2A87A

Crystal structure of m. tuberculosis thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
313
structure length
313
Chain Sequence
AHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
publication title Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 88
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A02
3GYJA 3P9UA 5EBKA 5U1OA 2B7RA 4U8JA 1QO8A 4TM0A 3KVEA 2WETA 3NTAA 1DXLA 1D4DA 2YG7A 4N9XA 1DJQA 4B68A 3ADAB 1GESA 4EIQA 2ZZCA 3KD9A 4LIIA 3RNMA 3UKHA 2X8HA 5BRTA 4OPIA 1VRQB 3CNSA 4JQ9A 3UKPA 1F8WA 4YWOA 2BC0A 3NHOX 2OLNA 3NYFA 1ONFA 2BCPA 2V3BA 1F8SA 3UTFA 2XFPA 1NENA 2V60A 3H8LA 4H50A 2YLWA 3AD9B 4KPRA 2FJEA 2WHDA 2R4EA 3FBSA 2ACZA 3ATRA 2ZZBA 4RG4A 3AEGA 4H2PA 1EBDA 1BGNA 1LQUA 1BWCA 2QAEA 4B1BA 1GRTA 1IUSA 3BI5A 4JY3A 4CNKA 4C77A 2WESA 4FK1C 3FIMB 2GR2A 2HQMA 4DGKA 1NDAA 4TM3A 4USQA 3IF9A 3UKKA 1ZDLA 3AEEA 3FG2P 4NEWA 1TDKA 3KKJA 1V59A 5FMHA 5M10A 1DNCA 2Q7VA 2BA9A 1H83A 3SQPA 4A6NA 3V3NA 1E6EA 4B64A 1ZOVA 4IV9A 3WE0A 4H4SA 4DNAA 3LADA 4H4UA 4Z24A 1GT8A 2Q6UA 2AR8A 4CCRA 4B67A 3UOYA 3VRBA 3GWFA 3ATQA 2RGJA 4M52A 3NIXA 2B9WA 3NH3X 2C67A 3AE7A 3ZYXA 1GRGA 3K7QX 3NNEA 2YR5A 1KSSA 3KU9A 4O5QA 1F6MA 4J31A 4K8DA 1LV0A 1OJAA 4IVOB 1DOCA 2FJAA 1KSUA 2CVJA 3NYEA 4U2SA 2R0PA 3GRSA 1XHCA 1N4VA 3QSSA 4JNAA 4YXDA 2YG4A 1XPQA 2WPCA 1IUUA 2XVFA 1H81A 1QJDA 2WDQA 5M0ZA 3AEFA 4H4XA 2VVLA 1PBCA 3K7MX 3UP4A 1D4EA 4Z44A 4K22A 4IA5A 1P2HA 1OJTA 2V3AA 3CGEA 1YQ3A 3B3RA 1H82A 2WP6A 3UOXA 1CJ3A 1XDIA 2XVEA 1S2QA 2XLPA 4CCQA 1GSNA 1JRXA 1PBEA 5JCKA 2GAGB 1KNPA 1ZY8A 1B4VA 2R4JA 3CNPA 3NLCA 1DOBA 1BGJA 4USRA 2BXSA 1FCDA 1LVLA 4OPLA 4O5UA 2YVGA 1TDOA 4AOXA 3CTYA 5IQ4A 1S3EA 3P1WA 1L9DA 1CC2A 3O0HA 3LZWA 3BNUA 4H7UA 4A9WA 3NK0X 2VQ7A 3VRDB 4Z43A 2JAEA 1COYA 2EQ7A 3SGLA 2C65A 1GRAA 4EQWA 2RABA 3NN6X 3URHA 1L0VA 3EPTA 1PDHA 3AE6A 1ZK7A 4IA6A 4CBQA 3AE9A 3E1TA 3ICTA 3RP7A 2C72A 3UTEA 4HB9A 1K0IA 3SFDA 2GAHB 5FS6A 4OPUA 1NPXA 2XLUA 4YKFA 5L46A 1B5QA 1PXCA 1VG9A 3AE5A 4ADWA 1JRZA 4EM4A 1DJNA 2GMJA 3NK1X 4P9SA 2C66A 4OPGA 2YG3A 4AP1A 2WOVA 4FK1A 4NEVA 3LXDA 4K7ZA 4GF7A 4FX9A 4YSHA 4I58A 2GV8A 4J34A 4AP3A 2RGHA 1H84A 3BHKA 3DA1A 2XLTA 3CGDA 5HHFA 1KFYA 3DJDA 3VR9A 4CRTA 4OPCA 5FS7A 2BK3A 1E1MA 2Q0LA 4U8KA 2E4GA 4YKGA 1ZKQA 2XYOA 1LJ1A 1YKJA 4Y4MA 1Q1WA 2C64A 2C75A 1PBFA 4BJYA 1P2EA 2QA2A 4H4YA 4AT2A 2YQUA 1JNRA 3C4AA 4J57A 3RP8A 4C3YA 1S2YA 3NYCA 1VDCA 5EOWA 4CY6A 3UTGA 1OJ9A 2BABA 3DK9A 2XFOA 1BF3A 2VVLG 4GCMA 3UKLA 1E1LA 2X3NA 4XWRA 4TLXA 3CIRA 1E1KA 2R46A 3UKFA 2BCGG 2WPFA 3ITJA 2XFQA 1N4WA 3P4SA 2C70A 3UOZA 5JCLA 2JBVA 3AD8B 2IIDA 4A7AA 4ZCDA 4J33A 4OVIA 3QFBA 2FJDA 4TM1A 4Y4LA 3REDA 4YT0A 2WDVA 3AE1A 2Y6RA 2XFUA 3AYIA 3PS9A 4B65A 1ELIA 3LB8A 4ZN0A 3BNMA 1TDEA 4B69A 3S61A 2IVEA 2JB1A 4BURA 4E0VA 3DH9A 3L1RA 3QJ4A 4EMIA 4A65A 1H7XA 3AD7B 1N1PA 3AECA 1OJDA 3AEBA 1GETA 3CGBA 2GQWA 1O95A 3VR8A 4APNA 2TPRA 2C7GA 2BK4A 2B9XA 3AE3A 4J36A 4D03A 1JNZA 4B63A 2GVCA 4BK1A 3GDNA 1D7YA 1NG4A 1B37A 4H4ZA 1GV4A 3DMEA 3IWAA 3II4A 1REOA 4A79A 1FOHA 2GH5A 1GRBA 3P4RA 3EF6A 3DJJA 3FMWA 1ZOYA 2YLTA 3RHAA 3GMBA 1IJHA 1VG0A 3BI4A 4LU6A 4GUVA 1Q9IA 4YTNA 1BKWA 1GXFA 1D5TA 4RG3A 4JY2A 1NHRA 5IQ1A 4BV6A 1NG3A 3LJPA 4X9MA 5HXIA 2XCGA 4H2QA 2J3NA 3AEDA 4YTPA 5J7XA 2X99A 1QLBA 1OJCA 3NGCX 1PS9A 2GEWA 1F3PA 3SM8A 1XANA 2XLRA 1K0JA 2QA1A 1TDNA 2YVJA 4PABA 4OPDA 4U2LA 2VOUA 4J2WA 2IVDA 4YSYA 4Z2RA 2YLSA 4H4VA 1E39A 3NRNA 2V5ZA 1SEZA 5DBJA 3CNDA 4KX6A 1RP0A 3ALLA 3V76A 3V3OA 5KOWA 1KF6A 4EQSA 4U8PA 2YG6A 5TR3A 4GDEA 3ZDNA 3K30A 2ZBWA 4OPTA 2H88A 1M64A 4XWZA 4K5SA 1NAAA 3CNJA 2R0CA 1LTXR 2WU2A 3CN8A 3G5SA 2R0GA 4LA1A 1CF3A 1Q1RA 2XVJA 1JEHA 2Q0KA 2FBWA 4Z2UA 2C76A 3QSEA 2E1MA 4K2XA 3Q9TA 4BK2A 1TYPA 5FS8A 5IPYA 3NN0X 3UKQA 1PBDA 2V6OA 4FDCB 4A99A 1CJ2A 3IC9A 5J60A 3LZXA 1GTEA 3AEAA 4YSZA 4ECHA 4ZCCA 2GR0A 2YR4A 1GNDA 2APGA 4NTEA 4TLZA 1TYTA 1L9EA 4H4WA 4CY8A 1KDGA 1W4XA 4A5LA 3M13A 4YTMA 4J56A 1NHQA 1Y0PA 2DKIA 2VZ2A 3GRTA 5BUKA 1GREA 2X8GA 1NEKA 2EQ6A 3H4KA 3L8KA 1RSGA 1BZLA 3S5WA 3K7TA 4D04A 3COXA 4NZHA 3ISHA 3SFEA 3PO7A 3UOVA 2X50A 2YLZA 4X4JA 2I0ZA 3DJGX 4IVMB 4CNJA 1K0LA 3G5RA 3P4PA 2WEUA 3QVPA 1ZMCA 1K4QA 2XDOA 1L9CA 3GYIA 3I3LA 1FECA 1B8SA 3VQRA 4DSGA 1CBOA 1MOKA 1D4CA 1PHHA 2YAUA 2C73A 3BI2A 3NT6A 3OZ2A 5KVHA 1NHSA 2BS4A 3GWDA 4U8MA 3DK8A 4H4PA 3RP6A 3CPIG 4JN9A 1NHPA 2GF3A 2XLSA 2QCUA 3GDPA 5BVAA 1FL2A 2DKHA 2A87A 3OC4A 5KOXA 2BC1A 4Z26A 2V61A 3GMCA 1GRHA 1DODA 1JU2A 1PJ5A 2GR1A 1Y56A 1JOAA 1LQTA 2B76A 2WP5A 2NVKX 4UDQA 2YLXA 2AAQA 2JB2A 2OA1A 4AOSA 4EMJA 2X8CA 2WS3A 4EM3A 3ALMA 4ICYA 1IUTA 1HYUA 1E1NA 2YM2A 2R45A 5CQFA 5JCMA 4Y4NA 5JCNA 4H2NA 4EQXA 5LV9A 2BACA 2GR3A 3IHGA 1ZMDA 1GTHA 1CJ4A 3EANA 1CHUA 3UCLA 1Z6LA 4AT0A 4U8NA 2R9ZA 3DGZA 1PJ7A 2UZZA 3UP5A 1MXTA 3EAOA 4DSHA 1CC4A 2JK6A 3AB1A 4TM4A 2YVFA 2WPEA 4EIPA 1M6IA 3KPFA 2WBAA 1FEBA 3AYLA 3D1CA 4RSLA 4UDRA 4C3XA 3CGCA 1GRFA 1ZP0A 1IUWA 1CL0A 3GD3A 3BHFA 4I59A 1E7PA 2B7SA 1O5WA 5FS9A 4C5OA 3AYJA 1N4UA 4U2TA 5U25A 2WP9A 2OAMA 4Z2TA 1TRBA 5EB5A 2Z5XA 2C3DA 1ZX9A 1YQZA 2VRLA 2Z5YA 3HZLA 5KVIA 2YR6A 2RGOA 1FEAA 2BK5A 3NKSA 1H7WA 4GR1A 3FPZA 3QSMA 3LOVA 3DJEA 1JRYA 3DGHA 2BS3A 3PVCA 2W0HA 1EL7A 2ZZ0A 4JNQA 1TDFA 3DK4A 2WDRA 2BXRA 3QFAA 2CULA 5EB4A 4EQRA 1PN0A 1PBBA 1GEUA 1S3BA 1PXBA 2XVHA 4OCGA 3T37A 2YWLA 3F8PA 3KLJA 5GSNA 1IUVA 1H6VA 1LPFA 4HA6A 3B6DA 5BULA 4H4QA 4UP3A 5JCIA 2VRMA 2C3CA 2ARDA 2VQBA 2XVIA 4YSXA 1YQ4A 2CFYA 1GPEA 2TMDA 1YY5A 1H86A 2YLRA 1X31B 2E5VA 4BJZA 5CKUA 4NTCA 3C4NA 1KNRA 1GERA 3NK2X 2WU5A 3QVRA 4GRTA 1D7LA 3H8IA 2VVMA 1RYIA 1Y56B 5C2TA 3NTDA 1AOGA 2Y6QA 4GDPA 3C96A 3ALJA 3GD4A 3AE8A 3R9UA 2F5ZA 5U63A 1F8RA 2O9ZA 2OALA 2XFNA 4U8LA 2GMHA 5KRQA 4NTDA 4C74A 3AXBA 4PAAA 2A89A 4U8IA 1EL5A 4B66A 3G5QA 3CPHG 1GOSA 3UTHA 4UDPA 4WCTA 2H89A 3JSKA 1PXAA 4X9NA 4Z25A 1PJ6A 2WQYA 2GRTA 3CPJG 2CDUA 2EQ8A 3ICSA 2FJBA 5HYMA 2BS2A 2JB3A 2PYXA 2PHHA 5HY5A 1EL9A 4U8OA 1UKVG 1VQWA 2B9YA 5C3JA 4BK3A 4H4TA 2EQ9A 1EL8A 4WX1A 3AE4A 3CNTA 2AQJA 1CC6A 1GALA 1MO9A 4H4RA 4XXGA 3F8RA 3ICRA 3P4QA 2GQFA 3Q6JA 4JDRA 3M0OA 3ABVA 3VRAA 4A6NB 2WOIA 3AE2A 1CJCA 3I6DA 2WOWA 2GB0A 4REKA 4EMWA 4K5RA 5GRTA 3D8XA 3NG7X 3KA7A 2NPXA 2BYBA 2JKCA 2YG5A 3M12A 3UKAA 2YM1A 5KWFA 5ER0A 1O94A 3IHMA 1DOEA 3AWIA 5KXJA 2A8XA 4MJWA 3F8DA 3GSIA 4H2RA 2OLOA 1IUXA
chains in the Genus database with same CATH superfamily
3GYJA 3P9UA 5EBKA 5U1OA 2B7RA 4U8JA 1QO8A 4TM0A 3KVEA 2WETA 3NTAA 1DXLA 1D4DA 2YG7A 4N9XA 1DJQA 4B68A 3ADAB 1GESA 4EIQA 2ZZCA 3KD9A 4LIIA 3RNMA 3UKHA 2X8HA 5BRTA 4OPIA 1VRQB 3CNSA 4JQ9A 3UKPA 1F8WA 4YWOA 2BC0A 3NHOX 2OLNA 3NYFA 1ONFA 2BCPA 2V3BA 1F8SA 3UTFA 2XFPA 1NENA 2V60A 3H8LA 4H50A 2YLWA 3AD9B 4KPRA 2FJEA 2WHDA 2R4EA 3FBSA 2ACZA 3ATRA 2ZZBA 4RG4A 3AEGA 4H2PA 1EBDA 1BGNA 1LQUA 1BWCA 2QAEA 4B1BA 1GRTA 1IUSA 3BI5A 4JY3A 4CNKA 4C77A 2WESA 4FK1C 3FIMB 2GR2A 2HQMA 3T0KA 4DGKA 1NDAA 4TM3A 4USQA 3IF9A 3UKKA 1ZDLA 3AEEA 3FG2P 4NEWA 1TDKA 3KKJA 1V59A 5FMHA 5M10A 1DNCA 2Q7VA 2BA9A 1H83A 3SQPA 3SZWA 3V3NA 1E6EA 4A6NA 1ZOVA 4IV9A 3WE0A 4H4SA 4B64A 4DNAA 3LADA 4H4UA 4Z24A 1GT8A 2Q6UA 2AR8A 4CCRA 4B67A 3UOYA 3SZCA 3VRBA 3GWFA 3ATQA 2RGJA 4M52A 3NIXA 2B9WA 3NH3X 2C67A 3AE7A 3ZYXA 1GRGA 3K7QX 3NNEA 2YR5A 1KSSA 3KU9A 4O5QA 1F6MA 3HYVA 4J31A 4K8DA 1LV0A 1OJAA 4IVOB 1DOCA 2FJAA 1KSUA 2CVJA 3NYEA 4U2SA 2R0PA 3GRSA 1XHCA 1N4VA 3QSSA 4JNAA 4YXDA 2YG4A 1XPQA 2WPCA 1IUUA 2XVFA 1H81A 1QJDA 2WDQA 5M0ZA 3AEFA 4H4XA 2VVLA 1PBCA 3K7MX 3UP4A 1D4EA 4Z44A 4K22A 4IA5A 1P2HA 1OJTA 2V3AA 5KMPA 3CGEA 1YQ3A 3B3RA 1H82A 2WP6A 3UOXA 1CJ3A 1XDIA 2XVEA 1S2QA 2XLPA 4CCQA 1GSNA 1JRXA 1PBEA 5JCKA 2GAGB 1KNPA 1ZY8A 1B4VA 2R4JA 3CNPA 3SZFA 3NLCA 1DOBA 1BGJA 4USRA 2BXSA 1FCDA 1LVLA 4OPLA 4O5UA 4II2A 2YVGA 1TDOA 4AOXA 3CTYA 5IQ4A 1S3EA 3P1WA 1L9DA 1CC2A 3O0HA 3LZWA 3BNUA 4H7UA 4A9WA 3NK0X 2VQ7A 3VRDB 4Z43A 2JAEA 1COYA 2EQ7A 3SGLA 2BRAA 2C65A 1GRAA 4EQWA 2RABA 3NN6X 3URHA 1L0VA 3EPTA 1PDHA 3AE6A 1ZK7A 4IA6A 4CBQA 3AE9A 3E1TA 3ICTA 3RP7A 2C72A 4GAVA 3UTEA 4HB9A 1K0IA 3SFDA 2GAHB 5FS6A 4OPUA 1NPXA 2XLUA 4YKFA 5L46A 1B5QA 1PXCA 1VG9A 3AE5A 4ADWA 1JRZA 4EM4A 1DJNA 2GMJA 3NK1X 4P9SA 2C66A 4OPGA 2YG3A 4GAPA 4AP1A 2WOVA 4FK1A 4NEVA 3LXDA 4K7ZA 4GF7A 4FX9A 4YSHA 4I58A 2GV8A 4J34A 4AP3A 2RGHA 1H84A 3BHKA 3DA1A 2XLTA 3CGDA 5HHFA 1KFYA 3DJDA 3VR9A 4CRTA 4OPCA 5FS7A 2BK3A 4G6HA 1E1MA 2Q0LA 4U8KA 2E4GA 4YKGA 1ZKQA 2XYOA 1LJ1A 1YKJA 4Y4MA 1Q1WA 2C64A 2C75A 1PBFA 4BJYA 1P2EA 2QA2A 4H4YA 4AT2A 2YQUA 1JNRA 3C4AA 4J57A 3RP8A 4C3YA 1S2YA 3NYCA 1VDCA 4NNJA 5EOWA 5KMQA 3UTGA 4CY6A 1OJ9A 2BABA 3DK9A 2XFOA 1BF3A 2VVLG 4GCMA 3UKLA 1E1LA 2X3NA 4XWRA 4TLXA 3CIRA 1E1KA 2R46A 3UKFA 2BCGG 2WPFA 5KNLA 3ITJA 2XFQA 1N4WA 3P4SA 2C70A 3UOZA 5JCLA 2JBVA 3AD8B 3T14A 2IIDA 4A7AA 4ZCDA 4J33A 4OVIA 3QFBA 2FJDA 4TM1A 4Y4LA 3REDA 4YT0A 2WDVA 3AE1A 2Y6RA 2XFUA 3AYIA 3PS9A 4B65A 1ELIA 3LB8A 4ZN0A 3BNMA 1TDEA 4B69A 3S61A 2IVEA 2JB1A 4BURA 4E0VA 3DH9A 3L1RA 3QJ4A 4EMIA 4A65A 5KMRA 1H7XA 3AD7B 1N1PA 3AECA 1OJDA 3AEBA 1GETA 3CGBA 2GQWA 1O95A 3VR8A 4APNA 2TPRA 2C7GA 2BK4A 2B9XA 3AE3A 4J36A 4D03A 1JNZA 4B63A 2GVCA 4BK1A 3GDNA 1D7YA 1NG4A 1B37A 4H4ZA 1GV4A 3DMEA 3IWAA 3II4A 1REOA 4A79A 1FOHA 2GH5A 1GRBA 3P4RA 3EF6A 3DJJA 4G9KA 3FMWA 1ZOYA 2YLTA 3HYWA 2BRYA 3GMBA 1IJHA 1VG0A 3RHAA 3BI4A 4LU6A 4GUVA 1Q9IA 4YTNA 1BKWA 1GXFA 1D5TA 4RG3A 4JY2A 1NHRA 5IQ1A 4BV6A 1NG3A 3LJPA 4X9MA 5HXIA 2XCGA 4H2QA 2J3NA 3AEDA 4YTPA 5J7XA 2X99A 1QLBA 1OJCA 3NGCX 1PS9A 2GEWA 1F3PA 3SM8A 1XANA 2XLRA 1K0JA 2QA1A 1TDNA 2YVJA 4PABA 4OPDA 4U2LA 2VOUA 4J2WA 2IVDA 4YSYA 3CMMA 2YLSA 4Z2RA 4H4VA 1E39A 3NRNA 2V5ZA 1SEZA 5DBJA 3CNDA 4KX6A 1RP0A 3ALLA 3V76A 3V3OA 5KOWA 1KF6A 4EQSA 4U8PA 2YG6A 5TR3A 4GDEA 3ZDNA 3K30A 2ZBWA 4OPTA 2H88A 1M64A 4XWZA 4K5SA 1NAAA 3CNJA 2R0CA 1LTXR 2WU2A 3CN8A 3G5SA 2R0GA 4LA1A 1CF3A 1Q1RA 2XVJA 1JEHA 2Q0KA 2FBWA 4Z2UA 2C76A 3QSEA 2E1MA 4K2XA 3Q9TA 4BK2A 1TYPA 5FS8A 5IPYA 3NN0X 3UKQA 1PBDA 2V6OA 4FDCB 4II3A 1CJ2A 3IC9A 4A99A 3LZXA 5J60A 1GTEA 3AEAA 4YSZA 4ECHA 4ZCCA 2GR0A 2YR4A 1GNDA 2APGA 4NTEA 4TLZA 1TYTA 1L9EA 4H4WA 4CY8A 1KDGA 1W4XA 4A5LA 3M13A 4YTMA 4J56A 3T31A 1NHQA 1Y0PA 2DKIA 2VZ2A 3GRTA 5BUKA 1GREA 2X8GA 1NEKA 2EQ6A 3H4KA 3L8KA 1RSGA 1BZLA 3S5WA 3K7TA 4D04A 3COXA 4NZHA 3ISHA 3SFEA 3PO7A 3UOVA 2X50A 2YLZA 4X4JA 2I0ZA 3DJGX 4IVMB 4CNJA 1K0LA 2C4CA 3G5RA 3P4PA 2WEUA 3QVPA 1ZMCA 1K4QA 2XDOA 1L9CA 3GYIA 3I3LA 1FECA 1B8SA 3VQRA 4DSGA 1CBOA 1MOKA 1D4CA 1PHHA 2YAUA 2C73A 3BI2A 3NT6A 3OZ2A 3T2ZA 5KVHA 1NHSA 2BS4A 3GWDA 4U8MA 3DK8A 4H4PA 3RP6A 3CPIG 4JN9A 1NHPA 2GF3A 2XLSA 2QCUA 3GDPA 5BVAA 1FL2A 2DKHA 2A87A 3OC4A 5KOXA 2BC1A 4Z26A 2V61A 3GMCA 1GRHA 1DODA 1JU2A 1PJ5A 2GR1A 1Y56A 1JOAA 1LQTA 2B76A 2WP5A 2NVKX 4UDQA 2YLXA 2AAQA 2JB2A 2OA1A 4AOSA 4EMJA 2X8CA 2WS3A 4EM3A 3ALMA 4ICYA 1IUTA 1HYUA 1E1NA 2YM2A 2R45A 5CQFA 5JCMA 4Y4NA 5JCNA 4H2NA 4EQXA 5LV9A 2BACA 2GR3A 3IHGA 1ZMDA 1GTHA 1CJ4A 3EANA 1CHUA 3UCLA 1Z6LA 4AT0A 4U8NA 2R9ZA 3DGZA 1PJ7A 2UZZA 3UP5A 1MXTA 3EAOA 4DSHA 1CC4A 2JK6A 3AB1A 4TM4A 3SX6A 2YVFA 2WPEA 4EIPA 1M6IA 3KPFA 2WBAA 1FEBA 3AYLA 3D1CA 4RSLA 4UDRA 4C3XA 3CGCA 1GRFA 1ZP0A 1IUWA 1CL0A 3GD3A 3BHFA 3KPKA 1E7PA 2B7SA 1O5WA 3HYXA 4I59A 5FS9A 3AYJA 1N4UA 4U2TA 5U25A 3SY4A 2WP9A 2OAMA 4Z2TA 1TRBA 5EB5A 2Z5XA 2C3DA 1ZX9A 1YQZA 2VRLA 2Z5YA 3HZLA 5KVIA 2YR6A 2RGOA 1FEAA 2BK5A 3NKSA 1H7WA 4GR1A 3FPZA 3QSMA 3LOVA 3DJEA 1JRYA 3DGHA 2BS3A 3PVCA 2W0HA 1EL7A 2ZZ0A 4JNQA 1TDFA 3DK4A 2WDRA 2BXRA 3QFAA 2CULA 5EB4A 4EQRA 1PN0A 1PBBA 1GEUA 1S3BA 1PXBA 2XVHA 3T2YA 4OCGA 3T37A 4G74A 2YWLA 3F8PA 3KLJA 5GSNA 4C5OA 1IUVA 1H6VA 1LPFA 4HA6A 3B6DA 5BULA 4H4QA 4UP3A 5JCIA 5KMSA 2VRMA 2C3CA 2ARDA 3SYIA 2VQBA 2XVIA 4YSXA 1YQ4A 4G6GA 2CFYA 1GPEA 2TMDA 1YY5A 1H86A 2YLRA 1X31B 2E5VA 4BJZA 5CKUA 4NTCA 3C4NA 1KNRA 1GERA 3NK2X 2WU5A 3QVRA 4GRTA 1D7LA 3H8IA 2VVMA 1RYIA 1Y56B 3T2KA 5C2TA 3NTDA 4G73A 1AOGA 3SXIA 2Y6QA 4GDPA 3C96A 3ALJA 3GD4A 3AE8A 3R9UA 2F5ZA 5U63A 1F8RA 2O9ZA 2OALA 2XFNA 4U8LA 2GMHA 5KRQA 4NTDA 4C74A 3AXBA 4PAAA 2A89A 4U8IA 1EL5A 4B66A 3G5QA 3CPHG 1GOSA 3UTHA 3GYXA 4UDPA 4WCTA 2H89A 3JSKA 1PXAA 4X9NA 4Z25A 1PJ6A 2WQYA 2GRTA 3CPJG 2CDUA 2EQ8A 3ICSA 2FJBA 5HYMA 2BS2A 2JB3A 2PYXA 2PHHA 5HY5A 1EL9A 4U8OA 1UKVG 1VQWA 2B9YA 3SZ0A 5C3JA 4BK3A 4H4TA 2EQ9A 1EL8A 4WX1A 3AE4A 3CNTA 2AQJA 1CC6A 1GALA 1MO9A 4H4RA 4XXGA 3F8RA 3ICRA 3P4QA 2GQFA 3Q6JA 4JDRA 3M0OA 3ABVA 3VRAA 4A6NB 2WOIA 3AE2A 1CJCA 3I6DA 2WOWA 2GB0A 4REKA 4EMWA 4K5RA 5GRTA 3D8XA 3NG7X 3KA7A 2NPXA 2BYBA 2JKCA 2YG5A 3M12A 3UKAA 2YM1A 5KWFA 5ER0A 1O94A 3IHMA 1DOEA 4NWZA 3AWIA 5KXJA 2A8XA 4MJWA 3F8DA 3GSIA 4H2RA 2OLOA 1IUXA
chains in the Genus database with same CATH topology
3GYJA 3P9UA 5EBKA 5U1OA 2B7RA 4U8JA 1QO8A 4TM0A 3KVEA 2WETA 3NTAA 1DXLA 1D4DA 2YG7A 4N9XA 1DJQA 4B68A 3ADAB 1GESA 4EIQA 2ZZCA 3KD9A 4LIIA 3RNMA 3UKHA 2X8HA 5BRTA 4OPIA 1VRQB 3CNSA 4JQ9A 3UKPA 1F8WA 4YWOA 2BC0A 3NHOX 2OLNA 3NYFA 1ONFA 2BCPA 2V3BA 1F8SA 3UTFA 2XFPA 1NENA 2V60A 3H8LA 4H50A 2YLWA 3AD9B 4KPRA 2FJEA 2WHDA 2R4EA 3FBSA 2ACZA 3ATRA 2ZZBA 4RG4A 3AEGA 4H2PA 1EBDA 1BGNA 1LQUA 1BWCA 2QAEA 4B1BA 1GRTA 1IUSA 3BI5A 4JY3A 4CNKA 4C77A 2WESA 4FK1C 3FIMB 2GR2A 2HQMA 3T0KA 4DGKA 1NDAA 4TM3A 4USQA 3IF9A 3UKKA 1ZDLA 3AEEA 3FG2P 4NEWA 1TDKA 3KKJA 1V59A 5FMHA 5M10A 1DNCA 2Q7VA 2BA9A 1H83A 3SQPA 3SZWA 3V3NA 1E6EA 4A6NA 1ZOVA 4IV9A 3WE0A 4H4SA 4B64A 4DNAA 3LADA 4H4UA 4Z24A 1GT8A 2Q6UA 2AR8A 4CCRA 4B67A 3UOYA 3SZCA 3VRBA 3GWFA 3ATQA 2RGJA 4M52A 3NIXA 2B9WA 3NH3X 2C67A 3AE7A 3ZYXA 1GRGA 3K7QX 3NNEA 2YR5A 1KSSA 3KU9A 4O5QA 1F6MA 3HYVA 4J31A 4K8DA 1LV0A 1OJAA 4IVOB 1DOCA 2FJAA 1KSUA 2CVJA 3NYEA 4U2SA 2R0PA 3GRSA 1XHCA 1N4VA 3QSSA 4JNAA 4YXDA 2YG4A 1XPQA 2WPCA 1IUUA 2XVFA 1H81A 1QJDA 2WDQA 5M0ZA 3AEFA 4H4XA 2VVLA 1PBCA 3K7MX 3UP4A 1D4EA 4Z44A 4K22A 4IA5A 1P2HA 1OJTA 2V3AA 5KMPA 3CGEA 1YQ3A 3B3RA 1H82A 2WP6A 3UOXA 1CJ3A 1XDIA 2XVEA 1S2QA 2XLPA 4CCQA 1GSNA 1JRXA 1PBEA 5JCKA 2GAGB 1KNPA 1ZY8A 1B4VA 2R4JA 3CNPA 3SZFA 3NLCA 1DOBA 1BGJA 4USRA 2BXSA 1FCDA 1LVLA 4OPLA 4O5UA 4II2A 2YVGA 1TDOA 4AOXA 3CTYA 5IQ4A 1S3EA 3P1WA 1L9DA 1CC2A 3O0HA 3LZWA 3BNUA 4H7UA 4A9WA 3NK0X 2VQ7A 3VRDB 4Z43A 2JAEA 1COYA 2EQ7A 3SGLA 2BRAA 2C65A 1GRAA 4EQWA 2RABA 3NN6X 3URHA 1L0VA 3EPTA 1PDHA 3AE6A 1ZK7A 4IA6A 4CBQA 3AE9A 3E1TA 3ICTA 3RP7A 2C72A 4GAVA 3UTEA 4HB9A 1K0IA 3SFDA 2GAHB 5FS6A 4OPUA 1NPXA 2XLUA 4YKFA 5L46A 1B5QA 1PXCA 1VG9A 3AE5A 4ADWA 1JRZA 4EM4A 1DJNA 2GMJA 3NK1X 4P9SA 2C66A 4OPGA 2YG3A 4GAPA 4AP1A 2WOVA 4FK1A 4NEVA 3LXDA 4K7ZA 4GF7A 4FX9A 4YSHA 4I58A 2GV8A 4J34A 4AP3A 2RGHA 1H84A 3BHKA 3DA1A 2XLTA 3CGDA 5HHFA 1KFYA 3DJDA 3VR9A 4CRTA 4OPCA 5FS7A 2BK3A 4G6HA 1E1MA 2Q0LA 4U8KA 2E4GA 4YKGA 1ZKQA 2XYOA 1LJ1A 1YKJA 4Y4MA 1Q1WA 2C64A 2C75A 1PBFA 4BJYA 1P2EA 2QA2A 4H4YA 4AT2A 2YQUA 1JNRA 3C4AA 4J57A 3RP8A 4C3YA 1S2YA 3NYCA 1VDCA 4NNJA 5EOWA 5KMQA 3UTGA 4CY6A 1OJ9A 2BABA 3DK9A 2XFOA 1BF3A 2VVLG 4GCMA 3UKLA 1E1LA 2X3NA 4XWRA 4TLXA 3CIRA 1E1KA 2R46A 3UKFA 2BCGG 2WPFA 5KNLA 3ITJA 2XFQA 1N4WA 3P4SA 2C70A 3UOZA 5JCLA 2JBVA 3AD8B 3T14A 2IIDA 4A7AA 4ZCDA 4J33A 4OVIA 3QFBA 2FJDA 4TM1A 4Y4LA 3REDA 4YT0A 2WDVA 3AE1A 2Y6RA 2XFUA 3AYIA 3PS9A 4B65A 1ELIA 3LB8A 4ZN0A 3BNMA 1TDEA 4B69A 3S61A 2IVEA 2JB1A 4BURA 4E0VA 3DH9A 3L1RA 3QJ4A 4EMIA 4A65A 5KMRA 1H7XA 3AD7B 1N1PA 3AECA 1OJDA 3AEBA 1GETA 3CGBA 2GQWA 1O95A 3VR8A 4APNA 2TPRA 2C7GA 2BK4A 2B9XA 3AE3A 4J36A 4D03A 1JNZA 4B63A 2GVCA 4BK1A 3GDNA 1D7YA 1NG4A 1B37A 4H4ZA 1GV4A 3DMEA 3IWAA 3II4A 1REOA 4A79A 1FOHA 2GH5A 1GRBA 3P4RA 3EF6A 3DJJA 4G9KA 3FMWA 1ZOYA 2YLTA 3HYWA 2BRYA 3GMBA 1IJHA 1VG0A 3RHAA 3BI4A 4LU6A 4GUVA 1Q9IA 4YTNA 1BKWA 1GXFA 1D5TA 4RG3A 4JY2A 1NHRA 5IQ1A 4BV6A 1NG3A 3LJPA 4X9MA 5HXIA 2XCGA 4H2QA 2J3NA 3AEDA 4YTPA 5J7XA 2X99A 1QLBA 1OJCA 3NGCX 1PS9A 2GEWA 1F3PA 3SM8A 1XANA 2XLRA 1K0JA 2QA1A 1TDNA 2YVJA 4PABA 4OPDA 4U2LA 2VOUA 4J2WA 2IVDA 4YSYA 3CMMA 2YLSA 4Z2RA 4H4VA 1E39A 3NRNA 2V5ZA 1SEZA 5DBJA 3CNDA 4KX6A 1RP0A 3ALLA 3V76A 3V3OA 5KOWA 1KF6A 4EQSA 4U8PA 2YG6A 5TR3A 4GDEA 3ZDNA 3K30A 2ZBWA 4OPTA 2H88A 1M64A 4XWZA 4K5SA 1NAAA 3CNJA 2R0CA 1LTXR 2WU2A 3CN8A 3G5SA 2R0GA 4LA1A 1CF3A 1Q1RA 2XVJA 1JEHA 2Q0KA 2FBWA 4Z2UA 2C76A 3QSEA 2E1MA 4K2XA 3Q9TA 4BK2A 1TYPA 5FS8A 5IPYA 3NN0X 3UKQA 1PBDA 2V6OA 4FDCB 4II3A 1CJ2A 3IC9A 4A99A 3LZXA 5J60A 1GTEA 3AEAA 4YSZA 4ECHA 4ZCCA 2GR0A 2YR4A 1GNDA 2APGA 4NTEA 4TLZA 1TYTA 1L9EA 4H4WA 4CY8A 1KDGA 1W4XA 4A5LA 3M13A 4YTMA 4J56A 3T31A 1NHQA 1Y0PA 2DKIA 2VZ2A 3GRTA 5BUKA 1GREA 2X8GA 1NEKA 2EQ6A 3H4KA 3L8KA 1RSGA 1BZLA 3S5WA 3K7TA 4D04A 3COXA 4NZHA 3ISHA 3SFEA 3PO7A 3UOVA 2X50A 2YLZA 4X4JA 2I0ZA 3DJGX 4IVMB 4CNJA 1K0LA 2C4CA 3G5RA 3P4PA 2WEUA 3QVPA 1ZMCA 1K4QA 2XDOA 1L9CA 3GYIA 3I3LA 1FECA 1B8SA 3VQRA 4DSGA 1CBOA 1MOKA 1D4CA 1PHHA 2YAUA 2C73A 3BI2A 3NT6A 3OZ2A 3T2ZA 5KVHA 1NHSA 2BS4A 3GWDA 4U8MA 3DK8A 4H4PA 3RP6A 3CPIG 4JN9A 1NHPA 2GF3A 2XLSA 2QCUA 3GDPA 5BVAA 1FL2A 2DKHA 2A87A 3OC4A 5KOXA 2BC1A 4Z26A 2V61A 3GMCA 1GRHA 1DODA 1JU2A 1PJ5A 2GR1A 1Y56A 1JOAA 1LQTA 2B76A 2WP5A 2NVKX 4UDQA 2YLXA 2AAQA 2JB2A 2OA1A 4AOSA 4EMJA 2X8CA 2WS3A 4EM3A 3ALMA 4ICYA 1IUTA 1HYUA 1E1NA 2YM2A 2R45A 5CQFA 5JCMA 4Y4NA 5JCNA 4H2NA 4EQXA 5LV9A 2BACA 2GR3A 3IHGA 1ZMDA 1GTHA 1CJ4A 3EANA 1CHUA 3UCLA 1Z6LA 4AT0A 4U8NA 2R9ZA 3DGZA 1PJ7A 2UZZA 3UP5A 1MXTA 3EAOA 4DSHA 1CC4A 2JK6A 3AB1A 4TM4A 3SX6A 2YVFA 2WPEA 4EIPA 1M6IA 3KPFA 2WBAA 1FEBA 3AYLA 3D1CA 4RSLA 4UDRA 4C3XA 3CGCA 1GRFA 1ZP0A 1IUWA 1CL0A 3GD3A 3BHFA 3KPKA 1E7PA 2B7SA 1O5WA 3HYXA 4I59A 5FS9A 3AYJA 1N4UA 4U2TA 5U25A 3SY4A 2WP9A 2OAMA 4Z2TA 1TRBA 5EB5A 2Z5XA 2C3DA 1ZX9A 1YQZA 2VRLA 2Z5YA 3HZLA 5KVIA 2YR6A 2RGOA 1FEAA 2BK5A 3NKSA 1H7WA 4GR1A 3FPZA 3QSMA 3LOVA 3DJEA 1JRYA 3DGHA 2BS3A 3PVCA 2W0HA 1EL7A 2ZZ0A 4JNQA 1TDFA 3DK4A 2WDRA 2BXRA 3QFAA 2CULA 5EB4A 4EQRA 1PN0A 1PBBA 1GEUA 1S3BA 1PXBA 2XVHA 3T2YA 4OCGA 3T37A 4G74A 2YWLA 3F8PA 3KLJA 5GSNA 4C5OA 1IUVA 1H6VA 1LPFA 4HA6A 3B6DA 5BULA 4H4QA 4UP3A 5JCIA 5KMSA 2VRMA 2C3CA 2ARDA 3SYIA 2VQBA 2XVIA 4YSXA 1YQ4A 4G6GA 2CFYA 1GPEA 2TMDA 1YY5A 1H86A 2YLRA 1X31B 2E5VA 4BJZA 5CKUA 4NTCA 3C4NA 1KNRA 1GERA 3NK2X 2WU5A 3QVRA 4GRTA 1D7LA 3H8IA 2VVMA 1RYIA 1Y56B 3T2KA 5C2TA 3NTDA 4G73A 1AOGA 3SXIA 2Y6QA 4GDPA 3C96A 3ALJA 3GD4A 3AE8A 3R9UA 2F5ZA 5U63A 1F8RA 2O9ZA 2OALA 2XFNA 4U8LA 2GMHA 5KRQA 4NTDA 4C74A 3AXBA 4PAAA 2A89A 4U8IA 1EL5A 4B66A 3G5QA 3CPHG 1GOSA 3UTHA 3GYXA 4UDPA 4WCTA 2H89A 3JSKA 1PXAA 4X9NA 4Z25A 1PJ6A 2WQYA 2GRTA 3CPJG 2CDUA 2EQ8A 3ICSA 2FJBA 5HYMA 2BS2A 2JB3A 2PYXA 2PHHA 5HY5A 1EL9A 4U8OA 1UKVG 1VQWA 2B9YA 3SZ0A 5C3JA 4BK3A 4H4TA 2EQ9A 1EL8A 4WX1A 3AE4A 3CNTA 2AQJA 1CC6A 1GALA 1MO9A 4H4RA 4XXGA 3F8RA 3ICRA 3P4QA 2GQFA 3Q6JA 4JDRA 3M0OA 3ABVA 3VRAA 4A6NB 2WOIA 3AE2A 1CJCA 3I6DA 2WOWA 2GB0A 4REKA 4EMWA 4K5RA 5GRTA 3D8XA 3NG7X 3KA7A 2NPXA 2BYBA 2JKCA 2YG5A 3M12A 3UKAA 2YM1A 5KWFA 5ER0A 1O94A 3IHMA 1DOEA 4NWZA 3AWIA 5KXJA 2A8XA 4MJWA 3F8DA 3GSIA 4H2RA 2OLOA 1IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYJ A;  3P9U A;  5EBK A;  5U1O A;  2B7R A;  4U8J A;  1QO8 A;  4TM0 A;  3KVE A;  2WET A;  3NTA A;  1DXL A;  1D4D A;  2YG7 A;  4N9X A;  1DJQ A;  4B68 A;  3ADA B;  1GES A;  4EIQ A;  2ZZC A;  3KD9 A;  4LII A;  3RNM A;  3UKH A;  2X8H A;  5BRT A;  4OPI A;  1VRQ B;  3CNS A;  4JQ9 A;  3UKP A;  1F8W A;  4YWO A;  2BC0 A;  3NHO X;  2OLN A;  3NYF A;  1ONF A;  2BCP A;  2V3B A;  1F8S A;  3UTF A;  2XFP A;  1NEN A;  2V60 A;  3H8L A;  4H50 A;  2YLW A;  3AD9 B;  4KPR A;  2FJE A;  2WHD A;  2R4E A;  3FBS A;  2ACZ A;  3ATR A;  2ZZB A;  4RG4 A;  3AEG A;  4H2P A;  1EBD A;  1BGN A;  1LQU A;  1BWC A;  2QAE A;  4B1B A;  1GRT A;  1IUS A;  3BI5 A;  4JY3 A;  4CNK A;  4C77 A;  2WES A;  4FK1 C;  3FIM B;  2GR2 A;  2HQM A;  4DGK A;  1NDA A;  4TM3 A;  4USQ A;  3IF9 A;  3UKK A;  1ZDL A;  3AEE A;  3FG2 P;  4NEW A;  1TDK A;  3KKJ A;  1V59 A;  5FMH A;  5M10 A;  1DNC A;  2Q7V A;  2BA9 A;  1H83 A;  3SQP A;  4A6N A;  3V3N A;  1E6E A;  4B64 A;  1ZOV A;  4IV9 A;  3WE0 A;  4H4S A;  4DNA A;  3LAD A;  4H4U A;  4Z24 A;  1GT8 A;  2Q6U A;  2AR8 A;  4CCR A;  4B67 A;  3UOY A;  3VRB A;  3GWF A;  3ATQ A;  2RGJ A;  4M52 A;  3NIX A;  2B9W A;  3NH3 X;  2C67 A;  3AE7 A;  3ZYX A;  1GRG A;  3K7Q X;  3NNE A;  2YR5 A;  1KSS A;  3KU9 A;  4O5Q A;  1F6M A;  4J31 A;  4K8D A;  1LV0 A;  1OJA A;  4IVO B;  1DOC A;  2FJA A;  1KSU A;  2CVJ A;  3NYE A;  4U2S A;  2R0P A;  3GRS A;  1XHC A;  1N4V A;  3QSS A;  4JNA A;  4YXD A;  2YG4 A;  1XPQ A;  2WPC A;  1IUU A;  2XVF A;  1H81 A;  1QJD A;  2WDQ A;  5M0Z A;  3AEF A;  4H4X A;  2VVL A;  1PBC A;  3K7M X;  3UP4 A;  1D4E A;  4Z44 A;  4K22 A;  4IA5 A;  1P2H A;  1OJT A;  2V3A A;  3CGE A;  1YQ3 A;  3B3R A;  1H82 A;  2WP6 A;  3UOX A;  1CJ3 A;  1XDI A;  2XVE A;  1S2Q A;  2XLP A;  4CCQ A;  1GSN A;  1JRX A;  1PBE A;  5JCK A;  2GAG B;  1KNP A;  1ZY8 A;  1B4V A;  2R4J A;  3CNP A;  3NLC A;  1DOB A;  1BGJ A;  4USR A;  2BXS A;  1FCD A;  1LVL A;  4OPL A;  4O5U A;  2YVG A;  1TDO A;  4AOX A;  3CTY A;  5IQ4 A;  1S3E A;  3P1W A;  1L9D A;  1CC2 A;  3O0H A;  3LZW A;  3BNU A;  4H7U A;  4A9W A;  3NK0 X;  2VQ7 A;  3VRD B;  4Z43 A;  2JAE A;  1COY A;  2EQ7 A;  3SGL A;  2C65 A;  1GRA A;  4EQW A;  2RAB A;  3NN6 X;  3URH A;  1L0V A;  3EPT A;  1PDH A;  3AE6 A;  1ZK7 A;  4IA6 A;  4CBQ A;  3AE9 A;  3E1T A;  3ICT A;  3RP7 A;  2C72 A;  3UTE A;  4HB9 A;  1K0I A;  3SFD A;  2GAH B;  5FS6 A;  4OPU A;  1NPX A;  2XLU A;  4YKF A;  5L46 A;  1B5Q A;  1PXC A;  1VG9 A;  3AE5 A;  4ADW A;  1JRZ A;  4EM4 A;  1DJN A;  2GMJ A;  3NK1 X;  4P9S A;  2C66 A;  4OPG A;  2YG3 A;  4AP1 A;  2WOV A;  4FK1 A;  4NEV A;  3LXD A;  4K7Z A;  4GF7 A;  4FX9 A;  4YSH A;  4I58 A;  2GV8 A;  4J34 A;  4AP3 A;  2RGH A;  1H84 A;  3BHK A;  3DA1 A;  2XLT A;  3CGD A;  5HHF A;  1KFY A;  3DJD A;  3VR9 A;  4CRT A;  4OPC A;  5FS7 A;  2BK3 A;  1E1M A;  2Q0L A;  4U8K A;  2E4G A;  4YKG A;  1ZKQ A;  2XYO A;  1LJ1 A;  1YKJ A;  4Y4M A;  1Q1W A;  2C64 A;  2C75 A;  1PBF A;  4BJY A;  1P2E A;  2QA2 A;  4H4Y A;  4AT2 A;  2YQU A;  1JNR A;  3C4A A;  4J57 A;  3RP8 A;  4C3Y A;  1S2Y A;  3NYC A;  1VDC A;  5EOW A;  4CY6 A;  3UTG A;  1OJ9 A;  2BAB A;  3DK9 A;  2XFO A;  1BF3 A;  2VVL G;  4GCM A;  3UKL A;  1E1L A;  2X3N A;  4XWR A;  4TLX A;  3CIR A;  1E1K A;  2R46 A;  3UKF A;  2BCG G;  2WPF A;  3ITJ A;  2XFQ A;  1N4W A;  3P4S A;  2C70 A;  3UOZ A;  5JCL A;  2JBV A;  3AD8 B;  2IID A;  4A7A A;  4ZCD A;  4J33 A;  4OVI A;  3QFB A;  2FJD A;  4TM1 A;  4Y4L A;  3RED A;  4YT0 A;  2WDV A;  3AE1 A;  2Y6R A;  2XFU A;  3AYI A;  3PS9 A;  4B65 A;  1ELI A;  3LB8 A;  4ZN0 A;  3BNM A;  1TDE A;  4B69 A;  3S61 A;  2IVE A;  2JB1 A;  4BUR A;  4E0V A;  3DH9 A;  3L1R A;  3QJ4 A;  4EMI A;  4A65 A;  1H7X A;  3AD7 B;  1N1P A;  3AEC A;  1OJD A;  3AEB A;  1GET A;  3CGB A;  2GQW A;  1O95 A;  3VR8 A;  4APN A;  2TPR A;  2C7G A;  2BK4 A;  2B9X A;  3AE3 A;  4J36 A;  4D03 A;  1JNZ A;  4B63 A;  2GVC A;  4BK1 A;  3GDN A;  1D7Y A;  1NG4 A;  1B37 A;  4H4Z A;  1GV4 A;  3DME A;  3IWA A;  3II4 A;  1REO A;  4A79 A;  1FOH A;  2GH5 A;  1GRB A;  3P4R A;  3EF6 A;  3DJJ A;  3FMW A;  1ZOY A;  2YLT A;  3RHA A;  3GMB A;  1IJH A;  1VG0 A;  3BI4 A;  4LU6 A;  4GUV A;  1Q9I A;  4YTN A;  1BKW A;  1GXF A;  1D5T A;  4RG3 A;  4JY2 A;  1NHR A;  5IQ1 A;  4BV6 A;  1NG3 A;  3LJP A;  4X9M A;  5HXI A;  2XCG A;  4H2Q A;  2J3N A;  3AED A;  4YTP A;  5J7X A;  2X99 A;  1QLB A;  1OJC A;  3NGC X;  1PS9 A;  2GEW A;  1F3P A;  3SM8 A;  1XAN A;  2XLR A;  1K0J A;  2QA1 A;  1TDN A;  2YVJ A;  4PAB A;  4OPD A;  4U2L A;  2VOU A;  4J2W A;  2IVD A;  4YSY A;  4Z2R A;  2YLS A;  4H4V A;  1E39 A;  3NRN A;  2V5Z A;  1SEZ A;  5DBJ A;  3CND A;  4KX6 A;  1RP0 A;  3ALL A;  3V76 A;  3V3O A;  5KOW A;  1KF6 A;  4EQS A;  4U8P A;  2YG6 A;  5TR3 A;  4GDE A;  3ZDN A;  3K30 A;  2ZBW A;  4OPT A;  2H88 A;  1M64 A;  4XWZ A;  4K5S A;  1NAA A;  3CNJ A;  2R0C A;  1LTX R;  2WU2 A;  3CN8 A;  3G5S A;  2R0G A;  4LA1 A;  1CF3 A;  1Q1R A;  2XVJ A;  1JEH A;  2Q0K A;  2FBW A;  4Z2U A;  2C76 A;  3QSE A;  2E1M A;  4K2X A;  3Q9T A;  4BK2 A;  1TYP A;  5FS8 A;  5IPY A;  3NN0 X;  3UKQ A;  1PBD A;  2V6O A;  4FDC B;  4A99 A;  1CJ2 A;  3IC9 A;  5J60 A;  3LZX A;  1GTE A;  3AEA A;  4YSZ A;  4ECH A;  4ZCC A;  2GR0 A;  2YR4 A;  1GND A;  2APG A;  4NTE A;  4TLZ A;  1TYT A;  1L9E A;  4H4W A;  4CY8 A;  1KDG A;  1W4X A;  4A5L A;  3M13 A;  4YTM A;  4J56 A;  1NHQ A;  1Y0P A;  2DKI A;  2VZ2 A;  3GRT A;  5BUK A;  1GRE A;  2X8G A;  1NEK A;  2EQ6 A;  3H4K A;  3L8K A;  1RSG A;  1BZL A;  3S5W A;  3K7T A;  4D04 A;  3COX A;  4NZH A;  3ISH A;  3SFE A;  3PO7 A;  3UOV A;  2X50 A;  2YLZ A;  4X4J A;  2I0Z A;  3DJG X;  4IVM B;  4CNJ A;  1K0L A;  3G5R A;  3P4P A;  2WEU A;  3QVP A;  1ZMC A;  1K4Q A;  2XDO A;  1L9C A;  3GYI A;  3I3L A;  1FEC A;  1B8S A;  3VQR A;  4DSG A;  1CBO A;  1MOK A;  1D4C A;  1PHH A;  2YAU A;  2C73 A;  3BI2 A;  3NT6 A;  3OZ2 A;  5KVH A;  1NHS A;  2BS4 A;  3GWD A;  4U8M A;  3DK8 A;  4H4P A;  3RP6 A;  3CPI G;  4JN9 A;  1NHP A;  2GF3 A;  2XLS A;  2QCU A;  3GDP A;  5BVA A;  1FL2 A;  2DKH A;  2A87 A;  3OC4 A;  5KOX A;  2BC1 A;  4Z26 A;  2V61 A;  3GMC A;  1GRH A;  1DOD A;  1JU2 A;  1PJ5 A;  2GR1 A;  1Y56 A;  1JOA A;  1LQT A;  2B76 A;  2WP5 A;  2NVK X;  4UDQ A;  2YLX A;  2AAQ A;  2JB2 A;  2OA1 A;  4AOS A;  4EMJ A;  2X8C A;  2WS3 A;  4EM3 A;  3ALM A;  4ICY A;  1IUT A;  1HYU A;  1E1N A;  2YM2 A;  2R45 A;  5CQF A;  5JCM A;  4Y4N A;  5JCN A;  4H2N A;  4EQX A;  5LV9 A;  2BAC A;  2GR3 A;  3IHG A;  1ZMD A;  1GTH A;  1CJ4 A;  3EAN A;  1CHU A;  3UCL A;  1Z6L A;  4AT0 A;  4U8N A;  2R9Z A;  3DGZ A;  1PJ7 A;  2UZZ A;  3UP5 A;  1MXT A;  3EAO A;  4DSH A;  1CC4 A;  2JK6 A;  3AB1 A;  4TM4 A;  2YVF A;  2WPE A;  4EIP A;  1M6I A;  3KPF A;  2WBA A;  1FEB A;  3AYL A;  3D1C A;  4RSL A;  4UDR A;  4C3X A;  3CGC A;  1GRF A;  1ZP0 A;  1IUW A;  1CL0 A;  3GD3 A;  3BHF A;  4I59 A;  1E7P A;  2B7S A;  1O5W A;  5FS9 A;  4C5O A;  3AYJ A;  1N4U A;  4U2T A;  5U25 A;  2WP9 A;  2OAM A;  4Z2T A;  1TRB A;  5EB5 A;  2Z5X A;  2C3D A;  1ZX9 A;  1YQZ A;  2VRL A;  2Z5Y A;  3HZL A;  5KVI A;  2YR6 A;  2RGO A;  1FEA A;  2BK5 A;  3NKS A;  1H7W A;  4GR1 A;  3FPZ A;  3QSM A;  3LOV A;  3DJE A;  1JRY A;  3DGH A;  2BS3 A;  3PVC A;  2W0H A;  1EL7 A;  2ZZ0 A;  4JNQ A;  1TDF A;  3DK4 A;  2WDR A;  2BXR A;  3QFA A;  2CUL A;  5EB4 A;  4EQR A;  1PN0 A;  1PBB A;  1GEU A;  1S3B A;  1PXB A;  2XVH A;  4OCG A;  3T37 A;  2YWL A;  3F8P A;  3KLJ A;  5GSN A;  1IUV A;  1H6V A;  1LPF A;  4HA6 A;  3B6D A;  5BUL A;  4H4Q A;  4UP3 A;  5JCI A;  2VRM A;  2C3C A;  2ARD A;  2VQB A;  2XVI A;  4YSX A;  1YQ4 A;  2CFY A;  1GPE A;  2TMD A;  1YY5 A;  1H86 A;  2YLR A;  1X31 B;  2E5V A;  4BJZ A;  5CKU A;  4NTC A;  3C4N A;  1KNR A;  1GER A;  3NK2 X;  2WU5 A;  3QVR A;  4GRT A;  1D7L A;  3H8I A;  2VVM A;  1RYI A;  1Y56 B;  5C2T A;  3NTD A;  1AOG A;  2Y6Q A;  4GDP A;  3C96 A;  3ALJ A;  3GD4 A;  3AE8 A;  3R9U A;  2F5Z A;  5U63 A;  1F8R A;  2O9Z A;  2OAL A;  2XFN A;  4U8L A;  2GMH A;  5KRQ A;  4NTD A;  4C74 A;  3AXB A;  4PAA A;  2A89 A;  4U8I A;  1EL5 A;  4B66 A;  3G5Q A;  3CPH G;  1GOS A;  3UTH A;  4UDP A;  4WCT A;  2H89 A;  3JSK A;  1PXA A;  4X9N A;  4Z25 A;  1PJ6 A;  2WQY A;  2GRT A;  3CPJ G;  2CDU A;  2EQ8 A;  3ICS A;  2FJB A;  5HYM A;  2BS2 A;  2JB3 A;  2PYX A;  2PHH A;  5HY5 A;  1EL9 A;  4U8O A;  1UKV G;  1VQW A;  2B9Y A;  5C3J A;  4BK3 A;  4H4T A;  2EQ9 A;  1EL8 A;  4WX1 A;  3AE4 A;  3CNT A;  2AQJ A;  1CC6 A;  1GAL A;  1MO9 A;  4H4R A;  4XXG A;  3F8R A;  3ICR A;  3P4Q A;  2GQF A;  3Q6J A;  4JDR A;  3M0O A;  3ABV A;  3VRA A;  4A6N B;  2WOI A;  3AE2 A;  1CJC A;  3I6D A;  2WOW A;  2GB0 A;  4REK A;  4EMW A;  4K5R A;  5GRT A;  3D8X A;  3NG7 X;  3KA7 A;  2NPX A;  2BYB A;  2JKC A;  2YG5 A;  3M12 A;  3UKA A;  2YM1 A;  5KWF A;  5ER0 A;  1O94 A;  3IHM A;  1DOE A;  3AWI A;  5KXJ A;  2A8X A;  4MJW A;  3F8D A;  3GSI A;  4H2R A;  2OLO A;  1IUX A; 
#chains in the Genus database with same CATH topology
 3GYJ A;  3P9U A;  5EBK A;  5U1O A;  2B7R A;  4U8J A;  1QO8 A;  4TM0 A;  3KVE A;  2WET A;  3NTA A;  1DXL A;  1D4D A;  2YG7 A;  4N9X A;  1DJQ A;  4B68 A;  3ADA B;  1GES A;  4EIQ A;  2ZZC A;  3KD9 A;  4LII A;  3RNM A;  3UKH A;  2X8H A;  5BRT A;  4OPI A;  1VRQ B;  3CNS A;  4JQ9 A;  3UKP A;  1F8W A;  4YWO A;  2BC0 A;  3NHO X;  2OLN A;  3NYF A;  1ONF A;  2BCP A;  2V3B A;  1F8S A;  3UTF A;  2XFP A;  1NEN A;  2V60 A;  3H8L A;  4H50 A;  2YLW A;  3AD9 B;  4KPR A;  2FJE A;  2WHD A;  2R4E A;  3FBS A;  2ACZ A;  3ATR A;  2ZZB A;  4RG4 A;  3AEG A;  4H2P A;  1EBD A;  1BGN A;  1LQU A;  1BWC A;  2QAE A;  4B1B A;  1GRT A;  1IUS A;  3BI5 A;  4JY3 A;  4CNK A;  4C77 A;  2WES A;  4FK1 C;  3FIM B;  2GR2 A;  2HQM A;  3T0K A;  4DGK A;  1NDA A;  4TM3 A;  4USQ A;  3IF9 A;  3UKK A;  1ZDL A;  3AEE A;  3FG2 P;  4NEW A;  1TDK A;  3KKJ A;  1V59 A;  5FMH A;  5M10 A;  1DNC A;  2Q7V A;  2BA9 A;  1H83 A;  3SQP A;  3SZW A;  3V3N A;  1E6E A;  4A6N A;  1ZOV A;  4IV9 A;  3WE0 A;  4H4S A;  4B64 A;  4DNA A;  3LAD A;  4H4U A;  4Z24 A;  1GT8 A;  2Q6U A;  2AR8 A;  4CCR A;  4B67 A;  3UOY A;  3SZC A;  3VRB A;  3GWF A;  3ATQ A;  2RGJ A;  4M52 A;  3NIX A;  2B9W A;  3NH3 X;  2C67 A;  3AE7 A;  3ZYX A;  1GRG A;  3K7Q X;  3NNE A;  2YR5 A;  1KSS A;  3KU9 A;  4O5Q A;  1F6M A;  3HYV A;  4J31 A;  4K8D A;  1LV0 A;  1OJA A;  4IVO B;  1DOC A;  2FJA A;  1KSU A;  2CVJ A;  3NYE A;  4U2S A;  2R0P A;  3GRS A;  1XHC A;  1N4V A;  3QSS A;  4JNA A;  4YXD A;  2YG4 A;  1XPQ A;  2WPC A;  1IUU A;  2XVF A;  1H81 A;  1QJD A;  2WDQ A;  5M0Z A;  3AEF A;  4H4X A;  2VVL A;  1PBC A;  3K7M X;  3UP4 A;  1D4E A;  4Z44 A;  4K22 A;  4IA5 A;  1P2H A;  1OJT A;  2V3A A;  5KMP A;  3CGE A;  1YQ3 A;  3B3R A;  1H82 A;  2WP6 A;  3UOX A;  1CJ3 A;  1XDI A;  2XVE A;  1S2Q A;  2XLP A;  4CCQ A;  1GSN A;  1JRX A;  1PBE A;  5JCK A;  2GAG B;  1KNP A;  1ZY8 A;  1B4V A;  2R4J A;  3CNP A;  3SZF A;  3NLC A;  1DOB A;  1BGJ A;  4USR A;  2BXS A;  1FCD A;  1LVL A;  4OPL A;  4O5U A;  4II2 A;  2YVG A;  1TDO A;  4AOX A;  3CTY A;  5IQ4 A;  1S3E A;  3P1W A;  1L9D A;  1CC2 A;  3O0H A;  3LZW A;  3BNU A;  4H7U A;  4A9W A;  3NK0 X;  2VQ7 A;  3VRD B;  4Z43 A;  2JAE A;  1COY A;  2EQ7 A;  3SGL A;  2BRA A;  2C65 A;  1GRA A;  4EQW A;  2RAB A;  3NN6 X;  3URH A;  1L0V A;  3EPT A;  1PDH A;  3AE6 A;  1ZK7 A;  4IA6 A;  4CBQ A;  3AE9 A;  3E1T A;  3ICT A;  3RP7 A;  2C72 A;  4GAV A;  3UTE A;  4HB9 A;  1K0I A;  3SFD A;  2GAH B;  5FS6 A;  4OPU A;  1NPX A;  2XLU A;  4YKF A;  5L46 A;  1B5Q A;  1PXC A;  1VG9 A;  3AE5 A;  4ADW A;  1JRZ A;  4EM4 A;  1DJN A;  2GMJ A;  3NK1 X;  4P9S A;  2C66 A;  4OPG A;  2YG3 A;  4GAP A;  4AP1 A;  2WOV A;  4FK1 A;  4NEV A;  3LXD A;  4K7Z A;  4GF7 A;  4FX9 A;  4YSH A;  4I58 A;  2GV8 A;  4J34 A;  4AP3 A;  2RGH A;  1H84 A;  3BHK A;  3DA1 A;  2XLT A;  3CGD A;  5HHF A;  1KFY A;  3DJD A;  3VR9 A;  4CRT A;  4OPC A;  5FS7 A;  2BK3 A;  4G6H A;  1E1M A;  2Q0L A;  4U8K A;  2E4G A;  4YKG A;  1ZKQ A;  2XYO A;  1LJ1 A;  1YKJ A;  4Y4M A;  1Q1W A;  2C64 A;  2C75 A;  1PBF A;  4BJY A;  1P2E A;  2QA2 A;  4H4Y A;  4AT2 A;  2YQU A;  1JNR A;  3C4A A;  4J57 A;  3RP8 A;  4C3Y A;  1S2Y A;  3NYC A;  1VDC A;  4NNJ A;  5EOW A;  5KMQ A;  3UTG A;  4CY6 A;  1OJ9 A;  2BAB A;  3DK9 A;  2XFO A;  1BF3 A;  2VVL G;  4GCM A;  3UKL A;  1E1L A;  2X3N A;  4XWR A;  4TLX A;  3CIR A;  1E1K A;  2R46 A;  3UKF A;  2BCG G;  2WPF A;  5KNL A;  3ITJ A;  2XFQ A;  1N4W A;  3P4S A;  2C70 A;  3UOZ A;  5JCL A;  2JBV A;  3AD8 B;  3T14 A;  2IID A;  4A7A A;  4ZCD A;  4J33 A;  4OVI A;  3QFB A;  2FJD A;  4TM1 A;  4Y4L A;  3RED A;  4YT0 A;  2WDV A;  3AE1 A;  2Y6R A;  2XFU A;  3AYI A;  3PS9 A;  4B65 A;  1ELI A;  3LB8 A;  4ZN0 A;  3BNM A;  1TDE A;  4B69 A;  3S61 A;  2IVE A;  2JB1 A;  4BUR A;  4E0V A;  3DH9 A;  3L1R A;  3QJ4 A;  4EMI A;  4A65 A;  5KMR A;  1H7X A;  3AD7 B;  1N1P A;  3AEC A;  1OJD A;  3AEB A;  1GET A;  3CGB A;  2GQW A;  1O95 A;  3VR8 A;  4APN A;  2TPR A;  2C7G A;  2BK4 A;  2B9X A;  3AE3 A;  4J36 A;  4D03 A;  1JNZ A;  4B63 A;  2GVC A;  4BK1 A;  3GDN A;  1D7Y A;  1NG4 A;  1B37 A;  4H4Z A;  1GV4 A;  3DME A;  3IWA A;  3II4 A;  1REO A;  4A79 A;  1FOH A;  2GH5 A;  1GRB A;  3P4R A;  3EF6 A;  3DJJ A;  4G9K A;  3FMW A;  1ZOY A;  2YLT A;  3HYW A;  2BRY A;  3GMB A;  1IJH A;  1VG0 A;  3RHA A;  3BI4 A;  4LU6 A;  4GUV A;  1Q9I A;  4YTN A;  1BKW A;  1GXF A;  1D5T A;  4RG3 A;  4JY2 A;  1NHR A;  5IQ1 A;  4BV6 A;  1NG3 A;  3LJP A;  4X9M A;  5HXI A;  2XCG A;  4H2Q A;  2J3N A;  3AED A;  4YTP A;  5J7X A;  2X99 A;  1QLB A;  1OJC A;  3NGC X;  1PS9 A;  2GEW A;  1F3P A;  3SM8 A;  1XAN A;  2XLR A;  1K0J A;  2QA1 A;  1TDN A;  2YVJ A;  4PAB A;  4OPD A;  4U2L A;  2VOU A;  4J2W A;  2IVD A;  4YSY A;  3CMM A;  2YLS A;  4Z2R A;  4H4V A;  1E39 A;  3NRN A;  2V5Z A;  1SEZ A;  5DBJ A;  3CND A;  4KX6 A;  1RP0 A;  3ALL A;  3V76 A;  3V3O A;  5KOW A;  1KF6 A;  4EQS A;  4U8P A;  2YG6 A;  5TR3 A;  4GDE A;  3ZDN A;  3K30 A;  2ZBW A;  4OPT A;  2H88 A;  1M64 A;  4XWZ A;  4K5S A;  1NAA A;  3CNJ A;  2R0C A;  1LTX R;  2WU2 A;  3CN8 A;  3G5S A;  2R0G A;  4LA1 A;  1CF3 A;  1Q1R A;  2XVJ A;  1JEH A;  2Q0K A;  2FBW A;  4Z2U A;  2C76 A;  3QSE A;  2E1M A;  4K2X A;  3Q9T A;  4BK2 A;  1TYP A;  5FS8 A;  5IPY A;  3NN0 X;  3UKQ A;  1PBD A;  2V6O A;  4FDC B;  4II3 A;  1CJ2 A;  3IC9 A;  4A99 A;  3LZX A;  5J60 A;  1GTE A;  3AEA A;  4YSZ A;  4ECH A;  4ZCC A;  2GR0 A;  2YR4 A;  1GND A;  2APG A;  4NTE A;  4TLZ A;  1TYT A;  1L9E A;  4H4W A;  4CY8 A;  1KDG A;  1W4X A;  4A5L A;  3M13 A;  4YTM A;  4J56 A;  3T31 A;  1NHQ A;  1Y0P A;  2DKI A;  2VZ2 A;  3GRT A;  5BUK A;  1GRE A;  2X8G A;  1NEK A;  2EQ6 A;  3H4K A;  3L8K A;  1RSG A;  1BZL A;  3S5W A;  3K7T A;  4D04 A;  3COX A;  4NZH A;  3ISH A;  3SFE A;  3PO7 A;  3UOV A;  2X50 A;  2YLZ A;  4X4J A;  2I0Z A;  3DJG X;  4IVM B;  4CNJ A;  1K0L A;  2C4C A;  3G5R A;  3P4P A;  2WEU A;  3QVP A;  1ZMC A;  1K4Q A;  2XDO A;  1L9C A;  3GYI A;  3I3L A;  1FEC A;  1B8S A;  3VQR A;  4DSG A;  1CBO A;  1MOK A;  1D4C A;  1PHH A;  2YAU A;  2C73 A;  3BI2 A;  3NT6 A;  3OZ2 A;  3T2Z A;  5KVH A;  1NHS A;  2BS4 A;  3GWD A;  4U8M A;  3DK8 A;  4H4P A;  3RP6 A;  3CPI G;  4JN9 A;  1NHP A;  2GF3 A;  2XLS A;  2QCU A;  3GDP A;  5BVA A;  1FL2 A;  2DKH A;  2A87 A;  3OC4 A;  5KOX A;  2BC1 A;  4Z26 A;  2V61 A;  3GMC A;  1GRH A;  1DOD A;  1JU2 A;  1PJ5 A;  2GR1 A;  1Y56 A;  1JOA A;  1LQT A;  2B76 A;  2WP5 A;  2NVK X;  4UDQ A;  2YLX A;  2AAQ A;  2JB2 A;  2OA1 A;  4AOS A;  4EMJ A;  2X8C A;  2WS3 A;  4EM3 A;  3ALM A;  4ICY A;  1IUT A;  1HYU A;  1E1N A;  2YM2 A;  2R45 A;  5CQF A;  5JCM A;  4Y4N A;  5JCN A;  4H2N A;  4EQX A;  5LV9 A;  2BAC A;  2GR3 A;  3IHG A;  1ZMD A;  1GTH A;  1CJ4 A;  3EAN A;  1CHU A;  3UCL A;  1Z6L A;  4AT0 A;  4U8N A;  2R9Z A;  3DGZ A;  1PJ7 A;  2UZZ A;  3UP5 A;  1MXT A;  3EAO A;  4DSH A;  1CC4 A;  2JK6 A;  3AB1 A;  4TM4 A;  3SX6 A;  2YVF A;  2WPE A;  4EIP A;  1M6I A;  3KPF A;  2WBA A;  1FEB A;  3AYL A;  3D1C A;  4RSL A;  4UDR A;  4C3X A;  3CGC A;  1GRF A;  1ZP0 A;  1IUW A;  1CL0 A;  3GD3 A;  3BHF A;  3KPK A;  1E7P A;  2B7S A;  1O5W A;  3HYX A;  4I59 A;  5FS9 A;  3AYJ A;  1N4U A;  4U2T A;  5U25 A;  3SY4 A;  2WP9 A;  2OAM A;  4Z2T A;  1TRB A;  5EB5 A;  2Z5X A;  2C3D A;  1ZX9 A;  1YQZ A;  2VRL A;  2Z5Y A;  3HZL A;  5KVI A;  2YR6 A;  2RGO A;  1FEA A;  2BK5 A;  3NKS A;  1H7W A;  4GR1 A;  3FPZ A;  3QSM A;  3LOV A;  3DJE A;  1JRY A;  3DGH A;  2BS3 A;  3PVC A;  2W0H A;  1EL7 A;  2ZZ0 A;  4JNQ A;  1TDF A;  3DK4 A;  2WDR A;  2BXR A;  3QFA A;  2CUL A;  5EB4 A;  4EQR A;  1PN0 A;  1PBB A;  1GEU A;  1S3B A;  1PXB A;  2XVH A;  3T2Y A;  4OCG A;  3T37 A;  4G74 A;  2YWL A;  3F8P A;  3KLJ A;  5GSN A;  4C5O A;  1IUV A;  1H6V A;  1LPF A;  4HA6 A;  3B6D A;  5BUL A;  4H4Q A;  4UP3 A;  5JCI A;  5KMS A;  2VRM A;  2C3C A;  2ARD A;  3SYI A;  2VQB A;  2XVI A;  4YSX A;  1YQ4 A;  4G6G A;  2CFY A;  1GPE A;  2TMD A;  1YY5 A;  1H86 A;  2YLR A;  1X31 B;  2E5V A;  4BJZ A;  5CKU A;  4NTC A;  3C4N A;  1KNR A;  1GER A;  3NK2 X;  2WU5 A;  3QVR A;  4GRT A;  1D7L A;  3H8I A;  2VVM A;  1RYI A;  1Y56 B;  3T2K A;  5C2T A;  3NTD A;  4G73 A;  1AOG A;  3SXI A;  2Y6Q A;  4GDP A;  3C96 A;  3ALJ A;  3GD4 A;  3AE8 A;  3R9U A;  2F5Z A;  5U63 A;  1F8R A;  2O9Z A;  2OAL A;  2XFN A;  4U8L A;  2GMH A;  5KRQ A;  4NTD A;  4C74 A;  3AXB A;  4PAA A;  2A89 A;  4U8I A;  1EL5 A;  4B66 A;  3G5Q A;  3CPH G;  1GOS A;  3UTH A;  3GYX A;  4UDP A;  4WCT A;  2H89 A;  3JSK A;  1PXA A;  4X9N A;  4Z25 A;  1PJ6 A;  2WQY A;  2GRT A;  3CPJ G;  2CDU A;  2EQ8 A;  3ICS A;  2FJB A;  5HYM A;  2BS2 A;  2JB3 A;  2PYX A;  2PHH A;  5HY5 A;  1EL9 A;  4U8O A;  1UKV G;  1VQW A;  2B9Y A;  3SZ0 A;  5C3J A;  4BK3 A;  4H4T A;  2EQ9 A;  1EL8 A;  4WX1 A;  3AE4 A;  3CNT A;  2AQJ A;  1CC6 A;  1GAL A;  1MO9 A;  4H4R A;  4XXG A;  3F8R A;  3ICR A;  3P4Q A;  2GQF A;  3Q6J A;  4JDR A;  3M0O A;  3ABV A;  3VRA A;  4A6N B;  2WOI A;  3AE2 A;  1CJC A;  3I6D A;  2WOW A;  2GB0 A;  4REK A;  4EMW A;  4K5R A;  5GRT A;  3D8X A;  3NG7 X;  3KA7 A;  2NPX A;  2BYB A;  2JKC A;  2YG5 A;  3M12 A;  3UKA A;  2YM1 A;  5KWF A;  5ER0 A;  1O94 A;  3IHM A;  1DOE A;  4NWZ A;  3AWI A;  5KXJ A;  2A8X A;  4MJW A;  3F8D A;  3GSI A;  4H2R A;  2OLO A;  1IUX A; 
#chains in the Genus database with same CATH homology
 3GYJ A;  3P9U A;  5EBK A;  5U1O A;  2B7R A;  4U8J A;  1QO8 A;  4TM0 A;  3KVE A;  2WET A;  3NTA A;  1DXL A;  1D4D A;  2YG7 A;  4N9X A;  1DJQ A;  4B68 A;  3ADA B;  1GES A;  4EIQ A;  2ZZC A;  3KD9 A;  4LII A;  3RNM A;  3UKH A;  2X8H A;  5BRT A;  4OPI A;  1VRQ B;  3CNS A;  4JQ9 A;  3UKP A;  1F8W A;  4YWO A;  2BC0 A;  3NHO X;  2OLN A;  3NYF A;  1ONF A;  2BCP A;  2V3B A;  1F8S A;  3UTF A;  2XFP A;  1NEN A;  2V60 A;  3H8L A;  4H50 A;  2YLW A;  3AD9 B;  4KPR A;  2FJE A;  2WHD A;  2R4E A;  3FBS A;  2ACZ A;  3ATR A;  2ZZB A;  4RG4 A;  3AEG A;  4H2P A;  1EBD A;  1BGN A;  1LQU A;  1BWC A;  2QAE A;  4B1B A;  1GRT A;  1IUS A;  3BI5 A;  4JY3 A;  4CNK A;  4C77 A;  2WES A;  4FK1 C;  3FIM B;  2GR2 A;  2HQM A;  3T0K A;  4DGK A;  1NDA A;  4TM3 A;  4USQ A;  3IF9 A;  3UKK A;  1ZDL A;  3AEE A;  3FG2 P;  4NEW A;  1TDK A;  3KKJ A;  1V59 A;  5FMH A;  5M10 A;  1DNC A;  2Q7V A;  2BA9 A;  1H83 A;  3SQP A;  3SZW A;  3V3N A;  1E6E A;  4A6N A;  1ZOV A;  4IV9 A;  3WE0 A;  4H4S A;  4B64 A;  4DNA A;  3LAD A;  4H4U A;  4Z24 A;  1GT8 A;  2Q6U A;  2AR8 A;  4CCR A;  4B67 A;  3UOY A;  3SZC A;  3VRB A;  3GWF A;  3ATQ A;  2RGJ A;  4M52 A;  3NIX A;  2B9W A;  3NH3 X;  2C67 A;  3AE7 A;  3ZYX A;  1GRG A;  3K7Q X;  3NNE A;  2YR5 A;  1KSS A;  3KU9 A;  4O5Q A;  1F6M A;  3HYV A;  4J31 A;  4K8D A;  1LV0 A;  1OJA A;  4IVO B;  1DOC A;  2FJA A;  1KSU A;  2CVJ A;  3NYE A;  4U2S A;  2R0P A;  3GRS A;  1XHC A;  1N4V A;  3QSS A;  4JNA A;  4YXD A;  2YG4 A;  1XPQ A;  2WPC A;  1IUU A;  2XVF A;  1H81 A;  1QJD A;  2WDQ A;  5M0Z A;  3AEF A;  4H4X A;  2VVL A;  1PBC A;  3K7M X;  3UP4 A;  1D4E A;  4Z44 A;  4K22 A;  4IA5 A;  1P2H A;  1OJT A;  2V3A A;  5KMP A;  3CGE A;  1YQ3 A;  3B3R A;  1H82 A;  2WP6 A;  3UOX A;  1CJ3 A;  1XDI A;  2XVE A;  1S2Q A;  2XLP A;  4CCQ A;  1GSN A;  1JRX A;  1PBE A;  5JCK A;  2GAG B;  1KNP A;  1ZY8 A;  1B4V A;  2R4J A;  3CNP A;  3SZF A;  3NLC A;  1DOB A;  1BGJ A;  4USR A;  2BXS A;  1FCD A;  1LVL A;  4OPL A;  4O5U A;  4II2 A;  2YVG A;  1TDO A;  4AOX A;  3CTY A;  5IQ4 A;  1S3E A;  3P1W A;  1L9D A;  1CC2 A;  3O0H A;  3LZW A;  3BNU A;  4H7U A;  4A9W A;  3NK0 X;  2VQ7 A;  3VRD B;  4Z43 A;  2JAE A;  1COY A;  2EQ7 A;  3SGL A;  2BRA A;  2C65 A;  1GRA A;  4EQW A;  2RAB A;  3NN6 X;  3URH A;  1L0V A;  3EPT A;  1PDH A;  3AE6 A;  1ZK7 A;  4IA6 A;  4CBQ A;  3AE9 A;  3E1T A;  3ICT A;  3RP7 A;  2C72 A;  4GAV A;  3UTE A;  4HB9 A;  1K0I A;  3SFD A;  2GAH B;  5FS6 A;  4OPU A;  1NPX A;  2XLU A;  4YKF A;  5L46 A;  1B5Q A;  1PXC A;  1VG9 A;  3AE5 A;  4ADW A;  1JRZ A;  4EM4 A;  1DJN A;  2GMJ A;  3NK1 X;  4P9S A;  2C66 A;  4OPG A;  2YG3 A;  4GAP A;  4AP1 A;  2WOV A;  4FK1 A;  4NEV A;  3LXD A;  4K7Z A;  4GF7 A;  4FX9 A;  4YSH A;  4I58 A;  2GV8 A;  4J34 A;  4AP3 A;  2RGH A;  1H84 A;  3BHK A;  3DA1 A;  2XLT A;  3CGD A;  5HHF A;  1KFY A;  3DJD A;  3VR9 A;  4CRT A;  4OPC A;  5FS7 A;  2BK3 A;  4G6H A;  1E1M A;  2Q0L A;  4U8K A;  2E4G A;  4YKG A;  1ZKQ A;  2XYO A;  1LJ1 A;  1YKJ A;  4Y4M A;  1Q1W A;  2C64 A;  2C75 A;  1PBF A;  4BJY A;  1P2E A;  2QA2 A;  4H4Y A;  4AT2 A;  2YQU A;  1JNR A;  3C4A A;  4J57 A;  3RP8 A;  4C3Y A;  1S2Y A;  3NYC A;  1VDC A;  4NNJ A;  5EOW A;  5KMQ A;  3UTG A;  4CY6 A;  1OJ9 A;  2BAB A;  3DK9 A;  2XFO A;  1BF3 A;  2VVL G;  4GCM A;  3UKL A;  1E1L A;  2X3N A;  4XWR A;  4TLX A;  3CIR A;  1E1K A;  2R46 A;  3UKF A;  2BCG G;  2WPF A;  5KNL A;  3ITJ A;  2XFQ A;  1N4W A;  3P4S A;  2C70 A;  3UOZ A;  5JCL A;  2JBV A;  3AD8 B;  3T14 A;  2IID A;  4A7A A;  4ZCD A;  4J33 A;  4OVI A;  3QFB A;  2FJD A;  4TM1 A;  4Y4L A;  3RED A;  4YT0 A;  2WDV A;  3AE1 A;  2Y6R A;  2XFU A;  3AYI A;  3PS9 A;  4B65 A;  1ELI A;  3LB8 A;  4ZN0 A;  3BNM A;  1TDE A;  4B69 A;  3S61 A;  2IVE A;  2JB1 A;  4BUR A;  4E0V A;  3DH9 A;  3L1R A;  3QJ4 A;  4EMI A;  4A65 A;  5KMR A;  1H7X A;  3AD7 B;  1N1P A;  3AEC A;  1OJD A;  3AEB A;  1GET A;  3CGB A;  2GQW A;  1O95 A;  3VR8 A;  4APN A;  2TPR A;  2C7G A;  2BK4 A;  2B9X A;  3AE3 A;  4J36 A;  4D03 A;  1JNZ A;  4B63 A;  2GVC A;  4BK1 A;  3GDN A;  1D7Y A;  1NG4 A;  1B37 A;  4H4Z A;  1GV4 A;  3DME A;  3IWA A;  3II4 A;  1REO A;  4A79 A;  1FOH A;  2GH5 A;  1GRB A;  3P4R A;  3EF6 A;  3DJJ A;  4G9K A;  3FMW A;  1ZOY A;  2YLT A;  3HYW A;  2BRY A;  3GMB A;  1IJH A;  1VG0 A;  3RHA A;  3BI4 A;  4LU6 A;  4GUV A;  1Q9I A;  4YTN A;  1BKW A;  1GXF A;  1D5T A;  4RG3 A;  4JY2 A;  1NHR A;  5IQ1 A;  4BV6 A;  1NG3 A;  3LJP A;  4X9M A;  5HXI A;  2XCG A;  4H2Q A;  2J3N A;  3AED A;  4YTP A;  5J7X A;  2X99 A;  1QLB A;  1OJC A;  3NGC X;  1PS9 A;  2GEW A;  1F3P A;  3SM8 A;  1XAN A;  2XLR A;  1K0J A;  2QA1 A;  1TDN A;  2YVJ A;  4PAB A;  4OPD A;  4U2L A;  2VOU A;  4J2W A;  2IVD A;  4YSY A;  3CMM A;  2YLS A;  4Z2R A;  4H4V A;  1E39 A;  3NRN A;  2V5Z A;  1SEZ A;  5DBJ A;  3CND A;  4KX6 A;  1RP0 A;  3ALL A;  3V76 A;  3V3O A;  5KOW A;  1KF6 A;  4EQS A;  4U8P A;  2YG6 A;  5TR3 A;  4GDE A;  3ZDN A;  3K30 A;  2ZBW A;  4OPT A;  2H88 A;  1M64 A;  4XWZ A;  4K5S A;  1NAA A;  3CNJ A;  2R0C A;  1LTX R;  2WU2 A;  3CN8 A;  3G5S A;  2R0G A;  4LA1 A;  1CF3 A;  1Q1R A;  2XVJ A;  1JEH A;  2Q0K A;  2FBW A;  4Z2U A;  2C76 A;  3QSE A;  2E1M A;  4K2X A;  3Q9T A;  4BK2 A;  1TYP A;  5FS8 A;  5IPY A;  3NN0 X;  3UKQ A;  1PBD A;  2V6O A;  4FDC B;  4II3 A;  1CJ2 A;  3IC9 A;  4A99 A;  3LZX A;  5J60 A;  1GTE A;  3AEA A;  4YSZ A;  4ECH A;  4ZCC A;  2GR0 A;  2YR4 A;  1GND A;  2APG A;  4NTE A;  4TLZ A;  1TYT A;  1L9E A;  4H4W A;  4CY8 A;  1KDG A;  1W4X A;  4A5L A;  3M13 A;  4YTM A;  4J56 A;  3T31 A;  1NHQ A;  1Y0P A;  2DKI A;  2VZ2 A;  3GRT A;  5BUK A;  1GRE A;  2X8G A;  1NEK A;  2EQ6 A;  3H4K A;  3L8K A;  1RSG A;  1BZL A;  3S5W A;  3K7T A;  4D04 A;  3COX A;  4NZH A;  3ISH A;  3SFE A;  3PO7 A;  3UOV A;  2X50 A;  2YLZ A;  4X4J A;  2I0Z A;  3DJG X;  4IVM B;  4CNJ A;  1K0L A;  2C4C A;  3G5R A;  3P4P A;  2WEU A;  3QVP A;  1ZMC A;  1K4Q A;  2XDO A;  1L9C A;  3GYI A;  3I3L A;  1FEC A;  1B8S A;  3VQR A;  4DSG A;  1CBO A;  1MOK A;  1D4C A;  1PHH A;  2YAU A;  2C73 A;  3BI2 A;  3NT6 A;  3OZ2 A;  3T2Z A;  5KVH A;  1NHS A;  2BS4 A;  3GWD A;  4U8M A;  3DK8 A;  4H4P A;  3RP6 A;  3CPI G;  4JN9 A;  1NHP A;  2GF3 A;  2XLS A;  2QCU A;  3GDP A;  5BVA A;  1FL2 A;  2DKH A;  2A87 A;  3OC4 A;  5KOX A;  2BC1 A;  4Z26 A;  2V61 A;  3GMC A;  1GRH A;  1DOD A;  1JU2 A;  1PJ5 A;  2GR1 A;  1Y56 A;  1JOA A;  1LQT A;  2B76 A;  2WP5 A;  2NVK X;  4UDQ A;  2YLX A;  2AAQ A;  2JB2 A;  2OA1 A;  4AOS A;  4EMJ A;  2X8C A;  2WS3 A;  4EM3 A;  3ALM A;  4ICY A;  1IUT A;  1HYU A;  1E1N A;  2YM2 A;  2R45 A;  5CQF A;  5JCM A;  4Y4N A;  5JCN A;  4H2N A;  4EQX A;  5LV9 A;  2BAC A;  2GR3 A;  3IHG A;  1ZMD A;  1GTH A;  1CJ4 A;  3EAN A;  1CHU A;  3UCL A;  1Z6L A;  4AT0 A;  4U8N A;  2R9Z A;  3DGZ A;  1PJ7 A;  2UZZ A;  3UP5 A;  1MXT A;  3EAO A;  4DSH A;  1CC4 A;  2JK6 A;  3AB1 A;  4TM4 A;  3SX6 A;  2YVF A;  2WPE A;  4EIP A;  1M6I A;  3KPF A;  2WBA A;  1FEB A;  3AYL A;  3D1C A;  4RSL A;  4UDR A;  4C3X A;  3CGC A;  1GRF A;  1ZP0 A;  1IUW A;  1CL0 A;  3GD3 A;  3BHF A;  3KPK A;  1E7P A;  2B7S A;  1O5W A;  3HYX A;  4I59 A;  5FS9 A;  3AYJ A;  1N4U A;  4U2T A;  5U25 A;  3SY4 A;  2WP9 A;  2OAM A;  4Z2T A;  1TRB A;  5EB5 A;  2Z5X A;  2C3D A;  1ZX9 A;  1YQZ A;  2VRL A;  2Z5Y A;  3HZL A;  5KVI A;  2YR6 A;  2RGO A;  1FEA A;  2BK5 A;  3NKS A;  1H7W A;  4GR1 A;  3FPZ A;  3QSM A;  3LOV A;  3DJE A;  1JRY A;  3DGH A;  2BS3 A;  3PVC A;  2W0H A;  1EL7 A;  2ZZ0 A;  4JNQ A;  1TDF A;  3DK4 A;  2WDR A;  2BXR A;  3QFA A;  2CUL A;  5EB4 A;  4EQR A;  1PN0 A;  1PBB A;  1GEU A;  1S3B A;  1PXB A;  2XVH A;  3T2Y A;  4OCG A;  3T37 A;  4G74 A;  2YWL A;  3F8P A;  3KLJ A;  5GSN A;  4C5O A;  1IUV A;  1H6V A;  1LPF A;  4HA6 A;  3B6D A;  5BUL A;  4H4Q A;  4UP3 A;  5JCI A;  5KMS A;  2VRM A;  2C3C A;  2ARD A;  3SYI A;  2VQB A;  2XVI A;  4YSX A;  1YQ4 A;  4G6G A;  2CFY A;  1GPE A;  2TMD A;  1YY5 A;  1H86 A;  2YLR A;  1X31 B;  2E5V A;  4BJZ A;  5CKU A;  4NTC A;  3C4N A;  1KNR A;  1GER A;  3NK2 X;  2WU5 A;  3QVR A;  4GRT A;  1D7L A;  3H8I A;  2VVM A;  1RYI A;  1Y56 B;  3T2K A;  5C2T A;  3NTD A;  4G73 A;  1AOG A;  3SXI A;  2Y6Q A;  4GDP A;  3C96 A;  3ALJ A;  3GD4 A;  3AE8 A;  3R9U A;  2F5Z A;  5U63 A;  1F8R A;  2O9Z A;  2OAL A;  2XFN A;  4U8L A;  2GMH A;  5KRQ A;  4NTD A;  4C74 A;  3AXB A;  4PAA A;  2A89 A;  4U8I A;  1EL5 A;  4B66 A;  3G5Q A;  3CPH G;  1GOS A;  3UTH A;  3GYX A;  4UDP A;  4WCT A;  2H89 A;  3JSK A;  1PXA A;  4X9N A;  4Z25 A;  1PJ6 A;  2WQY A;  2GRT A;  3CPJ G;  2CDU A;  2EQ8 A;  3ICS A;  2FJB A;  5HYM A;  2BS2 A;  2JB3 A;  2PYX A;  2PHH A;  5HY5 A;  1EL9 A;  4U8O A;  1UKV G;  1VQW A;  2B9Y A;  3SZ0 A;  5C3J A;  4BK3 A;  4H4T A;  2EQ9 A;  1EL8 A;  4WX1 A;  3AE4 A;  3CNT A;  2AQJ A;  1CC6 A;  1GAL A;  1MO9 A;  4H4R A;  4XXG A;  3F8R A;  3ICR A;  3P4Q A;  2GQF A;  3Q6J A;  4JDR A;  3M0O A;  3ABV A;  3VRA A;  4A6N B;  2WOI A;  3AE2 A;  1CJC A;  3I6D A;  2WOW A;  2GB0 A;  4REK A;  4EMW A;  4K5R A;  5GRT A;  3D8X A;  3NG7 X;  3KA7 A;  2NPX A;  2BYB A;  2JKC A;  2YG5 A;  3M12 A;  3UKA A;  2YM1 A;  5KWF A;  5ER0 A;  1O94 A;  3IHM A;  1DOE A;  4NWZ A;  3AWI A;  5KXJ A;  2A8X A;  4MJW A;  3F8D A;  3GSI A;  4H2R A;  2OLO A;  1IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...