3UOZA

Crystal structure of otemo complex with fad and nadp (form 2)
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
540
structure length
540
Chain Sequence
b'KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 186
structure length 540
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uozA01
2UZZA 4OPGA 3K7MX 4JDRA 3IF9A 2E1MA 4YSZA 4U8KA 1CBOA 3FIMB 3LXDA 4B1BA 1Z6LA 2YG7A 1F8WA 4J31A 1M64A 3AE7A 4TM3A 5M0ZA 2V61A 4UDQA 4CY6A 3AD8B 4OPLA 1E39A 4UDPA 4CY8A 1KSUA 2YVFA 2V3AA 2YM2A 2EQ9A 2WP6A 3PO7A 1GREA 3Q6JA 2XLTA 5TR3A 1KDGA 4WX1A 1N4UA 4ZCDA 4USRA 4ADWA 4AOXA 4BJZA 3DA1A 3QJ4A 4Z24A 4YSHA 1K0LA 4NZHA 2B9WA 4D03A 3IHGA 4EMJA 1XDIA 2R45A 1ZY8A 3AYLA 1V59A 4J33A 5EOWA 5LV9A 1FEBA 4PAAA 2BK3A 3CPHG 4ZCCA 2OLOA 1YY5A 3NYEA 2VRMA 4GRTA 2X99A 4Z44A 4K2XA 2YAUA 4BK3A 4TM0A 1OJDA 3AD9B 1B37A 1ZOYA 3AE9A 1H82A 1FL2A 1JRZA 1YQ3A 2C67A 4MJWA 2HQMA 3AEEA 3C96A 2JB3A 2JAEA 1NEKA 4U8IA 1EL5A 3ZDNA 4LU6A 3URHA 1PBDA 1CC6A 3CNTA 2CULA 3PVCA 3R9UA 4YTNA 3KPFA 3CGEA 1FEAA 2WDRA 4ZN0A 4AOSA 4H4UA 2JB2A 4LA1A 2V3BA 1PBFA 3H8IA 1O5WA 4FK1A 4J34A 1XHCA 2WP5A 2WOIA 3GYIA 3NLCA 5GRTA 4WCTA 3UTGA 2R0PA 2CVJA 3QSEA 4GF7A 5J60A 2FJAA 4AP1A 2R4EA 5FS7A 4B66A 1NHPA 3DGHA 3UOZA 4B67A 1N4WA 4H2PA 5C2TA 2GH5A 3BI5A 5IQ1A 2OA1A 3HZLA 2BCPA 5FMHA 1PS9A 1E1MA 1GRTA 3AB1A 1F6MA 4RG3A 4REKA 4U8OA 4I59A 3QFAA 3Q9TA 4CBQA 2BS2A 1CC4A 4CCQA 1JRYA 1ZK7A 3GD4A 1W4XA 2Q7VA 4I58A 4YT0A 1D7YA 3GD3A 1NG4A 4UP3A 4YWOA 1NPXA 4Z2UA 2YR6A 2C3CA 3LJPA 2BYBA 4H2QA 4RSLA 3NN0X 4BURA 1D4DA 2ZZBA 4J56A 4K7ZA 3V3NA 1L9CA 1VG0A 1AOGA 3CNSA 5JCKA 1D5TA 1TDKA 2X3NA 4U8NA 3FG2P 2YR4A 4BK2A 2X50A 1DOCA 1DNCA 4YXDA 5L46A 1X31B 4DSGA 4YTPA 2XVEA 3SQPA 5HY5A 1OJAA 1BGNA 1H86A 2EQ7A 3T37A 5HHFA 4A99A 2JB1A 4DGKA 2R0CA 2XVIA 1LPFA 2WOVA 2QA2A 4EIPA 2XFNA 1NDAA 3K30A 3EPTA 1E1NA 1LVLA 2GR1A 4TM4A 5JCLA 3LADA 1F3PA 1Y56B 2GEWA 2YG6A 3V76A 3QVRA 1IUXA 1CHUA 2ZZCA 2YVGA 4H4WA 3GDPA 4H4RA 3ALLA 1E6EA 2V6OA 3NK1X 3VRAA 1PBBA 3CGCA 1DOBA 3CGBA 3NRNA 1BZLA 4X9NA 4XXGA 1K0JA 2XDOA 3BNMA 3LZWA 4B63A 2BACA 1JRXA 1FOHA 1JU2A 4H4PA 5KVHA 2A87A 4DSHA 2GMJA 3FBSA 3BI2A 1BGJA 3CNPA 1YQ4A 3ZYXA 3CNDA 2BABA 4Y4LA 3GDNA 2WEUA 1L9EA 3JSKA 2GRTA 2B9XA 3AYJA 2BXSA 3M13A 3O0HA 2A89A 3KVEA 1N1PA 4C77A 2FJBA 3AE5A 1XANA 4YKGA 1GRBA 3NN6X 1H7XA 2W0HA 4A7AA 3UKPA 5KRQA 2GR0A 3UP4A 1ZX9A 2XVFA 2WOWA 4A65A 4TLZA 1E1KA 3P1WA 4H4ZA 4C3YA 3ATRA 1KSSA 1VDCA 3DJJA 1O95A 3QSSA 3LZXA 2EQ6A 3GWDA 1KFYA 1QLBA 3F8DA 1PN0A 2C3DA 2X8CA 4H4VA 1DODA 4NTCA 3ABVA 2IIDA 3P4PA 3V3OA 1KF6A 2WBAA 3NG7X 2VZ2A 3IWAA 1ZMCA 1GRAA 4KX6A 3AE1A 1S3EA 2BS4A 5J7XA 1DJQA 1JOAA 1M6IA 2APGA 2Z5YA 1DJNA 1D4EA 4KPRA 2OAMA 1GRFA 2BC1A 2VQ7A 1IUUA 1PBCA 2GR3A 3COXA 4B68A 2RGOA 5M10A 4FX9A 2WS3A 4GCMA 4U8PA 3EAOA 2XFQA 3AE4A 5KXJA 3VR9A 3C4AA 3UOYA 1NG3A 4TM1A 4M52A 4C3XA 2BCGG 3AE6A 2QCUA 2WPCA 2YVJA 3UKHA 1CF3A 2GB0A 2NPXA 2XVJA 2JBVA 3ALMA 3D1CA 2GF3A 3KA7A 5ER0A 4U8LA 2YG5A 5JCNA 3QSMA 1SEZA 4P9SA 1F8RA 1H7WA 1JNRA 1ZKQA 2YQUA 3UKFA 4Z2RA 3E1TA 1D4CA 1IUVA 4USQA 3VR8A 4E0VA 5IQ4A 1MXTA 4O5UA 2GV8A 1YQZA 1RSGA 2YG4A 3I6DA 4JNAA 2BA9A 3BNUA 4AP3A 2FJDA 1LV0A 3DGZA 2XCGA 2BK5A 1GRGA 2WPFA 4YSYA 2PHHA 2WP9A 2JK6A 1TYTA 4NEWA 4EM4A 2XLUA 2GR2A 2RGJA 3SGLA 1CL0A 2Q0LA 1GETA 3NYFA 1QO8A 2YLXA 4YSXA 4FK1C 1ELIA 3AE3A 3KLJA 5U1OA 2ZZ0A 3S5WA 1PJ7A 5KOXA 1CJ4A 1PJ5A 5HXIA 3DK8A 4Z26A 2XYOA 1OJCA 4O5QA 1TDEA 4EMWA 3CNJA 1EL9A 1QJDA 4XWRA 1NENA 4J2WA 3NTAA 3L1RA 1E7PA 2DKIA 2VRLA 3F8RA 1RP0A 3RP8A 1VQWA 2WDVA 2ZBWA 2BS3A 2VQBA 5EB5A 4Z43A 5HYMA 2GVCA 4X4JA 5BRTA 4ECHA 4K8DA 1E1LA 1ZOVA 2BC0A 1DXLA 4K5SA 3QVPA 3RP6A 4Z25A 3OC4A 1L0VA 2CFYA 4K5RA 2AQJA 2Y6QA 4RG4A 4A9WA 4JN9A 1GT8A 2C66A 1RYIA 1NHQA 4JY2A 1H81A 1MOKA 1IUTA 1UKVG 2IVDA 2XLRA 3BI4A 1K4QA 2VVLA 2X8GA 2QAEA 5DBJA 3UKAA 1S3BA 3C4NA 3UTEA 3NHOX 1DOEA 3M0OA 4IVMB 3P4SA 2AAQA 3CGDA 4GDPA 4Y4NA 2FJEA 5CQFA 4UDRA 2VOUA 1COYA 3SFDA 3H4KA 1Q1WA 4U8JA 4YKFA 2OLNA 3S61A 3IC9A 4H7UA 1CC2A 1LJ1A 2JKCA 3CTYA 2A8XA 4FDCB 2YWLA 3LOVA 5JCIA 1TYPA 1PXAA 3AECA 4OPDA 5EB4A 4GR1A 1HYUA 2WU5A 4EQXA 4Z2TA 4GDEA 2B7RA 1L9DA 2C76A 2F5ZA 2NVKX 2C64A 3VRDB 1PJ6A 2AR8A 3WE0A 1GERA 3NNEA 3NH3X 4BJYA 1PXBA 1Y0PA 2C65A 3AXBA 3L8KA 5KVIA 3GSIA 2YR5A 3DJGX 2H88A 4HB9A 4APNA 3P4RA 4U2TA 1GSNA 4U2LA 1ZMDA 3REDA 1GV4A 3FMWA 2ARDA 3G5QA 1GXFA 4A6NB 3KD9A 1CJ3A 2VVLG 2C70A 1NHRA 2XFOA 2GAHB 4X9MA 3NTDA 1ZDLA 4H4YA 3II4A 3GRSA 1EL8A 1NHSA 4EIQA 1GEUA 3D8XA 1B5QA 1FCDA 2J3NA 2V60A 4Y4MA 1PDHA 1CJ2A 3CPIG 5BUKA 1H6VA 3KKJA 4CCRA 2GQFA 3CPJG 2GAGB 1LQUA 5GSNA 4DNAA 1BKWA 4ICYA 3AE2A 4H4SA 2E5VA 1VRQB 4OCGA 2H89A 3BHKA 1B8SA 2ACZA 1GTHA 3DJEA 1EL7A 3VRBA 1OJTA 1PXCA 3GMCA 3VQRA 1S2YA 1OJ9A 2WDQA 2WPEA 3NK0X 1JEHA 2Q6UA 4EMIA 1O94A 3UKLA 4BK1A 3AYIA 3B3RA 4OPUA 2TPRA 4OPIA 3F8PA 2R4JA 3AD7B 3DH9A 3FPZA 4J57A 1LQTA 1Y56A 1IJHA 3OZ2A 3P4QA 2I0ZA 1TDOA 4CNJA 4B69A 3CN8A 1H83A 3ICSA 3K7TA 4H50A 3G5SA 4K22A 5BULA 2BXRA 2R0GA 2XLSA 3NKSA 4BV6A 1CJCA 1LTXR 2Z5XA 2X8HA 2EQ8A 1GOSA 5FS9A 5FS8A 4AT0A 2YLZA 3ISHA 3UOVA 3AWIA 3DK4A 2CDUA 1REOA 3SM8A 3K7QX 4B65A 1KNRA 4H4XA 2Q0KA 2R9ZA 4IVOB 1TDFA 2B9YA 4A79A 3AEBA 1VG9A 1FECA 4IV9A 3NT6A 4OVIA 4B64A 3ICRA 4EM3A 2WU2A 5CKUA 2YM1A 1GRHA 3CIRA 3LB8A 3G5RA 4EQRA 3AEAA 4CNKA 3GWFA 4OPCA 3ATQA 3UKKA 4H2RA 2C73A 2TMDA 3KU9A 4PABA 4D04A 2YLWA 1ZP0A 4TLXA 1F8SA 3P9UA 4HA6A 4AT2A 1IUWA 2WETA 4OPTA 3DJDA 4JQ9A 2BK4A 4J36A 2XFPA 1Q9IA 2OALA 3UCLA 4H4QA 3PS9A 1YKJA 2C75A 1JNZA 2RGHA 4H2NA 1H84A 4NEVA 4C5OA 1EBDA 2YLSA 3UP5A 5JCMA 3NK2X 5C3JA 2FBWA 3H8LA 3UKQA 5IPYA 3GMBA 3GRTA 4C74A 3AEFA 3M12A 5U63A 1IUSA 1K0IA 2WESA 3NIXA 5FS6A 3IHMA 2YLTA 2O9ZA 1GNDA 2IVEA 3GYJA 1GPEA 4LIIA 3AE8A 1TDNA 3ALJA 3NGCX 1MO9A 1PHHA 4A5LA 3I3LA 1NAAA 2C72A 2YG3A 3EANA 1S2QA 3EF6A 1ONFA 3RNMA 4A6NA 2V5ZA 1B4VA 4N9XA 1GESA 1N4VA 5U25A 3ICTA 4U8MA 2PYXA 1GTEA 2B7SA 3NYCA 3UTHA 2DKHA 4NTDA 1D7LA 4H4TA 3RP7A 2GMHA 3BHFA 4NTEA 3ADAB 4IA5A 4JY3A 2YLRA 3SFEA 2WQYA 5BVAA 4CRTA 4JNQA 2RABA 3DMEA 5KWFA 4GUVA 2XFUA 3UOXA 1P2HA 3RHAA 4U2SA 2WHDA 1GALA 2GQWA 3AEDA 4YTMA 3DK9A 3AEGA 2B76A 2E4GA 3B6DA 2C7GA 2XVHA 1BWCA 1KNPA 1P2EA 3UTFA 2XLPA 4XWZA 1XPQA 1TRBA 3QFBA 1Q1RA 5KOWA 3ITJA 4EQWA 1BF3A 2QA1A 2Y6RA 1PBEA 4IA6A 2VVMA 5EBKA 4EQSA 2R46A
chains in the Genus database with same CATH superfamily
2UZZA 4OPGA 3K7MX 4JDRA 3IF9A 2E1MA 3GYXA 4YSZA 4U8KA 1CBOA 3FIMB 3LXDA 4B1BA 1Z6LA 2YG7A 1F8WA 4J31A 1M64A 3AE7A 4TM3A 5M0ZA 2V61A 4UDQA 4CY6A 3AD8B 4OPLA 1E39A 4UDPA 4CY8A 1KSUA 2YVFA 2V3AA 2YM2A 2EQ9A 2WP6A 3PO7A 1GREA 3Q6JA 2XLTA 5TR3A 1KDGA 4WX1A 1N4UA 4ZCDA 4USRA 4ADWA 4AOXA 4BJZA 3DA1A 3QJ4A 4Z24A 4YSHA 1K0LA 4NZHA 2B9WA 4D03A 3IHGA 3SX6A 4EMJA 1XDIA 2R45A 1ZY8A 3AYLA 1V59A 4J33A 5EOWA 5LV9A 1FEBA 4PAAA 2BK3A 3CPHG 4ZCCA 2OLOA 1YY5A 3NYEA 2VRMA 4GRTA 2X99A 4Z44A 4K2XA 2YAUA 4BK3A 4TM0A 1OJDA 3AD9B 1B37A 1ZOYA 3AE9A 1H82A 1FL2A 1JRZA 1YQ3A 2C67A 4MJWA 2HQMA 3AEEA 3C96A 2JB3A 2JAEA 1NEKA 4U8IA 1EL5A 3ZDNA 4LU6A 3URHA 1PBDA 1CC6A 3CNTA 2CULA 3PVCA 3R9UA 4YTNA 3KPFA 3CGEA 1FEAA 2WDRA 4ZN0A 4AOSA 4H4UA 2JB2A 4LA1A 2V3BA 1PBFA 3H8IA 1O5WA 4FK1A 4J34A 1XHCA 2WP5A 2WOIA 3GYIA 3NLCA 5GRTA 4WCTA 3UTGA 2R0PA 2CVJA 3QSEA 4GF7A 5J60A 2FJAA 4AP1A 2R4EA 5FS7A 4B66A 1NHPA 3DGHA 3UOZA 4B67A 1N4WA 4H2PA 5C2TA 2GH5A 3BI5A 5IQ1A 2OA1A 3HZLA 2BCPA 5FMHA 1PS9A 1E1MA 1GRTA 3AB1A 1F6MA 4RG3A 4REKA 4U8OA 4I59A 3QFAA 3Q9TA 4GAPA 4CBQA 2BS2A 1CC4A 4CCQA 1JRYA 1ZK7A 3GD4A 1W4XA 4G9KA 2Q7VA 4I58A 4YT0A 1D7YA 3GD3A 1NG4A 4UP3A 4YWOA 1NPXA 4Z2UA 2YR6A 2C3CA 3LJPA 3T14A 2BYBA 4H2QA 4RSLA 3NN0X 4BURA 1D4DA 2ZZBA 4J56A 4K7ZA 3V3NA 1L9CA 1VG0A 1AOGA 3CNSA 5JCKA 1D5TA 1TDKA 2X3NA 4U8NA 3FG2P 2YR4A 4BK2A 2X50A 1DOCA 1DNCA 4YXDA 5L46A 1X31B 4DSGA 4YTPA 2XVEA 3SQPA 5HY5A 1OJAA 5KNLA 1BGNA 1H86A 2EQ7A 4G6GA 5HHFA 3T37A 4A99A 2JB1A 4DGKA 2R0CA 2XVIA 1LPFA 2WOVA 2QA2A 4EIPA 2XFNA 1NDAA 3K30A 3EPTA 1E1NA 1LVLA 2GR1A 4TM4A 5JCLA 3LADA 1F3PA 1Y56B 2GEWA 2YG6A 3V76A 3QVRA 1IUXA 1CHUA 2ZZCA 2YVGA 4H4WA 3SZ0A 3GDPA 4H4RA 3ALLA 5KMPA 1E6EA 2V6OA 3NK1X 3VRAA 1PBBA 3CGCA 1DOBA 3CGBA 3NRNA 1BZLA 4X9NA 4XXGA 1K0JA 2XDOA 3BNMA 3LZWA 4B63A 2BACA 1JRXA 1FOHA 1JU2A 4H4PA 3T0KA 5KVHA 2A87A 4DSHA 2GMJA 3FBSA 3BI2A 1BGJA 3CNPA 1YQ4A 3ZYXA 3CNDA 2BABA 4Y4LA 3GDNA 2WEUA 1L9EA 3JSKA 2GRTA 2B9XA 3AYJA 2BXSA 3M13A 3O0HA 2A89A 3KVEA 3T2ZA 1N1PA 4C77A 2FJBA 3AE5A 1XANA 3T2YA 4YKGA 1GRBA 3NN6X 1H7XA 2W0HA 4A7AA 3UKPA 5KRQA 2GR0A 3UP4A 1ZX9A 2XVFA 2WOWA 4A65A 4TLZA 1E1KA 3P1WA 4H4ZA 4C3YA 3ATRA 1KSSA 1VDCA 3DJJA 1O95A 3QSSA 3LZXA 2EQ6A 3GWDA 1KFYA 1QLBA 3F8DA 1PN0A 2C3DA 2X8CA 4H4VA 1DODA 4NTCA 3ABVA 2IIDA 3P4PA 3V3OA 1KF6A 2WBAA 3NG7X 2VZ2A 3IWAA 1ZMCA 1GRAA 4KX6A 4G73A 3AE1A 1S3EA 2BS4A 5J7XA 1DJQA 4G74A 1JOAA 1M6IA 2APGA 2Z5YA 1DJNA 4II3A 1D4EA 4KPRA 2OAMA 1GRFA 2BC1A 2VQ7A 1IUUA 1PBCA 2GR3A 3COXA 4B68A 2RGOA 5M10A 4FX9A 2WS3A 4GCMA 4U8PA 3EAOA 2XFQA 3AE4A 5KXJA 3VR9A 3C4AA 3UOYA 1NG3A 4TM1A 4M52A 4C3XA 2BCGG 3AE6A 2QCUA 2WPCA 2YVJA 3UKHA 1CF3A 2GB0A 2NPXA 2XVJA 2JBVA 3ALMA 3D1CA 2GF3A 3KA7A 4G6HA 5ER0A 4U8LA 2YG5A 5JCNA 3QSMA 1SEZA 4P9SA 1F8RA 1H7WA 1JNRA 1ZKQA 2YQUA 3UKFA 4Z2RA 3E1TA 1D4CA 1IUVA 4USQA 3VR8A 4E0VA 5IQ4A 1MXTA 4O5UA 1YQZA 1RSGA 2GV8A 2YG4A 3I6DA 4JNAA 2BA9A 3BNUA 4AP3A 2FJDA 1LV0A 3DGZA 2XCGA 2BK5A 1GRGA 2WPFA 4YSYA 2PHHA 2WP9A 2JK6A 1TYTA 4NEWA 5KMSA 4EM4A 2XLUA 2GR2A 2RGJA 3SGLA 1CL0A 2Q0LA 1GETA 3NYFA 1QO8A 2YLXA 4YSXA 4FK1C 1ELIA 3SZFA 3AE3A 3KLJA 5U1OA 2ZZ0A 3S5WA 1PJ7A 5KOXA 1CJ4A 3KPKA 1PJ5A 5HXIA 3DK8A 4Z26A 2XYOA 1OJCA 4O5QA 1TDEA 4EMWA 3CNJA 1EL9A 1QJDA 4XWRA 1NENA 4J2WA 3NTAA 3HYXA 3L1RA 1E7PA 2DKIA 2VRLA 3F8RA 1RP0A 3RP8A 1VQWA 5KMQA 2WDVA 2ZBWA 2BS3A 2VQBA 5EB5A 4Z43A 5HYMA 2GVCA 4X4JA 5BRTA 4ECHA 4K8DA 1E1LA 1ZOVA 2BC0A 1DXLA 4K5SA 3QVPA 3RP6A 4Z25A 3OC4A 1L0VA 2CFYA 4K5RA 2AQJA 2Y6QA 4RG4A 4A9WA 4JN9A 1GT8A 2C66A 1RYIA 1NHQA 4JY2A 1H81A 1MOKA 1IUTA 1UKVG 2IVDA 2XLRA 3BI4A 1K4QA 2VVLA 2X8GA 2QAEA 5DBJA 3UKAA 1S3BA 3C4NA 3UTEA 3NHOX 1DOEA 3M0OA 4IVMB 3P4SA 2AAQA 3CGDA 4GDPA 3T2KA 4NWZA 4Y4NA 3HYWA 2FJEA 5CQFA 4UDRA 2VOUA 1COYA 3SFDA 3H4KA 1Q1WA 4U8JA 4YKFA 2OLNA 3S61A 3IC9A 4H7UA 1CC2A 1LJ1A 2JKCA 3CTYA 2A8XA 4FDCB 2YWLA 3LOVA 5JCIA 1TYPA 1PXAA 3AECA 4OPDA 5EB4A 4GR1A 1HYUA 2WU5A 4EQXA 4Z2TA 4GDEA 2B7RA 1L9DA 2C76A 2F5ZA 2NVKX 5KMRA 2C64A 3VRDB 1PJ6A 2AR8A 3WE0A 1GERA 3NNEA 3NH3X 4BJYA 1PXBA 1Y0PA 2C65A 3AXBA 3L8KA 5KVIA 3GSIA 2YR5A 4NNJA 3DJGX 2H88A 4HB9A 4APNA 3P4RA 2C4CA 4U2TA 1GSNA 4U2LA 1ZMDA 3REDA 1GV4A 3FMWA 2ARDA 3G5QA 1GXFA 4A6NB 3KD9A 1CJ3A 2VVLG 2C70A 1NHRA 2XFOA 2GAHB 4X9MA 3NTDA 1ZDLA 4H4YA 3II4A 3GRSA 1EL8A 1NHSA 4EIQA 1GEUA 3D8XA 1B5QA 1FCDA 2J3NA 2V60A 4Y4MA 1PDHA 1CJ2A 3CPIG 5BUKA 1H6VA 3KKJA 4CCRA 2GQFA 3CPJG 2GAGB 1LQUA 5GSNA 4DNAA 1BKWA 4ICYA 3AE2A 4H4SA 2E5VA 1VRQB 4OCGA 2H89A 3BHKA 1B8SA 2ACZA 1GTHA 3CMMA 3DJEA 1EL7A 3VRBA 1OJTA 1PXCA 3GMCA 3VQRA 1S2YA 1OJ9A 2WDQA 2WPEA 3NK0X 1JEHA 2Q6UA 4GAVA 4EMIA 1O94A 3UKLA 4BK1A 3AYIA 3B3RA 4OPUA 2TPRA 4OPIA 3F8PA 2R4JA 3AD7B 3DH9A 3FPZA 4J57A 1LQTA 1Y56A 1IJHA 3OZ2A 3P4QA 2I0ZA 1TDOA 3SZCA 4CNJA 4B69A 3CN8A 1H83A 3ICSA 3K7TA 4H50A 3G5SA 4K22A 5BULA 2BXRA 2R0GA 2XLSA 3NKSA 4BV6A 1CJCA 1LTXR 2Z5XA 2X8HA 2EQ8A 1GOSA 3SXIA 5FS9A 5FS8A 4AT0A 2YLZA 3ISHA 3UOVA 3AWIA 3DK4A 2CDUA 1REOA 3SM8A 3K7QX 4B65A 1KNRA 4H4XA 2Q0KA 2R9ZA 4IVOB 1TDFA 2B9YA 4A79A 2BRYA 3AEBA 1VG9A 1FECA 4IV9A 3NT6A 4OVIA 4B64A 3ICRA 4EM3A 2WU2A 5CKUA 2YM1A 1GRHA 3CIRA 3LB8A 3G5RA 4EQRA 3AEAA 4CNKA 2BRAA 3GWFA 4OPCA 3ATQA 3UKKA 4H2RA 2C73A 2TMDA 3KU9A 4PABA 4D04A 2YLWA 1ZP0A 4TLXA 1F8SA 3P9UA 4HA6A 3SY4A 4AT2A 1IUWA 2WETA 4OPTA 3DJDA 4JQ9A 2BK4A 4J36A 2XFPA 1Q9IA 2OALA 3UCLA 4H4QA 3PS9A 1YKJA 2C75A 1JNZA 2RGHA 4H2NA 1H84A 4NEVA 4C5OA 1EBDA 2YLSA 3UP5A 5JCMA 3NK2X 5C3JA 2FBWA 3H8LA 3UKQA 5IPYA 3GMBA 3GRTA 4C74A 3AEFA 3M12A 5U63A 1IUSA 3SYIA 1K0IA 2WESA 3NIXA 5FS6A 3IHMA 2YLTA 2O9ZA 4II2A 1GNDA 2IVEA 3GYJA 1GPEA 4LIIA 3AE8A 1TDNA 3ALJA 3NGCX 1MO9A 1PHHA 4A5LA 3I3LA 1NAAA 2C72A 2YG3A 3EANA 1S2QA 3EF6A 1ONFA 3RNMA 4A6NA 2V5ZA 1B4VA 4N9XA 1GESA 1N4VA 3HYVA 3T31A 5U25A 3ICTA 4U8MA 2PYXA 1GTEA 2B7SA 3NYCA 3UTHA 2DKHA 4NTDA 1D7LA 4H4TA 3RP7A 2GMHA 3BHFA 4NTEA 3ADAB 4IA5A 4JY3A 2YLRA 3SFEA 2WQYA 5BVAA 4CRTA 4JNQA 2RABA 3DMEA 5KWFA 4GUVA 2XFUA 3UOXA 1P2HA 3RHAA 4U2SA 2WHDA 1GALA 2GQWA 3AEDA 4YTMA 3DK9A 3AEGA 2B76A 2E4GA 3B6DA 2C7GA 2XVHA 1BWCA 1KNPA 1P2EA 3UTFA 2XLPA 4XWZA 1XPQA 1TRBA 3QFBA 1Q1RA 5KOWA 3ITJA 4EQWA 1BF3A 2QA1A 2Y6RA 1PBEA 4IA6A 2VVMA 5EBKA 4EQSA 3SZWA 2R46A
chains in the Genus database with same CATH topology
2UZZA 4OPGA 3K7MX 4JDRA 3IF9A 2E1MA 3GYXA 4YSZA 4U8KA 1CBOA 3FIMB 3LXDA 4B1BA 1Z6LA 2YG7A 1F8WA 4J31A 1M64A 3AE7A 4TM3A 5M0ZA 2V61A 4UDQA 4CY6A 3AD8B 4OPLA 1E39A 4UDPA 4CY8A 1KSUA 2YVFA 2V3AA 2YM2A 2EQ9A 2WP6A 3PO7A 1GREA 3Q6JA 2XLTA 5TR3A 1KDGA 4WX1A 1N4UA 4ZCDA 4USRA 4ADWA 4AOXA 4BJZA 3DA1A 3QJ4A 4Z24A 4YSHA 1K0LA 4NZHA 2B9WA 4D03A 3IHGA 3SX6A 4EMJA 1XDIA 2R45A 1ZY8A 3AYLA 1V59A 4J33A 5EOWA 5LV9A 1FEBA 4PAAA 2BK3A 3CPHG 4ZCCA 2OLOA 1YY5A 3NYEA 2VRMA 4GRTA 2X99A 4Z44A 4K2XA 2YAUA 4BK3A 4TM0A 1OJDA 3AD9B 1B37A 1ZOYA 3AE9A 1H82A 1FL2A 1JRZA 1YQ3A 2C67A 4MJWA 2HQMA 3AEEA 3C96A 2JB3A 2JAEA 1NEKA 4U8IA 1EL5A 3ZDNA 4LU6A 3URHA 1PBDA 1CC6A 3CNTA 2CULA 3PVCA 3R9UA 4YTNA 3KPFA 3CGEA 1FEAA 2WDRA 4ZN0A 4AOSA 4H4UA 2JB2A 4LA1A 2V3BA 1PBFA 3H8IA 1O5WA 4FK1A 4J34A 1XHCA 2WP5A 2WOIA 3GYIA 3NLCA 5GRTA 4WCTA 3UTGA 2R0PA 2CVJA 3QSEA 4GF7A 5J60A 2FJAA 4AP1A 2R4EA 5FS7A 4B66A 1NHPA 3DGHA 3UOZA 4B67A 1N4WA 4H2PA 5C2TA 2GH5A 3BI5A 5IQ1A 2OA1A 3HZLA 2BCPA 5FMHA 1PS9A 1E1MA 1GRTA 3AB1A 1F6MA 4RG3A 4REKA 4U8OA 4I59A 3QFAA 3Q9TA 4GAPA 4CBQA 2BS2A 1CC4A 4CCQA 1JRYA 1ZK7A 3GD4A 1W4XA 4G9KA 2Q7VA 4I58A 4YT0A 1D7YA 3GD3A 1NG4A 4UP3A 4YWOA 1NPXA 4Z2UA 2YR6A 2C3CA 3LJPA 3T14A 2BYBA 4H2QA 4RSLA 3NN0X 4BURA 1D4DA 2ZZBA 4J56A 4K7ZA 3V3NA 1L9CA 1VG0A 1AOGA 3CNSA 5JCKA 1D5TA 1TDKA 2X3NA 4U8NA 3FG2P 2YR4A 4BK2A 2X50A 1DOCA 1DNCA 4YXDA 5L46A 1X31B 4DSGA 4YTPA 2XVEA 3SQPA 5HY5A 1OJAA 5KNLA 1BGNA 1H86A 2EQ7A 4G6GA 5HHFA 3T37A 4A99A 2JB1A 4DGKA 2R0CA 2XVIA 1LPFA 2WOVA 2QA2A 4EIPA 2XFNA 1NDAA 3K30A 3EPTA 1E1NA 1LVLA 2GR1A 4TM4A 5JCLA 3LADA 1F3PA 1Y56B 2GEWA 2YG6A 3V76A 3QVRA 1IUXA 1CHUA 2ZZCA 2YVGA 4H4WA 3SZ0A 3GDPA 4H4RA 3ALLA 5KMPA 1E6EA 2V6OA 3NK1X 3VRAA 1PBBA 3CGCA 1DOBA 3CGBA 3NRNA 1BZLA 4X9NA 4XXGA 1K0JA 2XDOA 3BNMA 3LZWA 4B63A 2BACA 1JRXA 1FOHA 1JU2A 4H4PA 3T0KA 5KVHA 2A87A 4DSHA 2GMJA 3FBSA 3BI2A 1BGJA 3CNPA 1YQ4A 3ZYXA 3CNDA 2BABA 4Y4LA 3GDNA 2WEUA 1L9EA 3JSKA 2GRTA 2B9XA 3AYJA 2BXSA 3M13A 3O0HA 2A89A 3KVEA 3T2ZA 1N1PA 4C77A 2FJBA 3AE5A 1XANA 3T2YA 4YKGA 1GRBA 3NN6X 1H7XA 2W0HA 4A7AA 3UKPA 5KRQA 2GR0A 3UP4A 1ZX9A 2XVFA 2WOWA 4A65A 4TLZA 1E1KA 3P1WA 4H4ZA 4C3YA 3ATRA 1KSSA 1VDCA 3DJJA 1O95A 3QSSA 3LZXA 2EQ6A 3GWDA 1KFYA 1QLBA 3F8DA 1PN0A 2C3DA 2X8CA 4H4VA 1DODA 4NTCA 3ABVA 2IIDA 3P4PA 3V3OA 1KF6A 2WBAA 3NG7X 2VZ2A 3IWAA 1ZMCA 1GRAA 4KX6A 4G73A 3AE1A 1S3EA 2BS4A 5J7XA 1DJQA 4G74A 1JOAA 1M6IA 2APGA 2Z5YA 1DJNA 4II3A 1D4EA 4KPRA 2OAMA 1GRFA 2BC1A 2VQ7A 1IUUA 1PBCA 2GR3A 3COXA 4B68A 2RGOA 5M10A 4FX9A 2WS3A 4GCMA 4U8PA 3EAOA 2XFQA 3AE4A 5KXJA 3VR9A 3C4AA 3UOYA 1NG3A 4TM1A 4M52A 4C3XA 2BCGG 3AE6A 2QCUA 2WPCA 2YVJA 3UKHA 1CF3A 2GB0A 2NPXA 2XVJA 2JBVA 3ALMA 3D1CA 2GF3A 3KA7A 4G6HA 5ER0A 4U8LA 2YG5A 5JCNA 3QSMA 1SEZA 4P9SA 1F8RA 1H7WA 1JNRA 1ZKQA 2YQUA 3UKFA 4Z2RA 3E1TA 1D4CA 1IUVA 4USQA 3VR8A 4E0VA 5IQ4A 1MXTA 4O5UA 1YQZA 1RSGA 2GV8A 2YG4A 3I6DA 4JNAA 2BA9A 3BNUA 4AP3A 2FJDA 1LV0A 3DGZA 2XCGA 2BK5A 1GRGA 2WPFA 4YSYA 2PHHA 2WP9A 2JK6A 1TYTA 4NEWA 5KMSA 4EM4A 2XLUA 2GR2A 2RGJA 3SGLA 1CL0A 2Q0LA 1GETA 3NYFA 1QO8A 2YLXA 4YSXA 4FK1C 1ELIA 3SZFA 3AE3A 3KLJA 5U1OA 2ZZ0A 3S5WA 1PJ7A 5KOXA 1CJ4A 3KPKA 1PJ5A 5HXIA 3DK8A 4Z26A 2XYOA 1OJCA 4O5QA 1TDEA 4EMWA 3CNJA 1EL9A 1QJDA 4XWRA 1NENA 4J2WA 3NTAA 3HYXA 3L1RA 1E7PA 2DKIA 2VRLA 3F8RA 1RP0A 3RP8A 1VQWA 5KMQA 2WDVA 2ZBWA 2BS3A 2VQBA 5EB5A 4Z43A 5HYMA 2GVCA 4X4JA 5BRTA 4ECHA 4K8DA 1E1LA 1ZOVA 2BC0A 1DXLA 4K5SA 3QVPA 3RP6A 4Z25A 3OC4A 1L0VA 2CFYA 4K5RA 2AQJA 2Y6QA 4RG4A 4A9WA 4JN9A 1GT8A 2C66A 1RYIA 1NHQA 4JY2A 1H81A 1MOKA 1IUTA 1UKVG 2IVDA 2XLRA 3BI4A 1K4QA 2VVLA 2X8GA 2QAEA 5DBJA 3UKAA 1S3BA 3C4NA 3UTEA 3NHOX 1DOEA 3M0OA 4IVMB 3P4SA 2AAQA 3CGDA 4GDPA 3T2KA 4NWZA 4Y4NA 3HYWA 2FJEA 5CQFA 4UDRA 2VOUA 1COYA 3SFDA 3H4KA 1Q1WA 4U8JA 4YKFA 2OLNA 3S61A 3IC9A 4H7UA 1CC2A 1LJ1A 2JKCA 3CTYA 2A8XA 4FDCB 2YWLA 3LOVA 5JCIA 1TYPA 1PXAA 3AECA 4OPDA 5EB4A 4GR1A 1HYUA 2WU5A 4EQXA 4Z2TA 4GDEA 2B7RA 1L9DA 2C76A 2F5ZA 2NVKX 5KMRA 2C64A 3VRDB 1PJ6A 2AR8A 3WE0A 1GERA 3NNEA 3NH3X 4BJYA 1PXBA 1Y0PA 2C65A 3AXBA 3L8KA 5KVIA 3GSIA 2YR5A 4NNJA 3DJGX 2H88A 4HB9A 4APNA 3P4RA 2C4CA 4U2TA 1GSNA 4U2LA 1ZMDA 3REDA 1GV4A 3FMWA 2ARDA 3G5QA 1GXFA 4A6NB 3KD9A 1CJ3A 2VVLG 2C70A 1NHRA 2XFOA 2GAHB 4X9MA 3NTDA 1ZDLA 4H4YA 3II4A 3GRSA 1EL8A 1NHSA 4EIQA 1GEUA 3D8XA 1B5QA 1FCDA 2J3NA 2V60A 4Y4MA 1PDHA 1CJ2A 3CPIG 5BUKA 1H6VA 3KKJA 4CCRA 2GQFA 3CPJG 2GAGB 1LQUA 5GSNA 4DNAA 1BKWA 4ICYA 3AE2A 4H4SA 2E5VA 1VRQB 4OCGA 2H89A 3BHKA 1B8SA 2ACZA 1GTHA 3CMMA 3DJEA 1EL7A 3VRBA 1OJTA 1PXCA 3GMCA 3VQRA 1S2YA 1OJ9A 2WDQA 2WPEA 3NK0X 1JEHA 2Q6UA 4GAVA 4EMIA 1O94A 3UKLA 4BK1A 3AYIA 3B3RA 4OPUA 2TPRA 4OPIA 3F8PA 2R4JA 3AD7B 3DH9A 3FPZA 4J57A 1LQTA 1Y56A 1IJHA 3OZ2A 3P4QA 2I0ZA 1TDOA 3SZCA 4CNJA 4B69A 3CN8A 1H83A 3ICSA 3K7TA 4H50A 3G5SA 4K22A 5BULA 2BXRA 2R0GA 2XLSA 3NKSA 4BV6A 1CJCA 1LTXR 2Z5XA 2X8HA 2EQ8A 1GOSA 3SXIA 5FS9A 5FS8A 4AT0A 2YLZA 3ISHA 3UOVA 3AWIA 3DK4A 2CDUA 1REOA 3SM8A 3K7QX 4B65A 1KNRA 4H4XA 2Q0KA 2R9ZA 4IVOB 1TDFA 2B9YA 4A79A 2BRYA 3AEBA 1VG9A 1FECA 4IV9A 3NT6A 4OVIA 4B64A 3ICRA 4EM3A 2WU2A 5CKUA 2YM1A 1GRHA 3CIRA 3LB8A 3G5RA 4EQRA 3AEAA 4CNKA 2BRAA 3GWFA 4OPCA 3ATQA 3UKKA 4H2RA 2C73A 2TMDA 3KU9A 4PABA 4D04A 2YLWA 1ZP0A 4TLXA 1F8SA 3P9UA 4HA6A 3SY4A 4AT2A 1IUWA 2WETA 4OPTA 3DJDA 4JQ9A 2BK4A 4J36A 2XFPA 1Q9IA 2OALA 3UCLA 4H4QA 3PS9A 1YKJA 2C75A 1JNZA 2RGHA 4H2NA 1H84A 4NEVA 4C5OA 1EBDA 2YLSA 3UP5A 5JCMA 3NK2X 5C3JA 2FBWA 3H8LA 3UKQA 5IPYA 3GMBA 3GRTA 4C74A 3AEFA 3M12A 5U63A 1IUSA 3SYIA 1K0IA 2WESA 3NIXA 5FS6A 3IHMA 2YLTA 2O9ZA 4II2A 1GNDA 2IVEA 3GYJA 1GPEA 4LIIA 3AE8A 1TDNA 3ALJA 3NGCX 1MO9A 1PHHA 4A5LA 3I3LA 1NAAA 2C72A 2YG3A 3EANA 1S2QA 3EF6A 1ONFA 3RNMA 4A6NA 2V5ZA 1B4VA 4N9XA 1GESA 1N4VA 3HYVA 3T31A 5U25A 3ICTA 4U8MA 2PYXA 1GTEA 2B7SA 3NYCA 3UTHA 2DKHA 4NTDA 1D7LA 4H4TA 3RP7A 2GMHA 3BHFA 4NTEA 3ADAB 4IA5A 4JY3A 2YLRA 3SFEA 2WQYA 5BVAA 4CRTA 4JNQA 2RABA 3DMEA 5KWFA 4GUVA 2XFUA 3UOXA 1P2HA 3RHAA 4U2SA 2WHDA 1GALA 2GQWA 3AEDA 4YTMA 3DK9A 3AEGA 2B76A 2E4GA 3B6DA 2C7GA 2XVHA 1BWCA 1KNPA 1P2EA 3UTFA 2XLPA 4XWZA 1XPQA 1TRBA 3QFBA 1Q1RA 5KOWA 3ITJA 4EQWA 1BF3A 2QA1A 2Y6RA 1PBEA 4IA6A 2VVMA 5EBKA 4EQSA 3SZWA 2R46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZZ A;  4OPG A;  3K7M X;  4JDR A;  3IF9 A;  2E1M A;  4YSZ A;  4U8K A;  1CBO A;  3FIM B;  3LXD A;  4B1B A;  1Z6L A;  2YG7 A;  1F8W A;  4J31 A;  1M64 A;  3AE7 A;  4TM3 A;  5M0Z A;  2V61 A;  4UDQ A;  4CY6 A;  3AD8 B;  4OPL A;  1E39 A;  4UDP A;  4CY8 A;  1KSU A;  2YVF A;  2V3A A;  2YM2 A;  2EQ9 A;  2WP6 A;  3PO7 A;  1GRE A;  3Q6J A;  2XLT A;  5TR3 A;  1KDG A;  4WX1 A;  1N4U A;  4ZCD A;  4USR A;  4ADW A;  4AOX A;  4BJZ A;  3DA1 A;  3QJ4 A;  4Z24 A;  4YSH A;  1K0L A;  4NZH A;  2B9W A;  4D03 A;  3IHG A;  4EMJ A;  1XDI A;  2R45 A;  1ZY8 A;  3AYL A;  1V59 A;  4J33 A;  5EOW A;  5LV9 A;  1FEB A;  4PAA A;  2BK3 A;  3CPH G;  4ZCC A;  2OLO A;  1YY5 A;  3NYE A;  2VRM A;  4GRT A;  2X99 A;  4Z44 A;  4K2X A;  2YAU A;  4BK3 A;  4TM0 A;  1OJD A;  3AD9 B;  1B37 A;  1ZOY A;  3AE9 A;  1H82 A;  1FL2 A;  1JRZ A;  1YQ3 A;  2C67 A;  4MJW A;  2HQM A;  3AEE A;  3C96 A;  2JB3 A;  2JAE A;  1NEK A;  4U8I A;  1EL5 A;  3ZDN A;  4LU6 A;  3URH A;  1PBD A;  1CC6 A;  3CNT A;  2CUL A;  3PVC A;  3R9U A;  4YTN A;  3KPF A;  3CGE A;  1FEA A;  2WDR A;  4ZN0 A;  4AOS A;  4H4U A;  2JB2 A;  4LA1 A;  2V3B A;  1PBF A;  3H8I A;  1O5W A;  4FK1 A;  4J34 A;  1XHC A;  2WP5 A;  2WOI A;  3GYI A;  3NLC A;  5GRT A;  4WCT A;  3UTG A;  2R0P A;  2CVJ A;  3QSE A;  4GF7 A;  5J60 A;  2FJA A;  4AP1 A;  2R4E A;  5FS7 A;  4B66 A;  1NHP A;  3DGH A;  3UOZ A;  4B67 A;  1N4W A;  4H2P A;  5C2T A;  2GH5 A;  3BI5 A;  5IQ1 A;  2OA1 A;  3HZL A;  2BCP A;  5FMH A;  1PS9 A;  1E1M A;  1GRT A;  3AB1 A;  1F6M A;  4RG3 A;  4REK A;  4U8O A;  4I59 A;  3QFA A;  3Q9T A;  4CBQ A;  2BS2 A;  1CC4 A;  4CCQ A;  1JRY A;  1ZK7 A;  3GD4 A;  1W4X A;  2Q7V A;  4I58 A;  4YT0 A;  1D7Y A;  3GD3 A;  1NG4 A;  4UP3 A;  4YWO A;  1NPX A;  4Z2U A;  2YR6 A;  2C3C A;  3LJP A;  2BYB A;  4H2Q A;  4RSL A;  3NN0 X;  4BUR A;  1D4D A;  2ZZB A;  4J56 A;  4K7Z A;  3V3N A;  1L9C A;  1VG0 A;  1AOG A;  3CNS A;  5JCK A;  1D5T A;  1TDK A;  2X3N A;  4U8N A;  3FG2 P;  2YR4 A;  4BK2 A;  2X50 A;  1DOC A;  1DNC A;  4YXD A;  5L46 A;  1X31 B;  4DSG A;  4YTP A;  2XVE A;  3SQP A;  5HY5 A;  1OJA A;  1BGN A;  1H86 A;  2EQ7 A;  3T37 A;  5HHF A;  4A99 A;  2JB1 A;  4DGK A;  2R0C A;  2XVI A;  1LPF A;  2WOV A;  2QA2 A;  4EIP A;  2XFN A;  1NDA A;  3K30 A;  3EPT A;  1E1N A;  1LVL A;  2GR1 A;  4TM4 A;  5JCL A;  3LAD A;  1F3P A;  1Y56 B;  2GEW A;  2YG6 A;  3V76 A;  3QVR A;  1IUX A;  1CHU A;  2ZZC A;  2YVG A;  4H4W A;  3GDP A;  4H4R A;  3ALL A;  1E6E A;  2V6O A;  3NK1 X;  3VRA A;  1PBB A;  3CGC A;  1DOB A;  3CGB A;  3NRN A;  1BZL A;  4X9N A;  4XXG A;  1K0J A;  2XDO A;  3BNM A;  3LZW A;  4B63 A;  2BAC A;  1JRX A;  1FOH A;  1JU2 A;  4H4P A;  5KVH A;  2A87 A;  4DSH A;  2GMJ A;  3FBS A;  3BI2 A;  1BGJ A;  3CNP A;  1YQ4 A;  3ZYX A;  3CND A;  2BAB A;  4Y4L A;  3GDN A;  2WEU A;  1L9E A;  3JSK A;  2GRT A;  2B9X A;  3AYJ A;  2BXS A;  3M13 A;  3O0H A;  2A89 A;  3KVE A;  1N1P A;  4C77 A;  2FJB A;  3AE5 A;  1XAN A;  4YKG A;  1GRB A;  3NN6 X;  1H7X A;  2W0H A;  4A7A A;  3UKP A;  5KRQ A;  2GR0 A;  3UP4 A;  1ZX9 A;  2XVF A;  2WOW A;  4A65 A;  4TLZ A;  1E1K A;  3P1W A;  4H4Z A;  4C3Y A;  3ATR A;  1KSS A;  1VDC A;  3DJJ A;  1O95 A;  3QSS A;  3LZX A;  2EQ6 A;  3GWD A;  1KFY A;  1QLB A;  3F8D A;  1PN0 A;  2C3D A;  2X8C A;  4H4V A;  1DOD A;  4NTC A;  3ABV A;  2IID A;  3P4P A;  3V3O A;  1KF6 A;  2WBA A;  3NG7 X;  2VZ2 A;  3IWA A;  1ZMC A;  1GRA A;  4KX6 A;  3AE1 A;  1S3E A;  2BS4 A;  5J7X A;  1DJQ A;  1JOA A;  1M6I A;  2APG A;  2Z5Y A;  1DJN A;  1D4E A;  4KPR A;  2OAM A;  1GRF A;  2BC1 A;  2VQ7 A;  1IUU A;  1PBC A;  2GR3 A;  3COX A;  4B68 A;  2RGO A;  5M10 A;  4FX9 A;  2WS3 A;  4GCM A;  4U8P A;  3EAO A;  2XFQ A;  3AE4 A;  5KXJ A;  3VR9 A;  3C4A A;  3UOY A;  1NG3 A;  4TM1 A;  4M52 A;  4C3X A;  2BCG G;  3AE6 A;  2QCU A;  2WPC A;  2YVJ A;  3UKH A;  1CF3 A;  2GB0 A;  2NPX A;  2XVJ A;  2JBV A;  3ALM A;  3D1C A;  2GF3 A;  3KA7 A;  5ER0 A;  4U8L A;  2YG5 A;  5JCN A;  3QSM A;  1SEZ A;  4P9S A;  1F8R A;  1H7W A;  1JNR A;  1ZKQ A;  2YQU A;  3UKF A;  4Z2R A;  3E1T A;  1D4C A;  1IUV A;  4USQ A;  3VR8 A;  4E0V A;  5IQ4 A;  1MXT A;  4O5U A;  2GV8 A;  1YQZ A;  1RSG A;  2YG4 A;  3I6D A;  4JNA A;  2BA9 A;  3BNU A;  4AP3 A;  2FJD A;  1LV0 A;  3DGZ A;  2XCG A;  2BK5 A;  1GRG A;  2WPF A;  4YSY A;  2PHH A;  2WP9 A;  2JK6 A;  1TYT A;  4NEW A;  4EM4 A;  2XLU A;  2GR2 A;  2RGJ A;  3SGL A;  1CL0 A;  2Q0L A;  1GET A;  3NYF A;  1QO8 A;  2YLX A;  4YSX A;  4FK1 C;  1ELI A;  3AE3 A;  3KLJ A;  5U1O A;  2ZZ0 A;  3S5W A;  1PJ7 A;  5KOX A;  1CJ4 A;  1PJ5 A;  5HXI A;  3DK8 A;  4Z26 A;  2XYO A;  1OJC A;  4O5Q A;  1TDE A;  4EMW A;  3CNJ A;  1EL9 A;  1QJD A;  4XWR A;  1NEN A;  4J2W A;  3NTA A;  3L1R A;  1E7P A;  2DKI A;  2VRL A;  3F8R A;  1RP0 A;  3RP8 A;  1VQW A;  2WDV A;  2ZBW A;  2BS3 A;  2VQB A;  5EB5 A;  4Z43 A;  5HYM A;  2GVC A;  4X4J A;  5BRT A;  4ECH A;  4K8D A;  1E1L A;  1ZOV A;  2BC0 A;  1DXL A;  4K5S A;  3QVP A;  3RP6 A;  4Z25 A;  3OC4 A;  1L0V A;  2CFY A;  4K5R A;  2AQJ A;  2Y6Q A;  4RG4 A;  4A9W A;  4JN9 A;  1GT8 A;  2C66 A;  1RYI A;  1NHQ A;  4JY2 A;  1H81 A;  1MOK A;  1IUT A;  1UKV G;  2IVD A;  2XLR A;  3BI4 A;  1K4Q A;  2VVL A;  2X8G A;  2QAE A;  5DBJ A;  3UKA A;  1S3B A;  3C4N A;  3UTE A;  3NHO X;  1DOE A;  3M0O A;  4IVM B;  3P4S A;  2AAQ A;  3CGD A;  4GDP A;  4Y4N A;  2FJE A;  5CQF A;  4UDR A;  2VOU A;  1COY A;  3SFD A;  3H4K A;  1Q1W A;  4U8J A;  4YKF A;  2OLN A;  3S61 A;  3IC9 A;  4H7U A;  1CC2 A;  1LJ1 A;  2JKC A;  3CTY A;  2A8X A;  4FDC B;  2YWL A;  3LOV A;  5JCI A;  1TYP A;  1PXA A;  3AEC A;  4OPD A;  5EB4 A;  4GR1 A;  1HYU A;  2WU5 A;  4EQX A;  4Z2T A;  4GDE A;  2B7R A;  1L9D A;  2C76 A;  2F5Z A;  2NVK X;  2C64 A;  3VRD B;  1PJ6 A;  2AR8 A;  3WE0 A;  1GER A;  3NNE A;  3NH3 X;  4BJY A;  1PXB A;  1Y0P A;  2C65 A;  3AXB A;  3L8K A;  5KVI A;  3GSI A;  2YR5 A;  3DJG X;  2H88 A;  4HB9 A;  4APN A;  3P4R A;  4U2T A;  1GSN A;  4U2L A;  1ZMD A;  3RED A;  1GV4 A;  3FMW A;  2ARD A;  3G5Q A;  1GXF A;  4A6N B;  3KD9 A;  1CJ3 A;  2VVL G;  2C70 A;  1NHR A;  2XFO A;  2GAH B;  4X9M A;  3NTD A;  1ZDL A;  4H4Y A;  3II4 A;  3GRS A;  1EL8 A;  1NHS A;  4EIQ A;  1GEU A;  3D8X A;  1B5Q A;  1FCD A;  2J3N A;  2V60 A;  4Y4M A;  1PDH A;  1CJ2 A;  3CPI G;  5BUK A;  1H6V A;  3KKJ A;  4CCR A;  2GQF A;  3CPJ G;  2GAG B;  1LQU A;  5GSN A;  4DNA A;  1BKW A;  4ICY A;  3AE2 A;  4H4S A;  2E5V A;  1VRQ B;  4OCG A;  2H89 A;  3BHK A;  1B8S A;  2ACZ A;  1GTH A;  3DJE A;  1EL7 A;  3VRB A;  1OJT A;  1PXC A;  3GMC A;  3VQR A;  1S2Y A;  1OJ9 A;  2WDQ A;  2WPE A;  3NK0 X;  1JEH A;  2Q6U A;  4EMI A;  1O94 A;  3UKL A;  4BK1 A;  3AYI A;  3B3R A;  4OPU A;  2TPR A;  4OPI A;  3F8P A;  2R4J A;  3AD7 B;  3DH9 A;  3FPZ A;  4J57 A;  1LQT A;  1Y56 A;  1IJH A;  3OZ2 A;  3P4Q A;  2I0Z A;  1TDO A;  4CNJ A;  4B69 A;  3CN8 A;  1H83 A;  3ICS A;  3K7T A;  4H50 A;  3G5S A;  4K22 A;  5BUL A;  2BXR A;  2R0G A;  2XLS A;  3NKS A;  4BV6 A;  1CJC A;  1LTX R;  2Z5X A;  2X8H A;  2EQ8 A;  1GOS A;  5FS9 A;  5FS8 A;  4AT0 A;  2YLZ A;  3ISH A;  3UOV A;  3AWI A;  3DK4 A;  2CDU A;  1REO A;  3SM8 A;  3K7Q X;  4B65 A;  1KNR A;  4H4X A;  2Q0K A;  2R9Z A;  4IVO B;  1TDF A;  2B9Y A;  4A79 A;  3AEB A;  1VG9 A;  1FEC A;  4IV9 A;  3NT6 A;  4OVI A;  4B64 A;  3ICR A;  4EM3 A;  2WU2 A;  5CKU A;  2YM1 A;  1GRH A;  3CIR A;  3LB8 A;  3G5R A;  4EQR A;  3AEA A;  4CNK A;  3GWF A;  4OPC A;  3ATQ A;  3UKK A;  4H2R A;  2C73 A;  2TMD A;  3KU9 A;  4PAB A;  4D04 A;  2YLW A;  1ZP0 A;  4TLX A;  1F8S A;  3P9U A;  4HA6 A;  4AT2 A;  1IUW A;  2WET A;  4OPT A;  3DJD A;  4JQ9 A;  2BK4 A;  4J36 A;  2XFP A;  1Q9I A;  2OAL A;  3UCL A;  4H4Q A;  3PS9 A;  1YKJ A;  2C75 A;  1JNZ A;  2RGH A;  4H2N A;  1H84 A;  4NEV A;  4C5O A;  1EBD A;  2YLS A;  3UP5 A;  5JCM A;  3NK2 X;  5C3J A;  2FBW A;  3H8L A;  3UKQ A;  5IPY A;  3GMB A;  3GRT A;  4C74 A;  3AEF A;  3M12 A;  5U63 A;  1IUS A;  1K0I A;  2WES A;  3NIX A;  5FS6 A;  3IHM A;  2YLT A;  2O9Z A;  1GND A;  2IVE A;  3GYJ A;  1GPE A;  4LII A;  3AE8 A;  1TDN A;  3ALJ A;  3NGC X;  1MO9 A;  1PHH A;  4A5L A;  3I3L A;  1NAA A;  2C72 A;  2YG3 A;  3EAN A;  1S2Q A;  3EF6 A;  1ONF A;  3RNM A;  4A6N A;  2V5Z A;  1B4V A;  4N9X A;  1GES A;  1N4V A;  5U25 A;  3ICT A;  4U8M A;  2PYX A;  1GTE A;  2B7S A;  3NYC A;  3UTH A;  2DKH A;  4NTD A;  1D7L A;  4H4T A;  3RP7 A;  2GMH A;  3BHF A;  4NTE A;  3ADA B;  4IA5 A;  4JY3 A;  2YLR A;  3SFE A;  2WQY A;  5BVA A;  4CRT A;  4JNQ A;  2RAB A;  3DME A;  5KWF A;  4GUV A;  2XFU A;  3UOX A;  1P2H A;  3RHA A;  4U2S A;  2WHD A;  1GAL A;  2GQW A;  3AED A;  4YTM A;  3DK9 A;  3AEG A;  2B76 A;  2E4G A;  3B6D A;  2C7G A;  2XVH A;  1BWC A;  1KNP A;  1P2E A;  3UTF A;  2XLP A;  4XWZ A;  1XPQ A;  1TRB A;  3QFB A;  1Q1R A;  5KOW A;  3ITJ A;  4EQW A;  1BF3 A;  2QA1 A;  2Y6R A;  1PBE A;  4IA6 A;  2VVM A;  5EBK A;  4EQS A;  2R46 A; 
#chains in the Genus database with same CATH topology
 2UZZ A;  4OPG A;  3K7M X;  4JDR A;  3IF9 A;  2E1M A;  3GYX A;  4YSZ A;  4U8K A;  1CBO A;  3FIM B;  3LXD A;  4B1B A;  1Z6L A;  2YG7 A;  1F8W A;  4J31 A;  1M64 A;  3AE7 A;  4TM3 A;  5M0Z A;  2V61 A;  4UDQ A;  4CY6 A;  3AD8 B;  4OPL A;  1E39 A;  4UDP A;  4CY8 A;  1KSU A;  2YVF A;  2V3A A;  2YM2 A;  2EQ9 A;  2WP6 A;  3PO7 A;  1GRE A;  3Q6J A;  2XLT A;  5TR3 A;  1KDG A;  4WX1 A;  1N4U A;  4ZCD A;  4USR A;  4ADW A;  4AOX A;  4BJZ A;  3DA1 A;  3QJ4 A;  4Z24 A;  4YSH A;  1K0L A;  4NZH A;  2B9W A;  4D03 A;  3IHG A;  3SX6 A;  4EMJ A;  1XDI A;  2R45 A;  1ZY8 A;  3AYL A;  1V59 A;  4J33 A;  5EOW A;  5LV9 A;  1FEB A;  4PAA A;  2BK3 A;  3CPH G;  4ZCC A;  2OLO A;  1YY5 A;  3NYE A;  2VRM A;  4GRT A;  2X99 A;  4Z44 A;  4K2X A;  2YAU A;  4BK3 A;  4TM0 A;  1OJD A;  3AD9 B;  1B37 A;  1ZOY A;  3AE9 A;  1H82 A;  1FL2 A;  1JRZ A;  1YQ3 A;  2C67 A;  4MJW A;  2HQM A;  3AEE A;  3C96 A;  2JB3 A;  2JAE A;  1NEK A;  4U8I A;  1EL5 A;  3ZDN A;  4LU6 A;  3URH A;  1PBD A;  1CC6 A;  3CNT A;  2CUL A;  3PVC A;  3R9U A;  4YTN A;  3KPF A;  3CGE A;  1FEA A;  2WDR A;  4ZN0 A;  4AOS A;  4H4U A;  2JB2 A;  4LA1 A;  2V3B A;  1PBF A;  3H8I A;  1O5W A;  4FK1 A;  4J34 A;  1XHC A;  2WP5 A;  2WOI A;  3GYI A;  3NLC A;  5GRT A;  4WCT A;  3UTG A;  2R0P A;  2CVJ A;  3QSE A;  4GF7 A;  5J60 A;  2FJA A;  4AP1 A;  2R4E A;  5FS7 A;  4B66 A;  1NHP A;  3DGH A;  3UOZ A;  4B67 A;  1N4W A;  4H2P A;  5C2T A;  2GH5 A;  3BI5 A;  5IQ1 A;  2OA1 A;  3HZL A;  2BCP A;  5FMH A;  1PS9 A;  1E1M A;  1GRT A;  3AB1 A;  1F6M A;  4RG3 A;  4REK A;  4U8O A;  4I59 A;  3QFA A;  3Q9T A;  4GAP A;  4CBQ A;  2BS2 A;  1CC4 A;  4CCQ A;  1JRY A;  1ZK7 A;  3GD4 A;  1W4X A;  4G9K A;  2Q7V A;  4I58 A;  4YT0 A;  1D7Y A;  3GD3 A;  1NG4 A;  4UP3 A;  4YWO A;  1NPX A;  4Z2U A;  2YR6 A;  2C3C A;  3LJP A;  3T14 A;  2BYB A;  4H2Q A;  4RSL A;  3NN0 X;  4BUR A;  1D4D A;  2ZZB A;  4J56 A;  4K7Z A;  3V3N A;  1L9C A;  1VG0 A;  1AOG A;  3CNS A;  5JCK A;  1D5T A;  1TDK A;  2X3N A;  4U8N A;  3FG2 P;  2YR4 A;  4BK2 A;  2X50 A;  1DOC A;  1DNC A;  4YXD A;  5L46 A;  1X31 B;  4DSG A;  4YTP A;  2XVE A;  3SQP A;  5HY5 A;  1OJA A;  5KNL A;  1BGN A;  1H86 A;  2EQ7 A;  4G6G A;  5HHF A;  3T37 A;  4A99 A;  2JB1 A;  4DGK A;  2R0C A;  2XVI A;  1LPF A;  2WOV A;  2QA2 A;  4EIP A;  2XFN A;  1NDA A;  3K30 A;  3EPT A;  1E1N A;  1LVL A;  2GR1 A;  4TM4 A;  5JCL A;  3LAD A;  1F3P A;  1Y56 B;  2GEW A;  2YG6 A;  3V76 A;  3QVR A;  1IUX A;  1CHU A;  2ZZC A;  2YVG A;  4H4W A;  3SZ0 A;  3GDP A;  4H4R A;  3ALL A;  5KMP A;  1E6E A;  2V6O A;  3NK1 X;  3VRA A;  1PBB A;  3CGC A;  1DOB A;  3CGB A;  3NRN A;  1BZL A;  4X9N A;  4XXG A;  1K0J A;  2XDO A;  3BNM A;  3LZW A;  4B63 A;  2BAC A;  1JRX A;  1FOH A;  1JU2 A;  4H4P A;  3T0K A;  5KVH A;  2A87 A;  4DSH A;  2GMJ A;  3FBS A;  3BI2 A;  1BGJ A;  3CNP A;  1YQ4 A;  3ZYX A;  3CND A;  2BAB A;  4Y4L A;  3GDN A;  2WEU A;  1L9E A;  3JSK A;  2GRT A;  2B9X A;  3AYJ A;  2BXS A;  3M13 A;  3O0H A;  2A89 A;  3KVE A;  3T2Z A;  1N1P A;  4C77 A;  2FJB A;  3AE5 A;  1XAN A;  3T2Y A;  4YKG A;  1GRB A;  3NN6 X;  1H7X A;  2W0H A;  4A7A A;  3UKP A;  5KRQ A;  2GR0 A;  3UP4 A;  1ZX9 A;  2XVF A;  2WOW A;  4A65 A;  4TLZ A;  1E1K A;  3P1W A;  4H4Z A;  4C3Y A;  3ATR A;  1KSS A;  1VDC A;  3DJJ A;  1O95 A;  3QSS A;  3LZX A;  2EQ6 A;  3GWD A;  1KFY A;  1QLB A;  3F8D A;  1PN0 A;  2C3D A;  2X8C A;  4H4V A;  1DOD A;  4NTC A;  3ABV A;  2IID A;  3P4P A;  3V3O A;  1KF6 A;  2WBA A;  3NG7 X;  2VZ2 A;  3IWA A;  1ZMC A;  1GRA A;  4KX6 A;  4G73 A;  3AE1 A;  1S3E A;  2BS4 A;  5J7X A;  1DJQ A;  4G74 A;  1JOA A;  1M6I A;  2APG A;  2Z5Y A;  1DJN A;  4II3 A;  1D4E A;  4KPR A;  2OAM A;  1GRF A;  2BC1 A;  2VQ7 A;  1IUU A;  1PBC A;  2GR3 A;  3COX A;  4B68 A;  2RGO A;  5M10 A;  4FX9 A;  2WS3 A;  4GCM A;  4U8P A;  3EAO A;  2XFQ A;  3AE4 A;  5KXJ A;  3VR9 A;  3C4A A;  3UOY A;  1NG3 A;  4TM1 A;  4M52 A;  4C3X A;  2BCG G;  3AE6 A;  2QCU A;  2WPC A;  2YVJ A;  3UKH A;  1CF3 A;  2GB0 A;  2NPX A;  2XVJ A;  2JBV A;  3ALM A;  3D1C A;  2GF3 A;  3KA7 A;  4G6H A;  5ER0 A;  4U8L A;  2YG5 A;  5JCN A;  3QSM A;  1SEZ A;  4P9S A;  1F8R A;  1H7W A;  1JNR A;  1ZKQ A;  2YQU A;  3UKF A;  4Z2R A;  3E1T A;  1D4C A;  1IUV A;  4USQ A;  3VR8 A;  4E0V A;  5IQ4 A;  1MXT A;  4O5U A;  1YQZ A;  1RSG A;  2GV8 A;  2YG4 A;  3I6D A;  4JNA A;  2BA9 A;  3BNU A;  4AP3 A;  2FJD A;  1LV0 A;  3DGZ A;  2XCG A;  2BK5 A;  1GRG A;  2WPF A;  4YSY A;  2PHH A;  2WP9 A;  2JK6 A;  1TYT A;  4NEW A;  5KMS A;  4EM4 A;  2XLU A;  2GR2 A;  2RGJ A;  3SGL A;  1CL0 A;  2Q0L A;  1GET A;  3NYF A;  1QO8 A;  2YLX A;  4YSX A;  4FK1 C;  1ELI A;  3SZF A;  3AE3 A;  3KLJ A;  5U1O A;  2ZZ0 A;  3S5W A;  1PJ7 A;  5KOX A;  1CJ4 A;  3KPK A;  1PJ5 A;  5HXI A;  3DK8 A;  4Z26 A;  2XYO A;  1OJC A;  4O5Q A;  1TDE A;  4EMW A;  3CNJ A;  1EL9 A;  1QJD A;  4XWR A;  1NEN A;  4J2W A;  3NTA A;  3HYX A;  3L1R A;  1E7P A;  2DKI A;  2VRL A;  3F8R A;  1RP0 A;  3RP8 A;  1VQW A;  5KMQ A;  2WDV A;  2ZBW A;  2BS3 A;  2VQB A;  5EB5 A;  4Z43 A;  5HYM A;  2GVC A;  4X4J A;  5BRT A;  4ECH A;  4K8D A;  1E1L A;  1ZOV A;  2BC0 A;  1DXL A;  4K5S A;  3QVP A;  3RP6 A;  4Z25 A;  3OC4 A;  1L0V A;  2CFY A;  4K5R A;  2AQJ A;  2Y6Q A;  4RG4 A;  4A9W A;  4JN9 A;  1GT8 A;  2C66 A;  1RYI A;  1NHQ A;  4JY2 A;  1H81 A;  1MOK A;  1IUT A;  1UKV G;  2IVD A;  2XLR A;  3BI4 A;  1K4Q A;  2VVL A;  2X8G A;  2QAE A;  5DBJ A;  3UKA A;  1S3B A;  3C4N A;  3UTE A;  3NHO X;  1DOE A;  3M0O A;  4IVM B;  3P4S A;  2AAQ A;  3CGD A;  4GDP A;  3T2K A;  4NWZ A;  4Y4N A;  3HYW A;  2FJE A;  5CQF A;  4UDR A;  2VOU A;  1COY A;  3SFD A;  3H4K A;  1Q1W A;  4U8J A;  4YKF A;  2OLN A;  3S61 A;  3IC9 A;  4H7U A;  1CC2 A;  1LJ1 A;  2JKC A;  3CTY A;  2A8X A;  4FDC B;  2YWL A;  3LOV A;  5JCI A;  1TYP A;  1PXA A;  3AEC A;  4OPD A;  5EB4 A;  4GR1 A;  1HYU A;  2WU5 A;  4EQX A;  4Z2T A;  4GDE A;  2B7R A;  1L9D A;  2C76 A;  2F5Z A;  2NVK X;  5KMR A;  2C64 A;  3VRD B;  1PJ6 A;  2AR8 A;  3WE0 A;  1GER A;  3NNE A;  3NH3 X;  4BJY A;  1PXB A;  1Y0P A;  2C65 A;  3AXB A;  3L8K A;  5KVI A;  3GSI A;  2YR5 A;  4NNJ A;  3DJG X;  2H88 A;  4HB9 A;  4APN A;  3P4R A;  2C4C A;  4U2T A;  1GSN A;  4U2L A;  1ZMD A;  3RED A;  1GV4 A;  3FMW A;  2ARD A;  3G5Q A;  1GXF A;  4A6N B;  3KD9 A;  1CJ3 A;  2VVL G;  2C70 A;  1NHR A;  2XFO A;  2GAH B;  4X9M A;  3NTD A;  1ZDL A;  4H4Y A;  3II4 A;  3GRS A;  1EL8 A;  1NHS A;  4EIQ A;  1GEU A;  3D8X A;  1B5Q A;  1FCD A;  2J3N A;  2V60 A;  4Y4M A;  1PDH A;  1CJ2 A;  3CPI G;  5BUK A;  1H6V A;  3KKJ A;  4CCR A;  2GQF A;  3CPJ G;  2GAG B;  1LQU A;  5GSN A;  4DNA A;  1BKW A;  4ICY A;  3AE2 A;  4H4S A;  2E5V A;  1VRQ B;  4OCG A;  2H89 A;  3BHK A;  1B8S A;  2ACZ A;  1GTH A;  3CMM A;  3DJE A;  1EL7 A;  3VRB A;  1OJT A;  1PXC A;  3GMC A;  3VQR A;  1S2Y A;  1OJ9 A;  2WDQ A;  2WPE A;  3NK0 X;  1JEH A;  2Q6U A;  4GAV A;  4EMI A;  1O94 A;  3UKL A;  4BK1 A;  3AYI A;  3B3R A;  4OPU A;  2TPR A;  4OPI A;  3F8P A;  2R4J A;  3AD7 B;  3DH9 A;  3FPZ A;  4J57 A;  1LQT A;  1Y56 A;  1IJH A;  3OZ2 A;  3P4Q A;  2I0Z A;  1TDO A;  3SZC A;  4CNJ A;  4B69 A;  3CN8 A;  1H83 A;  3ICS A;  3K7T A;  4H50 A;  3G5S A;  4K22 A;  5BUL A;  2BXR A;  2R0G A;  2XLS A;  3NKS A;  4BV6 A;  1CJC A;  1LTX R;  2Z5X A;  2X8H A;  2EQ8 A;  1GOS A;  3SXI A;  5FS9 A;  5FS8 A;  4AT0 A;  2YLZ A;  3ISH A;  3UOV A;  3AWI A;  3DK4 A;  2CDU A;  1REO A;  3SM8 A;  3K7Q X;  4B65 A;  1KNR A;  4H4X A;  2Q0K A;  2R9Z A;  4IVO B;  1TDF A;  2B9Y A;  4A79 A;  2BRY A;  3AEB A;  1VG9 A;  1FEC A;  4IV9 A;  3NT6 A;  4OVI A;  4B64 A;  3ICR A;  4EM3 A;  2WU2 A;  5CKU A;  2YM1 A;  1GRH A;  3CIR A;  3LB8 A;  3G5R A;  4EQR A;  3AEA A;  4CNK A;  2BRA A;  3GWF A;  4OPC A;  3ATQ A;  3UKK A;  4H2R A;  2C73 A;  2TMD A;  3KU9 A;  4PAB A;  4D04 A;  2YLW A;  1ZP0 A;  4TLX A;  1F8S A;  3P9U A;  4HA6 A;  3SY4 A;  4AT2 A;  1IUW A;  2WET A;  4OPT A;  3DJD A;  4JQ9 A;  2BK4 A;  4J36 A;  2XFP A;  1Q9I A;  2OAL A;  3UCL A;  4H4Q A;  3PS9 A;  1YKJ A;  2C75 A;  1JNZ A;  2RGH A;  4H2N A;  1H84 A;  4NEV A;  4C5O A;  1EBD A;  2YLS A;  3UP5 A;  5JCM A;  3NK2 X;  5C3J A;  2FBW A;  3H8L A;  3UKQ A;  5IPY A;  3GMB A;  3GRT A;  4C74 A;  3AEF A;  3M12 A;  5U63 A;  1IUS A;  3SYI A;  1K0I A;  2WES A;  3NIX A;  5FS6 A;  3IHM A;  2YLT A;  2O9Z A;  4II2 A;  1GND A;  2IVE A;  3GYJ A;  1GPE A;  4LII A;  3AE8 A;  1TDN A;  3ALJ A;  3NGC X;  1MO9 A;  1PHH A;  4A5L A;  3I3L A;  1NAA A;  2C72 A;  2YG3 A;  3EAN A;  1S2Q A;  3EF6 A;  1ONF A;  3RNM A;  4A6N A;  2V5Z A;  1B4V A;  4N9X A;  1GES A;  1N4V A;  3HYV A;  3T31 A;  5U25 A;  3ICT A;  4U8M A;  2PYX A;  1GTE A;  2B7S A;  3NYC A;  3UTH A;  2DKH A;  4NTD A;  1D7L A;  4H4T A;  3RP7 A;  2GMH A;  3BHF A;  4NTE A;  3ADA B;  4IA5 A;  4JY3 A;  2YLR A;  3SFE A;  2WQY A;  5BVA A;  4CRT A;  4JNQ A;  2RAB A;  3DME A;  5KWF A;  4GUV A;  2XFU A;  3UOX A;  1P2H A;  3RHA A;  4U2S A;  2WHD A;  1GAL A;  2GQW A;  3AED A;  4YTM A;  3DK9 A;  3AEG A;  2B76 A;  2E4G A;  3B6D A;  2C7G A;  2XVH A;  1BWC A;  1KNP A;  1P2E A;  3UTF A;  2XLP A;  4XWZ A;  1XPQ A;  1TRB A;  3QFB A;  1Q1R A;  5KOW A;  3ITJ A;  4EQW A;  1BF3 A;  2QA1 A;  2Y6R A;  1PBE A;  4IA6 A;  2VVM A;  5EBK A;  4EQS A;  3SZW A;  2R46 A; 
#chains in the Genus database with same CATH homology
 2UZZ A;  4OPG A;  3K7M X;  4JDR A;  3IF9 A;  2E1M A;  3GYX A;  4YSZ A;  4U8K A;  1CBO A;  3FIM B;  3LXD A;  4B1B A;  1Z6L A;  2YG7 A;  1F8W A;  4J31 A;  1M64 A;  3AE7 A;  4TM3 A;  5M0Z A;  2V61 A;  4UDQ A;  4CY6 A;  3AD8 B;  4OPL A;  1E39 A;  4UDP A;  4CY8 A;  1KSU A;  2YVF A;  2V3A A;  2YM2 A;  2EQ9 A;  2WP6 A;  3PO7 A;  1GRE A;  3Q6J A;  2XLT A;  5TR3 A;  1KDG A;  4WX1 A;  1N4U A;  4ZCD A;  4USR A;  4ADW A;  4AOX A;  4BJZ A;  3DA1 A;  3QJ4 A;  4Z24 A;  4YSH A;  1K0L A;  4NZH A;  2B9W A;  4D03 A;  3IHG A;  3SX6 A;  4EMJ A;  1XDI A;  2R45 A;  1ZY8 A;  3AYL A;  1V59 A;  4J33 A;  5EOW A;  5LV9 A;  1FEB A;  4PAA A;  2BK3 A;  3CPH G;  4ZCC A;  2OLO A;  1YY5 A;  3NYE A;  2VRM A;  4GRT A;  2X99 A;  4Z44 A;  4K2X A;  2YAU A;  4BK3 A;  4TM0 A;  1OJD A;  3AD9 B;  1B37 A;  1ZOY A;  3AE9 A;  1H82 A;  1FL2 A;  1JRZ A;  1YQ3 A;  2C67 A;  4MJW A;  2HQM A;  3AEE A;  3C96 A;  2JB3 A;  2JAE A;  1NEK A;  4U8I A;  1EL5 A;  3ZDN A;  4LU6 A;  3URH A;  1PBD A;  1CC6 A;  3CNT A;  2CUL A;  3PVC A;  3R9U A;  4YTN A;  3KPF A;  3CGE A;  1FEA A;  2WDR A;  4ZN0 A;  4AOS A;  4H4U A;  2JB2 A;  4LA1 A;  2V3B A;  1PBF A;  3H8I A;  1O5W A;  4FK1 A;  4J34 A;  1XHC A;  2WP5 A;  2WOI A;  3GYI A;  3NLC A;  5GRT A;  4WCT A;  3UTG A;  2R0P A;  2CVJ A;  3QSE A;  4GF7 A;  5J60 A;  2FJA A;  4AP1 A;  2R4E A;  5FS7 A;  4B66 A;  1NHP A;  3DGH A;  3UOZ A;  4B67 A;  1N4W A;  4H2P A;  5C2T A;  2GH5 A;  3BI5 A;  5IQ1 A;  2OA1 A;  3HZL A;  2BCP A;  5FMH A;  1PS9 A;  1E1M A;  1GRT A;  3AB1 A;  1F6M A;  4RG3 A;  4REK A;  4U8O A;  4I59 A;  3QFA A;  3Q9T A;  4GAP A;  4CBQ A;  2BS2 A;  1CC4 A;  4CCQ A;  1JRY A;  1ZK7 A;  3GD4 A;  1W4X A;  4G9K A;  2Q7V A;  4I58 A;  4YT0 A;  1D7Y A;  3GD3 A;  1NG4 A;  4UP3 A;  4YWO A;  1NPX A;  4Z2U A;  2YR6 A;  2C3C A;  3LJP A;  3T14 A;  2BYB A;  4H2Q A;  4RSL A;  3NN0 X;  4BUR A;  1D4D A;  2ZZB A;  4J56 A;  4K7Z A;  3V3N A;  1L9C A;  1VG0 A;  1AOG A;  3CNS A;  5JCK A;  1D5T A;  1TDK A;  2X3N A;  4U8N A;  3FG2 P;  2YR4 A;  4BK2 A;  2X50 A;  1DOC A;  1DNC A;  4YXD A;  5L46 A;  1X31 B;  4DSG A;  4YTP A;  2XVE A;  3SQP A;  5HY5 A;  1OJA A;  5KNL A;  1BGN A;  1H86 A;  2EQ7 A;  4G6G A;  5HHF A;  3T37 A;  4A99 A;  2JB1 A;  4DGK A;  2R0C A;  2XVI A;  1LPF A;  2WOV A;  2QA2 A;  4EIP A;  2XFN A;  1NDA A;  3K30 A;  3EPT A;  1E1N A;  1LVL A;  2GR1 A;  4TM4 A;  5JCL A;  3LAD A;  1F3P A;  1Y56 B;  2GEW A;  2YG6 A;  3V76 A;  3QVR A;  1IUX A;  1CHU A;  2ZZC A;  2YVG A;  4H4W A;  3SZ0 A;  3GDP A;  4H4R A;  3ALL A;  5KMP A;  1E6E A;  2V6O A;  3NK1 X;  3VRA A;  1PBB A;  3CGC A;  1DOB A;  3CGB A;  3NRN A;  1BZL A;  4X9N A;  4XXG A;  1K0J A;  2XDO A;  3BNM A;  3LZW A;  4B63 A;  2BAC A;  1JRX A;  1FOH A;  1JU2 A;  4H4P A;  3T0K A;  5KVH A;  2A87 A;  4DSH A;  2GMJ A;  3FBS A;  3BI2 A;  1BGJ A;  3CNP A;  1YQ4 A;  3ZYX A;  3CND A;  2BAB A;  4Y4L A;  3GDN A;  2WEU A;  1L9E A;  3JSK A;  2GRT A;  2B9X A;  3AYJ A;  2BXS A;  3M13 A;  3O0H A;  2A89 A;  3KVE A;  3T2Z A;  1N1P A;  4C77 A;  2FJB A;  3AE5 A;  1XAN A;  3T2Y A;  4YKG A;  1GRB A;  3NN6 X;  1H7X A;  2W0H A;  4A7A A;  3UKP A;  5KRQ A;  2GR0 A;  3UP4 A;  1ZX9 A;  2XVF A;  2WOW A;  4A65 A;  4TLZ A;  1E1K A;  3P1W A;  4H4Z A;  4C3Y A;  3ATR A;  1KSS A;  1VDC A;  3DJJ A;  1O95 A;  3QSS A;  3LZX A;  2EQ6 A;  3GWD A;  1KFY A;  1QLB A;  3F8D A;  1PN0 A;  2C3D A;  2X8C A;  4H4V A;  1DOD A;  4NTC A;  3ABV A;  2IID A;  3P4P A;  3V3O A;  1KF6 A;  2WBA A;  3NG7 X;  2VZ2 A;  3IWA A;  1ZMC A;  1GRA A;  4KX6 A;  4G73 A;  3AE1 A;  1S3E A;  2BS4 A;  5J7X A;  1DJQ A;  4G74 A;  1JOA A;  1M6I A;  2APG A;  2Z5Y A;  1DJN A;  4II3 A;  1D4E A;  4KPR A;  2OAM A;  1GRF A;  2BC1 A;  2VQ7 A;  1IUU A;  1PBC A;  2GR3 A;  3COX A;  4B68 A;  2RGO A;  5M10 A;  4FX9 A;  2WS3 A;  4GCM A;  4U8P A;  3EAO A;  2XFQ A;  3AE4 A;  5KXJ A;  3VR9 A;  3C4A A;  3UOY A;  1NG3 A;  4TM1 A;  4M52 A;  4C3X A;  2BCG G;  3AE6 A;  2QCU A;  2WPC A;  2YVJ A;  3UKH A;  1CF3 A;  2GB0 A;  2NPX A;  2XVJ A;  2JBV A;  3ALM A;  3D1C A;  2GF3 A;  3KA7 A;  4G6H A;  5ER0 A;  4U8L A;  2YG5 A;  5JCN A;  3QSM A;  1SEZ A;  4P9S A;  1F8R A;  1H7W A;  1JNR A;  1ZKQ A;  2YQU A;  3UKF A;  4Z2R A;  3E1T A;  1D4C A;  1IUV A;  4USQ A;  3VR8 A;  4E0V A;  5IQ4 A;  1MXT A;  4O5U A;  1YQZ A;  1RSG A;  2GV8 A;  2YG4 A;  3I6D A;  4JNA A;  2BA9 A;  3BNU A;  4AP3 A;  2FJD A;  1LV0 A;  3DGZ A;  2XCG A;  2BK5 A;  1GRG A;  2WPF A;  4YSY A;  2PHH A;  2WP9 A;  2JK6 A;  1TYT A;  4NEW A;  5KMS A;  4EM4 A;  2XLU A;  2GR2 A;  2RGJ A;  3SGL A;  1CL0 A;  2Q0L A;  1GET A;  3NYF A;  1QO8 A;  2YLX A;  4YSX A;  4FK1 C;  1ELI A;  3SZF A;  3AE3 A;  3KLJ A;  5U1O A;  2ZZ0 A;  3S5W A;  1PJ7 A;  5KOX A;  1CJ4 A;  3KPK A;  1PJ5 A;  5HXI A;  3DK8 A;  4Z26 A;  2XYO A;  1OJC A;  4O5Q A;  1TDE A;  4EMW A;  3CNJ A;  1EL9 A;  1QJD A;  4XWR A;  1NEN A;  4J2W A;  3NTA A;  3HYX A;  3L1R A;  1E7P A;  2DKI A;  2VRL A;  3F8R A;  1RP0 A;  3RP8 A;  1VQW A;  5KMQ A;  2WDV A;  2ZBW A;  2BS3 A;  2VQB A;  5EB5 A;  4Z43 A;  5HYM A;  2GVC A;  4X4J A;  5BRT A;  4ECH A;  4K8D A;  1E1L A;  1ZOV A;  2BC0 A;  1DXL A;  4K5S A;  3QVP A;  3RP6 A;  4Z25 A;  3OC4 A;  1L0V A;  2CFY A;  4K5R A;  2AQJ A;  2Y6Q A;  4RG4 A;  4A9W A;  4JN9 A;  1GT8 A;  2C66 A;  1RYI A;  1NHQ A;  4JY2 A;  1H81 A;  1MOK A;  1IUT A;  1UKV G;  2IVD A;  2XLR A;  3BI4 A;  1K4Q A;  2VVL A;  2X8G A;  2QAE A;  5DBJ A;  3UKA A;  1S3B A;  3C4N A;  3UTE A;  3NHO X;  1DOE A;  3M0O A;  4IVM B;  3P4S A;  2AAQ A;  3CGD A;  4GDP A;  3T2K A;  4NWZ A;  4Y4N A;  3HYW A;  2FJE A;  5CQF A;  4UDR A;  2VOU A;  1COY A;  3SFD A;  3H4K A;  1Q1W A;  4U8J A;  4YKF A;  2OLN A;  3S61 A;  3IC9 A;  4H7U A;  1CC2 A;  1LJ1 A;  2JKC A;  3CTY A;  2A8X A;  4FDC B;  2YWL A;  3LOV A;  5JCI A;  1TYP A;  1PXA A;  3AEC A;  4OPD A;  5EB4 A;  4GR1 A;  1HYU A;  2WU5 A;  4EQX A;  4Z2T A;  4GDE A;  2B7R A;  1L9D A;  2C76 A;  2F5Z A;  2NVK X;  5KMR A;  2C64 A;  3VRD B;  1PJ6 A;  2AR8 A;  3WE0 A;  1GER A;  3NNE A;  3NH3 X;  4BJY A;  1PXB A;  1Y0P A;  2C65 A;  3AXB A;  3L8K A;  5KVI A;  3GSI A;  2YR5 A;  4NNJ A;  3DJG X;  2H88 A;  4HB9 A;  4APN A;  3P4R A;  2C4C A;  4U2T A;  1GSN A;  4U2L A;  1ZMD A;  3RED A;  1GV4 A;  3FMW A;  2ARD A;  3G5Q A;  1GXF A;  4A6N B;  3KD9 A;  1CJ3 A;  2VVL G;  2C70 A;  1NHR A;  2XFO A;  2GAH B;  4X9M A;  3NTD A;  1ZDL A;  4H4Y A;  3II4 A;  3GRS A;  1EL8 A;  1NHS A;  4EIQ A;  1GEU A;  3D8X A;  1B5Q A;  1FCD A;  2J3N A;  2V60 A;  4Y4M A;  1PDH A;  1CJ2 A;  3CPI G;  5BUK A;  1H6V A;  3KKJ A;  4CCR A;  2GQF A;  3CPJ G;  2GAG B;  1LQU A;  5GSN A;  4DNA A;  1BKW A;  4ICY A;  3AE2 A;  4H4S A;  2E5V A;  1VRQ B;  4OCG A;  2H89 A;  3BHK A;  1B8S A;  2ACZ A;  1GTH A;  3CMM A;  3DJE A;  1EL7 A;  3VRB A;  1OJT A;  1PXC A;  3GMC A;  3VQR A;  1S2Y A;  1OJ9 A;  2WDQ A;  2WPE A;  3NK0 X;  1JEH A;  2Q6U A;  4GAV A;  4EMI A;  1O94 A;  3UKL A;  4BK1 A;  3AYI A;  3B3R A;  4OPU A;  2TPR A;  4OPI A;  3F8P A;  2R4J A;  3AD7 B;  3DH9 A;  3FPZ A;  4J57 A;  1LQT A;  1Y56 A;  1IJH A;  3OZ2 A;  3P4Q A;  2I0Z A;  1TDO A;  3SZC A;  4CNJ A;  4B69 A;  3CN8 A;  1H83 A;  3ICS A;  3K7T A;  4H50 A;  3G5S A;  4K22 A;  5BUL A;  2BXR A;  2R0G A;  2XLS A;  3NKS A;  4BV6 A;  1CJC A;  1LTX R;  2Z5X A;  2X8H A;  2EQ8 A;  1GOS A;  3SXI A;  5FS9 A;  5FS8 A;  4AT0 A;  2YLZ A;  3ISH A;  3UOV A;  3AWI A;  3DK4 A;  2CDU A;  1REO A;  3SM8 A;  3K7Q X;  4B65 A;  1KNR A;  4H4X A;  2Q0K A;  2R9Z A;  4IVO B;  1TDF A;  2B9Y A;  4A79 A;  2BRY A;  3AEB A;  1VG9 A;  1FEC A;  4IV9 A;  3NT6 A;  4OVI A;  4B64 A;  3ICR A;  4EM3 A;  2WU2 A;  5CKU A;  2YM1 A;  1GRH A;  3CIR A;  3LB8 A;  3G5R A;  4EQR A;  3AEA A;  4CNK A;  2BRA A;  3GWF A;  4OPC A;  3ATQ A;  3UKK A;  4H2R A;  2C73 A;  2TMD A;  3KU9 A;  4PAB A;  4D04 A;  2YLW A;  1ZP0 A;  4TLX A;  1F8S A;  3P9U A;  4HA6 A;  3SY4 A;  4AT2 A;  1IUW A;  2WET A;  4OPT A;  3DJD A;  4JQ9 A;  2BK4 A;  4J36 A;  2XFP A;  1Q9I A;  2OAL A;  3UCL A;  4H4Q A;  3PS9 A;  1YKJ A;  2C75 A;  1JNZ A;  2RGH A;  4H2N A;  1H84 A;  4NEV A;  4C5O A;  1EBD A;  2YLS A;  3UP5 A;  5JCM A;  3NK2 X;  5C3J A;  2FBW A;  3H8L A;  3UKQ A;  5IPY A;  3GMB A;  3GRT A;  4C74 A;  3AEF A;  3M12 A;  5U63 A;  1IUS A;  3SYI A;  1K0I A;  2WES A;  3NIX A;  5FS6 A;  3IHM A;  2YLT A;  2O9Z A;  4II2 A;  1GND A;  2IVE A;  3GYJ A;  1GPE A;  4LII A;  3AE8 A;  1TDN A;  3ALJ A;  3NGC X;  1MO9 A;  1PHH A;  4A5L A;  3I3L A;  1NAA A;  2C72 A;  2YG3 A;  3EAN A;  1S2Q A;  3EF6 A;  1ONF A;  3RNM A;  4A6N A;  2V5Z A;  1B4V A;  4N9X A;  1GES A;  1N4V A;  3HYV A;  3T31 A;  5U25 A;  3ICT A;  4U8M A;  2PYX A;  1GTE A;  2B7S A;  3NYC A;  3UTH A;  2DKH A;  4NTD A;  1D7L A;  4H4T A;  3RP7 A;  2GMH A;  3BHF A;  4NTE A;  3ADA B;  4IA5 A;  4JY3 A;  2YLR A;  3SFE A;  2WQY A;  5BVA A;  4CRT A;  4JNQ A;  2RAB A;  3DME A;  5KWF A;  4GUV A;  2XFU A;  3UOX A;  1P2H A;  3RHA A;  4U2S A;  2WHD A;  1GAL A;  2GQW A;  3AED A;  4YTM A;  3DK9 A;  3AEG A;  2B76 A;  2E4G A;  3B6D A;  2C7G A;  2XVH A;  1BWC A;  1KNP A;  1P2E A;  3UTF A;  2XLP A;  4XWZ A;  1XPQ A;  1TRB A;  3QFB A;  1Q1R A;  5KOW A;  3ITJ A;  4EQW A;  1BF3 A;  2QA1 A;  2Y6R A;  1PBE A;  4IA6 A;  2VVM A;  5EBK A;  4EQS A;  3SZW A;  2R46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...