5BUKA

Structure of flavin-dependent chlorinase mpy16
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
434
Chain Sequence
EPQFDVGIIGGGPAGSTTASYLARAGLKVALFESDNFPREHVGESLVPATTPVLVDIDAFDKVEAAGFPKKFGAAWTSADSGPSDKMGFTGLDHDFRAAEIMFNERTQSGVHKDYTFHVDRGQFDLLLLKHAEEQGAKVHQGVRVNRVNFDGAFPVLETSVAGQRAKVPVKMVVDASGRRTQLGSQLKVKEKDPVFNQYAIHTWFDNFDRKALAVDQSQSDFIFIHFLPVIDTWVWQIPITDTITSVGVVTQKERLDLEKFFWDTLGSRPELHKALKESEQVRPLKTEGDYSYALTKVCGDNFLMVGDAARFVDPIFSSGVSVALNSARIASADIIAAHRAGDYSKKRFDTYESMLRRGVNNWYEFISIYYRLNILFTAFVQDPRYRIDVLKMLQGDVYDDEEPKALAAMREIVKAVEEDPNHLWHPFLGSLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
source organism Streptomyces sp. cnq-418
molecule tags Oxidoreductase
molecule keywords FADH2-dependent halogenase
total genus 155
structure length 434
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bukA00
4N9XA 4OPTA 4ZCDA 2XVIA 4UDPA 1NEKA 2GMJA 2C76A 1LVLA 4K2XA 1NHRA 1O95A 3BI4A 1ZP0A 3RNMA 2DKHA 1CC2A 1TDEA 2YQUA 5U63A 1GV4A 1VDCA 2YLTA 4U8PA 5FS7A 5M0ZA 1KSUA 4A9WA 1Z6LA 2IVEA 1NHPA 2R4EA 2XVEA 3CGBA 3DA1A 1H7XA 2APGA 3K7QX 1N4VA 2C64A 2R0PA 4ZCCA 3AE4A 3L1RA 3ICTA 3NIXA 4B68A 2YG6A 3D8XA 4C3YA 1NAAA 2WS3A 2YAUA 3BHFA 3DJGX 3ICSA 4USQA 2XLRA 3BHKA 4KX6A 3GDPA 1H84A 1XHCA 4H4QA 4A6NB 1N1PA 4BJZA 4H2RA 2VRMA 2V3AA 1L0VA 5FMHA 3UKPA 2XLSA 2BC0A 1E1KA 2XLTA 2GH5A 4AP1A 4EQRA 2Z5XA 3GWFA 1IUSA 4YTNA 1AOGA 3NTAA 1TYTA 1Y56B 3P4PA 3AE2A 1GRAA 4Y4NA 3AD9B 2WP6A 2JAEA 3GMCA 1S2YA 1S3BA 1B37A 4BK3A 1Q1WA 1KNRA 2R45A 3F8PA 3KVEA 3GD3A 3ATRA 4Z2UA 1KDGA 1F8WA 3NKSA 4AOXA 2YR4A 3QVRA 5KOWA 3NGCX 1GREA 4EMWA 3AWIA 2NPXA 3AE6A 3EAOA 2X8GA 2C73A 2R0CA 4JNQA 3SGLA 2FJEA 2IVDA 3BNMA 4GF7A 3IF9A 4RG4A 1VQWA 4J34A 4K22A 2PHHA 3P9UA 4J56A 1M6IA 2W0HA 3CNSA 1IUUA 1P2EA 2VVLG 2Q6UA 1NHQA 2WHDA 4GDPA 5KOXA 4OPCA 1L9DA 4NTCA 3ZYXA 2XYOA 3NLCA 1FECA 3G5RA 3KLJA 2GAGB 3B3RA 4U2LA 4BK2A 1RSGA 3KKJA 5BVAA 1REOA 3G5SA 2XVJA 1ZK7A 2XVHA 4AT2A 3AEBA 3E1TA 3LJPA 2QCUA 3GMBA 4U2TA 4H2QA 4NTDA 1CJ2A 3CNJA 3DK4A 5FS8A 4X9MA 1MOKA 1KF6A 1CC4A 2F5ZA 1O94A 2XFOA 4H7UA 3VR8A 4FX9A 1LPFA 4YTMA 1JRXA 3FMWA 4CNKA 2V6OA 3QFBA 1ZMCA 4TM1A 3LXDA 3ICRA 2WETA 4Y4MA 4B66A 2XFNA 2BK4A 2VQ7A 3LZXA 4YKGA 2WPCA 3DJJA 1H81A 2WEUA 3CNTA 4H4RA 4IA5A 4YTPA 4BURA 1PXCA 1E1MA 4DSGA 3DK8A 3GWDA 1YQ3A 1GOSA 1PDHA 3NG7X 4KPRA 2X99A 2VVMA 2BK3A 4H4PA 3NYEA 1GTHA 3AEAA 1N4WA 1XANA 2V60A 3Q9TA 3UTGA 1GALA 5M10A 4HB9A 3RP7A 4NEWA 1RYIA 4U8JA 4C77A 2YVGA 4FK1A 3VRDB 1H83A 2EQ6A 2R4JA 4ADWA 2YVFA 4HA6A 1CF3A 2YLRA 3CNDA 3QSMA 5HXIA 3NK0X 1GERA 4EIPA 3LADA 3NN6X 4YXDA 3VQRA 2RGOA 1E1LA 3NH3X 3CGCA 3CPJG 3UTHA 3D1CA 3NYCA 3QVPA 1IUXA 1S2QA 1GXFA 4PAAA 3IHGA 4GCMA 4I58A 3HZLA 3LOVA 2C67A 4ECHA 3KU9A 4B67A 1B8SA 4H4YA 1P2HA 2E5VA 3SM8A 2GF3A 1DJNA 2GR0A 4JDRA 1KSSA 1OJCA 4LU6A 1FEBA 5EB5A 2VZ2A 1TDOA 3UKHA 5KXJA 1DJQA 3AEGA 3SQPA 1OJAA 3ALJA 2OA1A 4DNAA 1H86A 3NYFA 1K0LA 3UKLA 1L9CA 3DJEA 1GRTA 4GDEA 2GV8A 1HYUA 1VG9A 2WOIA 4K5SA 3NK2X 4OPDA 3EANA 1QLBA 1OJDA 5CKUA 2C66A 2GVCA 2YLXA 3M13A 5BULA 2CDUA 2JB3A 3CGDA 2C75A 4AT0A 3F8RA 3Q6JA 3UP4A 4Z43A 1OJTA 1ZKQA 3DMEA 4J36A 4U8IA 1EL8A 4X4JA 2VRLA 1GEUA 4Z26A 3C96A 4FDCB 1Q9IA 2GQFA 3IHMA 2XFQA 2B9YA 3FBSA 1EL5A 1BF3A 5U25A 3G5QA 4H2NA 4H4ZA 4H4SA 3AEDA 4CY6A 2XDOA 2TPRA 2OLOA 2WPFA 4H4UA 3ITJA 3UKAA 2I0ZA 2BABA 4JY2A 4JY3A 4CY8A 2BCGG 2CVJA 2BC1A 1QJDA 1BKWA 1PBCA 1PBEA 2WDVA 4O5UA 3EPTA 4UP3A 4UDRA 5EOWA 4A6NA 5JCKA 2YG3A 1JNRA 2B9WA 1Q1RA 4X9NA 2GR1A 4USRA 5IQ4A 4EM3A 3BI2A 3CGEA 1JEHA 2Q0LA 3AD7B 2BXSA 3S61A 4H2PA 2GRTA 4OPLA 1PJ7A 2XLUA 1PHHA 3OZ2A 2Z5YA 2GQWA 1TDFA 1LTXR 4B69A 4CBQA 2GR3A 4ZN0A 2YR6A 5EBKA 2YG7A 2UZZA 4GR1A 4WCTA 4BK1A 5JCIA 3V3OA 4BJYA 2X3NA 2DKIA 1GTEA 2JKCA 1D7LA 2C72A 1PBFA 4U8MA 3OC4A 3CPHG 4TLXA 2C70A 2XLPA 3IWAA 4UDQA 1DODA 2B7SA 4Y4LA 1KNPA 5FS9A 4YSXA 4YT0A 3JSKA 4OPIA 4D03A 4U8NA 2JB2A 2QA2A 2CFYA 3ALLA 2A89A 2PYXA 5C2TA 2JBVA 5JCLA 3NN0X 5IQ1A 1FOHA 2Q0KA 1PS9A 4H4VA 3UCLA 3RP8A 5HY5A 1BGNA 4IV9A 4DSHA 1FL2A 1D4CA 1CJCA 2NVKX 4J33A 3QSEA 1DOBA 5KVHA 4AOSA 2JK6A 3II4A 2AAQA 1UKVG 4XWRA 3REDA 3UKFA 4DGKA 1RP0A 5J60A 2YR5A 3QSSA 2TMDA 1CL0A 1YQZA 3DH9A 2WU2A 1TRBA 1VRQB 2WOWA 3P4RA 3B6DA 1BGJA 1K0IA 2IIDA 1IUTA 2JB1A 1B4VA 4CCRA 1GSNA 3AEFA 3FG2P 3P1WA 3AE7A 4JNAA 3AECA 3RHAA 4B63A 4C3XA 3ABVA 3AE5A 3FPZA 1EL9A 2XCGA 5HHFA 1XDIA 1F8RA 3NT6A 4XXGA 3R9UA 2WPEA 2ZZ0A 4U8LA 1FEAA 4JN9A 1NHSA 3AD8B 4JQ9A 2C3DA 4YWOA 4NZHA 1JRZA 1EL7A 1CC6A 4WX1A 3AE8A 3DGHA 1PJ6A 2YG4A 1BWCA 1N4UA 4CNJA 4NTEA 1GNDA 1YKJA 3K30A 3CIRA 3KPFA 3F8DA 3DK9A 5JCMA 2CULA 3UTEA 1GETA 1MXTA 2XFUA 3AYIA 3T37A 2V61A 2R0GA 1F3PA 4B1BA 1NDAA 2XFPA 1TDKA 2EQ9A 2OAMA 4D04A 3UOVA 4U8KA 4EIQA 5ER0A 3GRSA 4XWZA 3C4AA 4TM4A 1F8SA 1LJ1A 2X50A 1YQ4A 3O0HA 4A65A 4E0VA 1SEZA 2WQYA 1D5TA 1ELIA 1TYPA 5DBJA 1B5QA 1QO8A 1NG4A 2WESA 1GRFA 4EM4A 1PXBA 4J57A 1GRBA 3NTDA 2EQ7A 1ZOYA 2J3NA 3I6DA 2GEWA 3DJDA 3NRNA 3ZDNA 2ACZA 2BS4A 3ADAB 3LZWA 4H4XA 4GUVA 3LB8A 4Z44A 4BV6A 2VQBA 2AR8A 1GRHA 3IC9A 3VR9A 2YG5A 3UKKA 1JU2A 3QFAA 4C74A 1H82A 2V3BA 3H8IA 5BUKA 3EF6A 2YVJA 4ICYA 5KRQA 4EQSA 4EQXA 2H89A 1V59A 3GDNA 1E6EA 4IVOB 4LA1A 4OCGA 1KFYA 3AE3A 3VRAA 1X31B 3CNPA 4AP3A 5L46A 2C3CA 1PJ5A 2E1MA 3SFEA 2B9XA 1NENA 5EB4A 4IA6A 3QJ4A 3GSIA 4RSLA 1K4QA 4A7AA 1IUWA 1K0JA 4EMIA 4Z2TA 3K7TA 1XPQA 4YSYA 3L8KA 3AEEA 3DGZA 1S3EA 3NK1X 2RGHA 2R46A 2YWLA 2YLWA 5GRTA 5TR3A 2Y6RA 4MJWA 3S5WA 4TM0A 4J31A 3URHA 4CRTA 3WE0A 3M12A 5KVIA 3CPIG 4C5OA 1MO9A 2H88A 2O9ZA 4NEVA 3V76A 2WP5A 1ZMDA 2GB0A 3UOZA 4YSZA 1LQTA 2QA1A 3KD9A 2YM1A 3P4SA 2OLNA 2A87A 2Y6QA 4O5QA 1Y0PA 1PN0A 2HQMA 1JNZA 4LIIA 4PABA 4RG3A 2ZZBA 5J7XA 1W4XA 2BS2A 4EQWA 2BXRA 5CQFA 2FJAA 1PBBA 1PBDA 4OVIA 1COYA 2FBWA 1D4EA 3AYJA 4U2SA 2FJDA 3AYLA 3AE1A 2E4GA 2YLZA 3BI5A 2C7GA 4A79A 4Z2RA 1ZX9A 3UTFA 2GMHA 4I59A 2WU5A 2EQ8A 1D4DA 1PXAA 4IVMB 1GPEA 2WDRA 1GT8A 3GD4A 3VRBA 1F6MA 1ONFA 3BNUA 3RP6A 4OPGA 1FCDA 2VVLA 3AE9A 4P9SA 3FIMB 4J2WA 2BS3A 4FK1C 4A5LA 2B7RA 2C65A 1L9EA 5HYMA 4K5RA 4U8OA 4H50A 2XVFA 5GSNA 2YLSA 5BRTA 2BYBA 3KA7A 4OPUA 1GRGA 2X8CA 5U1OA 3PS9A 2BCPA 3UOYA 4CCQA 2V5ZA 1BZLA 1VG0A 3H4KA 1E39A 1OJ9A 4EMJA 4B65A 1ZOVA 1JOAA 5JCNA 2BK5A 2BA9A 4APNA 1LV0A 3CTYA 4GRTA 4TLZA 1GESA 1LQUA 2AQJA 2GAHB 4H4WA 1ZDLA 1IJHA 4K8DA 3GRTA 1JRYA 2Q7VA 3CN8A 4M52A 4YSHA 1DXLA 1YY5A 2YM2A 3AB1A 4TM3A 3UOXA 3K7MX 1IUVA 1E1NA 1E7PA 2QAEA 2RABA 2BACA 1D7YA 3ISHA 1DNCA 5KWFA 1CHUA 2VOUA 5LV9A 4YKFA 2ARDA 1CJ4A 3GYJA 2X8HA 3M0OA 2WP9A 2OALA 2WDQA 2ZZCA 3UP5A 1DOEA 2A8XA 2FJBA 1H7WA 3ATQA 1EBDA 2B76A 3H8LA 4REKA 2ZBWA 4Z25A 4K7ZA 3I3LA 1NG3A 3P4QA 1NPXA 2WBAA 3V3NA 3NNEA 1O5WA 3PVCA 1DOCA 1ZY8A 3COXA 3GYIA 1M64A 4H4TA 5IPYA 3NHOX 4B64A 1H6VA 2R9ZA 2RGJA 3SFDA 5FS6A 3UKQA 1Y56A 3PO7A 3C4NA 2GR2A 3ALMA 1TDNA 4A99A 5C3JA 1CJ3A 4Z24A 1CBOA 3AXBA 2WOVA
chains in the Genus database with same CATH superfamily
4N9XA 4OPTA 4ZCDA 2XVIA 4UDPA 1NEKA 2GMJA 2C76A 1LVLA 4K2XA 1NHRA 1O95A 3BI4A 1ZP0A 3RNMA 3SXIA 3SX6A 2DKHA 1CC2A 1TDEA 2YQUA 5U63A 1GV4A 1VDCA 2YLTA 4U8PA 5FS7A 5M0ZA 1KSUA 4A9WA 1Z6LA 2IVEA 1NHPA 2R4EA 2XVEA 3CGBA 3DA1A 1H7XA 2APGA 3K7QX 1N4VA 2C64A 2R0PA 4ZCCA 5KNLA 3AE4A 3L1RA 3ICTA 3NIXA 4B68A 2YG6A 3D8XA 4C3YA 1NAAA 2WS3A 2YAUA 3BHFA 3DJGX 3ICSA 4USQA 2XLRA 3BHKA 4KX6A 3GDPA 1H84A 1XHCA 4H4QA 4A6NB 1N1PA 4BJZA 4H2RA 2VRMA 5KMQA 2V3AA 1L0VA 5FMHA 3UKPA 2XLSA 2BC0A 1E1KA 2XLTA 2GH5A 4AP1A 4EQRA 2Z5XA 3GWFA 1IUSA 4YTNA 1AOGA 3NTAA 1TYTA 1Y56B 3P4PA 3AE2A 1GRAA 4Y4NA 3AD9B 2WP6A 2JAEA 3GMCA 1S2YA 1S3BA 1B37A 3SZCA 4BK3A 1Q1WA 1KNRA 2R45A 3F8PA 3KVEA 3GD3A 3ATRA 4Z2UA 1KDGA 1F8WA 3NKSA 4AOXA 2YR4A 3QVRA 5KOWA 3NGCX 1GREA 4EMWA 3AWIA 2NPXA 3AE6A 3EAOA 4G74A 2X8GA 2C73A 2R0CA 4JNQA 3SGLA 2FJEA 2IVDA 3BNMA 4GF7A 3IF9A 4RG4A 1VQWA 4J34A 4K22A 2PHHA 3P9UA 4J56A 1M6IA 2W0HA 5KMRA 3CNSA 1IUUA 1P2EA 2VVLG 2Q6UA 1NHQA 2WHDA 4GDPA 5KOXA 4OPCA 1L9DA 4NTCA 3ZYXA 2XYOA 3NLCA 1FECA 3G5RA 3KLJA 2GAGB 3B3RA 4U2LA 4BK2A 1RSGA 3KKJA 5BVAA 1REOA 3G5SA 2XVJA 1ZK7A 2XVHA 4AT2A 3AEBA 3E1TA 3LJPA 2QCUA 3GMBA 4U2TA 4H2QA 4NTDA 1CJ2A 3CNJA 3DK4A 5FS8A 4X9MA 1MOKA 1KF6A 1CC4A 2F5ZA 1O94A 2XFOA 4H7UA 3VR8A 4FX9A 2C4CA 5KMSA 1LPFA 4YTMA 1JRXA 3FMWA 4CNKA 2V6OA 3QFBA 1ZMCA 4TM1A 3LXDA 3ICRA 2WETA 4Y4MA 4B66A 2XFNA 2BK4A 2VQ7A 3LZXA 4YKGA 2WPCA 3DJJA 1H81A 2WEUA 3CNTA 4H4RA 4IA5A 4YTPA 4BURA 1PXCA 1E1MA 4DSGA 3DK8A 3GWDA 1YQ3A 1GOSA 1PDHA 3NG7X 4KPRA 2X99A 2VVMA 2BK3A 4H4PA 3NYEA 1GTHA 3AEAA 1N4WA 1XANA 2V60A 3Q9TA 3UTGA 1GALA 5M10A 4HB9A 3RP7A 4NEWA 1RYIA 4U8JA 4C77A 2YVGA 4FK1A 3VRDB 1H83A 2EQ6A 2R4JA 4ADWA 2YVFA 4HA6A 1CF3A 2YLRA 3CNDA 3QSMA 5HXIA 3NK0X 1GERA 4EIPA 3LADA 3NN6X 4YXDA 3VQRA 2RGOA 1E1LA 3NH3X 3CGCA 3CPJG 3UTHA 3D1CA 3NYCA 3QVPA 1IUXA 1S2QA 1GXFA 4PAAA 3IHGA 4GCMA 4I58A 3HZLA 3LOVA 2C67A 4ECHA 3KU9A 4B67A 1B8SA 4H4YA 1P2HA 2E5VA 3SM8A 2GF3A 1DJNA 2GR0A 4JDRA 1KSSA 1OJCA 4LU6A 1FEBA 5EB5A 2VZ2A 1TDOA 3UKHA 5KXJA 1DJQA 3AEGA 3SQPA 5KMPA 1OJAA 3ALJA 2OA1A 4DNAA 5L46A 1H86A 3NYFA 1K0LA 3UKLA 1L9CA 3DJEA 1GRTA 4GDEA 2GV8A 1HYUA 1VG9A 2WOIA 4K5SA 3NK2X 4OPDA 3EANA 1QLBA 1OJDA 5CKUA 2C66A 2GVCA 2YLXA 3M13A 3T2KA 2CDUA 2JB3A 4Z25A 5BULA 3CGDA 2C75A 4AT0A 3F8RA 3Q6JA 3UP4A 4Z43A 1OJTA 1ZKQA 3DMEA 4J36A 4U8IA 1EL8A 4X4JA 2VRLA 1GEUA 4Z26A 3C96A 4FDCB 1Q9IA 2GQFA 3IHMA 2XFQA 2B9YA 3FBSA 1EL5A 1BF3A 5U25A 3G5QA 4H2NA 4H4ZA 4H4SA 3AEDA 4CY6A 2XDOA 2TPRA 2OLOA 2WPFA 4H4UA 3ITJA 3UKAA 2I0ZA 2BABA 4JY2A 4JY3A 4CY8A 2BCGG 2CVJA 2BC1A 1QJDA 1BKWA 1PBCA 1PBEA 2WDVA 4O5UA 3EPTA 4UP3A 4UDRA 5EOWA 4A6NA 5JCKA 2YG3A 1JNRA 2B9WA 3SZFA 1Q1RA 4X9NA 2GR1A 4USRA 5IQ4A 4EM3A 3BI2A 3CGEA 1JEHA 2Q0LA 3AD7B 2BXSA 3S61A 4H2PA 2GRTA 4OPLA 1PJ7A 2XLUA 2BRYA 1PHHA 3OZ2A 4G6GA 2Z5YA 2GQWA 1TDFA 1LTXR 4B69A 4CBQA 2GR3A 4ZN0A 2YR6A 5EBKA 2YG7A 2UZZA 4GR1A 4WCTA 4BK1A 5JCIA 3V3OA 4BJYA 2X3NA 2DKIA 1GTEA 2JKCA 1D7LA 2C72A 1PBFA 4U8MA 3OC4A 3CPHG 4TLXA 2C70A 2XLPA 3IWAA 4UDQA 1DODA 2B7SA 4Y4LA 1KNPA 5FS9A 4YSXA 4YT0A 3JSKA 4OPIA 4D03A 4U8NA 2JB2A 2QA2A 2CFYA 3ALLA 2A89A 2PYXA 5C2TA 2JBVA 5JCLA 3NN0X 5IQ1A 1FOHA 2Q0KA 1PS9A 4H4VA 3UCLA 3RP8A 5HY5A 1BGNA 4IV9A 4DSHA 1FL2A 1D4CA 1CJCA 2NVKX 4J33A 3QSEA 1DOBA 5KVHA 4AOSA 2JK6A 3II4A 2AAQA 1UKVG 4XWRA 3REDA 3UKFA 4DGKA 1RP0A 5J60A 2YR5A 3QSSA 2TMDA 1CL0A 1YQZA 3DH9A 2WU2A 1TRBA 1VRQB 2WOWA 3HYVA 3P4RA 3B6DA 1BGJA 1K0IA 2IIDA 1IUTA 2JB1A 1B4VA 4CCRA 1GSNA 3AEFA 3FG2P 3P1WA 3AE7A 4JNAA 3AECA 3RHAA 4B63A 4C3XA 3ABVA 3AE5A 3FPZA 3SY4A 1EL9A 2XCGA 5HHFA 1XDIA 1F8RA 3NT6A 4XXGA 3R9UA 2WPEA 2ZZ0A 4U8LA 1FEAA 4JN9A 1NHSA 3AD8B 4JQ9A 2C3DA 4YWOA 4NZHA 1JRZA 1EL7A 1CC6A 4WX1A 3AE8A 3DGHA 1PJ6A 2YG4A 1BWCA 1N4UA 4CNJA 4NTEA 1GNDA 1YKJA 3K30A 3CIRA 3KPFA 3F8DA 3DK9A 5JCMA 3HYXA 2CULA 3UTEA 1GETA 1MXTA 2XFUA 3AYIA 3T37A 3GYXA 2V61A 2R0GA 1F3PA 4B1BA 1NDAA 2XFPA 1TDKA 2EQ9A 2OAMA 3T2YA 4D04A 3UOVA 4U8KA 2BRAA 4EIQA 5ER0A 3GRSA 4XWZA 3C4AA 4TM4A 1F8SA 1LJ1A 2X50A 1YQ4A 3O0HA 4A65A 4E0VA 1SEZA 2WQYA 1D5TA 1ELIA 1TYPA 5DBJA 1B5QA 4II2A 1QO8A 1NG4A 2WESA 1GRFA 4EM4A 1PXBA 4J57A 1GRBA 3SYIA 3NTDA 2EQ7A 1ZOYA 2J3NA 3T14A 3I6DA 2GEWA 3DJDA 3NRNA 3ZDNA 3KPKA 2ACZA 2BS4A 3ADAB 3LZWA 4H4XA 4GUVA 3LB8A 4Z44A 4BV6A 2VQBA 2AR8A 1GRHA 3IC9A 3VR9A 2YG5A 3UKKA 1JU2A 3QFAA 4C74A 1H82A 2V3BA 3H8IA 5BUKA 3EF6A 2YVJA 4ICYA 5KRQA 4EQSA 4EQXA 2H89A 1V59A 3GDNA 1E6EA 4IVOB 4LA1A 4OCGA 1KFYA 3AE3A 3VRAA 1X31B 3CNPA 3T0KA 4AP3A 2C3CA 1PJ5A 2E1MA 3SFEA 2B9XA 1NENA 5EB4A 4IA6A 3QJ4A 3GSIA 4RSLA 1K4QA 4A7AA 1IUWA 1K0JA 4EMIA 4Z2TA 3K7TA 1XPQA 3HYWA 4YSYA 3L8KA 3AEEA 3CMMA 3DGZA 1S3EA 3NK1X 2RGHA 2R46A 2YWLA 2YLWA 5GRTA 5TR3A 2Y6RA 4MJWA 3S5WA 4TM0A 4J31A 3URHA 4CRTA 3WE0A 3M12A 5KVIA 3CPIG 4C5OA 4II3A 4GAVA 1MO9A 2H88A 2O9ZA 4NEVA 3V76A 2WP5A 1ZMDA 2GB0A 3UOZA 4YSZA 1LQTA 2QA1A 3SZWA 3KD9A 2YM1A 3P4SA 2OLNA 2A87A 2Y6QA 4O5QA 1Y0PA 1PN0A 2HQMA 1JNZA 4LIIA 4PABA 4RG3A 2ZZBA 5J7XA 1W4XA 2BS2A 4EQWA 2BXRA 5CQFA 2FJAA 1PBBA 1PBDA 4OVIA 1COYA 2FBWA 1D4EA 3AYJA 4U2SA 2FJDA 3AYLA 4G6HA 3AE1A 2E4GA 2YLZA 3BI5A 2C7GA 4A79A 4Z2RA 1ZX9A 3UTFA 2GMHA 4I59A 2WU5A 2EQ8A 1D4DA 1PXAA 4IVMB 1GPEA 2WDRA 1GT8A 3GD4A 3VRBA 1F6MA 1ONFA 3BNUA 3RP6A 4OPGA 1FCDA 2VVLA 3AE9A 4P9SA 3FIMB 4J2WA 2BS3A 4FK1C 4A5LA 3T2ZA 2B7RA 3SZ0A 2C65A 1L9EA 5HYMA 4K5RA 4U8OA 4H50A 2XVFA 5GSNA 2YLSA 4NNJA 2BYBA 5BRTA 3KA7A 4OPUA 4G73A 1GRGA 2X8CA 5U1OA 3PS9A 2BCPA 3UOYA 4NWZA 4CCQA 2V5ZA 1BZLA 1VG0A 3H4KA 1E39A 1OJ9A 4EMJA 4B65A 1ZOVA 1JOAA 5JCNA 2BK5A 2BA9A 4APNA 1LV0A 3CTYA 4GRTA 4TLZA 1GESA 1LQUA 2AQJA 2GAHB 4H4WA 1ZDLA 1IJHA 4K8DA 3GRTA 1JRYA 2Q7VA 3CN8A 4M52A 4YSHA 1DXLA 1YY5A 2YM2A 3AB1A 4TM3A 3UOXA 3K7MX 1IUVA 1E1NA 1E7PA 2QAEA 2RABA 2BACA 1D7YA 3ISHA 1DNCA 5KWFA 1CHUA 2VOUA 5LV9A 4YKFA 2ARDA 1CJ4A 3GYJA 2X8HA 3M0OA 2WP9A 2OALA 2WDQA 2ZZCA 3UP5A 1DOEA 4GAPA 2A8XA 2FJBA 1H7WA 3ATQA 1EBDA 2B76A 3H8LA 4G9KA 2ZBWA 4REKA 4K7ZA 3I3LA 1NG3A 3P4QA 1NPXA 2WBAA 3V3NA 3NNEA 1O5WA 3PVCA 1DOCA 1ZY8A 3COXA 3GYIA 1M64A 4H4TA 5IPYA 3NHOX 4B64A 1H6VA 2R9ZA 2RGJA 3SFDA 5FS6A 3UKQA 1Y56A 3PO7A 3C4NA 2GR2A 3ALMA 1TDNA 3T31A 4A99A 5C3JA 1CJ3A 4Z24A 1CBOA 3AXBA 2WOVA
chains in the Genus database with same CATH topology
4N9XA 4OPTA 4ZCDA 2XVIA 4UDPA 1NEKA 2GMJA 2C76A 1LVLA 4K2XA 1NHRA 1O95A 3BI4A 1ZP0A 3RNMA 3SXIA 3SX6A 2DKHA 1CC2A 1TDEA 2YQUA 5U63A 1GV4A 1VDCA 2YLTA 4U8PA 5FS7A 5M0ZA 1KSUA 4A9WA 1Z6LA 2IVEA 1NHPA 2R4EA 2XVEA 3CGBA 3DA1A 1H7XA 2APGA 3K7QX 1N4VA 2C64A 2R0PA 4ZCCA 5KNLA 3AE4A 3L1RA 3ICTA 3NIXA 4B68A 2YG6A 3D8XA 4C3YA 1NAAA 2WS3A 2YAUA 3BHFA 3DJGX 3ICSA 4USQA 2XLRA 3BHKA 4KX6A 3GDPA 1H84A 1XHCA 4H4QA 4A6NB 1N1PA 4BJZA 4H2RA 2VRMA 5KMQA 2V3AA 1L0VA 5FMHA 3UKPA 2XLSA 2BC0A 1E1KA 2XLTA 2GH5A 4AP1A 4EQRA 2Z5XA 3GWFA 1IUSA 4YTNA 1AOGA 3NTAA 1TYTA 1Y56B 3P4PA 3AE2A 1GRAA 4Y4NA 3AD9B 2WP6A 2JAEA 3GMCA 1S2YA 1S3BA 1B37A 3SZCA 4BK3A 1Q1WA 1KNRA 2R45A 3F8PA 3KVEA 3GD3A 3ATRA 4Z2UA 1KDGA 1F8WA 3NKSA 4AOXA 2YR4A 3QVRA 5KOWA 3NGCX 1GREA 4EMWA 3AWIA 2NPXA 3AE6A 3EAOA 4G74A 2X8GA 2C73A 2R0CA 4JNQA 3SGLA 2FJEA 2IVDA 3BNMA 4GF7A 3IF9A 4RG4A 1VQWA 4J34A 4K22A 2PHHA 3P9UA 4J56A 1M6IA 2W0HA 5KMRA 3CNSA 1IUUA 1P2EA 2VVLG 2Q6UA 1NHQA 2WHDA 4GDPA 5KOXA 4OPCA 1L9DA 4NTCA 3ZYXA 2XYOA 3NLCA 1FECA 3G5RA 3KLJA 2GAGB 3B3RA 4U2LA 4BK2A 1RSGA 3KKJA 5BVAA 1REOA 3G5SA 2XVJA 1ZK7A 2XVHA 4AT2A 3AEBA 3E1TA 3LJPA 2QCUA 3GMBA 4U2TA 4H2QA 4NTDA 1CJ2A 3CNJA 3DK4A 5FS8A 4X9MA 1MOKA 1KF6A 1CC4A 2F5ZA 1O94A 2XFOA 4H7UA 3VR8A 4FX9A 2C4CA 5KMSA 1LPFA 4YTMA 1JRXA 3FMWA 4CNKA 2V6OA 3QFBA 1ZMCA 4TM1A 3LXDA 3ICRA 2WETA 4Y4MA 4B66A 2XFNA 2BK4A 2VQ7A 3LZXA 4YKGA 2WPCA 3DJJA 1H81A 2WEUA 3CNTA 4H4RA 4IA5A 4YTPA 4BURA 1PXCA 1E1MA 4DSGA 3DK8A 3GWDA 1YQ3A 1GOSA 1PDHA 3NG7X 4KPRA 2X99A 2VVMA 2BK3A 4H4PA 3NYEA 1GTHA 3AEAA 1N4WA 1XANA 2V60A 3Q9TA 3UTGA 1GALA 5M10A 4HB9A 3RP7A 4NEWA 1RYIA 4U8JA 4C77A 2YVGA 4FK1A 3VRDB 1H83A 2EQ6A 2R4JA 4ADWA 2YVFA 4HA6A 1CF3A 2YLRA 3CNDA 3QSMA 5HXIA 3NK0X 1GERA 4EIPA 3LADA 3NN6X 4YXDA 3VQRA 2RGOA 1E1LA 3NH3X 3CGCA 3CPJG 3UTHA 3D1CA 3NYCA 3QVPA 1IUXA 1S2QA 1GXFA 4PAAA 3IHGA 4GCMA 4I58A 3HZLA 3LOVA 2C67A 4ECHA 3KU9A 4B67A 1B8SA 4H4YA 1P2HA 2E5VA 3SM8A 2GF3A 1DJNA 2GR0A 4JDRA 1KSSA 1OJCA 4LU6A 1FEBA 5EB5A 2VZ2A 1TDOA 3UKHA 5KXJA 1DJQA 3AEGA 3SQPA 5KMPA 1OJAA 3ALJA 2OA1A 4DNAA 5L46A 1H86A 3NYFA 1K0LA 3UKLA 1L9CA 3DJEA 1GRTA 4GDEA 2GV8A 1HYUA 1VG9A 2WOIA 4K5SA 3NK2X 4OPDA 3EANA 1QLBA 1OJDA 5CKUA 2C66A 2GVCA 2YLXA 3M13A 3T2KA 2CDUA 2JB3A 4Z25A 5BULA 3CGDA 2C75A 4AT0A 3F8RA 3Q6JA 3UP4A 4Z43A 1OJTA 1ZKQA 3DMEA 4J36A 4U8IA 1EL8A 4X4JA 2VRLA 1GEUA 4Z26A 3C96A 4FDCB 1Q9IA 2GQFA 3IHMA 2XFQA 2B9YA 3FBSA 1EL5A 1BF3A 5U25A 3G5QA 4H2NA 4H4ZA 4H4SA 3AEDA 4CY6A 2XDOA 2TPRA 2OLOA 2WPFA 4H4UA 3ITJA 3UKAA 2I0ZA 2BABA 4JY2A 4JY3A 4CY8A 2BCGG 2CVJA 2BC1A 1QJDA 1BKWA 1PBCA 1PBEA 2WDVA 4O5UA 3EPTA 4UP3A 4UDRA 5EOWA 4A6NA 5JCKA 2YG3A 1JNRA 2B9WA 3SZFA 1Q1RA 4X9NA 2GR1A 4USRA 5IQ4A 4EM3A 3BI2A 3CGEA 1JEHA 2Q0LA 3AD7B 2BXSA 3S61A 4H2PA 2GRTA 4OPLA 1PJ7A 2XLUA 2BRYA 1PHHA 3OZ2A 4G6GA 2Z5YA 2GQWA 1TDFA 1LTXR 4B69A 4CBQA 2GR3A 4ZN0A 2YR6A 5EBKA 2YG7A 2UZZA 4GR1A 4WCTA 4BK1A 5JCIA 3V3OA 4BJYA 2X3NA 2DKIA 1GTEA 2JKCA 1D7LA 2C72A 1PBFA 4U8MA 3OC4A 3CPHG 4TLXA 2C70A 2XLPA 3IWAA 4UDQA 1DODA 2B7SA 4Y4LA 1KNPA 5FS9A 4YSXA 4YT0A 3JSKA 4OPIA 4D03A 4U8NA 2JB2A 2QA2A 2CFYA 3ALLA 2A89A 2PYXA 5C2TA 2JBVA 5JCLA 3NN0X 5IQ1A 1FOHA 2Q0KA 1PS9A 4H4VA 3UCLA 3RP8A 5HY5A 1BGNA 4IV9A 4DSHA 1FL2A 1D4CA 1CJCA 2NVKX 4J33A 3QSEA 1DOBA 5KVHA 4AOSA 2JK6A 3II4A 2AAQA 1UKVG 4XWRA 3REDA 3UKFA 4DGKA 1RP0A 5J60A 2YR5A 3QSSA 2TMDA 1CL0A 1YQZA 3DH9A 2WU2A 1TRBA 1VRQB 2WOWA 3HYVA 3P4RA 3B6DA 1BGJA 1K0IA 2IIDA 1IUTA 2JB1A 1B4VA 4CCRA 1GSNA 3AEFA 3FG2P 3P1WA 3AE7A 4JNAA 3AECA 3RHAA 4B63A 4C3XA 3ABVA 3AE5A 3FPZA 3SY4A 1EL9A 2XCGA 5HHFA 1XDIA 1F8RA 3NT6A 4XXGA 3R9UA 2WPEA 2ZZ0A 4U8LA 1FEAA 4JN9A 1NHSA 3AD8B 4JQ9A 2C3DA 4YWOA 4NZHA 1JRZA 1EL7A 1CC6A 4WX1A 3AE8A 3DGHA 1PJ6A 2YG4A 1BWCA 1N4UA 4CNJA 4NTEA 1GNDA 1YKJA 3K30A 3CIRA 3KPFA 3F8DA 3DK9A 5JCMA 3HYXA 2CULA 3UTEA 1GETA 1MXTA 2XFUA 3AYIA 3T37A 3GYXA 2V61A 2R0GA 1F3PA 4B1BA 1NDAA 2XFPA 1TDKA 2EQ9A 2OAMA 3T2YA 4D04A 3UOVA 4U8KA 2BRAA 4EIQA 5ER0A 3GRSA 4XWZA 3C4AA 4TM4A 1F8SA 1LJ1A 2X50A 1YQ4A 3O0HA 4A65A 4E0VA 1SEZA 2WQYA 1D5TA 1ELIA 1TYPA 5DBJA 1B5QA 4II2A 1QO8A 1NG4A 2WESA 1GRFA 4EM4A 1PXBA 4J57A 1GRBA 3SYIA 3NTDA 2EQ7A 1ZOYA 2J3NA 3T14A 3I6DA 2GEWA 3DJDA 3NRNA 3ZDNA 3KPKA 2ACZA 2BS4A 3ADAB 3LZWA 4H4XA 4GUVA 3LB8A 4Z44A 4BV6A 2VQBA 2AR8A 1GRHA 3IC9A 3VR9A 2YG5A 3UKKA 1JU2A 3QFAA 4C74A 1H82A 2V3BA 3H8IA 5BUKA 3EF6A 2YVJA 4ICYA 5KRQA 4EQSA 4EQXA 2H89A 1V59A 3GDNA 1E6EA 4IVOB 4LA1A 4OCGA 1KFYA 3AE3A 3VRAA 1X31B 3CNPA 3T0KA 4AP3A 2C3CA 1PJ5A 2E1MA 3SFEA 2B9XA 1NENA 5EB4A 4IA6A 3QJ4A 3GSIA 4RSLA 1K4QA 4A7AA 1IUWA 1K0JA 4EMIA 4Z2TA 3K7TA 1XPQA 3HYWA 4YSYA 3L8KA 3AEEA 3CMMA 3DGZA 1S3EA 3NK1X 2RGHA 2R46A 2YWLA 2YLWA 5GRTA 5TR3A 2Y6RA 4MJWA 3S5WA 4TM0A 4J31A 3URHA 4CRTA 3WE0A 3M12A 5KVIA 3CPIG 4C5OA 4II3A 4GAVA 1MO9A 2H88A 2O9ZA 4NEVA 3V76A 2WP5A 1ZMDA 2GB0A 3UOZA 4YSZA 1LQTA 2QA1A 3SZWA 3KD9A 2YM1A 3P4SA 2OLNA 2A87A 2Y6QA 4O5QA 1Y0PA 1PN0A 2HQMA 1JNZA 4LIIA 4PABA 4RG3A 2ZZBA 5J7XA 1W4XA 2BS2A 4EQWA 2BXRA 5CQFA 2FJAA 1PBBA 1PBDA 4OVIA 1COYA 2FBWA 1D4EA 3AYJA 4U2SA 2FJDA 3AYLA 4G6HA 3AE1A 2E4GA 2YLZA 3BI5A 2C7GA 4A79A 4Z2RA 1ZX9A 3UTFA 2GMHA 4I59A 2WU5A 2EQ8A 1D4DA 1PXAA 4IVMB 1GPEA 2WDRA 1GT8A 3GD4A 3VRBA 1F6MA 1ONFA 3BNUA 3RP6A 4OPGA 1FCDA 2VVLA 3AE9A 4P9SA 3FIMB 4J2WA 2BS3A 4FK1C 4A5LA 3T2ZA 2B7RA 3SZ0A 2C65A 1L9EA 5HYMA 4K5RA 4U8OA 4H50A 2XVFA 5GSNA 2YLSA 4NNJA 2BYBA 5BRTA 3KA7A 4OPUA 4G73A 1GRGA 2X8CA 5U1OA 3PS9A 2BCPA 3UOYA 4NWZA 4CCQA 2V5ZA 1BZLA 1VG0A 3H4KA 1E39A 1OJ9A 4EMJA 4B65A 1ZOVA 1JOAA 5JCNA 2BK5A 2BA9A 4APNA 1LV0A 3CTYA 4GRTA 4TLZA 1GESA 1LQUA 2AQJA 2GAHB 4H4WA 1ZDLA 1IJHA 4K8DA 3GRTA 1JRYA 2Q7VA 3CN8A 4M52A 4YSHA 1DXLA 1YY5A 2YM2A 3AB1A 4TM3A 3UOXA 3K7MX 1IUVA 1E1NA 1E7PA 2QAEA 2RABA 2BACA 1D7YA 3ISHA 1DNCA 5KWFA 1CHUA 2VOUA 5LV9A 4YKFA 2ARDA 1CJ4A 3GYJA 2X8HA 3M0OA 2WP9A 2OALA 2WDQA 2ZZCA 3UP5A 1DOEA 4GAPA 2A8XA 2FJBA 1H7WA 3ATQA 1EBDA 2B76A 3H8LA 4G9KA 2ZBWA 4REKA 4K7ZA 3I3LA 1NG3A 3P4QA 1NPXA 2WBAA 3V3NA 3NNEA 1O5WA 3PVCA 1DOCA 1ZY8A 3COXA 3GYIA 1M64A 4H4TA 5IPYA 3NHOX 4B64A 1H6VA 2R9ZA 2RGJA 3SFDA 5FS6A 3UKQA 1Y56A 3PO7A 3C4NA 2GR2A 3ALMA 1TDNA 3T31A 4A99A 5C3JA 1CJ3A 4Z24A 1CBOA 3AXBA 2WOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9X A;  4OPT A;  4ZCD A;  2XVI A;  4UDP A;  1NEK A;  2GMJ A;  2C76 A;  1LVL A;  4K2X A;  1NHR A;  1O95 A;  3BI4 A;  1ZP0 A;  3RNM A;  2DKH A;  1CC2 A;  1TDE A;  2YQU A;  5U63 A;  1GV4 A;  1VDC A;  2YLT A;  4U8P A;  5FS7 A;  5M0Z A;  1KSU A;  4A9W A;  1Z6L A;  2IVE A;  1NHP A;  2R4E A;  2XVE A;  3CGB A;  3DA1 A;  1H7X A;  2APG A;  3K7Q X;  1N4V A;  2C64 A;  2R0P A;  4ZCC A;  3AE4 A;  3L1R A;  3ICT A;  3NIX A;  4B68 A;  2YG6 A;  3D8X A;  4C3Y A;  1NAA A;  2WS3 A;  2YAU A;  3BHF A;  3DJG X;  3ICS A;  4USQ A;  2XLR A;  3BHK A;  4KX6 A;  3GDP A;  1H84 A;  1XHC A;  4H4Q A;  4A6N B;  1N1P A;  4BJZ A;  4H2R A;  2VRM A;  2V3A A;  1L0V A;  5FMH A;  3UKP A;  2XLS A;  2BC0 A;  1E1K A;  2XLT A;  2GH5 A;  4AP1 A;  4EQR A;  2Z5X A;  3GWF A;  1IUS A;  4YTN A;  1AOG A;  3NTA A;  1TYT A;  1Y56 B;  3P4P A;  3AE2 A;  1GRA A;  4Y4N A;  3AD9 B;  2WP6 A;  2JAE A;  3GMC A;  1S2Y A;  1S3B A;  1B37 A;  4BK3 A;  1Q1W A;  1KNR A;  2R45 A;  3F8P A;  3KVE A;  3GD3 A;  3ATR A;  4Z2U A;  1KDG A;  1F8W A;  3NKS A;  4AOX A;  2YR4 A;  3QVR A;  5KOW A;  3NGC X;  1GRE A;  4EMW A;  3AWI A;  2NPX A;  3AE6 A;  3EAO A;  2X8G A;  2C73 A;  2R0C A;  4JNQ A;  3SGL A;  2FJE A;  2IVD A;  3BNM A;  4GF7 A;  3IF9 A;  4RG4 A;  1VQW A;  4J34 A;  4K22 A;  2PHH A;  3P9U A;  4J56 A;  1M6I A;  2W0H A;  3CNS A;  1IUU A;  1P2E A;  2VVL G;  2Q6U A;  1NHQ A;  2WHD A;  4GDP A;  5KOX A;  4OPC A;  1L9D A;  4NTC A;  3ZYX A;  2XYO A;  3NLC A;  1FEC A;  3G5R A;  3KLJ A;  2GAG B;  3B3R A;  4U2L A;  4BK2 A;  1RSG A;  3KKJ A;  5BVA A;  1REO A;  3G5S A;  2XVJ A;  1ZK7 A;  2XVH A;  4AT2 A;  3AEB A;  3E1T A;  3LJP A;  2QCU A;  3GMB A;  4U2T A;  4H2Q A;  4NTD A;  1CJ2 A;  3CNJ A;  3DK4 A;  5FS8 A;  4X9M A;  1MOK A;  1KF6 A;  1CC4 A;  2F5Z A;  1O94 A;  2XFO A;  4H7U A;  3VR8 A;  4FX9 A;  1LPF A;  4YTM A;  1JRX A;  3FMW A;  4CNK A;  2V6O A;  3QFB A;  1ZMC A;  4TM1 A;  3LXD A;  3ICR A;  2WET A;  4Y4M A;  4B66 A;  2XFN A;  2BK4 A;  2VQ7 A;  3LZX A;  4YKG A;  2WPC A;  3DJJ A;  1H81 A;  2WEU A;  3CNT A;  4H4R A;  4IA5 A;  4YTP A;  4BUR A;  1PXC A;  1E1M A;  4DSG A;  3DK8 A;  3GWD A;  1YQ3 A;  1GOS A;  1PDH A;  3NG7 X;  4KPR A;  2X99 A;  2VVM A;  2BK3 A;  4H4P A;  3NYE A;  1GTH A;  3AEA A;  1N4W A;  1XAN A;  2V60 A;  3Q9T A;  3UTG A;  1GAL A;  5M10 A;  4HB9 A;  3RP7 A;  4NEW A;  1RYI A;  4U8J A;  4C77 A;  2YVG A;  4FK1 A;  3VRD B;  1H83 A;  2EQ6 A;  2R4J A;  4ADW A;  2YVF A;  4HA6 A;  1CF3 A;  2YLR A;  3CND A;  3QSM A;  5HXI A;  3NK0 X;  1GER A;  4EIP A;  3LAD A;  3NN6 X;  4YXD A;  3VQR A;  2RGO A;  1E1L A;  3NH3 X;  3CGC A;  3CPJ G;  3UTH A;  3D1C A;  3NYC A;  3QVP A;  1IUX A;  1S2Q A;  1GXF A;  4PAA A;  3IHG A;  4GCM A;  4I58 A;  3HZL A;  3LOV A;  2C67 A;  4ECH A;  3KU9 A;  4B67 A;  1B8S A;  4H4Y A;  1P2H A;  2E5V A;  3SM8 A;  2GF3 A;  1DJN A;  2GR0 A;  4JDR A;  1KSS A;  1OJC A;  4LU6 A;  1FEB A;  5EB5 A;  2VZ2 A;  1TDO A;  3UKH A;  5KXJ A;  1DJQ A;  3AEG A;  3SQP A;  1OJA A;  3ALJ A;  2OA1 A;  4DNA A;  1H86 A;  3NYF A;  1K0L A;  3UKL A;  1L9C A;  3DJE A;  1GRT A;  4GDE A;  2GV8 A;  1HYU A;  1VG9 A;  2WOI A;  4K5S A;  3NK2 X;  4OPD A;  3EAN A;  1QLB A;  1OJD A;  5CKU A;  2C66 A;  2GVC A;  2YLX A;  3M13 A;  5BUL A;  2CDU A;  2JB3 A;  3CGD A;  2C75 A;  4AT0 A;  3F8R A;  3Q6J A;  3UP4 A;  4Z43 A;  1OJT A;  1ZKQ A;  3DME A;  4J36 A;  4U8I A;  1EL8 A;  4X4J A;  2VRL A;  1GEU A;  4Z26 A;  3C96 A;  4FDC B;  1Q9I A;  2GQF A;  3IHM A;  2XFQ A;  2B9Y A;  3FBS A;  1EL5 A;  1BF3 A;  5U25 A;  3G5Q A;  4H2N A;  4H4Z A;  4H4S A;  3AED A;  4CY6 A;  2XDO A;  2TPR A;  2OLO A;  2WPF A;  4H4U A;  3ITJ A;  3UKA A;  2I0Z A;  2BAB A;  4JY2 A;  4JY3 A;  4CY8 A;  2BCG G;  2CVJ A;  2BC1 A;  1QJD A;  1BKW A;  1PBC A;  1PBE A;  2WDV A;  4O5U A;  3EPT A;  4UP3 A;  4UDR A;  5EOW A;  4A6N A;  5JCK A;  2YG3 A;  1JNR A;  2B9W A;  1Q1R A;  4X9N A;  2GR1 A;  4USR A;  5IQ4 A;  4EM3 A;  3BI2 A;  3CGE A;  1JEH A;  2Q0L A;  3AD7 B;  2BXS A;  3S61 A;  4H2P A;  2GRT A;  4OPL A;  1PJ7 A;  2XLU A;  1PHH A;  3OZ2 A;  2Z5Y A;  2GQW A;  1TDF A;  1LTX R;  4B69 A;  4CBQ A;  2GR3 A;  4ZN0 A;  2YR6 A;  5EBK A;  2YG7 A;  2UZZ A;  4GR1 A;  4WCT A;  4BK1 A;  5JCI A;  3V3O A;  4BJY A;  2X3N A;  2DKI A;  1GTE A;  2JKC A;  1D7L A;  2C72 A;  1PBF A;  4U8M A;  3OC4 A;  3CPH G;  4TLX A;  2C70 A;  2XLP A;  3IWA A;  4UDQ A;  1DOD A;  2B7S A;  4Y4L A;  1KNP A;  5FS9 A;  4YSX A;  4YT0 A;  3JSK A;  4OPI A;  4D03 A;  4U8N A;  2JB2 A;  2QA2 A;  2CFY A;  3ALL A;  2A89 A;  2PYX A;  5C2T A;  2JBV A;  5JCL A;  3NN0 X;  5IQ1 A;  1FOH A;  2Q0K A;  1PS9 A;  4H4V A;  3UCL A;  3RP8 A;  5HY5 A;  1BGN A;  4IV9 A;  4DSH A;  1FL2 A;  1D4C A;  1CJC A;  2NVK X;  4J33 A;  3QSE A;  1DOB A;  5KVH A;  4AOS A;  2JK6 A;  3II4 A;  2AAQ A;  1UKV G;  4XWR A;  3RED A;  3UKF A;  4DGK A;  1RP0 A;  5J60 A;  2YR5 A;  3QSS A;  2TMD A;  1CL0 A;  1YQZ A;  3DH9 A;  2WU2 A;  1TRB A;  1VRQ B;  2WOW A;  3P4R A;  3B6D A;  1BGJ A;  1K0I A;  2IID A;  1IUT A;  2JB1 A;  1B4V A;  4CCR A;  1GSN A;  3AEF A;  3FG2 P;  3P1W A;  3AE7 A;  4JNA A;  3AEC A;  3RHA A;  4B63 A;  4C3X A;  3ABV A;  3AE5 A;  3FPZ A;  1EL9 A;  2XCG A;  5HHF A;  1XDI A;  1F8R A;  3NT6 A;  4XXG A;  3R9U A;  2WPE A;  2ZZ0 A;  4U8L A;  1FEA A;  4JN9 A;  1NHS A;  3AD8 B;  4JQ9 A;  2C3D A;  4YWO A;  4NZH A;  1JRZ A;  1EL7 A;  1CC6 A;  4WX1 A;  3AE8 A;  3DGH A;  1PJ6 A;  2YG4 A;  1BWC A;  1N4U A;  4CNJ A;  4NTE A;  1GND A;  1YKJ A;  3K30 A;  3CIR A;  3KPF A;  3F8D A;  3DK9 A;  5JCM A;  2CUL A;  3UTE A;  1GET A;  1MXT A;  2XFU A;  3AYI A;  3T37 A;  2V61 A;  2R0G A;  1F3P A;  4B1B A;  1NDA A;  2XFP A;  1TDK A;  2EQ9 A;  2OAM A;  4D04 A;  3UOV A;  4U8K A;  4EIQ A;  5ER0 A;  3GRS A;  4XWZ A;  3C4A A;  4TM4 A;  1F8S A;  1LJ1 A;  2X50 A;  1YQ4 A;  3O0H A;  4A65 A;  4E0V A;  1SEZ A;  2WQY A;  1D5T A;  1ELI A;  1TYP A;  5DBJ A;  1B5Q A;  1QO8 A;  1NG4 A;  2WES A;  1GRF A;  4EM4 A;  1PXB A;  4J57 A;  1GRB A;  3NTD A;  2EQ7 A;  1ZOY A;  2J3N A;  3I6D A;  2GEW A;  3DJD A;  3NRN A;  3ZDN A;  2ACZ A;  2BS4 A;  3ADA B;  3LZW A;  4H4X A;  4GUV A;  3LB8 A;  4Z44 A;  4BV6 A;  2VQB A;  2AR8 A;  1GRH A;  3IC9 A;  3VR9 A;  2YG5 A;  3UKK A;  1JU2 A;  3QFA A;  4C74 A;  1H82 A;  2V3B A;  3H8I A;  5BUK A;  3EF6 A;  2YVJ A;  4ICY A;  5KRQ A;  4EQS A;  4EQX A;  2H89 A;  1V59 A;  3GDN A;  1E6E A;  4IVO B;  4LA1 A;  4OCG A;  1KFY A;  3AE3 A;  3VRA A;  1X31 B;  3CNP A;  4AP3 A;  5L46 A;  2C3C A;  1PJ5 A;  2E1M A;  3SFE A;  2B9X A;  1NEN A;  5EB4 A;  4IA6 A;  3QJ4 A;  3GSI A;  4RSL A;  1K4Q A;  4A7A A;  1IUW A;  1K0J A;  4EMI A;  4Z2T A;  3K7T A;  1XPQ A;  4YSY A;  3L8K A;  3AEE A;  3DGZ A;  1S3E A;  3NK1 X;  2RGH A;  2R46 A;  2YWL A;  2YLW A;  5GRT A;  5TR3 A;  2Y6R A;  4MJW A;  3S5W A;  4TM0 A;  4J31 A;  3URH A;  4CRT A;  3WE0 A;  3M12 A;  5KVI A;  3CPI G;  4C5O A;  1MO9 A;  2H88 A;  2O9Z A;  4NEV A;  3V76 A;  2WP5 A;  1ZMD A;  2GB0 A;  3UOZ A;  4YSZ A;  1LQT A;  2QA1 A;  3KD9 A;  2YM1 A;  3P4S A;  2OLN A;  2A87 A;  2Y6Q A;  4O5Q A;  1Y0P A;  1PN0 A;  2HQM A;  1JNZ A;  4LII A;  4PAB A;  4RG3 A;  2ZZB A;  5J7X A;  1W4X A;  2BS2 A;  4EQW A;  2BXR A;  5CQF A;  2FJA A;  1PBB A;  1PBD A;  4OVI A;  1COY A;  2FBW A;  1D4E A;  3AYJ A;  4U2S A;  2FJD A;  3AYL A;  3AE1 A;  2E4G A;  2YLZ A;  3BI5 A;  2C7G A;  4A79 A;  4Z2R A;  1ZX9 A;  3UTF A;  2GMH A;  4I59 A;  2WU5 A;  2EQ8 A;  1D4D A;  1PXA A;  4IVM B;  1GPE A;  2WDR A;  1GT8 A;  3GD4 A;  3VRB A;  1F6M A;  1ONF A;  3BNU A;  3RP6 A;  4OPG A;  1FCD A;  2VVL A;  3AE9 A;  4P9S A;  3FIM B;  4J2W A;  2BS3 A;  4FK1 C;  4A5L A;  2B7R A;  2C65 A;  1L9E A;  5HYM A;  4K5R A;  4U8O A;  4H50 A;  2XVF A;  5GSN A;  2YLS A;  5BRT A;  2BYB A;  3KA7 A;  4OPU A;  1GRG A;  2X8C A;  5U1O A;  3PS9 A;  2BCP A;  3UOY A;  4CCQ A;  2V5Z A;  1BZL A;  1VG0 A;  3H4K A;  1E39 A;  1OJ9 A;  4EMJ A;  4B65 A;  1ZOV A;  1JOA A;  5JCN A;  2BK5 A;  2BA9 A;  4APN A;  1LV0 A;  3CTY A;  4GRT A;  4TLZ A;  1GES A;  1LQU A;  2AQJ A;  2GAH B;  4H4W A;  1ZDL A;  1IJH A;  4K8D A;  3GRT A;  1JRY A;  2Q7V A;  3CN8 A;  4M52 A;  4YSH A;  1DXL A;  1YY5 A;  2YM2 A;  3AB1 A;  4TM3 A;  3UOX A;  3K7M X;  1IUV A;  1E1N A;  1E7P A;  2QAE A;  2RAB A;  2BAC A;  1D7Y A;  3ISH A;  1DNC A;  5KWF A;  1CHU A;  2VOU A;  5LV9 A;  4YKF A;  2ARD A;  1CJ4 A;  3GYJ A;  2X8H A;  3M0O A;  2WP9 A;  2OAL A;  2WDQ A;  2ZZC A;  3UP5 A;  1DOE A;  2A8X A;  2FJB A;  1H7W A;  3ATQ A;  1EBD A;  2B76 A;  3H8L A;  4REK A;  2ZBW A;  4Z25 A;  4K7Z A;  3I3L A;  1NG3 A;  3P4Q A;  1NPX A;  2WBA A;  3V3N A;  3NNE A;  1O5W A;  3PVC A;  1DOC A;  1ZY8 A;  3COX A;  3GYI A;  1M64 A;  4H4T A;  5IPY A;  3NHO X;  4B64 A;  1H6V A;  2R9Z A;  2RGJ A;  3SFD A;  5FS6 A;  3UKQ A;  1Y56 A;  3PO7 A;  3C4N A;  2GR2 A;  3ALM A;  1TDN A;  4A99 A;  5C3J A;  1CJ3 A;  4Z24 A;  1CBO A;  3AXB A;  2WOV A; 
#chains in the Genus database with same CATH topology
 4N9X A;  4OPT A;  4ZCD A;  2XVI A;  4UDP A;  1NEK A;  2GMJ A;  2C76 A;  1LVL A;  4K2X A;  1NHR A;  1O95 A;  3BI4 A;  1ZP0 A;  3RNM A;  3SXI A;  3SX6 A;  2DKH A;  1CC2 A;  1TDE A;  2YQU A;  5U63 A;  1GV4 A;  1VDC A;  2YLT A;  4U8P A;  5FS7 A;  5M0Z A;  1KSU A;  4A9W A;  1Z6L A;  2IVE A;  1NHP A;  2R4E A;  2XVE A;  3CGB A;  3DA1 A;  1H7X A;  2APG A;  3K7Q X;  1N4V A;  2C64 A;  2R0P A;  4ZCC A;  5KNL A;  3AE4 A;  3L1R A;  3ICT A;  3NIX A;  4B68 A;  2YG6 A;  3D8X A;  4C3Y A;  1NAA A;  2WS3 A;  2YAU A;  3BHF A;  3DJG X;  3ICS A;  4USQ A;  2XLR A;  3BHK A;  4KX6 A;  3GDP A;  1H84 A;  1XHC A;  4H4Q A;  4A6N B;  1N1P A;  4BJZ A;  4H2R A;  2VRM A;  5KMQ A;  2V3A A;  1L0V A;  5FMH A;  3UKP A;  2XLS A;  2BC0 A;  1E1K A;  2XLT A;  2GH5 A;  4AP1 A;  4EQR A;  2Z5X A;  3GWF A;  1IUS A;  4YTN A;  1AOG A;  3NTA A;  1TYT A;  1Y56 B;  3P4P A;  3AE2 A;  1GRA A;  4Y4N A;  3AD9 B;  2WP6 A;  2JAE A;  3GMC A;  1S2Y A;  1S3B A;  1B37 A;  3SZC A;  4BK3 A;  1Q1W A;  1KNR A;  2R45 A;  3F8P A;  3KVE A;  3GD3 A;  3ATR A;  4Z2U A;  1KDG A;  1F8W A;  3NKS A;  4AOX A;  2YR4 A;  3QVR A;  5KOW A;  3NGC X;  1GRE A;  4EMW A;  3AWI A;  2NPX A;  3AE6 A;  3EAO A;  4G74 A;  2X8G A;  2C73 A;  2R0C A;  4JNQ A;  3SGL A;  2FJE A;  2IVD A;  3BNM A;  4GF7 A;  3IF9 A;  4RG4 A;  1VQW A;  4J34 A;  4K22 A;  2PHH A;  3P9U A;  4J56 A;  1M6I A;  2W0H A;  5KMR A;  3CNS A;  1IUU A;  1P2E A;  2VVL G;  2Q6U A;  1NHQ A;  2WHD A;  4GDP A;  5KOX A;  4OPC A;  1L9D A;  4NTC A;  3ZYX A;  2XYO A;  3NLC A;  1FEC A;  3G5R A;  3KLJ A;  2GAG B;  3B3R A;  4U2L A;  4BK2 A;  1RSG A;  3KKJ A;  5BVA A;  1REO A;  3G5S A;  2XVJ A;  1ZK7 A;  2XVH A;  4AT2 A;  3AEB A;  3E1T A;  3LJP A;  2QCU A;  3GMB A;  4U2T A;  4H2Q A;  4NTD A;  1CJ2 A;  3CNJ A;  3DK4 A;  5FS8 A;  4X9M A;  1MOK A;  1KF6 A;  1CC4 A;  2F5Z A;  1O94 A;  2XFO A;  4H7U A;  3VR8 A;  4FX9 A;  2C4C A;  5KMS A;  1LPF A;  4YTM A;  1JRX A;  3FMW A;  4CNK A;  2V6O A;  3QFB A;  1ZMC A;  4TM1 A;  3LXD A;  3ICR A;  2WET A;  4Y4M A;  4B66 A;  2XFN A;  2BK4 A;  2VQ7 A;  3LZX A;  4YKG A;  2WPC A;  3DJJ A;  1H81 A;  2WEU A;  3CNT A;  4H4R A;  4IA5 A;  4YTP A;  4BUR A;  1PXC A;  1E1M A;  4DSG A;  3DK8 A;  3GWD A;  1YQ3 A;  1GOS A;  1PDH A;  3NG7 X;  4KPR A;  2X99 A;  2VVM A;  2BK3 A;  4H4P A;  3NYE A;  1GTH A;  3AEA A;  1N4W A;  1XAN A;  2V60 A;  3Q9T A;  3UTG A;  1GAL A;  5M10 A;  4HB9 A;  3RP7 A;  4NEW A;  1RYI A;  4U8J A;  4C77 A;  2YVG A;  4FK1 A;  3VRD B;  1H83 A;  2EQ6 A;  2R4J A;  4ADW A;  2YVF A;  4HA6 A;  1CF3 A;  2YLR A;  3CND A;  3QSM A;  5HXI A;  3NK0 X;  1GER A;  4EIP A;  3LAD A;  3NN6 X;  4YXD A;  3VQR A;  2RGO A;  1E1L A;  3NH3 X;  3CGC A;  3CPJ G;  3UTH A;  3D1C A;  3NYC A;  3QVP A;  1IUX A;  1S2Q A;  1GXF A;  4PAA A;  3IHG A;  4GCM A;  4I58 A;  3HZL A;  3LOV A;  2C67 A;  4ECH A;  3KU9 A;  4B67 A;  1B8S A;  4H4Y A;  1P2H A;  2E5V A;  3SM8 A;  2GF3 A;  1DJN A;  2GR0 A;  4JDR A;  1KSS A;  1OJC A;  4LU6 A;  1FEB A;  5EB5 A;  2VZ2 A;  1TDO A;  3UKH A;  5KXJ A;  1DJQ A;  3AEG A;  3SQP A;  5KMP A;  1OJA A;  3ALJ A;  2OA1 A;  4DNA A;  5L46 A;  1H86 A;  3NYF A;  1K0L A;  3UKL A;  1L9C A;  3DJE A;  1GRT A;  4GDE A;  2GV8 A;  1HYU A;  1VG9 A;  2WOI A;  4K5S A;  3NK2 X;  4OPD A;  3EAN A;  1QLB A;  1OJD A;  5CKU A;  2C66 A;  2GVC A;  2YLX A;  3M13 A;  3T2K A;  2CDU A;  2JB3 A;  4Z25 A;  5BUL A;  3CGD A;  2C75 A;  4AT0 A;  3F8R A;  3Q6J A;  3UP4 A;  4Z43 A;  1OJT A;  1ZKQ A;  3DME A;  4J36 A;  4U8I A;  1EL8 A;  4X4J A;  2VRL A;  1GEU A;  4Z26 A;  3C96 A;  4FDC B;  1Q9I A;  2GQF A;  3IHM A;  2XFQ A;  2B9Y A;  3FBS A;  1EL5 A;  1BF3 A;  5U25 A;  3G5Q A;  4H2N A;  4H4Z A;  4H4S A;  3AED A;  4CY6 A;  2XDO A;  2TPR A;  2OLO A;  2WPF A;  4H4U A;  3ITJ A;  3UKA A;  2I0Z A;  2BAB A;  4JY2 A;  4JY3 A;  4CY8 A;  2BCG G;  2CVJ A;  2BC1 A;  1QJD A;  1BKW A;  1PBC A;  1PBE A;  2WDV A;  4O5U A;  3EPT A;  4UP3 A;  4UDR A;  5EOW A;  4A6N A;  5JCK A;  2YG3 A;  1JNR A;  2B9W A;  3SZF A;  1Q1R A;  4X9N A;  2GR1 A;  4USR A;  5IQ4 A;  4EM3 A;  3BI2 A;  3CGE A;  1JEH A;  2Q0L A;  3AD7 B;  2BXS A;  3S61 A;  4H2P A;  2GRT A;  4OPL A;  1PJ7 A;  2XLU A;  2BRY A;  1PHH A;  3OZ2 A;  4G6G A;  2Z5Y A;  2GQW A;  1TDF A;  1LTX R;  4B69 A;  4CBQ A;  2GR3 A;  4ZN0 A;  2YR6 A;  5EBK A;  2YG7 A;  2UZZ A;  4GR1 A;  4WCT A;  4BK1 A;  5JCI A;  3V3O A;  4BJY A;  2X3N A;  2DKI A;  1GTE A;  2JKC A;  1D7L A;  2C72 A;  1PBF A;  4U8M A;  3OC4 A;  3CPH G;  4TLX A;  2C70 A;  2XLP A;  3IWA A;  4UDQ A;  1DOD A;  2B7S A;  4Y4L A;  1KNP A;  5FS9 A;  4YSX A;  4YT0 A;  3JSK A;  4OPI A;  4D03 A;  4U8N A;  2JB2 A;  2QA2 A;  2CFY A;  3ALL A;  2A89 A;  2PYX A;  5C2T A;  2JBV A;  5JCL A;  3NN0 X;  5IQ1 A;  1FOH A;  2Q0K A;  1PS9 A;  4H4V A;  3UCL A;  3RP8 A;  5HY5 A;  1BGN A;  4IV9 A;  4DSH A;  1FL2 A;  1D4C A;  1CJC A;  2NVK X;  4J33 A;  3QSE A;  1DOB A;  5KVH A;  4AOS A;  2JK6 A;  3II4 A;  2AAQ A;  1UKV G;  4XWR A;  3RED A;  3UKF A;  4DGK A;  1RP0 A;  5J60 A;  2YR5 A;  3QSS A;  2TMD A;  1CL0 A;  1YQZ A;  3DH9 A;  2WU2 A;  1TRB A;  1VRQ B;  2WOW A;  3HYV A;  3P4R A;  3B6D A;  1BGJ A;  1K0I A;  2IID A;  1IUT A;  2JB1 A;  1B4V A;  4CCR A;  1GSN A;  3AEF A;  3FG2 P;  3P1W A;  3AE7 A;  4JNA A;  3AEC A;  3RHA A;  4B63 A;  4C3X A;  3ABV A;  3AE5 A;  3FPZ A;  3SY4 A;  1EL9 A;  2XCG A;  5HHF A;  1XDI A;  1F8R A;  3NT6 A;  4XXG A;  3R9U A;  2WPE A;  2ZZ0 A;  4U8L A;  1FEA A;  4JN9 A;  1NHS A;  3AD8 B;  4JQ9 A;  2C3D A;  4YWO A;  4NZH A;  1JRZ A;  1EL7 A;  1CC6 A;  4WX1 A;  3AE8 A;  3DGH A;  1PJ6 A;  2YG4 A;  1BWC A;  1N4U A;  4CNJ A;  4NTE A;  1GND A;  1YKJ A;  3K30 A;  3CIR A;  3KPF A;  3F8D A;  3DK9 A;  5JCM A;  3HYX A;  2CUL A;  3UTE A;  1GET A;  1MXT A;  2XFU A;  3AYI A;  3T37 A;  3GYX A;  2V61 A;  2R0G A;  1F3P A;  4B1B A;  1NDA A;  2XFP A;  1TDK A;  2EQ9 A;  2OAM A;  3T2Y A;  4D04 A;  3UOV A;  4U8K A;  2BRA A;  4EIQ A;  5ER0 A;  3GRS A;  4XWZ A;  3C4A A;  4TM4 A;  1F8S A;  1LJ1 A;  2X50 A;  1YQ4 A;  3O0H A;  4A65 A;  4E0V A;  1SEZ A;  2WQY A;  1D5T A;  1ELI A;  1TYP A;  5DBJ A;  1B5Q A;  4II2 A;  1QO8 A;  1NG4 A;  2WES A;  1GRF A;  4EM4 A;  1PXB A;  4J57 A;  1GRB A;  3SYI A;  3NTD A;  2EQ7 A;  1ZOY A;  2J3N A;  3T14 A;  3I6D A;  2GEW A;  3DJD A;  3NRN A;  3ZDN A;  3KPK A;  2ACZ A;  2BS4 A;  3ADA B;  3LZW A;  4H4X A;  4GUV A;  3LB8 A;  4Z44 A;  4BV6 A;  2VQB A;  2AR8 A;  1GRH A;  3IC9 A;  3VR9 A;  2YG5 A;  3UKK A;  1JU2 A;  3QFA A;  4C74 A;  1H82 A;  2V3B A;  3H8I A;  5BUK A;  3EF6 A;  2YVJ A;  4ICY A;  5KRQ A;  4EQS A;  4EQX A;  2H89 A;  1V59 A;  3GDN A;  1E6E A;  4IVO B;  4LA1 A;  4OCG A;  1KFY A;  3AE3 A;  3VRA A;  1X31 B;  3CNP A;  3T0K A;  4AP3 A;  2C3C A;  1PJ5 A;  2E1M A;  3SFE A;  2B9X A;  1NEN A;  5EB4 A;  4IA6 A;  3QJ4 A;  3GSI A;  4RSL A;  1K4Q A;  4A7A A;  1IUW A;  1K0J A;  4EMI A;  4Z2T A;  3K7T A;  1XPQ A;  3HYW A;  4YSY A;  3L8K A;  3AEE A;  3CMM A;  3DGZ A;  1S3E A;  3NK1 X;  2RGH A;  2R46 A;  2YWL A;  2YLW A;  5GRT A;  5TR3 A;  2Y6R A;  4MJW A;  3S5W A;  4TM0 A;  4J31 A;  3URH A;  4CRT A;  3WE0 A;  3M12 A;  5KVI A;  3CPI G;  4C5O A;  4II3 A;  4GAV A;  1MO9 A;  2H88 A;  2O9Z A;  4NEV A;  3V76 A;  2WP5 A;  1ZMD A;  2GB0 A;  3UOZ A;  4YSZ A;  1LQT A;  2QA1 A;  3SZW A;  3KD9 A;  2YM1 A;  3P4S A;  2OLN A;  2A87 A;  2Y6Q A;  4O5Q A;  1Y0P A;  1PN0 A;  2HQM A;  1JNZ A;  4LII A;  4PAB A;  4RG3 A;  2ZZB A;  5J7X A;  1W4X A;  2BS2 A;  4EQW A;  2BXR A;  5CQF A;  2FJA A;  1PBB A;  1PBD A;  4OVI A;  1COY A;  2FBW A;  1D4E A;  3AYJ A;  4U2S A;  2FJD A;  3AYL A;  4G6H A;  3AE1 A;  2E4G A;  2YLZ A;  3BI5 A;  2C7G A;  4A79 A;  4Z2R A;  1ZX9 A;  3UTF A;  2GMH A;  4I59 A;  2WU5 A;  2EQ8 A;  1D4D A;  1PXA A;  4IVM B;  1GPE A;  2WDR A;  1GT8 A;  3GD4 A;  3VRB A;  1F6M A;  1ONF A;  3BNU A;  3RP6 A;  4OPG A;  1FCD A;  2VVL A;  3AE9 A;  4P9S A;  3FIM B;  4J2W A;  2BS3 A;  4FK1 C;  4A5L A;  3T2Z A;  2B7R A;  3SZ0 A;  2C65 A;  1L9E A;  5HYM A;  4K5R A;  4U8O A;  4H50 A;  2XVF A;  5GSN A;  2YLS A;  4NNJ A;  2BYB A;  5BRT A;  3KA7 A;  4OPU A;  4G73 A;  1GRG A;  2X8C A;  5U1O A;  3PS9 A;  2BCP A;  3UOY A;  4NWZ A;  4CCQ A;  2V5Z A;  1BZL A;  1VG0 A;  3H4K A;  1E39 A;  1OJ9 A;  4EMJ A;  4B65 A;  1ZOV A;  1JOA A;  5JCN A;  2BK5 A;  2BA9 A;  4APN A;  1LV0 A;  3CTY A;  4GRT A;  4TLZ A;  1GES A;  1LQU A;  2AQJ A;  2GAH B;  4H4W A;  1ZDL A;  1IJH A;  4K8D A;  3GRT A;  1JRY A;  2Q7V A;  3CN8 A;  4M52 A;  4YSH A;  1DXL A;  1YY5 A;  2YM2 A;  3AB1 A;  4TM3 A;  3UOX A;  3K7M X;  1IUV A;  1E1N A;  1E7P A;  2QAE A;  2RAB A;  2BAC A;  1D7Y A;  3ISH A;  1DNC A;  5KWF A;  1CHU A;  2VOU A;  5LV9 A;  4YKF A;  2ARD A;  1CJ4 A;  3GYJ A;  2X8H A;  3M0O A;  2WP9 A;  2OAL A;  2WDQ A;  2ZZC A;  3UP5 A;  1DOE A;  4GAP A;  2A8X A;  2FJB A;  1H7W A;  3ATQ A;  1EBD A;  2B76 A;  3H8L A;  4G9K A;  2ZBW A;  4REK A;  4K7Z A;  3I3L A;  1NG3 A;  3P4Q A;  1NPX A;  2WBA A;  3V3N A;  3NNE A;  1O5W A;  3PVC A;  1DOC A;  1ZY8 A;  3COX A;  3GYI A;  1M64 A;  4H4T A;  5IPY A;  3NHO X;  4B64 A;  1H6V A;  2R9Z A;  2RGJ A;  3SFD A;  5FS6 A;  3UKQ A;  1Y56 A;  3PO7 A;  3C4N A;  2GR2 A;  3ALM A;  1TDN A;  3T31 A;  4A99 A;  5C3J A;  1CJ3 A;  4Z24 A;  1CBO A;  3AXB A;  2WOV A; 
#chains in the Genus database with same CATH homology
 4N9X A;  4OPT A;  4ZCD A;  2XVI A;  4UDP A;  1NEK A;  2GMJ A;  2C76 A;  1LVL A;  4K2X A;  1NHR A;  1O95 A;  3BI4 A;  1ZP0 A;  3RNM A;  3SXI A;  3SX6 A;  2DKH A;  1CC2 A;  1TDE A;  2YQU A;  5U63 A;  1GV4 A;  1VDC A;  2YLT A;  4U8P A;  5FS7 A;  5M0Z A;  1KSU A;  4A9W A;  1Z6L A;  2IVE A;  1NHP A;  2R4E A;  2XVE A;  3CGB A;  3DA1 A;  1H7X A;  2APG A;  3K7Q X;  1N4V A;  2C64 A;  2R0P A;  4ZCC A;  5KNL A;  3AE4 A;  3L1R A;  3ICT A;  3NIX A;  4B68 A;  2YG6 A;  3D8X A;  4C3Y A;  1NAA A;  2WS3 A;  2YAU A;  3BHF A;  3DJG X;  3ICS A;  4USQ A;  2XLR A;  3BHK A;  4KX6 A;  3GDP A;  1H84 A;  1XHC A;  4H4Q A;  4A6N B;  1N1P A;  4BJZ A;  4H2R A;  2VRM A;  5KMQ A;  2V3A A;  1L0V A;  5FMH A;  3UKP A;  2XLS A;  2BC0 A;  1E1K A;  2XLT A;  2GH5 A;  4AP1 A;  4EQR A;  2Z5X A;  3GWF A;  1IUS A;  4YTN A;  1AOG A;  3NTA A;  1TYT A;  1Y56 B;  3P4P A;  3AE2 A;  1GRA A;  4Y4N A;  3AD9 B;  2WP6 A;  2JAE A;  3GMC A;  1S2Y A;  1S3B A;  1B37 A;  3SZC A;  4BK3 A;  1Q1W A;  1KNR A;  2R45 A;  3F8P A;  3KVE A;  3GD3 A;  3ATR A;  4Z2U A;  1KDG A;  1F8W A;  3NKS A;  4AOX A;  2YR4 A;  3QVR A;  5KOW A;  3NGC X;  1GRE A;  4EMW A;  3AWI A;  2NPX A;  3AE6 A;  3EAO A;  4G74 A;  2X8G A;  2C73 A;  2R0C A;  4JNQ A;  3SGL A;  2FJE A;  2IVD A;  3BNM A;  4GF7 A;  3IF9 A;  4RG4 A;  1VQW A;  4J34 A;  4K22 A;  2PHH A;  3P9U A;  4J56 A;  1M6I A;  2W0H A;  5KMR A;  3CNS A;  1IUU A;  1P2E A;  2VVL G;  2Q6U A;  1NHQ A;  2WHD A;  4GDP A;  5KOX A;  4OPC A;  1L9D A;  4NTC A;  3ZYX A;  2XYO A;  3NLC A;  1FEC A;  3G5R A;  3KLJ A;  2GAG B;  3B3R A;  4U2L A;  4BK2 A;  1RSG A;  3KKJ A;  5BVA A;  1REO A;  3G5S A;  2XVJ A;  1ZK7 A;  2XVH A;  4AT2 A;  3AEB A;  3E1T A;  3LJP A;  2QCU A;  3GMB A;  4U2T A;  4H2Q A;  4NTD A;  1CJ2 A;  3CNJ A;  3DK4 A;  5FS8 A;  4X9M A;  1MOK A;  1KF6 A;  1CC4 A;  2F5Z A;  1O94 A;  2XFO A;  4H7U A;  3VR8 A;  4FX9 A;  2C4C A;  5KMS A;  1LPF A;  4YTM A;  1JRX A;  3FMW A;  4CNK A;  2V6O A;  3QFB A;  1ZMC A;  4TM1 A;  3LXD A;  3ICR A;  2WET A;  4Y4M A;  4B66 A;  2XFN A;  2BK4 A;  2VQ7 A;  3LZX A;  4YKG A;  2WPC A;  3DJJ A;  1H81 A;  2WEU A;  3CNT A;  4H4R A;  4IA5 A;  4YTP A;  4BUR A;  1PXC A;  1E1M A;  4DSG A;  3DK8 A;  3GWD A;  1YQ3 A;  1GOS A;  1PDH A;  3NG7 X;  4KPR A;  2X99 A;  2VVM A;  2BK3 A;  4H4P A;  3NYE A;  1GTH A;  3AEA A;  1N4W A;  1XAN A;  2V60 A;  3Q9T A;  3UTG A;  1GAL A;  5M10 A;  4HB9 A;  3RP7 A;  4NEW A;  1RYI A;  4U8J A;  4C77 A;  2YVG A;  4FK1 A;  3VRD B;  1H83 A;  2EQ6 A;  2R4J A;  4ADW A;  2YVF A;  4HA6 A;  1CF3 A;  2YLR A;  3CND A;  3QSM A;  5HXI A;  3NK0 X;  1GER A;  4EIP A;  3LAD A;  3NN6 X;  4YXD A;  3VQR A;  2RGO A;  1E1L A;  3NH3 X;  3CGC A;  3CPJ G;  3UTH A;  3D1C A;  3NYC A;  3QVP A;  1IUX A;  1S2Q A;  1GXF A;  4PAA A;  3IHG A;  4GCM A;  4I58 A;  3HZL A;  3LOV A;  2C67 A;  4ECH A;  3KU9 A;  4B67 A;  1B8S A;  4H4Y A;  1P2H A;  2E5V A;  3SM8 A;  2GF3 A;  1DJN A;  2GR0 A;  4JDR A;  1KSS A;  1OJC A;  4LU6 A;  1FEB A;  5EB5 A;  2VZ2 A;  1TDO A;  3UKH A;  5KXJ A;  1DJQ A;  3AEG A;  3SQP A;  5KMP A;  1OJA A;  3ALJ A;  2OA1 A;  4DNA A;  5L46 A;  1H86 A;  3NYF A;  1K0L A;  3UKL A;  1L9C A;  3DJE A;  1GRT A;  4GDE A;  2GV8 A;  1HYU A;  1VG9 A;  2WOI A;  4K5S A;  3NK2 X;  4OPD A;  3EAN A;  1QLB A;  1OJD A;  5CKU A;  2C66 A;  2GVC A;  2YLX A;  3M13 A;  3T2K A;  2CDU A;  2JB3 A;  4Z25 A;  5BUL A;  3CGD A;  2C75 A;  4AT0 A;  3F8R A;  3Q6J A;  3UP4 A;  4Z43 A;  1OJT A;  1ZKQ A;  3DME A;  4J36 A;  4U8I A;  1EL8 A;  4X4J A;  2VRL A;  1GEU A;  4Z26 A;  3C96 A;  4FDC B;  1Q9I A;  2GQF A;  3IHM A;  2XFQ A;  2B9Y A;  3FBS A;  1EL5 A;  1BF3 A;  5U25 A;  3G5Q A;  4H2N A;  4H4Z A;  4H4S A;  3AED A;  4CY6 A;  2XDO A;  2TPR A;  2OLO A;  2WPF A;  4H4U A;  3ITJ A;  3UKA A;  2I0Z A;  2BAB A;  4JY2 A;  4JY3 A;  4CY8 A;  2BCG G;  2CVJ A;  2BC1 A;  1QJD A;  1BKW A;  1PBC A;  1PBE A;  2WDV A;  4O5U A;  3EPT A;  4UP3 A;  4UDR A;  5EOW A;  4A6N A;  5JCK A;  2YG3 A;  1JNR A;  2B9W A;  3SZF A;  1Q1R A;  4X9N A;  2GR1 A;  4USR A;  5IQ4 A;  4EM3 A;  3BI2 A;  3CGE A;  1JEH A;  2Q0L A;  3AD7 B;  2BXS A;  3S61 A;  4H2P A;  2GRT A;  4OPL A;  1PJ7 A;  2XLU A;  2BRY A;  1PHH A;  3OZ2 A;  4G6G A;  2Z5Y A;  2GQW A;  1TDF A;  1LTX R;  4B69 A;  4CBQ A;  2GR3 A;  4ZN0 A;  2YR6 A;  5EBK A;  2YG7 A;  2UZZ A;  4GR1 A;  4WCT A;  4BK1 A;  5JCI A;  3V3O A;  4BJY A;  2X3N A;  2DKI A;  1GTE A;  2JKC A;  1D7L A;  2C72 A;  1PBF A;  4U8M A;  3OC4 A;  3CPH G;  4TLX A;  2C70 A;  2XLP A;  3IWA A;  4UDQ A;  1DOD A;  2B7S A;  4Y4L A;  1KNP A;  5FS9 A;  4YSX A;  4YT0 A;  3JSK A;  4OPI A;  4D03 A;  4U8N A;  2JB2 A;  2QA2 A;  2CFY A;  3ALL A;  2A89 A;  2PYX A;  5C2T A;  2JBV A;  5JCL A;  3NN0 X;  5IQ1 A;  1FOH A;  2Q0K A;  1PS9 A;  4H4V A;  3UCL A;  3RP8 A;  5HY5 A;  1BGN A;  4IV9 A;  4DSH A;  1FL2 A;  1D4C A;  1CJC A;  2NVK X;  4J33 A;  3QSE A;  1DOB A;  5KVH A;  4AOS A;  2JK6 A;  3II4 A;  2AAQ A;  1UKV G;  4XWR A;  3RED A;  3UKF A;  4DGK A;  1RP0 A;  5J60 A;  2YR5 A;  3QSS A;  2TMD A;  1CL0 A;  1YQZ A;  3DH9 A;  2WU2 A;  1TRB A;  1VRQ B;  2WOW A;  3HYV A;  3P4R A;  3B6D A;  1BGJ A;  1K0I A;  2IID A;  1IUT A;  2JB1 A;  1B4V A;  4CCR A;  1GSN A;  3AEF A;  3FG2 P;  3P1W A;  3AE7 A;  4JNA A;  3AEC A;  3RHA A;  4B63 A;  4C3X A;  3ABV A;  3AE5 A;  3FPZ A;  3SY4 A;  1EL9 A;  2XCG A;  5HHF A;  1XDI A;  1F8R A;  3NT6 A;  4XXG A;  3R9U A;  2WPE A;  2ZZ0 A;  4U8L A;  1FEA A;  4JN9 A;  1NHS A;  3AD8 B;  4JQ9 A;  2C3D A;  4YWO A;  4NZH A;  1JRZ A;  1EL7 A;  1CC6 A;  4WX1 A;  3AE8 A;  3DGH A;  1PJ6 A;  2YG4 A;  1BWC A;  1N4U A;  4CNJ A;  4NTE A;  1GND A;  1YKJ A;  3K30 A;  3CIR A;  3KPF A;  3F8D A;  3DK9 A;  5JCM A;  3HYX A;  2CUL A;  3UTE A;  1GET A;  1MXT A;  2XFU A;  3AYI A;  3T37 A;  3GYX A;  2V61 A;  2R0G A;  1F3P A;  4B1B A;  1NDA A;  2XFP A;  1TDK A;  2EQ9 A;  2OAM A;  3T2Y A;  4D04 A;  3UOV A;  4U8K A;  2BRA A;  4EIQ A;  5ER0 A;  3GRS A;  4XWZ A;  3C4A A;  4TM4 A;  1F8S A;  1LJ1 A;  2X50 A;  1YQ4 A;  3O0H A;  4A65 A;  4E0V A;  1SEZ A;  2WQY A;  1D5T A;  1ELI A;  1TYP A;  5DBJ A;  1B5Q A;  4II2 A;  1QO8 A;  1NG4 A;  2WES A;  1GRF A;  4EM4 A;  1PXB A;  4J57 A;  1GRB A;  3SYI A;  3NTD A;  2EQ7 A;  1ZOY A;  2J3N A;  3T14 A;  3I6D A;  2GEW A;  3DJD A;  3NRN A;  3ZDN A;  3KPK A;  2ACZ A;  2BS4 A;  3ADA B;  3LZW A;  4H4X A;  4GUV A;  3LB8 A;  4Z44 A;  4BV6 A;  2VQB A;  2AR8 A;  1GRH A;  3IC9 A;  3VR9 A;  2YG5 A;  3UKK A;  1JU2 A;  3QFA A;  4C74 A;  1H82 A;  2V3B A;  3H8I A;  5BUK A;  3EF6 A;  2YVJ A;  4ICY A;  5KRQ A;  4EQS A;  4EQX A;  2H89 A;  1V59 A;  3GDN A;  1E6E A;  4IVO B;  4LA1 A;  4OCG A;  1KFY A;  3AE3 A;  3VRA A;  1X31 B;  3CNP A;  3T0K A;  4AP3 A;  2C3C A;  1PJ5 A;  2E1M A;  3SFE A;  2B9X A;  1NEN A;  5EB4 A;  4IA6 A;  3QJ4 A;  3GSI A;  4RSL A;  1K4Q A;  4A7A A;  1IUW A;  1K0J A;  4EMI A;  4Z2T A;  3K7T A;  1XPQ A;  3HYW A;  4YSY A;  3L8K A;  3AEE A;  3CMM A;  3DGZ A;  1S3E A;  3NK1 X;  2RGH A;  2R46 A;  2YWL A;  2YLW A;  5GRT A;  5TR3 A;  2Y6R A;  4MJW A;  3S5W A;  4TM0 A;  4J31 A;  3URH A;  4CRT A;  3WE0 A;  3M12 A;  5KVI A;  3CPI G;  4C5O A;  4II3 A;  4GAV A;  1MO9 A;  2H88 A;  2O9Z A;  4NEV A;  3V76 A;  2WP5 A;  1ZMD A;  2GB0 A;  3UOZ A;  4YSZ A;  1LQT A;  2QA1 A;  3SZW A;  3KD9 A;  2YM1 A;  3P4S A;  2OLN A;  2A87 A;  2Y6Q A;  4O5Q A;  1Y0P A;  1PN0 A;  2HQM A;  1JNZ A;  4LII A;  4PAB A;  4RG3 A;  2ZZB A;  5J7X A;  1W4X A;  2BS2 A;  4EQW A;  2BXR A;  5CQF A;  2FJA A;  1PBB A;  1PBD A;  4OVI A;  1COY A;  2FBW A;  1D4E A;  3AYJ A;  4U2S A;  2FJD A;  3AYL A;  4G6H A;  3AE1 A;  2E4G A;  2YLZ A;  3BI5 A;  2C7G A;  4A79 A;  4Z2R A;  1ZX9 A;  3UTF A;  2GMH A;  4I59 A;  2WU5 A;  2EQ8 A;  1D4D A;  1PXA A;  4IVM B;  1GPE A;  2WDR A;  1GT8 A;  3GD4 A;  3VRB A;  1F6M A;  1ONF A;  3BNU A;  3RP6 A;  4OPG A;  1FCD A;  2VVL A;  3AE9 A;  4P9S A;  3FIM B;  4J2W A;  2BS3 A;  4FK1 C;  4A5L A;  3T2Z A;  2B7R A;  3SZ0 A;  2C65 A;  1L9E A;  5HYM A;  4K5R A;  4U8O A;  4H50 A;  2XVF A;  5GSN A;  2YLS A;  4NNJ A;  2BYB A;  5BRT A;  3KA7 A;  4OPU A;  4G73 A;  1GRG A;  2X8C A;  5U1O A;  3PS9 A;  2BCP A;  3UOY A;  4NWZ A;  4CCQ A;  2V5Z A;  1BZL A;  1VG0 A;  3H4K A;  1E39 A;  1OJ9 A;  4EMJ A;  4B65 A;  1ZOV A;  1JOA A;  5JCN A;  2BK5 A;  2BA9 A;  4APN A;  1LV0 A;  3CTY A;  4GRT A;  4TLZ A;  1GES A;  1LQU A;  2AQJ A;  2GAH B;  4H4W A;  1ZDL A;  1IJH A;  4K8D A;  3GRT A;  1JRY A;  2Q7V A;  3CN8 A;  4M52 A;  4YSH A;  1DXL A;  1YY5 A;  2YM2 A;  3AB1 A;  4TM3 A;  3UOX A;  3K7M X;  1IUV A;  1E1N A;  1E7P A;  2QAE A;  2RAB A;  2BAC A;  1D7Y A;  3ISH A;  1DNC A;  5KWF A;  1CHU A;  2VOU A;  5LV9 A;  4YKF A;  2ARD A;  1CJ4 A;  3GYJ A;  2X8H A;  3M0O A;  2WP9 A;  2OAL A;  2WDQ A;  2ZZC A;  3UP5 A;  1DOE A;  4GAP A;  2A8X A;  2FJB A;  1H7W A;  3ATQ A;  1EBD A;  2B76 A;  3H8L A;  4G9K A;  2ZBW A;  4REK A;  4K7Z A;  3I3L A;  1NG3 A;  3P4Q A;  1NPX A;  2WBA A;  3V3N A;  3NNE A;  1O5W A;  3PVC A;  1DOC A;  1ZY8 A;  3COX A;  3GYI A;  1M64 A;  4H4T A;  5IPY A;  3NHO X;  4B64 A;  1H6V A;  2R9Z A;  2RGJ A;  3SFD A;  5FS6 A;  3UKQ A;  1Y56 A;  3PO7 A;  3C4N A;  2GR2 A;  3ALM A;  1TDN A;  3T31 A;  4A99 A;  5C3J A;  1CJ3 A;  4Z24 A;  1CBO A;  3AXB A;  2WOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...