3KD9A

Crystal structure of pyridine nucleotide disulfide oxidoreductase from pyrococcus horikoshii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
442
structure length
418
Chain Sequence
SLKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSEVFIKKRGIDLHLNAEVIEVDTGYVRVRENGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDALAIREYMEKYKVENVVIIGGGYIGIEMAEAFAAQGKNVTMIVRGERVLRRSFDKEVTDILEEKLKKHVNLRLQEITMKIEGEERVEKVVTDAGEYKAELVILATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKELHFPGVLGTAVTKFMDVEIGKTGLTEMEALKEGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSDILPRIDTAAAMLMAGFTTKDAFFTDLAYAPPFAPVWDPLIVLARVLKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridine nucleotide disulfide oxidoreductase from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
molecule keywords Coenzyme A disulfide reductase
total genus 124
structure length 418
sequence length 442
chains with identical sequence B, C
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kd9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kd9A01
1Q1WA 2BK3A 4NTDA 4EMIA 1EL7A 3KD9A 4A9WA 4U2LA 4YSXA 3BNUA 2WU2A 5GSNA 3AE1A 4OPIA 2B9WA 1N1PA 3F8DA 3GRTA 2GR3A 3ICSA 3CTYA 1PHHA 4JN9A 2GQFA 1S3EA 3GD4A 4REKA 3SGLA 4K8DA 4U2TA 4YTMA 3DK4A 2X3NA 2BYBA 2A87A 2YG4A 1KDGA 3NRNA 4H4WA 4NTEA 1ZMDA 2RABA 2CDUA 3LB8A 2BC1A 2XLRA 1W4XA 2CFYA 1IJHA 3FG2P 2R4JA 1BWCA 2WPCA 4YTPA 1IUSA 1GTEA 1M6IA 1PBCA 3E1TA 3QFBA 1L0VA 4C3XA 1H83A 5EB4A 1F8WA 1JNRA 1N4WA 3AE8A 5KXJA 4CRTA 4H2QA 2R46A 1FOHA 1E6EA 1NPXA 2C65A 2YLXA 4GCMA 1RSGA 1N4UA 4C77A 1KSUA 1GESA 1YY5A 1P2HA 1D7YA 1QLBA 1PBBA 4DSGA 1DJNA 1GSNA 3P4RA 3P1WA 1GRGA 3GYIA 4AT2A 3OC4A 1SEZA 4CNKA 1BGJA 2XCGA 2XFNA 3V3NA 4ECHA 5TR3A 1NAAA 1YQ4A 4XWZA 2C75A 2XLTA 4BJYA 1TDOA 2AR8A 1DNCA 2CULA 3T37A 5HYMA 3VRBA 3NHOX 4GDPA 1KF6A 4NZHA 5EBKA 3ALJA 5CKUA 4B69A 3RNMA 3LZWA 1OJTA 4LA1A 2Q0KA 1B8SA 1ZX9A 1PBDA 4Z43A 1RP0A 3BHFA 5M0ZA 3REDA 4B68A 2BS2A 1NENA 4X9MA 4GRTA 3VR8A 4AT0A 4B63A 4M52A 2GR1A 4PAAA 1KNPA 2WETA 5JCKA 2EQ9A 2EQ7A 3EAOA 2WOVA 1V59A 3D1CA 3DMEA 1P2EA 2GR2A 3F8RA 1GPEA 3CGDA 4CNJA 4Z2RA 4A6NA 2V6OA 1NG3A 3G5QA 4MJWA 4J2WA 4GDEA 4JDRA 4Y4NA 1VG9A 3CNTA 4X4JA 4ADWA 4CY6A 1PXBA 1ZKQA 3CGCA 3CPJG 2R0GA 1E1NA 2WDRA 3HZLA 3K7MX 3K7TA 4H4ZA 2TPRA 1DJQA 2ACZA 2ARDA 2YLSA 3IHGA 3UTEA 2PYXA 3DK8A 3UOXA 1Q1RA 2X8HA 4N9XA 1AOGA 2ZZBA 3DGZA 3GWFA 2JAEA 1PS9A 1VRQB 4YT0A 4H4SA 3KU9A 4H4TA 4B64A 2C76A 5HHFA 2WDVA 2WP6A 4IVMB 3UTFA 2X50A 4K5RA 1TDFA 4TLZA 1NHSA 1H6VA 3D8XA 2RGOA 2PHHA 1IUWA 2IIDA 2WHDA 4H4UA 5GRTA 4C3YA 2WU5A 5FS9A 4Z26A 4LU6A 3V3OA 3AYJA 3PS9A 2J3NA 3DJEA 3KKJA 3L1RA 3CNJA 1OJDA 3P9UA 3SFEA 3UKHA 5U63A 3BI4A 1NHQA 3AB1A 4J34A 2GAGB 4UP3A 4CCQA 3CIRA 3S61A 3BHKA 2BCPA 2GH5A 3C4AA 2GMJA 4GR1A 3NYCA 1D4CA 1FCDA 3Q9TA 2V3BA 4OPDA 1EL9A 4H4YA 3UTGA 3LJPA 2OLOA 2R45A 2VVLA 4YXDA 2BK5A 1GETA 3G5RA 3FPZA 1O95A 2E4GA 4HA6A 1VDCA 1H86A 2C72A 4H50A 4AOSA 4A99A 1F3PA 5U1OA 4JNAA 1L9DA 3Q6JA 4O5UA 5KWFA 1H7XA 2B9YA 4Z44A 3VR9A 4U2SA 3RP7A 2VVLG 3QSMA 4BK1A 5ER0A 2C7GA 4K5SA 4GUVA 2WPEA 1CBOA 4J36A 5C3JA 3ADAB 2BACA 3LZXA 2YM2A 1NEKA 2WDQA 1KNRA 3NTDA 2YWLA 1MOKA 3GD3A 3KPFA 1D5TA 3IHMA 1LTXR 3VRAA 1PBFA 4YTNA 3AWIA 3KVEA 1EBDA 3L8KA 2FJDA 2AAQA 4H7UA 3NK2X 5BUKA 2HQMA 2YR6A 2YR5A 4YSYA 2GMHA 1ZY8A 3CGEA 3LADA 5KRQA 2V60A 2B7SA 2CVJA 4JY2A 3ATQA 3UP5A 4DGKA 2GQWA 1VG0A 1JRXA 4JNQA 4BJZA 3CNPA 3PVCA 2YG7A 2XVFA 2E1MA 4ZCDA 1OJAA 3SM8A 2B9XA 1BF3A 4X9NA 1Y56B 3NLCA 2NPXA 1CJ3A 2TMDA 3CNDA 1JNZA 3AD7B 3KA7A 4ZCCA 2BABA 3AECA 1GRBA 5JCLA 1GNDA 1ZP0A 2QA2A 1D7LA 4OPCA 1PN0A 2GB0A 1GRAA 1BKWA 3BI2A 5FS7A 1MO9A 1EL5A 3ABVA 1X31B 4DSHA 2YG6A 2O9ZA 2FJEA 1YQZA 2Q0LA 3NH3X 2XLSA 4OPTA 3AYIA 3EF6A 1S2YA 3AEEA 4H4RA 2ZBWA 4PABA 2B76A 1JRZA 3ALLA 4TM1A 4CCRA 2JB2A 2YG3A 2A89A 1NHPA 1FL2A 3AEBA 3EPTA 1DOEA 1LVLA 2R0CA 4U8JA 3VRDB 4Z2UA 3AE6A 2YR4A 3H8IA 2A8XA 1E1KA 3GMBA 3IF9A 5KOWA 1VQWA 2BCGG 3G5SA 3UOZA 2Y6RA 2R9ZA 1GT8A 3EANA 1ELIA 4K22A 1JOAA 3LOVA 2AQJA 2GV8A 4A6NB 2Z5YA 1NG4A 4EM3A 3URHA 4UDRA 3BI5A 2R0PA 4D03A 3K30A 3UKQA 2C3DA 1XDIA 2WEUA 1MXTA 1D4EA 2WBAA 4XWRA 4XXGA 4J33A 2XVIA 3K7QX 1REOA 4C74A 4KPRA 1XANA 2VVMA 4H2PA 4YSZA 5L46A 4BK3A 2ZZCA 1Q9IA 2YLZA 4YKGA 4EIPA 4FK1A 1E39A 2FJAA 2BS3A 3AEFA 3JSKA 1PDHA 3AD9B 1YQ3A 1D4DA 2E5VA 1CC6A 2ZZ0A 1JEHA 1ZOVA 3R9UA 1E1MA 2QCUA 3UKPA 4H4PA 5EB5A 3ICRA 2B7RA 1YKJA 5FMHA 4GF7A 2WP9A 1DXLA 2JKCA 2V5ZA 3GWDA 4EM4A 3IC9A 2VOUA 2JB1A 1ZMCA 3F8PA 1COYA 1CC4A 1F8RA 3COXA 3NN6X 1Z6LA 3UOVA 2WOIA 3QFAA 1K0JA 3UOYA 3OZ2A 3UKFA 3BNMA 3NYFA 3O0HA 3RP8A 2APGA 2VQ7A 3GYJA 4IA6A 4USRA 4C5OA 2WS3A 2XVJA 5EOWA 1PXCA 2XVHA 3IWAA 2WP5A 3NYEA 1Y0PA 1GV4A 4AP1A 3SQPA 3FMWA 3NGCX 2BXSA 2JBVA 4D04A 1NHRA 4DNAA 4A65A 2Q6UA 3B3RA 2XDOA 1Y56A 3NK1X 2FBWA 2IVDA 2C67A 2X99A 4USQA 3DJDA 1DOCA 4EQSA 2F5ZA 4K2XA 4RSLA 2I0ZA 2YG5A 1LJ1A 4WX1A 2XFUA 4CY8A 2R4EA 4BURA 1DODA 1BZLA 2FJBA 1S2QA 1F6MA 4FK1C 2EQ8A 3I6DA 4J57A 4BV6A 4J31A 2DKHA 2XFPA 3II4A 1PJ5A 3AE7A 4EIQA 1GRFA 1EL8A 4TM3A 1JRYA 2GF3A 3DJJA 2IVEA 4U8PA 1CHUA 5HY5A 1E1LA 1L9EA 1FECA 1GRHA 4O5QA 1GERA 4OPLA 3ICTA 3QJ4A 3ITJA 5DBJA 3AE3A 4IA5A 1B4VA 1H84A 4NEWA 4EQRA 3ATRA 1TDKA 4YWOA 2OAMA 1GOSA 3CNSA 1E7PA 5FS6A 3NK0X 3S5WA 4Z2TA 2YLTA 3GDPA 1NDAA 4JQ9A 4CBQA 5IQ4A 1CJ4A 3C96A 4HB9A 1DOBA 2GRTA 3M0OA 4B65A 2XLUA 5JCMA 3UKLA 2YAUA 2BK4A 3FBSA 3AXBA 3ALMA 3NKSA 3B6DA 3NT6A 5BRTA 1O5WA 2EQ6A 1GRTA 3AE4A 1KSSA 4I59A 4A79A 3NIXA 3WE0A 2RGJA 3ZDNA 5KVHA 4IV9A 2QAEA 1L9CA 1UKVG 1PJ7A 2WPFA 4Z24A 4IVOB 1LV0A 5C2TA 4I58A 5BULA 3DJGX 3GMCA 1XHCA 2YVFA 5JCIA 3VQRA 1H81A 4J56A 4RG4A 2XLPA 4AP3A 3I3LA 4NTCA 2YLWA 2GVCA 2C64A 1BGNA 4H4QA 1ZOYA 2YVJA 2BXRA 1CC2A 1TDEA 4YSHA 1PJ6A 1QJDA 1GXFA 1N4VA 2Y6QA 2NVKX 4RG3A 1S3BA 1LQTA 2OA1A 3PO7A 5IPYA 2XFOA 3AE5A 4OVIA 2GAHB 3CN8A 2XFQA 1B5QA 4KX6A 4B1BA 2VRLA 3NTAA 1CF3A 3M12A 4A7AA 3CPIG 2YVGA 3NG7X 4EQXA 4AOXA 3V76A 3AE9A 4YKFA 4EQWA 1XPQA 2VRMA 1GREA 3UKAA 3NNEA 2H89A 3H8LA 2C3CA 2Q7VA 2UZZA 3QSSA 4B67A 2QA1A 1CJCA 5HXIA 1KFYA 4FDCB 4U8MA 4K7ZA 2W0HA 2YLRA 1K4QA 1GALA 1HYUA 1M64A 4EMWA 4UDQA 4Y4MA 4WCTA 2VZ2A 5J60A 1O94A 4Y4LA 2GEWA 4U8KA 4BK2A 4U8IA 3SFDA 1PBEA 3FIMB 4OPUA 1ZDLA 3GRSA 1F8SA 3QVRA 3DH9A 1TRBA 3UTHA 3DGHA 3ISHA 4ICYA 4EMJA 5IQ1A 1IUUA 1LPFA 1TYTA 1ONFA 1K0LA 1OJ9A 1RYIA 2XVEA 3AEDA 5CQFA 2C66A 2OLNA 2VQBA 3CGBA 4TLXA 4H2NA 4P9SA 4B66A 2WQYA 2C73A 2DKIA 4Z25A 5U25A 3ZYXA 5JCNA 1GTHA 3QVPA 5FS8A 1CL0A 2BC0A 2GR0A 1FEBA 1ZK7A 1K0IA 2V61A 4TM0A 5KOXA 3KLJA 1B37A 1CJ2A 3DA1A 3UCLA 2RGHA 3UP4A 4OCGA 4NEVA 5J7XA 2X8GA 4H4VA 1IUVA 3AYLA 2C70A 3QSEA 3RHAA 3GDNA 3AD8B 1QO8A 4ZN0A 2JB3A 4U8NA 2OALA 4H4XA 2YM1A 3C4NA 3CPHG 2BA9A 3P4PA 1TYPA 3GSIA 1IUTA 4TM4A 2X8CA 5KVIA 3P4SA 3P4QA 2YQUA 1H82A 3LXDA 4FX9A 2JK6A 4U8LA 1IUXA 3RP6A 4A5LA 1JU2A 3M13A 4UDPA 4E0VA 5BVAA 1FEAA 3H4KA 4JY3A 3UKKA 4H2RA 2V3AA 2Z5XA 3AE2A 2WOWA 4APNA 1H7WA 1GEUA 2BS4A 2H88A 2WESA 3AEGA 3DK9A 4LIIA 4OPGA 4U8OA 1TDNA 1OJCA 3AEAA 1PXAA 5LV9A 3NN0X 5M10A 1LQUA 2XYOA
chains in the Genus database with same CATH superfamily
1Q1WA 2BK3A 4NTDA 4EMIA 1EL7A 3KD9A 4A9WA 4U2LA 4YSXA 3BNUA 2WU2A 5GSNA 3AE1A 4OPIA 2B9WA 1N1PA 3F8DA 3GRTA 2GR3A 3ICSA 3CTYA 1PHHA 4JN9A 2GQFA 1S3EA 3GD4A 4REKA 3SGLA 4K8DA 4U2TA 4YTMA 3DK4A 2X3NA 2BYBA 2A87A 2YG4A 1KDGA 3NRNA 4H4WA 4NTEA 1ZMDA 2RABA 2CDUA 3LB8A 3SX6A 3HYXA 2BC1A 2XLRA 1W4XA 2CFYA 1IJHA 3FG2P 2R4JA 1BWCA 2WPCA 4YTPA 1IUSA 1GTEA 1M6IA 1PBCA 3E1TA 3QFBA 1L0VA 4C3XA 1H83A 4II2A 5EB4A 1F8WA 1JNRA 1N4WA 3AE8A 5KXJA 4CRTA 4G6HA 4H2QA 2R46A 5KMQA 1FOHA 1E6EA 1NPXA 2C65A 2YLXA 4GCMA 1RSGA 1N4UA 4C77A 1KSUA 1GESA 1YY5A 1P2HA 1D7YA 1QLBA 1PBBA 4DSGA 1DJNA 1GSNA 3P4RA 3P1WA 1GRGA 3GYIA 4AT2A 3OC4A 1SEZA 4CNKA 1BGJA 2XCGA 2XFNA 3V3NA 4ECHA 5TR3A 1NAAA 1YQ4A 4XWZA 2C75A 2XLTA 4BJYA 1TDOA 2AR8A 1DNCA 2CULA 3T37A 5HYMA 3VRBA 3NHOX 4GDPA 1KF6A 4NZHA 5EBKA 3ALJA 5CKUA 4B69A 3RNMA 3LZWA 1OJTA 4LA1A 2Q0KA 1B8SA 1ZX9A 1PBDA 4Z43A 1RP0A 3BHFA 5M0ZA 3REDA 4B68A 2BS2A 1NENA 4X9MA 4GRTA 3VR8A 4AT0A 4B63A 4M52A 2GR1A 4PAAA 1KNPA 2WETA 5JCKA 2EQ9A 2EQ7A 3EAOA 2WOVA 1V59A 3D1CA 3DMEA 1P2EA 2GR2A 3F8RA 1GPEA 3CGDA 4II3A 4CNJA 4Z2RA 4A6NA 2V6OA 1NG3A 3G5QA 4MJWA 4J2WA 4GDEA 4JDRA 4Y4NA 1VG9A 3CNTA 4X4JA 4ADWA 4CY6A 1PXBA 1ZKQA 3CGCA 3CPJG 2R0GA 1E1NA 2WDRA 3HZLA 2C4CA 3K7MX 3K7TA 4H4ZA 2TPRA 1DJQA 2ACZA 2ARDA 2YLSA 3IHGA 3UTEA 2PYXA 3DK8A 3UOXA 1Q1RA 2X8HA 4N9XA 1AOGA 2ZZBA 3DGZA 3GWFA 2JAEA 1PS9A 1VRQB 4YT0A 4H4SA 3KU9A 4H4TA 4B64A 2C76A 5HHFA 2WDVA 2WP6A 4IVMB 3UTFA 2X50A 4K5RA 1TDFA 4TLZA 1NHSA 1H6VA 3D8XA 2RGOA 2PHHA 1IUWA 2IIDA 2WHDA 3GYXA 4H4UA 5GRTA 2WU5A 5FS9A 4Z26A 4LU6A 3V3OA 3AYJA 3PS9A 2J3NA 3DJEA 3KKJA 3L1RA 3CNJA 1OJDA 3P9UA 3SFEA 3UKHA 5U63A 3BI4A 1NHQA 3AB1A 4J34A 2GAGB 4UP3A 4CCQA 3CIRA 3S61A 3BHKA 2BCPA 2GH5A 3C4AA 2GMJA 4GR1A 3NYCA 1D4CA 1FCDA 3Q9TA 2V3BA 4OPDA 1EL9A 4H4YA 3UTGA 3LJPA 2OLOA 2R45A 2VVLA 3T2ZA 2BK5A 4YXDA 1GETA 3G5RA 3SZ0A 3FPZA 1O95A 2E4GA 4HA6A 1VDCA 1H86A 2C72A 4H50A 4AOSA 4A99A 1F3PA 5U1OA 4JNAA 1L9DA 3Q6JA 4O5UA 5KWFA 1H7XA 2B9YA 4Z44A 3VR9A 4U2SA 3RP7A 2VVLG 3QSMA 4BK1A 3SY4A 5ER0A 2C7GA 4K5SA 4GUVA 2WPEA 1CBOA 4J36A 5C3JA 3ADAB 2BACA 3LZXA 2YM2A 1NEKA 2WDQA 1KNRA 3NTDA 4NWZA 2YWLA 1MOKA 3GD3A 3KPFA 1D5TA 3IHMA 1LTXR 3VRAA 1PBFA 4YTNA 3AWIA 3KVEA 1EBDA 3L8KA 2FJDA 2AAQA 4H7UA 3NK2X 5BUKA 2HQMA 2YR6A 2YR5A 4YSYA 2GMHA 1ZY8A 3CGEA 3LADA 5KRQA 2V60A 2B7SA 2CVJA 4JY2A 3ATQA 3UP5A 4DGKA 2GQWA 1VG0A 1JRXA 4JNQA 4BJZA 3CNPA 3PVCA 2YG7A 2XVFA 2E1MA 4ZCDA 1OJAA 3SM8A 2B9XA 1BF3A 4X9NA 1Y56B 3NLCA 2NPXA 1CJ3A 2TMDA 3CNDA 1JNZA 3AD7B 3KA7A 4ZCCA 2BABA 3AECA 1GRBA 5JCLA 1GNDA 1ZP0A 2QA2A 1D7LA 4OPCA 1PN0A 2GB0A 1GRAA 1BKWA 3BI2A 5FS7A 3T0KA 1MO9A 1EL5A 2BRYA 1X31B 3ABVA 2YG6A 2O9ZA 2FJEA 1YQZA 2Q0LA 3HYWA 3NH3X 4DSHA 2XLSA 4OPTA 3AYIA 3EF6A 1S2YA 3AEEA 4H4RA 2ZBWA 4PABA 2B76A 1JRZA 3ALLA 4TM1A 4CCRA 2JB2A 3T31A 2YG3A 2A89A 1NHPA 1FL2A 3AEBA 3EPTA 1DOEA 1LVLA 2R0CA 4U8JA 3VRDB 4Z2UA 3AE6A 2YR4A 3H8IA 2A8XA 1E1KA 3GMBA 3IF9A 5KOWA 1VQWA 2BCGG 3G5SA 3UOZA 2Y6RA 2R9ZA 1GT8A 3EANA 1ELIA 3CMMA 4K22A 1JOAA 3LOVA 2AQJA 2GV8A 4A6NB 2Z5YA 1NG4A 4EM3A 3URHA 4UDRA 3BI5A 2R0PA 4D03A 3K30A 3UKQA 2C3DA 1XDIA 2WEUA 4G9KA 1MXTA 1D4EA 2WBAA 4XWRA 4XXGA 4J33A 2XVIA 3K7QX 1REOA 4C74A 4KPRA 1XANA 2VVMA 4H2PA 4YSZA 5L46A 4BK3A 2ZZCA 1Q9IA 2YLZA 4YKGA 4EIPA 4FK1A 1E39A 2FJAA 3SZCA 2BS3A 3AEFA 3JSKA 1PDHA 3AD9B 1YQ3A 1D4DA 2BRAA 2E5VA 1CC6A 2ZZ0A 4NNJA 1JEHA 1ZOVA 3R9UA 1E1MA 2QCUA 3UKPA 4H4PA 5EB5A 3ICRA 2B7RA 1YKJA 5FMHA 4GF7A 2WP9A 1DXLA 2JKCA 2V5ZA 3GWDA 4EM4A 3IC9A 2VOUA 5KMRA 2JB1A 1ZMCA 3F8PA 1COYA 1CC4A 1F8RA 3COXA 3NN6X 1Z6LA 3UOVA 2WOIA 3QFAA 1K0JA 3UOYA 3OZ2A 3UKFA 3BNMA 3NYFA 3O0HA 3RP8A 2APGA 2VQ7A 3GYJA 4IA6A 4USRA 4C5OA 2WS3A 2XVJA 5EOWA 1PXCA 2XVHA 3IWAA 2WP5A 3NYEA 1Y0PA 1GV4A 4AP1A 3SQPA 3FMWA 3NGCX 2BXSA 2JBVA 4D04A 1NHRA 4DNAA 4A65A 2Q6UA 3B3RA 2XDOA 1Y56A 3NK1X 2FBWA 2IVDA 2C67A 2X99A 4USQA 3DJDA 1DOCA 4EQSA 2F5ZA 4K2XA 4RSLA 2I0ZA 2YG5A 1LJ1A 4WX1A 2XFUA 4CY8A 2R4EA 5KMPA 4BURA 1DODA 1BZLA 2FJBA 1S2QA 1F6MA 4FK1C 2EQ8A 3I6DA 4J57A 4BV6A 4J31A 2DKHA 2XFPA 3II4A 1PJ5A 3AE7A 4EIQA 1GRFA 1EL8A 4TM3A 1JRYA 2GF3A 3DJJA 2IVEA 4U8PA 1CHUA 5HY5A 1E1LA 1L9EA 1FECA 1GRHA 4O5QA 1GERA 4OPLA 3ICTA 3QJ4A 3ITJA 5DBJA 3AE3A 4IA5A 1B4VA 1H84A 4NEWA 4EQRA 3ATRA 1TDKA 4YWOA 2OAMA 1GOSA 3CNSA 1E7PA 4GAVA 5FS6A 3NK0X 3S5WA 4Z2TA 2YLTA 3HYVA 3GDPA 1NDAA 4JQ9A 4CBQA 5IQ4A 1CJ4A 3C96A 4HB9A 1DOBA 2GRTA 3M0OA 4B65A 2XLUA 5JCMA 3UKLA 2YAUA 2BK4A 3FBSA 3AXBA 3ALMA 3NKSA 3B6DA 3NT6A 5BRTA 1O5WA 2EQ6A 1GRTA 3AE4A 1KSSA 4I59A 4A79A 3NIXA 3WE0A 2RGJA 4G73A 3ZDNA 5KVHA 4IV9A 3KPKA 5KMSA 2QAEA 1L9CA 1UKVG 1PJ7A 2WPFA 3SZWA 4Z24A 4IVOB 1LV0A 5C2TA 4I58A 5BULA 3DJGX 3GMCA 1XHCA 2YVFA 5JCIA 3VQRA 1H81A 4J56A 4RG4A 2XLPA 4AP3A 3I3LA 4NTCA 2YLWA 2GVCA 2C64A 1BGNA 4H4QA 1ZOYA 2YVJA 2BXRA 1CC2A 1TDEA 4YSHA 1PJ6A 1QJDA 1GXFA 1N4VA 2Y6QA 2NVKX 4RG3A 1S3BA 1LQTA 2OA1A 3PO7A 5IPYA 2XFOA 3AE5A 4OVIA 2GAHB 3CN8A 2XFQA 1B5QA 4KX6A 4B1BA 2VRLA 3NTAA 1CF3A 3M12A 4A7AA 3CPIG 2YVGA 3NG7X 4EQXA 4AOXA 3V76A 3AE9A 4GAPA 4YKFA 4EQWA 1XPQA 2VRMA 1GREA 3UKAA 3NNEA 2H89A 3H8LA 2C3CA 2Q7VA 2UZZA 3QSSA 4B67A 2QA1A 1CJCA 3SXIA 1KFYA 5HXIA 4FDCB 4U8MA 4K7ZA 2W0HA 2YLRA 1K4QA 1GALA 1HYUA 1M64A 4EMWA 4UDQA 4Y4MA 4WCTA 2VZ2A 4C3YA 5J60A 1O94A 4Y4LA 2GEWA 4U8KA 4BK2A 4U8IA 3SFDA 1PBEA 3FIMB 4OPUA 1ZDLA 3GRSA 1F8SA 3QVRA 3DH9A 1TRBA 3UTHA 3DGHA 3ISHA 4ICYA 3SZFA 5IQ1A 1IUUA 4EMJA 1LPFA 1TYTA 1ONFA 1K0LA 1OJ9A 1RYIA 2XVEA 3AEDA 5CQFA 2C66A 2OLNA 2VQBA 3CGBA 4TLXA 4H2NA 4P9SA 4B66A 2WQYA 2C73A 2DKIA 4Z25A 5U25A 3ZYXA 5JCNA 1GTHA 3QVPA 5FS8A 1CL0A 2BC0A 2GR0A 1FEBA 4G6GA 1ZK7A 1K0IA 2V61A 3T14A 4TM0A 5KOXA 3KLJA 5KNLA 1B37A 1CJ2A 3DA1A 3UCLA 2RGHA 3SYIA 3UP4A 4OCGA 4NEVA 5J7XA 2X8GA 4H4VA 1IUVA 3AYLA 2C70A 3QSEA 3RHAA 3GDNA 3AD8B 1QO8A 4ZN0A 2JB3A 4U8NA 2OALA 4H4XA 2YM1A 3C4NA 3CPHG 2BA9A 3P4PA 1TYPA 3GSIA 1IUTA 4TM4A 2X8CA 5KVIA 3P4SA 3T2KA 3P4QA 2YQUA 1H82A 3LXDA 4FX9A 2JK6A 4U8LA 1IUXA 3RP6A 4A5LA 1JU2A 3M13A 4UDPA 4E0VA 5BVAA 1FEAA 3H4KA 4JY3A 3UKKA 4H2RA 3T2YA 2V3AA 2Z5XA 3AE2A 2WOWA 4APNA 1H7WA 1GEUA 2BS4A 2H88A 2WESA 3AEGA 3DK9A 4LIIA 4OPGA 4U8OA 1TDNA 1OJCA 3AEAA 1PXAA 4G74A 3NN0X 5LV9A 5M10A 1LQUA 2XYOA
chains in the Genus database with same CATH topology
1Q1WA 2BK3A 4NTDA 4EMIA 1EL7A 3KD9A 4A9WA 4U2LA 4YSXA 3BNUA 2WU2A 5GSNA 3AE1A 4OPIA 2B9WA 1N1PA 3F8DA 3GRTA 2GR3A 3ICSA 3CTYA 1PHHA 4JN9A 2GQFA 1S3EA 3GD4A 4REKA 3SGLA 4K8DA 4U2TA 4YTMA 3DK4A 2X3NA 2BYBA 2A87A 2YG4A 1KDGA 3NRNA 4H4WA 4NTEA 1ZMDA 2RABA 2CDUA 3LB8A 3SX6A 3HYXA 2BC1A 2XLRA 1W4XA 2CFYA 1IJHA 3FG2P 2R4JA 1BWCA 2WPCA 4YTPA 1IUSA 1GTEA 1M6IA 1PBCA 3E1TA 3QFBA 1L0VA 4C3XA 1H83A 4II2A 5EB4A 1F8WA 1JNRA 1N4WA 3AE8A 5KXJA 4CRTA 4G6HA 4H2QA 2R46A 5KMQA 1FOHA 1E6EA 1NPXA 2C65A 2YLXA 4GCMA 1RSGA 1N4UA 4C77A 1KSUA 1GESA 1YY5A 1P2HA 1D7YA 1QLBA 1PBBA 4DSGA 1DJNA 1GSNA 3P4RA 3P1WA 1GRGA 3GYIA 4AT2A 3OC4A 1SEZA 4CNKA 1BGJA 2XCGA 2XFNA 3V3NA 4ECHA 5TR3A 1NAAA 1YQ4A 4XWZA 2C75A 2XLTA 4BJYA 1TDOA 2AR8A 1DNCA 2CULA 3T37A 5HYMA 3VRBA 3NHOX 4GDPA 1KF6A 4NZHA 5EBKA 3ALJA 5CKUA 4B69A 3RNMA 3LZWA 1OJTA 4LA1A 2Q0KA 1B8SA 1ZX9A 1PBDA 4Z43A 1RP0A 3BHFA 5M0ZA 3REDA 4B68A 2BS2A 1NENA 4X9MA 4GRTA 3VR8A 4AT0A 4B63A 4M52A 2GR1A 4PAAA 1KNPA 2WETA 5JCKA 2EQ9A 2EQ7A 3EAOA 2WOVA 1V59A 3D1CA 3DMEA 1P2EA 2GR2A 3F8RA 1GPEA 3CGDA 4II3A 4CNJA 4Z2RA 4A6NA 2V6OA 1NG3A 3G5QA 4MJWA 4J2WA 4GDEA 4JDRA 4Y4NA 1VG9A 3CNTA 4X4JA 4ADWA 4CY6A 1PXBA 1ZKQA 3CGCA 3CPJG 2R0GA 1E1NA 2WDRA 3HZLA 2C4CA 3K7MX 3K7TA 4H4ZA 2TPRA 1DJQA 2ACZA 2ARDA 2YLSA 3IHGA 3UTEA 2PYXA 3DK8A 3UOXA 1Q1RA 2X8HA 4N9XA 1AOGA 2ZZBA 3DGZA 3GWFA 2JAEA 1PS9A 1VRQB 4YT0A 4H4SA 3KU9A 4H4TA 4B64A 2C76A 5HHFA 2WDVA 2WP6A 4IVMB 3UTFA 2X50A 4K5RA 1TDFA 4TLZA 1NHSA 1H6VA 3D8XA 2RGOA 2PHHA 1IUWA 2IIDA 2WHDA 3GYXA 4H4UA 5GRTA 2WU5A 5FS9A 4Z26A 4LU6A 3V3OA 3AYJA 3PS9A 2J3NA 3DJEA 3KKJA 3L1RA 3CNJA 1OJDA 3P9UA 3SFEA 3UKHA 5U63A 3BI4A 1NHQA 3AB1A 4J34A 2GAGB 4UP3A 4CCQA 3CIRA 3S61A 3BHKA 2BCPA 2GH5A 3C4AA 2GMJA 4GR1A 3NYCA 1D4CA 1FCDA 3Q9TA 2V3BA 4OPDA 1EL9A 4H4YA 3UTGA 3LJPA 2OLOA 2R45A 2VVLA 3T2ZA 2BK5A 4YXDA 1GETA 3G5RA 3SZ0A 3FPZA 1O95A 2E4GA 4HA6A 1VDCA 1H86A 2C72A 4H50A 4AOSA 4A99A 1F3PA 5U1OA 4JNAA 1L9DA 3Q6JA 4O5UA 5KWFA 1H7XA 2B9YA 4Z44A 3VR9A 4U2SA 3RP7A 2VVLG 3QSMA 4BK1A 3SY4A 5ER0A 2C7GA 4K5SA 4GUVA 2WPEA 1CBOA 4J36A 5C3JA 3ADAB 2BACA 3LZXA 2YM2A 1NEKA 2WDQA 1KNRA 3NTDA 4NWZA 2YWLA 1MOKA 3GD3A 3KPFA 1D5TA 3IHMA 1LTXR 3VRAA 1PBFA 4YTNA 3AWIA 3KVEA 1EBDA 3L8KA 2FJDA 2AAQA 4H7UA 3NK2X 5BUKA 2HQMA 2YR6A 2YR5A 4YSYA 2GMHA 1ZY8A 3CGEA 3LADA 5KRQA 2V60A 2B7SA 2CVJA 4JY2A 3ATQA 3UP5A 4DGKA 2GQWA 1VG0A 1JRXA 4JNQA 4BJZA 3CNPA 3PVCA 2YG7A 2XVFA 2E1MA 4ZCDA 1OJAA 3SM8A 2B9XA 1BF3A 4X9NA 1Y56B 3NLCA 2NPXA 1CJ3A 2TMDA 3CNDA 1JNZA 3AD7B 3KA7A 4ZCCA 2BABA 3AECA 1GRBA 5JCLA 1GNDA 1ZP0A 2QA2A 1D7LA 4OPCA 1PN0A 2GB0A 1GRAA 1BKWA 3BI2A 5FS7A 3T0KA 1MO9A 1EL5A 2BRYA 1X31B 3ABVA 2YG6A 2O9ZA 2FJEA 1YQZA 2Q0LA 3HYWA 3NH3X 4DSHA 2XLSA 4OPTA 3AYIA 3EF6A 1S2YA 3AEEA 4H4RA 2ZBWA 4PABA 2B76A 1JRZA 3ALLA 4TM1A 4CCRA 2JB2A 3T31A 2YG3A 2A89A 1NHPA 1FL2A 3AEBA 3EPTA 1DOEA 1LVLA 2R0CA 4U8JA 3VRDB 4Z2UA 3AE6A 2YR4A 3H8IA 2A8XA 1E1KA 3GMBA 3IF9A 5KOWA 1VQWA 2BCGG 3G5SA 3UOZA 2Y6RA 2R9ZA 1GT8A 3EANA 1ELIA 3CMMA 4K22A 1JOAA 3LOVA 2AQJA 2GV8A 4A6NB 2Z5YA 1NG4A 4EM3A 3URHA 4UDRA 3BI5A 2R0PA 4D03A 3K30A 3UKQA 2C3DA 1XDIA 2WEUA 4G9KA 1MXTA 1D4EA 2WBAA 4XWRA 4XXGA 4J33A 2XVIA 3K7QX 1REOA 4C74A 4KPRA 1XANA 2VVMA 4H2PA 4YSZA 5L46A 4BK3A 2ZZCA 1Q9IA 2YLZA 4YKGA 4EIPA 4FK1A 1E39A 2FJAA 3SZCA 2BS3A 3AEFA 3JSKA 1PDHA 3AD9B 1YQ3A 1D4DA 2BRAA 2E5VA 1CC6A 2ZZ0A 4NNJA 1JEHA 1ZOVA 3R9UA 1E1MA 2QCUA 3UKPA 4H4PA 5EB5A 3ICRA 2B7RA 1YKJA 5FMHA 4GF7A 2WP9A 1DXLA 2JKCA 2V5ZA 3GWDA 4EM4A 3IC9A 2VOUA 5KMRA 2JB1A 1ZMCA 3F8PA 1COYA 1CC4A 1F8RA 3COXA 3NN6X 1Z6LA 3UOVA 2WOIA 3QFAA 1K0JA 3UOYA 3OZ2A 3UKFA 3BNMA 3NYFA 3O0HA 3RP8A 2APGA 2VQ7A 3GYJA 4IA6A 4USRA 4C5OA 2WS3A 2XVJA 5EOWA 1PXCA 2XVHA 3IWAA 2WP5A 3NYEA 1Y0PA 1GV4A 4AP1A 3SQPA 3FMWA 3NGCX 2BXSA 2JBVA 4D04A 1NHRA 4DNAA 4A65A 2Q6UA 3B3RA 2XDOA 1Y56A 3NK1X 2FBWA 2IVDA 2C67A 2X99A 4USQA 3DJDA 1DOCA 4EQSA 2F5ZA 4K2XA 4RSLA 2I0ZA 2YG5A 1LJ1A 4WX1A 2XFUA 4CY8A 2R4EA 5KMPA 4BURA 1DODA 1BZLA 2FJBA 1S2QA 1F6MA 4FK1C 2EQ8A 3I6DA 4J57A 4BV6A 4J31A 2DKHA 2XFPA 3II4A 1PJ5A 3AE7A 4EIQA 1GRFA 1EL8A 4TM3A 1JRYA 2GF3A 3DJJA 2IVEA 4U8PA 1CHUA 5HY5A 1E1LA 1L9EA 1FECA 1GRHA 4O5QA 1GERA 4OPLA 3ICTA 3QJ4A 3ITJA 5DBJA 3AE3A 4IA5A 1B4VA 1H84A 4NEWA 4EQRA 3ATRA 1TDKA 4YWOA 2OAMA 1GOSA 3CNSA 1E7PA 4GAVA 5FS6A 3NK0X 3S5WA 4Z2TA 2YLTA 3HYVA 3GDPA 1NDAA 4JQ9A 4CBQA 5IQ4A 1CJ4A 3C96A 4HB9A 1DOBA 2GRTA 3M0OA 4B65A 2XLUA 5JCMA 3UKLA 2YAUA 2BK4A 3FBSA 3AXBA 3ALMA 3NKSA 3B6DA 3NT6A 5BRTA 1O5WA 2EQ6A 1GRTA 3AE4A 1KSSA 4I59A 4A79A 3NIXA 3WE0A 2RGJA 4G73A 3ZDNA 5KVHA 4IV9A 3KPKA 5KMSA 2QAEA 1L9CA 1UKVG 1PJ7A 2WPFA 3SZWA 4Z24A 4IVOB 1LV0A 5C2TA 4I58A 5BULA 3DJGX 3GMCA 1XHCA 2YVFA 5JCIA 3VQRA 1H81A 4J56A 4RG4A 2XLPA 4AP3A 3I3LA 4NTCA 2YLWA 2GVCA 2C64A 1BGNA 4H4QA 1ZOYA 2YVJA 2BXRA 1CC2A 1TDEA 4YSHA 1PJ6A 1QJDA 1GXFA 1N4VA 2Y6QA 2NVKX 4RG3A 1S3BA 1LQTA 2OA1A 3PO7A 5IPYA 2XFOA 3AE5A 4OVIA 2GAHB 3CN8A 2XFQA 1B5QA 4KX6A 4B1BA 2VRLA 3NTAA 1CF3A 3M12A 4A7AA 3CPIG 2YVGA 3NG7X 4EQXA 4AOXA 3V76A 3AE9A 4GAPA 4YKFA 4EQWA 1XPQA 2VRMA 1GREA 3UKAA 3NNEA 2H89A 3H8LA 2C3CA 2Q7VA 2UZZA 3QSSA 4B67A 2QA1A 1CJCA 3SXIA 1KFYA 5HXIA 4FDCB 4U8MA 4K7ZA 2W0HA 2YLRA 1K4QA 1GALA 1HYUA 1M64A 4EMWA 4UDQA 4Y4MA 4WCTA 2VZ2A 4C3YA 5J60A 1O94A 4Y4LA 2GEWA 4U8KA 4BK2A 4U8IA 3SFDA 1PBEA 3FIMB 4OPUA 1ZDLA 3GRSA 1F8SA 3QVRA 3DH9A 1TRBA 3UTHA 3DGHA 3ISHA 4ICYA 3SZFA 5IQ1A 1IUUA 4EMJA 1LPFA 1TYTA 1ONFA 1K0LA 1OJ9A 1RYIA 2XVEA 3AEDA 5CQFA 2C66A 2OLNA 2VQBA 3CGBA 4TLXA 4H2NA 4P9SA 4B66A 2WQYA 2C73A 2DKIA 4Z25A 5U25A 3ZYXA 5JCNA 1GTHA 3QVPA 5FS8A 1CL0A 2BC0A 2GR0A 1FEBA 4G6GA 1ZK7A 1K0IA 2V61A 3T14A 4TM0A 5KOXA 3KLJA 5KNLA 1B37A 1CJ2A 3DA1A 3UCLA 2RGHA 3SYIA 3UP4A 4OCGA 4NEVA 5J7XA 2X8GA 4H4VA 1IUVA 3AYLA 2C70A 3QSEA 3RHAA 3GDNA 3AD8B 1QO8A 4ZN0A 2JB3A 4U8NA 2OALA 4H4XA 2YM1A 3C4NA 3CPHG 2BA9A 3P4PA 1TYPA 3GSIA 1IUTA 4TM4A 2X8CA 5KVIA 3P4SA 3T2KA 3P4QA 2YQUA 1H82A 3LXDA 4FX9A 2JK6A 4U8LA 1IUXA 3RP6A 4A5LA 1JU2A 3M13A 4UDPA 4E0VA 5BVAA 1FEAA 3H4KA 4JY3A 3UKKA 4H2RA 3T2YA 2V3AA 2Z5XA 3AE2A 2WOWA 4APNA 1H7WA 1GEUA 2BS4A 2H88A 2WESA 3AEGA 3DK9A 4LIIA 4OPGA 4U8OA 1TDNA 1OJCA 3AEAA 1PXAA 4G74A 3NN0X 5LV9A 5M10A 1LQUA 2XYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1W A;  2BK3 A;  4NTD A;  4EMI A;  1EL7 A;  3KD9 A;  4A9W A;  4U2L A;  4YSX A;  3BNU A;  2WU2 A;  5GSN A;  3AE1 A;  4OPI A;  2B9W A;  1N1P A;  3F8D A;  3GRT A;  2GR3 A;  3ICS A;  3CTY A;  1PHH A;  4JN9 A;  2GQF A;  1S3E A;  3GD4 A;  4REK A;  3SGL A;  4K8D A;  4U2T A;  4YTM A;  3DK4 A;  2X3N A;  2BYB A;  2A87 A;  2YG4 A;  1KDG A;  3NRN A;  4H4W A;  4NTE A;  1ZMD A;  2RAB A;  2CDU A;  3LB8 A;  2BC1 A;  2XLR A;  1W4X A;  2CFY A;  1IJH A;  3FG2 P;  2R4J A;  1BWC A;  2WPC A;  4YTP A;  1IUS A;  1GTE A;  1M6I A;  1PBC A;  3E1T A;  3QFB A;  1L0V A;  4C3X A;  1H83 A;  5EB4 A;  1F8W A;  1JNR A;  1N4W A;  3AE8 A;  5KXJ A;  4CRT A;  4H2Q A;  2R46 A;  1FOH A;  1E6E A;  1NPX A;  2C65 A;  2YLX A;  4GCM A;  1RSG A;  1N4U A;  4C77 A;  1KSU A;  1GES A;  1YY5 A;  1P2H A;  1D7Y A;  1QLB A;  1PBB A;  4DSG A;  1DJN A;  1GSN A;  3P4R A;  3P1W A;  1GRG A;  3GYI A;  4AT2 A;  3OC4 A;  1SEZ A;  4CNK A;  1BGJ A;  2XCG A;  2XFN A;  3V3N A;  4ECH A;  5TR3 A;  1NAA A;  1YQ4 A;  4XWZ A;  2C75 A;  2XLT A;  4BJY A;  1TDO A;  2AR8 A;  1DNC A;  2CUL A;  3T37 A;  5HYM A;  3VRB A;  3NHO X;  4GDP A;  1KF6 A;  4NZH A;  5EBK A;  3ALJ A;  5CKU A;  4B69 A;  3RNM A;  3LZW A;  1OJT A;  4LA1 A;  2Q0K A;  1B8S A;  1ZX9 A;  1PBD A;  4Z43 A;  1RP0 A;  3BHF A;  5M0Z A;  3RED A;  4B68 A;  2BS2 A;  1NEN A;  4X9M A;  4GRT A;  3VR8 A;  4AT0 A;  4B63 A;  4M52 A;  2GR1 A;  4PAA A;  1KNP A;  2WET A;  5JCK A;  2EQ9 A;  2EQ7 A;  3EAO A;  2WOV A;  1V59 A;  3D1C A;  3DME A;  1P2E A;  2GR2 A;  3F8R A;  1GPE A;  3CGD A;  4CNJ A;  4Z2R A;  4A6N A;  2V6O A;  1NG3 A;  3G5Q A;  4MJW A;  4J2W A;  4GDE A;  4JDR A;  4Y4N A;  1VG9 A;  3CNT A;  4X4J A;  4ADW A;  4CY6 A;  1PXB A;  1ZKQ A;  3CGC A;  3CPJ G;  2R0G A;  1E1N A;  2WDR A;  3HZL A;  3K7M X;  3K7T A;  4H4Z A;  2TPR A;  1DJQ A;  2ACZ A;  2ARD A;  2YLS A;  3IHG A;  3UTE A;  2PYX A;  3DK8 A;  3UOX A;  1Q1R A;  2X8H A;  4N9X A;  1AOG A;  2ZZB A;  3DGZ A;  3GWF A;  2JAE A;  1PS9 A;  1VRQ B;  4YT0 A;  4H4S A;  3KU9 A;  4H4T A;  4B64 A;  2C76 A;  5HHF A;  2WDV A;  2WP6 A;  4IVM B;  3UTF A;  2X50 A;  4K5R A;  1TDF A;  4TLZ A;  1NHS A;  1H6V A;  3D8X A;  2RGO A;  2PHH A;  1IUW A;  2IID A;  2WHD A;  4H4U A;  5GRT A;  4C3Y A;  2WU5 A;  5FS9 A;  4Z26 A;  4LU6 A;  3V3O A;  3AYJ A;  3PS9 A;  2J3N A;  3DJE A;  3KKJ A;  3L1R A;  3CNJ A;  1OJD A;  3P9U A;  3SFE A;  3UKH A;  5U63 A;  3BI4 A;  1NHQ A;  3AB1 A;  4J34 A;  2GAG B;  4UP3 A;  4CCQ A;  3CIR A;  3S61 A;  3BHK A;  2BCP A;  2GH5 A;  3C4A A;  2GMJ A;  4GR1 A;  3NYC A;  1D4C A;  1FCD A;  3Q9T A;  2V3B A;  4OPD A;  1EL9 A;  4H4Y A;  3UTG A;  3LJP A;  2OLO A;  2R45 A;  2VVL A;  4YXD A;  2BK5 A;  1GET A;  3G5R A;  3FPZ A;  1O95 A;  2E4G A;  4HA6 A;  1VDC A;  1H86 A;  2C72 A;  4H50 A;  4AOS A;  4A99 A;  1F3P A;  5U1O A;  4JNA A;  1L9D A;  3Q6J A;  4O5U A;  5KWF A;  1H7X A;  2B9Y A;  4Z44 A;  3VR9 A;  4U2S A;  3RP7 A;  2VVL G;  3QSM A;  4BK1 A;  5ER0 A;  2C7G A;  4K5S A;  4GUV A;  2WPE A;  1CBO A;  4J36 A;  5C3J A;  3ADA B;  2BAC A;  3LZX A;  2YM2 A;  1NEK A;  2WDQ A;  1KNR A;  3NTD A;  2YWL A;  1MOK A;  3GD3 A;  3KPF A;  1D5T A;  3IHM A;  1LTX R;  3VRA A;  1PBF A;  4YTN A;  3AWI A;  3KVE A;  1EBD A;  3L8K A;  2FJD A;  2AAQ A;  4H7U A;  3NK2 X;  5BUK A;  2HQM A;  2YR6 A;  2YR5 A;  4YSY A;  2GMH A;  1ZY8 A;  3CGE A;  3LAD A;  5KRQ A;  2V60 A;  2B7S A;  2CVJ A;  4JY2 A;  3ATQ A;  3UP5 A;  4DGK A;  2GQW A;  1VG0 A;  1JRX A;  4JNQ A;  4BJZ A;  3CNP A;  3PVC A;  2YG7 A;  2XVF A;  2E1M A;  4ZCD A;  1OJA A;  3SM8 A;  2B9X A;  1BF3 A;  4X9N A;  1Y56 B;  3NLC A;  2NPX A;  1CJ3 A;  2TMD A;  3CND A;  1JNZ A;  3AD7 B;  3KA7 A;  4ZCC A;  2BAB A;  3AEC A;  1GRB A;  5JCL A;  1GND A;  1ZP0 A;  2QA2 A;  1D7L A;  4OPC A;  1PN0 A;  2GB0 A;  1GRA A;  1BKW A;  3BI2 A;  5FS7 A;  1MO9 A;  1EL5 A;  3ABV A;  1X31 B;  4DSH A;  2YG6 A;  2O9Z A;  2FJE A;  1YQZ A;  2Q0L A;  3NH3 X;  2XLS A;  4OPT A;  3AYI A;  3EF6 A;  1S2Y A;  3AEE A;  4H4R A;  2ZBW A;  4PAB A;  2B76 A;  1JRZ A;  3ALL A;  4TM1 A;  4CCR A;  2JB2 A;  2YG3 A;  2A89 A;  1NHP A;  1FL2 A;  3AEB A;  3EPT A;  1DOE A;  1LVL A;  2R0C A;  4U8J A;  3VRD B;  4Z2U A;  3AE6 A;  2YR4 A;  3H8I A;  2A8X A;  1E1K A;  3GMB A;  3IF9 A;  5KOW A;  1VQW A;  2BCG G;  3G5S A;  3UOZ A;  2Y6R A;  2R9Z A;  1GT8 A;  3EAN A;  1ELI A;  4K22 A;  1JOA A;  3LOV A;  2AQJ A;  2GV8 A;  4A6N B;  2Z5Y A;  1NG4 A;  4EM3 A;  3URH A;  4UDR A;  3BI5 A;  2R0P A;  4D03 A;  3K30 A;  3UKQ A;  2C3D A;  1XDI A;  2WEU A;  1MXT A;  1D4E A;  2WBA A;  4XWR A;  4XXG A;  4J33 A;  2XVI A;  3K7Q X;  1REO A;  4C74 A;  4KPR A;  1XAN A;  2VVM A;  4H2P A;  4YSZ A;  5L46 A;  4BK3 A;  2ZZC A;  1Q9I A;  2YLZ A;  4YKG A;  4EIP A;  4FK1 A;  1E39 A;  2FJA A;  2BS3 A;  3AEF A;  3JSK A;  1PDH A;  3AD9 B;  1YQ3 A;  1D4D A;  2E5V A;  1CC6 A;  2ZZ0 A;  1JEH A;  1ZOV A;  3R9U A;  1E1M A;  2QCU A;  3UKP A;  4H4P A;  5EB5 A;  3ICR A;  2B7R A;  1YKJ A;  5FMH A;  4GF7 A;  2WP9 A;  1DXL A;  2JKC A;  2V5Z A;  3GWD A;  4EM4 A;  3IC9 A;  2VOU A;  2JB1 A;  1ZMC A;  3F8P A;  1COY A;  1CC4 A;  1F8R A;  3COX A;  3NN6 X;  1Z6L A;  3UOV A;  2WOI A;  3QFA A;  1K0J A;  3UOY A;  3OZ2 A;  3UKF A;  3BNM A;  3NYF A;  3O0H A;  3RP8 A;  2APG A;  2VQ7 A;  3GYJ A;  4IA6 A;  4USR A;  4C5O A;  2WS3 A;  2XVJ A;  5EOW A;  1PXC A;  2XVH A;  3IWA A;  2WP5 A;  3NYE A;  1Y0P A;  1GV4 A;  4AP1 A;  3SQP A;  3FMW A;  3NGC X;  2BXS A;  2JBV A;  4D04 A;  1NHR A;  4DNA A;  4A65 A;  2Q6U A;  3B3R A;  2XDO A;  1Y56 A;  3NK1 X;  2FBW A;  2IVD A;  2C67 A;  2X99 A;  4USQ A;  3DJD A;  1DOC A;  4EQS A;  2F5Z A;  4K2X A;  4RSL A;  2I0Z A;  2YG5 A;  1LJ1 A;  4WX1 A;  2XFU A;  4CY8 A;  2R4E A;  4BUR A;  1DOD A;  1BZL A;  2FJB A;  1S2Q A;  1F6M A;  4FK1 C;  2EQ8 A;  3I6D A;  4J57 A;  4BV6 A;  4J31 A;  2DKH A;  2XFP A;  3II4 A;  1PJ5 A;  3AE7 A;  4EIQ A;  1GRF A;  1EL8 A;  4TM3 A;  1JRY A;  2GF3 A;  3DJJ A;  2IVE A;  4U8P A;  1CHU A;  5HY5 A;  1E1L A;  1L9E A;  1FEC A;  1GRH A;  4O5Q A;  1GER A;  4OPL A;  3ICT A;  3QJ4 A;  3ITJ A;  5DBJ A;  3AE3 A;  4IA5 A;  1B4V A;  1H84 A;  4NEW A;  4EQR A;  3ATR A;  1TDK A;  4YWO A;  2OAM A;  1GOS A;  3CNS A;  1E7P A;  5FS6 A;  3NK0 X;  3S5W A;  4Z2T A;  2YLT A;  3GDP A;  1NDA A;  4JQ9 A;  4CBQ A;  5IQ4 A;  1CJ4 A;  3C96 A;  4HB9 A;  1DOB A;  2GRT A;  3M0O A;  4B65 A;  2XLU A;  5JCM A;  3UKL A;  2YAU A;  2BK4 A;  3FBS A;  3AXB A;  3ALM A;  3NKS A;  3B6D A;  3NT6 A;  5BRT A;  1O5W A;  2EQ6 A;  1GRT A;  3AE4 A;  1KSS A;  4I59 A;  4A79 A;  3NIX A;  3WE0 A;  2RGJ A;  3ZDN A;  5KVH A;  4IV9 A;  2QAE A;  1L9C A;  1UKV G;  1PJ7 A;  2WPF A;  4Z24 A;  4IVO B;  1LV0 A;  5C2T A;  4I58 A;  5BUL A;  3DJG X;  3GMC A;  1XHC A;  2YVF A;  5JCI A;  3VQR A;  1H81 A;  4J56 A;  4RG4 A;  2XLP A;  4AP3 A;  3I3L A;  4NTC A;  2YLW A;  2GVC A;  2C64 A;  1BGN A;  4H4Q A;  1ZOY A;  2YVJ A;  2BXR A;  1CC2 A;  1TDE A;  4YSH A;  1PJ6 A;  1QJD A;  1GXF A;  1N4V A;  2Y6Q A;  2NVK X;  4RG3 A;  1S3B A;  1LQT A;  2OA1 A;  3PO7 A;  5IPY A;  2XFO A;  3AE5 A;  4OVI A;  2GAH B;  3CN8 A;  2XFQ A;  1B5Q A;  4KX6 A;  4B1B A;  2VRL A;  3NTA A;  1CF3 A;  3M12 A;  4A7A A;  3CPI G;  2YVG A;  3NG7 X;  4EQX A;  4AOX A;  3V76 A;  3AE9 A;  4YKF A;  4EQW A;  1XPQ A;  2VRM A;  1GRE A;  3UKA A;  3NNE A;  2H89 A;  3H8L A;  2C3C A;  2Q7V A;  2UZZ A;  3QSS A;  4B67 A;  2QA1 A;  1CJC A;  5HXI A;  1KFY A;  4FDC B;  4U8M A;  4K7Z A;  2W0H A;  2YLR A;  1K4Q A;  1GAL A;  1HYU A;  1M64 A;  4EMW A;  4UDQ A;  4Y4M A;  4WCT A;  2VZ2 A;  5J60 A;  1O94 A;  4Y4L A;  2GEW A;  4U8K A;  4BK2 A;  4U8I A;  3SFD A;  1PBE A;  3FIM B;  4OPU A;  1ZDL A;  3GRS A;  1F8S A;  3QVR A;  3DH9 A;  1TRB A;  3UTH A;  3DGH A;  3ISH A;  4ICY A;  4EMJ A;  5IQ1 A;  1IUU A;  1LPF A;  1TYT A;  1ONF A;  1K0L A;  1OJ9 A;  1RYI A;  2XVE A;  3AED A;  5CQF A;  2C66 A;  2OLN A;  2VQB A;  3CGB A;  4TLX A;  4H2N A;  4P9S A;  4B66 A;  2WQY A;  2C73 A;  2DKI A;  4Z25 A;  5U25 A;  3ZYX A;  5JCN A;  1GTH A;  3QVP A;  5FS8 A;  1CL0 A;  2BC0 A;  2GR0 A;  1FEB A;  1ZK7 A;  1K0I A;  2V61 A;  4TM0 A;  5KOX A;  3KLJ A;  1B37 A;  1CJ2 A;  3DA1 A;  3UCL A;  2RGH A;  3UP4 A;  4OCG A;  4NEV A;  5J7X A;  2X8G A;  4H4V A;  1IUV A;  3AYL A;  2C70 A;  3QSE A;  3RHA A;  3GDN A;  3AD8 B;  1QO8 A;  4ZN0 A;  2JB3 A;  4U8N A;  2OAL A;  4H4X A;  2YM1 A;  3C4N A;  3CPH G;  2BA9 A;  3P4P A;  1TYP A;  3GSI A;  1IUT A;  4TM4 A;  2X8C A;  5KVI A;  3P4S A;  3P4Q A;  2YQU A;  1H82 A;  3LXD A;  4FX9 A;  2JK6 A;  4U8L A;  1IUX A;  3RP6 A;  4A5L A;  1JU2 A;  3M13 A;  4UDP A;  4E0V A;  5BVA A;  1FEA A;  3H4K A;  4JY3 A;  3UKK A;  4H2R A;  2V3A A;  2Z5X A;  3AE2 A;  2WOW A;  4APN A;  1H7W A;  1GEU A;  2BS4 A;  2H88 A;  2WES A;  3AEG A;  3DK9 A;  4LII A;  4OPG A;  4U8O A;  1TDN A;  1OJC A;  3AEA A;  1PXA A;  5LV9 A;  3NN0 X;  5M10 A;  1LQU A;  2XYO A; 
#chains in the Genus database with same CATH topology
 1Q1W A;  2BK3 A;  4NTD A;  4EMI A;  1EL7 A;  3KD9 A;  4A9W A;  4U2L A;  4YSX A;  3BNU A;  2WU2 A;  5GSN A;  3AE1 A;  4OPI A;  2B9W A;  1N1P A;  3F8D A;  3GRT A;  2GR3 A;  3ICS A;  3CTY A;  1PHH A;  4JN9 A;  2GQF A;  1S3E A;  3GD4 A;  4REK A;  3SGL A;  4K8D A;  4U2T A;  4YTM A;  3DK4 A;  2X3N A;  2BYB A;  2A87 A;  2YG4 A;  1KDG A;  3NRN A;  4H4W A;  4NTE A;  1ZMD A;  2RAB A;  2CDU A;  3LB8 A;  3SX6 A;  3HYX A;  2BC1 A;  2XLR A;  1W4X A;  2CFY A;  1IJH A;  3FG2 P;  2R4J A;  1BWC A;  2WPC A;  4YTP A;  1IUS A;  1GTE A;  1M6I A;  1PBC A;  3E1T A;  3QFB A;  1L0V A;  4C3X A;  1H83 A;  4II2 A;  5EB4 A;  1F8W A;  1JNR A;  1N4W A;  3AE8 A;  5KXJ A;  4CRT A;  4G6H A;  4H2Q A;  2R46 A;  5KMQ A;  1FOH A;  1E6E A;  1NPX A;  2C65 A;  2YLX A;  4GCM A;  1RSG A;  1N4U A;  4C77 A;  1KSU A;  1GES A;  1YY5 A;  1P2H A;  1D7Y A;  1QLB A;  1PBB A;  4DSG A;  1DJN A;  1GSN A;  3P4R A;  3P1W A;  1GRG A;  3GYI A;  4AT2 A;  3OC4 A;  1SEZ A;  4CNK A;  1BGJ A;  2XCG A;  2XFN A;  3V3N A;  4ECH A;  5TR3 A;  1NAA A;  1YQ4 A;  4XWZ A;  2C75 A;  2XLT A;  4BJY A;  1TDO A;  2AR8 A;  1DNC A;  2CUL A;  3T37 A;  5HYM A;  3VRB A;  3NHO X;  4GDP A;  1KF6 A;  4NZH A;  5EBK A;  3ALJ A;  5CKU A;  4B69 A;  3RNM A;  3LZW A;  1OJT A;  4LA1 A;  2Q0K A;  1B8S A;  1ZX9 A;  1PBD A;  4Z43 A;  1RP0 A;  3BHF A;  5M0Z A;  3RED A;  4B68 A;  2BS2 A;  1NEN A;  4X9M A;  4GRT A;  3VR8 A;  4AT0 A;  4B63 A;  4M52 A;  2GR1 A;  4PAA A;  1KNP A;  2WET A;  5JCK A;  2EQ9 A;  2EQ7 A;  3EAO A;  2WOV A;  1V59 A;  3D1C A;  3DME A;  1P2E A;  2GR2 A;  3F8R A;  1GPE A;  3CGD A;  4II3 A;  4CNJ A;  4Z2R A;  4A6N A;  2V6O A;  1NG3 A;  3G5Q A;  4MJW A;  4J2W A;  4GDE A;  4JDR A;  4Y4N A;  1VG9 A;  3CNT A;  4X4J A;  4ADW A;  4CY6 A;  1PXB A;  1ZKQ A;  3CGC A;  3CPJ G;  2R0G A;  1E1N A;  2WDR A;  3HZL A;  2C4C A;  3K7M X;  3K7T A;  4H4Z A;  2TPR A;  1DJQ A;  2ACZ A;  2ARD A;  2YLS A;  3IHG A;  3UTE A;  2PYX A;  3DK8 A;  3UOX A;  1Q1R A;  2X8H A;  4N9X A;  1AOG A;  2ZZB A;  3DGZ A;  3GWF A;  2JAE A;  1PS9 A;  1VRQ B;  4YT0 A;  4H4S A;  3KU9 A;  4H4T A;  4B64 A;  2C76 A;  5HHF A;  2WDV A;  2WP6 A;  4IVM B;  3UTF A;  2X50 A;  4K5R A;  1TDF A;  4TLZ A;  1NHS A;  1H6V A;  3D8X A;  2RGO A;  2PHH A;  1IUW A;  2IID A;  2WHD A;  3GYX A;  4H4U A;  5GRT A;  2WU5 A;  5FS9 A;  4Z26 A;  4LU6 A;  3V3O A;  3AYJ A;  3PS9 A;  2J3N A;  3DJE A;  3KKJ A;  3L1R A;  3CNJ A;  1OJD A;  3P9U A;  3SFE A;  3UKH A;  5U63 A;  3BI4 A;  1NHQ A;  3AB1 A;  4J34 A;  2GAG B;  4UP3 A;  4CCQ A;  3CIR A;  3S61 A;  3BHK A;  2BCP A;  2GH5 A;  3C4A A;  2GMJ A;  4GR1 A;  3NYC A;  1D4C A;  1FCD A;  3Q9T A;  2V3B A;  4OPD A;  1EL9 A;  4H4Y A;  3UTG A;  3LJP A;  2OLO A;  2R45 A;  2VVL A;  3T2Z A;  2BK5 A;  4YXD A;  1GET A;  3G5R A;  3SZ0 A;  3FPZ A;  1O95 A;  2E4G A;  4HA6 A;  1VDC A;  1H86 A;  2C72 A;  4H50 A;  4AOS A;  4A99 A;  1F3P A;  5U1O A;  4JNA A;  1L9D A;  3Q6J A;  4O5U A;  5KWF A;  1H7X A;  2B9Y A;  4Z44 A;  3VR9 A;  4U2S A;  3RP7 A;  2VVL G;  3QSM A;  4BK1 A;  3SY4 A;  5ER0 A;  2C7G A;  4K5S A;  4GUV A;  2WPE A;  1CBO A;  4J36 A;  5C3J A;  3ADA B;  2BAC A;  3LZX A;  2YM2 A;  1NEK A;  2WDQ A;  1KNR A;  3NTD A;  4NWZ A;  2YWL A;  1MOK A;  3GD3 A;  3KPF A;  1D5T A;  3IHM A;  1LTX R;  3VRA A;  1PBF A;  4YTN A;  3AWI A;  3KVE A;  1EBD A;  3L8K A;  2FJD A;  2AAQ A;  4H7U A;  3NK2 X;  5BUK A;  2HQM A;  2YR6 A;  2YR5 A;  4YSY A;  2GMH A;  1ZY8 A;  3CGE A;  3LAD A;  5KRQ A;  2V60 A;  2B7S A;  2CVJ A;  4JY2 A;  3ATQ A;  3UP5 A;  4DGK A;  2GQW A;  1VG0 A;  1JRX A;  4JNQ A;  4BJZ A;  3CNP A;  3PVC A;  2YG7 A;  2XVF A;  2E1M A;  4ZCD A;  1OJA A;  3SM8 A;  2B9X A;  1BF3 A;  4X9N A;  1Y56 B;  3NLC A;  2NPX A;  1CJ3 A;  2TMD A;  3CND A;  1JNZ A;  3AD7 B;  3KA7 A;  4ZCC A;  2BAB A;  3AEC A;  1GRB A;  5JCL A;  1GND A;  1ZP0 A;  2QA2 A;  1D7L A;  4OPC A;  1PN0 A;  2GB0 A;  1GRA A;  1BKW A;  3BI2 A;  5FS7 A;  3T0K A;  1MO9 A;  1EL5 A;  2BRY A;  1X31 B;  3ABV A;  2YG6 A;  2O9Z A;  2FJE A;  1YQZ A;  2Q0L A;  3HYW A;  3NH3 X;  4DSH A;  2XLS A;  4OPT A;  3AYI A;  3EF6 A;  1S2Y A;  3AEE A;  4H4R A;  2ZBW A;  4PAB A;  2B76 A;  1JRZ A;  3ALL A;  4TM1 A;  4CCR A;  2JB2 A;  3T31 A;  2YG3 A;  2A89 A;  1NHP A;  1FL2 A;  3AEB A;  3EPT A;  1DOE A;  1LVL A;  2R0C A;  4U8J A;  3VRD B;  4Z2U A;  3AE6 A;  2YR4 A;  3H8I A;  2A8X A;  1E1K A;  3GMB A;  3IF9 A;  5KOW A;  1VQW A;  2BCG G;  3G5S A;  3UOZ A;  2Y6R A;  2R9Z A;  1GT8 A;  3EAN A;  1ELI A;  3CMM A;  4K22 A;  1JOA A;  3LOV A;  2AQJ A;  2GV8 A;  4A6N B;  2Z5Y A;  1NG4 A;  4EM3 A;  3URH A;  4UDR A;  3BI5 A;  2R0P A;  4D03 A;  3K30 A;  3UKQ A;  2C3D A;  1XDI A;  2WEU A;  4G9K A;  1MXT A;  1D4E A;  2WBA A;  4XWR A;  4XXG A;  4J33 A;  2XVI A;  3K7Q X;  1REO A;  4C74 A;  4KPR A;  1XAN A;  2VVM A;  4H2P A;  4YSZ A;  5L46 A;  4BK3 A;  2ZZC A;  1Q9I A;  2YLZ A;  4YKG A;  4EIP A;  4FK1 A;  1E39 A;  2FJA A;  3SZC A;  2BS3 A;  3AEF A;  3JSK A;  1PDH A;  3AD9 B;  1YQ3 A;  1D4D A;  2BRA A;  2E5V A;  1CC6 A;  2ZZ0 A;  4NNJ A;  1JEH A;  1ZOV A;  3R9U A;  1E1M A;  2QCU A;  3UKP A;  4H4P A;  5EB5 A;  3ICR A;  2B7R A;  1YKJ A;  5FMH A;  4GF7 A;  2WP9 A;  1DXL A;  2JKC A;  2V5Z A;  3GWD A;  4EM4 A;  3IC9 A;  2VOU A;  5KMR A;  2JB1 A;  1ZMC A;  3F8P A;  1COY A;  1CC4 A;  1F8R A;  3COX A;  3NN6 X;  1Z6L A;  3UOV A;  2WOI A;  3QFA A;  1K0J A;  3UOY A;  3OZ2 A;  3UKF A;  3BNM A;  3NYF A;  3O0H A;  3RP8 A;  2APG A;  2VQ7 A;  3GYJ A;  4IA6 A;  4USR A;  4C5O A;  2WS3 A;  2XVJ A;  5EOW A;  1PXC A;  2XVH A;  3IWA A;  2WP5 A;  3NYE A;  1Y0P A;  1GV4 A;  4AP1 A;  3SQP A;  3FMW A;  3NGC X;  2BXS A;  2JBV A;  4D04 A;  1NHR A;  4DNA A;  4A65 A;  2Q6U A;  3B3R A;  2XDO A;  1Y56 A;  3NK1 X;  2FBW A;  2IVD A;  2C67 A;  2X99 A;  4USQ A;  3DJD A;  1DOC A;  4EQS A;  2F5Z A;  4K2X A;  4RSL A;  2I0Z A;  2YG5 A;  1LJ1 A;  4WX1 A;  2XFU A;  4CY8 A;  2R4E A;  5KMP A;  4BUR A;  1DOD A;  1BZL A;  2FJB A;  1S2Q A;  1F6M A;  4FK1 C;  2EQ8 A;  3I6D A;  4J57 A;  4BV6 A;  4J31 A;  2DKH A;  2XFP A;  3II4 A;  1PJ5 A;  3AE7 A;  4EIQ A;  1GRF A;  1EL8 A;  4TM3 A;  1JRY A;  2GF3 A;  3DJJ A;  2IVE A;  4U8P A;  1CHU A;  5HY5 A;  1E1L A;  1L9E A;  1FEC A;  1GRH A;  4O5Q A;  1GER A;  4OPL A;  3ICT A;  3QJ4 A;  3ITJ A;  5DBJ A;  3AE3 A;  4IA5 A;  1B4V A;  1H84 A;  4NEW A;  4EQR A;  3ATR A;  1TDK A;  4YWO A;  2OAM A;  1GOS A;  3CNS A;  1E7P A;  4GAV A;  5FS6 A;  3NK0 X;  3S5W A;  4Z2T A;  2YLT A;  3HYV A;  3GDP A;  1NDA A;  4JQ9 A;  4CBQ A;  5IQ4 A;  1CJ4 A;  3C96 A;  4HB9 A;  1DOB A;  2GRT A;  3M0O A;  4B65 A;  2XLU A;  5JCM A;  3UKL A;  2YAU A;  2BK4 A;  3FBS A;  3AXB A;  3ALM A;  3NKS A;  3B6D A;  3NT6 A;  5BRT A;  1O5W A;  2EQ6 A;  1GRT A;  3AE4 A;  1KSS A;  4I59 A;  4A79 A;  3NIX A;  3WE0 A;  2RGJ A;  4G73 A;  3ZDN A;  5KVH A;  4IV9 A;  3KPK A;  5KMS A;  2QAE A;  1L9C A;  1UKV G;  1PJ7 A;  2WPF A;  3SZW A;  4Z24 A;  4IVO B;  1LV0 A;  5C2T A;  4I58 A;  5BUL A;  3DJG X;  3GMC A;  1XHC A;  2YVF A;  5JCI A;  3VQR A;  1H81 A;  4J56 A;  4RG4 A;  2XLP A;  4AP3 A;  3I3L A;  4NTC A;  2YLW A;  2GVC A;  2C64 A;  1BGN A;  4H4Q A;  1ZOY A;  2YVJ A;  2BXR A;  1CC2 A;  1TDE A;  4YSH A;  1PJ6 A;  1QJD A;  1GXF A;  1N4V A;  2Y6Q A;  2NVK X;  4RG3 A;  1S3B A;  1LQT A;  2OA1 A;  3PO7 A;  5IPY A;  2XFO A;  3AE5 A;  4OVI A;  2GAH B;  3CN8 A;  2XFQ A;  1B5Q A;  4KX6 A;  4B1B A;  2VRL A;  3NTA A;  1CF3 A;  3M12 A;  4A7A A;  3CPI G;  2YVG A;  3NG7 X;  4EQX A;  4AOX A;  3V76 A;  3AE9 A;  4GAP A;  4YKF A;  4EQW A;  1XPQ A;  2VRM A;  1GRE A;  3UKA A;  3NNE A;  2H89 A;  3H8L A;  2C3C A;  2Q7V A;  2UZZ A;  3QSS A;  4B67 A;  2QA1 A;  1CJC A;  3SXI A;  1KFY A;  5HXI A;  4FDC B;  4U8M A;  4K7Z A;  2W0H A;  2YLR A;  1K4Q A;  1GAL A;  1HYU A;  1M64 A;  4EMW A;  4UDQ A;  4Y4M A;  4WCT A;  2VZ2 A;  4C3Y A;  5J60 A;  1O94 A;  4Y4L A;  2GEW A;  4U8K A;  4BK2 A;  4U8I A;  3SFD A;  1PBE A;  3FIM B;  4OPU A;  1ZDL A;  3GRS A;  1F8S A;  3QVR A;  3DH9 A;  1TRB A;  3UTH A;  3DGH A;  3ISH A;  4ICY A;  3SZF A;  5IQ1 A;  1IUU A;  4EMJ A;  1LPF A;  1TYT A;  1ONF A;  1K0L A;  1OJ9 A;  1RYI A;  2XVE A;  3AED A;  5CQF A;  2C66 A;  2OLN A;  2VQB A;  3CGB A;  4TLX A;  4H2N A;  4P9S A;  4B66 A;  2WQY A;  2C73 A;  2DKI A;  4Z25 A;  5U25 A;  3ZYX A;  5JCN A;  1GTH A;  3QVP A;  5FS8 A;  1CL0 A;  2BC0 A;  2GR0 A;  1FEB A;  4G6G A;  1ZK7 A;  1K0I A;  2V61 A;  3T14 A;  4TM0 A;  5KOX A;  3KLJ A;  5KNL A;  1B37 A;  1CJ2 A;  3DA1 A;  3UCL A;  2RGH A;  3SYI A;  3UP4 A;  4OCG A;  4NEV A;  5J7X A;  2X8G A;  4H4V A;  1IUV A;  3AYL A;  2C70 A;  3QSE A;  3RHA A;  3GDN A;  3AD8 B;  1QO8 A;  4ZN0 A;  2JB3 A;  4U8N A;  2OAL A;  4H4X A;  2YM1 A;  3C4N A;  3CPH G;  2BA9 A;  3P4P A;  1TYP A;  3GSI A;  1IUT A;  4TM4 A;  2X8C A;  5KVI A;  3P4S A;  3T2K A;  3P4Q A;  2YQU A;  1H82 A;  3LXD A;  4FX9 A;  2JK6 A;  4U8L A;  1IUX A;  3RP6 A;  4A5L A;  1JU2 A;  3M13 A;  4UDP A;  4E0V A;  5BVA A;  1FEA A;  3H4K A;  4JY3 A;  3UKK A;  4H2R A;  3T2Y A;  2V3A A;  2Z5X A;  3AE2 A;  2WOW A;  4APN A;  1H7W A;  1GEU A;  2BS4 A;  2H88 A;  2WES A;  3AEG A;  3DK9 A;  4LII A;  4OPG A;  4U8O A;  1TDN A;  1OJC A;  3AEA A;  1PXA A;  4G74 A;  3NN0 X;  5LV9 A;  5M10 A;  1LQU A;  2XYO A; 
#chains in the Genus database with same CATH homology
 1Q1W A;  2BK3 A;  4NTD A;  4EMI A;  1EL7 A;  3KD9 A;  4A9W A;  4U2L A;  4YSX A;  3BNU A;  2WU2 A;  5GSN A;  3AE1 A;  4OPI A;  2B9W A;  1N1P A;  3F8D A;  3GRT A;  2GR3 A;  3ICS A;  3CTY A;  1PHH A;  4JN9 A;  2GQF A;  1S3E A;  3GD4 A;  4REK A;  3SGL A;  4K8D A;  4U2T A;  4YTM A;  3DK4 A;  2X3N A;  2BYB A;  2A87 A;  2YG4 A;  1KDG A;  3NRN A;  4H4W A;  4NTE A;  1ZMD A;  2RAB A;  2CDU A;  3LB8 A;  3SX6 A;  3HYX A;  2BC1 A;  2XLR A;  1W4X A;  2CFY A;  1IJH A;  3FG2 P;  2R4J A;  1BWC A;  2WPC A;  4YTP A;  1IUS A;  1GTE A;  1M6I A;  1PBC A;  3E1T A;  3QFB A;  1L0V A;  4C3X A;  1H83 A;  4II2 A;  5EB4 A;  1F8W A;  1JNR A;  1N4W A;  3AE8 A;  5KXJ A;  4CRT A;  4G6H A;  4H2Q A;  2R46 A;  5KMQ A;  1FOH A;  1E6E A;  1NPX A;  2C65 A;  2YLX A;  4GCM A;  1RSG A;  1N4U A;  4C77 A;  1KSU A;  1GES A;  1YY5 A;  1P2H A;  1D7Y A;  1QLB A;  1PBB A;  4DSG A;  1DJN A;  1GSN A;  3P4R A;  3P1W A;  1GRG A;  3GYI A;  4AT2 A;  3OC4 A;  1SEZ A;  4CNK A;  1BGJ A;  2XCG A;  2XFN A;  3V3N A;  4ECH A;  5TR3 A;  1NAA A;  1YQ4 A;  4XWZ A;  2C75 A;  2XLT A;  4BJY A;  1TDO A;  2AR8 A;  1DNC A;  2CUL A;  3T37 A;  5HYM A;  3VRB A;  3NHO X;  4GDP A;  1KF6 A;  4NZH A;  5EBK A;  3ALJ A;  5CKU A;  4B69 A;  3RNM A;  3LZW A;  1OJT A;  4LA1 A;  2Q0K A;  1B8S A;  1ZX9 A;  1PBD A;  4Z43 A;  1RP0 A;  3BHF A;  5M0Z A;  3RED A;  4B68 A;  2BS2 A;  1NEN A;  4X9M A;  4GRT A;  3VR8 A;  4AT0 A;  4B63 A;  4M52 A;  2GR1 A;  4PAA A;  1KNP A;  2WET A;  5JCK A;  2EQ9 A;  2EQ7 A;  3EAO A;  2WOV A;  1V59 A;  3D1C A;  3DME A;  1P2E A;  2GR2 A;  3F8R A;  1GPE A;  3CGD A;  4II3 A;  4CNJ A;  4Z2R A;  4A6N A;  2V6O A;  1NG3 A;  3G5Q A;  4MJW A;  4J2W A;  4GDE A;  4JDR A;  4Y4N A;  1VG9 A;  3CNT A;  4X4J A;  4ADW A;  4CY6 A;  1PXB A;  1ZKQ A;  3CGC A;  3CPJ G;  2R0G A;  1E1N A;  2WDR A;  3HZL A;  2C4C A;  3K7M X;  3K7T A;  4H4Z A;  2TPR A;  1DJQ A;  2ACZ A;  2ARD A;  2YLS A;  3IHG A;  3UTE A;  2PYX A;  3DK8 A;  3UOX A;  1Q1R A;  2X8H A;  4N9X A;  1AOG A;  2ZZB A;  3DGZ A;  3GWF A;  2JAE A;  1PS9 A;  1VRQ B;  4YT0 A;  4H4S A;  3KU9 A;  4H4T A;  4B64 A;  2C76 A;  5HHF A;  2WDV A;  2WP6 A;  4IVM B;  3UTF A;  2X50 A;  4K5R A;  1TDF A;  4TLZ A;  1NHS A;  1H6V A;  3D8X A;  2RGO A;  2PHH A;  1IUW A;  2IID A;  2WHD A;  3GYX A;  4H4U A;  5GRT A;  2WU5 A;  5FS9 A;  4Z26 A;  4LU6 A;  3V3O A;  3AYJ A;  3PS9 A;  2J3N A;  3DJE A;  3KKJ A;  3L1R A;  3CNJ A;  1OJD A;  3P9U A;  3SFE A;  3UKH A;  5U63 A;  3BI4 A;  1NHQ A;  3AB1 A;  4J34 A;  2GAG B;  4UP3 A;  4CCQ A;  3CIR A;  3S61 A;  3BHK A;  2BCP A;  2GH5 A;  3C4A A;  2GMJ A;  4GR1 A;  3NYC A;  1D4C A;  1FCD A;  3Q9T A;  2V3B A;  4OPD A;  1EL9 A;  4H4Y A;  3UTG A;  3LJP A;  2OLO A;  2R45 A;  2VVL A;  3T2Z A;  2BK5 A;  4YXD A;  1GET A;  3G5R A;  3SZ0 A;  3FPZ A;  1O95 A;  2E4G A;  4HA6 A;  1VDC A;  1H86 A;  2C72 A;  4H50 A;  4AOS A;  4A99 A;  1F3P A;  5U1O A;  4JNA A;  1L9D A;  3Q6J A;  4O5U A;  5KWF A;  1H7X A;  2B9Y A;  4Z44 A;  3VR9 A;  4U2S A;  3RP7 A;  2VVL G;  3QSM A;  4BK1 A;  3SY4 A;  5ER0 A;  2C7G A;  4K5S A;  4GUV A;  2WPE A;  1CBO A;  4J36 A;  5C3J A;  3ADA B;  2BAC A;  3LZX A;  2YM2 A;  1NEK A;  2WDQ A;  1KNR A;  3NTD A;  4NWZ A;  2YWL A;  1MOK A;  3GD3 A;  3KPF A;  1D5T A;  3IHM A;  1LTX R;  3VRA A;  1PBF A;  4YTN A;  3AWI A;  3KVE A;  1EBD A;  3L8K A;  2FJD A;  2AAQ A;  4H7U A;  3NK2 X;  5BUK A;  2HQM A;  2YR6 A;  2YR5 A;  4YSY A;  2GMH A;  1ZY8 A;  3CGE A;  3LAD A;  5KRQ A;  2V60 A;  2B7S A;  2CVJ A;  4JY2 A;  3ATQ A;  3UP5 A;  4DGK A;  2GQW A;  1VG0 A;  1JRX A;  4JNQ A;  4BJZ A;  3CNP A;  3PVC A;  2YG7 A;  2XVF A;  2E1M A;  4ZCD A;  1OJA A;  3SM8 A;  2B9X A;  1BF3 A;  4X9N A;  1Y56 B;  3NLC A;  2NPX A;  1CJ3 A;  2TMD A;  3CND A;  1JNZ A;  3AD7 B;  3KA7 A;  4ZCC A;  2BAB A;  3AEC A;  1GRB A;  5JCL A;  1GND A;  1ZP0 A;  2QA2 A;  1D7L A;  4OPC A;  1PN0 A;  2GB0 A;  1GRA A;  1BKW A;  3BI2 A;  5FS7 A;  3T0K A;  1MO9 A;  1EL5 A;  2BRY A;  1X31 B;  3ABV A;  2YG6 A;  2O9Z A;  2FJE A;  1YQZ A;  2Q0L A;  3HYW A;  3NH3 X;  4DSH A;  2XLS A;  4OPT A;  3AYI A;  3EF6 A;  1S2Y A;  3AEE A;  4H4R A;  2ZBW A;  4PAB A;  2B76 A;  1JRZ A;  3ALL A;  4TM1 A;  4CCR A;  2JB2 A;  3T31 A;  2YG3 A;  2A89 A;  1NHP A;  1FL2 A;  3AEB A;  3EPT A;  1DOE A;  1LVL A;  2R0C A;  4U8J A;  3VRD B;  4Z2U A;  3AE6 A;  2YR4 A;  3H8I A;  2A8X A;  1E1K A;  3GMB A;  3IF9 A;  5KOW A;  1VQW A;  2BCG G;  3G5S A;  3UOZ A;  2Y6R A;  2R9Z A;  1GT8 A;  3EAN A;  1ELI A;  3CMM A;  4K22 A;  1JOA A;  3LOV A;  2AQJ A;  2GV8 A;  4A6N B;  2Z5Y A;  1NG4 A;  4EM3 A;  3URH A;  4UDR A;  3BI5 A;  2R0P A;  4D03 A;  3K30 A;  3UKQ A;  2C3D A;  1XDI A;  2WEU A;  4G9K A;  1MXT A;  1D4E A;  2WBA A;  4XWR A;  4XXG A;  4J33 A;  2XVI A;  3K7Q X;  1REO A;  4C74 A;  4KPR A;  1XAN A;  2VVM A;  4H2P A;  4YSZ A;  5L46 A;  4BK3 A;  2ZZC A;  1Q9I A;  2YLZ A;  4YKG A;  4EIP A;  4FK1 A;  1E39 A;  2FJA A;  3SZC A;  2BS3 A;  3AEF A;  3JSK A;  1PDH A;  3AD9 B;  1YQ3 A;  1D4D A;  2BRA A;  2E5V A;  1CC6 A;  2ZZ0 A;  4NNJ A;  1JEH A;  1ZOV A;  3R9U A;  1E1M A;  2QCU A;  3UKP A;  4H4P A;  5EB5 A;  3ICR A;  2B7R A;  1YKJ A;  5FMH A;  4GF7 A;  2WP9 A;  1DXL A;  2JKC A;  2V5Z A;  3GWD A;  4EM4 A;  3IC9 A;  2VOU A;  5KMR A;  2JB1 A;  1ZMC A;  3F8P A;  1COY A;  1CC4 A;  1F8R A;  3COX A;  3NN6 X;  1Z6L A;  3UOV A;  2WOI A;  3QFA A;  1K0J A;  3UOY A;  3OZ2 A;  3UKF A;  3BNM A;  3NYF A;  3O0H A;  3RP8 A;  2APG A;  2VQ7 A;  3GYJ A;  4IA6 A;  4USR A;  4C5O A;  2WS3 A;  2XVJ A;  5EOW A;  1PXC A;  2XVH A;  3IWA A;  2WP5 A;  3NYE A;  1Y0P A;  1GV4 A;  4AP1 A;  3SQP A;  3FMW A;  3NGC X;  2BXS A;  2JBV A;  4D04 A;  1NHR A;  4DNA A;  4A65 A;  2Q6U A;  3B3R A;  2XDO A;  1Y56 A;  3NK1 X;  2FBW A;  2IVD A;  2C67 A;  2X99 A;  4USQ A;  3DJD A;  1DOC A;  4EQS A;  2F5Z A;  4K2X A;  4RSL A;  2I0Z A;  2YG5 A;  1LJ1 A;  4WX1 A;  2XFU A;  4CY8 A;  2R4E A;  5KMP A;  4BUR A;  1DOD A;  1BZL A;  2FJB A;  1S2Q A;  1F6M A;  4FK1 C;  2EQ8 A;  3I6D A;  4J57 A;  4BV6 A;  4J31 A;  2DKH A;  2XFP A;  3II4 A;  1PJ5 A;  3AE7 A;  4EIQ A;  1GRF A;  1EL8 A;  4TM3 A;  1JRY A;  2GF3 A;  3DJJ A;  2IVE A;  4U8P A;  1CHU A;  5HY5 A;  1E1L A;  1L9E A;  1FEC A;  1GRH A;  4O5Q A;  1GER A;  4OPL A;  3ICT A;  3QJ4 A;  3ITJ A;  5DBJ A;  3AE3 A;  4IA5 A;  1B4V A;  1H84 A;  4NEW A;  4EQR A;  3ATR A;  1TDK A;  4YWO A;  2OAM A;  1GOS A;  3CNS A;  1E7P A;  4GAV A;  5FS6 A;  3NK0 X;  3S5W A;  4Z2T A;  2YLT A;  3HYV A;  3GDP A;  1NDA A;  4JQ9 A;  4CBQ A;  5IQ4 A;  1CJ4 A;  3C96 A;  4HB9 A;  1DOB A;  2GRT A;  3M0O A;  4B65 A;  2XLU A;  5JCM A;  3UKL A;  2YAU A;  2BK4 A;  3FBS A;  3AXB A;  3ALM A;  3NKS A;  3B6D A;  3NT6 A;  5BRT A;  1O5W A;  2EQ6 A;  1GRT A;  3AE4 A;  1KSS A;  4I59 A;  4A79 A;  3NIX A;  3WE0 A;  2RGJ A;  4G73 A;  3ZDN A;  5KVH A;  4IV9 A;  3KPK A;  5KMS A;  2QAE A;  1L9C A;  1UKV G;  1PJ7 A;  2WPF A;  3SZW A;  4Z24 A;  4IVO B;  1LV0 A;  5C2T A;  4I58 A;  5BUL A;  3DJG X;  3GMC A;  1XHC A;  2YVF A;  5JCI A;  3VQR A;  1H81 A;  4J56 A;  4RG4 A;  2XLP A;  4AP3 A;  3I3L A;  4NTC A;  2YLW A;  2GVC A;  2C64 A;  1BGN A;  4H4Q A;  1ZOY A;  2YVJ A;  2BXR A;  1CC2 A;  1TDE A;  4YSH A;  1PJ6 A;  1QJD A;  1GXF A;  1N4V A;  2Y6Q A;  2NVK X;  4RG3 A;  1S3B A;  1LQT A;  2OA1 A;  3PO7 A;  5IPY A;  2XFO A;  3AE5 A;  4OVI A;  2GAH B;  3CN8 A;  2XFQ A;  1B5Q A;  4KX6 A;  4B1B A;  2VRL A;  3NTA A;  1CF3 A;  3M12 A;  4A7A A;  3CPI G;  2YVG A;  3NG7 X;  4EQX A;  4AOX A;  3V76 A;  3AE9 A;  4GAP A;  4YKF A;  4EQW A;  1XPQ A;  2VRM A;  1GRE A;  3UKA A;  3NNE A;  2H89 A;  3H8L A;  2C3C A;  2Q7V A;  2UZZ A;  3QSS A;  4B67 A;  2QA1 A;  1CJC A;  3SXI A;  1KFY A;  5HXI A;  4FDC B;  4U8M A;  4K7Z A;  2W0H A;  2YLR A;  1K4Q A;  1GAL A;  1HYU A;  1M64 A;  4EMW A;  4UDQ A;  4Y4M A;  4WCT A;  2VZ2 A;  4C3Y A;  5J60 A;  1O94 A;  4Y4L A;  2GEW A;  4U8K A;  4BK2 A;  4U8I A;  3SFD A;  1PBE A;  3FIM B;  4OPU A;  1ZDL A;  3GRS A;  1F8S A;  3QVR A;  3DH9 A;  1TRB A;  3UTH A;  3DGH A;  3ISH A;  4ICY A;  3SZF A;  5IQ1 A;  1IUU A;  4EMJ A;  1LPF A;  1TYT A;  1ONF A;  1K0L A;  1OJ9 A;  1RYI A;  2XVE A;  3AED A;  5CQF A;  2C66 A;  2OLN A;  2VQB A;  3CGB A;  4TLX A;  4H2N A;  4P9S A;  4B66 A;  2WQY A;  2C73 A;  2DKI A;  4Z25 A;  5U25 A;  3ZYX A;  5JCN A;  1GTH A;  3QVP A;  5FS8 A;  1CL0 A;  2BC0 A;  2GR0 A;  1FEB A;  4G6G A;  1ZK7 A;  1K0I A;  2V61 A;  3T14 A;  4TM0 A;  5KOX A;  3KLJ A;  5KNL A;  1B37 A;  1CJ2 A;  3DA1 A;  3UCL A;  2RGH A;  3SYI A;  3UP4 A;  4OCG A;  4NEV A;  5J7X A;  2X8G A;  4H4V A;  1IUV A;  3AYL A;  2C70 A;  3QSE A;  3RHA A;  3GDN A;  3AD8 B;  1QO8 A;  4ZN0 A;  2JB3 A;  4U8N A;  2OAL A;  4H4X A;  2YM1 A;  3C4N A;  3CPH G;  2BA9 A;  3P4P A;  1TYP A;  3GSI A;  1IUT A;  4TM4 A;  2X8C A;  5KVI A;  3P4S A;  3T2K A;  3P4Q A;  2YQU A;  1H82 A;  3LXD A;  4FX9 A;  2JK6 A;  4U8L A;  1IUX A;  3RP6 A;  4A5L A;  1JU2 A;  3M13 A;  4UDP A;  4E0V A;  5BVA A;  1FEA A;  3H4K A;  4JY3 A;  3UKK A;  4H2R A;  3T2Y A;  2V3A A;  2Z5X A;  3AE2 A;  2WOW A;  4APN A;  1H7W A;  1GEU A;  2BS4 A;  2H88 A;  2WES A;  3AEG A;  3DK9 A;  4LII A;  4OPG A;  4U8O A;  1TDN A;  1OJC A;  3AEA A;  1PXA A;  4G74 A;  3NN0 X;  5LV9 A;  5M10 A;  1LQU A;  2XYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...