2CVJA

Crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
MWDVIVVGGGPSGLSAALFLARAGLKVLVLDGGRSKVKGVSRVPNYPGLLDEPSGEELLRRLEAHARRYGAEVRPGVVKGVRDMGGVFEVETEEGVEKAERLLLCTHKDPTLPSLLGLTRRGAYIDTDEGGRTSYPRVYAAGVARGKVPGHAIISAGDGAYVAVHLVSDLRGEPYKDHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords thioredoxin reductase related protein
publication title Crystal Structure of thioredoxin reductase-related protein TTHA0370 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 56
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2cvjA01
2C75A 3BI2A 3E1TA 1ZK7A 3C4NA 5HXIA 1QJDA 4JQ9A 3FIMB 1O94A 4P9SA 3UKPA 5CQFA 5GRTA 3ICRA 1BGNA 2VOUA 3GD3A 3NYCA 3P4SA 3EANA 3B6DA 3NGCX 4I58A 1Y56B 4D03A 1L9DA 3IHMA 1N4WA 3AE4A 1L9EA 3PO7A 2WOIA 2AR8A 1P2HA 4H4QA 1JEHA 1OJTA 5EBKA 3NRNA 2PHHA 1D7YA 4Y4LA 5J7XA 3D8XA 1PJ6A 4A6NB 2GH5A 1DOCA 3B3RA 3QVPA 2GF3A 1PBEA 3BHKA 4U2SA 4H2RA 4Z44A 3AD7B 1KSSA 3IF9A 1CJCA 3REDA 2GQFA 4C3XA 2GAHB 1KF6A 1S3EA 1XDIA 3GWDA 1YQ4A 4CNJA 3AE6A 1YKJA 2RABA 1NG3A 4H4UA 2Q0KA 4GRTA 3DH9A 1JRZA 2EQ7A 4OPGA 4CNKA 2RGOA 3AEBA 2WPCA 4OPIA 2YLXA 1M64A 2GEWA 4XWZA 2GB0A 3M12A 1GESA 5U1OA 2DKIA 1FEBA 3K30A 3OC4A 3RP8A 5HY5A 3L1RA 1MXTA 3KA7A 4OVIA 1CL0A 3GRTA 3KU9A 4AP1A 1JU2A 2X8CA 1NHPA 2WEUA 1S2QA 3AYJA 2XCGA 2EQ6A 3DJJA 3DJGX 2ZZBA 2RGJA 3NN6X 4TLXA 3OZ2A 3NKSA 3AE8A 4U8LA 5JCNA 2AAQA 2WU5A 3AE1A 4O5QA 1KFYA 3EAOA 4OCGA 2UZZA 3DA1A 3PS9A 3UOYA 3NG7X 4H2QA 5FS6A 2YR5A 1RYIA 3AE3A 1N4VA 1YY5A 5KVIA 4YSXA 5BRTA 1IUWA 2Z5YA 1GRAA 3RP6A 3VR8A 2BYBA 2BC0A 3CNPA 4I59A 4GUVA 4K7ZA 2BC1A 1H82A 2YLZA 1GETA 3NIXA 4RG3A 4Y4NA 1DOEA 2A8XA 2WDRA 1OJAA 1Q1RA 3G5QA 3QSEA 1GREA 4H4VA 1QLBA 1EL7A 1K0LA 4U8KA 4IV9A 4A99A 1W4XA 1O5WA 1JNZA 4B69A 2GR1A 4EIPA 4C5OA 1D4DA 3AD8B 4USQA 1CJ2A 3CIRA 2BK5A 5EOWA 4CBQA 3COXA 1GXFA 3K7TA 2EQ8A 2YVFA 3DK4A 4FDCB 4H2NA 5BULA 4NTEA 1IUTA 3QVRA 2XLSA 1H84A 4RG4A 2WDQA 3V76A 1D5TA 2IIDA 3UTEA 1JNRA 2C65A 4C3YA 3ICTA 1PN0A 3URHA 1D4EA 2J3NA 3FG2P 1E6EA 2YVJA 3QFBA 3P9UA 4J2WA 1GSNA 4IVOB 2XVFA 2IVDA 2CFYA 3CGBA 3ZDNA 3LZXA 1EL5A 1PXAA 3BI4A 2B76A 4GR1A 4HB9A 2BS4A 1ZOYA 3NLCA 4K2XA 3AEGA 4GDEA 4CRTA 1TDFA 1E39A 4BJZA 4EQXA 2XVEA 1DXLA 3M13A 1FOHA 2GRTA 1TRBA 2WOWA 3P1WA 1RSGA 2R45A 1BF3A 1Q1WA 1Y0PA 4Z2TA 1NPXA 1OJDA 1ZMCA 3EPTA 2VVLA 2GR3A 1PS9A 3GD4A 1ZP0A 3VRBA 1PBBA 3AEAA 5U25A 4LU6A 4AT0A 4U8IA 4EIQA 5M10A 1EBDA 1QO8A 3I3LA 3VQRA 3UP4A 5BVAA 3QJ4A 1DODA 1IJHA 1REOA 4YKGA 3G5SA 4EMWA 3NTAA 3H8IA 1GV4A 2C3CA 4A79A 4ZCCA 4U2TA 1NHRA 5JCMA 2JB2A 3AE2A 4MJWA 2APGA 3ICSA 1FCDA 2C67A 3S5WA 2B9WA 1GALA 2YM1A 2XVIA 1BKWA 1GERA 4X9NA 5HHFA 1HYUA 1JRYA 3JSKA 4KPRA 3VRAA 4OPCA 2V61A 2JAEA 1F3PA 3L8KA 3II4A 3K7MX 1CJ4A 2XFPA 2WESA 3ADAB 4A5LA 3GMBA 3UKQA 4PAAA 3SQPA 2X99A 3Q6JA 3DK8A 3KPFA 4H4TA 4AP3A 2Q6UA 4UDPA 1CJ3A 1PBCA 1PBFA 2F5ZA 2OA1A 4U8PA 2XVHA 3NN0X 3AE7A 4YSZA 2JK6A 3UTFA 1GNDA 4NEWA 1JOAA 2XLTA 4NTCA 4BJYA 3G5RA 4YSYA 4J31A 3LOVA 5IQ1A 2BS3A 2WU2A 3P4RA 5CKUA 3AEFA 4EMIA 4ECHA 4Z43A 1IUVA 1E1KA 1OJ9A 1GRGA 2X50A 2DKHA 2HQMA 3NT6A 5KWFA 2BCPA 2ZZ0A 3ALJA 1O95A 4APNA 2QA2A 1K0IA 1NAAA 2C73A 1F8SA 1BGJA 3ALLA 4JNQA 1TDNA 1F8RA 5JCIA 3UKFA 1E1MA 3ATQA 3CPIG 4C74A 1E1NA 3UTGA 5BUKA 1FL2A 2WS3A 3S61A 1ELIA 1MO9A 3FMWA 3GRSA 2B7RA 2R46A 3AECA 3AWIA 4TM3A 1ZDLA 2ZZCA 2GR2A 4YTNA 2V60A 2XLPA 1Z6LA 2YQUA 4X4JA 4FX9A 5JCLA 1B37A 3DJEA 3ALMA 1PDHA 4BK3A 2C76A 2VRLA 2OAMA 2QAEA 3NYFA 4H4SA 3CTYA 5KOWA 4BK1A 3F8RA 2E5VA 4JDRA 4J56A 3AB1A 2C72A 2QCUA 3RHAA 4OPTA 1YQZA 1V59A 3P4QA 5EB4A 4FK1A 3DGHA 2JB3A 5IQ4A 3LZWA 2WQYA 3SFEA 3UOVA 2CULA 2GQWA 2Z5XA 4BK2A 2XDOA 5KXJA 1DJQA 2R4EA 4DSGA 1X31B 3UKHA 2PYXA 2BK3A 3C96A 4Z24A 2W0HA 3M0OA 4JY3A 4K8DA 2WP5A 4XXGA 3SM8A 1GRFA 2E1MA 4EQRA 4Z2RA 3BNMA 4DSHA 3AXBA 2VRMA 2VZ2A 2FBWA 2WPFA 2XFQA 4GCMA 4B67A 2RGHA 2H89A 4REKA 3V3OA 4ZN0A 2IVEA 2BXSA 2BABA 2B9XA 4KX6A 1RP0A 3DJDA 4TM4A 4USRA 3UOZA 4NEVA 3NK2X 3GYIA 4YTPA 1B8SA 4CY6A 5IPYA 1VQWA 3ATRA 1Q9IA 2V6OA 1LPFA 3GDNA 5FS8A 2V5ZA 4IA5A 4AOSA 1GTHA 2XFNA 2WETA 5M0ZA 4A9WA 3CGCA 2CVJA 1VG0A 4TM1A 4J34A 4H4WA 1BZLA 1EL9A 2H88A 2R0CA 1LQTA 4TM0A 4DGKA 1GOSA 4B1BA 5ER0A 1GPEA 5U63A 4B66A 1GRBA 1CHUA 1TDKA 2VVLG 4FK1C 1D7LA 3LXDA 3CPHG 4E0VA 4N9XA 3CNDA 2FJBA 3DK9A 2WPEA 1DJNA 5J60A 3GWFA 1EL8A 1H7WA 3O0HA 5GSNA 1K0JA 2GAGB 2CDUA 3CN8A 4BURA 4OPUA 1N1PA 1NHQA 1AOGA 3LADA 1ZX9A 2C70A 1ZOVA 5C3JA 3GDPA 1LJ1A 3CPJG 2FJEA 4U2LA 1H6VA 2TPRA 4IA6A 5FMHA 4CY8A 1GTEA 2WP9A 3BHFA 3CGEA 3ZYXA 1XANA 4YT0A 4Z2UA 4Z26A 4ZCDA 1KSUA 4H7UA 4YKFA 1LQUA 1ZY8A 1DNCA 1GRTA 1H81A 1VDCA 5EB5A 1NG4A 3KKJA 2XVJA 1P2EA 3VR9A 2YWLA 3ISHA 5FS9A 4H4YA 5C2TA 3RP7A 1TYPA 3KVEA 4B63A 3UKKA 1GT8A 1H7XA 2ARDA 4UP3A 3UOXA 2VVMA 4EQWA 3CNTA 3K7QX 2JKCA 1D4CA 4BV6A 3C4AA 1CC6A 3IWAA 1CC4A 2YG3A 4JY2A 4ADWA 1Y56A 2B7SA 3FPZA 1PJ7A 2NPXA 2V3AA 3NNEA 2VQBA 4YXDA 3RNMA 4H4ZA 2GR0A 1CBOA 4CCRA 2GMJA 1KNPA 1ZKQA 3HZLA 1ONFA 3AD9B 3Q9TA 4K5RA 3GYJA 1YQ3A 4NTDA 4XWRA 1NEKA 3UKAA 4A6NA 4EQSA 4J57A 1E7PA 2C66A 1JRXA 4X9MA 2YG4A 2YR4A 2GMHA 3BI5A 2GVCA 4H4RA 4EMJA 1LTXR 2YLSA 4IVMB 4AOXA 1LVLA 1IUXA 2X8HA 3SFDA 4AT2A 5LV9A 1TDOA 4M52A 4DNAA 4UDRA 5KVHA 3DMEA 4D04A 5TR3A 2ZBWA 2YR6A 1VRQB 2BACA 1GEUA 2Y6RA 4OPDA 2C64A 3QSMA 3QFAA 1KNRA 2YAUA 4WX1A 3I6DA 4Z25A 1XPQA 3AEDA 4HA6A 2I0ZA 4JN9A 1VG9A 3SGLA 1NDAA 2YG6A 1K4QA 4LIIA 3IC9A 1DOBA 5FS7A 1F6MA 4H2PA 4TLZA 1COYA 1PHHA 2YVGA 1PJ5A 4EM4A 2FJDA 1TDEA 2BK4A 4NZHA 4UDQA 3AYLA 4LA1A 4OPLA 2WHDA 1OJCA 1L9CA 1N4UA 3F8DA 2YLWA 2JBVA 2NVKX 4YSHA 3R9UA 2OLOA 2XYOA 4K22A 4B64A 1F8WA 2JB1A 3AE9A 4YTMA 2OLNA 4PABA 2C3DA 1S2YA 3BNUA 1H86A 4WCTA 1GRHA 4U8MA 1LV0A 3WE0A 1KDGA 1NHSA 3ITJA 2BA9A 3KD9A 4U8NA 4JNAA 4GF7A 2YG5A 4RSLA 2TMDA 3H8LA 4O5UA 1CF3A 3CNSA 3DGZA 5JCKA 1MOKA 1NENA 5HYMA 3QSSA 3GSIA 5L46A 3NK1X 1M6IA 2X3NA 4Y4MA 2B9YA 3UTHA 2YM2A 2R0PA 2WDVA 3CNJA 4J33A 2FJAA 1PBDA 2XFUA 1E1LA 2QA1A 3H4KA 3LB8A 1B5QA 1L0VA 3UCLA 4A65A 2O9ZA 5KOXA 2XLRA 3NYEA 3EF6A 4GDPA 2BXRA 3AYIA 2YG7A 2XFOA 4B65A 1FEAA 1B4VA 3P4PA 4K5SA 2ACZA 3NK0X 4H4XA 1PXBA 4ICYA 1SEZA 5DBJA 2GV8A 3T37A 4C77A 1IUSA 2OALA 2R9ZA 2X8GA 3ABVA 4J36A 1CC2A 1H83A 4U8OA 2E4GA 2BCGG 2VQ7A 4YWOA 2AQJA 2WOVA 2Q7VA 1UKVG 2WBAA 1IUUA 3GMCA 3UKLA 3NH3X 4H50A 3UP5A 3KLJA 1ZMDA 1S3BA 3AE5A 4B68A 2A89A 2C7GA 1PXCA 2A87A 1TYTA 3NHOX 2EQ9A 4CCQA 2BS2A 3NTDA 2WP6A 3PVCA 1FECA 3D1CA 3LJPA 2Y6QA 3V3NA 3F8PA 3CGDA 2V3BA 4A7AA 2YLTA 2YLRA 3VRDB 2R0GA 2R4JA 1BWCA 3FBSA 2XLUA 2Q0LA 4H4PA 1XHCA 4U8JA 4EM3A 5KRQA 3AEEA 3IHGA
chains in the Genus database with same CATH superfamily
2C75A 3BI2A 3E1TA 1ZK7A 3C4NA 5HXIA 1QJDA 4JQ9A 3FIMB 1O94A 4P9SA 3UKPA 5CQFA 5GRTA 3ICRA 1BGNA 2VOUA 3SX6A 3GD3A 3NYCA 3P4SA 3EANA 3B6DA 3NGCX 4I58A 4G74A 1Y56B 4D03A 1L9DA 3IHMA 1N4WA 3AE4A 1L9EA 3PO7A 2WOIA 2AR8A 1P2HA 4H4QA 1JEHA 1OJTA 5EBKA 3NRNA 2PHHA 1D7YA 4Y4LA 5J7XA 3D8XA 1PJ6A 4A6NB 2GH5A 1DOCA 3B3RA 3QVPA 2GF3A 1PBEA 3BHKA 4U2SA 4H2RA 4Z44A 3AD7B 1KSSA 3IF9A 1CJCA 3REDA 2GQFA 4C3XA 2GAHB 1KF6A 1S3EA 1XDIA 3GWDA 1YQ4A 4CNJA 3AE6A 1YKJA 2RABA 1NG3A 4H4UA 2Q0KA 4GRTA 3DH9A 1JRZA 2EQ7A 4OPGA 4CNKA 2RGOA 3AEBA 2WPCA 4OPIA 2YLXA 1M64A 3CMMA 2GEWA 4XWZA 2GB0A 3M12A 1GESA 5U1OA 2DKIA 1FEBA 3K30A 3OC4A 3RP8A 5HY5A 3L1RA 1MXTA 3KA7A 4OVIA 1CL0A 3GRTA 3KU9A 4AP1A 1JU2A 2X8CA 1NHPA 2WEUA 1S2QA 3AYJA 2XCGA 2EQ6A 3DJJA 3DJGX 2ZZBA 2RGJA 2C4CA 3NN6X 4TLXA 3OZ2A 3NKSA 3AE8A 4U8LA 5JCNA 2AAQA 2WU5A 3AE1A 4O5QA 1KFYA 3EAOA 4OCGA 2UZZA 3DA1A 3PS9A 4GAPA 3NG7X 3UOYA 4H2QA 5FS6A 2YR5A 1RYIA 3AE3A 1N4VA 1YY5A 5KVIA 4YSXA 5BRTA 1IUWA 2Z5YA 1GRAA 3RP6A 3VR8A 2BYBA 2BC0A 3CNPA 4I59A 4GUVA 4K7ZA 2BC1A 1H82A 2YLZA 1GETA 3NIXA 4RG3A 4Y4NA 1DOEA 2A8XA 2WDRA 1OJAA 1Q1RA 3G5QA 3QSEA 1GREA 4H4VA 1QLBA 1EL7A 1K0LA 4U8KA 4IV9A 4A99A 1W4XA 1O5WA 1JNZA 4B69A 2GR1A 4EIPA 4C5OA 1D4DA 3AD8B 4USQA 1CJ2A 3CIRA 2BK5A 5EOWA 4CBQA 3COXA 1GXFA 3K7TA 2EQ8A 2YVFA 3DK4A 4FDCB 4H2NA 5BULA 4NTEA 1IUTA 3QVRA 2XLSA 1H84A 4RG4A 2WDQA 3V76A 1D5TA 2IIDA 3UTEA 1JNRA 2C65A 4C3YA 3ICTA 1PN0A 2BRYA 3URHA 1D4EA 2J3NA 3FG2P 1E6EA 2YVJA 3QFBA 3P9UA 4J2WA 1GSNA 4IVOB 3HYVA 2XVFA 2IVDA 2CFYA 3CGBA 3ZDNA 3LZXA 1EL5A 1PXAA 3BI4A 2B76A 4GR1A 4HB9A 2BS4A 3T2KA 1ZOYA 3NLCA 4K2XA 3AEGA 4GDEA 4CRTA 1TDFA 1E39A 4BJZA 4EQXA 2XVEA 1DXLA 3M13A 1FOHA 2GRTA 1TRBA 2WOWA 3P1WA 1RSGA 2R45A 1BF3A 1Q1WA 1Y0PA 4Z2TA 1NPXA 1OJDA 4G73A 1ZMCA 3EPTA 2VVLA 2GR3A 1PS9A 3GD4A 1ZP0A 3VRBA 1PBBA 3AEAA 5U25A 4LU6A 4AT0A 4U8IA 4EIQA 5M10A 1EBDA 1QO8A 3I3LA 3VQRA 3UP4A 5BVAA 3QJ4A 1DODA 1IJHA 1REOA 4YKGA 3G5SA 4EMWA 3NTAA 3H8IA 1GV4A 2C3CA 4A79A 4ZCCA 4U2TA 1NHRA 5JCMA 2JB2A 3AE2A 4MJWA 2APGA 3ICSA 1FCDA 2C67A 3S5WA 2B9WA 1GALA 2YM1A 2XVIA 1BKWA 1GERA 4X9NA 5HHFA 1HYUA 1JRYA 3JSKA 4KPRA 3VRAA 4OPCA 2V61A 2JAEA 1F3PA 3L8KA 3II4A 3K7MX 1CJ4A 2XFPA 2WESA 3ADAB 4A5LA 3GMBA 3UKQA 4PAAA 3SQPA 2X99A 3Q6JA 3DK8A 3KPFA 4H4TA 4AP3A 2Q6UA 4UDPA 1CJ3A 1PBCA 1PBFA 2F5ZA 2OA1A 4U8PA 2XVHA 3NN0X 3AE7A 4YSZA 2JK6A 3UTFA 1GNDA 4NEWA 1JOAA 2XLTA 4NTCA 4BJYA 3G5RA 4YSYA 4J31A 3LOVA 5IQ1A 2BS3A 2WU2A 3P4RA 5CKUA 3AEFA 4EMIA 4ECHA 4Z43A 1IUVA 1E1KA 1OJ9A 1GRGA 2X50A 4NWZA 2DKHA 2HQMA 3NT6A 5KWFA 2BCPA 2ZZ0A 3ALJA 1O95A 4APNA 2QA2A 1K0IA 1NAAA 2C73A 1F8SA 1BGJA 3ALLA 4JNQA 1TDNA 1F8RA 5JCIA 3UKFA 1E1MA 3ATQA 3CPIG 4C74A 1E1NA 3UTGA 5BUKA 1FL2A 2WS3A 3S61A 1ELIA 1MO9A 3FMWA 3GRSA 2B7RA 2R46A 3KPKA 3AECA 3AWIA 4TM3A 1ZDLA 2ZZCA 2GR2A 4YTNA 2V60A 2XLPA 1Z6LA 2YQUA 4X4JA 4FX9A 5JCLA 1B37A 3DJEA 3ALMA 1PDHA 4BK3A 2C76A 2VRLA 2OAMA 2QAEA 3NYFA 4H4SA 3CTYA 5KOWA 4G9KA 4BK1A 3F8RA 2E5VA 4JDRA 4J56A 3AB1A 2C72A 2QCUA 3RHAA 4OPTA 1YQZA 1V59A 3P4QA 5EB4A 4FK1A 3HYXA 3DGHA 2JB3A 5KMQA 5IQ4A 3LZWA 2WQYA 3SFEA 3UOVA 2CULA 2GQWA 2Z5XA 4BK2A 2XDOA 5KXJA 1DJQA 2R4EA 4DSGA 1X31B 3UKHA 2PYXA 3SXIA 2BK3A 3C96A 4Z24A 2W0HA 3M0OA 4JY3A 4II2A 4K8DA 2WP5A 4XXGA 3SM8A 1GRFA 2E1MA 3SZCA 4EQRA 4Z2RA 3BNMA 4DSHA 3AXBA 2VRMA 2VZ2A 2FBWA 2WPFA 2XFQA 4GCMA 4B67A 2RGHA 2H89A 4REKA 3V3OA 4ZN0A 2IVEA 2BXSA 2BABA 2B9XA 4KX6A 1RP0A 3DJDA 4TM4A 4USRA 3UOZA 4NEVA 3NK2X 3GYIA 4NNJA 1B8SA 4CY6A 4YTPA 5IPYA 1VQWA 3ATRA 1Q9IA 2V6OA 1LPFA 3GDNA 5FS8A 2V5ZA 4IA5A 4AOSA 1GTHA 2XFNA 2WETA 5M0ZA 4A9WA 3CGCA 2CVJA 1VG0A 4TM1A 5KMSA 4J34A 3SZWA 4H4WA 1BZLA 1EL9A 2H88A 2R0CA 1LQTA 4TM0A 4DGKA 1GOSA 4B1BA 5ER0A 1GPEA 5U63A 4B66A 1GRBA 1CHUA 1TDKA 2VVLG 4FK1C 1D7LA 3LXDA 3CPHG 4E0VA 4N9XA 3CNDA 2FJBA 3DK9A 2WPEA 1DJNA 5J60A 3GWFA 1EL8A 1H7WA 3O0HA 5GSNA 1K0JA 2GAGB 2CDUA 3CN8A 3T14A 4BURA 4OPUA 1N1PA 1NHQA 1AOGA 3LADA 1ZX9A 2C70A 1ZOVA 5C3JA 3GDPA 1LJ1A 3CPJG 2FJEA 4U2LA 1H6VA 2TPRA 4IA6A 5FMHA 4CY8A 1GTEA 2WP9A 3BHFA 3CGEA 3SZ0A 1XANA 3ZYXA 4YT0A 4Z2UA 4Z26A 4ZCDA 1KSUA 4H7UA 4YKFA 1LQUA 1ZY8A 1DNCA 1GRTA 1H81A 1VDCA 5EB5A 1NG4A 3KKJA 2XVJA 3SZFA 1P2EA 3VR9A 2YWLA 3ISHA 5FS9A 4H4YA 5C2TA 3RP7A 1TYPA 3KVEA 3HYWA 4B63A 3UKKA 1GT8A 1H7XA 2ARDA 4UP3A 3UOXA 2VVMA 4EQWA 3CNTA 3K7QX 2JKCA 1D4CA 4BV6A 3C4AA 1CC6A 3IWAA 1CC4A 2YG3A 4JY2A 4ADWA 1Y56A 2B7SA 3FPZA 1PJ7A 2NPXA 2V3AA 3NNEA 2VQBA 4YXDA 3RNMA 4H4ZA 2GR0A 1CBOA 4CCRA 2GMJA 1KNPA 1ZKQA 3T2ZA 3HZLA 1ONFA 3AD9B 3Q9TA 4K5RA 3GYJA 1YQ3A 4NTDA 4XWRA 1NEKA 3UKAA 4A6NA 4EQSA 4J57A 1E7PA 2C66A 1JRXA 4X9MA 2YG4A 2YR4A 5KNLA 2GMHA 3BI5A 2GVCA 4H4RA 4EMJA 1LTXR 2YLSA 4IVMB 4AOXA 1LVLA 3T0KA 1IUXA 2X8HA 3SFDA 4AT2A 5LV9A 1TDOA 4M52A 4DNAA 4UDRA 5KVHA 3DMEA 4G6GA 4D04A 5TR3A 2ZBWA 2YR6A 1VRQB 2BACA 1GEUA 2BRAA 2Y6RA 4OPDA 2C64A 3QSMA 3QFAA 1KNRA 2YAUA 4WX1A 3I6DA 4Z25A 1XPQA 3AEDA 4HA6A 2I0ZA 4JN9A 1VG9A 3SGLA 1NDAA 2YG6A 1K4QA 4LIIA 3T31A 3IC9A 3GYXA 1DOBA 5FS7A 1F6MA 4H2PA 4TLZA 1COYA 1PHHA 2YVGA 1PJ5A 4EM4A 2FJDA 1TDEA 2BK4A 4NZHA 4UDQA 3AYLA 4LA1A 4OPLA 2WHDA 1OJCA 1L9CA 1N4UA 3F8DA 2YLWA 2JBVA 2NVKX 5KMPA 3SYIA 4YSHA 3R9UA 2OLOA 2XYOA 4K22A 4B64A 1F8WA 2JB1A 3AE9A 4YTMA 2OLNA 4PABA 2C3DA 1S2YA 3BNUA 1H86A 4WCTA 1GRHA 4U8MA 1LV0A 3WE0A 1KDGA 1NHSA 3ITJA 2BA9A 3KD9A 4U8NA 4JNAA 4GF7A 2YG5A 4RSLA 2TMDA 3H8LA 4O5UA 1CF3A 3CNSA 3DGZA 5JCKA 1MOKA 1NENA 5HYMA 3QSSA 3GSIA 5L46A 3NK1X 1M6IA 2X3NA 4Y4MA 2B9YA 3UTHA 2YM2A 2R0PA 2WDVA 3CNJA 4J33A 2FJAA 1PBDA 2XFUA 1E1LA 2QA1A 3H4KA 3LB8A 1B5QA 1L0VA 3UCLA 4A65A 2O9ZA 5KOXA 2XLRA 3NYEA 3EF6A 4GDPA 5KMRA 2BXRA 3AYIA 2YG7A 2XFOA 4B65A 1FEAA 1B4VA 3P4PA 4K5SA 2ACZA 3NK0X 4H4XA 1PXBA 4G6HA 4ICYA 1SEZA 5DBJA 2GV8A 3T37A 4C77A 1IUSA 2OALA 2R9ZA 2X8GA 3ABVA 4J36A 1CC2A 1H83A 4U8OA 2E4GA 3SY4A 2BCGG 2VQ7A 4YWOA 2AQJA 2WOVA 2Q7VA 1UKVG 4GAVA 2WBAA 1IUUA 3GMCA 3UKLA 3NH3X 4H50A 3UP5A 3KLJA 1ZMDA 1S3BA 3AE5A 4B68A 2A89A 2C7GA 1PXCA 2A87A 1TYTA 3NHOX 2EQ9A 4CCQA 2BS2A 3NTDA 2WP6A 3PVCA 1FECA 3D1CA 3LJPA 2Y6QA 3V3NA 3F8PA 4II3A 3CGDA 2V3BA 3T2YA 4A7AA 2YLTA 2YLRA 3VRDB 2R0GA 2R4JA 1BWCA 3FBSA 2XLUA 2Q0LA 4H4PA 1XHCA 4U8JA 4EM3A 5KRQA 3AEEA 3IHGA
chains in the Genus database with same CATH topology
2C75A 3BI2A 3E1TA 1ZK7A 3C4NA 5HXIA 1QJDA 4JQ9A 3FIMB 1O94A 4P9SA 3UKPA 5CQFA 5GRTA 3ICRA 1BGNA 2VOUA 3SX6A 3GD3A 3NYCA 3P4SA 3EANA 3B6DA 3NGCX 4I58A 4G74A 1Y56B 4D03A 1L9DA 3IHMA 1N4WA 3AE4A 1L9EA 3PO7A 2WOIA 2AR8A 1P2HA 4H4QA 1JEHA 1OJTA 5EBKA 3NRNA 2PHHA 1D7YA 4Y4LA 5J7XA 3D8XA 1PJ6A 4A6NB 2GH5A 1DOCA 3B3RA 3QVPA 2GF3A 1PBEA 3BHKA 4U2SA 4H2RA 4Z44A 3AD7B 1KSSA 3IF9A 1CJCA 3REDA 2GQFA 4C3XA 2GAHB 1KF6A 1S3EA 1XDIA 3GWDA 1YQ4A 4CNJA 3AE6A 1YKJA 2RABA 1NG3A 4H4UA 2Q0KA 4GRTA 3DH9A 1JRZA 2EQ7A 4OPGA 4CNKA 2RGOA 3AEBA 2WPCA 4OPIA 2YLXA 1M64A 3CMMA 2GEWA 4XWZA 2GB0A 3M12A 1GESA 5U1OA 2DKIA 1FEBA 3K30A 3OC4A 3RP8A 5HY5A 3L1RA 1MXTA 3KA7A 4OVIA 1CL0A 3GRTA 3KU9A 4AP1A 1JU2A 2X8CA 1NHPA 2WEUA 1S2QA 3AYJA 2XCGA 2EQ6A 3DJJA 3DJGX 2ZZBA 2RGJA 2C4CA 3NN6X 4TLXA 3OZ2A 3NKSA 3AE8A 4U8LA 5JCNA 2AAQA 2WU5A 3AE1A 4O5QA 1KFYA 3EAOA 4OCGA 2UZZA 3DA1A 3PS9A 4GAPA 3NG7X 3UOYA 4H2QA 5FS6A 2YR5A 1RYIA 3AE3A 1N4VA 1YY5A 5KVIA 4YSXA 5BRTA 1IUWA 2Z5YA 1GRAA 3RP6A 3VR8A 2BYBA 2BC0A 3CNPA 4I59A 4GUVA 4K7ZA 2BC1A 1H82A 2YLZA 1GETA 3NIXA 4RG3A 4Y4NA 1DOEA 2A8XA 2WDRA 1OJAA 1Q1RA 3G5QA 3QSEA 1GREA 4H4VA 1QLBA 1EL7A 1K0LA 4U8KA 4IV9A 4A99A 1W4XA 1O5WA 1JNZA 4B69A 2GR1A 4EIPA 4C5OA 1D4DA 3AD8B 4USQA 1CJ2A 3CIRA 2BK5A 5EOWA 4CBQA 3COXA 1GXFA 3K7TA 2EQ8A 2YVFA 3DK4A 4FDCB 4H2NA 5BULA 4NTEA 1IUTA 3QVRA 2XLSA 1H84A 4RG4A 2WDQA 3V76A 1D5TA 2IIDA 3UTEA 1JNRA 2C65A 4C3YA 3ICTA 1PN0A 2BRYA 3URHA 1D4EA 2J3NA 3FG2P 1E6EA 2YVJA 3QFBA 3P9UA 4J2WA 1GSNA 4IVOB 3HYVA 2XVFA 2IVDA 2CFYA 3CGBA 3ZDNA 3LZXA 1EL5A 1PXAA 3BI4A 2B76A 4GR1A 4HB9A 2BS4A 3T2KA 1ZOYA 3NLCA 4K2XA 3AEGA 4GDEA 4CRTA 1TDFA 1E39A 4BJZA 4EQXA 2XVEA 1DXLA 3M13A 1FOHA 2GRTA 1TRBA 2WOWA 3P1WA 1RSGA 2R45A 1BF3A 1Q1WA 1Y0PA 4Z2TA 1NPXA 1OJDA 4G73A 1ZMCA 3EPTA 2VVLA 2GR3A 1PS9A 3GD4A 1ZP0A 3VRBA 1PBBA 3AEAA 5U25A 4LU6A 4AT0A 4U8IA 4EIQA 5M10A 1EBDA 1QO8A 3I3LA 3VQRA 3UP4A 5BVAA 3QJ4A 1DODA 1IJHA 1REOA 4YKGA 3G5SA 4EMWA 3NTAA 3H8IA 1GV4A 2C3CA 4A79A 4ZCCA 4U2TA 1NHRA 5JCMA 2JB2A 3AE2A 4MJWA 2APGA 3ICSA 1FCDA 2C67A 3S5WA 2B9WA 1GALA 2YM1A 2XVIA 1BKWA 1GERA 4X9NA 5HHFA 1HYUA 1JRYA 3JSKA 4KPRA 3VRAA 4OPCA 2V61A 2JAEA 1F3PA 3L8KA 3II4A 3K7MX 1CJ4A 2XFPA 2WESA 3ADAB 4A5LA 3GMBA 3UKQA 4PAAA 3SQPA 2X99A 3Q6JA 3DK8A 3KPFA 4H4TA 4AP3A 2Q6UA 4UDPA 1CJ3A 1PBCA 1PBFA 2F5ZA 2OA1A 4U8PA 2XVHA 3NN0X 3AE7A 4YSZA 2JK6A 3UTFA 1GNDA 4NEWA 1JOAA 2XLTA 4NTCA 4BJYA 3G5RA 4YSYA 4J31A 3LOVA 5IQ1A 2BS3A 2WU2A 3P4RA 5CKUA 3AEFA 4EMIA 4ECHA 4Z43A 1IUVA 1E1KA 1OJ9A 1GRGA 2X50A 4NWZA 2DKHA 2HQMA 3NT6A 5KWFA 2BCPA 2ZZ0A 3ALJA 1O95A 4APNA 2QA2A 1K0IA 1NAAA 2C73A 1F8SA 1BGJA 3ALLA 4JNQA 1TDNA 1F8RA 5JCIA 3UKFA 1E1MA 3ATQA 3CPIG 4C74A 1E1NA 3UTGA 5BUKA 1FL2A 2WS3A 3S61A 1ELIA 1MO9A 3FMWA 3GRSA 2B7RA 2R46A 3KPKA 3AECA 3AWIA 4TM3A 1ZDLA 2ZZCA 2GR2A 4YTNA 2V60A 2XLPA 1Z6LA 2YQUA 4X4JA 4FX9A 5JCLA 1B37A 3DJEA 3ALMA 1PDHA 4BK3A 2C76A 2VRLA 2OAMA 2QAEA 3NYFA 4H4SA 3CTYA 5KOWA 4G9KA 4BK1A 3F8RA 2E5VA 4JDRA 4J56A 3AB1A 2C72A 2QCUA 3RHAA 4OPTA 1YQZA 1V59A 3P4QA 5EB4A 4FK1A 3HYXA 3DGHA 2JB3A 5KMQA 5IQ4A 3LZWA 2WQYA 3SFEA 3UOVA 2CULA 2GQWA 2Z5XA 4BK2A 2XDOA 5KXJA 1DJQA 2R4EA 4DSGA 1X31B 3UKHA 2PYXA 3SXIA 2BK3A 3C96A 4Z24A 2W0HA 3M0OA 4JY3A 4II2A 4K8DA 2WP5A 4XXGA 3SM8A 1GRFA 2E1MA 3SZCA 4EQRA 4Z2RA 3BNMA 4DSHA 3AXBA 2VRMA 2VZ2A 2FBWA 2WPFA 2XFQA 4GCMA 4B67A 2RGHA 2H89A 4REKA 3V3OA 4ZN0A 2IVEA 2BXSA 2BABA 2B9XA 4KX6A 1RP0A 3DJDA 4TM4A 4USRA 3UOZA 4NEVA 3NK2X 3GYIA 4NNJA 1B8SA 4CY6A 4YTPA 5IPYA 1VQWA 3ATRA 1Q9IA 2V6OA 1LPFA 3GDNA 5FS8A 2V5ZA 4IA5A 4AOSA 1GTHA 2XFNA 2WETA 5M0ZA 4A9WA 3CGCA 2CVJA 1VG0A 4TM1A 5KMSA 4J34A 3SZWA 4H4WA 1BZLA 1EL9A 2H88A 2R0CA 1LQTA 4TM0A 4DGKA 1GOSA 4B1BA 5ER0A 1GPEA 5U63A 4B66A 1GRBA 1CHUA 1TDKA 2VVLG 4FK1C 1D7LA 3LXDA 3CPHG 4E0VA 4N9XA 3CNDA 2FJBA 3DK9A 2WPEA 1DJNA 5J60A 3GWFA 1EL8A 1H7WA 3O0HA 5GSNA 1K0JA 2GAGB 2CDUA 3CN8A 3T14A 4BURA 4OPUA 1N1PA 1NHQA 1AOGA 3LADA 1ZX9A 2C70A 1ZOVA 5C3JA 3GDPA 1LJ1A 3CPJG 2FJEA 4U2LA 1H6VA 2TPRA 4IA6A 5FMHA 4CY8A 1GTEA 2WP9A 3BHFA 3CGEA 3SZ0A 1XANA 3ZYXA 4YT0A 4Z2UA 4Z26A 4ZCDA 1KSUA 4H7UA 4YKFA 1LQUA 1ZY8A 1DNCA 1GRTA 1H81A 1VDCA 5EB5A 1NG4A 3KKJA 2XVJA 3SZFA 1P2EA 3VR9A 2YWLA 3ISHA 5FS9A 4H4YA 5C2TA 3RP7A 1TYPA 3KVEA 3HYWA 4B63A 3UKKA 1GT8A 1H7XA 2ARDA 4UP3A 3UOXA 2VVMA 4EQWA 3CNTA 3K7QX 2JKCA 1D4CA 4BV6A 3C4AA 1CC6A 3IWAA 1CC4A 2YG3A 4JY2A 4ADWA 1Y56A 2B7SA 3FPZA 1PJ7A 2NPXA 2V3AA 3NNEA 2VQBA 4YXDA 3RNMA 4H4ZA 2GR0A 1CBOA 4CCRA 2GMJA 1KNPA 1ZKQA 3T2ZA 3HZLA 1ONFA 3AD9B 3Q9TA 4K5RA 3GYJA 1YQ3A 4NTDA 4XWRA 1NEKA 3UKAA 4A6NA 4EQSA 4J57A 1E7PA 2C66A 1JRXA 4X9MA 2YG4A 2YR4A 5KNLA 2GMHA 3BI5A 2GVCA 4H4RA 4EMJA 1LTXR 2YLSA 4IVMB 4AOXA 1LVLA 3T0KA 1IUXA 2X8HA 3SFDA 4AT2A 5LV9A 1TDOA 4M52A 4DNAA 4UDRA 5KVHA 3DMEA 4G6GA 4D04A 5TR3A 2ZBWA 2YR6A 1VRQB 2BACA 1GEUA 2BRAA 2Y6RA 4OPDA 2C64A 3QSMA 3QFAA 1KNRA 2YAUA 4WX1A 3I6DA 4Z25A 1XPQA 3AEDA 4HA6A 2I0ZA 4JN9A 1VG9A 3SGLA 1NDAA 2YG6A 1K4QA 4LIIA 3T31A 3IC9A 3GYXA 1DOBA 5FS7A 1F6MA 4H2PA 4TLZA 1COYA 1PHHA 2YVGA 1PJ5A 4EM4A 2FJDA 1TDEA 2BK4A 4NZHA 4UDQA 3AYLA 4LA1A 4OPLA 2WHDA 1OJCA 1L9CA 1N4UA 3F8DA 2YLWA 2JBVA 2NVKX 5KMPA 3SYIA 4YSHA 3R9UA 2OLOA 2XYOA 4K22A 4B64A 1F8WA 2JB1A 3AE9A 4YTMA 2OLNA 4PABA 2C3DA 1S2YA 3BNUA 1H86A 4WCTA 1GRHA 4U8MA 1LV0A 3WE0A 1KDGA 1NHSA 3ITJA 2BA9A 3KD9A 4U8NA 4JNAA 4GF7A 2YG5A 4RSLA 2TMDA 3H8LA 4O5UA 1CF3A 3CNSA 3DGZA 5JCKA 1MOKA 1NENA 5HYMA 3QSSA 3GSIA 5L46A 3NK1X 1M6IA 2X3NA 4Y4MA 2B9YA 3UTHA 2YM2A 2R0PA 2WDVA 3CNJA 4J33A 2FJAA 1PBDA 2XFUA 1E1LA 2QA1A 3H4KA 3LB8A 1B5QA 1L0VA 3UCLA 4A65A 2O9ZA 5KOXA 2XLRA 3NYEA 3EF6A 4GDPA 5KMRA 2BXRA 3AYIA 2YG7A 2XFOA 4B65A 1FEAA 1B4VA 3P4PA 4K5SA 2ACZA 3NK0X 4H4XA 1PXBA 4G6HA 4ICYA 1SEZA 5DBJA 2GV8A 3T37A 4C77A 1IUSA 2OALA 2R9ZA 2X8GA 3ABVA 4J36A 1CC2A 1H83A 4U8OA 2E4GA 3SY4A 2BCGG 2VQ7A 4YWOA 2AQJA 2WOVA 2Q7VA 1UKVG 4GAVA 2WBAA 1IUUA 3GMCA 3UKLA 3NH3X 4H50A 3UP5A 3KLJA 1ZMDA 1S3BA 3AE5A 4B68A 2A89A 2C7GA 1PXCA 2A87A 1TYTA 3NHOX 2EQ9A 4CCQA 2BS2A 3NTDA 2WP6A 3PVCA 1FECA 3D1CA 3LJPA 2Y6QA 3V3NA 3F8PA 4II3A 3CGDA 2V3BA 3T2YA 4A7AA 2YLTA 2YLRA 3VRDB 2R0GA 2R4JA 1BWCA 3FBSA 2XLUA 2Q0LA 4H4PA 1XHCA 4U8JA 4EM3A 5KRQA 3AEEA 3IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C75 A;  3BI2 A;  3E1T A;  1ZK7 A;  3C4N A;  5HXI A;  1QJD A;  4JQ9 A;  3FIM B;  1O94 A;  4P9S A;  3UKP A;  5CQF A;  5GRT A;  3ICR A;  1BGN A;  2VOU A;  3GD3 A;  3NYC A;  3P4S A;  3EAN A;  3B6D A;  3NGC X;  4I58 A;  1Y56 B;  4D03 A;  1L9D A;  3IHM A;  1N4W A;  3AE4 A;  1L9E A;  3PO7 A;  2WOI A;  2AR8 A;  1P2H A;  4H4Q A;  1JEH A;  1OJT A;  5EBK A;  3NRN A;  2PHH A;  1D7Y A;  4Y4L A;  5J7X A;  3D8X A;  1PJ6 A;  4A6N B;  2GH5 A;  1DOC A;  3B3R A;  3QVP A;  2GF3 A;  1PBE A;  3BHK A;  4U2S A;  4H2R A;  4Z44 A;  3AD7 B;  1KSS A;  3IF9 A;  1CJC A;  3RED A;  2GQF A;  4C3X A;  2GAH B;  1KF6 A;  1S3E A;  1XDI A;  3GWD A;  1YQ4 A;  4CNJ A;  3AE6 A;  1YKJ A;  2RAB A;  1NG3 A;  4H4U A;  2Q0K A;  4GRT A;  3DH9 A;  1JRZ A;  2EQ7 A;  4OPG A;  4CNK A;  2RGO A;  3AEB A;  2WPC A;  4OPI A;  2YLX A;  1M64 A;  2GEW A;  4XWZ A;  2GB0 A;  3M12 A;  1GES A;  5U1O A;  2DKI A;  1FEB A;  3K30 A;  3OC4 A;  3RP8 A;  5HY5 A;  3L1R A;  1MXT A;  3KA7 A;  4OVI A;  1CL0 A;  3GRT A;  3KU9 A;  4AP1 A;  1JU2 A;  2X8C A;  1NHP A;  2WEU A;  1S2Q A;  3AYJ A;  2XCG A;  2EQ6 A;  3DJJ A;  3DJG X;  2ZZB A;  2RGJ A;  3NN6 X;  4TLX A;  3OZ2 A;  3NKS A;  3AE8 A;  4U8L A;  5JCN A;  2AAQ A;  2WU5 A;  3AE1 A;  4O5Q A;  1KFY A;  3EAO A;  4OCG A;  2UZZ A;  3DA1 A;  3PS9 A;  3UOY A;  3NG7 X;  4H2Q A;  5FS6 A;  2YR5 A;  1RYI A;  3AE3 A;  1N4V A;  1YY5 A;  5KVI A;  4YSX A;  5BRT A;  1IUW A;  2Z5Y A;  1GRA A;  3RP6 A;  3VR8 A;  2BYB A;  2BC0 A;  3CNP A;  4I59 A;  4GUV A;  4K7Z A;  2BC1 A;  1H82 A;  2YLZ A;  1GET A;  3NIX A;  4RG3 A;  4Y4N A;  1DOE A;  2A8X A;  2WDR A;  1OJA A;  1Q1R A;  3G5Q A;  3QSE A;  1GRE A;  4H4V A;  1QLB A;  1EL7 A;  1K0L A;  4U8K A;  4IV9 A;  4A99 A;  1W4X A;  1O5W A;  1JNZ A;  4B69 A;  2GR1 A;  4EIP A;  4C5O A;  1D4D A;  3AD8 B;  4USQ A;  1CJ2 A;  3CIR A;  2BK5 A;  5EOW A;  4CBQ A;  3COX A;  1GXF A;  3K7T A;  2EQ8 A;  2YVF A;  3DK4 A;  4FDC B;  4H2N A;  5BUL A;  4NTE A;  1IUT A;  3QVR A;  2XLS A;  1H84 A;  4RG4 A;  2WDQ A;  3V76 A;  1D5T A;  2IID A;  3UTE A;  1JNR A;  2C65 A;  4C3Y A;  3ICT A;  1PN0 A;  3URH A;  1D4E A;  2J3N A;  3FG2 P;  1E6E A;  2YVJ A;  3QFB A;  3P9U A;  4J2W A;  1GSN A;  4IVO B;  2XVF A;  2IVD A;  2CFY A;  3CGB A;  3ZDN A;  3LZX A;  1EL5 A;  1PXA A;  3BI4 A;  2B76 A;  4GR1 A;  4HB9 A;  2BS4 A;  1ZOY A;  3NLC A;  4K2X A;  3AEG A;  4GDE A;  4CRT A;  1TDF A;  1E39 A;  4BJZ A;  4EQX A;  2XVE A;  1DXL A;  3M13 A;  1FOH A;  2GRT A;  1TRB A;  2WOW A;  3P1W A;  1RSG A;  2R45 A;  1BF3 A;  1Q1W A;  1Y0P A;  4Z2T A;  1NPX A;  1OJD A;  1ZMC A;  3EPT A;  2VVL A;  2GR3 A;  1PS9 A;  3GD4 A;  1ZP0 A;  3VRB A;  1PBB A;  3AEA A;  5U25 A;  4LU6 A;  4AT0 A;  4U8I A;  4EIQ A;  5M10 A;  1EBD A;  1QO8 A;  3I3L A;  3VQR A;  3UP4 A;  5BVA A;  3QJ4 A;  1DOD A;  1IJH A;  1REO A;  4YKG A;  3G5S A;  4EMW A;  3NTA A;  3H8I A;  1GV4 A;  2C3C A;  4A79 A;  4ZCC A;  4U2T A;  1NHR A;  5JCM A;  2JB2 A;  3AE2 A;  4MJW A;  2APG A;  3ICS A;  1FCD A;  2C67 A;  3S5W A;  2B9W A;  1GAL A;  2YM1 A;  2XVI A;  1BKW A;  1GER A;  4X9N A;  5HHF A;  1HYU A;  1JRY A;  3JSK A;  4KPR A;  3VRA A;  4OPC A;  2V61 A;  2JAE A;  1F3P A;  3L8K A;  3II4 A;  3K7M X;  1CJ4 A;  2XFP A;  2WES A;  3ADA B;  4A5L A;  3GMB A;  3UKQ A;  4PAA A;  3SQP A;  2X99 A;  3Q6J A;  3DK8 A;  3KPF A;  4H4T A;  4AP3 A;  2Q6U A;  4UDP A;  1CJ3 A;  1PBC A;  1PBF A;  2F5Z A;  2OA1 A;  4U8P A;  2XVH A;  3NN0 X;  3AE7 A;  4YSZ A;  2JK6 A;  3UTF A;  1GND A;  4NEW A;  1JOA A;  2XLT A;  4NTC A;  4BJY A;  3G5R A;  4YSY A;  4J31 A;  3LOV A;  5IQ1 A;  2BS3 A;  2WU2 A;  3P4R A;  5CKU A;  3AEF A;  4EMI A;  4ECH A;  4Z43 A;  1IUV A;  1E1K A;  1OJ9 A;  1GRG A;  2X50 A;  2DKH A;  2HQM A;  3NT6 A;  5KWF A;  2BCP A;  2ZZ0 A;  3ALJ A;  1O95 A;  4APN A;  2QA2 A;  1K0I A;  1NAA A;  2C73 A;  1F8S A;  1BGJ A;  3ALL A;  4JNQ A;  1TDN A;  1F8R A;  5JCI A;  3UKF A;  1E1M A;  3ATQ A;  3CPI G;  4C74 A;  1E1N A;  3UTG A;  5BUK A;  1FL2 A;  2WS3 A;  3S61 A;  1ELI A;  1MO9 A;  3FMW A;  3GRS A;  2B7R A;  2R46 A;  3AEC A;  3AWI A;  4TM3 A;  1ZDL A;  2ZZC A;  2GR2 A;  4YTN A;  2V60 A;  2XLP A;  1Z6L A;  2YQU A;  4X4J A;  4FX9 A;  5JCL A;  1B37 A;  3DJE A;  3ALM A;  1PDH A;  4BK3 A;  2C76 A;  2VRL A;  2OAM A;  2QAE A;  3NYF A;  4H4S A;  3CTY A;  5KOW A;  4BK1 A;  3F8R A;  2E5V A;  4JDR A;  4J56 A;  3AB1 A;  2C72 A;  2QCU A;  3RHA A;  4OPT A;  1YQZ A;  1V59 A;  3P4Q A;  5EB4 A;  4FK1 A;  3DGH A;  2JB3 A;  5IQ4 A;  3LZW A;  2WQY A;  3SFE A;  3UOV A;  2CUL A;  2GQW A;  2Z5X A;  4BK2 A;  2XDO A;  5KXJ A;  1DJQ A;  2R4E A;  4DSG A;  1X31 B;  3UKH A;  2PYX A;  2BK3 A;  3C96 A;  4Z24 A;  2W0H A;  3M0O A;  4JY3 A;  4K8D A;  2WP5 A;  4XXG A;  3SM8 A;  1GRF A;  2E1M A;  4EQR A;  4Z2R A;  3BNM A;  4DSH A;  3AXB A;  2VRM A;  2VZ2 A;  2FBW A;  2WPF A;  2XFQ A;  4GCM A;  4B67 A;  2RGH A;  2H89 A;  4REK A;  3V3O A;  4ZN0 A;  2IVE A;  2BXS A;  2BAB A;  2B9X A;  4KX6 A;  1RP0 A;  3DJD A;  4TM4 A;  4USR A;  3UOZ A;  4NEV A;  3NK2 X;  3GYI A;  4YTP A;  1B8S A;  4CY6 A;  5IPY A;  1VQW A;  3ATR A;  1Q9I A;  2V6O A;  1LPF A;  3GDN A;  5FS8 A;  2V5Z A;  4IA5 A;  4AOS A;  1GTH A;  2XFN A;  2WET A;  5M0Z A;  4A9W A;  3CGC A;  2CVJ A;  1VG0 A;  4TM1 A;  4J34 A;  4H4W A;  1BZL A;  1EL9 A;  2H88 A;  2R0C A;  1LQT A;  4TM0 A;  4DGK A;  1GOS A;  4B1B A;  5ER0 A;  1GPE A;  5U63 A;  4B66 A;  1GRB A;  1CHU A;  1TDK A;  2VVL G;  4FK1 C;  1D7L A;  3LXD A;  3CPH G;  4E0V A;  4N9X A;  3CND A;  2FJB A;  3DK9 A;  2WPE A;  1DJN A;  5J60 A;  3GWF A;  1EL8 A;  1H7W A;  3O0H A;  5GSN A;  1K0J A;  2GAG B;  2CDU A;  3CN8 A;  4BUR A;  4OPU A;  1N1P A;  1NHQ A;  1AOG A;  3LAD A;  1ZX9 A;  2C70 A;  1ZOV A;  5C3J A;  3GDP A;  1LJ1 A;  3CPJ G;  2FJE A;  4U2L A;  1H6V A;  2TPR A;  4IA6 A;  5FMH A;  4CY8 A;  1GTE A;  2WP9 A;  3BHF A;  3CGE A;  3ZYX A;  1XAN A;  4YT0 A;  4Z2U A;  4Z26 A;  4ZCD A;  1KSU A;  4H7U A;  4YKF A;  1LQU A;  1ZY8 A;  1DNC A;  1GRT A;  1H81 A;  1VDC A;  5EB5 A;  1NG4 A;  3KKJ A;  2XVJ A;  1P2E A;  3VR9 A;  2YWL A;  3ISH A;  5FS9 A;  4H4Y A;  5C2T A;  3RP7 A;  1TYP A;  3KVE A;  4B63 A;  3UKK A;  1GT8 A;  1H7X A;  2ARD A;  4UP3 A;  3UOX A;  2VVM A;  4EQW A;  3CNT A;  3K7Q X;  2JKC A;  1D4C A;  4BV6 A;  3C4A A;  1CC6 A;  3IWA A;  1CC4 A;  2YG3 A;  4JY2 A;  4ADW A;  1Y56 A;  2B7S A;  3FPZ A;  1PJ7 A;  2NPX A;  2V3A A;  3NNE A;  2VQB A;  4YXD A;  3RNM A;  4H4Z A;  2GR0 A;  1CBO A;  4CCR A;  2GMJ A;  1KNP A;  1ZKQ A;  3HZL A;  1ONF A;  3AD9 B;  3Q9T A;  4K5R A;  3GYJ A;  1YQ3 A;  4NTD A;  4XWR A;  1NEK A;  3UKA A;  4A6N A;  4EQS A;  4J57 A;  1E7P A;  2C66 A;  1JRX A;  4X9M A;  2YG4 A;  2YR4 A;  2GMH A;  3BI5 A;  2GVC A;  4H4R A;  4EMJ A;  1LTX R;  2YLS A;  4IVM B;  4AOX A;  1LVL A;  1IUX A;  2X8H A;  3SFD A;  4AT2 A;  5LV9 A;  1TDO A;  4M52 A;  4DNA A;  4UDR A;  5KVH A;  3DME A;  4D04 A;  5TR3 A;  2ZBW A;  2YR6 A;  1VRQ B;  2BAC A;  1GEU A;  2Y6R A;  4OPD A;  2C64 A;  3QSM A;  3QFA A;  1KNR A;  2YAU A;  4WX1 A;  3I6D A;  4Z25 A;  1XPQ A;  3AED A;  4HA6 A;  2I0Z A;  4JN9 A;  1VG9 A;  3SGL A;  1NDA A;  2YG6 A;  1K4Q A;  4LII A;  3IC9 A;  1DOB A;  5FS7 A;  1F6M A;  4H2P A;  4TLZ A;  1COY A;  1PHH A;  2YVG A;  1PJ5 A;  4EM4 A;  2FJD A;  1TDE A;  2BK4 A;  4NZH A;  4UDQ A;  3AYL A;  4LA1 A;  4OPL A;  2WHD A;  1OJC A;  1L9C A;  1N4U A;  3F8D A;  2YLW A;  2JBV A;  2NVK X;  4YSH A;  3R9U A;  2OLO A;  2XYO A;  4K22 A;  4B64 A;  1F8W A;  2JB1 A;  3AE9 A;  4YTM A;  2OLN A;  4PAB A;  2C3D A;  1S2Y A;  3BNU A;  1H86 A;  4WCT A;  1GRH A;  4U8M A;  1LV0 A;  3WE0 A;  1KDG A;  1NHS A;  3ITJ A;  2BA9 A;  3KD9 A;  4U8N A;  4JNA A;  4GF7 A;  2YG5 A;  4RSL A;  2TMD A;  3H8L A;  4O5U A;  1CF3 A;  3CNS A;  3DGZ A;  5JCK A;  1MOK A;  1NEN A;  5HYM A;  3QSS A;  3GSI A;  5L46 A;  3NK1 X;  1M6I A;  2X3N A;  4Y4M A;  2B9Y A;  3UTH A;  2YM2 A;  2R0P A;  2WDV A;  3CNJ A;  4J33 A;  2FJA A;  1PBD A;  2XFU A;  1E1L A;  2QA1 A;  3H4K A;  3LB8 A;  1B5Q A;  1L0V A;  3UCL A;  4A65 A;  2O9Z A;  5KOX A;  2XLR A;  3NYE A;  3EF6 A;  4GDP A;  2BXR A;  3AYI A;  2YG7 A;  2XFO A;  4B65 A;  1FEA A;  1B4V A;  3P4P A;  4K5S A;  2ACZ A;  3NK0 X;  4H4X A;  1PXB A;  4ICY A;  1SEZ A;  5DBJ A;  2GV8 A;  3T37 A;  4C77 A;  1IUS A;  2OAL A;  2R9Z A;  2X8G A;  3ABV A;  4J36 A;  1CC2 A;  1H83 A;  4U8O A;  2E4G A;  2BCG G;  2VQ7 A;  4YWO A;  2AQJ A;  2WOV A;  2Q7V A;  1UKV G;  2WBA A;  1IUU A;  3GMC A;  3UKL A;  3NH3 X;  4H50 A;  3UP5 A;  3KLJ A;  1ZMD A;  1S3B A;  3AE5 A;  4B68 A;  2A89 A;  2C7G A;  1PXC A;  2A87 A;  1TYT A;  3NHO X;  2EQ9 A;  4CCQ A;  2BS2 A;  3NTD A;  2WP6 A;  3PVC A;  1FEC A;  3D1C A;  3LJP A;  2Y6Q A;  3V3N A;  3F8P A;  3CGD A;  2V3B A;  4A7A A;  2YLT A;  2YLR A;  3VRD B;  2R0G A;  2R4J A;  1BWC A;  3FBS A;  2XLU A;  2Q0L A;  4H4P A;  1XHC A;  4U8J A;  4EM3 A;  5KRQ A;  3AEE A;  3IHG A; 
#chains in the Genus database with same CATH topology
 2C75 A;  3BI2 A;  3E1T A;  1ZK7 A;  3C4N A;  5HXI A;  1QJD A;  4JQ9 A;  3FIM B;  1O94 A;  4P9S A;  3UKP A;  5CQF A;  5GRT A;  3ICR A;  1BGN A;  2VOU A;  3SX6 A;  3GD3 A;  3NYC A;  3P4S A;  3EAN A;  3B6D A;  3NGC X;  4I58 A;  4G74 A;  1Y56 B;  4D03 A;  1L9D A;  3IHM A;  1N4W A;  3AE4 A;  1L9E A;  3PO7 A;  2WOI A;  2AR8 A;  1P2H A;  4H4Q A;  1JEH A;  1OJT A;  5EBK A;  3NRN A;  2PHH A;  1D7Y A;  4Y4L A;  5J7X A;  3D8X A;  1PJ6 A;  4A6N B;  2GH5 A;  1DOC A;  3B3R A;  3QVP A;  2GF3 A;  1PBE A;  3BHK A;  4U2S A;  4H2R A;  4Z44 A;  3AD7 B;  1KSS A;  3IF9 A;  1CJC A;  3RED A;  2GQF A;  4C3X A;  2GAH B;  1KF6 A;  1S3E A;  1XDI A;  3GWD A;  1YQ4 A;  4CNJ A;  3AE6 A;  1YKJ A;  2RAB A;  1NG3 A;  4H4U A;  2Q0K A;  4GRT A;  3DH9 A;  1JRZ A;  2EQ7 A;  4OPG A;  4CNK A;  2RGO A;  3AEB A;  2WPC A;  4OPI A;  2YLX A;  1M64 A;  3CMM A;  2GEW A;  4XWZ A;  2GB0 A;  3M12 A;  1GES A;  5U1O A;  2DKI A;  1FEB A;  3K30 A;  3OC4 A;  3RP8 A;  5HY5 A;  3L1R A;  1MXT A;  3KA7 A;  4OVI A;  1CL0 A;  3GRT A;  3KU9 A;  4AP1 A;  1JU2 A;  2X8C A;  1NHP A;  2WEU A;  1S2Q A;  3AYJ A;  2XCG A;  2EQ6 A;  3DJJ A;  3DJG X;  2ZZB A;  2RGJ A;  2C4C A;  3NN6 X;  4TLX A;  3OZ2 A;  3NKS A;  3AE8 A;  4U8L A;  5JCN A;  2AAQ A;  2WU5 A;  3AE1 A;  4O5Q A;  1KFY A;  3EAO A;  4OCG A;  2UZZ A;  3DA1 A;  3PS9 A;  4GAP A;  3NG7 X;  3UOY A;  4H2Q A;  5FS6 A;  2YR5 A;  1RYI A;  3AE3 A;  1N4V A;  1YY5 A;  5KVI A;  4YSX A;  5BRT A;  1IUW A;  2Z5Y A;  1GRA A;  3RP6 A;  3VR8 A;  2BYB A;  2BC0 A;  3CNP A;  4I59 A;  4GUV A;  4K7Z A;  2BC1 A;  1H82 A;  2YLZ A;  1GET A;  3NIX A;  4RG3 A;  4Y4N A;  1DOE A;  2A8X A;  2WDR A;  1OJA A;  1Q1R A;  3G5Q A;  3QSE A;  1GRE A;  4H4V A;  1QLB A;  1EL7 A;  1K0L A;  4U8K A;  4IV9 A;  4A99 A;  1W4X A;  1O5W A;  1JNZ A;  4B69 A;  2GR1 A;  4EIP A;  4C5O A;  1D4D A;  3AD8 B;  4USQ A;  1CJ2 A;  3CIR A;  2BK5 A;  5EOW A;  4CBQ A;  3COX A;  1GXF A;  3K7T A;  2EQ8 A;  2YVF A;  3DK4 A;  4FDC B;  4H2N A;  5BUL A;  4NTE A;  1IUT A;  3QVR A;  2XLS A;  1H84 A;  4RG4 A;  2WDQ A;  3V76 A;  1D5T A;  2IID A;  3UTE A;  1JNR A;  2C65 A;  4C3Y A;  3ICT A;  1PN0 A;  2BRY A;  3URH A;  1D4E A;  2J3N A;  3FG2 P;  1E6E A;  2YVJ A;  3QFB A;  3P9U A;  4J2W A;  1GSN A;  4IVO B;  3HYV A;  2XVF A;  2IVD A;  2CFY A;  3CGB A;  3ZDN A;  3LZX A;  1EL5 A;  1PXA A;  3BI4 A;  2B76 A;  4GR1 A;  4HB9 A;  2BS4 A;  3T2K A;  1ZOY A;  3NLC A;  4K2X A;  3AEG A;  4GDE A;  4CRT A;  1TDF A;  1E39 A;  4BJZ A;  4EQX A;  2XVE A;  1DXL A;  3M13 A;  1FOH A;  2GRT A;  1TRB A;  2WOW A;  3P1W A;  1RSG A;  2R45 A;  1BF3 A;  1Q1W A;  1Y0P A;  4Z2T A;  1NPX A;  1OJD A;  4G73 A;  1ZMC A;  3EPT A;  2VVL A;  2GR3 A;  1PS9 A;  3GD4 A;  1ZP0 A;  3VRB A;  1PBB A;  3AEA A;  5U25 A;  4LU6 A;  4AT0 A;  4U8I A;  4EIQ A;  5M10 A;  1EBD A;  1QO8 A;  3I3L A;  3VQR A;  3UP4 A;  5BVA A;  3QJ4 A;  1DOD A;  1IJH A;  1REO A;  4YKG A;  3G5S A;  4EMW A;  3NTA A;  3H8I A;  1GV4 A;  2C3C A;  4A79 A;  4ZCC A;  4U2T A;  1NHR A;  5JCM A;  2JB2 A;  3AE2 A;  4MJW A;  2APG A;  3ICS A;  1FCD A;  2C67 A;  3S5W A;  2B9W A;  1GAL A;  2YM1 A;  2XVI A;  1BKW A;  1GER A;  4X9N A;  5HHF A;  1HYU A;  1JRY A;  3JSK A;  4KPR A;  3VRA A;  4OPC A;  2V61 A;  2JAE A;  1F3P A;  3L8K A;  3II4 A;  3K7M X;  1CJ4 A;  2XFP A;  2WES A;  3ADA B;  4A5L A;  3GMB A;  3UKQ A;  4PAA A;  3SQP A;  2X99 A;  3Q6J A;  3DK8 A;  3KPF A;  4H4T A;  4AP3 A;  2Q6U A;  4UDP A;  1CJ3 A;  1PBC A;  1PBF A;  2F5Z A;  2OA1 A;  4U8P A;  2XVH A;  3NN0 X;  3AE7 A;  4YSZ A;  2JK6 A;  3UTF A;  1GND A;  4NEW A;  1JOA A;  2XLT A;  4NTC A;  4BJY A;  3G5R A;  4YSY A;  4J31 A;  3LOV A;  5IQ1 A;  2BS3 A;  2WU2 A;  3P4R A;  5CKU A;  3AEF A;  4EMI A;  4ECH A;  4Z43 A;  1IUV A;  1E1K A;  1OJ9 A;  1GRG A;  2X50 A;  4NWZ A;  2DKH A;  2HQM A;  3NT6 A;  5KWF A;  2BCP A;  2ZZ0 A;  3ALJ A;  1O95 A;  4APN A;  2QA2 A;  1K0I A;  1NAA A;  2C73 A;  1F8S A;  1BGJ A;  3ALL A;  4JNQ A;  1TDN A;  1F8R A;  5JCI A;  3UKF A;  1E1M A;  3ATQ A;  3CPI G;  4C74 A;  1E1N A;  3UTG A;  5BUK A;  1FL2 A;  2WS3 A;  3S61 A;  1ELI A;  1MO9 A;  3FMW A;  3GRS A;  2B7R A;  2R46 A;  3KPK A;  3AEC A;  3AWI A;  4TM3 A;  1ZDL A;  2ZZC A;  2GR2 A;  4YTN A;  2V60 A;  2XLP A;  1Z6L A;  2YQU A;  4X4J A;  4FX9 A;  5JCL A;  1B37 A;  3DJE A;  3ALM A;  1PDH A;  4BK3 A;  2C76 A;  2VRL A;  2OAM A;  2QAE A;  3NYF A;  4H4S A;  3CTY A;  5KOW A;  4G9K A;  4BK1 A;  3F8R A;  2E5V A;  4JDR A;  4J56 A;  3AB1 A;  2C72 A;  2QCU A;  3RHA A;  4OPT A;  1YQZ A;  1V59 A;  3P4Q A;  5EB4 A;  4FK1 A;  3HYX A;  3DGH A;  2JB3 A;  5KMQ A;  5IQ4 A;  3LZW A;  2WQY A;  3SFE A;  3UOV A;  2CUL A;  2GQW A;  2Z5X A;  4BK2 A;  2XDO A;  5KXJ A;  1DJQ A;  2R4E A;  4DSG A;  1X31 B;  3UKH A;  2PYX A;  3SXI A;  2BK3 A;  3C96 A;  4Z24 A;  2W0H A;  3M0O A;  4JY3 A;  4II2 A;  4K8D A;  2WP5 A;  4XXG A;  3SM8 A;  1GRF A;  2E1M A;  3SZC A;  4EQR A;  4Z2R A;  3BNM A;  4DSH A;  3AXB A;  2VRM A;  2VZ2 A;  2FBW A;  2WPF A;  2XFQ A;  4GCM A;  4B67 A;  2RGH A;  2H89 A;  4REK A;  3V3O A;  4ZN0 A;  2IVE A;  2BXS A;  2BAB A;  2B9X A;  4KX6 A;  1RP0 A;  3DJD A;  4TM4 A;  4USR A;  3UOZ A;  4NEV A;  3NK2 X;  3GYI A;  4NNJ A;  1B8S A;  4CY6 A;  4YTP A;  5IPY A;  1VQW A;  3ATR A;  1Q9I A;  2V6O A;  1LPF A;  3GDN A;  5FS8 A;  2V5Z A;  4IA5 A;  4AOS A;  1GTH A;  2XFN A;  2WET A;  5M0Z A;  4A9W A;  3CGC A;  2CVJ A;  1VG0 A;  4TM1 A;  5KMS A;  4J34 A;  3SZW A;  4H4W A;  1BZL A;  1EL9 A;  2H88 A;  2R0C A;  1LQT A;  4TM0 A;  4DGK A;  1GOS A;  4B1B A;  5ER0 A;  1GPE A;  5U63 A;  4B66 A;  1GRB A;  1CHU A;  1TDK A;  2VVL G;  4FK1 C;  1D7L A;  3LXD A;  3CPH G;  4E0V A;  4N9X A;  3CND A;  2FJB A;  3DK9 A;  2WPE A;  1DJN A;  5J60 A;  3GWF A;  1EL8 A;  1H7W A;  3O0H A;  5GSN A;  1K0J A;  2GAG B;  2CDU A;  3CN8 A;  3T14 A;  4BUR A;  4OPU A;  1N1P A;  1NHQ A;  1AOG A;  3LAD A;  1ZX9 A;  2C70 A;  1ZOV A;  5C3J A;  3GDP A;  1LJ1 A;  3CPJ G;  2FJE A;  4U2L A;  1H6V A;  2TPR A;  4IA6 A;  5FMH A;  4CY8 A;  1GTE A;  2WP9 A;  3BHF A;  3CGE A;  3SZ0 A;  1XAN A;  3ZYX A;  4YT0 A;  4Z2U A;  4Z26 A;  4ZCD A;  1KSU A;  4H7U A;  4YKF A;  1LQU A;  1ZY8 A;  1DNC A;  1GRT A;  1H81 A;  1VDC A;  5EB5 A;  1NG4 A;  3KKJ A;  2XVJ A;  3SZF A;  1P2E A;  3VR9 A;  2YWL A;  3ISH A;  5FS9 A;  4H4Y A;  5C2T A;  3RP7 A;  1TYP A;  3KVE A;  3HYW A;  4B63 A;  3UKK A;  1GT8 A;  1H7X A;  2ARD A;  4UP3 A;  3UOX A;  2VVM A;  4EQW A;  3CNT A;  3K7Q X;  2JKC A;  1D4C A;  4BV6 A;  3C4A A;  1CC6 A;  3IWA A;  1CC4 A;  2YG3 A;  4JY2 A;  4ADW A;  1Y56 A;  2B7S A;  3FPZ A;  1PJ7 A;  2NPX A;  2V3A A;  3NNE A;  2VQB A;  4YXD A;  3RNM A;  4H4Z A;  2GR0 A;  1CBO A;  4CCR A;  2GMJ A;  1KNP A;  1ZKQ A;  3T2Z A;  3HZL A;  1ONF A;  3AD9 B;  3Q9T A;  4K5R A;  3GYJ A;  1YQ3 A;  4NTD A;  4XWR A;  1NEK A;  3UKA A;  4A6N A;  4EQS A;  4J57 A;  1E7P A;  2C66 A;  1JRX A;  4X9M A;  2YG4 A;  2YR4 A;  5KNL A;  2GMH A;  3BI5 A;  2GVC A;  4H4R A;  4EMJ A;  1LTX R;  2YLS A;  4IVM B;  4AOX A;  1LVL A;  3T0K A;  1IUX A;  2X8H A;  3SFD A;  4AT2 A;  5LV9 A;  1TDO A;  4M52 A;  4DNA A;  4UDR A;  5KVH A;  3DME A;  4G6G A;  4D04 A;  5TR3 A;  2ZBW A;  2YR6 A;  1VRQ B;  2BAC A;  1GEU A;  2BRA A;  2Y6R A;  4OPD A;  2C64 A;  3QSM A;  3QFA A;  1KNR A;  2YAU A;  4WX1 A;  3I6D A;  4Z25 A;  1XPQ A;  3AED A;  4HA6 A;  2I0Z A;  4JN9 A;  1VG9 A;  3SGL A;  1NDA A;  2YG6 A;  1K4Q A;  4LII A;  3T31 A;  3IC9 A;  3GYX A;  1DOB A;  5FS7 A;  1F6M A;  4H2P A;  4TLZ A;  1COY A;  1PHH A;  2YVG A;  1PJ5 A;  4EM4 A;  2FJD A;  1TDE A;  2BK4 A;  4NZH A;  4UDQ A;  3AYL A;  4LA1 A;  4OPL A;  2WHD A;  1OJC A;  1L9C A;  1N4U A;  3F8D A;  2YLW A;  2JBV A;  2NVK X;  5KMP A;  3SYI A;  4YSH A;  3R9U A;  2OLO A;  2XYO A;  4K22 A;  4B64 A;  1F8W A;  2JB1 A;  3AE9 A;  4YTM A;  2OLN A;  4PAB A;  2C3D A;  1S2Y A;  3BNU A;  1H86 A;  4WCT A;  1GRH A;  4U8M A;  1LV0 A;  3WE0 A;  1KDG A;  1NHS A;  3ITJ A;  2BA9 A;  3KD9 A;  4U8N A;  4JNA A;  4GF7 A;  2YG5 A;  4RSL A;  2TMD A;  3H8L A;  4O5U A;  1CF3 A;  3CNS A;  3DGZ A;  5JCK A;  1MOK A;  1NEN A;  5HYM A;  3QSS A;  3GSI A;  5L46 A;  3NK1 X;  1M6I A;  2X3N A;  4Y4M A;  2B9Y A;  3UTH A;  2YM2 A;  2R0P A;  2WDV A;  3CNJ A;  4J33 A;  2FJA A;  1PBD A;  2XFU A;  1E1L A;  2QA1 A;  3H4K A;  3LB8 A;  1B5Q A;  1L0V A;  3UCL A;  4A65 A;  2O9Z A;  5KOX A;  2XLR A;  3NYE A;  3EF6 A;  4GDP A;  5KMR A;  2BXR A;  3AYI A;  2YG7 A;  2XFO A;  4B65 A;  1FEA A;  1B4V A;  3P4P A;  4K5S A;  2ACZ A;  3NK0 X;  4H4X A;  1PXB A;  4G6H A;  4ICY A;  1SEZ A;  5DBJ A;  2GV8 A;  3T37 A;  4C77 A;  1IUS A;  2OAL A;  2R9Z A;  2X8G A;  3ABV A;  4J36 A;  1CC2 A;  1H83 A;  4U8O A;  2E4G A;  3SY4 A;  2BCG G;  2VQ7 A;  4YWO A;  2AQJ A;  2WOV A;  2Q7V A;  1UKV G;  4GAV A;  2WBA A;  1IUU A;  3GMC A;  3UKL A;  3NH3 X;  4H50 A;  3UP5 A;  3KLJ A;  1ZMD A;  1S3B A;  3AE5 A;  4B68 A;  2A89 A;  2C7G A;  1PXC A;  2A87 A;  1TYT A;  3NHO X;  2EQ9 A;  4CCQ A;  2BS2 A;  3NTD A;  2WP6 A;  3PVC A;  1FEC A;  3D1C A;  3LJP A;  2Y6Q A;  3V3N A;  3F8P A;  4II3 A;  3CGD A;  2V3B A;  3T2Y A;  4A7A A;  2YLT A;  2YLR A;  3VRD B;  2R0G A;  2R4J A;  1BWC A;  3FBS A;  2XLU A;  2Q0L A;  4H4P A;  1XHC A;  4U8J A;  4EM3 A;  5KRQ A;  3AEE A;  3IHG A; 
#chains in the Genus database with same CATH homology
 2C75 A;  3BI2 A;  3E1T A;  1ZK7 A;  3C4N A;  5HXI A;  1QJD A;  4JQ9 A;  3FIM B;  1O94 A;  4P9S A;  3UKP A;  5CQF A;  5GRT A;  3ICR A;  1BGN A;  2VOU A;  3SX6 A;  3GD3 A;  3NYC A;  3P4S A;  3EAN A;  3B6D A;  3NGC X;  4I58 A;  4G74 A;  1Y56 B;  4D03 A;  1L9D A;  3IHM A;  1N4W A;  3AE4 A;  1L9E A;  3PO7 A;  2WOI A;  2AR8 A;  1P2H A;  4H4Q A;  1JEH A;  1OJT A;  5EBK A;  3NRN A;  2PHH A;  1D7Y A;  4Y4L A;  5J7X A;  3D8X A;  1PJ6 A;  4A6N B;  2GH5 A;  1DOC A;  3B3R A;  3QVP A;  2GF3 A;  1PBE A;  3BHK A;  4U2S A;  4H2R A;  4Z44 A;  3AD7 B;  1KSS A;  3IF9 A;  1CJC A;  3RED A;  2GQF A;  4C3X A;  2GAH B;  1KF6 A;  1S3E A;  1XDI A;  3GWD A;  1YQ4 A;  4CNJ A;  3AE6 A;  1YKJ A;  2RAB A;  1NG3 A;  4H4U A;  2Q0K A;  4GRT A;  3DH9 A;  1JRZ A;  2EQ7 A;  4OPG A;  4CNK A;  2RGO A;  3AEB A;  2WPC A;  4OPI A;  2YLX A;  1M64 A;  3CMM A;  2GEW A;  4XWZ A;  2GB0 A;  3M12 A;  1GES A;  5U1O A;  2DKI A;  1FEB A;  3K30 A;  3OC4 A;  3RP8 A;  5HY5 A;  3L1R A;  1MXT A;  3KA7 A;  4OVI A;  1CL0 A;  3GRT A;  3KU9 A;  4AP1 A;  1JU2 A;  2X8C A;  1NHP A;  2WEU A;  1S2Q A;  3AYJ A;  2XCG A;  2EQ6 A;  3DJJ A;  3DJG X;  2ZZB A;  2RGJ A;  2C4C A;  3NN6 X;  4TLX A;  3OZ2 A;  3NKS A;  3AE8 A;  4U8L A;  5JCN A;  2AAQ A;  2WU5 A;  3AE1 A;  4O5Q A;  1KFY A;  3EAO A;  4OCG A;  2UZZ A;  3DA1 A;  3PS9 A;  4GAP A;  3NG7 X;  3UOY A;  4H2Q A;  5FS6 A;  2YR5 A;  1RYI A;  3AE3 A;  1N4V A;  1YY5 A;  5KVI A;  4YSX A;  5BRT A;  1IUW A;  2Z5Y A;  1GRA A;  3RP6 A;  3VR8 A;  2BYB A;  2BC0 A;  3CNP A;  4I59 A;  4GUV A;  4K7Z A;  2BC1 A;  1H82 A;  2YLZ A;  1GET A;  3NIX A;  4RG3 A;  4Y4N A;  1DOE A;  2A8X A;  2WDR A;  1OJA A;  1Q1R A;  3G5Q A;  3QSE A;  1GRE A;  4H4V A;  1QLB A;  1EL7 A;  1K0L A;  4U8K A;  4IV9 A;  4A99 A;  1W4X A;  1O5W A;  1JNZ A;  4B69 A;  2GR1 A;  4EIP A;  4C5O A;  1D4D A;  3AD8 B;  4USQ A;  1CJ2 A;  3CIR A;  2BK5 A;  5EOW A;  4CBQ A;  3COX A;  1GXF A;  3K7T A;  2EQ8 A;  2YVF A;  3DK4 A;  4FDC B;  4H2N A;  5BUL A;  4NTE A;  1IUT A;  3QVR A;  2XLS A;  1H84 A;  4RG4 A;  2WDQ A;  3V76 A;  1D5T A;  2IID A;  3UTE A;  1JNR A;  2C65 A;  4C3Y A;  3ICT A;  1PN0 A;  2BRY A;  3URH A;  1D4E A;  2J3N A;  3FG2 P;  1E6E A;  2YVJ A;  3QFB A;  3P9U A;  4J2W A;  1GSN A;  4IVO B;  3HYV A;  2XVF A;  2IVD A;  2CFY A;  3CGB A;  3ZDN A;  3LZX A;  1EL5 A;  1PXA A;  3BI4 A;  2B76 A;  4GR1 A;  4HB9 A;  2BS4 A;  3T2K A;  1ZOY A;  3NLC A;  4K2X A;  3AEG A;  4GDE A;  4CRT A;  1TDF A;  1E39 A;  4BJZ A;  4EQX A;  2XVE A;  1DXL A;  3M13 A;  1FOH A;  2GRT A;  1TRB A;  2WOW A;  3P1W A;  1RSG A;  2R45 A;  1BF3 A;  1Q1W A;  1Y0P A;  4Z2T A;  1NPX A;  1OJD A;  4G73 A;  1ZMC A;  3EPT A;  2VVL A;  2GR3 A;  1PS9 A;  3GD4 A;  1ZP0 A;  3VRB A;  1PBB A;  3AEA A;  5U25 A;  4LU6 A;  4AT0 A;  4U8I A;  4EIQ A;  5M10 A;  1EBD A;  1QO8 A;  3I3L A;  3VQR A;  3UP4 A;  5BVA A;  3QJ4 A;  1DOD A;  1IJH A;  1REO A;  4YKG A;  3G5S A;  4EMW A;  3NTA A;  3H8I A;  1GV4 A;  2C3C A;  4A79 A;  4ZCC A;  4U2T A;  1NHR A;  5JCM A;  2JB2 A;  3AE2 A;  4MJW A;  2APG A;  3ICS A;  1FCD A;  2C67 A;  3S5W A;  2B9W A;  1GAL A;  2YM1 A;  2XVI A;  1BKW A;  1GER A;  4X9N A;  5HHF A;  1HYU A;  1JRY A;  3JSK A;  4KPR A;  3VRA A;  4OPC A;  2V61 A;  2JAE A;  1F3P A;  3L8K A;  3II4 A;  3K7M X;  1CJ4 A;  2XFP A;  2WES A;  3ADA B;  4A5L A;  3GMB A;  3UKQ A;  4PAA A;  3SQP A;  2X99 A;  3Q6J A;  3DK8 A;  3KPF A;  4H4T A;  4AP3 A;  2Q6U A;  4UDP A;  1CJ3 A;  1PBC A;  1PBF A;  2F5Z A;  2OA1 A;  4U8P A;  2XVH A;  3NN0 X;  3AE7 A;  4YSZ A;  2JK6 A;  3UTF A;  1GND A;  4NEW A;  1JOA A;  2XLT A;  4NTC A;  4BJY A;  3G5R A;  4YSY A;  4J31 A;  3LOV A;  5IQ1 A;  2BS3 A;  2WU2 A;  3P4R A;  5CKU A;  3AEF A;  4EMI A;  4ECH A;  4Z43 A;  1IUV A;  1E1K A;  1OJ9 A;  1GRG A;  2X50 A;  4NWZ A;  2DKH A;  2HQM A;  3NT6 A;  5KWF A;  2BCP A;  2ZZ0 A;  3ALJ A;  1O95 A;  4APN A;  2QA2 A;  1K0I A;  1NAA A;  2C73 A;  1F8S A;  1BGJ A;  3ALL A;  4JNQ A;  1TDN A;  1F8R A;  5JCI A;  3UKF A;  1E1M A;  3ATQ A;  3CPI G;  4C74 A;  1E1N A;  3UTG A;  5BUK A;  1FL2 A;  2WS3 A;  3S61 A;  1ELI A;  1MO9 A;  3FMW A;  3GRS A;  2B7R A;  2R46 A;  3KPK A;  3AEC A;  3AWI A;  4TM3 A;  1ZDL A;  2ZZC A;  2GR2 A;  4YTN A;  2V60 A;  2XLP A;  1Z6L A;  2YQU A;  4X4J A;  4FX9 A;  5JCL A;  1B37 A;  3DJE A;  3ALM A;  1PDH A;  4BK3 A;  2C76 A;  2VRL A;  2OAM A;  2QAE A;  3NYF A;  4H4S A;  3CTY A;  5KOW A;  4G9K A;  4BK1 A;  3F8R A;  2E5V A;  4JDR A;  4J56 A;  3AB1 A;  2C72 A;  2QCU A;  3RHA A;  4OPT A;  1YQZ A;  1V59 A;  3P4Q A;  5EB4 A;  4FK1 A;  3HYX A;  3DGH A;  2JB3 A;  5KMQ A;  5IQ4 A;  3LZW A;  2WQY A;  3SFE A;  3UOV A;  2CUL A;  2GQW A;  2Z5X A;  4BK2 A;  2XDO A;  5KXJ A;  1DJQ A;  2R4E A;  4DSG A;  1X31 B;  3UKH A;  2PYX A;  3SXI A;  2BK3 A;  3C96 A;  4Z24 A;  2W0H A;  3M0O A;  4JY3 A;  4II2 A;  4K8D A;  2WP5 A;  4XXG A;  3SM8 A;  1GRF A;  2E1M A;  3SZC A;  4EQR A;  4Z2R A;  3BNM A;  4DSH A;  3AXB A;  2VRM A;  2VZ2 A;  2FBW A;  2WPF A;  2XFQ A;  4GCM A;  4B67 A;  2RGH A;  2H89 A;  4REK A;  3V3O A;  4ZN0 A;  2IVE A;  2BXS A;  2BAB A;  2B9X A;  4KX6 A;  1RP0 A;  3DJD A;  4TM4 A;  4USR A;  3UOZ A;  4NEV A;  3NK2 X;  3GYI A;  4NNJ A;  1B8S A;  4CY6 A;  4YTP A;  5IPY A;  1VQW A;  3ATR A;  1Q9I A;  2V6O A;  1LPF A;  3GDN A;  5FS8 A;  2V5Z A;  4IA5 A;  4AOS A;  1GTH A;  2XFN A;  2WET A;  5M0Z A;  4A9W A;  3CGC A;  2CVJ A;  1VG0 A;  4TM1 A;  5KMS A;  4J34 A;  3SZW A;  4H4W A;  1BZL A;  1EL9 A;  2H88 A;  2R0C A;  1LQT A;  4TM0 A;  4DGK A;  1GOS A;  4B1B A;  5ER0 A;  1GPE A;  5U63 A;  4B66 A;  1GRB A;  1CHU A;  1TDK A;  2VVL G;  4FK1 C;  1D7L A;  3LXD A;  3CPH G;  4E0V A;  4N9X A;  3CND A;  2FJB A;  3DK9 A;  2WPE A;  1DJN A;  5J60 A;  3GWF A;  1EL8 A;  1H7W A;  3O0H A;  5GSN A;  1K0J A;  2GAG B;  2CDU A;  3CN8 A;  3T14 A;  4BUR A;  4OPU A;  1N1P A;  1NHQ A;  1AOG A;  3LAD A;  1ZX9 A;  2C70 A;  1ZOV A;  5C3J A;  3GDP A;  1LJ1 A;  3CPJ G;  2FJE A;  4U2L A;  1H6V A;  2TPR A;  4IA6 A;  5FMH A;  4CY8 A;  1GTE A;  2WP9 A;  3BHF A;  3CGE A;  3SZ0 A;  1XAN A;  3ZYX A;  4YT0 A;  4Z2U A;  4Z26 A;  4ZCD A;  1KSU A;  4H7U A;  4YKF A;  1LQU A;  1ZY8 A;  1DNC A;  1GRT A;  1H81 A;  1VDC A;  5EB5 A;  1NG4 A;  3KKJ A;  2XVJ A;  3SZF A;  1P2E A;  3VR9 A;  2YWL A;  3ISH A;  5FS9 A;  4H4Y A;  5C2T A;  3RP7 A;  1TYP A;  3KVE A;  3HYW A;  4B63 A;  3UKK A;  1GT8 A;  1H7X A;  2ARD A;  4UP3 A;  3UOX A;  2VVM A;  4EQW A;  3CNT A;  3K7Q X;  2JKC A;  1D4C A;  4BV6 A;  3C4A A;  1CC6 A;  3IWA A;  1CC4 A;  2YG3 A;  4JY2 A;  4ADW A;  1Y56 A;  2B7S A;  3FPZ A;  1PJ7 A;  2NPX A;  2V3A A;  3NNE A;  2VQB A;  4YXD A;  3RNM A;  4H4Z A;  2GR0 A;  1CBO A;  4CCR A;  2GMJ A;  1KNP A;  1ZKQ A;  3T2Z A;  3HZL A;  1ONF A;  3AD9 B;  3Q9T A;  4K5R A;  3GYJ A;  1YQ3 A;  4NTD A;  4XWR A;  1NEK A;  3UKA A;  4A6N A;  4EQS A;  4J57 A;  1E7P A;  2C66 A;  1JRX A;  4X9M A;  2YG4 A;  2YR4 A;  5KNL A;  2GMH A;  3BI5 A;  2GVC A;  4H4R A;  4EMJ A;  1LTX R;  2YLS A;  4IVM B;  4AOX A;  1LVL A;  3T0K A;  1IUX A;  2X8H A;  3SFD A;  4AT2 A;  5LV9 A;  1TDO A;  4M52 A;  4DNA A;  4UDR A;  5KVH A;  3DME A;  4G6G A;  4D04 A;  5TR3 A;  2ZBW A;  2YR6 A;  1VRQ B;  2BAC A;  1GEU A;  2BRA A;  2Y6R A;  4OPD A;  2C64 A;  3QSM A;  3QFA A;  1KNR A;  2YAU A;  4WX1 A;  3I6D A;  4Z25 A;  1XPQ A;  3AED A;  4HA6 A;  2I0Z A;  4JN9 A;  1VG9 A;  3SGL A;  1NDA A;  2YG6 A;  1K4Q A;  4LII A;  3T31 A;  3IC9 A;  3GYX A;  1DOB A;  5FS7 A;  1F6M A;  4H2P A;  4TLZ A;  1COY A;  1PHH A;  2YVG A;  1PJ5 A;  4EM4 A;  2FJD A;  1TDE A;  2BK4 A;  4NZH A;  4UDQ A;  3AYL A;  4LA1 A;  4OPL A;  2WHD A;  1OJC A;  1L9C A;  1N4U A;  3F8D A;  2YLW A;  2JBV A;  2NVK X;  5KMP A;  3SYI A;  4YSH A;  3R9U A;  2OLO A;  2XYO A;  4K22 A;  4B64 A;  1F8W A;  2JB1 A;  3AE9 A;  4YTM A;  2OLN A;  4PAB A;  2C3D A;  1S2Y A;  3BNU A;  1H86 A;  4WCT A;  1GRH A;  4U8M A;  1LV0 A;  3WE0 A;  1KDG A;  1NHS A;  3ITJ A;  2BA9 A;  3KD9 A;  4U8N A;  4JNA A;  4GF7 A;  2YG5 A;  4RSL A;  2TMD A;  3H8L A;  4O5U A;  1CF3 A;  3CNS A;  3DGZ A;  5JCK A;  1MOK A;  1NEN A;  5HYM A;  3QSS A;  3GSI A;  5L46 A;  3NK1 X;  1M6I A;  2X3N A;  4Y4M A;  2B9Y A;  3UTH A;  2YM2 A;  2R0P A;  2WDV A;  3CNJ A;  4J33 A;  2FJA A;  1PBD A;  2XFU A;  1E1L A;  2QA1 A;  3H4K A;  3LB8 A;  1B5Q A;  1L0V A;  3UCL A;  4A65 A;  2O9Z A;  5KOX A;  2XLR A;  3NYE A;  3EF6 A;  4GDP A;  5KMR A;  2BXR A;  3AYI A;  2YG7 A;  2XFO A;  4B65 A;  1FEA A;  1B4V A;  3P4P A;  4K5S A;  2ACZ A;  3NK0 X;  4H4X A;  1PXB A;  4G6H A;  4ICY A;  1SEZ A;  5DBJ A;  2GV8 A;  3T37 A;  4C77 A;  1IUS A;  2OAL A;  2R9Z A;  2X8G A;  3ABV A;  4J36 A;  1CC2 A;  1H83 A;  4U8O A;  2E4G A;  3SY4 A;  2BCG G;  2VQ7 A;  4YWO A;  2AQJ A;  2WOV A;  2Q7V A;  1UKV G;  4GAV A;  2WBA A;  1IUU A;  3GMC A;  3UKL A;  3NH3 X;  4H50 A;  3UP5 A;  3KLJ A;  1ZMD A;  1S3B A;  3AE5 A;  4B68 A;  2A89 A;  2C7G A;  1PXC A;  2A87 A;  1TYT A;  3NHO X;  2EQ9 A;  4CCQ A;  2BS2 A;  3NTD A;  2WP6 A;  3PVC A;  1FEC A;  3D1C A;  3LJP A;  2Y6Q A;  3V3N A;  3F8P A;  4II3 A;  3CGD A;  2V3B A;  3T2Y A;  4A7A A;  2YLT A;  2YLR A;  3VRD B;  2R0G A;  2R4J A;  1BWC A;  3FBS A;  2XLU A;  2Q0L A;  4H4P A;  1XHC A;  4U8J A;  4EM3 A;  5KRQ A;  3AEE A;  3IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...