2CVJA

Crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
MWDVIVVGGGPSGLSAALFLARAGLKVLVLDGGRSKVKGVSRVPNYPGLLDEPSGEELLRRLEAHARRYGAEVRPGVVKGVRDMGGVFEVETEEGVEKAERLLLCTHKDPTLPSLLGLTRRGAYIDTDEGGRTSYPRVYAAGVARGKVPGHAIISAGDGAYVAVHLVSDLRGEPYKDHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin reductase related protein
publication title Crystal Structure of thioredoxin reductase-related protein TTHA0370 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 56
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2cvjA01
2C73A 1OJAA 2GMHA 3URHA 4BJZA 2WDQA 2YLTA 4GDPA 3M0OA 1L9EA 2V60A 3H8IA 3ZDNA 5BRTA 5GSNA 2C72A 2J3NA 1QO8A 1IUVA 3IHGA 4UDPA 2QAEA 4Z24A 3II4A 2ZBWA 3AEAA 3GRSA 2ARDA 4Y4NA 2YLZA 4YKGA 1CHUA 3AEDA 2YLXA 3BNMA 4U8LA 2BC0A 4CCQA 1OJ9A 2XVEA 1F3PA 1GOSA 1KSUA 2YR5A 4XWRA 3RP6A 2XLUA 1Q9IA 5HHFA 4BV6A 3VRBA 1TYTA 4NTCA 3C4AA 3NRNA 5KRQA 1E1LA 3UOYA 4U2TA 3P1WA 1CBOA 3F8PA 3PO7A 1PBBA 3GMCA 3SFDA 1O94A 2ZZBA 2BYBA 3FG2P 2JB2A 3CGCA 4H4QA 5EOWA 3AEGA 4CRTA 1TYPA 4B1BA 2YG3A 4K8DA 2BXRA 3ALLA 4OPUA 4UDQA 2R0CA 3NH3X 4K5SA 2FJDA 2VRLA 3NYCA 4OPCA 2TPRA 2W0HA 5EBKA 1ZY8A 3DK4A 1GRBA 3UKHA 4B64A 2IIDA 3K30A 3LZWA 4B67A 2RGOA 1K0IA 4LIIA 2A89A 2Y6RA 4H4ZA 2C66A 5BULA 4J2WA 2GR3A 1DJQA 3KVEA 1H7WA 2JBVA 3KPFA 4XWZA 2QA2A 2NPXA 3FPZA 3EF6A 3DA1A 4JNQA 3L8KA 3UCLA 4A5LA 3ICTA 4A65A 4A6NA 2VQBA 2WPFA 4YSZA 3RP7A 1H84A 3PVCA 4J33A 4AT0A 1BZLA 2BS2A 2WBAA 4H4TA 3AE9A 2RGHA 1D7YA 4TLXA 3ALMA 5FS8A 3AD9B 2A87A 2OALA 3AE6A 3ATQA 4JQ9A 3UOXA 1DOBA 3AEBA 1S3EA 1ZDLA 4EMWA 4HA6A 1OJDA 1JRYA 4E0VA 1E1KA 2YVFA 1CC4A 5U63A 1YQZA 3KU9A 4OPIA 1B5QA 1PXCA 1S3BA 2CFYA 2H88A 5IPYA 1NAAA 2B9WA 5DBJA 4U2SA 4Y4MA 3RP8A 3CNJA 5IQ4A 4RG4A 1OJTA 3AYJA 3BI5A 2WP9A 1JNZA 3SGLA 4NEWA 1YQ3A 1Y0PA 2XCGA 4Z44A 4DNAA 3GWDA 3DK9A 4B69A 1H6VA 2WP6A 3QVRA 3LB8A 2DKHA 4U8PA 3NK1X 4X9NA 3F8RA 4Z2TA 4IA5A 4TLZA 1Y56A 2Q0KA 2QA1A 3CNTA 3P4SA 1D4DA 4EQXA 1GPEA 1Z6LA 3AEFA 1DNCA 1TDFA 3WE0A 5JCNA 2O9ZA 2JKCA 1MO9A 4C74A 3DJDA 3GYJA 2XLRA 3BI4A 1L9DA 2XYOA 2RGJA 2YG4A 4IVMB 3VR9A 4EMIA 1EL7A 4GCMA 3K7TA 1BWCA 2E1MA 3R9UA 1JOAA 3QVPA 4U8OA 2YLSA 1GREA 1FOHA 4GR1A 4AP3A 2EQ9A 4A99A 3KD9A 4PABA 1LJ1A 2C75A 3GD3A 1ZX9A 4NTDA 3IF9A 3ICSA 3UKLA 1ZKQA 2Z5XA 3CGBA 3D1CA 4GDEA 4U8KA 4GF7A 3SFEA 3AECA 1GRGA 1P2EA 4OPDA 4H4SA 2R9ZA 1H86A 2FJBA 3NG7X 3S61A 4A7AA 2VVMA 1BKWA 3BNUA 1O95A 5KVHA 4HB9A 2JB3A 1GSNA 1FECA 2VRMA 3I6DA 3DJGX 1H82A 3AYLA 1TRBA 1DODA 4N9XA 4D04A 1EBDA 2WDRA 3H8LA 5EB4A 1D5TA 1DOCA 3ALJA 1ZK7A 1ZOVA 1VDCA 2JK6A 3CPHG 1GT8A 1GRFA 2B7RA 2VQ7A 2E5VA 3E1TA 5FS6A 3NTDA 2CDUA 3UKAA 3AE8A 1LQUA 2XVIA 2C7GA 3D8XA 2V6OA 4J36A 4I58A 1GESA 5HY5A 4FDCB 2BK5A 5CKUA 2IVEA 3CN8A 4C5OA 2VVLG 4M52A 1W4XA 4B63A 4H2NA 2XFOA 2X8GA 1AOGA 2YM2A 1F8RA 2YQUA 3KKJA 3NT6A 4ZN0A 1PS9A 3RHAA 1E7PA 3BHKA 2AR8A 1NG3A 2YVGA 4Z2UA 4J31A 5KOWA 4CY6A 4C77A 1K4QA 2WQYA 2GQWA 2WOVA 4OVIA 1KSSA 1GRTA 1CJ3A 1Q1RA 2GAGB 3NGCX 3S5WA 1NPXA 1JU2A 1TDNA 3UOZA 2WEUA 4J56A 2UZZA 4J34A 3ICRA 1GV4A 3M13A 3UKQA 5C3JA 1NHPA 4YSYA 3NIXA 4H4RA 3NYFA 3QSMA 3KLJA 4TM0A 1Q1WA 4OCGA 1GRAA 3VRAA 5HXIA 3M12A 1YY5A 2WPEA 4BURA 3O0HA 2VZ2A 1H83A 1E39A 2OAMA 3LXDA 3QSSA 2R4JA 3G5SA 1FEAA 2YAUA 5IQ1A 1RP0A 5JCIA 3B6DA 1REOA 2BC1A 3ATRA 3GD4A 4ECHA 2BS4A 2ZZ0A 4WCTA 1PJ7A 3DJEA 4TM1A 4U8IA 2NVKX 4AP1A 1D7LA 3H4KA 2EQ8A 3NK2X 5FS9A 2C76A 3GYIA 1PJ5A 2X3NA 3LJPA 5JCKA 2GH5A 1NEKA 4NZHA 4JY2A 3AD8B 4IVOB 2V3BA 4USRA 4A79A 2APGA 3DGZA 4A9WA 2R4EA 1CL0A 3AYIA 4AT2A 1FL2A 1JNRA 4J57A 4APNA 4O5QA 2WS3A 2WOIA 4LU6A 2V61A 1KNPA 2BABA 3G5QA 3UTEA 5U1OA 3CGDA 2FJAA 1JRXA 3AE3A 5ER0A 3GWFA 4Z25A 1XDIA 4GRTA 4Z2RA 1CC2A 4IV9A 1EL9A 4UP3A 3NN0X 2XFNA 2GQFA 4U2LA 1M64A 4BK3A 2BCPA 3UOVA 4U8NA 1DXLA 1LVLA 3NHOX 1BGNA 1IUTA 1GRHA 3CIRA 1TDOA 3IC9A 3GRTA 1M6IA 1KNRA 4I59A 2GR1A 4TM3A 4X4JA 1GEUA 3CPJG 1GALA 1YKJA 3AE2A 3ABVA 4LA1A 2V5ZA 4OPTA 1H81A 1KDGA 2BK3A 3P9UA 1O5WA 1Y56B 1PBEA 2ACZA 1D4CA 3AB1A 1F8SA 4DSGA 1KFYA 4ZCCA 4ADWA 4H4VA 2Z5YA 3V76A 2ZZCA 1HYUA 1S2QA 1X31B 2X8HA 4EQWA 3JSKA 4OPGA 1B4VA 1E6EA 1TDKA 2YWLA 3GDPA 3CPIG 1VRQB 5C2TA 3C96A 1B37A 2YG5A 4FX9A 1CC6A 4JNAA 2WOWA 4EMJA 1PBDA 1PDHA 4AOSA 2R0PA 3CNPA 4USQA 4C3YA 2IVDA 2YR4A 5EB5A 4FK1C 4OPLA 1ELIA 2WHDA 5FS7A 4B68A 1D4EA 4EQSA 1PN0A 3UKKA 1GTEA 1PBCA 2BS3A 1PHHA 5LV9A 2X99A 1EL5A 2C65A 1XHCA 1PXBA 2XVHA 2WU5A 2XVJA 3IWAA 3HZLA 2A8XA 3ADAB 4EQRA 3UKFA 4RG3A 3G5RA 2YVJA 1OJCA 2XVFA 5M10A 1NHQA 4YTNA 3CNDA 3SQPA 3K7MX 1DJNA 4X9MA 1EL8A 3CNSA 3ISHA 3FMWA 4U8MA 2XLSA 2VVLA 4U8JA 2BACA 2FJEA 3UTHA 5KWFA 5BUKA 3CTYA 1UKVG 3VQRA 1SEZA 3Q9TA 1LV0A 3VRDB 2B7SA 3P4PA 1L9CA 4BK1A 3Q6JA 1IUUA 4AOXA 3AE5A 1IJHA 1P2HA 2AAQA 2Q7VA 2X8CA 3OZ2A 3VR8A 1H7XA 3B3RA 1NHRA 3EPTA 4H50A 1N4UA 2GAHB 1PBFA 1LTXR 4Z43A 2WP5A 2YR6A 3F8DA 3FBSA 4RSLA 1CJ4A 2VOUA 2QCUA 1KF6A 2Q6UA 1VG9A 1NG4A 2XFPA 3NK0X 2XLPA 3NTAA 2C64A 4CCRA 4DGKA 1PJ6A 1L0VA 4BK2A 3COXA 2EQ7A 1JRZA 1VQWA 4GUVA 1V59A 3BHFA 4ICYA 3UP5A 1S2YA 3P4QA 2GF3A 1NDAA 2PHHA 5JCMA 4KX6A 3AD7B 4H2RA 1LQTA 2JAEA 3CGEA 3REDA 1CJCA 1N4VA 4YT0A 2YG7A 4JY3A 1N4WA 4H2PA 3T37A 3UTFA 1IUXA 1XANA 5GRTA 5BVAA 3QFAA 2XFQA 4WX1A 3BI2A 4BJYA 4NEVA 4REKA 2FBWA 3PS9A 5J7XA 4CNKA 3GSIA 4H4WA 1N1PA 4K22A 4A6NB 4K5RA 2DKIA 4B66A 2GB0A 2X50A 4FK1A 4H4UA 1ZOYA 3NKSA 1PXAA 2YM1A 1ZMDA 2GR2A 4O5UA 3AWIA 3DMEA 2R0GA 2WESA 5HYMA 3IHMA 3P4RA 4KPRA 5J60A 4D03A 5M0ZA 2GMJA 5U25A 4K7ZA 4K2XA 1IUSA 4YSHA 1MOKA 3NNEA 2E4GA 1MXTA 3ITJA 4Y4LA 3V3NA 5KOXA 4IA6A 2CULA 1TDEA 4P9SA 2XLTA 1YQ4A 2BXSA 3L1RA 3QFBA 1NHSA 4ZCDA 1QLBA 4EIQA 4H4XA 2AQJA 3UTGA 4YWOA 4H4YA 2CVJA 2WU2A 3C4NA 1JEHA 3FIMB 4EIPA 2JB1A 1GXFA 2GV8A 2XDOA 1RSGA 4H4PA 4H7UA 1E1MA 1F8WA 1CJ2A 1GERA 1ONFA 3LADA 3QJ4A 4Z26A 2R45A 3AEEA 3UP4A 5L46A 2WETA 4YTMA 4JN9A 2R46A 2YLRA 4YKFA 4NTEA 1F6MA 2C70A 4CY8A 2WPCA 4H2QA 1K0LA 3GMBA 2YLWA 1COYA 3EAOA 3UKPA 5JCLA 1ZMCA 2EQ6A 3DGHA 3DH9A 1LPFA 1GETA 4CNJA 1GNDA 2YG6A 4XXGA 1QJDA 2B76A 2H89A 5KVIA 2HQMA 4DSHA 4EM4A 1BGJA 4JDRA 3NYEA 2OLOA 2V3AA 3NN6X 3AXBA 3GDNA 4C3XA 2C3CA 4PAAA 3LZXA 2F5ZA 3RNMA 5KXJA 3OC4A 1B8SA 1ZP0A 2B9YA 2C3DA 1NENA 3AE7A 3AE4A 3LOVA 2B9XA 2OA1A 5TR3A 3QSEA 2BA9A 5FMHA 3ZYXA 2C67A 1CF3A 1IUWA 3V3OA 1XPQA 2BK4A 3AE1A 1FEBA 3K7QX 2RABA 3NLCA 4UDRA 4YSXA 2I0ZA 3KA7A 2XFUA 2GVCA 4CBQA 3EANA 1BF3A 4TM4A 2BCGG 2WDVA 4EM3A 1DOEA 4MJWA 2Y6QA 1RYIA 2PYXA 4YXDA 1E1NA 3DJJA 5CQFA 1K0JA 1VG0A 3DK8A 2Q0LA 2TMDA 1GTHA 2OLNA 1FCDA 3SM8A 2GR0A 4B65A 3I3LA 2GRTA 2GEWA 4YTPA
chains in the Genus database with same CATH superfamily
2C73A 3T14A 1OJAA 2GMHA 3URHA 3T2ZA 4BJZA 2WDQA 2YLTA 4GDPA 3M0OA 1L9EA 2V60A 3H8IA 3ZDNA 5BRTA 5GSNA 2C72A 2J3NA 1QO8A 1IUVA 3IHGA 4UDPA 2QAEA 4Z24A 3II4A 2ZBWA 3AEAA 3GRSA 2ARDA 4Y4NA 2YLZA 4YKGA 1CHUA 3AEDA 2YLXA 3BNMA 4U8LA 2BC0A 4CCQA 1OJ9A 2XVEA 1F3PA 1GOSA 3SZ0A 1KSUA 2YR5A 4XWRA 3RP6A 2XLUA 1Q9IA 5HHFA 4BV6A 3VRBA 1TYTA 4NTCA 3C4AA 3NRNA 5KRQA 1E1LA 3UOYA 4U2TA 3P1WA 1CBOA 3F8PA 3PO7A 1PBBA 3GMCA 3SFDA 1O94A 2ZZBA 2BYBA 3FG2P 2JB2A 3CGCA 4H4QA 5EOWA 3AEGA 4CRTA 1TYPA 4B1BA 2YG3A 4K8DA 3SY4A 2BXRA 3ALLA 4OPUA 4UDQA 2R0CA 3NH3X 4G9KA 4K5SA 2FJDA 2VRLA 3NYCA 4OPCA 2TPRA 2W0HA 5EBKA 1ZY8A 3DK4A 1GRBA 3UKHA 4B64A 2IIDA 3K30A 3LZWA 4B67A 2RGOA 1K0IA 4LIIA 2A89A 2Y6RA 4H4ZA 2C66A 5BULA 4J2WA 2GR3A 1DJQA 3KVEA 1H7WA 2JBVA 3KPFA 4XWZA 2QA2A 2NPXA 3FPZA 3EF6A 3DA1A 3CMMA 3L8KA 4JNQA 3UCLA 3ICTA 4A65A 4A5LA 4A6NA 2VQBA 2WPFA 4YSZA 3RP7A 1H84A 3PVCA 4J33A 4AT0A 1BZLA 2BS2A 2WBAA 4H4TA 3AE9A 2RGHA 1D7YA 4TLXA 3ALMA 5FS8A 3AD9B 2A87A 2OALA 3AE6A 3ATQA 4JQ9A 3UOXA 1DOBA 3AEBA 1S3EA 1ZDLA 4EMWA 4HA6A 1OJDA 1JRYA 4E0VA 1E1KA 2YVFA 1CC4A 3T31A 5U63A 1YQZA 3KU9A 4OPIA 1B5QA 1PXCA 1S3BA 2CFYA 2H88A 5IPYA 1NAAA 2B9WA 5DBJA 4U2SA 4Y4MA 3RP8A 3CNJA 5IQ4A 4RG4A 1OJTA 3AYJA 3BI5A 2WP9A 1JNZA 3SGLA 4NEWA 1YQ3A 1Y0PA 2XCGA 4Z44A 4DNAA 3GWDA 3DK9A 4B69A 1H6VA 2WP6A 3QVRA 3LB8A 2DKHA 4U8PA 3NK1X 3HYWA 3F8RA 4X9NA 4Z2TA 4IA5A 4TLZA 1Y56A 2Q0KA 2QA1A 3CNTA 3P4SA 1D4DA 4EQXA 1GPEA 1Z6LA 3AEFA 1DNCA 1TDFA 3WE0A 5JCNA 2O9ZA 2JKCA 2BRYA 5KMQA 1MO9A 4C74A 3DJDA 3GYJA 2XLRA 3BI4A 1L9DA 2XYOA 2RGJA 2YG4A 4IVMB 3VR9A 4EMIA 1EL7A 4GCMA 3K7TA 1BWCA 2E1MA 3R9UA 1JOAA 3QVPA 4U8OA 2YLSA 1GREA 1FOHA 4GR1A 4AP3A 2EQ9A 4A99A 3KD9A 4PABA 5KNLA 1LJ1A 2C75A 3GD3A 1ZX9A 4NTDA 3IF9A 3ICSA 3UKLA 1ZKQA 2Z5XA 3CGBA 3D1CA 4GDEA 4U8KA 4GF7A 3SFEA 3AECA 1GRGA 1P2EA 4OPDA 4II3A 4H4SA 2R9ZA 1H86A 2FJBA 3NG7X 3S61A 4A7AA 2VVMA 1BKWA 3BNUA 1O95A 5KVHA 4HB9A 2JB3A 1GSNA 1FECA 2VRMA 3I6DA 3DJGX 1H82A 3AYLA 1TRBA 1DODA 4N9XA 4D04A 1EBDA 2WDRA 3H8LA 5EB4A 1D5TA 1DOCA 3ALJA 1ZK7A 1ZOVA 1VDCA 4G6GA 2JK6A 3CPHG 1GT8A 1GRFA 2B7RA 2VQ7A 2E5VA 3E1TA 5FS6A 3NTDA 2CDUA 3UKAA 3AE8A 1LQUA 2XVIA 2C7GA 3D8XA 2V6OA 4J36A 4I58A 1GESA 3HYXA 5HY5A 4FDCB 2BK5A 5CKUA 2IVEA 3CN8A 4C5OA 2VVLG 4M52A 1W4XA 4B63A 4H2NA 2XFOA 2X8GA 1AOGA 2YM2A 1F8RA 2YQUA 3KKJA 3NT6A 4ZN0A 1PS9A 3RHAA 1E7PA 3BHKA 2AR8A 1NG3A 2YVGA 3SZCA 4Z2UA 4J31A 5KOWA 4CY6A 4C77A 1K4QA 2WQYA 2GQWA 2WOVA 4OVIA 1KSSA 1GRTA 1CJ3A 1Q1RA 2GAGB 3NGCX 3S5WA 1NPXA 1JU2A 1TDNA 3UOZA 2WEUA 4J56A 2UZZA 4J34A 3T2YA 3ICRA 1GV4A 3M13A 3UKQA 5C3JA 1NHPA 4YSYA 3NIXA 4H4RA 3NYFA 3QSMA 3KLJA 4TM0A 1Q1WA 4OCGA 1GRAA 3VRAA 5HXIA 3M12A 1YY5A 2WPEA 4BURA 3O0HA 2VZ2A 1H83A 1E39A 2OAMA 3LXDA 3QSSA 2R4JA 3G5SA 1FEAA 2YAUA 5IQ1A 1RP0A 5JCIA 3B6DA 1REOA 2BC1A 3ATRA 3GD4A 4ECHA 2BS4A 2ZZ0A 4WCTA 1PJ7A 3DJEA 4TM1A 4U8IA 2NVKX 4AP1A 1D7LA 3H4KA 2EQ8A 3NK2X 5FS9A 2C76A 3GYIA 1PJ5A 2X3NA 3LJPA 5JCKA 2GH5A 1NEKA 4NZHA 4JY2A 3AD8B 4IVOB 2V3BA 4USRA 4A79A 2APGA 3DGZA 4A9WA 2R4EA 1CL0A 3AYIA 4AT2A 1FL2A 1JNRA 4J57A 4APNA 4O5QA 2WS3A 2WOIA 4LU6A 2V61A 1KNPA 2BABA 3G5QA 3UTEA 5U1OA 3CGDA 2FJAA 1JRXA 3AE3A 5ER0A 3GWFA 4Z25A 1XDIA 4GRTA 4Z2RA 1CC2A 4IV9A 1EL9A 4UP3A 3SZFA 3NN0X 2XFNA 2GQFA 4U2LA 1M64A 4BK3A 2BCPA 3UOVA 4U8NA 1DXLA 1LVLA 3NHOX 1BGNA 1IUTA 1GRHA 3CIRA 1TDOA 3IC9A 3GRTA 1M6IA 1KNRA 4I59A 2GR1A 4TM3A 4X4JA 1GEUA 3CPJG 1GALA 1YKJA 3AE2A 3ABVA 4LA1A 4G74A 2V5ZA 4OPTA 1H81A 1KDGA 2BK3A 3P9UA 1O5WA 1Y56B 1PBEA 2ACZA 1D4CA 3AB1A 1F8SA 4DSGA 1KFYA 4ZCCA 4ADWA 4H4VA 5KMRA 2Z5YA 3V76A 2ZZCA 1HYUA 1S2QA 1X31B 2X8HA 4EQWA 3JSKA 4OPGA 5KMPA 1B4VA 1E6EA 1TDKA 2C4CA 2YWLA 3CPIG 1VRQB 3GDPA 5C2TA 3C96A 1B37A 2YG5A 4FX9A 1CC6A 4JNAA 2WOWA 4EMJA 1PBDA 1PDHA 4AOSA 2R0PA 3CNPA 4USQA 4C3YA 2IVDA 2YR4A 5EB5A 4FK1C 4OPLA 3SX6A 1ELIA 2WHDA 5FS7A 4B68A 1D4EA 4EQSA 1PN0A 3UKKA 1GTEA 1PBCA 2BS3A 1PHHA 5LV9A 2X99A 1EL5A 2C65A 1XHCA 1PXBA 2XVHA 2WU5A 2XVJA 3IWAA 3HZLA 2A8XA 3ADAB 4EQRA 3UKFA 4RG3A 3G5RA 2YVJA 1OJCA 2XVFA 5M10A 1NHQA 4YTNA 3CNDA 3SQPA 3K7MX 1DJNA 4X9MA 1EL8A 3CNSA 3ISHA 3FMWA 4U8MA 2XLSA 2VVLA 4U8JA 2BACA 2FJEA 3UTHA 5KWFA 3SZWA 5BUKA 3CTYA 1UKVG 3VQRA 1SEZA 3Q9TA 1LV0A 3VRDB 2B7SA 3P4PA 1L9CA 4BK1A 3Q6JA 5KMSA 1IUUA 4AOXA 3AE5A 1IJHA 1P2HA 2AAQA 2Q7VA 2X8CA 3OZ2A 3VR8A 1H7XA 3B3RA 1NHRA 3EPTA 4H50A 1N4UA 2GAHB 1PBFA 1LTXR 4Z43A 2WP5A 2YR6A 3F8DA 3FBSA 4II2A 4RSLA 1CJ4A 2VOUA 2QCUA 4G73A 1KF6A 2Q6UA 1VG9A 1NG4A 2XFPA 3NK0X 2XLPA 3T0KA 3NTAA 2C64A 4CCRA 4DGKA 1PJ6A 1L0VA 4BK2A 3COXA 2EQ7A 1JRZA 1VQWA 4GUVA 1V59A 3BHFA 4ICYA 3UP5A 1S2YA 3GYXA 2GF3A 1NDAA 2PHHA 3P4QA 5JCMA 4KX6A 3AD7B 4H2RA 1LQTA 2JAEA 3CGEA 3REDA 1CJCA 1N4VA 4YT0A 2YG7A 4JY3A 1N4WA 4H2PA 3T37A 3UTFA 1IUXA 1XANA 5GRTA 5BVAA 3QFAA 2XFQA 4WX1A 3BI2A 4BJYA 4NEVA 4REKA 2FBWA 3PS9A 5J7XA 4CNKA 3GSIA 4H4WA 1N1PA 4K22A 4A6NB 4K5RA 2DKIA 4B66A 2GB0A 2X50A 4FK1A 4H4UA 1ZOYA 3NKSA 1PXAA 2YM1A 1ZMDA 2GR2A 4O5UA 3AWIA 3DMEA 2R0GA 2WESA 5HYMA 3IHMA 3P4RA 4KPRA 5J60A 4D03A 5M0ZA 2GMJA 5U25A 4K7ZA 4K2XA 1IUSA 4YSHA 1MOKA 3NNEA 4GAVA 2E4GA 1MXTA 3ITJA 4Y4LA 3V3NA 5KOXA 4IA6A 2CULA 1TDEA 4P9SA 2XLTA 1YQ4A 2BXSA 3L1RA 3QFBA 1NHSA 4ZCDA 1QLBA 4EIQA 4H4XA 2AQJA 3UTGA 4YWOA 4H4YA 2CVJA 2WU2A 3C4NA 1JEHA 3FIMB 4GAPA 4NWZA 4NNJA 2JB1A 4EIPA 1GXFA 2GV8A 2XDOA 1RSGA 4H4PA 4H7UA 1E1MA 1F8WA 1CJ2A 1GERA 1ONFA 3LADA 2BRAA 3QJ4A 4Z26A 2R45A 3AEEA 3UP4A 5L46A 2WETA 4YTMA 4JN9A 2R46A 2YLRA 4YKFA 4NTEA 1F6MA 2C70A 4CY8A 2WPCA 4H2QA 1K0LA 3GMBA 2YLWA 1COYA 3EAOA 3UKPA 3KPKA 5JCLA 1ZMCA 2EQ6A 3DGHA 3DH9A 1LPFA 1GETA 4CNJA 1GNDA 2YG6A 4XXGA 1QJDA 2B76A 2H89A 5KVIA 2HQMA 4DSHA 3HYVA 4EM4A 1BGJA 4JDRA 3NYEA 2OLOA 2V3AA 3NN6X 3AXBA 3GDNA 4C3XA 2C3CA 4PAAA 3LZXA 2F5ZA 3RNMA 5KXJA 3OC4A 1B8SA 1ZP0A 2B9YA 3SXIA 2C3DA 1NENA 3AE7A 3AE4A 3LOVA 2B9XA 2OA1A 5TR3A 3QSEA 2BA9A 5FMHA 3ZYXA 2C67A 1CF3A 1IUWA 3V3OA 1XPQA 2BK4A 3AE1A 1FEBA 3K7QX 2RABA 3NLCA 4UDRA 4YSXA 2I0ZA 3KA7A 2XFUA 2GVCA 4CBQA 3EANA 1BF3A 4TM4A 2BCGG 2WDVA 4EM3A 1DOEA 4MJWA 2Y6QA 1RYIA 2PYXA 4YXDA 1E1NA 3DJJA 4G6HA 5CQFA 1K0JA 1VG0A 3DK8A 2Q0LA 2TMDA 1GTHA 2OLNA 1FCDA 3SM8A 2GR0A 3SYIA 3T2KA 3I3LA 4B65A 2GRTA 2GEWA 4YTPA
chains in the Genus database with same CATH topology
2C73A 3T14A 1OJAA 2GMHA 3URHA 3T2ZA 4BJZA 2WDQA 2YLTA 4GDPA 3M0OA 1L9EA 2V60A 3H8IA 3ZDNA 5BRTA 5GSNA 2C72A 2J3NA 1QO8A 1IUVA 3IHGA 4UDPA 2QAEA 4Z24A 3II4A 2ZBWA 3AEAA 3GRSA 2ARDA 4Y4NA 2YLZA 4YKGA 1CHUA 3AEDA 2YLXA 3BNMA 4U8LA 2BC0A 4CCQA 1OJ9A 2XVEA 1F3PA 1GOSA 3SZ0A 1KSUA 2YR5A 4XWRA 3RP6A 2XLUA 1Q9IA 5HHFA 4BV6A 3VRBA 1TYTA 4NTCA 3C4AA 3NRNA 5KRQA 1E1LA 3UOYA 4U2TA 3P1WA 1CBOA 3F8PA 3PO7A 1PBBA 3GMCA 3SFDA 1O94A 2ZZBA 2BYBA 3FG2P 2JB2A 3CGCA 4H4QA 5EOWA 3AEGA 4CRTA 1TYPA 4B1BA 2YG3A 4K8DA 3SY4A 2BXRA 3ALLA 4OPUA 4UDQA 2R0CA 3NH3X 4G9KA 4K5SA 2FJDA 2VRLA 3NYCA 4OPCA 2TPRA 2W0HA 5EBKA 1ZY8A 3DK4A 1GRBA 3UKHA 4B64A 2IIDA 3K30A 3LZWA 4B67A 2RGOA 1K0IA 4LIIA 2A89A 2Y6RA 4H4ZA 2C66A 5BULA 4J2WA 2GR3A 1DJQA 3KVEA 1H7WA 2JBVA 3KPFA 4XWZA 2QA2A 2NPXA 3FPZA 3EF6A 3DA1A 3CMMA 3L8KA 4JNQA 3UCLA 3ICTA 4A65A 4A5LA 4A6NA 2VQBA 2WPFA 4YSZA 3RP7A 1H84A 3PVCA 4J33A 4AT0A 1BZLA 2BS2A 2WBAA 4H4TA 3AE9A 2RGHA 1D7YA 4TLXA 3ALMA 5FS8A 3AD9B 2A87A 2OALA 3AE6A 3ATQA 4JQ9A 3UOXA 1DOBA 3AEBA 1S3EA 1ZDLA 4EMWA 4HA6A 1OJDA 1JRYA 4E0VA 1E1KA 2YVFA 1CC4A 3T31A 5U63A 1YQZA 3KU9A 4OPIA 1B5QA 1PXCA 1S3BA 2CFYA 2H88A 5IPYA 1NAAA 2B9WA 5DBJA 4U2SA 4Y4MA 3RP8A 3CNJA 5IQ4A 4RG4A 1OJTA 3AYJA 3BI5A 2WP9A 1JNZA 3SGLA 4NEWA 1YQ3A 1Y0PA 2XCGA 4Z44A 4DNAA 3GWDA 3DK9A 4B69A 1H6VA 2WP6A 3QVRA 3LB8A 2DKHA 4U8PA 3NK1X 3HYWA 3F8RA 4X9NA 4Z2TA 4IA5A 4TLZA 1Y56A 2Q0KA 2QA1A 3CNTA 3P4SA 1D4DA 4EQXA 1GPEA 1Z6LA 3AEFA 1DNCA 1TDFA 3WE0A 5JCNA 2O9ZA 2JKCA 2BRYA 5KMQA 1MO9A 4C74A 3DJDA 3GYJA 2XLRA 3BI4A 1L9DA 2XYOA 2RGJA 2YG4A 4IVMB 3VR9A 4EMIA 1EL7A 4GCMA 3K7TA 1BWCA 2E1MA 3R9UA 1JOAA 3QVPA 4U8OA 2YLSA 1GREA 1FOHA 4GR1A 4AP3A 2EQ9A 4A99A 3KD9A 4PABA 5KNLA 1LJ1A 2C75A 3GD3A 1ZX9A 4NTDA 3IF9A 3ICSA 3UKLA 1ZKQA 2Z5XA 3CGBA 3D1CA 4GDEA 4U8KA 4GF7A 3SFEA 3AECA 1GRGA 1P2EA 4OPDA 4II3A 4H4SA 2R9ZA 1H86A 2FJBA 3NG7X 3S61A 4A7AA 2VVMA 1BKWA 3BNUA 1O95A 5KVHA 4HB9A 2JB3A 1GSNA 1FECA 2VRMA 3I6DA 3DJGX 1H82A 3AYLA 1TRBA 1DODA 4N9XA 4D04A 1EBDA 2WDRA 3H8LA 5EB4A 1D5TA 1DOCA 3ALJA 1ZK7A 1ZOVA 1VDCA 4G6GA 2JK6A 3CPHG 1GT8A 1GRFA 2B7RA 2VQ7A 2E5VA 3E1TA 5FS6A 3NTDA 2CDUA 3UKAA 3AE8A 1LQUA 2XVIA 2C7GA 3D8XA 2V6OA 4J36A 4I58A 1GESA 3HYXA 5HY5A 4FDCB 2BK5A 5CKUA 2IVEA 3CN8A 4C5OA 2VVLG 4M52A 1W4XA 4B63A 4H2NA 2XFOA 2X8GA 1AOGA 2YM2A 1F8RA 2YQUA 3KKJA 3NT6A 4ZN0A 1PS9A 3RHAA 1E7PA 3BHKA 2AR8A 1NG3A 2YVGA 3SZCA 4Z2UA 4J31A 5KOWA 4CY6A 4C77A 1K4QA 2WQYA 2GQWA 2WOVA 4OVIA 1KSSA 1GRTA 1CJ3A 1Q1RA 2GAGB 3NGCX 3S5WA 1NPXA 1JU2A 1TDNA 3UOZA 2WEUA 4J56A 2UZZA 4J34A 3T2YA 3ICRA 1GV4A 3M13A 3UKQA 5C3JA 1NHPA 4YSYA 3NIXA 4H4RA 3NYFA 3QSMA 3KLJA 4TM0A 1Q1WA 4OCGA 1GRAA 3VRAA 5HXIA 3M12A 1YY5A 2WPEA 4BURA 3O0HA 2VZ2A 1H83A 1E39A 2OAMA 3LXDA 3QSSA 2R4JA 3G5SA 1FEAA 2YAUA 5IQ1A 1RP0A 5JCIA 3B6DA 1REOA 2BC1A 3ATRA 3GD4A 4ECHA 2BS4A 2ZZ0A 4WCTA 1PJ7A 3DJEA 4TM1A 4U8IA 2NVKX 4AP1A 1D7LA 3H4KA 2EQ8A 3NK2X 5FS9A 2C76A 3GYIA 1PJ5A 2X3NA 3LJPA 5JCKA 2GH5A 1NEKA 4NZHA 4JY2A 3AD8B 4IVOB 2V3BA 4USRA 4A79A 2APGA 3DGZA 4A9WA 2R4EA 1CL0A 3AYIA 4AT2A 1FL2A 1JNRA 4J57A 4APNA 4O5QA 2WS3A 2WOIA 4LU6A 2V61A 1KNPA 2BABA 3G5QA 3UTEA 5U1OA 3CGDA 2FJAA 1JRXA 3AE3A 5ER0A 3GWFA 4Z25A 1XDIA 4GRTA 4Z2RA 1CC2A 4IV9A 1EL9A 4UP3A 3SZFA 3NN0X 2XFNA 2GQFA 4U2LA 1M64A 4BK3A 2BCPA 3UOVA 4U8NA 1DXLA 1LVLA 3NHOX 1BGNA 1IUTA 1GRHA 3CIRA 1TDOA 3IC9A 3GRTA 1M6IA 1KNRA 4I59A 2GR1A 4TM3A 4X4JA 1GEUA 3CPJG 1GALA 1YKJA 3AE2A 3ABVA 4LA1A 4G74A 2V5ZA 4OPTA 1H81A 1KDGA 2BK3A 3P9UA 1O5WA 1Y56B 1PBEA 2ACZA 1D4CA 3AB1A 1F8SA 4DSGA 1KFYA 4ZCCA 4ADWA 4H4VA 5KMRA 2Z5YA 3V76A 2ZZCA 1HYUA 1S2QA 1X31B 2X8HA 4EQWA 3JSKA 4OPGA 5KMPA 1B4VA 1E6EA 1TDKA 2C4CA 2YWLA 3CPIG 1VRQB 3GDPA 5C2TA 3C96A 1B37A 2YG5A 4FX9A 1CC6A 4JNAA 2WOWA 4EMJA 1PBDA 1PDHA 4AOSA 2R0PA 3CNPA 4USQA 4C3YA 2IVDA 2YR4A 5EB5A 4FK1C 4OPLA 3SX6A 1ELIA 2WHDA 5FS7A 4B68A 1D4EA 4EQSA 1PN0A 3UKKA 1GTEA 1PBCA 2BS3A 1PHHA 5LV9A 2X99A 1EL5A 2C65A 1XHCA 1PXBA 2XVHA 2WU5A 2XVJA 3IWAA 3HZLA 2A8XA 3ADAB 4EQRA 3UKFA 4RG3A 3G5RA 2YVJA 1OJCA 2XVFA 5M10A 1NHQA 4YTNA 3CNDA 3SQPA 3K7MX 1DJNA 4X9MA 1EL8A 3CNSA 3ISHA 3FMWA 4U8MA 2XLSA 2VVLA 4U8JA 2BACA 2FJEA 3UTHA 5KWFA 3SZWA 5BUKA 3CTYA 1UKVG 3VQRA 1SEZA 3Q9TA 1LV0A 3VRDB 2B7SA 3P4PA 1L9CA 4BK1A 3Q6JA 5KMSA 1IUUA 4AOXA 3AE5A 1IJHA 1P2HA 2AAQA 2Q7VA 2X8CA 3OZ2A 3VR8A 1H7XA 3B3RA 1NHRA 3EPTA 4H50A 1N4UA 2GAHB 1PBFA 1LTXR 4Z43A 2WP5A 2YR6A 3F8DA 3FBSA 4II2A 4RSLA 1CJ4A 2VOUA 2QCUA 4G73A 1KF6A 2Q6UA 1VG9A 1NG4A 2XFPA 3NK0X 2XLPA 3T0KA 3NTAA 2C64A 4CCRA 4DGKA 1PJ6A 1L0VA 4BK2A 3COXA 2EQ7A 1JRZA 1VQWA 4GUVA 1V59A 3BHFA 4ICYA 3UP5A 1S2YA 3GYXA 2GF3A 1NDAA 2PHHA 3P4QA 5JCMA 4KX6A 3AD7B 4H2RA 1LQTA 2JAEA 3CGEA 3REDA 1CJCA 1N4VA 4YT0A 2YG7A 4JY3A 1N4WA 4H2PA 3T37A 3UTFA 1IUXA 1XANA 5GRTA 5BVAA 3QFAA 2XFQA 4WX1A 3BI2A 4BJYA 4NEVA 4REKA 2FBWA 3PS9A 5J7XA 4CNKA 3GSIA 4H4WA 1N1PA 4K22A 4A6NB 4K5RA 2DKIA 4B66A 2GB0A 2X50A 4FK1A 4H4UA 1ZOYA 3NKSA 1PXAA 2YM1A 1ZMDA 2GR2A 4O5UA 3AWIA 3DMEA 2R0GA 2WESA 5HYMA 3IHMA 3P4RA 4KPRA 5J60A 4D03A 5M0ZA 2GMJA 5U25A 4K7ZA 4K2XA 1IUSA 4YSHA 1MOKA 3NNEA 4GAVA 2E4GA 1MXTA 3ITJA 4Y4LA 3V3NA 5KOXA 4IA6A 2CULA 1TDEA 4P9SA 2XLTA 1YQ4A 2BXSA 3L1RA 3QFBA 1NHSA 4ZCDA 1QLBA 4EIQA 4H4XA 2AQJA 3UTGA 4YWOA 4H4YA 2CVJA 2WU2A 3C4NA 1JEHA 3FIMB 4GAPA 4NWZA 4NNJA 2JB1A 4EIPA 1GXFA 2GV8A 2XDOA 1RSGA 4H4PA 4H7UA 1E1MA 1F8WA 1CJ2A 1GERA 1ONFA 3LADA 2BRAA 3QJ4A 4Z26A 2R45A 3AEEA 3UP4A 5L46A 2WETA 4YTMA 4JN9A 2R46A 2YLRA 4YKFA 4NTEA 1F6MA 2C70A 4CY8A 2WPCA 4H2QA 1K0LA 3GMBA 2YLWA 1COYA 3EAOA 3UKPA 3KPKA 5JCLA 1ZMCA 2EQ6A 3DGHA 3DH9A 1LPFA 1GETA 4CNJA 1GNDA 2YG6A 4XXGA 1QJDA 2B76A 2H89A 5KVIA 2HQMA 4DSHA 3HYVA 4EM4A 1BGJA 4JDRA 3NYEA 2OLOA 2V3AA 3NN6X 3AXBA 3GDNA 4C3XA 2C3CA 4PAAA 3LZXA 2F5ZA 3RNMA 5KXJA 3OC4A 1B8SA 1ZP0A 2B9YA 3SXIA 2C3DA 1NENA 3AE7A 3AE4A 3LOVA 2B9XA 2OA1A 5TR3A 3QSEA 2BA9A 5FMHA 3ZYXA 2C67A 1CF3A 1IUWA 3V3OA 1XPQA 2BK4A 3AE1A 1FEBA 3K7QX 2RABA 3NLCA 4UDRA 4YSXA 2I0ZA 3KA7A 2XFUA 2GVCA 4CBQA 3EANA 1BF3A 4TM4A 2BCGG 2WDVA 4EM3A 1DOEA 4MJWA 2Y6QA 1RYIA 2PYXA 4YXDA 1E1NA 3DJJA 4G6HA 5CQFA 1K0JA 1VG0A 3DK8A 2Q0LA 2TMDA 1GTHA 2OLNA 1FCDA 3SM8A 2GR0A 3SYIA 3T2KA 3I3LA 4B65A 2GRTA 2GEWA 4YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C73 A;  1OJA A;  2GMH A;  3URH A;  4BJZ A;  2WDQ A;  2YLT A;  4GDP A;  3M0O A;  1L9E A;  2V60 A;  3H8I A;  3ZDN A;  5BRT A;  5GSN A;  2C72 A;  2J3N A;  1QO8 A;  1IUV A;  3IHG A;  4UDP A;  2QAE A;  4Z24 A;  3II4 A;  2ZBW A;  3AEA A;  3GRS A;  2ARD A;  4Y4N A;  2YLZ A;  4YKG A;  1CHU A;  3AED A;  2YLX A;  3BNM A;  4U8L A;  2BC0 A;  4CCQ A;  1OJ9 A;  2XVE A;  1F3P A;  1GOS A;  1KSU A;  2YR5 A;  4XWR A;  3RP6 A;  2XLU A;  1Q9I A;  5HHF A;  4BV6 A;  3VRB A;  1TYT A;  4NTC A;  3C4A A;  3NRN A;  5KRQ A;  1E1L A;  3UOY A;  4U2T A;  3P1W A;  1CBO A;  3F8P A;  3PO7 A;  1PBB A;  3GMC A;  3SFD A;  1O94 A;  2ZZB A;  2BYB A;  3FG2 P;  2JB2 A;  3CGC A;  4H4Q A;  5EOW A;  3AEG A;  4CRT A;  1TYP A;  4B1B A;  2YG3 A;  4K8D A;  2BXR A;  3ALL A;  4OPU A;  4UDQ A;  2R0C A;  3NH3 X;  4K5S A;  2FJD A;  2VRL A;  3NYC A;  4OPC A;  2TPR A;  2W0H A;  5EBK A;  1ZY8 A;  3DK4 A;  1GRB A;  3UKH A;  4B64 A;  2IID A;  3K30 A;  3LZW A;  4B67 A;  2RGO A;  1K0I A;  4LII A;  2A89 A;  2Y6R A;  4H4Z A;  2C66 A;  5BUL A;  4J2W A;  2GR3 A;  1DJQ A;  3KVE A;  1H7W A;  2JBV A;  3KPF A;  4XWZ A;  2QA2 A;  2NPX A;  3FPZ A;  3EF6 A;  3DA1 A;  4JNQ A;  3L8K A;  3UCL A;  4A5L A;  3ICT A;  4A65 A;  4A6N A;  2VQB A;  2WPF A;  4YSZ A;  3RP7 A;  1H84 A;  3PVC A;  4J33 A;  4AT0 A;  1BZL A;  2BS2 A;  2WBA A;  4H4T A;  3AE9 A;  2RGH A;  1D7Y A;  4TLX A;  3ALM A;  5FS8 A;  3AD9 B;  2A87 A;  2OAL A;  3AE6 A;  3ATQ A;  4JQ9 A;  3UOX A;  1DOB A;  3AEB A;  1S3E A;  1ZDL A;  4EMW A;  4HA6 A;  1OJD A;  1JRY A;  4E0V A;  1E1K A;  2YVF A;  1CC4 A;  5U63 A;  1YQZ A;  3KU9 A;  4OPI A;  1B5Q A;  1PXC A;  1S3B A;  2CFY A;  2H88 A;  5IPY A;  1NAA A;  2B9W A;  5DBJ A;  4U2S A;  4Y4M A;  3RP8 A;  3CNJ A;  5IQ4 A;  4RG4 A;  1OJT A;  3AYJ A;  3BI5 A;  2WP9 A;  1JNZ A;  3SGL A;  4NEW A;  1YQ3 A;  1Y0P A;  2XCG A;  4Z44 A;  4DNA A;  3GWD A;  3DK9 A;  4B69 A;  1H6V A;  2WP6 A;  3QVR A;  3LB8 A;  2DKH A;  4U8P A;  3NK1 X;  4X9N A;  3F8R A;  4Z2T A;  4IA5 A;  4TLZ A;  1Y56 A;  2Q0K A;  2QA1 A;  3CNT A;  3P4S A;  1D4D A;  4EQX A;  1GPE A;  1Z6L A;  3AEF A;  1DNC A;  1TDF A;  3WE0 A;  5JCN A;  2O9Z A;  2JKC A;  1MO9 A;  4C74 A;  3DJD A;  3GYJ A;  2XLR A;  3BI4 A;  1L9D A;  2XYO A;  2RGJ A;  2YG4 A;  4IVM B;  3VR9 A;  4EMI A;  1EL7 A;  4GCM A;  3K7T A;  1BWC A;  2E1M A;  3R9U A;  1JOA A;  3QVP A;  4U8O A;  2YLS A;  1GRE A;  1FOH A;  4GR1 A;  4AP3 A;  2EQ9 A;  4A99 A;  3KD9 A;  4PAB A;  1LJ1 A;  2C75 A;  3GD3 A;  1ZX9 A;  4NTD A;  3IF9 A;  3ICS A;  3UKL A;  1ZKQ A;  2Z5X A;  3CGB A;  3D1C A;  4GDE A;  4U8K A;  4GF7 A;  3SFE A;  3AEC A;  1GRG A;  1P2E A;  4OPD A;  4H4S A;  2R9Z A;  1H86 A;  2FJB A;  3NG7 X;  3S61 A;  4A7A A;  2VVM A;  1BKW A;  3BNU A;  1O95 A;  5KVH A;  4HB9 A;  2JB3 A;  1GSN A;  1FEC A;  2VRM A;  3I6D A;  3DJG X;  1H82 A;  3AYL A;  1TRB A;  1DOD A;  4N9X A;  4D04 A;  1EBD A;  2WDR A;  3H8L A;  5EB4 A;  1D5T A;  1DOC A;  3ALJ A;  1ZK7 A;  1ZOV A;  1VDC A;  2JK6 A;  3CPH G;  1GT8 A;  1GRF A;  2B7R A;  2VQ7 A;  2E5V A;  3E1T A;  5FS6 A;  3NTD A;  2CDU A;  3UKA A;  3AE8 A;  1LQU A;  2XVI A;  2C7G A;  3D8X A;  2V6O A;  4J36 A;  4I58 A;  1GES A;  5HY5 A;  4FDC B;  2BK5 A;  5CKU A;  2IVE A;  3CN8 A;  4C5O A;  2VVL G;  4M52 A;  1W4X A;  4B63 A;  4H2N A;  2XFO A;  2X8G A;  1AOG A;  2YM2 A;  1F8R A;  2YQU A;  3KKJ A;  3NT6 A;  4ZN0 A;  1PS9 A;  3RHA A;  1E7P A;  3BHK A;  2AR8 A;  1NG3 A;  2YVG A;  4Z2U A;  4J31 A;  5KOW A;  4CY6 A;  4C77 A;  1K4Q A;  2WQY A;  2GQW A;  2WOV A;  4OVI A;  1KSS A;  1GRT A;  1CJ3 A;  1Q1R A;  2GAG B;  3NGC X;  3S5W A;  1NPX A;  1JU2 A;  1TDN A;  3UOZ A;  2WEU A;  4J56 A;  2UZZ A;  4J34 A;  3ICR A;  1GV4 A;  3M13 A;  3UKQ A;  5C3J A;  1NHP A;  4YSY A;  3NIX A;  4H4R A;  3NYF A;  3QSM A;  3KLJ A;  4TM0 A;  1Q1W A;  4OCG A;  1GRA A;  3VRA A;  5HXI A;  3M12 A;  1YY5 A;  2WPE A;  4BUR A;  3O0H A;  2VZ2 A;  1H83 A;  1E39 A;  2OAM A;  3LXD A;  3QSS A;  2R4J A;  3G5S A;  1FEA A;  2YAU A;  5IQ1 A;  1RP0 A;  5JCI A;  3B6D A;  1REO A;  2BC1 A;  3ATR A;  3GD4 A;  4ECH A;  2BS4 A;  2ZZ0 A;  4WCT A;  1PJ7 A;  3DJE A;  4TM1 A;  4U8I A;  2NVK X;  4AP1 A;  1D7L A;  3H4K A;  2EQ8 A;  3NK2 X;  5FS9 A;  2C76 A;  3GYI A;  1PJ5 A;  2X3N A;  3LJP A;  5JCK A;  2GH5 A;  1NEK A;  4NZH A;  4JY2 A;  3AD8 B;  4IVO B;  2V3B A;  4USR A;  4A79 A;  2APG A;  3DGZ A;  4A9W A;  2R4E A;  1CL0 A;  3AYI A;  4AT2 A;  1FL2 A;  1JNR A;  4J57 A;  4APN A;  4O5Q A;  2WS3 A;  2WOI A;  4LU6 A;  2V61 A;  1KNP A;  2BAB A;  3G5Q A;  3UTE A;  5U1O A;  3CGD A;  2FJA A;  1JRX A;  3AE3 A;  5ER0 A;  3GWF A;  4Z25 A;  1XDI A;  4GRT A;  4Z2R A;  1CC2 A;  4IV9 A;  1EL9 A;  4UP3 A;  3NN0 X;  2XFN A;  2GQF A;  4U2L A;  1M64 A;  4BK3 A;  2BCP A;  3UOV A;  4U8N A;  1DXL A;  1LVL A;  3NHO X;  1BGN A;  1IUT A;  1GRH A;  3CIR A;  1TDO A;  3IC9 A;  3GRT A;  1M6I A;  1KNR A;  4I59 A;  2GR1 A;  4TM3 A;  4X4J A;  1GEU A;  3CPJ G;  1GAL A;  1YKJ A;  3AE2 A;  3ABV A;  4LA1 A;  2V5Z A;  4OPT A;  1H81 A;  1KDG A;  2BK3 A;  3P9U A;  1O5W A;  1Y56 B;  1PBE A;  2ACZ A;  1D4C A;  3AB1 A;  1F8S A;  4DSG A;  1KFY A;  4ZCC A;  4ADW A;  4H4V A;  2Z5Y A;  3V76 A;  2ZZC A;  1HYU A;  1S2Q A;  1X31 B;  2X8H A;  4EQW A;  3JSK A;  4OPG A;  1B4V A;  1E6E A;  1TDK A;  2YWL A;  3GDP A;  3CPI G;  1VRQ B;  5C2T A;  3C96 A;  1B37 A;  2YG5 A;  4FX9 A;  1CC6 A;  4JNA A;  2WOW A;  4EMJ A;  1PBD A;  1PDH A;  4AOS A;  2R0P A;  3CNP A;  4USQ A;  4C3Y A;  2IVD A;  2YR4 A;  5EB5 A;  4FK1 C;  4OPL A;  1ELI A;  2WHD A;  5FS7 A;  4B68 A;  1D4E A;  4EQS A;  1PN0 A;  3UKK A;  1GTE A;  1PBC A;  2BS3 A;  1PHH A;  5LV9 A;  2X99 A;  1EL5 A;  2C65 A;  1XHC A;  1PXB A;  2XVH A;  2WU5 A;  2XVJ A;  3IWA A;  3HZL A;  2A8X A;  3ADA B;  4EQR A;  3UKF A;  4RG3 A;  3G5R A;  2YVJ A;  1OJC A;  2XVF A;  5M10 A;  1NHQ A;  4YTN A;  3CND A;  3SQP A;  3K7M X;  1DJN A;  4X9M A;  1EL8 A;  3CNS A;  3ISH A;  3FMW A;  4U8M A;  2XLS A;  2VVL A;  4U8J A;  2BAC A;  2FJE A;  3UTH A;  5KWF A;  5BUK A;  3CTY A;  1UKV G;  3VQR A;  1SEZ A;  3Q9T A;  1LV0 A;  3VRD B;  2B7S A;  3P4P A;  1L9C A;  4BK1 A;  3Q6J A;  1IUU A;  4AOX A;  3AE5 A;  1IJH A;  1P2H A;  2AAQ A;  2Q7V A;  2X8C A;  3OZ2 A;  3VR8 A;  1H7X A;  3B3R A;  1NHR A;  3EPT A;  4H50 A;  1N4U A;  2GAH B;  1PBF A;  1LTX R;  4Z43 A;  2WP5 A;  2YR6 A;  3F8D A;  3FBS A;  4RSL A;  1CJ4 A;  2VOU A;  2QCU A;  1KF6 A;  2Q6U A;  1VG9 A;  1NG4 A;  2XFP A;  3NK0 X;  2XLP A;  3NTA A;  2C64 A;  4CCR A;  4DGK A;  1PJ6 A;  1L0V A;  4BK2 A;  3COX A;  2EQ7 A;  1JRZ A;  1VQW A;  4GUV A;  1V59 A;  3BHF A;  4ICY A;  3UP5 A;  1S2Y A;  3P4Q A;  2GF3 A;  1NDA A;  2PHH A;  5JCM A;  4KX6 A;  3AD7 B;  4H2R A;  1LQT A;  2JAE A;  3CGE A;  3RED A;  1CJC A;  1N4V A;  4YT0 A;  2YG7 A;  4JY3 A;  1N4W A;  4H2P A;  3T37 A;  3UTF A;  1IUX A;  1XAN A;  5GRT A;  5BVA A;  3QFA A;  2XFQ A;  4WX1 A;  3BI2 A;  4BJY A;  4NEV A;  4REK A;  2FBW A;  3PS9 A;  5J7X A;  4CNK A;  3GSI A;  4H4W A;  1N1P A;  4K22 A;  4A6N B;  4K5R A;  2DKI A;  4B66 A;  2GB0 A;  2X50 A;  4FK1 A;  4H4U A;  1ZOY A;  3NKS A;  1PXA A;  2YM1 A;  1ZMD A;  2GR2 A;  4O5U A;  3AWI A;  3DME A;  2R0G A;  2WES A;  5HYM A;  3IHM A;  3P4R A;  4KPR A;  5J60 A;  4D03 A;  5M0Z A;  2GMJ A;  5U25 A;  4K7Z A;  4K2X A;  1IUS A;  4YSH A;  1MOK A;  3NNE A;  2E4G A;  1MXT A;  3ITJ A;  4Y4L A;  3V3N A;  5KOX A;  4IA6 A;  2CUL A;  1TDE A;  4P9S A;  2XLT A;  1YQ4 A;  2BXS A;  3L1R A;  3QFB A;  1NHS A;  4ZCD A;  1QLB A;  4EIQ A;  4H4X A;  2AQJ A;  3UTG A;  4YWO A;  4H4Y A;  2CVJ A;  2WU2 A;  3C4N A;  1JEH A;  3FIM B;  4EIP A;  2JB1 A;  1GXF A;  2GV8 A;  2XDO A;  1RSG A;  4H4P A;  4H7U A;  1E1M A;  1F8W A;  1CJ2 A;  1GER A;  1ONF A;  3LAD A;  3QJ4 A;  4Z26 A;  2R45 A;  3AEE A;  3UP4 A;  5L46 A;  2WET A;  4YTM A;  4JN9 A;  2R46 A;  2YLR A;  4YKF A;  4NTE A;  1F6M A;  2C70 A;  4CY8 A;  2WPC A;  4H2Q A;  1K0L A;  3GMB A;  2YLW A;  1COY A;  3EAO A;  3UKP A;  5JCL A;  1ZMC A;  2EQ6 A;  3DGH A;  3DH9 A;  1LPF A;  1GET A;  4CNJ A;  1GND A;  2YG6 A;  4XXG A;  1QJD A;  2B76 A;  2H89 A;  5KVI A;  2HQM A;  4DSH A;  4EM4 A;  1BGJ A;  4JDR A;  3NYE A;  2OLO A;  2V3A A;  3NN6 X;  3AXB A;  3GDN A;  4C3X A;  2C3C A;  4PAA A;  3LZX A;  2F5Z A;  3RNM A;  5KXJ A;  3OC4 A;  1B8S A;  1ZP0 A;  2B9Y A;  2C3D A;  1NEN A;  3AE7 A;  3AE4 A;  3LOV A;  2B9X A;  2OA1 A;  5TR3 A;  3QSE A;  2BA9 A;  5FMH A;  3ZYX A;  2C67 A;  1CF3 A;  1IUW A;  3V3O A;  1XPQ A;  2BK4 A;  3AE1 A;  1FEB A;  3K7Q X;  2RAB A;  3NLC A;  4UDR A;  4YSX A;  2I0Z A;  3KA7 A;  2XFU A;  2GVC A;  4CBQ A;  3EAN A;  1BF3 A;  4TM4 A;  2BCG G;  2WDV A;  4EM3 A;  1DOE A;  4MJW A;  2Y6Q A;  1RYI A;  2PYX A;  4YXD A;  1E1N A;  3DJJ A;  5CQF A;  1K0J A;  1VG0 A;  3DK8 A;  2Q0L A;  2TMD A;  1GTH A;  2OLN A;  1FCD A;  3SM8 A;  2GR0 A;  4B65 A;  3I3L A;  2GRT A;  2GEW A;  4YTP A; 
#chains in the Genus database with same CATH topology
 2C73 A;  3T14 A;  1OJA A;  2GMH A;  3URH A;  3T2Z A;  4BJZ A;  2WDQ A;  2YLT A;  4GDP A;  3M0O A;  1L9E A;  2V60 A;  3H8I A;  3ZDN A;  5BRT A;  5GSN A;  2C72 A;  2J3N A;  1QO8 A;  1IUV A;  3IHG A;  4UDP A;  2QAE A;  4Z24 A;  3II4 A;  2ZBW A;  3AEA A;  3GRS A;  2ARD A;  4Y4N A;  2YLZ A;  4YKG A;  1CHU A;  3AED A;  2YLX A;  3BNM A;  4U8L A;  2BC0 A;  4CCQ A;  1OJ9 A;  2XVE A;  1F3P A;  1GOS A;  3SZ0 A;  1KSU A;  2YR5 A;  4XWR A;  3RP6 A;  2XLU A;  1Q9I A;  5HHF A;  4BV6 A;  3VRB A;  1TYT A;  4NTC A;  3C4A A;  3NRN A;  5KRQ A;  1E1L A;  3UOY A;  4U2T A;  3P1W A;  1CBO A;  3F8P A;  3PO7 A;  1PBB A;  3GMC A;  3SFD A;  1O94 A;  2ZZB A;  2BYB A;  3FG2 P;  2JB2 A;  3CGC A;  4H4Q A;  5EOW A;  3AEG A;  4CRT A;  1TYP A;  4B1B A;  2YG3 A;  4K8D A;  3SY4 A;  2BXR A;  3ALL A;  4OPU A;  4UDQ A;  2R0C A;  3NH3 X;  4G9K A;  4K5S A;  2FJD A;  2VRL A;  3NYC A;  4OPC A;  2TPR A;  2W0H A;  5EBK A;  1ZY8 A;  3DK4 A;  1GRB A;  3UKH A;  4B64 A;  2IID A;  3K30 A;  3LZW A;  4B67 A;  2RGO A;  1K0I A;  4LII A;  2A89 A;  2Y6R A;  4H4Z A;  2C66 A;  5BUL A;  4J2W A;  2GR3 A;  1DJQ A;  3KVE A;  1H7W A;  2JBV A;  3KPF A;  4XWZ A;  2QA2 A;  2NPX A;  3FPZ A;  3EF6 A;  3DA1 A;  3CMM A;  3L8K A;  4JNQ A;  3UCL A;  3ICT A;  4A65 A;  4A5L A;  4A6N A;  2VQB A;  2WPF A;  4YSZ A;  3RP7 A;  1H84 A;  3PVC A;  4J33 A;  4AT0 A;  1BZL A;  2BS2 A;  2WBA A;  4H4T A;  3AE9 A;  2RGH A;  1D7Y A;  4TLX A;  3ALM A;  5FS8 A;  3AD9 B;  2A87 A;  2OAL A;  3AE6 A;  3ATQ A;  4JQ9 A;  3UOX A;  1DOB A;  3AEB A;  1S3E A;  1ZDL A;  4EMW A;  4HA6 A;  1OJD A;  1JRY A;  4E0V A;  1E1K A;  2YVF A;  1CC4 A;  3T31 A;  5U63 A;  1YQZ A;  3KU9 A;  4OPI A;  1B5Q A;  1PXC A;  1S3B A;  2CFY A;  2H88 A;  5IPY A;  1NAA A;  2B9W A;  5DBJ A;  4U2S A;  4Y4M A;  3RP8 A;  3CNJ A;  5IQ4 A;  4RG4 A;  1OJT A;  3AYJ A;  3BI5 A;  2WP9 A;  1JNZ A;  3SGL A;  4NEW A;  1YQ3 A;  1Y0P A;  2XCG A;  4Z44 A;  4DNA A;  3GWD A;  3DK9 A;  4B69 A;  1H6V A;  2WP6 A;  3QVR A;  3LB8 A;  2DKH A;  4U8P A;  3NK1 X;  3HYW A;  3F8R A;  4X9N A;  4Z2T A;  4IA5 A;  4TLZ A;  1Y56 A;  2Q0K A;  2QA1 A;  3CNT A;  3P4S A;  1D4D A;  4EQX A;  1GPE A;  1Z6L A;  3AEF A;  1DNC A;  1TDF A;  3WE0 A;  5JCN A;  2O9Z A;  2JKC A;  2BRY A;  5KMQ A;  1MO9 A;  4C74 A;  3DJD A;  3GYJ A;  2XLR A;  3BI4 A;  1L9D A;  2XYO A;  2RGJ A;  2YG4 A;  4IVM B;  3VR9 A;  4EMI A;  1EL7 A;  4GCM A;  3K7T A;  1BWC A;  2E1M A;  3R9U A;  1JOA A;  3QVP A;  4U8O A;  2YLS A;  1GRE A;  1FOH A;  4GR1 A;  4AP3 A;  2EQ9 A;  4A99 A;  3KD9 A;  4PAB A;  5KNL A;  1LJ1 A;  2C75 A;  3GD3 A;  1ZX9 A;  4NTD A;  3IF9 A;  3ICS A;  3UKL A;  1ZKQ A;  2Z5X A;  3CGB A;  3D1C A;  4GDE A;  4U8K A;  4GF7 A;  3SFE A;  3AEC A;  1GRG A;  1P2E A;  4OPD A;  4II3 A;  4H4S A;  2R9Z A;  1H86 A;  2FJB A;  3NG7 X;  3S61 A;  4A7A A;  2VVM A;  1BKW A;  3BNU A;  1O95 A;  5KVH A;  4HB9 A;  2JB3 A;  1GSN A;  1FEC A;  2VRM A;  3I6D A;  3DJG X;  1H82 A;  3AYL A;  1TRB A;  1DOD A;  4N9X A;  4D04 A;  1EBD A;  2WDR A;  3H8L A;  5EB4 A;  1D5T A;  1DOC A;  3ALJ A;  1ZK7 A;  1ZOV A;  1VDC A;  4G6G A;  2JK6 A;  3CPH G;  1GT8 A;  1GRF A;  2B7R A;  2VQ7 A;  2E5V A;  3E1T A;  5FS6 A;  3NTD A;  2CDU A;  3UKA A;  3AE8 A;  1LQU A;  2XVI A;  2C7G A;  3D8X A;  2V6O A;  4J36 A;  4I58 A;  1GES A;  3HYX A;  5HY5 A;  4FDC B;  2BK5 A;  5CKU A;  2IVE A;  3CN8 A;  4C5O A;  2VVL G;  4M52 A;  1W4X A;  4B63 A;  4H2N A;  2XFO A;  2X8G A;  1AOG A;  2YM2 A;  1F8R A;  2YQU A;  3KKJ A;  3NT6 A;  4ZN0 A;  1PS9 A;  3RHA A;  1E7P A;  3BHK A;  2AR8 A;  1NG3 A;  2YVG A;  3SZC A;  4Z2U A;  4J31 A;  5KOW A;  4CY6 A;  4C77 A;  1K4Q A;  2WQY A;  2GQW A;  2WOV A;  4OVI A;  1KSS A;  1GRT A;  1CJ3 A;  1Q1R A;  2GAG B;  3NGC X;  3S5W A;  1NPX A;  1JU2 A;  1TDN A;  3UOZ A;  2WEU A;  4J56 A;  2UZZ A;  4J34 A;  3T2Y A;  3ICR A;  1GV4 A;  3M13 A;  3UKQ A;  5C3J A;  1NHP A;  4YSY A;  3NIX A;  4H4R A;  3NYF A;  3QSM A;  3KLJ A;  4TM0 A;  1Q1W A;  4OCG A;  1GRA A;  3VRA A;  5HXI A;  3M12 A;  1YY5 A;  2WPE A;  4BUR A;  3O0H A;  2VZ2 A;  1H83 A;  1E39 A;  2OAM A;  3LXD A;  3QSS A;  2R4J A;  3G5S A;  1FEA A;  2YAU A;  5IQ1 A;  1RP0 A;  5JCI A;  3B6D A;  1REO A;  2BC1 A;  3ATR A;  3GD4 A;  4ECH A;  2BS4 A;  2ZZ0 A;  4WCT A;  1PJ7 A;  3DJE A;  4TM1 A;  4U8I A;  2NVK X;  4AP1 A;  1D7L A;  3H4K A;  2EQ8 A;  3NK2 X;  5FS9 A;  2C76 A;  3GYI A;  1PJ5 A;  2X3N A;  3LJP A;  5JCK A;  2GH5 A;  1NEK A;  4NZH A;  4JY2 A;  3AD8 B;  4IVO B;  2V3B A;  4USR A;  4A79 A;  2APG A;  3DGZ A;  4A9W A;  2R4E A;  1CL0 A;  3AYI A;  4AT2 A;  1FL2 A;  1JNR A;  4J57 A;  4APN A;  4O5Q A;  2WS3 A;  2WOI A;  4LU6 A;  2V61 A;  1KNP A;  2BAB A;  3G5Q A;  3UTE A;  5U1O A;  3CGD A;  2FJA A;  1JRX A;  3AE3 A;  5ER0 A;  3GWF A;  4Z25 A;  1XDI A;  4GRT A;  4Z2R A;  1CC2 A;  4IV9 A;  1EL9 A;  4UP3 A;  3SZF A;  3NN0 X;  2XFN A;  2GQF A;  4U2L A;  1M64 A;  4BK3 A;  2BCP A;  3UOV A;  4U8N A;  1DXL A;  1LVL A;  3NHO X;  1BGN A;  1IUT A;  1GRH A;  3CIR A;  1TDO A;  3IC9 A;  3GRT A;  1M6I A;  1KNR A;  4I59 A;  2GR1 A;  4TM3 A;  4X4J A;  1GEU A;  3CPJ G;  1GAL A;  1YKJ A;  3AE2 A;  3ABV A;  4LA1 A;  4G74 A;  2V5Z A;  4OPT A;  1H81 A;  1KDG A;  2BK3 A;  3P9U A;  1O5W A;  1Y56 B;  1PBE A;  2ACZ A;  1D4C A;  3AB1 A;  1F8S A;  4DSG A;  1KFY A;  4ZCC A;  4ADW A;  4H4V A;  5KMR A;  2Z5Y A;  3V76 A;  2ZZC A;  1HYU A;  1S2Q A;  1X31 B;  2X8H A;  4EQW A;  3JSK A;  4OPG A;  5KMP A;  1B4V A;  1E6E A;  1TDK A;  2C4C A;  2YWL A;  3CPI G;  1VRQ B;  3GDP A;  5C2T A;  3C96 A;  1B37 A;  2YG5 A;  4FX9 A;  1CC6 A;  4JNA A;  2WOW A;  4EMJ A;  1PBD A;  1PDH A;  4AOS A;  2R0P A;  3CNP A;  4USQ A;  4C3Y A;  2IVD A;  2YR4 A;  5EB5 A;  4FK1 C;  4OPL A;  3SX6 A;  1ELI A;  2WHD A;  5FS7 A;  4B68 A;  1D4E A;  4EQS A;  1PN0 A;  3UKK A;  1GTE A;  1PBC A;  2BS3 A;  1PHH A;  5LV9 A;  2X99 A;  1EL5 A;  2C65 A;  1XHC A;  1PXB A;  2XVH A;  2WU5 A;  2XVJ A;  3IWA A;  3HZL A;  2A8X A;  3ADA B;  4EQR A;  3UKF A;  4RG3 A;  3G5R A;  2YVJ A;  1OJC A;  2XVF A;  5M10 A;  1NHQ A;  4YTN A;  3CND A;  3SQP A;  3K7M X;  1DJN A;  4X9M A;  1EL8 A;  3CNS A;  3ISH A;  3FMW A;  4U8M A;  2XLS A;  2VVL A;  4U8J A;  2BAC A;  2FJE A;  3UTH A;  5KWF A;  3SZW A;  5BUK A;  3CTY A;  1UKV G;  3VQR A;  1SEZ A;  3Q9T A;  1LV0 A;  3VRD B;  2B7S A;  3P4P A;  1L9C A;  4BK1 A;  3Q6J A;  5KMS A;  1IUU A;  4AOX A;  3AE5 A;  1IJH A;  1P2H A;  2AAQ A;  2Q7V A;  2X8C A;  3OZ2 A;  3VR8 A;  1H7X A;  3B3R A;  1NHR A;  3EPT A;  4H50 A;  1N4U A;  2GAH B;  1PBF A;  1LTX R;  4Z43 A;  2WP5 A;  2YR6 A;  3F8D A;  3FBS A;  4II2 A;  4RSL A;  1CJ4 A;  2VOU A;  2QCU A;  4G73 A;  1KF6 A;  2Q6U A;  1VG9 A;  1NG4 A;  2XFP A;  3NK0 X;  2XLP A;  3T0K A;  3NTA A;  2C64 A;  4CCR A;  4DGK A;  1PJ6 A;  1L0V A;  4BK2 A;  3COX A;  2EQ7 A;  1JRZ A;  1VQW A;  4GUV A;  1V59 A;  3BHF A;  4ICY A;  3UP5 A;  1S2Y A;  3GYX A;  2GF3 A;  1NDA A;  2PHH A;  3P4Q A;  5JCM A;  4KX6 A;  3AD7 B;  4H2R A;  1LQT A;  2JAE A;  3CGE A;  3RED A;  1CJC A;  1N4V A;  4YT0 A;  2YG7 A;  4JY3 A;  1N4W A;  4H2P A;  3T37 A;  3UTF A;  1IUX A;  1XAN A;  5GRT A;  5BVA A;  3QFA A;  2XFQ A;  4WX1 A;  3BI2 A;  4BJY A;  4NEV A;  4REK A;  2FBW A;  3PS9 A;  5J7X A;  4CNK A;  3GSI A;  4H4W A;  1N1P A;  4K22 A;  4A6N B;  4K5R A;  2DKI A;  4B66 A;  2GB0 A;  2X50 A;  4FK1 A;  4H4U A;  1ZOY A;  3NKS A;  1PXA A;  2YM1 A;  1ZMD A;  2GR2 A;  4O5U A;  3AWI A;  3DME A;  2R0G A;  2WES A;  5HYM A;  3IHM A;  3P4R A;  4KPR A;  5J60 A;  4D03 A;  5M0Z A;  2GMJ A;  5U25 A;  4K7Z A;  4K2X A;  1IUS A;  4YSH A;  1MOK A;  3NNE A;  4GAV A;  2E4G A;  1MXT A;  3ITJ A;  4Y4L A;  3V3N A;  5KOX A;  4IA6 A;  2CUL A;  1TDE A;  4P9S A;  2XLT A;  1YQ4 A;  2BXS A;  3L1R A;  3QFB A;  1NHS A;  4ZCD A;  1QLB A;  4EIQ A;  4H4X A;  2AQJ A;  3UTG A;  4YWO A;  4H4Y A;  2CVJ A;  2WU2 A;  3C4N A;  1JEH A;  3FIM B;  4GAP A;  4NWZ A;  4NNJ A;  2JB1 A;  4EIP A;  1GXF A;  2GV8 A;  2XDO A;  1RSG A;  4H4P A;  4H7U A;  1E1M A;  1F8W A;  1CJ2 A;  1GER A;  1ONF A;  3LAD A;  2BRA A;  3QJ4 A;  4Z26 A;  2R45 A;  3AEE A;  3UP4 A;  5L46 A;  2WET A;  4YTM A;  4JN9 A;  2R46 A;  2YLR A;  4YKF A;  4NTE A;  1F6M A;  2C70 A;  4CY8 A;  2WPC A;  4H2Q A;  1K0L A;  3GMB A;  2YLW A;  1COY A;  3EAO A;  3UKP A;  3KPK A;  5JCL A;  1ZMC A;  2EQ6 A;  3DGH A;  3DH9 A;  1LPF A;  1GET A;  4CNJ A;  1GND A;  2YG6 A;  4XXG A;  1QJD A;  2B76 A;  2H89 A;  5KVI A;  2HQM A;  4DSH A;  3HYV A;  4EM4 A;  1BGJ A;  4JDR A;  3NYE A;  2OLO A;  2V3A A;  3NN6 X;  3AXB A;  3GDN A;  4C3X A;  2C3C A;  4PAA A;  3LZX A;  2F5Z A;  3RNM A;  5KXJ A;  3OC4 A;  1B8S A;  1ZP0 A;  2B9Y A;  3SXI A;  2C3D A;  1NEN A;  3AE7 A;  3AE4 A;  3LOV A;  2B9X A;  2OA1 A;  5TR3 A;  3QSE A;  2BA9 A;  5FMH A;  3ZYX A;  2C67 A;  1CF3 A;  1IUW A;  3V3O A;  1XPQ A;  2BK4 A;  3AE1 A;  1FEB A;  3K7Q X;  2RAB A;  3NLC A;  4UDR A;  4YSX A;  2I0Z A;  3KA7 A;  2XFU A;  2GVC A;  4CBQ A;  3EAN A;  1BF3 A;  4TM4 A;  2BCG G;  2WDV A;  4EM3 A;  1DOE A;  4MJW A;  2Y6Q A;  1RYI A;  2PYX A;  4YXD A;  1E1N A;  3DJJ A;  4G6H A;  5CQF A;  1K0J A;  1VG0 A;  3DK8 A;  2Q0L A;  2TMD A;  1GTH A;  2OLN A;  1FCD A;  3SM8 A;  2GR0 A;  3SYI A;  3T2K A;  3I3L A;  4B65 A;  2GRT A;  2GEW A;  4YTP A; 
#chains in the Genus database with same CATH homology
 2C73 A;  3T14 A;  1OJA A;  2GMH A;  3URH A;  3T2Z A;  4BJZ A;  2WDQ A;  2YLT A;  4GDP A;  3M0O A;  1L9E A;  2V60 A;  3H8I A;  3ZDN A;  5BRT A;  5GSN A;  2C72 A;  2J3N A;  1QO8 A;  1IUV A;  3IHG A;  4UDP A;  2QAE A;  4Z24 A;  3II4 A;  2ZBW A;  3AEA A;  3GRS A;  2ARD A;  4Y4N A;  2YLZ A;  4YKG A;  1CHU A;  3AED A;  2YLX A;  3BNM A;  4U8L A;  2BC0 A;  4CCQ A;  1OJ9 A;  2XVE A;  1F3P A;  1GOS A;  3SZ0 A;  1KSU A;  2YR5 A;  4XWR A;  3RP6 A;  2XLU A;  1Q9I A;  5HHF A;  4BV6 A;  3VRB A;  1TYT A;  4NTC A;  3C4A A;  3NRN A;  5KRQ A;  1E1L A;  3UOY A;  4U2T A;  3P1W A;  1CBO A;  3F8P A;  3PO7 A;  1PBB A;  3GMC A;  3SFD A;  1O94 A;  2ZZB A;  2BYB A;  3FG2 P;  2JB2 A;  3CGC A;  4H4Q A;  5EOW A;  3AEG A;  4CRT A;  1TYP A;  4B1B A;  2YG3 A;  4K8D A;  3SY4 A;  2BXR A;  3ALL A;  4OPU A;  4UDQ A;  2R0C A;  3NH3 X;  4G9K A;  4K5S A;  2FJD A;  2VRL A;  3NYC A;  4OPC A;  2TPR A;  2W0H A;  5EBK A;  1ZY8 A;  3DK4 A;  1GRB A;  3UKH A;  4B64 A;  2IID A;  3K30 A;  3LZW A;  4B67 A;  2RGO A;  1K0I A;  4LII A;  2A89 A;  2Y6R A;  4H4Z A;  2C66 A;  5BUL A;  4J2W A;  2GR3 A;  1DJQ A;  3KVE A;  1H7W A;  2JBV A;  3KPF A;  4XWZ A;  2QA2 A;  2NPX A;  3FPZ A;  3EF6 A;  3DA1 A;  3CMM A;  3L8K A;  4JNQ A;  3UCL A;  3ICT A;  4A65 A;  4A5L A;  4A6N A;  2VQB A;  2WPF A;  4YSZ A;  3RP7 A;  1H84 A;  3PVC A;  4J33 A;  4AT0 A;  1BZL A;  2BS2 A;  2WBA A;  4H4T A;  3AE9 A;  2RGH A;  1D7Y A;  4TLX A;  3ALM A;  5FS8 A;  3AD9 B;  2A87 A;  2OAL A;  3AE6 A;  3ATQ A;  4JQ9 A;  3UOX A;  1DOB A;  3AEB A;  1S3E A;  1ZDL A;  4EMW A;  4HA6 A;  1OJD A;  1JRY A;  4E0V A;  1E1K A;  2YVF A;  1CC4 A;  3T31 A;  5U63 A;  1YQZ A;  3KU9 A;  4OPI A;  1B5Q A;  1PXC A;  1S3B A;  2CFY A;  2H88 A;  5IPY A;  1NAA A;  2B9W A;  5DBJ A;  4U2S A;  4Y4M A;  3RP8 A;  3CNJ A;  5IQ4 A;  4RG4 A;  1OJT A;  3AYJ A;  3BI5 A;  2WP9 A;  1JNZ A;  3SGL A;  4NEW A;  1YQ3 A;  1Y0P A;  2XCG A;  4Z44 A;  4DNA A;  3GWD A;  3DK9 A;  4B69 A;  1H6V A;  2WP6 A;  3QVR A;  3LB8 A;  2DKH A;  4U8P A;  3NK1 X;  3HYW A;  3F8R A;  4X9N A;  4Z2T A;  4IA5 A;  4TLZ A;  1Y56 A;  2Q0K A;  2QA1 A;  3CNT A;  3P4S A;  1D4D A;  4EQX A;  1GPE A;  1Z6L A;  3AEF A;  1DNC A;  1TDF A;  3WE0 A;  5JCN A;  2O9Z A;  2JKC A;  2BRY A;  5KMQ A;  1MO9 A;  4C74 A;  3DJD A;  3GYJ A;  2XLR A;  3BI4 A;  1L9D A;  2XYO A;  2RGJ A;  2YG4 A;  4IVM B;  3VR9 A;  4EMI A;  1EL7 A;  4GCM A;  3K7T A;  1BWC A;  2E1M A;  3R9U A;  1JOA A;  3QVP A;  4U8O A;  2YLS A;  1GRE A;  1FOH A;  4GR1 A;  4AP3 A;  2EQ9 A;  4A99 A;  3KD9 A;  4PAB A;  5KNL A;  1LJ1 A;  2C75 A;  3GD3 A;  1ZX9 A;  4NTD A;  3IF9 A;  3ICS A;  3UKL A;  1ZKQ A;  2Z5X A;  3CGB A;  3D1C A;  4GDE A;  4U8K A;  4GF7 A;  3SFE A;  3AEC A;  1GRG A;  1P2E A;  4OPD A;  4II3 A;  4H4S A;  2R9Z A;  1H86 A;  2FJB A;  3NG7 X;  3S61 A;  4A7A A;  2VVM A;  1BKW A;  3BNU A;  1O95 A;  5KVH A;  4HB9 A;  2JB3 A;  1GSN A;  1FEC A;  2VRM A;  3I6D A;  3DJG X;  1H82 A;  3AYL A;  1TRB A;  1DOD A;  4N9X A;  4D04 A;  1EBD A;  2WDR A;  3H8L A;  5EB4 A;  1D5T A;  1DOC A;  3ALJ A;  1ZK7 A;  1ZOV A;  1VDC A;  4G6G A;  2JK6 A;  3CPH G;  1GT8 A;  1GRF A;  2B7R A;  2VQ7 A;  2E5V A;  3E1T A;  5FS6 A;  3NTD A;  2CDU A;  3UKA A;  3AE8 A;  1LQU A;  2XVI A;  2C7G A;  3D8X A;  2V6O A;  4J36 A;  4I58 A;  1GES A;  3HYX A;  5HY5 A;  4FDC B;  2BK5 A;  5CKU A;  2IVE A;  3CN8 A;  4C5O A;  2VVL G;  4M52 A;  1W4X A;  4B63 A;  4H2N A;  2XFO A;  2X8G A;  1AOG A;  2YM2 A;  1F8R A;  2YQU A;  3KKJ A;  3NT6 A;  4ZN0 A;  1PS9 A;  3RHA A;  1E7P A;  3BHK A;  2AR8 A;  1NG3 A;  2YVG A;  3SZC A;  4Z2U A;  4J31 A;  5KOW A;  4CY6 A;  4C77 A;  1K4Q A;  2WQY A;  2GQW A;  2WOV A;  4OVI A;  1KSS A;  1GRT A;  1CJ3 A;  1Q1R A;  2GAG B;  3NGC X;  3S5W A;  1NPX A;  1JU2 A;  1TDN A;  3UOZ A;  2WEU A;  4J56 A;  2UZZ A;  4J34 A;  3T2Y A;  3ICR A;  1GV4 A;  3M13 A;  3UKQ A;  5C3J A;  1NHP A;  4YSY A;  3NIX A;  4H4R A;  3NYF A;  3QSM A;  3KLJ A;  4TM0 A;  1Q1W A;  4OCG A;  1GRA A;  3VRA A;  5HXI A;  3M12 A;  1YY5 A;  2WPE A;  4BUR A;  3O0H A;  2VZ2 A;  1H83 A;  1E39 A;  2OAM A;  3LXD A;  3QSS A;  2R4J A;  3G5S A;  1FEA A;  2YAU A;  5IQ1 A;  1RP0 A;  5JCI A;  3B6D A;  1REO A;  2BC1 A;  3ATR A;  3GD4 A;  4ECH A;  2BS4 A;  2ZZ0 A;  4WCT A;  1PJ7 A;  3DJE A;  4TM1 A;  4U8I A;  2NVK X;  4AP1 A;  1D7L A;  3H4K A;  2EQ8 A;  3NK2 X;  5FS9 A;  2C76 A;  3GYI A;  1PJ5 A;  2X3N A;  3LJP A;  5JCK A;  2GH5 A;  1NEK A;  4NZH A;  4JY2 A;  3AD8 B;  4IVO B;  2V3B A;  4USR A;  4A79 A;  2APG A;  3DGZ A;  4A9W A;  2R4E A;  1CL0 A;  3AYI A;  4AT2 A;  1FL2 A;  1JNR A;  4J57 A;  4APN A;  4O5Q A;  2WS3 A;  2WOI A;  4LU6 A;  2V61 A;  1KNP A;  2BAB A;  3G5Q A;  3UTE A;  5U1O A;  3CGD A;  2FJA A;  1JRX A;  3AE3 A;  5ER0 A;  3GWF A;  4Z25 A;  1XDI A;  4GRT A;  4Z2R A;  1CC2 A;  4IV9 A;  1EL9 A;  4UP3 A;  3SZF A;  3NN0 X;  2XFN A;  2GQF A;  4U2L A;  1M64 A;  4BK3 A;  2BCP A;  3UOV A;  4U8N A;  1DXL A;  1LVL A;  3NHO X;  1BGN A;  1IUT A;  1GRH A;  3CIR A;  1TDO A;  3IC9 A;  3GRT A;  1M6I A;  1KNR A;  4I59 A;  2GR1 A;  4TM3 A;  4X4J A;  1GEU A;  3CPJ G;  1GAL A;  1YKJ A;  3AE2 A;  3ABV A;  4LA1 A;  4G74 A;  2V5Z A;  4OPT A;  1H81 A;  1KDG A;  2BK3 A;  3P9U A;  1O5W A;  1Y56 B;  1PBE A;  2ACZ A;  1D4C A;  3AB1 A;  1F8S A;  4DSG A;  1KFY A;  4ZCC A;  4ADW A;  4H4V A;  5KMR A;  2Z5Y A;  3V76 A;  2ZZC A;  1HYU A;  1S2Q A;  1X31 B;  2X8H A;  4EQW A;  3JSK A;  4OPG A;  5KMP A;  1B4V A;  1E6E A;  1TDK A;  2C4C A;  2YWL A;  3CPI G;  1VRQ B;  3GDP A;  5C2T A;  3C96 A;  1B37 A;  2YG5 A;  4FX9 A;  1CC6 A;  4JNA A;  2WOW A;  4EMJ A;  1PBD A;  1PDH A;  4AOS A;  2R0P A;  3CNP A;  4USQ A;  4C3Y A;  2IVD A;  2YR4 A;  5EB5 A;  4FK1 C;  4OPL A;  3SX6 A;  1ELI A;  2WHD A;  5FS7 A;  4B68 A;  1D4E A;  4EQS A;  1PN0 A;  3UKK A;  1GTE A;  1PBC A;  2BS3 A;  1PHH A;  5LV9 A;  2X99 A;  1EL5 A;  2C65 A;  1XHC A;  1PXB A;  2XVH A;  2WU5 A;  2XVJ A;  3IWA A;  3HZL A;  2A8X A;  3ADA B;  4EQR A;  3UKF A;  4RG3 A;  3G5R A;  2YVJ A;  1OJC A;  2XVF A;  5M10 A;  1NHQ A;  4YTN A;  3CND A;  3SQP A;  3K7M X;  1DJN A;  4X9M A;  1EL8 A;  3CNS A;  3ISH A;  3FMW A;  4U8M A;  2XLS A;  2VVL A;  4U8J A;  2BAC A;  2FJE A;  3UTH A;  5KWF A;  3SZW A;  5BUK A;  3CTY A;  1UKV G;  3VQR A;  1SEZ A;  3Q9T A;  1LV0 A;  3VRD B;  2B7S A;  3P4P A;  1L9C A;  4BK1 A;  3Q6J A;  5KMS A;  1IUU A;  4AOX A;  3AE5 A;  1IJH A;  1P2H A;  2AAQ A;  2Q7V A;  2X8C A;  3OZ2 A;  3VR8 A;  1H7X A;  3B3R A;  1NHR A;  3EPT A;  4H50 A;  1N4U A;  2GAH B;  1PBF A;  1LTX R;  4Z43 A;  2WP5 A;  2YR6 A;  3F8D A;  3FBS A;  4II2 A;  4RSL A;  1CJ4 A;  2VOU A;  2QCU A;  4G73 A;  1KF6 A;  2Q6U A;  1VG9 A;  1NG4 A;  2XFP A;  3NK0 X;  2XLP A;  3T0K A;  3NTA A;  2C64 A;  4CCR A;  4DGK A;  1PJ6 A;  1L0V A;  4BK2 A;  3COX A;  2EQ7 A;  1JRZ A;  1VQW A;  4GUV A;  1V59 A;  3BHF A;  4ICY A;  3UP5 A;  1S2Y A;  3GYX A;  2GF3 A;  1NDA A;  2PHH A;  3P4Q A;  5JCM A;  4KX6 A;  3AD7 B;  4H2R A;  1LQT A;  2JAE A;  3CGE A;  3RED A;  1CJC A;  1N4V A;  4YT0 A;  2YG7 A;  4JY3 A;  1N4W A;  4H2P A;  3T37 A;  3UTF A;  1IUX A;  1XAN A;  5GRT A;  5BVA A;  3QFA A;  2XFQ A;  4WX1 A;  3BI2 A;  4BJY A;  4NEV A;  4REK A;  2FBW A;  3PS9 A;  5J7X A;  4CNK A;  3GSI A;  4H4W A;  1N1P A;  4K22 A;  4A6N B;  4K5R A;  2DKI A;  4B66 A;  2GB0 A;  2X50 A;  4FK1 A;  4H4U A;  1ZOY A;  3NKS A;  1PXA A;  2YM1 A;  1ZMD A;  2GR2 A;  4O5U A;  3AWI A;  3DME A;  2R0G A;  2WES A;  5HYM A;  3IHM A;  3P4R A;  4KPR A;  5J60 A;  4D03 A;  5M0Z A;  2GMJ A;  5U25 A;  4K7Z A;  4K2X A;  1IUS A;  4YSH A;  1MOK A;  3NNE A;  4GAV A;  2E4G A;  1MXT A;  3ITJ A;  4Y4L A;  3V3N A;  5KOX A;  4IA6 A;  2CUL A;  1TDE A;  4P9S A;  2XLT A;  1YQ4 A;  2BXS A;  3L1R A;  3QFB A;  1NHS A;  4ZCD A;  1QLB A;  4EIQ A;  4H4X A;  2AQJ A;  3UTG A;  4YWO A;  4H4Y A;  2CVJ A;  2WU2 A;  3C4N A;  1JEH A;  3FIM B;  4GAP A;  4NWZ A;  4NNJ A;  2JB1 A;  4EIP A;  1GXF A;  2GV8 A;  2XDO A;  1RSG A;  4H4P A;  4H7U A;  1E1M A;  1F8W A;  1CJ2 A;  1GER A;  1ONF A;  3LAD A;  2BRA A;  3QJ4 A;  4Z26 A;  2R45 A;  3AEE A;  3UP4 A;  5L46 A;  2WET A;  4YTM A;  4JN9 A;  2R46 A;  2YLR A;  4YKF A;  4NTE A;  1F6M A;  2C70 A;  4CY8 A;  2WPC A;  4H2Q A;  1K0L A;  3GMB A;  2YLW A;  1COY A;  3EAO A;  3UKP A;  3KPK A;  5JCL A;  1ZMC A;  2EQ6 A;  3DGH A;  3DH9 A;  1LPF A;  1GET A;  4CNJ A;  1GND A;  2YG6 A;  4XXG A;  1QJD A;  2B76 A;  2H89 A;  5KVI A;  2HQM A;  4DSH A;  3HYV A;  4EM4 A;  1BGJ A;  4JDR A;  3NYE A;  2OLO A;  2V3A A;  3NN6 X;  3AXB A;  3GDN A;  4C3X A;  2C3C A;  4PAA A;  3LZX A;  2F5Z A;  3RNM A;  5KXJ A;  3OC4 A;  1B8S A;  1ZP0 A;  2B9Y A;  3SXI A;  2C3D A;  1NEN A;  3AE7 A;  3AE4 A;  3LOV A;  2B9X A;  2OA1 A;  5TR3 A;  3QSE A;  2BA9 A;  5FMH A;  3ZYX A;  2C67 A;  1CF3 A;  1IUW A;  3V3O A;  1XPQ A;  2BK4 A;  3AE1 A;  1FEB A;  3K7Q X;  2RAB A;  3NLC A;  4UDR A;  4YSX A;  2I0Z A;  3KA7 A;  2XFU A;  2GVC A;  4CBQ A;  3EAN A;  1BF3 A;  4TM4 A;  2BCG G;  2WDV A;  4EM3 A;  1DOE A;  4MJW A;  2Y6Q A;  1RYI A;  2PYX A;  4YXD A;  1E1N A;  3DJJ A;  4G6H A;  5CQF A;  1K0J A;  1VG0 A;  3DK8 A;  2Q0L A;  2TMD A;  1GTH A;  2OLN A;  1FCD A;  3SM8 A;  2GR0 A;  3SYI A;  3T2K A;  3I3L A;  4B65 A;  2GRT A;  2GEW A;  4YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...