4G74A

Crystal structure of ndh with quinone
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
478
structure length
471
Chain Sequence
GPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 156
structure length 471
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g74A00
5KMQA 4G6GA 3SXIA 3SZCA 4G6HA 3SX6A 3T14A 3T2KA 5KMRA 3SZWA 3HYWA 4G9KA 3KPKA 3T0KA 3SYIA 3T31A 4NWZA 4GAVA 4GAPA 5KMPA 3SZ0A 3SZFA 3HYXA 5KMSA 3T2ZA 4G73A 3T2YA 4G74A 3SY4A 3HYVA
chains in the Genus database with same CATH superfamily
2CVJA 3AD7B 4AP3A 3OC4A 5KVIA 1M64A 3F8RA 5BVAA 3IC9A 1DJQA 2EQ7A 4H4QA 1CBOA 4NTCA 4YTPA 4U2TA 3SFDA 1KNPA 4A7AA 2C65A 3CGEA 4CCRA 1H84A 4A99A 3M0OA 4AP1A 4CY8A 4GCMA 1PS9A 4TLZA 1EBDA 2XFQA 2X99A 3S5WA 1FECA 3AEFA 5J7XA 1ZMCA 1PXAA 4FX9A 4IA5A 1QJDA 3NLCA 4FK1A 3SYIA 2WP6A 4BJZA 2J3NA 4DGKA 2B9YA 2NPXA 3BI2A 1CC4A 2XFOA 1XANA 2YQUA 2FJBA 2XLUA 1W4XA 3EPTA 2GR3A 4J34A 2B9XA 3GYJA 2C76A 2OALA 2NVKX 4FK1C 1Y0PA 2VVLG 1OJ9A 3P4SA 4B63A 1N4WA 3KVEA 4EMWA 4YXDA 3QJ4A 4H4YA 1B8SA 3UTGA 4A9WA 4APNA 1ZMDA 2FJDA 3PO7A 2IVEA 1ZY8A 1P2HA 1PBCA 2BS4A 1ELIA 3URHA 2WU5A 4HB9A 2Q0KA 5U63A 4X9MA 4B1BA 3NG7X 3QSEA 2BCGG 3RNMA 2A89A 4MJWA 2VQ7A 3ALJA 5FMHA 2BC0A 2GAHB 4AT2A 1S2YA 1IUVA 2C72A 3AEDA 3G5SA 1OJCA 2RGOA 4GDEA 3T2ZA 4B65A 4BURA 4G73A 1D4CA 3UKFA 3K7TA 4K5SA 1BGJA 4H2QA 3CTYA 1F8SA 4A5LA 4U8LA 2X3NA 4K7ZA 3C4AA 4JDRA 2XFUA 2GF3A 2JK6A 3NN6X 3DJGX 1FL2A 5EBKA 4C3YA 3COXA 3AE1A 3T14A 3II4A 1NHSA 3FPZA 3CNTA 5KVHA 2GRTA 5C2TA 2YLZA 5C3JA 2XVEA 3GSIA 3NT6A 3CN8A 3KPKA 3P1WA 4YSYA 3G5RA 2AAQA 2EQ8A 3AXBA 5KWFA 2XLTA 3UOVA 1Q9IA 4C5OA 5JCKA 2YR4A 1Z6LA 2O9ZA 1D7LA 4UP3A 3ICTA 3VR9A 4JN9A 2B7SA 3VRDB 1N4UA 2WDRA 1RSGA 3D1CA 3LXDA 2XVHA 3NGCX 2C75A 4OCGA 3AYLA 5KMQA 5HY5A 5BUKA 5JCNA 3RHAA 1DODA 4NZHA 1FCDA 1PBDA 1ZOVA 1H6VA 4JY2A 4OPGA 3BHFA 3SX6A 4ZN0A 1TYPA 2VVMA 4CRTA 1Y56B 1B5QA 2GVCA 4YWOA 3AE7A 2FJAA 3H4KA 2B9WA 2GEWA 3GRTA 3ISHA 3NYFA 4K8DA 4U8JA 4J33A 4NTEA 2X8CA 3AE9A 3T31A 2H88A 2RGJA 2GB0A 3KA7A 5FS9A 1F8RA 1QLBA 1D7YA 2GR0A 2GQWA 1VG0A 2R0CA 3ADAB 3SZFA 4YKGA 1BF3A 3RP7A 1PXBA 2R0GA 3AYJA 3NHOX 3UKKA 2V6OA 3NN0X 1GV4A 3DK9A 3SY4A 2VVLA 2YLXA 4M52A 1LQTA 3SQPA 1H83A 4EM4A 2C7GA 2YLRA 5JCLA 3P4QA 1O5WA 1NHPA 1Y56A 1CC2A 2JB3A 3KU9A 4GRTA 3ZDNA 2QCUA 2WEUA 4NNJA 3SXIA 4K5RA 3EANA 2BACA 2BXRA 4H50A 3P9UA 1JOAA 5BULA 2ZZ0A 4Z2RA 3HYWA 3V3OA 1HYUA 4LU6A 3V76A 4H4SA 2YLTA 1GRHA 4XWRA 1LQUA 4HA6A 1K0JA 4BK2A 3IF9A 3DJDA 4USRA 1DOBA 2GH5A 3NYEA 3LJPA 1KFYA 4U8KA 5ER0A 1XDIA 2IIDA 1Q1WA 3GMBA 3CNPA 4OVIA 4ZCDA 1OJAA 4U2LA 1GT8A 1LJ1A 2W0HA 5BRTA 4CY6A 4TLXA 3HYVA 1CC6A 2XLSA 3H8IA 2X8GA 4TM4A 5IQ4A 4OPTA 3K7MX 3DGZA 4JY3A 3ALLA 1H7XA 2C67A 1BWCA 2VOUA 1JNZA 1PJ5A 2OLNA 4LA1A 4Z24A 4EIQA 1DOEA 5GRTA 1S3BA 2BCPA 3CNSA 3KLJA 4A6NB 2YWLA 5IPYA 2BS3A 2C73A 2WQYA 2GAGB 2WS3A 1NENA 2Q6UA 2HQMA 1IUXA 2XYOA 1S2QA 4O5UA 3UOZA 5KXJA 4NWZA 3UCLA 3GDPA 4CBQA 3QFBA 1TDKA 1FEAA 3K30A 4H4PA 5IQ1A 2C64A 2RABA 3F8DA 1LVLA 4PABA 1PBEA 1S3EA 3E1TA 4CNJA 2V3AA 2RGHA 3UOYA 2GQFA 2ZZCA 1RYIA 3I6DA 4EM3A 2XCGA 2DKIA 4NEWA 4OPLA 3NK2X 3AEEA 4KPRA 4IV9A 4J57A 4J56A 1BZLA 2R46A 4A6NA 4YT0A 2BABA 3LADA 2TPRA 5M0ZA 4B68A 4RG3A 4GUVA 3IHMA 3VR8A 3AECA 4K22A 1H7WA 1P2EA 3AD9B 4GDPA 4Z44A 4U8IA 4TM0A 1L9CA 1XPQA 4Y4LA 4XWZA 3C96A 1ZDLA 3JSKA 1E1NA 1KSSA 3NH3X 5KMPA 1GOSA 2E1MA 5GSNA 3VRBA 3HYXA 4BV6A 1PXCA 4YTMA 3CPJG 3VQRA 1L0VA 1F3PA 4H2NA 1V59A 3B3RA 1ZP0A 3AE8A 2WP5A 3RP8A 2YVFA 1PBFA 4B67A 1L9EA 5KOXA 3DK8A 2YG6A 3QFAA 3AEGA 1D4EA 3UP4A 3NIXA 2VQBA 4NTDA 1ZKQA 1PN0A 4Z25A 2C4CA 4H4WA 1GRAA 1ZX9A 2C3DA 1X31B 3KKJA 1NG4A 2XVIA 3T2KA 3AE3A 2EQ6A 3CGDA 3D8XA 2XVFA 3P4PA 3ITJA 1PBBA 3ATRA 3QVPA 4G9KA 1LPFA 4U8OA 3DGHA 3NKSA 1GRGA 3R9UA 1GTHA 2R4EA 3GYIA 2YR6A 4E0VA 2CDUA 3C4NA 3NTAA 3BI5A 5TR3A 1TDOA 2WPCA 3SZ0A 4U8PA 3BNMA 1M6IA 3GD4A 2V61A 3CGCA 3RP6A 4G74A 1D4DA 1CL0A 2YVGA 1GEUA 3ATQA 4BK3A 4A65A 2B7RA 1VDCA 3NRNA 1K0LA 1K0IA 4RSLA 4B69A 1N4VA 1YKJA 2FJEA 3CGBA 1UKVG 1IJHA 1IUWA 1RP0A 1GALA 1TDFA 2XDOA 4O5QA 2YG3A 1EL7A 4H4UA 5FS7A 3Q6JA 1PDHA 1D5TA 2C3CA 2GMHA 2A87A 3CPHG 3Q9TA 3ZYXA 5LV9A 1DNCA 1EL8A 4P9SA 4U2SA 3UP5A 3GMCA 4ZCCA 3SM8A 3ICSA 4EQRA 1CJCA 2V5ZA 1NHQA 2TMDA 4Z2UA 4H4VA 2R45A 3AEAA 1H81A 3SGLA 3REDA 2YG4A 3DJJA 3K7QX 4Z2TA 1GNDA 1GREA 4UDQA 2GR1A 1MOKA 5M10A 1LTXR 3CPIG 3QSMA 4UDRA 4U8MA 3GWDA 2JBVA 4ICYA 1KSUA 2JB2A 4JNAA 2IVDA 2CFYA 1REOA 2E4GA 2GMJA 2YR5A 3FMWA 4BK1A 1IUUA 3KD9A 2WOWA 4GAVA 4DSHA 2YG7A 2XLRA 1JU2A 1JRYA 3AE2A 2BXSA 1F8WA 3ALMA 1JNRA 1KDGA 1NAAA 1O94A 2VRLA 3G5QA 4IVOB 1GETA 1AOGA 1VRQB 2WESA 2OAMA 2XLPA 2ZBWA 1TDNA 1B4VA 2QA1A 1GPEA 3UTHA 3HZLA 1GRTA 2WOIA 3SZCA 4NEVA 1YQZA 2XFNA 1MXTA 4REKA 1ZOYA 3CNJA 4X9NA 4C74A 2V60A 3O0HA 4U8NA 2BC1A 1DJNA 3GWFA 3L8KA 1B37A 3DA1A 5J60A 2B76A 1BGNA 2JAEA 2VZ2A 3B6DA 2WHDA 2Y6QA 2YM1A 4UDPA 1EL9A 4FDCB 2BK5A 1TRBA 5JCMA 3AEBA 5KMSA 3BHKA 4YKFA 5U1OA 2YLWA 3UTFA 2AQJA 4C77A 4Y4MA 2GR2A 3AD8B 4AOSA 1N1PA 2VRMA 4G6GA 5L46A 3CMMA 2R0PA 3FG2P 3V3NA 2ARDA 5U25A 1CJ2A 3H8LA 2X8HA 4Z43A 4Y4NA 1NEKA 4TM1A 4CNKA 4DNAA 5EB4A 4XXGA 4D03A 2AR8A 3PVCA 3UKHA 1CJ3A 3GD3A 3LZWA 4H4TA 2WU2A 3FIMB 4OPUA 5JCIA 1XHCA 1MO9A 1GRFA 1YQ3A 2BYBA 3EF6A 4RG4A 3QVRA 4BJYA 4II2A 5KNLA 4H4RA 4WCTA 2BRYA 2BK4A 4OPCA 2ZZBA 3M12A 3UKPA 1CJ4A 4DSGA 2QAEA 3DJEA 3GDNA 4J2WA 4USQA 3UKAA 3AB1A 2EQ9A 2WP9A 4X4JA 4K2XA 2Z5XA 3ABVA 1F6MA 3I3LA 2PHHA 4AOXA 2BRAA 1TYTA 2PYXA 4I58A 4II3A 3L1RA 3ICRA 1NHRA 3VRAA 3NNEA 3UKLA 3EAOA 4JQ9A 3T0KA 1GRBA 3DK4A 2A8XA 4IA6A 1GESA 5DBJA 1H86A 4B64A 4EMIA 1JRZA 5CKUA 3M13A 1GERA 1EL5A 1E6EA 2F5ZA 1ONFA 4YSXA 5KRQA 1E1LA 4D04A 3CIRA 2FBWA 4H2PA 4KX6A 2I0ZA 4TM3A 4EQWA 1BKWA 4LIIA 2JB1A 1O95A 1PJ6A 1OJTA 4ECHA 1IUSA 2OA1A 2X50A 3PS9A 2YG5A 1E7PA 1NG3A 4AT0A 3IWAA 4GR1A 2V3BA 2WPFA 1KNRA 1NPXA 3UTEA 1SEZA 4J36A 3GRSA 3WE0A 5CQFA 1TDEA 1GTEA 1FEBA 4EQSA 2YLSA 2BA9A 3AE5A 2XVJA 2R9ZA 2WBAA 1PHHA 3BI4A 3NTDA 3T37A 2QA2A 5HHFA 4GF7A 3AE4A 3QSSA 2JKCA 1KF6A 2ACZA 2WETA 2WDVA 2YM2A 3FBSA 1VQWA 2UZZA 3GYXA 3DH9A 4J31A 1COYA 3S61A 3UKQA 1K4QA 1ZK7A 4I59A 3AYIA 3BNUA 4H4ZA 2OLOA 4G6HA 2BK3A 4EQXA 5FS8A 3LZXA 4EMJA 4A79A 2Y6RA 1NDAA 2GV8A 4ADWA 4YSZA 1GSNA 3AWIA 3LB8A 4N9XA 2CULA 3NK0X 5HYMA 4H2RA 1DXLA 4GAPA 4H4XA 2C66A 2WDQA 4CCQA 2YAUA 4EIPA 5KOWA 2BS2A 3IHGA 5EB5A 4B66A 4C3XA 3OZ2A 1IUTA 3T2YA 4OPDA 1JRXA 2Q0LA 4PAAA 1Q1RA 1E39A 2Z5YA 4JNQA 2E5VA 2H89A 1YQ4A 4WX1A 4YSHA 1H82A 1L9DA 2WPEA 3KPFA 1JEHA 3P4RA 1YY5A 5FS6A 4Z26A 1PJ7A 4IVMB 4H7UA 2APGA 1OJDA 4YTNA 5KMRA 3SZWA 2C70A 3LOVA 3NK1X 1E1MA 1CHUA 3CNDA 1CF3A 1E1KA 2YVJA 1DOCA 5HXIA 1FOHA 1QO8A 3SFEA 1LV0A 2WOVA 2DKHA 3F8PA 5EOWA 1VG9A 2Q7VA 3AE6A 3DMEA 2XFPA 2R4JA 3NYCA 3UOXA 4OPIA 1GXFA
chains in the Genus database with same CATH topology
2CVJA 3AD7B 4AP3A 3OC4A 5KVIA 1M64A 3F8RA 5BVAA 3IC9A 1DJQA 2EQ7A 4H4QA 1CBOA 4NTCA 4YTPA 4U2TA 3SFDA 1KNPA 4A7AA 2C65A 3CGEA 4CCRA 1H84A 4A99A 3M0OA 4AP1A 4CY8A 4GCMA 1PS9A 4TLZA 1EBDA 2XFQA 2X99A 3S5WA 1FECA 3AEFA 5J7XA 1ZMCA 1PXAA 4FX9A 4IA5A 1QJDA 3NLCA 4FK1A 3SYIA 2WP6A 4BJZA 2J3NA 4DGKA 2B9YA 2NPXA 3BI2A 1CC4A 2XFOA 1XANA 2YQUA 2FJBA 2XLUA 1W4XA 3EPTA 2GR3A 4J34A 2B9XA 3GYJA 2C76A 2OALA 2NVKX 4FK1C 1Y0PA 2VVLG 1OJ9A 3P4SA 4B63A 1N4WA 3KVEA 4EMWA 4YXDA 3QJ4A 4H4YA 1B8SA 3UTGA 4A9WA 4APNA 1ZMDA 2FJDA 3PO7A 2IVEA 1ZY8A 1P2HA 1PBCA 2BS4A 1ELIA 3URHA 2WU5A 4HB9A 2Q0KA 5U63A 4X9MA 4B1BA 3NG7X 3QSEA 2BCGG 3RNMA 2A89A 4MJWA 2VQ7A 3ALJA 5FMHA 2BC0A 2GAHB 4AT2A 1S2YA 1IUVA 2C72A 3AEDA 3G5SA 1OJCA 2RGOA 4GDEA 3T2ZA 4B65A 4BURA 4G73A 1D4CA 3UKFA 3K7TA 4K5SA 1BGJA 4H2QA 3CTYA 1F8SA 4A5LA 4U8LA 2X3NA 4K7ZA 3C4AA 4JDRA 2XFUA 2GF3A 2JK6A 3NN6X 3DJGX 1FL2A 5EBKA 4C3YA 3COXA 3AE1A 3T14A 3II4A 1NHSA 3FPZA 3CNTA 5KVHA 2GRTA 5C2TA 2YLZA 5C3JA 2XVEA 3GSIA 3NT6A 3CN8A 3KPKA 3P1WA 4YSYA 3G5RA 2AAQA 2EQ8A 3AXBA 5KWFA 2XLTA 3UOVA 1Q9IA 4C5OA 5JCKA 2YR4A 1Z6LA 2O9ZA 1D7LA 4UP3A 3ICTA 3VR9A 4JN9A 2B7SA 3VRDB 1N4UA 2WDRA 1RSGA 3D1CA 3LXDA 2XVHA 3NGCX 2C75A 4OCGA 3AYLA 5KMQA 5HY5A 5BUKA 5JCNA 3RHAA 1DODA 4NZHA 1FCDA 1PBDA 1ZOVA 1H6VA 4JY2A 4OPGA 3BHFA 3SX6A 4ZN0A 1TYPA 2VVMA 4CRTA 1Y56B 1B5QA 2GVCA 4YWOA 3AE7A 2FJAA 3H4KA 2B9WA 2GEWA 3GRTA 3ISHA 3NYFA 4K8DA 4U8JA 4J33A 4NTEA 2X8CA 3AE9A 3T31A 2H88A 2RGJA 2GB0A 3KA7A 5FS9A 1F8RA 1QLBA 1D7YA 2GR0A 2GQWA 1VG0A 2R0CA 3ADAB 3SZFA 4YKGA 1BF3A 3RP7A 1PXBA 2R0GA 3AYJA 3NHOX 3UKKA 2V6OA 3NN0X 1GV4A 3DK9A 3SY4A 2VVLA 2YLXA 4M52A 1LQTA 3SQPA 1H83A 4EM4A 2C7GA 2YLRA 5JCLA 3P4QA 1O5WA 1NHPA 1Y56A 1CC2A 2JB3A 3KU9A 4GRTA 3ZDNA 2QCUA 2WEUA 4NNJA 3SXIA 4K5RA 3EANA 2BACA 2BXRA 4H50A 3P9UA 1JOAA 5BULA 2ZZ0A 4Z2RA 3HYWA 3V3OA 1HYUA 4LU6A 3V76A 4H4SA 2YLTA 1GRHA 4XWRA 1LQUA 4HA6A 1K0JA 4BK2A 3IF9A 3DJDA 4USRA 1DOBA 2GH5A 3NYEA 3LJPA 1KFYA 4U8KA 5ER0A 1XDIA 2IIDA 1Q1WA 3GMBA 3CNPA 4OVIA 4ZCDA 1OJAA 4U2LA 1GT8A 1LJ1A 2W0HA 5BRTA 4CY6A 4TLXA 3HYVA 1CC6A 2XLSA 3H8IA 2X8GA 4TM4A 5IQ4A 4OPTA 3K7MX 3DGZA 4JY3A 3ALLA 1H7XA 2C67A 1BWCA 2VOUA 1JNZA 1PJ5A 2OLNA 4LA1A 4Z24A 4EIQA 1DOEA 5GRTA 1S3BA 2BCPA 3CNSA 3KLJA 4A6NB 2YWLA 5IPYA 2BS3A 2C73A 2WQYA 2GAGB 2WS3A 1NENA 2Q6UA 2HQMA 1IUXA 2XYOA 1S2QA 4O5UA 3UOZA 5KXJA 4NWZA 3UCLA 3GDPA 4CBQA 3QFBA 1TDKA 1FEAA 3K30A 4H4PA 5IQ1A 2C64A 2RABA 3F8DA 1LVLA 4PABA 1PBEA 1S3EA 3E1TA 4CNJA 2V3AA 2RGHA 3UOYA 2GQFA 2ZZCA 1RYIA 3I6DA 4EM3A 2XCGA 2DKIA 4NEWA 4OPLA 3NK2X 3AEEA 4KPRA 4IV9A 4J57A 4J56A 1BZLA 2R46A 4A6NA 4YT0A 2BABA 3LADA 2TPRA 5M0ZA 4B68A 4RG3A 4GUVA 3IHMA 3VR8A 3AECA 4K22A 1H7WA 1P2EA 3AD9B 4GDPA 4Z44A 4U8IA 4TM0A 1L9CA 1XPQA 4Y4LA 4XWZA 3C96A 1ZDLA 3JSKA 1E1NA 1KSSA 3NH3X 5KMPA 1GOSA 2E1MA 5GSNA 3VRBA 3HYXA 4BV6A 1PXCA 4YTMA 3CPJG 3VQRA 1L0VA 1F3PA 4H2NA 1V59A 3B3RA 1ZP0A 3AE8A 2WP5A 3RP8A 2YVFA 1PBFA 4B67A 1L9EA 5KOXA 3DK8A 2YG6A 3QFAA 3AEGA 1D4EA 3UP4A 3NIXA 2VQBA 4NTDA 1ZKQA 1PN0A 4Z25A 2C4CA 4H4WA 1GRAA 1ZX9A 2C3DA 1X31B 3KKJA 1NG4A 2XVIA 3T2KA 3AE3A 2EQ6A 3CGDA 3D8XA 2XVFA 3P4PA 3ITJA 1PBBA 3ATRA 3QVPA 4G9KA 1LPFA 4U8OA 3DGHA 3NKSA 1GRGA 3R9UA 1GTHA 2R4EA 3GYIA 2YR6A 4E0VA 2CDUA 3C4NA 3NTAA 3BI5A 5TR3A 1TDOA 2WPCA 3SZ0A 4U8PA 3BNMA 1M6IA 3GD4A 2V61A 3CGCA 3RP6A 4G74A 1D4DA 1CL0A 2YVGA 1GEUA 3ATQA 4BK3A 4A65A 2B7RA 1VDCA 3NRNA 1K0LA 1K0IA 4RSLA 4B69A 1N4VA 1YKJA 2FJEA 3CGBA 1UKVG 1IJHA 1IUWA 1RP0A 1GALA 1TDFA 2XDOA 4O5QA 2YG3A 1EL7A 4H4UA 5FS7A 3Q6JA 1PDHA 1D5TA 2C3CA 2GMHA 2A87A 3CPHG 3Q9TA 3ZYXA 5LV9A 1DNCA 1EL8A 4P9SA 4U2SA 3UP5A 3GMCA 4ZCCA 3SM8A 3ICSA 4EQRA 1CJCA 2V5ZA 1NHQA 2TMDA 4Z2UA 4H4VA 2R45A 3AEAA 1H81A 3SGLA 3REDA 2YG4A 3DJJA 3K7QX 4Z2TA 1GNDA 1GREA 4UDQA 2GR1A 1MOKA 5M10A 1LTXR 3CPIG 3QSMA 4UDRA 4U8MA 3GWDA 2JBVA 4ICYA 1KSUA 2JB2A 4JNAA 2IVDA 2CFYA 1REOA 2E4GA 2GMJA 2YR5A 3FMWA 4BK1A 1IUUA 3KD9A 2WOWA 4GAVA 4DSHA 2YG7A 2XLRA 1JU2A 1JRYA 3AE2A 2BXSA 1F8WA 3ALMA 1JNRA 1KDGA 1NAAA 1O94A 2VRLA 3G5QA 4IVOB 1GETA 1AOGA 1VRQB 2WESA 2OAMA 2XLPA 2ZBWA 1TDNA 1B4VA 2QA1A 1GPEA 3UTHA 3HZLA 1GRTA 2WOIA 3SZCA 4NEVA 1YQZA 2XFNA 1MXTA 4REKA 1ZOYA 3CNJA 4X9NA 4C74A 2V60A 3O0HA 4U8NA 2BC1A 1DJNA 3GWFA 3L8KA 1B37A 3DA1A 5J60A 2B76A 1BGNA 2JAEA 2VZ2A 3B6DA 2WHDA 2Y6QA 2YM1A 4UDPA 1EL9A 4FDCB 2BK5A 1TRBA 5JCMA 3AEBA 5KMSA 3BHKA 4YKFA 5U1OA 2YLWA 3UTFA 2AQJA 4C77A 4Y4MA 2GR2A 3AD8B 4AOSA 1N1PA 2VRMA 4G6GA 5L46A 3CMMA 2R0PA 3FG2P 3V3NA 2ARDA 5U25A 1CJ2A 3H8LA 2X8HA 4Z43A 4Y4NA 1NEKA 4TM1A 4CNKA 4DNAA 5EB4A 4XXGA 4D03A 2AR8A 3PVCA 3UKHA 1CJ3A 3GD3A 3LZWA 4H4TA 2WU2A 3FIMB 4OPUA 5JCIA 1XHCA 1MO9A 1GRFA 1YQ3A 2BYBA 3EF6A 4RG4A 3QVRA 4BJYA 4II2A 5KNLA 4H4RA 4WCTA 2BRYA 2BK4A 4OPCA 2ZZBA 3M12A 3UKPA 1CJ4A 4DSGA 2QAEA 3DJEA 3GDNA 4J2WA 4USQA 3UKAA 3AB1A 2EQ9A 2WP9A 4X4JA 4K2XA 2Z5XA 3ABVA 1F6MA 3I3LA 2PHHA 4AOXA 2BRAA 1TYTA 2PYXA 4I58A 4II3A 3L1RA 3ICRA 1NHRA 3VRAA 3NNEA 3UKLA 3EAOA 4JQ9A 3T0KA 1GRBA 3DK4A 2A8XA 4IA6A 1GESA 5DBJA 1H86A 4B64A 4EMIA 1JRZA 5CKUA 3M13A 1GERA 1EL5A 1E6EA 2F5ZA 1ONFA 4YSXA 5KRQA 1E1LA 4D04A 3CIRA 2FBWA 4H2PA 4KX6A 2I0ZA 4TM3A 4EQWA 1BKWA 4LIIA 2JB1A 1O95A 1PJ6A 1OJTA 4ECHA 1IUSA 2OA1A 2X50A 3PS9A 2YG5A 1E7PA 1NG3A 4AT0A 3IWAA 4GR1A 2V3BA 2WPFA 1KNRA 1NPXA 3UTEA 1SEZA 4J36A 3GRSA 3WE0A 5CQFA 1TDEA 1GTEA 1FEBA 4EQSA 2YLSA 2BA9A 3AE5A 2XVJA 2R9ZA 2WBAA 1PHHA 3BI4A 3NTDA 3T37A 2QA2A 5HHFA 4GF7A 3AE4A 3QSSA 2JKCA 1KF6A 2ACZA 2WETA 2WDVA 2YM2A 3FBSA 1VQWA 2UZZA 3GYXA 3DH9A 4J31A 1COYA 3S61A 3UKQA 1K4QA 1ZK7A 4I59A 3AYIA 3BNUA 4H4ZA 2OLOA 4G6HA 2BK3A 4EQXA 5FS8A 3LZXA 4EMJA 4A79A 2Y6RA 1NDAA 2GV8A 4ADWA 4YSZA 1GSNA 3AWIA 3LB8A 4N9XA 2CULA 3NK0X 5HYMA 4H2RA 1DXLA 4GAPA 4H4XA 2C66A 2WDQA 4CCQA 2YAUA 4EIPA 5KOWA 2BS2A 3IHGA 5EB5A 4B66A 4C3XA 3OZ2A 1IUTA 3T2YA 4OPDA 1JRXA 2Q0LA 4PAAA 1Q1RA 1E39A 2Z5YA 4JNQA 2E5VA 2H89A 1YQ4A 4WX1A 4YSHA 1H82A 1L9DA 2WPEA 3KPFA 1JEHA 3P4RA 1YY5A 5FS6A 4Z26A 1PJ7A 4IVMB 4H7UA 2APGA 1OJDA 4YTNA 5KMRA 3SZWA 2C70A 3LOVA 3NK1X 1E1MA 1CHUA 3CNDA 1CF3A 1E1KA 2YVJA 1DOCA 5HXIA 1FOHA 1QO8A 3SFEA 1LV0A 2WOVA 2DKHA 3F8PA 5EOWA 1VG9A 2Q7VA 3AE6A 3DMEA 2XFPA 2R4JA 3NYCA 3UOXA 4OPIA 1GXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KMQ A;  4G6G A;  3SXI A;  3SZC A;  4G6H A;  3SX6 A;  3T14 A;  3T2K A;  5KMR A;  3SZW A;  3HYW A;  4G9K A;  3KPK A;  3T0K A;  3SYI A;  3T31 A;  4NWZ A;  4GAV A;  4GAP A;  5KMP A;  3SZ0 A;  3SZF A;  3HYX A;  5KMS A;  3T2Z A;  4G73 A;  3T2Y A;  4G74 A;  3SY4 A;  3HYV A; 
#chains in the Genus database with same CATH topology
 2CVJ A;  3AD7 B;  4AP3 A;  3OC4 A;  5KVI A;  1M64 A;  3F8R A;  5BVA A;  3IC9 A;  1DJQ A;  2EQ7 A;  4H4Q A;  1CBO A;  4NTC A;  4YTP A;  4U2T A;  3SFD A;  1KNP A;  4A7A A;  2C65 A;  3CGE A;  4CCR A;  1H84 A;  4A99 A;  3M0O A;  4AP1 A;  4CY8 A;  4GCM A;  1PS9 A;  4TLZ A;  1EBD A;  2XFQ A;  2X99 A;  3S5W A;  1FEC A;  3AEF A;  5J7X A;  1ZMC A;  1PXA A;  4FX9 A;  4IA5 A;  1QJD A;  3NLC A;  4FK1 A;  3SYI A;  2WP6 A;  4BJZ A;  2J3N A;  4DGK A;  2B9Y A;  2NPX A;  3BI2 A;  1CC4 A;  2XFO A;  1XAN A;  2YQU A;  2FJB A;  2XLU A;  1W4X A;  3EPT A;  2GR3 A;  4J34 A;  2B9X A;  3GYJ A;  2C76 A;  2OAL A;  2NVK X;  4FK1 C;  1Y0P A;  2VVL G;  1OJ9 A;  3P4S A;  4B63 A;  1N4W A;  3KVE A;  4EMW A;  4YXD A;  3QJ4 A;  4H4Y A;  1B8S A;  3UTG A;  4A9W A;  4APN A;  1ZMD A;  2FJD A;  3PO7 A;  2IVE A;  1ZY8 A;  1P2H A;  1PBC A;  2BS4 A;  1ELI A;  3URH A;  2WU5 A;  4HB9 A;  2Q0K A;  5U63 A;  4X9M A;  4B1B A;  3NG7 X;  3QSE A;  2BCG G;  3RNM A;  2A89 A;  4MJW A;  2VQ7 A;  3ALJ A;  5FMH A;  2BC0 A;  2GAH B;  4AT2 A;  1S2Y A;  1IUV A;  2C72 A;  3AED A;  3G5S A;  1OJC A;  2RGO A;  4GDE A;  3T2Z A;  4B65 A;  4BUR A;  4G73 A;  1D4C A;  3UKF A;  3K7T A;  4K5S A;  1BGJ A;  4H2Q A;  3CTY A;  1F8S A;  4A5L A;  4U8L A;  2X3N A;  4K7Z A;  3C4A A;  4JDR A;  2XFU A;  2GF3 A;  2JK6 A;  3NN6 X;  3DJG X;  1FL2 A;  5EBK A;  4C3Y A;  3COX A;  3AE1 A;  3T14 A;  3II4 A;  1NHS A;  3FPZ A;  3CNT A;  5KVH A;  2GRT A;  5C2T A;  2YLZ A;  5C3J A;  2XVE A;  3GSI A;  3NT6 A;  3CN8 A;  3KPK A;  3P1W A;  4YSY A;  3G5R A;  2AAQ A;  2EQ8 A;  3AXB A;  5KWF A;  2XLT A;  3UOV A;  1Q9I A;  4C5O A;  5JCK A;  2YR4 A;  1Z6L A;  2O9Z A;  1D7L A;  4UP3 A;  3ICT A;  3VR9 A;  4JN9 A;  2B7S A;  3VRD B;  1N4U A;  2WDR A;  1RSG A;  3D1C A;  3LXD A;  2XVH A;  3NGC X;  2C75 A;  4OCG A;  3AYL A;  5KMQ A;  5HY5 A;  5BUK A;  5JCN A;  3RHA A;  1DOD A;  4NZH A;  1FCD A;  1PBD A;  1ZOV A;  1H6V A;  4JY2 A;  4OPG A;  3BHF A;  3SX6 A;  4ZN0 A;  1TYP A;  2VVM A;  4CRT A;  1Y56 B;  1B5Q A;  2GVC A;  4YWO A;  3AE7 A;  2FJA A;  3H4K A;  2B9W A;  2GEW A;  3GRT A;  3ISH A;  3NYF A;  4K8D A;  4U8J A;  4J33 A;  4NTE A;  2X8C A;  3AE9 A;  3T31 A;  2H88 A;  2RGJ A;  2GB0 A;  3KA7 A;  5FS9 A;  1F8R A;  1QLB A;  1D7Y A;  2GR0 A;  2GQW A;  1VG0 A;  2R0C A;  3ADA B;  3SZF A;  4YKG A;  1BF3 A;  3RP7 A;  1PXB A;  2R0G A;  3AYJ A;  3NHO X;  3UKK A;  2V6O A;  3NN0 X;  1GV4 A;  3DK9 A;  3SY4 A;  2VVL A;  2YLX A;  4M52 A;  1LQT A;  3SQP A;  1H83 A;  4EM4 A;  2C7G A;  2YLR A;  5JCL A;  3P4Q A;  1O5W A;  1NHP A;  1Y56 A;  1CC2 A;  2JB3 A;  3KU9 A;  4GRT A;  3ZDN A;  2QCU A;  2WEU A;  4NNJ A;  3SXI A;  4K5R A;  3EAN A;  2BAC A;  2BXR A;  4H50 A;  3P9U A;  1JOA A;  5BUL A;  2ZZ0 A;  4Z2R A;  3HYW A;  3V3O A;  1HYU A;  4LU6 A;  3V76 A;  4H4S A;  2YLT A;  1GRH A;  4XWR A;  1LQU A;  4HA6 A;  1K0J A;  4BK2 A;  3IF9 A;  3DJD A;  4USR A;  1DOB A;  2GH5 A;  3NYE A;  3LJP A;  1KFY A;  4U8K A;  5ER0 A;  1XDI A;  2IID A;  1Q1W A;  3GMB A;  3CNP A;  4OVI A;  4ZCD A;  1OJA A;  4U2L A;  1GT8 A;  1LJ1 A;  2W0H A;  5BRT A;  4CY6 A;  4TLX A;  3HYV A;  1CC6 A;  2XLS A;  3H8I A;  2X8G A;  4TM4 A;  5IQ4 A;  4OPT A;  3K7M X;  3DGZ A;  4JY3 A;  3ALL A;  1H7X A;  2C67 A;  1BWC A;  2VOU A;  1JNZ A;  1PJ5 A;  2OLN A;  4LA1 A;  4Z24 A;  4EIQ A;  1DOE A;  5GRT A;  1S3B A;  2BCP A;  3CNS A;  3KLJ A;  4A6N B;  2YWL A;  5IPY A;  2BS3 A;  2C73 A;  2WQY A;  2GAG B;  2WS3 A;  1NEN A;  2Q6U A;  2HQM A;  1IUX A;  2XYO A;  1S2Q A;  4O5U A;  3UOZ A;  5KXJ A;  4NWZ A;  3UCL A;  3GDP A;  4CBQ A;  3QFB A;  1TDK A;  1FEA A;  3K30 A;  4H4P A;  5IQ1 A;  2C64 A;  2RAB A;  3F8D A;  1LVL A;  4PAB A;  1PBE A;  1S3E A;  3E1T A;  4CNJ A;  2V3A A;  2RGH A;  3UOY A;  2GQF A;  2ZZC A;  1RYI A;  3I6D A;  4EM3 A;  2XCG A;  2DKI A;  4NEW A;  4OPL A;  3NK2 X;  3AEE A;  4KPR A;  4IV9 A;  4J57 A;  4J56 A;  1BZL A;  2R46 A;  4A6N A;  4YT0 A;  2BAB A;  3LAD A;  2TPR A;  5M0Z A;  4B68 A;  4RG3 A;  4GUV A;  3IHM A;  3VR8 A;  3AEC A;  4K22 A;  1H7W A;  1P2E A;  3AD9 B;  4GDP A;  4Z44 A;  4U8I A;  4TM0 A;  1L9C A;  1XPQ A;  4Y4L A;  4XWZ A;  3C96 A;  1ZDL A;  3JSK A;  1E1N A;  1KSS A;  3NH3 X;  5KMP A;  1GOS A;  2E1M A;  5GSN A;  3VRB A;  3HYX A;  4BV6 A;  1PXC A;  4YTM A;  3CPJ G;  3VQR A;  1L0V A;  1F3P A;  4H2N A;  1V59 A;  3B3R A;  1ZP0 A;  3AE8 A;  2WP5 A;  3RP8 A;  2YVF A;  1PBF A;  4B67 A;  1L9E A;  5KOX A;  3DK8 A;  2YG6 A;  3QFA A;  3AEG A;  1D4E A;  3UP4 A;  3NIX A;  2VQB A;  4NTD A;  1ZKQ A;  1PN0 A;  4Z25 A;  2C4C A;  4H4W A;  1GRA A;  1ZX9 A;  2C3D A;  1X31 B;  3KKJ A;  1NG4 A;  2XVI A;  3T2K A;  3AE3 A;  2EQ6 A;  3CGD A;  3D8X A;  2XVF A;  3P4P A;  3ITJ A;  1PBB A;  3ATR A;  3QVP A;  4G9K A;  1LPF A;  4U8O A;  3DGH A;  3NKS A;  1GRG A;  3R9U A;  1GTH A;  2R4E A;  3GYI A;  2YR6 A;  4E0V A;  2CDU A;  3C4N A;  3NTA A;  3BI5 A;  5TR3 A;  1TDO A;  2WPC A;  3SZ0 A;  4U8P A;  3BNM A;  1M6I A;  3GD4 A;  2V61 A;  3CGC A;  3RP6 A;  4G74 A;  1D4D A;  1CL0 A;  2YVG A;  1GEU A;  3ATQ A;  4BK3 A;  4A65 A;  2B7R A;  1VDC A;  3NRN A;  1K0L A;  1K0I A;  4RSL A;  4B69 A;  1N4V A;  1YKJ A;  2FJE A;  3CGB A;  1UKV G;  1IJH A;  1IUW A;  1RP0 A;  1GAL A;  1TDF A;  2XDO A;  4O5Q A;  2YG3 A;  1EL7 A;  4H4U A;  5FS7 A;  3Q6J A;  1PDH A;  1D5T A;  2C3C A;  2GMH A;  2A87 A;  3CPH G;  3Q9T A;  3ZYX A;  5LV9 A;  1DNC A;  1EL8 A;  4P9S A;  4U2S A;  3UP5 A;  3GMC A;  4ZCC A;  3SM8 A;  3ICS A;  4EQR A;  1CJC A;  2V5Z A;  1NHQ A;  2TMD A;  4Z2U A;  4H4V A;  2R45 A;  3AEA A;  1H81 A;  3SGL A;  3RED A;  2YG4 A;  3DJJ A;  3K7Q X;  4Z2T A;  1GND A;  1GRE A;  4UDQ A;  2GR1 A;  1MOK A;  5M10 A;  1LTX R;  3CPI G;  3QSM A;  4UDR A;  4U8M A;  3GWD A;  2JBV A;  4ICY A;  1KSU A;  2JB2 A;  4JNA A;  2IVD A;  2CFY A;  1REO A;  2E4G A;  2GMJ A;  2YR5 A;  3FMW A;  4BK1 A;  1IUU A;  3KD9 A;  2WOW A;  4GAV A;  4DSH A;  2YG7 A;  2XLR A;  1JU2 A;  1JRY A;  3AE2 A;  2BXS A;  1F8W A;  3ALM A;  1JNR A;  1KDG A;  1NAA A;  1O94 A;  2VRL A;  3G5Q A;  4IVO B;  1GET A;  1AOG A;  1VRQ B;  2WES A;  2OAM A;  2XLP A;  2ZBW A;  1TDN A;  1B4V A;  2QA1 A;  1GPE A;  3UTH A;  3HZL A;  1GRT A;  2WOI A;  3SZC A;  4NEV A;  1YQZ A;  2XFN A;  1MXT A;  4REK A;  1ZOY A;  3CNJ A;  4X9N A;  4C74 A;  2V60 A;  3O0H A;  4U8N A;  2BC1 A;  1DJN A;  3GWF A;  3L8K A;  1B37 A;  3DA1 A;  5J60 A;  2B76 A;  1BGN A;  2JAE A;  2VZ2 A;  3B6D A;  2WHD A;  2Y6Q A;  2YM1 A;  4UDP A;  1EL9 A;  4FDC B;  2BK5 A;  1TRB A;  5JCM A;  3AEB A;  5KMS A;  3BHK A;  4YKF A;  5U1O A;  2YLW A;  3UTF A;  2AQJ A;  4C77 A;  4Y4M A;  2GR2 A;  3AD8 B;  4AOS A;  1N1P A;  2VRM A;  4G6G A;  5L46 A;  3CMM A;  2R0P A;  3FG2 P;  3V3N A;  2ARD A;  5U25 A;  1CJ2 A;  3H8L A;  2X8H A;  4Z43 A;  4Y4N A;  1NEK A;  4TM1 A;  4CNK A;  4DNA A;  5EB4 A;  4XXG A;  4D03 A;  2AR8 A;  3PVC A;  3UKH A;  1CJ3 A;  3GD3 A;  3LZW A;  4H4T A;  2WU2 A;  3FIM B;  4OPU A;  5JCI A;  1XHC A;  1MO9 A;  1GRF A;  1YQ3 A;  2BYB A;  3EF6 A;  4RG4 A;  3QVR A;  4BJY A;  4II2 A;  5KNL A;  4H4R A;  4WCT A;  2BRY A;  2BK4 A;  4OPC A;  2ZZB A;  3M12 A;  3UKP A;  1CJ4 A;  4DSG A;  2QAE A;  3DJE A;  3GDN A;  4J2W A;  4USQ A;  3UKA A;  3AB1 A;  2EQ9 A;  2WP9 A;  4X4J A;  4K2X A;  2Z5X A;  3ABV A;  1F6M A;  3I3L A;  2PHH A;  4AOX A;  2BRA A;  1TYT A;  2PYX A;  4I58 A;  4II3 A;  3L1R A;  3ICR A;  1NHR A;  3VRA A;  3NNE A;  3UKL A;  3EAO A;  4JQ9 A;  3T0K A;  1GRB A;  3DK4 A;  2A8X A;  4IA6 A;  1GES A;  5DBJ A;  1H86 A;  4B64 A;  4EMI A;  1JRZ A;  5CKU A;  3M13 A;  1GER A;  1EL5 A;  1E6E A;  2F5Z A;  1ONF A;  4YSX A;  5KRQ A;  1E1L A;  4D04 A;  3CIR A;  2FBW A;  4H2P A;  4KX6 A;  2I0Z A;  4TM3 A;  4EQW A;  1BKW A;  4LII A;  2JB1 A;  1O95 A;  1PJ6 A;  1OJT A;  4ECH A;  1IUS A;  2OA1 A;  2X50 A;  3PS9 A;  2YG5 A;  1E7P A;  1NG3 A;  4AT0 A;  3IWA A;  4GR1 A;  2V3B A;  2WPF A;  1KNR A;  1NPX A;  3UTE A;  1SEZ A;  4J36 A;  3GRS A;  3WE0 A;  5CQF A;  1TDE A;  1GTE A;  1FEB A;  4EQS A;  2YLS A;  2BA9 A;  3AE5 A;  2XVJ A;  2R9Z A;  2WBA A;  1PHH A;  3BI4 A;  3NTD A;  3T37 A;  2QA2 A;  5HHF A;  4GF7 A;  3AE4 A;  3QSS A;  2JKC A;  1KF6 A;  2ACZ A;  2WET A;  2WDV A;  2YM2 A;  3FBS A;  1VQW A;  2UZZ A;  3GYX A;  3DH9 A;  4J31 A;  1COY A;  3S61 A;  3UKQ A;  1K4Q A;  1ZK7 A;  4I59 A;  3AYI A;  3BNU A;  4H4Z A;  2OLO A;  4G6H A;  2BK3 A;  4EQX A;  5FS8 A;  3LZX A;  4EMJ A;  4A79 A;  2Y6R A;  1NDA A;  2GV8 A;  4ADW A;  4YSZ A;  1GSN A;  3AWI A;  3LB8 A;  4N9X A;  2CUL A;  3NK0 X;  5HYM A;  4H2R A;  1DXL A;  4GAP A;  4H4X A;  2C66 A;  2WDQ A;  4CCQ A;  2YAU A;  4EIP A;  5KOW A;  2BS2 A;  3IHG A;  5EB5 A;  4B66 A;  4C3X A;  3OZ2 A;  1IUT A;  3T2Y A;  4OPD A;  1JRX A;  2Q0L A;  4PAA A;  1Q1R A;  1E39 A;  2Z5Y A;  4JNQ A;  2E5V A;  2H89 A;  1YQ4 A;  4WX1 A;  4YSH A;  1H82 A;  1L9D A;  2WPE A;  3KPF A;  1JEH A;  3P4R A;  1YY5 A;  5FS6 A;  4Z26 A;  1PJ7 A;  4IVM B;  4H7U A;  2APG A;  1OJD A;  4YTN A;  5KMR A;  3SZW A;  2C70 A;  3LOV A;  3NK1 X;  1E1M A;  1CHU A;  3CND A;  1CF3 A;  1E1K A;  2YVJ A;  1DOC A;  5HXI A;  1FOH A;  1QO8 A;  3SFE A;  1LV0 A;  2WOV A;  2DKH A;  3F8P A;  5EOW A;  1VG9 A;  2Q7V A;  3AE6 A;  3DME A;  2XFP A;  2R4J A;  3NYC A;  3UOX A;  4OPI A;  1GXF A; 
#chains in the Genus database with same CATH homology
 2CVJ A;  3AD7 B;  4AP3 A;  3OC4 A;  5KVI A;  1M64 A;  3F8R A;  5BVA A;  3IC9 A;  1DJQ A;  2EQ7 A;  4H4Q A;  1CBO A;  4NTC A;  4YTP A;  4U2T A;  3SFD A;  1KNP A;  4A7A A;  2C65 A;  3CGE A;  4CCR A;  1H84 A;  4A99 A;  3M0O A;  4AP1 A;  4CY8 A;  4GCM A;  1PS9 A;  4TLZ A;  1EBD A;  2XFQ A;  2X99 A;  3S5W A;  1FEC A;  3AEF A;  5J7X A;  1ZMC A;  1PXA A;  4FX9 A;  4IA5 A;  1QJD A;  3NLC A;  4FK1 A;  3SYI A;  2WP6 A;  4BJZ A;  2J3N A;  4DGK A;  2B9Y A;  2NPX A;  3BI2 A;  1CC4 A;  2XFO A;  1XAN A;  2YQU A;  2FJB A;  2XLU A;  1W4X A;  3EPT A;  2GR3 A;  4J34 A;  2B9X A;  3GYJ A;  2C76 A;  2OAL A;  2NVK X;  4FK1 C;  1Y0P A;  2VVL G;  1OJ9 A;  3P4S A;  4B63 A;  1N4W A;  3KVE A;  4EMW A;  4YXD A;  3QJ4 A;  4H4Y A;  1B8S A;  3UTG A;  4A9W A;  4APN A;  1ZMD A;  2FJD A;  3PO7 A;  2IVE A;  1ZY8 A;  1P2H A;  1PBC A;  2BS4 A;  1ELI A;  3URH A;  2WU5 A;  4HB9 A;  2Q0K A;  5U63 A;  4X9M A;  4B1B A;  3NG7 X;  3QSE A;  2BCG G;  3RNM A;  2A89 A;  4MJW A;  2VQ7 A;  3ALJ A;  5FMH A;  2BC0 A;  2GAH B;  4AT2 A;  1S2Y A;  1IUV A;  2C72 A;  3AED A;  3G5S A;  1OJC A;  2RGO A;  4GDE A;  3T2Z A;  4B65 A;  4BUR A;  4G73 A;  1D4C A;  3UKF A;  3K7T A;  4K5S A;  1BGJ A;  4H2Q A;  3CTY A;  1F8S A;  4A5L A;  4U8L A;  2X3N A;  4K7Z A;  3C4A A;  4JDR A;  2XFU A;  2GF3 A;  2JK6 A;  3NN6 X;  3DJG X;  1FL2 A;  5EBK A;  4C3Y A;  3COX A;  3AE1 A;  3T14 A;  3II4 A;  1NHS A;  3FPZ A;  3CNT A;  5KVH A;  2GRT A;  5C2T A;  2YLZ A;  5C3J A;  2XVE A;  3GSI A;  3NT6 A;  3CN8 A;  3KPK A;  3P1W A;  4YSY A;  3G5R A;  2AAQ A;  2EQ8 A;  3AXB A;  5KWF A;  2XLT A;  3UOV A;  1Q9I A;  4C5O A;  5JCK A;  2YR4 A;  1Z6L A;  2O9Z A;  1D7L A;  4UP3 A;  3ICT A;  3VR9 A;  4JN9 A;  2B7S A;  3VRD B;  1N4U A;  2WDR A;  1RSG A;  3D1C A;  3LXD A;  2XVH A;  3NGC X;  2C75 A;  4OCG A;  3AYL A;  5KMQ A;  5HY5 A;  5BUK A;  5JCN A;  3RHA A;  1DOD A;  4NZH A;  1FCD A;  1PBD A;  1ZOV A;  1H6V A;  4JY2 A;  4OPG A;  3BHF A;  3SX6 A;  4ZN0 A;  1TYP A;  2VVM A;  4CRT A;  1Y56 B;  1B5Q A;  2GVC A;  4YWO A;  3AE7 A;  2FJA A;  3H4K A;  2B9W A;  2GEW A;  3GRT A;  3ISH A;  3NYF A;  4K8D A;  4U8J A;  4J33 A;  4NTE A;  2X8C A;  3AE9 A;  3T31 A;  2H88 A;  2RGJ A;  2GB0 A;  3KA7 A;  5FS9 A;  1F8R A;  1QLB A;  1D7Y A;  2GR0 A;  2GQW A;  1VG0 A;  2R0C A;  3ADA B;  3SZF A;  4YKG A;  1BF3 A;  3RP7 A;  1PXB A;  2R0G A;  3AYJ A;  3NHO X;  3UKK A;  2V6O A;  3NN0 X;  1GV4 A;  3DK9 A;  3SY4 A;  2VVL A;  2YLX A;  4M52 A;  1LQT A;  3SQP A;  1H83 A;  4EM4 A;  2C7G A;  2YLR A;  5JCL A;  3P4Q A;  1O5W A;  1NHP A;  1Y56 A;  1CC2 A;  2JB3 A;  3KU9 A;  4GRT A;  3ZDN A;  2QCU A;  2WEU A;  4NNJ A;  3SXI A;  4K5R A;  3EAN A;  2BAC A;  2BXR A;  4H50 A;  3P9U A;  1JOA A;  5BUL A;  2ZZ0 A;  4Z2R A;  3HYW A;  3V3O A;  1HYU A;  4LU6 A;  3V76 A;  4H4S A;  2YLT A;  1GRH A;  4XWR A;  1LQU A;  4HA6 A;  1K0J A;  4BK2 A;  3IF9 A;  3DJD A;  4USR A;  1DOB A;  2GH5 A;  3NYE A;  3LJP A;  1KFY A;  4U8K A;  5ER0 A;  1XDI A;  2IID A;  1Q1W A;  3GMB A;  3CNP A;  4OVI A;  4ZCD A;  1OJA A;  4U2L A;  1GT8 A;  1LJ1 A;  2W0H A;  5BRT A;  4CY6 A;  4TLX A;  3HYV A;  1CC6 A;  2XLS A;  3H8I A;  2X8G A;  4TM4 A;  5IQ4 A;  4OPT A;  3K7M X;  3DGZ A;  4JY3 A;  3ALL A;  1H7X A;  2C67 A;  1BWC A;  2VOU A;  1JNZ A;  1PJ5 A;  2OLN A;  4LA1 A;  4Z24 A;  4EIQ A;  1DOE A;  5GRT A;  1S3B A;  2BCP A;  3CNS A;  3KLJ A;  4A6N B;  2YWL A;  5IPY A;  2BS3 A;  2C73 A;  2WQY A;  2GAG B;  2WS3 A;  1NEN A;  2Q6U A;  2HQM A;  1IUX A;  2XYO A;  1S2Q A;  4O5U A;  3UOZ A;  5KXJ A;  4NWZ A;  3UCL A;  3GDP A;  4CBQ A;  3QFB A;  1TDK A;  1FEA A;  3K30 A;  4H4P A;  5IQ1 A;  2C64 A;  2RAB A;  3F8D A;  1LVL A;  4PAB A;  1PBE A;  1S3E A;  3E1T A;  4CNJ A;  2V3A A;  2RGH A;  3UOY A;  2GQF A;  2ZZC A;  1RYI A;  3I6D A;  4EM3 A;  2XCG A;  2DKI A;  4NEW A;  4OPL A;  3NK2 X;  3AEE A;  4KPR A;  4IV9 A;  4J57 A;  4J56 A;  1BZL A;  2R46 A;  4A6N A;  4YT0 A;  2BAB A;  3LAD A;  2TPR A;  5M0Z A;  4B68 A;  4RG3 A;  4GUV A;  3IHM A;  3VR8 A;  3AEC A;  4K22 A;  1H7W A;  1P2E A;  3AD9 B;  4GDP A;  4Z44 A;  4U8I A;  4TM0 A;  1L9C A;  1XPQ A;  4Y4L A;  4XWZ A;  3C96 A;  1ZDL A;  3JSK A;  1E1N A;  1KSS A;  3NH3 X;  5KMP A;  1GOS A;  2E1M A;  5GSN A;  3VRB A;  3HYX A;  4BV6 A;  1PXC A;  4YTM A;  3CPJ G;  3VQR A;  1L0V A;  1F3P A;  4H2N A;  1V59 A;  3B3R A;  1ZP0 A;  3AE8 A;  2WP5 A;  3RP8 A;  2YVF A;  1PBF A;  4B67 A;  1L9E A;  5KOX A;  3DK8 A;  2YG6 A;  3QFA A;  3AEG A;  1D4E A;  3UP4 A;  3NIX A;  2VQB A;  4NTD A;  1ZKQ A;  1PN0 A;  4Z25 A;  2C4C A;  4H4W A;  1GRA A;  1ZX9 A;  2C3D A;  1X31 B;  3KKJ A;  1NG4 A;  2XVI A;  3T2K A;  3AE3 A;  2EQ6 A;  3CGD A;  3D8X A;  2XVF A;  3P4P A;  3ITJ A;  1PBB A;  3ATR A;  3QVP A;  4G9K A;  1LPF A;  4U8O A;  3DGH A;  3NKS A;  1GRG A;  3R9U A;  1GTH A;  2R4E A;  3GYI A;  2YR6 A;  4E0V A;  2CDU A;  3C4N A;  3NTA A;  3BI5 A;  5TR3 A;  1TDO A;  2WPC A;  3SZ0 A;  4U8P A;  3BNM A;  1M6I A;  3GD4 A;  2V61 A;  3CGC A;  3RP6 A;  4G74 A;  1D4D A;  1CL0 A;  2YVG A;  1GEU A;  3ATQ A;  4BK3 A;  4A65 A;  2B7R A;  1VDC A;  3NRN A;  1K0L A;  1K0I A;  4RSL A;  4B69 A;  1N4V A;  1YKJ A;  2FJE A;  3CGB A;  1UKV G;  1IJH A;  1IUW A;  1RP0 A;  1GAL A;  1TDF A;  2XDO A;  4O5Q A;  2YG3 A;  1EL7 A;  4H4U A;  5FS7 A;  3Q6J A;  1PDH A;  1D5T A;  2C3C A;  2GMH A;  2A87 A;  3CPH G;  3Q9T A;  3ZYX A;  5LV9 A;  1DNC A;  1EL8 A;  4P9S A;  4U2S A;  3UP5 A;  3GMC A;  4ZCC A;  3SM8 A;  3ICS A;  4EQR A;  1CJC A;  2V5Z A;  1NHQ A;  2TMD A;  4Z2U A;  4H4V A;  2R45 A;  3AEA A;  1H81 A;  3SGL A;  3RED A;  2YG4 A;  3DJJ A;  3K7Q X;  4Z2T A;  1GND A;  1GRE A;  4UDQ A;  2GR1 A;  1MOK A;  5M10 A;  1LTX R;  3CPI G;  3QSM A;  4UDR A;  4U8M A;  3GWD A;  2JBV A;  4ICY A;  1KSU A;  2JB2 A;  4JNA A;  2IVD A;  2CFY A;  1REO A;  2E4G A;  2GMJ A;  2YR5 A;  3FMW A;  4BK1 A;  1IUU A;  3KD9 A;  2WOW A;  4GAV A;  4DSH A;  2YG7 A;  2XLR A;  1JU2 A;  1JRY A;  3AE2 A;  2BXS A;  1F8W A;  3ALM A;  1JNR A;  1KDG A;  1NAA A;  1O94 A;  2VRL A;  3G5Q A;  4IVO B;  1GET A;  1AOG A;  1VRQ B;  2WES A;  2OAM A;  2XLP A;  2ZBW A;  1TDN A;  1B4V A;  2QA1 A;  1GPE A;  3UTH A;  3HZL A;  1GRT A;  2WOI A;  3SZC A;  4NEV A;  1YQZ A;  2XFN A;  1MXT A;  4REK A;  1ZOY A;  3CNJ A;  4X9N A;  4C74 A;  2V60 A;  3O0H A;  4U8N A;  2BC1 A;  1DJN A;  3GWF A;  3L8K A;  1B37 A;  3DA1 A;  5J60 A;  2B76 A;  1BGN A;  2JAE A;  2VZ2 A;  3B6D A;  2WHD A;  2Y6Q A;  2YM1 A;  4UDP A;  1EL9 A;  4FDC B;  2BK5 A;  1TRB A;  5JCM A;  3AEB A;  5KMS A;  3BHK A;  4YKF A;  5U1O A;  2YLW A;  3UTF A;  2AQJ A;  4C77 A;  4Y4M A;  2GR2 A;  3AD8 B;  4AOS A;  1N1P A;  2VRM A;  4G6G A;  5L46 A;  3CMM A;  2R0P A;  3FG2 P;  3V3N A;  2ARD A;  5U25 A;  1CJ2 A;  3H8L A;  2X8H A;  4Z43 A;  4Y4N A;  1NEK A;  4TM1 A;  4CNK A;  4DNA A;  5EB4 A;  4XXG A;  4D03 A;  2AR8 A;  3PVC A;  3UKH A;  1CJ3 A;  3GD3 A;  3LZW A;  4H4T A;  2WU2 A;  3FIM B;  4OPU A;  5JCI A;  1XHC A;  1MO9 A;  1GRF A;  1YQ3 A;  2BYB A;  3EF6 A;  4RG4 A;  3QVR A;  4BJY A;  4II2 A;  5KNL A;  4H4R A;  4WCT A;  2BRY A;  2BK4 A;  4OPC A;  2ZZB A;  3M12 A;  3UKP A;  1CJ4 A;  4DSG A;  2QAE A;  3DJE A;  3GDN A;  4J2W A;  4USQ A;  3UKA A;  3AB1 A;  2EQ9 A;  2WP9 A;  4X4J A;  4K2X A;  2Z5X A;  3ABV A;  1F6M A;  3I3L A;  2PHH A;  4AOX A;  2BRA A;  1TYT A;  2PYX A;  4I58 A;  4II3 A;  3L1R A;  3ICR A;  1NHR A;  3VRA A;  3NNE A;  3UKL A;  3EAO A;  4JQ9 A;  3T0K A;  1GRB A;  3DK4 A;  2A8X A;  4IA6 A;  1GES A;  5DBJ A;  1H86 A;  4B64 A;  4EMI A;  1JRZ A;  5CKU A;  3M13 A;  1GER A;  1EL5 A;  1E6E A;  2F5Z A;  1ONF A;  4YSX A;  5KRQ A;  1E1L A;  4D04 A;  3CIR A;  2FBW A;  4H2P A;  4KX6 A;  2I0Z A;  4TM3 A;  4EQW A;  1BKW A;  4LII A;  2JB1 A;  1O95 A;  1PJ6 A;  1OJT A;  4ECH A;  1IUS A;  2OA1 A;  2X50 A;  3PS9 A;  2YG5 A;  1E7P A;  1NG3 A;  4AT0 A;  3IWA A;  4GR1 A;  2V3B A;  2WPF A;  1KNR A;  1NPX A;  3UTE A;  1SEZ A;  4J36 A;  3GRS A;  3WE0 A;  5CQF A;  1TDE A;  1GTE A;  1FEB A;  4EQS A;  2YLS A;  2BA9 A;  3AE5 A;  2XVJ A;  2R9Z A;  2WBA A;  1PHH A;  3BI4 A;  3NTD A;  3T37 A;  2QA2 A;  5HHF A;  4GF7 A;  3AE4 A;  3QSS A;  2JKC A;  1KF6 A;  2ACZ A;  2WET A;  2WDV A;  2YM2 A;  3FBS A;  1VQW A;  2UZZ A;  3GYX A;  3DH9 A;  4J31 A;  1COY A;  3S61 A;  3UKQ A;  1K4Q A;  1ZK7 A;  4I59 A;  3AYI A;  3BNU A;  4H4Z A;  2OLO A;  4G6H A;  2BK3 A;  4EQX A;  5FS8 A;  3LZX A;  4EMJ A;  4A79 A;  2Y6R A;  1NDA A;  2GV8 A;  4ADW A;  4YSZ A;  1GSN A;  3AWI A;  3LB8 A;  4N9X A;  2CUL A;  3NK0 X;  5HYM A;  4H2R A;  1DXL A;  4GAP A;  4H4X A;  2C66 A;  2WDQ A;  4CCQ A;  2YAU A;  4EIP A;  5KOW A;  2BS2 A;  3IHG A;  5EB5 A;  4B66 A;  4C3X A;  3OZ2 A;  1IUT A;  3T2Y A;  4OPD A;  1JRX A;  2Q0L A;  4PAA A;  1Q1R A;  1E39 A;  2Z5Y A;  4JNQ A;  2E5V A;  2H89 A;  1YQ4 A;  4WX1 A;  4YSH A;  1H82 A;  1L9D A;  2WPE A;  3KPF A;  1JEH A;  3P4R A;  1YY5 A;  5FS6 A;  4Z26 A;  1PJ7 A;  4IVM B;  4H7U A;  2APG A;  1OJD A;  4YTN A;  5KMR A;  3SZW A;  2C70 A;  3LOV A;  3NK1 X;  1E1M A;  1CHU A;  3CND A;  1CF3 A;  1E1K A;  2YVJ A;  1DOC A;  5HXI A;  1FOH A;  1QO8 A;  3SFE A;  1LV0 A;  2WOV A;  2DKH A;  3F8P A;  5EOW A;  1VG9 A;  2Q7V A;  3AE6 A;  3DME A;  2XFP A;  2R4J A;  3NYC A;  3UOX A;  4OPI A;  1GXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...