3UOZA

Crystal structure of otemo complex with fad and nadp (form 2)
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
540
structure length
540
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 186
structure length 540
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uozA01
1XHCA 3AE3A 2F5ZA 2YLWA 1NDAA 2OA1A 3ITJA 1OJ9A 4H4XA 3NTAA 4KX6A 4U8IA 5GSNA 4EQXA 4ZCDA 2Z5XA 1QJDA 4I59A 1IUVA 5DBJA 5L46A 3VQRA 1F3PA 4H4PA 1DXLA 2ARDA 5IQ1A 2B9YA 1LJ1A 2FBWA 2YVJA 1JEHA 1O5WA 2V3BA 3NG7X 4H4QA 1VG9A 4YTNA 1PJ5A 4J56A 4PABA 1YKJA 3QSEA 1ZOYA 2JB3A 2GR1A 5FS7A 2UZZA 1MXTA 1K4QA 1GERA 4H4TA 2Z5YA 2C70A 3EAOA 1NENA 2C3CA 2ZBWA 1PXAA 3C4AA 3CN8A 1NHQA 4RSLA 3AECA 2X8GA 3WE0A 1TRBA 4H4WA 1GEUA 1O95A 1LTXR 3BNUA 4WX1A 5EB4A 4IV9A 2BS2A 3UKAA 3CPHG 4UDRA 2NPXA 4EM3A 2GAHB 1W4XA 1VQWA 4IVMB 3P1WA 5FS8A 2C75A 1NAAA 1NEKA 2YVGA 3SFEA 1H81A 3UP5A 3ALLA 1NHRA 2BCPA 3NN0X 2GMHA 1GREA 3NRNA 2CFYA 3SFDA 3KLJA 2IVEA 1GPEA 2O9ZA 2GVCA 3QFAA 1F8WA 3BI4A 2X8HA 1YQZA 3ICTA 2X3NA 1NG4A 3GYJA 2JBVA 2GR2A 2TMDA 4Z24A 1YY5A 1F6MA 2R46A 3UKHA 3BI2A 1GRBA 1ZMCA 2GRTA 2GB0A 1YQ4A 4EMIA 1DJNA 3BI5A 3NYEA 3NHOX 2E4GA 2VRMA 2Y6QA 3CGEA 3RP7A 2C65A 2BA9A 2ZZ0A 3CGBA 4CNJA 1E1NA 3GWFA 1KSSA 2YLZA 2WEUA 4OCGA 1S3BA 4Z43A 2VVLG 4JQ9A 2ZZCA 2EQ8A 4BK1A 4JY2A 4IVOB 2Q0LA 4NEWA 1OJAA 2XLTA 3NKSA 4BK2A 3UKKA 5JCIA 4K2XA 2VVLA 4TLZA 3HZLA 2PYXA 1NHPA 4CRTA 3REDA 2JKCA 2V60A 1ZOVA 3QVPA 4LU6A 1L9DA 2WPCA 3E1TA 3AE8A 5GRTA 3EF6A 1LQTA 1BZLA 4J34A 1LQUA 2BC1A 2JAEA 3DJJA 4EM4A 4NTEA 3AE6A 3KU9A 1RP0A 4J57A 2VQ7A 3KVEA 3Q9TA 1GETA 4FX9A 1Y56B 2OAMA 4CNKA 2WETA 5J60A 3GD3A 3BHKA 1PS9A 4TLXA 3VRAA 4EQWA 3ICRA 3PS9A 3KKJA 4MJWA 5BRTA 2VRLA 3AE2A 5FMHA 1BKWA 3UTGA 1P2HA 3LOVA 4J33A 2WOVA 5JCLA 3L8KA 5JCMA 4PAAA 4UDQA 2J3NA 3AE7A 4A6NB 4GRTA 1IUSA 3R9UA 3P4PA 3UTHA 1GTHA 2R45A 2YLTA 2V6OA 3AXBA 4HA6A 1DODA 4DNAA 2R0CA 2C64A 4YXDA 1ELIA 2RGHA 5IQ4A 1TDKA 2RABA 2A87A 4OPIA 5HY5A 1S2YA 1CL0A 3AE5A 2OLOA 3ZYXA 1DJQA 1EL8A 2BACA 1B4VA 1GRFA 3V3OA 1AOGA 3CGDA 2YLXA 3COXA 3H8IA 1VG0A 3AD8B 2WP5A 4OPCA 4JNQA 3LZWA 1FEBA 3UTFA 2RGJA 4O5QA 3AYJA 1RSGA 1RYIA 1PBDA 3AE4A 4AP3A 4JDRA 2VZ2A 3K7QX 2XVHA 2YG5A 4LA1A 2YQUA 3FG2P 3SGLA 2YR6A 5KXJA 2BK4A 3UKQA 2WP9A 5KVHA 3GMBA 3AD7B 3NNEA 1EBDA 1FEAA 3ABVA 3DJEA 1GRHA 4I58A 2GF3A 1L9EA 2XDOA 1BGNA 2Q7VA 3VRDB 3UOXA 2OALA 4GUVA 3G5RA 2WP6A 2WBAA 1K0IA 3AEGA 3H4KA 4Z2RA 1IUXA 4TM4A 4APNA 4RG3A 1F8SA 4B63A 2A89A 3QJ4A 3GMCA 1H7WA 4J31A 4CBQA 1EL9A 2YR4A 2BCGG 2C76A 2WQYA 3QVRA 1IUWA 2FJAA 1ONFA 5FS6A 2BXRA 3GDNA 1PN0A 4ADWA 1KNRA 5BULA 1E1LA 4H50A 1GESA 3AYLA 2Q6UA 4IA6A 2GAGB 2CVJA 1NG3A 2WDRA 3BHFA 4Y4LA 4BK3A 5C2TA 2Y6RA 1EL7A 3EPTA 4GDPA 4C5OA 3KD9A 4FK1C 1D7LA 1JRZA 2B9XA 2WOIA 1DOBA 2WDQA 2R4JA 5LV9A 1FECA 3NK0X 1XPQA 1GRAA 4FK1A 4U8MA 2YLRA 3AE9A 4A99A 3AE1A 1V59A 1VRQB 4YKFA 5FS9A 3NYFA 3P9UA 2YG3A 3DA1A 3EANA 3UKPA 2A8XA 4EQRA 4YSYA 2C67A 2ZZBA 1QLBA 4AT0A 1Q9IA 2VVMA 4O5UA 2DKIA 4Z2UA 4U2TA 1B5QA 1XANA 3CGCA 1PHHA 4WCTA 1D4CA 3VRBA 4A65A 3F8DA 4CCRA 2EQ9A 2CULA 5BVAA 3FBSA 1PBFA 4JNAA 3ZDNA 1Q1WA 2GEWA 2X8CA 4YSHA 3CPIG 4H2RA 1Y0PA 4ZCCA 2GV8A 1Z6LA 1K0LA 3DJGX 4TM0A 4CY8A 5EBKA 1OJCA 2ACZA 3DGZA 1PXCA 2XFUA 3F8RA 4JY3A 2HQMA 3OC4A 3M12A 1KF6A 4USQA 2BS3A 3GD4A 2C73A 2VQBA 4H4ZA 1E1KA 3AWIA 1UKVG 4GDEA 4BJZA 1GV4A 3PVCA 3FPZA 3RHAA 4XWRA 3CPJG 2XCGA 3S5WA 2H89A 2B76A 2I0ZA 3UP4A 2QA1A 3GYIA 5JCNA 4B68A 2GQFA 1XDIA 1B8SA 2WOWA 3NT6A 4KPRA 3OZ2A 3QSMA 5EOWA 3L1RA 4NTCA 1ZMDA 4NTDA 1CJ3A 1TDFA 3AYIA 1ZX9A 2YG4A 3CNTA 1DNCA 2GR0A 3DGHA 2B7RA 4C77A 1D4EA 4YKGA 1KSUA 1OJTA 3NH3X 1OJDA 2EQ7A 1E39A 4ZN0A 3Q6JA 2WPEA 2YVFA 3KPFA 2WU2A 2X99A 3M13A 4N9XA 1JU2A 1FCDA 2WS3A 2XLUA 4H4SA 1KDGA 1COYA 2R9ZA 3G5SA 4OVIA 3NYCA 5HHFA 4B69A 3NGCX 1H6VA 3V76A 2YG7A 4CY6A 1JRYA 1PJ6A 1NPXA 2BK5A 1LV0A 5ER0A 2BC0A 3I3LA 3GSIA 5CKUA 5U63A 4OPUA 2XFQA 2IVDA 1SEZA 1E6EA 1GT8A 3K7MX 4Z44A 4D03A 4YSZA 4JN9A 1LVLA 1TYTA 1DOEA 3AEAA 1JNZA 2W0HA 1H86A 1EL5A 3GDPA 4DSHA 2TPRA 4Z2TA 3LADA 1N1PA 2E5VA 1HYUA 2DKHA 1N4WA 3AB1A 4ICYA 3V3NA 3AD9B 3IHGA 1VDCA 5U25A 3I6DA 1N4VA 3FIMB 1GOSA 1YQ3A 3DMEA 4X4JA 2EQ6A 3IF9A 1BGJA 3LB8A 4LIIA 1JOAA 3QFBA 3UOVA 2YLSA 1MO9A 3GWDA 3AEFA 5TR3A 5M0ZA 4B64A 5C3JA 2GR3A 4HB9A 1H83A 2R4EA 3DK9A 3NTDA 4TM1A 1CF3A 2V3AA 3BNMA 2XFNA 3O0HA 1ZP0A 2XLPA 4DGKA 4YTPA 3RNMA 1FL2A 4NZHA 4H2QA 2GMJA 3DK8A 5CQFA 4BV6A 4K5RA 1O94A 3ALMA 3D1CA 4IA5A 4YWOA 1BWCA 1PBCA 2AQJA 5JCKA 2R0GA 2WDVA 3RP6A 1NHSA 3CNDA 4U2LA 3SQPA 2JK6A 3H8LA 4EMJA 4C74A 1K0JA 2NVKX 3C4NA 2X50A 3DK4A 2C3DA 2WU5A 3PO7A 3P4SA 2XFOA 3JSKA 3UKFA 5HXIA 3CNPA 1DOCA 3UOYA 2FJDA 5U1OA 2WHDA 4AOSA 3LXDA 4X9NA 4Z26A 4E0VA 4NEVA 5KRQA 4A7AA 3S61A 1JRXA 4U8LA 2Q0KA 3M0OA 1D7YA 4M52A 4OPTA 4EIQA 3K7TA 1N4UA 2APGA 1D4DA 2AAQA 2PHHA 3DJDA 2H88A 3NIXA 1IJHA 4U8KA 1LPFA 4U8OA 4AOXA 1TDEA 1S3EA 1Y56A 2JB2A 2YM2A 3GRSA 4A9WA 3P4RA 3RP8A 1CC4A 5KVIA 1IUTA 1H82A 2IIDA 2WPFA 3B3RA 4X9MA 2XVJA 2CDUA 4K8DA 4YSXA 1L0VA 1PBBA 4J2WA 5KOXA 1CJCA 3SM8A 3F8PA 4C3YA 4H2PA 1M64A 4UP3A 2JB1A 2XVFA 3URHA 1CC2A 4D04A 1PXBA 3ATRA 3ALJA 1PJ7A 3IWAA 1CJ2A 3C96A 4CCQA 1P2EA 2YM1A 4H4YA 4AP1A 2GQWA 4A6NA 4FDCB 4K5SA 1CC6A 2B7SA 4A79A 4Y4MA 2QA2A 4Z25A 1CHUA 4C3XA 4H4UA 4AT2A 4B67A 4B66A 2V5ZA 1KFYA 2BABA 3AEBA 4BJYA 4XWZA 1ZKQA 3LZXA 4RG4A 2GH5A 5HYMA 4H7UA 4U8NA 2C72A 2FJBA 1E7PA 1ZK7A 3UOZA 4DSGA 1GTEA 1TDOA 2XFPA 3GRTA 3ICSA 4YT0A 1GRTA 2V61A 1TDNA 2XLSA 5J7XA 1GNDA 3UCLA 4ECHA 3T37A 1GXFA 3AEEA 2C7GA 1IUUA 4BURA 2XVIA 2YWLA 2BXSA 4REKA 3CNSA 2XVEA 3FMWA 2BK3A 2VOUA 1L9CA 5KOWA 4UDPA 4J36A 3CTYA 1FOHA 1S2QA 1BF3A 1E1MA 4Y4NA 4H4VA 2R0PA 3LJPA 4U2SA 1QO8A 5KWFA 2BS4A 4K22A 3NN6X 3ATQA 2E1MA 4XXGA 3IHMA 3NK2X 1PBEA 1M6IA 3VR9A 3D8XA 3II4A 1Q1RA 4OPGA 4U8JA 3QSSA 3ADAB 1B37A 3AEDA 3KA7A 1X31B 2XLRA 3UTEA 1REOA 4EQSA 3CNJA 1GALA 4USRA 4YTMA 4U8PA 3VR8A 1ZDLA 3IC9A 2OLNA 4OPDA 4K7ZA 4A5LA 1GRGA 1ZY8A 2FJEA 3CIRA 4H2NA 5EB5A 1H84A 1JNRA 2WESA 1H7XA 3G5QA 2B9WA 2QAEA 2XYOA 3ISHA 3P4QA 5M10A 4EMWA 3K30A 1D5TA 2RGOA 1CJ4A 3NK1X 4EIPA 2YR5A 2BYBA 1TYPA 1KNPA 4GF7A 2YG6A 3B6DA 3DH9A 1PDHA 2QCUA 1MOKA 1CBOA 4OPLA 3UKLA 4B65A 4P9SA 2YAUA 2AR8A 3NLCA 4GR1A 2C66A 4TM3A 4B1BA 1F8RA 5BUKA 4H4RA 5IPYA 4GCMA 1GSNA
chains in the Genus database with same CATH superfamily
1XHCA 3AE3A 2F5ZA 2YLWA 1NDAA 2OA1A 3ITJA 1OJ9A 4H4XA 3NTAA 4KX6A 4U8IA 5GSNA 4G6GA 4EQXA 4ZCDA 2Z5XA 1QJDA 4I59A 1IUVA 5DBJA 5L46A 3VQRA 1F3PA 4H4PA 1DXLA 2ARDA 5IQ1A 2B9YA 1LJ1A 2FBWA 2YVJA 1JEHA 1O5WA 2V3BA 3NG7X 4H4QA 1VG9A 4NNJA 4YTNA 1PJ5A 4J56A 4PABA 1YKJA 3QSEA 1ZOYA 2JB3A 2GR1A 5FS7A 3SYIA 3SZFA 2UZZA 1MXTA 1K4QA 1GERA 4H4TA 2Z5YA 2C70A 3EAOA 1NENA 2C3CA 2ZBWA 1PXAA 3C4AA 3CN8A 1NHQA 4RSLA 3AECA 2X8GA 3WE0A 1TRBA 4H4WA 1GEUA 1O95A 1LTXR 3BNUA 4WX1A 5EB4A 4IV9A 2BS2A 3UKAA 3CPHG 4UDRA 2NPXA 4EM3A 2GAHB 1W4XA 3SZ0A 1VQWA 4IVMB 3T0KA 3P1WA 5FS8A 2C75A 1NAAA 1NEKA 2YVGA 3SFEA 1H81A 3SY4A 3ALLA 3UP5A 1NHRA 2BCPA 3NN0X 2GMHA 1GREA 3NRNA 2CFYA 3SFDA 3KLJA 4G73A 2IVEA 1GPEA 2O9ZA 2GVCA 3QFAA 2BRAA 1F8WA 3BI4A 2X8HA 1YQZA 3ICTA 2X3NA 1NG4A 3GYJA 2JBVA 2GR2A 2TMDA 4Z24A 1YY5A 1F6MA 2R46A 3UKHA 4II2A 3BI2A 1GRBA 1ZMCA 2GRTA 2GB0A 1YQ4A 4EMIA 1DJNA 3BI5A 3NYEA 3NHOX 2E4GA 2VRMA 2Y6QA 3CGEA 3RP7A 2C65A 2BA9A 2ZZ0A 3CGBA 4CNJA 1E1NA 3GWFA 1KSSA 2YLZA 2WEUA 4OCGA 1S3BA 4Z43A 2VVLG 4JQ9A 2ZZCA 2EQ8A 4BK1A 4JY2A 4IVOB 2Q0LA 4NEWA 1OJAA 2XLTA 3NKSA 4BK2A 3UKKA 5JCIA 4K2XA 2VVLA 4TLZA 3HZLA 2PYXA 1NHPA 4CRTA 3REDA 5KMPA 2JKCA 2V60A 1ZOVA 3QVPA 4LU6A 1L9DA 2WPCA 3E1TA 3T2KA 3AE8A 5GRTA 3EF6A 1LQTA 1BZLA 4J34A 1LQUA 2BC1A 2JAEA 3DJJA 4EM4A 4NTEA 3AE6A 3KU9A 1RP0A 4J57A 2VQ7A 3KVEA 3Q9TA 1GETA 4FX9A 5KMSA 1Y56B 2OAMA 4CNKA 2WETA 5J60A 3GD3A 3BHKA 1PS9A 4TLXA 3VRAA 4EQWA 3ICRA 3PS9A 3KKJA 4MJWA 5BRTA 2VRLA 3AE2A 5FMHA 1BKWA 3UTGA 1P2HA 3LOVA 4J33A 2WOVA 5JCLA 3L8KA 5JCMA 4PAAA 4UDQA 3T2YA 2J3NA 3AE7A 4A6NB 4GRTA 1IUSA 3R9UA 3P4PA 3UTHA 1GTHA 2R45A 2YLTA 2V6OA 3AXBA 4HA6A 1DODA 4DNAA 2R0CA 2C64A 4YXDA 1ELIA 2RGHA 5IQ4A 3SXIA 1TDKA 2RABA 3T2ZA 2A87A 4OPIA 5HY5A 3SZWA 1S2YA 1CL0A 3AE5A 2OLOA 3ZYXA 1DJQA 1EL8A 2BACA 5KMQA 1B4VA 1GRFA 3V3OA 1AOGA 3CGDA 2YLXA 3COXA 3H8IA 1VG0A 3AD8B 2WP5A 4OPCA 4JNQA 3LZWA 1FEBA 3UTFA 2RGJA 4O5QA 3AYJA 1RSGA 1RYIA 1PBDA 3AE4A 4AP3A 4JDRA 2VZ2A 3K7QX 2XVHA 2YG5A 4LA1A 2YQUA 3FG2P 3SGLA 2YR6A 5KXJA 2BK4A 3UKQA 2WP9A 5KVHA 3GMBA 3AD7B 3NNEA 1EBDA 1FEAA 3ABVA 3DJEA 1GRHA 4I58A 2GF3A 1L9EA 2XDOA 1BGNA 2Q7VA 3VRDB 3UOXA 2OALA 4GUVA 3G5RA 2WP6A 2WBAA 1K0IA 3AEGA 3H4KA 4Z2RA 1IUXA 4TM4A 3KPKA 4RG3A 4APNA 1F8SA 4B63A 2A89A 3QJ4A 3GMCA 1H7WA 4J31A 4CBQA 1EL9A 2YR4A 2BCGG 2C76A 2WQYA 3QVRA 1IUWA 2FJAA 1ONFA 5FS6A 2BXRA 3GDNA 3GYXA 1PN0A 4ADWA 1KNRA 5BULA 1E1LA 4H50A 1GESA 3AYLA 3SZCA 2Q6UA 4IA6A 2GAGB 2CVJA 1NG3A 2WDRA 3BHFA 4Y4LA 4BK3A 5C2TA 2Y6RA 1EL7A 3EPTA 4GDPA 4C5OA 3KD9A 4FK1C 1D7LA 1JRZA 2B9XA 2WOIA 1DOBA 4GAPA 2WDQA 2R4JA 5LV9A 3HYVA 1FECA 3NK0X 1XPQA 1GRAA 4FK1A 4U8MA 2YLRA 3AE9A 4A99A 3AE1A 1V59A 1VRQB 4YKFA 5FS9A 3NYFA 3P9UA 2YG3A 3DA1A 3EANA 3UKPA 2A8XA 4EQRA 4YSYA 2C67A 2ZZBA 1QLBA 4AT0A 1Q9IA 2VVMA 4O5UA 2DKIA 4Z2UA 4U2TA 1B5QA 1XANA 3CGCA 1PHHA 4WCTA 1D4CA 3VRBA 4A65A 3F8DA 4CCRA 2EQ9A 2CULA 5BVAA 3FBSA 1PBFA 4JNAA 3ZDNA 1Q1WA 2GEWA 2X8CA 4YSHA 3CPIG 4H2RA 1Y0PA 4ZCCA 2GV8A 4G74A 1Z6LA 1K0LA 3DJGX 4TM0A 4II3A 4CY8A 5EBKA 3SX6A 1OJCA 2ACZA 3DGZA 1PXCA 2XFUA 3F8RA 4JY3A 2HQMA 3OC4A 3M12A 1KF6A 4USQA 2BS3A 3GD4A 2C73A 2VQBA 4H4ZA 1E1KA 3AWIA 3T14A 1UKVG 4GDEA 4BJZA 1GV4A 3PVCA 3FPZA 3RHAA 4XWRA 3CPJG 2XCGA 3S5WA 2H89A 2B76A 2I0ZA 3UP4A 2QA1A 3GYIA 5JCNA 4B68A 2GQFA 1XDIA 1B8SA 2WOWA 3NT6A 4KPRA 3OZ2A 3QSMA 5EOWA 3L1RA 4NTCA 1ZMDA 4NTDA 1CJ3A 1TDFA 3AYIA 1ZX9A 2YG4A 3CNTA 1DNCA 2GR0A 3DGHA 2B7RA 4C77A 1D4EA 4YKGA 1KSUA 1OJTA 3NH3X 1OJDA 2EQ7A 1E39A 4ZN0A 3Q6JA 2WPEA 2YVFA 3KPFA 2WU2A 2X99A 3M13A 4N9XA 1JU2A 1FCDA 2WS3A 2XLUA 4H4SA 1KDGA 1COYA 2R9ZA 3G5SA 4OVIA 3NYCA 5HHFA 4B69A 3NGCX 1H6VA 3V76A 2YG7A 4CY6A 1JRYA 1PJ6A 1NPXA 2BK5A 1LV0A 5ER0A 2BC0A 3I3LA 3GSIA 5CKUA 5U63A 4OPUA 2XFQA 2IVDA 1SEZA 1E6EA 1GT8A 3K7MX 4Z44A 4D03A 4YSZA 4JN9A 1LVLA 1TYTA 1DOEA 3AEAA 1JNZA 2W0HA 1H86A 1EL5A 3GDPA 4DSHA 2TPRA 4Z2TA 3LADA 1N1PA 2E5VA 1HYUA 2DKHA 1N4WA 3AB1A 4ICYA 3V3NA 3AD9B 3IHGA 1VDCA 5U25A 3I6DA 1N4VA 3FIMB 1GOSA 1YQ3A 3DMEA 4X4JA 2EQ6A 3IF9A 1BGJA 3LB8A 4LIIA 1JOAA 3QFBA 3UOVA 2YLSA 1MO9A 3GWDA 3AEFA 5TR3A 5M0ZA 4B64A 5C3JA 2GR3A 4HB9A 1H83A 2R4EA 3DK9A 3NTDA 4TM1A 1CF3A 2V3AA 3BNMA 2XFNA 3O0HA 1ZP0A 2XLPA 4DGKA 4YTPA 3RNMA 1FL2A 4NZHA 4H2QA 3HYXA 2GMJA 3DK8A 5CQFA 4BV6A 4K5RA 1O94A 3ALMA 3D1CA 4IA5A 4YWOA 1BWCA 1PBCA 2AQJA 5JCKA 2R0GA 2WDVA 3RP6A 1NHSA 3CNDA 4U2LA 3SQPA 2JK6A 3H8LA 4EMJA 4C74A 1K0JA 3T31A 2NVKX 3C4NA 2X50A 3DK4A 2C3DA 2WU5A 3PO7A 3P4SA 2XFOA 3JSKA 4NWZA 3UKFA 5HXIA 3CNPA 1DOCA 3UOYA 2FJDA 2C4CA 5U1OA 2WHDA 4AOSA 3LXDA 4X9NA 4Z26A 4E0VA 4NEVA 5KRQA 4A7AA 3S61A 4G6HA 1JRXA 4U8LA 2BRYA 2Q0KA 3M0OA 1D7YA 4M52A 4OPTA 4EIQA 3K7TA 1N4UA 2APGA 1D4DA 2AAQA 2PHHA 3DJDA 2H88A 3NIXA 1IJHA 4U8KA 1LPFA 4U8OA 4AOXA 1TDEA 1S3EA 1Y56A 2JB2A 2YM2A 3GRSA 4A9WA 3P4RA 3RP8A 1CC4A 5KVIA 1IUTA 1H82A 2IIDA 2WPFA 3B3RA 4X9MA 2XVJA 2CDUA 4K8DA 4YSXA 1L0VA 1PBBA 4J2WA 5KOXA 1CJCA 5KNLA 3SM8A 3F8PA 4C3YA 4H2PA 1M64A 4UP3A 2JB1A 2XVFA 3URHA 1CC2A 4D04A 1PXBA 3ATRA 3ALJA 1PJ7A 3IWAA 1CJ2A 3C96A 4CCQA 1P2EA 2YM1A 4H4YA 4AP1A 2GQWA 4A6NA 4FDCB 4K5SA 1CC6A 2B7SA 4A79A 4Y4MA 2QA2A 4Z25A 1CHUA 4C3XA 4H4UA 4AT2A 4B67A 4B66A 2V5ZA 1KFYA 2BABA 3AEBA 4BJYA 4XWZA 1ZKQA 3LZXA 4RG4A 2GH5A 5HYMA 4H7UA 4U8NA 2C72A 2FJBA 1E7PA 3CMMA 1ZK7A 3UOZA 4DSGA 1GTEA 1TDOA 2XFPA 3GRTA 3ICSA 4YT0A 1GRTA 4G9KA 2V61A 1TDNA 2XLSA 5J7XA 1GNDA 3UCLA 4ECHA 3T37A 1GXFA 3AEEA 2C7GA 1IUUA 4BURA 2XVIA 2YWLA 2BXSA 4REKA 3CNSA 2XVEA 3FMWA 2BK3A 2VOUA 1L9CA 5KOWA 4UDPA 4J36A 3CTYA 3HYWA 1FOHA 1S2QA 1BF3A 1E1MA 4Y4NA 4H4VA 2R0PA 3LJPA 4U2SA 1QO8A 5KWFA 2BS4A 4K22A 3NN6X 3ATQA 2E1MA 4XXGA 3IHMA 4GAVA 3NK2X 1PBEA 1M6IA 3VR9A 3D8XA 3II4A 1Q1RA 4OPGA 4U8JA 3QSSA 3ADAB 1B37A 3AEDA 3KA7A 1X31B 2XLRA 3UTEA 1REOA 4EQSA 3CNJA 1GALA 4USRA 4YTMA 4U8PA 3VR8A 1ZDLA 3IC9A 2OLNA 4OPDA 4K7ZA 4A5LA 1GRGA 1ZY8A 2FJEA 3CIRA 4H2NA 5EB5A 1H84A 1JNRA 2WESA 1H7XA 3G5QA 2B9WA 2QAEA 2XYOA 3ISHA 3P4QA 5M10A 4EMWA 3K30A 1D5TA 2RGOA 1CJ4A 3NK1X 4EIPA 2YR5A 2BYBA 1TYPA 1KNPA 4GF7A 2YG6A 3B6DA 3DH9A 1PDHA 2QCUA 1MOKA 1CBOA 4OPLA 3UKLA 4B65A 4P9SA 2YAUA 2AR8A 3NLCA 4GR1A 2C66A 4TM3A 4B1BA 1F8RA 5BUKA 4H4RA 5IPYA 4GCMA 1GSNA 5KMRA
chains in the Genus database with same CATH topology
1XHCA 3AE3A 2F5ZA 2YLWA 1NDAA 2OA1A 3ITJA 1OJ9A 4H4XA 3NTAA 4KX6A 4U8IA 5GSNA 4G6GA 4EQXA 4ZCDA 2Z5XA 1QJDA 4I59A 1IUVA 5DBJA 5L46A 3VQRA 1F3PA 4H4PA 1DXLA 2ARDA 5IQ1A 2B9YA 1LJ1A 2FBWA 2YVJA 1JEHA 1O5WA 2V3BA 3NG7X 4H4QA 1VG9A 4NNJA 4YTNA 1PJ5A 4J56A 4PABA 1YKJA 3QSEA 1ZOYA 2JB3A 2GR1A 5FS7A 3SYIA 3SZFA 2UZZA 1MXTA 1K4QA 1GERA 4H4TA 2Z5YA 2C70A 3EAOA 1NENA 2C3CA 2ZBWA 1PXAA 3C4AA 3CN8A 1NHQA 4RSLA 3AECA 2X8GA 3WE0A 1TRBA 4H4WA 1GEUA 1O95A 1LTXR 3BNUA 4WX1A 5EB4A 4IV9A 2BS2A 3UKAA 3CPHG 4UDRA 2NPXA 4EM3A 2GAHB 1W4XA 3SZ0A 1VQWA 4IVMB 3T0KA 3P1WA 5FS8A 2C75A 1NAAA 1NEKA 2YVGA 3SFEA 1H81A 3SY4A 3ALLA 3UP5A 1NHRA 2BCPA 3NN0X 2GMHA 1GREA 3NRNA 2CFYA 3SFDA 3KLJA 4G73A 2IVEA 1GPEA 2O9ZA 2GVCA 3QFAA 2BRAA 1F8WA 3BI4A 2X8HA 1YQZA 3ICTA 2X3NA 1NG4A 3GYJA 2JBVA 2GR2A 2TMDA 4Z24A 1YY5A 1F6MA 2R46A 3UKHA 4II2A 3BI2A 1GRBA 1ZMCA 2GRTA 2GB0A 1YQ4A 4EMIA 1DJNA 3BI5A 3NYEA 3NHOX 2E4GA 2VRMA 2Y6QA 3CGEA 3RP7A 2C65A 2BA9A 2ZZ0A 3CGBA 4CNJA 1E1NA 3GWFA 1KSSA 2YLZA 2WEUA 4OCGA 1S3BA 4Z43A 2VVLG 4JQ9A 2ZZCA 2EQ8A 4BK1A 4JY2A 4IVOB 2Q0LA 4NEWA 1OJAA 2XLTA 3NKSA 4BK2A 3UKKA 5JCIA 4K2XA 2VVLA 4TLZA 3HZLA 2PYXA 1NHPA 4CRTA 3REDA 5KMPA 2JKCA 2V60A 1ZOVA 3QVPA 4LU6A 1L9DA 2WPCA 3E1TA 3T2KA 3AE8A 5GRTA 3EF6A 1LQTA 1BZLA 4J34A 1LQUA 2BC1A 2JAEA 3DJJA 4EM4A 4NTEA 3AE6A 3KU9A 1RP0A 4J57A 2VQ7A 3KVEA 3Q9TA 1GETA 4FX9A 5KMSA 1Y56B 2OAMA 4CNKA 2WETA 5J60A 3GD3A 3BHKA 1PS9A 4TLXA 3VRAA 4EQWA 3ICRA 3PS9A 3KKJA 4MJWA 5BRTA 2VRLA 3AE2A 5FMHA 1BKWA 3UTGA 1P2HA 3LOVA 4J33A 2WOVA 5JCLA 3L8KA 5JCMA 4PAAA 4UDQA 3T2YA 2J3NA 3AE7A 4A6NB 4GRTA 1IUSA 3R9UA 3P4PA 3UTHA 1GTHA 2R45A 2YLTA 2V6OA 3AXBA 4HA6A 1DODA 4DNAA 2R0CA 2C64A 4YXDA 1ELIA 2RGHA 5IQ4A 3SXIA 1TDKA 2RABA 3T2ZA 2A87A 4OPIA 5HY5A 3SZWA 1S2YA 1CL0A 3AE5A 2OLOA 3ZYXA 1DJQA 1EL8A 2BACA 5KMQA 1B4VA 1GRFA 3V3OA 1AOGA 3CGDA 2YLXA 3COXA 3H8IA 1VG0A 3AD8B 2WP5A 4OPCA 4JNQA 3LZWA 1FEBA 3UTFA 2RGJA 4O5QA 3AYJA 1RSGA 1RYIA 1PBDA 3AE4A 4AP3A 4JDRA 2VZ2A 3K7QX 2XVHA 2YG5A 4LA1A 2YQUA 3FG2P 3SGLA 2YR6A 5KXJA 2BK4A 3UKQA 2WP9A 5KVHA 3GMBA 3AD7B 3NNEA 1EBDA 1FEAA 3ABVA 3DJEA 1GRHA 4I58A 2GF3A 1L9EA 2XDOA 1BGNA 2Q7VA 3VRDB 3UOXA 2OALA 4GUVA 3G5RA 2WP6A 2WBAA 1K0IA 3AEGA 3H4KA 4Z2RA 1IUXA 4TM4A 3KPKA 4RG3A 4APNA 1F8SA 4B63A 2A89A 3QJ4A 3GMCA 1H7WA 4J31A 4CBQA 1EL9A 2YR4A 2BCGG 2C76A 2WQYA 3QVRA 1IUWA 2FJAA 1ONFA 5FS6A 2BXRA 3GDNA 3GYXA 1PN0A 4ADWA 1KNRA 5BULA 1E1LA 4H50A 1GESA 3AYLA 3SZCA 2Q6UA 4IA6A 2GAGB 2CVJA 1NG3A 2WDRA 3BHFA 4Y4LA 4BK3A 5C2TA 2Y6RA 1EL7A 3EPTA 4GDPA 4C5OA 3KD9A 4FK1C 1D7LA 1JRZA 2B9XA 2WOIA 1DOBA 4GAPA 2WDQA 2R4JA 5LV9A 3HYVA 1FECA 3NK0X 1XPQA 1GRAA 4FK1A 4U8MA 2YLRA 3AE9A 4A99A 3AE1A 1V59A 1VRQB 4YKFA 5FS9A 3NYFA 3P9UA 2YG3A 3DA1A 3EANA 3UKPA 2A8XA 4EQRA 4YSYA 2C67A 2ZZBA 1QLBA 4AT0A 1Q9IA 2VVMA 4O5UA 2DKIA 4Z2UA 4U2TA 1B5QA 1XANA 3CGCA 1PHHA 4WCTA 1D4CA 3VRBA 4A65A 3F8DA 4CCRA 2EQ9A 2CULA 5BVAA 3FBSA 1PBFA 4JNAA 3ZDNA 1Q1WA 2GEWA 2X8CA 4YSHA 3CPIG 4H2RA 1Y0PA 4ZCCA 2GV8A 4G74A 1Z6LA 1K0LA 3DJGX 4TM0A 4II3A 4CY8A 5EBKA 3SX6A 1OJCA 2ACZA 3DGZA 1PXCA 2XFUA 3F8RA 4JY3A 2HQMA 3OC4A 3M12A 1KF6A 4USQA 2BS3A 3GD4A 2C73A 2VQBA 4H4ZA 1E1KA 3AWIA 3T14A 1UKVG 4GDEA 4BJZA 1GV4A 3PVCA 3FPZA 3RHAA 4XWRA 3CPJG 2XCGA 3S5WA 2H89A 2B76A 2I0ZA 3UP4A 2QA1A 3GYIA 5JCNA 4B68A 2GQFA 1XDIA 1B8SA 2WOWA 3NT6A 4KPRA 3OZ2A 3QSMA 5EOWA 3L1RA 4NTCA 1ZMDA 4NTDA 1CJ3A 1TDFA 3AYIA 1ZX9A 2YG4A 3CNTA 1DNCA 2GR0A 3DGHA 2B7RA 4C77A 1D4EA 4YKGA 1KSUA 1OJTA 3NH3X 1OJDA 2EQ7A 1E39A 4ZN0A 3Q6JA 2WPEA 2YVFA 3KPFA 2WU2A 2X99A 3M13A 4N9XA 1JU2A 1FCDA 2WS3A 2XLUA 4H4SA 1KDGA 1COYA 2R9ZA 3G5SA 4OVIA 3NYCA 5HHFA 4B69A 3NGCX 1H6VA 3V76A 2YG7A 4CY6A 1JRYA 1PJ6A 1NPXA 2BK5A 1LV0A 5ER0A 2BC0A 3I3LA 3GSIA 5CKUA 5U63A 4OPUA 2XFQA 2IVDA 1SEZA 1E6EA 1GT8A 3K7MX 4Z44A 4D03A 4YSZA 4JN9A 1LVLA 1TYTA 1DOEA 3AEAA 1JNZA 2W0HA 1H86A 1EL5A 3GDPA 4DSHA 2TPRA 4Z2TA 3LADA 1N1PA 2E5VA 1HYUA 2DKHA 1N4WA 3AB1A 4ICYA 3V3NA 3AD9B 3IHGA 1VDCA 5U25A 3I6DA 1N4VA 3FIMB 1GOSA 1YQ3A 3DMEA 4X4JA 2EQ6A 3IF9A 1BGJA 3LB8A 4LIIA 1JOAA 3QFBA 3UOVA 2YLSA 1MO9A 3GWDA 3AEFA 5TR3A 5M0ZA 4B64A 5C3JA 2GR3A 4HB9A 1H83A 2R4EA 3DK9A 3NTDA 4TM1A 1CF3A 2V3AA 3BNMA 2XFNA 3O0HA 1ZP0A 2XLPA 4DGKA 4YTPA 3RNMA 1FL2A 4NZHA 4H2QA 3HYXA 2GMJA 3DK8A 5CQFA 4BV6A 4K5RA 1O94A 3ALMA 3D1CA 4IA5A 4YWOA 1BWCA 1PBCA 2AQJA 5JCKA 2R0GA 2WDVA 3RP6A 1NHSA 3CNDA 4U2LA 3SQPA 2JK6A 3H8LA 4EMJA 4C74A 1K0JA 3T31A 2NVKX 3C4NA 2X50A 3DK4A 2C3DA 2WU5A 3PO7A 3P4SA 2XFOA 3JSKA 4NWZA 3UKFA 5HXIA 3CNPA 1DOCA 3UOYA 2FJDA 2C4CA 5U1OA 2WHDA 4AOSA 3LXDA 4X9NA 4Z26A 4E0VA 4NEVA 5KRQA 4A7AA 3S61A 4G6HA 1JRXA 4U8LA 2BRYA 2Q0KA 3M0OA 1D7YA 4M52A 4OPTA 4EIQA 3K7TA 1N4UA 2APGA 1D4DA 2AAQA 2PHHA 3DJDA 2H88A 3NIXA 1IJHA 4U8KA 1LPFA 4U8OA 4AOXA 1TDEA 1S3EA 1Y56A 2JB2A 2YM2A 3GRSA 4A9WA 3P4RA 3RP8A 1CC4A 5KVIA 1IUTA 1H82A 2IIDA 2WPFA 3B3RA 4X9MA 2XVJA 2CDUA 4K8DA 4YSXA 1L0VA 1PBBA 4J2WA 5KOXA 1CJCA 5KNLA 3SM8A 3F8PA 4C3YA 4H2PA 1M64A 4UP3A 2JB1A 2XVFA 3URHA 1CC2A 4D04A 1PXBA 3ATRA 3ALJA 1PJ7A 3IWAA 1CJ2A 3C96A 4CCQA 1P2EA 2YM1A 4H4YA 4AP1A 2GQWA 4A6NA 4FDCB 4K5SA 1CC6A 2B7SA 4A79A 4Y4MA 2QA2A 4Z25A 1CHUA 4C3XA 4H4UA 4AT2A 4B67A 4B66A 2V5ZA 1KFYA 2BABA 3AEBA 4BJYA 4XWZA 1ZKQA 3LZXA 4RG4A 2GH5A 5HYMA 4H7UA 4U8NA 2C72A 2FJBA 1E7PA 3CMMA 1ZK7A 3UOZA 4DSGA 1GTEA 1TDOA 2XFPA 3GRTA 3ICSA 4YT0A 1GRTA 4G9KA 2V61A 1TDNA 2XLSA 5J7XA 1GNDA 3UCLA 4ECHA 3T37A 1GXFA 3AEEA 2C7GA 1IUUA 4BURA 2XVIA 2YWLA 2BXSA 4REKA 3CNSA 2XVEA 3FMWA 2BK3A 2VOUA 1L9CA 5KOWA 4UDPA 4J36A 3CTYA 3HYWA 1FOHA 1S2QA 1BF3A 1E1MA 4Y4NA 4H4VA 2R0PA 3LJPA 4U2SA 1QO8A 5KWFA 2BS4A 4K22A 3NN6X 3ATQA 2E1MA 4XXGA 3IHMA 4GAVA 3NK2X 1PBEA 1M6IA 3VR9A 3D8XA 3II4A 1Q1RA 4OPGA 4U8JA 3QSSA 3ADAB 1B37A 3AEDA 3KA7A 1X31B 2XLRA 3UTEA 1REOA 4EQSA 3CNJA 1GALA 4USRA 4YTMA 4U8PA 3VR8A 1ZDLA 3IC9A 2OLNA 4OPDA 4K7ZA 4A5LA 1GRGA 1ZY8A 2FJEA 3CIRA 4H2NA 5EB5A 1H84A 1JNRA 2WESA 1H7XA 3G5QA 2B9WA 2QAEA 2XYOA 3ISHA 3P4QA 5M10A 4EMWA 3K30A 1D5TA 2RGOA 1CJ4A 3NK1X 4EIPA 2YR5A 2BYBA 1TYPA 1KNPA 4GF7A 2YG6A 3B6DA 3DH9A 1PDHA 2QCUA 1MOKA 1CBOA 4OPLA 3UKLA 4B65A 4P9SA 2YAUA 2AR8A 3NLCA 4GR1A 2C66A 4TM3A 4B1BA 1F8RA 5BUKA 4H4RA 5IPYA 4GCMA 1GSNA 5KMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHC A;  3AE3 A;  2F5Z A;  2YLW A;  1NDA A;  2OA1 A;  3ITJ A;  1OJ9 A;  4H4X A;  3NTA A;  4KX6 A;  4U8I A;  5GSN A;  4EQX A;  4ZCD A;  2Z5X A;  1QJD A;  4I59 A;  1IUV A;  5DBJ A;  5L46 A;  3VQR A;  1F3P A;  4H4P A;  1DXL A;  2ARD A;  5IQ1 A;  2B9Y A;  1LJ1 A;  2FBW A;  2YVJ A;  1JEH A;  1O5W A;  2V3B A;  3NG7 X;  4H4Q A;  1VG9 A;  4YTN A;  1PJ5 A;  4J56 A;  4PAB A;  1YKJ A;  3QSE A;  1ZOY A;  2JB3 A;  2GR1 A;  5FS7 A;  2UZZ A;  1MXT A;  1K4Q A;  1GER A;  4H4T A;  2Z5Y A;  2C70 A;  3EAO A;  1NEN A;  2C3C A;  2ZBW A;  1PXA A;  3C4A A;  3CN8 A;  1NHQ A;  4RSL A;  3AEC A;  2X8G A;  3WE0 A;  1TRB A;  4H4W A;  1GEU A;  1O95 A;  1LTX R;  3BNU A;  4WX1 A;  5EB4 A;  4IV9 A;  2BS2 A;  3UKA A;  3CPH G;  4UDR A;  2NPX A;  4EM3 A;  2GAH B;  1W4X A;  1VQW A;  4IVM B;  3P1W A;  5FS8 A;  2C75 A;  1NAA A;  1NEK A;  2YVG A;  3SFE A;  1H81 A;  3UP5 A;  3ALL A;  1NHR A;  2BCP A;  3NN0 X;  2GMH A;  1GRE A;  3NRN A;  2CFY A;  3SFD A;  3KLJ A;  2IVE A;  1GPE A;  2O9Z A;  2GVC A;  3QFA A;  1F8W A;  3BI4 A;  2X8H A;  1YQZ A;  3ICT A;  2X3N A;  1NG4 A;  3GYJ A;  2JBV A;  2GR2 A;  2TMD A;  4Z24 A;  1YY5 A;  1F6M A;  2R46 A;  3UKH A;  3BI2 A;  1GRB A;  1ZMC A;  2GRT A;  2GB0 A;  1YQ4 A;  4EMI A;  1DJN A;  3BI5 A;  3NYE A;  3NHO X;  2E4G A;  2VRM A;  2Y6Q A;  3CGE A;  3RP7 A;  2C65 A;  2BA9 A;  2ZZ0 A;  3CGB A;  4CNJ A;  1E1N A;  3GWF A;  1KSS A;  2YLZ A;  2WEU A;  4OCG A;  1S3B A;  4Z43 A;  2VVL G;  4JQ9 A;  2ZZC A;  2EQ8 A;  4BK1 A;  4JY2 A;  4IVO B;  2Q0L A;  4NEW A;  1OJA A;  2XLT A;  3NKS A;  4BK2 A;  3UKK A;  5JCI A;  4K2X A;  2VVL A;  4TLZ A;  3HZL A;  2PYX A;  1NHP A;  4CRT A;  3RED A;  2JKC A;  2V60 A;  1ZOV A;  3QVP A;  4LU6 A;  1L9D A;  2WPC A;  3E1T A;  3AE8 A;  5GRT A;  3EF6 A;  1LQT A;  1BZL A;  4J34 A;  1LQU A;  2BC1 A;  2JAE A;  3DJJ A;  4EM4 A;  4NTE A;  3AE6 A;  3KU9 A;  1RP0 A;  4J57 A;  2VQ7 A;  3KVE A;  3Q9T A;  1GET A;  4FX9 A;  1Y56 B;  2OAM A;  4CNK A;  2WET A;  5J60 A;  3GD3 A;  3BHK A;  1PS9 A;  4TLX A;  3VRA A;  4EQW A;  3ICR A;  3PS9 A;  3KKJ A;  4MJW A;  5BRT A;  2VRL A;  3AE2 A;  5FMH A;  1BKW A;  3UTG A;  1P2H A;  3LOV A;  4J33 A;  2WOV A;  5JCL A;  3L8K A;  5JCM A;  4PAA A;  4UDQ A;  2J3N A;  3AE7 A;  4A6N B;  4GRT A;  1IUS A;  3R9U A;  3P4P A;  3UTH A;  1GTH A;  2R45 A;  2YLT A;  2V6O A;  3AXB A;  4HA6 A;  1DOD A;  4DNA A;  2R0C A;  2C64 A;  4YXD A;  1ELI A;  2RGH A;  5IQ4 A;  1TDK A;  2RAB A;  2A87 A;  4OPI A;  5HY5 A;  1S2Y A;  1CL0 A;  3AE5 A;  2OLO A;  3ZYX A;  1DJQ A;  1EL8 A;  2BAC A;  1B4V A;  1GRF A;  3V3O A;  1AOG A;  3CGD A;  2YLX A;  3COX A;  3H8I A;  1VG0 A;  3AD8 B;  2WP5 A;  4OPC A;  4JNQ A;  3LZW A;  1FEB A;  3UTF A;  2RGJ A;  4O5Q A;  3AYJ A;  1RSG A;  1RYI A;  1PBD A;  3AE4 A;  4AP3 A;  4JDR A;  2VZ2 A;  3K7Q X;  2XVH A;  2YG5 A;  4LA1 A;  2YQU A;  3FG2 P;  3SGL A;  2YR6 A;  5KXJ A;  2BK4 A;  3UKQ A;  2WP9 A;  5KVH A;  3GMB A;  3AD7 B;  3NNE A;  1EBD A;  1FEA A;  3ABV A;  3DJE A;  1GRH A;  4I58 A;  2GF3 A;  1L9E A;  2XDO A;  1BGN A;  2Q7V A;  3VRD B;  3UOX A;  2OAL A;  4GUV A;  3G5R A;  2WP6 A;  2WBA A;  1K0I A;  3AEG A;  3H4K A;  4Z2R A;  1IUX A;  4TM4 A;  4APN A;  4RG3 A;  1F8S A;  4B63 A;  2A89 A;  3QJ4 A;  3GMC A;  1H7W A;  4J31 A;  4CBQ A;  1EL9 A;  2YR4 A;  2BCG G;  2C76 A;  2WQY A;  3QVR A;  1IUW A;  2FJA A;  1ONF A;  5FS6 A;  2BXR A;  3GDN A;  1PN0 A;  4ADW A;  1KNR A;  5BUL A;  1E1L A;  4H50 A;  1GES A;  3AYL A;  2Q6U A;  4IA6 A;  2GAG B;  2CVJ A;  1NG3 A;  2WDR A;  3BHF A;  4Y4L A;  4BK3 A;  5C2T A;  2Y6R A;  1EL7 A;  3EPT A;  4GDP A;  4C5O A;  3KD9 A;  4FK1 C;  1D7L A;  1JRZ A;  2B9X A;  2WOI A;  1DOB A;  2WDQ A;  2R4J A;  5LV9 A;  1FEC A;  3NK0 X;  1XPQ A;  1GRA A;  4FK1 A;  4U8M A;  2YLR A;  3AE9 A;  4A99 A;  3AE1 A;  1V59 A;  1VRQ B;  4YKF A;  5FS9 A;  3NYF A;  3P9U A;  2YG3 A;  3DA1 A;  3EAN A;  3UKP A;  2A8X A;  4EQR A;  4YSY A;  2C67 A;  2ZZB A;  1QLB A;  4AT0 A;  1Q9I A;  2VVM A;  4O5U A;  2DKI A;  4Z2U A;  4U2T A;  1B5Q A;  1XAN A;  3CGC A;  1PHH A;  4WCT A;  1D4C A;  3VRB A;  4A65 A;  3F8D A;  4CCR A;  2EQ9 A;  2CUL A;  5BVA A;  3FBS A;  1PBF A;  4JNA A;  3ZDN A;  1Q1W A;  2GEW A;  2X8C A;  4YSH A;  3CPI G;  4H2R A;  1Y0P A;  4ZCC A;  2GV8 A;  1Z6L A;  1K0L A;  3DJG X;  4TM0 A;  4CY8 A;  5EBK A;  1OJC A;  2ACZ A;  3DGZ A;  1PXC A;  2XFU A;  3F8R A;  4JY3 A;  2HQM A;  3OC4 A;  3M12 A;  1KF6 A;  4USQ A;  2BS3 A;  3GD4 A;  2C73 A;  2VQB A;  4H4Z A;  1E1K A;  3AWI A;  1UKV G;  4GDE A;  4BJZ A;  1GV4 A;  3PVC A;  3FPZ A;  3RHA A;  4XWR A;  3CPJ G;  2XCG A;  3S5W A;  2H89 A;  2B76 A;  2I0Z A;  3UP4 A;  2QA1 A;  3GYI A;  5JCN A;  4B68 A;  2GQF A;  1XDI A;  1B8S A;  2WOW A;  3NT6 A;  4KPR A;  3OZ2 A;  3QSM A;  5EOW A;  3L1R A;  4NTC A;  1ZMD A;  4NTD A;  1CJ3 A;  1TDF A;  3AYI A;  1ZX9 A;  2YG4 A;  3CNT A;  1DNC A;  2GR0 A;  3DGH A;  2B7R A;  4C77 A;  1D4E A;  4YKG A;  1KSU A;  1OJT A;  3NH3 X;  1OJD A;  2EQ7 A;  1E39 A;  4ZN0 A;  3Q6J A;  2WPE A;  2YVF A;  3KPF A;  2WU2 A;  2X99 A;  3M13 A;  4N9X A;  1JU2 A;  1FCD A;  2WS3 A;  2XLU A;  4H4S A;  1KDG A;  1COY A;  2R9Z A;  3G5S A;  4OVI A;  3NYC A;  5HHF A;  4B69 A;  3NGC X;  1H6V A;  3V76 A;  2YG7 A;  4CY6 A;  1JRY A;  1PJ6 A;  1NPX A;  2BK5 A;  1LV0 A;  5ER0 A;  2BC0 A;  3I3L A;  3GSI A;  5CKU A;  5U63 A;  4OPU A;  2XFQ A;  2IVD A;  1SEZ A;  1E6E A;  1GT8 A;  3K7M X;  4Z44 A;  4D03 A;  4YSZ A;  4JN9 A;  1LVL A;  1TYT A;  1DOE A;  3AEA A;  1JNZ A;  2W0H A;  1H86 A;  1EL5 A;  3GDP A;  4DSH A;  2TPR A;  4Z2T A;  3LAD A;  1N1P A;  2E5V A;  1HYU A;  2DKH A;  1N4W A;  3AB1 A;  4ICY A;  3V3N A;  3AD9 B;  3IHG A;  1VDC A;  5U25 A;  3I6D A;  1N4V A;  3FIM B;  1GOS A;  1YQ3 A;  3DME A;  4X4J A;  2EQ6 A;  3IF9 A;  1BGJ A;  3LB8 A;  4LII A;  1JOA A;  3QFB A;  3UOV A;  2YLS A;  1MO9 A;  3GWD A;  3AEF A;  5TR3 A;  5M0Z A;  4B64 A;  5C3J A;  2GR3 A;  4HB9 A;  1H83 A;  2R4E A;  3DK9 A;  3NTD A;  4TM1 A;  1CF3 A;  2V3A A;  3BNM A;  2XFN A;  3O0H A;  1ZP0 A;  2XLP A;  4DGK A;  4YTP A;  3RNM A;  1FL2 A;  4NZH A;  4H2Q A;  2GMJ A;  3DK8 A;  5CQF A;  4BV6 A;  4K5R A;  1O94 A;  3ALM A;  3D1C A;  4IA5 A;  4YWO A;  1BWC A;  1PBC A;  2AQJ A;  5JCK A;  2R0G A;  2WDV A;  3RP6 A;  1NHS A;  3CND A;  4U2L A;  3SQP A;  2JK6 A;  3H8L A;  4EMJ A;  4C74 A;  1K0J A;  2NVK X;  3C4N A;  2X50 A;  3DK4 A;  2C3D A;  2WU5 A;  3PO7 A;  3P4S A;  2XFO A;  3JSK A;  3UKF A;  5HXI A;  3CNP A;  1DOC A;  3UOY A;  2FJD A;  5U1O A;  2WHD A;  4AOS A;  3LXD A;  4X9N A;  4Z26 A;  4E0V A;  4NEV A;  5KRQ A;  4A7A A;  3S61 A;  1JRX A;  4U8L A;  2Q0K A;  3M0O A;  1D7Y A;  4M52 A;  4OPT A;  4EIQ A;  3K7T A;  1N4U A;  2APG A;  1D4D A;  2AAQ A;  2PHH A;  3DJD A;  2H88 A;  3NIX A;  1IJH A;  4U8K A;  1LPF A;  4U8O A;  4AOX A;  1TDE A;  1S3E A;  1Y56 A;  2JB2 A;  2YM2 A;  3GRS A;  4A9W A;  3P4R A;  3RP8 A;  1CC4 A;  5KVI A;  1IUT A;  1H82 A;  2IID A;  2WPF A;  3B3R A;  4X9M A;  2XVJ A;  2CDU A;  4K8D A;  4YSX A;  1L0V A;  1PBB A;  4J2W A;  5KOX A;  1CJC A;  3SM8 A;  3F8P A;  4C3Y A;  4H2P A;  1M64 A;  4UP3 A;  2JB1 A;  2XVF A;  3URH A;  1CC2 A;  4D04 A;  1PXB A;  3ATR A;  3ALJ A;  1PJ7 A;  3IWA A;  1CJ2 A;  3C96 A;  4CCQ A;  1P2E A;  2YM1 A;  4H4Y A;  4AP1 A;  2GQW A;  4A6N A;  4FDC B;  4K5S A;  1CC6 A;  2B7S A;  4A79 A;  4Y4M A;  2QA2 A;  4Z25 A;  1CHU A;  4C3X A;  4H4U A;  4AT2 A;  4B67 A;  4B66 A;  2V5Z A;  1KFY A;  2BAB A;  3AEB A;  4BJY A;  4XWZ A;  1ZKQ A;  3LZX A;  4RG4 A;  2GH5 A;  5HYM A;  4H7U A;  4U8N A;  2C72 A;  2FJB A;  1E7P A;  1ZK7 A;  3UOZ A;  4DSG A;  1GTE A;  1TDO A;  2XFP A;  3GRT A;  3ICS A;  4YT0 A;  1GRT A;  2V61 A;  1TDN A;  2XLS A;  5J7X A;  1GND A;  3UCL A;  4ECH A;  3T37 A;  1GXF A;  3AEE A;  2C7G A;  1IUU A;  4BUR A;  2XVI A;  2YWL A;  2BXS A;  4REK A;  3CNS A;  2XVE A;  3FMW A;  2BK3 A;  2VOU A;  1L9C A;  5KOW A;  4UDP A;  4J36 A;  3CTY A;  1FOH A;  1S2Q A;  1BF3 A;  1E1M A;  4Y4N A;  4H4V A;  2R0P A;  3LJP A;  4U2S A;  1QO8 A;  5KWF A;  2BS4 A;  4K22 A;  3NN6 X;  3ATQ A;  2E1M A;  4XXG A;  3IHM A;  3NK2 X;  1PBE A;  1M6I A;  3VR9 A;  3D8X A;  3II4 A;  1Q1R A;  4OPG A;  4U8J A;  3QSS A;  3ADA B;  1B37 A;  3AED A;  3KA7 A;  1X31 B;  2XLR A;  3UTE A;  1REO A;  4EQS A;  3CNJ A;  1GAL A;  4USR A;  4YTM A;  4U8P A;  3VR8 A;  1ZDL A;  3IC9 A;  2OLN A;  4OPD A;  4K7Z A;  4A5L A;  1GRG A;  1ZY8 A;  2FJE A;  3CIR A;  4H2N A;  5EB5 A;  1H84 A;  1JNR A;  2WES A;  1H7X A;  3G5Q A;  2B9W A;  2QAE A;  2XYO A;  3ISH A;  3P4Q A;  5M10 A;  4EMW A;  3K30 A;  1D5T A;  2RGO A;  1CJ4 A;  3NK1 X;  4EIP A;  2YR5 A;  2BYB A;  1TYP A;  1KNP A;  4GF7 A;  2YG6 A;  3B6D A;  3DH9 A;  1PDH A;  2QCU A;  1MOK A;  1CBO A;  4OPL A;  3UKL A;  4B65 A;  4P9S A;  2YAU A;  2AR8 A;  3NLC A;  4GR1 A;  2C66 A;  4TM3 A;  4B1B A;  1F8R A;  5BUK A;  4H4R A;  5IPY A;  4GCM A;  1GSN A; 
#chains in the Genus database with same CATH topology
 1XHC A;  3AE3 A;  2F5Z A;  2YLW A;  1NDA A;  2OA1 A;  3ITJ A;  1OJ9 A;  4H4X A;  3NTA A;  4KX6 A;  4U8I A;  5GSN A;  4G6G A;  4EQX A;  4ZCD A;  2Z5X A;  1QJD A;  4I59 A;  1IUV A;  5DBJ A;  5L46 A;  3VQR A;  1F3P A;  4H4P A;  1DXL A;  2ARD A;  5IQ1 A;  2B9Y A;  1LJ1 A;  2FBW A;  2YVJ A;  1JEH A;  1O5W A;  2V3B A;  3NG7 X;  4H4Q A;  1VG9 A;  4NNJ A;  4YTN A;  1PJ5 A;  4J56 A;  4PAB A;  1YKJ A;  3QSE A;  1ZOY A;  2JB3 A;  2GR1 A;  5FS7 A;  3SYI A;  3SZF A;  2UZZ A;  1MXT A;  1K4Q A;  1GER A;  4H4T A;  2Z5Y A;  2C70 A;  3EAO A;  1NEN A;  2C3C A;  2ZBW A;  1PXA A;  3C4A A;  3CN8 A;  1NHQ A;  4RSL A;  3AEC A;  2X8G A;  3WE0 A;  1TRB A;  4H4W A;  1GEU A;  1O95 A;  1LTX R;  3BNU A;  4WX1 A;  5EB4 A;  4IV9 A;  2BS2 A;  3UKA A;  3CPH G;  4UDR A;  2NPX A;  4EM3 A;  2GAH B;  1W4X A;  3SZ0 A;  1VQW A;  4IVM B;  3T0K A;  3P1W A;  5FS8 A;  2C75 A;  1NAA A;  1NEK A;  2YVG A;  3SFE A;  1H81 A;  3SY4 A;  3ALL A;  3UP5 A;  1NHR A;  2BCP A;  3NN0 X;  2GMH A;  1GRE A;  3NRN A;  2CFY A;  3SFD A;  3KLJ A;  4G73 A;  2IVE A;  1GPE A;  2O9Z A;  2GVC A;  3QFA A;  2BRA A;  1F8W A;  3BI4 A;  2X8H A;  1YQZ A;  3ICT A;  2X3N A;  1NG4 A;  3GYJ A;  2JBV A;  2GR2 A;  2TMD A;  4Z24 A;  1YY5 A;  1F6M A;  2R46 A;  3UKH A;  4II2 A;  3BI2 A;  1GRB A;  1ZMC A;  2GRT A;  2GB0 A;  1YQ4 A;  4EMI A;  1DJN A;  3BI5 A;  3NYE A;  3NHO X;  2E4G A;  2VRM A;  2Y6Q A;  3CGE A;  3RP7 A;  2C65 A;  2BA9 A;  2ZZ0 A;  3CGB A;  4CNJ A;  1E1N A;  3GWF A;  1KSS A;  2YLZ A;  2WEU A;  4OCG A;  1S3B A;  4Z43 A;  2VVL G;  4JQ9 A;  2ZZC A;  2EQ8 A;  4BK1 A;  4JY2 A;  4IVO B;  2Q0L A;  4NEW A;  1OJA A;  2XLT A;  3NKS A;  4BK2 A;  3UKK A;  5JCI A;  4K2X A;  2VVL A;  4TLZ A;  3HZL A;  2PYX A;  1NHP A;  4CRT A;  3RED A;  5KMP A;  2JKC A;  2V60 A;  1ZOV A;  3QVP A;  4LU6 A;  1L9D A;  2WPC A;  3E1T A;  3T2K A;  3AE8 A;  5GRT A;  3EF6 A;  1LQT A;  1BZL A;  4J34 A;  1LQU A;  2BC1 A;  2JAE A;  3DJJ A;  4EM4 A;  4NTE A;  3AE6 A;  3KU9 A;  1RP0 A;  4J57 A;  2VQ7 A;  3KVE A;  3Q9T A;  1GET A;  4FX9 A;  5KMS A;  1Y56 B;  2OAM A;  4CNK A;  2WET A;  5J60 A;  3GD3 A;  3BHK A;  1PS9 A;  4TLX A;  3VRA A;  4EQW A;  3ICR A;  3PS9 A;  3KKJ A;  4MJW A;  5BRT A;  2VRL A;  3AE2 A;  5FMH A;  1BKW A;  3UTG A;  1P2H A;  3LOV A;  4J33 A;  2WOV A;  5JCL A;  3L8K A;  5JCM A;  4PAA A;  4UDQ A;  3T2Y A;  2J3N A;  3AE7 A;  4A6N B;  4GRT A;  1IUS A;  3R9U A;  3P4P A;  3UTH A;  1GTH A;  2R45 A;  2YLT A;  2V6O A;  3AXB A;  4HA6 A;  1DOD A;  4DNA A;  2R0C A;  2C64 A;  4YXD A;  1ELI A;  2RGH A;  5IQ4 A;  3SXI A;  1TDK A;  2RAB A;  3T2Z A;  2A87 A;  4OPI A;  5HY5 A;  3SZW A;  1S2Y A;  1CL0 A;  3AE5 A;  2OLO A;  3ZYX A;  1DJQ A;  1EL8 A;  2BAC A;  5KMQ A;  1B4V A;  1GRF A;  3V3O A;  1AOG A;  3CGD A;  2YLX A;  3COX A;  3H8I A;  1VG0 A;  3AD8 B;  2WP5 A;  4OPC A;  4JNQ A;  3LZW A;  1FEB A;  3UTF A;  2RGJ A;  4O5Q A;  3AYJ A;  1RSG A;  1RYI A;  1PBD A;  3AE4 A;  4AP3 A;  4JDR A;  2VZ2 A;  3K7Q X;  2XVH A;  2YG5 A;  4LA1 A;  2YQU A;  3FG2 P;  3SGL A;  2YR6 A;  5KXJ A;  2BK4 A;  3UKQ A;  2WP9 A;  5KVH A;  3GMB A;  3AD7 B;  3NNE A;  1EBD A;  1FEA A;  3ABV A;  3DJE A;  1GRH A;  4I58 A;  2GF3 A;  1L9E A;  2XDO A;  1BGN A;  2Q7V A;  3VRD B;  3UOX A;  2OAL A;  4GUV A;  3G5R A;  2WP6 A;  2WBA A;  1K0I A;  3AEG A;  3H4K A;  4Z2R A;  1IUX A;  4TM4 A;  3KPK A;  4RG3 A;  4APN A;  1F8S A;  4B63 A;  2A89 A;  3QJ4 A;  3GMC A;  1H7W A;  4J31 A;  4CBQ A;  1EL9 A;  2YR4 A;  2BCG G;  2C76 A;  2WQY A;  3QVR A;  1IUW A;  2FJA A;  1ONF A;  5FS6 A;  2BXR A;  3GDN A;  3GYX A;  1PN0 A;  4ADW A;  1KNR A;  5BUL A;  1E1L A;  4H50 A;  1GES A;  3AYL A;  3SZC A;  2Q6U A;  4IA6 A;  2GAG B;  2CVJ A;  1NG3 A;  2WDR A;  3BHF A;  4Y4L A;  4BK3 A;  5C2T A;  2Y6R A;  1EL7 A;  3EPT A;  4GDP A;  4C5O A;  3KD9 A;  4FK1 C;  1D7L A;  1JRZ A;  2B9X A;  2WOI A;  1DOB A;  4GAP A;  2WDQ A;  2R4J A;  5LV9 A;  3HYV A;  1FEC A;  3NK0 X;  1XPQ A;  1GRA A;  4FK1 A;  4U8M A;  2YLR A;  3AE9 A;  4A99 A;  3AE1 A;  1V59 A;  1VRQ B;  4YKF A;  5FS9 A;  3NYF A;  3P9U A;  2YG3 A;  3DA1 A;  3EAN A;  3UKP A;  2A8X A;  4EQR A;  4YSY A;  2C67 A;  2ZZB A;  1QLB A;  4AT0 A;  1Q9I A;  2VVM A;  4O5U A;  2DKI A;  4Z2U A;  4U2T A;  1B5Q A;  1XAN A;  3CGC A;  1PHH A;  4WCT A;  1D4C A;  3VRB A;  4A65 A;  3F8D A;  4CCR A;  2EQ9 A;  2CUL A;  5BVA A;  3FBS A;  1PBF A;  4JNA A;  3ZDN A;  1Q1W A;  2GEW A;  2X8C A;  4YSH A;  3CPI G;  4H2R A;  1Y0P A;  4ZCC A;  2GV8 A;  4G74 A;  1Z6L A;  1K0L A;  3DJG X;  4TM0 A;  4II3 A;  4CY8 A;  5EBK A;  3SX6 A;  1OJC A;  2ACZ A;  3DGZ A;  1PXC A;  2XFU A;  3F8R A;  4JY3 A;  2HQM A;  3OC4 A;  3M12 A;  1KF6 A;  4USQ A;  2BS3 A;  3GD4 A;  2C73 A;  2VQB A;  4H4Z A;  1E1K A;  3AWI A;  3T14 A;  1UKV G;  4GDE A;  4BJZ A;  1GV4 A;  3PVC A;  3FPZ A;  3RHA A;  4XWR A;  3CPJ G;  2XCG A;  3S5W A;  2H89 A;  2B76 A;  2I0Z A;  3UP4 A;  2QA1 A;  3GYI A;  5JCN A;  4B68 A;  2GQF A;  1XDI A;  1B8S A;  2WOW A;  3NT6 A;  4KPR A;  3OZ2 A;  3QSM A;  5EOW A;  3L1R A;  4NTC A;  1ZMD A;  4NTD A;  1CJ3 A;  1TDF A;  3AYI A;  1ZX9 A;  2YG4 A;  3CNT A;  1DNC A;  2GR0 A;  3DGH A;  2B7R A;  4C77 A;  1D4E A;  4YKG A;  1KSU A;  1OJT A;  3NH3 X;  1OJD A;  2EQ7 A;  1E39 A;  4ZN0 A;  3Q6J A;  2WPE A;  2YVF A;  3KPF A;  2WU2 A;  2X99 A;  3M13 A;  4N9X A;  1JU2 A;  1FCD A;  2WS3 A;  2XLU A;  4H4S A;  1KDG A;  1COY A;  2R9Z A;  3G5S A;  4OVI A;  3NYC A;  5HHF A;  4B69 A;  3NGC X;  1H6V A;  3V76 A;  2YG7 A;  4CY6 A;  1JRY A;  1PJ6 A;  1NPX A;  2BK5 A;  1LV0 A;  5ER0 A;  2BC0 A;  3I3L A;  3GSI A;  5CKU A;  5U63 A;  4OPU A;  2XFQ A;  2IVD A;  1SEZ A;  1E6E A;  1GT8 A;  3K7M X;  4Z44 A;  4D03 A;  4YSZ A;  4JN9 A;  1LVL A;  1TYT A;  1DOE A;  3AEA A;  1JNZ A;  2W0H A;  1H86 A;  1EL5 A;  3GDP A;  4DSH A;  2TPR A;  4Z2T A;  3LAD A;  1N1P A;  2E5V A;  1HYU A;  2DKH A;  1N4W A;  3AB1 A;  4ICY A;  3V3N A;  3AD9 B;  3IHG A;  1VDC A;  5U25 A;  3I6D A;  1N4V A;  3FIM B;  1GOS A;  1YQ3 A;  3DME A;  4X4J A;  2EQ6 A;  3IF9 A;  1BGJ A;  3LB8 A;  4LII A;  1JOA A;  3QFB A;  3UOV A;  2YLS A;  1MO9 A;  3GWD A;  3AEF A;  5TR3 A;  5M0Z A;  4B64 A;  5C3J A;  2GR3 A;  4HB9 A;  1H83 A;  2R4E A;  3DK9 A;  3NTD A;  4TM1 A;  1CF3 A;  2V3A A;  3BNM A;  2XFN A;  3O0H A;  1ZP0 A;  2XLP A;  4DGK A;  4YTP A;  3RNM A;  1FL2 A;  4NZH A;  4H2Q A;  3HYX A;  2GMJ A;  3DK8 A;  5CQF A;  4BV6 A;  4K5R A;  1O94 A;  3ALM A;  3D1C A;  4IA5 A;  4YWO A;  1BWC A;  1PBC A;  2AQJ A;  5JCK A;  2R0G A;  2WDV A;  3RP6 A;  1NHS A;  3CND A;  4U2L A;  3SQP A;  2JK6 A;  3H8L A;  4EMJ A;  4C74 A;  1K0J A;  3T31 A;  2NVK X;  3C4N A;  2X50 A;  3DK4 A;  2C3D A;  2WU5 A;  3PO7 A;  3P4S A;  2XFO A;  3JSK A;  4NWZ A;  3UKF A;  5HXI A;  3CNP A;  1DOC A;  3UOY A;  2FJD A;  2C4C A;  5U1O A;  2WHD A;  4AOS A;  3LXD A;  4X9N A;  4Z26 A;  4E0V A;  4NEV A;  5KRQ A;  4A7A A;  3S61 A;  4G6H A;  1JRX A;  4U8L A;  2BRY A;  2Q0K A;  3M0O A;  1D7Y A;  4M52 A;  4OPT A;  4EIQ A;  3K7T A;  1N4U A;  2APG A;  1D4D A;  2AAQ A;  2PHH A;  3DJD A;  2H88 A;  3NIX A;  1IJH A;  4U8K A;  1LPF A;  4U8O A;  4AOX A;  1TDE A;  1S3E A;  1Y56 A;  2JB2 A;  2YM2 A;  3GRS A;  4A9W A;  3P4R A;  3RP8 A;  1CC4 A;  5KVI A;  1IUT A;  1H82 A;  2IID A;  2WPF A;  3B3R A;  4X9M A;  2XVJ A;  2CDU A;  4K8D A;  4YSX A;  1L0V A;  1PBB A;  4J2W A;  5KOX A;  1CJC A;  5KNL A;  3SM8 A;  3F8P A;  4C3Y A;  4H2P A;  1M64 A;  4UP3 A;  2JB1 A;  2XVF A;  3URH A;  1CC2 A;  4D04 A;  1PXB A;  3ATR A;  3ALJ A;  1PJ7 A;  3IWA A;  1CJ2 A;  3C96 A;  4CCQ A;  1P2E A;  2YM1 A;  4H4Y A;  4AP1 A;  2GQW A;  4A6N A;  4FDC B;  4K5S A;  1CC6 A;  2B7S A;  4A79 A;  4Y4M A;  2QA2 A;  4Z25 A;  1CHU A;  4C3X A;  4H4U A;  4AT2 A;  4B67 A;  4B66 A;  2V5Z A;  1KFY A;  2BAB A;  3AEB A;  4BJY A;  4XWZ A;  1ZKQ A;  3LZX A;  4RG4 A;  2GH5 A;  5HYM A;  4H7U A;  4U8N A;  2C72 A;  2FJB A;  1E7P A;  3CMM A;  1ZK7 A;  3UOZ A;  4DSG A;  1GTE A;  1TDO A;  2XFP A;  3GRT A;  3ICS A;  4YT0 A;  1GRT A;  4G9K A;  2V61 A;  1TDN A;  2XLS A;  5J7X A;  1GND A;  3UCL A;  4ECH A;  3T37 A;  1GXF A;  3AEE A;  2C7G A;  1IUU A;  4BUR A;  2XVI A;  2YWL A;  2BXS A;  4REK A;  3CNS A;  2XVE A;  3FMW A;  2BK3 A;  2VOU A;  1L9C A;  5KOW A;  4UDP A;  4J36 A;  3CTY A;  3HYW A;  1FOH A;  1S2Q A;  1BF3 A;  1E1M A;  4Y4N A;  4H4V A;  2R0P A;  3LJP A;  4U2S A;  1QO8 A;  5KWF A;  2BS4 A;  4K22 A;  3NN6 X;  3ATQ A;  2E1M A;  4XXG A;  3IHM A;  4GAV A;  3NK2 X;  1PBE A;  1M6I A;  3VR9 A;  3D8X A;  3II4 A;  1Q1R A;  4OPG A;  4U8J A;  3QSS A;  3ADA B;  1B37 A;  3AED A;  3KA7 A;  1X31 B;  2XLR A;  3UTE A;  1REO A;  4EQS A;  3CNJ A;  1GAL A;  4USR A;  4YTM A;  4U8P A;  3VR8 A;  1ZDL A;  3IC9 A;  2OLN A;  4OPD A;  4K7Z A;  4A5L A;  1GRG A;  1ZY8 A;  2FJE A;  3CIR A;  4H2N A;  5EB5 A;  1H84 A;  1JNR A;  2WES A;  1H7X A;  3G5Q A;  2B9W A;  2QAE A;  2XYO A;  3ISH A;  3P4Q A;  5M10 A;  4EMW A;  3K30 A;  1D5T A;  2RGO A;  1CJ4 A;  3NK1 X;  4EIP A;  2YR5 A;  2BYB A;  1TYP A;  1KNP A;  4GF7 A;  2YG6 A;  3B6D A;  3DH9 A;  1PDH A;  2QCU A;  1MOK A;  1CBO A;  4OPL A;  3UKL A;  4B65 A;  4P9S A;  2YAU A;  2AR8 A;  3NLC A;  4GR1 A;  2C66 A;  4TM3 A;  4B1B A;  1F8R A;  5BUK A;  4H4R A;  5IPY A;  4GCM A;  1GSN A;  5KMR A; 
#chains in the Genus database with same CATH homology
 1XHC A;  3AE3 A;  2F5Z A;  2YLW A;  1NDA A;  2OA1 A;  3ITJ A;  1OJ9 A;  4H4X A;  3NTA A;  4KX6 A;  4U8I A;  5GSN A;  4G6G A;  4EQX A;  4ZCD A;  2Z5X A;  1QJD A;  4I59 A;  1IUV A;  5DBJ A;  5L46 A;  3VQR A;  1F3P A;  4H4P A;  1DXL A;  2ARD A;  5IQ1 A;  2B9Y A;  1LJ1 A;  2FBW A;  2YVJ A;  1JEH A;  1O5W A;  2V3B A;  3NG7 X;  4H4Q A;  1VG9 A;  4NNJ A;  4YTN A;  1PJ5 A;  4J56 A;  4PAB A;  1YKJ A;  3QSE A;  1ZOY A;  2JB3 A;  2GR1 A;  5FS7 A;  3SYI A;  3SZF A;  2UZZ A;  1MXT A;  1K4Q A;  1GER A;  4H4T A;  2Z5Y A;  2C70 A;  3EAO A;  1NEN A;  2C3C A;  2ZBW A;  1PXA A;  3C4A A;  3CN8 A;  1NHQ A;  4RSL A;  3AEC A;  2X8G A;  3WE0 A;  1TRB A;  4H4W A;  1GEU A;  1O95 A;  1LTX R;  3BNU A;  4WX1 A;  5EB4 A;  4IV9 A;  2BS2 A;  3UKA A;  3CPH G;  4UDR A;  2NPX A;  4EM3 A;  2GAH B;  1W4X A;  3SZ0 A;  1VQW A;  4IVM B;  3T0K A;  3P1W A;  5FS8 A;  2C75 A;  1NAA A;  1NEK A;  2YVG A;  3SFE A;  1H81 A;  3SY4 A;  3ALL A;  3UP5 A;  1NHR A;  2BCP A;  3NN0 X;  2GMH A;  1GRE A;  3NRN A;  2CFY A;  3SFD A;  3KLJ A;  4G73 A;  2IVE A;  1GPE A;  2O9Z A;  2GVC A;  3QFA A;  2BRA A;  1F8W A;  3BI4 A;  2X8H A;  1YQZ A;  3ICT A;  2X3N A;  1NG4 A;  3GYJ A;  2JBV A;  2GR2 A;  2TMD A;  4Z24 A;  1YY5 A;  1F6M A;  2R46 A;  3UKH A;  4II2 A;  3BI2 A;  1GRB A;  1ZMC A;  2GRT A;  2GB0 A;  1YQ4 A;  4EMI A;  1DJN A;  3BI5 A;  3NYE A;  3NHO X;  2E4G A;  2VRM A;  2Y6Q A;  3CGE A;  3RP7 A;  2C65 A;  2BA9 A;  2ZZ0 A;  3CGB A;  4CNJ A;  1E1N A;  3GWF A;  1KSS A;  2YLZ A;  2WEU A;  4OCG A;  1S3B A;  4Z43 A;  2VVL G;  4JQ9 A;  2ZZC A;  2EQ8 A;  4BK1 A;  4JY2 A;  4IVO B;  2Q0L A;  4NEW A;  1OJA A;  2XLT A;  3NKS A;  4BK2 A;  3UKK A;  5JCI A;  4K2X A;  2VVL A;  4TLZ A;  3HZL A;  2PYX A;  1NHP A;  4CRT A;  3RED A;  5KMP A;  2JKC A;  2V60 A;  1ZOV A;  3QVP A;  4LU6 A;  1L9D A;  2WPC A;  3E1T A;  3T2K A;  3AE8 A;  5GRT A;  3EF6 A;  1LQT A;  1BZL A;  4J34 A;  1LQU A;  2BC1 A;  2JAE A;  3DJJ A;  4EM4 A;  4NTE A;  3AE6 A;  3KU9 A;  1RP0 A;  4J57 A;  2VQ7 A;  3KVE A;  3Q9T A;  1GET A;  4FX9 A;  5KMS A;  1Y56 B;  2OAM A;  4CNK A;  2WET A;  5J60 A;  3GD3 A;  3BHK A;  1PS9 A;  4TLX A;  3VRA A;  4EQW A;  3ICR A;  3PS9 A;  3KKJ A;  4MJW A;  5BRT A;  2VRL A;  3AE2 A;  5FMH A;  1BKW A;  3UTG A;  1P2H A;  3LOV A;  4J33 A;  2WOV A;  5JCL A;  3L8K A;  5JCM A;  4PAA A;  4UDQ A;  3T2Y A;  2J3N A;  3AE7 A;  4A6N B;  4GRT A;  1IUS A;  3R9U A;  3P4P A;  3UTH A;  1GTH A;  2R45 A;  2YLT A;  2V6O A;  3AXB A;  4HA6 A;  1DOD A;  4DNA A;  2R0C A;  2C64 A;  4YXD A;  1ELI A;  2RGH A;  5IQ4 A;  3SXI A;  1TDK A;  2RAB A;  3T2Z A;  2A87 A;  4OPI A;  5HY5 A;  3SZW A;  1S2Y A;  1CL0 A;  3AE5 A;  2OLO A;  3ZYX A;  1DJQ A;  1EL8 A;  2BAC A;  5KMQ A;  1B4V A;  1GRF A;  3V3O A;  1AOG A;  3CGD A;  2YLX A;  3COX A;  3H8I A;  1VG0 A;  3AD8 B;  2WP5 A;  4OPC A;  4JNQ A;  3LZW A;  1FEB A;  3UTF A;  2RGJ A;  4O5Q A;  3AYJ A;  1RSG A;  1RYI A;  1PBD A;  3AE4 A;  4AP3 A;  4JDR A;  2VZ2 A;  3K7Q X;  2XVH A;  2YG5 A;  4LA1 A;  2YQU A;  3FG2 P;  3SGL A;  2YR6 A;  5KXJ A;  2BK4 A;  3UKQ A;  2WP9 A;  5KVH A;  3GMB A;  3AD7 B;  3NNE A;  1EBD A;  1FEA A;  3ABV A;  3DJE A;  1GRH A;  4I58 A;  2GF3 A;  1L9E A;  2XDO A;  1BGN A;  2Q7V A;  3VRD B;  3UOX A;  2OAL A;  4GUV A;  3G5R A;  2WP6 A;  2WBA A;  1K0I A;  3AEG A;  3H4K A;  4Z2R A;  1IUX A;  4TM4 A;  3KPK A;  4RG3 A;  4APN A;  1F8S A;  4B63 A;  2A89 A;  3QJ4 A;  3GMC A;  1H7W A;  4J31 A;  4CBQ A;  1EL9 A;  2YR4 A;  2BCG G;  2C76 A;  2WQY A;  3QVR A;  1IUW A;  2FJA A;  1ONF A;  5FS6 A;  2BXR A;  3GDN A;  3GYX A;  1PN0 A;  4ADW A;  1KNR A;  5BUL A;  1E1L A;  4H50 A;  1GES A;  3AYL A;  3SZC A;  2Q6U A;  4IA6 A;  2GAG B;  2CVJ A;  1NG3 A;  2WDR A;  3BHF A;  4Y4L A;  4BK3 A;  5C2T A;  2Y6R A;  1EL7 A;  3EPT A;  4GDP A;  4C5O A;  3KD9 A;  4FK1 C;  1D7L A;  1JRZ A;  2B9X A;  2WOI A;  1DOB A;  4GAP A;  2WDQ A;  2R4J A;  5LV9 A;  3HYV A;  1FEC A;  3NK0 X;  1XPQ A;  1GRA A;  4FK1 A;  4U8M A;  2YLR A;  3AE9 A;  4A99 A;  3AE1 A;  1V59 A;  1VRQ B;  4YKF A;  5FS9 A;  3NYF A;  3P9U A;  2YG3 A;  3DA1 A;  3EAN A;  3UKP A;  2A8X A;  4EQR A;  4YSY A;  2C67 A;  2ZZB A;  1QLB A;  4AT0 A;  1Q9I A;  2VVM A;  4O5U A;  2DKI A;  4Z2U A;  4U2T A;  1B5Q A;  1XAN A;  3CGC A;  1PHH A;  4WCT A;  1D4C A;  3VRB A;  4A65 A;  3F8D A;  4CCR A;  2EQ9 A;  2CUL A;  5BVA A;  3FBS A;  1PBF A;  4JNA A;  3ZDN A;  1Q1W A;  2GEW A;  2X8C A;  4YSH A;  3CPI G;  4H2R A;  1Y0P A;  4ZCC A;  2GV8 A;  4G74 A;  1Z6L A;  1K0L A;  3DJG X;  4TM0 A;  4II3 A;  4CY8 A;  5EBK A;  3SX6 A;  1OJC A;  2ACZ A;  3DGZ A;  1PXC A;  2XFU A;  3F8R A;  4JY3 A;  2HQM A;  3OC4 A;  3M12 A;  1KF6 A;  4USQ A;  2BS3 A;  3GD4 A;  2C73 A;  2VQB A;  4H4Z A;  1E1K A;  3AWI A;  3T14 A;  1UKV G;  4GDE A;  4BJZ A;  1GV4 A;  3PVC A;  3FPZ A;  3RHA A;  4XWR A;  3CPJ G;  2XCG A;  3S5W A;  2H89 A;  2B76 A;  2I0Z A;  3UP4 A;  2QA1 A;  3GYI A;  5JCN A;  4B68 A;  2GQF A;  1XDI A;  1B8S A;  2WOW A;  3NT6 A;  4KPR A;  3OZ2 A;  3QSM A;  5EOW A;  3L1R A;  4NTC A;  1ZMD A;  4NTD A;  1CJ3 A;  1TDF A;  3AYI A;  1ZX9 A;  2YG4 A;  3CNT A;  1DNC A;  2GR0 A;  3DGH A;  2B7R A;  4C77 A;  1D4E A;  4YKG A;  1KSU A;  1OJT A;  3NH3 X;  1OJD A;  2EQ7 A;  1E39 A;  4ZN0 A;  3Q6J A;  2WPE A;  2YVF A;  3KPF A;  2WU2 A;  2X99 A;  3M13 A;  4N9X A;  1JU2 A;  1FCD A;  2WS3 A;  2XLU A;  4H4S A;  1KDG A;  1COY A;  2R9Z A;  3G5S A;  4OVI A;  3NYC A;  5HHF A;  4B69 A;  3NGC X;  1H6V A;  3V76 A;  2YG7 A;  4CY6 A;  1JRY A;  1PJ6 A;  1NPX A;  2BK5 A;  1LV0 A;  5ER0 A;  2BC0 A;  3I3L A;  3GSI A;  5CKU A;  5U63 A;  4OPU A;  2XFQ A;  2IVD A;  1SEZ A;  1E6E A;  1GT8 A;  3K7M X;  4Z44 A;  4D03 A;  4YSZ A;  4JN9 A;  1LVL A;  1TYT A;  1DOE A;  3AEA A;  1JNZ A;  2W0H A;  1H86 A;  1EL5 A;  3GDP A;  4DSH A;  2TPR A;  4Z2T A;  3LAD A;  1N1P A;  2E5V A;  1HYU A;  2DKH A;  1N4W A;  3AB1 A;  4ICY A;  3V3N A;  3AD9 B;  3IHG A;  1VDC A;  5U25 A;  3I6D A;  1N4V A;  3FIM B;  1GOS A;  1YQ3 A;  3DME A;  4X4J A;  2EQ6 A;  3IF9 A;  1BGJ A;  3LB8 A;  4LII A;  1JOA A;  3QFB A;  3UOV A;  2YLS A;  1MO9 A;  3GWD A;  3AEF A;  5TR3 A;  5M0Z A;  4B64 A;  5C3J A;  2GR3 A;  4HB9 A;  1H83 A;  2R4E A;  3DK9 A;  3NTD A;  4TM1 A;  1CF3 A;  2V3A A;  3BNM A;  2XFN A;  3O0H A;  1ZP0 A;  2XLP A;  4DGK A;  4YTP A;  3RNM A;  1FL2 A;  4NZH A;  4H2Q A;  3HYX A;  2GMJ A;  3DK8 A;  5CQF A;  4BV6 A;  4K5R A;  1O94 A;  3ALM A;  3D1C A;  4IA5 A;  4YWO A;  1BWC A;  1PBC A;  2AQJ A;  5JCK A;  2R0G A;  2WDV A;  3RP6 A;  1NHS A;  3CND A;  4U2L A;  3SQP A;  2JK6 A;  3H8L A;  4EMJ A;  4C74 A;  1K0J A;  3T31 A;  2NVK X;  3C4N A;  2X50 A;  3DK4 A;  2C3D A;  2WU5 A;  3PO7 A;  3P4S A;  2XFO A;  3JSK A;  4NWZ A;  3UKF A;  5HXI A;  3CNP A;  1DOC A;  3UOY A;  2FJD A;  2C4C A;  5U1O A;  2WHD A;  4AOS A;  3LXD A;  4X9N A;  4Z26 A;  4E0V A;  4NEV A;  5KRQ A;  4A7A A;  3S61 A;  4G6H A;  1JRX A;  4U8L A;  2BRY A;  2Q0K A;  3M0O A;  1D7Y A;  4M52 A;  4OPT A;  4EIQ A;  3K7T A;  1N4U A;  2APG A;  1D4D A;  2AAQ A;  2PHH A;  3DJD A;  2H88 A;  3NIX A;  1IJH A;  4U8K A;  1LPF A;  4U8O A;  4AOX A;  1TDE A;  1S3E A;  1Y56 A;  2JB2 A;  2YM2 A;  3GRS A;  4A9W A;  3P4R A;  3RP8 A;  1CC4 A;  5KVI A;  1IUT A;  1H82 A;  2IID A;  2WPF A;  3B3R A;  4X9M A;  2XVJ A;  2CDU A;  4K8D A;  4YSX A;  1L0V A;  1PBB A;  4J2W A;  5KOX A;  1CJC A;  5KNL A;  3SM8 A;  3F8P A;  4C3Y A;  4H2P A;  1M64 A;  4UP3 A;  2JB1 A;  2XVF A;  3URH A;  1CC2 A;  4D04 A;  1PXB A;  3ATR A;  3ALJ A;  1PJ7 A;  3IWA A;  1CJ2 A;  3C96 A;  4CCQ A;  1P2E A;  2YM1 A;  4H4Y A;  4AP1 A;  2GQW A;  4A6N A;  4FDC B;  4K5S A;  1CC6 A;  2B7S A;  4A79 A;  4Y4M A;  2QA2 A;  4Z25 A;  1CHU A;  4C3X A;  4H4U A;  4AT2 A;  4B67 A;  4B66 A;  2V5Z A;  1KFY A;  2BAB A;  3AEB A;  4BJY A;  4XWZ A;  1ZKQ A;  3LZX A;  4RG4 A;  2GH5 A;  5HYM A;  4H7U A;  4U8N A;  2C72 A;  2FJB A;  1E7P A;  3CMM A;  1ZK7 A;  3UOZ A;  4DSG A;  1GTE A;  1TDO A;  2XFP A;  3GRT A;  3ICS A;  4YT0 A;  1GRT A;  4G9K A;  2V61 A;  1TDN A;  2XLS A;  5J7X A;  1GND A;  3UCL A;  4ECH A;  3T37 A;  1GXF A;  3AEE A;  2C7G A;  1IUU A;  4BUR A;  2XVI A;  2YWL A;  2BXS A;  4REK A;  3CNS A;  2XVE A;  3FMW A;  2BK3 A;  2VOU A;  1L9C A;  5KOW A;  4UDP A;  4J36 A;  3CTY A;  3HYW A;  1FOH A;  1S2Q A;  1BF3 A;  1E1M A;  4Y4N A;  4H4V A;  2R0P A;  3LJP A;  4U2S A;  1QO8 A;  5KWF A;  2BS4 A;  4K22 A;  3NN6 X;  3ATQ A;  2E1M A;  4XXG A;  3IHM A;  4GAV A;  3NK2 X;  1PBE A;  1M6I A;  3VR9 A;  3D8X A;  3II4 A;  1Q1R A;  4OPG A;  4U8J A;  3QSS A;  3ADA B;  1B37 A;  3AED A;  3KA7 A;  1X31 B;  2XLR A;  3UTE A;  1REO A;  4EQS A;  3CNJ A;  1GAL A;  4USR A;  4YTM A;  4U8P A;  3VR8 A;  1ZDL A;  3IC9 A;  2OLN A;  4OPD A;  4K7Z A;  4A5L A;  1GRG A;  1ZY8 A;  2FJE A;  3CIR A;  4H2N A;  5EB5 A;  1H84 A;  1JNR A;  2WES A;  1H7X A;  3G5Q A;  2B9W A;  2QAE A;  2XYO A;  3ISH A;  3P4Q A;  5M10 A;  4EMW A;  3K30 A;  1D5T A;  2RGO A;  1CJ4 A;  3NK1 X;  4EIP A;  2YR5 A;  2BYB A;  1TYP A;  1KNP A;  4GF7 A;  2YG6 A;  3B6D A;  3DH9 A;  1PDH A;  2QCU A;  1MOK A;  1CBO A;  4OPL A;  3UKL A;  4B65 A;  4P9S A;  2YAU A;  2AR8 A;  3NLC A;  4GR1 A;  2C66 A;  4TM3 A;  4B1B A;  1F8R A;  5BUK A;  4H4R A;  5IPY A;  4GCM A;  1GSN A;  5KMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...