3IWAA

Crystal structure of a fad-dependent pyridine nucleotide-disulphide oxidoreductase from desulfovibrio vulgaris
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
459
structure length
397
Chain Sequence
KHVVVIGAVALGPKAACRFKRLDPEAHVTMIDQAVEALVETRAHAIDRAAHTVEIENLRTGERRTLKYDKLVLALGSKANRPPVEGMDLAGVTPVTNLDEAEFVQHAISAGEVSKAVIVGGGFIGLEMAVSLADMWGIDTTVVELADQIMPGFTSKSLSQMLRHDLEKNDVVVHTGEKVVRLEGENGKVARVITDKRTLDADLVILAAGVSPNTQLARDAGLELDPRGAIIVDTRMRTSDPDIFAGGDCVTIPNLVTGKPGFFPLGSMANRQGRVIGTNLADGDATFPGAVGSWAVKLFEGSASGAGLTVEGALREGYDAVNVHVEQIMTLQLVVDRPTRRVLGIQGFSTLGDALTARINAVATMLASKPTVEDISNAEVVMDIVNVAGNVADNVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a FAD-dependent pyridine nucleotide-disulphide oxidoreductase from Desulfovibrio vulgaris
rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
total genus 131
structure length 397
sequence length 459
ec nomenclature ec 1.6.-.-:
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3iwaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3iwaA01
2Y6RA 1ZP0A 1GRAA 3CPHG 5IPYA 2C7GA 1PBDA 2JB1A 2R0PA 4X9NA 3I6DA 1ONFA 4B67A 1TDOA 3T37A 2QCUA 3V3OA 1PJ7A 2BYBA 4OPCA 1Y56A 1FL2A 3AEDA 1CC4A 1V59A 1NG4A 4NZHA 1S3BA 4O5QA 3H4KA 3AD7B 1FEBA 3ZYXA 2IVEA 2WS3A 3NK0X 3EF6A 4A9WA 2J3NA 3CGCA 2B9XA 4EQXA 2C76A 3GWDA 4EQRA 4H2QA 5BRTA 4USRA 4B63A 3DK4A 1CJ4A 4D03A 2FBWA 3RHAA 3PO7A 4M52A 4BV6A 3GMCA 1PHHA 4CCQA 4GCMA 1YQ4A 4REKA 3Q9TA 4FK1C 4H7UA 2YVJA 4J31A 1CHUA 4LU6A 1Q1RA 4EMWA 3IHMA 1SEZA 3RP7A 2C67A 2W0HA 5IQ1A 3FG2P 3NGCX 2Y6QA 1GESA 2WPEA 3F8RA 4H50A 2XLSA 1MO9A 2BCPA 1KNPA 3L8KA 4CRTA 3IC9A 5IQ4A 4AP3A 5KWFA 1OJDA 2GEWA 3H8LA 3K30A 2BS2A 2GQWA 4A99A 2OALA 4C77A 2V6OA 2YLZA 1ZX9A 1IUWA 3GD4A 1E1NA 4GR1A 3AE6A 3WE0A 1P2EA 1DNCA 2VQBA 1PS9A 3OC4A 2B9YA 1H84A 2BC1A 1NENA 2A89A 3AD9B 1GXFA 2V3AA 4UDRA 4H4WA 3D8XA 3Q6JA 4N9XA 1L0VA 4P9SA 1TYPA 4LIIA 2GVCA 4YTMA 2WU5A 2GR1A 2V5ZA 1NHQA 3UKLA 3SFDA 2V60A 1IUXA 2BXSA 2XDOA 1PBEA 2ZBWA 3AEFA 3NRNA 1QJDA 2TMDA 1L9DA 1H82A 1NAAA 2Z5YA 4BJYA 1EL9A 1XANA 2BABA 3DH9A 4C3XA 3VRBA 4APNA 1O95A 2FJAA 4PAAA 3UKKA 4LA1A 2Q0KA 4EMJA 2Z5XA 4YT0A 4OPGA 1GV4A 4C5OA 2XVIA 3AE7A 1VG0A 3COXA 3QVRA 1DOCA 4EM3A 2XVEA 4H2NA 5JCKA 2BK5A 3FIMB 1F6MA 3P4PA 3UOYA 2B7RA 1IUVA 1OJAA 4K5SA 1N4WA 1PN0A 3KA7A 3UKPA 1ZK7A 1TDNA 1LTXR 3URHA 3B6DA 3LB8A 2JKCA 2I0ZA 3BI4A 4B69A 2H89A 3DJJA 4NTEA 1D4DA 5U63A 1B8SA 4TM4A 2A87A 3DGHA 4A65A 4IVMB 3UTFA 3P4SA 1N4UA 1NHRA 4ZCDA 3KPFA 3OZ2A 1GPEA 1ZY8A 3AXBA 4H4YA 5KVIA 2ACZA 5LV9A 1QLBA 2GR0A 2WP9A 2XFOA 3P1WA 3AE1A 2DKIA 4YSZA 2RGOA 4WX1A 3GSIA 1IUUA 4YKFA 3AWIA 4PABA 4B1BA 3NIXA 3BNUA 3LXDA 1ELIA 1D7LA 2WOVA 5CKUA 3NK1X 4H4XA 2VQ7A 3NG7X 2YG4A 4YTNA 4ADWA 1L9EA 4AT0A 3BHKA 4BJZA 4J2WA 4U8MA 3M12A 2EQ8A 3NTAA 2XFUA 3G5QA 1L9CA 4CBQA 4H4VA 2IVDA 3BHFA 1KF6A 4B66A 1BKWA 3CNDA 2WDQA 4GRTA 3F8PA 2GR3A 1PJ5A 4OPUA 1H81A 1GRHA 5BVAA 2JB2A 1GRTA 2C65A 1KDGA 1N4VA 1Q9IA 2TPRA 2YM1A 4JNAA 1AOGA 4CCRA 2C73A 4EIPA 1YQZA 2YG3A 1ZDLA 3GRTA 3S61A 2VRLA 4YTPA 5C2TA 4AOXA 3UKQA 5C3JA 2YWLA 3AE8A 1W4XA 4AOSA 3LZXA 4Z44A 5ER0A 2EQ9A 3LOVA 3LZWA 2R0CA 1GNDA 1H6VA 1JNZA 3UP5A 4CY8A 1BGJA 2GH5A 2ZZCA 3UOVA 1TDEA 3DJEA 2C64A 2OLNA 3CGDA 3CNSA 3VRAA 5J7XA 2FJDA 5U1OA 1CJCA 1RYIA 1YQ3A 3BI5A 5JCIA 3KLJA 1E1LA 2ZZ0A 2XYOA 1LVLA 3DA1A 5TR3A 2XLRA 4ZN0A 5FS7A 4H4ZA 1EL5A 1Y0PA 2C75A 1KSUA 1XPQA 4ZCCA 3P4QA 3VQRA 3VR8A 1RSGA 1DJQA 3II4A 1BWCA 4IA6A 4A7AA 1K0JA 1PJ6A 3GRSA 1PBFA 3QSEA 2E5VA 5JCNA 1D7YA 3RP6A 3FMWA 2BS4A 3C4NA 4OPTA 4I58A 4J36A 3NN0X 2GR2A 2HQMA 3QJ4A 3AECA 4WCTA 1N1PA 2BXRA 4FDCB 5KOWA 1GSNA 4JDRA 4DGKA 1LQUA 4Z25A 2YR6A 3K7TA 3NKSA 4H4SA 3SFEA 5JCLA 4H4PA 4U8KA 5KOXA 1S3EA 4RG3A 4ECHA 1JRXA 3SQPA 1GREA 4J56A 1VQWA 5KXJA 3B3RA 4JY3A 2O9ZA 1LQTA 1ZKQA 2X8GA 1UKVG 1YKJA 1PDHA 4KPRA 2YVFA 4YKGA 2IIDA 4H2PA 1NHPA 1GTHA 1TRBA 3LJPA 4OVIA 2APGA 1KNRA 1D4CA 4BK1A 2R0GA 2C3DA 2WP5A 3H8IA 4H4QA 5DBJA 4BK3A 2C70A 3AEAA 1D4EA 1HYUA 4XWZA 3ZDNA 2XVHA 2WDRA 4U2TA 3CPIG 4X9MA 4A6NA 2BA9A 2YLSA 4UP3A 4Z26A 1PXAA 4TLZA 1VG9A 4I59A 5HHFA 4K5RA 2C72A 2V3BA 1NEKA 1TYTA 4XWRA 2XVFA 3D1CA 4C3YA 4NTCA 4CNJA 3EPTA 1CL0A 2AR8A 3REDA 3UKFA 2GAGB 4TM3A 3QFBA 2WETA 1TDFA 3GD3A 1DXLA 1JU2A 1M64A 2ZZBA 2RGHA 3UTEA 2RGJA 2GMJA 2JAEA 2PHHA 3SGLA 4EMIA 2R45A 3AE2A 2CULA 1O94A 3CGBA 3M13A 2GF3A 4JQ9A 3ICTA 5L46A 3KU9A 4TM1A 2XLPA 2YVGA 3AYLA 3CN8A 2BCGG 3ISHA 2WBAA 1BF3A 3PVCA 4U8IA 3CGEA 1JRYA 4RSLA 4TLXA 2BACA 4A5LA 2CVJA 2YAUA 3G5RA 2X50A 4GDEA 3PS9A 3ABVA 2NPXA 4OPDA 1Q1WA 2GMHA 1E1MA 1PBCA 2JK6A 2X8CA 3AEBA 3NNEA 4IVOB 4FK1A 3VR9A 1E1KA 4A79A 2PYXA 2WU2A 4BURA 1H7XA 4B64A 2ARDA 2GQFA 1GALA 3LADA 4Z2TA 4IV9A 5M0ZA 5BUKA 4YSHA 4UDPA 1GEUA 2EQ6A 4KX6A 2Q0LA 4K7ZA 4EM4A 1EL8A 3CTYA 3GDPA 3BNMA 3M0OA 3KVEA 2GAHB 1OJTA 5FS8A 3IWAA 3FPZA 3ALJA 3ICRA 4HB9A 2QA2A 2YG7A 3AD8B 4Y4MA 2YR4A 4GF7A 2WPFA 1BGNA 3GYJA 5J60A 5JCMA 2XFQA 3AYJA 1BZLA 4EQSA 2XFPA 3G5SA 1GOSA 4X4JA 2AAQA 2VVMA 4JY2A 1P2HA 1LJ1A 1XHCA 3QFAA 5CQFA 3E1TA 3CNTA 1GTEA 4A6NB 1ZMCA 2B9WA 1GRGA 1OJCA 1K4QA 3F8DA 1ZOVA 3NTDA 1ZOYA 2OA1A 1GRFA 1CC6A 3NYCA 4NEVA 1E6EA 2WOWA 2WHDA 4DSGA 1FOHA 2B76A 3K7MX 3IHGA 3DGZA 2VRMA 4RG4A 1PBBA 5GSNA 4AP1A 5BULA 4JN9A 3UOXA 2BS3A 1FEAA 5FMHA 2WEUA 2XCGA 5U25A 4DSHA 1COYA 3UKAA 5FS6A 1F8RA 1FCDA 5M10A 3P4RA 2GB0A 1KSSA 2VVLA 2WESA 4K22A 2BK4A 3UTGA 4H4TA 2YQUA 1S2QA 5HYMA 1IJHA 5EB5A 2BK3A 4Z2RA 3K7QX 2YR5A 4GUVA 4YSYA 3ADAB 1IUTA 1JEHA 4AT2A 3UCLA 1DODA 2QA1A 1PXBA 1S2YA 3NK2X 3C4AA 2X99A 4UDQA 1JRZA 3AEGA 1CJ2A 3V3NA 2EQ7A 1DJNA 2VZ2A 1NDAA 3AE3A 4E0VA 2C66A 3O0HA 2VVLG 2CFYA 2X8HA 4EQWA 3CPJG 2H88A 3UKHA 3NYFA 1ZMDA 2OAMA 1DOBA 3EANA 2XVJA 2VOUA 4K2XA 4CY6A 3P9UA 4JNQA 4Z2UA 5FS9A 3DJDA 4B68A 2C3CA 1D5TA 2A8XA 1K0IA 4USQA 4H4UA 1GRBA 2RABA 3NN6X 4NEWA 3DJGX 3QVPA 2UZZA 1E7PA 2CDUA 3AE4A 2R46A 5HY5A 4DNAA 4J57A 1EL7A 1LPFA 1CC2A 2XLUA 3BI2A 3GYIA 5EOWA 3ICSA 4H4RA 4EIQA 4Z43A 3V76A 5KRQA 4HA6A 1VDCA 2GRTA 2WQYA 3I3LA 3NT6A 4U8LA 3NHOX 1QO8A 4B65A 4Y4LA 3IF9A 3DK9A 2E1MA 4GDPA 1LV0A 4Z24A 4OPIA 2XFNA 4D04A 2YG6A 4U2LA 5HXIA 3HZLA 1CBOA 2FJBA 1NG3A 3QSSA 2E4GA 1MXTA 1NHSA 4CNKA 2DKHA 1O5WA 1H86A 3S5WA 2X3NA 1GERA 5GRTA 5KVHA 2Q6UA 2BC0A 1XDIA 3CNJA 1E39A 3ATRA 2QAEA 2YLRA 3AEEA 4OCGA 4TM0A 1Z6LA 3EAOA 3R9UA 2WOIA 3ALMA 4NTDA 2WDVA 2WPCA 3UP4A 4ICYA 2OLOA 2JB3A 2R4EA 1REOA 3NH3X 2R4JA 4K8DA 4Y4NA 1B5QA 3RNMA 1K0LA 2AQJA 1OJ9A 4U8PA 2XLTA 3CIRA 1RP0A 3GDNA 4H2RA 1M6IA 1TDKA 1F8WA 1GETA 2B7SA 2YM2A 3GWFA 5EB4A 4U8JA 2JBVA 1FECA 3ITJA 3KD9A 1Y56B 3ALLA 4YSXA 1JOAA 1CF3A 3SM8A 1H83A 3AB1A 2NVKX 3L1RA 3VRDB 1F3PA 3ATQA 4BK2A 3C96A 3JSKA 3QSMA 2YLTA 4O5UA 2YLXA 3CNPA 2Q7VA 4MJWA 4FX9A 1DOEA 1IUSA 4J33A 4U8NA 3AYIA 2YLWA 2YG5A 1KFYA 3NYEA 4C74A 3RP8A 1MOKA 1CJ3A 4XXGA 5EBKA 3KKJA 1VRQB 3NLCA 3FBSA 1PXCA 2FJEA 2WP6A 3GMBA 3DMEA 2F5ZA 3DK8A 3AE9A 1NPXA 1X31B 3UOZA 1YY5A 4YXDA 3AE5A 2R9ZA 4IA5A 4J34A 2GV8A 4U2SA 4U8OA 1B37A 2V61A 4YWOA 3UTHA 1JNRA 1B4VA 1EBDA 1H7WA 4OPLA 1GT8A 1F8SA
chains in the Genus database with same CATH superfamily
2Y6RA 1ZP0A 1GRAA 3CPHG 5IPYA 2C7GA 1PBDA 2JB1A 2R0PA 4X9NA 3I6DA 1ONFA 3SYIA 4B67A 1TDOA 3T37A 2QCUA 3V3OA 1PJ7A 2BYBA 4OPCA 1Y56A 1FL2A 3AEDA 1CC4A 1V59A 1NG4A 4NZHA 1S3BA 4O5QA 3SZFA 3H4KA 3SZCA 3AD7B 1FEBA 3ZYXA 2IVEA 2WS3A 3NK0X 3EF6A 4A9WA 2J3NA 5KMRA 3CGCA 2B9XA 4EQXA 2C76A 3GWDA 4EQRA 4H2QA 5BRTA 4USRA 4B63A 3DK4A 1CJ4A 4D03A 2FBWA 3RHAA 3PO7A 4M52A 4BV6A 3GMCA 1PHHA 4CCQA 4GCMA 1YQ4A 4REKA 3Q9TA 4G6GA 4FK1C 4H7UA 2YVJA 4J31A 1CHUA 4LU6A 1Q1RA 4EMWA 3IHMA 1SEZA 3RP7A 2C67A 2W0HA 5IQ1A 3FG2P 3NGCX 3T14A 2Y6QA 1GESA 2WPEA 3F8RA 4H50A 2XLSA 4G74A 1MO9A 4GAPA 2BCPA 1KNPA 3L8KA 4CRTA 3IC9A 5IQ4A 4AP3A 5KWFA 1OJDA 2GEWA 3H8LA 3K30A 2BS2A 2GQWA 4A99A 2OALA 4C77A 2V6OA 2YLZA 1ZX9A 1IUWA 3GD4A 1E1NA 4GR1A 3AE6A 3WE0A 1P2EA 1DNCA 2VQBA 1PS9A 3OC4A 2B9YA 1H84A 2BC1A 1NENA 2A89A 3AD9B 1GXFA 2V3AA 4UDRA 4H4WA 3D8XA 3Q6JA 4N9XA 1L0VA 4P9SA 1TYPA 4LIIA 2GVCA 3HYXA 4YTMA 2WU5A 2GR1A 2V5ZA 1NHQA 3UKLA 3SFDA 2V60A 1IUXA 2BXSA 2XDOA 1PBEA 2ZBWA 3AEFA 3NRNA 1QJDA 2TMDA 1L9DA 1H82A 2BRYA 1NAAA 2Z5YA 4BJYA 1EL9A 1XANA 2BABA 3DH9A 4C3XA 3VRBA 4APNA 1O95A 2FJAA 4PAAA 3UKKA 4LA1A 2Q0KA 4EMJA 2Z5XA 5KMSA 4YT0A 4OPGA 1GV4A 4C5OA 2XVIA 3AE7A 1VG0A 3COXA 3QVRA 1DOCA 4EM3A 2XVEA 4H2NA 5JCKA 2BK5A 3FIMB 1F6MA 3P4PA 3UOYA 2B7RA 1IUVA 1OJAA 4K5SA 3CMMA 1N4WA 4II2A 1PN0A 3KA7A 3UKPA 1ZK7A 1TDNA 1LTXR 3URHA 3B6DA 3LB8A 2JKCA 2I0ZA 3BI4A 4B69A 2H89A 3DJJA 4NTEA 1D4DA 5U63A 1B8SA 4TM4A 2A87A 3DGHA 4A65A 4IVMB 3UTFA 3P4SA 1N4UA 1NHRA 4ZCDA 3KPFA 3OZ2A 1GPEA 1ZY8A 3AXBA 4H4YA 5KVIA 2ACZA 5LV9A 1QLBA 2GR0A 2WP9A 2XFOA 3P1WA 3AE1A 2DKIA 4YSZA 2RGOA 4WX1A 3GSIA 1IUUA 4YKFA 3AWIA 4PABA 4B1BA 3NIXA 3BNUA 3LXDA 1ELIA 1D7LA 2WOVA 5CKUA 3NK1X 4H4XA 2VQ7A 3NG7X 2YG4A 3HYVA 4YTNA 4ADWA 1L9EA 4AT0A 3BHKA 4BJZA 4J2WA 4U8MA 3M12A 2EQ8A 3NTAA 2XFUA 3G5QA 1L9CA 4CBQA 4GAVA 4H4VA 3BHFA 2IVDA 1KF6A 4B66A 1BKWA 3CNDA 2WDQA 4GRTA 3F8PA 2GR3A 1PJ5A 4OPUA 1H81A 1GRHA 5BVAA 2JB2A 1GRTA 2C65A 1KDGA 1N4VA 1Q9IA 2TPRA 2YM1A 4JNAA 1AOGA 4CCRA 2C73A 4EIPA 1YQZA 2YG3A 1ZDLA 3GRTA 3S61A 2VRLA 4YTPA 5C2TA 4AOXA 3UKQA 5C3JA 2YWLA 3AE8A 1W4XA 4AOSA 3LZXA 4Z44A 5ER0A 2EQ9A 3LOVA 3LZWA 2R0CA 1GNDA 1H6VA 1JNZA 3GYXA 3SZWA 3UP5A 4CY8A 1BGJA 2GH5A 2ZZCA 3UOVA 1TDEA 3DJEA 2C64A 2OLNA 3CGDA 3CNSA 3VRAA 5J7XA 2FJDA 5U1OA 1CJCA 1RYIA 1YQ3A 3BI5A 5JCIA 3KLJA 1E1LA 2ZZ0A 2XYOA 1LVLA 3DA1A 5TR3A 2XLRA 4ZN0A 5FS7A 4H4ZA 1EL5A 1Y0PA 2C75A 1KSUA 1XPQA 4ZCCA 3P4QA 3VQRA 3VR8A 4Z43A 1RSGA 1DJQA 3II4A 1BWCA 4IA6A 4A7AA 1K0JA 1PJ6A 3GRSA 1PBFA 3QSEA 2E5VA 5JCNA 1D7YA 3RP6A 3FMWA 2BS4A 3C4NA 4OPTA 4I58A 4J36A 3NN0X 2GR2A 2HQMA 3QJ4A 3AECA 4WCTA 1N1PA 2BXRA 4FDCB 5KOWA 1GSNA 4JDRA 4DGKA 1LQUA 4Z25A 2YR6A 3K7TA 3NKSA 4H4SA 3SFEA 4G9KA 4H4PA 4U8KA 5JCLA 1S3EA 5KOXA 4RG3A 4ECHA 1JRXA 3SQPA 1GREA 4J56A 1VQWA 5KXJA 3B3RA 4JY3A 2O9ZA 1LQTA 1ZKQA 2X8GA 1UKVG 1YKJA 1PDHA 4KPRA 2YVFA 4YKGA 2IIDA 4H2PA 1NHPA 1GTHA 1TRBA 3LJPA 4OVIA 2APGA 1KNRA 1D4CA 4BK1A 2R0GA 2C3DA 2WP5A 3H8IA 4H4QA 5DBJA 4BK3A 2C70A 3AEAA 1D4EA 1HYUA 4XWZA 3ZDNA 2XVHA 2WDRA 4U2TA 3CPIG 4X9MA 4A6NA 2BA9A 2YLSA 4UP3A 4Z26A 1PXAA 4TLZA 1VG9A 4I59A 5HHFA 4K5RA 4NNJA 2C72A 2V3BA 1NEKA 1TYTA 4XWRA 2XVFA 3D1CA 4C3YA 4NTCA 4CNJA 3EPTA 1CL0A 2AR8A 3REDA 3UKFA 2GAGB 4TM3A 3QFBA 2WETA 1TDFA 3GD3A 3T0KA 1DXLA 1JU2A 1M64A 2ZZBA 2RGHA 3UTEA 2RGJA 2GMJA 2JAEA 2PHHA 3SGLA 4EMIA 2R45A 3AE2A 2CULA 1O94A 3CGBA 3M13A 2GF3A 4JQ9A 3ICTA 5L46A 3KU9A 4TM1A 2XLPA 2YVGA 3AYLA 3CN8A 2BCGG 3ISHA 2WBAA 1BF3A 3PVCA 4U8IA 3CGEA 1JRYA 4RSLA 4TLXA 2BACA 4A5LA 2CVJA 2YAUA 3G5RA 2X50A 4GDEA 3PS9A 3ABVA 2NPXA 4OPDA 1Q1WA 2GMHA 4YWOA 1E1MA 1PBCA 2JK6A 2X8CA 2BRAA 3AEBA 3NNEA 4FK1A 4IVOB 3VR9A 1E1KA 4A79A 2PYXA 2WU2A 4BURA 1H7XA 4B64A 3SY4A 2ARDA 2GQFA 1GALA 3LADA 4Z2TA 4IV9A 5M0ZA 5BUKA 4YSHA 4UDPA 1GEUA 2EQ6A 4KX6A 5KNLA 2Q0LA 4K7ZA 4EM4A 1EL8A 3CTYA 3GDPA 3BNMA 3M0OA 3KVEA 2GAHB 1OJTA 5FS8A 3IWAA 3FPZA 3ALJA 3ICRA 4HB9A 5KMPA 2QA2A 2YG7A 3AD8B 4Y4MA 3T2YA 3T2KA 2YR4A 4GF7A 2WPFA 1BGNA 3GYJA 5J60A 5JCMA 2XFQA 3AYJA 1BZLA 4EQSA 2XFPA 3G5SA 1GOSA 4X4JA 2AAQA 2VVMA 4JY2A 1P2HA 1LJ1A 1XHCA 3QFAA 5CQFA 3E1TA 3CNTA 1GTEA 4A6NB 1ZMCA 2B9WA 1GRGA 1OJCA 1K4QA 3F8DA 1ZOVA 3NTDA 1ZOYA 2OA1A 1GRFA 1CC6A 3NYCA 4NEVA 1E6EA 2WOWA 2WHDA 4DSGA 1FOHA 2B76A 3K7MX 3IHGA 3DGZA 2VRMA 4RG4A 1PBBA 5GSNA 4AP1A 5BULA 4JN9A 3UOXA 2BS3A 1FEAA 4G6HA 5FMHA 2C4CA 2WEUA 2XCGA 5U25A 3SXIA 4DSHA 3T2ZA 1COYA 3UKAA 5FS6A 1F8RA 1FCDA 5M10A 3P4RA 2GB0A 1KSSA 2VVLA 2WESA 4K22A 2BK4A 3UTGA 4H4TA 2YQUA 1S2QA 5HYMA 1IJHA 5EB5A 2BK3A 4Z2RA 3K7QX 2YR5A 4GUVA 4YSYA 3ADAB 1IUTA 1JEHA 4AT2A 3UCLA 4II3A 1DODA 2QA1A 1PXBA 1S2YA 3NK2X 3C4AA 2X99A 4UDQA 1JRZA 3AEGA 1CJ2A 3V3NA 2EQ7A 1DJNA 2VZ2A 1NDAA 3AE3A 4E0VA 2C66A 3O0HA 2VVLG 2CFYA 2X8HA 4EQWA 3CPJG 2H88A 3UKHA 3NYFA 1ZMDA 2OAMA 1DOBA 4NWZA 3EANA 2XVJA 2VOUA 4K2XA 4CY6A 3P9UA 4JNQA 4Z2UA 5FS9A 3DJDA 4B68A 2C3CA 1D5TA 2A8XA 1K0IA 4USQA 4H4UA 1GRBA 2RABA 3NN6X 4NEWA 3DJGX 3QVPA 2UZZA 1E7PA 2CDUA 3AE4A 2R46A 5HY5A 4DNAA 4J57A 1EL7A 1LPFA 1CC2A 2XLUA 3BI2A 3GYIA 4G73A 3ICSA 4H4RA 5EOWA 4EIQA 3V76A 5KRQA 4HA6A 1VDCA 2GRTA 2WQYA 3I3LA 3NT6A 4U8LA 3SZ0A 3NHOX 1QO8A 4B65A 4Y4LA 3IF9A 3DK9A 2E1MA 4GDPA 1LV0A 4Z24A 4OPIA 2XFNA 4D04A 2YG6A 4U2LA 5HXIA 3HZLA 1CBOA 2FJBA 1NG3A 3QSSA 2E4GA 1MXTA 1NHSA 4CNKA 2DKHA 1O5WA 1H86A 3S5WA 2X3NA 1GERA 5GRTA 5KVHA 2Q6UA 2BC0A 1XDIA 3CNJA 1E39A 3ATRA 2QAEA 2YLRA 3AEEA 4OCGA 4TM0A 1Z6LA 3EAOA 3R9UA 2WOIA 3ALMA 4NTDA 2WDVA 2WPCA 3UP4A 4ICYA 2OLOA 2JB3A 2R4EA 1REOA 3KPKA 3NH3X 2R4JA 4K8DA 4Y4NA 1B5QA 3T31A 3RNMA 1K0LA 2AQJA 1OJ9A 4U8PA 2XLTA 3CIRA 1RP0A 3GDNA 4H2RA 1M6IA 1TDKA 1F8WA 1GETA 2B7SA 2YM2A 3GWFA 5EB4A 4U8JA 2JBVA 1FECA 3ITJA 3KD9A 5KMQA 1Y56B 3ALLA 4YSXA 1JOAA 1CF3A 3SM8A 1H83A 3AB1A 2NVKX 3L1RA 3SX6A 3VRDB 1F3PA 3ATQA 4BK2A 3C96A 3JSKA 3QSMA 2YLTA 4O5UA 2YLXA 3CNPA 2Q7VA 4MJWA 4FX9A 1DOEA 1IUSA 4J33A 4U8NA 3AYIA 2YLWA 2YG5A 1KFYA 3NYEA 4C74A 3RP8A 1MOKA 1CJ3A 4XXGA 5EBKA 3KKJA 1VRQB 3NLCA 3FBSA 1PXCA 2FJEA 2WP6A 3GMBA 3DMEA 2F5ZA 3DK8A 3AE9A 1NPXA 1X31B 3UOZA 1YY5A 4YXDA 3AE5A 2R9ZA 4IA5A 4J34A 2GV8A 4U2SA 4U8OA 1B37A 2V61A 3HYWA 3UTHA 1JNRA 1B4VA 1EBDA 1H7WA 4OPLA 1GT8A 1F8SA
chains in the Genus database with same CATH topology
2Y6RA 1ZP0A 1GRAA 3CPHG 5IPYA 2C7GA 1PBDA 2JB1A 2R0PA 4X9NA 3I6DA 1ONFA 3SYIA 4B67A 1TDOA 3T37A 2QCUA 3V3OA 1PJ7A 2BYBA 4OPCA 1Y56A 1FL2A 3AEDA 1CC4A 1V59A 1NG4A 4NZHA 1S3BA 4O5QA 3SZFA 3H4KA 3SZCA 3AD7B 1FEBA 3ZYXA 2IVEA 2WS3A 3NK0X 3EF6A 4A9WA 2J3NA 5KMRA 3CGCA 2B9XA 4EQXA 2C76A 3GWDA 4EQRA 4H2QA 5BRTA 4USRA 4B63A 3DK4A 1CJ4A 4D03A 2FBWA 3RHAA 3PO7A 4M52A 4BV6A 3GMCA 1PHHA 4CCQA 4GCMA 1YQ4A 4REKA 3Q9TA 4G6GA 4FK1C 4H7UA 2YVJA 4J31A 1CHUA 4LU6A 1Q1RA 4EMWA 3IHMA 1SEZA 3RP7A 2C67A 2W0HA 5IQ1A 3FG2P 3NGCX 3T14A 2Y6QA 1GESA 2WPEA 3F8RA 4H50A 2XLSA 4G74A 1MO9A 4GAPA 2BCPA 1KNPA 3L8KA 4CRTA 3IC9A 5IQ4A 4AP3A 5KWFA 1OJDA 2GEWA 3H8LA 3K30A 2BS2A 2GQWA 4A99A 2OALA 4C77A 2V6OA 2YLZA 1ZX9A 1IUWA 3GD4A 1E1NA 4GR1A 3AE6A 3WE0A 1P2EA 1DNCA 2VQBA 1PS9A 3OC4A 2B9YA 1H84A 2BC1A 1NENA 2A89A 3AD9B 1GXFA 2V3AA 4UDRA 4H4WA 3D8XA 3Q6JA 4N9XA 1L0VA 4P9SA 1TYPA 4LIIA 2GVCA 3HYXA 4YTMA 2WU5A 2GR1A 2V5ZA 1NHQA 3UKLA 3SFDA 2V60A 1IUXA 2BXSA 2XDOA 1PBEA 2ZBWA 3AEFA 3NRNA 1QJDA 2TMDA 1L9DA 1H82A 2BRYA 1NAAA 2Z5YA 4BJYA 1EL9A 1XANA 2BABA 3DH9A 4C3XA 3VRBA 4APNA 1O95A 2FJAA 4PAAA 3UKKA 4LA1A 2Q0KA 4EMJA 2Z5XA 5KMSA 4YT0A 4OPGA 1GV4A 4C5OA 2XVIA 3AE7A 1VG0A 3COXA 3QVRA 1DOCA 4EM3A 2XVEA 4H2NA 5JCKA 2BK5A 3FIMB 1F6MA 3P4PA 3UOYA 2B7RA 1IUVA 1OJAA 4K5SA 3CMMA 1N4WA 4II2A 1PN0A 3KA7A 3UKPA 1ZK7A 1TDNA 1LTXR 3URHA 3B6DA 3LB8A 2JKCA 2I0ZA 3BI4A 4B69A 2H89A 3DJJA 4NTEA 1D4DA 5U63A 1B8SA 4TM4A 2A87A 3DGHA 4A65A 4IVMB 3UTFA 3P4SA 1N4UA 1NHRA 4ZCDA 3KPFA 3OZ2A 1GPEA 1ZY8A 3AXBA 4H4YA 5KVIA 2ACZA 5LV9A 1QLBA 2GR0A 2WP9A 2XFOA 3P1WA 3AE1A 2DKIA 4YSZA 2RGOA 4WX1A 3GSIA 1IUUA 4YKFA 3AWIA 4PABA 4B1BA 3NIXA 3BNUA 3LXDA 1ELIA 1D7LA 2WOVA 5CKUA 3NK1X 4H4XA 2VQ7A 3NG7X 2YG4A 3HYVA 4YTNA 4ADWA 1L9EA 4AT0A 3BHKA 4BJZA 4J2WA 4U8MA 3M12A 2EQ8A 3NTAA 2XFUA 3G5QA 1L9CA 4CBQA 4GAVA 4H4VA 3BHFA 2IVDA 1KF6A 4B66A 1BKWA 3CNDA 2WDQA 4GRTA 3F8PA 2GR3A 1PJ5A 4OPUA 1H81A 1GRHA 5BVAA 2JB2A 1GRTA 2C65A 1KDGA 1N4VA 1Q9IA 2TPRA 2YM1A 4JNAA 1AOGA 4CCRA 2C73A 4EIPA 1YQZA 2YG3A 1ZDLA 3GRTA 3S61A 2VRLA 4YTPA 5C2TA 4AOXA 3UKQA 5C3JA 2YWLA 3AE8A 1W4XA 4AOSA 3LZXA 4Z44A 5ER0A 2EQ9A 3LOVA 3LZWA 2R0CA 1GNDA 1H6VA 1JNZA 3GYXA 3SZWA 3UP5A 4CY8A 1BGJA 2GH5A 2ZZCA 3UOVA 1TDEA 3DJEA 2C64A 2OLNA 3CGDA 3CNSA 3VRAA 5J7XA 2FJDA 5U1OA 1CJCA 1RYIA 1YQ3A 3BI5A 5JCIA 3KLJA 1E1LA 2ZZ0A 2XYOA 1LVLA 3DA1A 5TR3A 2XLRA 4ZN0A 5FS7A 4H4ZA 1EL5A 1Y0PA 2C75A 1KSUA 1XPQA 4ZCCA 3P4QA 3VQRA 3VR8A 4Z43A 1RSGA 1DJQA 3II4A 1BWCA 4IA6A 4A7AA 1K0JA 1PJ6A 3GRSA 1PBFA 3QSEA 2E5VA 5JCNA 1D7YA 3RP6A 3FMWA 2BS4A 3C4NA 4OPTA 4I58A 4J36A 3NN0X 2GR2A 2HQMA 3QJ4A 3AECA 4WCTA 1N1PA 2BXRA 4FDCB 5KOWA 1GSNA 4JDRA 4DGKA 1LQUA 4Z25A 2YR6A 3K7TA 3NKSA 4H4SA 3SFEA 4G9KA 4H4PA 4U8KA 5JCLA 1S3EA 5KOXA 4RG3A 4ECHA 1JRXA 3SQPA 1GREA 4J56A 1VQWA 5KXJA 3B3RA 4JY3A 2O9ZA 1LQTA 1ZKQA 2X8GA 1UKVG 1YKJA 1PDHA 4KPRA 2YVFA 4YKGA 2IIDA 4H2PA 1NHPA 1GTHA 1TRBA 3LJPA 4OVIA 2APGA 1KNRA 1D4CA 4BK1A 2R0GA 2C3DA 2WP5A 3H8IA 4H4QA 5DBJA 4BK3A 2C70A 3AEAA 1D4EA 1HYUA 4XWZA 3ZDNA 2XVHA 2WDRA 4U2TA 3CPIG 4X9MA 4A6NA 2BA9A 2YLSA 4UP3A 4Z26A 1PXAA 4TLZA 1VG9A 4I59A 5HHFA 4K5RA 4NNJA 2C72A 2V3BA 1NEKA 1TYTA 4XWRA 2XVFA 3D1CA 4C3YA 4NTCA 4CNJA 3EPTA 1CL0A 2AR8A 3REDA 3UKFA 2GAGB 4TM3A 3QFBA 2WETA 1TDFA 3GD3A 3T0KA 1DXLA 1JU2A 1M64A 2ZZBA 2RGHA 3UTEA 2RGJA 2GMJA 2JAEA 2PHHA 3SGLA 4EMIA 2R45A 3AE2A 2CULA 1O94A 3CGBA 3M13A 2GF3A 4JQ9A 3ICTA 5L46A 3KU9A 4TM1A 2XLPA 2YVGA 3AYLA 3CN8A 2BCGG 3ISHA 2WBAA 1BF3A 3PVCA 4U8IA 3CGEA 1JRYA 4RSLA 4TLXA 2BACA 4A5LA 2CVJA 2YAUA 3G5RA 2X50A 4GDEA 3PS9A 3ABVA 2NPXA 4OPDA 1Q1WA 2GMHA 4YWOA 1E1MA 1PBCA 2JK6A 2X8CA 2BRAA 3AEBA 3NNEA 4FK1A 4IVOB 3VR9A 1E1KA 4A79A 2PYXA 2WU2A 4BURA 1H7XA 4B64A 3SY4A 2ARDA 2GQFA 1GALA 3LADA 4Z2TA 4IV9A 5M0ZA 5BUKA 4YSHA 4UDPA 1GEUA 2EQ6A 4KX6A 5KNLA 2Q0LA 4K7ZA 4EM4A 1EL8A 3CTYA 3GDPA 3BNMA 3M0OA 3KVEA 2GAHB 1OJTA 5FS8A 3IWAA 3FPZA 3ALJA 3ICRA 4HB9A 5KMPA 2QA2A 2YG7A 3AD8B 4Y4MA 3T2YA 3T2KA 2YR4A 4GF7A 2WPFA 1BGNA 3GYJA 5J60A 5JCMA 2XFQA 3AYJA 1BZLA 4EQSA 2XFPA 3G5SA 1GOSA 4X4JA 2AAQA 2VVMA 4JY2A 1P2HA 1LJ1A 1XHCA 3QFAA 5CQFA 3E1TA 3CNTA 1GTEA 4A6NB 1ZMCA 2B9WA 1GRGA 1OJCA 1K4QA 3F8DA 1ZOVA 3NTDA 1ZOYA 2OA1A 1GRFA 1CC6A 3NYCA 4NEVA 1E6EA 2WOWA 2WHDA 4DSGA 1FOHA 2B76A 3K7MX 3IHGA 3DGZA 2VRMA 4RG4A 1PBBA 5GSNA 4AP1A 5BULA 4JN9A 3UOXA 2BS3A 1FEAA 4G6HA 5FMHA 2C4CA 2WEUA 2XCGA 5U25A 3SXIA 4DSHA 3T2ZA 1COYA 3UKAA 5FS6A 1F8RA 1FCDA 5M10A 3P4RA 2GB0A 1KSSA 2VVLA 2WESA 4K22A 2BK4A 3UTGA 4H4TA 2YQUA 1S2QA 5HYMA 1IJHA 5EB5A 2BK3A 4Z2RA 3K7QX 2YR5A 4GUVA 4YSYA 3ADAB 1IUTA 1JEHA 4AT2A 3UCLA 4II3A 1DODA 2QA1A 1PXBA 1S2YA 3NK2X 3C4AA 2X99A 4UDQA 1JRZA 3AEGA 1CJ2A 3V3NA 2EQ7A 1DJNA 2VZ2A 1NDAA 3AE3A 4E0VA 2C66A 3O0HA 2VVLG 2CFYA 2X8HA 4EQWA 3CPJG 2H88A 3UKHA 3NYFA 1ZMDA 2OAMA 1DOBA 4NWZA 3EANA 2XVJA 2VOUA 4K2XA 4CY6A 3P9UA 4JNQA 4Z2UA 5FS9A 3DJDA 4B68A 2C3CA 1D5TA 2A8XA 1K0IA 4USQA 4H4UA 1GRBA 2RABA 3NN6X 4NEWA 3DJGX 3QVPA 2UZZA 1E7PA 2CDUA 3AE4A 2R46A 5HY5A 4DNAA 4J57A 1EL7A 1LPFA 1CC2A 2XLUA 3BI2A 3GYIA 4G73A 3ICSA 4H4RA 5EOWA 4EIQA 3V76A 5KRQA 4HA6A 1VDCA 2GRTA 2WQYA 3I3LA 3NT6A 4U8LA 3SZ0A 3NHOX 1QO8A 4B65A 4Y4LA 3IF9A 3DK9A 2E1MA 4GDPA 1LV0A 4Z24A 4OPIA 2XFNA 4D04A 2YG6A 4U2LA 5HXIA 3HZLA 1CBOA 2FJBA 1NG3A 3QSSA 2E4GA 1MXTA 1NHSA 4CNKA 2DKHA 1O5WA 1H86A 3S5WA 2X3NA 1GERA 5GRTA 5KVHA 2Q6UA 2BC0A 1XDIA 3CNJA 1E39A 3ATRA 2QAEA 2YLRA 3AEEA 4OCGA 4TM0A 1Z6LA 3EAOA 3R9UA 2WOIA 3ALMA 4NTDA 2WDVA 2WPCA 3UP4A 4ICYA 2OLOA 2JB3A 2R4EA 1REOA 3KPKA 3NH3X 2R4JA 4K8DA 4Y4NA 1B5QA 3T31A 3RNMA 1K0LA 2AQJA 1OJ9A 4U8PA 2XLTA 3CIRA 1RP0A 3GDNA 4H2RA 1M6IA 1TDKA 1F8WA 1GETA 2B7SA 2YM2A 3GWFA 5EB4A 4U8JA 2JBVA 1FECA 3ITJA 3KD9A 5KMQA 1Y56B 3ALLA 4YSXA 1JOAA 1CF3A 3SM8A 1H83A 3AB1A 2NVKX 3L1RA 3SX6A 3VRDB 1F3PA 3ATQA 4BK2A 3C96A 3JSKA 3QSMA 2YLTA 4O5UA 2YLXA 3CNPA 2Q7VA 4MJWA 4FX9A 1DOEA 1IUSA 4J33A 4U8NA 3AYIA 2YLWA 2YG5A 1KFYA 3NYEA 4C74A 3RP8A 1MOKA 1CJ3A 4XXGA 5EBKA 3KKJA 1VRQB 3NLCA 3FBSA 1PXCA 2FJEA 2WP6A 3GMBA 3DMEA 2F5ZA 3DK8A 3AE9A 1NPXA 1X31B 3UOZA 1YY5A 4YXDA 3AE5A 2R9ZA 4IA5A 4J34A 2GV8A 4U2SA 4U8OA 1B37A 2V61A 3HYWA 3UTHA 1JNRA 1B4VA 1EBDA 1H7WA 4OPLA 1GT8A 1F8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6R A;  1ZP0 A;  1GRA A;  3CPH G;  5IPY A;  2C7G A;  1PBD A;  2JB1 A;  2R0P A;  4X9N A;  3I6D A;  1ONF A;  4B67 A;  1TDO A;  3T37 A;  2QCU A;  3V3O A;  1PJ7 A;  2BYB A;  4OPC A;  1Y56 A;  1FL2 A;  3AED A;  1CC4 A;  1V59 A;  1NG4 A;  4NZH A;  1S3B A;  4O5Q A;  3H4K A;  3AD7 B;  1FEB A;  3ZYX A;  2IVE A;  2WS3 A;  3NK0 X;  3EF6 A;  4A9W A;  2J3N A;  3CGC A;  2B9X A;  4EQX A;  2C76 A;  3GWD A;  4EQR A;  4H2Q A;  5BRT A;  4USR A;  4B63 A;  3DK4 A;  1CJ4 A;  4D03 A;  2FBW A;  3RHA A;  3PO7 A;  4M52 A;  4BV6 A;  3GMC A;  1PHH A;  4CCQ A;  4GCM A;  1YQ4 A;  4REK A;  3Q9T A;  4FK1 C;  4H7U A;  2YVJ A;  4J31 A;  1CHU A;  4LU6 A;  1Q1R A;  4EMW A;  3IHM A;  1SEZ A;  3RP7 A;  2C67 A;  2W0H A;  5IQ1 A;  3FG2 P;  3NGC X;  2Y6Q A;  1GES A;  2WPE A;  3F8R A;  4H50 A;  2XLS A;  1MO9 A;  2BCP A;  1KNP A;  3L8K A;  4CRT A;  3IC9 A;  5IQ4 A;  4AP3 A;  5KWF A;  1OJD A;  2GEW A;  3H8L A;  3K30 A;  2BS2 A;  2GQW A;  4A99 A;  2OAL A;  4C77 A;  2V6O A;  2YLZ A;  1ZX9 A;  1IUW A;  3GD4 A;  1E1N A;  4GR1 A;  3AE6 A;  3WE0 A;  1P2E A;  1DNC A;  2VQB A;  1PS9 A;  3OC4 A;  2B9Y A;  1H84 A;  2BC1 A;  1NEN A;  2A89 A;  3AD9 B;  1GXF A;  2V3A A;  4UDR A;  4H4W A;  3D8X A;  3Q6J A;  4N9X A;  1L0V A;  4P9S A;  1TYP A;  4LII A;  2GVC A;  4YTM A;  2WU5 A;  2GR1 A;  2V5Z A;  1NHQ A;  3UKL A;  3SFD A;  2V60 A;  1IUX A;  2BXS A;  2XDO A;  1PBE A;  2ZBW A;  3AEF A;  3NRN A;  1QJD A;  2TMD A;  1L9D A;  1H82 A;  1NAA A;  2Z5Y A;  4BJY A;  1EL9 A;  1XAN A;  2BAB A;  3DH9 A;  4C3X A;  3VRB A;  4APN A;  1O95 A;  2FJA A;  4PAA A;  3UKK A;  4LA1 A;  2Q0K A;  4EMJ A;  2Z5X A;  4YT0 A;  4OPG A;  1GV4 A;  4C5O A;  2XVI A;  3AE7 A;  1VG0 A;  3COX A;  3QVR A;  1DOC A;  4EM3 A;  2XVE A;  4H2N A;  5JCK A;  2BK5 A;  3FIM B;  1F6M A;  3P4P A;  3UOY A;  2B7R A;  1IUV A;  1OJA A;  4K5S A;  1N4W A;  1PN0 A;  3KA7 A;  3UKP A;  1ZK7 A;  1TDN A;  1LTX R;  3URH A;  3B6D A;  3LB8 A;  2JKC A;  2I0Z A;  3BI4 A;  4B69 A;  2H89 A;  3DJJ A;  4NTE A;  1D4D A;  5U63 A;  1B8S A;  4TM4 A;  2A87 A;  3DGH A;  4A65 A;  4IVM B;  3UTF A;  3P4S A;  1N4U A;  1NHR A;  4ZCD A;  3KPF A;  3OZ2 A;  1GPE A;  1ZY8 A;  3AXB A;  4H4Y A;  5KVI A;  2ACZ A;  5LV9 A;  1QLB A;  2GR0 A;  2WP9 A;  2XFO A;  3P1W A;  3AE1 A;  2DKI A;  4YSZ A;  2RGO A;  4WX1 A;  3GSI A;  1IUU A;  4YKF A;  3AWI A;  4PAB A;  4B1B A;  3NIX A;  3BNU A;  3LXD A;  1ELI A;  1D7L A;  2WOV A;  5CKU A;  3NK1 X;  4H4X A;  2VQ7 A;  3NG7 X;  2YG4 A;  4YTN A;  4ADW A;  1L9E A;  4AT0 A;  3BHK A;  4BJZ A;  4J2W A;  4U8M A;  3M12 A;  2EQ8 A;  3NTA A;  2XFU A;  3G5Q A;  1L9C A;  4CBQ A;  4H4V A;  2IVD A;  3BHF A;  1KF6 A;  4B66 A;  1BKW A;  3CND A;  2WDQ A;  4GRT A;  3F8P A;  2GR3 A;  1PJ5 A;  4OPU A;  1H81 A;  1GRH A;  5BVA A;  2JB2 A;  1GRT A;  2C65 A;  1KDG A;  1N4V A;  1Q9I A;  2TPR A;  2YM1 A;  4JNA A;  1AOG A;  4CCR A;  2C73 A;  4EIP A;  1YQZ A;  2YG3 A;  1ZDL A;  3GRT A;  3S61 A;  2VRL A;  4YTP A;  5C2T A;  4AOX A;  3UKQ A;  5C3J A;  2YWL A;  3AE8 A;  1W4X A;  4AOS A;  3LZX A;  4Z44 A;  5ER0 A;  2EQ9 A;  3LOV A;  3LZW A;  2R0C A;  1GND A;  1H6V A;  1JNZ A;  3UP5 A;  4CY8 A;  1BGJ A;  2GH5 A;  2ZZC A;  3UOV A;  1TDE A;  3DJE A;  2C64 A;  2OLN A;  3CGD A;  3CNS A;  3VRA A;  5J7X A;  2FJD A;  5U1O A;  1CJC A;  1RYI A;  1YQ3 A;  3BI5 A;  5JCI A;  3KLJ A;  1E1L A;  2ZZ0 A;  2XYO A;  1LVL A;  3DA1 A;  5TR3 A;  2XLR A;  4ZN0 A;  5FS7 A;  4H4Z A;  1EL5 A;  1Y0P A;  2C75 A;  1KSU A;  1XPQ A;  4ZCC A;  3P4Q A;  3VQR A;  3VR8 A;  1RSG A;  1DJQ A;  3II4 A;  1BWC A;  4IA6 A;  4A7A A;  1K0J A;  1PJ6 A;  3GRS A;  1PBF A;  3QSE A;  2E5V A;  5JCN A;  1D7Y A;  3RP6 A;  3FMW A;  2BS4 A;  3C4N A;  4OPT A;  4I58 A;  4J36 A;  3NN0 X;  2GR2 A;  2HQM A;  3QJ4 A;  3AEC A;  4WCT A;  1N1P A;  2BXR A;  4FDC B;  5KOW A;  1GSN A;  4JDR A;  4DGK A;  1LQU A;  4Z25 A;  2YR6 A;  3K7T A;  3NKS A;  4H4S A;  3SFE A;  5JCL A;  4H4P A;  4U8K A;  5KOX A;  1S3E A;  4RG3 A;  4ECH A;  1JRX A;  3SQP A;  1GRE A;  4J56 A;  1VQW A;  5KXJ A;  3B3R A;  4JY3 A;  2O9Z A;  1LQT A;  1ZKQ A;  2X8G A;  1UKV G;  1YKJ A;  1PDH A;  4KPR A;  2YVF A;  4YKG A;  2IID A;  4H2P A;  1NHP A;  1GTH A;  1TRB A;  3LJP A;  4OVI A;  2APG A;  1KNR A;  1D4C A;  4BK1 A;  2R0G A;  2C3D A;  2WP5 A;  3H8I A;  4H4Q A;  5DBJ A;  4BK3 A;  2C70 A;  3AEA A;  1D4E A;  1HYU A;  4XWZ A;  3ZDN A;  2XVH A;  2WDR A;  4U2T A;  3CPI G;  4X9M A;  4A6N A;  2BA9 A;  2YLS A;  4UP3 A;  4Z26 A;  1PXA A;  4TLZ A;  1VG9 A;  4I59 A;  5HHF A;  4K5R A;  2C72 A;  2V3B A;  1NEK A;  1TYT A;  4XWR A;  2XVF A;  3D1C A;  4C3Y A;  4NTC A;  4CNJ A;  3EPT A;  1CL0 A;  2AR8 A;  3RED A;  3UKF A;  2GAG B;  4TM3 A;  3QFB A;  2WET A;  1TDF A;  3GD3 A;  1DXL A;  1JU2 A;  1M64 A;  2ZZB A;  2RGH A;  3UTE A;  2RGJ A;  2GMJ A;  2JAE A;  2PHH A;  3SGL A;  4EMI A;  2R45 A;  3AE2 A;  2CUL A;  1O94 A;  3CGB A;  3M13 A;  2GF3 A;  4JQ9 A;  3ICT A;  5L46 A;  3KU9 A;  4TM1 A;  2XLP A;  2YVG A;  3AYL A;  3CN8 A;  2BCG G;  3ISH A;  2WBA A;  1BF3 A;  3PVC A;  4U8I A;  3CGE A;  1JRY A;  4RSL A;  4TLX A;  2BAC A;  4A5L A;  2CVJ A;  2YAU A;  3G5R A;  2X50 A;  4GDE A;  3PS9 A;  3ABV A;  2NPX A;  4OPD A;  1Q1W A;  2GMH A;  1E1M A;  1PBC A;  2JK6 A;  2X8C A;  3AEB A;  3NNE A;  4IVO B;  4FK1 A;  3VR9 A;  1E1K A;  4A79 A;  2PYX A;  2WU2 A;  4BUR A;  1H7X A;  4B64 A;  2ARD A;  2GQF A;  1GAL A;  3LAD A;  4Z2T A;  4IV9 A;  5M0Z A;  5BUK A;  4YSH A;  4UDP A;  1GEU A;  2EQ6 A;  4KX6 A;  2Q0L A;  4K7Z A;  4EM4 A;  1EL8 A;  3CTY A;  3GDP A;  3BNM A;  3M0O A;  3KVE A;  2GAH B;  1OJT A;  5FS8 A;  3IWA A;  3FPZ A;  3ALJ A;  3ICR A;  4HB9 A;  2QA2 A;  2YG7 A;  3AD8 B;  4Y4M A;  2YR4 A;  4GF7 A;  2WPF A;  1BGN A;  3GYJ A;  5J60 A;  5JCM A;  2XFQ A;  3AYJ A;  1BZL A;  4EQS A;  2XFP A;  3G5S A;  1GOS A;  4X4J A;  2AAQ A;  2VVM A;  4JY2 A;  1P2H A;  1LJ1 A;  1XHC A;  3QFA A;  5CQF A;  3E1T A;  3CNT A;  1GTE A;  4A6N B;  1ZMC A;  2B9W A;  1GRG A;  1OJC A;  1K4Q A;  3F8D A;  1ZOV A;  3NTD A;  1ZOY A;  2OA1 A;  1GRF A;  1CC6 A;  3NYC A;  4NEV A;  1E6E A;  2WOW A;  2WHD A;  4DSG A;  1FOH A;  2B76 A;  3K7M X;  3IHG A;  3DGZ A;  2VRM A;  4RG4 A;  1PBB A;  5GSN A;  4AP1 A;  5BUL A;  4JN9 A;  3UOX A;  2BS3 A;  1FEA A;  5FMH A;  2WEU A;  2XCG A;  5U25 A;  4DSH A;  1COY A;  3UKA A;  5FS6 A;  1F8R A;  1FCD A;  5M10 A;  3P4R A;  2GB0 A;  1KSS A;  2VVL A;  2WES A;  4K22 A;  2BK4 A;  3UTG A;  4H4T A;  2YQU A;  1S2Q A;  5HYM A;  1IJH A;  5EB5 A;  2BK3 A;  4Z2R A;  3K7Q X;  2YR5 A;  4GUV A;  4YSY A;  3ADA B;  1IUT A;  1JEH A;  4AT2 A;  3UCL A;  1DOD A;  2QA1 A;  1PXB A;  1S2Y A;  3NK2 X;  3C4A A;  2X99 A;  4UDQ A;  1JRZ A;  3AEG A;  1CJ2 A;  3V3N A;  2EQ7 A;  1DJN A;  2VZ2 A;  1NDA A;  3AE3 A;  4E0V A;  2C66 A;  3O0H A;  2VVL G;  2CFY A;  2X8H A;  4EQW A;  3CPJ G;  2H88 A;  3UKH A;  3NYF A;  1ZMD A;  2OAM A;  1DOB A;  3EAN A;  2XVJ A;  2VOU A;  4K2X A;  4CY6 A;  3P9U A;  4JNQ A;  4Z2U A;  5FS9 A;  3DJD A;  4B68 A;  2C3C A;  1D5T A;  2A8X A;  1K0I A;  4USQ A;  4H4U A;  1GRB A;  2RAB A;  3NN6 X;  4NEW A;  3DJG X;  3QVP A;  2UZZ A;  1E7P A;  2CDU A;  3AE4 A;  2R46 A;  5HY5 A;  4DNA A;  4J57 A;  1EL7 A;  1LPF A;  1CC2 A;  2XLU A;  3BI2 A;  3GYI A;  5EOW A;  3ICS A;  4H4R A;  4EIQ A;  4Z43 A;  3V76 A;  5KRQ A;  4HA6 A;  1VDC A;  2GRT A;  2WQY A;  3I3L A;  3NT6 A;  4U8L A;  3NHO X;  1QO8 A;  4B65 A;  4Y4L A;  3IF9 A;  3DK9 A;  2E1M A;  4GDP A;  1LV0 A;  4Z24 A;  4OPI A;  2XFN A;  4D04 A;  2YG6 A;  4U2L A;  5HXI A;  3HZL A;  1CBO A;  2FJB A;  1NG3 A;  3QSS A;  2E4G A;  1MXT A;  1NHS A;  4CNK A;  2DKH A;  1O5W A;  1H86 A;  3S5W A;  2X3N A;  1GER A;  5GRT A;  5KVH A;  2Q6U A;  2BC0 A;  1XDI A;  3CNJ A;  1E39 A;  3ATR A;  2QAE A;  2YLR A;  3AEE A;  4OCG A;  4TM0 A;  1Z6L A;  3EAO A;  3R9U A;  2WOI A;  3ALM A;  4NTD A;  2WDV A;  2WPC A;  3UP4 A;  4ICY A;  2OLO A;  2JB3 A;  2R4E A;  1REO A;  3NH3 X;  2R4J A;  4K8D A;  4Y4N A;  1B5Q A;  3RNM A;  1K0L A;  2AQJ A;  1OJ9 A;  4U8P A;  2XLT A;  3CIR A;  1RP0 A;  3GDN A;  4H2R A;  1M6I A;  1TDK A;  1F8W A;  1GET A;  2B7S A;  2YM2 A;  3GWF A;  5EB4 A;  4U8J A;  2JBV A;  1FEC A;  3ITJ A;  3KD9 A;  1Y56 B;  3ALL A;  4YSX A;  1JOA A;  1CF3 A;  3SM8 A;  1H83 A;  3AB1 A;  2NVK X;  3L1R A;  3VRD B;  1F3P A;  3ATQ A;  4BK2 A;  3C96 A;  3JSK A;  3QSM A;  2YLT A;  4O5U A;  2YLX A;  3CNP A;  2Q7V A;  4MJW A;  4FX9 A;  1DOE A;  1IUS A;  4J33 A;  4U8N A;  3AYI A;  2YLW A;  2YG5 A;  1KFY A;  3NYE A;  4C74 A;  3RP8 A;  1MOK A;  1CJ3 A;  4XXG A;  5EBK A;  3KKJ A;  1VRQ B;  3NLC A;  3FBS A;  1PXC A;  2FJE A;  2WP6 A;  3GMB A;  3DME A;  2F5Z A;  3DK8 A;  3AE9 A;  1NPX A;  1X31 B;  3UOZ A;  1YY5 A;  4YXD A;  3AE5 A;  2R9Z A;  4IA5 A;  4J34 A;  2GV8 A;  4U2S A;  4U8O A;  1B37 A;  2V61 A;  4YWO A;  3UTH A;  1JNR A;  1B4V A;  1EBD A;  1H7W A;  4OPL A;  1GT8 A;  1F8S A; 
#chains in the Genus database with same CATH topology
 2Y6R A;  1ZP0 A;  1GRA A;  3CPH G;  5IPY A;  2C7G A;  1PBD A;  2JB1 A;  2R0P A;  4X9N A;  3I6D A;  1ONF A;  3SYI A;  4B67 A;  1TDO A;  3T37 A;  2QCU A;  3V3O A;  1PJ7 A;  2BYB A;  4OPC A;  1Y56 A;  1FL2 A;  3AED A;  1CC4 A;  1V59 A;  1NG4 A;  4NZH A;  1S3B A;  4O5Q A;  3SZF A;  3H4K A;  3SZC A;  3AD7 B;  1FEB A;  3ZYX A;  2IVE A;  2WS3 A;  3NK0 X;  3EF6 A;  4A9W A;  2J3N A;  5KMR A;  3CGC A;  2B9X A;  4EQX A;  2C76 A;  3GWD A;  4EQR A;  4H2Q A;  5BRT A;  4USR A;  4B63 A;  3DK4 A;  1CJ4 A;  4D03 A;  2FBW A;  3RHA A;  3PO7 A;  4M52 A;  4BV6 A;  3GMC A;  1PHH A;  4CCQ A;  4GCM A;  1YQ4 A;  4REK A;  3Q9T A;  4G6G A;  4FK1 C;  4H7U A;  2YVJ A;  4J31 A;  1CHU A;  4LU6 A;  1Q1R A;  4EMW A;  3IHM A;  1SEZ A;  3RP7 A;  2C67 A;  2W0H A;  5IQ1 A;  3FG2 P;  3NGC X;  3T14 A;  2Y6Q A;  1GES A;  2WPE A;  3F8R A;  4H50 A;  2XLS A;  4G74 A;  1MO9 A;  4GAP A;  2BCP A;  1KNP A;  3L8K A;  4CRT A;  3IC9 A;  5IQ4 A;  4AP3 A;  5KWF A;  1OJD A;  2GEW A;  3H8L A;  3K30 A;  2BS2 A;  2GQW A;  4A99 A;  2OAL A;  4C77 A;  2V6O A;  2YLZ A;  1ZX9 A;  1IUW A;  3GD4 A;  1E1N A;  4GR1 A;  3AE6 A;  3WE0 A;  1P2E A;  1DNC A;  2VQB A;  1PS9 A;  3OC4 A;  2B9Y A;  1H84 A;  2BC1 A;  1NEN A;  2A89 A;  3AD9 B;  1GXF A;  2V3A A;  4UDR A;  4H4W A;  3D8X A;  3Q6J A;  4N9X A;  1L0V A;  4P9S A;  1TYP A;  4LII A;  2GVC A;  3HYX A;  4YTM A;  2WU5 A;  2GR1 A;  2V5Z A;  1NHQ A;  3UKL A;  3SFD A;  2V60 A;  1IUX A;  2BXS A;  2XDO A;  1PBE A;  2ZBW A;  3AEF A;  3NRN A;  1QJD A;  2TMD A;  1L9D A;  1H82 A;  2BRY A;  1NAA A;  2Z5Y A;  4BJY A;  1EL9 A;  1XAN A;  2BAB A;  3DH9 A;  4C3X A;  3VRB A;  4APN A;  1O95 A;  2FJA A;  4PAA A;  3UKK A;  4LA1 A;  2Q0K A;  4EMJ A;  2Z5X A;  5KMS A;  4YT0 A;  4OPG A;  1GV4 A;  4C5O A;  2XVI A;  3AE7 A;  1VG0 A;  3COX A;  3QVR A;  1DOC A;  4EM3 A;  2XVE A;  4H2N A;  5JCK A;  2BK5 A;  3FIM B;  1F6M A;  3P4P A;  3UOY A;  2B7R A;  1IUV A;  1OJA A;  4K5S A;  3CMM A;  1N4W A;  4II2 A;  1PN0 A;  3KA7 A;  3UKP A;  1ZK7 A;  1TDN A;  1LTX R;  3URH A;  3B6D A;  3LB8 A;  2JKC A;  2I0Z A;  3BI4 A;  4B69 A;  2H89 A;  3DJJ A;  4NTE A;  1D4D A;  5U63 A;  1B8S A;  4TM4 A;  2A87 A;  3DGH A;  4A65 A;  4IVM B;  3UTF A;  3P4S A;  1N4U A;  1NHR A;  4ZCD A;  3KPF A;  3OZ2 A;  1GPE A;  1ZY8 A;  3AXB A;  4H4Y A;  5KVI A;  2ACZ A;  5LV9 A;  1QLB A;  2GR0 A;  2WP9 A;  2XFO A;  3P1W A;  3AE1 A;  2DKI A;  4YSZ A;  2RGO A;  4WX1 A;  3GSI A;  1IUU A;  4YKF A;  3AWI A;  4PAB A;  4B1B A;  3NIX A;  3BNU A;  3LXD A;  1ELI A;  1D7L A;  2WOV A;  5CKU A;  3NK1 X;  4H4X A;  2VQ7 A;  3NG7 X;  2YG4 A;  3HYV A;  4YTN A;  4ADW A;  1L9E A;  4AT0 A;  3BHK A;  4BJZ A;  4J2W A;  4U8M A;  3M12 A;  2EQ8 A;  3NTA A;  2XFU A;  3G5Q A;  1L9C A;  4CBQ A;  4GAV A;  4H4V A;  3BHF A;  2IVD A;  1KF6 A;  4B66 A;  1BKW A;  3CND A;  2WDQ A;  4GRT A;  3F8P A;  2GR3 A;  1PJ5 A;  4OPU A;  1H81 A;  1GRH A;  5BVA A;  2JB2 A;  1GRT A;  2C65 A;  1KDG A;  1N4V A;  1Q9I A;  2TPR A;  2YM1 A;  4JNA A;  1AOG A;  4CCR A;  2C73 A;  4EIP A;  1YQZ A;  2YG3 A;  1ZDL A;  3GRT A;  3S61 A;  2VRL A;  4YTP A;  5C2T A;  4AOX A;  3UKQ A;  5C3J A;  2YWL A;  3AE8 A;  1W4X A;  4AOS A;  3LZX A;  4Z44 A;  5ER0 A;  2EQ9 A;  3LOV A;  3LZW A;  2R0C A;  1GND A;  1H6V A;  1JNZ A;  3GYX A;  3SZW A;  3UP5 A;  4CY8 A;  1BGJ A;  2GH5 A;  2ZZC A;  3UOV A;  1TDE A;  3DJE A;  2C64 A;  2OLN A;  3CGD A;  3CNS A;  3VRA A;  5J7X A;  2FJD A;  5U1O A;  1CJC A;  1RYI A;  1YQ3 A;  3BI5 A;  5JCI A;  3KLJ A;  1E1L A;  2ZZ0 A;  2XYO A;  1LVL A;  3DA1 A;  5TR3 A;  2XLR A;  4ZN0 A;  5FS7 A;  4H4Z A;  1EL5 A;  1Y0P A;  2C75 A;  1KSU A;  1XPQ A;  4ZCC A;  3P4Q A;  3VQR A;  3VR8 A;  4Z43 A;  1RSG A;  1DJQ A;  3II4 A;  1BWC A;  4IA6 A;  4A7A A;  1K0J A;  1PJ6 A;  3GRS A;  1PBF A;  3QSE A;  2E5V A;  5JCN A;  1D7Y A;  3RP6 A;  3FMW A;  2BS4 A;  3C4N A;  4OPT A;  4I58 A;  4J36 A;  3NN0 X;  2GR2 A;  2HQM A;  3QJ4 A;  3AEC A;  4WCT A;  1N1P A;  2BXR A;  4FDC B;  5KOW A;  1GSN A;  4JDR A;  4DGK A;  1LQU A;  4Z25 A;  2YR6 A;  3K7T A;  3NKS A;  4H4S A;  3SFE A;  4G9K A;  4H4P A;  4U8K A;  5JCL A;  1S3E A;  5KOX A;  4RG3 A;  4ECH A;  1JRX A;  3SQP A;  1GRE A;  4J56 A;  1VQW A;  5KXJ A;  3B3R A;  4JY3 A;  2O9Z A;  1LQT A;  1ZKQ A;  2X8G A;  1UKV G;  1YKJ A;  1PDH A;  4KPR A;  2YVF A;  4YKG A;  2IID A;  4H2P A;  1NHP A;  1GTH A;  1TRB A;  3LJP A;  4OVI A;  2APG A;  1KNR A;  1D4C A;  4BK1 A;  2R0G A;  2C3D A;  2WP5 A;  3H8I A;  4H4Q A;  5DBJ A;  4BK3 A;  2C70 A;  3AEA A;  1D4E A;  1HYU A;  4XWZ A;  3ZDN A;  2XVH A;  2WDR A;  4U2T A;  3CPI G;  4X9M A;  4A6N A;  2BA9 A;  2YLS A;  4UP3 A;  4Z26 A;  1PXA A;  4TLZ A;  1VG9 A;  4I59 A;  5HHF A;  4K5R A;  4NNJ A;  2C72 A;  2V3B A;  1NEK A;  1TYT A;  4XWR A;  2XVF A;  3D1C A;  4C3Y A;  4NTC A;  4CNJ A;  3EPT A;  1CL0 A;  2AR8 A;  3RED A;  3UKF A;  2GAG B;  4TM3 A;  3QFB A;  2WET A;  1TDF A;  3GD3 A;  3T0K A;  1DXL A;  1JU2 A;  1M64 A;  2ZZB A;  2RGH A;  3UTE A;  2RGJ A;  2GMJ A;  2JAE A;  2PHH A;  3SGL A;  4EMI A;  2R45 A;  3AE2 A;  2CUL A;  1O94 A;  3CGB A;  3M13 A;  2GF3 A;  4JQ9 A;  3ICT A;  5L46 A;  3KU9 A;  4TM1 A;  2XLP A;  2YVG A;  3AYL A;  3CN8 A;  2BCG G;  3ISH A;  2WBA A;  1BF3 A;  3PVC A;  4U8I A;  3CGE A;  1JRY A;  4RSL A;  4TLX A;  2BAC A;  4A5L A;  2CVJ A;  2YAU A;  3G5R A;  2X50 A;  4GDE A;  3PS9 A;  3ABV A;  2NPX A;  4OPD A;  1Q1W A;  2GMH A;  4YWO A;  1E1M A;  1PBC A;  2JK6 A;  2X8C A;  2BRA A;  3AEB A;  3NNE A;  4FK1 A;  4IVO B;  3VR9 A;  1E1K A;  4A79 A;  2PYX A;  2WU2 A;  4BUR A;  1H7X A;  4B64 A;  3SY4 A;  2ARD A;  2GQF A;  1GAL A;  3LAD A;  4Z2T A;  4IV9 A;  5M0Z A;  5BUK A;  4YSH A;  4UDP A;  1GEU A;  2EQ6 A;  4KX6 A;  5KNL A;  2Q0L A;  4K7Z A;  4EM4 A;  1EL8 A;  3CTY A;  3GDP A;  3BNM A;  3M0O A;  3KVE A;  2GAH B;  1OJT A;  5FS8 A;  3IWA A;  3FPZ A;  3ALJ A;  3ICR A;  4HB9 A;  5KMP A;  2QA2 A;  2YG7 A;  3AD8 B;  4Y4M A;  3T2Y A;  3T2K A;  2YR4 A;  4GF7 A;  2WPF A;  1BGN A;  3GYJ A;  5J60 A;  5JCM A;  2XFQ A;  3AYJ A;  1BZL A;  4EQS A;  2XFP A;  3G5S A;  1GOS A;  4X4J A;  2AAQ A;  2VVM A;  4JY2 A;  1P2H A;  1LJ1 A;  1XHC A;  3QFA A;  5CQF A;  3E1T A;  3CNT A;  1GTE A;  4A6N B;  1ZMC A;  2B9W A;  1GRG A;  1OJC A;  1K4Q A;  3F8D A;  1ZOV A;  3NTD A;  1ZOY A;  2OA1 A;  1GRF A;  1CC6 A;  3NYC A;  4NEV A;  1E6E A;  2WOW A;  2WHD A;  4DSG A;  1FOH A;  2B76 A;  3K7M X;  3IHG A;  3DGZ A;  2VRM A;  4RG4 A;  1PBB A;  5GSN A;  4AP1 A;  5BUL A;  4JN9 A;  3UOX A;  2BS3 A;  1FEA A;  4G6H A;  5FMH A;  2C4C A;  2WEU A;  2XCG A;  5U25 A;  3SXI A;  4DSH A;  3T2Z A;  1COY A;  3UKA A;  5FS6 A;  1F8R A;  1FCD A;  5M10 A;  3P4R A;  2GB0 A;  1KSS A;  2VVL A;  2WES A;  4K22 A;  2BK4 A;  3UTG A;  4H4T A;  2YQU A;  1S2Q A;  5HYM A;  1IJH A;  5EB5 A;  2BK3 A;  4Z2R A;  3K7Q X;  2YR5 A;  4GUV A;  4YSY A;  3ADA B;  1IUT A;  1JEH A;  4AT2 A;  3UCL A;  4II3 A;  1DOD A;  2QA1 A;  1PXB A;  1S2Y A;  3NK2 X;  3C4A A;  2X99 A;  4UDQ A;  1JRZ A;  3AEG A;  1CJ2 A;  3V3N A;  2EQ7 A;  1DJN A;  2VZ2 A;  1NDA A;  3AE3 A;  4E0V A;  2C66 A;  3O0H A;  2VVL G;  2CFY A;  2X8H A;  4EQW A;  3CPJ G;  2H88 A;  3UKH A;  3NYF A;  1ZMD A;  2OAM A;  1DOB A;  4NWZ A;  3EAN A;  2XVJ A;  2VOU A;  4K2X A;  4CY6 A;  3P9U A;  4JNQ A;  4Z2U A;  5FS9 A;  3DJD A;  4B68 A;  2C3C A;  1D5T A;  2A8X A;  1K0I A;  4USQ A;  4H4U A;  1GRB A;  2RAB A;  3NN6 X;  4NEW A;  3DJG X;  3QVP A;  2UZZ A;  1E7P A;  2CDU A;  3AE4 A;  2R46 A;  5HY5 A;  4DNA A;  4J57 A;  1EL7 A;  1LPF A;  1CC2 A;  2XLU A;  3BI2 A;  3GYI A;  4G73 A;  3ICS A;  4H4R A;  5EOW A;  4EIQ A;  3V76 A;  5KRQ A;  4HA6 A;  1VDC A;  2GRT A;  2WQY A;  3I3L A;  3NT6 A;  4U8L A;  3SZ0 A;  3NHO X;  1QO8 A;  4B65 A;  4Y4L A;  3IF9 A;  3DK9 A;  2E1M A;  4GDP A;  1LV0 A;  4Z24 A;  4OPI A;  2XFN A;  4D04 A;  2YG6 A;  4U2L A;  5HXI A;  3HZL A;  1CBO A;  2FJB A;  1NG3 A;  3QSS A;  2E4G A;  1MXT A;  1NHS A;  4CNK A;  2DKH A;  1O5W A;  1H86 A;  3S5W A;  2X3N A;  1GER A;  5GRT A;  5KVH A;  2Q6U A;  2BC0 A;  1XDI A;  3CNJ A;  1E39 A;  3ATR A;  2QAE A;  2YLR A;  3AEE A;  4OCG A;  4TM0 A;  1Z6L A;  3EAO A;  3R9U A;  2WOI A;  3ALM A;  4NTD A;  2WDV A;  2WPC A;  3UP4 A;  4ICY A;  2OLO A;  2JB3 A;  2R4E A;  1REO A;  3KPK A;  3NH3 X;  2R4J A;  4K8D A;  4Y4N A;  1B5Q A;  3T31 A;  3RNM A;  1K0L A;  2AQJ A;  1OJ9 A;  4U8P A;  2XLT A;  3CIR A;  1RP0 A;  3GDN A;  4H2R A;  1M6I A;  1TDK A;  1F8W A;  1GET A;  2B7S A;  2YM2 A;  3GWF A;  5EB4 A;  4U8J A;  2JBV A;  1FEC A;  3ITJ A;  3KD9 A;  5KMQ A;  1Y56 B;  3ALL A;  4YSX A;  1JOA A;  1CF3 A;  3SM8 A;  1H83 A;  3AB1 A;  2NVK X;  3L1R A;  3SX6 A;  3VRD B;  1F3P A;  3ATQ A;  4BK2 A;  3C96 A;  3JSK A;  3QSM A;  2YLT A;  4O5U A;  2YLX A;  3CNP A;  2Q7V A;  4MJW A;  4FX9 A;  1DOE A;  1IUS A;  4J33 A;  4U8N A;  3AYI A;  2YLW A;  2YG5 A;  1KFY A;  3NYE A;  4C74 A;  3RP8 A;  1MOK A;  1CJ3 A;  4XXG A;  5EBK A;  3KKJ A;  1VRQ B;  3NLC A;  3FBS A;  1PXC A;  2FJE A;  2WP6 A;  3GMB A;  3DME A;  2F5Z A;  3DK8 A;  3AE9 A;  1NPX A;  1X31 B;  3UOZ A;  1YY5 A;  4YXD A;  3AE5 A;  2R9Z A;  4IA5 A;  4J34 A;  2GV8 A;  4U2S A;  4U8O A;  1B37 A;  2V61 A;  3HYW A;  3UTH A;  1JNR A;  1B4V A;  1EBD A;  1H7W A;  4OPL A;  1GT8 A;  1F8S A; 
#chains in the Genus database with same CATH homology
 2Y6R A;  1ZP0 A;  1GRA A;  3CPH G;  5IPY A;  2C7G A;  1PBD A;  2JB1 A;  2R0P A;  4X9N A;  3I6D A;  1ONF A;  3SYI A;  4B67 A;  1TDO A;  3T37 A;  2QCU A;  3V3O A;  1PJ7 A;  2BYB A;  4OPC A;  1Y56 A;  1FL2 A;  3AED A;  1CC4 A;  1V59 A;  1NG4 A;  4NZH A;  1S3B A;  4O5Q A;  3SZF A;  3H4K A;  3SZC A;  3AD7 B;  1FEB A;  3ZYX A;  2IVE A;  2WS3 A;  3NK0 X;  3EF6 A;  4A9W A;  2J3N A;  5KMR A;  3CGC A;  2B9X A;  4EQX A;  2C76 A;  3GWD A;  4EQR A;  4H2Q A;  5BRT A;  4USR A;  4B63 A;  3DK4 A;  1CJ4 A;  4D03 A;  2FBW A;  3RHA A;  3PO7 A;  4M52 A;  4BV6 A;  3GMC A;  1PHH A;  4CCQ A;  4GCM A;  1YQ4 A;  4REK A;  3Q9T A;  4G6G A;  4FK1 C;  4H7U A;  2YVJ A;  4J31 A;  1CHU A;  4LU6 A;  1Q1R A;  4EMW A;  3IHM A;  1SEZ A;  3RP7 A;  2C67 A;  2W0H A;  5IQ1 A;  3FG2 P;  3NGC X;  3T14 A;  2Y6Q A;  1GES A;  2WPE A;  3F8R A;  4H50 A;  2XLS A;  4G74 A;  1MO9 A;  4GAP A;  2BCP A;  1KNP A;  3L8K A;  4CRT A;  3IC9 A;  5IQ4 A;  4AP3 A;  5KWF A;  1OJD A;  2GEW A;  3H8L A;  3K30 A;  2BS2 A;  2GQW A;  4A99 A;  2OAL A;  4C77 A;  2V6O A;  2YLZ A;  1ZX9 A;  1IUW A;  3GD4 A;  1E1N A;  4GR1 A;  3AE6 A;  3WE0 A;  1P2E A;  1DNC A;  2VQB A;  1PS9 A;  3OC4 A;  2B9Y A;  1H84 A;  2BC1 A;  1NEN A;  2A89 A;  3AD9 B;  1GXF A;  2V3A A;  4UDR A;  4H4W A;  3D8X A;  3Q6J A;  4N9X A;  1L0V A;  4P9S A;  1TYP A;  4LII A;  2GVC A;  3HYX A;  4YTM A;  2WU5 A;  2GR1 A;  2V5Z A;  1NHQ A;  3UKL A;  3SFD A;  2V60 A;  1IUX A;  2BXS A;  2XDO A;  1PBE A;  2ZBW A;  3AEF A;  3NRN A;  1QJD A;  2TMD A;  1L9D A;  1H82 A;  2BRY A;  1NAA A;  2Z5Y A;  4BJY A;  1EL9 A;  1XAN A;  2BAB A;  3DH9 A;  4C3X A;  3VRB A;  4APN A;  1O95 A;  2FJA A;  4PAA A;  3UKK A;  4LA1 A;  2Q0K A;  4EMJ A;  2Z5X A;  5KMS A;  4YT0 A;  4OPG A;  1GV4 A;  4C5O A;  2XVI A;  3AE7 A;  1VG0 A;  3COX A;  3QVR A;  1DOC A;  4EM3 A;  2XVE A;  4H2N A;  5JCK A;  2BK5 A;  3FIM B;  1F6M A;  3P4P A;  3UOY A;  2B7R A;  1IUV A;  1OJA A;  4K5S A;  3CMM A;  1N4W A;  4II2 A;  1PN0 A;  3KA7 A;  3UKP A;  1ZK7 A;  1TDN A;  1LTX R;  3URH A;  3B6D A;  3LB8 A;  2JKC A;  2I0Z A;  3BI4 A;  4B69 A;  2H89 A;  3DJJ A;  4NTE A;  1D4D A;  5U63 A;  1B8S A;  4TM4 A;  2A87 A;  3DGH A;  4A65 A;  4IVM B;  3UTF A;  3P4S A;  1N4U A;  1NHR A;  4ZCD A;  3KPF A;  3OZ2 A;  1GPE A;  1ZY8 A;  3AXB A;  4H4Y A;  5KVI A;  2ACZ A;  5LV9 A;  1QLB A;  2GR0 A;  2WP9 A;  2XFO A;  3P1W A;  3AE1 A;  2DKI A;  4YSZ A;  2RGO A;  4WX1 A;  3GSI A;  1IUU A;  4YKF A;  3AWI A;  4PAB A;  4B1B A;  3NIX A;  3BNU A;  3LXD A;  1ELI A;  1D7L A;  2WOV A;  5CKU A;  3NK1 X;  4H4X A;  2VQ7 A;  3NG7 X;  2YG4 A;  3HYV A;  4YTN A;  4ADW A;  1L9E A;  4AT0 A;  3BHK A;  4BJZ A;  4J2W A;  4U8M A;  3M12 A;  2EQ8 A;  3NTA A;  2XFU A;  3G5Q A;  1L9C A;  4CBQ A;  4GAV A;  4H4V A;  3BHF A;  2IVD A;  1KF6 A;  4B66 A;  1BKW A;  3CND A;  2WDQ A;  4GRT A;  3F8P A;  2GR3 A;  1PJ5 A;  4OPU A;  1H81 A;  1GRH A;  5BVA A;  2JB2 A;  1GRT A;  2C65 A;  1KDG A;  1N4V A;  1Q9I A;  2TPR A;  2YM1 A;  4JNA A;  1AOG A;  4CCR A;  2C73 A;  4EIP A;  1YQZ A;  2YG3 A;  1ZDL A;  3GRT A;  3S61 A;  2VRL A;  4YTP A;  5C2T A;  4AOX A;  3UKQ A;  5C3J A;  2YWL A;  3AE8 A;  1W4X A;  4AOS A;  3LZX A;  4Z44 A;  5ER0 A;  2EQ9 A;  3LOV A;  3LZW A;  2R0C A;  1GND A;  1H6V A;  1JNZ A;  3GYX A;  3SZW A;  3UP5 A;  4CY8 A;  1BGJ A;  2GH5 A;  2ZZC A;  3UOV A;  1TDE A;  3DJE A;  2C64 A;  2OLN A;  3CGD A;  3CNS A;  3VRA A;  5J7X A;  2FJD A;  5U1O A;  1CJC A;  1RYI A;  1YQ3 A;  3BI5 A;  5JCI A;  3KLJ A;  1E1L A;  2ZZ0 A;  2XYO A;  1LVL A;  3DA1 A;  5TR3 A;  2XLR A;  4ZN0 A;  5FS7 A;  4H4Z A;  1EL5 A;  1Y0P A;  2C75 A;  1KSU A;  1XPQ A;  4ZCC A;  3P4Q A;  3VQR A;  3VR8 A;  4Z43 A;  1RSG A;  1DJQ A;  3II4 A;  1BWC A;  4IA6 A;  4A7A A;  1K0J A;  1PJ6 A;  3GRS A;  1PBF A;  3QSE A;  2E5V A;  5JCN A;  1D7Y A;  3RP6 A;  3FMW A;  2BS4 A;  3C4N A;  4OPT A;  4I58 A;  4J36 A;  3NN0 X;  2GR2 A;  2HQM A;  3QJ4 A;  3AEC A;  4WCT A;  1N1P A;  2BXR A;  4FDC B;  5KOW A;  1GSN A;  4JDR A;  4DGK A;  1LQU A;  4Z25 A;  2YR6 A;  3K7T A;  3NKS A;  4H4S A;  3SFE A;  4G9K A;  4H4P A;  4U8K A;  5JCL A;  1S3E A;  5KOX A;  4RG3 A;  4ECH A;  1JRX A;  3SQP A;  1GRE A;  4J56 A;  1VQW A;  5KXJ A;  3B3R A;  4JY3 A;  2O9Z A;  1LQT A;  1ZKQ A;  2X8G A;  1UKV G;  1YKJ A;  1PDH A;  4KPR A;  2YVF A;  4YKG A;  2IID A;  4H2P A;  1NHP A;  1GTH A;  1TRB A;  3LJP A;  4OVI A;  2APG A;  1KNR A;  1D4C A;  4BK1 A;  2R0G A;  2C3D A;  2WP5 A;  3H8I A;  4H4Q A;  5DBJ A;  4BK3 A;  2C70 A;  3AEA A;  1D4E A;  1HYU A;  4XWZ A;  3ZDN A;  2XVH A;  2WDR A;  4U2T A;  3CPI G;  4X9M A;  4A6N A;  2BA9 A;  2YLS A;  4UP3 A;  4Z26 A;  1PXA A;  4TLZ A;  1VG9 A;  4I59 A;  5HHF A;  4K5R A;  4NNJ A;  2C72 A;  2V3B A;  1NEK A;  1TYT A;  4XWR A;  2XVF A;  3D1C A;  4C3Y A;  4NTC A;  4CNJ A;  3EPT A;  1CL0 A;  2AR8 A;  3RED A;  3UKF A;  2GAG B;  4TM3 A;  3QFB A;  2WET A;  1TDF A;  3GD3 A;  3T0K A;  1DXL A;  1JU2 A;  1M64 A;  2ZZB A;  2RGH A;  3UTE A;  2RGJ A;  2GMJ A;  2JAE A;  2PHH A;  3SGL A;  4EMI A;  2R45 A;  3AE2 A;  2CUL A;  1O94 A;  3CGB A;  3M13 A;  2GF3 A;  4JQ9 A;  3ICT A;  5L46 A;  3KU9 A;  4TM1 A;  2XLP A;  2YVG A;  3AYL A;  3CN8 A;  2BCG G;  3ISH A;  2WBA A;  1BF3 A;  3PVC A;  4U8I A;  3CGE A;  1JRY A;  4RSL A;  4TLX A;  2BAC A;  4A5L A;  2CVJ A;  2YAU A;  3G5R A;  2X50 A;  4GDE A;  3PS9 A;  3ABV A;  2NPX A;  4OPD A;  1Q1W A;  2GMH A;  4YWO A;  1E1M A;  1PBC A;  2JK6 A;  2X8C A;  2BRA A;  3AEB A;  3NNE A;  4FK1 A;  4IVO B;  3VR9 A;  1E1K A;  4A79 A;  2PYX A;  2WU2 A;  4BUR A;  1H7X A;  4B64 A;  3SY4 A;  2ARD A;  2GQF A;  1GAL A;  3LAD A;  4Z2T A;  4IV9 A;  5M0Z A;  5BUK A;  4YSH A;  4UDP A;  1GEU A;  2EQ6 A;  4KX6 A;  5KNL A;  2Q0L A;  4K7Z A;  4EM4 A;  1EL8 A;  3CTY A;  3GDP A;  3BNM A;  3M0O A;  3KVE A;  2GAH B;  1OJT A;  5FS8 A;  3IWA A;  3FPZ A;  3ALJ A;  3ICR A;  4HB9 A;  5KMP A;  2QA2 A;  2YG7 A;  3AD8 B;  4Y4M A;  3T2Y A;  3T2K A;  2YR4 A;  4GF7 A;  2WPF A;  1BGN A;  3GYJ A;  5J60 A;  5JCM A;  2XFQ A;  3AYJ A;  1BZL A;  4EQS A;  2XFP A;  3G5S A;  1GOS A;  4X4J A;  2AAQ A;  2VVM A;  4JY2 A;  1P2H A;  1LJ1 A;  1XHC A;  3QFA A;  5CQF A;  3E1T A;  3CNT A;  1GTE A;  4A6N B;  1ZMC A;  2B9W A;  1GRG A;  1OJC A;  1K4Q A;  3F8D A;  1ZOV A;  3NTD A;  1ZOY A;  2OA1 A;  1GRF A;  1CC6 A;  3NYC A;  4NEV A;  1E6E A;  2WOW A;  2WHD A;  4DSG A;  1FOH A;  2B76 A;  3K7M X;  3IHG A;  3DGZ A;  2VRM A;  4RG4 A;  1PBB A;  5GSN A;  4AP1 A;  5BUL A;  4JN9 A;  3UOX A;  2BS3 A;  1FEA A;  4G6H A;  5FMH A;  2C4C A;  2WEU A;  2XCG A;  5U25 A;  3SXI A;  4DSH A;  3T2Z A;  1COY A;  3UKA A;  5FS6 A;  1F8R A;  1FCD A;  5M10 A;  3P4R A;  2GB0 A;  1KSS A;  2VVL A;  2WES A;  4K22 A;  2BK4 A;  3UTG A;  4H4T A;  2YQU A;  1S2Q A;  5HYM A;  1IJH A;  5EB5 A;  2BK3 A;  4Z2R A;  3K7Q X;  2YR5 A;  4GUV A;  4YSY A;  3ADA B;  1IUT A;  1JEH A;  4AT2 A;  3UCL A;  4II3 A;  1DOD A;  2QA1 A;  1PXB A;  1S2Y A;  3NK2 X;  3C4A A;  2X99 A;  4UDQ A;  1JRZ A;  3AEG A;  1CJ2 A;  3V3N A;  2EQ7 A;  1DJN A;  2VZ2 A;  1NDA A;  3AE3 A;  4E0V A;  2C66 A;  3O0H A;  2VVL G;  2CFY A;  2X8H A;  4EQW A;  3CPJ G;  2H88 A;  3UKH A;  3NYF A;  1ZMD A;  2OAM A;  1DOB A;  4NWZ A;  3EAN A;  2XVJ A;  2VOU A;  4K2X A;  4CY6 A;  3P9U A;  4JNQ A;  4Z2U A;  5FS9 A;  3DJD A;  4B68 A;  2C3C A;  1D5T A;  2A8X A;  1K0I A;  4USQ A;  4H4U A;  1GRB A;  2RAB A;  3NN6 X;  4NEW A;  3DJG X;  3QVP A;  2UZZ A;  1E7P A;  2CDU A;  3AE4 A;  2R46 A;  5HY5 A;  4DNA A;  4J57 A;  1EL7 A;  1LPF A;  1CC2 A;  2XLU A;  3BI2 A;  3GYI A;  4G73 A;  3ICS A;  4H4R A;  5EOW A;  4EIQ A;  3V76 A;  5KRQ A;  4HA6 A;  1VDC A;  2GRT A;  2WQY A;  3I3L A;  3NT6 A;  4U8L A;  3SZ0 A;  3NHO X;  1QO8 A;  4B65 A;  4Y4L A;  3IF9 A;  3DK9 A;  2E1M A;  4GDP A;  1LV0 A;  4Z24 A;  4OPI A;  2XFN A;  4D04 A;  2YG6 A;  4U2L A;  5HXI A;  3HZL A;  1CBO A;  2FJB A;  1NG3 A;  3QSS A;  2E4G A;  1MXT A;  1NHS A;  4CNK A;  2DKH A;  1O5W A;  1H86 A;  3S5W A;  2X3N A;  1GER A;  5GRT A;  5KVH A;  2Q6U A;  2BC0 A;  1XDI A;  3CNJ A;  1E39 A;  3ATR A;  2QAE A;  2YLR A;  3AEE A;  4OCG A;  4TM0 A;  1Z6L A;  3EAO A;  3R9U A;  2WOI A;  3ALM A;  4NTD A;  2WDV A;  2WPC A;  3UP4 A;  4ICY A;  2OLO A;  2JB3 A;  2R4E A;  1REO A;  3KPK A;  3NH3 X;  2R4J A;  4K8D A;  4Y4N A;  1B5Q A;  3T31 A;  3RNM A;  1K0L A;  2AQJ A;  1OJ9 A;  4U8P A;  2XLT A;  3CIR A;  1RP0 A;  3GDN A;  4H2R A;  1M6I A;  1TDK A;  1F8W A;  1GET A;  2B7S A;  2YM2 A;  3GWF A;  5EB4 A;  4U8J A;  2JBV A;  1FEC A;  3ITJ A;  3KD9 A;  5KMQ A;  1Y56 B;  3ALL A;  4YSX A;  1JOA A;  1CF3 A;  3SM8 A;  1H83 A;  3AB1 A;  2NVK X;  3L1R A;  3SX6 A;  3VRD B;  1F3P A;  3ATQ A;  4BK2 A;  3C96 A;  3JSK A;  3QSM A;  2YLT A;  4O5U A;  2YLX A;  3CNP A;  2Q7V A;  4MJW A;  4FX9 A;  1DOE A;  1IUS A;  4J33 A;  4U8N A;  3AYI A;  2YLW A;  2YG5 A;  1KFY A;  3NYE A;  4C74 A;  3RP8 A;  1MOK A;  1CJ3 A;  4XXG A;  5EBK A;  3KKJ A;  1VRQ B;  3NLC A;  3FBS A;  1PXC A;  2FJE A;  2WP6 A;  3GMB A;  3DME A;  2F5Z A;  3DK8 A;  3AE9 A;  1NPX A;  1X31 B;  3UOZ A;  1YY5 A;  4YXD A;  3AE5 A;  2R9Z A;  4IA5 A;  4J34 A;  2GV8 A;  4U2S A;  4U8O A;  1B37 A;  2V61 A;  3HYW A;  3UTH A;  1JNR A;  1B4V A;  1EBD A;  1H7W A;  4OPL A;  1GT8 A;  1F8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...