3UOZA

Crystal structure of otemo complex with fad and nadp (form 2)
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
540
structure length
540
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords OTEMO
total genus 186
structure length 540
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uozA01
4K8DA 3CNPA 5EBKA 1DJNA 1BZLA 1XANA 2JAEA 4A99A 4J56A 4YWOA 1B4VA 2FJBA 2JB3A 1GTHA 2NPXA 5C3JA 2E5VA 3NK0X 5FS8A 1L9EA 3AECA 4X9MA 5BUKA 1E7PA 1EBDA 2BXSA 4C3YA 4TM4A 5IQ1A 3GWFA 3LZXA 3ALLA 3FMWA 2V6OA 2W0HA 1PHHA 5FS6A 2WPFA 1LTXR 3H4KA 2Q7VA 1CF3A 3P9UA 2QA2A 5EB4A 1X31B 4BJZA 3DGZA 1GREA 3ICRA 3UKAA 2EQ9A 4YKGA 4Z2TA 1F3PA 3AE3A 3KVEA 2F5ZA 4EM4A 3ALMA 4WX1A 2QA1A 3AEBA 3JSKA 1E1NA 1Q9IA 1FEAA 1EL9A 1JRYA 5M0ZA 3GRTA 2GQFA 3CGCA 4CRTA 1ZDLA 2C75A 3EPTA 1ZOVA 4IA5A 3AWIA 3UKPA 4B68A 1CC6A 3VRDB 3UTHA 3UOYA 2AQJA 3LADA 1D7LA 4NTEA 4U8IA 4B64A 4C77A 1DOBA 1L0VA 3QFBA 4CY6A 4B65A 1PJ5A 2GAHB 2B76A 2XVEA 4RSLA 5TR3A 2C3DA 4K5SA 3QSMA 3G5SA 4U8PA 2WETA 3F8DA 3UOZA 4DSGA 4TM3A 4EIQA 5BULA 1CJCA 2YG4A 1W4XA 1VG0A 3VR8A 5KOXA 2CULA 2Q0KA 4A6NA 2X8CA 2OAMA 3RP6A 1PJ7A 2WESA 3ISHA 3VRBA 3NK1X 1N1PA 2XLPA 2BK3A 5GSNA 2C70A 3B6DA 3BHFA 2FJEA 4D03A 1ELIA 3WE0A 1PDHA 5JCLA 1OJAA 1KF6A 2C65A 4I58A 3AYJA 3EANA 2WOVA 1RYIA 1QJDA 4H2PA 3COXA 3KPFA 2NVKX 1GRHA 1NAAA 4ICYA 1CBOA 1ZOYA 2BS3A 1EL5A 4K7ZA 1RSGA 3GRSA 3ADAB 1XPQA 3GMBA 4ADWA 1AOGA 1BKWA 2E4GA 2B7SA 2XFOA 2ZZCA 3NYFA 4APNA 1OJTA 2AAQA 1VRQB 4H50A 3VR9A 1ONFA 1GRTA 2VOUA 2XCGA 1D7YA 3KD9A 3NLCA 1CJ4A 2A8XA 2EQ8A 1JNRA 2XDOA 1SEZA 2GEWA 2WDRA 4NTCA 3LB8A 2TMDA 2YLZA 4JNQA 5GRTA 2ZZ0A 4JY2A 3AD9B 2ZZBA 1GEUA 4Z2UA 2OALA 4A9WA 3UKFA 1KSSA 1GT8A 5KVHA 1D4EA 2B9WA 2J3NA 3ATQA 4WCTA 3AE1A 3NH3X 1ZX9A 4YSXA 2HQMA 2FJDA 3P4SA 3AYIA 1PBFA 3NN0X 3NTAA 5KWFA 2DKIA 2VZ2A 2BC1A 5JCNA 3UP4A 1NHQA 1E1LA 2IIDA 4U8MA 1YQ4A 1S2YA 2XFPA 2BS4A 3QJ4A 2XVIA 1QLBA 2BACA 2RABA 3AEDA 2C64A 2Q0LA 3PO7A 2X8HA 1M64A 1LPFA 3GWDA 4U2SA 1B8SA 3DJGX 3RP7A 1TRBA 3AD7B 3UTFA 1PBDA 3FG2P 2VVMA 2YLWA 2WHDA 2V61A 2WDVA 3G5QA 3OC4A 2GR1A 1JNZA 3UKHA 4AT0A 2OA1A 4H4VA 4AOSA 1N4VA 3AD8B 3AE7A 1PBCA 4K5RA 3T37A 4BJYA 4JN9A 3GSIA 5FS7A 5HYMA 4NEVA 2VQBA 2X3NA 4J2WA 1P2HA 2WP5A 3P4PA 1S2QA 2DKHA 4EQXA 4M52A 1DODA 3ICSA 2GR3A 2OLNA 2Z5XA 4RG4A 1GRGA 2GH5A 2R46A 2C72A 3F8PA 2WPCA 1DNCA 2GF3A 4H4XA 2E1MA 2H88A 4H2NA 1BWCA 4Z2RA 2PHHA 1H82A 3AEGA 1K0LA 4X9NA 1Q1RA 4A79A 4EMIA 1XDIA 2VVLA 2EQ6A 3CNSA 1H83A 5HY5A 4OCGA 2JB2A 1F8WA 1GRAA 2X50A 4OPDA 4Z25A 2BCGG 1GESA 3DH9A 4TLZA 4BK2A 1KNRA 3NIXA 4OPUA 1PXBA 3QSSA 2BXRA 2C67A 2YG6A 4Y4NA 5EOWA 3S61A 3CPHG 2QAEA 2WOIA 5IQ4A 2GR2A 3ICTA 1GXFA 4BV6A 4EM3A 1CHUA 2BCPA 1IUWA 4USQA 1CJ3A 3FPZA 3GD4A 2YR6A 2WBAA 4ZN0A 2CFYA 1OJCA 4Z43A 1PS9A 4U8KA 2FJAA 2Y6QA 1JRZA 3AE4A 2RGJA 1ZKQA 1H7XA 3AE2A 1IJHA 3DK8A 3IHGA 3AXBA 5U25A 1Z6LA 3GDPA 5BRTA 2FBWA 3DGHA 1FCDA 1O95A 1DOCA 4XXGA 2C7GA 2JKCA 1PN0A 1FECA 2BK5A 2GR0A 3BHKA 1H6VA 4GR1A 4IVMB 3CIRA 2WOWA 1NPXA 4N9XA 4ZCDA 1JEHA 2UZZA 4OPTA 3REDA 3H8LA 2WP9A 3SQPA 4J33A 5J60A 1BGJA 4J57A 1ZP0A 4XWRA 1NDAA 1YQ3A 2JBVA 3IF9A 3Q6JA 4H2QA 4OPLA 4U2LA 1OJ9A 1VQWA 2R4JA 3C4AA 3K7MX 3NTDA 4BK1A 1S3EA 4CCQA 3C4NA 3SFDA 4J34A 1K0IA 1O5WA 4A7AA 1GPEA 3ITJA 4H4ZA 4CNJA 3ALJA 1LVLA 4USRA 1PBBA 1K0JA 3D8XA 5M10A 1TDEA 4MJWA 3UKQA 2TPRA 3DJDA 3AE6A 2VVLG 3S5WA 1EL8A 5KXJA 1MXTA 1DXLA 1KFYA 2X99A 3DA1A 2C66A 1L9DA 2WS3A 4OPGA 4AP3A 1TDKA 2GVCA 2I0ZA 3LJPA 1JRXA 4H4PA 1GSNA 3DJEA 3K30A 1GV4A 1NENA 3GYIA 4U8OA 4C5OA 1EL7A 5IPYA 3AEEA 1GNDA 1KSUA 2XLSA 3GYJA 2A87A 4U8LA 2APGA 4HA6A 4NZHA 3K7TA 1DOEA 5KOWA 3FBSA 4H4QA 1KDGA 2XVJA 1NHSA 3AB1A 4H7UA 1LQUA 3UTEA 1MOKA 1IUSA 4OVIA 4ZCCA 3Q9TA 4AOXA 1M6IA 2CVJA 2XYOA 3AEAA 3CGBA 1NHRA 4GF7A 4GRTA 2YM1A 4YTMA 1B37A 1NEKA 1TDOA 3NRNA 4BK3A 3D1CA 1GERA 4OPIA 5C2TA 1Q1WA 3CTYA 4AP1A 2B7RA 4YSHA 3BI2A 4REKA 4YKFA 4B63A 3BI5A 3II4A 4GDPA 3UOXA 4Z26A 3DK9A 4LIIA 3GD3A 1Y56B 4YXDA 1F6MA 2IVEA 1VG9A 3QVPA 4JQ9A 2WQYA 3NNEA 4UDRA 2RGOA 4K22A 1FL2A 2R4EA 5BVAA 1NG3A 1RP0A 4O5QA 4H4WA 3UKLA 2YLRA 3AEFA 3CPJG 3P1WA 1V59A 3EF6A 2R45A 5DBJA 3HZLA 4NEWA 3PVCA 2BYBA 4IVOB 2VQ7A 4JNAA 3UKKA 4EMJA 3K7QX 1IUUA 3ABVA 4JY3A 3PS9A 4LU6A 3NG7X 1JU2A 3KA7A 2V3AA 2IVDA 3M13A 2B9YA 3G5RA 3UTGA 2YR5A 2Z5YA 1L9CA 4FK1A 1FOHA 1YKJA 2B9XA 1VDCA 1H84A 1CC2A 3KLJA 4E0VA 4P9SA 3P4RA 2GB0A 1GRBA 2OLOA 4X4JA 2ARDA 2XVHA 4XWZA 5ER0A 4YSYA 5HXIA 2WPEA 1NHPA 2O9ZA 1D4DA 3NT6A 4J36A 4TM0A 1E1MA 4H4UA 3P4QA 2R0GA 2A89A 3R9UA 3IWAA 3VQRA 2YVFA 3B3RA 1GALA 4YTPA 3AE9A 3LZWA 4Z24A 4OPCA 3SFEA 1TYPA 1H81A 1K4QA 3IC9A 1REOA 4Z44A 3V76A 3M12A 1COYA 1YQZA 3FIMB 1FEBA 3O0HA 4H4YA 4DNAA 1E1KA 2BK4A 4GCMA 1OJDA 1N4WA 4IV9A 2YLXA 4EQRA 1TDFA 4GDEA 1D4CA 1LQTA 2YQUA 3I6DA 1BF3A 4JDRA 4ECHA 1N4UA 2R0PA 1PBEA 3C96A 3CNJA 3AYLA 2R9ZA 3KKJA 2C3CA 2VRMA 3E1TA 2V5ZA 2YG3A 4KX6A 5LV9A 2GMHA 1DJQA 4YTNA 4H4SA 2AR8A 5FMHA 1XHCA 2RGHA 3GDNA 2YLSA 3KU9A 2YWLA 5JCMA 4H4TA 1ZK7A 3RNMA 5U63A 3EAOA 4Y4LA 1PJ6A 3BNUA 1LV0A 3QSEA 4AT2A 1KNPA 1GRFA 1LJ1A 4YT0A 1QO8A 1HYUA 4U8NA 1IUVA 2XFUA 3OZ2A 1B5QA 1TYTA 4KPRA 5CKUA 1Y0PA 3ATRA 4B66A 4D04A 3DJJA 4UP3A 4HB9A 3URHA 4FDCB 2XLRA 2GV8A 1E39A 2WP6A 4A65A 1ZY8A 3AE5A 4C3XA 4GUVA 4BURA 4CY8A 3CN8A 2V3BA 1ZMDA 1GTEA 3L1RA 2V60A 5CQFA 1BGNA 2XVFA 5L46A 2YLTA 4DGKA 1CJ2A 2PYXA 3LXDA 1H86A 4FK1C 4C74A 4PAAA 4CBQA 2XLTA 1CL0A 4UDQA 1MO9A 1YY5A 1O94A 3ZDNA 1ZMCA 2YG7A 5JCIA 4FX9A 2XLUA 1D5TA 3H8IA 3NN6X 3CNTA 1F8SA 5JCKA 1JOAA 2GQWA 3SGLA 2WU2A 4YSZA 2XFNA 2H89A 3DK4A 4TLXA 5U1OA 3RHAA 3VRAA 2BC0A 4U2TA 1IUTA 3IHMA 4B67A 4PABA 4CNKA 2YM2A 4NTDA 2EQ7A 4IA6A 3QVRA 4RG3A 1Y56A 2R0CA 3CGDA 1F8RA 2GRTA 3SM8A 5J7XA 2C73A 3NHOX 2YAUA 2WU5A 4CCRA 3BNMA 2VRLA 4Y4MA 3ZYXA 2QCUA 4K2XA 2X8GA 2JK6A 5FS9A 2JB1A 4EQWA 3UCLA 5EB5A 4LA1A 3UP5A 3RP8A 1H7WA 2ZBWA 4J31A 2BS2A 2CDUA 4H2RA 4EMWA 3DMEA 2YVJA 3V3OA 3V3NA 5HHFA 2GMJA 3I3LA 2XFQA 4TM1A 2Q6UA 3F8RA 1GETA 3NKSA 1NG4A 2YG5A 4U8JA 1PXAA 3M0OA 4B1BA 4A6NB 2GAGB 1P2EA 1E6EA 2WEUA 3BI4A 3CPIG 2YR4A 3CGEA 3QFAA 1PXCA 4UDPA 2Y6RA 4EQSA 3NYEA 2BABA 3NYCA 1GOSA 3LOVA 4DSHA 3AE8A 3CNDA 3GMCA 4O5UA 2WDQA 1CC4A 2C76A 4I59A 4H4RA 3UOVA 1TDNA 4EIPA 1S3BA 2ACZA 5KRQA 2YVGA 4B69A 3L8KA 4A5LA 5KVIA 1UKVG 2BA9A 3NK2X 3NGCX 1IUXA
chains in the Genus database with same CATH superfamily
4K8DA 3CNPA 5EBKA 1DJNA 1BZLA 1XANA 2JAEA 4A99A 4J56A 4YWOA 1B4VA 2FJBA 2JB3A 1GTHA 2NPXA 5C3JA 2E5VA 3NK0X 5FS8A 1L9EA 3AECA 4X9MA 5BUKA 1E7PA 1EBDA 2BXSA 4C3YA 2BRAA 4TM4A 5IQ1A 3KPKA 3GWFA 3LZXA 3ALLA 3FMWA 2V6OA 2W0HA 1PHHA 5FS6A 2WPFA 1LTXR 3H4KA 2Q7VA 1CF3A 3P9UA 2QA2A 5EB4A 1X31B 4BJZA 3DGZA 1GREA 3ICRA 3UKAA 2EQ9A 4YKGA 4Z2TA 1F3PA 3AE3A 3KVEA 4GAPA 2F5ZA 4EM4A 3ALMA 4WX1A 2QA1A 3AEBA 3JSKA 1E1NA 1Q9IA 1FEAA 1EL9A 1JRYA 5M0ZA 3GRTA 5KMRA 2GQFA 3CGCA 4CRTA 1ZDLA 2C75A 3EPTA 1ZOVA 4IA5A 3AWIA 3UKPA 4B68A 1CC6A 3VRDB 3UTHA 3UOYA 2AQJA 3LADA 1D7LA 4NTEA 4U8IA 4B64A 4C77A 1DOBA 1L0VA 3QFBA 4CY6A 4B65A 1PJ5A 2GAHB 3SYIA 2B76A 2XVEA 4RSLA 5TR3A 2C3DA 4K5SA 3QSMA 3G5SA 4U8PA 2WETA 3F8DA 3UOZA 4DSGA 4TM3A 4EIQA 5BULA 1CJCA 2YG4A 1W4XA 1VG0A 3VR8A 5KOXA 2CULA 2Q0KA 4NNJA 4A6NA 5KMQA 2X8CA 2OAMA 3RP6A 1PJ7A 2WESA 3ISHA 3VRBA 3NK1X 1N1PA 2XLPA 2BK3A 5GSNA 2C70A 3B6DA 3BHFA 2FJEA 4D03A 1ELIA 3WE0A 4NWZA 1PDHA 5JCLA 1OJAA 1KF6A 2C65A 4I58A 3AYJA 3EANA 2WOVA 1RYIA 1QJDA 4H2PA 3HYWA 3COXA 3KPFA 2NVKX 1GRHA 1NAAA 4ICYA 1CBOA 1ZOYA 2BS3A 1EL5A 4K7ZA 5KNLA 1RSGA 3GRSA 3ADAB 1XPQA 3GMBA 4ADWA 1AOGA 1BKWA 2E4GA 2B7SA 2XFOA 2ZZCA 3NYFA 4APNA 1OJTA 2AAQA 1VRQB 4H50A 3VR9A 1ONFA 1GRTA 2VOUA 2XCGA 1D7YA 3KD9A 3NLCA 1CJ4A 2A8XA 2EQ8A 1JNRA 2XDOA 1SEZA 2GEWA 2WDRA 4NTCA 3LB8A 2TMDA 2YLZA 4JNQA 5GRTA 2ZZ0A 4JY2A 3AD9B 2ZZBA 1GEUA 4Z2UA 3SZWA 2OALA 4A9WA 3UKFA 1KSSA 1GT8A 5KVHA 1D4EA 2B9WA 2J3NA 3ATQA 4WCTA 3AE1A 3NH3X 1ZX9A 4YSXA 2HQMA 2FJDA 3P4SA 3AYIA 1PBFA 3NN0X 3NTAA 4G9KA 5KWFA 2DKIA 2VZ2A 2BC1A 5JCNA 3UP4A 1NHQA 1E1LA 2IIDA 4U8MA 1YQ4A 1S2YA 2XFPA 2BS4A 3QJ4A 2XVIA 1QLBA 2BACA 2RABA 3AEDA 2C64A 2Q0LA 3PO7A 2X8HA 1M64A 1LPFA 3GWDA 4U2SA 1B8SA 3DJGX 3RP7A 1TRBA 3AD7B 3UTFA 1PBDA 3FG2P 2VVMA 2YLWA 2WHDA 2V61A 2WDVA 3G5QA 3OC4A 2GR1A 1JNZA 3UKHA 4AT0A 2OA1A 4H4VA 3CMMA 4AOSA 1N4VA 3AD8B 3AE7A 1PBCA 4K5RA 3T37A 4BJYA 4JN9A 3GSIA 5FS7A 5HYMA 4NEVA 2VQBA 2X3NA 4J2WA 1P2HA 2WP5A 3P4PA 1S2QA 2DKHA 4EQXA 4M52A 1DODA 3ICSA 3T2YA 2GR3A 2OLNA 2Z5XA 4RG4A 1GRGA 2GH5A 2R46A 2C72A 3F8PA 2WPCA 1DNCA 2GF3A 4H4XA 2E1MA 2H88A 4H2NA 1BWCA 4Z2RA 2PHHA 1H82A 3AEGA 1K0LA 4X9NA 1Q1RA 4A79A 4EMIA 1XDIA 2VVLA 2EQ6A 3CNSA 1H83A 5HY5A 4OCGA 2JB2A 1F8WA 1GRAA 2X50A 4OPDA 4Z25A 2BCGG 1GESA 3DH9A 4TLZA 4BK2A 1KNRA 3NIXA 4OPUA 1PXBA 3QSSA 2BXRA 2C67A 2YG6A 4Y4NA 5EOWA 3S61A 3CPHG 2QAEA 2WOIA 5IQ4A 2GR2A 3ICTA 1GXFA 4BV6A 4EM3A 1CHUA 2BCPA 1IUWA 4USQA 1CJ3A 3FPZA 3GD4A 2YR6A 2WBAA 4ZN0A 2CFYA 1OJCA 3SZCA 4Z43A 1PS9A 4U8KA 2FJAA 2Y6QA 1JRZA 3AE4A 2RGJA 1ZKQA 1H7XA 3AE2A 1IJHA 3DK8A 3IHGA 3AXBA 4II3A 5U25A 1Z6LA 3GDPA 5BRTA 2FBWA 3DGHA 1FCDA 1O95A 1DOCA 4XXGA 2C7GA 2JKCA 1PN0A 1FECA 2BK5A 2GR0A 3BHKA 1H6VA 4GR1A 4IVMB 3CIRA 2WOWA 1NPXA 4N9XA 4ZCDA 1JEHA 2UZZA 4OPTA 3REDA 3H8LA 2WP9A 3SQPA 4J33A 5J60A 1BGJA 4J57A 1ZP0A 4XWRA 1NDAA 1YQ3A 2JBVA 3IF9A 3Q6JA 4H2QA 4OPLA 4U2LA 1OJ9A 1VQWA 2R4JA 3C4AA 3K7MX 3NTDA 4BK1A 1S3EA 4CCQA 3C4NA 3SFDA 4J34A 1K0IA 1O5WA 4A7AA 1GPEA 3ITJA 4H4ZA 4CNJA 3ALJA 1LVLA 4USRA 1PBBA 1K0JA 3D8XA 4G6GA 5M10A 1TDEA 4MJWA 3UKQA 2TPRA 3DJDA 3AE6A 2VVLG 3S5WA 1EL8A 5KXJA 1MXTA 1DXLA 1KFYA 2X99A 3DA1A 2C66A 1L9DA 2WS3A 4OPGA 4AP3A 1TDKA 2GVCA 2I0ZA 3LJPA 1JRXA 4H4PA 1GSNA 3DJEA 3K30A 1GV4A 1NENA 3GYIA 4U8OA 4C5OA 1EL7A 5IPYA 3AEEA 1GNDA 1KSUA 2XLSA 3GYJA 3T2ZA 2A87A 4U8LA 2APGA 4HA6A 4NZHA 3K7TA 1DOEA 5KOWA 3FBSA 2C4CA 4H4QA 1KDGA 2XVJA 1NHSA 3AB1A 4H7UA 1LQUA 3UTEA 1MOKA 1IUSA 4OVIA 4ZCCA 3Q9TA 4AOXA 1M6IA 2CVJA 2XYOA 3AEAA 3CGBA 1NHRA 4GF7A 4GRTA 2YM1A 4YTMA 1B37A 1NEKA 1TDOA 3NRNA 4BK3A 3D1CA 1GERA 4OPIA 5C2TA 4GAVA 1Q1WA 3CTYA 4AP1A 2B7RA 4YSHA 3BI2A 4REKA 4YKFA 4B63A 3BI5A 3II4A 4GDPA 3UOXA 4Z26A 3DK9A 4LIIA 3GD3A 1Y56B 4YXDA 1F6MA 2IVEA 1VG9A 3QVPA 4JQ9A 2WQYA 3NNEA 4UDRA 2RGOA 4K22A 1FL2A 2R4EA 3T0KA 5BVAA 1NG3A 1RP0A 4O5QA 4H4WA 3UKLA 2YLRA 3AEFA 3GYXA 3CPJG 3P1WA 1V59A 3EF6A 2R45A 5DBJA 3HZLA 4NEWA 3PVCA 2BYBA 4IVOB 2VQ7A 4JNAA 3UKKA 4EMJA 4G73A 3K7QX 1IUUA 3ABVA 4JY3A 4G74A 3PS9A 4LU6A 3NG7X 1JU2A 3KA7A 2V3AA 2IVDA 3M13A 2B9YA 3G5RA 3UTGA 2YR5A 2Z5YA 1L9CA 4FK1A 1FOHA 1YKJA 2B9XA 1VDCA 1H84A 1CC2A 3KLJA 4E0VA 4P9SA 3P4RA 2GB0A 1GRBA 2OLOA 4X4JA 2ARDA 2XVHA 4XWZA 5ER0A 4YSYA 5HXIA 2WPEA 1NHPA 2O9ZA 1D4DA 3NT6A 4J36A 4TM0A 1E1MA 4H4UA 3P4QA 2R0GA 2A89A 3R9UA 3IWAA 3VQRA 2YVFA 3B3RA 1GALA 4YTPA 3SXIA 3AE9A 3LZWA 4Z24A 4OPCA 3SFEA 1TYPA 1H81A 1K4QA 3IC9A 1REOA 4Z44A 3V76A 3M12A 1COYA 1YQZA 3FIMB 1FEBA 3O0HA 4H4YA 4DNAA 1E1KA 2BK4A 4GCMA 1OJDA 1N4WA 4IV9A 2YLXA 4EQRA 1TDFA 4GDEA 1D4CA 1LQTA 2YQUA 3I6DA 1BF3A 4JDRA 4ECHA 1N4UA 2R0PA 1PBEA 3C96A 3CNJA 3AYLA 3T31A 2R9ZA 3KKJA 2C3CA 2VRMA 3E1TA 2V5ZA 2YG3A 4KX6A 5LV9A 2GMHA 1DJQA 2BRYA 4YTNA 4H4SA 2AR8A 5FMHA 1XHCA 2RGHA 3GDNA 2YLSA 3SZFA 4II2A 3KU9A 2YWLA 5JCMA 4H4TA 1ZK7A 3RNMA 5KMSA 5U63A 3EAOA 4Y4LA 1PJ6A 3BNUA 1LV0A 3QSEA 4AT2A 1KNPA 1GRFA 1LJ1A 4YT0A 1QO8A 1HYUA 4U8NA 1IUVA 2XFUA 3OZ2A 1B5QA 1TYTA 4KPRA 5CKUA 1Y0PA 3ATRA 4B66A 4D04A 3DJJA 4UP3A 4HB9A 3URHA 4FDCB 2XLRA 2GV8A 1E39A 2WP6A 4A65A 3T2KA 1ZY8A 3AE5A 4C3XA 4GUVA 4BURA 4CY8A 3CN8A 2V3BA 1ZMDA 1GTEA 3L1RA 2V60A 5CQFA 1BGNA 2XVFA 5L46A 2YLTA 4DGKA 1CJ2A 2PYXA 3LXDA 1H86A 4FK1C 4C74A 4PAAA 4CBQA 2XLTA 1CL0A 4UDQA 1MO9A 1YY5A 1O94A 3ZDNA 1ZMCA 2YG7A 5JCIA 4FX9A 2XLUA 1D5TA 3H8IA 3NN6X 3CNTA 1F8SA 5JCKA 1JOAA 2GQWA 3SGLA 2WU2A 4YSZA 2XFNA 2H89A 3DK4A 4TLXA 5U1OA 3RHAA 3SX6A 3VRAA 2BC0A 4U2TA 1IUTA 3IHMA 4B67A 4PABA 4CNKA 2YM2A 4NTDA 2EQ7A 4IA6A 3QVRA 4RG3A 3T14A 1Y56A 2R0CA 3CGDA 1F8RA 2GRTA 3SM8A 5J7XA 2C73A 3NHOX 2YAUA 2WU5A 4CCRA 3BNMA 2VRLA 4Y4MA 3ZYXA 2QCUA 4K2XA 2X8GA 2JK6A 5FS9A 2JB1A 4EQWA 3UCLA 5EB5A 4LA1A 3HYVA 3UP5A 3RP8A 1H7WA 2ZBWA 4J31A 2BS2A 2CDUA 4H2RA 3SZ0A 4EMWA 3DMEA 2YVJA 3V3OA 3V3NA 5HHFA 2GMJA 3I3LA 2XFQA 4TM1A 2Q6UA 3F8RA 1GETA 3NKSA 1NG4A 2YG5A 4U8JA 1PXAA 3M0OA 4B1BA 4A6NB 2GAGB 1P2EA 1E6EA 2WEUA 3BI4A 3CPIG 2YR4A 3CGEA 3QFAA 1PXCA 4UDPA 2Y6RA 3SY4A 4EQSA 3NYEA 2BABA 3NYCA 1GOSA 3LOVA 4DSHA 5KMPA 3AE8A 3CNDA 3GMCA 4G6HA 4O5UA 3HYXA 2WDQA 1CC4A 2C76A 4I59A 4H4RA 3UOVA 1TDNA 4EIPA 1S3BA 2ACZA 5KRQA 2YVGA 4B69A 3L8KA 4A5LA 5KVIA 1UKVG 2BA9A 3NK2X 3NGCX 1IUXA
chains in the Genus database with same CATH topology
4K8DA 3CNPA 5EBKA 1DJNA 1BZLA 1XANA 2JAEA 4A99A 4J56A 4YWOA 1B4VA 2FJBA 2JB3A 1GTHA 2NPXA 5C3JA 2E5VA 3NK0X 5FS8A 1L9EA 3AECA 4X9MA 5BUKA 1E7PA 1EBDA 2BXSA 4C3YA 2BRAA 4TM4A 5IQ1A 3KPKA 3GWFA 3LZXA 3ALLA 3FMWA 2V6OA 2W0HA 1PHHA 5FS6A 2WPFA 1LTXR 3H4KA 2Q7VA 1CF3A 3P9UA 2QA2A 5EB4A 1X31B 4BJZA 3DGZA 1GREA 3ICRA 3UKAA 2EQ9A 4YKGA 4Z2TA 1F3PA 3AE3A 3KVEA 4GAPA 2F5ZA 4EM4A 3ALMA 4WX1A 2QA1A 3AEBA 3JSKA 1E1NA 1Q9IA 1FEAA 1EL9A 1JRYA 5M0ZA 3GRTA 5KMRA 2GQFA 3CGCA 4CRTA 1ZDLA 2C75A 3EPTA 1ZOVA 4IA5A 3AWIA 3UKPA 4B68A 1CC6A 3VRDB 3UTHA 3UOYA 2AQJA 3LADA 1D7LA 4NTEA 4U8IA 4B64A 4C77A 1DOBA 1L0VA 3QFBA 4CY6A 4B65A 1PJ5A 2GAHB 3SYIA 2B76A 2XVEA 4RSLA 5TR3A 2C3DA 4K5SA 3QSMA 3G5SA 4U8PA 2WETA 3F8DA 3UOZA 4DSGA 4TM3A 4EIQA 5BULA 1CJCA 2YG4A 1W4XA 1VG0A 3VR8A 5KOXA 2CULA 2Q0KA 4NNJA 4A6NA 5KMQA 2X8CA 2OAMA 3RP6A 1PJ7A 2WESA 3ISHA 3VRBA 3NK1X 1N1PA 2XLPA 2BK3A 5GSNA 2C70A 3B6DA 3BHFA 2FJEA 4D03A 1ELIA 3WE0A 4NWZA 1PDHA 5JCLA 1OJAA 1KF6A 2C65A 4I58A 3AYJA 3EANA 2WOVA 1RYIA 1QJDA 4H2PA 3HYWA 3COXA 3KPFA 2NVKX 1GRHA 1NAAA 4ICYA 1CBOA 1ZOYA 2BS3A 1EL5A 4K7ZA 5KNLA 1RSGA 3GRSA 3ADAB 1XPQA 3GMBA 4ADWA 1AOGA 1BKWA 2E4GA 2B7SA 2XFOA 2ZZCA 3NYFA 4APNA 1OJTA 2AAQA 1VRQB 4H50A 3VR9A 1ONFA 1GRTA 2VOUA 2XCGA 1D7YA 3KD9A 3NLCA 1CJ4A 2A8XA 2EQ8A 1JNRA 2XDOA 1SEZA 2GEWA 2WDRA 4NTCA 3LB8A 2TMDA 2YLZA 4JNQA 5GRTA 2ZZ0A 4JY2A 3AD9B 2ZZBA 1GEUA 4Z2UA 3SZWA 2OALA 4A9WA 3UKFA 1KSSA 1GT8A 5KVHA 1D4EA 2B9WA 2J3NA 3ATQA 4WCTA 3AE1A 3NH3X 1ZX9A 4YSXA 2HQMA 2FJDA 3P4SA 3AYIA 1PBFA 3NN0X 3NTAA 4G9KA 5KWFA 2DKIA 2VZ2A 2BC1A 5JCNA 3UP4A 1NHQA 1E1LA 2IIDA 4U8MA 1YQ4A 1S2YA 2XFPA 2BS4A 3QJ4A 2XVIA 1QLBA 2BACA 2RABA 3AEDA 2C64A 2Q0LA 3PO7A 2X8HA 1M64A 1LPFA 3GWDA 4U2SA 1B8SA 3DJGX 3RP7A 1TRBA 3AD7B 3UTFA 1PBDA 3FG2P 2VVMA 2YLWA 2WHDA 2V61A 2WDVA 3G5QA 3OC4A 2GR1A 1JNZA 3UKHA 4AT0A 2OA1A 4H4VA 3CMMA 4AOSA 1N4VA 3AD8B 3AE7A 1PBCA 4K5RA 3T37A 4BJYA 4JN9A 3GSIA 5FS7A 5HYMA 4NEVA 2VQBA 2X3NA 4J2WA 1P2HA 2WP5A 3P4PA 1S2QA 2DKHA 4EQXA 4M52A 1DODA 3ICSA 3T2YA 2GR3A 2OLNA 2Z5XA 4RG4A 1GRGA 2GH5A 2R46A 2C72A 3F8PA 2WPCA 1DNCA 2GF3A 4H4XA 2E1MA 2H88A 4H2NA 1BWCA 4Z2RA 2PHHA 1H82A 3AEGA 1K0LA 4X9NA 1Q1RA 4A79A 4EMIA 1XDIA 2VVLA 2EQ6A 3CNSA 1H83A 5HY5A 4OCGA 2JB2A 1F8WA 1GRAA 2X50A 4OPDA 4Z25A 2BCGG 1GESA 3DH9A 4TLZA 4BK2A 1KNRA 3NIXA 4OPUA 1PXBA 3QSSA 2BXRA 2C67A 2YG6A 4Y4NA 5EOWA 3S61A 3CPHG 2QAEA 2WOIA 5IQ4A 2GR2A 3ICTA 1GXFA 4BV6A 4EM3A 1CHUA 2BCPA 1IUWA 4USQA 1CJ3A 3FPZA 3GD4A 2YR6A 2WBAA 4ZN0A 2CFYA 1OJCA 3SZCA 4Z43A 1PS9A 4U8KA 2FJAA 2Y6QA 1JRZA 3AE4A 2RGJA 1ZKQA 1H7XA 3AE2A 1IJHA 3DK8A 3IHGA 3AXBA 4II3A 5U25A 1Z6LA 3GDPA 5BRTA 2FBWA 3DGHA 1FCDA 1O95A 1DOCA 4XXGA 2C7GA 2JKCA 1PN0A 1FECA 2BK5A 2GR0A 3BHKA 1H6VA 4GR1A 4IVMB 3CIRA 2WOWA 1NPXA 4N9XA 4ZCDA 1JEHA 2UZZA 4OPTA 3REDA 3H8LA 2WP9A 3SQPA 4J33A 5J60A 1BGJA 4J57A 1ZP0A 4XWRA 1NDAA 1YQ3A 2JBVA 3IF9A 3Q6JA 4H2QA 4OPLA 4U2LA 1OJ9A 1VQWA 2R4JA 3C4AA 3K7MX 3NTDA 4BK1A 1S3EA 4CCQA 3C4NA 3SFDA 4J34A 1K0IA 1O5WA 4A7AA 1GPEA 3ITJA 4H4ZA 4CNJA 3ALJA 1LVLA 4USRA 1PBBA 1K0JA 3D8XA 4G6GA 5M10A 1TDEA 4MJWA 3UKQA 2TPRA 3DJDA 3AE6A 2VVLG 3S5WA 1EL8A 5KXJA 1MXTA 1DXLA 1KFYA 2X99A 3DA1A 2C66A 1L9DA 2WS3A 4OPGA 4AP3A 1TDKA 2GVCA 2I0ZA 3LJPA 1JRXA 4H4PA 1GSNA 3DJEA 3K30A 1GV4A 1NENA 3GYIA 4U8OA 4C5OA 1EL7A 5IPYA 3AEEA 1GNDA 1KSUA 2XLSA 3GYJA 3T2ZA 2A87A 4U8LA 2APGA 4HA6A 4NZHA 3K7TA 1DOEA 5KOWA 3FBSA 2C4CA 4H4QA 1KDGA 2XVJA 1NHSA 3AB1A 4H7UA 1LQUA 3UTEA 1MOKA 1IUSA 4OVIA 4ZCCA 3Q9TA 4AOXA 1M6IA 2CVJA 2XYOA 3AEAA 3CGBA 1NHRA 4GF7A 4GRTA 2YM1A 4YTMA 1B37A 1NEKA 1TDOA 3NRNA 4BK3A 3D1CA 1GERA 4OPIA 5C2TA 4GAVA 1Q1WA 3CTYA 4AP1A 2B7RA 4YSHA 3BI2A 4REKA 4YKFA 4B63A 3BI5A 3II4A 4GDPA 3UOXA 4Z26A 3DK9A 4LIIA 3GD3A 1Y56B 4YXDA 1F6MA 2IVEA 1VG9A 3QVPA 4JQ9A 2WQYA 3NNEA 4UDRA 2RGOA 4K22A 1FL2A 2R4EA 3T0KA 5BVAA 1NG3A 1RP0A 4O5QA 4H4WA 3UKLA 2YLRA 3AEFA 3GYXA 3CPJG 3P1WA 1V59A 3EF6A 2R45A 5DBJA 3HZLA 4NEWA 3PVCA 2BYBA 4IVOB 2VQ7A 4JNAA 3UKKA 4EMJA 4G73A 3K7QX 1IUUA 3ABVA 4JY3A 4G74A 3PS9A 4LU6A 3NG7X 1JU2A 3KA7A 2V3AA 2IVDA 3M13A 2B9YA 3G5RA 3UTGA 2YR5A 2Z5YA 1L9CA 4FK1A 1FOHA 1YKJA 2B9XA 1VDCA 1H84A 1CC2A 3KLJA 4E0VA 4P9SA 3P4RA 2GB0A 1GRBA 2OLOA 4X4JA 2ARDA 2XVHA 4XWZA 5ER0A 4YSYA 5HXIA 2WPEA 1NHPA 2O9ZA 1D4DA 3NT6A 4J36A 4TM0A 1E1MA 4H4UA 3P4QA 2R0GA 2A89A 3R9UA 3IWAA 3VQRA 2YVFA 3B3RA 1GALA 4YTPA 3SXIA 3AE9A 3LZWA 4Z24A 4OPCA 3SFEA 1TYPA 1H81A 1K4QA 3IC9A 1REOA 4Z44A 3V76A 3M12A 1COYA 1YQZA 3FIMB 1FEBA 3O0HA 4H4YA 4DNAA 1E1KA 2BK4A 4GCMA 1OJDA 1N4WA 4IV9A 2YLXA 4EQRA 1TDFA 4GDEA 1D4CA 1LQTA 2YQUA 3I6DA 1BF3A 4JDRA 4ECHA 1N4UA 2R0PA 1PBEA 3C96A 3CNJA 3AYLA 3T31A 2R9ZA 3KKJA 2C3CA 2VRMA 3E1TA 2V5ZA 2YG3A 4KX6A 5LV9A 2GMHA 1DJQA 2BRYA 4YTNA 4H4SA 2AR8A 5FMHA 1XHCA 2RGHA 3GDNA 2YLSA 3SZFA 4II2A 3KU9A 2YWLA 5JCMA 4H4TA 1ZK7A 3RNMA 5KMSA 5U63A 3EAOA 4Y4LA 1PJ6A 3BNUA 1LV0A 3QSEA 4AT2A 1KNPA 1GRFA 1LJ1A 4YT0A 1QO8A 1HYUA 4U8NA 1IUVA 2XFUA 3OZ2A 1B5QA 1TYTA 4KPRA 5CKUA 1Y0PA 3ATRA 4B66A 4D04A 3DJJA 4UP3A 4HB9A 3URHA 4FDCB 2XLRA 2GV8A 1E39A 2WP6A 4A65A 3T2KA 1ZY8A 3AE5A 4C3XA 4GUVA 4BURA 4CY8A 3CN8A 2V3BA 1ZMDA 1GTEA 3L1RA 2V60A 5CQFA 1BGNA 2XVFA 5L46A 2YLTA 4DGKA 1CJ2A 2PYXA 3LXDA 1H86A 4FK1C 4C74A 4PAAA 4CBQA 2XLTA 1CL0A 4UDQA 1MO9A 1YY5A 1O94A 3ZDNA 1ZMCA 2YG7A 5JCIA 4FX9A 2XLUA 1D5TA 3H8IA 3NN6X 3CNTA 1F8SA 5JCKA 1JOAA 2GQWA 3SGLA 2WU2A 4YSZA 2XFNA 2H89A 3DK4A 4TLXA 5U1OA 3RHAA 3SX6A 3VRAA 2BC0A 4U2TA 1IUTA 3IHMA 4B67A 4PABA 4CNKA 2YM2A 4NTDA 2EQ7A 4IA6A 3QVRA 4RG3A 3T14A 1Y56A 2R0CA 3CGDA 1F8RA 2GRTA 3SM8A 5J7XA 2C73A 3NHOX 2YAUA 2WU5A 4CCRA 3BNMA 2VRLA 4Y4MA 3ZYXA 2QCUA 4K2XA 2X8GA 2JK6A 5FS9A 2JB1A 4EQWA 3UCLA 5EB5A 4LA1A 3HYVA 3UP5A 3RP8A 1H7WA 2ZBWA 4J31A 2BS2A 2CDUA 4H2RA 3SZ0A 4EMWA 3DMEA 2YVJA 3V3OA 3V3NA 5HHFA 2GMJA 3I3LA 2XFQA 4TM1A 2Q6UA 3F8RA 1GETA 3NKSA 1NG4A 2YG5A 4U8JA 1PXAA 3M0OA 4B1BA 4A6NB 2GAGB 1P2EA 1E6EA 2WEUA 3BI4A 3CPIG 2YR4A 3CGEA 3QFAA 1PXCA 4UDPA 2Y6RA 3SY4A 4EQSA 3NYEA 2BABA 3NYCA 1GOSA 3LOVA 4DSHA 5KMPA 3AE8A 3CNDA 3GMCA 4G6HA 4O5UA 3HYXA 2WDQA 1CC4A 2C76A 4I59A 4H4RA 3UOVA 1TDNA 4EIPA 1S3BA 2ACZA 5KRQA 2YVGA 4B69A 3L8KA 4A5LA 5KVIA 1UKVG 2BA9A 3NK2X 3NGCX 1IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8D A;  3CNP A;  5EBK A;  1DJN A;  1BZL A;  1XAN A;  2JAE A;  4A99 A;  4J56 A;  4YWO A;  1B4V A;  2FJB A;  2JB3 A;  1GTH A;  2NPX A;  5C3J A;  2E5V A;  3NK0 X;  5FS8 A;  1L9E A;  3AEC A;  4X9M A;  5BUK A;  1E7P A;  1EBD A;  2BXS A;  4C3Y A;  4TM4 A;  5IQ1 A;  3GWF A;  3LZX A;  3ALL A;  3FMW A;  2V6O A;  2W0H A;  1PHH A;  5FS6 A;  2WPF A;  1LTX R;  3H4K A;  2Q7V A;  1CF3 A;  3P9U A;  2QA2 A;  5EB4 A;  1X31 B;  4BJZ A;  3DGZ A;  1GRE A;  3ICR A;  3UKA A;  2EQ9 A;  4YKG A;  4Z2T A;  1F3P A;  3AE3 A;  3KVE A;  2F5Z A;  4EM4 A;  3ALM A;  4WX1 A;  2QA1 A;  3AEB A;  3JSK A;  1E1N A;  1Q9I A;  1FEA A;  1EL9 A;  1JRY A;  5M0Z A;  3GRT A;  2GQF A;  3CGC A;  4CRT A;  1ZDL A;  2C75 A;  3EPT A;  1ZOV A;  4IA5 A;  3AWI A;  3UKP A;  4B68 A;  1CC6 A;  3VRD B;  3UTH A;  3UOY A;  2AQJ A;  3LAD A;  1D7L A;  4NTE A;  4U8I A;  4B64 A;  4C77 A;  1DOB A;  1L0V A;  3QFB A;  4CY6 A;  4B65 A;  1PJ5 A;  2GAH B;  2B76 A;  2XVE A;  4RSL A;  5TR3 A;  2C3D A;  4K5S A;  3QSM A;  3G5S A;  4U8P A;  2WET A;  3F8D A;  3UOZ A;  4DSG A;  4TM3 A;  4EIQ A;  5BUL A;  1CJC A;  2YG4 A;  1W4X A;  1VG0 A;  3VR8 A;  5KOX A;  2CUL A;  2Q0K A;  4A6N A;  2X8C A;  2OAM A;  3RP6 A;  1PJ7 A;  2WES A;  3ISH A;  3VRB A;  3NK1 X;  1N1P A;  2XLP A;  2BK3 A;  5GSN A;  2C70 A;  3B6D A;  3BHF A;  2FJE A;  4D03 A;  1ELI A;  3WE0 A;  1PDH A;  5JCL A;  1OJA A;  1KF6 A;  2C65 A;  4I58 A;  3AYJ A;  3EAN A;  2WOV A;  1RYI A;  1QJD A;  4H2P A;  3COX A;  3KPF A;  2NVK X;  1GRH A;  1NAA A;  4ICY A;  1CBO A;  1ZOY A;  2BS3 A;  1EL5 A;  4K7Z A;  1RSG A;  3GRS A;  3ADA B;  1XPQ A;  3GMB A;  4ADW A;  1AOG A;  1BKW A;  2E4G A;  2B7S A;  2XFO A;  2ZZC A;  3NYF A;  4APN A;  1OJT A;  2AAQ A;  1VRQ B;  4H50 A;  3VR9 A;  1ONF A;  1GRT A;  2VOU A;  2XCG A;  1D7Y A;  3KD9 A;  3NLC A;  1CJ4 A;  2A8X A;  2EQ8 A;  1JNR A;  2XDO A;  1SEZ A;  2GEW A;  2WDR A;  4NTC A;  3LB8 A;  2TMD A;  2YLZ A;  4JNQ A;  5GRT A;  2ZZ0 A;  4JY2 A;  3AD9 B;  2ZZB A;  1GEU A;  4Z2U A;  2OAL A;  4A9W A;  3UKF A;  1KSS A;  1GT8 A;  5KVH A;  1D4E A;  2B9W A;  2J3N A;  3ATQ A;  4WCT A;  3AE1 A;  3NH3 X;  1ZX9 A;  4YSX A;  2HQM A;  2FJD A;  3P4S A;  3AYI A;  1PBF A;  3NN0 X;  3NTA A;  5KWF A;  2DKI A;  2VZ2 A;  2BC1 A;  5JCN A;  3UP4 A;  1NHQ A;  1E1L A;  2IID A;  4U8M A;  1YQ4 A;  1S2Y A;  2XFP A;  2BS4 A;  3QJ4 A;  2XVI A;  1QLB A;  2BAC A;  2RAB A;  3AED A;  2C64 A;  2Q0L A;  3PO7 A;  2X8H A;  1M64 A;  1LPF A;  3GWD A;  4U2S A;  1B8S A;  3DJG X;  3RP7 A;  1TRB A;  3AD7 B;  3UTF A;  1PBD A;  3FG2 P;  2VVM A;  2YLW A;  2WHD A;  2V61 A;  2WDV A;  3G5Q A;  3OC4 A;  2GR1 A;  1JNZ A;  3UKH A;  4AT0 A;  2OA1 A;  4H4V A;  4AOS A;  1N4V A;  3AD8 B;  3AE7 A;  1PBC A;  4K5R A;  3T37 A;  4BJY A;  4JN9 A;  3GSI A;  5FS7 A;  5HYM A;  4NEV A;  2VQB A;  2X3N A;  4J2W A;  1P2H A;  2WP5 A;  3P4P A;  1S2Q A;  2DKH A;  4EQX A;  4M52 A;  1DOD A;  3ICS A;  2GR3 A;  2OLN A;  2Z5X A;  4RG4 A;  1GRG A;  2GH5 A;  2R46 A;  2C72 A;  3F8P A;  2WPC A;  1DNC A;  2GF3 A;  4H4X A;  2E1M A;  2H88 A;  4H2N A;  1BWC A;  4Z2R A;  2PHH A;  1H82 A;  3AEG A;  1K0L A;  4X9N A;  1Q1R A;  4A79 A;  4EMI A;  1XDI A;  2VVL A;  2EQ6 A;  3CNS A;  1H83 A;  5HY5 A;  4OCG A;  2JB2 A;  1F8W A;  1GRA A;  2X50 A;  4OPD A;  4Z25 A;  2BCG G;  1GES A;  3DH9 A;  4TLZ A;  4BK2 A;  1KNR A;  3NIX A;  4OPU A;  1PXB A;  3QSS A;  2BXR A;  2C67 A;  2YG6 A;  4Y4N A;  5EOW A;  3S61 A;  3CPH G;  2QAE A;  2WOI A;  5IQ4 A;  2GR2 A;  3ICT A;  1GXF A;  4BV6 A;  4EM3 A;  1CHU A;  2BCP A;  1IUW A;  4USQ A;  1CJ3 A;  3FPZ A;  3GD4 A;  2YR6 A;  2WBA A;  4ZN0 A;  2CFY A;  1OJC A;  4Z43 A;  1PS9 A;  4U8K A;  2FJA A;  2Y6Q A;  1JRZ A;  3AE4 A;  2RGJ A;  1ZKQ A;  1H7X A;  3AE2 A;  1IJH A;  3DK8 A;  3IHG A;  3AXB A;  5U25 A;  1Z6L A;  3GDP A;  5BRT A;  2FBW A;  3DGH A;  1FCD A;  1O95 A;  1DOC A;  4XXG A;  2C7G A;  2JKC A;  1PN0 A;  1FEC A;  2BK5 A;  2GR0 A;  3BHK A;  1H6V A;  4GR1 A;  4IVM B;  3CIR A;  2WOW A;  1NPX A;  4N9X A;  4ZCD A;  1JEH A;  2UZZ A;  4OPT A;  3RED A;  3H8L A;  2WP9 A;  3SQP A;  4J33 A;  5J60 A;  1BGJ A;  4J57 A;  1ZP0 A;  4XWR A;  1NDA A;  1YQ3 A;  2JBV A;  3IF9 A;  3Q6J A;  4H2Q A;  4OPL A;  4U2L A;  1OJ9 A;  1VQW A;  2R4J A;  3C4A A;  3K7M X;  3NTD A;  4BK1 A;  1S3E A;  4CCQ A;  3C4N A;  3SFD A;  4J34 A;  1K0I A;  1O5W A;  4A7A A;  1GPE A;  3ITJ A;  4H4Z A;  4CNJ A;  3ALJ A;  1LVL A;  4USR A;  1PBB A;  1K0J A;  3D8X A;  5M10 A;  1TDE A;  4MJW A;  3UKQ A;  2TPR A;  3DJD A;  3AE6 A;  2VVL G;  3S5W A;  1EL8 A;  5KXJ A;  1MXT A;  1DXL A;  1KFY A;  2X99 A;  3DA1 A;  2C66 A;  1L9D A;  2WS3 A;  4OPG A;  4AP3 A;  1TDK A;  2GVC A;  2I0Z A;  3LJP A;  1JRX A;  4H4P A;  1GSN A;  3DJE A;  3K30 A;  1GV4 A;  1NEN A;  3GYI A;  4U8O A;  4C5O A;  1EL7 A;  5IPY A;  3AEE A;  1GND A;  1KSU A;  2XLS A;  3GYJ A;  2A87 A;  4U8L A;  2APG A;  4HA6 A;  4NZH A;  3K7T A;  1DOE A;  5KOW A;  3FBS A;  4H4Q A;  1KDG A;  2XVJ A;  1NHS A;  3AB1 A;  4H7U A;  1LQU A;  3UTE A;  1MOK A;  1IUS A;  4OVI A;  4ZCC A;  3Q9T A;  4AOX A;  1M6I A;  2CVJ A;  2XYO A;  3AEA A;  3CGB A;  1NHR A;  4GF7 A;  4GRT A;  2YM1 A;  4YTM A;  1B37 A;  1NEK A;  1TDO A;  3NRN A;  4BK3 A;  3D1C A;  1GER A;  4OPI A;  5C2T A;  1Q1W A;  3CTY A;  4AP1 A;  2B7R A;  4YSH A;  3BI2 A;  4REK A;  4YKF A;  4B63 A;  3BI5 A;  3II4 A;  4GDP A;  3UOX A;  4Z26 A;  3DK9 A;  4LII A;  3GD3 A;  1Y56 B;  4YXD A;  1F6M A;  2IVE A;  1VG9 A;  3QVP A;  4JQ9 A;  2WQY A;  3NNE A;  4UDR A;  2RGO A;  4K22 A;  1FL2 A;  2R4E A;  5BVA A;  1NG3 A;  1RP0 A;  4O5Q A;  4H4W A;  3UKL A;  2YLR A;  3AEF A;  3CPJ G;  3P1W A;  1V59 A;  3EF6 A;  2R45 A;  5DBJ A;  3HZL A;  4NEW A;  3PVC A;  2BYB A;  4IVO B;  2VQ7 A;  4JNA A;  3UKK A;  4EMJ A;  3K7Q X;  1IUU A;  3ABV A;  4JY3 A;  3PS9 A;  4LU6 A;  3NG7 X;  1JU2 A;  3KA7 A;  2V3A A;  2IVD A;  3M13 A;  2B9Y A;  3G5R A;  3UTG A;  2YR5 A;  2Z5Y A;  1L9C A;  4FK1 A;  1FOH A;  1YKJ A;  2B9X A;  1VDC A;  1H84 A;  1CC2 A;  3KLJ A;  4E0V A;  4P9S A;  3P4R A;  2GB0 A;  1GRB A;  2OLO A;  4X4J A;  2ARD A;  2XVH A;  4XWZ A;  5ER0 A;  4YSY A;  5HXI A;  2WPE A;  1NHP A;  2O9Z A;  1D4D A;  3NT6 A;  4J36 A;  4TM0 A;  1E1M A;  4H4U A;  3P4Q A;  2R0G A;  2A89 A;  3R9U A;  3IWA A;  3VQR A;  2YVF A;  3B3R A;  1GAL A;  4YTP A;  3AE9 A;  3LZW A;  4Z24 A;  4OPC A;  3SFE A;  1TYP A;  1H81 A;  1K4Q A;  3IC9 A;  1REO A;  4Z44 A;  3V76 A;  3M12 A;  1COY A;  1YQZ A;  3FIM B;  1FEB A;  3O0H A;  4H4Y A;  4DNA A;  1E1K A;  2BK4 A;  4GCM A;  1OJD A;  1N4W A;  4IV9 A;  2YLX A;  4EQR A;  1TDF A;  4GDE A;  1D4C A;  1LQT A;  2YQU A;  3I6D A;  1BF3 A;  4JDR A;  4ECH A;  1N4U A;  2R0P A;  1PBE A;  3C96 A;  3CNJ A;  3AYL A;  2R9Z A;  3KKJ A;  2C3C A;  2VRM A;  3E1T A;  2V5Z A;  2YG3 A;  4KX6 A;  5LV9 A;  2GMH A;  1DJQ A;  4YTN A;  4H4S A;  2AR8 A;  5FMH A;  1XHC A;  2RGH A;  3GDN A;  2YLS A;  3KU9 A;  2YWL A;  5JCM A;  4H4T A;  1ZK7 A;  3RNM A;  5U63 A;  3EAO A;  4Y4L A;  1PJ6 A;  3BNU A;  1LV0 A;  3QSE A;  4AT2 A;  1KNP A;  1GRF A;  1LJ1 A;  4YT0 A;  1QO8 A;  1HYU A;  4U8N A;  1IUV A;  2XFU A;  3OZ2 A;  1B5Q A;  1TYT A;  4KPR A;  5CKU A;  1Y0P A;  3ATR A;  4B66 A;  4D04 A;  3DJJ A;  4UP3 A;  4HB9 A;  3URH A;  4FDC B;  2XLR A;  2GV8 A;  1E39 A;  2WP6 A;  4A65 A;  1ZY8 A;  3AE5 A;  4C3X A;  4GUV A;  4BUR A;  4CY8 A;  3CN8 A;  2V3B A;  1ZMD A;  1GTE A;  3L1R A;  2V60 A;  5CQF A;  1BGN A;  2XVF A;  5L46 A;  2YLT A;  4DGK A;  1CJ2 A;  2PYX A;  3LXD A;  1H86 A;  4FK1 C;  4C74 A;  4PAA A;  4CBQ A;  2XLT A;  1CL0 A;  4UDQ A;  1MO9 A;  1YY5 A;  1O94 A;  3ZDN A;  1ZMC A;  2YG7 A;  5JCI A;  4FX9 A;  2XLU A;  1D5T A;  3H8I A;  3NN6 X;  3CNT A;  1F8S A;  5JCK A;  1JOA A;  2GQW A;  3SGL A;  2WU2 A;  4YSZ A;  2XFN A;  2H89 A;  3DK4 A;  4TLX A;  5U1O A;  3RHA A;  3VRA A;  2BC0 A;  4U2T A;  1IUT A;  3IHM A;  4B67 A;  4PAB A;  4CNK A;  2YM2 A;  4NTD A;  2EQ7 A;  4IA6 A;  3QVR A;  4RG3 A;  1Y56 A;  2R0C A;  3CGD A;  1F8R A;  2GRT A;  3SM8 A;  5J7X A;  2C73 A;  3NHO X;  2YAU A;  2WU5 A;  4CCR A;  3BNM A;  2VRL A;  4Y4M A;  3ZYX A;  2QCU A;  4K2X A;  2X8G A;  2JK6 A;  5FS9 A;  2JB1 A;  4EQW A;  3UCL A;  5EB5 A;  4LA1 A;  3UP5 A;  3RP8 A;  1H7W A;  2ZBW A;  4J31 A;  2BS2 A;  2CDU A;  4H2R A;  4EMW A;  3DME A;  2YVJ A;  3V3O A;  3V3N A;  5HHF A;  2GMJ A;  3I3L A;  2XFQ A;  4TM1 A;  2Q6U A;  3F8R A;  1GET A;  3NKS A;  1NG4 A;  2YG5 A;  4U8J A;  1PXA A;  3M0O A;  4B1B A;  4A6N B;  2GAG B;  1P2E A;  1E6E A;  2WEU A;  3BI4 A;  3CPI G;  2YR4 A;  3CGE A;  3QFA A;  1PXC A;  4UDP A;  2Y6R A;  4EQS A;  3NYE A;  2BAB A;  3NYC A;  1GOS A;  3LOV A;  4DSH A;  3AE8 A;  3CND A;  3GMC A;  4O5U A;  2WDQ A;  1CC4 A;  2C76 A;  4I59 A;  4H4R A;  3UOV A;  1TDN A;  4EIP A;  1S3B A;  2ACZ A;  5KRQ A;  2YVG A;  4B69 A;  3L8K A;  4A5L A;  5KVI A;  1UKV G;  2BA9 A;  3NK2 X;  3NGC X;  1IUX A; 
#chains in the Genus database with same CATH topology
 4K8D A;  3CNP A;  5EBK A;  1DJN A;  1BZL A;  1XAN A;  2JAE A;  4A99 A;  4J56 A;  4YWO A;  1B4V A;  2FJB A;  2JB3 A;  1GTH A;  2NPX A;  5C3J A;  2E5V A;  3NK0 X;  5FS8 A;  1L9E A;  3AEC A;  4X9M A;  5BUK A;  1E7P A;  1EBD A;  2BXS A;  4C3Y A;  2BRA A;  4TM4 A;  5IQ1 A;  3KPK A;  3GWF A;  3LZX A;  3ALL A;  3FMW A;  2V6O A;  2W0H A;  1PHH A;  5FS6 A;  2WPF A;  1LTX R;  3H4K A;  2Q7V A;  1CF3 A;  3P9U A;  2QA2 A;  5EB4 A;  1X31 B;  4BJZ A;  3DGZ A;  1GRE A;  3ICR A;  3UKA A;  2EQ9 A;  4YKG A;  4Z2T A;  1F3P A;  3AE3 A;  3KVE A;  4GAP A;  2F5Z A;  4EM4 A;  3ALM A;  4WX1 A;  2QA1 A;  3AEB A;  3JSK A;  1E1N A;  1Q9I A;  1FEA A;  1EL9 A;  1JRY A;  5M0Z A;  3GRT A;  5KMR A;  2GQF A;  3CGC A;  4CRT A;  1ZDL A;  2C75 A;  3EPT A;  1ZOV A;  4IA5 A;  3AWI A;  3UKP A;  4B68 A;  1CC6 A;  3VRD B;  3UTH A;  3UOY A;  2AQJ A;  3LAD A;  1D7L A;  4NTE A;  4U8I A;  4B64 A;  4C77 A;  1DOB A;  1L0V A;  3QFB A;  4CY6 A;  4B65 A;  1PJ5 A;  2GAH B;  3SYI A;  2B76 A;  2XVE A;  4RSL A;  5TR3 A;  2C3D A;  4K5S A;  3QSM A;  3G5S A;  4U8P A;  2WET A;  3F8D A;  3UOZ A;  4DSG A;  4TM3 A;  4EIQ A;  5BUL A;  1CJC A;  2YG4 A;  1W4X A;  1VG0 A;  3VR8 A;  5KOX A;  2CUL A;  2Q0K A;  4NNJ A;  4A6N A;  5KMQ A;  2X8C A;  2OAM A;  3RP6 A;  1PJ7 A;  2WES A;  3ISH A;  3VRB A;  3NK1 X;  1N1P A;  2XLP A;  2BK3 A;  5GSN A;  2C70 A;  3B6D A;  3BHF A;  2FJE A;  4D03 A;  1ELI A;  3WE0 A;  4NWZ A;  1PDH A;  5JCL A;  1OJA A;  1KF6 A;  2C65 A;  4I58 A;  3AYJ A;  3EAN A;  2WOV A;  1RYI A;  1QJD A;  4H2P A;  3HYW A;  3COX A;  3KPF A;  2NVK X;  1GRH A;  1NAA A;  4ICY A;  1CBO A;  1ZOY A;  2BS3 A;  1EL5 A;  4K7Z A;  5KNL A;  1RSG A;  3GRS A;  3ADA B;  1XPQ A;  3GMB A;  4ADW A;  1AOG A;  1BKW A;  2E4G A;  2B7S A;  2XFO A;  2ZZC A;  3NYF A;  4APN A;  1OJT A;  2AAQ A;  1VRQ B;  4H50 A;  3VR9 A;  1ONF A;  1GRT A;  2VOU A;  2XCG A;  1D7Y A;  3KD9 A;  3NLC A;  1CJ4 A;  2A8X A;  2EQ8 A;  1JNR A;  2XDO A;  1SEZ A;  2GEW A;  2WDR A;  4NTC A;  3LB8 A;  2TMD A;  2YLZ A;  4JNQ A;  5GRT A;  2ZZ0 A;  4JY2 A;  3AD9 B;  2ZZB A;  1GEU A;  4Z2U A;  3SZW A;  2OAL A;  4A9W A;  3UKF A;  1KSS A;  1GT8 A;  5KVH A;  1D4E A;  2B9W A;  2J3N A;  3ATQ A;  4WCT A;  3AE1 A;  3NH3 X;  1ZX9 A;  4YSX A;  2HQM A;  2FJD A;  3P4S A;  3AYI A;  1PBF A;  3NN0 X;  3NTA A;  4G9K A;  5KWF A;  2DKI A;  2VZ2 A;  2BC1 A;  5JCN A;  3UP4 A;  1NHQ A;  1E1L A;  2IID A;  4U8M A;  1YQ4 A;  1S2Y A;  2XFP A;  2BS4 A;  3QJ4 A;  2XVI A;  1QLB A;  2BAC A;  2RAB A;  3AED A;  2C64 A;  2Q0L A;  3PO7 A;  2X8H A;  1M64 A;  1LPF A;  3GWD A;  4U2S A;  1B8S A;  3DJG X;  3RP7 A;  1TRB A;  3AD7 B;  3UTF A;  1PBD A;  3FG2 P;  2VVM A;  2YLW A;  2WHD A;  2V61 A;  2WDV A;  3G5Q A;  3OC4 A;  2GR1 A;  1JNZ A;  3UKH A;  4AT0 A;  2OA1 A;  4H4V A;  3CMM A;  4AOS A;  1N4V A;  3AD8 B;  3AE7 A;  1PBC A;  4K5R A;  3T37 A;  4BJY A;  4JN9 A;  3GSI A;  5FS7 A;  5HYM A;  4NEV A;  2VQB A;  2X3N A;  4J2W A;  1P2H A;  2WP5 A;  3P4P A;  1S2Q A;  2DKH A;  4EQX A;  4M52 A;  1DOD A;  3ICS A;  3T2Y A;  2GR3 A;  2OLN A;  2Z5X A;  4RG4 A;  1GRG A;  2GH5 A;  2R46 A;  2C72 A;  3F8P A;  2WPC A;  1DNC A;  2GF3 A;  4H4X A;  2E1M A;  2H88 A;  4H2N A;  1BWC A;  4Z2R A;  2PHH A;  1H82 A;  3AEG A;  1K0L A;  4X9N A;  1Q1R A;  4A79 A;  4EMI A;  1XDI A;  2VVL A;  2EQ6 A;  3CNS A;  1H83 A;  5HY5 A;  4OCG A;  2JB2 A;  1F8W A;  1GRA A;  2X50 A;  4OPD A;  4Z25 A;  2BCG G;  1GES A;  3DH9 A;  4TLZ A;  4BK2 A;  1KNR A;  3NIX A;  4OPU A;  1PXB A;  3QSS A;  2BXR A;  2C67 A;  2YG6 A;  4Y4N A;  5EOW A;  3S61 A;  3CPH G;  2QAE A;  2WOI A;  5IQ4 A;  2GR2 A;  3ICT A;  1GXF A;  4BV6 A;  4EM3 A;  1CHU A;  2BCP A;  1IUW A;  4USQ A;  1CJ3 A;  3FPZ A;  3GD4 A;  2YR6 A;  2WBA A;  4ZN0 A;  2CFY A;  1OJC A;  3SZC A;  4Z43 A;  1PS9 A;  4U8K A;  2FJA A;  2Y6Q A;  1JRZ A;  3AE4 A;  2RGJ A;  1ZKQ A;  1H7X A;  3AE2 A;  1IJH A;  3DK8 A;  3IHG A;  3AXB A;  4II3 A;  5U25 A;  1Z6L A;  3GDP A;  5BRT A;  2FBW A;  3DGH A;  1FCD A;  1O95 A;  1DOC A;  4XXG A;  2C7G A;  2JKC A;  1PN0 A;  1FEC A;  2BK5 A;  2GR0 A;  3BHK A;  1H6V A;  4GR1 A;  4IVM B;  3CIR A;  2WOW A;  1NPX A;  4N9X A;  4ZCD A;  1JEH A;  2UZZ A;  4OPT A;  3RED A;  3H8L A;  2WP9 A;  3SQP A;  4J33 A;  5J60 A;  1BGJ A;  4J57 A;  1ZP0 A;  4XWR A;  1NDA A;  1YQ3 A;  2JBV A;  3IF9 A;  3Q6J A;  4H2Q A;  4OPL A;  4U2L A;  1OJ9 A;  1VQW A;  2R4J A;  3C4A A;  3K7M X;  3NTD A;  4BK1 A;  1S3E A;  4CCQ A;  3C4N A;  3SFD A;  4J34 A;  1K0I A;  1O5W A;  4A7A A;  1GPE A;  3ITJ A;  4H4Z A;  4CNJ A;  3ALJ A;  1LVL A;  4USR A;  1PBB A;  1K0J A;  3D8X A;  4G6G A;  5M10 A;  1TDE A;  4MJW A;  3UKQ A;  2TPR A;  3DJD A;  3AE6 A;  2VVL G;  3S5W A;  1EL8 A;  5KXJ A;  1MXT A;  1DXL A;  1KFY A;  2X99 A;  3DA1 A;  2C66 A;  1L9D A;  2WS3 A;  4OPG A;  4AP3 A;  1TDK A;  2GVC A;  2I0Z A;  3LJP A;  1JRX A;  4H4P A;  1GSN A;  3DJE A;  3K30 A;  1GV4 A;  1NEN A;  3GYI A;  4U8O A;  4C5O A;  1EL7 A;  5IPY A;  3AEE A;  1GND A;  1KSU A;  2XLS A;  3GYJ A;  3T2Z A;  2A87 A;  4U8L A;  2APG A;  4HA6 A;  4NZH A;  3K7T A;  1DOE A;  5KOW A;  3FBS A;  2C4C A;  4H4Q A;  1KDG A;  2XVJ A;  1NHS A;  3AB1 A;  4H7U A;  1LQU A;  3UTE A;  1MOK A;  1IUS A;  4OVI A;  4ZCC A;  3Q9T A;  4AOX A;  1M6I A;  2CVJ A;  2XYO A;  3AEA A;  3CGB A;  1NHR A;  4GF7 A;  4GRT A;  2YM1 A;  4YTM A;  1B37 A;  1NEK A;  1TDO A;  3NRN A;  4BK3 A;  3D1C A;  1GER A;  4OPI A;  5C2T A;  4GAV A;  1Q1W A;  3CTY A;  4AP1 A;  2B7R A;  4YSH A;  3BI2 A;  4REK A;  4YKF A;  4B63 A;  3BI5 A;  3II4 A;  4GDP A;  3UOX A;  4Z26 A;  3DK9 A;  4LII A;  3GD3 A;  1Y56 B;  4YXD A;  1F6M A;  2IVE A;  1VG9 A;  3QVP A;  4JQ9 A;  2WQY A;  3NNE A;  4UDR A;  2RGO A;  4K22 A;  1FL2 A;  2R4E A;  3T0K A;  5BVA A;  1NG3 A;  1RP0 A;  4O5Q A;  4H4W A;  3UKL A;  2YLR A;  3AEF A;  3GYX A;  3CPJ G;  3P1W A;  1V59 A;  3EF6 A;  2R45 A;  5DBJ A;  3HZL A;  4NEW A;  3PVC A;  2BYB A;  4IVO B;  2VQ7 A;  4JNA A;  3UKK A;  4EMJ A;  4G73 A;  3K7Q X;  1IUU A;  3ABV A;  4JY3 A;  4G74 A;  3PS9 A;  4LU6 A;  3NG7 X;  1JU2 A;  3KA7 A;  2V3A A;  2IVD A;  3M13 A;  2B9Y A;  3G5R A;  3UTG A;  2YR5 A;  2Z5Y A;  1L9C A;  4FK1 A;  1FOH A;  1YKJ A;  2B9X A;  1VDC A;  1H84 A;  1CC2 A;  3KLJ A;  4E0V A;  4P9S A;  3P4R A;  2GB0 A;  1GRB A;  2OLO A;  4X4J A;  2ARD A;  2XVH A;  4XWZ A;  5ER0 A;  4YSY A;  5HXI A;  2WPE A;  1NHP A;  2O9Z A;  1D4D A;  3NT6 A;  4J36 A;  4TM0 A;  1E1M A;  4H4U A;  3P4Q A;  2R0G A;  2A89 A;  3R9U A;  3IWA A;  3VQR A;  2YVF A;  3B3R A;  1GAL A;  4YTP A;  3SXI A;  3AE9 A;  3LZW A;  4Z24 A;  4OPC A;  3SFE A;  1TYP A;  1H81 A;  1K4Q A;  3IC9 A;  1REO A;  4Z44 A;  3V76 A;  3M12 A;  1COY A;  1YQZ A;  3FIM B;  1FEB A;  3O0H A;  4H4Y A;  4DNA A;  1E1K A;  2BK4 A;  4GCM A;  1OJD A;  1N4W A;  4IV9 A;  2YLX A;  4EQR A;  1TDF A;  4GDE A;  1D4C A;  1LQT A;  2YQU A;  3I6D A;  1BF3 A;  4JDR A;  4ECH A;  1N4U A;  2R0P A;  1PBE A;  3C96 A;  3CNJ A;  3AYL A;  3T31 A;  2R9Z A;  3KKJ A;  2C3C A;  2VRM A;  3E1T A;  2V5Z A;  2YG3 A;  4KX6 A;  5LV9 A;  2GMH A;  1DJQ A;  2BRY A;  4YTN A;  4H4S A;  2AR8 A;  5FMH A;  1XHC A;  2RGH A;  3GDN A;  2YLS A;  3SZF A;  4II2 A;  3KU9 A;  2YWL A;  5JCM A;  4H4T A;  1ZK7 A;  3RNM A;  5KMS A;  5U63 A;  3EAO A;  4Y4L A;  1PJ6 A;  3BNU A;  1LV0 A;  3QSE A;  4AT2 A;  1KNP A;  1GRF A;  1LJ1 A;  4YT0 A;  1QO8 A;  1HYU A;  4U8N A;  1IUV A;  2XFU A;  3OZ2 A;  1B5Q A;  1TYT A;  4KPR A;  5CKU A;  1Y0P A;  3ATR A;  4B66 A;  4D04 A;  3DJJ A;  4UP3 A;  4HB9 A;  3URH A;  4FDC B;  2XLR A;  2GV8 A;  1E39 A;  2WP6 A;  4A65 A;  3T2K A;  1ZY8 A;  3AE5 A;  4C3X A;  4GUV A;  4BUR A;  4CY8 A;  3CN8 A;  2V3B A;  1ZMD A;  1GTE A;  3L1R A;  2V60 A;  5CQF A;  1BGN A;  2XVF A;  5L46 A;  2YLT A;  4DGK A;  1CJ2 A;  2PYX A;  3LXD A;  1H86 A;  4FK1 C;  4C74 A;  4PAA A;  4CBQ A;  2XLT A;  1CL0 A;  4UDQ A;  1MO9 A;  1YY5 A;  1O94 A;  3ZDN A;  1ZMC A;  2YG7 A;  5JCI A;  4FX9 A;  2XLU A;  1D5T A;  3H8I A;  3NN6 X;  3CNT A;  1F8S A;  5JCK A;  1JOA A;  2GQW A;  3SGL A;  2WU2 A;  4YSZ A;  2XFN A;  2H89 A;  3DK4 A;  4TLX A;  5U1O A;  3RHA A;  3SX6 A;  3VRA A;  2BC0 A;  4U2T A;  1IUT A;  3IHM A;  4B67 A;  4PAB A;  4CNK A;  2YM2 A;  4NTD A;  2EQ7 A;  4IA6 A;  3QVR A;  4RG3 A;  3T14 A;  1Y56 A;  2R0C A;  3CGD A;  1F8R A;  2GRT A;  3SM8 A;  5J7X A;  2C73 A;  3NHO X;  2YAU A;  2WU5 A;  4CCR A;  3BNM A;  2VRL A;  4Y4M A;  3ZYX A;  2QCU A;  4K2X A;  2X8G A;  2JK6 A;  5FS9 A;  2JB1 A;  4EQW A;  3UCL A;  5EB5 A;  4LA1 A;  3HYV A;  3UP5 A;  3RP8 A;  1H7W A;  2ZBW A;  4J31 A;  2BS2 A;  2CDU A;  4H2R A;  3SZ0 A;  4EMW A;  3DME A;  2YVJ A;  3V3O A;  3V3N A;  5HHF A;  2GMJ A;  3I3L A;  2XFQ A;  4TM1 A;  2Q6U A;  3F8R A;  1GET A;  3NKS A;  1NG4 A;  2YG5 A;  4U8J A;  1PXA A;  3M0O A;  4B1B A;  4A6N B;  2GAG B;  1P2E A;  1E6E A;  2WEU A;  3BI4 A;  3CPI G;  2YR4 A;  3CGE A;  3QFA A;  1PXC A;  4UDP A;  2Y6R A;  3SY4 A;  4EQS A;  3NYE A;  2BAB A;  3NYC A;  1GOS A;  3LOV A;  4DSH A;  5KMP A;  3AE8 A;  3CND A;  3GMC A;  4G6H A;  4O5U A;  3HYX A;  2WDQ A;  1CC4 A;  2C76 A;  4I59 A;  4H4R A;  3UOV A;  1TDN A;  4EIP A;  1S3B A;  2ACZ A;  5KRQ A;  2YVG A;  4B69 A;  3L8K A;  4A5L A;  5KVI A;  1UKV G;  2BA9 A;  3NK2 X;  3NGC X;  1IUX A; 
#chains in the Genus database with same CATH homology
 4K8D A;  3CNP A;  5EBK A;  1DJN A;  1BZL A;  1XAN A;  2JAE A;  4A99 A;  4J56 A;  4YWO A;  1B4V A;  2FJB A;  2JB3 A;  1GTH A;  2NPX A;  5C3J A;  2E5V A;  3NK0 X;  5FS8 A;  1L9E A;  3AEC A;  4X9M A;  5BUK A;  1E7P A;  1EBD A;  2BXS A;  4C3Y A;  2BRA A;  4TM4 A;  5IQ1 A;  3KPK A;  3GWF A;  3LZX A;  3ALL A;  3FMW A;  2V6O A;  2W0H A;  1PHH A;  5FS6 A;  2WPF A;  1LTX R;  3H4K A;  2Q7V A;  1CF3 A;  3P9U A;  2QA2 A;  5EB4 A;  1X31 B;  4BJZ A;  3DGZ A;  1GRE A;  3ICR A;  3UKA A;  2EQ9 A;  4YKG A;  4Z2T A;  1F3P A;  3AE3 A;  3KVE A;  4GAP A;  2F5Z A;  4EM4 A;  3ALM A;  4WX1 A;  2QA1 A;  3AEB A;  3JSK A;  1E1N A;  1Q9I A;  1FEA A;  1EL9 A;  1JRY A;  5M0Z A;  3GRT A;  5KMR A;  2GQF A;  3CGC A;  4CRT A;  1ZDL A;  2C75 A;  3EPT A;  1ZOV A;  4IA5 A;  3AWI A;  3UKP A;  4B68 A;  1CC6 A;  3VRD B;  3UTH A;  3UOY A;  2AQJ A;  3LAD A;  1D7L A;  4NTE A;  4U8I A;  4B64 A;  4C77 A;  1DOB A;  1L0V A;  3QFB A;  4CY6 A;  4B65 A;  1PJ5 A;  2GAH B;  3SYI A;  2B76 A;  2XVE A;  4RSL A;  5TR3 A;  2C3D A;  4K5S A;  3QSM A;  3G5S A;  4U8P A;  2WET A;  3F8D A;  3UOZ A;  4DSG A;  4TM3 A;  4EIQ A;  5BUL A;  1CJC A;  2YG4 A;  1W4X A;  1VG0 A;  3VR8 A;  5KOX A;  2CUL A;  2Q0K A;  4NNJ A;  4A6N A;  5KMQ A;  2X8C A;  2OAM A;  3RP6 A;  1PJ7 A;  2WES A;  3ISH A;  3VRB A;  3NK1 X;  1N1P A;  2XLP A;  2BK3 A;  5GSN A;  2C70 A;  3B6D A;  3BHF A;  2FJE A;  4D03 A;  1ELI A;  3WE0 A;  4NWZ A;  1PDH A;  5JCL A;  1OJA A;  1KF6 A;  2C65 A;  4I58 A;  3AYJ A;  3EAN A;  2WOV A;  1RYI A;  1QJD A;  4H2P A;  3HYW A;  3COX A;  3KPF A;  2NVK X;  1GRH A;  1NAA A;  4ICY A;  1CBO A;  1ZOY A;  2BS3 A;  1EL5 A;  4K7Z A;  5KNL A;  1RSG A;  3GRS A;  3ADA B;  1XPQ A;  3GMB A;  4ADW A;  1AOG A;  1BKW A;  2E4G A;  2B7S A;  2XFO A;  2ZZC A;  3NYF A;  4APN A;  1OJT A;  2AAQ A;  1VRQ B;  4H50 A;  3VR9 A;  1ONF A;  1GRT A;  2VOU A;  2XCG A;  1D7Y A;  3KD9 A;  3NLC A;  1CJ4 A;  2A8X A;  2EQ8 A;  1JNR A;  2XDO A;  1SEZ A;  2GEW A;  2WDR A;  4NTC A;  3LB8 A;  2TMD A;  2YLZ A;  4JNQ A;  5GRT A;  2ZZ0 A;  4JY2 A;  3AD9 B;  2ZZB A;  1GEU A;  4Z2U A;  3SZW A;  2OAL A;  4A9W A;  3UKF A;  1KSS A;  1GT8 A;  5KVH A;  1D4E A;  2B9W A;  2J3N A;  3ATQ A;  4WCT A;  3AE1 A;  3NH3 X;  1ZX9 A;  4YSX A;  2HQM A;  2FJD A;  3P4S A;  3AYI A;  1PBF A;  3NN0 X;  3NTA A;  4G9K A;  5KWF A;  2DKI A;  2VZ2 A;  2BC1 A;  5JCN A;  3UP4 A;  1NHQ A;  1E1L A;  2IID A;  4U8M A;  1YQ4 A;  1S2Y A;  2XFP A;  2BS4 A;  3QJ4 A;  2XVI A;  1QLB A;  2BAC A;  2RAB A;  3AED A;  2C64 A;  2Q0L A;  3PO7 A;  2X8H A;  1M64 A;  1LPF A;  3GWD A;  4U2S A;  1B8S A;  3DJG X;  3RP7 A;  1TRB A;  3AD7 B;  3UTF A;  1PBD A;  3FG2 P;  2VVM A;  2YLW A;  2WHD A;  2V61 A;  2WDV A;  3G5Q A;  3OC4 A;  2GR1 A;  1JNZ A;  3UKH A;  4AT0 A;  2OA1 A;  4H4V A;  3CMM A;  4AOS A;  1N4V A;  3AD8 B;  3AE7 A;  1PBC A;  4K5R A;  3T37 A;  4BJY A;  4JN9 A;  3GSI A;  5FS7 A;  5HYM A;  4NEV A;  2VQB A;  2X3N A;  4J2W A;  1P2H A;  2WP5 A;  3P4P A;  1S2Q A;  2DKH A;  4EQX A;  4M52 A;  1DOD A;  3ICS A;  3T2Y A;  2GR3 A;  2OLN A;  2Z5X A;  4RG4 A;  1GRG A;  2GH5 A;  2R46 A;  2C72 A;  3F8P A;  2WPC A;  1DNC A;  2GF3 A;  4H4X A;  2E1M A;  2H88 A;  4H2N A;  1BWC A;  4Z2R A;  2PHH A;  1H82 A;  3AEG A;  1K0L A;  4X9N A;  1Q1R A;  4A79 A;  4EMI A;  1XDI A;  2VVL A;  2EQ6 A;  3CNS A;  1H83 A;  5HY5 A;  4OCG A;  2JB2 A;  1F8W A;  1GRA A;  2X50 A;  4OPD A;  4Z25 A;  2BCG G;  1GES A;  3DH9 A;  4TLZ A;  4BK2 A;  1KNR A;  3NIX A;  4OPU A;  1PXB A;  3QSS A;  2BXR A;  2C67 A;  2YG6 A;  4Y4N A;  5EOW A;  3S61 A;  3CPH G;  2QAE A;  2WOI A;  5IQ4 A;  2GR2 A;  3ICT A;  1GXF A;  4BV6 A;  4EM3 A;  1CHU A;  2BCP A;  1IUW A;  4USQ A;  1CJ3 A;  3FPZ A;  3GD4 A;  2YR6 A;  2WBA A;  4ZN0 A;  2CFY A;  1OJC A;  3SZC A;  4Z43 A;  1PS9 A;  4U8K A;  2FJA A;  2Y6Q A;  1JRZ A;  3AE4 A;  2RGJ A;  1ZKQ A;  1H7X A;  3AE2 A;  1IJH A;  3DK8 A;  3IHG A;  3AXB A;  4II3 A;  5U25 A;  1Z6L A;  3GDP A;  5BRT A;  2FBW A;  3DGH A;  1FCD A;  1O95 A;  1DOC A;  4XXG A;  2C7G A;  2JKC A;  1PN0 A;  1FEC A;  2BK5 A;  2GR0 A;  3BHK A;  1H6V A;  4GR1 A;  4IVM B;  3CIR A;  2WOW A;  1NPX A;  4N9X A;  4ZCD A;  1JEH A;  2UZZ A;  4OPT A;  3RED A;  3H8L A;  2WP9 A;  3SQP A;  4J33 A;  5J60 A;  1BGJ A;  4J57 A;  1ZP0 A;  4XWR A;  1NDA A;  1YQ3 A;  2JBV A;  3IF9 A;  3Q6J A;  4H2Q A;  4OPL A;  4U2L A;  1OJ9 A;  1VQW A;  2R4J A;  3C4A A;  3K7M X;  3NTD A;  4BK1 A;  1S3E A;  4CCQ A;  3C4N A;  3SFD A;  4J34 A;  1K0I A;  1O5W A;  4A7A A;  1GPE A;  3ITJ A;  4H4Z A;  4CNJ A;  3ALJ A;  1LVL A;  4USR A;  1PBB A;  1K0J A;  3D8X A;  4G6G A;  5M10 A;  1TDE A;  4MJW A;  3UKQ A;  2TPR A;  3DJD A;  3AE6 A;  2VVL G;  3S5W A;  1EL8 A;  5KXJ A;  1MXT A;  1DXL A;  1KFY A;  2X99 A;  3DA1 A;  2C66 A;  1L9D A;  2WS3 A;  4OPG A;  4AP3 A;  1TDK A;  2GVC A;  2I0Z A;  3LJP A;  1JRX A;  4H4P A;  1GSN A;  3DJE A;  3K30 A;  1GV4 A;  1NEN A;  3GYI A;  4U8O A;  4C5O A;  1EL7 A;  5IPY A;  3AEE A;  1GND A;  1KSU A;  2XLS A;  3GYJ A;  3T2Z A;  2A87 A;  4U8L A;  2APG A;  4HA6 A;  4NZH A;  3K7T A;  1DOE A;  5KOW A;  3FBS A;  2C4C A;  4H4Q A;  1KDG A;  2XVJ A;  1NHS A;  3AB1 A;  4H7U A;  1LQU A;  3UTE A;  1MOK A;  1IUS A;  4OVI A;  4ZCC A;  3Q9T A;  4AOX A;  1M6I A;  2CVJ A;  2XYO A;  3AEA A;  3CGB A;  1NHR A;  4GF7 A;  4GRT A;  2YM1 A;  4YTM A;  1B37 A;  1NEK A;  1TDO A;  3NRN A;  4BK3 A;  3D1C A;  1GER A;  4OPI A;  5C2T A;  4GAV A;  1Q1W A;  3CTY A;  4AP1 A;  2B7R A;  4YSH A;  3BI2 A;  4REK A;  4YKF A;  4B63 A;  3BI5 A;  3II4 A;  4GDP A;  3UOX A;  4Z26 A;  3DK9 A;  4LII A;  3GD3 A;  1Y56 B;  4YXD A;  1F6M A;  2IVE A;  1VG9 A;  3QVP A;  4JQ9 A;  2WQY A;  3NNE A;  4UDR A;  2RGO A;  4K22 A;  1FL2 A;  2R4E A;  3T0K A;  5BVA A;  1NG3 A;  1RP0 A;  4O5Q A;  4H4W A;  3UKL A;  2YLR A;  3AEF A;  3GYX A;  3CPJ G;  3P1W A;  1V59 A;  3EF6 A;  2R45 A;  5DBJ A;  3HZL A;  4NEW A;  3PVC A;  2BYB A;  4IVO B;  2VQ7 A;  4JNA A;  3UKK A;  4EMJ A;  4G73 A;  3K7Q X;  1IUU A;  3ABV A;  4JY3 A;  4G74 A;  3PS9 A;  4LU6 A;  3NG7 X;  1JU2 A;  3KA7 A;  2V3A A;  2IVD A;  3M13 A;  2B9Y A;  3G5R A;  3UTG A;  2YR5 A;  2Z5Y A;  1L9C A;  4FK1 A;  1FOH A;  1YKJ A;  2B9X A;  1VDC A;  1H84 A;  1CC2 A;  3KLJ A;  4E0V A;  4P9S A;  3P4R A;  2GB0 A;  1GRB A;  2OLO A;  4X4J A;  2ARD A;  2XVH A;  4XWZ A;  5ER0 A;  4YSY A;  5HXI A;  2WPE A;  1NHP A;  2O9Z A;  1D4D A;  3NT6 A;  4J36 A;  4TM0 A;  1E1M A;  4H4U A;  3P4Q A;  2R0G A;  2A89 A;  3R9U A;  3IWA A;  3VQR A;  2YVF A;  3B3R A;  1GAL A;  4YTP A;  3SXI A;  3AE9 A;  3LZW A;  4Z24 A;  4OPC A;  3SFE A;  1TYP A;  1H81 A;  1K4Q A;  3IC9 A;  1REO A;  4Z44 A;  3V76 A;  3M12 A;  1COY A;  1YQZ A;  3FIM B;  1FEB A;  3O0H A;  4H4Y A;  4DNA A;  1E1K A;  2BK4 A;  4GCM A;  1OJD A;  1N4W A;  4IV9 A;  2YLX A;  4EQR A;  1TDF A;  4GDE A;  1D4C A;  1LQT A;  2YQU A;  3I6D A;  1BF3 A;  4JDR A;  4ECH A;  1N4U A;  2R0P A;  1PBE A;  3C96 A;  3CNJ A;  3AYL A;  3T31 A;  2R9Z A;  3KKJ A;  2C3C A;  2VRM A;  3E1T A;  2V5Z A;  2YG3 A;  4KX6 A;  5LV9 A;  2GMH A;  1DJQ A;  2BRY A;  4YTN A;  4H4S A;  2AR8 A;  5FMH A;  1XHC A;  2RGH A;  3GDN A;  2YLS A;  3SZF A;  4II2 A;  3KU9 A;  2YWL A;  5JCM A;  4H4T A;  1ZK7 A;  3RNM A;  5KMS A;  5U63 A;  3EAO A;  4Y4L A;  1PJ6 A;  3BNU A;  1LV0 A;  3QSE A;  4AT2 A;  1KNP A;  1GRF A;  1LJ1 A;  4YT0 A;  1QO8 A;  1HYU A;  4U8N A;  1IUV A;  2XFU A;  3OZ2 A;  1B5Q A;  1TYT A;  4KPR A;  5CKU A;  1Y0P A;  3ATR A;  4B66 A;  4D04 A;  3DJJ A;  4UP3 A;  4HB9 A;  3URH A;  4FDC B;  2XLR A;  2GV8 A;  1E39 A;  2WP6 A;  4A65 A;  3T2K A;  1ZY8 A;  3AE5 A;  4C3X A;  4GUV A;  4BUR A;  4CY8 A;  3CN8 A;  2V3B A;  1ZMD A;  1GTE A;  3L1R A;  2V60 A;  5CQF A;  1BGN A;  2XVF A;  5L46 A;  2YLT A;  4DGK A;  1CJ2 A;  2PYX A;  3LXD A;  1H86 A;  4FK1 C;  4C74 A;  4PAA A;  4CBQ A;  2XLT A;  1CL0 A;  4UDQ A;  1MO9 A;  1YY5 A;  1O94 A;  3ZDN A;  1ZMC A;  2YG7 A;  5JCI A;  4FX9 A;  2XLU A;  1D5T A;  3H8I A;  3NN6 X;  3CNT A;  1F8S A;  5JCK A;  1JOA A;  2GQW A;  3SGL A;  2WU2 A;  4YSZ A;  2XFN A;  2H89 A;  3DK4 A;  4TLX A;  5U1O A;  3RHA A;  3SX6 A;  3VRA A;  2BC0 A;  4U2T A;  1IUT A;  3IHM A;  4B67 A;  4PAB A;  4CNK A;  2YM2 A;  4NTD A;  2EQ7 A;  4IA6 A;  3QVR A;  4RG3 A;  3T14 A;  1Y56 A;  2R0C A;  3CGD A;  1F8R A;  2GRT A;  3SM8 A;  5J7X A;  2C73 A;  3NHO X;  2YAU A;  2WU5 A;  4CCR A;  3BNM A;  2VRL A;  4Y4M A;  3ZYX A;  2QCU A;  4K2X A;  2X8G A;  2JK6 A;  5FS9 A;  2JB1 A;  4EQW A;  3UCL A;  5EB5 A;  4LA1 A;  3HYV A;  3UP5 A;  3RP8 A;  1H7W A;  2ZBW A;  4J31 A;  2BS2 A;  2CDU A;  4H2R A;  3SZ0 A;  4EMW A;  3DME A;  2YVJ A;  3V3O A;  3V3N A;  5HHF A;  2GMJ A;  3I3L A;  2XFQ A;  4TM1 A;  2Q6U A;  3F8R A;  1GET A;  3NKS A;  1NG4 A;  2YG5 A;  4U8J A;  1PXA A;  3M0O A;  4B1B A;  4A6N B;  2GAG B;  1P2E A;  1E6E A;  2WEU A;  3BI4 A;  3CPI G;  2YR4 A;  3CGE A;  3QFA A;  1PXC A;  4UDP A;  2Y6R A;  3SY4 A;  4EQS A;  3NYE A;  2BAB A;  3NYC A;  1GOS A;  3LOV A;  4DSH A;  5KMP A;  3AE8 A;  3CND A;  3GMC A;  4G6H A;  4O5U A;  3HYX A;  2WDQ A;  1CC4 A;  2C76 A;  4I59 A;  4H4R A;  3UOV A;  1TDN A;  4EIP A;  1S3B A;  2ACZ A;  5KRQ A;  2YVG A;  4B69 A;  3L8K A;  4A5L A;  5KVI A;  1UKV G;  2BA9 A;  3NK2 X;  3NGC X;  1IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...