2CVJA

Crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
MWDVIVVGGGPSGLSAALFLARAGLKVLVLDGGRSKVKGVSRVPNYPGLLDEPSGEELLRRLEAHARRYGAEVRPGVVKGVRDMGGVFEVETEEGVEKAERLLLCTHKDPTLPSLLGLTRRGAYIDTDEGGRTSYPRVYAAGVARGKVPGHAIISAGDGAYVAVHLVSDLRGEPYKDHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of thioredoxin reductase-related protein TTHA0370 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords thioredoxin reductase related protein
total genus 56
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2cvjA01
1JU2A 1TDNA 2GB0A 4EM3A 1LPFA 3QSSA 2Q0KA 2TPRA 2YLZA 1JRXA 2CVJA 3P4QA 3M13A 2GQFA 4JNQA 2R46A 3UTEA 1D4CA 3SGLA 3KA7A 3VR9A 2OA1A 2Y6QA 4UDQA 1E1NA 2XDOA 4Z26A 5HY5A 3CNJA 1TDOA 4XXGA 4DNAA 2EQ7A 2BABA 4IVOB 2YG4A 2B7RA 4ICYA 3D1CA 2X8CA 4CY6A 1IUWA 5EOWA 1CJCA 2GMJA 5HHFA 2YLRA 2OLOA 3PO7A 2QA1A 1DJNA 1IUSA 3GD3A 3UTGA 3UTHA 1OJ9A 5HYMA 2XFNA 4K5RA 3ADAB 2VRMA 2DKIA 3ABVA 2WQYA 3AXBA 1YQ4A 2Q7VA 1GRGA 4D03A 4Y4NA 4KPRA 1V59A 2GV8A 1GRTA 2Q0LA 3ALJA 4XWZA 3PVCA 4EIPA 4WX1A 2C70A 4BV6A 1VQWA 2YR4A 4OPLA 1E7PA 4AT2A 3V76A 1JRYA 2GVCA 3KU9A 2WOVA 3GRTA 1GRFA 2YR5A 4GDEA 4PAAA 3RNMA 1PXCA 1O5WA 1GT8A 4H2QA 5TR3A 3GDPA 2XVJA 1GSNA 2C65A 1E1MA 2EQ6A 4IV9A 1JOAA 3UOYA 1GTEA 3HZLA 3SFEA 1VDCA 3E1TA 2YLSA 4TLXA 2GAHB 2IIDA 2YVJA 4EMJA 3BHFA 2A89A 3NT6A 1S3EA 4Z25A 2WDRA 4OPTA 4A9WA 1JRZA 2ARDA 3LJPA 4H4RA 2WOIA 1P2HA 4I58A 5CQFA 3UKAA 3FMWA 2F5ZA 3UTFA 1H83A 2NVKX 4ECHA 5JCLA 3LOVA 1EL7A 1O94A 2X8GA 3CTYA 3DH9A 4ADWA 4CNKA 1TRBA 4CBQA 2V61A 3KKJA 3RP7A 4JQ9A 1KSUA 3CGCA 4C5OA 3DJJA 5BUKA 1FOHA 5C3JA 4YSHA 1ZX9A 2GEWA 4EMIA 2QCUA 1L9CA 1JNZA 3BI5A 1REOA 4C3YA 2WPCA 3CNDA 3M0OA 2X99A 2FBWA 1IUUA 3NK1X 1W4XA 2WS3A 3AE5A 5M0ZA 2R0GA 1H7WA 4JNAA 4TLZA 2VZ2A 1EL5A 3WE0A 5HXIA 4H4XA 1KSSA 4USQA 2Y6RA 1NHPA 3AB1A 3R9UA 3NYEA 3QJ4A 2EQ9A 2BXRA 1CJ4A 4YTPA 2WDQA 3P4SA 3NNEA 1BF3A 1NHSA 1L9EA 4OPIA 4BJZA 2AQJA 2QA2A 1D4EA 1JEHA 2A87A 3AE6A 4O5UA 4OVIA 1ZOVA 4A6NA 4H4YA 3UOXA 1FECA 1DJQA 1ZY8A 1LJ1A 3AEFA 1ZMCA 3Q6JA 1DNCA 4U8LA 2V5ZA 3M12A 1IJHA 2GH5A 3K7MX 5J60A 2BC1A 4RG4A 3CPHG 3IC9A 3DMEA 1VRQB 3FIMB 3II4A 2V3AA 3V3OA 5FS9A 1JNRA 1N4UA 3UKLA 5BRTA 4DGKA 3AE7A 4GRTA 1DOBA 3QVPA 2YG5A 2BS3A 1CJ3A 1GESA 2CDUA 1CC2A 3BHKA 4J2WA 4EQWA 1IUVA 1S2QA 1Y0PA 3UCLA 4YTMA 3QSMA 2GR1A 3NH3X 1KNRA 4DSGA 3UKHA 3ALMA 4YSYA 2IVEA 1BKWA 4TM3A 1YQ3A 1ZP0A 3FPZA 1ELIA 2YVGA 4N9XA 1S2YA 1FEAA 2HQMA 4M52A 2VQ7A 3ZYXA 1RYIA 2CFYA 4OPGA 4X9MA 2WOWA 5BVAA 5EB4A 1GRHA 2VVMA 4BK3A 2ZZBA 1F8WA 1LQUA 4H4ZA 4J33A 4J34A 4U2LA 1FCDA 4YT0A 3AYJA 3AEAA 2UZZA 2NPXA 3UOVA 1PBFA 3CGBA 1VG0A 5GSNA 2XFUA 4B68A 5U25A 3CNTA 4FDCB 3JSKA 3P4PA 2JKCA 1VG9A 4B69A 3SQPA 1BWCA 2WPFA 3QFBA 4FK1C 1L9DA 3H8IA 2Z5YA 3IF9A 3GD4A 4D04A 4TM1A 4A7AA 5JCMA 3QSEA 1OJCA 3KVEA 2GR0A 2C73A 1XANA 3NTDA 4U8NA 1NEKA 1HYUA 2R0CA 3UKKA 1PBBA 2Q6UA 3KD9A 2YLWA 2PHHA 1N1PA 1GTHA 2C7GA 2ZZCA 1CF3A 2JK6A 1Q1RA 4UDRA 4Z44A 2XLUA 4IVMB 2JB1A 2BXSA 4NTEA 4GF7A 4EQSA 2CULA 4LIIA 1NHRA 2FJDA 4X4JA 1PXAA 3AEEA 1O95A 5FS6A 1EL9A 3QFAA 3UOZA 3VR8A 2VRLA 2WP9A 2XVFA 1BGJA 1RSGA 3LB8A 4C77A 3L8KA 3CNPA 3VQRA 4C74A 3NYCA 4Z43A 3BI4A 4B66A 3GYJA 4HA6A 4GDPA 4Y4LA 3RHAA 3VRAA 4H4UA 4UP3A 4B63A 3URHA 1LQTA 3P4RA 3F8RA 4XWRA 3VRDB 2J3NA 3AE8A 1E39A 2EQ8A 4BK1A 1OJTA 3AD7B 4BK2A 3CGEA 2WPEA 1YKJA 2XVHA 2XLPA 3GMCA 3GRSA 4NTDA 4HB9A 3ATRA 4Z24A 1CJ2A 3NHOX 3KLJA 1NPXA 3NRNA 5JCNA 3BNMA 1XPQA 1RP0A 3AE3A 3G5QA 4OCGA 1PDHA 3AWIA 1PJ5A 4BURA 1Q9IA 1F6MA 2AAQA 2XFOA 3Q9TA 1QO8A 2YVFA 1XDIA 2BK3A 2JAEA 2B7SA 1K0JA 3GWDA 4J56A 5U63A 5JCKA 4KX6A 2RABA 2X8HA 3DGHA 4GR1A 4JN9A 4JY3A 2BCGG 5KWFA 4OPDA 3B3RA 2FJEA 2YG3A 4O5QA 1GERA 1M64A 3DA1A 4H4WA 4J36A 2JB3A 2VQBA 4CY8A 3K7QX 1B4VA 1DXLA 1TDKA 4AP1A 4YSXA 3EAOA 1GEUA 4H4QA 3UKPA 3S5WA 1LTXR 1D5TA 1D7LA 1SEZA 2GQWA 2JBVA 4A79A 3AE9A 3LADA 4H4VA 1FL2A 1GREA 3ALLA 2E4GA 5DBJA 4A5LA 3CPJG 2C72A 2RGHA 4IA5A 4TM0A 5ER0A 2R45A 2XCGA 1NDAA 2X50A 2YM2A 2C76A 3AE1A 4H2PA 4U8MA 5FS8A 4CNJA 1LVLA 1GNDA 2JB2A 1DOEA 3PS9A 2A8XA 3S61A 1TDEA 1GOSA 4GCMA 4AOXA 2B9YA 2XVIA 1N4WA 3NG7X 2RGJA 1GPEA 4EMWA 2ZZ0A 4YKGA 2ZBWA 3DJGX 4EQXA 4YTNA 2BK5A 4WCTA 1H86A 1ZKQA 1IUTA 1GALA 3NTAA 3RP8A 4AP3A 2VOUA 4UDPA 1PHHA 5M10A 3AD8B 4MJWA 3DJDA 1H7XA 3NKSA 4JDRA 4REKA 2BS2A 4YXDA 1AOGA 4OPUA 3C96A 4H4PA 5C2TA 2YG7A 4EM4A 4Z2TA 3F8DA 4H2NA 3DGZA 4U8PA 3NN0X 4USRA 1Q1WA 1D4DA 2WP6A 3QVRA 4RG3A 4EIQA 5LV9A 1H6VA 2YQUA 4AT0A 3NK2X 4A99A 2YWLA 4ZCCA 2OAMA 1F8RA 2OALA 2WU5A 3COXA 2GRTA 2R0PA 5L46A 2BCPA 2XFQA 1XHCA 3AYLA 3P9UA 2BA9A 1GRAA 2V3BA 2ACZA 2WDVA 2FJBA 2V60A 1Y56B 3NK0X 5JCIA 2V6OA 3CGDA 4OPCA 2IVDA 2WP5A 1GXFA 1OJAA 2FJAA 1PJ6A 3V3NA 1ZOYA 3H8LA 3NLCA 1H81A 1MO9A 3AEBA 1ZDLA 2I0ZA 3ATQA 4CCRA 1NG3A 1UKVG 2BACA 3AEGA 2E1MA 1EL8A 5KRQA 3IWAA 3AECA 4B67A 4ZCDA 5KVIA 2B76A 1H84A 3H4KA 4NTCA 1PBDA 5KOXA 1B37A 2XFPA 2PYXA 4U8JA 2XYOA 3AE4A 4PABA 1QJDA 2YLXA 2C67A 4GUVA 1MOKA 2C3DA 2TMDA 2X3NA 2YM1A 2Z5XA 2E5VA 2R4JA 3BI2A 3ZDNA 3K30A 4APNA 3VRBA 4I59A 3NYFA 2XLRA 1L0VA 1OJDA 1DODA 4U2TA 3UKQA 4YWOA 1ZK7A 1NENA 2WHDA 2WBAA 4U8KA 1E6EA 2VVLG 4IA6A 4YKFA 1GV4A 3EPTA 3L1RA 4J57A 2GF3A 2RGOA 3OC4A 4X9NA 1COYA 1KDGA 1TYPA 2QAEA 3AD9B 4U8IA 4NEWA 4H7UA 5IQ4A 4E0VA 4NEVA 3CN8A 3G5RA 1F3PA 1KFYA 2XVEA 1X31B 3C4NA 2WESA 2WETA 1MXTA 3CNSA 3AE2A 3OZ2A 5FMHA 1PJ7A 1B5QA 4K2XA 1N4VA 4K5SA 1B8SA 3D8XA 3G5SA 3LZXA 1ONFA 5EBKA 3EANA 1PXBA 1CC4A 2B9WA 2H88A 1NHQA 4A65A 4FK1A 1KNPA 2AR8A 3KPFA 5CKUA 4B1BA 1P2EA 1Y56A 1PN0A 4TM4A 1NG4A 3GYIA 4H50A 2YG6A 3ITJA 1PBCA 4YSZA 2APGA 5EB5A 1QLBA 4H4SA 3FG2P 3GMBA 3REDA 3T37A 3BNUA 4B64A 2BYBA 4A6NB 2C3CA 3I6DA 1KF6A 1ZMDA 2BS4A 1M6IA 1F8SA 3ICSA 3ICTA 3SFDA 3ICRA 3K7TA 2DKHA 3NGCX 1CBOA 3DK4A 2YR6A 4P9SA 4AOSA 2XLTA 3AYIA 3F8PA 4C3XA 1BZLA 2R9ZA 4U8OA 3O0HA 3NN6X 5GRTA 1TDFA 1FEBA 1BGNA 4DSHA 4CRTA 1CL0A 1K0LA 5IQ1A 4LU6A 3DK8A 1E1KA 1LV0A 3IHGA 1GRBA 2OLNA 4FX9A 3UP4A 2C75A 2GR3A 3AEDA 4LA1A 3I3LA 3RP6A 3SM8A 1PS9A 3DK9A 3C4AA 2YAUA 4J31A 1K0IA 1H82A 2VVLA 3CPIG 3LZWA 4K22A 4RSLA 3NIXA 4EQRA 4Z2RA 2C64A 4H2RA 2B9XA 4U2SA 4B65A 2R4EA 5U1OA 1E1LA 2WU2A 5FS7A 4JY2A 3CIRA 2GMHA 1GETA 2YLTA 5KVHA 5BULA 1Z6LA 3EF6A 2WEUA 2O9ZA 1CHUA 2XLSA 3UKFA 1K4QA 1YQZA 3ISHA 2H89A 4BJYA 1NAAA 4K7ZA 3GDNA 3IHMA 1IUXA 1YY5A 2BC0A 1PBEA 4CCQA 5IPYA 3UP5A 3B6DA 4Z2UA 1TYTA 2BK4A 2GR2A 3FBSA 1CC6A 2C66A 1DOCA 1D7YA 5KOWA 1EBDA 5KXJA 2W0HA 2GAGB 4ZN0A 3GWFA 3P1WA 5J7XA 3LXDA 4Y4MA 4K8DA 3GSIA 3DJEA 4H4TA 4NZHA 1S3BA
chains in the Genus database with same CATH superfamily
1JU2A 1TDNA 2GB0A 4EM3A 1LPFA 3QSSA 2Q0KA 2TPRA 2YLZA 1JRXA 2CVJA 3P4QA 3M13A 2GQFA 4JNQA 2R46A 3UTEA 1D4CA 3SGLA 3KA7A 3VR9A 2OA1A 2Y6QA 4UDQA 1E1NA 2XDOA 4GAVA 4Z26A 5HY5A 3CNJA 1TDOA 4XXGA 3SZFA 4DNAA 2EQ7A 2BABA 4IVOB 3SX6A 2YG4A 2B7RA 4ICYA 3D1CA 2X8CA 4CY6A 1IUWA 5EOWA 1CJCA 2GMJA 5HHFA 2YLRA 2OLOA 3PO7A 2QA1A 1DJNA 1IUSA 3GD3A 3UTGA 3UTHA 1OJ9A 5HYMA 2XFNA 4K5RA 3ADAB 2VRMA 2DKIA 3ABVA 2WQYA 3AXBA 3T0KA 1YQ4A 2Q7VA 1GRGA 4D03A 4Y4NA 4KPRA 1V59A 2GV8A 1GRTA 2Q0LA 3ALJA 4XWZA 3PVCA 4EIPA 4WX1A 2C70A 4BV6A 1VQWA 2YR4A 4OPLA 1E7PA 4AT2A 3V76A 1JRYA 2GVCA 3KU9A 2WOVA 3GRTA 3SXIA 1GRFA 2YR5A 5KMSA 4GDEA 4PAAA 3RNMA 1PXCA 1O5WA 1GT8A 4H2QA 5TR3A 3GDPA 2XVJA 1GSNA 2C65A 1E1MA 2EQ6A 4IV9A 1JOAA 3UOYA 1GTEA 3HZLA 3SFEA 1VDCA 3E1TA 2YLSA 2BRAA 4TLXA 2GAHB 5KMRA 2IIDA 2YVJA 4EMJA 3BHFA 2A89A 3NT6A 1S3EA 4Z25A 2WDRA 4OPTA 4A9WA 1JRZA 2ARDA 3LJPA 4H4RA 2WOIA 1P2HA 4I58A 5CQFA 3UKAA 3FMWA 2F5ZA 3UTFA 1H83A 2NVKX 4ECHA 5JCLA 3LOVA 1EL7A 1O94A 2X8GA 3CTYA 3DH9A 4ADWA 4CNKA 1TRBA 4CBQA 2V61A 3KKJA 3RP7A 4JQ9A 1KSUA 3CGCA 4C5OA 3DJJA 5BUKA 1FOHA 5C3JA 4YSHA 1ZX9A 2GEWA 4EMIA 2QCUA 1L9CA 4NNJA 1JNZA 3BI5A 1REOA 4C3YA 2WPCA 3CNDA 3M0OA 2X99A 2FBWA 1IUUA 3NK1X 1W4XA 2WS3A 3AE5A 5M0ZA 2R0GA 1H7WA 4JNAA 4TLZA 2VZ2A 1EL5A 3WE0A 5HXIA 4H4XA 1KSSA 4USQA 2Y6RA 1NHPA 3AB1A 3R9UA 3NYEA 3QJ4A 2EQ9A 2BXRA 1CJ4A 4YTPA 2WDQA 3P4SA 3NNEA 1BF3A 1NHSA 1L9EA 4OPIA 4BJZA 2AQJA 2QA2A 1D4EA 1JEHA 2A87A 3AE6A 4O5UA 4OVIA 1ZOVA 4A6NA 4H4YA 3UOXA 1FECA 1DJQA 1ZY8A 1LJ1A 3AEFA 1ZMCA 3Q6JA 1DNCA 4U8LA 2V5ZA 3M12A 1IJHA 2GH5A 3K7MX 5J60A 2BC1A 4RG4A 3CPHG 3IC9A 3DMEA 1VRQB 3FIMB 3II4A 2V3AA 3V3OA 5FS9A 1JNRA 1N4UA 3UKLA 5BRTA 4DGKA 3AE7A 4GRTA 1DOBA 4II2A 3QVPA 2YG5A 2BS3A 1CJ3A 1GESA 2CDUA 1CC2A 3BHKA 3HYWA 3HYXA 4J2WA 4EQWA 1IUVA 1S2QA 1Y0PA 3UCLA 4YTMA 3QSMA 2GR1A 3NH3X 1KNRA 4DSGA 3UKHA 3ALMA 4YSYA 2IVEA 1BKWA 4TM3A 1YQ3A 1ZP0A 3FPZA 1ELIA 2YVGA 4N9XA 1S2YA 1FEAA 2HQMA 4M52A 4II3A 2VQ7A 3ZYXA 1RYIA 2CFYA 4OPGA 4X9MA 2WOWA 5BVAA 5EB4A 1GRHA 2VVMA 4BK3A 2ZZBA 1F8WA 1LQUA 4H4ZA 4J33A 4J34A 4U2LA 1FCDA 4YT0A 3AYJA 3AEAA 2UZZA 2NPXA 3UOVA 1PBFA 3CGBA 1VG0A 5GSNA 2XFUA 3T2ZA 5KMQA 4B68A 5U25A 3CNTA 4FDCB 3JSKA 3P4PA 2JKCA 1VG9A 4B69A 3SQPA 1BWCA 2WPFA 3QFBA 4FK1C 1L9DA 3H8IA 2Z5YA 3IF9A 3GD4A 3SZCA 4D04A 4TM1A 4A7AA 5JCMA 3QSEA 1OJCA 3KVEA 2GR0A 2C73A 1XANA 3NTDA 4U8NA 1NEKA 1HYUA 2R0CA 3UKKA 1PBBA 2Q6UA 3KD9A 2YLWA 2PHHA 1N1PA 1GTHA 2C7GA 2ZZCA 1CF3A 2JK6A 3T2YA 1Q1RA 4UDRA 4Z44A 2XLUA 4IVMB 2JB1A 2BXSA 4NTEA 4GF7A 4EQSA 2CULA 4LIIA 1NHRA 2FJDA 4X4JA 1PXAA 3AEEA 1O95A 5FS6A 1EL9A 3QFAA 4G6GA 3UOZA 3VR8A 2VRLA 2WP9A 2XVFA 1BGJA 1RSGA 3LB8A 4C77A 3L8KA 3CNPA 3VQRA 4C74A 3NYCA 4Z43A 3BI4A 4B66A 3GYJA 4HA6A 4GDPA 4Y4LA 3RHAA 3VRAA 4H4UA 4UP3A 4B63A 3SY4A 3URHA 1LQTA 3P4RA 3F8RA 4XWRA 3VRDB 2J3NA 3AE8A 1E39A 2EQ8A 4BK1A 1OJTA 3AD7B 4BK2A 3CGEA 2WPEA 1YKJA 2XVHA 2XLPA 3GMCA 3GRSA 4NTDA 4HB9A 3ATRA 4Z24A 1CJ2A 3NHOX 3KLJA 1NPXA 3NRNA 5JCNA 3BNMA 1XPQA 1RP0A 3AE3A 3G5QA 4OCGA 1PDHA 3AWIA 1PJ5A 4BURA 1Q9IA 1F6MA 2AAQA 2XFOA 3Q9TA 1QO8A 2YVFA 1XDIA 2BK3A 2JAEA 2B7SA 1K0JA 3GWDA 4J56A 5U63A 5JCKA 4KX6A 2RABA 4NWZA 3SYIA 2X8HA 3DGHA 4GR1A 4JN9A 4JY3A 2BCGG 5KWFA 4OPDA 3B3RA 2FJEA 2YG3A 4O5QA 1GERA 1M64A 3DA1A 4H4WA 4J36A 2JB3A 2VQBA 4CY8A 3K7QX 1B4VA 1DXLA 1TDKA 4AP1A 4YSXA 3EAOA 1GEUA 4H4QA 3UKPA 3S5WA 1LTXR 1D5TA 1D7LA 1SEZA 2GQWA 2JBVA 4A79A 3AE9A 3LADA 4H4VA 1FL2A 1GREA 3ALLA 2BRYA 2E4GA 5DBJA 4A5LA 5KNLA 3CPJG 2C72A 2RGHA 4G9KA 4IA5A 4TM0A 2R45A 5ER0A 2XCGA 1NDAA 2X50A 2YM2A 2C76A 3AE1A 4H2PA 4U8MA 5FS8A 4CNJA 1LVLA 1GNDA 2JB2A 1DOEA 3PS9A 2A8XA 3S61A 1TDEA 1GOSA 4GCMA 4AOXA 2B9YA 2XVIA 1N4WA 3NG7X 2RGJA 1GPEA 4EMWA 2ZZ0A 4YKGA 2ZBWA 3DJGX 4EQXA 4YTNA 2BK5A 4WCTA 1H86A 1ZKQA 1IUTA 1GALA 3NTAA 3RP8A 4AP3A 2VOUA 4UDPA 1PHHA 5M10A 5KMPA 3AD8B 4MJWA 4G73A 3DJDA 1H7XA 3NKSA 4JDRA 4REKA 2BS2A 4YXDA 1AOGA 4OPUA 3C96A 4H4PA 3SZWA 5C2TA 2YG7A 4EM4A 4Z2TA 3F8DA 4H2NA 3DGZA 4U8PA 3NN0X 4USRA 1Q1WA 1D4DA 2WP6A 3QVRA 4RG3A 4EIQA 5LV9A 1H6VA 2YQUA 4AT0A 3NK2X 4A99A 2YWLA 4ZCCA 2OAMA 1F8RA 2OALA 2WU5A 3COXA 3CMMA 2GRTA 2R0PA 5L46A 2BCPA 2XFQA 1XHCA 3AYLA 3P9UA 2BA9A 1GRAA 2V3BA 2ACZA 2WDVA 2FJBA 2V60A 1Y56B 3NK0X 5JCIA 2V6OA 3CGDA 4OPCA 2IVDA 2WP5A 1GXFA 1OJAA 2FJAA 1PJ6A 3V3NA 1ZOYA 3H8LA 3NLCA 1H81A 1MO9A 3AEBA 1ZDLA 2I0ZA 3ATQA 4CCRA 3SZ0A 1NG3A 1UKVG 2BACA 3AEGA 2E1MA 1EL8A 5KRQA 3IWAA 3AECA 4B67A 4ZCDA 5KVIA 2B76A 1H84A 3H4KA 4NTCA 1PBDA 3T14A 5KOXA 1B37A 2XFPA 2PYXA 4U8JA 2XYOA 3AE4A 4G74A 4PABA 1QJDA 2YLXA 2C67A 4GUVA 1MOKA 2C3DA 2TMDA 2X3NA 2YM1A 2Z5XA 2E5VA 2R4JA 3BI2A 3ZDNA 3K30A 4APNA 3VRBA 4I59A 3NYFA 2XLRA 1L0VA 1OJDA 1DODA 4U2TA 3UKQA 4YWOA 1ZK7A 1NENA 2WHDA 2WBAA 4U8KA 1E6EA 2VVLG 4IA6A 4YKFA 1GV4A 3EPTA 3L1RA 4J57A 2GF3A 2RGOA 3OC4A 4X9NA 1COYA 1KDGA 1TYPA 2QAEA 3AD9B 4U8IA 4NEWA 4H7UA 5IQ4A 4E0VA 4NEVA 3CN8A 3G5RA 1F3PA 1KFYA 2XVEA 1X31B 3C4NA 2WESA 2WETA 1MXTA 3CNSA 3AE2A 3OZ2A 5FMHA 1PJ7A 1B5QA 4K2XA 1N4VA 4K5SA 1B8SA 3D8XA 3G5SA 3LZXA 1ONFA 5EBKA 3EANA 1PXBA 1CC4A 2B9WA 2H88A 1NHQA 4A65A 4FK1A 1KNPA 3HYVA 2AR8A 3KPFA 5CKUA 3T2KA 4B1BA 1P2EA 1Y56A 1PN0A 4TM4A 1NG4A 3GYIA 4H50A 2YG6A 3ITJA 1PBCA 3KPKA 4YSZA 2APGA 5EB5A 1QLBA 4H4SA 3FG2P 3GMBA 3REDA 3T37A 3BNUA 4B64A 2BYBA 4A6NB 2C3CA 3I6DA 1KF6A 1ZMDA 2BS4A 1M6IA 1F8SA 3ICSA 3ICTA 3SFDA 3ICRA 3K7TA 2DKHA 3NGCX 1CBOA 3DK4A 2YR6A 4P9SA 4AOSA 3GYXA 2XLTA 3AYIA 3F8PA 4C3XA 1BZLA 2R9ZA 4U8OA 3O0HA 3NN6X 4G6HA 5GRTA 1TDFA 1FEBA 1BGNA 4DSHA 4CRTA 1CL0A 1K0LA 5IQ1A 4LU6A 3DK8A 1E1KA 1LV0A 3IHGA 1GRBA 2OLNA 4FX9A 3UP4A 2C75A 2GR3A 3AEDA 4LA1A 3I3LA 3RP6A 3SM8A 1PS9A 2C4CA 3DK9A 3C4AA 2YAUA 4J31A 1K0IA 1H82A 2VVLA 3CPIG 3LZWA 4K22A 4RSLA 3NIXA 4EQRA 4Z2RA 2C64A 4H2RA 2B9XA 4U2SA 4B65A 2R4EA 5U1OA 1E1LA 2WU2A 5FS7A 4JY2A 3CIRA 2GMHA 1GETA 2YLTA 5KVHA 5BULA 1Z6LA 3EF6A 2WEUA 2O9ZA 1CHUA 2XLSA 3UKFA 1K4QA 1YQZA 3ISHA 2H89A 4BJYA 1NAAA 4K7ZA 3GDNA 3IHMA 1IUXA 1YY5A 2BC0A 1PBEA 4CCQA 5IPYA 3UP5A 3B6DA 4Z2UA 1TYTA 2BK4A 2GR2A 3FBSA 1CC6A 2C66A 1DOCA 1D7YA 5KOWA 1EBDA 3T31A 5KXJA 2W0HA 2GAGB 4ZN0A 3GWFA 3P1WA 5J7XA 4GAPA 3LXDA 4Y4MA 4K8DA 3GSIA 3DJEA 4H4TA 4NZHA 1S3BA
chains in the Genus database with same CATH topology
1JU2A 1TDNA 2GB0A 4EM3A 1LPFA 3QSSA 2Q0KA 2TPRA 2YLZA 1JRXA 2CVJA 3P4QA 3M13A 2GQFA 4JNQA 2R46A 3UTEA 1D4CA 3SGLA 3KA7A 3VR9A 2OA1A 2Y6QA 4UDQA 1E1NA 2XDOA 4GAVA 4Z26A 5HY5A 3CNJA 1TDOA 4XXGA 3SZFA 4DNAA 2EQ7A 2BABA 4IVOB 3SX6A 2YG4A 2B7RA 4ICYA 3D1CA 2X8CA 4CY6A 1IUWA 5EOWA 1CJCA 2GMJA 5HHFA 2YLRA 2OLOA 3PO7A 2QA1A 1DJNA 1IUSA 3GD3A 3UTGA 3UTHA 1OJ9A 5HYMA 2XFNA 4K5RA 3ADAB 2VRMA 2DKIA 3ABVA 2WQYA 3AXBA 3T0KA 1YQ4A 2Q7VA 1GRGA 4D03A 4Y4NA 4KPRA 1V59A 2GV8A 1GRTA 2Q0LA 3ALJA 4XWZA 3PVCA 4EIPA 4WX1A 2C70A 4BV6A 1VQWA 2YR4A 4OPLA 1E7PA 4AT2A 3V76A 1JRYA 2GVCA 3KU9A 2WOVA 3GRTA 3SXIA 1GRFA 2YR5A 5KMSA 4GDEA 4PAAA 3RNMA 1PXCA 1O5WA 1GT8A 4H2QA 5TR3A 3GDPA 2XVJA 1GSNA 2C65A 1E1MA 2EQ6A 4IV9A 1JOAA 3UOYA 1GTEA 3HZLA 3SFEA 1VDCA 3E1TA 2YLSA 2BRAA 4TLXA 2GAHB 5KMRA 2IIDA 2YVJA 4EMJA 3BHFA 2A89A 3NT6A 1S3EA 4Z25A 2WDRA 4OPTA 4A9WA 1JRZA 2ARDA 3LJPA 4H4RA 2WOIA 1P2HA 4I58A 5CQFA 3UKAA 3FMWA 2F5ZA 3UTFA 1H83A 2NVKX 4ECHA 5JCLA 3LOVA 1EL7A 1O94A 2X8GA 3CTYA 3DH9A 4ADWA 4CNKA 1TRBA 4CBQA 2V61A 3KKJA 3RP7A 4JQ9A 1KSUA 3CGCA 4C5OA 3DJJA 5BUKA 1FOHA 5C3JA 4YSHA 1ZX9A 2GEWA 4EMIA 2QCUA 1L9CA 4NNJA 1JNZA 3BI5A 1REOA 4C3YA 2WPCA 3CNDA 3M0OA 2X99A 2FBWA 1IUUA 3NK1X 1W4XA 2WS3A 3AE5A 5M0ZA 2R0GA 1H7WA 4JNAA 4TLZA 2VZ2A 1EL5A 3WE0A 5HXIA 4H4XA 1KSSA 4USQA 2Y6RA 1NHPA 3AB1A 3R9UA 3NYEA 3QJ4A 2EQ9A 2BXRA 1CJ4A 4YTPA 2WDQA 3P4SA 3NNEA 1BF3A 1NHSA 1L9EA 4OPIA 4BJZA 2AQJA 2QA2A 1D4EA 1JEHA 2A87A 3AE6A 4O5UA 4OVIA 1ZOVA 4A6NA 4H4YA 3UOXA 1FECA 1DJQA 1ZY8A 1LJ1A 3AEFA 1ZMCA 3Q6JA 1DNCA 4U8LA 2V5ZA 3M12A 1IJHA 2GH5A 3K7MX 5J60A 2BC1A 4RG4A 3CPHG 3IC9A 3DMEA 1VRQB 3FIMB 3II4A 2V3AA 3V3OA 5FS9A 1JNRA 1N4UA 3UKLA 5BRTA 4DGKA 3AE7A 4GRTA 1DOBA 4II2A 3QVPA 2YG5A 2BS3A 1CJ3A 1GESA 2CDUA 1CC2A 3BHKA 3HYWA 3HYXA 4J2WA 4EQWA 1IUVA 1S2QA 1Y0PA 3UCLA 4YTMA 3QSMA 2GR1A 3NH3X 1KNRA 4DSGA 3UKHA 3ALMA 4YSYA 2IVEA 1BKWA 4TM3A 1YQ3A 1ZP0A 3FPZA 1ELIA 2YVGA 4N9XA 1S2YA 1FEAA 2HQMA 4M52A 4II3A 2VQ7A 3ZYXA 1RYIA 2CFYA 4OPGA 4X9MA 2WOWA 5BVAA 5EB4A 1GRHA 2VVMA 4BK3A 2ZZBA 1F8WA 1LQUA 4H4ZA 4J33A 4J34A 4U2LA 1FCDA 4YT0A 3AYJA 3AEAA 2UZZA 2NPXA 3UOVA 1PBFA 3CGBA 1VG0A 5GSNA 2XFUA 3T2ZA 5KMQA 4B68A 5U25A 3CNTA 4FDCB 3JSKA 3P4PA 2JKCA 1VG9A 4B69A 3SQPA 1BWCA 2WPFA 3QFBA 4FK1C 1L9DA 3H8IA 2Z5YA 3IF9A 3GD4A 3SZCA 4D04A 4TM1A 4A7AA 5JCMA 3QSEA 1OJCA 3KVEA 2GR0A 2C73A 1XANA 3NTDA 4U8NA 1NEKA 1HYUA 2R0CA 3UKKA 1PBBA 2Q6UA 3KD9A 2YLWA 2PHHA 1N1PA 1GTHA 2C7GA 2ZZCA 1CF3A 2JK6A 3T2YA 1Q1RA 4UDRA 4Z44A 2XLUA 4IVMB 2JB1A 2BXSA 4NTEA 4GF7A 4EQSA 2CULA 4LIIA 1NHRA 2FJDA 4X4JA 1PXAA 3AEEA 1O95A 5FS6A 1EL9A 3QFAA 4G6GA 3UOZA 3VR8A 2VRLA 2WP9A 2XVFA 1BGJA 1RSGA 3LB8A 4C77A 3L8KA 3CNPA 3VQRA 4C74A 3NYCA 4Z43A 3BI4A 4B66A 3GYJA 4HA6A 4GDPA 4Y4LA 3RHAA 3VRAA 4H4UA 4UP3A 4B63A 3SY4A 3URHA 1LQTA 3P4RA 3F8RA 4XWRA 3VRDB 2J3NA 3AE8A 1E39A 2EQ8A 4BK1A 1OJTA 3AD7B 4BK2A 3CGEA 2WPEA 1YKJA 2XVHA 2XLPA 3GMCA 3GRSA 4NTDA 4HB9A 3ATRA 4Z24A 1CJ2A 3NHOX 3KLJA 1NPXA 3NRNA 5JCNA 3BNMA 1XPQA 1RP0A 3AE3A 3G5QA 4OCGA 1PDHA 3AWIA 1PJ5A 4BURA 1Q9IA 1F6MA 2AAQA 2XFOA 3Q9TA 1QO8A 2YVFA 1XDIA 2BK3A 2JAEA 2B7SA 1K0JA 3GWDA 4J56A 5U63A 5JCKA 4KX6A 2RABA 4NWZA 3SYIA 2X8HA 3DGHA 4GR1A 4JN9A 4JY3A 2BCGG 5KWFA 4OPDA 3B3RA 2FJEA 2YG3A 4O5QA 1GERA 1M64A 3DA1A 4H4WA 4J36A 2JB3A 2VQBA 4CY8A 3K7QX 1B4VA 1DXLA 1TDKA 4AP1A 4YSXA 3EAOA 1GEUA 4H4QA 3UKPA 3S5WA 1LTXR 1D5TA 1D7LA 1SEZA 2GQWA 2JBVA 4A79A 3AE9A 3LADA 4H4VA 1FL2A 1GREA 3ALLA 2BRYA 2E4GA 5DBJA 4A5LA 5KNLA 3CPJG 2C72A 2RGHA 4G9KA 4IA5A 4TM0A 2R45A 5ER0A 2XCGA 1NDAA 2X50A 2YM2A 2C76A 3AE1A 4H2PA 4U8MA 5FS8A 4CNJA 1LVLA 1GNDA 2JB2A 1DOEA 3PS9A 2A8XA 3S61A 1TDEA 1GOSA 4GCMA 4AOXA 2B9YA 2XVIA 1N4WA 3NG7X 2RGJA 1GPEA 4EMWA 2ZZ0A 4YKGA 2ZBWA 3DJGX 4EQXA 4YTNA 2BK5A 4WCTA 1H86A 1ZKQA 1IUTA 1GALA 3NTAA 3RP8A 4AP3A 2VOUA 4UDPA 1PHHA 5M10A 5KMPA 3AD8B 4MJWA 4G73A 3DJDA 1H7XA 3NKSA 4JDRA 4REKA 2BS2A 4YXDA 1AOGA 4OPUA 3C96A 4H4PA 3SZWA 5C2TA 2YG7A 4EM4A 4Z2TA 3F8DA 4H2NA 3DGZA 4U8PA 3NN0X 4USRA 1Q1WA 1D4DA 2WP6A 3QVRA 4RG3A 4EIQA 5LV9A 1H6VA 2YQUA 4AT0A 3NK2X 4A99A 2YWLA 4ZCCA 2OAMA 1F8RA 2OALA 2WU5A 3COXA 3CMMA 2GRTA 2R0PA 5L46A 2BCPA 2XFQA 1XHCA 3AYLA 3P9UA 2BA9A 1GRAA 2V3BA 2ACZA 2WDVA 2FJBA 2V60A 1Y56B 3NK0X 5JCIA 2V6OA 3CGDA 4OPCA 2IVDA 2WP5A 1GXFA 1OJAA 2FJAA 1PJ6A 3V3NA 1ZOYA 3H8LA 3NLCA 1H81A 1MO9A 3AEBA 1ZDLA 2I0ZA 3ATQA 4CCRA 3SZ0A 1NG3A 1UKVG 2BACA 3AEGA 2E1MA 1EL8A 5KRQA 3IWAA 3AECA 4B67A 4ZCDA 5KVIA 2B76A 1H84A 3H4KA 4NTCA 1PBDA 3T14A 5KOXA 1B37A 2XFPA 2PYXA 4U8JA 2XYOA 3AE4A 4G74A 4PABA 1QJDA 2YLXA 2C67A 4GUVA 1MOKA 2C3DA 2TMDA 2X3NA 2YM1A 2Z5XA 2E5VA 2R4JA 3BI2A 3ZDNA 3K30A 4APNA 3VRBA 4I59A 3NYFA 2XLRA 1L0VA 1OJDA 1DODA 4U2TA 3UKQA 4YWOA 1ZK7A 1NENA 2WHDA 2WBAA 4U8KA 1E6EA 2VVLG 4IA6A 4YKFA 1GV4A 3EPTA 3L1RA 4J57A 2GF3A 2RGOA 3OC4A 4X9NA 1COYA 1KDGA 1TYPA 2QAEA 3AD9B 4U8IA 4NEWA 4H7UA 5IQ4A 4E0VA 4NEVA 3CN8A 3G5RA 1F3PA 1KFYA 2XVEA 1X31B 3C4NA 2WESA 2WETA 1MXTA 3CNSA 3AE2A 3OZ2A 5FMHA 1PJ7A 1B5QA 4K2XA 1N4VA 4K5SA 1B8SA 3D8XA 3G5SA 3LZXA 1ONFA 5EBKA 3EANA 1PXBA 1CC4A 2B9WA 2H88A 1NHQA 4A65A 4FK1A 1KNPA 3HYVA 2AR8A 3KPFA 5CKUA 3T2KA 4B1BA 1P2EA 1Y56A 1PN0A 4TM4A 1NG4A 3GYIA 4H50A 2YG6A 3ITJA 1PBCA 3KPKA 4YSZA 2APGA 5EB5A 1QLBA 4H4SA 3FG2P 3GMBA 3REDA 3T37A 3BNUA 4B64A 2BYBA 4A6NB 2C3CA 3I6DA 1KF6A 1ZMDA 2BS4A 1M6IA 1F8SA 3ICSA 3ICTA 3SFDA 3ICRA 3K7TA 2DKHA 3NGCX 1CBOA 3DK4A 2YR6A 4P9SA 4AOSA 3GYXA 2XLTA 3AYIA 3F8PA 4C3XA 1BZLA 2R9ZA 4U8OA 3O0HA 3NN6X 4G6HA 5GRTA 1TDFA 1FEBA 1BGNA 4DSHA 4CRTA 1CL0A 1K0LA 5IQ1A 4LU6A 3DK8A 1E1KA 1LV0A 3IHGA 1GRBA 2OLNA 4FX9A 3UP4A 2C75A 2GR3A 3AEDA 4LA1A 3I3LA 3RP6A 3SM8A 1PS9A 2C4CA 3DK9A 3C4AA 2YAUA 4J31A 1K0IA 1H82A 2VVLA 3CPIG 3LZWA 4K22A 4RSLA 3NIXA 4EQRA 4Z2RA 2C64A 4H2RA 2B9XA 4U2SA 4B65A 2R4EA 5U1OA 1E1LA 2WU2A 5FS7A 4JY2A 3CIRA 2GMHA 1GETA 2YLTA 5KVHA 5BULA 1Z6LA 3EF6A 2WEUA 2O9ZA 1CHUA 2XLSA 3UKFA 1K4QA 1YQZA 3ISHA 2H89A 4BJYA 1NAAA 4K7ZA 3GDNA 3IHMA 1IUXA 1YY5A 2BC0A 1PBEA 4CCQA 5IPYA 3UP5A 3B6DA 4Z2UA 1TYTA 2BK4A 2GR2A 3FBSA 1CC6A 2C66A 1DOCA 1D7YA 5KOWA 1EBDA 3T31A 5KXJA 2W0HA 2GAGB 4ZN0A 3GWFA 3P1WA 5J7XA 4GAPA 3LXDA 4Y4MA 4K8DA 3GSIA 3DJEA 4H4TA 4NZHA 1S3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU2 A;  1TDN A;  2GB0 A;  4EM3 A;  1LPF A;  3QSS A;  2Q0K A;  2TPR A;  2YLZ A;  1JRX A;  2CVJ A;  3P4Q A;  3M13 A;  2GQF A;  4JNQ A;  2R46 A;  3UTE A;  1D4C A;  3SGL A;  3KA7 A;  3VR9 A;  2OA1 A;  2Y6Q A;  4UDQ A;  1E1N A;  2XDO A;  4Z26 A;  5HY5 A;  3CNJ A;  1TDO A;  4XXG A;  4DNA A;  2EQ7 A;  2BAB A;  4IVO B;  2YG4 A;  2B7R A;  4ICY A;  3D1C A;  2X8C A;  4CY6 A;  1IUW A;  5EOW A;  1CJC A;  2GMJ A;  5HHF A;  2YLR A;  2OLO A;  3PO7 A;  2QA1 A;  1DJN A;  1IUS A;  3GD3 A;  3UTG A;  3UTH A;  1OJ9 A;  5HYM A;  2XFN A;  4K5R A;  3ADA B;  2VRM A;  2DKI A;  3ABV A;  2WQY A;  3AXB A;  1YQ4 A;  2Q7V A;  1GRG A;  4D03 A;  4Y4N A;  4KPR A;  1V59 A;  2GV8 A;  1GRT A;  2Q0L A;  3ALJ A;  4XWZ A;  3PVC A;  4EIP A;  4WX1 A;  2C70 A;  4BV6 A;  1VQW A;  2YR4 A;  4OPL A;  1E7P A;  4AT2 A;  3V76 A;  1JRY A;  2GVC A;  3KU9 A;  2WOV A;  3GRT A;  1GRF A;  2YR5 A;  4GDE A;  4PAA A;  3RNM A;  1PXC A;  1O5W A;  1GT8 A;  4H2Q A;  5TR3 A;  3GDP A;  2XVJ A;  1GSN A;  2C65 A;  1E1M A;  2EQ6 A;  4IV9 A;  1JOA A;  3UOY A;  1GTE A;  3HZL A;  3SFE A;  1VDC A;  3E1T A;  2YLS A;  4TLX A;  2GAH B;  2IID A;  2YVJ A;  4EMJ A;  3BHF A;  2A89 A;  3NT6 A;  1S3E A;  4Z25 A;  2WDR A;  4OPT A;  4A9W A;  1JRZ A;  2ARD A;  3LJP A;  4H4R A;  2WOI A;  1P2H A;  4I58 A;  5CQF A;  3UKA A;  3FMW A;  2F5Z A;  3UTF A;  1H83 A;  2NVK X;  4ECH A;  5JCL A;  3LOV A;  1EL7 A;  1O94 A;  2X8G A;  3CTY A;  3DH9 A;  4ADW A;  4CNK A;  1TRB A;  4CBQ A;  2V61 A;  3KKJ A;  3RP7 A;  4JQ9 A;  1KSU A;  3CGC A;  4C5O A;  3DJJ A;  5BUK A;  1FOH A;  5C3J A;  4YSH A;  1ZX9 A;  2GEW A;  4EMI A;  2QCU A;  1L9C A;  1JNZ A;  3BI5 A;  1REO A;  4C3Y A;  2WPC A;  3CND A;  3M0O A;  2X99 A;  2FBW A;  1IUU A;  3NK1 X;  1W4X A;  2WS3 A;  3AE5 A;  5M0Z A;  2R0G A;  1H7W A;  4JNA A;  4TLZ A;  2VZ2 A;  1EL5 A;  3WE0 A;  5HXI A;  4H4X A;  1KSS A;  4USQ A;  2Y6R A;  1NHP A;  3AB1 A;  3R9U A;  3NYE A;  3QJ4 A;  2EQ9 A;  2BXR A;  1CJ4 A;  4YTP A;  2WDQ A;  3P4S A;  3NNE A;  1BF3 A;  1NHS A;  1L9E A;  4OPI A;  4BJZ A;  2AQJ A;  2QA2 A;  1D4E A;  1JEH A;  2A87 A;  3AE6 A;  4O5U A;  4OVI A;  1ZOV A;  4A6N A;  4H4Y A;  3UOX A;  1FEC A;  1DJQ A;  1ZY8 A;  1LJ1 A;  3AEF A;  1ZMC A;  3Q6J A;  1DNC A;  4U8L A;  2V5Z A;  3M12 A;  1IJH A;  2GH5 A;  3K7M X;  5J60 A;  2BC1 A;  4RG4 A;  3CPH G;  3IC9 A;  3DME A;  1VRQ B;  3FIM B;  3II4 A;  2V3A A;  3V3O A;  5FS9 A;  1JNR A;  1N4U A;  3UKL A;  5BRT A;  4DGK A;  3AE7 A;  4GRT A;  1DOB A;  3QVP A;  2YG5 A;  2BS3 A;  1CJ3 A;  1GES A;  2CDU A;  1CC2 A;  3BHK A;  4J2W A;  4EQW A;  1IUV A;  1S2Q A;  1Y0P A;  3UCL A;  4YTM A;  3QSM A;  2GR1 A;  3NH3 X;  1KNR A;  4DSG A;  3UKH A;  3ALM A;  4YSY A;  2IVE A;  1BKW A;  4TM3 A;  1YQ3 A;  1ZP0 A;  3FPZ A;  1ELI A;  2YVG A;  4N9X A;  1S2Y A;  1FEA A;  2HQM A;  4M52 A;  2VQ7 A;  3ZYX A;  1RYI A;  2CFY A;  4OPG A;  4X9M A;  2WOW A;  5BVA A;  5EB4 A;  1GRH A;  2VVM A;  4BK3 A;  2ZZB A;  1F8W A;  1LQU A;  4H4Z A;  4J33 A;  4J34 A;  4U2L A;  1FCD A;  4YT0 A;  3AYJ A;  3AEA A;  2UZZ A;  2NPX A;  3UOV A;  1PBF A;  3CGB A;  1VG0 A;  5GSN A;  2XFU A;  4B68 A;  5U25 A;  3CNT A;  4FDC B;  3JSK A;  3P4P A;  2JKC A;  1VG9 A;  4B69 A;  3SQP A;  1BWC A;  2WPF A;  3QFB A;  4FK1 C;  1L9D A;  3H8I A;  2Z5Y A;  3IF9 A;  3GD4 A;  4D04 A;  4TM1 A;  4A7A A;  5JCM A;  3QSE A;  1OJC A;  3KVE A;  2GR0 A;  2C73 A;  1XAN A;  3NTD A;  4U8N A;  1NEK A;  1HYU A;  2R0C A;  3UKK A;  1PBB A;  2Q6U A;  3KD9 A;  2YLW A;  2PHH A;  1N1P A;  1GTH A;  2C7G A;  2ZZC A;  1CF3 A;  2JK6 A;  1Q1R A;  4UDR A;  4Z44 A;  2XLU A;  4IVM B;  2JB1 A;  2BXS A;  4NTE A;  4GF7 A;  4EQS A;  2CUL A;  4LII A;  1NHR A;  2FJD A;  4X4J A;  1PXA A;  3AEE A;  1O95 A;  5FS6 A;  1EL9 A;  3QFA A;  3UOZ A;  3VR8 A;  2VRL A;  2WP9 A;  2XVF A;  1BGJ A;  1RSG A;  3LB8 A;  4C77 A;  3L8K A;  3CNP A;  3VQR A;  4C74 A;  3NYC A;  4Z43 A;  3BI4 A;  4B66 A;  3GYJ A;  4HA6 A;  4GDP A;  4Y4L A;  3RHA A;  3VRA A;  4H4U A;  4UP3 A;  4B63 A;  3URH A;  1LQT A;  3P4R A;  3F8R A;  4XWR A;  3VRD B;  2J3N A;  3AE8 A;  1E39 A;  2EQ8 A;  4BK1 A;  1OJT A;  3AD7 B;  4BK2 A;  3CGE A;  2WPE A;  1YKJ A;  2XVH A;  2XLP A;  3GMC A;  3GRS A;  4NTD A;  4HB9 A;  3ATR A;  4Z24 A;  1CJ2 A;  3NHO X;  3KLJ A;  1NPX A;  3NRN A;  5JCN A;  3BNM A;  1XPQ A;  1RP0 A;  3AE3 A;  3G5Q A;  4OCG A;  1PDH A;  3AWI A;  1PJ5 A;  4BUR A;  1Q9I A;  1F6M A;  2AAQ A;  2XFO A;  3Q9T A;  1QO8 A;  2YVF A;  1XDI A;  2BK3 A;  2JAE A;  2B7S A;  1K0J A;  3GWD A;  4J56 A;  5U63 A;  5JCK A;  4KX6 A;  2RAB A;  2X8H A;  3DGH A;  4GR1 A;  4JN9 A;  4JY3 A;  2BCG G;  5KWF A;  4OPD A;  3B3R A;  2FJE A;  2YG3 A;  4O5Q A;  1GER A;  1M64 A;  3DA1 A;  4H4W A;  4J36 A;  2JB3 A;  2VQB A;  4CY8 A;  3K7Q X;  1B4V A;  1DXL A;  1TDK A;  4AP1 A;  4YSX A;  3EAO A;  1GEU A;  4H4Q A;  3UKP A;  3S5W A;  1LTX R;  1D5T A;  1D7L A;  1SEZ A;  2GQW A;  2JBV A;  4A79 A;  3AE9 A;  3LAD A;  4H4V A;  1FL2 A;  1GRE A;  3ALL A;  2E4G A;  5DBJ A;  4A5L A;  3CPJ G;  2C72 A;  2RGH A;  4IA5 A;  4TM0 A;  5ER0 A;  2R45 A;  2XCG A;  1NDA A;  2X50 A;  2YM2 A;  2C76 A;  3AE1 A;  4H2P A;  4U8M A;  5FS8 A;  4CNJ A;  1LVL A;  1GND A;  2JB2 A;  1DOE A;  3PS9 A;  2A8X A;  3S61 A;  1TDE A;  1GOS A;  4GCM A;  4AOX A;  2B9Y A;  2XVI A;  1N4W A;  3NG7 X;  2RGJ A;  1GPE A;  4EMW A;  2ZZ0 A;  4YKG A;  2ZBW A;  3DJG X;  4EQX A;  4YTN A;  2BK5 A;  4WCT A;  1H86 A;  1ZKQ A;  1IUT A;  1GAL A;  3NTA A;  3RP8 A;  4AP3 A;  2VOU A;  4UDP A;  1PHH A;  5M10 A;  3AD8 B;  4MJW A;  3DJD A;  1H7X A;  3NKS A;  4JDR A;  4REK A;  2BS2 A;  4YXD A;  1AOG A;  4OPU A;  3C96 A;  4H4P A;  5C2T A;  2YG7 A;  4EM4 A;  4Z2T A;  3F8D A;  4H2N A;  3DGZ A;  4U8P A;  3NN0 X;  4USR A;  1Q1W A;  1D4D A;  2WP6 A;  3QVR A;  4RG3 A;  4EIQ A;  5LV9 A;  1H6V A;  2YQU A;  4AT0 A;  3NK2 X;  4A99 A;  2YWL A;  4ZCC A;  2OAM A;  1F8R A;  2OAL A;  2WU5 A;  3COX A;  2GRT A;  2R0P A;  5L46 A;  2BCP A;  2XFQ A;  1XHC A;  3AYL A;  3P9U A;  2BA9 A;  1GRA A;  2V3B A;  2ACZ A;  2WDV A;  2FJB A;  2V60 A;  1Y56 B;  3NK0 X;  5JCI A;  2V6O A;  3CGD A;  4OPC A;  2IVD A;  2WP5 A;  1GXF A;  1OJA A;  2FJA A;  1PJ6 A;  3V3N A;  1ZOY A;  3H8L A;  3NLC A;  1H81 A;  1MO9 A;  3AEB A;  1ZDL A;  2I0Z A;  3ATQ A;  4CCR A;  1NG3 A;  1UKV G;  2BAC A;  3AEG A;  2E1M A;  1EL8 A;  5KRQ A;  3IWA A;  3AEC A;  4B67 A;  4ZCD A;  5KVI A;  2B76 A;  1H84 A;  3H4K A;  4NTC A;  1PBD A;  5KOX A;  1B37 A;  2XFP A;  2PYX A;  4U8J A;  2XYO A;  3AE4 A;  4PAB A;  1QJD A;  2YLX A;  2C67 A;  4GUV A;  1MOK A;  2C3D A;  2TMD A;  2X3N A;  2YM1 A;  2Z5X A;  2E5V A;  2R4J A;  3BI2 A;  3ZDN A;  3K30 A;  4APN A;  3VRB A;  4I59 A;  3NYF A;  2XLR A;  1L0V A;  1OJD A;  1DOD A;  4U2T A;  3UKQ A;  4YWO A;  1ZK7 A;  1NEN A;  2WHD A;  2WBA A;  4U8K A;  1E6E A;  2VVL G;  4IA6 A;  4YKF A;  1GV4 A;  3EPT A;  3L1R A;  4J57 A;  2GF3 A;  2RGO A;  3OC4 A;  4X9N A;  1COY A;  1KDG A;  1TYP A;  2QAE A;  3AD9 B;  4U8I A;  4NEW A;  4H7U A;  5IQ4 A;  4E0V A;  4NEV A;  3CN8 A;  3G5R A;  1F3P A;  1KFY A;  2XVE A;  1X31 B;  3C4N A;  2WES A;  2WET A;  1MXT A;  3CNS A;  3AE2 A;  3OZ2 A;  5FMH A;  1PJ7 A;  1B5Q A;  4K2X A;  1N4V A;  4K5S A;  1B8S A;  3D8X A;  3G5S A;  3LZX A;  1ONF A;  5EBK A;  3EAN A;  1PXB A;  1CC4 A;  2B9W A;  2H88 A;  1NHQ A;  4A65 A;  4FK1 A;  1KNP A;  2AR8 A;  3KPF A;  5CKU A;  4B1B A;  1P2E A;  1Y56 A;  1PN0 A;  4TM4 A;  1NG4 A;  3GYI A;  4H50 A;  2YG6 A;  3ITJ A;  1PBC A;  4YSZ A;  2APG A;  5EB5 A;  1QLB A;  4H4S A;  3FG2 P;  3GMB A;  3RED A;  3T37 A;  3BNU A;  4B64 A;  2BYB A;  4A6N B;  2C3C A;  3I6D A;  1KF6 A;  1ZMD A;  2BS4 A;  1M6I A;  1F8S A;  3ICS A;  3ICT A;  3SFD A;  3ICR A;  3K7T A;  2DKH A;  3NGC X;  1CBO A;  3DK4 A;  2YR6 A;  4P9S A;  4AOS A;  2XLT A;  3AYI A;  3F8P A;  4C3X A;  1BZL A;  2R9Z A;  4U8O A;  3O0H A;  3NN6 X;  5GRT A;  1TDF A;  1FEB A;  1BGN A;  4DSH A;  4CRT A;  1CL0 A;  1K0L A;  5IQ1 A;  4LU6 A;  3DK8 A;  1E1K A;  1LV0 A;  3IHG A;  1GRB A;  2OLN A;  4FX9 A;  3UP4 A;  2C75 A;  2GR3 A;  3AED A;  4LA1 A;  3I3L A;  3RP6 A;  3SM8 A;  1PS9 A;  3DK9 A;  3C4A A;  2YAU A;  4J31 A;  1K0I A;  1H82 A;  2VVL A;  3CPI G;  3LZW A;  4K22 A;  4RSL A;  3NIX A;  4EQR A;  4Z2R A;  2C64 A;  4H2R A;  2B9X A;  4U2S A;  4B65 A;  2R4E A;  5U1O A;  1E1L A;  2WU2 A;  5FS7 A;  4JY2 A;  3CIR A;  2GMH A;  1GET A;  2YLT A;  5KVH A;  5BUL A;  1Z6L A;  3EF6 A;  2WEU A;  2O9Z A;  1CHU A;  2XLS A;  3UKF A;  1K4Q A;  1YQZ A;  3ISH A;  2H89 A;  4BJY A;  1NAA A;  4K7Z A;  3GDN A;  3IHM A;  1IUX A;  1YY5 A;  2BC0 A;  1PBE A;  4CCQ A;  5IPY A;  3UP5 A;  3B6D A;  4Z2U A;  1TYT A;  2BK4 A;  2GR2 A;  3FBS A;  1CC6 A;  2C66 A;  1DOC A;  1D7Y A;  5KOW A;  1EBD A;  5KXJ A;  2W0H A;  2GAG B;  4ZN0 A;  3GWF A;  3P1W A;  5J7X A;  3LXD A;  4Y4M A;  4K8D A;  3GSI A;  3DJE A;  4H4T A;  4NZH A;  1S3B A; 
#chains in the Genus database with same CATH topology
 1JU2 A;  1TDN A;  2GB0 A;  4EM3 A;  1LPF A;  3QSS A;  2Q0K A;  2TPR A;  2YLZ A;  1JRX A;  2CVJ A;  3P4Q A;  3M13 A;  2GQF A;  4JNQ A;  2R46 A;  3UTE A;  1D4C A;  3SGL A;  3KA7 A;  3VR9 A;  2OA1 A;  2Y6Q A;  4UDQ A;  1E1N A;  2XDO A;  4GAV A;  4Z26 A;  5HY5 A;  3CNJ A;  1TDO A;  4XXG A;  3SZF A;  4DNA A;  2EQ7 A;  2BAB A;  4IVO B;  3SX6 A;  2YG4 A;  2B7R A;  4ICY A;  3D1C A;  2X8C A;  4CY6 A;  1IUW A;  5EOW A;  1CJC A;  2GMJ A;  5HHF A;  2YLR A;  2OLO A;  3PO7 A;  2QA1 A;  1DJN A;  1IUS A;  3GD3 A;  3UTG A;  3UTH A;  1OJ9 A;  5HYM A;  2XFN A;  4K5R A;  3ADA B;  2VRM A;  2DKI A;  3ABV A;  2WQY A;  3AXB A;  3T0K A;  1YQ4 A;  2Q7V A;  1GRG A;  4D03 A;  4Y4N A;  4KPR A;  1V59 A;  2GV8 A;  1GRT A;  2Q0L A;  3ALJ A;  4XWZ A;  3PVC A;  4EIP A;  4WX1 A;  2C70 A;  4BV6 A;  1VQW A;  2YR4 A;  4OPL A;  1E7P A;  4AT2 A;  3V76 A;  1JRY A;  2GVC A;  3KU9 A;  2WOV A;  3GRT A;  3SXI A;  1GRF A;  2YR5 A;  5KMS A;  4GDE A;  4PAA A;  3RNM A;  1PXC A;  1O5W A;  1GT8 A;  4H2Q A;  5TR3 A;  3GDP A;  2XVJ A;  1GSN A;  2C65 A;  1E1M A;  2EQ6 A;  4IV9 A;  1JOA A;  3UOY A;  1GTE A;  3HZL A;  3SFE A;  1VDC A;  3E1T A;  2YLS A;  2BRA A;  4TLX A;  2GAH B;  5KMR A;  2IID A;  2YVJ A;  4EMJ A;  3BHF A;  2A89 A;  3NT6 A;  1S3E A;  4Z25 A;  2WDR A;  4OPT A;  4A9W A;  1JRZ A;  2ARD A;  3LJP A;  4H4R A;  2WOI A;  1P2H A;  4I58 A;  5CQF A;  3UKA A;  3FMW A;  2F5Z A;  3UTF A;  1H83 A;  2NVK X;  4ECH A;  5JCL A;  3LOV A;  1EL7 A;  1O94 A;  2X8G A;  3CTY A;  3DH9 A;  4ADW A;  4CNK A;  1TRB A;  4CBQ A;  2V61 A;  3KKJ A;  3RP7 A;  4JQ9 A;  1KSU A;  3CGC A;  4C5O A;  3DJJ A;  5BUK A;  1FOH A;  5C3J A;  4YSH A;  1ZX9 A;  2GEW A;  4EMI A;  2QCU A;  1L9C A;  4NNJ A;  1JNZ A;  3BI5 A;  1REO A;  4C3Y A;  2WPC A;  3CND A;  3M0O A;  2X99 A;  2FBW A;  1IUU A;  3NK1 X;  1W4X A;  2WS3 A;  3AE5 A;  5M0Z A;  2R0G A;  1H7W A;  4JNA A;  4TLZ A;  2VZ2 A;  1EL5 A;  3WE0 A;  5HXI A;  4H4X A;  1KSS A;  4USQ A;  2Y6R A;  1NHP A;  3AB1 A;  3R9U A;  3NYE A;  3QJ4 A;  2EQ9 A;  2BXR A;  1CJ4 A;  4YTP A;  2WDQ A;  3P4S A;  3NNE A;  1BF3 A;  1NHS A;  1L9E A;  4OPI A;  4BJZ A;  2AQJ A;  2QA2 A;  1D4E A;  1JEH A;  2A87 A;  3AE6 A;  4O5U A;  4OVI A;  1ZOV A;  4A6N A;  4H4Y A;  3UOX A;  1FEC A;  1DJQ A;  1ZY8 A;  1LJ1 A;  3AEF A;  1ZMC A;  3Q6J A;  1DNC A;  4U8L A;  2V5Z A;  3M12 A;  1IJH A;  2GH5 A;  3K7M X;  5J60 A;  2BC1 A;  4RG4 A;  3CPH G;  3IC9 A;  3DME A;  1VRQ B;  3FIM B;  3II4 A;  2V3A A;  3V3O A;  5FS9 A;  1JNR A;  1N4U A;  3UKL A;  5BRT A;  4DGK A;  3AE7 A;  4GRT A;  1DOB A;  4II2 A;  3QVP A;  2YG5 A;  2BS3 A;  1CJ3 A;  1GES A;  2CDU A;  1CC2 A;  3BHK A;  3HYW A;  3HYX A;  4J2W A;  4EQW A;  1IUV A;  1S2Q A;  1Y0P A;  3UCL A;  4YTM A;  3QSM A;  2GR1 A;  3NH3 X;  1KNR A;  4DSG A;  3UKH A;  3ALM A;  4YSY A;  2IVE A;  1BKW A;  4TM3 A;  1YQ3 A;  1ZP0 A;  3FPZ A;  1ELI A;  2YVG A;  4N9X A;  1S2Y A;  1FEA A;  2HQM A;  4M52 A;  4II3 A;  2VQ7 A;  3ZYX A;  1RYI A;  2CFY A;  4OPG A;  4X9M A;  2WOW A;  5BVA A;  5EB4 A;  1GRH A;  2VVM A;  4BK3 A;  2ZZB A;  1F8W A;  1LQU A;  4H4Z A;  4J33 A;  4J34 A;  4U2L A;  1FCD A;  4YT0 A;  3AYJ A;  3AEA A;  2UZZ A;  2NPX A;  3UOV A;  1PBF A;  3CGB A;  1VG0 A;  5GSN A;  2XFU A;  3T2Z A;  5KMQ A;  4B68 A;  5U25 A;  3CNT A;  4FDC B;  3JSK A;  3P4P A;  2JKC A;  1VG9 A;  4B69 A;  3SQP A;  1BWC A;  2WPF A;  3QFB A;  4FK1 C;  1L9D A;  3H8I A;  2Z5Y A;  3IF9 A;  3GD4 A;  3SZC A;  4D04 A;  4TM1 A;  4A7A A;  5JCM A;  3QSE A;  1OJC A;  3KVE A;  2GR0 A;  2C73 A;  1XAN A;  3NTD A;  4U8N A;  1NEK A;  1HYU A;  2R0C A;  3UKK A;  1PBB A;  2Q6U A;  3KD9 A;  2YLW A;  2PHH A;  1N1P A;  1GTH A;  2C7G A;  2ZZC A;  1CF3 A;  2JK6 A;  3T2Y A;  1Q1R A;  4UDR A;  4Z44 A;  2XLU A;  4IVM B;  2JB1 A;  2BXS A;  4NTE A;  4GF7 A;  4EQS A;  2CUL A;  4LII A;  1NHR A;  2FJD A;  4X4J A;  1PXA A;  3AEE A;  1O95 A;  5FS6 A;  1EL9 A;  3QFA A;  4G6G A;  3UOZ A;  3VR8 A;  2VRL A;  2WP9 A;  2XVF A;  1BGJ A;  1RSG A;  3LB8 A;  4C77 A;  3L8K A;  3CNP A;  3VQR A;  4C74 A;  3NYC A;  4Z43 A;  3BI4 A;  4B66 A;  3GYJ A;  4HA6 A;  4GDP A;  4Y4L A;  3RHA A;  3VRA A;  4H4U A;  4UP3 A;  4B63 A;  3SY4 A;  3URH A;  1LQT A;  3P4R A;  3F8R A;  4XWR A;  3VRD B;  2J3N A;  3AE8 A;  1E39 A;  2EQ8 A;  4BK1 A;  1OJT A;  3AD7 B;  4BK2 A;  3CGE A;  2WPE A;  1YKJ A;  2XVH A;  2XLP A;  3GMC A;  3GRS A;  4NTD A;  4HB9 A;  3ATR A;  4Z24 A;  1CJ2 A;  3NHO X;  3KLJ A;  1NPX A;  3NRN A;  5JCN A;  3BNM A;  1XPQ A;  1RP0 A;  3AE3 A;  3G5Q A;  4OCG A;  1PDH A;  3AWI A;  1PJ5 A;  4BUR A;  1Q9I A;  1F6M A;  2AAQ A;  2XFO A;  3Q9T A;  1QO8 A;  2YVF A;  1XDI A;  2BK3 A;  2JAE A;  2B7S A;  1K0J A;  3GWD A;  4J56 A;  5U63 A;  5JCK A;  4KX6 A;  2RAB A;  4NWZ A;  3SYI A;  2X8H A;  3DGH A;  4GR1 A;  4JN9 A;  4JY3 A;  2BCG G;  5KWF A;  4OPD A;  3B3R A;  2FJE A;  2YG3 A;  4O5Q A;  1GER A;  1M64 A;  3DA1 A;  4H4W A;  4J36 A;  2JB3 A;  2VQB A;  4CY8 A;  3K7Q X;  1B4V A;  1DXL A;  1TDK A;  4AP1 A;  4YSX A;  3EAO A;  1GEU A;  4H4Q A;  3UKP A;  3S5W A;  1LTX R;  1D5T A;  1D7L A;  1SEZ A;  2GQW A;  2JBV A;  4A79 A;  3AE9 A;  3LAD A;  4H4V A;  1FL2 A;  1GRE A;  3ALL A;  2BRY A;  2E4G A;  5DBJ A;  4A5L A;  5KNL A;  3CPJ G;  2C72 A;  2RGH A;  4G9K A;  4IA5 A;  4TM0 A;  2R45 A;  5ER0 A;  2XCG A;  1NDA A;  2X50 A;  2YM2 A;  2C76 A;  3AE1 A;  4H2P A;  4U8M A;  5FS8 A;  4CNJ A;  1LVL A;  1GND A;  2JB2 A;  1DOE A;  3PS9 A;  2A8X A;  3S61 A;  1TDE A;  1GOS A;  4GCM A;  4AOX A;  2B9Y A;  2XVI A;  1N4W A;  3NG7 X;  2RGJ A;  1GPE A;  4EMW A;  2ZZ0 A;  4YKG A;  2ZBW A;  3DJG X;  4EQX A;  4YTN A;  2BK5 A;  4WCT A;  1H86 A;  1ZKQ A;  1IUT A;  1GAL A;  3NTA A;  3RP8 A;  4AP3 A;  2VOU A;  4UDP A;  1PHH A;  5M10 A;  5KMP A;  3AD8 B;  4MJW A;  4G73 A;  3DJD A;  1H7X A;  3NKS A;  4JDR A;  4REK A;  2BS2 A;  4YXD A;  1AOG A;  4OPU A;  3C96 A;  4H4P A;  3SZW A;  5C2T A;  2YG7 A;  4EM4 A;  4Z2T A;  3F8D A;  4H2N A;  3DGZ A;  4U8P A;  3NN0 X;  4USR A;  1Q1W A;  1D4D A;  2WP6 A;  3QVR A;  4RG3 A;  4EIQ A;  5LV9 A;  1H6V A;  2YQU A;  4AT0 A;  3NK2 X;  4A99 A;  2YWL A;  4ZCC A;  2OAM A;  1F8R A;  2OAL A;  2WU5 A;  3COX A;  3CMM A;  2GRT A;  2R0P A;  5L46 A;  2BCP A;  2XFQ A;  1XHC A;  3AYL A;  3P9U A;  2BA9 A;  1GRA A;  2V3B A;  2ACZ A;  2WDV A;  2FJB A;  2V60 A;  1Y56 B;  3NK0 X;  5JCI A;  2V6O A;  3CGD A;  4OPC A;  2IVD A;  2WP5 A;  1GXF A;  1OJA A;  2FJA A;  1PJ6 A;  3V3N A;  1ZOY A;  3H8L A;  3NLC A;  1H81 A;  1MO9 A;  3AEB A;  1ZDL A;  2I0Z A;  3ATQ A;  4CCR A;  3SZ0 A;  1NG3 A;  1UKV G;  2BAC A;  3AEG A;  2E1M A;  1EL8 A;  5KRQ A;  3IWA A;  3AEC A;  4B67 A;  4ZCD A;  5KVI A;  2B76 A;  1H84 A;  3H4K A;  4NTC A;  1PBD A;  3T14 A;  5KOX A;  1B37 A;  2XFP A;  2PYX A;  4U8J A;  2XYO A;  3AE4 A;  4G74 A;  4PAB A;  1QJD A;  2YLX A;  2C67 A;  4GUV A;  1MOK A;  2C3D A;  2TMD A;  2X3N A;  2YM1 A;  2Z5X A;  2E5V A;  2R4J A;  3BI2 A;  3ZDN A;  3K30 A;  4APN A;  3VRB A;  4I59 A;  3NYF A;  2XLR A;  1L0V A;  1OJD A;  1DOD A;  4U2T A;  3UKQ A;  4YWO A;  1ZK7 A;  1NEN A;  2WHD A;  2WBA A;  4U8K A;  1E6E A;  2VVL G;  4IA6 A;  4YKF A;  1GV4 A;  3EPT A;  3L1R A;  4J57 A;  2GF3 A;  2RGO A;  3OC4 A;  4X9N A;  1COY A;  1KDG A;  1TYP A;  2QAE A;  3AD9 B;  4U8I A;  4NEW A;  4H7U A;  5IQ4 A;  4E0V A;  4NEV A;  3CN8 A;  3G5R A;  1F3P A;  1KFY A;  2XVE A;  1X31 B;  3C4N A;  2WES A;  2WET A;  1MXT A;  3CNS A;  3AE2 A;  3OZ2 A;  5FMH A;  1PJ7 A;  1B5Q A;  4K2X A;  1N4V A;  4K5S A;  1B8S A;  3D8X A;  3G5S A;  3LZX A;  1ONF A;  5EBK A;  3EAN A;  1PXB A;  1CC4 A;  2B9W A;  2H88 A;  1NHQ A;  4A65 A;  4FK1 A;  1KNP A;  3HYV A;  2AR8 A;  3KPF A;  5CKU A;  3T2K A;  4B1B A;  1P2E A;  1Y56 A;  1PN0 A;  4TM4 A;  1NG4 A;  3GYI A;  4H50 A;  2YG6 A;  3ITJ A;  1PBC A;  3KPK A;  4YSZ A;  2APG A;  5EB5 A;  1QLB A;  4H4S A;  3FG2 P;  3GMB A;  3RED A;  3T37 A;  3BNU A;  4B64 A;  2BYB A;  4A6N B;  2C3C A;  3I6D A;  1KF6 A;  1ZMD A;  2BS4 A;  1M6I A;  1F8S A;  3ICS A;  3ICT A;  3SFD A;  3ICR A;  3K7T A;  2DKH A;  3NGC X;  1CBO A;  3DK4 A;  2YR6 A;  4P9S A;  4AOS A;  3GYX A;  2XLT A;  3AYI A;  3F8P A;  4C3X A;  1BZL A;  2R9Z A;  4U8O A;  3O0H A;  3NN6 X;  4G6H A;  5GRT A;  1TDF A;  1FEB A;  1BGN A;  4DSH A;  4CRT A;  1CL0 A;  1K0L A;  5IQ1 A;  4LU6 A;  3DK8 A;  1E1K A;  1LV0 A;  3IHG A;  1GRB A;  2OLN A;  4FX9 A;  3UP4 A;  2C75 A;  2GR3 A;  3AED A;  4LA1 A;  3I3L A;  3RP6 A;  3SM8 A;  1PS9 A;  2C4C A;  3DK9 A;  3C4A A;  2YAU A;  4J31 A;  1K0I A;  1H82 A;  2VVL A;  3CPI G;  3LZW A;  4K22 A;  4RSL A;  3NIX A;  4EQR A;  4Z2R A;  2C64 A;  4H2R A;  2B9X A;  4U2S A;  4B65 A;  2R4E A;  5U1O A;  1E1L A;  2WU2 A;  5FS7 A;  4JY2 A;  3CIR A;  2GMH A;  1GET A;  2YLT A;  5KVH A;  5BUL A;  1Z6L A;  3EF6 A;  2WEU A;  2O9Z A;  1CHU A;  2XLS A;  3UKF A;  1K4Q A;  1YQZ A;  3ISH A;  2H89 A;  4BJY A;  1NAA A;  4K7Z A;  3GDN A;  3IHM A;  1IUX A;  1YY5 A;  2BC0 A;  1PBE A;  4CCQ A;  5IPY A;  3UP5 A;  3B6D A;  4Z2U A;  1TYT A;  2BK4 A;  2GR2 A;  3FBS A;  1CC6 A;  2C66 A;  1DOC A;  1D7Y A;  5KOW A;  1EBD A;  3T31 A;  5KXJ A;  2W0H A;  2GAG B;  4ZN0 A;  3GWF A;  3P1W A;  5J7X A;  4GAP A;  3LXD A;  4Y4M A;  4K8D A;  3GSI A;  3DJE A;  4H4T A;  4NZH A;  1S3B A; 
#chains in the Genus database with same CATH homology
 1JU2 A;  1TDN A;  2GB0 A;  4EM3 A;  1LPF A;  3QSS A;  2Q0K A;  2TPR A;  2YLZ A;  1JRX A;  2CVJ A;  3P4Q A;  3M13 A;  2GQF A;  4JNQ A;  2R46 A;  3UTE A;  1D4C A;  3SGL A;  3KA7 A;  3VR9 A;  2OA1 A;  2Y6Q A;  4UDQ A;  1E1N A;  2XDO A;  4GAV A;  4Z26 A;  5HY5 A;  3CNJ A;  1TDO A;  4XXG A;  3SZF A;  4DNA A;  2EQ7 A;  2BAB A;  4IVO B;  3SX6 A;  2YG4 A;  2B7R A;  4ICY A;  3D1C A;  2X8C A;  4CY6 A;  1IUW A;  5EOW A;  1CJC A;  2GMJ A;  5HHF A;  2YLR A;  2OLO A;  3PO7 A;  2QA1 A;  1DJN A;  1IUS A;  3GD3 A;  3UTG A;  3UTH A;  1OJ9 A;  5HYM A;  2XFN A;  4K5R A;  3ADA B;  2VRM A;  2DKI A;  3ABV A;  2WQY A;  3AXB A;  3T0K A;  1YQ4 A;  2Q7V A;  1GRG A;  4D03 A;  4Y4N A;  4KPR A;  1V59 A;  2GV8 A;  1GRT A;  2Q0L A;  3ALJ A;  4XWZ A;  3PVC A;  4EIP A;  4WX1 A;  2C70 A;  4BV6 A;  1VQW A;  2YR4 A;  4OPL A;  1E7P A;  4AT2 A;  3V76 A;  1JRY A;  2GVC A;  3KU9 A;  2WOV A;  3GRT A;  3SXI A;  1GRF A;  2YR5 A;  5KMS A;  4GDE A;  4PAA A;  3RNM A;  1PXC A;  1O5W A;  1GT8 A;  4H2Q A;  5TR3 A;  3GDP A;  2XVJ A;  1GSN A;  2C65 A;  1E1M A;  2EQ6 A;  4IV9 A;  1JOA A;  3UOY A;  1GTE A;  3HZL A;  3SFE A;  1VDC A;  3E1T A;  2YLS A;  2BRA A;  4TLX A;  2GAH B;  5KMR A;  2IID A;  2YVJ A;  4EMJ A;  3BHF A;  2A89 A;  3NT6 A;  1S3E A;  4Z25 A;  2WDR A;  4OPT A;  4A9W A;  1JRZ A;  2ARD A;  3LJP A;  4H4R A;  2WOI A;  1P2H A;  4I58 A;  5CQF A;  3UKA A;  3FMW A;  2F5Z A;  3UTF A;  1H83 A;  2NVK X;  4ECH A;  5JCL A;  3LOV A;  1EL7 A;  1O94 A;  2X8G A;  3CTY A;  3DH9 A;  4ADW A;  4CNK A;  1TRB A;  4CBQ A;  2V61 A;  3KKJ A;  3RP7 A;  4JQ9 A;  1KSU A;  3CGC A;  4C5O A;  3DJJ A;  5BUK A;  1FOH A;  5C3J A;  4YSH A;  1ZX9 A;  2GEW A;  4EMI A;  2QCU A;  1L9C A;  4NNJ A;  1JNZ A;  3BI5 A;  1REO A;  4C3Y A;  2WPC A;  3CND A;  3M0O A;  2X99 A;  2FBW A;  1IUU A;  3NK1 X;  1W4X A;  2WS3 A;  3AE5 A;  5M0Z A;  2R0G A;  1H7W A;  4JNA A;  4TLZ A;  2VZ2 A;  1EL5 A;  3WE0 A;  5HXI A;  4H4X A;  1KSS A;  4USQ A;  2Y6R A;  1NHP A;  3AB1 A;  3R9U A;  3NYE A;  3QJ4 A;  2EQ9 A;  2BXR A;  1CJ4 A;  4YTP A;  2WDQ A;  3P4S A;  3NNE A;  1BF3 A;  1NHS A;  1L9E A;  4OPI A;  4BJZ A;  2AQJ A;  2QA2 A;  1D4E A;  1JEH A;  2A87 A;  3AE6 A;  4O5U A;  4OVI A;  1ZOV A;  4A6N A;  4H4Y A;  3UOX A;  1FEC A;  1DJQ A;  1ZY8 A;  1LJ1 A;  3AEF A;  1ZMC A;  3Q6J A;  1DNC A;  4U8L A;  2V5Z A;  3M12 A;  1IJH A;  2GH5 A;  3K7M X;  5J60 A;  2BC1 A;  4RG4 A;  3CPH G;  3IC9 A;  3DME A;  1VRQ B;  3FIM B;  3II4 A;  2V3A A;  3V3O A;  5FS9 A;  1JNR A;  1N4U A;  3UKL A;  5BRT A;  4DGK A;  3AE7 A;  4GRT A;  1DOB A;  4II2 A;  3QVP A;  2YG5 A;  2BS3 A;  1CJ3 A;  1GES A;  2CDU A;  1CC2 A;  3BHK A;  3HYW A;  3HYX A;  4J2W A;  4EQW A;  1IUV A;  1S2Q A;  1Y0P A;  3UCL A;  4YTM A;  3QSM A;  2GR1 A;  3NH3 X;  1KNR A;  4DSG A;  3UKH A;  3ALM A;  4YSY A;  2IVE A;  1BKW A;  4TM3 A;  1YQ3 A;  1ZP0 A;  3FPZ A;  1ELI A;  2YVG A;  4N9X A;  1S2Y A;  1FEA A;  2HQM A;  4M52 A;  4II3 A;  2VQ7 A;  3ZYX A;  1RYI A;  2CFY A;  4OPG A;  4X9M A;  2WOW A;  5BVA A;  5EB4 A;  1GRH A;  2VVM A;  4BK3 A;  2ZZB A;  1F8W A;  1LQU A;  4H4Z A;  4J33 A;  4J34 A;  4U2L A;  1FCD A;  4YT0 A;  3AYJ A;  3AEA A;  2UZZ A;  2NPX A;  3UOV A;  1PBF A;  3CGB A;  1VG0 A;  5GSN A;  2XFU A;  3T2Z A;  5KMQ A;  4B68 A;  5U25 A;  3CNT A;  4FDC B;  3JSK A;  3P4P A;  2JKC A;  1VG9 A;  4B69 A;  3SQP A;  1BWC A;  2WPF A;  3QFB A;  4FK1 C;  1L9D A;  3H8I A;  2Z5Y A;  3IF9 A;  3GD4 A;  3SZC A;  4D04 A;  4TM1 A;  4A7A A;  5JCM A;  3QSE A;  1OJC A;  3KVE A;  2GR0 A;  2C73 A;  1XAN A;  3NTD A;  4U8N A;  1NEK A;  1HYU A;  2R0C A;  3UKK A;  1PBB A;  2Q6U A;  3KD9 A;  2YLW A;  2PHH A;  1N1P A;  1GTH A;  2C7G A;  2ZZC A;  1CF3 A;  2JK6 A;  3T2Y A;  1Q1R A;  4UDR A;  4Z44 A;  2XLU A;  4IVM B;  2JB1 A;  2BXS A;  4NTE A;  4GF7 A;  4EQS A;  2CUL A;  4LII A;  1NHR A;  2FJD A;  4X4J A;  1PXA A;  3AEE A;  1O95 A;  5FS6 A;  1EL9 A;  3QFA A;  4G6G A;  3UOZ A;  3VR8 A;  2VRL A;  2WP9 A;  2XVF A;  1BGJ A;  1RSG A;  3LB8 A;  4C77 A;  3L8K A;  3CNP A;  3VQR A;  4C74 A;  3NYC A;  4Z43 A;  3BI4 A;  4B66 A;  3GYJ A;  4HA6 A;  4GDP A;  4Y4L A;  3RHA A;  3VRA A;  4H4U A;  4UP3 A;  4B63 A;  3SY4 A;  3URH A;  1LQT A;  3P4R A;  3F8R A;  4XWR A;  3VRD B;  2J3N A;  3AE8 A;  1E39 A;  2EQ8 A;  4BK1 A;  1OJT A;  3AD7 B;  4BK2 A;  3CGE A;  2WPE A;  1YKJ A;  2XVH A;  2XLP A;  3GMC A;  3GRS A;  4NTD A;  4HB9 A;  3ATR A;  4Z24 A;  1CJ2 A;  3NHO X;  3KLJ A;  1NPX A;  3NRN A;  5JCN A;  3BNM A;  1XPQ A;  1RP0 A;  3AE3 A;  3G5Q A;  4OCG A;  1PDH A;  3AWI A;  1PJ5 A;  4BUR A;  1Q9I A;  1F6M A;  2AAQ A;  2XFO A;  3Q9T A;  1QO8 A;  2YVF A;  1XDI A;  2BK3 A;  2JAE A;  2B7S A;  1K0J A;  3GWD A;  4J56 A;  5U63 A;  5JCK A;  4KX6 A;  2RAB A;  4NWZ A;  3SYI A;  2X8H A;  3DGH A;  4GR1 A;  4JN9 A;  4JY3 A;  2BCG G;  5KWF A;  4OPD A;  3B3R A;  2FJE A;  2YG3 A;  4O5Q A;  1GER A;  1M64 A;  3DA1 A;  4H4W A;  4J36 A;  2JB3 A;  2VQB A;  4CY8 A;  3K7Q X;  1B4V A;  1DXL A;  1TDK A;  4AP1 A;  4YSX A;  3EAO A;  1GEU A;  4H4Q A;  3UKP A;  3S5W A;  1LTX R;  1D5T A;  1D7L A;  1SEZ A;  2GQW A;  2JBV A;  4A79 A;  3AE9 A;  3LAD A;  4H4V A;  1FL2 A;  1GRE A;  3ALL A;  2BRY A;  2E4G A;  5DBJ A;  4A5L A;  5KNL A;  3CPJ G;  2C72 A;  2RGH A;  4G9K A;  4IA5 A;  4TM0 A;  2R45 A;  5ER0 A;  2XCG A;  1NDA A;  2X50 A;  2YM2 A;  2C76 A;  3AE1 A;  4H2P A;  4U8M A;  5FS8 A;  4CNJ A;  1LVL A;  1GND A;  2JB2 A;  1DOE A;  3PS9 A;  2A8X A;  3S61 A;  1TDE A;  1GOS A;  4GCM A;  4AOX A;  2B9Y A;  2XVI A;  1N4W A;  3NG7 X;  2RGJ A;  1GPE A;  4EMW A;  2ZZ0 A;  4YKG A;  2ZBW A;  3DJG X;  4EQX A;  4YTN A;  2BK5 A;  4WCT A;  1H86 A;  1ZKQ A;  1IUT A;  1GAL A;  3NTA A;  3RP8 A;  4AP3 A;  2VOU A;  4UDP A;  1PHH A;  5M10 A;  5KMP A;  3AD8 B;  4MJW A;  4G73 A;  3DJD A;  1H7X A;  3NKS A;  4JDR A;  4REK A;  2BS2 A;  4YXD A;  1AOG A;  4OPU A;  3C96 A;  4H4P A;  3SZW A;  5C2T A;  2YG7 A;  4EM4 A;  4Z2T A;  3F8D A;  4H2N A;  3DGZ A;  4U8P A;  3NN0 X;  4USR A;  1Q1W A;  1D4D A;  2WP6 A;  3QVR A;  4RG3 A;  4EIQ A;  5LV9 A;  1H6V A;  2YQU A;  4AT0 A;  3NK2 X;  4A99 A;  2YWL A;  4ZCC A;  2OAM A;  1F8R A;  2OAL A;  2WU5 A;  3COX A;  3CMM A;  2GRT A;  2R0P A;  5L46 A;  2BCP A;  2XFQ A;  1XHC A;  3AYL A;  3P9U A;  2BA9 A;  1GRA A;  2V3B A;  2ACZ A;  2WDV A;  2FJB A;  2V60 A;  1Y56 B;  3NK0 X;  5JCI A;  2V6O A;  3CGD A;  4OPC A;  2IVD A;  2WP5 A;  1GXF A;  1OJA A;  2FJA A;  1PJ6 A;  3V3N A;  1ZOY A;  3H8L A;  3NLC A;  1H81 A;  1MO9 A;  3AEB A;  1ZDL A;  2I0Z A;  3ATQ A;  4CCR A;  3SZ0 A;  1NG3 A;  1UKV G;  2BAC A;  3AEG A;  2E1M A;  1EL8 A;  5KRQ A;  3IWA A;  3AEC A;  4B67 A;  4ZCD A;  5KVI A;  2B76 A;  1H84 A;  3H4K A;  4NTC A;  1PBD A;  3T14 A;  5KOX A;  1B37 A;  2XFP A;  2PYX A;  4U8J A;  2XYO A;  3AE4 A;  4G74 A;  4PAB A;  1QJD A;  2YLX A;  2C67 A;  4GUV A;  1MOK A;  2C3D A;  2TMD A;  2X3N A;  2YM1 A;  2Z5X A;  2E5V A;  2R4J A;  3BI2 A;  3ZDN A;  3K30 A;  4APN A;  3VRB A;  4I59 A;  3NYF A;  2XLR A;  1L0V A;  1OJD A;  1DOD A;  4U2T A;  3UKQ A;  4YWO A;  1ZK7 A;  1NEN A;  2WHD A;  2WBA A;  4U8K A;  1E6E A;  2VVL G;  4IA6 A;  4YKF A;  1GV4 A;  3EPT A;  3L1R A;  4J57 A;  2GF3 A;  2RGO A;  3OC4 A;  4X9N A;  1COY A;  1KDG A;  1TYP A;  2QAE A;  3AD9 B;  4U8I A;  4NEW A;  4H7U A;  5IQ4 A;  4E0V A;  4NEV A;  3CN8 A;  3G5R A;  1F3P A;  1KFY A;  2XVE A;  1X31 B;  3C4N A;  2WES A;  2WET A;  1MXT A;  3CNS A;  3AE2 A;  3OZ2 A;  5FMH A;  1PJ7 A;  1B5Q A;  4K2X A;  1N4V A;  4K5S A;  1B8S A;  3D8X A;  3G5S A;  3LZX A;  1ONF A;  5EBK A;  3EAN A;  1PXB A;  1CC4 A;  2B9W A;  2H88 A;  1NHQ A;  4A65 A;  4FK1 A;  1KNP A;  3HYV A;  2AR8 A;  3KPF A;  5CKU A;  3T2K A;  4B1B A;  1P2E A;  1Y56 A;  1PN0 A;  4TM4 A;  1NG4 A;  3GYI A;  4H50 A;  2YG6 A;  3ITJ A;  1PBC A;  3KPK A;  4YSZ A;  2APG A;  5EB5 A;  1QLB A;  4H4S A;  3FG2 P;  3GMB A;  3RED A;  3T37 A;  3BNU A;  4B64 A;  2BYB A;  4A6N B;  2C3C A;  3I6D A;  1KF6 A;  1ZMD A;  2BS4 A;  1M6I A;  1F8S A;  3ICS A;  3ICT A;  3SFD A;  3ICR A;  3K7T A;  2DKH A;  3NGC X;  1CBO A;  3DK4 A;  2YR6 A;  4P9S A;  4AOS A;  3GYX A;  2XLT A;  3AYI A;  3F8P A;  4C3X A;  1BZL A;  2R9Z A;  4U8O A;  3O0H A;  3NN6 X;  4G6H A;  5GRT A;  1TDF A;  1FEB A;  1BGN A;  4DSH A;  4CRT A;  1CL0 A;  1K0L A;  5IQ1 A;  4LU6 A;  3DK8 A;  1E1K A;  1LV0 A;  3IHG A;  1GRB A;  2OLN A;  4FX9 A;  3UP4 A;  2C75 A;  2GR3 A;  3AED A;  4LA1 A;  3I3L A;  3RP6 A;  3SM8 A;  1PS9 A;  2C4C A;  3DK9 A;  3C4A A;  2YAU A;  4J31 A;  1K0I A;  1H82 A;  2VVL A;  3CPI G;  3LZW A;  4K22 A;  4RSL A;  3NIX A;  4EQR A;  4Z2R A;  2C64 A;  4H2R A;  2B9X A;  4U2S A;  4B65 A;  2R4E A;  5U1O A;  1E1L A;  2WU2 A;  5FS7 A;  4JY2 A;  3CIR A;  2GMH A;  1GET A;  2YLT A;  5KVH A;  5BUL A;  1Z6L A;  3EF6 A;  2WEU A;  2O9Z A;  1CHU A;  2XLS A;  3UKF A;  1K4Q A;  1YQZ A;  3ISH A;  2H89 A;  4BJY A;  1NAA A;  4K7Z A;  3GDN A;  3IHM A;  1IUX A;  1YY5 A;  2BC0 A;  1PBE A;  4CCQ A;  5IPY A;  3UP5 A;  3B6D A;  4Z2U A;  1TYT A;  2BK4 A;  2GR2 A;  3FBS A;  1CC6 A;  2C66 A;  1DOC A;  1D7Y A;  5KOW A;  1EBD A;  3T31 A;  5KXJ A;  2W0H A;  2GAG B;  4ZN0 A;  3GWF A;  3P1W A;  5J7X A;  4GAP A;  3LXD A;  4Y4M A;  4K8D A;  3GSI A;  3DJE A;  4H4T A;  4NZH A;  1S3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...