4G74A

Crystal structure of ndh with quinone
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
478
structure length
471
Chain Sequence
b'GPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 156
structure length 471
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g74A00
3SXIA 5KMPA 3HYVA 3T31A 3T2YA 4G74A 3SY4A 5KMQA 3SZFA 4GAPA 3SZCA 4NWZA 3SYIA 3T0KA 4G6HA 3T2KA 4G9KA 5KMSA 3KPKA 3HYWA 3T14A 3SZWA 5KMRA 4G6GA 3HYXA 4GAVA 4G73A 3T2ZA 3SZ0A 3SX6A
chains in the Genus database with same CATH superfamily
2GRTA 4XWRA 1D7YA 3AE6A 2YR5A 4REKA 1GV4A 1P2HA 2RABA 4CY8A 2DKIA 3ICTA 1PXAA 4Z2RA 1PXBA 2EQ9A 2BS2A 5KMQA 3GSIA 4C5OA 4RSLA 3AEGA 3RHAA 2WU2A 5IQ4A 3NTAA 1JRZA 3H8IA 1VQWA 2C4CA 2XFQA 4AT0A 4EIQA 2GR2A 5C2TA 1NPXA 4H2RA 1GESA 1IUUA 1GREA 2BACA 4P9SA 3OZ2A 4USQA 2Q6UA 4FDCB 1CF3A 3UKAA 2YAUA 4O5QA 3RP6A 3SZ0A 3DJJA 4USRA 3LADA 3T2YA 2JB3A 3UKHA 4JNQA 2ACZA 2BC0A 2W0HA 1PN0A 4K22A 4YSXA 1UKVG 1GT8A 4GAPA 5BVAA 3P4QA 4YSYA 4A79A 1LQUA 3SYIA 3CMMA 1B5QA 2GAGB 2R0PA 1M6IA 1NHRA 2WPFA 5KVHA 1TYPA 3KPFA 4Z24A 4EQXA 1QLBA 2IIDA 5J7XA 1BGNA 3REDA 4IA5A 1V59A 2YQUA 1CC4A 3AE3A 1PJ5A 1TDFA 2R0GA 3GRSA 1CC6A 3KVEA 4UDQA 2XLTA 2JKCA 4I58A 4K2XA 2AAQA 4NTDA 3BI2A 4DSHA 3CPJG 3DK8A 1COYA 4X9NA 4APNA 2XLPA 4IVOB 5JCMA 3M13A 3KA7A 1D7LA 3ICSA 3AEDA 3G5QA 4K5SA 3ALJA 3L8KA 3T31A 4H7UA 1OJAA 3UP5A 2J3NA 4O5UA 1O94A 3IWAA 2XLUA 3PVCA 2NVKX 3Q9TA 1TDEA 3UOZA 2JK6A 4A7AA 1NG3A 3CNPA 1E1NA 1K4QA 3EAOA 3KD9A 5KMSA 2IVEA 3GMBA 2GB0A 2ZBWA 4Z43A 3NH3X 1ONFA 3CGEA 3ATRA 1E7PA 3K30A 4GDEA 4J36A 4YTNA 5BUKA 1D5TA 4H4SA 1EL7A 1GRBA 1ELIA 1KSSA 1EL5A 4KPRA 2OALA 1PJ7A 4YWOA 4OPLA 1TDOA 3OC4A 1S2QA 1KDGA 1BWCA 1N4UA 3EANA 4JDRA 2UZZA 4X4JA 4ZCCA 2ZZBA 3SX6A 3SXIA 4AP1A 3BHKA 2XCGA 2BRYA 1B37A 3AYIA 3C4NA 3QFAA 4EM3A 1ZDLA 3EPTA 4UDRA 2BABA 5JCLA 2YLRA 3KLJA 1TDNA 2QCUA 1SEZA 3P1WA 4BV6A 5M10A 4YKFA 2GV8A 3NYEA 3P9UA 4NNJA 3L1RA 2H89A 1Y56B 1E1KA 2C75A 4U8OA 3PO7A 3C96A 1GXFA 2YR6A 5KRQA 1XANA 2GR1A 5U63A 3ZDNA 4H4UA 1LPFA 4GAVA 1E1LA 1ZOVA 1NG4A 5JCNA 3GWFA 4UDPA 4UP3A 5FS6A 3S5WA 3GYIA 4OVIA 4FK1C 1X31B 1K0LA 3CNDA 3D1CA 2BK3A 3K7MX 4B67A 4EQRA 3FIMB 5JCIA 4C3YA 5HXIA 3P4PA 1OJ9A 2X8GA 1GTEA 2O9ZA 4AT2A 1GRFA 2GMJA 3QVPA 2YG5A 2V61A 4E0VA 2FJAA 4II3A 3ISHA 4OPDA 3NTDA 3M0OA 3AD8B 1GETA 4H2NA 2C64A 1JRYA 1ZK7A 5GRTA 2A89A 3VRAA 4IV9A 2C73A 3VR8A 3ZYXA 4A6NA 4A99A 1N4WA 1MXTA 1ZX9A 4TM4A 2JB1A 3UOYA 5ER0A 2FJBA 1VG0A 4C3XA 2BXRA 2XVFA 2WQYA 3PS9A 4YSHA 2WOVA 4G74A 3QSMA 4C74A 5DBJA 1LJ1A 2VVLG 1L0VA 1E1MA 2X3NA 5EB5A 2JBVA 2V6OA 2C67A 2XDOA 4U8PA 4YKGA 4Z26A 2B7SA 5TR3A 4JY3A 1FEAA 2XYOA 2V60A 5EBKA 1XHCA 1D4DA 3AE1A 1GERA 2YR4A 4OCGA 1DXLA 3K7QX 5KOWA 2VVLA 3NNEA 1GRTA 3AEAA 2DKHA 1IUVA 1GRAA 3SGLA 3VRDB 2Y6RA 3AEEA 1PBBA 1N4VA 3V76A 1VRQB 2GAHB 1IJHA 2Z5YA 3HYVA 3AE5A 3GD3A 2FBWA 1GPEA 3NYCA 2GVCA 4PABA 4CBQA 5KNLA 1JNRA 4CCQA 4B69A 1OJCA 4DSGA 1DODA 5HYMA 3SFDA 4NTCA 3NIXA 2BRAA 1L9DA 1Q1WA 1ZP0A 1Z6LA 2YVJA 3AECA 1ZKQA 1MO9A 1YQ3A 4J2WA 3F8PA 2C70A 4B65A 2R46A 2YWLA 2Q0LA 4FX9A 3SZWA 1EL8A 3LB8A 4K5RA 4EQSA 2C65A 3II4A 4BK1A 2GF3A 2Q7VA 3NKSA 1PJ6A 3IHMA 2BC1A 3NYFA 5BRTA 2XFPA 2VQBA 3LXDA 2XFOA 2XFNA 1XPQA 3AWIA 2R4EA 2XVEA 5CKUA 4EIPA 1NHPA 2RGJA 3GYJA 3DK9A 1FCDA 4M52A 4ZN0A 2V5ZA 4Z25A 4FK1A 5U25A 3VRBA 3SZFA 2CVJA 4JQ9A 3ITJA 1KNPA 2VRMA 4EM4A 1K0JA 2BS3A 4J33A 5FS7A 1TDKA 1H83A 4BJZA 2WDRA 2YLSA 2V3AA 3GMCA 4EMJA 1GTHA 4TM1A 5EB4A 2WOIA 1DOEA 1F6MA 1KSUA 2FJDA 3ATQA 3NG7X 1BGJA 2APGA 2YG3A 1O95A 4H4VA 1YQZA 4Y4NA 4MJWA 4B1BA 3R9UA 1IUWA 1ZMDA 2C3CA 4D03A 4CRTA 5HY5A 3H8LA 2XLSA 1PHHA 2BK5A 2WP6A 4NEVA 2CULA 2TPRA 2H88A 1K0IA 4XXGA 1CC2A 2A87A 2C76A 3SY4A 2BK4A 5KWFA 3AB1A 3DJDA 3DA1A 3NT6A 4ECHA 2F5ZA 2YG7A 4U2TA 5EOWA 1CL0A 4JY2A 1CJ4A 3AE8A 5CQFA 2BS4A 4G9KA 4XWZA 4LIIA 2YLXA 1YY5A 3AEBA 5JCKA 3UTFA 2YLWA 3AE4A 2C66A 3Q6JA 4II2A 2BA9A 1IUXA 1VDCA 2VZ2A 2WHDA 4GDPA 4CY6A 2CDUA 1S2YA 2GR0A 4Z2TA 1H86A 1RYIA 1KNRA 2OA1A 2PHHA 4A9WA 3CTYA 3QFBA 2E4GA 4GUVA 1LQTA 1LV0A 4D04A 1CJ2A 2NPXA 1PS9A 2FJEA 1H7WA 2C3DA 4ZCDA 4TLZA 4HB9A 3FG2P 4ICYA 3EF6A 4BK3A 1CJ3A 3LZWA 4N9XA 1H6VA 3I3LA 3UCLA 3SZCA 3UTGA 3UKQA 1VG9A 2EQ8A 1DJNA 2XVJA 3NGCX 4RG4A 4CNKA 2ZZCA 3KPKA 3URHA 1PBCA 1PBDA 3ALLA 1GOSA 3COXA 4H4XA 3AE9A 1GRGA 3FPZA 5LV9A 4AOXA 1TRBA 1EBDA 2VVMA 2B9YA 3C4AA 3DMEA 4B68A 3IHGA 3AYJA 3HZLA 4K8DA 3GRTA 3UKKA 4GR1A 2E1MA 1NENA 1DJQA 1FL2A 2WPEA 4U8LA 1D4EA 1CHUA 1ZY8A 4OPUA 4Z44A 3UKLA 1W4XA 5C3JA 3QSSA 1PBEA 1KFYA 1H81A 3FMWA 2X8HA 3G5RA 4TLXA 2XVIA 5L46A 2WDQA 4H4QA 3RNMA 2OAMA 4LU6A 1F8SA 3UOVA 3T2KA 1REOA 4RG3A 3NK2X 1LTXR 1GEUA 3CPHG 3HYWA 3SM8A 2VOUA 2C72A 1FEBA 1BKWA 2GR3A 4H50A 3GDNA 1JU2A 3B6DA 5KMRA 3BI5A 4GRTA 3QSEA 3F8DA 4I59A 1BZLA 1GSNA 2YLTA 1CBOA 3P4SA 3UTHA 3ICRA 1DNCA 4EMIA 2AR8A 4BURA 2VRLA 5M0ZA 4ADWA 3AE2A 2ZZ0A 2WS3A 1JRXA 4NZHA 1TYTA 4WX1A 4A6NB 2A8XA 1ZMCA 1GNDA 2X50A 3AXBA 4U8NA 2B7RA 3V3OA 1Q9IA 1Q1RA 5KOXA 3DJGX 5FS9A 1XDIA 2QA2A 3CGDA 2XLRA 4U2SA 4KX6A 3ALMA 4YT0A 2YM1A 3GDPA 4G6HA 4GCMA 2WPCA 3NRNA 4B64A 2WDVA 5KXJA 3UKFA 4JN9A 2TMDA 4WCTA 2ARDA 1DOCA 2RGHA 1F8RA 3DGZA 4J34A 1BF3A 3IF9A 5FMHA 4DGKA 4A65A 2R0CA 1H84A 2R9ZA 1D4CA 4H4YA 4H2QA 3D8XA 1M64A 4EMWA 2B76A 4AOSA 2EQ6A 4G73A 3AYLA 3DGHA 2WP5A 3SQPA 1L9EA 1IUTA 1JEHA 1L9CA 3DK4A 1E39A 1CJCA 2BCPA 4OPIA 3GYXA 4H4TA 3CIRA 2BYBA 4AP3A 3F8RA 3BHFA 2X8CA 2I0ZA 5U1OA 4YTPA 3NK0X 3CNSA 1HYUA 4OPCA 4YTMA 3T14A 3WE0A 1NDAA 2WETA 4K7ZA 1FOHA 4J57A 3LOVA 2OLOA 2R4JA 3CN8A 3DH9A 2WOWA 2QAEA 3QJ4A 4G6GA 2Q0KA 2YG6A 1H7XA 3HYXA 2C7GA 4X9MA 3O0HA 4U8MA 3T2ZA 4H2PA 4Y4LA 2EQ7A 2AQJA 2YVFA 1JOAA 3S61A 3VQRA 5KMPA 2YG4A 3G5SA 1GALA 1PDHA 1S3BA 1YKJA 2HQMA 3I6DA 4DNAA 1P2EA 4YXDA 3LJPA 1O5WA 2WEUA 4OPGA 3BNUA 4BK2A 4YSZA 4J31A 1GRHA 1OJTA 2OLNA 4OPTA 3P4RA 5KVIA 4B66A 3V3NA 3E1TA 1Y56A 2GQWA 1RSGA 3VR9A 4J56A 2V3BA 2JAEA 1Y0PA 3KKJA 4NTEA 3CGCA 3AD7B 1PXCA 3ABVA 3NK1X 3SFEA 2VQ7A 3GWDA 3BI4A 2GQFA 2JB2A 2XFUA 2Z5XA 4A5LA 4CNJA 4BJYA 1ZOYA 4NEWA 3UTEA 4U8KA 3LZXA 1QJDA 2QA1A 3UKPA 1H82A 2E5VA 3DJEA 3M12A 1NEKA 4Y4MA 2R45A 1NHQA 3NHOX 3H4KA 1S3EA 1N1PA 2B9XA 1DOBA 4H4PA 5IQ1A 2GH5A 2WESA 4U2LA 1OJDA 2RGOA 4PAAA 1YQ4A 3JSKA 4U8JA 3T0KA 5FS8A 3QVRA 3CNTA 3AE7A 3KU9A 4IA6A 4B63A 3UOXA 3FBSA 2IVDA 5GSNA 3T37A 2YLZA 3CNJA 4CCRA 3AD9B 2GMHA 4Z2UA 2GEWA 4IVMB 5J60A 1PBFA 2YM2A 1F3PA 2WBAA 5HHFA 3ADAB 2X99A 3IC9A 2XVHA 4H4RA 1QO8A 3RP7A 3GD4A 4EQWA 1IUSA 1JNZA 4C77A 4JNAA 3NN0X 1AOGA 2WP9A 2WU5A 2CFYA 4TM3A 2B9WA 3AEFA 3CGBA 5IPYA 4HA6A 4NWZA 1FECA 3UP4A 1EL9A 5BULA 1MOKA 1NHSA 3NLCA 4GF7A 1E6EA 1NAAA 2BCGG 1B4VA 3B3RA 3K7TA 2BXSA 1RP0A 4LA1A 1LVLA 2YVGA 4H4WA 2Y6QA 1F8WA 3NN6X 1B8SA 4TM0A 3BNMA 3CPIG 4H4ZA 2PYXA 4U8IA 1KF6A 3RP8A
chains in the Genus database with same CATH topology
2GRTA 4XWRA 1D7YA 3AE6A 2YR5A 4REKA 1GV4A 1P2HA 2RABA 4CY8A 2DKIA 3ICTA 1PXAA 4Z2RA 1PXBA 2EQ9A 2BS2A 5KMQA 3GSIA 4C5OA 4RSLA 3AEGA 3RHAA 2WU2A 5IQ4A 3NTAA 1JRZA 3H8IA 1VQWA 2C4CA 2XFQA 4AT0A 4EIQA 2GR2A 5C2TA 1NPXA 4H2RA 1GESA 1IUUA 1GREA 2BACA 4P9SA 3OZ2A 4USQA 2Q6UA 4FDCB 1CF3A 3UKAA 2YAUA 4O5QA 3RP6A 3SZ0A 3DJJA 4USRA 3LADA 3T2YA 2JB3A 3UKHA 4JNQA 2ACZA 2BC0A 2W0HA 1PN0A 4K22A 4YSXA 1UKVG 1GT8A 4GAPA 5BVAA 3P4QA 4YSYA 4A79A 1LQUA 3SYIA 3CMMA 1B5QA 2GAGB 2R0PA 1M6IA 1NHRA 2WPFA 5KVHA 1TYPA 3KPFA 4Z24A 4EQXA 1QLBA 2IIDA 5J7XA 1BGNA 3REDA 4IA5A 1V59A 2YQUA 1CC4A 3AE3A 1PJ5A 1TDFA 2R0GA 3GRSA 1CC6A 3KVEA 4UDQA 2XLTA 2JKCA 4I58A 4K2XA 2AAQA 4NTDA 3BI2A 4DSHA 3CPJG 3DK8A 1COYA 4X9NA 4APNA 2XLPA 4IVOB 5JCMA 3M13A 3KA7A 1D7LA 3ICSA 3AEDA 3G5QA 4K5SA 3ALJA 3L8KA 3T31A 4H7UA 1OJAA 3UP5A 2J3NA 4O5UA 1O94A 3IWAA 2XLUA 3PVCA 2NVKX 3Q9TA 1TDEA 3UOZA 2JK6A 4A7AA 1NG3A 3CNPA 1E1NA 1K4QA 3EAOA 3KD9A 5KMSA 2IVEA 3GMBA 2GB0A 2ZBWA 4Z43A 3NH3X 1ONFA 3CGEA 3ATRA 1E7PA 3K30A 4GDEA 4J36A 4YTNA 5BUKA 1D5TA 4H4SA 1EL7A 1GRBA 1ELIA 1KSSA 1EL5A 4KPRA 2OALA 1PJ7A 4YWOA 4OPLA 1TDOA 3OC4A 1S2QA 1KDGA 1BWCA 1N4UA 3EANA 4JDRA 2UZZA 4X4JA 4ZCCA 2ZZBA 3SX6A 3SXIA 4AP1A 3BHKA 2XCGA 2BRYA 1B37A 3AYIA 3C4NA 3QFAA 4EM3A 1ZDLA 3EPTA 4UDRA 2BABA 5JCLA 2YLRA 3KLJA 1TDNA 2QCUA 1SEZA 3P1WA 4BV6A 5M10A 4YKFA 2GV8A 3NYEA 3P9UA 4NNJA 3L1RA 2H89A 1Y56B 1E1KA 2C75A 4U8OA 3PO7A 3C96A 1GXFA 2YR6A 5KRQA 1XANA 2GR1A 5U63A 3ZDNA 4H4UA 1LPFA 4GAVA 1E1LA 1ZOVA 1NG4A 5JCNA 3GWFA 4UDPA 4UP3A 5FS6A 3S5WA 3GYIA 4OVIA 4FK1C 1X31B 1K0LA 3CNDA 3D1CA 2BK3A 3K7MX 4B67A 4EQRA 3FIMB 5JCIA 4C3YA 5HXIA 3P4PA 1OJ9A 2X8GA 1GTEA 2O9ZA 4AT2A 1GRFA 2GMJA 3QVPA 2YG5A 2V61A 4E0VA 2FJAA 4II3A 3ISHA 4OPDA 3NTDA 3M0OA 3AD8B 1GETA 4H2NA 2C64A 1JRYA 1ZK7A 5GRTA 2A89A 3VRAA 4IV9A 2C73A 3VR8A 3ZYXA 4A6NA 4A99A 1N4WA 1MXTA 1ZX9A 4TM4A 2JB1A 3UOYA 5ER0A 2FJBA 1VG0A 4C3XA 2BXRA 2XVFA 2WQYA 3PS9A 4YSHA 2WOVA 4G74A 3QSMA 4C74A 5DBJA 1LJ1A 2VVLG 1L0VA 1E1MA 2X3NA 5EB5A 2JBVA 2V6OA 2C67A 2XDOA 4U8PA 4YKGA 4Z26A 2B7SA 5TR3A 4JY3A 1FEAA 2XYOA 2V60A 5EBKA 1XHCA 1D4DA 3AE1A 1GERA 2YR4A 4OCGA 1DXLA 3K7QX 5KOWA 2VVLA 3NNEA 1GRTA 3AEAA 2DKHA 1IUVA 1GRAA 3SGLA 3VRDB 2Y6RA 3AEEA 1PBBA 1N4VA 3V76A 1VRQB 2GAHB 1IJHA 2Z5YA 3HYVA 3AE5A 3GD3A 2FBWA 1GPEA 3NYCA 2GVCA 4PABA 4CBQA 5KNLA 1JNRA 4CCQA 4B69A 1OJCA 4DSGA 1DODA 5HYMA 3SFDA 4NTCA 3NIXA 2BRAA 1L9DA 1Q1WA 1ZP0A 1Z6LA 2YVJA 3AECA 1ZKQA 1MO9A 1YQ3A 4J2WA 3F8PA 2C70A 4B65A 2R46A 2YWLA 2Q0LA 4FX9A 3SZWA 1EL8A 3LB8A 4K5RA 4EQSA 2C65A 3II4A 4BK1A 2GF3A 2Q7VA 3NKSA 1PJ6A 3IHMA 2BC1A 3NYFA 5BRTA 2XFPA 2VQBA 3LXDA 2XFOA 2XFNA 1XPQA 3AWIA 2R4EA 2XVEA 5CKUA 4EIPA 1NHPA 2RGJA 3GYJA 3DK9A 1FCDA 4M52A 4ZN0A 2V5ZA 4Z25A 4FK1A 5U25A 3VRBA 3SZFA 2CVJA 4JQ9A 3ITJA 1KNPA 2VRMA 4EM4A 1K0JA 2BS3A 4J33A 5FS7A 1TDKA 1H83A 4BJZA 2WDRA 2YLSA 2V3AA 3GMCA 4EMJA 1GTHA 4TM1A 5EB4A 2WOIA 1DOEA 1F6MA 1KSUA 2FJDA 3ATQA 3NG7X 1BGJA 2APGA 2YG3A 1O95A 4H4VA 1YQZA 4Y4NA 4MJWA 4B1BA 3R9UA 1IUWA 1ZMDA 2C3CA 4D03A 4CRTA 5HY5A 3H8LA 2XLSA 1PHHA 2BK5A 2WP6A 4NEVA 2CULA 2TPRA 2H88A 1K0IA 4XXGA 1CC2A 2A87A 2C76A 3SY4A 2BK4A 5KWFA 3AB1A 3DJDA 3DA1A 3NT6A 4ECHA 2F5ZA 2YG7A 4U2TA 5EOWA 1CL0A 4JY2A 1CJ4A 3AE8A 5CQFA 2BS4A 4G9KA 4XWZA 4LIIA 2YLXA 1YY5A 3AEBA 5JCKA 3UTFA 2YLWA 3AE4A 2C66A 3Q6JA 4II2A 2BA9A 1IUXA 1VDCA 2VZ2A 2WHDA 4GDPA 4CY6A 2CDUA 1S2YA 2GR0A 4Z2TA 1H86A 1RYIA 1KNRA 2OA1A 2PHHA 4A9WA 3CTYA 3QFBA 2E4GA 4GUVA 1LQTA 1LV0A 4D04A 1CJ2A 2NPXA 1PS9A 2FJEA 1H7WA 2C3DA 4ZCDA 4TLZA 4HB9A 3FG2P 4ICYA 3EF6A 4BK3A 1CJ3A 3LZWA 4N9XA 1H6VA 3I3LA 3UCLA 3SZCA 3UTGA 3UKQA 1VG9A 2EQ8A 1DJNA 2XVJA 3NGCX 4RG4A 4CNKA 2ZZCA 3KPKA 3URHA 1PBCA 1PBDA 3ALLA 1GOSA 3COXA 4H4XA 3AE9A 1GRGA 3FPZA 5LV9A 4AOXA 1TRBA 1EBDA 2VVMA 2B9YA 3C4AA 3DMEA 4B68A 3IHGA 3AYJA 3HZLA 4K8DA 3GRTA 3UKKA 4GR1A 2E1MA 1NENA 1DJQA 1FL2A 2WPEA 4U8LA 1D4EA 1CHUA 1ZY8A 4OPUA 4Z44A 3UKLA 1W4XA 5C3JA 3QSSA 1PBEA 1KFYA 1H81A 3FMWA 2X8HA 3G5RA 4TLXA 2XVIA 5L46A 2WDQA 4H4QA 3RNMA 2OAMA 4LU6A 1F8SA 3UOVA 3T2KA 1REOA 4RG3A 3NK2X 1LTXR 1GEUA 3CPHG 3HYWA 3SM8A 2VOUA 2C72A 1FEBA 1BKWA 2GR3A 4H50A 3GDNA 1JU2A 3B6DA 5KMRA 3BI5A 4GRTA 3QSEA 3F8DA 4I59A 1BZLA 1GSNA 2YLTA 1CBOA 3P4SA 3UTHA 3ICRA 1DNCA 4EMIA 2AR8A 4BURA 2VRLA 5M0ZA 4ADWA 3AE2A 2ZZ0A 2WS3A 1JRXA 4NZHA 1TYTA 4WX1A 4A6NB 2A8XA 1ZMCA 1GNDA 2X50A 3AXBA 4U8NA 2B7RA 3V3OA 1Q9IA 1Q1RA 5KOXA 3DJGX 5FS9A 1XDIA 2QA2A 3CGDA 2XLRA 4U2SA 4KX6A 3ALMA 4YT0A 2YM1A 3GDPA 4G6HA 4GCMA 2WPCA 3NRNA 4B64A 2WDVA 5KXJA 3UKFA 4JN9A 2TMDA 4WCTA 2ARDA 1DOCA 2RGHA 1F8RA 3DGZA 4J34A 1BF3A 3IF9A 5FMHA 4DGKA 4A65A 2R0CA 1H84A 2R9ZA 1D4CA 4H4YA 4H2QA 3D8XA 1M64A 4EMWA 2B76A 4AOSA 2EQ6A 4G73A 3AYLA 3DGHA 2WP5A 3SQPA 1L9EA 1IUTA 1JEHA 1L9CA 3DK4A 1E39A 1CJCA 2BCPA 4OPIA 3GYXA 4H4TA 3CIRA 2BYBA 4AP3A 3F8RA 3BHFA 2X8CA 2I0ZA 5U1OA 4YTPA 3NK0X 3CNSA 1HYUA 4OPCA 4YTMA 3T14A 3WE0A 1NDAA 2WETA 4K7ZA 1FOHA 4J57A 3LOVA 2OLOA 2R4JA 3CN8A 3DH9A 2WOWA 2QAEA 3QJ4A 4G6GA 2Q0KA 2YG6A 1H7XA 3HYXA 2C7GA 4X9MA 3O0HA 4U8MA 3T2ZA 4H2PA 4Y4LA 2EQ7A 2AQJA 2YVFA 1JOAA 3S61A 3VQRA 5KMPA 2YG4A 3G5SA 1GALA 1PDHA 1S3BA 1YKJA 2HQMA 3I6DA 4DNAA 1P2EA 4YXDA 3LJPA 1O5WA 2WEUA 4OPGA 3BNUA 4BK2A 4YSZA 4J31A 1GRHA 1OJTA 2OLNA 4OPTA 3P4RA 5KVIA 4B66A 3V3NA 3E1TA 1Y56A 2GQWA 1RSGA 3VR9A 4J56A 2V3BA 2JAEA 1Y0PA 3KKJA 4NTEA 3CGCA 3AD7B 1PXCA 3ABVA 3NK1X 3SFEA 2VQ7A 3GWDA 3BI4A 2GQFA 2JB2A 2XFUA 2Z5XA 4A5LA 4CNJA 4BJYA 1ZOYA 4NEWA 3UTEA 4U8KA 3LZXA 1QJDA 2QA1A 3UKPA 1H82A 2E5VA 3DJEA 3M12A 1NEKA 4Y4MA 2R45A 1NHQA 3NHOX 3H4KA 1S3EA 1N1PA 2B9XA 1DOBA 4H4PA 5IQ1A 2GH5A 2WESA 4U2LA 1OJDA 2RGOA 4PAAA 1YQ4A 3JSKA 4U8JA 3T0KA 5FS8A 3QVRA 3CNTA 3AE7A 3KU9A 4IA6A 4B63A 3UOXA 3FBSA 2IVDA 5GSNA 3T37A 2YLZA 3CNJA 4CCRA 3AD9B 2GMHA 4Z2UA 2GEWA 4IVMB 5J60A 1PBFA 2YM2A 1F3PA 2WBAA 5HHFA 3ADAB 2X99A 3IC9A 2XVHA 4H4RA 1QO8A 3RP7A 3GD4A 4EQWA 1IUSA 1JNZA 4C77A 4JNAA 3NN0X 1AOGA 2WP9A 2WU5A 2CFYA 4TM3A 2B9WA 3AEFA 3CGBA 5IPYA 4HA6A 4NWZA 1FECA 3UP4A 1EL9A 5BULA 1MOKA 1NHSA 3NLCA 4GF7A 1E6EA 1NAAA 2BCGG 1B4VA 3B3RA 3K7TA 2BXSA 1RP0A 4LA1A 1LVLA 2YVGA 4H4WA 2Y6QA 1F8WA 3NN6X 1B8SA 4TM0A 3BNMA 3CPIG 4H4ZA 2PYXA 4U8IA 1KF6A 3RP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXI A;  5KMP A;  3HYV A;  3T31 A;  3T2Y A;  4G74 A;  3SY4 A;  5KMQ A;  3SZF A;  4GAP A;  3SZC A;  4NWZ A;  3SYI A;  3T0K A;  4G6H A;  3T2K A;  4G9K A;  5KMS A;  3KPK A;  3HYW A;  3T14 A;  3SZW A;  5KMR A;  4G6G A;  3HYX A;  4GAV A;  4G73 A;  3T2Z A;  3SZ0 A;  3SX6 A; 
#chains in the Genus database with same CATH topology
 2GRT A;  4XWR A;  1D7Y A;  3AE6 A;  2YR5 A;  4REK A;  1GV4 A;  1P2H A;  2RAB A;  4CY8 A;  2DKI A;  3ICT A;  1PXA A;  4Z2R A;  1PXB A;  2EQ9 A;  2BS2 A;  5KMQ A;  3GSI A;  4C5O A;  4RSL A;  3AEG A;  3RHA A;  2WU2 A;  5IQ4 A;  3NTA A;  1JRZ A;  3H8I A;  1VQW A;  2C4C A;  2XFQ A;  4AT0 A;  4EIQ A;  2GR2 A;  5C2T A;  1NPX A;  4H2R A;  1GES A;  1IUU A;  1GRE A;  2BAC A;  4P9S A;  3OZ2 A;  4USQ A;  2Q6U A;  4FDC B;  1CF3 A;  3UKA A;  2YAU A;  4O5Q A;  3RP6 A;  3SZ0 A;  3DJJ A;  4USR A;  3LAD A;  3T2Y A;  2JB3 A;  3UKH A;  4JNQ A;  2ACZ A;  2BC0 A;  2W0H A;  1PN0 A;  4K22 A;  4YSX A;  1UKV G;  1GT8 A;  4GAP A;  5BVA A;  3P4Q A;  4YSY A;  4A79 A;  1LQU A;  3SYI A;  3CMM A;  1B5Q A;  2GAG B;  2R0P A;  1M6I A;  1NHR A;  2WPF A;  5KVH A;  1TYP A;  3KPF A;  4Z24 A;  4EQX A;  1QLB A;  2IID A;  5J7X A;  1BGN A;  3RED A;  4IA5 A;  1V59 A;  2YQU A;  1CC4 A;  3AE3 A;  1PJ5 A;  1TDF A;  2R0G A;  3GRS A;  1CC6 A;  3KVE A;  4UDQ A;  2XLT A;  2JKC A;  4I58 A;  4K2X A;  2AAQ A;  4NTD A;  3BI2 A;  4DSH A;  3CPJ G;  3DK8 A;  1COY A;  4X9N A;  4APN A;  2XLP A;  4IVO B;  5JCM A;  3M13 A;  3KA7 A;  1D7L A;  3ICS A;  3AED A;  3G5Q A;  4K5S A;  3ALJ A;  3L8K A;  3T31 A;  4H7U A;  1OJA A;  3UP5 A;  2J3N A;  4O5U A;  1O94 A;  3IWA A;  2XLU A;  3PVC A;  2NVK X;  3Q9T A;  1TDE A;  3UOZ A;  2JK6 A;  4A7A A;  1NG3 A;  3CNP A;  1E1N A;  1K4Q A;  3EAO A;  3KD9 A;  5KMS A;  2IVE A;  3GMB A;  2GB0 A;  2ZBW A;  4Z43 A;  3NH3 X;  1ONF A;  3CGE A;  3ATR A;  1E7P A;  3K30 A;  4GDE A;  4J36 A;  4YTN A;  5BUK A;  1D5T A;  4H4S A;  1EL7 A;  1GRB A;  1ELI A;  1KSS A;  1EL5 A;  4KPR A;  2OAL A;  1PJ7 A;  4YWO A;  4OPL A;  1TDO A;  3OC4 A;  1S2Q A;  1KDG A;  1BWC A;  1N4U A;  3EAN A;  4JDR A;  2UZZ A;  4X4J A;  4ZCC A;  2ZZB A;  3SX6 A;  3SXI A;  4AP1 A;  3BHK A;  2XCG A;  2BRY A;  1B37 A;  3AYI A;  3C4N A;  3QFA A;  4EM3 A;  1ZDL A;  3EPT A;  4UDR A;  2BAB A;  5JCL A;  2YLR A;  3KLJ A;  1TDN A;  2QCU A;  1SEZ A;  3P1W A;  4BV6 A;  5M10 A;  4YKF A;  2GV8 A;  3NYE A;  3P9U A;  4NNJ A;  3L1R A;  2H89 A;  1Y56 B;  1E1K A;  2C75 A;  4U8O A;  3PO7 A;  3C96 A;  1GXF A;  2YR6 A;  5KRQ A;  1XAN A;  2GR1 A;  5U63 A;  3ZDN A;  4H4U A;  1LPF A;  4GAV A;  1E1L A;  1ZOV A;  1NG4 A;  5JCN A;  3GWF A;  4UDP A;  4UP3 A;  5FS6 A;  3S5W A;  3GYI A;  4OVI A;  4FK1 C;  1X31 B;  1K0L A;  3CND A;  3D1C A;  2BK3 A;  3K7M X;  4B67 A;  4EQR A;  3FIM B;  5JCI A;  4C3Y A;  5HXI A;  3P4P A;  1OJ9 A;  2X8G A;  1GTE A;  2O9Z A;  4AT2 A;  1GRF A;  2GMJ A;  3QVP A;  2YG5 A;  2V61 A;  4E0V A;  2FJA A;  4II3 A;  3ISH A;  4OPD A;  3NTD A;  3M0O A;  3AD8 B;  1GET A;  4H2N A;  2C64 A;  1JRY A;  1ZK7 A;  5GRT A;  2A89 A;  3VRA A;  4IV9 A;  2C73 A;  3VR8 A;  3ZYX A;  4A6N A;  4A99 A;  1N4W A;  1MXT A;  1ZX9 A;  4TM4 A;  2JB1 A;  3UOY A;  5ER0 A;  2FJB A;  1VG0 A;  4C3X A;  2BXR A;  2XVF A;  2WQY A;  3PS9 A;  4YSH A;  2WOV A;  4G74 A;  3QSM A;  4C74 A;  5DBJ A;  1LJ1 A;  2VVL G;  1L0V A;  1E1M A;  2X3N A;  5EB5 A;  2JBV A;  2V6O A;  2C67 A;  2XDO A;  4U8P A;  4YKG A;  4Z26 A;  2B7S A;  5TR3 A;  4JY3 A;  1FEA A;  2XYO A;  2V60 A;  5EBK A;  1XHC A;  1D4D A;  3AE1 A;  1GER A;  2YR4 A;  4OCG A;  1DXL A;  3K7Q X;  5KOW A;  2VVL A;  3NNE A;  1GRT A;  3AEA A;  2DKH A;  1IUV A;  1GRA A;  3SGL A;  3VRD B;  2Y6R A;  3AEE A;  1PBB A;  1N4V A;  3V76 A;  1VRQ B;  2GAH B;  1IJH A;  2Z5Y A;  3HYV A;  3AE5 A;  3GD3 A;  2FBW A;  1GPE A;  3NYC A;  2GVC A;  4PAB A;  4CBQ A;  5KNL A;  1JNR A;  4CCQ A;  4B69 A;  1OJC A;  4DSG A;  1DOD A;  5HYM A;  3SFD A;  4NTC A;  3NIX A;  2BRA A;  1L9D A;  1Q1W A;  1ZP0 A;  1Z6L A;  2YVJ A;  3AEC A;  1ZKQ A;  1MO9 A;  1YQ3 A;  4J2W A;  3F8P A;  2C70 A;  4B65 A;  2R46 A;  2YWL A;  2Q0L A;  4FX9 A;  3SZW A;  1EL8 A;  3LB8 A;  4K5R A;  4EQS A;  2C65 A;  3II4 A;  4BK1 A;  2GF3 A;  2Q7V A;  3NKS A;  1PJ6 A;  3IHM A;  2BC1 A;  3NYF A;  5BRT A;  2XFP A;  2VQB A;  3LXD A;  2XFO A;  2XFN A;  1XPQ A;  3AWI A;  2R4E A;  2XVE A;  5CKU A;  4EIP A;  1NHP A;  2RGJ A;  3GYJ A;  3DK9 A;  1FCD A;  4M52 A;  4ZN0 A;  2V5Z A;  4Z25 A;  4FK1 A;  5U25 A;  3VRB A;  3SZF A;  2CVJ A;  4JQ9 A;  3ITJ A;  1KNP A;  2VRM A;  4EM4 A;  1K0J A;  2BS3 A;  4J33 A;  5FS7 A;  1TDK A;  1H83 A;  4BJZ A;  2WDR A;  2YLS A;  2V3A A;  3GMC A;  4EMJ A;  1GTH A;  4TM1 A;  5EB4 A;  2WOI A;  1DOE A;  1F6M A;  1KSU A;  2FJD A;  3ATQ A;  3NG7 X;  1BGJ A;  2APG A;  2YG3 A;  1O95 A;  4H4V A;  1YQZ A;  4Y4N A;  4MJW A;  4B1B A;  3R9U A;  1IUW A;  1ZMD A;  2C3C A;  4D03 A;  4CRT A;  5HY5 A;  3H8L A;  2XLS A;  1PHH A;  2BK5 A;  2WP6 A;  4NEV A;  2CUL A;  2TPR A;  2H88 A;  1K0I A;  4XXG A;  1CC2 A;  2A87 A;  2C76 A;  3SY4 A;  2BK4 A;  5KWF A;  3AB1 A;  3DJD A;  3DA1 A;  3NT6 A;  4ECH A;  2F5Z A;  2YG7 A;  4U2T A;  5EOW A;  1CL0 A;  4JY2 A;  1CJ4 A;  3AE8 A;  5CQF A;  2BS4 A;  4G9K A;  4XWZ A;  4LII A;  2YLX A;  1YY5 A;  3AEB A;  5JCK A;  3UTF A;  2YLW A;  3AE4 A;  2C66 A;  3Q6J A;  4II2 A;  2BA9 A;  1IUX A;  1VDC A;  2VZ2 A;  2WHD A;  4GDP A;  4CY6 A;  2CDU A;  1S2Y A;  2GR0 A;  4Z2T A;  1H86 A;  1RYI A;  1KNR A;  2OA1 A;  2PHH A;  4A9W A;  3CTY A;  3QFB A;  2E4G A;  4GUV A;  1LQT A;  1LV0 A;  4D04 A;  1CJ2 A;  2NPX A;  1PS9 A;  2FJE A;  1H7W A;  2C3D A;  4ZCD A;  4TLZ A;  4HB9 A;  3FG2 P;  4ICY A;  3EF6 A;  4BK3 A;  1CJ3 A;  3LZW A;  4N9X A;  1H6V A;  3I3L A;  3UCL A;  3SZC A;  3UTG A;  3UKQ A;  1VG9 A;  2EQ8 A;  1DJN A;  2XVJ A;  3NGC X;  4RG4 A;  4CNK A;  2ZZC A;  3KPK A;  3URH A;  1PBC A;  1PBD A;  3ALL A;  1GOS A;  3COX A;  4H4X A;  3AE9 A;  1GRG A;  3FPZ A;  5LV9 A;  4AOX A;  1TRB A;  1EBD A;  2VVM A;  2B9Y A;  3C4A A;  3DME A;  4B68 A;  3IHG A;  3AYJ A;  3HZL A;  4K8D A;  3GRT A;  3UKK A;  4GR1 A;  2E1M A;  1NEN A;  1DJQ A;  1FL2 A;  2WPE A;  4U8L A;  1D4E A;  1CHU A;  1ZY8 A;  4OPU A;  4Z44 A;  3UKL A;  1W4X A;  5C3J A;  3QSS A;  1PBE A;  1KFY A;  1H81 A;  3FMW A;  2X8H A;  3G5R A;  4TLX A;  2XVI A;  5L46 A;  2WDQ A;  4H4Q A;  3RNM A;  2OAM A;  4LU6 A;  1F8S A;  3UOV A;  3T2K A;  1REO A;  4RG3 A;  3NK2 X;  1LTX R;  1GEU A;  3CPH G;  3HYW A;  3SM8 A;  2VOU A;  2C72 A;  1FEB A;  1BKW A;  2GR3 A;  4H50 A;  3GDN A;  1JU2 A;  3B6D A;  5KMR A;  3BI5 A;  4GRT A;  3QSE A;  3F8D A;  4I59 A;  1BZL A;  1GSN A;  2YLT A;  1CBO A;  3P4S A;  3UTH A;  3ICR A;  1DNC A;  4EMI A;  2AR8 A;  4BUR A;  2VRL A;  5M0Z A;  4ADW A;  3AE2 A;  2ZZ0 A;  2WS3 A;  1JRX A;  4NZH A;  1TYT A;  4WX1 A;  4A6N B;  2A8X A;  1ZMC A;  1GND A;  2X50 A;  3AXB A;  4U8N A;  2B7R A;  3V3O A;  1Q9I A;  1Q1R A;  5KOX A;  3DJG X;  5FS9 A;  1XDI A;  2QA2 A;  3CGD A;  2XLR A;  4U2S A;  4KX6 A;  3ALM A;  4YT0 A;  2YM1 A;  3GDP A;  4G6H A;  4GCM A;  2WPC A;  3NRN A;  4B64 A;  2WDV A;  5KXJ A;  3UKF A;  4JN9 A;  2TMD A;  4WCT A;  2ARD A;  1DOC A;  2RGH A;  1F8R A;  3DGZ A;  4J34 A;  1BF3 A;  3IF9 A;  5FMH A;  4DGK A;  4A65 A;  2R0C A;  1H84 A;  2R9Z A;  1D4C A;  4H4Y A;  4H2Q A;  3D8X A;  1M64 A;  4EMW A;  2B76 A;  4AOS A;  2EQ6 A;  4G73 A;  3AYL A;  3DGH A;  2WP5 A;  3SQP A;  1L9E A;  1IUT A;  1JEH A;  1L9C A;  3DK4 A;  1E39 A;  1CJC A;  2BCP A;  4OPI A;  3GYX A;  4H4T A;  3CIR A;  2BYB A;  4AP3 A;  3F8R A;  3BHF A;  2X8C A;  2I0Z A;  5U1O A;  4YTP A;  3NK0 X;  3CNS A;  1HYU A;  4OPC A;  4YTM A;  3T14 A;  3WE0 A;  1NDA A;  2WET A;  4K7Z A;  1FOH A;  4J57 A;  3LOV A;  2OLO A;  2R4J A;  3CN8 A;  3DH9 A;  2WOW A;  2QAE A;  3QJ4 A;  4G6G A;  2Q0K A;  2YG6 A;  1H7X A;  3HYX A;  2C7G A;  4X9M A;  3O0H A;  4U8M A;  3T2Z A;  4H2P A;  4Y4L A;  2EQ7 A;  2AQJ A;  2YVF A;  1JOA A;  3S61 A;  3VQR A;  5KMP A;  2YG4 A;  3G5S A;  1GAL A;  1PDH A;  1S3B A;  1YKJ A;  2HQM A;  3I6D A;  4DNA A;  1P2E A;  4YXD A;  3LJP A;  1O5W A;  2WEU A;  4OPG A;  3BNU A;  4BK2 A;  4YSZ A;  4J31 A;  1GRH A;  1OJT A;  2OLN A;  4OPT A;  3P4R A;  5KVI A;  4B66 A;  3V3N A;  3E1T A;  1Y56 A;  2GQW A;  1RSG A;  3VR9 A;  4J56 A;  2V3B A;  2JAE A;  1Y0P A;  3KKJ A;  4NTE A;  3CGC A;  3AD7 B;  1PXC A;  3ABV A;  3NK1 X;  3SFE A;  2VQ7 A;  3GWD A;  3BI4 A;  2GQF A;  2JB2 A;  2XFU A;  2Z5X A;  4A5L A;  4CNJ A;  4BJY A;  1ZOY A;  4NEW A;  3UTE A;  4U8K A;  3LZX A;  1QJD A;  2QA1 A;  3UKP A;  1H82 A;  2E5V A;  3DJE A;  3M12 A;  1NEK A;  4Y4M A;  2R45 A;  1NHQ A;  3NHO X;  3H4K A;  1S3E A;  1N1P A;  2B9X A;  1DOB A;  4H4P A;  5IQ1 A;  2GH5 A;  2WES A;  4U2L A;  1OJD A;  2RGO A;  4PAA A;  1YQ4 A;  3JSK A;  4U8J A;  3T0K A;  5FS8 A;  3QVR A;  3CNT A;  3AE7 A;  3KU9 A;  4IA6 A;  4B63 A;  3UOX A;  3FBS A;  2IVD A;  5GSN A;  3T37 A;  2YLZ A;  3CNJ A;  4CCR A;  3AD9 B;  2GMH A;  4Z2U A;  2GEW A;  4IVM B;  5J60 A;  1PBF A;  2YM2 A;  1F3P A;  2WBA A;  5HHF A;  3ADA B;  2X99 A;  3IC9 A;  2XVH A;  4H4R A;  1QO8 A;  3RP7 A;  3GD4 A;  4EQW A;  1IUS A;  1JNZ A;  4C77 A;  4JNA A;  3NN0 X;  1AOG A;  2WP9 A;  2WU5 A;  2CFY A;  4TM3 A;  2B9W A;  3AEF A;  3CGB A;  5IPY A;  4HA6 A;  4NWZ A;  1FEC A;  3UP4 A;  1EL9 A;  5BUL A;  1MOK A;  1NHS A;  3NLC A;  4GF7 A;  1E6E A;  1NAA A;  2BCG G;  1B4V A;  3B3R A;  3K7T A;  2BXS A;  1RP0 A;  4LA1 A;  1LVL A;  2YVG A;  4H4W A;  2Y6Q A;  1F8W A;  3NN6 X;  1B8S A;  4TM0 A;  3BNM A;  3CPI G;  4H4Z A;  2PYX A;  4U8I A;  1KF6 A;  3RP8 A; 
#chains in the Genus database with same CATH homology
 2GRT A;  4XWR A;  1D7Y A;  3AE6 A;  2YR5 A;  4REK A;  1GV4 A;  1P2H A;  2RAB A;  4CY8 A;  2DKI A;  3ICT A;  1PXA A;  4Z2R A;  1PXB A;  2EQ9 A;  2BS2 A;  5KMQ A;  3GSI A;  4C5O A;  4RSL A;  3AEG A;  3RHA A;  2WU2 A;  5IQ4 A;  3NTA A;  1JRZ A;  3H8I A;  1VQW A;  2C4C A;  2XFQ A;  4AT0 A;  4EIQ A;  2GR2 A;  5C2T A;  1NPX A;  4H2R A;  1GES A;  1IUU A;  1GRE A;  2BAC A;  4P9S A;  3OZ2 A;  4USQ A;  2Q6U A;  4FDC B;  1CF3 A;  3UKA A;  2YAU A;  4O5Q A;  3RP6 A;  3SZ0 A;  3DJJ A;  4USR A;  3LAD A;  3T2Y A;  2JB3 A;  3UKH A;  4JNQ A;  2ACZ A;  2BC0 A;  2W0H A;  1PN0 A;  4K22 A;  4YSX A;  1UKV G;  1GT8 A;  4GAP A;  5BVA A;  3P4Q A;  4YSY A;  4A79 A;  1LQU A;  3SYI A;  3CMM A;  1B5Q A;  2GAG B;  2R0P A;  1M6I A;  1NHR A;  2WPF A;  5KVH A;  1TYP A;  3KPF A;  4Z24 A;  4EQX A;  1QLB A;  2IID A;  5J7X A;  1BGN A;  3RED A;  4IA5 A;  1V59 A;  2YQU A;  1CC4 A;  3AE3 A;  1PJ5 A;  1TDF A;  2R0G A;  3GRS A;  1CC6 A;  3KVE A;  4UDQ A;  2XLT A;  2JKC A;  4I58 A;  4K2X A;  2AAQ A;  4NTD A;  3BI2 A;  4DSH A;  3CPJ G;  3DK8 A;  1COY A;  4X9N A;  4APN A;  2XLP A;  4IVO B;  5JCM A;  3M13 A;  3KA7 A;  1D7L A;  3ICS A;  3AED A;  3G5Q A;  4K5S A;  3ALJ A;  3L8K A;  3T31 A;  4H7U A;  1OJA A;  3UP5 A;  2J3N A;  4O5U A;  1O94 A;  3IWA A;  2XLU A;  3PVC A;  2NVK X;  3Q9T A;  1TDE A;  3UOZ A;  2JK6 A;  4A7A A;  1NG3 A;  3CNP A;  1E1N A;  1K4Q A;  3EAO A;  3KD9 A;  5KMS A;  2IVE A;  3GMB A;  2GB0 A;  2ZBW A;  4Z43 A;  3NH3 X;  1ONF A;  3CGE A;  3ATR A;  1E7P A;  3K30 A;  4GDE A;  4J36 A;  4YTN A;  5BUK A;  1D5T A;  4H4S A;  1EL7 A;  1GRB A;  1ELI A;  1KSS A;  1EL5 A;  4KPR A;  2OAL A;  1PJ7 A;  4YWO A;  4OPL A;  1TDO A;  3OC4 A;  1S2Q A;  1KDG A;  1BWC A;  1N4U A;  3EAN A;  4JDR A;  2UZZ A;  4X4J A;  4ZCC A;  2ZZB A;  3SX6 A;  3SXI A;  4AP1 A;  3BHK A;  2XCG A;  2BRY A;  1B37 A;  3AYI A;  3C4N A;  3QFA A;  4EM3 A;  1ZDL A;  3EPT A;  4UDR A;  2BAB A;  5JCL A;  2YLR A;  3KLJ A;  1TDN A;  2QCU A;  1SEZ A;  3P1W A;  4BV6 A;  5M10 A;  4YKF A;  2GV8 A;  3NYE A;  3P9U A;  4NNJ A;  3L1R A;  2H89 A;  1Y56 B;  1E1K A;  2C75 A;  4U8O A;  3PO7 A;  3C96 A;  1GXF A;  2YR6 A;  5KRQ A;  1XAN A;  2GR1 A;  5U63 A;  3ZDN A;  4H4U A;  1LPF A;  4GAV A;  1E1L A;  1ZOV A;  1NG4 A;  5JCN A;  3GWF A;  4UDP A;  4UP3 A;  5FS6 A;  3S5W A;  3GYI A;  4OVI A;  4FK1 C;  1X31 B;  1K0L A;  3CND A;  3D1C A;  2BK3 A;  3K7M X;  4B67 A;  4EQR A;  3FIM B;  5JCI A;  4C3Y A;  5HXI A;  3P4P A;  1OJ9 A;  2X8G A;  1GTE A;  2O9Z A;  4AT2 A;  1GRF A;  2GMJ A;  3QVP A;  2YG5 A;  2V61 A;  4E0V A;  2FJA A;  4II3 A;  3ISH A;  4OPD A;  3NTD A;  3M0O A;  3AD8 B;  1GET A;  4H2N A;  2C64 A;  1JRY A;  1ZK7 A;  5GRT A;  2A89 A;  3VRA A;  4IV9 A;  2C73 A;  3VR8 A;  3ZYX A;  4A6N A;  4A99 A;  1N4W A;  1MXT A;  1ZX9 A;  4TM4 A;  2JB1 A;  3UOY A;  5ER0 A;  2FJB A;  1VG0 A;  4C3X A;  2BXR A;  2XVF A;  2WQY A;  3PS9 A;  4YSH A;  2WOV A;  4G74 A;  3QSM A;  4C74 A;  5DBJ A;  1LJ1 A;  2VVL G;  1L0V A;  1E1M A;  2X3N A;  5EB5 A;  2JBV A;  2V6O A;  2C67 A;  2XDO A;  4U8P A;  4YKG A;  4Z26 A;  2B7S A;  5TR3 A;  4JY3 A;  1FEA A;  2XYO A;  2V60 A;  5EBK A;  1XHC A;  1D4D A;  3AE1 A;  1GER A;  2YR4 A;  4OCG A;  1DXL A;  3K7Q X;  5KOW A;  2VVL A;  3NNE A;  1GRT A;  3AEA A;  2DKH A;  1IUV A;  1GRA A;  3SGL A;  3VRD B;  2Y6R A;  3AEE A;  1PBB A;  1N4V A;  3V76 A;  1VRQ B;  2GAH B;  1IJH A;  2Z5Y A;  3HYV A;  3AE5 A;  3GD3 A;  2FBW A;  1GPE A;  3NYC A;  2GVC A;  4PAB A;  4CBQ A;  5KNL A;  1JNR A;  4CCQ A;  4B69 A;  1OJC A;  4DSG A;  1DOD A;  5HYM A;  3SFD A;  4NTC A;  3NIX A;  2BRA A;  1L9D A;  1Q1W A;  1ZP0 A;  1Z6L A;  2YVJ A;  3AEC A;  1ZKQ A;  1MO9 A;  1YQ3 A;  4J2W A;  3F8P A;  2C70 A;  4B65 A;  2R46 A;  2YWL A;  2Q0L A;  4FX9 A;  3SZW A;  1EL8 A;  3LB8 A;  4K5R A;  4EQS A;  2C65 A;  3II4 A;  4BK1 A;  2GF3 A;  2Q7V A;  3NKS A;  1PJ6 A;  3IHM A;  2BC1 A;  3NYF A;  5BRT A;  2XFP A;  2VQB A;  3LXD A;  2XFO A;  2XFN A;  1XPQ A;  3AWI A;  2R4E A;  2XVE A;  5CKU A;  4EIP A;  1NHP A;  2RGJ A;  3GYJ A;  3DK9 A;  1FCD A;  4M52 A;  4ZN0 A;  2V5Z A;  4Z25 A;  4FK1 A;  5U25 A;  3VRB A;  3SZF A;  2CVJ A;  4JQ9 A;  3ITJ A;  1KNP A;  2VRM A;  4EM4 A;  1K0J A;  2BS3 A;  4J33 A;  5FS7 A;  1TDK A;  1H83 A;  4BJZ A;  2WDR A;  2YLS A;  2V3A A;  3GMC A;  4EMJ A;  1GTH A;  4TM1 A;  5EB4 A;  2WOI A;  1DOE A;  1F6M A;  1KSU A;  2FJD A;  3ATQ A;  3NG7 X;  1BGJ A;  2APG A;  2YG3 A;  1O95 A;  4H4V A;  1YQZ A;  4Y4N A;  4MJW A;  4B1B A;  3R9U A;  1IUW A;  1ZMD A;  2C3C A;  4D03 A;  4CRT A;  5HY5 A;  3H8L A;  2XLS A;  1PHH A;  2BK5 A;  2WP6 A;  4NEV A;  2CUL A;  2TPR A;  2H88 A;  1K0I A;  4XXG A;  1CC2 A;  2A87 A;  2C76 A;  3SY4 A;  2BK4 A;  5KWF A;  3AB1 A;  3DJD A;  3DA1 A;  3NT6 A;  4ECH A;  2F5Z A;  2YG7 A;  4U2T A;  5EOW A;  1CL0 A;  4JY2 A;  1CJ4 A;  3AE8 A;  5CQF A;  2BS4 A;  4G9K A;  4XWZ A;  4LII A;  2YLX A;  1YY5 A;  3AEB A;  5JCK A;  3UTF A;  2YLW A;  3AE4 A;  2C66 A;  3Q6J A;  4II2 A;  2BA9 A;  1IUX A;  1VDC A;  2VZ2 A;  2WHD A;  4GDP A;  4CY6 A;  2CDU A;  1S2Y A;  2GR0 A;  4Z2T A;  1H86 A;  1RYI A;  1KNR A;  2OA1 A;  2PHH A;  4A9W A;  3CTY A;  3QFB A;  2E4G A;  4GUV A;  1LQT A;  1LV0 A;  4D04 A;  1CJ2 A;  2NPX A;  1PS9 A;  2FJE A;  1H7W A;  2C3D A;  4ZCD A;  4TLZ A;  4HB9 A;  3FG2 P;  4ICY A;  3EF6 A;  4BK3 A;  1CJ3 A;  3LZW A;  4N9X A;  1H6V A;  3I3L A;  3UCL A;  3SZC A;  3UTG A;  3UKQ A;  1VG9 A;  2EQ8 A;  1DJN A;  2XVJ A;  3NGC X;  4RG4 A;  4CNK A;  2ZZC A;  3KPK A;  3URH A;  1PBC A;  1PBD A;  3ALL A;  1GOS A;  3COX A;  4H4X A;  3AE9 A;  1GRG A;  3FPZ A;  5LV9 A;  4AOX A;  1TRB A;  1EBD A;  2VVM A;  2B9Y A;  3C4A A;  3DME A;  4B68 A;  3IHG A;  3AYJ A;  3HZL A;  4K8D A;  3GRT A;  3UKK A;  4GR1 A;  2E1M A;  1NEN A;  1DJQ A;  1FL2 A;  2WPE A;  4U8L A;  1D4E A;  1CHU A;  1ZY8 A;  4OPU A;  4Z44 A;  3UKL A;  1W4X A;  5C3J A;  3QSS A;  1PBE A;  1KFY A;  1H81 A;  3FMW A;  2X8H A;  3G5R A;  4TLX A;  2XVI A;  5L46 A;  2WDQ A;  4H4Q A;  3RNM A;  2OAM A;  4LU6 A;  1F8S A;  3UOV A;  3T2K A;  1REO A;  4RG3 A;  3NK2 X;  1LTX R;  1GEU A;  3CPH G;  3HYW A;  3SM8 A;  2VOU A;  2C72 A;  1FEB A;  1BKW A;  2GR3 A;  4H50 A;  3GDN A;  1JU2 A;  3B6D A;  5KMR A;  3BI5 A;  4GRT A;  3QSE A;  3F8D A;  4I59 A;  1BZL A;  1GSN A;  2YLT A;  1CBO A;  3P4S A;  3UTH A;  3ICR A;  1DNC A;  4EMI A;  2AR8 A;  4BUR A;  2VRL A;  5M0Z A;  4ADW A;  3AE2 A;  2ZZ0 A;  2WS3 A;  1JRX A;  4NZH A;  1TYT A;  4WX1 A;  4A6N B;  2A8X A;  1ZMC A;  1GND A;  2X50 A;  3AXB A;  4U8N A;  2B7R A;  3V3O A;  1Q9I A;  1Q1R A;  5KOX A;  3DJG X;  5FS9 A;  1XDI A;  2QA2 A;  3CGD A;  2XLR A;  4U2S A;  4KX6 A;  3ALM A;  4YT0 A;  2YM1 A;  3GDP A;  4G6H A;  4GCM A;  2WPC A;  3NRN A;  4B64 A;  2WDV A;  5KXJ A;  3UKF A;  4JN9 A;  2TMD A;  4WCT A;  2ARD A;  1DOC A;  2RGH A;  1F8R A;  3DGZ A;  4J34 A;  1BF3 A;  3IF9 A;  5FMH A;  4DGK A;  4A65 A;  2R0C A;  1H84 A;  2R9Z A;  1D4C A;  4H4Y A;  4H2Q A;  3D8X A;  1M64 A;  4EMW A;  2B76 A;  4AOS A;  2EQ6 A;  4G73 A;  3AYL A;  3DGH A;  2WP5 A;  3SQP A;  1L9E A;  1IUT A;  1JEH A;  1L9C A;  3DK4 A;  1E39 A;  1CJC A;  2BCP A;  4OPI A;  3GYX A;  4H4T A;  3CIR A;  2BYB A;  4AP3 A;  3F8R A;  3BHF A;  2X8C A;  2I0Z A;  5U1O A;  4YTP A;  3NK0 X;  3CNS A;  1HYU A;  4OPC A;  4YTM A;  3T14 A;  3WE0 A;  1NDA A;  2WET A;  4K7Z A;  1FOH A;  4J57 A;  3LOV A;  2OLO A;  2R4J A;  3CN8 A;  3DH9 A;  2WOW A;  2QAE A;  3QJ4 A;  4G6G A;  2Q0K A;  2YG6 A;  1H7X A;  3HYX A;  2C7G A;  4X9M A;  3O0H A;  4U8M A;  3T2Z A;  4H2P A;  4Y4L A;  2EQ7 A;  2AQJ A;  2YVF A;  1JOA A;  3S61 A;  3VQR A;  5KMP A;  2YG4 A;  3G5S A;  1GAL A;  1PDH A;  1S3B A;  1YKJ A;  2HQM A;  3I6D A;  4DNA A;  1P2E A;  4YXD A;  3LJP A;  1O5W A;  2WEU A;  4OPG A;  3BNU A;  4BK2 A;  4YSZ A;  4J31 A;  1GRH A;  1OJT A;  2OLN A;  4OPT A;  3P4R A;  5KVI A;  4B66 A;  3V3N A;  3E1T A;  1Y56 A;  2GQW A;  1RSG A;  3VR9 A;  4J56 A;  2V3B A;  2JAE A;  1Y0P A;  3KKJ A;  4NTE A;  3CGC A;  3AD7 B;  1PXC A;  3ABV A;  3NK1 X;  3SFE A;  2VQ7 A;  3GWD A;  3BI4 A;  2GQF A;  2JB2 A;  2XFU A;  2Z5X A;  4A5L A;  4CNJ A;  4BJY A;  1ZOY A;  4NEW A;  3UTE A;  4U8K A;  3LZX A;  1QJD A;  2QA1 A;  3UKP A;  1H82 A;  2E5V A;  3DJE A;  3M12 A;  1NEK A;  4Y4M A;  2R45 A;  1NHQ A;  3NHO X;  3H4K A;  1S3E A;  1N1P A;  2B9X A;  1DOB A;  4H4P A;  5IQ1 A;  2GH5 A;  2WES A;  4U2L A;  1OJD A;  2RGO A;  4PAA A;  1YQ4 A;  3JSK A;  4U8J A;  3T0K A;  5FS8 A;  3QVR A;  3CNT A;  3AE7 A;  3KU9 A;  4IA6 A;  4B63 A;  3UOX A;  3FBS A;  2IVD A;  5GSN A;  3T37 A;  2YLZ A;  3CNJ A;  4CCR A;  3AD9 B;  2GMH A;  4Z2U A;  2GEW A;  4IVM B;  5J60 A;  1PBF A;  2YM2 A;  1F3P A;  2WBA A;  5HHF A;  3ADA B;  2X99 A;  3IC9 A;  2XVH A;  4H4R A;  1QO8 A;  3RP7 A;  3GD4 A;  4EQW A;  1IUS A;  1JNZ A;  4C77 A;  4JNA A;  3NN0 X;  1AOG A;  2WP9 A;  2WU5 A;  2CFY A;  4TM3 A;  2B9W A;  3AEF A;  3CGB A;  5IPY A;  4HA6 A;  4NWZ A;  1FEC A;  3UP4 A;  1EL9 A;  5BUL A;  1MOK A;  1NHS A;  3NLC A;  4GF7 A;  1E6E A;  1NAA A;  2BCG G;  1B4V A;  3B3R A;  3K7T A;  2BXS A;  1RP0 A;  4LA1 A;  1LVL A;  2YVG A;  4H4W A;  2Y6Q A;  1F8W A;  3NN6 X;  1B8S A;  4TM0 A;  3BNM A;  3CPI G;  4H4Z A;  2PYX A;  4U8I A;  1KF6 A;  3RP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...