2XVEA

Crystal structure of bacterial flavin-containing monooxygenase
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
445
structure length
445
Chain Sequence
b'TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 166
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xveA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xveA02
2C76A 5U63A 2B9XA 3AD8B 1N4WA 3I6DA 5JCLA 2GEWA 3DJEA 4U8PA 4E0VA 2FJDA 4B68A 2R9ZA 1COYA 4AOSA 2BCGG 2GRTA 2VVLA 4EQWA 3C96A 2Z5XA 2JB3A 3KKJA 3QFAA 3UOZA 1KF6A 4YWOA 2XLTA 3UTHA 1GPEA 2EQ7A 2R46A 4DSHA 1TDFA 2R45A 2C73A 3KA7A 2A89A 4JN9A 1KNRA 4BK2A 2JBVA 3IF9A 1XDIA 2A8XA 1IUVA 1GT8A 1DOBA 3LZXA 1TDEA 2BK3A 1LPFA 2C70A 3EF6A 4X9NA 2XVHA 2RABA 2WP5A 5HXIA 1PXCA 2V3BA 2R0CA 1DXLA 4IVMB 5JCKA 2O9ZA 1BGJA 1F3PA 3ATQA 2WPCA 1PS9A 4Z43A 3NYFA 1JNZA 2ZZCA 4IA6A 3C4NA 1IUUA 2GB0A 2XFUA 2IIDA 1GRTA 2GR2A 2X8GA 3KD9A 1GSNA 1N1PA 3ISHA 2QA2A 3F8PA 4Y4LA 4TLXA 2YM2A 3AE6A 1L9DA 4CNKA 4XXGA 4U8NA 2C3CA 2V60A 3DGHA 3KVEA 1JRZA 4Y4NA 4GF7A 1NPXA 1CJ3A 2YG5A 3AD9B 4B65A 4U8IA 4OPGA 3UOXA 1GERA 4YT0A 1FECA 1TDKA 4A65A 1H86A 1DNCA 4FDCB 2JKCA 4JY2A 4OPDA 1OJ9A 1YKJA 3ALMA 3NTDA 2YG3A 2OALA 1VG0A 2H88A 2XFNA 1GRFA 2C75A 2C66A 2GMHA 3M0OA 2OLNA 1CJ2A 4Z2TA 4JY3A 4C77A 4YKFA 1PBBA 3P4RA 2BS4A 1VDCA 4EM3A 1L9CA 1NDAA 3SM8A 2X99A 1OJCA 1PN0A 5FS7A 1L0VA 3NK0X 5KVIA 4Y4MA 3BHFA 2YWLA 1D7YA 4H4PA 4U2TA 4O5UA 5KVHA 1GRGA 4AP1A 3CNJA 2GVCA 4AOXA 3DJJA 1H6VA 3CN8A 4AP3A 1PBFA 1H81A 3NIXA 2WETA 3NTAA 3ITJA 3V3NA 4OPUA 4EM4A 1FEAA 1F8RA 1Q9IA 1KNPA 3GWDA 3NG7X 3AE1A 4H50A 3L8KA 2AQJA 5FS9A 2VZ2A 1IUWA 2ZZBA 3PVCA 3B3RA 3V76A 2XLPA 4YTNA 1FEBA 1GREA 2JK6A 3AXBA 3GDNA 5M0ZA 2GQFA 1PXBA 2Z5YA 2VQBA 4H4SA 4YTPA 2X3NA 4UDPA 5C3JA 3Q6JA 1K0IA 5EBKA 1NENA 3LJPA 4HA6A 5TR3A 3D1CA 2YVFA 2Y6QA 3K30A 1UKVG 2YR5A 2QA1A 5CKUA 3UKAA 4AT0A 3UCLA 2WDRA 5CQFA 1GTHA 1LTXR 2BK4A 3ATRA 4XWRA 3EANA 1D4CA 3BI4A 2XFPA 2B76A 1ZKQA 2WU5A 3LADA 2BA9A 3ICSA 2XFQA 4KPRA 4NZHA 1KSUA 4A5LA 1EL8A 3DJGX 2FJAA 1OJTA 4U2SA 1K0JA 1S3BA 2R0PA 1P2HA 3COXA 2ARDA 2QAEA 1SEZA 5HY5A 2R4EA 5BULA 1JRXA 1D7LA 1EL5A 4XWZA 1YQ4A 5L46A 3P4PA 4H2RA 4EIQA 1TDNA 4GRTA 2GMJA 3G5RA 3CIRA 4A99A 3NKSA 5FMHA 1B5QA 1H7XA 1S2QA 1W4XA 1ZX9A 1Q1WA 4EMIA 3VR9A 3BI5A 4GDPA 4PAAA 3VQRA 2Y6RA 5LV9A 2R0GA 3RP8A 1TDOA 4K2XA 1O95A 3AYJA 2BABA 4BK3A 3H8LA 4BJYA 1CBOA 3F8RA 3RHAA 1LQTA 2YAUA 3NT6A 4KX6A 2GR1A 2UZZA 2XVJA 3AE2A 4EMWA 4PABA 1PJ6A 1ZMCA 1Y0PA 3AE7A 3GRTA 3UKHA 4Z2RA 1AOGA 1N4UA 2YVGA 3AWIA 2I0ZA 2WQYA 4H4WA 4FK1C 4ADWA 2WS3A 3ICTA 2ZZ0A 3NK2X 4H2PA 2BCPA 1BZLA 1MXTA 1V59A 2C67A 3ALLA 4I59A 1Y56B 1FOHA 3CGBA 1CC6A 1E7PA 4TM3A 4EMJA 3R9UA 1CC2A 4OVIA 2TPRA 3VRBA 1PJ5A 4LA1A 2WBAA 4Z24A 4H2NA 1K4QA 4TM4A 1JRYA 1IUTA 2WU2A 3IC9A 2E5VA 3ADAB 4K7ZA 3NLCA 2YR6A 3PS9A 1XHCA 3NYEA 3RP7A 2EQ8A 2V61A 4WX1A 4C5OA 2CULA 4P9SA 3AYLA 1CF3A 1H82A 3CNTA 1D5TA 1P2EA 1GOSA 1PBEA 4H4QA 4MJWA 5J7XA 2XDOA 4B67A 4YKGA 4B69A 1B4VA 3UKQA 2CDUA 1ZDLA 1LJ1A 2FBWA 4TM1A 4X4JA 3NNEA 1RYIA 3FPZA 4H2QA 4GCMA 4H4XA 2GV8A 4H7UA 2Q0KA 3C4AA 2X50A 5EB4A 4EQXA 3BNUA 2GR3A 2BYBA 4H4ZA 3V3OA 5IQ4A 5KOWA 1ZMDA 3CGDA 1Q1RA 3AEEA 5EOWA 2VQ7A 1Z6LA 1ZY8A 1S3EA 4GR1A 3UTFA 3AEDA 2CVJA 3B6DA 4O5QA 2BS3A 2YLWA 1DOEA 3VRAA 3NK1X 3UKPA 4NTCA 2GQWA 2YLXA 4X9MA 3D8XA 1X31B 4B64A 5GSNA 1BWCA 4BK1A 2F5ZA 1PJ7A 4H4VA 3ICRA 4LIIA 3GWFA 3GMBA 2WP9A 2YLTA 2WESA 2BC0A 2YLSA 5KOXA 1QLBA 1GRHA 5GRTA 2FJEA 2NVKX 3AB1A 1BF3A 4H4TA 1LQUA 3AEFA 1MO9A 4GDEA 4YXDA 3AE8A 2GR0A 1NAAA 3H8IA 1Y56A 1REOA 1S2YA 3AEGA 3FBSA 1GALA 2GAGB 2C64A 3NRNA 3QFBA 3SGLA 2BC1A 3UTEA 5JCIA 4OPTA 1PBDA 4OPIA 1PDHA 1KDGA 4NTEA 3G5QA 4CCQA 2YLRA 4B66A 1GNDA 4CY6A 2X8HA 3GYIA 3JSKA 2YM1A 1YY5A 1O94A 1EL7A 4OPCA 1JU2A 4J34A 3DGZA 4YTMA 3CPHG 2WPEA 3F8DA 2E1MA 1DJQA 1GTEA 1YQZA 2Q6UA 2RGOA 2X8CA 4JDRA 4USRA 1ELIA 5HYMA 4EIPA 1NHSA 1PXAA 2YG4A 3CGCA 3RP6A 3LZWA 3KLJA 3G5SA 2OAMA 4ZN0A 5C2TA 3NN0X 1CL0A 2OA1A 4J36A 3NGCX 4U8LA 4D04A 3M13A 4ECHA 1QO8A 1CC4A 3P9UA 3UP4A 2J3NA 3NHOX 5IPYA 5JCMA 2IVEA 2E4GA 2W0HA 3LOVA 3QSMA 4J31A 5JCNA 1K0LA 2XFOA 5J60A 5U25A 2APGA 1RP0A 2C65A 3FMWA 3KPFA 1NEKA 4U8KA 4RG3A 3EAOA 1TYTA 2XVFA 1E1LA 1LVLA 2DKHA 1HYUA 1JNRA 4K5SA 1F8WA 5HHFA 1DODA 3QSSA 4B63A 3I3LA 4YSZA 3BI2A 1ZOVA 4CBQA 3QSEA 4UDQA 4DGKA 4U8JA 5FS6A 2B7SA 4Z2UA 4Z26A 3DK8A 2H89A 3CNSA 3P4SA 3FIMB 3UKKA 3EPTA 2GH5A 2WOVA 3URHA 2V6OA 1GETA 3DK4A 3CGEA 2JAEA 4N9XA 4NEVA 4UP3A 3M12A 3DA1A 3PO7A 2VVLG 2RGJA 4JNAA 3UTGA 3AEBA 5DBJA 1L9EA 1RSGA 3QVPA 3LB8A 1KSSA 2EQ9A 2GAHB 2PHHA 4OCGA 1YQ3A 4M52A 4CNJA 4NTDA 4ZCDA 3T37A 2ACZA 2BXRA 1E39A 2BS2A 4A9WA 3AECA 5BVAA 3KU9A 2XLRA 4A6NA 2EQ6A 1BKWA 4RG4A 5IQ1A 1MOKA 2NPXA 1DJNA 1EL9A 2B7RA 2XLSA 3P1WA 4WCTA 3S61A 3E1TA 4JNQA 1ZP0A 2B9WA 1GESA 3BNMA 3VRDB 1VRQB 4U8OA 4C74A 1GRBA 3CNDA 3UOVA 3HZLA 2GF3A 3L1RA 1PHHA 3NH3X 4FK1A 1TRBA 4B1BA 2WOWA 5KRQA 4YSYA 3GMCA 1QJDA 2VRMA 3AEAA 4EQRA 1NHRA 1F6MA 4CY8A 1NHPA 4A79A 5ER0A 3IHMA 3K7TA 3SFEA 3II4A 1KFYA 3GD4A 1IUSA 4K22A 4RSLA 2CFYA 2R4JA 3H4KA 3AD7B 2C3DA 1GRAA 4CCRA 4K8DA 2XVIA 1OJDA 2OLOA 1IUXA 1NG3A 3ZDNA 5KXJA 3FG2P 5KWFA 1NG4A 1TYPA 1D4EA 4ZCCA 4DNAA 3ABVA 1VQWA 1JOAA 3UKFA 3DMEA 3ALJA 3K7QX 1N4VA 1B37A 1CHUA 2FJBA 2BXSA 3O0HA 4IVOB 2ZBWA 1NHQA 3AE9A 2WPFA 4IV9A 2YLZA 1VG9A 3AE5A 2WHDA 2WOIA 4H4RA 1M6IA 4AT2A 1GEUA 3IHGA 3RNMA 1H7WA 4LU6A 1B8SA 3DJDA 2YG7A 5BUKA 4Z44A 4ICYA 3OC4A 3Q9TA 4YSXA 4U2LA 2VRLA 2XCGA 2XLUA 2VVMA 4BJZA 5M10A 1OJAA 2JB2A 2WP6A 4K5RA 3REDA 3SFDA 1D4DA 2QCUA 3UOYA 3NN6X 4TM0A 3ZYXA 4A6NB 1LV0A 3GD3A 1E6EA 4BURA 4TLZA 2YR4A 4NEWA 3IWAA 3BHKA 4J2WA 2HQMA 4CRTA 2Q7VA 3OZ2A 2IVDA 4USQA 2WEUA 4YSHA 3UKLA 1E1KA 2YQUA 1GV4A 1ZOYA 4J33A 1XANA 2C72A 4APNA 3CPIG 2WDQA 1E1NA 2YVJA 2VOUA 1ONFA 3GYJA 3QVRA 5EB5A 1F8SA 3P4QA 4D03A 2C7GA 1DOCA 4DSGA 3NYCA 4REKA 4U8MA 4BV6A 3DH9A 2JB1A 4I58A 1JEHA 4OPLA 3CNPA 2Q0LA 2XYOA 3GRSA 5BRTA 1EBDA 1PBCA 4HB9A 3CTYA 2AR8A 3AE4A 4GUVA 3UP5A 1FCDA 1CJ4A 2XVEA 4FX9A 2A87A 5U1OA 3S5WA 3VR8A 3WE0A 3SQPA 1FL2A 1E1MA 2BACA 2AAQA 3DK9A 1GXFA 1O5WA 2B9YA 2DKIA 2WDVA 3GDPA 3QJ4A 2V5ZA 4H4YA 4JQ9A 2BK5A 4EQSA 1ZK7A 4IA5A 4Z25A 3GSIA 4H4UA 2V3AA 1M64A 3LXDA 4C3XA 4C3YA 4A7AA 1XPQA 1H83A 2PYXA 4UDRA 3CPJG 3AYIA 4J57A 4J56A 1IJHA 1CJCA 5FS8A 2RGHA 2YG6A 3AE3A 1BGNA 3K7MX 1H84A 2TMDA
chains in the Genus database with same CATH superfamily
2C76A 5U63A 2B9XA 3AD8B 1N4WA 3I6DA 5JCLA 2GEWA 3DJEA 4U8PA 4E0VA 2FJDA 4B68A 2R9ZA 1COYA 4AOSA 2BCGG 2GRTA 2VVLA 4EQWA 3C96A 2Z5XA 2JB3A 3KKJA 3QFAA 3UOZA 1KF6A 4YWOA 2XLTA 3UTHA 1GPEA 2EQ7A 2R46A 4DSHA 1TDFA 2R45A 2C73A 3KA7A 2A89A 4JN9A 1KNRA 4BK2A 2JBVA 3IF9A 1XDIA 2A8XA 1IUVA 1GT8A 1DOBA 3LZXA 1TDEA 2BK3A 1LPFA 2C70A 3EF6A 4X9NA 2XVHA 2RABA 2WP5A 5HXIA 1PXCA 2V3BA 2R0CA 1DXLA 4IVMB 5JCKA 2O9ZA 4G6HA 1BGJA 1F3PA 3ATQA 2WPCA 1PS9A 4Z43A 3NYFA 1JNZA 2ZZCA 4IA6A 3C4NA 1IUUA 2GB0A 2XFUA 2IIDA 1GRTA 2GR2A 2X8GA 3KD9A 1GSNA 1N1PA 3ISHA 2QA2A 3F8PA 3SZFA 4Y4LA 4TLXA 2YM2A 3AE6A 1L9DA 4CNKA 4XXGA 4U8NA 2C3CA 2V60A 3DGHA 3KVEA 1JRZA 4Y4NA 4GF7A 1NPXA 1CJ3A 2YG5A 3AD9B 4B65A 4U8IA 4OPGA 3UOXA 1GERA 4YT0A 1FECA 1TDKA 4A65A 1H86A 1DNCA 4FDCB 2JKCA 4JY2A 4OPDA 1OJ9A 1YKJA 4G74A 3ALMA 3NTDA 2YG3A 2OALA 1VG0A 2H88A 2XFNA 1GRFA 2C75A 2C66A 2GMHA 3M0OA 2OLNA 1CJ2A 4Z2TA 4JY3A 2BRAA 4C77A 4YKFA 3HYWA 1PBBA 3P4RA 2BS4A 1VDCA 4EM3A 3T2ZA 1L9CA 1NDAA 3SM8A 2X99A 1OJCA 1PN0A 5FS7A 1L0VA 3NK0X 5KVIA 4Y4MA 3BHFA 2YWLA 1D7YA 4H4PA 4U2TA 4O5UA 5KVHA 1GRGA 4AP1A 3CNJA 2GVCA 4AOXA 3DJJA 1H6VA 3CN8A 4AP3A 1PBFA 1H81A 3NIXA 2WETA 3NTAA 3ITJA 3V3NA 4OPUA 4EM4A 1FEAA 1F8RA 1Q9IA 1KNPA 3GWDA 3NG7X 3AE1A 4H50A 5KMRA 3L8KA 2AQJA 5FS9A 2BRYA 1IUWA 2VZ2A 2ZZBA 3B3RA 3PVCA 2XLPA 3V76A 4YTNA 1FEBA 1GREA 2JK6A 3AXBA 3GDNA 5M0ZA 2GQFA 1PXBA 2Z5YA 2VQBA 3GYXA 4H4SA 4YTPA 2X3NA 4UDPA 5C3JA 3Q6JA 5KMSA 1K0IA 5EBKA 1NENA 3LJPA 4HA6A 5KNLA 5TR3A 3D1CA 2YVFA 2Y6QA 3K30A 1UKVG 2YR5A 2QA1A 3KPKA 5CKUA 3UKAA 3UCLA 4AT0A 2WDRA 5CQFA 1GTHA 1LTXR 2BK4A 3ATRA 4XWRA 3EANA 1D4CA 3BI4A 2XFPA 2B76A 1ZKQA 2WU5A 3LADA 2BA9A 3ICSA 2XFQA 4KPRA 4NZHA 1KSUA 4A5LA 1EL8A 3DJGX 2FJAA 1OJTA 4U2SA 1K0JA 1S3BA 2R0PA 1P2HA 3COXA 2ARDA 2QAEA 1SEZA 5HY5A 2R4EA 5BULA 1JRXA 1D7LA 1EL5A 4XWZA 1YQ4A 5L46A 3P4PA 4H2RA 4EIQA 1TDNA 4GRTA 2GMJA 3G5RA 3CIRA 4A99A 3NKSA 5FMHA 1B5QA 1H7XA 1S2QA 1W4XA 1ZX9A 1Q1WA 4EMIA 3VR9A 3BI5A 4GDPA 4II3A 4PAAA 3VQRA 2Y6RA 5LV9A 2R0GA 3RP8A 1TDOA 4K2XA 1O95A 3AYJA 2BABA 4BK3A 3H8LA 4BJYA 1CBOA 3F8RA 3RHAA 1LQTA 2YAUA 3NT6A 4KX6A 2GR1A 2UZZA 2XVJA 3AE2A 3SX6A 4PABA 4EMWA 1PJ6A 1ZMCA 1Y0PA 3AE7A 3GRTA 3UKHA 4Z2RA 1AOGA 1N4UA 2YVGA 3AWIA 2I0ZA 2WQYA 4H4WA 4FK1C 4ADWA 2WS3A 3ICTA 2ZZ0A 3NK2X 4H2PA 2BCPA 1BZLA 1MXTA 1V59A 2C67A 3ALLA 4I59A 5KMQA 1Y56B 1FOHA 3CGBA 1CC6A 1E7PA 4TM3A 4EMJA 3R9UA 1CC2A 4OVIA 3SYIA 2TPRA 3VRBA 1PJ5A 4LA1A 2WBAA 4Z24A 4H2NA 1K4QA 4TM4A 1JRYA 1IUTA 2WU2A 3IC9A 2E5VA 3ADAB 4K7ZA 3NLCA 2YR6A 3PS9A 1XHCA 3NYEA 3RP7A 2EQ8A 2V61A 4WX1A 4C5OA 2CULA 4P9SA 3AYLA 1CF3A 1H82A 3CNTA 1D5TA 1P2EA 1GOSA 1PBEA 4H4QA 4MJWA 5J7XA 2XDOA 4B67A 4YKGA 4B69A 1B4VA 3UKQA 2CDUA 1ZDLA 1LJ1A 5HYMA 2FBWA 4TM1A 4X4JA 3NNEA 1RYIA 3FPZA 4H2QA 4GCMA 4H4XA 2GV8A 4H7UA 2Q0KA 3C4AA 2X50A 5EB4A 4EQXA 3BNUA 2GR3A 2BYBA 4H4ZA 3V3OA 5IQ4A 5KOWA 1ZMDA 3CGDA 1Q1RA 3AEEA 5EOWA 2VQ7A 1Z6LA 1ZY8A 1S3EA 4GR1A 3UTFA 3AEDA 2CVJA 3B6DA 4O5QA 2BS3A 2YLWA 1DOEA 3VRAA 3NK1X 3UKPA 4NTCA 2GQWA 2YLXA 4X9MA 3D8XA 1X31B 4B64A 5GSNA 1BWCA 4BK1A 2F5ZA 1PJ7A 4H4VA 3ICRA 4LIIA 3GWFA 3GMBA 2WP9A 2YLTA 2WESA 2BC0A 2YLSA 5KOXA 1QLBA 1GRHA 5GRTA 2FJEA 2NVKX 3AB1A 1BF3A 4H4TA 1LQUA 3AEFA 1MO9A 4GDEA 4YXDA 3AE8A 2GR0A 1NAAA 3H8IA 1Y56A 1REOA 1S2YA 3AEGA 3FBSA 1GALA 2GAGB 2C64A 3NRNA 3QFBA 3SGLA 2BC1A 3UTEA 5JCIA 4OPTA 1PBDA 4OPIA 1PDHA 1KDGA 4NTEA 3G5QA 4CCQA 2YLRA 4B66A 1GNDA 4CY6A 2X8HA 3GYIA 3JSKA 2YM1A 1YY5A 1O94A 1EL7A 4OPCA 1JU2A 4J34A 3DGZA 4YTMA 3CPHG 2WPEA 3F8DA 2E1MA 1DJQA 1GTEA 1YQZA 2Q6UA 2RGOA 2X8CA 4JDRA 4NWZA 1ELIA 4USRA 4EIPA 1NHSA 1PXAA 2YG4A 3CGCA 3RP6A 3LZWA 3KLJA 3G5SA 2OAMA 4ZN0A 5C2TA 3NN0X 1CL0A 2OA1A 4J36A 3NGCX 4U8LA 4D04A 3M13A 4ECHA 1QO8A 1CC4A 3P9UA 3UP4A 2J3NA 3NHOX 5IPYA 5JCMA 2IVEA 2E4GA 2W0HA 3LOVA 3QSMA 4J31A 3SZ0A 5KMPA 5JCNA 1K0LA 2XFOA 5J60A 5U25A 2APGA 1RP0A 2C65A 3FMWA 3KPFA 1NEKA 4U8KA 4RG3A 3EAOA 1TYTA 2XVFA 1E1LA 1LVLA 2DKHA 1HYUA 1JNRA 4K5SA 1F8WA 5HHFA 3T14A 1DODA 3QSSA 4B63A 3I3LA 4YSZA 3BI2A 1ZOVA 4CBQA 3QSEA 4UDQA 4DGKA 4U8JA 5FS6A 2B7SA 4Z2UA 4Z26A 3DK8A 2H89A 3CNSA 3P4SA 3FIMB 3UKKA 3EPTA 2GH5A 2WOVA 3T31A 2V6OA 3URHA 1GETA 3DK4A 3CGEA 2JAEA 4N9XA 4II2A 4NEVA 4UP3A 3M12A 3DA1A 3PO7A 2VVLG 2RGJA 4JNAA 3UTGA 3AEBA 5DBJA 1L9EA 1RSGA 2C4CA 3QVPA 3LB8A 1KSSA 2EQ9A 2GAHB 2PHHA 4G73A 3T0KA 4OCGA 1YQ3A 4M52A 4CNJA 4NTDA 4G6GA 4ZCDA 3T37A 2ACZA 2BXRA 1E39A 2BS2A 4A9WA 3AECA 5BVAA 3KU9A 2XLRA 4A6NA 2EQ6A 4G9KA 1BKWA 4RG4A 5IQ1A 1MOKA 2NPXA 1DJNA 1EL9A 2B7RA 2XLSA 3P1WA 4WCTA 3S61A 3E1TA 4JNQA 1ZP0A 2B9WA 1GESA 3BNMA 3VRDB 1VRQB 4U8OA 4C74A 1GRBA 3CNDA 3UOVA 3HZLA 2GF3A 3L1RA 1PHHA 3NH3X 4FK1A 1TRBA 3HYXA 4B1BA 2WOWA 5KRQA 4YSYA 3GMCA 4GAPA 1QJDA 2VRMA 3AEAA 4EQRA 1NHRA 1F6MA 4CY8A 1NHPA 4A79A 5ER0A 3CMMA 3IHMA 3K7TA 3SFEA 3SY4A 3II4A 1KFYA 3GD4A 1IUSA 4K22A 4RSLA 2CFYA 2R4JA 3H4KA 3AD7B 2C3DA 1GRAA 4CCRA 3T2YA 4K8DA 2XVIA 1OJDA 2OLOA 1IUXA 1NG3A 3ZDNA 5KXJA 3T2KA 3FG2P 5KWFA 1NG4A 1TYPA 1D4EA 4ZCCA 4DNAA 3ABVA 1VQWA 1JOAA 3UKFA 3DMEA 3ALJA 3K7QX 1N4VA 1B37A 1CHUA 2FJBA 2BXSA 3O0HA 4IVOB 2ZBWA 1NHQA 3SXIA 3AE9A 3SZWA 2WPFA 4IV9A 2YLZA 1VG9A 3AE5A 2WHDA 2WOIA 4H4RA 1M6IA 4GAVA 4AT2A 1GEUA 3IHGA 3RNMA 1H7WA 4LU6A 1B8SA 3DJDA 2YG7A 5BUKA 4Z44A 4ICYA 3OC4A 3Q9TA 4YSXA 4U2LA 2VRLA 2XCGA 2XLUA 2VVMA 4BJZA 5M10A 1OJAA 2JB2A 2WP6A 4K5RA 3REDA 3SFDA 1D4DA 2QCUA 3UOYA 3NN6X 4TM0A 3ZYXA 4A6NB 1LV0A 3GD3A 1E6EA 4BURA 4NNJA 4TLZA 2YR4A 4NEWA 3IWAA 3BHKA 4J2WA 2HQMA 4CRTA 2Q7VA 3OZ2A 2IVDA 4USQA 2WEUA 4YSHA 3UKLA 1E1KA 2YQUA 1GV4A 1ZOYA 4J33A 1XANA 2C72A 4APNA 3CPIG 2WDQA 1E1NA 2YVJA 2VOUA 1ONFA 3GYJA 3QVRA 5EB5A 1F8SA 3P4QA 4D03A 2C7GA 1DOCA 4DSGA 3NYCA 4REKA 4U8MA 4BV6A 3DH9A 2JB1A 4I58A 1JEHA 4OPLA 3CNPA 2Q0LA 2XYOA 3GRSA 5BRTA 1EBDA 3HYVA 1PBCA 4HB9A 3CTYA 2AR8A 3AE4A 4GUVA 3UP5A 1FCDA 1CJ4A 2XVEA 4FX9A 2A87A 5U1OA 3S5WA 3SZCA 3VR8A 3WE0A 3SQPA 1FL2A 1E1MA 2BACA 2AAQA 3DK9A 1GXFA 1O5WA 2B9YA 2DKIA 2WDVA 3GDPA 3QJ4A 2V5ZA 4H4YA 4JQ9A 2BK5A 4EQSA 1ZK7A 4IA5A 4Z25A 3GSIA 4H4UA 2V3AA 1M64A 3LXDA 4C3XA 4C3YA 4A7AA 1XPQA 1H83A 2PYXA 4UDRA 3CPJG 3AYIA 4J57A 4J56A 1IJHA 1CJCA 5FS8A 2RGHA 2YG6A 3AE3A 1BGNA 3K7MX 1H84A 2TMDA
chains in the Genus database with same CATH topology
2C76A 5U63A 2B9XA 3AD8B 1N4WA 3I6DA 5JCLA 2GEWA 3DJEA 4U8PA 4E0VA 2FJDA 4B68A 2R9ZA 1COYA 4AOSA 2BCGG 2GRTA 2VVLA 4EQWA 3C96A 2Z5XA 2JB3A 3KKJA 3QFAA 3UOZA 1KF6A 4YWOA 2XLTA 3UTHA 1GPEA 2EQ7A 2R46A 4DSHA 1TDFA 2R45A 2C73A 3KA7A 2A89A 4JN9A 1KNRA 4BK2A 2JBVA 3IF9A 1XDIA 2A8XA 1IUVA 1GT8A 1DOBA 3LZXA 1TDEA 2BK3A 1LPFA 2C70A 3EF6A 4X9NA 2XVHA 2RABA 2WP5A 5HXIA 1PXCA 2V3BA 2R0CA 1DXLA 4IVMB 5JCKA 2O9ZA 4G6HA 1BGJA 1F3PA 3ATQA 2WPCA 1PS9A 4Z43A 3NYFA 1JNZA 2ZZCA 4IA6A 3C4NA 1IUUA 2GB0A 2XFUA 2IIDA 1GRTA 2GR2A 2X8GA 3KD9A 1GSNA 1N1PA 3ISHA 2QA2A 3F8PA 3SZFA 4Y4LA 4TLXA 2YM2A 3AE6A 1L9DA 4CNKA 4XXGA 4U8NA 2C3CA 2V60A 3DGHA 3KVEA 1JRZA 4Y4NA 4GF7A 1NPXA 1CJ3A 2YG5A 3AD9B 4B65A 4U8IA 4OPGA 3UOXA 1GERA 4YT0A 1FECA 1TDKA 4A65A 1H86A 1DNCA 4FDCB 2JKCA 4JY2A 4OPDA 1OJ9A 1YKJA 4G74A 3ALMA 3NTDA 2YG3A 2OALA 1VG0A 2H88A 2XFNA 1GRFA 2C75A 2C66A 2GMHA 3M0OA 2OLNA 1CJ2A 4Z2TA 4JY3A 2BRAA 4C77A 4YKFA 3HYWA 1PBBA 3P4RA 2BS4A 1VDCA 4EM3A 3T2ZA 1L9CA 1NDAA 3SM8A 2X99A 1OJCA 1PN0A 5FS7A 1L0VA 3NK0X 5KVIA 4Y4MA 3BHFA 2YWLA 1D7YA 4H4PA 4U2TA 4O5UA 5KVHA 1GRGA 4AP1A 3CNJA 2GVCA 4AOXA 3DJJA 1H6VA 3CN8A 4AP3A 1PBFA 1H81A 3NIXA 2WETA 3NTAA 3ITJA 3V3NA 4OPUA 4EM4A 1FEAA 1F8RA 1Q9IA 1KNPA 3GWDA 3NG7X 3AE1A 4H50A 5KMRA 3L8KA 2AQJA 5FS9A 2BRYA 1IUWA 2VZ2A 2ZZBA 3B3RA 3PVCA 2XLPA 3V76A 4YTNA 1FEBA 1GREA 2JK6A 3AXBA 3GDNA 5M0ZA 2GQFA 1PXBA 2Z5YA 2VQBA 3GYXA 4H4SA 4YTPA 2X3NA 4UDPA 5C3JA 3Q6JA 5KMSA 1K0IA 5EBKA 1NENA 3LJPA 4HA6A 5KNLA 5TR3A 3D1CA 2YVFA 2Y6QA 3K30A 1UKVG 2YR5A 2QA1A 3KPKA 5CKUA 3UKAA 3UCLA 4AT0A 2WDRA 5CQFA 1GTHA 1LTXR 2BK4A 3ATRA 4XWRA 3EANA 1D4CA 3BI4A 2XFPA 2B76A 1ZKQA 2WU5A 3LADA 2BA9A 3ICSA 2XFQA 4KPRA 4NZHA 1KSUA 4A5LA 1EL8A 3DJGX 2FJAA 1OJTA 4U2SA 1K0JA 1S3BA 2R0PA 1P2HA 3COXA 2ARDA 2QAEA 1SEZA 5HY5A 2R4EA 5BULA 1JRXA 1D7LA 1EL5A 4XWZA 1YQ4A 5L46A 3P4PA 4H2RA 4EIQA 1TDNA 4GRTA 2GMJA 3G5RA 3CIRA 4A99A 3NKSA 5FMHA 1B5QA 1H7XA 1S2QA 1W4XA 1ZX9A 1Q1WA 4EMIA 3VR9A 3BI5A 4GDPA 4II3A 4PAAA 3VQRA 2Y6RA 5LV9A 2R0GA 3RP8A 1TDOA 4K2XA 1O95A 3AYJA 2BABA 4BK3A 3H8LA 4BJYA 1CBOA 3F8RA 3RHAA 1LQTA 2YAUA 3NT6A 4KX6A 2GR1A 2UZZA 2XVJA 3AE2A 3SX6A 4PABA 4EMWA 1PJ6A 1ZMCA 1Y0PA 3AE7A 3GRTA 3UKHA 4Z2RA 1AOGA 1N4UA 2YVGA 3AWIA 2I0ZA 2WQYA 4H4WA 4FK1C 4ADWA 2WS3A 3ICTA 2ZZ0A 3NK2X 4H2PA 2BCPA 1BZLA 1MXTA 1V59A 2C67A 3ALLA 4I59A 5KMQA 1Y56B 1FOHA 3CGBA 1CC6A 1E7PA 4TM3A 4EMJA 3R9UA 1CC2A 4OVIA 3SYIA 2TPRA 3VRBA 1PJ5A 4LA1A 2WBAA 4Z24A 4H2NA 1K4QA 4TM4A 1JRYA 1IUTA 2WU2A 3IC9A 2E5VA 3ADAB 4K7ZA 3NLCA 2YR6A 3PS9A 1XHCA 3NYEA 3RP7A 2EQ8A 2V61A 4WX1A 4C5OA 2CULA 4P9SA 3AYLA 1CF3A 1H82A 3CNTA 1D5TA 1P2EA 1GOSA 1PBEA 4H4QA 4MJWA 5J7XA 2XDOA 4B67A 4YKGA 4B69A 1B4VA 3UKQA 2CDUA 1ZDLA 1LJ1A 5HYMA 2FBWA 4TM1A 4X4JA 3NNEA 1RYIA 3FPZA 4H2QA 4GCMA 4H4XA 2GV8A 4H7UA 2Q0KA 3C4AA 2X50A 5EB4A 4EQXA 3BNUA 2GR3A 2BYBA 4H4ZA 3V3OA 5IQ4A 5KOWA 1ZMDA 3CGDA 1Q1RA 3AEEA 5EOWA 2VQ7A 1Z6LA 1ZY8A 1S3EA 4GR1A 3UTFA 3AEDA 2CVJA 3B6DA 4O5QA 2BS3A 2YLWA 1DOEA 3VRAA 3NK1X 3UKPA 4NTCA 2GQWA 2YLXA 4X9MA 3D8XA 1X31B 4B64A 5GSNA 1BWCA 4BK1A 2F5ZA 1PJ7A 4H4VA 3ICRA 4LIIA 3GWFA 3GMBA 2WP9A 2YLTA 2WESA 2BC0A 2YLSA 5KOXA 1QLBA 1GRHA 5GRTA 2FJEA 2NVKX 3AB1A 1BF3A 4H4TA 1LQUA 3AEFA 1MO9A 4GDEA 4YXDA 3AE8A 2GR0A 1NAAA 3H8IA 1Y56A 1REOA 1S2YA 3AEGA 3FBSA 1GALA 2GAGB 2C64A 3NRNA 3QFBA 3SGLA 2BC1A 3UTEA 5JCIA 4OPTA 1PBDA 4OPIA 1PDHA 1KDGA 4NTEA 3G5QA 4CCQA 2YLRA 4B66A 1GNDA 4CY6A 2X8HA 3GYIA 3JSKA 2YM1A 1YY5A 1O94A 1EL7A 4OPCA 1JU2A 4J34A 3DGZA 4YTMA 3CPHG 2WPEA 3F8DA 2E1MA 1DJQA 1GTEA 1YQZA 2Q6UA 2RGOA 2X8CA 4JDRA 4NWZA 1ELIA 4USRA 4EIPA 1NHSA 1PXAA 2YG4A 3CGCA 3RP6A 3LZWA 3KLJA 3G5SA 2OAMA 4ZN0A 5C2TA 3NN0X 1CL0A 2OA1A 4J36A 3NGCX 4U8LA 4D04A 3M13A 4ECHA 1QO8A 1CC4A 3P9UA 3UP4A 2J3NA 3NHOX 5IPYA 5JCMA 2IVEA 2E4GA 2W0HA 3LOVA 3QSMA 4J31A 3SZ0A 5KMPA 5JCNA 1K0LA 2XFOA 5J60A 5U25A 2APGA 1RP0A 2C65A 3FMWA 3KPFA 1NEKA 4U8KA 4RG3A 3EAOA 1TYTA 2XVFA 1E1LA 1LVLA 2DKHA 1HYUA 1JNRA 4K5SA 1F8WA 5HHFA 3T14A 1DODA 3QSSA 4B63A 3I3LA 4YSZA 3BI2A 1ZOVA 4CBQA 3QSEA 4UDQA 4DGKA 4U8JA 5FS6A 2B7SA 4Z2UA 4Z26A 3DK8A 2H89A 3CNSA 3P4SA 3FIMB 3UKKA 3EPTA 2GH5A 2WOVA 3T31A 2V6OA 3URHA 1GETA 3DK4A 3CGEA 2JAEA 4N9XA 4II2A 4NEVA 4UP3A 3M12A 3DA1A 3PO7A 2VVLG 2RGJA 4JNAA 3UTGA 3AEBA 5DBJA 1L9EA 1RSGA 2C4CA 3QVPA 3LB8A 1KSSA 2EQ9A 2GAHB 2PHHA 4G73A 3T0KA 4OCGA 1YQ3A 4M52A 4CNJA 4NTDA 4G6GA 4ZCDA 3T37A 2ACZA 2BXRA 1E39A 2BS2A 4A9WA 3AECA 5BVAA 3KU9A 2XLRA 4A6NA 2EQ6A 4G9KA 1BKWA 4RG4A 5IQ1A 1MOKA 2NPXA 1DJNA 1EL9A 2B7RA 2XLSA 3P1WA 4WCTA 3S61A 3E1TA 4JNQA 1ZP0A 2B9WA 1GESA 3BNMA 3VRDB 1VRQB 4U8OA 4C74A 1GRBA 3CNDA 3UOVA 3HZLA 2GF3A 3L1RA 1PHHA 3NH3X 4FK1A 1TRBA 3HYXA 4B1BA 2WOWA 5KRQA 4YSYA 3GMCA 4GAPA 1QJDA 2VRMA 3AEAA 4EQRA 1NHRA 1F6MA 4CY8A 1NHPA 4A79A 5ER0A 3CMMA 3IHMA 3K7TA 3SFEA 3SY4A 3II4A 1KFYA 3GD4A 1IUSA 4K22A 4RSLA 2CFYA 2R4JA 3H4KA 3AD7B 2C3DA 1GRAA 4CCRA 3T2YA 4K8DA 2XVIA 1OJDA 2OLOA 1IUXA 1NG3A 3ZDNA 5KXJA 3T2KA 3FG2P 5KWFA 1NG4A 1TYPA 1D4EA 4ZCCA 4DNAA 3ABVA 1VQWA 1JOAA 3UKFA 3DMEA 3ALJA 3K7QX 1N4VA 1B37A 1CHUA 2FJBA 2BXSA 3O0HA 4IVOB 2ZBWA 1NHQA 3SXIA 3AE9A 3SZWA 2WPFA 4IV9A 2YLZA 1VG9A 3AE5A 2WHDA 2WOIA 4H4RA 1M6IA 4GAVA 4AT2A 1GEUA 3IHGA 3RNMA 1H7WA 4LU6A 1B8SA 3DJDA 2YG7A 5BUKA 4Z44A 4ICYA 3OC4A 3Q9TA 4YSXA 4U2LA 2VRLA 2XCGA 2XLUA 2VVMA 4BJZA 5M10A 1OJAA 2JB2A 2WP6A 4K5RA 3REDA 3SFDA 1D4DA 2QCUA 3UOYA 3NN6X 4TM0A 3ZYXA 4A6NB 1LV0A 3GD3A 1E6EA 4BURA 4NNJA 4TLZA 2YR4A 4NEWA 3IWAA 3BHKA 4J2WA 2HQMA 4CRTA 2Q7VA 3OZ2A 2IVDA 4USQA 2WEUA 4YSHA 3UKLA 1E1KA 2YQUA 1GV4A 1ZOYA 4J33A 1XANA 2C72A 4APNA 3CPIG 2WDQA 1E1NA 2YVJA 2VOUA 1ONFA 3GYJA 3QVRA 5EB5A 1F8SA 3P4QA 4D03A 2C7GA 1DOCA 4DSGA 3NYCA 4REKA 4U8MA 4BV6A 3DH9A 2JB1A 4I58A 1JEHA 4OPLA 3CNPA 2Q0LA 2XYOA 3GRSA 5BRTA 1EBDA 3HYVA 1PBCA 4HB9A 3CTYA 2AR8A 3AE4A 4GUVA 3UP5A 1FCDA 1CJ4A 2XVEA 4FX9A 2A87A 5U1OA 3S5WA 3SZCA 3VR8A 3WE0A 3SQPA 1FL2A 1E1MA 2BACA 2AAQA 3DK9A 1GXFA 1O5WA 2B9YA 2DKIA 2WDVA 3GDPA 3QJ4A 2V5ZA 4H4YA 4JQ9A 2BK5A 4EQSA 1ZK7A 4IA5A 4Z25A 3GSIA 4H4UA 2V3AA 1M64A 3LXDA 4C3XA 4C3YA 4A7AA 1XPQA 1H83A 2PYXA 4UDRA 3CPJG 3AYIA 4J57A 4J56A 1IJHA 1CJCA 5FS8A 2RGHA 2YG6A 3AE3A 1BGNA 3K7MX 1H84A 2TMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C76 A;  5U63 A;  2B9X A;  3AD8 B;  1N4W A;  3I6D A;  5JCL A;  2GEW A;  3DJE A;  4U8P A;  4E0V A;  2FJD A;  4B68 A;  2R9Z A;  1COY A;  4AOS A;  2BCG G;  2GRT A;  2VVL A;  4EQW A;  3C96 A;  2Z5X A;  2JB3 A;  3KKJ A;  3QFA A;  3UOZ A;  1KF6 A;  4YWO A;  2XLT A;  3UTH A;  1GPE A;  2EQ7 A;  2R46 A;  4DSH A;  1TDF A;  2R45 A;  2C73 A;  3KA7 A;  2A89 A;  4JN9 A;  1KNR A;  4BK2 A;  2JBV A;  3IF9 A;  1XDI A;  2A8X A;  1IUV A;  1GT8 A;  1DOB A;  3LZX A;  1TDE A;  2BK3 A;  1LPF A;  2C70 A;  3EF6 A;  4X9N A;  2XVH A;  2RAB A;  2WP5 A;  5HXI A;  1PXC A;  2V3B A;  2R0C A;  1DXL A;  4IVM B;  5JCK A;  2O9Z A;  1BGJ A;  1F3P A;  3ATQ A;  2WPC A;  1PS9 A;  4Z43 A;  3NYF A;  1JNZ A;  2ZZC A;  4IA6 A;  3C4N A;  1IUU A;  2GB0 A;  2XFU A;  2IID A;  1GRT A;  2GR2 A;  2X8G A;  3KD9 A;  1GSN A;  1N1P A;  3ISH A;  2QA2 A;  3F8P A;  4Y4L A;  4TLX A;  2YM2 A;  3AE6 A;  1L9D A;  4CNK A;  4XXG A;  4U8N A;  2C3C A;  2V60 A;  3DGH A;  3KVE A;  1JRZ A;  4Y4N A;  4GF7 A;  1NPX A;  1CJ3 A;  2YG5 A;  3AD9 B;  4B65 A;  4U8I A;  4OPG A;  3UOX A;  1GER A;  4YT0 A;  1FEC A;  1TDK A;  4A65 A;  1H86 A;  1DNC A;  4FDC B;  2JKC A;  4JY2 A;  4OPD A;  1OJ9 A;  1YKJ A;  3ALM A;  3NTD A;  2YG3 A;  2OAL A;  1VG0 A;  2H88 A;  2XFN A;  1GRF A;  2C75 A;  2C66 A;  2GMH A;  3M0O A;  2OLN A;  1CJ2 A;  4Z2T A;  4JY3 A;  4C77 A;  4YKF A;  1PBB A;  3P4R A;  2BS4 A;  1VDC A;  4EM3 A;  1L9C A;  1NDA A;  3SM8 A;  2X99 A;  1OJC A;  1PN0 A;  5FS7 A;  1L0V A;  3NK0 X;  5KVI A;  4Y4M A;  3BHF A;  2YWL A;  1D7Y A;  4H4P A;  4U2T A;  4O5U A;  5KVH A;  1GRG A;  4AP1 A;  3CNJ A;  2GVC A;  4AOX A;  3DJJ A;  1H6V A;  3CN8 A;  4AP3 A;  1PBF A;  1H81 A;  3NIX A;  2WET A;  3NTA A;  3ITJ A;  3V3N A;  4OPU A;  4EM4 A;  1FEA A;  1F8R A;  1Q9I A;  1KNP A;  3GWD A;  3NG7 X;  3AE1 A;  4H50 A;  3L8K A;  2AQJ A;  5FS9 A;  2VZ2 A;  1IUW A;  2ZZB A;  3PVC A;  3B3R A;  3V76 A;  2XLP A;  4YTN A;  1FEB A;  1GRE A;  2JK6 A;  3AXB A;  3GDN A;  5M0Z A;  2GQF A;  1PXB A;  2Z5Y A;  2VQB A;  4H4S A;  4YTP A;  2X3N A;  4UDP A;  5C3J A;  3Q6J A;  1K0I A;  5EBK A;  1NEN A;  3LJP A;  4HA6 A;  5TR3 A;  3D1C A;  2YVF A;  2Y6Q A;  3K30 A;  1UKV G;  2YR5 A;  2QA1 A;  5CKU A;  3UKA A;  4AT0 A;  3UCL A;  2WDR A;  5CQF A;  1GTH A;  1LTX R;  2BK4 A;  3ATR A;  4XWR A;  3EAN A;  1D4C A;  3BI4 A;  2XFP A;  2B76 A;  1ZKQ A;  2WU5 A;  3LAD A;  2BA9 A;  3ICS A;  2XFQ A;  4KPR A;  4NZH A;  1KSU A;  4A5L A;  1EL8 A;  3DJG X;  2FJA A;  1OJT A;  4U2S A;  1K0J A;  1S3B A;  2R0P A;  1P2H A;  3COX A;  2ARD A;  2QAE A;  1SEZ A;  5HY5 A;  2R4E A;  5BUL A;  1JRX A;  1D7L A;  1EL5 A;  4XWZ A;  1YQ4 A;  5L46 A;  3P4P A;  4H2R A;  4EIQ A;  1TDN A;  4GRT A;  2GMJ A;  3G5R A;  3CIR A;  4A99 A;  3NKS A;  5FMH A;  1B5Q A;  1H7X A;  1S2Q A;  1W4X A;  1ZX9 A;  1Q1W A;  4EMI A;  3VR9 A;  3BI5 A;  4GDP A;  4PAA A;  3VQR A;  2Y6R A;  5LV9 A;  2R0G A;  3RP8 A;  1TDO A;  4K2X A;  1O95 A;  3AYJ A;  2BAB A;  4BK3 A;  3H8L A;  4BJY A;  1CBO A;  3F8R A;  3RHA A;  1LQT A;  2YAU A;  3NT6 A;  4KX6 A;  2GR1 A;  2UZZ A;  2XVJ A;  3AE2 A;  4EMW A;  4PAB A;  1PJ6 A;  1ZMC A;  1Y0P A;  3AE7 A;  3GRT A;  3UKH A;  4Z2R A;  1AOG A;  1N4U A;  2YVG A;  3AWI A;  2I0Z A;  2WQY A;  4H4W A;  4FK1 C;  4ADW A;  2WS3 A;  3ICT A;  2ZZ0 A;  3NK2 X;  4H2P A;  2BCP A;  1BZL A;  1MXT A;  1V59 A;  2C67 A;  3ALL A;  4I59 A;  1Y56 B;  1FOH A;  3CGB A;  1CC6 A;  1E7P A;  4TM3 A;  4EMJ A;  3R9U A;  1CC2 A;  4OVI A;  2TPR A;  3VRB A;  1PJ5 A;  4LA1 A;  2WBA A;  4Z24 A;  4H2N A;  1K4Q A;  4TM4 A;  1JRY A;  1IUT A;  2WU2 A;  3IC9 A;  2E5V A;  3ADA B;  4K7Z A;  3NLC A;  2YR6 A;  3PS9 A;  1XHC A;  3NYE A;  3RP7 A;  2EQ8 A;  2V61 A;  4WX1 A;  4C5O A;  2CUL A;  4P9S A;  3AYL A;  1CF3 A;  1H82 A;  3CNT A;  1D5T A;  1P2E A;  1GOS A;  1PBE A;  4H4Q A;  4MJW A;  5J7X A;  2XDO A;  4B67 A;  4YKG A;  4B69 A;  1B4V A;  3UKQ A;  2CDU A;  1ZDL A;  1LJ1 A;  2FBW A;  4TM1 A;  4X4J A;  3NNE A;  1RYI A;  3FPZ A;  4H2Q A;  4GCM A;  4H4X A;  2GV8 A;  4H7U A;  2Q0K A;  3C4A A;  2X50 A;  5EB4 A;  4EQX A;  3BNU A;  2GR3 A;  2BYB A;  4H4Z A;  3V3O A;  5IQ4 A;  5KOW A;  1ZMD A;  3CGD A;  1Q1R A;  3AEE A;  5EOW A;  2VQ7 A;  1Z6L A;  1ZY8 A;  1S3E A;  4GR1 A;  3UTF A;  3AED A;  2CVJ A;  3B6D A;  4O5Q A;  2BS3 A;  2YLW A;  1DOE A;  3VRA A;  3NK1 X;  3UKP A;  4NTC A;  2GQW A;  2YLX A;  4X9M A;  3D8X A;  1X31 B;  4B64 A;  5GSN A;  1BWC A;  4BK1 A;  2F5Z A;  1PJ7 A;  4H4V A;  3ICR A;  4LII A;  3GWF A;  3GMB A;  2WP9 A;  2YLT A;  2WES A;  2BC0 A;  2YLS A;  5KOX A;  1QLB A;  1GRH A;  5GRT A;  2FJE A;  2NVK X;  3AB1 A;  1BF3 A;  4H4T A;  1LQU A;  3AEF A;  1MO9 A;  4GDE A;  4YXD A;  3AE8 A;  2GR0 A;  1NAA A;  3H8I A;  1Y56 A;  1REO A;  1S2Y A;  3AEG A;  3FBS A;  1GAL A;  2GAG B;  2C64 A;  3NRN A;  3QFB A;  3SGL A;  2BC1 A;  3UTE A;  5JCI A;  4OPT A;  1PBD A;  4OPI A;  1PDH A;  1KDG A;  4NTE A;  3G5Q A;  4CCQ A;  2YLR A;  4B66 A;  1GND A;  4CY6 A;  2X8H A;  3GYI A;  3JSK A;  2YM1 A;  1YY5 A;  1O94 A;  1EL7 A;  4OPC A;  1JU2 A;  4J34 A;  3DGZ A;  4YTM A;  3CPH G;  2WPE A;  3F8D A;  2E1M A;  1DJQ A;  1GTE A;  1YQZ A;  2Q6U A;  2RGO A;  2X8C A;  4JDR A;  4USR A;  1ELI A;  5HYM A;  4EIP A;  1NHS A;  1PXA A;  2YG4 A;  3CGC A;  3RP6 A;  3LZW A;  3KLJ A;  3G5S A;  2OAM A;  4ZN0 A;  5C2T A;  3NN0 X;  1CL0 A;  2OA1 A;  4J36 A;  3NGC X;  4U8L A;  4D04 A;  3M13 A;  4ECH A;  1QO8 A;  1CC4 A;  3P9U A;  3UP4 A;  2J3N A;  3NHO X;  5IPY A;  5JCM A;  2IVE A;  2E4G A;  2W0H A;  3LOV A;  3QSM A;  4J31 A;  5JCN A;  1K0L A;  2XFO A;  5J60 A;  5U25 A;  2APG A;  1RP0 A;  2C65 A;  3FMW A;  3KPF A;  1NEK A;  4U8K A;  4RG3 A;  3EAO A;  1TYT A;  2XVF A;  1E1L A;  1LVL A;  2DKH A;  1HYU A;  1JNR A;  4K5S A;  1F8W A;  5HHF A;  1DOD A;  3QSS A;  4B63 A;  3I3L A;  4YSZ A;  3BI2 A;  1ZOV A;  4CBQ A;  3QSE A;  4UDQ A;  4DGK A;  4U8J A;  5FS6 A;  2B7S A;  4Z2U A;  4Z26 A;  3DK8 A;  2H89 A;  3CNS A;  3P4S A;  3FIM B;  3UKK A;  3EPT A;  2GH5 A;  2WOV A;  3URH A;  2V6O A;  1GET A;  3DK4 A;  3CGE A;  2JAE A;  4N9X A;  4NEV A;  4UP3 A;  3M12 A;  3DA1 A;  3PO7 A;  2VVL G;  2RGJ A;  4JNA A;  3UTG A;  3AEB A;  5DBJ A;  1L9E A;  1RSG A;  3QVP A;  3LB8 A;  1KSS A;  2EQ9 A;  2GAH B;  2PHH A;  4OCG A;  1YQ3 A;  4M52 A;  4CNJ A;  4NTD A;  4ZCD A;  3T37 A;  2ACZ A;  2BXR A;  1E39 A;  2BS2 A;  4A9W A;  3AEC A;  5BVA A;  3KU9 A;  2XLR A;  4A6N A;  2EQ6 A;  1BKW A;  4RG4 A;  5IQ1 A;  1MOK A;  2NPX A;  1DJN A;  1EL9 A;  2B7R A;  2XLS A;  3P1W A;  4WCT A;  3S61 A;  3E1T A;  4JNQ A;  1ZP0 A;  2B9W A;  1GES A;  3BNM A;  3VRD B;  1VRQ B;  4U8O A;  4C74 A;  1GRB A;  3CND A;  3UOV A;  3HZL A;  2GF3 A;  3L1R A;  1PHH A;  3NH3 X;  4FK1 A;  1TRB A;  4B1B A;  2WOW A;  5KRQ A;  4YSY A;  3GMC A;  1QJD A;  2VRM A;  3AEA A;  4EQR A;  1NHR A;  1F6M A;  4CY8 A;  1NHP A;  4A79 A;  5ER0 A;  3IHM A;  3K7T A;  3SFE A;  3II4 A;  1KFY A;  3GD4 A;  1IUS A;  4K22 A;  4RSL A;  2CFY A;  2R4J A;  3H4K A;  3AD7 B;  2C3D A;  1GRA A;  4CCR A;  4K8D A;  2XVI A;  1OJD A;  2OLO A;  1IUX A;  1NG3 A;  3ZDN A;  5KXJ A;  3FG2 P;  5KWF A;  1NG4 A;  1TYP A;  1D4E A;  4ZCC A;  4DNA A;  3ABV A;  1VQW A;  1JOA A;  3UKF A;  3DME A;  3ALJ A;  3K7Q X;  1N4V A;  1B37 A;  1CHU A;  2FJB A;  2BXS A;  3O0H A;  4IVO B;  2ZBW A;  1NHQ A;  3AE9 A;  2WPF A;  4IV9 A;  2YLZ A;  1VG9 A;  3AE5 A;  2WHD A;  2WOI A;  4H4R A;  1M6I A;  4AT2 A;  1GEU A;  3IHG A;  3RNM A;  1H7W A;  4LU6 A;  1B8S A;  3DJD A;  2YG7 A;  5BUK A;  4Z44 A;  4ICY A;  3OC4 A;  3Q9T A;  4YSX A;  4U2L A;  2VRL A;  2XCG A;  2XLU A;  2VVM A;  4BJZ A;  5M10 A;  1OJA A;  2JB2 A;  2WP6 A;  4K5R A;  3RED A;  3SFD A;  1D4D A;  2QCU A;  3UOY A;  3NN6 X;  4TM0 A;  3ZYX A;  4A6N B;  1LV0 A;  3GD3 A;  1E6E A;  4BUR A;  4TLZ A;  2YR4 A;  4NEW A;  3IWA A;  3BHK A;  4J2W A;  2HQM A;  4CRT A;  2Q7V A;  3OZ2 A;  2IVD A;  4USQ A;  2WEU A;  4YSH A;  3UKL A;  1E1K A;  2YQU A;  1GV4 A;  1ZOY A;  4J33 A;  1XAN A;  2C72 A;  4APN A;  3CPI G;  2WDQ A;  1E1N A;  2YVJ A;  2VOU A;  1ONF A;  3GYJ A;  3QVR A;  5EB5 A;  1F8S A;  3P4Q A;  4D03 A;  2C7G A;  1DOC A;  4DSG A;  3NYC A;  4REK A;  4U8M A;  4BV6 A;  3DH9 A;  2JB1 A;  4I58 A;  1JEH A;  4OPL A;  3CNP A;  2Q0L A;  2XYO A;  3GRS A;  5BRT A;  1EBD A;  1PBC A;  4HB9 A;  3CTY A;  2AR8 A;  3AE4 A;  4GUV A;  3UP5 A;  1FCD A;  1CJ4 A;  2XVE A;  4FX9 A;  2A87 A;  5U1O A;  3S5W A;  3VR8 A;  3WE0 A;  3SQP A;  1FL2 A;  1E1M A;  2BAC A;  2AAQ A;  3DK9 A;  1GXF A;  1O5W A;  2B9Y A;  2DKI A;  2WDV A;  3GDP A;  3QJ4 A;  2V5Z A;  4H4Y A;  4JQ9 A;  2BK5 A;  4EQS A;  1ZK7 A;  4IA5 A;  4Z25 A;  3GSI A;  4H4U A;  2V3A A;  1M64 A;  3LXD A;  4C3X A;  4C3Y A;  4A7A A;  1XPQ A;  1H83 A;  2PYX A;  4UDR A;  3CPJ G;  3AYI A;  4J57 A;  4J56 A;  1IJH A;  1CJC A;  5FS8 A;  2RGH A;  2YG6 A;  3AE3 A;  1BGN A;  3K7M X;  1H84 A;  2TMD A; 
#chains in the Genus database with same CATH topology
 2C76 A;  5U63 A;  2B9X A;  3AD8 B;  1N4W A;  3I6D A;  5JCL A;  2GEW A;  3DJE A;  4U8P A;  4E0V A;  2FJD A;  4B68 A;  2R9Z A;  1COY A;  4AOS A;  2BCG G;  2GRT A;  2VVL A;  4EQW A;  3C96 A;  2Z5X A;  2JB3 A;  3KKJ A;  3QFA A;  3UOZ A;  1KF6 A;  4YWO A;  2XLT A;  3UTH A;  1GPE A;  2EQ7 A;  2R46 A;  4DSH A;  1TDF A;  2R45 A;  2C73 A;  3KA7 A;  2A89 A;  4JN9 A;  1KNR A;  4BK2 A;  2JBV A;  3IF9 A;  1XDI A;  2A8X A;  1IUV A;  1GT8 A;  1DOB A;  3LZX A;  1TDE A;  2BK3 A;  1LPF A;  2C70 A;  3EF6 A;  4X9N A;  2XVH A;  2RAB A;  2WP5 A;  5HXI A;  1PXC A;  2V3B A;  2R0C A;  1DXL A;  4IVM B;  5JCK A;  2O9Z A;  4G6H A;  1BGJ A;  1F3P A;  3ATQ A;  2WPC A;  1PS9 A;  4Z43 A;  3NYF A;  1JNZ A;  2ZZC A;  4IA6 A;  3C4N A;  1IUU A;  2GB0 A;  2XFU A;  2IID A;  1GRT A;  2GR2 A;  2X8G A;  3KD9 A;  1GSN A;  1N1P A;  3ISH A;  2QA2 A;  3F8P A;  3SZF A;  4Y4L A;  4TLX A;  2YM2 A;  3AE6 A;  1L9D A;  4CNK A;  4XXG A;  4U8N A;  2C3C A;  2V60 A;  3DGH A;  3KVE A;  1JRZ A;  4Y4N A;  4GF7 A;  1NPX A;  1CJ3 A;  2YG5 A;  3AD9 B;  4B65 A;  4U8I A;  4OPG A;  3UOX A;  1GER A;  4YT0 A;  1FEC A;  1TDK A;  4A65 A;  1H86 A;  1DNC A;  4FDC B;  2JKC A;  4JY2 A;  4OPD A;  1OJ9 A;  1YKJ A;  4G74 A;  3ALM A;  3NTD A;  2YG3 A;  2OAL A;  1VG0 A;  2H88 A;  2XFN A;  1GRF A;  2C75 A;  2C66 A;  2GMH A;  3M0O A;  2OLN A;  1CJ2 A;  4Z2T A;  4JY3 A;  2BRA A;  4C77 A;  4YKF A;  3HYW A;  1PBB A;  3P4R A;  2BS4 A;  1VDC A;  4EM3 A;  3T2Z A;  1L9C A;  1NDA A;  3SM8 A;  2X99 A;  1OJC A;  1PN0 A;  5FS7 A;  1L0V A;  3NK0 X;  5KVI A;  4Y4M A;  3BHF A;  2YWL A;  1D7Y A;  4H4P A;  4U2T A;  4O5U A;  5KVH A;  1GRG A;  4AP1 A;  3CNJ A;  2GVC A;  4AOX A;  3DJJ A;  1H6V A;  3CN8 A;  4AP3 A;  1PBF A;  1H81 A;  3NIX A;  2WET A;  3NTA A;  3ITJ A;  3V3N A;  4OPU A;  4EM4 A;  1FEA A;  1F8R A;  1Q9I A;  1KNP A;  3GWD A;  3NG7 X;  3AE1 A;  4H50 A;  5KMR A;  3L8K A;  2AQJ A;  5FS9 A;  2BRY A;  1IUW A;  2VZ2 A;  2ZZB A;  3B3R A;  3PVC A;  2XLP A;  3V76 A;  4YTN A;  1FEB A;  1GRE A;  2JK6 A;  3AXB A;  3GDN A;  5M0Z A;  2GQF A;  1PXB A;  2Z5Y A;  2VQB A;  3GYX A;  4H4S A;  4YTP A;  2X3N A;  4UDP A;  5C3J A;  3Q6J A;  5KMS A;  1K0I A;  5EBK A;  1NEN A;  3LJP A;  4HA6 A;  5KNL A;  5TR3 A;  3D1C A;  2YVF A;  2Y6Q A;  3K30 A;  1UKV G;  2YR5 A;  2QA1 A;  3KPK A;  5CKU A;  3UKA A;  3UCL A;  4AT0 A;  2WDR A;  5CQF A;  1GTH A;  1LTX R;  2BK4 A;  3ATR A;  4XWR A;  3EAN A;  1D4C A;  3BI4 A;  2XFP A;  2B76 A;  1ZKQ A;  2WU5 A;  3LAD A;  2BA9 A;  3ICS A;  2XFQ A;  4KPR A;  4NZH A;  1KSU A;  4A5L A;  1EL8 A;  3DJG X;  2FJA A;  1OJT A;  4U2S A;  1K0J A;  1S3B A;  2R0P A;  1P2H A;  3COX A;  2ARD A;  2QAE A;  1SEZ A;  5HY5 A;  2R4E A;  5BUL A;  1JRX A;  1D7L A;  1EL5 A;  4XWZ A;  1YQ4 A;  5L46 A;  3P4P A;  4H2R A;  4EIQ A;  1TDN A;  4GRT A;  2GMJ A;  3G5R A;  3CIR A;  4A99 A;  3NKS A;  5FMH A;  1B5Q A;  1H7X A;  1S2Q A;  1W4X A;  1ZX9 A;  1Q1W A;  4EMI A;  3VR9 A;  3BI5 A;  4GDP A;  4II3 A;  4PAA A;  3VQR A;  2Y6R A;  5LV9 A;  2R0G A;  3RP8 A;  1TDO A;  4K2X A;  1O95 A;  3AYJ A;  2BAB A;  4BK3 A;  3H8L A;  4BJY A;  1CBO A;  3F8R A;  3RHA A;  1LQT A;  2YAU A;  3NT6 A;  4KX6 A;  2GR1 A;  2UZZ A;  2XVJ A;  3AE2 A;  3SX6 A;  4PAB A;  4EMW A;  1PJ6 A;  1ZMC A;  1Y0P A;  3AE7 A;  3GRT A;  3UKH A;  4Z2R A;  1AOG A;  1N4U A;  2YVG A;  3AWI A;  2I0Z A;  2WQY A;  4H4W A;  4FK1 C;  4ADW A;  2WS3 A;  3ICT A;  2ZZ0 A;  3NK2 X;  4H2P A;  2BCP A;  1BZL A;  1MXT A;  1V59 A;  2C67 A;  3ALL A;  4I59 A;  5KMQ A;  1Y56 B;  1FOH A;  3CGB A;  1CC6 A;  1E7P A;  4TM3 A;  4EMJ A;  3R9U A;  1CC2 A;  4OVI A;  3SYI A;  2TPR A;  3VRB A;  1PJ5 A;  4LA1 A;  2WBA A;  4Z24 A;  4H2N A;  1K4Q A;  4TM4 A;  1JRY A;  1IUT A;  2WU2 A;  3IC9 A;  2E5V A;  3ADA B;  4K7Z A;  3NLC A;  2YR6 A;  3PS9 A;  1XHC A;  3NYE A;  3RP7 A;  2EQ8 A;  2V61 A;  4WX1 A;  4C5O A;  2CUL A;  4P9S A;  3AYL A;  1CF3 A;  1H82 A;  3CNT A;  1D5T A;  1P2E A;  1GOS A;  1PBE A;  4H4Q A;  4MJW A;  5J7X A;  2XDO A;  4B67 A;  4YKG A;  4B69 A;  1B4V A;  3UKQ A;  2CDU A;  1ZDL A;  1LJ1 A;  5HYM A;  2FBW A;  4TM1 A;  4X4J A;  3NNE A;  1RYI A;  3FPZ A;  4H2Q A;  4GCM A;  4H4X A;  2GV8 A;  4H7U A;  2Q0K A;  3C4A A;  2X50 A;  5EB4 A;  4EQX A;  3BNU A;  2GR3 A;  2BYB A;  4H4Z A;  3V3O A;  5IQ4 A;  5KOW A;  1ZMD A;  3CGD A;  1Q1R A;  3AEE A;  5EOW A;  2VQ7 A;  1Z6L A;  1ZY8 A;  1S3E A;  4GR1 A;  3UTF A;  3AED A;  2CVJ A;  3B6D A;  4O5Q A;  2BS3 A;  2YLW A;  1DOE A;  3VRA A;  3NK1 X;  3UKP A;  4NTC A;  2GQW A;  2YLX A;  4X9M A;  3D8X A;  1X31 B;  4B64 A;  5GSN A;  1BWC A;  4BK1 A;  2F5Z A;  1PJ7 A;  4H4V A;  3ICR A;  4LII A;  3GWF A;  3GMB A;  2WP9 A;  2YLT A;  2WES A;  2BC0 A;  2YLS A;  5KOX A;  1QLB A;  1GRH A;  5GRT A;  2FJE A;  2NVK X;  3AB1 A;  1BF3 A;  4H4T A;  1LQU A;  3AEF A;  1MO9 A;  4GDE A;  4YXD A;  3AE8 A;  2GR0 A;  1NAA A;  3H8I A;  1Y56 A;  1REO A;  1S2Y A;  3AEG A;  3FBS A;  1GAL A;  2GAG B;  2C64 A;  3NRN A;  3QFB A;  3SGL A;  2BC1 A;  3UTE A;  5JCI A;  4OPT A;  1PBD A;  4OPI A;  1PDH A;  1KDG A;  4NTE A;  3G5Q A;  4CCQ A;  2YLR A;  4B66 A;  1GND A;  4CY6 A;  2X8H A;  3GYI A;  3JSK A;  2YM1 A;  1YY5 A;  1O94 A;  1EL7 A;  4OPC A;  1JU2 A;  4J34 A;  3DGZ A;  4YTM A;  3CPH G;  2WPE A;  3F8D A;  2E1M A;  1DJQ A;  1GTE A;  1YQZ A;  2Q6U A;  2RGO A;  2X8C A;  4JDR A;  4NWZ A;  1ELI A;  4USR A;  4EIP A;  1NHS A;  1PXA A;  2YG4 A;  3CGC A;  3RP6 A;  3LZW A;  3KLJ A;  3G5S A;  2OAM A;  4ZN0 A;  5C2T A;  3NN0 X;  1CL0 A;  2OA1 A;  4J36 A;  3NGC X;  4U8L A;  4D04 A;  3M13 A;  4ECH A;  1QO8 A;  1CC4 A;  3P9U A;  3UP4 A;  2J3N A;  3NHO X;  5IPY A;  5JCM A;  2IVE A;  2E4G A;  2W0H A;  3LOV A;  3QSM A;  4J31 A;  3SZ0 A;  5KMP A;  5JCN A;  1K0L A;  2XFO A;  5J60 A;  5U25 A;  2APG A;  1RP0 A;  2C65 A;  3FMW A;  3KPF A;  1NEK A;  4U8K A;  4RG3 A;  3EAO A;  1TYT A;  2XVF A;  1E1L A;  1LVL A;  2DKH A;  1HYU A;  1JNR A;  4K5S A;  1F8W A;  5HHF A;  3T14 A;  1DOD A;  3QSS A;  4B63 A;  3I3L A;  4YSZ A;  3BI2 A;  1ZOV A;  4CBQ A;  3QSE A;  4UDQ A;  4DGK A;  4U8J A;  5FS6 A;  2B7S A;  4Z2U A;  4Z26 A;  3DK8 A;  2H89 A;  3CNS A;  3P4S A;  3FIM B;  3UKK A;  3EPT A;  2GH5 A;  2WOV A;  3T31 A;  2V6O A;  3URH A;  1GET A;  3DK4 A;  3CGE A;  2JAE A;  4N9X A;  4II2 A;  4NEV A;  4UP3 A;  3M12 A;  3DA1 A;  3PO7 A;  2VVL G;  2RGJ A;  4JNA A;  3UTG A;  3AEB A;  5DBJ A;  1L9E A;  1RSG A;  2C4C A;  3QVP A;  3LB8 A;  1KSS A;  2EQ9 A;  2GAH B;  2PHH A;  4G73 A;  3T0K A;  4OCG A;  1YQ3 A;  4M52 A;  4CNJ A;  4NTD A;  4G6G A;  4ZCD A;  3T37 A;  2ACZ A;  2BXR A;  1E39 A;  2BS2 A;  4A9W A;  3AEC A;  5BVA A;  3KU9 A;  2XLR A;  4A6N A;  2EQ6 A;  4G9K A;  1BKW A;  4RG4 A;  5IQ1 A;  1MOK A;  2NPX A;  1DJN A;  1EL9 A;  2B7R A;  2XLS A;  3P1W A;  4WCT A;  3S61 A;  3E1T A;  4JNQ A;  1ZP0 A;  2B9W A;  1GES A;  3BNM A;  3VRD B;  1VRQ B;  4U8O A;  4C74 A;  1GRB A;  3CND A;  3UOV A;  3HZL A;  2GF3 A;  3L1R A;  1PHH A;  3NH3 X;  4FK1 A;  1TRB A;  3HYX A;  4B1B A;  2WOW A;  5KRQ A;  4YSY A;  3GMC A;  4GAP A;  1QJD A;  2VRM A;  3AEA A;  4EQR A;  1NHR A;  1F6M A;  4CY8 A;  1NHP A;  4A79 A;  5ER0 A;  3CMM A;  3IHM A;  3K7T A;  3SFE A;  3SY4 A;  3II4 A;  1KFY A;  3GD4 A;  1IUS A;  4K22 A;  4RSL A;  2CFY A;  2R4J A;  3H4K A;  3AD7 B;  2C3D A;  1GRA A;  4CCR A;  3T2Y A;  4K8D A;  2XVI A;  1OJD A;  2OLO A;  1IUX A;  1NG3 A;  3ZDN A;  5KXJ A;  3T2K A;  3FG2 P;  5KWF A;  1NG4 A;  1TYP A;  1D4E A;  4ZCC A;  4DNA A;  3ABV A;  1VQW A;  1JOA A;  3UKF A;  3DME A;  3ALJ A;  3K7Q X;  1N4V A;  1B37 A;  1CHU A;  2FJB A;  2BXS A;  3O0H A;  4IVO B;  2ZBW A;  1NHQ A;  3SXI A;  3AE9 A;  3SZW A;  2WPF A;  4IV9 A;  2YLZ A;  1VG9 A;  3AE5 A;  2WHD A;  2WOI A;  4H4R A;  1M6I A;  4GAV A;  4AT2 A;  1GEU A;  3IHG A;  3RNM A;  1H7W A;  4LU6 A;  1B8S A;  3DJD A;  2YG7 A;  5BUK A;  4Z44 A;  4ICY A;  3OC4 A;  3Q9T A;  4YSX A;  4U2L A;  2VRL A;  2XCG A;  2XLU A;  2VVM A;  4BJZ A;  5M10 A;  1OJA A;  2JB2 A;  2WP6 A;  4K5R A;  3RED A;  3SFD A;  1D4D A;  2QCU A;  3UOY A;  3NN6 X;  4TM0 A;  3ZYX A;  4A6N B;  1LV0 A;  3GD3 A;  1E6E A;  4BUR A;  4NNJ A;  4TLZ A;  2YR4 A;  4NEW A;  3IWA A;  3BHK A;  4J2W A;  2HQM A;  4CRT A;  2Q7V A;  3OZ2 A;  2IVD A;  4USQ A;  2WEU A;  4YSH A;  3UKL A;  1E1K A;  2YQU A;  1GV4 A;  1ZOY A;  4J33 A;  1XAN A;  2C72 A;  4APN A;  3CPI G;  2WDQ A;  1E1N A;  2YVJ A;  2VOU A;  1ONF A;  3GYJ A;  3QVR A;  5EB5 A;  1F8S A;  3P4Q A;  4D03 A;  2C7G A;  1DOC A;  4DSG A;  3NYC A;  4REK A;  4U8M A;  4BV6 A;  3DH9 A;  2JB1 A;  4I58 A;  1JEH A;  4OPL A;  3CNP A;  2Q0L A;  2XYO A;  3GRS A;  5BRT A;  1EBD A;  3HYV A;  1PBC A;  4HB9 A;  3CTY A;  2AR8 A;  3AE4 A;  4GUV A;  3UP5 A;  1FCD A;  1CJ4 A;  2XVE A;  4FX9 A;  2A87 A;  5U1O A;  3S5W A;  3SZC A;  3VR8 A;  3WE0 A;  3SQP A;  1FL2 A;  1E1M A;  2BAC A;  2AAQ A;  3DK9 A;  1GXF A;  1O5W A;  2B9Y A;  2DKI A;  2WDV A;  3GDP A;  3QJ4 A;  2V5Z A;  4H4Y A;  4JQ9 A;  2BK5 A;  4EQS A;  1ZK7 A;  4IA5 A;  4Z25 A;  3GSI A;  4H4U A;  2V3A A;  1M64 A;  3LXD A;  4C3X A;  4C3Y A;  4A7A A;  1XPQ A;  1H83 A;  2PYX A;  4UDR A;  3CPJ G;  3AYI A;  4J57 A;  4J56 A;  1IJH A;  1CJC A;  5FS8 A;  2RGH A;  2YG6 A;  3AE3 A;  1BGN A;  3K7M X;  1H84 A;  2TMD A; 
#chains in the Genus database with same CATH homology
 2C76 A;  5U63 A;  2B9X A;  3AD8 B;  1N4W A;  3I6D A;  5JCL A;  2GEW A;  3DJE A;  4U8P A;  4E0V A;  2FJD A;  4B68 A;  2R9Z A;  1COY A;  4AOS A;  2BCG G;  2GRT A;  2VVL A;  4EQW A;  3C96 A;  2Z5X A;  2JB3 A;  3KKJ A;  3QFA A;  3UOZ A;  1KF6 A;  4YWO A;  2XLT A;  3UTH A;  1GPE A;  2EQ7 A;  2R46 A;  4DSH A;  1TDF A;  2R45 A;  2C73 A;  3KA7 A;  2A89 A;  4JN9 A;  1KNR A;  4BK2 A;  2JBV A;  3IF9 A;  1XDI A;  2A8X A;  1IUV A;  1GT8 A;  1DOB A;  3LZX A;  1TDE A;  2BK3 A;  1LPF A;  2C70 A;  3EF6 A;  4X9N A;  2XVH A;  2RAB A;  2WP5 A;  5HXI A;  1PXC A;  2V3B A;  2R0C A;  1DXL A;  4IVM B;  5JCK A;  2O9Z A;  4G6H A;  1BGJ A;  1F3P A;  3ATQ A;  2WPC A;  1PS9 A;  4Z43 A;  3NYF A;  1JNZ A;  2ZZC A;  4IA6 A;  3C4N A;  1IUU A;  2GB0 A;  2XFU A;  2IID A;  1GRT A;  2GR2 A;  2X8G A;  3KD9 A;  1GSN A;  1N1P A;  3ISH A;  2QA2 A;  3F8P A;  3SZF A;  4Y4L A;  4TLX A;  2YM2 A;  3AE6 A;  1L9D A;  4CNK A;  4XXG A;  4U8N A;  2C3C A;  2V60 A;  3DGH A;  3KVE A;  1JRZ A;  4Y4N A;  4GF7 A;  1NPX A;  1CJ3 A;  2YG5 A;  3AD9 B;  4B65 A;  4U8I A;  4OPG A;  3UOX A;  1GER A;  4YT0 A;  1FEC A;  1TDK A;  4A65 A;  1H86 A;  1DNC A;  4FDC B;  2JKC A;  4JY2 A;  4OPD A;  1OJ9 A;  1YKJ A;  4G74 A;  3ALM A;  3NTD A;  2YG3 A;  2OAL A;  1VG0 A;  2H88 A;  2XFN A;  1GRF A;  2C75 A;  2C66 A;  2GMH A;  3M0O A;  2OLN A;  1CJ2 A;  4Z2T A;  4JY3 A;  2BRA A;  4C77 A;  4YKF A;  3HYW A;  1PBB A;  3P4R A;  2BS4 A;  1VDC A;  4EM3 A;  3T2Z A;  1L9C A;  1NDA A;  3SM8 A;  2X99 A;  1OJC A;  1PN0 A;  5FS7 A;  1L0V A;  3NK0 X;  5KVI A;  4Y4M A;  3BHF A;  2YWL A;  1D7Y A;  4H4P A;  4U2T A;  4O5U A;  5KVH A;  1GRG A;  4AP1 A;  3CNJ A;  2GVC A;  4AOX A;  3DJJ A;  1H6V A;  3CN8 A;  4AP3 A;  1PBF A;  1H81 A;  3NIX A;  2WET A;  3NTA A;  3ITJ A;  3V3N A;  4OPU A;  4EM4 A;  1FEA A;  1F8R A;  1Q9I A;  1KNP A;  3GWD A;  3NG7 X;  3AE1 A;  4H50 A;  5KMR A;  3L8K A;  2AQJ A;  5FS9 A;  2BRY A;  1IUW A;  2VZ2 A;  2ZZB A;  3B3R A;  3PVC A;  2XLP A;  3V76 A;  4YTN A;  1FEB A;  1GRE A;  2JK6 A;  3AXB A;  3GDN A;  5M0Z A;  2GQF A;  1PXB A;  2Z5Y A;  2VQB A;  3GYX A;  4H4S A;  4YTP A;  2X3N A;  4UDP A;  5C3J A;  3Q6J A;  5KMS A;  1K0I A;  5EBK A;  1NEN A;  3LJP A;  4HA6 A;  5KNL A;  5TR3 A;  3D1C A;  2YVF A;  2Y6Q A;  3K30 A;  1UKV G;  2YR5 A;  2QA1 A;  3KPK A;  5CKU A;  3UKA A;  3UCL A;  4AT0 A;  2WDR A;  5CQF A;  1GTH A;  1LTX R;  2BK4 A;  3ATR A;  4XWR A;  3EAN A;  1D4C A;  3BI4 A;  2XFP A;  2B76 A;  1ZKQ A;  2WU5 A;  3LAD A;  2BA9 A;  3ICS A;  2XFQ A;  4KPR A;  4NZH A;  1KSU A;  4A5L A;  1EL8 A;  3DJG X;  2FJA A;  1OJT A;  4U2S A;  1K0J A;  1S3B A;  2R0P A;  1P2H A;  3COX A;  2ARD A;  2QAE A;  1SEZ A;  5HY5 A;  2R4E A;  5BUL A;  1JRX A;  1D7L A;  1EL5 A;  4XWZ A;  1YQ4 A;  5L46 A;  3P4P A;  4H2R A;  4EIQ A;  1TDN A;  4GRT A;  2GMJ A;  3G5R A;  3CIR A;  4A99 A;  3NKS A;  5FMH A;  1B5Q A;  1H7X A;  1S2Q A;  1W4X A;  1ZX9 A;  1Q1W A;  4EMI A;  3VR9 A;  3BI5 A;  4GDP A;  4II3 A;  4PAA A;  3VQR A;  2Y6R A;  5LV9 A;  2R0G A;  3RP8 A;  1TDO A;  4K2X A;  1O95 A;  3AYJ A;  2BAB A;  4BK3 A;  3H8L A;  4BJY A;  1CBO A;  3F8R A;  3RHA A;  1LQT A;  2YAU A;  3NT6 A;  4KX6 A;  2GR1 A;  2UZZ A;  2XVJ A;  3AE2 A;  3SX6 A;  4PAB A;  4EMW A;  1PJ6 A;  1ZMC A;  1Y0P A;  3AE7 A;  3GRT A;  3UKH A;  4Z2R A;  1AOG A;  1N4U A;  2YVG A;  3AWI A;  2I0Z A;  2WQY A;  4H4W A;  4FK1 C;  4ADW A;  2WS3 A;  3ICT A;  2ZZ0 A;  3NK2 X;  4H2P A;  2BCP A;  1BZL A;  1MXT A;  1V59 A;  2C67 A;  3ALL A;  4I59 A;  5KMQ A;  1Y56 B;  1FOH A;  3CGB A;  1CC6 A;  1E7P A;  4TM3 A;  4EMJ A;  3R9U A;  1CC2 A;  4OVI A;  3SYI A;  2TPR A;  3VRB A;  1PJ5 A;  4LA1 A;  2WBA A;  4Z24 A;  4H2N A;  1K4Q A;  4TM4 A;  1JRY A;  1IUT A;  2WU2 A;  3IC9 A;  2E5V A;  3ADA B;  4K7Z A;  3NLC A;  2YR6 A;  3PS9 A;  1XHC A;  3NYE A;  3RP7 A;  2EQ8 A;  2V61 A;  4WX1 A;  4C5O A;  2CUL A;  4P9S A;  3AYL A;  1CF3 A;  1H82 A;  3CNT A;  1D5T A;  1P2E A;  1GOS A;  1PBE A;  4H4Q A;  4MJW A;  5J7X A;  2XDO A;  4B67 A;  4YKG A;  4B69 A;  1B4V A;  3UKQ A;  2CDU A;  1ZDL A;  1LJ1 A;  5HYM A;  2FBW A;  4TM1 A;  4X4J A;  3NNE A;  1RYI A;  3FPZ A;  4H2Q A;  4GCM A;  4H4X A;  2GV8 A;  4H7U A;  2Q0K A;  3C4A A;  2X50 A;  5EB4 A;  4EQX A;  3BNU A;  2GR3 A;  2BYB A;  4H4Z A;  3V3O A;  5IQ4 A;  5KOW A;  1ZMD A;  3CGD A;  1Q1R A;  3AEE A;  5EOW A;  2VQ7 A;  1Z6L A;  1ZY8 A;  1S3E A;  4GR1 A;  3UTF A;  3AED A;  2CVJ A;  3B6D A;  4O5Q A;  2BS3 A;  2YLW A;  1DOE A;  3VRA A;  3NK1 X;  3UKP A;  4NTC A;  2GQW A;  2YLX A;  4X9M A;  3D8X A;  1X31 B;  4B64 A;  5GSN A;  1BWC A;  4BK1 A;  2F5Z A;  1PJ7 A;  4H4V A;  3ICR A;  4LII A;  3GWF A;  3GMB A;  2WP9 A;  2YLT A;  2WES A;  2BC0 A;  2YLS A;  5KOX A;  1QLB A;  1GRH A;  5GRT A;  2FJE A;  2NVK X;  3AB1 A;  1BF3 A;  4H4T A;  1LQU A;  3AEF A;  1MO9 A;  4GDE A;  4YXD A;  3AE8 A;  2GR0 A;  1NAA A;  3H8I A;  1Y56 A;  1REO A;  1S2Y A;  3AEG A;  3FBS A;  1GAL A;  2GAG B;  2C64 A;  3NRN A;  3QFB A;  3SGL A;  2BC1 A;  3UTE A;  5JCI A;  4OPT A;  1PBD A;  4OPI A;  1PDH A;  1KDG A;  4NTE A;  3G5Q A;  4CCQ A;  2YLR A;  4B66 A;  1GND A;  4CY6 A;  2X8H A;  3GYI A;  3JSK A;  2YM1 A;  1YY5 A;  1O94 A;  1EL7 A;  4OPC A;  1JU2 A;  4J34 A;  3DGZ A;  4YTM A;  3CPH G;  2WPE A;  3F8D A;  2E1M A;  1DJQ A;  1GTE A;  1YQZ A;  2Q6U A;  2RGO A;  2X8C A;  4JDR A;  4NWZ A;  1ELI A;  4USR A;  4EIP A;  1NHS A;  1PXA A;  2YG4 A;  3CGC A;  3RP6 A;  3LZW A;  3KLJ A;  3G5S A;  2OAM A;  4ZN0 A;  5C2T A;  3NN0 X;  1CL0 A;  2OA1 A;  4J36 A;  3NGC X;  4U8L A;  4D04 A;  3M13 A;  4ECH A;  1QO8 A;  1CC4 A;  3P9U A;  3UP4 A;  2J3N A;  3NHO X;  5IPY A;  5JCM A;  2IVE A;  2E4G A;  2W0H A;  3LOV A;  3QSM A;  4J31 A;  3SZ0 A;  5KMP A;  5JCN A;  1K0L A;  2XFO A;  5J60 A;  5U25 A;  2APG A;  1RP0 A;  2C65 A;  3FMW A;  3KPF A;  1NEK A;  4U8K A;  4RG3 A;  3EAO A;  1TYT A;  2XVF A;  1E1L A;  1LVL A;  2DKH A;  1HYU A;  1JNR A;  4K5S A;  1F8W A;  5HHF A;  3T14 A;  1DOD A;  3QSS A;  4B63 A;  3I3L A;  4YSZ A;  3BI2 A;  1ZOV A;  4CBQ A;  3QSE A;  4UDQ A;  4DGK A;  4U8J A;  5FS6 A;  2B7S A;  4Z2U A;  4Z26 A;  3DK8 A;  2H89 A;  3CNS A;  3P4S A;  3FIM B;  3UKK A;  3EPT A;  2GH5 A;  2WOV A;  3T31 A;  2V6O A;  3URH A;  1GET A;  3DK4 A;  3CGE A;  2JAE A;  4N9X A;  4II2 A;  4NEV A;  4UP3 A;  3M12 A;  3DA1 A;  3PO7 A;  2VVL G;  2RGJ A;  4JNA A;  3UTG A;  3AEB A;  5DBJ A;  1L9E A;  1RSG A;  2C4C A;  3QVP A;  3LB8 A;  1KSS A;  2EQ9 A;  2GAH B;  2PHH A;  4G73 A;  3T0K A;  4OCG A;  1YQ3 A;  4M52 A;  4CNJ A;  4NTD A;  4G6G A;  4ZCD A;  3T37 A;  2ACZ A;  2BXR A;  1E39 A;  2BS2 A;  4A9W A;  3AEC A;  5BVA A;  3KU9 A;  2XLR A;  4A6N A;  2EQ6 A;  4G9K A;  1BKW A;  4RG4 A;  5IQ1 A;  1MOK A;  2NPX A;  1DJN A;  1EL9 A;  2B7R A;  2XLS A;  3P1W A;  4WCT A;  3S61 A;  3E1T A;  4JNQ A;  1ZP0 A;  2B9W A;  1GES A;  3BNM A;  3VRD B;  1VRQ B;  4U8O A;  4C74 A;  1GRB A;  3CND A;  3UOV A;  3HZL A;  2GF3 A;  3L1R A;  1PHH A;  3NH3 X;  4FK1 A;  1TRB A;  3HYX A;  4B1B A;  2WOW A;  5KRQ A;  4YSY A;  3GMC A;  4GAP A;  1QJD A;  2VRM A;  3AEA A;  4EQR A;  1NHR A;  1F6M A;  4CY8 A;  1NHP A;  4A79 A;  5ER0 A;  3CMM A;  3IHM A;  3K7T A;  3SFE A;  3SY4 A;  3II4 A;  1KFY A;  3GD4 A;  1IUS A;  4K22 A;  4RSL A;  2CFY A;  2R4J A;  3H4K A;  3AD7 B;  2C3D A;  1GRA A;  4CCR A;  3T2Y A;  4K8D A;  2XVI A;  1OJD A;  2OLO A;  1IUX A;  1NG3 A;  3ZDN A;  5KXJ A;  3T2K A;  3FG2 P;  5KWF A;  1NG4 A;  1TYP A;  1D4E A;  4ZCC A;  4DNA A;  3ABV A;  1VQW A;  1JOA A;  3UKF A;  3DME A;  3ALJ A;  3K7Q X;  1N4V A;  1B37 A;  1CHU A;  2FJB A;  2BXS A;  3O0H A;  4IVO B;  2ZBW A;  1NHQ A;  3SXI A;  3AE9 A;  3SZW A;  2WPF A;  4IV9 A;  2YLZ A;  1VG9 A;  3AE5 A;  2WHD A;  2WOI A;  4H4R A;  1M6I A;  4GAV A;  4AT2 A;  1GEU A;  3IHG A;  3RNM A;  1H7W A;  4LU6 A;  1B8S A;  3DJD A;  2YG7 A;  5BUK A;  4Z44 A;  4ICY A;  3OC4 A;  3Q9T A;  4YSX A;  4U2L A;  2VRL A;  2XCG A;  2XLU A;  2VVM A;  4BJZ A;  5M10 A;  1OJA A;  2JB2 A;  2WP6 A;  4K5R A;  3RED A;  3SFD A;  1D4D A;  2QCU A;  3UOY A;  3NN6 X;  4TM0 A;  3ZYX A;  4A6N B;  1LV0 A;  3GD3 A;  1E6E A;  4BUR A;  4NNJ A;  4TLZ A;  2YR4 A;  4NEW A;  3IWA A;  3BHK A;  4J2W A;  2HQM A;  4CRT A;  2Q7V A;  3OZ2 A;  2IVD A;  4USQ A;  2WEU A;  4YSH A;  3UKL A;  1E1K A;  2YQU A;  1GV4 A;  1ZOY A;  4J33 A;  1XAN A;  2C72 A;  4APN A;  3CPI G;  2WDQ A;  1E1N A;  2YVJ A;  2VOU A;  1ONF A;  3GYJ A;  3QVR A;  5EB5 A;  1F8S A;  3P4Q A;  4D03 A;  2C7G A;  1DOC A;  4DSG A;  3NYC A;  4REK A;  4U8M A;  4BV6 A;  3DH9 A;  2JB1 A;  4I58 A;  1JEH A;  4OPL A;  3CNP A;  2Q0L A;  2XYO A;  3GRS A;  5BRT A;  1EBD A;  3HYV A;  1PBC A;  4HB9 A;  3CTY A;  2AR8 A;  3AE4 A;  4GUV A;  3UP5 A;  1FCD A;  1CJ4 A;  2XVE A;  4FX9 A;  2A87 A;  5U1O A;  3S5W A;  3SZC A;  3VR8 A;  3WE0 A;  3SQP A;  1FL2 A;  1E1M A;  2BAC A;  2AAQ A;  3DK9 A;  1GXF A;  1O5W A;  2B9Y A;  2DKI A;  2WDV A;  3GDP A;  3QJ4 A;  2V5Z A;  4H4Y A;  4JQ9 A;  2BK5 A;  4EQS A;  1ZK7 A;  4IA5 A;  4Z25 A;  3GSI A;  4H4U A;  2V3A A;  1M64 A;  3LXD A;  4C3X A;  4C3Y A;  4A7A A;  1XPQ A;  1H83 A;  2PYX A;  4UDR A;  3CPJ G;  3AYI A;  4J57 A;  4J56 A;  1IJH A;  1CJC A;  5FS8 A;  2RGH A;  2YG6 A;  3AE3 A;  1BGN A;  3K7M X;  1H84 A;  2TMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...