2CVJA

Crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
MWDVIVVGGGPSGLSAALFLARAGLKVLVLDGGRSKVKGVSRVPNYPGLLDEPSGEELLRRLEAHARRYGAEVRPGVVKGVRDMGGVFEVETEEGVEKAERLLLCTHKDPTLPSLLGLTRRGAYIDTDEGGRTSYPRVYAAGVARGKVPGHAIISAGDGAYVAVHLVSDLRGEPYKDHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin reductase related protein
publication title Crystal Structure of thioredoxin reductase-related protein TTHA0370 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 56
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2cvjA01
3UOXA 1KF6A 3F8RA 2BXSA 3DK8A 1GRGA 2BC1A 2EQ6A 3DGZA 4NZHA 4A6NA 2C73A 3V76A 4OPLA 2OA1A 3AWIA 1YQ3A 3NKSA 4NEVA 2XYOA 4DNAA 4UDQA 1KDGA 2XVIA 4P9SA 3ICRA 1H83A 1OJAA 5FS7A 4Z2TA 3CPIG 1MXTA 3ZYXA 1O94A 4TM3A 2XVFA 2WBAA 3KVEA 2RGJA 3GYIA 4C5OA 4OPCA 2E4GA 3QVPA 2B9YA 4KX6A 1AOGA 3IF9A 3NT6A 2ZBWA 1NDAA 1D4DA 2EQ7A 3K7MX 4O5UA 1Q1RA 2I0ZA 1H81A 3DK4A 4YXDA 4GUVA 2YLRA 3GD3A 4WX1A 2WOVA 2GVCA 4C77A 2V6OA 3GWDA 5BVAA 1JOAA 2WP6A 3BHFA 4YT0A 2BS3A 3OZ2A 4U8LA 4CNKA 3OC4A 5IQ4A 4O5QA 1GSNA 2BS4A 2GAHB 2Y6QA 2GR2A 3AE2A 1HYUA 2GQFA 2YLZA 2BCGG 3F8DA 2TPRA 2XLPA 4EIPA 4NTEA 3BI4A 1BWCA 2RABA 4I58A 4ZCCA 2YQUA 1XANA 3AE5A 4U8PA 3C96A 1ZOYA 4PABA 4J56A 1GTEA 2YWLA 4H4QA 1GNDA 4XWRA 2C75A 1GRHA 1IUVA 1LQUA 4H2QA 2FJAA 4JN9A 1NAAA 3UOVA 3AECA 1QJDA 4MJWA 2R9ZA 2C64A 1ZK7A 1EL9A 1XHCA 3L8KA 2GF3A 5U63A 4C3YA 3ITJA 4H2RA 3AEAA 1IUTA 4U8KA 5TR3A 4DGKA 4WCTA 3GMBA 1CJ3A 3GMCA 1KSUA 2GR1A 4GDPA 3FG2P 3AB1A 3FPZA 2XFUA 2AQJA 4TM1A 2CFYA 4H4TA 1IUSA 3NK1X 2XFOA 4U8MA 2C67A 2FJBA 1KNRA 1Q9IA 1GT8A 1JRYA 1OJDA 1KFYA 1Z6LA 2C70A 2TMDA 3FBSA 3UTEA 1D7LA 2B7RA 1W4XA 2CDUA 1B5QA 3CPHG 3II4A 5J7XA 1MOKA 1FECA 3GWFA 4FK1C 5DBJA 4Z25A 1Y56B 3F8PA 3G5SA 3BI5A 4DSGA 1XPQA 4TLZA 1ZP0A 4KPRA 5L46A 1UKVG 4AP1A 4ZCDA 2GQWA 1CC6A 3E1TA 2VQ7A 1NEKA 1JU2A 1ELIA 1YQZA 4CY6A 1YQ4A 4RG4A 4EM3A 4CCRA 1PXAA 2OALA 1NPXA 2GMJA 4K7ZA 1H7WA 1NG3A 2XLUA 2AAQA 1JRXA 2C3DA 4H4UA 1PBDA 4A9WA 1Y0PA 1EBDA 2WPCA 2ZZBA 3SFDA 5FS6A 1GRBA 2GRTA 2B9WA 2C72A 5LV9A 2Q7VA 1Q1WA 1RSGA 1EL7A 3AE9A 2ZZCA 4K8DA 2CVJA 1DOEA 5HHFA 4K5RA 1P2EA 1TYTA 3CGDA 1JEHA 4XXGA 1EL8A 1TDFA 5GSNA 1JRZA 5HYMA 3PVCA 4B69A 5C3JA 3AEGA 1BGJA 3I3LA 4TM0A 2PHHA 4OPTA 3LJPA 3L1RA 4U2TA 4EQRA 1VRQB 1ZMDA 1LPFA 2JKCA 3AE8A 3AE7A 1SEZA 2XLTA 2BK5A 2YLSA 3LZXA 3NK2X 3CGBA 2VRLA 2X8HA 5GRTA 3REDA 1GRFA 2IVEA 1N4UA 4Y4LA 1RYIA 4DSHA 2VVMA 2BS2A 1TRBA 2GB0A 4H4YA 3P4QA 2OLOA 1MO9A 3B6DA 4EMWA 4J36A 1PXCA 1N1PA 4ADWA 1FOHA 4NTCA 4EIQA 1YY5A 4A7AA 4D04A 1GTHA 4YKGA 2WP9A 3LOVA 2YVGA 1B8SA 1OJ9A 2VZ2A 3IC9A 3LB8A 3NRNA 3ZDNA 3NYCA 4Z26A 4GRTA 4CRTA 3R9UA 2V3BA 3S5WA 1D7YA 2JB2A 3CGCA 1K0LA 4A79A 3VRAA 3P1WA 3ABVA 1LJ1A 1DJQA 3NTAA 3NYEA 3CNJA 5FS9A 1NHPA 4YKFA 2NPXA 3DJGX 1D4EA 1CC4A 3EAOA 5KXJA 1LQTA 3ALLA 3NNEA 4YSZA 1K0IA 3RP8A 2X8GA 1M64A 4IVMB 1CC2A 4ICYA 3AEFA 3VRDB 3COXA 4J33A 3DA1A 2B7SA 2H89A 5FS8A 1GERA 1FEBA 3KPFA 1DNCA 3NHOX 5JCKA 4B1BA 1E6EA 1GREA 1PJ6A 4D03A 2WOWA 5JCLA 1S2QA 3LXDA 3CNSA 1PS9A 4IV9A 3PO7A 4JY3A 1F3PA 2WEUA 3CNPA 3I6DA 3P4SA 4Z24A 3UTFA 4YSHA 1S2YA 1S3BA 3Q6JA 2GR3A 1TDOA 4OPDA 3UKHA 4CNJA 1EL5A 2R4JA 2Z5YA 3LZWA 4X9NA 3H4KA 3GRTA 4REKA 5KRQA 4H4SA 1H84A 3AYLA 5HY5A 4U8IA 1F6MA 2QA1A 1GXFA 4H4ZA 3CNDA 1NHSA 3KLJA 2JAEA 1N4VA 2Q0KA 2C76A 1CF3A 1GALA 3DJEA 2APGA 2YAUA 3NIXA 4U8JA 3H8IA 2YM2A 1VG9A 2WDQA 1DJNA 2DKIA 3GDPA 1E1KA 1NG4A 4JNQA 1VDCA 1CJCA 4GCMA 2JB3A 3BNUA 4RSLA 4J31A 2C3CA 2YG3A 3QSMA 4EMJA 1QLBA 4N9XA 1KSSA 3UKPA 4IA5A 1P2HA 1FCDA 5J60A 3P9UA 3SQPA 2RGOA 2XFNA 1F8RA 2JB1A 3AE3A 4APNA 3UKAA 1JNRA 2YVJA 1FEAA 3ICSA 4H4XA 5EB4A 5KWFA 5KOXA 1RP0A 3UP4A 1VG0A 3PS9A 1L9CA 3WE0A 3NYFA 1BKWA 3SM8A 1PBEA 4BK1A 4H2PA 3ATQA 1GPEA 1L9DA 3S61A 1PBBA 3IHGA 5EB5A 3QVRA 3K7TA 1V59A 4OPUA 3GD4A 4RG3A 3C4AA 4NEWA 1NHQA 1N4WA 2YG6A 4CY8A 2WPFA 5KVHA 1PHHA 3UKLA 1DOBA 4YTNA 2X50A 2YLWA 4JY2A 4FK1A 3P4PA 1L0VA 4Z2RA 3NN6X 3NLCA 3EF6A 1LTXR 1YKJA 2FJEA 4K5SA 3UCLA 2O9ZA 3ISHA 4LU6A 3FMWA 3DJJA 4B66A 2YLTA 3D1CA 3VRBA 5M0ZA 3BHKA 4LA1A 2A89A 5BULA 5CKUA 1BGNA 1E1MA 3ATRA 3AYJA 3FIMB 1NHRA 4Z2UA 2FJDA 4OPGA 3T37A 2YVFA 1DXLA 5KOWA 2ARDA 2XLRA 1CJ2A 5FMHA 3QJ4A 1ZMCA 3QFAA 1IUUA 1H82A 2GV8A 2FBWA 1GOSA 2F5ZA 4AT0A 4EQWA 2WDVA 2VRMA 2BC0A 1B37A 1VQWA 3VR8A 5JCNA 4HB9A 2WQYA 2XVHA 4TLXA 1KNPA 2GH5A 1LV0A 1O95A 3NH3X 1O5WA 4EM4A 3GDNA 2IIDA 4B67A 4I59A 3NTDA 3LADA 4GR1A 3HZLA 2YG7A 1K4QA 4B68A 3H8LA 2YG5A 2ACZA 1BF3A 1DOCA 4J34A 4UDPA 1S3EA 3AEEA 2XCGA 1BZLA 3CTYA 2XFQA 3AYIA 3KD9A 3M13A 3AE4A 4H4RA 4H7UA 4C3XA 4EQXA 1D4CA 2YR6A 4BJZA 1IJHA 2BK4A 3P4RA 1FL2A 2EQ9A 3NN0X 4FDCB 2JBVA 4ECHA 3IHMA 1PDHA 1PN0A 2WDRA 2YR4A 1K0JA 1CJ4A 3CIRA 3GYJA 1F8WA 3ICTA 1REOA 2QAEA 1Y56A 2A8XA 4M52A 3SGLA 3VQRA 2OLNA 1NENA 2E1MA 4AP3A 1E39A 5U25A 2YM1A 4H2NA 2RGHA 5JCMA 4PAAA 3UOZA 1ZY8A 2BABA 1PJ7A 2E5VA 2X99A 1COYA 5BRTA 2WU5A 3KU9A 2XVJA 2AR8A 2BA9A 4J2WA 2IVDA 2V60A 4NTDA 5IPYA 4YSYA 2V5ZA 1E1LA 1H6VA 4OVIA 3AD9B 1B4VA 2VVLG 3CN8A 4YWOA 4HA6A 3SFEA 3G5RA 5C2TA 4A6NB 4X9MA 1GESA 4AOXA 1JNZA 4BV6A 4LIIA 4U2SA 3GRSA 4IA6A 1TDNA 3AEDA 1F8SA 3B3RA 3VR9A 4XWZA 2WS3A 2OAMA 2CULA 3JSKA 3ADAB 3UTHA 2WPEA 2BYBA 4CBQA 2EQ8A 3KA7A 1H7XA 4K22A 3AD8B 4BJYA 3EANA 4E0VA 4Z43A 1E1NA 2Y6RA 1GV4A 3QSSA 3BNMA 3DH9A 4X4JA 3O0HA 3QSEA 4OPIA 3K7QX 1IUWA 3K30A 1D5TA 2X8CA 3M0OA 1GEUA 2B76A 3UKFA 4UDRA 3AEBA 2R0PA 2WOIA 1CHUA 4B63A 1TYPA 3V3NA 3URHA 4C74A 2WETA 4H50A 1E7PA 4BK3A 2WESA 1TDEA 1OJTA 3CGEA 1PBFA 2VOUA 5KVIA 1CBOA 2DKHA 4YTPA 2BK3A 2PYXA 4IVOB 3AXBA 3ALMA 4USRA 4Y4NA 2YLXA 1X31B 5IQ1A 3DK9A 1L9EA 4BURA 2R0GA 2J3NA 2A87A 2YG4A 1QO8A 2W0HA 4U8NA 3BI2A 2C7GA 3ALJA 2R0CA 2BCPA 3KKJA 1PJ5A 5CQFA 1GRTA 4TM4A 2Q6UA 3DJDA 1IUXA 2XFPA 4U2LA 1TDKA 3NK0X 4FX9A 2UZZA 2Z5XA 3AD7B 3Q9TA 4GF7A 4A5LA 3IWAA 4Z44A 2H88A 2B9XA 4H4VA 5EBKA 2JK6A 4BK2A 2GR0A 4Y4MA 2Q0LA 3D8XA 4H4WA 5JCIA 3UKKA 3DGHA 2GEWA 1CL0A 2VVLA 3QFBA 4JDRA 1DODA 3DMEA 3RP6A 4AT2A 2GMHA 2QCUA 1ONFA 4ZN0A 4U8OA 2WHDA 1XDIA 2V3AA 2XVEA 2ZZ0A 2QA2A 2R4EA 4UP3A 4AOSA 5BUKA 4JQ9A 3CPJG 3NGCX 4GDEA 3C4NA 4B64A 3UOYA 4EMIA 2C65A 2NVKX 2VQBA 4YTMA 5ER0A 2WU2A 3UTGA 1GETA 5M10A 1ZDLA 4B65A 5HXIA 2BXRA 4H4PA 3M12A 1ZOVA 1GRAA 1PBCA 1ZX9A 3AE1A 3RHAA 1ZKQA 2WP5A 2GAGB 4JNAA 2R46A 3RP7A 1PXBA 4CCQA 3RNMA 1H86A 2HQMA 4A65A 4A99A 3UP5A 3EPTA 1M6IA 3AE6A 2V61A 2XDOA 4J57A 3V3OA 4YSXA 3G5QA 3UKQA 1LVLA 2BACA 3GSIA 3CNTA 4USQA 4EQSA 2C66A 4OCGA 5U1OA 5EOWA 2XLSA 2X3NA 2R45A 4K2XA 3NG7X 1OJCA 2YR5A
chains in the Genus database with same CATH superfamily
3UOXA 1KF6A 3F8RA 2BXSA 3DK8A 1GRGA 2BC1A 2EQ6A 3DGZA 4NZHA 4A6NA 2C73A 3V76A 4OPLA 2OA1A 3AWIA 1YQ3A 3NKSA 4NEVA 2XYOA 4DNAA 4UDQA 1KDGA 2XVIA 4P9SA 3ICRA 1H83A 1OJAA 5FS7A 4Z2TA 3CPIG 3KPKA 1MXTA 3ZYXA 1O94A 4TM3A 2XVFA 2WBAA 3KVEA 2RGJA 3GYIA 4C5OA 4OPCA 2E4GA 3QVPA 2B9YA 4KX6A 1AOGA 3IF9A 3NT6A 2ZBWA 1NDAA 1D4DA 2EQ7A 3K7MX 4O5UA 1Q1RA 2I0ZA 1H81A 3DK4A 4YXDA 4G6GA 4GUVA 2YLRA 3GD3A 4WX1A 2WOVA 2GVCA 4C77A 2V6OA 3GWDA 5BVAA 1JOAA 2WP6A 3BHFA 4YT0A 2BS3A 3OZ2A 4U8LA 4CNKA 4II2A 3OC4A 5IQ4A 4O5QA 5KMRA 1GSNA 2BS4A 2GAHB 2Y6QA 2GR2A 3AE2A 1HYUA 2GQFA 2YLZA 2BCGG 3F8DA 2TPRA 2XLPA 4EIPA 4NTEA 3BI4A 1BWCA 2RABA 4I58A 4ZCCA 2YQUA 1XANA 3AE5A 4U8PA 3C96A 1ZOYA 4PABA 4J56A 1GTEA 2YWLA 4H4QA 1GNDA 3SZ0A 4XWRA 2C75A 1GRHA 1IUVA 1LQUA 4H2QA 2FJAA 4JN9A 1NAAA 3UOVA 3AECA 1QJDA 4MJWA 2R9ZA 2C64A 1ZK7A 1EL9A 1XHCA 3L8KA 2GF3A 5U63A 4C3YA 3ITJA 4H2RA 3AEAA 1IUTA 4U8KA 5TR3A 4DGKA 4WCTA 3GMBA 1CJ3A 3GMCA 1KSUA 2GR1A 4GDPA 3FG2P 3AB1A 3FPZA 4II3A 2XFUA 2AQJA 4TM1A 2CFYA 4H4TA 1IUSA 3NK1X 2XFOA 4U8MA 2C67A 2FJBA 1KNRA 1Q9IA 1GT8A 1JRYA 1OJDA 1KFYA 1Z6LA 2C70A 2TMDA 3FBSA 3UTEA 1D7LA 2B7RA 1W4XA 2CDUA 1B5QA 3CPHG 3II4A 5J7XA 1MOKA 1FECA 3GWFA 4FK1C 5DBJA 4Z25A 1Y56B 3F8PA 3G5SA 3BI5A 4DSGA 1XPQA 4TLZA 1ZP0A 4KPRA 5L46A 1UKVG 4AP1A 4ZCDA 3T2YA 2GQWA 1CC6A 3E1TA 2VQ7A 3SYIA 1NEKA 1JU2A 1ELIA 1YQZA 4CY6A 1YQ4A 4RG4A 4EM3A 4CCRA 1PXAA 2OALA 1NPXA 2GMJA 4K7ZA 1H7WA 1NG3A 2XLUA 2AAQA 1JRXA 2C3DA 4H4UA 1PBDA 3T31A 1Y0PA 4A9WA 1EBDA 2WPCA 2ZZBA 3SFDA 5FS6A 1GRBA 2GRTA 2B9WA 2C72A 5LV9A 2Q7VA 1Q1WA 1RSGA 1EL7A 3AE9A 2ZZCA 4K8DA 2CVJA 1DOEA 5HHFA 4K5RA 1P2EA 1TYTA 3CGDA 1JEHA 4XXGA 1EL8A 1TDFA 5GSNA 1JRZA 5HYMA 3PVCA 4B69A 5C3JA 3AEGA 1BGJA 3I3LA 4TM0A 2PHHA 4OPTA 3SY4A 3LJPA 3L1RA 4U2TA 4EQRA 1VRQB 1ZMDA 1LPFA 2JKCA 3AE8A 3AE7A 1SEZA 2XLTA 2BK5A 2YLSA 3LZXA 3NK2X 3CGBA 2VRLA 2X8HA 5GRTA 3REDA 1GRFA 2IVEA 1N4UA 4Y4LA 1RYIA 4DSHA 2VVMA 2BS2A 1TRBA 2GB0A 4H4YA 3P4QA 2OLOA 3SXIA 1MO9A 3B6DA 4EMWA 4J36A 1PXCA 3HYVA 1N1PA 4ADWA 1FOHA 4NTCA 4EIQA 1YY5A 4A7AA 4D04A 1GTHA 4YKGA 2WP9A 3LOVA 2YVGA 1B8SA 1OJ9A 2VZ2A 3IC9A 3LB8A 3NRNA 3ZDNA 3NYCA 4Z26A 4GRTA 4CRTA 3R9UA 2V3BA 3S5WA 1D7YA 2JB2A 3CGCA 1K0LA 4A79A 3VRAA 3P1WA 3ABVA 1LJ1A 1DJQA 3NTAA 3NYEA 3CNJA 5FS9A 1NHPA 4YKFA 2NPXA 3DJGX 1D4EA 1CC4A 3EAOA 5KXJA 1LQTA 3ALLA 3NNEA 4YSZA 1K0IA 3RP8A 2X8GA 1M64A 4G6HA 4IVMB 1CC2A 4ICYA 3AEFA 2BRYA 3VRDB 3COXA 4J33A 3SZWA 3DA1A 3CMMA 2B7SA 2H89A 5FS8A 1GERA 1FEBA 3KPFA 1DNCA 3NHOX 5JCKA 4B1BA 1E6EA 1GREA 1PJ6A 4D03A 2WOWA 5JCLA 1S2QA 3LXDA 3CNSA 1PS9A 4IV9A 3PO7A 4JY3A 1F3PA 2WEUA 3CNPA 3I6DA 3P4SA 4Z24A 3UTFA 4YSHA 1S2YA 1S3BA 3Q6JA 2GR3A 1TDOA 4OPDA 3UKHA 4CNJA 1EL5A 2R4JA 2Z5YA 3LZWA 4X9NA 3H4KA 3GRTA 4REKA 5KRQA 4H4SA 1H84A 3AYLA 5HY5A 4U8IA 1F6MA 2QA1A 1GXFA 4H4ZA 3CNDA 1NHSA 3KLJA 2JAEA 1N4VA 2Q0KA 2C76A 1CF3A 1GALA 3DJEA 2APGA 2YAUA 3NIXA 4U8JA 3HYWA 3H8IA 2YM2A 1VG9A 2WDQA 1DJNA 2DKIA 3GDPA 1E1KA 1NG4A 4JNQA 1VDCA 4GAVA 1CJCA 4GCMA 2JB3A 3BNUA 4RSLA 4J31A 2C3CA 2YG3A 3QSMA 4EMJA 1QLBA 4N9XA 1KSSA 3UKPA 4IA5A 1P2HA 1FCDA 4G73A 5J60A 3P9UA 3SQPA 2RGOA 2XFNA 1F8RA 2JB1A 3AE3A 4APNA 3UKAA 1JNRA 2YVJA 1FEAA 3ICSA 4H4XA 5EB4A 5KWFA 5KOXA 1RP0A 3UP4A 1VG0A 3PS9A 1L9CA 3WE0A 3NYFA 1BKWA 3SM8A 1PBEA 4BK1A 4H2PA 3ATQA 3SX6A 1GPEA 1L9DA 3S61A 1PBBA 3IHGA 5EB5A 3QVRA 3K7TA 1V59A 4OPUA 3GD4A 4RG3A 3C4AA 4NEWA 1NHQA 1N4WA 2YG6A 4CY8A 2WPFA 5KVHA 1PHHA 3UKLA 1DOBA 4YTNA 4NWZA 2X50A 3GYXA 2YLWA 4JY2A 4FK1A 5KMPA 5KMSA 3P4PA 1L0VA 4Z2RA 3NN6X 3NLCA 3EF6A 1LTXR 1YKJA 2FJEA 4K5SA 3UCLA 2O9ZA 3ISHA 4LU6A 3FMWA 3T2KA 3DJJA 4B66A 2YLTA 5KNLA 3D1CA 3VRBA 5M0ZA 3BHKA 4LA1A 2A89A 5BULA 5CKUA 1BGNA 1E1MA 3ATRA 3AYJA 3FIMB 1NHRA 4Z2UA 2FJDA 4OPGA 3T37A 2YVFA 1DXLA 5KOWA 2ARDA 2XLRA 1CJ2A 5FMHA 3QJ4A 1ZMCA 3QFAA 1IUUA 1H82A 2GV8A 2FBWA 1GOSA 2F5ZA 4AT0A 4EQWA 2WDVA 2VRMA 2BC0A 1B37A 1VQWA 3VR8A 5JCNA 4HB9A 2WQYA 2XVHA 4TLXA 1KNPA 2GH5A 1LV0A 1O95A 3NH3X 1O5WA 4EM4A 3GDNA 2IIDA 4B67A 4I59A 3NTDA 3LADA 4GR1A 3HZLA 2YG7A 1K4QA 4B68A 3H8LA 2YG5A 2ACZA 1BF3A 1DOCA 4J34A 4UDPA 1S3EA 3AEEA 2XCGA 1BZLA 3CTYA 2XFQA 3AYIA 3KD9A 3M13A 3AE4A 4H4RA 4H7UA 4C3XA 4EQXA 1D4CA 2YR6A 4BJZA 1IJHA 2BK4A 3P4RA 1FL2A 2EQ9A 3NN0X 4GAPA 4FDCB 2JBVA 4ECHA 3IHMA 1PDHA 1PN0A 2WDRA 2YR4A 1K0JA 1CJ4A 3CIRA 3GYJA 1F8WA 3ICTA 1REOA 2QAEA 1Y56A 2A8XA 4M52A 4G9KA 3SGLA 3VQRA 2OLNA 1NENA 2E1MA 4AP3A 1E39A 5U25A 2YM1A 4H2NA 2RGHA 5JCMA 4PAAA 3UOZA 3SZFA 1ZY8A 2BABA 1PJ7A 2E5VA 2X99A 1COYA 5BRTA 2WU5A 3KU9A 2XVJA 2AR8A 2BA9A 4J2WA 2IVDA 2V60A 4NTDA 5IPYA 4YSYA 2V5ZA 1E1LA 1H6VA 4OVIA 3AD9B 1B4VA 2VVLG 3CN8A 4YWOA 4HA6A 3SFEA 3G5RA 3T2ZA 5C2TA 4A6NB 4X9MA 1GESA 4AOXA 1JNZA 4BV6A 4LIIA 4U2SA 3GRSA 4IA6A 1TDNA 3AEDA 1F8SA 3B3RA 3VR9A 4XWZA 2WS3A 2OAMA 2CULA 3JSKA 3ADAB 3UTHA 2WPEA 2BYBA 3T14A 4CBQA 2EQ8A 3KA7A 1H7XA 4K22A 3AD8B 4BJYA 3EANA 4E0VA 4Z43A 1E1NA 2Y6RA 1GV4A 3QSSA 3BNMA 3DH9A 4X4JA 3O0HA 3QSEA 4OPIA 3K7QX 1IUWA 3K30A 1D5TA 2X8CA 3M0OA 1GEUA 2B76A 3UKFA 4UDRA 3AEBA 2R0PA 2WOIA 1CHUA 2BRAA 4B63A 1TYPA 3V3NA 3URHA 4C74A 2WETA 4H50A 1E7PA 4BK3A 4NNJA 2WESA 1TDEA 1OJTA 3CGEA 1PBFA 2VOUA 5KVIA 1CBOA 2DKHA 4YTPA 2BK3A 2PYXA 4IVOB 3AXBA 3ALMA 4USRA 4Y4NA 2YLXA 1X31B 5IQ1A 3DK9A 1L9EA 4BURA 2R0GA 3T0KA 2J3NA 2A87A 2YG4A 1QO8A 2W0HA 3HYXA 4U8NA 3BI2A 2C7GA 3ALJA 2R0CA 2BCPA 3KKJA 1PJ5A 5CQFA 1GRTA 4TM4A 2Q6UA 3DJDA 1IUXA 2XFPA 4U2LA 1TDKA 3NK0X 4FX9A 2UZZA 2Z5XA 3AD7B 3Q9TA 4GF7A 4A5LA 3IWAA 4Z44A 2H88A 2B9XA 4H4VA 5EBKA 2JK6A 4BK2A 2GR0A 4Y4MA 2Q0LA 3D8XA 4H4WA 5JCIA 3UKKA 3DGHA 2GEWA 1CL0A 2VVLA 3QFBA 4JDRA 1DODA 3DMEA 3RP6A 4AT2A 2GMHA 2QCUA 1ONFA 3SZCA 4ZN0A 4U8OA 2WHDA 1XDIA 2V3AA 2XVEA 2ZZ0A 2QA2A 2R4EA 4UP3A 4AOSA 5BUKA 4JQ9A 5KMQA 3CPJG 3NGCX 4GDEA 3C4NA 4B64A 3UOYA 4EMIA 2C65A 2NVKX 2VQBA 4YTMA 5ER0A 2WU2A 3UTGA 1GETA 2C4CA 5M10A 1ZDLA 4B65A 5HXIA 2BXRA 4H4PA 3M12A 1ZOVA 1GRAA 1PBCA 1ZX9A 3AE1A 3RHAA 1ZKQA 2WP5A 2GAGB 4JNAA 2R46A 3RP7A 1PXBA 4CCQA 3RNMA 1H86A 2HQMA 4A65A 4A99A 3UP5A 3EPTA 1M6IA 3AE6A 2V61A 2XDOA 4J57A 3V3OA 4YSXA 3G5QA 3UKQA 1LVLA 2BACA 3GSIA 3CNTA 4USQA 4EQSA 2C66A 4OCGA 5U1OA 4G74A 5EOWA 2XLSA 2X3NA 2R45A 4K2XA 3NG7X 1OJCA 2YR5A
chains in the Genus database with same CATH topology
3UOXA 1KF6A 3F8RA 2BXSA 3DK8A 1GRGA 2BC1A 2EQ6A 3DGZA 4NZHA 4A6NA 2C73A 3V76A 4OPLA 2OA1A 3AWIA 1YQ3A 3NKSA 4NEVA 2XYOA 4DNAA 4UDQA 1KDGA 2XVIA 4P9SA 3ICRA 1H83A 1OJAA 5FS7A 4Z2TA 3CPIG 3KPKA 1MXTA 3ZYXA 1O94A 4TM3A 2XVFA 2WBAA 3KVEA 2RGJA 3GYIA 4C5OA 4OPCA 2E4GA 3QVPA 2B9YA 4KX6A 1AOGA 3IF9A 3NT6A 2ZBWA 1NDAA 1D4DA 2EQ7A 3K7MX 4O5UA 1Q1RA 2I0ZA 1H81A 3DK4A 4YXDA 4G6GA 4GUVA 2YLRA 3GD3A 4WX1A 2WOVA 2GVCA 4C77A 2V6OA 3GWDA 5BVAA 1JOAA 2WP6A 3BHFA 4YT0A 2BS3A 3OZ2A 4U8LA 4CNKA 4II2A 3OC4A 5IQ4A 4O5QA 5KMRA 1GSNA 2BS4A 2GAHB 2Y6QA 2GR2A 3AE2A 1HYUA 2GQFA 2YLZA 2BCGG 3F8DA 2TPRA 2XLPA 4EIPA 4NTEA 3BI4A 1BWCA 2RABA 4I58A 4ZCCA 2YQUA 1XANA 3AE5A 4U8PA 3C96A 1ZOYA 4PABA 4J56A 1GTEA 2YWLA 4H4QA 1GNDA 3SZ0A 4XWRA 2C75A 1GRHA 1IUVA 1LQUA 4H2QA 2FJAA 4JN9A 1NAAA 3UOVA 3AECA 1QJDA 4MJWA 2R9ZA 2C64A 1ZK7A 1EL9A 1XHCA 3L8KA 2GF3A 5U63A 4C3YA 3ITJA 4H2RA 3AEAA 1IUTA 4U8KA 5TR3A 4DGKA 4WCTA 3GMBA 1CJ3A 3GMCA 1KSUA 2GR1A 4GDPA 3FG2P 3AB1A 3FPZA 4II3A 2XFUA 2AQJA 4TM1A 2CFYA 4H4TA 1IUSA 3NK1X 2XFOA 4U8MA 2C67A 2FJBA 1KNRA 1Q9IA 1GT8A 1JRYA 1OJDA 1KFYA 1Z6LA 2C70A 2TMDA 3FBSA 3UTEA 1D7LA 2B7RA 1W4XA 2CDUA 1B5QA 3CPHG 3II4A 5J7XA 1MOKA 1FECA 3GWFA 4FK1C 5DBJA 4Z25A 1Y56B 3F8PA 3G5SA 3BI5A 4DSGA 1XPQA 4TLZA 1ZP0A 4KPRA 5L46A 1UKVG 4AP1A 4ZCDA 3T2YA 2GQWA 1CC6A 3E1TA 2VQ7A 3SYIA 1NEKA 1JU2A 1ELIA 1YQZA 4CY6A 1YQ4A 4RG4A 4EM3A 4CCRA 1PXAA 2OALA 1NPXA 2GMJA 4K7ZA 1H7WA 1NG3A 2XLUA 2AAQA 1JRXA 2C3DA 4H4UA 1PBDA 3T31A 1Y0PA 4A9WA 1EBDA 2WPCA 2ZZBA 3SFDA 5FS6A 1GRBA 2GRTA 2B9WA 2C72A 5LV9A 2Q7VA 1Q1WA 1RSGA 1EL7A 3AE9A 2ZZCA 4K8DA 2CVJA 1DOEA 5HHFA 4K5RA 1P2EA 1TYTA 3CGDA 1JEHA 4XXGA 1EL8A 1TDFA 5GSNA 1JRZA 5HYMA 3PVCA 4B69A 5C3JA 3AEGA 1BGJA 3I3LA 4TM0A 2PHHA 4OPTA 3SY4A 3LJPA 3L1RA 4U2TA 4EQRA 1VRQB 1ZMDA 1LPFA 2JKCA 3AE8A 3AE7A 1SEZA 2XLTA 2BK5A 2YLSA 3LZXA 3NK2X 3CGBA 2VRLA 2X8HA 5GRTA 3REDA 1GRFA 2IVEA 1N4UA 4Y4LA 1RYIA 4DSHA 2VVMA 2BS2A 1TRBA 2GB0A 4H4YA 3P4QA 2OLOA 3SXIA 1MO9A 3B6DA 4EMWA 4J36A 1PXCA 3HYVA 1N1PA 4ADWA 1FOHA 4NTCA 4EIQA 1YY5A 4A7AA 4D04A 1GTHA 4YKGA 2WP9A 3LOVA 2YVGA 1B8SA 1OJ9A 2VZ2A 3IC9A 3LB8A 3NRNA 3ZDNA 3NYCA 4Z26A 4GRTA 4CRTA 3R9UA 2V3BA 3S5WA 1D7YA 2JB2A 3CGCA 1K0LA 4A79A 3VRAA 3P1WA 3ABVA 1LJ1A 1DJQA 3NTAA 3NYEA 3CNJA 5FS9A 1NHPA 4YKFA 2NPXA 3DJGX 1D4EA 1CC4A 3EAOA 5KXJA 1LQTA 3ALLA 3NNEA 4YSZA 1K0IA 3RP8A 2X8GA 1M64A 4G6HA 4IVMB 1CC2A 4ICYA 3AEFA 2BRYA 3VRDB 3COXA 4J33A 3SZWA 3DA1A 3CMMA 2B7SA 2H89A 5FS8A 1GERA 1FEBA 3KPFA 1DNCA 3NHOX 5JCKA 4B1BA 1E6EA 1GREA 1PJ6A 4D03A 2WOWA 5JCLA 1S2QA 3LXDA 3CNSA 1PS9A 4IV9A 3PO7A 4JY3A 1F3PA 2WEUA 3CNPA 3I6DA 3P4SA 4Z24A 3UTFA 4YSHA 1S2YA 1S3BA 3Q6JA 2GR3A 1TDOA 4OPDA 3UKHA 4CNJA 1EL5A 2R4JA 2Z5YA 3LZWA 4X9NA 3H4KA 3GRTA 4REKA 5KRQA 4H4SA 1H84A 3AYLA 5HY5A 4U8IA 1F6MA 2QA1A 1GXFA 4H4ZA 3CNDA 1NHSA 3KLJA 2JAEA 1N4VA 2Q0KA 2C76A 1CF3A 1GALA 3DJEA 2APGA 2YAUA 3NIXA 4U8JA 3HYWA 3H8IA 2YM2A 1VG9A 2WDQA 1DJNA 2DKIA 3GDPA 1E1KA 1NG4A 4JNQA 1VDCA 4GAVA 1CJCA 4GCMA 2JB3A 3BNUA 4RSLA 4J31A 2C3CA 2YG3A 3QSMA 4EMJA 1QLBA 4N9XA 1KSSA 3UKPA 4IA5A 1P2HA 1FCDA 4G73A 5J60A 3P9UA 3SQPA 2RGOA 2XFNA 1F8RA 2JB1A 3AE3A 4APNA 3UKAA 1JNRA 2YVJA 1FEAA 3ICSA 4H4XA 5EB4A 5KWFA 5KOXA 1RP0A 3UP4A 1VG0A 3PS9A 1L9CA 3WE0A 3NYFA 1BKWA 3SM8A 1PBEA 4BK1A 4H2PA 3ATQA 3SX6A 1GPEA 1L9DA 3S61A 1PBBA 3IHGA 5EB5A 3QVRA 3K7TA 1V59A 4OPUA 3GD4A 4RG3A 3C4AA 4NEWA 1NHQA 1N4WA 2YG6A 4CY8A 2WPFA 5KVHA 1PHHA 3UKLA 1DOBA 4YTNA 4NWZA 2X50A 3GYXA 2YLWA 4JY2A 4FK1A 5KMPA 5KMSA 3P4PA 1L0VA 4Z2RA 3NN6X 3NLCA 3EF6A 1LTXR 1YKJA 2FJEA 4K5SA 3UCLA 2O9ZA 3ISHA 4LU6A 3FMWA 3T2KA 3DJJA 4B66A 2YLTA 5KNLA 3D1CA 3VRBA 5M0ZA 3BHKA 4LA1A 2A89A 5BULA 5CKUA 1BGNA 1E1MA 3ATRA 3AYJA 3FIMB 1NHRA 4Z2UA 2FJDA 4OPGA 3T37A 2YVFA 1DXLA 5KOWA 2ARDA 2XLRA 1CJ2A 5FMHA 3QJ4A 1ZMCA 3QFAA 1IUUA 1H82A 2GV8A 2FBWA 1GOSA 2F5ZA 4AT0A 4EQWA 2WDVA 2VRMA 2BC0A 1B37A 1VQWA 3VR8A 5JCNA 4HB9A 2WQYA 2XVHA 4TLXA 1KNPA 2GH5A 1LV0A 1O95A 3NH3X 1O5WA 4EM4A 3GDNA 2IIDA 4B67A 4I59A 3NTDA 3LADA 4GR1A 3HZLA 2YG7A 1K4QA 4B68A 3H8LA 2YG5A 2ACZA 1BF3A 1DOCA 4J34A 4UDPA 1S3EA 3AEEA 2XCGA 1BZLA 3CTYA 2XFQA 3AYIA 3KD9A 3M13A 3AE4A 4H4RA 4H7UA 4C3XA 4EQXA 1D4CA 2YR6A 4BJZA 1IJHA 2BK4A 3P4RA 1FL2A 2EQ9A 3NN0X 4GAPA 4FDCB 2JBVA 4ECHA 3IHMA 1PDHA 1PN0A 2WDRA 2YR4A 1K0JA 1CJ4A 3CIRA 3GYJA 1F8WA 3ICTA 1REOA 2QAEA 1Y56A 2A8XA 4M52A 4G9KA 3SGLA 3VQRA 2OLNA 1NENA 2E1MA 4AP3A 1E39A 5U25A 2YM1A 4H2NA 2RGHA 5JCMA 4PAAA 3UOZA 3SZFA 1ZY8A 2BABA 1PJ7A 2E5VA 2X99A 1COYA 5BRTA 2WU5A 3KU9A 2XVJA 2AR8A 2BA9A 4J2WA 2IVDA 2V60A 4NTDA 5IPYA 4YSYA 2V5ZA 1E1LA 1H6VA 4OVIA 3AD9B 1B4VA 2VVLG 3CN8A 4YWOA 4HA6A 3SFEA 3G5RA 3T2ZA 5C2TA 4A6NB 4X9MA 1GESA 4AOXA 1JNZA 4BV6A 4LIIA 4U2SA 3GRSA 4IA6A 1TDNA 3AEDA 1F8SA 3B3RA 3VR9A 4XWZA 2WS3A 2OAMA 2CULA 3JSKA 3ADAB 3UTHA 2WPEA 2BYBA 3T14A 4CBQA 2EQ8A 3KA7A 1H7XA 4K22A 3AD8B 4BJYA 3EANA 4E0VA 4Z43A 1E1NA 2Y6RA 1GV4A 3QSSA 3BNMA 3DH9A 4X4JA 3O0HA 3QSEA 4OPIA 3K7QX 1IUWA 3K30A 1D5TA 2X8CA 3M0OA 1GEUA 2B76A 3UKFA 4UDRA 3AEBA 2R0PA 2WOIA 1CHUA 2BRAA 4B63A 1TYPA 3V3NA 3URHA 4C74A 2WETA 4H50A 1E7PA 4BK3A 4NNJA 2WESA 1TDEA 1OJTA 3CGEA 1PBFA 2VOUA 5KVIA 1CBOA 2DKHA 4YTPA 2BK3A 2PYXA 4IVOB 3AXBA 3ALMA 4USRA 4Y4NA 2YLXA 1X31B 5IQ1A 3DK9A 1L9EA 4BURA 2R0GA 3T0KA 2J3NA 2A87A 2YG4A 1QO8A 2W0HA 3HYXA 4U8NA 3BI2A 2C7GA 3ALJA 2R0CA 2BCPA 3KKJA 1PJ5A 5CQFA 1GRTA 4TM4A 2Q6UA 3DJDA 1IUXA 2XFPA 4U2LA 1TDKA 3NK0X 4FX9A 2UZZA 2Z5XA 3AD7B 3Q9TA 4GF7A 4A5LA 3IWAA 4Z44A 2H88A 2B9XA 4H4VA 5EBKA 2JK6A 4BK2A 2GR0A 4Y4MA 2Q0LA 3D8XA 4H4WA 5JCIA 3UKKA 3DGHA 2GEWA 1CL0A 2VVLA 3QFBA 4JDRA 1DODA 3DMEA 3RP6A 4AT2A 2GMHA 2QCUA 1ONFA 3SZCA 4ZN0A 4U8OA 2WHDA 1XDIA 2V3AA 2XVEA 2ZZ0A 2QA2A 2R4EA 4UP3A 4AOSA 5BUKA 4JQ9A 5KMQA 3CPJG 3NGCX 4GDEA 3C4NA 4B64A 3UOYA 4EMIA 2C65A 2NVKX 2VQBA 4YTMA 5ER0A 2WU2A 3UTGA 1GETA 2C4CA 5M10A 1ZDLA 4B65A 5HXIA 2BXRA 4H4PA 3M12A 1ZOVA 1GRAA 1PBCA 1ZX9A 3AE1A 3RHAA 1ZKQA 2WP5A 2GAGB 4JNAA 2R46A 3RP7A 1PXBA 4CCQA 3RNMA 1H86A 2HQMA 4A65A 4A99A 3UP5A 3EPTA 1M6IA 3AE6A 2V61A 2XDOA 4J57A 3V3OA 4YSXA 3G5QA 3UKQA 1LVLA 2BACA 3GSIA 3CNTA 4USQA 4EQSA 2C66A 4OCGA 5U1OA 4G74A 5EOWA 2XLSA 2X3NA 2R45A 4K2XA 3NG7X 1OJCA 2YR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOX A;  1KF6 A;  3F8R A;  2BXS A;  3DK8 A;  1GRG A;  2BC1 A;  2EQ6 A;  3DGZ A;  4NZH A;  4A6N A;  2C73 A;  3V76 A;  4OPL A;  2OA1 A;  3AWI A;  1YQ3 A;  3NKS A;  4NEV A;  2XYO A;  4DNA A;  4UDQ A;  1KDG A;  2XVI A;  4P9S A;  3ICR A;  1H83 A;  1OJA A;  5FS7 A;  4Z2T A;  3CPI G;  1MXT A;  3ZYX A;  1O94 A;  4TM3 A;  2XVF A;  2WBA A;  3KVE A;  2RGJ A;  3GYI A;  4C5O A;  4OPC A;  2E4G A;  3QVP A;  2B9Y A;  4KX6 A;  1AOG A;  3IF9 A;  3NT6 A;  2ZBW A;  1NDA A;  1D4D A;  2EQ7 A;  3K7M X;  4O5U A;  1Q1R A;  2I0Z A;  1H81 A;  3DK4 A;  4YXD A;  4GUV A;  2YLR A;  3GD3 A;  4WX1 A;  2WOV A;  2GVC A;  4C77 A;  2V6O A;  3GWD A;  5BVA A;  1JOA A;  2WP6 A;  3BHF A;  4YT0 A;  2BS3 A;  3OZ2 A;  4U8L A;  4CNK A;  3OC4 A;  5IQ4 A;  4O5Q A;  1GSN A;  2BS4 A;  2GAH B;  2Y6Q A;  2GR2 A;  3AE2 A;  1HYU A;  2GQF A;  2YLZ A;  2BCG G;  3F8D A;  2TPR A;  2XLP A;  4EIP A;  4NTE A;  3BI4 A;  1BWC A;  2RAB A;  4I58 A;  4ZCC A;  2YQU A;  1XAN A;  3AE5 A;  4U8P A;  3C96 A;  1ZOY A;  4PAB A;  4J56 A;  1GTE A;  2YWL A;  4H4Q A;  1GND A;  4XWR A;  2C75 A;  1GRH A;  1IUV A;  1LQU A;  4H2Q A;  2FJA A;  4JN9 A;  1NAA A;  3UOV A;  3AEC A;  1QJD A;  4MJW A;  2R9Z A;  2C64 A;  1ZK7 A;  1EL9 A;  1XHC A;  3L8K A;  2GF3 A;  5U63 A;  4C3Y A;  3ITJ A;  4H2R A;  3AEA A;  1IUT A;  4U8K A;  5TR3 A;  4DGK A;  4WCT A;  3GMB A;  1CJ3 A;  3GMC A;  1KSU A;  2GR1 A;  4GDP A;  3FG2 P;  3AB1 A;  3FPZ A;  2XFU A;  2AQJ A;  4TM1 A;  2CFY A;  4H4T A;  1IUS A;  3NK1 X;  2XFO A;  4U8M A;  2C67 A;  2FJB A;  1KNR A;  1Q9I A;  1GT8 A;  1JRY A;  1OJD A;  1KFY A;  1Z6L A;  2C70 A;  2TMD A;  3FBS A;  3UTE A;  1D7L A;  2B7R A;  1W4X A;  2CDU A;  1B5Q A;  3CPH G;  3II4 A;  5J7X A;  1MOK A;  1FEC A;  3GWF A;  4FK1 C;  5DBJ A;  4Z25 A;  1Y56 B;  3F8P A;  3G5S A;  3BI5 A;  4DSG A;  1XPQ A;  4TLZ A;  1ZP0 A;  4KPR A;  5L46 A;  1UKV G;  4AP1 A;  4ZCD A;  2GQW A;  1CC6 A;  3E1T A;  2VQ7 A;  1NEK A;  1JU2 A;  1ELI A;  1YQZ A;  4CY6 A;  1YQ4 A;  4RG4 A;  4EM3 A;  4CCR A;  1PXA A;  2OAL A;  1NPX A;  2GMJ A;  4K7Z A;  1H7W A;  1NG3 A;  2XLU A;  2AAQ A;  1JRX A;  2C3D A;  4H4U A;  1PBD A;  4A9W A;  1Y0P A;  1EBD A;  2WPC A;  2ZZB A;  3SFD A;  5FS6 A;  1GRB A;  2GRT A;  2B9W A;  2C72 A;  5LV9 A;  2Q7V A;  1Q1W A;  1RSG A;  1EL7 A;  3AE9 A;  2ZZC A;  4K8D A;  2CVJ A;  1DOE A;  5HHF A;  4K5R A;  1P2E A;  1TYT A;  3CGD A;  1JEH A;  4XXG A;  1EL8 A;  1TDF A;  5GSN A;  1JRZ A;  5HYM A;  3PVC A;  4B69 A;  5C3J A;  3AEG A;  1BGJ A;  3I3L A;  4TM0 A;  2PHH A;  4OPT A;  3LJP A;  3L1R A;  4U2T A;  4EQR A;  1VRQ B;  1ZMD A;  1LPF A;  2JKC A;  3AE8 A;  3AE7 A;  1SEZ A;  2XLT A;  2BK5 A;  2YLS A;  3LZX A;  3NK2 X;  3CGB A;  2VRL A;  2X8H A;  5GRT A;  3RED A;  1GRF A;  2IVE A;  1N4U A;  4Y4L A;  1RYI A;  4DSH A;  2VVM A;  2BS2 A;  1TRB A;  2GB0 A;  4H4Y A;  3P4Q A;  2OLO A;  1MO9 A;  3B6D A;  4EMW A;  4J36 A;  1PXC A;  1N1P A;  4ADW A;  1FOH A;  4NTC A;  4EIQ A;  1YY5 A;  4A7A A;  4D04 A;  1GTH A;  4YKG A;  2WP9 A;  3LOV A;  2YVG A;  1B8S A;  1OJ9 A;  2VZ2 A;  3IC9 A;  3LB8 A;  3NRN A;  3ZDN A;  3NYC A;  4Z26 A;  4GRT A;  4CRT A;  3R9U A;  2V3B A;  3S5W A;  1D7Y A;  2JB2 A;  3CGC A;  1K0L A;  4A79 A;  3VRA A;  3P1W A;  3ABV A;  1LJ1 A;  1DJQ A;  3NTA A;  3NYE A;  3CNJ A;  5FS9 A;  1NHP A;  4YKF A;  2NPX A;  3DJG X;  1D4E A;  1CC4 A;  3EAO A;  5KXJ A;  1LQT A;  3ALL A;  3NNE A;  4YSZ A;  1K0I A;  3RP8 A;  2X8G A;  1M64 A;  4IVM B;  1CC2 A;  4ICY A;  3AEF A;  3VRD B;  3COX A;  4J33 A;  3DA1 A;  2B7S A;  2H89 A;  5FS8 A;  1GER A;  1FEB A;  3KPF A;  1DNC A;  3NHO X;  5JCK A;  4B1B A;  1E6E A;  1GRE A;  1PJ6 A;  4D03 A;  2WOW A;  5JCL A;  1S2Q A;  3LXD A;  3CNS A;  1PS9 A;  4IV9 A;  3PO7 A;  4JY3 A;  1F3P A;  2WEU A;  3CNP A;  3I6D A;  3P4S A;  4Z24 A;  3UTF A;  4YSH A;  1S2Y A;  1S3B A;  3Q6J A;  2GR3 A;  1TDO A;  4OPD A;  3UKH A;  4CNJ A;  1EL5 A;  2R4J A;  2Z5Y A;  3LZW A;  4X9N A;  3H4K A;  3GRT A;  4REK A;  5KRQ A;  4H4S A;  1H84 A;  3AYL A;  5HY5 A;  4U8I A;  1F6M A;  2QA1 A;  1GXF A;  4H4Z A;  3CND A;  1NHS A;  3KLJ A;  2JAE A;  1N4V A;  2Q0K A;  2C76 A;  1CF3 A;  1GAL A;  3DJE A;  2APG A;  2YAU A;  3NIX A;  4U8J A;  3H8I A;  2YM2 A;  1VG9 A;  2WDQ A;  1DJN A;  2DKI A;  3GDP A;  1E1K A;  1NG4 A;  4JNQ A;  1VDC A;  1CJC A;  4GCM A;  2JB3 A;  3BNU A;  4RSL A;  4J31 A;  2C3C A;  2YG3 A;  3QSM A;  4EMJ A;  1QLB A;  4N9X A;  1KSS A;  3UKP A;  4IA5 A;  1P2H A;  1FCD A;  5J60 A;  3P9U A;  3SQP A;  2RGO A;  2XFN A;  1F8R A;  2JB1 A;  3AE3 A;  4APN A;  3UKA A;  1JNR A;  2YVJ A;  1FEA A;  3ICS A;  4H4X A;  5EB4 A;  5KWF A;  5KOX A;  1RP0 A;  3UP4 A;  1VG0 A;  3PS9 A;  1L9C A;  3WE0 A;  3NYF A;  1BKW A;  3SM8 A;  1PBE A;  4BK1 A;  4H2P A;  3ATQ A;  1GPE A;  1L9D A;  3S61 A;  1PBB A;  3IHG A;  5EB5 A;  3QVR A;  3K7T A;  1V59 A;  4OPU A;  3GD4 A;  4RG3 A;  3C4A A;  4NEW A;  1NHQ A;  1N4W A;  2YG6 A;  4CY8 A;  2WPF A;  5KVH A;  1PHH A;  3UKL A;  1DOB A;  4YTN A;  2X50 A;  2YLW A;  4JY2 A;  4FK1 A;  3P4P A;  1L0V A;  4Z2R A;  3NN6 X;  3NLC A;  3EF6 A;  1LTX R;  1YKJ A;  2FJE A;  4K5S A;  3UCL A;  2O9Z A;  3ISH A;  4LU6 A;  3FMW A;  3DJJ A;  4B66 A;  2YLT A;  3D1C A;  3VRB A;  5M0Z A;  3BHK A;  4LA1 A;  2A89 A;  5BUL A;  5CKU A;  1BGN A;  1E1M A;  3ATR A;  3AYJ A;  3FIM B;  1NHR A;  4Z2U A;  2FJD A;  4OPG A;  3T37 A;  2YVF A;  1DXL A;  5KOW A;  2ARD A;  2XLR A;  1CJ2 A;  5FMH A;  3QJ4 A;  1ZMC A;  3QFA A;  1IUU A;  1H82 A;  2GV8 A;  2FBW A;  1GOS A;  2F5Z A;  4AT0 A;  4EQW A;  2WDV A;  2VRM A;  2BC0 A;  1B37 A;  1VQW A;  3VR8 A;  5JCN A;  4HB9 A;  2WQY A;  2XVH A;  4TLX A;  1KNP A;  2GH5 A;  1LV0 A;  1O95 A;  3NH3 X;  1O5W A;  4EM4 A;  3GDN A;  2IID A;  4B67 A;  4I59 A;  3NTD A;  3LAD A;  4GR1 A;  3HZL A;  2YG7 A;  1K4Q A;  4B68 A;  3H8L A;  2YG5 A;  2ACZ A;  1BF3 A;  1DOC A;  4J34 A;  4UDP A;  1S3E A;  3AEE A;  2XCG A;  1BZL A;  3CTY A;  2XFQ A;  3AYI A;  3KD9 A;  3M13 A;  3AE4 A;  4H4R A;  4H7U A;  4C3X A;  4EQX A;  1D4C A;  2YR6 A;  4BJZ A;  1IJH A;  2BK4 A;  3P4R A;  1FL2 A;  2EQ9 A;  3NN0 X;  4FDC B;  2JBV A;  4ECH A;  3IHM A;  1PDH A;  1PN0 A;  2WDR A;  2YR4 A;  1K0J A;  1CJ4 A;  3CIR A;  3GYJ A;  1F8W A;  3ICT A;  1REO A;  2QAE A;  1Y56 A;  2A8X A;  4M52 A;  3SGL A;  3VQR A;  2OLN A;  1NEN A;  2E1M A;  4AP3 A;  1E39 A;  5U25 A;  2YM1 A;  4H2N A;  2RGH A;  5JCM A;  4PAA A;  3UOZ A;  1ZY8 A;  2BAB A;  1PJ7 A;  2E5V A;  2X99 A;  1COY A;  5BRT A;  2WU5 A;  3KU9 A;  2XVJ A;  2AR8 A;  2BA9 A;  4J2W A;  2IVD A;  2V60 A;  4NTD A;  5IPY A;  4YSY A;  2V5Z A;  1E1L A;  1H6V A;  4OVI A;  3AD9 B;  1B4V A;  2VVL G;  3CN8 A;  4YWO A;  4HA6 A;  3SFE A;  3G5R A;  5C2T A;  4A6N B;  4X9M A;  1GES A;  4AOX A;  1JNZ A;  4BV6 A;  4LII A;  4U2S A;  3GRS A;  4IA6 A;  1TDN A;  3AED A;  1F8S A;  3B3R A;  3VR9 A;  4XWZ A;  2WS3 A;  2OAM A;  2CUL A;  3JSK A;  3ADA B;  3UTH A;  2WPE A;  2BYB A;  4CBQ A;  2EQ8 A;  3KA7 A;  1H7X A;  4K22 A;  3AD8 B;  4BJY A;  3EAN A;  4E0V A;  4Z43 A;  1E1N A;  2Y6R A;  1GV4 A;  3QSS A;  3BNM A;  3DH9 A;  4X4J A;  3O0H A;  3QSE A;  4OPI A;  3K7Q X;  1IUW A;  3K30 A;  1D5T A;  2X8C A;  3M0O A;  1GEU A;  2B76 A;  3UKF A;  4UDR A;  3AEB A;  2R0P A;  2WOI A;  1CHU A;  4B63 A;  1TYP A;  3V3N A;  3URH A;  4C74 A;  2WET A;  4H50 A;  1E7P A;  4BK3 A;  2WES A;  1TDE A;  1OJT A;  3CGE A;  1PBF A;  2VOU A;  5KVI A;  1CBO A;  2DKH A;  4YTP A;  2BK3 A;  2PYX A;  4IVO B;  3AXB A;  3ALM A;  4USR A;  4Y4N A;  2YLX A;  1X31 B;  5IQ1 A;  3DK9 A;  1L9E A;  4BUR A;  2R0G A;  2J3N A;  2A87 A;  2YG4 A;  1QO8 A;  2W0H A;  4U8N A;  3BI2 A;  2C7G A;  3ALJ A;  2R0C A;  2BCP A;  3KKJ A;  1PJ5 A;  5CQF A;  1GRT A;  4TM4 A;  2Q6U A;  3DJD A;  1IUX A;  2XFP A;  4U2L A;  1TDK A;  3NK0 X;  4FX9 A;  2UZZ A;  2Z5X A;  3AD7 B;  3Q9T A;  4GF7 A;  4A5L A;  3IWA A;  4Z44 A;  2H88 A;  2B9X A;  4H4V A;  5EBK A;  2JK6 A;  4BK2 A;  2GR0 A;  4Y4M A;  2Q0L A;  3D8X A;  4H4W A;  5JCI A;  3UKK A;  3DGH A;  2GEW A;  1CL0 A;  2VVL A;  3QFB A;  4JDR A;  1DOD A;  3DME A;  3RP6 A;  4AT2 A;  2GMH A;  2QCU A;  1ONF A;  4ZN0 A;  4U8O A;  2WHD A;  1XDI A;  2V3A A;  2XVE A;  2ZZ0 A;  2QA2 A;  2R4E A;  4UP3 A;  4AOS A;  5BUK A;  4JQ9 A;  3CPJ G;  3NGC X;  4GDE A;  3C4N A;  4B64 A;  3UOY A;  4EMI A;  2C65 A;  2NVK X;  2VQB A;  4YTM A;  5ER0 A;  2WU2 A;  3UTG A;  1GET A;  5M10 A;  1ZDL A;  4B65 A;  5HXI A;  2BXR A;  4H4P A;  3M12 A;  1ZOV A;  1GRA A;  1PBC A;  1ZX9 A;  3AE1 A;  3RHA A;  1ZKQ A;  2WP5 A;  2GAG B;  4JNA A;  2R46 A;  3RP7 A;  1PXB A;  4CCQ A;  3RNM A;  1H86 A;  2HQM A;  4A65 A;  4A99 A;  3UP5 A;  3EPT A;  1M6I A;  3AE6 A;  2V61 A;  2XDO A;  4J57 A;  3V3O A;  4YSX A;  3G5Q A;  3UKQ A;  1LVL A;  2BAC A;  3GSI A;  3CNT A;  4USQ A;  4EQS A;  2C66 A;  4OCG A;  5U1O A;  5EOW A;  2XLS A;  2X3N A;  2R45 A;  4K2X A;  3NG7 X;  1OJC A;  2YR5 A; 
#chains in the Genus database with same CATH topology
 3UOX A;  1KF6 A;  3F8R A;  2BXS A;  3DK8 A;  1GRG A;  2BC1 A;  2EQ6 A;  3DGZ A;  4NZH A;  4A6N A;  2C73 A;  3V76 A;  4OPL A;  2OA1 A;  3AWI A;  1YQ3 A;  3NKS A;  4NEV A;  2XYO A;  4DNA A;  4UDQ A;  1KDG A;  2XVI A;  4P9S A;  3ICR A;  1H83 A;  1OJA A;  5FS7 A;  4Z2T A;  3CPI G;  3KPK A;  1MXT A;  3ZYX A;  1O94 A;  4TM3 A;  2XVF A;  2WBA A;  3KVE A;  2RGJ A;  3GYI A;  4C5O A;  4OPC A;  2E4G A;  3QVP A;  2B9Y A;  4KX6 A;  1AOG A;  3IF9 A;  3NT6 A;  2ZBW A;  1NDA A;  1D4D A;  2EQ7 A;  3K7M X;  4O5U A;  1Q1R A;  2I0Z A;  1H81 A;  3DK4 A;  4YXD A;  4G6G A;  4GUV A;  2YLR A;  3GD3 A;  4WX1 A;  2WOV A;  2GVC A;  4C77 A;  2V6O A;  3GWD A;  5BVA A;  1JOA A;  2WP6 A;  3BHF A;  4YT0 A;  2BS3 A;  3OZ2 A;  4U8L A;  4CNK A;  4II2 A;  3OC4 A;  5IQ4 A;  4O5Q A;  5KMR A;  1GSN A;  2BS4 A;  2GAH B;  2Y6Q A;  2GR2 A;  3AE2 A;  1HYU A;  2GQF A;  2YLZ A;  2BCG G;  3F8D A;  2TPR A;  2XLP A;  4EIP A;  4NTE A;  3BI4 A;  1BWC A;  2RAB A;  4I58 A;  4ZCC A;  2YQU A;  1XAN A;  3AE5 A;  4U8P A;  3C96 A;  1ZOY A;  4PAB A;  4J56 A;  1GTE A;  2YWL A;  4H4Q A;  1GND A;  3SZ0 A;  4XWR A;  2C75 A;  1GRH A;  1IUV A;  1LQU A;  4H2Q A;  2FJA A;  4JN9 A;  1NAA A;  3UOV A;  3AEC A;  1QJD A;  4MJW A;  2R9Z A;  2C64 A;  1ZK7 A;  1EL9 A;  1XHC A;  3L8K A;  2GF3 A;  5U63 A;  4C3Y A;  3ITJ A;  4H2R A;  3AEA A;  1IUT A;  4U8K A;  5TR3 A;  4DGK A;  4WCT A;  3GMB A;  1CJ3 A;  3GMC A;  1KSU A;  2GR1 A;  4GDP A;  3FG2 P;  3AB1 A;  3FPZ A;  4II3 A;  2XFU A;  2AQJ A;  4TM1 A;  2CFY A;  4H4T A;  1IUS A;  3NK1 X;  2XFO A;  4U8M A;  2C67 A;  2FJB A;  1KNR A;  1Q9I A;  1GT8 A;  1JRY A;  1OJD A;  1KFY A;  1Z6L A;  2C70 A;  2TMD A;  3FBS A;  3UTE A;  1D7L A;  2B7R A;  1W4X A;  2CDU A;  1B5Q A;  3CPH G;  3II4 A;  5J7X A;  1MOK A;  1FEC A;  3GWF A;  4FK1 C;  5DBJ A;  4Z25 A;  1Y56 B;  3F8P A;  3G5S A;  3BI5 A;  4DSG A;  1XPQ A;  4TLZ A;  1ZP0 A;  4KPR A;  5L46 A;  1UKV G;  4AP1 A;  4ZCD A;  3T2Y A;  2GQW A;  1CC6 A;  3E1T A;  2VQ7 A;  3SYI A;  1NEK A;  1JU2 A;  1ELI A;  1YQZ A;  4CY6 A;  1YQ4 A;  4RG4 A;  4EM3 A;  4CCR A;  1PXA A;  2OAL A;  1NPX A;  2GMJ A;  4K7Z A;  1H7W A;  1NG3 A;  2XLU A;  2AAQ A;  1JRX A;  2C3D A;  4H4U A;  1PBD A;  3T31 A;  1Y0P A;  4A9W A;  1EBD A;  2WPC A;  2ZZB A;  3SFD A;  5FS6 A;  1GRB A;  2GRT A;  2B9W A;  2C72 A;  5LV9 A;  2Q7V A;  1Q1W A;  1RSG A;  1EL7 A;  3AE9 A;  2ZZC A;  4K8D A;  2CVJ A;  1DOE A;  5HHF A;  4K5R A;  1P2E A;  1TYT A;  3CGD A;  1JEH A;  4XXG A;  1EL8 A;  1TDF A;  5GSN A;  1JRZ A;  5HYM A;  3PVC A;  4B69 A;  5C3J A;  3AEG A;  1BGJ A;  3I3L A;  4TM0 A;  2PHH A;  4OPT A;  3SY4 A;  3LJP A;  3L1R A;  4U2T A;  4EQR A;  1VRQ B;  1ZMD A;  1LPF A;  2JKC A;  3AE8 A;  3AE7 A;  1SEZ A;  2XLT A;  2BK5 A;  2YLS A;  3LZX A;  3NK2 X;  3CGB A;  2VRL A;  2X8H A;  5GRT A;  3RED A;  1GRF A;  2IVE A;  1N4U A;  4Y4L A;  1RYI A;  4DSH A;  2VVM A;  2BS2 A;  1TRB A;  2GB0 A;  4H4Y A;  3P4Q A;  2OLO A;  3SXI A;  1MO9 A;  3B6D A;  4EMW A;  4J36 A;  1PXC A;  3HYV A;  1N1P A;  4ADW A;  1FOH A;  4NTC A;  4EIQ A;  1YY5 A;  4A7A A;  4D04 A;  1GTH A;  4YKG A;  2WP9 A;  3LOV A;  2YVG A;  1B8S A;  1OJ9 A;  2VZ2 A;  3IC9 A;  3LB8 A;  3NRN A;  3ZDN A;  3NYC A;  4Z26 A;  4GRT A;  4CRT A;  3R9U A;  2V3B A;  3S5W A;  1D7Y A;  2JB2 A;  3CGC A;  1K0L A;  4A79 A;  3VRA A;  3P1W A;  3ABV A;  1LJ1 A;  1DJQ A;  3NTA A;  3NYE A;  3CNJ A;  5FS9 A;  1NHP A;  4YKF A;  2NPX A;  3DJG X;  1D4E A;  1CC4 A;  3EAO A;  5KXJ A;  1LQT A;  3ALL A;  3NNE A;  4YSZ A;  1K0I A;  3RP8 A;  2X8G A;  1M64 A;  4G6H A;  4IVM B;  1CC2 A;  4ICY A;  3AEF A;  2BRY A;  3VRD B;  3COX A;  4J33 A;  3SZW A;  3DA1 A;  3CMM A;  2B7S A;  2H89 A;  5FS8 A;  1GER A;  1FEB A;  3KPF A;  1DNC A;  3NHO X;  5JCK A;  4B1B A;  1E6E A;  1GRE A;  1PJ6 A;  4D03 A;  2WOW A;  5JCL A;  1S2Q A;  3LXD A;  3CNS A;  1PS9 A;  4IV9 A;  3PO7 A;  4JY3 A;  1F3P A;  2WEU A;  3CNP A;  3I6D A;  3P4S A;  4Z24 A;  3UTF A;  4YSH A;  1S2Y A;  1S3B A;  3Q6J A;  2GR3 A;  1TDO A;  4OPD A;  3UKH A;  4CNJ A;  1EL5 A;  2R4J A;  2Z5Y A;  3LZW A;  4X9N A;  3H4K A;  3GRT A;  4REK A;  5KRQ A;  4H4S A;  1H84 A;  3AYL A;  5HY5 A;  4U8I A;  1F6M A;  2QA1 A;  1GXF A;  4H4Z A;  3CND A;  1NHS A;  3KLJ A;  2JAE A;  1N4V A;  2Q0K A;  2C76 A;  1CF3 A;  1GAL A;  3DJE A;  2APG A;  2YAU A;  3NIX A;  4U8J A;  3HYW A;  3H8I A;  2YM2 A;  1VG9 A;  2WDQ A;  1DJN A;  2DKI A;  3GDP A;  1E1K A;  1NG4 A;  4JNQ A;  1VDC A;  4GAV A;  1CJC A;  4GCM A;  2JB3 A;  3BNU A;  4RSL A;  4J31 A;  2C3C A;  2YG3 A;  3QSM A;  4EMJ A;  1QLB A;  4N9X A;  1KSS A;  3UKP A;  4IA5 A;  1P2H A;  1FCD A;  4G73 A;  5J60 A;  3P9U A;  3SQP A;  2RGO A;  2XFN A;  1F8R A;  2JB1 A;  3AE3 A;  4APN A;  3UKA A;  1JNR A;  2YVJ A;  1FEA A;  3ICS A;  4H4X A;  5EB4 A;  5KWF A;  5KOX A;  1RP0 A;  3UP4 A;  1VG0 A;  3PS9 A;  1L9C A;  3WE0 A;  3NYF A;  1BKW A;  3SM8 A;  1PBE A;  4BK1 A;  4H2P A;  3ATQ A;  3SX6 A;  1GPE A;  1L9D A;  3S61 A;  1PBB A;  3IHG A;  5EB5 A;  3QVR A;  3K7T A;  1V59 A;  4OPU A;  3GD4 A;  4RG3 A;  3C4A A;  4NEW A;  1NHQ A;  1N4W A;  2YG6 A;  4CY8 A;  2WPF A;  5KVH A;  1PHH A;  3UKL A;  1DOB A;  4YTN A;  4NWZ A;  2X50 A;  3GYX A;  2YLW A;  4JY2 A;  4FK1 A;  5KMP A;  5KMS A;  3P4P A;  1L0V A;  4Z2R A;  3NN6 X;  3NLC A;  3EF6 A;  1LTX R;  1YKJ A;  2FJE A;  4K5S A;  3UCL A;  2O9Z A;  3ISH A;  4LU6 A;  3FMW A;  3T2K A;  3DJJ A;  4B66 A;  2YLT A;  5KNL A;  3D1C A;  3VRB A;  5M0Z A;  3BHK A;  4LA1 A;  2A89 A;  5BUL A;  5CKU A;  1BGN A;  1E1M A;  3ATR A;  3AYJ A;  3FIM B;  1NHR A;  4Z2U A;  2FJD A;  4OPG A;  3T37 A;  2YVF A;  1DXL A;  5KOW A;  2ARD A;  2XLR A;  1CJ2 A;  5FMH A;  3QJ4 A;  1ZMC A;  3QFA A;  1IUU A;  1H82 A;  2GV8 A;  2FBW A;  1GOS A;  2F5Z A;  4AT0 A;  4EQW A;  2WDV A;  2VRM A;  2BC0 A;  1B37 A;  1VQW A;  3VR8 A;  5JCN A;  4HB9 A;  2WQY A;  2XVH A;  4TLX A;  1KNP A;  2GH5 A;  1LV0 A;  1O95 A;  3NH3 X;  1O5W A;  4EM4 A;  3GDN A;  2IID A;  4B67 A;  4I59 A;  3NTD A;  3LAD A;  4GR1 A;  3HZL A;  2YG7 A;  1K4Q A;  4B68 A;  3H8L A;  2YG5 A;  2ACZ A;  1BF3 A;  1DOC A;  4J34 A;  4UDP A;  1S3E A;  3AEE A;  2XCG A;  1BZL A;  3CTY A;  2XFQ A;  3AYI A;  3KD9 A;  3M13 A;  3AE4 A;  4H4R A;  4H7U A;  4C3X A;  4EQX A;  1D4C A;  2YR6 A;  4BJZ A;  1IJH A;  2BK4 A;  3P4R A;  1FL2 A;  2EQ9 A;  3NN0 X;  4GAP A;  4FDC B;  2JBV A;  4ECH A;  3IHM A;  1PDH A;  1PN0 A;  2WDR A;  2YR4 A;  1K0J A;  1CJ4 A;  3CIR A;  3GYJ A;  1F8W A;  3ICT A;  1REO A;  2QAE A;  1Y56 A;  2A8X A;  4M52 A;  4G9K A;  3SGL A;  3VQR A;  2OLN A;  1NEN A;  2E1M A;  4AP3 A;  1E39 A;  5U25 A;  2YM1 A;  4H2N A;  2RGH A;  5JCM A;  4PAA A;  3UOZ A;  3SZF A;  1ZY8 A;  2BAB A;  1PJ7 A;  2E5V A;  2X99 A;  1COY A;  5BRT A;  2WU5 A;  3KU9 A;  2XVJ A;  2AR8 A;  2BA9 A;  4J2W A;  2IVD A;  2V60 A;  4NTD A;  5IPY A;  4YSY A;  2V5Z A;  1E1L A;  1H6V A;  4OVI A;  3AD9 B;  1B4V A;  2VVL G;  3CN8 A;  4YWO A;  4HA6 A;  3SFE A;  3G5R A;  3T2Z A;  5C2T A;  4A6N B;  4X9M A;  1GES A;  4AOX A;  1JNZ A;  4BV6 A;  4LII A;  4U2S A;  3GRS A;  4IA6 A;  1TDN A;  3AED A;  1F8S A;  3B3R A;  3VR9 A;  4XWZ A;  2WS3 A;  2OAM A;  2CUL A;  3JSK A;  3ADA B;  3UTH A;  2WPE A;  2BYB A;  3T14 A;  4CBQ A;  2EQ8 A;  3KA7 A;  1H7X A;  4K22 A;  3AD8 B;  4BJY A;  3EAN A;  4E0V A;  4Z43 A;  1E1N A;  2Y6R A;  1GV4 A;  3QSS A;  3BNM A;  3DH9 A;  4X4J A;  3O0H A;  3QSE A;  4OPI A;  3K7Q X;  1IUW A;  3K30 A;  1D5T A;  2X8C A;  3M0O A;  1GEU A;  2B76 A;  3UKF A;  4UDR A;  3AEB A;  2R0P A;  2WOI A;  1CHU A;  2BRA A;  4B63 A;  1TYP A;  3V3N A;  3URH A;  4C74 A;  2WET A;  4H50 A;  1E7P A;  4BK3 A;  4NNJ A;  2WES A;  1TDE A;  1OJT A;  3CGE A;  1PBF A;  2VOU A;  5KVI A;  1CBO A;  2DKH A;  4YTP A;  2BK3 A;  2PYX A;  4IVO B;  3AXB A;  3ALM A;  4USR A;  4Y4N A;  2YLX A;  1X31 B;  5IQ1 A;  3DK9 A;  1L9E A;  4BUR A;  2R0G A;  3T0K A;  2J3N A;  2A87 A;  2YG4 A;  1QO8 A;  2W0H A;  3HYX A;  4U8N A;  3BI2 A;  2C7G A;  3ALJ A;  2R0C A;  2BCP A;  3KKJ A;  1PJ5 A;  5CQF A;  1GRT A;  4TM4 A;  2Q6U A;  3DJD A;  1IUX A;  2XFP A;  4U2L A;  1TDK A;  3NK0 X;  4FX9 A;  2UZZ A;  2Z5X A;  3AD7 B;  3Q9T A;  4GF7 A;  4A5L A;  3IWA A;  4Z44 A;  2H88 A;  2B9X A;  4H4V A;  5EBK A;  2JK6 A;  4BK2 A;  2GR0 A;  4Y4M A;  2Q0L A;  3D8X A;  4H4W A;  5JCI A;  3UKK A;  3DGH A;  2GEW A;  1CL0 A;  2VVL A;  3QFB A;  4JDR A;  1DOD A;  3DME A;  3RP6 A;  4AT2 A;  2GMH A;  2QCU A;  1ONF A;  3SZC A;  4ZN0 A;  4U8O A;  2WHD A;  1XDI A;  2V3A A;  2XVE A;  2ZZ0 A;  2QA2 A;  2R4E A;  4UP3 A;  4AOS A;  5BUK A;  4JQ9 A;  5KMQ A;  3CPJ G;  3NGC X;  4GDE A;  3C4N A;  4B64 A;  3UOY A;  4EMI A;  2C65 A;  2NVK X;  2VQB A;  4YTM A;  5ER0 A;  2WU2 A;  3UTG A;  1GET A;  2C4C A;  5M10 A;  1ZDL A;  4B65 A;  5HXI A;  2BXR A;  4H4P A;  3M12 A;  1ZOV A;  1GRA A;  1PBC A;  1ZX9 A;  3AE1 A;  3RHA A;  1ZKQ A;  2WP5 A;  2GAG B;  4JNA A;  2R46 A;  3RP7 A;  1PXB A;  4CCQ A;  3RNM A;  1H86 A;  2HQM A;  4A65 A;  4A99 A;  3UP5 A;  3EPT A;  1M6I A;  3AE6 A;  2V61 A;  2XDO A;  4J57 A;  3V3O A;  4YSX A;  3G5Q A;  3UKQ A;  1LVL A;  2BAC A;  3GSI A;  3CNT A;  4USQ A;  4EQS A;  2C66 A;  4OCG A;  5U1O A;  4G74 A;  5EOW A;  2XLS A;  2X3N A;  2R45 A;  4K2X A;  3NG7 X;  1OJC A;  2YR5 A; 
#chains in the Genus database with same CATH homology
 3UOX A;  1KF6 A;  3F8R A;  2BXS A;  3DK8 A;  1GRG A;  2BC1 A;  2EQ6 A;  3DGZ A;  4NZH A;  4A6N A;  2C73 A;  3V76 A;  4OPL A;  2OA1 A;  3AWI A;  1YQ3 A;  3NKS A;  4NEV A;  2XYO A;  4DNA A;  4UDQ A;  1KDG A;  2XVI A;  4P9S A;  3ICR A;  1H83 A;  1OJA A;  5FS7 A;  4Z2T A;  3CPI G;  3KPK A;  1MXT A;  3ZYX A;  1O94 A;  4TM3 A;  2XVF A;  2WBA A;  3KVE A;  2RGJ A;  3GYI A;  4C5O A;  4OPC A;  2E4G A;  3QVP A;  2B9Y A;  4KX6 A;  1AOG A;  3IF9 A;  3NT6 A;  2ZBW A;  1NDA A;  1D4D A;  2EQ7 A;  3K7M X;  4O5U A;  1Q1R A;  2I0Z A;  1H81 A;  3DK4 A;  4YXD A;  4G6G A;  4GUV A;  2YLR A;  3GD3 A;  4WX1 A;  2WOV A;  2GVC A;  4C77 A;  2V6O A;  3GWD A;  5BVA A;  1JOA A;  2WP6 A;  3BHF A;  4YT0 A;  2BS3 A;  3OZ2 A;  4U8L A;  4CNK A;  4II2 A;  3OC4 A;  5IQ4 A;  4O5Q A;  5KMR A;  1GSN A;  2BS4 A;  2GAH B;  2Y6Q A;  2GR2 A;  3AE2 A;  1HYU A;  2GQF A;  2YLZ A;  2BCG G;  3F8D A;  2TPR A;  2XLP A;  4EIP A;  4NTE A;  3BI4 A;  1BWC A;  2RAB A;  4I58 A;  4ZCC A;  2YQU A;  1XAN A;  3AE5 A;  4U8P A;  3C96 A;  1ZOY A;  4PAB A;  4J56 A;  1GTE A;  2YWL A;  4H4Q A;  1GND A;  3SZ0 A;  4XWR A;  2C75 A;  1GRH A;  1IUV A;  1LQU A;  4H2Q A;  2FJA A;  4JN9 A;  1NAA A;  3UOV A;  3AEC A;  1QJD A;  4MJW A;  2R9Z A;  2C64 A;  1ZK7 A;  1EL9 A;  1XHC A;  3L8K A;  2GF3 A;  5U63 A;  4C3Y A;  3ITJ A;  4H2R A;  3AEA A;  1IUT A;  4U8K A;  5TR3 A;  4DGK A;  4WCT A;  3GMB A;  1CJ3 A;  3GMC A;  1KSU A;  2GR1 A;  4GDP A;  3FG2 P;  3AB1 A;  3FPZ A;  4II3 A;  2XFU A;  2AQJ A;  4TM1 A;  2CFY A;  4H4T A;  1IUS A;  3NK1 X;  2XFO A;  4U8M A;  2C67 A;  2FJB A;  1KNR A;  1Q9I A;  1GT8 A;  1JRY A;  1OJD A;  1KFY A;  1Z6L A;  2C70 A;  2TMD A;  3FBS A;  3UTE A;  1D7L A;  2B7R A;  1W4X A;  2CDU A;  1B5Q A;  3CPH G;  3II4 A;  5J7X A;  1MOK A;  1FEC A;  3GWF A;  4FK1 C;  5DBJ A;  4Z25 A;  1Y56 B;  3F8P A;  3G5S A;  3BI5 A;  4DSG A;  1XPQ A;  4TLZ A;  1ZP0 A;  4KPR A;  5L46 A;  1UKV G;  4AP1 A;  4ZCD A;  3T2Y A;  2GQW A;  1CC6 A;  3E1T A;  2VQ7 A;  3SYI A;  1NEK A;  1JU2 A;  1ELI A;  1YQZ A;  4CY6 A;  1YQ4 A;  4RG4 A;  4EM3 A;  4CCR A;  1PXA A;  2OAL A;  1NPX A;  2GMJ A;  4K7Z A;  1H7W A;  1NG3 A;  2XLU A;  2AAQ A;  1JRX A;  2C3D A;  4H4U A;  1PBD A;  3T31 A;  1Y0P A;  4A9W A;  1EBD A;  2WPC A;  2ZZB A;  3SFD A;  5FS6 A;  1GRB A;  2GRT A;  2B9W A;  2C72 A;  5LV9 A;  2Q7V A;  1Q1W A;  1RSG A;  1EL7 A;  3AE9 A;  2ZZC A;  4K8D A;  2CVJ A;  1DOE A;  5HHF A;  4K5R A;  1P2E A;  1TYT A;  3CGD A;  1JEH A;  4XXG A;  1EL8 A;  1TDF A;  5GSN A;  1JRZ A;  5HYM A;  3PVC A;  4B69 A;  5C3J A;  3AEG A;  1BGJ A;  3I3L A;  4TM0 A;  2PHH A;  4OPT A;  3SY4 A;  3LJP A;  3L1R A;  4U2T A;  4EQR A;  1VRQ B;  1ZMD A;  1LPF A;  2JKC A;  3AE8 A;  3AE7 A;  1SEZ A;  2XLT A;  2BK5 A;  2YLS A;  3LZX A;  3NK2 X;  3CGB A;  2VRL A;  2X8H A;  5GRT A;  3RED A;  1GRF A;  2IVE A;  1N4U A;  4Y4L A;  1RYI A;  4DSH A;  2VVM A;  2BS2 A;  1TRB A;  2GB0 A;  4H4Y A;  3P4Q A;  2OLO A;  3SXI A;  1MO9 A;  3B6D A;  4EMW A;  4J36 A;  1PXC A;  3HYV A;  1N1P A;  4ADW A;  1FOH A;  4NTC A;  4EIQ A;  1YY5 A;  4A7A A;  4D04 A;  1GTH A;  4YKG A;  2WP9 A;  3LOV A;  2YVG A;  1B8S A;  1OJ9 A;  2VZ2 A;  3IC9 A;  3LB8 A;  3NRN A;  3ZDN A;  3NYC A;  4Z26 A;  4GRT A;  4CRT A;  3R9U A;  2V3B A;  3S5W A;  1D7Y A;  2JB2 A;  3CGC A;  1K0L A;  4A79 A;  3VRA A;  3P1W A;  3ABV A;  1LJ1 A;  1DJQ A;  3NTA A;  3NYE A;  3CNJ A;  5FS9 A;  1NHP A;  4YKF A;  2NPX A;  3DJG X;  1D4E A;  1CC4 A;  3EAO A;  5KXJ A;  1LQT A;  3ALL A;  3NNE A;  4YSZ A;  1K0I A;  3RP8 A;  2X8G A;  1M64 A;  4G6H A;  4IVM B;  1CC2 A;  4ICY A;  3AEF A;  2BRY A;  3VRD B;  3COX A;  4J33 A;  3SZW A;  3DA1 A;  3CMM A;  2B7S A;  2H89 A;  5FS8 A;  1GER A;  1FEB A;  3KPF A;  1DNC A;  3NHO X;  5JCK A;  4B1B A;  1E6E A;  1GRE A;  1PJ6 A;  4D03 A;  2WOW A;  5JCL A;  1S2Q A;  3LXD A;  3CNS A;  1PS9 A;  4IV9 A;  3PO7 A;  4JY3 A;  1F3P A;  2WEU A;  3CNP A;  3I6D A;  3P4S A;  4Z24 A;  3UTF A;  4YSH A;  1S2Y A;  1S3B A;  3Q6J A;  2GR3 A;  1TDO A;  4OPD A;  3UKH A;  4CNJ A;  1EL5 A;  2R4J A;  2Z5Y A;  3LZW A;  4X9N A;  3H4K A;  3GRT A;  4REK A;  5KRQ A;  4H4S A;  1H84 A;  3AYL A;  5HY5 A;  4U8I A;  1F6M A;  2QA1 A;  1GXF A;  4H4Z A;  3CND A;  1NHS A;  3KLJ A;  2JAE A;  1N4V A;  2Q0K A;  2C76 A;  1CF3 A;  1GAL A;  3DJE A;  2APG A;  2YAU A;  3NIX A;  4U8J A;  3HYW A;  3H8I A;  2YM2 A;  1VG9 A;  2WDQ A;  1DJN A;  2DKI A;  3GDP A;  1E1K A;  1NG4 A;  4JNQ A;  1VDC A;  4GAV A;  1CJC A;  4GCM A;  2JB3 A;  3BNU A;  4RSL A;  4J31 A;  2C3C A;  2YG3 A;  3QSM A;  4EMJ A;  1QLB A;  4N9X A;  1KSS A;  3UKP A;  4IA5 A;  1P2H A;  1FCD A;  4G73 A;  5J60 A;  3P9U A;  3SQP A;  2RGO A;  2XFN A;  1F8R A;  2JB1 A;  3AE3 A;  4APN A;  3UKA A;  1JNR A;  2YVJ A;  1FEA A;  3ICS A;  4H4X A;  5EB4 A;  5KWF A;  5KOX A;  1RP0 A;  3UP4 A;  1VG0 A;  3PS9 A;  1L9C A;  3WE0 A;  3NYF A;  1BKW A;  3SM8 A;  1PBE A;  4BK1 A;  4H2P A;  3ATQ A;  3SX6 A;  1GPE A;  1L9D A;  3S61 A;  1PBB A;  3IHG A;  5EB5 A;  3QVR A;  3K7T A;  1V59 A;  4OPU A;  3GD4 A;  4RG3 A;  3C4A A;  4NEW A;  1NHQ A;  1N4W A;  2YG6 A;  4CY8 A;  2WPF A;  5KVH A;  1PHH A;  3UKL A;  1DOB A;  4YTN A;  4NWZ A;  2X50 A;  3GYX A;  2YLW A;  4JY2 A;  4FK1 A;  5KMP A;  5KMS A;  3P4P A;  1L0V A;  4Z2R A;  3NN6 X;  3NLC A;  3EF6 A;  1LTX R;  1YKJ A;  2FJE A;  4K5S A;  3UCL A;  2O9Z A;  3ISH A;  4LU6 A;  3FMW A;  3T2K A;  3DJJ A;  4B66 A;  2YLT A;  5KNL A;  3D1C A;  3VRB A;  5M0Z A;  3BHK A;  4LA1 A;  2A89 A;  5BUL A;  5CKU A;  1BGN A;  1E1M A;  3ATR A;  3AYJ A;  3FIM B;  1NHR A;  4Z2U A;  2FJD A;  4OPG A;  3T37 A;  2YVF A;  1DXL A;  5KOW A;  2ARD A;  2XLR A;  1CJ2 A;  5FMH A;  3QJ4 A;  1ZMC A;  3QFA A;  1IUU A;  1H82 A;  2GV8 A;  2FBW A;  1GOS A;  2F5Z A;  4AT0 A;  4EQW A;  2WDV A;  2VRM A;  2BC0 A;  1B37 A;  1VQW A;  3VR8 A;  5JCN A;  4HB9 A;  2WQY A;  2XVH A;  4TLX A;  1KNP A;  2GH5 A;  1LV0 A;  1O95 A;  3NH3 X;  1O5W A;  4EM4 A;  3GDN A;  2IID A;  4B67 A;  4I59 A;  3NTD A;  3LAD A;  4GR1 A;  3HZL A;  2YG7 A;  1K4Q A;  4B68 A;  3H8L A;  2YG5 A;  2ACZ A;  1BF3 A;  1DOC A;  4J34 A;  4UDP A;  1S3E A;  3AEE A;  2XCG A;  1BZL A;  3CTY A;  2XFQ A;  3AYI A;  3KD9 A;  3M13 A;  3AE4 A;  4H4R A;  4H7U A;  4C3X A;  4EQX A;  1D4C A;  2YR6 A;  4BJZ A;  1IJH A;  2BK4 A;  3P4R A;  1FL2 A;  2EQ9 A;  3NN0 X;  4GAP A;  4FDC B;  2JBV A;  4ECH A;  3IHM A;  1PDH A;  1PN0 A;  2WDR A;  2YR4 A;  1K0J A;  1CJ4 A;  3CIR A;  3GYJ A;  1F8W A;  3ICT A;  1REO A;  2QAE A;  1Y56 A;  2A8X A;  4M52 A;  4G9K A;  3SGL A;  3VQR A;  2OLN A;  1NEN A;  2E1M A;  4AP3 A;  1E39 A;  5U25 A;  2YM1 A;  4H2N A;  2RGH A;  5JCM A;  4PAA A;  3UOZ A;  3SZF A;  1ZY8 A;  2BAB A;  1PJ7 A;  2E5V A;  2X99 A;  1COY A;  5BRT A;  2WU5 A;  3KU9 A;  2XVJ A;  2AR8 A;  2BA9 A;  4J2W A;  2IVD A;  2V60 A;  4NTD A;  5IPY A;  4YSY A;  2V5Z A;  1E1L A;  1H6V A;  4OVI A;  3AD9 B;  1B4V A;  2VVL G;  3CN8 A;  4YWO A;  4HA6 A;  3SFE A;  3G5R A;  3T2Z A;  5C2T A;  4A6N B;  4X9M A;  1GES A;  4AOX A;  1JNZ A;  4BV6 A;  4LII A;  4U2S A;  3GRS A;  4IA6 A;  1TDN A;  3AED A;  1F8S A;  3B3R A;  3VR9 A;  4XWZ A;  2WS3 A;  2OAM A;  2CUL A;  3JSK A;  3ADA B;  3UTH A;  2WPE A;  2BYB A;  3T14 A;  4CBQ A;  2EQ8 A;  3KA7 A;  1H7X A;  4K22 A;  3AD8 B;  4BJY A;  3EAN A;  4E0V A;  4Z43 A;  1E1N A;  2Y6R A;  1GV4 A;  3QSS A;  3BNM A;  3DH9 A;  4X4J A;  3O0H A;  3QSE A;  4OPI A;  3K7Q X;  1IUW A;  3K30 A;  1D5T A;  2X8C A;  3M0O A;  1GEU A;  2B76 A;  3UKF A;  4UDR A;  3AEB A;  2R0P A;  2WOI A;  1CHU A;  2BRA A;  4B63 A;  1TYP A;  3V3N A;  3URH A;  4C74 A;  2WET A;  4H50 A;  1E7P A;  4BK3 A;  4NNJ A;  2WES A;  1TDE A;  1OJT A;  3CGE A;  1PBF A;  2VOU A;  5KVI A;  1CBO A;  2DKH A;  4YTP A;  2BK3 A;  2PYX A;  4IVO B;  3AXB A;  3ALM A;  4USR A;  4Y4N A;  2YLX A;  1X31 B;  5IQ1 A;  3DK9 A;  1L9E A;  4BUR A;  2R0G A;  3T0K A;  2J3N A;  2A87 A;  2YG4 A;  1QO8 A;  2W0H A;  3HYX A;  4U8N A;  3BI2 A;  2C7G A;  3ALJ A;  2R0C A;  2BCP A;  3KKJ A;  1PJ5 A;  5CQF A;  1GRT A;  4TM4 A;  2Q6U A;  3DJD A;  1IUX A;  2XFP A;  4U2L A;  1TDK A;  3NK0 X;  4FX9 A;  2UZZ A;  2Z5X A;  3AD7 B;  3Q9T A;  4GF7 A;  4A5L A;  3IWA A;  4Z44 A;  2H88 A;  2B9X A;  4H4V A;  5EBK A;  2JK6 A;  4BK2 A;  2GR0 A;  4Y4M A;  2Q0L A;  3D8X A;  4H4W A;  5JCI A;  3UKK A;  3DGH A;  2GEW A;  1CL0 A;  2VVL A;  3QFB A;  4JDR A;  1DOD A;  3DME A;  3RP6 A;  4AT2 A;  2GMH A;  2QCU A;  1ONF A;  3SZC A;  4ZN0 A;  4U8O A;  2WHD A;  1XDI A;  2V3A A;  2XVE A;  2ZZ0 A;  2QA2 A;  2R4E A;  4UP3 A;  4AOS A;  5BUK A;  4JQ9 A;  5KMQ A;  3CPJ G;  3NGC X;  4GDE A;  3C4N A;  4B64 A;  3UOY A;  4EMI A;  2C65 A;  2NVK X;  2VQB A;  4YTM A;  5ER0 A;  2WU2 A;  3UTG A;  1GET A;  2C4C A;  5M10 A;  1ZDL A;  4B65 A;  5HXI A;  2BXR A;  4H4P A;  3M12 A;  1ZOV A;  1GRA A;  1PBC A;  1ZX9 A;  3AE1 A;  3RHA A;  1ZKQ A;  2WP5 A;  2GAG B;  4JNA A;  2R46 A;  3RP7 A;  1PXB A;  4CCQ A;  3RNM A;  1H86 A;  2HQM A;  4A65 A;  4A99 A;  3UP5 A;  3EPT A;  1M6I A;  3AE6 A;  2V61 A;  2XDO A;  4J57 A;  3V3O A;  4YSX A;  3G5Q A;  3UKQ A;  1LVL A;  2BAC A;  3GSI A;  3CNT A;  4USQ A;  4EQS A;  2C66 A;  4OCG A;  5U1O A;  4G74 A;  5EOW A;  2XLS A;  2X3N A;  2R45 A;  4K2X A;  3NG7 X;  1OJC A;  2YR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...