4G74A

Crystal structure of ndh with quinone
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
478
structure length
471
Chain Sequence
GPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
total genus 156
structure length 471
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g74A00
4NWZA 4GAPA 3SZWA 3SX6A 5KMQA 3T2YA 3T2ZA 5KMPA 3HYVA 4G73A 3SY4A 4G6GA 3SZCA 4G74A 3T2KA 3HYXA 3KPKA 3SYIA 3SZ0A 4GAVA 3T14A 4G9KA 3T31A 3SXIA 4G6HA 3SZFA 3T0KA 5KMSA 5KMRA 3HYWA
chains in the Genus database with same CATH superfamily
2R46A 3CTYA 1ONFA 5HY5A 1FOHA 3L8KA 3REDA 3AEGA 1Y56A 2Q0LA 3HYVA 2ZZ0A 3SQPA 3LADA 2R0GA 3CPIG 1GESA 1L9DA 3LOVA 4U2LA 4YXDA 4H2NA 3UTHA 3T2KA 2DKIA 1LQTA 4J34A 3SYIA 1KDGA 1GTEA 2W0HA 3G5QA 4B63A 1OJCA 4OPUA 2XYOA 2WETA 3RP8A 3GYJA 2GAHB 4Z24A 4A6NB 4NTCA 3Q9TA 1X31B 1RYIA 2GB0A 1XANA 1ZP0A 5KMRA 3K30A 2Z5XA 4J57A 3ZYXA 3CNPA 2B76A 2XFPA 1B5QA 3VR8A 4AT0A 3D1CA 2VOUA 3F8RA 1H84A 1QO8A 1F8SA 1UKVG 3DGHA 1O94A 2YVFA 3GSIA 3NYEA 2WP6A 5FS9A 1N4WA 4A65A 1DJQA 1CF3A 3QJ4A 1K4QA 1VQWA 1FEAA 3QFAA 3AD7B 2UZZA 1M6IA 4NTEA 4B64A 1ZOYA 2VRMA 4OPGA 4X9MA 3CNJA 1KSSA 3BNMA 2YLRA 1PBEA 2GR1A 3NN0X 1ZKQA 1XHCA 4GAVA 1IUTA 3COXA 3AE9A 4Z43A 4G6HA 3QVPA 2R9ZA 1CC4A 2B7SA 1TYPA 1L0VA 1OJ9A 4UDPA 3FMWA 3EAOA 2AAQA 4FK1A 2PHHA 5JCNA 1CJCA 3S5WA 2GAGB 3NYCA 4USQA 2XLUA 3VRBA 1FECA 5JCKA 2EQ6A 2YLTA 3IC9A 2JK6A 4H4YA 4JQ9A 4G74A 1DNCA 1GV4A 1H7XA 1ELIA 1P2HA 1W4XA 3AE7A 1EL9A 4HA6A 4BURA 5KVIA 4A7AA 4BJYA 3G5RA 1IUUA 1CHUA 2ARDA 2YWLA 1N1PA 2V5ZA 3NLCA 1S3EA 3VR9A 1B8SA 2A87A 4ADWA 3T31A 2E5VA 4J36A 2RGHA 3GDNA 3DK8A 2XVJA 3GD4A 4J56A 1PXAA 2BRYA 2GVCA 3LZWA 4OPIA 1EBDA 4Y4NA 2VQ7A 3ATQA 4EMWA 4U8PA 1BZLA 4U8JA 4BV6A 1GT8A 2GMHA 2V60A 4K8DA 2FJDA 3AEEA 5KMQA 3URHA 5KMPA 2XVIA 3UKFA 1JEHA 3Q6JA 1DODA 4GDEA 1KF6A 2XLTA 4J33A 4X9NA 1PXCA 3P9UA 1Q1WA 4JNQA 1D7LA 1TDFA 3CPHG 4GRTA 2YM1A 1XDIA 4K22A 2EQ9A 1K0JA 1S2YA 4KX6A 1E1LA 1TDNA 2E1MA 1LV0A 3P4SA 4JNAA 4AP3A 4II3A 3UKKA 1GREA 1L9CA 3AD9B 2GR0A 1E1KA 4BK1A 4Z44A 1IJHA 5U63A 3DGZA 3DJJA 5LV9A 3G5SA 3P1WA 3PO7A 2BS2A 4IA6A 1ZMDA 2WP9A 3AEFA 2EQ7A 5HYMA 3AYLA 3HYWA 2X8CA 1IUSA 4U8OA 4H7UA 4J31A 3SX6A 5U25A 3AE4A 3UP4A 3IWAA 2WPFA 2BS4A 4JY3A 1S3BA 2Q7VA 2C70A 2WU2A 2JAEA 4H4ZA 4O5QA 2R4EA 2OAMA 3CNTA 2VVLG 2YR5A 1TDEA 2XFNA 1GRBA 3NNEA 4U8NA 4ECHA 2GQWA 3GYIA 5DBJA 3GYXA 3M0OA 2V6OA 1PBCA 2BK3A 4TM3A 3LB8A 4ICYA 3QVRA 4TLZA 2BRAA 3H8LA 3UKQA 4TM4A 1LJ1A 3HZLA 4XXGA 3E1TA 2H89A 2WQYA 3ICRA 5EOWA 4OPCA 3F8DA 1PDHA 2YR4A 5EBKA 3I3LA 1BKWA 2X8GA 4CBQA 4NWZA 2IIDA 2GMJA 3NK2X 4EQSA 4YTNA 3T2ZA 3AYJA 1NENA 2WDRA 4CCRA 1CC6A 1O5WA 2BA9A 3AEDA 1N4UA 3KKJA 4YSZA 3P4PA 2APGA 1ZY8A 2QAEA 2TMDA 3H8IA 2JB1A 3AE6A 4IVOB 4M52A 3ADAB 3NGCX 5FS8A 4REKA 3CGDA 4K5SA 4H4WA 3AD8B 5BVAA 2WBAA 2WHDA 3RP6A 2YLZA 3BI2A 3AE8A 3GWFA 2YVGA 2QA1A 2Z5YA 4P9SA 1TDOA 1PXBA 4TM1A 1Q1RA 1YQ4A 3L1RA 4HB9A 3NHOX 5GRTA 2BC1A 5IQ1A 3SGLA 3R9UA 4AT2A 2Y6RA 3KU9A 3GMCA 1KFYA 1S2QA 1EL8A 2B9XA 5TR3A 4CNKA 2C65A 1VDCA 2BCGG 4YKFA 4I58A 3ALMA 4JDRA 1NEKA 4A79A 3DK4A 4U8LA 2DKHA 1H81A 3FG2P 2OALA 1NHSA 2WESA 2WP5A 2JKCA 2XLRA 2YLXA 3C4NA 3CGCA 3P4QA 3QFBA 2WPEA 1D5TA 4NZHA 1NG4A 4IVMB 3ALJA 1IUWA 3CGEA 3CNDA 3GWDA 2WOVA 3UOVA 1PHHA 5JCMA 5KMSA 2BCPA 4H4TA 5KVHA 4Z25A 2GV8A 3T2YA 4IV9A 3BI5A 2BABA 3CNSA 1PJ5A 4RG3A 1GXFA 4A9WA 2CDUA 3ICTA 3K7MX 5EB4A 4ZCDA 3S61A 4Z2TA 3II4A 4EM3A 2XLPA 4CY6A 2Y6QA 2V3AA 3UOXA 1GRGA 4H2QA 4YWOA 3UOYA 1VG0A 3O0HA 4FK1C 5KNLA 3SFDA 2FJBA 1CJ2A 2YR6A 1O95A 3CGBA 1ZMCA 4WX1A 3QSSA 3SZ0A 3ISHA 4Z26A 1GEUA 4O5UA 3FIMB 3GRSA 3SZFA 3EF6A 4H4SA 3M12A 2C73A 1DJNA 4PABA 1JRYA 4NTDA 3ATRA 2EQ8A 1COYA 2QCUA 4BK3A 3JSKA 4G73A 1EL7A 2YAUA 4EMJA 5CKUA 4E0VA 3AWIA 3OC4A 2TPRA 4EIPA 1PBBA 4OCGA 2NVKX 3KA7A 2VQBA 4K2XA 4OPTA 4B69A 2R0CA 1JU2A 3T37A 1GRTA 1GPEA 3AE5A 1M64A 3RNMA 1GSNA 1VG9A 2R0PA 3GD3A 2YM2A 2X99A 3M13A 4U8KA 4APNA 1E1NA 1NAAA 5KXJA 4EM4A 2VVMA 2BK5A 5FMHA 1GETA 3IF9A 1B37A 3NIXA 4DSHA 4EMIA 1H6VA 2CULA 3PVCA 4G6GA 4JN9A 4U8IA 2CVJA 2Q6UA 4NEWA 2V61A 1CC2A 2A89A 1YQ3A 2B7RA 4YSHA 3KPKA 2RGJA 3V3OA 3GDPA 1K0IA 2BYBA 2X8HA 1TRBA 5J60A 4DGKA 1GRAA 3V76A 4YSXA 2XVEA 3BNUA 1CBOA 3KVEA 2X3NA 3RP7A 4X4JA 3AXBA 2XVHA 2Q0KA 3DMEA 4K7ZA 4YT0A 2OLOA 1PJ6A 3ALLA 2C66A 1YKJA 3BHKA 1F6MA 4C77A 1E6EA 4DSGA 4RSLA 3D8XA 1ZX9A 1E7PA 2C64A 5EB5A 2ZBWA 2C76A 1LVLA 1NG3A 1CJ3A 4ZN0A 2XDOA 1JNZA 1H83A 4OPLA 4B65A 1F3PA 4C3XA 4GDPA 3SM8A 4XWRA 3I6DA 2X50A 2QA2A 3ABVA 3AEAA 1Z6LA 2O9ZA 3P4RA 2NPXA 1FEBA 4J2WA 4UDQA 5J7XA 1JNRA 2H88A 1IUVA 4NNJA 4A6NA 2YG5A 3RHAA 3UTFA 4EQWA 3B6DA 2GQFA 3QSMA 4H4RA 2ZZBA 4RG4A 2JBVA 4EQRA 2GR2A 2C67A 2JB3A 3NRNA 3AYIA 3T0KA 3K7QX 4CRTA 1KSUA 3PS9A 1FCDA 1Q9IA 1E1MA 1B4VA 3FBSA 1PN0A 1Y56B 3UKPA 1KNRA 2WEUA 1YY5A 3BI4A 4WCTA 3SZCA 2XVFA 2VRLA 4H4XA 1PBFA 1PJ7A 3UKHA 1PBDA 1RSGA 3UKLA 5HXIA 4U2TA 2WDVA 4UDRA 1EL5A 5IPYA 2AQJA 3UTGA 4CY8A 1D4EA 1NHPA 4ZCCA 5IQ4A 3C4AA 1CJ4A 1FL2A 4G9KA 4XWZA 3EPTA 4BJZA 3SXIA 4B1BA 5C3JA 1E39A 1F8WA 3UKAA 4Z2UA 4AOSA 3AEBA 3DK9A 4C74A 4YTMA 1MOKA 4PAAA 2BS3A 4EQXA 2GH5A 2WDQA 3SZWA 3VRDB 1QLBA 3AE2A 2WU5A 3CN8A 4D04A 4EIQA 2C4CA 2GEWA 4CCQA 2ACZA 2F5ZA 2OA1A 4USRA 1DOCA 3SY4A 2YG6A 4U2SA 4KPRA 1BWCA 2C3CA 3FPZA 3NG7X 1OJDA 3AB1A 3UP5A 4TLXA 2WPCA 1BF3A 2VVLA 3K7TA 4YTPA 4C5OA 2FJEA 3WE0A 5ER0A 1H86A 2BXRA 1GRFA 5KWFA 1LQUA 4OVIA 3IHMA 1L9EA 4B68A 4C3YA 1Y0PA 5HHFA 1D4DA 2OLNA 1F8RA 3DA1A 1LPFA 4H50A 4Z2RA 4AP1A 3V3NA 1GRHA 1GERA 1SEZA 4D03A 1AOGA 4H4PA 1GALA 1XPQA 4N9XA 4H4UA 1MXTA 3LJPA 1MO9A 4FDCB 1K0LA 1DOEA 2WOWA 1QJDA 1DOBA 3NK0X 4B67A 4A5LA 3UCLA 1DXLA 4GF7A 5JCIA 3SFEA 1PS9A 3GRTA 1NHRA 2R45A 3HYXA 1V59A 3B3RA 2IVDA 3ZDNA 2YLSA 1JOAA 2B9WA 3LZXA 1JRZA 1REOA 3T14A 2C72A 3KLJA 2BK4A 4A99A 3EANA 5M10A 1HYUA 3AECA 2BXSA 2XFUA 3OZ2A 3ICSA 2A8XA 5FS6A 4H4VA 1ZOVA 1D4CA 3ITJA 5JCLA 4H2PA 1RP0A 1N4VA 3DH9A 3NTAA 3H4KA 4GAPA 4H4QA 2C75A 5BUKA 2YLWA 3NK1X 2C7GA 1BGJA 1GOSA 2WOIA 1TDKA 2YVJA 4GCMA 3C96A 4IA5A 4K5RA 4Y4MA 2GR3A 1IUXA 4GUVA 2YQUA 3IHGA 1GTHA 3CIRA 4YKGA 3GMBA 5FS7A 5BULA 3NKSA 1BGNA 4I59A 1ZDLA 2V3BA 2YG3A 4LA1A 3QSEA 4CNJA 3F8PA 2J3NA 3LXDA 5KOXA 3NTDA 4NEVA 4AOXA 4H2RA 5KOWA 1D7YA 2XCGA 1JRXA 2I0ZA 2HQMA 2XFQA 4B66A 2E4GA 3NT6A 4BK2A 3NH3X 1NDAA 1YQZA 5M0ZA 5L46A 1LTXR 3KPFA 2IVEA 1P2EA 2JB2A 3VQRA 1TYTA 1KNPA 5C2TA 5U1OA 4GR1A 4JY2A 4LU6A 4DNAA 4TM0A 3KD9A 5BRTA 3NYFA 1OJAA 2GRTA 4OPDA 1H7WA 4Y4LA 3BHFA 3CPJG 1NHQA 4II2A 3UOZA 2YG7A 1VRQB 1NPXA 1ZK7A 4FX9A 2XLSA 3DJGX 3VRAA 2BC0A 2R4JA 3CMMA 5KRQA 2WS3A 2YG4A 2XFOA 3DJDA 4UP3A 5GSNA 2AR8A 4LIIA 2RABA 2PYXA 1OJTA 2CFYA 1CL0A 2FBWA 3DJEA 5CQFA 2RGOA 2GF3A 2B9YA 2C3DA 3AE1A 3NN6X 3UTEA 2FJAA 4MJWA 3AE3A 2ZZCA 4U8MA 2VZ2A 1GNDA 2BACA 1H82A 4YSYA
chains in the Genus database with same CATH topology
2R46A 3CTYA 1ONFA 5HY5A 1FOHA 3L8KA 3REDA 3AEGA 1Y56A 2Q0LA 3HYVA 2ZZ0A 3SQPA 3LADA 2R0GA 3CPIG 1GESA 1L9DA 3LOVA 4U2LA 4YXDA 4H2NA 3UTHA 3T2KA 2DKIA 1LQTA 4J34A 3SYIA 1KDGA 1GTEA 2W0HA 3G5QA 4B63A 1OJCA 4OPUA 2XYOA 2WETA 3RP8A 3GYJA 2GAHB 4Z24A 4A6NB 4NTCA 3Q9TA 1X31B 1RYIA 2GB0A 1XANA 1ZP0A 5KMRA 3K30A 2Z5XA 4J57A 3ZYXA 3CNPA 2B76A 2XFPA 1B5QA 3VR8A 4AT0A 3D1CA 2VOUA 3F8RA 1H84A 1QO8A 1F8SA 1UKVG 3DGHA 1O94A 2YVFA 3GSIA 3NYEA 2WP6A 5FS9A 1N4WA 4A65A 1DJQA 1CF3A 3QJ4A 1K4QA 1VQWA 1FEAA 3QFAA 3AD7B 2UZZA 1M6IA 4NTEA 4B64A 1ZOYA 2VRMA 4OPGA 4X9MA 3CNJA 1KSSA 3BNMA 2YLRA 1PBEA 2GR1A 3NN0X 1ZKQA 1XHCA 4GAVA 1IUTA 3COXA 3AE9A 4Z43A 4G6HA 3QVPA 2R9ZA 1CC4A 2B7SA 1TYPA 1L0VA 1OJ9A 4UDPA 3FMWA 3EAOA 2AAQA 4FK1A 2PHHA 5JCNA 1CJCA 3S5WA 2GAGB 3NYCA 4USQA 2XLUA 3VRBA 1FECA 5JCKA 2EQ6A 2YLTA 3IC9A 2JK6A 4H4YA 4JQ9A 4G74A 1DNCA 1GV4A 1H7XA 1ELIA 1P2HA 1W4XA 3AE7A 1EL9A 4HA6A 4BURA 5KVIA 4A7AA 4BJYA 3G5RA 1IUUA 1CHUA 2ARDA 2YWLA 1N1PA 2V5ZA 3NLCA 1S3EA 3VR9A 1B8SA 2A87A 4ADWA 3T31A 2E5VA 4J36A 2RGHA 3GDNA 3DK8A 2XVJA 3GD4A 4J56A 1PXAA 2BRYA 2GVCA 3LZWA 4OPIA 1EBDA 4Y4NA 2VQ7A 3ATQA 4EMWA 4U8PA 1BZLA 4U8JA 4BV6A 1GT8A 2GMHA 2V60A 4K8DA 2FJDA 3AEEA 5KMQA 3URHA 5KMPA 2XVIA 3UKFA 1JEHA 3Q6JA 1DODA 4GDEA 1KF6A 2XLTA 4J33A 4X9NA 1PXCA 3P9UA 1Q1WA 4JNQA 1D7LA 1TDFA 3CPHG 4GRTA 2YM1A 1XDIA 4K22A 2EQ9A 1K0JA 1S2YA 4KX6A 1E1LA 1TDNA 2E1MA 1LV0A 3P4SA 4JNAA 4AP3A 4II3A 3UKKA 1GREA 1L9CA 3AD9B 2GR0A 1E1KA 4BK1A 4Z44A 1IJHA 5U63A 3DGZA 3DJJA 5LV9A 3G5SA 3P1WA 3PO7A 2BS2A 4IA6A 1ZMDA 2WP9A 3AEFA 2EQ7A 5HYMA 3AYLA 3HYWA 2X8CA 1IUSA 4U8OA 4H7UA 4J31A 3SX6A 5U25A 3AE4A 3UP4A 3IWAA 2WPFA 2BS4A 4JY3A 1S3BA 2Q7VA 2C70A 2WU2A 2JAEA 4H4ZA 4O5QA 2R4EA 2OAMA 3CNTA 2VVLG 2YR5A 1TDEA 2XFNA 1GRBA 3NNEA 4U8NA 4ECHA 2GQWA 3GYIA 5DBJA 3GYXA 3M0OA 2V6OA 1PBCA 2BK3A 4TM3A 3LB8A 4ICYA 3QVRA 4TLZA 2BRAA 3H8LA 3UKQA 4TM4A 1LJ1A 3HZLA 4XXGA 3E1TA 2H89A 2WQYA 3ICRA 5EOWA 4OPCA 3F8DA 1PDHA 2YR4A 5EBKA 3I3LA 1BKWA 2X8GA 4CBQA 4NWZA 2IIDA 2GMJA 3NK2X 4EQSA 4YTNA 3T2ZA 3AYJA 1NENA 2WDRA 4CCRA 1CC6A 1O5WA 2BA9A 3AEDA 1N4UA 3KKJA 4YSZA 3P4PA 2APGA 1ZY8A 2QAEA 2TMDA 3H8IA 2JB1A 3AE6A 4IVOB 4M52A 3ADAB 3NGCX 5FS8A 4REKA 3CGDA 4K5SA 4H4WA 3AD8B 5BVAA 2WBAA 2WHDA 3RP6A 2YLZA 3BI2A 3AE8A 3GWFA 2YVGA 2QA1A 2Z5YA 4P9SA 1TDOA 1PXBA 4TM1A 1Q1RA 1YQ4A 3L1RA 4HB9A 3NHOX 5GRTA 2BC1A 5IQ1A 3SGLA 3R9UA 4AT2A 2Y6RA 3KU9A 3GMCA 1KFYA 1S2QA 1EL8A 2B9XA 5TR3A 4CNKA 2C65A 1VDCA 2BCGG 4YKFA 4I58A 3ALMA 4JDRA 1NEKA 4A79A 3DK4A 4U8LA 2DKHA 1H81A 3FG2P 2OALA 1NHSA 2WESA 2WP5A 2JKCA 2XLRA 2YLXA 3C4NA 3CGCA 3P4QA 3QFBA 2WPEA 1D5TA 4NZHA 1NG4A 4IVMB 3ALJA 1IUWA 3CGEA 3CNDA 3GWDA 2WOVA 3UOVA 1PHHA 5JCMA 5KMSA 2BCPA 4H4TA 5KVHA 4Z25A 2GV8A 3T2YA 4IV9A 3BI5A 2BABA 3CNSA 1PJ5A 4RG3A 1GXFA 4A9WA 2CDUA 3ICTA 3K7MX 5EB4A 4ZCDA 3S61A 4Z2TA 3II4A 4EM3A 2XLPA 4CY6A 2Y6QA 2V3AA 3UOXA 1GRGA 4H2QA 4YWOA 3UOYA 1VG0A 3O0HA 4FK1C 5KNLA 3SFDA 2FJBA 1CJ2A 2YR6A 1O95A 3CGBA 1ZMCA 4WX1A 3QSSA 3SZ0A 3ISHA 4Z26A 1GEUA 4O5UA 3FIMB 3GRSA 3SZFA 3EF6A 4H4SA 3M12A 2C73A 1DJNA 4PABA 1JRYA 4NTDA 3ATRA 2EQ8A 1COYA 2QCUA 4BK3A 3JSKA 4G73A 1EL7A 2YAUA 4EMJA 5CKUA 4E0VA 3AWIA 3OC4A 2TPRA 4EIPA 1PBBA 4OCGA 2NVKX 3KA7A 2VQBA 4K2XA 4OPTA 4B69A 2R0CA 1JU2A 3T37A 1GRTA 1GPEA 3AE5A 1M64A 3RNMA 1GSNA 1VG9A 2R0PA 3GD3A 2YM2A 2X99A 3M13A 4U8KA 4APNA 1E1NA 1NAAA 5KXJA 4EM4A 2VVMA 2BK5A 5FMHA 1GETA 3IF9A 1B37A 3NIXA 4DSHA 4EMIA 1H6VA 2CULA 3PVCA 4G6GA 4JN9A 4U8IA 2CVJA 2Q6UA 4NEWA 2V61A 1CC2A 2A89A 1YQ3A 2B7RA 4YSHA 3KPKA 2RGJA 3V3OA 3GDPA 1K0IA 2BYBA 2X8HA 1TRBA 5J60A 4DGKA 1GRAA 3V76A 4YSXA 2XVEA 3BNUA 1CBOA 3KVEA 2X3NA 3RP7A 4X4JA 3AXBA 2XVHA 2Q0KA 3DMEA 4K7ZA 4YT0A 2OLOA 1PJ6A 3ALLA 2C66A 1YKJA 3BHKA 1F6MA 4C77A 1E6EA 4DSGA 4RSLA 3D8XA 1ZX9A 1E7PA 2C64A 5EB5A 2ZBWA 2C76A 1LVLA 1NG3A 1CJ3A 4ZN0A 2XDOA 1JNZA 1H83A 4OPLA 4B65A 1F3PA 4C3XA 4GDPA 3SM8A 4XWRA 3I6DA 2X50A 2QA2A 3ABVA 3AEAA 1Z6LA 2O9ZA 3P4RA 2NPXA 1FEBA 4J2WA 4UDQA 5J7XA 1JNRA 2H88A 1IUVA 4NNJA 4A6NA 2YG5A 3RHAA 3UTFA 4EQWA 3B6DA 2GQFA 3QSMA 4H4RA 2ZZBA 4RG4A 2JBVA 4EQRA 2GR2A 2C67A 2JB3A 3NRNA 3AYIA 3T0KA 3K7QX 4CRTA 1KSUA 3PS9A 1FCDA 1Q9IA 1E1MA 1B4VA 3FBSA 1PN0A 1Y56B 3UKPA 1KNRA 2WEUA 1YY5A 3BI4A 4WCTA 3SZCA 2XVFA 2VRLA 4H4XA 1PBFA 1PJ7A 3UKHA 1PBDA 1RSGA 3UKLA 5HXIA 4U2TA 2WDVA 4UDRA 1EL5A 5IPYA 2AQJA 3UTGA 4CY8A 1D4EA 1NHPA 4ZCCA 5IQ4A 3C4AA 1CJ4A 1FL2A 4G9KA 4XWZA 3EPTA 4BJZA 3SXIA 4B1BA 5C3JA 1E39A 1F8WA 3UKAA 4Z2UA 4AOSA 3AEBA 3DK9A 4C74A 4YTMA 1MOKA 4PAAA 2BS3A 4EQXA 2GH5A 2WDQA 3SZWA 3VRDB 1QLBA 3AE2A 2WU5A 3CN8A 4D04A 4EIQA 2C4CA 2GEWA 4CCQA 2ACZA 2F5ZA 2OA1A 4USRA 1DOCA 3SY4A 2YG6A 4U2SA 4KPRA 1BWCA 2C3CA 3FPZA 3NG7X 1OJDA 3AB1A 3UP5A 4TLXA 2WPCA 1BF3A 2VVLA 3K7TA 4YTPA 4C5OA 2FJEA 3WE0A 5ER0A 1H86A 2BXRA 1GRFA 5KWFA 1LQUA 4OVIA 3IHMA 1L9EA 4B68A 4C3YA 1Y0PA 5HHFA 1D4DA 2OLNA 1F8RA 3DA1A 1LPFA 4H50A 4Z2RA 4AP1A 3V3NA 1GRHA 1GERA 1SEZA 4D03A 1AOGA 4H4PA 1GALA 1XPQA 4N9XA 4H4UA 1MXTA 3LJPA 1MO9A 4FDCB 1K0LA 1DOEA 2WOWA 1QJDA 1DOBA 3NK0X 4B67A 4A5LA 3UCLA 1DXLA 4GF7A 5JCIA 3SFEA 1PS9A 3GRTA 1NHRA 2R45A 3HYXA 1V59A 3B3RA 2IVDA 3ZDNA 2YLSA 1JOAA 2B9WA 3LZXA 1JRZA 1REOA 3T14A 2C72A 3KLJA 2BK4A 4A99A 3EANA 5M10A 1HYUA 3AECA 2BXSA 2XFUA 3OZ2A 3ICSA 2A8XA 5FS6A 4H4VA 1ZOVA 1D4CA 3ITJA 5JCLA 4H2PA 1RP0A 1N4VA 3DH9A 3NTAA 3H4KA 4GAPA 4H4QA 2C75A 5BUKA 2YLWA 3NK1X 2C7GA 1BGJA 1GOSA 2WOIA 1TDKA 2YVJA 4GCMA 3C96A 4IA5A 4K5RA 4Y4MA 2GR3A 1IUXA 4GUVA 2YQUA 3IHGA 1GTHA 3CIRA 4YKGA 3GMBA 5FS7A 5BULA 3NKSA 1BGNA 4I59A 1ZDLA 2V3BA 2YG3A 4LA1A 3QSEA 4CNJA 3F8PA 2J3NA 3LXDA 5KOXA 3NTDA 4NEVA 4AOXA 4H2RA 5KOWA 1D7YA 2XCGA 1JRXA 2I0ZA 2HQMA 2XFQA 4B66A 2E4GA 3NT6A 4BK2A 3NH3X 1NDAA 1YQZA 5M0ZA 5L46A 1LTXR 3KPFA 2IVEA 1P2EA 2JB2A 3VQRA 1TYTA 1KNPA 5C2TA 5U1OA 4GR1A 4JY2A 4LU6A 4DNAA 4TM0A 3KD9A 5BRTA 3NYFA 1OJAA 2GRTA 4OPDA 1H7WA 4Y4LA 3BHFA 3CPJG 1NHQA 4II2A 3UOZA 2YG7A 1VRQB 1NPXA 1ZK7A 4FX9A 2XLSA 3DJGX 3VRAA 2BC0A 2R4JA 3CMMA 5KRQA 2WS3A 2YG4A 2XFOA 3DJDA 4UP3A 5GSNA 2AR8A 4LIIA 2RABA 2PYXA 1OJTA 2CFYA 1CL0A 2FBWA 3DJEA 5CQFA 2RGOA 2GF3A 2B9YA 2C3DA 3AE1A 3NN6X 3UTEA 2FJAA 4MJWA 3AE3A 2ZZCA 4U8MA 2VZ2A 1GNDA 2BACA 1H82A 4YSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NWZ A;  4GAP A;  3SZW A;  3SX6 A;  5KMQ A;  3T2Y A;  3T2Z A;  5KMP A;  3HYV A;  4G73 A;  3SY4 A;  4G6G A;  3SZC A;  4G74 A;  3T2K A;  3HYX A;  3KPK A;  3SYI A;  3SZ0 A;  4GAV A;  3T14 A;  4G9K A;  3T31 A;  3SXI A;  4G6H A;  3SZF A;  3T0K A;  5KMS A;  5KMR A;  3HYW A; 
#chains in the Genus database with same CATH topology
 2R46 A;  3CTY A;  1ONF A;  5HY5 A;  1FOH A;  3L8K A;  3RED A;  3AEG A;  1Y56 A;  2Q0L A;  3HYV A;  2ZZ0 A;  3SQP A;  3LAD A;  2R0G A;  3CPI G;  1GES A;  1L9D A;  3LOV A;  4U2L A;  4YXD A;  4H2N A;  3UTH A;  3T2K A;  2DKI A;  1LQT A;  4J34 A;  3SYI A;  1KDG A;  1GTE A;  2W0H A;  3G5Q A;  4B63 A;  1OJC A;  4OPU A;  2XYO A;  2WET A;  3RP8 A;  3GYJ A;  2GAH B;  4Z24 A;  4A6N B;  4NTC A;  3Q9T A;  1X31 B;  1RYI A;  2GB0 A;  1XAN A;  1ZP0 A;  5KMR A;  3K30 A;  2Z5X A;  4J57 A;  3ZYX A;  3CNP A;  2B76 A;  2XFP A;  1B5Q A;  3VR8 A;  4AT0 A;  3D1C A;  2VOU A;  3F8R A;  1H84 A;  1QO8 A;  1F8S A;  1UKV G;  3DGH A;  1O94 A;  2YVF A;  3GSI A;  3NYE A;  2WP6 A;  5FS9 A;  1N4W A;  4A65 A;  1DJQ A;  1CF3 A;  3QJ4 A;  1K4Q A;  1VQW A;  1FEA A;  3QFA A;  3AD7 B;  2UZZ A;  1M6I A;  4NTE A;  4B64 A;  1ZOY A;  2VRM A;  4OPG A;  4X9M A;  3CNJ A;  1KSS A;  3BNM A;  2YLR A;  1PBE A;  2GR1 A;  3NN0 X;  1ZKQ A;  1XHC A;  4GAV A;  1IUT A;  3COX A;  3AE9 A;  4Z43 A;  4G6H A;  3QVP A;  2R9Z A;  1CC4 A;  2B7S A;  1TYP A;  1L0V A;  1OJ9 A;  4UDP A;  3FMW A;  3EAO A;  2AAQ A;  4FK1 A;  2PHH A;  5JCN A;  1CJC A;  3S5W A;  2GAG B;  3NYC A;  4USQ A;  2XLU A;  3VRB A;  1FEC A;  5JCK A;  2EQ6 A;  2YLT A;  3IC9 A;  2JK6 A;  4H4Y A;  4JQ9 A;  4G74 A;  1DNC A;  1GV4 A;  1H7X A;  1ELI A;  1P2H A;  1W4X A;  3AE7 A;  1EL9 A;  4HA6 A;  4BUR A;  5KVI A;  4A7A A;  4BJY A;  3G5R A;  1IUU A;  1CHU A;  2ARD A;  2YWL A;  1N1P A;  2V5Z A;  3NLC A;  1S3E A;  3VR9 A;  1B8S A;  2A87 A;  4ADW A;  3T31 A;  2E5V A;  4J36 A;  2RGH A;  3GDN A;  3DK8 A;  2XVJ A;  3GD4 A;  4J56 A;  1PXA A;  2BRY A;  2GVC A;  3LZW A;  4OPI A;  1EBD A;  4Y4N A;  2VQ7 A;  3ATQ A;  4EMW A;  4U8P A;  1BZL A;  4U8J A;  4BV6 A;  1GT8 A;  2GMH A;  2V60 A;  4K8D A;  2FJD A;  3AEE A;  5KMQ A;  3URH A;  5KMP A;  2XVI A;  3UKF A;  1JEH A;  3Q6J A;  1DOD A;  4GDE A;  1KF6 A;  2XLT A;  4J33 A;  4X9N A;  1PXC A;  3P9U A;  1Q1W A;  4JNQ A;  1D7L A;  1TDF A;  3CPH G;  4GRT A;  2YM1 A;  1XDI A;  4K22 A;  2EQ9 A;  1K0J A;  1S2Y A;  4KX6 A;  1E1L A;  1TDN A;  2E1M A;  1LV0 A;  3P4S A;  4JNA A;  4AP3 A;  4II3 A;  3UKK A;  1GRE A;  1L9C A;  3AD9 B;  2GR0 A;  1E1K A;  4BK1 A;  4Z44 A;  1IJH A;  5U63 A;  3DGZ A;  3DJJ A;  5LV9 A;  3G5S A;  3P1W A;  3PO7 A;  2BS2 A;  4IA6 A;  1ZMD A;  2WP9 A;  3AEF A;  2EQ7 A;  5HYM A;  3AYL A;  3HYW A;  2X8C A;  1IUS A;  4U8O A;  4H7U A;  4J31 A;  3SX6 A;  5U25 A;  3AE4 A;  3UP4 A;  3IWA A;  2WPF A;  2BS4 A;  4JY3 A;  1S3B A;  2Q7V A;  2C70 A;  2WU2 A;  2JAE A;  4H4Z A;  4O5Q A;  2R4E A;  2OAM A;  3CNT A;  2VVL G;  2YR5 A;  1TDE A;  2XFN A;  1GRB A;  3NNE A;  4U8N A;  4ECH A;  2GQW A;  3GYI A;  5DBJ A;  3GYX A;  3M0O A;  2V6O A;  1PBC A;  2BK3 A;  4TM3 A;  3LB8 A;  4ICY A;  3QVR A;  4TLZ A;  2BRA A;  3H8L A;  3UKQ A;  4TM4 A;  1LJ1 A;  3HZL A;  4XXG A;  3E1T A;  2H89 A;  2WQY A;  3ICR A;  5EOW A;  4OPC A;  3F8D A;  1PDH A;  2YR4 A;  5EBK A;  3I3L A;  1BKW A;  2X8G A;  4CBQ A;  4NWZ A;  2IID A;  2GMJ A;  3NK2 X;  4EQS A;  4YTN A;  3T2Z A;  3AYJ A;  1NEN A;  2WDR A;  4CCR A;  1CC6 A;  1O5W A;  2BA9 A;  3AED A;  1N4U A;  3KKJ A;  4YSZ A;  3P4P A;  2APG A;  1ZY8 A;  2QAE A;  2TMD A;  3H8I A;  2JB1 A;  3AE6 A;  4IVO B;  4M52 A;  3ADA B;  3NGC X;  5FS8 A;  4REK A;  3CGD A;  4K5S A;  4H4W A;  3AD8 B;  5BVA A;  2WBA A;  2WHD A;  3RP6 A;  2YLZ A;  3BI2 A;  3AE8 A;  3GWF A;  2YVG A;  2QA1 A;  2Z5Y A;  4P9S A;  1TDO A;  1PXB A;  4TM1 A;  1Q1R A;  1YQ4 A;  3L1R A;  4HB9 A;  3NHO X;  5GRT A;  2BC1 A;  5IQ1 A;  3SGL A;  3R9U A;  4AT2 A;  2Y6R A;  3KU9 A;  3GMC A;  1KFY A;  1S2Q A;  1EL8 A;  2B9X A;  5TR3 A;  4CNK A;  2C65 A;  1VDC A;  2BCG G;  4YKF A;  4I58 A;  3ALM A;  4JDR A;  1NEK A;  4A79 A;  3DK4 A;  4U8L A;  2DKH A;  1H81 A;  3FG2 P;  2OAL A;  1NHS A;  2WES A;  2WP5 A;  2JKC A;  2XLR A;  2YLX A;  3C4N A;  3CGC A;  3P4Q A;  3QFB A;  2WPE A;  1D5T A;  4NZH A;  1NG4 A;  4IVM B;  3ALJ A;  1IUW A;  3CGE A;  3CND A;  3GWD A;  2WOV A;  3UOV A;  1PHH A;  5JCM A;  5KMS A;  2BCP A;  4H4T A;  5KVH A;  4Z25 A;  2GV8 A;  3T2Y A;  4IV9 A;  3BI5 A;  2BAB A;  3CNS A;  1PJ5 A;  4RG3 A;  1GXF A;  4A9W A;  2CDU A;  3ICT A;  3K7M X;  5EB4 A;  4ZCD A;  3S61 A;  4Z2T A;  3II4 A;  4EM3 A;  2XLP A;  4CY6 A;  2Y6Q A;  2V3A A;  3UOX A;  1GRG A;  4H2Q A;  4YWO A;  3UOY A;  1VG0 A;  3O0H A;  4FK1 C;  5KNL A;  3SFD A;  2FJB A;  1CJ2 A;  2YR6 A;  1O95 A;  3CGB A;  1ZMC A;  4WX1 A;  3QSS A;  3SZ0 A;  3ISH A;  4Z26 A;  1GEU A;  4O5U A;  3FIM B;  3GRS A;  3SZF A;  3EF6 A;  4H4S A;  3M12 A;  2C73 A;  1DJN A;  4PAB A;  1JRY A;  4NTD A;  3ATR A;  2EQ8 A;  1COY A;  2QCU A;  4BK3 A;  3JSK A;  4G73 A;  1EL7 A;  2YAU A;  4EMJ A;  5CKU A;  4E0V A;  3AWI A;  3OC4 A;  2TPR A;  4EIP A;  1PBB A;  4OCG A;  2NVK X;  3KA7 A;  2VQB A;  4K2X A;  4OPT A;  4B69 A;  2R0C A;  1JU2 A;  3T37 A;  1GRT A;  1GPE A;  3AE5 A;  1M64 A;  3RNM A;  1GSN A;  1VG9 A;  2R0P A;  3GD3 A;  2YM2 A;  2X99 A;  3M13 A;  4U8K A;  4APN A;  1E1N A;  1NAA A;  5KXJ A;  4EM4 A;  2VVM A;  2BK5 A;  5FMH A;  1GET A;  3IF9 A;  1B37 A;  3NIX A;  4DSH A;  4EMI A;  1H6V A;  2CUL A;  3PVC A;  4G6G A;  4JN9 A;  4U8I A;  2CVJ A;  2Q6U A;  4NEW A;  2V61 A;  1CC2 A;  2A89 A;  1YQ3 A;  2B7R A;  4YSH A;  3KPK A;  2RGJ A;  3V3O A;  3GDP A;  1K0I A;  2BYB A;  2X8H A;  1TRB A;  5J60 A;  4DGK A;  1GRA A;  3V76 A;  4YSX A;  2XVE A;  3BNU A;  1CBO A;  3KVE A;  2X3N A;  3RP7 A;  4X4J A;  3AXB A;  2XVH A;  2Q0K A;  3DME A;  4K7Z A;  4YT0 A;  2OLO A;  1PJ6 A;  3ALL A;  2C66 A;  1YKJ A;  3BHK A;  1F6M A;  4C77 A;  1E6E A;  4DSG A;  4RSL A;  3D8X A;  1ZX9 A;  1E7P A;  2C64 A;  5EB5 A;  2ZBW A;  2C76 A;  1LVL A;  1NG3 A;  1CJ3 A;  4ZN0 A;  2XDO A;  1JNZ A;  1H83 A;  4OPL A;  4B65 A;  1F3P A;  4C3X A;  4GDP A;  3SM8 A;  4XWR A;  3I6D A;  2X50 A;  2QA2 A;  3ABV A;  3AEA A;  1Z6L A;  2O9Z A;  3P4R A;  2NPX A;  1FEB A;  4J2W A;  4UDQ A;  5J7X A;  1JNR A;  2H88 A;  1IUV A;  4NNJ A;  4A6N A;  2YG5 A;  3RHA A;  3UTF A;  4EQW A;  3B6D A;  2GQF A;  3QSM A;  4H4R A;  2ZZB A;  4RG4 A;  2JBV A;  4EQR A;  2GR2 A;  2C67 A;  2JB3 A;  3NRN A;  3AYI A;  3T0K A;  3K7Q X;  4CRT A;  1KSU A;  3PS9 A;  1FCD A;  1Q9I A;  1E1M A;  1B4V A;  3FBS A;  1PN0 A;  1Y56 B;  3UKP A;  1KNR A;  2WEU A;  1YY5 A;  3BI4 A;  4WCT A;  3SZC A;  2XVF A;  2VRL A;  4H4X A;  1PBF A;  1PJ7 A;  3UKH A;  1PBD A;  1RSG A;  3UKL A;  5HXI A;  4U2T A;  2WDV A;  4UDR A;  1EL5 A;  5IPY A;  2AQJ A;  3UTG A;  4CY8 A;  1D4E A;  1NHP A;  4ZCC A;  5IQ4 A;  3C4A A;  1CJ4 A;  1FL2 A;  4G9K A;  4XWZ A;  3EPT A;  4BJZ A;  3SXI A;  4B1B A;  5C3J A;  1E39 A;  1F8W A;  3UKA A;  4Z2U A;  4AOS A;  3AEB A;  3DK9 A;  4C74 A;  4YTM A;  1MOK A;  4PAA A;  2BS3 A;  4EQX A;  2GH5 A;  2WDQ A;  3SZW A;  3VRD B;  1QLB A;  3AE2 A;  2WU5 A;  3CN8 A;  4D04 A;  4EIQ A;  2C4C A;  2GEW A;  4CCQ A;  2ACZ A;  2F5Z A;  2OA1 A;  4USR A;  1DOC A;  3SY4 A;  2YG6 A;  4U2S A;  4KPR A;  1BWC A;  2C3C A;  3FPZ A;  3NG7 X;  1OJD A;  3AB1 A;  3UP5 A;  4TLX A;  2WPC A;  1BF3 A;  2VVL A;  3K7T A;  4YTP A;  4C5O A;  2FJE A;  3WE0 A;  5ER0 A;  1H86 A;  2BXR A;  1GRF A;  5KWF A;  1LQU A;  4OVI A;  3IHM A;  1L9E A;  4B68 A;  4C3Y A;  1Y0P A;  5HHF A;  1D4D A;  2OLN A;  1F8R A;  3DA1 A;  1LPF A;  4H50 A;  4Z2R A;  4AP1 A;  3V3N A;  1GRH A;  1GER A;  1SEZ A;  4D03 A;  1AOG A;  4H4P A;  1GAL A;  1XPQ A;  4N9X A;  4H4U A;  1MXT A;  3LJP A;  1MO9 A;  4FDC B;  1K0L A;  1DOE A;  2WOW A;  1QJD A;  1DOB A;  3NK0 X;  4B67 A;  4A5L A;  3UCL A;  1DXL A;  4GF7 A;  5JCI A;  3SFE A;  1PS9 A;  3GRT A;  1NHR A;  2R45 A;  3HYX A;  1V59 A;  3B3R A;  2IVD A;  3ZDN A;  2YLS A;  1JOA A;  2B9W A;  3LZX A;  1JRZ A;  1REO A;  3T14 A;  2C72 A;  3KLJ A;  2BK4 A;  4A99 A;  3EAN A;  5M10 A;  1HYU A;  3AEC A;  2BXS A;  2XFU A;  3OZ2 A;  3ICS A;  2A8X A;  5FS6 A;  4H4V A;  1ZOV A;  1D4C A;  3ITJ A;  5JCL A;  4H2P A;  1RP0 A;  1N4V A;  3DH9 A;  3NTA A;  3H4K A;  4GAP A;  4H4Q A;  2C75 A;  5BUK A;  2YLW A;  3NK1 X;  2C7G A;  1BGJ A;  1GOS A;  2WOI A;  1TDK A;  2YVJ A;  4GCM A;  3C96 A;  4IA5 A;  4K5R A;  4Y4M A;  2GR3 A;  1IUX A;  4GUV A;  2YQU A;  3IHG A;  1GTH A;  3CIR A;  4YKG A;  3GMB A;  5FS7 A;  5BUL A;  3NKS A;  1BGN A;  4I59 A;  1ZDL A;  2V3B A;  2YG3 A;  4LA1 A;  3QSE A;  4CNJ A;  3F8P A;  2J3N A;  3LXD A;  5KOX A;  3NTD A;  4NEV A;  4AOX A;  4H2R A;  5KOW A;  1D7Y A;  2XCG A;  1JRX A;  2I0Z A;  2HQM A;  2XFQ A;  4B66 A;  2E4G A;  3NT6 A;  4BK2 A;  3NH3 X;  1NDA A;  1YQZ A;  5M0Z A;  5L46 A;  1LTX R;  3KPF A;  2IVE A;  1P2E A;  2JB2 A;  3VQR A;  1TYT A;  1KNP A;  5C2T A;  5U1O A;  4GR1 A;  4JY2 A;  4LU6 A;  4DNA A;  4TM0 A;  3KD9 A;  5BRT A;  3NYF A;  1OJA A;  2GRT A;  4OPD A;  1H7W A;  4Y4L A;  3BHF A;  3CPJ G;  1NHQ A;  4II2 A;  3UOZ A;  2YG7 A;  1VRQ B;  1NPX A;  1ZK7 A;  4FX9 A;  2XLS A;  3DJG X;  3VRA A;  2BC0 A;  2R4J A;  3CMM A;  5KRQ A;  2WS3 A;  2YG4 A;  2XFO A;  3DJD A;  4UP3 A;  5GSN A;  2AR8 A;  4LII A;  2RAB A;  2PYX A;  1OJT A;  2CFY A;  1CL0 A;  2FBW A;  3DJE A;  5CQF A;  2RGO A;  2GF3 A;  2B9Y A;  2C3D A;  3AE1 A;  3NN6 X;  3UTE A;  2FJA A;  4MJW A;  3AE3 A;  2ZZC A;  4U8M A;  2VZ2 A;  1GND A;  2BAC A;  1H82 A;  4YSY A; 
#chains in the Genus database with same CATH homology
 2R46 A;  3CTY A;  1ONF A;  5HY5 A;  1FOH A;  3L8K A;  3RED A;  3AEG A;  1Y56 A;  2Q0L A;  3HYV A;  2ZZ0 A;  3SQP A;  3LAD A;  2R0G A;  3CPI G;  1GES A;  1L9D A;  3LOV A;  4U2L A;  4YXD A;  4H2N A;  3UTH A;  3T2K A;  2DKI A;  1LQT A;  4J34 A;  3SYI A;  1KDG A;  1GTE A;  2W0H A;  3G5Q A;  4B63 A;  1OJC A;  4OPU A;  2XYO A;  2WET A;  3RP8 A;  3GYJ A;  2GAH B;  4Z24 A;  4A6N B;  4NTC A;  3Q9T A;  1X31 B;  1RYI A;  2GB0 A;  1XAN A;  1ZP0 A;  5KMR A;  3K30 A;  2Z5X A;  4J57 A;  3ZYX A;  3CNP A;  2B76 A;  2XFP A;  1B5Q A;  3VR8 A;  4AT0 A;  3D1C A;  2VOU A;  3F8R A;  1H84 A;  1QO8 A;  1F8S A;  1UKV G;  3DGH A;  1O94 A;  2YVF A;  3GSI A;  3NYE A;  2WP6 A;  5FS9 A;  1N4W A;  4A65 A;  1DJQ A;  1CF3 A;  3QJ4 A;  1K4Q A;  1VQW A;  1FEA A;  3QFA A;  3AD7 B;  2UZZ A;  1M6I A;  4NTE A;  4B64 A;  1ZOY A;  2VRM A;  4OPG A;  4X9M A;  3CNJ A;  1KSS A;  3BNM A;  2YLR A;  1PBE A;  2GR1 A;  3NN0 X;  1ZKQ A;  1XHC A;  4GAV A;  1IUT A;  3COX A;  3AE9 A;  4Z43 A;  4G6H A;  3QVP A;  2R9Z A;  1CC4 A;  2B7S A;  1TYP A;  1L0V A;  1OJ9 A;  4UDP A;  3FMW A;  3EAO A;  2AAQ A;  4FK1 A;  2PHH A;  5JCN A;  1CJC A;  3S5W A;  2GAG B;  3NYC A;  4USQ A;  2XLU A;  3VRB A;  1FEC A;  5JCK A;  2EQ6 A;  2YLT A;  3IC9 A;  2JK6 A;  4H4Y A;  4JQ9 A;  4G74 A;  1DNC A;  1GV4 A;  1H7X A;  1ELI A;  1P2H A;  1W4X A;  3AE7 A;  1EL9 A;  4HA6 A;  4BUR A;  5KVI A;  4A7A A;  4BJY A;  3G5R A;  1IUU A;  1CHU A;  2ARD A;  2YWL A;  1N1P A;  2V5Z A;  3NLC A;  1S3E A;  3VR9 A;  1B8S A;  2A87 A;  4ADW A;  3T31 A;  2E5V A;  4J36 A;  2RGH A;  3GDN A;  3DK8 A;  2XVJ A;  3GD4 A;  4J56 A;  1PXA A;  2BRY A;  2GVC A;  3LZW A;  4OPI A;  1EBD A;  4Y4N A;  2VQ7 A;  3ATQ A;  4EMW A;  4U8P A;  1BZL A;  4U8J A;  4BV6 A;  1GT8 A;  2GMH A;  2V60 A;  4K8D A;  2FJD A;  3AEE A;  5KMQ A;  3URH A;  5KMP A;  2XVI A;  3UKF A;  1JEH A;  3Q6J A;  1DOD A;  4GDE A;  1KF6 A;  2XLT A;  4J33 A;  4X9N A;  1PXC A;  3P9U A;  1Q1W A;  4JNQ A;  1D7L A;  1TDF A;  3CPH G;  4GRT A;  2YM1 A;  1XDI A;  4K22 A;  2EQ9 A;  1K0J A;  1S2Y A;  4KX6 A;  1E1L A;  1TDN A;  2E1M A;  1LV0 A;  3P4S A;  4JNA A;  4AP3 A;  4II3 A;  3UKK A;  1GRE A;  1L9C A;  3AD9 B;  2GR0 A;  1E1K A;  4BK1 A;  4Z44 A;  1IJH A;  5U63 A;  3DGZ A;  3DJJ A;  5LV9 A;  3G5S A;  3P1W A;  3PO7 A;  2BS2 A;  4IA6 A;  1ZMD A;  2WP9 A;  3AEF A;  2EQ7 A;  5HYM A;  3AYL A;  3HYW A;  2X8C A;  1IUS A;  4U8O A;  4H7U A;  4J31 A;  3SX6 A;  5U25 A;  3AE4 A;  3UP4 A;  3IWA A;  2WPF A;  2BS4 A;  4JY3 A;  1S3B A;  2Q7V A;  2C70 A;  2WU2 A;  2JAE A;  4H4Z A;  4O5Q A;  2R4E A;  2OAM A;  3CNT A;  2VVL G;  2YR5 A;  1TDE A;  2XFN A;  1GRB A;  3NNE A;  4U8N A;  4ECH A;  2GQW A;  3GYI A;  5DBJ A;  3GYX A;  3M0O A;  2V6O A;  1PBC A;  2BK3 A;  4TM3 A;  3LB8 A;  4ICY A;  3QVR A;  4TLZ A;  2BRA A;  3H8L A;  3UKQ A;  4TM4 A;  1LJ1 A;  3HZL A;  4XXG A;  3E1T A;  2H89 A;  2WQY A;  3ICR A;  5EOW A;  4OPC A;  3F8D A;  1PDH A;  2YR4 A;  5EBK A;  3I3L A;  1BKW A;  2X8G A;  4CBQ A;  4NWZ A;  2IID A;  2GMJ A;  3NK2 X;  4EQS A;  4YTN A;  3T2Z A;  3AYJ A;  1NEN A;  2WDR A;  4CCR A;  1CC6 A;  1O5W A;  2BA9 A;  3AED A;  1N4U A;  3KKJ A;  4YSZ A;  3P4P A;  2APG A;  1ZY8 A;  2QAE A;  2TMD A;  3H8I A;  2JB1 A;  3AE6 A;  4IVO B;  4M52 A;  3ADA B;  3NGC X;  5FS8 A;  4REK A;  3CGD A;  4K5S A;  4H4W A;  3AD8 B;  5BVA A;  2WBA A;  2WHD A;  3RP6 A;  2YLZ A;  3BI2 A;  3AE8 A;  3GWF A;  2YVG A;  2QA1 A;  2Z5Y A;  4P9S A;  1TDO A;  1PXB A;  4TM1 A;  1Q1R A;  1YQ4 A;  3L1R A;  4HB9 A;  3NHO X;  5GRT A;  2BC1 A;  5IQ1 A;  3SGL A;  3R9U A;  4AT2 A;  2Y6R A;  3KU9 A;  3GMC A;  1KFY A;  1S2Q A;  1EL8 A;  2B9X A;  5TR3 A;  4CNK A;  2C65 A;  1VDC A;  2BCG G;  4YKF A;  4I58 A;  3ALM A;  4JDR A;  1NEK A;  4A79 A;  3DK4 A;  4U8L A;  2DKH A;  1H81 A;  3FG2 P;  2OAL A;  1NHS A;  2WES A;  2WP5 A;  2JKC A;  2XLR A;  2YLX A;  3C4N A;  3CGC A;  3P4Q A;  3QFB A;  2WPE A;  1D5T A;  4NZH A;  1NG4 A;  4IVM B;  3ALJ A;  1IUW A;  3CGE A;  3CND A;  3GWD A;  2WOV A;  3UOV A;  1PHH A;  5JCM A;  5KMS A;  2BCP A;  4H4T A;  5KVH A;  4Z25 A;  2GV8 A;  3T2Y A;  4IV9 A;  3BI5 A;  2BAB A;  3CNS A;  1PJ5 A;  4RG3 A;  1GXF A;  4A9W A;  2CDU A;  3ICT A;  3K7M X;  5EB4 A;  4ZCD A;  3S61 A;  4Z2T A;  3II4 A;  4EM3 A;  2XLP A;  4CY6 A;  2Y6Q A;  2V3A A;  3UOX A;  1GRG A;  4H2Q A;  4YWO A;  3UOY A;  1VG0 A;  3O0H A;  4FK1 C;  5KNL A;  3SFD A;  2FJB A;  1CJ2 A;  2YR6 A;  1O95 A;  3CGB A;  1ZMC A;  4WX1 A;  3QSS A;  3SZ0 A;  3ISH A;  4Z26 A;  1GEU A;  4O5U A;  3FIM B;  3GRS A;  3SZF A;  3EF6 A;  4H4S A;  3M12 A;  2C73 A;  1DJN A;  4PAB A;  1JRY A;  4NTD A;  3ATR A;  2EQ8 A;  1COY A;  2QCU A;  4BK3 A;  3JSK A;  4G73 A;  1EL7 A;  2YAU A;  4EMJ A;  5CKU A;  4E0V A;  3AWI A;  3OC4 A;  2TPR A;  4EIP A;  1PBB A;  4OCG A;  2NVK X;  3KA7 A;  2VQB A;  4K2X A;  4OPT A;  4B69 A;  2R0C A;  1JU2 A;  3T37 A;  1GRT A;  1GPE A;  3AE5 A;  1M64 A;  3RNM A;  1GSN A;  1VG9 A;  2R0P A;  3GD3 A;  2YM2 A;  2X99 A;  3M13 A;  4U8K A;  4APN A;  1E1N A;  1NAA A;  5KXJ A;  4EM4 A;  2VVM A;  2BK5 A;  5FMH A;  1GET A;  3IF9 A;  1B37 A;  3NIX A;  4DSH A;  4EMI A;  1H6V A;  2CUL A;  3PVC A;  4G6G A;  4JN9 A;  4U8I A;  2CVJ A;  2Q6U A;  4NEW A;  2V61 A;  1CC2 A;  2A89 A;  1YQ3 A;  2B7R A;  4YSH A;  3KPK A;  2RGJ A;  3V3O A;  3GDP A;  1K0I A;  2BYB A;  2X8H A;  1TRB A;  5J60 A;  4DGK A;  1GRA A;  3V76 A;  4YSX A;  2XVE A;  3BNU A;  1CBO A;  3KVE A;  2X3N A;  3RP7 A;  4X4J A;  3AXB A;  2XVH A;  2Q0K A;  3DME A;  4K7Z A;  4YT0 A;  2OLO A;  1PJ6 A;  3ALL A;  2C66 A;  1YKJ A;  3BHK A;  1F6M A;  4C77 A;  1E6E A;  4DSG A;  4RSL A;  3D8X A;  1ZX9 A;  1E7P A;  2C64 A;  5EB5 A;  2ZBW A;  2C76 A;  1LVL A;  1NG3 A;  1CJ3 A;  4ZN0 A;  2XDO A;  1JNZ A;  1H83 A;  4OPL A;  4B65 A;  1F3P A;  4C3X A;  4GDP A;  3SM8 A;  4XWR A;  3I6D A;  2X50 A;  2QA2 A;  3ABV A;  3AEA A;  1Z6L A;  2O9Z A;  3P4R A;  2NPX A;  1FEB A;  4J2W A;  4UDQ A;  5J7X A;  1JNR A;  2H88 A;  1IUV A;  4NNJ A;  4A6N A;  2YG5 A;  3RHA A;  3UTF A;  4EQW A;  3B6D A;  2GQF A;  3QSM A;  4H4R A;  2ZZB A;  4RG4 A;  2JBV A;  4EQR A;  2GR2 A;  2C67 A;  2JB3 A;  3NRN A;  3AYI A;  3T0K A;  3K7Q X;  4CRT A;  1KSU A;  3PS9 A;  1FCD A;  1Q9I A;  1E1M A;  1B4V A;  3FBS A;  1PN0 A;  1Y56 B;  3UKP A;  1KNR A;  2WEU A;  1YY5 A;  3BI4 A;  4WCT A;  3SZC A;  2XVF A;  2VRL A;  4H4X A;  1PBF A;  1PJ7 A;  3UKH A;  1PBD A;  1RSG A;  3UKL A;  5HXI A;  4U2T A;  2WDV A;  4UDR A;  1EL5 A;  5IPY A;  2AQJ A;  3UTG A;  4CY8 A;  1D4E A;  1NHP A;  4ZCC A;  5IQ4 A;  3C4A A;  1CJ4 A;  1FL2 A;  4G9K A;  4XWZ A;  3EPT A;  4BJZ A;  3SXI A;  4B1B A;  5C3J A;  1E39 A;  1F8W A;  3UKA A;  4Z2U A;  4AOS A;  3AEB A;  3DK9 A;  4C74 A;  4YTM A;  1MOK A;  4PAA A;  2BS3 A;  4EQX A;  2GH5 A;  2WDQ A;  3SZW A;  3VRD B;  1QLB A;  3AE2 A;  2WU5 A;  3CN8 A;  4D04 A;  4EIQ A;  2C4C A;  2GEW A;  4CCQ A;  2ACZ A;  2F5Z A;  2OA1 A;  4USR A;  1DOC A;  3SY4 A;  2YG6 A;  4U2S A;  4KPR A;  1BWC A;  2C3C A;  3FPZ A;  3NG7 X;  1OJD A;  3AB1 A;  3UP5 A;  4TLX A;  2WPC A;  1BF3 A;  2VVL A;  3K7T A;  4YTP A;  4C5O A;  2FJE A;  3WE0 A;  5ER0 A;  1H86 A;  2BXR A;  1GRF A;  5KWF A;  1LQU A;  4OVI A;  3IHM A;  1L9E A;  4B68 A;  4C3Y A;  1Y0P A;  5HHF A;  1D4D A;  2OLN A;  1F8R A;  3DA1 A;  1LPF A;  4H50 A;  4Z2R A;  4AP1 A;  3V3N A;  1GRH A;  1GER A;  1SEZ A;  4D03 A;  1AOG A;  4H4P A;  1GAL A;  1XPQ A;  4N9X A;  4H4U A;  1MXT A;  3LJP A;  1MO9 A;  4FDC B;  1K0L A;  1DOE A;  2WOW A;  1QJD A;  1DOB A;  3NK0 X;  4B67 A;  4A5L A;  3UCL A;  1DXL A;  4GF7 A;  5JCI A;  3SFE A;  1PS9 A;  3GRT A;  1NHR A;  2R45 A;  3HYX A;  1V59 A;  3B3R A;  2IVD A;  3ZDN A;  2YLS A;  1JOA A;  2B9W A;  3LZX A;  1JRZ A;  1REO A;  3T14 A;  2C72 A;  3KLJ A;  2BK4 A;  4A99 A;  3EAN A;  5M10 A;  1HYU A;  3AEC A;  2BXS A;  2XFU A;  3OZ2 A;  3ICS A;  2A8X A;  5FS6 A;  4H4V A;  1ZOV A;  1D4C A;  3ITJ A;  5JCL A;  4H2P A;  1RP0 A;  1N4V A;  3DH9 A;  3NTA A;  3H4K A;  4GAP A;  4H4Q A;  2C75 A;  5BUK A;  2YLW A;  3NK1 X;  2C7G A;  1BGJ A;  1GOS A;  2WOI A;  1TDK A;  2YVJ A;  4GCM A;  3C96 A;  4IA5 A;  4K5R A;  4Y4M A;  2GR3 A;  1IUX A;  4GUV A;  2YQU A;  3IHG A;  1GTH A;  3CIR A;  4YKG A;  3GMB A;  5FS7 A;  5BUL A;  3NKS A;  1BGN A;  4I59 A;  1ZDL A;  2V3B A;  2YG3 A;  4LA1 A;  3QSE A;  4CNJ A;  3F8P A;  2J3N A;  3LXD A;  5KOX A;  3NTD A;  4NEV A;  4AOX A;  4H2R A;  5KOW A;  1D7Y A;  2XCG A;  1JRX A;  2I0Z A;  2HQM A;  2XFQ A;  4B66 A;  2E4G A;  3NT6 A;  4BK2 A;  3NH3 X;  1NDA A;  1YQZ A;  5M0Z A;  5L46 A;  1LTX R;  3KPF A;  2IVE A;  1P2E A;  2JB2 A;  3VQR A;  1TYT A;  1KNP A;  5C2T A;  5U1O A;  4GR1 A;  4JY2 A;  4LU6 A;  4DNA A;  4TM0 A;  3KD9 A;  5BRT A;  3NYF A;  1OJA A;  2GRT A;  4OPD A;  1H7W A;  4Y4L A;  3BHF A;  3CPJ G;  1NHQ A;  4II2 A;  3UOZ A;  2YG7 A;  1VRQ B;  1NPX A;  1ZK7 A;  4FX9 A;  2XLS A;  3DJG X;  3VRA A;  2BC0 A;  2R4J A;  3CMM A;  5KRQ A;  2WS3 A;  2YG4 A;  2XFO A;  3DJD A;  4UP3 A;  5GSN A;  2AR8 A;  4LII A;  2RAB A;  2PYX A;  1OJT A;  2CFY A;  1CL0 A;  2FBW A;  3DJE A;  5CQF A;  2RGO A;  2GF3 A;  2B9Y A;  2C3D A;  3AE1 A;  3NN6 X;  3UTE A;  2FJA A;  4MJW A;  3AE3 A;  2ZZC A;  4U8M A;  2VZ2 A;  1GND A;  2BAC A;  1H82 A;  4YSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...