2XLRA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78asp mutant
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
446
structure length
446
Chain Sequence
MATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSDGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 159
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlrA02
4NZHA 1GRAA 1GRHA 1IUTA 3GRSA 4IVMB 2WS3A 1CJCA 2JAEA 3OZ2A 3AE7A 1Q9IA 5JCLA 2C65A 1L9CA 2XLTA 2X8CA 3GDPA 3P4RA 1CC2A 1RYIA 4EQXA 4B63A 2B7SA 3PS9A 2GAGB 5C3JA 5IQ4A 3NN0X 4NEVA 5JCNA 1KDGA 4YT0A 4CY8A 1H6VA 2W0HA 2YG3A 1TDNA 3ZYXA 2FJEA 2RABA 1D4CA 1PXBA 3G5SA 2TPRA 3UOVA 1EL5A 4H50A 4H4QA 1JNRA 3CTYA 2Q6UA 3NK2X 3CN8A 2Q7VA 4U2LA 3II4A 1ZMDA 1DOEA 2B9YA 2Y6RA 1CC6A 1MOKA 3AD7B 3AE3A 3SFDA 1COYA 1PJ5A 3NH3X 1H7XA 2VQ7A 3AE2A 2C73A 4X4JA 4CCRA 4K8DA 2BK4A 4J57A 3CNPA 2UZZA 1F6MA 5EB5A 4YWOA 2XYOA 3AEAA 3DJDA 3EAOA 1ZOYA 2ACZA 4B65A 4A5LA 1ZOVA 3V3OA 3ABVA 4J36A 1FEAA 1Y0PA 4JNAA 4GRTA 3GYIA 4K5SA 4TLZA 2YG7A 4B69A 4B64A 3NLCA 2R9ZA 4H2RA 1VRQB 2R0PA 4ICYA 4X9MA 1KFYA 2XLPA 2YLRA 3AYJA 3K7QX 2C3DA 4USQA 1QLBA 4AOXA 4IA5A 2WDQA 5CKUA 1IUWA 1D7LA 4UP3A 3AEBA 2V3BA 4H4RA 4GF7A 1DJQA 1DODA 2GB0A 1O5WA 4EMWA 2B76A 2FBWA 2BS4A 1PBFA 2DKHA 2WQYA 2XDOA 1GXFA 4REKA 1NHRA 3R9UA 3UKAA 4CRTA 3QVPA 1XANA 2BCPA 1GETA 4EM4A 1YQ4A 1DNCA 3VR8A 5KVIA 4DNAA 2XLRA 4Z43A 4TLXA 3DGHA 3LB8A 1TDKA 3O0HA 2VZ2A 2YR4A 1VDCA 3PO7A 4H4PA 4CBQA 1HYUA 3BNMA 4U8PA 1OJCA 2R0GA 3VR9A 3AXBA 1GOSA 1REOA 1NENA 1S2YA 2A89A 3SGLA 2NVKX 2JB3A 2YLTA 3SFEA 4EQWA 1IUUA 1JRYA 3NYEA 3GWFA 4IA6A 3ALJA 2IVDA 4Z25A 1D5TA 1NAAA 2OAMA 1QJDA 2YM1A 2WP9A 4A6NB 1LV0A 4JQ9A 3AE1A 4EMJA 1VQWA 2C64A 2IVEA 2XFOA 4AP3A 3LJPA 1PBDA 1GALA 2YLWA 3F8PA 3ICRA 2VRMA 4H4YA 1L9EA 4K5RA 4XWRA 2BXSA 2WOIA 3P1WA 1F3PA 1TDEA 1E1LA 4K2XA 2FJDA 2YM2A 5BUKA 1GESA 2QAEA 3GWDA 3GRTA 1ZKQA 4A6NA 4U8OA 3CNJA 3NK0X 2X8HA 2BC1A 1O94A 2VVLG 3UKFA 5M10A 2GRTA 4AP1A 1EL8A 3D8XA 1GRTA 2EQ7A 3D1CA 3KPFA 2C3CA 3DA1A 4GDEA 1P2EA 1OJ9A 3AWIA 2YG4A 2YG5A 2ZBWA 4NTCA 3VRBA 1F8RA 5KOXA 1KNRA 1AOGA 5IPYA 2WP5A 1CHUA 2XFPA 4KX6A 1JNZA 5HXIA 1ONFA 1PJ7A 1H7WA 1YKJA 2BK3A 4DSHA 1B37A 1GSNA 3P4PA 4AT2A 2GQFA 3CGCA 4BK3A 1OJDA 2C70A 3CGDA 3UOYA 5BRTA 1E6EA 1XHCA 2IIDA 2VQBA 2YVJA 4E0VA 1TDFA 1UKVG 3H8IA 3H8LA 4J34A 2QA1A 2WDRA 1DJNA 1IUSA 4D04A 4GDPA 2V61A 5C2TA 3NGCX 4OPGA 5CQFA 3UKPA 4H2QA 1PS9A 3SM8A 4BK1A 3ATQA 4B66A 3OC4A 1GV4A 2WP6A 4GUVA 3NIXA 4U8KA 1M6IA 2GH5A 5KRQA 1PN0A 1NHSA 3KA7A 1PDHA 1PBCA 4IVOB 4ZCCA 5JCMA 4K22A 3IWAA 2C7GA 3NYFA 4H4UA 4NTEA 2R46A 3RP6A 2APGA 3UKHA 3DH9A 1N4VA 4H4WA 1GT8A 3AD9B 4A79A 4UDQA 3LXDA 1V59A 4ADWA 4TM4A 4HA6A 4Z2RA 1KSSA 1LQUA 2R4EA 2ZZBA 3M0OA 3QFAA 4H4XA 1IUXA 2C75A 3G5QA 4H4VA 4YTNA 4H4TA 2J3NA 3QSMA 2WDVA 1PBEA 4XWZA 4RG4A 3LADA 3AE6A 4FDCB 2B9XA 4B68A 1XDIA 3NTDA 1IJHA 1K4QA 2BYBA 2I0ZA 3AECA 4BK2A 2A8XA 5JCIA 2YLXA 3ICSA 1TDOA 4K7ZA 2XVEA 3ALLA 3CNDA 1B5QA 4CY6A 4FX9A 4WCTA 3SQPA 2XLUA 5FMHA 2Y6QA 3AB1A 3QJ4A 4J33A 4BV6A 2GMHA 4YTPA 1OJAA 1PXAA 3I3LA 2JB1A 1GTHA 3DK9A 2HQMA 4EQSA 1ZX9A 3T37A 4Z26A 1JRZA 2GMJA 1NHPA 2AQJA 1KNPA 3GSIA 5BULA 4USRA 4FK1C 1GREA 3ICTA 5U63A 2BXRA 2R4JA 5IQ1A 5U1OA 3DJEA 1TYPA 2BS3A 2YG6A 3C4NA 4FK1A 4YTMA 1LPFA 1GRFA 3CPIG 2EQ9A 3NHOX 3UTHA 2OALA 3NRNA 5EBKA 3REDA 3UOXA 3BI2A 3CPHG 2WETA 4JDRA 1S2QA 1ZMCA 4O5UA 4OPCA 4APNA 1O95A 5J60A 3E1TA 3NG7X 2GAHB 1BWCA 3V3NA 3AEEA 3FIMB 3NK1X 1H84A 4IV9A 3CNSA 1BF3A 1CC4A 2AR8A 1K0JA 1DXLA 2WHDA 3B6DA 2EQ8A 4JN9A 3DJJA 4A65A 3AEDA 3GMBA 4YSYA 5BVAA 3UKKA 2JK6A 4AOSA 4C77A 4ZN0A 4H4ZA 2BACA 3UCLA 5LV9A 4TM0A 4U8JA 3WE0A 2ARDA 3AYIA 4PABA 2V60A 1CJ3A 2VVLA 1SEZA 4YXDA 3H4KA 1GERA 1S3BA 4B1BA 3BI4A 2BA9A 4ZCDA 3RP8A 4GR1A 4RSLA 2CVJA 1DOCA 2YVFA 4B67A 2X99A 2XVHA 2WOVA 4Y4LA 4CCQA 3IHGA 4EQRA 1NDAA 4J56A 2GR3A 5JCKA 2GQWA 3L8KA 4C5OA 3K30A 4OPDA 2GV8A 4BJZA 3CIRA 3UP5A 2YWLA 3V76A 3UTFA 5FS7A 1H83A 4J2WA 4UDPA 1GTEA 4UDRA 1PJ6A 2Z5YA 1E39A 1FL2A 1CJ2A 3UTEA 1F8SA 1KSUA 1ZK7A 4A7AA 2FJAA 2CULA 3NNEA 5DBJA 2C72A 4P9SA 3BI5A 4U2SA 2X50A 4LA1A 4U8IA 2JB2A 2X8GA 3COXA 3PVCA 4Z2TA 4NEWA 2AAQA 1DOBA 2JBVA 3L1RA 1ELIA 1YQZA 3LZWA 3GDNA 3QSEA 4H7UA 4LU6A 2XFUA 2XLSA 2BC0A 2VVMA 1E1NA 2YVGA 3UKLA 1BGJA 1Z6LA 3JSKA 2H88A 2Q0LA 4OPIA 3UKQA 2GEWA 2ZZ0A 3M13A 1EL7A 2E1MA 2QCUA 2XFNA 3GMCA 1D4EA 4H2PA 3C4AA 4BJYA 3P4QA 3EANA 4OPLA 4M52A 3P4SA 4CNKA 3UP4A 2XFQA 3IC9A 2YLSA 2YLZA 3KD9A 3Q6JA 5L46A 1N1PA 2R0CA 4BURA 3NN6X 4YSZA 2E4GA 2C66A 3QVRA 4I59A 3AYLA 4X9NA 3IF9A 4TM3A 3CPJG 2R45A 2WPEA 3RHAA 2CDUA 4U8NA 4DGKA 1PHHA 3F8RA 3Q9TA 4ECHA 1GPEA 3EPTA 4OVIA 1LTXR 3NYCA 1H81A 3AD8B 3DJGX 1K0LA 2BABA 1IUVA 3FG2P 5TR3A 1N4WA 1CBOA 2ZZCA 3NKSA 1H86A 5EOWA 4C74A 2Z5XA 2EQ6A 2GR2A 2PHHA 1GRBA 4JY2A 2A87A 3CNTA 2V6OA 3UTGA 4Z44A 2WBAA 3IHMA 3I6DA 5HYMA 3VRAA 3CGBA 2B9WA 1W4XA 1VG9A 1D7YA 3AE5A 1MO9A 2DKIA 5HHFA 1E1KA 1NEKA 2F5ZA 3F8DA 1YQ3A 2C67A 5KXJA 4YSHA 2PYXA 2NPXA 2Q0KA 2QA2A 3UOZA 1CL0A 2B7RA 4JNQA 1QO8A 1OJTA 3C96A 3P9UA 1JEHA 4EIQA 1FOHA 1ZP0A 4EMIA 3LZXA 3G5RA 1ZY8A 2WOWA 4YSXA 1NHQA 1N4UA 1GRGA 5KWFA 1CJ4A 4H2NA 5GRTA 3ATRA 2OLNA 1YY5A 1JU2A 1LQTA 2WU2A 2RGHA 4GCMA 2TMDA 3FBSA 2O9ZA 3RNMA 3AEGA 5J7XA 5U25A 4A9WA 3URHA 2GF3A 5KOWA 4JY3A 2JKCA 5FS9A 1FECA 3FMWA 3BNUA 3FPZA 3NTAA 4J31A 3S61A 3GD3A 3NT6A 1RSGA 1BGNA 1D4DA 1E1MA 1TYTA 5FS8A 3LOVA 1EBDA 3ISHA 3B3RA 4XXGA 4CNJA 1FEBA 1Q1RA 2YR6A 1S3EA 4EIPA 5GSNA 1BZLA 2FJBA 2GR0A 2YQUA 3BHKA 1TRBA 3GD4A 4Z2UA 4KPRA 1X31B 1JRXA 3KKJA 3RP7A 3HZLA 2V3AA 3DK4A 2WESA 2X3NA 3ITJA 3VQRA 2XCGA 3CGEA 4D03A 2RGJA 3GYJA 4TM1A 1Y56B 3AE4A 4MJWA 4OCGA 1JOAA 2OA1A 4I58A 5FS6A 1H82A 2C76A 1B4VA 4RG3A 2E5VA 2VOUA 1FCDA 1NPXA 4U8MA 3KVEA 1ZDLA 4Z24A 2OLOA 1B8SA 1XPQA 2VRLA 1P2HA 2XVFA 1GNDA 3S5WA 2H89A 3DK8A 3EF6A 4Y4NA 1KF6A 4C3XA 2GVCA 4DSGA 4AT0A 4YKGA 1E7PA 1Y56A 1PXCA 1F8WA 2XVJA 3KLJA 2XVIA 2YR5A 3VRDB 3DMEA 4HB9A 3K7TA 2BK5A 2WU5A 1EL9A 1LVLA 1LJ1A 3ZDNA 4C3YA 3ADAB 3AEFA 3KU9A 1NG4A 4OPTA 4LIIA 2BCGG 5ER0A 3ALMA 3QSSA 1Q1WA 1RP0A 5M0ZA 1NG3A 4PAAA 2WPCA 3K7MX 1CF3A 2BS2A 1BKWA 3AE8A 1GEUA 4EM3A 4WX1A 1VG0A 1K0IA 4H4SA 4U2TA 1MXTA 3AE9A 4NTDA 4N9XA 5HY5A 1PBBA 1M64A 5EB4A 4U8LA 1L9DA 2RGOA 4YKFA 2WEUA 3QFBA 4Y4MA 5KVHA 2V5ZA 2YAUA 3M12A 3BHFA 1L0VA 4A99A 3DGZA 2GR1A 4O5QA 2CFYA 4OPUA 2WPFA
chains in the Genus database with same CATH superfamily
4NZHA 1GRAA 1GRHA 1IUTA 3GRSA 4IVMB 2WS3A 1CJCA 2JAEA 3OZ2A 3AE7A 1Q9IA 5JCLA 2C65A 1L9CA 2XLTA 2X8CA 3GDPA 3P4RA 1CC2A 1RYIA 2BRAA 4EQXA 4B63A 2B7SA 3PS9A 2GAGB 5C3JA 5IQ4A 3NN0X 4NEVA 5JCNA 3GYXA 1KDGA 4YT0A 4CY8A 1H6VA 2W0HA 2YG3A 1TDNA 3ZYXA 2FJEA 2RABA 1D4CA 1PXBA 3G5SA 2TPRA 3UOVA 1EL5A 4H50A 4H4QA 1JNRA 3CTYA 2Q6UA 3NK2X 3CN8A 2Q7VA 4U2LA 3II4A 1ZMDA 1DOEA 2B9YA 2Y6RA 1CC6A 1MOKA 3AD7B 3AE3A 3SFDA 1COYA 1PJ5A 3NH3X 3T2KA 1H7XA 2VQ7A 3AE2A 2C73A 4X4JA 4CCRA 4K8DA 2BK4A 4J57A 3CNPA 2UZZA 1F6MA 5EB5A 4YWOA 2XYOA 3AEAA 3DJDA 3EAOA 1ZOYA 2ACZA 4B65A 4A5LA 1ZOVA 3V3OA 3ABVA 3SXIA 4J36A 1FEAA 1Y0PA 4JNAA 4GRTA 3GYIA 4K5SA 4TLZA 2YG7A 4B69A 4B64A 3NLCA 2R9ZA 4H2RA 3T2ZA 1VRQB 2R0PA 4ICYA 4X9MA 1KFYA 2XLPA 2YLRA 3AYJA 3K7QX 2C3DA 4USQA 1QLBA 4AOXA 4IA5A 4II2A 2WDQA 5CKUA 1IUWA 1D7LA 4UP3A 3AEBA 2V3BA 4H4RA 4GF7A 1DJQA 1DODA 2GB0A 1O5WA 4EMWA 2B76A 2FBWA 2BS4A 1PBFA 2DKHA 2WQYA 2XDOA 1GXFA 4REKA 1NHRA 3R9UA 3UKAA 4CRTA 3QVPA 1XANA 2BCPA 1GETA 4EM4A 1YQ4A 1DNCA 3VR8A 5KVIA 4DNAA 2XLRA 4Z43A 4TLXA 3DGHA 3LB8A 4G6HA 1TDKA 3O0HA 2VZ2A 2YR4A 1VDCA 3PO7A 4H4PA 4CBQA 1HYUA 3BNMA 4U8PA 1OJCA 3SY4A 3T0KA 2R0GA 3VR9A 3AXBA 1GOSA 1REOA 1NENA 1S2YA 2A89A 3SGLA 2NVKX 2JB3A 2YLTA 3SFEA 4EQWA 1IUUA 1JRYA 3NYEA 3GWFA 4IA6A 3ALJA 2IVDA 4Z25A 1D5TA 1NAAA 2OAMA 1QJDA 2YM1A 2WP9A 4A6NB 4G73A 1LV0A 4JQ9A 3AE1A 4EMJA 1VQWA 2C64A 2IVEA 2XFOA 4AP3A 3HYWA 3LJPA 1PBDA 1GALA 2YLWA 3F8PA 3ICRA 2VRMA 4H4YA 1L9EA 4K5RA 4XWRA 2BXSA 2WOIA 3P1WA 1F3PA 1TDEA 1E1LA 4K2XA 2FJDA 2YM2A 5BUKA 1GESA 2QAEA 3GWDA 4NNJA 3GRTA 1ZKQA 4A6NA 4U8OA 3CNJA 3NK0X 2X8HA 2BC1A 1O94A 2VVLG 3UKFA 5M10A 2GRTA 4AP1A 1EL8A 3D8XA 1GRTA 2EQ7A 3D1CA 3KPFA 2C3CA 3DA1A 4GDEA 1P2EA 1OJ9A 3AWIA 2YG4A 2YG5A 2ZBWA 4NTCA 3VRBA 1F8RA 5KOXA 1KNRA 1AOGA 5IPYA 2WP5A 1CHUA 2XFPA 4KX6A 1JNZA 5HXIA 1ONFA 1PJ7A 1H7WA 1YKJA 2BK3A 4DSHA 1B37A 1GSNA 3P4PA 4AT2A 2C4CA 2GQFA 3CGCA 4BK3A 1OJDA 2C70A 3CGDA 3UOYA 5BRTA 1E6EA 1XHCA 2IIDA 2VQBA 2YVJA 4E0VA 1TDFA 1UKVG 3H8IA 3H8LA 3KPKA 4J34A 5KMRA 2QA1A 2WDRA 4GAVA 1DJNA 1IUSA 4D04A 3SYIA 4GDPA 2V61A 5C2TA 3NGCX 4OPGA 5CQFA 3UKPA 4H2QA 1PS9A 3SM8A 4BK1A 3ATQA 4B66A 3OC4A 1GV4A 2WP6A 4GUVA 3NIXA 4U8KA 1M6IA 2GH5A 5KRQA 1PN0A 1NHSA 3KA7A 1PDHA 1PBCA 4IVOB 4ZCCA 5JCMA 4K22A 3IWAA 2C7GA 3NYFA 4H4UA 4NTEA 2R46A 3RP6A 2APGA 3UKHA 3DH9A 1N4VA 4H4WA 5KMSA 1GT8A 3AD9B 4G6GA 4UDQA 3LXDA 3SZFA 4A79A 1V59A 4G9KA 4TM4A 4ADWA 4HA6A 4Z2RA 1KSSA 1LQUA 2R4EA 2ZZBA 3M0OA 3QFAA 4H4XA 1IUXA 2C75A 3G5QA 4H4VA 4YTNA 4H4TA 2J3NA 4II3A 3QSMA 2WDVA 1PBEA 4XWZA 4RG4A 3LADA 3AE6A 4FDCB 2B9XA 4B68A 1XDIA 3NTDA 1IJHA 1K4QA 2BYBA 2I0ZA 3AECA 4BK2A 2A8XA 5JCIA 2YLXA 3ICSA 1TDOA 4K7ZA 2XVEA 3ALLA 3CNDA 1B5QA 4CY6A 4FX9A 4WCTA 3SQPA 2XLUA 3HYVA 5FMHA 2Y6QA 3AB1A 3HYXA 3QJ4A 4J33A 4BV6A 2GMHA 4YTPA 1OJAA 1PXAA 3I3LA 2JB1A 1GTHA 3DK9A 2HQMA 4EQSA 1ZX9A 3T37A 4Z26A 1JRZA 2GMJA 1NHPA 4GAPA 2AQJA 1KNPA 3GSIA 3T2YA 5BULA 3SZCA 4USRA 4FK1C 1GREA 3ICTA 5KNLA 5U63A 2BXRA 2R4JA 5IQ1A 5U1OA 3DJEA 1TYPA 2BS3A 2YG6A 3C4NA 4FK1A 4YTMA 1LPFA 1GRFA 3CPIG 2EQ9A 3NHOX 3UTHA 2OALA 3NRNA 5EBKA 3REDA 3UOXA 3BI2A 3CPHG 2WETA 4JDRA 1S2QA 1ZMCA 4O5UA 4OPCA 4APNA 1O95A 5J60A 3E1TA 3NG7X 2GAHB 1BWCA 3V3NA 3AEEA 3FIMB 3NK1X 1H84A 4IV9A 3CNSA 1BF3A 1CC4A 2AR8A 1K0JA 1DXLA 2WHDA 3B6DA 2EQ8A 4JN9A 3T14A 3DJJA 5KMQA 4A65A 3AEDA 3GMBA 4YSYA 5BVAA 3SX6A 3UKKA 2JK6A 4AOSA 4C77A 4ZN0A 4H4ZA 2BACA 3UCLA 5LV9A 3SZ0A 4TM0A 4U8JA 3WE0A 2ARDA 3AYIA 4PABA 2V60A 1CJ3A 2VVLA 1SEZA 4YXDA 3H4KA 1GERA 1S3BA 4B1BA 3BI4A 2BA9A 4ZCDA 3RP8A 4GR1A 4RSLA 2CVJA 1DOCA 2YVFA 4B67A 2X99A 2XVHA 2WOVA 4Y4LA 4CCQA 3IHGA 4EQRA 1NDAA 4J56A 2GR3A 5JCKA 2GQWA 3L8KA 4C5OA 3K30A 4OPDA 2GV8A 4BJZA 3CIRA 3T31A 3UP5A 2YWLA 3V76A 3UTFA 5FS7A 1H83A 4J2WA 4UDPA 1GTEA 4UDRA 1PJ6A 2Z5YA 1E39A 1FL2A 1CJ2A 4NWZA 1F8SA 1KSUA 1ZK7A 3UTEA 4A7AA 2FJAA 2CULA 3NNEA 5DBJA 2C72A 4P9SA 3BI5A 4U2SA 2X50A 4LA1A 4U8IA 2JB2A 2X8GA 3COXA 3PVCA 4Z2TA 4NEWA 2AAQA 1DOBA 2JBVA 3L1RA 1ELIA 1YQZA 3LZWA 3GDNA 3QSEA 4H7UA 4LU6A 2XFUA 2XLSA 2BC0A 2VVMA 1E1NA 2YVGA 3UKLA 1BGJA 1Z6LA 3JSKA 2H88A 2Q0LA 4OPIA 3UKQA 2GEWA 2ZZ0A 3M13A 1EL7A 2E1MA 2QCUA 2XFNA 3GMCA 1D4EA 4H2PA 3C4AA 4BJYA 3P4QA 3EANA 4OPLA 4M52A 3P4SA 4CNKA 3UP4A 2XFQA 3IC9A 2YLSA 2YLZA 3KD9A 3Q6JA 5L46A 1N1PA 2R0CA 4BURA 3NN6X 4YSZA 2E4GA 2C66A 3QVRA 4I59A 3AYLA 4X9NA 3IF9A 4TM3A 3CPJG 2R45A 2WPEA 3RHAA 2CDUA 4U8NA 4DGKA 1PHHA 3F8RA 3Q9TA 4ECHA 1GPEA 3EPTA 4OVIA 1LTXR 3NYCA 1H81A 3AD8B 3DJGX 1K0LA 2BABA 1IUVA 3FG2P 5TR3A 1N4WA 1CBOA 2ZZCA 3NKSA 1H86A 5EOWA 2BRYA 4C74A 2Z5XA 2EQ6A 2GR2A 2PHHA 1GRBA 4JY2A 2A87A 3CNTA 2V6OA 3UTGA 4Z44A 2WBAA 3IHMA 3I6DA 5HYMA 3VRAA 3CGBA 2B9WA 1W4XA 1VG9A 1D7YA 3AE5A 1MO9A 2DKIA 5HHFA 1E1KA 1NEKA 2F5ZA 3F8DA 1YQ3A 2C67A 5KXJA 4YSHA 2PYXA 2NPXA 2Q0KA 2QA2A 3UOZA 1CL0A 2B7RA 4JNQA 1QO8A 1OJTA 3C96A 3P9UA 1JEHA 4EIQA 1FOHA 1ZP0A 4EMIA 3LZXA 3G5RA 1ZY8A 2WOWA 4YSXA 1NHQA 1N4UA 1GRGA 5KWFA 1CJ4A 4G74A 4H2NA 5GRTA 3ATRA 2OLNA 1YY5A 1JU2A 1LQTA 2WU2A 2RGHA 4GCMA 2TMDA 3FBSA 2O9ZA 3RNMA 3AEGA 5J7XA 5U25A 4A9WA 3URHA 2GF3A 5KOWA 4JY3A 2JKCA 5FS9A 1FECA 3FMWA 3BNUA 3FPZA 3NTAA 4J31A 3S61A 3GD3A 3NT6A 1RSGA 1BGNA 1D4DA 1E1MA 1TYTA 3CMMA 5FS8A 3LOVA 1EBDA 5KMPA 3ISHA 3B3RA 4XXGA 4CNJA 1FEBA 1Q1RA 2YR6A 1S3EA 4EIPA 5GSNA 1BZLA 2FJBA 2GR0A 2YQUA 3BHKA 1TRBA 3GD4A 4Z2UA 4KPRA 1X31B 1JRXA 3KKJA 3RP7A 3HZLA 2V3AA 3DK4A 2WESA 2X3NA 3ITJA 3VQRA 2XCGA 3CGEA 4D03A 2RGJA 3GYJA 4TM1A 1Y56B 3AE4A 4MJWA 4OCGA 1JOAA 2OA1A 4I58A 5FS6A 1H82A 2C76A 1B4VA 4RG3A 2E5VA 2VOUA 1FCDA 1NPXA 4U8MA 3KVEA 1ZDLA 4Z24A 2OLOA 1B8SA 1XPQA 2VRLA 1P2HA 2XVFA 1GNDA 3S5WA 2H89A 3DK8A 3EF6A 4Y4NA 1KF6A 4C3XA 2GVCA 4DSGA 4AT0A 4YKGA 1E7PA 1Y56A 1PXCA 1F8WA 2XVJA 3KLJA 3SZWA 2XVIA 2YR5A 3VRDB 3DMEA 4HB9A 3K7TA 2BK5A 2WU5A 1EL9A 1LVLA 1LJ1A 3ZDNA 4C3YA 3ADAB 3AEFA 3KU9A 1NG4A 4OPTA 4LIIA 2BCGG 5ER0A 3ALMA 3QSSA 1Q1WA 1RP0A 5M0ZA 1NG3A 4PAAA 2WPCA 3K7MX 1CF3A 2BS2A 1BKWA 3AE8A 1GEUA 4EM3A 4WX1A 1VG0A 1K0IA 4H4SA 4U2TA 1MXTA 3AE9A 4NTDA 4N9XA 5HY5A 1PBBA 1M64A 5EB4A 4U8LA 1L9DA 2RGOA 4YKFA 2WEUA 3QFBA 4Y4MA 5KVHA 2V5ZA 2YAUA 3M12A 3BHFA 1L0VA 4A99A 3DGZA 2GR1A 4O5QA 2CFYA 4OPUA 2WPFA
chains in the Genus database with same CATH topology
4NZHA 1GRAA 1GRHA 1IUTA 3GRSA 4IVMB 2WS3A 1CJCA 2JAEA 3OZ2A 3AE7A 1Q9IA 5JCLA 2C65A 1L9CA 2XLTA 2X8CA 3GDPA 3P4RA 1CC2A 1RYIA 2BRAA 4EQXA 4B63A 2B7SA 3PS9A 2GAGB 5C3JA 5IQ4A 3NN0X 4NEVA 5JCNA 3GYXA 1KDGA 4YT0A 4CY8A 1H6VA 2W0HA 2YG3A 1TDNA 3ZYXA 2FJEA 2RABA 1D4CA 1PXBA 3G5SA 2TPRA 3UOVA 1EL5A 4H50A 4H4QA 1JNRA 3CTYA 2Q6UA 3NK2X 3CN8A 2Q7VA 4U2LA 3II4A 1ZMDA 1DOEA 2B9YA 2Y6RA 1CC6A 1MOKA 3AD7B 3AE3A 3SFDA 1COYA 1PJ5A 3NH3X 3T2KA 1H7XA 2VQ7A 3AE2A 2C73A 4X4JA 4CCRA 4K8DA 2BK4A 4J57A 3CNPA 2UZZA 1F6MA 5EB5A 4YWOA 2XYOA 3AEAA 3DJDA 3EAOA 1ZOYA 2ACZA 4B65A 4A5LA 1ZOVA 3V3OA 3ABVA 3SXIA 4J36A 1FEAA 1Y0PA 4JNAA 4GRTA 3GYIA 4K5SA 4TLZA 2YG7A 4B69A 4B64A 3NLCA 2R9ZA 4H2RA 3T2ZA 1VRQB 2R0PA 4ICYA 4X9MA 1KFYA 2XLPA 2YLRA 3AYJA 3K7QX 2C3DA 4USQA 1QLBA 4AOXA 4IA5A 4II2A 2WDQA 5CKUA 1IUWA 1D7LA 4UP3A 3AEBA 2V3BA 4H4RA 4GF7A 1DJQA 1DODA 2GB0A 1O5WA 4EMWA 2B76A 2FBWA 2BS4A 1PBFA 2DKHA 2WQYA 2XDOA 1GXFA 4REKA 1NHRA 3R9UA 3UKAA 4CRTA 3QVPA 1XANA 2BCPA 1GETA 4EM4A 1YQ4A 1DNCA 3VR8A 5KVIA 4DNAA 2XLRA 4Z43A 4TLXA 3DGHA 3LB8A 4G6HA 1TDKA 3O0HA 2VZ2A 2YR4A 1VDCA 3PO7A 4H4PA 4CBQA 1HYUA 3BNMA 4U8PA 1OJCA 3SY4A 3T0KA 2R0GA 3VR9A 3AXBA 1GOSA 1REOA 1NENA 1S2YA 2A89A 3SGLA 2NVKX 2JB3A 2YLTA 3SFEA 4EQWA 1IUUA 1JRYA 3NYEA 3GWFA 4IA6A 3ALJA 2IVDA 4Z25A 1D5TA 1NAAA 2OAMA 1QJDA 2YM1A 2WP9A 4A6NB 4G73A 1LV0A 4JQ9A 3AE1A 4EMJA 1VQWA 2C64A 2IVEA 2XFOA 4AP3A 3HYWA 3LJPA 1PBDA 1GALA 2YLWA 3F8PA 3ICRA 2VRMA 4H4YA 1L9EA 4K5RA 4XWRA 2BXSA 2WOIA 3P1WA 1F3PA 1TDEA 1E1LA 4K2XA 2FJDA 2YM2A 5BUKA 1GESA 2QAEA 3GWDA 4NNJA 3GRTA 1ZKQA 4A6NA 4U8OA 3CNJA 3NK0X 2X8HA 2BC1A 1O94A 2VVLG 3UKFA 5M10A 2GRTA 4AP1A 1EL8A 3D8XA 1GRTA 2EQ7A 3D1CA 3KPFA 2C3CA 3DA1A 4GDEA 1P2EA 1OJ9A 3AWIA 2YG4A 2YG5A 2ZBWA 4NTCA 3VRBA 1F8RA 5KOXA 1KNRA 1AOGA 5IPYA 2WP5A 1CHUA 2XFPA 4KX6A 1JNZA 5HXIA 1ONFA 1PJ7A 1H7WA 1YKJA 2BK3A 4DSHA 1B37A 1GSNA 3P4PA 4AT2A 2C4CA 2GQFA 3CGCA 4BK3A 1OJDA 2C70A 3CGDA 3UOYA 5BRTA 1E6EA 1XHCA 2IIDA 2VQBA 2YVJA 4E0VA 1TDFA 1UKVG 3H8IA 3H8LA 3KPKA 4J34A 5KMRA 2QA1A 2WDRA 4GAVA 1DJNA 1IUSA 4D04A 3SYIA 4GDPA 2V61A 5C2TA 3NGCX 4OPGA 5CQFA 3UKPA 4H2QA 1PS9A 3SM8A 4BK1A 3ATQA 4B66A 3OC4A 1GV4A 2WP6A 4GUVA 3NIXA 4U8KA 1M6IA 2GH5A 5KRQA 1PN0A 1NHSA 3KA7A 1PDHA 1PBCA 4IVOB 4ZCCA 5JCMA 4K22A 3IWAA 2C7GA 3NYFA 4H4UA 4NTEA 2R46A 3RP6A 2APGA 3UKHA 3DH9A 1N4VA 4H4WA 5KMSA 1GT8A 3AD9B 4G6GA 4UDQA 3LXDA 3SZFA 4A79A 1V59A 4G9KA 4TM4A 4ADWA 4HA6A 4Z2RA 1KSSA 1LQUA 2R4EA 2ZZBA 3M0OA 3QFAA 4H4XA 1IUXA 2C75A 3G5QA 4H4VA 4YTNA 4H4TA 2J3NA 4II3A 3QSMA 2WDVA 1PBEA 4XWZA 4RG4A 3LADA 3AE6A 4FDCB 2B9XA 4B68A 1XDIA 3NTDA 1IJHA 1K4QA 2BYBA 2I0ZA 3AECA 4BK2A 2A8XA 5JCIA 2YLXA 3ICSA 1TDOA 4K7ZA 2XVEA 3ALLA 3CNDA 1B5QA 4CY6A 4FX9A 4WCTA 3SQPA 2XLUA 3HYVA 5FMHA 2Y6QA 3AB1A 3HYXA 3QJ4A 4J33A 4BV6A 2GMHA 4YTPA 1OJAA 1PXAA 3I3LA 2JB1A 1GTHA 3DK9A 2HQMA 4EQSA 1ZX9A 3T37A 4Z26A 1JRZA 2GMJA 1NHPA 4GAPA 2AQJA 1KNPA 3GSIA 3T2YA 5BULA 3SZCA 4USRA 4FK1C 1GREA 3ICTA 5KNLA 5U63A 2BXRA 2R4JA 5IQ1A 5U1OA 3DJEA 1TYPA 2BS3A 2YG6A 3C4NA 4FK1A 4YTMA 1LPFA 1GRFA 3CPIG 2EQ9A 3NHOX 3UTHA 2OALA 3NRNA 5EBKA 3REDA 3UOXA 3BI2A 3CPHG 2WETA 4JDRA 1S2QA 1ZMCA 4O5UA 4OPCA 4APNA 1O95A 5J60A 3E1TA 3NG7X 2GAHB 1BWCA 3V3NA 3AEEA 3FIMB 3NK1X 1H84A 4IV9A 3CNSA 1BF3A 1CC4A 2AR8A 1K0JA 1DXLA 2WHDA 3B6DA 2EQ8A 4JN9A 3T14A 3DJJA 5KMQA 4A65A 3AEDA 3GMBA 4YSYA 5BVAA 3SX6A 3UKKA 2JK6A 4AOSA 4C77A 4ZN0A 4H4ZA 2BACA 3UCLA 5LV9A 3SZ0A 4TM0A 4U8JA 3WE0A 2ARDA 3AYIA 4PABA 2V60A 1CJ3A 2VVLA 1SEZA 4YXDA 3H4KA 1GERA 1S3BA 4B1BA 3BI4A 2BA9A 4ZCDA 3RP8A 4GR1A 4RSLA 2CVJA 1DOCA 2YVFA 4B67A 2X99A 2XVHA 2WOVA 4Y4LA 4CCQA 3IHGA 4EQRA 1NDAA 4J56A 2GR3A 5JCKA 2GQWA 3L8KA 4C5OA 3K30A 4OPDA 2GV8A 4BJZA 3CIRA 3T31A 3UP5A 2YWLA 3V76A 3UTFA 5FS7A 1H83A 4J2WA 4UDPA 1GTEA 4UDRA 1PJ6A 2Z5YA 1E39A 1FL2A 1CJ2A 4NWZA 1F8SA 1KSUA 1ZK7A 3UTEA 4A7AA 2FJAA 2CULA 3NNEA 5DBJA 2C72A 4P9SA 3BI5A 4U2SA 2X50A 4LA1A 4U8IA 2JB2A 2X8GA 3COXA 3PVCA 4Z2TA 4NEWA 2AAQA 1DOBA 2JBVA 3L1RA 1ELIA 1YQZA 3LZWA 3GDNA 3QSEA 4H7UA 4LU6A 2XFUA 2XLSA 2BC0A 2VVMA 1E1NA 2YVGA 3UKLA 1BGJA 1Z6LA 3JSKA 2H88A 2Q0LA 4OPIA 3UKQA 2GEWA 2ZZ0A 3M13A 1EL7A 2E1MA 2QCUA 2XFNA 3GMCA 1D4EA 4H2PA 3C4AA 4BJYA 3P4QA 3EANA 4OPLA 4M52A 3P4SA 4CNKA 3UP4A 2XFQA 3IC9A 2YLSA 2YLZA 3KD9A 3Q6JA 5L46A 1N1PA 2R0CA 4BURA 3NN6X 4YSZA 2E4GA 2C66A 3QVRA 4I59A 3AYLA 4X9NA 3IF9A 4TM3A 3CPJG 2R45A 2WPEA 3RHAA 2CDUA 4U8NA 4DGKA 1PHHA 3F8RA 3Q9TA 4ECHA 1GPEA 3EPTA 4OVIA 1LTXR 3NYCA 1H81A 3AD8B 3DJGX 1K0LA 2BABA 1IUVA 3FG2P 5TR3A 1N4WA 1CBOA 2ZZCA 3NKSA 1H86A 5EOWA 2BRYA 4C74A 2Z5XA 2EQ6A 2GR2A 2PHHA 1GRBA 4JY2A 2A87A 3CNTA 2V6OA 3UTGA 4Z44A 2WBAA 3IHMA 3I6DA 5HYMA 3VRAA 3CGBA 2B9WA 1W4XA 1VG9A 1D7YA 3AE5A 1MO9A 2DKIA 5HHFA 1E1KA 1NEKA 2F5ZA 3F8DA 1YQ3A 2C67A 5KXJA 4YSHA 2PYXA 2NPXA 2Q0KA 2QA2A 3UOZA 1CL0A 2B7RA 4JNQA 1QO8A 1OJTA 3C96A 3P9UA 1JEHA 4EIQA 1FOHA 1ZP0A 4EMIA 3LZXA 3G5RA 1ZY8A 2WOWA 4YSXA 1NHQA 1N4UA 1GRGA 5KWFA 1CJ4A 4G74A 4H2NA 5GRTA 3ATRA 2OLNA 1YY5A 1JU2A 1LQTA 2WU2A 2RGHA 4GCMA 2TMDA 3FBSA 2O9ZA 3RNMA 3AEGA 5J7XA 5U25A 4A9WA 3URHA 2GF3A 5KOWA 4JY3A 2JKCA 5FS9A 1FECA 3FMWA 3BNUA 3FPZA 3NTAA 4J31A 3S61A 3GD3A 3NT6A 1RSGA 1BGNA 1D4DA 1E1MA 1TYTA 3CMMA 5FS8A 3LOVA 1EBDA 5KMPA 3ISHA 3B3RA 4XXGA 4CNJA 1FEBA 1Q1RA 2YR6A 1S3EA 4EIPA 5GSNA 1BZLA 2FJBA 2GR0A 2YQUA 3BHKA 1TRBA 3GD4A 4Z2UA 4KPRA 1X31B 1JRXA 3KKJA 3RP7A 3HZLA 2V3AA 3DK4A 2WESA 2X3NA 3ITJA 3VQRA 2XCGA 3CGEA 4D03A 2RGJA 3GYJA 4TM1A 1Y56B 3AE4A 4MJWA 4OCGA 1JOAA 2OA1A 4I58A 5FS6A 1H82A 2C76A 1B4VA 4RG3A 2E5VA 2VOUA 1FCDA 1NPXA 4U8MA 3KVEA 1ZDLA 4Z24A 2OLOA 1B8SA 1XPQA 2VRLA 1P2HA 2XVFA 1GNDA 3S5WA 2H89A 3DK8A 3EF6A 4Y4NA 1KF6A 4C3XA 2GVCA 4DSGA 4AT0A 4YKGA 1E7PA 1Y56A 1PXCA 1F8WA 2XVJA 3KLJA 3SZWA 2XVIA 2YR5A 3VRDB 3DMEA 4HB9A 3K7TA 2BK5A 2WU5A 1EL9A 1LVLA 1LJ1A 3ZDNA 4C3YA 3ADAB 3AEFA 3KU9A 1NG4A 4OPTA 4LIIA 2BCGG 5ER0A 3ALMA 3QSSA 1Q1WA 1RP0A 5M0ZA 1NG3A 4PAAA 2WPCA 3K7MX 1CF3A 2BS2A 1BKWA 3AE8A 1GEUA 4EM3A 4WX1A 1VG0A 1K0IA 4H4SA 4U2TA 1MXTA 3AE9A 4NTDA 4N9XA 5HY5A 1PBBA 1M64A 5EB4A 4U8LA 1L9DA 2RGOA 4YKFA 2WEUA 3QFBA 4Y4MA 5KVHA 2V5ZA 2YAUA 3M12A 3BHFA 1L0VA 4A99A 3DGZA 2GR1A 4O5QA 2CFYA 4OPUA 2WPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NZH A;  1GRA A;  1GRH A;  1IUT A;  3GRS A;  4IVM B;  2WS3 A;  1CJC A;  2JAE A;  3OZ2 A;  3AE7 A;  1Q9I A;  5JCL A;  2C65 A;  1L9C A;  2XLT A;  2X8C A;  3GDP A;  3P4R A;  1CC2 A;  1RYI A;  4EQX A;  4B63 A;  2B7S A;  3PS9 A;  2GAG B;  5C3J A;  5IQ4 A;  3NN0 X;  4NEV A;  5JCN A;  1KDG A;  4YT0 A;  4CY8 A;  1H6V A;  2W0H A;  2YG3 A;  1TDN A;  3ZYX A;  2FJE A;  2RAB A;  1D4C A;  1PXB A;  3G5S A;  2TPR A;  3UOV A;  1EL5 A;  4H50 A;  4H4Q A;  1JNR A;  3CTY A;  2Q6U A;  3NK2 X;  3CN8 A;  2Q7V A;  4U2L A;  3II4 A;  1ZMD A;  1DOE A;  2B9Y A;  2Y6R A;  1CC6 A;  1MOK A;  3AD7 B;  3AE3 A;  3SFD A;  1COY A;  1PJ5 A;  3NH3 X;  1H7X A;  2VQ7 A;  3AE2 A;  2C73 A;  4X4J A;  4CCR A;  4K8D A;  2BK4 A;  4J57 A;  3CNP A;  2UZZ A;  1F6M A;  5EB5 A;  4YWO A;  2XYO A;  3AEA A;  3DJD A;  3EAO A;  1ZOY A;  2ACZ A;  4B65 A;  4A5L A;  1ZOV A;  3V3O A;  3ABV A;  4J36 A;  1FEA A;  1Y0P A;  4JNA A;  4GRT A;  3GYI A;  4K5S A;  4TLZ A;  2YG7 A;  4B69 A;  4B64 A;  3NLC A;  2R9Z A;  4H2R A;  1VRQ B;  2R0P A;  4ICY A;  4X9M A;  1KFY A;  2XLP A;  2YLR A;  3AYJ A;  3K7Q X;  2C3D A;  4USQ A;  1QLB A;  4AOX A;  4IA5 A;  2WDQ A;  5CKU A;  1IUW A;  1D7L A;  4UP3 A;  3AEB A;  2V3B A;  4H4R A;  4GF7 A;  1DJQ A;  1DOD A;  2GB0 A;  1O5W A;  4EMW A;  2B76 A;  2FBW A;  2BS4 A;  1PBF A;  2DKH A;  2WQY A;  2XDO A;  1GXF A;  4REK A;  1NHR A;  3R9U A;  3UKA A;  4CRT A;  3QVP A;  1XAN A;  2BCP A;  1GET A;  4EM4 A;  1YQ4 A;  1DNC A;  3VR8 A;  5KVI A;  4DNA A;  2XLR A;  4Z43 A;  4TLX A;  3DGH A;  3LB8 A;  1TDK A;  3O0H A;  2VZ2 A;  2YR4 A;  1VDC A;  3PO7 A;  4H4P A;  4CBQ A;  1HYU A;  3BNM A;  4U8P A;  1OJC A;  2R0G A;  3VR9 A;  3AXB A;  1GOS A;  1REO A;  1NEN A;  1S2Y A;  2A89 A;  3SGL A;  2NVK X;  2JB3 A;  2YLT A;  3SFE A;  4EQW A;  1IUU A;  1JRY A;  3NYE A;  3GWF A;  4IA6 A;  3ALJ A;  2IVD A;  4Z25 A;  1D5T A;  1NAA A;  2OAM A;  1QJD A;  2YM1 A;  2WP9 A;  4A6N B;  1LV0 A;  4JQ9 A;  3AE1 A;  4EMJ A;  1VQW A;  2C64 A;  2IVE A;  2XFO A;  4AP3 A;  3LJP A;  1PBD A;  1GAL A;  2YLW A;  3F8P A;  3ICR A;  2VRM A;  4H4Y A;  1L9E A;  4K5R A;  4XWR A;  2BXS A;  2WOI A;  3P1W A;  1F3P A;  1TDE A;  1E1L A;  4K2X A;  2FJD A;  2YM2 A;  5BUK A;  1GES A;  2QAE A;  3GWD A;  3GRT A;  1ZKQ A;  4A6N A;  4U8O A;  3CNJ A;  3NK0 X;  2X8H A;  2BC1 A;  1O94 A;  2VVL G;  3UKF A;  5M10 A;  2GRT A;  4AP1 A;  1EL8 A;  3D8X A;  1GRT A;  2EQ7 A;  3D1C A;  3KPF A;  2C3C A;  3DA1 A;  4GDE A;  1P2E A;  1OJ9 A;  3AWI A;  2YG4 A;  2YG5 A;  2ZBW A;  4NTC A;  3VRB A;  1F8R A;  5KOX A;  1KNR A;  1AOG A;  5IPY A;  2WP5 A;  1CHU A;  2XFP A;  4KX6 A;  1JNZ A;  5HXI A;  1ONF A;  1PJ7 A;  1H7W A;  1YKJ A;  2BK3 A;  4DSH A;  1B37 A;  1GSN A;  3P4P A;  4AT2 A;  2GQF A;  3CGC A;  4BK3 A;  1OJD A;  2C70 A;  3CGD A;  3UOY A;  5BRT A;  1E6E A;  1XHC A;  2IID A;  2VQB A;  2YVJ A;  4E0V A;  1TDF A;  1UKV G;  3H8I A;  3H8L A;  4J34 A;  2QA1 A;  2WDR A;  1DJN A;  1IUS A;  4D04 A;  4GDP A;  2V61 A;  5C2T A;  3NGC X;  4OPG A;  5CQF A;  3UKP A;  4H2Q A;  1PS9 A;  3SM8 A;  4BK1 A;  3ATQ A;  4B66 A;  3OC4 A;  1GV4 A;  2WP6 A;  4GUV A;  3NIX A;  4U8K A;  1M6I A;  2GH5 A;  5KRQ A;  1PN0 A;  1NHS A;  3KA7 A;  1PDH A;  1PBC A;  4IVO B;  4ZCC A;  5JCM A;  4K22 A;  3IWA A;  2C7G A;  3NYF A;  4H4U A;  4NTE A;  2R46 A;  3RP6 A;  2APG A;  3UKH A;  3DH9 A;  1N4V A;  4H4W A;  1GT8 A;  3AD9 B;  4A79 A;  4UDQ A;  3LXD A;  1V59 A;  4ADW A;  4TM4 A;  4HA6 A;  4Z2R A;  1KSS A;  1LQU A;  2R4E A;  2ZZB A;  3M0O A;  3QFA A;  4H4X A;  1IUX A;  2C75 A;  3G5Q A;  4H4V A;  4YTN A;  4H4T A;  2J3N A;  3QSM A;  2WDV A;  1PBE A;  4XWZ A;  4RG4 A;  3LAD A;  3AE6 A;  4FDC B;  2B9X A;  4B68 A;  1XDI A;  3NTD A;  1IJH A;  1K4Q A;  2BYB A;  2I0Z A;  3AEC A;  4BK2 A;  2A8X A;  5JCI A;  2YLX A;  3ICS A;  1TDO A;  4K7Z A;  2XVE A;  3ALL A;  3CND A;  1B5Q A;  4CY6 A;  4FX9 A;  4WCT A;  3SQP A;  2XLU A;  5FMH A;  2Y6Q A;  3AB1 A;  3QJ4 A;  4J33 A;  4BV6 A;  2GMH A;  4YTP A;  1OJA A;  1PXA A;  3I3L A;  2JB1 A;  1GTH A;  3DK9 A;  2HQM A;  4EQS A;  1ZX9 A;  3T37 A;  4Z26 A;  1JRZ A;  2GMJ A;  1NHP A;  2AQJ A;  1KNP A;  3GSI A;  5BUL A;  4USR A;  4FK1 C;  1GRE A;  3ICT A;  5U63 A;  2BXR A;  2R4J A;  5IQ1 A;  5U1O A;  3DJE A;  1TYP A;  2BS3 A;  2YG6 A;  3C4N A;  4FK1 A;  4YTM A;  1LPF A;  1GRF A;  3CPI G;  2EQ9 A;  3NHO X;  3UTH A;  2OAL A;  3NRN A;  5EBK A;  3RED A;  3UOX A;  3BI2 A;  3CPH G;  2WET A;  4JDR A;  1S2Q A;  1ZMC A;  4O5U A;  4OPC A;  4APN A;  1O95 A;  5J60 A;  3E1T A;  3NG7 X;  2GAH B;  1BWC A;  3V3N A;  3AEE A;  3FIM B;  3NK1 X;  1H84 A;  4IV9 A;  3CNS A;  1BF3 A;  1CC4 A;  2AR8 A;  1K0J A;  1DXL A;  2WHD A;  3B6D A;  2EQ8 A;  4JN9 A;  3DJJ A;  4A65 A;  3AED A;  3GMB A;  4YSY A;  5BVA A;  3UKK A;  2JK6 A;  4AOS A;  4C77 A;  4ZN0 A;  4H4Z A;  2BAC A;  3UCL A;  5LV9 A;  4TM0 A;  4U8J A;  3WE0 A;  2ARD A;  3AYI A;  4PAB A;  2V60 A;  1CJ3 A;  2VVL A;  1SEZ A;  4YXD A;  3H4K A;  1GER A;  1S3B A;  4B1B A;  3BI4 A;  2BA9 A;  4ZCD A;  3RP8 A;  4GR1 A;  4RSL A;  2CVJ A;  1DOC A;  2YVF A;  4B67 A;  2X99 A;  2XVH A;  2WOV A;  4Y4L A;  4CCQ A;  3IHG A;  4EQR A;  1NDA A;  4J56 A;  2GR3 A;  5JCK A;  2GQW A;  3L8K A;  4C5O A;  3K30 A;  4OPD A;  2GV8 A;  4BJZ A;  3CIR A;  3UP5 A;  2YWL A;  3V76 A;  3UTF A;  5FS7 A;  1H83 A;  4J2W A;  4UDP A;  1GTE A;  4UDR A;  1PJ6 A;  2Z5Y A;  1E39 A;  1FL2 A;  1CJ2 A;  3UTE A;  1F8S A;  1KSU A;  1ZK7 A;  4A7A A;  2FJA A;  2CUL A;  3NNE A;  5DBJ A;  2C72 A;  4P9S A;  3BI5 A;  4U2S A;  2X50 A;  4LA1 A;  4U8I A;  2JB2 A;  2X8G A;  3COX A;  3PVC A;  4Z2T A;  4NEW A;  2AAQ A;  1DOB A;  2JBV A;  3L1R A;  1ELI A;  1YQZ A;  3LZW A;  3GDN A;  3QSE A;  4H7U A;  4LU6 A;  2XFU A;  2XLS A;  2BC0 A;  2VVM A;  1E1N A;  2YVG A;  3UKL A;  1BGJ A;  1Z6L A;  3JSK A;  2H88 A;  2Q0L A;  4OPI A;  3UKQ A;  2GEW A;  2ZZ0 A;  3M13 A;  1EL7 A;  2E1M A;  2QCU A;  2XFN A;  3GMC A;  1D4E A;  4H2P A;  3C4A A;  4BJY A;  3P4Q A;  3EAN A;  4OPL A;  4M52 A;  3P4S A;  4CNK A;  3UP4 A;  2XFQ A;  3IC9 A;  2YLS A;  2YLZ A;  3KD9 A;  3Q6J A;  5L46 A;  1N1P A;  2R0C A;  4BUR A;  3NN6 X;  4YSZ A;  2E4G A;  2C66 A;  3QVR A;  4I59 A;  3AYL A;  4X9N A;  3IF9 A;  4TM3 A;  3CPJ G;  2R45 A;  2WPE A;  3RHA A;  2CDU A;  4U8N A;  4DGK A;  1PHH A;  3F8R A;  3Q9T A;  4ECH A;  1GPE A;  3EPT A;  4OVI A;  1LTX R;  3NYC A;  1H81 A;  3AD8 B;  3DJG X;  1K0L A;  2BAB A;  1IUV A;  3FG2 P;  5TR3 A;  1N4W A;  1CBO A;  2ZZC A;  3NKS A;  1H86 A;  5EOW A;  4C74 A;  2Z5X A;  2EQ6 A;  2GR2 A;  2PHH A;  1GRB A;  4JY2 A;  2A87 A;  3CNT A;  2V6O A;  3UTG A;  4Z44 A;  2WBA A;  3IHM A;  3I6D A;  5HYM A;  3VRA A;  3CGB A;  2B9W A;  1W4X A;  1VG9 A;  1D7Y A;  3AE5 A;  1MO9 A;  2DKI A;  5HHF A;  1E1K A;  1NEK A;  2F5Z A;  3F8D A;  1YQ3 A;  2C67 A;  5KXJ A;  4YSH A;  2PYX A;  2NPX A;  2Q0K A;  2QA2 A;  3UOZ A;  1CL0 A;  2B7R A;  4JNQ A;  1QO8 A;  1OJT A;  3C96 A;  3P9U A;  1JEH A;  4EIQ A;  1FOH A;  1ZP0 A;  4EMI A;  3LZX A;  3G5R A;  1ZY8 A;  2WOW A;  4YSX A;  1NHQ A;  1N4U A;  1GRG A;  5KWF A;  1CJ4 A;  4H2N A;  5GRT A;  3ATR A;  2OLN A;  1YY5 A;  1JU2 A;  1LQT A;  2WU2 A;  2RGH A;  4GCM A;  2TMD A;  3FBS A;  2O9Z A;  3RNM A;  3AEG A;  5J7X A;  5U25 A;  4A9W A;  3URH A;  2GF3 A;  5KOW A;  4JY3 A;  2JKC A;  5FS9 A;  1FEC A;  3FMW A;  3BNU A;  3FPZ A;  3NTA A;  4J31 A;  3S61 A;  3GD3 A;  3NT6 A;  1RSG A;  1BGN A;  1D4D A;  1E1M A;  1TYT A;  5FS8 A;  3LOV A;  1EBD A;  3ISH A;  3B3R A;  4XXG A;  4CNJ A;  1FEB A;  1Q1R A;  2YR6 A;  1S3E A;  4EIP A;  5GSN A;  1BZL A;  2FJB A;  2GR0 A;  2YQU A;  3BHK A;  1TRB A;  3GD4 A;  4Z2U A;  4KPR A;  1X31 B;  1JRX A;  3KKJ A;  3RP7 A;  3HZL A;  2V3A A;  3DK4 A;  2WES A;  2X3N A;  3ITJ A;  3VQR A;  2XCG A;  3CGE A;  4D03 A;  2RGJ A;  3GYJ A;  4TM1 A;  1Y56 B;  3AE4 A;  4MJW A;  4OCG A;  1JOA A;  2OA1 A;  4I58 A;  5FS6 A;  1H82 A;  2C76 A;  1B4V A;  4RG3 A;  2E5V A;  2VOU A;  1FCD A;  1NPX A;  4U8M A;  3KVE A;  1ZDL A;  4Z24 A;  2OLO A;  1B8S A;  1XPQ A;  2VRL A;  1P2H A;  2XVF A;  1GND A;  3S5W A;  2H89 A;  3DK8 A;  3EF6 A;  4Y4N A;  1KF6 A;  4C3X A;  2GVC A;  4DSG A;  4AT0 A;  4YKG A;  1E7P A;  1Y56 A;  1PXC A;  1F8W A;  2XVJ A;  3KLJ A;  2XVI A;  2YR5 A;  3VRD B;  3DME A;  4HB9 A;  3K7T A;  2BK5 A;  2WU5 A;  1EL9 A;  1LVL A;  1LJ1 A;  3ZDN A;  4C3Y A;  3ADA B;  3AEF A;  3KU9 A;  1NG4 A;  4OPT A;  4LII A;  2BCG G;  5ER0 A;  3ALM A;  3QSS A;  1Q1W A;  1RP0 A;  5M0Z A;  1NG3 A;  4PAA A;  2WPC A;  3K7M X;  1CF3 A;  2BS2 A;  1BKW A;  3AE8 A;  1GEU A;  4EM3 A;  4WX1 A;  1VG0 A;  1K0I A;  4H4S A;  4U2T A;  1MXT A;  3AE9 A;  4NTD A;  4N9X A;  5HY5 A;  1PBB A;  1M64 A;  5EB4 A;  4U8L A;  1L9D A;  2RGO A;  4YKF A;  2WEU A;  3QFB A;  4Y4M A;  5KVH A;  2V5Z A;  2YAU A;  3M12 A;  3BHF A;  1L0V A;  4A99 A;  3DGZ A;  2GR1 A;  4O5Q A;  2CFY A;  4OPU A;  2WPF A; 
#chains in the Genus database with same CATH topology
 4NZH A;  1GRA A;  1GRH A;  1IUT A;  3GRS A;  4IVM B;  2WS3 A;  1CJC A;  2JAE A;  3OZ2 A;  3AE7 A;  1Q9I A;  5JCL A;  2C65 A;  1L9C A;  2XLT A;  2X8C A;  3GDP A;  3P4R A;  1CC2 A;  1RYI A;  2BRA A;  4EQX A;  4B63 A;  2B7S A;  3PS9 A;  2GAG B;  5C3J A;  5IQ4 A;  3NN0 X;  4NEV A;  5JCN A;  3GYX A;  1KDG A;  4YT0 A;  4CY8 A;  1H6V A;  2W0H A;  2YG3 A;  1TDN A;  3ZYX A;  2FJE A;  2RAB A;  1D4C A;  1PXB A;  3G5S A;  2TPR A;  3UOV A;  1EL5 A;  4H50 A;  4H4Q A;  1JNR A;  3CTY A;  2Q6U A;  3NK2 X;  3CN8 A;  2Q7V A;  4U2L A;  3II4 A;  1ZMD A;  1DOE A;  2B9Y A;  2Y6R A;  1CC6 A;  1MOK A;  3AD7 B;  3AE3 A;  3SFD A;  1COY A;  1PJ5 A;  3NH3 X;  3T2K A;  1H7X A;  2VQ7 A;  3AE2 A;  2C73 A;  4X4J A;  4CCR A;  4K8D A;  2BK4 A;  4J57 A;  3CNP A;  2UZZ A;  1F6M A;  5EB5 A;  4YWO A;  2XYO A;  3AEA A;  3DJD A;  3EAO A;  1ZOY A;  2ACZ A;  4B65 A;  4A5L A;  1ZOV A;  3V3O A;  3ABV A;  3SXI A;  4J36 A;  1FEA A;  1Y0P A;  4JNA A;  4GRT A;  3GYI A;  4K5S A;  4TLZ A;  2YG7 A;  4B69 A;  4B64 A;  3NLC A;  2R9Z A;  4H2R A;  3T2Z A;  1VRQ B;  2R0P A;  4ICY A;  4X9M A;  1KFY A;  2XLP A;  2YLR A;  3AYJ A;  3K7Q X;  2C3D A;  4USQ A;  1QLB A;  4AOX A;  4IA5 A;  4II2 A;  2WDQ A;  5CKU A;  1IUW A;  1D7L A;  4UP3 A;  3AEB A;  2V3B A;  4H4R A;  4GF7 A;  1DJQ A;  1DOD A;  2GB0 A;  1O5W A;  4EMW A;  2B76 A;  2FBW A;  2BS4 A;  1PBF A;  2DKH A;  2WQY A;  2XDO A;  1GXF A;  4REK A;  1NHR A;  3R9U A;  3UKA A;  4CRT A;  3QVP A;  1XAN A;  2BCP A;  1GET A;  4EM4 A;  1YQ4 A;  1DNC A;  3VR8 A;  5KVI A;  4DNA A;  2XLR A;  4Z43 A;  4TLX A;  3DGH A;  3LB8 A;  4G6H A;  1TDK A;  3O0H A;  2VZ2 A;  2YR4 A;  1VDC A;  3PO7 A;  4H4P A;  4CBQ A;  1HYU A;  3BNM A;  4U8P A;  1OJC A;  3SY4 A;  3T0K A;  2R0G A;  3VR9 A;  3AXB A;  1GOS A;  1REO A;  1NEN A;  1S2Y A;  2A89 A;  3SGL A;  2NVK X;  2JB3 A;  2YLT A;  3SFE A;  4EQW A;  1IUU A;  1JRY A;  3NYE A;  3GWF A;  4IA6 A;  3ALJ A;  2IVD A;  4Z25 A;  1D5T A;  1NAA A;  2OAM A;  1QJD A;  2YM1 A;  2WP9 A;  4A6N B;  4G73 A;  1LV0 A;  4JQ9 A;  3AE1 A;  4EMJ A;  1VQW A;  2C64 A;  2IVE A;  2XFO A;  4AP3 A;  3HYW A;  3LJP A;  1PBD A;  1GAL A;  2YLW A;  3F8P A;  3ICR A;  2VRM A;  4H4Y A;  1L9E A;  4K5R A;  4XWR A;  2BXS A;  2WOI A;  3P1W A;  1F3P A;  1TDE A;  1E1L A;  4K2X A;  2FJD A;  2YM2 A;  5BUK A;  1GES A;  2QAE A;  3GWD A;  4NNJ A;  3GRT A;  1ZKQ A;  4A6N A;  4U8O A;  3CNJ A;  3NK0 X;  2X8H A;  2BC1 A;  1O94 A;  2VVL G;  3UKF A;  5M10 A;  2GRT A;  4AP1 A;  1EL8 A;  3D8X A;  1GRT A;  2EQ7 A;  3D1C A;  3KPF A;  2C3C A;  3DA1 A;  4GDE A;  1P2E A;  1OJ9 A;  3AWI A;  2YG4 A;  2YG5 A;  2ZBW A;  4NTC A;  3VRB A;  1F8R A;  5KOX A;  1KNR A;  1AOG A;  5IPY A;  2WP5 A;  1CHU A;  2XFP A;  4KX6 A;  1JNZ A;  5HXI A;  1ONF A;  1PJ7 A;  1H7W A;  1YKJ A;  2BK3 A;  4DSH A;  1B37 A;  1GSN A;  3P4P A;  4AT2 A;  2C4C A;  2GQF A;  3CGC A;  4BK3 A;  1OJD A;  2C70 A;  3CGD A;  3UOY A;  5BRT A;  1E6E A;  1XHC A;  2IID A;  2VQB A;  2YVJ A;  4E0V A;  1TDF A;  1UKV G;  3H8I A;  3H8L A;  3KPK A;  4J34 A;  5KMR A;  2QA1 A;  2WDR A;  4GAV A;  1DJN A;  1IUS A;  4D04 A;  3SYI A;  4GDP A;  2V61 A;  5C2T A;  3NGC X;  4OPG A;  5CQF A;  3UKP A;  4H2Q A;  1PS9 A;  3SM8 A;  4BK1 A;  3ATQ A;  4B66 A;  3OC4 A;  1GV4 A;  2WP6 A;  4GUV A;  3NIX A;  4U8K A;  1M6I A;  2GH5 A;  5KRQ A;  1PN0 A;  1NHS A;  3KA7 A;  1PDH A;  1PBC A;  4IVO B;  4ZCC A;  5JCM A;  4K22 A;  3IWA A;  2C7G A;  3NYF A;  4H4U A;  4NTE A;  2R46 A;  3RP6 A;  2APG A;  3UKH A;  3DH9 A;  1N4V A;  4H4W A;  5KMS A;  1GT8 A;  3AD9 B;  4G6G A;  4UDQ A;  3LXD A;  3SZF A;  4A79 A;  1V59 A;  4G9K A;  4TM4 A;  4ADW A;  4HA6 A;  4Z2R A;  1KSS A;  1LQU A;  2R4E A;  2ZZB A;  3M0O A;  3QFA A;  4H4X A;  1IUX A;  2C75 A;  3G5Q A;  4H4V A;  4YTN A;  4H4T A;  2J3N A;  4II3 A;  3QSM A;  2WDV A;  1PBE A;  4XWZ A;  4RG4 A;  3LAD A;  3AE6 A;  4FDC B;  2B9X A;  4B68 A;  1XDI A;  3NTD A;  1IJH A;  1K4Q A;  2BYB A;  2I0Z A;  3AEC A;  4BK2 A;  2A8X A;  5JCI A;  2YLX A;  3ICS A;  1TDO A;  4K7Z A;  2XVE A;  3ALL A;  3CND A;  1B5Q A;  4CY6 A;  4FX9 A;  4WCT A;  3SQP A;  2XLU A;  3HYV A;  5FMH A;  2Y6Q A;  3AB1 A;  3HYX A;  3QJ4 A;  4J33 A;  4BV6 A;  2GMH A;  4YTP A;  1OJA A;  1PXA A;  3I3L A;  2JB1 A;  1GTH A;  3DK9 A;  2HQM A;  4EQS A;  1ZX9 A;  3T37 A;  4Z26 A;  1JRZ A;  2GMJ A;  1NHP A;  4GAP A;  2AQJ A;  1KNP A;  3GSI A;  3T2Y A;  5BUL A;  3SZC A;  4USR A;  4FK1 C;  1GRE A;  3ICT A;  5KNL A;  5U63 A;  2BXR A;  2R4J A;  5IQ1 A;  5U1O A;  3DJE A;  1TYP A;  2BS3 A;  2YG6 A;  3C4N A;  4FK1 A;  4YTM A;  1LPF A;  1GRF A;  3CPI G;  2EQ9 A;  3NHO X;  3UTH A;  2OAL A;  3NRN A;  5EBK A;  3RED A;  3UOX A;  3BI2 A;  3CPH G;  2WET A;  4JDR A;  1S2Q A;  1ZMC A;  4O5U A;  4OPC A;  4APN A;  1O95 A;  5J60 A;  3E1T A;  3NG7 X;  2GAH B;  1BWC A;  3V3N A;  3AEE A;  3FIM B;  3NK1 X;  1H84 A;  4IV9 A;  3CNS A;  1BF3 A;  1CC4 A;  2AR8 A;  1K0J A;  1DXL A;  2WHD A;  3B6D A;  2EQ8 A;  4JN9 A;  3T14 A;  3DJJ A;  5KMQ A;  4A65 A;  3AED A;  3GMB A;  4YSY A;  5BVA A;  3SX6 A;  3UKK A;  2JK6 A;  4AOS A;  4C77 A;  4ZN0 A;  4H4Z A;  2BAC A;  3UCL A;  5LV9 A;  3SZ0 A;  4TM0 A;  4U8J A;  3WE0 A;  2ARD A;  3AYI A;  4PAB A;  2V60 A;  1CJ3 A;  2VVL A;  1SEZ A;  4YXD A;  3H4K A;  1GER A;  1S3B A;  4B1B A;  3BI4 A;  2BA9 A;  4ZCD A;  3RP8 A;  4GR1 A;  4RSL A;  2CVJ A;  1DOC A;  2YVF A;  4B67 A;  2X99 A;  2XVH A;  2WOV A;  4Y4L A;  4CCQ A;  3IHG A;  4EQR A;  1NDA A;  4J56 A;  2GR3 A;  5JCK A;  2GQW A;  3L8K A;  4C5O A;  3K30 A;  4OPD A;  2GV8 A;  4BJZ A;  3CIR A;  3T31 A;  3UP5 A;  2YWL A;  3V76 A;  3UTF A;  5FS7 A;  1H83 A;  4J2W A;  4UDP A;  1GTE A;  4UDR A;  1PJ6 A;  2Z5Y A;  1E39 A;  1FL2 A;  1CJ2 A;  4NWZ A;  1F8S A;  1KSU A;  1ZK7 A;  3UTE A;  4A7A A;  2FJA A;  2CUL A;  3NNE A;  5DBJ A;  2C72 A;  4P9S A;  3BI5 A;  4U2S A;  2X50 A;  4LA1 A;  4U8I A;  2JB2 A;  2X8G A;  3COX A;  3PVC A;  4Z2T A;  4NEW A;  2AAQ A;  1DOB A;  2JBV A;  3L1R A;  1ELI A;  1YQZ A;  3LZW A;  3GDN A;  3QSE A;  4H7U A;  4LU6 A;  2XFU A;  2XLS A;  2BC0 A;  2VVM A;  1E1N A;  2YVG A;  3UKL A;  1BGJ A;  1Z6L A;  3JSK A;  2H88 A;  2Q0L A;  4OPI A;  3UKQ A;  2GEW A;  2ZZ0 A;  3M13 A;  1EL7 A;  2E1M A;  2QCU A;  2XFN A;  3GMC A;  1D4E A;  4H2P A;  3C4A A;  4BJY A;  3P4Q A;  3EAN A;  4OPL A;  4M52 A;  3P4S A;  4CNK A;  3UP4 A;  2XFQ A;  3IC9 A;  2YLS A;  2YLZ A;  3KD9 A;  3Q6J A;  5L46 A;  1N1P A;  2R0C A;  4BUR A;  3NN6 X;  4YSZ A;  2E4G A;  2C66 A;  3QVR A;  4I59 A;  3AYL A;  4X9N A;  3IF9 A;  4TM3 A;  3CPJ G;  2R45 A;  2WPE A;  3RHA A;  2CDU A;  4U8N A;  4DGK A;  1PHH A;  3F8R A;  3Q9T A;  4ECH A;  1GPE A;  3EPT A;  4OVI A;  1LTX R;  3NYC A;  1H81 A;  3AD8 B;  3DJG X;  1K0L A;  2BAB A;  1IUV A;  3FG2 P;  5TR3 A;  1N4W A;  1CBO A;  2ZZC A;  3NKS A;  1H86 A;  5EOW A;  2BRY A;  4C74 A;  2Z5X A;  2EQ6 A;  2GR2 A;  2PHH A;  1GRB A;  4JY2 A;  2A87 A;  3CNT A;  2V6O A;  3UTG A;  4Z44 A;  2WBA A;  3IHM A;  3I6D A;  5HYM A;  3VRA A;  3CGB A;  2B9W A;  1W4X A;  1VG9 A;  1D7Y A;  3AE5 A;  1MO9 A;  2DKI A;  5HHF A;  1E1K A;  1NEK A;  2F5Z A;  3F8D A;  1YQ3 A;  2C67 A;  5KXJ A;  4YSH A;  2PYX A;  2NPX A;  2Q0K A;  2QA2 A;  3UOZ A;  1CL0 A;  2B7R A;  4JNQ A;  1QO8 A;  1OJT A;  3C96 A;  3P9U A;  1JEH A;  4EIQ A;  1FOH A;  1ZP0 A;  4EMI A;  3LZX A;  3G5R A;  1ZY8 A;  2WOW A;  4YSX A;  1NHQ A;  1N4U A;  1GRG A;  5KWF A;  1CJ4 A;  4G74 A;  4H2N A;  5GRT A;  3ATR A;  2OLN A;  1YY5 A;  1JU2 A;  1LQT A;  2WU2 A;  2RGH A;  4GCM A;  2TMD A;  3FBS A;  2O9Z A;  3RNM A;  3AEG A;  5J7X A;  5U25 A;  4A9W A;  3URH A;  2GF3 A;  5KOW A;  4JY3 A;  2JKC A;  5FS9 A;  1FEC A;  3FMW A;  3BNU A;  3FPZ A;  3NTA A;  4J31 A;  3S61 A;  3GD3 A;  3NT6 A;  1RSG A;  1BGN A;  1D4D A;  1E1M A;  1TYT A;  3CMM A;  5FS8 A;  3LOV A;  1EBD A;  5KMP A;  3ISH A;  3B3R A;  4XXG A;  4CNJ A;  1FEB A;  1Q1R A;  2YR6 A;  1S3E A;  4EIP A;  5GSN A;  1BZL A;  2FJB A;  2GR0 A;  2YQU A;  3BHK A;  1TRB A;  3GD4 A;  4Z2U A;  4KPR A;  1X31 B;  1JRX A;  3KKJ A;  3RP7 A;  3HZL A;  2V3A A;  3DK4 A;  2WES A;  2X3N A;  3ITJ A;  3VQR A;  2XCG A;  3CGE A;  4D03 A;  2RGJ A;  3GYJ A;  4TM1 A;  1Y56 B;  3AE4 A;  4MJW A;  4OCG A;  1JOA A;  2OA1 A;  4I58 A;  5FS6 A;  1H82 A;  2C76 A;  1B4V A;  4RG3 A;  2E5V A;  2VOU A;  1FCD A;  1NPX A;  4U8M A;  3KVE A;  1ZDL A;  4Z24 A;  2OLO A;  1B8S A;  1XPQ A;  2VRL A;  1P2H A;  2XVF A;  1GND A;  3S5W A;  2H89 A;  3DK8 A;  3EF6 A;  4Y4N A;  1KF6 A;  4C3X A;  2GVC A;  4DSG A;  4AT0 A;  4YKG A;  1E7P A;  1Y56 A;  1PXC A;  1F8W A;  2XVJ A;  3KLJ A;  3SZW A;  2XVI A;  2YR5 A;  3VRD B;  3DME A;  4HB9 A;  3K7T A;  2BK5 A;  2WU5 A;  1EL9 A;  1LVL A;  1LJ1 A;  3ZDN A;  4C3Y A;  3ADA B;  3AEF A;  3KU9 A;  1NG4 A;  4OPT A;  4LII A;  2BCG G;  5ER0 A;  3ALM A;  3QSS A;  1Q1W A;  1RP0 A;  5M0Z A;  1NG3 A;  4PAA A;  2WPC A;  3K7M X;  1CF3 A;  2BS2 A;  1BKW A;  3AE8 A;  1GEU A;  4EM3 A;  4WX1 A;  1VG0 A;  1K0I A;  4H4S A;  4U2T A;  1MXT A;  3AE9 A;  4NTD A;  4N9X A;  5HY5 A;  1PBB A;  1M64 A;  5EB4 A;  4U8L A;  1L9D A;  2RGO A;  4YKF A;  2WEU A;  3QFB A;  4Y4M A;  5KVH A;  2V5Z A;  2YAU A;  3M12 A;  3BHF A;  1L0V A;  4A99 A;  3DGZ A;  2GR1 A;  4O5Q A;  2CFY A;  4OPU A;  2WPF A; 
#chains in the Genus database with same CATH homology
 4NZH A;  1GRA A;  1GRH A;  1IUT A;  3GRS A;  4IVM B;  2WS3 A;  1CJC A;  2JAE A;  3OZ2 A;  3AE7 A;  1Q9I A;  5JCL A;  2C65 A;  1L9C A;  2XLT A;  2X8C A;  3GDP A;  3P4R A;  1CC2 A;  1RYI A;  2BRA A;  4EQX A;  4B63 A;  2B7S A;  3PS9 A;  2GAG B;  5C3J A;  5IQ4 A;  3NN0 X;  4NEV A;  5JCN A;  3GYX A;  1KDG A;  4YT0 A;  4CY8 A;  1H6V A;  2W0H A;  2YG3 A;  1TDN A;  3ZYX A;  2FJE A;  2RAB A;  1D4C A;  1PXB A;  3G5S A;  2TPR A;  3UOV A;  1EL5 A;  4H50 A;  4H4Q A;  1JNR A;  3CTY A;  2Q6U A;  3NK2 X;  3CN8 A;  2Q7V A;  4U2L A;  3II4 A;  1ZMD A;  1DOE A;  2B9Y A;  2Y6R A;  1CC6 A;  1MOK A;  3AD7 B;  3AE3 A;  3SFD A;  1COY A;  1PJ5 A;  3NH3 X;  3T2K A;  1H7X A;  2VQ7 A;  3AE2 A;  2C73 A;  4X4J A;  4CCR A;  4K8D A;  2BK4 A;  4J57 A;  3CNP A;  2UZZ A;  1F6M A;  5EB5 A;  4YWO A;  2XYO A;  3AEA A;  3DJD A;  3EAO A;  1ZOY A;  2ACZ A;  4B65 A;  4A5L A;  1ZOV A;  3V3O A;  3ABV A;  3SXI A;  4J36 A;  1FEA A;  1Y0P A;  4JNA A;  4GRT A;  3GYI A;  4K5S A;  4TLZ A;  2YG7 A;  4B69 A;  4B64 A;  3NLC A;  2R9Z A;  4H2R A;  3T2Z A;  1VRQ B;  2R0P A;  4ICY A;  4X9M A;  1KFY A;  2XLP A;  2YLR A;  3AYJ A;  3K7Q X;  2C3D A;  4USQ A;  1QLB A;  4AOX A;  4IA5 A;  4II2 A;  2WDQ A;  5CKU A;  1IUW A;  1D7L A;  4UP3 A;  3AEB A;  2V3B A;  4H4R A;  4GF7 A;  1DJQ A;  1DOD A;  2GB0 A;  1O5W A;  4EMW A;  2B76 A;  2FBW A;  2BS4 A;  1PBF A;  2DKH A;  2WQY A;  2XDO A;  1GXF A;  4REK A;  1NHR A;  3R9U A;  3UKA A;  4CRT A;  3QVP A;  1XAN A;  2BCP A;  1GET A;  4EM4 A;  1YQ4 A;  1DNC A;  3VR8 A;  5KVI A;  4DNA A;  2XLR A;  4Z43 A;  4TLX A;  3DGH A;  3LB8 A;  4G6H A;  1TDK A;  3O0H A;  2VZ2 A;  2YR4 A;  1VDC A;  3PO7 A;  4H4P A;  4CBQ A;  1HYU A;  3BNM A;  4U8P A;  1OJC A;  3SY4 A;  3T0K A;  2R0G A;  3VR9 A;  3AXB A;  1GOS A;  1REO A;  1NEN A;  1S2Y A;  2A89 A;  3SGL A;  2NVK X;  2JB3 A;  2YLT A;  3SFE A;  4EQW A;  1IUU A;  1JRY A;  3NYE A;  3GWF A;  4IA6 A;  3ALJ A;  2IVD A;  4Z25 A;  1D5T A;  1NAA A;  2OAM A;  1QJD A;  2YM1 A;  2WP9 A;  4A6N B;  4G73 A;  1LV0 A;  4JQ9 A;  3AE1 A;  4EMJ A;  1VQW A;  2C64 A;  2IVE A;  2XFO A;  4AP3 A;  3HYW A;  3LJP A;  1PBD A;  1GAL A;  2YLW A;  3F8P A;  3ICR A;  2VRM A;  4H4Y A;  1L9E A;  4K5R A;  4XWR A;  2BXS A;  2WOI A;  3P1W A;  1F3P A;  1TDE A;  1E1L A;  4K2X A;  2FJD A;  2YM2 A;  5BUK A;  1GES A;  2QAE A;  3GWD A;  4NNJ A;  3GRT A;  1ZKQ A;  4A6N A;  4U8O A;  3CNJ A;  3NK0 X;  2X8H A;  2BC1 A;  1O94 A;  2VVL G;  3UKF A;  5M10 A;  2GRT A;  4AP1 A;  1EL8 A;  3D8X A;  1GRT A;  2EQ7 A;  3D1C A;  3KPF A;  2C3C A;  3DA1 A;  4GDE A;  1P2E A;  1OJ9 A;  3AWI A;  2YG4 A;  2YG5 A;  2ZBW A;  4NTC A;  3VRB A;  1F8R A;  5KOX A;  1KNR A;  1AOG A;  5IPY A;  2WP5 A;  1CHU A;  2XFP A;  4KX6 A;  1JNZ A;  5HXI A;  1ONF A;  1PJ7 A;  1H7W A;  1YKJ A;  2BK3 A;  4DSH A;  1B37 A;  1GSN A;  3P4P A;  4AT2 A;  2C4C A;  2GQF A;  3CGC A;  4BK3 A;  1OJD A;  2C70 A;  3CGD A;  3UOY A;  5BRT A;  1E6E A;  1XHC A;  2IID A;  2VQB A;  2YVJ A;  4E0V A;  1TDF A;  1UKV G;  3H8I A;  3H8L A;  3KPK A;  4J34 A;  5KMR A;  2QA1 A;  2WDR A;  4GAV A;  1DJN A;  1IUS A;  4D04 A;  3SYI A;  4GDP A;  2V61 A;  5C2T A;  3NGC X;  4OPG A;  5CQF A;  3UKP A;  4H2Q A;  1PS9 A;  3SM8 A;  4BK1 A;  3ATQ A;  4B66 A;  3OC4 A;  1GV4 A;  2WP6 A;  4GUV A;  3NIX A;  4U8K A;  1M6I A;  2GH5 A;  5KRQ A;  1PN0 A;  1NHS A;  3KA7 A;  1PDH A;  1PBC A;  4IVO B;  4ZCC A;  5JCM A;  4K22 A;  3IWA A;  2C7G A;  3NYF A;  4H4U A;  4NTE A;  2R46 A;  3RP6 A;  2APG A;  3UKH A;  3DH9 A;  1N4V A;  4H4W A;  5KMS A;  1GT8 A;  3AD9 B;  4G6G A;  4UDQ A;  3LXD A;  3SZF A;  4A79 A;  1V59 A;  4G9K A;  4TM4 A;  4ADW A;  4HA6 A;  4Z2R A;  1KSS A;  1LQU A;  2R4E A;  2ZZB A;  3M0O A;  3QFA A;  4H4X A;  1IUX A;  2C75 A;  3G5Q A;  4H4V A;  4YTN A;  4H4T A;  2J3N A;  4II3 A;  3QSM A;  2WDV A;  1PBE A;  4XWZ A;  4RG4 A;  3LAD A;  3AE6 A;  4FDC B;  2B9X A;  4B68 A;  1XDI A;  3NTD A;  1IJH A;  1K4Q A;  2BYB A;  2I0Z A;  3AEC A;  4BK2 A;  2A8X A;  5JCI A;  2YLX A;  3ICS A;  1TDO A;  4K7Z A;  2XVE A;  3ALL A;  3CND A;  1B5Q A;  4CY6 A;  4FX9 A;  4WCT A;  3SQP A;  2XLU A;  3HYV A;  5FMH A;  2Y6Q A;  3AB1 A;  3HYX A;  3QJ4 A;  4J33 A;  4BV6 A;  2GMH A;  4YTP A;  1OJA A;  1PXA A;  3I3L A;  2JB1 A;  1GTH A;  3DK9 A;  2HQM A;  4EQS A;  1ZX9 A;  3T37 A;  4Z26 A;  1JRZ A;  2GMJ A;  1NHP A;  4GAP A;  2AQJ A;  1KNP A;  3GSI A;  3T2Y A;  5BUL A;  3SZC A;  4USR A;  4FK1 C;  1GRE A;  3ICT A;  5KNL A;  5U63 A;  2BXR A;  2R4J A;  5IQ1 A;  5U1O A;  3DJE A;  1TYP A;  2BS3 A;  2YG6 A;  3C4N A;  4FK1 A;  4YTM A;  1LPF A;  1GRF A;  3CPI G;  2EQ9 A;  3NHO X;  3UTH A;  2OAL A;  3NRN A;  5EBK A;  3RED A;  3UOX A;  3BI2 A;  3CPH G;  2WET A;  4JDR A;  1S2Q A;  1ZMC A;  4O5U A;  4OPC A;  4APN A;  1O95 A;  5J60 A;  3E1T A;  3NG7 X;  2GAH B;  1BWC A;  3V3N A;  3AEE A;  3FIM B;  3NK1 X;  1H84 A;  4IV9 A;  3CNS A;  1BF3 A;  1CC4 A;  2AR8 A;  1K0J A;  1DXL A;  2WHD A;  3B6D A;  2EQ8 A;  4JN9 A;  3T14 A;  3DJJ A;  5KMQ A;  4A65 A;  3AED A;  3GMB A;  4YSY A;  5BVA A;  3SX6 A;  3UKK A;  2JK6 A;  4AOS A;  4C77 A;  4ZN0 A;  4H4Z A;  2BAC A;  3UCL A;  5LV9 A;  3SZ0 A;  4TM0 A;  4U8J A;  3WE0 A;  2ARD A;  3AYI A;  4PAB A;  2V60 A;  1CJ3 A;  2VVL A;  1SEZ A;  4YXD A;  3H4K A;  1GER A;  1S3B A;  4B1B A;  3BI4 A;  2BA9 A;  4ZCD A;  3RP8 A;  4GR1 A;  4RSL A;  2CVJ A;  1DOC A;  2YVF A;  4B67 A;  2X99 A;  2XVH A;  2WOV A;  4Y4L A;  4CCQ A;  3IHG A;  4EQR A;  1NDA A;  4J56 A;  2GR3 A;  5JCK A;  2GQW A;  3L8K A;  4C5O A;  3K30 A;  4OPD A;  2GV8 A;  4BJZ A;  3CIR A;  3T31 A;  3UP5 A;  2YWL A;  3V76 A;  3UTF A;  5FS7 A;  1H83 A;  4J2W A;  4UDP A;  1GTE A;  4UDR A;  1PJ6 A;  2Z5Y A;  1E39 A;  1FL2 A;  1CJ2 A;  4NWZ A;  1F8S A;  1KSU A;  1ZK7 A;  3UTE A;  4A7A A;  2FJA A;  2CUL A;  3NNE A;  5DBJ A;  2C72 A;  4P9S A;  3BI5 A;  4U2S A;  2X50 A;  4LA1 A;  4U8I A;  2JB2 A;  2X8G A;  3COX A;  3PVC A;  4Z2T A;  4NEW A;  2AAQ A;  1DOB A;  2JBV A;  3L1R A;  1ELI A;  1YQZ A;  3LZW A;  3GDN A;  3QSE A;  4H7U A;  4LU6 A;  2XFU A;  2XLS A;  2BC0 A;  2VVM A;  1E1N A;  2YVG A;  3UKL A;  1BGJ A;  1Z6L A;  3JSK A;  2H88 A;  2Q0L A;  4OPI A;  3UKQ A;  2GEW A;  2ZZ0 A;  3M13 A;  1EL7 A;  2E1M A;  2QCU A;  2XFN A;  3GMC A;  1D4E A;  4H2P A;  3C4A A;  4BJY A;  3P4Q A;  3EAN A;  4OPL A;  4M52 A;  3P4S A;  4CNK A;  3UP4 A;  2XFQ A;  3IC9 A;  2YLS A;  2YLZ A;  3KD9 A;  3Q6J A;  5L46 A;  1N1P A;  2R0C A;  4BUR A;  3NN6 X;  4YSZ A;  2E4G A;  2C66 A;  3QVR A;  4I59 A;  3AYL A;  4X9N A;  3IF9 A;  4TM3 A;  3CPJ G;  2R45 A;  2WPE A;  3RHA A;  2CDU A;  4U8N A;  4DGK A;  1PHH A;  3F8R A;  3Q9T A;  4ECH A;  1GPE A;  3EPT A;  4OVI A;  1LTX R;  3NYC A;  1H81 A;  3AD8 B;  3DJG X;  1K0L A;  2BAB A;  1IUV A;  3FG2 P;  5TR3 A;  1N4W A;  1CBO A;  2ZZC A;  3NKS A;  1H86 A;  5EOW A;  2BRY A;  4C74 A;  2Z5X A;  2EQ6 A;  2GR2 A;  2PHH A;  1GRB A;  4JY2 A;  2A87 A;  3CNT A;  2V6O A;  3UTG A;  4Z44 A;  2WBA A;  3IHM A;  3I6D A;  5HYM A;  3VRA A;  3CGB A;  2B9W A;  1W4X A;  1VG9 A;  1D7Y A;  3AE5 A;  1MO9 A;  2DKI A;  5HHF A;  1E1K A;  1NEK A;  2F5Z A;  3F8D A;  1YQ3 A;  2C67 A;  5KXJ A;  4YSH A;  2PYX A;  2NPX A;  2Q0K A;  2QA2 A;  3UOZ A;  1CL0 A;  2B7R A;  4JNQ A;  1QO8 A;  1OJT A;  3C96 A;  3P9U A;  1JEH A;  4EIQ A;  1FOH A;  1ZP0 A;  4EMI A;  3LZX A;  3G5R A;  1ZY8 A;  2WOW A;  4YSX A;  1NHQ A;  1N4U A;  1GRG A;  5KWF A;  1CJ4 A;  4G74 A;  4H2N A;  5GRT A;  3ATR A;  2OLN A;  1YY5 A;  1JU2 A;  1LQT A;  2WU2 A;  2RGH A;  4GCM A;  2TMD A;  3FBS A;  2O9Z A;  3RNM A;  3AEG A;  5J7X A;  5U25 A;  4A9W A;  3URH A;  2GF3 A;  5KOW A;  4JY3 A;  2JKC A;  5FS9 A;  1FEC A;  3FMW A;  3BNU A;  3FPZ A;  3NTA A;  4J31 A;  3S61 A;  3GD3 A;  3NT6 A;  1RSG A;  1BGN A;  1D4D A;  1E1M A;  1TYT A;  3CMM A;  5FS8 A;  3LOV A;  1EBD A;  5KMP A;  3ISH A;  3B3R A;  4XXG A;  4CNJ A;  1FEB A;  1Q1R A;  2YR6 A;  1S3E A;  4EIP A;  5GSN A;  1BZL A;  2FJB A;  2GR0 A;  2YQU A;  3BHK A;  1TRB A;  3GD4 A;  4Z2U A;  4KPR A;  1X31 B;  1JRX A;  3KKJ A;  3RP7 A;  3HZL A;  2V3A A;  3DK4 A;  2WES A;  2X3N A;  3ITJ A;  3VQR A;  2XCG A;  3CGE A;  4D03 A;  2RGJ A;  3GYJ A;  4TM1 A;  1Y56 B;  3AE4 A;  4MJW A;  4OCG A;  1JOA A;  2OA1 A;  4I58 A;  5FS6 A;  1H82 A;  2C76 A;  1B4V A;  4RG3 A;  2E5V A;  2VOU A;  1FCD A;  1NPX A;  4U8M A;  3KVE A;  1ZDL A;  4Z24 A;  2OLO A;  1B8S A;  1XPQ A;  2VRL A;  1P2H A;  2XVF A;  1GND A;  3S5W A;  2H89 A;  3DK8 A;  3EF6 A;  4Y4N A;  1KF6 A;  4C3X A;  2GVC A;  4DSG A;  4AT0 A;  4YKG A;  1E7P A;  1Y56 A;  1PXC A;  1F8W A;  2XVJ A;  3KLJ A;  3SZW A;  2XVI A;  2YR5 A;  3VRD B;  3DME A;  4HB9 A;  3K7T A;  2BK5 A;  2WU5 A;  1EL9 A;  1LVL A;  1LJ1 A;  3ZDN A;  4C3Y A;  3ADA B;  3AEF A;  3KU9 A;  1NG4 A;  4OPT A;  4LII A;  2BCG G;  5ER0 A;  3ALM A;  3QSS A;  1Q1W A;  1RP0 A;  5M0Z A;  1NG3 A;  4PAA A;  2WPC A;  3K7M X;  1CF3 A;  2BS2 A;  1BKW A;  3AE8 A;  1GEU A;  4EM3 A;  4WX1 A;  1VG0 A;  1K0I A;  4H4S A;  4U2T A;  1MXT A;  3AE9 A;  4NTD A;  4N9X A;  5HY5 A;  1PBB A;  1M64 A;  5EB4 A;  4U8L A;  1L9D A;  2RGO A;  4YKF A;  2WEU A;  3QFB A;  4Y4M A;  5KVH A;  2V5Z A;  2YAU A;  3M12 A;  3BHF A;  1L0V A;  4A99 A;  3DGZ A;  2GR1 A;  4O5Q A;  2CFY A;  4OPU A;  2WPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...