1H81A

Structure of polyamine oxidase in the reduced state
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
total genus 167
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h81A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h81A02
4Z2TA 4IA5A 4H2RA 3D1CA 4XXGA 1NAAA 3SQPA 4CY8A 5HYMA 5KRQA 4RG3A 1GEUA 2E4GA 1H86A 1S3BA 2YR6A 3NK0X 3CIRA 4EMJA 3QVPA 1FCDA 1ZY8A 2A87A 3NT6A 2B7SA 1EBDA 4H2NA 3KA7A 4U8KA 2Y6RA 3DMEA 4J31A 4JQ9A 1K0IA 4U2TA 2O9ZA 3LADA 2XLSA 3CNPA 1FEAA 2C67A 3NK1X 1PDHA 2X8HA 3DK4A 4UDQA 3AE4A 2WEUA 1Z6LA 4XWRA 4B67A 2WESA 1K4QA 2XDOA 2YM1A 2R4JA 2V61A 3CGCA 3CGDA 2CFYA 1E39A 2BK4A 1VQWA 3H8LA 2BS2A 2VVLG 1Q9IA 2X8CA 4O5QA 4EM3A 1NPXA 4OPLA 4GDPA 3VQRA 4BK1A 3QSMA 1PN0A 3GYJA 2GMHA 2OLOA 2CULA 5C2TA 1JRYA 1JOAA 5GRTA 2B9WA 3ICSA 4YSYA 3FMWA 1ZP0A 4GUVA 1JEHA 1F8WA 2GR2A 3DH9A 3BI5A 2XFQA 1RYIA 2R9ZA 1GRHA 1LVLA 2WPCA 4H4YA 4K5RA 4REKA 2WU5A 3IWAA 4X4JA 4CNJA 1W4XA 3GMBA 3ICTA 2XVFA 1IUUA 2BS3A 3IHMA 1YKJA 3LOVA 1PBCA 3GDNA 1NEKA 4UDPA 3UKHA 3C96A 4K5SA 1VDCA 1CC6A 5BUKA 3K30A 1PXAA 3KU9A 2BC0A 2B7RA 4Y4MA 4BURA 4C74A 1QLBA 4I58A 4YKFA 3R9UA 1KSUA 1LPFA 3GWFA 1TDKA 2GQFA 3M12A 3M13A 4IVMB 4IVOB 3LB8A 4Y4NA 3E1TA 3EANA 2RGOA 5FS6A 4A6NB 3CPIG 2RABA 3H8IA 4CNKA 5JCKA 3ALLA 4IV9A 4JY3A 1PXBA 2Q0LA 1EL9A 1YQZA 4Z2RA 1D7LA 2EQ6A 4B66A 3UTHA 3CN8A 3I3LA 3QJ4A 1GNDA 3AE5A 2XLTA 3KLJA 3UOZA 1E6EA 1NHRA 3K7TA 2R0PA 1Y56B 3DK9A 1GRBA 4LIIA 4ZCDA 2BYBA 1E1MA 4KPRA 3AE1A 2C70A 3AD8B 1SEZA 3K7MX 3G5RA 4H7UA 1ZMCA 4B64A 4GR1A 2BCGG 4U2SA 4K2XA 5JCIA 3NTDA 3FPZA 2DKIA 2YLWA 4N9XA 5EB5A 4CBQA 4EMWA 4DGKA 3VRAA 4M52A 2PHHA 1O94A 2XVEA 2QAEA 2XFNA 4YT0A 4O5UA 5DBJA 2GB0A 4C3XA 2R4EA 4OVIA 2Y6QA 1OJCA 1F6MA 2Q7VA 4OPIA 2X3NA 5FS8A 4BJYA 2C76A 2QA2A 4J33A 2Z5XA 2YR5A 4A5LA 3EPTA 3V3OA 1B8SA 1ZKQA 4H2PA 1K0LA 3C4NA 3P4QA 1EL7A 4HA6A 1S3EA 2F5ZA 4EM4A 4B63A 4OPCA 4OPGA 5FS9A 2GAGB 5L46A 4GF7A 1GSNA 2EQ7A 4YSHA 4J2WA 2WU2A 4I59A 1CL0A 1TRBA 2BA9A 2HQMA 2X99A 2XFPA 2YVFA 3IF9A 1GTHA 1IUSA 1DOEA 1N4VA 2H89A 5JCLA 1DJQA 5TR3A 4U8IA 4YSZA 3ZDNA 3S5WA 1L9CA 4K22A 4U8PA 5KOWA 2GQWA 1LV0A 3AE2A 2EQ9A 4OPTA 3DGZA 3KD9A 4H4TA 2PYXA 3ALJA 1XPQA 3EF6A 2VVMA 3CNSA 4X9MA 4YTNA 5J60A 3AE8A 2CVJA 5BVAA 2WOWA 2JB2A 3NN0X 2XVHA 3AEAA 3PO7A 3PVCA 5FS7A 4H4VA 3AD7B 3PS9A 3GWDA 4P9SA 2XFUA 3CTYA 1ONFA 2VRMA 1PBDA 4X9NA 2WS3A 1CF3A 1GRAA 3LXDA 5CQFA 2WP9A 2X50A 2APGA 2EQ8A 1IUXA 1D4CA 4B1BA 1H6VA 3HZLA 5GSNA 2WHDA 2GMJA 3ICRA 1FL2A 3DJJA 2WDQA 4Z43A 4H4PA 1V59A 2FJDA 1Y56A 2XLRA 2YG5A 1EL5A 3DK8A 1CJ3A 3SGLA 4RSLA 3AE6A 4NEVA 2IVEA 2Z5YA 4FK1A 4A99A 2XLPA 4ECHA 3NYFA 1KF6A 2YLXA 4IA6A 2VQBA 3AE9A 3KVEA 4J34A 1JNRA 4H4RA 4AP1A 5KVHA 3NG7X 3CGEA 4NTEA 1PBBA 3VR9A 1NHPA 2JK6A 3UKKA 4OPUA 4LU6A 1F8RA 3VRBA 4H2QA 5LV9A 1PHHA 4C77A 1GREA 4A7AA 2OA1A 3BI4A 3DGHA 4EIPA 4AP3A 1RP0A 3COXA 1GXFA 2JB1A 1LQTA 3ABVA 3GSIA 2V3AA 2C73A 2OAMA 4A79A 4TM0A 2FJAA 4APNA 2AQJA 2WOIA 4WCTA 4AT0A 4NTCA 2X8GA 2JB3A 3Q9TA 4GRTA 3GRTA 2YQUA 4JNAA 2C66A 3D8XA 1E1NA 4A65A 3WE0A 3QSEA 4DNAA 2YG3A 3VRDB 5IPYA 2NPXA 2V60A 2YLRA 3F8RA 1DNCA 2R0CA 3BNUA 3GD3A 4UP3A 1NG3A 2BK5A 1HYUA 3SM8A 1E1LA 5HXIA 1YQ4A 1KDGA 5KOXA 4ZN0A 5KWFA 2VVLA 3AEDA 1VRQB 1BGJA 1TDFA 2C75A 2YLTA 4TM3A 4CY6A 2YG6A 1MOKA 1TDOA 4FK1C 1F3PA 3AE7A 3P4SA 4YWOA 2YR4A 3RP8A 2ZBWA 3AD9B 1F8SA 3NGCX 4E0VA 1TDNA 2RGJA 3ATQA 3UTGA 1Q1RA 3G5SA 1H83A 3NK2X 1N4UA 5U63A 4Z25A 1Q1WA 4Z24A 3B6DA 3L1RA 1CJ2A 3IC9A 3RHAA 3T37A 4BK3A 1CC4A 3B3RA 2XFOA 3BHFA 2JAEA 4Z44A 1O95A 1ZOYA 2Q0KA 4YTMA 1GOSA 2UZZA 3QSSA 3RNMA 4YXDA 1O5WA 1PJ5A 2B76A 4BK2A 3UKFA 1IUTA 1NDAA 4Y4LA 1GPEA 3S61A 1XHCA 2YVGA 4Z2UA 3DJDA 1ZX9A 1KSSA 4MJWA 4U8LA 4USRA 3P4PA 1MO9A 2YG4A 3REDA 2C3DA 2XLUA 5U1OA 4H4ZA 4PAAA 3K7QX 3AB1A 5HHFA 3II4A 2R45A 1L0VA 3C4AA 3QFAA 5U25A 3SFDA 1BWCA 3GMCA 3AEFA 3UKLA 1PBEA 2E5VA 2VZ2A 4NTDA 3GYIA 1LQUA 2WOVA 4OCGA 4UDRA 2WPEA 4GCMA 1B4VA 3NLCA 2ARDA 2GV8A 2YLSA 2GVCA 2GRTA 2E1MA 2YM2A 5M0ZA 1NG4A 2RGHA 3UTEA 2OLNA 2YAUA 4PABA 4H4SA 4DSHA 2VQ7A 2C65A 2GR1A 3UOYA 1H7WA 2GAHB 4C5OA 4H4UA 4TLXA 1E7PA 4H50A 1DOCA 1K0JA 2WDVA 1QO8A 4NEWA 5KVIA 3CPJG 4B68A 1KFYA 2J3NA 4JY2A 1MXTA 1OJDA 1CJ4A 1BF3A 1D4DA 1FOHA 1JRZA 4EIQA 1OJ9A 1KNPA 3ATRA 3AEGA 2BCPA 5C3JA 4DSGA 1GV4A 4J57A 1IJHA 4CCQA 3I6DA 2BABA 2BS4A 2VRLA 2C64A 4A6NA 2R0GA 3P1WA 3ZYXA 4BJZA 3ADAB 4TM1A 1S2QA 3AXBA 1YQ3A 3AYJA 4U8OA 2JKCA 3DJEA 3Q6JA 1BKWA 4OPDA 1TYTA 4U8MA 5EBKA 2FBWA 1S2YA 2R46A 2GH5A 3ALMA 2AAQA 2WDRA 4NZHA 4TM4A 4RG4A 3AEBA 3NHOX 3IHGA 4HB9A 1H84A 1H81A 1DOBA 2BXSA 3NYEA 2IVDA 4YSXA 3FIMB 4FX9A 1RSGA 2ZZBA 3ITJA 1OJTA 3UKPA 5BULA 4J36A 1ELIA 3G5QA 2IIDA 3AWIA 1GERA 1D5TA 4EQWA 3P4RA 3OZ2A 4H4XA 2TMDA 3CNJA 4EQRA 3F8DA 1QJDA 5EB4A 1BZLA 1JRXA 3UOXA 2YWLA 4EQXA 2I0ZA 3UKAA 1ZK7A 4LA1A 4USQA 4CCRA 3AEEA 3UTFA 3NH3X 4WX1A 1M64A 2NVKX 3CGBA 2OALA 3CNDA 1ZOVA 4J56A 1BGNA 1B37A 1PXCA 1PJ7A 2WPFA 1GT8A 1N1PA 1CHUA 1OJAA 2GEWA 2JBVA 1LJ1A 4U8NA 1H82A 1TYPA 3QFBA 4H4QA 3O0HA 1GALA 2WBAA 3UP4A 2C7GA 3AE3A 5BRTA 3KPFA 2GF3A 1GRTA 2H88A 4K7ZA 3UOVA 2ZZCA 1UKVG 5IQ4A 2Q6UA 2XVIA 2V3BA 3URHA 4AOSA 2GR3A 1H7XA 1IUWA 1JNZA 3AECA 2BXRA 5EOWA 2WP5A 4BV6A 5HY5A 1IUVA 4A9WA 1NHSA 2B9YA 2WETA 3UCLA 2BACA 4B69A 2WQYA 5ER0A 1LTXR 5J7XA 1D7YA 2XYOA 1EL8A 4GDEA 1GETA 5JCMA 4JDRA 2W0HA 2YLZA 1CJCA 1TDEA 2FJEA 3AYIA 4TLZA 2BK3A 2XCGA 2BC1A 1NENA 1B5QA 1PBFA 1ZDLA 2V6OA 3GD4A 3H4KA 4CRTA 4EMIA 4Z26A 3NNEA 3GDPA 1COYA 1DODA 3OC4A 4ADWA 3UKQA 2C72A 2WP6A 2ZZ0A 2GR0A 1JU2A 3VR8A 5KXJA 1ZMDA 3CNTA 3BI2A 3V76A 4D04A 1NHQA 2YVJA 3FBSA 1XDIA 4ZCCA 1N4WA 3SFEA 3JSKA 3DA1A 1PJ6A 3FG2P 1L9DA 1GESA 1YY5A 1P2HA 3QVRA 3ISHA 5JCNA 1DJNA 1CBOA 2XVJA 2TPRA 3DJGX 2B9XA 3EAOA 3L8KA 3NTAA 3V3NA 2YG7A 2QCUA 1GTEA 5IQ1A 4U8JA 3M0OA 1P2EA 2CDUA 3NYCA 3AYLA 1REOA 3F8PA 2AR8A 4AOXA 5FMHA 3NIXA 1GRFA 5M10A 2V5ZA 1FEBA 2ACZA 1VG0A 3NRNA 4XWZA 4YKGA 3UP5A 4JNQA 2A89A 2C3CA 2QA1A 1DXLA 1PS9A 1XANA 2FJBA 1VG9A 3P9UA 4D03A 1Y0PA 1D4EA 3LZXA 1L9EA 4KX6A 4K8DA 1M6IA 1KNRA 4B65A 1AOGA 2VOUA 4JN9A 4U2LA 3LZWA 2A8XA 4FDCB 3LJPA 4EQSA 3GRSA 4ICYA 3RP7A 1CC2A 1X31B 1E1KA 3NN6X 1GRGA 4H4WA 3BNMA 2DKHA 3NKSA 4AT2A 3KKJA 3BHKA 3CPHG 1FECA 4C3YA 4YTPA 3RP6A 5CKUA
chains in the Genus database with same CATH superfamily
4G73A 4Z2TA 4IA5A 4H2RA 3D1CA 4XXGA 1NAAA 3SQPA 4CY8A 5HYMA 5KRQA 4RG3A 1GEUA 2E4GA 1H86A 1S3BA 2YR6A 3NK0X 3HYWA 3CIRA 4EMJA 3QVPA 1FCDA 1ZY8A 2A87A 3NT6A 2B7SA 1EBDA 4H2NA 3KA7A 4U8KA 2Y6RA 3DMEA 4J31A 4JQ9A 1K0IA 4U2TA 2O9ZA 3LADA 2XLSA 3CNPA 1FEAA 2C67A 3NK1X 1PDHA 2X8HA 3DK4A 4UDQA 3AE4A 2WEUA 1Z6LA 4XWRA 4B67A 2WESA 1K4QA 2XDOA 2YM1A 2R4JA 2V61A 3CGCA 3CGDA 2CFYA 1E39A 2BK4A 1VQWA 3H8LA 2BS2A 2VVLG 1Q9IA 2X8CA 3HYXA 4O5QA 4EM3A 1NPXA 4OPLA 4GDPA 3VQRA 4BK1A 3QSMA 1PN0A 3GYJA 2GMHA 2OLOA 2CULA 5C2TA 4G74A 1JRYA 1JOAA 5GRTA 2B9WA 3ICSA 4YSYA 4GAVA 3FMWA 3T2KA 1ZP0A 4GUVA 1JEHA 1F8WA 2GR2A 3DH9A 3BI5A 2XFQA 1RYIA 2R9ZA 1GRHA 1LVLA 2WPCA 4H4YA 4K5RA 4REKA 2WU5A 3IWAA 4X4JA 4CNJA 1W4XA 3GMBA 3ICTA 4G9KA 2XVFA 1IUUA 2BS3A 3IHMA 1YKJA 3LOVA 1PBCA 3GDNA 1NEKA 4UDPA 3UKHA 3C96A 4K5SA 1VDCA 2C4CA 1CC6A 5BUKA 3K30A 1PXAA 3KU9A 2BC0A 2B7RA 4Y4MA 4BURA 2BRAA 4C74A 3GYXA 1QLBA 4I58A 4YKFA 3R9UA 1KSUA 1LPFA 3GWFA 1TDKA 2GQFA 3M12A 3M13A 4IVMB 4IVOB 3LB8A 4Y4NA 3E1TA 3EANA 2RGOA 5FS6A 4A6NB 3CPIG 2RABA 3H8IA 4CNKA 5JCKA 3ALLA 4IV9A 4JY3A 1PXBA 2Q0LA 1EL9A 1YQZA 4Z2RA 1D7LA 2EQ6A 4B66A 3T2ZA 3UTHA 3CN8A 3I3LA 3QJ4A 1GNDA 3AE5A 2XLTA 3KLJA 3UOZA 1E6EA 1NHRA 3K7TA 2R0PA 1Y56B 3DK9A 1GRBA 4LIIA 4ZCDA 2BYBA 1E1MA 4KPRA 3AE1A 2C70A 3AD8B 1SEZA 3K7MX 3G5RA 4H7UA 1ZMCA 4B64A 4GR1A 2BCGG 3SZFA 4U2SA 4K2XA 5JCIA 3NTDA 3FPZA 2DKIA 2YLWA 4N9XA 5EB5A 4CBQA 4EMWA 4DGKA 3VRAA 4M52A 2PHHA 1O94A 2XVEA 2QAEA 2XFNA 4YT0A 4O5UA 5DBJA 2GB0A 4C3XA 2R4EA 4OVIA 2Y6QA 1OJCA 1F6MA 2Q7VA 4OPIA 2X3NA 5FS8A 4BJYA 2C76A 2QA2A 4J33A 2Z5XA 2YR5A 4A5LA 3HYVA 3EPTA 3V3OA 1B8SA 1ZKQA 4H2PA 1K0LA 3C4NA 3P4QA 1EL7A 4HA6A 1S3EA 5KMPA 2F5ZA 3SZ0A 4EM4A 4B63A 4OPCA 4OPGA 5FS9A 2GAGB 5L46A 4GF7A 1GSNA 2EQ7A 4YSHA 4J2WA 2WU2A 4I59A 1CL0A 1TRBA 2BA9A 2HQMA 2X99A 2XFPA 2YVFA 3IF9A 1GTHA 1IUSA 1DOEA 1N4VA 2H89A 5JCLA 1DJQA 5TR3A 4U8IA 4YSZA 3ZDNA 3S5WA 1L9CA 4K22A 4U8PA 5KOWA 2GQWA 1LV0A 3AE2A 2EQ9A 4OPTA 3DGZA 3KD9A 4H4TA 2PYXA 3ALJA 1XPQA 3EF6A 2VVMA 3CNSA 4X9MA 4YTNA 5J60A 3AE8A 5KMRA 2CVJA 5BVAA 2WOWA 2JB2A 3NN0X 2XVHA 3AEAA 3PO7A 3PVCA 5FS7A 4H4VA 3AD7B 3PS9A 3GWDA 2BRYA 4P9SA 2XFUA 3CTYA 1ONFA 2VRMA 1PBDA 4X9NA 2WS3A 1CF3A 1GRAA 3LXDA 5CQFA 2WP9A 2X50A 2APGA 2EQ8A 1IUXA 1D4CA 4B1BA 1H6VA 3HZLA 5GSNA 2WHDA 2GMJA 3ICRA 1FL2A 3DJJA 2WDQA 4Z43A 4H4PA 1V59A 2FJDA 1Y56A 2XLRA 2YG5A 1EL5A 3DK8A 1CJ3A 3SGLA 4RSLA 3AE6A 4NEVA 2IVEA 2Z5YA 4FK1A 4A99A 2XLPA 4ECHA 3NYFA 1KF6A 2YLXA 4IA6A 2VQBA 3AE9A 3KVEA 4J34A 1JNRA 4H4RA 4AP1A 5KVHA 3NG7X 3CGEA 4NTEA 1PBBA 3VR9A 1NHPA 2JK6A 3UKKA 4OPUA 4LU6A 1F8RA 3VRBA 4H2QA 5LV9A 1PHHA 4C77A 1GREA 4A7AA 2OA1A 3BI4A 3DGHA 4EIPA 4AP3A 1RP0A 3COXA 1GXFA 2JB1A 1LQTA 3ABVA 3GSIA 2V3AA 5KMSA 2C73A 2OAMA 4A79A 4GAPA 4TM0A 2FJAA 4APNA 2AQJA 2WOIA 4WCTA 4AT0A 4NTCA 2X8GA 2JB3A 3Q9TA 4GRTA 3GRTA 2YQUA 4JNAA 2C66A 3T0KA 3D8XA 1E1NA 4A65A 3WE0A 4NWZA 3QSEA 4DNAA 2YG3A 3VRDB 5IPYA 2NPXA 2V60A 2YLRA 3F8RA 1DNCA 2R0CA 3BNUA 3GD3A 4UP3A 1NG3A 2BK5A 1HYUA 3SM8A 1E1LA 5HXIA 1YQ4A 1KDGA 5KOXA 4ZN0A 3T14A 2VVLA 3AEDA 1VRQB 1BGJA 1TDFA 2C75A 2YLTA 4TM3A 4CY6A 2YG6A 1MOKA 1TDOA 4FK1C 1F3PA 3AE7A 3P4SA 4YWOA 2YR4A 3RP8A 2ZBWA 3AD9B 1F8SA 3NGCX 4E0VA 3SXIA 1TDNA 2RGJA 3ATQA 4II2A 1Q1RA 3UTGA 3G5SA 1H83A 3NK2X 1N4UA 5U63A 4Z25A 1Q1WA 4Z24A 3B6DA 3CMMA 1CJ2A 3IC9A 3L1RA 3RHAA 3T37A 4BK3A 5KWFA 1CC4A 3B3RA 2XFOA 3BHFA 2JAEA 4Z44A 1O95A 1ZOYA 2Q0KA 4YTMA 1GOSA 2UZZA 3QSSA 3RNMA 4YXDA 1O5WA 1PJ5A 2B76A 4BK2A 3UKFA 1IUTA 1NDAA 4Y4LA 1GPEA 3S61A 1XHCA 2YVGA 4Z2UA 3DJDA 1ZX9A 1KSSA 4MJWA 4U8LA 4USRA 3P4PA 1MO9A 2YG4A 3REDA 5KMQA 2C3DA 2XLUA 5U1OA 4H4ZA 4G6HA 4PAAA 3K7QX 3AB1A 5HHFA 3II4A 2R45A 1L0VA 3C4AA 3QFAA 5U25A 3SFDA 1BWCA 3GMCA 3AEFA 3UKLA 1PBEA 2E5VA 2VZ2A 4NTDA 3GYIA 1LQUA 2WOVA 4OCGA 4UDRA 2WPEA 4GCMA 1B4VA 3NLCA 2ARDA 2GV8A 2YLSA 2GVCA 2GRTA 2E1MA 2YM2A 5M0ZA 1NG4A 2RGHA 3UTEA 2OLNA 2YAUA 4PABA 4H4SA 4DSHA 2VQ7A 2C65A 2GR1A 3UOYA 1H7WA 2GAHB 4C5OA 4H4UA 4TLXA 1E7PA 4H50A 1DOCA 1K0JA 2WDVA 1QO8A 4NEWA 5KVIA 3SY4A 3CPJG 4B68A 1KFYA 2J3NA 4JY2A 1MXTA 1OJDA 1CJ4A 1BF3A 1D4DA 1FOHA 1JRZA 4EIQA 1OJ9A 1KNPA 3ATRA 3AEGA 2BCPA 5C3JA 4DSGA 1GV4A 4J57A 1IJHA 4CCQA 3I6DA 2BABA 2BS4A 2VRLA 2C64A 4A6NA 2R0GA 3P1WA 3ZYXA 4BJZA 3ADAB 4TM1A 1S2QA 3AXBA 1YQ3A 3AYJA 4U8OA 2JKCA 3DJEA 3Q6JA 1BKWA 4OPDA 1TYTA 4U8MA 5EBKA 2FBWA 1S2YA 2R46A 2GH5A 4II3A 3ALMA 2AAQA 2WDRA 4NZHA 4TM4A 4RG4A 3AEBA 3NHOX 3IHGA 4HB9A 1H84A 1H81A 1DOBA 2BXSA 3NYEA 2IVDA 4YSXA 3FIMB 4FX9A 3SZCA 1RSGA 2ZZBA 3ITJA 1OJTA 3UKPA 5BULA 4J36A 1ELIA 3G5QA 2IIDA 3AWIA 1GERA 1D5TA 4EQWA 3P4RA 3OZ2A 4H4XA 2TMDA 3CNJA 4EQRA 3F8DA 1QJDA 5EB4A 1BZLA 1JRXA 3UOXA 2YWLA 4EQXA 2I0ZA 3UKAA 1ZK7A 4LA1A 4USQA 4CCRA 3AEEA 3UTFA 3NH3X 4WX1A 1M64A 2NVKX 3CGBA 2OALA 3CNDA 1ZOVA 4J56A 1BGNA 1B37A 1PXCA 1PJ7A 2WPFA 1GT8A 1N1PA 1CHUA 1OJAA 2GEWA 2JBVA 1LJ1A 3T31A 4U8NA 1H82A 1TYPA 3QFBA 4H4QA 3O0HA 1GALA 2WBAA 3UP4A 2C7GA 3SZWA 3AE3A 5BRTA 3KPFA 2GF3A 1GRTA 2H88A 4K7ZA 3UOVA 2ZZCA 1UKVG 5IQ4A 2Q6UA 2XVIA 2V3BA 3URHA 4AOSA 2GR3A 1H7XA 1IUWA 1JNZA 3AECA 2BXRA 5EOWA 2WP5A 4BV6A 5HY5A 1IUVA 4A9WA 1NHSA 2B9YA 2WETA 3UCLA 2BACA 5KNLA 4B69A 2WQYA 3T2YA 5ER0A 1LTXR 5J7XA 1D7YA 2XYOA 1EL8A 4GDEA 1GETA 5JCMA 4JDRA 2W0HA 2YLZA 1CJCA 1TDEA 2FJEA 3AYIA 4TLZA 2BK3A 2XCGA 2BC1A 1NENA 1B5QA 1PBFA 1ZDLA 2V6OA 3GD4A 3H4KA 4CRTA 4EMIA 4Z26A 3NNEA 3GDPA 1COYA 1DODA 3OC4A 4ADWA 3UKQA 2C72A 2WP6A 2ZZ0A 2GR0A 1JU2A 3VR8A 5KXJA 1ZMDA 3CNTA 3BI2A 3V76A 4D04A 1NHQA 2YVJA 3FBSA 1XDIA 4ZCCA 1N4WA 3SFEA 3JSKA 3DA1A 1PJ6A 3FG2P 1L9DA 1GESA 1YY5A 1P2HA 3QVRA 3ISHA 5JCNA 3SX6A 1DJNA 1CBOA 2XVJA 2TPRA 3DJGX 2B9XA 3EAOA 3L8KA 3NTAA 4G6GA 3V3NA 2YG7A 2QCUA 1GTEA 5IQ1A 4U8JA 3M0OA 1P2EA 2CDUA 3NYCA 3AYLA 1REOA 3F8PA 2AR8A 4AOXA 5FMHA 3NIXA 1GRFA 5M10A 2V5ZA 1FEBA 2ACZA 1VG0A 3NRNA 4XWZA 4YKGA 3UP5A 4JNQA 2A89A 2C3CA 2QA1A 1DXLA 1PS9A 1XANA 2FJBA 3KPKA 4NNJA 1VG9A 3P9UA 4D03A 1Y0PA 1D4EA 3LZXA 1L9EA 4KX6A 4K8DA 1M6IA 1KNRA 4B65A 1AOGA 2VOUA 4JN9A 4U2LA 3LZWA 2A8XA 4FDCB 3LJPA 4EQSA 3GRSA 4ICYA 3RP7A 1CC2A 1X31B 1E1KA 3NN6X 1GRGA 4H4WA 3BNMA 2DKHA 3NKSA 4AT2A 3KKJA 3BHKA 3CPHG 1FECA 4C3YA 4YTPA 3SYIA 3RP6A 5CKUA
chains in the Genus database with same CATH topology
4G73A 4Z2TA 4IA5A 4H2RA 3D1CA 4XXGA 1NAAA 3SQPA 4CY8A 5HYMA 5KRQA 4RG3A 1GEUA 2E4GA 1H86A 1S3BA 2YR6A 3NK0X 3HYWA 3CIRA 4EMJA 3QVPA 1FCDA 1ZY8A 2A87A 3NT6A 2B7SA 1EBDA 4H2NA 3KA7A 4U8KA 2Y6RA 3DMEA 4J31A 4JQ9A 1K0IA 4U2TA 2O9ZA 3LADA 2XLSA 3CNPA 1FEAA 2C67A 3NK1X 1PDHA 2X8HA 3DK4A 4UDQA 3AE4A 2WEUA 1Z6LA 4XWRA 4B67A 2WESA 1K4QA 2XDOA 2YM1A 2R4JA 2V61A 3CGCA 3CGDA 2CFYA 1E39A 2BK4A 1VQWA 3H8LA 2BS2A 2VVLG 1Q9IA 2X8CA 3HYXA 4O5QA 4EM3A 1NPXA 4OPLA 4GDPA 3VQRA 4BK1A 3QSMA 1PN0A 3GYJA 2GMHA 2OLOA 2CULA 5C2TA 4G74A 1JRYA 1JOAA 5GRTA 2B9WA 3ICSA 4YSYA 4GAVA 3FMWA 3T2KA 1ZP0A 4GUVA 1JEHA 1F8WA 2GR2A 3DH9A 3BI5A 2XFQA 1RYIA 2R9ZA 1GRHA 1LVLA 2WPCA 4H4YA 4K5RA 4REKA 2WU5A 3IWAA 4X4JA 4CNJA 1W4XA 3GMBA 3ICTA 4G9KA 2XVFA 1IUUA 2BS3A 3IHMA 1YKJA 3LOVA 1PBCA 3GDNA 1NEKA 4UDPA 3UKHA 3C96A 4K5SA 1VDCA 2C4CA 1CC6A 5BUKA 3K30A 1PXAA 3KU9A 2BC0A 2B7RA 4Y4MA 4BURA 2BRAA 4C74A 3GYXA 1QLBA 4I58A 4YKFA 3R9UA 1KSUA 1LPFA 3GWFA 1TDKA 2GQFA 3M12A 3M13A 4IVMB 4IVOB 3LB8A 4Y4NA 3E1TA 3EANA 2RGOA 5FS6A 4A6NB 3CPIG 2RABA 3H8IA 4CNKA 5JCKA 3ALLA 4IV9A 4JY3A 1PXBA 2Q0LA 1EL9A 1YQZA 4Z2RA 1D7LA 2EQ6A 4B66A 3T2ZA 3UTHA 3CN8A 3I3LA 3QJ4A 1GNDA 3AE5A 2XLTA 3KLJA 3UOZA 1E6EA 1NHRA 3K7TA 2R0PA 1Y56B 3DK9A 1GRBA 4LIIA 4ZCDA 2BYBA 1E1MA 4KPRA 3AE1A 2C70A 3AD8B 1SEZA 3K7MX 3G5RA 4H7UA 1ZMCA 4B64A 4GR1A 2BCGG 3SZFA 4U2SA 4K2XA 5JCIA 3NTDA 3FPZA 2DKIA 2YLWA 4N9XA 5EB5A 4CBQA 4EMWA 4DGKA 3VRAA 4M52A 2PHHA 1O94A 2XVEA 2QAEA 2XFNA 4YT0A 4O5UA 5DBJA 2GB0A 4C3XA 2R4EA 4OVIA 2Y6QA 1OJCA 1F6MA 2Q7VA 4OPIA 2X3NA 5FS8A 4BJYA 2C76A 2QA2A 4J33A 2Z5XA 2YR5A 4A5LA 3HYVA 3EPTA 3V3OA 1B8SA 1ZKQA 4H2PA 1K0LA 3C4NA 3P4QA 1EL7A 4HA6A 1S3EA 5KMPA 2F5ZA 3SZ0A 4EM4A 4B63A 4OPCA 4OPGA 5FS9A 2GAGB 5L46A 4GF7A 1GSNA 2EQ7A 4YSHA 4J2WA 2WU2A 4I59A 1CL0A 1TRBA 2BA9A 2HQMA 2X99A 2XFPA 2YVFA 3IF9A 1GTHA 1IUSA 1DOEA 1N4VA 2H89A 5JCLA 1DJQA 5TR3A 4U8IA 4YSZA 3ZDNA 3S5WA 1L9CA 4K22A 4U8PA 5KOWA 2GQWA 1LV0A 3AE2A 2EQ9A 4OPTA 3DGZA 3KD9A 4H4TA 2PYXA 3ALJA 1XPQA 3EF6A 2VVMA 3CNSA 4X9MA 4YTNA 5J60A 3AE8A 5KMRA 2CVJA 5BVAA 2WOWA 2JB2A 3NN0X 2XVHA 3AEAA 3PO7A 3PVCA 5FS7A 4H4VA 3AD7B 3PS9A 3GWDA 2BRYA 4P9SA 2XFUA 3CTYA 1ONFA 2VRMA 1PBDA 4X9NA 2WS3A 1CF3A 1GRAA 3LXDA 5CQFA 2WP9A 2X50A 2APGA 2EQ8A 1IUXA 1D4CA 4B1BA 1H6VA 3HZLA 5GSNA 2WHDA 2GMJA 3ICRA 1FL2A 3DJJA 2WDQA 4Z43A 4H4PA 1V59A 2FJDA 1Y56A 2XLRA 2YG5A 1EL5A 3DK8A 1CJ3A 3SGLA 4RSLA 3AE6A 4NEVA 2IVEA 2Z5YA 4FK1A 4A99A 2XLPA 4ECHA 3NYFA 1KF6A 2YLXA 4IA6A 2VQBA 3AE9A 3KVEA 4J34A 1JNRA 4H4RA 4AP1A 5KVHA 3NG7X 3CGEA 4NTEA 1PBBA 3VR9A 1NHPA 2JK6A 3UKKA 4OPUA 4LU6A 1F8RA 3VRBA 4H2QA 5LV9A 1PHHA 4C77A 1GREA 4A7AA 2OA1A 3BI4A 3DGHA 4EIPA 4AP3A 1RP0A 3COXA 1GXFA 2JB1A 1LQTA 3ABVA 3GSIA 2V3AA 5KMSA 2C73A 2OAMA 4A79A 4GAPA 4TM0A 2FJAA 4APNA 2AQJA 2WOIA 4WCTA 4AT0A 4NTCA 2X8GA 2JB3A 3Q9TA 4GRTA 3GRTA 2YQUA 4JNAA 2C66A 3T0KA 3D8XA 1E1NA 4A65A 3WE0A 4NWZA 3QSEA 4DNAA 2YG3A 3VRDB 5IPYA 2NPXA 2V60A 2YLRA 3F8RA 1DNCA 2R0CA 3BNUA 3GD3A 4UP3A 1NG3A 2BK5A 1HYUA 3SM8A 1E1LA 5HXIA 1YQ4A 1KDGA 5KOXA 4ZN0A 3T14A 2VVLA 3AEDA 1VRQB 1BGJA 1TDFA 2C75A 2YLTA 4TM3A 4CY6A 2YG6A 1MOKA 1TDOA 4FK1C 1F3PA 3AE7A 3P4SA 4YWOA 2YR4A 3RP8A 2ZBWA 3AD9B 1F8SA 3NGCX 4E0VA 3SXIA 1TDNA 2RGJA 3ATQA 4II2A 1Q1RA 3UTGA 3G5SA 1H83A 3NK2X 1N4UA 5U63A 4Z25A 1Q1WA 4Z24A 3B6DA 3CMMA 1CJ2A 3IC9A 3L1RA 3RHAA 3T37A 4BK3A 5KWFA 1CC4A 3B3RA 2XFOA 3BHFA 2JAEA 4Z44A 1O95A 1ZOYA 2Q0KA 4YTMA 1GOSA 2UZZA 3QSSA 3RNMA 4YXDA 1O5WA 1PJ5A 2B76A 4BK2A 3UKFA 1IUTA 1NDAA 4Y4LA 1GPEA 3S61A 1XHCA 2YVGA 4Z2UA 3DJDA 1ZX9A 1KSSA 4MJWA 4U8LA 4USRA 3P4PA 1MO9A 2YG4A 3REDA 5KMQA 2C3DA 2XLUA 5U1OA 4H4ZA 4G6HA 4PAAA 3K7QX 3AB1A 5HHFA 3II4A 2R45A 1L0VA 3C4AA 3QFAA 5U25A 3SFDA 1BWCA 3GMCA 3AEFA 3UKLA 1PBEA 2E5VA 2VZ2A 4NTDA 3GYIA 1LQUA 2WOVA 4OCGA 4UDRA 2WPEA 4GCMA 1B4VA 3NLCA 2ARDA 2GV8A 2YLSA 2GVCA 2GRTA 2E1MA 2YM2A 5M0ZA 1NG4A 2RGHA 3UTEA 2OLNA 2YAUA 4PABA 4H4SA 4DSHA 2VQ7A 2C65A 2GR1A 3UOYA 1H7WA 2GAHB 4C5OA 4H4UA 4TLXA 1E7PA 4H50A 1DOCA 1K0JA 2WDVA 1QO8A 4NEWA 5KVIA 3SY4A 3CPJG 4B68A 1KFYA 2J3NA 4JY2A 1MXTA 1OJDA 1CJ4A 1BF3A 1D4DA 1FOHA 1JRZA 4EIQA 1OJ9A 1KNPA 3ATRA 3AEGA 2BCPA 5C3JA 4DSGA 1GV4A 4J57A 1IJHA 4CCQA 3I6DA 2BABA 2BS4A 2VRLA 2C64A 4A6NA 2R0GA 3P1WA 3ZYXA 4BJZA 3ADAB 4TM1A 1S2QA 3AXBA 1YQ3A 3AYJA 4U8OA 2JKCA 3DJEA 3Q6JA 1BKWA 4OPDA 1TYTA 4U8MA 5EBKA 2FBWA 1S2YA 2R46A 2GH5A 4II3A 3ALMA 2AAQA 2WDRA 4NZHA 4TM4A 4RG4A 3AEBA 3NHOX 3IHGA 4HB9A 1H84A 1H81A 1DOBA 2BXSA 3NYEA 2IVDA 4YSXA 3FIMB 4FX9A 3SZCA 1RSGA 2ZZBA 3ITJA 1OJTA 3UKPA 5BULA 4J36A 1ELIA 3G5QA 2IIDA 3AWIA 1GERA 1D5TA 4EQWA 3P4RA 3OZ2A 4H4XA 2TMDA 3CNJA 4EQRA 3F8DA 1QJDA 5EB4A 1BZLA 1JRXA 3UOXA 2YWLA 4EQXA 2I0ZA 3UKAA 1ZK7A 4LA1A 4USQA 4CCRA 3AEEA 3UTFA 3NH3X 4WX1A 1M64A 2NVKX 3CGBA 2OALA 3CNDA 1ZOVA 4J56A 1BGNA 1B37A 1PXCA 1PJ7A 2WPFA 1GT8A 1N1PA 1CHUA 1OJAA 2GEWA 2JBVA 1LJ1A 3T31A 4U8NA 1H82A 1TYPA 3QFBA 4H4QA 3O0HA 1GALA 2WBAA 3UP4A 2C7GA 3SZWA 3AE3A 5BRTA 3KPFA 2GF3A 1GRTA 2H88A 4K7ZA 3UOVA 2ZZCA 1UKVG 5IQ4A 2Q6UA 2XVIA 2V3BA 3URHA 4AOSA 2GR3A 1H7XA 1IUWA 1JNZA 3AECA 2BXRA 5EOWA 2WP5A 4BV6A 5HY5A 1IUVA 4A9WA 1NHSA 2B9YA 2WETA 3UCLA 2BACA 5KNLA 4B69A 2WQYA 3T2YA 5ER0A 1LTXR 5J7XA 1D7YA 2XYOA 1EL8A 4GDEA 1GETA 5JCMA 4JDRA 2W0HA 2YLZA 1CJCA 1TDEA 2FJEA 3AYIA 4TLZA 2BK3A 2XCGA 2BC1A 1NENA 1B5QA 1PBFA 1ZDLA 2V6OA 3GD4A 3H4KA 4CRTA 4EMIA 4Z26A 3NNEA 3GDPA 1COYA 1DODA 3OC4A 4ADWA 3UKQA 2C72A 2WP6A 2ZZ0A 2GR0A 1JU2A 3VR8A 5KXJA 1ZMDA 3CNTA 3BI2A 3V76A 4D04A 1NHQA 2YVJA 3FBSA 1XDIA 4ZCCA 1N4WA 3SFEA 3JSKA 3DA1A 1PJ6A 3FG2P 1L9DA 1GESA 1YY5A 1P2HA 3QVRA 3ISHA 5JCNA 3SX6A 1DJNA 1CBOA 2XVJA 2TPRA 3DJGX 2B9XA 3EAOA 3L8KA 3NTAA 4G6GA 3V3NA 2YG7A 2QCUA 1GTEA 5IQ1A 4U8JA 3M0OA 1P2EA 2CDUA 3NYCA 3AYLA 1REOA 3F8PA 2AR8A 4AOXA 5FMHA 3NIXA 1GRFA 5M10A 2V5ZA 1FEBA 2ACZA 1VG0A 3NRNA 4XWZA 4YKGA 3UP5A 4JNQA 2A89A 2C3CA 2QA1A 1DXLA 1PS9A 1XANA 2FJBA 3KPKA 4NNJA 1VG9A 3P9UA 4D03A 1Y0PA 1D4EA 3LZXA 1L9EA 4KX6A 4K8DA 1M6IA 1KNRA 4B65A 1AOGA 2VOUA 4JN9A 4U2LA 3LZWA 2A8XA 4FDCB 3LJPA 4EQSA 3GRSA 4ICYA 3RP7A 1CC2A 1X31B 1E1KA 3NN6X 1GRGA 4H4WA 3BNMA 2DKHA 3NKSA 4AT2A 3KKJA 3BHKA 3CPHG 1FECA 4C3YA 4YTPA 3SYIA 3RP6A 5CKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2T A;  4IA5 A;  4H2R A;  3D1C A;  4XXG A;  1NAA A;  3SQP A;  4CY8 A;  5HYM A;  5KRQ A;  4RG3 A;  1GEU A;  2E4G A;  1H86 A;  1S3B A;  2YR6 A;  3NK0 X;  3CIR A;  4EMJ A;  3QVP A;  1FCD A;  1ZY8 A;  2A87 A;  3NT6 A;  2B7S A;  1EBD A;  4H2N A;  3KA7 A;  4U8K A;  2Y6R A;  3DME A;  4J31 A;  4JQ9 A;  1K0I A;  4U2T A;  2O9Z A;  3LAD A;  2XLS A;  3CNP A;  1FEA A;  2C67 A;  3NK1 X;  1PDH A;  2X8H A;  3DK4 A;  4UDQ A;  3AE4 A;  2WEU A;  1Z6L A;  4XWR A;  4B67 A;  2WES A;  1K4Q A;  2XDO A;  2YM1 A;  2R4J A;  2V61 A;  3CGC A;  3CGD A;  2CFY A;  1E39 A;  2BK4 A;  1VQW A;  3H8L A;  2BS2 A;  2VVL G;  1Q9I A;  2X8C A;  4O5Q A;  4EM3 A;  1NPX A;  4OPL A;  4GDP A;  3VQR A;  4BK1 A;  3QSM A;  1PN0 A;  3GYJ A;  2GMH A;  2OLO A;  2CUL A;  5C2T A;  1JRY A;  1JOA A;  5GRT A;  2B9W A;  3ICS A;  4YSY A;  3FMW A;  1ZP0 A;  4GUV A;  1JEH A;  1F8W A;  2GR2 A;  3DH9 A;  3BI5 A;  2XFQ A;  1RYI A;  2R9Z A;  1GRH A;  1LVL A;  2WPC A;  4H4Y A;  4K5R A;  4REK A;  2WU5 A;  3IWA A;  4X4J A;  4CNJ A;  1W4X A;  3GMB A;  3ICT A;  2XVF A;  1IUU A;  2BS3 A;  3IHM A;  1YKJ A;  3LOV A;  1PBC A;  3GDN A;  1NEK A;  4UDP A;  3UKH A;  3C96 A;  4K5S A;  1VDC A;  1CC6 A;  5BUK A;  3K30 A;  1PXA A;  3KU9 A;  2BC0 A;  2B7R A;  4Y4M A;  4BUR A;  4C74 A;  1QLB A;  4I58 A;  4YKF A;  3R9U A;  1KSU A;  1LPF A;  3GWF A;  1TDK A;  2GQF A;  3M12 A;  3M13 A;  4IVM B;  4IVO B;  3LB8 A;  4Y4N A;  3E1T A;  3EAN A;  2RGO A;  5FS6 A;  4A6N B;  3CPI G;  2RAB A;  3H8I A;  4CNK A;  5JCK A;  3ALL A;  4IV9 A;  4JY3 A;  1PXB A;  2Q0L A;  1EL9 A;  1YQZ A;  4Z2R A;  1D7L A;  2EQ6 A;  4B66 A;  3UTH A;  3CN8 A;  3I3L A;  3QJ4 A;  1GND A;  3AE5 A;  2XLT A;  3KLJ A;  3UOZ A;  1E6E A;  1NHR A;  3K7T A;  2R0P A;  1Y56 B;  3DK9 A;  1GRB A;  4LII A;  4ZCD A;  2BYB A;  1E1M A;  4KPR A;  3AE1 A;  2C70 A;  3AD8 B;  1SEZ A;  3K7M X;  3G5R A;  4H7U A;  1ZMC A;  4B64 A;  4GR1 A;  2BCG G;  4U2S A;  4K2X A;  5JCI A;  3NTD A;  3FPZ A;  2DKI A;  2YLW A;  4N9X A;  5EB5 A;  4CBQ A;  4EMW A;  4DGK A;  3VRA A;  4M52 A;  2PHH A;  1O94 A;  2XVE A;  2QAE A;  2XFN A;  4YT0 A;  4O5U A;  5DBJ A;  2GB0 A;  4C3X A;  2R4E A;  4OVI A;  2Y6Q A;  1OJC A;  1F6M A;  2Q7V A;  4OPI A;  2X3N A;  5FS8 A;  4BJY A;  2C76 A;  2QA2 A;  4J33 A;  2Z5X A;  2YR5 A;  4A5L A;  3EPT A;  3V3O A;  1B8S A;  1ZKQ A;  4H2P A;  1K0L A;  3C4N A;  3P4Q A;  1EL7 A;  4HA6 A;  1S3E A;  2F5Z A;  4EM4 A;  4B63 A;  4OPC A;  4OPG A;  5FS9 A;  2GAG B;  5L46 A;  4GF7 A;  1GSN A;  2EQ7 A;  4YSH A;  4J2W A;  2WU2 A;  4I59 A;  1CL0 A;  1TRB A;  2BA9 A;  2HQM A;  2X99 A;  2XFP A;  2YVF A;  3IF9 A;  1GTH A;  1IUS A;  1DOE A;  1N4V A;  2H89 A;  5JCL A;  1DJQ A;  5TR3 A;  4U8I A;  4YSZ A;  3ZDN A;  3S5W A;  1L9C A;  4K22 A;  4U8P A;  5KOW A;  2GQW A;  1LV0 A;  3AE2 A;  2EQ9 A;  4OPT A;  3DGZ A;  3KD9 A;  4H4T A;  2PYX A;  3ALJ A;  1XPQ A;  3EF6 A;  2VVM A;  3CNS A;  4X9M A;  4YTN A;  5J60 A;  3AE8 A;  2CVJ A;  5BVA A;  2WOW A;  2JB2 A;  3NN0 X;  2XVH A;  3AEA A;  3PO7 A;  3PVC A;  5FS7 A;  4H4V A;  3AD7 B;  3PS9 A;  3GWD A;  4P9S A;  2XFU A;  3CTY A;  1ONF A;  2VRM A;  1PBD A;  4X9N A;  2WS3 A;  1CF3 A;  1GRA A;  3LXD A;  5CQF A;  2WP9 A;  2X50 A;  2APG A;  2EQ8 A;  1IUX A;  1D4C A;  4B1B A;  1H6V A;  3HZL A;  5GSN A;  2WHD A;  2GMJ A;  3ICR A;  1FL2 A;  3DJJ A;  2WDQ A;  4Z43 A;  4H4P A;  1V59 A;  2FJD A;  1Y56 A;  2XLR A;  2YG5 A;  1EL5 A;  3DK8 A;  1CJ3 A;  3SGL A;  4RSL A;  3AE6 A;  4NEV A;  2IVE A;  2Z5Y A;  4FK1 A;  4A99 A;  2XLP A;  4ECH A;  3NYF A;  1KF6 A;  2YLX A;  4IA6 A;  2VQB A;  3AE9 A;  3KVE A;  4J34 A;  1JNR A;  4H4R A;  4AP1 A;  5KVH A;  3NG7 X;  3CGE A;  4NTE A;  1PBB A;  3VR9 A;  1NHP A;  2JK6 A;  3UKK A;  4OPU A;  4LU6 A;  1F8R A;  3VRB A;  4H2Q A;  5LV9 A;  1PHH A;  4C77 A;  1GRE A;  4A7A A;  2OA1 A;  3BI4 A;  3DGH A;  4EIP A;  4AP3 A;  1RP0 A;  3COX A;  1GXF A;  2JB1 A;  1LQT A;  3ABV A;  3GSI A;  2V3A A;  2C73 A;  2OAM A;  4A79 A;  4TM0 A;  2FJA A;  4APN A;  2AQJ A;  2WOI A;  4WCT A;  4AT0 A;  4NTC A;  2X8G A;  2JB3 A;  3Q9T A;  4GRT A;  3GRT A;  2YQU A;  4JNA A;  2C66 A;  3D8X A;  1E1N A;  4A65 A;  3WE0 A;  3QSE A;  4DNA A;  2YG3 A;  3VRD B;  5IPY A;  2NPX A;  2V60 A;  2YLR A;  3F8R A;  1DNC A;  2R0C A;  3BNU A;  3GD3 A;  4UP3 A;  1NG3 A;  2BK5 A;  1HYU A;  3SM8 A;  1E1L A;  5HXI A;  1YQ4 A;  1KDG A;  5KOX A;  4ZN0 A;  5KWF A;  2VVL A;  3AED A;  1VRQ B;  1BGJ A;  1TDF A;  2C75 A;  2YLT A;  4TM3 A;  4CY6 A;  2YG6 A;  1MOK A;  1TDO A;  4FK1 C;  1F3P A;  3AE7 A;  3P4S A;  4YWO A;  2YR4 A;  3RP8 A;  2ZBW A;  3AD9 B;  1F8S A;  3NGC X;  4E0V A;  1TDN A;  2RGJ A;  3ATQ A;  3UTG A;  1Q1R A;  3G5S A;  1H83 A;  3NK2 X;  1N4U A;  5U63 A;  4Z25 A;  1Q1W A;  4Z24 A;  3B6D A;  3L1R A;  1CJ2 A;  3IC9 A;  3RHA A;  3T37 A;  4BK3 A;  1CC4 A;  3B3R A;  2XFO A;  3BHF A;  2JAE A;  4Z44 A;  1O95 A;  1ZOY A;  2Q0K A;  4YTM A;  1GOS A;  2UZZ A;  3QSS A;  3RNM A;  4YXD A;  1O5W A;  1PJ5 A;  2B76 A;  4BK2 A;  3UKF A;  1IUT A;  1NDA A;  4Y4L A;  1GPE A;  3S61 A;  1XHC A;  2YVG A;  4Z2U A;  3DJD A;  1ZX9 A;  1KSS A;  4MJW A;  4U8L A;  4USR A;  3P4P A;  1MO9 A;  2YG4 A;  3RED A;  2C3D A;  2XLU A;  5U1O A;  4H4Z A;  4PAA A;  3K7Q X;  3AB1 A;  5HHF A;  3II4 A;  2R45 A;  1L0V A;  3C4A A;  3QFA A;  5U25 A;  3SFD A;  1BWC A;  3GMC A;  3AEF A;  3UKL A;  1PBE A;  2E5V A;  2VZ2 A;  4NTD A;  3GYI A;  1LQU A;  2WOV A;  4OCG A;  4UDR A;  2WPE A;  4GCM A;  1B4V A;  3NLC A;  2ARD A;  2GV8 A;  2YLS A;  2GVC A;  2GRT A;  2E1M A;  2YM2 A;  5M0Z A;  1NG4 A;  2RGH A;  3UTE A;  2OLN A;  2YAU A;  4PAB A;  4H4S A;  4DSH A;  2VQ7 A;  2C65 A;  2GR1 A;  3UOY A;  1H7W A;  2GAH B;  4C5O A;  4H4U A;  4TLX A;  1E7P A;  4H50 A;  1DOC A;  1K0J A;  2WDV A;  1QO8 A;  4NEW A;  5KVI A;  3CPJ G;  4B68 A;  1KFY A;  2J3N A;  4JY2 A;  1MXT A;  1OJD A;  1CJ4 A;  1BF3 A;  1D4D A;  1FOH A;  1JRZ A;  4EIQ A;  1OJ9 A;  1KNP A;  3ATR A;  3AEG A;  2BCP A;  5C3J A;  4DSG A;  1GV4 A;  4J57 A;  1IJH A;  4CCQ A;  3I6D A;  2BAB A;  2BS4 A;  2VRL A;  2C64 A;  4A6N A;  2R0G A;  3P1W A;  3ZYX A;  4BJZ A;  3ADA B;  4TM1 A;  1S2Q A;  3AXB A;  1YQ3 A;  3AYJ A;  4U8O A;  2JKC A;  3DJE A;  3Q6J A;  1BKW A;  4OPD A;  1TYT A;  4U8M A;  5EBK A;  2FBW A;  1S2Y A;  2R46 A;  2GH5 A;  3ALM A;  2AAQ A;  2WDR A;  4NZH A;  4TM4 A;  4RG4 A;  3AEB A;  3NHO X;  3IHG A;  4HB9 A;  1H84 A;  1H81 A;  1DOB A;  2BXS A;  3NYE A;  2IVD A;  4YSX A;  3FIM B;  4FX9 A;  1RSG A;  2ZZB A;  3ITJ A;  1OJT A;  3UKP A;  5BUL A;  4J36 A;  1ELI A;  3G5Q A;  2IID A;  3AWI A;  1GER A;  1D5T A;  4EQW A;  3P4R A;  3OZ2 A;  4H4X A;  2TMD A;  3CNJ A;  4EQR A;  3F8D A;  1QJD A;  5EB4 A;  1BZL A;  1JRX A;  3UOX A;  2YWL A;  4EQX A;  2I0Z A;  3UKA A;  1ZK7 A;  4LA1 A;  4USQ A;  4CCR A;  3AEE A;  3UTF A;  3NH3 X;  4WX1 A;  1M64 A;  2NVK X;  3CGB A;  2OAL A;  3CND A;  1ZOV A;  4J56 A;  1BGN A;  1B37 A;  1PXC A;  1PJ7 A;  2WPF A;  1GT8 A;  1N1P A;  1CHU A;  1OJA A;  2GEW A;  2JBV A;  1LJ1 A;  4U8N A;  1H82 A;  1TYP A;  3QFB A;  4H4Q A;  3O0H A;  1GAL A;  2WBA A;  3UP4 A;  2C7G A;  3AE3 A;  5BRT A;  3KPF A;  2GF3 A;  1GRT A;  2H88 A;  4K7Z A;  3UOV A;  2ZZC A;  1UKV G;  5IQ4 A;  2Q6U A;  2XVI A;  2V3B A;  3URH A;  4AOS A;  2GR3 A;  1H7X A;  1IUW A;  1JNZ A;  3AEC A;  2BXR A;  5EOW A;  2WP5 A;  4BV6 A;  5HY5 A;  1IUV A;  4A9W A;  1NHS A;  2B9Y A;  2WET A;  3UCL A;  2BAC A;  4B69 A;  2WQY A;  5ER0 A;  1LTX R;  5J7X A;  1D7Y A;  2XYO A;  1EL8 A;  4GDE A;  1GET A;  5JCM A;  4JDR A;  2W0H A;  2YLZ A;  1CJC A;  1TDE A;  2FJE A;  3AYI A;  4TLZ A;  2BK3 A;  2XCG A;  2BC1 A;  1NEN A;  1B5Q A;  1PBF A;  1ZDL A;  2V6O A;  3GD4 A;  3H4K A;  4CRT A;  4EMI A;  4Z26 A;  3NNE A;  3GDP A;  1COY A;  1DOD A;  3OC4 A;  4ADW A;  3UKQ A;  2C72 A;  2WP6 A;  2ZZ0 A;  2GR0 A;  1JU2 A;  3VR8 A;  5KXJ A;  1ZMD A;  3CNT A;  3BI2 A;  3V76 A;  4D04 A;  1NHQ A;  2YVJ A;  3FBS A;  1XDI A;  4ZCC A;  1N4W A;  3SFE A;  3JSK A;  3DA1 A;  1PJ6 A;  3FG2 P;  1L9D A;  1GES A;  1YY5 A;  1P2H A;  3QVR A;  3ISH A;  5JCN A;  1DJN A;  1CBO A;  2XVJ A;  2TPR A;  3DJG X;  2B9X A;  3EAO A;  3L8K A;  3NTA A;  3V3N A;  2YG7 A;  2QCU A;  1GTE A;  5IQ1 A;  4U8J A;  3M0O A;  1P2E A;  2CDU A;  3NYC A;  3AYL A;  1REO A;  3F8P A;  2AR8 A;  4AOX A;  5FMH A;  3NIX A;  1GRF A;  5M10 A;  2V5Z A;  1FEB A;  2ACZ A;  1VG0 A;  3NRN A;  4XWZ A;  4YKG A;  3UP5 A;  4JNQ A;  2A89 A;  2C3C A;  2QA1 A;  1DXL A;  1PS9 A;  1XAN A;  2FJB A;  1VG9 A;  3P9U A;  4D03 A;  1Y0P A;  1D4E A;  3LZX A;  1L9E A;  4KX6 A;  4K8D A;  1M6I A;  1KNR A;  4B65 A;  1AOG A;  2VOU A;  4JN9 A;  4U2L A;  3LZW A;  2A8X A;  4FDC B;  3LJP A;  4EQS A;  3GRS A;  4ICY A;  3RP7 A;  1CC2 A;  1X31 B;  1E1K A;  3NN6 X;  1GRG A;  4H4W A;  3BNM A;  2DKH A;  3NKS A;  4AT2 A;  3KKJ A;  3BHK A;  3CPH G;  1FEC A;  4C3Y A;  4YTP A;  3RP6 A;  5CKU A; 
#chains in the Genus database with same CATH topology
 4G73 A;  4Z2T A;  4IA5 A;  4H2R A;  3D1C A;  4XXG A;  1NAA A;  3SQP A;  4CY8 A;  5HYM A;  5KRQ A;  4RG3 A;  1GEU A;  2E4G A;  1H86 A;  1S3B A;  2YR6 A;  3NK0 X;  3HYW A;  3CIR A;  4EMJ A;  3QVP A;  1FCD A;  1ZY8 A;  2A87 A;  3NT6 A;  2B7S A;  1EBD A;  4H2N A;  3KA7 A;  4U8K A;  2Y6R A;  3DME A;  4J31 A;  4JQ9 A;  1K0I A;  4U2T A;  2O9Z A;  3LAD A;  2XLS A;  3CNP A;  1FEA A;  2C67 A;  3NK1 X;  1PDH A;  2X8H A;  3DK4 A;  4UDQ A;  3AE4 A;  2WEU A;  1Z6L A;  4XWR A;  4B67 A;  2WES A;  1K4Q A;  2XDO A;  2YM1 A;  2R4J A;  2V61 A;  3CGC A;  3CGD A;  2CFY A;  1E39 A;  2BK4 A;  1VQW A;  3H8L A;  2BS2 A;  2VVL G;  1Q9I A;  2X8C A;  3HYX A;  4O5Q A;  4EM3 A;  1NPX A;  4OPL A;  4GDP A;  3VQR A;  4BK1 A;  3QSM A;  1PN0 A;  3GYJ A;  2GMH A;  2OLO A;  2CUL A;  5C2T A;  4G74 A;  1JRY A;  1JOA A;  5GRT A;  2B9W A;  3ICS A;  4YSY A;  4GAV A;  3FMW A;  3T2K A;  1ZP0 A;  4GUV A;  1JEH A;  1F8W A;  2GR2 A;  3DH9 A;  3BI5 A;  2XFQ A;  1RYI A;  2R9Z A;  1GRH A;  1LVL A;  2WPC A;  4H4Y A;  4K5R A;  4REK A;  2WU5 A;  3IWA A;  4X4J A;  4CNJ A;  1W4X A;  3GMB A;  3ICT A;  4G9K A;  2XVF A;  1IUU A;  2BS3 A;  3IHM A;  1YKJ A;  3LOV A;  1PBC A;  3GDN A;  1NEK A;  4UDP A;  3UKH A;  3C96 A;  4K5S A;  1VDC A;  2C4C A;  1CC6 A;  5BUK A;  3K30 A;  1PXA A;  3KU9 A;  2BC0 A;  2B7R A;  4Y4M A;  4BUR A;  2BRA A;  4C74 A;  3GYX A;  1QLB A;  4I58 A;  4YKF A;  3R9U A;  1KSU A;  1LPF A;  3GWF A;  1TDK A;  2GQF A;  3M12 A;  3M13 A;  4IVM B;  4IVO B;  3LB8 A;  4Y4N A;  3E1T A;  3EAN A;  2RGO A;  5FS6 A;  4A6N B;  3CPI G;  2RAB A;  3H8I A;  4CNK A;  5JCK A;  3ALL A;  4IV9 A;  4JY3 A;  1PXB A;  2Q0L A;  1EL9 A;  1YQZ A;  4Z2R A;  1D7L A;  2EQ6 A;  4B66 A;  3T2Z A;  3UTH A;  3CN8 A;  3I3L A;  3QJ4 A;  1GND A;  3AE5 A;  2XLT A;  3KLJ A;  3UOZ A;  1E6E A;  1NHR A;  3K7T A;  2R0P A;  1Y56 B;  3DK9 A;  1GRB A;  4LII A;  4ZCD A;  2BYB A;  1E1M A;  4KPR A;  3AE1 A;  2C70 A;  3AD8 B;  1SEZ A;  3K7M X;  3G5R A;  4H7U A;  1ZMC A;  4B64 A;  4GR1 A;  2BCG G;  3SZF A;  4U2S A;  4K2X A;  5JCI A;  3NTD A;  3FPZ A;  2DKI A;  2YLW A;  4N9X A;  5EB5 A;  4CBQ A;  4EMW A;  4DGK A;  3VRA A;  4M52 A;  2PHH A;  1O94 A;  2XVE A;  2QAE A;  2XFN A;  4YT0 A;  4O5U A;  5DBJ A;  2GB0 A;  4C3X A;  2R4E A;  4OVI A;  2Y6Q A;  1OJC A;  1F6M A;  2Q7V A;  4OPI A;  2X3N A;  5FS8 A;  4BJY A;  2C76 A;  2QA2 A;  4J33 A;  2Z5X A;  2YR5 A;  4A5L A;  3HYV A;  3EPT A;  3V3O A;  1B8S A;  1ZKQ A;  4H2P A;  1K0L A;  3C4N A;  3P4Q A;  1EL7 A;  4HA6 A;  1S3E A;  5KMP A;  2F5Z A;  3SZ0 A;  4EM4 A;  4B63 A;  4OPC A;  4OPG A;  5FS9 A;  2GAG B;  5L46 A;  4GF7 A;  1GSN A;  2EQ7 A;  4YSH A;  4J2W A;  2WU2 A;  4I59 A;  1CL0 A;  1TRB A;  2BA9 A;  2HQM A;  2X99 A;  2XFP A;  2YVF A;  3IF9 A;  1GTH A;  1IUS A;  1DOE A;  1N4V A;  2H89 A;  5JCL A;  1DJQ A;  5TR3 A;  4U8I A;  4YSZ A;  3ZDN A;  3S5W A;  1L9C A;  4K22 A;  4U8P A;  5KOW A;  2GQW A;  1LV0 A;  3AE2 A;  2EQ9 A;  4OPT A;  3DGZ A;  3KD9 A;  4H4T A;  2PYX A;  3ALJ A;  1XPQ A;  3EF6 A;  2VVM A;  3CNS A;  4X9M A;  4YTN A;  5J60 A;  3AE8 A;  5KMR A;  2CVJ A;  5BVA A;  2WOW A;  2JB2 A;  3NN0 X;  2XVH A;  3AEA A;  3PO7 A;  3PVC A;  5FS7 A;  4H4V A;  3AD7 B;  3PS9 A;  3GWD A;  2BRY A;  4P9S A;  2XFU A;  3CTY A;  1ONF A;  2VRM A;  1PBD A;  4X9N A;  2WS3 A;  1CF3 A;  1GRA A;  3LXD A;  5CQF A;  2WP9 A;  2X50 A;  2APG A;  2EQ8 A;  1IUX A;  1D4C A;  4B1B A;  1H6V A;  3HZL A;  5GSN A;  2WHD A;  2GMJ A;  3ICR A;  1FL2 A;  3DJJ A;  2WDQ A;  4Z43 A;  4H4P A;  1V59 A;  2FJD A;  1Y56 A;  2XLR A;  2YG5 A;  1EL5 A;  3DK8 A;  1CJ3 A;  3SGL A;  4RSL A;  3AE6 A;  4NEV A;  2IVE A;  2Z5Y A;  4FK1 A;  4A99 A;  2XLP A;  4ECH A;  3NYF A;  1KF6 A;  2YLX A;  4IA6 A;  2VQB A;  3AE9 A;  3KVE A;  4J34 A;  1JNR A;  4H4R A;  4AP1 A;  5KVH A;  3NG7 X;  3CGE A;  4NTE A;  1PBB A;  3VR9 A;  1NHP A;  2JK6 A;  3UKK A;  4OPU A;  4LU6 A;  1F8R A;  3VRB A;  4H2Q A;  5LV9 A;  1PHH A;  4C77 A;  1GRE A;  4A7A A;  2OA1 A;  3BI4 A;  3DGH A;  4EIP A;  4AP3 A;  1RP0 A;  3COX A;  1GXF A;  2JB1 A;  1LQT A;  3ABV A;  3GSI A;  2V3A A;  5KMS A;  2C73 A;  2OAM A;  4A79 A;  4GAP A;  4TM0 A;  2FJA A;  4APN A;  2AQJ A;  2WOI A;  4WCT A;  4AT0 A;  4NTC A;  2X8G A;  2JB3 A;  3Q9T A;  4GRT A;  3GRT A;  2YQU A;  4JNA A;  2C66 A;  3T0K A;  3D8X A;  1E1N A;  4A65 A;  3WE0 A;  4NWZ A;  3QSE A;  4DNA A;  2YG3 A;  3VRD B;  5IPY A;  2NPX A;  2V60 A;  2YLR A;  3F8R A;  1DNC A;  2R0C A;  3BNU A;  3GD3 A;  4UP3 A;  1NG3 A;  2BK5 A;  1HYU A;  3SM8 A;  1E1L A;  5HXI A;  1YQ4 A;  1KDG A;  5KOX A;  4ZN0 A;  3T14 A;  2VVL A;  3AED A;  1VRQ B;  1BGJ A;  1TDF A;  2C75 A;  2YLT A;  4TM3 A;  4CY6 A;  2YG6 A;  1MOK A;  1TDO A;  4FK1 C;  1F3P A;  3AE7 A;  3P4S A;  4YWO A;  2YR4 A;  3RP8 A;  2ZBW A;  3AD9 B;  1F8S A;  3NGC X;  4E0V A;  3SXI A;  1TDN A;  2RGJ A;  3ATQ A;  4II2 A;  1Q1R A;  3UTG A;  3G5S A;  1H83 A;  3NK2 X;  1N4U A;  5U63 A;  4Z25 A;  1Q1W A;  4Z24 A;  3B6D A;  3CMM A;  1CJ2 A;  3IC9 A;  3L1R A;  3RHA A;  3T37 A;  4BK3 A;  5KWF A;  1CC4 A;  3B3R A;  2XFO A;  3BHF A;  2JAE A;  4Z44 A;  1O95 A;  1ZOY A;  2Q0K A;  4YTM A;  1GOS A;  2UZZ A;  3QSS A;  3RNM A;  4YXD A;  1O5W A;  1PJ5 A;  2B76 A;  4BK2 A;  3UKF A;  1IUT A;  1NDA A;  4Y4L A;  1GPE A;  3S61 A;  1XHC A;  2YVG A;  4Z2U A;  3DJD A;  1ZX9 A;  1KSS A;  4MJW A;  4U8L A;  4USR A;  3P4P A;  1MO9 A;  2YG4 A;  3RED A;  5KMQ A;  2C3D A;  2XLU A;  5U1O A;  4H4Z A;  4G6H A;  4PAA A;  3K7Q X;  3AB1 A;  5HHF A;  3II4 A;  2R45 A;  1L0V A;  3C4A A;  3QFA A;  5U25 A;  3SFD A;  1BWC A;  3GMC A;  3AEF A;  3UKL A;  1PBE A;  2E5V A;  2VZ2 A;  4NTD A;  3GYI A;  1LQU A;  2WOV A;  4OCG A;  4UDR A;  2WPE A;  4GCM A;  1B4V A;  3NLC A;  2ARD A;  2GV8 A;  2YLS A;  2GVC A;  2GRT A;  2E1M A;  2YM2 A;  5M0Z A;  1NG4 A;  2RGH A;  3UTE A;  2OLN A;  2YAU A;  4PAB A;  4H4S A;  4DSH A;  2VQ7 A;  2C65 A;  2GR1 A;  3UOY A;  1H7W A;  2GAH B;  4C5O A;  4H4U A;  4TLX A;  1E7P A;  4H50 A;  1DOC A;  1K0J A;  2WDV A;  1QO8 A;  4NEW A;  5KVI A;  3SY4 A;  3CPJ G;  4B68 A;  1KFY A;  2J3N A;  4JY2 A;  1MXT A;  1OJD A;  1CJ4 A;  1BF3 A;  1D4D A;  1FOH A;  1JRZ A;  4EIQ A;  1OJ9 A;  1KNP A;  3ATR A;  3AEG A;  2BCP A;  5C3J A;  4DSG A;  1GV4 A;  4J57 A;  1IJH A;  4CCQ A;  3I6D A;  2BAB A;  2BS4 A;  2VRL A;  2C64 A;  4A6N A;  2R0G A;  3P1W A;  3ZYX A;  4BJZ A;  3ADA B;  4TM1 A;  1S2Q A;  3AXB A;  1YQ3 A;  3AYJ A;  4U8O A;  2JKC A;  3DJE A;  3Q6J A;  1BKW A;  4OPD A;  1TYT A;  4U8M A;  5EBK A;  2FBW A;  1S2Y A;  2R46 A;  2GH5 A;  4II3 A;  3ALM A;  2AAQ A;  2WDR A;  4NZH A;  4TM4 A;  4RG4 A;  3AEB A;  3NHO X;  3IHG A;  4HB9 A;  1H84 A;  1H81 A;  1DOB A;  2BXS A;  3NYE A;  2IVD A;  4YSX A;  3FIM B;  4FX9 A;  3SZC A;  1RSG A;  2ZZB A;  3ITJ A;  1OJT A;  3UKP A;  5BUL A;  4J36 A;  1ELI A;  3G5Q A;  2IID A;  3AWI A;  1GER A;  1D5T A;  4EQW A;  3P4R A;  3OZ2 A;  4H4X A;  2TMD A;  3CNJ A;  4EQR A;  3F8D A;  1QJD A;  5EB4 A;  1BZL A;  1JRX A;  3UOX A;  2YWL A;  4EQX A;  2I0Z A;  3UKA A;  1ZK7 A;  4LA1 A;  4USQ A;  4CCR A;  3AEE A;  3UTF A;  3NH3 X;  4WX1 A;  1M64 A;  2NVK X;  3CGB A;  2OAL A;  3CND A;  1ZOV A;  4J56 A;  1BGN A;  1B37 A;  1PXC A;  1PJ7 A;  2WPF A;  1GT8 A;  1N1P A;  1CHU A;  1OJA A;  2GEW A;  2JBV A;  1LJ1 A;  3T31 A;  4U8N A;  1H82 A;  1TYP A;  3QFB A;  4H4Q A;  3O0H A;  1GAL A;  2WBA A;  3UP4 A;  2C7G A;  3SZW A;  3AE3 A;  5BRT A;  3KPF A;  2GF3 A;  1GRT A;  2H88 A;  4K7Z A;  3UOV A;  2ZZC A;  1UKV G;  5IQ4 A;  2Q6U A;  2XVI A;  2V3B A;  3URH A;  4AOS A;  2GR3 A;  1H7X A;  1IUW A;  1JNZ A;  3AEC A;  2BXR A;  5EOW A;  2WP5 A;  4BV6 A;  5HY5 A;  1IUV A;  4A9W A;  1NHS A;  2B9Y A;  2WET A;  3UCL A;  2BAC A;  5KNL A;  4B69 A;  2WQY A;  3T2Y A;  5ER0 A;  1LTX R;  5J7X A;  1D7Y A;  2XYO A;  1EL8 A;  4GDE A;  1GET A;  5JCM A;  4JDR A;  2W0H A;  2YLZ A;  1CJC A;  1TDE A;  2FJE A;  3AYI A;  4TLZ A;  2BK3 A;  2XCG A;  2BC1 A;  1NEN A;  1B5Q A;  1PBF A;  1ZDL A;  2V6O A;  3GD4 A;  3H4K A;  4CRT A;  4EMI A;  4Z26 A;  3NNE A;  3GDP A;  1COY A;  1DOD A;  3OC4 A;  4ADW A;  3UKQ A;  2C72 A;  2WP6 A;  2ZZ0 A;  2GR0 A;  1JU2 A;  3VR8 A;  5KXJ A;  1ZMD A;  3CNT A;  3BI2 A;  3V76 A;  4D04 A;  1NHQ A;  2YVJ A;  3FBS A;  1XDI A;  4ZCC A;  1N4W A;  3SFE A;  3JSK A;  3DA1 A;  1PJ6 A;  3FG2 P;  1L9D A;  1GES A;  1YY5 A;  1P2H A;  3QVR A;  3ISH A;  5JCN A;  3SX6 A;  1DJN A;  1CBO A;  2XVJ A;  2TPR A;  3DJG X;  2B9X A;  3EAO A;  3L8K A;  3NTA A;  4G6G A;  3V3N A;  2YG7 A;  2QCU A;  1GTE A;  5IQ1 A;  4U8J A;  3M0O A;  1P2E A;  2CDU A;  3NYC A;  3AYL A;  1REO A;  3F8P A;  2AR8 A;  4AOX A;  5FMH A;  3NIX A;  1GRF A;  5M10 A;  2V5Z A;  1FEB A;  2ACZ A;  1VG0 A;  3NRN A;  4XWZ A;  4YKG A;  3UP5 A;  4JNQ A;  2A89 A;  2C3C A;  2QA1 A;  1DXL A;  1PS9 A;  1XAN A;  2FJB A;  3KPK A;  4NNJ A;  1VG9 A;  3P9U A;  4D03 A;  1Y0P A;  1D4E A;  3LZX A;  1L9E A;  4KX6 A;  4K8D A;  1M6I A;  1KNR A;  4B65 A;  1AOG A;  2VOU A;  4JN9 A;  4U2L A;  3LZW A;  2A8X A;  4FDC B;  3LJP A;  4EQS A;  3GRS A;  4ICY A;  3RP7 A;  1CC2 A;  1X31 B;  1E1K A;  3NN6 X;  1GRG A;  4H4W A;  3BNM A;  2DKH A;  3NKS A;  4AT2 A;  3KKJ A;  3BHK A;  3CPH G;  1FEC A;  4C3Y A;  4YTP A;  3SYI A;  3RP6 A;  5CKU A; 
#chains in the Genus database with same CATH homology
 4G73 A;  4Z2T A;  4IA5 A;  4H2R A;  3D1C A;  4XXG A;  1NAA A;  3SQP A;  4CY8 A;  5HYM A;  5KRQ A;  4RG3 A;  1GEU A;  2E4G A;  1H86 A;  1S3B A;  2YR6 A;  3NK0 X;  3HYW A;  3CIR A;  4EMJ A;  3QVP A;  1FCD A;  1ZY8 A;  2A87 A;  3NT6 A;  2B7S A;  1EBD A;  4H2N A;  3KA7 A;  4U8K A;  2Y6R A;  3DME A;  4J31 A;  4JQ9 A;  1K0I A;  4U2T A;  2O9Z A;  3LAD A;  2XLS A;  3CNP A;  1FEA A;  2C67 A;  3NK1 X;  1PDH A;  2X8H A;  3DK4 A;  4UDQ A;  3AE4 A;  2WEU A;  1Z6L A;  4XWR A;  4B67 A;  2WES A;  1K4Q A;  2XDO A;  2YM1 A;  2R4J A;  2V61 A;  3CGC A;  3CGD A;  2CFY A;  1E39 A;  2BK4 A;  1VQW A;  3H8L A;  2BS2 A;  2VVL G;  1Q9I A;  2X8C A;  3HYX A;  4O5Q A;  4EM3 A;  1NPX A;  4OPL A;  4GDP A;  3VQR A;  4BK1 A;  3QSM A;  1PN0 A;  3GYJ A;  2GMH A;  2OLO A;  2CUL A;  5C2T A;  4G74 A;  1JRY A;  1JOA A;  5GRT A;  2B9W A;  3ICS A;  4YSY A;  4GAV A;  3FMW A;  3T2K A;  1ZP0 A;  4GUV A;  1JEH A;  1F8W A;  2GR2 A;  3DH9 A;  3BI5 A;  2XFQ A;  1RYI A;  2R9Z A;  1GRH A;  1LVL A;  2WPC A;  4H4Y A;  4K5R A;  4REK A;  2WU5 A;  3IWA A;  4X4J A;  4CNJ A;  1W4X A;  3GMB A;  3ICT A;  4G9K A;  2XVF A;  1IUU A;  2BS3 A;  3IHM A;  1YKJ A;  3LOV A;  1PBC A;  3GDN A;  1NEK A;  4UDP A;  3UKH A;  3C96 A;  4K5S A;  1VDC A;  2C4C A;  1CC6 A;  5BUK A;  3K30 A;  1PXA A;  3KU9 A;  2BC0 A;  2B7R A;  4Y4M A;  4BUR A;  2BRA A;  4C74 A;  3GYX A;  1QLB A;  4I58 A;  4YKF A;  3R9U A;  1KSU A;  1LPF A;  3GWF A;  1TDK A;  2GQF A;  3M12 A;  3M13 A;  4IVM B;  4IVO B;  3LB8 A;  4Y4N A;  3E1T A;  3EAN A;  2RGO A;  5FS6 A;  4A6N B;  3CPI G;  2RAB A;  3H8I A;  4CNK A;  5JCK A;  3ALL A;  4IV9 A;  4JY3 A;  1PXB A;  2Q0L A;  1EL9 A;  1YQZ A;  4Z2R A;  1D7L A;  2EQ6 A;  4B66 A;  3T2Z A;  3UTH A;  3CN8 A;  3I3L A;  3QJ4 A;  1GND A;  3AE5 A;  2XLT A;  3KLJ A;  3UOZ A;  1E6E A;  1NHR A;  3K7T A;  2R0P A;  1Y56 B;  3DK9 A;  1GRB A;  4LII A;  4ZCD A;  2BYB A;  1E1M A;  4KPR A;  3AE1 A;  2C70 A;  3AD8 B;  1SEZ A;  3K7M X;  3G5R A;  4H7U A;  1ZMC A;  4B64 A;  4GR1 A;  2BCG G;  3SZF A;  4U2S A;  4K2X A;  5JCI A;  3NTD A;  3FPZ A;  2DKI A;  2YLW A;  4N9X A;  5EB5 A;  4CBQ A;  4EMW A;  4DGK A;  3VRA A;  4M52 A;  2PHH A;  1O94 A;  2XVE A;  2QAE A;  2XFN A;  4YT0 A;  4O5U A;  5DBJ A;  2GB0 A;  4C3X A;  2R4E A;  4OVI A;  2Y6Q A;  1OJC A;  1F6M A;  2Q7V A;  4OPI A;  2X3N A;  5FS8 A;  4BJY A;  2C76 A;  2QA2 A;  4J33 A;  2Z5X A;  2YR5 A;  4A5L A;  3HYV A;  3EPT A;  3V3O A;  1B8S A;  1ZKQ A;  4H2P A;  1K0L A;  3C4N A;  3P4Q A;  1EL7 A;  4HA6 A;  1S3E A;  5KMP A;  2F5Z A;  3SZ0 A;  4EM4 A;  4B63 A;  4OPC A;  4OPG A;  5FS9 A;  2GAG B;  5L46 A;  4GF7 A;  1GSN A;  2EQ7 A;  4YSH A;  4J2W A;  2WU2 A;  4I59 A;  1CL0 A;  1TRB A;  2BA9 A;  2HQM A;  2X99 A;  2XFP A;  2YVF A;  3IF9 A;  1GTH A;  1IUS A;  1DOE A;  1N4V A;  2H89 A;  5JCL A;  1DJQ A;  5TR3 A;  4U8I A;  4YSZ A;  3ZDN A;  3S5W A;  1L9C A;  4K22 A;  4U8P A;  5KOW A;  2GQW A;  1LV0 A;  3AE2 A;  2EQ9 A;  4OPT A;  3DGZ A;  3KD9 A;  4H4T A;  2PYX A;  3ALJ A;  1XPQ A;  3EF6 A;  2VVM A;  3CNS A;  4X9M A;  4YTN A;  5J60 A;  3AE8 A;  5KMR A;  2CVJ A;  5BVA A;  2WOW A;  2JB2 A;  3NN0 X;  2XVH A;  3AEA A;  3PO7 A;  3PVC A;  5FS7 A;  4H4V A;  3AD7 B;  3PS9 A;  3GWD A;  2BRY A;  4P9S A;  2XFU A;  3CTY A;  1ONF A;  2VRM A;  1PBD A;  4X9N A;  2WS3 A;  1CF3 A;  1GRA A;  3LXD A;  5CQF A;  2WP9 A;  2X50 A;  2APG A;  2EQ8 A;  1IUX A;  1D4C A;  4B1B A;  1H6V A;  3HZL A;  5GSN A;  2WHD A;  2GMJ A;  3ICR A;  1FL2 A;  3DJJ A;  2WDQ A;  4Z43 A;  4H4P A;  1V59 A;  2FJD A;  1Y56 A;  2XLR A;  2YG5 A;  1EL5 A;  3DK8 A;  1CJ3 A;  3SGL A;  4RSL A;  3AE6 A;  4NEV A;  2IVE A;  2Z5Y A;  4FK1 A;  4A99 A;  2XLP A;  4ECH A;  3NYF A;  1KF6 A;  2YLX A;  4IA6 A;  2VQB A;  3AE9 A;  3KVE A;  4J34 A;  1JNR A;  4H4R A;  4AP1 A;  5KVH A;  3NG7 X;  3CGE A;  4NTE A;  1PBB A;  3VR9 A;  1NHP A;  2JK6 A;  3UKK A;  4OPU A;  4LU6 A;  1F8R A;  3VRB A;  4H2Q A;  5LV9 A;  1PHH A;  4C77 A;  1GRE A;  4A7A A;  2OA1 A;  3BI4 A;  3DGH A;  4EIP A;  4AP3 A;  1RP0 A;  3COX A;  1GXF A;  2JB1 A;  1LQT A;  3ABV A;  3GSI A;  2V3A A;  5KMS A;  2C73 A;  2OAM A;  4A79 A;  4GAP A;  4TM0 A;  2FJA A;  4APN A;  2AQJ A;  2WOI A;  4WCT A;  4AT0 A;  4NTC A;  2X8G A;  2JB3 A;  3Q9T A;  4GRT A;  3GRT A;  2YQU A;  4JNA A;  2C66 A;  3T0K A;  3D8X A;  1E1N A;  4A65 A;  3WE0 A;  4NWZ A;  3QSE A;  4DNA A;  2YG3 A;  3VRD B;  5IPY A;  2NPX A;  2V60 A;  2YLR A;  3F8R A;  1DNC A;  2R0C A;  3BNU A;  3GD3 A;  4UP3 A;  1NG3 A;  2BK5 A;  1HYU A;  3SM8 A;  1E1L A;  5HXI A;  1YQ4 A;  1KDG A;  5KOX A;  4ZN0 A;  3T14 A;  2VVL A;  3AED A;  1VRQ B;  1BGJ A;  1TDF A;  2C75 A;  2YLT A;  4TM3 A;  4CY6 A;  2YG6 A;  1MOK A;  1TDO A;  4FK1 C;  1F3P A;  3AE7 A;  3P4S A;  4YWO A;  2YR4 A;  3RP8 A;  2ZBW A;  3AD9 B;  1F8S A;  3NGC X;  4E0V A;  3SXI A;  1TDN A;  2RGJ A;  3ATQ A;  4II2 A;  1Q1R A;  3UTG A;  3G5S A;  1H83 A;  3NK2 X;  1N4U A;  5U63 A;  4Z25 A;  1Q1W A;  4Z24 A;  3B6D A;  3CMM A;  1CJ2 A;  3IC9 A;  3L1R A;  3RHA A;  3T37 A;  4BK3 A;  5KWF A;  1CC4 A;  3B3R A;  2XFO A;  3BHF A;  2JAE A;  4Z44 A;  1O95 A;  1ZOY A;  2Q0K A;  4YTM A;  1GOS A;  2UZZ A;  3QSS A;  3RNM A;  4YXD A;  1O5W A;  1PJ5 A;  2B76 A;  4BK2 A;  3UKF A;  1IUT A;  1NDA A;  4Y4L A;  1GPE A;  3S61 A;  1XHC A;  2YVG A;  4Z2U A;  3DJD A;  1ZX9 A;  1KSS A;  4MJW A;  4U8L A;  4USR A;  3P4P A;  1MO9 A;  2YG4 A;  3RED A;  5KMQ A;  2C3D A;  2XLU A;  5U1O A;  4H4Z A;  4G6H A;  4PAA A;  3K7Q X;  3AB1 A;  5HHF A;  3II4 A;  2R45 A;  1L0V A;  3C4A A;  3QFA A;  5U25 A;  3SFD A;  1BWC A;  3GMC A;  3AEF A;  3UKL A;  1PBE A;  2E5V A;  2VZ2 A;  4NTD A;  3GYI A;  1LQU A;  2WOV A;  4OCG A;  4UDR A;  2WPE A;  4GCM A;  1B4V A;  3NLC A;  2ARD A;  2GV8 A;  2YLS A;  2GVC A;  2GRT A;  2E1M A;  2YM2 A;  5M0Z A;  1NG4 A;  2RGH A;  3UTE A;  2OLN A;  2YAU A;  4PAB A;  4H4S A;  4DSH A;  2VQ7 A;  2C65 A;  2GR1 A;  3UOY A;  1H7W A;  2GAH B;  4C5O A;  4H4U A;  4TLX A;  1E7P A;  4H50 A;  1DOC A;  1K0J A;  2WDV A;  1QO8 A;  4NEW A;  5KVI A;  3SY4 A;  3CPJ G;  4B68 A;  1KFY A;  2J3N A;  4JY2 A;  1MXT A;  1OJD A;  1CJ4 A;  1BF3 A;  1D4D A;  1FOH A;  1JRZ A;  4EIQ A;  1OJ9 A;  1KNP A;  3ATR A;  3AEG A;  2BCP A;  5C3J A;  4DSG A;  1GV4 A;  4J57 A;  1IJH A;  4CCQ A;  3I6D A;  2BAB A;  2BS4 A;  2VRL A;  2C64 A;  4A6N A;  2R0G A;  3P1W A;  3ZYX A;  4BJZ A;  3ADA B;  4TM1 A;  1S2Q A;  3AXB A;  1YQ3 A;  3AYJ A;  4U8O A;  2JKC A;  3DJE A;  3Q6J A;  1BKW A;  4OPD A;  1TYT A;  4U8M A;  5EBK A;  2FBW A;  1S2Y A;  2R46 A;  2GH5 A;  4II3 A;  3ALM A;  2AAQ A;  2WDR A;  4NZH A;  4TM4 A;  4RG4 A;  3AEB A;  3NHO X;  3IHG A;  4HB9 A;  1H84 A;  1H81 A;  1DOB A;  2BXS A;  3NYE A;  2IVD A;  4YSX A;  3FIM B;  4FX9 A;  3SZC A;  1RSG A;  2ZZB A;  3ITJ A;  1OJT A;  3UKP A;  5BUL A;  4J36 A;  1ELI A;  3G5Q A;  2IID A;  3AWI A;  1GER A;  1D5T A;  4EQW A;  3P4R A;  3OZ2 A;  4H4X A;  2TMD A;  3CNJ A;  4EQR A;  3F8D A;  1QJD A;  5EB4 A;  1BZL A;  1JRX A;  3UOX A;  2YWL A;  4EQX A;  2I0Z A;  3UKA A;  1ZK7 A;  4LA1 A;  4USQ A;  4CCR A;  3AEE A;  3UTF A;  3NH3 X;  4WX1 A;  1M64 A;  2NVK X;  3CGB A;  2OAL A;  3CND A;  1ZOV A;  4J56 A;  1BGN A;  1B37 A;  1PXC A;  1PJ7 A;  2WPF A;  1GT8 A;  1N1P A;  1CHU A;  1OJA A;  2GEW A;  2JBV A;  1LJ1 A;  3T31 A;  4U8N A;  1H82 A;  1TYP A;  3QFB A;  4H4Q A;  3O0H A;  1GAL A;  2WBA A;  3UP4 A;  2C7G A;  3SZW A;  3AE3 A;  5BRT A;  3KPF A;  2GF3 A;  1GRT A;  2H88 A;  4K7Z A;  3UOV A;  2ZZC A;  1UKV G;  5IQ4 A;  2Q6U A;  2XVI A;  2V3B A;  3URH A;  4AOS A;  2GR3 A;  1H7X A;  1IUW A;  1JNZ A;  3AEC A;  2BXR A;  5EOW A;  2WP5 A;  4BV6 A;  5HY5 A;  1IUV A;  4A9W A;  1NHS A;  2B9Y A;  2WET A;  3UCL A;  2BAC A;  5KNL A;  4B69 A;  2WQY A;  3T2Y A;  5ER0 A;  1LTX R;  5J7X A;  1D7Y A;  2XYO A;  1EL8 A;  4GDE A;  1GET A;  5JCM A;  4JDR A;  2W0H A;  2YLZ A;  1CJC A;  1TDE A;  2FJE A;  3AYI A;  4TLZ A;  2BK3 A;  2XCG A;  2BC1 A;  1NEN A;  1B5Q A;  1PBF A;  1ZDL A;  2V6O A;  3GD4 A;  3H4K A;  4CRT A;  4EMI A;  4Z26 A;  3NNE A;  3GDP A;  1COY A;  1DOD A;  3OC4 A;  4ADW A;  3UKQ A;  2C72 A;  2WP6 A;  2ZZ0 A;  2GR0 A;  1JU2 A;  3VR8 A;  5KXJ A;  1ZMD A;  3CNT A;  3BI2 A;  3V76 A;  4D04 A;  1NHQ A;  2YVJ A;  3FBS A;  1XDI A;  4ZCC A;  1N4W A;  3SFE A;  3JSK A;  3DA1 A;  1PJ6 A;  3FG2 P;  1L9D A;  1GES A;  1YY5 A;  1P2H A;  3QVR A;  3ISH A;  5JCN A;  3SX6 A;  1DJN A;  1CBO A;  2XVJ A;  2TPR A;  3DJG X;  2B9X A;  3EAO A;  3L8K A;  3NTA A;  4G6G A;  3V3N A;  2YG7 A;  2QCU A;  1GTE A;  5IQ1 A;  4U8J A;  3M0O A;  1P2E A;  2CDU A;  3NYC A;  3AYL A;  1REO A;  3F8P A;  2AR8 A;  4AOX A;  5FMH A;  3NIX A;  1GRF A;  5M10 A;  2V5Z A;  1FEB A;  2ACZ A;  1VG0 A;  3NRN A;  4XWZ A;  4YKG A;  3UP5 A;  4JNQ A;  2A89 A;  2C3C A;  2QA1 A;  1DXL A;  1PS9 A;  1XAN A;  2FJB A;  3KPK A;  4NNJ A;  1VG9 A;  3P9U A;  4D03 A;  1Y0P A;  1D4E A;  3LZX A;  1L9E A;  4KX6 A;  4K8D A;  1M6I A;  1KNR A;  4B65 A;  1AOG A;  2VOU A;  4JN9 A;  4U2L A;  3LZW A;  2A8X A;  4FDC B;  3LJP A;  4EQS A;  3GRS A;  4ICY A;  3RP7 A;  1CC2 A;  1X31 B;  1E1K A;  3NN6 X;  1GRG A;  4H4W A;  3BNM A;  2DKH A;  3NKS A;  4AT2 A;  3KKJ A;  3BHK A;  3CPH G;  1FEC A;  4C3Y A;  4YTP A;  3SYI A;  3RP6 A;  5CKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...