4GF7A

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco), unliganded form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
370
Chain Sequence
b'KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
molecule tags Oxidoreductase
source organism Mesorhizobium loti
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
total genus 127
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4gf7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gf7A01
2R45A 2ZZ0A 5KOXA 3DH9A 4LU6A 3DK8A 4E0VA 3EPTA 3UCLA 3NN0X 1MO9A 2B9XA 4GCMA 2GV8A 3V76A 3UOZA 4K8DA 3NK2X 2YG4A 4EQSA 2GR3A 1S3BA 4OCGA 3AE1A 2YG6A 2WESA 1D4EA 4OPGA 2YVJA 3KD9A 1ZX9A 1RSGA 1HYUA 2IIDA 4IVMB 2XVEA 4EM3A 1GTEA 3AE2A 1GRBA 2A89A 1OJ9A 1N1PA 1PBBA 2BABA 2Q7VA 3CPHG 4UDQA 2XVHA 3RP6A 3EANA 1VDCA 1H82A 1KNRA 2C64A 1L9EA 3COXA 4BV6A 3FPZA 2YG5A 3M13A 3UKQA 4P9SA 3IF9A 2CVJA 4DGKA 2GMJA 1ZK7A 3IC9A 1AOGA 5EB5A 2BXRA 2R4JA 4K2XA 3PS9A 3NH3X 1ZY8A 3II4A 2GVCA 1B37A 1NHRA 2X8GA 1JOAA 2XVFA 3JSKA 5BULA 3I6DA 4TM3A 1K0IA 1H81A 1ZMDA 4OPUA 4TLXA 2YAUA 3P4SA 4H4UA 1CJ4A 4H4SA 1UKVG 2RGHA 2QA1A 3F8PA 1NDAA 3AE3A 3AE5A 3P4RA 2X8CA 2YM1A 3CNTA 1IUVA 4TLZA 2XFUA 2VQ7A 3PO7A 3NTAA 4B69A 1TDOA 1O94A 1F3PA 4FX9A 1GRHA 2FJAA 2RABA 5KVHA 4UDPA 2XLRA 4HB9A 3H8LA 3ICRA 3ZDNA 2EQ8A 4IA6A 3M12A 2WEUA 2YM2A 2C72A 2VVLG 3AYJA 1XPQA 2WP9A 5TR3A 1W4XA 3BI5A 1L9DA 1PXCA 1NHPA 4O5QA 4AP1A 3CPJG 3UKFA 1EL9A 3NHOX 2Y6QA 3G5RA 1DOEA 4IVOB 4YSXA 2C73A 4J36A 4Z2RA 1DXLA 2GR1A 4JQ9A 2OALA 2GRTA 1VQWA 3ATRA 1H7XA 4X4JA 3AECA 2GQWA 2UZZA 3D8XA 3DJDA 3NYFA 1GTHA 5IQ4A 3EAOA 1DJQA 4C5OA 2I0ZA 2XLSA 2OLNA 2OAMA 2QA2A 2C66A 4H4XA 3UKLA 4JNQA 3CPIG 4BK1A 3H8IA 1TYPA 2YQUA 4U8OA 2J3NA 1ZOVA 1LQTA 2XFNA 2O9ZA 4KPRA 5ER0A 4DSHA 3AD8B 5JCIA 4J34A 3ABVA 3BHFA 1H84A 2VVMA 1S3EA 2VQBA 1IUXA 4B64A 1YQZA 3VRBA 3GYIA 1PJ5A 2TMDA 4Z2UA 3GMCA 1N4VA 2V3BA 2JKCA 4K5RA 2XDOA 4U8IA 4Z44A 2DKHA 5BVAA 4EMIA 4A9WA 4OPDA 4A6NA 3NK1X 1IJHA 4H2QA 2AR8A 4BURA 2R0CA 1Y56A 2C67A 3AXBA 4U8LA 3BI4A 3CGEA 2EQ7A 5U1OA 5U63A 4ZCDA 4C77A 3AWIA 3D1CA 1GEUA 4YXDA 1GXFA 5M10A 2GMHA 3QJ4A 3UOXA 1PBCA 1YQ3A 2WP5A 2XFPA 1JNRA 1Q1WA 2XYOA 3IHGA 4J56A 2BK3A 1GT8A 2IVEA 5CQFA 4D03A 4GR1A 4J57A 2WP6A 4X9NA 1GRGA 2B9WA 1EL5A 1NPXA 2XLUA 3DJEA 2NVKX 2APGA 2WU2A 1B8SA 2PHHA 3B6DA 3I3LA 2Q0KA 3AYLA 3LADA 3NRNA 4A5LA 2BYBA 1FEBA 3KPFA 1LJ1A 2CULA 1GERA 1D5TA 2BS3A 3LOVA 4BJZA 1N4WA 2XVJA 1NENA 1ZOYA 2E4GA 3CTYA 3F8RA 4B65A 1JRYA 4BJYA 1VG0A 4U8PA 1GALA 3K30A 2WBAA 3RHAA 3NTDA 1KFYA 2WS3A 2GAHB 3DMEA 3SFEA 1S2YA 1GESA 2B7SA 4JDRA 3NN6X 4LA1A 4Y4MA 4BK3A 3O0HA 4B67A 2XFOA 4EQXA 1VRQB 1F8WA 3ATQA 3V3NA 3AD9B 1GNDA 4YTMA 2ACZA 1OJDA 5JCNA 2C76A 1IUUA 1CBOA 3E1TA 2XFQA 2VVLA 1EBDA 2CDUA 2BC0A 2AAQA 1P2HA 2WETA 3GWDA 1Q1RA 4DNAA 1TDEA 3NGCX 3Q9TA 1EL8A 1E39A 3DGHA 3P1WA 4YWOA 1GETA 2YR6A 2BS4A 3UKKA 2YR4A 2A87A 3CGCA 3FBSA 1NG3A 4A99A 2X50A 4A6NB 3CNDA 2B76A 3RP8A 5L46A 4C3XA 1Z6LA 4JY3A 3DK4A 4AOXA 1NHQA 1DNCA 1MOKA 2Q6UA 3VRAA 4YKFA 4EIPA 1YKJA 3LXDA 3PVCA 2DKIA 3LB8A 4YT0A 1E7PA 4GUVA 4UDRA 3UKAA 1M6IA 4U8MA 1B5QA 3B3RA 2XLTA 3NNEA 4XWRA 1PBDA 1BGNA 4RSLA 1X31B 1PS9A 4O5UA 1KDGA 1JRZA 1FOHA 3DJJA 3BNUA 2BK4A 2FBWA 2ZZBA 3QSSA 3AEDA 1S2QA 3AD7B 1PDHA 4AT2A 1XHCA 3AEBA 1OJCA 1DODA 2A8XA 3AEFA 4YSYA 4YTNA 3C4NA 4C74A 2XLPA 5JCMA 1YQ4A 4FK1A 1FCDA 3BNMA 1CF3A 5DBJA 4J2WA 3CNPA 2BXSA 1GRFA 2YR5A 4WCTA 2EQ6A 3SM8A 3UTEA 2WQYA 4CY6A 1FECA 3P9UA 4EMWA 3NLCA 1V59A 1KSSA 1P2EA 2V61A 4LIIA 4Z24A 2GF3A 2XCGA 1KSUA 3FG2P 1Q9IA 1LVLA 1PXAA 1VG9A 2AQJA 2YLTA 4NEWA 5LV9A 2C3DA 4REKA 5C2TA 4U8KA 3SGLA 4EQWA 2R0PA 5HYMA 2EQ9A 4H4YA 2WDVA 4A7AA 4H2PA 5IPYA 2XVIA 4GF7A 3QSMA 5KVIA 4Z43A 5J60A 2E5VA 4A65A 2C3CA 2YLXA 2F5ZA 3AYIA 1CJCA 5KRQA 3RP7A 4Z2TA 1ZDLA 2Z5YA 4U8JA 5FS6A 5FS7A 3ITJA 3NYEA 4H4VA 2GH5A 1NG4A 3QFBA 1LPFA 2H89A 4I58A 3T37A 1FEAA 4ZCCA 5KWFA 3KKJA 3UOYA 4Y4LA 4CCRA 1Y0PA 4B66A 2B9YA 1GSNA 2Q0LA 4U2SA 3S5WA 5BRTA 3URHA 2RGOA 4NTDA 4Z26A 2WOWA 3GMBA 1RP0A 3NK0X 4OVIA 4I59A 3GD3A 4NEVA 3FMWA 1E1LA 3LZWA 2GEWA 3CNSA 2R46A 4H2NA 5J7XA 2WHDA 1GPEA 2Z5XA 4H4RA 5FS9A 1TDNA 4X9MA 3ZYXA 4B63A 1M64A 4U8NA 4J31A 2GR0A 4B1BA 1BGJA 1E1MA 5M0ZA 1PBEA 4TM4A 2C65A 2WOVA 4PAAA 1DOCA 4EIQA 5GSNA 5HXIA 2GQFA 3VRDB 1BZLA 1F8RA 4FDCB 3P4QA 3G5SA 1BF3A 4USRA 3H4KA 3REDA 3DGZA 4AOSA 2C70A 1OJTA 1PHHA 2JBVA 4CRTA 2BCPA 3NYCA 4MJWA 3GRSA 1N4UA 1L0VA 4CNKA 2R0GA 1MXTA 1QLBA 1SEZA 2YLWA 3BHKA 2JAEA 4H4PA 2FJDA 4PABA 2GAGB 3V3OA 4YSZA 4D04A 1JRXA 4XWZA 3ISHA 1LQUA 1K4QA 1TDKA 1F6MA 3K7TA 3NG7X 1GREA 4AP3A 1GV4A 1IUTA 1ZMCA 2YG3A 4OPCA 4K5SA 3BI2A 3LZXA 4GRTA 4U2TA 3SQPA 1F8SA 4APNA 2B7RA 1JU2A 1QO8A 2WPCA 2V60A 4HA6A 4EM4A 1CC2A 3DA1A 4H4QA 1NAAA 2BK5A 3GDPA 1GRTA 2VRMA 2ARDA 5HHFA 5KXJA 3CGBA 3DK9A 4Y4NA 2JB3A 3NKSA 3P4PA 1DJNA 3QFAA 3UOVA 4H4TA 3SFDA 1KF6A 3OC4A 2JB1A 2ZZCA 3ALMA 3IWAA 4WX1A 4CBQA 4NTCA 2E1MA 3L1RA 3IHMA 3CN8A 3GYJA 1O95A 1H86A 5FS8A 2X99A 1CL0A 1PN0A 1E1NA 2R4EA 4CNJA 4K22A 3EF6A 4ADWA 3K7QX 3DJGX 3KVEA 4JY2A 2FJBA 3KU9A 4IV9A 2WOIA 4GDEA 4EMJA 1K0JA 4H4WA 1NHSA 4A79A 1YY5A 3Q6JA 3KA7A 2FJEA 3AE9A 3FIMB 1D7YA 2QCUA 4OPLA 3ALLA 3CNJA 3VR8A 2X3NA 2PYXA 2JK6A 1REOA 3ICSA 5KOWA 5FMHA 1EL7A 2YLSA 1H83A 5GRTA 4TM0A 3UP4A 2BCGG 2NPXA 1K0LA 3NIXA 3UTHA 2R9ZA 2BA9A 1PXBA 4NTEA 1XDIA 3AE6A 3QVRA 2OA1A 4IA5A 4U2LA 2OLOA 5EB4A 3QVPA 4BK2A 3UKHA 2V5ZA 1D7LA 2WPEA 3AE7A 3GD4A 4ICYA 1E1KA 4OPTA 1CC6A 1COYA 2VRLA 4N9XA 2IVDA 2BS2A 2X8HA 1BKWA 4YSHA 4GDPA 3G5QA 4OPIA 1PBFA 4YTPA 4ZN0A 2GR2A 1FL2A 2HQMA 3HZLA 4KX6A 1GRAA 1IUWA 1CJ3A 3ICTA 3ALJA 1BWCA 2V3AA 3GDNA 3RNMA 3UP5A 3VR9A 4H2RA 4M52A 4AT0A 2JB2A 2YVGA 4J33A 3AB1A 4C3YA 1LV0A 1H7WA 1H6VA 5BUKA 1B4VA 3UTGA 1LTXR 1JNZA 2H88A 1E6EA 1ZKQA 2ZBWA 2BACA 4UP3A 4YKGA 3GSIA 2WDRA 5IQ1A 3S61A 3VQRA 2C7GA 1CHUA 1L9CA 4FK1C 5U25A 1GOSA 2WDQA 3UKPA 2QAEA 4XXGA 2TPRA 2W0HA 3AEAA 2Y6RA 3ADAB 4H50A 3AEGA 5JCKA 1DOBA 5C3JA 2BC1A 4TM1A 1CC4A 2CFYA 1O5WA 3AE4A 1CJ2A 2WPFA 1Y56B 3CGDA 4CCQA 5JCLA 3UTFA 4K7ZA 5HY5A 3WE0A 3R9UA 4CY8A 1TYTA 1XANA 2GB0A 2RGJA 4Z25A 1D4DA 3CIRA 3OZ2A 4DSGA 4JN9A 2VZ2A 2V6OA 4RG4A 4ECHA 4H4ZA 1PJ6A 4EQRA 2VOUA 3M0OA 1OJAA 1PJ7A 2YG7A 4USQA 1JEHA 3L8KA 5EOWA 2YWLA 1NEKA 3AE8A 3LJPA 3GRTA 5CKUA 1ELIA 1QJDA 3GWFA 4RG3A 1RYIA 2YVFA 1IUSA 1TRBA 4NZHA 3NT6A 4JNAA 5EBKA 3K7MX 3QSEA 2C75A 1ONFA 4H7UA 1ZP0A 2WU5A 1KNPA 2YLZA 2YLRA 3AEEA 3C96A 3KLJA 4B68A 1D4CA 1TDFA 3F8DA 3C4AA
chains in the Genus database with same CATH superfamily
2R45A 2ZZ0A 5KOXA 3DH9A 4LU6A 3DK8A 1KIFA 4E0VA 3EPTA 3UCLA 3NN0X 1MO9A 4G9KA 2B9XA 4GCMA 2GV8A 3V76A 3UOZA 4K8DA 3NK2X 2YG4A 4EQSA 2GR3A 1S3BA 4OCGA 3AE1A 2YG6A 2WESA 1D4EA 4OPGA 2YVJA 3KD9A 1ZX9A 1RSGA 1HYUA 2IIDA 4IVMB 2XVEA 4EM3A 1GTEA 3AE2A 2A89A 1GRBA 1OJ9A 1PBBA 1N1PA 2BABA 2Q7VA 3CPHG 4UDQA 3SYIA 2XVHA 3RP6A 3EANA 1VDCA 1H82A 1KNRA 2C64A 1L9EA 2C4CA 3COXA 4BV6A 3FPZA 2YG5A 3T2ZA 3M13A 3UKQA 4P9SA 3IF9A 2CVJA 4DGKA 2GMJA 1ZK7A 3IC9A 1AOGA 5EB5A 2BXRA 2R4JA 4K2XA 3PS9A 3NH3X 1ZY8A 3II4A 2GVCA 1B37A 1NHRA 2X8GA 1JOAA 2XVFA 3JSKA 5BULA 3I6DA 4TM3A 1K0IA 1H81A 1ZMDA 4OPUA 4TLXA 2YAUA 3P4SA 4H4UA 1CJ4A 4H4SA 1UKVG 2RGHA 2QA1A 3F8PA 1NDAA 3AE3A 4G73A 3ZNQA 3AE5A 3P4RA 2X8CA 2YM1A 3CNTA 3ZNNA 1IUVA 4TLZA 2XFUA 2VQ7A 3PO7A 3NTAA 4B69A 1TDOA 1O94A 1F3PA 4FX9A 3SX6A 1GRHA 2FJAA 2RABA 5KVHA 4UDPA 2XLRA 4HB9A 3H8LA 3ICRA 3ZDNA 2EQ8A 4IA6A 3M12A 2WEUA 2YM2A 2C72A 2VVLG 3AYJA 1XPQA 2WP9A 5TR3A 2BRAA 1W4XA 3BI5A 1L9DA 1PXCA 1NHPA 4O5QA 4AP1A 3CPJG 3UKFA 1EL9A 3NHOX 2Y6QA 3G5RA 1DOEA 4IVOB 4YSXA 2C73A 4J36A 4Z2RA 5KMPA 1DXLA 2GR1A 4JQ9A 2OALA 2GRTA 1VQWA 3ATRA 1H7XA 4X4JA 3AECA 3DJDA 2UZZA 3NYFA 2GQWA 3D8XA 1GTHA 5IQ4A 3EAOA 1DJQA 4C5OA 2I0ZA 2XLSA 2OLNA 2OAMA 2QA2A 2C66A 4H4XA 3SXIA 3UKLA 4JNQA 4BK1A 3CPIG 3H8IA 1TYPA 2YQUA 4U8OA 2J3NA 1ZOVA 1LQTA 2XFNA 2O9ZA 4KPRA 5ER0A 4DSHA 3AD8B 5JCIA 4J34A 3BHFA 3ABVA 3T31A 1H84A 2VVMA 1S3EA 2VQBA 1IUXA 4B64A 1YQZA 4GAPA 1DDOA 3VRBA 3GYIA 1PJ5A 2TMDA 4Z2UA 3GMCA 1N4VA 2V3BA 2JKCA 4K5RA 2XDOA 4U8IA 4Z44A 2DKHA 5BVAA 4EMIA 4A9WA 4OPDA 4A6NA 3NK1X 1IJHA 4H2QA 2AR8A 4BURA 2R0CA 1Y56A 3AXBA 2C67A 4U8LA 3HYVA 3BI4A 3CGEA 2EQ7A 5U1OA 5U63A 4ZCDA 4C77A 3AWIA 3D1CA 1GEUA 4YXDA 1GXFA 5M10A 2GMHA 3QJ4A 3UOXA 4NWZA 1PBCA 1YQ3A 2WP5A 2XFPA 1JNRA 1Q1WA 2XYOA 3IHGA 4J56A 2BK3A 1GT8A 2IVEA 5CQFA 4D03A 4GR1A 4J57A 4X9NA 2WP6A 1GRGA 2B9WA 1EL5A 3DJEA 1NPXA 2XLUA 2NVKX 2APGA 2WU2A 2PHHA 1B8SA 3B6DA 3I3LA 2Q0KA 3AYLA 3LADA 3NRNA 4A5LA 2BYBA 1FEBA 3KPFA 1LJ1A 2CULA 1GERA 1D5TA 2BS3A 3LOVA 4BJZA 1N4WA 4YJHB 1NENA 1ZOYA 2E4GA 2XVJA 3CTYA 3F8RA 4B65A 4BJYA 1JRYA 1VG0A 4U8PA 1GALA 3K30A 2WBAA 3RHAA 4YJHA 3NTDA 1KFYA 2WS3A 2GAHB 3DMEA 3SFEA 1S2YA 1GESA 2B7SA 4JDRA 3NN6X 4LA1A 4BK3A 4Y4MA 3O0HA 4B67A 2XFOA 3SZWA 4EQXA 1VRQB 1F8WA 3ATQA 3CUKA 3V3NA 3AD9B 1GNDA 4YTMA 2ACZA 1OJDA 5JCNA 2C76A 1IUUA 1CBOA 3E1TA 2XFQA 3KPKA 2VVLA 1EBDA 2CDUA 2BC0A 2AAQA 1P2HA 4YJFA 2WETA 3GWDA 2E48A 1Q1RA 1TDEA 4DNAA 3NGCX 3SY4A 3Q9TA 1EL8A 1E39A 3DGHA 3P1WA 4YWOA 1GETA 2YR6A 2BS4A 3UKKA 2YR4A 2A87A 3CGCA 3FBSA 1NG3A 4A99A 2X50A 4A6NB 3CNDA 2B76A 3RP8A 5L46A 4C3XA 4NNJA 1AN9A 4JY3A 1Z6LA 3DK4A 3ZNPA 1NHQA 4AOXA 1DNCA 3T2KA 1MOKA 2Q6UA 3VRAA 4YKFA 1YKJA 4EIPA 3LXDA 3PVCA 3T2YA 2DKIA 3LB8A 4YT0A 1E7PA 4GUVA 4UDRA 3UKAA 1M6IA 4U8MA 1B5QA 3B3RA 2XLTA 3NNEA 4XWRA 1PBDA 1BGNA 4RSLA 1X31B 1PS9A 4O5UA 5KMSA 1KDGA 1JRZA 1FOHA 4GAVA 3DJJA 3BNUA 2BK4A 5KNLA 2FBWA 2ZZBA 3QSSA 4II3A 3AEDA 1S2QA 3AD7B 1PDHA 4AT2A 1XHCA 3AEBA 1OJCA 1DODA 2A8XA 3AEFA 4YSYA 4YTNA 3C4NA 4C74A 2XLPA 5JCMA 1YQ4A 4FK1A 1FCDA 3BNMA 1CF3A 5DBJA 4J2WA 3CNPA 3SZ0A 2BXSA 1GRFA 2YR5A 4WCTA 2EQ6A 3SM8A 3UTEA 2WQYA 4CY6A 1FECA 3P9UA 4EMWA 3NLCA 2E82A 1V59A 1KSSA 1P2EA 2V61A 4LIIA 4Z24A 2GF3A 2XCGA 3ZNOA 1KSUA 3FG2P 1Q9IA 1PXAA 1LVLA 1VG9A 2AQJA 2YLTA 4NEWA 5LV9A 2C3DA 4REKA 2DU8A 5C2TA 4U8KA 3SGLA 4EQWA 2R0PA 1C0KA 5HYMA 2EQ9A 4H4YA 2WDVA 4A7AA 4H2PA 5IPYA 2XVIA 3QSMA 4GF7A 5KVIA 4Z43A 5J60A 2E5VA 4A65A 2C3CA 2YLXA 2F5ZA 3AYIA 1C0LA 1CJCA 5KRQA 3RP7A 4Z2TA 1ZDLA 2Z5YA 4U8JA 5FS6A 5FS7A 3NYEA 3ITJA 4H4VA 2GH5A 1NG4A 3QFBA 1LPFA 2H89A 4I58A 3T37A 1FEAA 4ZCCA 5KWFA 3KKJA 3UOYA 4Y4LA 4CCRA 1Y0PA 4B66A 3GYXA 2B9YA 1GSNA 2Q0LA 4U2SA 3S5WA 5BRTA 3URHA 2RGOA 4NTDA 4Z26A 2WOWA 3GMBA 1RP0A 3NK0X 4OVIA 4I59A 3GD3A 4NEVA 3FMWA 1E1LA 3LZWA 3T0KA 2GEWA 3CNSA 2R46A 4H2NA 5J7XA 2WHDA 1GPEA 2Z5XA 4H4RA 5FS9A 4X9MA 1TDNA 3ZYXA 4B63A 1M64A 1EVIA 4U8NA 4J31A 2GR0A 4B1BA 1BGJA 1E1MA 5M0ZA 3HYWA 1PBEA 4TM4A 2C65A 2WOVA 4PAAA 1DOCA 4EIQA 2E4AA 5HXIA 2GQFA 4G6GA 5GSNA 3VRDB 1BZLA 1F8RA 4FDCB 3P4QA 3G5SA 1BF3A 4USRA 3H4KA 3REDA 3DGZA 4AOSA 2C70A 1OJTA 3SZCA 1PHHA 2JBVA 4CRTA 3NYCA 2BCPA 4MJWA 3GRSA 1N4UA 1L0VA 4CNKA 2R0GA 1QLBA 1SEZA 3BHKA 4PABA 1MXTA 2JAEA 2YLWA 2FJDA 4H4PA 2GAGB 5KMQA 3V3OA 4YSZA 3G3EA 4D04A 1JRXA 2BRYA 4XWZA 3ISHA 1LQUA 1K4QA 1TDKA 1F6MA 3K7TA 3NG7X 1GREA 4AP3A 1GV4A 1IUTA 1ZMCA 2YG3A 4OPCA 4K5SA 3BI2A 3LZXA 4GRTA 4U2TA 3SQPA 1F8SA 4APNA 2B7RA 1JU2A 1QO8A 2WPCA 2V60A 4HA6A 4EM4A 3DA1A 1CC2A 4H4QA 1NAAA 2BK5A 3GDPA 1GRTA 2VRMA 2ARDA 5HHFA 5KXJA 3SZFA 3CGBA 3DK9A 4Y4NA 2JB3A 3NKSA 3P4PA 1DJNA 3QFAA 3UOVA 4H4TA 3SFDA 1KF6A 3W4JA 2JB1A 3OC4A 2ZZCA 3ALMA 3IWAA 4WX1A 4CBQA 4NTCA 2E1MA 3L1RA 3IHMA 1VE9A 3CN8A 3GYJA 1O95A 1H86A 3HYXA 5FS8A 2X99A 1PN0A 2R4EA 1CL0A 1E1NA 4CNJA 4K22A 4YJFB 3EF6A 4ADWA 3CMMA 3K7QX 3DJGX 3KVEA 4JY2A 2FJBA 3KU9A 4IV9A 2WOIA 4GDEA 4EMJA 1K0JA 4H4WA 4G74A 1NHSA 4A79A 1YY5A 3Q6JA 3KA7A 4QFCA 2FJEA 3AE9A 3FIMB 1D7YA 2QCUA 4OPLA 3ALLA 4G6HA 3CNJA 3VR8A 4YJGB 3W4KA 2X3NA 2PYXA 2JK6A 1REOA 3ICSA 5KOWA 5FMHA 5KMRA 1EL7A 2YLSA 1H83A 5GRTA 4TM0A 3UP4A 2BCGG 2NPXA 1K0LA 3NIXA 3UTHA 2R9ZA 1C0IA 1PXBA 2BA9A 4NTEA 1XDIA 3AE6A 3QVRA 4IA5A 2OA1A 4U2LA 2OLOA 5EB4A 3W4IA 1DAOA 4BK2A 3QVPA 3UKHA 2V5ZA 1D7LA 2WPEA 3AE7A 3GD4A 4ICYA 4YJGA 1E1KA 1CC6A 1COYA 2VRLA 4OPTA 4N9XA 2IVDA 2BS2A 2X8HA 1C0PA 1BKWA 4YSHA 4GDPA 3G5QA 4OPIA 1PBFA 4YTPA 4ZN0A 2GR2A 1FL2A 3HZLA 2HQMA 4KX6A 1GRAA 1IUWA 1CJ3A 3ICTA 3ALJA 1BWCA 2V3AA 3GDNA 3RNMA 3UP5A 3VR9A 4H2RA 4M52A 4AT0A 2JB2A 2YVGA 4J33A 3AB1A 4C3YA 1LV0A 3T14A 1H7WA 1H6VA 5BUKA 1B4VA 3UTGA 1LTXR 1JNZA 2H88A 1E6EA 1ZKQA 2ZBWA 2BACA 4UP3A 4YKGA 3GSIA 2WDRA 5IQ1A 3S61A 3VQRA 2C7GA 1L9CA 1CHUA 4FK1C 5U25A 1GOSA 2WDQA 3UKPA 2QAEA 4XXGA 2TPRA 2W0HA 4II2A 3AEAA 2Y6RA 3ADAB 4H50A 3AEGA 5JCKA 1DOBA 5C3JA 2BC1A 4TM1A 1CC4A 2CFYA 1O5WA 3AE4A 1CJ2A 4QFDA 1Y56B 2WPFA 3CGDA 4CCQA 5JCLA 3UTFA 4K7ZA 5HY5A 3WE0A 3R9UA 4CY8A 1TYTA 2RGJA 2GB0A 1XANA 4Z25A 1D4DA 3CIRA 3OZ2A 4DSGA 4JN9A 2VZ2A 2V6OA 4RG4A 4YJDA 4ECHA 4H4ZA 1PJ6A 4EQRA 2VOUA 3M0OA 1OJAA 1PJ7A 2YG7A 4USQA 1JEHA 3L8KA 5EOWA 2YWLA 1NEKA 2E49A 3AE8A 3LJPA 3GRTA 5CKUA 1ELIA 1QJDA 3GWFA 4RG3A 1RYIA 2YVFA 1IUSA 1TRBA 4NZHA 3NT6A 3WGTA 4JNAA 5EBKA 3QSEA 3K7MX 2C75A 1ONFA 4H7UA 1ZP0A 2WU5A 1KNPA 2YLZA 2YLRA 3AEEA 3C96A 3KLJA 4B68A 1D4CA 1TDFA 3F8DA 3C4AA
chains in the Genus database with same CATH topology
2R45A 2ZZ0A 5KOXA 3DH9A 4LU6A 3DK8A 4E0VA 3EPTA 3UCLA 3NN0X 1MO9A 4G9KA 2B9XA 4GCMA 2GV8A 3V76A 3UOZA 4K8DA 3NK2X 2YG4A 4EQSA 2GR3A 1S3BA 4OCGA 3AE1A 2YG6A 2WESA 1D4EA 4OPGA 2YVJA 3KD9A 1ZX9A 1RSGA 1HYUA 2IIDA 4IVMB 2XVEA 4EM3A 1GTEA 3AE2A 1GRBA 2A89A 1OJ9A 1N1PA 1PBBA 2BABA 2Q7VA 3CPHG 4UDQA 3SYIA 2XVHA 3RP6A 3EANA 1VDCA 1H82A 1KNRA 2C64A 1L9EA 2C4CA 3COXA 4BV6A 3FPZA 2YG5A 3T2ZA 3M13A 3UKQA 4P9SA 3IF9A 2CVJA 4DGKA 2GMJA 1ZK7A 3IC9A 1AOGA 5EB5A 2BXRA 2R4JA 4K2XA 3PS9A 3NH3X 1ZY8A 3II4A 2GVCA 1B37A 1NHRA 2X8GA 1JOAA 2XVFA 3JSKA 5BULA 3I6DA 4TM3A 1K0IA 1H81A 1ZMDA 4OPUA 4TLXA 2YAUA 3P4SA 4H4UA 1CJ4A 4H4SA 1UKVG 2RGHA 2QA1A 3F8PA 1NDAA 3AE3A 4G73A 3AE5A 3P4RA 2X8CA 2YM1A 3CNTA 1IUVA 4TLZA 2XFUA 2VQ7A 3PO7A 3NTAA 4B69A 1TDOA 1O94A 1F3PA 4FX9A 3SX6A 1GRHA 2FJAA 2RABA 5KVHA 4UDPA 2XLRA 4HB9A 3H8LA 3ICRA 3ZDNA 2EQ8A 4IA6A 3M12A 2WEUA 2YM2A 2C72A 2VVLG 3AYJA 1XPQA 2WP9A 5TR3A 2BRAA 1W4XA 3BI5A 1L9DA 1PXCA 1NHPA 4O5QA 4AP1A 3CPJG 3UKFA 1EL9A 3NHOX 2Y6QA 3G5RA 1DOEA 4IVOB 4YSXA 2C73A 4J36A 4Z2RA 5KMPA 1DXLA 2GR1A 4JQ9A 2OALA 2GRTA 1VQWA 3ATRA 1H7XA 4X4JA 3AECA 2GQWA 2UZZA 3D8XA 3DJDA 3NYFA 1GTHA 5IQ4A 3EAOA 1DJQA 4C5OA 2I0ZA 2XLSA 2OLNA 2OAMA 2QA2A 2C66A 4H4XA 3SXIA 3UKLA 4JNQA 4BK1A 3CPIG 3H8IA 1TYPA 2YQUA 4U8OA 2J3NA 1ZOVA 1LQTA 2XFNA 2O9ZA 4KPRA 5ER0A 4DSHA 3AD8B 5JCIA 4J34A 3ABVA 3BHFA 3T31A 1H84A 2VVMA 1S3EA 2VQBA 1IUXA 4B64A 1YQZA 4GAPA 3VRBA 3GYIA 1PJ5A 2TMDA 4Z2UA 3GMCA 1N4VA 2V3BA 2JKCA 4K5RA 2XDOA 4U8IA 4Z44A 2DKHA 5BVAA 4EMIA 4A9WA 4OPDA 4A6NA 3NK1X 1IJHA 4H2QA 2AR8A 4BURA 2R0CA 1Y56A 2C67A 3AXBA 4U8LA 3HYVA 3BI4A 3CGEA 2EQ7A 5U1OA 5U63A 4ZCDA 4C77A 3AWIA 3D1CA 1GEUA 4YXDA 1GXFA 5M10A 2GMHA 3QJ4A 3UOXA 4NWZA 1PBCA 1YQ3A 2WP5A 2XFPA 1JNRA 1Q1WA 2XYOA 3IHGA 4J56A 2BK3A 1GT8A 2IVEA 5CQFA 4D03A 4GR1A 4J57A 2WP6A 4X9NA 1GRGA 2B9WA 1EL5A 1NPXA 2XLUA 3DJEA 2NVKX 2APGA 2WU2A 1B8SA 2PHHA 3B6DA 3I3LA 2Q0KA 3AYLA 3LADA 3NRNA 4A5LA 2BYBA 1FEBA 3KPFA 1LJ1A 2CULA 1GERA 1D5TA 2BS3A 3LOVA 4BJZA 1N4WA 2XVJA 1NENA 1ZOYA 2E4GA 3CTYA 3F8RA 4B65A 4BJYA 1JRYA 1VG0A 4U8PA 1GALA 3K30A 2WBAA 3RHAA 3NTDA 1KFYA 2WS3A 2GAHB 3DMEA 3SFEA 1S2YA 1GESA 2B7SA 4JDRA 3NN6X 4LA1A 4BK3A 4Y4MA 3O0HA 4B67A 2XFOA 3SZWA 4EQXA 1VRQB 1F8WA 3ATQA 3V3NA 3AD9B 1GNDA 4YTMA 2ACZA 1OJDA 5JCNA 2C76A 1IUUA 1CBOA 3E1TA 2XFQA 3KPKA 2VVLA 1EBDA 2CDUA 2BC0A 2AAQA 1P2HA 2WETA 3GWDA 1Q1RA 4DNAA 1TDEA 3NGCX 3SY4A 3Q9TA 1EL8A 1E39A 3DGHA 3P1WA 4YWOA 1GETA 2YR6A 2BS4A 3UKKA 2YR4A 2A87A 3CGCA 3FBSA 1NG3A 4A99A 2X50A 4A6NB 3CNDA 2B76A 3RP8A 5L46A 4C3XA 4NNJA 1Z6LA 4JY3A 3DK4A 4AOXA 1NHQA 1DNCA 3T2KA 1MOKA 2Q6UA 3VRAA 4YKFA 4EIPA 1YKJA 3LXDA 3PVCA 3T2YA 2DKIA 3LB8A 4YT0A 1E7PA 4GUVA 4UDRA 3UKAA 1M6IA 4U8MA 1B5QA 3B3RA 2XLTA 3NNEA 4XWRA 1PBDA 1BGNA 4RSLA 1X31B 1PS9A 4O5UA 5KMSA 1KDGA 1JRZA 1FOHA 4GAVA 3DJJA 3BNUA 2BK4A 5KNLA 2FBWA 2ZZBA 3QSSA 4II3A 3AEDA 1S2QA 3AD7B 1PDHA 4AT2A 1XHCA 3AEBA 1OJCA 1DODA 2A8XA 3AEFA 4YSYA 4YTNA 3C4NA 4C74A 2XLPA 5JCMA 1YQ4A 4FK1A 1FCDA 3BNMA 1CF3A 5DBJA 4J2WA 3CNPA 3SZ0A 2BXSA 1GRFA 2YR5A 4WCTA 2EQ6A 3SM8A 3UTEA 2WQYA 4CY6A 1FECA 3P9UA 4EMWA 3NLCA 1V59A 1KSSA 1P2EA 2V61A 4LIIA 4Z24A 2GF3A 2XCGA 1KSUA 3FG2P 1Q9IA 1LVLA 1PXAA 1VG9A 2AQJA 2YLTA 4NEWA 5LV9A 2C3DA 4REKA 5C2TA 4U8KA 3SGLA 4EQWA 2R0PA 5HYMA 2EQ9A 4H4YA 2WDVA 4A7AA 4H2PA 5IPYA 2XVIA 4GF7A 3QSMA 5KVIA 4Z43A 5J60A 2E5VA 4A65A 2C3CA 2YLXA 2F5ZA 3AYIA 1CJCA 5KRQA 3RP7A 4Z2TA 1ZDLA 2Z5YA 4U8JA 5FS6A 5FS7A 3ITJA 3NYEA 4H4VA 2GH5A 1NG4A 3QFBA 1LPFA 2H89A 4I58A 3T37A 1FEAA 4ZCCA 5KWFA 3KKJA 3UOYA 4Y4LA 4CCRA 1Y0PA 4B66A 3GYXA 2B9YA 1GSNA 2Q0LA 4U2SA 3S5WA 5BRTA 3URHA 2RGOA 4NTDA 4Z26A 2WOWA 3GMBA 1RP0A 3NK0X 4OVIA 4I59A 3GD3A 4NEVA 3FMWA 1E1LA 3LZWA 3T0KA 2GEWA 3CNSA 2R46A 4H2NA 5J7XA 2WHDA 1GPEA 2Z5XA 4H4RA 5FS9A 1TDNA 4X9MA 3ZYXA 4B63A 1M64A 4U8NA 4J31A 2GR0A 4B1BA 1BGJA 1E1MA 5M0ZA 3HYWA 1PBEA 4TM4A 2C65A 2WOVA 4PAAA 1DOCA 4EIQA 5GSNA 5HXIA 2GQFA 4G6GA 3VRDB 1BZLA 1F8RA 4FDCB 3P4QA 3G5SA 1BF3A 4USRA 3H4KA 3REDA 3DGZA 4AOSA 2C70A 1OJTA 3SZCA 1PHHA 2JBVA 4CRTA 2BCPA 3NYCA 4MJWA 3GRSA 1N4UA 1L0VA 4CNKA 2R0GA 1MXTA 1QLBA 1SEZA 2YLWA 3BHKA 2JAEA 4H4PA 2FJDA 4PABA 2GAGB 5KMQA 3V3OA 4YSZA 4D04A 1JRXA 2BRYA 4XWZA 3ISHA 1LQUA 1K4QA 1TDKA 1F6MA 3K7TA 3NG7X 1GREA 4AP3A 1GV4A 1IUTA 1ZMCA 2YG3A 4OPCA 4K5SA 3BI2A 3LZXA 4GRTA 4U2TA 3SQPA 1F8SA 4APNA 2B7RA 1JU2A 1QO8A 2WPCA 2V60A 4HA6A 4EM4A 1CC2A 3DA1A 4H4QA 1NAAA 2BK5A 3GDPA 1GRTA 2VRMA 2ARDA 5HHFA 5KXJA 3SZFA 3CGBA 3DK9A 4Y4NA 2JB3A 3NKSA 3P4PA 1DJNA 3QFAA 3UOVA 4H4TA 3SFDA 1KF6A 3OC4A 2JB1A 2ZZCA 3ALMA 3IWAA 4WX1A 4CBQA 4NTCA 2E1MA 3L1RA 3IHMA 3CN8A 3GYJA 1O95A 1H86A 3HYXA 5FS8A 2X99A 1CL0A 1PN0A 1E1NA 2R4EA 4CNJA 4K22A 3EF6A 4ADWA 3CMMA 3K7QX 3DJGX 3KVEA 4JY2A 2FJBA 3KU9A 4IV9A 2WOIA 4GDEA 4EMJA 1K0JA 4H4WA 4G74A 1NHSA 4A79A 1YY5A 3Q6JA 3KA7A 2FJEA 3AE9A 3FIMB 1D7YA 2QCUA 4OPLA 3ALLA 4G6HA 3CNJA 3VR8A 2X3NA 2PYXA 2JK6A 1REOA 3ICSA 5KOWA 5FMHA 5KMRA 1EL7A 2YLSA 1H83A 5GRTA 4TM0A 3UP4A 2BCGG 2NPXA 1K0LA 3NIXA 3UTHA 2R9ZA 2BA9A 1PXBA 4NTEA 1XDIA 3AE6A 3QVRA 4IA5A 2OA1A 4U2LA 2OLOA 5EB4A 4BK2A 3QVPA 3UKHA 2V5ZA 1D7LA 2WPEA 3AE7A 3GD4A 4ICYA 1E1KA 4OPTA 1CC6A 1COYA 2VRLA 4N9XA 2IVDA 2BS2A 2X8HA 1BKWA 4YSHA 4GDPA 3G5QA 4OPIA 1PBFA 4YTPA 4ZN0A 2GR2A 1FL2A 2HQMA 3HZLA 4KX6A 1GRAA 1IUWA 1CJ3A 3ICTA 3ALJA 1BWCA 2V3AA 3GDNA 3RNMA 3UP5A 3VR9A 4H2RA 4M52A 4AT0A 2JB2A 2YVGA 4J33A 3AB1A 4C3YA 1LV0A 3T14A 1H7WA 1H6VA 5BUKA 1B4VA 3UTGA 1LTXR 1JNZA 2H88A 1E6EA 1ZKQA 2ZBWA 2BACA 4UP3A 4YKGA 3GSIA 2WDRA 5IQ1A 3S61A 3VQRA 2C7GA 1CHUA 1L9CA 4FK1C 5U25A 1GOSA 2WDQA 3UKPA 2QAEA 4XXGA 2TPRA 2W0HA 4II2A 3AEAA 2Y6RA 3ADAB 4H50A 3AEGA 5JCKA 1DOBA 5C3JA 2BC1A 4TM1A 1CC4A 2CFYA 1O5WA 3AE4A 1CJ2A 2WPFA 1Y56B 3CGDA 4CCQA 5JCLA 3UTFA 4K7ZA 5HY5A 3WE0A 3R9UA 4CY8A 1TYTA 2RGJA 1XANA 2GB0A 4Z25A 1D4DA 3CIRA 3OZ2A 4DSGA 4JN9A 2VZ2A 2V6OA 4RG4A 4ECHA 4H4ZA 1PJ6A 4EQRA 2VOUA 3M0OA 1OJAA 1PJ7A 2YG7A 4USQA 1JEHA 3L8KA 5EOWA 2YWLA 1NEKA 3AE8A 3LJPA 3GRTA 5CKUA 1ELIA 1QJDA 3GWFA 4RG3A 1RYIA 2YVFA 1IUSA 1TRBA 4NZHA 3NT6A 4JNAA 5EBKA 3K7MX 3QSEA 2C75A 1ONFA 4H7UA 1ZP0A 2WU5A 1KNPA 2YLZA 2YLRA 3AEEA 3C96A 3KLJA 4B68A 1D4CA 1TDFA 3F8DA 3C4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R45 A;  2ZZ0 A;  5KOX A;  3DH9 A;  4LU6 A;  3DK8 A;  4E0V A;  3EPT A;  3UCL A;  3NN0 X;  1MO9 A;  2B9X A;  4GCM A;  2GV8 A;  3V76 A;  3UOZ A;  4K8D A;  3NK2 X;  2YG4 A;  4EQS A;  2GR3 A;  1S3B A;  4OCG A;  3AE1 A;  2YG6 A;  2WES A;  1D4E A;  4OPG A;  2YVJ A;  3KD9 A;  1ZX9 A;  1RSG A;  1HYU A;  2IID A;  4IVM B;  2XVE A;  4EM3 A;  1GTE A;  3AE2 A;  1GRB A;  2A89 A;  1OJ9 A;  1N1P A;  1PBB A;  2BAB A;  2Q7V A;  3CPH G;  4UDQ A;  2XVH A;  3RP6 A;  3EAN A;  1VDC A;  1H82 A;  1KNR A;  2C64 A;  1L9E A;  3COX A;  4BV6 A;  3FPZ A;  2YG5 A;  3M13 A;  3UKQ A;  4P9S A;  3IF9 A;  2CVJ A;  4DGK A;  2GMJ A;  1ZK7 A;  3IC9 A;  1AOG A;  5EB5 A;  2BXR A;  2R4J A;  4K2X A;  3PS9 A;  3NH3 X;  1ZY8 A;  3II4 A;  2GVC A;  1B37 A;  1NHR A;  2X8G A;  1JOA A;  2XVF A;  3JSK A;  5BUL A;  3I6D A;  4TM3 A;  1K0I A;  1H81 A;  1ZMD A;  4OPU A;  4TLX A;  2YAU A;  3P4S A;  4H4U A;  1CJ4 A;  4H4S A;  1UKV G;  2RGH A;  2QA1 A;  3F8P A;  1NDA A;  3AE3 A;  3AE5 A;  3P4R A;  2X8C A;  2YM1 A;  3CNT A;  1IUV A;  4TLZ A;  2XFU A;  2VQ7 A;  3PO7 A;  3NTA A;  4B69 A;  1TDO A;  1O94 A;  1F3P A;  4FX9 A;  1GRH A;  2FJA A;  2RAB A;  5KVH A;  4UDP A;  2XLR A;  4HB9 A;  3H8L A;  3ICR A;  3ZDN A;  2EQ8 A;  4IA6 A;  3M12 A;  2WEU A;  2YM2 A;  2C72 A;  2VVL G;  3AYJ A;  1XPQ A;  2WP9 A;  5TR3 A;  1W4X A;  3BI5 A;  1L9D A;  1PXC A;  1NHP A;  4O5Q A;  4AP1 A;  3CPJ G;  3UKF A;  1EL9 A;  3NHO X;  2Y6Q A;  3G5R A;  1DOE A;  4IVO B;  4YSX A;  2C73 A;  4J36 A;  4Z2R A;  1DXL A;  2GR1 A;  4JQ9 A;  2OAL A;  2GRT A;  1VQW A;  3ATR A;  1H7X A;  4X4J A;  3AEC A;  2GQW A;  2UZZ A;  3D8X A;  3DJD A;  3NYF A;  1GTH A;  5IQ4 A;  3EAO A;  1DJQ A;  4C5O A;  2I0Z A;  2XLS A;  2OLN A;  2OAM A;  2QA2 A;  2C66 A;  4H4X A;  3UKL A;  4JNQ A;  3CPI G;  4BK1 A;  3H8I A;  1TYP A;  2YQU A;  4U8O A;  2J3N A;  1ZOV A;  1LQT A;  2XFN A;  2O9Z A;  4KPR A;  5ER0 A;  4DSH A;  3AD8 B;  5JCI A;  4J34 A;  3ABV A;  3BHF A;  1H84 A;  2VVM A;  1S3E A;  2VQB A;  1IUX A;  4B64 A;  1YQZ A;  3VRB A;  3GYI A;  1PJ5 A;  2TMD A;  4Z2U A;  3GMC A;  1N4V A;  2V3B A;  2JKC A;  4K5R A;  2XDO A;  4U8I A;  4Z44 A;  2DKH A;  5BVA A;  4EMI A;  4A9W A;  4OPD A;  4A6N A;  3NK1 X;  1IJH A;  4H2Q A;  2AR8 A;  4BUR A;  2R0C A;  1Y56 A;  2C67 A;  3AXB A;  4U8L A;  3BI4 A;  3CGE A;  2EQ7 A;  5U1O A;  5U63 A;  4ZCD A;  4C77 A;  3AWI A;  3D1C A;  1GEU A;  4YXD A;  1GXF A;  5M10 A;  2GMH A;  3QJ4 A;  3UOX A;  1PBC A;  1YQ3 A;  2WP5 A;  2XFP A;  1JNR A;  1Q1W A;  2XYO A;  3IHG A;  4J56 A;  2BK3 A;  1GT8 A;  2IVE A;  5CQF A;  4D03 A;  4GR1 A;  4J57 A;  2WP6 A;  4X9N A;  1GRG A;  2B9W A;  1EL5 A;  1NPX A;  2XLU A;  3DJE A;  2NVK X;  2APG A;  2WU2 A;  1B8S A;  2PHH A;  3B6D A;  3I3L A;  2Q0K A;  3AYL A;  3LAD A;  3NRN A;  4A5L A;  2BYB A;  1FEB A;  3KPF A;  1LJ1 A;  2CUL A;  1GER A;  1D5T A;  2BS3 A;  3LOV A;  4BJZ A;  1N4W A;  2XVJ A;  1NEN A;  1ZOY A;  2E4G A;  3CTY A;  3F8R A;  4B65 A;  1JRY A;  4BJY A;  1VG0 A;  4U8P A;  1GAL A;  3K30 A;  2WBA A;  3RHA A;  3NTD A;  1KFY A;  2WS3 A;  2GAH B;  3DME A;  3SFE A;  1S2Y A;  1GES A;  2B7S A;  4JDR A;  3NN6 X;  4LA1 A;  4Y4M A;  4BK3 A;  3O0H A;  4B67 A;  2XFO A;  4EQX A;  1VRQ B;  1F8W A;  3ATQ A;  3V3N A;  3AD9 B;  1GND A;  4YTM A;  2ACZ A;  1OJD A;  5JCN A;  2C76 A;  1IUU A;  1CBO A;  3E1T A;  2XFQ A;  2VVL A;  1EBD A;  2CDU A;  2BC0 A;  2AAQ A;  1P2H A;  2WET A;  3GWD A;  1Q1R A;  4DNA A;  1TDE A;  3NGC X;  3Q9T A;  1EL8 A;  1E39 A;  3DGH A;  3P1W A;  4YWO A;  1GET A;  2YR6 A;  2BS4 A;  3UKK A;  2YR4 A;  2A87 A;  3CGC A;  3FBS A;  1NG3 A;  4A99 A;  2X50 A;  4A6N B;  3CND A;  2B76 A;  3RP8 A;  5L46 A;  4C3X A;  1Z6L A;  4JY3 A;  3DK4 A;  4AOX A;  1NHQ A;  1DNC A;  1MOK A;  2Q6U A;  3VRA A;  4YKF A;  4EIP A;  1YKJ A;  3LXD A;  3PVC A;  2DKI A;  3LB8 A;  4YT0 A;  1E7P A;  4GUV A;  4UDR A;  3UKA A;  1M6I A;  4U8M A;  1B5Q A;  3B3R A;  2XLT A;  3NNE A;  4XWR A;  1PBD A;  1BGN A;  4RSL A;  1X31 B;  1PS9 A;  4O5U A;  1KDG A;  1JRZ A;  1FOH A;  3DJJ A;  3BNU A;  2BK4 A;  2FBW A;  2ZZB A;  3QSS A;  3AED A;  1S2Q A;  3AD7 B;  1PDH A;  4AT2 A;  1XHC A;  3AEB A;  1OJC A;  1DOD A;  2A8X A;  3AEF A;  4YSY A;  4YTN A;  3C4N A;  4C74 A;  2XLP A;  5JCM A;  1YQ4 A;  4FK1 A;  1FCD A;  3BNM A;  1CF3 A;  5DBJ A;  4J2W A;  3CNP A;  2BXS A;  1GRF A;  2YR5 A;  4WCT A;  2EQ6 A;  3SM8 A;  3UTE A;  2WQY A;  4CY6 A;  1FEC A;  3P9U A;  4EMW A;  3NLC A;  1V59 A;  1KSS A;  1P2E A;  2V61 A;  4LII A;  4Z24 A;  2GF3 A;  2XCG A;  1KSU A;  3FG2 P;  1Q9I A;  1LVL A;  1PXA A;  1VG9 A;  2AQJ A;  2YLT A;  4NEW A;  5LV9 A;  2C3D A;  4REK A;  5C2T A;  4U8K A;  3SGL A;  4EQW A;  2R0P A;  5HYM A;  2EQ9 A;  4H4Y A;  2WDV A;  4A7A A;  4H2P A;  5IPY A;  2XVI A;  4GF7 A;  3QSM A;  5KVI A;  4Z43 A;  5J60 A;  2E5V A;  4A65 A;  2C3C A;  2YLX A;  2F5Z A;  3AYI A;  1CJC A;  5KRQ A;  3RP7 A;  4Z2T A;  1ZDL A;  2Z5Y A;  4U8J A;  5FS6 A;  5FS7 A;  3ITJ A;  3NYE A;  4H4V A;  2GH5 A;  1NG4 A;  3QFB A;  1LPF A;  2H89 A;  4I58 A;  3T37 A;  1FEA A;  4ZCC A;  5KWF A;  3KKJ A;  3UOY A;  4Y4L A;  4CCR A;  1Y0P A;  4B66 A;  2B9Y A;  1GSN A;  2Q0L A;  4U2S A;  3S5W A;  5BRT A;  3URH A;  2RGO A;  4NTD A;  4Z26 A;  2WOW A;  3GMB A;  1RP0 A;  3NK0 X;  4OVI A;  4I59 A;  3GD3 A;  4NEV A;  3FMW A;  1E1L A;  3LZW A;  2GEW A;  3CNS A;  2R46 A;  4H2N A;  5J7X A;  2WHD A;  1GPE A;  2Z5X A;  4H4R A;  5FS9 A;  1TDN A;  4X9M A;  3ZYX A;  4B63 A;  1M64 A;  4U8N A;  4J31 A;  2GR0 A;  4B1B A;  1BGJ A;  1E1M A;  5M0Z A;  1PBE A;  4TM4 A;  2C65 A;  2WOV A;  4PAA A;  1DOC A;  4EIQ A;  5GSN A;  5HXI A;  2GQF A;  3VRD B;  1BZL A;  1F8R A;  4FDC B;  3P4Q A;  3G5S A;  1BF3 A;  4USR A;  3H4K A;  3RED A;  3DGZ A;  4AOS A;  2C70 A;  1OJT A;  1PHH A;  2JBV A;  4CRT A;  2BCP A;  3NYC A;  4MJW A;  3GRS A;  1N4U A;  1L0V A;  4CNK A;  2R0G A;  1MXT A;  1QLB A;  1SEZ A;  2YLW A;  3BHK A;  2JAE A;  4H4P A;  2FJD A;  4PAB A;  2GAG B;  3V3O A;  4YSZ A;  4D04 A;  1JRX A;  4XWZ A;  3ISH A;  1LQU A;  1K4Q A;  1TDK A;  1F6M A;  3K7T A;  3NG7 X;  1GRE A;  4AP3 A;  1GV4 A;  1IUT A;  1ZMC A;  2YG3 A;  4OPC A;  4K5S A;  3BI2 A;  3LZX A;  4GRT A;  4U2T A;  3SQP A;  1F8S A;  4APN A;  2B7R A;  1JU2 A;  1QO8 A;  2WPC A;  2V60 A;  4HA6 A;  4EM4 A;  1CC2 A;  3DA1 A;  4H4Q A;  1NAA A;  2BK5 A;  3GDP A;  1GRT A;  2VRM A;  2ARD A;  5HHF A;  5KXJ A;  3CGB A;  3DK9 A;  4Y4N A;  2JB3 A;  3NKS A;  3P4P A;  1DJN A;  3QFA A;  3UOV A;  4H4T A;  3SFD A;  1KF6 A;  3OC4 A;  2JB1 A;  2ZZC A;  3ALM A;  3IWA A;  4WX1 A;  4CBQ A;  4NTC A;  2E1M A;  3L1R A;  3IHM A;  3CN8 A;  3GYJ A;  1O95 A;  1H86 A;  5FS8 A;  2X99 A;  1CL0 A;  1PN0 A;  1E1N A;  2R4E A;  4CNJ A;  4K22 A;  3EF6 A;  4ADW A;  3K7Q X;  3DJG X;  3KVE A;  4JY2 A;  2FJB A;  3KU9 A;  4IV9 A;  2WOI A;  4GDE A;  4EMJ A;  1K0J A;  4H4W A;  1NHS A;  4A79 A;  1YY5 A;  3Q6J A;  3KA7 A;  2FJE A;  3AE9 A;  3FIM B;  1D7Y A;  2QCU A;  4OPL A;  3ALL A;  3CNJ A;  3VR8 A;  2X3N A;  2PYX A;  2JK6 A;  1REO A;  3ICS A;  5KOW A;  5FMH A;  1EL7 A;  2YLS A;  1H83 A;  5GRT A;  4TM0 A;  3UP4 A;  2BCG G;  2NPX A;  1K0L A;  3NIX A;  3UTH A;  2R9Z A;  2BA9 A;  1PXB A;  4NTE A;  1XDI A;  3AE6 A;  3QVR A;  2OA1 A;  4IA5 A;  4U2L A;  2OLO A;  5EB4 A;  3QVP A;  4BK2 A;  3UKH A;  2V5Z A;  1D7L A;  2WPE A;  3AE7 A;  3GD4 A;  4ICY A;  1E1K A;  4OPT A;  1CC6 A;  1COY A;  2VRL A;  4N9X A;  2IVD A;  2BS2 A;  2X8H A;  1BKW A;  4YSH A;  4GDP A;  3G5Q A;  4OPI A;  1PBF A;  4YTP A;  4ZN0 A;  2GR2 A;  1FL2 A;  2HQM A;  3HZL A;  4KX6 A;  1GRA A;  1IUW A;  1CJ3 A;  3ICT A;  3ALJ A;  1BWC A;  2V3A A;  3GDN A;  3RNM A;  3UP5 A;  3VR9 A;  4H2R A;  4M52 A;  4AT0 A;  2JB2 A;  2YVG A;  4J33 A;  3AB1 A;  4C3Y A;  1LV0 A;  1H7W A;  1H6V A;  5BUK A;  1B4V A;  3UTG A;  1LTX R;  1JNZ A;  2H88 A;  1E6E A;  1ZKQ A;  2ZBW A;  2BAC A;  4UP3 A;  4YKG A;  3GSI A;  2WDR A;  5IQ1 A;  3S61 A;  3VQR A;  2C7G A;  1CHU A;  1L9C A;  4FK1 C;  5U25 A;  1GOS A;  2WDQ A;  3UKP A;  2QAE A;  4XXG A;  2TPR A;  2W0H A;  3AEA A;  2Y6R A;  3ADA B;  4H50 A;  3AEG A;  5JCK A;  1DOB A;  5C3J A;  2BC1 A;  4TM1 A;  1CC4 A;  2CFY A;  1O5W A;  3AE4 A;  1CJ2 A;  2WPF A;  1Y56 B;  3CGD A;  4CCQ A;  5JCL A;  3UTF A;  4K7Z A;  5HY5 A;  3WE0 A;  3R9U A;  4CY8 A;  1TYT A;  1XAN A;  2GB0 A;  2RGJ A;  4Z25 A;  1D4D A;  3CIR A;  3OZ2 A;  4DSG A;  4JN9 A;  2VZ2 A;  2V6O A;  4RG4 A;  4ECH A;  4H4Z A;  1PJ6 A;  4EQR A;  2VOU A;  3M0O A;  1OJA A;  1PJ7 A;  2YG7 A;  4USQ A;  1JEH A;  3L8K A;  5EOW A;  2YWL A;  1NEK A;  3AE8 A;  3LJP A;  3GRT A;  5CKU A;  1ELI A;  1QJD A;  3GWF A;  4RG3 A;  1RYI A;  2YVF A;  1IUS A;  1TRB A;  4NZH A;  3NT6 A;  4JNA A;  5EBK A;  3K7M X;  3QSE A;  2C75 A;  1ONF A;  4H7U A;  1ZP0 A;  2WU5 A;  1KNP A;  2YLZ A;  2YLR A;  3AEE A;  3C96 A;  3KLJ A;  4B68 A;  1D4C A;  1TDF A;  3F8D A;  3C4A A; 
#chains in the Genus database with same CATH topology
 2R45 A;  2ZZ0 A;  5KOX A;  3DH9 A;  4LU6 A;  3DK8 A;  1KIF A;  4E0V A;  3EPT A;  3UCL A;  3NN0 X;  1MO9 A;  4G9K A;  2B9X A;  4GCM A;  2GV8 A;  3V76 A;  3UOZ A;  4K8D A;  3NK2 X;  2YG4 A;  4EQS A;  2GR3 A;  1S3B A;  4OCG A;  3AE1 A;  2YG6 A;  2WES A;  1D4E A;  4OPG A;  2YVJ A;  3KD9 A;  1ZX9 A;  1RSG A;  1HYU A;  2IID A;  4IVM B;  2XVE A;  4EM3 A;  1GTE A;  3AE2 A;  2A89 A;  1GRB A;  1OJ9 A;  1PBB A;  1N1P A;  2BAB A;  2Q7V A;  3CPH G;  4UDQ A;  3SYI A;  2XVH A;  3RP6 A;  3EAN A;  1VDC A;  1H82 A;  1KNR A;  2C64 A;  1L9E A;  2C4C A;  3COX A;  4BV6 A;  3FPZ A;  2YG5 A;  3T2Z A;  3M13 A;  3UKQ A;  4P9S A;  3IF9 A;  2CVJ A;  4DGK A;  2GMJ A;  1ZK7 A;  3IC9 A;  1AOG A;  5EB5 A;  2BXR A;  2R4J A;  4K2X A;  3PS9 A;  3NH3 X;  1ZY8 A;  3II4 A;  2GVC A;  1B37 A;  1NHR A;  2X8G A;  1JOA A;  2XVF A;  3JSK A;  5BUL A;  3I6D A;  4TM3 A;  1K0I A;  1H81 A;  1ZMD A;  4OPU A;  4TLX A;  2YAU A;  3P4S A;  4H4U A;  1CJ4 A;  4H4S A;  1UKV G;  2RGH A;  2QA1 A;  3F8P A;  1NDA A;  3AE3 A;  4G73 A;  3ZNQ A;  3AE5 A;  3P4R A;  2X8C A;  2YM1 A;  3CNT A;  3ZNN A;  1IUV A;  4TLZ A;  2XFU A;  2VQ7 A;  3PO7 A;  3NTA A;  4B69 A;  1TDO A;  1O94 A;  1F3P A;  4FX9 A;  3SX6 A;  1GRH A;  2FJA A;  2RAB A;  5KVH A;  4UDP A;  2XLR A;  4HB9 A;  3H8L A;  3ICR A;  3ZDN A;  2EQ8 A;  4IA6 A;  3M12 A;  2WEU A;  2YM2 A;  2C72 A;  2VVL G;  3AYJ A;  1XPQ A;  2WP9 A;  5TR3 A;  2BRA A;  1W4X A;  3BI5 A;  1L9D A;  1PXC A;  1NHP A;  4O5Q A;  4AP1 A;  3CPJ G;  3UKF A;  1EL9 A;  3NHO X;  2Y6Q A;  3G5R A;  1DOE A;  4IVO B;  4YSX A;  2C73 A;  4J36 A;  4Z2R A;  5KMP A;  1DXL A;  2GR1 A;  4JQ9 A;  2OAL A;  2GRT A;  1VQW A;  3ATR A;  1H7X A;  4X4J A;  3AEC A;  3DJD A;  2UZZ A;  3NYF A;  2GQW A;  3D8X A;  1GTH A;  5IQ4 A;  3EAO A;  1DJQ A;  4C5O A;  2I0Z A;  2XLS A;  2OLN A;  2OAM A;  2QA2 A;  2C66 A;  4H4X A;  3SXI A;  3UKL A;  4JNQ A;  4BK1 A;  3CPI G;  3H8I A;  1TYP A;  2YQU A;  4U8O A;  2J3N A;  1ZOV A;  1LQT A;  2XFN A;  2O9Z A;  4KPR A;  5ER0 A;  4DSH A;  3AD8 B;  5JCI A;  4J34 A;  3BHF A;  3ABV A;  3T31 A;  1H84 A;  2VVM A;  1S3E A;  2VQB A;  1IUX A;  4B64 A;  1YQZ A;  4GAP A;  1DDO A;  3VRB A;  3GYI A;  1PJ5 A;  2TMD A;  4Z2U A;  3GMC A;  1N4V A;  2V3B A;  2JKC A;  4K5R A;  2XDO A;  4U8I A;  4Z44 A;  2DKH A;  5BVA A;  4EMI A;  4A9W A;  4OPD A;  4A6N A;  3NK1 X;  1IJH A;  4H2Q A;  2AR8 A;  4BUR A;  2R0C A;  1Y56 A;  3AXB A;  2C67 A;  4U8L A;  3HYV A;  3BI4 A;  3CGE A;  2EQ7 A;  5U1O A;  5U63 A;  4ZCD A;  4C77 A;  3AWI A;  3D1C A;  1GEU A;  4YXD A;  1GXF A;  5M10 A;  2GMH A;  3QJ4 A;  3UOX A;  4NWZ A;  1PBC A;  1YQ3 A;  2WP5 A;  2XFP A;  1JNR A;  1Q1W A;  2XYO A;  3IHG A;  4J56 A;  2BK3 A;  1GT8 A;  2IVE A;  5CQF A;  4D03 A;  4GR1 A;  4J57 A;  4X9N A;  2WP6 A;  1GRG A;  2B9W A;  1EL5 A;  3DJE A;  1NPX A;  2XLU A;  2NVK X;  2APG A;  2WU2 A;  2PHH A;  1B8S A;  3B6D A;  3I3L A;  2Q0K A;  3AYL A;  3LAD A;  3NRN A;  4A5L A;  2BYB A;  1FEB A;  3KPF A;  1LJ1 A;  2CUL A;  1GER A;  1D5T A;  2BS3 A;  3LOV A;  4BJZ A;  1N4W A;  4YJH B;  1NEN A;  1ZOY A;  2E4G A;  2XVJ A;  3CTY A;  3F8R A;  4B65 A;  4BJY A;  1JRY A;  1VG0 A;  4U8P A;  1GAL A;  3K30 A;  2WBA A;  3RHA A;  4YJH A;  3NTD A;  1KFY A;  2WS3 A;  2GAH B;  3DME A;  3SFE A;  1S2Y A;  1GES A;  2B7S A;  4JDR A;  3NN6 X;  4LA1 A;  4BK3 A;  4Y4M A;  3O0H A;  4B67 A;  2XFO A;  3SZW A;  4EQX A;  1VRQ B;  1F8W A;  3ATQ A;  3CUK A;  3V3N A;  3AD9 B;  1GND A;  4YTM A;  2ACZ A;  1OJD A;  5JCN A;  2C76 A;  1IUU A;  1CBO A;  3E1T A;  2XFQ A;  3KPK A;  2VVL A;  1EBD A;  2CDU A;  2BC0 A;  2AAQ A;  1P2H A;  4YJF A;  2WET A;  3GWD A;  2E48 A;  1Q1R A;  1TDE A;  4DNA A;  3NGC X;  3SY4 A;  3Q9T A;  1EL8 A;  1E39 A;  3DGH A;  3P1W A;  4YWO A;  1GET A;  2YR6 A;  2BS4 A;  3UKK A;  2YR4 A;  2A87 A;  3CGC A;  3FBS A;  1NG3 A;  4A99 A;  2X50 A;  4A6N B;  3CND A;  2B76 A;  3RP8 A;  5L46 A;  4C3X A;  4NNJ A;  1AN9 A;  4JY3 A;  1Z6L A;  3DK4 A;  3ZNP A;  1NHQ A;  4AOX A;  1DNC A;  3T2K A;  1MOK A;  2Q6U A;  3VRA A;  4YKF A;  1YKJ A;  4EIP A;  3LXD A;  3PVC A;  3T2Y A;  2DKI A;  3LB8 A;  4YT0 A;  1E7P A;  4GUV A;  4UDR A;  3UKA A;  1M6I A;  4U8M A;  1B5Q A;  3B3R A;  2XLT A;  3NNE A;  4XWR A;  1PBD A;  1BGN A;  4RSL A;  1X31 B;  1PS9 A;  4O5U A;  5KMS A;  1KDG A;  1JRZ A;  1FOH A;  4GAV A;  3DJJ A;  3BNU A;  2BK4 A;  5KNL A;  2FBW A;  2ZZB A;  3QSS A;  4II3 A;  3AED A;  1S2Q A;  3AD7 B;  1PDH A;  4AT2 A;  1XHC A;  3AEB A;  1OJC A;  1DOD A;  2A8X A;  3AEF A;  4YSY A;  4YTN A;  3C4N A;  4C74 A;  2XLP A;  5JCM A;  1YQ4 A;  4FK1 A;  1FCD A;  3BNM A;  1CF3 A;  5DBJ A;  4J2W A;  3CNP A;  3SZ0 A;  2BXS A;  1GRF A;  2YR5 A;  4WCT A;  2EQ6 A;  3SM8 A;  3UTE A;  2WQY A;  4CY6 A;  1FEC A;  3P9U A;  4EMW A;  3NLC A;  2E82 A;  1V59 A;  1KSS A;  1P2E A;  2V61 A;  4LII A;  4Z24 A;  2GF3 A;  2XCG A;  3ZNO A;  1KSU A;  3FG2 P;  1Q9I A;  1PXA A;  1LVL A;  1VG9 A;  2AQJ A;  2YLT A;  4NEW A;  5LV9 A;  2C3D A;  4REK A;  2DU8 A;  5C2T A;  4U8K A;  3SGL A;  4EQW A;  2R0P A;  1C0K A;  5HYM A;  2EQ9 A;  4H4Y A;  2WDV A;  4A7A A;  4H2P A;  5IPY A;  2XVI A;  3QSM A;  4GF7 A;  5KVI A;  4Z43 A;  5J60 A;  2E5V A;  4A65 A;  2C3C A;  2YLX A;  2F5Z A;  3AYI A;  1C0L A;  1CJC A;  5KRQ A;  3RP7 A;  4Z2T A;  1ZDL A;  2Z5Y A;  4U8J A;  5FS6 A;  5FS7 A;  3NYE A;  3ITJ A;  4H4V A;  2GH5 A;  1NG4 A;  3QFB A;  1LPF A;  2H89 A;  4I58 A;  3T37 A;  1FEA A;  4ZCC A;  5KWF A;  3KKJ A;  3UOY A;  4Y4L A;  4CCR A;  1Y0P A;  4B66 A;  3GYX A;  2B9Y A;  1GSN A;  2Q0L A;  4U2S A;  3S5W A;  5BRT A;  3URH A;  2RGO A;  4NTD A;  4Z26 A;  2WOW A;  3GMB A;  1RP0 A;  3NK0 X;  4OVI A;  4I59 A;  3GD3 A;  4NEV A;  3FMW A;  1E1L A;  3LZW A;  3T0K A;  2GEW A;  3CNS A;  2R46 A;  4H2N A;  5J7X A;  2WHD A;  1GPE A;  2Z5X A;  4H4R A;  5FS9 A;  4X9M A;  1TDN A;  3ZYX A;  4B63 A;  1M64 A;  1EVI A;  4U8N A;  4J31 A;  2GR0 A;  4B1B A;  1BGJ A;  1E1M A;  5M0Z A;  3HYW A;  1PBE A;  4TM4 A;  2C65 A;  2WOV A;  4PAA A;  1DOC A;  4EIQ A;  2E4A A;  5HXI A;  2GQF A;  4G6G A;  5GSN A;  3VRD B;  1BZL A;  1F8R A;  4FDC B;  3P4Q A;  3G5S A;  1BF3 A;  4USR A;  3H4K A;  3RED A;  3DGZ A;  4AOS A;  2C70 A;  1OJT A;  3SZC A;  1PHH A;  2JBV A;  4CRT A;  3NYC A;  2BCP A;  4MJW A;  3GRS A;  1N4U A;  1L0V A;  4CNK A;  2R0G A;  1QLB A;  1SEZ A;  3BHK A;  4PAB A;  1MXT A;  2JAE A;  2YLW A;  2FJD A;  4H4P A;  2GAG B;  5KMQ A;  3V3O A;  4YSZ A;  3G3E A;  4D04 A;  1JRX A;  2BRY A;  4XWZ A;  3ISH A;  1LQU A;  1K4Q A;  1TDK A;  1F6M A;  3K7T A;  3NG7 X;  1GRE A;  4AP3 A;  1GV4 A;  1IUT A;  1ZMC A;  2YG3 A;  4OPC A;  4K5S A;  3BI2 A;  3LZX A;  4GRT A;  4U2T A;  3SQP A;  1F8S A;  4APN A;  2B7R A;  1JU2 A;  1QO8 A;  2WPC A;  2V60 A;  4HA6 A;  4EM4 A;  3DA1 A;  1CC2 A;  4H4Q A;  1NAA A;  2BK5 A;  3GDP A;  1GRT A;  2VRM A;  2ARD A;  5HHF A;  5KXJ A;  3SZF A;  3CGB A;  3DK9 A;  4Y4N A;  2JB3 A;  3NKS A;  3P4P A;  1DJN A;  3QFA A;  3UOV A;  4H4T A;  3SFD A;  1KF6 A;  3W4J A;  2JB1 A;  3OC4 A;  2ZZC A;  3ALM A;  3IWA A;  4WX1 A;  4CBQ A;  4NTC A;  2E1M A;  3L1R A;  3IHM A;  1VE9 A;  3CN8 A;  3GYJ A;  1O95 A;  1H86 A;  3HYX A;  5FS8 A;  2X99 A;  1PN0 A;  2R4E A;  1CL0 A;  1E1N A;  4CNJ A;  4K22 A;  4YJF B;  3EF6 A;  4ADW A;  3CMM A;  3K7Q X;  3DJG X;  3KVE A;  4JY2 A;  2FJB A;  3KU9 A;  4IV9 A;  2WOI A;  4GDE A;  4EMJ A;  1K0J A;  4H4W A;  4G74 A;  1NHS A;  4A79 A;  1YY5 A;  3Q6J A;  3KA7 A;  4QFC A;  2FJE A;  3AE9 A;  3FIM B;  1D7Y A;  2QCU A;  4OPL A;  3ALL A;  4G6H A;  3CNJ A;  3VR8 A;  4YJG B;  3W4K A;  2X3N A;  2PYX A;  2JK6 A;  1REO A;  3ICS A;  5KOW A;  5FMH A;  5KMR A;  1EL7 A;  2YLS A;  1H83 A;  5GRT A;  4TM0 A;  3UP4 A;  2BCG G;  2NPX A;  1K0L A;  3NIX A;  3UTH A;  2R9Z A;  1C0I A;  1PXB A;  2BA9 A;  4NTE A;  1XDI A;  3AE6 A;  3QVR A;  4IA5 A;  2OA1 A;  4U2L A;  2OLO A;  5EB4 A;  3W4I A;  1DAO A;  4BK2 A;  3QVP A;  3UKH A;  2V5Z A;  1D7L A;  2WPE A;  3AE7 A;  3GD4 A;  4ICY A;  4YJG A;  1E1K A;  1CC6 A;  1COY A;  2VRL A;  4OPT A;  4N9X A;  2IVD A;  2BS2 A;  2X8H A;  1C0P A;  1BKW A;  4YSH A;  4GDP A;  3G5Q A;  4OPI A;  1PBF A;  4YTP A;  4ZN0 A;  2GR2 A;  1FL2 A;  3HZL A;  2HQM A;  4KX6 A;  1GRA A;  1IUW A;  1CJ3 A;  3ICT A;  3ALJ A;  1BWC A;  2V3A A;  3GDN A;  3RNM A;  3UP5 A;  3VR9 A;  4H2R A;  4M52 A;  4AT0 A;  2JB2 A;  2YVG A;  4J33 A;  3AB1 A;  4C3Y A;  1LV0 A;  3T14 A;  1H7W A;  1H6V A;  5BUK A;  1B4V A;  3UTG A;  1LTX R;  1JNZ A;  2H88 A;  1E6E A;  1ZKQ A;  2ZBW A;  2BAC A;  4UP3 A;  4YKG A;  3GSI A;  2WDR A;  5IQ1 A;  3S61 A;  3VQR A;  2C7G A;  1L9C A;  1CHU A;  4FK1 C;  5U25 A;  1GOS A;  2WDQ A;  3UKP A;  2QAE A;  4XXG A;  2TPR A;  2W0H A;  4II2 A;  3AEA A;  2Y6R A;  3ADA B;  4H50 A;  3AEG A;  5JCK A;  1DOB A;  5C3J A;  2BC1 A;  4TM1 A;  1CC4 A;  2CFY A;  1O5W A;  3AE4 A;  1CJ2 A;  4QFD A;  1Y56 B;  2WPF A;  3CGD A;  4CCQ A;  5JCL A;  3UTF A;  4K7Z A;  5HY5 A;  3WE0 A;  3R9U A;  4CY8 A;  1TYT A;  2RGJ A;  2GB0 A;  1XAN A;  4Z25 A;  1D4D A;  3CIR A;  3OZ2 A;  4DSG A;  4JN9 A;  2VZ2 A;  2V6O A;  4RG4 A;  4YJD A;  4ECH A;  4H4Z A;  1PJ6 A;  4EQR A;  2VOU A;  3M0O A;  1OJA A;  1PJ7 A;  2YG7 A;  4USQ A;  1JEH A;  3L8K A;  5EOW A;  2YWL A;  1NEK A;  2E49 A;  3AE8 A;  3LJP A;  3GRT A;  5CKU A;  1ELI A;  1QJD A;  3GWF A;  4RG3 A;  1RYI A;  2YVF A;  1IUS A;  1TRB A;  4NZH A;  3NT6 A;  3WGT A;  4JNA A;  5EBK A;  3QSE A;  3K7M X;  2C75 A;  1ONF A;  4H7U A;  1ZP0 A;  2WU5 A;  1KNP A;  2YLZ A;  2YLR A;  3AEE A;  3C96 A;  3KLJ A;  4B68 A;  1D4C A;  1TDF A;  3F8D A;  3C4A A; 
#chains in the Genus database with same CATH homology
 2R45 A;  2ZZ0 A;  5KOX A;  3DH9 A;  4LU6 A;  3DK8 A;  4E0V A;  3EPT A;  3UCL A;  3NN0 X;  1MO9 A;  4G9K A;  2B9X A;  4GCM A;  2GV8 A;  3V76 A;  3UOZ A;  4K8D A;  3NK2 X;  2YG4 A;  4EQS A;  2GR3 A;  1S3B A;  4OCG A;  3AE1 A;  2YG6 A;  2WES A;  1D4E A;  4OPG A;  2YVJ A;  3KD9 A;  1ZX9 A;  1RSG A;  1HYU A;  2IID A;  4IVM B;  2XVE A;  4EM3 A;  1GTE A;  3AE2 A;  1GRB A;  2A89 A;  1OJ9 A;  1N1P A;  1PBB A;  2BAB A;  2Q7V A;  3CPH G;  4UDQ A;  3SYI A;  2XVH A;  3RP6 A;  3EAN A;  1VDC A;  1H82 A;  1KNR A;  2C64 A;  1L9E A;  2C4C A;  3COX A;  4BV6 A;  3FPZ A;  2YG5 A;  3T2Z A;  3M13 A;  3UKQ A;  4P9S A;  3IF9 A;  2CVJ A;  4DGK A;  2GMJ A;  1ZK7 A;  3IC9 A;  1AOG A;  5EB5 A;  2BXR A;  2R4J A;  4K2X A;  3PS9 A;  3NH3 X;  1ZY8 A;  3II4 A;  2GVC A;  1B37 A;  1NHR A;  2X8G A;  1JOA A;  2XVF A;  3JSK A;  5BUL A;  3I6D A;  4TM3 A;  1K0I A;  1H81 A;  1ZMD A;  4OPU A;  4TLX A;  2YAU A;  3P4S A;  4H4U A;  1CJ4 A;  4H4S A;  1UKV G;  2RGH A;  2QA1 A;  3F8P A;  1NDA A;  3AE3 A;  4G73 A;  3AE5 A;  3P4R A;  2X8C A;  2YM1 A;  3CNT A;  1IUV A;  4TLZ A;  2XFU A;  2VQ7 A;  3PO7 A;  3NTA A;  4B69 A;  1TDO A;  1O94 A;  1F3P A;  4FX9 A;  3SX6 A;  1GRH A;  2FJA A;  2RAB A;  5KVH A;  4UDP A;  2XLR A;  4HB9 A;  3H8L A;  3ICR A;  3ZDN A;  2EQ8 A;  4IA6 A;  3M12 A;  2WEU A;  2YM2 A;  2C72 A;  2VVL G;  3AYJ A;  1XPQ A;  2WP9 A;  5TR3 A;  2BRA A;  1W4X A;  3BI5 A;  1L9D A;  1PXC A;  1NHP A;  4O5Q A;  4AP1 A;  3CPJ G;  3UKF A;  1EL9 A;  3NHO X;  2Y6Q A;  3G5R A;  1DOE A;  4IVO B;  4YSX A;  2C73 A;  4J36 A;  4Z2R A;  5KMP A;  1DXL A;  2GR1 A;  4JQ9 A;  2OAL A;  2GRT A;  1VQW A;  3ATR A;  1H7X A;  4X4J A;  3AEC A;  2GQW A;  2UZZ A;  3D8X A;  3DJD A;  3NYF A;  1GTH A;  5IQ4 A;  3EAO A;  1DJQ A;  4C5O A;  2I0Z A;  2XLS A;  2OLN A;  2OAM A;  2QA2 A;  2C66 A;  4H4X A;  3SXI A;  3UKL A;  4JNQ A;  4BK1 A;  3CPI G;  3H8I A;  1TYP A;  2YQU A;  4U8O A;  2J3N A;  1ZOV A;  1LQT A;  2XFN A;  2O9Z A;  4KPR A;  5ER0 A;  4DSH A;  3AD8 B;  5JCI A;  4J34 A;  3ABV A;  3BHF A;  3T31 A;  1H84 A;  2VVM A;  1S3E A;  2VQB A;  1IUX A;  4B64 A;  1YQZ A;  4GAP A;  3VRB A;  3GYI A;  1PJ5 A;  2TMD A;  4Z2U A;  3GMC A;  1N4V A;  2V3B A;  2JKC A;  4K5R A;  2XDO A;  4U8I A;  4Z44 A;  2DKH A;  5BVA A;  4EMI A;  4A9W A;  4OPD A;  4A6N A;  3NK1 X;  1IJH A;  4H2Q A;  2AR8 A;  4BUR A;  2R0C A;  1Y56 A;  2C67 A;  3AXB A;  4U8L A;  3HYV A;  3BI4 A;  3CGE A;  2EQ7 A;  5U1O A;  5U63 A;  4ZCD A;  4C77 A;  3AWI A;  3D1C A;  1GEU A;  4YXD A;  1GXF A;  5M10 A;  2GMH A;  3QJ4 A;  3UOX A;  4NWZ A;  1PBC A;  1YQ3 A;  2WP5 A;  2XFP A;  1JNR A;  1Q1W A;  2XYO A;  3IHG A;  4J56 A;  2BK3 A;  1GT8 A;  2IVE A;  5CQF A;  4D03 A;  4GR1 A;  4J57 A;  2WP6 A;  4X9N A;  1GRG A;  2B9W A;  1EL5 A;  1NPX A;  2XLU A;  3DJE A;  2NVK X;  2APG A;  2WU2 A;  1B8S A;  2PHH A;  3B6D A;  3I3L A;  2Q0K A;  3AYL A;  3LAD A;  3NRN A;  4A5L A;  2BYB A;  1FEB A;  3KPF A;  1LJ1 A;  2CUL A;  1GER A;  1D5T A;  2BS3 A;  3LOV A;  4BJZ A;  1N4W A;  2XVJ A;  1NEN A;  1ZOY A;  2E4G A;  3CTY A;  3F8R A;  4B65 A;  4BJY A;  1JRY A;  1VG0 A;  4U8P A;  1GAL A;  3K30 A;  2WBA A;  3RHA A;  3NTD A;  1KFY A;  2WS3 A;  2GAH B;  3DME A;  3SFE A;  1S2Y A;  1GES A;  2B7S A;  4JDR A;  3NN6 X;  4LA1 A;  4BK3 A;  4Y4M A;  3O0H A;  4B67 A;  2XFO A;  3SZW A;  4EQX A;  1VRQ B;  1F8W A;  3ATQ A;  3V3N A;  3AD9 B;  1GND A;  4YTM A;  2ACZ A;  1OJD A;  5JCN A;  2C76 A;  1IUU A;  1CBO A;  3E1T A;  2XFQ A;  3KPK A;  2VVL A;  1EBD A;  2CDU A;  2BC0 A;  2AAQ A;  1P2H A;  2WET A;  3GWD A;  1Q1R A;  4DNA A;  1TDE A;  3NGC X;  3SY4 A;  3Q9T A;  1EL8 A;  1E39 A;  3DGH A;  3P1W A;  4YWO A;  1GET A;  2YR6 A;  2BS4 A;  3UKK A;  2YR4 A;  2A87 A;  3CGC A;  3FBS A;  1NG3 A;  4A99 A;  2X50 A;  4A6N B;  3CND A;  2B76 A;  3RP8 A;  5L46 A;  4C3X A;  4NNJ A;  1Z6L A;  4JY3 A;  3DK4 A;  4AOX A;  1NHQ A;  1DNC A;  3T2K A;  1MOK A;  2Q6U A;  3VRA A;  4YKF A;  4EIP A;  1YKJ A;  3LXD A;  3PVC A;  3T2Y A;  2DKI A;  3LB8 A;  4YT0 A;  1E7P A;  4GUV A;  4UDR A;  3UKA A;  1M6I A;  4U8M A;  1B5Q A;  3B3R A;  2XLT A;  3NNE A;  4XWR A;  1PBD A;  1BGN A;  4RSL A;  1X31 B;  1PS9 A;  4O5U A;  5KMS A;  1KDG A;  1JRZ A;  1FOH A;  4GAV A;  3DJJ A;  3BNU A;  2BK4 A;  5KNL A;  2FBW A;  2ZZB A;  3QSS A;  4II3 A;  3AED A;  1S2Q A;  3AD7 B;  1PDH A;  4AT2 A;  1XHC A;  3AEB A;  1OJC A;  1DOD A;  2A8X A;  3AEF A;  4YSY A;  4YTN A;  3C4N A;  4C74 A;  2XLP A;  5JCM A;  1YQ4 A;  4FK1 A;  1FCD A;  3BNM A;  1CF3 A;  5DBJ A;  4J2W A;  3CNP A;  3SZ0 A;  2BXS A;  1GRF A;  2YR5 A;  4WCT A;  2EQ6 A;  3SM8 A;  3UTE A;  2WQY A;  4CY6 A;  1FEC A;  3P9U A;  4EMW A;  3NLC A;  1V59 A;  1KSS A;  1P2E A;  2V61 A;  4LII A;  4Z24 A;  2GF3 A;  2XCG A;  1KSU A;  3FG2 P;  1Q9I A;  1LVL A;  1PXA A;  1VG9 A;  2AQJ A;  2YLT A;  4NEW A;  5LV9 A;  2C3D A;  4REK A;  5C2T A;  4U8K A;  3SGL A;  4EQW A;  2R0P A;  5HYM A;  2EQ9 A;  4H4Y A;  2WDV A;  4A7A A;  4H2P A;  5IPY A;  2XVI A;  4GF7 A;  3QSM A;  5KVI A;  4Z43 A;  5J60 A;  2E5V A;  4A65 A;  2C3C A;  2YLX A;  2F5Z A;  3AYI A;  1CJC A;  5KRQ A;  3RP7 A;  4Z2T A;  1ZDL A;  2Z5Y A;  4U8J A;  5FS6 A;  5FS7 A;  3ITJ A;  3NYE A;  4H4V A;  2GH5 A;  1NG4 A;  3QFB A;  1LPF A;  2H89 A;  4I58 A;  3T37 A;  1FEA A;  4ZCC A;  5KWF A;  3KKJ A;  3UOY A;  4Y4L A;  4CCR A;  1Y0P A;  4B66 A;  3GYX A;  2B9Y A;  1GSN A;  2Q0L A;  4U2S A;  3S5W A;  5BRT A;  3URH A;  2RGO A;  4NTD A;  4Z26 A;  2WOW A;  3GMB A;  1RP0 A;  3NK0 X;  4OVI A;  4I59 A;  3GD3 A;  4NEV A;  3FMW A;  1E1L A;  3LZW A;  3T0K A;  2GEW A;  3CNS A;  2R46 A;  4H2N A;  5J7X A;  2WHD A;  1GPE A;  2Z5X A;  4H4R A;  5FS9 A;  1TDN A;  4X9M A;  3ZYX A;  4B63 A;  1M64 A;  4U8N A;  4J31 A;  2GR0 A;  4B1B A;  1BGJ A;  1E1M A;  5M0Z A;  3HYW A;  1PBE A;  4TM4 A;  2C65 A;  2WOV A;  4PAA A;  1DOC A;  4EIQ A;  5GSN A;  5HXI A;  2GQF A;  4G6G A;  3VRD B;  1BZL A;  1F8R A;  4FDC B;  3P4Q A;  3G5S A;  1BF3 A;  4USR A;  3H4K A;  3RED A;  3DGZ A;  4AOS A;  2C70 A;  1OJT A;  3SZC A;  1PHH A;  2JBV A;  4CRT A;  2BCP A;  3NYC A;  4MJW A;  3GRS A;  1N4U A;  1L0V A;  4CNK A;  2R0G A;  1MXT A;  1QLB A;  1SEZ A;  2YLW A;  3BHK A;  2JAE A;  4H4P A;  2FJD A;  4PAB A;  2GAG B;  5KMQ A;  3V3O A;  4YSZ A;  4D04 A;  1JRX A;  2BRY A;  4XWZ A;  3ISH A;  1LQU A;  1K4Q A;  1TDK A;  1F6M A;  3K7T A;  3NG7 X;  1GRE A;  4AP3 A;  1GV4 A;  1IUT A;  1ZMC A;  2YG3 A;  4OPC A;  4K5S A;  3BI2 A;  3LZX A;  4GRT A;  4U2T A;  3SQP A;  1F8S A;  4APN A;  2B7R A;  1JU2 A;  1QO8 A;  2WPC A;  2V60 A;  4HA6 A;  4EM4 A;  1CC2 A;  3DA1 A;  4H4Q A;  1NAA A;  2BK5 A;  3GDP A;  1GRT A;  2VRM A;  2ARD A;  5HHF A;  5KXJ A;  3SZF A;  3CGB A;  3DK9 A;  4Y4N A;  2JB3 A;  3NKS A;  3P4P A;  1DJN A;  3QFA A;  3UOV A;  4H4T A;  3SFD A;  1KF6 A;  3OC4 A;  2JB1 A;  2ZZC A;  3ALM A;  3IWA A;  4WX1 A;  4CBQ A;  4NTC A;  2E1M A;  3L1R A;  3IHM A;  3CN8 A;  3GYJ A;  1O95 A;  1H86 A;  3HYX A;  5FS8 A;  2X99 A;  1CL0 A;  1PN0 A;  1E1N A;  2R4E A;  4CNJ A;  4K22 A;  3EF6 A;  4ADW A;  3CMM A;  3K7Q X;  3DJG X;  3KVE A;  4JY2 A;  2FJB A;  3KU9 A;  4IV9 A;  2WOI A;  4GDE A;  4EMJ A;  1K0J A;  4H4W A;  4G74 A;  1NHS A;  4A79 A;  1YY5 A;  3Q6J A;  3KA7 A;  2FJE A;  3AE9 A;  3FIM B;  1D7Y A;  2QCU A;  4OPL A;  3ALL A;  4G6H A;  3CNJ A;  3VR8 A;  2X3N A;  2PYX A;  2JK6 A;  1REO A;  3ICS A;  5KOW A;  5FMH A;  5KMR A;  1EL7 A;  2YLS A;  1H83 A;  5GRT A;  4TM0 A;  3UP4 A;  2BCG G;  2NPX A;  1K0L A;  3NIX A;  3UTH A;  2R9Z A;  2BA9 A;  1PXB A;  4NTE A;  1XDI A;  3AE6 A;  3QVR A;  4IA5 A;  2OA1 A;  4U2L A;  2OLO A;  5EB4 A;  4BK2 A;  3QVP A;  3UKH A;  2V5Z A;  1D7L A;  2WPE A;  3AE7 A;  3GD4 A;  4ICY A;  1E1K A;  4OPT A;  1CC6 A;  1COY A;  2VRL A;  4N9X A;  2IVD A;  2BS2 A;  2X8H A;  1BKW A;  4YSH A;  4GDP A;  3G5Q A;  4OPI A;  1PBF A;  4YTP A;  4ZN0 A;  2GR2 A;  1FL2 A;  2HQM A;  3HZL A;  4KX6 A;  1GRA A;  1IUW A;  1CJ3 A;  3ICT A;  3ALJ A;  1BWC A;  2V3A A;  3GDN A;  3RNM A;  3UP5 A;  3VR9 A;  4H2R A;  4M52 A;  4AT0 A;  2JB2 A;  2YVG A;  4J33 A;  3AB1 A;  4C3Y A;  1LV0 A;  3T14 A;  1H7W A;  1H6V A;  5BUK A;  1B4V A;  3UTG A;  1LTX R;  1JNZ A;  2H88 A;  1E6E A;  1ZKQ A;  2ZBW A;  2BAC A;  4UP3 A;  4YKG A;  3GSI A;  2WDR A;  5IQ1 A;  3S61 A;  3VQR A;  2C7G A;  1CHU A;  1L9C A;  4FK1 C;  5U25 A;  1GOS A;  2WDQ A;  3UKP A;  2QAE A;  4XXG A;  2TPR A;  2W0H A;  4II2 A;  3AEA A;  2Y6R A;  3ADA B;  4H50 A;  3AEG A;  5JCK A;  1DOB A;  5C3J A;  2BC1 A;  4TM1 A;  1CC4 A;  2CFY A;  1O5W A;  3AE4 A;  1CJ2 A;  2WPF A;  1Y56 B;  3CGD A;  4CCQ A;  5JCL A;  3UTF A;  4K7Z A;  5HY5 A;  3WE0 A;  3R9U A;  4CY8 A;  1TYT A;  2RGJ A;  1XAN A;  2GB0 A;  4Z25 A;  1D4D A;  3CIR A;  3OZ2 A;  4DSG A;  4JN9 A;  2VZ2 A;  2V6O A;  4RG4 A;  4ECH A;  4H4Z A;  1PJ6 A;  4EQR A;  2VOU A;  3M0O A;  1OJA A;  1PJ7 A;  2YG7 A;  4USQ A;  1JEH A;  3L8K A;  5EOW A;  2YWL A;  1NEK A;  3AE8 A;  3LJP A;  3GRT A;  5CKU A;  1ELI A;  1QJD A;  3GWF A;  4RG3 A;  1RYI A;  2YVF A;  1IUS A;  1TRB A;  4NZH A;  3NT6 A;  4JNA A;  5EBK A;  3K7M X;  3QSE A;  2C75 A;  1ONF A;  4H7U A;  1ZP0 A;  2WU5 A;  1KNP A;  2YLZ A;  2YLR A;  3AEE A;  3C96 A;  3KLJ A;  4B68 A;  1D4C A;  1TDF A;  3F8D A;  3C4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...