3UOZA

Crystal structure of otemo complex with fad and nadp (form 2)
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
540
structure length
540
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 186
structure length 540
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uozA01
3C4AA 3KLJA 1TDEA 2QAEA 1B37A 2C65A 2YLTA 3GDNA 3H8IA 4I59A 5J7XA 1FECA 3UTEA 4OPDA 2GVCA 5BRTA 4ZCCA 4CCQA 1DOCA 1H7WA 3UKKA 4J2WA 4Y4MA 1NG3A 5EOWA 4EIPA 1TDKA 3CPIG 4BJYA 3CNPA 2XFNA 3LADA 4K22A 3AD9B 1PXAA 3K7TA 2FJAA 2GR0A 3RP8A 3UKLA 4B65A 1H6VA 1NDAA 1PBFA 2X8CA 2YVJA 3ZYXA 4A6NA 4TM0A 3AYLA 3UCLA 1ELIA 3FMWA 4UDRA 2V5ZA 4AOXA 4B67A 4BURA 5HY5A 5TR3A 1GRAA 3D8XA 1Y56A 1E7PA 2R4EA 2VQBA 3ITJA 5KOXA 2GAGB 3CGEA 3AEFA 2FJEA 5HHFA 4K2XA 1D7LA 4EQXA 1NPXA 2OAMA 2RABA 3AE4A 3C96A 3UKAA 4CRTA 5L46A 3GMCA 4K8DA 1L9CA 2B76A 2IVDA 2GRTA 5LV9A 4YXDA 1IUXA 3CGCA 3NRNA 5C2TA 3EANA 5ER0A 1QJDA 2ARDA 4USRA 4UDQA 4Z25A 4B1BA 4ZCDA 1EL7A 1ZOYA 1CJ4A 1GETA 3PS9A 1VG0A 5U25A 2YLSA 3DGZA 3QSEA 4GRTA 3P4SA 4USQA 1Y0PA 2ACZA 1B4VA 2APGA 2IIDA 3BI2A 4GR1A 4U8IA 2I0ZA 1MOKA 3NGCX 2A87A 2VOUA 3UTHA 3SGLA 2VRMA 2WBAA 4A9WA 1ZDLA 4AT2A 1CJCA 4YKGA 3JSKA 1XPQA 1JOAA 3O0HA 4J56A 1AOGA 1PDHA 1H83A 1M6IA 4A99A 5KRQA 2R0PA 3IF9A 2V60A 3SFDA 2EQ7A 2WHDA 1LJ1A 4OPIA 3RP6A 3UKPA 4EM4A 3DK8A 1PBCA 5HXIA 5FS8A 4C3XA 1GEUA 3EAOA 4GF7A 1OJTA 1CJ2A 3BNMA 2JAEA 2WPCA 4B68A 1H86A 4CBQA 2BK5A 2BCGG 2WP9A 1W4XA 2FJDA 2XLSA 4X9NA 1E39A 3K7MX 2WQYA 3GMBA 4DSGA 3CNJA 3P4QA 3RHAA 2Q0LA 1PXCA 3GD3A 1K0JA 2B9YA 3AE2A 3ISHA 4JN9A 3UTFA 1NHRA 2XVHA 2RGOA 1Q1WA 2NPXA 4RG3A 4KPRA 4OPLA 4LIIA 4CNKA 1S3BA 5JCIA 1LQUA 3P4RA 1JRYA 4YKFA 1COYA 4BK1A 3AB1A 4D03A 5BUKA 2XVIA 1PBBA 1B5QA 4H2QA 2C72A 4JY3A 3KD9A 4YTMA 1GRTA 2R45A 2WP5A 1BKWA 4JNQA 3AEAA 3NLCA 4H4WA 4IVOB 2H89A 3QSSA 3AYJA 2H88A 3ICRA 2C3CA 1GSNA 4YSZA 2YVGA 2V6OA 1MXTA 2WOVA 1MO9A 3FPZA 4O5UA 2WU2A 1IUWA 1PHHA 4FX9A 2OALA 2O9ZA 1TDOA 5IQ4A 3G5QA 1ZY8A 2V3AA 4J36A 3NH3X 1PJ7A 2E1MA 3DJJA 2ZBWA 2XLTA 2V3BA 3CGDA 4CY6A 2WETA 4C5OA 3KU9A 3RNMA 2A89A 1F8SA 1QO8A 3HZLA 2GR1A 1DJQA 1PBDA 2GAHB 1B8SA 3UTGA 3AE6A 4YSXA 2J3NA 4UP3A 4U8MA 4J34A 2C64A 4H4VA 3BNUA 1PBEA 1REOA 1ONFA 2GEWA 5EBKA 1S2YA 3UOYA 1NAAA 3ABVA 4RG4A 2YLWA 4EQSA 2R4JA 1DXLA 1GREA 3FG2P 2C7GA 2QA1A 1CC4A 4K5RA 4CNJA 4BK2A 3SM8A 4U8PA 3M0OA 4DNAA 3SQPA 2GQFA 1EL8A 1L9DA 2WEUA 2YVFA 3L1RA 4O5QA 3UOZA 2YR6A 3CGBA 2XLRA 4WCTA 1F8RA 4H4UA 3S61A 2BS2A 3KPFA 1BGJA 4YT0A 2VVLA 1ZP0A 3AE9A 4KX6A 2PYXA 3NKSA 4C77A 1NHQA 3GD4A 4X4JA 4XWZA 2YG6A 4TLZA 1E6EA 1GPEA 4EMWA 4H4PA 2DKIA 4OPUA 3RP7A 1E1LA 2JKCA 1E1KA 2Y6QA 3GYJA 4TLXA 4JDRA 2E5VA 3F8DA 3PVCA 3WE0A 4CCRA 1GRHA 1ZMCA 4C74A 1FEBA 2YLXA 1H84A 1RYIA 4C3YA 3F8RA 3K30A 4NEWA 1YQ4A 1D7YA 4U8NA 2AAQA 1VQWA 1XDIA 1GTHA 4H50A 4Z43A 2Y6RA 3URHA 4BJZA 2OLNA 4H4RA 4K5SA 3UKHA 4A79A 2YG7A 2YR4A 4ZN0A 2VZ2A 1NG4A 5JCLA 2BA9A 1GV4A 2BABA 3AE1A 1H7XA 4NTEA 2WPEA 4M52A 3LJPA 4I58A 1E1NA 3IHGA 1GNDA 3T37A 5FS6A 2JB1A 3PO7A 4ICYA 3ZDNA 1GALA 1BWCA 1GRBA 4EQRA 1BZLA 1KFYA 4EMJA 3ALJA 3P9UA 5CQFA 4LA1A 2YM2A 2WDRA 2WP6A 1K0IA 5BULA 2C75A 3AD7B 2XVJA 1NHPA 3VRBA 2BS3A 2TMDA 3V76A 1VRQB 3NG7X 1PN0A 1NEKA 2GR3A 1F8WA 2YR5A 4N9XA 4B69A 2Q6UA 2V61A 1LPFA 2ZZ0A 2WS3A 3BHFA 4J31A 2XLUA 3I3LA 4H4TA 1LQTA 2XYOA 1LTXR 3AE8A 4EIQA 3QVPA 4EM3A 1S3EA 1CF3A 1JEHA 2B7RA 3K7QX 2R0CA 4JY2A 4Y4NA 3NHOX 1N1PA 2JB2A 2VRLA 1UKVG 4H4XA 3NYCA 4Z2UA 3DJEA 5U63A 2QA2A 4PABA 3ALLA 1D4DA 3VQRA 3NIXA 3QVRA 1P2EA 1N4WA 3QFAA 1TYPA 2JBVA 3SFEA 2X8HA 4U8OA 2WPFA 1VDCA 4IV9A 2Z5YA 3LOVA 4XXGA 2C70A 1CC6A 4HB9A 2R46A 3H4KA 4NZHA 1ZX9A 2ZZCA 5JCKA 2RGHA 3FIMB 5JCMA 4B63A 2XVEA 1DODA 2TPRA 3G5SA 1P2HA 3DA1A 3AD8B 3I6DA 3VRAA 3P1WA 4APNA 3UKQA 3OZ2A 3VR8A 4E0VA 5KOWA 4IA5A 3NNEA 1O5WA 4A5LA 2WOWA 1JNRA 3GWFA 3CIRA 1IUTA 1CL0A 1IJHA 2BK3A 4NTCA 3V3OA 4U8JA 3QSMA 4H4SA 1L0VA 2GF3A 1L9EA 1O94A 1XANA 1EL9A 5GRTA 2BXRA 2GMHA 3LXDA 3LZXA 1ZOVA 4U2TA 3AEBA 4YWOA 3CPJG 2FJBA 3DGHA 3UKFA 2C3DA 3H8LA 4AOSA 1D4CA 2C73A 2X3NA 5C3JA 1V59A 4YTNA 1IUVA 1JNZA 3NTDA 1ZMDA 4Z2RA 1BF3A 2W0HA 4J33A 4H7UA 1NHSA 2BCPA 3D1CA 4Z44A 2YQUA 3KKJA 2FBWA 4GDEA 2YAUA 3GRTA 1RP0A 3DJGX 3ICSA 4HA6A 2OA1A 3F8PA 2YM1A 3ATQA 5U1OA 3R9UA 4UDPA 4OVIA 3ICTA 1XHCA 2WDQA 3NN6X 4A6NB 4H4YA 1GRFA 4H2NA 2CFYA 3V3NA 2GMJA 3L8KA 2X50A 5IPYA 3E1TA 4D04A 2Q0KA 2XFUA 1D4EA 1DJNA 1X31B 1Y56B 1LVLA 3EPTA 4GCMA 4TM4A 1FL2A 1FOHA 2PHHA 4IA6A 1KDGA 4DSHA 4EQWA 3GRSA 4U8KA 5J60A 3KVEA 1GRGA 2X8GA 3BI5A 4LU6A 2DKHA 4YSYA 3LB8A 3Q6JA 1OJCA 2GH5A 4H2RA 4A7AA 4GDPA 1YQZA 4JNAA 2VVMA 3IWAA 2BK4A 3S5WA 1DOEA 4FK1C 3AXBA 3AE7A 4AT0A 3NN0X 4YTPA 2XFQA 4Y4LA 1JRXA 1KF6A 1OJDA 2XCGA 2BC1A 4H4QA 1TDNA 3AEDA 4Z24A 2WDVA 3AEEA 1N4VA 1JU2A 3UP4A 3M13A 4A65A 1DNCA 4DGKA 5KVHA 4ECHA 1O95A 1KSSA 3FBSA 3Q9TA 2EQ8A 3DK4A 4Z2TA 2R0GA 4OPCA 1BGNA 4OPTA 2BYBA 1M64A 4XWRA 1SEZA 1HYUA 2JK6A 1K4QA 3NTAA 3GWDA 3NK0X 3C4NA 4H4ZA 1YY5A 4B66A 2GV8A 3M12A 2GB0A 3NYEA 2HQMA 2YLRA 3NT6A 5M10A 3QFBA 2UZZA 1K0LA 1PJ6A 2AR8A 2WESA 1H82A 5KVIA 3CTYA 1EBDA 1FEAA 2Z5XA 3AE3A 3NYFA 2C67A 1GT8A 4P9SA 1CHUA 3REDA 2CDUA 1PJ5A 1EL5A 3IHMA 2B9XA 5KWFA 2YG3A 1TYTA 3AWIA 1RSGA 2JB3A 3ATRA 3IC9A 3QJ4A 4WX1A 3VRDB 4TM3A 4OPGA 2BACA 4ADWA 4J57A 3P4PA 4MJWA 4CY8A 2YG4A 2EQ6A 2WU5A 2BS4A 3B3RA 1PS9A 2C76A 4AP1A 4EMIA 2XLPA 1CBOA 1Z6LA 2X99A 3LZWA 1JRZA 2A8XA 5FS7A 2NVKX 3ALMA 1TDFA 2RGJA 1F6MA 5GSNA 2Q7VA 1NENA 1KNRA 3GDPA 3B6DA 1LV0A 3CNSA 1GERA 3II4A 3KA7A 3OC4A 3UOXA 1PXBA 1KNPA 2XDOA 1F3PA 2E4GA 4RSLA 4X9MA 1YQ3A 2CVJA 4U2SA 1DOBA 4JQ9A 3NK1X 4B64A 2C66A 5JCNA 2BC0A 2VQ7A 1CJ3A 2GR2A 1GXFA 3ADAB 5EB5A 5CKUA 2YWLA 3VR9A 2GQWA 3AEGA 2AQJA 2ZZBA 1OJ9A 1IUUA 2XVFA 1KSUA 3CPHG 5FS9A 4OCGA 3UP5A 2YLZA 4PAAA 3DJDA 2OLOA 1N4UA 5M0ZA 3CNDA 1GTEA 5KXJA 3AE5A 3BI4A 3CNTA 4FDCB 3EF6A 3GYIA 3CN8A 3BHKA 1D5TA 5IQ1A 1Q9IA 1CC2A 1FCDA 4AP3A 1GOSA 1ZKQA 1TRBA 1IUSA 2BXSA 2XFOA 5BVAA 2B9WA 2XFPA 4NEVA 4FK1A 4U8LA 1QLBA 1ZK7A 3GSIA 2R9ZA 1GESA 4BK3A 1H81A 3DH9A 5FMHA 1S2QA 1OJAA 5EB4A 4H2PA 1VG9A 2CULA 2WOIA 3AYIA 2VVLG 2B7SA 4IVMB 3COXA 3AECA 4K7ZA 1E1MA 3G5RA 4Z26A 2QCUA 5HYMA 2YG5A 4YSHA 4BV6A 1Q1RA 2F5ZA 4GUVA 2EQ9A 4NTDA 4U2LA 4REKA 3UOVA 2IVEA 3DMEA 4TM1A 3DK9A 5DBJA 1YKJA 3NK2X
chains in the Genus database with same CATH superfamily
3C4AA 3KLJA 1TDEA 2QAEA 1B37A 2C65A 2YLTA 3GDNA 3H8IA 4I59A 5J7XA 5KNLA 1FECA 3UTEA 4OPDA 2GVCA 5BRTA 4ZCCA 4CCQA 1DOCA 1H7WA 3UKKA 4J2WA 4Y4MA 1NG3A 5EOWA 4EIPA 1TDKA 3CPIG 4BJYA 3CNPA 2XFNA 3LADA 4K22A 3AD9B 1PXAA 3K7TA 2FJAA 2GR0A 3RP8A 3UKLA 4B65A 1H6VA 1NDAA 1PBFA 2X8CA 2YVJA 3ZYXA 4A6NA 4TM0A 3AYLA 3UCLA 3T2YA 1ELIA 3FMWA 4UDRA 2V5ZA 4AOXA 4B67A 4BURA 5HY5A 5TR3A 1GRAA 3D8XA 1Y56A 1E7PA 2R4EA 2VQBA 3ITJA 5KOXA 2GAGB 3CGEA 3AEFA 2FJEA 5HHFA 3T31A 4K2XA 1D7LA 4EQXA 1NPXA 2OAMA 2RABA 3AE4A 2BRAA 3C96A 3UKAA 4CRTA 5L46A 3GMCA 4K8DA 1L9CA 2B76A 2IVDA 2GRTA 5LV9A 4YXDA 1IUXA 3CGCA 3NRNA 5C2TA 3EANA 5ER0A 1QJDA 2ARDA 4USRA 4UDQA 4Z25A 4B1BA 4ZCDA 1EL7A 1ZOYA 1CJ4A 1GETA 3PS9A 1VG0A 5U25A 2YLSA 3DGZA 3QSEA 4GRTA 3P4SA 4USQA 1Y0PA 2ACZA 1B4VA 2APGA 2IIDA 3BI2A 4GR1A 4U8IA 2I0ZA 1MOKA 3NGCX 2A87A 2VOUA 3HYWA 3UTHA 3SGLA 2VRMA 2WBAA 4A9WA 1ZDLA 4AT2A 1CJCA 4YKGA 3JSKA 1XPQA 1JOAA 3O0HA 4GAVA 4J56A 1AOGA 4G6GA 1PDHA 1H83A 1M6IA 5KMRA 4A99A 5KRQA 2R0PA 3IF9A 2V60A 3SFDA 2EQ7A 2WHDA 1LJ1A 4OPIA 3RP6A 3UKPA 4EM4A 3DK8A 1PBCA 5HXIA 5FS8A 4C3XA 1GEUA 3EAOA 4GF7A 1OJTA 1CJ2A 3BNMA 2JAEA 2WPCA 4B68A 1H86A 4II2A 4CBQA 2BK5A 2BCGG 2WP9A 1W4XA 2FJDA 2XLSA 4X9NA 1E39A 3K7MX 2WQYA 3GMBA 4DSGA 3CNJA 3P4QA 3RHAA 2Q0LA 1PXCA 3GD3A 1K0JA 2B9YA 3AE2A 3ISHA 4JN9A 3SY4A 1NHRA 3UTFA 2XVHA 2RGOA 1Q1WA 2NPXA 4RG3A 4KPRA 4OPLA 4LIIA 4CNKA 1S3BA 5JCIA 1LQUA 3P4RA 1JRYA 4YKFA 3T2KA 1COYA 4BK1A 3AB1A 4D03A 5BUKA 2XVIA 1PBBA 1B5QA 4H2QA 2C72A 4JY3A 3KD9A 4YTMA 1GRTA 2R45A 2WP5A 1BKWA 4JNQA 3AEAA 3NLCA 4H4WA 4IVOB 2H89A 3QSSA 3AYJA 2H88A 3ICRA 2C3CA 1GSNA 4YSZA 2YVGA 2V6OA 1MXTA 2WOVA 1MO9A 3FPZA 4O5UA 2WU2A 1IUWA 1PHHA 4FX9A 2OALA 2O9ZA 1TDOA 3CMMA 5IQ4A 3G5QA 1ZY8A 2V3AA 4J36A 3NH3X 1PJ7A 2E1MA 3DJJA 2ZBWA 2XLTA 2V3BA 3CGDA 4CY6A 2WETA 4C5OA 3KU9A 3RNMA 2A89A 1F8SA 1QO8A 3HZLA 2GR1A 1DJQA 1PBDA 2GAHB 1B8SA 3UTGA 3AE6A 4YSXA 2J3NA 4UP3A 4U8MA 4J34A 2C64A 3HYVA 4H4VA 3BNUA 1PBEA 1REOA 1ONFA 2GEWA 5EBKA 1S2YA 3UOYA 1NAAA 3ABVA 4RG4A 2YLWA 4EQSA 2R4JA 1DXLA 1GREA 3FG2P 2C7GA 2QA1A 1CC4A 4K5RA 4CNJA 4BK2A 3SM8A 4U8PA 3M0OA 4DNAA 3SQPA 2GQFA 1EL8A 1L9DA 2WEUA 2YVFA 3L1RA 4O5QA 3UOZA 2YR6A 3CGBA 2XLRA 4WCTA 1F8RA 4H4UA 3S61A 2BS2A 3KPFA 1BGJA 4YT0A 2VVLA 1ZP0A 3AE9A 4KX6A 2PYXA 3NKSA 4C77A 1NHQA 3GD4A 4X4JA 4XWZA 2YG6A 4TLZA 1E6EA 1GPEA 4EMWA 4H4PA 2DKIA 4OPUA 3RP7A 1E1LA 2JKCA 1E1KA 2Y6QA 3GYJA 4TLXA 4JDRA 2E5VA 3F8DA 3PVCA 3WE0A 4CCRA 1GRHA 1ZMCA 4C74A 1FEBA 2YLXA 1H84A 1RYIA 4C3YA 3F8RA 3K30A 4NEWA 1YQ4A 1D7YA 4U8NA 2AAQA 1VQWA 1XDIA 1GTHA 4H50A 4Z43A 2Y6RA 3URHA 4BJZA 2OLNA 4H4RA 4K5SA 3UKHA 4A79A 2YG7A 2YR4A 4NNJA 4ZN0A 2VZ2A 1NG4A 5JCLA 2BA9A 1GV4A 2BABA 3AE1A 1H7XA 4NTEA 2WPEA 4M52A 3LJPA 4I58A 1E1NA 3IHGA 1GNDA 3T37A 5FS6A 2JB1A 3PO7A 4ICYA 3ZDNA 1GALA 1BWCA 1GRBA 4G9KA 4EQRA 1BZLA 1KFYA 4EMJA 3ALJA 3P9UA 5CQFA 4LA1A 2YM2A 2WDRA 2WP6A 1K0IA 3T0KA 2C75A 3AD7B 5BULA 2XVJA 1NHPA 4G73A 3VRBA 2BS3A 2TMDA 3V76A 1VRQB 3NG7X 1PN0A 1NEKA 2GR3A 1F8WA 2YR5A 4N9XA 4B69A 2Q6UA 2V61A 1LPFA 2ZZ0A 2WS3A 3BHFA 4J31A 2XLUA 3I3LA 4H4TA 1LQTA 2XYOA 1LTXR 3AE8A 4EIQA 3QVPA 4EM3A 1S3EA 1CF3A 1JEHA 2B7RA 3K7QX 3T14A 2R0CA 4JY2A 4Y4NA 3SZCA 3NHOX 1N1PA 2JB2A 2VRLA 1UKVG 4H4XA 3NYCA 4Z2UA 3DJEA 5U63A 2QA2A 4PABA 3SZ0A 3ALLA 1D4DA 4G6HA 3VQRA 3NIXA 3QVRA 1P2EA 1N4WA 3QFAA 1TYPA 2JBVA 3SFEA 2X8HA 4U8OA 2WPFA 1VDCA 4IV9A 2Z5YA 3LOVA 4XXGA 2C70A 1CC6A 4HB9A 2R46A 3H4KA 4NZHA 1ZX9A 2ZZCA 5JCKA 2RGHA 3FIMB 5JCMA 4B63A 3T2ZA 2XVEA 1DODA 2TPRA 3G5SA 1P2HA 2BRYA 3DA1A 3AD8B 3I6DA 3VRAA 3P1WA 4APNA 3UKQA 3OZ2A 3VR8A 4E0VA 5KOWA 4IA5A 3NNEA 1O5WA 4A5LA 2WOWA 1JNRA 3GWFA 3CIRA 1IUTA 1CL0A 1IJHA 2BK3A 4NTCA 3V3OA 4U8JA 3QSMA 4H4SA 1L0VA 2GF3A 1L9EA 1O94A 1XANA 1EL9A 5GRTA 2BXRA 2GMHA 3LXDA 3LZXA 1ZOVA 4U2TA 3AEBA 4YWOA 3CPJG 2FJBA 3DGHA 3UKFA 2C3DA 3H8LA 4AOSA 3SYIA 1D4CA 2C73A 2X3NA 5C3JA 1V59A 4YTNA 1IUVA 1JNZA 3NTDA 1ZMDA 4Z2RA 1BF3A 2W0HA 4J33A 4H7UA 1NHSA 2BCPA 3D1CA 4Z44A 2YQUA 3KKJA 2FBWA 4GDEA 5KMPA 2YAUA 3GRTA 1RP0A 3DJGX 3ICSA 4HA6A 2OA1A 3F8PA 2YM1A 3ATQA 5U1OA 3R9UA 4UDPA 4OVIA 3ICTA 1XHCA 2WDQA 3NN6X 4A6NB 4H4YA 1GRFA 4H2NA 2CFYA 3V3NA 2GMJA 3L8KA 2X50A 5IPYA 3E1TA 4D04A 2Q0KA 2XFUA 1D4EA 1DJNA 1X31B 1Y56B 1LVLA 3EPTA 4GCMA 4TM4A 1FL2A 1FOHA 2PHHA 4IA6A 1KDGA 4DSHA 4EQWA 3GRSA 4U8KA 5J60A 3KVEA 1GRGA 2X8GA 3BI5A 4LU6A 2DKHA 4YSYA 3LB8A 3Q6JA 1OJCA 2GH5A 4GAPA 4H2RA 4A7AA 4GDPA 1YQZA 4JNAA 2VVMA 3IWAA 2BK4A 3S5WA 1DOEA 4FK1C 4G74A 3AXBA 3AE7A 4AT0A 3NN0X 4YTPA 2XFQA 4Y4LA 1JRXA 1KF6A 1OJDA 2XCGA 2BC1A 5KMQA 4H4QA 1TDNA 3AEDA 4Z24A 2WDVA 3AEEA 1N4VA 1JU2A 3UP4A 3M13A 4A65A 1DNCA 4DGKA 5KVHA 4ECHA 1O95A 1KSSA 3FBSA 3Q9TA 2EQ8A 3DK4A 4Z2TA 2R0GA 4OPCA 1BGNA 4OPTA 2BYBA 1M64A 4XWRA 1SEZA 1HYUA 2JK6A 1K4QA 3NTAA 3GWDA 3NK0X 3C4NA 4H4ZA 1YY5A 4B66A 2GV8A 3M12A 2GB0A 3NYEA 2HQMA 2YLRA 3NT6A 5M10A 3QFBA 2UZZA 1K0LA 1PJ6A 2AR8A 2WESA 1H82A 5KVIA 3SX6A 3CTYA 1EBDA 1FEAA 2Z5XA 3AE3A 3NYFA 2C67A 1GT8A 4P9SA 1CHUA 3REDA 2CDUA 1PJ5A 1EL5A 3IHMA 2B9XA 5KWFA 2YG3A 1TYTA 3AWIA 1RSGA 2JB3A 3ATRA 3IC9A 3QJ4A 4WX1A 3VRDB 4TM3A 4OPGA 2BACA 2C4CA 4ADWA 4J57A 3P4PA 4MJWA 4CY8A 2YG4A 2EQ6A 2WU5A 2BS4A 3B3RA 3SZFA 1PS9A 2C76A 4AP1A 4EMIA 2XLPA 1CBOA 1Z6LA 2X99A 3LZWA 1JRZA 2A8XA 5FS7A 2NVKX 3ALMA 1TDFA 2RGJA 1F6MA 5GSNA 2Q7VA 1NENA 1KNRA 3GDPA 3B6DA 1LV0A 3CNSA 1GERA 3II4A 3KA7A 3OC4A 3UOXA 1PXBA 1KNPA 2XDOA 1F3PA 2E4GA 4RSLA 4X9MA 1YQ3A 2CVJA 4U2SA 1DOBA 4JQ9A 3NK1X 4B64A 2C66A 5JCNA 3GYXA 2BC0A 2VQ7A 1CJ3A 2GR2A 5KMSA 1GXFA 3ADAB 5EB5A 5CKUA 2YWLA 3VR9A 2GQWA 3AEGA 2AQJA 2ZZBA 1OJ9A 1IUUA 3HYXA 2XVFA 1KSUA 3CPHG 5FS9A 3SXIA 4OCGA 3UP5A 2YLZA 4PAAA 3DJDA 2OLOA 1N4UA 5M0ZA 3CNDA 1GTEA 5KXJA 3AE5A 3BI4A 3CNTA 4FDCB 3EF6A 3GYIA 3KPKA 3CN8A 3BHKA 1D5TA 5IQ1A 1Q9IA 1CC2A 1FCDA 4AP3A 1GOSA 1ZKQA 1TRBA 4NWZA 1IUSA 2BXSA 2XFOA 5BVAA 2B9WA 3SZWA 2XFPA 4NEVA 4FK1A 4U8LA 1QLBA 1ZK7A 3GSIA 2R9ZA 1GESA 4BK3A 1H81A 3DH9A 5FMHA 1S2QA 1OJAA 5EB4A 4H2PA 1VG9A 2CULA 2WOIA 3AYIA 2VVLG 2B7SA 4IVMB 3COXA 3AECA 4K7ZA 4II3A 1E1MA 3G5RA 4Z26A 2QCUA 5HYMA 2YG5A 4YSHA 4BV6A 1Q1RA 2F5ZA 4GUVA 2EQ9A 4NTDA 4U2LA 4REKA 3UOVA 2IVEA 3DMEA 4TM1A 3DK9A 5DBJA 1YKJA 3NK2X
chains in the Genus database with same CATH topology
3C4AA 3KLJA 1TDEA 2QAEA 1B37A 2C65A 2YLTA 3GDNA 3H8IA 4I59A 5J7XA 5KNLA 1FECA 3UTEA 4OPDA 2GVCA 5BRTA 4ZCCA 4CCQA 1DOCA 1H7WA 3UKKA 4J2WA 4Y4MA 1NG3A 5EOWA 4EIPA 1TDKA 3CPIG 4BJYA 3CNPA 2XFNA 3LADA 4K22A 3AD9B 1PXAA 3K7TA 2FJAA 2GR0A 3RP8A 3UKLA 4B65A 1H6VA 1NDAA 1PBFA 2X8CA 2YVJA 3ZYXA 4A6NA 4TM0A 3AYLA 3UCLA 3T2YA 1ELIA 3FMWA 4UDRA 2V5ZA 4AOXA 4B67A 4BURA 5HY5A 5TR3A 1GRAA 3D8XA 1Y56A 1E7PA 2R4EA 2VQBA 3ITJA 5KOXA 2GAGB 3CGEA 3AEFA 2FJEA 5HHFA 3T31A 4K2XA 1D7LA 4EQXA 1NPXA 2OAMA 2RABA 3AE4A 2BRAA 3C96A 3UKAA 4CRTA 5L46A 3GMCA 4K8DA 1L9CA 2B76A 2IVDA 2GRTA 5LV9A 4YXDA 1IUXA 3CGCA 3NRNA 5C2TA 3EANA 5ER0A 1QJDA 2ARDA 4USRA 4UDQA 4Z25A 4B1BA 4ZCDA 1EL7A 1ZOYA 1CJ4A 1GETA 3PS9A 1VG0A 5U25A 2YLSA 3DGZA 3QSEA 4GRTA 3P4SA 4USQA 1Y0PA 2ACZA 1B4VA 2APGA 2IIDA 3BI2A 4GR1A 4U8IA 2I0ZA 1MOKA 3NGCX 2A87A 2VOUA 3HYWA 3UTHA 3SGLA 2VRMA 2WBAA 4A9WA 1ZDLA 4AT2A 1CJCA 4YKGA 3JSKA 1XPQA 1JOAA 3O0HA 4GAVA 4J56A 1AOGA 4G6GA 1PDHA 1H83A 1M6IA 5KMRA 4A99A 5KRQA 2R0PA 3IF9A 2V60A 3SFDA 2EQ7A 2WHDA 1LJ1A 4OPIA 3RP6A 3UKPA 4EM4A 3DK8A 1PBCA 5HXIA 5FS8A 4C3XA 1GEUA 3EAOA 4GF7A 1OJTA 1CJ2A 3BNMA 2JAEA 2WPCA 4B68A 1H86A 4II2A 4CBQA 2BK5A 2BCGG 2WP9A 1W4XA 2FJDA 2XLSA 4X9NA 1E39A 3K7MX 2WQYA 3GMBA 4DSGA 3CNJA 3P4QA 3RHAA 2Q0LA 1PXCA 3GD3A 1K0JA 2B9YA 3AE2A 3ISHA 4JN9A 3SY4A 1NHRA 3UTFA 2XVHA 2RGOA 1Q1WA 2NPXA 4RG3A 4KPRA 4OPLA 4LIIA 4CNKA 1S3BA 5JCIA 1LQUA 3P4RA 1JRYA 4YKFA 3T2KA 1COYA 4BK1A 3AB1A 4D03A 5BUKA 2XVIA 1PBBA 1B5QA 4H2QA 2C72A 4JY3A 3KD9A 4YTMA 1GRTA 2R45A 2WP5A 1BKWA 4JNQA 3AEAA 3NLCA 4H4WA 4IVOB 2H89A 3QSSA 3AYJA 2H88A 3ICRA 2C3CA 1GSNA 4YSZA 2YVGA 2V6OA 1MXTA 2WOVA 1MO9A 3FPZA 4O5UA 2WU2A 1IUWA 1PHHA 4FX9A 2OALA 2O9ZA 1TDOA 3CMMA 5IQ4A 3G5QA 1ZY8A 2V3AA 4J36A 3NH3X 1PJ7A 2E1MA 3DJJA 2ZBWA 2XLTA 2V3BA 3CGDA 4CY6A 2WETA 4C5OA 3KU9A 3RNMA 2A89A 1F8SA 1QO8A 3HZLA 2GR1A 1DJQA 1PBDA 2GAHB 1B8SA 3UTGA 3AE6A 4YSXA 2J3NA 4UP3A 4U8MA 4J34A 2C64A 3HYVA 4H4VA 3BNUA 1PBEA 1REOA 1ONFA 2GEWA 5EBKA 1S2YA 3UOYA 1NAAA 3ABVA 4RG4A 2YLWA 4EQSA 2R4JA 1DXLA 1GREA 3FG2P 2C7GA 2QA1A 1CC4A 4K5RA 4CNJA 4BK2A 3SM8A 4U8PA 3M0OA 4DNAA 3SQPA 2GQFA 1EL8A 1L9DA 2WEUA 2YVFA 3L1RA 4O5QA 3UOZA 2YR6A 3CGBA 2XLRA 4WCTA 1F8RA 4H4UA 3S61A 2BS2A 3KPFA 1BGJA 4YT0A 2VVLA 1ZP0A 3AE9A 4KX6A 2PYXA 3NKSA 4C77A 1NHQA 3GD4A 4X4JA 4XWZA 2YG6A 4TLZA 1E6EA 1GPEA 4EMWA 4H4PA 2DKIA 4OPUA 3RP7A 1E1LA 2JKCA 1E1KA 2Y6QA 3GYJA 4TLXA 4JDRA 2E5VA 3F8DA 3PVCA 3WE0A 4CCRA 1GRHA 1ZMCA 4C74A 1FEBA 2YLXA 1H84A 1RYIA 4C3YA 3F8RA 3K30A 4NEWA 1YQ4A 1D7YA 4U8NA 2AAQA 1VQWA 1XDIA 1GTHA 4H50A 4Z43A 2Y6RA 3URHA 4BJZA 2OLNA 4H4RA 4K5SA 3UKHA 4A79A 2YG7A 2YR4A 4NNJA 4ZN0A 2VZ2A 1NG4A 5JCLA 2BA9A 1GV4A 2BABA 3AE1A 1H7XA 4NTEA 2WPEA 4M52A 3LJPA 4I58A 1E1NA 3IHGA 1GNDA 3T37A 5FS6A 2JB1A 3PO7A 4ICYA 3ZDNA 1GALA 1BWCA 1GRBA 4G9KA 4EQRA 1BZLA 1KFYA 4EMJA 3ALJA 3P9UA 5CQFA 4LA1A 2YM2A 2WDRA 2WP6A 1K0IA 3T0KA 2C75A 3AD7B 5BULA 2XVJA 1NHPA 4G73A 3VRBA 2BS3A 2TMDA 3V76A 1VRQB 3NG7X 1PN0A 1NEKA 2GR3A 1F8WA 2YR5A 4N9XA 4B69A 2Q6UA 2V61A 1LPFA 2ZZ0A 2WS3A 3BHFA 4J31A 2XLUA 3I3LA 4H4TA 1LQTA 2XYOA 1LTXR 3AE8A 4EIQA 3QVPA 4EM3A 1S3EA 1CF3A 1JEHA 2B7RA 3K7QX 3T14A 2R0CA 4JY2A 4Y4NA 3SZCA 3NHOX 1N1PA 2JB2A 2VRLA 1UKVG 4H4XA 3NYCA 4Z2UA 3DJEA 5U63A 2QA2A 4PABA 3SZ0A 3ALLA 1D4DA 4G6HA 3VQRA 3NIXA 3QVRA 1P2EA 1N4WA 3QFAA 1TYPA 2JBVA 3SFEA 2X8HA 4U8OA 2WPFA 1VDCA 4IV9A 2Z5YA 3LOVA 4XXGA 2C70A 1CC6A 4HB9A 2R46A 3H4KA 4NZHA 1ZX9A 2ZZCA 5JCKA 2RGHA 3FIMB 5JCMA 4B63A 3T2ZA 2XVEA 1DODA 2TPRA 3G5SA 1P2HA 2BRYA 3DA1A 3AD8B 3I6DA 3VRAA 3P1WA 4APNA 3UKQA 3OZ2A 3VR8A 4E0VA 5KOWA 4IA5A 3NNEA 1O5WA 4A5LA 2WOWA 1JNRA 3GWFA 3CIRA 1IUTA 1CL0A 1IJHA 2BK3A 4NTCA 3V3OA 4U8JA 3QSMA 4H4SA 1L0VA 2GF3A 1L9EA 1O94A 1XANA 1EL9A 5GRTA 2BXRA 2GMHA 3LXDA 3LZXA 1ZOVA 4U2TA 3AEBA 4YWOA 3CPJG 2FJBA 3DGHA 3UKFA 2C3DA 3H8LA 4AOSA 3SYIA 1D4CA 2C73A 2X3NA 5C3JA 1V59A 4YTNA 1IUVA 1JNZA 3NTDA 1ZMDA 4Z2RA 1BF3A 2W0HA 4J33A 4H7UA 1NHSA 2BCPA 3D1CA 4Z44A 2YQUA 3KKJA 2FBWA 4GDEA 5KMPA 2YAUA 3GRTA 1RP0A 3DJGX 3ICSA 4HA6A 2OA1A 3F8PA 2YM1A 3ATQA 5U1OA 3R9UA 4UDPA 4OVIA 3ICTA 1XHCA 2WDQA 3NN6X 4A6NB 4H4YA 1GRFA 4H2NA 2CFYA 3V3NA 2GMJA 3L8KA 2X50A 5IPYA 3E1TA 4D04A 2Q0KA 2XFUA 1D4EA 1DJNA 1X31B 1Y56B 1LVLA 3EPTA 4GCMA 4TM4A 1FL2A 1FOHA 2PHHA 4IA6A 1KDGA 4DSHA 4EQWA 3GRSA 4U8KA 5J60A 3KVEA 1GRGA 2X8GA 3BI5A 4LU6A 2DKHA 4YSYA 3LB8A 3Q6JA 1OJCA 2GH5A 4GAPA 4H2RA 4A7AA 4GDPA 1YQZA 4JNAA 2VVMA 3IWAA 2BK4A 3S5WA 1DOEA 4FK1C 4G74A 3AXBA 3AE7A 4AT0A 3NN0X 4YTPA 2XFQA 4Y4LA 1JRXA 1KF6A 1OJDA 2XCGA 2BC1A 5KMQA 4H4QA 1TDNA 3AEDA 4Z24A 2WDVA 3AEEA 1N4VA 1JU2A 3UP4A 3M13A 4A65A 1DNCA 4DGKA 5KVHA 4ECHA 1O95A 1KSSA 3FBSA 3Q9TA 2EQ8A 3DK4A 4Z2TA 2R0GA 4OPCA 1BGNA 4OPTA 2BYBA 1M64A 4XWRA 1SEZA 1HYUA 2JK6A 1K4QA 3NTAA 3GWDA 3NK0X 3C4NA 4H4ZA 1YY5A 4B66A 2GV8A 3M12A 2GB0A 3NYEA 2HQMA 2YLRA 3NT6A 5M10A 3QFBA 2UZZA 1K0LA 1PJ6A 2AR8A 2WESA 1H82A 5KVIA 3SX6A 3CTYA 1EBDA 1FEAA 2Z5XA 3AE3A 3NYFA 2C67A 1GT8A 4P9SA 1CHUA 3REDA 2CDUA 1PJ5A 1EL5A 3IHMA 2B9XA 5KWFA 2YG3A 1TYTA 3AWIA 1RSGA 2JB3A 3ATRA 3IC9A 3QJ4A 4WX1A 3VRDB 4TM3A 4OPGA 2BACA 2C4CA 4ADWA 4J57A 3P4PA 4MJWA 4CY8A 2YG4A 2EQ6A 2WU5A 2BS4A 3B3RA 3SZFA 1PS9A 2C76A 4AP1A 4EMIA 2XLPA 1CBOA 1Z6LA 2X99A 3LZWA 1JRZA 2A8XA 5FS7A 2NVKX 3ALMA 1TDFA 2RGJA 1F6MA 5GSNA 2Q7VA 1NENA 1KNRA 3GDPA 3B6DA 1LV0A 3CNSA 1GERA 3II4A 3KA7A 3OC4A 3UOXA 1PXBA 1KNPA 2XDOA 1F3PA 2E4GA 4RSLA 4X9MA 1YQ3A 2CVJA 4U2SA 1DOBA 4JQ9A 3NK1X 4B64A 2C66A 5JCNA 3GYXA 2BC0A 2VQ7A 1CJ3A 2GR2A 5KMSA 1GXFA 3ADAB 5EB5A 5CKUA 2YWLA 3VR9A 2GQWA 3AEGA 2AQJA 2ZZBA 1OJ9A 1IUUA 3HYXA 2XVFA 1KSUA 3CPHG 5FS9A 3SXIA 4OCGA 3UP5A 2YLZA 4PAAA 3DJDA 2OLOA 1N4UA 5M0ZA 3CNDA 1GTEA 5KXJA 3AE5A 3BI4A 3CNTA 4FDCB 3EF6A 3GYIA 3KPKA 3CN8A 3BHKA 1D5TA 5IQ1A 1Q9IA 1CC2A 1FCDA 4AP3A 1GOSA 1ZKQA 1TRBA 4NWZA 1IUSA 2BXSA 2XFOA 5BVAA 2B9WA 3SZWA 2XFPA 4NEVA 4FK1A 4U8LA 1QLBA 1ZK7A 3GSIA 2R9ZA 1GESA 4BK3A 1H81A 3DH9A 5FMHA 1S2QA 1OJAA 5EB4A 4H2PA 1VG9A 2CULA 2WOIA 3AYIA 2VVLG 2B7SA 4IVMB 3COXA 3AECA 4K7ZA 4II3A 1E1MA 3G5RA 4Z26A 2QCUA 5HYMA 2YG5A 4YSHA 4BV6A 1Q1RA 2F5ZA 4GUVA 2EQ9A 4NTDA 4U2LA 4REKA 3UOVA 2IVEA 3DMEA 4TM1A 3DK9A 5DBJA 1YKJA 3NK2X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4A A;  3KLJ A;  1TDE A;  2QAE A;  1B37 A;  2C65 A;  2YLT A;  3GDN A;  3H8I A;  4I59 A;  5J7X A;  1FEC A;  3UTE A;  4OPD A;  2GVC A;  5BRT A;  4ZCC A;  4CCQ A;  1DOC A;  1H7W A;  3UKK A;  4J2W A;  4Y4M A;  1NG3 A;  5EOW A;  4EIP A;  1TDK A;  3CPI G;  4BJY A;  3CNP A;  2XFN A;  3LAD A;  4K22 A;  3AD9 B;  1PXA A;  3K7T A;  2FJA A;  2GR0 A;  3RP8 A;  3UKL A;  4B65 A;  1H6V A;  1NDA A;  1PBF A;  2X8C A;  2YVJ A;  3ZYX A;  4A6N A;  4TM0 A;  3AYL A;  3UCL A;  1ELI A;  3FMW A;  4UDR A;  2V5Z A;  4AOX A;  4B67 A;  4BUR A;  5HY5 A;  5TR3 A;  1GRA A;  3D8X A;  1Y56 A;  1E7P A;  2R4E A;  2VQB A;  3ITJ A;  5KOX A;  2GAG B;  3CGE A;  3AEF A;  2FJE A;  5HHF A;  4K2X A;  1D7L A;  4EQX A;  1NPX A;  2OAM A;  2RAB A;  3AE4 A;  3C96 A;  3UKA A;  4CRT A;  5L46 A;  3GMC A;  4K8D A;  1L9C A;  2B76 A;  2IVD A;  2GRT A;  5LV9 A;  4YXD A;  1IUX A;  3CGC A;  3NRN A;  5C2T A;  3EAN A;  5ER0 A;  1QJD A;  2ARD A;  4USR A;  4UDQ A;  4Z25 A;  4B1B A;  4ZCD A;  1EL7 A;  1ZOY A;  1CJ4 A;  1GET A;  3PS9 A;  1VG0 A;  5U25 A;  2YLS A;  3DGZ A;  3QSE A;  4GRT A;  3P4S A;  4USQ A;  1Y0P A;  2ACZ A;  1B4V A;  2APG A;  2IID A;  3BI2 A;  4GR1 A;  4U8I A;  2I0Z A;  1MOK A;  3NGC X;  2A87 A;  2VOU A;  3UTH A;  3SGL A;  2VRM A;  2WBA A;  4A9W A;  1ZDL A;  4AT2 A;  1CJC A;  4YKG A;  3JSK A;  1XPQ A;  1JOA A;  3O0H A;  4J56 A;  1AOG A;  1PDH A;  1H83 A;  1M6I A;  4A99 A;  5KRQ A;  2R0P A;  3IF9 A;  2V60 A;  3SFD A;  2EQ7 A;  2WHD A;  1LJ1 A;  4OPI A;  3RP6 A;  3UKP A;  4EM4 A;  3DK8 A;  1PBC A;  5HXI A;  5FS8 A;  4C3X A;  1GEU A;  3EAO A;  4GF7 A;  1OJT A;  1CJ2 A;  3BNM A;  2JAE A;  2WPC A;  4B68 A;  1H86 A;  4CBQ A;  2BK5 A;  2BCG G;  2WP9 A;  1W4X A;  2FJD A;  2XLS A;  4X9N A;  1E39 A;  3K7M X;  2WQY A;  3GMB A;  4DSG A;  3CNJ A;  3P4Q A;  3RHA A;  2Q0L A;  1PXC A;  3GD3 A;  1K0J A;  2B9Y A;  3AE2 A;  3ISH A;  4JN9 A;  3UTF A;  1NHR A;  2XVH A;  2RGO A;  1Q1W A;  2NPX A;  4RG3 A;  4KPR A;  4OPL A;  4LII A;  4CNK A;  1S3B A;  5JCI A;  1LQU A;  3P4R A;  1JRY A;  4YKF A;  1COY A;  4BK1 A;  3AB1 A;  4D03 A;  5BUK A;  2XVI A;  1PBB A;  1B5Q A;  4H2Q A;  2C72 A;  4JY3 A;  3KD9 A;  4YTM A;  1GRT A;  2R45 A;  2WP5 A;  1BKW A;  4JNQ A;  3AEA A;  3NLC A;  4H4W A;  4IVO B;  2H89 A;  3QSS A;  3AYJ A;  2H88 A;  3ICR A;  2C3C A;  1GSN A;  4YSZ A;  2YVG A;  2V6O A;  1MXT A;  2WOV A;  1MO9 A;  3FPZ A;  4O5U A;  2WU2 A;  1IUW A;  1PHH A;  4FX9 A;  2OAL A;  2O9Z A;  1TDO A;  5IQ4 A;  3G5Q A;  1ZY8 A;  2V3A A;  4J36 A;  3NH3 X;  1PJ7 A;  2E1M A;  3DJJ A;  2ZBW A;  2XLT A;  2V3B A;  3CGD A;  4CY6 A;  2WET A;  4C5O A;  3KU9 A;  3RNM A;  2A89 A;  1F8S A;  1QO8 A;  3HZL A;  2GR1 A;  1DJQ A;  1PBD A;  2GAH B;  1B8S A;  3UTG A;  3AE6 A;  4YSX A;  2J3N A;  4UP3 A;  4U8M A;  4J34 A;  2C64 A;  4H4V A;  3BNU A;  1PBE A;  1REO A;  1ONF A;  2GEW A;  5EBK A;  1S2Y A;  3UOY A;  1NAA A;  3ABV A;  4RG4 A;  2YLW A;  4EQS A;  2R4J A;  1DXL A;  1GRE A;  3FG2 P;  2C7G A;  2QA1 A;  1CC4 A;  4K5R A;  4CNJ A;  4BK2 A;  3SM8 A;  4U8P A;  3M0O A;  4DNA A;  3SQP A;  2GQF A;  1EL8 A;  1L9D A;  2WEU A;  2YVF A;  3L1R A;  4O5Q A;  3UOZ A;  2YR6 A;  3CGB A;  2XLR A;  4WCT A;  1F8R A;  4H4U A;  3S61 A;  2BS2 A;  3KPF A;  1BGJ A;  4YT0 A;  2VVL A;  1ZP0 A;  3AE9 A;  4KX6 A;  2PYX A;  3NKS A;  4C77 A;  1NHQ A;  3GD4 A;  4X4J A;  4XWZ A;  2YG6 A;  4TLZ A;  1E6E A;  1GPE A;  4EMW A;  4H4P A;  2DKI A;  4OPU A;  3RP7 A;  1E1L A;  2JKC A;  1E1K A;  2Y6Q A;  3GYJ A;  4TLX A;  4JDR A;  2E5V A;  3F8D A;  3PVC A;  3WE0 A;  4CCR A;  1GRH A;  1ZMC A;  4C74 A;  1FEB A;  2YLX A;  1H84 A;  1RYI A;  4C3Y A;  3F8R A;  3K30 A;  4NEW A;  1YQ4 A;  1D7Y A;  4U8N A;  2AAQ A;  1VQW A;  1XDI A;  1GTH A;  4H50 A;  4Z43 A;  2Y6R A;  3URH A;  4BJZ A;  2OLN A;  4H4R A;  4K5S A;  3UKH A;  4A79 A;  2YG7 A;  2YR4 A;  4ZN0 A;  2VZ2 A;  1NG4 A;  5JCL A;  2BA9 A;  1GV4 A;  2BAB A;  3AE1 A;  1H7X A;  4NTE A;  2WPE A;  4M52 A;  3LJP A;  4I58 A;  1E1N A;  3IHG A;  1GND A;  3T37 A;  5FS6 A;  2JB1 A;  3PO7 A;  4ICY A;  3ZDN A;  1GAL A;  1BWC A;  1GRB A;  4EQR A;  1BZL A;  1KFY A;  4EMJ A;  3ALJ A;  3P9U A;  5CQF A;  4LA1 A;  2YM2 A;  2WDR A;  2WP6 A;  1K0I A;  5BUL A;  2C75 A;  3AD7 B;  2XVJ A;  1NHP A;  3VRB A;  2BS3 A;  2TMD A;  3V76 A;  1VRQ B;  3NG7 X;  1PN0 A;  1NEK A;  2GR3 A;  1F8W A;  2YR5 A;  4N9X A;  4B69 A;  2Q6U A;  2V61 A;  1LPF A;  2ZZ0 A;  2WS3 A;  3BHF A;  4J31 A;  2XLU A;  3I3L A;  4H4T A;  1LQT A;  2XYO A;  1LTX R;  3AE8 A;  4EIQ A;  3QVP A;  4EM3 A;  1S3E A;  1CF3 A;  1JEH A;  2B7R A;  3K7Q X;  2R0C A;  4JY2 A;  4Y4N A;  3NHO X;  1N1P A;  2JB2 A;  2VRL A;  1UKV G;  4H4X A;  3NYC A;  4Z2U A;  3DJE A;  5U63 A;  2QA2 A;  4PAB A;  3ALL A;  1D4D A;  3VQR A;  3NIX A;  3QVR A;  1P2E A;  1N4W A;  3QFA A;  1TYP A;  2JBV A;  3SFE A;  2X8H A;  4U8O A;  2WPF A;  1VDC A;  4IV9 A;  2Z5Y A;  3LOV A;  4XXG A;  2C70 A;  1CC6 A;  4HB9 A;  2R46 A;  3H4K A;  4NZH A;  1ZX9 A;  2ZZC A;  5JCK A;  2RGH A;  3FIM B;  5JCM A;  4B63 A;  2XVE A;  1DOD A;  2TPR A;  3G5S A;  1P2H A;  3DA1 A;  3AD8 B;  3I6D A;  3VRA A;  3P1W A;  4APN A;  3UKQ A;  3OZ2 A;  3VR8 A;  4E0V A;  5KOW A;  4IA5 A;  3NNE A;  1O5W A;  4A5L A;  2WOW A;  1JNR A;  3GWF A;  3CIR A;  1IUT A;  1CL0 A;  1IJH A;  2BK3 A;  4NTC A;  3V3O A;  4U8J A;  3QSM A;  4H4S A;  1L0V A;  2GF3 A;  1L9E A;  1O94 A;  1XAN A;  1EL9 A;  5GRT A;  2BXR A;  2GMH A;  3LXD A;  3LZX A;  1ZOV A;  4U2T A;  3AEB A;  4YWO A;  3CPJ G;  2FJB A;  3DGH A;  3UKF A;  2C3D A;  3H8L A;  4AOS A;  1D4C A;  2C73 A;  2X3N A;  5C3J A;  1V59 A;  4YTN A;  1IUV A;  1JNZ A;  3NTD A;  1ZMD A;  4Z2R A;  1BF3 A;  2W0H A;  4J33 A;  4H7U A;  1NHS A;  2BCP A;  3D1C A;  4Z44 A;  2YQU A;  3KKJ A;  2FBW A;  4GDE A;  2YAU A;  3GRT A;  1RP0 A;  3DJG X;  3ICS A;  4HA6 A;  2OA1 A;  3F8P A;  2YM1 A;  3ATQ A;  5U1O A;  3R9U A;  4UDP A;  4OVI A;  3ICT A;  1XHC A;  2WDQ A;  3NN6 X;  4A6N B;  4H4Y A;  1GRF A;  4H2N A;  2CFY A;  3V3N A;  2GMJ A;  3L8K A;  2X50 A;  5IPY A;  3E1T A;  4D04 A;  2Q0K A;  2XFU A;  1D4E A;  1DJN A;  1X31 B;  1Y56 B;  1LVL A;  3EPT A;  4GCM A;  4TM4 A;  1FL2 A;  1FOH A;  2PHH A;  4IA6 A;  1KDG A;  4DSH A;  4EQW A;  3GRS A;  4U8K A;  5J60 A;  3KVE A;  1GRG A;  2X8G A;  3BI5 A;  4LU6 A;  2DKH A;  4YSY A;  3LB8 A;  3Q6J A;  1OJC A;  2GH5 A;  4H2R A;  4A7A A;  4GDP A;  1YQZ A;  4JNA A;  2VVM A;  3IWA A;  2BK4 A;  3S5W A;  1DOE A;  4FK1 C;  3AXB A;  3AE7 A;  4AT0 A;  3NN0 X;  4YTP A;  2XFQ A;  4Y4L A;  1JRX A;  1KF6 A;  1OJD A;  2XCG A;  2BC1 A;  4H4Q A;  1TDN A;  3AED A;  4Z24 A;  2WDV A;  3AEE A;  1N4V A;  1JU2 A;  3UP4 A;  3M13 A;  4A65 A;  1DNC A;  4DGK A;  5KVH A;  4ECH A;  1O95 A;  1KSS A;  3FBS A;  3Q9T A;  2EQ8 A;  3DK4 A;  4Z2T A;  2R0G A;  4OPC A;  1BGN A;  4OPT A;  2BYB A;  1M64 A;  4XWR A;  1SEZ A;  1HYU A;  2JK6 A;  1K4Q A;  3NTA A;  3GWD A;  3NK0 X;  3C4N A;  4H4Z A;  1YY5 A;  4B66 A;  2GV8 A;  3M12 A;  2GB0 A;  3NYE A;  2HQM A;  2YLR A;  3NT6 A;  5M10 A;  3QFB A;  2UZZ A;  1K0L A;  1PJ6 A;  2AR8 A;  2WES A;  1H82 A;  5KVI A;  3CTY A;  1EBD A;  1FEA A;  2Z5X A;  3AE3 A;  3NYF A;  2C67 A;  1GT8 A;  4P9S A;  1CHU A;  3RED A;  2CDU A;  1PJ5 A;  1EL5 A;  3IHM A;  2B9X A;  5KWF A;  2YG3 A;  1TYT A;  3AWI A;  1RSG A;  2JB3 A;  3ATR A;  3IC9 A;  3QJ4 A;  4WX1 A;  3VRD B;  4TM3 A;  4OPG A;  2BAC A;  4ADW A;  4J57 A;  3P4P A;  4MJW A;  4CY8 A;  2YG4 A;  2EQ6 A;  2WU5 A;  2BS4 A;  3B3R A;  1PS9 A;  2C76 A;  4AP1 A;  4EMI A;  2XLP A;  1CBO A;  1Z6L A;  2X99 A;  3LZW A;  1JRZ A;  2A8X A;  5FS7 A;  2NVK X;  3ALM A;  1TDF A;  2RGJ A;  1F6M A;  5GSN A;  2Q7V A;  1NEN A;  1KNR A;  3GDP A;  3B6D A;  1LV0 A;  3CNS A;  1GER A;  3II4 A;  3KA7 A;  3OC4 A;  3UOX A;  1PXB A;  1KNP A;  2XDO A;  1F3P A;  2E4G A;  4RSL A;  4X9M A;  1YQ3 A;  2CVJ A;  4U2S A;  1DOB A;  4JQ9 A;  3NK1 X;  4B64 A;  2C66 A;  5JCN A;  2BC0 A;  2VQ7 A;  1CJ3 A;  2GR2 A;  1GXF A;  3ADA B;  5EB5 A;  5CKU A;  2YWL A;  3VR9 A;  2GQW A;  3AEG A;  2AQJ A;  2ZZB A;  1OJ9 A;  1IUU A;  2XVF A;  1KSU A;  3CPH G;  5FS9 A;  4OCG A;  3UP5 A;  2YLZ A;  4PAA A;  3DJD A;  2OLO A;  1N4U A;  5M0Z A;  3CND A;  1GTE A;  5KXJ A;  3AE5 A;  3BI4 A;  3CNT A;  4FDC B;  3EF6 A;  3GYI A;  3CN8 A;  3BHK A;  1D5T A;  5IQ1 A;  1Q9I A;  1CC2 A;  1FCD A;  4AP3 A;  1GOS A;  1ZKQ A;  1TRB A;  1IUS A;  2BXS A;  2XFO A;  5BVA A;  2B9W A;  2XFP A;  4NEV A;  4FK1 A;  4U8L A;  1QLB A;  1ZK7 A;  3GSI A;  2R9Z A;  1GES A;  4BK3 A;  1H81 A;  3DH9 A;  5FMH A;  1S2Q A;  1OJA A;  5EB4 A;  4H2P A;  1VG9 A;  2CUL A;  2WOI A;  3AYI A;  2VVL G;  2B7S A;  4IVM B;  3COX A;  3AEC A;  4K7Z A;  1E1M A;  3G5R A;  4Z26 A;  2QCU A;  5HYM A;  2YG5 A;  4YSH A;  4BV6 A;  1Q1R A;  2F5Z A;  4GUV A;  2EQ9 A;  4NTD A;  4U2L A;  4REK A;  3UOV A;  2IVE A;  3DME A;  4TM1 A;  3DK9 A;  5DBJ A;  1YKJ A;  3NK2 X; 
#chains in the Genus database with same CATH topology
 3C4A A;  3KLJ A;  1TDE A;  2QAE A;  1B37 A;  2C65 A;  2YLT A;  3GDN A;  3H8I A;  4I59 A;  5J7X A;  5KNL A;  1FEC A;  3UTE A;  4OPD A;  2GVC A;  5BRT A;  4ZCC A;  4CCQ A;  1DOC A;  1H7W A;  3UKK A;  4J2W A;  4Y4M A;  1NG3 A;  5EOW A;  4EIP A;  1TDK A;  3CPI G;  4BJY A;  3CNP A;  2XFN A;  3LAD A;  4K22 A;  3AD9 B;  1PXA A;  3K7T A;  2FJA A;  2GR0 A;  3RP8 A;  3UKL A;  4B65 A;  1H6V A;  1NDA A;  1PBF A;  2X8C A;  2YVJ A;  3ZYX A;  4A6N A;  4TM0 A;  3AYL A;  3UCL A;  3T2Y A;  1ELI A;  3FMW A;  4UDR A;  2V5Z A;  4AOX A;  4B67 A;  4BUR A;  5HY5 A;  5TR3 A;  1GRA A;  3D8X A;  1Y56 A;  1E7P A;  2R4E A;  2VQB A;  3ITJ A;  5KOX A;  2GAG B;  3CGE A;  3AEF A;  2FJE A;  5HHF A;  3T31 A;  4K2X A;  1D7L A;  4EQX A;  1NPX A;  2OAM A;  2RAB A;  3AE4 A;  2BRA A;  3C96 A;  3UKA A;  4CRT A;  5L46 A;  3GMC A;  4K8D A;  1L9C A;  2B76 A;  2IVD A;  2GRT A;  5LV9 A;  4YXD A;  1IUX A;  3CGC A;  3NRN A;  5C2T A;  3EAN A;  5ER0 A;  1QJD A;  2ARD A;  4USR A;  4UDQ A;  4Z25 A;  4B1B A;  4ZCD A;  1EL7 A;  1ZOY A;  1CJ4 A;  1GET A;  3PS9 A;  1VG0 A;  5U25 A;  2YLS A;  3DGZ A;  3QSE A;  4GRT A;  3P4S A;  4USQ A;  1Y0P A;  2ACZ A;  1B4V A;  2APG A;  2IID A;  3BI2 A;  4GR1 A;  4U8I A;  2I0Z A;  1MOK A;  3NGC X;  2A87 A;  2VOU A;  3HYW A;  3UTH A;  3SGL A;  2VRM A;  2WBA A;  4A9W A;  1ZDL A;  4AT2 A;  1CJC A;  4YKG A;  3JSK A;  1XPQ A;  1JOA A;  3O0H A;  4GAV A;  4J56 A;  1AOG A;  4G6G A;  1PDH A;  1H83 A;  1M6I A;  5KMR A;  4A99 A;  5KRQ A;  2R0P A;  3IF9 A;  2V60 A;  3SFD A;  2EQ7 A;  2WHD A;  1LJ1 A;  4OPI A;  3RP6 A;  3UKP A;  4EM4 A;  3DK8 A;  1PBC A;  5HXI A;  5FS8 A;  4C3X A;  1GEU A;  3EAO A;  4GF7 A;  1OJT A;  1CJ2 A;  3BNM A;  2JAE A;  2WPC A;  4B68 A;  1H86 A;  4II2 A;  4CBQ A;  2BK5 A;  2BCG G;  2WP9 A;  1W4X A;  2FJD A;  2XLS A;  4X9N A;  1E39 A;  3K7M X;  2WQY A;  3GMB A;  4DSG A;  3CNJ A;  3P4Q A;  3RHA A;  2Q0L A;  1PXC A;  3GD3 A;  1K0J A;  2B9Y A;  3AE2 A;  3ISH A;  4JN9 A;  3SY4 A;  1NHR A;  3UTF A;  2XVH A;  2RGO A;  1Q1W A;  2NPX A;  4RG3 A;  4KPR A;  4OPL A;  4LII A;  4CNK A;  1S3B A;  5JCI A;  1LQU A;  3P4R A;  1JRY A;  4YKF A;  3T2K A;  1COY A;  4BK1 A;  3AB1 A;  4D03 A;  5BUK A;  2XVI A;  1PBB A;  1B5Q A;  4H2Q A;  2C72 A;  4JY3 A;  3KD9 A;  4YTM A;  1GRT A;  2R45 A;  2WP5 A;  1BKW A;  4JNQ A;  3AEA A;  3NLC A;  4H4W A;  4IVO B;  2H89 A;  3QSS A;  3AYJ A;  2H88 A;  3ICR A;  2C3C A;  1GSN A;  4YSZ A;  2YVG A;  2V6O A;  1MXT A;  2WOV A;  1MO9 A;  3FPZ A;  4O5U A;  2WU2 A;  1IUW A;  1PHH A;  4FX9 A;  2OAL A;  2O9Z A;  1TDO A;  3CMM A;  5IQ4 A;  3G5Q A;  1ZY8 A;  2V3A A;  4J36 A;  3NH3 X;  1PJ7 A;  2E1M A;  3DJJ A;  2ZBW A;  2XLT A;  2V3B A;  3CGD A;  4CY6 A;  2WET A;  4C5O A;  3KU9 A;  3RNM A;  2A89 A;  1F8S A;  1QO8 A;  3HZL A;  2GR1 A;  1DJQ A;  1PBD A;  2GAH B;  1B8S A;  3UTG A;  3AE6 A;  4YSX A;  2J3N A;  4UP3 A;  4U8M A;  4J34 A;  2C64 A;  3HYV A;  4H4V A;  3BNU A;  1PBE A;  1REO A;  1ONF A;  2GEW A;  5EBK A;  1S2Y A;  3UOY A;  1NAA A;  3ABV A;  4RG4 A;  2YLW A;  4EQS A;  2R4J A;  1DXL A;  1GRE A;  3FG2 P;  2C7G A;  2QA1 A;  1CC4 A;  4K5R A;  4CNJ A;  4BK2 A;  3SM8 A;  4U8P A;  3M0O A;  4DNA A;  3SQP A;  2GQF A;  1EL8 A;  1L9D A;  2WEU A;  2YVF A;  3L1R A;  4O5Q A;  3UOZ A;  2YR6 A;  3CGB A;  2XLR A;  4WCT A;  1F8R A;  4H4U A;  3S61 A;  2BS2 A;  3KPF A;  1BGJ A;  4YT0 A;  2VVL A;  1ZP0 A;  3AE9 A;  4KX6 A;  2PYX A;  3NKS A;  4C77 A;  1NHQ A;  3GD4 A;  4X4J A;  4XWZ A;  2YG6 A;  4TLZ A;  1E6E A;  1GPE A;  4EMW A;  4H4P A;  2DKI A;  4OPU A;  3RP7 A;  1E1L A;  2JKC A;  1E1K A;  2Y6Q A;  3GYJ A;  4TLX A;  4JDR A;  2E5V A;  3F8D A;  3PVC A;  3WE0 A;  4CCR A;  1GRH A;  1ZMC A;  4C74 A;  1FEB A;  2YLX A;  1H84 A;  1RYI A;  4C3Y A;  3F8R A;  3K30 A;  4NEW A;  1YQ4 A;  1D7Y A;  4U8N A;  2AAQ A;  1VQW A;  1XDI A;  1GTH A;  4H50 A;  4Z43 A;  2Y6R A;  3URH A;  4BJZ A;  2OLN A;  4H4R A;  4K5S A;  3UKH A;  4A79 A;  2YG7 A;  2YR4 A;  4NNJ A;  4ZN0 A;  2VZ2 A;  1NG4 A;  5JCL A;  2BA9 A;  1GV4 A;  2BAB A;  3AE1 A;  1H7X A;  4NTE A;  2WPE A;  4M52 A;  3LJP A;  4I58 A;  1E1N A;  3IHG A;  1GND A;  3T37 A;  5FS6 A;  2JB1 A;  3PO7 A;  4ICY A;  3ZDN A;  1GAL A;  1BWC A;  1GRB A;  4G9K A;  4EQR A;  1BZL A;  1KFY A;  4EMJ A;  3ALJ A;  3P9U A;  5CQF A;  4LA1 A;  2YM2 A;  2WDR A;  2WP6 A;  1K0I A;  3T0K A;  2C75 A;  3AD7 B;  5BUL A;  2XVJ A;  1NHP A;  4G73 A;  3VRB A;  2BS3 A;  2TMD A;  3V76 A;  1VRQ B;  3NG7 X;  1PN0 A;  1NEK A;  2GR3 A;  1F8W A;  2YR5 A;  4N9X A;  4B69 A;  2Q6U A;  2V61 A;  1LPF A;  2ZZ0 A;  2WS3 A;  3BHF A;  4J31 A;  2XLU A;  3I3L A;  4H4T A;  1LQT A;  2XYO A;  1LTX R;  3AE8 A;  4EIQ A;  3QVP A;  4EM3 A;  1S3E A;  1CF3 A;  1JEH A;  2B7R A;  3K7Q X;  3T14 A;  2R0C A;  4JY2 A;  4Y4N A;  3SZC A;  3NHO X;  1N1P A;  2JB2 A;  2VRL A;  1UKV G;  4H4X A;  3NYC A;  4Z2U A;  3DJE A;  5U63 A;  2QA2 A;  4PAB A;  3SZ0 A;  3ALL A;  1D4D A;  4G6H A;  3VQR A;  3NIX A;  3QVR A;  1P2E A;  1N4W A;  3QFA A;  1TYP A;  2JBV A;  3SFE A;  2X8H A;  4U8O A;  2WPF A;  1VDC A;  4IV9 A;  2Z5Y A;  3LOV A;  4XXG A;  2C70 A;  1CC6 A;  4HB9 A;  2R46 A;  3H4K A;  4NZH A;  1ZX9 A;  2ZZC A;  5JCK A;  2RGH A;  3FIM B;  5JCM A;  4B63 A;  3T2Z A;  2XVE A;  1DOD A;  2TPR A;  3G5S A;  1P2H A;  2BRY A;  3DA1 A;  3AD8 B;  3I6D A;  3VRA A;  3P1W A;  4APN A;  3UKQ A;  3OZ2 A;  3VR8 A;  4E0V A;  5KOW A;  4IA5 A;  3NNE A;  1O5W A;  4A5L A;  2WOW A;  1JNR A;  3GWF A;  3CIR A;  1IUT A;  1CL0 A;  1IJH A;  2BK3 A;  4NTC A;  3V3O A;  4U8J A;  3QSM A;  4H4S A;  1L0V A;  2GF3 A;  1L9E A;  1O94 A;  1XAN A;  1EL9 A;  5GRT A;  2BXR A;  2GMH A;  3LXD A;  3LZX A;  1ZOV A;  4U2T A;  3AEB A;  4YWO A;  3CPJ G;  2FJB A;  3DGH A;  3UKF A;  2C3D A;  3H8L A;  4AOS A;  3SYI A;  1D4C A;  2C73 A;  2X3N A;  5C3J A;  1V59 A;  4YTN A;  1IUV A;  1JNZ A;  3NTD A;  1ZMD A;  4Z2R A;  1BF3 A;  2W0H A;  4J33 A;  4H7U A;  1NHS A;  2BCP A;  3D1C A;  4Z44 A;  2YQU A;  3KKJ A;  2FBW A;  4GDE A;  5KMP A;  2YAU A;  3GRT A;  1RP0 A;  3DJG X;  3ICS A;  4HA6 A;  2OA1 A;  3F8P A;  2YM1 A;  3ATQ A;  5U1O A;  3R9U A;  4UDP A;  4OVI A;  3ICT A;  1XHC A;  2WDQ A;  3NN6 X;  4A6N B;  4H4Y A;  1GRF A;  4H2N A;  2CFY A;  3V3N A;  2GMJ A;  3L8K A;  2X50 A;  5IPY A;  3E1T A;  4D04 A;  2Q0K A;  2XFU A;  1D4E A;  1DJN A;  1X31 B;  1Y56 B;  1LVL A;  3EPT A;  4GCM A;  4TM4 A;  1FL2 A;  1FOH A;  2PHH A;  4IA6 A;  1KDG A;  4DSH A;  4EQW A;  3GRS A;  4U8K A;  5J60 A;  3KVE A;  1GRG A;  2X8G A;  3BI5 A;  4LU6 A;  2DKH A;  4YSY A;  3LB8 A;  3Q6J A;  1OJC A;  2GH5 A;  4GAP A;  4H2R A;  4A7A A;  4GDP A;  1YQZ A;  4JNA A;  2VVM A;  3IWA A;  2BK4 A;  3S5W A;  1DOE A;  4FK1 C;  4G74 A;  3AXB A;  3AE7 A;  4AT0 A;  3NN0 X;  4YTP A;  2XFQ A;  4Y4L A;  1JRX A;  1KF6 A;  1OJD A;  2XCG A;  2BC1 A;  5KMQ A;  4H4Q A;  1TDN A;  3AED A;  4Z24 A;  2WDV A;  3AEE A;  1N4V A;  1JU2 A;  3UP4 A;  3M13 A;  4A65 A;  1DNC A;  4DGK A;  5KVH A;  4ECH A;  1O95 A;  1KSS A;  3FBS A;  3Q9T A;  2EQ8 A;  3DK4 A;  4Z2T A;  2R0G A;  4OPC A;  1BGN A;  4OPT A;  2BYB A;  1M64 A;  4XWR A;  1SEZ A;  1HYU A;  2JK6 A;  1K4Q A;  3NTA A;  3GWD A;  3NK0 X;  3C4N A;  4H4Z A;  1YY5 A;  4B66 A;  2GV8 A;  3M12 A;  2GB0 A;  3NYE A;  2HQM A;  2YLR A;  3NT6 A;  5M10 A;  3QFB A;  2UZZ A;  1K0L A;  1PJ6 A;  2AR8 A;  2WES A;  1H82 A;  5KVI A;  3SX6 A;  3CTY A;  1EBD A;  1FEA A;  2Z5X A;  3AE3 A;  3NYF A;  2C67 A;  1GT8 A;  4P9S A;  1CHU A;  3RED A;  2CDU A;  1PJ5 A;  1EL5 A;  3IHM A;  2B9X A;  5KWF A;  2YG3 A;  1TYT A;  3AWI A;  1RSG A;  2JB3 A;  3ATR A;  3IC9 A;  3QJ4 A;  4WX1 A;  3VRD B;  4TM3 A;  4OPG A;  2BAC A;  2C4C A;  4ADW A;  4J57 A;  3P4P A;  4MJW A;  4CY8 A;  2YG4 A;  2EQ6 A;  2WU5 A;  2BS4 A;  3B3R A;  3SZF A;  1PS9 A;  2C76 A;  4AP1 A;  4EMI A;  2XLP A;  1CBO A;  1Z6L A;  2X99 A;  3LZW A;  1JRZ A;  2A8X A;  5FS7 A;  2NVK X;  3ALM A;  1TDF A;  2RGJ A;  1F6M A;  5GSN A;  2Q7V A;  1NEN A;  1KNR A;  3GDP A;  3B6D A;  1LV0 A;  3CNS A;  1GER A;  3II4 A;  3KA7 A;  3OC4 A;  3UOX A;  1PXB A;  1KNP A;  2XDO A;  1F3P A;  2E4G A;  4RSL A;  4X9M A;  1YQ3 A;  2CVJ A;  4U2S A;  1DOB A;  4JQ9 A;  3NK1 X;  4B64 A;  2C66 A;  5JCN A;  3GYX A;  2BC0 A;  2VQ7 A;  1CJ3 A;  2GR2 A;  5KMS A;  1GXF A;  3ADA B;  5EB5 A;  5CKU A;  2YWL A;  3VR9 A;  2GQW A;  3AEG A;  2AQJ A;  2ZZB A;  1OJ9 A;  1IUU A;  3HYX A;  2XVF A;  1KSU A;  3CPH G;  5FS9 A;  3SXI A;  4OCG A;  3UP5 A;  2YLZ A;  4PAA A;  3DJD A;  2OLO A;  1N4U A;  5M0Z A;  3CND A;  1GTE A;  5KXJ A;  3AE5 A;  3BI4 A;  3CNT A;  4FDC B;  3EF6 A;  3GYI A;  3KPK A;  3CN8 A;  3BHK A;  1D5T A;  5IQ1 A;  1Q9I A;  1CC2 A;  1FCD A;  4AP3 A;  1GOS A;  1ZKQ A;  1TRB A;  4NWZ A;  1IUS A;  2BXS A;  2XFO A;  5BVA A;  2B9W A;  3SZW A;  2XFP A;  4NEV A;  4FK1 A;  4U8L A;  1QLB A;  1ZK7 A;  3GSI A;  2R9Z A;  1GES A;  4BK3 A;  1H81 A;  3DH9 A;  5FMH A;  1S2Q A;  1OJA A;  5EB4 A;  4H2P A;  1VG9 A;  2CUL A;  2WOI A;  3AYI A;  2VVL G;  2B7S A;  4IVM B;  3COX A;  3AEC A;  4K7Z A;  4II3 A;  1E1M A;  3G5R A;  4Z26 A;  2QCU A;  5HYM A;  2YG5 A;  4YSH A;  4BV6 A;  1Q1R A;  2F5Z A;  4GUV A;  2EQ9 A;  4NTD A;  4U2L A;  4REK A;  3UOV A;  2IVE A;  3DME A;  4TM1 A;  3DK9 A;  5DBJ A;  1YKJ A;  3NK2 X; 
#chains in the Genus database with same CATH homology
 3C4A A;  3KLJ A;  1TDE A;  2QAE A;  1B37 A;  2C65 A;  2YLT A;  3GDN A;  3H8I A;  4I59 A;  5J7X A;  5KNL A;  1FEC A;  3UTE A;  4OPD A;  2GVC A;  5BRT A;  4ZCC A;  4CCQ A;  1DOC A;  1H7W A;  3UKK A;  4J2W A;  4Y4M A;  1NG3 A;  5EOW A;  4EIP A;  1TDK A;  3CPI G;  4BJY A;  3CNP A;  2XFN A;  3LAD A;  4K22 A;  3AD9 B;  1PXA A;  3K7T A;  2FJA A;  2GR0 A;  3RP8 A;  3UKL A;  4B65 A;  1H6V A;  1NDA A;  1PBF A;  2X8C A;  2YVJ A;  3ZYX A;  4A6N A;  4TM0 A;  3AYL A;  3UCL A;  3T2Y A;  1ELI A;  3FMW A;  4UDR A;  2V5Z A;  4AOX A;  4B67 A;  4BUR A;  5HY5 A;  5TR3 A;  1GRA A;  3D8X A;  1Y56 A;  1E7P A;  2R4E A;  2VQB A;  3ITJ A;  5KOX A;  2GAG B;  3CGE A;  3AEF A;  2FJE A;  5HHF A;  3T31 A;  4K2X A;  1D7L A;  4EQX A;  1NPX A;  2OAM A;  2RAB A;  3AE4 A;  2BRA A;  3C96 A;  3UKA A;  4CRT A;  5L46 A;  3GMC A;  4K8D A;  1L9C A;  2B76 A;  2IVD A;  2GRT A;  5LV9 A;  4YXD A;  1IUX A;  3CGC A;  3NRN A;  5C2T A;  3EAN A;  5ER0 A;  1QJD A;  2ARD A;  4USR A;  4UDQ A;  4Z25 A;  4B1B A;  4ZCD A;  1EL7 A;  1ZOY A;  1CJ4 A;  1GET A;  3PS9 A;  1VG0 A;  5U25 A;  2YLS A;  3DGZ A;  3QSE A;  4GRT A;  3P4S A;  4USQ A;  1Y0P A;  2ACZ A;  1B4V A;  2APG A;  2IID A;  3BI2 A;  4GR1 A;  4U8I A;  2I0Z A;  1MOK A;  3NGC X;  2A87 A;  2VOU A;  3HYW A;  3UTH A;  3SGL A;  2VRM A;  2WBA A;  4A9W A;  1ZDL A;  4AT2 A;  1CJC A;  4YKG A;  3JSK A;  1XPQ A;  1JOA A;  3O0H A;  4GAV A;  4J56 A;  1AOG A;  4G6G A;  1PDH A;  1H83 A;  1M6I A;  5KMR A;  4A99 A;  5KRQ A;  2R0P A;  3IF9 A;  2V60 A;  3SFD A;  2EQ7 A;  2WHD A;  1LJ1 A;  4OPI A;  3RP6 A;  3UKP A;  4EM4 A;  3DK8 A;  1PBC A;  5HXI A;  5FS8 A;  4C3X A;  1GEU A;  3EAO A;  4GF7 A;  1OJT A;  1CJ2 A;  3BNM A;  2JAE A;  2WPC A;  4B68 A;  1H86 A;  4II2 A;  4CBQ A;  2BK5 A;  2BCG G;  2WP9 A;  1W4X A;  2FJD A;  2XLS A;  4X9N A;  1E39 A;  3K7M X;  2WQY A;  3GMB A;  4DSG A;  3CNJ A;  3P4Q A;  3RHA A;  2Q0L A;  1PXC A;  3GD3 A;  1K0J A;  2B9Y A;  3AE2 A;  3ISH A;  4JN9 A;  3SY4 A;  1NHR A;  3UTF A;  2XVH A;  2RGO A;  1Q1W A;  2NPX A;  4RG3 A;  4KPR A;  4OPL A;  4LII A;  4CNK A;  1S3B A;  5JCI A;  1LQU A;  3P4R A;  1JRY A;  4YKF A;  3T2K A;  1COY A;  4BK1 A;  3AB1 A;  4D03 A;  5BUK A;  2XVI A;  1PBB A;  1B5Q A;  4H2Q A;  2C72 A;  4JY3 A;  3KD9 A;  4YTM A;  1GRT A;  2R45 A;  2WP5 A;  1BKW A;  4JNQ A;  3AEA A;  3NLC A;  4H4W A;  4IVO B;  2H89 A;  3QSS A;  3AYJ A;  2H88 A;  3ICR A;  2C3C A;  1GSN A;  4YSZ A;  2YVG A;  2V6O A;  1MXT A;  2WOV A;  1MO9 A;  3FPZ A;  4O5U A;  2WU2 A;  1IUW A;  1PHH A;  4FX9 A;  2OAL A;  2O9Z A;  1TDO A;  3CMM A;  5IQ4 A;  3G5Q A;  1ZY8 A;  2V3A A;  4J36 A;  3NH3 X;  1PJ7 A;  2E1M A;  3DJJ A;  2ZBW A;  2XLT A;  2V3B A;  3CGD A;  4CY6 A;  2WET A;  4C5O A;  3KU9 A;  3RNM A;  2A89 A;  1F8S A;  1QO8 A;  3HZL A;  2GR1 A;  1DJQ A;  1PBD A;  2GAH B;  1B8S A;  3UTG A;  3AE6 A;  4YSX A;  2J3N A;  4UP3 A;  4U8M A;  4J34 A;  2C64 A;  3HYV A;  4H4V A;  3BNU A;  1PBE A;  1REO A;  1ONF A;  2GEW A;  5EBK A;  1S2Y A;  3UOY A;  1NAA A;  3ABV A;  4RG4 A;  2YLW A;  4EQS A;  2R4J A;  1DXL A;  1GRE A;  3FG2 P;  2C7G A;  2QA1 A;  1CC4 A;  4K5R A;  4CNJ A;  4BK2 A;  3SM8 A;  4U8P A;  3M0O A;  4DNA A;  3SQP A;  2GQF A;  1EL8 A;  1L9D A;  2WEU A;  2YVF A;  3L1R A;  4O5Q A;  3UOZ A;  2YR6 A;  3CGB A;  2XLR A;  4WCT A;  1F8R A;  4H4U A;  3S61 A;  2BS2 A;  3KPF A;  1BGJ A;  4YT0 A;  2VVL A;  1ZP0 A;  3AE9 A;  4KX6 A;  2PYX A;  3NKS A;  4C77 A;  1NHQ A;  3GD4 A;  4X4J A;  4XWZ A;  2YG6 A;  4TLZ A;  1E6E A;  1GPE A;  4EMW A;  4H4P A;  2DKI A;  4OPU A;  3RP7 A;  1E1L A;  2JKC A;  1E1K A;  2Y6Q A;  3GYJ A;  4TLX A;  4JDR A;  2E5V A;  3F8D A;  3PVC A;  3WE0 A;  4CCR A;  1GRH A;  1ZMC A;  4C74 A;  1FEB A;  2YLX A;  1H84 A;  1RYI A;  4C3Y A;  3F8R A;  3K30 A;  4NEW A;  1YQ4 A;  1D7Y A;  4U8N A;  2AAQ A;  1VQW A;  1XDI A;  1GTH A;  4H50 A;  4Z43 A;  2Y6R A;  3URH A;  4BJZ A;  2OLN A;  4H4R A;  4K5S A;  3UKH A;  4A79 A;  2YG7 A;  2YR4 A;  4NNJ A;  4ZN0 A;  2VZ2 A;  1NG4 A;  5JCL A;  2BA9 A;  1GV4 A;  2BAB A;  3AE1 A;  1H7X A;  4NTE A;  2WPE A;  4M52 A;  3LJP A;  4I58 A;  1E1N A;  3IHG A;  1GND A;  3T37 A;  5FS6 A;  2JB1 A;  3PO7 A;  4ICY A;  3ZDN A;  1GAL A;  1BWC A;  1GRB A;  4G9K A;  4EQR A;  1BZL A;  1KFY A;  4EMJ A;  3ALJ A;  3P9U A;  5CQF A;  4LA1 A;  2YM2 A;  2WDR A;  2WP6 A;  1K0I A;  3T0K A;  2C75 A;  3AD7 B;  5BUL A;  2XVJ A;  1NHP A;  4G73 A;  3VRB A;  2BS3 A;  2TMD A;  3V76 A;  1VRQ B;  3NG7 X;  1PN0 A;  1NEK A;  2GR3 A;  1F8W A;  2YR5 A;  4N9X A;  4B69 A;  2Q6U A;  2V61 A;  1LPF A;  2ZZ0 A;  2WS3 A;  3BHF A;  4J31 A;  2XLU A;  3I3L A;  4H4T A;  1LQT A;  2XYO A;  1LTX R;  3AE8 A;  4EIQ A;  3QVP A;  4EM3 A;  1S3E A;  1CF3 A;  1JEH A;  2B7R A;  3K7Q X;  3T14 A;  2R0C A;  4JY2 A;  4Y4N A;  3SZC A;  3NHO X;  1N1P A;  2JB2 A;  2VRL A;  1UKV G;  4H4X A;  3NYC A;  4Z2U A;  3DJE A;  5U63 A;  2QA2 A;  4PAB A;  3SZ0 A;  3ALL A;  1D4D A;  4G6H A;  3VQR A;  3NIX A;  3QVR A;  1P2E A;  1N4W A;  3QFA A;  1TYP A;  2JBV A;  3SFE A;  2X8H A;  4U8O A;  2WPF A;  1VDC A;  4IV9 A;  2Z5Y A;  3LOV A;  4XXG A;  2C70 A;  1CC6 A;  4HB9 A;  2R46 A;  3H4K A;  4NZH A;  1ZX9 A;  2ZZC A;  5JCK A;  2RGH A;  3FIM B;  5JCM A;  4B63 A;  3T2Z A;  2XVE A;  1DOD A;  2TPR A;  3G5S A;  1P2H A;  2BRY A;  3DA1 A;  3AD8 B;  3I6D A;  3VRA A;  3P1W A;  4APN A;  3UKQ A;  3OZ2 A;  3VR8 A;  4E0V A;  5KOW A;  4IA5 A;  3NNE A;  1O5W A;  4A5L A;  2WOW A;  1JNR A;  3GWF A;  3CIR A;  1IUT A;  1CL0 A;  1IJH A;  2BK3 A;  4NTC A;  3V3O A;  4U8J A;  3QSM A;  4H4S A;  1L0V A;  2GF3 A;  1L9E A;  1O94 A;  1XAN A;  1EL9 A;  5GRT A;  2BXR A;  2GMH A;  3LXD A;  3LZX A;  1ZOV A;  4U2T A;  3AEB A;  4YWO A;  3CPJ G;  2FJB A;  3DGH A;  3UKF A;  2C3D A;  3H8L A;  4AOS A;  3SYI A;  1D4C A;  2C73 A;  2X3N A;  5C3J A;  1V59 A;  4YTN A;  1IUV A;  1JNZ A;  3NTD A;  1ZMD A;  4Z2R A;  1BF3 A;  2W0H A;  4J33 A;  4H7U A;  1NHS A;  2BCP A;  3D1C A;  4Z44 A;  2YQU A;  3KKJ A;  2FBW A;  4GDE A;  5KMP A;  2YAU A;  3GRT A;  1RP0 A;  3DJG X;  3ICS A;  4HA6 A;  2OA1 A;  3F8P A;  2YM1 A;  3ATQ A;  5U1O A;  3R9U A;  4UDP A;  4OVI A;  3ICT A;  1XHC A;  2WDQ A;  3NN6 X;  4A6N B;  4H4Y A;  1GRF A;  4H2N A;  2CFY A;  3V3N A;  2GMJ A;  3L8K A;  2X50 A;  5IPY A;  3E1T A;  4D04 A;  2Q0K A;  2XFU A;  1D4E A;  1DJN A;  1X31 B;  1Y56 B;  1LVL A;  3EPT A;  4GCM A;  4TM4 A;  1FL2 A;  1FOH A;  2PHH A;  4IA6 A;  1KDG A;  4DSH A;  4EQW A;  3GRS A;  4U8K A;  5J60 A;  3KVE A;  1GRG A;  2X8G A;  3BI5 A;  4LU6 A;  2DKH A;  4YSY A;  3LB8 A;  3Q6J A;  1OJC A;  2GH5 A;  4GAP A;  4H2R A;  4A7A A;  4GDP A;  1YQZ A;  4JNA A;  2VVM A;  3IWA A;  2BK4 A;  3S5W A;  1DOE A;  4FK1 C;  4G74 A;  3AXB A;  3AE7 A;  4AT0 A;  3NN0 X;  4YTP A;  2XFQ A;  4Y4L A;  1JRX A;  1KF6 A;  1OJD A;  2XCG A;  2BC1 A;  5KMQ A;  4H4Q A;  1TDN A;  3AED A;  4Z24 A;  2WDV A;  3AEE A;  1N4V A;  1JU2 A;  3UP4 A;  3M13 A;  4A65 A;  1DNC A;  4DGK A;  5KVH A;  4ECH A;  1O95 A;  1KSS A;  3FBS A;  3Q9T A;  2EQ8 A;  3DK4 A;  4Z2T A;  2R0G A;  4OPC A;  1BGN A;  4OPT A;  2BYB A;  1M64 A;  4XWR A;  1SEZ A;  1HYU A;  2JK6 A;  1K4Q A;  3NTA A;  3GWD A;  3NK0 X;  3C4N A;  4H4Z A;  1YY5 A;  4B66 A;  2GV8 A;  3M12 A;  2GB0 A;  3NYE A;  2HQM A;  2YLR A;  3NT6 A;  5M10 A;  3QFB A;  2UZZ A;  1K0L A;  1PJ6 A;  2AR8 A;  2WES A;  1H82 A;  5KVI A;  3SX6 A;  3CTY A;  1EBD A;  1FEA A;  2Z5X A;  3AE3 A;  3NYF A;  2C67 A;  1GT8 A;  4P9S A;  1CHU A;  3RED A;  2CDU A;  1PJ5 A;  1EL5 A;  3IHM A;  2B9X A;  5KWF A;  2YG3 A;  1TYT A;  3AWI A;  1RSG A;  2JB3 A;  3ATR A;  3IC9 A;  3QJ4 A;  4WX1 A;  3VRD B;  4TM3 A;  4OPG A;  2BAC A;  2C4C A;  4ADW A;  4J57 A;  3P4P A;  4MJW A;  4CY8 A;  2YG4 A;  2EQ6 A;  2WU5 A;  2BS4 A;  3B3R A;  3SZF A;  1PS9 A;  2C76 A;  4AP1 A;  4EMI A;  2XLP A;  1CBO A;  1Z6L A;  2X99 A;  3LZW A;  1JRZ A;  2A8X A;  5FS7 A;  2NVK X;  3ALM A;  1TDF A;  2RGJ A;  1F6M A;  5GSN A;  2Q7V A;  1NEN A;  1KNR A;  3GDP A;  3B6D A;  1LV0 A;  3CNS A;  1GER A;  3II4 A;  3KA7 A;  3OC4 A;  3UOX A;  1PXB A;  1KNP A;  2XDO A;  1F3P A;  2E4G A;  4RSL A;  4X9M A;  1YQ3 A;  2CVJ A;  4U2S A;  1DOB A;  4JQ9 A;  3NK1 X;  4B64 A;  2C66 A;  5JCN A;  3GYX A;  2BC0 A;  2VQ7 A;  1CJ3 A;  2GR2 A;  5KMS A;  1GXF A;  3ADA B;  5EB5 A;  5CKU A;  2YWL A;  3VR9 A;  2GQW A;  3AEG A;  2AQJ A;  2ZZB A;  1OJ9 A;  1IUU A;  3HYX A;  2XVF A;  1KSU A;  3CPH G;  5FS9 A;  3SXI A;  4OCG A;  3UP5 A;  2YLZ A;  4PAA A;  3DJD A;  2OLO A;  1N4U A;  5M0Z A;  3CND A;  1GTE A;  5KXJ A;  3AE5 A;  3BI4 A;  3CNT A;  4FDC B;  3EF6 A;  3GYI A;  3KPK A;  3CN8 A;  3BHK A;  1D5T A;  5IQ1 A;  1Q9I A;  1CC2 A;  1FCD A;  4AP3 A;  1GOS A;  1ZKQ A;  1TRB A;  4NWZ A;  1IUS A;  2BXS A;  2XFO A;  5BVA A;  2B9W A;  3SZW A;  2XFP A;  4NEV A;  4FK1 A;  4U8L A;  1QLB A;  1ZK7 A;  3GSI A;  2R9Z A;  1GES A;  4BK3 A;  1H81 A;  3DH9 A;  5FMH A;  1S2Q A;  1OJA A;  5EB4 A;  4H2P A;  1VG9 A;  2CUL A;  2WOI A;  3AYI A;  2VVL G;  2B7S A;  4IVM B;  3COX A;  3AEC A;  4K7Z A;  4II3 A;  1E1M A;  3G5R A;  4Z26 A;  2QCU A;  5HYM A;  2YG5 A;  4YSH A;  4BV6 A;  1Q1R A;  2F5Z A;  4GUV A;  2EQ9 A;  4NTD A;  4U2L A;  4REK A;  3UOV A;  2IVE A;  3DME A;  4TM1 A;  3DK9 A;  5DBJ A;  1YKJ A;  3NK2 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...