4B1BA

Crystal structure of plasmodium falciparum oxidised thioredoxin reductase at 2.9 angstrom
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
468
structure length
437
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal Structure of Plasmodium Falciparum Thioredoxin Reductase, a Validated Drug Target.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 123
structure length 437
sequence length 468
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4b1bA00
1FEAA 3AD9B 3QJ4A 4IVOB 2YM1A 4OPDA 3KPFA 4CNKA 3BNMA 1VDCA 1QO8A 2C3DA 3ISHA 1TDEA 4C74A 5J7XA 2VVLG 2Y6RA 3CNPA 2WBAA 3QSMA 1KSSA 4TM4A 5EB4A 1COYA 1JU2A 4OPTA 4RG4A 4USRA 3RNMA 4USQA 2GAHB 3CPHG 1XANA 1Q9IA 1XDIA 5DBJA 1PBCA 4NTEA 4YTNA 4EQSA 3R9UA 3UKPA 2VRLA 1H81A 2X99A 1EL8A 2XVEA 2Z5YA 3ICTA 2YLTA 4UP3A 1KFYA 4EM4A 2Y6QA 3NLCA 4EIQA 5EBKA 2H89A 1F8WA 1LVLA 1Q1WA 3BI2A 1E6EA 3G5SA 3NGCX 3NK0X 3QFAA 4C77A 1PJ6A 1E7PA 2BCPA 3EPTA 3LJPA 1O95A 1D5TA 1D7LA 1B8SA 1DNCA 2FJDA 1F8SA 1PBBA 2WPCA 1DOEA 1JNZA 1IUUA 3DJEA 2WOVA 2V61A 2YWLA 3SGLA 2B9XA 1NAAA 2R0GA 5JCNA 1H83A 4GUVA 1F3PA 1BKWA 2AQJA 2R4EA 2ZZ0A 3IHGA 3P9UA 4HB9A 3UKAA 1CC2A 2B76A 1PHHA 2WOWA 2CDUA 1PJ7A 2JAEA 3RP8A 3GWFA 1L9DA 2WETA 1QJDA 3ALJA 3QFBA 3UTEA 1S2QA 3DJJA 4AOSA 3ZYXA 1FOHA 4U2LA 1RP0A 4A65A 3KD9A 2R0CA 4JDRA 3VQRA 1CBOA 2FBWA 3AEEA 3UOVA 3EF6A 2WPEA 2X8CA 3GWDA 3PS9A 1E1NA 2DKHA 4ZCCA 1K0LA 4YKFA 4AP1A 1W4XA 1PBDA 1ZY8A 3CGCA 4U8PA 1OJTA 1RYIA 1BWCA 3K30A 4KX6A 3LADA 3AE2A 2V3BA 5KXJA 2A87A 3AB1A 3UTFA 1ZOVA 4J36A 3HZLA 2VVMA 3AE9A 4RSLA 4B66A 1NG4A 3S61A 1UKVG 2GF3A 1Q1RA 1YY5A 4TM1A 2CFYA 3AD8B 2OAMA 4M52A 2YG7A 4NEVA 2QCUA 2YLSA 4B63A 3ABVA 4C5OA 2RGOA 4TM3A 1H86A 4CY6A 4I58A 3NRNA 4ZCDA 2BS4A 3GMCA 2GMHA 3LXDA 1DJQA 4MJWA 4A6NA 1E39A 2GR2A 3AEGA 4YKGA 5IQ4A 5IQ1A 4LA1A 2TMDA 3DH9A 3NTAA 4D03A 1S3EA 3IF9A 2XLTA 1K4QA 2WESA 1CC4A 4EIPA 2WS3A 3ATRA 2VQ7A 4ECHA 3ADAB 3PO7A 2WHDA 3ATQA 3GDPA 3LZWA 4A6NB 4KPRA 5IPYA 2R0PA 2C72A 4NZHA 1N1PA 2YVFA 4APNA 2YG6A 1TDFA 2YLRA 3URHA 3KKJA 2E4GA 3AE7A 4B64A 2WDRA 3NG7X 4DSGA 3DJDA 1TDNA 5FS6A 2XLSA 4FK1A 3GMBA 1GRFA 2XYOA 3NN6X 3BNUA 1GOSA 4IVMB 3AYIA 2GR1A 1F8RA 3UOYA 1IUVA 4J56A 3H4KA 2YVGA 3UP5A 3UTHA 1GRHA 3DA1A 2WP5A 4A7AA 2RGHA 5FS9A 1HYUA 4BURA 4A5LA 3M0OA 3UCLA 4I59A 1GERA 1PJ5A 4EMWA 2ZZCA 2BYBA 2TPRA 1NPXA 3GDNA 3CPJG 4Z43A 2YVJA 4EQRA 1D4CA 3H8IA 4NTDA 1MO9A 3EAOA 4GRTA 5FS8A 2C64A 4EMJA 1PXBA 2BCGG 2A89A 2QA2A 3NHOX 5CQFA 4TLXA 1M6IA 4U8JA 2OLOA 3OC4A 4CNJA 2GQWA 2YLZA 1NEKA 5CKUA 3I6DA 1S3BA 1LQUA 2GB0A 1N4UA 2CULA 5HHFA 3NK1X 3UOXA 1GTHA 2B9WA 4EQWA 4A99A 3I3LA 5FS7A 2Z5XA 4H4VA 3RP7A 3AEBA 2WP6A 3CIRA 4DNAA 1ZX9A 2GR3A 2BS3A 1Y56A 1JEHA 1GT8A 1B4VA 4YWOA 5ER0A 1OJCA 1JOAA 5EOWA 3Q9TA 2OLNA 3COXA 3CGBA 2QAEA 4ICYA 2F5ZA 2YR6A 1JNRA 2X3NA 1B5QA 3P4RA 2V6OA 4WCTA 4AT2A 1BGJA 3C96A 1GRBA 2XDOA 3UKQA 3CNJA 2WP9A 1Y56B 4H2RA 1ZKQA 1QLBA 3VR8A 2V3AA 2VOUA 2YG4A 5L46A 2FJEA 1H6VA 4J57A 3CGEA 1V59A 2NPXA 4GF7A 4Z2TA 2ACZA 2WQYA 4K2XA 1ZMCA 1Z6LA 2C66A 2JK6A 2YG3A 4U8KA 4YSXA 1IUWA 4TLZA 4RG3A 4AP3A 4X9NA 1OJAA 1ZP0A 3IC9A 4H4PA 2XVJA 4DSHA 2Q0KA 1YQZA 4OVIA 2RABA 4OPUA 1PBEA 2EQ6A 4J33A 4EM3A 3FIMB 4GDPA 3V3OA 3QVPA 1VQWA 1OJ9A 1ONFA 2XLUA 3BI4A 2E5VA 4U2TA 2YM2A 2YR5A 3C4AA 4O5UA 4OPCA 2E1MA 1AOGA 2XFNA 3L8KA 1ZDLA 1DOCA 2Q7VA 3FG2P 3NTDA 2YAUA 3AXBA 3O0HA 3UOZA 3VRDB 4H4QA 2PHHA 1ZOYA 2VRMA 2WOIA 4H4ZA 3SQPA 2B7RA 2YLWA 4JQ9A 4AT0A 4YSZA 5M10A 2WEUA 1O94A 1FCDA 2XLPA 3SFDA 1VRQB 1ZK7A 4U8NA 2FJBA 2GMJA 3UKFA 4OCGA 2BS2A 4CRTA 3QVRA 4IA5A 2V60A 4H4XA 4H4TA 1L9CA 2JB3A 4BK2A 4C3XA 1KNRA 1CC6A 2C70A 2JBVA 1GRAA 4XWZA 5J60A 3RP6A 3P4PA 4H2PA 3WE0A 3ZDNA 4BK1A 2R9ZA 2BC0A 1VG9A 2GH5A 3AEFA 3K7MX 2B7SA 1XHCA 1NHSA 3AYJA 3RHAA 3ALMA 5JCMA 3K7TA 4K8DA 3F8RA 4YXDA 2VQBA 3NYFA 1PS9A 1REOA 2JB2A 3IWAA 2ZZBA 4JY2A 1FECA 3SM8A 3II4A 4H50A 4U2SA 3NYEA 5KVIA 3FBSA 1CJ2A 2XFPA 2GV8A 3D1CA 2XFOA 4GR1A 1NDAA 3GD3A 1H7XA 1DXLA 1TYTA 1P2EA 4H7UA 2VVLA 2C73A 1NHRA 3LOVA 4LU6A 4DGKA 1IJHA 1KSUA 1PN0A 4ZN0A 1TRBA 3ICRA 1D4EA 1PDHA 1H84A 1ZMDA 2GEWA 2EQ8A 3GRSA 1YQ3A 3CNDA 4B1BA 3QSEA 2QA1A 4H4UA 1KF6A 1TDOA 4JN9A 4Y4MA 1NHPA 3AE8A 2EQ9A 5TR3A 1KDGA 1EL9A 4FK1C 3FPZA 1MXTA 4NEWA 2AAQA 1IUTA 1KNPA 4H2QA 4PABA 3UKKA 5HY5A 4JNQA 3AD7B 5EB5A 4WX1A 1LTXR 3DGZA 4J34A 2BK3A 1JRXA 3BHFA 4ADWA 5JCLA 1CJCA 4Z24A 2EQ7A 1LQTA 4Z26A 2WPFA 1VG0A 3UKLA 1CF3A 3M12A 4LIIA 3G5RA 3V3NA 1JRYA 3BHKA 3V76A 2Q0LA 4REKA 3T37A 3ITJA 3P4QA 3L1RA 2WU2A 3GYJA 3LB8A 2C67A 2X8HA 4U8LA 4K5RA 4U8OA 2BACA 2C76A 1L9EA 4K7ZA 2O9ZA 1RSGA 2YG5A 4UDRA 3ALLA 3JSKA 4OPIA 4XWRA 2GVCA 3DMEA 1PXAA 3EANA 4CCQA 1YKJA 1EBDA 4JY3A 5KRQA 2AR8A 5U1OA 3NH3X 3P1WA 3UKHA 2APGA 4B67A 2X50A 4YTMA 1BF3A 1D4DA 4BJZA 2XFQA 4BJYA 5HXIA 2V5ZA 2X8GA 1X31B 1H82A 2C65A 1GEUA 3KVEA 4YT0A 4FDCB 1BGNA 5HYMA 3P4SA 4A79A 4B69A 2C7GA 3AWIA 3DGHA 3K7QX 4YTPA 1GALA 2VZ2A 1LPFA 1XPQA 2GAGB 1NHQA 3AE3A 2FJAA 2OALA 4Y4LA 4X4JA 3FMWA 4C3YA 2BXRA 1B37A 1EL5A 1K0IA 3CNTA 4X9MA 2BC1A 2W0HA 5C2TA 5GRTA 1GREA 3LZXA 5C3JA 2BK4A 2OA1A 2IVDA 1GTEA 2BK5A 3E1TA 3M13A 3NIXA 2BXSA 1GXFA 1O5WA 2XLRA 1SEZA 3B3RA 2DKIA 3AE6A 5BUKA 1FEBA 1GPEA 4GCMA 4Z25A 3DK8A 1NENA 5M0ZA 2BABA 3Q6JA 3S5WA 2I0ZA 3KU9A 1TYPA 3CNSA 4Z2RA 5KOXA 1E1MA 1DJNA 2J3NA 4CBQA 4E0VA 5GSNA 4EMIA 2XFUA 3DK4A 3AE4A 1GRTA 1LJ1A 3CTYA 1P2HA 4Z2UA 3AECA 4Y4NA 3UP4A 5BVAA 5JCIA 3BI5A 3IHMA 2XVIA 2CVJA 3ICSA 2NVKX 1DODA 3GRTA 2H88A 2RGJA 3H8LA 4IV9A 3SFEA 1BZLA 3QSSA 1E1KA 4J31A 5U63A 4A9WA 3KA7A 2YR4A 4K22A 3AE5A 3PVCA 1LV0A 5BRTA 3CN8A 3D8XA 4J2WA 4H4YA 4YSHA 2IIDA 3NNEA 2YQUA 1D7YA 2ARDA 3DJGX 3AEDA 1S2YA 3AE1A 2C75A 3REDA 2IVEA 4U8MA 2ZBWA 2C3CA 1DOBA 1CL0A 1JRZA 4B68A 5JCKA 4K5SA 2WDQA 3AYLA 3VRBA 5KWFA 3OZ2A 4XXGA 2GRTA 2R45A 3F8PA 4OPGA 3VRAA 4TM0A 3AEAA 4N9XA 1CJ4A 1N4VA 2JB1A 3G5QA 2GR0A 5KVHA 1ELIA 3NN0X 4Z44A 2GQFA 4FX9A 4H4RA 4CY8A 2XVHA 1E1LA 2WDVA 1GESA 5U25A 4H4SA 1PXCA 1CJ3A 4AOXA 3F8DA 2R46A 3GYIA 1FL2A 3KLJA 3C4NA 3GD4A 4H4WA 3CGDA 4IA6A 1H7WA 2Q6UA 2HQMA 2XVFA 3NT6A 3NYCA 4UDPA 1TDKA 1L0VA 3CPIG 1Y0PA 4PAAA 3UTGA 1IUSA 4BK3A 2PYXA 3VR9A 4GDEA 2JKCA 4P9SA 1GSNA 4OPLA 4B65A 5LV9A 3B6DA 2WU5A 2BA9A 5KOWA 4JNAA 3GSIA 4CCRA 3NK2X 5BULA 3DK9A 2YLXA 1PBFA 1N4WA 1CHUA 1GV4A 1K0JA 1F6MA 2A8XA 4U8IA 1GNDA 4O5QA 2XCGA 3NKSA 4NTCA 2R4JA 1YQ4A 4UDQA 4EQXA 2B9YA 1IUXA 1GRGA 4HA6A 1NG3A 4D04A 1OJDA 4H2NA 1M64A 5FMHA 1MOKA 2UZZA 4BV6A 1EL7A 4YSYA 1GETA
chains in the Genus database with same CATH superfamily
1FEAA 3AD9B 3QJ4A 4IVOB 2YM1A 4OPDA 3KPFA 4CNKA 3BNMA 1VDCA 1QO8A 2C3DA 3ISHA 1TDEA 4C74A 5J7XA 2VVLG 2Y6RA 3CNPA 2WBAA 3QSMA 1KSSA 4TM4A 5EB4A 1COYA 1JU2A 4OPTA 4RG4A 4USRA 3RNMA 4USQA 2GAHB 3CPHG 1XANA 1Q9IA 1XDIA 3T31A 5DBJA 1PBCA 3T2ZA 4NTEA 4YTNA 4EQSA 3R9UA 3UKPA 2VRLA 1H81A 2X99A 1EL8A 2XVEA 2Z5YA 3GYXA 2YLTA 3ICTA 4UP3A 1KFYA 4EM4A 2Y6QA 3NLCA 4EIQA 5EBKA 2H89A 1F8WA 1LVLA 1Q1WA 3BI2A 1E6EA 3G5SA 3NGCX 3NK0X 3QFAA 4G9KA 1PJ6A 1E7PA 2BCPA 3EPTA 3LJPA 1O95A 4C77A 1D5TA 5KMRA 1D7LA 1B8SA 1DNCA 2FJDA 1F8SA 1PBBA 2WPCA 1DOEA 1JNZA 1IUUA 3DJEA 2WOVA 2V61A 2YWLA 3SGLA 2B9XA 1NAAA 2R0GA 5JCNA 1H83A 4GUVA 1F3PA 1BKWA 2AQJA 2R4EA 2ZZ0A 3IHGA 3P9UA 4HB9A 3UKAA 1CC2A 2B76A 1PHHA 2WOWA 2CDUA 1PJ7A 2JAEA 3RP8A 3GWFA 1L9DA 2WETA 1QJDA 3ALJA 3QFBA 3UTEA 1S2QA 3DJJA 4AOSA 3ZYXA 1FOHA 4U2LA 1RP0A 4A65A 3KD9A 2R0CA 4JDRA 5KMSA 3VQRA 1CBOA 2FBWA 3AEEA 3UOVA 3EF6A 2WPEA 3HYXA 2X8CA 3GWDA 3PS9A 1E1NA 2DKHA 4ZCCA 5KMPA 1K0LA 4YKFA 4AP1A 1W4XA 1PBDA 1ZY8A 3CGCA 4U8PA 1OJTA 1RYIA 1BWCA 3K30A 4KX6A 3LADA 3AE2A 2V3BA 5KXJA 2A87A 3AB1A 3UTFA 1ZOVA 4J36A 3HZLA 2VVMA 3AE9A 4RSLA 4B66A 1NG4A 3S61A 1UKVG 2GF3A 1Q1RA 1YY5A 4TM1A 2CFYA 3AD8B 2OAMA 4M52A 2YG7A 4NEVA 2QCUA 2YLSA 4B63A 4NNJA 3ABVA 4C5OA 2RGOA 4TM3A 1H86A 4CY6A 4I58A 3SZWA 3NRNA 4ZCDA 2BS4A 3GMCA 2GMHA 3LXDA 1DJQA 4MJWA 4A6NA 1E39A 2GR2A 3AEGA 4YKGA 5IQ4A 5IQ1A 4LA1A 2TMDA 3DH9A 3NTAA 4D03A 1S3EA 3IF9A 3KPKA 2XLTA 1K4QA 2WESA 1CC4A 4EIPA 2WS3A 3ATRA 2VQ7A 4ECHA 3ADAB 3PO7A 2WHDA 3ATQA 3GDPA 3LZWA 4A6NB 4KPRA 5IPYA 2R0PA 3CMMA 2C72A 4NZHA 1N1PA 2YVFA 4APNA 2YG6A 1TDFA 2YLRA 3URHA 3KKJA 2E4GA 3AE7A 4B64A 2WDRA 3NG7X 4DSGA 3DJDA 1TDNA 5FS6A 2XLSA 4FK1A 3GMBA 1GRFA 2XYOA 3NN6X 3BNUA 1GOSA 4IVMB 3AYIA 2GR1A 1F8RA 3UOYA 1IUVA 4J56A 3H4KA 2YVGA 3UP5A 3UTHA 1GRHA 3DA1A 2WP5A 4A7AA 2RGHA 5FS9A 1HYUA 4BURA 4A5LA 5KMQA 3M0OA 3UCLA 4I59A 1GERA 1PJ5A 4EMWA 2ZZCA 2BYBA 2TPRA 1NPXA 3GDNA 4II3A 3CPJG 4Z43A 2YVJA 4EQRA 1D4CA 3H8IA 4NTDA 5JCIA 1MO9A 3EAOA 4GRTA 5FS8A 2C64A 4EMJA 1PXBA 2BCGG 2A89A 2QA2A 3NHOX 5CQFA 4TLXA 1M6IA 4U8JA 2OLOA 3OC4A 4CNJA 2GQWA 2YLZA 3SXIA 1NEKA 5CKUA 3I6DA 1S3BA 1LQUA 2GB0A 1N4UA 2CULA 5HHFA 3NK1X 3UOXA 1GTHA 2B9WA 4EQWA 4A99A 3I3LA 5FS7A 2Z5XA 4H4VA 3RP7A 4II2A 3AEBA 2WP6A 3CIRA 2C4CA 4DNAA 1ZX9A 2GR3A 2BS3A 1Y56A 1JEHA 1GT8A 1B4VA 4YWOA 5ER0A 1OJCA 1JOAA 5EOWA 3Q9TA 2OLNA 3COXA 3CGBA 2QAEA 4ICYA 2F5ZA 2YR6A 1JNRA 2X3NA 1B5QA 3P4RA 2V6OA 4WCTA 4AT2A 1BGJA 3C96A 1GRBA 2XDOA 3UKQA 3CNJA 2WP9A 1Y56B 4G6HA 4H2RA 1ZKQA 1QLBA 3VR8A 2V3AA 2VOUA 2YG4A 5L46A 2FJEA 1H6VA 4J57A 3CGEA 1V59A 2NPXA 4GF7A 4Z2TA 2ACZA 2WQYA 4K2XA 1ZMCA 1Z6LA 2C66A 2JK6A 2YG3A 4U8KA 4YSXA 1IUWA 4TLZA 4RG3A 4AP3A 4X9NA 1OJAA 1ZP0A 3IC9A 4H4PA 2XVJA 4DSHA 2Q0KA 1YQZA 4OVIA 2RABA 4OPUA 1PBEA 2EQ6A 4J33A 4EM3A 3FIMB 4GDPA 3V3OA 3QVPA 1VQWA 1OJ9A 1ONFA 2XLUA 3BI4A 2E5VA 4U2TA 2YM2A 2YR5A 3C4AA 4O5UA 4OPCA 2E1MA 1AOGA 2XFNA 3L8KA 1ZDLA 1DOCA 2Q7VA 3FG2P 3NTDA 2YAUA 3AXBA 3O0HA 3UOZA 3VRDB 4H4QA 3SX6A 2PHHA 3T0KA 1ZOYA 2VRMA 2WOIA 4NWZA 4H4ZA 3T14A 3SQPA 2B7RA 2YLWA 4JQ9A 4AT0A 4YSZA 5M10A 2WEUA 1O94A 1FCDA 2XLPA 3SFDA 1VRQB 1ZK7A 4U8NA 2FJBA 2GMJA 3UKFA 4OCGA 2BS2A 4CRTA 3QVRA 4IA5A 2V60A 4H4XA 4H4TA 1L9CA 2JB3A 4BK2A 4C3XA 1KNRA 1CC6A 2C70A 2JBVA 1GRAA 4XWZA 5J60A 3RP6A 3P4PA 4H2PA 3WE0A 3ZDNA 4BK1A 2R9ZA 4G74A 2BC0A 1VG9A 2GH5A 3AEFA 3K7MX 2B7SA 1XHCA 1NHSA 3AYJA 3RHAA 3ALMA 5JCMA 3K7TA 4K8DA 3F8RA 4YXDA 2VQBA 3NYFA 1PS9A 1REOA 2JB2A 3IWAA 2ZZBA 4JY2A 1FECA 3SM8A 3II4A 4H50A 4U2SA 3NYEA 5KVIA 3FBSA 1CJ2A 2XFPA 2GV8A 3D1CA 2XFOA 4GR1A 1NDAA 3GD3A 1H7XA 1DXLA 1TYTA 1P2EA 4H7UA 2VVLA 2C73A 1NHRA 3LOVA 4LU6A 4DGKA 1IJHA 1KSUA 1PN0A 4ZN0A 1TRBA 3ICRA 1D4EA 1PDHA 1H84A 1ZMDA 2GEWA 2EQ8A 3GRSA 1YQ3A 3CNDA 4B1BA 3QSEA 2QA1A 4H4UA 1KF6A 1TDOA 4JN9A 4Y4MA 1NHPA 3AE8A 2EQ9A 5TR3A 1KDGA 1EL9A 4FK1C 3FPZA 1MXTA 4NEWA 2AAQA 1IUTA 1KNPA 4H2QA 4PABA 3UKKA 5HY5A 4JNQA 3AD7B 5EB5A 4WX1A 1LTXR 3DGZA 4J34A 2BK3A 1JRXA 3BHFA 4ADWA 5JCLA 1CJCA 3HYVA 4Z24A 2EQ7A 1LQTA 4Z26A 2WPFA 1VG0A 3UKLA 1CF3A 3M12A 4LIIA 3G5RA 3V3NA 3SZ0A 1JRYA 3BHKA 3V76A 2Q0LA 4REKA 3T37A 3T2YA 3ITJA 3P4QA 3L1RA 2WU2A 3GYJA 3LB8A 2C67A 2X8HA 4U8LA 4K5RA 4U8OA 2BACA 4GAPA 2C76A 1L9EA 4K7ZA 2O9ZA 1RSGA 2YG5A 4UDRA 3ALLA 3JSKA 4OPIA 4XWRA 2GVCA 3DMEA 1PXAA 3EANA 4CCQA 1YKJA 1EBDA 4JY3A 5KRQA 2AR8A 5U1OA 3NH3X 3P1WA 3UKHA 2APGA 4B67A 2X50A 4YTMA 1BF3A 1D4DA 4BJZA 2XFQA 4BJYA 5HXIA 2V5ZA 2X8GA 1X31B 1H82A 2C65A 1GEUA 3KVEA 5KNLA 4YT0A 4FDCB 1BGNA 4G73A 3P4SA 4A79A 4B69A 2C7GA 3AWIA 3DGHA 3K7QX 4YTPA 1GALA 2VZ2A 1LPFA 1XPQA 2GAGB 1NHQA 3AE3A 2FJAA 2OALA 4Y4LA 4X4JA 3FMWA 4C3YA 2BXRA 1B37A 1EL5A 1K0IA 3CNTA 3SZCA 4X9MA 2BC1A 2W0HA 5C2TA 5GRTA 1GREA 3LZXA 5C3JA 2BK4A 2OA1A 2BRAA 4GAVA 2IVDA 1GTEA 2BK5A 3E1TA 3HYWA 3M13A 3NIXA 2BXSA 1GXFA 1O5WA 2XLRA 1SEZA 3B3RA 2DKIA 3AE6A 5BUKA 1FEBA 1GPEA 4GCMA 4Z25A 3DK8A 1NENA 5M0ZA 3T2KA 2BABA 3Q6JA 3S5WA 2I0ZA 3KU9A 1TYPA 3CNSA 4Z2RA 5KOXA 1E1MA 1DJNA 2J3NA 4CBQA 4E0VA 5GSNA 4EMIA 2XFUA 3DK4A 3AE4A 1GRTA 1LJ1A 3CTYA 1P2HA 4Z2UA 3AECA 4Y4NA 4G6GA 3UP4A 5BVAA 3BI5A 3IHMA 2XVIA 2CVJA 3ICSA 2NVKX 1DODA 3GRTA 2H88A 2RGJA 3H8LA 4IV9A 3SFEA 1BZLA 3QSSA 1E1KA 4J31A 5U63A 3SZFA 4A9WA 3KA7A 2YR4A 4K22A 3AE5A 3PVCA 1LV0A 5BRTA 3CN8A 3D8XA 4J2WA 4H4YA 4YSHA 2IIDA 3SY4A 3NNEA 2YQUA 1D7YA 2ARDA 3DJGX 3AEDA 1S2YA 3AE1A 2C75A 3REDA 2IVEA 4U8MA 2ZBWA 2C3CA 1DOBA 1CL0A 1JRZA 4B68A 5JCKA 4K5SA 2WDQA 3AYLA 3VRBA 5KWFA 3OZ2A 4XXGA 2GRTA 2R45A 3F8PA 4OPGA 3SYIA 3VRAA 4TM0A 3AEAA 4N9XA 1CJ4A 1N4VA 2JB1A 3G5QA 2GR0A 5KVHA 1ELIA 3NN0X 4Z44A 2GQFA 4FX9A 4H4RA 4CY8A 2XVHA 1E1LA 2WDVA 1GESA 5U25A 4H4SA 1PXCA 1CJ3A 4AOXA 3F8DA 2R46A 3GYIA 1FL2A 3KLJA 3C4NA 3GD4A 4H4WA 3CGDA 4IA6A 1H7WA 2Q6UA 2HQMA 2XVFA 3NT6A 3NYCA 4UDPA 1TDKA 1L0VA 3CPIG 1Y0PA 4PAAA 3UTGA 1IUSA 4BK3A 2PYXA 3VR9A 4GDEA 2JKCA 4P9SA 1GSNA 4OPLA 4B65A 5LV9A 3B6DA 2WU5A 2BA9A 5KOWA 4JNAA 3GSIA 4CCRA 3NK2X 5BULA 3DK9A 2YLXA 1PBFA 1N4WA 1CHUA 1GV4A 1K0JA 1F6MA 2A8XA 4U8IA 1GNDA 5HYMA 4O5QA 2BRYA 2XCGA 3NKSA 4NTCA 2R4JA 1YQ4A 4UDQA 4EQXA 2B9YA 1IUXA 1GRGA 4HA6A 1NG3A 4D04A 1OJDA 4H2NA 1M64A 5FMHA 1MOKA 2UZZA 4BV6A 1EL7A 4YSYA 1GETA
chains in the Genus database with same CATH topology
1FEAA 3AD9B 3QJ4A 4IVOB 2YM1A 4OPDA 3KPFA 4CNKA 3BNMA 1VDCA 1QO8A 2C3DA 3ISHA 1TDEA 4C74A 5J7XA 2VVLG 2Y6RA 3CNPA 2WBAA 3QSMA 1KSSA 4TM4A 5EB4A 1COYA 1JU2A 4OPTA 4RG4A 4USRA 3RNMA 4USQA 2GAHB 3CPHG 1XANA 1Q9IA 1XDIA 3T31A 5DBJA 1PBCA 3T2ZA 4NTEA 4YTNA 4EQSA 3R9UA 3UKPA 2VRLA 1H81A 2X99A 1EL8A 2XVEA 2Z5YA 3GYXA 2YLTA 3ICTA 4UP3A 1KFYA 4EM4A 2Y6QA 3NLCA 4EIQA 5EBKA 2H89A 1F8WA 1LVLA 1Q1WA 3BI2A 1E6EA 3G5SA 3NGCX 3NK0X 3QFAA 4G9KA 1PJ6A 1E7PA 2BCPA 3EPTA 3LJPA 1O95A 4C77A 1D5TA 5KMRA 1D7LA 1B8SA 1DNCA 2FJDA 1F8SA 1PBBA 2WPCA 1DOEA 1JNZA 1IUUA 3DJEA 2WOVA 2V61A 2YWLA 3SGLA 2B9XA 1NAAA 2R0GA 5JCNA 1H83A 4GUVA 1F3PA 1BKWA 2AQJA 2R4EA 2ZZ0A 3IHGA 3P9UA 4HB9A 3UKAA 1CC2A 2B76A 1PHHA 2WOWA 2CDUA 1PJ7A 2JAEA 3RP8A 3GWFA 1L9DA 2WETA 1QJDA 3ALJA 3QFBA 3UTEA 1S2QA 3DJJA 4AOSA 3ZYXA 1FOHA 4U2LA 1RP0A 4A65A 3KD9A 2R0CA 4JDRA 5KMSA 3VQRA 1CBOA 2FBWA 3AEEA 3UOVA 3EF6A 2WPEA 3HYXA 2X8CA 3GWDA 3PS9A 1E1NA 2DKHA 4ZCCA 5KMPA 1K0LA 4YKFA 4AP1A 1W4XA 1PBDA 1ZY8A 3CGCA 4U8PA 1OJTA 1RYIA 1BWCA 3K30A 4KX6A 3LADA 3AE2A 2V3BA 5KXJA 2A87A 3AB1A 3UTFA 1ZOVA 4J36A 3HZLA 2VVMA 3AE9A 4RSLA 4B66A 1NG4A 3S61A 1UKVG 2GF3A 1Q1RA 1YY5A 4TM1A 2CFYA 3AD8B 2OAMA 4M52A 2YG7A 4NEVA 2QCUA 2YLSA 4B63A 4NNJA 3ABVA 4C5OA 2RGOA 4TM3A 1H86A 4CY6A 4I58A 3SZWA 3NRNA 4ZCDA 2BS4A 3GMCA 2GMHA 3LXDA 1DJQA 4MJWA 4A6NA 1E39A 2GR2A 3AEGA 4YKGA 5IQ4A 5IQ1A 4LA1A 2TMDA 3DH9A 3NTAA 4D03A 1S3EA 3IF9A 3KPKA 2XLTA 1K4QA 2WESA 1CC4A 4EIPA 2WS3A 3ATRA 2VQ7A 4ECHA 3ADAB 3PO7A 2WHDA 3ATQA 3GDPA 3LZWA 4A6NB 4KPRA 5IPYA 2R0PA 3CMMA 2C72A 4NZHA 1N1PA 2YVFA 4APNA 2YG6A 1TDFA 2YLRA 3URHA 3KKJA 2E4GA 3AE7A 4B64A 2WDRA 3NG7X 4DSGA 3DJDA 1TDNA 5FS6A 2XLSA 4FK1A 3GMBA 1GRFA 2XYOA 3NN6X 3BNUA 1GOSA 4IVMB 3AYIA 2GR1A 1F8RA 3UOYA 1IUVA 4J56A 3H4KA 2YVGA 3UP5A 3UTHA 1GRHA 3DA1A 2WP5A 4A7AA 2RGHA 5FS9A 1HYUA 4BURA 4A5LA 5KMQA 3M0OA 3UCLA 4I59A 1GERA 1PJ5A 4EMWA 2ZZCA 2BYBA 2TPRA 1NPXA 3GDNA 4II3A 3CPJG 4Z43A 2YVJA 4EQRA 1D4CA 3H8IA 4NTDA 5JCIA 1MO9A 3EAOA 4GRTA 5FS8A 2C64A 4EMJA 1PXBA 2BCGG 2A89A 2QA2A 3NHOX 5CQFA 4TLXA 1M6IA 4U8JA 2OLOA 3OC4A 4CNJA 2GQWA 2YLZA 3SXIA 1NEKA 5CKUA 3I6DA 1S3BA 1LQUA 2GB0A 1N4UA 2CULA 5HHFA 3NK1X 3UOXA 1GTHA 2B9WA 4EQWA 4A99A 3I3LA 5FS7A 2Z5XA 4H4VA 3RP7A 4II2A 3AEBA 2WP6A 3CIRA 2C4CA 4DNAA 1ZX9A 2GR3A 2BS3A 1Y56A 1JEHA 1GT8A 1B4VA 4YWOA 5ER0A 1OJCA 1JOAA 5EOWA 3Q9TA 2OLNA 3COXA 3CGBA 2QAEA 4ICYA 2F5ZA 2YR6A 1JNRA 2X3NA 1B5QA 3P4RA 2V6OA 4WCTA 4AT2A 1BGJA 3C96A 1GRBA 2XDOA 3UKQA 3CNJA 2WP9A 1Y56B 4G6HA 4H2RA 1ZKQA 1QLBA 3VR8A 2V3AA 2VOUA 2YG4A 5L46A 2FJEA 1H6VA 4J57A 3CGEA 1V59A 2NPXA 4GF7A 4Z2TA 2ACZA 2WQYA 4K2XA 1ZMCA 1Z6LA 2C66A 2JK6A 2YG3A 4U8KA 4YSXA 1IUWA 4TLZA 4RG3A 4AP3A 4X9NA 1OJAA 1ZP0A 3IC9A 4H4PA 2XVJA 4DSHA 2Q0KA 1YQZA 4OVIA 2RABA 4OPUA 1PBEA 2EQ6A 4J33A 4EM3A 3FIMB 4GDPA 3V3OA 3QVPA 1VQWA 1OJ9A 1ONFA 2XLUA 3BI4A 2E5VA 4U2TA 2YM2A 2YR5A 3C4AA 4O5UA 4OPCA 2E1MA 1AOGA 2XFNA 3L8KA 1ZDLA 1DOCA 2Q7VA 3FG2P 3NTDA 2YAUA 3AXBA 3O0HA 3UOZA 3VRDB 4H4QA 3SX6A 2PHHA 3T0KA 1ZOYA 2VRMA 2WOIA 4NWZA 4H4ZA 3T14A 3SQPA 2B7RA 2YLWA 4JQ9A 4AT0A 4YSZA 5M10A 2WEUA 1O94A 1FCDA 2XLPA 3SFDA 1VRQB 1ZK7A 4U8NA 2FJBA 2GMJA 3UKFA 4OCGA 2BS2A 4CRTA 3QVRA 4IA5A 2V60A 4H4XA 4H4TA 1L9CA 2JB3A 4BK2A 4C3XA 1KNRA 1CC6A 2C70A 2JBVA 1GRAA 4XWZA 5J60A 3RP6A 3P4PA 4H2PA 3WE0A 3ZDNA 4BK1A 2R9ZA 4G74A 2BC0A 1VG9A 2GH5A 3AEFA 3K7MX 2B7SA 1XHCA 1NHSA 3AYJA 3RHAA 3ALMA 5JCMA 3K7TA 4K8DA 3F8RA 4YXDA 2VQBA 3NYFA 1PS9A 1REOA 2JB2A 3IWAA 2ZZBA 4JY2A 1FECA 3SM8A 3II4A 4H50A 4U2SA 3NYEA 5KVIA 3FBSA 1CJ2A 2XFPA 2GV8A 3D1CA 2XFOA 4GR1A 1NDAA 3GD3A 1H7XA 1DXLA 1TYTA 1P2EA 4H7UA 2VVLA 2C73A 1NHRA 3LOVA 4LU6A 4DGKA 1IJHA 1KSUA 1PN0A 4ZN0A 1TRBA 3ICRA 1D4EA 1PDHA 1H84A 1ZMDA 2GEWA 2EQ8A 3GRSA 1YQ3A 3CNDA 4B1BA 3QSEA 2QA1A 4H4UA 1KF6A 1TDOA 4JN9A 4Y4MA 1NHPA 3AE8A 2EQ9A 5TR3A 1KDGA 1EL9A 4FK1C 3FPZA 1MXTA 4NEWA 2AAQA 1IUTA 1KNPA 4H2QA 4PABA 3UKKA 5HY5A 4JNQA 3AD7B 5EB5A 4WX1A 1LTXR 3DGZA 4J34A 2BK3A 1JRXA 3BHFA 4ADWA 5JCLA 1CJCA 3HYVA 4Z24A 2EQ7A 1LQTA 4Z26A 2WPFA 1VG0A 3UKLA 1CF3A 3M12A 4LIIA 3G5RA 3V3NA 3SZ0A 1JRYA 3BHKA 3V76A 2Q0LA 4REKA 3T37A 3T2YA 3ITJA 3P4QA 3L1RA 2WU2A 3GYJA 3LB8A 2C67A 2X8HA 4U8LA 4K5RA 4U8OA 2BACA 4GAPA 2C76A 1L9EA 4K7ZA 2O9ZA 1RSGA 2YG5A 4UDRA 3ALLA 3JSKA 4OPIA 4XWRA 2GVCA 3DMEA 1PXAA 3EANA 4CCQA 1YKJA 1EBDA 4JY3A 5KRQA 2AR8A 5U1OA 3NH3X 3P1WA 3UKHA 2APGA 4B67A 2X50A 4YTMA 1BF3A 1D4DA 4BJZA 2XFQA 4BJYA 5HXIA 2V5ZA 2X8GA 1X31B 1H82A 2C65A 1GEUA 3KVEA 5KNLA 4YT0A 4FDCB 1BGNA 4G73A 3P4SA 4A79A 4B69A 2C7GA 3AWIA 3DGHA 3K7QX 4YTPA 1GALA 2VZ2A 1LPFA 1XPQA 2GAGB 1NHQA 3AE3A 2FJAA 2OALA 4Y4LA 4X4JA 3FMWA 4C3YA 2BXRA 1B37A 1EL5A 1K0IA 3CNTA 3SZCA 4X9MA 2BC1A 2W0HA 5C2TA 5GRTA 1GREA 3LZXA 5C3JA 2BK4A 2OA1A 2BRAA 4GAVA 2IVDA 1GTEA 2BK5A 3E1TA 3HYWA 3M13A 3NIXA 2BXSA 1GXFA 1O5WA 2XLRA 1SEZA 3B3RA 2DKIA 3AE6A 5BUKA 1FEBA 1GPEA 4GCMA 4Z25A 3DK8A 1NENA 5M0ZA 3T2KA 2BABA 3Q6JA 3S5WA 2I0ZA 3KU9A 1TYPA 3CNSA 4Z2RA 5KOXA 1E1MA 1DJNA 2J3NA 4CBQA 4E0VA 5GSNA 4EMIA 2XFUA 3DK4A 3AE4A 1GRTA 1LJ1A 3CTYA 1P2HA 4Z2UA 3AECA 4Y4NA 4G6GA 3UP4A 5BVAA 3BI5A 3IHMA 2XVIA 2CVJA 3ICSA 2NVKX 1DODA 3GRTA 2H88A 2RGJA 3H8LA 4IV9A 3SFEA 1BZLA 3QSSA 1E1KA 4J31A 5U63A 3SZFA 4A9WA 3KA7A 2YR4A 4K22A 3AE5A 3PVCA 1LV0A 5BRTA 3CN8A 3D8XA 4J2WA 4H4YA 4YSHA 2IIDA 3SY4A 3NNEA 2YQUA 1D7YA 2ARDA 3DJGX 3AEDA 1S2YA 3AE1A 2C75A 3REDA 2IVEA 4U8MA 2ZBWA 2C3CA 1DOBA 1CL0A 1JRZA 4B68A 5JCKA 4K5SA 2WDQA 3AYLA 3VRBA 5KWFA 3OZ2A 4XXGA 2GRTA 2R45A 3F8PA 4OPGA 3SYIA 3VRAA 4TM0A 3AEAA 4N9XA 1CJ4A 1N4VA 2JB1A 3G5QA 2GR0A 5KVHA 1ELIA 3NN0X 4Z44A 2GQFA 4FX9A 4H4RA 4CY8A 2XVHA 1E1LA 2WDVA 1GESA 5U25A 4H4SA 1PXCA 1CJ3A 4AOXA 3F8DA 2R46A 3GYIA 1FL2A 3KLJA 3C4NA 3GD4A 4H4WA 3CGDA 4IA6A 1H7WA 2Q6UA 2HQMA 2XVFA 3NT6A 3NYCA 4UDPA 1TDKA 1L0VA 3CPIG 1Y0PA 4PAAA 3UTGA 1IUSA 4BK3A 2PYXA 3VR9A 4GDEA 2JKCA 4P9SA 1GSNA 4OPLA 4B65A 5LV9A 3B6DA 2WU5A 2BA9A 5KOWA 4JNAA 3GSIA 4CCRA 3NK2X 5BULA 3DK9A 2YLXA 1PBFA 1N4WA 1CHUA 1GV4A 1K0JA 1F6MA 2A8XA 4U8IA 1GNDA 5HYMA 4O5QA 2BRYA 2XCGA 3NKSA 4NTCA 2R4JA 1YQ4A 4UDQA 4EQXA 2B9YA 1IUXA 1GRGA 4HA6A 1NG3A 4D04A 1OJDA 4H2NA 1M64A 5FMHA 1MOKA 2UZZA 4BV6A 1EL7A 4YSYA 1GETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEA A;  3AD9 B;  3QJ4 A;  4IVO B;  2YM1 A;  4OPD A;  3KPF A;  4CNK A;  3BNM A;  1VDC A;  1QO8 A;  2C3D A;  3ISH A;  1TDE A;  4C74 A;  5J7X A;  2VVL G;  2Y6R A;  3CNP A;  2WBA A;  3QSM A;  1KSS A;  4TM4 A;  5EB4 A;  1COY A;  1JU2 A;  4OPT A;  4RG4 A;  4USR A;  3RNM A;  4USQ A;  2GAH B;  3CPH G;  1XAN A;  1Q9I A;  1XDI A;  5DBJ A;  1PBC A;  4NTE A;  4YTN A;  4EQS A;  3R9U A;  3UKP A;  2VRL A;  1H81 A;  2X99 A;  1EL8 A;  2XVE A;  2Z5Y A;  3ICT A;  2YLT A;  4UP3 A;  1KFY A;  4EM4 A;  2Y6Q A;  3NLC A;  4EIQ A;  5EBK A;  2H89 A;  1F8W A;  1LVL A;  1Q1W A;  3BI2 A;  1E6E A;  3G5S A;  3NGC X;  3NK0 X;  3QFA A;  4C77 A;  1PJ6 A;  1E7P A;  2BCP A;  3EPT A;  3LJP A;  1O95 A;  1D5T A;  1D7L A;  1B8S A;  1DNC A;  2FJD A;  1F8S A;  1PBB A;  2WPC A;  1DOE A;  1JNZ A;  1IUU A;  3DJE A;  2WOV A;  2V61 A;  2YWL A;  3SGL A;  2B9X A;  1NAA A;  2R0G A;  5JCN A;  1H83 A;  4GUV A;  1F3P A;  1BKW A;  2AQJ A;  2R4E A;  2ZZ0 A;  3IHG A;  3P9U A;  4HB9 A;  3UKA A;  1CC2 A;  2B76 A;  1PHH A;  2WOW A;  2CDU A;  1PJ7 A;  2JAE A;  3RP8 A;  3GWF A;  1L9D A;  2WET A;  1QJD A;  3ALJ A;  3QFB A;  3UTE A;  1S2Q A;  3DJJ A;  4AOS A;  3ZYX A;  1FOH A;  4U2L A;  1RP0 A;  4A65 A;  3KD9 A;  2R0C A;  4JDR A;  3VQR A;  1CBO A;  2FBW A;  3AEE A;  3UOV A;  3EF6 A;  2WPE A;  2X8C A;  3GWD A;  3PS9 A;  1E1N A;  2DKH A;  4ZCC A;  1K0L A;  4YKF A;  4AP1 A;  1W4X A;  1PBD A;  1ZY8 A;  3CGC A;  4U8P A;  1OJT A;  1RYI A;  1BWC A;  3K30 A;  4KX6 A;  3LAD A;  3AE2 A;  2V3B A;  5KXJ A;  2A87 A;  3AB1 A;  3UTF A;  1ZOV A;  4J36 A;  3HZL A;  2VVM A;  3AE9 A;  4RSL A;  4B66 A;  1NG4 A;  3S61 A;  1UKV G;  2GF3 A;  1Q1R A;  1YY5 A;  4TM1 A;  2CFY A;  3AD8 B;  2OAM A;  4M52 A;  2YG7 A;  4NEV A;  2QCU A;  2YLS A;  4B63 A;  3ABV A;  4C5O A;  2RGO A;  4TM3 A;  1H86 A;  4CY6 A;  4I58 A;  3NRN A;  4ZCD A;  2BS4 A;  3GMC A;  2GMH A;  3LXD A;  1DJQ A;  4MJW A;  4A6N A;  1E39 A;  2GR2 A;  3AEG A;  4YKG A;  5IQ4 A;  5IQ1 A;  4LA1 A;  2TMD A;  3DH9 A;  3NTA A;  4D03 A;  1S3E A;  3IF9 A;  2XLT A;  1K4Q A;  2WES A;  1CC4 A;  4EIP A;  2WS3 A;  3ATR A;  2VQ7 A;  4ECH A;  3ADA B;  3PO7 A;  2WHD A;  3ATQ A;  3GDP A;  3LZW A;  4A6N B;  4KPR A;  5IPY A;  2R0P A;  2C72 A;  4NZH A;  1N1P A;  2YVF A;  4APN A;  2YG6 A;  1TDF A;  2YLR A;  3URH A;  3KKJ A;  2E4G A;  3AE7 A;  4B64 A;  2WDR A;  3NG7 X;  4DSG A;  3DJD A;  1TDN A;  5FS6 A;  2XLS A;  4FK1 A;  3GMB A;  1GRF A;  2XYO A;  3NN6 X;  3BNU A;  1GOS A;  4IVM B;  3AYI A;  2GR1 A;  1F8R A;  3UOY A;  1IUV A;  4J56 A;  3H4K A;  2YVG A;  3UP5 A;  3UTH A;  1GRH A;  3DA1 A;  2WP5 A;  4A7A A;  2RGH A;  5FS9 A;  1HYU A;  4BUR A;  4A5L A;  3M0O A;  3UCL A;  4I59 A;  1GER A;  1PJ5 A;  4EMW A;  2ZZC A;  2BYB A;  2TPR A;  1NPX A;  3GDN A;  3CPJ G;  4Z43 A;  2YVJ A;  4EQR A;  1D4C A;  3H8I A;  4NTD A;  1MO9 A;  3EAO A;  4GRT A;  5FS8 A;  2C64 A;  4EMJ A;  1PXB A;  2BCG G;  2A89 A;  2QA2 A;  3NHO X;  5CQF A;  4TLX A;  1M6I A;  4U8J A;  2OLO A;  3OC4 A;  4CNJ A;  2GQW A;  2YLZ A;  1NEK A;  5CKU A;  3I6D A;  1S3B A;  1LQU A;  2GB0 A;  1N4U A;  2CUL A;  5HHF A;  3NK1 X;  3UOX A;  1GTH A;  2B9W A;  4EQW A;  4A99 A;  3I3L A;  5FS7 A;  2Z5X A;  4H4V A;  3RP7 A;  3AEB A;  2WP6 A;  3CIR A;  4DNA A;  1ZX9 A;  2GR3 A;  2BS3 A;  1Y56 A;  1JEH A;  1GT8 A;  1B4V A;  4YWO A;  5ER0 A;  1OJC A;  1JOA A;  5EOW A;  3Q9T A;  2OLN A;  3COX A;  3CGB A;  2QAE A;  4ICY A;  2F5Z A;  2YR6 A;  1JNR A;  2X3N A;  1B5Q A;  3P4R A;  2V6O A;  4WCT A;  4AT2 A;  1BGJ A;  3C96 A;  1GRB A;  2XDO A;  3UKQ A;  3CNJ A;  2WP9 A;  1Y56 B;  4H2R A;  1ZKQ A;  1QLB A;  3VR8 A;  2V3A A;  2VOU A;  2YG4 A;  5L46 A;  2FJE A;  1H6V A;  4J57 A;  3CGE A;  1V59 A;  2NPX A;  4GF7 A;  4Z2T A;  2ACZ A;  2WQY A;  4K2X A;  1ZMC A;  1Z6L A;  2C66 A;  2JK6 A;  2YG3 A;  4U8K A;  4YSX A;  1IUW A;  4TLZ A;  4RG3 A;  4AP3 A;  4X9N A;  1OJA A;  1ZP0 A;  3IC9 A;  4H4P A;  2XVJ A;  4DSH A;  2Q0K A;  1YQZ A;  4OVI A;  2RAB A;  4OPU A;  1PBE A;  2EQ6 A;  4J33 A;  4EM3 A;  3FIM B;  4GDP A;  3V3O A;  3QVP A;  1VQW A;  1OJ9 A;  1ONF A;  2XLU A;  3BI4 A;  2E5V A;  4U2T A;  2YM2 A;  2YR5 A;  3C4A A;  4O5U A;  4OPC A;  2E1M A;  1AOG A;  2XFN A;  3L8K A;  1ZDL A;  1DOC A;  2Q7V A;  3FG2 P;  3NTD A;  2YAU A;  3AXB A;  3O0H A;  3UOZ A;  3VRD B;  4H4Q A;  2PHH A;  1ZOY A;  2VRM A;  2WOI A;  4H4Z A;  3SQP A;  2B7R A;  2YLW A;  4JQ9 A;  4AT0 A;  4YSZ A;  5M10 A;  2WEU A;  1O94 A;  1FCD A;  2XLP A;  3SFD A;  1VRQ B;  1ZK7 A;  4U8N A;  2FJB A;  2GMJ A;  3UKF A;  4OCG A;  2BS2 A;  4CRT A;  3QVR A;  4IA5 A;  2V60 A;  4H4X A;  4H4T A;  1L9C A;  2JB3 A;  4BK2 A;  4C3X A;  1KNR A;  1CC6 A;  2C70 A;  2JBV A;  1GRA A;  4XWZ A;  5J60 A;  3RP6 A;  3P4P A;  4H2P A;  3WE0 A;  3ZDN A;  4BK1 A;  2R9Z A;  2BC0 A;  1VG9 A;  2GH5 A;  3AEF A;  3K7M X;  2B7S A;  1XHC A;  1NHS A;  3AYJ A;  3RHA A;  3ALM A;  5JCM A;  3K7T A;  4K8D A;  3F8R A;  4YXD A;  2VQB A;  3NYF A;  1PS9 A;  1REO A;  2JB2 A;  3IWA A;  2ZZB A;  4JY2 A;  1FEC A;  3SM8 A;  3II4 A;  4H50 A;  4U2S A;  3NYE A;  5KVI A;  3FBS A;  1CJ2 A;  2XFP A;  2GV8 A;  3D1C A;  2XFO A;  4GR1 A;  1NDA A;  3GD3 A;  1H7X A;  1DXL A;  1TYT A;  1P2E A;  4H7U A;  2VVL A;  2C73 A;  1NHR A;  3LOV A;  4LU6 A;  4DGK A;  1IJH A;  1KSU A;  1PN0 A;  4ZN0 A;  1TRB A;  3ICR A;  1D4E A;  1PDH A;  1H84 A;  1ZMD A;  2GEW A;  2EQ8 A;  3GRS A;  1YQ3 A;  3CND A;  4B1B A;  3QSE A;  2QA1 A;  4H4U A;  1KF6 A;  1TDO A;  4JN9 A;  4Y4M A;  1NHP A;  3AE8 A;  2EQ9 A;  5TR3 A;  1KDG A;  1EL9 A;  4FK1 C;  3FPZ A;  1MXT A;  4NEW A;  2AAQ A;  1IUT A;  1KNP A;  4H2Q A;  4PAB A;  3UKK A;  5HY5 A;  4JNQ A;  3AD7 B;  5EB5 A;  4WX1 A;  1LTX R;  3DGZ A;  4J34 A;  2BK3 A;  1JRX A;  3BHF A;  4ADW A;  5JCL A;  1CJC A;  4Z24 A;  2EQ7 A;  1LQT A;  4Z26 A;  2WPF A;  1VG0 A;  3UKL A;  1CF3 A;  3M12 A;  4LII A;  3G5R A;  3V3N A;  1JRY A;  3BHK A;  3V76 A;  2Q0L A;  4REK A;  3T37 A;  3ITJ A;  3P4Q A;  3L1R A;  2WU2 A;  3GYJ A;  3LB8 A;  2C67 A;  2X8H A;  4U8L A;  4K5R A;  4U8O A;  2BAC A;  2C76 A;  1L9E A;  4K7Z A;  2O9Z A;  1RSG A;  2YG5 A;  4UDR A;  3ALL A;  3JSK A;  4OPI A;  4XWR A;  2GVC A;  3DME A;  1PXA A;  3EAN A;  4CCQ A;  1YKJ A;  1EBD A;  4JY3 A;  5KRQ A;  2AR8 A;  5U1O A;  3NH3 X;  3P1W A;  3UKH A;  2APG A;  4B67 A;  2X50 A;  4YTM A;  1BF3 A;  1D4D A;  4BJZ A;  2XFQ A;  4BJY A;  5HXI A;  2V5Z A;  2X8G A;  1X31 B;  1H82 A;  2C65 A;  1GEU A;  3KVE A;  4YT0 A;  4FDC B;  1BGN A;  5HYM A;  3P4S A;  4A79 A;  4B69 A;  2C7G A;  3AWI A;  3DGH A;  3K7Q X;  4YTP A;  1GAL A;  2VZ2 A;  1LPF A;  1XPQ A;  2GAG B;  1NHQ A;  3AE3 A;  2FJA A;  2OAL A;  4Y4L A;  4X4J A;  3FMW A;  4C3Y A;  2BXR A;  1B37 A;  1EL5 A;  1K0I A;  3CNT A;  4X9M A;  2BC1 A;  2W0H A;  5C2T A;  5GRT A;  1GRE A;  3LZX A;  5C3J A;  2BK4 A;  2OA1 A;  2IVD A;  1GTE A;  2BK5 A;  3E1T A;  3M13 A;  3NIX A;  2BXS A;  1GXF A;  1O5W A;  2XLR A;  1SEZ A;  3B3R A;  2DKI A;  3AE6 A;  5BUK A;  1FEB A;  1GPE A;  4GCM A;  4Z25 A;  3DK8 A;  1NEN A;  5M0Z A;  2BAB A;  3Q6J A;  3S5W A;  2I0Z A;  3KU9 A;  1TYP A;  3CNS A;  4Z2R A;  5KOX A;  1E1M A;  1DJN A;  2J3N A;  4CBQ A;  4E0V A;  5GSN A;  4EMI A;  2XFU A;  3DK4 A;  3AE4 A;  1GRT A;  1LJ1 A;  3CTY A;  1P2H A;  4Z2U A;  3AEC A;  4Y4N A;  3UP4 A;  5BVA A;  5JCI A;  3BI5 A;  3IHM A;  2XVI A;  2CVJ A;  3ICS A;  2NVK X;  1DOD A;  3GRT A;  2H88 A;  2RGJ A;  3H8L A;  4IV9 A;  3SFE A;  1BZL A;  3QSS A;  1E1K A;  4J31 A;  5U63 A;  4A9W A;  3KA7 A;  2YR4 A;  4K22 A;  3AE5 A;  3PVC A;  1LV0 A;  5BRT A;  3CN8 A;  3D8X A;  4J2W A;  4H4Y A;  4YSH A;  2IID A;  3NNE A;  2YQU A;  1D7Y A;  2ARD A;  3DJG X;  3AED A;  1S2Y A;  3AE1 A;  2C75 A;  3RED A;  2IVE A;  4U8M A;  2ZBW A;  2C3C A;  1DOB A;  1CL0 A;  1JRZ A;  4B68 A;  5JCK A;  4K5S A;  2WDQ A;  3AYL A;  3VRB A;  5KWF A;  3OZ2 A;  4XXG A;  2GRT A;  2R45 A;  3F8P A;  4OPG A;  3VRA A;  4TM0 A;  3AEA A;  4N9X A;  1CJ4 A;  1N4V A;  2JB1 A;  3G5Q A;  2GR0 A;  5KVH A;  1ELI A;  3NN0 X;  4Z44 A;  2GQF A;  4FX9 A;  4H4R A;  4CY8 A;  2XVH A;  1E1L A;  2WDV A;  1GES A;  5U25 A;  4H4S A;  1PXC A;  1CJ3 A;  4AOX A;  3F8D A;  2R46 A;  3GYI A;  1FL2 A;  3KLJ A;  3C4N A;  3GD4 A;  4H4W A;  3CGD A;  4IA6 A;  1H7W A;  2Q6U A;  2HQM A;  2XVF A;  3NT6 A;  3NYC A;  4UDP A;  1TDK A;  1L0V A;  3CPI G;  1Y0P A;  4PAA A;  3UTG A;  1IUS A;  4BK3 A;  2PYX A;  3VR9 A;  4GDE A;  2JKC A;  4P9S A;  1GSN A;  4OPL A;  4B65 A;  5LV9 A;  3B6D A;  2WU5 A;  2BA9 A;  5KOW A;  4JNA A;  3GSI A;  4CCR A;  3NK2 X;  5BUL A;  3DK9 A;  2YLX A;  1PBF A;  1N4W A;  1CHU A;  1GV4 A;  1K0J A;  1F6M A;  2A8X A;  4U8I A;  1GND A;  4O5Q A;  2XCG A;  3NKS A;  4NTC A;  2R4J A;  1YQ4 A;  4UDQ A;  4EQX A;  2B9Y A;  1IUX A;  1GRG A;  4HA6 A;  1NG3 A;  4D04 A;  1OJD A;  4H2N A;  1M64 A;  5FMH A;  1MOK A;  2UZZ A;  4BV6 A;  1EL7 A;  4YSY A;  1GET A; 
#chains in the Genus database with same CATH topology
 1FEA A;  3AD9 B;  3QJ4 A;  4IVO B;  2YM1 A;  4OPD A;  3KPF A;  4CNK A;  3BNM A;  1VDC A;  1QO8 A;  2C3D A;  3ISH A;  1TDE A;  4C74 A;  5J7X A;  2VVL G;  2Y6R A;  3CNP A;  2WBA A;  3QSM A;  1KSS A;  4TM4 A;  5EB4 A;  1COY A;  1JU2 A;  4OPT A;  4RG4 A;  4USR A;  3RNM A;  4USQ A;  2GAH B;  3CPH G;  1XAN A;  1Q9I A;  1XDI A;  3T31 A;  5DBJ A;  1PBC A;  3T2Z A;  4NTE A;  4YTN A;  4EQS A;  3R9U A;  3UKP A;  2VRL A;  1H81 A;  2X99 A;  1EL8 A;  2XVE A;  2Z5Y A;  3GYX A;  2YLT A;  3ICT A;  4UP3 A;  1KFY A;  4EM4 A;  2Y6Q A;  3NLC A;  4EIQ A;  5EBK A;  2H89 A;  1F8W A;  1LVL A;  1Q1W A;  3BI2 A;  1E6E A;  3G5S A;  3NGC X;  3NK0 X;  3QFA A;  4G9K A;  1PJ6 A;  1E7P A;  2BCP A;  3EPT A;  3LJP A;  1O95 A;  4C77 A;  1D5T A;  5KMR A;  1D7L A;  1B8S A;  1DNC A;  2FJD A;  1F8S A;  1PBB A;  2WPC A;  1DOE A;  1JNZ A;  1IUU A;  3DJE A;  2WOV A;  2V61 A;  2YWL A;  3SGL A;  2B9X A;  1NAA A;  2R0G A;  5JCN A;  1H83 A;  4GUV A;  1F3P A;  1BKW A;  2AQJ A;  2R4E A;  2ZZ0 A;  3IHG A;  3P9U A;  4HB9 A;  3UKA A;  1CC2 A;  2B76 A;  1PHH A;  2WOW A;  2CDU A;  1PJ7 A;  2JAE A;  3RP8 A;  3GWF A;  1L9D A;  2WET A;  1QJD A;  3ALJ A;  3QFB A;  3UTE A;  1S2Q A;  3DJJ A;  4AOS A;  3ZYX A;  1FOH A;  4U2L A;  1RP0 A;  4A65 A;  3KD9 A;  2R0C A;  4JDR A;  5KMS A;  3VQR A;  1CBO A;  2FBW A;  3AEE A;  3UOV A;  3EF6 A;  2WPE A;  3HYX A;  2X8C A;  3GWD A;  3PS9 A;  1E1N A;  2DKH A;  4ZCC A;  5KMP A;  1K0L A;  4YKF A;  4AP1 A;  1W4X A;  1PBD A;  1ZY8 A;  3CGC A;  4U8P A;  1OJT A;  1RYI A;  1BWC A;  3K30 A;  4KX6 A;  3LAD A;  3AE2 A;  2V3B A;  5KXJ A;  2A87 A;  3AB1 A;  3UTF A;  1ZOV A;  4J36 A;  3HZL A;  2VVM A;  3AE9 A;  4RSL A;  4B66 A;  1NG4 A;  3S61 A;  1UKV G;  2GF3 A;  1Q1R A;  1YY5 A;  4TM1 A;  2CFY A;  3AD8 B;  2OAM A;  4M52 A;  2YG7 A;  4NEV A;  2QCU A;  2YLS A;  4B63 A;  4NNJ A;  3ABV A;  4C5O A;  2RGO A;  4TM3 A;  1H86 A;  4CY6 A;  4I58 A;  3SZW A;  3NRN A;  4ZCD A;  2BS4 A;  3GMC A;  2GMH A;  3LXD A;  1DJQ A;  4MJW A;  4A6N A;  1E39 A;  2GR2 A;  3AEG A;  4YKG A;  5IQ4 A;  5IQ1 A;  4LA1 A;  2TMD A;  3DH9 A;  3NTA A;  4D03 A;  1S3E A;  3IF9 A;  3KPK A;  2XLT A;  1K4Q A;  2WES A;  1CC4 A;  4EIP A;  2WS3 A;  3ATR A;  2VQ7 A;  4ECH A;  3ADA B;  3PO7 A;  2WHD A;  3ATQ A;  3GDP A;  3LZW A;  4A6N B;  4KPR A;  5IPY A;  2R0P A;  3CMM A;  2C72 A;  4NZH A;  1N1P A;  2YVF A;  4APN A;  2YG6 A;  1TDF A;  2YLR A;  3URH A;  3KKJ A;  2E4G A;  3AE7 A;  4B64 A;  2WDR A;  3NG7 X;  4DSG A;  3DJD A;  1TDN A;  5FS6 A;  2XLS A;  4FK1 A;  3GMB A;  1GRF A;  2XYO A;  3NN6 X;  3BNU A;  1GOS A;  4IVM B;  3AYI A;  2GR1 A;  1F8R A;  3UOY A;  1IUV A;  4J56 A;  3H4K A;  2YVG A;  3UP5 A;  3UTH A;  1GRH A;  3DA1 A;  2WP5 A;  4A7A A;  2RGH A;  5FS9 A;  1HYU A;  4BUR A;  4A5L A;  5KMQ A;  3M0O A;  3UCL A;  4I59 A;  1GER A;  1PJ5 A;  4EMW A;  2ZZC A;  2BYB A;  2TPR A;  1NPX A;  3GDN A;  4II3 A;  3CPJ G;  4Z43 A;  2YVJ A;  4EQR A;  1D4C A;  3H8I A;  4NTD A;  5JCI A;  1MO9 A;  3EAO A;  4GRT A;  5FS8 A;  2C64 A;  4EMJ A;  1PXB A;  2BCG G;  2A89 A;  2QA2 A;  3NHO X;  5CQF A;  4TLX A;  1M6I A;  4U8J A;  2OLO A;  3OC4 A;  4CNJ A;  2GQW A;  2YLZ A;  3SXI A;  1NEK A;  5CKU A;  3I6D A;  1S3B A;  1LQU A;  2GB0 A;  1N4U A;  2CUL A;  5HHF A;  3NK1 X;  3UOX A;  1GTH A;  2B9W A;  4EQW A;  4A99 A;  3I3L A;  5FS7 A;  2Z5X A;  4H4V A;  3RP7 A;  4II2 A;  3AEB A;  2WP6 A;  3CIR A;  2C4C A;  4DNA A;  1ZX9 A;  2GR3 A;  2BS3 A;  1Y56 A;  1JEH A;  1GT8 A;  1B4V A;  4YWO A;  5ER0 A;  1OJC A;  1JOA A;  5EOW A;  3Q9T A;  2OLN A;  3COX A;  3CGB A;  2QAE A;  4ICY A;  2F5Z A;  2YR6 A;  1JNR A;  2X3N A;  1B5Q A;  3P4R A;  2V6O A;  4WCT A;  4AT2 A;  1BGJ A;  3C96 A;  1GRB A;  2XDO A;  3UKQ A;  3CNJ A;  2WP9 A;  1Y56 B;  4G6H A;  4H2R A;  1ZKQ A;  1QLB A;  3VR8 A;  2V3A A;  2VOU A;  2YG4 A;  5L46 A;  2FJE A;  1H6V A;  4J57 A;  3CGE A;  1V59 A;  2NPX A;  4GF7 A;  4Z2T A;  2ACZ A;  2WQY A;  4K2X A;  1ZMC A;  1Z6L A;  2C66 A;  2JK6 A;  2YG3 A;  4U8K A;  4YSX A;  1IUW A;  4TLZ A;  4RG3 A;  4AP3 A;  4X9N A;  1OJA A;  1ZP0 A;  3IC9 A;  4H4P A;  2XVJ A;  4DSH A;  2Q0K A;  1YQZ A;  4OVI A;  2RAB A;  4OPU A;  1PBE A;  2EQ6 A;  4J33 A;  4EM3 A;  3FIM B;  4GDP A;  3V3O A;  3QVP A;  1VQW A;  1OJ9 A;  1ONF A;  2XLU A;  3BI4 A;  2E5V A;  4U2T A;  2YM2 A;  2YR5 A;  3C4A A;  4O5U A;  4OPC A;  2E1M A;  1AOG A;  2XFN A;  3L8K A;  1ZDL A;  1DOC A;  2Q7V A;  3FG2 P;  3NTD A;  2YAU A;  3AXB A;  3O0H A;  3UOZ A;  3VRD B;  4H4Q A;  3SX6 A;  2PHH A;  3T0K A;  1ZOY A;  2VRM A;  2WOI A;  4NWZ A;  4H4Z A;  3T14 A;  3SQP A;  2B7R A;  2YLW A;  4JQ9 A;  4AT0 A;  4YSZ A;  5M10 A;  2WEU A;  1O94 A;  1FCD A;  2XLP A;  3SFD A;  1VRQ B;  1ZK7 A;  4U8N A;  2FJB A;  2GMJ A;  3UKF A;  4OCG A;  2BS2 A;  4CRT A;  3QVR A;  4IA5 A;  2V60 A;  4H4X A;  4H4T A;  1L9C A;  2JB3 A;  4BK2 A;  4C3X A;  1KNR A;  1CC6 A;  2C70 A;  2JBV A;  1GRA A;  4XWZ A;  5J60 A;  3RP6 A;  3P4P A;  4H2P A;  3WE0 A;  3ZDN A;  4BK1 A;  2R9Z A;  4G74 A;  2BC0 A;  1VG9 A;  2GH5 A;  3AEF A;  3K7M X;  2B7S A;  1XHC A;  1NHS A;  3AYJ A;  3RHA A;  3ALM A;  5JCM A;  3K7T A;  4K8D A;  3F8R A;  4YXD A;  2VQB A;  3NYF A;  1PS9 A;  1REO A;  2JB2 A;  3IWA A;  2ZZB A;  4JY2 A;  1FEC A;  3SM8 A;  3II4 A;  4H50 A;  4U2S A;  3NYE A;  5KVI A;  3FBS A;  1CJ2 A;  2XFP A;  2GV8 A;  3D1C A;  2XFO A;  4GR1 A;  1NDA A;  3GD3 A;  1H7X A;  1DXL A;  1TYT A;  1P2E A;  4H7U A;  2VVL A;  2C73 A;  1NHR A;  3LOV A;  4LU6 A;  4DGK A;  1IJH A;  1KSU A;  1PN0 A;  4ZN0 A;  1TRB A;  3ICR A;  1D4E A;  1PDH A;  1H84 A;  1ZMD A;  2GEW A;  2EQ8 A;  3GRS A;  1YQ3 A;  3CND A;  4B1B A;  3QSE A;  2QA1 A;  4H4U A;  1KF6 A;  1TDO A;  4JN9 A;  4Y4M A;  1NHP A;  3AE8 A;  2EQ9 A;  5TR3 A;  1KDG A;  1EL9 A;  4FK1 C;  3FPZ A;  1MXT A;  4NEW A;  2AAQ A;  1IUT A;  1KNP A;  4H2Q A;  4PAB A;  3UKK A;  5HY5 A;  4JNQ A;  3AD7 B;  5EB5 A;  4WX1 A;  1LTX R;  3DGZ A;  4J34 A;  2BK3 A;  1JRX A;  3BHF A;  4ADW A;  5JCL A;  1CJC A;  3HYV A;  4Z24 A;  2EQ7 A;  1LQT A;  4Z26 A;  2WPF A;  1VG0 A;  3UKL A;  1CF3 A;  3M12 A;  4LII A;  3G5R A;  3V3N A;  3SZ0 A;  1JRY A;  3BHK A;  3V76 A;  2Q0L A;  4REK A;  3T37 A;  3T2Y A;  3ITJ A;  3P4Q A;  3L1R A;  2WU2 A;  3GYJ A;  3LB8 A;  2C67 A;  2X8H A;  4U8L A;  4K5R A;  4U8O A;  2BAC A;  4GAP A;  2C76 A;  1L9E A;  4K7Z A;  2O9Z A;  1RSG A;  2YG5 A;  4UDR A;  3ALL A;  3JSK A;  4OPI A;  4XWR A;  2GVC A;  3DME A;  1PXA A;  3EAN A;  4CCQ A;  1YKJ A;  1EBD A;  4JY3 A;  5KRQ A;  2AR8 A;  5U1O A;  3NH3 X;  3P1W A;  3UKH A;  2APG A;  4B67 A;  2X50 A;  4YTM A;  1BF3 A;  1D4D A;  4BJZ A;  2XFQ A;  4BJY A;  5HXI A;  2V5Z A;  2X8G A;  1X31 B;  1H82 A;  2C65 A;  1GEU A;  3KVE A;  5KNL A;  4YT0 A;  4FDC B;  1BGN A;  4G73 A;  3P4S A;  4A79 A;  4B69 A;  2C7G A;  3AWI A;  3DGH A;  3K7Q X;  4YTP A;  1GAL A;  2VZ2 A;  1LPF A;  1XPQ A;  2GAG B;  1NHQ A;  3AE3 A;  2FJA A;  2OAL A;  4Y4L A;  4X4J A;  3FMW A;  4C3Y A;  2BXR A;  1B37 A;  1EL5 A;  1K0I A;  3CNT A;  3SZC A;  4X9M A;  2BC1 A;  2W0H A;  5C2T A;  5GRT A;  1GRE A;  3LZX A;  5C3J A;  2BK4 A;  2OA1 A;  2BRA A;  4GAV A;  2IVD A;  1GTE A;  2BK5 A;  3E1T A;  3HYW A;  3M13 A;  3NIX A;  2BXS A;  1GXF A;  1O5W A;  2XLR A;  1SEZ A;  3B3R A;  2DKI A;  3AE6 A;  5BUK A;  1FEB A;  1GPE A;  4GCM A;  4Z25 A;  3DK8 A;  1NEN A;  5M0Z A;  3T2K A;  2BAB A;  3Q6J A;  3S5W A;  2I0Z A;  3KU9 A;  1TYP A;  3CNS A;  4Z2R A;  5KOX A;  1E1M A;  1DJN A;  2J3N A;  4CBQ A;  4E0V A;  5GSN A;  4EMI A;  2XFU A;  3DK4 A;  3AE4 A;  1GRT A;  1LJ1 A;  3CTY A;  1P2H A;  4Z2U A;  3AEC A;  4Y4N A;  4G6G A;  3UP4 A;  5BVA A;  3BI5 A;  3IHM A;  2XVI A;  2CVJ A;  3ICS A;  2NVK X;  1DOD A;  3GRT A;  2H88 A;  2RGJ A;  3H8L A;  4IV9 A;  3SFE A;  1BZL A;  3QSS A;  1E1K A;  4J31 A;  5U63 A;  3SZF A;  4A9W A;  3KA7 A;  2YR4 A;  4K22 A;  3AE5 A;  3PVC A;  1LV0 A;  5BRT A;  3CN8 A;  3D8X A;  4J2W A;  4H4Y A;  4YSH A;  2IID A;  3SY4 A;  3NNE A;  2YQU A;  1D7Y A;  2ARD A;  3DJG X;  3AED A;  1S2Y A;  3AE1 A;  2C75 A;  3RED A;  2IVE A;  4U8M A;  2ZBW A;  2C3C A;  1DOB A;  1CL0 A;  1JRZ A;  4B68 A;  5JCK A;  4K5S A;  2WDQ A;  3AYL A;  3VRB A;  5KWF A;  3OZ2 A;  4XXG A;  2GRT A;  2R45 A;  3F8P A;  4OPG A;  3SYI A;  3VRA A;  4TM0 A;  3AEA A;  4N9X A;  1CJ4 A;  1N4V A;  2JB1 A;  3G5Q A;  2GR0 A;  5KVH A;  1ELI A;  3NN0 X;  4Z44 A;  2GQF A;  4FX9 A;  4H4R A;  4CY8 A;  2XVH A;  1E1L A;  2WDV A;  1GES A;  5U25 A;  4H4S A;  1PXC A;  1CJ3 A;  4AOX A;  3F8D A;  2R46 A;  3GYI A;  1FL2 A;  3KLJ A;  3C4N A;  3GD4 A;  4H4W A;  3CGD A;  4IA6 A;  1H7W A;  2Q6U A;  2HQM A;  2XVF A;  3NT6 A;  3NYC A;  4UDP A;  1TDK A;  1L0V A;  3CPI G;  1Y0P A;  4PAA A;  3UTG A;  1IUS A;  4BK3 A;  2PYX A;  3VR9 A;  4GDE A;  2JKC A;  4P9S A;  1GSN A;  4OPL A;  4B65 A;  5LV9 A;  3B6D A;  2WU5 A;  2BA9 A;  5KOW A;  4JNA A;  3GSI A;  4CCR A;  3NK2 X;  5BUL A;  3DK9 A;  2YLX A;  1PBF A;  1N4W A;  1CHU A;  1GV4 A;  1K0J A;  1F6M A;  2A8X A;  4U8I A;  1GND A;  5HYM A;  4O5Q A;  2BRY A;  2XCG A;  3NKS A;  4NTC A;  2R4J A;  1YQ4 A;  4UDQ A;  4EQX A;  2B9Y A;  1IUX A;  1GRG A;  4HA6 A;  1NG3 A;  4D04 A;  1OJD A;  4H2N A;  1M64 A;  5FMH A;  1MOK A;  2UZZ A;  4BV6 A;  1EL7 A;  4YSY A;  1GET A; 
#chains in the Genus database with same CATH homology
 1FEA A;  3AD9 B;  3QJ4 A;  4IVO B;  2YM1 A;  4OPD A;  3KPF A;  4CNK A;  3BNM A;  1VDC A;  1QO8 A;  2C3D A;  3ISH A;  1TDE A;  4C74 A;  5J7X A;  2VVL G;  2Y6R A;  3CNP A;  2WBA A;  3QSM A;  1KSS A;  4TM4 A;  5EB4 A;  1COY A;  1JU2 A;  4OPT A;  4RG4 A;  4USR A;  3RNM A;  4USQ A;  2GAH B;  3CPH G;  1XAN A;  1Q9I A;  1XDI A;  3T31 A;  5DBJ A;  1PBC A;  3T2Z A;  4NTE A;  4YTN A;  4EQS A;  3R9U A;  3UKP A;  2VRL A;  1H81 A;  2X99 A;  1EL8 A;  2XVE A;  2Z5Y A;  3GYX A;  2YLT A;  3ICT A;  4UP3 A;  1KFY A;  4EM4 A;  2Y6Q A;  3NLC A;  4EIQ A;  5EBK A;  2H89 A;  1F8W A;  1LVL A;  1Q1W A;  3BI2 A;  1E6E A;  3G5S A;  3NGC X;  3NK0 X;  3QFA A;  4G9K A;  1PJ6 A;  1E7P A;  2BCP A;  3EPT A;  3LJP A;  1O95 A;  4C77 A;  1D5T A;  5KMR A;  1D7L A;  1B8S A;  1DNC A;  2FJD A;  1F8S A;  1PBB A;  2WPC A;  1DOE A;  1JNZ A;  1IUU A;  3DJE A;  2WOV A;  2V61 A;  2YWL A;  3SGL A;  2B9X A;  1NAA A;  2R0G A;  5JCN A;  1H83 A;  4GUV A;  1F3P A;  1BKW A;  2AQJ A;  2R4E A;  2ZZ0 A;  3IHG A;  3P9U A;  4HB9 A;  3UKA A;  1CC2 A;  2B76 A;  1PHH A;  2WOW A;  2CDU A;  1PJ7 A;  2JAE A;  3RP8 A;  3GWF A;  1L9D A;  2WET A;  1QJD A;  3ALJ A;  3QFB A;  3UTE A;  1S2Q A;  3DJJ A;  4AOS A;  3ZYX A;  1FOH A;  4U2L A;  1RP0 A;  4A65 A;  3KD9 A;  2R0C A;  4JDR A;  5KMS A;  3VQR A;  1CBO A;  2FBW A;  3AEE A;  3UOV A;  3EF6 A;  2WPE A;  3HYX A;  2X8C A;  3GWD A;  3PS9 A;  1E1N A;  2DKH A;  4ZCC A;  5KMP A;  1K0L A;  4YKF A;  4AP1 A;  1W4X A;  1PBD A;  1ZY8 A;  3CGC A;  4U8P A;  1OJT A;  1RYI A;  1BWC A;  3K30 A;  4KX6 A;  3LAD A;  3AE2 A;  2V3B A;  5KXJ A;  2A87 A;  3AB1 A;  3UTF A;  1ZOV A;  4J36 A;  3HZL A;  2VVM A;  3AE9 A;  4RSL A;  4B66 A;  1NG4 A;  3S61 A;  1UKV G;  2GF3 A;  1Q1R A;  1YY5 A;  4TM1 A;  2CFY A;  3AD8 B;  2OAM A;  4M52 A;  2YG7 A;  4NEV A;  2QCU A;  2YLS A;  4B63 A;  4NNJ A;  3ABV A;  4C5O A;  2RGO A;  4TM3 A;  1H86 A;  4CY6 A;  4I58 A;  3SZW A;  3NRN A;  4ZCD A;  2BS4 A;  3GMC A;  2GMH A;  3LXD A;  1DJQ A;  4MJW A;  4A6N A;  1E39 A;  2GR2 A;  3AEG A;  4YKG A;  5IQ4 A;  5IQ1 A;  4LA1 A;  2TMD A;  3DH9 A;  3NTA A;  4D03 A;  1S3E A;  3IF9 A;  3KPK A;  2XLT A;  1K4Q A;  2WES A;  1CC4 A;  4EIP A;  2WS3 A;  3ATR A;  2VQ7 A;  4ECH A;  3ADA B;  3PO7 A;  2WHD A;  3ATQ A;  3GDP A;  3LZW A;  4A6N B;  4KPR A;  5IPY A;  2R0P A;  3CMM A;  2C72 A;  4NZH A;  1N1P A;  2YVF A;  4APN A;  2YG6 A;  1TDF A;  2YLR A;  3URH A;  3KKJ A;  2E4G A;  3AE7 A;  4B64 A;  2WDR A;  3NG7 X;  4DSG A;  3DJD A;  1TDN A;  5FS6 A;  2XLS A;  4FK1 A;  3GMB A;  1GRF A;  2XYO A;  3NN6 X;  3BNU A;  1GOS A;  4IVM B;  3AYI A;  2GR1 A;  1F8R A;  3UOY A;  1IUV A;  4J56 A;  3H4K A;  2YVG A;  3UP5 A;  3UTH A;  1GRH A;  3DA1 A;  2WP5 A;  4A7A A;  2RGH A;  5FS9 A;  1HYU A;  4BUR A;  4A5L A;  5KMQ A;  3M0O A;  3UCL A;  4I59 A;  1GER A;  1PJ5 A;  4EMW A;  2ZZC A;  2BYB A;  2TPR A;  1NPX A;  3GDN A;  4II3 A;  3CPJ G;  4Z43 A;  2YVJ A;  4EQR A;  1D4C A;  3H8I A;  4NTD A;  5JCI A;  1MO9 A;  3EAO A;  4GRT A;  5FS8 A;  2C64 A;  4EMJ A;  1PXB A;  2BCG G;  2A89 A;  2QA2 A;  3NHO X;  5CQF A;  4TLX A;  1M6I A;  4U8J A;  2OLO A;  3OC4 A;  4CNJ A;  2GQW A;  2YLZ A;  3SXI A;  1NEK A;  5CKU A;  3I6D A;  1S3B A;  1LQU A;  2GB0 A;  1N4U A;  2CUL A;  5HHF A;  3NK1 X;  3UOX A;  1GTH A;  2B9W A;  4EQW A;  4A99 A;  3I3L A;  5FS7 A;  2Z5X A;  4H4V A;  3RP7 A;  4II2 A;  3AEB A;  2WP6 A;  3CIR A;  2C4C A;  4DNA A;  1ZX9 A;  2GR3 A;  2BS3 A;  1Y56 A;  1JEH A;  1GT8 A;  1B4V A;  4YWO A;  5ER0 A;  1OJC A;  1JOA A;  5EOW A;  3Q9T A;  2OLN A;  3COX A;  3CGB A;  2QAE A;  4ICY A;  2F5Z A;  2YR6 A;  1JNR A;  2X3N A;  1B5Q A;  3P4R A;  2V6O A;  4WCT A;  4AT2 A;  1BGJ A;  3C96 A;  1GRB A;  2XDO A;  3UKQ A;  3CNJ A;  2WP9 A;  1Y56 B;  4G6H A;  4H2R A;  1ZKQ A;  1QLB A;  3VR8 A;  2V3A A;  2VOU A;  2YG4 A;  5L46 A;  2FJE A;  1H6V A;  4J57 A;  3CGE A;  1V59 A;  2NPX A;  4GF7 A;  4Z2T A;  2ACZ A;  2WQY A;  4K2X A;  1ZMC A;  1Z6L A;  2C66 A;  2JK6 A;  2YG3 A;  4U8K A;  4YSX A;  1IUW A;  4TLZ A;  4RG3 A;  4AP3 A;  4X9N A;  1OJA A;  1ZP0 A;  3IC9 A;  4H4P A;  2XVJ A;  4DSH A;  2Q0K A;  1YQZ A;  4OVI A;  2RAB A;  4OPU A;  1PBE A;  2EQ6 A;  4J33 A;  4EM3 A;  3FIM B;  4GDP A;  3V3O A;  3QVP A;  1VQW A;  1OJ9 A;  1ONF A;  2XLU A;  3BI4 A;  2E5V A;  4U2T A;  2YM2 A;  2YR5 A;  3C4A A;  4O5U A;  4OPC A;  2E1M A;  1AOG A;  2XFN A;  3L8K A;  1ZDL A;  1DOC A;  2Q7V A;  3FG2 P;  3NTD A;  2YAU A;  3AXB A;  3O0H A;  3UOZ A;  3VRD B;  4H4Q A;  3SX6 A;  2PHH A;  3T0K A;  1ZOY A;  2VRM A;  2WOI A;  4NWZ A;  4H4Z A;  3T14 A;  3SQP A;  2B7R A;  2YLW A;  4JQ9 A;  4AT0 A;  4YSZ A;  5M10 A;  2WEU A;  1O94 A;  1FCD A;  2XLP A;  3SFD A;  1VRQ B;  1ZK7 A;  4U8N A;  2FJB A;  2GMJ A;  3UKF A;  4OCG A;  2BS2 A;  4CRT A;  3QVR A;  4IA5 A;  2V60 A;  4H4X A;  4H4T A;  1L9C A;  2JB3 A;  4BK2 A;  4C3X A;  1KNR A;  1CC6 A;  2C70 A;  2JBV A;  1GRA A;  4XWZ A;  5J60 A;  3RP6 A;  3P4P A;  4H2P A;  3WE0 A;  3ZDN A;  4BK1 A;  2R9Z A;  4G74 A;  2BC0 A;  1VG9 A;  2GH5 A;  3AEF A;  3K7M X;  2B7S A;  1XHC A;  1NHS A;  3AYJ A;  3RHA A;  3ALM A;  5JCM A;  3K7T A;  4K8D A;  3F8R A;  4YXD A;  2VQB A;  3NYF A;  1PS9 A;  1REO A;  2JB2 A;  3IWA A;  2ZZB A;  4JY2 A;  1FEC A;  3SM8 A;  3II4 A;  4H50 A;  4U2S A;  3NYE A;  5KVI A;  3FBS A;  1CJ2 A;  2XFP A;  2GV8 A;  3D1C A;  2XFO A;  4GR1 A;  1NDA A;  3GD3 A;  1H7X A;  1DXL A;  1TYT A;  1P2E A;  4H7U A;  2VVL A;  2C73 A;  1NHR A;  3LOV A;  4LU6 A;  4DGK A;  1IJH A;  1KSU A;  1PN0 A;  4ZN0 A;  1TRB A;  3ICR A;  1D4E A;  1PDH A;  1H84 A;  1ZMD A;  2GEW A;  2EQ8 A;  3GRS A;  1YQ3 A;  3CND A;  4B1B A;  3QSE A;  2QA1 A;  4H4U A;  1KF6 A;  1TDO A;  4JN9 A;  4Y4M A;  1NHP A;  3AE8 A;  2EQ9 A;  5TR3 A;  1KDG A;  1EL9 A;  4FK1 C;  3FPZ A;  1MXT A;  4NEW A;  2AAQ A;  1IUT A;  1KNP A;  4H2Q A;  4PAB A;  3UKK A;  5HY5 A;  4JNQ A;  3AD7 B;  5EB5 A;  4WX1 A;  1LTX R;  3DGZ A;  4J34 A;  2BK3 A;  1JRX A;  3BHF A;  4ADW A;  5JCL A;  1CJC A;  3HYV A;  4Z24 A;  2EQ7 A;  1LQT A;  4Z26 A;  2WPF A;  1VG0 A;  3UKL A;  1CF3 A;  3M12 A;  4LII A;  3G5R A;  3V3N A;  3SZ0 A;  1JRY A;  3BHK A;  3V76 A;  2Q0L A;  4REK A;  3T37 A;  3T2Y A;  3ITJ A;  3P4Q A;  3L1R A;  2WU2 A;  3GYJ A;  3LB8 A;  2C67 A;  2X8H A;  4U8L A;  4K5R A;  4U8O A;  2BAC A;  4GAP A;  2C76 A;  1L9E A;  4K7Z A;  2O9Z A;  1RSG A;  2YG5 A;  4UDR A;  3ALL A;  3JSK A;  4OPI A;  4XWR A;  2GVC A;  3DME A;  1PXA A;  3EAN A;  4CCQ A;  1YKJ A;  1EBD A;  4JY3 A;  5KRQ A;  2AR8 A;  5U1O A;  3NH3 X;  3P1W A;  3UKH A;  2APG A;  4B67 A;  2X50 A;  4YTM A;  1BF3 A;  1D4D A;  4BJZ A;  2XFQ A;  4BJY A;  5HXI A;  2V5Z A;  2X8G A;  1X31 B;  1H82 A;  2C65 A;  1GEU A;  3KVE A;  5KNL A;  4YT0 A;  4FDC B;  1BGN A;  4G73 A;  3P4S A;  4A79 A;  4B69 A;  2C7G A;  3AWI A;  3DGH A;  3K7Q X;  4YTP A;  1GAL A;  2VZ2 A;  1LPF A;  1XPQ A;  2GAG B;  1NHQ A;  3AE3 A;  2FJA A;  2OAL A;  4Y4L A;  4X4J A;  3FMW A;  4C3Y A;  2BXR A;  1B37 A;  1EL5 A;  1K0I A;  3CNT A;  3SZC A;  4X9M A;  2BC1 A;  2W0H A;  5C2T A;  5GRT A;  1GRE A;  3LZX A;  5C3J A;  2BK4 A;  2OA1 A;  2BRA A;  4GAV A;  2IVD A;  1GTE A;  2BK5 A;  3E1T A;  3HYW A;  3M13 A;  3NIX A;  2BXS A;  1GXF A;  1O5W A;  2XLR A;  1SEZ A;  3B3R A;  2DKI A;  3AE6 A;  5BUK A;  1FEB A;  1GPE A;  4GCM A;  4Z25 A;  3DK8 A;  1NEN A;  5M0Z A;  3T2K A;  2BAB A;  3Q6J A;  3S5W A;  2I0Z A;  3KU9 A;  1TYP A;  3CNS A;  4Z2R A;  5KOX A;  1E1M A;  1DJN A;  2J3N A;  4CBQ A;  4E0V A;  5GSN A;  4EMI A;  2XFU A;  3DK4 A;  3AE4 A;  1GRT A;  1LJ1 A;  3CTY A;  1P2H A;  4Z2U A;  3AEC A;  4Y4N A;  4G6G A;  3UP4 A;  5BVA A;  3BI5 A;  3IHM A;  2XVI A;  2CVJ A;  3ICS A;  2NVK X;  1DOD A;  3GRT A;  2H88 A;  2RGJ A;  3H8L A;  4IV9 A;  3SFE A;  1BZL A;  3QSS A;  1E1K A;  4J31 A;  5U63 A;  3SZF A;  4A9W A;  3KA7 A;  2YR4 A;  4K22 A;  3AE5 A;  3PVC A;  1LV0 A;  5BRT A;  3CN8 A;  3D8X A;  4J2W A;  4H4Y A;  4YSH A;  2IID A;  3SY4 A;  3NNE A;  2YQU A;  1D7Y A;  2ARD A;  3DJG X;  3AED A;  1S2Y A;  3AE1 A;  2C75 A;  3RED A;  2IVE A;  4U8M A;  2ZBW A;  2C3C A;  1DOB A;  1CL0 A;  1JRZ A;  4B68 A;  5JCK A;  4K5S A;  2WDQ A;  3AYL A;  3VRB A;  5KWF A;  3OZ2 A;  4XXG A;  2GRT A;  2R45 A;  3F8P A;  4OPG A;  3SYI A;  3VRA A;  4TM0 A;  3AEA A;  4N9X A;  1CJ4 A;  1N4V A;  2JB1 A;  3G5Q A;  2GR0 A;  5KVH A;  1ELI A;  3NN0 X;  4Z44 A;  2GQF A;  4FX9 A;  4H4R A;  4CY8 A;  2XVH A;  1E1L A;  2WDV A;  1GES A;  5U25 A;  4H4S A;  1PXC A;  1CJ3 A;  4AOX A;  3F8D A;  2R46 A;  3GYI A;  1FL2 A;  3KLJ A;  3C4N A;  3GD4 A;  4H4W A;  3CGD A;  4IA6 A;  1H7W A;  2Q6U A;  2HQM A;  2XVF A;  3NT6 A;  3NYC A;  4UDP A;  1TDK A;  1L0V A;  3CPI G;  1Y0P A;  4PAA A;  3UTG A;  1IUS A;  4BK3 A;  2PYX A;  3VR9 A;  4GDE A;  2JKC A;  4P9S A;  1GSN A;  4OPL A;  4B65 A;  5LV9 A;  3B6D A;  2WU5 A;  2BA9 A;  5KOW A;  4JNA A;  3GSI A;  4CCR A;  3NK2 X;  5BUL A;  3DK9 A;  2YLX A;  1PBF A;  1N4W A;  1CHU A;  1GV4 A;  1K0J A;  1F6M A;  2A8X A;  4U8I A;  1GND A;  5HYM A;  4O5Q A;  2BRY A;  2XCG A;  3NKS A;  4NTC A;  2R4J A;  1YQ4 A;  4UDQ A;  4EQX A;  2B9Y A;  1IUX A;  1GRG A;  4HA6 A;  1NG3 A;  4D04 A;  1OJD A;  4H2N A;  1M64 A;  5FMH A;  1MOK A;  2UZZ A;  4BV6 A;  1EL7 A;  4YSY A;  1GET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...