3KD9A

Crystal structure of pyridine nucleotide disulfide oxidoreductase from pyrococcus horikoshii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
442
structure length
418
Chain Sequence
SLKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSEVFIKKRGIDLHLNAEVIEVDTGYVRVRENGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDALAIREYMEKYKVENVVIIGGGYIGIEMAEAFAAQGKNVTMIVRGERVLRRSFDKEVTDILEEKLKKHVNLRLQEITMKIEGEERVEKVVTDAGEYKAELVILATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKELHFPGVLGTAVTKFMDVEIGKTGLTEMEALKEGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSDILPRIDTAAAMLMAGFTTKDAFFTDLAYAPPFAPVWDPLIVLARVLKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridine nucleotide disulfide oxidoreductase from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
molecule keywords Coenzyme A disulfide reductase
total genus 124
structure length 418
sequence length 442
chains with identical sequence B, C
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kd9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kd9A01
5IQ4A 5JCMA 2WP9A 3KKJA 3K7TA 1VG9A 1PBEA 3UKKA 3KLJA 3DJDA 2YG7A 4RG4A 1GERA 4A5LA 3G5QA 3GMCA 2YM2A 3DK9A 3NLCA 1E6EA 3ICTA 4H2PA 2XLUA 3T37A 4K2XA 3II4A 5FS6A 4UDRA 1PBCA 3IC9A 1P2EA 1EL9A 2VVMA 2WU2A 1QJDA 3FG2P 3GDPA 3K7MX 4K22A 4EMWA 3UTGA 4BK3A 3GYJA 4A65A 1GRFA 2BC0A 2JB1A 3DJGX 3EPTA 4NZHA 1EL5A 5TR3A 4EMJA 2A89A 1EL7A 2A8XA 2W0HA 3VRAA 5JCIA 3ICSA 1YY5A 1F3PA 3DH9A 3UTFA 3QFBA 4Y4MA 4CBQA 5FMHA 3AE9A 1DXLA 2Y6QA 2XVFA 4OPLA 2Y6RA 3AE3A 3P4QA 4J2WA 3H4KA 5EOWA 3DA1A 3V3NA 1FOHA 1DOBA 1ZOYA 3CGBA 1GXFA 4RSLA 2YVJA 1GRBA 2YVFA 2XVIA 1RYIA 3AECA 5CQFA 2R0PA 3SGLA 3OC4A 5BUKA 2XFUA 3K30A 4H7UA 4CRTA 5KOWA 3I3LA 1D4EA 4RG3A 1ZP0A 2Q7VA 2YLZA 1D7LA 2ZBWA 5KOXA 3GD3A 3NT6A 4BK2A 3P1WA 5KRQA 2R9ZA 3CNPA 2EQ9A 1F8SA 3AE1A 4EQRA 4FK1A 2YQUA 3CGCA 1VG0A 1O5WA 1CF3A 2YR4A 4UP3A 4YKGA 3ADAB 3ATRA 1BF3A 3F8DA 3AD8B 3KVEA 3VRBA 4DGKA 1N1PA 3LB8A 2R0GA 2YG5A 3ABVA 2B9WA 1W4XA 3P9UA 4BJYA 1E1LA 2WS3A 1FECA 3LZWA 1ZK7A 3OZ2A 2WESA 1O95A 2C72A 2XFPA 3CPIG 2YR6A 4I59A 3CIRA 3B3RA 2X8CA 1PBDA 3F8RA 1E7PA 3UP5A 3DJEA 3NK2X 3RHAA 1M6IA 5ER0A 2GRTA 1H6VA 2XFOA 1CC6A 4NTCA 1E1MA 1NENA 2BABA 5M0ZA 4A99A 2GR0A 2JAEA 3G5RA 2GVCA 1TDKA 1IUSA 5J7XA 3ALLA 1ZKQA 4JDRA 2WU5A 3BI4A 2XVEA 5M10A 1H86A 2VQBA 2Z5XA 3FBSA 4U8NA 4AT2A 2E1MA 4PAAA 2H89A 4XWRA 2JBVA 3UP4A 4GR1A 3UOYA 5JCKA 1PDHA 3C96A 1FEAA 4H4UA 2YLTA 3DJJA 4PABA 3UKQA 3KA7A 2WPFA 4IV9A 5EB5A 2YAUA 4YTPA 3LJPA 3UOZA 3Q9TA 2WHDA 2X3NA 1QLBA 4OPGA 3K7QX 1KF6A 2WPEA 4YXDA 1IJHA 3V3OA 4Z44A 1GEUA 3COXA 5HY5A 1OJAA 3C4NA 2FJBA 1JU2A 1TYPA 4YWOA 4BJZA 2XVHA 1FL2A 2YR5A 2PYXA 3LADA 2XLTA 3SQPA 1D5TA 3KPFA 1D4DA 3NH3X 3DMEA 1NAAA 1NHPA 5KVHA 3EANA 3AEDA 4H4SA 4A9WA 2C64A 2VZ2A 2CULA 2PHHA 4K5SA 4YKFA 2FJEA 1E39A 1TDEA 2C65A 3CPHG 5U1OA 4EIPA 1LPFA 2ACZA 2ZZCA 1K0IA 4TLXA 4JNQA 1GRHA 2B7SA 4EQWA 1TDFA 3ALMA 4U8PA 3RP8A 2A87A 3NYCA 3QFAA 4EMIA 3C4AA 3UKLA 4C74A 3ALJA 4J56A 1VDCA 4KX6A 3RNMA 4OPCA 4M52A 4JN9A 3AEGA 4U8MA 4YSZA 1PXCA 1E1KA 1N4UA 2BCGG 2WDVA 2QA2A 1F8RA 1CJCA 3IF9A 4WCTA 4A7AA 3NKSA 1GRGA 1YQ4A 3SFDA 1GALA 1GT8A 2VOUA 3NN6X 4D03A 1ZOVA 1IUUA 2GR3A 2EQ6A 3RP7A 4NEWA 1B37A 3I6DA 3HZLA 2WOVA 4YSXA 4AP1A 4LU6A 3QVPA 4Z2UA 3NYEA 5IQ1A 3NHOX 1NG3A 4YT0A 4X9NA 1BGJA 1XANA 5FS7A 1UKVG 4GCMA 2IVDA 4AP3A 1XDIA 3R9UA 2BCPA 4A6NB 4YSYA 3NYFA 1LJ1A 1XPQA 4U8KA 5HYMA 3V76A 4Z26A 2V3BA 3CPJG 1GOSA 4Z2TA 4GRTA 3EF6A 1D4CA 2B7RA 3LZXA 2V6OA 2ZZ0A 1OJ9A 3AD7B 3NTAA 1BGNA 3CNTA 3VQRA 1N4VA 2F5ZA 4AOSA 3PVCA 1S2QA 1GESA 2B9YA 4C3YA 3FIMB 4XXGA 1ZMCA 4Z24A 3VR8A 2E5VA 3GWFA 1NG4A 1L9DA 1TRBA 3BHFA 3QSMA 1KNPA 3GWDA 2V60A 3BI2A 2Z5YA 3AEEA 4BURA 4C5OA 3M13A 2QCUA 2R4JA 3AYLA 1GPEA 5L46A 2GF3A 3NTDA 1K4QA 2GMJA 4U2TA 1IUXA 4JQ9A 2XVJA 4J57A 3RP6A 1S3EA 3ZDNA 4GDEA 2ARDA 2XLSA 1F6MA 2VRLA 3ISHA 2C66A 4I58A 4ECHA 2C67A 3BI5A 1PS9A 3LOVA 1KDGA 3UOVA 2X50A 1SEZA 1GRTA 3URHA 4DSGA 5KWFA 1AOGA 1N4WA 2XCGA 4CCQA 1K0LA 1KSUA 2DKHA 4GUVA 3AYJA 3P4SA 1VRQB 3D8XA 1X31B 2JK6A 2V3AA 1PJ7A 4BK1A 3B6DA 4EQXA 4CY6A 5BRTA 4C77A 2VQ7A 2YLRA 3KD9A 2R45A 1JRZA 1CBOA 3GRTA 2BYBA 1COYA 2CVJA 1DODA 5FS9A 1MO9A 3AE5A 3CNDA 2OLNA 1NHQA 2EQ8A 4WX1A 4Z2RA 2GAGB 1NPXA 4JNAA 2VVLA 1Q1RA 3FPZA 2C70A 2EQ7A 2XDOA 3BHKA 1H7XA 4CY8A 1FEBA 4B63A 2VVLG 2Q6UA 1ZX9A 1P2HA 1M64A 2GAHB 4TM1A 4H4QA 1KSSA 2JB3A 2YLXA 3G5SA 1V59A 4N9XA 3S5WA 3DGHA 5JCLA 1DOCA 4D04A 2WDQA 4H4VA 1IUWA 1CJ4A 4JY2A 2WEUA 2XLPA 2GQFA 2TMDA 2XFQA 2GR1A 3NN0X 3UTEA 2V61A 3GDNA 4ICYA 4MJWA 1OJDA 4TM3A 4CNJA 2X99A 2BA9A 2RABA 4NTEA 3LXDA 1TYTA 1NDAA 2YLSA 4X9MA 1GREA 2TPRA 1QO8A 1D7YA 1GTEA 1JRXA 1NEKA 4OPUA 1LVLA 5CKUA 4U8OA 4U8IA 1PBBA 1PHHA 1RP0A 1CL0A 2GR2A 3SM8A 2YM1A 2GQWA 3H8LA 4H4TA 5EBKA 4P9SA 2OAMA 4DSHA 1E1NA 2GMHA 1Q9IA 2WBAA 3GYIA 3ATQA 3DK8A 1YQ3A 3AE4A 4IA5A 5HXIA 1GNDA 1OJTA 1OJCA 1YQZA 4O5UA 1DJNA 4AT0A 2BS4A 4IVMB 4Y4LA 2WP6A 4B65A 5IPYA 2JB2A 2H88A 3P4PA 2OLOA 4CCRA 2XFNA 1VQWA 2RGJA 2BXRA 3L1RA 4H4RA 3NNEA 4LIIA 4H4YA 2VRMA 1Y56B 5C2TA 4E0VA 2R0CA 4AOXA 1Y0PA 1REOA 4EM4A 4USQA 1Q1WA 4USRA 3AEBA 3AWIA 4X4JA 1LQUA 4KPRA 1LV0A 2YG4A 3NGCX 2BK3A 3AEAA 2WPCA 4K8DA 1H7WA 4OPDA 2APGA 2C73A 3CGEA 1S3BA 3UKAA 3GRSA 2BXSA 2GB0A 2NVKX 1H82A 1CHUA 1BWCA 2GEWA 1PN0A 3PO7A 4Y4NA 3UOXA 2C75A 1GV4A 3QJ4A 1ONFA 4FK1C 4U8JA 1B5QA 2XLRA 3L8KA 4UDQA 4A6NA 1BKWA 2C76A 3NK1X 1ELIA 2BK4A 3VRDB 2J3NA 5KVIA 2WDRA 2AAQA 2BS3A 1JRYA 3F8PA 2WETA 2AR8A 1L0VA 4ZCCA 5FS8A 4NEVA 1F8WA 4XWZA 2YVGA 5J60A 2R46A 4U2LA 5DBJA 1PJ6A 4YSHA 3WE0A 1O94A 3AEFA 1BZLA 1PBFA 2I0ZA 2Q0KA 4U2SA 3Q6JA 4H2RA 3ITJA 3REDA 5KXJA 4EM3A 1JNRA 1H84A 1DOEA 3CNSA 2OA1A 2DKIA 3P4RA 4ZCDA 2B76A 2C3CA 2BK5A 1B8SA 1CC2A 1LTXR 3DGZA 2BC1A 1MXTA 2FJAA 3NIXA 3NRNA 4APNA 1MOKA 3AB1A 2O9ZA 4TM0A 4LA1A 5GRTA 5BVAA 2JKCA 3CTYA 2BACA 2E4GA 3SFEA 3ZYXA 3IWAA 2CDUA 4Z43A 1LQTA 4EQSA 1CJ3A 2FBWA 3JSKA 4OVIA 3H8IA 4YTNA 1H83A 1PXAA 3QVRA 1CJ2A 1NHSA 1K0JA 2X8HA 4O5QA 2BS2A 2V5ZA 4REKA 4A79A 1GETA 4TM4A 1JNZA 2C7GA 3UCLA 4ZN0A 1GTHA 5BULA 1TDNA 1YKJA 4OCGA 1JEHA 3UKPA 4B64A 4GDPA 3AE7A 5U63A 2QA1A 2R4EA 4J34A 3AD9B 5U25A 5LV9A 3NG7X 5GSNA 1TDOA 4FDCB 4ADWA 4YTMA 4C3XA 1GSNA 3KU9A 3GMBA 3EAOA 4B66A 2B9XA 5JCNA 2WOIA 4H50A 2WQYA 4GF7A 2ZZBA 3M12A 4HB9A 3VR9A 4B69A 2X8GA 2WOWA 4IVOB 1JOAA 2IIDA 1L9CA 3QSSA 4U8LA 4H4ZA 4NTDA 1ZMDA 3UKHA 4H4XA 4H2QA 2YG3A 3AE6A 4K5RA 2YLWA 3M0OA 1EBDA 2AQJA 1DJQA 1PXBA 3D1CA 2GH5A 2C3DA 3AE2A 2NPXA 1CC4A 4JY3A 3CN8A 4DNAA 5C3JA 5HHFA 1B4VA 1HYUA 4BV6A 4Z25A 2CFYA 4H4WA 3GSIA 1H81A 3PS9A 4J36A 1ZY8A 4UDPA 3ICRA 1RSGA 1S2YA 3GD4A 3IHMA 4K7ZA 4H2NA 1DNCA 4J33A 2UZZA 4OPIA 2IVEA 3O0HA 3BNUA 2FJDA 3QSEA 2GV8A 4TLZA 4FX9A 3AE8A 1PJ5A 4B1BA 2XYOA 1ZDLA 2QAEA 3S61A 2WP5A 4HA6A 3IHGA 3AXBA 4B67A 2OALA 3UTHA 1IUVA 1L9EA 4EIQA 1FCDA 4H4PA 1XHCA 4OPTA 1IUTA 3NK0X 5EB4A 2RGHA 1NHRA 2YWLA 2HQMA 3DK4A 3E1TA 4CNKA 2Q0LA 1Y56A 1KFYA 4IA6A 3FMWA 3CNJA 3AYIA 1GRAA 1EL8A 2RGOA 4B68A 2YG6A 3UKFA 3BNMA 4J31A 1KNRA 1Z6LA 3CGDA
chains in the Genus database with same CATH superfamily
3HYWA 5IQ4A 5JCMA 2WP9A 3KKJA 3K7TA 1VG9A 1PBEA 3UKKA 3KLJA 3DJDA 2YG7A 4RG4A 1GERA 4A5LA 3G5QA 3GMCA 2YM2A 3DK9A 3NLCA 1E6EA 3ICTA 4H2PA 2XLUA 3T37A 4K2XA 3II4A 5FS6A 3SZ0A 4UDRA 1PBCA 3IC9A 1P2EA 1EL9A 2VVMA 2WU2A 1QJDA 3FG2P 3GDPA 3K7MX 4K22A 4EMWA 3UTGA 4BK3A 3GYJA 4A65A 1GRFA 2BC0A 2JB1A 3DJGX 3EPTA 4NZHA 1EL5A 4NNJA 5TR3A 4EMJA 2A89A 1EL7A 2A8XA 2W0HA 3VRAA 5JCIA 3ICSA 1YY5A 1F3PA 3DH9A 3UTFA 3QFBA 4Y4MA 4CBQA 5FMHA 3AE9A 3T14A 1DXLA 2Y6QA 2XVFA 4OPLA 2Y6RA 3AE3A 3P4QA 4J2WA 3H4KA 5EOWA 3DA1A 3V3NA 1FOHA 1DOBA 1ZOYA 3CGBA 1GXFA 4RSLA 2YVJA 1GRBA 2YVFA 2XVIA 1RYIA 3AECA 5CQFA 2R0PA 3SGLA 3OC4A 5BUKA 2XFUA 3K30A 4H7UA 4CRTA 5KOWA 3I3LA 3KPKA 1D4EA 4II2A 4RG3A 1ZP0A 2Q7VA 2YLZA 1D7LA 2ZBWA 5KOXA 3GD3A 3NT6A 4BK2A 3P1WA 5KRQA 2R9ZA 3CNPA 2EQ9A 1F8SA 3AE1A 4EQRA 4FK1A 2YQUA 3CGCA 1VG0A 1O5WA 1CF3A 2YR4A 4UP3A 4YKGA 3ADAB 3ATRA 1BF3A 3F8DA 3AD8B 3KVEA 3VRBA 4G6GA 4DGKA 1N1PA 3LB8A 2R0GA 2YG5A 3ABVA 2B9WA 1W4XA 3P9UA 4BJYA 1E1LA 2WS3A 1FECA 3LZWA 1ZK7A 3OZ2A 2WESA 1O95A 2C72A 2XFPA 3CPIG 2YR6A 4I59A 3CIRA 3B3RA 2X8CA 1PBDA 3F8RA 1E7PA 3UP5A 4G73A 3DJEA 3NK2X 3RHAA 1M6IA 5ER0A 2GRTA 1H6VA 2XFOA 1CC6A 4NTCA 1E1MA 1NENA 2BABA 5M0ZA 4A99A 2GR0A 2JAEA 3G5RA 2GVCA 3SYIA 1TDKA 1IUSA 5J7XA 3ALLA 1ZKQA 4JDRA 2WU5A 3BI4A 2XVEA 5M10A 1H86A 2VQBA 2Z5XA 3FBSA 4U8NA 4AT2A 2E1MA 4PAAA 2H89A 4XWRA 2JBVA 3UP4A 4GR1A 3UOYA 5JCKA 1PDHA 3C96A 1FEAA 4H4UA 2YLTA 3DJJA 4PABA 3UKQA 3KA7A 2WPFA 4IV9A 5EB5A 2YAUA 4YTPA 3LJPA 3UOZA 3Q9TA 2WHDA 2X3NA 1QLBA 4OPGA 3K7QX 1KF6A 2WPEA 4YXDA 1IJHA 3V3OA 4Z44A 1GEUA 3COXA 5HY5A 1OJAA 3C4NA 2FJBA 1JU2A 1TYPA 4YWOA 4BJZA 2XVHA 1FL2A 2YR5A 2PYXA 2BRYA 2XLTA 3GYXA 3LADA 3SQPA 1D5TA 3KPFA 1D4DA 3NH3X 3DMEA 1NAAA 1NHPA 5KVHA 3EANA 3AEDA 4H4SA 4A9WA 2C64A 2VZ2A 2CULA 2PHHA 4K5SA 4YKFA 2FJEA 1E39A 1TDEA 2C65A 3CPHG 5U1OA 4EIPA 1LPFA 2ACZA 2ZZCA 1K0IA 4TLXA 4JNQA 1GRHA 2B7SA 4EQWA 1TDFA 3ALMA 4U8PA 3RP8A 2A87A 3NYCA 3SZWA 3QFAA 4EMIA 3C4AA 3UKLA 4C74A 3ALJA 4J56A 1VDCA 4KX6A 3RNMA 4OPCA 4M52A 4JN9A 3T0KA 3AEGA 4U8MA 4YSZA 1PXCA 1E1KA 1N4UA 2BCGG 3SXIA 2WDVA 4G74A 2QA2A 1F8RA 1CJCA 3IF9A 4WCTA 4A7AA 3NKSA 1GRGA 1YQ4A 2BRAA 1GALA 1GT8A 2VOUA 3NN6X 3SFDA 4D03A 1ZOVA 1IUUA 2GR3A 2EQ6A 3RP7A 4NEWA 1B37A 3I6DA 3HZLA 2WOVA 4YSXA 4AP1A 4LU6A 3QVPA 4Z2UA 3NYEA 5IQ1A 3NHOX 1NG3A 4YT0A 4X9NA 1BGJA 1XANA 5FS7A 1UKVG 4GCMA 2IVDA 4AP3A 1XDIA 3R9UA 2BCPA 4A6NB 4YSYA 3NYFA 1LJ1A 1XPQA 4U8KA 5HYMA 3V76A 4Z26A 2V3BA 3CPJG 1GOSA 4Z2TA 4GRTA 3EF6A 1D4CA 2B7RA 3LZXA 2V6OA 2ZZ0A 1OJ9A 3AD7B 3NTAA 1BGNA 3CNTA 3T2ZA 3VQRA 1N4VA 2F5ZA 4AOSA 3PVCA 1S2QA 1GESA 2B9YA 4C3YA 3FIMB 4XXGA 1ZMCA 4Z24A 3VR8A 2E5VA 3T2KA 5KMSA 3GWFA 1NG4A 1L9DA 1TRBA 3BHFA 3QSMA 1KNPA 3GWDA 2V60A 3BI2A 2Z5YA 3AEEA 4BURA 4C5OA 3CMMA 3M13A 2QCUA 2R4JA 3AYLA 1GPEA 5L46A 2GF3A 3NTDA 1K4QA 2GMJA 4U2TA 1IUXA 4JQ9A 2XVJA 4J57A 3RP6A 3SZCA 1S3EA 3ZDNA 4GDEA 2ARDA 2XLSA 1F6MA 2VRLA 3ISHA 2C66A 4I58A 3SX6A 4ECHA 2C67A 3BI5A 1PS9A 3LOVA 1KDGA 3UOVA 2X50A 4GAVA 1SEZA 1GRTA 3URHA 4DSGA 5KWFA 4GAPA 1AOGA 1N4WA 2XCGA 4CCQA 1K0LA 1KSUA 2DKHA 4GUVA 3AYJA 3P4SA 1VRQB 3D8XA 1X31B 2JK6A 2V3AA 1PJ7A 4BK1A 3B6DA 4EQXA 4CY6A 5BRTA 4C77A 2VQ7A 2YLRA 3KD9A 2R45A 1JRZA 1CBOA 3GRTA 2BYBA 1COYA 2CVJA 1DODA 5FS9A 1MO9A 3AE5A 3CNDA 2OLNA 1NHQA 2EQ8A 4WX1A 4Z2RA 2GAGB 1NPXA 4JNAA 2VVLA 1Q1RA 3FPZA 2C70A 2EQ7A 2XDOA 3BHKA 1H7XA 4CY8A 1FEBA 4B63A 2VVLG 2Q6UA 1ZX9A 1P2HA 1M64A 2GAHB 4TM1A 4H4QA 1KSSA 2JB3A 2YLXA 3G5SA 1V59A 4N9XA 3S5WA 3DGHA 5JCLA 1DOCA 4D04A 2WDQA 4H4VA 1IUWA 1CJ4A 4JY2A 2WEUA 2XLPA 2GQFA 2TMDA 2XFQA 2GR1A 3NN0X 3UTEA 2V61A 3GDNA 4ICYA 4MJWA 1OJDA 4TM3A 4CNJA 2X99A 2BA9A 2RABA 4NTEA 3LXDA 1TYTA 1NDAA 2YLSA 4X9MA 1GREA 2TPRA 1QO8A 1D7YA 1GTEA 1JRXA 1NEKA 4OPUA 1LVLA 5CKUA 4U8OA 3SZFA 4U8IA 1PBBA 1PHHA 1RP0A 1CL0A 2GR2A 4NWZA 3SM8A 2YM1A 2GQWA 3H8LA 4H4TA 5EBKA 4P9SA 2OAMA 4DSHA 1E1NA 2GMHA 1Q9IA 2WBAA 3GYIA 3ATQA 3DK8A 1YQ3A 3AE4A 4IA5A 5HXIA 1GNDA 1OJTA 1OJCA 1YQZA 4O5UA 1DJNA 4AT0A 2BS4A 4IVMB 4Y4LA 2WP6A 4B65A 5IPYA 2JB2A 2H88A 3P4PA 2OLOA 4CCRA 2XFNA 1VQWA 2RGJA 2BXRA 3L1RA 4H4RA 3NNEA 4LIIA 4H4YA 2VRMA 1Y56B 5C2TA 4E0VA 5KMPA 2R0CA 4AOXA 1Y0PA 1REOA 4EM4A 4USQA 1Q1WA 4USRA 3AEBA 3AWIA 4X4JA 1LQUA 4KPRA 1LV0A 2YG4A 3NGCX 2BK3A 3AEAA 2WPCA 4K8DA 1H7WA 4OPDA 2APGA 2C73A 3CGEA 1S3BA 3UKAA 3GRSA 2BXSA 2GB0A 2NVKX 1H82A 1CHUA 1BWCA 2GEWA 1PN0A 3PO7A 4Y4NA 3UOXA 2C75A 1GV4A 3QJ4A 1ONFA 5KNLA 4FK1C 4U8JA 1B5QA 2XLRA 3L8KA 4UDQA 4A6NA 1BKWA 2C76A 3NK1X 1ELIA 2BK4A 2C4CA 3VRDB 2J3NA 5KVIA 2WDRA 2AAQA 2BS3A 1JRYA 3F8PA 2WETA 2AR8A 1L0VA 4ZCCA 5FS8A 4NEVA 1F8WA 4XWZA 2YVGA 5J60A 2R46A 4U2LA 5DBJA 5KMQA 1PJ6A 4YSHA 3WE0A 1O94A 3AEFA 1BZLA 1PBFA 2I0ZA 2Q0KA 4U2SA 3SY4A 3Q6JA 4H2RA 3ITJA 3REDA 5KXJA 4G9KA 4EM3A 1JNRA 1H84A 1DOEA 3CNSA 2OA1A 2DKIA 3P4RA 4ZCDA 2B76A 3T2YA 2C3CA 2BK5A 1B8SA 1CC2A 1LTXR 3DGZA 2BC1A 1MXTA 2FJAA 3NIXA 3NRNA 4APNA 1MOKA 3AB1A 2O9ZA 4TM0A 4LA1A 5GRTA 5BVAA 2JKCA 3CTYA 2BACA 2E4GA 3SFEA 3ZYXA 3HYVA 3IWAA 4G6HA 2CDUA 4Z43A 1LQTA 4EQSA 1CJ3A 2FBWA 3JSKA 4OVIA 3H8IA 4YTNA 1H83A 1PXAA 3QVRA 1CJ2A 1NHSA 1K0JA 2X8HA 4O5QA 2BS2A 2V5ZA 4REKA 4A79A 1GETA 4TM4A 1JNZA 2C7GA 3UCLA 4ZN0A 1GTHA 5BULA 1TDNA 1YKJA 4OCGA 1JEHA 3UKPA 4B64A 4GDPA 3AE7A 5U63A 2QA1A 2R4EA 4J34A 3AD9B 5U25A 5LV9A 3NG7X 5GSNA 1TDOA 4FDCB 4ADWA 4YTMA 4C3XA 1GSNA 3KU9A 3GMBA 3EAOA 4B66A 2B9XA 5JCNA 2WOIA 4H50A 2WQYA 4GF7A 2ZZBA 3M12A 4HB9A 3VR9A 4B69A 2X8GA 2WOWA 4IVOB 1JOAA 2IIDA 1L9CA 3QSSA 4U8LA 4H4ZA 4NTDA 5KMRA 1ZMDA 3UKHA 4H4XA 4H2QA 2YG3A 3AE6A 4K5RA 2YLWA 4II3A 3M0OA 3T31A 1EBDA 2AQJA 1DJQA 1PXBA 3D1CA 2GH5A 2C3DA 3AE2A 2NPXA 1CC4A 4JY3A 3CN8A 4DNAA 5C3JA 5HHFA 1B4VA 1HYUA 4BV6A 4Z25A 2CFYA 4H4WA 3GSIA 1H81A 3PS9A 4J36A 1ZY8A 3HYXA 4UDPA 3ICRA 1RSGA 1S2YA 3GD4A 3IHMA 4K7ZA 4H2NA 1DNCA 4J33A 2UZZA 4OPIA 2IVEA 3O0HA 3BNUA 2FJDA 3QSEA 2GV8A 4TLZA 4FX9A 3AE8A 1PJ5A 4B1BA 2XYOA 1ZDLA 2QAEA 3S61A 2WP5A 4HA6A 3IHGA 3AXBA 4B67A 2OALA 3UTHA 1IUVA 1L9EA 4EIQA 1FCDA 4H4PA 1XHCA 4OPTA 1IUTA 3NK0X 5EB4A 2RGHA 1NHRA 2YWLA 2HQMA 3DK4A 3E1TA 4CNKA 2Q0LA 1Y56A 1KFYA 4IA6A 3FMWA 3CNJA 3AYIA 1GRAA 1EL8A 2RGOA 4B68A 2YG6A 3UKFA 3BNMA 4J31A 1KNRA 1Z6LA 3CGDA
chains in the Genus database with same CATH topology
3HYWA 5IQ4A 5JCMA 2WP9A 3KKJA 3K7TA 1VG9A 1PBEA 3UKKA 3KLJA 3DJDA 2YG7A 4RG4A 1GERA 4A5LA 3G5QA 3GMCA 2YM2A 3DK9A 3NLCA 1E6EA 3ICTA 4H2PA 2XLUA 3T37A 4K2XA 3II4A 5FS6A 3SZ0A 4UDRA 1PBCA 3IC9A 1P2EA 1EL9A 2VVMA 2WU2A 1QJDA 3FG2P 3GDPA 3K7MX 4K22A 4EMWA 3UTGA 4BK3A 3GYJA 4A65A 1GRFA 2BC0A 2JB1A 3DJGX 3EPTA 4NZHA 1EL5A 4NNJA 5TR3A 4EMJA 2A89A 1EL7A 2A8XA 2W0HA 3VRAA 5JCIA 3ICSA 1YY5A 1F3PA 3DH9A 3UTFA 3QFBA 4Y4MA 4CBQA 5FMHA 3AE9A 3T14A 1DXLA 2Y6QA 2XVFA 4OPLA 2Y6RA 3AE3A 3P4QA 4J2WA 3H4KA 5EOWA 3DA1A 3V3NA 1FOHA 1DOBA 1ZOYA 3CGBA 1GXFA 4RSLA 2YVJA 1GRBA 2YVFA 2XVIA 1RYIA 3AECA 5CQFA 2R0PA 3SGLA 3OC4A 5BUKA 2XFUA 3K30A 4H7UA 4CRTA 5KOWA 3I3LA 3KPKA 1D4EA 4II2A 4RG3A 1ZP0A 2Q7VA 2YLZA 1D7LA 2ZBWA 5KOXA 3GD3A 3NT6A 4BK2A 3P1WA 5KRQA 2R9ZA 3CNPA 2EQ9A 1F8SA 3AE1A 4EQRA 4FK1A 2YQUA 3CGCA 1VG0A 1O5WA 1CF3A 2YR4A 4UP3A 4YKGA 3ADAB 3ATRA 1BF3A 3F8DA 3AD8B 3KVEA 3VRBA 4G6GA 4DGKA 1N1PA 3LB8A 2R0GA 2YG5A 3ABVA 2B9WA 1W4XA 3P9UA 4BJYA 1E1LA 2WS3A 1FECA 3LZWA 1ZK7A 3OZ2A 2WESA 1O95A 2C72A 2XFPA 3CPIG 2YR6A 4I59A 3CIRA 3B3RA 2X8CA 1PBDA 3F8RA 1E7PA 3UP5A 4G73A 3DJEA 3NK2X 3RHAA 1M6IA 5ER0A 2GRTA 1H6VA 2XFOA 1CC6A 4NTCA 1E1MA 1NENA 2BABA 5M0ZA 4A99A 2GR0A 2JAEA 3G5RA 2GVCA 3SYIA 1TDKA 1IUSA 5J7XA 3ALLA 1ZKQA 4JDRA 2WU5A 3BI4A 2XVEA 5M10A 1H86A 2VQBA 2Z5XA 3FBSA 4U8NA 4AT2A 2E1MA 4PAAA 2H89A 4XWRA 2JBVA 3UP4A 4GR1A 3UOYA 5JCKA 1PDHA 3C96A 1FEAA 4H4UA 2YLTA 3DJJA 4PABA 3UKQA 3KA7A 2WPFA 4IV9A 5EB5A 2YAUA 4YTPA 3LJPA 3UOZA 3Q9TA 2WHDA 2X3NA 1QLBA 4OPGA 3K7QX 1KF6A 2WPEA 4YXDA 1IJHA 3V3OA 4Z44A 1GEUA 3COXA 5HY5A 1OJAA 3C4NA 2FJBA 1JU2A 1TYPA 4YWOA 4BJZA 2XVHA 1FL2A 2YR5A 2PYXA 2BRYA 2XLTA 3GYXA 3LADA 3SQPA 1D5TA 3KPFA 1D4DA 3NH3X 3DMEA 1NAAA 1NHPA 5KVHA 3EANA 3AEDA 4H4SA 4A9WA 2C64A 2VZ2A 2CULA 2PHHA 4K5SA 4YKFA 2FJEA 1E39A 1TDEA 2C65A 3CPHG 5U1OA 4EIPA 1LPFA 2ACZA 2ZZCA 1K0IA 4TLXA 4JNQA 1GRHA 2B7SA 4EQWA 1TDFA 3ALMA 4U8PA 3RP8A 2A87A 3NYCA 3SZWA 3QFAA 4EMIA 3C4AA 3UKLA 4C74A 3ALJA 4J56A 1VDCA 4KX6A 3RNMA 4OPCA 4M52A 4JN9A 3T0KA 3AEGA 4U8MA 4YSZA 1PXCA 1E1KA 1N4UA 2BCGG 3SXIA 2WDVA 4G74A 2QA2A 1F8RA 1CJCA 3IF9A 4WCTA 4A7AA 3NKSA 1GRGA 1YQ4A 2BRAA 1GALA 1GT8A 2VOUA 3NN6X 3SFDA 4D03A 1ZOVA 1IUUA 2GR3A 2EQ6A 3RP7A 4NEWA 1B37A 3I6DA 3HZLA 2WOVA 4YSXA 4AP1A 4LU6A 3QVPA 4Z2UA 3NYEA 5IQ1A 3NHOX 1NG3A 4YT0A 4X9NA 1BGJA 1XANA 5FS7A 1UKVG 4GCMA 2IVDA 4AP3A 1XDIA 3R9UA 2BCPA 4A6NB 4YSYA 3NYFA 1LJ1A 1XPQA 4U8KA 5HYMA 3V76A 4Z26A 2V3BA 3CPJG 1GOSA 4Z2TA 4GRTA 3EF6A 1D4CA 2B7RA 3LZXA 2V6OA 2ZZ0A 1OJ9A 3AD7B 3NTAA 1BGNA 3CNTA 3T2ZA 3VQRA 1N4VA 2F5ZA 4AOSA 3PVCA 1S2QA 1GESA 2B9YA 4C3YA 3FIMB 4XXGA 1ZMCA 4Z24A 3VR8A 2E5VA 3T2KA 5KMSA 3GWFA 1NG4A 1L9DA 1TRBA 3BHFA 3QSMA 1KNPA 3GWDA 2V60A 3BI2A 2Z5YA 3AEEA 4BURA 4C5OA 3CMMA 3M13A 2QCUA 2R4JA 3AYLA 1GPEA 5L46A 2GF3A 3NTDA 1K4QA 2GMJA 4U2TA 1IUXA 4JQ9A 2XVJA 4J57A 3RP6A 3SZCA 1S3EA 3ZDNA 4GDEA 2ARDA 2XLSA 1F6MA 2VRLA 3ISHA 2C66A 4I58A 3SX6A 4ECHA 2C67A 3BI5A 1PS9A 3LOVA 1KDGA 3UOVA 2X50A 4GAVA 1SEZA 1GRTA 3URHA 4DSGA 5KWFA 4GAPA 1AOGA 1N4WA 2XCGA 4CCQA 1K0LA 1KSUA 2DKHA 4GUVA 3AYJA 3P4SA 1VRQB 3D8XA 1X31B 2JK6A 2V3AA 1PJ7A 4BK1A 3B6DA 4EQXA 4CY6A 5BRTA 4C77A 2VQ7A 2YLRA 3KD9A 2R45A 1JRZA 1CBOA 3GRTA 2BYBA 1COYA 2CVJA 1DODA 5FS9A 1MO9A 3AE5A 3CNDA 2OLNA 1NHQA 2EQ8A 4WX1A 4Z2RA 2GAGB 1NPXA 4JNAA 2VVLA 1Q1RA 3FPZA 2C70A 2EQ7A 2XDOA 3BHKA 1H7XA 4CY8A 1FEBA 4B63A 2VVLG 2Q6UA 1ZX9A 1P2HA 1M64A 2GAHB 4TM1A 4H4QA 1KSSA 2JB3A 2YLXA 3G5SA 1V59A 4N9XA 3S5WA 3DGHA 5JCLA 1DOCA 4D04A 2WDQA 4H4VA 1IUWA 1CJ4A 4JY2A 2WEUA 2XLPA 2GQFA 2TMDA 2XFQA 2GR1A 3NN0X 3UTEA 2V61A 3GDNA 4ICYA 4MJWA 1OJDA 4TM3A 4CNJA 2X99A 2BA9A 2RABA 4NTEA 3LXDA 1TYTA 1NDAA 2YLSA 4X9MA 1GREA 2TPRA 1QO8A 1D7YA 1GTEA 1JRXA 1NEKA 4OPUA 1LVLA 5CKUA 4U8OA 3SZFA 4U8IA 1PBBA 1PHHA 1RP0A 1CL0A 2GR2A 4NWZA 3SM8A 2YM1A 2GQWA 3H8LA 4H4TA 5EBKA 4P9SA 2OAMA 4DSHA 1E1NA 2GMHA 1Q9IA 2WBAA 3GYIA 3ATQA 3DK8A 1YQ3A 3AE4A 4IA5A 5HXIA 1GNDA 1OJTA 1OJCA 1YQZA 4O5UA 1DJNA 4AT0A 2BS4A 4IVMB 4Y4LA 2WP6A 4B65A 5IPYA 2JB2A 2H88A 3P4PA 2OLOA 4CCRA 2XFNA 1VQWA 2RGJA 2BXRA 3L1RA 4H4RA 3NNEA 4LIIA 4H4YA 2VRMA 1Y56B 5C2TA 4E0VA 5KMPA 2R0CA 4AOXA 1Y0PA 1REOA 4EM4A 4USQA 1Q1WA 4USRA 3AEBA 3AWIA 4X4JA 1LQUA 4KPRA 1LV0A 2YG4A 3NGCX 2BK3A 3AEAA 2WPCA 4K8DA 1H7WA 4OPDA 2APGA 2C73A 3CGEA 1S3BA 3UKAA 3GRSA 2BXSA 2GB0A 2NVKX 1H82A 1CHUA 1BWCA 2GEWA 1PN0A 3PO7A 4Y4NA 3UOXA 2C75A 1GV4A 3QJ4A 1ONFA 5KNLA 4FK1C 4U8JA 1B5QA 2XLRA 3L8KA 4UDQA 4A6NA 1BKWA 2C76A 3NK1X 1ELIA 2BK4A 2C4CA 3VRDB 2J3NA 5KVIA 2WDRA 2AAQA 2BS3A 1JRYA 3F8PA 2WETA 2AR8A 1L0VA 4ZCCA 5FS8A 4NEVA 1F8WA 4XWZA 2YVGA 5J60A 2R46A 4U2LA 5DBJA 5KMQA 1PJ6A 4YSHA 3WE0A 1O94A 3AEFA 1BZLA 1PBFA 2I0ZA 2Q0KA 4U2SA 3SY4A 3Q6JA 4H2RA 3ITJA 3REDA 5KXJA 4G9KA 4EM3A 1JNRA 1H84A 1DOEA 3CNSA 2OA1A 2DKIA 3P4RA 4ZCDA 2B76A 3T2YA 2C3CA 2BK5A 1B8SA 1CC2A 1LTXR 3DGZA 2BC1A 1MXTA 2FJAA 3NIXA 3NRNA 4APNA 1MOKA 3AB1A 2O9ZA 4TM0A 4LA1A 5GRTA 5BVAA 2JKCA 3CTYA 2BACA 2E4GA 3SFEA 3ZYXA 3HYVA 3IWAA 4G6HA 2CDUA 4Z43A 1LQTA 4EQSA 1CJ3A 2FBWA 3JSKA 4OVIA 3H8IA 4YTNA 1H83A 1PXAA 3QVRA 1CJ2A 1NHSA 1K0JA 2X8HA 4O5QA 2BS2A 2V5ZA 4REKA 4A79A 1GETA 4TM4A 1JNZA 2C7GA 3UCLA 4ZN0A 1GTHA 5BULA 1TDNA 1YKJA 4OCGA 1JEHA 3UKPA 4B64A 4GDPA 3AE7A 5U63A 2QA1A 2R4EA 4J34A 3AD9B 5U25A 5LV9A 3NG7X 5GSNA 1TDOA 4FDCB 4ADWA 4YTMA 4C3XA 1GSNA 3KU9A 3GMBA 3EAOA 4B66A 2B9XA 5JCNA 2WOIA 4H50A 2WQYA 4GF7A 2ZZBA 3M12A 4HB9A 3VR9A 4B69A 2X8GA 2WOWA 4IVOB 1JOAA 2IIDA 1L9CA 3QSSA 4U8LA 4H4ZA 4NTDA 5KMRA 1ZMDA 3UKHA 4H4XA 4H2QA 2YG3A 3AE6A 4K5RA 2YLWA 4II3A 3M0OA 3T31A 1EBDA 2AQJA 1DJQA 1PXBA 3D1CA 2GH5A 2C3DA 3AE2A 2NPXA 1CC4A 4JY3A 3CN8A 4DNAA 5C3JA 5HHFA 1B4VA 1HYUA 4BV6A 4Z25A 2CFYA 4H4WA 3GSIA 1H81A 3PS9A 4J36A 1ZY8A 3HYXA 4UDPA 3ICRA 1RSGA 1S2YA 3GD4A 3IHMA 4K7ZA 4H2NA 1DNCA 4J33A 2UZZA 4OPIA 2IVEA 3O0HA 3BNUA 2FJDA 3QSEA 2GV8A 4TLZA 4FX9A 3AE8A 1PJ5A 4B1BA 2XYOA 1ZDLA 2QAEA 3S61A 2WP5A 4HA6A 3IHGA 3AXBA 4B67A 2OALA 3UTHA 1IUVA 1L9EA 4EIQA 1FCDA 4H4PA 1XHCA 4OPTA 1IUTA 3NK0X 5EB4A 2RGHA 1NHRA 2YWLA 2HQMA 3DK4A 3E1TA 4CNKA 2Q0LA 1Y56A 1KFYA 4IA6A 3FMWA 3CNJA 3AYIA 1GRAA 1EL8A 2RGOA 4B68A 2YG6A 3UKFA 3BNMA 4J31A 1KNRA 1Z6LA 3CGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IQ4 A;  5JCM A;  2WP9 A;  3KKJ A;  3K7T A;  1VG9 A;  1PBE A;  3UKK A;  3KLJ A;  3DJD A;  2YG7 A;  4RG4 A;  1GER A;  4A5L A;  3G5Q A;  3GMC A;  2YM2 A;  3DK9 A;  3NLC A;  1E6E A;  3ICT A;  4H2P A;  2XLU A;  3T37 A;  4K2X A;  3II4 A;  5FS6 A;  4UDR A;  1PBC A;  3IC9 A;  1P2E A;  1EL9 A;  2VVM A;  2WU2 A;  1QJD A;  3FG2 P;  3GDP A;  3K7M X;  4K22 A;  4EMW A;  3UTG A;  4BK3 A;  3GYJ A;  4A65 A;  1GRF A;  2BC0 A;  2JB1 A;  3DJG X;  3EPT A;  4NZH A;  1EL5 A;  5TR3 A;  4EMJ A;  2A89 A;  1EL7 A;  2A8X A;  2W0H A;  3VRA A;  5JCI A;  3ICS A;  1YY5 A;  1F3P A;  3DH9 A;  3UTF A;  3QFB A;  4Y4M A;  4CBQ A;  5FMH A;  3AE9 A;  1DXL A;  2Y6Q A;  2XVF A;  4OPL A;  2Y6R A;  3AE3 A;  3P4Q A;  4J2W A;  3H4K A;  5EOW A;  3DA1 A;  3V3N A;  1FOH A;  1DOB A;  1ZOY A;  3CGB A;  1GXF A;  4RSL A;  2YVJ A;  1GRB A;  2YVF A;  2XVI A;  1RYI A;  3AEC A;  5CQF A;  2R0P A;  3SGL A;  3OC4 A;  5BUK A;  2XFU A;  3K30 A;  4H7U A;  4CRT A;  5KOW A;  3I3L A;  1D4E A;  4RG3 A;  1ZP0 A;  2Q7V A;  2YLZ A;  1D7L A;  2ZBW A;  5KOX A;  3GD3 A;  3NT6 A;  4BK2 A;  3P1W A;  5KRQ A;  2R9Z A;  3CNP A;  2EQ9 A;  1F8S A;  3AE1 A;  4EQR A;  4FK1 A;  2YQU A;  3CGC A;  1VG0 A;  1O5W A;  1CF3 A;  2YR4 A;  4UP3 A;  4YKG A;  3ADA B;  3ATR A;  1BF3 A;  3F8D A;  3AD8 B;  3KVE A;  3VRB A;  4DGK A;  1N1P A;  3LB8 A;  2R0G A;  2YG5 A;  3ABV A;  2B9W A;  1W4X A;  3P9U A;  4BJY A;  1E1L A;  2WS3 A;  1FEC A;  3LZW A;  1ZK7 A;  3OZ2 A;  2WES A;  1O95 A;  2C72 A;  2XFP A;  3CPI G;  2YR6 A;  4I59 A;  3CIR A;  3B3R A;  2X8C A;  1PBD A;  3F8R A;  1E7P A;  3UP5 A;  3DJE A;  3NK2 X;  3RHA A;  1M6I A;  5ER0 A;  2GRT A;  1H6V A;  2XFO A;  1CC6 A;  4NTC A;  1E1M A;  1NEN A;  2BAB A;  5M0Z A;  4A99 A;  2GR0 A;  2JAE A;  3G5R A;  2GVC A;  1TDK A;  1IUS A;  5J7X A;  3ALL A;  1ZKQ A;  4JDR A;  2WU5 A;  3BI4 A;  2XVE A;  5M10 A;  1H86 A;  2VQB A;  2Z5X A;  3FBS A;  4U8N A;  4AT2 A;  2E1M A;  4PAA A;  2H89 A;  4XWR A;  2JBV A;  3UP4 A;  4GR1 A;  3UOY A;  5JCK A;  1PDH A;  3C96 A;  1FEA A;  4H4U A;  2YLT A;  3DJJ A;  4PAB A;  3UKQ A;  3KA7 A;  2WPF A;  4IV9 A;  5EB5 A;  2YAU A;  4YTP A;  3LJP A;  3UOZ A;  3Q9T A;  2WHD A;  2X3N A;  1QLB A;  4OPG A;  3K7Q X;  1KF6 A;  2WPE A;  4YXD A;  1IJH A;  3V3O A;  4Z44 A;  1GEU A;  3COX A;  5HY5 A;  1OJA A;  3C4N A;  2FJB A;  1JU2 A;  1TYP A;  4YWO A;  4BJZ A;  2XVH A;  1FL2 A;  2YR5 A;  2PYX A;  3LAD A;  2XLT A;  3SQP A;  1D5T A;  3KPF A;  1D4D A;  3NH3 X;  3DME A;  1NAA A;  1NHP A;  5KVH A;  3EAN A;  3AED A;  4H4S A;  4A9W A;  2C64 A;  2VZ2 A;  2CUL A;  2PHH A;  4K5S A;  4YKF A;  2FJE A;  1E39 A;  1TDE A;  2C65 A;  3CPH G;  5U1O A;  4EIP A;  1LPF A;  2ACZ A;  2ZZC A;  1K0I A;  4TLX A;  4JNQ A;  1GRH A;  2B7S A;  4EQW A;  1TDF A;  3ALM A;  4U8P A;  3RP8 A;  2A87 A;  3NYC A;  3QFA A;  4EMI A;  3C4A A;  3UKL A;  4C74 A;  3ALJ A;  4J56 A;  1VDC A;  4KX6 A;  3RNM A;  4OPC A;  4M52 A;  4JN9 A;  3AEG A;  4U8M A;  4YSZ A;  1PXC A;  1E1K A;  1N4U A;  2BCG G;  2WDV A;  2QA2 A;  1F8R A;  1CJC A;  3IF9 A;  4WCT A;  4A7A A;  3NKS A;  1GRG A;  1YQ4 A;  3SFD A;  1GAL A;  1GT8 A;  2VOU A;  3NN6 X;  4D03 A;  1ZOV A;  1IUU A;  2GR3 A;  2EQ6 A;  3RP7 A;  4NEW A;  1B37 A;  3I6D A;  3HZL A;  2WOV A;  4YSX A;  4AP1 A;  4LU6 A;  3QVP A;  4Z2U A;  3NYE A;  5IQ1 A;  3NHO X;  1NG3 A;  4YT0 A;  4X9N A;  1BGJ A;  1XAN A;  5FS7 A;  1UKV G;  4GCM A;  2IVD A;  4AP3 A;  1XDI A;  3R9U A;  2BCP A;  4A6N B;  4YSY A;  3NYF A;  1LJ1 A;  1XPQ A;  4U8K A;  5HYM A;  3V76 A;  4Z26 A;  2V3B A;  3CPJ G;  1GOS A;  4Z2T A;  4GRT A;  3EF6 A;  1D4C A;  2B7R A;  3LZX A;  2V6O A;  2ZZ0 A;  1OJ9 A;  3AD7 B;  3NTA A;  1BGN A;  3CNT A;  3VQR A;  1N4V A;  2F5Z A;  4AOS A;  3PVC A;  1S2Q A;  1GES A;  2B9Y A;  4C3Y A;  3FIM B;  4XXG A;  1ZMC A;  4Z24 A;  3VR8 A;  2E5V A;  3GWF A;  1NG4 A;  1L9D A;  1TRB A;  3BHF A;  3QSM A;  1KNP A;  3GWD A;  2V60 A;  3BI2 A;  2Z5Y A;  3AEE A;  4BUR A;  4C5O A;  3M13 A;  2QCU A;  2R4J A;  3AYL A;  1GPE A;  5L46 A;  2GF3 A;  3NTD A;  1K4Q A;  2GMJ A;  4U2T A;  1IUX A;  4JQ9 A;  2XVJ A;  4J57 A;  3RP6 A;  1S3E A;  3ZDN A;  4GDE A;  2ARD A;  2XLS A;  1F6M A;  2VRL A;  3ISH A;  2C66 A;  4I58 A;  4ECH A;  2C67 A;  3BI5 A;  1PS9 A;  3LOV A;  1KDG A;  3UOV A;  2X50 A;  1SEZ A;  1GRT A;  3URH A;  4DSG A;  5KWF A;  1AOG A;  1N4W A;  2XCG A;  4CCQ A;  1K0L A;  1KSU A;  2DKH A;  4GUV A;  3AYJ A;  3P4S A;  1VRQ B;  3D8X A;  1X31 B;  2JK6 A;  2V3A A;  1PJ7 A;  4BK1 A;  3B6D A;  4EQX A;  4CY6 A;  5BRT A;  4C77 A;  2VQ7 A;  2YLR A;  3KD9 A;  2R45 A;  1JRZ A;  1CBO A;  3GRT A;  2BYB A;  1COY A;  2CVJ A;  1DOD A;  5FS9 A;  1MO9 A;  3AE5 A;  3CND A;  2OLN A;  1NHQ A;  2EQ8 A;  4WX1 A;  4Z2R A;  2GAG B;  1NPX A;  4JNA A;  2VVL A;  1Q1R A;  3FPZ A;  2C70 A;  2EQ7 A;  2XDO A;  3BHK A;  1H7X A;  4CY8 A;  1FEB A;  4B63 A;  2VVL G;  2Q6U A;  1ZX9 A;  1P2H A;  1M64 A;  2GAH B;  4TM1 A;  4H4Q A;  1KSS A;  2JB3 A;  2YLX A;  3G5S A;  1V59 A;  4N9X A;  3S5W A;  3DGH A;  5JCL A;  1DOC A;  4D04 A;  2WDQ A;  4H4V A;  1IUW A;  1CJ4 A;  4JY2 A;  2WEU A;  2XLP A;  2GQF A;  2TMD A;  2XFQ A;  2GR1 A;  3NN0 X;  3UTE A;  2V61 A;  3GDN A;  4ICY A;  4MJW A;  1OJD A;  4TM3 A;  4CNJ A;  2X99 A;  2BA9 A;  2RAB A;  4NTE A;  3LXD A;  1TYT A;  1NDA A;  2YLS A;  4X9M A;  1GRE A;  2TPR A;  1QO8 A;  1D7Y A;  1GTE A;  1JRX A;  1NEK A;  4OPU A;  1LVL A;  5CKU A;  4U8O A;  4U8I A;  1PBB A;  1PHH A;  1RP0 A;  1CL0 A;  2GR2 A;  3SM8 A;  2YM1 A;  2GQW A;  3H8L A;  4H4T A;  5EBK A;  4P9S A;  2OAM A;  4DSH A;  1E1N A;  2GMH A;  1Q9I A;  2WBA A;  3GYI A;  3ATQ A;  3DK8 A;  1YQ3 A;  3AE4 A;  4IA5 A;  5HXI A;  1GND A;  1OJT A;  1OJC A;  1YQZ A;  4O5U A;  1DJN A;  4AT0 A;  2BS4 A;  4IVM B;  4Y4L A;  2WP6 A;  4B65 A;  5IPY A;  2JB2 A;  2H88 A;  3P4P A;  2OLO A;  4CCR A;  2XFN A;  1VQW A;  2RGJ A;  2BXR A;  3L1R A;  4H4R A;  3NNE A;  4LII A;  4H4Y A;  2VRM A;  1Y56 B;  5C2T A;  4E0V A;  2R0C A;  4AOX A;  1Y0P A;  1REO A;  4EM4 A;  4USQ A;  1Q1W A;  4USR A;  3AEB A;  3AWI A;  4X4J A;  1LQU A;  4KPR A;  1LV0 A;  2YG4 A;  3NGC X;  2BK3 A;  3AEA A;  2WPC A;  4K8D A;  1H7W A;  4OPD A;  2APG A;  2C73 A;  3CGE A;  1S3B A;  3UKA A;  3GRS A;  2BXS A;  2GB0 A;  2NVK X;  1H82 A;  1CHU A;  1BWC A;  2GEW A;  1PN0 A;  3PO7 A;  4Y4N A;  3UOX A;  2C75 A;  1GV4 A;  3QJ4 A;  1ONF A;  4FK1 C;  4U8J A;  1B5Q A;  2XLR A;  3L8K A;  4UDQ A;  4A6N A;  1BKW A;  2C76 A;  3NK1 X;  1ELI A;  2BK4 A;  3VRD B;  2J3N A;  5KVI A;  2WDR A;  2AAQ A;  2BS3 A;  1JRY A;  3F8P A;  2WET A;  2AR8 A;  1L0V A;  4ZCC A;  5FS8 A;  4NEV A;  1F8W A;  4XWZ A;  2YVG A;  5J60 A;  2R46 A;  4U2L A;  5DBJ A;  1PJ6 A;  4YSH A;  3WE0 A;  1O94 A;  3AEF A;  1BZL A;  1PBF A;  2I0Z A;  2Q0K A;  4U2S A;  3Q6J A;  4H2R A;  3ITJ A;  3RED A;  5KXJ A;  4EM3 A;  1JNR A;  1H84 A;  1DOE A;  3CNS A;  2OA1 A;  2DKI A;  3P4R A;  4ZCD A;  2B76 A;  2C3C A;  2BK5 A;  1B8S A;  1CC2 A;  1LTX R;  3DGZ A;  2BC1 A;  1MXT A;  2FJA A;  3NIX A;  3NRN A;  4APN A;  1MOK A;  3AB1 A;  2O9Z A;  4TM0 A;  4LA1 A;  5GRT A;  5BVA A;  2JKC A;  3CTY A;  2BAC A;  2E4G A;  3SFE A;  3ZYX A;  3IWA A;  2CDU A;  4Z43 A;  1LQT A;  4EQS A;  1CJ3 A;  2FBW A;  3JSK A;  4OVI A;  3H8I A;  4YTN A;  1H83 A;  1PXA A;  3QVR A;  1CJ2 A;  1NHS A;  1K0J A;  2X8H A;  4O5Q A;  2BS2 A;  2V5Z A;  4REK A;  4A79 A;  1GET A;  4TM4 A;  1JNZ A;  2C7G A;  3UCL A;  4ZN0 A;  1GTH A;  5BUL A;  1TDN A;  1YKJ A;  4OCG A;  1JEH A;  3UKP A;  4B64 A;  4GDP A;  3AE7 A;  5U63 A;  2QA1 A;  2R4E A;  4J34 A;  3AD9 B;  5U25 A;  5LV9 A;  3NG7 X;  5GSN A;  1TDO A;  4FDC B;  4ADW A;  4YTM A;  4C3X A;  1GSN A;  3KU9 A;  3GMB A;  3EAO A;  4B66 A;  2B9X A;  5JCN A;  2WOI A;  4H50 A;  2WQY A;  4GF7 A;  2ZZB A;  3M12 A;  4HB9 A;  3VR9 A;  4B69 A;  2X8G A;  2WOW A;  4IVO B;  1JOA A;  2IID A;  1L9C A;  3QSS A;  4U8L A;  4H4Z A;  4NTD A;  1ZMD A;  3UKH A;  4H4X A;  4H2Q A;  2YG3 A;  3AE6 A;  4K5R A;  2YLW A;  3M0O A;  1EBD A;  2AQJ A;  1DJQ A;  1PXB A;  3D1C A;  2GH5 A;  2C3D A;  3AE2 A;  2NPX A;  1CC4 A;  4JY3 A;  3CN8 A;  4DNA A;  5C3J A;  5HHF A;  1B4V A;  1HYU A;  4BV6 A;  4Z25 A;  2CFY A;  4H4W A;  3GSI A;  1H81 A;  3PS9 A;  4J36 A;  1ZY8 A;  4UDP A;  3ICR A;  1RSG A;  1S2Y A;  3GD4 A;  3IHM A;  4K7Z A;  4H2N A;  1DNC A;  4J33 A;  2UZZ A;  4OPI A;  2IVE A;  3O0H A;  3BNU A;  2FJD A;  3QSE A;  2GV8 A;  4TLZ A;  4FX9 A;  3AE8 A;  1PJ5 A;  4B1B A;  2XYO A;  1ZDL A;  2QAE A;  3S61 A;  2WP5 A;  4HA6 A;  3IHG A;  3AXB A;  4B67 A;  2OAL A;  3UTH A;  1IUV A;  1L9E A;  4EIQ A;  1FCD A;  4H4P A;  1XHC A;  4OPT A;  1IUT A;  3NK0 X;  5EB4 A;  2RGH A;  1NHR A;  2YWL A;  2HQM A;  3DK4 A;  3E1T A;  4CNK A;  2Q0L A;  1Y56 A;  1KFY A;  4IA6 A;  3FMW A;  3CNJ A;  3AYI A;  1GRA A;  1EL8 A;  2RGO A;  4B68 A;  2YG6 A;  3UKF A;  3BNM A;  4J31 A;  1KNR A;  1Z6L A;  3CGD A; 
#chains in the Genus database with same CATH topology
 3HYW A;  5IQ4 A;  5JCM A;  2WP9 A;  3KKJ A;  3K7T A;  1VG9 A;  1PBE A;  3UKK A;  3KLJ A;  3DJD A;  2YG7 A;  4RG4 A;  1GER A;  4A5L A;  3G5Q A;  3GMC A;  2YM2 A;  3DK9 A;  3NLC A;  1E6E A;  3ICT A;  4H2P A;  2XLU A;  3T37 A;  4K2X A;  3II4 A;  5FS6 A;  3SZ0 A;  4UDR A;  1PBC A;  3IC9 A;  1P2E A;  1EL9 A;  2VVM A;  2WU2 A;  1QJD A;  3FG2 P;  3GDP A;  3K7M X;  4K22 A;  4EMW A;  3UTG A;  4BK3 A;  3GYJ A;  4A65 A;  1GRF A;  2BC0 A;  2JB1 A;  3DJG X;  3EPT A;  4NZH A;  1EL5 A;  4NNJ A;  5TR3 A;  4EMJ A;  2A89 A;  1EL7 A;  2A8X A;  2W0H A;  3VRA A;  5JCI A;  3ICS A;  1YY5 A;  1F3P A;  3DH9 A;  3UTF A;  3QFB A;  4Y4M A;  4CBQ A;  5FMH A;  3AE9 A;  3T14 A;  1DXL A;  2Y6Q A;  2XVF A;  4OPL A;  2Y6R A;  3AE3 A;  3P4Q A;  4J2W A;  3H4K A;  5EOW A;  3DA1 A;  3V3N A;  1FOH A;  1DOB A;  1ZOY A;  3CGB A;  1GXF A;  4RSL A;  2YVJ A;  1GRB A;  2YVF A;  2XVI A;  1RYI A;  3AEC A;  5CQF A;  2R0P A;  3SGL A;  3OC4 A;  5BUK A;  2XFU A;  3K30 A;  4H7U A;  4CRT A;  5KOW A;  3I3L A;  3KPK A;  1D4E A;  4II2 A;  4RG3 A;  1ZP0 A;  2Q7V A;  2YLZ A;  1D7L A;  2ZBW A;  5KOX A;  3GD3 A;  3NT6 A;  4BK2 A;  3P1W A;  5KRQ A;  2R9Z A;  3CNP A;  2EQ9 A;  1F8S A;  3AE1 A;  4EQR A;  4FK1 A;  2YQU A;  3CGC A;  1VG0 A;  1O5W A;  1CF3 A;  2YR4 A;  4UP3 A;  4YKG A;  3ADA B;  3ATR A;  1BF3 A;  3F8D A;  3AD8 B;  3KVE A;  3VRB A;  4G6G A;  4DGK A;  1N1P A;  3LB8 A;  2R0G A;  2YG5 A;  3ABV A;  2B9W A;  1W4X A;  3P9U A;  4BJY A;  1E1L A;  2WS3 A;  1FEC A;  3LZW A;  1ZK7 A;  3OZ2 A;  2WES A;  1O95 A;  2C72 A;  2XFP A;  3CPI G;  2YR6 A;  4I59 A;  3CIR A;  3B3R A;  2X8C A;  1PBD A;  3F8R A;  1E7P A;  3UP5 A;  4G73 A;  3DJE A;  3NK2 X;  3RHA A;  1M6I A;  5ER0 A;  2GRT A;  1H6V A;  2XFO A;  1CC6 A;  4NTC A;  1E1M A;  1NEN A;  2BAB A;  5M0Z A;  4A99 A;  2GR0 A;  2JAE A;  3G5R A;  2GVC A;  3SYI A;  1TDK A;  1IUS A;  5J7X A;  3ALL A;  1ZKQ A;  4JDR A;  2WU5 A;  3BI4 A;  2XVE A;  5M10 A;  1H86 A;  2VQB A;  2Z5X A;  3FBS A;  4U8N A;  4AT2 A;  2E1M A;  4PAA A;  2H89 A;  4XWR A;  2JBV A;  3UP4 A;  4GR1 A;  3UOY A;  5JCK A;  1PDH A;  3C96 A;  1FEA A;  4H4U A;  2YLT A;  3DJJ A;  4PAB A;  3UKQ A;  3KA7 A;  2WPF A;  4IV9 A;  5EB5 A;  2YAU A;  4YTP A;  3LJP A;  3UOZ A;  3Q9T A;  2WHD A;  2X3N A;  1QLB A;  4OPG A;  3K7Q X;  1KF6 A;  2WPE A;  4YXD A;  1IJH A;  3V3O A;  4Z44 A;  1GEU A;  3COX A;  5HY5 A;  1OJA A;  3C4N A;  2FJB A;  1JU2 A;  1TYP A;  4YWO A;  4BJZ A;  2XVH A;  1FL2 A;  2YR5 A;  2PYX A;  2BRY A;  2XLT A;  3GYX A;  3LAD A;  3SQP A;  1D5T A;  3KPF A;  1D4D A;  3NH3 X;  3DME A;  1NAA A;  1NHP A;  5KVH A;  3EAN A;  3AED A;  4H4S A;  4A9W A;  2C64 A;  2VZ2 A;  2CUL A;  2PHH A;  4K5S A;  4YKF A;  2FJE A;  1E39 A;  1TDE A;  2C65 A;  3CPH G;  5U1O A;  4EIP A;  1LPF A;  2ACZ A;  2ZZC A;  1K0I A;  4TLX A;  4JNQ A;  1GRH A;  2B7S A;  4EQW A;  1TDF A;  3ALM A;  4U8P A;  3RP8 A;  2A87 A;  3NYC A;  3SZW A;  3QFA A;  4EMI A;  3C4A A;  3UKL A;  4C74 A;  3ALJ A;  4J56 A;  1VDC A;  4KX6 A;  3RNM A;  4OPC A;  4M52 A;  4JN9 A;  3T0K A;  3AEG A;  4U8M A;  4YSZ A;  1PXC A;  1E1K A;  1N4U A;  2BCG G;  3SXI A;  2WDV A;  4G74 A;  2QA2 A;  1F8R A;  1CJC A;  3IF9 A;  4WCT A;  4A7A A;  3NKS A;  1GRG A;  1YQ4 A;  2BRA A;  1GAL A;  1GT8 A;  2VOU A;  3NN6 X;  3SFD A;  4D03 A;  1ZOV A;  1IUU A;  2GR3 A;  2EQ6 A;  3RP7 A;  4NEW A;  1B37 A;  3I6D A;  3HZL A;  2WOV A;  4YSX A;  4AP1 A;  4LU6 A;  3QVP A;  4Z2U A;  3NYE A;  5IQ1 A;  3NHO X;  1NG3 A;  4YT0 A;  4X9N A;  1BGJ A;  1XAN A;  5FS7 A;  1UKV G;  4GCM A;  2IVD A;  4AP3 A;  1XDI A;  3R9U A;  2BCP A;  4A6N B;  4YSY A;  3NYF A;  1LJ1 A;  1XPQ A;  4U8K A;  5HYM A;  3V76 A;  4Z26 A;  2V3B A;  3CPJ G;  1GOS A;  4Z2T A;  4GRT A;  3EF6 A;  1D4C A;  2B7R A;  3LZX A;  2V6O A;  2ZZ0 A;  1OJ9 A;  3AD7 B;  3NTA A;  1BGN A;  3CNT A;  3T2Z A;  3VQR A;  1N4V A;  2F5Z A;  4AOS A;  3PVC A;  1S2Q A;  1GES A;  2B9Y A;  4C3Y A;  3FIM B;  4XXG A;  1ZMC A;  4Z24 A;  3VR8 A;  2E5V A;  3T2K A;  5KMS A;  3GWF A;  1NG4 A;  1L9D A;  1TRB A;  3BHF A;  3QSM A;  1KNP A;  3GWD A;  2V60 A;  3BI2 A;  2Z5Y A;  3AEE A;  4BUR A;  4C5O A;  3CMM A;  3M13 A;  2QCU A;  2R4J A;  3AYL A;  1GPE A;  5L46 A;  2GF3 A;  3NTD A;  1K4Q A;  2GMJ A;  4U2T A;  1IUX A;  4JQ9 A;  2XVJ A;  4J57 A;  3RP6 A;  3SZC A;  1S3E A;  3ZDN A;  4GDE A;  2ARD A;  2XLS A;  1F6M A;  2VRL A;  3ISH A;  2C66 A;  4I58 A;  3SX6 A;  4ECH A;  2C67 A;  3BI5 A;  1PS9 A;  3LOV A;  1KDG A;  3UOV A;  2X50 A;  4GAV A;  1SEZ A;  1GRT A;  3URH A;  4DSG A;  5KWF A;  4GAP A;  1AOG A;  1N4W A;  2XCG A;  4CCQ A;  1K0L A;  1KSU A;  2DKH A;  4GUV A;  3AYJ A;  3P4S A;  1VRQ B;  3D8X A;  1X31 B;  2JK6 A;  2V3A A;  1PJ7 A;  4BK1 A;  3B6D A;  4EQX A;  4CY6 A;  5BRT A;  4C77 A;  2VQ7 A;  2YLR A;  3KD9 A;  2R45 A;  1JRZ A;  1CBO A;  3GRT A;  2BYB A;  1COY A;  2CVJ A;  1DOD A;  5FS9 A;  1MO9 A;  3AE5 A;  3CND A;  2OLN A;  1NHQ A;  2EQ8 A;  4WX1 A;  4Z2R A;  2GAG B;  1NPX A;  4JNA A;  2VVL A;  1Q1R A;  3FPZ A;  2C70 A;  2EQ7 A;  2XDO A;  3BHK A;  1H7X A;  4CY8 A;  1FEB A;  4B63 A;  2VVL G;  2Q6U A;  1ZX9 A;  1P2H A;  1M64 A;  2GAH B;  4TM1 A;  4H4Q A;  1KSS A;  2JB3 A;  2YLX A;  3G5S A;  1V59 A;  4N9X A;  3S5W A;  3DGH A;  5JCL A;  1DOC A;  4D04 A;  2WDQ A;  4H4V A;  1IUW A;  1CJ4 A;  4JY2 A;  2WEU A;  2XLP A;  2GQF A;  2TMD A;  2XFQ A;  2GR1 A;  3NN0 X;  3UTE A;  2V61 A;  3GDN A;  4ICY A;  4MJW A;  1OJD A;  4TM3 A;  4CNJ A;  2X99 A;  2BA9 A;  2RAB A;  4NTE A;  3LXD A;  1TYT A;  1NDA A;  2YLS A;  4X9M A;  1GRE A;  2TPR A;  1QO8 A;  1D7Y A;  1GTE A;  1JRX A;  1NEK A;  4OPU A;  1LVL A;  5CKU A;  4U8O A;  3SZF A;  4U8I A;  1PBB A;  1PHH A;  1RP0 A;  1CL0 A;  2GR2 A;  4NWZ A;  3SM8 A;  2YM1 A;  2GQW A;  3H8L A;  4H4T A;  5EBK A;  4P9S A;  2OAM A;  4DSH A;  1E1N A;  2GMH A;  1Q9I A;  2WBA A;  3GYI A;  3ATQ A;  3DK8 A;  1YQ3 A;  3AE4 A;  4IA5 A;  5HXI A;  1GND A;  1OJT A;  1OJC A;  1YQZ A;  4O5U A;  1DJN A;  4AT0 A;  2BS4 A;  4IVM B;  4Y4L A;  2WP6 A;  4B65 A;  5IPY A;  2JB2 A;  2H88 A;  3P4P A;  2OLO A;  4CCR A;  2XFN A;  1VQW A;  2RGJ A;  2BXR A;  3L1R A;  4H4R A;  3NNE A;  4LII A;  4H4Y A;  2VRM A;  1Y56 B;  5C2T A;  4E0V A;  5KMP A;  2R0C A;  4AOX A;  1Y0P A;  1REO A;  4EM4 A;  4USQ A;  1Q1W A;  4USR A;  3AEB A;  3AWI A;  4X4J A;  1LQU A;  4KPR A;  1LV0 A;  2YG4 A;  3NGC X;  2BK3 A;  3AEA A;  2WPC A;  4K8D A;  1H7W A;  4OPD A;  2APG A;  2C73 A;  3CGE A;  1S3B A;  3UKA A;  3GRS A;  2BXS A;  2GB0 A;  2NVK X;  1H82 A;  1CHU A;  1BWC A;  2GEW A;  1PN0 A;  3PO7 A;  4Y4N A;  3UOX A;  2C75 A;  1GV4 A;  3QJ4 A;  1ONF A;  5KNL A;  4FK1 C;  4U8J A;  1B5Q A;  2XLR A;  3L8K A;  4UDQ A;  4A6N A;  1BKW A;  2C76 A;  3NK1 X;  1ELI A;  2BK4 A;  2C4C A;  3VRD B;  2J3N A;  5KVI A;  2WDR A;  2AAQ A;  2BS3 A;  1JRY A;  3F8P A;  2WET A;  2AR8 A;  1L0V A;  4ZCC A;  5FS8 A;  4NEV A;  1F8W A;  4XWZ A;  2YVG A;  5J60 A;  2R46 A;  4U2L A;  5DBJ A;  5KMQ A;  1PJ6 A;  4YSH A;  3WE0 A;  1O94 A;  3AEF A;  1BZL A;  1PBF A;  2I0Z A;  2Q0K A;  4U2S A;  3SY4 A;  3Q6J A;  4H2R A;  3ITJ A;  3RED A;  5KXJ A;  4G9K A;  4EM3 A;  1JNR A;  1H84 A;  1DOE A;  3CNS A;  2OA1 A;  2DKI A;  3P4R A;  4ZCD A;  2B76 A;  3T2Y A;  2C3C A;  2BK5 A;  1B8S A;  1CC2 A;  1LTX R;  3DGZ A;  2BC1 A;  1MXT A;  2FJA A;  3NIX A;  3NRN A;  4APN A;  1MOK A;  3AB1 A;  2O9Z A;  4TM0 A;  4LA1 A;  5GRT A;  5BVA A;  2JKC A;  3CTY A;  2BAC A;  2E4G A;  3SFE A;  3ZYX A;  3HYV A;  3IWA A;  4G6H A;  2CDU A;  4Z43 A;  1LQT A;  4EQS A;  1CJ3 A;  2FBW A;  3JSK A;  4OVI A;  3H8I A;  4YTN A;  1H83 A;  1PXA A;  3QVR A;  1CJ2 A;  1NHS A;  1K0J A;  2X8H A;  4O5Q A;  2BS2 A;  2V5Z A;  4REK A;  4A79 A;  1GET A;  4TM4 A;  1JNZ A;  2C7G A;  3UCL A;  4ZN0 A;  1GTH A;  5BUL A;  1TDN A;  1YKJ A;  4OCG A;  1JEH A;  3UKP A;  4B64 A;  4GDP A;  3AE7 A;  5U63 A;  2QA1 A;  2R4E A;  4J34 A;  3AD9 B;  5U25 A;  5LV9 A;  3NG7 X;  5GSN A;  1TDO A;  4FDC B;  4ADW A;  4YTM A;  4C3X A;  1GSN A;  3KU9 A;  3GMB A;  3EAO A;  4B66 A;  2B9X A;  5JCN A;  2WOI A;  4H50 A;  2WQY A;  4GF7 A;  2ZZB A;  3M12 A;  4HB9 A;  3VR9 A;  4B69 A;  2X8G A;  2WOW A;  4IVO B;  1JOA A;  2IID A;  1L9C A;  3QSS A;  4U8L A;  4H4Z A;  4NTD A;  5KMR A;  1ZMD A;  3UKH A;  4H4X A;  4H2Q A;  2YG3 A;  3AE6 A;  4K5R A;  2YLW A;  4II3 A;  3M0O A;  3T31 A;  1EBD A;  2AQJ A;  1DJQ A;  1PXB A;  3D1C A;  2GH5 A;  2C3D A;  3AE2 A;  2NPX A;  1CC4 A;  4JY3 A;  3CN8 A;  4DNA A;  5C3J A;  5HHF A;  1B4V A;  1HYU A;  4BV6 A;  4Z25 A;  2CFY A;  4H4W A;  3GSI A;  1H81 A;  3PS9 A;  4J36 A;  1ZY8 A;  3HYX A;  4UDP A;  3ICR A;  1RSG A;  1S2Y A;  3GD4 A;  3IHM A;  4K7Z A;  4H2N A;  1DNC A;  4J33 A;  2UZZ A;  4OPI A;  2IVE A;  3O0H A;  3BNU A;  2FJD A;  3QSE A;  2GV8 A;  4TLZ A;  4FX9 A;  3AE8 A;  1PJ5 A;  4B1B A;  2XYO A;  1ZDL A;  2QAE A;  3S61 A;  2WP5 A;  4HA6 A;  3IHG A;  3AXB A;  4B67 A;  2OAL A;  3UTH A;  1IUV A;  1L9E A;  4EIQ A;  1FCD A;  4H4P A;  1XHC A;  4OPT A;  1IUT A;  3NK0 X;  5EB4 A;  2RGH A;  1NHR A;  2YWL A;  2HQM A;  3DK4 A;  3E1T A;  4CNK A;  2Q0L A;  1Y56 A;  1KFY A;  4IA6 A;  3FMW A;  3CNJ A;  3AYI A;  1GRA A;  1EL8 A;  2RGO A;  4B68 A;  2YG6 A;  3UKF A;  3BNM A;  4J31 A;  1KNR A;  1Z6L A;  3CGD A; 
#chains in the Genus database with same CATH homology
 3HYW A;  5IQ4 A;  5JCM A;  2WP9 A;  3KKJ A;  3K7T A;  1VG9 A;  1PBE A;  3UKK A;  3KLJ A;  3DJD A;  2YG7 A;  4RG4 A;  1GER A;  4A5L A;  3G5Q A;  3GMC A;  2YM2 A;  3DK9 A;  3NLC A;  1E6E A;  3ICT A;  4H2P A;  2XLU A;  3T37 A;  4K2X A;  3II4 A;  5FS6 A;  3SZ0 A;  4UDR A;  1PBC A;  3IC9 A;  1P2E A;  1EL9 A;  2VVM A;  2WU2 A;  1QJD A;  3FG2 P;  3GDP A;  3K7M X;  4K22 A;  4EMW A;  3UTG A;  4BK3 A;  3GYJ A;  4A65 A;  1GRF A;  2BC0 A;  2JB1 A;  3DJG X;  3EPT A;  4NZH A;  1EL5 A;  4NNJ A;  5TR3 A;  4EMJ A;  2A89 A;  1EL7 A;  2A8X A;  2W0H A;  3VRA A;  5JCI A;  3ICS A;  1YY5 A;  1F3P A;  3DH9 A;  3UTF A;  3QFB A;  4Y4M A;  4CBQ A;  5FMH A;  3AE9 A;  3T14 A;  1DXL A;  2Y6Q A;  2XVF A;  4OPL A;  2Y6R A;  3AE3 A;  3P4Q A;  4J2W A;  3H4K A;  5EOW A;  3DA1 A;  3V3N A;  1FOH A;  1DOB A;  1ZOY A;  3CGB A;  1GXF A;  4RSL A;  2YVJ A;  1GRB A;  2YVF A;  2XVI A;  1RYI A;  3AEC A;  5CQF A;  2R0P A;  3SGL A;  3OC4 A;  5BUK A;  2XFU A;  3K30 A;  4H7U A;  4CRT A;  5KOW A;  3I3L A;  3KPK A;  1D4E A;  4II2 A;  4RG3 A;  1ZP0 A;  2Q7V A;  2YLZ A;  1D7L A;  2ZBW A;  5KOX A;  3GD3 A;  3NT6 A;  4BK2 A;  3P1W A;  5KRQ A;  2R9Z A;  3CNP A;  2EQ9 A;  1F8S A;  3AE1 A;  4EQR A;  4FK1 A;  2YQU A;  3CGC A;  1VG0 A;  1O5W A;  1CF3 A;  2YR4 A;  4UP3 A;  4YKG A;  3ADA B;  3ATR A;  1BF3 A;  3F8D A;  3AD8 B;  3KVE A;  3VRB A;  4G6G A;  4DGK A;  1N1P A;  3LB8 A;  2R0G A;  2YG5 A;  3ABV A;  2B9W A;  1W4X A;  3P9U A;  4BJY A;  1E1L A;  2WS3 A;  1FEC A;  3LZW A;  1ZK7 A;  3OZ2 A;  2WES A;  1O95 A;  2C72 A;  2XFP A;  3CPI G;  2YR6 A;  4I59 A;  3CIR A;  3B3R A;  2X8C A;  1PBD A;  3F8R A;  1E7P A;  3UP5 A;  4G73 A;  3DJE A;  3NK2 X;  3RHA A;  1M6I A;  5ER0 A;  2GRT A;  1H6V A;  2XFO A;  1CC6 A;  4NTC A;  1E1M A;  1NEN A;  2BAB A;  5M0Z A;  4A99 A;  2GR0 A;  2JAE A;  3G5R A;  2GVC A;  3SYI A;  1TDK A;  1IUS A;  5J7X A;  3ALL A;  1ZKQ A;  4JDR A;  2WU5 A;  3BI4 A;  2XVE A;  5M10 A;  1H86 A;  2VQB A;  2Z5X A;  3FBS A;  4U8N A;  4AT2 A;  2E1M A;  4PAA A;  2H89 A;  4XWR A;  2JBV A;  3UP4 A;  4GR1 A;  3UOY A;  5JCK A;  1PDH A;  3C96 A;  1FEA A;  4H4U A;  2YLT A;  3DJJ A;  4PAB A;  3UKQ A;  3KA7 A;  2WPF A;  4IV9 A;  5EB5 A;  2YAU A;  4YTP A;  3LJP A;  3UOZ A;  3Q9T A;  2WHD A;  2X3N A;  1QLB A;  4OPG A;  3K7Q X;  1KF6 A;  2WPE A;  4YXD A;  1IJH A;  3V3O A;  4Z44 A;  1GEU A;  3COX A;  5HY5 A;  1OJA A;  3C4N A;  2FJB A;  1JU2 A;  1TYP A;  4YWO A;  4BJZ A;  2XVH A;  1FL2 A;  2YR5 A;  2PYX A;  2BRY A;  2XLT A;  3GYX A;  3LAD A;  3SQP A;  1D5T A;  3KPF A;  1D4D A;  3NH3 X;  3DME A;  1NAA A;  1NHP A;  5KVH A;  3EAN A;  3AED A;  4H4S A;  4A9W A;  2C64 A;  2VZ2 A;  2CUL A;  2PHH A;  4K5S A;  4YKF A;  2FJE A;  1E39 A;  1TDE A;  2C65 A;  3CPH G;  5U1O A;  4EIP A;  1LPF A;  2ACZ A;  2ZZC A;  1K0I A;  4TLX A;  4JNQ A;  1GRH A;  2B7S A;  4EQW A;  1TDF A;  3ALM A;  4U8P A;  3RP8 A;  2A87 A;  3NYC A;  3SZW A;  3QFA A;  4EMI A;  3C4A A;  3UKL A;  4C74 A;  3ALJ A;  4J56 A;  1VDC A;  4KX6 A;  3RNM A;  4OPC A;  4M52 A;  4JN9 A;  3T0K A;  3AEG A;  4U8M A;  4YSZ A;  1PXC A;  1E1K A;  1N4U A;  2BCG G;  3SXI A;  2WDV A;  4G74 A;  2QA2 A;  1F8R A;  1CJC A;  3IF9 A;  4WCT A;  4A7A A;  3NKS A;  1GRG A;  1YQ4 A;  2BRA A;  1GAL A;  1GT8 A;  2VOU A;  3NN6 X;  3SFD A;  4D03 A;  1ZOV A;  1IUU A;  2GR3 A;  2EQ6 A;  3RP7 A;  4NEW A;  1B37 A;  3I6D A;  3HZL A;  2WOV A;  4YSX A;  4AP1 A;  4LU6 A;  3QVP A;  4Z2U A;  3NYE A;  5IQ1 A;  3NHO X;  1NG3 A;  4YT0 A;  4X9N A;  1BGJ A;  1XAN A;  5FS7 A;  1UKV G;  4GCM A;  2IVD A;  4AP3 A;  1XDI A;  3R9U A;  2BCP A;  4A6N B;  4YSY A;  3NYF A;  1LJ1 A;  1XPQ A;  4U8K A;  5HYM A;  3V76 A;  4Z26 A;  2V3B A;  3CPJ G;  1GOS A;  4Z2T A;  4GRT A;  3EF6 A;  1D4C A;  2B7R A;  3LZX A;  2V6O A;  2ZZ0 A;  1OJ9 A;  3AD7 B;  3NTA A;  1BGN A;  3CNT A;  3T2Z A;  3VQR A;  1N4V A;  2F5Z A;  4AOS A;  3PVC A;  1S2Q A;  1GES A;  2B9Y A;  4C3Y A;  3FIM B;  4XXG A;  1ZMC A;  4Z24 A;  3VR8 A;  2E5V A;  3T2K A;  5KMS A;  3GWF A;  1NG4 A;  1L9D A;  1TRB A;  3BHF A;  3QSM A;  1KNP A;  3GWD A;  2V60 A;  3BI2 A;  2Z5Y A;  3AEE A;  4BUR A;  4C5O A;  3CMM A;  3M13 A;  2QCU A;  2R4J A;  3AYL A;  1GPE A;  5L46 A;  2GF3 A;  3NTD A;  1K4Q A;  2GMJ A;  4U2T A;  1IUX A;  4JQ9 A;  2XVJ A;  4J57 A;  3RP6 A;  3SZC A;  1S3E A;  3ZDN A;  4GDE A;  2ARD A;  2XLS A;  1F6M A;  2VRL A;  3ISH A;  2C66 A;  4I58 A;  3SX6 A;  4ECH A;  2C67 A;  3BI5 A;  1PS9 A;  3LOV A;  1KDG A;  3UOV A;  2X50 A;  4GAV A;  1SEZ A;  1GRT A;  3URH A;  4DSG A;  5KWF A;  4GAP A;  1AOG A;  1N4W A;  2XCG A;  4CCQ A;  1K0L A;  1KSU A;  2DKH A;  4GUV A;  3AYJ A;  3P4S A;  1VRQ B;  3D8X A;  1X31 B;  2JK6 A;  2V3A A;  1PJ7 A;  4BK1 A;  3B6D A;  4EQX A;  4CY6 A;  5BRT A;  4C77 A;  2VQ7 A;  2YLR A;  3KD9 A;  2R45 A;  1JRZ A;  1CBO A;  3GRT A;  2BYB A;  1COY A;  2CVJ A;  1DOD A;  5FS9 A;  1MO9 A;  3AE5 A;  3CND A;  2OLN A;  1NHQ A;  2EQ8 A;  4WX1 A;  4Z2R A;  2GAG B;  1NPX A;  4JNA A;  2VVL A;  1Q1R A;  3FPZ A;  2C70 A;  2EQ7 A;  2XDO A;  3BHK A;  1H7X A;  4CY8 A;  1FEB A;  4B63 A;  2VVL G;  2Q6U A;  1ZX9 A;  1P2H A;  1M64 A;  2GAH B;  4TM1 A;  4H4Q A;  1KSS A;  2JB3 A;  2YLX A;  3G5S A;  1V59 A;  4N9X A;  3S5W A;  3DGH A;  5JCL A;  1DOC A;  4D04 A;  2WDQ A;  4H4V A;  1IUW A;  1CJ4 A;  4JY2 A;  2WEU A;  2XLP A;  2GQF A;  2TMD A;  2XFQ A;  2GR1 A;  3NN0 X;  3UTE A;  2V61 A;  3GDN A;  4ICY A;  4MJW A;  1OJD A;  4TM3 A;  4CNJ A;  2X99 A;  2BA9 A;  2RAB A;  4NTE A;  3LXD A;  1TYT A;  1NDA A;  2YLS A;  4X9M A;  1GRE A;  2TPR A;  1QO8 A;  1D7Y A;  1GTE A;  1JRX A;  1NEK A;  4OPU A;  1LVL A;  5CKU A;  4U8O A;  3SZF A;  4U8I A;  1PBB A;  1PHH A;  1RP0 A;  1CL0 A;  2GR2 A;  4NWZ A;  3SM8 A;  2YM1 A;  2GQW A;  3H8L A;  4H4T A;  5EBK A;  4P9S A;  2OAM A;  4DSH A;  1E1N A;  2GMH A;  1Q9I A;  2WBA A;  3GYI A;  3ATQ A;  3DK8 A;  1YQ3 A;  3AE4 A;  4IA5 A;  5HXI A;  1GND A;  1OJT A;  1OJC A;  1YQZ A;  4O5U A;  1DJN A;  4AT0 A;  2BS4 A;  4IVM B;  4Y4L A;  2WP6 A;  4B65 A;  5IPY A;  2JB2 A;  2H88 A;  3P4P A;  2OLO A;  4CCR A;  2XFN A;  1VQW A;  2RGJ A;  2BXR A;  3L1R A;  4H4R A;  3NNE A;  4LII A;  4H4Y A;  2VRM A;  1Y56 B;  5C2T A;  4E0V A;  5KMP A;  2R0C A;  4AOX A;  1Y0P A;  1REO A;  4EM4 A;  4USQ A;  1Q1W A;  4USR A;  3AEB A;  3AWI A;  4X4J A;  1LQU A;  4KPR A;  1LV0 A;  2YG4 A;  3NGC X;  2BK3 A;  3AEA A;  2WPC A;  4K8D A;  1H7W A;  4OPD A;  2APG A;  2C73 A;  3CGE A;  1S3B A;  3UKA A;  3GRS A;  2BXS A;  2GB0 A;  2NVK X;  1H82 A;  1CHU A;  1BWC A;  2GEW A;  1PN0 A;  3PO7 A;  4Y4N A;  3UOX A;  2C75 A;  1GV4 A;  3QJ4 A;  1ONF A;  5KNL A;  4FK1 C;  4U8J A;  1B5Q A;  2XLR A;  3L8K A;  4UDQ A;  4A6N A;  1BKW A;  2C76 A;  3NK1 X;  1ELI A;  2BK4 A;  2C4C A;  3VRD B;  2J3N A;  5KVI A;  2WDR A;  2AAQ A;  2BS3 A;  1JRY A;  3F8P A;  2WET A;  2AR8 A;  1L0V A;  4ZCC A;  5FS8 A;  4NEV A;  1F8W A;  4XWZ A;  2YVG A;  5J60 A;  2R46 A;  4U2L A;  5DBJ A;  5KMQ A;  1PJ6 A;  4YSH A;  3WE0 A;  1O94 A;  3AEF A;  1BZL A;  1PBF A;  2I0Z A;  2Q0K A;  4U2S A;  3SY4 A;  3Q6J A;  4H2R A;  3ITJ A;  3RED A;  5KXJ A;  4G9K A;  4EM3 A;  1JNR A;  1H84 A;  1DOE A;  3CNS A;  2OA1 A;  2DKI A;  3P4R A;  4ZCD A;  2B76 A;  3T2Y A;  2C3C A;  2BK5 A;  1B8S A;  1CC2 A;  1LTX R;  3DGZ A;  2BC1 A;  1MXT A;  2FJA A;  3NIX A;  3NRN A;  4APN A;  1MOK A;  3AB1 A;  2O9Z A;  4TM0 A;  4LA1 A;  5GRT A;  5BVA A;  2JKC A;  3CTY A;  2BAC A;  2E4G A;  3SFE A;  3ZYX A;  3HYV A;  3IWA A;  4G6H A;  2CDU A;  4Z43 A;  1LQT A;  4EQS A;  1CJ3 A;  2FBW A;  3JSK A;  4OVI A;  3H8I A;  4YTN A;  1H83 A;  1PXA A;  3QVR A;  1CJ2 A;  1NHS A;  1K0J A;  2X8H A;  4O5Q A;  2BS2 A;  2V5Z A;  4REK A;  4A79 A;  1GET A;  4TM4 A;  1JNZ A;  2C7G A;  3UCL A;  4ZN0 A;  1GTH A;  5BUL A;  1TDN A;  1YKJ A;  4OCG A;  1JEH A;  3UKP A;  4B64 A;  4GDP A;  3AE7 A;  5U63 A;  2QA1 A;  2R4E A;  4J34 A;  3AD9 B;  5U25 A;  5LV9 A;  3NG7 X;  5GSN A;  1TDO A;  4FDC B;  4ADW A;  4YTM A;  4C3X A;  1GSN A;  3KU9 A;  3GMB A;  3EAO A;  4B66 A;  2B9X A;  5JCN A;  2WOI A;  4H50 A;  2WQY A;  4GF7 A;  2ZZB A;  3M12 A;  4HB9 A;  3VR9 A;  4B69 A;  2X8G A;  2WOW A;  4IVO B;  1JOA A;  2IID A;  1L9C A;  3QSS A;  4U8L A;  4H4Z A;  4NTD A;  5KMR A;  1ZMD A;  3UKH A;  4H4X A;  4H2Q A;  2YG3 A;  3AE6 A;  4K5R A;  2YLW A;  4II3 A;  3M0O A;  3T31 A;  1EBD A;  2AQJ A;  1DJQ A;  1PXB A;  3D1C A;  2GH5 A;  2C3D A;  3AE2 A;  2NPX A;  1CC4 A;  4JY3 A;  3CN8 A;  4DNA A;  5C3J A;  5HHF A;  1B4V A;  1HYU A;  4BV6 A;  4Z25 A;  2CFY A;  4H4W A;  3GSI A;  1H81 A;  3PS9 A;  4J36 A;  1ZY8 A;  3HYX A;  4UDP A;  3ICR A;  1RSG A;  1S2Y A;  3GD4 A;  3IHM A;  4K7Z A;  4H2N A;  1DNC A;  4J33 A;  2UZZ A;  4OPI A;  2IVE A;  3O0H A;  3BNU A;  2FJD A;  3QSE A;  2GV8 A;  4TLZ A;  4FX9 A;  3AE8 A;  1PJ5 A;  4B1B A;  2XYO A;  1ZDL A;  2QAE A;  3S61 A;  2WP5 A;  4HA6 A;  3IHG A;  3AXB A;  4B67 A;  2OAL A;  3UTH A;  1IUV A;  1L9E A;  4EIQ A;  1FCD A;  4H4P A;  1XHC A;  4OPT A;  1IUT A;  3NK0 X;  5EB4 A;  2RGH A;  1NHR A;  2YWL A;  2HQM A;  3DK4 A;  3E1T A;  4CNK A;  2Q0L A;  1Y56 A;  1KFY A;  4IA6 A;  3FMW A;  3CNJ A;  3AYI A;  1GRA A;  1EL8 A;  2RGO A;  4B68 A;  2YG6 A;  3UKF A;  3BNM A;  4J31 A;  1KNR A;  1Z6L A;  3CGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...