5BUKA

Structure of flavin-dependent chlorinase mpy16
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
434
Chain Sequence
EPQFDVGIIGGGPAGSTTASYLARAGLKVALFESDNFPREHVGESLVPATTPVLVDIDAFDKVEAAGFPKKFGAAWTSADSGPSDKMGFTGLDHDFRAAEIMFNERTQSGVHKDYTFHVDRGQFDLLLLKHAEEQGAKVHQGVRVNRVNFDGAFPVLETSVAGQRAKVPVKMVVDASGRRTQLGSQLKVKEKDPVFNQYAIHTWFDNFDRKALAVDQSQSDFIFIHFLPVIDTWVWQIPITDTITSVGVVTQKERLDLEKFFWDTLGSRPELHKALKESEQVRPLKTEGDYSYALTKVCGDNFLMVGDAARFVDPIFSSGVSVALNSARIASADIIAAHRAGDYSKKRFDTYESMLRRGVNNWYEFISIYYRLNILFTAFVQDPRYRIDVLKMLQGDVYDDEEPKALAAMREIVKAVEEDPNHLWHPFLGSLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FADH2-dependent halogenase
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
source organism Streptomyces sp. cnq-418
total genus 155
structure length 434
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bukA00
5C3JA 2CDUA 2E1MA 3AD9B 1E1LA 3GMCA 3SFDA 4H4TA 1XDIA 3CPJG 1D4CA 3AEEA 4H2PA 1CJ3A 3CNDA 3NN0X 2R0CA 1D7YA 3GYIA 3KA7A 4GUVA 4I58A 2JB3A 4JQ9A 3OC4A 2GQWA 2WPCA 1W4XA 4A79A 1K4QA 2ARDA 4RG3A 2NVKX 3ICSA 3AD7B 4JN9A 1FECA 5TR3A 3P9UA 3CGDA 3CNSA 1PXBA 4GDEA 3AD8B 3GMBA 4B65A 2PYXA 1H7XA 4EMWA 4C5OA 4YWOA 4PAAA 2ZZBA 5BVAA 2YLSA 1GTEA 1CC4A 4OPDA 3UOZA 2IIDA 3BHFA 1NAAA 2WP5A 4XXGA 5DBJA 3RP6A 2BC1A 1B5QA 4H2QA 4A9WA 3K7TA 4B63A 1IUWA 4C77A 1CC2A 2CULA 2OLOA 2RGHA 3AE4A 2ZZCA 1CL0A 1COYA 4ECHA 1PBCA 2QA1A 2Q0KA 2YR6A 4Y4LA 1OJ9A 1S2QA 3AE2A 1BWCA 2XCGA 1LVLA 2W0HA 1LQUA 2AQJA 1F8RA 1L0VA 2VQ7A 4A6NA 4D03A 1H83A 2C73A 1O5WA 3PS9A 2VVMA 3T37A 2AR8A 2XLRA 1ZDLA 2A8XA 1D5TA 2WS3A 1GTHA 1MOKA 1LTXR 1S3EA 2BK5A 2BXRA 2C7GA 2PHHA 4CRTA 4YSXA 3R9UA 3F8PA 1E1NA 2XDOA 2VRLA 3II4A 5CQFA 3VR8A 4CBQA 1B8SA 4HA6A 3AE7A 1PBEA 3IHMA 3REDA 3BI5A 3UKAA 1VRQB 3D1CA 4CY6A 5C2TA 1ZP0A 4EQSA 3WE0A 1BZLA 1CJ4A 3AE8A 2R9ZA 3ALJA 1EBDA 4H7UA 2ACZA 4J34A 4X4JA 1GRBA 1KNRA 3NT6A 2JB1A 2YVGA 4AP3A 4J56A 4EM4A 4JNAA 1K0JA 3O0HA 4C74A 1TDEA 1BF3A 1GREA 1IUUA 3VRBA 2WU5A 4A6NB 4J36A 3NHOX 1PBDA 1K0IA 5ER0A 4KPRA 3AE5A 3VQRA 1PJ7A 3AE6A 5JCLA 1GRGA 2RABA 2VZ2A 4CY8A 3P4QA 3UTGA 1GV4A 3CTYA 3FG2P 2WBAA 3C4AA 4UP3A 3P4PA 4Z2RA 2BS2A 3UKHA 4A7AA 5U63A 4ICYA 1JRXA 4BK3A 4U8PA 1DODA 3UOYA 1F6MA 4H4YA 4I59A 4YKGA 4JY2A 3QSEA 2FJEA 1TDKA 1GALA 3COXA 3NYEA 2I0ZA 3UKLA 2WOVA 3P4SA 4A65A 3H8LA 1NHSA 2YLXA 4U8JA 5JCIA 2C72A 3FMWA 5BULA 2RGJA 3ITJA 3NIXA 5IQ1A 4NTEA 4B69A 1RP0A 4K22A 4MJWA 3ICRA 4UDRA 1TDOA 4GF7A 1CJ2A 1GT8A 3IWAA 2WP6A 5M10A 1LJ1A 2GF3A 2C70A 1GRTA 2GVCA 2YVJA 3GWDA 3PO7A 4HB9A 4K8DA 5U1OA 1ELIA 3GD3A 4B66A 4REKA 4XWRA 1DNCA 2WPFA 4H4QA 4CNJA 2DKIA 3DA1A 1ZKQA 5JCMA 2H89A 2V3BA 1ZOVA 5JCKA 2E5VA 4WCTA 2WP9A 3DJJA 3QFAA 2XVFA 1TYPA 1YQZA 2XLPA 3UKQA 4D04A 1MO9A 2R0GA 4BURA 1DXLA 1KSSA 1X31B 4BK2A 2XFUA 3AYIA 2YWLA 2GB0A 2BA9A 3QVRA 3UTHA 2GAHB 3DGZA 4H4ZA 4OPLA 4U8OA 3UKFA 3EF6A 5HHFA 1H86A 1O94A 2C3DA 1JEHA 3CGBA 4OPGA 5JCNA 3AXBA 4U8IA 4NTDA 4ZCCA 1L9DA 1Q1WA 1PXAA 1ZMCA 1H82A 1CF3A 2WQYA 2B7SA 5EOWA 3KPFA 4PABA 3QVPA 2GMHA 4H4RA 3H8IA 4E0VA 1RSGA 4UDQA 4FX9A 2TMDA 1GRHA 1KDGA 1DOBA 3L8KA 2B9XA 3DK4A 4TLXA 2YVFA 1REOA 1PDHA 2X99A 5J60A 1ZY8A 2A87A 5EB4A 1L9EA 1QJDA 1QLBA 3QSSA 4JDRA 4YSYA 4K2XA 2EQ8A 3RP8A 2C3CA 3CGCA 1XHCA 3GYJA 5U25A 3BNUA 4YKFA 4ADWA 1D4DA 1IUSA 1GRFA 3GRSA 1DJNA 2OLNA 3ZYXA 2BCGG 2BCPA 2XLUA 2FJDA 2YR4A 4OPUA 4RSLA 3UTFA 1OJAA 2APGA 5M0ZA 4B68A 1BKWA 1NG4A 2X8CA 1S2YA 2VVLA 4BJYA 2WHDA 2WU2A 4U2LA 1E39A 2XYOA 1OJTA 3NRNA 3NYCA 3AE1A 3BHKA 4DSGA 3QSMA 5FS6A 2B7RA 2A89A 1KFYA 1PJ5A 3QFBA 5GRTA 4C3YA 3DJDA 4CCQA 1BGNA 1JRYA 3F8RA 2BS3A 2V6OA 1GESA 3V3OA 1JNZA 1N4VA 4H50A 3KD9A 1JNRA 4H4WA 4DNAA 3LZWA 4Z44A 1GXFA 4NEVA 4YSZA 3ZDNA 4U2SA 1TYTA 1OJDA 4EIQA 2C66A 1F8WA 1CHUA 2BK3A 4YTNA 3IHGA 4Y4MA 4N9XA 1E1MA 2X8GA 3ISHA 3L1RA 3AEBA 2OAMA 1FOHA 3K7QX 4H2RA 1DOCA 1KNPA 2XVIA 1ZK7A 3UCLA 3ALLA 4AP1A 1B4VA 3B6DA 1DJQA 1CC6A 1NHQA 1PBBA 3IF9A 1LPFA 3NYFA 1NEKA 3I3LA 4TM1A 4EQWA 5EBKA 1D4EA 2YG7A 2GQFA 4B1BA 1GEUA 3CGEA 1GNDA 2Q7VA 4EMJA 2OA1A 2UZZA 5KWFA 2FJBA 2YLTA 3KU9A 2E4GA 5FMHA 4YT0A 1SEZA 2C64A 4X9NA 4Z25A 3SM8A 4NEWA 2XVHA 2TPRA 3FPZA 3S5WA 3UP5A 2V61A 3AEDA 4O5QA 4WX1A 2C65A 3NH3X 4GCMA 1TDNA 4TM0A 4AOSA 4CNKA 4K5RA 2B9WA 1VG9A 3K30A 3NNEA 4AT0A 4DGKA 1ZOYA 3Q6JA 3AEGA 1VDCA 3E1TA 1EL5A 2IVDA 4BV6A 1CBOA 3BI2A 2QA2A 1PXCA 3C4NA 4IA6A 5KRQA 3G5SA 1NG3A 3URHA 3BI4A 4YTPA 2YM2A 4H4UA 3AE9A 1XANA 2R45A 2WDVA 1FCDA 2YQUA 1NHPA 1F8SA 3EAOA 2YLZA 4K7ZA 1P2HA 1TDFA 3RNMA 2WDQA 3GD4A 3M0OA 4APNA 1B37A 3DJGX 2VQBA 3GWFA 3CNTA 4BJZA 1V59A 2BABA 4U2TA 1PJ6A 1Q1RA 2WOWA 3GSIA 3HZLA 4IA5A 3KLJA 4EQRA 5IQ4A 3LXDA 2BXSA 1N4UA 4USRA 1IUVA 2ZZ0A 4IV9A 4YSHA 1H6VA 2Z5YA 3K7MX 3V76A 1Y0PA 1YY5A 2X3NA 3AB1A 3ADAB 4UDPA 1ZMDA 3SGLA 2ZBWA 2VRMA 2GV8A 1QO8A 3LB8A 2XLTA 4JY3A 3IC9A 4NTCA 1GERA 4EIPA 1GOSA 1H84A 3P1WA 4H4SA 1N4WA 2XFPA 1EL9A 5LV9A 3UKPA 4J31A 2B76A 2VVLG 3VR9A 4CCRA 3GDPA 4B64A 5KVIA 1XPQA 1EL7A 1BGJA 4J33A 2GR1A 1L9CA 1YQ3A 3AEAA 1JOAA 2WEUA 1LV0A 4U8KA 2GRTA 1E7PA 4U8LA 3UOVA 2B9YA 1NPXA 3AEFA 2C76A 1PN0A 4Z26A 3DGHA 4H2NA 1GSNA 4IVOB 4RG4A 5KOWA 3JSKA 4OPTA 2NPXA 3NG7X 1FEBA 3DH9A 4ZCDA 2X50A 3NK1X 1Z6LA 3CNJA 1Q9IA 1RYIA 4OPCA 3D8XA 3LOVA 3NKSA 2YLWA 2C75A 2YAUA 1GRAA 1M6IA 3DJEA 2JAEA 1KF6A 3UP4A 4XWZA 1DOEA 4OCGA 3G5QA 3Q9TA 1Y56A 2GAGB 3NTDA 2XFNA 3LADA 3P4RA 2EQ7A 5EB5A 2XVJA 1JRZA 3CN8A 4ZN0A 1IUTA 2R0PA 3DK8A 4OPIA 2VOUA 5J7XA 2EQ9A 2RGOA 3NLCA 4K5SA 4IVMB 3ABVA 3GDNA 3PVCA 3ATQA 2YG3A 3AYLA 3FBSA 3KKJA 3KVEA 3M13A 2Q6UA 2JKCA 3RP7A 3SQPA 1NDAA 3B3RA 5KXJA 1LQTA 3QJ4A 2CVJA 4M52A 1TRBA 2JBVA 1GPEA 2GR0A 2BACA 2JK6A 4J57A 5GSNA 3VRDB 3BNMA 4C3XA 1PHHA 4LA1A 1PBFA 2R4EA 2H88A 1Y56B 3I6DA 1NHRA 4U8MA 1H7WA 3NN6X 3AE3A 2WETA 4BK1A 2AAQA 4A5LA 2XFOA 2YLRA 4EQXA 2FBWA 5BUKA 2C67A 3CNPA 4Z43A 1GETA 2Z5XA 5L46A 1KSUA 1K0LA 1FL2A 1OJCA 3CPIG 4FK1C 4EM3A 2WPEA 5KOXA 1F3PA 3DMEA 2XFQA 2R46A 3M12A 5KVHA 2V60A 1P2EA 4H4XA 4Y4NA 1YQ4A 4KX6A 2V3AA 4A99A 2X8HA 3VRAA 2QAEA 3S61A 5HYMA 1S3BA 2O9ZA 4U8NA 1ZX9A 2F5ZA 3H4KA 3LJPA 5FS9A 2BS4A 1EL8A 3LZXA 4J2WA 3NK0X 4TM3A 2CFYA 2YR5A 2OALA 2YM1A 4AOXA 1AOGA 1ONFA 4TM4A 4GDPA 1N1PA 2J3NA 2R4JA 1PS9A 1M64A 3FIMB 2Y6QA 2BC0A 1H81A 2GMJA 3NGCX 2JB2A 2IVEA 4JNQA 4AT2A 2XLSA 5CKUA 3UTEA 3EPTA 2XVEA 3OZ2A 3NK2X 3AWIA 2DKHA 2WOIA 4YXDA 1IJHA 3DK9A 3UKKA 2Y6RA 4EMIA 2YG6A 3SFEA 1UKVG 4P9SA 1FEAA 1VQWA 1CJCA 1O95A 3CIRA 2EQ6A 4YTMA 1MXTA 3AYJA 2QCUA 4Z24A 4O5UA 1YKJA 3AECA 3ALMA 3ICTA 2GEWA 1IUXA 4H4PA 4LIIA 4USQA 2GR2A 1E6EA 2WESA 4FDCB 4FK1A 4GR1A 3CPHG 4X9MA 3F8DA 2BK4A 2GR3A 1HYUA 3EANA 4NZHA 4Z2UA 2YG4A 5IPYA 2GH5A 4DSHA 2WDRA 4GRTA 1D7LA 3GRTA 3ATRA 5HY5A 4H4VA 5HXIA 3C96A 3NTAA 1JU2A 1NENA 2YG5A 1VG0A 2V5ZA 3RHAA 4TLZA 4B67A 2BYBA 1E1KA 2FJAA 2HQMA 4LU6A 5FS8A 3V3NA 5FS7A 2Q0LA 4Z2TA 3UOXA 4OVIA 5BRTA 3G5RA
chains in the Genus database with same CATH superfamily
5C3JA 2CDUA 2E1MA 3AD9B 4G6GA 1E1LA 3GMCA 3SFDA 4H4TA 1XDIA 3CPJG 1D4CA 3AEEA 4H2PA 1CJ3A 3CNDA 3NN0X 2R0CA 1D7YA 3GYIA 3KA7A 5KMRA 4GUVA 4I58A 5KNLA 2JB3A 4JQ9A 3SZCA 3OC4A 2GQWA 2WPCA 1W4XA 4A79A 1K4QA 2ARDA 4RG3A 2NVKX 3ICSA 3AD7B 4JN9A 1FECA 5TR3A 3P9UA 3CGDA 3CNSA 1PXBA 4GDEA 3AD8B 3GMBA 4B65A 2PYXA 1H7XA 4EMWA 4C5OA 4YWOA 4PAAA 2ZZBA 5BVAA 2YLSA 1GTEA 1CC4A 4OPDA 3UOZA 2IIDA 3BHFA 1NAAA 2WP5A 4XXGA 5DBJA 3RP6A 2BC1A 1B5QA 4H2QA 4A9WA 3K7TA 4B63A 1IUWA 4C77A 1CC2A 2CULA 2OLOA 2RGHA 3AE4A 2ZZCA 1CL0A 1COYA 4ECHA 1PBCA 2QA1A 2Q0KA 2YR6A 4Y4LA 1OJ9A 1S2QA 3AE2A 1BWCA 2XCGA 1LVLA 2W0HA 1LQUA 4GAVA 2AQJA 1F8RA 4B66A 1L0VA 2VQ7A 4A6NA 4D03A 1H83A 2C73A 1O5WA 3PS9A 2VVMA 3T37A 2AR8A 2XLRA 1ZDLA 2A8XA 1D5TA 2WS3A 3T31A 3KPKA 1GTHA 1MOKA 1LTXR 1S3EA 2BK5A 2BXRA 2C7GA 2PHHA 4CRTA 4YSXA 3R9UA 3F8PA 1E1NA 2XDOA 2VRLA 3II4A 5CQFA 3VR8A 4CBQA 1B8SA 4HA6A 3AE7A 1PBEA 3IHMA 3REDA 3BI5A 3UKAA 1VRQB 3D1CA 4CY6A 5C2TA 1ZP0A 4EQSA 3WE0A 1BZLA 1CJ4A 3AE8A 2R9ZA 3ALJA 1EBDA 4H7UA 2ACZA 4J34A 4X4JA 1GRBA 1KNRA 3NT6A 2JB1A 2YVGA 4G74A 4AP3A 4J56A 4EM4A 4JNAA 1K0JA 3O0HA 4C74A 1TDEA 1BF3A 1GREA 1IUUA 3VRBA 2WU5A 4A6NB 4J36A 3NHOX 1PBDA 1K0IA 5ER0A 4KPRA 3AE5A 3VQRA 1PJ7A 3AE6A 5JCLA 3T2KA 1GRGA 2RABA 2VZ2A 4CY8A 3P4QA 3UTGA 1GV4A 3CTYA 3FG2P 2WBAA 3C4AA 4UP3A 3P4PA 4Z2RA 2BS2A 3UKHA 3SZWA 4A7AA 5U63A 4ICYA 1JRXA 3SX6A 4BK3A 4U8PA 1DODA 3UOYA 1F6MA 4H4YA 4I59A 4YKGA 4JY2A 3QSEA 2FJEA 1TDKA 1GALA 3COXA 3NYEA 2I0ZA 3UKLA 2WOVA 3P4SA 4A65A 3H8LA 1NHSA 2YLXA 4U8JA 5JCIA 2C72A 3FMWA 5BULA 2RGJA 3ITJA 3NIXA 3T14A 5IQ1A 4NTEA 4B69A 1RP0A 4K22A 4MJWA 3ICRA 4UDRA 1TDOA 4GF7A 1CJ2A 1GT8A 3IWAA 2WP6A 5M10A 1LJ1A 2GF3A 2C70A 1GRTA 2GVCA 2YVJA 3GWDA 3HYWA 3PO7A 4HB9A 4K8DA 1ELIA 3GD3A 5U1OA 4REKA 4XWRA 1DNCA 2WPFA 4H4QA 4CNJA 2DKIA 3DA1A 1ZKQA 5JCMA 2H89A 2V3BA 1ZOVA 2BRAA 2E5VA 5JCKA 4WCTA 2WP9A 3DJJA 3QFAA 2XVFA 1TYPA 1YQZA 2XLPA 3UKQA 4D04A 1MO9A 2R0GA 4BURA 1DXLA 1KSSA 1X31B 4BK2A 2XFUA 3AYIA 2YWLA 2GB0A 2BA9A 5KMSA 3QVRA 3UTHA 2GAHB 3DGZA 4H4ZA 4OPLA 4U8OA 3UKFA 3EF6A 5HHFA 1H86A 1O94A 2C3DA 1JEHA 3CGBA 4OPGA 5JCNA 3AXBA 3SZ0A 4U8IA 4NTDA 4ZCCA 1L9DA 1Q1WA 1PXAA 1ZMCA 1H82A 1CF3A 2WQYA 2B7SA 5EOWA 3KPFA 4PABA 3QVPA 2GMHA 4H4RA 3H8IA 4E0VA 1RSGA 4UDQA 4FX9A 2TMDA 1GRHA 1KDGA 1DOBA 3L8KA 2B9XA 3DK4A 4TLXA 2YVFA 4II3A 1REOA 4G6HA 1PDHA 2X99A 5J60A 1ZY8A 2A87A 5EB4A 1L9EA 1QJDA 1QLBA 3QSSA 4JDRA 4YSYA 4K2XA 2EQ8A 3RP8A 2C3CA 3CGCA 1XHCA 3GYJA 5U25A 3BNUA 4YKFA 4ADWA 1D4DA 1IUSA 1GRFA 3GRSA 1DJNA 2OLNA 3ZYXA 2BCGG 2BCPA 2XLUA 2FJDA 2YR4A 4OPUA 4RSLA 3UTFA 1OJAA 2APGA 3GYXA 5M0ZA 4B68A 1BKWA 1NG4A 2X8CA 1S2YA 2VVLA 4BJYA 2WHDA 2WU2A 4U2LA 1E39A 2XYOA 1OJTA 3NRNA 3NYCA 3AE1A 3BHKA 4DSGA 4G9KA 3QSMA 5FS6A 2B7RA 2A89A 1KFYA 1PJ5A 3QFBA 5GRTA 4C3YA 3DJDA 4CCQA 1BGNA 1JRYA 3F8RA 2BS3A 2V6OA 1GESA 3V3OA 1JNZA 1N4VA 4H50A 3KD9A 1JNRA 4H4WA 4DNAA 3LZWA 4Z44A 1GXFA 4NEVA 4YSZA 3ZDNA 4U2SA 1TYTA 1OJDA 4EIQA 2C66A 1F8WA 1CHUA 2BK3A 4YTNA 3IHGA 4Y4MA 4N9XA 1E1MA 2X8GA 3ISHA 3L1RA 3AEBA 2OAMA 1FOHA 3K7QX 4H2RA 1DOCA 1KNPA 2XVIA 1ZK7A 3UCLA 3ALLA 4AP1A 1B4VA 3B6DA 1DJQA 1CC6A 1NHQA 1PBBA 3IF9A 1LPFA 3NYFA 1NEKA 3I3LA 4TM1A 4EQWA 5EBKA 1D4EA 2YG7A 2GQFA 4B1BA 1GEUA 3CGEA 1GNDA 2Q7VA 4EMJA 2OA1A 2UZZA 5KWFA 2FJBA 2YLTA 3KU9A 2E4GA 5FMHA 4YT0A 1SEZA 2C64A 4X9NA 4Z25A 3SM8A 4NEWA 2XVHA 2TPRA 3FPZA 3HYXA 3S5WA 3UP5A 2V61A 3AEDA 4O5QA 4WX1A 2C65A 3NH3X 4GCMA 1TDNA 4TM0A 4AOSA 4CNKA 4K5RA 2B9WA 1VG9A 3K30A 3NNEA 4AT0A 4DGKA 1ZOYA 3Q6JA 3AEGA 1VDCA 3E1TA 1EL5A 2IVDA 4BV6A 1CBOA 3BI2A 2QA2A 1PXCA 3C4NA 4IA6A 5KRQA 3T2ZA 3G5SA 1NG3A 3URHA 3BI4A 4YTPA 2YM2A 4H4UA 3AE9A 1XANA 2R45A 2WDVA 1FCDA 2YQUA 1NHPA 1F8SA 3EAOA 2YLZA 4K7ZA 1P2HA 1TDFA 3RNMA 2WDQA 3GD4A 3M0OA 4APNA 1B37A 3DJGX 2VQBA 3GWFA 3CNTA 4BJZA 1V59A 2BABA 4U2TA 1PJ6A 1Q1RA 2WOWA 3GSIA 3HZLA 4IA5A 3KLJA 4EQRA 5IQ4A 3LXDA 2BXSA 1N4UA 4USRA 1IUVA 2ZZ0A 4IV9A 4YSHA 1H6VA 2Z5YA 3K7MX 3V76A 1Y0PA 1YY5A 2X3NA 3AB1A 3ADAB 4UDPA 1ZMDA 3SGLA 2ZBWA 2VRMA 2GV8A 1QO8A 3LB8A 2XLTA 4JY3A 3IC9A 4NTCA 4NNJA 1GERA 4EIPA 5KMPA 1GOSA 1H84A 3P1WA 4H4SA 1N4WA 2XFPA 1EL9A 5LV9A 3UKPA 4J31A 2B76A 2VVLG 3VR9A 4CCRA 3GDPA 4B64A 5KVIA 1XPQA 1EL7A 1BGJA 4J33A 3SY4A 2GR1A 1L9CA 1YQ3A 3AEAA 1JOAA 2WEUA 1LV0A 4U8KA 2GRTA 1E7PA 4U8LA 3UOVA 2B9YA 1NPXA 3AEFA 2C76A 1PN0A 3SZFA 3DGHA 4H2NA 4Z26A 1GSNA 4IVOB 4RG4A 3CMMA 3JSKA 4GAPA 4OPTA 2NPXA 3NG7X 1FEBA 5KOWA 3DH9A 4ZCDA 2X50A 3NK1X 1Z6LA 3CNJA 1Q9IA 1RYIA 4OPCA 3D8XA 3LOVA 3NKSA 2YLWA 2C75A 2YAUA 1GRAA 1M6IA 3DJEA 2JAEA 1KF6A 3UP4A 4XWZA 1DOEA 4OCGA 3G5QA 3Q9TA 1Y56A 2GAGB 3NTDA 2XFNA 3LADA 2BRYA 3P4RA 2EQ7A 5EB5A 2XVJA 1JRZA 3CN8A 3T2YA 4ZN0A 1IUTA 2R0PA 3DK8A 4OPIA 2VOUA 5J7XA 2EQ9A 2RGOA 3NLCA 4K5SA 4IVMB 3ABVA 3GDNA 3PVCA 3ATQA 2YG3A 3AYLA 3FBSA 3KKJA 3KVEA 3M13A 2Q6UA 2JKCA 3RP7A 3SQPA 3T0KA 1NDAA 3B3RA 5KXJA 1LQTA 3QJ4A 2CVJA 4M52A 1TRBA 2JBVA 1GPEA 2GR0A 2BACA 2JK6A 4J57A 5GSNA 3VRDB 3BNMA 4C3XA 1PHHA 4LA1A 1PBFA 2R4EA 2H88A 1Y56B 3I6DA 1NHRA 4U8MA 1H7WA 3NN6X 3AE3A 2WETA 4BK1A 2AAQA 4A5LA 2XFOA 2YLRA 4EQXA 2FBWA 5BUKA 2C67A 3CNPA 4Z43A 1GETA 2Z5XA 5L46A 1KSUA 1K0LA 1FL2A 1OJCA 3CPIG 4FK1C 5KMQA 3SXIA 4EM3A 2WPEA 5KOXA 1F3PA 3DMEA 2XFQA 2R46A 3M12A 5KVHA 2V60A 1P2EA 4H4XA 4Y4NA 1YQ4A 4KX6A 2V3AA 4A99A 2X8HA 3VRAA 2QAEA 3S61A 5HYMA 1S3BA 2O9ZA 4U8NA 1ZX9A 2F5ZA 3H4KA 3LJPA 5FS9A 2BS4A 1EL8A 3LZXA 4J2WA 3NK0X 4TM3A 2CFYA 2YR5A 2OALA 2YM1A 4AOXA 1AOGA 1ONFA 4TM4A 4GDPA 1N1PA 2J3NA 2R4JA 1PS9A 1M64A 3FIMB 2Y6QA 2BC0A 4II2A 1H81A 2GMJA 3NGCX 2JB2A 2IVEA 4JNQA 4AT2A 4NWZA 2XLSA 5CKUA 3UTEA 3EPTA 2XVEA 3OZ2A 3NK2X 3AWIA 2DKHA 2WOIA 4YXDA 1IJHA 3DK9A 3UKKA 2Y6RA 4EMIA 2YG6A 3SFEA 1UKVG 4P9SA 1FEAA 4G73A 3SYIA 1VQWA 1CJCA 1O95A 3CIRA 2EQ6A 4YTMA 1MXTA 3AYJA 2QCUA 4Z24A 4O5UA 1YKJA 3AECA 3ALMA 3ICTA 2GEWA 1IUXA 4H4PA 4LIIA 4USQA 2GR2A 1E6EA 2WESA 4FDCB 4FK1A 4GR1A 3CPHG 4X9MA 3F8DA 2BK4A 2GR3A 1HYUA 3EANA 4NZHA 4Z2UA 2YG4A 5IPYA 2GH5A 4DSHA 2WDRA 4GRTA 1D7LA 3GRTA 2C4CA 3ATRA 5HY5A 4H4VA 5HXIA 3C96A 3NTAA 1JU2A 1NENA 2YG5A 1VG0A 2V5ZA 3RHAA 4TLZA 4B67A 2BYBA 1E1KA 2FJAA 2HQMA 4LU6A 5FS8A 3V3NA 5FS7A 2Q0LA 4Z2TA 3UOXA 4OVIA 5BRTA 3HYVA 3G5RA
chains in the Genus database with same CATH topology
5C3JA 2CDUA 2E1MA 3AD9B 4G6GA 1E1LA 3GMCA 3SFDA 4H4TA 1XDIA 3CPJG 1D4CA 3AEEA 4H2PA 1CJ3A 3CNDA 3NN0X 2R0CA 1D7YA 3GYIA 3KA7A 5KMRA 4GUVA 4I58A 5KNLA 2JB3A 4JQ9A 3SZCA 3OC4A 2GQWA 2WPCA 1W4XA 4A79A 1K4QA 2ARDA 4RG3A 2NVKX 3ICSA 3AD7B 4JN9A 1FECA 5TR3A 3P9UA 3CGDA 3CNSA 1PXBA 4GDEA 3AD8B 3GMBA 4B65A 2PYXA 1H7XA 4EMWA 4C5OA 4YWOA 4PAAA 2ZZBA 5BVAA 2YLSA 1GTEA 1CC4A 4OPDA 3UOZA 2IIDA 3BHFA 1NAAA 2WP5A 4XXGA 5DBJA 3RP6A 2BC1A 1B5QA 4H2QA 4A9WA 3K7TA 4B63A 1IUWA 4C77A 1CC2A 2CULA 2OLOA 2RGHA 3AE4A 2ZZCA 1CL0A 1COYA 4ECHA 1PBCA 2QA1A 2Q0KA 2YR6A 4Y4LA 1OJ9A 1S2QA 3AE2A 1BWCA 2XCGA 1LVLA 2W0HA 1LQUA 4GAVA 2AQJA 1F8RA 4B66A 1L0VA 2VQ7A 4A6NA 4D03A 1H83A 2C73A 1O5WA 3PS9A 2VVMA 3T37A 2AR8A 2XLRA 1ZDLA 2A8XA 1D5TA 2WS3A 3T31A 3KPKA 1GTHA 1MOKA 1LTXR 1S3EA 2BK5A 2BXRA 2C7GA 2PHHA 4CRTA 4YSXA 3R9UA 3F8PA 1E1NA 2XDOA 2VRLA 3II4A 5CQFA 3VR8A 4CBQA 1B8SA 4HA6A 3AE7A 1PBEA 3IHMA 3REDA 3BI5A 3UKAA 1VRQB 3D1CA 4CY6A 5C2TA 1ZP0A 4EQSA 3WE0A 1BZLA 1CJ4A 3AE8A 2R9ZA 3ALJA 1EBDA 4H7UA 2ACZA 4J34A 4X4JA 1GRBA 1KNRA 3NT6A 2JB1A 2YVGA 4G74A 4AP3A 4J56A 4EM4A 4JNAA 1K0JA 3O0HA 4C74A 1TDEA 1BF3A 1GREA 1IUUA 3VRBA 2WU5A 4A6NB 4J36A 3NHOX 1PBDA 1K0IA 5ER0A 4KPRA 3AE5A 3VQRA 1PJ7A 3AE6A 5JCLA 3T2KA 1GRGA 2RABA 2VZ2A 4CY8A 3P4QA 3UTGA 1GV4A 3CTYA 3FG2P 2WBAA 3C4AA 4UP3A 3P4PA 4Z2RA 2BS2A 3UKHA 3SZWA 4A7AA 5U63A 4ICYA 1JRXA 3SX6A 4BK3A 4U8PA 1DODA 3UOYA 1F6MA 4H4YA 4I59A 4YKGA 4JY2A 3QSEA 2FJEA 1TDKA 1GALA 3COXA 3NYEA 2I0ZA 3UKLA 2WOVA 3P4SA 4A65A 3H8LA 1NHSA 2YLXA 4U8JA 5JCIA 2C72A 3FMWA 5BULA 2RGJA 3ITJA 3NIXA 3T14A 5IQ1A 4NTEA 4B69A 1RP0A 4K22A 4MJWA 3ICRA 4UDRA 1TDOA 4GF7A 1CJ2A 1GT8A 3IWAA 2WP6A 5M10A 1LJ1A 2GF3A 2C70A 1GRTA 2GVCA 2YVJA 3GWDA 3HYWA 3PO7A 4HB9A 4K8DA 1ELIA 3GD3A 5U1OA 4REKA 4XWRA 1DNCA 2WPFA 4H4QA 4CNJA 2DKIA 3DA1A 1ZKQA 5JCMA 2H89A 2V3BA 1ZOVA 2BRAA 2E5VA 5JCKA 4WCTA 2WP9A 3DJJA 3QFAA 2XVFA 1TYPA 1YQZA 2XLPA 3UKQA 4D04A 1MO9A 2R0GA 4BURA 1DXLA 1KSSA 1X31B 4BK2A 2XFUA 3AYIA 2YWLA 2GB0A 2BA9A 5KMSA 3QVRA 3UTHA 2GAHB 3DGZA 4H4ZA 4OPLA 4U8OA 3UKFA 3EF6A 5HHFA 1H86A 1O94A 2C3DA 1JEHA 3CGBA 4OPGA 5JCNA 3AXBA 3SZ0A 4U8IA 4NTDA 4ZCCA 1L9DA 1Q1WA 1PXAA 1ZMCA 1H82A 1CF3A 2WQYA 2B7SA 5EOWA 3KPFA 4PABA 3QVPA 2GMHA 4H4RA 3H8IA 4E0VA 1RSGA 4UDQA 4FX9A 2TMDA 1GRHA 1KDGA 1DOBA 3L8KA 2B9XA 3DK4A 4TLXA 2YVFA 4II3A 1REOA 4G6HA 1PDHA 2X99A 5J60A 1ZY8A 2A87A 5EB4A 1L9EA 1QJDA 1QLBA 3QSSA 4JDRA 4YSYA 4K2XA 2EQ8A 3RP8A 2C3CA 3CGCA 1XHCA 3GYJA 5U25A 3BNUA 4YKFA 4ADWA 1D4DA 1IUSA 1GRFA 3GRSA 1DJNA 2OLNA 3ZYXA 2BCGG 2BCPA 2XLUA 2FJDA 2YR4A 4OPUA 4RSLA 3UTFA 1OJAA 2APGA 3GYXA 5M0ZA 4B68A 1BKWA 1NG4A 2X8CA 1S2YA 2VVLA 4BJYA 2WHDA 2WU2A 4U2LA 1E39A 2XYOA 1OJTA 3NRNA 3NYCA 3AE1A 3BHKA 4DSGA 4G9KA 3QSMA 5FS6A 2B7RA 2A89A 1KFYA 1PJ5A 3QFBA 5GRTA 4C3YA 3DJDA 4CCQA 1BGNA 1JRYA 3F8RA 2BS3A 2V6OA 1GESA 3V3OA 1JNZA 1N4VA 4H50A 3KD9A 1JNRA 4H4WA 4DNAA 3LZWA 4Z44A 1GXFA 4NEVA 4YSZA 3ZDNA 4U2SA 1TYTA 1OJDA 4EIQA 2C66A 1F8WA 1CHUA 2BK3A 4YTNA 3IHGA 4Y4MA 4N9XA 1E1MA 2X8GA 3ISHA 3L1RA 3AEBA 2OAMA 1FOHA 3K7QX 4H2RA 1DOCA 1KNPA 2XVIA 1ZK7A 3UCLA 3ALLA 4AP1A 1B4VA 3B6DA 1DJQA 1CC6A 1NHQA 1PBBA 3IF9A 1LPFA 3NYFA 1NEKA 3I3LA 4TM1A 4EQWA 5EBKA 1D4EA 2YG7A 2GQFA 4B1BA 1GEUA 3CGEA 1GNDA 2Q7VA 4EMJA 2OA1A 2UZZA 5KWFA 2FJBA 2YLTA 3KU9A 2E4GA 5FMHA 4YT0A 1SEZA 2C64A 4X9NA 4Z25A 3SM8A 4NEWA 2XVHA 2TPRA 3FPZA 3HYXA 3S5WA 3UP5A 2V61A 3AEDA 4O5QA 4WX1A 2C65A 3NH3X 4GCMA 1TDNA 4TM0A 4AOSA 4CNKA 4K5RA 2B9WA 1VG9A 3K30A 3NNEA 4AT0A 4DGKA 1ZOYA 3Q6JA 3AEGA 1VDCA 3E1TA 1EL5A 2IVDA 4BV6A 1CBOA 3BI2A 2QA2A 1PXCA 3C4NA 4IA6A 5KRQA 3T2ZA 3G5SA 1NG3A 3URHA 3BI4A 4YTPA 2YM2A 4H4UA 3AE9A 1XANA 2R45A 2WDVA 1FCDA 2YQUA 1NHPA 1F8SA 3EAOA 2YLZA 4K7ZA 1P2HA 1TDFA 3RNMA 2WDQA 3GD4A 3M0OA 4APNA 1B37A 3DJGX 2VQBA 3GWFA 3CNTA 4BJZA 1V59A 2BABA 4U2TA 1PJ6A 1Q1RA 2WOWA 3GSIA 3HZLA 4IA5A 3KLJA 4EQRA 5IQ4A 3LXDA 2BXSA 1N4UA 4USRA 1IUVA 2ZZ0A 4IV9A 4YSHA 1H6VA 2Z5YA 3K7MX 3V76A 1Y0PA 1YY5A 2X3NA 3AB1A 3ADAB 4UDPA 1ZMDA 3SGLA 2ZBWA 2VRMA 2GV8A 1QO8A 3LB8A 2XLTA 4JY3A 3IC9A 4NTCA 4NNJA 1GERA 4EIPA 5KMPA 1GOSA 1H84A 3P1WA 4H4SA 1N4WA 2XFPA 1EL9A 5LV9A 3UKPA 4J31A 2B76A 2VVLG 3VR9A 4CCRA 3GDPA 4B64A 5KVIA 1XPQA 1EL7A 1BGJA 4J33A 3SY4A 2GR1A 1L9CA 1YQ3A 3AEAA 1JOAA 2WEUA 1LV0A 4U8KA 2GRTA 1E7PA 4U8LA 3UOVA 2B9YA 1NPXA 3AEFA 2C76A 1PN0A 3SZFA 3DGHA 4H2NA 4Z26A 1GSNA 4IVOB 4RG4A 3CMMA 3JSKA 4GAPA 4OPTA 2NPXA 3NG7X 1FEBA 5KOWA 3DH9A 4ZCDA 2X50A 3NK1X 1Z6LA 3CNJA 1Q9IA 1RYIA 4OPCA 3D8XA 3LOVA 3NKSA 2YLWA 2C75A 2YAUA 1GRAA 1M6IA 3DJEA 2JAEA 1KF6A 3UP4A 4XWZA 1DOEA 4OCGA 3G5QA 3Q9TA 1Y56A 2GAGB 3NTDA 2XFNA 3LADA 2BRYA 3P4RA 2EQ7A 5EB5A 2XVJA 1JRZA 3CN8A 3T2YA 4ZN0A 1IUTA 2R0PA 3DK8A 4OPIA 2VOUA 5J7XA 2EQ9A 2RGOA 3NLCA 4K5SA 4IVMB 3ABVA 3GDNA 3PVCA 3ATQA 2YG3A 3AYLA 3FBSA 3KKJA 3KVEA 3M13A 2Q6UA 2JKCA 3RP7A 3SQPA 3T0KA 1NDAA 3B3RA 5KXJA 1LQTA 3QJ4A 2CVJA 4M52A 1TRBA 2JBVA 1GPEA 2GR0A 2BACA 2JK6A 4J57A 5GSNA 3VRDB 3BNMA 4C3XA 1PHHA 4LA1A 1PBFA 2R4EA 2H88A 1Y56B 3I6DA 1NHRA 4U8MA 1H7WA 3NN6X 3AE3A 2WETA 4BK1A 2AAQA 4A5LA 2XFOA 2YLRA 4EQXA 2FBWA 5BUKA 2C67A 3CNPA 4Z43A 1GETA 2Z5XA 5L46A 1KSUA 1K0LA 1FL2A 1OJCA 3CPIG 4FK1C 5KMQA 3SXIA 4EM3A 2WPEA 5KOXA 1F3PA 3DMEA 2XFQA 2R46A 3M12A 5KVHA 2V60A 1P2EA 4H4XA 4Y4NA 1YQ4A 4KX6A 2V3AA 4A99A 2X8HA 3VRAA 2QAEA 3S61A 5HYMA 1S3BA 2O9ZA 4U8NA 1ZX9A 2F5ZA 3H4KA 3LJPA 5FS9A 2BS4A 1EL8A 3LZXA 4J2WA 3NK0X 4TM3A 2CFYA 2YR5A 2OALA 2YM1A 4AOXA 1AOGA 1ONFA 4TM4A 4GDPA 1N1PA 2J3NA 2R4JA 1PS9A 1M64A 3FIMB 2Y6QA 2BC0A 4II2A 1H81A 2GMJA 3NGCX 2JB2A 2IVEA 4JNQA 4AT2A 4NWZA 2XLSA 5CKUA 3UTEA 3EPTA 2XVEA 3OZ2A 3NK2X 3AWIA 2DKHA 2WOIA 4YXDA 1IJHA 3DK9A 3UKKA 2Y6RA 4EMIA 2YG6A 3SFEA 1UKVG 4P9SA 1FEAA 4G73A 3SYIA 1VQWA 1CJCA 1O95A 3CIRA 2EQ6A 4YTMA 1MXTA 3AYJA 2QCUA 4Z24A 4O5UA 1YKJA 3AECA 3ALMA 3ICTA 2GEWA 1IUXA 4H4PA 4LIIA 4USQA 2GR2A 1E6EA 2WESA 4FDCB 4FK1A 4GR1A 3CPHG 4X9MA 3F8DA 2BK4A 2GR3A 1HYUA 3EANA 4NZHA 4Z2UA 2YG4A 5IPYA 2GH5A 4DSHA 2WDRA 4GRTA 1D7LA 3GRTA 2C4CA 3ATRA 5HY5A 4H4VA 5HXIA 3C96A 3NTAA 1JU2A 1NENA 2YG5A 1VG0A 2V5ZA 3RHAA 4TLZA 4B67A 2BYBA 1E1KA 2FJAA 2HQMA 4LU6A 5FS8A 3V3NA 5FS7A 2Q0LA 4Z2TA 3UOXA 4OVIA 5BRTA 3HYVA 3G5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3J A;  2CDU A;  2E1M A;  3AD9 B;  1E1L A;  3GMC A;  3SFD A;  4H4T A;  1XDI A;  3CPJ G;  1D4C A;  3AEE A;  4H2P A;  1CJ3 A;  3CND A;  3NN0 X;  2R0C A;  1D7Y A;  3GYI A;  3KA7 A;  4GUV A;  4I58 A;  2JB3 A;  4JQ9 A;  3OC4 A;  2GQW A;  2WPC A;  1W4X A;  4A79 A;  1K4Q A;  2ARD A;  4RG3 A;  2NVK X;  3ICS A;  3AD7 B;  4JN9 A;  1FEC A;  5TR3 A;  3P9U A;  3CGD A;  3CNS A;  1PXB A;  4GDE A;  3AD8 B;  3GMB A;  4B65 A;  2PYX A;  1H7X A;  4EMW A;  4C5O A;  4YWO A;  4PAA A;  2ZZB A;  5BVA A;  2YLS A;  1GTE A;  1CC4 A;  4OPD A;  3UOZ A;  2IID A;  3BHF A;  1NAA A;  2WP5 A;  4XXG A;  5DBJ A;  3RP6 A;  2BC1 A;  1B5Q A;  4H2Q A;  4A9W A;  3K7T A;  4B63 A;  1IUW A;  4C77 A;  1CC2 A;  2CUL A;  2OLO A;  2RGH A;  3AE4 A;  2ZZC A;  1CL0 A;  1COY A;  4ECH A;  1PBC A;  2QA1 A;  2Q0K A;  2YR6 A;  4Y4L A;  1OJ9 A;  1S2Q A;  3AE2 A;  1BWC A;  2XCG A;  1LVL A;  2W0H A;  1LQU A;  2AQJ A;  1F8R A;  1L0V A;  2VQ7 A;  4A6N A;  4D03 A;  1H83 A;  2C73 A;  1O5W A;  3PS9 A;  2VVM A;  3T37 A;  2AR8 A;  2XLR A;  1ZDL A;  2A8X A;  1D5T A;  2WS3 A;  1GTH A;  1MOK A;  1LTX R;  1S3E A;  2BK5 A;  2BXR A;  2C7G A;  2PHH A;  4CRT A;  4YSX A;  3R9U A;  3F8P A;  1E1N A;  2XDO A;  2VRL A;  3II4 A;  5CQF A;  3VR8 A;  4CBQ A;  1B8S A;  4HA6 A;  3AE7 A;  1PBE A;  3IHM A;  3RED A;  3BI5 A;  3UKA A;  1VRQ B;  3D1C A;  4CY6 A;  5C2T A;  1ZP0 A;  4EQS A;  3WE0 A;  1BZL A;  1CJ4 A;  3AE8 A;  2R9Z A;  3ALJ A;  1EBD A;  4H7U A;  2ACZ A;  4J34 A;  4X4J A;  1GRB A;  1KNR A;  3NT6 A;  2JB1 A;  2YVG A;  4AP3 A;  4J56 A;  4EM4 A;  4JNA A;  1K0J A;  3O0H A;  4C74 A;  1TDE A;  1BF3 A;  1GRE A;  1IUU A;  3VRB A;  2WU5 A;  4A6N B;  4J36 A;  3NHO X;  1PBD A;  1K0I A;  5ER0 A;  4KPR A;  3AE5 A;  3VQR A;  1PJ7 A;  3AE6 A;  5JCL A;  1GRG A;  2RAB A;  2VZ2 A;  4CY8 A;  3P4Q A;  3UTG A;  1GV4 A;  3CTY A;  3FG2 P;  2WBA A;  3C4A A;  4UP3 A;  3P4P A;  4Z2R A;  2BS2 A;  3UKH A;  4A7A A;  5U63 A;  4ICY A;  1JRX A;  4BK3 A;  4U8P A;  1DOD A;  3UOY A;  1F6M A;  4H4Y A;  4I59 A;  4YKG A;  4JY2 A;  3QSE A;  2FJE A;  1TDK A;  1GAL A;  3COX A;  3NYE A;  2I0Z A;  3UKL A;  2WOV A;  3P4S A;  4A65 A;  3H8L A;  1NHS A;  2YLX A;  4U8J A;  5JCI A;  2C72 A;  3FMW A;  5BUL A;  2RGJ A;  3ITJ A;  3NIX A;  5IQ1 A;  4NTE A;  4B69 A;  1RP0 A;  4K22 A;  4MJW A;  3ICR A;  4UDR A;  1TDO A;  4GF7 A;  1CJ2 A;  1GT8 A;  3IWA A;  2WP6 A;  5M10 A;  1LJ1 A;  2GF3 A;  2C70 A;  1GRT A;  2GVC A;  2YVJ A;  3GWD A;  3PO7 A;  4HB9 A;  4K8D A;  5U1O A;  1ELI A;  3GD3 A;  4B66 A;  4REK A;  4XWR A;  1DNC A;  2WPF A;  4H4Q A;  4CNJ A;  2DKI A;  3DA1 A;  1ZKQ A;  5JCM A;  2H89 A;  2V3B A;  1ZOV A;  5JCK A;  2E5V A;  4WCT A;  2WP9 A;  3DJJ A;  3QFA A;  2XVF A;  1TYP A;  1YQZ A;  2XLP A;  3UKQ A;  4D04 A;  1MO9 A;  2R0G A;  4BUR A;  1DXL A;  1KSS A;  1X31 B;  4BK2 A;  2XFU A;  3AYI A;  2YWL A;  2GB0 A;  2BA9 A;  3QVR A;  3UTH A;  2GAH B;  3DGZ A;  4H4Z A;  4OPL A;  4U8O A;  3UKF A;  3EF6 A;  5HHF A;  1H86 A;  1O94 A;  2C3D A;  1JEH A;  3CGB A;  4OPG A;  5JCN A;  3AXB A;  4U8I A;  4NTD A;  4ZCC A;  1L9D A;  1Q1W A;  1PXA A;  1ZMC A;  1H82 A;  1CF3 A;  2WQY A;  2B7S A;  5EOW A;  3KPF A;  4PAB A;  3QVP A;  2GMH A;  4H4R A;  3H8I A;  4E0V A;  1RSG A;  4UDQ A;  4FX9 A;  2TMD A;  1GRH A;  1KDG A;  1DOB A;  3L8K A;  2B9X A;  3DK4 A;  4TLX A;  2YVF A;  1REO A;  1PDH A;  2X99 A;  5J60 A;  1ZY8 A;  2A87 A;  5EB4 A;  1L9E A;  1QJD A;  1QLB A;  3QSS A;  4JDR A;  4YSY A;  4K2X A;  2EQ8 A;  3RP8 A;  2C3C A;  3CGC A;  1XHC A;  3GYJ A;  5U25 A;  3BNU A;  4YKF A;  4ADW A;  1D4D A;  1IUS A;  1GRF A;  3GRS A;  1DJN A;  2OLN A;  3ZYX A;  2BCG G;  2BCP A;  2XLU A;  2FJD A;  2YR4 A;  4OPU A;  4RSL A;  3UTF A;  1OJA A;  2APG A;  5M0Z A;  4B68 A;  1BKW A;  1NG4 A;  2X8C A;  1S2Y A;  2VVL A;  4BJY A;  2WHD A;  2WU2 A;  4U2L A;  1E39 A;  2XYO A;  1OJT A;  3NRN A;  3NYC A;  3AE1 A;  3BHK A;  4DSG A;  3QSM A;  5FS6 A;  2B7R A;  2A89 A;  1KFY A;  1PJ5 A;  3QFB A;  5GRT A;  4C3Y A;  3DJD A;  4CCQ A;  1BGN A;  1JRY A;  3F8R A;  2BS3 A;  2V6O A;  1GES A;  3V3O A;  1JNZ A;  1N4V A;  4H50 A;  3KD9 A;  1JNR A;  4H4W A;  4DNA A;  3LZW A;  4Z44 A;  1GXF A;  4NEV A;  4YSZ A;  3ZDN A;  4U2S A;  1TYT A;  1OJD A;  4EIQ A;  2C66 A;  1F8W A;  1CHU A;  2BK3 A;  4YTN A;  3IHG A;  4Y4M A;  4N9X A;  1E1M A;  2X8G A;  3ISH A;  3L1R A;  3AEB A;  2OAM A;  1FOH A;  3K7Q X;  4H2R A;  1DOC A;  1KNP A;  2XVI A;  1ZK7 A;  3UCL A;  3ALL A;  4AP1 A;  1B4V A;  3B6D A;  1DJQ A;  1CC6 A;  1NHQ A;  1PBB A;  3IF9 A;  1LPF A;  3NYF A;  1NEK A;  3I3L A;  4TM1 A;  4EQW A;  5EBK A;  1D4E A;  2YG7 A;  2GQF A;  4B1B A;  1GEU A;  3CGE A;  1GND A;  2Q7V A;  4EMJ A;  2OA1 A;  2UZZ A;  5KWF A;  2FJB A;  2YLT A;  3KU9 A;  2E4G A;  5FMH A;  4YT0 A;  1SEZ A;  2C64 A;  4X9N A;  4Z25 A;  3SM8 A;  4NEW A;  2XVH A;  2TPR A;  3FPZ A;  3S5W A;  3UP5 A;  2V61 A;  3AED A;  4O5Q A;  4WX1 A;  2C65 A;  3NH3 X;  4GCM A;  1TDN A;  4TM0 A;  4AOS A;  4CNK A;  4K5R A;  2B9W A;  1VG9 A;  3K30 A;  3NNE A;  4AT0 A;  4DGK A;  1ZOY A;  3Q6J A;  3AEG A;  1VDC A;  3E1T A;  1EL5 A;  2IVD A;  4BV6 A;  1CBO A;  3BI2 A;  2QA2 A;  1PXC A;  3C4N A;  4IA6 A;  5KRQ A;  3G5S A;  1NG3 A;  3URH A;  3BI4 A;  4YTP A;  2YM2 A;  4H4U A;  3AE9 A;  1XAN A;  2R45 A;  2WDV A;  1FCD A;  2YQU A;  1NHP A;  1F8S A;  3EAO A;  2YLZ A;  4K7Z A;  1P2H A;  1TDF A;  3RNM A;  2WDQ A;  3GD4 A;  3M0O A;  4APN A;  1B37 A;  3DJG X;  2VQB A;  3GWF A;  3CNT A;  4BJZ A;  1V59 A;  2BAB A;  4U2T A;  1PJ6 A;  1Q1R A;  2WOW A;  3GSI A;  3HZL A;  4IA5 A;  3KLJ A;  4EQR A;  5IQ4 A;  3LXD A;  2BXS A;  1N4U A;  4USR A;  1IUV A;  2ZZ0 A;  4IV9 A;  4YSH A;  1H6V A;  2Z5Y A;  3K7M X;  3V76 A;  1Y0P A;  1YY5 A;  2X3N A;  3AB1 A;  3ADA B;  4UDP A;  1ZMD A;  3SGL A;  2ZBW A;  2VRM A;  2GV8 A;  1QO8 A;  3LB8 A;  2XLT A;  4JY3 A;  3IC9 A;  4NTC A;  1GER A;  4EIP A;  1GOS A;  1H84 A;  3P1W A;  4H4S A;  1N4W A;  2XFP A;  1EL9 A;  5LV9 A;  3UKP A;  4J31 A;  2B76 A;  2VVL G;  3VR9 A;  4CCR A;  3GDP A;  4B64 A;  5KVI A;  1XPQ A;  1EL7 A;  1BGJ A;  4J33 A;  2GR1 A;  1L9C A;  1YQ3 A;  3AEA A;  1JOA A;  2WEU A;  1LV0 A;  4U8K A;  2GRT A;  1E7P A;  4U8L A;  3UOV A;  2B9Y A;  1NPX A;  3AEF A;  2C76 A;  1PN0 A;  4Z26 A;  3DGH A;  4H2N A;  1GSN A;  4IVO B;  4RG4 A;  5KOW A;  3JSK A;  4OPT A;  2NPX A;  3NG7 X;  1FEB A;  3DH9 A;  4ZCD A;  2X50 A;  3NK1 X;  1Z6L A;  3CNJ A;  1Q9I A;  1RYI A;  4OPC A;  3D8X A;  3LOV A;  3NKS A;  2YLW A;  2C75 A;  2YAU A;  1GRA A;  1M6I A;  3DJE A;  2JAE A;  1KF6 A;  3UP4 A;  4XWZ A;  1DOE A;  4OCG A;  3G5Q A;  3Q9T A;  1Y56 A;  2GAG B;  3NTD A;  2XFN A;  3LAD A;  3P4R A;  2EQ7 A;  5EB5 A;  2XVJ A;  1JRZ A;  3CN8 A;  4ZN0 A;  1IUT A;  2R0P A;  3DK8 A;  4OPI A;  2VOU A;  5J7X A;  2EQ9 A;  2RGO A;  3NLC A;  4K5S A;  4IVM B;  3ABV A;  3GDN A;  3PVC A;  3ATQ A;  2YG3 A;  3AYL A;  3FBS A;  3KKJ A;  3KVE A;  3M13 A;  2Q6U A;  2JKC A;  3RP7 A;  3SQP A;  1NDA A;  3B3R A;  5KXJ A;  1LQT A;  3QJ4 A;  2CVJ A;  4M52 A;  1TRB A;  2JBV A;  1GPE A;  2GR0 A;  2BAC A;  2JK6 A;  4J57 A;  5GSN A;  3VRD B;  3BNM A;  4C3X A;  1PHH A;  4LA1 A;  1PBF A;  2R4E A;  2H88 A;  1Y56 B;  3I6D A;  1NHR A;  4U8M A;  1H7W A;  3NN6 X;  3AE3 A;  2WET A;  4BK1 A;  2AAQ A;  4A5L A;  2XFO A;  2YLR A;  4EQX A;  2FBW A;  5BUK A;  2C67 A;  3CNP A;  4Z43 A;  1GET A;  2Z5X A;  5L46 A;  1KSU A;  1K0L A;  1FL2 A;  1OJC A;  3CPI G;  4FK1 C;  4EM3 A;  2WPE A;  5KOX A;  1F3P A;  3DME A;  2XFQ A;  2R46 A;  3M12 A;  5KVH A;  2V60 A;  1P2E A;  4H4X A;  4Y4N A;  1YQ4 A;  4KX6 A;  2V3A A;  4A99 A;  2X8H A;  3VRA A;  2QAE A;  3S61 A;  5HYM A;  1S3B A;  2O9Z A;  4U8N A;  1ZX9 A;  2F5Z A;  3H4K A;  3LJP A;  5FS9 A;  2BS4 A;  1EL8 A;  3LZX A;  4J2W A;  3NK0 X;  4TM3 A;  2CFY A;  2YR5 A;  2OAL A;  2YM1 A;  4AOX A;  1AOG A;  1ONF A;  4TM4 A;  4GDP A;  1N1P A;  2J3N A;  2R4J A;  1PS9 A;  1M64 A;  3FIM B;  2Y6Q A;  2BC0 A;  1H81 A;  2GMJ A;  3NGC X;  2JB2 A;  2IVE A;  4JNQ A;  4AT2 A;  2XLS A;  5CKU A;  3UTE A;  3EPT A;  2XVE A;  3OZ2 A;  3NK2 X;  3AWI A;  2DKH A;  2WOI A;  4YXD A;  1IJH A;  3DK9 A;  3UKK A;  2Y6R A;  4EMI A;  2YG6 A;  3SFE A;  1UKV G;  4P9S A;  1FEA A;  1VQW A;  1CJC A;  1O95 A;  3CIR A;  2EQ6 A;  4YTM A;  1MXT A;  3AYJ A;  2QCU A;  4Z24 A;  4O5U A;  1YKJ A;  3AEC A;  3ALM A;  3ICT A;  2GEW A;  1IUX A;  4H4P A;  4LII A;  4USQ A;  2GR2 A;  1E6E A;  2WES A;  4FDC B;  4FK1 A;  4GR1 A;  3CPH G;  4X9M A;  3F8D A;  2BK4 A;  2GR3 A;  1HYU A;  3EAN A;  4NZH A;  4Z2U A;  2YG4 A;  5IPY A;  2GH5 A;  4DSH A;  2WDR A;  4GRT A;  1D7L A;  3GRT A;  3ATR A;  5HY5 A;  4H4V A;  5HXI A;  3C96 A;  3NTA A;  1JU2 A;  1NEN A;  2YG5 A;  1VG0 A;  2V5Z A;  3RHA A;  4TLZ A;  4B67 A;  2BYB A;  1E1K A;  2FJA A;  2HQM A;  4LU6 A;  5FS8 A;  3V3N A;  5FS7 A;  2Q0L A;  4Z2T A;  3UOX A;  4OVI A;  5BRT A;  3G5R A; 
#chains in the Genus database with same CATH topology
 5C3J A;  2CDU A;  2E1M A;  3AD9 B;  4G6G A;  1E1L A;  3GMC A;  3SFD A;  4H4T A;  1XDI A;  3CPJ G;  1D4C A;  3AEE A;  4H2P A;  1CJ3 A;  3CND A;  3NN0 X;  2R0C A;  1D7Y A;  3GYI A;  3KA7 A;  5KMR A;  4GUV A;  4I58 A;  5KNL A;  2JB3 A;  4JQ9 A;  3SZC A;  3OC4 A;  2GQW A;  2WPC A;  1W4X A;  4A79 A;  1K4Q A;  2ARD A;  4RG3 A;  2NVK X;  3ICS A;  3AD7 B;  4JN9 A;  1FEC A;  5TR3 A;  3P9U A;  3CGD A;  3CNS A;  1PXB A;  4GDE A;  3AD8 B;  3GMB A;  4B65 A;  2PYX A;  1H7X A;  4EMW A;  4C5O A;  4YWO A;  4PAA A;  2ZZB A;  5BVA A;  2YLS A;  1GTE A;  1CC4 A;  4OPD A;  3UOZ A;  2IID A;  3BHF A;  1NAA A;  2WP5 A;  4XXG A;  5DBJ A;  3RP6 A;  2BC1 A;  1B5Q A;  4H2Q A;  4A9W A;  3K7T A;  4B63 A;  1IUW A;  4C77 A;  1CC2 A;  2CUL A;  2OLO A;  2RGH A;  3AE4 A;  2ZZC A;  1CL0 A;  1COY A;  4ECH A;  1PBC A;  2QA1 A;  2Q0K A;  2YR6 A;  4Y4L A;  1OJ9 A;  1S2Q A;  3AE2 A;  1BWC A;  2XCG A;  1LVL A;  2W0H A;  1LQU A;  4GAV A;  2AQJ A;  1F8R A;  4B66 A;  1L0V A;  2VQ7 A;  4A6N A;  4D03 A;  1H83 A;  2C73 A;  1O5W A;  3PS9 A;  2VVM A;  3T37 A;  2AR8 A;  2XLR A;  1ZDL A;  2A8X A;  1D5T A;  2WS3 A;  3T31 A;  3KPK A;  1GTH A;  1MOK A;  1LTX R;  1S3E A;  2BK5 A;  2BXR A;  2C7G A;  2PHH A;  4CRT A;  4YSX A;  3R9U A;  3F8P A;  1E1N A;  2XDO A;  2VRL A;  3II4 A;  5CQF A;  3VR8 A;  4CBQ A;  1B8S A;  4HA6 A;  3AE7 A;  1PBE A;  3IHM A;  3RED A;  3BI5 A;  3UKA A;  1VRQ B;  3D1C A;  4CY6 A;  5C2T A;  1ZP0 A;  4EQS A;  3WE0 A;  1BZL A;  1CJ4 A;  3AE8 A;  2R9Z A;  3ALJ A;  1EBD A;  4H7U A;  2ACZ A;  4J34 A;  4X4J A;  1GRB A;  1KNR A;  3NT6 A;  2JB1 A;  2YVG A;  4G74 A;  4AP3 A;  4J56 A;  4EM4 A;  4JNA A;  1K0J A;  3O0H A;  4C74 A;  1TDE A;  1BF3 A;  1GRE A;  1IUU A;  3VRB A;  2WU5 A;  4A6N B;  4J36 A;  3NHO X;  1PBD A;  1K0I A;  5ER0 A;  4KPR A;  3AE5 A;  3VQR A;  1PJ7 A;  3AE6 A;  5JCL A;  3T2K A;  1GRG A;  2RAB A;  2VZ2 A;  4CY8 A;  3P4Q A;  3UTG A;  1GV4 A;  3CTY A;  3FG2 P;  2WBA A;  3C4A A;  4UP3 A;  3P4P A;  4Z2R A;  2BS2 A;  3UKH A;  3SZW A;  4A7A A;  5U63 A;  4ICY A;  1JRX A;  3SX6 A;  4BK3 A;  4U8P A;  1DOD A;  3UOY A;  1F6M A;  4H4Y A;  4I59 A;  4YKG A;  4JY2 A;  3QSE A;  2FJE A;  1TDK A;  1GAL A;  3COX A;  3NYE A;  2I0Z A;  3UKL A;  2WOV A;  3P4S A;  4A65 A;  3H8L A;  1NHS A;  2YLX A;  4U8J A;  5JCI A;  2C72 A;  3FMW A;  5BUL A;  2RGJ A;  3ITJ A;  3NIX A;  3T14 A;  5IQ1 A;  4NTE A;  4B69 A;  1RP0 A;  4K22 A;  4MJW A;  3ICR A;  4UDR A;  1TDO A;  4GF7 A;  1CJ2 A;  1GT8 A;  3IWA A;  2WP6 A;  5M10 A;  1LJ1 A;  2GF3 A;  2C70 A;  1GRT A;  2GVC A;  2YVJ A;  3GWD A;  3HYW A;  3PO7 A;  4HB9 A;  4K8D A;  1ELI A;  3GD3 A;  5U1O A;  4REK A;  4XWR A;  1DNC A;  2WPF A;  4H4Q A;  4CNJ A;  2DKI A;  3DA1 A;  1ZKQ A;  5JCM A;  2H89 A;  2V3B A;  1ZOV A;  2BRA A;  2E5V A;  5JCK A;  4WCT A;  2WP9 A;  3DJJ A;  3QFA A;  2XVF A;  1TYP A;  1YQZ A;  2XLP A;  3UKQ A;  4D04 A;  1MO9 A;  2R0G A;  4BUR A;  1DXL A;  1KSS A;  1X31 B;  4BK2 A;  2XFU A;  3AYI A;  2YWL A;  2GB0 A;  2BA9 A;  5KMS A;  3QVR A;  3UTH A;  2GAH B;  3DGZ A;  4H4Z A;  4OPL A;  4U8O A;  3UKF A;  3EF6 A;  5HHF A;  1H86 A;  1O94 A;  2C3D A;  1JEH A;  3CGB A;  4OPG A;  5JCN A;  3AXB A;  3SZ0 A;  4U8I A;  4NTD A;  4ZCC A;  1L9D A;  1Q1W A;  1PXA A;  1ZMC A;  1H82 A;  1CF3 A;  2WQY A;  2B7S A;  5EOW A;  3KPF A;  4PAB A;  3QVP A;  2GMH A;  4H4R A;  3H8I A;  4E0V A;  1RSG A;  4UDQ A;  4FX9 A;  2TMD A;  1GRH A;  1KDG A;  1DOB A;  3L8K A;  2B9X A;  3DK4 A;  4TLX A;  2YVF A;  4II3 A;  1REO A;  4G6H A;  1PDH A;  2X99 A;  5J60 A;  1ZY8 A;  2A87 A;  5EB4 A;  1L9E A;  1QJD A;  1QLB A;  3QSS A;  4JDR A;  4YSY A;  4K2X A;  2EQ8 A;  3RP8 A;  2C3C A;  3CGC A;  1XHC A;  3GYJ A;  5U25 A;  3BNU A;  4YKF A;  4ADW A;  1D4D A;  1IUS A;  1GRF A;  3GRS A;  1DJN A;  2OLN A;  3ZYX A;  2BCG G;  2BCP A;  2XLU A;  2FJD A;  2YR4 A;  4OPU A;  4RSL A;  3UTF A;  1OJA A;  2APG A;  3GYX A;  5M0Z A;  4B68 A;  1BKW A;  1NG4 A;  2X8C A;  1S2Y A;  2VVL A;  4BJY A;  2WHD A;  2WU2 A;  4U2L A;  1E39 A;  2XYO A;  1OJT A;  3NRN A;  3NYC A;  3AE1 A;  3BHK A;  4DSG A;  4G9K A;  3QSM A;  5FS6 A;  2B7R A;  2A89 A;  1KFY A;  1PJ5 A;  3QFB A;  5GRT A;  4C3Y A;  3DJD A;  4CCQ A;  1BGN A;  1JRY A;  3F8R A;  2BS3 A;  2V6O A;  1GES A;  3V3O A;  1JNZ A;  1N4V A;  4H50 A;  3KD9 A;  1JNR A;  4H4W A;  4DNA A;  3LZW A;  4Z44 A;  1GXF A;  4NEV A;  4YSZ A;  3ZDN A;  4U2S A;  1TYT A;  1OJD A;  4EIQ A;  2C66 A;  1F8W A;  1CHU A;  2BK3 A;  4YTN A;  3IHG A;  4Y4M A;  4N9X A;  1E1M A;  2X8G A;  3ISH A;  3L1R A;  3AEB A;  2OAM A;  1FOH A;  3K7Q X;  4H2R A;  1DOC A;  1KNP A;  2XVI A;  1ZK7 A;  3UCL A;  3ALL A;  4AP1 A;  1B4V A;  3B6D A;  1DJQ A;  1CC6 A;  1NHQ A;  1PBB A;  3IF9 A;  1LPF A;  3NYF A;  1NEK A;  3I3L A;  4TM1 A;  4EQW A;  5EBK A;  1D4E A;  2YG7 A;  2GQF A;  4B1B A;  1GEU A;  3CGE A;  1GND A;  2Q7V A;  4EMJ A;  2OA1 A;  2UZZ A;  5KWF A;  2FJB A;  2YLT A;  3KU9 A;  2E4G A;  5FMH A;  4YT0 A;  1SEZ A;  2C64 A;  4X9N A;  4Z25 A;  3SM8 A;  4NEW A;  2XVH A;  2TPR A;  3FPZ A;  3HYX A;  3S5W A;  3UP5 A;  2V61 A;  3AED A;  4O5Q A;  4WX1 A;  2C65 A;  3NH3 X;  4GCM A;  1TDN A;  4TM0 A;  4AOS A;  4CNK A;  4K5R A;  2B9W A;  1VG9 A;  3K30 A;  3NNE A;  4AT0 A;  4DGK A;  1ZOY A;  3Q6J A;  3AEG A;  1VDC A;  3E1T A;  1EL5 A;  2IVD A;  4BV6 A;  1CBO A;  3BI2 A;  2QA2 A;  1PXC A;  3C4N A;  4IA6 A;  5KRQ A;  3T2Z A;  3G5S A;  1NG3 A;  3URH A;  3BI4 A;  4YTP A;  2YM2 A;  4H4U A;  3AE9 A;  1XAN A;  2R45 A;  2WDV A;  1FCD A;  2YQU A;  1NHP A;  1F8S A;  3EAO A;  2YLZ A;  4K7Z A;  1P2H A;  1TDF A;  3RNM A;  2WDQ A;  3GD4 A;  3M0O A;  4APN A;  1B37 A;  3DJG X;  2VQB A;  3GWF A;  3CNT A;  4BJZ A;  1V59 A;  2BAB A;  4U2T A;  1PJ6 A;  1Q1R A;  2WOW A;  3GSI A;  3HZL A;  4IA5 A;  3KLJ A;  4EQR A;  5IQ4 A;  3LXD A;  2BXS A;  1N4U A;  4USR A;  1IUV A;  2ZZ0 A;  4IV9 A;  4YSH A;  1H6V A;  2Z5Y A;  3K7M X;  3V76 A;  1Y0P A;  1YY5 A;  2X3N A;  3AB1 A;  3ADA B;  4UDP A;  1ZMD A;  3SGL A;  2ZBW A;  2VRM A;  2GV8 A;  1QO8 A;  3LB8 A;  2XLT A;  4JY3 A;  3IC9 A;  4NTC A;  4NNJ A;  1GER A;  4EIP A;  5KMP A;  1GOS A;  1H84 A;  3P1W A;  4H4S A;  1N4W A;  2XFP A;  1EL9 A;  5LV9 A;  3UKP A;  4J31 A;  2B76 A;  2VVL G;  3VR9 A;  4CCR A;  3GDP A;  4B64 A;  5KVI A;  1XPQ A;  1EL7 A;  1BGJ A;  4J33 A;  3SY4 A;  2GR1 A;  1L9C A;  1YQ3 A;  3AEA A;  1JOA A;  2WEU A;  1LV0 A;  4U8K A;  2GRT A;  1E7P A;  4U8L A;  3UOV A;  2B9Y A;  1NPX A;  3AEF A;  2C76 A;  1PN0 A;  3SZF A;  3DGH A;  4H2N A;  4Z26 A;  1GSN A;  4IVO B;  4RG4 A;  3CMM A;  3JSK A;  4GAP A;  4OPT A;  2NPX A;  3NG7 X;  1FEB A;  5KOW A;  3DH9 A;  4ZCD A;  2X50 A;  3NK1 X;  1Z6L A;  3CNJ A;  1Q9I A;  1RYI A;  4OPC A;  3D8X A;  3LOV A;  3NKS A;  2YLW A;  2C75 A;  2YAU A;  1GRA A;  1M6I A;  3DJE A;  2JAE A;  1KF6 A;  3UP4 A;  4XWZ A;  1DOE A;  4OCG A;  3G5Q A;  3Q9T A;  1Y56 A;  2GAG B;  3NTD A;  2XFN A;  3LAD A;  2BRY A;  3P4R A;  2EQ7 A;  5EB5 A;  2XVJ A;  1JRZ A;  3CN8 A;  3T2Y A;  4ZN0 A;  1IUT A;  2R0P A;  3DK8 A;  4OPI A;  2VOU A;  5J7X A;  2EQ9 A;  2RGO A;  3NLC A;  4K5S A;  4IVM B;  3ABV A;  3GDN A;  3PVC A;  3ATQ A;  2YG3 A;  3AYL A;  3FBS A;  3KKJ A;  3KVE A;  3M13 A;  2Q6U A;  2JKC A;  3RP7 A;  3SQP A;  3T0K A;  1NDA A;  3B3R A;  5KXJ A;  1LQT A;  3QJ4 A;  2CVJ A;  4M52 A;  1TRB A;  2JBV A;  1GPE A;  2GR0 A;  2BAC A;  2JK6 A;  4J57 A;  5GSN A;  3VRD B;  3BNM A;  4C3X A;  1PHH A;  4LA1 A;  1PBF A;  2R4E A;  2H88 A;  1Y56 B;  3I6D A;  1NHR A;  4U8M A;  1H7W A;  3NN6 X;  3AE3 A;  2WET A;  4BK1 A;  2AAQ A;  4A5L A;  2XFO A;  2YLR A;  4EQX A;  2FBW A;  5BUK A;  2C67 A;  3CNP A;  4Z43 A;  1GET A;  2Z5X A;  5L46 A;  1KSU A;  1K0L A;  1FL2 A;  1OJC A;  3CPI G;  4FK1 C;  5KMQ A;  3SXI A;  4EM3 A;  2WPE A;  5KOX A;  1F3P A;  3DME A;  2XFQ A;  2R46 A;  3M12 A;  5KVH A;  2V60 A;  1P2E A;  4H4X A;  4Y4N A;  1YQ4 A;  4KX6 A;  2V3A A;  4A99 A;  2X8H A;  3VRA A;  2QAE A;  3S61 A;  5HYM A;  1S3B A;  2O9Z A;  4U8N A;  1ZX9 A;  2F5Z A;  3H4K A;  3LJP A;  5FS9 A;  2BS4 A;  1EL8 A;  3LZX A;  4J2W A;  3NK0 X;  4TM3 A;  2CFY A;  2YR5 A;  2OAL A;  2YM1 A;  4AOX A;  1AOG A;  1ONF A;  4TM4 A;  4GDP A;  1N1P A;  2J3N A;  2R4J A;  1PS9 A;  1M64 A;  3FIM B;  2Y6Q A;  2BC0 A;  4II2 A;  1H81 A;  2GMJ A;  3NGC X;  2JB2 A;  2IVE A;  4JNQ A;  4AT2 A;  4NWZ A;  2XLS A;  5CKU A;  3UTE A;  3EPT A;  2XVE A;  3OZ2 A;  3NK2 X;  3AWI A;  2DKH A;  2WOI A;  4YXD A;  1IJH A;  3DK9 A;  3UKK A;  2Y6R A;  4EMI A;  2YG6 A;  3SFE A;  1UKV G;  4P9S A;  1FEA A;  4G73 A;  3SYI A;  1VQW A;  1CJC A;  1O95 A;  3CIR A;  2EQ6 A;  4YTM A;  1MXT A;  3AYJ A;  2QCU A;  4Z24 A;  4O5U A;  1YKJ A;  3AEC A;  3ALM A;  3ICT A;  2GEW A;  1IUX A;  4H4P A;  4LII A;  4USQ A;  2GR2 A;  1E6E A;  2WES A;  4FDC B;  4FK1 A;  4GR1 A;  3CPH G;  4X9M A;  3F8D A;  2BK4 A;  2GR3 A;  1HYU A;  3EAN A;  4NZH A;  4Z2U A;  2YG4 A;  5IPY A;  2GH5 A;  4DSH A;  2WDR A;  4GRT A;  1D7L A;  3GRT A;  2C4C A;  3ATR A;  5HY5 A;  4H4V A;  5HXI A;  3C96 A;  3NTA A;  1JU2 A;  1NEN A;  2YG5 A;  1VG0 A;  2V5Z A;  3RHA A;  4TLZ A;  4B67 A;  2BYB A;  1E1K A;  2FJA A;  2HQM A;  4LU6 A;  5FS8 A;  3V3N A;  5FS7 A;  2Q0L A;  4Z2T A;  3UOX A;  4OVI A;  5BRT A;  3HYV A;  3G5R A; 
#chains in the Genus database with same CATH homology
 5C3J A;  2CDU A;  2E1M A;  3AD9 B;  4G6G A;  1E1L A;  3GMC A;  3SFD A;  4H4T A;  1XDI A;  3CPJ G;  1D4C A;  3AEE A;  4H2P A;  1CJ3 A;  3CND A;  3NN0 X;  2R0C A;  1D7Y A;  3GYI A;  3KA7 A;  5KMR A;  4GUV A;  4I58 A;  5KNL A;  2JB3 A;  4JQ9 A;  3SZC A;  3OC4 A;  2GQW A;  2WPC A;  1W4X A;  4A79 A;  1K4Q A;  2ARD A;  4RG3 A;  2NVK X;  3ICS A;  3AD7 B;  4JN9 A;  1FEC A;  5TR3 A;  3P9U A;  3CGD A;  3CNS A;  1PXB A;  4GDE A;  3AD8 B;  3GMB A;  4B65 A;  2PYX A;  1H7X A;  4EMW A;  4C5O A;  4YWO A;  4PAA A;  2ZZB A;  5BVA A;  2YLS A;  1GTE A;  1CC4 A;  4OPD A;  3UOZ A;  2IID A;  3BHF A;  1NAA A;  2WP5 A;  4XXG A;  5DBJ A;  3RP6 A;  2BC1 A;  1B5Q A;  4H2Q A;  4A9W A;  3K7T A;  4B63 A;  1IUW A;  4C77 A;  1CC2 A;  2CUL A;  2OLO A;  2RGH A;  3AE4 A;  2ZZC A;  1CL0 A;  1COY A;  4ECH A;  1PBC A;  2QA1 A;  2Q0K A;  2YR6 A;  4Y4L A;  1OJ9 A;  1S2Q A;  3AE2 A;  1BWC A;  2XCG A;  1LVL A;  2W0H A;  1LQU A;  4GAV A;  2AQJ A;  1F8R A;  4B66 A;  1L0V A;  2VQ7 A;  4A6N A;  4D03 A;  1H83 A;  2C73 A;  1O5W A;  3PS9 A;  2VVM A;  3T37 A;  2AR8 A;  2XLR A;  1ZDL A;  2A8X A;  1D5T A;  2WS3 A;  3T31 A;  3KPK A;  1GTH A;  1MOK A;  1LTX R;  1S3E A;  2BK5 A;  2BXR A;  2C7G A;  2PHH A;  4CRT A;  4YSX A;  3R9U A;  3F8P A;  1E1N A;  2XDO A;  2VRL A;  3II4 A;  5CQF A;  3VR8 A;  4CBQ A;  1B8S A;  4HA6 A;  3AE7 A;  1PBE A;  3IHM A;  3RED A;  3BI5 A;  3UKA A;  1VRQ B;  3D1C A;  4CY6 A;  5C2T A;  1ZP0 A;  4EQS A;  3WE0 A;  1BZL A;  1CJ4 A;  3AE8 A;  2R9Z A;  3ALJ A;  1EBD A;  4H7U A;  2ACZ A;  4J34 A;  4X4J A;  1GRB A;  1KNR A;  3NT6 A;  2JB1 A;  2YVG A;  4G74 A;  4AP3 A;  4J56 A;  4EM4 A;  4JNA A;  1K0J A;  3O0H A;  4C74 A;  1TDE A;  1BF3 A;  1GRE A;  1IUU A;  3VRB A;  2WU5 A;  4A6N B;  4J36 A;  3NHO X;  1PBD A;  1K0I A;  5ER0 A;  4KPR A;  3AE5 A;  3VQR A;  1PJ7 A;  3AE6 A;  5JCL A;  3T2K A;  1GRG A;  2RAB A;  2VZ2 A;  4CY8 A;  3P4Q A;  3UTG A;  1GV4 A;  3CTY A;  3FG2 P;  2WBA A;  3C4A A;  4UP3 A;  3P4P A;  4Z2R A;  2BS2 A;  3UKH A;  3SZW A;  4A7A A;  5U63 A;  4ICY A;  1JRX A;  3SX6 A;  4BK3 A;  4U8P A;  1DOD A;  3UOY A;  1F6M A;  4H4Y A;  4I59 A;  4YKG A;  4JY2 A;  3QSE A;  2FJE A;  1TDK A;  1GAL A;  3COX A;  3NYE A;  2I0Z A;  3UKL A;  2WOV A;  3P4S A;  4A65 A;  3H8L A;  1NHS A;  2YLX A;  4U8J A;  5JCI A;  2C72 A;  3FMW A;  5BUL A;  2RGJ A;  3ITJ A;  3NIX A;  3T14 A;  5IQ1 A;  4NTE A;  4B69 A;  1RP0 A;  4K22 A;  4MJW A;  3ICR A;  4UDR A;  1TDO A;  4GF7 A;  1CJ2 A;  1GT8 A;  3IWA A;  2WP6 A;  5M10 A;  1LJ1 A;  2GF3 A;  2C70 A;  1GRT A;  2GVC A;  2YVJ A;  3GWD A;  3HYW A;  3PO7 A;  4HB9 A;  4K8D A;  1ELI A;  3GD3 A;  5U1O A;  4REK A;  4XWR A;  1DNC A;  2WPF A;  4H4Q A;  4CNJ A;  2DKI A;  3DA1 A;  1ZKQ A;  5JCM A;  2H89 A;  2V3B A;  1ZOV A;  2BRA A;  2E5V A;  5JCK A;  4WCT A;  2WP9 A;  3DJJ A;  3QFA A;  2XVF A;  1TYP A;  1YQZ A;  2XLP A;  3UKQ A;  4D04 A;  1MO9 A;  2R0G A;  4BUR A;  1DXL A;  1KSS A;  1X31 B;  4BK2 A;  2XFU A;  3AYI A;  2YWL A;  2GB0 A;  2BA9 A;  5KMS A;  3QVR A;  3UTH A;  2GAH B;  3DGZ A;  4H4Z A;  4OPL A;  4U8O A;  3UKF A;  3EF6 A;  5HHF A;  1H86 A;  1O94 A;  2C3D A;  1JEH A;  3CGB A;  4OPG A;  5JCN A;  3AXB A;  3SZ0 A;  4U8I A;  4NTD A;  4ZCC A;  1L9D A;  1Q1W A;  1PXA A;  1ZMC A;  1H82 A;  1CF3 A;  2WQY A;  2B7S A;  5EOW A;  3KPF A;  4PAB A;  3QVP A;  2GMH A;  4H4R A;  3H8I A;  4E0V A;  1RSG A;  4UDQ A;  4FX9 A;  2TMD A;  1GRH A;  1KDG A;  1DOB A;  3L8K A;  2B9X A;  3DK4 A;  4TLX A;  2YVF A;  4II3 A;  1REO A;  4G6H A;  1PDH A;  2X99 A;  5J60 A;  1ZY8 A;  2A87 A;  5EB4 A;  1L9E A;  1QJD A;  1QLB A;  3QSS A;  4JDR A;  4YSY A;  4K2X A;  2EQ8 A;  3RP8 A;  2C3C A;  3CGC A;  1XHC A;  3GYJ A;  5U25 A;  3BNU A;  4YKF A;  4ADW A;  1D4D A;  1IUS A;  1GRF A;  3GRS A;  1DJN A;  2OLN A;  3ZYX A;  2BCG G;  2BCP A;  2XLU A;  2FJD A;  2YR4 A;  4OPU A;  4RSL A;  3UTF A;  1OJA A;  2APG A;  3GYX A;  5M0Z A;  4B68 A;  1BKW A;  1NG4 A;  2X8C A;  1S2Y A;  2VVL A;  4BJY A;  2WHD A;  2WU2 A;  4U2L A;  1E39 A;  2XYO A;  1OJT A;  3NRN A;  3NYC A;  3AE1 A;  3BHK A;  4DSG A;  4G9K A;  3QSM A;  5FS6 A;  2B7R A;  2A89 A;  1KFY A;  1PJ5 A;  3QFB A;  5GRT A;  4C3Y A;  3DJD A;  4CCQ A;  1BGN A;  1JRY A;  3F8R A;  2BS3 A;  2V6O A;  1GES A;  3V3O A;  1JNZ A;  1N4V A;  4H50 A;  3KD9 A;  1JNR A;  4H4W A;  4DNA A;  3LZW A;  4Z44 A;  1GXF A;  4NEV A;  4YSZ A;  3ZDN A;  4U2S A;  1TYT A;  1OJD A;  4EIQ A;  2C66 A;  1F8W A;  1CHU A;  2BK3 A;  4YTN A;  3IHG A;  4Y4M A;  4N9X A;  1E1M A;  2X8G A;  3ISH A;  3L1R A;  3AEB A;  2OAM A;  1FOH A;  3K7Q X;  4H2R A;  1DOC A;  1KNP A;  2XVI A;  1ZK7 A;  3UCL A;  3ALL A;  4AP1 A;  1B4V A;  3B6D A;  1DJQ A;  1CC6 A;  1NHQ A;  1PBB A;  3IF9 A;  1LPF A;  3NYF A;  1NEK A;  3I3L A;  4TM1 A;  4EQW A;  5EBK A;  1D4E A;  2YG7 A;  2GQF A;  4B1B A;  1GEU A;  3CGE A;  1GND A;  2Q7V A;  4EMJ A;  2OA1 A;  2UZZ A;  5KWF A;  2FJB A;  2YLT A;  3KU9 A;  2E4G A;  5FMH A;  4YT0 A;  1SEZ A;  2C64 A;  4X9N A;  4Z25 A;  3SM8 A;  4NEW A;  2XVH A;  2TPR A;  3FPZ A;  3HYX A;  3S5W A;  3UP5 A;  2V61 A;  3AED A;  4O5Q A;  4WX1 A;  2C65 A;  3NH3 X;  4GCM A;  1TDN A;  4TM0 A;  4AOS A;  4CNK A;  4K5R A;  2B9W A;  1VG9 A;  3K30 A;  3NNE A;  4AT0 A;  4DGK A;  1ZOY A;  3Q6J A;  3AEG A;  1VDC A;  3E1T A;  1EL5 A;  2IVD A;  4BV6 A;  1CBO A;  3BI2 A;  2QA2 A;  1PXC A;  3C4N A;  4IA6 A;  5KRQ A;  3T2Z A;  3G5S A;  1NG3 A;  3URH A;  3BI4 A;  4YTP A;  2YM2 A;  4H4U A;  3AE9 A;  1XAN A;  2R45 A;  2WDV A;  1FCD A;  2YQU A;  1NHP A;  1F8S A;  3EAO A;  2YLZ A;  4K7Z A;  1P2H A;  1TDF A;  3RNM A;  2WDQ A;  3GD4 A;  3M0O A;  4APN A;  1B37 A;  3DJG X;  2VQB A;  3GWF A;  3CNT A;  4BJZ A;  1V59 A;  2BAB A;  4U2T A;  1PJ6 A;  1Q1R A;  2WOW A;  3GSI A;  3HZL A;  4IA5 A;  3KLJ A;  4EQR A;  5IQ4 A;  3LXD A;  2BXS A;  1N4U A;  4USR A;  1IUV A;  2ZZ0 A;  4IV9 A;  4YSH A;  1H6V A;  2Z5Y A;  3K7M X;  3V76 A;  1Y0P A;  1YY5 A;  2X3N A;  3AB1 A;  3ADA B;  4UDP A;  1ZMD A;  3SGL A;  2ZBW A;  2VRM A;  2GV8 A;  1QO8 A;  3LB8 A;  2XLT A;  4JY3 A;  3IC9 A;  4NTC A;  4NNJ A;  1GER A;  4EIP A;  5KMP A;  1GOS A;  1H84 A;  3P1W A;  4H4S A;  1N4W A;  2XFP A;  1EL9 A;  5LV9 A;  3UKP A;  4J31 A;  2B76 A;  2VVL G;  3VR9 A;  4CCR A;  3GDP A;  4B64 A;  5KVI A;  1XPQ A;  1EL7 A;  1BGJ A;  4J33 A;  3SY4 A;  2GR1 A;  1L9C A;  1YQ3 A;  3AEA A;  1JOA A;  2WEU A;  1LV0 A;  4U8K A;  2GRT A;  1E7P A;  4U8L A;  3UOV A;  2B9Y A;  1NPX A;  3AEF A;  2C76 A;  1PN0 A;  3SZF A;  3DGH A;  4H2N A;  4Z26 A;  1GSN A;  4IVO B;  4RG4 A;  3CMM A;  3JSK A;  4GAP A;  4OPT A;  2NPX A;  3NG7 X;  1FEB A;  5KOW A;  3DH9 A;  4ZCD A;  2X50 A;  3NK1 X;  1Z6L A;  3CNJ A;  1Q9I A;  1RYI A;  4OPC A;  3D8X A;  3LOV A;  3NKS A;  2YLW A;  2C75 A;  2YAU A;  1GRA A;  1M6I A;  3DJE A;  2JAE A;  1KF6 A;  3UP4 A;  4XWZ A;  1DOE A;  4OCG A;  3G5Q A;  3Q9T A;  1Y56 A;  2GAG B;  3NTD A;  2XFN A;  3LAD A;  2BRY A;  3P4R A;  2EQ7 A;  5EB5 A;  2XVJ A;  1JRZ A;  3CN8 A;  3T2Y A;  4ZN0 A;  1IUT A;  2R0P A;  3DK8 A;  4OPI A;  2VOU A;  5J7X A;  2EQ9 A;  2RGO A;  3NLC A;  4K5S A;  4IVM B;  3ABV A;  3GDN A;  3PVC A;  3ATQ A;  2YG3 A;  3AYL A;  3FBS A;  3KKJ A;  3KVE A;  3M13 A;  2Q6U A;  2JKC A;  3RP7 A;  3SQP A;  3T0K A;  1NDA A;  3B3R A;  5KXJ A;  1LQT A;  3QJ4 A;  2CVJ A;  4M52 A;  1TRB A;  2JBV A;  1GPE A;  2GR0 A;  2BAC A;  2JK6 A;  4J57 A;  5GSN A;  3VRD B;  3BNM A;  4C3X A;  1PHH A;  4LA1 A;  1PBF A;  2R4E A;  2H88 A;  1Y56 B;  3I6D A;  1NHR A;  4U8M A;  1H7W A;  3NN6 X;  3AE3 A;  2WET A;  4BK1 A;  2AAQ A;  4A5L A;  2XFO A;  2YLR A;  4EQX A;  2FBW A;  5BUK A;  2C67 A;  3CNP A;  4Z43 A;  1GET A;  2Z5X A;  5L46 A;  1KSU A;  1K0L A;  1FL2 A;  1OJC A;  3CPI G;  4FK1 C;  5KMQ A;  3SXI A;  4EM3 A;  2WPE A;  5KOX A;  1F3P A;  3DME A;  2XFQ A;  2R46 A;  3M12 A;  5KVH A;  2V60 A;  1P2E A;  4H4X A;  4Y4N A;  1YQ4 A;  4KX6 A;  2V3A A;  4A99 A;  2X8H A;  3VRA A;  2QAE A;  3S61 A;  5HYM A;  1S3B A;  2O9Z A;  4U8N A;  1ZX9 A;  2F5Z A;  3H4K A;  3LJP A;  5FS9 A;  2BS4 A;  1EL8 A;  3LZX A;  4J2W A;  3NK0 X;  4TM3 A;  2CFY A;  2YR5 A;  2OAL A;  2YM1 A;  4AOX A;  1AOG A;  1ONF A;  4TM4 A;  4GDP A;  1N1P A;  2J3N A;  2R4J A;  1PS9 A;  1M64 A;  3FIM B;  2Y6Q A;  2BC0 A;  4II2 A;  1H81 A;  2GMJ A;  3NGC X;  2JB2 A;  2IVE A;  4JNQ A;  4AT2 A;  4NWZ A;  2XLS A;  5CKU A;  3UTE A;  3EPT A;  2XVE A;  3OZ2 A;  3NK2 X;  3AWI A;  2DKH A;  2WOI A;  4YXD A;  1IJH A;  3DK9 A;  3UKK A;  2Y6R A;  4EMI A;  2YG6 A;  3SFE A;  1UKV G;  4P9S A;  1FEA A;  4G73 A;  3SYI A;  1VQW A;  1CJC A;  1O95 A;  3CIR A;  2EQ6 A;  4YTM A;  1MXT A;  3AYJ A;  2QCU A;  4Z24 A;  4O5U A;  1YKJ A;  3AEC A;  3ALM A;  3ICT A;  2GEW A;  1IUX A;  4H4P A;  4LII A;  4USQ A;  2GR2 A;  1E6E A;  2WES A;  4FDC B;  4FK1 A;  4GR1 A;  3CPH G;  4X9M A;  3F8D A;  2BK4 A;  2GR3 A;  1HYU A;  3EAN A;  4NZH A;  4Z2U A;  2YG4 A;  5IPY A;  2GH5 A;  4DSH A;  2WDR A;  4GRT A;  1D7L A;  3GRT A;  2C4C A;  3ATR A;  5HY5 A;  4H4V A;  5HXI A;  3C96 A;  3NTA A;  1JU2 A;  1NEN A;  2YG5 A;  1VG0 A;  2V5Z A;  3RHA A;  4TLZ A;  4B67 A;  2BYB A;  1E1K A;  2FJA A;  2HQM A;  4LU6 A;  5FS8 A;  3V3N A;  5FS7 A;  2Q0L A;  4Z2T A;  3UOX A;  4OVI A;  5BRT A;  3HYV A;  3G5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...