4G74A

Crystal structure of ndh with quinone
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
478
structure length
471
Chain Sequence
GPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 156
structure length 471
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g74A00
3T2YA 3KPKA 5KMQA 5KMPA 4G6HA 3T0KA 4GAVA 3HYVA 3SX6A 3SXIA 3SYIA 4GAPA 3SZ0A 3SZFA 3T31A 3SZWA 3SZCA 3SY4A 4G9KA 4G74A 4NWZA 3HYXA 3T2ZA 3T14A 4G73A 3T2KA 5KMRA 4G6GA 3HYWA 5KMSA
chains in the Genus database with same CATH superfamily
2BABA 4GR1A 3AWIA 1PBEA 3CGDA 4IA6A 1EBDA 3AEEA 4FK1C 1NPXA 2JKCA 3OZ2A 1E6EA 3KPFA 5L46A 1QLBA 1GV4A 2XVFA 2NPXA 2V6OA 4OPCA 4GAVA 1XDIA 2WDRA 2XLTA 2JB2A 5KXJA 5KNLA 1PBFA 4APNA 4BK1A 1LQTA 3E1TA 4CCQA 1PXAA 4KPRA 4EM4A 2GF3A 3LB8A 2XFUA 1XANA 1FECA 1MO9A 4GRTA 1ZOYA 4ZN0A 1IUSA 1FEBA 1Q9IA 1CJ4A 4HB9A 3K7TA 3GRSA 1L9DA 3ALLA 5J7XA 5KMSA 3P9UA 4USQA 1N4UA 1NHRA 1ZP0A 4REKA 1CBOA 1VQWA 3KKJA 5KMQA 5U25A 4U8IA 5HHFA 3M0OA 2FBWA 1M64A 1OJ9A 2A87A 3NLCA 5BUKA 5M10A 1DOCA 1ZMDA 4Z2TA 2GQFA 3RP7A 2XFQA 4O5QA 5KOXA 2JK6A 3FG2P 3CNTA 3ICTA 4IA5A 1N1PA 2WU5A 2OLOA 3JSKA 3T2ZA 1SEZA 3NG7X 2EQ6A 2YR4A 4B64A 3M13A 4NNJA 4YKFA 5KMPA 1GXFA 1L0VA 4C3YA 4H4PA 4NTCA 1PBCA 2PHHA 4LIIA 1EL8A 5LV9A 3CGBA 4B66A 2VQBA 1F3PA 3O0HA 1PXBA 5JCKA 2WESA 1KNRA 4EIPA 1IUVA 1Z6LA 3SX6A 3GYIA 2YR5A 2XCGA 3NRNA 1BGJA 4USRA 2WDQA 4EQRA 1BKWA 5JCMA 1N4VA 4U8PA 1ZOVA 3EAOA 2WP6A 4X4JA 2Z5XA 4TLXA 1ZKQA 3VQRA 4LA1A 1PBBA 1TRBA 2DKIA 4GF7A 4RG3A 4EQXA 1COYA 3UTFA 5KRQA 1GOSA 2XLUA 4CNJA 2DKHA 4G6GA 4B68A 3CPHG 5HY5A 1EL5A 2C3CA 2GR2A 4JNQA 1GERA 3NK2X 2B7SA 4Y4NA 4NEWA 3C96A 3NT6A 1PXCA 2BYBA 4IVMB 3CMMA 1H7XA 3AYLA 2OLNA 3UP5A 2WP9A 1B5QA 3AB1A 1B37A 3G5RA 3NN0X 1Q1WA 2X50A 1YKJA 3AYJA 2VVLA 1DNCA 3AD9B 1D4EA 2GQWA 2YR6A 4B69A 3C4NA 3NGCX 3URHA 5JCNA 3UKHA 3RP8A 5KOWA 2CVJA 4OPDA 2A89A 3FIMB 3EPTA 4H4UA 1OJTA 3GD3A 1NHQA 2GV8A 4G73A 4IVOB 4U8NA 3DGZA 5TR3A 1X31B 3I6DA 2XLSA 2HQMA 3K7QX 3VR9A 2X99A 4J2WA 4YSZA 2YLTA 4CY6A 3LZXA 1Y56B 3KPKA 4JY3A 2WP5A 2JB1A 2WOWA 5C3JA 3NTDA 1QJDA 4Z43A 4U2TA 4G6HA 3T0KA 3P4QA 1PN0A 2BK3A 3V3NA 4AT2A 1NEKA 1F8RA 1GNDA 1L9CA 3P4SA 3T37A 4JQ9A 4EM3A 1DOEA 1VG0A 4FK1A 4H2RA 5FS7A 2AR8A 2XVJA 4GDEA 1JOAA 2OA1A 1F6MA 2YG3A 3DK4A 4NZHA 3BI4A 1GTEA 4IV9A 5J60A 4J34A 1IJHA 4H2NA 3NN6X 3S5WA 1PJ7A 3P1WA 1E7PA 1B8SA 2WU2A 3AE8A 2C7GA 3T2KA 5BVAA 4GDPA 1FCDA 5BRTA 3SFDA 1BGNA 1GRGA 3G5SA 1GT8A 3Q9TA 3SFEA 2X8HA 2JB3A 3NH3X 4AOXA 2WEUA 4UDPA 4U8JA 4H4WA 4BJYA 3NTAA 4CY8A 1YY5A 2C73A 4YSYA 1D4CA 5GSNA 3QVPA 4Z25A 4ADWA 4BJZA 4CBQA 4D03A 4EIQA 2WPCA 4XXGA 3QVRA 3KVEA 4NEVA 2QA2A 3F8PA 4K2XA 1VG9A 2C4CA 2GVCA 3QFAA 3SZFA 1DJNA 2VVLG 1ONFA 4A6NB 1S2YA 1DOBA 1S3BA 4LU6A 1GREA 1W4XA 3AEAA 2X8CA 3V76A 2R4JA 2B76A 2VZ2A 1CJ2A 2FJEA 3T14A 5KMRA 3UKPA 4Y4LA 1QO8A 3AE2A 1CC6A 4ECHA 2YM1A 1ZX9A 2IIDA 4J56A 3H8IA 3IF9A 2QA1A 1KFYA 3ATRA 3ZYXA 2BACA 1TDFA 2ACZA 2Q6UA 2WHDA 3R9UA 3ZDNA 3GDPA 4C74A 4Z26A 1K0JA 4OCGA 2WDVA 1TYPA 3B3RA 2R9ZA 3VRBA 1KNPA 4II3A 4H4XA 1VRQB 4TLZA 2C3DA 2O9ZA 4C3XA 1CC2A 2CDUA 2C70A 1LJ1A 4G9KA 4H4SA 4J57A 1NDAA 3KU9A 5DBJA 5U1OA 1KSSA 3AEBA 1BZLA 5HYMA 3CGCA 4OPUA 1GSNA 3AD8B 4TM3A 3AE7A 1YQ4A 4A79A 2QCUA 2R0PA 4A6NA 1ELIA 3UKQA 1IUTA 1GEUA 3T2YA 1DODA 2GRTA 1YQ3A 2W0HA 3II4A 4TM4A 1LPFA 3DJEA 5FS6A 2B9WA 3GDNA 2OALA 4N9XA 4AT0A 2YQUA 4DSHA 2Y6QA 3GWFA 5EBKA 3GMCA 4H4ZA 3SXIA 1ZK7A 3UOYA 2BCPA 2GEWA 1OJCA 4MJWA 4YXDA 1ZDLA 5IPYA 2BK5A 2JBVA 1PJ6A 1XPQA 4GCMA 2BS3A 2GR1A 2ZZBA 4TM1A 1H6VA 4YTPA 3P4PA 3GMBA 3NK0X 1CF3A 4DGKA 2XLRA 4YSXA 3UOXA 4H4YA 2GB0A 1H7WA 2R46A 2XVHA 2XDOA 2YLZA 3HYWA 3AEGA 3AD7B 4ICYA 3AE1A 1MOKA 4U8KA 1ZY8A 3OC4A 4WX1A 4YTMA 4BURA 1S3EA 3RHAA 3RP6A 3B6DA 1MXTA 4U2SA 1GPEA 2WOVA 2X8GA 1M6IA 2UZZA 3AECA 2E5VA 2YLXA 1S2QA 2WPEA 4JNAA 5JCLA 1YQZA 4OPLA 3NYFA 1NG3A 3AE5A 2EQ8A 4J31A 3UOVA 4M52A 3GYJA 4YTNA 3UP4A 2BRYA 4P9SA 2C76A 1KSUA 1D4DA 1P2HA 3CNPA 4H4RA 1HYUA 4UP3A 1XHCA 3VRAA 2ZZCA 2VVMA 3ADAB 3AE9A 3DA1A 3LOVA 1GRBA 5CKUA 3NK1X 4XWRA 1D5TA 4H2PA 3K30A 1GESA 1VDCA 1K0IA 3FBSA 4B65A 4B63A 3IWAA 3UTGA 1BWCA 2C72A 2YLWA 1TYTA 4B1BA 3NKSA 3QFBA 3QSSA 1TDNA 2EQ9A 2ZBWA 1ZMCA 2BS4A 1TDEA 4PAAA 3SYIA 3QSEA 4CNKA 3NNEA 3DJDA 2V60A 4AP3A 1FOHA 1IUUA 2BXSA 3AEFA 2VQ7A 3D8XA 3T31A 3RNMA 2V61A 1CJ3A 2BC0A 2YG5A 4G74A 2RGJA 3GWDA 4YKGA 3HYXA 1D7YA 3VR8A 2XVIA 1IUXA 4C5OA 2GR3A 1PS9A 2PYXA 2VOUA 2VRLA 4FX9A 3COXA 3UTEA 2C75A 2RGOA 4E0VA 4BK3A 4JDRA 2YLSA 5EB5A 1RSGA 1NHPA 4OPTA 1PHHA 4K22A 2RGHA 1V59A 4K5RA 3UKLA 2B9XA 1KF6A 4A5LA 1E39A 3GYXA 4H4VA 2CFYA 5EB4A 2YG6A 4HA6A 4OVIA 1H83A 4YWOA 2WBAA 3HYVA 4OPGA 5KWFA 2IVEA 3CGEA 1NHSA 4J36A 2A8XA 1CL0A 2F5ZA 3IHGA 3F8DA 3UOZA 1Y56A 3AYIA 1BF3A 4AP1A 4EMIA 2WETA 4X9MA 3QSMA 3SY4A 1REOA 2YLRA 3FPZA 1LV0A 5FMHA 2Z5YA 1TDOA 3BHKA 5IQ1A 3LJPA 4U8OA 2YG4A 4Z2RA 5JCIA 4EQSA 4CCRA 3UKAA 3AE3A 3NHOX 2C64A 1GALA 3L8KA 2XYOA 1CC4A 1O95A 3GD4A 3AEDA 3CPJG 3WE0A 4H2QA 1E1LA 1FEAA 1O94A 3BNUA 3C4AA 3ICRA 2APGA 4BK2A 4FDCB 4B67A 2OAMA 4YSHA 3M12A 3FMWA 4II2A 2BS2A 2ARDA 3KD9A 2YG7A 3REDA 2Q0LA 2J3NA 3VRDB 3BI5A 1JRXA 3CIRA 3Q6JA 1PJ5A 3NYEA 2V5ZA 2CULA 3H8LA 4A9WA 4GUVA 5FS9A 2H89A 4U8LA 5C2TA 1E1MA 3DJGX 4A7AA 5EOWA 2I0ZA 3EF6A 3LZWA 4NTEA 1GRAA 1OJAA 2FJDA 2V3AA 4O5UA 2YAUA 4U2LA 4D04A 4X9NA 1LVLA 2GR0A 2TPRA 4Y4MA 4K5SA 3BI2A 5KVIA 1L9EA 2YWLA 4EMWA 1CHUA 1N4WA 2BXRA 2WOIA 4J33A 2AQJA 1GRFA 1H84A 1GETA 2BC1A 4Z44A 2V3BA 2B9YA 2IVDA 4OPIA 1EL9A 1PBDA 4YT0A 2H88A 3NIXA 4K7ZA 4ZCDA 1F8SA 1O5WA 4WCTA 5IQ4A 1F8WA 4I58A 3CTYA 3UCLA 4A99A 2FJAA 3AXBA 2C66A 4KX6A 2XFNA 3ITJA 3QJ4A 3GSIA 3SM8A 3F8RA 5ER0A 2ZZ0A 3IHMA 4PABA 1AOGA 3DK8A 1EL7A 2Q0KA 1E1NA 2E1MA 4XWZA 3K7MX 1OJDA 4JY2A 3AE6A 3DK9A 4RG4A 4UDQA 2NVKX 4TM0A 3SZ0A 1K0LA 4EQWA 1IUWA 4H4QA 1NENA 2BRAA 5CQFA 5KVHA 2Q7VA 1D7LA 3LXDA 4NTDA 1B4VA 1TDKA 4EMJA 3PO7A 3ABVA 3SGLA 1DXLA 2BK4A 3BHFA 1GRHA 3LADA 1PDHA 2XFPA 4DNAA 3PVCA 4BV6A 1RYIA 1RP0A 2C65A 4H4TA 4UDRA 5GRTA 2GAGB 4K8DA 3CN8A 3IC9A 1LQUA 1DJQA 2B7RA 4I59A 1FL2A 4AOSA 1JEHA 4RSLA 5BULA 2FJBA 2YVJA 2VRMA 3DMEA 2GAHB 1H82A 2BA9A 2WPFA 2R0CA 4A65A 4GAPA 1JNRA 2YVGA 3CNDA 1H86A 1E1KA 2WS3A 3L1RA 3ISHA 5HXIA 3H4KA 3SZWA 3SZCA 1JRZA 4H7UA 1GRTA 4U8MA 2GMJA 2YM2A 3ALJA 2R4EA 3ALMA 1KDGA 2R45A 4H50A 3KLJA 3P4RA 3SQPA 2BCGG 1JNZA 1K4QA 1Q1RA 3EANA 3V3OA 2GMHA 2Y6RA 2WQYA 2XLPA 3DJJA 3HZLA 4CRTA 1CJCA 2RABA 1LTXR 3S61A 3DH9A 2QAEA 2GH5A 2R0GA 2AAQA 1NAAA 3UKFA 5U63A 3BNMA 4DSGA 2YVFA 2E4GA 3CNSA 1NG4A 2XFOA 5FS8A 3UTHA 3AE4A 3DGHA 3PS9A 3ICSA 3CPIG 1JU2A 1Y0PA 3G5QA 3KA7A 1UKVG 2EQ7A 4NWZA 3UKKA 3NYCA 4Z2UA 4ZCCA 3CNJA 1P2EA 1JRYA 3ATQA 2TMDA 2X3NA 4JN9A 2XVEA 4C77A 3I3LA 1H81A 5M0ZA 3D1CA 2JAEA 2C67A 1GTHA 3GRTA 4Z24A
chains in the Genus database with same CATH topology
2BABA 4GR1A 3AWIA 1PBEA 3CGDA 4IA6A 1EBDA 3AEEA 4FK1C 1NPXA 2JKCA 3OZ2A 1E6EA 3KPFA 5L46A 1QLBA 1GV4A 2XVFA 2NPXA 2V6OA 4OPCA 4GAVA 1XDIA 2WDRA 2XLTA 2JB2A 5KXJA 5KNLA 1PBFA 4APNA 4BK1A 1LQTA 3E1TA 4CCQA 1PXAA 4KPRA 4EM4A 2GF3A 3LB8A 2XFUA 1XANA 1FECA 1MO9A 4GRTA 1ZOYA 4ZN0A 1IUSA 1FEBA 1Q9IA 1CJ4A 4HB9A 3K7TA 3GRSA 1L9DA 3ALLA 5J7XA 5KMSA 3P9UA 4USQA 1N4UA 1NHRA 1ZP0A 4REKA 1CBOA 1VQWA 3KKJA 5KMQA 5U25A 4U8IA 5HHFA 3M0OA 2FBWA 1M64A 1OJ9A 2A87A 3NLCA 5BUKA 5M10A 1DOCA 1ZMDA 4Z2TA 2GQFA 3RP7A 2XFQA 4O5QA 5KOXA 2JK6A 3FG2P 3CNTA 3ICTA 4IA5A 1N1PA 2WU5A 2OLOA 3JSKA 3T2ZA 1SEZA 3NG7X 2EQ6A 2YR4A 4B64A 3M13A 4NNJA 4YKFA 5KMPA 1GXFA 1L0VA 4C3YA 4H4PA 4NTCA 1PBCA 2PHHA 4LIIA 1EL8A 5LV9A 3CGBA 4B66A 2VQBA 1F3PA 3O0HA 1PXBA 5JCKA 2WESA 1KNRA 4EIPA 1IUVA 1Z6LA 3SX6A 3GYIA 2YR5A 2XCGA 3NRNA 1BGJA 4USRA 2WDQA 4EQRA 1BKWA 5JCMA 1N4VA 4U8PA 1ZOVA 3EAOA 2WP6A 4X4JA 2Z5XA 4TLXA 1ZKQA 3VQRA 4LA1A 1PBBA 1TRBA 2DKIA 4GF7A 4RG3A 4EQXA 1COYA 3UTFA 5KRQA 1GOSA 2XLUA 4CNJA 2DKHA 4G6GA 4B68A 3CPHG 5HY5A 1EL5A 2C3CA 2GR2A 4JNQA 1GERA 3NK2X 2B7SA 4Y4NA 4NEWA 3C96A 3NT6A 1PXCA 2BYBA 4IVMB 3CMMA 1H7XA 3AYLA 2OLNA 3UP5A 2WP9A 1B5QA 3AB1A 1B37A 3G5RA 3NN0X 1Q1WA 2X50A 1YKJA 3AYJA 2VVLA 1DNCA 3AD9B 1D4EA 2GQWA 2YR6A 4B69A 3C4NA 3NGCX 3URHA 5JCNA 3UKHA 3RP8A 5KOWA 2CVJA 4OPDA 2A89A 3FIMB 3EPTA 4H4UA 1OJTA 3GD3A 1NHQA 2GV8A 4G73A 4IVOB 4U8NA 3DGZA 5TR3A 1X31B 3I6DA 2XLSA 2HQMA 3K7QX 3VR9A 2X99A 4J2WA 4YSZA 2YLTA 4CY6A 3LZXA 1Y56B 3KPKA 4JY3A 2WP5A 2JB1A 2WOWA 5C3JA 3NTDA 1QJDA 4Z43A 4U2TA 4G6HA 3T0KA 3P4QA 1PN0A 2BK3A 3V3NA 4AT2A 1NEKA 1F8RA 1GNDA 1L9CA 3P4SA 3T37A 4JQ9A 4EM3A 1DOEA 1VG0A 4FK1A 4H2RA 5FS7A 2AR8A 2XVJA 4GDEA 1JOAA 2OA1A 1F6MA 2YG3A 3DK4A 4NZHA 3BI4A 1GTEA 4IV9A 5J60A 4J34A 1IJHA 4H2NA 3NN6X 3S5WA 1PJ7A 3P1WA 1E7PA 1B8SA 2WU2A 3AE8A 2C7GA 3T2KA 5BVAA 4GDPA 1FCDA 5BRTA 3SFDA 1BGNA 1GRGA 3G5SA 1GT8A 3Q9TA 3SFEA 2X8HA 2JB3A 3NH3X 4AOXA 2WEUA 4UDPA 4U8JA 4H4WA 4BJYA 3NTAA 4CY8A 1YY5A 2C73A 4YSYA 1D4CA 5GSNA 3QVPA 4Z25A 4ADWA 4BJZA 4CBQA 4D03A 4EIQA 2WPCA 4XXGA 3QVRA 3KVEA 4NEVA 2QA2A 3F8PA 4K2XA 1VG9A 2C4CA 2GVCA 3QFAA 3SZFA 1DJNA 2VVLG 1ONFA 4A6NB 1S2YA 1DOBA 1S3BA 4LU6A 1GREA 1W4XA 3AEAA 2X8CA 3V76A 2R4JA 2B76A 2VZ2A 1CJ2A 2FJEA 3T14A 5KMRA 3UKPA 4Y4LA 1QO8A 3AE2A 1CC6A 4ECHA 2YM1A 1ZX9A 2IIDA 4J56A 3H8IA 3IF9A 2QA1A 1KFYA 3ATRA 3ZYXA 2BACA 1TDFA 2ACZA 2Q6UA 2WHDA 3R9UA 3ZDNA 3GDPA 4C74A 4Z26A 1K0JA 4OCGA 2WDVA 1TYPA 3B3RA 2R9ZA 3VRBA 1KNPA 4II3A 4H4XA 1VRQB 4TLZA 2C3DA 2O9ZA 4C3XA 1CC2A 2CDUA 2C70A 1LJ1A 4G9KA 4H4SA 4J57A 1NDAA 3KU9A 5DBJA 5U1OA 1KSSA 3AEBA 1BZLA 5HYMA 3CGCA 4OPUA 1GSNA 3AD8B 4TM3A 3AE7A 1YQ4A 4A79A 2QCUA 2R0PA 4A6NA 1ELIA 3UKQA 1IUTA 1GEUA 3T2YA 1DODA 2GRTA 1YQ3A 2W0HA 3II4A 4TM4A 1LPFA 3DJEA 5FS6A 2B9WA 3GDNA 2OALA 4N9XA 4AT0A 2YQUA 4DSHA 2Y6QA 3GWFA 5EBKA 3GMCA 4H4ZA 3SXIA 1ZK7A 3UOYA 2BCPA 2GEWA 1OJCA 4MJWA 4YXDA 1ZDLA 5IPYA 2BK5A 2JBVA 1PJ6A 1XPQA 4GCMA 2BS3A 2GR1A 2ZZBA 4TM1A 1H6VA 4YTPA 3P4PA 3GMBA 3NK0X 1CF3A 4DGKA 2XLRA 4YSXA 3UOXA 4H4YA 2GB0A 1H7WA 2R46A 2XVHA 2XDOA 2YLZA 3HYWA 3AEGA 3AD7B 4ICYA 3AE1A 1MOKA 4U8KA 1ZY8A 3OC4A 4WX1A 4YTMA 4BURA 1S3EA 3RHAA 3RP6A 3B6DA 1MXTA 4U2SA 1GPEA 2WOVA 2X8GA 1M6IA 2UZZA 3AECA 2E5VA 2YLXA 1S2QA 2WPEA 4JNAA 5JCLA 1YQZA 4OPLA 3NYFA 1NG3A 3AE5A 2EQ8A 4J31A 3UOVA 4M52A 3GYJA 4YTNA 3UP4A 2BRYA 4P9SA 2C76A 1KSUA 1D4DA 1P2HA 3CNPA 4H4RA 1HYUA 4UP3A 1XHCA 3VRAA 2ZZCA 2VVMA 3ADAB 3AE9A 3DA1A 3LOVA 1GRBA 5CKUA 3NK1X 4XWRA 1D5TA 4H2PA 3K30A 1GESA 1VDCA 1K0IA 3FBSA 4B65A 4B63A 3IWAA 3UTGA 1BWCA 2C72A 2YLWA 1TYTA 4B1BA 3NKSA 3QFBA 3QSSA 1TDNA 2EQ9A 2ZBWA 1ZMCA 2BS4A 1TDEA 4PAAA 3SYIA 3QSEA 4CNKA 3NNEA 3DJDA 2V60A 4AP3A 1FOHA 1IUUA 2BXSA 3AEFA 2VQ7A 3D8XA 3T31A 3RNMA 2V61A 1CJ3A 2BC0A 2YG5A 4G74A 2RGJA 3GWDA 4YKGA 3HYXA 1D7YA 3VR8A 2XVIA 1IUXA 4C5OA 2GR3A 1PS9A 2PYXA 2VOUA 2VRLA 4FX9A 3COXA 3UTEA 2C75A 2RGOA 4E0VA 4BK3A 4JDRA 2YLSA 5EB5A 1RSGA 1NHPA 4OPTA 1PHHA 4K22A 2RGHA 1V59A 4K5RA 3UKLA 2B9XA 1KF6A 4A5LA 1E39A 3GYXA 4H4VA 2CFYA 5EB4A 2YG6A 4HA6A 4OVIA 1H83A 4YWOA 2WBAA 3HYVA 4OPGA 5KWFA 2IVEA 3CGEA 1NHSA 4J36A 2A8XA 1CL0A 2F5ZA 3IHGA 3F8DA 3UOZA 1Y56A 3AYIA 1BF3A 4AP1A 4EMIA 2WETA 4X9MA 3QSMA 3SY4A 1REOA 2YLRA 3FPZA 1LV0A 5FMHA 2Z5YA 1TDOA 3BHKA 5IQ1A 3LJPA 4U8OA 2YG4A 4Z2RA 5JCIA 4EQSA 4CCRA 3UKAA 3AE3A 3NHOX 2C64A 1GALA 3L8KA 2XYOA 1CC4A 1O95A 3GD4A 3AEDA 3CPJG 3WE0A 4H2QA 1E1LA 1FEAA 1O94A 3BNUA 3C4AA 3ICRA 2APGA 4BK2A 4FDCB 4B67A 2OAMA 4YSHA 3M12A 3FMWA 4II2A 2BS2A 2ARDA 3KD9A 2YG7A 3REDA 2Q0LA 2J3NA 3VRDB 3BI5A 1JRXA 3CIRA 3Q6JA 1PJ5A 3NYEA 2V5ZA 2CULA 3H8LA 4A9WA 4GUVA 5FS9A 2H89A 4U8LA 5C2TA 1E1MA 3DJGX 4A7AA 5EOWA 2I0ZA 3EF6A 3LZWA 4NTEA 1GRAA 1OJAA 2FJDA 2V3AA 4O5UA 2YAUA 4U2LA 4D04A 4X9NA 1LVLA 2GR0A 2TPRA 4Y4MA 4K5SA 3BI2A 5KVIA 1L9EA 2YWLA 4EMWA 1CHUA 1N4WA 2BXRA 2WOIA 4J33A 2AQJA 1GRFA 1H84A 1GETA 2BC1A 4Z44A 2V3BA 2B9YA 2IVDA 4OPIA 1EL9A 1PBDA 4YT0A 2H88A 3NIXA 4K7ZA 4ZCDA 1F8SA 1O5WA 4WCTA 5IQ4A 1F8WA 4I58A 3CTYA 3UCLA 4A99A 2FJAA 3AXBA 2C66A 4KX6A 2XFNA 3ITJA 3QJ4A 3GSIA 3SM8A 3F8RA 5ER0A 2ZZ0A 3IHMA 4PABA 1AOGA 3DK8A 1EL7A 2Q0KA 1E1NA 2E1MA 4XWZA 3K7MX 1OJDA 4JY2A 3AE6A 3DK9A 4RG4A 4UDQA 2NVKX 4TM0A 3SZ0A 1K0LA 4EQWA 1IUWA 4H4QA 1NENA 2BRAA 5CQFA 5KVHA 2Q7VA 1D7LA 3LXDA 4NTDA 1B4VA 1TDKA 4EMJA 3PO7A 3ABVA 3SGLA 1DXLA 2BK4A 3BHFA 1GRHA 3LADA 1PDHA 2XFPA 4DNAA 3PVCA 4BV6A 1RYIA 1RP0A 2C65A 4H4TA 4UDRA 5GRTA 2GAGB 4K8DA 3CN8A 3IC9A 1LQUA 1DJQA 2B7RA 4I59A 1FL2A 4AOSA 1JEHA 4RSLA 5BULA 2FJBA 2YVJA 2VRMA 3DMEA 2GAHB 1H82A 2BA9A 2WPFA 2R0CA 4A65A 4GAPA 1JNRA 2YVGA 3CNDA 1H86A 1E1KA 2WS3A 3L1RA 3ISHA 5HXIA 3H4KA 3SZWA 3SZCA 1JRZA 4H7UA 1GRTA 4U8MA 2GMJA 2YM2A 3ALJA 2R4EA 3ALMA 1KDGA 2R45A 4H50A 3KLJA 3P4RA 3SQPA 2BCGG 1JNZA 1K4QA 1Q1RA 3EANA 3V3OA 2GMHA 2Y6RA 2WQYA 2XLPA 3DJJA 3HZLA 4CRTA 1CJCA 2RABA 1LTXR 3S61A 3DH9A 2QAEA 2GH5A 2R0GA 2AAQA 1NAAA 3UKFA 5U63A 3BNMA 4DSGA 2YVFA 2E4GA 3CNSA 1NG4A 2XFOA 5FS8A 3UTHA 3AE4A 3DGHA 3PS9A 3ICSA 3CPIG 1JU2A 1Y0PA 3G5QA 3KA7A 1UKVG 2EQ7A 4NWZA 3UKKA 3NYCA 4Z2UA 4ZCCA 3CNJA 1P2EA 1JRYA 3ATQA 2TMDA 2X3NA 4JN9A 2XVEA 4C77A 3I3LA 1H81A 5M0ZA 3D1CA 2JAEA 2C67A 1GTHA 3GRTA 4Z24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2Y A;  3KPK A;  5KMQ A;  5KMP A;  4G6H A;  3T0K A;  4GAV A;  3HYV A;  3SX6 A;  3SXI A;  3SYI A;  4GAP A;  3SZ0 A;  3SZF A;  3T31 A;  3SZW A;  3SZC A;  3SY4 A;  4G9K A;  4G74 A;  4NWZ A;  3HYX A;  3T2Z A;  3T14 A;  4G73 A;  3T2K A;  5KMR A;  4G6G A;  3HYW A;  5KMS A; 
#chains in the Genus database with same CATH topology
 2BAB A;  4GR1 A;  3AWI A;  1PBE A;  3CGD A;  4IA6 A;  1EBD A;  3AEE A;  4FK1 C;  1NPX A;  2JKC A;  3OZ2 A;  1E6E A;  3KPF A;  5L46 A;  1QLB A;  1GV4 A;  2XVF A;  2NPX A;  2V6O A;  4OPC A;  4GAV A;  1XDI A;  2WDR A;  2XLT A;  2JB2 A;  5KXJ A;  5KNL A;  1PBF A;  4APN A;  4BK1 A;  1LQT A;  3E1T A;  4CCQ A;  1PXA A;  4KPR A;  4EM4 A;  2GF3 A;  3LB8 A;  2XFU A;  1XAN A;  1FEC A;  1MO9 A;  4GRT A;  1ZOY A;  4ZN0 A;  1IUS A;  1FEB A;  1Q9I A;  1CJ4 A;  4HB9 A;  3K7T A;  3GRS A;  1L9D A;  3ALL A;  5J7X A;  5KMS A;  3P9U A;  4USQ A;  1N4U A;  1NHR A;  1ZP0 A;  4REK A;  1CBO A;  1VQW A;  3KKJ A;  5KMQ A;  5U25 A;  4U8I A;  5HHF A;  3M0O A;  2FBW A;  1M64 A;  1OJ9 A;  2A87 A;  3NLC A;  5BUK A;  5M10 A;  1DOC A;  1ZMD A;  4Z2T A;  2GQF A;  3RP7 A;  2XFQ A;  4O5Q A;  5KOX A;  2JK6 A;  3FG2 P;  3CNT A;  3ICT A;  4IA5 A;  1N1P A;  2WU5 A;  2OLO A;  3JSK A;  3T2Z A;  1SEZ A;  3NG7 X;  2EQ6 A;  2YR4 A;  4B64 A;  3M13 A;  4NNJ A;  4YKF A;  5KMP A;  1GXF A;  1L0V A;  4C3Y A;  4H4P A;  4NTC A;  1PBC A;  2PHH A;  4LII A;  1EL8 A;  5LV9 A;  3CGB A;  4B66 A;  2VQB A;  1F3P A;  3O0H A;  1PXB A;  5JCK A;  2WES A;  1KNR A;  4EIP A;  1IUV A;  1Z6L A;  3SX6 A;  3GYI A;  2YR5 A;  2XCG A;  3NRN A;  1BGJ A;  4USR A;  2WDQ A;  4EQR A;  1BKW A;  5JCM A;  1N4V A;  4U8P A;  1ZOV A;  3EAO A;  2WP6 A;  4X4J A;  2Z5X A;  4TLX A;  1ZKQ A;  3VQR A;  4LA1 A;  1PBB A;  1TRB A;  2DKI A;  4GF7 A;  4RG3 A;  4EQX A;  1COY A;  3UTF A;  5KRQ A;  1GOS A;  2XLU A;  4CNJ A;  2DKH A;  4G6G A;  4B68 A;  3CPH G;  5HY5 A;  1EL5 A;  2C3C A;  2GR2 A;  4JNQ A;  1GER A;  3NK2 X;  2B7S A;  4Y4N A;  4NEW A;  3C96 A;  3NT6 A;  1PXC A;  2BYB A;  4IVM B;  3CMM A;  1H7X A;  3AYL A;  2OLN A;  3UP5 A;  2WP9 A;  1B5Q A;  3AB1 A;  1B37 A;  3G5R A;  3NN0 X;  1Q1W A;  2X50 A;  1YKJ A;  3AYJ A;  2VVL A;  1DNC A;  3AD9 B;  1D4E A;  2GQW A;  2YR6 A;  4B69 A;  3C4N A;  3NGC X;  3URH A;  5JCN A;  3UKH A;  3RP8 A;  5KOW A;  2CVJ A;  4OPD A;  2A89 A;  3FIM B;  3EPT A;  4H4U A;  1OJT A;  3GD3 A;  1NHQ A;  2GV8 A;  4G73 A;  4IVO B;  4U8N A;  3DGZ A;  5TR3 A;  1X31 B;  3I6D A;  2XLS A;  2HQM A;  3K7Q X;  3VR9 A;  2X99 A;  4J2W A;  4YSZ A;  2YLT A;  4CY6 A;  3LZX A;  1Y56 B;  3KPK A;  4JY3 A;  2WP5 A;  2JB1 A;  2WOW A;  5C3J A;  3NTD A;  1QJD A;  4Z43 A;  4U2T A;  4G6H A;  3T0K A;  3P4Q A;  1PN0 A;  2BK3 A;  3V3N A;  4AT2 A;  1NEK A;  1F8R A;  1GND A;  1L9C A;  3P4S A;  3T37 A;  4JQ9 A;  4EM3 A;  1DOE A;  1VG0 A;  4FK1 A;  4H2R A;  5FS7 A;  2AR8 A;  2XVJ A;  4GDE A;  1JOA A;  2OA1 A;  1F6M A;  2YG3 A;  3DK4 A;  4NZH A;  3BI4 A;  1GTE A;  4IV9 A;  5J60 A;  4J34 A;  1IJH A;  4H2N A;  3NN6 X;  3S5W A;  1PJ7 A;  3P1W A;  1E7P A;  1B8S A;  2WU2 A;  3AE8 A;  2C7G A;  3T2K A;  5BVA A;  4GDP A;  1FCD A;  5BRT A;  3SFD A;  1BGN A;  1GRG A;  3G5S A;  1GT8 A;  3Q9T A;  3SFE A;  2X8H A;  2JB3 A;  3NH3 X;  4AOX A;  2WEU A;  4UDP A;  4U8J A;  4H4W A;  4BJY A;  3NTA A;  4CY8 A;  1YY5 A;  2C73 A;  4YSY A;  1D4C A;  5GSN A;  3QVP A;  4Z25 A;  4ADW A;  4BJZ A;  4CBQ A;  4D03 A;  4EIQ A;  2WPC A;  4XXG A;  3QVR A;  3KVE A;  4NEV A;  2QA2 A;  3F8P A;  4K2X A;  1VG9 A;  2C4C A;  2GVC A;  3QFA A;  3SZF A;  1DJN A;  2VVL G;  1ONF A;  4A6N B;  1S2Y A;  1DOB A;  1S3B A;  4LU6 A;  1GRE A;  1W4X A;  3AEA A;  2X8C A;  3V76 A;  2R4J A;  2B76 A;  2VZ2 A;  1CJ2 A;  2FJE A;  3T14 A;  5KMR A;  3UKP A;  4Y4L A;  1QO8 A;  3AE2 A;  1CC6 A;  4ECH A;  2YM1 A;  1ZX9 A;  2IID A;  4J56 A;  3H8I A;  3IF9 A;  2QA1 A;  1KFY A;  3ATR A;  3ZYX A;  2BAC A;  1TDF A;  2ACZ A;  2Q6U A;  2WHD A;  3R9U A;  3ZDN A;  3GDP A;  4C74 A;  4Z26 A;  1K0J A;  4OCG A;  2WDV A;  1TYP A;  3B3R A;  2R9Z A;  3VRB A;  1KNP A;  4II3 A;  4H4X A;  1VRQ B;  4TLZ A;  2C3D A;  2O9Z A;  4C3X A;  1CC2 A;  2CDU A;  2C70 A;  1LJ1 A;  4G9K A;  4H4S A;  4J57 A;  1NDA A;  3KU9 A;  5DBJ A;  5U1O A;  1KSS A;  3AEB A;  1BZL A;  5HYM A;  3CGC A;  4OPU A;  1GSN A;  3AD8 B;  4TM3 A;  3AE7 A;  1YQ4 A;  4A79 A;  2QCU A;  2R0P A;  4A6N A;  1ELI A;  3UKQ A;  1IUT A;  1GEU A;  3T2Y A;  1DOD A;  2GRT A;  1YQ3 A;  2W0H A;  3II4 A;  4TM4 A;  1LPF A;  3DJE A;  5FS6 A;  2B9W A;  3GDN A;  2OAL A;  4N9X A;  4AT0 A;  2YQU A;  4DSH A;  2Y6Q A;  3GWF A;  5EBK A;  3GMC A;  4H4Z A;  3SXI A;  1ZK7 A;  3UOY A;  2BCP A;  2GEW A;  1OJC A;  4MJW A;  4YXD A;  1ZDL A;  5IPY A;  2BK5 A;  2JBV A;  1PJ6 A;  1XPQ A;  4GCM A;  2BS3 A;  2GR1 A;  2ZZB A;  4TM1 A;  1H6V A;  4YTP A;  3P4P A;  3GMB A;  3NK0 X;  1CF3 A;  4DGK A;  2XLR A;  4YSX A;  3UOX A;  4H4Y A;  2GB0 A;  1H7W A;  2R46 A;  2XVH A;  2XDO A;  2YLZ A;  3HYW A;  3AEG A;  3AD7 B;  4ICY A;  3AE1 A;  1MOK A;  4U8K A;  1ZY8 A;  3OC4 A;  4WX1 A;  4YTM A;  4BUR A;  1S3E A;  3RHA A;  3RP6 A;  3B6D A;  1MXT A;  4U2S A;  1GPE A;  2WOV A;  2X8G A;  1M6I A;  2UZZ A;  3AEC A;  2E5V A;  2YLX A;  1S2Q A;  2WPE A;  4JNA A;  5JCL A;  1YQZ A;  4OPL A;  3NYF A;  1NG3 A;  3AE5 A;  2EQ8 A;  4J31 A;  3UOV A;  4M52 A;  3GYJ A;  4YTN A;  3UP4 A;  2BRY A;  4P9S A;  2C76 A;  1KSU A;  1D4D A;  1P2H A;  3CNP A;  4H4R A;  1HYU A;  4UP3 A;  1XHC A;  3VRA A;  2ZZC A;  2VVM A;  3ADA B;  3AE9 A;  3DA1 A;  3LOV A;  1GRB A;  5CKU A;  3NK1 X;  4XWR A;  1D5T A;  4H2P A;  3K30 A;  1GES A;  1VDC A;  1K0I A;  3FBS A;  4B65 A;  4B63 A;  3IWA A;  3UTG A;  1BWC A;  2C72 A;  2YLW A;  1TYT A;  4B1B A;  3NKS A;  3QFB A;  3QSS A;  1TDN A;  2EQ9 A;  2ZBW A;  1ZMC A;  2BS4 A;  1TDE A;  4PAA A;  3SYI A;  3QSE A;  4CNK A;  3NNE A;  3DJD A;  2V60 A;  4AP3 A;  1FOH A;  1IUU A;  2BXS A;  3AEF A;  2VQ7 A;  3D8X A;  3T31 A;  3RNM A;  2V61 A;  1CJ3 A;  2BC0 A;  2YG5 A;  4G74 A;  2RGJ A;  3GWD A;  4YKG A;  3HYX A;  1D7Y A;  3VR8 A;  2XVI A;  1IUX A;  4C5O A;  2GR3 A;  1PS9 A;  2PYX A;  2VOU A;  2VRL A;  4FX9 A;  3COX A;  3UTE A;  2C75 A;  2RGO A;  4E0V A;  4BK3 A;  4JDR A;  2YLS A;  5EB5 A;  1RSG A;  1NHP A;  4OPT A;  1PHH A;  4K22 A;  2RGH A;  1V59 A;  4K5R A;  3UKL A;  2B9X A;  1KF6 A;  4A5L A;  1E39 A;  3GYX A;  4H4V A;  2CFY A;  5EB4 A;  2YG6 A;  4HA6 A;  4OVI A;  1H83 A;  4YWO A;  2WBA A;  3HYV A;  4OPG A;  5KWF A;  2IVE A;  3CGE A;  1NHS A;  4J36 A;  2A8X A;  1CL0 A;  2F5Z A;  3IHG A;  3F8D A;  3UOZ A;  1Y56 A;  3AYI A;  1BF3 A;  4AP1 A;  4EMI A;  2WET A;  4X9M A;  3QSM A;  3SY4 A;  1REO A;  2YLR A;  3FPZ A;  1LV0 A;  5FMH A;  2Z5Y A;  1TDO A;  3BHK A;  5IQ1 A;  3LJP A;  4U8O A;  2YG4 A;  4Z2R A;  5JCI A;  4EQS A;  4CCR A;  3UKA A;  3AE3 A;  3NHO X;  2C64 A;  1GAL A;  3L8K A;  2XYO A;  1CC4 A;  1O95 A;  3GD4 A;  3AED A;  3CPJ G;  3WE0 A;  4H2Q A;  1E1L A;  1FEA A;  1O94 A;  3BNU A;  3C4A A;  3ICR A;  2APG A;  4BK2 A;  4FDC B;  4B67 A;  2OAM A;  4YSH A;  3M12 A;  3FMW A;  4II2 A;  2BS2 A;  2ARD A;  3KD9 A;  2YG7 A;  3RED A;  2Q0L A;  2J3N A;  3VRD B;  3BI5 A;  1JRX A;  3CIR A;  3Q6J A;  1PJ5 A;  3NYE A;  2V5Z A;  2CUL A;  3H8L A;  4A9W A;  4GUV A;  5FS9 A;  2H89 A;  4U8L A;  5C2T A;  1E1M A;  3DJG X;  4A7A A;  5EOW A;  2I0Z A;  3EF6 A;  3LZW A;  4NTE A;  1GRA A;  1OJA A;  2FJD A;  2V3A A;  4O5U A;  2YAU A;  4U2L A;  4D04 A;  4X9N A;  1LVL A;  2GR0 A;  2TPR A;  4Y4M A;  4K5S A;  3BI2 A;  5KVI A;  1L9E A;  2YWL A;  4EMW A;  1CHU A;  1N4W A;  2BXR A;  2WOI A;  4J33 A;  2AQJ A;  1GRF A;  1H84 A;  1GET A;  2BC1 A;  4Z44 A;  2V3B A;  2B9Y A;  2IVD A;  4OPI A;  1EL9 A;  1PBD A;  4YT0 A;  2H88 A;  3NIX A;  4K7Z A;  4ZCD A;  1F8S A;  1O5W A;  4WCT A;  5IQ4 A;  1F8W A;  4I58 A;  3CTY A;  3UCL A;  4A99 A;  2FJA A;  3AXB A;  2C66 A;  4KX6 A;  2XFN A;  3ITJ A;  3QJ4 A;  3GSI A;  3SM8 A;  3F8R A;  5ER0 A;  2ZZ0 A;  3IHM A;  4PAB A;  1AOG A;  3DK8 A;  1EL7 A;  2Q0K A;  1E1N A;  2E1M A;  4XWZ A;  3K7M X;  1OJD A;  4JY2 A;  3AE6 A;  3DK9 A;  4RG4 A;  4UDQ A;  2NVK X;  4TM0 A;  3SZ0 A;  1K0L A;  4EQW A;  1IUW A;  4H4Q A;  1NEN A;  2BRA A;  5CQF A;  5KVH A;  2Q7V A;  1D7L A;  3LXD A;  4NTD A;  1B4V A;  1TDK A;  4EMJ A;  3PO7 A;  3ABV A;  3SGL A;  1DXL A;  2BK4 A;  3BHF A;  1GRH A;  3LAD A;  1PDH A;  2XFP A;  4DNA A;  3PVC A;  4BV6 A;  1RYI A;  1RP0 A;  2C65 A;  4H4T A;  4UDR A;  5GRT A;  2GAG B;  4K8D A;  3CN8 A;  3IC9 A;  1LQU A;  1DJQ A;  2B7R A;  4I59 A;  1FL2 A;  4AOS A;  1JEH A;  4RSL A;  5BUL A;  2FJB A;  2YVJ A;  2VRM A;  3DME A;  2GAH B;  1H82 A;  2BA9 A;  2WPF A;  2R0C A;  4A65 A;  4GAP A;  1JNR A;  2YVG A;  3CND A;  1H86 A;  1E1K A;  2WS3 A;  3L1R A;  3ISH A;  5HXI A;  3H4K A;  3SZW A;  3SZC A;  1JRZ A;  4H7U A;  1GRT A;  4U8M A;  2GMJ A;  2YM2 A;  3ALJ A;  2R4E A;  3ALM A;  1KDG A;  2R45 A;  4H50 A;  3KLJ A;  3P4R A;  3SQP A;  2BCG G;  1JNZ A;  1K4Q A;  1Q1R A;  3EAN A;  3V3O A;  2GMH A;  2Y6R A;  2WQY A;  2XLP A;  3DJJ A;  3HZL A;  4CRT A;  1CJC A;  2RAB A;  1LTX R;  3S61 A;  3DH9 A;  2QAE A;  2GH5 A;  2R0G A;  2AAQ A;  1NAA A;  3UKF A;  5U63 A;  3BNM A;  4DSG A;  2YVF A;  2E4G A;  3CNS A;  1NG4 A;  2XFO A;  5FS8 A;  3UTH A;  3AE4 A;  3DGH A;  3PS9 A;  3ICS A;  3CPI G;  1JU2 A;  1Y0P A;  3G5Q A;  3KA7 A;  1UKV G;  2EQ7 A;  4NWZ A;  3UKK A;  3NYC A;  4Z2U A;  4ZCC A;  3CNJ A;  1P2E A;  1JRY A;  3ATQ A;  2TMD A;  2X3N A;  4JN9 A;  2XVE A;  4C77 A;  3I3L A;  1H81 A;  5M0Z A;  3D1C A;  2JAE A;  2C67 A;  1GTH A;  3GRT A;  4Z24 A; 
#chains in the Genus database with same CATH homology
 2BAB A;  4GR1 A;  3AWI A;  1PBE A;  3CGD A;  4IA6 A;  1EBD A;  3AEE A;  4FK1 C;  1NPX A;  2JKC A;  3OZ2 A;  1E6E A;  3KPF A;  5L46 A;  1QLB A;  1GV4 A;  2XVF A;  2NPX A;  2V6O A;  4OPC A;  4GAV A;  1XDI A;  2WDR A;  2XLT A;  2JB2 A;  5KXJ A;  5KNL A;  1PBF A;  4APN A;  4BK1 A;  1LQT A;  3E1T A;  4CCQ A;  1PXA A;  4KPR A;  4EM4 A;  2GF3 A;  3LB8 A;  2XFU A;  1XAN A;  1FEC A;  1MO9 A;  4GRT A;  1ZOY A;  4ZN0 A;  1IUS A;  1FEB A;  1Q9I A;  1CJ4 A;  4HB9 A;  3K7T A;  3GRS A;  1L9D A;  3ALL A;  5J7X A;  5KMS A;  3P9U A;  4USQ A;  1N4U A;  1NHR A;  1ZP0 A;  4REK A;  1CBO A;  1VQW A;  3KKJ A;  5KMQ A;  5U25 A;  4U8I A;  5HHF A;  3M0O A;  2FBW A;  1M64 A;  1OJ9 A;  2A87 A;  3NLC A;  5BUK A;  5M10 A;  1DOC A;  1ZMD A;  4Z2T A;  2GQF A;  3RP7 A;  2XFQ A;  4O5Q A;  5KOX A;  2JK6 A;  3FG2 P;  3CNT A;  3ICT A;  4IA5 A;  1N1P A;  2WU5 A;  2OLO A;  3JSK A;  3T2Z A;  1SEZ A;  3NG7 X;  2EQ6 A;  2YR4 A;  4B64 A;  3M13 A;  4NNJ A;  4YKF A;  5KMP A;  1GXF A;  1L0V A;  4C3Y A;  4H4P A;  4NTC A;  1PBC A;  2PHH A;  4LII A;  1EL8 A;  5LV9 A;  3CGB A;  4B66 A;  2VQB A;  1F3P A;  3O0H A;  1PXB A;  5JCK A;  2WES A;  1KNR A;  4EIP A;  1IUV A;  1Z6L A;  3SX6 A;  3GYI A;  2YR5 A;  2XCG A;  3NRN A;  1BGJ A;  4USR A;  2WDQ A;  4EQR A;  1BKW A;  5JCM A;  1N4V A;  4U8P A;  1ZOV A;  3EAO A;  2WP6 A;  4X4J A;  2Z5X A;  4TLX A;  1ZKQ A;  3VQR A;  4LA1 A;  1PBB A;  1TRB A;  2DKI A;  4GF7 A;  4RG3 A;  4EQX A;  1COY A;  3UTF A;  5KRQ A;  1GOS A;  2XLU A;  4CNJ A;  2DKH A;  4G6G A;  4B68 A;  3CPH G;  5HY5 A;  1EL5 A;  2C3C A;  2GR2 A;  4JNQ A;  1GER A;  3NK2 X;  2B7S A;  4Y4N A;  4NEW A;  3C96 A;  3NT6 A;  1PXC A;  2BYB A;  4IVM B;  3CMM A;  1H7X A;  3AYL A;  2OLN A;  3UP5 A;  2WP9 A;  1B5Q A;  3AB1 A;  1B37 A;  3G5R A;  3NN0 X;  1Q1W A;  2X50 A;  1YKJ A;  3AYJ A;  2VVL A;  1DNC A;  3AD9 B;  1D4E A;  2GQW A;  2YR6 A;  4B69 A;  3C4N A;  3NGC X;  3URH A;  5JCN A;  3UKH A;  3RP8 A;  5KOW A;  2CVJ A;  4OPD A;  2A89 A;  3FIM B;  3EPT A;  4H4U A;  1OJT A;  3GD3 A;  1NHQ A;  2GV8 A;  4G73 A;  4IVO B;  4U8N A;  3DGZ A;  5TR3 A;  1X31 B;  3I6D A;  2XLS A;  2HQM A;  3K7Q X;  3VR9 A;  2X99 A;  4J2W A;  4YSZ A;  2YLT A;  4CY6 A;  3LZX A;  1Y56 B;  3KPK A;  4JY3 A;  2WP5 A;  2JB1 A;  2WOW A;  5C3J A;  3NTD A;  1QJD A;  4Z43 A;  4U2T A;  4G6H A;  3T0K A;  3P4Q A;  1PN0 A;  2BK3 A;  3V3N A;  4AT2 A;  1NEK A;  1F8R A;  1GND A;  1L9C A;  3P4S A;  3T37 A;  4JQ9 A;  4EM3 A;  1DOE A;  1VG0 A;  4FK1 A;  4H2R A;  5FS7 A;  2AR8 A;  2XVJ A;  4GDE A;  1JOA A;  2OA1 A;  1F6M A;  2YG3 A;  3DK4 A;  4NZH A;  3BI4 A;  1GTE A;  4IV9 A;  5J60 A;  4J34 A;  1IJH A;  4H2N A;  3NN6 X;  3S5W A;  1PJ7 A;  3P1W A;  1E7P A;  1B8S A;  2WU2 A;  3AE8 A;  2C7G A;  3T2K A;  5BVA A;  4GDP A;  1FCD A;  5BRT A;  3SFD A;  1BGN A;  1GRG A;  3G5S A;  1GT8 A;  3Q9T A;  3SFE A;  2X8H A;  2JB3 A;  3NH3 X;  4AOX A;  2WEU A;  4UDP A;  4U8J A;  4H4W A;  4BJY A;  3NTA A;  4CY8 A;  1YY5 A;  2C73 A;  4YSY A;  1D4C A;  5GSN A;  3QVP A;  4Z25 A;  4ADW A;  4BJZ A;  4CBQ A;  4D03 A;  4EIQ A;  2WPC A;  4XXG A;  3QVR A;  3KVE A;  4NEV A;  2QA2 A;  3F8P A;  4K2X A;  1VG9 A;  2C4C A;  2GVC A;  3QFA A;  3SZF A;  1DJN A;  2VVL G;  1ONF A;  4A6N B;  1S2Y A;  1DOB A;  1S3B A;  4LU6 A;  1GRE A;  1W4X A;  3AEA A;  2X8C A;  3V76 A;  2R4J A;  2B76 A;  2VZ2 A;  1CJ2 A;  2FJE A;  3T14 A;  5KMR A;  3UKP A;  4Y4L A;  1QO8 A;  3AE2 A;  1CC6 A;  4ECH A;  2YM1 A;  1ZX9 A;  2IID A;  4J56 A;  3H8I A;  3IF9 A;  2QA1 A;  1KFY A;  3ATR A;  3ZYX A;  2BAC A;  1TDF A;  2ACZ A;  2Q6U A;  2WHD A;  3R9U A;  3ZDN A;  3GDP A;  4C74 A;  4Z26 A;  1K0J A;  4OCG A;  2WDV A;  1TYP A;  3B3R A;  2R9Z A;  3VRB A;  1KNP A;  4II3 A;  4H4X A;  1VRQ B;  4TLZ A;  2C3D A;  2O9Z A;  4C3X A;  1CC2 A;  2CDU A;  2C70 A;  1LJ1 A;  4G9K A;  4H4S A;  4J57 A;  1NDA A;  3KU9 A;  5DBJ A;  5U1O A;  1KSS A;  3AEB A;  1BZL A;  5HYM A;  3CGC A;  4OPU A;  1GSN A;  3AD8 B;  4TM3 A;  3AE7 A;  1YQ4 A;  4A79 A;  2QCU A;  2R0P A;  4A6N A;  1ELI A;  3UKQ A;  1IUT A;  1GEU A;  3T2Y A;  1DOD A;  2GRT A;  1YQ3 A;  2W0H A;  3II4 A;  4TM4 A;  1LPF A;  3DJE A;  5FS6 A;  2B9W A;  3GDN A;  2OAL A;  4N9X A;  4AT0 A;  2YQU A;  4DSH A;  2Y6Q A;  3GWF A;  5EBK A;  3GMC A;  4H4Z A;  3SXI A;  1ZK7 A;  3UOY A;  2BCP A;  2GEW A;  1OJC A;  4MJW A;  4YXD A;  1ZDL A;  5IPY A;  2BK5 A;  2JBV A;  1PJ6 A;  1XPQ A;  4GCM A;  2BS3 A;  2GR1 A;  2ZZB A;  4TM1 A;  1H6V A;  4YTP A;  3P4P A;  3GMB A;  3NK0 X;  1CF3 A;  4DGK A;  2XLR A;  4YSX A;  3UOX A;  4H4Y A;  2GB0 A;  1H7W A;  2R46 A;  2XVH A;  2XDO A;  2YLZ A;  3HYW A;  3AEG A;  3AD7 B;  4ICY A;  3AE1 A;  1MOK A;  4U8K A;  1ZY8 A;  3OC4 A;  4WX1 A;  4YTM A;  4BUR A;  1S3E A;  3RHA A;  3RP6 A;  3B6D A;  1MXT A;  4U2S A;  1GPE A;  2WOV A;  2X8G A;  1M6I A;  2UZZ A;  3AEC A;  2E5V A;  2YLX A;  1S2Q A;  2WPE A;  4JNA A;  5JCL A;  1YQZ A;  4OPL A;  3NYF A;  1NG3 A;  3AE5 A;  2EQ8 A;  4J31 A;  3UOV A;  4M52 A;  3GYJ A;  4YTN A;  3UP4 A;  2BRY A;  4P9S A;  2C76 A;  1KSU A;  1D4D A;  1P2H A;  3CNP A;  4H4R A;  1HYU A;  4UP3 A;  1XHC A;  3VRA A;  2ZZC A;  2VVM A;  3ADA B;  3AE9 A;  3DA1 A;  3LOV A;  1GRB A;  5CKU A;  3NK1 X;  4XWR A;  1D5T A;  4H2P A;  3K30 A;  1GES A;  1VDC A;  1K0I A;  3FBS A;  4B65 A;  4B63 A;  3IWA A;  3UTG A;  1BWC A;  2C72 A;  2YLW A;  1TYT A;  4B1B A;  3NKS A;  3QFB A;  3QSS A;  1TDN A;  2EQ9 A;  2ZBW A;  1ZMC A;  2BS4 A;  1TDE A;  4PAA A;  3SYI A;  3QSE A;  4CNK A;  3NNE A;  3DJD A;  2V60 A;  4AP3 A;  1FOH A;  1IUU A;  2BXS A;  3AEF A;  2VQ7 A;  3D8X A;  3T31 A;  3RNM A;  2V61 A;  1CJ3 A;  2BC0 A;  2YG5 A;  4G74 A;  2RGJ A;  3GWD A;  4YKG A;  3HYX A;  1D7Y A;  3VR8 A;  2XVI A;  1IUX A;  4C5O A;  2GR3 A;  1PS9 A;  2PYX A;  2VOU A;  2VRL A;  4FX9 A;  3COX A;  3UTE A;  2C75 A;  2RGO A;  4E0V A;  4BK3 A;  4JDR A;  2YLS A;  5EB5 A;  1RSG A;  1NHP A;  4OPT A;  1PHH A;  4K22 A;  2RGH A;  1V59 A;  4K5R A;  3UKL A;  2B9X A;  1KF6 A;  4A5L A;  1E39 A;  3GYX A;  4H4V A;  2CFY A;  5EB4 A;  2YG6 A;  4HA6 A;  4OVI A;  1H83 A;  4YWO A;  2WBA A;  3HYV A;  4OPG A;  5KWF A;  2IVE A;  3CGE A;  1NHS A;  4J36 A;  2A8X A;  1CL0 A;  2F5Z A;  3IHG A;  3F8D A;  3UOZ A;  1Y56 A;  3AYI A;  1BF3 A;  4AP1 A;  4EMI A;  2WET A;  4X9M A;  3QSM A;  3SY4 A;  1REO A;  2YLR A;  3FPZ A;  1LV0 A;  5FMH A;  2Z5Y A;  1TDO A;  3BHK A;  5IQ1 A;  3LJP A;  4U8O A;  2YG4 A;  4Z2R A;  5JCI A;  4EQS A;  4CCR A;  3UKA A;  3AE3 A;  3NHO X;  2C64 A;  1GAL A;  3L8K A;  2XYO A;  1CC4 A;  1O95 A;  3GD4 A;  3AED A;  3CPJ G;  3WE0 A;  4H2Q A;  1E1L A;  1FEA A;  1O94 A;  3BNU A;  3C4A A;  3ICR A;  2APG A;  4BK2 A;  4FDC B;  4B67 A;  2OAM A;  4YSH A;  3M12 A;  3FMW A;  4II2 A;  2BS2 A;  2ARD A;  3KD9 A;  2YG7 A;  3RED A;  2Q0L A;  2J3N A;  3VRD B;  3BI5 A;  1JRX A;  3CIR A;  3Q6J A;  1PJ5 A;  3NYE A;  2V5Z A;  2CUL A;  3H8L A;  4A9W A;  4GUV A;  5FS9 A;  2H89 A;  4U8L A;  5C2T A;  1E1M A;  3DJG X;  4A7A A;  5EOW A;  2I0Z A;  3EF6 A;  3LZW A;  4NTE A;  1GRA A;  1OJA A;  2FJD A;  2V3A A;  4O5U A;  2YAU A;  4U2L A;  4D04 A;  4X9N A;  1LVL A;  2GR0 A;  2TPR A;  4Y4M A;  4K5S A;  3BI2 A;  5KVI A;  1L9E A;  2YWL A;  4EMW A;  1CHU A;  1N4W A;  2BXR A;  2WOI A;  4J33 A;  2AQJ A;  1GRF A;  1H84 A;  1GET A;  2BC1 A;  4Z44 A;  2V3B A;  2B9Y A;  2IVD A;  4OPI A;  1EL9 A;  1PBD A;  4YT0 A;  2H88 A;  3NIX A;  4K7Z A;  4ZCD A;  1F8S A;  1O5W A;  4WCT A;  5IQ4 A;  1F8W A;  4I58 A;  3CTY A;  3UCL A;  4A99 A;  2FJA A;  3AXB A;  2C66 A;  4KX6 A;  2XFN A;  3ITJ A;  3QJ4 A;  3GSI A;  3SM8 A;  3F8R A;  5ER0 A;  2ZZ0 A;  3IHM A;  4PAB A;  1AOG A;  3DK8 A;  1EL7 A;  2Q0K A;  1E1N A;  2E1M A;  4XWZ A;  3K7M X;  1OJD A;  4JY2 A;  3AE6 A;  3DK9 A;  4RG4 A;  4UDQ A;  2NVK X;  4TM0 A;  3SZ0 A;  1K0L A;  4EQW A;  1IUW A;  4H4Q A;  1NEN A;  2BRA A;  5CQF A;  5KVH A;  2Q7V A;  1D7L A;  3LXD A;  4NTD A;  1B4V A;  1TDK A;  4EMJ A;  3PO7 A;  3ABV A;  3SGL A;  1DXL A;  2BK4 A;  3BHF A;  1GRH A;  3LAD A;  1PDH A;  2XFP A;  4DNA A;  3PVC A;  4BV6 A;  1RYI A;  1RP0 A;  2C65 A;  4H4T A;  4UDR A;  5GRT A;  2GAG B;  4K8D A;  3CN8 A;  3IC9 A;  1LQU A;  1DJQ A;  2B7R A;  4I59 A;  1FL2 A;  4AOS A;  1JEH A;  4RSL A;  5BUL A;  2FJB A;  2YVJ A;  2VRM A;  3DME A;  2GAH B;  1H82 A;  2BA9 A;  2WPF A;  2R0C A;  4A65 A;  4GAP A;  1JNR A;  2YVG A;  3CND A;  1H86 A;  1E1K A;  2WS3 A;  3L1R A;  3ISH A;  5HXI A;  3H4K A;  3SZW A;  3SZC A;  1JRZ A;  4H7U A;  1GRT A;  4U8M A;  2GMJ A;  2YM2 A;  3ALJ A;  2R4E A;  3ALM A;  1KDG A;  2R45 A;  4H50 A;  3KLJ A;  3P4R A;  3SQP A;  2BCG G;  1JNZ A;  1K4Q A;  1Q1R A;  3EAN A;  3V3O A;  2GMH A;  2Y6R A;  2WQY A;  2XLP A;  3DJJ A;  3HZL A;  4CRT A;  1CJC A;  2RAB A;  1LTX R;  3S61 A;  3DH9 A;  2QAE A;  2GH5 A;  2R0G A;  2AAQ A;  1NAA A;  3UKF A;  5U63 A;  3BNM A;  4DSG A;  2YVF A;  2E4G A;  3CNS A;  1NG4 A;  2XFO A;  5FS8 A;  3UTH A;  3AE4 A;  3DGH A;  3PS9 A;  3ICS A;  3CPI G;  1JU2 A;  1Y0P A;  3G5Q A;  3KA7 A;  1UKV G;  2EQ7 A;  4NWZ A;  3UKK A;  3NYC A;  4Z2U A;  4ZCC A;  3CNJ A;  1P2E A;  1JRY A;  3ATQ A;  2TMD A;  2X3N A;  4JN9 A;  2XVE A;  4C77 A;  3I3L A;  1H81 A;  5M0Z A;  3D1C A;  2JAE A;  2C67 A;  1GTH A;  3GRT A;  4Z24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...