2XLRA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78asp mutant
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
446
structure length
446
Chain Sequence
MATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSDGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
total genus 159
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlrA02
2BA9A 2YR5A 2BC1A 2WETA 3ATQA 1E1KA 3H8LA 4TLXA 5U25A 2WEUA 4KX6A 2CVJA 1IUVA 4UDPA 5JCIA 1Y56A 4JQ9A 1GRTA 1ZOYA 3URHA 1TDKA 4YTMA 3UKAA 1B4VA 3AYJA 1YQ3A 2BCPA 3AEBA 3NK2X 2ZZ0A 2OALA 4K8DA 4U2SA 1PXAA 2YG3A 1GALA 3VRAA 4OPDA 1GTEA 3S5WA 1JU2A 1CBOA 2BS3A 2C3CA 4YT0A 3FPZA 1F8RA 1GXFA 1H81A 1OJDA 3JSKA 4UDQA 4JNQA 2VZ2A 4K2XA 4UDRA 2WPFA 4K7ZA 3BI4A 4B64A 4BK2A 4DSHA 3GSIA 3AE2A 5KVHA 1GTHA 4CCRA 2IIDA 4H4QA 3T37A 3QVRA 1GREA 1JRXA 1LVLA 2V3BA 3AEDA 4YKFA 4DGKA 3QSSA 1TDFA 3VR9A 2APGA 2QA1A 2UZZA 4FX9A 4H4XA 3I6DA 3LZWA 4H4WA 2XLRA 1KSSA 2JB2A 4AOSA 3NT6A 1ZK7A 3CPJG 5KVIA 2BS2A 3UTGA 3VQRA 4JN9A 3ICSA 1YQ4A 4IV9A 2XDOA 3FIMB 2V61A 5EB4A 4B67A 1QJDA 4EM4A 2JKCA 4Z2UA 2V60A 3M13A 3V76A 5HXIA 1PN0A 2NPXA 4CRTA 1TYTA 1FCDA 1FL2A 2B7RA 2QA2A 1IUWA 1PJ6A 5KWFA 3BHFA 1DOBA 1PDHA 2TMDA 1S2YA 2R0PA 4IVOB 1BZLA 1V59A 1CF3A 2R4JA 1JRZA 3FG2P 3HZLA 1B37A 4H4ZA 1N4WA 1GRHA 2YM1A 3LOVA 2YLWA 2C72A 4A79A 3SQPA 4EQXA 2C70A 2YR4A 2JAEA 2FJAA 5C2TA 4D04A 3RNMA 1QO8A 1NPXA 3ICRA 2Q7VA 2WU5A 4EMWA 3RHAA 1JRYA 1GERA 3ADAB 4LU6A 1VG9A 4DNAA 1B8SA 3CPIG 5BULA 3UP5A 3NYCA 1TDNA 2HQMA 3IF9A 1L9DA 3REDA 2GMJA 2CULA 4YSHA 1EL8A 2X50A 3B6DA 4YXDA 2GAGB 4ICYA 5EB5A 4YTNA 4BV6A 4H4VA 3LZXA 2XLTA 2EQ6A 3K7QX 2Y6QA 3CN8A 1M6IA 3K30A 3M12A 4MJWA 2Q6UA 4U8PA 1DOEA 1E7PA 3DGZA 2BACA 3DK8A 4H4UA 3AD9B 4Z44A 5HY5A 3CGBA 1F3PA 2FBWA 5BUKA 1E39A 3RP7A 4B69A 1PBBA 4A7AA 3F8DA 2RABA 3NN6X 2YLXA 3VRBA 1BF3A 4DSGA 3NIXA 4GCMA 3C4AA 4A65A 2C76A 2WP5A 4OPUA 2WQYA 1D7LA 4J2WA 2I0ZA 2GMHA 3D8XA 4JNAA 2VQBA 1IUSA 2VOUA 2QCUA 3K7TA 2R4EA 3KD9A 5IQ4A 3AB1A 4C74A 4OPLA 4J56A 2BCGG 3IHMA 1PJ5A 4JY3A 4A6NA 2C66A 2Y6RA 1CHUA 3ALLA 2EQ8A 3EAOA 3G5SA 1VQWA 1O94A 1GETA 4EMIA 1K0JA 5CQFA 4C5OA 4C3YA 1H7WA 1FEBA 2ACZA 2XFOA 4J57A 3GMBA 3DH9A 4Z25A 3AE9A 3NYFA 4X9MA 1NDAA 4E0VA 3GD4A 4FK1A 2XVHA 3DJGX 2DKHA 5JCMA 3G5RA 1OJ9A 4P9SA 5FMHA 2J3NA 3II4A 3UKHA 1GOSA 3P1WA 1DJQA 2R0CA 4TM4A 4BJYA 1GRFA 1PJ7A 3PS9A 4C3XA 2RGOA 2YVGA 3DJDA 2XVEA 3L8KA 2X99A 2DKIA 1CC2A 4K5SA 2Q0KA 3K7MX 3KPFA 4RG4A 4BK3A 1MOKA 1MO9A 3BNUA 1S2QA 2OAMA 1EL5A 1UKVG 2Q0LA 3AE3A 4H4RA 4OPCA 1GESA 3NKSA 5DBJA 4YSYA 1AOGA 2C65A 1KFYA 3CIRA 2W0HA 1GRBA 4FDCB 4N9XA 5J7XA 1GRAA 4ZCCA 3UOZA 1D4DA 2XLPA 2OLNA 1L0VA 4EQWA 1L9CA 3IWAA 2X8CA 4BURA 2JBVA 1KNPA 1ZKQA 3RP6A 3NG7X 4NEVA 3SFEA 2IVEA 1BGNA 2YVJA 4PABA 2VVLA 4RG3A 4B66A 2GR3A 1PBFA 1E1MA 1FECA 2RGJA 3AYLA 1H83A 1JOAA 1SEZA 2YM2A 3BHKA 1ZDLA 3QFAA 2C3DA 3UTFA 5KXJA 3C4NA 3D1CA 4ADWA 1VRQB 1CJ3A 5J60A 1OJTA 2H89A 3AWIA 1O5WA 1NHQA 3LB8A 3AECA 4A5LA 3COXA 2BYBA 4H2NA 4GDEA 3GDPA 2YLSA 2ZBWA 2GH5A 1NHRA 4UP3A 3O0HA 1KF6A 2B7SA 3CNDA 1K0IA 3EF6A 5JCKA 1YQZA 1OJCA 1ZY8A 2H88A 1RYIA 1NHPA 1XANA 2X3NA 3VRDB 3Q6JA 5GRTA 2GQFA 2VQ7A 3ISHA 2RGHA 4OVIA 3UKKA 2ZZCA 1DJNA 1OJAA 4NTCA 3I3LA 1PXBA 3NTAA 3DMEA 2R46A 3KU9A 1CC4A 3UOVA 3CGEA 4CY8A 2CFYA 3G5QA 3NGCX 4USQA 4Z2TA 3VR8A 1TYPA 4GUVA 4HA6A 1Y0PA 4CCQA 1D4CA 2GQWA 2BK4A 3KA7A 4Z2RA 4KPRA 4H50A 1H6VA 1KNRA 1H84A 2WP6A 4GDPA 4LA1A 4X9NA 2FJEA 1S3BA 3NNEA 4EQSA 1LQTA 1BGJA 1GT8A 3GDNA 2B76A 3LJPA 3NHOX 2WHDA 1TRBA 5GSNA 1FOHA 1XHCA 5U1OA 2GEWA 3ITJA 2YG6A 3F8RA 1TDOA 3EANA 1DNCA 1KSUA 2WPCA 4H4PA 1H86A 2GRTA 4ECHA 2JB1A 3CNPA 4YTPA 2X8HA 4APNA 2BS4A 1YY5A 3DJEA 4TLZA 2YG7A 3GD3A 3NTDA 3E1TA 4FK1C 1D5TA 2BK3A 2WS3A 4Y4MA 3KVEA 1ZOVA 1ZMCA 2E4GA 4J34A 5M0ZA 1PXCA 4J33A 1ZX9A 1ELIA 1VG0A 1W4XA 3SFDA 1LQUA 4USRA 2XFPA 1BKWA 3FMWA 4O5UA 2WDRA 1E6EA 1NAAA 3KKJA 3NN0X 4XWZA 2C67A 1RP0A 2XLUA 2C75A 3DGHA 3UKLA 3NK1X 2JB3A 2X8GA 4GR1A 2PYXA 2ARDA 2WDVA 4AT2A 2GR1A 2WOWA 1DODA 3QSEA 1M64A 3AEFA 4XWRA 1IUTA 1COYA 2IVDA 4Z43A 1F6MA 1Q1WA 1TDEA 2A87A 4M52A 2YAUA 2QAEA 4NZHA 5JCLA 4U8JA 1HYUA 3NK0X 2WESA 1PBCA 1KDGA 3AXBA 2C64A 2XVIA 4AT0A 4U8IA 2BABA 5EOWA 1X31B 5JCNA 2PHHA 1IUXA 3P9UA 4YWOA 2XVJA 5KRQA 2XFNA 3Q9TA 4EM3A 4B63A 2V3AA 2GF3A 4H4YA 4AP3A 3AEGA 5C3JA 2YLTA 1NHSA 3BNMA 3M0OA 1K4QA 1XPQA 3AE1A 4X4JA 3LXDA 1GV4A 3GYIA 1D7YA 5L46A 5EBKA 1P2EA 2VVMA 3NRNA 4XXGA 4EIPA 3B3RA 2GAHB 3GRTA 4TM3A 4U8MA 5U63A 3UKFA 5ER0A 3AYIA 2GR0A 3IHGA 4ZN0A 1XDIA 4B1BA 4U2TA 3DK9A 4C77A 4U8KA 2XFQA 5TR3A 4REKA 4AP1A 4TM1A 3AE8A 1S3EA 4D03A 3GWDA 4TM0A 1CJ4A 2WBAA 1CC6A 2WP9A 3EPTA 5FS6A 2Z5YA 4BJZA 2GVCA 3L1RA 2R9ZA 3H8IA 2ZZBA 1IJHA 5FS9A 3BI5A 2BXRA 1PHHA 2BXSA 2FJDA 2AR8A 2EQ7A 4LIIA 4J36A 4OPTA 2YG4A 2B9XA 5HHFA 3ZYXA 3H4KA 1L9EA 5BVAA 1ZP0A 5IQ1A 4ZCDA 4NEWA 1DOCA 1DXLA 4EIQA 3AE5A 5HYMA 2A8XA 4GRTA 4JDRA 1LTXR 3GYJA 3UTHA 1N1PA 1E1LA 2AAQA 1BWCA 1GRGA 2R0GA 3IC9A 3GWFA 4H2QA 5BRTA 5FS8A 2Z5XA 5IPYA 3AE6A 1PBEA 1K0LA 3SGLA 3LADA 2R45A 4J31A 4K22A 3R9UA 3WE0A 2GV8A 2XFUA 2WOIA 1QLBA 2BC0A 3CNTA 4EMJA 4H2RA 1LPFA 1Z6LA 2E5VA 3QSMA 3S61A 4BK1A 1N4UA 3P4QA 1ZMDA 3QJ4A 5FS7A 3DA1A 3UKQA 4B65A 3AE4A 4JY2A 4CNKA 4A99A 3UTEA 1P2HA 3NH3X 3PVCA 3UP4A 2C7GA 4A6NB 4YSXA 3UKPA 3ABVA 2C73A 2XCGA 2XVFA 4H4SA 4WX1A 4YSZA 3PO7A 3V3NA 1N4VA 3CGDA 3NYEA 5M10A 1REOA 3CGCA 4U8NA 2O9ZA 1D4EA 2OLOA 4Z26A 4Y4NA 1CJ2A 2YLRA 2A89A 3UOYA 4Z24A 4OPIA 3AD8B 1FEAA 4B68A 1NG3A 3CPHG 3ATRA 3OZ2A 1GNDA 1B5QA 3P4SA 4CNJA 2TPRA 2WU2A 1Q1RA 1MXTA 1LV0A 1VDCA 2V5ZA 4K5RA 2JK6A 1NEKA 3F8PA 2WOVA 4U8LA 1Y56B 4GF7A 1IUUA 3AEEA 4I58A 2B9WA 5KOWA 2BK5A 4OCGA 1CL0A 4U2LA 1LJ1A 4CBQA 3AD7B 3AEAA 4RSLA 4WCTA 2VRLA 3UOXA 3NLCA 2YVFA 1Q9IA 2E1MA 3ICTA 3P4RA 3C96A 3UCLA 4CY6A 2OA1A 2YWLA 3CTYA 4H2PA 4U8OA 1RSGA 3CNSA 2YQUA 2AQJA 4OPGA 1E1NA 2VRMA 2WDQA 3QVPA 2NVKX 3QFBA 3ZDNA 3P4PA 5LV9A 2VVLG 4NTEA 1F8WA 2YG5A 4NTDA 2GB0A 1GPEA 1EL7A 2B9YA 4O5QA 3RP8A 5KOXA 3SM8A 3DK4A 2XYOA 2CDUA 4I59A 4HB9A 4PAAA 2FJBA 2YLZA 4A9WA 2YR6A 1NG4A 3GRSA 5CKUA 3KLJA 2F5ZA 1JEHA 1JNRA 1PS9A 3ALMA 3GMCA 1EBDA 3CNJA 1ONFA 1H82A 3AE7A 4AOXA 1NENA 4IA6A 1O95A 4Y4LA 1GEUA 1EL9A 1CJCA 1GSNA 1H7XA 3FBSA 3DJJA 1PBDA 4YKGA 2EQ9A 4IVMB 3ALJA 3BI2A 1JNZA 4H7UA 1F8SA 4EQRA 3OC4A 1YKJA 4H4TA 2GR2A 2XLSA 2V6OA 4IA5A 2WPEA 3V3OA
chains in the Genus database with same CATH superfamily
2BA9A 2YR5A 2BC1A 2WETA 3ATQA 1E1KA 3H8LA 4TLXA 5U25A 2WEUA 4KX6A 3T31A 2CVJA 1IUVA 4UDPA 5JCIA 1Y56A 4JQ9A 1GRTA 1ZOYA 3URHA 1TDKA 4YTMA 3UKAA 1B4VA 3AYJA 1YQ3A 2BCPA 3AEBA 3NK2X 2ZZ0A 2OALA 4K8DA 4U2SA 1PXAA 2YG3A 1GALA 3VRAA 4OPDA 1GTEA 3S5WA 1JU2A 1CBOA 2BS3A 2C3CA 4YT0A 3FPZA 1F8RA 1GXFA 1H81A 1OJDA 3JSKA 4UDQA 4JNQA 2VZ2A 4K2XA 4UDRA 2WPFA 4K7ZA 3BI4A 3T14A 3T2ZA 4B64A 3GSIA 3AE2A 4BK2A 1GTHA 4CCRA 5KVHA 2IIDA 4H4QA 3T37A 3QVRA 1GREA 1JRXA 1LVLA 2V3BA 3AEDA 4YKFA 4DGKA 3QSSA 1TDFA 4G6GA 3VR9A 2APGA 2QA1A 2UZZA 4FX9A 4H4XA 3I6DA 3LZWA 4H4WA 2XLRA 1KSSA 2JB2A 4AOSA 3NT6A 1ZK7A 3CPJG 5KVIA 2BS2A 3UTGA 3VQRA 4JN9A 3ICSA 1YQ4A 4IV9A 2XDOA 3FIMB 2V61A 5EB4A 4B67A 1QJDA 4EM4A 2JKCA 4Z2UA 2V60A 3M13A 3V76A 5HXIA 1PN0A 2NPXA 4CRTA 1TYTA 1FCDA 1FL2A 2B7RA 2QA2A 1IUWA 1PJ6A 5KWFA 3BHFA 1DOBA 1PDHA 2TMDA 1S2YA 2R0PA 4IVOB 1BZLA 1V59A 1CF3A 2R4JA 1JRZA 3FG2P 3HZLA 1B37A 4H4ZA 3T0KA 1N4WA 1GRHA 2YM1A 3LOVA 2YLWA 2C72A 4A79A 3SQPA 4EQXA 2C70A 2YR4A 3SZFA 2JAEA 2FJAA 5C2TA 4D04A 3RNMA 1QO8A 1NPXA 3ICRA 2Q7VA 2WU5A 4EMWA 3RHAA 1JRYA 1GERA 3ADAB 4LU6A 1VG9A 4DNAA 1B8SA 3CPIG 4MJWA 5BULA 3GYXA 3UP5A 3NYCA 1TDNA 2HQMA 3IF9A 1L9DA 3REDA 2GMJA 2CULA 4YSHA 1EL8A 2X50A 3B6DA 4YXDA 2GAGB 4ICYA 5EB5A 4YTNA 4BV6A 3HYVA 3LZXA 4H4VA 2XLTA 2EQ6A 3K7QX 2Y6QA 2BRYA 1M6IA 3CN8A 3K30A 3M12A 2Q6UA 4U8PA 1DOEA 1E7PA 3DGZA 2BACA 3DK8A 4H4UA 3AD9B 4Z44A 3SYIA 3SZWA 3CGBA 1F3PA 2FBWA 5BUKA 1E39A 3RP7A 4B69A 1PBBA 4A7AA 3F8DA 2RABA 3NN6X 2YLXA 3VRBA 1BF3A 4DSGA 3NIXA 4GCMA 3C4AA 4A65A 2C76A 2WP5A 4OPUA 2WQYA 1D7LA 4J2WA 2I0ZA 2GMHA 3D8XA 4JNAA 2VQBA 1IUSA 2VOUA 2QCUA 3K7TA 2R4EA 3KD9A 5IQ4A 3AB1A 4C74A 4OPLA 4J56A 2BCGG 3IHMA 1PJ5A 4JY3A 4A6NA 2C66A 2Y6RA 1CHUA 3ALLA 2EQ8A 3EAOA 3G5SA 1VQWA 1O94A 1GETA 4EMIA 1K0JA 5CQFA 4C5OA 4C3YA 1H7WA 1FEBA 2ACZA 2XFOA 4J57A 3GMBA 3DH9A 4Z25A 4II2A 3AE9A 3NYFA 4X9MA 1NDAA 4E0VA 4GAVA 3GD4A 4FK1A 2XVHA 3DJGX 5HY5A 2DKHA 5JCMA 3G5RA 1OJ9A 4P9SA 5FMHA 2J3NA 3II4A 3UKHA 1GOSA 3P1WA 1DJQA 2R0CA 4TM4A 4BJYA 1GRFA 1PJ7A 3PS9A 4C3XA 2RGOA 2YVGA 3DJDA 2XVEA 3L8KA 2X99A 2DKIA 1CC2A 4K5SA 2Q0KA 3K7MX 3KPFA 4RG4A 4BK3A 1MOKA 1MO9A 3BNUA 1S2QA 2OAMA 1EL5A 1UKVG 2Q0LA 3AE3A 4H4RA 4OPCA 1GESA 3NKSA 5DBJA 4YSYA 3SY4A 1AOGA 2C65A 1KFYA 3CIRA 2W0HA 1GRBA 4FDCB 4N9XA 3SZCA 5KNLA 5J7XA 1GRAA 4ZCCA 3UOZA 1D4DA 2XLPA 2OLNA 1L0VA 4EQWA 1L9CA 3IWAA 2X8CA 4BURA 2JBVA 1KNPA 1ZKQA 3RP6A 3NG7X 4NEVA 3SFEA 2IVEA 1BGNA 2YVJA 4PABA 2VVLA 4RG3A 4B66A 2GR3A 1PBFA 1E1MA 1FECA 2RGJA 3AYLA 1H83A 1JOAA 1SEZA 2YM2A 3BHKA 1ZDLA 3QFAA 2C3DA 3UTFA 5KXJA 3C4NA 3D1CA 4ADWA 1VRQB 1CJ3A 5J60A 1OJTA 2H89A 3AWIA 1O5WA 1NHQA 3LB8A 3AECA 4A5LA 3COXA 2BYBA 4H2NA 4GDEA 3GDPA 2YLSA 2ZBWA 2GH5A 1NHRA 4UP3A 3O0HA 1KF6A 2B7SA 3CNDA 1K0IA 3EF6A 5JCKA 1YQZA 1OJCA 1ZY8A 2H88A 1RYIA 1NHPA 1XANA 2X3NA 3VRDB 3Q6JA 5GRTA 2BRAA 2GQFA 2VQ7A 3ISHA 2RGHA 4OVIA 3UKKA 2ZZCA 1DJNA 1OJAA 4NTCA 3I3LA 1PXBA 3NTAA 3DMEA 2R46A 3KU9A 1CC4A 5KMQA 3CGEA 3T2YA 2CFYA 3UOVA 4CY8A 3G5QA 3NGCX 4USQA 4Z2TA 3VR8A 1TYPA 4GUVA 4HA6A 1Y0PA 4G6HA 1D4CA 2GQWA 4CCQA 2BK4A 3KA7A 4Z2RA 4KPRA 4H50A 1H6VA 1KNRA 1H84A 2WP6A 4GDPA 4LA1A 4X9NA 2FJEA 1S3BA 3NNEA 4EQSA 1LQTA 1BGJA 1GT8A 3GDNA 2B76A 3LJPA 3NHOX 2WHDA 1TRBA 5GSNA 1FOHA 1XHCA 5U1OA 2GEWA 3ITJA 2YG6A 3F8RA 1TDOA 3EANA 1DNCA 1KSUA 2WPCA 4H4PA 1H86A 2GRTA 4ECHA 2JB1A 3CNPA 4YTPA 2X8HA 4APNA 2BS4A 1YY5A 3DJEA 4TLZA 2YG7A 3GD3A 3NTDA 3E1TA 4FK1C 1D5TA 2BK3A 2WS3A 4Y4MA 3KVEA 1ZOVA 1ZMCA 2E4GA 4J34A 5M0ZA 1PXCA 4J33A 1ZX9A 1ELIA 3KPKA 1VG0A 1W4XA 3SFDA 1LQUA 4USRA 2XFPA 1BKWA 3FMWA 4O5UA 2WDRA 1E6EA 1NAAA 3KKJA 3NN0X 4XWZA 2C67A 1RP0A 2XLUA 2C75A 3DGHA 3UKLA 3NK1X 2JB3A 2X8GA 4GR1A 2PYXA 2ARDA 2WDVA 4AT2A 2GR1A 2WOWA 1DODA 3QSEA 1M64A 3AEFA 4XWRA 1IUTA 1COYA 2IVDA 4Z43A 1F6MA 1Q1WA 1TDEA 2A87A 4M52A 2YAUA 2QAEA 4NZHA 5JCLA 4U8JA 1HYUA 3NK0X 2WESA 1PBCA 4DSHA 1KDGA 3AXBA 2C64A 2XVIA 4AT0A 4U8IA 2BABA 5EOWA 1X31B 5JCNA 2PHHA 1IUXA 3P9UA 4YWOA 2XVJA 5KRQA 2XFNA 3Q9TA 4EM3A 4B63A 2V3AA 2GF3A 4H4YA 4AP3A 3AEGA 5C3JA 2YLTA 1NHSA 4II3A 3BNMA 3T2KA 3M0OA 1K4QA 1XPQA 3AE1A 4X4JA 3LXDA 1GV4A 3GYIA 1D7YA 5L46A 4G74A 5EBKA 1P2EA 2VVMA 3NRNA 4XXGA 4EIPA 3B3RA 2GAHB 3GRTA 4TM3A 4U8MA 5U63A 3UKFA 5ER0A 3AYIA 2GR0A 3IHGA 4ZN0A 1XDIA 4B1BA 4U2TA 3DK9A 4C77A 4U8KA 2XFQA 5TR3A 4REKA 4AP1A 4TM1A 3AE8A 1S3EA 4D03A 3GWDA 5KMSA 4TM0A 1CJ4A 2WBAA 1CC6A 2WP9A 3EPTA 5FS6A 2Z5YA 4BJZA 2GVCA 3L1RA 2R9ZA 3H8IA 2ZZBA 4NNJA 1IJHA 5FS9A 3BI5A 2BXRA 1PHHA 2BXSA 2FJDA 2AR8A 2EQ7A 4LIIA 4J36A 4OPTA 2YG4A 2B9XA 5HHFA 3ZYXA 3H4KA 3HYXA 1L9EA 5BVAA 1ZP0A 5IQ1A 4ZCDA 4NEWA 1DOCA 1DXLA 4EIQA 3AE5A 5HYMA 2A8XA 4GRTA 4JDRA 3SZ0A 1LTXR 3GYJA 3UTHA 1N1PA 1E1LA 2AAQA 1BWCA 1GRGA 2R0GA 3IC9A 3GWFA 4H2QA 5BRTA 5FS8A 2Z5XA 5IPYA 3AE6A 1PBEA 1K0LA 3SGLA 3LADA 2R45A 4J31A 4K22A 3R9UA 4NWZA 2GV8A 2XFUA 3WE0A 2WOIA 1QLBA 2BC0A 3CNTA 4EMJA 4H2RA 1LPFA 1Z6LA 2E5VA 3QSMA 3S61A 4BK1A 1N4UA 3P4QA 1ZMDA 3QJ4A 5FS7A 3DA1A 3SX6A 3UKQA 3AE4A 4JY2A 4B65A 4CNKA 4A99A 3UTEA 1P2HA 3NH3X 3PVCA 3UP4A 2C7GA 4A6NB 4YSXA 3UKPA 5KMRA 3ABVA 2C73A 2XCGA 2XVFA 4H4SA 4WX1A 4YSZA 3PO7A 3V3NA 1N4VA 3CGDA 3NYEA 5M10A 1REOA 3CGCA 4U8NA 2C4CA 1D4EA 2O9ZA 2OLOA 4Z26A 4Y4NA 1CJ2A 2YLRA 2A89A 3UOYA 4Z24A 4OPIA 3AD8B 1FEAA 4B68A 1NG3A 3CPHG 3ATRA 3OZ2A 1GNDA 1B5QA 3P4SA 4CNJA 2TPRA 2WU2A 1Q1RA 1MXTA 1LV0A 1VDCA 2V5ZA 4K5RA 2JK6A 1NEKA 3F8PA 2WOVA 4U8LA 1Y56B 4GF7A 1IUUA 3AEEA 4I58A 2B9WA 5KOWA 2BK5A 4OCGA 1CL0A 4U2LA 1LJ1A 4CBQA 3AD7B 3AEAA 4RSLA 4WCTA 4G73A 2VRLA 3UOXA 3NLCA 2YVFA 1Q9IA 2E1MA 3ICTA 3P4RA 3C96A 3UCLA 3CMMA 4CY6A 2OA1A 2YWLA 3CTYA 4H2PA 4U8OA 1RSGA 3CNSA 2YQUA 2AQJA 4OPGA 1E1NA 5KMPA 2VRMA 2WDQA 3QVPA 4GAPA 2NVKX 3QFBA 3ZDNA 3P4PA 5LV9A 2VVLG 4NTEA 1F8WA 2YG5A 4G9KA 2GB0A 1GPEA 1EL7A 2B9YA 4NTDA 4O5QA 3RP8A 5KOXA 3SM8A 3DK4A 2XYOA 2CDUA 4I59A 4HB9A 4PAAA 2FJBA 2YLZA 4A9WA 2YR6A 1NG4A 3GRSA 5CKUA 3KLJA 2F5ZA 1JEHA 1JNRA 1PS9A 3ALMA 3GMCA 1EBDA 3CNJA 1ONFA 1H82A 3AE7A 4AOXA 1NENA 4IA6A 1O95A 4Y4LA 3HYWA 1GEUA 1EL9A 1CJCA 1GSNA 1H7XA 3FBSA 3DJJA 1PBDA 3SXIA 4YKGA 2EQ9A 4IVMB 3ALJA 3BI2A 1JNZA 4H7UA 1F8SA 4EQRA 3OC4A 1YKJA 4H4TA 2GR2A 2XLSA 2V6OA 4IA5A 2WPEA 3V3OA
chains in the Genus database with same CATH topology
2BA9A 2YR5A 2BC1A 2WETA 3ATQA 1E1KA 3H8LA 4TLXA 5U25A 2WEUA 4KX6A 3T31A 2CVJA 1IUVA 4UDPA 5JCIA 1Y56A 4JQ9A 1GRTA 1ZOYA 3URHA 1TDKA 4YTMA 3UKAA 1B4VA 3AYJA 1YQ3A 2BCPA 3AEBA 3NK2X 2ZZ0A 2OALA 4K8DA 4U2SA 1PXAA 2YG3A 1GALA 3VRAA 4OPDA 1GTEA 3S5WA 1JU2A 1CBOA 2BS3A 2C3CA 4YT0A 3FPZA 1F8RA 1GXFA 1H81A 1OJDA 3JSKA 4UDQA 4JNQA 2VZ2A 4K2XA 4UDRA 2WPFA 4K7ZA 3BI4A 3T14A 3T2ZA 4B64A 3GSIA 3AE2A 4BK2A 1GTHA 4CCRA 5KVHA 2IIDA 4H4QA 3T37A 3QVRA 1GREA 1JRXA 1LVLA 2V3BA 3AEDA 4YKFA 4DGKA 3QSSA 1TDFA 4G6GA 3VR9A 2APGA 2QA1A 2UZZA 4FX9A 4H4XA 3I6DA 3LZWA 4H4WA 2XLRA 1KSSA 2JB2A 4AOSA 3NT6A 1ZK7A 3CPJG 5KVIA 2BS2A 3UTGA 3VQRA 4JN9A 3ICSA 1YQ4A 4IV9A 2XDOA 3FIMB 2V61A 5EB4A 4B67A 1QJDA 4EM4A 2JKCA 4Z2UA 2V60A 3M13A 3V76A 5HXIA 1PN0A 2NPXA 4CRTA 1TYTA 1FCDA 1FL2A 2B7RA 2QA2A 1IUWA 1PJ6A 5KWFA 3BHFA 1DOBA 1PDHA 2TMDA 1S2YA 2R0PA 4IVOB 1BZLA 1V59A 1CF3A 2R4JA 1JRZA 3FG2P 3HZLA 1B37A 4H4ZA 3T0KA 1N4WA 1GRHA 2YM1A 3LOVA 2YLWA 2C72A 4A79A 3SQPA 4EQXA 2C70A 2YR4A 3SZFA 2JAEA 2FJAA 5C2TA 4D04A 3RNMA 1QO8A 1NPXA 3ICRA 2Q7VA 2WU5A 4EMWA 3RHAA 1JRYA 1GERA 3ADAB 4LU6A 1VG9A 4DNAA 1B8SA 3CPIG 4MJWA 5BULA 3GYXA 3UP5A 3NYCA 1TDNA 2HQMA 3IF9A 1L9DA 3REDA 2GMJA 2CULA 4YSHA 1EL8A 2X50A 3B6DA 4YXDA 2GAGB 4ICYA 5EB5A 4YTNA 4BV6A 3HYVA 3LZXA 4H4VA 2XLTA 2EQ6A 3K7QX 2Y6QA 2BRYA 1M6IA 3CN8A 3K30A 3M12A 2Q6UA 4U8PA 1DOEA 1E7PA 3DGZA 2BACA 3DK8A 4H4UA 3AD9B 4Z44A 3SYIA 3SZWA 3CGBA 1F3PA 2FBWA 5BUKA 1E39A 3RP7A 4B69A 1PBBA 4A7AA 3F8DA 2RABA 3NN6X 2YLXA 3VRBA 1BF3A 4DSGA 3NIXA 4GCMA 3C4AA 4A65A 2C76A 2WP5A 4OPUA 2WQYA 1D7LA 4J2WA 2I0ZA 2GMHA 3D8XA 4JNAA 2VQBA 1IUSA 2VOUA 2QCUA 3K7TA 2R4EA 3KD9A 5IQ4A 3AB1A 4C74A 4OPLA 4J56A 2BCGG 3IHMA 1PJ5A 4JY3A 4A6NA 2C66A 2Y6RA 1CHUA 3ALLA 2EQ8A 3EAOA 3G5SA 1VQWA 1O94A 1GETA 4EMIA 1K0JA 5CQFA 4C5OA 4C3YA 1H7WA 1FEBA 2ACZA 2XFOA 4J57A 3GMBA 3DH9A 4Z25A 4II2A 3AE9A 3NYFA 4X9MA 1NDAA 4E0VA 4GAVA 3GD4A 4FK1A 2XVHA 3DJGX 5HY5A 2DKHA 5JCMA 3G5RA 1OJ9A 4P9SA 5FMHA 2J3NA 3II4A 3UKHA 1GOSA 3P1WA 1DJQA 2R0CA 4TM4A 4BJYA 1GRFA 1PJ7A 3PS9A 4C3XA 2RGOA 2YVGA 3DJDA 2XVEA 3L8KA 2X99A 2DKIA 1CC2A 4K5SA 2Q0KA 3K7MX 3KPFA 4RG4A 4BK3A 1MOKA 1MO9A 3BNUA 1S2QA 2OAMA 1EL5A 1UKVG 2Q0LA 3AE3A 4H4RA 4OPCA 1GESA 3NKSA 5DBJA 4YSYA 3SY4A 1AOGA 2C65A 1KFYA 3CIRA 2W0HA 1GRBA 4FDCB 4N9XA 3SZCA 5KNLA 5J7XA 1GRAA 4ZCCA 3UOZA 1D4DA 2XLPA 2OLNA 1L0VA 4EQWA 1L9CA 3IWAA 2X8CA 4BURA 2JBVA 1KNPA 1ZKQA 3RP6A 3NG7X 4NEVA 3SFEA 2IVEA 1BGNA 2YVJA 4PABA 2VVLA 4RG3A 4B66A 2GR3A 1PBFA 1E1MA 1FECA 2RGJA 3AYLA 1H83A 1JOAA 1SEZA 2YM2A 3BHKA 1ZDLA 3QFAA 2C3DA 3UTFA 5KXJA 3C4NA 3D1CA 4ADWA 1VRQB 1CJ3A 5J60A 1OJTA 2H89A 3AWIA 1O5WA 1NHQA 3LB8A 3AECA 4A5LA 3COXA 2BYBA 4H2NA 4GDEA 3GDPA 2YLSA 2ZBWA 2GH5A 1NHRA 4UP3A 3O0HA 1KF6A 2B7SA 3CNDA 1K0IA 3EF6A 5JCKA 1YQZA 1OJCA 1ZY8A 2H88A 1RYIA 1NHPA 1XANA 2X3NA 3VRDB 3Q6JA 5GRTA 2BRAA 2GQFA 2VQ7A 3ISHA 2RGHA 4OVIA 3UKKA 2ZZCA 1DJNA 1OJAA 4NTCA 3I3LA 1PXBA 3NTAA 3DMEA 2R46A 3KU9A 1CC4A 5KMQA 3CGEA 3T2YA 2CFYA 3UOVA 4CY8A 3G5QA 3NGCX 4USQA 4Z2TA 3VR8A 1TYPA 4GUVA 4HA6A 1Y0PA 4G6HA 1D4CA 2GQWA 4CCQA 2BK4A 3KA7A 4Z2RA 4KPRA 4H50A 1H6VA 1KNRA 1H84A 2WP6A 4GDPA 4LA1A 4X9NA 2FJEA 1S3BA 3NNEA 4EQSA 1LQTA 1BGJA 1GT8A 3GDNA 2B76A 3LJPA 3NHOX 2WHDA 1TRBA 5GSNA 1FOHA 1XHCA 5U1OA 2GEWA 3ITJA 2YG6A 3F8RA 1TDOA 3EANA 1DNCA 1KSUA 2WPCA 4H4PA 1H86A 2GRTA 4ECHA 2JB1A 3CNPA 4YTPA 2X8HA 4APNA 2BS4A 1YY5A 3DJEA 4TLZA 2YG7A 3GD3A 3NTDA 3E1TA 4FK1C 1D5TA 2BK3A 2WS3A 4Y4MA 3KVEA 1ZOVA 1ZMCA 2E4GA 4J34A 5M0ZA 1PXCA 4J33A 1ZX9A 1ELIA 3KPKA 1VG0A 1W4XA 3SFDA 1LQUA 4USRA 2XFPA 1BKWA 3FMWA 4O5UA 2WDRA 1E6EA 1NAAA 3KKJA 3NN0X 4XWZA 2C67A 1RP0A 2XLUA 2C75A 3DGHA 3UKLA 3NK1X 2JB3A 2X8GA 4GR1A 2PYXA 2ARDA 2WDVA 4AT2A 2GR1A 2WOWA 1DODA 3QSEA 1M64A 3AEFA 4XWRA 1IUTA 1COYA 2IVDA 4Z43A 1F6MA 1Q1WA 1TDEA 2A87A 4M52A 2YAUA 2QAEA 4NZHA 5JCLA 4U8JA 1HYUA 3NK0X 2WESA 1PBCA 4DSHA 1KDGA 3AXBA 2C64A 2XVIA 4AT0A 4U8IA 2BABA 5EOWA 1X31B 5JCNA 2PHHA 1IUXA 3P9UA 4YWOA 2XVJA 5KRQA 2XFNA 3Q9TA 4EM3A 4B63A 2V3AA 2GF3A 4H4YA 4AP3A 3AEGA 5C3JA 2YLTA 1NHSA 4II3A 3BNMA 3T2KA 3M0OA 1K4QA 1XPQA 3AE1A 4X4JA 3LXDA 1GV4A 3GYIA 1D7YA 5L46A 4G74A 5EBKA 1P2EA 2VVMA 3NRNA 4XXGA 4EIPA 3B3RA 2GAHB 3GRTA 4TM3A 4U8MA 5U63A 3UKFA 5ER0A 3AYIA 2GR0A 3IHGA 4ZN0A 1XDIA 4B1BA 4U2TA 3DK9A 4C77A 4U8KA 2XFQA 5TR3A 4REKA 4AP1A 4TM1A 3AE8A 1S3EA 4D03A 3GWDA 5KMSA 4TM0A 1CJ4A 2WBAA 1CC6A 2WP9A 3EPTA 5FS6A 2Z5YA 4BJZA 2GVCA 3L1RA 2R9ZA 3H8IA 2ZZBA 4NNJA 1IJHA 5FS9A 3BI5A 2BXRA 1PHHA 2BXSA 2FJDA 2AR8A 2EQ7A 4LIIA 4J36A 4OPTA 2YG4A 2B9XA 5HHFA 3ZYXA 3H4KA 3HYXA 1L9EA 5BVAA 1ZP0A 5IQ1A 4ZCDA 4NEWA 1DOCA 1DXLA 4EIQA 3AE5A 5HYMA 2A8XA 4GRTA 4JDRA 3SZ0A 1LTXR 3GYJA 3UTHA 1N1PA 1E1LA 2AAQA 1BWCA 1GRGA 2R0GA 3IC9A 3GWFA 4H2QA 5BRTA 5FS8A 2Z5XA 5IPYA 3AE6A 1PBEA 1K0LA 3SGLA 3LADA 2R45A 4J31A 4K22A 3R9UA 4NWZA 2GV8A 2XFUA 3WE0A 2WOIA 1QLBA 2BC0A 3CNTA 4EMJA 4H2RA 1LPFA 1Z6LA 2E5VA 3QSMA 3S61A 4BK1A 1N4UA 3P4QA 1ZMDA 3QJ4A 5FS7A 3DA1A 3SX6A 3UKQA 3AE4A 4JY2A 4B65A 4CNKA 4A99A 3UTEA 1P2HA 3NH3X 3PVCA 3UP4A 2C7GA 4A6NB 4YSXA 3UKPA 5KMRA 3ABVA 2C73A 2XCGA 2XVFA 4H4SA 4WX1A 4YSZA 3PO7A 3V3NA 1N4VA 3CGDA 3NYEA 5M10A 1REOA 3CGCA 4U8NA 2C4CA 1D4EA 2O9ZA 2OLOA 4Z26A 4Y4NA 1CJ2A 2YLRA 2A89A 3UOYA 4Z24A 4OPIA 3AD8B 1FEAA 4B68A 1NG3A 3CPHG 3ATRA 3OZ2A 1GNDA 1B5QA 3P4SA 4CNJA 2TPRA 2WU2A 1Q1RA 1MXTA 1LV0A 1VDCA 2V5ZA 4K5RA 2JK6A 1NEKA 3F8PA 2WOVA 4U8LA 1Y56B 4GF7A 1IUUA 3AEEA 4I58A 2B9WA 5KOWA 2BK5A 4OCGA 1CL0A 4U2LA 1LJ1A 4CBQA 3AD7B 3AEAA 4RSLA 4WCTA 4G73A 2VRLA 3UOXA 3NLCA 2YVFA 1Q9IA 2E1MA 3ICTA 3P4RA 3C96A 3UCLA 3CMMA 4CY6A 2OA1A 2YWLA 3CTYA 4H2PA 4U8OA 1RSGA 3CNSA 2YQUA 2AQJA 4OPGA 1E1NA 5KMPA 2VRMA 2WDQA 3QVPA 4GAPA 2NVKX 3QFBA 3ZDNA 3P4PA 5LV9A 2VVLG 4NTEA 1F8WA 2YG5A 4G9KA 2GB0A 1GPEA 1EL7A 2B9YA 4NTDA 4O5QA 3RP8A 5KOXA 3SM8A 3DK4A 2XYOA 2CDUA 4I59A 4HB9A 4PAAA 2FJBA 2YLZA 4A9WA 2YR6A 1NG4A 3GRSA 5CKUA 3KLJA 2F5ZA 1JEHA 1JNRA 1PS9A 3ALMA 3GMCA 1EBDA 3CNJA 1ONFA 1H82A 3AE7A 4AOXA 1NENA 4IA6A 1O95A 4Y4LA 3HYWA 1GEUA 1EL9A 1CJCA 1GSNA 1H7XA 3FBSA 3DJJA 1PBDA 3SXIA 4YKGA 2EQ9A 4IVMB 3ALJA 3BI2A 1JNZA 4H7UA 1F8SA 4EQRA 3OC4A 1YKJA 4H4TA 2GR2A 2XLSA 2V6OA 4IA5A 2WPEA 3V3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA9 A;  2YR5 A;  2BC1 A;  2WET A;  3ATQ A;  1E1K A;  3H8L A;  4TLX A;  5U25 A;  2WEU A;  4KX6 A;  2CVJ A;  1IUV A;  4UDP A;  5JCI A;  1Y56 A;  4JQ9 A;  1GRT A;  1ZOY A;  3URH A;  1TDK A;  4YTM A;  3UKA A;  1B4V A;  3AYJ A;  1YQ3 A;  2BCP A;  3AEB A;  3NK2 X;  2ZZ0 A;  2OAL A;  4K8D A;  4U2S A;  1PXA A;  2YG3 A;  1GAL A;  3VRA A;  4OPD A;  1GTE A;  3S5W A;  1JU2 A;  1CBO A;  2BS3 A;  2C3C A;  4YT0 A;  3FPZ A;  1F8R A;  1GXF A;  1H81 A;  1OJD A;  3JSK A;  4UDQ A;  4JNQ A;  2VZ2 A;  4K2X A;  4UDR A;  2WPF A;  4K7Z A;  3BI4 A;  4B64 A;  4BK2 A;  4DSH A;  3GSI A;  3AE2 A;  5KVH A;  1GTH A;  4CCR A;  2IID A;  4H4Q A;  3T37 A;  3QVR A;  1GRE A;  1JRX A;  1LVL A;  2V3B A;  3AED A;  4YKF A;  4DGK A;  3QSS A;  1TDF A;  3VR9 A;  2APG A;  2QA1 A;  2UZZ A;  4FX9 A;  4H4X A;  3I6D A;  3LZW A;  4H4W A;  2XLR A;  1KSS A;  2JB2 A;  4AOS A;  3NT6 A;  1ZK7 A;  3CPJ G;  5KVI A;  2BS2 A;  3UTG A;  3VQR A;  4JN9 A;  3ICS A;  1YQ4 A;  4IV9 A;  2XDO A;  3FIM B;  2V61 A;  5EB4 A;  4B67 A;  1QJD A;  4EM4 A;  2JKC A;  4Z2U A;  2V60 A;  3M13 A;  3V76 A;  5HXI A;  1PN0 A;  2NPX A;  4CRT A;  1TYT A;  1FCD A;  1FL2 A;  2B7R A;  2QA2 A;  1IUW A;  1PJ6 A;  5KWF A;  3BHF A;  1DOB A;  1PDH A;  2TMD A;  1S2Y A;  2R0P A;  4IVO B;  1BZL A;  1V59 A;  1CF3 A;  2R4J A;  1JRZ A;  3FG2 P;  3HZL A;  1B37 A;  4H4Z A;  1N4W A;  1GRH A;  2YM1 A;  3LOV A;  2YLW A;  2C72 A;  4A79 A;  3SQP A;  4EQX A;  2C70 A;  2YR4 A;  2JAE A;  2FJA A;  5C2T A;  4D04 A;  3RNM A;  1QO8 A;  1NPX A;  3ICR A;  2Q7V A;  2WU5 A;  4EMW A;  3RHA A;  1JRY A;  1GER A;  3ADA B;  4LU6 A;  1VG9 A;  4DNA A;  1B8S A;  3CPI G;  5BUL A;  3UP5 A;  3NYC A;  1TDN A;  2HQM A;  3IF9 A;  1L9D A;  3RED A;  2GMJ A;  2CUL A;  4YSH A;  1EL8 A;  2X50 A;  3B6D A;  4YXD A;  2GAG B;  4ICY A;  5EB5 A;  4YTN A;  4BV6 A;  4H4V A;  3LZX A;  2XLT A;  2EQ6 A;  3K7Q X;  2Y6Q A;  3CN8 A;  1M6I A;  3K30 A;  3M12 A;  4MJW A;  2Q6U A;  4U8P A;  1DOE A;  1E7P A;  3DGZ A;  2BAC A;  3DK8 A;  4H4U A;  3AD9 B;  4Z44 A;  5HY5 A;  3CGB A;  1F3P A;  2FBW A;  5BUK A;  1E39 A;  3RP7 A;  4B69 A;  1PBB A;  4A7A A;  3F8D A;  2RAB A;  3NN6 X;  2YLX A;  3VRB A;  1BF3 A;  4DSG A;  3NIX A;  4GCM A;  3C4A A;  4A65 A;  2C76 A;  2WP5 A;  4OPU A;  2WQY A;  1D7L A;  4J2W A;  2I0Z A;  2GMH A;  3D8X A;  4JNA A;  2VQB A;  1IUS A;  2VOU A;  2QCU A;  3K7T A;  2R4E A;  3KD9 A;  5IQ4 A;  3AB1 A;  4C74 A;  4OPL A;  4J56 A;  2BCG G;  3IHM A;  1PJ5 A;  4JY3 A;  4A6N A;  2C66 A;  2Y6R A;  1CHU A;  3ALL A;  2EQ8 A;  3EAO A;  3G5S A;  1VQW A;  1O94 A;  1GET A;  4EMI A;  1K0J A;  5CQF A;  4C5O A;  4C3Y A;  1H7W A;  1FEB A;  2ACZ A;  2XFO A;  4J57 A;  3GMB A;  3DH9 A;  4Z25 A;  3AE9 A;  3NYF A;  4X9M A;  1NDA A;  4E0V A;  3GD4 A;  4FK1 A;  2XVH A;  3DJG X;  2DKH A;  5JCM A;  3G5R A;  1OJ9 A;  4P9S A;  5FMH A;  2J3N A;  3II4 A;  3UKH A;  1GOS A;  3P1W A;  1DJQ A;  2R0C A;  4TM4 A;  4BJY A;  1GRF A;  1PJ7 A;  3PS9 A;  4C3X A;  2RGO A;  2YVG A;  3DJD A;  2XVE A;  3L8K A;  2X99 A;  2DKI A;  1CC2 A;  4K5S A;  2Q0K A;  3K7M X;  3KPF A;  4RG4 A;  4BK3 A;  1MOK A;  1MO9 A;  3BNU A;  1S2Q A;  2OAM A;  1EL5 A;  1UKV G;  2Q0L A;  3AE3 A;  4H4R A;  4OPC A;  1GES A;  3NKS A;  5DBJ A;  4YSY A;  1AOG A;  2C65 A;  1KFY A;  3CIR A;  2W0H A;  1GRB A;  4FDC B;  4N9X A;  5J7X A;  1GRA A;  4ZCC A;  3UOZ A;  1D4D A;  2XLP A;  2OLN A;  1L0V A;  4EQW A;  1L9C A;  3IWA A;  2X8C A;  4BUR A;  2JBV A;  1KNP A;  1ZKQ A;  3RP6 A;  3NG7 X;  4NEV A;  3SFE A;  2IVE A;  1BGN A;  2YVJ A;  4PAB A;  2VVL A;  4RG3 A;  4B66 A;  2GR3 A;  1PBF A;  1E1M A;  1FEC A;  2RGJ A;  3AYL A;  1H83 A;  1JOA A;  1SEZ A;  2YM2 A;  3BHK A;  1ZDL A;  3QFA A;  2C3D A;  3UTF A;  5KXJ A;  3C4N A;  3D1C A;  4ADW A;  1VRQ B;  1CJ3 A;  5J60 A;  1OJT A;  2H89 A;  3AWI A;  1O5W A;  1NHQ A;  3LB8 A;  3AEC A;  4A5L A;  3COX A;  2BYB A;  4H2N A;  4GDE A;  3GDP A;  2YLS A;  2ZBW A;  2GH5 A;  1NHR A;  4UP3 A;  3O0H A;  1KF6 A;  2B7S A;  3CND A;  1K0I A;  3EF6 A;  5JCK A;  1YQZ A;  1OJC A;  1ZY8 A;  2H88 A;  1RYI A;  1NHP A;  1XAN A;  2X3N A;  3VRD B;  3Q6J A;  5GRT A;  2GQF A;  2VQ7 A;  3ISH A;  2RGH A;  4OVI A;  3UKK A;  2ZZC A;  1DJN A;  1OJA A;  4NTC A;  3I3L A;  1PXB A;  3NTA A;  3DME A;  2R46 A;  3KU9 A;  1CC4 A;  3UOV A;  3CGE A;  4CY8 A;  2CFY A;  3G5Q A;  3NGC X;  4USQ A;  4Z2T A;  3VR8 A;  1TYP A;  4GUV A;  4HA6 A;  1Y0P A;  4CCQ A;  1D4C A;  2GQW A;  2BK4 A;  3KA7 A;  4Z2R A;  4KPR A;  4H50 A;  1H6V A;  1KNR A;  1H84 A;  2WP6 A;  4GDP A;  4LA1 A;  4X9N A;  2FJE A;  1S3B A;  3NNE A;  4EQS A;  1LQT A;  1BGJ A;  1GT8 A;  3GDN A;  2B76 A;  3LJP A;  3NHO X;  2WHD A;  1TRB A;  5GSN A;  1FOH A;  1XHC A;  5U1O A;  2GEW A;  3ITJ A;  2YG6 A;  3F8R A;  1TDO A;  3EAN A;  1DNC A;  1KSU A;  2WPC A;  4H4P A;  1H86 A;  2GRT A;  4ECH A;  2JB1 A;  3CNP A;  4YTP A;  2X8H A;  4APN A;  2BS4 A;  1YY5 A;  3DJE A;  4TLZ A;  2YG7 A;  3GD3 A;  3NTD A;  3E1T A;  4FK1 C;  1D5T A;  2BK3 A;  2WS3 A;  4Y4M A;  3KVE A;  1ZOV A;  1ZMC A;  2E4G A;  4J34 A;  5M0Z A;  1PXC A;  4J33 A;  1ZX9 A;  1ELI A;  1VG0 A;  1W4X A;  3SFD A;  1LQU A;  4USR A;  2XFP A;  1BKW A;  3FMW A;  4O5U A;  2WDR A;  1E6E A;  1NAA A;  3KKJ A;  3NN0 X;  4XWZ A;  2C67 A;  1RP0 A;  2XLU A;  2C75 A;  3DGH A;  3UKL A;  3NK1 X;  2JB3 A;  2X8G A;  4GR1 A;  2PYX A;  2ARD A;  2WDV A;  4AT2 A;  2GR1 A;  2WOW A;  1DOD A;  3QSE A;  1M64 A;  3AEF A;  4XWR A;  1IUT A;  1COY A;  2IVD A;  4Z43 A;  1F6M A;  1Q1W A;  1TDE A;  2A87 A;  4M52 A;  2YAU A;  2QAE A;  4NZH A;  5JCL A;  4U8J A;  1HYU A;  3NK0 X;  2WES A;  1PBC A;  1KDG A;  3AXB A;  2C64 A;  2XVI A;  4AT0 A;  4U8I A;  2BAB A;  5EOW A;  1X31 B;  5JCN A;  2PHH A;  1IUX A;  3P9U A;  4YWO A;  2XVJ A;  5KRQ A;  2XFN A;  3Q9T A;  4EM3 A;  4B63 A;  2V3A A;  2GF3 A;  4H4Y A;  4AP3 A;  3AEG A;  5C3J A;  2YLT A;  1NHS A;  3BNM A;  3M0O A;  1K4Q A;  1XPQ A;  3AE1 A;  4X4J A;  3LXD A;  1GV4 A;  3GYI A;  1D7Y A;  5L46 A;  5EBK A;  1P2E A;  2VVM A;  3NRN A;  4XXG A;  4EIP A;  3B3R A;  2GAH B;  3GRT A;  4TM3 A;  4U8M A;  5U63 A;  3UKF A;  5ER0 A;  3AYI A;  2GR0 A;  3IHG A;  4ZN0 A;  1XDI A;  4B1B A;  4U2T A;  3DK9 A;  4C77 A;  4U8K A;  2XFQ A;  5TR3 A;  4REK A;  4AP1 A;  4TM1 A;  3AE8 A;  1S3E A;  4D03 A;  3GWD A;  4TM0 A;  1CJ4 A;  2WBA A;  1CC6 A;  2WP9 A;  3EPT A;  5FS6 A;  2Z5Y A;  4BJZ A;  2GVC A;  3L1R A;  2R9Z A;  3H8I A;  2ZZB A;  1IJH A;  5FS9 A;  3BI5 A;  2BXR A;  1PHH A;  2BXS A;  2FJD A;  2AR8 A;  2EQ7 A;  4LII A;  4J36 A;  4OPT A;  2YG4 A;  2B9X A;  5HHF A;  3ZYX A;  3H4K A;  1L9E A;  5BVA A;  1ZP0 A;  5IQ1 A;  4ZCD A;  4NEW A;  1DOC A;  1DXL A;  4EIQ A;  3AE5 A;  5HYM A;  2A8X A;  4GRT A;  4JDR A;  1LTX R;  3GYJ A;  3UTH A;  1N1P A;  1E1L A;  2AAQ A;  1BWC A;  1GRG A;  2R0G A;  3IC9 A;  3GWF A;  4H2Q A;  5BRT A;  5FS8 A;  2Z5X A;  5IPY A;  3AE6 A;  1PBE A;  1K0L A;  3SGL A;  3LAD A;  2R45 A;  4J31 A;  4K22 A;  3R9U A;  3WE0 A;  2GV8 A;  2XFU A;  2WOI A;  1QLB A;  2BC0 A;  3CNT A;  4EMJ A;  4H2R A;  1LPF A;  1Z6L A;  2E5V A;  3QSM A;  3S61 A;  4BK1 A;  1N4U A;  3P4Q A;  1ZMD A;  3QJ4 A;  5FS7 A;  3DA1 A;  3UKQ A;  4B65 A;  3AE4 A;  4JY2 A;  4CNK A;  4A99 A;  3UTE A;  1P2H A;  3NH3 X;  3PVC A;  3UP4 A;  2C7G A;  4A6N B;  4YSX A;  3UKP A;  3ABV A;  2C73 A;  2XCG A;  2XVF A;  4H4S A;  4WX1 A;  4YSZ A;  3PO7 A;  3V3N A;  1N4V A;  3CGD A;  3NYE A;  5M10 A;  1REO A;  3CGC A;  4U8N A;  2O9Z A;  1D4E A;  2OLO A;  4Z26 A;  4Y4N A;  1CJ2 A;  2YLR A;  2A89 A;  3UOY A;  4Z24 A;  4OPI A;  3AD8 B;  1FEA A;  4B68 A;  1NG3 A;  3CPH G;  3ATR A;  3OZ2 A;  1GND A;  1B5Q A;  3P4S A;  4CNJ A;  2TPR A;  2WU2 A;  1Q1R A;  1MXT A;  1LV0 A;  1VDC A;  2V5Z A;  4K5R A;  2JK6 A;  1NEK A;  3F8P A;  2WOV A;  4U8L A;  1Y56 B;  4GF7 A;  1IUU A;  3AEE A;  4I58 A;  2B9W A;  5KOW A;  2BK5 A;  4OCG A;  1CL0 A;  4U2L A;  1LJ1 A;  4CBQ A;  3AD7 B;  3AEA A;  4RSL A;  4WCT A;  2VRL A;  3UOX A;  3NLC A;  2YVF A;  1Q9I A;  2E1M A;  3ICT A;  3P4R A;  3C96 A;  3UCL A;  4CY6 A;  2OA1 A;  2YWL A;  3CTY A;  4H2P A;  4U8O A;  1RSG A;  3CNS A;  2YQU A;  2AQJ A;  4OPG A;  1E1N A;  2VRM A;  2WDQ A;  3QVP A;  2NVK X;  3QFB A;  3ZDN A;  3P4P A;  5LV9 A;  2VVL G;  4NTE A;  1F8W A;  2YG5 A;  4NTD A;  2GB0 A;  1GPE A;  1EL7 A;  2B9Y A;  4O5Q A;  3RP8 A;  5KOX A;  3SM8 A;  3DK4 A;  2XYO A;  2CDU A;  4I59 A;  4HB9 A;  4PAA A;  2FJB A;  2YLZ A;  4A9W A;  2YR6 A;  1NG4 A;  3GRS A;  5CKU A;  3KLJ A;  2F5Z A;  1JEH A;  1JNR A;  1PS9 A;  3ALM A;  3GMC A;  1EBD A;  3CNJ A;  1ONF A;  1H82 A;  3AE7 A;  4AOX A;  1NEN A;  4IA6 A;  1O95 A;  4Y4L A;  1GEU A;  1EL9 A;  1CJC A;  1GSN A;  1H7X A;  3FBS A;  3DJJ A;  1PBD A;  4YKG A;  2EQ9 A;  4IVM B;  3ALJ A;  3BI2 A;  1JNZ A;  4H7U A;  1F8S A;  4EQR A;  3OC4 A;  1YKJ A;  4H4T A;  2GR2 A;  2XLS A;  2V6O A;  4IA5 A;  2WPE A;  3V3O A; 
#chains in the Genus database with same CATH topology
 2BA9 A;  2YR5 A;  2BC1 A;  2WET A;  3ATQ A;  1E1K A;  3H8L A;  4TLX A;  5U25 A;  2WEU A;  4KX6 A;  3T31 A;  2CVJ A;  1IUV A;  4UDP A;  5JCI A;  1Y56 A;  4JQ9 A;  1GRT A;  1ZOY A;  3URH A;  1TDK A;  4YTM A;  3UKA A;  1B4V A;  3AYJ A;  1YQ3 A;  2BCP A;  3AEB A;  3NK2 X;  2ZZ0 A;  2OAL A;  4K8D A;  4U2S A;  1PXA A;  2YG3 A;  1GAL A;  3VRA A;  4OPD A;  1GTE A;  3S5W A;  1JU2 A;  1CBO A;  2BS3 A;  2C3C A;  4YT0 A;  3FPZ A;  1F8R A;  1GXF A;  1H81 A;  1OJD A;  3JSK A;  4UDQ A;  4JNQ A;  2VZ2 A;  4K2X A;  4UDR A;  2WPF A;  4K7Z A;  3BI4 A;  3T14 A;  3T2Z A;  4B64 A;  3GSI A;  3AE2 A;  4BK2 A;  1GTH A;  4CCR A;  5KVH A;  2IID A;  4H4Q A;  3T37 A;  3QVR A;  1GRE A;  1JRX A;  1LVL A;  2V3B A;  3AED A;  4YKF A;  4DGK A;  3QSS A;  1TDF A;  4G6G A;  3VR9 A;  2APG A;  2QA1 A;  2UZZ A;  4FX9 A;  4H4X A;  3I6D A;  3LZW A;  4H4W A;  2XLR A;  1KSS A;  2JB2 A;  4AOS A;  3NT6 A;  1ZK7 A;  3CPJ G;  5KVI A;  2BS2 A;  3UTG A;  3VQR A;  4JN9 A;  3ICS A;  1YQ4 A;  4IV9 A;  2XDO A;  3FIM B;  2V61 A;  5EB4 A;  4B67 A;  1QJD A;  4EM4 A;  2JKC A;  4Z2U A;  2V60 A;  3M13 A;  3V76 A;  5HXI A;  1PN0 A;  2NPX A;  4CRT A;  1TYT A;  1FCD A;  1FL2 A;  2B7R A;  2QA2 A;  1IUW A;  1PJ6 A;  5KWF A;  3BHF A;  1DOB A;  1PDH A;  2TMD A;  1S2Y A;  2R0P A;  4IVO B;  1BZL A;  1V59 A;  1CF3 A;  2R4J A;  1JRZ A;  3FG2 P;  3HZL A;  1B37 A;  4H4Z A;  3T0K A;  1N4W A;  1GRH A;  2YM1 A;  3LOV A;  2YLW A;  2C72 A;  4A79 A;  3SQP A;  4EQX A;  2C70 A;  2YR4 A;  3SZF A;  2JAE A;  2FJA A;  5C2T A;  4D04 A;  3RNM A;  1QO8 A;  1NPX A;  3ICR A;  2Q7V A;  2WU5 A;  4EMW A;  3RHA A;  1JRY A;  1GER A;  3ADA B;  4LU6 A;  1VG9 A;  4DNA A;  1B8S A;  3CPI G;  4MJW A;  5BUL A;  3GYX A;  3UP5 A;  3NYC A;  1TDN A;  2HQM A;  3IF9 A;  1L9D A;  3RED A;  2GMJ A;  2CUL A;  4YSH A;  1EL8 A;  2X50 A;  3B6D A;  4YXD A;  2GAG B;  4ICY A;  5EB5 A;  4YTN A;  4BV6 A;  3HYV A;  3LZX A;  4H4V A;  2XLT A;  2EQ6 A;  3K7Q X;  2Y6Q A;  2BRY A;  1M6I A;  3CN8 A;  3K30 A;  3M12 A;  2Q6U A;  4U8P A;  1DOE A;  1E7P A;  3DGZ A;  2BAC A;  3DK8 A;  4H4U A;  3AD9 B;  4Z44 A;  3SYI A;  3SZW A;  3CGB A;  1F3P A;  2FBW A;  5BUK A;  1E39 A;  3RP7 A;  4B69 A;  1PBB A;  4A7A A;  3F8D A;  2RAB A;  3NN6 X;  2YLX A;  3VRB A;  1BF3 A;  4DSG A;  3NIX A;  4GCM A;  3C4A A;  4A65 A;  2C76 A;  2WP5 A;  4OPU A;  2WQY A;  1D7L A;  4J2W A;  2I0Z A;  2GMH A;  3D8X A;  4JNA A;  2VQB A;  1IUS A;  2VOU A;  2QCU A;  3K7T A;  2R4E A;  3KD9 A;  5IQ4 A;  3AB1 A;  4C74 A;  4OPL A;  4J56 A;  2BCG G;  3IHM A;  1PJ5 A;  4JY3 A;  4A6N A;  2C66 A;  2Y6R A;  1CHU A;  3ALL A;  2EQ8 A;  3EAO A;  3G5S A;  1VQW A;  1O94 A;  1GET A;  4EMI A;  1K0J A;  5CQF A;  4C5O A;  4C3Y A;  1H7W A;  1FEB A;  2ACZ A;  2XFO A;  4J57 A;  3GMB A;  3DH9 A;  4Z25 A;  4II2 A;  3AE9 A;  3NYF A;  4X9M A;  1NDA A;  4E0V A;  4GAV A;  3GD4 A;  4FK1 A;  2XVH A;  3DJG X;  5HY5 A;  2DKH A;  5JCM A;  3G5R A;  1OJ9 A;  4P9S A;  5FMH A;  2J3N A;  3II4 A;  3UKH A;  1GOS A;  3P1W A;  1DJQ A;  2R0C A;  4TM4 A;  4BJY A;  1GRF A;  1PJ7 A;  3PS9 A;  4C3X A;  2RGO A;  2YVG A;  3DJD A;  2XVE A;  3L8K A;  2X99 A;  2DKI A;  1CC2 A;  4K5S A;  2Q0K A;  3K7M X;  3KPF A;  4RG4 A;  4BK3 A;  1MOK A;  1MO9 A;  3BNU A;  1S2Q A;  2OAM A;  1EL5 A;  1UKV G;  2Q0L A;  3AE3 A;  4H4R A;  4OPC A;  1GES A;  3NKS A;  5DBJ A;  4YSY A;  3SY4 A;  1AOG A;  2C65 A;  1KFY A;  3CIR A;  2W0H A;  1GRB A;  4FDC B;  4N9X A;  3SZC A;  5KNL A;  5J7X A;  1GRA A;  4ZCC A;  3UOZ A;  1D4D A;  2XLP A;  2OLN A;  1L0V A;  4EQW A;  1L9C A;  3IWA A;  2X8C A;  4BUR A;  2JBV A;  1KNP A;  1ZKQ A;  3RP6 A;  3NG7 X;  4NEV A;  3SFE A;  2IVE A;  1BGN A;  2YVJ A;  4PAB A;  2VVL A;  4RG3 A;  4B66 A;  2GR3 A;  1PBF A;  1E1M A;  1FEC A;  2RGJ A;  3AYL A;  1H83 A;  1JOA A;  1SEZ A;  2YM2 A;  3BHK A;  1ZDL A;  3QFA A;  2C3D A;  3UTF A;  5KXJ A;  3C4N A;  3D1C A;  4ADW A;  1VRQ B;  1CJ3 A;  5J60 A;  1OJT A;  2H89 A;  3AWI A;  1O5W A;  1NHQ A;  3LB8 A;  3AEC A;  4A5L A;  3COX A;  2BYB A;  4H2N A;  4GDE A;  3GDP A;  2YLS A;  2ZBW A;  2GH5 A;  1NHR A;  4UP3 A;  3O0H A;  1KF6 A;  2B7S A;  3CND A;  1K0I A;  3EF6 A;  5JCK A;  1YQZ A;  1OJC A;  1ZY8 A;  2H88 A;  1RYI A;  1NHP A;  1XAN A;  2X3N A;  3VRD B;  3Q6J A;  5GRT A;  2BRA A;  2GQF A;  2VQ7 A;  3ISH A;  2RGH A;  4OVI A;  3UKK A;  2ZZC A;  1DJN A;  1OJA A;  4NTC A;  3I3L A;  1PXB A;  3NTA A;  3DME A;  2R46 A;  3KU9 A;  1CC4 A;  5KMQ A;  3CGE A;  3T2Y A;  2CFY A;  3UOV A;  4CY8 A;  3G5Q A;  3NGC X;  4USQ A;  4Z2T A;  3VR8 A;  1TYP A;  4GUV A;  4HA6 A;  1Y0P A;  4G6H A;  1D4C A;  2GQW A;  4CCQ A;  2BK4 A;  3KA7 A;  4Z2R A;  4KPR A;  4H50 A;  1H6V A;  1KNR A;  1H84 A;  2WP6 A;  4GDP A;  4LA1 A;  4X9N A;  2FJE A;  1S3B A;  3NNE A;  4EQS A;  1LQT A;  1BGJ A;  1GT8 A;  3GDN A;  2B76 A;  3LJP A;  3NHO X;  2WHD A;  1TRB A;  5GSN A;  1FOH A;  1XHC A;  5U1O A;  2GEW A;  3ITJ A;  2YG6 A;  3F8R A;  1TDO A;  3EAN A;  1DNC A;  1KSU A;  2WPC A;  4H4P A;  1H86 A;  2GRT A;  4ECH A;  2JB1 A;  3CNP A;  4YTP A;  2X8H A;  4APN A;  2BS4 A;  1YY5 A;  3DJE A;  4TLZ A;  2YG7 A;  3GD3 A;  3NTD A;  3E1T A;  4FK1 C;  1D5T A;  2BK3 A;  2WS3 A;  4Y4M A;  3KVE A;  1ZOV A;  1ZMC A;  2E4G A;  4J34 A;  5M0Z A;  1PXC A;  4J33 A;  1ZX9 A;  1ELI A;  3KPK A;  1VG0 A;  1W4X A;  3SFD A;  1LQU A;  4USR A;  2XFP A;  1BKW A;  3FMW A;  4O5U A;  2WDR A;  1E6E A;  1NAA A;  3KKJ A;  3NN0 X;  4XWZ A;  2C67 A;  1RP0 A;  2XLU A;  2C75 A;  3DGH A;  3UKL A;  3NK1 X;  2JB3 A;  2X8G A;  4GR1 A;  2PYX A;  2ARD A;  2WDV A;  4AT2 A;  2GR1 A;  2WOW A;  1DOD A;  3QSE A;  1M64 A;  3AEF A;  4XWR A;  1IUT A;  1COY A;  2IVD A;  4Z43 A;  1F6M A;  1Q1W A;  1TDE A;  2A87 A;  4M52 A;  2YAU A;  2QAE A;  4NZH A;  5JCL A;  4U8J A;  1HYU A;  3NK0 X;  2WES A;  1PBC A;  4DSH A;  1KDG A;  3AXB A;  2C64 A;  2XVI A;  4AT0 A;  4U8I A;  2BAB A;  5EOW A;  1X31 B;  5JCN A;  2PHH A;  1IUX A;  3P9U A;  4YWO A;  2XVJ A;  5KRQ A;  2XFN A;  3Q9T A;  4EM3 A;  4B63 A;  2V3A A;  2GF3 A;  4H4Y A;  4AP3 A;  3AEG A;  5C3J A;  2YLT A;  1NHS A;  4II3 A;  3BNM A;  3T2K A;  3M0O A;  1K4Q A;  1XPQ A;  3AE1 A;  4X4J A;  3LXD A;  1GV4 A;  3GYI A;  1D7Y A;  5L46 A;  4G74 A;  5EBK A;  1P2E A;  2VVM A;  3NRN A;  4XXG A;  4EIP A;  3B3R A;  2GAH B;  3GRT A;  4TM3 A;  4U8M A;  5U63 A;  3UKF A;  5ER0 A;  3AYI A;  2GR0 A;  3IHG A;  4ZN0 A;  1XDI A;  4B1B A;  4U2T A;  3DK9 A;  4C77 A;  4U8K A;  2XFQ A;  5TR3 A;  4REK A;  4AP1 A;  4TM1 A;  3AE8 A;  1S3E A;  4D03 A;  3GWD A;  5KMS A;  4TM0 A;  1CJ4 A;  2WBA A;  1CC6 A;  2WP9 A;  3EPT A;  5FS6 A;  2Z5Y A;  4BJZ A;  2GVC A;  3L1R A;  2R9Z A;  3H8I A;  2ZZB A;  4NNJ A;  1IJH A;  5FS9 A;  3BI5 A;  2BXR A;  1PHH A;  2BXS A;  2FJD A;  2AR8 A;  2EQ7 A;  4LII A;  4J36 A;  4OPT A;  2YG4 A;  2B9X A;  5HHF A;  3ZYX A;  3H4K A;  3HYX A;  1L9E A;  5BVA A;  1ZP0 A;  5IQ1 A;  4ZCD A;  4NEW A;  1DOC A;  1DXL A;  4EIQ A;  3AE5 A;  5HYM A;  2A8X A;  4GRT A;  4JDR A;  3SZ0 A;  1LTX R;  3GYJ A;  3UTH A;  1N1P A;  1E1L A;  2AAQ A;  1BWC A;  1GRG A;  2R0G A;  3IC9 A;  3GWF A;  4H2Q A;  5BRT A;  5FS8 A;  2Z5X A;  5IPY A;  3AE6 A;  1PBE A;  1K0L A;  3SGL A;  3LAD A;  2R45 A;  4J31 A;  4K22 A;  3R9U A;  4NWZ A;  2GV8 A;  2XFU A;  3WE0 A;  2WOI A;  1QLB A;  2BC0 A;  3CNT A;  4EMJ A;  4H2R A;  1LPF A;  1Z6L A;  2E5V A;  3QSM A;  3S61 A;  4BK1 A;  1N4U A;  3P4Q A;  1ZMD A;  3QJ4 A;  5FS7 A;  3DA1 A;  3SX6 A;  3UKQ A;  3AE4 A;  4JY2 A;  4B65 A;  4CNK A;  4A99 A;  3UTE A;  1P2H A;  3NH3 X;  3PVC A;  3UP4 A;  2C7G A;  4A6N B;  4YSX A;  3UKP A;  5KMR A;  3ABV A;  2C73 A;  2XCG A;  2XVF A;  4H4S A;  4WX1 A;  4YSZ A;  3PO7 A;  3V3N A;  1N4V A;  3CGD A;  3NYE A;  5M10 A;  1REO A;  3CGC A;  4U8N A;  2C4C A;  1D4E A;  2O9Z A;  2OLO A;  4Z26 A;  4Y4N A;  1CJ2 A;  2YLR A;  2A89 A;  3UOY A;  4Z24 A;  4OPI A;  3AD8 B;  1FEA A;  4B68 A;  1NG3 A;  3CPH G;  3ATR A;  3OZ2 A;  1GND A;  1B5Q A;  3P4S A;  4CNJ A;  2TPR A;  2WU2 A;  1Q1R A;  1MXT A;  1LV0 A;  1VDC A;  2V5Z A;  4K5R A;  2JK6 A;  1NEK A;  3F8P A;  2WOV A;  4U8L A;  1Y56 B;  4GF7 A;  1IUU A;  3AEE A;  4I58 A;  2B9W A;  5KOW A;  2BK5 A;  4OCG A;  1CL0 A;  4U2L A;  1LJ1 A;  4CBQ A;  3AD7 B;  3AEA A;  4RSL A;  4WCT A;  4G73 A;  2VRL A;  3UOX A;  3NLC A;  2YVF A;  1Q9I A;  2E1M A;  3ICT A;  3P4R A;  3C96 A;  3UCL A;  3CMM A;  4CY6 A;  2OA1 A;  2YWL A;  3CTY A;  4H2P A;  4U8O A;  1RSG A;  3CNS A;  2YQU A;  2AQJ A;  4OPG A;  1E1N A;  5KMP A;  2VRM A;  2WDQ A;  3QVP A;  4GAP A;  2NVK X;  3QFB A;  3ZDN A;  3P4P A;  5LV9 A;  2VVL G;  4NTE A;  1F8W A;  2YG5 A;  4G9K A;  2GB0 A;  1GPE A;  1EL7 A;  2B9Y A;  4NTD A;  4O5Q A;  3RP8 A;  5KOX A;  3SM8 A;  3DK4 A;  2XYO A;  2CDU A;  4I59 A;  4HB9 A;  4PAA A;  2FJB A;  2YLZ A;  4A9W A;  2YR6 A;  1NG4 A;  3GRS A;  5CKU A;  3KLJ A;  2F5Z A;  1JEH A;  1JNR A;  1PS9 A;  3ALM A;  3GMC A;  1EBD A;  3CNJ A;  1ONF A;  1H82 A;  3AE7 A;  4AOX A;  1NEN A;  4IA6 A;  1O95 A;  4Y4L A;  3HYW A;  1GEU A;  1EL9 A;  1CJC A;  1GSN A;  1H7X A;  3FBS A;  3DJJ A;  1PBD A;  3SXI A;  4YKG A;  2EQ9 A;  4IVM B;  3ALJ A;  3BI2 A;  1JNZ A;  4H7U A;  1F8S A;  4EQR A;  3OC4 A;  1YKJ A;  4H4T A;  2GR2 A;  2XLS A;  2V6O A;  4IA5 A;  2WPE A;  3V3O A; 
#chains in the Genus database with same CATH homology
 2BA9 A;  2YR5 A;  2BC1 A;  2WET A;  3ATQ A;  1E1K A;  3H8L A;  4TLX A;  5U25 A;  2WEU A;  4KX6 A;  3T31 A;  2CVJ A;  1IUV A;  4UDP A;  5JCI A;  1Y56 A;  4JQ9 A;  1GRT A;  1ZOY A;  3URH A;  1TDK A;  4YTM A;  3UKA A;  1B4V A;  3AYJ A;  1YQ3 A;  2BCP A;  3AEB A;  3NK2 X;  2ZZ0 A;  2OAL A;  4K8D A;  4U2S A;  1PXA A;  2YG3 A;  1GAL A;  3VRA A;  4OPD A;  1GTE A;  3S5W A;  1JU2 A;  1CBO A;  2BS3 A;  2C3C A;  4YT0 A;  3FPZ A;  1F8R A;  1GXF A;  1H81 A;  1OJD A;  3JSK A;  4UDQ A;  4JNQ A;  2VZ2 A;  4K2X A;  4UDR A;  2WPF A;  4K7Z A;  3BI4 A;  3T14 A;  3T2Z A;  4B64 A;  3GSI A;  3AE2 A;  4BK2 A;  1GTH A;  4CCR A;  5KVH A;  2IID A;  4H4Q A;  3T37 A;  3QVR A;  1GRE A;  1JRX A;  1LVL A;  2V3B A;  3AED A;  4YKF A;  4DGK A;  3QSS A;  1TDF A;  4G6G A;  3VR9 A;  2APG A;  2QA1 A;  2UZZ A;  4FX9 A;  4H4X A;  3I6D A;  3LZW A;  4H4W A;  2XLR A;  1KSS A;  2JB2 A;  4AOS A;  3NT6 A;  1ZK7 A;  3CPJ G;  5KVI A;  2BS2 A;  3UTG A;  3VQR A;  4JN9 A;  3ICS A;  1YQ4 A;  4IV9 A;  2XDO A;  3FIM B;  2V61 A;  5EB4 A;  4B67 A;  1QJD A;  4EM4 A;  2JKC A;  4Z2U A;  2V60 A;  3M13 A;  3V76 A;  5HXI A;  1PN0 A;  2NPX A;  4CRT A;  1TYT A;  1FCD A;  1FL2 A;  2B7R A;  2QA2 A;  1IUW A;  1PJ6 A;  5KWF A;  3BHF A;  1DOB A;  1PDH A;  2TMD A;  1S2Y A;  2R0P A;  4IVO B;  1BZL A;  1V59 A;  1CF3 A;  2R4J A;  1JRZ A;  3FG2 P;  3HZL A;  1B37 A;  4H4Z A;  3T0K A;  1N4W A;  1GRH A;  2YM1 A;  3LOV A;  2YLW A;  2C72 A;  4A79 A;  3SQP A;  4EQX A;  2C70 A;  2YR4 A;  3SZF A;  2JAE A;  2FJA A;  5C2T A;  4D04 A;  3RNM A;  1QO8 A;  1NPX A;  3ICR A;  2Q7V A;  2WU5 A;  4EMW A;  3RHA A;  1JRY A;  1GER A;  3ADA B;  4LU6 A;  1VG9 A;  4DNA A;  1B8S A;  3CPI G;  4MJW A;  5BUL A;  3GYX A;  3UP5 A;  3NYC A;  1TDN A;  2HQM A;  3IF9 A;  1L9D A;  3RED A;  2GMJ A;  2CUL A;  4YSH A;  1EL8 A;  2X50 A;  3B6D A;  4YXD A;  2GAG B;  4ICY A;  5EB5 A;  4YTN A;  4BV6 A;  3HYV A;  3LZX A;  4H4V A;  2XLT A;  2EQ6 A;  3K7Q X;  2Y6Q A;  2BRY A;  1M6I A;  3CN8 A;  3K30 A;  3M12 A;  2Q6U A;  4U8P A;  1DOE A;  1E7P A;  3DGZ A;  2BAC A;  3DK8 A;  4H4U A;  3AD9 B;  4Z44 A;  3SYI A;  3SZW A;  3CGB A;  1F3P A;  2FBW A;  5BUK A;  1E39 A;  3RP7 A;  4B69 A;  1PBB A;  4A7A A;  3F8D A;  2RAB A;  3NN6 X;  2YLX A;  3VRB A;  1BF3 A;  4DSG A;  3NIX A;  4GCM A;  3C4A A;  4A65 A;  2C76 A;  2WP5 A;  4OPU A;  2WQY A;  1D7L A;  4J2W A;  2I0Z A;  2GMH A;  3D8X A;  4JNA A;  2VQB A;  1IUS A;  2VOU A;  2QCU A;  3K7T A;  2R4E A;  3KD9 A;  5IQ4 A;  3AB1 A;  4C74 A;  4OPL A;  4J56 A;  2BCG G;  3IHM A;  1PJ5 A;  4JY3 A;  4A6N A;  2C66 A;  2Y6R A;  1CHU A;  3ALL A;  2EQ8 A;  3EAO A;  3G5S A;  1VQW A;  1O94 A;  1GET A;  4EMI A;  1K0J A;  5CQF A;  4C5O A;  4C3Y A;  1H7W A;  1FEB A;  2ACZ A;  2XFO A;  4J57 A;  3GMB A;  3DH9 A;  4Z25 A;  4II2 A;  3AE9 A;  3NYF A;  4X9M A;  1NDA A;  4E0V A;  4GAV A;  3GD4 A;  4FK1 A;  2XVH A;  3DJG X;  5HY5 A;  2DKH A;  5JCM A;  3G5R A;  1OJ9 A;  4P9S A;  5FMH A;  2J3N A;  3II4 A;  3UKH A;  1GOS A;  3P1W A;  1DJQ A;  2R0C A;  4TM4 A;  4BJY A;  1GRF A;  1PJ7 A;  3PS9 A;  4C3X A;  2RGO A;  2YVG A;  3DJD A;  2XVE A;  3L8K A;  2X99 A;  2DKI A;  1CC2 A;  4K5S A;  2Q0K A;  3K7M X;  3KPF A;  4RG4 A;  4BK3 A;  1MOK A;  1MO9 A;  3BNU A;  1S2Q A;  2OAM A;  1EL5 A;  1UKV G;  2Q0L A;  3AE3 A;  4H4R A;  4OPC A;  1GES A;  3NKS A;  5DBJ A;  4YSY A;  3SY4 A;  1AOG A;  2C65 A;  1KFY A;  3CIR A;  2W0H A;  1GRB A;  4FDC B;  4N9X A;  3SZC A;  5KNL A;  5J7X A;  1GRA A;  4ZCC A;  3UOZ A;  1D4D A;  2XLP A;  2OLN A;  1L0V A;  4EQW A;  1L9C A;  3IWA A;  2X8C A;  4BUR A;  2JBV A;  1KNP A;  1ZKQ A;  3RP6 A;  3NG7 X;  4NEV A;  3SFE A;  2IVE A;  1BGN A;  2YVJ A;  4PAB A;  2VVL A;  4RG3 A;  4B66 A;  2GR3 A;  1PBF A;  1E1M A;  1FEC A;  2RGJ A;  3AYL A;  1H83 A;  1JOA A;  1SEZ A;  2YM2 A;  3BHK A;  1ZDL A;  3QFA A;  2C3D A;  3UTF A;  5KXJ A;  3C4N A;  3D1C A;  4ADW A;  1VRQ B;  1CJ3 A;  5J60 A;  1OJT A;  2H89 A;  3AWI A;  1O5W A;  1NHQ A;  3LB8 A;  3AEC A;  4A5L A;  3COX A;  2BYB A;  4H2N A;  4GDE A;  3GDP A;  2YLS A;  2ZBW A;  2GH5 A;  1NHR A;  4UP3 A;  3O0H A;  1KF6 A;  2B7S A;  3CND A;  1K0I A;  3EF6 A;  5JCK A;  1YQZ A;  1OJC A;  1ZY8 A;  2H88 A;  1RYI A;  1NHP A;  1XAN A;  2X3N A;  3VRD B;  3Q6J A;  5GRT A;  2BRA A;  2GQF A;  2VQ7 A;  3ISH A;  2RGH A;  4OVI A;  3UKK A;  2ZZC A;  1DJN A;  1OJA A;  4NTC A;  3I3L A;  1PXB A;  3NTA A;  3DME A;  2R46 A;  3KU9 A;  1CC4 A;  5KMQ A;  3CGE A;  3T2Y A;  2CFY A;  3UOV A;  4CY8 A;  3G5Q A;  3NGC X;  4USQ A;  4Z2T A;  3VR8 A;  1TYP A;  4GUV A;  4HA6 A;  1Y0P A;  4G6H A;  1D4C A;  2GQW A;  4CCQ A;  2BK4 A;  3KA7 A;  4Z2R A;  4KPR A;  4H50 A;  1H6V A;  1KNR A;  1H84 A;  2WP6 A;  4GDP A;  4LA1 A;  4X9N A;  2FJE A;  1S3B A;  3NNE A;  4EQS A;  1LQT A;  1BGJ A;  1GT8 A;  3GDN A;  2B76 A;  3LJP A;  3NHO X;  2WHD A;  1TRB A;  5GSN A;  1FOH A;  1XHC A;  5U1O A;  2GEW A;  3ITJ A;  2YG6 A;  3F8R A;  1TDO A;  3EAN A;  1DNC A;  1KSU A;  2WPC A;  4H4P A;  1H86 A;  2GRT A;  4ECH A;  2JB1 A;  3CNP A;  4YTP A;  2X8H A;  4APN A;  2BS4 A;  1YY5 A;  3DJE A;  4TLZ A;  2YG7 A;  3GD3 A;  3NTD A;  3E1T A;  4FK1 C;  1D5T A;  2BK3 A;  2WS3 A;  4Y4M A;  3KVE A;  1ZOV A;  1ZMC A;  2E4G A;  4J34 A;  5M0Z A;  1PXC A;  4J33 A;  1ZX9 A;  1ELI A;  3KPK A;  1VG0 A;  1W4X A;  3SFD A;  1LQU A;  4USR A;  2XFP A;  1BKW A;  3FMW A;  4O5U A;  2WDR A;  1E6E A;  1NAA A;  3KKJ A;  3NN0 X;  4XWZ A;  2C67 A;  1RP0 A;  2XLU A;  2C75 A;  3DGH A;  3UKL A;  3NK1 X;  2JB3 A;  2X8G A;  4GR1 A;  2PYX A;  2ARD A;  2WDV A;  4AT2 A;  2GR1 A;  2WOW A;  1DOD A;  3QSE A;  1M64 A;  3AEF A;  4XWR A;  1IUT A;  1COY A;  2IVD A;  4Z43 A;  1F6M A;  1Q1W A;  1TDE A;  2A87 A;  4M52 A;  2YAU A;  2QAE A;  4NZH A;  5JCL A;  4U8J A;  1HYU A;  3NK0 X;  2WES A;  1PBC A;  4DSH A;  1KDG A;  3AXB A;  2C64 A;  2XVI A;  4AT0 A;  4U8I A;  2BAB A;  5EOW A;  1X31 B;  5JCN A;  2PHH A;  1IUX A;  3P9U A;  4YWO A;  2XVJ A;  5KRQ A;  2XFN A;  3Q9T A;  4EM3 A;  4B63 A;  2V3A A;  2GF3 A;  4H4Y A;  4AP3 A;  3AEG A;  5C3J A;  2YLT A;  1NHS A;  4II3 A;  3BNM A;  3T2K A;  3M0O A;  1K4Q A;  1XPQ A;  3AE1 A;  4X4J A;  3LXD A;  1GV4 A;  3GYI A;  1D7Y A;  5L46 A;  4G74 A;  5EBK A;  1P2E A;  2VVM A;  3NRN A;  4XXG A;  4EIP A;  3B3R A;  2GAH B;  3GRT A;  4TM3 A;  4U8M A;  5U63 A;  3UKF A;  5ER0 A;  3AYI A;  2GR0 A;  3IHG A;  4ZN0 A;  1XDI A;  4B1B A;  4U2T A;  3DK9 A;  4C77 A;  4U8K A;  2XFQ A;  5TR3 A;  4REK A;  4AP1 A;  4TM1 A;  3AE8 A;  1S3E A;  4D03 A;  3GWD A;  5KMS A;  4TM0 A;  1CJ4 A;  2WBA A;  1CC6 A;  2WP9 A;  3EPT A;  5FS6 A;  2Z5Y A;  4BJZ A;  2GVC A;  3L1R A;  2R9Z A;  3H8I A;  2ZZB A;  4NNJ A;  1IJH A;  5FS9 A;  3BI5 A;  2BXR A;  1PHH A;  2BXS A;  2FJD A;  2AR8 A;  2EQ7 A;  4LII A;  4J36 A;  4OPT A;  2YG4 A;  2B9X A;  5HHF A;  3ZYX A;  3H4K A;  3HYX A;  1L9E A;  5BVA A;  1ZP0 A;  5IQ1 A;  4ZCD A;  4NEW A;  1DOC A;  1DXL A;  4EIQ A;  3AE5 A;  5HYM A;  2A8X A;  4GRT A;  4JDR A;  3SZ0 A;  1LTX R;  3GYJ A;  3UTH A;  1N1P A;  1E1L A;  2AAQ A;  1BWC A;  1GRG A;  2R0G A;  3IC9 A;  3GWF A;  4H2Q A;  5BRT A;  5FS8 A;  2Z5X A;  5IPY A;  3AE6 A;  1PBE A;  1K0L A;  3SGL A;  3LAD A;  2R45 A;  4J31 A;  4K22 A;  3R9U A;  4NWZ A;  2GV8 A;  2XFU A;  3WE0 A;  2WOI A;  1QLB A;  2BC0 A;  3CNT A;  4EMJ A;  4H2R A;  1LPF A;  1Z6L A;  2E5V A;  3QSM A;  3S61 A;  4BK1 A;  1N4U A;  3P4Q A;  1ZMD A;  3QJ4 A;  5FS7 A;  3DA1 A;  3SX6 A;  3UKQ A;  3AE4 A;  4JY2 A;  4B65 A;  4CNK A;  4A99 A;  3UTE A;  1P2H A;  3NH3 X;  3PVC A;  3UP4 A;  2C7G A;  4A6N B;  4YSX A;  3UKP A;  5KMR A;  3ABV A;  2C73 A;  2XCG A;  2XVF A;  4H4S A;  4WX1 A;  4YSZ A;  3PO7 A;  3V3N A;  1N4V A;  3CGD A;  3NYE A;  5M10 A;  1REO A;  3CGC A;  4U8N A;  2C4C A;  1D4E A;  2O9Z A;  2OLO A;  4Z26 A;  4Y4N A;  1CJ2 A;  2YLR A;  2A89 A;  3UOY A;  4Z24 A;  4OPI A;  3AD8 B;  1FEA A;  4B68 A;  1NG3 A;  3CPH G;  3ATR A;  3OZ2 A;  1GND A;  1B5Q A;  3P4S A;  4CNJ A;  2TPR A;  2WU2 A;  1Q1R A;  1MXT A;  1LV0 A;  1VDC A;  2V5Z A;  4K5R A;  2JK6 A;  1NEK A;  3F8P A;  2WOV A;  4U8L A;  1Y56 B;  4GF7 A;  1IUU A;  3AEE A;  4I58 A;  2B9W A;  5KOW A;  2BK5 A;  4OCG A;  1CL0 A;  4U2L A;  1LJ1 A;  4CBQ A;  3AD7 B;  3AEA A;  4RSL A;  4WCT A;  4G73 A;  2VRL A;  3UOX A;  3NLC A;  2YVF A;  1Q9I A;  2E1M A;  3ICT A;  3P4R A;  3C96 A;  3UCL A;  3CMM A;  4CY6 A;  2OA1 A;  2YWL A;  3CTY A;  4H2P A;  4U8O A;  1RSG A;  3CNS A;  2YQU A;  2AQJ A;  4OPG A;  1E1N A;  5KMP A;  2VRM A;  2WDQ A;  3QVP A;  4GAP A;  2NVK X;  3QFB A;  3ZDN A;  3P4P A;  5LV9 A;  2VVL G;  4NTE A;  1F8W A;  2YG5 A;  4G9K A;  2GB0 A;  1GPE A;  1EL7 A;  2B9Y A;  4NTD A;  4O5Q A;  3RP8 A;  5KOX A;  3SM8 A;  3DK4 A;  2XYO A;  2CDU A;  4I59 A;  4HB9 A;  4PAA A;  2FJB A;  2YLZ A;  4A9W A;  2YR6 A;  1NG4 A;  3GRS A;  5CKU A;  3KLJ A;  2F5Z A;  1JEH A;  1JNR A;  1PS9 A;  3ALM A;  3GMC A;  1EBD A;  3CNJ A;  1ONF A;  1H82 A;  3AE7 A;  4AOX A;  1NEN A;  4IA6 A;  1O95 A;  4Y4L A;  3HYW A;  1GEU A;  1EL9 A;  1CJC A;  1GSN A;  1H7X A;  3FBS A;  3DJJ A;  1PBD A;  3SXI A;  4YKG A;  2EQ9 A;  4IVM B;  3ALJ A;  3BI2 A;  1JNZ A;  4H7U A;  1F8S A;  4EQR A;  3OC4 A;  1YKJ A;  4H4T A;  2GR2 A;  2XLS A;  2V6O A;  4IA5 A;  2WPE A;  3V3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...