1H81A

Structure of polyamine oxidase in the reduced state
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 167
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h81A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h81A02
2C7GA 2ARDA 4PAAA 3K30A 2JBVA 1K4QA 3KA7A 2WBAA 4YKGA 4J33A 4OPGA 5BUKA 2BA9A 3IC9A 2UZZA 3QSMA 3UKAA 4Z2UA 3AE6A 1ZOYA 2GF3A 3AYLA 4WCTA 2V5ZA 3HZLA 2F5ZA 3NYEA 1M6IA 2RGJA 4YXDA 4NEVA 1NHRA 4B67A 4GUVA 5KOXA 4H2NA 2GR3A 4CNJA 3IHGA 4AT0A 4Z26A 1TYTA 3I6DA 1VRQB 1ELIA 2YQUA 4K5SA 2WOVA 4U2SA 1OJTA 2X50A 4OVIA 2BK4A 3FPZA 3GWFA 4JDRA 4J36A 2IVDA 2YLSA 3RP7A 4BK2A 1GPEA 2FBWA 3H4KA 3AECA 2OA1A 4JY2A 2GVCA 1XHCA 5C2TA 3C4AA 3DA1A 2R0GA 4JNAA 4H4QA 3CPIG 4U8NA 3GDNA 3NTDA 2CULA 1FEBA 3AD9B 1JU2A 2WDQA 4J2WA 4BV6A 3ALJA 3NN0X 4USRA 1S3EA 4DSGA 1GRBA 1F3PA 3AD8B 1IUSA 2Q0KA 3CIRA 4BURA 3ISHA 2GAHB 3CGEA 3AE4A 4EMWA 1PDHA 1E6EA 3CPJG 4HA6A 3IHMA 1PBBA 3UP5A 3S5WA 1RYIA 1LQUA 2V6OA 4KPRA 1N4WA 2X3NA 4I58A 2YLTA 3FG2P 3VR8A 2A8XA 3UTHA 5JCMA 1S3BA 2WQYA 3AE7A 4EIPA 3KPFA 4BJYA 4YTNA 4B64A 5JCNA 4GDEA 4CY8A 3EPTA 4C74A 4IVOB 2OLOA 1ZP0A 2BXSA 5FS8A 1REOA 2V61A 3UOYA 5KVHA 3AYIA 3II4A 2B9YA 2YG7A 1PBDA 5FS6A 3CGBA 3NNEA 2FJBA 3ABVA 3Q6JA 1OJCA 4AP3A 1ONFA 1EL7A 1Q1WA 2V60A 5C3JA 3VQRA 5JCLA 2ZZCA 2C66A 4FK1A 4OPUA 1CBOA 1NPXA 4H4RA 3NT6A 3JSKA 1PBCA 2AAQA 3FIMB 2B7SA 2XLRA 3BI5A 2WPCA 2C3CA 3EANA 4H4TA 3UOVA 4Z24A 3V3NA 3R9UA 1LPFA 1JRZA 3S61A 1JNZA 2AQJA 3BI4A 1GREA 1TDNA 1JRXA 1RSGA 1O94A 1M64A 2WP5A 3PO7A 1EL9A 2GQWA 2ZBWA 4NEWA 4O5QA 3AEFA 5GRTA 3QVPA 2TPRA 3K7QX 3C96A 3BI2A 1MO9A 3EAOA 4YSXA 5TR3A 3BHFA 1QO8A 3UKQA 2A89A 2GQFA 3AWIA 3CGDA 4OPDA 3NH3X 1NEKA 2XVIA 3M12A 3NHOX 4YSZA 2V3BA 4H4ZA 2W0HA 4GR1A 3UKPA 4Z44A 3VRBA 1XPQA 4CRTA 5BULA 4UDQA 1CL0A 3DJEA 1DNCA 4Z2RA 1S2YA 1UKVG 4LIIA 1LQTA 1ZY8A 3NLCA 3NK1X 2YWLA 3CNJA 2BYBA 4FK1C 5IQ1A 2BACA 2C76A 3NGCX 1KSSA 2ACZA 1EL5A 2R4JA 1PXAA 1MXTA 2PYXA 4B1BA 2R0PA 3P4SA 3G5RA 3NN6X 3NIXA 3BNUA 2XLUA 3AE1A 4GDPA 4USQA 4O5UA 1B8SA 2NVKX 4OPLA 1BZLA 4NTDA 4UDPA 1GNDA 2TMDA 2H89A 4A6NA 4Y4NA 1L9CA 3AXBA 4U8OA 4Z25A 3GD3A 1CC6A 4EM4A 4KX6A 2C67A 3F8DA 1EL8A 2WETA 4UDRA 4TM1A 4YTMA 5BRTA 4H7UA 2JB1A 3ICRA 5L46A 4LA1A 2XLSA 2XFQA 3P9UA 3ATRA 4H4XA 5IQ4A 3QVRA 3GWDA 3P1WA 3ALLA 1GALA 1ZDLA 3ALMA 4Y4LA 3CN8A 1L9EA 5HHFA 2R4EA 3GYJA 2RGHA 3UP4A 2R45A 2YG5A 4X9MA 1N4UA 3AEEA 5FS9A 1NHQA 1YQ3A 2GRTA 3QSSA 4OPIA 3P4PA 2BXRA 4ICYA 3AEDA 4BK1A 5J7XA 4U8JA 4Z2TA 3LADA 1XANA 1X31B 2E1MA 4J31A 5HY5A 1CJCA 3LJPA 3QFBA 1PN0A 4EM3A 1SEZA 1JNRA 1NHPA 3CTYA 1KF6A 2BC1A 3NKSA 2BS4A 5U1OA 4U8LA 3M0OA 1TDFA 4YKFA 3DJDA 5ER0A 3F8RA 2WP9A 1OJ9A 3AE8A 3LZXA 3VRAA 1K0IA 4M52A 4HB9A 4K7ZA 2VVLA 4XXGA 1PXBA 2XFNA 2YAUA 2YG6A 3CNTA 4J34A 3AEGA 2QCUA 4GCMA 4EQSA 1Z6LA 5M0ZA 2NPXA 1BWCA 1YY5A 1F8WA 1DXLA 2GAGB 5J60A 2VOUA 4YWOA 5KVIA 1GRHA 2JKCA 1KNRA 4XWRA 2CVJA 1KFYA 3M13A 3RP8A 2E4GA 1E1LA 1DJQA 4YSHA 1F6MA 2PHHA 4LU6A 4NZHA 2C65A 2B7RA 1DOCA 3LXDA 1BF3A 2VVMA 4H2QA 2XLPA 2Z5YA 3VR9A 1IUWA 3GMCA 4A7AA 1PJ7A 2ZZ0A 1D4CA 3AD7B 3AE2A 1Q9IA 3DMEA 1H6VA 4H50A 1NDAA 1PS9A 3UKHA 1YQ4A 4H4SA 2AR8A 5KWFA 2B9XA 4JY3A 2B76A 1JOAA 3CGCA 2GMJA 4TLXA 4IV9A 4H2PA 3BNMA 3WE0A 2EQ9A 3PVCA 2WPFA 2XLTA 3AEAA 5EB4A 1VQWA 3DH9A 2IIDA 2QAEA 4ZCCA 1CHUA 2XVHA 3K7MX 1GETA 2DKIA 1PJ6A 2WDVA 2VRMA 3C4NA 1TDOA 4OPCA 3SM8A 1DJNA 3NTAA 4K8DA 5HYMA 1COYA 2YG3A 3NG7X 1GTHA 4TM0A 2B9WA 5EOWA 4XWZA 1CJ3A 1CJ4A 2C72A 2BABA 2Q0LA 2Q7VA 1L0VA 1OJAA 2ZZBA 3NRNA 5EB5A 4CCRA 1N1PA 3AE3A 2VRLA 1GSNA 4U8PA 4B63A 2OALA 3UKLA 1W4XA 1F8SA 4EMIA 4ADWA 2WP6A 2YR5A 4K22A 1ZMCA 3LOVA 3RHAA 2WEUA 3CNPA 2BCPA 3LZWA 1ZMDA 4IA5A 3BHKA 1TDKA 2BS2A 1GT8A 4U8KA 5BVAA 2GEWA 4DSHA 2XFOA 5JCKA 3NYFA 2FJAA 2WU5A 3UCLA 3B3RA 2XYOA 3DGHA 5KRQA 1Y56A 4IVMB 4FX9A 1LVLA 4H4PA 5FS7A 1H86A 3QSEA 2A87A 4C3XA 2WOWA 4N9XA 1IUUA 1LV0A 2JAEA 4I59A 1BKWA 3DK8A 3FBSA 4TM4A 3I3LA 5LV9A 4K5RA 3IWAA 4UP3A 1D4DA 2XCGA 1P2EA 3KLJA 3GYIA 3NYCA 4H4UA 2X8GA 2R46A 3UTFA 1QLBA 3DK4A 1PBEA 2GR2A 1IUVA 3ZDNA 4JN9A 1V59A 4D03A 3AYJA 1ZOVA 3NK0X 3QFAA 5JCIA 3ZYXA 4Y4MA 3VRDB 1B4VA 3DGZA 2YG4A 2R9ZA 1GERA 4REKA 3D8XA 3E1TA 4OPTA 4U2TA 1EBDA 2VQ7A 2C73A 3UOZA 2R0CA 1E1MA 4P9SA 4B66A 1PBFA 4GRTA 1CJ2A 1B37A 1CF3A 3DJGX 2YM2A 2C64A 4A6NB 4C3YA 4DNAA 3SGLA 2APGA 1FECA 1Y0PA 2XVEA 3AEBA 1PJ5A 4CBQA 4YT0A 4U2LA 2EQ8A 3URHA 2CDUA 1PHHA 4WX1A 1ZK7A 2WOIA 4B65A 2XVFA 3COXA 2YLRA 2O9ZA 1GRTA 2VVLG 1E39A 1VDCA 3AE5A 1IUTA 2GB0A 2RGOA 5FMHA 4H4WA 3AB1A 5DBJA 1ZX9A 3AE9A 3OC4A 2RABA 3H8LA 2XDOA 1CC4A 2BC0A 2VQBA 4X4JA 2JB2A 2YVJA 3UKKA 4BJZA 1YQZA 2GR0A 3KVEA 1DOBA 1GEUA 3SFDA 3L8KA 4GF7A 3GDPA 3CNSA 4K2XA 1XDIA 2WESA 2WDRA 1AOGA 1GOSA 2V3AA 3GD4A 3REDA 1QJDA 4APNA 1S2QA 1DODA 2GMHA 2H88A 5HXIA 2YVFA 1FCDA 4H4VA 3RNMA 4TM3A 5CKUA 3T37A 4EQRA 1TYPA 4U8IA 3V3OA 1PXCA 4DGKA 1GESA 2BK3A 4X9NA 1DOEA 1NG4A 1D4EA 1P2HA 3Q9TA 5IPYA 4U8MA 4ECHA 3GRSA 1ZKQA 3UTGA 1K0LA 1GRAA 2BS3A 1B5QA 3L1RA 4NTCA 3UKFA 3SQPA 1KNPA 4BK3A 1GRGA 1JRYA 3GRTA 2WHDA 1H83A 5KXJA 4OCGA 2C75A 4CNKA 4JNQA 2FJEA 2WS3A 4YSYA 1IJHA 4A65A 3K7TA 4AP1A 4D04A 4FDCB 4CCQA 4AT2A 2X8HA 5M10A 5CQFA 4B68A 1KSUA 2IVEA 2YLXA 3O0HA 2OLNA 1GV4A 2Q6UA 3KU9A 2X8CA 3SFEA 4B69A 3GSIA 3NK2X 4EQWA 2CFYA 1E1KA 1NG3A 3UTEA 3UOXA 2EQ6A 3QJ4A 1TDEA 5EBKA 2C3DA 1CC2A 4EIQA 3KD9A 2FJDA 1O5WA 2GH5A 1VG0A 3ADAB 1GRFA 4J57A 4C5OA 1E7PA 2WU2A 1JEHA 1TRBA 1L9DA 1FL2A 2YVGA 4TLZA 2OAMA 2JK6A 3ICTA 1VG9A 4E0VA 2Z5XA 1E1NA 2JB3A 4RG3A 3F8PA 4A79A 3D1CA 3DK9A 2XFUA 2QA1A 4AOXA 2QA2A 3EF6A 1HYUA 1MOKA 1H82A 4AOSA 1FEAA 4EQXA 4A9WA 1H7WA 3ATQA 4MJWA 5U25A 3P4QA 1OJDA 2E5VA 4ZN0A 1KDGA 4ZCDA 2BK5A 3ICSA 3H8IA 2X99A 2Y6RA 3DJJA 1H81A 4H4YA 5U63A 4CY6A 3ITJA 2XFPA 3KKJA 3V76A 2GV8A 4Z43A 1RP0A 3G5QA 1H7XA 2BCGG 2DKHA 2J3NA 1GXFA 1K0JA 1FOHA 2EQ7A 1H84A 2Y6QA 4EMJA 1F8RA 1N4VA 1BGJA 3PS9A 4J56A 1YKJA 4IA6A 4NTEA 4RSLA 3GMBA 1GTEA 2YLWA 3CNDA 4RG4A 2YR4A 5GSNA 2WPEA 1Y56B 2C70A 2XVJA 3FMWA 1LJ1A 2YM1A 3P4RA 4A99A 4C77A 1BGNA 2VZ2A 1IUXA 1D7YA 1NENA 3RP6A 4A5LA 4YTPA 2YR6A 5KOWA 2HQMA 3B6DA 3IF9A 4JQ9A 3LB8A 4PABA 2GR1A 1O95A 3G5SA 3OZ2A 4H2RA 3CPHG 2I0ZA 1LTXR 1D5TA 1Q1RA 2YLZA 1NHSA 1NAAA 1D7LA
chains in the Genus database with same CATH superfamily
2C7GA 2ARDA 4PAAA 3K30A 2JBVA 1K4QA 3KA7A 2WBAA 4YKGA 4J33A 4OPGA 5BUKA 2BA9A 3IC9A 2UZZA 3QSMA 3UKAA 4Z2UA 3AE6A 1ZOYA 2GF3A 3AYLA 4WCTA 2V5ZA 3HZLA 2F5ZA 3NYEA 1M6IA 2RGJA 4II3A 4YXDA 4NEVA 1NHRA 4B67A 4GUVA 5KOXA 4H2NA 2GR3A 4CNJA 3IHGA 4AT0A 4Z26A 1TYTA 3I6DA 1VRQB 1ELIA 2YQUA 4K5SA 2WOVA 4U2SA 1OJTA 2X50A 4OVIA 2BK4A 3FPZA 3GWFA 4JDRA 4J36A 2IVDA 2YLSA 3RP7A 4BK2A 1GPEA 2FBWA 3H4KA 3AECA 2OA1A 4JY2A 2GVCA 1XHCA 5C2TA 3C4AA 3DA1A 5KWFA 2R0GA 4JNAA 4H4QA 4NWZA 3CPIG 4U8NA 3GDNA 3NTDA 2CULA 1FEBA 3AD9B 1JU2A 2WDQA 4J2WA 4BV6A 3ALJA 3HYXA 3NN0X 4USRA 1S3EA 4DSGA 1GRBA 1F3PA 3AD8B 1IUSA 2Q0KA 3CIRA 4BURA 3ISHA 2GAHB 3CGEA 3AE4A 4EMWA 1PDHA 1E6EA 3CPJG 4HA6A 3IHMA 1PBBA 3UP5A 3S5WA 1RYIA 1LQUA 2V6OA 4KPRA 1N4WA 3T31A 2X3NA 4I58A 2YLTA 3FG2P 3VR8A 2A8XA 3UTHA 4G9KA 5JCMA 4II2A 1S3BA 2WQYA 3AE7A 4EIPA 3KPFA 4BJYA 4YTNA 4B64A 5JCNA 4GDEA 4CY8A 3EPTA 4C74A 4IVOB 2OLOA 1ZP0A 2BXSA 5FS8A 1REOA 2V61A 3SYIA 3UOYA 3AYIA 3II4A 2B9YA 2YG7A 1PBDA 5KVHA 5FS6A 3CGBA 3NNEA 2FJBA 3ABVA 3Q6JA 1OJCA 4AP3A 1ONFA 1EL7A 1Q1WA 2V60A 5C3JA 3T14A 3VQRA 5JCLA 2ZZCA 2C66A 4FK1A 4OPUA 1CBOA 1NPXA 4H4RA 2BRYA 3JSKA 1PBCA 2AAQA 3NT6A 3FIMB 2B7SA 2XLRA 3BI5A 2WPCA 2C3CA 3EANA 4H4TA 3UOVA 3T2ZA 4Z24A 3V3NA 3R9UA 1LPFA 1JRZA 3S61A 1JNZA 2AQJA 3BI4A 1GREA 1TDNA 1JRXA 1RSGA 1O94A 3T0KA 1M64A 2WP5A 3PO7A 1EL9A 2GQWA 2ZBWA 4NEWA 4O5QA 3AEFA 5GRTA 3QVPA 2TPRA 3K7QX 3C96A 3BI2A 1MO9A 3EAOA 4YSXA 5TR3A 3BHFA 1QO8A 3UKQA 2A89A 2GQFA 3AWIA 3CGDA 4OPDA 3NH3X 1NEKA 2XVIA 3M12A 3NHOX 4YSZA 2V3BA 4H4ZA 2W0HA 4GR1A 3UKPA 4Z44A 3VRBA 1XPQA 4CRTA 5BULA 4UDQA 1CL0A 3DJEA 3SX6A 1DNCA 4Z2RA 1S2YA 1UKVG 4LIIA 1LQTA 1ZY8A 4G6GA 3NLCA 3NK1X 2YWLA 3CNJA 2BYBA 4FK1C 5IQ1A 2BACA 2C76A 3NGCX 1KSSA 2ACZA 1EL5A 2R4JA 1PXAA 1MXTA 2PYXA 4B1BA 2R0PA 3P4SA 3G5RA 3NN6X 3NIXA 3BNUA 5KMQA 2XLUA 3AE1A 4GDPA 4USQA 4O5UA 1B8SA 2NVKX 4OPLA 1BZLA 4NTDA 4UDPA 1GNDA 2TMDA 3SZ0A 2H89A 4A6NA 4Y4NA 1L9CA 3AXBA 4U8OA 4Z25A 3GD3A 1CC6A 4EM4A 4KX6A 2C67A 3F8DA 1EL8A 2WETA 4UDRA 4TM1A 4YTMA 5BRTA 4H7UA 2JB1A 3ICRA 5L46A 4LA1A 2XLSA 2XFQA 3P9UA 3ATRA 4H4XA 3SZWA 5IQ4A 3QVRA 3GWDA 3P1WA 3ALLA 1GALA 1ZDLA 3ALMA 4Y4LA 3CN8A 1L9EA 5HHFA 2R4EA 3GYJA 2RGHA 3UP4A 2R45A 2YG5A 4X9MA 1N4UA 3AEEA 5FS9A 1NHQA 1YQ3A 2GRTA 3QSSA 4OPIA 3P4PA 2BXRA 4ICYA 3AEDA 4BK1A 5J7XA 4U8JA 4Z2TA 3LADA 1XANA 1X31B 2E1MA 4J31A 5HY5A 1CJCA 3LJPA 3QFBA 1PN0A 4EM3A 1SEZA 1JNRA 1NHPA 3CTYA 1KF6A 2BC1A 3NKSA 2BS4A 5U1OA 4U8LA 3M0OA 1TDFA 4YKFA 3DJDA 5ER0A 5KNLA 3F8RA 2WP9A 4G74A 1OJ9A 3AE8A 3LZXA 3VRAA 1K0IA 4M52A 4HB9A 4K7ZA 3SZCA 2VVLA 4XXGA 1PXBA 2XFNA 2YAUA 2YG6A 3CNTA 4J34A 3AEGA 2QCUA 4GCMA 4EQSA 1Z6LA 5M0ZA 2NPXA 1BWCA 1YY5A 1F8WA 1DXLA 2GAGB 5J60A 2VOUA 4YWOA 5KVIA 1GRHA 2JKCA 1KNRA 3T2KA 4XWRA 2CVJA 1KFYA 3M13A 3RP8A 2E4GA 1E1LA 1DJQA 4YSHA 1F6MA 2PHHA 4LU6A 4NZHA 2C65A 2B7RA 1DOCA 3LXDA 4G73A 1BF3A 2VVMA 4H2QA 2XLPA 2Z5YA 3VR9A 1IUWA 2C4CA 3GMCA 4A7AA 1PJ7A 2ZZ0A 1D4CA 3AD7B 3AE2A 1Q9IA 3DMEA 1H6VA 4H50A 1NDAA 1PS9A 4G6HA 1YQ4A 4H4SA 2AR8A 3UKHA 2B9XA 4JY3A 2B76A 1JOAA 3CGCA 2GMJA 4TLXA 4IV9A 4H2PA 3BNMA 3WE0A 2EQ9A 3PVCA 2WPFA 2XLTA 3AEAA 5EB4A 1VQWA 3DH9A 2IIDA 2QAEA 4ZCCA 1CHUA 2XVHA 3K7MX 1GETA 2DKIA 1PJ6A 2WDVA 2VRMA 3C4NA 1TDOA 4OPCA 3SM8A 1DJNA 3NTAA 4K8DA 5HYMA 1COYA 2YG3A 3NG7X 1GTHA 4TM0A 2B9WA 5EOWA 4XWZA 1CJ3A 1CJ4A 2C72A 2BABA 2Q0LA 2Q7VA 1L0VA 1OJAA 2ZZBA 3NRNA 5EB5A 4CCRA 2BRAA 1N1PA 3AE3A 2VRLA 1GSNA 4U8PA 4B63A 2OALA 3UKLA 1W4XA 1F8SA 4EMIA 4ADWA 2WP6A 2YR5A 4K22A 4NNJA 1ZMCA 3LOVA 3RHAA 2WEUA 3CNPA 2BCPA 3LZWA 1ZMDA 4IA5A 3BHKA 1TDKA 2BS2A 1GT8A 4U8KA 5BVAA 2GEWA 4DSHA 2XFOA 5JCKA 3NYFA 2FJAA 2WU5A 4GAPA 3UCLA 3HYVA 3B3RA 2XYOA 3DGHA 5KRQA 1Y56A 4IVMB 4FX9A 1LVLA 4H4PA 5FS7A 1H86A 3QSEA 2A87A 4C3XA 2WOWA 4N9XA 1IUUA 1LV0A 2JAEA 4I59A 1BKWA 3DK8A 3FBSA 4TM4A 3I3LA 5LV9A 4K5RA 3IWAA 4UP3A 1D4DA 2XCGA 1P2EA 3KLJA 3GYIA 3NYCA 4H4UA 2X8GA 2R46A 3UTFA 1QLBA 3DK4A 1PBEA 2GR2A 1IUVA 3ZDNA 4JN9A 1V59A 3SXIA 4D03A 3AYJA 1ZOVA 3NK0X 3QFAA 5JCIA 3ZYXA 4Y4MA 3VRDB 1B4VA 3DGZA 2YG4A 2R9ZA 1GERA 4REKA 3D8XA 3E1TA 4OPTA 4U2TA 3CMMA 1EBDA 2VQ7A 2C73A 3UOZA 2R0CA 1E1MA 4P9SA 4B66A 1PBFA 4GRTA 1CJ2A 1B37A 1CF3A 3DJGX 2YM2A 2C64A 3KPKA 4A6NB 4C3YA 4DNAA 3SGLA 2APGA 1FECA 1Y0PA 2XVEA 3AEBA 1PJ5A 4CBQA 4YT0A 4U2LA 2EQ8A 3URHA 2CDUA 1PHHA 4WX1A 1ZK7A 2WOIA 3SZFA 4B65A 2XVFA 3COXA 2YLRA 2O9ZA 1GRTA 2VVLG 1E39A 1VDCA 3AE5A 1IUTA 2GB0A 2RGOA 5FMHA 4H4WA 3AB1A 5DBJA 5KMSA 1ZX9A 3AE9A 3OC4A 2RABA 3H8LA 2XDOA 1CC4A 2BC0A 2VQBA 4X4JA 2JB2A 2YVJA 3UKKA 4BJZA 5KMPA 1YQZA 2GR0A 3KVEA 1DOBA 1GEUA 3SFDA 3L8KA 4GF7A 3GDPA 3CNSA 4K2XA 1XDIA 2WESA 2WDRA 1AOGA 1GOSA 2V3AA 3GD4A 3REDA 1QJDA 4APNA 1S2QA 1DODA 2GMHA 2H88A 5HXIA 2YVFA 1FCDA 4H4VA 3RNMA 4TM3A 5CKUA 3T37A 4EQRA 1TYPA 4U8IA 3V3OA 1PXCA 4DGKA 1GESA 2BK3A 4X9NA 1DOEA 1NG4A 1D4EA 3T2YA 1P2HA 3Q9TA 5IPYA 4U8MA 4ECHA 3GRSA 1ZKQA 3UTGA 1K0LA 1GRAA 4GAVA 5KMRA 2BS3A 1B5QA 3L1RA 4NTCA 3UKFA 3SQPA 1KNPA 4BK3A 1GRGA 1JRYA 3GRTA 2WHDA 1H83A 5KXJA 4OCGA 3HYWA 2C75A 4CNKA 4JNQA 2FJEA 2WS3A 4YSYA 1IJHA 4A65A 3K7TA 4AP1A 4D04A 4FDCB 4CCQA 4AT2A 2X8HA 5M10A 5CQFA 4B68A 1KSUA 2IVEA 2YLXA 3O0HA 2OLNA 1GV4A 2Q6UA 3KU9A 2X8CA 3SFEA 4B69A 3GSIA 3NK2X 4EQWA 2CFYA 1E1KA 1NG3A 3UTEA 3UOXA 2EQ6A 3QJ4A 1TDEA 5EBKA 2C3DA 1CC2A 4EIQA 3KD9A 2FJDA 1O5WA 2GH5A 1VG0A 3ADAB 1GRFA 4J57A 4C5OA 1E7PA 2WU2A 1JEHA 1TRBA 1L9DA 1FL2A 2YVGA 4TLZA 2OAMA 2JK6A 3ICTA 3SY4A 1VG9A 4E0VA 2Z5XA 1E1NA 2JB3A 4RG3A 3F8PA 3GYXA 4A79A 3D1CA 3DK9A 2XFUA 2QA1A 4AOXA 2QA2A 3EF6A 1HYUA 1MOKA 1H82A 4AOSA 1FEAA 4EQXA 4A9WA 1H7WA 3ATQA 4MJWA 5U25A 3P4QA 1OJDA 2E5VA 4ZN0A 1KDGA 4ZCDA 2BK5A 3ICSA 3H8IA 2X99A 2Y6RA 3DJJA 1H81A 4H4YA 5U63A 4CY6A 3ITJA 2XFPA 3KKJA 3V76A 2GV8A 4Z43A 1RP0A 3G5QA 1H7XA 2BCGG 2DKHA 2J3NA 1GXFA 1K0JA 1FOHA 2EQ7A 1H84A 2Y6QA 4EMJA 1F8RA 1N4VA 1BGJA 3PS9A 4J56A 1YKJA 4IA6A 4NTEA 4RSLA 3GMBA 1GTEA 2YLWA 3CNDA 4RG4A 2YR4A 5GSNA 2WPEA 1Y56B 2C70A 2XVJA 3FMWA 1LJ1A 2YM1A 3P4RA 4A99A 4C77A 1BGNA 2VZ2A 1IUXA 1D7YA 1NENA 3RP6A 4A5LA 4YTPA 2YR6A 5KOWA 2HQMA 3B6DA 3IF9A 4JQ9A 3LB8A 4PABA 2GR1A 1O95A 3G5SA 3OZ2A 4H2RA 3CPHG 2I0ZA 1LTXR 1D5TA 1Q1RA 2YLZA 1NHSA 1NAAA 1D7LA
chains in the Genus database with same CATH topology
2C7GA 2ARDA 4PAAA 3K30A 2JBVA 1K4QA 3KA7A 2WBAA 4YKGA 4J33A 4OPGA 5BUKA 2BA9A 3IC9A 2UZZA 3QSMA 3UKAA 4Z2UA 3AE6A 1ZOYA 2GF3A 3AYLA 4WCTA 2V5ZA 3HZLA 2F5ZA 3NYEA 1M6IA 2RGJA 4II3A 4YXDA 4NEVA 1NHRA 4B67A 4GUVA 5KOXA 4H2NA 2GR3A 4CNJA 3IHGA 4AT0A 4Z26A 1TYTA 3I6DA 1VRQB 1ELIA 2YQUA 4K5SA 2WOVA 4U2SA 1OJTA 2X50A 4OVIA 2BK4A 3FPZA 3GWFA 4JDRA 4J36A 2IVDA 2YLSA 3RP7A 4BK2A 1GPEA 2FBWA 3H4KA 3AECA 2OA1A 4JY2A 2GVCA 1XHCA 5C2TA 3C4AA 3DA1A 5KWFA 2R0GA 4JNAA 4H4QA 4NWZA 3CPIG 4U8NA 3GDNA 3NTDA 2CULA 1FEBA 3AD9B 1JU2A 2WDQA 4J2WA 4BV6A 3ALJA 3HYXA 3NN0X 4USRA 1S3EA 4DSGA 1GRBA 1F3PA 3AD8B 1IUSA 2Q0KA 3CIRA 4BURA 3ISHA 2GAHB 3CGEA 3AE4A 4EMWA 1PDHA 1E6EA 3CPJG 4HA6A 3IHMA 1PBBA 3UP5A 3S5WA 1RYIA 1LQUA 2V6OA 4KPRA 1N4WA 3T31A 2X3NA 4I58A 2YLTA 3FG2P 3VR8A 2A8XA 3UTHA 4G9KA 5JCMA 4II2A 1S3BA 2WQYA 3AE7A 4EIPA 3KPFA 4BJYA 4YTNA 4B64A 5JCNA 4GDEA 4CY8A 3EPTA 4C74A 4IVOB 2OLOA 1ZP0A 2BXSA 5FS8A 1REOA 2V61A 3SYIA 3UOYA 3AYIA 3II4A 2B9YA 2YG7A 1PBDA 5KVHA 5FS6A 3CGBA 3NNEA 2FJBA 3ABVA 3Q6JA 1OJCA 4AP3A 1ONFA 1EL7A 1Q1WA 2V60A 5C3JA 3T14A 3VQRA 5JCLA 2ZZCA 2C66A 4FK1A 4OPUA 1CBOA 1NPXA 4H4RA 2BRYA 3JSKA 1PBCA 2AAQA 3NT6A 3FIMB 2B7SA 2XLRA 3BI5A 2WPCA 2C3CA 3EANA 4H4TA 3UOVA 3T2ZA 4Z24A 3V3NA 3R9UA 1LPFA 1JRZA 3S61A 1JNZA 2AQJA 3BI4A 1GREA 1TDNA 1JRXA 1RSGA 1O94A 3T0KA 1M64A 2WP5A 3PO7A 1EL9A 2GQWA 2ZBWA 4NEWA 4O5QA 3AEFA 5GRTA 3QVPA 2TPRA 3K7QX 3C96A 3BI2A 1MO9A 3EAOA 4YSXA 5TR3A 3BHFA 1QO8A 3UKQA 2A89A 2GQFA 3AWIA 3CGDA 4OPDA 3NH3X 1NEKA 2XVIA 3M12A 3NHOX 4YSZA 2V3BA 4H4ZA 2W0HA 4GR1A 3UKPA 4Z44A 3VRBA 1XPQA 4CRTA 5BULA 4UDQA 1CL0A 3DJEA 3SX6A 1DNCA 4Z2RA 1S2YA 1UKVG 4LIIA 1LQTA 1ZY8A 4G6GA 3NLCA 3NK1X 2YWLA 3CNJA 2BYBA 4FK1C 5IQ1A 2BACA 2C76A 3NGCX 1KSSA 2ACZA 1EL5A 2R4JA 1PXAA 1MXTA 2PYXA 4B1BA 2R0PA 3P4SA 3G5RA 3NN6X 3NIXA 3BNUA 5KMQA 2XLUA 3AE1A 4GDPA 4USQA 4O5UA 1B8SA 2NVKX 4OPLA 1BZLA 4NTDA 4UDPA 1GNDA 2TMDA 3SZ0A 2H89A 4A6NA 4Y4NA 1L9CA 3AXBA 4U8OA 4Z25A 3GD3A 1CC6A 4EM4A 4KX6A 2C67A 3F8DA 1EL8A 2WETA 4UDRA 4TM1A 4YTMA 5BRTA 4H7UA 2JB1A 3ICRA 5L46A 4LA1A 2XLSA 2XFQA 3P9UA 3ATRA 4H4XA 3SZWA 5IQ4A 3QVRA 3GWDA 3P1WA 3ALLA 1GALA 1ZDLA 3ALMA 4Y4LA 3CN8A 1L9EA 5HHFA 2R4EA 3GYJA 2RGHA 3UP4A 2R45A 2YG5A 4X9MA 1N4UA 3AEEA 5FS9A 1NHQA 1YQ3A 2GRTA 3QSSA 4OPIA 3P4PA 2BXRA 4ICYA 3AEDA 4BK1A 5J7XA 4U8JA 4Z2TA 3LADA 1XANA 1X31B 2E1MA 4J31A 5HY5A 1CJCA 3LJPA 3QFBA 1PN0A 4EM3A 1SEZA 1JNRA 1NHPA 3CTYA 1KF6A 2BC1A 3NKSA 2BS4A 5U1OA 4U8LA 3M0OA 1TDFA 4YKFA 3DJDA 5ER0A 5KNLA 3F8RA 2WP9A 4G74A 1OJ9A 3AE8A 3LZXA 3VRAA 1K0IA 4M52A 4HB9A 4K7ZA 3SZCA 2VVLA 4XXGA 1PXBA 2XFNA 2YAUA 2YG6A 3CNTA 4J34A 3AEGA 2QCUA 4GCMA 4EQSA 1Z6LA 5M0ZA 2NPXA 1BWCA 1YY5A 1F8WA 1DXLA 2GAGB 5J60A 2VOUA 4YWOA 5KVIA 1GRHA 2JKCA 1KNRA 3T2KA 4XWRA 2CVJA 1KFYA 3M13A 3RP8A 2E4GA 1E1LA 1DJQA 4YSHA 1F6MA 2PHHA 4LU6A 4NZHA 2C65A 2B7RA 1DOCA 3LXDA 4G73A 1BF3A 2VVMA 4H2QA 2XLPA 2Z5YA 3VR9A 1IUWA 2C4CA 3GMCA 4A7AA 1PJ7A 2ZZ0A 1D4CA 3AD7B 3AE2A 1Q9IA 3DMEA 1H6VA 4H50A 1NDAA 1PS9A 4G6HA 1YQ4A 4H4SA 2AR8A 3UKHA 2B9XA 4JY3A 2B76A 1JOAA 3CGCA 2GMJA 4TLXA 4IV9A 4H2PA 3BNMA 3WE0A 2EQ9A 3PVCA 2WPFA 2XLTA 3AEAA 5EB4A 1VQWA 3DH9A 2IIDA 2QAEA 4ZCCA 1CHUA 2XVHA 3K7MX 1GETA 2DKIA 1PJ6A 2WDVA 2VRMA 3C4NA 1TDOA 4OPCA 3SM8A 1DJNA 3NTAA 4K8DA 5HYMA 1COYA 2YG3A 3NG7X 1GTHA 4TM0A 2B9WA 5EOWA 4XWZA 1CJ3A 1CJ4A 2C72A 2BABA 2Q0LA 2Q7VA 1L0VA 1OJAA 2ZZBA 3NRNA 5EB5A 4CCRA 2BRAA 1N1PA 3AE3A 2VRLA 1GSNA 4U8PA 4B63A 2OALA 3UKLA 1W4XA 1F8SA 4EMIA 4ADWA 2WP6A 2YR5A 4K22A 4NNJA 1ZMCA 3LOVA 3RHAA 2WEUA 3CNPA 2BCPA 3LZWA 1ZMDA 4IA5A 3BHKA 1TDKA 2BS2A 1GT8A 4U8KA 5BVAA 2GEWA 4DSHA 2XFOA 5JCKA 3NYFA 2FJAA 2WU5A 4GAPA 3UCLA 3HYVA 3B3RA 2XYOA 3DGHA 5KRQA 1Y56A 4IVMB 4FX9A 1LVLA 4H4PA 5FS7A 1H86A 3QSEA 2A87A 4C3XA 2WOWA 4N9XA 1IUUA 1LV0A 2JAEA 4I59A 1BKWA 3DK8A 3FBSA 4TM4A 3I3LA 5LV9A 4K5RA 3IWAA 4UP3A 1D4DA 2XCGA 1P2EA 3KLJA 3GYIA 3NYCA 4H4UA 2X8GA 2R46A 3UTFA 1QLBA 3DK4A 1PBEA 2GR2A 1IUVA 3ZDNA 4JN9A 1V59A 3SXIA 4D03A 3AYJA 1ZOVA 3NK0X 3QFAA 5JCIA 3ZYXA 4Y4MA 3VRDB 1B4VA 3DGZA 2YG4A 2R9ZA 1GERA 4REKA 3D8XA 3E1TA 4OPTA 4U2TA 3CMMA 1EBDA 2VQ7A 2C73A 3UOZA 2R0CA 1E1MA 4P9SA 4B66A 1PBFA 4GRTA 1CJ2A 1B37A 1CF3A 3DJGX 2YM2A 2C64A 3KPKA 4A6NB 4C3YA 4DNAA 3SGLA 2APGA 1FECA 1Y0PA 2XVEA 3AEBA 1PJ5A 4CBQA 4YT0A 4U2LA 2EQ8A 3URHA 2CDUA 1PHHA 4WX1A 1ZK7A 2WOIA 3SZFA 4B65A 2XVFA 3COXA 2YLRA 2O9ZA 1GRTA 2VVLG 1E39A 1VDCA 3AE5A 1IUTA 2GB0A 2RGOA 5FMHA 4H4WA 3AB1A 5DBJA 5KMSA 1ZX9A 3AE9A 3OC4A 2RABA 3H8LA 2XDOA 1CC4A 2BC0A 2VQBA 4X4JA 2JB2A 2YVJA 3UKKA 4BJZA 5KMPA 1YQZA 2GR0A 3KVEA 1DOBA 1GEUA 3SFDA 3L8KA 4GF7A 3GDPA 3CNSA 4K2XA 1XDIA 2WESA 2WDRA 1AOGA 1GOSA 2V3AA 3GD4A 3REDA 1QJDA 4APNA 1S2QA 1DODA 2GMHA 2H88A 5HXIA 2YVFA 1FCDA 4H4VA 3RNMA 4TM3A 5CKUA 3T37A 4EQRA 1TYPA 4U8IA 3V3OA 1PXCA 4DGKA 1GESA 2BK3A 4X9NA 1DOEA 1NG4A 1D4EA 3T2YA 1P2HA 3Q9TA 5IPYA 4U8MA 4ECHA 3GRSA 1ZKQA 3UTGA 1K0LA 1GRAA 4GAVA 5KMRA 2BS3A 1B5QA 3L1RA 4NTCA 3UKFA 3SQPA 1KNPA 4BK3A 1GRGA 1JRYA 3GRTA 2WHDA 1H83A 5KXJA 4OCGA 3HYWA 2C75A 4CNKA 4JNQA 2FJEA 2WS3A 4YSYA 1IJHA 4A65A 3K7TA 4AP1A 4D04A 4FDCB 4CCQA 4AT2A 2X8HA 5M10A 5CQFA 4B68A 1KSUA 2IVEA 2YLXA 3O0HA 2OLNA 1GV4A 2Q6UA 3KU9A 2X8CA 3SFEA 4B69A 3GSIA 3NK2X 4EQWA 2CFYA 1E1KA 1NG3A 3UTEA 3UOXA 2EQ6A 3QJ4A 1TDEA 5EBKA 2C3DA 1CC2A 4EIQA 3KD9A 2FJDA 1O5WA 2GH5A 1VG0A 3ADAB 1GRFA 4J57A 4C5OA 1E7PA 2WU2A 1JEHA 1TRBA 1L9DA 1FL2A 2YVGA 4TLZA 2OAMA 2JK6A 3ICTA 3SY4A 1VG9A 4E0VA 2Z5XA 1E1NA 2JB3A 4RG3A 3F8PA 3GYXA 4A79A 3D1CA 3DK9A 2XFUA 2QA1A 4AOXA 2QA2A 3EF6A 1HYUA 1MOKA 1H82A 4AOSA 1FEAA 4EQXA 4A9WA 1H7WA 3ATQA 4MJWA 5U25A 3P4QA 1OJDA 2E5VA 4ZN0A 1KDGA 4ZCDA 2BK5A 3ICSA 3H8IA 2X99A 2Y6RA 3DJJA 1H81A 4H4YA 5U63A 4CY6A 3ITJA 2XFPA 3KKJA 3V76A 2GV8A 4Z43A 1RP0A 3G5QA 1H7XA 2BCGG 2DKHA 2J3NA 1GXFA 1K0JA 1FOHA 2EQ7A 1H84A 2Y6QA 4EMJA 1F8RA 1N4VA 1BGJA 3PS9A 4J56A 1YKJA 4IA6A 4NTEA 4RSLA 3GMBA 1GTEA 2YLWA 3CNDA 4RG4A 2YR4A 5GSNA 2WPEA 1Y56B 2C70A 2XVJA 3FMWA 1LJ1A 2YM1A 3P4RA 4A99A 4C77A 1BGNA 2VZ2A 1IUXA 1D7YA 1NENA 3RP6A 4A5LA 4YTPA 2YR6A 5KOWA 2HQMA 3B6DA 3IF9A 4JQ9A 3LB8A 4PABA 2GR1A 1O95A 3G5SA 3OZ2A 4H2RA 3CPHG 2I0ZA 1LTXR 1D5TA 1Q1RA 2YLZA 1NHSA 1NAAA 1D7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7G A;  2ARD A;  4PAA A;  3K30 A;  2JBV A;  1K4Q A;  3KA7 A;  2WBA A;  4YKG A;  4J33 A;  4OPG A;  5BUK A;  2BA9 A;  3IC9 A;  2UZZ A;  3QSM A;  3UKA A;  4Z2U A;  3AE6 A;  1ZOY A;  2GF3 A;  3AYL A;  4WCT A;  2V5Z A;  3HZL A;  2F5Z A;  3NYE A;  1M6I A;  2RGJ A;  4YXD A;  4NEV A;  1NHR A;  4B67 A;  4GUV A;  5KOX A;  4H2N A;  2GR3 A;  4CNJ A;  3IHG A;  4AT0 A;  4Z26 A;  1TYT A;  3I6D A;  1VRQ B;  1ELI A;  2YQU A;  4K5S A;  2WOV A;  4U2S A;  1OJT A;  2X50 A;  4OVI A;  2BK4 A;  3FPZ A;  3GWF A;  4JDR A;  4J36 A;  2IVD A;  2YLS A;  3RP7 A;  4BK2 A;  1GPE A;  2FBW A;  3H4K A;  3AEC A;  2OA1 A;  4JY2 A;  2GVC A;  1XHC A;  5C2T A;  3C4A A;  3DA1 A;  2R0G A;  4JNA A;  4H4Q A;  3CPI G;  4U8N A;  3GDN A;  3NTD A;  2CUL A;  1FEB A;  3AD9 B;  1JU2 A;  2WDQ A;  4J2W A;  4BV6 A;  3ALJ A;  3NN0 X;  4USR A;  1S3E A;  4DSG A;  1GRB A;  1F3P A;  3AD8 B;  1IUS A;  2Q0K A;  3CIR A;  4BUR A;  3ISH A;  2GAH B;  3CGE A;  3AE4 A;  4EMW A;  1PDH A;  1E6E A;  3CPJ G;  4HA6 A;  3IHM A;  1PBB A;  3UP5 A;  3S5W A;  1RYI A;  1LQU A;  2V6O A;  4KPR A;  1N4W A;  2X3N A;  4I58 A;  2YLT A;  3FG2 P;  3VR8 A;  2A8X A;  3UTH A;  5JCM A;  1S3B A;  2WQY A;  3AE7 A;  4EIP A;  3KPF A;  4BJY A;  4YTN A;  4B64 A;  5JCN A;  4GDE A;  4CY8 A;  3EPT A;  4C74 A;  4IVO B;  2OLO A;  1ZP0 A;  2BXS A;  5FS8 A;  1REO A;  2V61 A;  3UOY A;  5KVH A;  3AYI A;  3II4 A;  2B9Y A;  2YG7 A;  1PBD A;  5FS6 A;  3CGB A;  3NNE A;  2FJB A;  3ABV A;  3Q6J A;  1OJC A;  4AP3 A;  1ONF A;  1EL7 A;  1Q1W A;  2V60 A;  5C3J A;  3VQR A;  5JCL A;  2ZZC A;  2C66 A;  4FK1 A;  4OPU A;  1CBO A;  1NPX A;  4H4R A;  3NT6 A;  3JSK A;  1PBC A;  2AAQ A;  3FIM B;  2B7S A;  2XLR A;  3BI5 A;  2WPC A;  2C3C A;  3EAN A;  4H4T A;  3UOV A;  4Z24 A;  3V3N A;  3R9U A;  1LPF A;  1JRZ A;  3S61 A;  1JNZ A;  2AQJ A;  3BI4 A;  1GRE A;  1TDN A;  1JRX A;  1RSG A;  1O94 A;  1M64 A;  2WP5 A;  3PO7 A;  1EL9 A;  2GQW A;  2ZBW A;  4NEW A;  4O5Q A;  3AEF A;  5GRT A;  3QVP A;  2TPR A;  3K7Q X;  3C96 A;  3BI2 A;  1MO9 A;  3EAO A;  4YSX A;  5TR3 A;  3BHF A;  1QO8 A;  3UKQ A;  2A89 A;  2GQF A;  3AWI A;  3CGD A;  4OPD A;  3NH3 X;  1NEK A;  2XVI A;  3M12 A;  3NHO X;  4YSZ A;  2V3B A;  4H4Z A;  2W0H A;  4GR1 A;  3UKP A;  4Z44 A;  3VRB A;  1XPQ A;  4CRT A;  5BUL A;  4UDQ A;  1CL0 A;  3DJE A;  1DNC A;  4Z2R A;  1S2Y A;  1UKV G;  4LII A;  1LQT A;  1ZY8 A;  3NLC A;  3NK1 X;  2YWL A;  3CNJ A;  2BYB A;  4FK1 C;  5IQ1 A;  2BAC A;  2C76 A;  3NGC X;  1KSS A;  2ACZ A;  1EL5 A;  2R4J A;  1PXA A;  1MXT A;  2PYX A;  4B1B A;  2R0P A;  3P4S A;  3G5R A;  3NN6 X;  3NIX A;  3BNU A;  2XLU A;  3AE1 A;  4GDP A;  4USQ A;  4O5U A;  1B8S A;  2NVK X;  4OPL A;  1BZL A;  4NTD A;  4UDP A;  1GND A;  2TMD A;  2H89 A;  4A6N A;  4Y4N A;  1L9C A;  3AXB A;  4U8O A;  4Z25 A;  3GD3 A;  1CC6 A;  4EM4 A;  4KX6 A;  2C67 A;  3F8D A;  1EL8 A;  2WET A;  4UDR A;  4TM1 A;  4YTM A;  5BRT A;  4H7U A;  2JB1 A;  3ICR A;  5L46 A;  4LA1 A;  2XLS A;  2XFQ A;  3P9U A;  3ATR A;  4H4X A;  5IQ4 A;  3QVR A;  3GWD A;  3P1W A;  3ALL A;  1GAL A;  1ZDL A;  3ALM A;  4Y4L A;  3CN8 A;  1L9E A;  5HHF A;  2R4E A;  3GYJ A;  2RGH A;  3UP4 A;  2R45 A;  2YG5 A;  4X9M A;  1N4U A;  3AEE A;  5FS9 A;  1NHQ A;  1YQ3 A;  2GRT A;  3QSS A;  4OPI A;  3P4P A;  2BXR A;  4ICY A;  3AED A;  4BK1 A;  5J7X A;  4U8J A;  4Z2T A;  3LAD A;  1XAN A;  1X31 B;  2E1M A;  4J31 A;  5HY5 A;  1CJC A;  3LJP A;  3QFB A;  1PN0 A;  4EM3 A;  1SEZ A;  1JNR A;  1NHP A;  3CTY A;  1KF6 A;  2BC1 A;  3NKS A;  2BS4 A;  5U1O A;  4U8L A;  3M0O A;  1TDF A;  4YKF A;  3DJD A;  5ER0 A;  3F8R A;  2WP9 A;  1OJ9 A;  3AE8 A;  3LZX A;  3VRA A;  1K0I A;  4M52 A;  4HB9 A;  4K7Z A;  2VVL A;  4XXG A;  1PXB A;  2XFN A;  2YAU A;  2YG6 A;  3CNT A;  4J34 A;  3AEG A;  2QCU A;  4GCM A;  4EQS A;  1Z6L A;  5M0Z A;  2NPX A;  1BWC A;  1YY5 A;  1F8W A;  1DXL A;  2GAG B;  5J60 A;  2VOU A;  4YWO A;  5KVI A;  1GRH A;  2JKC A;  1KNR A;  4XWR A;  2CVJ A;  1KFY A;  3M13 A;  3RP8 A;  2E4G A;  1E1L A;  1DJQ A;  4YSH A;  1F6M A;  2PHH A;  4LU6 A;  4NZH A;  2C65 A;  2B7R A;  1DOC A;  3LXD A;  1BF3 A;  2VVM A;  4H2Q A;  2XLP A;  2Z5Y A;  3VR9 A;  1IUW A;  3GMC A;  4A7A A;  1PJ7 A;  2ZZ0 A;  1D4C A;  3AD7 B;  3AE2 A;  1Q9I A;  3DME A;  1H6V A;  4H50 A;  1NDA A;  1PS9 A;  3UKH A;  1YQ4 A;  4H4S A;  2AR8 A;  5KWF A;  2B9X A;  4JY3 A;  2B76 A;  1JOA A;  3CGC A;  2GMJ A;  4TLX A;  4IV9 A;  4H2P A;  3BNM A;  3WE0 A;  2EQ9 A;  3PVC A;  2WPF A;  2XLT A;  3AEA A;  5EB4 A;  1VQW A;  3DH9 A;  2IID A;  2QAE A;  4ZCC A;  1CHU A;  2XVH A;  3K7M X;  1GET A;  2DKI A;  1PJ6 A;  2WDV A;  2VRM A;  3C4N A;  1TDO A;  4OPC A;  3SM8 A;  1DJN A;  3NTA A;  4K8D A;  5HYM A;  1COY A;  2YG3 A;  3NG7 X;  1GTH A;  4TM0 A;  2B9W A;  5EOW A;  4XWZ A;  1CJ3 A;  1CJ4 A;  2C72 A;  2BAB A;  2Q0L A;  2Q7V A;  1L0V A;  1OJA A;  2ZZB A;  3NRN A;  5EB5 A;  4CCR A;  1N1P A;  3AE3 A;  2VRL A;  1GSN A;  4U8P A;  4B63 A;  2OAL A;  3UKL A;  1W4X A;  1F8S A;  4EMI A;  4ADW A;  2WP6 A;  2YR5 A;  4K22 A;  1ZMC A;  3LOV A;  3RHA A;  2WEU A;  3CNP A;  2BCP A;  3LZW A;  1ZMD A;  4IA5 A;  3BHK A;  1TDK A;  2BS2 A;  1GT8 A;  4U8K A;  5BVA A;  2GEW A;  4DSH A;  2XFO A;  5JCK A;  3NYF A;  2FJA A;  2WU5 A;  3UCL A;  3B3R A;  2XYO A;  3DGH A;  5KRQ A;  1Y56 A;  4IVM B;  4FX9 A;  1LVL A;  4H4P A;  5FS7 A;  1H86 A;  3QSE A;  2A87 A;  4C3X A;  2WOW A;  4N9X A;  1IUU A;  1LV0 A;  2JAE A;  4I59 A;  1BKW A;  3DK8 A;  3FBS A;  4TM4 A;  3I3L A;  5LV9 A;  4K5R A;  3IWA A;  4UP3 A;  1D4D A;  2XCG A;  1P2E A;  3KLJ A;  3GYI A;  3NYC A;  4H4U A;  2X8G A;  2R46 A;  3UTF A;  1QLB A;  3DK4 A;  1PBE A;  2GR2 A;  1IUV A;  3ZDN A;  4JN9 A;  1V59 A;  4D03 A;  3AYJ A;  1ZOV A;  3NK0 X;  3QFA A;  5JCI A;  3ZYX A;  4Y4M A;  3VRD B;  1B4V A;  3DGZ A;  2YG4 A;  2R9Z A;  1GER A;  4REK A;  3D8X A;  3E1T A;  4OPT A;  4U2T A;  1EBD A;  2VQ7 A;  2C73 A;  3UOZ A;  2R0C A;  1E1M A;  4P9S A;  4B66 A;  1PBF A;  4GRT A;  1CJ2 A;  1B37 A;  1CF3 A;  3DJG X;  2YM2 A;  2C64 A;  4A6N B;  4C3Y A;  4DNA A;  3SGL A;  2APG A;  1FEC A;  1Y0P A;  2XVE A;  3AEB A;  1PJ5 A;  4CBQ A;  4YT0 A;  4U2L A;  2EQ8 A;  3URH A;  2CDU A;  1PHH A;  4WX1 A;  1ZK7 A;  2WOI A;  4B65 A;  2XVF A;  3COX A;  2YLR A;  2O9Z A;  1GRT A;  2VVL G;  1E39 A;  1VDC A;  3AE5 A;  1IUT A;  2GB0 A;  2RGO A;  5FMH A;  4H4W A;  3AB1 A;  5DBJ A;  1ZX9 A;  3AE9 A;  3OC4 A;  2RAB A;  3H8L A;  2XDO A;  1CC4 A;  2BC0 A;  2VQB A;  4X4J A;  2JB2 A;  2YVJ A;  3UKK A;  4BJZ A;  1YQZ A;  2GR0 A;  3KVE A;  1DOB A;  1GEU A;  3SFD A;  3L8K A;  4GF7 A;  3GDP A;  3CNS A;  4K2X A;  1XDI A;  2WES A;  2WDR A;  1AOG A;  1GOS A;  2V3A A;  3GD4 A;  3RED A;  1QJD A;  4APN A;  1S2Q A;  1DOD A;  2GMH A;  2H88 A;  5HXI A;  2YVF A;  1FCD A;  4H4V A;  3RNM A;  4TM3 A;  5CKU A;  3T37 A;  4EQR A;  1TYP A;  4U8I A;  3V3O A;  1PXC A;  4DGK A;  1GES A;  2BK3 A;  4X9N A;  1DOE A;  1NG4 A;  1D4E A;  1P2H A;  3Q9T A;  5IPY A;  4U8M A;  4ECH A;  3GRS A;  1ZKQ A;  3UTG A;  1K0L A;  1GRA A;  2BS3 A;  1B5Q A;  3L1R A;  4NTC A;  3UKF A;  3SQP A;  1KNP A;  4BK3 A;  1GRG A;  1JRY A;  3GRT A;  2WHD A;  1H83 A;  5KXJ A;  4OCG A;  2C75 A;  4CNK A;  4JNQ A;  2FJE A;  2WS3 A;  4YSY A;  1IJH A;  4A65 A;  3K7T A;  4AP1 A;  4D04 A;  4FDC B;  4CCQ A;  4AT2 A;  2X8H A;  5M10 A;  5CQF A;  4B68 A;  1KSU A;  2IVE A;  2YLX A;  3O0H A;  2OLN A;  1GV4 A;  2Q6U A;  3KU9 A;  2X8C A;  3SFE A;  4B69 A;  3GSI A;  3NK2 X;  4EQW A;  2CFY A;  1E1K A;  1NG3 A;  3UTE A;  3UOX A;  2EQ6 A;  3QJ4 A;  1TDE A;  5EBK A;  2C3D A;  1CC2 A;  4EIQ A;  3KD9 A;  2FJD A;  1O5W A;  2GH5 A;  1VG0 A;  3ADA B;  1GRF A;  4J57 A;  4C5O A;  1E7P A;  2WU2 A;  1JEH A;  1TRB A;  1L9D A;  1FL2 A;  2YVG A;  4TLZ A;  2OAM A;  2JK6 A;  3ICT A;  1VG9 A;  4E0V A;  2Z5X A;  1E1N A;  2JB3 A;  4RG3 A;  3F8P A;  4A79 A;  3D1C A;  3DK9 A;  2XFU A;  2QA1 A;  4AOX A;  2QA2 A;  3EF6 A;  1HYU A;  1MOK A;  1H82 A;  4AOS A;  1FEA A;  4EQX A;  4A9W A;  1H7W A;  3ATQ A;  4MJW A;  5U25 A;  3P4Q A;  1OJD A;  2E5V A;  4ZN0 A;  1KDG A;  4ZCD A;  2BK5 A;  3ICS A;  3H8I A;  2X99 A;  2Y6R A;  3DJJ A;  1H81 A;  4H4Y A;  5U63 A;  4CY6 A;  3ITJ A;  2XFP A;  3KKJ A;  3V76 A;  2GV8 A;  4Z43 A;  1RP0 A;  3G5Q A;  1H7X A;  2BCG G;  2DKH A;  2J3N A;  1GXF A;  1K0J A;  1FOH A;  2EQ7 A;  1H84 A;  2Y6Q A;  4EMJ A;  1F8R A;  1N4V A;  1BGJ A;  3PS9 A;  4J56 A;  1YKJ A;  4IA6 A;  4NTE A;  4RSL A;  3GMB A;  1GTE A;  2YLW A;  3CND A;  4RG4 A;  2YR4 A;  5GSN A;  2WPE A;  1Y56 B;  2C70 A;  2XVJ A;  3FMW A;  1LJ1 A;  2YM1 A;  3P4R A;  4A99 A;  4C77 A;  1BGN A;  2VZ2 A;  1IUX A;  1D7Y A;  1NEN A;  3RP6 A;  4A5L A;  4YTP A;  2YR6 A;  5KOW A;  2HQM A;  3B6D A;  3IF9 A;  4JQ9 A;  3LB8 A;  4PAB A;  2GR1 A;  1O95 A;  3G5S A;  3OZ2 A;  4H2R A;  3CPH G;  2I0Z A;  1LTX R;  1D5T A;  1Q1R A;  2YLZ A;  1NHS A;  1NAA A;  1D7L A; 
#chains in the Genus database with same CATH topology
 2C7G A;  2ARD A;  4PAA A;  3K30 A;  2JBV A;  1K4Q A;  3KA7 A;  2WBA A;  4YKG A;  4J33 A;  4OPG A;  5BUK A;  2BA9 A;  3IC9 A;  2UZZ A;  3QSM A;  3UKA A;  4Z2U A;  3AE6 A;  1ZOY A;  2GF3 A;  3AYL A;  4WCT A;  2V5Z A;  3HZL A;  2F5Z A;  3NYE A;  1M6I A;  2RGJ A;  4II3 A;  4YXD A;  4NEV A;  1NHR A;  4B67 A;  4GUV A;  5KOX A;  4H2N A;  2GR3 A;  4CNJ A;  3IHG A;  4AT0 A;  4Z26 A;  1TYT A;  3I6D A;  1VRQ B;  1ELI A;  2YQU A;  4K5S A;  2WOV A;  4U2S A;  1OJT A;  2X50 A;  4OVI A;  2BK4 A;  3FPZ A;  3GWF A;  4JDR A;  4J36 A;  2IVD A;  2YLS A;  3RP7 A;  4BK2 A;  1GPE A;  2FBW A;  3H4K A;  3AEC A;  2OA1 A;  4JY2 A;  2GVC A;  1XHC A;  5C2T A;  3C4A A;  3DA1 A;  5KWF A;  2R0G A;  4JNA A;  4H4Q A;  4NWZ A;  3CPI G;  4U8N A;  3GDN A;  3NTD A;  2CUL A;  1FEB A;  3AD9 B;  1JU2 A;  2WDQ A;  4J2W A;  4BV6 A;  3ALJ A;  3HYX A;  3NN0 X;  4USR A;  1S3E A;  4DSG A;  1GRB A;  1F3P A;  3AD8 B;  1IUS A;  2Q0K A;  3CIR A;  4BUR A;  3ISH A;  2GAH B;  3CGE A;  3AE4 A;  4EMW A;  1PDH A;  1E6E A;  3CPJ G;  4HA6 A;  3IHM A;  1PBB A;  3UP5 A;  3S5W A;  1RYI A;  1LQU A;  2V6O A;  4KPR A;  1N4W A;  3T31 A;  2X3N A;  4I58 A;  2YLT A;  3FG2 P;  3VR8 A;  2A8X A;  3UTH A;  4G9K A;  5JCM A;  4II2 A;  1S3B A;  2WQY A;  3AE7 A;  4EIP A;  3KPF A;  4BJY A;  4YTN A;  4B64 A;  5JCN A;  4GDE A;  4CY8 A;  3EPT A;  4C74 A;  4IVO B;  2OLO A;  1ZP0 A;  2BXS A;  5FS8 A;  1REO A;  2V61 A;  3SYI A;  3UOY A;  3AYI A;  3II4 A;  2B9Y A;  2YG7 A;  1PBD A;  5KVH A;  5FS6 A;  3CGB A;  3NNE A;  2FJB A;  3ABV A;  3Q6J A;  1OJC A;  4AP3 A;  1ONF A;  1EL7 A;  1Q1W A;  2V60 A;  5C3J A;  3T14 A;  3VQR A;  5JCL A;  2ZZC A;  2C66 A;  4FK1 A;  4OPU A;  1CBO A;  1NPX A;  4H4R A;  2BRY A;  3JSK A;  1PBC A;  2AAQ A;  3NT6 A;  3FIM B;  2B7S A;  2XLR A;  3BI5 A;  2WPC A;  2C3C A;  3EAN A;  4H4T A;  3UOV A;  3T2Z A;  4Z24 A;  3V3N A;  3R9U A;  1LPF A;  1JRZ A;  3S61 A;  1JNZ A;  2AQJ A;  3BI4 A;  1GRE A;  1TDN A;  1JRX A;  1RSG A;  1O94 A;  3T0K A;  1M64 A;  2WP5 A;  3PO7 A;  1EL9 A;  2GQW A;  2ZBW A;  4NEW A;  4O5Q A;  3AEF A;  5GRT A;  3QVP A;  2TPR A;  3K7Q X;  3C96 A;  3BI2 A;  1MO9 A;  3EAO A;  4YSX A;  5TR3 A;  3BHF A;  1QO8 A;  3UKQ A;  2A89 A;  2GQF A;  3AWI A;  3CGD A;  4OPD A;  3NH3 X;  1NEK A;  2XVI A;  3M12 A;  3NHO X;  4YSZ A;  2V3B A;  4H4Z A;  2W0H A;  4GR1 A;  3UKP A;  4Z44 A;  3VRB A;  1XPQ A;  4CRT A;  5BUL A;  4UDQ A;  1CL0 A;  3DJE A;  3SX6 A;  1DNC A;  4Z2R A;  1S2Y A;  1UKV G;  4LII A;  1LQT A;  1ZY8 A;  4G6G A;  3NLC A;  3NK1 X;  2YWL A;  3CNJ A;  2BYB A;  4FK1 C;  5IQ1 A;  2BAC A;  2C76 A;  3NGC X;  1KSS A;  2ACZ A;  1EL5 A;  2R4J A;  1PXA A;  1MXT A;  2PYX A;  4B1B A;  2R0P A;  3P4S A;  3G5R A;  3NN6 X;  3NIX A;  3BNU A;  5KMQ A;  2XLU A;  3AE1 A;  4GDP A;  4USQ A;  4O5U A;  1B8S A;  2NVK X;  4OPL A;  1BZL A;  4NTD A;  4UDP A;  1GND A;  2TMD A;  3SZ0 A;  2H89 A;  4A6N A;  4Y4N A;  1L9C A;  3AXB A;  4U8O A;  4Z25 A;  3GD3 A;  1CC6 A;  4EM4 A;  4KX6 A;  2C67 A;  3F8D A;  1EL8 A;  2WET A;  4UDR A;  4TM1 A;  4YTM A;  5BRT A;  4H7U A;  2JB1 A;  3ICR A;  5L46 A;  4LA1 A;  2XLS A;  2XFQ A;  3P9U A;  3ATR A;  4H4X A;  3SZW A;  5IQ4 A;  3QVR A;  3GWD A;  3P1W A;  3ALL A;  1GAL A;  1ZDL A;  3ALM A;  4Y4L A;  3CN8 A;  1L9E A;  5HHF A;  2R4E A;  3GYJ A;  2RGH A;  3UP4 A;  2R45 A;  2YG5 A;  4X9M A;  1N4U A;  3AEE A;  5FS9 A;  1NHQ A;  1YQ3 A;  2GRT A;  3QSS A;  4OPI A;  3P4P A;  2BXR A;  4ICY A;  3AED A;  4BK1 A;  5J7X A;  4U8J A;  4Z2T A;  3LAD A;  1XAN A;  1X31 B;  2E1M A;  4J31 A;  5HY5 A;  1CJC A;  3LJP A;  3QFB A;  1PN0 A;  4EM3 A;  1SEZ A;  1JNR A;  1NHP A;  3CTY A;  1KF6 A;  2BC1 A;  3NKS A;  2BS4 A;  5U1O A;  4U8L A;  3M0O A;  1TDF A;  4YKF A;  3DJD A;  5ER0 A;  5KNL A;  3F8R A;  2WP9 A;  4G74 A;  1OJ9 A;  3AE8 A;  3LZX A;  3VRA A;  1K0I A;  4M52 A;  4HB9 A;  4K7Z A;  3SZC A;  2VVL A;  4XXG A;  1PXB A;  2XFN A;  2YAU A;  2YG6 A;  3CNT A;  4J34 A;  3AEG A;  2QCU A;  4GCM A;  4EQS A;  1Z6L A;  5M0Z A;  2NPX A;  1BWC A;  1YY5 A;  1F8W A;  1DXL A;  2GAG B;  5J60 A;  2VOU A;  4YWO A;  5KVI A;  1GRH A;  2JKC A;  1KNR A;  3T2K A;  4XWR A;  2CVJ A;  1KFY A;  3M13 A;  3RP8 A;  2E4G A;  1E1L A;  1DJQ A;  4YSH A;  1F6M A;  2PHH A;  4LU6 A;  4NZH A;  2C65 A;  2B7R A;  1DOC A;  3LXD A;  4G73 A;  1BF3 A;  2VVM A;  4H2Q A;  2XLP A;  2Z5Y A;  3VR9 A;  1IUW A;  2C4C A;  3GMC A;  4A7A A;  1PJ7 A;  2ZZ0 A;  1D4C A;  3AD7 B;  3AE2 A;  1Q9I A;  3DME A;  1H6V A;  4H50 A;  1NDA A;  1PS9 A;  4G6H A;  1YQ4 A;  4H4S A;  2AR8 A;  3UKH A;  2B9X A;  4JY3 A;  2B76 A;  1JOA A;  3CGC A;  2GMJ A;  4TLX A;  4IV9 A;  4H2P A;  3BNM A;  3WE0 A;  2EQ9 A;  3PVC A;  2WPF A;  2XLT A;  3AEA A;  5EB4 A;  1VQW A;  3DH9 A;  2IID A;  2QAE A;  4ZCC A;  1CHU A;  2XVH A;  3K7M X;  1GET A;  2DKI A;  1PJ6 A;  2WDV A;  2VRM A;  3C4N A;  1TDO A;  4OPC A;  3SM8 A;  1DJN A;  3NTA A;  4K8D A;  5HYM A;  1COY A;  2YG3 A;  3NG7 X;  1GTH A;  4TM0 A;  2B9W A;  5EOW A;  4XWZ A;  1CJ3 A;  1CJ4 A;  2C72 A;  2BAB A;  2Q0L A;  2Q7V A;  1L0V A;  1OJA A;  2ZZB A;  3NRN A;  5EB5 A;  4CCR A;  2BRA A;  1N1P A;  3AE3 A;  2VRL A;  1GSN A;  4U8P A;  4B63 A;  2OAL A;  3UKL A;  1W4X A;  1F8S A;  4EMI A;  4ADW A;  2WP6 A;  2YR5 A;  4K22 A;  4NNJ A;  1ZMC A;  3LOV A;  3RHA A;  2WEU A;  3CNP A;  2BCP A;  3LZW A;  1ZMD A;  4IA5 A;  3BHK A;  1TDK A;  2BS2 A;  1GT8 A;  4U8K A;  5BVA A;  2GEW A;  4DSH A;  2XFO A;  5JCK A;  3NYF A;  2FJA A;  2WU5 A;  4GAP A;  3UCL A;  3HYV A;  3B3R A;  2XYO A;  3DGH A;  5KRQ A;  1Y56 A;  4IVM B;  4FX9 A;  1LVL A;  4H4P A;  5FS7 A;  1H86 A;  3QSE A;  2A87 A;  4C3X A;  2WOW A;  4N9X A;  1IUU A;  1LV0 A;  2JAE A;  4I59 A;  1BKW A;  3DK8 A;  3FBS A;  4TM4 A;  3I3L A;  5LV9 A;  4K5R A;  3IWA A;  4UP3 A;  1D4D A;  2XCG A;  1P2E A;  3KLJ A;  3GYI A;  3NYC A;  4H4U A;  2X8G A;  2R46 A;  3UTF A;  1QLB A;  3DK4 A;  1PBE A;  2GR2 A;  1IUV A;  3ZDN A;  4JN9 A;  1V59 A;  3SXI A;  4D03 A;  3AYJ A;  1ZOV A;  3NK0 X;  3QFA A;  5JCI A;  3ZYX A;  4Y4M A;  3VRD B;  1B4V A;  3DGZ A;  2YG4 A;  2R9Z A;  1GER A;  4REK A;  3D8X A;  3E1T A;  4OPT A;  4U2T A;  3CMM A;  1EBD A;  2VQ7 A;  2C73 A;  3UOZ A;  2R0C A;  1E1M A;  4P9S A;  4B66 A;  1PBF A;  4GRT A;  1CJ2 A;  1B37 A;  1CF3 A;  3DJG X;  2YM2 A;  2C64 A;  3KPK A;  4A6N B;  4C3Y A;  4DNA A;  3SGL A;  2APG A;  1FEC A;  1Y0P A;  2XVE A;  3AEB A;  1PJ5 A;  4CBQ A;  4YT0 A;  4U2L A;  2EQ8 A;  3URH A;  2CDU A;  1PHH A;  4WX1 A;  1ZK7 A;  2WOI A;  3SZF A;  4B65 A;  2XVF A;  3COX A;  2YLR A;  2O9Z A;  1GRT A;  2VVL G;  1E39 A;  1VDC A;  3AE5 A;  1IUT A;  2GB0 A;  2RGO A;  5FMH A;  4H4W A;  3AB1 A;  5DBJ A;  5KMS A;  1ZX9 A;  3AE9 A;  3OC4 A;  2RAB A;  3H8L A;  2XDO A;  1CC4 A;  2BC0 A;  2VQB A;  4X4J A;  2JB2 A;  2YVJ A;  3UKK A;  4BJZ A;  5KMP A;  1YQZ A;  2GR0 A;  3KVE A;  1DOB A;  1GEU A;  3SFD A;  3L8K A;  4GF7 A;  3GDP A;  3CNS A;  4K2X A;  1XDI A;  2WES A;  2WDR A;  1AOG A;  1GOS A;  2V3A A;  3GD4 A;  3RED A;  1QJD A;  4APN A;  1S2Q A;  1DOD A;  2GMH A;  2H88 A;  5HXI A;  2YVF A;  1FCD A;  4H4V A;  3RNM A;  4TM3 A;  5CKU A;  3T37 A;  4EQR A;  1TYP A;  4U8I A;  3V3O A;  1PXC A;  4DGK A;  1GES A;  2BK3 A;  4X9N A;  1DOE A;  1NG4 A;  1D4E A;  3T2Y A;  1P2H A;  3Q9T A;  5IPY A;  4U8M A;  4ECH A;  3GRS A;  1ZKQ A;  3UTG A;  1K0L A;  1GRA A;  4GAV A;  5KMR A;  2BS3 A;  1B5Q A;  3L1R A;  4NTC A;  3UKF A;  3SQP A;  1KNP A;  4BK3 A;  1GRG A;  1JRY A;  3GRT A;  2WHD A;  1H83 A;  5KXJ A;  4OCG A;  3HYW A;  2C75 A;  4CNK A;  4JNQ A;  2FJE A;  2WS3 A;  4YSY A;  1IJH A;  4A65 A;  3K7T A;  4AP1 A;  4D04 A;  4FDC B;  4CCQ A;  4AT2 A;  2X8H A;  5M10 A;  5CQF A;  4B68 A;  1KSU A;  2IVE A;  2YLX A;  3O0H A;  2OLN A;  1GV4 A;  2Q6U A;  3KU9 A;  2X8C A;  3SFE A;  4B69 A;  3GSI A;  3NK2 X;  4EQW A;  2CFY A;  1E1K A;  1NG3 A;  3UTE A;  3UOX A;  2EQ6 A;  3QJ4 A;  1TDE A;  5EBK A;  2C3D A;  1CC2 A;  4EIQ A;  3KD9 A;  2FJD A;  1O5W A;  2GH5 A;  1VG0 A;  3ADA B;  1GRF A;  4J57 A;  4C5O A;  1E7P A;  2WU2 A;  1JEH A;  1TRB A;  1L9D A;  1FL2 A;  2YVG A;  4TLZ A;  2OAM A;  2JK6 A;  3ICT A;  3SY4 A;  1VG9 A;  4E0V A;  2Z5X A;  1E1N A;  2JB3 A;  4RG3 A;  3F8P A;  3GYX A;  4A79 A;  3D1C A;  3DK9 A;  2XFU A;  2QA1 A;  4AOX A;  2QA2 A;  3EF6 A;  1HYU A;  1MOK A;  1H82 A;  4AOS A;  1FEA A;  4EQX A;  4A9W A;  1H7W A;  3ATQ A;  4MJW A;  5U25 A;  3P4Q A;  1OJD A;  2E5V A;  4ZN0 A;  1KDG A;  4ZCD A;  2BK5 A;  3ICS A;  3H8I A;  2X99 A;  2Y6R A;  3DJJ A;  1H81 A;  4H4Y A;  5U63 A;  4CY6 A;  3ITJ A;  2XFP A;  3KKJ A;  3V76 A;  2GV8 A;  4Z43 A;  1RP0 A;  3G5Q A;  1H7X A;  2BCG G;  2DKH A;  2J3N A;  1GXF A;  1K0J A;  1FOH A;  2EQ7 A;  1H84 A;  2Y6Q A;  4EMJ A;  1F8R A;  1N4V A;  1BGJ A;  3PS9 A;  4J56 A;  1YKJ A;  4IA6 A;  4NTE A;  4RSL A;  3GMB A;  1GTE A;  2YLW A;  3CND A;  4RG4 A;  2YR4 A;  5GSN A;  2WPE A;  1Y56 B;  2C70 A;  2XVJ A;  3FMW A;  1LJ1 A;  2YM1 A;  3P4R A;  4A99 A;  4C77 A;  1BGN A;  2VZ2 A;  1IUX A;  1D7Y A;  1NEN A;  3RP6 A;  4A5L A;  4YTP A;  2YR6 A;  5KOW A;  2HQM A;  3B6D A;  3IF9 A;  4JQ9 A;  3LB8 A;  4PAB A;  2GR1 A;  1O95 A;  3G5S A;  3OZ2 A;  4H2R A;  3CPH G;  2I0Z A;  1LTX R;  1D5T A;  1Q1R A;  2YLZ A;  1NHS A;  1NAA A;  1D7L A; 
#chains in the Genus database with same CATH homology
 2C7G A;  2ARD A;  4PAA A;  3K30 A;  2JBV A;  1K4Q A;  3KA7 A;  2WBA A;  4YKG A;  4J33 A;  4OPG A;  5BUK A;  2BA9 A;  3IC9 A;  2UZZ A;  3QSM A;  3UKA A;  4Z2U A;  3AE6 A;  1ZOY A;  2GF3 A;  3AYL A;  4WCT A;  2V5Z A;  3HZL A;  2F5Z A;  3NYE A;  1M6I A;  2RGJ A;  4II3 A;  4YXD A;  4NEV A;  1NHR A;  4B67 A;  4GUV A;  5KOX A;  4H2N A;  2GR3 A;  4CNJ A;  3IHG A;  4AT0 A;  4Z26 A;  1TYT A;  3I6D A;  1VRQ B;  1ELI A;  2YQU A;  4K5S A;  2WOV A;  4U2S A;  1OJT A;  2X50 A;  4OVI A;  2BK4 A;  3FPZ A;  3GWF A;  4JDR A;  4J36 A;  2IVD A;  2YLS A;  3RP7 A;  4BK2 A;  1GPE A;  2FBW A;  3H4K A;  3AEC A;  2OA1 A;  4JY2 A;  2GVC A;  1XHC A;  5C2T A;  3C4A A;  3DA1 A;  5KWF A;  2R0G A;  4JNA A;  4H4Q A;  4NWZ A;  3CPI G;  4U8N A;  3GDN A;  3NTD A;  2CUL A;  1FEB A;  3AD9 B;  1JU2 A;  2WDQ A;  4J2W A;  4BV6 A;  3ALJ A;  3HYX A;  3NN0 X;  4USR A;  1S3E A;  4DSG A;  1GRB A;  1F3P A;  3AD8 B;  1IUS A;  2Q0K A;  3CIR A;  4BUR A;  3ISH A;  2GAH B;  3CGE A;  3AE4 A;  4EMW A;  1PDH A;  1E6E A;  3CPJ G;  4HA6 A;  3IHM A;  1PBB A;  3UP5 A;  3S5W A;  1RYI A;  1LQU A;  2V6O A;  4KPR A;  1N4W A;  3T31 A;  2X3N A;  4I58 A;  2YLT A;  3FG2 P;  3VR8 A;  2A8X A;  3UTH A;  4G9K A;  5JCM A;  4II2 A;  1S3B A;  2WQY A;  3AE7 A;  4EIP A;  3KPF A;  4BJY A;  4YTN A;  4B64 A;  5JCN A;  4GDE A;  4CY8 A;  3EPT A;  4C74 A;  4IVO B;  2OLO A;  1ZP0 A;  2BXS A;  5FS8 A;  1REO A;  2V61 A;  3SYI A;  3UOY A;  3AYI A;  3II4 A;  2B9Y A;  2YG7 A;  1PBD A;  5KVH A;  5FS6 A;  3CGB A;  3NNE A;  2FJB A;  3ABV A;  3Q6J A;  1OJC A;  4AP3 A;  1ONF A;  1EL7 A;  1Q1W A;  2V60 A;  5C3J A;  3T14 A;  3VQR A;  5JCL A;  2ZZC A;  2C66 A;  4FK1 A;  4OPU A;  1CBO A;  1NPX A;  4H4R A;  2BRY A;  3JSK A;  1PBC A;  2AAQ A;  3NT6 A;  3FIM B;  2B7S A;  2XLR A;  3BI5 A;  2WPC A;  2C3C A;  3EAN A;  4H4T A;  3UOV A;  3T2Z A;  4Z24 A;  3V3N A;  3R9U A;  1LPF A;  1JRZ A;  3S61 A;  1JNZ A;  2AQJ A;  3BI4 A;  1GRE A;  1TDN A;  1JRX A;  1RSG A;  1O94 A;  3T0K A;  1M64 A;  2WP5 A;  3PO7 A;  1EL9 A;  2GQW A;  2ZBW A;  4NEW A;  4O5Q A;  3AEF A;  5GRT A;  3QVP A;  2TPR A;  3K7Q X;  3C96 A;  3BI2 A;  1MO9 A;  3EAO A;  4YSX A;  5TR3 A;  3BHF A;  1QO8 A;  3UKQ A;  2A89 A;  2GQF A;  3AWI A;  3CGD A;  4OPD A;  3NH3 X;  1NEK A;  2XVI A;  3M12 A;  3NHO X;  4YSZ A;  2V3B A;  4H4Z A;  2W0H A;  4GR1 A;  3UKP A;  4Z44 A;  3VRB A;  1XPQ A;  4CRT A;  5BUL A;  4UDQ A;  1CL0 A;  3DJE A;  3SX6 A;  1DNC A;  4Z2R A;  1S2Y A;  1UKV G;  4LII A;  1LQT A;  1ZY8 A;  4G6G A;  3NLC A;  3NK1 X;  2YWL A;  3CNJ A;  2BYB A;  4FK1 C;  5IQ1 A;  2BAC A;  2C76 A;  3NGC X;  1KSS A;  2ACZ A;  1EL5 A;  2R4J A;  1PXA A;  1MXT A;  2PYX A;  4B1B A;  2R0P A;  3P4S A;  3G5R A;  3NN6 X;  3NIX A;  3BNU A;  5KMQ A;  2XLU A;  3AE1 A;  4GDP A;  4USQ A;  4O5U A;  1B8S A;  2NVK X;  4OPL A;  1BZL A;  4NTD A;  4UDP A;  1GND A;  2TMD A;  3SZ0 A;  2H89 A;  4A6N A;  4Y4N A;  1L9C A;  3AXB A;  4U8O A;  4Z25 A;  3GD3 A;  1CC6 A;  4EM4 A;  4KX6 A;  2C67 A;  3F8D A;  1EL8 A;  2WET A;  4UDR A;  4TM1 A;  4YTM A;  5BRT A;  4H7U A;  2JB1 A;  3ICR A;  5L46 A;  4LA1 A;  2XLS A;  2XFQ A;  3P9U A;  3ATR A;  4H4X A;  3SZW A;  5IQ4 A;  3QVR A;  3GWD A;  3P1W A;  3ALL A;  1GAL A;  1ZDL A;  3ALM A;  4Y4L A;  3CN8 A;  1L9E A;  5HHF A;  2R4E A;  3GYJ A;  2RGH A;  3UP4 A;  2R45 A;  2YG5 A;  4X9M A;  1N4U A;  3AEE A;  5FS9 A;  1NHQ A;  1YQ3 A;  2GRT A;  3QSS A;  4OPI A;  3P4P A;  2BXR A;  4ICY A;  3AED A;  4BK1 A;  5J7X A;  4U8J A;  4Z2T A;  3LAD A;  1XAN A;  1X31 B;  2E1M A;  4J31 A;  5HY5 A;  1CJC A;  3LJP A;  3QFB A;  1PN0 A;  4EM3 A;  1SEZ A;  1JNR A;  1NHP A;  3CTY A;  1KF6 A;  2BC1 A;  3NKS A;  2BS4 A;  5U1O A;  4U8L A;  3M0O A;  1TDF A;  4YKF A;  3DJD A;  5ER0 A;  5KNL A;  3F8R A;  2WP9 A;  4G74 A;  1OJ9 A;  3AE8 A;  3LZX A;  3VRA A;  1K0I A;  4M52 A;  4HB9 A;  4K7Z A;  3SZC A;  2VVL A;  4XXG A;  1PXB A;  2XFN A;  2YAU A;  2YG6 A;  3CNT A;  4J34 A;  3AEG A;  2QCU A;  4GCM A;  4EQS A;  1Z6L A;  5M0Z A;  2NPX A;  1BWC A;  1YY5 A;  1F8W A;  1DXL A;  2GAG B;  5J60 A;  2VOU A;  4YWO A;  5KVI A;  1GRH A;  2JKC A;  1KNR A;  3T2K A;  4XWR A;  2CVJ A;  1KFY A;  3M13 A;  3RP8 A;  2E4G A;  1E1L A;  1DJQ A;  4YSH A;  1F6M A;  2PHH A;  4LU6 A;  4NZH A;  2C65 A;  2B7R A;  1DOC A;  3LXD A;  4G73 A;  1BF3 A;  2VVM A;  4H2Q A;  2XLP A;  2Z5Y A;  3VR9 A;  1IUW A;  2C4C A;  3GMC A;  4A7A A;  1PJ7 A;  2ZZ0 A;  1D4C A;  3AD7 B;  3AE2 A;  1Q9I A;  3DME A;  1H6V A;  4H50 A;  1NDA A;  1PS9 A;  4G6H A;  1YQ4 A;  4H4S A;  2AR8 A;  3UKH A;  2B9X A;  4JY3 A;  2B76 A;  1JOA A;  3CGC A;  2GMJ A;  4TLX A;  4IV9 A;  4H2P A;  3BNM A;  3WE0 A;  2EQ9 A;  3PVC A;  2WPF A;  2XLT A;  3AEA A;  5EB4 A;  1VQW A;  3DH9 A;  2IID A;  2QAE A;  4ZCC A;  1CHU A;  2XVH A;  3K7M X;  1GET A;  2DKI A;  1PJ6 A;  2WDV A;  2VRM A;  3C4N A;  1TDO A;  4OPC A;  3SM8 A;  1DJN A;  3NTA A;  4K8D A;  5HYM A;  1COY A;  2YG3 A;  3NG7 X;  1GTH A;  4TM0 A;  2B9W A;  5EOW A;  4XWZ A;  1CJ3 A;  1CJ4 A;  2C72 A;  2BAB A;  2Q0L A;  2Q7V A;  1L0V A;  1OJA A;  2ZZB A;  3NRN A;  5EB5 A;  4CCR A;  2BRA A;  1N1P A;  3AE3 A;  2VRL A;  1GSN A;  4U8P A;  4B63 A;  2OAL A;  3UKL A;  1W4X A;  1F8S A;  4EMI A;  4ADW A;  2WP6 A;  2YR5 A;  4K22 A;  4NNJ A;  1ZMC A;  3LOV A;  3RHA A;  2WEU A;  3CNP A;  2BCP A;  3LZW A;  1ZMD A;  4IA5 A;  3BHK A;  1TDK A;  2BS2 A;  1GT8 A;  4U8K A;  5BVA A;  2GEW A;  4DSH A;  2XFO A;  5JCK A;  3NYF A;  2FJA A;  2WU5 A;  4GAP A;  3UCL A;  3HYV A;  3B3R A;  2XYO A;  3DGH A;  5KRQ A;  1Y56 A;  4IVM B;  4FX9 A;  1LVL A;  4H4P A;  5FS7 A;  1H86 A;  3QSE A;  2A87 A;  4C3X A;  2WOW A;  4N9X A;  1IUU A;  1LV0 A;  2JAE A;  4I59 A;  1BKW A;  3DK8 A;  3FBS A;  4TM4 A;  3I3L A;  5LV9 A;  4K5R A;  3IWA A;  4UP3 A;  1D4D A;  2XCG A;  1P2E A;  3KLJ A;  3GYI A;  3NYC A;  4H4U A;  2X8G A;  2R46 A;  3UTF A;  1QLB A;  3DK4 A;  1PBE A;  2GR2 A;  1IUV A;  3ZDN A;  4JN9 A;  1V59 A;  3SXI A;  4D03 A;  3AYJ A;  1ZOV A;  3NK0 X;  3QFA A;  5JCI A;  3ZYX A;  4Y4M A;  3VRD B;  1B4V A;  3DGZ A;  2YG4 A;  2R9Z A;  1GER A;  4REK A;  3D8X A;  3E1T A;  4OPT A;  4U2T A;  3CMM A;  1EBD A;  2VQ7 A;  2C73 A;  3UOZ A;  2R0C A;  1E1M A;  4P9S A;  4B66 A;  1PBF A;  4GRT A;  1CJ2 A;  1B37 A;  1CF3 A;  3DJG X;  2YM2 A;  2C64 A;  3KPK A;  4A6N B;  4C3Y A;  4DNA A;  3SGL A;  2APG A;  1FEC A;  1Y0P A;  2XVE A;  3AEB A;  1PJ5 A;  4CBQ A;  4YT0 A;  4U2L A;  2EQ8 A;  3URH A;  2CDU A;  1PHH A;  4WX1 A;  1ZK7 A;  2WOI A;  3SZF A;  4B65 A;  2XVF A;  3COX A;  2YLR A;  2O9Z A;  1GRT A;  2VVL G;  1E39 A;  1VDC A;  3AE5 A;  1IUT A;  2GB0 A;  2RGO A;  5FMH A;  4H4W A;  3AB1 A;  5DBJ A;  5KMS A;  1ZX9 A;  3AE9 A;  3OC4 A;  2RAB A;  3H8L A;  2XDO A;  1CC4 A;  2BC0 A;  2VQB A;  4X4J A;  2JB2 A;  2YVJ A;  3UKK A;  4BJZ A;  5KMP A;  1YQZ A;  2GR0 A;  3KVE A;  1DOB A;  1GEU A;  3SFD A;  3L8K A;  4GF7 A;  3GDP A;  3CNS A;  4K2X A;  1XDI A;  2WES A;  2WDR A;  1AOG A;  1GOS A;  2V3A A;  3GD4 A;  3RED A;  1QJD A;  4APN A;  1S2Q A;  1DOD A;  2GMH A;  2H88 A;  5HXI A;  2YVF A;  1FCD A;  4H4V A;  3RNM A;  4TM3 A;  5CKU A;  3T37 A;  4EQR A;  1TYP A;  4U8I A;  3V3O A;  1PXC A;  4DGK A;  1GES A;  2BK3 A;  4X9N A;  1DOE A;  1NG4 A;  1D4E A;  3T2Y A;  1P2H A;  3Q9T A;  5IPY A;  4U8M A;  4ECH A;  3GRS A;  1ZKQ A;  3UTG A;  1K0L A;  1GRA A;  4GAV A;  5KMR A;  2BS3 A;  1B5Q A;  3L1R A;  4NTC A;  3UKF A;  3SQP A;  1KNP A;  4BK3 A;  1GRG A;  1JRY A;  3GRT A;  2WHD A;  1H83 A;  5KXJ A;  4OCG A;  3HYW A;  2C75 A;  4CNK A;  4JNQ A;  2FJE A;  2WS3 A;  4YSY A;  1IJH A;  4A65 A;  3K7T A;  4AP1 A;  4D04 A;  4FDC B;  4CCQ A;  4AT2 A;  2X8H A;  5M10 A;  5CQF A;  4B68 A;  1KSU A;  2IVE A;  2YLX A;  3O0H A;  2OLN A;  1GV4 A;  2Q6U A;  3KU9 A;  2X8C A;  3SFE A;  4B69 A;  3GSI A;  3NK2 X;  4EQW A;  2CFY A;  1E1K A;  1NG3 A;  3UTE A;  3UOX A;  2EQ6 A;  3QJ4 A;  1TDE A;  5EBK A;  2C3D A;  1CC2 A;  4EIQ A;  3KD9 A;  2FJD A;  1O5W A;  2GH5 A;  1VG0 A;  3ADA B;  1GRF A;  4J57 A;  4C5O A;  1E7P A;  2WU2 A;  1JEH A;  1TRB A;  1L9D A;  1FL2 A;  2YVG A;  4TLZ A;  2OAM A;  2JK6 A;  3ICT A;  3SY4 A;  1VG9 A;  4E0V A;  2Z5X A;  1E1N A;  2JB3 A;  4RG3 A;  3F8P A;  3GYX A;  4A79 A;  3D1C A;  3DK9 A;  2XFU A;  2QA1 A;  4AOX A;  2QA2 A;  3EF6 A;  1HYU A;  1MOK A;  1H82 A;  4AOS A;  1FEA A;  4EQX A;  4A9W A;  1H7W A;  3ATQ A;  4MJW A;  5U25 A;  3P4Q A;  1OJD A;  2E5V A;  4ZN0 A;  1KDG A;  4ZCD A;  2BK5 A;  3ICS A;  3H8I A;  2X99 A;  2Y6R A;  3DJJ A;  1H81 A;  4H4Y A;  5U63 A;  4CY6 A;  3ITJ A;  2XFP A;  3KKJ A;  3V76 A;  2GV8 A;  4Z43 A;  1RP0 A;  3G5Q A;  1H7X A;  2BCG G;  2DKH A;  2J3N A;  1GXF A;  1K0J A;  1FOH A;  2EQ7 A;  1H84 A;  2Y6Q A;  4EMJ A;  1F8R A;  1N4V A;  1BGJ A;  3PS9 A;  4J56 A;  1YKJ A;  4IA6 A;  4NTE A;  4RSL A;  3GMB A;  1GTE A;  2YLW A;  3CND A;  4RG4 A;  2YR4 A;  5GSN A;  2WPE A;  1Y56 B;  2C70 A;  2XVJ A;  3FMW A;  1LJ1 A;  2YM1 A;  3P4R A;  4A99 A;  4C77 A;  1BGN A;  2VZ2 A;  1IUX A;  1D7Y A;  1NEN A;  3RP6 A;  4A5L A;  4YTP A;  2YR6 A;  5KOW A;  2HQM A;  3B6D A;  3IF9 A;  4JQ9 A;  3LB8 A;  4PAB A;  2GR1 A;  1O95 A;  3G5S A;  3OZ2 A;  4H2R A;  3CPH G;  2I0Z A;  1LTX R;  1D5T A;  1Q1R A;  2YLZ A;  1NHS A;  1NAA A;  1D7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...