DAOA 2R0CA 3RNMA 3UKHA 4DSHA 3LZXA 2R45A 2CFYA 1GESA 4PAAA 2XVJA 4K2XA 1CJ4A 4TM0A 4YJFB 3B3RA 3VR9A 3II4A 2C70A 1EL9A 4U8LA 1NEKA 2ZBWA 4KPRA 3CNTA 3BI5A 5KVHA 2VQBA 2JK6A 3UP5A 1F8SA 1H84A 4DSGA 2HQMA 3K7QX 4X9NA 4U8PA 1DJNA 4B64A 1GPEA 5ER0A 2BS3A 4EQRA 5BRTA 1Z6LA 2Y6QA 5J7XA 1N4VA 3AEDA 5KOXA 2ZZ0A 1Q1RA 4KX6A 1LPFA 1NHPA 1PN0A 1GRFA 3QSEA 2Q7VA 3G5RA 4AT2A 3CN8A 1EL7A 2WU5A 3GWFA 4ZCDA 4XWZA 3AE2A 1NG3A 4EQXA 1QJDA 3K7TA 3P4PA 2PHHA 1CC6A 2GQWA 4EIQA 3NRNA 1IUXA 1XANA 4NTCA 3AEGA 3DH9A 4N9XA 2FBWA 2WU2A 3LJPA 4LU6A 3FPZA 3ZNPA 1KNPA 1KSUA 5HYMA 2VRLA 1GRAA 2GMHA 2IVEA 4Z2TA 1TYPA 4IVMB 3RP8A 2GR3A 2FJBA 4OPGA 2YG5A 4UP3A 4CRTA 4FX9A 1NPXA 1P2EA 5EB5A 4I59A 4Z44A 3AD8B 2YVGA 1L9DA 1N4UA 3URHA 2XFNA 5BUKA 1CHUA 1PJ5A 4YJHB 5FMHA 3P4QA 4ECHA 3UKQA 5BVAA 2J3NA 2E49A 1E1MA 1GRBA 4CY6A 3AE6A 3KA7A 1TDEA 3NN0X 1NHRA 1OJCA 2WBAA 1CC4A 4H4YA 4B65A 1JEHA 4ZCCA 4X9MA 4U8NA 5HXIA 3KPFA 2VOUA 4J34A 1BWCA 3ITJA 4O5UA 4UDQA 4UDRA 1VDCA 4U2TA 4C74A 3DJDA 2XVEA 2C67A 2XCGA 3QVRA 1B37A 3NLCA 3UOVA 3OC4A 3GDNA 3P4RA 5TR3A 2VQ7A 3EPTA 4Z2RA 1D4DA 1PBDA 1GXFA 4YSXA 4EM4A 3AEEA 1BZLA 2RGJA 5U63A 2OLNA 1O95A 3M0OA 1PS9A 5EOWA 4P9SA 1H83A 5U25A 1VG0A 3DK8A 1TDOA 1OJAA 1ZMDA 2XLTA 4Z24A 2H89A 5FS6A 4TM1A 1BF3A 3AYJA 3ICTA 3F8DA 2WP5A 3AEFA 1DNCA 2GR0A 2YM1A 4GDEA 1ZMCA 2YLXA 3KLJA 4B1BA 1GEUA 2YR5A 2UZZA 2FJAA 4B68A 1FL2A 3ALLA 1D7YA 2YG6A 1BGNA 1GSNA 2OA1A 2B7SA 2V5ZA 2YR6A 4LA1A 4H7UA 1CF3A 1KFYA 4H4WA 3VRDB 3ATQA 4C3XA 1JRXA 5HHFA 1OJTA 2V3BA 5CQFA 4ADWA 1S2YA 4H2NA 3EANA 2RABA 4B69A 3LADA 3NK1X 2B76A 2GEWA 1EVIA 3CGEA 4USRA 4WCTA 1YQZA 1FEBA 2YAUA 4A79A 2XFOA 4OPLA 2H88A 2A8XA 1GREA 2Q0KA 4CNJA 5C2TA 4WX1A 1DOEA 1HYUA 3IHGA 1NG4A 3RHAA 1PBBA 1E39A 3UOZA 4A6NA 3FMWA 4OPTA 1EL8A 2ZZBA 3CGBA 3LOVA 3CNSA 4GF7A 2BACA 3P4SA 5KRQA 2C64A 5GRTA 2R0GA 4JN9A 3UOXA 4Z2UA 2JKCA 1KSSA 4FK1C 1Y56A 4J36A 1YQ4A 5FS7A 4H2RA 4TLZA 5KVIA 4H2QA 2JB2A 1PDHA 3BHKA 3IF9A 1GOSA 2WOIA 2YLRA 4D04A 2C76A 2WP6A 1D4EA 2VVLG 2YLWA 3UKLA 1PJ7A 2GH5A 2XLRA 3GD4A 1JOAA 4CCRA 2OALA 5U1OA 4NEWA 5HY5A 3RP7A 4BK2A 1LQUA 4DGKA 1Y0PA 3GDPA 2EQ7A 3Q6JA 1H6VA 1ZOVA 2AQJA 4U8OA 4CCQA 5C3JA 1ZKQA 1X31B 4GR1A 2X8GA 3H8LA 2OAMA 3M13A 2QCUA 1UKVG 2GR1A 3NG7X 4Y4MA 2NVKX 3AE1A 1K0JA 3ATRA 3CGDA 4GDPA 1PXCA 4XWRA 4EMWA 1LTXR 1YQ3A 4NEVA 3UKKA 1NHSA 1MOKA 2DKHA 3ZNQA 4H4XA 2GVCA 2BK3A 1Q1WA 2DKIA 4B63A 1N1PA 4JQ9A 4A7AA 4A99A 2I0ZA 4AOSA 3NT6A 2BC1A 2X8CA 3QFBA 3KVEA 1O94A 2E48A 3AYLA 1H82A 1IJHA 4C3YA 3BNMA 4YSYA 1BKWA 4K22A 3WE0A 2WOVA 1PBEA 2WS3A 1ZDLA 3R9UA 3D8XA 4EQWA 4Z43A 5CKUA 3AE5A 4YJHA 2E4GA 2XYOA 1IUWA 3W4JA 4U2SA 3EAOA 2A89A 1QLBA 2YLSA 1K0LA 3V76A 2BCGG 2WPEA 3NN6X 3AYIA 2TPRA 3ICRA 4JNQA 3AWIA 3F8RA 4YTNA 3H8IA 2C75A 1JNRA 3ALJA 1DJQA 3NKSA 1B8SA 3LXDA 3VR8A 4FK1A 2R46A 5IQ4A 4YWOA 3ICSA 2BK5A 1D5TA 5DBJA 1E1NA 2A87A 3HZLA 1PHHA 1C0KA 1VQWA 2GAHB 2X8HA 2YLZA 3P1WA 4OPCA 5LV9A 2WDQA 5EB4A 3GYJA 1GTEA 2VRMA 4H50A 4BJYA 1FEAA 4BK3A 4GRTA 1PXBA 5JCMA 2GB0A 1XHCA 2JB3A 2QAEA 2GMJA 3V3NA 2C3CA 2Y6RA 3S61A 4Z25A 1L9CA 2V3AA 4LIIA 1W4XA 1NHQA 1H7XA 2GF3A 3SFEA 2BYBA 1OJ9A 4K5SA 2VVMA 3NNEA 3AE7A 2BCPA 1GV4A 3GSIA 3QSSA 3BNUA 3F8PA 3CUKA 2WDVA 2YG7A 3GYIA 5M10A 1IUTA 2E4AA 3BHFA 2Q0LA 1GTHA 4K7ZA 1K4QA 5IPYA 3IC9A 1GALA 4RSLA 3PS9A 4YJFA 4IA6A 4U8IA 3DJGX 2BS4A 4TLXA 4Z26A 3NGCX 1EL5A 1ZY8A 2CDUA 1XPQA 3KKJA 3NK2X 3QFAA 2DU8A 1C0LA 1JRZA 1VE9A 3ADAB 4U8JA 1DXLA 1RSGA 2BXSA 2VVLA 3H4KA 2W0HA 4ICYA 1COYA 1ZOYA 2E82A 4M52A 4JY2A 4OPDA 1KIFA 3LZWA 1L0VA 4BJZA 2WQYA 3DGZA 2IIDA 4JY3A 2RGOA 1P2HA 3C4AA 4BURA 1TDKA 3AXBA 1NDAA 2RGHA 1LV0A 4H4QA 4RG4A 2GAGB 4D03A 3Q9TA 2AR8A 1TDNA 4NTDA 2QA2A 2XLPA 3FIMB
chains in the Genus database with same CATH superfamily
2XLSA 1LQTA 1IUSA 4MJWA 2OLOA 1B4VA 4H2PA 3T2ZA 2XFUA 2ARDA 4XXGA 1GERA 4AP1A 2XVHA 3ISHA 3CPJG 3DJJA 3AD9B 3DMEA 1M64A 3AE4A 3DK9A 4OPIA 3SZFA 1RYIA 1ZP0A 3DA1A 2YVJA 3S5WA 4X4JA 3ZDNA 2R9ZA 4YKFA 5IQ1A 2V6OA 4J2WA 4YT0A 1S3EA 2B9YA 2EQ6A 1C0IA 2EQ9A 2XFQA 5JCKA 4EMIA 1F8RA 3VRAA 4EM3A 3O0HA 2YVFA 4EMJA 2F5ZA 4H4TA 3W4IA 2V61A 2C66A 1DODA 3GD3A 4HB9A 1FOHA 3GRTA 3AECA 3NK0X 3HYVA 4AOXA 3CPHG 3GYXA 1VG9A 2B9XA 1NENA 2JBVA 4H4RA 3L1RA 2APGA 3SM8A 2GRTA 2YWLA 4A5LA 1D4CA 4YSZA 3NYEA 1F8WA 1XDIA 4K5RA 2CULA 2E1MA 1NAAA 2WHDA 3VRBA 3AE9A 3DK4A 2ACZA 3FG2P 4G73A 4J57A 2B9WA 3SYIA 3COXA 4JNAA 4A65A 1CJ2A 1DDOA 1RP0A 1LJ1A 2CVJA 5FS9A 1CBOA 4J56A 4OPUA 4H4UA 1Y56B 2GR2A 2X99A 1S2QA 4O5QA 4TM4A 4QFCA 3GMBA 5JCIA 3B6DA 2BABA 2XVFA 1DOBA 2WPCA 4AP3A 4YJDA 1M6IA 2XVIA 3G3EA 5BULA 5KXJA 1F6MA 1PJ6A 1IUUA 5KWFA 4YTMA 2WESA 4YTPA 4B67A 2FJDA 1F3PA 2WOWA 1KF6A 2VZ2A 2IVDA 1D7LA 2BA9A 4NTEA 3CIRA 1TDFA 1CJCA 5KNLA 3T31A 1YKJA 1JNZA 3UTFA 2C3DA 4TM3A 4J33A 4REKA 5GSNA 1GRTA 4BV6A 3CGCA 1JRYA 3REDA 1CC2A 3CNPA 2E5VA 3FBSA 3JSKA 2C4CA 3L8KA 4NZHA 3UOYA 3UTHA 4YKGA 5J60A 2PYXA 4YSHA 1DOCA 5KMPA 3UTEA 3AB1A 1KNRA 3CNJA 2YR4A 3K7MX 4J31A 1K0IA 1FCDA 5L46A 1L9EA 5M0ZA 1E1KA 3GRSA 5JCNA 4Y4NA 1GETA 2BXRA 3OZ2A 3UKPA 2R4EA 1BGJA 4IVOB 1E6EA 2WPFA 3I6DA 1O5WA 3AEBA 3G5QA 3G5SA 2Z5XA 2YQUA 1PXAA 1GRHA 2TMDA 4E0VA 1SEZA 2WDRA 5FS8A 4ZN0A 3ZYXA 1QO8A 2WP9A 3NH3X 4GUVA 3WGTA 3CMMA 2R0PA 3CTYA 4H4VA 2JB1A 4U8KA 4YJGB 5JCLA 2YM2A 1VRQB 3D1CA 4CY8A 4EQSA 1EBDA 1LVLA 2C72A 1PBCA 3QSMA 1H86A 1TYTA 3PO7A 1YY5A 3C96A 1C0PA 3CPIG 3NIXA 4H4SA 3SFDA 2V60A 4APNA 4G9KA 1REOA 1ZK7A 3CNDA 3NYCA 3T37A 2ZZCA 4EIPA 1GT8A 2BK4A 2X50A 3UTGA 1PBFA 2X3NA 3E1TA 3RP6A 3DGHA 2XLUA 3UKAA 2YLTA 1AN9A 1JU2A 2YG3A 1ZX9A 3BI2A 4B66A 1CJ3A 4C5OA 1N4WA 3IWAA 3AE8A 2EQ8A 4C77A 4HA6A 2XFPA 3EF6A 4USQA 3ALMA 4IV9A 3DJEA 3V3OA 4A9WA 2WEUA 5KOWA 1H81A 3I3LA 2XDOA 3AD7B 4U2LA 4CBQA 4H4PA 3VQRA 2NPXA 3KU9A 1H7WA 1MO9A 4A6NB 2GQFA 4YXDA 3GWDA 1E1LA 2O9ZA 1OJDA 3ZNNA 3K30A 3NTAA 2C73A 1B5QA 1S3BA 1IUVA 3P9UA 3C4NA 2C65A 1GNDA 4CNKA 3UKFA 3ABVA 3GMCA 3UP4A 1CL0A 1TRBA 3SQPA 4OVIA 4AT0A 3PVCA 2WETA 3AE3A 1MXTA 2FJEA 2AAQA 2YG4A 1ONFA 4QFDA 3AEAA 4UDPA 5EBKA 2Q6UA 1ELIA 3W4KA 4IA5A 3NHOX 3NTDA 5KMQA 3LB8A 4I58A 1FECA 2Z5YA 1GRGA 2GV8A 3QJ4A 3QVPA 4FDCB 2R4JA 3BI4A 3SZWA 4PABA 4OCGA 2C7GA 2B7RA 3KD9A 4H4ZA 4RG3A 2JAEA 3M12A 4GCMA 4U8MA 4Y4LA 1E7PA 2BC0A 4YJGA 3ZNOA 1V59A 4JDRA 3SGLA 4BK1A 1KDGA 1Q9IA 1AOGA 4DNAA 2QA1A 3NYFA 4K8DA 3UCLA 2BS2A 4GAPA 3IHMA 1DAOA 2R0CA 3RNMA 3UKHA 4DSHA 3LZXA 2R45A 2CFYA 1GESA 4PAAA 2XVJA 4K2XA 1CJ4A 4TM0A 4YJFB 3B3RA 3SY4A 3VR9A 3II4A 2C70A 1EL9A 4U8LA 1NEKA 2ZBWA 4KPRA 3CNTA 3BI5A 5KVHA 2VQBA 2JK6A 3UP5A 1F8SA 1H84A 4DSGA 2HQMA 3K7QX 4X9NA 4U8PA 1DJNA 4B64A 1GPEA 5ER0A 2BS3A 4EQRA 5BRTA 1Z6LA 2Y6QA 5J7XA 1N4VA 3AEDA 5KOXA 2ZZ0A 1Q1RA 4KX6A 1LPFA 1NHPA 1PN0A 1GRFA 3QSEA 2Q7VA 3G5RA 4AT2A 3CN8A 1EL7A 2WU5A 3GWFA 4ZCDA 4XWZA 3AE2A 1NG3A 4EQXA 1QJDA 3K7TA 3P4PA 2PHHA 1CC6A 4EIQA 2GQWA 3NRNA 1IUXA 1XANA 4NTCA 3AEGA 3DH9A 4N9XA 2FBWA 2WU2A 3LJPA 4LU6A 3FPZA 3ZNPA 1KNPA 5HYMA 1KSUA 2VRLA 1GRAA 2GMHA 2IVEA 4Z2TA 5KMSA 1TYPA 4IVMB 3RP8A 2GR3A 2FJBA 4OPGA 2YG5A 4UP3A 4CRTA 4FX9A 1NPXA 1P2EA 5EB5A 4I59A 4Z44A 3AD8B 2YVGA 1L9DA 1N4UA 3URHA 3HYWA 2XFNA 5BUKA 1CHUA 1PJ5A 4YJHB 5FMHA 3P4QA 4ECHA 3UKQA 5BVAA 2J3NA 2E49A 1E1MA 4G6HA 1GRBA 4CY6A 3AE6A 3KA7A 1TDEA 3NN0X 1NHRA 1OJCA 2WBAA 1CC4A 4G6GA 4H4YA 4B65A 1JEHA 4ZCCA 4X9MA 4U8NA 5HXIA 3KPFA 2VOUA 4J34A 1BWCA 3ITJA 4O5UA 4UDQA 3SX6A 4UDRA 1VDCA 4U2TA 4C74A 3DJDA 2XVEA 2C67A 2XCGA 3QVRA 1B37A 3NLCA 3UOVA 3OC4A 3GDNA 3P4RA 3HYXA 5TR3A 2VQ7A 3EPTA 4Z2RA 1D4DA 1PBDA 1GXFA 3SZ0A 4YSXA 4EM4A 3AEEA 1BZLA 2RGJA 5U63A 2OLNA 1O95A 3M0OA 1PS9A 5EOWA 4P9SA 1H83A 4NWZA 5U25A 1VG0A 3T14A 3DK8A 1TDOA 1OJAA 1ZMDA 2XLTA 3SXIA 4Z24A 2H89A 5FS6A 2BRAA 4TM1A 1BF3A 3AYJA 3ICTA 3F8DA 2WP5A 3AEFA 1DNCA 2GR0A 2YM1A 4GDEA 1ZMCA 2YLXA 3KLJA 4B1BA 1GEUA 2YR5A 2UZZA 2FJAA 4B68A 1FL2A 3ALLA 1D7YA 2YG6A 1BGNA 1GSNA 2OA1A 2B7SA 2V5ZA 2YR6A 4LA1A 4H7UA 1CF3A 1KFYA 4H4WA 3VRDB 3ATQA 4C3XA 1JRXA 5HHFA 1OJTA 2V3BA 5CQFA 4ADWA 1S2YA 4H2NA 3EANA 2RABA 4B69A 3LADA 3NK1X 2B76A 2GEWA 1EVIA 3CGEA 4USRA 4WCTA 1YQZA 1FEBA 2YAUA 4A79A 2XFOA 4OPLA 2H88A 2A8XA 1GREA 2Q0KA 3T2YA 4CNJA 5C2TA 5KMRA 4WX1A 1DOEA 1HYUA 3IHGA 1NG4A 3RHAA 1PBBA 1E39A 3UOZA 4A6NA 3FMWA 4OPTA 1EL8A 2ZZBA 3CGBA 3LOVA 4GF7A 3CNSA 2BACA 3P4SA 5KRQA 2C64A 5GRTA 2R0GA 4JN9A 3UOXA 4Z2UA 2JKCA 1KSSA 4FK1C 1Y56A 4J36A 1YQ4A 5FS7A 4H2RA 4TLZA 5KVIA 4H2QA 2JB2A 1PDHA 3BHKA 3IF9A 1GOSA 3KPKA 2WOIA 2YLRA 4D04A 2C76A 2WP6A 1D4EA 2VVLG 2YLWA 3UKLA 1PJ7A 2GH5A 2XLRA 3GD4A 1JOAA 4CCRA 2OALA 5U1OA 4NEWA 5HY5A 3RP7A 4BK2A 1LQUA 4DGKA 1Y0PA 3GDPA 2EQ7A 3Q6JA 1H6VA 1ZOVA 2AQJA 4U8OA 4CCQA 5C3JA 1ZKQA 1X31B 4GR1A 2X8GA 3H8LA 2OAMA 3M13A 2QCUA 1UKVG 2GR1A 3NG7X 4Y4MA 2NVKX 3AE1A 1K0JA 3ATRA 3CGDA 4GDPA 1PXCA 4XWRA 4EMWA 1LTXR 1YQ3A 4NEVA 3UKKA 1NHSA 1MOKA 2DKHA 3ZNQA 4H4XA 2GVCA 2BK3A 1Q1WA 2DKIA 4B63A 1N1PA 4JQ9A 4A7AA 4A99A 2I0ZA 4AOSA 3NT6A 2BC1A 2X8CA 2BRYA 3QFBA 3KVEA 1O94A 2E48A 3AYLA 4II3A 1H82A 1IJHA 3T0KA 3BNMA 4C3YA 4YSYA 1BKWA 4K22A 3WE0A 2WOVA 1PBEA 2WS3A 1ZDLA 3R9UA 3D8XA 4EQWA 4Z43A 5CKUA 3AE5A 4YJHA 2E4GA 2XYOA 1IUWA 3W4JA 4U2SA 3EAOA 2A89A 1QLBA 2YLSA 1K0LA 3V76A 2BCGG 2WPEA 3NN6X 3AYIA 2TPRA 3ICRA 4JNQA 3AWIA 3F8RA 4YTNA 3H8IA 2C75A 3ALJA 1JNRA 4NNJA 1DJQA 3NKSA 1B8SA 3LXDA 3VR8A 4FK1A 2R46A 5IQ4A 4YWOA 3ICSA 2BK5A 1D5TA 4GAVA 1E1NA 5DBJA 2A87A 3HZLA 1PHHA 1C0KA 1VQWA 2GAHB 2X8HA 2YLZA 3P1WA 4OPCA 5LV9A 2WDQA 5EB4A 3GYJA 1GTEA 2VRMA 4H50A 4BJYA 4BK3A 1FEAA 4GRTA 1PXBA 5JCMA 2GB0A 1XHCA 2JB3A 2QAEA 2GMJA 3V3NA 2C3CA 2Y6RA 3S61A 4Z25A 1L9CA 2V3AA 4LIIA 1W4XA 1NHQA 1H7XA 2GF3A 3SFEA 2BYBA 1OJ9A 4K5SA 2VVMA 3NNEA 3AE7A 2BCPA 1GV4A 3GSIA 3QSSA 3BNUA 3F8PA 3CUKA 2WDVA 2YG7A 3GYIA 5M10A 1IUTA 2E4AA 4G74A 3BHFA 3SZCA 2Q0LA 1GTHA 4K7ZA 1K4QA 5IPYA 3IC9A 1GALA 4RSLA 3PS9A 4IA6A 4YJFA 4U8IA 3DJGX 2BS4A 4TLXA 4Z26A 3NGCX 1EL5A 1ZY8A 2CDUA 1XPQA 3KKJA 3NK2X 3QFAA 2DU8A 1C0LA 1JRZA 1VE9A 3ADAB 4U8JA 1DXLA 1RSGA 2BXSA 2VVLA 3H4KA 2W0HA 4ICYA 4II2A 1COYA 1ZOYA 2E82A 4M52A 4JY2A 4OPDA 1KIFA 3LZWA 1L0VA 4BJZA 2WQYA 3DGZA 2IIDA 4JY3A 2RGOA 1P2HA 3C4AA 4BURA 1TDKA 3AXBA 1NDAA 2RGHA 1LV0A 4H4QA 3T2KA 4RG4A 2GAGB 4D03A 3Q9TA 2AR8A 1TDNA 4NTDA 2QA2A 2XLPA 3FIMB
chains in the Genus database with same CATH topology
2XLSA 1LQTA 1IUSA 4MJWA 2OLOA 1B4VA 4H2PA 3T2ZA 2XFUA 2ARDA 4XXGA 1GERA 4AP1A 2XVHA 3ISHA 3CPJG 3DJJA 3AD9B 3DMEA 1M64A 3AE4A 3DK9A 4OPIA 3SZFA 1RYIA 1ZP0A 3DA1A 2YVJA 3S5WA 4X4JA 3ZDNA 2R9ZA 4YKFA 5IQ1A 2V6OA 4J2WA 4YT0A 1S3EA 2B9YA 2EQ6A 1C0IA 2EQ9A 2XFQA 5JCKA 4EMIA 1F8RA 3VRAA 4EM3A 3O0HA 2YVFA 4EMJA 2F5ZA 4H4TA 3W4IA 2V61A 2C66A 1DODA 3GD3A 4HB9A 1FOHA 3GRTA 3AECA 3NK0X 3HYVA 4AOXA 3CPHG 3GYXA 1VG9A 2B9XA 1NENA 2JBVA 4H4RA 3L1RA 2APGA 3SM8A 2GRTA 2YWLA 4A5LA 1D4CA 4YSZA 3NYEA 1F8WA 1XDIA 4K5RA 2CULA 2E1MA 1NAAA 2WHDA 3VRBA 3AE9A 3DK4A 2ACZA 3FG2P 4G73A 4J57A 2B9WA 3SYIA 3COXA 4JNAA 4A65A 1CJ2A 1DDOA 1RP0A 1LJ1A 2CVJA 5FS9A 1CBOA 4J56A 4OPUA 4H4UA 1Y56B 2GR2A 2X99A 1S2QA 4O5QA 4TM4A 4QFCA 3GMBA 5JCIA 3B6DA 2BABA 2XVFA 1DOBA 2WPCA 4AP3A 4YJDA 1M6IA 2XVIA 3G3EA 5BULA 5KXJA 1F6MA 1PJ6A 1IUUA 5KWFA 4YTMA 2WESA 4YTPA 4B67A 2FJDA 1F3PA 2WOWA 1KF6A 2VZ2A 2IVDA 1D7LA 2BA9A 4NTEA 3CIRA 1TDFA 1CJCA 5KNLA 3T31A 1YKJA 1JNZA 3UTFA 2C3DA 4TM3A 4J33A 4REKA 5GSNA 1GRTA 4BV6A 3CGCA 1JRYA 3REDA 1CC2A 3CNPA 2E5VA 3FBSA 3JSKA 2C4CA 3L8KA 4NZHA 3UOYA 3UTHA 4YKGA 5J60A 2PYXA 4YSHA 1DOCA 5KMPA 3UTEA 3AB1A 1KNRA 3CNJA 2YR4A 3K7MX 4J31A 1K0IA 5L46A 1L9EA 1FCDA 5M0ZA 1E1KA 3GRSA 5JCNA 4Y4NA 1GETA 2BXRA 3OZ2A 3UKPA 2R4EA 1BGJA 4IVOB 1E6EA 2WPFA 3I6DA 1O5WA 3AEBA 3G5QA 3G5SA 2Z5XA 2YQUA 1PXAA 1GRHA 2TMDA 4E0VA 1SEZA 2WDRA 5FS8A 4ZN0A 3ZYXA 1QO8A 2WP9A 3NH3X 4GUVA 3WGTA 3CMMA 2R0PA 3CTYA 4H4VA 2JB1A 4U8KA 4YJGB 5JCLA 2YM2A 1VRQB 3D1CA 4CY8A 4EQSA 1EBDA 1LVLA 2C72A 1PBCA 3QSMA 1H86A 1TYTA 3PO7A 1YY5A 3C96A 1C0PA 3CPIG 3NIXA 4H4SA 3SFDA 2V60A 4APNA 4G9KA 1REOA 1ZK7A 3CNDA 3NYCA 3T37A 2ZZCA 4EIPA 1GT8A 2BK4A 2X50A 3UTGA 1PBFA 2X3NA 3E1TA 3RP6A 3DGHA 2XLUA 3UKAA 2YLTA 1AN9A 1JU2A 2YG3A 1ZX9A 3BI2A 4B66A 1CJ3A 4C5OA 1N4WA 3IWAA 3AE8A 2EQ8A 4C77A 4HA6A 2XFPA 3EF6A 4USQA 3ALMA 4IV9A 3DJEA 3V3OA 4A9WA 2WEUA 5KOWA 1H81A 3I3LA 2XDOA 3AD7B 4U2LA 4CBQA 4H4PA 3VQRA 2NPXA 3KU9A 1H7WA 1MO9A 4A6NB 2GQFA 4YXDA 3GWDA 1E1LA 2O9ZA 1OJDA 3ZNNA 3K30A 3NTAA 2C73A 1B5QA 1S3BA 1IUVA 3P9UA 3C4NA 2C65A 1GNDA 4CNKA 3UKFA 3ABVA 3GMCA 3UP4A 1CL0A 1TRBA 3SQPA 4OVIA 4AT0A 3PVCA 2WETA 3AE3A 1MXTA 2FJEA 2AAQA 2YG4A 1ONFA 4QFDA 3AEAA 4UDPA 5EBKA 2Q6UA 1ELIA 3W4KA 3NHOX 3NTDA 4IA5A 5KMQA 3LB8A 4I58A 1FECA 2Z5YA 1GRGA 2GV8A 3QJ4A 3QVPA 4FDCB 2R4JA 3BI4A 3SZWA 4PABA 4OCGA 2C7GA 2B7RA 3KD9A 4H4ZA 4RG3A 2JAEA 3M12A 4GCMA 4U8MA 4Y4LA 1E7PA 2BC0A 4YJGA 3ZNOA 1V59A 4JDRA 3SGLA 4BK1A 1KDGA 1Q9IA 1AOGA 4DNAA 2QA1A 3NYFA 4K8DA 3UCLA 2BS2A 4GAPA 3IHMA 1DAOA 2R0CA 3RNMA 3UKHA 4DSHA 3LZXA 2R45A 2CFYA 1GESA 4PAAA 2XVJA 4K2XA 1CJ4A 4TM0A 4YJFB 3B3RA 3SY4A 3VR9A 3II4A 2C70A 1EL9A 4U8LA 1NEKA 2ZBWA 4KPRA 3CNTA 3BI5A 5KVHA 2VQBA 2JK6A 3UP5A 1F8SA 1H84A 4DSGA 2HQMA 3K7QX 4X9NA 4U8PA 1DJNA 4B64A 1GPEA 5ER0A 2BS3A 4EQRA 5BRTA 1Z6LA 2Y6QA 5J7XA 1N4VA 3AEDA 5KOXA 2ZZ0A 1Q1RA 4KX6A 1LPFA 1NHPA 1PN0A 1GRFA 3QSEA 2Q7VA 3G5RA 4AT2A 3CN8A 1EL7A 2WU5A 3GWFA 4ZCDA 4XWZA 3AE2A 1NG3A 4EQXA 1QJDA 3K7TA 3P4PA 2PHHA 1CC6A 2GQWA 4EIQA 3NRNA 1IUXA 1XANA 4NTCA 3AEGA 3DH9A 4N9XA 2FBWA 2WU2A 3LJPA 4LU6A 3FPZA 3ZNPA 1KNPA 1KSUA 5HYMA 2VRLA 1GRAA 2GMHA 2IVEA 4Z2TA 5KMSA 1TYPA 4IVMB 3RP8A 2GR3A 2FJBA 4OPGA 2YG5A 4UP3A 4CRTA 4FX9A 1NPXA 1P2EA 5EB5A 4I59A 4Z44A 3AD8B 2YVGA 1L9DA 1N4UA 3URHA 3HYWA 2XFNA 5BUKA 1CHUA 1PJ5A 4YJHB 5FMHA 3P4QA 4ECHA 3UKQA 5BVAA 2J3NA 2E49A 1E1MA 4G6HA 1GRBA 4CY6A 3AE6A 3KA7A 1TDEA 3NN0X 1NHRA 1OJCA 2WBAA 1CC4A 4G6GA 4H4YA 4B65A 1JEHA 4ZCCA 4X9MA 4U8NA 5HXIA 3KPFA 2VOUA 4J34A 1BWCA 3ITJA 4O5UA 4UDQA 3SX6A 4UDRA 1VDCA 4U2TA 4C74A 3DJDA 2XVEA 2C67A 2XCGA 3QVRA 1B37A 3NLCA 3UOVA 3OC4A 3GDNA 3P4RA 3HYXA 5TR3A 2VQ7A 3EPTA 4Z2RA 1D4DA 1PBDA 1GXFA 3SZ0A 4YSXA 4EM4A 3AEEA 1BZLA 2RGJA 5U63A 2OLNA 1O95A 3M0OA 1PS9A 5EOWA 4P9SA 1H83A 4NWZA 5U25A 1VG0A 3T14A 3DK8A 1TDOA 1OJAA 1ZMDA 2XLTA 3SXIA 4Z24A 2H89A 5FS6A 2BRAA 4TM1A 1BF3A 3AYJA 3ICTA 3F8DA 2WP5A 3AEFA 1DNCA 2GR0A 2YM1A 4GDEA 1ZMCA 2YLXA 3KLJA 4B1BA 1GEUA 2YR5A 2UZZA 2FJAA 4B68A 1FL2A 3ALLA 1D7YA 2YG6A 1BGNA 1GSNA 2OA1A 2B7SA 2V5ZA 2YR6A 4LA1A 4H7UA 1CF3A 1KFYA 4H4WA 3VRDB 3ATQA 4C3XA 1JRXA 5HHFA 1OJTA 2V3BA 5CQFA 4ADWA 1S2YA 4H2NA 3EANA 2RABA 4B69A 3LADA 3NK1X 2B76A 2GEWA 1EVIA 3CGEA 4USRA 4WCTA 1YQZA 1FEBA 2YAUA 4A79A 2XFOA 4OPLA 2H88A 2A8XA 1GREA 2Q0KA 3T2YA 4CNJA 5C2TA 5KMRA 4WX1A 1DOEA 1HYUA 3IHGA 1NG4A 3RHAA 1PBBA 1E39A 3UOZA 4A6NA 3FMWA 4OPTA 1EL8A 2ZZBA 3CGBA 3LOVA 3CNSA 4GF7A 2BACA 3P4SA 5KRQA 2C64A 5GRTA 2R0GA 4JN9A 3UOXA 4Z2UA 2JKCA 1KSSA 4FK1C 1Y56A 4J36A 1YQ4A 5FS7A 4H2RA 4TLZA 5KVIA 4H2QA 2JB2A 1PDHA 3BHKA 3IF9A 1GOSA 3KPKA 2WOIA 2YLRA 4D04A 2C76A 2WP6A 1D4EA 2VVLG 2YLWA 3UKLA 1PJ7A 2GH5A 2XLRA 3GD4A 1JOAA 4CCRA 2OALA 5U1OA 4NEWA 5HY5A 3RP7A 4BK2A 1LQUA 4DGKA 1Y0PA 3GDPA 2EQ7A 3Q6JA 1H6VA 1ZOVA 2AQJA 4U8OA 4CCQA 5C3JA 1ZKQA 1X31B 4GR1A 2X8GA 3H8LA 2OAMA 3M13A 2QCUA 1UKVG 2GR1A 3NG7X 4Y4MA 2NVKX 3AE1A 1K0JA 3ATRA 3CGDA 4GDPA 1PXCA 4XWRA 4EMWA 1LTXR 1YQ3A 4NEVA 3UKKA 1NHSA 1MOKA 2DKHA 3ZNQA 4H4XA 2GVCA 2BK3A 1Q1WA 2DKIA 4B63A 1N1PA 4JQ9A 4A7AA 4A99A 2I0ZA 4AOSA 3NT6A 2BC1A 2X8CA 2BRYA 3QFBA 3KVEA 1O94A 2E48A 3AYLA 4II3A 1H82A 1IJHA 3T0KA 3BNMA 4C3YA 4YSYA 1BKWA 4K22A 3WE0A 2WOVA 1PBEA 2WS3A 1ZDLA 3R9UA 3D8XA 4EQWA 4Z43A 5CKUA 3AE5A 4YJHA 2E4GA 2XYOA 1IUWA 3W4JA 4U2SA 3EAOA 2A89A 1QLBA 2YLSA 1K0LA 3V76A 2BCGG 2WPEA 3NN6X 3AYIA 2TPRA 3ICRA 4JNQA 3AWIA 3F8RA 4YTNA 3H8IA 2C75A 1JNRA 3ALJA 4NNJA 1DJQA 3NKSA 1B8SA 3LXDA 3VR8A 4FK1A 2R46A 5IQ4A 4YWOA 3ICSA 2BK5A 1D5TA 4GAVA 1E1NA 5DBJA 2A87A 3HZLA 1PHHA 1C0KA 1VQWA 2GAHB 2X8HA 2YLZA 3P1WA 4OPCA 5LV9A 2WDQA 5EB4A 3GYJA 1GTEA 2VRMA 4H50A 4BJYA 1FEAA 4BK3A 4GRTA 1PXBA 5JCMA 2GB0A 1XHCA 2JB3A 2QAEA 2GMJA 3V3NA 2C3CA 2Y6RA 3S61A 4Z25A 1L9CA 2V3AA 4LIIA 1W4XA 1NHQA 1H7XA 2GF3A 3SFEA 2BYBA 1OJ9A 4K5SA 2VVMA 3NNEA 3AE7A 2BCPA 1GV4A 3GSIA 3QSSA 3BNUA 3F8PA 3CUKA 2WDVA 2YG7A 3GYIA 5M10A 1IUTA 2E4AA 4G74A 3BHFA 3SZCA 2Q0LA 1GTHA 4K7ZA 1K4QA 5IPYA 3IC9A 1GALA 4RSLA 3PS9A 4YJFA 4IA6A 4U8IA 3DJGX 2BS4A 4TLXA 4Z26A 3NGCX 1EL5A 1ZY8A 2CDUA 1XPQA 3KKJA 3NK2X 3QFAA 2DU8A 1C0LA 1JRZA 1VE9A 3ADAB 4U8JA 1DXLA 1RSGA 2BXSA 2VVLA 3H4KA 2W0HA 4ICYA 4II2A 1COYA 1ZOYA 2E82A 4M52A 4JY2A 4OPDA 1KIFA 3LZWA 1L0VA 4BJZA 2WQYA 3DGZA 2IIDA 4JY3A 2RGOA 1P2HA 3C4AA 4BURA 1TDKA 3AXBA 1NDAA 2RGHA 1LV0A 4H4QA 3T2KA 4RG4A 2GAGB 4D03A 3Q9TA 2AR8A 1TDNA 4NTDA 2QA2A 2XLPA 3FIMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLS A;  1LQT A;  1IUS A;  4MJW A;  2OLO A;  1B4V A;  4H2P A;  2XFU A;  2ARD A;  4XXG A;  1GER A;  4AP1 A;  2XVH A;  3ISH A;  3CPJ G;  3DJJ A;  3AD9 B;  3DME A;  1M64 A;  3AE4 A;  3DK9 A;  4OPI A;  1RYI A;  1ZP0 A;  3DA1 A;  2YVJ A;  3S5W A;  4X4J A;  3ZDN A;  2R9Z A;  4YKF A;  5IQ1 A;  2V6O A;  4J2W A;  4YT0 A;  1S3E A;  2B9Y A;  2EQ6 A;  1C0I A;  2EQ9 A;  2XFQ A;  5JCK A;  4EMI A;  1F8R A;  3VRA A;  4EM3 A;  3O0H A;  2YVF A;  4EMJ A;  2F5Z A;  4H4T A;  3W4I A;  2V61 A;  2C66 A;  1DOD A;  3GD3 A;  4HB9 A;  1FOH A;  3GRT A;  3AEC A;  3NK0 X;  4AOX A;  3CPH G;  1VG9 A;  2B9X A;  1NEN A;  2JBV A;  4H4R A;  3L1R A;  2APG A;  3SM8 A;  2GRT A;  2YWL A;  4A5L A;  1D4C A;  4YSZ A;  3NYE A;  1F8W A;  1XDI A;  4K5R A;  2CUL A;  2E1M A;  1NAA A;  2WHD A;  3VRB A;  3AE9 A;  3DK4 A;  2ACZ A;  3FG2 P;  4J57 A;  2B9W A;  4A65 A;  3COX A;  4JNA A;  1CJ2 A;  1DDO A;  1RP0 A;  1LJ1 A;  2CVJ A;  5FS9 A;  1CBO A;  4J56 A;  4OPU A;  4H4U A;  1Y56 B;  2GR2 A;  2X99 A;  1S2Q A;  4O5Q A;  4TM4 A;  4QFC A;  3GMB A;  5JCI A;  3B6D A;  2BAB A;  2XVF A;  1DOB A;  2WPC A;  4AP3 A;  4YJD A;  1M6I A;  2XVI A;  3G3E A;  5BUL A;  5KXJ A;  1F6M A;  1PJ6 A;  1IUU A;  5KWF A;  4YTM A;  2WES A;  4YTP A;  4B67 A;  2FJD A;  1F3P A;  2WOW A;  1KF6 A;  2VZ2 A;  2IVD A;  1D7L A;  2BA9 A;  4NTE A;  3CIR A;  1TDF A;  1CJC A;  1YKJ A;  1JNZ A;  3UTF A;  2C3D A;  4TM3 A;  4J33 A;  4REK A;  5GSN A;  1GRT A;  4BV6 A;  3CGC A;  1JRY A;  3RED A;  1CC2 A;  3CNP A;  2E5V A;  3FBS A;  3JSK A;  3L8K A;  4NZH A;  3UOY A;  3UTH A;  4YKG A;  5J60 A;  2PYX A;  4YSH A;  1DOC A;  3UTE A;  3AB1 A;  1KNR A;  3CNJ A;  2YR4 A;  3K7M X;  4J31 A;  1K0I A;  5L46 A;  1L9E A;  1FCD A;  5M0Z A;  1E1K A;  3GRS A;  5JCN A;  4Y4N A;  1GET A;  2BXR A;  3OZ2 A;  3UKP A;  2R4E A;  1BGJ A;  4IVO B;  1E6E A;  2WPF A;  3I6D A;  1O5W A;  3AEB A;  3G5Q A;  3G5S A;  2Z5X A;  2YQU A;  1PXA A;  1GRH A;  2TMD A;  4E0V A;  1SEZ A;  2WDR A;  5FS8 A;  4ZN0 A;  3ZYX A;  1QO8 A;  2WP9 A;  3NH3 X;  4GUV A;  3WGT A;  4H4V A;  2R0P A;  3CTY A;  2JB1 A;  4U8K A;  4YJG B;  5JCL A;  2YM2 A;  1VRQ B;  3D1C A;  4CY8 A;  4EQS A;  1EBD A;  1LVL A;  2C72 A;  1PBC A;  3QSM A;  1H86 A;  1TYT A;  3PO7 A;  1YY5 A;  3C96 A;  1C0P A;  3CPI G;  3NIX A;  4H4S A;  3SFD A;  2V60 A;  4APN A;  1REO A;  1ZK7 A;  3CND A;  3NYC A;  3T37 A;  2ZZC A;  4EIP A;  1GT8 A;  2BK4 A;  2X50 A;  3UTG A;  1PBF A;  2X3N A;  3E1T A;  3RP6 A;  3DGH A;  2XLU A;  3UKA A;  2YLT A;  1AN9 A;  1JU2 A;  2YG3 A;  1ZX9 A;  3BI2 A;  4B66 A;  1CJ3 A;  4C5O A;  1N4W A;  3IWA A;  3AE8 A;  2EQ8 A;  4C77 A;  4HA6 A;  2XFP A;  3EF6 A;  4USQ A;  3ALM A;  4IV9 A;  3DJE A;  3V3O A;  4A9W A;  2WEU A;  5KOW A;  1H81 A;  3I3L A;  2XDO A;  3AD7 B;  4U2L A;  4CBQ A;  4H4P A;  3VQR A;  2NPX A;  3KU9 A;  1H7W A;  1MO9 A;  4A6N B;  2GQF A;  4YXD A;  3GWD A;  1E1L A;  2O9Z A;  1OJD A;  3ZNN A;  3K30 A;  3NTA A;  2C73 A;  1B5Q A;  1S3B A;  1IUV A;  3P9U A;  3C4N A;  2C65 A;  1GND A;  4CNK A;  3UKF A;  3ABV A;  3GMC A;  3UP4 A;  1CL0 A;  1TRB A;  3SQP A;  4OVI A;  4AT0 A;  3PVC A;  2WET A;  3AE3 A;  1MXT A;  2FJE A;  2AAQ A;  2YG4 A;  1ONF A;  4QFD A;  3AEA A;  4UDP A;  5EBK A;  2Q6U A;  1ELI A;  3W4K A;  3NHO X;  3NTD A;  4IA5 A;  3LB8 A;  4I58 A;  1FEC A;  2Z5Y A;  1GRG A;  2GV8 A;  3QJ4 A;  3QVP A;  4FDC B;  2R4J A;  3BI4 A;  4PAB A;  4OCG A;  2C7G A;  2B7R A;  3KD9 A;  4H4Z A;  4RG3 A;  2JAE A;  3M12 A;  4GCM A;  4U8M A;  4Y4L A;  1E7P A;  2BC0 A;  4YJG A;  3ZNO A;  1V59 A;  4JDR A;  3SGL A;  4BK1 A;  1KDG A;  1Q9I A;  1AOG A;  4DNA A;  2QA1 A;  3NYF A;  4K8D A;  3UCL A;  2BS2 A;  3IHM A;  1DAO A;  2R0C A;  3RNM A;  3UKH A;  4DSH A;  3LZX A;  2R45 A;  2CFY A;  1GES A;  4PAA A;  2XVJ A;  4K2X A;  1CJ4 A;  4TM0 A;  4YJF B;  3B3R A;  3VR9 A;  3II4 A;  2C70 A;  1EL9 A;  4U8L A;  1NEK A;  2ZBW A;  4KPR A;  3CNT A;  3BI5 A;  5KVH A;  2VQB A;  2JK6 A;  3UP5 A;  1F8S A;  1H84 A;  4DSG A;  2HQM A;  3K7Q X;  4X9N A;  4U8P A;  1DJN A;  4B64 A;  1GPE A;  5ER0 A;  2BS3 A;  4EQR A;  5BRT A;  1Z6L A;  2Y6Q A;  5J7X A;  1N4V A;  3AED A;  5KOX A;  2ZZ0 A;  1Q1R A;  4KX6 A;  1LPF A;  1NHP A;  1PN0 A;  1GRF A;  3QSE A;  2Q7V A;  3G5R A;  4AT2 A;  3CN8 A;  1EL7 A;  2WU5 A;  3GWF A;  4ZCD A;  4XWZ A;  3AE2 A;  1NG3 A;  4EQX A;  1QJD A;  3K7T A;  3P4P A;  2PHH A;  1CC6 A;  2GQW A;  4EIQ A;  3NRN A;  1IUX A;  1XAN A;  4NTC A;  3AEG A;  3DH9 A;  4N9X A;  2FBW A;  2WU2 A;  3LJP A;  4LU6 A;  3FPZ A;  3ZNP A;  1KNP A;  1KSU A;  5HYM A;  2VRL A;  1GRA A;  2GMH A;  2IVE A;  4Z2T A;  1TYP A;  4IVM B;  3RP8 A;  2GR3 A;  2FJB A;  4OPG A;  2YG5 A;  4UP3 A;  4CRT A;  4FX9 A;  1NPX A;  1P2E A;  5EB5 A;  4I59 A;  4Z44 A;  3AD8 B;  2YVG A;  1L9D A;  1N4U A;  3URH A;  2XFN A;  5BUK A;  1CHU A;  1PJ5 A;  4YJH B;  5FMH A;  3P4Q A;  4ECH A;  3UKQ A;  5BVA A;  2J3N A;  2E49 A;  1E1M A;  1GRB A;  4CY6 A;  3AE6 A;  3KA7 A;  1TDE A;  3NN0 X;  1NHR A;  1OJC A;  2WBA A;  1CC4 A;  4H4Y A;  4B65 A;  1JEH A;  4ZCC A;  4X9M A;  4U8N A;  5HXI A;  3KPF A;  2VOU A;  4J34 A;  1BWC A;  3ITJ A;  4O5U A;  4UDQ A;  4UDR A;  1VDC A;  4U2T A;  4C74 A;  3DJD A;  2XVE A;  2C67 A;  2XCG A;  3QVR A;  1B37 A;  3NLC A;  3UOV A;  3OC4 A;  3GDN A;  3P4R A;  5TR3 A;  2VQ7 A;  3EPT A;  4Z2R A;  1D4D A;  1PBD A;  1GXF A;  4YSX A;  4EM4 A;  3AEE A;  1BZL A;  2RGJ A;  5U63 A;  2OLN A;  1O95 A;  3M0O A;  1PS9 A;  5EOW A;  4P9S A;  1H83 A;  5U25 A;  1VG0 A;  3DK8 A;  1TDO A;  1OJA A;  1ZMD A;  2XLT A;  4Z24 A;  2H89 A;  5FS6 A;  4TM1 A;  1BF3 A;  3AYJ A;  3ICT A;  3F8D A;  2WP5 A;  3AEF A;  1DNC A;  2GR0 A;  2YM1 A;  4GDE A;  1ZMC A;  2YLX A;  3KLJ A;  4B1B A;  1GEU A;  2YR5 A;  2UZZ A;  2FJA A;  4B68 A;  1FL2 A;  3ALL A;  1D7Y A;  2YG6 A;  1BGN A;  1GSN A;  2OA1 A;  2B7S A;  2V5Z A;  2YR6 A;  4LA1 A;  4H7U A;  1CF3 A;  1KFY A;  4H4W A;  3VRD B;  3ATQ A;  4C3X A;  1JRX A;  5HHF A;  1OJT A;  2V3B A;  5CQF A;  4ADW A;  1S2Y A;  4H2N A;  3EAN A;  2RAB A;  4B69 A;  3LAD A;  3NK1 X;  2B76 A;  2GEW A;  1EVI A;  3CGE A;  4USR A;  4WCT A;  1YQZ A;  1FEB A;  2YAU A;  4A79 A;  2XFO A;  4OPL A;  2H88 A;  2A8X A;  1GRE A;  2Q0K A;  4CNJ A;  5C2T A;  4WX1 A;  1DOE A;  1HYU A;  3IHG A;  1NG4 A;  3RHA A;  1PBB A;  1E39 A;  3UOZ A;  4A6N A;  3FMW A;  4OPT A;  1EL8 A;  2ZZB A;  3CGB A;  3LOV A;  3CNS A;  4GF7 A;  2BAC A;  3P4S A;  5KRQ A;  2C64 A;  5GRT A;  2R0G A;  4JN9 A;  3UOX A;  4Z2U A;  2JKC A;  1KSS A;  4FK1 C;  1Y56 A;  4J36 A;  1YQ4 A;  5FS7 A;  4H2R A;  4TLZ A;  5KVI A;  4H2Q A;  2JB2 A;  1PDH A;  3BHK A;  3IF9 A;  1GOS A;  2WOI A;  2YLR A;  4D04 A;  2C76 A;  2WP6 A;  1D4E A;  2VVL G;  2YLW A;  3UKL A;  1PJ7 A;  2GH5 A;  2XLR A;  3GD4 A;  1JOA A;  4CCR A;  2OAL A;  5U1O A;  4NEW A;  5HY5 A;  3RP7 A;  4BK2 A;  1LQU A;  4DGK A;  1Y0P A;  3GDP A;  2EQ7 A;  3Q6J A;  1H6V A;  1ZOV A;  2AQJ A;  4U8O A;  4CCQ A;  5C3J A;  1ZKQ A;  1X31 B;  4GR1 A;  2X8G A;  3H8L A;  2OAM A;  3M13 A;  2QCU A;  1UKV G;  2GR1 A;  3NG7 X;  4Y4M A;  2NVK X;  3AE1 A;  1K0J A;  3ATR A;  3CGD A;  4GDP A;  1PXC A;  4XWR A;  4EMW A;  1LTX R;  1YQ3 A;  4NEV A;  3UKK A;  1NHS A;  1MOK A;  2DKH A;  3ZNQ A;  4H4X A;  2GVC A;  2BK3 A;  1Q1W A;  2DKI A;  4B63 A;  1N1P A;  4JQ9 A;  4A7A A;  4A99 A;  2I0Z A;  4AOS A;  3NT6 A;  2BC1 A;  2X8C A;  3QFB A;  3KVE A;  1O94 A;  2E48 A;  3AYL A;  1H82 A;  1IJH A;  4C3Y A;  3BNM A;  4YSY A;  1BKW A;  4K22 A;  3WE0 A;  2WOV A;  1PBE A;  2WS3 A;  1ZDL A;  3R9U A;  3D8X A;  4EQW A;  4Z43 A;  5CKU A;  3AE5 A;  4YJH A;  2E4G A;  2XYO A;  1IUW A;  3W4J A;  4U2S A;  3EAO A;  2A89 A;  1QLB A;  2YLS A;  1K0L A;  3V76 A;  2BCG G;  2WPE A;  3NN6 X;  3AYI A;  2TPR A;  3ICR A;  4JNQ A;  3AWI A;  3F8R A;  4YTN A;  3H8I A;  2C75 A;  1JNR A;  3ALJ A;  1DJQ A;  3NKS A;  1B8S A;  3LXD A;  3VR8 A;  4FK1 A;  2R46 A;  5IQ4 A;  4YWO A;  3ICS A;  2BK5 A;  1D5T A;  5DBJ A;  1E1N A;  2A87 A;  3HZL A;  1PHH A;  1C0K A;  1VQW A;  2GAH B;  2X8H A;  2YLZ A;  3P1W A;  4OPC A;  5LV9 A;  2WDQ A;  5EB4 A;  3GYJ A;  1GTE A;  2VRM A;  4H50 A;  4BJY A;  1FEA A;  4BK3 A;  4GRT A;  1PXB A;  5JCM A;  2GB0 A;  1XHC A;  2JB3 A;  2QAE A;  2GMJ A;  3V3N A;  2C3C A;  2Y6R A;  3S61 A;  4Z25 A;  1L9C A;  2V3A A;  4LII A;  1W4X A;  1NHQ A;  1H7X A;  2GF3 A;  3SFE A;  2BYB A;  1OJ9 A;  4K5S A;  2VVM A;  3NNE A;  3AE7 A;  2BCP A;  1GV4 A;  3GSI A;  3QSS A;  3BNU A;  3F8P A;  3CUK A;  2WDV A;  2YG7 A;  3GYI A;  5M10 A;  1IUT A;  2E4A A;  3BHF A;  2Q0L A;  1GTH A;  4K7Z A;  1K4Q A;  5IPY A;  3IC9 A;  1GAL A;  4RSL A;  3PS9 A;  4YJF A;  4IA6 A;  4U8I A;  3DJG X;  2BS4 A;  4TLX A;  4Z26 A;  3NGC X;  1EL5 A;  1ZY8 A;  2CDU A;  1XPQ A;  3KKJ A;  3NK2 X;  3QFA A;  2DU8 A;  1C0L A;  1JRZ A;  1VE9 A;  3ADA B;  4U8J A;  1DXL A;  1RSG A;  2BXS A;  2VVL A;  3H4K A;  2W0H A;  4ICY A;  1COY A;  1ZOY A;  2E82 A;  4M52 A;  4JY2 A;  4OPD A;  1KIF A;  3LZW A;  1L0V A;  4BJZ A;  2WQY A;  3DGZ A;  2IID A;  4JY3 A;  2RGO A;  1P2H A;  3C4A A;  4BUR A;  1TDK A;  3AXB A;  1NDA A;  2RGH A;  1LV0 A;  4H4Q A;  4RG4 A;  2GAG B;  4D03 A;  3Q9T A;  2AR8 A;  1TDN A;  4NTD A;  2QA2 A;  2XLP A;  3FIM B; 
#chains in the Genus database with same CATH topology
 2XLS A;  1LQT A;  1IUS A;  4MJW A;  2OLO A;  1B4V A;  4H2P A;  3T2Z A;  2XFU A;  2ARD A;  4XXG A;  1GER A;  4AP1 A;  2XVH A;  3ISH A;  3CPJ G;  3DJJ A;  3AD9 B;  3DME A;  1M64 A;  3AE4 A;  3DK9 A;  4OPI A;  3SZF A;  1RYI A;  1ZP0 A;  3DA1 A;  2YVJ A;  3S5W A;  4X4J A;  3ZDN A;  2R9Z A;  4YKF A;  5IQ1 A;  2V6O A;  4J2W A;  4YT0 A;  1S3E A;  2B9Y A;  2EQ6 A;  1C0I A;  2EQ9 A;  2XFQ A;  5JCK A;  4EMI A;  1F8R A;  3VRA A;  4EM3 A;  3O0H A;  2YVF A;  4EMJ A;  2F5Z A;  4H4T A;  3W4I A;  2V61 A;  2C66 A;  1DOD A;  3GD3 A;  4HB9 A;  1FOH A;  3GRT A;  3AEC A;  3NK0 X;  3HYV A;  4AOX A;  3CPH G;  3GYX A;  1VG9 A;  2B9X A;  1NEN A;  2JBV A;  4H4R A;  3L1R A;  2APG A;  3SM8 A;  2GRT A;  2YWL A;  4A5L A;  1D4C A;  4YSZ A;  3NYE A;  1F8W A;  1XDI A;  4K5R A;  2CUL A;  2E1M A;  1NAA A;  2WHD A;  3VRB A;  3AE9 A;  3DK4 A;  2ACZ A;  3FG2 P;  4G73 A;  4J57 A;  2B9W A;  3SYI A;  3COX A;  4JNA A;  4A65 A;  1CJ2 A;  1DDO A;  1RP0 A;  1LJ1 A;  2CVJ A;  5FS9 A;  1CBO A;  4J56 A;  4OPU A;  4H4U A;  1Y56 B;  2GR2 A;  2X99 A;  1S2Q A;  4O5Q A;  4TM4 A;  4QFC A;  3GMB A;  5JCI A;  3B6D A;  2BAB A;  2XVF A;  1DOB A;  2WPC A;  4AP3 A;  4YJD A;  1M6I A;  2XVI A;  3G3E A;  5BUL A;  5KXJ A;  1F6M A;  1PJ6 A;  1IUU A;  5KWF A;  4YTM A;  2WES A;  4YTP A;  4B67 A;  2FJD A;  1F3P A;  2WOW A;  1KF6 A;  2VZ2 A;  2IVD A;  1D7L A;  2BA9 A;  4NTE A;  3CIR A;  1TDF A;  1CJC A;  5KNL A;  3T31 A;  1YKJ A;  1JNZ A;  3UTF A;  2C3D A;  4TM3 A;  4J33 A;  4REK A;  5GSN A;  1GRT A;  4BV6 A;  3CGC A;  1JRY A;  3RED A;  1CC2 A;  3CNP A;  2E5V A;  3FBS A;  3JSK A;  2C4C A;  3L8K A;  4NZH A;  3UOY A;  3UTH A;  4YKG A;  5J60 A;  2PYX A;  4YSH A;  1DOC A;  5KMP A;  3UTE A;  3AB1 A;  1KNR A;  3CNJ A;  2YR4 A;  3K7M X;  4J31 A;  1K0I A;  1FCD A;  5L46 A;  1L9E A;  5M0Z A;  1E1K A;  3GRS A;  5JCN A;  4Y4N A;  1GET A;  2BXR A;  3OZ2 A;  3UKP A;  2R4E A;  1BGJ A;  4IVO B;  1E6E A;  2WPF A;  3I6D A;  1O5W A;  3AEB A;  3G5Q A;  3G5S A;  2Z5X A;  2YQU A;  1PXA A;  1GRH A;  2TMD A;  4E0V A;  1SEZ A;  2WDR A;  5FS8 A;  4ZN0 A;  3ZYX A;  1QO8 A;  2WP9 A;  3NH3 X;  4GUV A;  3WGT A;  3CMM A;  2R0P A;  3CTY A;  4H4V A;  2JB1 A;  4U8K A;  4YJG B;  5JCL A;  2YM2 A;  1VRQ B;  3D1C A;  4CY8 A;  4EQS A;  1EBD A;  1LVL A;  2C72 A;  1PBC A;  3QSM A;  1H86 A;  1TYT A;  3PO7 A;  1YY5 A;  3C96 A;  1C0P A;  3CPI G;  3NIX A;  4H4S A;  3SFD A;  2V60 A;  4APN A;  4G9K A;  1REO A;  1ZK7 A;  3CND A;  3NYC A;  3T37 A;  2ZZC A;  4EIP A;  1GT8 A;  2BK4 A;  2X50 A;  3UTG A;  1PBF A;  2X3N A;  3E1T A;  3RP6 A;  3DGH A;  2XLU A;  3UKA A;  2YLT A;  1AN9 A;  1JU2 A;  2YG3 A;  1ZX9 A;  3BI2 A;  4B66 A;  1CJ3 A;  4C5O A;  1N4W A;  3IWA A;  3AE8 A;  2EQ8 A;  4C77 A;  4HA6 A;  2XFP A;  3EF6 A;  4USQ A;  3ALM A;  4IV9 A;  3DJE A;  3V3O A;  4A9W A;  2WEU A;  5KOW A;  1H81 A;  3I3L A;  2XDO A;  3AD7 B;  4U2L A;  4CBQ A;  4H4P A;  3VQR A;  2NPX A;  3KU9 A;  1H7W A;  1MO9 A;  4A6N B;  2GQF A;  4YXD A;  3GWD A;  1E1L A;  2O9Z A;  1OJD A;  3ZNN A;  3K30 A;  3NTA A;  2C73 A;  1B5Q A;  1S3B A;  1IUV A;  3P9U A;  3C4N A;  2C65 A;  1GND A;  4CNK A;  3UKF A;  3ABV A;  3GMC A;  3UP4 A;  1CL0 A;  1TRB A;  3SQP A;  4OVI A;  4AT0 A;  3PVC A;  2WET A;  3AE3 A;  1MXT A;  2FJE A;  2AAQ A;  2YG4 A;  1ONF A;  4QFD A;  3AEA A;  4UDP A;  5EBK A;  2Q6U A;  1ELI A;  3W4K A;  4IA5 A;  3NHO X;  3NTD A;  5KMQ A;  3LB8 A;  4I58 A;  1FEC A;  2Z5Y A;  1GRG A;  2GV8 A;  3QJ4 A;  3QVP A;  4FDC B;  2R4J A;  3BI4 A;  3SZW A;  4PAB A;  4OCG A;  2C7G A;  2B7R A;  3KD9 A;  4H4Z A;  4RG3 A;  2JAE A;  3M12 A;  4GCM A;  4U8M A;  4Y4L A;  1E7P A;  2BC0 A;  4YJG A;  3ZNO A;  1V59 A;  4JDR A;  3SGL A;  4BK1 A;  1KDG A;  1Q9I A;  1AOG A;  4DNA A;  2QA1 A;  3NYF A;  4K8D A;  3UCL A;  2BS2 A;  4GAP A;  3IHM A;  1DAO A;  2R0C A;  3RNM A;  3UKH A;  4DSH A;  3LZX A;  2R45 A;  2CFY A;  1GES A;  4PAA A;  2XVJ A;  4K2X A;  1CJ4 A;  4TM0 A;  4YJF B;  3B3R A;  3SY4 A;  3VR9 A;  3II4 A;  2C70 A;  1EL9 A;  4U8L A;  1NEK A;  2ZBW A;  4KPR A;  3CNT A;  3BI5 A;  5KVH A;  2VQB A;  2JK6 A;  3UP5 A;  1F8S A;  1H84 A;  4DSG A;  2HQM A;  3K7Q X;  4X9N A;  4U8P A;  1DJN A;  4B64 A;  1GPE A;  5ER0 A;  2BS3 A;  4EQR A;  5BRT A;  1Z6L A;  2Y6Q A;  5J7X A;  1N4V A;  3AED A;  5KOX A;  2ZZ0 A;  1Q1R A;  4KX6 A;  1LPF A;  1NHP A;  1PN0 A;  1GRF A;  3QSE A;  2Q7V A;  3G5R A;  4AT2 A;  3CN8 A;  1EL7 A;  2WU5 A;  3GWF A;  4ZCD A;  4XWZ A;  3AE2 A;  1NG3 A;  4EQX A;  1QJD A;  3K7T A;  3P4P A;  2PHH A;  1CC6 A;  4EIQ A;  2GQW A;  3NRN A;  1IUX A;  1XAN A;  4NTC A;  3AEG A;  3DH9 A;  4N9X A;  2FBW A;  2WU2 A;  3LJP A;  4LU6 A;  3FPZ A;  3ZNP A;  1KNP A;  5HYM A;  1KSU A;  2VRL A;  1GRA A;  2GMH A;  2IVE A;  4Z2T A;  5KMS A;  1TYP A;  4IVM B;  3RP8 A;  2GR3 A;  2FJB A;  4OPG A;  2YG5 A;  4UP3 A;  4CRT A;  4FX9 A;  1NPX A;  1P2E A;  5EB5 A;  4I59 A;  4Z44 A;  3AD8 B;  2YVG A;  1L9D A;  1N4U A;  3URH A;  3HYW A;  2XFN A;  5BUK A;  1CHU A;  1PJ5 A;  4YJH B;  5FMH A;  3P4Q A;  4ECH A;  3UKQ A;  5BVA A;  2J3N A;  2E49 A;  1E1M A;  4G6H A;  1GRB A;  4CY6 A;  3AE6 A;  3KA7 A;  1TDE A;  3NN0 X;  1NHR A;  1OJC A;  2WBA A;  1CC4 A;  4G6G A;  4H4Y A;  4B65 A;  1JEH A;  4ZCC A;  4X9M A;  4U8N A;  5HXI A;  3KPF A;  2VOU A;  4J34 A;  1BWC A;  3ITJ A;  4O5U A;  4UDQ A;  3SX6 A;  4UDR A;  1VDC A;  4U2T A;  4C74 A;  3DJD A;  2XVE A;  2C67 A;  2XCG A;  3QVR A;  1B37 A;  3NLC A;  3UOV A;  3OC4 A;  3GDN A;  3P4R A;  3HYX A;  5TR3 A;  2VQ7 A;  3EPT A;  4Z2R A;  1D4D A;  1PBD A;  1GXF A;  3SZ0 A;  4YSX A;  4EM4 A;  3AEE A;  1BZL A;  2RGJ A;  5U63 A;  2OLN A;  1O95 A;  3M0O A;  1PS9 A;  5EOW A;  4P9S A;  1H83 A;  4NWZ A;  5U25 A;  1VG0 A;  3T14 A;  3DK8 A;  1TDO A;  1OJA A;  1ZMD A;  2XLT A;  3SXI A;  4Z24 A;  2H89 A;  5FS6 A;  2BRA A;  4TM1 A;  1BF3 A;  3AYJ A;  3ICT A;  3F8D A;  2WP5 A;  3AEF A;  1DNC A;  2GR0 A;  2YM1 A;  4GDE A;  1ZMC A;  2YLX A;  3KLJ A;  4B1B A;  1GEU A;  2YR5 A;  2UZZ A;  2FJA A;  4B68 A;  1FL2 A;  3ALL A;  1D7Y A;  2YG6 A;  1BGN A;  1GSN A;  2OA1 A;  2B7S A;  2V5Z A;  2YR6 A;  4LA1 A;  4H7U A;  1CF3 A;  1KFY A;  4H4W A;  3VRD B;  3ATQ A;  4C3X A;  1JRX A;  5HHF A;  1OJT A;  2V3B A;  5CQF A;  4ADW A;  1S2Y A;  4H2N A;  3EAN A;  2RAB A;  4B69 A;  3LAD A;  3NK1 X;  2B76 A;  2GEW A;  1EVI A;  3CGE A;  4USR A;  4WCT A;  1YQZ A;  1FEB A;  2YAU A;  4A79 A;  2XFO A;  4OPL A;  2H88 A;  2A8X A;  1GRE A;  2Q0K A;  3T2Y A;  4CNJ A;  5C2T A;  5KMR A;  4WX1 A;  1DOE A;  1HYU A;  3IHG A;  1NG4 A;  3RHA A;  1PBB A;  1E39 A;  3UOZ A;  4A6N A;  3FMW A;  4OPT A;  1EL8 A;  2ZZB A;  3CGB A;  3LOV A;  4GF7 A;  3CNS A;  2BAC A;  3P4S A;  5KRQ A;  2C64 A;  5GRT A;  2R0G A;  4JN9 A;  3UOX A;  4Z2U A;  2JKC A;  1KSS A;  4FK1 C;  1Y56 A;  4J36 A;  1YQ4 A;  5FS7 A;  4H2R A;  4TLZ A;  5KVI A;  4H2Q A;  2JB2 A;  1PDH A;  3BHK A;  3IF9 A;  1GOS A;  3KPK A;  2WOI A;  2YLR A;  4D04 A;  2C76 A;  2WP6 A;  1D4E A;  2VVL G;  2YLW A;  3UKL A;  1PJ7 A;  2GH5 A;  2XLR A;  3GD4 A;  1JOA A;  4CCR A;  2OAL A;  5U1O A;  4NEW A;  5HY5 A;  3RP7 A;  4BK2 A;  1LQU A;  4DGK A;  1Y0P A;  3GDP A;  2EQ7 A;  3Q6J A;  1H6V A;  1ZOV A;  2AQJ A;  4U8O A;  4CCQ A;  5C3J A;  1ZKQ A;  1X31 B;  4GR1 A;  2X8G A;  3H8L A;  2OAM A;  3M13 A;  2QCU A;  1UKV G;  2GR1 A;  3NG7 X;  4Y4M A;  2NVK X;  3AE1 A;  1K0J A;  3ATR A;  3CGD A;  4GDP A;  1PXC A;  4XWR A;  4EMW A;  1LTX R;  1YQ3 A;  4NEV A;  3UKK A;  1NHS A;  1MOK A;  2DKH A;  3ZNQ A;  4H4X A;  2GVC A;  2BK3 A;  1Q1W A;  2DKI A;  4B63 A;  1N1P A;  4JQ9 A;  4A7A A;  4A99 A;  2I0Z A;  4AOS A;  3NT6 A;  2BC1 A;  2X8C A;  2BRY A;  3QFB A;  3KVE A;  1O94 A;  2E48 A;  3AYL A;  4II3 A;  1H82 A;  1IJH A;  3T0K A;  3BNM A;  4C3Y A;  4YSY A;  1BKW A;  4K22 A;  3WE0 A;  2WOV A;  1PBE A;  2WS3 A;  1ZDL A;  3R9U A;  3D8X A;  4EQW A;  4Z43 A;  5CKU A;  3AE5 A;  4YJH A;  2E4G A;  2XYO A;  1IUW A;  3W4J A;  4U2S A;  3EAO A;  2A89 A;  1QLB A;  2YLS A;  1K0L A;  3V76 A;  2BCG G;  2WPE A;  3NN6 X;  3AYI A;  2TPR A;  3ICR A;  4JNQ A;  3AWI A;  3F8R A;  4YTN A;  3H8I A;  2C75 A;  3ALJ A;  1JNR A;  4NNJ A;  1DJQ A;  3NKS A;  1B8S A;  3LXD A;  3VR8 A;  4FK1 A;  2R46 A;  5IQ4 A;  4YWO A;  3ICS A;  2BK5 A;  1D5T A;  4GAV A;  1E1N A;  5DBJ A;  2A87 A;  3HZL A;  1PHH A;  1C0K A;  1VQW A;  2GAH B;  2X8H A;  2YLZ A;  3P1W A;  4OPC A;  5LV9 A;  2WDQ A;  5EB4 A;  3GYJ A;  1GTE A;  2VRM A;  4H50 A;  4BJY A;  4BK3 A;  1FEA A;  4GRT A;  1PXB A;  5JCM A;  2GB0 A;  1XHC A;  2JB3 A;  2QAE A;  2GMJ A;  3V3N A;  2C3C A;  2Y6R A;  3S61 A;  4Z25 A;  1L9C A;  2V3A A;  4LII A;  1W4X A;  1NHQ A;  1H7X A;  2GF3 A;  3SFE A;  2BYB A;  1OJ9 A;  4K5S A;  2VVM A;  3NNE A;  3AE7 A;  2BCP A;  1GV4 A;  3GSI A;  3QSS A;  3BNU A;  3F8P A;  3CUK A;  2WDV A;  2YG7 A;  3GYI A;  5M10 A;  1IUT A;  2E4A A;  4G74 A;  3BHF A;  3SZC A;  2Q0L A;  1GTH A;  4K7Z A;  1K4Q A;  5IPY A;  3IC9 A;  1GAL A;  4RSL A;  3PS9 A;  4IA6 A;  4YJF A;  4U8I A;  3DJG X;  2BS4 A;  4TLX A;  4Z26 A;  3NGC X;  1EL5 A;  1ZY8 A;  2CDU A;  1XPQ A;  3KKJ A;  3NK2 X;  3QFA A;  2DU8 A;  1C0L A;  1JRZ A;  1VE9 A;  3ADA B;  4U8J A;  1DXL A;  1RSG A;  2BXS A;  2VVL A;  3H4K A;  2W0H A;  4ICY A;  4II2 A;  1COY A;  1ZOY A;  2E82 A;  4M52 A;  4JY2 A;  4OPD A;  1KIF A;  3LZW A;  1L0V A;  4BJZ A;  2WQY A;  3DGZ A;  2IID A;  4JY3 A;  2RGO A;  1P2H A;  3C4A A;  4BUR A;  1TDK A;  3AXB A;  1NDA A;  2RGH A;  1LV0 A;  4H4Q A;  3T2K A;  4RG4 A;  2GAG B;  4D03 A;  3Q9T A;  2AR8 A;  1TDN A;  4NTD A;  2QA2 A;  2XLP A;  3FIM B; 
#chains in the Genus database with same CATH homology
 2XLS A;  1LQT A;  1IUS A;  4MJW A;  2OLO A;  1B4V A;  4H2P A;  3T2Z A;  2XFU A;  2ARD A;  4XXG A;  1GER A;  4AP1 A;  2XVH A;  3ISH A;  3CPJ G;  3DJJ A;  3AD9 B;  3DME A;  1M64 A;  3AE4 A;  3DK9 A;  4OPI A;  3SZF A;  1RYI A;  1ZP0 A;  3DA1 A;  2YVJ A;  3S5W A;  4X4J A;  3ZDN A;  2R9Z A;  4YKF A;  5IQ1 A;  2V6O A;  4J2W A;  4YT0 A;  1S3E A;  2B9Y A;  2EQ6 A;  1C0I A;  2EQ9 A;  2XFQ A;  5JCK A;  4EMI A;  1F8R A;  3VRA A;  4EM3 A;  3O0H A;  2YVF A;  4EMJ A;  2F5Z A;  4H4T A;  3W4I A;  2V61 A;  2C66 A;  1DOD A;  3GD3 A;  4HB9 A;  1FOH A;  3GRT A;  3AEC A;  3NK0 X;  3HYV A;  4AOX A;  3CPH G;  3GYX A;  1VG9 A;  2B9X A;  1NEN A;  2JBV A;  4H4R A;  3L1R A;  2APG A;  3SM8 A;  2GRT A;  2YWL A;  4A5L A;  1D4C A;  4YSZ A;  3NYE A;  1F8W A;  1XDI A;  4K5R A;  2CUL A;  2E1M A;  1NAA A;  2WHD A;  3VRB A;  3AE9 A;  3DK4 A;  2ACZ A;  3FG2 P;  4G73 A;  4J57 A;  2B9W A;  3SYI A;  3COX A;  4JNA A;  4A65 A;  1CJ2 A;  1DDO A;  1RP0 A;  1LJ1 A;  2CVJ A;  5FS9 A;  1CBO A;  4J56 A;  4OPU A;  4H4U A;  1Y56 B;  2GR2 A;  2X99 A;  1S2Q A;  4O5Q A;  4TM4 A;  4QFC A;  3GMB A;  5JCI A;  3B6D A;  2BAB A;  2XVF A;  1DOB A;  2WPC A;  4AP3 A;  4YJD A;  1M6I A;  2XVI A;  3G3E A;  5BUL A;  5KXJ A;  1F6M A;  1PJ6 A;  1IUU A;  5KWF A;  4YTM A;  2WES A;  4YTP A;  4B67 A;  2FJD A;  1F3P A;  2WOW A;  1KF6 A;  2VZ2 A;  2IVD A;  1D7L A;  2BA9 A;  4NTE A;  3CIR A;  1TDF A;  1CJC A;  5KNL A;  3T31 A;  1YKJ A;  1JNZ A;  3UTF A;  2C3D A;  4TM3 A;  4J33 A;  4REK A;  5GSN A;  1GRT A;  4BV6 A;  3CGC A;  1JRY A;  3RED A;  1CC2 A;  3CNP A;  2E5V A;  3FBS A;  3JSK A;  2C4C A;  3L8K A;  4NZH A;  3UOY A;  3UTH A;  4YKG A;  5J60 A;  2PYX A;  4YSH A;  1DOC A;  5KMP A;  3UTE A;  3AB1 A;  1KNR A;  3CNJ A;  2YR4 A;  3K7M X;  4J31 A;  1K0I A;  5L46 A;  1L9E A;  1FCD A;  5M0Z A;  1E1K A;  3GRS A;  5JCN A;  4Y4N A;  1GET A;  2BXR A;  3OZ2 A;  3UKP A;  2R4E A;  1BGJ A;  4IVO B;  1E6E A;  2WPF A;  3I6D A;  1O5W A;  3AEB A;  3G5Q A;  3G5S A;  2Z5X A;  2YQU A;  1PXA A;  1GRH A;  2TMD A;  4E0V A;  1SEZ A;  2WDR A;  5FS8 A;  4ZN0 A;  3ZYX A;  1QO8 A;  2WP9 A;  3NH3 X;  4GUV A;  3WGT A;  3CMM A;  2R0P A;  3CTY A;  4H4V A;  2JB1 A;  4U8K A;  4YJG B;  5JCL A;  2YM2 A;  1VRQ B;  3D1C A;  4CY8 A;  4EQS A;  1EBD A;  1LVL A;  2C72 A;  1PBC A;  3QSM A;  1H86 A;  1TYT A;  3PO7 A;  1YY5 A;  3C96 A;  1C0P A;  3CPI G;  3NIX A;  4H4S A;  3SFD A;  2V60 A;  4APN A;  4G9K A;  1REO A;  1ZK7 A;  3CND A;  3NYC A;  3T37 A;  2ZZC A;  4EIP A;  1GT8 A;  2BK4 A;  2X50 A;  3UTG A;  1PBF A;  2X3N A;  3E1T A;  3RP6 A;  3DGH A;  2XLU A;  3UKA A;  2YLT A;  1AN9 A;  1JU2 A;  2YG3 A;  1ZX9 A;  3BI2 A;  4B66 A;  1CJ3 A;  4C5O A;  1N4W A;  3IWA A;  3AE8 A;  2EQ8 A;  4C77 A;  4HA6 A;  2XFP A;  3EF6 A;  4USQ A;  3ALM A;  4IV9 A;  3DJE A;  3V3O A;  4A9W A;  2WEU A;  5KOW A;  1H81 A;  3I3L A;  2XDO A;  3AD7 B;  4U2L A;  4CBQ A;  4H4P A;  3VQR A;  2NPX A;  3KU9 A;  1H7W A;  1MO9 A;  4A6N B;  2GQF A;  4YXD A;  3GWD A;  1E1L A;  2O9Z A;  1OJD A;  3ZNN A;  3K30 A;  3NTA A;  2C73 A;  1B5Q A;  1S3B A;  1IUV A;  3P9U A;  3C4N A;  2C65 A;  1GND A;  4CNK A;  3UKF A;  3ABV A;  3GMC A;  3UP4 A;  1CL0 A;  1TRB A;  3SQP A;  4OVI A;  4AT0 A;  3PVC A;  2WET A;  3AE3 A;  1MXT A;  2FJE A;  2AAQ A;  2YG4 A;  1ONF A;  4QFD A;  3AEA A;  4UDP A;  5EBK A;  2Q6U A;  1ELI A;  3W4K A;  3NHO X;  3NTD A;  4IA5 A;  5KMQ A;  3LB8 A;  4I58 A;  1FEC A;  2Z5Y A;  1GRG A;  2GV8 A;  3QJ4 A;  3QVP A;  4FDC B;  2R4J A;  3BI4 A;  3SZW A;  4PAB A;  4OCG A;  2C7G A;  2B7R A;  3KD9 A;  4H4Z A;  4RG3 A;  2JAE A;  3M12 A;  4GCM A;  4U8M A;  4Y4L A;  1E7P A;  2BC0 A;  4YJG A;  3ZNO A;  1V59 A;  4JDR A;  3SGL A;  4BK1 A;  1KDG A;  1Q9I A;  1AOG A;  4DNA A;  2QA1 A;  3NYF A;  4K8D A;  3UCL A;  2BS2 A;  4GAP A;  3IHM A;  1DAO A;  2R0C A;  3RNM A;  3UKH A;  4DSH A;  3LZX A;  2R45 A;  2CFY A;  1GES A;  4PAA A;  2XVJ A;  4K2X A;  1CJ4 A;  4TM0 A;  4YJF B;  3B3R A;  3SY4 A;  3VR9 A;  3II4 A;  2C70 A;  1EL9 A;  4U8L A;  1NEK A;  2ZBW A;  4KPR A;  3CNT A;  3BI5 A;  5KVH A;  2VQB A;  2JK6 A;  3UP5 A;  1F8S A;  1H84 A;  4DSG A;  2HQM A;  3K7Q X;  4X9N A;  4U8P A;  1DJN A;  4B64 A;  1GPE A;  5ER0 A;  2BS3 A;  4EQR A;  5BRT A;  1Z6L A;  2Y6Q A;  5J7X A;  1N4V A;  3AED A;  5KOX A;  2ZZ0 A;  1Q1R A;  4KX6 A;  1LPF A;  1NHP A;  1PN0 A;  1GRF A;  3QSE A;  2Q7V A;  3G5R A;  4AT2 A;  3CN8 A;  1EL7 A;  2WU5 A;  3GWF A;  4ZCD A;  4XWZ A;  3AE2 A;  1NG3 A;  4EQX A;  1QJD A;  3K7T A;  3P4P A;  2PHH A;  1CC6 A;  2GQW A;  4EIQ A;  3NRN A;  1IUX A;  1XAN A;  4NTC A;  3AEG A;  3DH9 A;  4N9X A;  2FBW A;  2WU2 A;  3LJP A;  4LU6 A;  3FPZ A;  3ZNP A;  1KNP A;  1KSU A;  5HYM A;  2VRL A;  1GRA A;  2GMH A;  2IVE A;  4Z2T A;  5KMS A;  1TYP A;  4IVM B;  3RP8 A;  2GR3 A;  2FJB A;  4OPG A;  2YG5 A;  4UP3 A;  4CRT A;  4FX9 A;  1NPX A;  1P2E A;  5EB5 A;  4I59 A;  4Z44 A;  3AD8 B;  2YVG A;  1L9D A;  1N4U A;  3URH A;  3HYW A;  2XFN A;  5BUK A;  1CHU A;  1PJ5 A;  4YJH B;  5FMH A;  3P4Q A;  4ECH A;  3UKQ A;  5BVA A;  2J3N A;  2E49 A;  1E1M A;  4G6H A;  1GRB A;  4CY6 A;  3AE6 A;  3KA7 A;  1TDE A;  3NN0 X;  1NHR A;  1OJC A;  2WBA A;  1CC4 A;  4G6G A;  4H4Y A;  4B65 A;  1JEH A;  4ZCC A;  4X9M A;  4U8N A;  5HXI A;  3KPF A;  2VOU A;  4J34 A;  1BWC A;  3ITJ A;  4O5U A;  4UDQ A;  3SX6 A;  4UDR A;  1VDC A;  4U2T A;  4C74 A;  3DJD A;  2XVE A;  2C67 A;  2XCG A;  3QVR A;  1B37 A;  3NLC A;  3UOV A;  3OC4 A;  3GDN A;  3P4R A;  3HYX A;  5TR3 A;  2VQ7 A;  3EPT A;  4Z2R A;  1D4D A;  1PBD A;  1GXF A;  3SZ0 A;  4YSX A;  4EM4 A;  3AEE A;  1BZL A;  2RGJ A;  5U63 A;  2OLN A;  1O95 A;  3M0O A;  1PS9 A;  5EOW A;  4P9S A;  1H83 A;  4NWZ A;  5U25 A;  1VG0 A;  3T14 A;  3DK8 A;  1TDO A;  1OJA A;  1ZMD A;  2XLT A;  3SXI A;  4Z24 A;  2H89 A;  5FS6 A;  2BRA A;  4TM1 A;  1BF3 A;  3AYJ A;  3ICT A;  3F8D A;  2WP5 A;  3AEF A;  1DNC A;  2GR0 A;  2YM1 A;  4GDE A;  1ZMC A;  2YLX A;  3KLJ A;  4B1B A;  1GEU A;  2YR5 A;  2UZZ A;  2FJA A;  4B68 A;  1FL2 A;  3ALL A;  1D7Y A;  2YG6 A;  1BGN A;  1GSN A;  2OA1 A;  2B7S A;  2V5Z A;  2YR6 A;  4LA1 A;  4H7U A;  1CF3 A;  1KFY A;  4H4W A;  3VRD B;  3ATQ A;  4C3X A;  1JRX A;  5HHF A;  1OJT A;  2V3B A;  5CQF A;  4ADW A;  1S2Y A;  4H2N A;  3EAN A;  2RAB A;  4B69 A;  3LAD A;  3NK1 X;  2B76 A;  2GEW A;  1EVI A;  3CGE A;  4USR A;  4WCT A;  1YQZ A;  1FEB A;  2YAU A;  4A79 A;  2XFO A;  4OPL A;  2H88 A;  2A8X A;  1GRE A;  2Q0K A;  3T2Y A;  4CNJ A;  5C2T A;  5KMR A;  4WX1 A;  1DOE A;  1HYU A;  3IHG A;  1NG4 A;  3RHA A;  1PBB A;  1E39 A;  3UOZ A;  4A6N A;  3FMW A;  4OPT A;  1EL8 A;  2ZZB A;  3CGB A;  3LOV A;  3CNS A;  4GF7 A;  2BAC A;  3P4S A;  5KRQ A;  2C64 A;  5GRT A;  2R0G A;  4JN9 A;  3UOX A;  4Z2U A;  2JKC A;  1KSS A;  4FK1 C;  1Y56 A;  4J36 A;  1YQ4 A;  5FS7 A;  4H2R A;  4TLZ A;  5KVI A;  4H2Q A;  2JB2 A;  1PDH A;  3BHK A;  3IF9 A;  1GOS A;  3KPK A;  2WOI A;  2YLR A;  4D04 A;  2C76 A;  2WP6 A;  1D4E A;  2VVL G;  2YLW A;  3UKL A;  1PJ7 A;  2GH5 A;  2XLR A;  3GD4 A;  1JOA A;  4CCR A;  2OAL A;  5U1O A;  4NEW A;  5HY5 A;  3RP7 A;  4BK2 A;  1LQU A;  4DGK A;  1Y0P A;  3GDP A;  2EQ7 A;  3Q6J A;  1H6V A;  1ZOV A;  2AQJ A;  4U8O A;  4CCQ A;  5C3J A;  1ZKQ A;  1X31 B;  4GR1 A;  2X8G A;  3H8L A;  2OAM A;  3M13 A;  2QCU A;  1UKV G;  2GR1 A;  3NG7 X;  4Y4M A;  2NVK X;  3AE1 A;  1K0J A;  3ATR A;  3CGD A;  4GDP A;  1PXC A;  4XWR A;  4EMW A;  1LTX R;  1YQ3 A;  4NEV A;  3UKK A;  1NHS A;  1MOK A;  2DKH A;  3ZNQ A;  4H4X A;  2GVC A;  2BK3 A;  1Q1W A;  2DKI A;  4B63 A;  1N1P A;  4JQ9 A;  4A7A A;  4A99 A;  2I0Z A;  4AOS A;  3NT6 A;  2BC1 A;  2X8C A;  2BRY A;  3QFB A;  3KVE A;  1O94 A;  2E48 A;  3AYL A;  4II3 A;  1H82 A;  1IJH A;  3T0K A;  3BNM A;  4C3Y A;  4YSY A;  1BKW A;  4K22 A;  3WE0 A;  2WOV A;  1PBE A;  2WS3 A;  1ZDL A;  3R9U A;  3D8X A;  4EQW A;  4Z43 A;  5CKU A;  3AE5 A;  4YJH A;  2E4G A;  2XYO A;  1IUW A;  3W4J A;  4U2S A;  3EAO A;  2A89 A;  1QLB A;  2YLS A;  1K0L A;  3V76 A;  2BCG G;  2WPE A;  3NN6 X;  3AYI A;  2TPR A;  3ICR A;  4JNQ A;  3AWI A;  3F8R A;  4YTN A;  3H8I A;  2C75 A;  1JNR A;  3ALJ A;  4NNJ A;  1DJQ A;  3NKS A;  1B8S A;  3LXD A;  3VR8 A;  4FK1 A;  2R46 A;  5IQ4 A;  4YWO A;  3ICS A;  2BK5 A;  1D5T A;  4GAV A;  1E1N A;  5DBJ A;  2A87 A;  3HZL A;  1PHH A;  1C0K A;  1VQW A;  2GAH B;  2X8H A;  2YLZ A;  3P1W A;  4OPC A;  5LV9 A;  2WDQ A;  5EB4 A;  3GYJ A;  1GTE A;  2VRM A;  4H50 A;  4BJY A;  1FEA A;  4BK3 A;  4GRT A;  1PXB A;  5JCM A;  2GB0 A;  1XHC A;  2JB3 A;  2QAE A;  2GMJ A;  3V3N A;  2C3C A;  2Y6R A;  3S61 A;  4Z25 A;  1L9C A;  2V3A A;  4LII A;  1W4X A;  1NHQ A;  1H7X A;  2GF3 A;  3SFE A;  2BYB A;  1OJ9 A;  4K5S A;  2VVM A;  3NNE A;  3AE7 A;  2BCP A;  1GV4 A;  3GSI A;  3QSS A;  3BNU A;  3F8P A;  3CUK A;  2WDV A;  2YG7 A;  3GYI A;  5M10 A;  1IUT A;  2E4A A;  4G74 A;  3BHF A;  3SZC A;  2Q0L A;  1GTH A;  4K7Z A;  1K4Q A;  5IPY A;  3IC9 A;  1GAL A;  4RSL A;  3PS9 A;  4YJF A;  4IA6 A;  4U8I A;  3DJG X;  2BS4 A;  4TLX A;  4Z26 A;  3NGC X;  1EL5 A;  1ZY8 A;  2CDU A;  1XPQ A;  3KKJ A;  3NK2 X;  3QFA A;  2DU8 A;  1C0L A;  1JRZ A;  1VE9 A;  3ADA B;  4U8J A;  1DXL A;  1RSG A;  2BXS A;  2VVL A;  3H4K A;  2W0H A;  4ICY A;  4II2 A;  1COY A;  1ZOY A;  2E82 A;  4M52 A;  4JY2 A;  4OPD A;  1KIF A;  3LZW A;  1L0V A;  4BJZ A;  2WQY A;  3DGZ A;  2IID A;  4JY3 A;  2RGO A;  1P2H A;  3C4A A;  4BUR A;  1TDK A;  3AXB A;  1NDA A;  2RGH A;  1LV0 A;  4H4Q A;  3T2K A;  4RG4 A;  2GAG B;  4D03 A;  3Q9T A;  2AR8 A;  1TDN A;  4NTD A;  2QA2 A;  2XLP A;  3FIM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...