2A87A

Crystal structure of m. tuberculosis thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
313
structure length
313
Chain Sequence
AHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 88
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A02
4FK1C 4H7UA 4YSXA 2BS2A 4TM3A 2YQUA 2YLSA 4H4RA 1CJ4A 3UKLA 4RSLA 5M10A 5FS8A 3P4PA 3Q6JA 2H88A 2WOVA 4YKGA 3IHMA 2IVEA 4AT0A 1VRQB 2YAUA 3CPHG 1PXAA 2HQMA 4GF7A 4NZHA 4H4SA 4BK2A 1NHPA 2AR8A 1NAAA 2WDRA 5HYMA 4DNAA 3CIRA 2C3CA 4NEVA 2YR5A 1GPEA 1O5WA 3DJGX 3DJDA 2C7GA 1E1LA 1GEUA 1GTEA 3COXA 3REDA 3G5QA 4OPTA 1COYA 3P4SA 5IQ1A 1ZDLA 5HY5A 5IPYA 3QSSA 2JBVA 2QA2A 3KD9A 1DOCA 3K7QX 1N4UA 3VRDB 1GRHA 3IWAA 3QSMA 1YY5A 1L9EA 3D1CA 1EBDA 1B5QA 2YM1A 3QSEA 4FX9A 3II4A 2WOWA 4CCQA 4AP1A 4DGKA 3ALJA 2Q0LA 2WPEA 3NHOX 3SQPA 3AYJA 2GQWA 3Q9TA 4EMWA 3H8IA 2B76A 3OZ2A 1UKVG 2GF3A 2R0PA 1GOSA 1D4DA 3NNEA 3K30A 5FS7A 4EM3A 4OPDA 3AEDA 1IUTA 2YM2A 2YWLA 3ICRA 3L1RA 1KNRA 1Q1RA 4UDPA 4GUVA 4JNAA 2C72A 2GB0A 3EANA 3ATQA 1PBBA 3RHAA 2GVCA 1ONFA 3KU9A 4B66A 3UP5A 1QJDA 4D04A 3QVRA 4OPUA 1L0VA 2GRTA 3UOXA 5JCLA 2BK5A 2BC0A 4O5UA 4U8IA 1Z6LA 4EQSA 3F8PA 2Y6RA 4B69A 5C3JA 1TDFA 1YQ4A 3NTDA 4U8JA 2BK4A 4IA5A 5KOWA 5KVIA 2XVIA 4J34A 2YLTA 2XLPA 4BV6A 4YT0A 1JNRA 2W0HA 3GDPA 2QCUA 3NKSA 1ZMDA 3AD9B 3UOVA 4DSGA 1PDHA 3NN0X 5EOWA 4DSHA 4OVIA 4A6NA 2XLUA 2AQJA 3DH9A 2C66A 5JCIA 3AE4A 1KNPA 4A79A 2YG5A 3IHGA 2RGOA 5EB5A 2JKCA 2V61A 1NG3A 3GDNA 2OA1A 2X3NA 3AXBA 4OPLA 2E5VA 2XFPA 4UDQA 3AE9A 5ER0A 4U8PA 2JB2A 4KPRA 1MOKA 2FJEA 2GR2A 4H4XA 5HXIA 1D5TA 2EQ8A 5KOXA 2PYXA 2TMDA 3BI4A 4UDRA 1S3EA 3UKPA 4ICYA 3AEAA 4Z2RA 1XHCA 1LQUA 3LB8A 3SGLA 3I6DA 4BK1A 1DNCA 2GMHA 2VVMA 1D7LA 1XDIA 3IF9A 3T37A 4YXDA 1IUVA 2E4GA 2XLRA 3SFDA 3M12A 3WE0A 4H2RA 2BABA 2ZBWA 1GSNA 3CNTA 1N4VA 1PJ5A 3P1WA 2VRLA 2YG3A 2AAQA 1E1NA 1CL0A 2Q0KA 2ZZCA 1FECA 3GD4A 1FOHA 1X31B 3F8RA 3BNMA 3FMWA 4K5RA 2RGJA 1BZLA 1JEHA 1XANA 1D7YA 3CNSA 1VQWA 2XFOA 4XXGA 3GD3A 4ECHA 5J60A 1F8SA 4TLXA 1CHUA 1ZMCA 4GRTA 3KVEA 2YLXA 1JRXA 1P2EA 1NHRA 3LJPA 4FDCB 5U25A 3UKFA 3KA7A 3LZWA 4ADWA 5TR3A 1AOGA 1BGNA 2JAEA 3P9UA 4U2LA 1FEAA 2WBAA 5KRQA 4TM0A 2GMJA 3AYLA 2GR3A 4I59A 1F8RA 4IV9A 3UP4A 2EQ7A 3QFBA 4J56A 1YQ3A 2GQFA 3B3RA 4B68A 2DKHA 1V59A 5J7XA 1KSSA 2BYBA 2RABA 2XVHA 2VVLA 2J3NA 4D03A 4H4YA 1W4XA 2GAGB 2GR1A 3NK1X 2VOUA 4GDEA 3UKKA 1EL9A 1S3BA 2RGHA 3KLJA 1QLBA 2XLTA 4Y4MA 1JRYA 1HYUA 1IUWA 4H4PA 1CF3A 2Y6QA 3CPIG 1RP0A 3S5WA 5CKUA 1TRBA 1M6IA 2YG4A 5FS9A 3QFAA 4LIIA 1EL8A 4O5QA 1PBEA 4GR1A 2C75A 2EQ9A 1BWCA 1KSUA 2GAHB 2GV8A 3RP7A 4CBQA 4YKFA 4YSZA 4Y4LA 2BK3A 2C67A 3BI5A 3CGCA 5BULA 2BCPA 3H8LA 2IIDA 3UOZA 4EMIA 2YR4A 1ZP0A 5GSNA 5JCMA 2VQBA 4TM4A 3AE7A 3UTGA 4J2WA 4U8MA 2OLNA 2WOIA 3NYFA 2BS3A 3AE1A 2Q6UA 1REOA 3GWFA 1L9CA 1XPQA 1BF3A 4A99A 4EIPA 4K22A 3P4QA 3AD7B 4K2XA 3ALLA 2DKIA 3SM8A 2X8CA 3QVPA 3IC9A 1NENA 3DK4A 1D4CA 2VVLG 2XFUA 3CTYA 1D4EA 3FPZA 4FK1A 2TPRA 4HA6A 3C4AA 3GMCA 1OJDA 2E1MA 3ALMA 2WDQA 1GESA 3AE8A 4EQWA 3DJJA 1TDKA 3ATRA 4LU6A 4A5LA 1LPFA 4CY6A 4TM1A 2B9XA 5BRTA 3NLCA 1JU2A 3URHA 1B8SA 1CC2A 2WPCA 1QO8A 1CC6A 2WDVA 2B7RA 3CGDA 3NN6X 4BJZA 1LTXR 1F6MA 1GRBA 4PABA 4NTDA 2A8XA 4XWRA 1GNDA 1K4QA 3GWDA 1E6EA 3C4NA 5U1OA 1Y56A 3PVCA 2CVJA 2R4EA 4AOSA 1MO9A 4A9WA 3JSKA 1LQTA 3NG7X 4EMJA 2GH5A 1BKWA 2PHHA 4CY8A 2WEUA 1O94A 3K7TA 3SFEA 3DA1A 1CJ2A 3UTHA 4GDPA 4AT2A 5L46A 1YKJA 4H4VA 1GRTA 3B6DA 3DMEA 4H4UA 4K5SA 1K0IA 5HHFA 4EIQA 1IUUA 4B1BA 5FS6A 2C70A 4HB9A 1S2YA 1OJAA 3LXDA 1ZK7A 4TLZA 1CJCA 2WP5A 1NDAA 1PXBA 1Q9IA 2WESA 2NVKX 4GCMA 2WP6A 4Z2UA 2V5ZA 1GV4A 2ZZ0A 4E0VA 4YSYA 3AE2A 3NK2X 4Z24A 4JNQA 3VR8A 4H4TA 1GALA 2Z5XA 3LADA 3AEFA 3QJ4A 5KWFA 5EB4A 4X9MA 1IUSA 4H4QA 3FBSA 4H4ZA 1NHSA 3AB1A 2BC1A 1Q1WA 4M52A 3FIMB 3L8KA 4APNA 2V6OA 3KKJA 3UTEA 1VG9A 2YVJA 3ICSA 1GETA 1NEKA 3UKAA 3NH3X 2YLZA 3GYJA 3R9UA 1GTHA 1B37A 4IVOB 2WU5A 3V76A 1RSGA 2BXSA 3CGEA 3UKHA 2OALA 4Y4NA 4C74A 3M13A 3G5SA 1LJ1A 3F8DA 2IVDA 1DJQA 2F5ZA 3BHFA 3DGZA 2R45A 4ZN0A 4J33A 4IVMB 4C3YA 2R9ZA 4USQA 2BCGG 3AEGA 1JRZA 1MXTA 2BXRA 3CNDA 1B4VA 4ZCDA 3VQRA 2YR6A 3GRTA 3I3LA 2YLWA 1FL2A 2C76A 3LZXA 3NYCA 4C3XA 3V3NA 3M0OA 3UKQA 4OPGA 4YSHA 3ZDNA 2XFNA 3PO7A 4CNJA 4U8OA 3VRBA 2UZZA 1N1PA 1DODA 1PN0A 3DJEA 3AEEA 2XVJA 2OLOA 2YLRA 3NRNA 2XVFA 1N4WA 1NG4A 4J57A 2R4JA 3NTAA 1ZX9A 1H6VA 3H4KA 2NPXA 3CGBA 1FEBA 1E1KA 4X9NA 3S61A 1JNZA 4Z2TA 3ITJA 1OJTA 4ZCCA 2A89A 2R46A 3RNMA 1DXLA 4KX6A 3AEBA 1OJCA 2YG6A 5LV9A 1DOEA 4U2TA 4I58A 5C2TA 3CNJA 2VRMA 2XLSA 3ABVA 3P4RA 1EL7A 5JCKA 1ELIA 4PAAA 2R0CA 1TYPA 2VQ7A 3NIXA 2FBWA 4Z44A 1TDEA 2XYOA 3KPFA 1LV0A 2XFQA 4U8NA 2C73A 1GT8A 4Z25A 4H2QA 4X4JA 4BURA 4J36A 5KVHA 3EF6A 1NHQA 2JK6A 4A65A 4WX1A 2APGA 1H82A 2B9YA 1H7WA 4REKA 1TDNA 1P2HA 4NTEA 4NTCA 3VR9A 4BK3A 1GXFA 1E7PA 1F3PA 3O0HA 4JDRA 1ZOYA 4B67A 1Y56B 4Z43A 4A7AA 2I0ZA 1VG0A 3EAOA 3NT6A 5FMHA 1GRFA 2Q7VA 3AD8B 1H7XA 2O9ZA 1M64A 4P9SA 2WQYA 1Y0PA 4H50A 3RP6A 1FCDA 1DOBA 4U2SA 4B63A 2ZZBA 4OPIA 4Z26A 3FG2P 4EQRA 4J31A 4MJWA 1PJ6A 4U8KA 2BACA 4OPCA 3V3OA 4B65A 2B7SA 3D8XA 2FJBA 3ZYXA 3RP8A 1GREA 2YVGA 4H2NA 1JOAA 1KFYA 3AE5A 2QA1A 2WP9A 1OJ9A 3DK9A 3CPJG 2EQ6A 2WETA 2GEWA 4OCGA 3BI2A 5M0ZA 1CJ3A 2GR0A 1CBOA 1H84A 2H89A 3CNPA 3ICTA 4LA1A 3DGHA 1IJHA 4A6NB 2V60A 1ZOVA 4H2PA 2CDUA 1KDGA 4CRTA 4RG4A 3ISHA 1EL5A 2ACZA 4N9XA 3AE6A 2XCGA 1E39A 3ADAB 1S2QA 3PS9A 4NEWA 4C77A 2FJDA 5KXJA 3AE3A 2WS3A 3CN8A 1TDOA 1ZY8A 2C64A 1K0LA 2C3DA 2X8GA 3DK8A 2A87A 1PHHA 4RG3A 2OAMA 4YWOA 1DJNA 2C65A 3AECA 2VZ2A 1RYIA 5EBKA 1IUXA 1GERA 1TYTA 4EM4A 1O95A 1H86A 2XDOA 4IA6A 2V3BA 2WU2A 3AYIA 3NGCX 5U63A 1BGJA 3NYEA 3BHKA 1VDCA 3GRSA 2BS4A 4YTNA 1GRGA 1PBDA 1L9DA 4JN9A 1KF6A 3EPTA 2CULA 1ZKQA 5CQFA 1E1MA 4U8LA 4K7ZA 3UTFA 3UCLA 3VRAA 5DBJA 3BNUA 4H4WA 2JB3A 1PBFA 1PXCA 3GMBA 4BJYA 4JY2A 1PBCA 3G5RA 4WCTA 4EQXA 3UOYA 1YQZA 2XVEA 5BVAA 1H81A 3K7MX 5JCNA 1F8WA 1PJ7A 2YG7A 2JB1A 4K8DA 2ARDA 4UP3A 3GSIA 2Z5YA 4CNKA 4CCRA 2B9WA 4YTMA 4C5OA 2X99A 5IQ4A 2X50A 3C96A 1LVLA 1NPXA 2FJAA 2X8HA 3HZLA 1PS9A 1K0JA 2QAEA 5BUKA 1CC4A 2CFYA 3GYIA 1H83A 3E1TA 3OC4A 4JQ9A 2V3AA 4USRA 2BA9A 4XWZA 3AWIA 3NK0X 4AP3A 4AOXA 4YTPA 2WHDA 1GRAA 2R0GA 3LOVA 5GRTA 4B64A 1SEZA 2WPFA 2YVFA 4JY3A
chains in the Genus database with same CATH superfamily
4FK1C 4H7UA 4YSXA 2BS2A 4TM3A 2YQUA 2YLSA 4H4RA 1CJ4A 3SX6A 4RSLA 3UKLA 5M10A 5FS8A 3P4PA 3Q6JA 2H88A 2WOVA 4YKGA 3IHMA 2IVEA 4AT0A 1VRQB 2YAUA 3CPHG 1PXAA 2HQMA 4GF7A 4NZHA 4H4SA 3T2ZA 4BK2A 1NHPA 2AR8A 1NAAA 2WDRA 5HYMA 4DNAA 3CIRA 2C3CA 4NEVA 2YR5A 1GPEA 1O5WA 3DJGX 3DJDA 2C7GA 1E1LA 1GEUA 1GTEA 3COXA 3REDA 3G5QA 4OPTA 1COYA 3P4SA 5IQ1A 1ZDLA 5HY5A 5IPYA 3QSSA 2JBVA 2QA2A 3KD9A 1DOCA 3K7QX 1N4UA 3VRDB 1GRHA 3IWAA 3QSMA 1YY5A 1L9EA 3D1CA 1EBDA 1B5QA 2YM1A 3QSEA 4FX9A 3II4A 2WOWA 4CCQA 4AP1A 4DGKA 3ALJA 2Q0LA 2WPEA 3NHOX 3SQPA 3AYJA 2GQWA 3Q9TA 5KMRA 4EMWA 3H8IA 2B76A 3OZ2A 1UKVG 2GF3A 2R0PA 1GOSA 3T2KA 1D4DA 3NNEA 3HYWA 3K30A 5FS7A 4EM3A 4OPDA 3AEDA 1IUTA 2YM2A 2YWLA 3ICRA 3L1RA 1KNRA 1Q1RA 4UDPA 4GUVA 4JNAA 5KMSA 2C72A 2GB0A 3EANA 3ATQA 1PBBA 3RHAA 2GVCA 1ONFA 3KU9A 4B66A 3UP5A 1QJDA 4D04A 3QVRA 4OPUA 1L0VA 2GRTA 3UOXA 5JCLA 2BK5A 2BC0A 4O5UA 4U8IA 1Z6LA 4EQSA 3F8PA 2Y6RA 4B69A 5C3JA 1TDFA 1YQ4A 3NTDA 4U8JA 2BK4A 4IA5A 5KOWA 5KVIA 2XVIA 4J34A 2YLTA 2XLPA 3T0KA 3T2YA 4BV6A 4YT0A 1JNRA 2W0HA 3GDPA 2QCUA 3NKSA 1ZMDA 3AD9B 3UOVA 4DSGA 1PDHA 3NN0X 5EOWA 4DSHA 4OVIA 4A6NA 2XLUA 2AQJA 3DH9A 2C66A 5JCIA 3AE4A 1KNPA 4A79A 2YG5A 3IHGA 2RGOA 5EB5A 2JKCA 2V61A 1NG3A 3GDNA 2OA1A 2X3NA 3AXBA 4OPLA 2E5VA 2XFPA 4UDQA 3SZWA 3AE9A 5ER0A 4U8PA 2JB2A 4KPRA 3T31A 1MOKA 2FJEA 2GR2A 4H4XA 3SXIA 1D5TA 5HXIA 2EQ8A 5KOXA 2PYXA 2TMDA 3BI4A 4UDRA 1S3EA 3UKPA 4ICYA 3AEAA 4Z2RA 1XHCA 1LQUA 3LB8A 3SGLA 3I6DA 4BK1A 1DNCA 2GMHA 2VVMA 1D7LA 1XDIA 3IF9A 3T37A 4YXDA 1IUVA 2E4GA 2XLRA 3SFDA 3M12A 3WE0A 4H2RA 2BABA 2ZBWA 1GSNA 3CNTA 1N4VA 1PJ5A 3P1WA 2VRLA 2YG3A 3SY4A 2AAQA 1E1NA 1CL0A 2Q0KA 2ZZCA 1FECA 3GD4A 1FOHA 1X31B 3F8RA 3BNMA 3FMWA 4K5RA 4II2A 2RGJA 1BZLA 1JEHA 1XANA 1D7YA 3CNSA 1VQWA 2XFOA 4XXGA 3GD3A 4ECHA 5J60A 1F8SA 4TLXA 1CHUA 1ZMCA 4GRTA 3KVEA 2YLXA 1JRXA 1P2EA 1NHRA 3LJPA 4FDCB 5U25A 3UKFA 3KA7A 3LZWA 4ADWA 5TR3A 1AOGA 1BGNA 2JAEA 3P9UA 4U2LA 1FEAA 2WBAA 5KRQA 4TM0A 2GMJA 3AYLA 2GR3A 4I59A 1F8RA 4IV9A 3UP4A 2EQ7A 3QFBA 4J56A 3HYVA 1YQ3A 2GQFA 3B3RA 4B68A 2DKHA 1V59A 5J7XA 1KSSA 2BYBA 2RABA 2XVHA 2VVLA 2J3NA 4D03A 4H4YA 1W4XA 2GAGB 2GR1A 3NK1X 2VOUA 4GDEA 3UKKA 1EL9A 1S3BA 2RGHA 3KLJA 1QLBA 2XLTA 4Y4MA 1JRYA 1HYUA 1IUWA 4H4PA 1CF3A 2Y6QA 3CPIG 1RP0A 3S5WA 5CKUA 1TRBA 1M6IA 2YG4A 5FS9A 3QFAA 4LIIA 1EL8A 4O5QA 1PBEA 4GR1A 2C75A 2EQ9A 1BWCA 1KSUA 2GAHB 2GV8A 3RP7A 4CBQA 4YKFA 4YSZA 4Y4LA 2BK3A 2BRYA 2C67A 3BI5A 3CGCA 5BULA 2BCPA 3H8LA 2IIDA 3UOZA 4EMIA 2YR4A 1ZP0A 5GSNA 5JCMA 2VQBA 4TM4A 3AE7A 3KPKA 3UTGA 4J2WA 4U8MA 2OLNA 2WOIA 3NYFA 2BS3A 3AE1A 2Q6UA 1REOA 3GWFA 1L9CA 1XPQA 1BF3A 4A99A 4EIPA 4K22A 3P4QA 3AD7B 4K2XA 3ALLA 2DKIA 3SM8A 2X8CA 3QVPA 3IC9A 1NENA 3GYXA 3DK4A 1D4CA 2VVLG 2XFUA 3CTYA 1D4EA 3FPZA 4FK1A 2C4CA 2TPRA 4HA6A 3C4AA 3GMCA 1OJDA 2E1MA 3ALMA 2WDQA 1GESA 3AE8A 4EQWA 3DJJA 1TDKA 3ATRA 4LU6A 4A5LA 1LPFA 4CY6A 4TM1A 2B9XA 5BRTA 3NLCA 1JU2A 3URHA 1B8SA 1CC2A 2WPCA 1QO8A 1CC6A 2WDVA 2B7RA 3CGDA 3NN6X 4BJZA 1LTXR 1F6MA 1GRBA 4PABA 4NTDA 2A8XA 4XWRA 1GNDA 1K4QA 3GWDA 1E6EA 3C4NA 5U1OA 1Y56A 3PVCA 2CVJA 2R4EA 4AOSA 1MO9A 4A9WA 3JSKA 1LQTA 3NG7X 3SZFA 4EMJA 2GH5A 1BKWA 2PHHA 4CY8A 2WEUA 1O94A 3K7TA 3SFEA 3DA1A 1CJ2A 3UTHA 4GDPA 4AT2A 5L46A 1YKJA 4H4VA 1GRTA 3B6DA 3DMEA 4H4UA 4K5SA 1K0IA 5HHFA 4EIQA 1IUUA 4B1BA 5FS6A 2C70A 4HB9A 1S2YA 1OJAA 3LXDA 1ZK7A 4TLZA 1CJCA 2WP5A 1NDAA 1PXBA 1Q9IA 2WESA 3SZCA 2NVKX 4GCMA 3HYXA 2WP6A 4Z2UA 2V5ZA 1GV4A 2ZZ0A 4E0VA 4YSYA 3AE2A 3NK2X 4Z24A 4JNQA 3VR8A 4H4TA 1GALA 2Z5XA 3LADA 3AEFA 3QJ4A 5KWFA 4G73A 5EB4A 4X9MA 1IUSA 4H4QA 3FBSA 4H4ZA 1NHSA 3AB1A 4GAPA 2BC1A 5KMQA 1Q1WA 4M52A 3CMMA 3FIMB 3L8KA 4APNA 2V6OA 3KKJA 3UTEA 5KNLA 1VG9A 2YVJA 3ICSA 1GETA 1NEKA 3UKAA 3NH3X 2YLZA 3GYJA 3R9UA 1GTHA 1B37A 4IVOB 2WU5A 3V76A 1RSGA 2BXSA 3CGEA 3UKHA 2OALA 4Y4NA 4C74A 3M13A 3G5SA 1LJ1A 3F8DA 2IVDA 1DJQA 2F5ZA 3BHFA 3DGZA 2R45A 4ZN0A 4J33A 4IVMB 4C3YA 2R9ZA 4USQA 2BCGG 3AEGA 1JRZA 1MXTA 2BXRA 3CNDA 1B4VA 4ZCDA 3VQRA 2YR6A 3GRTA 3I3LA 2YLWA 1FL2A 2C76A 3LZXA 3NYCA 4C3XA 3V3NA 3M0OA 4II3A 3UKQA 4OPGA 4YSHA 3ZDNA 2XFNA 2BRAA 3PO7A 4CNJA 4U8OA 3VRBA 2UZZA 1N1PA 1DODA 1PN0A 3DJEA 3SZ0A 3AEEA 2XVJA 2OLOA 2YLRA 3NRNA 2XVFA 1N4WA 1NG4A 4J57A 2R4JA 3NTAA 1ZX9A 1H6VA 3H4KA 2NPXA 3CGBA 1FEBA 1E1KA 4X9NA 3S61A 1JNZA 4Z2TA 3ITJA 1OJTA 4ZCCA 2A89A 2R46A 3RNMA 1DXLA 4KX6A 3AEBA 1OJCA 2YG6A 5LV9A 1DOEA 4U2TA 4I58A 5C2TA 3CNJA 2VRMA 2XLSA 3ABVA 3P4RA 1EL7A 5JCKA 1ELIA 4PAAA 2R0CA 1TYPA 2VQ7A 3NIXA 2FBWA 4Z44A 1TDEA 2XYOA 3KPFA 1LV0A 2XFQA 4U8NA 2C73A 1GT8A 4Z25A 4H2QA 4X4JA 4BURA 4J36A 5KVHA 3EF6A 1NHQA 2JK6A 4A65A 4WX1A 2APGA 1H82A 2B9YA 1H7WA 4REKA 1TDNA 1P2HA 4NTEA 4NTCA 3VR9A 3T14A 4BK3A 1GXFA 1E7PA 1F3PA 3O0HA 4JDRA 1ZOYA 4B67A 1Y56B 4Z43A 4A7AA 2I0ZA 1VG0A 3EAOA 3NT6A 5FMHA 1GRFA 2Q7VA 3AD8B 4G6HA 1H7XA 2O9ZA 1M64A 4P9SA 2WQYA 1Y0PA 4H50A 3RP6A 1FCDA 1DOBA 4U2SA 4B63A 2ZZBA 4OPIA 4Z26A 3FG2P 4EQRA 4J31A 4MJWA 1PJ6A 4U8KA 2BACA 4OPCA 3V3OA 4B65A 4NNJA 2B7SA 3D8XA 2FJBA 3ZYXA 3RP8A 1GREA 2YVGA 4H2NA 1JOAA 1KFYA 3AE5A 2QA1A 2WP9A 1OJ9A 3DK9A 3CPJG 4G6GA 2EQ6A 2WETA 2GEWA 4OCGA 3BI2A 5M0ZA 1CJ3A 2GR0A 1CBOA 1H84A 2H89A 3CNPA 3ICTA 4LA1A 3DGHA 1IJHA 4A6NB 2V60A 1ZOVA 4H2PA 2CDUA 1KDGA 4CRTA 4RG4A 3ISHA 1EL5A 2ACZA 4N9XA 3AE6A 2XCGA 1E39A 3ADAB 1S2QA 3PS9A 4NEWA 4C77A 2FJDA 5KXJA 3AE3A 2WS3A 3CN8A 1TDOA 1ZY8A 2C64A 1K0LA 2C3DA 2X8GA 3DK8A 2A87A 1PHHA 4RG3A 5KMPA 2OAMA 4YWOA 1DJNA 2C65A 3AECA 2VZ2A 1RYIA 5EBKA 1IUXA 1GERA 1TYTA 4EM4A 1O95A 1H86A 2XDOA 4IA6A 2V3BA 2WU2A 3AYIA 3NGCX 5U63A 1BGJA 3NYEA 3BHKA 1VDCA 3GRSA 2BS4A 4YTNA 1GRGA 1PBDA 1L9DA 4JN9A 1KF6A 3EPTA 2CULA 1ZKQA 5CQFA 1E1MA 4U8LA 4K7ZA 4G74A 3UTFA 3UCLA 4NWZA 3VRAA 5DBJA 3BNUA 4H4WA 2JB3A 1PBFA 1PXCA 3GMBA 4BJYA 4JY2A 1PBCA 3G5RA 4WCTA 4EQXA 3UOYA 1YQZA 2XVEA 5BVAA 1H81A 3K7MX 5JCNA 1F8WA 1PJ7A 2YG7A 4G9KA 2JB1A 4K8DA 2ARDA 4UP3A 3GSIA 2Z5YA 4CNKA 4CCRA 2B9WA 4YTMA 4C5OA 2X99A 5IQ4A 3SYIA 2X50A 3C96A 1LVLA 1NPXA 2FJAA 2X8HA 3HZLA 1PS9A 1K0JA 2QAEA 5BUKA 1CC4A 2CFYA 3GYIA 1H83A 3E1TA 3OC4A 4JQ9A 2V3AA 4USRA 2BA9A 4XWZA 3AWIA 3NK0X 4AP3A 4AOXA 4YTPA 2WHDA 1GRAA 2R0GA 3LOVA 4GAVA 5GRTA 4B64A 1SEZA 2WPFA 2YVFA 4JY3A
chains in the Genus database with same CATH topology
4FK1C 4H7UA 4YSXA 2BS2A 4TM3A 2YQUA 2YLSA 4H4RA 1CJ4A 3SX6A 4RSLA 3UKLA 5M10A 5FS8A 3P4PA 3Q6JA 2H88A 2WOVA 4YKGA 3IHMA 2IVEA 4AT0A 1VRQB 2YAUA 3CPHG 1PXAA 2HQMA 4GF7A 4NZHA 4H4SA 3T2ZA 4BK2A 1NHPA 2AR8A 1NAAA 2WDRA 5HYMA 4DNAA 3CIRA 2C3CA 4NEVA 2YR5A 1GPEA 1O5WA 3DJGX 3DJDA 2C7GA 1E1LA 1GEUA 1GTEA 3COXA 3REDA 3G5QA 4OPTA 1COYA 3P4SA 5IQ1A 1ZDLA 5HY5A 5IPYA 3QSSA 2JBVA 2QA2A 3KD9A 1DOCA 3K7QX 1N4UA 3VRDB 1GRHA 3IWAA 3QSMA 1YY5A 1L9EA 3D1CA 1EBDA 1B5QA 2YM1A 3QSEA 4FX9A 3II4A 2WOWA 4CCQA 4AP1A 4DGKA 3ALJA 2Q0LA 2WPEA 3NHOX 3SQPA 3AYJA 2GQWA 3Q9TA 5KMRA 4EMWA 3H8IA 2B76A 3OZ2A 1UKVG 2GF3A 2R0PA 1GOSA 3T2KA 1D4DA 3NNEA 3HYWA 3K30A 5FS7A 4EM3A 4OPDA 3AEDA 1IUTA 2YM2A 2YWLA 3ICRA 3L1RA 1KNRA 1Q1RA 4UDPA 4GUVA 4JNAA 5KMSA 2C72A 2GB0A 3EANA 3ATQA 1PBBA 3RHAA 2GVCA 1ONFA 3KU9A 4B66A 3UP5A 1QJDA 4D04A 3QVRA 4OPUA 1L0VA 2GRTA 3UOXA 5JCLA 2BK5A 2BC0A 4O5UA 4U8IA 1Z6LA 4EQSA 3F8PA 2Y6RA 4B69A 5C3JA 1TDFA 1YQ4A 3NTDA 4U8JA 2BK4A 4IA5A 5KOWA 5KVIA 2XVIA 4J34A 2YLTA 2XLPA 3T0KA 3T2YA 4BV6A 4YT0A 1JNRA 2W0HA 3GDPA 2QCUA 3NKSA 1ZMDA 3AD9B 3UOVA 4DSGA 1PDHA 3NN0X 5EOWA 4DSHA 4OVIA 4A6NA 2XLUA 2AQJA 3DH9A 2C66A 5JCIA 3AE4A 1KNPA 4A79A 2YG5A 3IHGA 2RGOA 5EB5A 2JKCA 2V61A 1NG3A 3GDNA 2OA1A 2X3NA 3AXBA 4OPLA 2E5VA 2XFPA 4UDQA 3SZWA 3AE9A 5ER0A 4U8PA 2JB2A 4KPRA 3T31A 1MOKA 2FJEA 2GR2A 4H4XA 3SXIA 1D5TA 5HXIA 2EQ8A 5KOXA 2PYXA 2TMDA 3BI4A 4UDRA 1S3EA 3UKPA 4ICYA 3AEAA 4Z2RA 1XHCA 1LQUA 3LB8A 3SGLA 3I6DA 4BK1A 1DNCA 2GMHA 2VVMA 1D7LA 1XDIA 3IF9A 3T37A 4YXDA 1IUVA 2E4GA 2XLRA 3SFDA 3M12A 3WE0A 4H2RA 2BABA 2ZBWA 1GSNA 3CNTA 1N4VA 1PJ5A 3P1WA 2VRLA 2YG3A 3SY4A 2AAQA 1E1NA 1CL0A 2Q0KA 2ZZCA 1FECA 3GD4A 1FOHA 1X31B 3F8RA 3BNMA 3FMWA 4K5RA 4II2A 2RGJA 1BZLA 1JEHA 1XANA 1D7YA 3CNSA 1VQWA 2XFOA 4XXGA 3GD3A 4ECHA 5J60A 1F8SA 4TLXA 1CHUA 1ZMCA 4GRTA 3KVEA 2YLXA 1JRXA 1P2EA 1NHRA 3LJPA 4FDCB 5U25A 3UKFA 3KA7A 3LZWA 4ADWA 5TR3A 1AOGA 1BGNA 2JAEA 3P9UA 4U2LA 1FEAA 2WBAA 5KRQA 4TM0A 2GMJA 3AYLA 2GR3A 4I59A 1F8RA 4IV9A 3UP4A 2EQ7A 3QFBA 4J56A 3HYVA 1YQ3A 2GQFA 3B3RA 4B68A 2DKHA 1V59A 5J7XA 1KSSA 2BYBA 2RABA 2XVHA 2VVLA 2J3NA 4D03A 4H4YA 1W4XA 2GAGB 2GR1A 3NK1X 2VOUA 4GDEA 3UKKA 1EL9A 1S3BA 2RGHA 3KLJA 1QLBA 2XLTA 4Y4MA 1JRYA 1HYUA 1IUWA 4H4PA 1CF3A 2Y6QA 3CPIG 1RP0A 3S5WA 5CKUA 1TRBA 1M6IA 2YG4A 5FS9A 3QFAA 4LIIA 1EL8A 4O5QA 1PBEA 4GR1A 2C75A 2EQ9A 1BWCA 1KSUA 2GAHB 2GV8A 3RP7A 4CBQA 4YKFA 4YSZA 4Y4LA 2BK3A 2BRYA 2C67A 3BI5A 3CGCA 5BULA 2BCPA 3H8LA 2IIDA 3UOZA 4EMIA 2YR4A 1ZP0A 5GSNA 5JCMA 2VQBA 4TM4A 3AE7A 3KPKA 3UTGA 4J2WA 4U8MA 2OLNA 2WOIA 3NYFA 2BS3A 3AE1A 2Q6UA 1REOA 3GWFA 1L9CA 1XPQA 1BF3A 4A99A 4EIPA 4K22A 3P4QA 3AD7B 4K2XA 3ALLA 2DKIA 3SM8A 2X8CA 3QVPA 3IC9A 1NENA 3GYXA 3DK4A 1D4CA 2VVLG 2XFUA 3CTYA 1D4EA 3FPZA 4FK1A 2C4CA 2TPRA 4HA6A 3C4AA 3GMCA 1OJDA 2E1MA 3ALMA 2WDQA 1GESA 3AE8A 4EQWA 3DJJA 1TDKA 3ATRA 4LU6A 4A5LA 1LPFA 4CY6A 4TM1A 2B9XA 5BRTA 3NLCA 1JU2A 3URHA 1B8SA 1CC2A 2WPCA 1QO8A 1CC6A 2WDVA 2B7RA 3CGDA 3NN6X 4BJZA 1LTXR 1F6MA 1GRBA 4PABA 4NTDA 2A8XA 4XWRA 1GNDA 1K4QA 3GWDA 1E6EA 3C4NA 5U1OA 1Y56A 3PVCA 2CVJA 2R4EA 4AOSA 1MO9A 4A9WA 3JSKA 1LQTA 3NG7X 3SZFA 4EMJA 2GH5A 1BKWA 2PHHA 4CY8A 2WEUA 1O94A 3K7TA 3SFEA 3DA1A 1CJ2A 3UTHA 4GDPA 4AT2A 5L46A 1YKJA 4H4VA 1GRTA 3B6DA 3DMEA 4H4UA 4K5SA 1K0IA 5HHFA 4EIQA 1IUUA 4B1BA 5FS6A 2C70A 4HB9A 1S2YA 1OJAA 3LXDA 1ZK7A 4TLZA 1CJCA 2WP5A 1NDAA 1PXBA 1Q9IA 2WESA 3SZCA 2NVKX 4GCMA 3HYXA 2WP6A 4Z2UA 2V5ZA 1GV4A 2ZZ0A 4E0VA 4YSYA 3AE2A 3NK2X 4Z24A 4JNQA 3VR8A 4H4TA 1GALA 2Z5XA 3LADA 3AEFA 3QJ4A 5KWFA 4G73A 5EB4A 4X9MA 1IUSA 4H4QA 3FBSA 4H4ZA 1NHSA 3AB1A 4GAPA 2BC1A 5KMQA 1Q1WA 4M52A 3CMMA 3FIMB 3L8KA 4APNA 2V6OA 3KKJA 3UTEA 5KNLA 1VG9A 2YVJA 3ICSA 1GETA 1NEKA 3UKAA 3NH3X 2YLZA 3GYJA 3R9UA 1GTHA 1B37A 4IVOB 2WU5A 3V76A 1RSGA 2BXSA 3CGEA 3UKHA 2OALA 4Y4NA 4C74A 3M13A 3G5SA 1LJ1A 3F8DA 2IVDA 1DJQA 2F5ZA 3BHFA 3DGZA 2R45A 4ZN0A 4J33A 4IVMB 4C3YA 2R9ZA 4USQA 2BCGG 3AEGA 1JRZA 1MXTA 2BXRA 3CNDA 1B4VA 4ZCDA 3VQRA 2YR6A 3GRTA 3I3LA 2YLWA 1FL2A 2C76A 3LZXA 3NYCA 4C3XA 3V3NA 3M0OA 4II3A 3UKQA 4OPGA 4YSHA 3ZDNA 2XFNA 2BRAA 3PO7A 4CNJA 4U8OA 3VRBA 2UZZA 1N1PA 1DODA 1PN0A 3DJEA 3SZ0A 3AEEA 2XVJA 2OLOA 2YLRA 3NRNA 2XVFA 1N4WA 1NG4A 4J57A 2R4JA 3NTAA 1ZX9A 1H6VA 3H4KA 2NPXA 3CGBA 1FEBA 1E1KA 4X9NA 3S61A 1JNZA 4Z2TA 3ITJA 1OJTA 4ZCCA 2A89A 2R46A 3RNMA 1DXLA 4KX6A 3AEBA 1OJCA 2YG6A 5LV9A 1DOEA 4U2TA 4I58A 5C2TA 3CNJA 2VRMA 2XLSA 3ABVA 3P4RA 1EL7A 5JCKA 1ELIA 4PAAA 2R0CA 1TYPA 2VQ7A 3NIXA 2FBWA 4Z44A 1TDEA 2XYOA 3KPFA 1LV0A 2XFQA 4U8NA 2C73A 1GT8A 4Z25A 4H2QA 4X4JA 4BURA 4J36A 5KVHA 3EF6A 1NHQA 2JK6A 4A65A 4WX1A 2APGA 1H82A 2B9YA 1H7WA 4REKA 1TDNA 1P2HA 4NTEA 4NTCA 3VR9A 3T14A 4BK3A 1GXFA 1E7PA 1F3PA 3O0HA 4JDRA 1ZOYA 4B67A 1Y56B 4Z43A 4A7AA 2I0ZA 1VG0A 3EAOA 3NT6A 5FMHA 1GRFA 2Q7VA 3AD8B 4G6HA 1H7XA 2O9ZA 1M64A 4P9SA 2WQYA 1Y0PA 4H50A 3RP6A 1FCDA 1DOBA 4U2SA 4B63A 2ZZBA 4OPIA 4Z26A 3FG2P 4EQRA 4J31A 4MJWA 1PJ6A 4U8KA 2BACA 4OPCA 3V3OA 4B65A 4NNJA 2B7SA 3D8XA 2FJBA 3ZYXA 3RP8A 1GREA 2YVGA 4H2NA 1JOAA 1KFYA 3AE5A 2QA1A 2WP9A 1OJ9A 3DK9A 3CPJG 4G6GA 2EQ6A 2WETA 2GEWA 4OCGA 3BI2A 5M0ZA 1CJ3A 2GR0A 1CBOA 1H84A 2H89A 3CNPA 3ICTA 4LA1A 3DGHA 1IJHA 4A6NB 2V60A 1ZOVA 4H2PA 2CDUA 1KDGA 4CRTA 4RG4A 3ISHA 1EL5A 2ACZA 4N9XA 3AE6A 2XCGA 1E39A 3ADAB 1S2QA 3PS9A 4NEWA 4C77A 2FJDA 5KXJA 3AE3A 2WS3A 3CN8A 1TDOA 1ZY8A 2C64A 1K0LA 2C3DA 2X8GA 3DK8A 2A87A 1PHHA 4RG3A 5KMPA 2OAMA 4YWOA 1DJNA 2C65A 3AECA 2VZ2A 1RYIA 5EBKA 1IUXA 1GERA 1TYTA 4EM4A 1O95A 1H86A 2XDOA 4IA6A 2V3BA 2WU2A 3AYIA 3NGCX 5U63A 1BGJA 3NYEA 3BHKA 1VDCA 3GRSA 2BS4A 4YTNA 1GRGA 1PBDA 1L9DA 4JN9A 1KF6A 3EPTA 2CULA 1ZKQA 5CQFA 1E1MA 4U8LA 4K7ZA 4G74A 3UTFA 3UCLA 4NWZA 3VRAA 5DBJA 3BNUA 4H4WA 2JB3A 1PBFA 1PXCA 3GMBA 4BJYA 4JY2A 1PBCA 3G5RA 4WCTA 4EQXA 3UOYA 1YQZA 2XVEA 5BVAA 1H81A 3K7MX 5JCNA 1F8WA 1PJ7A 2YG7A 4G9KA 2JB1A 4K8DA 2ARDA 4UP3A 3GSIA 2Z5YA 4CNKA 4CCRA 2B9WA 4YTMA 4C5OA 2X99A 5IQ4A 3SYIA 2X50A 3C96A 1LVLA 1NPXA 2FJAA 2X8HA 3HZLA 1PS9A 1K0JA 2QAEA 5BUKA 1CC4A 2CFYA 3GYIA 1H83A 3E1TA 3OC4A 4JQ9A 2V3AA 4USRA 2BA9A 4XWZA 3AWIA 3NK0X 4AP3A 4AOXA 4YTPA 2WHDA 1GRAA 2R0GA 3LOVA 4GAVA 5GRTA 4B64A 1SEZA 2WPFA 2YVFA 4JY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK1 C;  4H7U A;  4YSX A;  2BS2 A;  4TM3 A;  2YQU A;  2YLS A;  4H4R A;  1CJ4 A;  3UKL A;  4RSL A;  5M10 A;  5FS8 A;  3P4P A;  3Q6J A;  2H88 A;  2WOV A;  4YKG A;  3IHM A;  2IVE A;  4AT0 A;  1VRQ B;  2YAU A;  3CPH G;  1PXA A;  2HQM A;  4GF7 A;  4NZH A;  4H4S A;  4BK2 A;  1NHP A;  2AR8 A;  1NAA A;  2WDR A;  5HYM A;  4DNA A;  3CIR A;  2C3C A;  4NEV A;  2YR5 A;  1GPE A;  1O5W A;  3DJG X;  3DJD A;  2C7G A;  1E1L A;  1GEU A;  1GTE A;  3COX A;  3RED A;  3G5Q A;  4OPT A;  1COY A;  3P4S A;  5IQ1 A;  1ZDL A;  5HY5 A;  5IPY A;  3QSS A;  2JBV A;  2QA2 A;  3KD9 A;  1DOC A;  3K7Q X;  1N4U A;  3VRD B;  1GRH A;  3IWA A;  3QSM A;  1YY5 A;  1L9E A;  3D1C A;  1EBD A;  1B5Q A;  2YM1 A;  3QSE A;  4FX9 A;  3II4 A;  2WOW A;  4CCQ A;  4AP1 A;  4DGK A;  3ALJ A;  2Q0L A;  2WPE A;  3NHO X;  3SQP A;  3AYJ A;  2GQW A;  3Q9T A;  4EMW A;  3H8I A;  2B76 A;  3OZ2 A;  1UKV G;  2GF3 A;  2R0P A;  1GOS A;  1D4D A;  3NNE A;  3K30 A;  5FS7 A;  4EM3 A;  4OPD A;  3AED A;  1IUT A;  2YM2 A;  2YWL A;  3ICR A;  3L1R A;  1KNR A;  1Q1R A;  4UDP A;  4GUV A;  4JNA A;  2C72 A;  2GB0 A;  3EAN A;  3ATQ A;  1PBB A;  3RHA A;  2GVC A;  1ONF A;  3KU9 A;  4B66 A;  3UP5 A;  1QJD A;  4D04 A;  3QVR A;  4OPU A;  1L0V A;  2GRT A;  3UOX A;  5JCL A;  2BK5 A;  2BC0 A;  4O5U A;  4U8I A;  1Z6L A;  4EQS A;  3F8P A;  2Y6R A;  4B69 A;  5C3J A;  1TDF A;  1YQ4 A;  3NTD A;  4U8J A;  2BK4 A;  4IA5 A;  5KOW A;  5KVI A;  2XVI A;  4J34 A;  2YLT A;  2XLP A;  4BV6 A;  4YT0 A;  1JNR A;  2W0H A;  3GDP A;  2QCU A;  3NKS A;  1ZMD A;  3AD9 B;  3UOV A;  4DSG A;  1PDH A;  3NN0 X;  5EOW A;  4DSH A;  4OVI A;  4A6N A;  2XLU A;  2AQJ A;  3DH9 A;  2C66 A;  5JCI A;  3AE4 A;  1KNP A;  4A79 A;  2YG5 A;  3IHG A;  2RGO A;  5EB5 A;  2JKC A;  2V61 A;  1NG3 A;  3GDN A;  2OA1 A;  2X3N A;  3AXB A;  4OPL A;  2E5V A;  2XFP A;  4UDQ A;  3AE9 A;  5ER0 A;  4U8P A;  2JB2 A;  4KPR A;  1MOK A;  2FJE A;  2GR2 A;  4H4X A;  5HXI A;  1D5T A;  2EQ8 A;  5KOX A;  2PYX A;  2TMD A;  3BI4 A;  4UDR A;  1S3E A;  3UKP A;  4ICY A;  3AEA A;  4Z2R A;  1XHC A;  1LQU A;  3LB8 A;  3SGL A;  3I6D A;  4BK1 A;  1DNC A;  2GMH A;  2VVM A;  1D7L A;  1XDI A;  3IF9 A;  3T37 A;  4YXD A;  1IUV A;  2E4G A;  2XLR A;  3SFD A;  3M12 A;  3WE0 A;  4H2R A;  2BAB A;  2ZBW A;  1GSN A;  3CNT A;  1N4V A;  1PJ5 A;  3P1W A;  2VRL A;  2YG3 A;  2AAQ A;  1E1N A;  1CL0 A;  2Q0K A;  2ZZC A;  1FEC A;  3GD4 A;  1FOH A;  1X31 B;  3F8R A;  3BNM A;  3FMW A;  4K5R A;  2RGJ A;  1BZL A;  1JEH A;  1XAN A;  1D7Y A;  3CNS A;  1VQW A;  2XFO A;  4XXG A;  3GD3 A;  4ECH A;  5J60 A;  1F8S A;  4TLX A;  1CHU A;  1ZMC A;  4GRT A;  3KVE A;  2YLX A;  1JRX A;  1P2E A;  1NHR A;  3LJP A;  4FDC B;  5U25 A;  3UKF A;  3KA7 A;  3LZW A;  4ADW A;  5TR3 A;  1AOG A;  1BGN A;  2JAE A;  3P9U A;  4U2L A;  1FEA A;  2WBA A;  5KRQ A;  4TM0 A;  2GMJ A;  3AYL A;  2GR3 A;  4I59 A;  1F8R A;  4IV9 A;  3UP4 A;  2EQ7 A;  3QFB A;  4J56 A;  1YQ3 A;  2GQF A;  3B3R A;  4B68 A;  2DKH A;  1V59 A;  5J7X A;  1KSS A;  2BYB A;  2RAB A;  2XVH A;  2VVL A;  2J3N A;  4D03 A;  4H4Y A;  1W4X A;  2GAG B;  2GR1 A;  3NK1 X;  2VOU A;  4GDE A;  3UKK A;  1EL9 A;  1S3B A;  2RGH A;  3KLJ A;  1QLB A;  2XLT A;  4Y4M A;  1JRY A;  1HYU A;  1IUW A;  4H4P A;  1CF3 A;  2Y6Q A;  3CPI G;  1RP0 A;  3S5W A;  5CKU A;  1TRB A;  1M6I A;  2YG4 A;  5FS9 A;  3QFA A;  4LII A;  1EL8 A;  4O5Q A;  1PBE A;  4GR1 A;  2C75 A;  2EQ9 A;  1BWC A;  1KSU A;  2GAH B;  2GV8 A;  3RP7 A;  4CBQ A;  4YKF A;  4YSZ A;  4Y4L A;  2BK3 A;  2C67 A;  3BI5 A;  3CGC A;  5BUL A;  2BCP A;  3H8L A;  2IID A;  3UOZ A;  4EMI A;  2YR4 A;  1ZP0 A;  5GSN A;  5JCM A;  2VQB A;  4TM4 A;  3AE7 A;  3UTG A;  4J2W A;  4U8M A;  2OLN A;  2WOI A;  3NYF A;  2BS3 A;  3AE1 A;  2Q6U A;  1REO A;  3GWF A;  1L9C A;  1XPQ A;  1BF3 A;  4A99 A;  4EIP A;  4K22 A;  3P4Q A;  3AD7 B;  4K2X A;  3ALL A;  2DKI A;  3SM8 A;  2X8C A;  3QVP A;  3IC9 A;  1NEN A;  3DK4 A;  1D4C A;  2VVL G;  2XFU A;  3CTY A;  1D4E A;  3FPZ A;  4FK1 A;  2TPR A;  4HA6 A;  3C4A A;  3GMC A;  1OJD A;  2E1M A;  3ALM A;  2WDQ A;  1GES A;  3AE8 A;  4EQW A;  3DJJ A;  1TDK A;  3ATR A;  4LU6 A;  4A5L A;  1LPF A;  4CY6 A;  4TM1 A;  2B9X A;  5BRT A;  3NLC A;  1JU2 A;  3URH A;  1B8S A;  1CC2 A;  2WPC A;  1QO8 A;  1CC6 A;  2WDV A;  2B7R A;  3CGD A;  3NN6 X;  4BJZ A;  1LTX R;  1F6M A;  1GRB A;  4PAB A;  4NTD A;  2A8X A;  4XWR A;  1GND A;  1K4Q A;  3GWD A;  1E6E A;  3C4N A;  5U1O A;  1Y56 A;  3PVC A;  2CVJ A;  2R4E A;  4AOS A;  1MO9 A;  4A9W A;  3JSK A;  1LQT A;  3NG7 X;  4EMJ A;  2GH5 A;  1BKW A;  2PHH A;  4CY8 A;  2WEU A;  1O94 A;  3K7T A;  3SFE A;  3DA1 A;  1CJ2 A;  3UTH A;  4GDP A;  4AT2 A;  5L46 A;  1YKJ A;  4H4V A;  1GRT A;  3B6D A;  3DME A;  4H4U A;  4K5S A;  1K0I A;  5HHF A;  4EIQ A;  1IUU A;  4B1B A;  5FS6 A;  2C70 A;  4HB9 A;  1S2Y A;  1OJA A;  3LXD A;  1ZK7 A;  4TLZ A;  1CJC A;  2WP5 A;  1NDA A;  1PXB A;  1Q9I A;  2WES A;  2NVK X;  4GCM A;  2WP6 A;  4Z2U A;  2V5Z A;  1GV4 A;  2ZZ0 A;  4E0V A;  4YSY A;  3AE2 A;  3NK2 X;  4Z24 A;  4JNQ A;  3VR8 A;  4H4T A;  1GAL A;  2Z5X A;  3LAD A;  3AEF A;  3QJ4 A;  5KWF A;  5EB4 A;  4X9M A;  1IUS A;  4H4Q A;  3FBS A;  4H4Z A;  1NHS A;  3AB1 A;  2BC1 A;  1Q1W A;  4M52 A;  3FIM B;  3L8K A;  4APN A;  2V6O A;  3KKJ A;  3UTE A;  1VG9 A;  2YVJ A;  3ICS A;  1GET A;  1NEK A;  3UKA A;  3NH3 X;  2YLZ A;  3GYJ A;  3R9U A;  1GTH A;  1B37 A;  4IVO B;  2WU5 A;  3V76 A;  1RSG A;  2BXS A;  3CGE A;  3UKH A;  2OAL A;  4Y4N A;  4C74 A;  3M13 A;  3G5S A;  1LJ1 A;  3F8D A;  2IVD A;  1DJQ A;  2F5Z A;  3BHF A;  3DGZ A;  2R45 A;  4ZN0 A;  4J33 A;  4IVM B;  4C3Y A;  2R9Z A;  4USQ A;  2BCG G;  3AEG A;  1JRZ A;  1MXT A;  2BXR A;  3CND A;  1B4V A;  4ZCD A;  3VQR A;  2YR6 A;  3GRT A;  3I3L A;  2YLW A;  1FL2 A;  2C76 A;  3LZX A;  3NYC A;  4C3X A;  3V3N A;  3M0O A;  3UKQ A;  4OPG A;  4YSH A;  3ZDN A;  2XFN A;  3PO7 A;  4CNJ A;  4U8O A;  3VRB A;  2UZZ A;  1N1P A;  1DOD A;  1PN0 A;  3DJE A;  3AEE A;  2XVJ A;  2OLO A;  2YLR A;  3NRN A;  2XVF A;  1N4W A;  1NG4 A;  4J57 A;  2R4J A;  3NTA A;  1ZX9 A;  1H6V A;  3H4K A;  2NPX A;  3CGB A;  1FEB A;  1E1K A;  4X9N A;  3S61 A;  1JNZ A;  4Z2T A;  3ITJ A;  1OJT A;  4ZCC A;  2A89 A;  2R46 A;  3RNM A;  1DXL A;  4KX6 A;  3AEB A;  1OJC A;  2YG6 A;  5LV9 A;  1DOE A;  4U2T A;  4I58 A;  5C2T A;  3CNJ A;  2VRM A;  2XLS A;  3ABV A;  3P4R A;  1EL7 A;  5JCK A;  1ELI A;  4PAA A;  2R0C A;  1TYP A;  2VQ7 A;  3NIX A;  2FBW A;  4Z44 A;  1TDE A;  2XYO A;  3KPF A;  1LV0 A;  2XFQ A;  4U8N A;  2C73 A;  1GT8 A;  4Z25 A;  4H2Q A;  4X4J A;  4BUR A;  4J36 A;  5KVH A;  3EF6 A;  1NHQ A;  2JK6 A;  4A65 A;  4WX1 A;  2APG A;  1H82 A;  2B9Y A;  1H7W A;  4REK A;  1TDN A;  1P2H A;  4NTE A;  4NTC A;  3VR9 A;  4BK3 A;  1GXF A;  1E7P A;  1F3P A;  3O0H A;  4JDR A;  1ZOY A;  4B67 A;  1Y56 B;  4Z43 A;  4A7A A;  2I0Z A;  1VG0 A;  3EAO A;  3NT6 A;  5FMH A;  1GRF A;  2Q7V A;  3AD8 B;  1H7X A;  2O9Z A;  1M64 A;  4P9S A;  2WQY A;  1Y0P A;  4H50 A;  3RP6 A;  1FCD A;  1DOB A;  4U2S A;  4B63 A;  2ZZB A;  4OPI A;  4Z26 A;  3FG2 P;  4EQR A;  4J31 A;  4MJW A;  1PJ6 A;  4U8K A;  2BAC A;  4OPC A;  3V3O A;  4B65 A;  2B7S A;  3D8X A;  2FJB A;  3ZYX A;  3RP8 A;  1GRE A;  2YVG A;  4H2N A;  1JOA A;  1KFY A;  3AE5 A;  2QA1 A;  2WP9 A;  1OJ9 A;  3DK9 A;  3CPJ G;  2EQ6 A;  2WET A;  2GEW A;  4OCG A;  3BI2 A;  5M0Z A;  1CJ3 A;  2GR0 A;  1CBO A;  1H84 A;  2H89 A;  3CNP A;  3ICT A;  4LA1 A;  3DGH A;  1IJH A;  4A6N B;  2V60 A;  1ZOV A;  4H2P A;  2CDU A;  1KDG A;  4CRT A;  4RG4 A;  3ISH A;  1EL5 A;  2ACZ A;  4N9X A;  3AE6 A;  2XCG A;  1E39 A;  3ADA B;  1S2Q A;  3PS9 A;  4NEW A;  4C77 A;  2FJD A;  5KXJ A;  3AE3 A;  2WS3 A;  3CN8 A;  1TDO A;  1ZY8 A;  2C64 A;  1K0L A;  2C3D A;  2X8G A;  3DK8 A;  2A87 A;  1PHH A;  4RG3 A;  2OAM A;  4YWO A;  1DJN A;  2C65 A;  3AEC A;  2VZ2 A;  1RYI A;  5EBK A;  1IUX A;  1GER A;  1TYT A;  4EM4 A;  1O95 A;  1H86 A;  2XDO A;  4IA6 A;  2V3B A;  2WU2 A;  3AYI A;  3NGC X;  5U63 A;  1BGJ A;  3NYE A;  3BHK A;  1VDC A;  3GRS A;  2BS4 A;  4YTN A;  1GRG A;  1PBD A;  1L9D A;  4JN9 A;  1KF6 A;  3EPT A;  2CUL A;  1ZKQ A;  5CQF A;  1E1M A;  4U8L A;  4K7Z A;  3UTF A;  3UCL A;  3VRA A;  5DBJ A;  3BNU A;  4H4W A;  2JB3 A;  1PBF A;  1PXC A;  3GMB A;  4BJY A;  4JY2 A;  1PBC A;  3G5R A;  4WCT A;  4EQX A;  3UOY A;  1YQZ A;  2XVE A;  5BVA A;  1H81 A;  3K7M X;  5JCN A;  1F8W A;  1PJ7 A;  2YG7 A;  2JB1 A;  4K8D A;  2ARD A;  4UP3 A;  3GSI A;  2Z5Y A;  4CNK A;  4CCR A;  2B9W A;  4YTM A;  4C5O A;  2X99 A;  5IQ4 A;  2X50 A;  3C96 A;  1LVL A;  1NPX A;  2FJA A;  2X8H A;  3HZL A;  1PS9 A;  1K0J A;  2QAE A;  5BUK A;  1CC4 A;  2CFY A;  3GYI A;  1H83 A;  3E1T A;  3OC4 A;  4JQ9 A;  2V3A A;  4USR A;  2BA9 A;  4XWZ A;  3AWI A;  3NK0 X;  4AP3 A;  4AOX A;  4YTP A;  2WHD A;  1GRA A;  2R0G A;  3LOV A;  5GRT A;  4B64 A;  1SEZ A;  2WPF A;  2YVF A;  4JY3 A; 
#chains in the Genus database with same CATH topology
 4FK1 C;  4H7U A;  4YSX A;  2BS2 A;  4TM3 A;  2YQU A;  2YLS A;  4H4R A;  1CJ4 A;  3SX6 A;  4RSL A;  3UKL A;  5M10 A;  5FS8 A;  3P4P A;  3Q6J A;  2H88 A;  2WOV A;  4YKG A;  3IHM A;  2IVE A;  4AT0 A;  1VRQ B;  2YAU A;  3CPH G;  1PXA A;  2HQM A;  4GF7 A;  4NZH A;  4H4S A;  3T2Z A;  4BK2 A;  1NHP A;  2AR8 A;  1NAA A;  2WDR A;  5HYM A;  4DNA A;  3CIR A;  2C3C A;  4NEV A;  2YR5 A;  1GPE A;  1O5W A;  3DJG X;  3DJD A;  2C7G A;  1E1L A;  1GEU A;  1GTE A;  3COX A;  3RED A;  3G5Q A;  4OPT A;  1COY A;  3P4S A;  5IQ1 A;  1ZDL A;  5HY5 A;  5IPY A;  3QSS A;  2JBV A;  2QA2 A;  3KD9 A;  1DOC A;  3K7Q X;  1N4U A;  3VRD B;  1GRH A;  3IWA A;  3QSM A;  1YY5 A;  1L9E A;  3D1C A;  1EBD A;  1B5Q A;  2YM1 A;  3QSE A;  4FX9 A;  3II4 A;  2WOW A;  4CCQ A;  4AP1 A;  4DGK A;  3ALJ A;  2Q0L A;  2WPE A;  3NHO X;  3SQP A;  3AYJ A;  2GQW A;  3Q9T A;  5KMR A;  4EMW A;  3H8I A;  2B76 A;  3OZ2 A;  1UKV G;  2GF3 A;  2R0P A;  1GOS A;  3T2K A;  1D4D A;  3NNE A;  3HYW A;  3K30 A;  5FS7 A;  4EM3 A;  4OPD A;  3AED A;  1IUT A;  2YM2 A;  2YWL A;  3ICR A;  3L1R A;  1KNR A;  1Q1R A;  4UDP A;  4GUV A;  4JNA A;  5KMS A;  2C72 A;  2GB0 A;  3EAN A;  3ATQ A;  1PBB A;  3RHA A;  2GVC A;  1ONF A;  3KU9 A;  4B66 A;  3UP5 A;  1QJD A;  4D04 A;  3QVR A;  4OPU A;  1L0V A;  2GRT A;  3UOX A;  5JCL A;  2BK5 A;  2BC0 A;  4O5U A;  4U8I A;  1Z6L A;  4EQS A;  3F8P A;  2Y6R A;  4B69 A;  5C3J A;  1TDF A;  1YQ4 A;  3NTD A;  4U8J A;  2BK4 A;  4IA5 A;  5KOW A;  5KVI A;  2XVI A;  4J34 A;  2YLT A;  2XLP A;  3T0K A;  3T2Y A;  4BV6 A;  4YT0 A;  1JNR A;  2W0H A;  3GDP A;  2QCU A;  3NKS A;  1ZMD A;  3AD9 B;  3UOV A;  4DSG A;  1PDH A;  3NN0 X;  5EOW A;  4DSH A;  4OVI A;  4A6N A;  2XLU A;  2AQJ A;  3DH9 A;  2C66 A;  5JCI A;  3AE4 A;  1KNP A;  4A79 A;  2YG5 A;  3IHG A;  2RGO A;  5EB5 A;  2JKC A;  2V61 A;  1NG3 A;  3GDN A;  2OA1 A;  2X3N A;  3AXB A;  4OPL A;  2E5V A;  2XFP A;  4UDQ A;  3SZW A;  3AE9 A;  5ER0 A;  4U8P A;  2JB2 A;  4KPR A;  3T31 A;  1MOK A;  2FJE A;  2GR2 A;  4H4X A;  3SXI A;  1D5T A;  5HXI A;  2EQ8 A;  5KOX A;  2PYX A;  2TMD A;  3BI4 A;  4UDR A;  1S3E A;  3UKP A;  4ICY A;  3AEA A;  4Z2R A;  1XHC A;  1LQU A;  3LB8 A;  3SGL A;  3I6D A;  4BK1 A;  1DNC A;  2GMH A;  2VVM A;  1D7L A;  1XDI A;  3IF9 A;  3T37 A;  4YXD A;  1IUV A;  2E4G A;  2XLR A;  3SFD A;  3M12 A;  3WE0 A;  4H2R A;  2BAB A;  2ZBW A;  1GSN A;  3CNT A;  1N4V A;  1PJ5 A;  3P1W A;  2VRL A;  2YG3 A;  3SY4 A;  2AAQ A;  1E1N A;  1CL0 A;  2Q0K A;  2ZZC A;  1FEC A;  3GD4 A;  1FOH A;  1X31 B;  3F8R A;  3BNM A;  3FMW A;  4K5R A;  4II2 A;  2RGJ A;  1BZL A;  1JEH A;  1XAN A;  1D7Y A;  3CNS A;  1VQW A;  2XFO A;  4XXG A;  3GD3 A;  4ECH A;  5J60 A;  1F8S A;  4TLX A;  1CHU A;  1ZMC A;  4GRT A;  3KVE A;  2YLX A;  1JRX A;  1P2E A;  1NHR A;  3LJP A;  4FDC B;  5U25 A;  3UKF A;  3KA7 A;  3LZW A;  4ADW A;  5TR3 A;  1AOG A;  1BGN A;  2JAE A;  3P9U A;  4U2L A;  1FEA A;  2WBA A;  5KRQ A;  4TM0 A;  2GMJ A;  3AYL A;  2GR3 A;  4I59 A;  1F8R A;  4IV9 A;  3UP4 A;  2EQ7 A;  3QFB A;  4J56 A;  3HYV A;  1YQ3 A;  2GQF A;  3B3R A;  4B68 A;  2DKH A;  1V59 A;  5J7X A;  1KSS A;  2BYB A;  2RAB A;  2XVH A;  2VVL A;  2J3N A;  4D03 A;  4H4Y A;  1W4X A;  2GAG B;  2GR1 A;  3NK1 X;  2VOU A;  4GDE A;  3UKK A;  1EL9 A;  1S3B A;  2RGH A;  3KLJ A;  1QLB A;  2XLT A;  4Y4M A;  1JRY A;  1HYU A;  1IUW A;  4H4P A;  1CF3 A;  2Y6Q A;  3CPI G;  1RP0 A;  3S5W A;  5CKU A;  1TRB A;  1M6I A;  2YG4 A;  5FS9 A;  3QFA A;  4LII A;  1EL8 A;  4O5Q A;  1PBE A;  4GR1 A;  2C75 A;  2EQ9 A;  1BWC A;  1KSU A;  2GAH B;  2GV8 A;  3RP7 A;  4CBQ A;  4YKF A;  4YSZ A;  4Y4L A;  2BK3 A;  2BRY A;  2C67 A;  3BI5 A;  3CGC A;  5BUL A;  2BCP A;  3H8L A;  2IID A;  3UOZ A;  4EMI A;  2YR4 A;  1ZP0 A;  5GSN A;  5JCM A;  2VQB A;  4TM4 A;  3AE7 A;  3KPK A;  3UTG A;  4J2W A;  4U8M A;  2OLN A;  2WOI A;  3NYF A;  2BS3 A;  3AE1 A;  2Q6U A;  1REO A;  3GWF A;  1L9C A;  1XPQ A;  1BF3 A;  4A99 A;  4EIP A;  4K22 A;  3P4Q A;  3AD7 B;  4K2X A;  3ALL A;  2DKI A;  3SM8 A;  2X8C A;  3QVP A;  3IC9 A;  1NEN A;  3GYX A;  3DK4 A;  1D4C A;  2VVL G;  2XFU A;  3CTY A;  1D4E A;  3FPZ A;  4FK1 A;  2C4C A;  2TPR A;  4HA6 A;  3C4A A;  3GMC A;  1OJD A;  2E1M A;  3ALM A;  2WDQ A;  1GES A;  3AE8 A;  4EQW A;  3DJJ A;  1TDK A;  3ATR A;  4LU6 A;  4A5L A;  1LPF A;  4CY6 A;  4TM1 A;  2B9X A;  5BRT A;  3NLC A;  1JU2 A;  3URH A;  1B8S A;  1CC2 A;  2WPC A;  1QO8 A;  1CC6 A;  2WDV A;  2B7R A;  3CGD A;  3NN6 X;  4BJZ A;  1LTX R;  1F6M A;  1GRB A;  4PAB A;  4NTD A;  2A8X A;  4XWR A;  1GND A;  1K4Q A;  3GWD A;  1E6E A;  3C4N A;  5U1O A;  1Y56 A;  3PVC A;  2CVJ A;  2R4E A;  4AOS A;  1MO9 A;  4A9W A;  3JSK A;  1LQT A;  3NG7 X;  3SZF A;  4EMJ A;  2GH5 A;  1BKW A;  2PHH A;  4CY8 A;  2WEU A;  1O94 A;  3K7T A;  3SFE A;  3DA1 A;  1CJ2 A;  3UTH A;  4GDP A;  4AT2 A;  5L46 A;  1YKJ A;  4H4V A;  1GRT A;  3B6D A;  3DME A;  4H4U A;  4K5S A;  1K0I A;  5HHF A;  4EIQ A;  1IUU A;  4B1B A;  5FS6 A;  2C70 A;  4HB9 A;  1S2Y A;  1OJA A;  3LXD A;  1ZK7 A;  4TLZ A;  1CJC A;  2WP5 A;  1NDA A;  1PXB A;  1Q9I A;  2WES A;  3SZC A;  2NVK X;  4GCM A;  3HYX A;  2WP6 A;  4Z2U A;  2V5Z A;  1GV4 A;  2ZZ0 A;  4E0V A;  4YSY A;  3AE2 A;  3NK2 X;  4Z24 A;  4JNQ A;  3VR8 A;  4H4T A;  1GAL A;  2Z5X A;  3LAD A;  3AEF A;  3QJ4 A;  5KWF A;  4G73 A;  5EB4 A;  4X9M A;  1IUS A;  4H4Q A;  3FBS A;  4H4Z A;  1NHS A;  3AB1 A;  4GAP A;  2BC1 A;  5KMQ A;  1Q1W A;  4M52 A;  3CMM A;  3FIM B;  3L8K A;  4APN A;  2V6O A;  3KKJ A;  3UTE A;  5KNL A;  1VG9 A;  2YVJ A;  3ICS A;  1GET A;  1NEK A;  3UKA A;  3NH3 X;  2YLZ A;  3GYJ A;  3R9U A;  1GTH A;  1B37 A;  4IVO B;  2WU5 A;  3V76 A;  1RSG A;  2BXS A;  3CGE A;  3UKH A;  2OAL A;  4Y4N A;  4C74 A;  3M13 A;  3G5S A;  1LJ1 A;  3F8D A;  2IVD A;  1DJQ A;  2F5Z A;  3BHF A;  3DGZ A;  2R45 A;  4ZN0 A;  4J33 A;  4IVM B;  4C3Y A;  2R9Z A;  4USQ A;  2BCG G;  3AEG A;  1JRZ A;  1MXT A;  2BXR A;  3CND A;  1B4V A;  4ZCD A;  3VQR A;  2YR6 A;  3GRT A;  3I3L A;  2YLW A;  1FL2 A;  2C76 A;  3LZX A;  3NYC A;  4C3X A;  3V3N A;  3M0O A;  4II3 A;  3UKQ A;  4OPG A;  4YSH A;  3ZDN A;  2XFN A;  2BRA A;  3PO7 A;  4CNJ A;  4U8O A;  3VRB A;  2UZZ A;  1N1P A;  1DOD A;  1PN0 A;  3DJE A;  3SZ0 A;  3AEE A;  2XVJ A;  2OLO A;  2YLR A;  3NRN A;  2XVF A;  1N4W A;  1NG4 A;  4J57 A;  2R4J A;  3NTA A;  1ZX9 A;  1H6V A;  3H4K A;  2NPX A;  3CGB A;  1FEB A;  1E1K A;  4X9N A;  3S61 A;  1JNZ A;  4Z2T A;  3ITJ A;  1OJT A;  4ZCC A;  2A89 A;  2R46 A;  3RNM A;  1DXL A;  4KX6 A;  3AEB A;  1OJC A;  2YG6 A;  5LV9 A;  1DOE A;  4U2T A;  4I58 A;  5C2T A;  3CNJ A;  2VRM A;  2XLS A;  3ABV A;  3P4R A;  1EL7 A;  5JCK A;  1ELI A;  4PAA A;  2R0C A;  1TYP A;  2VQ7 A;  3NIX A;  2FBW A;  4Z44 A;  1TDE A;  2XYO A;  3KPF A;  1LV0 A;  2XFQ A;  4U8N A;  2C73 A;  1GT8 A;  4Z25 A;  4H2Q A;  4X4J A;  4BUR A;  4J36 A;  5KVH A;  3EF6 A;  1NHQ A;  2JK6 A;  4A65 A;  4WX1 A;  2APG A;  1H82 A;  2B9Y A;  1H7W A;  4REK A;  1TDN A;  1P2H A;  4NTE A;  4NTC A;  3VR9 A;  3T14 A;  4BK3 A;  1GXF A;  1E7P A;  1F3P A;  3O0H A;  4JDR A;  1ZOY A;  4B67 A;  1Y56 B;  4Z43 A;  4A7A A;  2I0Z A;  1VG0 A;  3EAO A;  3NT6 A;  5FMH A;  1GRF A;  2Q7V A;  3AD8 B;  4G6H A;  1H7X A;  2O9Z A;  1M64 A;  4P9S A;  2WQY A;  1Y0P A;  4H50 A;  3RP6 A;  1FCD A;  1DOB A;  4U2S A;  4B63 A;  2ZZB A;  4OPI A;  4Z26 A;  3FG2 P;  4EQR A;  4J31 A;  4MJW A;  1PJ6 A;  4U8K A;  2BAC A;  4OPC A;  3V3O A;  4B65 A;  4NNJ A;  2B7S A;  3D8X A;  2FJB A;  3ZYX A;  3RP8 A;  1GRE A;  2YVG A;  4H2N A;  1JOA A;  1KFY A;  3AE5 A;  2QA1 A;  2WP9 A;  1OJ9 A;  3DK9 A;  3CPJ G;  4G6G A;  2EQ6 A;  2WET A;  2GEW A;  4OCG A;  3BI2 A;  5M0Z A;  1CJ3 A;  2GR0 A;  1CBO A;  1H84 A;  2H89 A;  3CNP A;  3ICT A;  4LA1 A;  3DGH A;  1IJH A;  4A6N B;  2V60 A;  1ZOV A;  4H2P A;  2CDU A;  1KDG A;  4CRT A;  4RG4 A;  3ISH A;  1EL5 A;  2ACZ A;  4N9X A;  3AE6 A;  2XCG A;  1E39 A;  3ADA B;  1S2Q A;  3PS9 A;  4NEW A;  4C77 A;  2FJD A;  5KXJ A;  3AE3 A;  2WS3 A;  3CN8 A;  1TDO A;  1ZY8 A;  2C64 A;  1K0L A;  2C3D A;  2X8G A;  3DK8 A;  2A87 A;  1PHH A;  4RG3 A;  5KMP A;  2OAM A;  4YWO A;  1DJN A;  2C65 A;  3AEC A;  2VZ2 A;  1RYI A;  5EBK A;  1IUX A;  1GER A;  1TYT A;  4EM4 A;  1O95 A;  1H86 A;  2XDO A;  4IA6 A;  2V3B A;  2WU2 A;  3AYI A;  3NGC X;  5U63 A;  1BGJ A;  3NYE A;  3BHK A;  1VDC A;  3GRS A;  2BS4 A;  4YTN A;  1GRG A;  1PBD A;  1L9D A;  4JN9 A;  1KF6 A;  3EPT A;  2CUL A;  1ZKQ A;  5CQF A;  1E1M A;  4U8L A;  4K7Z A;  4G74 A;  3UTF A;  3UCL A;  4NWZ A;  3VRA A;  5DBJ A;  3BNU A;  4H4W A;  2JB3 A;  1PBF A;  1PXC A;  3GMB A;  4BJY A;  4JY2 A;  1PBC A;  3G5R A;  4WCT A;  4EQX A;  3UOY A;  1YQZ A;  2XVE A;  5BVA A;  1H81 A;  3K7M X;  5JCN A;  1F8W A;  1PJ7 A;  2YG7 A;  4G9K A;  2JB1 A;  4K8D A;  2ARD A;  4UP3 A;  3GSI A;  2Z5Y A;  4CNK A;  4CCR A;  2B9W A;  4YTM A;  4C5O A;  2X99 A;  5IQ4 A;  3SYI A;  2X50 A;  3C96 A;  1LVL A;  1NPX A;  2FJA A;  2X8H A;  3HZL A;  1PS9 A;  1K0J A;  2QAE A;  5BUK A;  1CC4 A;  2CFY A;  3GYI A;  1H83 A;  3E1T A;  3OC4 A;  4JQ9 A;  2V3A A;  4USR A;  2BA9 A;  4XWZ A;  3AWI A;  3NK0 X;  4AP3 A;  4AOX A;  4YTP A;  2WHD A;  1GRA A;  2R0G A;  3LOV A;  4GAV A;  5GRT A;  4B64 A;  1SEZ A;  2WPF A;  2YVF A;  4JY3 A; 
#chains in the Genus database with same CATH homology
 4FK1 C;  4H7U A;  4YSX A;  2BS2 A;  4TM3 A;  2YQU A;  2YLS A;  4H4R A;  1CJ4 A;  3SX6 A;  4RSL A;  3UKL A;  5M10 A;  5FS8 A;  3P4P A;  3Q6J A;  2H88 A;  2WOV A;  4YKG A;  3IHM A;  2IVE A;  4AT0 A;  1VRQ B;  2YAU A;  3CPH G;  1PXA A;  2HQM A;  4GF7 A;  4NZH A;  4H4S A;  3T2Z A;  4BK2 A;  1NHP A;  2AR8 A;  1NAA A;  2WDR A;  5HYM A;  4DNA A;  3CIR A;  2C3C A;  4NEV A;  2YR5 A;  1GPE A;  1O5W A;  3DJG X;  3DJD A;  2C7G A;  1E1L A;  1GEU A;  1GTE A;  3COX A;  3RED A;  3G5Q A;  4OPT A;  1COY A;  3P4S A;  5IQ1 A;  1ZDL A;  5HY5 A;  5IPY A;  3QSS A;  2JBV A;  2QA2 A;  3KD9 A;  1DOC A;  3K7Q X;  1N4U A;  3VRD B;  1GRH A;  3IWA A;  3QSM A;  1YY5 A;  1L9E A;  3D1C A;  1EBD A;  1B5Q A;  2YM1 A;  3QSE A;  4FX9 A;  3II4 A;  2WOW A;  4CCQ A;  4AP1 A;  4DGK A;  3ALJ A;  2Q0L A;  2WPE A;  3NHO X;  3SQP A;  3AYJ A;  2GQW A;  3Q9T A;  5KMR A;  4EMW A;  3H8I A;  2B76 A;  3OZ2 A;  1UKV G;  2GF3 A;  2R0P A;  1GOS A;  3T2K A;  1D4D A;  3NNE A;  3HYW A;  3K30 A;  5FS7 A;  4EM3 A;  4OPD A;  3AED A;  1IUT A;  2YM2 A;  2YWL A;  3ICR A;  3L1R A;  1KNR A;  1Q1R A;  4UDP A;  4GUV A;  4JNA A;  5KMS A;  2C72 A;  2GB0 A;  3EAN A;  3ATQ A;  1PBB A;  3RHA A;  2GVC A;  1ONF A;  3KU9 A;  4B66 A;  3UP5 A;  1QJD A;  4D04 A;  3QVR A;  4OPU A;  1L0V A;  2GRT A;  3UOX A;  5JCL A;  2BK5 A;  2BC0 A;  4O5U A;  4U8I A;  1Z6L A;  4EQS A;  3F8P A;  2Y6R A;  4B69 A;  5C3J A;  1TDF A;  1YQ4 A;  3NTD A;  4U8J A;  2BK4 A;  4IA5 A;  5KOW A;  5KVI A;  2XVI A;  4J34 A;  2YLT A;  2XLP A;  3T0K A;  3T2Y A;  4BV6 A;  4YT0 A;  1JNR A;  2W0H A;  3GDP A;  2QCU A;  3NKS A;  1ZMD A;  3AD9 B;  3UOV A;  4DSG A;  1PDH A;  3NN0 X;  5EOW A;  4DSH A;  4OVI A;  4A6N A;  2XLU A;  2AQJ A;  3DH9 A;  2C66 A;  5JCI A;  3AE4 A;  1KNP A;  4A79 A;  2YG5 A;  3IHG A;  2RGO A;  5EB5 A;  2JKC A;  2V61 A;  1NG3 A;  3GDN A;  2OA1 A;  2X3N A;  3AXB A;  4OPL A;  2E5V A;  2XFP A;  4UDQ A;  3SZW A;  3AE9 A;  5ER0 A;  4U8P A;  2JB2 A;  4KPR A;  3T31 A;  1MOK A;  2FJE A;  2GR2 A;  4H4X A;  3SXI A;  1D5T A;  5HXI A;  2EQ8 A;  5KOX A;  2PYX A;  2TMD A;  3BI4 A;  4UDR A;  1S3E A;  3UKP A;  4ICY A;  3AEA A;  4Z2R A;  1XHC A;  1LQU A;  3LB8 A;  3SGL A;  3I6D A;  4BK1 A;  1DNC A;  2GMH A;  2VVM A;  1D7L A;  1XDI A;  3IF9 A;  3T37 A;  4YXD A;  1IUV A;  2E4G A;  2XLR A;  3SFD A;  3M12 A;  3WE0 A;  4H2R A;  2BAB A;  2ZBW A;  1GSN A;  3CNT A;  1N4V A;  1PJ5 A;  3P1W A;  2VRL A;  2YG3 A;  3SY4 A;  2AAQ A;  1E1N A;  1CL0 A;  2Q0K A;  2ZZC A;  1FEC A;  3GD4 A;  1FOH A;  1X31 B;  3F8R A;  3BNM A;  3FMW A;  4K5R A;  4II2 A;  2RGJ A;  1BZL A;  1JEH A;  1XAN A;  1D7Y A;  3CNS A;  1VQW A;  2XFO A;  4XXG A;  3GD3 A;  4ECH A;  5J60 A;  1F8S A;  4TLX A;  1CHU A;  1ZMC A;  4GRT A;  3KVE A;  2YLX A;  1JRX A;  1P2E A;  1NHR A;  3LJP A;  4FDC B;  5U25 A;  3UKF A;  3KA7 A;  3LZW A;  4ADW A;  5TR3 A;  1AOG A;  1BGN A;  2JAE A;  3P9U A;  4U2L A;  1FEA A;  2WBA A;  5KRQ A;  4TM0 A;  2GMJ A;  3AYL A;  2GR3 A;  4I59 A;  1F8R A;  4IV9 A;  3UP4 A;  2EQ7 A;  3QFB A;  4J56 A;  3HYV A;  1YQ3 A;  2GQF A;  3B3R A;  4B68 A;  2DKH A;  1V59 A;  5J7X A;  1KSS A;  2BYB A;  2RAB A;  2XVH A;  2VVL A;  2J3N A;  4D03 A;  4H4Y A;  1W4X A;  2GAG B;  2GR1 A;  3NK1 X;  2VOU A;  4GDE A;  3UKK A;  1EL9 A;  1S3B A;  2RGH A;  3KLJ A;  1QLB A;  2XLT A;  4Y4M A;  1JRY A;  1HYU A;  1IUW A;  4H4P A;  1CF3 A;  2Y6Q A;  3CPI G;  1RP0 A;  3S5W A;  5CKU A;  1TRB A;  1M6I A;  2YG4 A;  5FS9 A;  3QFA A;  4LII A;  1EL8 A;  4O5Q A;  1PBE A;  4GR1 A;  2C75 A;  2EQ9 A;  1BWC A;  1KSU A;  2GAH B;  2GV8 A;  3RP7 A;  4CBQ A;  4YKF A;  4YSZ A;  4Y4L A;  2BK3 A;  2BRY A;  2C67 A;  3BI5 A;  3CGC A;  5BUL A;  2BCP A;  3H8L A;  2IID A;  3UOZ A;  4EMI A;  2YR4 A;  1ZP0 A;  5GSN A;  5JCM A;  2VQB A;  4TM4 A;  3AE7 A;  3KPK A;  3UTG A;  4J2W A;  4U8M A;  2OLN A;  2WOI A;  3NYF A;  2BS3 A;  3AE1 A;  2Q6U A;  1REO A;  3GWF A;  1L9C A;  1XPQ A;  1BF3 A;  4A99 A;  4EIP A;  4K22 A;  3P4Q A;  3AD7 B;  4K2X A;  3ALL A;  2DKI A;  3SM8 A;  2X8C A;  3QVP A;  3IC9 A;  1NEN A;  3GYX A;  3DK4 A;  1D4C A;  2VVL G;  2XFU A;  3CTY A;  1D4E A;  3FPZ A;  4FK1 A;  2C4C A;  2TPR A;  4HA6 A;  3C4A A;  3GMC A;  1OJD A;  2E1M A;  3ALM A;  2WDQ A;  1GES A;  3AE8 A;  4EQW A;  3DJJ A;  1TDK A;  3ATR A;  4LU6 A;  4A5L A;  1LPF A;  4CY6 A;  4TM1 A;  2B9X A;  5BRT A;  3NLC A;  1JU2 A;  3URH A;  1B8S A;  1CC2 A;  2WPC A;  1QO8 A;  1CC6 A;  2WDV A;  2B7R A;  3CGD A;  3NN6 X;  4BJZ A;  1LTX R;  1F6M A;  1GRB A;  4PAB A;  4NTD A;  2A8X A;  4XWR A;  1GND A;  1K4Q A;  3GWD A;  1E6E A;  3C4N A;  5U1O A;  1Y56 A;  3PVC A;  2CVJ A;  2R4E A;  4AOS A;  1MO9 A;  4A9W A;  3JSK A;  1LQT A;  3NG7 X;  3SZF A;  4EMJ A;  2GH5 A;  1BKW A;  2PHH A;  4CY8 A;  2WEU A;  1O94 A;  3K7T A;  3SFE A;  3DA1 A;  1CJ2 A;  3UTH A;  4GDP A;  4AT2 A;  5L46 A;  1YKJ A;  4H4V A;  1GRT A;  3B6D A;  3DME A;  4H4U A;  4K5S A;  1K0I A;  5HHF A;  4EIQ A;  1IUU A;  4B1B A;  5FS6 A;  2C70 A;  4HB9 A;  1S2Y A;  1OJA A;  3LXD A;  1ZK7 A;  4TLZ A;  1CJC A;  2WP5 A;  1NDA A;  1PXB A;  1Q9I A;  2WES A;  3SZC A;  2NVK X;  4GCM A;  3HYX A;  2WP6 A;  4Z2U A;  2V5Z A;  1GV4 A;  2ZZ0 A;  4E0V A;  4YSY A;  3AE2 A;  3NK2 X;  4Z24 A;  4JNQ A;  3VR8 A;  4H4T A;  1GAL A;  2Z5X A;  3LAD A;  3AEF A;  3QJ4 A;  5KWF A;  4G73 A;  5EB4 A;  4X9M A;  1IUS A;  4H4Q A;  3FBS A;  4H4Z A;  1NHS A;  3AB1 A;  4GAP A;  2BC1 A;  5KMQ A;  1Q1W A;  4M52 A;  3CMM A;  3FIM B;  3L8K A;  4APN A;  2V6O A;  3KKJ A;  3UTE A;  5KNL A;  1VG9 A;  2YVJ A;  3ICS A;  1GET A;  1NEK A;  3UKA A;  3NH3 X;  2YLZ A;  3GYJ A;  3R9U A;  1GTH A;  1B37 A;  4IVO B;  2WU5 A;  3V76 A;  1RSG A;  2BXS A;  3CGE A;  3UKH A;  2OAL A;  4Y4N A;  4C74 A;  3M13 A;  3G5S A;  1LJ1 A;  3F8D A;  2IVD A;  1DJQ A;  2F5Z A;  3BHF A;  3DGZ A;  2R45 A;  4ZN0 A;  4J33 A;  4IVM B;  4C3Y A;  2R9Z A;  4USQ A;  2BCG G;  3AEG A;  1JRZ A;  1MXT A;  2BXR A;  3CND A;  1B4V A;  4ZCD A;  3VQR A;  2YR6 A;  3GRT A;  3I3L A;  2YLW A;  1FL2 A;  2C76 A;  3LZX A;  3NYC A;  4C3X A;  3V3N A;  3M0O A;  4II3 A;  3UKQ A;  4OPG A;  4YSH A;  3ZDN A;  2XFN A;  2BRA A;  3PO7 A;  4CNJ A;  4U8O A;  3VRB A;  2UZZ A;  1N1P A;  1DOD A;  1PN0 A;  3DJE A;  3SZ0 A;  3AEE A;  2XVJ A;  2OLO A;  2YLR A;  3NRN A;  2XVF A;  1N4W A;  1NG4 A;  4J57 A;  2R4J A;  3NTA A;  1ZX9 A;  1H6V A;  3H4K A;  2NPX A;  3CGB A;  1FEB A;  1E1K A;  4X9N A;  3S61 A;  1JNZ A;  4Z2T A;  3ITJ A;  1OJT A;  4ZCC A;  2A89 A;  2R46 A;  3RNM A;  1DXL A;  4KX6 A;  3AEB A;  1OJC A;  2YG6 A;  5LV9 A;  1DOE A;  4U2T A;  4I58 A;  5C2T A;  3CNJ A;  2VRM A;  2XLS A;  3ABV A;  3P4R A;  1EL7 A;  5JCK A;  1ELI A;  4PAA A;  2R0C A;  1TYP A;  2VQ7 A;  3NIX A;  2FBW A;  4Z44 A;  1TDE A;  2XYO A;  3KPF A;  1LV0 A;  2XFQ A;  4U8N A;  2C73 A;  1GT8 A;  4Z25 A;  4H2Q A;  4X4J A;  4BUR A;  4J36 A;  5KVH A;  3EF6 A;  1NHQ A;  2JK6 A;  4A65 A;  4WX1 A;  2APG A;  1H82 A;  2B9Y A;  1H7W A;  4REK A;  1TDN A;  1P2H A;  4NTE A;  4NTC A;  3VR9 A;  3T14 A;  4BK3 A;  1GXF A;  1E7P A;  1F3P A;  3O0H A;  4JDR A;  1ZOY A;  4B67 A;  1Y56 B;  4Z43 A;  4A7A A;  2I0Z A;  1VG0 A;  3EAO A;  3NT6 A;  5FMH A;  1GRF A;  2Q7V A;  3AD8 B;  4G6H A;  1H7X A;  2O9Z A;  1M64 A;  4P9S A;  2WQY A;  1Y0P A;  4H50 A;  3RP6 A;  1FCD A;  1DOB A;  4U2S A;  4B63 A;  2ZZB A;  4OPI A;  4Z26 A;  3FG2 P;  4EQR A;  4J31 A;  4MJW A;  1PJ6 A;  4U8K A;  2BAC A;  4OPC A;  3V3O A;  4B65 A;  4NNJ A;  2B7S A;  3D8X A;  2FJB A;  3ZYX A;  3RP8 A;  1GRE A;  2YVG A;  4H2N A;  1JOA A;  1KFY A;  3AE5 A;  2QA1 A;  2WP9 A;  1OJ9 A;  3DK9 A;  3CPJ G;  4G6G A;  2EQ6 A;  2WET A;  2GEW A;  4OCG A;  3BI2 A;  5M0Z A;  1CJ3 A;  2GR0 A;  1CBO A;  1H84 A;  2H89 A;  3CNP A;  3ICT A;  4LA1 A;  3DGH A;  1IJH A;  4A6N B;  2V60 A;  1ZOV A;  4H2P A;  2CDU A;  1KDG A;  4CRT A;  4RG4 A;  3ISH A;  1EL5 A;  2ACZ A;  4N9X A;  3AE6 A;  2XCG A;  1E39 A;  3ADA B;  1S2Q A;  3PS9 A;  4NEW A;  4C77 A;  2FJD A;  5KXJ A;  3AE3 A;  2WS3 A;  3CN8 A;  1TDO A;  1ZY8 A;  2C64 A;  1K0L A;  2C3D A;  2X8G A;  3DK8 A;  2A87 A;  1PHH A;  4RG3 A;  5KMP A;  2OAM A;  4YWO A;  1DJN A;  2C65 A;  3AEC A;  2VZ2 A;  1RYI A;  5EBK A;  1IUX A;  1GER A;  1TYT A;  4EM4 A;  1O95 A;  1H86 A;  2XDO A;  4IA6 A;  2V3B A;  2WU2 A;  3AYI A;  3NGC X;  5U63 A;  1BGJ A;  3NYE A;  3BHK A;  1VDC A;  3GRS A;  2BS4 A;  4YTN A;  1GRG A;  1PBD A;  1L9D A;  4JN9 A;  1KF6 A;  3EPT A;  2CUL A;  1ZKQ A;  5CQF A;  1E1M A;  4U8L A;  4K7Z A;  4G74 A;  3UTF A;  3UCL A;  4NWZ A;  3VRA A;  5DBJ A;  3BNU A;  4H4W A;  2JB3 A;  1PBF A;  1PXC A;  3GMB A;  4BJY A;  4JY2 A;  1PBC A;  3G5R A;  4WCT A;  4EQX A;  3UOY A;  1YQZ A;  2XVE A;  5BVA A;  1H81 A;  3K7M X;  5JCN A;  1F8W A;  1PJ7 A;  2YG7 A;  4G9K A;  2JB1 A;  4K8D A;  2ARD A;  4UP3 A;  3GSI A;  2Z5Y A;  4CNK A;  4CCR A;  2B9W A;  4YTM A;  4C5O A;  2X99 A;  5IQ4 A;  3SYI A;  2X50 A;  3C96 A;  1LVL A;  1NPX A;  2FJA A;  2X8H A;  3HZL A;  1PS9 A;  1K0J A;  2QAE A;  5BUK A;  1CC4 A;  2CFY A;  3GYI A;  1H83 A;  3E1T A;  3OC4 A;  4JQ9 A;  2V3A A;  4USR A;  2BA9 A;  4XWZ A;  3AWI A;  3NK0 X;  4AP3 A;  4AOX A;  4YTP A;  2WHD A;  1GRA A;  2R0G A;  3LOV A;  4GAV A;  5GRT A;  4B64 A;  1SEZ A;  2WPF A;  2YVF A;  4JY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...