3KD9A

Crystal structure of pyridine nucleotide disulfide oxidoreductase from pyrococcus horikoshii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
442
structure length
418
Chain Sequence
b'SLKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSEVFIKKRGIDLHLNAEVIEVDTGYVRVRENGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDALAIREYMEKYKVENVVIIGGGYIGIEMAEAFAAQGKNVTMIVRGERVLRRSFDKEVTDILEEKLKKHVNLRLQEITMKIEGEERVEKVVTDAGEYKAELVILATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKELHFPGVLGTAVTKFMDVEIGKTGLTEMEALKEGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSDILPRIDTAAAMLMAGFTTKDAFFTDLAYAPPFAPVWDPLIVLARVLKEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme A disulfide reductase
publication title Crystal structure of pyridine nucleotide disulfide oxidoreductase from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
total genus 124
structure length 418
sequence length 442
chains with identical sequence B, C
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kd9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kd9A01
2XLTA 2YG7A 4A5LA 1OJTA 2BC1A 2YLSA 2C65A 3CGBA 3P4PA 4IA5A 4B68A 4Z25A 1BZLA 4H4WA 1FL2A 1P2EA 4H2NA 1LJ1A 5M0ZA 1GT8A 3QSSA 1D7LA 1PBBA 1PBEA 1E1NA 3CNTA 3KPFA 4J31A 2R45A 3UKFA 3DJJA 3G5QA 2WQYA 3UKQA 4J2WA 3H4KA 4YKFA 1FEAA 2XFQA 4TLXA 4YXDA 1NENA 3D8XA 2C3CA 4B69A 4CNJA 3H8LA 3IWAA 1PJ6A 2BC0A 2GV8A 3RP6A 1GRGA 4Y4NA 4EIQA 4A6NA 1YQZA 3KLJA 3NIXA 4Z24A 3FBSA 4DGKA 1CL0A 2Y6RA 4IVOB 5FS6A 4JNQA 2V3AA 3QSMA 3V3NA 1D4DA 1DODA 2ZZCA 3FPZA 1DOEA 3NGCX 1LQTA 3AEGA 1REOA 2VVMA 4BJYA 1N1PA 1K0IA 2V3BA 1BGNA 4KPRA 2ZZBA 3FIMB 4CCQA 3OC4A 1ONFA 1VG0A 4DNAA 1H83A 2XFUA 4CNKA 4TM0A 1LPFA 3UTFA 2Q0KA 2CDUA 2ARDA 4USQA 3FG2P 3QSEA 2C66A 3QVRA 3UTGA 3VR9A 2QCUA 3DJGX 2GEWA 2BCPA 2R4JA 2VOUA 4NTEA 2BK3A 3V3OA 1F3PA 3AYIA 4WX1A 4H4UA 1NHRA 3LZXA 3NK2X 4YTMA 3G5RA 3CGDA 3NN0X 4K2XA 1NDAA 4DSGA 4EMIA 3AE7A 1E7PA 2TMDA 3AWIA 1JU2A 4O5UA 2EQ6A 3GDPA 5J60A 1TDKA 4Y4MA 1JRZA 3NKSA 4B65A 3I3LA 1Y56A 3FMWA 3CNJA 3AYLA 3URHA 1NEKA 2AQJA 2GR2A 4LIIA 4EQRA 4WCTA 1GRBA 3H8IA 5EOWA 5KOXA 5KWFA 4H4PA 5KXJA 4Y4LA 4YSZA 1B37A 1VQWA 3ICSA 4YKGA 3UKLA 4O5QA 3VQRA 2AR8A 2R4EA 3B3RA 4GDPA 3RNMA 4AT2A 4FX9A 1E1LA 3CPJG 2XFPA 4EIPA 1PBDA 3GYJA 5L46A 1Q1RA 2DKIA 4NTDA 1E39A 3VRBA 1XHCA 1GRTA 2YWLA 2GF3A 1O94A 4NEVA 2C73A 1EL5A 4H4ZA 2X50A 3NTDA 2AAQA 1CHUA 1L0VA 5BVAA 3AE6A 1PJ7A 3M12A 1S2QA 3AEAA 2V6OA 1TDEA 1YKJA 1N4UA 2CVJA 3GDNA 4J33A 3L1RA 4K22A 2BXRA 1NHSA 1ZMCA 2GR3A 4BJZA 1JNRA 3G5SA 1RYIA 4XWRA 4U8NA 2JB2A 4GUVA 3CIRA 3P4QA 1N4WA 5HYMA 5LV9A 1N4VA 2JBVA 2XYOA 1B5QA 3SM8A 4EM4A 1O5WA 3IHMA 4GR1A 4UDQA 4EQXA 4Z2UA 1NAAA 4RG4A 4YTPA 3UP5A 3AD9B 5U25A 4D04A 4A7AA 2WPEA 3O0HA 3P9UA 1H86A 1D7YA 2V5ZA 3QJ4A 1H6VA 1TYTA 2WPCA 4GDEA 2WESA 1ZP0A 2IVEA 4YTNA 4RSLA 5FS7A 1IUUA 3AEEA 4BURA 1TDOA 3LXDA 1O95A 1GOSA 4A6NB 2VVLG 2C76A 2C67A 3UOYA 4EM3A 5CKUA 1CC4A 4U8JA 4K5SA 2XLRA 4JQ9A 4K7ZA 3KU9A 2XVIA 3AE9A 2IIDA 1GTHA 2QA2A 2GVCA 4B66A 1GESA 2WP6A 4B64A 3AXBA 4BK2A 1D4EA 3K30A 3M13A 3S61A 1CF3A 2OA1A 4HB9A 1TDFA 1CJ4A 3LOVA 1GTEA 1H84A 2B76A 2B9XA 3NN6X 2QA1A 4DSHA 2XVFA 3NT6A 2APGA 1ZKQA 3Q9TA 2ZZ0A 2X99A 3LB8A 4FK1A 4H2RA 5FMHA 3T37A 2BK5A 1B4VA 3ZDNA 4ZCDA 4CRTA 3AE4A 4GRTA 4H4TA 5EBKA 4J34A 2YQUA 4Z2RA 3PS9A 2H88A 3C4AA 3BI4A 3GWFA 1Y0PA 1Z6LA 1COYA 4EQSA 2XVEA 2V60A 1DOCA 4JY3A 4H7UA 1LQUA 2C75A 2WEUA 3SGLA 1NHPA 1L9CA 2X8HA 4U2SA 1PJ5A 4OPCA 2GAGB 3P1WA 1EL9A 4YSHA 5JCMA 1GEUA 5IPYA 2E4GA 2WBAA 4IV9A 2WP5A 1JRXA 2QAEA 2R0PA 2OLOA 1Y56B 2JB1A 3ALJA 3AE1A 1D4CA 4H2QA 4C3XA 5BULA 2YLTA 3EPTA 3CNDA 3KVEA 2OLNA 1GRHA 4J57A 2BACA 5KRQA 2WU2A 1F6MA 2YLRA 3ALLA 3ISHA 5CQFA 1GSNA 4APNA 1W4XA 3KA7A 1H82A 1ZMDA 4XXGA 3ALMA 3EF6A 4TM4A 2H89A 2RGOA 1KDGA 3BHKA 4TLZA 1B8SA 1GV4A 3PO7A 4FK1C 2WHDA 4ZCCA 1UKVG 3BI5A 1NG4A 1E1MA 4C3YA 4TM1A 1EL7A 2BS2A 3NG7X 4OPUA 5KOWA 2B9YA 1PXAA 3C96A 2X8GA 3ITJA 4U2LA 4CY8A 1XDIA 3AE8A 3AECA 1S3EA 1GRFA 4I58A 5BRTA 2BYBA 3UOZA 5KVHA 1IJHA 2ACZA 2A8XA 3CGCA 3VRAA 1PDHA 1L9EA 4ADWA 4ECHA 5FS9A 3AE3A 3F8DA 2YG5A 2YLXA 4PAAA 3K7TA 1GALA 1QLBA 3QFBA 1IUWA 4REKA 1DNCA 2XFNA 2WPFA 3UKKA 1FECA 2GMHA 1CC6A 2Y6QA 3AEFA 2EQ7A 4LA1A 4U8KA 4AP1A 2FJEA 4H4SA 1YQ3A 3JSKA 3R9UA 4YSYA 5U63A 3NYCA 2FJDA 1K0JA 2BCGG 1GNDA 1IUXA 1QJDA 2J3NA 1F8WA 3UOVA 1ZDLA 1JEHA 1LTXR 1SEZA 3CGEA 5DBJA 1NHQA 2VRLA 1E6EA 2B7RA 1KNRA 2YR6A 3DGZA 4ICYA 3GRSA 4Z44A 4OVIA 3DJEA 3RHAA 3GD4A 5HXIA 5IQ4A 2WETA 2EQ8A 3SFDA 4B67A 2WOIA 4Z26A 3ZYXA 4BK3A 1JRYA 4OPTA 3WE0A 1QO8A 1Q9IA 4YT0A 2YG3A 3II4A 4MJWA 3SQPA 1CJ2A 3K7QX 2PYXA 4AP3A 2RABA 1PS9A 2VVLA 2X8CA 1TDNA 2XVJA 3V76A 1H81A 1ZX9A 2R46A 4EMJA 3BHFA 4X9NA 4K8DA 3GMBA 1KFYA 5BUKA 3S5WA 1K4QA 4NZHA 2C3DA 2YG6A 4H4RA 1H7XA 1V59A 1BGJA 3GD3A 3LADA 2JKCA 1FOHA 2JK6A 3UKHA 1KSSA 1S2YA 2CFYA 1M64A 1P2HA 2WP9A 2X3NA 3NH3X 1AOGA 4PABA 5HY5A 2GH5A 2XFOA 3AEDA 3DK8A 5U1OA 4H4YA 4A99A 4J56A 4XWZA 2JB3A 2Q0LA 4AOSA 4J36A 4OCGA 2UZZA 3F8RA 2JAEA 3NNEA 2XLPA 2YLWA 2A87A 3UCLA 1PHHA 3F8PA 3GYIA 5IQ1A 1DOBA 1CJCA 2C70A 5JCIA 3ABVA 1DXLA 1F8SA 2BA9A 3LJPA 3UKAA 3AEBA 2YR5A 2RGHA 1IUSA 2VQ7A 4H4QA 2OAMA 4M52A 1MXTA 4UP3A 2GQFA 2IVDA 4B63A 4Z43A 2CULA 4X4JA 2FBWA 2YVFA 5J7XA 4OPLA 3CNPA 3NLCA 1KSUA 1MOKA 2FJAA 4AT0A 2C7GA 2FJBA 2YM2A 3AB1A 4RG3A 1FEBA 5EB4A 5C3JA 1EBDA 1PBCA 4EMWA 1JOAA 1PXBA 2GR0A 3P4RA 3OZ2A 3QVPA 4BV6A 3KKJA 1E1KA 1F8RA 4ZN0A 2GAHB 2B9WA 2WU5A 2XCGA 4U8PA 4U8IA 2O9ZA 3NRNA 2BXSA 1PXCA 2YLZA 3REDA 2XDOA 3KD9A 3M0OA 3ADAB 2Q7VA 3EANA 1XANA 4A65A 4U2TA 4EQWA 3E1TA 1VDCA 3ICRA 1PBFA 3NYFA 2E1MA 3ATQA 1BWCA 3IHGA 1VRQB 2YG4A 2WDVA 3COXA 3SFEA 2EQ9A 2WDQA 3AD8B 3B6DA 1ZY8A 4IVMB 4K5RA 1JNZA 5EB5A 4H4VA 3NK1X 1BKWA 3DMEA 4P9SA 5GSNA 1TRBA 2YR4A 3DK9A 2YM1A 2BK4A 2WS3A 1YQ4A 3P4SA 4JY2A 2PHHA 3GSIA 1IUTA 4HA6A 4JN9A 4JDRA 3CN8A 3BI2A 4CY6A 4H50A 4GCMA 1KF6A 2VRMA 1ZOYA 2E5VA 3K7MX 2R9ZA 1GETA 1VG9A 3NTAA 5TR3A 2BS4A 2GRTA 2WOVA 3CPHG 4IA6A 2OALA 4BK1A 3DJDA 2YVGA 4H4XA 3BNMA 4X9MA 3UOXA 2GB0A 3AD7B 1OJDA 3VRDB 4C5OA 2ZBWA 1D5TA 4YSXA 1YY5A 3GMCA 3RP8A 3BNUA 4D03A 1H7WA 4UDRA 1K0LA 2VZ2A 5HHFA 3UP4A 4TM3A 3GRTA 3AYJA 2Z5XA 4Z2TA 1OJCA 5JCNA 3RP7A 4YWOA 4AOXA 5GRTA 1GREA 1XPQA 4E0VA 3PVCA 4H2PA 1NG3A 4U8MA 4CBQA 3DA1A 2DKHA 3DGHA 2W0HA 1DJNA 1PN0A 3ICTA 1ZK7A 2NVKX 3UTHA 4OPDA 1S3BA 4NTCA 3AE5A 2R0GA 5M10A 3HZLA 3CTYA 3UKPA 2B7SA 2R0CA 4NEWA 5C2TA 2XLSA 4GF7A 4JNAA 4C74A 2HQMA 1ELIA 1FCDA 4U8OA 3UTEA 2YVJA 2C64A 1IUVA 1OJAA 2BABA 3L8KA 4LU6A 3DK4A 4FDCB 2XVHA 4UDPA 5FS8A 4A79A 4A9WA 2GMJA 4C77A 2GR1A 2YAUA 1CBOA 2XLUA 1DJQA 4KX6A 3EAOA 3I6DA 1LV0A 1BF3A 2WDRA 3QFAA 4N9XA 5JCKA 1Q1WA 5JCLA 5KVIA 2BS3A 2Z5YA 3Q6JA 1ZOVA 1GXFA 3D1CA 1LVLA 2NPXA 3DH9A 2F5ZA 2C72A 3NK0X 2GQWA 1MO9A 4B1BA 1OJ9A 3IC9A 1CJ3A 1KNPA 2TPRA 1GERA 1RP0A 4I59A 1M6IA 2A89A 3NYEA 5ER0A 2VQBA 1GRAA 1RSGA 3GWDA 3CNSA 1NPXA 3ATRA 3AE2A 2WOWA 3IF9A 1CC2A 1X31B 2I0ZA 1EL8A 4CCRA 3NHOX 3LZWA 2V61A 4OPGA 1GPEA 1HYUA 2RGJA 2Q6UA 1L9DA 3VR8A 3C4NA 4OPIA 4USRA 3CPIG 1TYPA 4U8LA
chains in the Genus database with same CATH superfamily
2XLTA 2YG7A 4A5LA 1OJTA 2BC1A 2YLSA 2C65A 3CGBA 3P4PA 4IA5A 4B68A 4Z25A 1BZLA 4H4WA 1FL2A 1P2EA 4H2NA 1LJ1A 5M0ZA 1GT8A 3QSSA 5KMSA 1D7LA 1PBBA 1PBEA 1E1NA 3CNTA 3KPFA 4J31A 2R45A 3UKFA 3DJJA 3G5QA 2WQYA 3UKQA 4J2WA 3SZCA 3H4KA 4YKFA 1FEAA 2XFQA 2BRYA 4TLXA 4YXDA 1NENA 4GAPA 3D8XA 2C3CA 5KNLA 4B69A 4CNJA 3H8LA 3IWAA 1PJ6A 2BC0A 2GV8A 3RP6A 1GRGA 4Y4NA 3T2KA 4EIQA 4A6NA 1YQZA 3KLJA 3NIXA 4Z24A 3FBSA 4DGKA 1CL0A 2Y6RA 4IVOB 5FS6A 4JNQA 2V3AA 3QSMA 3V3NA 1D4DA 1DODA 2ZZCA 3FPZA 3SZFA 1DOEA 3NGCX 1LQTA 3AEGA 1REOA 2VVMA 4BJYA 1N1PA 1K0IA 2V3BA 1BGNA 4KPRA 2ZZBA 3FIMB 4CCQA 3OC4A 1ONFA 1VG0A 4DNAA 1H83A 2XFUA 4CNKA 4TM0A 1LPFA 3UTFA 2Q0KA 2CDUA 2ARDA 4USQA 3FG2P 3QSEA 2C66A 3QVRA 3UTGA 3VR9A 2QCUA 3DJGX 2GEWA 2BCPA 2R4JA 2VOUA 4NTEA 2BK3A 3HYWA 3V3OA 1F3PA 3AYIA 4WX1A 4H4UA 1NHRA 3LZXA 3NK2X 4YTMA 3G5RA 3T2YA 3CGDA 3NN0X 4K2XA 1NDAA 4DSGA 4EMIA 3AE7A 1E7PA 2TMDA 3AWIA 1JU2A 4O5UA 2EQ6A 3GDPA 4G74A 5J60A 1TDKA 4Y4MA 1JRZA 3NKSA 4B65A 3I3LA 1Y56A 3FMWA 3CNJA 3AYLA 3URHA 1NEKA 2AQJA 2GR2A 4GAVA 4LIIA 4EQRA 4WCTA 3SYIA 1GRBA 3H8IA 4NNJA 5EOWA 5KOXA 5KWFA 4H4PA 5KXJA 4Y4LA 4YSZA 1B37A 1VQWA 3ICSA 4YKGA 3UKLA 4O5QA 3VQRA 2AR8A 3SX6A 2R4EA 3B3RA 3T14A 4GDPA 3RNMA 4AT2A 4FX9A 1E1LA 3CPJG 2XFPA 4EIPA 1PBDA 3CMMA 3GYJA 5L46A 1Q1RA 2DKIA 4NTDA 1E39A 3VRBA 1XHCA 1GRTA 2YWLA 2GF3A 1O94A 4NEVA 2C73A 1EL5A 4H4ZA 2C4CA 2X50A 3NTDA 2AAQA 1CHUA 1L0VA 5BVAA 3AE6A 1PJ7A 3M12A 1S2QA 3AEAA 2V6OA 1TDEA 1YKJA 1N4UA 2CVJA 3GDNA 4J33A 3L1RA 4K22A 2BXRA 1NHSA 1ZMCA 2GR3A 4BJZA 1JNRA 3G5SA 1RYIA 4XWRA 4U8NA 2JB2A 4GUVA 3CIRA 3P4QA 1N4WA 5HYMA 5LV9A 1N4VA 2JBVA 2XYOA 1B5QA 3SM8A 4EM4A 3SZ0A 1O5WA 3IHMA 4GR1A 4UDQA 4EQXA 4Z2UA 1NAAA 4RG4A 4YTPA 3UP5A 3AD9B 5U25A 4D04A 4A7AA 2WPEA 3O0HA 3P9UA 1H86A 1D7YA 2V5ZA 3QJ4A 1H6VA 1TYTA 2WPCA 4GDEA 2WESA 1ZP0A 2IVEA 4YTNA 4RSLA 5FS7A 1IUUA 3AEEA 4BURA 1TDOA 3LXDA 1O95A 1GOSA 5KMQA 4A6NB 2VVLG 2C76A 2C67A 3UOYA 4EM3A 5CKUA 1CC4A 4U8JA 4K5SA 2XLRA 4JQ9A 4K7ZA 3KU9A 2XVIA 3AE9A 2IIDA 1GTHA 2QA2A 2GVCA 4B66A 1GESA 2WP6A 4B64A 3AXBA 4BK2A 1D4EA 3K30A 3M13A 3S61A 1CF3A 2OA1A 4HB9A 1TDFA 1CJ4A 3LOVA 1GTEA 1H84A 2B76A 2B9XA 3NN6X 2QA1A 4DSHA 2XVFA 3NT6A 2APGA 1ZKQA 3Q9TA 2ZZ0A 2X99A 3LB8A 4FK1A 4H2RA 5FMHA 3T37A 2BK5A 1B4VA 3T2ZA 4ZCDA 3ZDNA 4CRTA 3AE4A 4GRTA 4H4TA 5EBKA 4J34A 2YQUA 4Z2RA 3PS9A 2H88A 3C4AA 3BI4A 3GWFA 1Y0PA 1Z6LA 1COYA 4EQSA 2XVEA 2V60A 1DOCA 4JY3A 4H7UA 1LQUA 2C75A 2WEUA 3HYVA 5KMRA 3SGLA 1NHPA 1L9CA 2X8HA 4U2SA 3SZWA 1PJ5A 4OPCA 2GAGB 3P1WA 1EL9A 4YSHA 5JCMA 1GEUA 5IPYA 2E4GA 2WBAA 4IV9A 2WP5A 1JRXA 2QAEA 2R0PA 2OLOA 1Y56B 2JB1A 3ALJA 3AE1A 1D4CA 4H2QA 4C3XA 5BULA 2YLTA 3EPTA 3SY4A 3CNDA 3KVEA 2OLNA 1GRHA 4J57A 2BACA 4G6HA 5KRQA 2WU2A 1F6MA 2YLRA 3ALLA 3ISHA 5CQFA 1GSNA 4APNA 1W4XA 3KA7A 1H82A 1ZMDA 4XXGA 3ALMA 3EF6A 4TM4A 2H89A 2RGOA 1KDGA 3BHKA 3HYXA 4TLZA 1B8SA 1GV4A 3PO7A 4FK1C 3T0KA 2WHDA 4ZCCA 1UKVG 3BI5A 1NG4A 1E1MA 4II2A 4TM1A 1EL7A 2BS2A 4C3YA 3NG7X 4OPUA 5KOWA 2B9YA 1PXAA 3C96A 2X8GA 3ITJA 4U2LA 4CY8A 1XDIA 3AE8A 3AECA 1S3EA 5KMPA 1GRFA 4I58A 5BRTA 2BYBA 3UOZA 5KVHA 1IJHA 2ACZA 2A8XA 3CGCA 3VRAA 1PDHA 1L9EA 4ADWA 4ECHA 5FS9A 3AE3A 3F8DA 2YG5A 2YLXA 4PAAA 3K7TA 1GALA 1QLBA 3QFBA 1IUWA 4II3A 1DNCA 2XFNA 4REKA 2WPFA 3UKKA 1FECA 2GMHA 1CC6A 2Y6QA 3AEFA 2EQ7A 3GYXA 4LA1A 4U8KA 4AP1A 2FJEA 4H4SA 1YQ3A 3JSKA 3R9UA 4YSYA 5U63A 3NYCA 2FJDA 1K0JA 2BCGG 1GNDA 1IUXA 1QJDA 2J3NA 1F8WA 3UOVA 1ZDLA 1JEHA 1LTXR 1SEZA 3CGEA 5DBJA 1NHQA 2VRLA 1E6EA 2B7RA 1KNRA 2YR6A 3DGZA 4ICYA 3GRSA 4Z44A 4OVIA 3DJEA 3RHAA 3GD4A 5HXIA 5IQ4A 2WETA 2EQ8A 3SFDA 4B67A 2WOIA 4Z26A 3ZYXA 4BK3A 1JRYA 4OPTA 3WE0A 1QO8A 1Q9IA 4YT0A 2YG3A 3II4A 4MJWA 3SQPA 1CJ2A 3K7QX 2PYXA 4AP3A 2RABA 1PS9A 2VVLA 2X8CA 1TDNA 2XVJA 3V76A 1H81A 1ZX9A 2R46A 4EMJA 3BHFA 4X9NA 4K8DA 3GMBA 1KFYA 5BUKA 3SXIA 3S5WA 1K4QA 4NZHA 2C3DA 2YG6A 4H4RA 1H7XA 1V59A 1BGJA 3GD3A 3LADA 2JKCA 1FOHA 2JK6A 3UKHA 3KPKA 1KSSA 1S2YA 2CFYA 1M64A 1P2HA 2WP9A 2X3NA 3NH3X 4G73A 1AOGA 4PABA 5HY5A 2GH5A 2XFOA 3AEDA 3DK8A 5U1OA 4H4YA 4A99A 4J56A 4XWZA 2JB3A 2Q0LA 4AOSA 4J36A 4OCGA 2UZZA 3F8RA 2JAEA 3NNEA 2XLPA 2YLWA 2A87A 3UCLA 1PHHA 3F8PA 3GYIA 5IQ1A 1DOBA 1CJCA 2C70A 5JCIA 3ABVA 1DXLA 1F8SA 2BA9A 3LJPA 3UKAA 3AEBA 3T31A 2YR5A 2RGHA 1IUSA 2VQ7A 4H4QA 2OAMA 4M52A 1MXTA 4UP3A 2GQFA 2IVDA 4B63A 4Z43A 2CULA 4X4JA 2FBWA 2YVFA 5J7XA 4OPLA 3CNPA 3NLCA 1KSUA 1MOKA 2FJAA 4AT0A 2C7GA 2FJBA 2YM2A 3AB1A 4RG3A 1FEBA 5EB4A 5C3JA 1EBDA 1PBCA 4EMWA 1JOAA 1PXBA 2GR0A 3P4RA 3OZ2A 3QVPA 4BV6A 3KKJA 1E1KA 1F8RA 4ZN0A 2GAHB 2B9WA 2WU5A 2XCGA 4U8PA 4U8IA 2O9ZA 3NRNA 2BXSA 1PXCA 2YLZA 3REDA 2XDOA 3KD9A 3M0OA 3ADAB 2Q7VA 3EANA 1XANA 4A65A 4U2TA 4EQWA 3E1TA 1VDCA 3ICRA 1PBFA 3NYFA 2E1MA 3ATQA 1BWCA 3IHGA 1VRQB 2YG4A 2WDVA 3COXA 3SFEA 2EQ9A 2WDQA 3AD8B 3B6DA 1ZY8A 4IVMB 4K5RA 1JNZA 5EB5A 4H4VA 3NK1X 1BKWA 3DMEA 4P9SA 5GSNA 1TRBA 2YR4A 4G9KA 3DK9A 2YM1A 2BK4A 2WS3A 1YQ4A 3P4SA 4JY2A 2PHHA 3GSIA 1IUTA 4HA6A 4JN9A 4JDRA 3CN8A 3BI2A 4CY6A 4H50A 4GCMA 1KF6A 2VRMA 1ZOYA 2E5VA 3K7MX 2R9ZA 1GETA 1VG9A 3NTAA 5TR3A 2BS4A 2GRTA 2WOVA 3CPHG 4IA6A 2OALA 4BK1A 3DJDA 2YVGA 4H4XA 3BNMA 4X9MA 3UOXA 2GB0A 3AD7B 1OJDA 3VRDB 4C5OA 2ZBWA 1D5TA 2BRAA 4YSXA 1YY5A 3GMCA 3RP8A 3BNUA 4D03A 1H7WA 4UDRA 1K0LA 2VZ2A 5HHFA 3UP4A 4TM3A 3GRTA 3AYJA 2Z5XA 4Z2TA 1OJCA 5JCNA 3RP7A 4YWOA 4AOXA 5GRTA 1GREA 1XPQA 4E0VA 3PVCA 4H2PA 1NG3A 4U8MA 4CBQA 3DA1A 2DKHA 3DGHA 2W0HA 1DJNA 1PN0A 3ICTA 1ZK7A 2NVKX 3UTHA 4OPDA 1S3BA 4NTCA 3AE5A 2R0GA 5M10A 4NWZA 3HZLA 3CTYA 3UKPA 2B7SA 2R0CA 4NEWA 5C2TA 2XLSA 4GF7A 4JNAA 4C74A 2HQMA 1ELIA 1FCDA 4U8OA 3UTEA 2YVJA 2C64A 1IUVA 1OJAA 2BABA 3L8KA 4LU6A 3DK4A 4FDCB 2XVHA 4UDPA 5FS8A 4A79A 4A9WA 2GMJA 4C77A 2GR1A 2YAUA 1CBOA 2XLUA 1DJQA 4KX6A 3EAOA 3I6DA 1LV0A 1BF3A 2WDRA 3QFAA 4N9XA 5JCKA 1Q1WA 5JCLA 5KVIA 2BS3A 2Z5YA 3Q6JA 1ZOVA 1GXFA 3D1CA 1LVLA 2NPXA 3DH9A 2F5ZA 4G6GA 2C72A 3NK0X 2GQWA 1MO9A 4B1BA 1OJ9A 3IC9A 1CJ3A 1KNPA 2TPRA 1GERA 1RP0A 4I59A 1M6IA 2A89A 3NYEA 5ER0A 2VQBA 1GRAA 1RSGA 3GWDA 3CNSA 1NPXA 3ATRA 3AE2A 2WOWA 3IF9A 1CC2A 1X31B 2I0ZA 1EL8A 4CCRA 3NHOX 3LZWA 2V61A 4OPGA 1GPEA 1HYUA 2RGJA 2Q6UA 1L9DA 3VR8A 3C4NA 4OPIA 4USRA 3CPIG 1TYPA 4U8LA
chains in the Genus database with same CATH topology
2XLTA 2YG7A 4A5LA 1OJTA 2BC1A 2YLSA 2C65A 3CGBA 3P4PA 4IA5A 4B68A 4Z25A 1BZLA 4H4WA 1FL2A 1P2EA 4H2NA 1LJ1A 5M0ZA 1GT8A 3QSSA 5KMSA 1D7LA 1PBBA 1PBEA 1E1NA 3CNTA 3KPFA 4J31A 2R45A 3UKFA 3DJJA 3G5QA 2WQYA 3UKQA 4J2WA 3SZCA 3H4KA 4YKFA 1FEAA 2XFQA 2BRYA 4TLXA 4YXDA 1NENA 4GAPA 3D8XA 2C3CA 5KNLA 4B69A 4CNJA 3H8LA 3IWAA 1PJ6A 2BC0A 2GV8A 3RP6A 1GRGA 4Y4NA 3T2KA 4EIQA 4A6NA 1YQZA 3KLJA 3NIXA 4Z24A 3FBSA 4DGKA 1CL0A 2Y6RA 4IVOB 5FS6A 4JNQA 2V3AA 3QSMA 3V3NA 1D4DA 1DODA 2ZZCA 3FPZA 3SZFA 1DOEA 3NGCX 1LQTA 3AEGA 1REOA 2VVMA 4BJYA 1N1PA 1K0IA 2V3BA 1BGNA 4KPRA 2ZZBA 3FIMB 4CCQA 3OC4A 1ONFA 1VG0A 4DNAA 1H83A 2XFUA 4CNKA 4TM0A 1LPFA 3UTFA 2Q0KA 2CDUA 2ARDA 4USQA 3FG2P 3QSEA 2C66A 3QVRA 3UTGA 3VR9A 2QCUA 3DJGX 2GEWA 2BCPA 2R4JA 2VOUA 4NTEA 2BK3A 3HYWA 3V3OA 1F3PA 3AYIA 4WX1A 4H4UA 1NHRA 3LZXA 3NK2X 4YTMA 3G5RA 3T2YA 3CGDA 3NN0X 4K2XA 1NDAA 4DSGA 4EMIA 3AE7A 1E7PA 2TMDA 3AWIA 1JU2A 4O5UA 2EQ6A 3GDPA 4G74A 5J60A 1TDKA 4Y4MA 1JRZA 3NKSA 4B65A 3I3LA 1Y56A 3FMWA 3CNJA 3AYLA 3URHA 1NEKA 2AQJA 2GR2A 4GAVA 4LIIA 4EQRA 4WCTA 3SYIA 1GRBA 3H8IA 4NNJA 5EOWA 5KOXA 5KWFA 4H4PA 5KXJA 4Y4LA 4YSZA 1B37A 1VQWA 3ICSA 4YKGA 3UKLA 4O5QA 3VQRA 2AR8A 3SX6A 2R4EA 3B3RA 3T14A 4GDPA 3RNMA 4AT2A 4FX9A 1E1LA 3CPJG 2XFPA 4EIPA 1PBDA 3CMMA 3GYJA 5L46A 1Q1RA 2DKIA 4NTDA 1E39A 3VRBA 1XHCA 1GRTA 2YWLA 2GF3A 1O94A 4NEVA 2C73A 1EL5A 4H4ZA 2C4CA 2X50A 3NTDA 2AAQA 1CHUA 1L0VA 5BVAA 3AE6A 1PJ7A 3M12A 1S2QA 3AEAA 2V6OA 1TDEA 1YKJA 1N4UA 2CVJA 3GDNA 4J33A 3L1RA 4K22A 2BXRA 1NHSA 1ZMCA 2GR3A 4BJZA 1JNRA 3G5SA 1RYIA 4XWRA 4U8NA 2JB2A 4GUVA 3CIRA 3P4QA 1N4WA 5HYMA 5LV9A 1N4VA 2JBVA 2XYOA 1B5QA 3SM8A 4EM4A 3SZ0A 1O5WA 3IHMA 4GR1A 4UDQA 4EQXA 4Z2UA 1NAAA 4RG4A 4YTPA 3UP5A 3AD9B 5U25A 4D04A 4A7AA 2WPEA 3O0HA 3P9UA 1H86A 1D7YA 2V5ZA 3QJ4A 1H6VA 1TYTA 2WPCA 4GDEA 2WESA 1ZP0A 2IVEA 4YTNA 4RSLA 5FS7A 1IUUA 3AEEA 4BURA 1TDOA 3LXDA 1O95A 1GOSA 5KMQA 4A6NB 2VVLG 2C76A 2C67A 3UOYA 4EM3A 5CKUA 1CC4A 4U8JA 4K5SA 2XLRA 4JQ9A 4K7ZA 3KU9A 2XVIA 3AE9A 2IIDA 1GTHA 2QA2A 2GVCA 4B66A 1GESA 2WP6A 4B64A 3AXBA 4BK2A 1D4EA 3K30A 3M13A 3S61A 1CF3A 2OA1A 4HB9A 1TDFA 1CJ4A 3LOVA 1GTEA 1H84A 2B76A 2B9XA 3NN6X 2QA1A 4DSHA 2XVFA 3NT6A 2APGA 1ZKQA 3Q9TA 2ZZ0A 2X99A 3LB8A 4FK1A 4H2RA 5FMHA 3T37A 2BK5A 1B4VA 3T2ZA 4ZCDA 3ZDNA 4CRTA 3AE4A 4GRTA 4H4TA 5EBKA 4J34A 2YQUA 4Z2RA 3PS9A 2H88A 3C4AA 3BI4A 3GWFA 1Y0PA 1Z6LA 1COYA 4EQSA 2XVEA 2V60A 1DOCA 4JY3A 4H7UA 1LQUA 2C75A 2WEUA 3HYVA 5KMRA 3SGLA 1NHPA 1L9CA 2X8HA 4U2SA 3SZWA 1PJ5A 4OPCA 2GAGB 3P1WA 1EL9A 4YSHA 5JCMA 1GEUA 5IPYA 2E4GA 2WBAA 4IV9A 2WP5A 1JRXA 2QAEA 2R0PA 2OLOA 1Y56B 2JB1A 3ALJA 3AE1A 1D4CA 4H2QA 4C3XA 5BULA 2YLTA 3EPTA 3SY4A 3CNDA 3KVEA 2OLNA 1GRHA 4J57A 2BACA 4G6HA 5KRQA 2WU2A 1F6MA 2YLRA 3ALLA 3ISHA 5CQFA 1GSNA 4APNA 1W4XA 3KA7A 1H82A 1ZMDA 4XXGA 3ALMA 3EF6A 4TM4A 2H89A 2RGOA 1KDGA 3BHKA 3HYXA 4TLZA 1B8SA 1GV4A 3PO7A 4FK1C 3T0KA 2WHDA 4ZCCA 1UKVG 3BI5A 1NG4A 1E1MA 4II2A 4TM1A 1EL7A 2BS2A 4C3YA 3NG7X 4OPUA 5KOWA 2B9YA 1PXAA 3C96A 2X8GA 3ITJA 4U2LA 4CY8A 1XDIA 3AE8A 3AECA 1S3EA 5KMPA 1GRFA 4I58A 5BRTA 2BYBA 3UOZA 5KVHA 1IJHA 2ACZA 2A8XA 3CGCA 3VRAA 1PDHA 1L9EA 4ADWA 4ECHA 5FS9A 3AE3A 3F8DA 2YG5A 2YLXA 4PAAA 3K7TA 1GALA 1QLBA 3QFBA 1IUWA 4II3A 1DNCA 2XFNA 4REKA 2WPFA 3UKKA 1FECA 2GMHA 1CC6A 2Y6QA 3AEFA 2EQ7A 3GYXA 4LA1A 4U8KA 4AP1A 2FJEA 4H4SA 1YQ3A 3JSKA 3R9UA 4YSYA 5U63A 3NYCA 2FJDA 1K0JA 2BCGG 1GNDA 1IUXA 1QJDA 2J3NA 1F8WA 3UOVA 1ZDLA 1JEHA 1LTXR 1SEZA 3CGEA 5DBJA 1NHQA 2VRLA 1E6EA 2B7RA 1KNRA 2YR6A 3DGZA 4ICYA 3GRSA 4Z44A 4OVIA 3DJEA 3RHAA 3GD4A 5HXIA 5IQ4A 2WETA 2EQ8A 3SFDA 4B67A 2WOIA 4Z26A 3ZYXA 4BK3A 1JRYA 4OPTA 3WE0A 1QO8A 1Q9IA 4YT0A 2YG3A 3II4A 4MJWA 3SQPA 1CJ2A 3K7QX 2PYXA 4AP3A 2RABA 1PS9A 2VVLA 2X8CA 1TDNA 2XVJA 3V76A 1H81A 1ZX9A 2R46A 4EMJA 3BHFA 4X9NA 4K8DA 3GMBA 1KFYA 5BUKA 3SXIA 3S5WA 1K4QA 4NZHA 2C3DA 2YG6A 4H4RA 1H7XA 1V59A 1BGJA 3GD3A 3LADA 2JKCA 1FOHA 2JK6A 3UKHA 3KPKA 1KSSA 1S2YA 2CFYA 1M64A 1P2HA 2WP9A 2X3NA 3NH3X 4G73A 1AOGA 4PABA 5HY5A 2GH5A 2XFOA 3AEDA 3DK8A 5U1OA 4H4YA 4A99A 4J56A 4XWZA 2JB3A 2Q0LA 4AOSA 4J36A 4OCGA 2UZZA 3F8RA 2JAEA 3NNEA 2XLPA 2YLWA 2A87A 3UCLA 1PHHA 3F8PA 3GYIA 5IQ1A 1DOBA 1CJCA 2C70A 5JCIA 3ABVA 1DXLA 1F8SA 2BA9A 3LJPA 3UKAA 3AEBA 3T31A 2YR5A 2RGHA 1IUSA 2VQ7A 4H4QA 2OAMA 4M52A 1MXTA 4UP3A 2GQFA 2IVDA 4B63A 4Z43A 2CULA 4X4JA 2FBWA 2YVFA 5J7XA 4OPLA 3CNPA 3NLCA 1KSUA 1MOKA 2FJAA 4AT0A 2C7GA 2FJBA 2YM2A 3AB1A 4RG3A 1FEBA 5EB4A 5C3JA 1EBDA 1PBCA 4EMWA 1JOAA 1PXBA 2GR0A 3P4RA 3OZ2A 3QVPA 4BV6A 3KKJA 1E1KA 1F8RA 4ZN0A 2GAHB 2B9WA 2WU5A 2XCGA 4U8PA 4U8IA 2O9ZA 3NRNA 2BXSA 1PXCA 2YLZA 3REDA 2XDOA 3KD9A 3M0OA 3ADAB 2Q7VA 3EANA 1XANA 4A65A 4U2TA 4EQWA 3E1TA 1VDCA 3ICRA 1PBFA 3NYFA 2E1MA 3ATQA 1BWCA 3IHGA 1VRQB 2YG4A 2WDVA 3COXA 3SFEA 2EQ9A 2WDQA 3AD8B 3B6DA 1ZY8A 4IVMB 4K5RA 1JNZA 5EB5A 4H4VA 3NK1X 1BKWA 3DMEA 4P9SA 5GSNA 1TRBA 2YR4A 4G9KA 3DK9A 2YM1A 2BK4A 2WS3A 1YQ4A 3P4SA 4JY2A 2PHHA 3GSIA 1IUTA 4HA6A 4JN9A 4JDRA 3CN8A 3BI2A 4CY6A 4H50A 4GCMA 1KF6A 2VRMA 1ZOYA 2E5VA 3K7MX 2R9ZA 1GETA 1VG9A 3NTAA 5TR3A 2BS4A 2GRTA 2WOVA 3CPHG 4IA6A 2OALA 4BK1A 3DJDA 2YVGA 4H4XA 3BNMA 4X9MA 3UOXA 2GB0A 3AD7B 1OJDA 3VRDB 4C5OA 2ZBWA 1D5TA 2BRAA 4YSXA 1YY5A 3GMCA 3RP8A 3BNUA 4D03A 1H7WA 4UDRA 1K0LA 2VZ2A 5HHFA 3UP4A 4TM3A 3GRTA 3AYJA 2Z5XA 4Z2TA 1OJCA 5JCNA 3RP7A 4YWOA 4AOXA 5GRTA 1GREA 1XPQA 4E0VA 3PVCA 4H2PA 1NG3A 4U8MA 4CBQA 3DA1A 2DKHA 3DGHA 2W0HA 1DJNA 1PN0A 3ICTA 1ZK7A 2NVKX 3UTHA 4OPDA 1S3BA 4NTCA 3AE5A 2R0GA 5M10A 4NWZA 3HZLA 3CTYA 3UKPA 2B7SA 2R0CA 4NEWA 5C2TA 2XLSA 4GF7A 4JNAA 4C74A 2HQMA 1ELIA 1FCDA 4U8OA 3UTEA 2YVJA 2C64A 1IUVA 1OJAA 2BABA 3L8KA 4LU6A 3DK4A 4FDCB 2XVHA 4UDPA 5FS8A 4A79A 4A9WA 2GMJA 4C77A 2GR1A 2YAUA 1CBOA 2XLUA 1DJQA 4KX6A 3EAOA 3I6DA 1LV0A 1BF3A 2WDRA 3QFAA 4N9XA 5JCKA 1Q1WA 5JCLA 5KVIA 2BS3A 2Z5YA 3Q6JA 1ZOVA 1GXFA 3D1CA 1LVLA 2NPXA 3DH9A 2F5ZA 4G6GA 2C72A 3NK0X 2GQWA 1MO9A 4B1BA 1OJ9A 3IC9A 1CJ3A 1KNPA 2TPRA 1GERA 1RP0A 4I59A 1M6IA 2A89A 3NYEA 5ER0A 2VQBA 1GRAA 1RSGA 3GWDA 3CNSA 1NPXA 3ATRA 3AE2A 2WOWA 3IF9A 1CC2A 1X31B 2I0ZA 1EL8A 4CCRA 3NHOX 3LZWA 2V61A 4OPGA 1GPEA 1HYUA 2RGJA 2Q6UA 1L9DA 3VR8A 3C4NA 4OPIA 4USRA 3CPIG 1TYPA 4U8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLT A;  2YG7 A;  4A5L A;  1OJT A;  2BC1 A;  2YLS A;  2C65 A;  3CGB A;  3P4P A;  4IA5 A;  4B68 A;  4Z25 A;  1BZL A;  4H4W A;  1FL2 A;  1P2E A;  4H2N A;  1LJ1 A;  5M0Z A;  1GT8 A;  3QSS A;  1D7L A;  1PBB A;  1PBE A;  1E1N A;  3CNT A;  3KPF A;  4J31 A;  2R45 A;  3UKF A;  3DJJ A;  3G5Q A;  2WQY A;  3UKQ A;  4J2W A;  3H4K A;  4YKF A;  1FEA A;  2XFQ A;  4TLX A;  4YXD A;  1NEN A;  3D8X A;  2C3C A;  4B69 A;  4CNJ A;  3H8L A;  3IWA A;  1PJ6 A;  2BC0 A;  2GV8 A;  3RP6 A;  1GRG A;  4Y4N A;  4EIQ A;  4A6N A;  1YQZ A;  3KLJ A;  3NIX A;  4Z24 A;  3FBS A;  4DGK A;  1CL0 A;  2Y6R A;  4IVO B;  5FS6 A;  4JNQ A;  2V3A A;  3QSM A;  3V3N A;  1D4D A;  1DOD A;  2ZZC A;  3FPZ A;  1DOE A;  3NGC X;  1LQT A;  3AEG A;  1REO A;  2VVM A;  4BJY A;  1N1P A;  1K0I A;  2V3B A;  1BGN A;  4KPR A;  2ZZB A;  3FIM B;  4CCQ A;  3OC4 A;  1ONF A;  1VG0 A;  4DNA A;  1H83 A;  2XFU A;  4CNK A;  4TM0 A;  1LPF A;  3UTF A;  2Q0K A;  2CDU A;  2ARD A;  4USQ A;  3FG2 P;  3QSE A;  2C66 A;  3QVR A;  3UTG A;  3VR9 A;  2QCU A;  3DJG X;  2GEW A;  2BCP A;  2R4J A;  2VOU A;  4NTE A;  2BK3 A;  3V3O A;  1F3P A;  3AYI A;  4WX1 A;  4H4U A;  1NHR A;  3LZX A;  3NK2 X;  4YTM A;  3G5R A;  3CGD A;  3NN0 X;  4K2X A;  1NDA A;  4DSG A;  4EMI A;  3AE7 A;  1E7P A;  2TMD A;  3AWI A;  1JU2 A;  4O5U A;  2EQ6 A;  3GDP A;  5J60 A;  1TDK A;  4Y4M A;  1JRZ A;  3NKS A;  4B65 A;  3I3L A;  1Y56 A;  3FMW A;  3CNJ A;  3AYL A;  3URH A;  1NEK A;  2AQJ A;  2GR2 A;  4LII A;  4EQR A;  4WCT A;  1GRB A;  3H8I A;  5EOW A;  5KOX A;  5KWF A;  4H4P A;  5KXJ A;  4Y4L A;  4YSZ A;  1B37 A;  1VQW A;  3ICS A;  4YKG A;  3UKL A;  4O5Q A;  3VQR A;  2AR8 A;  2R4E A;  3B3R A;  4GDP A;  3RNM A;  4AT2 A;  4FX9 A;  1E1L A;  3CPJ G;  2XFP A;  4EIP A;  1PBD A;  3GYJ A;  5L46 A;  1Q1R A;  2DKI A;  4NTD A;  1E39 A;  3VRB A;  1XHC A;  1GRT A;  2YWL A;  2GF3 A;  1O94 A;  4NEV A;  2C73 A;  1EL5 A;  4H4Z A;  2X50 A;  3NTD A;  2AAQ A;  1CHU A;  1L0V A;  5BVA A;  3AE6 A;  1PJ7 A;  3M12 A;  1S2Q A;  3AEA A;  2V6O A;  1TDE A;  1YKJ A;  1N4U A;  2CVJ A;  3GDN A;  4J33 A;  3L1R A;  4K22 A;  2BXR A;  1NHS A;  1ZMC A;  2GR3 A;  4BJZ A;  1JNR A;  3G5S A;  1RYI A;  4XWR A;  4U8N A;  2JB2 A;  4GUV A;  3CIR A;  3P4Q A;  1N4W A;  5HYM A;  5LV9 A;  1N4V A;  2JBV A;  2XYO A;  1B5Q A;  3SM8 A;  4EM4 A;  1O5W A;  3IHM A;  4GR1 A;  4UDQ A;  4EQX A;  4Z2U A;  1NAA A;  4RG4 A;  4YTP A;  3UP5 A;  3AD9 B;  5U25 A;  4D04 A;  4A7A A;  2WPE A;  3O0H A;  3P9U A;  1H86 A;  1D7Y A;  2V5Z A;  3QJ4 A;  1H6V A;  1TYT A;  2WPC A;  4GDE A;  2WES A;  1ZP0 A;  2IVE A;  4YTN A;  4RSL A;  5FS7 A;  1IUU A;  3AEE A;  4BUR A;  1TDO A;  3LXD A;  1O95 A;  1GOS A;  4A6N B;  2VVL G;  2C76 A;  2C67 A;  3UOY A;  4EM3 A;  5CKU A;  1CC4 A;  4U8J A;  4K5S A;  2XLR A;  4JQ9 A;  4K7Z A;  3KU9 A;  2XVI A;  3AE9 A;  2IID A;  1GTH A;  2QA2 A;  2GVC A;  4B66 A;  1GES A;  2WP6 A;  4B64 A;  3AXB A;  4BK2 A;  1D4E A;  3K30 A;  3M13 A;  3S61 A;  1CF3 A;  2OA1 A;  4HB9 A;  1TDF A;  1CJ4 A;  3LOV A;  1GTE A;  1H84 A;  2B76 A;  2B9X A;  3NN6 X;  2QA1 A;  4DSH A;  2XVF A;  3NT6 A;  2APG A;  1ZKQ A;  3Q9T A;  2ZZ0 A;  2X99 A;  3LB8 A;  4FK1 A;  4H2R A;  5FMH A;  3T37 A;  2BK5 A;  1B4V A;  3ZDN A;  4ZCD A;  4CRT A;  3AE4 A;  4GRT A;  4H4T A;  5EBK A;  4J34 A;  2YQU A;  4Z2R A;  3PS9 A;  2H88 A;  3C4A A;  3BI4 A;  3GWF A;  1Y0P A;  1Z6L A;  1COY A;  4EQS A;  2XVE A;  2V60 A;  1DOC A;  4JY3 A;  4H7U A;  1LQU A;  2C75 A;  2WEU A;  3SGL A;  1NHP A;  1L9C A;  2X8H A;  4U2S A;  1PJ5 A;  4OPC A;  2GAG B;  3P1W A;  1EL9 A;  4YSH A;  5JCM A;  1GEU A;  5IPY A;  2E4G A;  2WBA A;  4IV9 A;  2WP5 A;  1JRX A;  2QAE A;  2R0P A;  2OLO A;  1Y56 B;  2JB1 A;  3ALJ A;  3AE1 A;  1D4C A;  4H2Q A;  4C3X A;  5BUL A;  2YLT A;  3EPT A;  3CND A;  3KVE A;  2OLN A;  1GRH A;  4J57 A;  2BAC A;  5KRQ A;  2WU2 A;  1F6M A;  2YLR A;  3ALL A;  3ISH A;  5CQF A;  1GSN A;  4APN A;  1W4X A;  3KA7 A;  1H82 A;  1ZMD A;  4XXG A;  3ALM A;  3EF6 A;  4TM4 A;  2H89 A;  2RGO A;  1KDG A;  3BHK A;  4TLZ A;  1B8S A;  1GV4 A;  3PO7 A;  4FK1 C;  2WHD A;  4ZCC A;  1UKV G;  3BI5 A;  1NG4 A;  1E1M A;  4C3Y A;  4TM1 A;  1EL7 A;  2BS2 A;  3NG7 X;  4OPU A;  5KOW A;  2B9Y A;  1PXA A;  3C96 A;  2X8G A;  3ITJ A;  4U2L A;  4CY8 A;  1XDI A;  3AE8 A;  3AEC A;  1S3E A;  1GRF A;  4I58 A;  5BRT A;  2BYB A;  3UOZ A;  5KVH A;  1IJH A;  2ACZ A;  2A8X A;  3CGC A;  3VRA A;  1PDH A;  1L9E A;  4ADW A;  4ECH A;  5FS9 A;  3AE3 A;  3F8D A;  2YG5 A;  2YLX A;  4PAA A;  3K7T A;  1GAL A;  1QLB A;  3QFB A;  1IUW A;  4REK A;  1DNC A;  2XFN A;  2WPF A;  3UKK A;  1FEC A;  2GMH A;  1CC6 A;  2Y6Q A;  3AEF A;  2EQ7 A;  4LA1 A;  4U8K A;  4AP1 A;  2FJE A;  4H4S A;  1YQ3 A;  3JSK A;  3R9U A;  4YSY A;  5U63 A;  3NYC A;  2FJD A;  1K0J A;  2BCG G;  1GND A;  1IUX A;  1QJD A;  2J3N A;  1F8W A;  3UOV A;  1ZDL A;  1JEH A;  1LTX R;  1SEZ A;  3CGE A;  5DBJ A;  1NHQ A;  2VRL A;  1E6E A;  2B7R A;  1KNR A;  2YR6 A;  3DGZ A;  4ICY A;  3GRS A;  4Z44 A;  4OVI A;  3DJE A;  3RHA A;  3GD4 A;  5HXI A;  5IQ4 A;  2WET A;  2EQ8 A;  3SFD A;  4B67 A;  2WOI A;  4Z26 A;  3ZYX A;  4BK3 A;  1JRY A;  4OPT A;  3WE0 A;  1QO8 A;  1Q9I A;  4YT0 A;  2YG3 A;  3II4 A;  4MJW A;  3SQP A;  1CJ2 A;  3K7Q X;  2PYX A;  4AP3 A;  2RAB A;  1PS9 A;  2VVL A;  2X8C A;  1TDN A;  2XVJ A;  3V76 A;  1H81 A;  1ZX9 A;  2R46 A;  4EMJ A;  3BHF A;  4X9N A;  4K8D A;  3GMB A;  1KFY A;  5BUK A;  3S5W A;  1K4Q A;  4NZH A;  2C3D A;  2YG6 A;  4H4R A;  1H7X A;  1V59 A;  1BGJ A;  3GD3 A;  3LAD A;  2JKC A;  1FOH A;  2JK6 A;  3UKH A;  1KSS A;  1S2Y A;  2CFY A;  1M64 A;  1P2H A;  2WP9 A;  2X3N A;  3NH3 X;  1AOG A;  4PAB A;  5HY5 A;  2GH5 A;  2XFO A;  3AED A;  3DK8 A;  5U1O A;  4H4Y A;  4A99 A;  4J56 A;  4XWZ A;  2JB3 A;  2Q0L A;  4AOS A;  4J36 A;  4OCG A;  2UZZ A;  3F8R A;  2JAE A;  3NNE A;  2XLP A;  2YLW A;  2A87 A;  3UCL A;  1PHH A;  3F8P A;  3GYI A;  5IQ1 A;  1DOB A;  1CJC A;  2C70 A;  5JCI A;  3ABV A;  1DXL A;  1F8S A;  2BA9 A;  3LJP A;  3UKA A;  3AEB A;  2YR5 A;  2RGH A;  1IUS A;  2VQ7 A;  4H4Q A;  2OAM A;  4M52 A;  1MXT A;  4UP3 A;  2GQF A;  2IVD A;  4B63 A;  4Z43 A;  2CUL A;  4X4J A;  2FBW A;  2YVF A;  5J7X A;  4OPL A;  3CNP A;  3NLC A;  1KSU A;  1MOK A;  2FJA A;  4AT0 A;  2C7G A;  2FJB A;  2YM2 A;  3AB1 A;  4RG3 A;  1FEB A;  5EB4 A;  5C3J A;  1EBD A;  1PBC A;  4EMW A;  1JOA A;  1PXB A;  2GR0 A;  3P4R A;  3OZ2 A;  3QVP A;  4BV6 A;  3KKJ A;  1E1K A;  1F8R A;  4ZN0 A;  2GAH B;  2B9W A;  2WU5 A;  2XCG A;  4U8P A;  4U8I A;  2O9Z A;  3NRN A;  2BXS A;  1PXC A;  2YLZ A;  3RED A;  2XDO A;  3KD9 A;  3M0O A;  3ADA B;  2Q7V A;  3EAN A;  1XAN A;  4A65 A;  4U2T A;  4EQW A;  3E1T A;  1VDC A;  3ICR A;  1PBF A;  3NYF A;  2E1M A;  3ATQ A;  1BWC A;  3IHG A;  1VRQ B;  2YG4 A;  2WDV A;  3COX A;  3SFE A;  2EQ9 A;  2WDQ A;  3AD8 B;  3B6D A;  1ZY8 A;  4IVM B;  4K5R A;  1JNZ A;  5EB5 A;  4H4V A;  3NK1 X;  1BKW A;  3DME A;  4P9S A;  5GSN A;  1TRB A;  2YR4 A;  3DK9 A;  2YM1 A;  2BK4 A;  2WS3 A;  1YQ4 A;  3P4S A;  4JY2 A;  2PHH A;  3GSI A;  1IUT A;  4HA6 A;  4JN9 A;  4JDR A;  3CN8 A;  3BI2 A;  4CY6 A;  4H50 A;  4GCM A;  1KF6 A;  2VRM A;  1ZOY A;  2E5V A;  3K7M X;  2R9Z A;  1GET A;  1VG9 A;  3NTA A;  5TR3 A;  2BS4 A;  2GRT A;  2WOV A;  3CPH G;  4IA6 A;  2OAL A;  4BK1 A;  3DJD A;  2YVG A;  4H4X A;  3BNM A;  4X9M A;  3UOX A;  2GB0 A;  3AD7 B;  1OJD A;  3VRD B;  4C5O A;  2ZBW A;  1D5T A;  4YSX A;  1YY5 A;  3GMC A;  3RP8 A;  3BNU A;  4D03 A;  1H7W A;  4UDR A;  1K0L A;  2VZ2 A;  5HHF A;  3UP4 A;  4TM3 A;  3GRT A;  3AYJ A;  2Z5X A;  4Z2T A;  1OJC A;  5JCN A;  3RP7 A;  4YWO A;  4AOX A;  5GRT A;  1GRE A;  1XPQ A;  4E0V A;  3PVC A;  4H2P A;  1NG3 A;  4U8M A;  4CBQ A;  3DA1 A;  2DKH A;  3DGH A;  2W0H A;  1DJN A;  1PN0 A;  3ICT A;  1ZK7 A;  2NVK X;  3UTH A;  4OPD A;  1S3B A;  4NTC A;  3AE5 A;  2R0G A;  5M10 A;  3HZL A;  3CTY A;  3UKP A;  2B7S A;  2R0C A;  4NEW A;  5C2T A;  2XLS A;  4GF7 A;  4JNA A;  4C74 A;  2HQM A;  1ELI A;  1FCD A;  4U8O A;  3UTE A;  2YVJ A;  2C64 A;  1IUV A;  1OJA A;  2BAB A;  3L8K A;  4LU6 A;  3DK4 A;  4FDC B;  2XVH A;  4UDP A;  5FS8 A;  4A79 A;  4A9W A;  2GMJ A;  4C77 A;  2GR1 A;  2YAU A;  1CBO A;  2XLU A;  1DJQ A;  4KX6 A;  3EAO A;  3I6D A;  1LV0 A;  1BF3 A;  2WDR A;  3QFA A;  4N9X A;  5JCK A;  1Q1W A;  5JCL A;  5KVI A;  2BS3 A;  2Z5Y A;  3Q6J A;  1ZOV A;  1GXF A;  3D1C A;  1LVL A;  2NPX A;  3DH9 A;  2F5Z A;  2C72 A;  3NK0 X;  2GQW A;  1MO9 A;  4B1B A;  1OJ9 A;  3IC9 A;  1CJ3 A;  1KNP A;  2TPR A;  1GER A;  1RP0 A;  4I59 A;  1M6I A;  2A89 A;  3NYE A;  5ER0 A;  2VQB A;  1GRA A;  1RSG A;  3GWD A;  3CNS A;  1NPX A;  3ATR A;  3AE2 A;  2WOW A;  3IF9 A;  1CC2 A;  1X31 B;  2I0Z A;  1EL8 A;  4CCR A;  3NHO X;  3LZW A;  2V61 A;  4OPG A;  1GPE A;  1HYU A;  2RGJ A;  2Q6U A;  1L9D A;  3VR8 A;  3C4N A;  4OPI A;  4USR A;  3CPI G;  1TYP A;  4U8L A; 
#chains in the Genus database with same CATH topology
 2XLT A;  2YG7 A;  4A5L A;  1OJT A;  2BC1 A;  2YLS A;  2C65 A;  3CGB A;  3P4P A;  4IA5 A;  4B68 A;  4Z25 A;  1BZL A;  4H4W A;  1FL2 A;  1P2E A;  4H2N A;  1LJ1 A;  5M0Z A;  1GT8 A;  3QSS A;  5KMS A;  1D7L A;  1PBB A;  1PBE A;  1E1N A;  3CNT A;  3KPF A;  4J31 A;  2R45 A;  3UKF A;  3DJJ A;  3G5Q A;  2WQY A;  3UKQ A;  4J2W A;  3SZC A;  3H4K A;  4YKF A;  1FEA A;  2XFQ A;  2BRY A;  4TLX A;  4YXD A;  1NEN A;  4GAP A;  3D8X A;  2C3C A;  5KNL A;  4B69 A;  4CNJ A;  3H8L A;  3IWA A;  1PJ6 A;  2BC0 A;  2GV8 A;  3RP6 A;  1GRG A;  4Y4N A;  3T2K A;  4EIQ A;  4A6N A;  1YQZ A;  3KLJ A;  3NIX A;  4Z24 A;  3FBS A;  4DGK A;  1CL0 A;  2Y6R A;  4IVO B;  5FS6 A;  4JNQ A;  2V3A A;  3QSM A;  3V3N A;  1D4D A;  1DOD A;  2ZZC A;  3FPZ A;  3SZF A;  1DOE A;  3NGC X;  1LQT A;  3AEG A;  1REO A;  2VVM A;  4BJY A;  1N1P A;  1K0I A;  2V3B A;  1BGN A;  4KPR A;  2ZZB A;  3FIM B;  4CCQ A;  3OC4 A;  1ONF A;  1VG0 A;  4DNA A;  1H83 A;  2XFU A;  4CNK A;  4TM0 A;  1LPF A;  3UTF A;  2Q0K A;  2CDU A;  2ARD A;  4USQ A;  3FG2 P;  3QSE A;  2C66 A;  3QVR A;  3UTG A;  3VR9 A;  2QCU A;  3DJG X;  2GEW A;  2BCP A;  2R4J A;  2VOU A;  4NTE A;  2BK3 A;  3HYW A;  3V3O A;  1F3P A;  3AYI A;  4WX1 A;  4H4U A;  1NHR A;  3LZX A;  3NK2 X;  4YTM A;  3G5R A;  3T2Y A;  3CGD A;  3NN0 X;  4K2X A;  1NDA A;  4DSG A;  4EMI A;  3AE7 A;  1E7P A;  2TMD A;  3AWI A;  1JU2 A;  4O5U A;  2EQ6 A;  3GDP A;  4G74 A;  5J60 A;  1TDK A;  4Y4M A;  1JRZ A;  3NKS A;  4B65 A;  3I3L A;  1Y56 A;  3FMW A;  3CNJ A;  3AYL A;  3URH A;  1NEK A;  2AQJ A;  2GR2 A;  4GAV A;  4LII A;  4EQR A;  4WCT A;  3SYI A;  1GRB A;  3H8I A;  4NNJ A;  5EOW A;  5KOX A;  5KWF A;  4H4P A;  5KXJ A;  4Y4L A;  4YSZ A;  1B37 A;  1VQW A;  3ICS A;  4YKG A;  3UKL A;  4O5Q A;  3VQR A;  2AR8 A;  3SX6 A;  2R4E A;  3B3R A;  3T14 A;  4GDP A;  3RNM A;  4AT2 A;  4FX9 A;  1E1L A;  3CPJ G;  2XFP A;  4EIP A;  1PBD A;  3CMM A;  3GYJ A;  5L46 A;  1Q1R A;  2DKI A;  4NTD A;  1E39 A;  3VRB A;  1XHC A;  1GRT A;  2YWL A;  2GF3 A;  1O94 A;  4NEV A;  2C73 A;  1EL5 A;  4H4Z A;  2C4C A;  2X50 A;  3NTD A;  2AAQ A;  1CHU A;  1L0V A;  5BVA A;  3AE6 A;  1PJ7 A;  3M12 A;  1S2Q A;  3AEA A;  2V6O A;  1TDE A;  1YKJ A;  1N4U A;  2CVJ A;  3GDN A;  4J33 A;  3L1R A;  4K22 A;  2BXR A;  1NHS A;  1ZMC A;  2GR3 A;  4BJZ A;  1JNR A;  3G5S A;  1RYI A;  4XWR A;  4U8N A;  2JB2 A;  4GUV A;  3CIR A;  3P4Q A;  1N4W A;  5HYM A;  5LV9 A;  1N4V A;  2JBV A;  2XYO A;  1B5Q A;  3SM8 A;  4EM4 A;  3SZ0 A;  1O5W A;  3IHM A;  4GR1 A;  4UDQ A;  4EQX A;  4Z2U A;  1NAA A;  4RG4 A;  4YTP A;  3UP5 A;  3AD9 B;  5U25 A;  4D04 A;  4A7A A;  2WPE A;  3O0H A;  3P9U A;  1H86 A;  1D7Y A;  2V5Z A;  3QJ4 A;  1H6V A;  1TYT A;  2WPC A;  4GDE A;  2WES A;  1ZP0 A;  2IVE A;  4YTN A;  4RSL A;  5FS7 A;  1IUU A;  3AEE A;  4BUR A;  1TDO A;  3LXD A;  1O95 A;  1GOS A;  5KMQ A;  4A6N B;  2VVL G;  2C76 A;  2C67 A;  3UOY A;  4EM3 A;  5CKU A;  1CC4 A;  4U8J A;  4K5S A;  2XLR A;  4JQ9 A;  4K7Z A;  3KU9 A;  2XVI A;  3AE9 A;  2IID A;  1GTH A;  2QA2 A;  2GVC A;  4B66 A;  1GES A;  2WP6 A;  4B64 A;  3AXB A;  4BK2 A;  1D4E A;  3K30 A;  3M13 A;  3S61 A;  1CF3 A;  2OA1 A;  4HB9 A;  1TDF A;  1CJ4 A;  3LOV A;  1GTE A;  1H84 A;  2B76 A;  2B9X A;  3NN6 X;  2QA1 A;  4DSH A;  2XVF A;  3NT6 A;  2APG A;  1ZKQ A;  3Q9T A;  2ZZ0 A;  2X99 A;  3LB8 A;  4FK1 A;  4H2R A;  5FMH A;  3T37 A;  2BK5 A;  1B4V A;  3T2Z A;  4ZCD A;  3ZDN A;  4CRT A;  3AE4 A;  4GRT A;  4H4T A;  5EBK A;  4J34 A;  2YQU A;  4Z2R A;  3PS9 A;  2H88 A;  3C4A A;  3BI4 A;  3GWF A;  1Y0P A;  1Z6L A;  1COY A;  4EQS A;  2XVE A;  2V60 A;  1DOC A;  4JY3 A;  4H7U A;  1LQU A;  2C75 A;  2WEU A;  3HYV A;  5KMR A;  3SGL A;  1NHP A;  1L9C A;  2X8H A;  4U2S A;  3SZW A;  1PJ5 A;  4OPC A;  2GAG B;  3P1W A;  1EL9 A;  4YSH A;  5JCM A;  1GEU A;  5IPY A;  2E4G A;  2WBA A;  4IV9 A;  2WP5 A;  1JRX A;  2QAE A;  2R0P A;  2OLO A;  1Y56 B;  2JB1 A;  3ALJ A;  3AE1 A;  1D4C A;  4H2Q A;  4C3X A;  5BUL A;  2YLT A;  3EPT A;  3SY4 A;  3CND A;  3KVE A;  2OLN A;  1GRH A;  4J57 A;  2BAC A;  4G6H A;  5KRQ A;  2WU2 A;  1F6M A;  2YLR A;  3ALL A;  3ISH A;  5CQF A;  1GSN A;  4APN A;  1W4X A;  3KA7 A;  1H82 A;  1ZMD A;  4XXG A;  3ALM A;  3EF6 A;  4TM4 A;  2H89 A;  2RGO A;  1KDG A;  3BHK A;  3HYX A;  4TLZ A;  1B8S A;  1GV4 A;  3PO7 A;  4FK1 C;  3T0K A;  2WHD A;  4ZCC A;  1UKV G;  3BI5 A;  1NG4 A;  1E1M A;  4II2 A;  4TM1 A;  1EL7 A;  2BS2 A;  4C3Y A;  3NG7 X;  4OPU A;  5KOW A;  2B9Y A;  1PXA A;  3C96 A;  2X8G A;  3ITJ A;  4U2L A;  4CY8 A;  1XDI A;  3AE8 A;  3AEC A;  1S3E A;  5KMP A;  1GRF A;  4I58 A;  5BRT A;  2BYB A;  3UOZ A;  5KVH A;  1IJH A;  2ACZ A;  2A8X A;  3CGC A;  3VRA A;  1PDH A;  1L9E A;  4ADW A;  4ECH A;  5FS9 A;  3AE3 A;  3F8D A;  2YG5 A;  2YLX A;  4PAA A;  3K7T A;  1GAL A;  1QLB A;  3QFB A;  1IUW A;  4II3 A;  1DNC A;  2XFN A;  4REK A;  2WPF A;  3UKK A;  1FEC A;  2GMH A;  1CC6 A;  2Y6Q A;  3AEF A;  2EQ7 A;  3GYX A;  4LA1 A;  4U8K A;  4AP1 A;  2FJE A;  4H4S A;  1YQ3 A;  3JSK A;  3R9U A;  4YSY A;  5U63 A;  3NYC A;  2FJD A;  1K0J A;  2BCG G;  1GND A;  1IUX A;  1QJD A;  2J3N A;  1F8W A;  3UOV A;  1ZDL A;  1JEH A;  1LTX R;  1SEZ A;  3CGE A;  5DBJ A;  1NHQ A;  2VRL A;  1E6E A;  2B7R A;  1KNR A;  2YR6 A;  3DGZ A;  4ICY A;  3GRS A;  4Z44 A;  4OVI A;  3DJE A;  3RHA A;  3GD4 A;  5HXI A;  5IQ4 A;  2WET A;  2EQ8 A;  3SFD A;  4B67 A;  2WOI A;  4Z26 A;  3ZYX A;  4BK3 A;  1JRY A;  4OPT A;  3WE0 A;  1QO8 A;  1Q9I A;  4YT0 A;  2YG3 A;  3II4 A;  4MJW A;  3SQP A;  1CJ2 A;  3K7Q X;  2PYX A;  4AP3 A;  2RAB A;  1PS9 A;  2VVL A;  2X8C A;  1TDN A;  2XVJ A;  3V76 A;  1H81 A;  1ZX9 A;  2R46 A;  4EMJ A;  3BHF A;  4X9N A;  4K8D A;  3GMB A;  1KFY A;  5BUK A;  3SXI A;  3S5W A;  1K4Q A;  4NZH A;  2C3D A;  2YG6 A;  4H4R A;  1H7X A;  1V59 A;  1BGJ A;  3GD3 A;  3LAD A;  2JKC A;  1FOH A;  2JK6 A;  3UKH A;  3KPK A;  1KSS A;  1S2Y A;  2CFY A;  1M64 A;  1P2H A;  2WP9 A;  2X3N A;  3NH3 X;  4G73 A;  1AOG A;  4PAB A;  5HY5 A;  2GH5 A;  2XFO A;  3AED A;  3DK8 A;  5U1O A;  4H4Y A;  4A99 A;  4J56 A;  4XWZ A;  2JB3 A;  2Q0L A;  4AOS A;  4J36 A;  4OCG A;  2UZZ A;  3F8R A;  2JAE A;  3NNE A;  2XLP A;  2YLW A;  2A87 A;  3UCL A;  1PHH A;  3F8P A;  3GYI A;  5IQ1 A;  1DOB A;  1CJC A;  2C70 A;  5JCI A;  3ABV A;  1DXL A;  1F8S A;  2BA9 A;  3LJP A;  3UKA A;  3AEB A;  3T31 A;  2YR5 A;  2RGH A;  1IUS A;  2VQ7 A;  4H4Q A;  2OAM A;  4M52 A;  1MXT A;  4UP3 A;  2GQF A;  2IVD A;  4B63 A;  4Z43 A;  2CUL A;  4X4J A;  2FBW A;  2YVF A;  5J7X A;  4OPL A;  3CNP A;  3NLC A;  1KSU A;  1MOK A;  2FJA A;  4AT0 A;  2C7G A;  2FJB A;  2YM2 A;  3AB1 A;  4RG3 A;  1FEB A;  5EB4 A;  5C3J A;  1EBD A;  1PBC A;  4EMW A;  1JOA A;  1PXB A;  2GR0 A;  3P4R A;  3OZ2 A;  3QVP A;  4BV6 A;  3KKJ A;  1E1K A;  1F8R A;  4ZN0 A;  2GAH B;  2B9W A;  2WU5 A;  2XCG A;  4U8P A;  4U8I A;  2O9Z A;  3NRN A;  2BXS A;  1PXC A;  2YLZ A;  3RED A;  2XDO A;  3KD9 A;  3M0O A;  3ADA B;  2Q7V A;  3EAN A;  1XAN A;  4A65 A;  4U2T A;  4EQW A;  3E1T A;  1VDC A;  3ICR A;  1PBF A;  3NYF A;  2E1M A;  3ATQ A;  1BWC A;  3IHG A;  1VRQ B;  2YG4 A;  2WDV A;  3COX A;  3SFE A;  2EQ9 A;  2WDQ A;  3AD8 B;  3B6D A;  1ZY8 A;  4IVM B;  4K5R A;  1JNZ A;  5EB5 A;  4H4V A;  3NK1 X;  1BKW A;  3DME A;  4P9S A;  5GSN A;  1TRB A;  2YR4 A;  4G9K A;  3DK9 A;  2YM1 A;  2BK4 A;  2WS3 A;  1YQ4 A;  3P4S A;  4JY2 A;  2PHH A;  3GSI A;  1IUT A;  4HA6 A;  4JN9 A;  4JDR A;  3CN8 A;  3BI2 A;  4CY6 A;  4H50 A;  4GCM A;  1KF6 A;  2VRM A;  1ZOY A;  2E5V A;  3K7M X;  2R9Z A;  1GET A;  1VG9 A;  3NTA A;  5TR3 A;  2BS4 A;  2GRT A;  2WOV A;  3CPH G;  4IA6 A;  2OAL A;  4BK1 A;  3DJD A;  2YVG A;  4H4X A;  3BNM A;  4X9M A;  3UOX A;  2GB0 A;  3AD7 B;  1OJD A;  3VRD B;  4C5O A;  2ZBW A;  1D5T A;  2BRA A;  4YSX A;  1YY5 A;  3GMC A;  3RP8 A;  3BNU A;  4D03 A;  1H7W A;  4UDR A;  1K0L A;  2VZ2 A;  5HHF A;  3UP4 A;  4TM3 A;  3GRT A;  3AYJ A;  2Z5X A;  4Z2T A;  1OJC A;  5JCN A;  3RP7 A;  4YWO A;  4AOX A;  5GRT A;  1GRE A;  1XPQ A;  4E0V A;  3PVC A;  4H2P A;  1NG3 A;  4U8M A;  4CBQ A;  3DA1 A;  2DKH A;  3DGH A;  2W0H A;  1DJN A;  1PN0 A;  3ICT A;  1ZK7 A;  2NVK X;  3UTH A;  4OPD A;  1S3B A;  4NTC A;  3AE5 A;  2R0G A;  5M10 A;  4NWZ A;  3HZL A;  3CTY A;  3UKP A;  2B7S A;  2R0C A;  4NEW A;  5C2T A;  2XLS A;  4GF7 A;  4JNA A;  4C74 A;  2HQM A;  1ELI A;  1FCD A;  4U8O A;  3UTE A;  2YVJ A;  2C64 A;  1IUV A;  1OJA A;  2BAB A;  3L8K A;  4LU6 A;  3DK4 A;  4FDC B;  2XVH A;  4UDP A;  5FS8 A;  4A79 A;  4A9W A;  2GMJ A;  4C77 A;  2GR1 A;  2YAU A;  1CBO A;  2XLU A;  1DJQ A;  4KX6 A;  3EAO A;  3I6D A;  1LV0 A;  1BF3 A;  2WDR A;  3QFA A;  4N9X A;  5JCK A;  1Q1W A;  5JCL A;  5KVI A;  2BS3 A;  2Z5Y A;  3Q6J A;  1ZOV A;  1GXF A;  3D1C A;  1LVL A;  2NPX A;  3DH9 A;  2F5Z A;  4G6G A;  2C72 A;  3NK0 X;  2GQW A;  1MO9 A;  4B1B A;  1OJ9 A;  3IC9 A;  1CJ3 A;  1KNP A;  2TPR A;  1GER A;  1RP0 A;  4I59 A;  1M6I A;  2A89 A;  3NYE A;  5ER0 A;  2VQB A;  1GRA A;  1RSG A;  3GWD A;  3CNS A;  1NPX A;  3ATR A;  3AE2 A;  2WOW A;  3IF9 A;  1CC2 A;  1X31 B;  2I0Z A;  1EL8 A;  4CCR A;  3NHO X;  3LZW A;  2V61 A;  4OPG A;  1GPE A;  1HYU A;  2RGJ A;  2Q6U A;  1L9D A;  3VR8 A;  3C4N A;  4OPI A;  4USR A;  3CPI G;  1TYP A;  4U8L A; 
#chains in the Genus database with same CATH homology
 2XLT A;  2YG7 A;  4A5L A;  1OJT A;  2BC1 A;  2YLS A;  2C65 A;  3CGB A;  3P4P A;  4IA5 A;  4B68 A;  4Z25 A;  1BZL A;  4H4W A;  1FL2 A;  1P2E A;  4H2N A;  1LJ1 A;  5M0Z A;  1GT8 A;  3QSS A;  5KMS A;  1D7L A;  1PBB A;  1PBE A;  1E1N A;  3CNT A;  3KPF A;  4J31 A;  2R45 A;  3UKF A;  3DJJ A;  3G5Q A;  2WQY A;  3UKQ A;  4J2W A;  3SZC A;  3H4K A;  4YKF A;  1FEA A;  2XFQ A;  2BRY A;  4TLX A;  4YXD A;  1NEN A;  4GAP A;  3D8X A;  2C3C A;  5KNL A;  4B69 A;  4CNJ A;  3H8L A;  3IWA A;  1PJ6 A;  2BC0 A;  2GV8 A;  3RP6 A;  1GRG A;  4Y4N A;  3T2K A;  4EIQ A;  4A6N A;  1YQZ A;  3KLJ A;  3NIX A;  4Z24 A;  3FBS A;  4DGK A;  1CL0 A;  2Y6R A;  4IVO B;  5FS6 A;  4JNQ A;  2V3A A;  3QSM A;  3V3N A;  1D4D A;  1DOD A;  2ZZC A;  3FPZ A;  3SZF A;  1DOE A;  3NGC X;  1LQT A;  3AEG A;  1REO A;  2VVM A;  4BJY A;  1N1P A;  1K0I A;  2V3B A;  1BGN A;  4KPR A;  2ZZB A;  3FIM B;  4CCQ A;  3OC4 A;  1ONF A;  1VG0 A;  4DNA A;  1H83 A;  2XFU A;  4CNK A;  4TM0 A;  1LPF A;  3UTF A;  2Q0K A;  2CDU A;  2ARD A;  4USQ A;  3FG2 P;  3QSE A;  2C66 A;  3QVR A;  3UTG A;  3VR9 A;  2QCU A;  3DJG X;  2GEW A;  2BCP A;  2R4J A;  2VOU A;  4NTE A;  2BK3 A;  3HYW A;  3V3O A;  1F3P A;  3AYI A;  4WX1 A;  4H4U A;  1NHR A;  3LZX A;  3NK2 X;  4YTM A;  3G5R A;  3T2Y A;  3CGD A;  3NN0 X;  4K2X A;  1NDA A;  4DSG A;  4EMI A;  3AE7 A;  1E7P A;  2TMD A;  3AWI A;  1JU2 A;  4O5U A;  2EQ6 A;  3GDP A;  4G74 A;  5J60 A;  1TDK A;  4Y4M A;  1JRZ A;  3NKS A;  4B65 A;  3I3L A;  1Y56 A;  3FMW A;  3CNJ A;  3AYL A;  3URH A;  1NEK A;  2AQJ A;  2GR2 A;  4GAV A;  4LII A;  4EQR A;  4WCT A;  3SYI A;  1GRB A;  3H8I A;  4NNJ A;  5EOW A;  5KOX A;  5KWF A;  4H4P A;  5KXJ A;  4Y4L A;  4YSZ A;  1B37 A;  1VQW A;  3ICS A;  4YKG A;  3UKL A;  4O5Q A;  3VQR A;  2AR8 A;  3SX6 A;  2R4E A;  3B3R A;  3T14 A;  4GDP A;  3RNM A;  4AT2 A;  4FX9 A;  1E1L A;  3CPJ G;  2XFP A;  4EIP A;  1PBD A;  3CMM A;  3GYJ A;  5L46 A;  1Q1R A;  2DKI A;  4NTD A;  1E39 A;  3VRB A;  1XHC A;  1GRT A;  2YWL A;  2GF3 A;  1O94 A;  4NEV A;  2C73 A;  1EL5 A;  4H4Z A;  2C4C A;  2X50 A;  3NTD A;  2AAQ A;  1CHU A;  1L0V A;  5BVA A;  3AE6 A;  1PJ7 A;  3M12 A;  1S2Q A;  3AEA A;  2V6O A;  1TDE A;  1YKJ A;  1N4U A;  2CVJ A;  3GDN A;  4J33 A;  3L1R A;  4K22 A;  2BXR A;  1NHS A;  1ZMC A;  2GR3 A;  4BJZ A;  1JNR A;  3G5S A;  1RYI A;  4XWR A;  4U8N A;  2JB2 A;  4GUV A;  3CIR A;  3P4Q A;  1N4W A;  5HYM A;  5LV9 A;  1N4V A;  2JBV A;  2XYO A;  1B5Q A;  3SM8 A;  4EM4 A;  3SZ0 A;  1O5W A;  3IHM A;  4GR1 A;  4UDQ A;  4EQX A;  4Z2U A;  1NAA A;  4RG4 A;  4YTP A;  3UP5 A;  3AD9 B;  5U25 A;  4D04 A;  4A7A A;  2WPE A;  3O0H A;  3P9U A;  1H86 A;  1D7Y A;  2V5Z A;  3QJ4 A;  1H6V A;  1TYT A;  2WPC A;  4GDE A;  2WES A;  1ZP0 A;  2IVE A;  4YTN A;  4RSL A;  5FS7 A;  1IUU A;  3AEE A;  4BUR A;  1TDO A;  3LXD A;  1O95 A;  1GOS A;  5KMQ A;  4A6N B;  2VVL G;  2C76 A;  2C67 A;  3UOY A;  4EM3 A;  5CKU A;  1CC4 A;  4U8J A;  4K5S A;  2XLR A;  4JQ9 A;  4K7Z A;  3KU9 A;  2XVI A;  3AE9 A;  2IID A;  1GTH A;  2QA2 A;  2GVC A;  4B66 A;  1GES A;  2WP6 A;  4B64 A;  3AXB A;  4BK2 A;  1D4E A;  3K30 A;  3M13 A;  3S61 A;  1CF3 A;  2OA1 A;  4HB9 A;  1TDF A;  1CJ4 A;  3LOV A;  1GTE A;  1H84 A;  2B76 A;  2B9X A;  3NN6 X;  2QA1 A;  4DSH A;  2XVF A;  3NT6 A;  2APG A;  1ZKQ A;  3Q9T A;  2ZZ0 A;  2X99 A;  3LB8 A;  4FK1 A;  4H2R A;  5FMH A;  3T37 A;  2BK5 A;  1B4V A;  3T2Z A;  4ZCD A;  3ZDN A;  4CRT A;  3AE4 A;  4GRT A;  4H4T A;  5EBK A;  4J34 A;  2YQU A;  4Z2R A;  3PS9 A;  2H88 A;  3C4A A;  3BI4 A;  3GWF A;  1Y0P A;  1Z6L A;  1COY A;  4EQS A;  2XVE A;  2V60 A;  1DOC A;  4JY3 A;  4H7U A;  1LQU A;  2C75 A;  2WEU A;  3HYV A;  5KMR A;  3SGL A;  1NHP A;  1L9C A;  2X8H A;  4U2S A;  3SZW A;  1PJ5 A;  4OPC A;  2GAG B;  3P1W A;  1EL9 A;  4YSH A;  5JCM A;  1GEU A;  5IPY A;  2E4G A;  2WBA A;  4IV9 A;  2WP5 A;  1JRX A;  2QAE A;  2R0P A;  2OLO A;  1Y56 B;  2JB1 A;  3ALJ A;  3AE1 A;  1D4C A;  4H2Q A;  4C3X A;  5BUL A;  2YLT A;  3EPT A;  3SY4 A;  3CND A;  3KVE A;  2OLN A;  1GRH A;  4J57 A;  2BAC A;  4G6H A;  5KRQ A;  2WU2 A;  1F6M A;  2YLR A;  3ALL A;  3ISH A;  5CQF A;  1GSN A;  4APN A;  1W4X A;  3KA7 A;  1H82 A;  1ZMD A;  4XXG A;  3ALM A;  3EF6 A;  4TM4 A;  2H89 A;  2RGO A;  1KDG A;  3BHK A;  3HYX A;  4TLZ A;  1B8S A;  1GV4 A;  3PO7 A;  4FK1 C;  3T0K A;  2WHD A;  4ZCC A;  1UKV G;  3BI5 A;  1NG4 A;  1E1M A;  4II2 A;  4TM1 A;  1EL7 A;  2BS2 A;  4C3Y A;  3NG7 X;  4OPU A;  5KOW A;  2B9Y A;  1PXA A;  3C96 A;  2X8G A;  3ITJ A;  4U2L A;  4CY8 A;  1XDI A;  3AE8 A;  3AEC A;  1S3E A;  5KMP A;  1GRF A;  4I58 A;  5BRT A;  2BYB A;  3UOZ A;  5KVH A;  1IJH A;  2ACZ A;  2A8X A;  3CGC A;  3VRA A;  1PDH A;  1L9E A;  4ADW A;  4ECH A;  5FS9 A;  3AE3 A;  3F8D A;  2YG5 A;  2YLX A;  4PAA A;  3K7T A;  1GAL A;  1QLB A;  3QFB A;  1IUW A;  4II3 A;  1DNC A;  2XFN A;  4REK A;  2WPF A;  3UKK A;  1FEC A;  2GMH A;  1CC6 A;  2Y6Q A;  3AEF A;  2EQ7 A;  3GYX A;  4LA1 A;  4U8K A;  4AP1 A;  2FJE A;  4H4S A;  1YQ3 A;  3JSK A;  3R9U A;  4YSY A;  5U63 A;  3NYC A;  2FJD A;  1K0J A;  2BCG G;  1GND A;  1IUX A;  1QJD A;  2J3N A;  1F8W A;  3UOV A;  1ZDL A;  1JEH A;  1LTX R;  1SEZ A;  3CGE A;  5DBJ A;  1NHQ A;  2VRL A;  1E6E A;  2B7R A;  1KNR A;  2YR6 A;  3DGZ A;  4ICY A;  3GRS A;  4Z44 A;  4OVI A;  3DJE A;  3RHA A;  3GD4 A;  5HXI A;  5IQ4 A;  2WET A;  2EQ8 A;  3SFD A;  4B67 A;  2WOI A;  4Z26 A;  3ZYX A;  4BK3 A;  1JRY A;  4OPT A;  3WE0 A;  1QO8 A;  1Q9I A;  4YT0 A;  2YG3 A;  3II4 A;  4MJW A;  3SQP A;  1CJ2 A;  3K7Q X;  2PYX A;  4AP3 A;  2RAB A;  1PS9 A;  2VVL A;  2X8C A;  1TDN A;  2XVJ A;  3V76 A;  1H81 A;  1ZX9 A;  2R46 A;  4EMJ A;  3BHF A;  4X9N A;  4K8D A;  3GMB A;  1KFY A;  5BUK A;  3SXI A;  3S5W A;  1K4Q A;  4NZH A;  2C3D A;  2YG6 A;  4H4R A;  1H7X A;  1V59 A;  1BGJ A;  3GD3 A;  3LAD A;  2JKC A;  1FOH A;  2JK6 A;  3UKH A;  3KPK A;  1KSS A;  1S2Y A;  2CFY A;  1M64 A;  1P2H A;  2WP9 A;  2X3N A;  3NH3 X;  4G73 A;  1AOG A;  4PAB A;  5HY5 A;  2GH5 A;  2XFO A;  3AED A;  3DK8 A;  5U1O A;  4H4Y A;  4A99 A;  4J56 A;  4XWZ A;  2JB3 A;  2Q0L A;  4AOS A;  4J36 A;  4OCG A;  2UZZ A;  3F8R A;  2JAE A;  3NNE A;  2XLP A;  2YLW A;  2A87 A;  3UCL A;  1PHH A;  3F8P A;  3GYI A;  5IQ1 A;  1DOB A;  1CJC A;  2C70 A;  5JCI A;  3ABV A;  1DXL A;  1F8S A;  2BA9 A;  3LJP A;  3UKA A;  3AEB A;  3T31 A;  2YR5 A;  2RGH A;  1IUS A;  2VQ7 A;  4H4Q A;  2OAM A;  4M52 A;  1MXT A;  4UP3 A;  2GQF A;  2IVD A;  4B63 A;  4Z43 A;  2CUL A;  4X4J A;  2FBW A;  2YVF A;  5J7X A;  4OPL A;  3CNP A;  3NLC A;  1KSU A;  1MOK A;  2FJA A;  4AT0 A;  2C7G A;  2FJB A;  2YM2 A;  3AB1 A;  4RG3 A;  1FEB A;  5EB4 A;  5C3J A;  1EBD A;  1PBC A;  4EMW A;  1JOA A;  1PXB A;  2GR0 A;  3P4R A;  3OZ2 A;  3QVP A;  4BV6 A;  3KKJ A;  1E1K A;  1F8R A;  4ZN0 A;  2GAH B;  2B9W A;  2WU5 A;  2XCG A;  4U8P A;  4U8I A;  2O9Z A;  3NRN A;  2BXS A;  1PXC A;  2YLZ A;  3RED A;  2XDO A;  3KD9 A;  3M0O A;  3ADA B;  2Q7V A;  3EAN A;  1XAN A;  4A65 A;  4U2T A;  4EQW A;  3E1T A;  1VDC A;  3ICR A;  1PBF A;  3NYF A;  2E1M A;  3ATQ A;  1BWC A;  3IHG A;  1VRQ B;  2YG4 A;  2WDV A;  3COX A;  3SFE A;  2EQ9 A;  2WDQ A;  3AD8 B;  3B6D A;  1ZY8 A;  4IVM B;  4K5R A;  1JNZ A;  5EB5 A;  4H4V A;  3NK1 X;  1BKW A;  3DME A;  4P9S A;  5GSN A;  1TRB A;  2YR4 A;  4G9K A;  3DK9 A;  2YM1 A;  2BK4 A;  2WS3 A;  1YQ4 A;  3P4S A;  4JY2 A;  2PHH A;  3GSI A;  1IUT A;  4HA6 A;  4JN9 A;  4JDR A;  3CN8 A;  3BI2 A;  4CY6 A;  4H50 A;  4GCM A;  1KF6 A;  2VRM A;  1ZOY A;  2E5V A;  3K7M X;  2R9Z A;  1GET A;  1VG9 A;  3NTA A;  5TR3 A;  2BS4 A;  2GRT A;  2WOV A;  3CPH G;  4IA6 A;  2OAL A;  4BK1 A;  3DJD A;  2YVG A;  4H4X A;  3BNM A;  4X9M A;  3UOX A;  2GB0 A;  3AD7 B;  1OJD A;  3VRD B;  4C5O A;  2ZBW A;  1D5T A;  2BRA A;  4YSX A;  1YY5 A;  3GMC A;  3RP8 A;  3BNU A;  4D03 A;  1H7W A;  4UDR A;  1K0L A;  2VZ2 A;  5HHF A;  3UP4 A;  4TM3 A;  3GRT A;  3AYJ A;  2Z5X A;  4Z2T A;  1OJC A;  5JCN A;  3RP7 A;  4YWO A;  4AOX A;  5GRT A;  1GRE A;  1XPQ A;  4E0V A;  3PVC A;  4H2P A;  1NG3 A;  4U8M A;  4CBQ A;  3DA1 A;  2DKH A;  3DGH A;  2W0H A;  1DJN A;  1PN0 A;  3ICT A;  1ZK7 A;  2NVK X;  3UTH A;  4OPD A;  1S3B A;  4NTC A;  3AE5 A;  2R0G A;  5M10 A;  4NWZ A;  3HZL A;  3CTY A;  3UKP A;  2B7S A;  2R0C A;  4NEW A;  5C2T A;  2XLS A;  4GF7 A;  4JNA A;  4C74 A;  2HQM A;  1ELI A;  1FCD A;  4U8O A;  3UTE A;  2YVJ A;  2C64 A;  1IUV A;  1OJA A;  2BAB A;  3L8K A;  4LU6 A;  3DK4 A;  4FDC B;  2XVH A;  4UDP A;  5FS8 A;  4A79 A;  4A9W A;  2GMJ A;  4C77 A;  2GR1 A;  2YAU A;  1CBO A;  2XLU A;  1DJQ A;  4KX6 A;  3EAO A;  3I6D A;  1LV0 A;  1BF3 A;  2WDR A;  3QFA A;  4N9X A;  5JCK A;  1Q1W A;  5JCL A;  5KVI A;  2BS3 A;  2Z5Y A;  3Q6J A;  1ZOV A;  1GXF A;  3D1C A;  1LVL A;  2NPX A;  3DH9 A;  2F5Z A;  4G6G A;  2C72 A;  3NK0 X;  2GQW A;  1MO9 A;  4B1B A;  1OJ9 A;  3IC9 A;  1CJ3 A;  1KNP A;  2TPR A;  1GER A;  1RP0 A;  4I59 A;  1M6I A;  2A89 A;  3NYE A;  5ER0 A;  2VQB A;  1GRA A;  1RSG A;  3GWD A;  3CNS A;  1NPX A;  3ATR A;  3AE2 A;  2WOW A;  3IF9 A;  1CC2 A;  1X31 B;  2I0Z A;  1EL8 A;  4CCR A;  3NHO X;  3LZW A;  2V61 A;  4OPG A;  1GPE A;  1HYU A;  2RGJ A;  2Q6U A;  1L9D A;  3VR8 A;  3C4N A;  4OPI A;  4USR A;  3CPI G;  1TYP A;  4U8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...