2A87A

Crystal structure of m. tuberculosis thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
313
structure length
313
Chain Sequence
b'AHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 88
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2a87A02
2ZZCA 1EL9A 1B37A 1YKJA 1F8WA 1CC4A 4A7AA 2JB2A 3AYLA 4I59A 1EL7A 1KSUA 2TMDA 1DOEA 3BHFA 3V3NA 3H8IA 2FJDA 1D5TA 2C73A 3ALLA 4ZCDA 1N4VA 2GR3A 4U8NA 1CJ3A 2R0CA 2YVGA 3UTEA 1IUTA 1F8SA 2GR0A 2H89A 3SGLA 4H50A 2YR5A 3RNMA 1ZMCA 1BZLA 3ABVA 4ECHA 3AEAA 2BXSA 4Z2RA 1GETA 1COYA 1LPFA 4U2SA 3P4RA 1OJCA 3SFEA 1TYPA 2BS3A 2ZZBA 4BK3A 3G5QA 4CCRA 1CF3A 1FCDA 2JAEA 1TRBA 3QSSA 4AT0A 1DODA 2XDOA 3OZ2A 3ITJA 3PO7A 4OVIA 2IIDA 4GRTA 3DA1A 4O5QA 3UP4A 1M64A 1DNCA 5BUKA 1X31B 4H4ZA 2C76A 2XLPA 2C66A 3CNPA 1NHPA 2XLUA 1PS9A 4CCQA 3CNDA 4EM3A 2C3DA 2AAQA 1H84A 4Z24A 2X8CA 3DJGX 3NLCA 4DNAA 4A99A 2GR2A 2GAGB 2ACZA 3QSMA 2WOWA 4IA5A 5KOWA 1IJHA 1IUVA 1NDAA 1XHCA 3D8XA 2WPCA 4H4WA 3C96A 4EQWA 1PBFA 1NG4A 2R46A 2GEWA 2YLXA 1TDFA 3ICSA 4Z2TA 1HYUA 1GRAA 1Q9IA 3KLJA 2Y6RA 2JBVA 4NEWA 3KPFA 4Z25A 1MOKA 4APNA 5J60A 4M52A 1E1LA 3ATRA 1GESA 4C77A 4OCGA 4A5LA 1TDOA 1Y56B 3CNTA 2PYXA 3AB1A 1PBBA 1QJDA 2YQUA 4K5RA 2JB3A 5FS6A 2B9XA 2WOIA 3RP7A 4EQRA 1M6IA 4BV6A 1IUWA 4EMJA 1KNPA 3IHGA 4GUVA 2Q7VA 1FEAA 1Y56A 5IPYA 2R4JA 3ZDNA 1JRXA 4NTCA 2BCGG 2BCPA 1K4QA 5HYMA 2Z5YA 2R45A 2BK5A 3CPHG 4TM4A 3CGBA 4H2NA 3FMWA 4REKA 2E4GA 5U63A 1ZX9A 5EBKA 4C5OA 1VRQB 2YLZA 3NN6X 1F8RA 1GTHA 3ALJA 3VR9A 4AP3A 1ZP0A 1YY5A 3IHMA 3UTGA 2AQJA 2WOVA 3NKSA 1XPQA 4PAAA 4FK1C 1XANA 3AE2A 2Q6UA 2NPXA 3LOVA 3NNEA 4CRTA 2OAMA 3NG7X 4ICYA 3QJ4A 3DK9A 3CPIG 4ADWA 4H4RA 3CGEA 2CVJA 3AD7B 4IA6A 3CN8A 4B65A 2WPEA 1D7LA 2I0ZA 4JDRA 3AE3A 1BKWA 1KF6A 3BHKA 4NZHA 4YTMA 4A65A 4UDPA 2RGHA 4J33A 2XCGA 4LIIA 4Z26A 1NEKA 2B76A 1D7YA 1NPXA 3M12A 5FS8A 1H83A 1GERA 1VG0A 4GCMA 3M13A 2WU5A 1GTEA 5J7XA 3GWDA 2C3CA 2H88A 3CGDA 1IUSA 4OPUA 1DOBA 4FDCB 2WDRA 1OJDA 2GVCA 4HB9A 4J36A 1TDNA 1JNRA 3GSIA 4K8DA 4LU6A 2X8HA 4AP1A 5HXIA 1O94A 5JCMA 4A79A 5KXJA 1NHRA 3AYJA 1EL8A 2Q0LA 1NHQA 1JNZA 1H82A 2GQWA 2YLWA 1PXBA 3KKJA 2F5ZA 2FJEA 2X8GA 2OLNA 4YT0A 1OJAA 1H7XA 2OLOA 3GRTA 3NT6A 4J2WA 2VRMA 2YAUA 4U8OA 3EPTA 4X9NA 1Q1WA 1TDKA 3GMCA 4IVOB 4Y4MA 1S2YA 3GYJA 2WPFA 3AE7A 1GRHA 4H2PA 2GV8A 4NTDA 5ER0A 2A8XA 1B4VA 4U2TA 1CJ4A 4Z43A 5JCLA 3OC4A 3II4A 1DJQA 3NIXA 3V3OA 4U8LA 3B3RA 3FG2P 3KU9A 4NTEA 1L9EA 3BI4A 1DOCA 2IVDA 1N4WA 2V5ZA 5U1OA 3V76A 1NENA 3VRAA 4JQ9A 4EMWA 3LZXA 3WE0A 4UDQA 4BURA 1Q1RA 3GYIA 1B5QA 2XVEA 3CTYA 5BULA 5GRTA 3G5SA 4TLXA 3NH3X 4XXGA 4C3YA 4YSZA 4WX1A 2E5VA 1CJCA 2CFYA 4OPLA 5BVAA 2B7SA 4B1BA 2R0PA 2Z5XA 3UTFA 1OJTA 1S2QA 2WBAA 2B9YA 1DJNA 3AEEA 4U8IA 4CNKA 3UKQA 2GQFA 1NHSA 1IUUA 2R0GA 2WP9A 4KPRA 5DBJA 5LV9A 2YLSA 2XFQA 3LB8A 1YQZA 1N4UA 3B6DA 3SM8A 4EIPA 1MXTA 3P4PA 1GALA 2VVLA 3SFDA 3UOZA 1ZY8A 3DMEA 3DGHA 4JY3A 3NYEA 2C65A 1E7PA 2TPRA 2VQ7A 3FPZA 1ZOYA 3RP6A 2WU2A 1PJ6A 5M0ZA 4DSGA 4RG4A 2BACA 1D4EA 2HQMA 1KFYA 1ZKQA 3AE8A 1JEHA 1TYTA 3REDA 1LVLA 3ICTA 2GB0A 3ALMA 3SQPA 1O95A 2YM2A 1ZDLA 1NAAA 4BK1A 3NGCX 3COXA 2XVIA 1F6MA 5FS9A 4X4JA 4XWZA 3UOYA 4OPGA 1RYIA 3KA7A 4H4SA 2XFPA 1JRYA 2BS2A 2RGJA 1JOAA 1RSGA 4JY2A 3ICRA 4B64A 4HA6A 2WP5A 4ZN0A 5EB4A 3AD8B 3D1CA 3P4QA 1RP0A 3AD9B 3KD9A 4YTPA 3NTDA 3UKKA 3NYCA 1YQ4A 3AE1A 4EQSA 3BNUA 1B8SA 4YXDA 4K2XA 1EBDA 3VR8A 5JCKA 1VG9A 3GDPA 4H4UA 1CL0A 2BS4A 3HZLA 2R9ZA 3CNSA 2VRLA 4XWRA 3K7QX 3O0HA 2WDQA 3QVRA 2WQYA 4B67A 3F8PA 4J57A 2QA1A 4EQXA 3K7TA 1L9DA 4I58A 4EM4A 4J56A 3DK4A 4RG3A 1BF3A 3PVCA 2BYBA 1Z6LA 2C75A 4IV9A 4TM0A 3T37A 1LTXR 2XVHA 3QFBA 4YWOA 2CDUA 3EF6A 4AOSA 2WHDA 2B7RA 1GT8A 2YG4A 3IC9A 3NTAA 4FK1A 4OPCA 5FMHA 2YR4A 2C67A 4A9WA 3AEFA 4YSHA 2XVFA 4YSYA 4D03A 2YR6A 4EMIA 2FJBA 1PJ7A 3S5WA 2WS3A 1H86A 4B63A 3DH9A 1JU2A 4BJZA 1D4DA 3I6DA 5M10A 2BABA 4A6NB 2APGA 1ZMDA 3K7MX 1REOA 1FEBA 1LQUA 4H2RA 4O5UA 2GRTA 2XYOA 4A6NA 3UTHA 4DGKA 1E39A 1GRBA 3AEGA 2GH5A 1LV0A 3BI5A 4ZCCA 5FS7A 3VQRA 1YQ3A 2YLTA 1K0IA 2GR1A 4GF7A 1GSNA 3VRBA 1DXLA 4TM1A 3QSEA 2XFUA 3GDNA 4U2LA 2XLSA 3L8KA 1F3PA 3UKPA 2V6OA 3DJDA 5EOWA 3I3LA 4OPTA 4JNAA 1ZOVA 4U8KA 1FOHA 3H8LA 3ZYXA 3NYFA 2QA2A 4FX9A 4H4YA 1PXAA 1BWCA 2JK6A 3Q6JA 3AE5A 3UKFA 4KX6A 5CQFA 1FL2A 2ZBWA 3DK8A 1PBEA 2X99A 2YG5A 2WP6A 1PBDA 3AE9A 4JNQA 5TR3A 5CKUA 1XDIA 5KVHA 2J3NA 5HHFA 3GD3A 2YWLA 2AR8A 4YSXA 2V3AA 4H2QA 2GMJA 3L1RA 3PS9A 4AT2A 2WEUA 2XFOA 1LJ1A 3URHA 5KVIA 2WETA 3QVPA 2RABA 4Y4NA 3UKAA 1CC2A 1OJ9A 2FJAA 2X3NA 2Y6QA 4CBQA 5C2TA 4B68A 2BK3A 3AYIA 4YTNA 5KWFA 4LA1A 2A89A 2VVMA 2VVLG 1K0JA 2DKHA 4GR1A 4JN9A 1PN0A 4MJWA 4UP3A 1O5WA 2BC0A 1CHUA 2JKCA 2UZZA 4K7ZA 3C4NA 4K22A 1S3EA 4NEVA 1AOGA 2YG6A 4TM3A 3UOVA 4Z2UA 3ADAB 3AEDA 4P9SA 2O9ZA 3NK0X 3BNMA 4H4XA 1VQWA 5KOXA 3IF9A 3C4AA 1GRGA 2XFNA 3E1TA 3FIMB 3F8RA 2ZZ0A 1P2EA 3AWIA 4OPIA 2EQ6A 1KDGA 2OALA 1UKVG 1W4XA 3IWAA 1EL5A 5IQ1A 5C3JA 3R9UA 1D4CA 2E1MA 1GRFA 2GF3A 4BJYA 4U8JA 4GDPA 2EQ7A 3M0OA 4TLZA 4C3XA 2A87A 3NK2X 3NN0X 1P2HA 2V3BA 4C74A 3GRSA 3RHAA 1BGNA 1VDCA 1MO9A 1GREA 1GPEA 2R4EA 1H81A 5KRQA 4EIQA 2CULA 1TDEA 1E1KA 5EB5A 1QLBA 1ELIA 2Q0KA 1K0LA 3CNJA 3DJJA 3NHOX 4UDRA 1SEZA 2EQ8A 2JB1A 4PABA 2FBWA 1QO8A 2RGOA 5JCNA 1IUXA 3UKLA 3GMBA 3K30A 2WESA 5HY5A 3P1WA 1KSSA 2BA9A 3UP5A 3LADA 1GOSA 3FBSA 2BC1A 4OPDA 4H4PA 1S3BA 1PXCA 1PDHA 3JSKA 2GAHB 4DSHA 1PBCA 2ARDA 3VRDB 2B9WA 1CC6A 2XLTA 4J34A 3RP8A 3AXBA 1CBOA 2XVJA 4CY6A 3CPJG 2IVEA 2EQ9A 2GMHA 2VZ2A 4AOXA 2V61A 4Z44A 1KNRA 3EANA 3P4SA 1GEUA 5GSNA 2C7GA 5U25A 5BRTA 2C72A 4H7UA 1GRTA 4D04A 2VOUA 3LXDA 4USQA 1E1MA 1ONFA 4CY8A 2XLRA 4E0VA 2BK4A 3AEBA 3F8DA 3LZWA 2OA1A 3DGZA 4YKGA 4U8PA 1Y0PA 3Q9TA 1E6EA 1PJ5A 3QFAA 3BI2A 3LJPA 3UKHA 5JCIA 1LQTA 3S61A 4Y4LA 1N1PA 4H4QA 2QAEA 1V59A 4B66A 3NRNA 4GDEA 1NG3A 1JRZA 4IVMB 3AECA 3GD4A 2DKIA 2QCUA 3GWFA 2YG7A 3DJEA 1BGJA 2C64A 1GV4A 2X50A 3ATQA 2VQBA 1L9CA 4CNJA 2C70A 3EAOA 1E1NA 1FECA 2WDVA 3AE4A 2YG3A 3UCLA 4H4TA 4USRA 2V60A 3H4KA 5IQ4A 4K5SA 3CIRA 2BXRA 3UOXA 3NK1X 1PHHA 4H4VA 4YKFA 3P9UA 2YVFA 1L0VA 4X9MA 2NVKX 4U8MA 3G5RA 2YLRA 3CGCA 5L46A 1ZK7A 4RSLA 4BK2A 4B69A 1GNDA 1H7WA 3AE6A 4N9XA 1GXFA 1CJ2A 2YM1A 2PHHA 2YVJA 3ISHA 4J31A 2W0HA 1H6VA 3KVEA 4WCTA
chains in the Genus database with same CATH superfamily
2ZZCA 1EL9A 1B37A 1YKJA 1F8WA 1CC4A 4A7AA 2JB2A 3AYLA 4I59A 1EL7A 1KSUA 2TMDA 1DOEA 3BHFA 3V3NA 3H8IA 2FJDA 1D5TA 2C73A 3ALLA 4ZCDA 1N4VA 2GR3A 4U8NA 1CJ3A 2R0CA 2YVGA 3UTEA 1IUTA 1F8SA 2GR0A 3T2KA 2H89A 3SGLA 4H50A 2YR5A 3RNMA 1ZMCA 1BZLA 3ABVA 4ECHA 3AEAA 2BXSA 4Z2RA 1GETA 1COYA 1LPFA 2C4CA 3P4RA 4U2SA 1OJCA 3SFEA 1TYPA 2BS3A 2ZZBA 4BK3A 3G5QA 4CCRA 1CF3A 1FCDA 2JAEA 1TRBA 3QSSA 5KMSA 4AT0A 1DODA 2XDOA 3OZ2A 3ITJA 3PO7A 4OVIA 2IIDA 4GRTA 3DA1A 4O5QA 3SYIA 1M64A 1DNCA 3SXIA 3UP4A 1X31B 5BUKA 4H4ZA 2C76A 2XLPA 2C66A 3KPKA 3T14A 3CNPA 1NHPA 2XLUA 4G74A 1PS9A 4CCQA 3CNDA 4EM3A 2C3DA 2AAQA 1H84A 4Z24A 2X8CA 3DJGX 3NLCA 4DNAA 4A99A 2GR2A 2GAGB 2ACZA 3QSMA 2WOWA 4IA5A 5KOWA 1IJHA 1IUVA 1NDAA 1XHCA 3D8XA 2WPCA 3GYXA 3C96A 4H4WA 1PBFA 4EQWA 1NG4A 2R46A 2GEWA 2YLXA 1TDFA 3ICSA 4G9KA 4Z2TA 1HYUA 1GRAA 1Q9IA 3KLJA 2Y6RA 2JBVA 4NEWA 3T2YA 3KPFA 4Z25A 1MOKA 4APNA 5J60A 4M52A 1E1LA 3ATRA 1GESA 4C77A 4GAVA 4OCGA 4A5LA 1TDOA 1Y56B 3CNTA 2PYXA 3AB1A 1PBBA 1QJDA 2YQUA 4K5RA 2JB3A 5FS6A 2B9XA 2WOIA 3RP7A 4EQRA 1M6IA 4BV6A 1IUWA 3SZFA 4EMJA 1KNPA 3IHGA 4GUVA 2Q7VA 1FEAA 1Y56A 5IPYA 2R4JA 3ZDNA 1JRXA 4NTCA 2BCGG 2BCPA 1K4QA 5HYMA 2Z5YA 2R45A 2BK5A 3CPHG 4TM4A 3CGBA 4H2NA 3FMWA 4REKA 2E4GA 5U63A 1ZX9A 5EBKA 4C5OA 1VRQB 2YLZA 3NN6X 1F8RA 1GTHA 3ALJA 3VR9A 4AP3A 1ZP0A 1YY5A 3IHMA 3UTGA 2AQJA 2WOVA 3NKSA 1XPQA 4PAAA 4FK1C 1XANA 3AE2A 2Q6UA 2NPXA 3LOVA 3NNEA 4CRTA 2OAMA 3NG7X 4ICYA 3QJ4A 3DK9A 3CPIG 4ADWA 4H4RA 4NWZA 3CGEA 2CVJA 3AD7B 4IA6A 3CN8A 4B65A 2WPEA 1D7LA 2I0ZA 4JDRA 3AE3A 1BKWA 1KF6A 3BHKA 4NZHA 4YTMA 4A65A 4UDPA 2RGHA 4J33A 2XCGA 4LIIA 4Z26A 1NEKA 2B76A 1D7YA 1NPXA 3M12A 5FS8A 1H83A 1GERA 1VG0A 4GCMA 3SZ0A 3M13A 2WU5A 1GTEA 5J7XA 3GWDA 2C3CA 2H88A 3CGDA 1IUSA 4OPUA 1DOBA 4FDCB 2WDRA 1OJDA 2GVCA 4HB9A 4J36A 1TDNA 1JNRA 3GSIA 4K8DA 4LU6A 2X8HA 4AP1A 5HXIA 3SY4A 1O94A 5JCMA 4A79A 5KXJA 1NHRA 3AYJA 1EL8A 2Q0LA 1NHQA 1JNZA 1H82A 2GQWA 2YLWA 1PXBA 3KKJA 2F5ZA 2FJEA 2X8GA 2OLNA 4YT0A 1OJAA 1H7XA 2OLOA 3GRTA 3NT6A 4J2WA 2VRMA 2YAUA 4U8OA 3EPTA 4X9NA 1Q1WA 1TDKA 3GMCA 4IVOB 4Y4MA 1S2YA 3GYJA 2WPFA 3AE7A 1GRHA 4H2PA 2GV8A 4NTDA 5ER0A 2A8XA 1B4VA 4U2TA 1CJ4A 4Z43A 5JCLA 3OC4A 3II4A 1DJQA 3NIXA 3V3OA 4U8LA 3B3RA 3FG2P 3KU9A 4NTEA 1L9EA 3BI4A 1DOCA 2IVDA 3T0KA 1N4WA 2V5ZA 5U1OA 3V76A 1NENA 3VRAA 4JQ9A 4EMWA 3LZXA 3WE0A 4UDQA 5KMQA 1Q1RA 3GYIA 4BURA 1B5QA 2XVEA 3CTYA 5BULA 5GRTA 3G5SA 4TLXA 3NH3X 4XXGA 4C3YA 4YSZA 4WX1A 2E5VA 1CJCA 2CFYA 4OPLA 5BVAA 2B7SA 4B1BA 2R0PA 2Z5XA 3UTFA 1OJTA 1S2QA 2WBAA 2B9YA 1DJNA 3AEEA 4U8IA 4CNKA 3UKQA 2GQFA 1NHSA 1IUUA 2R0GA 2WP9A 4KPRA 5DBJA 5LV9A 2YLSA 2XFQA 3LB8A 1YQZA 1N4UA 3B6DA 4GAPA 3SM8A 4NNJA 4EIPA 1MXTA 3P4PA 1GALA 2VVLA 3SFDA 3UOZA 1ZY8A 3DMEA 3DGHA 4JY3A 3NYEA 2C65A 1E7PA 2TPRA 2VQ7A 3FPZA 1ZOYA 3RP6A 2WU2A 1PJ6A 5M0ZA 4DSGA 4RG4A 2BACA 1D4EA 3HYWA 2HQMA 1KFYA 1ZKQA 3AE8A 1JEHA 1TYTA 3REDA 1LVLA 3ICTA 2GB0A 3ALMA 4G6GA 3SQPA 1O95A 2YM2A 1ZDLA 1NAAA 4BK1A 3NGCX 3COXA 2XVIA 1F6MA 5FS9A 4X4JA 4XWZA 3UOYA 4OPGA 1RYIA 3KA7A 4H4SA 2XFPA 4G6HA 1JRYA 2BS2A 2RGJA 1JOAA 1RSGA 4JY2A 3ICRA 4B64A 4HA6A 2WP5A 4ZN0A 5EB4A 3AD8B 3D1CA 3P4QA 1RP0A 3AD9B 3KD9A 4YTPA 3NTDA 3UKKA 3NYCA 1YQ4A 3AE1A 4EQSA 3BNUA 1B8SA 4YXDA 4K2XA 1EBDA 3VR8A 5JCKA 3SZCA 1VG9A 3GDPA 4H4UA 1CL0A 2BS4A 3HZLA 2R9ZA 3CNSA 2VRLA 4XWRA 3K7QX 3O0HA 2WDQA 3QVRA 2WQYA 4B67A 3F8PA 4J57A 2QA1A 4EQXA 3K7TA 1L9DA 4I58A 4EM4A 4J56A 3DK4A 4RG3A 1BF3A 3PVCA 2BYBA 1Z6LA 2C75A 4IV9A 4TM0A 3T37A 1LTXR 2XVHA 3QFBA 4YWOA 2CDUA 3EF6A 4AOSA 2WHDA 2B7RA 1GT8A 2YG4A 3IC9A 3NTAA 4FK1A 4OPCA 5FMHA 2YR4A 2C67A 4A9WA 3AEFA 3CMMA 4YSHA 2XVFA 4YSYA 4D03A 2YR6A 4EMIA 2FJBA 1PJ7A 3S5WA 2WS3A 1H86A 4B63A 3DH9A 1JU2A 4BJZA 1D4DA 3I6DA 5M10A 2BABA 4A6NB 2APGA 4G73A 1ZMDA 3K7MX 1REOA 1FEBA 1LQUA 4H2RA 4O5UA 2GRTA 2XYOA 4A6NA 3UTHA 4DGKA 1E39A 1GRBA 3AEGA 2GH5A 1LV0A 3BI5A 4ZCCA 5FS7A 3VQRA 1YQ3A 2YLTA 1K0IA 2GR1A 4GF7A 1GSNA 3VRBA 1DXLA 4TM1A 3QSEA 2XFUA 3GDNA 4U2LA 2XLSA 3L8KA 1F3PA 3UKPA 2V6OA 3DJDA 5EOWA 3I3LA 4OPTA 4JNAA 1ZOVA 4U8KA 1FOHA 3H8LA 3ZYXA 3NYFA 2QA2A 4FX9A 4H4YA 1PXAA 1BWCA 2JK6A 3Q6JA 3AE5A 3UKFA 4KX6A 5CQFA 1FL2A 2ZBWA 3DK8A 1PBEA 2X99A 2YG5A 2WP6A 1PBDA 3AE9A 4JNQA 5TR3A 5CKUA 1XDIA 5KVHA 2J3NA 5HHFA 3GD3A 2YWLA 2AR8A 4YSXA 2V3AA 4H2QA 2GMJA 3L1RA 3PS9A 4AT2A 2WEUA 3HYVA 2XFOA 1LJ1A 3URHA 5KVIA 2WETA 3QVPA 2RABA 4Y4NA 3UKAA 1CC2A 1OJ9A 2FJAA 2X3NA 2Y6QA 3T2ZA 4CBQA 5C2TA 4B68A 2BK3A 3AYIA 4YTNA 5KWFA 4LA1A 2A89A 2VVMA 2VVLG 1K0JA 2DKHA 4GR1A 4JN9A 1PN0A 4MJWA 4UP3A 4II3A 1O5WA 2BC0A 1CHUA 2JKCA 2UZZA 4K7ZA 3C4NA 4K22A 1S3EA 4NEVA 1AOGA 2YG6A 4TM3A 3UOVA 4Z2UA 3ADAB 3SZWA 3AEDA 4P9SA 2O9ZA 3NK0X 3BNMA 4H4XA 1VQWA 5KOXA 3IF9A 3C4AA 1GRGA 2XFNA 3E1TA 3FIMB 3F8RA 5KMPA 2ZZ0A 1P2EA 3AWIA 4OPIA 2EQ6A 1KDGA 2OALA 1UKVG 1W4XA 3IWAA 2BRYA 1EL5A 5IQ1A 5C3JA 3R9UA 1D4CA 2E1MA 1GRFA 2GF3A 4BJYA 4U8JA 5KNLA 4II2A 4GDPA 2EQ7A 3M0OA 4TLZA 4C3XA 3HYXA 2A87A 2BRAA 3NK2X 3NN0X 1P2HA 2V3BA 4C74A 3GRSA 3RHAA 1BGNA 1VDCA 1MO9A 1GREA 1GPEA 2R4EA 1H81A 5KRQA 4EIQA 2CULA 1TDEA 1E1KA 5EB5A 1QLBA 1ELIA 2Q0KA 1K0LA 3CNJA 3DJJA 3NHOX 4UDRA 1SEZA 2EQ8A 2JB1A 4PABA 2FBWA 1QO8A 2RGOA 5JCNA 1IUXA 3UKLA 3GMBA 3K30A 2WESA 5HY5A 3P1WA 1KSSA 2BA9A 3UP5A 3LADA 1GOSA 3FBSA 2BC1A 4OPDA 4H4PA 1S3BA 3SX6A 1PXCA 1PDHA 3JSKA 2GAHB 4DSHA 1PBCA 2ARDA 3VRDB 2B9WA 1CC6A 2XLTA 4J34A 3RP8A 3AXBA 1CBOA 2XVJA 4CY6A 3CPJG 2IVEA 2EQ9A 2GMHA 2VZ2A 4AOXA 2V61A 4Z44A 1KNRA 3EANA 3P4SA 1GEUA 5GSNA 2C7GA 5U25A 5BRTA 2C72A 4H7UA 1GRTA 4D04A 2VOUA 3LXDA 4USQA 1E1MA 1ONFA 4CY8A 2XLRA 4E0VA 2BK4A 3AEBA 3F8DA 3LZWA 2OA1A 3DGZA 4YKGA 4U8PA 1Y0PA 3Q9TA 1E6EA 1PJ5A 3QFAA 3BI2A 3LJPA 3UKHA 5JCIA 1LQTA 3S61A 4Y4LA 1N1PA 4H4QA 2QAEA 1V59A 4B66A 3NRNA 4GDEA 1NG3A 1JRZA 4IVMB 3AECA 3GD4A 2DKIA 2QCUA 3GWFA 2YG7A 3DJEA 1BGJA 2C64A 1GV4A 2X50A 3ATQA 2VQBA 1L9CA 4CNJA 2C70A 3EAOA 1E1NA 1FECA 2WDVA 3AE4A 2YG3A 3UCLA 4H4TA 4USRA 2V60A 3H4KA 5IQ4A 4K5SA 3CIRA 3T31A 5KMRA 2BXRA 3UOXA 3NK1X 1PHHA 4H4VA 4YKFA 3P9UA 2YVFA 1L0VA 4X9MA 2NVKX 4U8MA 3G5RA 2YLRA 3CGCA 5L46A 1ZK7A 4RSLA 4BK2A 4B69A 1GNDA 1H7WA 3AE6A 4N9XA 1GXFA 1CJ2A 2YM1A 2PHHA 2YVJA 3ISHA 4J31A 2W0HA 1H6VA 3KVEA 4WCTA
chains in the Genus database with same CATH topology
2ZZCA 1EL9A 1B37A 1YKJA 1F8WA 1CC4A 4A7AA 2JB2A 3AYLA 4I59A 1EL7A 1KSUA 2TMDA 1DOEA 3BHFA 3V3NA 3H8IA 2FJDA 1D5TA 2C73A 3ALLA 4ZCDA 1N4VA 2GR3A 4U8NA 1CJ3A 2R0CA 2YVGA 3UTEA 1IUTA 1F8SA 2GR0A 3T2KA 2H89A 3SGLA 4H50A 2YR5A 3RNMA 1ZMCA 1BZLA 3ABVA 4ECHA 3AEAA 2BXSA 4Z2RA 1GETA 1COYA 1LPFA 2C4CA 3P4RA 4U2SA 1OJCA 3SFEA 1TYPA 2BS3A 2ZZBA 4BK3A 3G5QA 4CCRA 1CF3A 1FCDA 2JAEA 1TRBA 3QSSA 5KMSA 4AT0A 1DODA 2XDOA 3OZ2A 3ITJA 3PO7A 4OVIA 2IIDA 4GRTA 3DA1A 4O5QA 3SYIA 1M64A 1DNCA 3SXIA 3UP4A 1X31B 5BUKA 4H4ZA 2C76A 2XLPA 2C66A 3KPKA 3T14A 3CNPA 1NHPA 2XLUA 4G74A 1PS9A 4CCQA 3CNDA 4EM3A 2C3DA 2AAQA 1H84A 4Z24A 2X8CA 3DJGX 3NLCA 4DNAA 4A99A 2GR2A 2GAGB 2ACZA 3QSMA 2WOWA 4IA5A 5KOWA 1IJHA 1IUVA 1NDAA 1XHCA 3D8XA 2WPCA 3GYXA 3C96A 4H4WA 1PBFA 4EQWA 1NG4A 2R46A 2GEWA 2YLXA 1TDFA 3ICSA 4G9KA 4Z2TA 1HYUA 1GRAA 1Q9IA 3KLJA 2Y6RA 2JBVA 4NEWA 3T2YA 3KPFA 4Z25A 1MOKA 4APNA 5J60A 4M52A 1E1LA 3ATRA 1GESA 4C77A 4GAVA 4OCGA 4A5LA 1TDOA 1Y56B 3CNTA 2PYXA 3AB1A 1PBBA 1QJDA 2YQUA 4K5RA 2JB3A 5FS6A 2B9XA 2WOIA 3RP7A 4EQRA 1M6IA 4BV6A 1IUWA 3SZFA 4EMJA 1KNPA 3IHGA 4GUVA 2Q7VA 1FEAA 1Y56A 5IPYA 2R4JA 3ZDNA 1JRXA 4NTCA 2BCGG 2BCPA 1K4QA 5HYMA 2Z5YA 2R45A 2BK5A 3CPHG 4TM4A 3CGBA 4H2NA 3FMWA 4REKA 2E4GA 5U63A 1ZX9A 5EBKA 4C5OA 1VRQB 2YLZA 3NN6X 1F8RA 1GTHA 3ALJA 3VR9A 4AP3A 1ZP0A 1YY5A 3IHMA 3UTGA 2AQJA 2WOVA 3NKSA 1XPQA 4PAAA 4FK1C 1XANA 3AE2A 2Q6UA 2NPXA 3LOVA 3NNEA 4CRTA 2OAMA 3NG7X 4ICYA 3QJ4A 3DK9A 3CPIG 4ADWA 4H4RA 4NWZA 3CGEA 2CVJA 3AD7B 4IA6A 3CN8A 4B65A 2WPEA 1D7LA 2I0ZA 4JDRA 3AE3A 1BKWA 1KF6A 3BHKA 4NZHA 4YTMA 4A65A 4UDPA 2RGHA 4J33A 2XCGA 4LIIA 4Z26A 1NEKA 2B76A 1D7YA 1NPXA 3M12A 5FS8A 1H83A 1GERA 1VG0A 4GCMA 3SZ0A 3M13A 2WU5A 1GTEA 5J7XA 3GWDA 2C3CA 2H88A 3CGDA 1IUSA 4OPUA 1DOBA 4FDCB 2WDRA 1OJDA 2GVCA 4HB9A 4J36A 1TDNA 1JNRA 3GSIA 4K8DA 4LU6A 2X8HA 4AP1A 5HXIA 3SY4A 1O94A 5JCMA 4A79A 5KXJA 1NHRA 3AYJA 1EL8A 2Q0LA 1NHQA 1JNZA 1H82A 2GQWA 2YLWA 1PXBA 3KKJA 2F5ZA 2FJEA 2X8GA 2OLNA 4YT0A 1OJAA 1H7XA 2OLOA 3GRTA 3NT6A 4J2WA 2VRMA 2YAUA 4U8OA 3EPTA 4X9NA 1Q1WA 1TDKA 3GMCA 4IVOB 4Y4MA 1S2YA 3GYJA 2WPFA 3AE7A 1GRHA 4H2PA 2GV8A 4NTDA 5ER0A 2A8XA 1B4VA 4U2TA 1CJ4A 4Z43A 5JCLA 3OC4A 3II4A 1DJQA 3NIXA 3V3OA 4U8LA 3B3RA 3FG2P 3KU9A 4NTEA 1L9EA 3BI4A 1DOCA 2IVDA 3T0KA 1N4WA 2V5ZA 5U1OA 3V76A 1NENA 3VRAA 4JQ9A 4EMWA 3LZXA 3WE0A 4UDQA 5KMQA 1Q1RA 3GYIA 4BURA 1B5QA 2XVEA 3CTYA 5BULA 5GRTA 3G5SA 4TLXA 3NH3X 4XXGA 4C3YA 4YSZA 4WX1A 2E5VA 1CJCA 2CFYA 4OPLA 5BVAA 2B7SA 4B1BA 2R0PA 2Z5XA 3UTFA 1OJTA 1S2QA 2WBAA 2B9YA 1DJNA 3AEEA 4U8IA 4CNKA 3UKQA 2GQFA 1NHSA 1IUUA 2R0GA 2WP9A 4KPRA 5DBJA 5LV9A 2YLSA 2XFQA 3LB8A 1YQZA 1N4UA 3B6DA 4GAPA 3SM8A 4NNJA 4EIPA 1MXTA 3P4PA 1GALA 2VVLA 3SFDA 3UOZA 1ZY8A 3DMEA 3DGHA 4JY3A 3NYEA 2C65A 1E7PA 2TPRA 2VQ7A 3FPZA 1ZOYA 3RP6A 2WU2A 1PJ6A 5M0ZA 4DSGA 4RG4A 2BACA 1D4EA 3HYWA 2HQMA 1KFYA 1ZKQA 3AE8A 1JEHA 1TYTA 3REDA 1LVLA 3ICTA 2GB0A 3ALMA 4G6GA 3SQPA 1O95A 2YM2A 1ZDLA 1NAAA 4BK1A 3NGCX 3COXA 2XVIA 1F6MA 5FS9A 4X4JA 4XWZA 3UOYA 4OPGA 1RYIA 3KA7A 4H4SA 2XFPA 4G6HA 1JRYA 2BS2A 2RGJA 1JOAA 1RSGA 4JY2A 3ICRA 4B64A 4HA6A 2WP5A 4ZN0A 5EB4A 3AD8B 3D1CA 3P4QA 1RP0A 3AD9B 3KD9A 4YTPA 3NTDA 3UKKA 3NYCA 1YQ4A 3AE1A 4EQSA 3BNUA 1B8SA 4YXDA 4K2XA 1EBDA 3VR8A 5JCKA 3SZCA 1VG9A 3GDPA 4H4UA 1CL0A 2BS4A 3HZLA 2R9ZA 3CNSA 2VRLA 4XWRA 3K7QX 3O0HA 2WDQA 3QVRA 2WQYA 4B67A 3F8PA 4J57A 2QA1A 4EQXA 3K7TA 1L9DA 4I58A 4EM4A 4J56A 3DK4A 4RG3A 1BF3A 3PVCA 2BYBA 1Z6LA 2C75A 4IV9A 4TM0A 3T37A 1LTXR 2XVHA 3QFBA 4YWOA 2CDUA 3EF6A 4AOSA 2WHDA 2B7RA 1GT8A 2YG4A 3IC9A 3NTAA 4FK1A 4OPCA 5FMHA 2YR4A 2C67A 4A9WA 3AEFA 3CMMA 4YSHA 2XVFA 4YSYA 4D03A 2YR6A 4EMIA 2FJBA 1PJ7A 3S5WA 2WS3A 1H86A 4B63A 3DH9A 1JU2A 4BJZA 1D4DA 3I6DA 5M10A 2BABA 4A6NB 2APGA 4G73A 1ZMDA 3K7MX 1REOA 1FEBA 1LQUA 4H2RA 4O5UA 2GRTA 2XYOA 4A6NA 3UTHA 4DGKA 1E39A 1GRBA 3AEGA 2GH5A 1LV0A 3BI5A 4ZCCA 5FS7A 3VQRA 1YQ3A 2YLTA 1K0IA 2GR1A 4GF7A 1GSNA 3VRBA 1DXLA 4TM1A 3QSEA 2XFUA 3GDNA 4U2LA 2XLSA 3L8KA 1F3PA 3UKPA 2V6OA 3DJDA 5EOWA 3I3LA 4OPTA 4JNAA 1ZOVA 4U8KA 1FOHA 3H8LA 3ZYXA 3NYFA 2QA2A 4FX9A 4H4YA 1PXAA 1BWCA 2JK6A 3Q6JA 3AE5A 3UKFA 4KX6A 5CQFA 1FL2A 2ZBWA 3DK8A 1PBEA 2X99A 2YG5A 2WP6A 1PBDA 3AE9A 4JNQA 5TR3A 5CKUA 1XDIA 5KVHA 2J3NA 5HHFA 3GD3A 2YWLA 2AR8A 4YSXA 2V3AA 4H2QA 2GMJA 3L1RA 3PS9A 4AT2A 2WEUA 3HYVA 2XFOA 1LJ1A 3URHA 5KVIA 2WETA 3QVPA 2RABA 4Y4NA 3UKAA 1CC2A 1OJ9A 2FJAA 2X3NA 2Y6QA 3T2ZA 4CBQA 5C2TA 4B68A 2BK3A 3AYIA 4YTNA 5KWFA 4LA1A 2A89A 2VVMA 2VVLG 1K0JA 2DKHA 4GR1A 4JN9A 1PN0A 4MJWA 4UP3A 4II3A 1O5WA 2BC0A 1CHUA 2JKCA 2UZZA 4K7ZA 3C4NA 4K22A 1S3EA 4NEVA 1AOGA 2YG6A 4TM3A 3UOVA 4Z2UA 3ADAB 3SZWA 3AEDA 4P9SA 2O9ZA 3NK0X 3BNMA 4H4XA 1VQWA 5KOXA 3IF9A 3C4AA 1GRGA 2XFNA 3E1TA 3FIMB 3F8RA 5KMPA 2ZZ0A 1P2EA 3AWIA 4OPIA 2EQ6A 1KDGA 2OALA 1UKVG 1W4XA 3IWAA 2BRYA 1EL5A 5IQ1A 5C3JA 3R9UA 1D4CA 2E1MA 1GRFA 2GF3A 4BJYA 4U8JA 5KNLA 4II2A 4GDPA 2EQ7A 3M0OA 4TLZA 4C3XA 3HYXA 2A87A 2BRAA 3NK2X 3NN0X 1P2HA 2V3BA 4C74A 3GRSA 3RHAA 1BGNA 1VDCA 1MO9A 1GREA 1GPEA 2R4EA 1H81A 5KRQA 4EIQA 2CULA 1TDEA 1E1KA 5EB5A 1QLBA 1ELIA 2Q0KA 1K0LA 3CNJA 3DJJA 3NHOX 4UDRA 1SEZA 2EQ8A 2JB1A 4PABA 2FBWA 1QO8A 2RGOA 5JCNA 1IUXA 3UKLA 3GMBA 3K30A 2WESA 5HY5A 3P1WA 1KSSA 2BA9A 3UP5A 3LADA 1GOSA 3FBSA 2BC1A 4OPDA 4H4PA 1S3BA 3SX6A 1PXCA 1PDHA 3JSKA 2GAHB 4DSHA 1PBCA 2ARDA 3VRDB 2B9WA 1CC6A 2XLTA 4J34A 3RP8A 3AXBA 1CBOA 2XVJA 4CY6A 3CPJG 2IVEA 2EQ9A 2GMHA 2VZ2A 4AOXA 2V61A 4Z44A 1KNRA 3EANA 3P4SA 1GEUA 5GSNA 2C7GA 5U25A 5BRTA 2C72A 4H7UA 1GRTA 4D04A 2VOUA 3LXDA 4USQA 1E1MA 1ONFA 4CY8A 2XLRA 4E0VA 2BK4A 3AEBA 3F8DA 3LZWA 2OA1A 3DGZA 4YKGA 4U8PA 1Y0PA 3Q9TA 1E6EA 1PJ5A 3QFAA 3BI2A 3LJPA 3UKHA 5JCIA 1LQTA 3S61A 4Y4LA 1N1PA 4H4QA 2QAEA 1V59A 4B66A 3NRNA 4GDEA 1NG3A 1JRZA 4IVMB 3AECA 3GD4A 2DKIA 2QCUA 3GWFA 2YG7A 3DJEA 1BGJA 2C64A 1GV4A 2X50A 3ATQA 2VQBA 1L9CA 4CNJA 2C70A 3EAOA 1E1NA 1FECA 2WDVA 3AE4A 2YG3A 3UCLA 4H4TA 4USRA 2V60A 3H4KA 5IQ4A 4K5SA 3CIRA 3T31A 5KMRA 2BXRA 3UOXA 3NK1X 1PHHA 4H4VA 4YKFA 3P9UA 2YVFA 1L0VA 4X9MA 2NVKX 4U8MA 3G5RA 2YLRA 3CGCA 5L46A 1ZK7A 4RSLA 4BK2A 4B69A 1GNDA 1H7WA 3AE6A 4N9XA 1GXFA 1CJ2A 2YM1A 2PHHA 2YVJA 3ISHA 4J31A 2W0HA 1H6VA 3KVEA 4WCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZC A;  1EL9 A;  1B37 A;  1YKJ A;  1F8W A;  1CC4 A;  4A7A A;  2JB2 A;  3AYL A;  4I59 A;  1EL7 A;  1KSU A;  2TMD A;  1DOE A;  3BHF A;  3V3N A;  3H8I A;  2FJD A;  1D5T A;  2C73 A;  3ALL A;  4ZCD A;  1N4V A;  2GR3 A;  4U8N A;  1CJ3 A;  2R0C A;  2YVG A;  3UTE A;  1IUT A;  1F8S A;  2GR0 A;  2H89 A;  3SGL A;  4H50 A;  2YR5 A;  3RNM A;  1ZMC A;  1BZL A;  3ABV A;  4ECH A;  3AEA A;  2BXS A;  4Z2R A;  1GET A;  1COY A;  1LPF A;  4U2S A;  3P4R A;  1OJC A;  3SFE A;  1TYP A;  2BS3 A;  2ZZB A;  4BK3 A;  3G5Q A;  4CCR A;  1CF3 A;  1FCD A;  2JAE A;  1TRB A;  3QSS A;  4AT0 A;  1DOD A;  2XDO A;  3OZ2 A;  3ITJ A;  3PO7 A;  4OVI A;  2IID A;  4GRT A;  3DA1 A;  4O5Q A;  3UP4 A;  1M64 A;  1DNC A;  5BUK A;  1X31 B;  4H4Z A;  2C76 A;  2XLP A;  2C66 A;  3CNP A;  1NHP A;  2XLU A;  1PS9 A;  4CCQ A;  3CND A;  4EM3 A;  2C3D A;  2AAQ A;  1H84 A;  4Z24 A;  2X8C A;  3DJG X;  3NLC A;  4DNA A;  4A99 A;  2GR2 A;  2GAG B;  2ACZ A;  3QSM A;  2WOW A;  4IA5 A;  5KOW A;  1IJH A;  1IUV A;  1NDA A;  1XHC A;  3D8X A;  2WPC A;  4H4W A;  3C96 A;  4EQW A;  1PBF A;  1NG4 A;  2R46 A;  2GEW A;  2YLX A;  1TDF A;  3ICS A;  4Z2T A;  1HYU A;  1GRA A;  1Q9I A;  3KLJ A;  2Y6R A;  2JBV A;  4NEW A;  3KPF A;  4Z25 A;  1MOK A;  4APN A;  5J60 A;  4M52 A;  1E1L A;  3ATR A;  1GES A;  4C77 A;  4OCG A;  4A5L A;  1TDO A;  1Y56 B;  3CNT A;  2PYX A;  3AB1 A;  1PBB A;  1QJD A;  2YQU A;  4K5R A;  2JB3 A;  5FS6 A;  2B9X A;  2WOI A;  3RP7 A;  4EQR A;  1M6I A;  4BV6 A;  1IUW A;  4EMJ A;  1KNP A;  3IHG A;  4GUV A;  2Q7V A;  1FEA A;  1Y56 A;  5IPY A;  2R4J A;  3ZDN A;  1JRX A;  4NTC A;  2BCG G;  2BCP A;  1K4Q A;  5HYM A;  2Z5Y A;  2R45 A;  2BK5 A;  3CPH G;  4TM4 A;  3CGB A;  4H2N A;  3FMW A;  4REK A;  2E4G A;  5U63 A;  1ZX9 A;  5EBK A;  4C5O A;  1VRQ B;  2YLZ A;  3NN6 X;  1F8R A;  1GTH A;  3ALJ A;  3VR9 A;  4AP3 A;  1ZP0 A;  1YY5 A;  3IHM A;  3UTG A;  2AQJ A;  2WOV A;  3NKS A;  1XPQ A;  4PAA A;  4FK1 C;  1XAN A;  3AE2 A;  2Q6U A;  2NPX A;  3LOV A;  3NNE A;  4CRT A;  2OAM A;  3NG7 X;  4ICY A;  3QJ4 A;  3DK9 A;  3CPI G;  4ADW A;  4H4R A;  3CGE A;  2CVJ A;  3AD7 B;  4IA6 A;  3CN8 A;  4B65 A;  2WPE A;  1D7L A;  2I0Z A;  4JDR A;  3AE3 A;  1BKW A;  1KF6 A;  3BHK A;  4NZH A;  4YTM A;  4A65 A;  4UDP A;  2RGH A;  4J33 A;  2XCG A;  4LII A;  4Z26 A;  1NEK A;  2B76 A;  1D7Y A;  1NPX A;  3M12 A;  5FS8 A;  1H83 A;  1GER A;  1VG0 A;  4GCM A;  3M13 A;  2WU5 A;  1GTE A;  5J7X A;  3GWD A;  2C3C A;  2H88 A;  3CGD A;  1IUS A;  4OPU A;  1DOB A;  4FDC B;  2WDR A;  1OJD A;  2GVC A;  4HB9 A;  4J36 A;  1TDN A;  1JNR A;  3GSI A;  4K8D A;  4LU6 A;  2X8H A;  4AP1 A;  5HXI A;  1O94 A;  5JCM A;  4A79 A;  5KXJ A;  1NHR A;  3AYJ A;  1EL8 A;  2Q0L A;  1NHQ A;  1JNZ A;  1H82 A;  2GQW A;  2YLW A;  1PXB A;  3KKJ A;  2F5Z A;  2FJE A;  2X8G A;  2OLN A;  4YT0 A;  1OJA A;  1H7X A;  2OLO A;  3GRT A;  3NT6 A;  4J2W A;  2VRM A;  2YAU A;  4U8O A;  3EPT A;  4X9N A;  1Q1W A;  1TDK A;  3GMC A;  4IVO B;  4Y4M A;  1S2Y A;  3GYJ A;  2WPF A;  3AE7 A;  1GRH A;  4H2P A;  2GV8 A;  4NTD A;  5ER0 A;  2A8X A;  1B4V A;  4U2T A;  1CJ4 A;  4Z43 A;  5JCL A;  3OC4 A;  3II4 A;  1DJQ A;  3NIX A;  3V3O A;  4U8L A;  3B3R A;  3FG2 P;  3KU9 A;  4NTE A;  1L9E A;  3BI4 A;  1DOC A;  2IVD A;  1N4W A;  2V5Z A;  5U1O A;  3V76 A;  1NEN A;  3VRA A;  4JQ9 A;  4EMW A;  3LZX A;  3WE0 A;  4UDQ A;  4BUR A;  1Q1R A;  3GYI A;  1B5Q A;  2XVE A;  3CTY A;  5BUL A;  5GRT A;  3G5S A;  4TLX A;  3NH3 X;  4XXG A;  4C3Y A;  4YSZ A;  4WX1 A;  2E5V A;  1CJC A;  2CFY A;  4OPL A;  5BVA A;  2B7S A;  4B1B A;  2R0P A;  2Z5X A;  3UTF A;  1OJT A;  1S2Q A;  2WBA A;  2B9Y A;  1DJN A;  3AEE A;  4U8I A;  4CNK A;  3UKQ A;  2GQF A;  1NHS A;  1IUU A;  2R0G A;  2WP9 A;  4KPR A;  5DBJ A;  5LV9 A;  2YLS A;  2XFQ A;  3LB8 A;  1YQZ A;  1N4U A;  3B6D A;  3SM8 A;  4EIP A;  1MXT A;  3P4P A;  1GAL A;  2VVL A;  3SFD A;  3UOZ A;  1ZY8 A;  3DME A;  3DGH A;  4JY3 A;  3NYE A;  2C65 A;  1E7P A;  2TPR A;  2VQ7 A;  3FPZ A;  1ZOY A;  3RP6 A;  2WU2 A;  1PJ6 A;  5M0Z A;  4DSG A;  4RG4 A;  2BAC A;  1D4E A;  2HQM A;  1KFY A;  1ZKQ A;  3AE8 A;  1JEH A;  1TYT A;  3RED A;  1LVL A;  3ICT A;  2GB0 A;  3ALM A;  3SQP A;  1O95 A;  2YM2 A;  1ZDL A;  1NAA A;  4BK1 A;  3NGC X;  3COX A;  2XVI A;  1F6M A;  5FS9 A;  4X4J A;  4XWZ A;  3UOY A;  4OPG A;  1RYI A;  3KA7 A;  4H4S A;  2XFP A;  1JRY A;  2BS2 A;  2RGJ A;  1JOA A;  1RSG A;  4JY2 A;  3ICR A;  4B64 A;  4HA6 A;  2WP5 A;  4ZN0 A;  5EB4 A;  3AD8 B;  3D1C A;  3P4Q A;  1RP0 A;  3AD9 B;  3KD9 A;  4YTP A;  3NTD A;  3UKK A;  3NYC A;  1YQ4 A;  3AE1 A;  4EQS A;  3BNU A;  1B8S A;  4YXD A;  4K2X A;  1EBD A;  3VR8 A;  5JCK A;  1VG9 A;  3GDP A;  4H4U A;  1CL0 A;  2BS4 A;  3HZL A;  2R9Z A;  3CNS A;  2VRL A;  4XWR A;  3K7Q X;  3O0H A;  2WDQ A;  3QVR A;  2WQY A;  4B67 A;  3F8P A;  4J57 A;  2QA1 A;  4EQX A;  3K7T A;  1L9D A;  4I58 A;  4EM4 A;  4J56 A;  3DK4 A;  4RG3 A;  1BF3 A;  3PVC A;  2BYB A;  1Z6L A;  2C75 A;  4IV9 A;  4TM0 A;  3T37 A;  1LTX R;  2XVH A;  3QFB A;  4YWO A;  2CDU A;  3EF6 A;  4AOS A;  2WHD A;  2B7R A;  1GT8 A;  2YG4 A;  3IC9 A;  3NTA A;  4FK1 A;  4OPC A;  5FMH A;  2YR4 A;  2C67 A;  4A9W A;  3AEF A;  4YSH A;  2XVF A;  4YSY A;  4D03 A;  2YR6 A;  4EMI A;  2FJB A;  1PJ7 A;  3S5W A;  2WS3 A;  1H86 A;  4B63 A;  3DH9 A;  1JU2 A;  4BJZ A;  1D4D A;  3I6D A;  5M10 A;  2BAB A;  4A6N B;  2APG A;  1ZMD A;  3K7M X;  1REO A;  1FEB A;  1LQU A;  4H2R A;  4O5U A;  2GRT A;  2XYO A;  4A6N A;  3UTH A;  4DGK A;  1E39 A;  1GRB A;  3AEG A;  2GH5 A;  1LV0 A;  3BI5 A;  4ZCC A;  5FS7 A;  3VQR A;  1YQ3 A;  2YLT A;  1K0I A;  2GR1 A;  4GF7 A;  1GSN A;  3VRB A;  1DXL A;  4TM1 A;  3QSE A;  2XFU A;  3GDN A;  4U2L A;  2XLS A;  3L8K A;  1F3P A;  3UKP A;  2V6O A;  3DJD A;  5EOW A;  3I3L A;  4OPT A;  4JNA A;  1ZOV A;  4U8K A;  1FOH A;  3H8L A;  3ZYX A;  3NYF A;  2QA2 A;  4FX9 A;  4H4Y A;  1PXA A;  1BWC A;  2JK6 A;  3Q6J A;  3AE5 A;  3UKF A;  4KX6 A;  5CQF A;  1FL2 A;  2ZBW A;  3DK8 A;  1PBE A;  2X99 A;  2YG5 A;  2WP6 A;  1PBD A;  3AE9 A;  4JNQ A;  5TR3 A;  5CKU A;  1XDI A;  5KVH A;  2J3N A;  5HHF A;  3GD3 A;  2YWL A;  2AR8 A;  4YSX A;  2V3A A;  4H2Q A;  2GMJ A;  3L1R A;  3PS9 A;  4AT2 A;  2WEU A;  2XFO A;  1LJ1 A;  3URH A;  5KVI A;  2WET A;  3QVP A;  2RAB A;  4Y4N A;  3UKA A;  1CC2 A;  1OJ9 A;  2FJA A;  2X3N A;  2Y6Q A;  4CBQ A;  5C2T A;  4B68 A;  2BK3 A;  3AYI A;  4YTN A;  5KWF A;  4LA1 A;  2A89 A;  2VVM A;  2VVL G;  1K0J A;  2DKH A;  4GR1 A;  4JN9 A;  1PN0 A;  4MJW A;  4UP3 A;  1O5W A;  2BC0 A;  1CHU A;  2JKC A;  2UZZ A;  4K7Z A;  3C4N A;  4K22 A;  1S3E A;  4NEV A;  1AOG A;  2YG6 A;  4TM3 A;  3UOV A;  4Z2U A;  3ADA B;  3AED A;  4P9S A;  2O9Z A;  3NK0 X;  3BNM A;  4H4X A;  1VQW A;  5KOX A;  3IF9 A;  3C4A A;  1GRG A;  2XFN A;  3E1T A;  3FIM B;  3F8R A;  2ZZ0 A;  1P2E A;  3AWI A;  4OPI A;  2EQ6 A;  1KDG A;  2OAL A;  1UKV G;  1W4X A;  3IWA A;  1EL5 A;  5IQ1 A;  5C3J A;  3R9U A;  1D4C A;  2E1M A;  1GRF A;  2GF3 A;  4BJY A;  4U8J A;  4GDP A;  2EQ7 A;  3M0O A;  4TLZ A;  4C3X A;  2A87 A;  3NK2 X;  3NN0 X;  1P2H A;  2V3B A;  4C74 A;  3GRS A;  3RHA A;  1BGN A;  1VDC A;  1MO9 A;  1GRE A;  1GPE A;  2R4E A;  1H81 A;  5KRQ A;  4EIQ A;  2CUL A;  1TDE A;  1E1K A;  5EB5 A;  1QLB A;  1ELI A;  2Q0K A;  1K0L A;  3CNJ A;  3DJJ A;  3NHO X;  4UDR A;  1SEZ A;  2EQ8 A;  2JB1 A;  4PAB A;  2FBW A;  1QO8 A;  2RGO A;  5JCN A;  1IUX A;  3UKL A;  3GMB A;  3K30 A;  2WES A;  5HY5 A;  3P1W A;  1KSS A;  2BA9 A;  3UP5 A;  3LAD A;  1GOS A;  3FBS A;  2BC1 A;  4OPD A;  4H4P A;  1S3B A;  1PXC A;  1PDH A;  3JSK A;  2GAH B;  4DSH A;  1PBC A;  2ARD A;  3VRD B;  2B9W A;  1CC6 A;  2XLT A;  4J34 A;  3RP8 A;  3AXB A;  1CBO A;  2XVJ A;  4CY6 A;  3CPJ G;  2IVE A;  2EQ9 A;  2GMH A;  2VZ2 A;  4AOX A;  2V61 A;  4Z44 A;  1KNR A;  3EAN A;  3P4S A;  1GEU A;  5GSN A;  2C7G A;  5U25 A;  5BRT A;  2C72 A;  4H7U A;  1GRT A;  4D04 A;  2VOU A;  3LXD A;  4USQ A;  1E1M A;  1ONF A;  4CY8 A;  2XLR A;  4E0V A;  2BK4 A;  3AEB A;  3F8D A;  3LZW A;  2OA1 A;  3DGZ A;  4YKG A;  4U8P A;  1Y0P A;  3Q9T A;  1E6E A;  1PJ5 A;  3QFA A;  3BI2 A;  3LJP A;  3UKH A;  5JCI A;  1LQT A;  3S61 A;  4Y4L A;  1N1P A;  4H4Q A;  2QAE A;  1V59 A;  4B66 A;  3NRN A;  4GDE A;  1NG3 A;  1JRZ A;  4IVM B;  3AEC A;  3GD4 A;  2DKI A;  2QCU A;  3GWF A;  2YG7 A;  3DJE A;  1BGJ A;  2C64 A;  1GV4 A;  2X50 A;  3ATQ A;  2VQB A;  1L9C A;  4CNJ A;  2C70 A;  3EAO A;  1E1N A;  1FEC A;  2WDV A;  3AE4 A;  2YG3 A;  3UCL A;  4H4T A;  4USR A;  2V60 A;  3H4K A;  5IQ4 A;  4K5S A;  3CIR A;  2BXR A;  3UOX A;  3NK1 X;  1PHH A;  4H4V A;  4YKF A;  3P9U A;  2YVF A;  1L0V A;  4X9M A;  2NVK X;  4U8M A;  3G5R A;  2YLR A;  3CGC A;  5L46 A;  1ZK7 A;  4RSL A;  4BK2 A;  4B69 A;  1GND A;  1H7W A;  3AE6 A;  4N9X A;  1GXF A;  1CJ2 A;  2YM1 A;  2PHH A;  2YVJ A;  3ISH A;  4J31 A;  2W0H A;  1H6V A;  3KVE A;  4WCT A; 
#chains in the Genus database with same CATH topology
 2ZZC A;  1EL9 A;  1B37 A;  1YKJ A;  1F8W A;  1CC4 A;  4A7A A;  2JB2 A;  3AYL A;  4I59 A;  1EL7 A;  1KSU A;  2TMD A;  1DOE A;  3BHF A;  3V3N A;  3H8I A;  2FJD A;  1D5T A;  2C73 A;  3ALL A;  4ZCD A;  1N4V A;  2GR3 A;  4U8N A;  1CJ3 A;  2R0C A;  2YVG A;  3UTE A;  1IUT A;  1F8S A;  2GR0 A;  3T2K A;  2H89 A;  3SGL A;  4H50 A;  2YR5 A;  3RNM A;  1ZMC A;  1BZL A;  3ABV A;  4ECH A;  3AEA A;  2BXS A;  4Z2R A;  1GET A;  1COY A;  1LPF A;  2C4C A;  3P4R A;  4U2S A;  1OJC A;  3SFE A;  1TYP A;  2BS3 A;  2ZZB A;  4BK3 A;  3G5Q A;  4CCR A;  1CF3 A;  1FCD A;  2JAE A;  1TRB A;  3QSS A;  5KMS A;  4AT0 A;  1DOD A;  2XDO A;  3OZ2 A;  3ITJ A;  3PO7 A;  4OVI A;  2IID A;  4GRT A;  3DA1 A;  4O5Q A;  3SYI A;  1M64 A;  1DNC A;  3SXI A;  3UP4 A;  1X31 B;  5BUK A;  4H4Z A;  2C76 A;  2XLP A;  2C66 A;  3KPK A;  3T14 A;  3CNP A;  1NHP A;  2XLU A;  4G74 A;  1PS9 A;  4CCQ A;  3CND A;  4EM3 A;  2C3D A;  2AAQ A;  1H84 A;  4Z24 A;  2X8C A;  3DJG X;  3NLC A;  4DNA A;  4A99 A;  2GR2 A;  2GAG B;  2ACZ A;  3QSM A;  2WOW A;  4IA5 A;  5KOW A;  1IJH A;  1IUV A;  1NDA A;  1XHC A;  3D8X A;  2WPC A;  3GYX A;  3C96 A;  4H4W A;  1PBF A;  4EQW A;  1NG4 A;  2R46 A;  2GEW A;  2YLX A;  1TDF A;  3ICS A;  4G9K A;  4Z2T A;  1HYU A;  1GRA A;  1Q9I A;  3KLJ A;  2Y6R A;  2JBV A;  4NEW A;  3T2Y A;  3KPF A;  4Z25 A;  1MOK A;  4APN A;  5J60 A;  4M52 A;  1E1L A;  3ATR A;  1GES A;  4C77 A;  4GAV A;  4OCG A;  4A5L A;  1TDO A;  1Y56 B;  3CNT A;  2PYX A;  3AB1 A;  1PBB A;  1QJD A;  2YQU A;  4K5R A;  2JB3 A;  5FS6 A;  2B9X A;  2WOI A;  3RP7 A;  4EQR A;  1M6I A;  4BV6 A;  1IUW A;  3SZF A;  4EMJ A;  1KNP A;  3IHG A;  4GUV A;  2Q7V A;  1FEA A;  1Y56 A;  5IPY A;  2R4J A;  3ZDN A;  1JRX A;  4NTC A;  2BCG G;  2BCP A;  1K4Q A;  5HYM A;  2Z5Y A;  2R45 A;  2BK5 A;  3CPH G;  4TM4 A;  3CGB A;  4H2N A;  3FMW A;  4REK A;  2E4G A;  5U63 A;  1ZX9 A;  5EBK A;  4C5O A;  1VRQ B;  2YLZ A;  3NN6 X;  1F8R A;  1GTH A;  3ALJ A;  3VR9 A;  4AP3 A;  1ZP0 A;  1YY5 A;  3IHM A;  3UTG A;  2AQJ A;  2WOV A;  3NKS A;  1XPQ A;  4PAA A;  4FK1 C;  1XAN A;  3AE2 A;  2Q6U A;  2NPX A;  3LOV A;  3NNE A;  4CRT A;  2OAM A;  3NG7 X;  4ICY A;  3QJ4 A;  3DK9 A;  3CPI G;  4ADW A;  4H4R A;  4NWZ A;  3CGE A;  2CVJ A;  3AD7 B;  4IA6 A;  3CN8 A;  4B65 A;  2WPE A;  1D7L A;  2I0Z A;  4JDR A;  3AE3 A;  1BKW A;  1KF6 A;  3BHK A;  4NZH A;  4YTM A;  4A65 A;  4UDP A;  2RGH A;  4J33 A;  2XCG A;  4LII A;  4Z26 A;  1NEK A;  2B76 A;  1D7Y A;  1NPX A;  3M12 A;  5FS8 A;  1H83 A;  1GER A;  1VG0 A;  4GCM A;  3SZ0 A;  3M13 A;  2WU5 A;  1GTE A;  5J7X A;  3GWD A;  2C3C A;  2H88 A;  3CGD A;  1IUS A;  4OPU A;  1DOB A;  4FDC B;  2WDR A;  1OJD A;  2GVC A;  4HB9 A;  4J36 A;  1TDN A;  1JNR A;  3GSI A;  4K8D A;  4LU6 A;  2X8H A;  4AP1 A;  5HXI A;  3SY4 A;  1O94 A;  5JCM A;  4A79 A;  5KXJ A;  1NHR A;  3AYJ A;  1EL8 A;  2Q0L A;  1NHQ A;  1JNZ A;  1H82 A;  2GQW A;  2YLW A;  1PXB A;  3KKJ A;  2F5Z A;  2FJE A;  2X8G A;  2OLN A;  4YT0 A;  1OJA A;  1H7X A;  2OLO A;  3GRT A;  3NT6 A;  4J2W A;  2VRM A;  2YAU A;  4U8O A;  3EPT A;  4X9N A;  1Q1W A;  1TDK A;  3GMC A;  4IVO B;  4Y4M A;  1S2Y A;  3GYJ A;  2WPF A;  3AE7 A;  1GRH A;  4H2P A;  2GV8 A;  4NTD A;  5ER0 A;  2A8X A;  1B4V A;  4U2T A;  1CJ4 A;  4Z43 A;  5JCL A;  3OC4 A;  3II4 A;  1DJQ A;  3NIX A;  3V3O A;  4U8L A;  3B3R A;  3FG2 P;  3KU9 A;  4NTE A;  1L9E A;  3BI4 A;  1DOC A;  2IVD A;  3T0K A;  1N4W A;  2V5Z A;  5U1O A;  3V76 A;  1NEN A;  3VRA A;  4JQ9 A;  4EMW A;  3LZX A;  3WE0 A;  4UDQ A;  5KMQ A;  1Q1R A;  3GYI A;  4BUR A;  1B5Q A;  2XVE A;  3CTY A;  5BUL A;  5GRT A;  3G5S A;  4TLX A;  3NH3 X;  4XXG A;  4C3Y A;  4YSZ A;  4WX1 A;  2E5V A;  1CJC A;  2CFY A;  4OPL A;  5BVA A;  2B7S A;  4B1B A;  2R0P A;  2Z5X A;  3UTF A;  1OJT A;  1S2Q A;  2WBA A;  2B9Y A;  1DJN A;  3AEE A;  4U8I A;  4CNK A;  3UKQ A;  2GQF A;  1NHS A;  1IUU A;  2R0G A;  2WP9 A;  4KPR A;  5DBJ A;  5LV9 A;  2YLS A;  2XFQ A;  3LB8 A;  1YQZ A;  1N4U A;  3B6D A;  4GAP A;  3SM8 A;  4NNJ A;  4EIP A;  1MXT A;  3P4P A;  1GAL A;  2VVL A;  3SFD A;  3UOZ A;  1ZY8 A;  3DME A;  3DGH A;  4JY3 A;  3NYE A;  2C65 A;  1E7P A;  2TPR A;  2VQ7 A;  3FPZ A;  1ZOY A;  3RP6 A;  2WU2 A;  1PJ6 A;  5M0Z A;  4DSG A;  4RG4 A;  2BAC A;  1D4E A;  3HYW A;  2HQM A;  1KFY A;  1ZKQ A;  3AE8 A;  1JEH A;  1TYT A;  3RED A;  1LVL A;  3ICT A;  2GB0 A;  3ALM A;  4G6G A;  3SQP A;  1O95 A;  2YM2 A;  1ZDL A;  1NAA A;  4BK1 A;  3NGC X;  3COX A;  2XVI A;  1F6M A;  5FS9 A;  4X4J A;  4XWZ A;  3UOY A;  4OPG A;  1RYI A;  3KA7 A;  4H4S A;  2XFP A;  4G6H A;  1JRY A;  2BS2 A;  2RGJ A;  1JOA A;  1RSG A;  4JY2 A;  3ICR A;  4B64 A;  4HA6 A;  2WP5 A;  4ZN0 A;  5EB4 A;  3AD8 B;  3D1C A;  3P4Q A;  1RP0 A;  3AD9 B;  3KD9 A;  4YTP A;  3NTD A;  3UKK A;  3NYC A;  1YQ4 A;  3AE1 A;  4EQS A;  3BNU A;  1B8S A;  4YXD A;  4K2X A;  1EBD A;  3VR8 A;  5JCK A;  3SZC A;  1VG9 A;  3GDP A;  4H4U A;  1CL0 A;  2BS4 A;  3HZL A;  2R9Z A;  3CNS A;  2VRL A;  4XWR A;  3K7Q X;  3O0H A;  2WDQ A;  3QVR A;  2WQY A;  4B67 A;  3F8P A;  4J57 A;  2QA1 A;  4EQX A;  3K7T A;  1L9D A;  4I58 A;  4EM4 A;  4J56 A;  3DK4 A;  4RG3 A;  1BF3 A;  3PVC A;  2BYB A;  1Z6L A;  2C75 A;  4IV9 A;  4TM0 A;  3T37 A;  1LTX R;  2XVH A;  3QFB A;  4YWO A;  2CDU A;  3EF6 A;  4AOS A;  2WHD A;  2B7R A;  1GT8 A;  2YG4 A;  3IC9 A;  3NTA A;  4FK1 A;  4OPC A;  5FMH A;  2YR4 A;  2C67 A;  4A9W A;  3AEF A;  3CMM A;  4YSH A;  2XVF A;  4YSY A;  4D03 A;  2YR6 A;  4EMI A;  2FJB A;  1PJ7 A;  3S5W A;  2WS3 A;  1H86 A;  4B63 A;  3DH9 A;  1JU2 A;  4BJZ A;  1D4D A;  3I6D A;  5M10 A;  2BAB A;  4A6N B;  2APG A;  4G73 A;  1ZMD A;  3K7M X;  1REO A;  1FEB A;  1LQU A;  4H2R A;  4O5U A;  2GRT A;  2XYO A;  4A6N A;  3UTH A;  4DGK A;  1E39 A;  1GRB A;  3AEG A;  2GH5 A;  1LV0 A;  3BI5 A;  4ZCC A;  5FS7 A;  3VQR A;  1YQ3 A;  2YLT A;  1K0I A;  2GR1 A;  4GF7 A;  1GSN A;  3VRB A;  1DXL A;  4TM1 A;  3QSE A;  2XFU A;  3GDN A;  4U2L A;  2XLS A;  3L8K A;  1F3P A;  3UKP A;  2V6O A;  3DJD A;  5EOW A;  3I3L A;  4OPT A;  4JNA A;  1ZOV A;  4U8K A;  1FOH A;  3H8L A;  3ZYX A;  3NYF A;  2QA2 A;  4FX9 A;  4H4Y A;  1PXA A;  1BWC A;  2JK6 A;  3Q6J A;  3AE5 A;  3UKF A;  4KX6 A;  5CQF A;  1FL2 A;  2ZBW A;  3DK8 A;  1PBE A;  2X99 A;  2YG5 A;  2WP6 A;  1PBD A;  3AE9 A;  4JNQ A;  5TR3 A;  5CKU A;  1XDI A;  5KVH A;  2J3N A;  5HHF A;  3GD3 A;  2YWL A;  2AR8 A;  4YSX A;  2V3A A;  4H2Q A;  2GMJ A;  3L1R A;  3PS9 A;  4AT2 A;  2WEU A;  3HYV A;  2XFO A;  1LJ1 A;  3URH A;  5KVI A;  2WET A;  3QVP A;  2RAB A;  4Y4N A;  3UKA A;  1CC2 A;  1OJ9 A;  2FJA A;  2X3N A;  2Y6Q A;  3T2Z A;  4CBQ A;  5C2T A;  4B68 A;  2BK3 A;  3AYI A;  4YTN A;  5KWF A;  4LA1 A;  2A89 A;  2VVM A;  2VVL G;  1K0J A;  2DKH A;  4GR1 A;  4JN9 A;  1PN0 A;  4MJW A;  4UP3 A;  4II3 A;  1O5W A;  2BC0 A;  1CHU A;  2JKC A;  2UZZ A;  4K7Z A;  3C4N A;  4K22 A;  1S3E A;  4NEV A;  1AOG A;  2YG6 A;  4TM3 A;  3UOV A;  4Z2U A;  3ADA B;  3SZW A;  3AED A;  4P9S A;  2O9Z A;  3NK0 X;  3BNM A;  4H4X A;  1VQW A;  5KOX A;  3IF9 A;  3C4A A;  1GRG A;  2XFN A;  3E1T A;  3FIM B;  3F8R A;  5KMP A;  2ZZ0 A;  1P2E A;  3AWI A;  4OPI A;  2EQ6 A;  1KDG A;  2OAL A;  1UKV G;  1W4X A;  3IWA A;  2BRY A;  1EL5 A;  5IQ1 A;  5C3J A;  3R9U A;  1D4C A;  2E1M A;  1GRF A;  2GF3 A;  4BJY A;  4U8J A;  5KNL A;  4II2 A;  4GDP A;  2EQ7 A;  3M0O A;  4TLZ A;  4C3X A;  3HYX A;  2A87 A;  2BRA A;  3NK2 X;  3NN0 X;  1P2H A;  2V3B A;  4C74 A;  3GRS A;  3RHA A;  1BGN A;  1VDC A;  1MO9 A;  1GRE A;  1GPE A;  2R4E A;  1H81 A;  5KRQ A;  4EIQ A;  2CUL A;  1TDE A;  1E1K A;  5EB5 A;  1QLB A;  1ELI A;  2Q0K A;  1K0L A;  3CNJ A;  3DJJ A;  3NHO X;  4UDR A;  1SEZ A;  2EQ8 A;  2JB1 A;  4PAB A;  2FBW A;  1QO8 A;  2RGO A;  5JCN A;  1IUX A;  3UKL A;  3GMB A;  3K30 A;  2WES A;  5HY5 A;  3P1W A;  1KSS A;  2BA9 A;  3UP5 A;  3LAD A;  1GOS A;  3FBS A;  2BC1 A;  4OPD A;  4H4P A;  1S3B A;  3SX6 A;  1PXC A;  1PDH A;  3JSK A;  2GAH B;  4DSH A;  1PBC A;  2ARD A;  3VRD B;  2B9W A;  1CC6 A;  2XLT A;  4J34 A;  3RP8 A;  3AXB A;  1CBO A;  2XVJ A;  4CY6 A;  3CPJ G;  2IVE A;  2EQ9 A;  2GMH A;  2VZ2 A;  4AOX A;  2V61 A;  4Z44 A;  1KNR A;  3EAN A;  3P4S A;  1GEU A;  5GSN A;  2C7G A;  5U25 A;  5BRT A;  2C72 A;  4H7U A;  1GRT A;  4D04 A;  2VOU A;  3LXD A;  4USQ A;  1E1M A;  1ONF A;  4CY8 A;  2XLR A;  4E0V A;  2BK4 A;  3AEB A;  3F8D A;  3LZW A;  2OA1 A;  3DGZ A;  4YKG A;  4U8P A;  1Y0P A;  3Q9T A;  1E6E A;  1PJ5 A;  3QFA A;  3BI2 A;  3LJP A;  3UKH A;  5JCI A;  1LQT A;  3S61 A;  4Y4L A;  1N1P A;  4H4Q A;  2QAE A;  1V59 A;  4B66 A;  3NRN A;  4GDE A;  1NG3 A;  1JRZ A;  4IVM B;  3AEC A;  3GD4 A;  2DKI A;  2QCU A;  3GWF A;  2YG7 A;  3DJE A;  1BGJ A;  2C64 A;  1GV4 A;  2X50 A;  3ATQ A;  2VQB A;  1L9C A;  4CNJ A;  2C70 A;  3EAO A;  1E1N A;  1FEC A;  2WDV A;  3AE4 A;  2YG3 A;  3UCL A;  4H4T A;  4USR A;  2V60 A;  3H4K A;  5IQ4 A;  4K5S A;  3CIR A;  3T31 A;  5KMR A;  2BXR A;  3UOX A;  3NK1 X;  1PHH A;  4H4V A;  4YKF A;  3P9U A;  2YVF A;  1L0V A;  4X9M A;  2NVK X;  4U8M A;  3G5R A;  2YLR A;  3CGC A;  5L46 A;  1ZK7 A;  4RSL A;  4BK2 A;  4B69 A;  1GND A;  1H7W A;  3AE6 A;  4N9X A;  1GXF A;  1CJ2 A;  2YM1 A;  2PHH A;  2YVJ A;  3ISH A;  4J31 A;  2W0H A;  1H6V A;  3KVE A;  4WCT A; 
#chains in the Genus database with same CATH homology
 2ZZC A;  1EL9 A;  1B37 A;  1YKJ A;  1F8W A;  1CC4 A;  4A7A A;  2JB2 A;  3AYL A;  4I59 A;  1EL7 A;  1KSU A;  2TMD A;  1DOE A;  3BHF A;  3V3N A;  3H8I A;  2FJD A;  1D5T A;  2C73 A;  3ALL A;  4ZCD A;  1N4V A;  2GR3 A;  4U8N A;  1CJ3 A;  2R0C A;  2YVG A;  3UTE A;  1IUT A;  1F8S A;  2GR0 A;  3T2K A;  2H89 A;  3SGL A;  4H50 A;  2YR5 A;  3RNM A;  1ZMC A;  1BZL A;  3ABV A;  4ECH A;  3AEA A;  2BXS A;  4Z2R A;  1GET A;  1COY A;  1LPF A;  2C4C A;  3P4R A;  4U2S A;  1OJC A;  3SFE A;  1TYP A;  2BS3 A;  2ZZB A;  4BK3 A;  3G5Q A;  4CCR A;  1CF3 A;  1FCD A;  2JAE A;  1TRB A;  3QSS A;  5KMS A;  4AT0 A;  1DOD A;  2XDO A;  3OZ2 A;  3ITJ A;  3PO7 A;  4OVI A;  2IID A;  4GRT A;  3DA1 A;  4O5Q A;  3SYI A;  1M64 A;  1DNC A;  3SXI A;  3UP4 A;  1X31 B;  5BUK A;  4H4Z A;  2C76 A;  2XLP A;  2C66 A;  3KPK A;  3T14 A;  3CNP A;  1NHP A;  2XLU A;  4G74 A;  1PS9 A;  4CCQ A;  3CND A;  4EM3 A;  2C3D A;  2AAQ A;  1H84 A;  4Z24 A;  2X8C A;  3DJG X;  3NLC A;  4DNA A;  4A99 A;  2GR2 A;  2GAG B;  2ACZ A;  3QSM A;  2WOW A;  4IA5 A;  5KOW A;  1IJH A;  1IUV A;  1NDA A;  1XHC A;  3D8X A;  2WPC A;  3GYX A;  3C96 A;  4H4W A;  1PBF A;  4EQW A;  1NG4 A;  2R46 A;  2GEW A;  2YLX A;  1TDF A;  3ICS A;  4G9K A;  4Z2T A;  1HYU A;  1GRA A;  1Q9I A;  3KLJ A;  2Y6R A;  2JBV A;  4NEW A;  3T2Y A;  3KPF A;  4Z25 A;  1MOK A;  4APN A;  5J60 A;  4M52 A;  1E1L A;  3ATR A;  1GES A;  4C77 A;  4GAV A;  4OCG A;  4A5L A;  1TDO A;  1Y56 B;  3CNT A;  2PYX A;  3AB1 A;  1PBB A;  1QJD A;  2YQU A;  4K5R A;  2JB3 A;  5FS6 A;  2B9X A;  2WOI A;  3RP7 A;  4EQR A;  1M6I A;  4BV6 A;  1IUW A;  3SZF A;  4EMJ A;  1KNP A;  3IHG A;  4GUV A;  2Q7V A;  1FEA A;  1Y56 A;  5IPY A;  2R4J A;  3ZDN A;  1JRX A;  4NTC A;  2BCG G;  2BCP A;  1K4Q A;  5HYM A;  2Z5Y A;  2R45 A;  2BK5 A;  3CPH G;  4TM4 A;  3CGB A;  4H2N A;  3FMW A;  4REK A;  2E4G A;  5U63 A;  1ZX9 A;  5EBK A;  4C5O A;  1VRQ B;  2YLZ A;  3NN6 X;  1F8R A;  1GTH A;  3ALJ A;  3VR9 A;  4AP3 A;  1ZP0 A;  1YY5 A;  3IHM A;  3UTG A;  2AQJ A;  2WOV A;  3NKS A;  1XPQ A;  4PAA A;  4FK1 C;  1XAN A;  3AE2 A;  2Q6U A;  2NPX A;  3LOV A;  3NNE A;  4CRT A;  2OAM A;  3NG7 X;  4ICY A;  3QJ4 A;  3DK9 A;  3CPI G;  4ADW A;  4H4R A;  4NWZ A;  3CGE A;  2CVJ A;  3AD7 B;  4IA6 A;  3CN8 A;  4B65 A;  2WPE A;  1D7L A;  2I0Z A;  4JDR A;  3AE3 A;  1BKW A;  1KF6 A;  3BHK A;  4NZH A;  4YTM A;  4A65 A;  4UDP A;  2RGH A;  4J33 A;  2XCG A;  4LII A;  4Z26 A;  1NEK A;  2B76 A;  1D7Y A;  1NPX A;  3M12 A;  5FS8 A;  1H83 A;  1GER A;  1VG0 A;  4GCM A;  3SZ0 A;  3M13 A;  2WU5 A;  1GTE A;  5J7X A;  3GWD A;  2C3C A;  2H88 A;  3CGD A;  1IUS A;  4OPU A;  1DOB A;  4FDC B;  2WDR A;  1OJD A;  2GVC A;  4HB9 A;  4J36 A;  1TDN A;  1JNR A;  3GSI A;  4K8D A;  4LU6 A;  2X8H A;  4AP1 A;  5HXI A;  3SY4 A;  1O94 A;  5JCM A;  4A79 A;  5KXJ A;  1NHR A;  3AYJ A;  1EL8 A;  2Q0L A;  1NHQ A;  1JNZ A;  1H82 A;  2GQW A;  2YLW A;  1PXB A;  3KKJ A;  2F5Z A;  2FJE A;  2X8G A;  2OLN A;  4YT0 A;  1OJA A;  1H7X A;  2OLO A;  3GRT A;  3NT6 A;  4J2W A;  2VRM A;  2YAU A;  4U8O A;  3EPT A;  4X9N A;  1Q1W A;  1TDK A;  3GMC A;  4IVO B;  4Y4M A;  1S2Y A;  3GYJ A;  2WPF A;  3AE7 A;  1GRH A;  4H2P A;  2GV8 A;  4NTD A;  5ER0 A;  2A8X A;  1B4V A;  4U2T A;  1CJ4 A;  4Z43 A;  5JCL A;  3OC4 A;  3II4 A;  1DJQ A;  3NIX A;  3V3O A;  4U8L A;  3B3R A;  3FG2 P;  3KU9 A;  4NTE A;  1L9E A;  3BI4 A;  1DOC A;  2IVD A;  3T0K A;  1N4W A;  2V5Z A;  5U1O A;  3V76 A;  1NEN A;  3VRA A;  4JQ9 A;  4EMW A;  3LZX A;  3WE0 A;  4UDQ A;  5KMQ A;  1Q1R A;  3GYI A;  4BUR A;  1B5Q A;  2XVE A;  3CTY A;  5BUL A;  5GRT A;  3G5S A;  4TLX A;  3NH3 X;  4XXG A;  4C3Y A;  4YSZ A;  4WX1 A;  2E5V A;  1CJC A;  2CFY A;  4OPL A;  5BVA A;  2B7S A;  4B1B A;  2R0P A;  2Z5X A;  3UTF A;  1OJT A;  1S2Q A;  2WBA A;  2B9Y A;  1DJN A;  3AEE A;  4U8I A;  4CNK A;  3UKQ A;  2GQF A;  1NHS A;  1IUU A;  2R0G A;  2WP9 A;  4KPR A;  5DBJ A;  5LV9 A;  2YLS A;  2XFQ A;  3LB8 A;  1YQZ A;  1N4U A;  3B6D A;  4GAP A;  3SM8 A;  4NNJ A;  4EIP A;  1MXT A;  3P4P A;  1GAL A;  2VVL A;  3SFD A;  3UOZ A;  1ZY8 A;  3DME A;  3DGH A;  4JY3 A;  3NYE A;  2C65 A;  1E7P A;  2TPR A;  2VQ7 A;  3FPZ A;  1ZOY A;  3RP6 A;  2WU2 A;  1PJ6 A;  5M0Z A;  4DSG A;  4RG4 A;  2BAC A;  1D4E A;  3HYW A;  2HQM A;  1KFY A;  1ZKQ A;  3AE8 A;  1JEH A;  1TYT A;  3RED A;  1LVL A;  3ICT A;  2GB0 A;  3ALM A;  4G6G A;  3SQP A;  1O95 A;  2YM2 A;  1ZDL A;  1NAA A;  4BK1 A;  3NGC X;  3COX A;  2XVI A;  1F6M A;  5FS9 A;  4X4J A;  4XWZ A;  3UOY A;  4OPG A;  1RYI A;  3KA7 A;  4H4S A;  2XFP A;  4G6H A;  1JRY A;  2BS2 A;  2RGJ A;  1JOA A;  1RSG A;  4JY2 A;  3ICR A;  4B64 A;  4HA6 A;  2WP5 A;  4ZN0 A;  5EB4 A;  3AD8 B;  3D1C A;  3P4Q A;  1RP0 A;  3AD9 B;  3KD9 A;  4YTP A;  3NTD A;  3UKK A;  3NYC A;  1YQ4 A;  3AE1 A;  4EQS A;  3BNU A;  1B8S A;  4YXD A;  4K2X A;  1EBD A;  3VR8 A;  5JCK A;  3SZC A;  1VG9 A;  3GDP A;  4H4U A;  1CL0 A;  2BS4 A;  3HZL A;  2R9Z A;  3CNS A;  2VRL A;  4XWR A;  3K7Q X;  3O0H A;  2WDQ A;  3QVR A;  2WQY A;  4B67 A;  3F8P A;  4J57 A;  2QA1 A;  4EQX A;  3K7T A;  1L9D A;  4I58 A;  4EM4 A;  4J56 A;  3DK4 A;  4RG3 A;  1BF3 A;  3PVC A;  2BYB A;  1Z6L A;  2C75 A;  4IV9 A;  4TM0 A;  3T37 A;  1LTX R;  2XVH A;  3QFB A;  4YWO A;  2CDU A;  3EF6 A;  4AOS A;  2WHD A;  2B7R A;  1GT8 A;  2YG4 A;  3IC9 A;  3NTA A;  4FK1 A;  4OPC A;  5FMH A;  2YR4 A;  2C67 A;  4A9W A;  3AEF A;  3CMM A;  4YSH A;  2XVF A;  4YSY A;  4D03 A;  2YR6 A;  4EMI A;  2FJB A;  1PJ7 A;  3S5W A;  2WS3 A;  1H86 A;  4B63 A;  3DH9 A;  1JU2 A;  4BJZ A;  1D4D A;  3I6D A;  5M10 A;  2BAB A;  4A6N B;  2APG A;  4G73 A;  1ZMD A;  3K7M X;  1REO A;  1FEB A;  1LQU A;  4H2R A;  4O5U A;  2GRT A;  2XYO A;  4A6N A;  3UTH A;  4DGK A;  1E39 A;  1GRB A;  3AEG A;  2GH5 A;  1LV0 A;  3BI5 A;  4ZCC A;  5FS7 A;  3VQR A;  1YQ3 A;  2YLT A;  1K0I A;  2GR1 A;  4GF7 A;  1GSN A;  3VRB A;  1DXL A;  4TM1 A;  3QSE A;  2XFU A;  3GDN A;  4U2L A;  2XLS A;  3L8K A;  1F3P A;  3UKP A;  2V6O A;  3DJD A;  5EOW A;  3I3L A;  4OPT A;  4JNA A;  1ZOV A;  4U8K A;  1FOH A;  3H8L A;  3ZYX A;  3NYF A;  2QA2 A;  4FX9 A;  4H4Y A;  1PXA A;  1BWC A;  2JK6 A;  3Q6J A;  3AE5 A;  3UKF A;  4KX6 A;  5CQF A;  1FL2 A;  2ZBW A;  3DK8 A;  1PBE A;  2X99 A;  2YG5 A;  2WP6 A;  1PBD A;  3AE9 A;  4JNQ A;  5TR3 A;  5CKU A;  1XDI A;  5KVH A;  2J3N A;  5HHF A;  3GD3 A;  2YWL A;  2AR8 A;  4YSX A;  2V3A A;  4H2Q A;  2GMJ A;  3L1R A;  3PS9 A;  4AT2 A;  2WEU A;  3HYV A;  2XFO A;  1LJ1 A;  3URH A;  5KVI A;  2WET A;  3QVP A;  2RAB A;  4Y4N A;  3UKA A;  1CC2 A;  1OJ9 A;  2FJA A;  2X3N A;  2Y6Q A;  3T2Z A;  4CBQ A;  5C2T A;  4B68 A;  2BK3 A;  3AYI A;  4YTN A;  5KWF A;  4LA1 A;  2A89 A;  2VVM A;  2VVL G;  1K0J A;  2DKH A;  4GR1 A;  4JN9 A;  1PN0 A;  4MJW A;  4UP3 A;  4II3 A;  1O5W A;  2BC0 A;  1CHU A;  2JKC A;  2UZZ A;  4K7Z A;  3C4N A;  4K22 A;  1S3E A;  4NEV A;  1AOG A;  2YG6 A;  4TM3 A;  3UOV A;  4Z2U A;  3ADA B;  3SZW A;  3AED A;  4P9S A;  2O9Z A;  3NK0 X;  3BNM A;  4H4X A;  1VQW A;  5KOX A;  3IF9 A;  3C4A A;  1GRG A;  2XFN A;  3E1T A;  3FIM B;  3F8R A;  5KMP A;  2ZZ0 A;  1P2E A;  3AWI A;  4OPI A;  2EQ6 A;  1KDG A;  2OAL A;  1UKV G;  1W4X A;  3IWA A;  2BRY A;  1EL5 A;  5IQ1 A;  5C3J A;  3R9U A;  1D4C A;  2E1M A;  1GRF A;  2GF3 A;  4BJY A;  4U8J A;  5KNL A;  4II2 A;  4GDP A;  2EQ7 A;  3M0O A;  4TLZ A;  4C3X A;  3HYX A;  2A87 A;  2BRA A;  3NK2 X;  3NN0 X;  1P2H A;  2V3B A;  4C74 A;  3GRS A;  3RHA A;  1BGN A;  1VDC A;  1MO9 A;  1GRE A;  1GPE A;  2R4E A;  1H81 A;  5KRQ A;  4EIQ A;  2CUL A;  1TDE A;  1E1K A;  5EB5 A;  1QLB A;  1ELI A;  2Q0K A;  1K0L A;  3CNJ A;  3DJJ A;  3NHO X;  4UDR A;  1SEZ A;  2EQ8 A;  2JB1 A;  4PAB A;  2FBW A;  1QO8 A;  2RGO A;  5JCN A;  1IUX A;  3UKL A;  3GMB A;  3K30 A;  2WES A;  5HY5 A;  3P1W A;  1KSS A;  2BA9 A;  3UP5 A;  3LAD A;  1GOS A;  3FBS A;  2BC1 A;  4OPD A;  4H4P A;  1S3B A;  3SX6 A;  1PXC A;  1PDH A;  3JSK A;  2GAH B;  4DSH A;  1PBC A;  2ARD A;  3VRD B;  2B9W A;  1CC6 A;  2XLT A;  4J34 A;  3RP8 A;  3AXB A;  1CBO A;  2XVJ A;  4CY6 A;  3CPJ G;  2IVE A;  2EQ9 A;  2GMH A;  2VZ2 A;  4AOX A;  2V61 A;  4Z44 A;  1KNR A;  3EAN A;  3P4S A;  1GEU A;  5GSN A;  2C7G A;  5U25 A;  5BRT A;  2C72 A;  4H7U A;  1GRT A;  4D04 A;  2VOU A;  3LXD A;  4USQ A;  1E1M A;  1ONF A;  4CY8 A;  2XLR A;  4E0V A;  2BK4 A;  3AEB A;  3F8D A;  3LZW A;  2OA1 A;  3DGZ A;  4YKG A;  4U8P A;  1Y0P A;  3Q9T A;  1E6E A;  1PJ5 A;  3QFA A;  3BI2 A;  3LJP A;  3UKH A;  5JCI A;  1LQT A;  3S61 A;  4Y4L A;  1N1P A;  4H4Q A;  2QAE A;  1V59 A;  4B66 A;  3NRN A;  4GDE A;  1NG3 A;  1JRZ A;  4IVM B;  3AEC A;  3GD4 A;  2DKI A;  2QCU A;  3GWF A;  2YG7 A;  3DJE A;  1BGJ A;  2C64 A;  1GV4 A;  2X50 A;  3ATQ A;  2VQB A;  1L9C A;  4CNJ A;  2C70 A;  3EAO A;  1E1N A;  1FEC A;  2WDV A;  3AE4 A;  2YG3 A;  3UCL A;  4H4T A;  4USR A;  2V60 A;  3H4K A;  5IQ4 A;  4K5S A;  3CIR A;  3T31 A;  5KMR A;  2BXR A;  3UOX A;  3NK1 X;  1PHH A;  4H4V A;  4YKF A;  3P9U A;  2YVF A;  1L0V A;  4X9M A;  2NVK X;  4U8M A;  3G5R A;  2YLR A;  3CGC A;  5L46 A;  1ZK7 A;  4RSL A;  4BK2 A;  4B69 A;  1GND A;  1H7W A;  3AE6 A;  4N9X A;  1GXF A;  1CJ2 A;  2YM1 A;  2PHH A;  2YVJ A;  3ISH A;  4J31 A;  2W0H A;  1H6V A;  3KVE A;  4WCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...