2A87A

Crystal structure of m. tuberculosis thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
313
structure length
313
Chain Sequence
AHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 88
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A02
1E1KA 2GB0A 1N4UA 4Z43A 2GMJA 3I3LA 3GWFA 3NK2X 1IUTA 2WS3A 3DJGX 1FCDA 3GRSA 3GRTA 2DKIA 4C3XA 2GR1A 1F8SA 4RG3A 1BGNA 1GERA 3B3RA 1LQTA 2HQMA 3ABVA 2JK6A 5EB4A 1GV4A 2GQFA 4AP3A 2BS3A 3LZWA 2V6OA 1IUUA 1F8RA 2YR6A 4ICYA 3AE3A 5HY5A 3GMCA 1F3PA 3PVCA 4Z44A 1DXLA 3VR8A 2XLSA 2AAQA 2PYXA 3KU9A 4BJYA 2BXSA 3M13A 4YSZA 2FJDA 1FEAA 2FJAA 4OPCA 5KVHA 2GR3A 3LADA 1JRXA 1Q1RA 3DJDA 2Q7VA 3KVEA 1S2YA 5KXJA 1K0JA 5CQFA 4UDRA 4JNQA 2O9ZA 3AD7B 2QCUA 4FK1C 3D1CA 3NH3X 3CNTA 4TLXA 3UKHA 5GSNA 1H86A 3DJJA 2V61A 2NPXA 2XVFA 2XYOA 2WU5A 1GTHA 4H4XA 3QFBA 1GXFA 2YLSA 4Z2UA 1PN0A 2FJBA 3AWIA 1B8SA 2C3DA 1DJQA 1O95A 1DOEA 3AD8B 3GDPA 2BS4A 3DMEA 2BCPA 1S3EA 3AYJA 1D7LA 1PXCA 2A87A 2JAEA 3AE7A 4H2RA 1CC2A 3I6DA 2JB3A 1D5TA 4U8OA 1NHPA 3UKKA 1BF3A 2C65A 1GT8A 4IA6A 2ZZ0A 3UOZA 3AYIA 1E1LA 3BI2A 2X50A 2XLRA 2R0GA 1GOSA 3CGBA 2XVJA 4B1BA 1H83A 1NHRA 2VQBA 5BUKA 1TRBA 1CJCA 2WOVA 3ADAB 3NKSA 4OPLA 1NG4A 1PBFA 2ARDA 3NRNA 4O5QA 4USRA 2E4GA 3T37A 1XDIA 1ZMCA 2GV8A 1REOA 2YLTA 3UKAA 2XFNA 3RHAA 1GRHA 3GWDA 1LPFA 4EM4A 2QAEA 2WDVA 2I0ZA 3CIRA 2JBVA 4HA6A 4Z24A 2YG3A 4IVOB 1JRYA 4IVMB 3GD4A 4OPTA 4IA5A 1D4CA 1IJHA 1YQ4A 2H89A 1S3BA 1CF3A 2Q0LA 2BK4A 3NHOX 4H2PA 2BK3A 3AEDA 2R0PA 2XLUA 4KX6A 4I59A 4U8MA 1KNRA 3NYCA 4YT0A 4RSLA 3CPHG 4Y4MA 2XFOA 4EMJA 2V5ZA 3LB8A 4OPDA 1PHHA 3KA7A 3NN6X 5KOWA 1BKWA 4MJWA 1Y0PA 3O0HA 1H82A 3EANA 4CNJA 5KVIA 4GUVA 3VR9A 2YM2A 3UTEA 2YVGA 3K7MX 1TDKA 3K7QX 1GRTA 1DJNA 3RP8A 1NHQA 1FECA 1LV0A 1BWCA 3VRDB 1D4EA 1N4VA 3AE2A 3IF9A 4JQ9A 4CNKA 3H8LA 2B9XA 4AOXA 3B6DA 4LIIA 2Q6UA 2WEUA 4B65A 4EQXA 4U2SA 3L8KA 2VRMA 4U8JA 4D04A 4C3YA 4APNA 4H4UA 4B63A 2GVCA 2BXRA 1GRAA 4LU6A 4DNAA 2C3CA 2X8HA 2JKCA 1GREA 2CULA 4FX9A 4EM3A 1CJ3A 1KSUA 3NTDA 2ZZCA 3S61A 3SFDA 1RP0A 3VRAA 4X9MA 4Z26A 4H2QA 4YTMA 2B7SA 4GCMA 3GDNA 2EQ8A 2J3NA 2GMHA 4YTPA 1H6VA 2ZZBA 3CNSA 4GRTA 3JSKA 1DOBA 2WPFA 2RGJA 2YLRA 3EF6A 1Q9IA 3ICTA 4J2WA 4U8NA 4YSYA 3LOVA 5M10A 1OJAA 4H4PA 4PABA 3P9UA 1GALA 1NAAA 2AQJA 3QSEA 4D03A 3UKLA 3UP5A 4YXDA 2YLXA 2R4EA 3FIMB 3NG7X 1L9DA 4ZCCA 1Y56A 3KD9A 5U63A 2WP9A 2WP6A 3AYLA 3UOVA 1OJ9A 1FOHA 3QSMA 4NTCA 3CNPA 3GMBA 4NTEA 2A89A 4H50A 2YAUA 3K7TA 1D4DA 3D8XA 4UP3A 1ZDLA 4JY2A 1BZLA 2GH5A 2Z5YA 4CBQA 1MO9A 1ZK7A 3C4NA 3P4PA 1B37A 5FS7A 4OPUA 5BVAA 2YR4A 1ONFA 2TPRA 3ALMA 3IC9A 4JY3A 4WCTA 5J60A 2JB2A 5EB5A 1KNPA 2BCGG 3CNJA 1KSSA 1M64A 1PJ7A 3FBSA 2WHDA 2XCGA 3QVRA 4M52A 1Q1WA 4TLZA 2NVKX 4Y4LA 4X9NA 3V3OA 1V59A 3BI4A 2QA1A 2APGA 3AEAA 1GNDA 3CN8A 1NHSA 1VG0A 2BACA 3C96A 3WE0A 4ZCDA 3NN0X 4EIPA 2Q0KA 3AE1A 3NK1X 4H4VA 5JCMA 2GAGB 2EQ9A 1IUWA 3UTHA 3VQRA 4PAAA 4YKGA 4K5RA 1ZKQA 3IHMA 4H4TA 4TM0A 1X31B 3FMWA 2RGHA 4O5UA 4LA1A 4TM3A 2R46A 2V3BA 3NYEA 2XVIA 2IIDA 3EPTA 5FS6A 5J7XA 1F8WA 1PS9A 5KWFA 2WP5A 2GRTA 5IPYA 4OVIA 4BJZA 2BA9A 2AR8A 4H4QA 3BHFA 1RSGA 1K0LA 1P2EA 3NT6A 1Z6LA 3KLJA 1HYUA 4YWOA 4NZHA 2WDQA 4TM4A 5HXIA 4A5LA 4H4RA 4RG4A 4B67A 1CC6A 5DBJA 1LTXR 3G5SA 1L0VA 1QLBA 4FK1A 3KKJA 2JB1A 3IHGA 2C66A 4H4YA 5C2TA 2GR0A 3ISHA 4HB9A 1LVLA 2B9YA 1H7WA 1PDHA 3BI5A 4I58A 3IWAA 1QO8A 1NPXA 2VRLA 2YG6A 5C3JA 4XWRA 1DOCA 1E1NA 3NIXA 1YQ3A 2V3AA 3GYIA 2BC0A 3NLCA 3PO7A 4C5OA 5EOWA 4H2NA 2VQ7A 2V60A 1H84A 2WPEA 2C64A 2C76A 1GPEA 1OJDA 4A6NA 1K0IA 3AEFA 3E1TA 1GEUA 1ZMDA 4DSGA 1ZP0A 3AD9B 4GF7A 1KFYA 1Y56B 1E39A 3UOYA 3QFAA 3V3NA 4CY6A 2XFQA 3BHKA 3UTGA 2XLTA 3ATQA 1NEKA 4H4SA 2X3NA 3UKQA 1GTEA 3DA1A 3CPJG 1XANA 2VVMA 2W0HA 3AE4A 4U2TA 1O94A 1OJTA 4B64A 1L9EA 3P4SA 1IUVA 3CGEA 5FS8A 2B7RA 3K30A 2XLPA 3M12A 3AECA 4BURA 2BK5A 4CRTA 1ZX9A 4BK1A 4YSHA 1PBCA 1FL2A 3GD3A 3II4A 1XPQA 4K8DA 3NK0X 3QJ4A 1MOKA 1PBBA 1ZOYA 4K7ZA 2R0CA 3DK9A 5BULA 4CCRA 5BRTA 2CFYA 4UDQA 1K4QA 4YKFA 1E7PA 1VG9A 2XFUA 3OC4A 4DGKA 1N4WA 2Y6RA 3BNUA 3CTYA 4B68A 4AT0A 3AEGA 3FPZA 5IQ4A 3RP7A 1S2QA 3RNMA 1GRFA 2WOWA 2ZBWA 4DSHA 4BK2A 4EQRA 2GQWA 5JCNA 2E5VA 1OJCA 3Q9TA 2R45A 3AE8A 1VDCA 2GR2A 1M6IA 3CGDA 1GETA 4REKA 3AB1A 2PHHA 4OCGA 2BS2A 2Y6QA 2IVDA 1PJ5A 2B9WA 1IUSA 4K2XA 2OALA 2A8XA 1GESA 3P4RA 3ICSA 2CVJA 4YTNA 1PBEA 4ZN0A 2WBAA 2YLZA 1TDNA 3H8IA 2VZ2A 4USQA 1SEZA 4K5SA 2FJEA 1TDFA 1DODA 1H7XA 3SM8A 3LZXA 4XXGA 1EL7A 4J31A 1D7YA 4AT2A 4E0VA 4Z25A 1JNRA 2YLWA 4BV6A 2YVJA 1TYTA 4EMWA 1LQUA 2X99A 3NTAA 3SQPA 4JNAA 3ALJA 2C67A 2RGOA 1E6EA 3DJEA 3LJPA 4K22A 1N1PA 4U8PA 3DGHA 5FS9A 4U8LA 4XWZA 3AEBA 3DK8A 3NYFA 3G5QA 4A6NB 4X4JA 4Y4NA 2DKHA 1JNZA 3F8RA 1PJ6A 3SFEA 1PXAA 2YVFA 5FMHA 3URHA 4A79A 2WOIA 2BYBA 5CKUA 5M0ZA 4ECHA 2X8GA 1CC4A 1ELIA 2WPCA 4U8IA 4C77A 4EQWA 3UKPA 3ITJA 3LXDA 3ZYXA 2WETA 2YQUA 1PXBA 5JCIA 4WX1A 1B5QA 1YY5A 2F5ZA 1KF6A 2R9ZA 4A9WA 2EQ6A 2XVEA 4H4WA 2BC1A 2WDRA 4KPRA 4CY8A 4YSXA 2X8CA 1COYA 3ICRA 1LJ1A 1JEHA 4OPGA 2XFPA 3AXBA 3KPFA 4A7AA 1EL5A 3ZDNA 2OLNA 1YQZA 4NTDA 3CPIG 2OA1A 1VRQB 3DK4A 3GYJA 3AE9A 4J57A 4B66A 4C74A 1NG3A 3VRBA 4EMIA 1TYPA 3GSIA 3NGCX 5ER0A 4AOSA 3DGZA 2ACZA 2QA2A 3QSSA 4J36A 1MXTA 3UOXA 3UTFA 1EL9A 1AOGA 3CNDA 4AP1A 2VOUA 4P9SA 1YKJA 3BNMA 1XHCA 3UKFA 1FEBA 2C72A 2FBWA 2XDOA 2Z5XA 1ZY8A 2C7GA 1CL0A 3L1RA 2TMDA 5KRQA 5KOXA 1GRBA 3AE5A 4TM1A 3AEEA 2E1MA 2OAMA 2BABA 4GDEA 4NEVA 5IQ1A 4EIQA 4J56A 3COXA 1NENA 3UP4A 1F6MA 4Z2TA 1IUXA 4H4ZA 1DNCA 2VVLG 1JOAA 2YR5A 5U25A 4U8KA 2IVEA 3SGLA 1JU2A 2GF3A 2CDUA 2R4JA 2YM1A 3M0OA 3NNEA 3P1WA 4U2LA 1TDOA 2EQ7A 1QJDA 3EAOA 2WU2A 4EQSA 5U1OA 3F8DA 2B76A 2XVHA 4OPIA 1GRGA 1TDEA 3HZLA 1EBDA 2GAHB 3V76A 4B69A 2UZZA 2C70A 1NDAA 2H88A 2YG7A 4J33A 3QVPA 4ADWA 1L9CA 2VVLA 1P2HA 5GRTA 1UKVG 2C73A 3REDA 5HYMA 1BGJA 1CBOA 2OLOA 5EBKA 3DH9A 3F8PA 3RP6A 1KDGA 2WESA 3ALLA 4H7UA 3H4KA 3C4AA 1CJ4A 2YG5A 3Q6JA 4FDCB 5HHFA 3ATRA 1ZOVA 4NEWA 1CJ2A 5L46A 1B4VA 4GR1A 4Z2RA 2YWLA 1VQWA 3CGCA 4JDRA 4JN9A 4CCQA 4N9XA 1W4XA 1CHUA 3AE6A 4A65A 2WQYA 3S5WA 3P4QA 1GSNA 1O5WA 4UDPA 5LV9A 1PBDA 2RABA 1EL8A 3FG2P 4BK3A 2GEWA 5TR3A 3R9UA 1JRZA 5JCLA 5JCKA 4A99A 1H81A 3OZ2A 3UCLA 1RYIA 4IV9A 1E1MA 3G5RA 4J34A 2YG4A 3PS9A 4GDPA 2C75A
chains in the Genus database with same CATH superfamily
1E1KA 2GB0A 1N4UA 4Z43A 2GMJA 3I3LA 2BRYA 3GWFA 3NK2X 1IUTA 2WS3A 5KNLA 3DJGX 1FCDA 3GRSA 3GRTA 2DKIA 4C3XA 2GR1A 1F8SA 4RG3A 1BGNA 1GERA 3B3RA 1LQTA 2HQMA 3ABVA 2JK6A 5EB4A 1GV4A 2GQFA 4AP3A 2BS3A 3LZWA 2V6OA 1IUUA 1F8RA 2YR6A 4ICYA 3AE3A 5HY5A 3GMCA 1F3PA 3PVCA 4Z44A 1DXLA 3VR8A 2XLSA 2AAQA 2PYXA 3KU9A 4BJYA 2BXSA 3M13A 4YSZA 2FJDA 1FEAA 2FJAA 3T0KA 4OPCA 5KVHA 2GR3A 3LADA 1JRXA 1Q1RA 3DJDA 2Q7VA 3KVEA 1S2YA 5KXJA 1K0JA 5CQFA 4UDRA 4JNQA 2O9ZA 3AD7B 2QCUA 4FK1C 3D1CA 3NH3X 3CNTA 4TLXA 3UKHA 5GSNA 4NWZA 1H86A 3DJJA 2V61A 2NPXA 2XVFA 2XYOA 2WU5A 1GTHA 4H4XA 3QFBA 1GXFA 2YLSA 3T2KA 4Z2UA 1PN0A 2FJBA 3AWIA 1B8SA 2C3DA 1DJQA 1O95A 1DOEA 3AD8B 3GDPA 2BS4A 3DMEA 2BCPA 1S3EA 3AYJA 1D7LA 1PXCA 2A87A 2JAEA 3AE7A 4H2RA 1CC2A 3I6DA 2JB3A 1D5TA 4U8OA 1NHPA 3UKKA 1BF3A 2C65A 1GT8A 4IA6A 2ZZ0A 3UOZA 3AYIA 1E1LA 3BI2A 2X50A 2XLRA 2R0GA 1GOSA 3CGBA 2XVJA 3SZ0A 4B1BA 1H83A 1NHRA 2VQBA 5BUKA 1TRBA 1CJCA 2WOVA 3ADAB 3NKSA 4OPLA 1NG4A 1PBFA 2ARDA 3NRNA 4O5QA 4USRA 3T31A 2E4GA 3T37A 1XDIA 1ZMCA 2GV8A 1REOA 2YLTA 3UKAA 2XFNA 3RHAA 1GRHA 3GWDA 1LPFA 4EM4A 2QAEA 2WDVA 2I0ZA 3CIRA 2JBVA 4HA6A 4Z24A 2YG3A 4IVOB 1JRYA 4IVMB 3GD4A 4OPTA 3SZCA 4IA5A 1D4CA 1IJHA 1YQ4A 2C4CA 2H89A 1S3BA 1CF3A 2Q0LA 2BK4A 3NHOX 4H2PA 2BK3A 3AEDA 2R0PA 2XLUA 4KX6A 3HYVA 4I59A 4U8MA 1KNRA 3NYCA 4YT0A 4RSLA 3CPHG 4Y4MA 2XFOA 4EMJA 2V5ZA 3LB8A 4OPDA 1PHHA 3KA7A 3NN6X 5KOWA 1BKWA 4MJWA 1Y0PA 3O0HA 1H82A 3EANA 4CNJA 5KVIA 4GUVA 3VR9A 2YM2A 3UTEA 2YVGA 3K7MX 1TDKA 3K7QX 1GRTA 1DJNA 3RP8A 1NHQA 1FECA 1LV0A 1BWCA 3VRDB 1D4EA 3HYWA 1N4VA 3AE2A 3IF9A 4JQ9A 4CNKA 3H8LA 2B9XA 4AOXA 4G73A 3B6DA 4LIIA 2Q6UA 2WEUA 4B65A 4EQXA 4U2SA 3L8KA 2VRMA 4U8JA 4D04A 4C3YA 4APNA 4H4UA 4B63A 2GVCA 2BXRA 1GRAA 4LU6A 4DNAA 2C3CA 2X8HA 2JKCA 1GREA 2CULA 4FX9A 4EM3A 1CJ3A 1KSUA 3NTDA 2ZZCA 3S61A 3SFDA 1RP0A 3VRAA 4X9MA 4Z26A 4H2QA 4YTMA 2B7SA 4GCMA 3GDNA 2EQ8A 2J3NA 2GMHA 4YTPA 1H6VA 2ZZBA 3CNSA 4GRTA 3JSKA 1DOBA 2WPFA 2RGJA 2YLRA 3EF6A 1Q9IA 3ICTA 4J2WA 4U8NA 4YSYA 3LOVA 5M10A 1OJAA 4H4PA 4PABA 3P9UA 1GALA 1NAAA 2AQJA 3QSEA 4D03A 3UKLA 3UP5A 4YXDA 2YLXA 2R4EA 3FIMB 3NG7X 1L9DA 4ZCCA 1Y56A 3KD9A 5U63A 2WP9A 2WP6A 3AYLA 3UOVA 1OJ9A 1FOHA 3QSMA 4NTCA 3SZWA 3CNPA 3GMBA 4NTEA 2A89A 4H50A 2YAUA 3K7TA 1D4DA 3D8XA 4UP3A 1ZDLA 4JY2A 1BZLA 2GH5A 2Z5YA 3SY4A 1MO9A 1ZK7A 3C4NA 3P4PA 1B37A 4CBQA 5FS7A 4OPUA 5BVAA 2YR4A 1ONFA 2TPRA 3ALMA 3IC9A 4JY3A 4WCTA 5J60A 2JB2A 5EB5A 1KNPA 2BCGG 3CNJA 1KSSA 1M64A 1PJ7A 3FBSA 2WHDA 2XCGA 3QVRA 4M52A 1Q1WA 4TLZA 2NVKX 4Y4LA 4X9NA 3V3OA 1V59A 3BI4A 2QA1A 2APGA 3AEAA 1GNDA 3CN8A 1NHSA 1VG0A 2BACA 3C96A 3WE0A 4ZCDA 3NN0X 4EIPA 2Q0KA 3AE1A 3NK1X 4G6GA 4H4VA 5JCMA 2GAGB 2EQ9A 1IUWA 3UTHA 3VQRA 4PAAA 4YKGA 4K5RA 1ZKQA 3IHMA 4H4TA 4TM0A 1X31B 3FMWA 2RGHA 4O5UA 4LA1A 4TM3A 2R46A 2V3BA 3NYEA 2XVIA 4G74A 2IIDA 3EPTA 5FS6A 5J7XA 4G6HA 1F8WA 1PS9A 2BRAA 2WP5A 2GRTA 5IPYA 4OVIA 4BJZA 2BA9A 5KWFA 2AR8A 4H4QA 3BHFA 1RSGA 1K0LA 1P2EA 3NT6A 1Z6LA 3KLJA 1HYUA 4YWOA 4NZHA 2WDQA 4TM4A 5HXIA 4A5LA 4H4RA 4RG4A 4B67A 1CC6A 5DBJA 1LTXR 3G5SA 1L0VA 1QLBA 4FK1A 3KKJA 2JB1A 3IHGA 2C66A 4H4YA 5C2TA 2GR0A 3ISHA 4HB9A 1LVLA 3GYXA 2B9YA 1H7WA 1PDHA 3BI5A 4I58A 3IWAA 1QO8A 1NPXA 2VRLA 2YG6A 5C3JA 4XWRA 3CMMA 1DOCA 1E1NA 3NIXA 1YQ3A 2V3AA 3GYIA 2BC0A 3NLCA 4GAVA 3PO7A 4C5OA 5EOWA 4H2NA 2VQ7A 2V60A 1H84A 2WPEA 2C64A 2C76A 1GPEA 1OJDA 4NNJA 1K0IA 4A6NA 3AEFA 3E1TA 1GEUA 1ZMDA 4DSGA 1ZP0A 3AD9B 4GF7A 1KFYA 1Y56B 1E39A 3UOYA 5KMRA 3QFAA 3V3NA 4CY6A 2XFQA 3BHKA 3UTGA 2XLTA 3ATQA 1NEKA 4H4SA 2X3NA 3UKQA 1GTEA 3DA1A 3CPJG 1XANA 2VVMA 2W0HA 3AE4A 4U2TA 1O94A 1OJTA 3SZFA 4B64A 1L9EA 3P4SA 1IUVA 3CGEA 5FS8A 2B7RA 3K30A 2XLPA 3M12A 3AECA 4BURA 2BK5A 4CRTA 1ZX9A 4BK1A 4YSHA 1PBCA 1FL2A 3GD3A 3II4A 1XPQA 4K8DA 3NK0X 3QJ4A 1MOKA 1PBBA 1ZOYA 4K7ZA 2R0CA 3DK9A 5BULA 4CCRA 5BRTA 2CFYA 4UDQA 1K4QA 4YKFA 1E7PA 5KMPA 1VG9A 2XFUA 3OC4A 4DGKA 3SXIA 1N4WA 2Y6RA 3BNUA 3CTYA 4B68A 4AT0A 3AEGA 3FPZA 5IQ4A 3RP7A 1S2QA 3RNMA 1GRFA 2WOWA 2ZBWA 4DSHA 4BK2A 4EQRA 5KMQA 2GQWA 5JCNA 2E5VA 1OJCA 3Q9TA 2R45A 3AE8A 1VDCA 2GR2A 1M6IA 3CGDA 1GETA 4REKA 3AB1A 2PHHA 4OCGA 2BS2A 2Y6QA 2IVDA 1PJ5A 2B9WA 1IUSA 4K2XA 2OALA 2A8XA 1GESA 3P4RA 3ICSA 2CVJA 4YTNA 3T14A 1PBEA 4ZN0A 2WBAA 2YLZA 1TDNA 3H8IA 2VZ2A 4USQA 1SEZA 4K5SA 2FJEA 1TDFA 1DODA 1H7XA 3SM8A 3LZXA 4XXGA 1EL7A 4J31A 1D7YA 4AT2A 4E0VA 4Z25A 1JNRA 2YLWA 4BV6A 2YVJA 3SX6A 1TYTA 4EMWA 1LQUA 2X99A 3NTAA 3SQPA 3T2ZA 4JNAA 3ALJA 2C67A 2RGOA 1E6EA 3DJEA 3LJPA 4K22A 1N1PA 4U8PA 3DGHA 5FS9A 4U8LA 4XWZA 3AEBA 3DK8A 3NYFA 3G5QA 4A6NB 4X4JA 4Y4NA 2DKHA 1JNZA 3F8RA 1PJ6A 3SFEA 1PXAA 2YVFA 5FMHA 4II3A 3URHA 4A79A 2WOIA 2BYBA 5CKUA 5M0ZA 4ECHA 2X8GA 1CC4A 1ELIA 2WPCA 4U8IA 4C77A 4EQWA 3UKPA 3ITJA 3LXDA 3ZYXA 2WETA 2YQUA 1PXBA 5JCIA 4WX1A 1B5QA 1YY5A 2F5ZA 1KF6A 2R9ZA 4A9WA 2EQ6A 2XVEA 4H4WA 2BC1A 2WDRA 4KPRA 4CY8A 4YSXA 2X8CA 1COYA 3ICRA 1LJ1A 1JEHA 4OPGA 2XFPA 3AXBA 3KPFA 4A7AA 1EL5A 3ZDNA 2OLNA 1YQZA 4NTDA 3CPIG 2OA1A 1VRQB 3DK4A 3GYJA 3AE9A 4J57A 4B66A 4C74A 1NG3A 3VRBA 4EMIA 1TYPA 3GSIA 3NGCX 4GAPA 5ER0A 4AOSA 3DGZA 2ACZA 2QA2A 3QSSA 4J36A 1MXTA 3UOXA 3UTFA 1EL9A 1AOGA 3CNDA 4AP1A 2VOUA 4P9SA 1YKJA 3BNMA 1XHCA 3UKFA 1FEBA 2C72A 2FBWA 3SYIA 2XDOA 2Z5XA 1ZY8A 2C7GA 1CL0A 4G9KA 3L1RA 2TMDA 5KRQA 5KOXA 1GRBA 3AE5A 4TM1A 3AEEA 2E1MA 2OAMA 2BABA 4GDEA 4NEVA 5IQ1A 4EIQA 4J56A 3COXA 1NENA 3UP4A 1F6MA 4Z2TA 1IUXA 4H4ZA 3KPKA 1DNCA 2VVLG 1JOAA 2YR5A 5U25A 4U8KA 2IVEA 3SGLA 1JU2A 2GF3A 2CDUA 2R4JA 2YM1A 3M0OA 3NNEA 3P1WA 4U2LA 1TDOA 5KMSA 2EQ7A 1QJDA 3EAOA 2WU2A 3HYXA 4EQSA 5U1OA 3F8DA 2B76A 2XVHA 4OPIA 1GRGA 1TDEA 3HZLA 1EBDA 2GAHB 3V76A 4B69A 2UZZA 2C70A 1NDAA 2H88A 2YG7A 4J33A 3QVPA 4ADWA 1L9CA 2VVLA 4II2A 1P2HA 5GRTA 1UKVG 2C73A 3REDA 5HYMA 1BGJA 1CBOA 2OLOA 5EBKA 3DH9A 3F8PA 3RP6A 1KDGA 2WESA 3ALLA 4H7UA 3H4KA 3C4AA 1CJ4A 2YG5A 3Q6JA 4FDCB 5HHFA 3ATRA 1ZOVA 4NEWA 1CJ2A 5L46A 1B4VA 4GR1A 4Z2RA 2YWLA 1VQWA 3CGCA 4JDRA 4JN9A 4CCQA 4N9XA 1W4XA 1CHUA 3AE6A 4A65A 2WQYA 3S5WA 3P4QA 1GSNA 1O5WA 4UDPA 5LV9A 1PBDA 2RABA 1EL8A 3FG2P 4BK3A 2GEWA 5TR3A 3R9UA 1JRZA 5JCLA 5JCKA 4A99A 1H81A 3OZ2A 3UCLA 1RYIA 4IV9A 1E1MA 3T2YA 3G5RA 4J34A 2YG4A 3PS9A 4GDPA 2C75A
chains in the Genus database with same CATH topology
1E1KA 2GB0A 1N4UA 4Z43A 2GMJA 3I3LA 2BRYA 3GWFA 3NK2X 1IUTA 2WS3A 5KNLA 3DJGX 1FCDA 3GRSA 3GRTA 2DKIA 4C3XA 2GR1A 1F8SA 4RG3A 1BGNA 1GERA 3B3RA 1LQTA 2HQMA 3ABVA 2JK6A 5EB4A 1GV4A 2GQFA 4AP3A 2BS3A 3LZWA 2V6OA 1IUUA 1F8RA 2YR6A 4ICYA 3AE3A 5HY5A 3GMCA 1F3PA 3PVCA 4Z44A 1DXLA 3VR8A 2XLSA 2AAQA 2PYXA 3KU9A 4BJYA 2BXSA 3M13A 4YSZA 2FJDA 1FEAA 2FJAA 3T0KA 4OPCA 5KVHA 2GR3A 3LADA 1JRXA 1Q1RA 3DJDA 2Q7VA 3KVEA 1S2YA 5KXJA 1K0JA 5CQFA 4UDRA 4JNQA 2O9ZA 3AD7B 2QCUA 4FK1C 3D1CA 3NH3X 3CNTA 4TLXA 3UKHA 5GSNA 4NWZA 1H86A 3DJJA 2V61A 2NPXA 2XVFA 2XYOA 2WU5A 1GTHA 4H4XA 3QFBA 1GXFA 2YLSA 3T2KA 4Z2UA 1PN0A 2FJBA 3AWIA 1B8SA 2C3DA 1DJQA 1O95A 1DOEA 3AD8B 3GDPA 2BS4A 3DMEA 2BCPA 1S3EA 3AYJA 1D7LA 1PXCA 2A87A 2JAEA 3AE7A 4H2RA 1CC2A 3I6DA 2JB3A 1D5TA 4U8OA 1NHPA 3UKKA 1BF3A 2C65A 1GT8A 4IA6A 2ZZ0A 3UOZA 3AYIA 1E1LA 3BI2A 2X50A 2XLRA 2R0GA 1GOSA 3CGBA 2XVJA 3SZ0A 4B1BA 1H83A 1NHRA 2VQBA 5BUKA 1TRBA 1CJCA 2WOVA 3ADAB 3NKSA 4OPLA 1NG4A 1PBFA 2ARDA 3NRNA 4O5QA 4USRA 3T31A 2E4GA 3T37A 1XDIA 1ZMCA 2GV8A 1REOA 2YLTA 3UKAA 2XFNA 3RHAA 1GRHA 3GWDA 1LPFA 4EM4A 2QAEA 2WDVA 2I0ZA 3CIRA 2JBVA 4HA6A 4Z24A 2YG3A 4IVOB 1JRYA 4IVMB 3GD4A 4OPTA 3SZCA 4IA5A 1D4CA 1IJHA 1YQ4A 2C4CA 2H89A 1S3BA 1CF3A 2Q0LA 2BK4A 3NHOX 4H2PA 2BK3A 3AEDA 2R0PA 2XLUA 4KX6A 3HYVA 4I59A 4U8MA 1KNRA 3NYCA 4YT0A 4RSLA 3CPHG 4Y4MA 2XFOA 4EMJA 2V5ZA 3LB8A 4OPDA 1PHHA 3KA7A 3NN6X 5KOWA 1BKWA 4MJWA 1Y0PA 3O0HA 1H82A 3EANA 4CNJA 5KVIA 4GUVA 3VR9A 2YM2A 3UTEA 2YVGA 3K7MX 1TDKA 3K7QX 1GRTA 1DJNA 3RP8A 1NHQA 1FECA 1LV0A 1BWCA 3VRDB 1D4EA 3HYWA 1N4VA 3AE2A 3IF9A 4JQ9A 4CNKA 3H8LA 2B9XA 4AOXA 4G73A 3B6DA 4LIIA 2Q6UA 2WEUA 4B65A 4EQXA 4U2SA 3L8KA 2VRMA 4U8JA 4D04A 4C3YA 4APNA 4H4UA 4B63A 2GVCA 2BXRA 1GRAA 4LU6A 4DNAA 2C3CA 2X8HA 2JKCA 1GREA 2CULA 4FX9A 4EM3A 1CJ3A 1KSUA 3NTDA 2ZZCA 3S61A 3SFDA 1RP0A 3VRAA 4X9MA 4Z26A 4H2QA 4YTMA 2B7SA 4GCMA 3GDNA 2EQ8A 2J3NA 2GMHA 4YTPA 1H6VA 2ZZBA 3CNSA 4GRTA 3JSKA 1DOBA 2WPFA 2RGJA 2YLRA 3EF6A 1Q9IA 3ICTA 4J2WA 4U8NA 4YSYA 3LOVA 5M10A 1OJAA 4H4PA 4PABA 3P9UA 1GALA 1NAAA 2AQJA 3QSEA 4D03A 3UKLA 3UP5A 4YXDA 2YLXA 2R4EA 3FIMB 3NG7X 1L9DA 4ZCCA 1Y56A 3KD9A 5U63A 2WP9A 2WP6A 3AYLA 3UOVA 1OJ9A 1FOHA 3QSMA 4NTCA 3SZWA 3CNPA 3GMBA 4NTEA 2A89A 4H50A 2YAUA 3K7TA 1D4DA 3D8XA 4UP3A 1ZDLA 4JY2A 1BZLA 2GH5A 2Z5YA 3SY4A 1MO9A 1ZK7A 3C4NA 3P4PA 1B37A 4CBQA 5FS7A 4OPUA 5BVAA 2YR4A 1ONFA 2TPRA 3ALMA 3IC9A 4JY3A 4WCTA 5J60A 2JB2A 5EB5A 1KNPA 2BCGG 3CNJA 1KSSA 1M64A 1PJ7A 3FBSA 2WHDA 2XCGA 3QVRA 4M52A 1Q1WA 4TLZA 2NVKX 4Y4LA 4X9NA 3V3OA 1V59A 3BI4A 2QA1A 2APGA 3AEAA 1GNDA 3CN8A 1NHSA 1VG0A 2BACA 3C96A 3WE0A 4ZCDA 3NN0X 4EIPA 2Q0KA 3AE1A 3NK1X 4G6GA 4H4VA 5JCMA 2GAGB 2EQ9A 1IUWA 3UTHA 3VQRA 4PAAA 4YKGA 4K5RA 1ZKQA 3IHMA 4H4TA 4TM0A 1X31B 3FMWA 2RGHA 4O5UA 4LA1A 4TM3A 2R46A 2V3BA 3NYEA 2XVIA 4G74A 2IIDA 3EPTA 5FS6A 5J7XA 4G6HA 1F8WA 1PS9A 2BRAA 2WP5A 2GRTA 5IPYA 4OVIA 4BJZA 2BA9A 5KWFA 2AR8A 4H4QA 3BHFA 1RSGA 1K0LA 1P2EA 3NT6A 1Z6LA 3KLJA 1HYUA 4YWOA 4NZHA 2WDQA 4TM4A 5HXIA 4A5LA 4H4RA 4RG4A 4B67A 1CC6A 5DBJA 1LTXR 3G5SA 1L0VA 1QLBA 4FK1A 3KKJA 2JB1A 3IHGA 2C66A 4H4YA 5C2TA 2GR0A 3ISHA 4HB9A 1LVLA 3GYXA 2B9YA 1H7WA 1PDHA 3BI5A 4I58A 3IWAA 1QO8A 1NPXA 2VRLA 2YG6A 5C3JA 4XWRA 3CMMA 1DOCA 1E1NA 3NIXA 1YQ3A 2V3AA 3GYIA 2BC0A 3NLCA 4GAVA 3PO7A 4C5OA 5EOWA 4H2NA 2VQ7A 2V60A 1H84A 2WPEA 2C64A 2C76A 1GPEA 1OJDA 4NNJA 1K0IA 4A6NA 3AEFA 3E1TA 1GEUA 1ZMDA 4DSGA 1ZP0A 3AD9B 4GF7A 1KFYA 1Y56B 1E39A 3UOYA 5KMRA 3QFAA 3V3NA 4CY6A 2XFQA 3BHKA 3UTGA 2XLTA 3ATQA 1NEKA 4H4SA 2X3NA 3UKQA 1GTEA 3DA1A 3CPJG 1XANA 2VVMA 2W0HA 3AE4A 4U2TA 1O94A 1OJTA 3SZFA 4B64A 1L9EA 3P4SA 1IUVA 3CGEA 5FS8A 2B7RA 3K30A 2XLPA 3M12A 3AECA 4BURA 2BK5A 4CRTA 1ZX9A 4BK1A 4YSHA 1PBCA 1FL2A 3GD3A 3II4A 1XPQA 4K8DA 3NK0X 3QJ4A 1MOKA 1PBBA 1ZOYA 4K7ZA 2R0CA 3DK9A 5BULA 4CCRA 5BRTA 2CFYA 4UDQA 1K4QA 4YKFA 1E7PA 5KMPA 1VG9A 2XFUA 3OC4A 4DGKA 3SXIA 1N4WA 2Y6RA 3BNUA 3CTYA 4B68A 4AT0A 3AEGA 3FPZA 5IQ4A 3RP7A 1S2QA 3RNMA 1GRFA 2WOWA 2ZBWA 4DSHA 4BK2A 4EQRA 5KMQA 2GQWA 5JCNA 2E5VA 1OJCA 3Q9TA 2R45A 3AE8A 1VDCA 2GR2A 1M6IA 3CGDA 1GETA 4REKA 3AB1A 2PHHA 4OCGA 2BS2A 2Y6QA 2IVDA 1PJ5A 2B9WA 1IUSA 4K2XA 2OALA 2A8XA 1GESA 3P4RA 3ICSA 2CVJA 4YTNA 3T14A 1PBEA 4ZN0A 2WBAA 2YLZA 1TDNA 3H8IA 2VZ2A 4USQA 1SEZA 4K5SA 2FJEA 1TDFA 1DODA 1H7XA 3SM8A 3LZXA 4XXGA 1EL7A 4J31A 1D7YA 4AT2A 4E0VA 4Z25A 1JNRA 2YLWA 4BV6A 2YVJA 3SX6A 1TYTA 4EMWA 1LQUA 2X99A 3NTAA 3SQPA 3T2ZA 4JNAA 3ALJA 2C67A 2RGOA 1E6EA 3DJEA 3LJPA 4K22A 1N1PA 4U8PA 3DGHA 5FS9A 4U8LA 4XWZA 3AEBA 3DK8A 3NYFA 3G5QA 4A6NB 4X4JA 4Y4NA 2DKHA 1JNZA 3F8RA 1PJ6A 3SFEA 1PXAA 2YVFA 5FMHA 4II3A 3URHA 4A79A 2WOIA 2BYBA 5CKUA 5M0ZA 4ECHA 2X8GA 1CC4A 1ELIA 2WPCA 4U8IA 4C77A 4EQWA 3UKPA 3ITJA 3LXDA 3ZYXA 2WETA 2YQUA 1PXBA 5JCIA 4WX1A 1B5QA 1YY5A 2F5ZA 1KF6A 2R9ZA 4A9WA 2EQ6A 2XVEA 4H4WA 2BC1A 2WDRA 4KPRA 4CY8A 4YSXA 2X8CA 1COYA 3ICRA 1LJ1A 1JEHA 4OPGA 2XFPA 3AXBA 3KPFA 4A7AA 1EL5A 3ZDNA 2OLNA 1YQZA 4NTDA 3CPIG 2OA1A 1VRQB 3DK4A 3GYJA 3AE9A 4J57A 4B66A 4C74A 1NG3A 3VRBA 4EMIA 1TYPA 3GSIA 3NGCX 4GAPA 5ER0A 4AOSA 3DGZA 2ACZA 2QA2A 3QSSA 4J36A 1MXTA 3UOXA 3UTFA 1EL9A 1AOGA 3CNDA 4AP1A 2VOUA 4P9SA 1YKJA 3BNMA 1XHCA 3UKFA 1FEBA 2C72A 2FBWA 3SYIA 2XDOA 2Z5XA 1ZY8A 2C7GA 1CL0A 4G9KA 3L1RA 2TMDA 5KRQA 5KOXA 1GRBA 3AE5A 4TM1A 3AEEA 2E1MA 2OAMA 2BABA 4GDEA 4NEVA 5IQ1A 4EIQA 4J56A 3COXA 1NENA 3UP4A 1F6MA 4Z2TA 1IUXA 4H4ZA 3KPKA 1DNCA 2VVLG 1JOAA 2YR5A 5U25A 4U8KA 2IVEA 3SGLA 1JU2A 2GF3A 2CDUA 2R4JA 2YM1A 3M0OA 3NNEA 3P1WA 4U2LA 1TDOA 5KMSA 2EQ7A 1QJDA 3EAOA 2WU2A 3HYXA 4EQSA 5U1OA 3F8DA 2B76A 2XVHA 4OPIA 1GRGA 1TDEA 3HZLA 1EBDA 2GAHB 3V76A 4B69A 2UZZA 2C70A 1NDAA 2H88A 2YG7A 4J33A 3QVPA 4ADWA 1L9CA 2VVLA 4II2A 1P2HA 5GRTA 1UKVG 2C73A 3REDA 5HYMA 1BGJA 1CBOA 2OLOA 5EBKA 3DH9A 3F8PA 3RP6A 1KDGA 2WESA 3ALLA 4H7UA 3H4KA 3C4AA 1CJ4A 2YG5A 3Q6JA 4FDCB 5HHFA 3ATRA 1ZOVA 4NEWA 1CJ2A 5L46A 1B4VA 4GR1A 4Z2RA 2YWLA 1VQWA 3CGCA 4JDRA 4JN9A 4CCQA 4N9XA 1W4XA 1CHUA 3AE6A 4A65A 2WQYA 3S5WA 3P4QA 1GSNA 1O5WA 4UDPA 5LV9A 1PBDA 2RABA 1EL8A 3FG2P 4BK3A 2GEWA 5TR3A 3R9UA 1JRZA 5JCLA 5JCKA 4A99A 1H81A 3OZ2A 3UCLA 1RYIA 4IV9A 1E1MA 3T2YA 3G5RA 4J34A 2YG4A 3PS9A 4GDPA 2C75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1K A;  2GB0 A;  1N4U A;  4Z43 A;  2GMJ A;  3I3L A;  3GWF A;  3NK2 X;  1IUT A;  2WS3 A;  3DJG X;  1FCD A;  3GRS A;  3GRT A;  2DKI A;  4C3X A;  2GR1 A;  1F8S A;  4RG3 A;  1BGN A;  1GER A;  3B3R A;  1LQT A;  2HQM A;  3ABV A;  2JK6 A;  5EB4 A;  1GV4 A;  2GQF A;  4AP3 A;  2BS3 A;  3LZW A;  2V6O A;  1IUU A;  1F8R A;  2YR6 A;  4ICY A;  3AE3 A;  5HY5 A;  3GMC A;  1F3P A;  3PVC A;  4Z44 A;  1DXL A;  3VR8 A;  2XLS A;  2AAQ A;  2PYX A;  3KU9 A;  4BJY A;  2BXS A;  3M13 A;  4YSZ A;  2FJD A;  1FEA A;  2FJA A;  4OPC A;  5KVH A;  2GR3 A;  3LAD A;  1JRX A;  1Q1R A;  3DJD A;  2Q7V A;  3KVE A;  1S2Y A;  5KXJ A;  1K0J A;  5CQF A;  4UDR A;  4JNQ A;  2O9Z A;  3AD7 B;  2QCU A;  4FK1 C;  3D1C A;  3NH3 X;  3CNT A;  4TLX A;  3UKH A;  5GSN A;  1H86 A;  3DJJ A;  2V61 A;  2NPX A;  2XVF A;  2XYO A;  2WU5 A;  1GTH A;  4H4X A;  3QFB A;  1GXF A;  2YLS A;  4Z2U A;  1PN0 A;  2FJB A;  3AWI A;  1B8S A;  2C3D A;  1DJQ A;  1O95 A;  1DOE A;  3AD8 B;  3GDP A;  2BS4 A;  3DME A;  2BCP A;  1S3E A;  3AYJ A;  1D7L A;  1PXC A;  2A87 A;  2JAE A;  3AE7 A;  4H2R A;  1CC2 A;  3I6D A;  2JB3 A;  1D5T A;  4U8O A;  1NHP A;  3UKK A;  1BF3 A;  2C65 A;  1GT8 A;  4IA6 A;  2ZZ0 A;  3UOZ A;  3AYI A;  1E1L A;  3BI2 A;  2X50 A;  2XLR A;  2R0G A;  1GOS A;  3CGB A;  2XVJ A;  4B1B A;  1H83 A;  1NHR A;  2VQB A;  5BUK A;  1TRB A;  1CJC A;  2WOV A;  3ADA B;  3NKS A;  4OPL A;  1NG4 A;  1PBF A;  2ARD A;  3NRN A;  4O5Q A;  4USR A;  2E4G A;  3T37 A;  1XDI A;  1ZMC A;  2GV8 A;  1REO A;  2YLT A;  3UKA A;  2XFN A;  3RHA A;  1GRH A;  3GWD A;  1LPF A;  4EM4 A;  2QAE A;  2WDV A;  2I0Z A;  3CIR A;  2JBV A;  4HA6 A;  4Z24 A;  2YG3 A;  4IVO B;  1JRY A;  4IVM B;  3GD4 A;  4OPT A;  4IA5 A;  1D4C A;  1IJH A;  1YQ4 A;  2H89 A;  1S3B A;  1CF3 A;  2Q0L A;  2BK4 A;  3NHO X;  4H2P A;  2BK3 A;  3AED A;  2R0P A;  2XLU A;  4KX6 A;  4I59 A;  4U8M A;  1KNR A;  3NYC A;  4YT0 A;  4RSL A;  3CPH G;  4Y4M A;  2XFO A;  4EMJ A;  2V5Z A;  3LB8 A;  4OPD A;  1PHH A;  3KA7 A;  3NN6 X;  5KOW A;  1BKW A;  4MJW A;  1Y0P A;  3O0H A;  1H82 A;  3EAN A;  4CNJ A;  5KVI A;  4GUV A;  3VR9 A;  2YM2 A;  3UTE A;  2YVG A;  3K7M X;  1TDK A;  3K7Q X;  1GRT A;  1DJN A;  3RP8 A;  1NHQ A;  1FEC A;  1LV0 A;  1BWC A;  3VRD B;  1D4E A;  1N4V A;  3AE2 A;  3IF9 A;  4JQ9 A;  4CNK A;  3H8L A;  2B9X A;  4AOX A;  3B6D A;  4LII A;  2Q6U A;  2WEU A;  4B65 A;  4EQX A;  4U2S A;  3L8K A;  2VRM A;  4U8J A;  4D04 A;  4C3Y A;  4APN A;  4H4U A;  4B63 A;  2GVC A;  2BXR A;  1GRA A;  4LU6 A;  4DNA A;  2C3C A;  2X8H A;  2JKC A;  1GRE A;  2CUL A;  4FX9 A;  4EM3 A;  1CJ3 A;  1KSU A;  3NTD A;  2ZZC A;  3S61 A;  3SFD A;  1RP0 A;  3VRA A;  4X9M A;  4Z26 A;  4H2Q A;  4YTM A;  2B7S A;  4GCM A;  3GDN A;  2EQ8 A;  2J3N A;  2GMH A;  4YTP A;  1H6V A;  2ZZB A;  3CNS A;  4GRT A;  3JSK A;  1DOB A;  2WPF A;  2RGJ A;  2YLR A;  3EF6 A;  1Q9I A;  3ICT A;  4J2W A;  4U8N A;  4YSY A;  3LOV A;  5M10 A;  1OJA A;  4H4P A;  4PAB A;  3P9U A;  1GAL A;  1NAA A;  2AQJ A;  3QSE A;  4D03 A;  3UKL A;  3UP5 A;  4YXD A;  2YLX A;  2R4E A;  3FIM B;  3NG7 X;  1L9D A;  4ZCC A;  1Y56 A;  3KD9 A;  5U63 A;  2WP9 A;  2WP6 A;  3AYL A;  3UOV A;  1OJ9 A;  1FOH A;  3QSM A;  4NTC A;  3CNP A;  3GMB A;  4NTE A;  2A89 A;  4H50 A;  2YAU A;  3K7T A;  1D4D A;  3D8X A;  4UP3 A;  1ZDL A;  4JY2 A;  1BZL A;  2GH5 A;  2Z5Y A;  4CBQ A;  1MO9 A;  1ZK7 A;  3C4N A;  3P4P A;  1B37 A;  5FS7 A;  4OPU A;  5BVA A;  2YR4 A;  1ONF A;  2TPR A;  3ALM A;  3IC9 A;  4JY3 A;  4WCT A;  5J60 A;  2JB2 A;  5EB5 A;  1KNP A;  2BCG G;  3CNJ A;  1KSS A;  1M64 A;  1PJ7 A;  3FBS A;  2WHD A;  2XCG A;  3QVR A;  4M52 A;  1Q1W A;  4TLZ A;  2NVK X;  4Y4L A;  4X9N A;  3V3O A;  1V59 A;  3BI4 A;  2QA1 A;  2APG A;  3AEA A;  1GND A;  3CN8 A;  1NHS A;  1VG0 A;  2BAC A;  3C96 A;  3WE0 A;  4ZCD A;  3NN0 X;  4EIP A;  2Q0K A;  3AE1 A;  3NK1 X;  4H4V A;  5JCM A;  2GAG B;  2EQ9 A;  1IUW A;  3UTH A;  3VQR A;  4PAA A;  4YKG A;  4K5R A;  1ZKQ A;  3IHM A;  4H4T A;  4TM0 A;  1X31 B;  3FMW A;  2RGH A;  4O5U A;  4LA1 A;  4TM3 A;  2R46 A;  2V3B A;  3NYE A;  2XVI A;  2IID A;  3EPT A;  5FS6 A;  5J7X A;  1F8W A;  1PS9 A;  5KWF A;  2WP5 A;  2GRT A;  5IPY A;  4OVI A;  4BJZ A;  2BA9 A;  2AR8 A;  4H4Q A;  3BHF A;  1RSG A;  1K0L A;  1P2E A;  3NT6 A;  1Z6L A;  3KLJ A;  1HYU A;  4YWO A;  4NZH A;  2WDQ A;  4TM4 A;  5HXI A;  4A5L A;  4H4R A;  4RG4 A;  4B67 A;  1CC6 A;  5DBJ A;  1LTX R;  3G5S A;  1L0V A;  1QLB A;  4FK1 A;  3KKJ A;  2JB1 A;  3IHG A;  2C66 A;  4H4Y A;  5C2T A;  2GR0 A;  3ISH A;  4HB9 A;  1LVL A;  2B9Y A;  1H7W A;  1PDH A;  3BI5 A;  4I58 A;  3IWA A;  1QO8 A;  1NPX A;  2VRL A;  2YG6 A;  5C3J A;  4XWR A;  1DOC A;  1E1N A;  3NIX A;  1YQ3 A;  2V3A A;  3GYI A;  2BC0 A;  3NLC A;  3PO7 A;  4C5O A;  5EOW A;  4H2N A;  2VQ7 A;  2V60 A;  1H84 A;  2WPE A;  2C64 A;  2C76 A;  1GPE A;  1OJD A;  4A6N A;  1K0I A;  3AEF A;  3E1T A;  1GEU A;  1ZMD A;  4DSG A;  1ZP0 A;  3AD9 B;  4GF7 A;  1KFY A;  1Y56 B;  1E39 A;  3UOY A;  3QFA A;  3V3N A;  4CY6 A;  2XFQ A;  3BHK A;  3UTG A;  2XLT A;  3ATQ A;  1NEK A;  4H4S A;  2X3N A;  3UKQ A;  1GTE A;  3DA1 A;  3CPJ G;  1XAN A;  2VVM A;  2W0H A;  3AE4 A;  4U2T A;  1O94 A;  1OJT A;  4B64 A;  1L9E A;  3P4S A;  1IUV A;  3CGE A;  5FS8 A;  2B7R A;  3K30 A;  2XLP A;  3M12 A;  3AEC A;  4BUR A;  2BK5 A;  4CRT A;  1ZX9 A;  4BK1 A;  4YSH A;  1PBC A;  1FL2 A;  3GD3 A;  3II4 A;  1XPQ A;  4K8D A;  3NK0 X;  3QJ4 A;  1MOK A;  1PBB A;  1ZOY A;  4K7Z A;  2R0C A;  3DK9 A;  5BUL A;  4CCR A;  5BRT A;  2CFY A;  4UDQ A;  1K4Q A;  4YKF A;  1E7P A;  1VG9 A;  2XFU A;  3OC4 A;  4DGK A;  1N4W A;  2Y6R A;  3BNU A;  3CTY A;  4B68 A;  4AT0 A;  3AEG A;  3FPZ A;  5IQ4 A;  3RP7 A;  1S2Q A;  3RNM A;  1GRF A;  2WOW A;  2ZBW A;  4DSH A;  4BK2 A;  4EQR A;  2GQW A;  5JCN A;  2E5V A;  1OJC A;  3Q9T A;  2R45 A;  3AE8 A;  1VDC A;  2GR2 A;  1M6I A;  3CGD A;  1GET A;  4REK A;  3AB1 A;  2PHH A;  4OCG A;  2BS2 A;  2Y6Q A;  2IVD A;  1PJ5 A;  2B9W A;  1IUS A;  4K2X A;  2OAL A;  2A8X A;  1GES A;  3P4R A;  3ICS A;  2CVJ A;  4YTN A;  1PBE A;  4ZN0 A;  2WBA A;  2YLZ A;  1TDN A;  3H8I A;  2VZ2 A;  4USQ A;  1SEZ A;  4K5S A;  2FJE A;  1TDF A;  1DOD A;  1H7X A;  3SM8 A;  3LZX A;  4XXG A;  1EL7 A;  4J31 A;  1D7Y A;  4AT2 A;  4E0V A;  4Z25 A;  1JNR A;  2YLW A;  4BV6 A;  2YVJ A;  1TYT A;  4EMW A;  1LQU A;  2X99 A;  3NTA A;  3SQP A;  4JNA A;  3ALJ A;  2C67 A;  2RGO A;  1E6E A;  3DJE A;  3LJP A;  4K22 A;  1N1P A;  4U8P A;  3DGH A;  5FS9 A;  4U8L A;  4XWZ A;  3AEB A;  3DK8 A;  3NYF A;  3G5Q A;  4A6N B;  4X4J A;  4Y4N A;  2DKH A;  1JNZ A;  3F8R A;  1PJ6 A;  3SFE A;  1PXA A;  2YVF A;  5FMH A;  3URH A;  4A79 A;  2WOI A;  2BYB A;  5CKU A;  5M0Z A;  4ECH A;  2X8G A;  1CC4 A;  1ELI A;  2WPC A;  4U8I A;  4C77 A;  4EQW A;  3UKP A;  3ITJ A;  3LXD A;  3ZYX A;  2WET A;  2YQU A;  1PXB A;  5JCI A;  4WX1 A;  1B5Q A;  1YY5 A;  2F5Z A;  1KF6 A;  2R9Z A;  4A9W A;  2EQ6 A;  2XVE A;  4H4W A;  2BC1 A;  2WDR A;  4KPR A;  4CY8 A;  4YSX A;  2X8C A;  1COY A;  3ICR A;  1LJ1 A;  1JEH A;  4OPG A;  2XFP A;  3AXB A;  3KPF A;  4A7A A;  1EL5 A;  3ZDN A;  2OLN A;  1YQZ A;  4NTD A;  3CPI G;  2OA1 A;  1VRQ B;  3DK4 A;  3GYJ A;  3AE9 A;  4J57 A;  4B66 A;  4C74 A;  1NG3 A;  3VRB A;  4EMI A;  1TYP A;  3GSI A;  3NGC X;  5ER0 A;  4AOS A;  3DGZ A;  2ACZ A;  2QA2 A;  3QSS A;  4J36 A;  1MXT A;  3UOX A;  3UTF A;  1EL9 A;  1AOG A;  3CND A;  4AP1 A;  2VOU A;  4P9S A;  1YKJ A;  3BNM A;  1XHC A;  3UKF A;  1FEB A;  2C72 A;  2FBW A;  2XDO A;  2Z5X A;  1ZY8 A;  2C7G A;  1CL0 A;  3L1R A;  2TMD A;  5KRQ A;  5KOX A;  1GRB A;  3AE5 A;  4TM1 A;  3AEE A;  2E1M A;  2OAM A;  2BAB A;  4GDE A;  4NEV A;  5IQ1 A;  4EIQ A;  4J56 A;  3COX A;  1NEN A;  3UP4 A;  1F6M A;  4Z2T A;  1IUX A;  4H4Z A;  1DNC A;  2VVL G;  1JOA A;  2YR5 A;  5U25 A;  4U8K A;  2IVE A;  3SGL A;  1JU2 A;  2GF3 A;  2CDU A;  2R4J A;  2YM1 A;  3M0O A;  3NNE A;  3P1W A;  4U2L A;  1TDO A;  2EQ7 A;  1QJD A;  3EAO A;  2WU2 A;  4EQS A;  5U1O A;  3F8D A;  2B76 A;  2XVH A;  4OPI A;  1GRG A;  1TDE A;  3HZL A;  1EBD A;  2GAH B;  3V76 A;  4B69 A;  2UZZ A;  2C70 A;  1NDA A;  2H88 A;  2YG7 A;  4J33 A;  3QVP A;  4ADW A;  1L9C A;  2VVL A;  1P2H A;  5GRT A;  1UKV G;  2C73 A;  3RED A;  5HYM A;  1BGJ A;  1CBO A;  2OLO A;  5EBK A;  3DH9 A;  3F8P A;  3RP6 A;  1KDG A;  2WES A;  3ALL A;  4H7U A;  3H4K A;  3C4A A;  1CJ4 A;  2YG5 A;  3Q6J A;  4FDC B;  5HHF A;  3ATR A;  1ZOV A;  4NEW A;  1CJ2 A;  5L46 A;  1B4V A;  4GR1 A;  4Z2R A;  2YWL A;  1VQW A;  3CGC A;  4JDR A;  4JN9 A;  4CCQ A;  4N9X A;  1W4X A;  1CHU A;  3AE6 A;  4A65 A;  2WQY A;  3S5W A;  3P4Q A;  1GSN A;  1O5W A;  4UDP A;  5LV9 A;  1PBD A;  2RAB A;  1EL8 A;  3FG2 P;  4BK3 A;  2GEW A;  5TR3 A;  3R9U A;  1JRZ A;  5JCL A;  5JCK A;  4A99 A;  1H81 A;  3OZ2 A;  3UCL A;  1RYI A;  4IV9 A;  1E1M A;  3G5R A;  4J34 A;  2YG4 A;  3PS9 A;  4GDP A;  2C75 A; 
#chains in the Genus database with same CATH topology
 1E1K A;  2GB0 A;  1N4U A;  4Z43 A;  2GMJ A;  3I3L A;  2BRY A;  3GWF A;  3NK2 X;  1IUT A;  2WS3 A;  5KNL A;  3DJG X;  1FCD A;  3GRS A;  3GRT A;  2DKI A;  4C3X A;  2GR1 A;  1F8S A;  4RG3 A;  1BGN A;  1GER A;  3B3R A;  1LQT A;  2HQM A;  3ABV A;  2JK6 A;  5EB4 A;  1GV4 A;  2GQF A;  4AP3 A;  2BS3 A;  3LZW A;  2V6O A;  1IUU A;  1F8R A;  2YR6 A;  4ICY A;  3AE3 A;  5HY5 A;  3GMC A;  1F3P A;  3PVC A;  4Z44 A;  1DXL A;  3VR8 A;  2XLS A;  2AAQ A;  2PYX A;  3KU9 A;  4BJY A;  2BXS A;  3M13 A;  4YSZ A;  2FJD A;  1FEA A;  2FJA A;  3T0K A;  4OPC A;  5KVH A;  2GR3 A;  3LAD A;  1JRX A;  1Q1R A;  3DJD A;  2Q7V A;  3KVE A;  1S2Y A;  5KXJ A;  1K0J A;  5CQF A;  4UDR A;  4JNQ A;  2O9Z A;  3AD7 B;  2QCU A;  4FK1 C;  3D1C A;  3NH3 X;  3CNT A;  4TLX A;  3UKH A;  5GSN A;  4NWZ A;  1H86 A;  3DJJ A;  2V61 A;  2NPX A;  2XVF A;  2XYO A;  2WU5 A;  1GTH A;  4H4X A;  3QFB A;  1GXF A;  2YLS A;  3T2K A;  4Z2U A;  1PN0 A;  2FJB A;  3AWI A;  1B8S A;  2C3D A;  1DJQ A;  1O95 A;  1DOE A;  3AD8 B;  3GDP A;  2BS4 A;  3DME A;  2BCP A;  1S3E A;  3AYJ A;  1D7L A;  1PXC A;  2A87 A;  2JAE A;  3AE7 A;  4H2R A;  1CC2 A;  3I6D A;  2JB3 A;  1D5T A;  4U8O A;  1NHP A;  3UKK A;  1BF3 A;  2C65 A;  1GT8 A;  4IA6 A;  2ZZ0 A;  3UOZ A;  3AYI A;  1E1L A;  3BI2 A;  2X50 A;  2XLR A;  2R0G A;  1GOS A;  3CGB A;  2XVJ A;  3SZ0 A;  4B1B A;  1H83 A;  1NHR A;  2VQB A;  5BUK A;  1TRB A;  1CJC A;  2WOV A;  3ADA B;  3NKS A;  4OPL A;  1NG4 A;  1PBF A;  2ARD A;  3NRN A;  4O5Q A;  4USR A;  3T31 A;  2E4G A;  3T37 A;  1XDI A;  1ZMC A;  2GV8 A;  1REO A;  2YLT A;  3UKA A;  2XFN A;  3RHA A;  1GRH A;  3GWD A;  1LPF A;  4EM4 A;  2QAE A;  2WDV A;  2I0Z A;  3CIR A;  2JBV A;  4HA6 A;  4Z24 A;  2YG3 A;  4IVO B;  1JRY A;  4IVM B;  3GD4 A;  4OPT A;  3SZC A;  4IA5 A;  1D4C A;  1IJH A;  1YQ4 A;  2C4C A;  2H89 A;  1S3B A;  1CF3 A;  2Q0L A;  2BK4 A;  3NHO X;  4H2P A;  2BK3 A;  3AED A;  2R0P A;  2XLU A;  4KX6 A;  3HYV A;  4I59 A;  4U8M A;  1KNR A;  3NYC A;  4YT0 A;  4RSL A;  3CPH G;  4Y4M A;  2XFO A;  4EMJ A;  2V5Z A;  3LB8 A;  4OPD A;  1PHH A;  3KA7 A;  3NN6 X;  5KOW A;  1BKW A;  4MJW A;  1Y0P A;  3O0H A;  1H82 A;  3EAN A;  4CNJ A;  5KVI A;  4GUV A;  3VR9 A;  2YM2 A;  3UTE A;  2YVG A;  3K7M X;  1TDK A;  3K7Q X;  1GRT A;  1DJN A;  3RP8 A;  1NHQ A;  1FEC A;  1LV0 A;  1BWC A;  3VRD B;  1D4E A;  3HYW A;  1N4V A;  3AE2 A;  3IF9 A;  4JQ9 A;  4CNK A;  3H8L A;  2B9X A;  4AOX A;  4G73 A;  3B6D A;  4LII A;  2Q6U A;  2WEU A;  4B65 A;  4EQX A;  4U2S A;  3L8K A;  2VRM A;  4U8J A;  4D04 A;  4C3Y A;  4APN A;  4H4U A;  4B63 A;  2GVC A;  2BXR A;  1GRA A;  4LU6 A;  4DNA A;  2C3C A;  2X8H A;  2JKC A;  1GRE A;  2CUL A;  4FX9 A;  4EM3 A;  1CJ3 A;  1KSU A;  3NTD A;  2ZZC A;  3S61 A;  3SFD A;  1RP0 A;  3VRA A;  4X9M A;  4Z26 A;  4H2Q A;  4YTM A;  2B7S A;  4GCM A;  3GDN A;  2EQ8 A;  2J3N A;  2GMH A;  4YTP A;  1H6V A;  2ZZB A;  3CNS A;  4GRT A;  3JSK A;  1DOB A;  2WPF A;  2RGJ A;  2YLR A;  3EF6 A;  1Q9I A;  3ICT A;  4J2W A;  4U8N A;  4YSY A;  3LOV A;  5M10 A;  1OJA A;  4H4P A;  4PAB A;  3P9U A;  1GAL A;  1NAA A;  2AQJ A;  3QSE A;  4D03 A;  3UKL A;  3UP5 A;  4YXD A;  2YLX A;  2R4E A;  3FIM B;  3NG7 X;  1L9D A;  4ZCC A;  1Y56 A;  3KD9 A;  5U63 A;  2WP9 A;  2WP6 A;  3AYL A;  3UOV A;  1OJ9 A;  1FOH A;  3QSM A;  4NTC A;  3SZW A;  3CNP A;  3GMB A;  4NTE A;  2A89 A;  4H50 A;  2YAU A;  3K7T A;  1D4D A;  3D8X A;  4UP3 A;  1ZDL A;  4JY2 A;  1BZL A;  2GH5 A;  2Z5Y A;  3SY4 A;  1MO9 A;  1ZK7 A;  3C4N A;  3P4P A;  1B37 A;  4CBQ A;  5FS7 A;  4OPU A;  5BVA A;  2YR4 A;  1ONF A;  2TPR A;  3ALM A;  3IC9 A;  4JY3 A;  4WCT A;  5J60 A;  2JB2 A;  5EB5 A;  1KNP A;  2BCG G;  3CNJ A;  1KSS A;  1M64 A;  1PJ7 A;  3FBS A;  2WHD A;  2XCG A;  3QVR A;  4M52 A;  1Q1W A;  4TLZ A;  2NVK X;  4Y4L A;  4X9N A;  3V3O A;  1V59 A;  3BI4 A;  2QA1 A;  2APG A;  3AEA A;  1GND A;  3CN8 A;  1NHS A;  1VG0 A;  2BAC A;  3C96 A;  3WE0 A;  4ZCD A;  3NN0 X;  4EIP A;  2Q0K A;  3AE1 A;  3NK1 X;  4G6G A;  4H4V A;  5JCM A;  2GAG B;  2EQ9 A;  1IUW A;  3UTH A;  3VQR A;  4PAA A;  4YKG A;  4K5R A;  1ZKQ A;  3IHM A;  4H4T A;  4TM0 A;  1X31 B;  3FMW A;  2RGH A;  4O5U A;  4LA1 A;  4TM3 A;  2R46 A;  2V3B A;  3NYE A;  2XVI A;  4G74 A;  2IID A;  3EPT A;  5FS6 A;  5J7X A;  4G6H A;  1F8W A;  1PS9 A;  2BRA A;  2WP5 A;  2GRT A;  5IPY A;  4OVI A;  4BJZ A;  2BA9 A;  5KWF A;  2AR8 A;  4H4Q A;  3BHF A;  1RSG A;  1K0L A;  1P2E A;  3NT6 A;  1Z6L A;  3KLJ A;  1HYU A;  4YWO A;  4NZH A;  2WDQ A;  4TM4 A;  5HXI A;  4A5L A;  4H4R A;  4RG4 A;  4B67 A;  1CC6 A;  5DBJ A;  1LTX R;  3G5S A;  1L0V A;  1QLB A;  4FK1 A;  3KKJ A;  2JB1 A;  3IHG A;  2C66 A;  4H4Y A;  5C2T A;  2GR0 A;  3ISH A;  4HB9 A;  1LVL A;  3GYX A;  2B9Y A;  1H7W A;  1PDH A;  3BI5 A;  4I58 A;  3IWA A;  1QO8 A;  1NPX A;  2VRL A;  2YG6 A;  5C3J A;  4XWR A;  3CMM A;  1DOC A;  1E1N A;  3NIX A;  1YQ3 A;  2V3A A;  3GYI A;  2BC0 A;  3NLC A;  4GAV A;  3PO7 A;  4C5O A;  5EOW A;  4H2N A;  2VQ7 A;  2V60 A;  1H84 A;  2WPE A;  2C64 A;  2C76 A;  1GPE A;  1OJD A;  4NNJ A;  1K0I A;  4A6N A;  3AEF A;  3E1T A;  1GEU A;  1ZMD A;  4DSG A;  1ZP0 A;  3AD9 B;  4GF7 A;  1KFY A;  1Y56 B;  1E39 A;  3UOY A;  5KMR A;  3QFA A;  3V3N A;  4CY6 A;  2XFQ A;  3BHK A;  3UTG A;  2XLT A;  3ATQ A;  1NEK A;  4H4S A;  2X3N A;  3UKQ A;  1GTE A;  3DA1 A;  3CPJ G;  1XAN A;  2VVM A;  2W0H A;  3AE4 A;  4U2T A;  1O94 A;  1OJT A;  3SZF A;  4B64 A;  1L9E A;  3P4S A;  1IUV A;  3CGE A;  5FS8 A;  2B7R A;  3K30 A;  2XLP A;  3M12 A;  3AEC A;  4BUR A;  2BK5 A;  4CRT A;  1ZX9 A;  4BK1 A;  4YSH A;  1PBC A;  1FL2 A;  3GD3 A;  3II4 A;  1XPQ A;  4K8D A;  3NK0 X;  3QJ4 A;  1MOK A;  1PBB A;  1ZOY A;  4K7Z A;  2R0C A;  3DK9 A;  5BUL A;  4CCR A;  5BRT A;  2CFY A;  4UDQ A;  1K4Q A;  4YKF A;  1E7P A;  5KMP A;  1VG9 A;  2XFU A;  3OC4 A;  4DGK A;  3SXI A;  1N4W A;  2Y6R A;  3BNU A;  3CTY A;  4B68 A;  4AT0 A;  3AEG A;  3FPZ A;  5IQ4 A;  3RP7 A;  1S2Q A;  3RNM A;  1GRF A;  2WOW A;  2ZBW A;  4DSH A;  4BK2 A;  4EQR A;  5KMQ A;  2GQW A;  5JCN A;  2E5V A;  1OJC A;  3Q9T A;  2R45 A;  3AE8 A;  1VDC A;  2GR2 A;  1M6I A;  3CGD A;  1GET A;  4REK A;  3AB1 A;  2PHH A;  4OCG A;  2BS2 A;  2Y6Q A;  2IVD A;  1PJ5 A;  2B9W A;  1IUS A;  4K2X A;  2OAL A;  2A8X A;  1GES A;  3P4R A;  3ICS A;  2CVJ A;  4YTN A;  3T14 A;  1PBE A;  4ZN0 A;  2WBA A;  2YLZ A;  1TDN A;  3H8I A;  2VZ2 A;  4USQ A;  1SEZ A;  4K5S A;  2FJE A;  1TDF A;  1DOD A;  1H7X A;  3SM8 A;  3LZX A;  4XXG A;  1EL7 A;  4J31 A;  1D7Y A;  4AT2 A;  4E0V A;  4Z25 A;  1JNR A;  2YLW A;  4BV6 A;  2YVJ A;  3SX6 A;  1TYT A;  4EMW A;  1LQU A;  2X99 A;  3NTA A;  3SQP A;  3T2Z A;  4JNA A;  3ALJ A;  2C67 A;  2RGO A;  1E6E A;  3DJE A;  3LJP A;  4K22 A;  1N1P A;  4U8P A;  3DGH A;  5FS9 A;  4U8L A;  4XWZ A;  3AEB A;  3DK8 A;  3NYF A;  3G5Q A;  4A6N B;  4X4J A;  4Y4N A;  2DKH A;  1JNZ A;  3F8R A;  1PJ6 A;  3SFE A;  1PXA A;  2YVF A;  5FMH A;  4II3 A;  3URH A;  4A79 A;  2WOI A;  2BYB A;  5CKU A;  5M0Z A;  4ECH A;  2X8G A;  1CC4 A;  1ELI A;  2WPC A;  4U8I A;  4C77 A;  4EQW A;  3UKP A;  3ITJ A;  3LXD A;  3ZYX A;  2WET A;  2YQU A;  1PXB A;  5JCI A;  4WX1 A;  1B5Q A;  1YY5 A;  2F5Z A;  1KF6 A;  2R9Z A;  4A9W A;  2EQ6 A;  2XVE A;  4H4W A;  2BC1 A;  2WDR A;  4KPR A;  4CY8 A;  4YSX A;  2X8C A;  1COY A;  3ICR A;  1LJ1 A;  1JEH A;  4OPG A;  2XFP A;  3AXB A;  3KPF A;  4A7A A;  1EL5 A;  3ZDN A;  2OLN A;  1YQZ A;  4NTD A;  3CPI G;  2OA1 A;  1VRQ B;  3DK4 A;  3GYJ A;  3AE9 A;  4J57 A;  4B66 A;  4C74 A;  1NG3 A;  3VRB A;  4EMI A;  1TYP A;  3GSI A;  3NGC X;  4GAP A;  5ER0 A;  4AOS A;  3DGZ A;  2ACZ A;  2QA2 A;  3QSS A;  4J36 A;  1MXT A;  3UOX A;  3UTF A;  1EL9 A;  1AOG A;  3CND A;  4AP1 A;  2VOU A;  4P9S A;  1YKJ A;  3BNM A;  1XHC A;  3UKF A;  1FEB A;  2C72 A;  2FBW A;  3SYI A;  2XDO A;  2Z5X A;  1ZY8 A;  2C7G A;  1CL0 A;  4G9K A;  3L1R A;  2TMD A;  5KRQ A;  5KOX A;  1GRB A;  3AE5 A;  4TM1 A;  3AEE A;  2E1M A;  2OAM A;  2BAB A;  4GDE A;  4NEV A;  5IQ1 A;  4EIQ A;  4J56 A;  3COX A;  1NEN A;  3UP4 A;  1F6M A;  4Z2T A;  1IUX A;  4H4Z A;  3KPK A;  1DNC A;  2VVL G;  1JOA A;  2YR5 A;  5U25 A;  4U8K A;  2IVE A;  3SGL A;  1JU2 A;  2GF3 A;  2CDU A;  2R4J A;  2YM1 A;  3M0O A;  3NNE A;  3P1W A;  4U2L A;  1TDO A;  5KMS A;  2EQ7 A;  1QJD A;  3EAO A;  2WU2 A;  3HYX A;  4EQS A;  5U1O A;  3F8D A;  2B76 A;  2XVH A;  4OPI A;  1GRG A;  1TDE A;  3HZL A;  1EBD A;  2GAH B;  3V76 A;  4B69 A;  2UZZ A;  2C70 A;  1NDA A;  2H88 A;  2YG7 A;  4J33 A;  3QVP A;  4ADW A;  1L9C A;  2VVL A;  4II2 A;  1P2H A;  5GRT A;  1UKV G;  2C73 A;  3RED A;  5HYM A;  1BGJ A;  1CBO A;  2OLO A;  5EBK A;  3DH9 A;  3F8P A;  3RP6 A;  1KDG A;  2WES A;  3ALL A;  4H7U A;  3H4K A;  3C4A A;  1CJ4 A;  2YG5 A;  3Q6J A;  4FDC B;  5HHF A;  3ATR A;  1ZOV A;  4NEW A;  1CJ2 A;  5L46 A;  1B4V A;  4GR1 A;  4Z2R A;  2YWL A;  1VQW A;  3CGC A;  4JDR A;  4JN9 A;  4CCQ A;  4N9X A;  1W4X A;  1CHU A;  3AE6 A;  4A65 A;  2WQY A;  3S5W A;  3P4Q A;  1GSN A;  1O5W A;  4UDP A;  5LV9 A;  1PBD A;  2RAB A;  1EL8 A;  3FG2 P;  4BK3 A;  2GEW A;  5TR3 A;  3R9U A;  1JRZ A;  5JCL A;  5JCK A;  4A99 A;  1H81 A;  3OZ2 A;  3UCL A;  1RYI A;  4IV9 A;  1E1M A;  3T2Y A;  3G5R A;  4J34 A;  2YG4 A;  3PS9 A;  4GDP A;  2C75 A; 
#chains in the Genus database with same CATH homology
 1E1K A;  2GB0 A;  1N4U A;  4Z43 A;  2GMJ A;  3I3L A;  2BRY A;  3GWF A;  3NK2 X;  1IUT A;  2WS3 A;  5KNL A;  3DJG X;  1FCD A;  3GRS A;  3GRT A;  2DKI A;  4C3X A;  2GR1 A;  1F8S A;  4RG3 A;  1BGN A;  1GER A;  3B3R A;  1LQT A;  2HQM A;  3ABV A;  2JK6 A;  5EB4 A;  1GV4 A;  2GQF A;  4AP3 A;  2BS3 A;  3LZW A;  2V6O A;  1IUU A;  1F8R A;  2YR6 A;  4ICY A;  3AE3 A;  5HY5 A;  3GMC A;  1F3P A;  3PVC A;  4Z44 A;  1DXL A;  3VR8 A;  2XLS A;  2AAQ A;  2PYX A;  3KU9 A;  4BJY A;  2BXS A;  3M13 A;  4YSZ A;  2FJD A;  1FEA A;  2FJA A;  3T0K A;  4OPC A;  5KVH A;  2GR3 A;  3LAD A;  1JRX A;  1Q1R A;  3DJD A;  2Q7V A;  3KVE A;  1S2Y A;  5KXJ A;  1K0J A;  5CQF A;  4UDR A;  4JNQ A;  2O9Z A;  3AD7 B;  2QCU A;  4FK1 C;  3D1C A;  3NH3 X;  3CNT A;  4TLX A;  3UKH A;  5GSN A;  4NWZ A;  1H86 A;  3DJJ A;  2V61 A;  2NPX A;  2XVF A;  2XYO A;  2WU5 A;  1GTH A;  4H4X A;  3QFB A;  1GXF A;  2YLS A;  3T2K A;  4Z2U A;  1PN0 A;  2FJB A;  3AWI A;  1B8S A;  2C3D A;  1DJQ A;  1O95 A;  1DOE A;  3AD8 B;  3GDP A;  2BS4 A;  3DME A;  2BCP A;  1S3E A;  3AYJ A;  1D7L A;  1PXC A;  2A87 A;  2JAE A;  3AE7 A;  4H2R A;  1CC2 A;  3I6D A;  2JB3 A;  1D5T A;  4U8O A;  1NHP A;  3UKK A;  1BF3 A;  2C65 A;  1GT8 A;  4IA6 A;  2ZZ0 A;  3UOZ A;  3AYI A;  1E1L A;  3BI2 A;  2X50 A;  2XLR A;  2R0G A;  1GOS A;  3CGB A;  2XVJ A;  3SZ0 A;  4B1B A;  1H83 A;  1NHR A;  2VQB A;  5BUK A;  1TRB A;  1CJC A;  2WOV A;  3ADA B;  3NKS A;  4OPL A;  1NG4 A;  1PBF A;  2ARD A;  3NRN A;  4O5Q A;  4USR A;  3T31 A;  2E4G A;  3T37 A;  1XDI A;  1ZMC A;  2GV8 A;  1REO A;  2YLT A;  3UKA A;  2XFN A;  3RHA A;  1GRH A;  3GWD A;  1LPF A;  4EM4 A;  2QAE A;  2WDV A;  2I0Z A;  3CIR A;  2JBV A;  4HA6 A;  4Z24 A;  2YG3 A;  4IVO B;  1JRY A;  4IVM B;  3GD4 A;  4OPT A;  3SZC A;  4IA5 A;  1D4C A;  1IJH A;  1YQ4 A;  2C4C A;  2H89 A;  1S3B A;  1CF3 A;  2Q0L A;  2BK4 A;  3NHO X;  4H2P A;  2BK3 A;  3AED A;  2R0P A;  2XLU A;  4KX6 A;  3HYV A;  4I59 A;  4U8M A;  1KNR A;  3NYC A;  4YT0 A;  4RSL A;  3CPH G;  4Y4M A;  2XFO A;  4EMJ A;  2V5Z A;  3LB8 A;  4OPD A;  1PHH A;  3KA7 A;  3NN6 X;  5KOW A;  1BKW A;  4MJW A;  1Y0P A;  3O0H A;  1H82 A;  3EAN A;  4CNJ A;  5KVI A;  4GUV A;  3VR9 A;  2YM2 A;  3UTE A;  2YVG A;  3K7M X;  1TDK A;  3K7Q X;  1GRT A;  1DJN A;  3RP8 A;  1NHQ A;  1FEC A;  1LV0 A;  1BWC A;  3VRD B;  1D4E A;  3HYW A;  1N4V A;  3AE2 A;  3IF9 A;  4JQ9 A;  4CNK A;  3H8L A;  2B9X A;  4AOX A;  4G73 A;  3B6D A;  4LII A;  2Q6U A;  2WEU A;  4B65 A;  4EQX A;  4U2S A;  3L8K A;  2VRM A;  4U8J A;  4D04 A;  4C3Y A;  4APN A;  4H4U A;  4B63 A;  2GVC A;  2BXR A;  1GRA A;  4LU6 A;  4DNA A;  2C3C A;  2X8H A;  2JKC A;  1GRE A;  2CUL A;  4FX9 A;  4EM3 A;  1CJ3 A;  1KSU A;  3NTD A;  2ZZC A;  3S61 A;  3SFD A;  1RP0 A;  3VRA A;  4X9M A;  4Z26 A;  4H2Q A;  4YTM A;  2B7S A;  4GCM A;  3GDN A;  2EQ8 A;  2J3N A;  2GMH A;  4YTP A;  1H6V A;  2ZZB A;  3CNS A;  4GRT A;  3JSK A;  1DOB A;  2WPF A;  2RGJ A;  2YLR A;  3EF6 A;  1Q9I A;  3ICT A;  4J2W A;  4U8N A;  4YSY A;  3LOV A;  5M10 A;  1OJA A;  4H4P A;  4PAB A;  3P9U A;  1GAL A;  1NAA A;  2AQJ A;  3QSE A;  4D03 A;  3UKL A;  3UP5 A;  4YXD A;  2YLX A;  2R4E A;  3FIM B;  3NG7 X;  1L9D A;  4ZCC A;  1Y56 A;  3KD9 A;  5U63 A;  2WP9 A;  2WP6 A;  3AYL A;  3UOV A;  1OJ9 A;  1FOH A;  3QSM A;  4NTC A;  3SZW A;  3CNP A;  3GMB A;  4NTE A;  2A89 A;  4H50 A;  2YAU A;  3K7T A;  1D4D A;  3D8X A;  4UP3 A;  1ZDL A;  4JY2 A;  1BZL A;  2GH5 A;  2Z5Y A;  3SY4 A;  1MO9 A;  1ZK7 A;  3C4N A;  3P4P A;  1B37 A;  4CBQ A;  5FS7 A;  4OPU A;  5BVA A;  2YR4 A;  1ONF A;  2TPR A;  3ALM A;  3IC9 A;  4JY3 A;  4WCT A;  5J60 A;  2JB2 A;  5EB5 A;  1KNP A;  2BCG G;  3CNJ A;  1KSS A;  1M64 A;  1PJ7 A;  3FBS A;  2WHD A;  2XCG A;  3QVR A;  4M52 A;  1Q1W A;  4TLZ A;  2NVK X;  4Y4L A;  4X9N A;  3V3O A;  1V59 A;  3BI4 A;  2QA1 A;  2APG A;  3AEA A;  1GND A;  3CN8 A;  1NHS A;  1VG0 A;  2BAC A;  3C96 A;  3WE0 A;  4ZCD A;  3NN0 X;  4EIP A;  2Q0K A;  3AE1 A;  3NK1 X;  4G6G A;  4H4V A;  5JCM A;  2GAG B;  2EQ9 A;  1IUW A;  3UTH A;  3VQR A;  4PAA A;  4YKG A;  4K5R A;  1ZKQ A;  3IHM A;  4H4T A;  4TM0 A;  1X31 B;  3FMW A;  2RGH A;  4O5U A;  4LA1 A;  4TM3 A;  2R46 A;  2V3B A;  3NYE A;  2XVI A;  4G74 A;  2IID A;  3EPT A;  5FS6 A;  5J7X A;  4G6H A;  1F8W A;  1PS9 A;  2BRA A;  2WP5 A;  2GRT A;  5IPY A;  4OVI A;  4BJZ A;  2BA9 A;  5KWF A;  2AR8 A;  4H4Q A;  3BHF A;  1RSG A;  1K0L A;  1P2E A;  3NT6 A;  1Z6L A;  3KLJ A;  1HYU A;  4YWO A;  4NZH A;  2WDQ A;  4TM4 A;  5HXI A;  4A5L A;  4H4R A;  4RG4 A;  4B67 A;  1CC6 A;  5DBJ A;  1LTX R;  3G5S A;  1L0V A;  1QLB A;  4FK1 A;  3KKJ A;  2JB1 A;  3IHG A;  2C66 A;  4H4Y A;  5C2T A;  2GR0 A;  3ISH A;  4HB9 A;  1LVL A;  3GYX A;  2B9Y A;  1H7W A;  1PDH A;  3BI5 A;  4I58 A;  3IWA A;  1QO8 A;  1NPX A;  2VRL A;  2YG6 A;  5C3J A;  4XWR A;  3CMM A;  1DOC A;  1E1N A;  3NIX A;  1YQ3 A;  2V3A A;  3GYI A;  2BC0 A;  3NLC A;  4GAV A;  3PO7 A;  4C5O A;  5EOW A;  4H2N A;  2VQ7 A;  2V60 A;  1H84 A;  2WPE A;  2C64 A;  2C76 A;  1GPE A;  1OJD A;  4NNJ A;  1K0I A;  4A6N A;  3AEF A;  3E1T A;  1GEU A;  1ZMD A;  4DSG A;  1ZP0 A;  3AD9 B;  4GF7 A;  1KFY A;  1Y56 B;  1E39 A;  3UOY A;  5KMR A;  3QFA A;  3V3N A;  4CY6 A;  2XFQ A;  3BHK A;  3UTG A;  2XLT A;  3ATQ A;  1NEK A;  4H4S A;  2X3N A;  3UKQ A;  1GTE A;  3DA1 A;  3CPJ G;  1XAN A;  2VVM A;  2W0H A;  3AE4 A;  4U2T A;  1O94 A;  1OJT A;  3SZF A;  4B64 A;  1L9E A;  3P4S A;  1IUV A;  3CGE A;  5FS8 A;  2B7R A;  3K30 A;  2XLP A;  3M12 A;  3AEC A;  4BUR A;  2BK5 A;  4CRT A;  1ZX9 A;  4BK1 A;  4YSH A;  1PBC A;  1FL2 A;  3GD3 A;  3II4 A;  1XPQ A;  4K8D A;  3NK0 X;  3QJ4 A;  1MOK A;  1PBB A;  1ZOY A;  4K7Z A;  2R0C A;  3DK9 A;  5BUL A;  4CCR A;  5BRT A;  2CFY A;  4UDQ A;  1K4Q A;  4YKF A;  1E7P A;  5KMP A;  1VG9 A;  2XFU A;  3OC4 A;  4DGK A;  3SXI A;  1N4W A;  2Y6R A;  3BNU A;  3CTY A;  4B68 A;  4AT0 A;  3AEG A;  3FPZ A;  5IQ4 A;  3RP7 A;  1S2Q A;  3RNM A;  1GRF A;  2WOW A;  2ZBW A;  4DSH A;  4BK2 A;  4EQR A;  5KMQ A;  2GQW A;  5JCN A;  2E5V A;  1OJC A;  3Q9T A;  2R45 A;  3AE8 A;  1VDC A;  2GR2 A;  1M6I A;  3CGD A;  1GET A;  4REK A;  3AB1 A;  2PHH A;  4OCG A;  2BS2 A;  2Y6Q A;  2IVD A;  1PJ5 A;  2B9W A;  1IUS A;  4K2X A;  2OAL A;  2A8X A;  1GES A;  3P4R A;  3ICS A;  2CVJ A;  4YTN A;  3T14 A;  1PBE A;  4ZN0 A;  2WBA A;  2YLZ A;  1TDN A;  3H8I A;  2VZ2 A;  4USQ A;  1SEZ A;  4K5S A;  2FJE A;  1TDF A;  1DOD A;  1H7X A;  3SM8 A;  3LZX A;  4XXG A;  1EL7 A;  4J31 A;  1D7Y A;  4AT2 A;  4E0V A;  4Z25 A;  1JNR A;  2YLW A;  4BV6 A;  2YVJ A;  3SX6 A;  1TYT A;  4EMW A;  1LQU A;  2X99 A;  3NTA A;  3SQP A;  3T2Z A;  4JNA A;  3ALJ A;  2C67 A;  2RGO A;  1E6E A;  3DJE A;  3LJP A;  4K22 A;  1N1P A;  4U8P A;  3DGH A;  5FS9 A;  4U8L A;  4XWZ A;  3AEB A;  3DK8 A;  3NYF A;  3G5Q A;  4A6N B;  4X4J A;  4Y4N A;  2DKH A;  1JNZ A;  3F8R A;  1PJ6 A;  3SFE A;  1PXA A;  2YVF A;  5FMH A;  4II3 A;  3URH A;  4A79 A;  2WOI A;  2BYB A;  5CKU A;  5M0Z A;  4ECH A;  2X8G A;  1CC4 A;  1ELI A;  2WPC A;  4U8I A;  4C77 A;  4EQW A;  3UKP A;  3ITJ A;  3LXD A;  3ZYX A;  2WET A;  2YQU A;  1PXB A;  5JCI A;  4WX1 A;  1B5Q A;  1YY5 A;  2F5Z A;  1KF6 A;  2R9Z A;  4A9W A;  2EQ6 A;  2XVE A;  4H4W A;  2BC1 A;  2WDR A;  4KPR A;  4CY8 A;  4YSX A;  2X8C A;  1COY A;  3ICR A;  1LJ1 A;  1JEH A;  4OPG A;  2XFP A;  3AXB A;  3KPF A;  4A7A A;  1EL5 A;  3ZDN A;  2OLN A;  1YQZ A;  4NTD A;  3CPI G;  2OA1 A;  1VRQ B;  3DK4 A;  3GYJ A;  3AE9 A;  4J57 A;  4B66 A;  4C74 A;  1NG3 A;  3VRB A;  4EMI A;  1TYP A;  3GSI A;  3NGC X;  4GAP A;  5ER0 A;  4AOS A;  3DGZ A;  2ACZ A;  2QA2 A;  3QSS A;  4J36 A;  1MXT A;  3UOX A;  3UTF A;  1EL9 A;  1AOG A;  3CND A;  4AP1 A;  2VOU A;  4P9S A;  1YKJ A;  3BNM A;  1XHC A;  3UKF A;  1FEB A;  2C72 A;  2FBW A;  3SYI A;  2XDO A;  2Z5X A;  1ZY8 A;  2C7G A;  1CL0 A;  4G9K A;  3L1R A;  2TMD A;  5KRQ A;  5KOX A;  1GRB A;  3AE5 A;  4TM1 A;  3AEE A;  2E1M A;  2OAM A;  2BAB A;  4GDE A;  4NEV A;  5IQ1 A;  4EIQ A;  4J56 A;  3COX A;  1NEN A;  3UP4 A;  1F6M A;  4Z2T A;  1IUX A;  4H4Z A;  3KPK A;  1DNC A;  2VVL G;  1JOA A;  2YR5 A;  5U25 A;  4U8K A;  2IVE A;  3SGL A;  1JU2 A;  2GF3 A;  2CDU A;  2R4J A;  2YM1 A;  3M0O A;  3NNE A;  3P1W A;  4U2L A;  1TDO A;  5KMS A;  2EQ7 A;  1QJD A;  3EAO A;  2WU2 A;  3HYX A;  4EQS A;  5U1O A;  3F8D A;  2B76 A;  2XVH A;  4OPI A;  1GRG A;  1TDE A;  3HZL A;  1EBD A;  2GAH B;  3V76 A;  4B69 A;  2UZZ A;  2C70 A;  1NDA A;  2H88 A;  2YG7 A;  4J33 A;  3QVP A;  4ADW A;  1L9C A;  2VVL A;  4II2 A;  1P2H A;  5GRT A;  1UKV G;  2C73 A;  3RED A;  5HYM A;  1BGJ A;  1CBO A;  2OLO A;  5EBK A;  3DH9 A;  3F8P A;  3RP6 A;  1KDG A;  2WES A;  3ALL A;  4H7U A;  3H4K A;  3C4A A;  1CJ4 A;  2YG5 A;  3Q6J A;  4FDC B;  5HHF A;  3ATR A;  1ZOV A;  4NEW A;  1CJ2 A;  5L46 A;  1B4V A;  4GR1 A;  4Z2R A;  2YWL A;  1VQW A;  3CGC A;  4JDR A;  4JN9 A;  4CCQ A;  4N9X A;  1W4X A;  1CHU A;  3AE6 A;  4A65 A;  2WQY A;  3S5W A;  3P4Q A;  1GSN A;  1O5W A;  4UDP A;  5LV9 A;  1PBD A;  2RAB A;  1EL8 A;  3FG2 P;  4BK3 A;  2GEW A;  5TR3 A;  3R9U A;  1JRZ A;  5JCL A;  5JCK A;  4A99 A;  1H81 A;  3OZ2 A;  3UCL A;  1RYI A;  4IV9 A;  1E1M A;  3T2Y A;  3G5R A;  4J34 A;  2YG4 A;  3PS9 A;  4GDP A;  2C75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...