2A87A

Crystal structure of m. tuberculosis thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
313
structure length
313
Chain Sequence
AHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 88
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A02
4DSGA 2UZZA 2XFUA 1CC4A 3DGZA 2R0PA 4IA5A 2QA2A 1ZX9A 1FCDA 3AD9B 3AE6A 4WCTA 5M0ZA 2FJEA 2Q0KA 4CY8A 5HXIA 2BS3A 2VOUA 3F8DA 2ACZA 1XANA 1PDHA 1BF3A 4OPCA 1TDFA 1N4VA 4H4ZA 2VVLA 4WX1A 1KSSA 5BULA 1REOA 4IVOB 4EIQA 1EL8A 2A87A 3QFAA 3CN8A 1FEAA 4J34A 1ZMCA 3RP7A 3P4RA 1E1NA 3SQPA 1LPFA 3VRDB 4LU6A 5KWFA 4NZHA 3NK1X 1IUUA 3R9UA 1KDGA 5HYMA 1Y56A 5EB4A 2B76A 4AP3A 4CBQA 3M0OA 4J56A 3LJPA 2EQ8A 3AEDA 2TMDA 3K7QX 3NKSA 2BCGG 3UKKA 1EBDA 3NLCA 1GRAA 4U2TA 1D4CA 5FS8A 3UTGA 1DODA 2VRMA 1OJDA 3P1WA 3EF6A 1E7PA 1VRQB 2OALA 3AEGA 1FEBA 3KPFA 4GDEA 3BI2A 4H4VA 3ALJA 4YTNA 1S3EA 2JAEA 4J2WA 2B9YA 3GDNA 3F8RA 3BI4A 2H89A 4K7ZA 5M10A 1H7XA 2GEWA 3CNDA 1JNZA 3NTDA 4E0VA 3DH9A 3RHAA 4LIIA 1GRHA 2NPXA 4H4TA 1TDKA 4JN9A 3SFEA 3I3LA 4H2NA 2WPFA 2GRTA 2X8CA 4Z2TA 4GUVA 1BZLA 1MOKA 1ZMDA 4FDCB 2BACA 1E6EA 2YVJA 3VRAA 4D03A 4U8JA 2FJAA 1UKVG 1ZKQA 4ZN0A 4B66A 5JCIA 2JB1A 1PN0A 3DJJA 2BK3A 3QSMA 2YAUA 3UP5A 2YLZA 1H83A 1NHPA 4XWRA 3UOVA 3NN6X 3ZYXA 3P4PA 1GEUA 4EIPA 4ECHA 3CGBA 3BNUA 3C4AA 4I59A 4A9WA 2XFNA 4X9MA 1L9CA 3AE4A 3BNMA 4U8KA 2YG5A 1SEZA 2EQ7A 3DK8A 4UDRA 1TYPA 1ZOVA 2XDOA 2XLSA 1XDIA 2HQMA 4GR1A 3UOZA 1TYTA 2B9WA 5KOXA 4H2PA 4H7UA 2ARDA 2XLTA 4YSXA 2JK6A 2XLRA 3FPZA 4HA6A 4Y4NA 2R0CA 3B3RA 1D4DA 2H88A 3V3NA 4OPDA 4B65A 2C70A 4H4SA 3CPIG 5FS6A 5TR3A 4C74A 2C3DA 2C64A 3UKAA 5KOWA 2XVEA 4BJYA 4LA1A 2YR5A 4EM3A 4NTEA 2X8HA 4TM3A 4CNJA 1CJ3A 1H82A 3EPTA 2RABA 2XFQA 3CIRA 1TDNA 1Y0PA 2X50A 3NK2X 2EQ6A 2YLRA 1FL2A 2E1MA 2BS4A 4AOSA 3UKHA 4B68A 4B63A 2BCPA 4M52A 1L9DA 5EOWA 1DJNA 3DA1A 5IPYA 5U1OA 3P9UA 3BHFA 3K30A 1X31B 3GSIA 1AOGA 1F8SA 2GR0A 1YKJA 2RGHA 1CJ4A 1KNPA 3GD3A 3OC4A 1Z6LA 3NG7X 4FK1A 3VQRA 3NGCX 4USRA 2DKIA 3C4NA 5FS9A 1CF3A 4AT0A 4ADWA 1YY5A 1PJ6A 4U8MA 1TRBA 3OZ2A 1D5TA 2B7SA 4TM1A 3QSEA 1GREA 1EL7A 2VVMA 3NYEA 1ZK7A 3RP6A 4ICYA 2YG6A 2XVFA 4H4UA 4J57A 3F8PA 4USQA 2WPEA 3AB1A 2JB3A 4BK1A 2GQWA 2WHDA 3DJEA 5JCMA 1BGJA 4I58A 3IHMA 2BC0A 4K5SA 4CNKA 1PBEA 2X99A 3IWAA 1BKWA 3AXBA 2BS2A 1JOAA 4NTDA 1H6VA 1DNCA 2WEUA 2APGA 1DJQA 5JCKA 2JB2A 1H84A 4IA6A 1ZY8A 4YWOA 1CC6A 1LJ1A 3GRTA 2OLNA 1P2HA 4CY6A 2GR1A 1GRFA 5KRQA 5KXJA 1O5WA 2YLSA 1JRYA 1JNRA 1GESA 2YQUA 3UTHA 1P2EA 4BK2A 4A6NB 3LADA 4RG3A 4RG4A 2R4JA 2BC1A 2WESA 4CCRA 1GRTA 2IVEA 2F5ZA 3Q9TA 4JY3A 2GVCA 3H8LA 5EB5A 2FJDA 4EQRA 1O95A 4D04A 1NENA 3DGHA 2GMJA 4U8OA 3PVCA 2C3CA 1DOCA 1EL9A 4JY2A 3P4QA 2TPRA 3QJ4A 3FBSA 4YTMA 3H8IA 4N9XA 5U63A 3PS9A 3LZWA 3NIXA 3E1TA 1NHSA 4O5UA 5BRTA 4U8NA 2XVJA 2V60A 3AE8A 1Q9IA 1ZP0A 2R9ZA 4A5LA 3EAOA 3GMCA 1KSUA 2WOWA 3LZXA 2XFPA 3VR8A 1PS9A 1N4UA 2C66A 3AE9A 4DSHA 3KLJA 3D1CA 3ABVA 2I0ZA 5IQ1A 2FBWA 1S3BA 1YQZA 4OPTA 5LV9A 3HZLA 5J7XA 1IUVA 2V61A 1XPQA 4J31A 1PJ7A 3C96A 1B8SA 1S2YA 4B1BA 4ZCDA 2JBVA 2YVGA 3COXA 4NEWA 2BYBA 3WE0A 2VZ2A 2WP5A 2Q0LA 2XVHA 3SGLA 2C76A 2BXSA 3NH3X 3UP4A 4U2SA 3ZDNA 3V76A 2CDUA 4Y4LA 1NEKA 2GF3A 3AWIA 4UDPA 5BUKA 2CULA 1F8RA 2Z5XA 3QVRA 3KKJA 3SFDA 1DXLA 2QAEA 4H4PA 3JSKA 1GOSA 3DK4A 3S5WA 1BGNA 3CGEA 1PXAA 4U2LA 3AE5A 4EQSA 2R0GA 4A6NA 4H50A 4A99A 1IUXA 1PBCA 4C5OA 1RYIA 1CJCA 1YQ3A 3ALMA 1NPXA 1OJ9A 2XYOA 2XLPA 3LB8A 1JU2A 4OPIA 3KD9A 4GRTA 2BK4A 1JEHA 4X9NA 5ER0A 4H2RA 2EQ9A 2YG3A 2ZZBA 2B9XA 2ZZ0A 1GPEA 1V59A 2BABA 1DOBA 3M13A 2WDQA 4XWZA 4IV9A 1H81A 3PO7A 2V6OA 4OPUA 2WOIA 3NK0X 2WBAA 5CKUA 1K4QA 2AR8A 1PJ5A 1E39A 1M64A 3KU9A 3AE2A 2FJBA 5U25A 4DNAA 3RP8A 3AE1A 4H4YA 2GH5A 4B67A 1JRXA 4Z24A 1E1MA 1COYA 2C73A 5CQFA 1PBBA 1GRGA 5C3JA 4AOXA 1H7WA 2BK5A 3REDA 2E4GA 4BV6A 2VVLG 3AYLA 3AD8B 1E1KA 1F6MA 2DKHA 4K22A 3CTYA 4U8PA 3CPHG 1W4XA 3QVPA 4TLXA 4C3YA 2WU5A 4C3XA 1CBOA 1Q1WA 3K7MX 3URHA 2X8GA 3EANA 5KVHA 4J36A 4TLZA 3NTAA 4K8DA 2ZZCA 2YLWA 3AD7B 3AEBA 3G5RA 2PHHA 2WU2A 1JRZA 2R45A 3I6DA 4PAAA 4Z2RA 3K7TA 2YG7A 1NDAA 2GV8A 3NN0X 1FOHA 1NG4A 1D7YA 1IUTA 3D8XA 1GSNA 3Q6JA 1D7LA 4BK3A 1CHUA 3ICRA 3KA7A 1QO8A 1B37A 2CFYA 2GQFA 4BURA 1K0LA 3UTEA 3B6DA 2YLTA 4TM4A 4EQWA 3VRBA 3NYCA 5IQ4A 2WP9A 3ISHA 1NAAA 4OPGA 1QLBA 1TDEA 5HY5A 1Q1RA 1LV0A 2C65A 3QSSA 1PBFA 2X3NA 3SM8A 2C67A 1Y56B 3ATQA 4B69A 3CNSA 2OA1A 4P9SA 4EMIA 4REKA 3II4A 2WETA 3L1RA 4XXGA 5HHFA 1FECA 4JNAA 3GRSA 1CC2A 1RP0A 1GXFA 5FMHA 3ADAB 1OJTA 2WS3A 3FIMB 3GYJA 3DJGX 3UOXA 4Z25A 3AE7A 4Z44A 4BJZA 4H4WA 5L46A 1TDOA 1LTXR 1RSGA 2B7RA 2GAGB 2QCUA 1MXTA 2JKCA 1ONFA 2A89A 3CNJA 4FK1C 1LQUA 2Y6QA 2GMHA 3GWDA 3UOYA 3ATRA 3AEEA 3DJDA 3GDPA 2Q7VA 3GYIA 4YKFA 1GETA 4AP1A 3O0HA 2BXRA 3UTFA 3QFBA 4K2XA 1OJAA 3KVEA 4H4RA 4YSZA 1IUWA 4JNQA 3GMBA 2YLXA 3GD4A 1N4WA 4EMWA 3NYFA 4OPLA 4GDPA 4B64A 2YR6A 4K5RA 5JCNA 5C2TA 4YXDA 5BVAA 2PYXA 4FX9A 3NT6A 3AYIA 4O5QA 3VR9A 1NG3A 2GB0A 2W0HA 3GWFA 1GTHA 3ICTA 5KVIA 1CL0A 4KX6A 2XLUA 4A65A 2ZBWA 4IVMB 2C75A 4UDQA 2V5ZA 4NEVA 3H4KA 1D4EA 1GRBA 4GCMA 4YSHA 2WPCA 2RGJA 3CGCA 2XFOA 3AYJA 3LOVA 4YT0A 4Z43A 1QJDA 3IF9A 3AE3A 1N1PA 4J33A 5GSNA 4CRTA 4MJWA 3L8KA 2XCGA 3UKFA 1VDCA 1K0IA 3ICSA 3M12A 1ZOYA 1E1LA 1XHCA 2C72A 4H2QA 4EMJA 1BWCA 1PXCA 1CJ2A 2AAQA 1PXBA 4OCGA 4C77A 2RGOA 3V3OA 2Z5YA 1GNDA 4DGKA 3UKQA 1DOEA 1ELIA 1VG9A 4TM0A 4EQXA 2Q6UA 1B4VA 2V3AA 2GR3A 1GERA 4X4JA 2GAHB 1H86A 3LXDA 3BHKA 1GV4A 2R46A 4Z26A 4U8IA 4H4XA 5EBKA 4Y4MA 1NHRA 1OJCA 4RSLA 1LQTA 2IIDA 1O94A 1B5QA 1EL5A 2NVKX 3NNEA 1IJHA 2Y6RA 3NRNA 1GTEA 4YKGA 2VQ7A 3AEAA 2WP6A 1M6IA 3CNTA 3DK9A 4JQ9A 3ALLA 2J3NA 1ZDLA 1IUSA 4A7AA 2OAMA 2WDVA 4AT2A 2VRLA 1GT8A 3BI5A 1F3PA 4GF7A 4A79A 1K0JA 2YG4A 2WDRA 3UKLA 1KNRA 2WQYA 3ITJA 2OLOA 3G5QA 3RNMA 5J60A 2YWLA 1VQWA 4PABA 2E5VA 2GR2A 5DBJA 5GRTA 4EM4A 3AEFA 4NTCA 4KPRA 3UKPA 2VQBA 1KFYA 2AQJA 1VG0A 3FG2P 4ZCCA 2XVIA 2C7GA 3CNPA 1PBDA 1L9EA 3IHGA 2IVDA 2CVJA 2A8XA 3G5SA 1S2QA 3FMWA 2WOVA 4CCQA 3S61A 3P4SA 2YR4A 1LVLA 5FS7A 1GALA 3UCLA 1YQ4A 4JDRA 2YM1A 1L0VA 2YVFA 4HB9A 4APNA 2BA9A 2V3BA 5JCLA 3CGDA 1KF6A 3IC9A 4YTPA 4UP3A 3DMEA 4U8LA 4Z2UA 4OVIA 1PHHA 2QA1A 1MO9A 2O9ZA 3AECA 2YM2A 1NHQA 1HYUA 2R4EA 3CPJG 1F8WA 3T37A 4H4QA 3NHOX 4YSYA
chains in the Genus database with same CATH superfamily
4DSGA 2UZZA 2XFUA 1CC4A 3DGZA 2R0PA 4IA5A 2QA2A 4H4QA 1ZX9A 1FCDA 3AD9B 3AE6A 4WCTA 5M0ZA 2FJEA 2Q0KA 4CY8A 5HXIA 2BS3A 2VOUA 3F8DA 2ACZA 1XANA 1PDHA 1BF3A 4OPCA 1TDFA 1N4VA 4H4ZA 2VVLA 4WX1A 1KSSA 5BULA 1REOA 4IVOB 4EIQA 1EL8A 2A87A 3QFAA 3CN8A 1FEAA 4J34A 1ZMCA 3RP7A 3P4RA 1E1NA 3SQPA 1LPFA 3VRDB 4LU6A 3T2YA 5KWFA 4NZHA 3NK1X 1IUUA 3R9UA 1KDGA 5HYMA 1Y56A 5EB4A 2B76A 4AP3A 4CBQA 3M0OA 4J56A 3LJPA 2EQ8A 3AEDA 2TMDA 3K7QX 3NKSA 2BCGG 3UKKA 1EBDA 3NLCA 1GRAA 4U2TA 1D4CA 5FS8A 3UTGA 1DODA 2VRMA 1OJDA 3P1WA 3EF6A 1E7PA 1VRQB 2OALA 3AEGA 1FEBA 3KPFA 4II3A 4GDEA 3BI2A 4H4VA 3ALJA 4YTNA 1S3EA 2JAEA 4GAVA 2B9YA 3GDNA 3F8RA 3BI4A 2H89A 4J2WA 4K7ZA 5M10A 1H7XA 2GEWA 3CNDA 1JNZA 3NTDA 4E0VA 3DH9A 3RHAA 4LIIA 1GRHA 2NPXA 4H4TA 1TDKA 4JN9A 3SFEA 3I3LA 4H2NA 2WPFA 2GRTA 2X8CA 4Z2TA 4GUVA 1BZLA 1MOKA 1ZMDA 4FDCB 2BACA 1E6EA 4NNJA 2YVJA 3VRAA 4D03A 4U8JA 2FJAA 1UKVG 1ZKQA 4ZN0A 4B66A 5JCIA 2JB1A 1PN0A 3DJJA 2BK3A 3QSMA 2YAUA 3UP5A 2YLZA 1H83A 1NHPA 4XWRA 3UOVA 3NN6X 3ZYXA 3P4PA 1GEUA 4EIPA 4ECHA 3CGBA 3BNUA 3C4AA 4I59A 4A9WA 2XFNA 4X9MA 1L9CA 3AE4A 3BNMA 4U8KA 2YG5A 1SEZA 2EQ7A 3DK8A 4UDRA 1TYPA 3SZWA 1ZOVA 2XDOA 2XLSA 1XDIA 2HQMA 4GR1A 3UOZA 1TYTA 2B9WA 5KOXA 4H2PA 4H7UA 2ARDA 2XLTA 4YSXA 2JK6A 2XLRA 4G6HA 3FPZA 4HA6A 4Y4NA 2R0CA 3B3RA 1D4DA 2H88A 3V3NA 4OPDA 4B65A 2C70A 4H4SA 3CPIG 5FS6A 5TR3A 4C74A 2C3DA 2C64A 3UKAA 5KOWA 2XVEA 4BJYA 4LA1A 2YR5A 4EM3A 4NTEA 2X8HA 4TM3A 4CNJA 1CJ3A 1H82A 3EPTA 2RABA 2XFQA 3CIRA 1TDNA 1Y0PA 2X50A 3NK2X 2EQ6A 2YLRA 1FL2A 3T2KA 2E1MA 2BS4A 4AOSA 3UKHA 4B68A 4B63A 2BCPA 4M52A 1L9DA 5EOWA 1DJNA 3DA1A 5IPYA 5U1OA 3P9UA 3BHFA 3K30A 1X31B 3GSIA 1AOGA 1F8SA 2GR0A 1YKJA 2RGHA 1CJ4A 1KNPA 3GD3A 3OC4A 1Z6LA 3NG7X 4FK1A 3VQRA 3NGCX 4USRA 2DKIA 3KPKA 3C4NA 5FS9A 1CF3A 4AT0A 4ADWA 1YY5A 1PJ6A 4U8MA 3SY4A 1TRBA 3OZ2A 1D5TA 2B7SA 4TM1A 5KNLA 3QSEA 1GREA 1EL7A 2VVMA 3NYEA 1ZK7A 3RP6A 4ICYA 2YG6A 2XVFA 4H4UA 4J57A 3SZCA 3F8PA 4USQA 2WPEA 3AB1A 2JB3A 4BK1A 2GQWA 2WHDA 3DJEA 5JCMA 1BGJA 4I58A 3IHMA 2BC0A 4K5SA 4CNKA 1PBEA 2X99A 3IWAA 1BKWA 3AXBA 2BS2A 1JOAA 4NTDA 1H6VA 1DNCA 2WEUA 2APGA 1DJQA 5JCKA 2JB2A 1H84A 4IA6A 1ZY8A 4YWOA 1CC6A 1LJ1A 3GRTA 2OLNA 1P2HA 4CY6A 2GR1A 1GRFA 5KRQA 5KXJA 1O5WA 2YLSA 1JRYA 1JNRA 1GESA 2YQUA 3UTHA 1P2EA 4BK2A 4A6NB 3LADA 4RG3A 4RG4A 2R4JA 2BC1A 2WESA 4CCRA 1GRTA 2IVEA 2F5ZA 3Q9TA 4JY3A 2GVCA 3H8LA 5EB5A 2FJDA 4G9KA 4EQRA 1O95A 4D04A 1NENA 3DGHA 2GMJA 4U8OA 3PVCA 2C3CA 1DOCA 1EL9A 4JY2A 3P4QA 2TPRA 3QJ4A 3FBSA 4YTMA 3H8IA 4N9XA 5U63A 3SX6A 3T31A 3PS9A 3LZWA 3NIXA 3E1TA 1NHSA 4O5UA 3SZ0A 5BRTA 4U8NA 2XVJA 4GAPA 2V60A 3AE8A 1Q9IA 1ZP0A 2R9ZA 4A5LA 3EAOA 3GMCA 1KSUA 2WOWA 3LZXA 2XFPA 3VR8A 5KMSA 1PS9A 1N4UA 2C66A 3AE9A 4DSHA 3KLJA 3D1CA 3ABVA 2I0ZA 5IQ1A 2FBWA 1S3BA 1YQZA 4OPTA 5LV9A 3HZLA 5J7XA 1IUVA 2V61A 1XPQA 4J31A 3SYIA 1PJ7A 3C96A 1B8SA 3T14A 1S2YA 4B1BA 4ZCDA 2JBVA 2YVGA 3COXA 4NEWA 2BYBA 3WE0A 4G6GA 2VZ2A 2WP5A 2Q0LA 2XVHA 3SGLA 2C76A 2BXSA 3NH3X 3UP4A 4U2SA 3ZDNA 3V76A 2CDUA 4Y4LA 1NEKA 2GF3A 3AWIA 4UDPA 5BUKA 2CULA 1F8RA 2Z5XA 3QVRA 3KKJA 4II2A 3SFDA 1DXLA 2QAEA 4H4PA 3JSKA 1GOSA 3DK4A 3S5WA 1BGNA 3CGEA 1PXAA 4U2LA 4G73A 3AE5A 3HYXA 4EQSA 2R0GA 4A6NA 4H50A 4A99A 1IUXA 1PBCA 4C5OA 1RYIA 1CJCA 1YQ3A 3ALMA 4G74A 1NPXA 1OJ9A 2XYOA 2XLPA 3LB8A 1JU2A 4OPIA 3KD9A 4GRTA 2BK4A 1JEHA 4X9NA 5ER0A 4H2RA 2EQ9A 2YG3A 2ZZBA 2B9XA 2ZZ0A 1GPEA 1V59A 2BABA 1DOBA 3M13A 2WDQA 4XWZA 4IV9A 1H81A 3PO7A 2V6OA 4OPUA 2WOIA 3NK0X 2WBAA 5CKUA 1K4QA 2AR8A 1PJ5A 1E39A 1M64A 3KU9A 3AE2A 3GYXA 2FJBA 5U25A 4DNAA 3RP8A 3AE1A 4H4YA 2GH5A 4B67A 1JRXA 4Z24A 1E1MA 1COYA 2C73A 5CQFA 1PBBA 1GRGA 5C3JA 4AOXA 1H7WA 2BK5A 3REDA 2E4GA 4BV6A 2VVLG 3AYLA 3AD8B 1E1KA 1F6MA 2DKHA 4K22A 3CTYA 4U8PA 3CPHG 1W4XA 3QVPA 4TLXA 4C3YA 2WU5A 4C3XA 1CBOA 1Q1WA 3K7MX 3URHA 2X8GA 3EANA 5KVHA 4J36A 4TLZA 3NTAA 4K8DA 2ZZCA 2YLWA 3AD7B 3AEBA 3G5RA 2PHHA 2WU2A 1JRZA 2R45A 3I6DA 4PAAA 4Z2RA 2BRAA 3K7TA 2YG7A 1NDAA 2GV8A 3NN0X 1FOHA 1NG4A 1D7YA 1IUTA 3D8XA 1GSNA 3Q6JA 1D7LA 4BK3A 1CHUA 3ICRA 3KA7A 1QO8A 1B37A 2CFYA 2GQFA 3CMMA 4BURA 1K0LA 3UTEA 3B6DA 2YLTA 4TM4A 4EQWA 3VRBA 3NYCA 5IQ4A 2WP9A 3ISHA 1NAAA 4OPGA 1QLBA 1TDEA 5HY5A 1Q1RA 1LV0A 2C65A 3QSSA 1PBFA 2X3NA 3SM8A 4NWZA 2C67A 1Y56B 3ATQA 4B69A 3CNSA 2OA1A 4P9SA 4EMIA 4REKA 3II4A 2WETA 3L1RA 4XXGA 5HHFA 1FECA 4JNAA 3HYWA 3GRSA 1CC2A 1RP0A 1GXFA 5FMHA 3ADAB 1OJTA 2WS3A 3FIMB 3GYJA 3DJGX 3UOXA 4Z25A 3AE7A 4Z44A 4BJZA 4H4WA 5L46A 1TDOA 1LTXR 1RSGA 2B7RA 2GAGB 2QCUA 1MXTA 2JKCA 1ONFA 2A89A 3CNJA 4FK1C 1LQUA 2Y6QA 2GMHA 3GWDA 3UOYA 3ATRA 3AEEA 3DJDA 3GDPA 2Q7VA 3GYIA 4YKFA 1GETA 4AP1A 3HYVA 3O0HA 2BXRA 3UTFA 3QFBA 4K2XA 1OJAA 5KMQA 3KVEA 4H4RA 4YSZA 1IUWA 4JNQA 5KMRA 3GMBA 2YLXA 3GD4A 3T0KA 1N4WA 4EMWA 3NYFA 4OPLA 4GDPA 4B64A 2YR6A 4K5RA 5JCNA 5C2TA 4YXDA 5BVAA 2PYXA 4FX9A 3NT6A 3AYIA 4O5QA 3VR9A 1NG3A 2GB0A 2W0HA 3GWFA 1GTHA 3ICTA 5KVIA 1CL0A 4KX6A 2XLUA 4A65A 2ZBWA 4IVMB 2C75A 4UDQA 2V5ZA 4NEVA 3H4KA 1D4EA 1GRBA 4GCMA 4YSHA 2WPCA 2RGJA 3CGCA 2XFOA 3AYJA 3LOVA 4YT0A 4Z43A 1QJDA 3IF9A 3AE3A 1N1PA 4J33A 5GSNA 4CRTA 4MJWA 3SZFA 3L8KA 2XCGA 3UKFA 1VDCA 1K0IA 3ICSA 3M12A 1ZOYA 1E1LA 1XHCA 2C72A 4H2QA 4EMJA 1BWCA 1PXCA 1CJ2A 2AAQA 1PXBA 4OCGA 4C77A 3SXIA 2RGOA 3V3OA 2Z5YA 1GNDA 5KMPA 4DGKA 3UKQA 1DOEA 1ELIA 1VG9A 4TM0A 4EQXA 2Q6UA 1B4VA 2V3AA 2GR3A 1GERA 4X4JA 2GAHB 1H86A 3LXDA 3BHKA 1GV4A 2R46A 4Z26A 4U8IA 4H4XA 5EBKA 4Y4MA 1NHRA 1OJCA 4RSLA 1LQTA 2IIDA 1O94A 1B5QA 1EL5A 2NVKX 3NNEA 1IJHA 2Y6RA 3NRNA 1GTEA 4YKGA 2VQ7A 3AEAA 2WP6A 1M6IA 3CNTA 3DK9A 4JQ9A 3ALLA 2J3NA 1ZDLA 1IUSA 4A7AA 2OAMA 2WDVA 4AT2A 2VRLA 1GT8A 3BI5A 1F3PA 4GF7A 4A79A 1K0JA 2YG4A 2WDRA 3UKLA 1KNRA 2WQYA 3ITJA 2OLOA 3G5QA 3RNMA 5J60A 2YWLA 1VQWA 4PABA 2E5VA 2GR2A 5DBJA 5GRTA 4EM4A 3AEFA 4NTCA 4KPRA 3UKPA 2VQBA 1KFYA 2AQJA 1VG0A 3FG2P 4ZCCA 2XVIA 2C7GA 3CNPA 1PBDA 1L9EA 3T2ZA 3IHGA 2IVDA 2CVJA 2A8XA 3G5SA 1S2QA 3FMWA 2WOVA 4CCQA 3S61A 3P4SA 2YR4A 1LVLA 2BRYA 5FS7A 1GALA 3UCLA 1YQ4A 4JDRA 2YM1A 1L0VA 2YVFA 4HB9A 4APNA 2BA9A 2V3BA 5JCLA 3CGDA 1KF6A 3IC9A 4YTPA 4UP3A 3DMEA 4U8LA 4Z2UA 4OVIA 1PHHA 2QA1A 1MO9A 2O9ZA 3AECA 2YM2A 1NHQA 1HYUA 2R4EA 3CPJG 1F8WA 3T37A 2C4CA 3NHOX 4YSYA
chains in the Genus database with same CATH topology
4DSGA 2UZZA 2XFUA 1CC4A 3DGZA 2R0PA 4IA5A 2QA2A 4H4QA 1ZX9A 1FCDA 3AD9B 3AE6A 4WCTA 5M0ZA 2FJEA 2Q0KA 4CY8A 5HXIA 2BS3A 2VOUA 3F8DA 2ACZA 1XANA 1PDHA 1BF3A 4OPCA 1TDFA 1N4VA 4H4ZA 2VVLA 4WX1A 1KSSA 5BULA 1REOA 4IVOB 4EIQA 1EL8A 2A87A 3QFAA 3CN8A 1FEAA 4J34A 1ZMCA 3RP7A 3P4RA 1E1NA 3SQPA 1LPFA 3VRDB 4LU6A 3T2YA 5KWFA 4NZHA 3NK1X 1IUUA 3R9UA 1KDGA 5HYMA 1Y56A 5EB4A 2B76A 4AP3A 4CBQA 3M0OA 4J56A 3LJPA 2EQ8A 3AEDA 2TMDA 3K7QX 3NKSA 2BCGG 3UKKA 1EBDA 3NLCA 1GRAA 4U2TA 1D4CA 5FS8A 3UTGA 1DODA 2VRMA 1OJDA 3P1WA 3EF6A 1E7PA 1VRQB 2OALA 3AEGA 1FEBA 3KPFA 4II3A 4GDEA 3BI2A 4H4VA 3ALJA 4YTNA 1S3EA 2JAEA 4GAVA 2B9YA 3GDNA 3F8RA 3BI4A 2H89A 4J2WA 4K7ZA 5M10A 1H7XA 2GEWA 3CNDA 1JNZA 3NTDA 4E0VA 3DH9A 3RHAA 4LIIA 1GRHA 2NPXA 4H4TA 1TDKA 4JN9A 3SFEA 3I3LA 4H2NA 2WPFA 2GRTA 2X8CA 4Z2TA 4GUVA 1BZLA 1MOKA 1ZMDA 4FDCB 2BACA 1E6EA 4NNJA 2YVJA 3VRAA 4D03A 4U8JA 2FJAA 1UKVG 1ZKQA 4ZN0A 4B66A 5JCIA 2JB1A 1PN0A 3DJJA 2BK3A 3QSMA 2YAUA 3UP5A 2YLZA 1H83A 1NHPA 4XWRA 3UOVA 3NN6X 3ZYXA 3P4PA 1GEUA 4EIPA 4ECHA 3CGBA 3BNUA 3C4AA 4I59A 4A9WA 2XFNA 4X9MA 1L9CA 3AE4A 3BNMA 4U8KA 2YG5A 1SEZA 2EQ7A 3DK8A 4UDRA 1TYPA 3SZWA 1ZOVA 2XDOA 2XLSA 1XDIA 2HQMA 4GR1A 3UOZA 1TYTA 2B9WA 5KOXA 4H2PA 4H7UA 2ARDA 2XLTA 4YSXA 2JK6A 2XLRA 4G6HA 3FPZA 4HA6A 4Y4NA 2R0CA 3B3RA 1D4DA 2H88A 3V3NA 4OPDA 4B65A 2C70A 4H4SA 3CPIG 5FS6A 5TR3A 4C74A 2C3DA 2C64A 3UKAA 5KOWA 2XVEA 4BJYA 4LA1A 2YR5A 4EM3A 4NTEA 2X8HA 4TM3A 4CNJA 1CJ3A 1H82A 3EPTA 2RABA 2XFQA 3CIRA 1TDNA 1Y0PA 2X50A 3NK2X 2EQ6A 2YLRA 1FL2A 3T2KA 2E1MA 2BS4A 4AOSA 3UKHA 4B68A 4B63A 2BCPA 4M52A 1L9DA 5EOWA 1DJNA 3DA1A 5IPYA 5U1OA 3P9UA 3BHFA 3K30A 1X31B 3GSIA 1AOGA 1F8SA 2GR0A 1YKJA 2RGHA 1CJ4A 1KNPA 3GD3A 3OC4A 1Z6LA 3NG7X 4FK1A 3VQRA 3NGCX 4USRA 2DKIA 3KPKA 3C4NA 5FS9A 1CF3A 4AT0A 4ADWA 1YY5A 1PJ6A 4U8MA 3SY4A 1TRBA 3OZ2A 1D5TA 2B7SA 4TM1A 5KNLA 3QSEA 1GREA 1EL7A 2VVMA 3NYEA 1ZK7A 3RP6A 4ICYA 2YG6A 2XVFA 4H4UA 4J57A 3SZCA 3F8PA 4USQA 2WPEA 3AB1A 2JB3A 4BK1A 2GQWA 2WHDA 3DJEA 5JCMA 1BGJA 4I58A 3IHMA 2BC0A 4K5SA 4CNKA 1PBEA 2X99A 3IWAA 1BKWA 3AXBA 2BS2A 1JOAA 4NTDA 1H6VA 1DNCA 2WEUA 2APGA 1DJQA 5JCKA 2JB2A 1H84A 4IA6A 1ZY8A 4YWOA 1CC6A 1LJ1A 3GRTA 2OLNA 1P2HA 4CY6A 2GR1A 1GRFA 5KRQA 5KXJA 1O5WA 2YLSA 1JRYA 1JNRA 1GESA 2YQUA 3UTHA 1P2EA 4BK2A 4A6NB 3LADA 4RG3A 4RG4A 2R4JA 2BC1A 2WESA 4CCRA 1GRTA 2IVEA 2F5ZA 3Q9TA 4JY3A 2GVCA 3H8LA 5EB5A 2FJDA 4G9KA 4EQRA 1O95A 4D04A 1NENA 3DGHA 2GMJA 4U8OA 3PVCA 2C3CA 1DOCA 1EL9A 4JY2A 3P4QA 2TPRA 3QJ4A 3FBSA 4YTMA 3H8IA 4N9XA 5U63A 3SX6A 3T31A 3PS9A 3LZWA 3NIXA 3E1TA 1NHSA 4O5UA 3SZ0A 5BRTA 4U8NA 2XVJA 4GAPA 2V60A 3AE8A 1Q9IA 1ZP0A 2R9ZA 4A5LA 3EAOA 3GMCA 1KSUA 2WOWA 3LZXA 2XFPA 3VR8A 5KMSA 1PS9A 1N4UA 2C66A 3AE9A 4DSHA 3KLJA 3D1CA 3ABVA 2I0ZA 5IQ1A 2FBWA 1S3BA 1YQZA 4OPTA 5LV9A 3HZLA 5J7XA 1IUVA 2V61A 1XPQA 4J31A 3SYIA 1PJ7A 3C96A 1B8SA 3T14A 1S2YA 4B1BA 4ZCDA 2JBVA 2YVGA 3COXA 4NEWA 2BYBA 3WE0A 4G6GA 2VZ2A 2WP5A 2Q0LA 2XVHA 3SGLA 2C76A 2BXSA 3NH3X 3UP4A 4U2SA 3ZDNA 3V76A 2CDUA 4Y4LA 1NEKA 2GF3A 3AWIA 4UDPA 5BUKA 2CULA 1F8RA 2Z5XA 3QVRA 3KKJA 4II2A 3SFDA 1DXLA 2QAEA 4H4PA 3JSKA 1GOSA 3DK4A 3S5WA 1BGNA 3CGEA 1PXAA 4U2LA 4G73A 3AE5A 3HYXA 4EQSA 2R0GA 4A6NA 4H50A 4A99A 1IUXA 1PBCA 4C5OA 1RYIA 1CJCA 1YQ3A 3ALMA 4G74A 1NPXA 1OJ9A 2XYOA 2XLPA 3LB8A 1JU2A 4OPIA 3KD9A 4GRTA 2BK4A 1JEHA 4X9NA 5ER0A 4H2RA 2EQ9A 2YG3A 2ZZBA 2B9XA 2ZZ0A 1GPEA 1V59A 2BABA 1DOBA 3M13A 2WDQA 4XWZA 4IV9A 1H81A 3PO7A 2V6OA 4OPUA 2WOIA 3NK0X 2WBAA 5CKUA 1K4QA 2AR8A 1PJ5A 1E39A 1M64A 3KU9A 3AE2A 3GYXA 2FJBA 5U25A 4DNAA 3RP8A 3AE1A 4H4YA 2GH5A 4B67A 1JRXA 4Z24A 1E1MA 1COYA 2C73A 5CQFA 1PBBA 1GRGA 5C3JA 4AOXA 1H7WA 2BK5A 3REDA 2E4GA 4BV6A 2VVLG 3AYLA 3AD8B 1E1KA 1F6MA 2DKHA 4K22A 3CTYA 4U8PA 3CPHG 1W4XA 3QVPA 4TLXA 4C3YA 2WU5A 4C3XA 1CBOA 1Q1WA 3K7MX 3URHA 2X8GA 3EANA 5KVHA 4J36A 4TLZA 3NTAA 4K8DA 2ZZCA 2YLWA 3AD7B 3AEBA 3G5RA 2PHHA 2WU2A 1JRZA 2R45A 3I6DA 4PAAA 4Z2RA 2BRAA 3K7TA 2YG7A 1NDAA 2GV8A 3NN0X 1FOHA 1NG4A 1D7YA 1IUTA 3D8XA 1GSNA 3Q6JA 1D7LA 4BK3A 1CHUA 3ICRA 3KA7A 1QO8A 1B37A 2CFYA 2GQFA 3CMMA 4BURA 1K0LA 3UTEA 3B6DA 2YLTA 4TM4A 4EQWA 3VRBA 3NYCA 5IQ4A 2WP9A 3ISHA 1NAAA 4OPGA 1QLBA 1TDEA 5HY5A 1Q1RA 1LV0A 2C65A 3QSSA 1PBFA 2X3NA 3SM8A 4NWZA 2C67A 1Y56B 3ATQA 4B69A 3CNSA 2OA1A 4P9SA 4EMIA 4REKA 3II4A 2WETA 3L1RA 4XXGA 5HHFA 1FECA 4JNAA 3HYWA 3GRSA 1CC2A 1RP0A 1GXFA 5FMHA 3ADAB 1OJTA 2WS3A 3FIMB 3GYJA 3DJGX 3UOXA 4Z25A 3AE7A 4Z44A 4BJZA 4H4WA 5L46A 1TDOA 1LTXR 1RSGA 2B7RA 2GAGB 2QCUA 1MXTA 2JKCA 1ONFA 2A89A 3CNJA 4FK1C 1LQUA 2Y6QA 2GMHA 3GWDA 3UOYA 3ATRA 3AEEA 3DJDA 3GDPA 2Q7VA 3GYIA 4YKFA 1GETA 4AP1A 3HYVA 3O0HA 2BXRA 3UTFA 3QFBA 4K2XA 1OJAA 5KMQA 3KVEA 4H4RA 4YSZA 1IUWA 4JNQA 5KMRA 3GMBA 2YLXA 3GD4A 3T0KA 1N4WA 4EMWA 3NYFA 4OPLA 4GDPA 4B64A 2YR6A 4K5RA 5JCNA 5C2TA 4YXDA 5BVAA 2PYXA 4FX9A 3NT6A 3AYIA 4O5QA 3VR9A 1NG3A 2GB0A 2W0HA 3GWFA 1GTHA 3ICTA 5KVIA 1CL0A 4KX6A 2XLUA 4A65A 2ZBWA 4IVMB 2C75A 4UDQA 2V5ZA 4NEVA 3H4KA 1D4EA 1GRBA 4GCMA 4YSHA 2WPCA 2RGJA 3CGCA 2XFOA 3AYJA 3LOVA 4YT0A 4Z43A 1QJDA 3IF9A 3AE3A 1N1PA 4J33A 5GSNA 4CRTA 4MJWA 3SZFA 3L8KA 2XCGA 3UKFA 1VDCA 1K0IA 3ICSA 3M12A 1ZOYA 1E1LA 1XHCA 2C72A 4H2QA 4EMJA 1BWCA 1PXCA 1CJ2A 2AAQA 1PXBA 4OCGA 4C77A 3SXIA 2RGOA 3V3OA 2Z5YA 1GNDA 5KMPA 4DGKA 3UKQA 1DOEA 1ELIA 1VG9A 4TM0A 4EQXA 2Q6UA 1B4VA 2V3AA 2GR3A 1GERA 4X4JA 2GAHB 1H86A 3LXDA 3BHKA 1GV4A 2R46A 4Z26A 4U8IA 4H4XA 5EBKA 4Y4MA 1NHRA 1OJCA 4RSLA 1LQTA 2IIDA 1O94A 1B5QA 1EL5A 2NVKX 3NNEA 1IJHA 2Y6RA 3NRNA 1GTEA 4YKGA 2VQ7A 3AEAA 2WP6A 1M6IA 3CNTA 3DK9A 4JQ9A 3ALLA 2J3NA 1ZDLA 1IUSA 4A7AA 2OAMA 2WDVA 4AT2A 2VRLA 1GT8A 3BI5A 1F3PA 4GF7A 4A79A 1K0JA 2YG4A 2WDRA 3UKLA 1KNRA 2WQYA 3ITJA 2OLOA 3G5QA 3RNMA 5J60A 2YWLA 1VQWA 4PABA 2E5VA 2GR2A 5DBJA 5GRTA 4EM4A 3AEFA 4NTCA 4KPRA 3UKPA 2VQBA 1KFYA 2AQJA 1VG0A 3FG2P 4ZCCA 2XVIA 2C7GA 3CNPA 1PBDA 1L9EA 3T2ZA 3IHGA 2IVDA 2CVJA 2A8XA 3G5SA 1S2QA 3FMWA 2WOVA 4CCQA 3S61A 3P4SA 2YR4A 1LVLA 2BRYA 5FS7A 1GALA 3UCLA 1YQ4A 4JDRA 2YM1A 1L0VA 2YVFA 4HB9A 4APNA 2BA9A 2V3BA 5JCLA 3CGDA 1KF6A 3IC9A 4YTPA 4UP3A 3DMEA 4U8LA 4Z2UA 4OVIA 1PHHA 2QA1A 1MO9A 2O9ZA 3AECA 2YM2A 1NHQA 1HYUA 2R4EA 3CPJG 1F8WA 3T37A 2C4CA 3NHOX 4YSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSG A;  2UZZ A;  2XFU A;  1CC4 A;  3DGZ A;  2R0P A;  4IA5 A;  2QA2 A;  1ZX9 A;  1FCD A;  3AD9 B;  3AE6 A;  4WCT A;  5M0Z A;  2FJE A;  2Q0K A;  4CY8 A;  5HXI A;  2BS3 A;  2VOU A;  3F8D A;  2ACZ A;  1XAN A;  1PDH A;  1BF3 A;  4OPC A;  1TDF A;  1N4V A;  4H4Z A;  2VVL A;  4WX1 A;  1KSS A;  5BUL A;  1REO A;  4IVO B;  4EIQ A;  1EL8 A;  2A87 A;  3QFA A;  3CN8 A;  1FEA A;  4J34 A;  1ZMC A;  3RP7 A;  3P4R A;  1E1N A;  3SQP A;  1LPF A;  3VRD B;  4LU6 A;  5KWF A;  4NZH A;  3NK1 X;  1IUU A;  3R9U A;  1KDG A;  5HYM A;  1Y56 A;  5EB4 A;  2B76 A;  4AP3 A;  4CBQ A;  3M0O A;  4J56 A;  3LJP A;  2EQ8 A;  3AED A;  2TMD A;  3K7Q X;  3NKS A;  2BCG G;  3UKK A;  1EBD A;  3NLC A;  1GRA A;  4U2T A;  1D4C A;  5FS8 A;  3UTG A;  1DOD A;  2VRM A;  1OJD A;  3P1W A;  3EF6 A;  1E7P A;  1VRQ B;  2OAL A;  3AEG A;  1FEB A;  3KPF A;  4GDE A;  3BI2 A;  4H4V A;  3ALJ A;  4YTN A;  1S3E A;  2JAE A;  4J2W A;  2B9Y A;  3GDN A;  3F8R A;  3BI4 A;  2H89 A;  4K7Z A;  5M10 A;  1H7X A;  2GEW A;  3CND A;  1JNZ A;  3NTD A;  4E0V A;  3DH9 A;  3RHA A;  4LII A;  1GRH A;  2NPX A;  4H4T A;  1TDK A;  4JN9 A;  3SFE A;  3I3L A;  4H2N A;  2WPF A;  2GRT A;  2X8C A;  4Z2T A;  4GUV A;  1BZL A;  1MOK A;  1ZMD A;  4FDC B;  2BAC A;  1E6E A;  2YVJ A;  3VRA A;  4D03 A;  4U8J A;  2FJA A;  1UKV G;  1ZKQ A;  4ZN0 A;  4B66 A;  5JCI A;  2JB1 A;  1PN0 A;  3DJJ A;  2BK3 A;  3QSM A;  2YAU A;  3UP5 A;  2YLZ A;  1H83 A;  1NHP A;  4XWR A;  3UOV A;  3NN6 X;  3ZYX A;  3P4P A;  1GEU A;  4EIP A;  4ECH A;  3CGB A;  3BNU A;  3C4A A;  4I59 A;  4A9W A;  2XFN A;  4X9M A;  1L9C A;  3AE4 A;  3BNM A;  4U8K A;  2YG5 A;  1SEZ A;  2EQ7 A;  3DK8 A;  4UDR A;  1TYP A;  1ZOV A;  2XDO A;  2XLS A;  1XDI A;  2HQM A;  4GR1 A;  3UOZ A;  1TYT A;  2B9W A;  5KOX A;  4H2P A;  4H7U A;  2ARD A;  2XLT A;  4YSX A;  2JK6 A;  2XLR A;  3FPZ A;  4HA6 A;  4Y4N A;  2R0C A;  3B3R A;  1D4D A;  2H88 A;  3V3N A;  4OPD A;  4B65 A;  2C70 A;  4H4S A;  3CPI G;  5FS6 A;  5TR3 A;  4C74 A;  2C3D A;  2C64 A;  3UKA A;  5KOW A;  2XVE A;  4BJY A;  4LA1 A;  2YR5 A;  4EM3 A;  4NTE A;  2X8H A;  4TM3 A;  4CNJ A;  1CJ3 A;  1H82 A;  3EPT A;  2RAB A;  2XFQ A;  3CIR A;  1TDN A;  1Y0P A;  2X50 A;  3NK2 X;  2EQ6 A;  2YLR A;  1FL2 A;  2E1M A;  2BS4 A;  4AOS A;  3UKH A;  4B68 A;  4B63 A;  2BCP A;  4M52 A;  1L9D A;  5EOW A;  1DJN A;  3DA1 A;  5IPY A;  5U1O A;  3P9U A;  3BHF A;  3K30 A;  1X31 B;  3GSI A;  1AOG A;  1F8S A;  2GR0 A;  1YKJ A;  2RGH A;  1CJ4 A;  1KNP A;  3GD3 A;  3OC4 A;  1Z6L A;  3NG7 X;  4FK1 A;  3VQR A;  3NGC X;  4USR A;  2DKI A;  3C4N A;  5FS9 A;  1CF3 A;  4AT0 A;  4ADW A;  1YY5 A;  1PJ6 A;  4U8M A;  1TRB A;  3OZ2 A;  1D5T A;  2B7S A;  4TM1 A;  3QSE A;  1GRE A;  1EL7 A;  2VVM A;  3NYE A;  1ZK7 A;  3RP6 A;  4ICY A;  2YG6 A;  2XVF A;  4H4U A;  4J57 A;  3F8P A;  4USQ A;  2WPE A;  3AB1 A;  2JB3 A;  4BK1 A;  2GQW A;  2WHD A;  3DJE A;  5JCM A;  1BGJ A;  4I58 A;  3IHM A;  2BC0 A;  4K5S A;  4CNK A;  1PBE A;  2X99 A;  3IWA A;  1BKW A;  3AXB A;  2BS2 A;  1JOA A;  4NTD A;  1H6V A;  1DNC A;  2WEU A;  2APG A;  1DJQ A;  5JCK A;  2JB2 A;  1H84 A;  4IA6 A;  1ZY8 A;  4YWO A;  1CC6 A;  1LJ1 A;  3GRT A;  2OLN A;  1P2H A;  4CY6 A;  2GR1 A;  1GRF A;  5KRQ A;  5KXJ A;  1O5W A;  2YLS A;  1JRY A;  1JNR A;  1GES A;  2YQU A;  3UTH A;  1P2E A;  4BK2 A;  4A6N B;  3LAD A;  4RG3 A;  4RG4 A;  2R4J A;  2BC1 A;  2WES A;  4CCR A;  1GRT A;  2IVE A;  2F5Z A;  3Q9T A;  4JY3 A;  2GVC A;  3H8L A;  5EB5 A;  2FJD A;  4EQR A;  1O95 A;  4D04 A;  1NEN A;  3DGH A;  2GMJ A;  4U8O A;  3PVC A;  2C3C A;  1DOC A;  1EL9 A;  4JY2 A;  3P4Q A;  2TPR A;  3QJ4 A;  3FBS A;  4YTM A;  3H8I A;  4N9X A;  5U63 A;  3PS9 A;  3LZW A;  3NIX A;  3E1T A;  1NHS A;  4O5U A;  5BRT A;  4U8N A;  2XVJ A;  2V60 A;  3AE8 A;  1Q9I A;  1ZP0 A;  2R9Z A;  4A5L A;  3EAO A;  3GMC A;  1KSU A;  2WOW A;  3LZX A;  2XFP A;  3VR8 A;  1PS9 A;  1N4U A;  2C66 A;  3AE9 A;  4DSH A;  3KLJ A;  3D1C A;  3ABV A;  2I0Z A;  5IQ1 A;  2FBW A;  1S3B A;  1YQZ A;  4OPT A;  5LV9 A;  3HZL A;  5J7X A;  1IUV A;  2V61 A;  1XPQ A;  4J31 A;  1PJ7 A;  3C96 A;  1B8S A;  1S2Y A;  4B1B A;  4ZCD A;  2JBV A;  2YVG A;  3COX A;  4NEW A;  2BYB A;  3WE0 A;  2VZ2 A;  2WP5 A;  2Q0L A;  2XVH A;  3SGL A;  2C76 A;  2BXS A;  3NH3 X;  3UP4 A;  4U2S A;  3ZDN A;  3V76 A;  2CDU A;  4Y4L A;  1NEK A;  2GF3 A;  3AWI A;  4UDP A;  5BUK A;  2CUL A;  1F8R A;  2Z5X A;  3QVR A;  3KKJ A;  3SFD A;  1DXL A;  2QAE A;  4H4P A;  3JSK A;  1GOS A;  3DK4 A;  3S5W A;  1BGN A;  3CGE A;  1PXA A;  4U2L A;  3AE5 A;  4EQS A;  2R0G A;  4A6N A;  4H50 A;  4A99 A;  1IUX A;  1PBC A;  4C5O A;  1RYI A;  1CJC A;  1YQ3 A;  3ALM A;  1NPX A;  1OJ9 A;  2XYO A;  2XLP A;  3LB8 A;  1JU2 A;  4OPI A;  3KD9 A;  4GRT A;  2BK4 A;  1JEH A;  4X9N A;  5ER0 A;  4H2R A;  2EQ9 A;  2YG3 A;  2ZZB A;  2B9X A;  2ZZ0 A;  1GPE A;  1V59 A;  2BAB A;  1DOB A;  3M13 A;  2WDQ A;  4XWZ A;  4IV9 A;  1H81 A;  3PO7 A;  2V6O A;  4OPU A;  2WOI A;  3NK0 X;  2WBA A;  5CKU A;  1K4Q A;  2AR8 A;  1PJ5 A;  1E39 A;  1M64 A;  3KU9 A;  3AE2 A;  2FJB A;  5U25 A;  4DNA A;  3RP8 A;  3AE1 A;  4H4Y A;  2GH5 A;  4B67 A;  1JRX A;  4Z24 A;  1E1M A;  1COY A;  2C73 A;  5CQF A;  1PBB A;  1GRG A;  5C3J A;  4AOX A;  1H7W A;  2BK5 A;  3RED A;  2E4G A;  4BV6 A;  2VVL G;  3AYL A;  3AD8 B;  1E1K A;  1F6M A;  2DKH A;  4K22 A;  3CTY A;  4U8P A;  3CPH G;  1W4X A;  3QVP A;  4TLX A;  4C3Y A;  2WU5 A;  4C3X A;  1CBO A;  1Q1W A;  3K7M X;  3URH A;  2X8G A;  3EAN A;  5KVH A;  4J36 A;  4TLZ A;  3NTA A;  4K8D A;  2ZZC A;  2YLW A;  3AD7 B;  3AEB A;  3G5R A;  2PHH A;  2WU2 A;  1JRZ A;  2R45 A;  3I6D A;  4PAA A;  4Z2R A;  3K7T A;  2YG7 A;  1NDA A;  2GV8 A;  3NN0 X;  1FOH A;  1NG4 A;  1D7Y A;  1IUT A;  3D8X A;  1GSN A;  3Q6J A;  1D7L A;  4BK3 A;  1CHU A;  3ICR A;  3KA7 A;  1QO8 A;  1B37 A;  2CFY A;  2GQF A;  4BUR A;  1K0L A;  3UTE A;  3B6D A;  2YLT A;  4TM4 A;  4EQW A;  3VRB A;  3NYC A;  5IQ4 A;  2WP9 A;  3ISH A;  1NAA A;  4OPG A;  1QLB A;  1TDE A;  5HY5 A;  1Q1R A;  1LV0 A;  2C65 A;  3QSS A;  1PBF A;  2X3N A;  3SM8 A;  2C67 A;  1Y56 B;  3ATQ A;  4B69 A;  3CNS A;  2OA1 A;  4P9S A;  4EMI A;  4REK A;  3II4 A;  2WET A;  3L1R A;  4XXG A;  5HHF A;  1FEC A;  4JNA A;  3GRS A;  1CC2 A;  1RP0 A;  1GXF A;  5FMH A;  3ADA B;  1OJT A;  2WS3 A;  3FIM B;  3GYJ A;  3DJG X;  3UOX A;  4Z25 A;  3AE7 A;  4Z44 A;  4BJZ A;  4H4W A;  5L46 A;  1TDO A;  1LTX R;  1RSG A;  2B7R A;  2GAG B;  2QCU A;  1MXT A;  2JKC A;  1ONF A;  2A89 A;  3CNJ A;  4FK1 C;  1LQU A;  2Y6Q A;  2GMH A;  3GWD A;  3UOY A;  3ATR A;  3AEE A;  3DJD A;  3GDP A;  2Q7V A;  3GYI A;  4YKF A;  1GET A;  4AP1 A;  3O0H A;  2BXR A;  3UTF A;  3QFB A;  4K2X A;  1OJA A;  3KVE A;  4H4R A;  4YSZ A;  1IUW A;  4JNQ A;  3GMB A;  2YLX A;  3GD4 A;  1N4W A;  4EMW A;  3NYF A;  4OPL A;  4GDP A;  4B64 A;  2YR6 A;  4K5R A;  5JCN A;  5C2T A;  4YXD A;  5BVA A;  2PYX A;  4FX9 A;  3NT6 A;  3AYI A;  4O5Q A;  3VR9 A;  1NG3 A;  2GB0 A;  2W0H A;  3GWF A;  1GTH A;  3ICT A;  5KVI A;  1CL0 A;  4KX6 A;  2XLU A;  4A65 A;  2ZBW A;  4IVM B;  2C75 A;  4UDQ A;  2V5Z A;  4NEV A;  3H4K A;  1D4E A;  1GRB A;  4GCM A;  4YSH A;  2WPC A;  2RGJ A;  3CGC A;  2XFO A;  3AYJ A;  3LOV A;  4YT0 A;  4Z43 A;  1QJD A;  3IF9 A;  3AE3 A;  1N1P A;  4J33 A;  5GSN A;  4CRT A;  4MJW A;  3L8K A;  2XCG A;  3UKF A;  1VDC A;  1K0I A;  3ICS A;  3M12 A;  1ZOY A;  1E1L A;  1XHC A;  2C72 A;  4H2Q A;  4EMJ A;  1BWC A;  1PXC A;  1CJ2 A;  2AAQ A;  1PXB A;  4OCG A;  4C77 A;  2RGO A;  3V3O A;  2Z5Y A;  1GND A;  4DGK A;  3UKQ A;  1DOE A;  1ELI A;  1VG9 A;  4TM0 A;  4EQX A;  2Q6U A;  1B4V A;  2V3A A;  2GR3 A;  1GER A;  4X4J A;  2GAH B;  1H86 A;  3LXD A;  3BHK A;  1GV4 A;  2R46 A;  4Z26 A;  4U8I A;  4H4X A;  5EBK A;  4Y4M A;  1NHR A;  1OJC A;  4RSL A;  1LQT A;  2IID A;  1O94 A;  1B5Q A;  1EL5 A;  2NVK X;  3NNE A;  1IJH A;  2Y6R A;  3NRN A;  1GTE A;  4YKG A;  2VQ7 A;  3AEA A;  2WP6 A;  1M6I A;  3CNT A;  3DK9 A;  4JQ9 A;  3ALL A;  2J3N A;  1ZDL A;  1IUS A;  4A7A A;  2OAM A;  2WDV A;  4AT2 A;  2VRL A;  1GT8 A;  3BI5 A;  1F3P A;  4GF7 A;  4A79 A;  1K0J A;  2YG4 A;  2WDR A;  3UKL A;  1KNR A;  2WQY A;  3ITJ A;  2OLO A;  3G5Q A;  3RNM A;  5J60 A;  2YWL A;  1VQW A;  4PAB A;  2E5V A;  2GR2 A;  5DBJ A;  5GRT A;  4EM4 A;  3AEF A;  4NTC A;  4KPR A;  3UKP A;  2VQB A;  1KFY A;  2AQJ A;  1VG0 A;  3FG2 P;  4ZCC A;  2XVI A;  2C7G A;  3CNP A;  1PBD A;  1L9E A;  3IHG A;  2IVD A;  2CVJ A;  2A8X A;  3G5S A;  1S2Q A;  3FMW A;  2WOV A;  4CCQ A;  3S61 A;  3P4S A;  2YR4 A;  1LVL A;  5FS7 A;  1GAL A;  3UCL A;  1YQ4 A;  4JDR A;  2YM1 A;  1L0V A;  2YVF A;  4HB9 A;  4APN A;  2BA9 A;  2V3B A;  5JCL A;  3CGD A;  1KF6 A;  3IC9 A;  4YTP A;  4UP3 A;  3DME A;  4U8L A;  4Z2U A;  4OVI A;  1PHH A;  2QA1 A;  1MO9 A;  2O9Z A;  3AEC A;  2YM2 A;  1NHQ A;  1HYU A;  2R4E A;  3CPJ G;  1F8W A;  3T37 A;  4H4Q A;  3NHO X;  4YSY A; 
#chains in the Genus database with same CATH topology
 4DSG A;  2UZZ A;  2XFU A;  1CC4 A;  3DGZ A;  2R0P A;  4IA5 A;  2QA2 A;  4H4Q A;  1ZX9 A;  1FCD A;  3AD9 B;  3AE6 A;  4WCT A;  5M0Z A;  2FJE A;  2Q0K A;  4CY8 A;  5HXI A;  2BS3 A;  2VOU A;  3F8D A;  2ACZ A;  1XAN A;  1PDH A;  1BF3 A;  4OPC A;  1TDF A;  1N4V A;  4H4Z A;  2VVL A;  4WX1 A;  1KSS A;  5BUL A;  1REO A;  4IVO B;  4EIQ A;  1EL8 A;  2A87 A;  3QFA A;  3CN8 A;  1FEA A;  4J34 A;  1ZMC A;  3RP7 A;  3P4R A;  1E1N A;  3SQP A;  1LPF A;  3VRD B;  4LU6 A;  3T2Y A;  5KWF A;  4NZH A;  3NK1 X;  1IUU A;  3R9U A;  1KDG A;  5HYM A;  1Y56 A;  5EB4 A;  2B76 A;  4AP3 A;  4CBQ A;  3M0O A;  4J56 A;  3LJP A;  2EQ8 A;  3AED A;  2TMD A;  3K7Q X;  3NKS A;  2BCG G;  3UKK A;  1EBD A;  3NLC A;  1GRA A;  4U2T A;  1D4C A;  5FS8 A;  3UTG A;  1DOD A;  2VRM A;  1OJD A;  3P1W A;  3EF6 A;  1E7P A;  1VRQ B;  2OAL A;  3AEG A;  1FEB A;  3KPF A;  4II3 A;  4GDE A;  3BI2 A;  4H4V A;  3ALJ A;  4YTN A;  1S3E A;  2JAE A;  4GAV A;  2B9Y A;  3GDN A;  3F8R A;  3BI4 A;  2H89 A;  4J2W A;  4K7Z A;  5M10 A;  1H7X A;  2GEW A;  3CND A;  1JNZ A;  3NTD A;  4E0V A;  3DH9 A;  3RHA A;  4LII A;  1GRH A;  2NPX A;  4H4T A;  1TDK A;  4JN9 A;  3SFE A;  3I3L A;  4H2N A;  2WPF A;  2GRT A;  2X8C A;  4Z2T A;  4GUV A;  1BZL A;  1MOK A;  1ZMD A;  4FDC B;  2BAC A;  1E6E A;  4NNJ A;  2YVJ A;  3VRA A;  4D03 A;  4U8J A;  2FJA A;  1UKV G;  1ZKQ A;  4ZN0 A;  4B66 A;  5JCI A;  2JB1 A;  1PN0 A;  3DJJ A;  2BK3 A;  3QSM A;  2YAU A;  3UP5 A;  2YLZ A;  1H83 A;  1NHP A;  4XWR A;  3UOV A;  3NN6 X;  3ZYX A;  3P4P A;  1GEU A;  4EIP A;  4ECH A;  3CGB A;  3BNU A;  3C4A A;  4I59 A;  4A9W A;  2XFN A;  4X9M A;  1L9C A;  3AE4 A;  3BNM A;  4U8K A;  2YG5 A;  1SEZ A;  2EQ7 A;  3DK8 A;  4UDR A;  1TYP A;  3SZW A;  1ZOV A;  2XDO A;  2XLS A;  1XDI A;  2HQM A;  4GR1 A;  3UOZ A;  1TYT A;  2B9W A;  5KOX A;  4H2P A;  4H7U A;  2ARD A;  2XLT A;  4YSX A;  2JK6 A;  2XLR A;  4G6H A;  3FPZ A;  4HA6 A;  4Y4N A;  2R0C A;  3B3R A;  1D4D A;  2H88 A;  3V3N A;  4OPD A;  4B65 A;  2C70 A;  4H4S A;  3CPI G;  5FS6 A;  5TR3 A;  4C74 A;  2C3D A;  2C64 A;  3UKA A;  5KOW A;  2XVE A;  4BJY A;  4LA1 A;  2YR5 A;  4EM3 A;  4NTE A;  2X8H A;  4TM3 A;  4CNJ A;  1CJ3 A;  1H82 A;  3EPT A;  2RAB A;  2XFQ A;  3CIR A;  1TDN A;  1Y0P A;  2X50 A;  3NK2 X;  2EQ6 A;  2YLR A;  1FL2 A;  3T2K A;  2E1M A;  2BS4 A;  4AOS A;  3UKH A;  4B68 A;  4B63 A;  2BCP A;  4M52 A;  1L9D A;  5EOW A;  1DJN A;  3DA1 A;  5IPY A;  5U1O A;  3P9U A;  3BHF A;  3K30 A;  1X31 B;  3GSI A;  1AOG A;  1F8S A;  2GR0 A;  1YKJ A;  2RGH A;  1CJ4 A;  1KNP A;  3GD3 A;  3OC4 A;  1Z6L A;  3NG7 X;  4FK1 A;  3VQR A;  3NGC X;  4USR A;  2DKI A;  3KPK A;  3C4N A;  5FS9 A;  1CF3 A;  4AT0 A;  4ADW A;  1YY5 A;  1PJ6 A;  4U8M A;  3SY4 A;  1TRB A;  3OZ2 A;  1D5T A;  2B7S A;  4TM1 A;  5KNL A;  3QSE A;  1GRE A;  1EL7 A;  2VVM A;  3NYE A;  1ZK7 A;  3RP6 A;  4ICY A;  2YG6 A;  2XVF A;  4H4U A;  4J57 A;  3SZC A;  3F8P A;  4USQ A;  2WPE A;  3AB1 A;  2JB3 A;  4BK1 A;  2GQW A;  2WHD A;  3DJE A;  5JCM A;  1BGJ A;  4I58 A;  3IHM A;  2BC0 A;  4K5S A;  4CNK A;  1PBE A;  2X99 A;  3IWA A;  1BKW A;  3AXB A;  2BS2 A;  1JOA A;  4NTD A;  1H6V A;  1DNC A;  2WEU A;  2APG A;  1DJQ A;  5JCK A;  2JB2 A;  1H84 A;  4IA6 A;  1ZY8 A;  4YWO A;  1CC6 A;  1LJ1 A;  3GRT A;  2OLN A;  1P2H A;  4CY6 A;  2GR1 A;  1GRF A;  5KRQ A;  5KXJ A;  1O5W A;  2YLS A;  1JRY A;  1JNR A;  1GES A;  2YQU A;  3UTH A;  1P2E A;  4BK2 A;  4A6N B;  3LAD A;  4RG3 A;  4RG4 A;  2R4J A;  2BC1 A;  2WES A;  4CCR A;  1GRT A;  2IVE A;  2F5Z A;  3Q9T A;  4JY3 A;  2GVC A;  3H8L A;  5EB5 A;  2FJD A;  4G9K A;  4EQR A;  1O95 A;  4D04 A;  1NEN A;  3DGH A;  2GMJ A;  4U8O A;  3PVC A;  2C3C A;  1DOC A;  1EL9 A;  4JY2 A;  3P4Q A;  2TPR A;  3QJ4 A;  3FBS A;  4YTM A;  3H8I A;  4N9X A;  5U63 A;  3SX6 A;  3T31 A;  3PS9 A;  3LZW A;  3NIX A;  3E1T A;  1NHS A;  4O5U A;  3SZ0 A;  5BRT A;  4U8N A;  2XVJ A;  4GAP A;  2V60 A;  3AE8 A;  1Q9I A;  1ZP0 A;  2R9Z A;  4A5L A;  3EAO A;  3GMC A;  1KSU A;  2WOW A;  3LZX A;  2XFP A;  3VR8 A;  5KMS A;  1PS9 A;  1N4U A;  2C66 A;  3AE9 A;  4DSH A;  3KLJ A;  3D1C A;  3ABV A;  2I0Z A;  5IQ1 A;  2FBW A;  1S3B A;  1YQZ A;  4OPT A;  5LV9 A;  3HZL A;  5J7X A;  1IUV A;  2V61 A;  1XPQ A;  4J31 A;  3SYI A;  1PJ7 A;  3C96 A;  1B8S A;  3T14 A;  1S2Y A;  4B1B A;  4ZCD A;  2JBV A;  2YVG A;  3COX A;  4NEW A;  2BYB A;  3WE0 A;  4G6G A;  2VZ2 A;  2WP5 A;  2Q0L A;  2XVH A;  3SGL A;  2C76 A;  2BXS A;  3NH3 X;  3UP4 A;  4U2S A;  3ZDN A;  3V76 A;  2CDU A;  4Y4L A;  1NEK A;  2GF3 A;  3AWI A;  4UDP A;  5BUK A;  2CUL A;  1F8R A;  2Z5X A;  3QVR A;  3KKJ A;  4II2 A;  3SFD A;  1DXL A;  2QAE A;  4H4P A;  3JSK A;  1GOS A;  3DK4 A;  3S5W A;  1BGN A;  3CGE A;  1PXA A;  4U2L A;  4G73 A;  3AE5 A;  3HYX A;  4EQS A;  2R0G A;  4A6N A;  4H50 A;  4A99 A;  1IUX A;  1PBC A;  4C5O A;  1RYI A;  1CJC A;  1YQ3 A;  3ALM A;  4G74 A;  1NPX A;  1OJ9 A;  2XYO A;  2XLP A;  3LB8 A;  1JU2 A;  4OPI A;  3KD9 A;  4GRT A;  2BK4 A;  1JEH A;  4X9N A;  5ER0 A;  4H2R A;  2EQ9 A;  2YG3 A;  2ZZB A;  2B9X A;  2ZZ0 A;  1GPE A;  1V59 A;  2BAB A;  1DOB A;  3M13 A;  2WDQ A;  4XWZ A;  4IV9 A;  1H81 A;  3PO7 A;  2V6O A;  4OPU A;  2WOI A;  3NK0 X;  2WBA A;  5CKU A;  1K4Q A;  2AR8 A;  1PJ5 A;  1E39 A;  1M64 A;  3KU9 A;  3AE2 A;  3GYX A;  2FJB A;  5U25 A;  4DNA A;  3RP8 A;  3AE1 A;  4H4Y A;  2GH5 A;  4B67 A;  1JRX A;  4Z24 A;  1E1M A;  1COY A;  2C73 A;  5CQF A;  1PBB A;  1GRG A;  5C3J A;  4AOX A;  1H7W A;  2BK5 A;  3RED A;  2E4G A;  4BV6 A;  2VVL G;  3AYL A;  3AD8 B;  1E1K A;  1F6M A;  2DKH A;  4K22 A;  3CTY A;  4U8P A;  3CPH G;  1W4X A;  3QVP A;  4TLX A;  4C3Y A;  2WU5 A;  4C3X A;  1CBO A;  1Q1W A;  3K7M X;  3URH A;  2X8G A;  3EAN A;  5KVH A;  4J36 A;  4TLZ A;  3NTA A;  4K8D A;  2ZZC A;  2YLW A;  3AD7 B;  3AEB A;  3G5R A;  2PHH A;  2WU2 A;  1JRZ A;  2R45 A;  3I6D A;  4PAA A;  4Z2R A;  2BRA A;  3K7T A;  2YG7 A;  1NDA A;  2GV8 A;  3NN0 X;  1FOH A;  1NG4 A;  1D7Y A;  1IUT A;  3D8X A;  1GSN A;  3Q6J A;  1D7L A;  4BK3 A;  1CHU A;  3ICR A;  3KA7 A;  1QO8 A;  1B37 A;  2CFY A;  2GQF A;  3CMM A;  4BUR A;  1K0L A;  3UTE A;  3B6D A;  2YLT A;  4TM4 A;  4EQW A;  3VRB A;  3NYC A;  5IQ4 A;  2WP9 A;  3ISH A;  1NAA A;  4OPG A;  1QLB A;  1TDE A;  5HY5 A;  1Q1R A;  1LV0 A;  2C65 A;  3QSS A;  1PBF A;  2X3N A;  3SM8 A;  4NWZ A;  2C67 A;  1Y56 B;  3ATQ A;  4B69 A;  3CNS A;  2OA1 A;  4P9S A;  4EMI A;  4REK A;  3II4 A;  2WET A;  3L1R A;  4XXG A;  5HHF A;  1FEC A;  4JNA A;  3HYW A;  3GRS A;  1CC2 A;  1RP0 A;  1GXF A;  5FMH A;  3ADA B;  1OJT A;  2WS3 A;  3FIM B;  3GYJ A;  3DJG X;  3UOX A;  4Z25 A;  3AE7 A;  4Z44 A;  4BJZ A;  4H4W A;  5L46 A;  1TDO A;  1LTX R;  1RSG A;  2B7R A;  2GAG B;  2QCU A;  1MXT A;  2JKC A;  1ONF A;  2A89 A;  3CNJ A;  4FK1 C;  1LQU A;  2Y6Q A;  2GMH A;  3GWD A;  3UOY A;  3ATR A;  3AEE A;  3DJD A;  3GDP A;  2Q7V A;  3GYI A;  4YKF A;  1GET A;  4AP1 A;  3HYV A;  3O0H A;  2BXR A;  3UTF A;  3QFB A;  4K2X A;  1OJA A;  5KMQ A;  3KVE A;  4H4R A;  4YSZ A;  1IUW A;  4JNQ A;  5KMR A;  3GMB A;  2YLX A;  3GD4 A;  3T0K A;  1N4W A;  4EMW A;  3NYF A;  4OPL A;  4GDP A;  4B64 A;  2YR6 A;  4K5R A;  5JCN A;  5C2T A;  4YXD A;  5BVA A;  2PYX A;  4FX9 A;  3NT6 A;  3AYI A;  4O5Q A;  3VR9 A;  1NG3 A;  2GB0 A;  2W0H A;  3GWF A;  1GTH A;  3ICT A;  5KVI A;  1CL0 A;  4KX6 A;  2XLU A;  4A65 A;  2ZBW A;  4IVM B;  2C75 A;  4UDQ A;  2V5Z A;  4NEV A;  3H4K A;  1D4E A;  1GRB A;  4GCM A;  4YSH A;  2WPC A;  2RGJ A;  3CGC A;  2XFO A;  3AYJ A;  3LOV A;  4YT0 A;  4Z43 A;  1QJD A;  3IF9 A;  3AE3 A;  1N1P A;  4J33 A;  5GSN A;  4CRT A;  4MJW A;  3SZF A;  3L8K A;  2XCG A;  3UKF A;  1VDC A;  1K0I A;  3ICS A;  3M12 A;  1ZOY A;  1E1L A;  1XHC A;  2C72 A;  4H2Q A;  4EMJ A;  1BWC A;  1PXC A;  1CJ2 A;  2AAQ A;  1PXB A;  4OCG A;  4C77 A;  3SXI A;  2RGO A;  3V3O A;  2Z5Y A;  1GND A;  5KMP A;  4DGK A;  3UKQ A;  1DOE A;  1ELI A;  1VG9 A;  4TM0 A;  4EQX A;  2Q6U A;  1B4V A;  2V3A A;  2GR3 A;  1GER A;  4X4J A;  2GAH B;  1H86 A;  3LXD A;  3BHK A;  1GV4 A;  2R46 A;  4Z26 A;  4U8I A;  4H4X A;  5EBK A;  4Y4M A;  1NHR A;  1OJC A;  4RSL A;  1LQT A;  2IID A;  1O94 A;  1B5Q A;  1EL5 A;  2NVK X;  3NNE A;  1IJH A;  2Y6R A;  3NRN A;  1GTE A;  4YKG A;  2VQ7 A;  3AEA A;  2WP6 A;  1M6I A;  3CNT A;  3DK9 A;  4JQ9 A;  3ALL A;  2J3N A;  1ZDL A;  1IUS A;  4A7A A;  2OAM A;  2WDV A;  4AT2 A;  2VRL A;  1GT8 A;  3BI5 A;  1F3P A;  4GF7 A;  4A79 A;  1K0J A;  2YG4 A;  2WDR A;  3UKL A;  1KNR A;  2WQY A;  3ITJ A;  2OLO A;  3G5Q A;  3RNM A;  5J60 A;  2YWL A;  1VQW A;  4PAB A;  2E5V A;  2GR2 A;  5DBJ A;  5GRT A;  4EM4 A;  3AEF A;  4NTC A;  4KPR A;  3UKP A;  2VQB A;  1KFY A;  2AQJ A;  1VG0 A;  3FG2 P;  4ZCC A;  2XVI A;  2C7G A;  3CNP A;  1PBD A;  1L9E A;  3T2Z A;  3IHG A;  2IVD A;  2CVJ A;  2A8X A;  3G5S A;  1S2Q A;  3FMW A;  2WOV A;  4CCQ A;  3S61 A;  3P4S A;  2YR4 A;  1LVL A;  2BRY A;  5FS7 A;  1GAL A;  3UCL A;  1YQ4 A;  4JDR A;  2YM1 A;  1L0V A;  2YVF A;  4HB9 A;  4APN A;  2BA9 A;  2V3B A;  5JCL A;  3CGD A;  1KF6 A;  3IC9 A;  4YTP A;  4UP3 A;  3DME A;  4U8L A;  4Z2U A;  4OVI A;  1PHH A;  2QA1 A;  1MO9 A;  2O9Z A;  3AEC A;  2YM2 A;  1NHQ A;  1HYU A;  2R4E A;  3CPJ G;  1F8W A;  3T37 A;  2C4C A;  3NHO X;  4YSY A; 
#chains in the Genus database with same CATH homology
 4DSG A;  2UZZ A;  2XFU A;  1CC4 A;  3DGZ A;  2R0P A;  4IA5 A;  2QA2 A;  4H4Q A;  1ZX9 A;  1FCD A;  3AD9 B;  3AE6 A;  4WCT A;  5M0Z A;  2FJE A;  2Q0K A;  4CY8 A;  5HXI A;  2BS3 A;  2VOU A;  3F8D A;  2ACZ A;  1XAN A;  1PDH A;  1BF3 A;  4OPC A;  1TDF A;  1N4V A;  4H4Z A;  2VVL A;  4WX1 A;  1KSS A;  5BUL A;  1REO A;  4IVO B;  4EIQ A;  1EL8 A;  2A87 A;  3QFA A;  3CN8 A;  1FEA A;  4J34 A;  1ZMC A;  3RP7 A;  3P4R A;  1E1N A;  3SQP A;  1LPF A;  3VRD B;  4LU6 A;  3T2Y A;  5KWF A;  4NZH A;  3NK1 X;  1IUU A;  3R9U A;  1KDG A;  5HYM A;  1Y56 A;  5EB4 A;  2B76 A;  4AP3 A;  4CBQ A;  3M0O A;  4J56 A;  3LJP A;  2EQ8 A;  3AED A;  2TMD A;  3K7Q X;  3NKS A;  2BCG G;  3UKK A;  1EBD A;  3NLC A;  1GRA A;  4U2T A;  1D4C A;  5FS8 A;  3UTG A;  1DOD A;  2VRM A;  1OJD A;  3P1W A;  3EF6 A;  1E7P A;  1VRQ B;  2OAL A;  3AEG A;  1FEB A;  3KPF A;  4II3 A;  4GDE A;  3BI2 A;  4H4V A;  3ALJ A;  4YTN A;  1S3E A;  2JAE A;  4GAV A;  2B9Y A;  3GDN A;  3F8R A;  3BI4 A;  2H89 A;  4J2W A;  4K7Z A;  5M10 A;  1H7X A;  2GEW A;  3CND A;  1JNZ A;  3NTD A;  4E0V A;  3DH9 A;  3RHA A;  4LII A;  1GRH A;  2NPX A;  4H4T A;  1TDK A;  4JN9 A;  3SFE A;  3I3L A;  4H2N A;  2WPF A;  2GRT A;  2X8C A;  4Z2T A;  4GUV A;  1BZL A;  1MOK A;  1ZMD A;  4FDC B;  2BAC A;  1E6E A;  4NNJ A;  2YVJ A;  3VRA A;  4D03 A;  4U8J A;  2FJA A;  1UKV G;  1ZKQ A;  4ZN0 A;  4B66 A;  5JCI A;  2JB1 A;  1PN0 A;  3DJJ A;  2BK3 A;  3QSM A;  2YAU A;  3UP5 A;  2YLZ A;  1H83 A;  1NHP A;  4XWR A;  3UOV A;  3NN6 X;  3ZYX A;  3P4P A;  1GEU A;  4EIP A;  4ECH A;  3CGB A;  3BNU A;  3C4A A;  4I59 A;  4A9W A;  2XFN A;  4X9M A;  1L9C A;  3AE4 A;  3BNM A;  4U8K A;  2YG5 A;  1SEZ A;  2EQ7 A;  3DK8 A;  4UDR A;  1TYP A;  3SZW A;  1ZOV A;  2XDO A;  2XLS A;  1XDI A;  2HQM A;  4GR1 A;  3UOZ A;  1TYT A;  2B9W A;  5KOX A;  4H2P A;  4H7U A;  2ARD A;  2XLT A;  4YSX A;  2JK6 A;  2XLR A;  4G6H A;  3FPZ A;  4HA6 A;  4Y4N A;  2R0C A;  3B3R A;  1D4D A;  2H88 A;  3V3N A;  4OPD A;  4B65 A;  2C70 A;  4H4S A;  3CPI G;  5FS6 A;  5TR3 A;  4C74 A;  2C3D A;  2C64 A;  3UKA A;  5KOW A;  2XVE A;  4BJY A;  4LA1 A;  2YR5 A;  4EM3 A;  4NTE A;  2X8H A;  4TM3 A;  4CNJ A;  1CJ3 A;  1H82 A;  3EPT A;  2RAB A;  2XFQ A;  3CIR A;  1TDN A;  1Y0P A;  2X50 A;  3NK2 X;  2EQ6 A;  2YLR A;  1FL2 A;  3T2K A;  2E1M A;  2BS4 A;  4AOS A;  3UKH A;  4B68 A;  4B63 A;  2BCP A;  4M52 A;  1L9D A;  5EOW A;  1DJN A;  3DA1 A;  5IPY A;  5U1O A;  3P9U A;  3BHF A;  3K30 A;  1X31 B;  3GSI A;  1AOG A;  1F8S A;  2GR0 A;  1YKJ A;  2RGH A;  1CJ4 A;  1KNP A;  3GD3 A;  3OC4 A;  1Z6L A;  3NG7 X;  4FK1 A;  3VQR A;  3NGC X;  4USR A;  2DKI A;  3KPK A;  3C4N A;  5FS9 A;  1CF3 A;  4AT0 A;  4ADW A;  1YY5 A;  1PJ6 A;  4U8M A;  3SY4 A;  1TRB A;  3OZ2 A;  1D5T A;  2B7S A;  4TM1 A;  5KNL A;  3QSE A;  1GRE A;  1EL7 A;  2VVM A;  3NYE A;  1ZK7 A;  3RP6 A;  4ICY A;  2YG6 A;  2XVF A;  4H4U A;  4J57 A;  3SZC A;  3F8P A;  4USQ A;  2WPE A;  3AB1 A;  2JB3 A;  4BK1 A;  2GQW A;  2WHD A;  3DJE A;  5JCM A;  1BGJ A;  4I58 A;  3IHM A;  2BC0 A;  4K5S A;  4CNK A;  1PBE A;  2X99 A;  3IWA A;  1BKW A;  3AXB A;  2BS2 A;  1JOA A;  4NTD A;  1H6V A;  1DNC A;  2WEU A;  2APG A;  1DJQ A;  5JCK A;  2JB2 A;  1H84 A;  4IA6 A;  1ZY8 A;  4YWO A;  1CC6 A;  1LJ1 A;  3GRT A;  2OLN A;  1P2H A;  4CY6 A;  2GR1 A;  1GRF A;  5KRQ A;  5KXJ A;  1O5W A;  2YLS A;  1JRY A;  1JNR A;  1GES A;  2YQU A;  3UTH A;  1P2E A;  4BK2 A;  4A6N B;  3LAD A;  4RG3 A;  4RG4 A;  2R4J A;  2BC1 A;  2WES A;  4CCR A;  1GRT A;  2IVE A;  2F5Z A;  3Q9T A;  4JY3 A;  2GVC A;  3H8L A;  5EB5 A;  2FJD A;  4G9K A;  4EQR A;  1O95 A;  4D04 A;  1NEN A;  3DGH A;  2GMJ A;  4U8O A;  3PVC A;  2C3C A;  1DOC A;  1EL9 A;  4JY2 A;  3P4Q A;  2TPR A;  3QJ4 A;  3FBS A;  4YTM A;  3H8I A;  4N9X A;  5U63 A;  3SX6 A;  3T31 A;  3PS9 A;  3LZW A;  3NIX A;  3E1T A;  1NHS A;  4O5U A;  3SZ0 A;  5BRT A;  4U8N A;  2XVJ A;  4GAP A;  2V60 A;  3AE8 A;  1Q9I A;  1ZP0 A;  2R9Z A;  4A5L A;  3EAO A;  3GMC A;  1KSU A;  2WOW A;  3LZX A;  2XFP A;  3VR8 A;  5KMS A;  1PS9 A;  1N4U A;  2C66 A;  3AE9 A;  4DSH A;  3KLJ A;  3D1C A;  3ABV A;  2I0Z A;  5IQ1 A;  2FBW A;  1S3B A;  1YQZ A;  4OPT A;  5LV9 A;  3HZL A;  5J7X A;  1IUV A;  2V61 A;  1XPQ A;  4J31 A;  3SYI A;  1PJ7 A;  3C96 A;  1B8S A;  3T14 A;  1S2Y A;  4B1B A;  4ZCD A;  2JBV A;  2YVG A;  3COX A;  4NEW A;  2BYB A;  3WE0 A;  4G6G A;  2VZ2 A;  2WP5 A;  2Q0L A;  2XVH A;  3SGL A;  2C76 A;  2BXS A;  3NH3 X;  3UP4 A;  4U2S A;  3ZDN A;  3V76 A;  2CDU A;  4Y4L A;  1NEK A;  2GF3 A;  3AWI A;  4UDP A;  5BUK A;  2CUL A;  1F8R A;  2Z5X A;  3QVR A;  3KKJ A;  4II2 A;  3SFD A;  1DXL A;  2QAE A;  4H4P A;  3JSK A;  1GOS A;  3DK4 A;  3S5W A;  1BGN A;  3CGE A;  1PXA A;  4U2L A;  4G73 A;  3AE5 A;  3HYX A;  4EQS A;  2R0G A;  4A6N A;  4H50 A;  4A99 A;  1IUX A;  1PBC A;  4C5O A;  1RYI A;  1CJC A;  1YQ3 A;  3ALM A;  4G74 A;  1NPX A;  1OJ9 A;  2XYO A;  2XLP A;  3LB8 A;  1JU2 A;  4OPI A;  3KD9 A;  4GRT A;  2BK4 A;  1JEH A;  4X9N A;  5ER0 A;  4H2R A;  2EQ9 A;  2YG3 A;  2ZZB A;  2B9X A;  2ZZ0 A;  1GPE A;  1V59 A;  2BAB A;  1DOB A;  3M13 A;  2WDQ A;  4XWZ A;  4IV9 A;  1H81 A;  3PO7 A;  2V6O A;  4OPU A;  2WOI A;  3NK0 X;  2WBA A;  5CKU A;  1K4Q A;  2AR8 A;  1PJ5 A;  1E39 A;  1M64 A;  3KU9 A;  3AE2 A;  3GYX A;  2FJB A;  5U25 A;  4DNA A;  3RP8 A;  3AE1 A;  4H4Y A;  2GH5 A;  4B67 A;  1JRX A;  4Z24 A;  1E1M A;  1COY A;  2C73 A;  5CQF A;  1PBB A;  1GRG A;  5C3J A;  4AOX A;  1H7W A;  2BK5 A;  3RED A;  2E4G A;  4BV6 A;  2VVL G;  3AYL A;  3AD8 B;  1E1K A;  1F6M A;  2DKH A;  4K22 A;  3CTY A;  4U8P A;  3CPH G;  1W4X A;  3QVP A;  4TLX A;  4C3Y A;  2WU5 A;  4C3X A;  1CBO A;  1Q1W A;  3K7M X;  3URH A;  2X8G A;  3EAN A;  5KVH A;  4J36 A;  4TLZ A;  3NTA A;  4K8D A;  2ZZC A;  2YLW A;  3AD7 B;  3AEB A;  3G5R A;  2PHH A;  2WU2 A;  1JRZ A;  2R45 A;  3I6D A;  4PAA A;  4Z2R A;  2BRA A;  3K7T A;  2YG7 A;  1NDA A;  2GV8 A;  3NN0 X;  1FOH A;  1NG4 A;  1D7Y A;  1IUT A;  3D8X A;  1GSN A;  3Q6J A;  1D7L A;  4BK3 A;  1CHU A;  3ICR A;  3KA7 A;  1QO8 A;  1B37 A;  2CFY A;  2GQF A;  3CMM A;  4BUR A;  1K0L A;  3UTE A;  3B6D A;  2YLT A;  4TM4 A;  4EQW A;  3VRB A;  3NYC A;  5IQ4 A;  2WP9 A;  3ISH A;  1NAA A;  4OPG A;  1QLB A;  1TDE A;  5HY5 A;  1Q1R A;  1LV0 A;  2C65 A;  3QSS A;  1PBF A;  2X3N A;  3SM8 A;  4NWZ A;  2C67 A;  1Y56 B;  3ATQ A;  4B69 A;  3CNS A;  2OA1 A;  4P9S A;  4EMI A;  4REK A;  3II4 A;  2WET A;  3L1R A;  4XXG A;  5HHF A;  1FEC A;  4JNA A;  3HYW A;  3GRS A;  1CC2 A;  1RP0 A;  1GXF A;  5FMH A;  3ADA B;  1OJT A;  2WS3 A;  3FIM B;  3GYJ A;  3DJG X;  3UOX A;  4Z25 A;  3AE7 A;  4Z44 A;  4BJZ A;  4H4W A;  5L46 A;  1TDO A;  1LTX R;  1RSG A;  2B7R A;  2GAG B;  2QCU A;  1MXT A;  2JKC A;  1ONF A;  2A89 A;  3CNJ A;  4FK1 C;  1LQU A;  2Y6Q A;  2GMH A;  3GWD A;  3UOY A;  3ATR A;  3AEE A;  3DJD A;  3GDP A;  2Q7V A;  3GYI A;  4YKF A;  1GET A;  4AP1 A;  3HYV A;  3O0H A;  2BXR A;  3UTF A;  3QFB A;  4K2X A;  1OJA A;  5KMQ A;  3KVE A;  4H4R A;  4YSZ A;  1IUW A;  4JNQ A;  5KMR A;  3GMB A;  2YLX A;  3GD4 A;  3T0K A;  1N4W A;  4EMW A;  3NYF A;  4OPL A;  4GDP A;  4B64 A;  2YR6 A;  4K5R A;  5JCN A;  5C2T A;  4YXD A;  5BVA A;  2PYX A;  4FX9 A;  3NT6 A;  3AYI A;  4O5Q A;  3VR9 A;  1NG3 A;  2GB0 A;  2W0H A;  3GWF A;  1GTH A;  3ICT A;  5KVI A;  1CL0 A;  4KX6 A;  2XLU A;  4A65 A;  2ZBW A;  4IVM B;  2C75 A;  4UDQ A;  2V5Z A;  4NEV A;  3H4K A;  1D4E A;  1GRB A;  4GCM A;  4YSH A;  2WPC A;  2RGJ A;  3CGC A;  2XFO A;  3AYJ A;  3LOV A;  4YT0 A;  4Z43 A;  1QJD A;  3IF9 A;  3AE3 A;  1N1P A;  4J33 A;  5GSN A;  4CRT A;  4MJW A;  3SZF A;  3L8K A;  2XCG A;  3UKF A;  1VDC A;  1K0I A;  3ICS A;  3M12 A;  1ZOY A;  1E1L A;  1XHC A;  2C72 A;  4H2Q A;  4EMJ A;  1BWC A;  1PXC A;  1CJ2 A;  2AAQ A;  1PXB A;  4OCG A;  4C77 A;  3SXI A;  2RGO A;  3V3O A;  2Z5Y A;  1GND A;  5KMP A;  4DGK A;  3UKQ A;  1DOE A;  1ELI A;  1VG9 A;  4TM0 A;  4EQX A;  2Q6U A;  1B4V A;  2V3A A;  2GR3 A;  1GER A;  4X4J A;  2GAH B;  1H86 A;  3LXD A;  3BHK A;  1GV4 A;  2R46 A;  4Z26 A;  4U8I A;  4H4X A;  5EBK A;  4Y4M A;  1NHR A;  1OJC A;  4RSL A;  1LQT A;  2IID A;  1O94 A;  1B5Q A;  1EL5 A;  2NVK X;  3NNE A;  1IJH A;  2Y6R A;  3NRN A;  1GTE A;  4YKG A;  2VQ7 A;  3AEA A;  2WP6 A;  1M6I A;  3CNT A;  3DK9 A;  4JQ9 A;  3ALL A;  2J3N A;  1ZDL A;  1IUS A;  4A7A A;  2OAM A;  2WDV A;  4AT2 A;  2VRL A;  1GT8 A;  3BI5 A;  1F3P A;  4GF7 A;  4A79 A;  1K0J A;  2YG4 A;  2WDR A;  3UKL A;  1KNR A;  2WQY A;  3ITJ A;  2OLO A;  3G5Q A;  3RNM A;  5J60 A;  2YWL A;  1VQW A;  4PAB A;  2E5V A;  2GR2 A;  5DBJ A;  5GRT A;  4EM4 A;  3AEF A;  4NTC A;  4KPR A;  3UKP A;  2VQB A;  1KFY A;  2AQJ A;  1VG0 A;  3FG2 P;  4ZCC A;  2XVI A;  2C7G A;  3CNP A;  1PBD A;  1L9E A;  3T2Z A;  3IHG A;  2IVD A;  2CVJ A;  2A8X A;  3G5S A;  1S2Q A;  3FMW A;  2WOV A;  4CCQ A;  3S61 A;  3P4S A;  2YR4 A;  1LVL A;  2BRY A;  5FS7 A;  1GAL A;  3UCL A;  1YQ4 A;  4JDR A;  2YM1 A;  1L0V A;  2YVF A;  4HB9 A;  4APN A;  2BA9 A;  2V3B A;  5JCL A;  3CGD A;  1KF6 A;  3IC9 A;  4YTP A;  4UP3 A;  3DME A;  4U8L A;  4Z2U A;  4OVI A;  1PHH A;  2QA1 A;  1MO9 A;  2O9Z A;  3AEC A;  2YM2 A;  1NHQ A;  1HYU A;  2R4E A;  3CPJ G;  1F8W A;  3T37 A;  2C4C A;  3NHO X;  4YSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...