4GF7A

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco), unliganded form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
370
Chain Sequence
b'KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 127
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4gf7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gf7A01
2BS4A 1KNPA 4RSLA 3O0HA 2CFYA 2WOWA 4YTPA 1DOBA 5JCMA 2WP6A 1BGJA 1L9CA 4H4TA 1H81A 4AT0A 3ICRA 1QLBA 1F8SA 2X8CA 4A79A 4Z24A 3KA7A 4EIPA 1LQUA 2VVLG 4LU6A 2GMJA 4C5OA 1K0IA 1CJ4A 2GF3A 4A99A 3K7TA 1REOA 1K0LA 2GRTA 4I59A 4CY8A 1E1NA 1XDIA 4H4QA 1D4DA 1VRQB 5FS8A 4OPLA 3UKPA 1Y56B 3DMEA 3UTGA 2BS3A 2RABA 4O5UA 3CN8A 4RG4A 3G5SA 3I3LA 5FMHA 3VR9A 2O9ZA 3BNUA 3IWAA 2IIDA 1GSNA 2V60A 4DSGA 2JBVA 3BI2A 3AWIA 1OJCA 3UKLA 1ZOYA 4U8MA 4ZCCA 3CGEA 4YSXA 3BI4A 4CCRA 4K7ZA 4N9XA 4OVIA 2RGJA 2Q7VA 2AR8A 4TM0A 4YSHA 2A8XA 1PBBA 4H4WA 2GMHA 4X4JA 4B65A 1AOGA 2XVFA 3QSEA 1BKWA 1ZMDA 2XDOA 4K2XA 2VRMA 2V61A 3ABVA 4H4VA 3P4QA 4OCGA 4PABA 4ZN0A 3CNSA 1YQZA 4NZHA 1GRHA 2VVLA 3LJPA 5CQFA 3DK8A 4EQSA 1D7YA 1L9DA 2ZZBA 2C66A 4B69A 1W4XA 4YTNA 5U1OA 4OPUA 3AD8B 3LADA 2C7GA 4FX9A 2JK6A 4IVMB 3FG2P 2YG7A 2X8GA 5HY5A 4KPRA 2JKCA 4H7UA 1DOCA 3VQRA 3QSSA 3B6DA 2R9ZA 3F8DA 1FEBA 1CJ2A 1MOKA 4OPGA 3RP7A 3AEEA 1N4UA 2APGA 2Z5XA 3NNEA 2YLWA 3P9UA 4H4ZA 1F8WA 3RP6A 2VRLA 2CULA 4FDCB 3RP8A 1IUWA 1DJQA 4B68A 1IUTA 3P4RA 3FPZA 1IUUA 2TMDA 3NHOX 4Y4MA 4H2PA 4C77A 3NTAA 3UOXA 3L8KA 3AEBA 3AE4A 4D04A 3NG7X 2WPFA 3HZLA 4IVOB 4MJWA 1K4QA 2WS3A 4CCQA 3NIXA 4A7AA 3CNJA 2FBWA 4A6NB 4NEWA 4O5QA 4AT2A 4EM3A 4BJZA 3SQPA 1GRBA 5FS9A 1GERA 2XVIA 2BC1A 2XYOA 3BNMA 4HA6A 1BZLA 4K5SA 3AE6A 1F6MA 3P1WA 4Y4LA 2WESA 1GV4A 1GXFA 3UP5A 4J56A 3AB1A 5EBKA 1H7XA 3KPFA 5J60A 2QA1A 4GDPA 4ICYA 2BABA 1LVLA 3EPTA 2C3CA 1DODA 1N1PA 4E0VA 4H4UA 4AP1A 3ICTA 1O95A 1V59A 3F8RA 1EL7A 1E1KA 3DK9A 2PHHA 1NHSA 3ITJA 3NTDA 2EQ8A 1ELIA 4U8KA 4CY6A 3PVCA 4U2LA 3URHA 1E1MA 2HQMA 2Q0KA 3DGZA 1CL0A 2YG5A 2GQWA 2GV8A 3DGHA 3GYJA 5DBJA 1LPFA 1RSGA 3UOZA 4AP3A 1IJHA 1CC4A 3GDPA 4A9WA 3C96A 1EL5A 4BK3A 4B67A 3FBSA 3CGBA 4BK1A 1QJDA 3NYCA 2YVJA 2H88A 4JY3A 1K0JA 2JAEA 1JNRA 3EAOA 2FJAA 1RYIA 3DA1A 4ADWA 3AE7A 1NHQA 3FIMB 4EQWA 2WDRA 2PYXA 2X3NA 2JB1A 5C3JA 2VOUA 2TPRA 2V3BA 2GAGB 2BCPA 2C70A 2WP5A 2C64A 1CC2A 2EQ6A 1VQWA 1CJ3A 3CIRA 3DH9A 3DJDA 2W0HA 3NYEA 4H4RA 2YG4A 5HXIA 1JU2A 2YLSA 2GR0A 3Q9TA 3CGDA 3KKJA 1H86A 1NAAA 5J7XA 1H7WA 4HB9A 4YT0A 5M10A 1ZY8A 5U63A 1PBCA 3BI5A 4A65A 1LJ1A 1FL2A 1B5QA 4XWZA 1GTEA 2GAHB 2GB0A 3GRTA 3ZYXA 3CGCA 3AE9A 5JCIA 4GDEA 2YLTA 3RHAA 3UTFA 1XANA 3R9UA 3K7MX 3GRSA 1D4CA 4BV6A 3I6DA 3QFBA 1TDFA 2QCUA 2WU2A 1BF3A 5M0ZA 4U8JA 3CNTA 4YWOA 1GREA 4DGKA 1PS9A 1FCDA 4UDQA 2UZZA 3T37A 1PBFA 4EIQA 3AEFA 3DJJA 2H89A 1EL8A 2GH5A 1O94A 3ATRA 1PN0A 2OLOA 2XFOA 4XWRA 4H2NA 4EM4A 5ER0A 4NTEA 5HHFA 1LV0A 4H2RA 2E1MA 4Z43A 3SGLA 2XFNA 4TM4A 1H6VA 4UP3A 3S61A 1PXAA 3ICSA 4NTCA 3G5RA 1F3PA 1YQ3A 3QSMA 2WU5A 4CNJA 4JDRA 2EQ9A 2R0GA 4RG3A 4NTDA 3H4KA 3ISHA 1NPXA 1PXBA 3PO7A 4BURA 3GDNA 2R0CA 1X31B 2C75A 2BCGG 4YSYA 3M0OA 1GEUA 3GWFA 4LA1A 5KOXA 3AEAA 1HYUA 3UTHA 2BK4A 4U8LA 1CHUA 1Z6LA 2B7SA 2WETA 2B9YA 3C4NA 1COYA 4H4YA 2YLRA 3Q6JA 1IUSA 3ATQA 1S3BA 5JCNA 3AE1A 1H82A 2YVFA 3FMWA 3IF9A 4BK2A 1CF3A 2BA9A 2VZ2A 2B9XA 2WHDA 2VVMA 2XLTA 4B64A 3CPIG 2XVEA 2R4EA 1GRAA 4XXGA 2V5ZA 4Z2RA 2YM2A 2E4GA 1OJDA 3P4SA 5EB5A 3UTEA 1M6IA 4AOXA 4APNA 1Q1WA 1OJTA 2GR2A 3PS9A 2QA2A 4YKGA 3LB8A 2XLSA 3GD3A 4JY2A 3GD4A 1PDHA 2R45A 2C73A 2AQJA 2XLUA 3UOVA 5FS6A 5KOWA 1CBOA 1GETA 2Q6UA 2WOVA 3E1TA 4OPIA 4U2TA 3RNMA 4GCMA 3GMCA 1TDKA 1MXTA 2BXSA 1B8SA 4EQRA 3SFEA 3KU9A 3AE3A 1PXCA 2IVDA 3ADAB 5JCKA 2WP9A 3C4AA 3UCLA 1KSSA 4U8OA 1B37A 1VDCA 3NK2X 4J57A 5U25A 1N4VA 1KFYA 3V76A 4EQXA 2YM1A 3QFAA 1GTHA 5JCLA 4B1BA 1B4VA 5EOWA 1NENA 2BS2A 2ZBWA 1S3EA 2GVCA 4H2QA 4J33A 3BHFA 3SFDA 5BVAA 1XHCA 4DNAA 4Z2TA 5TR3A 3OC4A 1RP0A 1JOAA 2VQ7A 4WCTA 4X9MA 2WPEA 1GALA 4K8DA 4C3YA 3ZDNA 1IUXA 4H4PA 4EMWA 1Y56A 1KSUA 3VRBA 1ZDLA 2YWLA 1YY5A 2C76A 4C74A 4OPDA 1OJ9A 5KVIA 3WE0A 2XVHA 1Q9IA 4YXDA 3KVEA 3QVRA 3KD9A 4EMJA 3AYJA 4WX1A 4USRA 2XFPA 3NRNA 1VG9A 3EANA 3DK4A 4J36A 1KDGA 1O5WA 2YR5A 2GQFA 3V3OA 2B7RA 5GRTA 2EQ7A 2FJDA 2Q0LA 3LZXA 4KX6A 1VG0A 4UDRA 4OPCA 1ZKQA 1GOSA 5IQ1A 4IA6A 2OAMA 4Z44A 1ZK7A 3AE5A 2B76A 1ZP0A 2OLNA 3UKQA 1NEKA 2Y6QA 5BRTA 4CNKA 2BK5A 1NDAA 4J34A 3NH3X 3UP4A 1JNZA 1YKJA 2GR1A 3UKFA 4DSHA 2GEWA 3AXBA 1NHRA 4U8PA 1ZOVA 4BJYA 1DOEA 3AYIA 1D4EA 1D7LA 3EF6A 3V3NA 1EL9A 1QO8A 1JEHA 4UDPA 3II4A 5CKUA 1JRZA 1L9EA 1LQTA 1ZMCA 2YLZA 4GF7A 3L1RA 3NN0X 4CBQA 1JRXA 4AOSA 1YQ4A 3IHMA 1PBDA 2YG3A 3VRAA 3IC9A 3NK1X 4Y4NA 2Y6RA 3AE8A 1TRBA 3NYFA 4GUVA 2DKHA 2V6OA 2A87A 2C72A 1OJAA 2A89A 3CPJG 3COXA 2I0ZA 3NKSA 1LTXR 4U8NA 4FK1A 1FECA 4ZCDA 5L46A 4TM1A 2BC0A 1E7PA 5C2TA 1D5TA 4IA5A 5HYMA 5KRQA 1GT8A 2E5VA 4A6NA 4K22A 2WEUA 3AD9B 1GPEA 3UOYA 3LZWA 1BGNA 1PHHA 4P9SA 3DJGX 1NG4A 2C3DA 4H4XA 4YTMA 2NPXA 4U8IA 3OZ2A 3VR8A 4K5RA 3GWDA 3M12A 3IHGA 3AECA 1P2HA 3NN6X 1P2EA 3VRDB 4J31A 5FS7A 1IUVA 1M64A 2QAEA 3CNPA 2YR6A 5KWFA 1KNRA 1S2YA 2WQYA 3CPHG 3KLJA 5IPYA 1FOHA 3CNDA 2GR3A 2BK3A 1MO9A 5LV9A 3AEDA 4TLZA 3LXDA 4X9NA 1NG3A 1CJCA 3JSKA 4OPTA 2YR4A 3CTYA 3NGCX 4JQ9A 2JB2A 1TDOA 3ALLA 1L0VA 3UKKA 3QVPA 1PJ5A 3NK0X 3GYIA 3QJ4A 3BHKA 4H50A 4PAAA 1GNDA 2YG6A 1Q1RA 4JNAA 5GSNA 2RGHA 3P4PA 2XFQA 3K30A 3H8LA 1S2QA 3K7QX 4U2SA 4A5LA 3SM8A 1GRTA 4TLXA 2BACA 3ALJA 4EMIA 3ALMA 5BULA 1TDEA 2XLPA 3D8XA 3M13A 2AAQA 5EB4A 2XLRA 2BYBA 2R4JA 1NHPA 3LOVA 1CC6A 1GRFA 2VQBA 2ZZCA 3B3RA 4I58A 4TM3A 3AYLA 1TDNA 1GRGA 1PJ7A 2YQUA 1FEAA 2BXRA 3GMBA 2WDQA 1DXLA 1SEZA 2WOIA 4H4SA 5IQ4A 2CDUA 1E6EA 1Y0PA 4YKFA 2J3NA 2FJEA 2OALA 5KVHA 1PJ6A 1TYTA 4FK1C 1KF6A 1BWCA 2X8HA 2NVKX 4Z25A 1EBDA 2B9WA 4Z2UA 2IVEA 2C67A 1F8RA 3NT6A 2JB3A 2XVJA 3H8IA 1E1LA 2WDVA 1H84A 2WPCA 5BUKA 3UKHA 2R46A 2X50A 3GSIA 4GR1A 2CVJA 4IV9A 1ONFA 2WBAA 4GRTA 2F5ZA 4CRTA 2R0PA 2V3AA 3NLCA 2XFUA 4M52A 4USQA 2ZZ0A 3F8PA 3AEGA 4LIIA 2RGOA 2YVGA 1XPQA 2ARDA 2Z5YA 4ECHA 3AE2A 3G5QA 4B66A 1UKVG 1DJNA 1JRYA 3D1CA 4NEVA 2FJBA 4JN9A 3UKAA 1DNCA 2YAUA 1H83A 2C65A 2YLXA 3DJEA 4J2WA 1N4WA 4D03A 2XCGA 4JNQA 4REKA 4Z26A 3AD7B 1E39A 2DKIA 4B63A 2X99A 1ZX9A 1PBEA 2ACZA 3REDA 1TYPA 4YSZA 4C3XA 3S5WA 1GESA 2OA1A 5KXJA
chains in the Genus database with same CATH superfamily
2BS4A 2E82A 4RSLA 1KNPA 3O0HA 2CFYA 3ZNQA 2WOWA 4YTPA 1DOBA 1C0IA 5JCMA 2WP6A 1BGJA 1L9CA 4H4TA 5KNLA 1H81A 4AT0A 3ICRA 1QLBA 1F8SA 2X8CA 4A79A 4Z24A 3KA7A 4EIPA 1LQUA 2VVLG 4LU6A 4YJDA 2GMJA 4C5OA 4G74A 1K0IA 1CJ4A 2GF3A 4A99A 3K7TA 1REOA 1K0LA 4YJGB 2GRTA 4I59A 4CY8A 3HYVA 1E1NA 1XDIA 4H4QA 1D4DA 1VRQB 5FS8A 4OPLA 3UKPA 4K5SA 1Y56B 3DMEA 3UTGA 2BS3A 2RABA 4O5UA 3CN8A 4RG4A 3G5SA 3I3LA 5FMHA 3VR9A 2O9ZA 3BNUA 3IWAA 1EVIA 2IIDA 1GSNA 2V60A 4DSGA 2JBVA 3BI2A 3AWIA 3W4KA 1OJCA 3UKLA 1ZOYA 4U8MA 4ZCCA 3CGEA 4YSXA 3BI4A 4CCRA 4K7ZA 4N9XA 4OVIA 2RGJA 2Q7VA 2AR8A 4TM0A 4QFCA 4YSHA 2A8XA 1PBBA 4H4WA 3T2KA 2GMHA 4X4JA 4B65A 1AOGA 3QSEA 2XVFA 1BKWA 1C0KA 1ZMDA 2XDOA 4K2XA 2DU8A 3T2ZA 2VRMA 2V61A 3ABVA 4H4VA 4NNJA 3P4QA 4OCGA 4PABA 4ZN0A 3CNSA 1YQZA 4NZHA 1GRHA 2VVLA 3LJPA 5CQFA 3DK8A 4EQSA 1D7YA 1L9DA 2ZZBA 2C66A 4B69A 1W4XA 4YTNA 5U1OA 4OPUA 3AD8B 3LADA 2C7GA 4FX9A 2JK6A 4IVMB 3FG2P 2YG7A 2X8GA 5HY5A 4KPRA 2JKCA 4H7UA 1DOCA 3QSSA 3B6DA 2R9ZA 3RP7A 1FEBA 1CJ2A 1MOKA 3F8DA 4OPGA 3AEEA 1N4UA 2APGA 2Z5XA 3NNEA 2YLWA 3P9UA 4H4ZA 1F8WA 3RP6A 2VRLA 2CULA 3RP8A 4FDCB 1IUWA 1DJQA 2BRYA 4B68A 1IUTA 3P4RA 3FPZA 1IUUA 2TMDA 3NHOX 4Y4MA 4H2PA 4C77A 3NTAA 3UOXA 3L8KA 3AEBA 3AE4A 4D04A 3NG7X 2WPFA 3HZLA 4IVOB 4MJWA 1K4QA 2WS3A 4CCQA 3NIXA 4A7AA 1C0LA 3CNJA 2FBWA 4A6NB 4NEWA 4O5QA 4AT2A 4EM3A 4BJZA 3SQPA 1GRBA 5FS9A 1GERA 2XVIA 2BC1A 2XYOA 3VQRA 3BNMA 4YJFB 1BZLA 3AE6A 1F6MA 3P1WA 4HA6A 2WESA 1GV4A 4Y4LA 1GXFA 3UP5A 4J56A 3AB1A 5EBKA 1H7XA 3KPFA 3HYXA 2QA1A 4GDPA 5J60A 4ICYA 2BABA 1LVLA 3EPTA 2C3CA 1DODA 1N1PA 4E0VA 4H4UA 4AP1A 3ICTA 1O95A 1V59A 3F8RA 1EL7A 1E1KA 3DK9A 2PHHA 1NHSA 3ITJA 3NTDA 2EQ8A 1ELIA 4U8KA 4CY6A 3PVCA 4U2LA 3URHA 1E1MA 2HQMA 2Q0KA 3DGZA 1CL0A 2YG5A 2GQWA 2GV8A 3DGHA 3GYJA 5KMSA 3KPKA 5DBJA 1LPFA 1RSGA 3UOZA 4AP3A 1IJHA 5KMPA 1CC4A 3GDPA 4A9WA 3CMMA 3C96A 1EL5A 4BK3A 4B67A 3FBSA 3CGBA 4BK1A 3NYCA 1QJDA 2YVJA 2H88A 4JY3A 1K0JA 2JAEA 1JNRA 3EAOA 3DA1A 1RYIA 2FJAA 4ADWA 3AE7A 1NHQA 3FIMB 4EQWA 2WDRA 2PYXA 2X3NA 2JB1A 5C3JA 2VOUA 2TPRA 2V3BA 2GAGB 2BCPA 2C70A 2WP5A 2C64A 1CC2A 2EQ6A 1VQWA 1CJ3A 3CIRA 3DH9A 4G9KA 3DJDA 3NYEA 2W0HA 4H4RA 2YG4A 5HXIA 1JU2A 2YLSA 2GR0A 3Q9TA 3CGDA 3KKJA 1H86A 1NAAA 5J7XA 1H7WA 4HB9A 4YT0A 5M10A 1ZY8A 5U63A 1PBCA 3BI5A 4A65A 1LJ1A 1FL2A 1B5QA 4XWZA 1GTEA 2GAHB 2GB0A 3GRTA 3ZYXA 3CGCA 3AE9A 5JCIA 4GDEA 2YLTA 3RHAA 3UTFA 3G3EA 1XANA 3R9UA 3K7MX 3GRSA 4QFDA 1D4CA 4BV6A 3I6DA 3QFBA 1TDFA 2QCUA 2WU2A 1BF3A 5M0ZA 4U8JA 3CNTA 4YWOA 1GREA 4DGKA 1PS9A 1FCDA 4UDQA 2UZZA 3T0KA 3T37A 1KIFA 1PBFA 4EIQA 3AEFA 3DJJA 2H89A 1EL8A 2GH5A 1O94A 3ATRA 1PN0A 2OLOA 2XFOA 4XWRA 4H2NA 4EM4A 5ER0A 4NTEA 5HHFA 1LV0A 4H2RA 2E1MA 4Z43A 3SGLA 2XFNA 4TM4A 1H6VA 4UP3A 3S61A 1PXAA 3ICSA 4NTCA 3G5RA 1F3PA 3QSMA 1YQ3A 2WU5A 4CNJA 4JDRA 2EQ9A 2R0GA 4RG3A 4NTDA 3H4KA 3ISHA 1NPXA 1PXBA 3PO7A 4BURA 3GDNA 1X31B 2R0CA 2C75A 2BCGG 4YSYA 3M0OA 1GEUA 3GWFA 4LA1A 5KOXA 3AEAA 1HYUA 3UTHA 2BK4A 4U8LA 1CHUA 1Z6LA 2B7SA 3C4NA 2B9YA 2WETA 1COYA 4YJHA 4H4YA 2YLRA 3Q6JA 1IUSA 3ATQA 1S3BA 4II2A 5JCNA 3AE1A 3IF9A 1H82A 2YVFA 3FMWA 4BK2A 1CF3A 2BA9A 2VZ2A 2B9XA 2WHDA 2VVMA 2XLTA 2E49A 4B64A 3WGTA 3CPIG 2XVEA 2R4EA 1GRAA 4XXGA 2V5ZA 4Z2RA 3SZWA 1VE9A 2YM2A 2E4GA 1OJDA 3ZNOA 3P4SA 5EB5A 3UTEA 1M6IA 4AOXA 4APNA 1Q1WA 1OJTA 2GR2A 3PS9A 2QA2A 4YKGA 3LB8A 2XLSA 4G6GA 3GD3A 4JY2A 3SZ0A 2E48A 3GD4A 1PDHA 2R45A 2C73A 2AQJA 2XLUA 3UOVA 5FS6A 5KOWA 1CBOA 2Q6UA 1GETA 3E1TA 2WOVA 4OPIA 3SX6A 4U2TA 3SYIA 3RNMA 4GCMA 3GMCA 1TDKA 1MXTA 2BXSA 1B8SA 4EQRA 3SFEA 3KU9A 3AE3A 1PXCA 2BRAA 2IVDA 3ADAB 5JCKA 2WP9A 3C4AA 3UCLA 1KSSA 4U8OA 1B37A 1VDCA 3NK2X 4J57A 5U25A 1N4VA 1KFYA 3V76A 3SXIA 4EQXA 2YM1A 3QFAA 1GTHA 5JCLA 4B1BA 1B4VA 1DDOA 5EOWA 1NENA 2BS2A 2ZBWA 4G73A 1S3EA 2GVCA 4H2QA 4J33A 3BHFA 3SFDA 5BVAA 1XHCA 4DNAA 4Z2TA 5TR3A 3OC4A 3SZFA 4X9MA 4WCTA 1JOAA 1RP0A 2VQ7A 4YJGA 2WPEA 3W4IA 1GALA 4K8DA 4C3YA 3ZDNA 1IUXA 4H4PA 4EMWA 1Y56A 1KSUA 3VRBA 1ZDLA 2YWLA 1YY5A 2C76A 4C74A 4OPDA 5KMRA 1OJ9A 5KVIA 3WE0A 2XVHA 3GYXA 1Q9IA 4YXDA 3KVEA 3QVRA 3KD9A 3CUKA 4EMJA 3AYJA 4WX1A 4USRA 2XFPA 3NRNA 1VG9A 3EANA 3DK4A 4J36A 1KDGA 1O5WA 2YR5A 2GQFA 3T2YA 3V3OA 2B7RA 5GRTA 3ZNNA 2EQ7A 2FJDA 2Q0LA 3LZXA 1VG0A 4KX6A 4UDRA 4OPCA 4G6HA 1ZKQA 1GOSA 5IQ1A 4IA6A 2OAMA 4Z44A 1ZK7A 3AE5A 2B76A 1ZP0A 2OLNA 3UKQA 1NEKA 2Y6QA 5BRTA 4CNKA 2BK5A 1NDAA 4J34A 3NH3X 3UP4A 1JNZA 1YKJA 2GR1A 3UKFA 4DSHA 3AXBA 2GEWA 1NHRA 4U8PA 1ZOVA 3SZCA 4BJYA 1DOEA 3AYIA 1D4EA 1D7LA 3EF6A 3V3NA 1EL9A 1QO8A 1JEHA 4UDPA 3II4A 5CKUA 1L9EA 1JRZA 1LQTA 1ZMCA 2YLZA 4GF7A 3L1RA 3NN0X 4CBQA 1JRXA 4AOSA 1YQ4A 3IHMA 1PBDA 2YG3A 3VRAA 3IC9A 3NK1X 4Y4NA 2Y6RA 3AE8A 1TRBA 3NYFA 4GUVA 2DKHA 2V6OA 2A87A 2C72A 1OJAA 2A89A 3CPJG 3T31A 3COXA 2I0ZA 5L46A 1LTXR 3NKSA 4FK1A 1FECA 4U8NA 4ZCDA 4TM1A 2BC0A 1E7PA 5C2TA 4IA5A 1D5TA 5HYMA 5KRQA 1GT8A 2E5VA 4A6NA 4K22A 3AD9B 2WEUA 1GPEA 3UOYA 3LZWA 1BGNA 1PHHA 4P9SA 3DJGX 1NG4A 2C3DA 4H4XA 4YJFA 2NPXA 4U8IA 4GAPA 4YTMA 2C4CA 3OZ2A 3VR8A 4K5RA 3GWDA 3M12A 3IHGA 3AECA 1P2HA 3NN6X 1P2EA 3VRDB 4J31A 5FS7A 1IUVA 1M64A 2QAEA 3CNPA 2YR6A 5KWFA 1KNRA 1S2YA 2WQYA 3CPHG 3KLJA 5IPYA 1FOHA 3CNDA 2GR3A 2BK3A 1MO9A 4GAVA 5LV9A 3AEDA 4TLZA 3LXDA 4X9NA 1NG3A 1DAOA 1CJCA 3JSKA 2YR4A 3CTYA 4OPTA 3NGCX 4JQ9A 1AN9A 2JB2A 1TDOA 3ALLA 1L0VA 3UKKA 3QVPA 1PJ5A 3NK0X 3GYIA 4PAAA 3BHKA 3QJ4A 4H50A 1GNDA 2YG6A 1Q1RA 4JNAA 5GSNA 2RGHA 3P4PA 2XFQA 3K30A 3H8LA 1S2QA 3K7QX 4U2SA 4A5LA 3SM8A 1GRTA 4TLXA 2BACA 3ALJA 4EMIA 3ALMA 5BULA 1TDEA 2XLPA 3D8XA 3M13A 2AAQA 5EB4A 2XLRA 2BYBA 2R4JA 1NHPA 3LOVA 1CC6A 3W4JA 1GRFA 2VQBA 2ZZCA 3B3RA 4I58A 4TM3A 3AYLA 1TDNA 3T14A 1GRGA 1PJ7A 2YQUA 1FEAA 2BXRA 3GMBA 2WDQA 4II3A 1DXLA 1SEZA 2WOIA 4H4SA 4NWZA 5IQ4A 2CDUA 1E6EA 1Y0PA 4YKFA 2J3NA 2FJEA 2OALA 5KVHA 1PJ6A 1TYTA 4FK1C 1KF6A 1BWCA 2X8HA 4YJHB 2NVKX 4Z25A 1EBDA 2B9WA 4Z2UA 2IVEA 3ZNPA 2C67A 1F8RA 3NT6A 2JB3A 2XVJA 3H8IA 1E1LA 2WDVA 1H84A 2WPCA 5BUKA 3UKHA 1C0PA 5KMQA 2R46A 2X50A 3GSIA 4GR1A 2CVJA 4IV9A 1ONFA 2WBAA 4GRTA 2F5ZA 4CRTA 2R0PA 2V3AA 3NLCA 2XFUA 4M52A 4USQA 2ZZ0A 3F8PA 3AEGA 4LIIA 2RGOA 3HYWA 2YVGA 1XPQA 3SY4A 2ARDA 2Z5YA 4ECHA 3AE2A 3G5QA 4B66A 1UKVG 1DJNA 1JRYA 3D1CA 4NEVA 2E4AA 2FJBA 4JN9A 1DNCA 2YAUA 3UKAA 1H83A 2C65A 3DJEA 2YLXA 4J2WA 1N4WA 4D03A 2XCGA 4JNQA 4REKA 4Z26A 3AD7B 1E39A 2DKIA 4B63A 2X99A 1ZX9A 1PBEA 2ACZA 3REDA 1TYPA 4YSZA 4C3XA 3S5WA 1GESA 2OA1A 5KXJA
chains in the Genus database with same CATH topology
2BS4A 1KNPA 4RSLA 3O0HA 2CFYA 2WOWA 4YTPA 1DOBA 5JCMA 2WP6A 1BGJA 1L9CA 4H4TA 5KNLA 1H81A 4AT0A 3ICRA 1QLBA 1F8SA 2X8CA 4A79A 4Z24A 3KA7A 4EIPA 1LQUA 2VVLG 4LU6A 2GMJA 4C5OA 4G74A 1K0IA 1CJ4A 2GF3A 4A99A 3K7TA 1REOA 1K0LA 2GRTA 4I59A 4CY8A 3HYVA 1E1NA 1XDIA 4H4QA 1D4DA 1VRQB 5FS8A 4OPLA 3UKPA 1Y56B 3DMEA 3UTGA 2BS3A 2RABA 4O5UA 3CN8A 4RG4A 3G5SA 3I3LA 5FMHA 3VR9A 2O9ZA 3BNUA 3IWAA 2IIDA 1GSNA 2V60A 4DSGA 2JBVA 3BI2A 3AWIA 1OJCA 3UKLA 1ZOYA 4U8MA 4ZCCA 3CGEA 4YSXA 3BI4A 4CCRA 4K7ZA 4N9XA 4OVIA 2RGJA 2Q7VA 2AR8A 4TM0A 4YSHA 2A8XA 1PBBA 4H4WA 3T2KA 2GMHA 4X4JA 4B65A 1AOGA 2XVFA 3QSEA 1BKWA 1ZMDA 2XDOA 4K2XA 3T2ZA 2VRMA 2V61A 3ABVA 4H4VA 4NNJA 3P4QA 4OCGA 4PABA 4ZN0A 3CNSA 1YQZA 4NZHA 1GRHA 2VVLA 3LJPA 5CQFA 3DK8A 4EQSA 1D7YA 1L9DA 2ZZBA 2C66A 4B69A 1W4XA 4YTNA 5U1OA 4OPUA 3AD8B 3LADA 2C7GA 4FX9A 2JK6A 4IVMB 3FG2P 2YG7A 2X8GA 5HY5A 4KPRA 2JKCA 4H7UA 1DOCA 3VQRA 3QSSA 3B6DA 2R9ZA 3RP7A 1FEBA 1CJ2A 1MOKA 3F8DA 4OPGA 3AEEA 1N4UA 2APGA 2Z5XA 3NNEA 2YLWA 3P9UA 4H4ZA 1F8WA 3RP6A 2VRLA 2CULA 3RP8A 4FDCB 1IUWA 1DJQA 2BRYA 4B68A 1IUTA 3P4RA 3FPZA 1IUUA 2TMDA 3NHOX 4Y4MA 4H2PA 4C77A 3NTAA 3UOXA 3L8KA 3AEBA 3AE4A 4D04A 3NG7X 2WPFA 3HZLA 4IVOB 4MJWA 1K4QA 2WS3A 4CCQA 3NIXA 4A7AA 3CNJA 2FBWA 4A6NB 4NEWA 4O5QA 4AT2A 4EM3A 4BJZA 3SQPA 1GRBA 5FS9A 1GERA 2XVIA 2BC1A 2XYOA 3BNMA 4HA6A 1BZLA 4K5SA 3AE6A 1F6MA 3P1WA 4Y4LA 2WESA 1GV4A 1GXFA 3UP5A 4J56A 3AB1A 5EBKA 1H7XA 3KPFA 3HYXA 2QA1A 4GDPA 5J60A 4ICYA 2BABA 1LVLA 3EPTA 2C3CA 1DODA 1N1PA 4E0VA 4H4UA 4AP1A 3ICTA 1O95A 1V59A 3F8RA 1EL7A 1E1KA 3DK9A 2PHHA 1NHSA 3ITJA 3NTDA 2EQ8A 1ELIA 4U8KA 4CY6A 3PVCA 4U2LA 3URHA 1E1MA 2HQMA 2Q0KA 3DGZA 1CL0A 2YG5A 2GQWA 2GV8A 3DGHA 3GYJA 5KMSA 3KPKA 5DBJA 1LPFA 1RSGA 3UOZA 4AP3A 1IJHA 5KMPA 1CC4A 3GDPA 4A9WA 3CMMA 3C96A 4BK3A 1EL5A 4B67A 3FBSA 3CGBA 4BK1A 1QJDA 3NYCA 2YVJA 2H88A 4JY3A 1K0JA 2JAEA 1JNRA 3EAOA 2FJAA 1RYIA 3DA1A 4ADWA 3AE7A 1NHQA 3FIMB 4EQWA 2WDRA 2PYXA 2X3NA 2JB1A 5C3JA 2VOUA 2TPRA 2V3BA 2GAGB 2BCPA 2C70A 2WP5A 2C64A 1CC2A 2EQ6A 1VQWA 1CJ3A 3CIRA 3DH9A 4G9KA 3DJDA 2W0HA 3NYEA 4H4RA 2YG4A 5HXIA 1JU2A 2YLSA 2GR0A 3Q9TA 3CGDA 3KKJA 1H86A 1NAAA 5J7XA 1H7WA 4HB9A 4YT0A 5M10A 1ZY8A 5U63A 1PBCA 3BI5A 4A65A 1LJ1A 1FL2A 1B5QA 4XWZA 1GTEA 2GAHB 2GB0A 3GRTA 3ZYXA 3CGCA 3AE9A 5JCIA 4GDEA 2YLTA 3RHAA 3UTFA 1XANA 3R9UA 3K7MX 3GRSA 1D4CA 4BV6A 3I6DA 3QFBA 1TDFA 2QCUA 2WU2A 1BF3A 5M0ZA 4U8JA 3CNTA 4YWOA 1GREA 4DGKA 1PS9A 1FCDA 4UDQA 2UZZA 3T0KA 3T37A 1PBFA 4EIQA 3AEFA 3DJJA 2H89A 1EL8A 2GH5A 1O94A 3ATRA 1PN0A 2OLOA 2XFOA 4XWRA 4H2NA 4EM4A 5ER0A 4NTEA 5HHFA 1LV0A 4H2RA 2E1MA 4Z43A 3SGLA 2XFNA 4TM4A 1H6VA 4UP3A 3S61A 1PXAA 3ICSA 4NTCA 3G5RA 1F3PA 1YQ3A 3QSMA 2WU5A 4CNJA 4JDRA 2EQ9A 2R0GA 4RG3A 4NTDA 3H4KA 3ISHA 1NPXA 1PXBA 3PO7A 4BURA 3GDNA 2R0CA 1X31B 2C75A 2BCGG 4YSYA 3M0OA 1GEUA 3GWFA 4LA1A 5KOXA 3AEAA 1HYUA 3UTHA 2BK4A 4U8LA 1CHUA 1Z6LA 2B7SA 2WETA 2B9YA 3C4NA 1COYA 4H4YA 2YLRA 3Q6JA 1IUSA 3ATQA 1S3BA 4II2A 5JCNA 3AE1A 1H82A 2YVFA 3FMWA 3IF9A 4BK2A 1CF3A 2BA9A 2VZ2A 2B9XA 2WHDA 2VVMA 2XLTA 4B64A 3CPIG 2XVEA 2R4EA 1GRAA 4XXGA 2V5ZA 4Z2RA 3SZWA 2YM2A 2E4GA 1OJDA 3P4SA 5EB5A 3UTEA 1M6IA 4AOXA 4APNA 1Q1WA 1OJTA 2GR2A 3PS9A 2QA2A 4YKGA 3LB8A 2XLSA 4G6GA 3GD3A 4JY2A 3SZ0A 3GD4A 1PDHA 2R45A 2C73A 2AQJA 2XLUA 3UOVA 5FS6A 5KOWA 1CBOA 1GETA 2Q6UA 3E1TA 2WOVA 4OPIA 3SX6A 4U2TA 3SYIA 3RNMA 4GCMA 3GMCA 1TDKA 1MXTA 2BXSA 1B8SA 4EQRA 3SFEA 3KU9A 3AE3A 1PXCA 2BRAA 2IVDA 3ADAB 5JCKA 2WP9A 3C4AA 3UCLA 1KSSA 4U8OA 1B37A 1VDCA 3NK2X 4J57A 5U25A 1N4VA 1KFYA 3V76A 3SXIA 4EQXA 2YM1A 3QFAA 1GTHA 5JCLA 4B1BA 1B4VA 5EOWA 1NENA 2BS2A 2ZBWA 4G73A 1S3EA 2GVCA 4H2QA 4J33A 3BHFA 3SFDA 5BVAA 1XHCA 4DNAA 4Z2TA 5TR3A 3OC4A 3SZFA 1RP0A 1JOAA 2VQ7A 4WCTA 4X9MA 2WPEA 1GALA 4K8DA 4C3YA 3ZDNA 1IUXA 4H4PA 4EMWA 1Y56A 1KSUA 3VRBA 1ZDLA 2YWLA 1YY5A 2C76A 4C74A 4OPDA 5KMRA 1OJ9A 5KVIA 3WE0A 2XVHA 3GYXA 1Q9IA 4YXDA 3KVEA 3QVRA 3KD9A 4EMJA 3AYJA 4WX1A 4USRA 2XFPA 3NRNA 1VG9A 3EANA 3DK4A 4J36A 1KDGA 1O5WA 2YR5A 2GQFA 3T2YA 3V3OA 2B7RA 5GRTA 2EQ7A 2FJDA 2Q0LA 3LZXA 4KX6A 1VG0A 4UDRA 4OPCA 4G6HA 1ZKQA 1GOSA 5IQ1A 4IA6A 2OAMA 4Z44A 1ZK7A 3AE5A 2B76A 1ZP0A 2OLNA 3UKQA 1NEKA 2Y6QA 5BRTA 4CNKA 2BK5A 1NDAA 4J34A 3NH3X 3UP4A 1JNZA 1YKJA 2GR1A 3UKFA 4DSHA 2GEWA 3AXBA 1NHRA 4U8PA 1ZOVA 3SZCA 4BJYA 1DOEA 3AYIA 1D4EA 1D7LA 3EF6A 3V3NA 1EL9A 1QO8A 1JEHA 4UDPA 3II4A 5CKUA 1JRZA 1L9EA 1LQTA 1ZMCA 2YLZA 4GF7A 3L1RA 3NN0X 4CBQA 1JRXA 4AOSA 1YQ4A 3IHMA 1PBDA 2YG3A 3VRAA 3IC9A 3NK1X 4Y4NA 2Y6RA 3AE8A 1TRBA 3NYFA 4GUVA 2DKHA 2V6OA 2A87A 2C72A 1OJAA 2A89A 3CPJG 3T31A 3COXA 2I0ZA 3NKSA 1LTXR 4U8NA 4FK1A 1FECA 4ZCDA 5L46A 4TM1A 2BC0A 1E7PA 5C2TA 4IA5A 1D5TA 5HYMA 5KRQA 1GT8A 2E5VA 4A6NA 4K22A 2WEUA 3AD9B 1GPEA 3UOYA 3LZWA 1BGNA 1PHHA 4P9SA 3DJGX 1NG4A 2C3DA 4H4XA 4YTMA 2NPXA 4U8IA 4GAPA 2C4CA 3OZ2A 3VR8A 4K5RA 3GWDA 3M12A 3IHGA 3AECA 1P2HA 3NN6X 1P2EA 3VRDB 4J31A 5FS7A 1IUVA 1M64A 2QAEA 3CNPA 2YR6A 5KWFA 1KNRA 1S2YA 2WQYA 3CPHG 3KLJA 5IPYA 1FOHA 3CNDA 2GR3A 2BK3A 1MO9A 4GAVA 5LV9A 3AEDA 4TLZA 3LXDA 4X9NA 1NG3A 1CJCA 3JSKA 4OPTA 2YR4A 3CTYA 3NGCX 4JQ9A 2JB2A 1TDOA 3ALLA 1L0VA 3UKKA 3QVPA 1PJ5A 3NK0X 3GYIA 3QJ4A 3BHKA 4H50A 4PAAA 1GNDA 2YG6A 1Q1RA 4JNAA 5GSNA 2RGHA 3P4PA 2XFQA 3K30A 3H8LA 1S2QA 3K7QX 4U2SA 4A5LA 3SM8A 1GRTA 4TLXA 2BACA 3ALJA 4EMIA 3ALMA 5BULA 1TDEA 2XLPA 3D8XA 3M13A 2AAQA 5EB4A 2XLRA 2BYBA 2R4JA 1NHPA 3LOVA 1CC6A 1GRFA 2VQBA 2ZZCA 3B3RA 4I58A 4TM3A 3AYLA 1TDNA 3T14A 1GRGA 1PJ7A 2YQUA 1FEAA 2BXRA 3GMBA 2WDQA 4II3A 1DXLA 1SEZA 2WOIA 4H4SA 4NWZA 5IQ4A 2CDUA 1E6EA 1Y0PA 4YKFA 2J3NA 2FJEA 2OALA 5KVHA 1PJ6A 1TYTA 4FK1C 1KF6A 1BWCA 2X8HA 2NVKX 4Z25A 1EBDA 2B9WA 4Z2UA 2IVEA 2C67A 1F8RA 3NT6A 2JB3A 2XVJA 3H8IA 1E1LA 2WDVA 1H84A 2WPCA 5BUKA 3UKHA 5KMQA 2R46A 2X50A 3GSIA 4GR1A 2CVJA 4IV9A 1ONFA 2WBAA 4GRTA 2F5ZA 4CRTA 2R0PA 2V3AA 3NLCA 2XFUA 4M52A 4USQA 2ZZ0A 3F8PA 3AEGA 4LIIA 2RGOA 3HYWA 2YVGA 1XPQA 3SY4A 2ARDA 2Z5YA 4ECHA 3AE2A 3G5QA 4B66A 1UKVG 1DJNA 1JRYA 3D1CA 4NEVA 2FJBA 4JN9A 3UKAA 1DNCA 2YAUA 1H83A 2C65A 2YLXA 3DJEA 4J2WA 1N4WA 4D03A 2XCGA 4JNQA 4REKA 4Z26A 3AD7B 1E39A 2DKIA 4B63A 2X99A 1ZX9A 1PBEA 2ACZA 3REDA 1TYPA 4YSZA 4C3XA 3S5WA 1GESA 2OA1A 5KXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS4 A;  1KNP A;  4RSL A;  3O0H A;  2CFY A;  2WOW A;  4YTP A;  1DOB A;  5JCM A;  2WP6 A;  1BGJ A;  1L9C A;  4H4T A;  1H81 A;  4AT0 A;  3ICR A;  1QLB A;  1F8S A;  2X8C A;  4A79 A;  4Z24 A;  3KA7 A;  4EIP A;  1LQU A;  2VVL G;  4LU6 A;  2GMJ A;  4C5O A;  1K0I A;  1CJ4 A;  2GF3 A;  4A99 A;  3K7T A;  1REO A;  1K0L A;  2GRT A;  4I59 A;  4CY8 A;  1E1N A;  1XDI A;  4H4Q A;  1D4D A;  1VRQ B;  5FS8 A;  4OPL A;  3UKP A;  1Y56 B;  3DME A;  3UTG A;  2BS3 A;  2RAB A;  4O5U A;  3CN8 A;  4RG4 A;  3G5S A;  3I3L A;  5FMH A;  3VR9 A;  2O9Z A;  3BNU A;  3IWA A;  2IID A;  1GSN A;  2V60 A;  4DSG A;  2JBV A;  3BI2 A;  3AWI A;  1OJC A;  3UKL A;  1ZOY A;  4U8M A;  4ZCC A;  3CGE A;  4YSX A;  3BI4 A;  4CCR A;  4K7Z A;  4N9X A;  4OVI A;  2RGJ A;  2Q7V A;  2AR8 A;  4TM0 A;  4YSH A;  2A8X A;  1PBB A;  4H4W A;  2GMH A;  4X4J A;  4B65 A;  1AOG A;  2XVF A;  3QSE A;  1BKW A;  1ZMD A;  2XDO A;  4K2X A;  2VRM A;  2V61 A;  3ABV A;  4H4V A;  3P4Q A;  4OCG A;  4PAB A;  4ZN0 A;  3CNS A;  1YQZ A;  4NZH A;  1GRH A;  2VVL A;  3LJP A;  5CQF A;  3DK8 A;  4EQS A;  1D7Y A;  1L9D A;  2ZZB A;  2C66 A;  4B69 A;  1W4X A;  4YTN A;  5U1O A;  4OPU A;  3AD8 B;  3LAD A;  2C7G A;  4FX9 A;  2JK6 A;  4IVM B;  3FG2 P;  2YG7 A;  2X8G A;  5HY5 A;  4KPR A;  2JKC A;  4H7U A;  1DOC A;  3VQR A;  3QSS A;  3B6D A;  2R9Z A;  3F8D A;  1FEB A;  1CJ2 A;  1MOK A;  4OPG A;  3RP7 A;  3AEE A;  1N4U A;  2APG A;  2Z5X A;  3NNE A;  2YLW A;  3P9U A;  4H4Z A;  1F8W A;  3RP6 A;  2VRL A;  2CUL A;  4FDC B;  3RP8 A;  1IUW A;  1DJQ A;  4B68 A;  1IUT A;  3P4R A;  3FPZ A;  1IUU A;  2TMD A;  3NHO X;  4Y4M A;  4H2P A;  4C77 A;  3NTA A;  3UOX A;  3L8K A;  3AEB A;  3AE4 A;  4D04 A;  3NG7 X;  2WPF A;  3HZL A;  4IVO B;  4MJW A;  1K4Q A;  2WS3 A;  4CCQ A;  3NIX A;  4A7A A;  3CNJ A;  2FBW A;  4A6N B;  4NEW A;  4O5Q A;  4AT2 A;  4EM3 A;  4BJZ A;  3SQP A;  1GRB A;  5FS9 A;  1GER A;  2XVI A;  2BC1 A;  2XYO A;  3BNM A;  4HA6 A;  1BZL A;  4K5S A;  3AE6 A;  1F6M A;  3P1W A;  4Y4L A;  2WES A;  1GV4 A;  1GXF A;  3UP5 A;  4J56 A;  3AB1 A;  5EBK A;  1H7X A;  3KPF A;  5J60 A;  2QA1 A;  4GDP A;  4ICY A;  2BAB A;  1LVL A;  3EPT A;  2C3C A;  1DOD A;  1N1P A;  4E0V A;  4H4U A;  4AP1 A;  3ICT A;  1O95 A;  1V59 A;  3F8R A;  1EL7 A;  1E1K A;  3DK9 A;  2PHH A;  1NHS A;  3ITJ A;  3NTD A;  2EQ8 A;  1ELI A;  4U8K A;  4CY6 A;  3PVC A;  4U2L A;  3URH A;  1E1M A;  2HQM A;  2Q0K A;  3DGZ A;  1CL0 A;  2YG5 A;  2GQW A;  2GV8 A;  3DGH A;  3GYJ A;  5DBJ A;  1LPF A;  1RSG A;  3UOZ A;  4AP3 A;  1IJH A;  1CC4 A;  3GDP A;  4A9W A;  3C96 A;  1EL5 A;  4BK3 A;  4B67 A;  3FBS A;  3CGB A;  4BK1 A;  1QJD A;  3NYC A;  2YVJ A;  2H88 A;  4JY3 A;  1K0J A;  2JAE A;  1JNR A;  3EAO A;  2FJA A;  1RYI A;  3DA1 A;  4ADW A;  3AE7 A;  1NHQ A;  3FIM B;  4EQW A;  2WDR A;  2PYX A;  2X3N A;  2JB1 A;  5C3J A;  2VOU A;  2TPR A;  2V3B A;  2GAG B;  2BCP A;  2C70 A;  2WP5 A;  2C64 A;  1CC2 A;  2EQ6 A;  1VQW A;  1CJ3 A;  3CIR A;  3DH9 A;  3DJD A;  2W0H A;  3NYE A;  4H4R A;  2YG4 A;  5HXI A;  1JU2 A;  2YLS A;  2GR0 A;  3Q9T A;  3CGD A;  3KKJ A;  1H86 A;  1NAA A;  5J7X A;  1H7W A;  4HB9 A;  4YT0 A;  5M10 A;  1ZY8 A;  5U63 A;  1PBC A;  3BI5 A;  4A65 A;  1LJ1 A;  1FL2 A;  1B5Q A;  4XWZ A;  1GTE A;  2GAH B;  2GB0 A;  3GRT A;  3ZYX A;  3CGC A;  3AE9 A;  5JCI A;  4GDE A;  2YLT A;  3RHA A;  3UTF A;  1XAN A;  3R9U A;  3K7M X;  3GRS A;  1D4C A;  4BV6 A;  3I6D A;  3QFB A;  1TDF A;  2QCU A;  2WU2 A;  1BF3 A;  5M0Z A;  4U8J A;  3CNT A;  4YWO A;  1GRE A;  4DGK A;  1PS9 A;  1FCD A;  4UDQ A;  2UZZ A;  3T37 A;  1PBF A;  4EIQ A;  3AEF A;  3DJJ A;  2H89 A;  1EL8 A;  2GH5 A;  1O94 A;  3ATR A;  1PN0 A;  2OLO A;  2XFO A;  4XWR A;  4H2N A;  4EM4 A;  5ER0 A;  4NTE A;  5HHF A;  1LV0 A;  4H2R A;  2E1M A;  4Z43 A;  3SGL A;  2XFN A;  4TM4 A;  1H6V A;  4UP3 A;  3S61 A;  1PXA A;  3ICS A;  4NTC A;  3G5R A;  1F3P A;  1YQ3 A;  3QSM A;  2WU5 A;  4CNJ A;  4JDR A;  2EQ9 A;  2R0G A;  4RG3 A;  4NTD A;  3H4K A;  3ISH A;  1NPX A;  1PXB A;  3PO7 A;  4BUR A;  3GDN A;  2R0C A;  1X31 B;  2C75 A;  2BCG G;  4YSY A;  3M0O A;  1GEU A;  3GWF A;  4LA1 A;  5KOX A;  3AEA A;  1HYU A;  3UTH A;  2BK4 A;  4U8L A;  1CHU A;  1Z6L A;  2B7S A;  2WET A;  2B9Y A;  3C4N A;  1COY A;  4H4Y A;  2YLR A;  3Q6J A;  1IUS A;  3ATQ A;  1S3B A;  5JCN A;  3AE1 A;  1H82 A;  2YVF A;  3FMW A;  3IF9 A;  4BK2 A;  1CF3 A;  2BA9 A;  2VZ2 A;  2B9X A;  2WHD A;  2VVM A;  2XLT A;  4B64 A;  3CPI G;  2XVE A;  2R4E A;  1GRA A;  4XXG A;  2V5Z A;  4Z2R A;  2YM2 A;  2E4G A;  1OJD A;  3P4S A;  5EB5 A;  3UTE A;  1M6I A;  4AOX A;  4APN A;  1Q1W A;  1OJT A;  2GR2 A;  3PS9 A;  2QA2 A;  4YKG A;  3LB8 A;  2XLS A;  3GD3 A;  4JY2 A;  3GD4 A;  1PDH A;  2R45 A;  2C73 A;  2AQJ A;  2XLU A;  3UOV A;  5FS6 A;  5KOW A;  1CBO A;  1GET A;  2Q6U A;  2WOV A;  3E1T A;  4OPI A;  4U2T A;  3RNM A;  4GCM A;  3GMC A;  1TDK A;  1MXT A;  2BXS A;  1B8S A;  4EQR A;  3SFE A;  3KU9 A;  3AE3 A;  1PXC A;  2IVD A;  3ADA B;  5JCK A;  2WP9 A;  3C4A A;  3UCL A;  1KSS A;  4U8O A;  1B37 A;  1VDC A;  3NK2 X;  4J57 A;  5U25 A;  1N4V A;  1KFY A;  3V76 A;  4EQX A;  2YM1 A;  3QFA A;  1GTH A;  5JCL A;  4B1B A;  1B4V A;  5EOW A;  1NEN A;  2BS2 A;  2ZBW A;  1S3E A;  2GVC A;  4H2Q A;  4J33 A;  3BHF A;  3SFD A;  5BVA A;  1XHC A;  4DNA A;  4Z2T A;  5TR3 A;  3OC4 A;  1RP0 A;  1JOA A;  2VQ7 A;  4WCT A;  4X9M A;  2WPE A;  1GAL A;  4K8D A;  4C3Y A;  3ZDN A;  1IUX A;  4H4P A;  4EMW A;  1Y56 A;  1KSU A;  3VRB A;  1ZDL A;  2YWL A;  1YY5 A;  2C76 A;  4C74 A;  4OPD A;  1OJ9 A;  5KVI A;  3WE0 A;  2XVH A;  1Q9I A;  4YXD A;  3KVE A;  3QVR A;  3KD9 A;  4EMJ A;  3AYJ A;  4WX1 A;  4USR A;  2XFP A;  3NRN A;  1VG9 A;  3EAN A;  3DK4 A;  4J36 A;  1KDG A;  1O5W A;  2YR5 A;  2GQF A;  3V3O A;  2B7R A;  5GRT A;  2EQ7 A;  2FJD A;  2Q0L A;  3LZX A;  4KX6 A;  1VG0 A;  4UDR A;  4OPC A;  1ZKQ A;  1GOS A;  5IQ1 A;  4IA6 A;  2OAM A;  4Z44 A;  1ZK7 A;  3AE5 A;  2B76 A;  1ZP0 A;  2OLN A;  3UKQ A;  1NEK A;  2Y6Q A;  5BRT A;  4CNK A;  2BK5 A;  1NDA A;  4J34 A;  3NH3 X;  3UP4 A;  1JNZ A;  1YKJ A;  2GR1 A;  3UKF A;  4DSH A;  2GEW A;  3AXB A;  1NHR A;  4U8P A;  1ZOV A;  4BJY A;  1DOE A;  3AYI A;  1D4E A;  1D7L A;  3EF6 A;  3V3N A;  1EL9 A;  1QO8 A;  1JEH A;  4UDP A;  3II4 A;  5CKU A;  1JRZ A;  1L9E A;  1LQT A;  1ZMC A;  2YLZ A;  4GF7 A;  3L1R A;  3NN0 X;  4CBQ A;  1JRX A;  4AOS A;  1YQ4 A;  3IHM A;  1PBD A;  2YG3 A;  3VRA A;  3IC9 A;  3NK1 X;  4Y4N A;  2Y6R A;  3AE8 A;  1TRB A;  3NYF A;  4GUV A;  2DKH A;  2V6O A;  2A87 A;  2C72 A;  1OJA A;  2A89 A;  3CPJ G;  3COX A;  2I0Z A;  3NKS A;  1LTX R;  4U8N A;  4FK1 A;  1FEC A;  4ZCD A;  5L46 A;  4TM1 A;  2BC0 A;  1E7P A;  5C2T A;  1D5T A;  4IA5 A;  5HYM A;  5KRQ A;  1GT8 A;  2E5V A;  4A6N A;  4K22 A;  2WEU A;  3AD9 B;  1GPE A;  3UOY A;  3LZW A;  1BGN A;  1PHH A;  4P9S A;  3DJG X;  1NG4 A;  2C3D A;  4H4X A;  4YTM A;  2NPX A;  4U8I A;  3OZ2 A;  3VR8 A;  4K5R A;  3GWD A;  3M12 A;  3IHG A;  3AEC A;  1P2H A;  3NN6 X;  1P2E A;  3VRD B;  4J31 A;  5FS7 A;  1IUV A;  1M64 A;  2QAE A;  3CNP A;  2YR6 A;  5KWF A;  1KNR A;  1S2Y A;  2WQY A;  3CPH G;  3KLJ A;  5IPY A;  1FOH A;  3CND A;  2GR3 A;  2BK3 A;  1MO9 A;  5LV9 A;  3AED A;  4TLZ A;  3LXD A;  4X9N A;  1NG3 A;  1CJC A;  3JSK A;  4OPT A;  2YR4 A;  3CTY A;  3NGC X;  4JQ9 A;  2JB2 A;  1TDO A;  3ALL A;  1L0V A;  3UKK A;  3QVP A;  1PJ5 A;  3NK0 X;  3GYI A;  3QJ4 A;  3BHK A;  4H50 A;  4PAA A;  1GND A;  2YG6 A;  1Q1R A;  4JNA A;  5GSN A;  2RGH A;  3P4P A;  2XFQ A;  3K30 A;  3H8L A;  1S2Q A;  3K7Q X;  4U2S A;  4A5L A;  3SM8 A;  1GRT A;  4TLX A;  2BAC A;  3ALJ A;  4EMI A;  3ALM A;  5BUL A;  1TDE A;  2XLP A;  3D8X A;  3M13 A;  2AAQ A;  5EB4 A;  2XLR A;  2BYB A;  2R4J A;  1NHP A;  3LOV A;  1CC6 A;  1GRF A;  2VQB A;  2ZZC A;  3B3R A;  4I58 A;  4TM3 A;  3AYL A;  1TDN A;  1GRG A;  1PJ7 A;  2YQU A;  1FEA A;  2BXR A;  3GMB A;  2WDQ A;  1DXL A;  1SEZ A;  2WOI A;  4H4S A;  5IQ4 A;  2CDU A;  1E6E A;  1Y0P A;  4YKF A;  2J3N A;  2FJE A;  2OAL A;  5KVH A;  1PJ6 A;  1TYT A;  4FK1 C;  1KF6 A;  1BWC A;  2X8H A;  2NVK X;  4Z25 A;  1EBD A;  2B9W A;  4Z2U A;  2IVE A;  2C67 A;  1F8R A;  3NT6 A;  2JB3 A;  2XVJ A;  3H8I A;  1E1L A;  2WDV A;  1H84 A;  2WPC A;  5BUK A;  3UKH A;  2R46 A;  2X50 A;  3GSI A;  4GR1 A;  2CVJ A;  4IV9 A;  1ONF A;  2WBA A;  4GRT A;  2F5Z A;  4CRT A;  2R0P A;  2V3A A;  3NLC A;  2XFU A;  4M52 A;  4USQ A;  2ZZ0 A;  3F8P A;  3AEG A;  4LII A;  2RGO A;  2YVG A;  1XPQ A;  2ARD A;  2Z5Y A;  4ECH A;  3AE2 A;  3G5Q A;  4B66 A;  1UKV G;  1DJN A;  1JRY A;  3D1C A;  4NEV A;  2FJB A;  4JN9 A;  3UKA A;  1DNC A;  2YAU A;  1H83 A;  2C65 A;  2YLX A;  3DJE A;  4J2W A;  1N4W A;  4D03 A;  2XCG A;  4JNQ A;  4REK A;  4Z26 A;  3AD7 B;  1E39 A;  2DKI A;  4B63 A;  2X99 A;  1ZX9 A;  1PBE A;  2ACZ A;  3RED A;  1TYP A;  4YSZ A;  4C3X A;  3S5W A;  1GES A;  2OA1 A;  5KXJ A; 
#chains in the Genus database with same CATH topology
 2BS4 A;  2E82 A;  4RSL A;  1KNP A;  3O0H A;  2CFY A;  3ZNQ A;  2WOW A;  4YTP A;  1DOB A;  1C0I A;  5JCM A;  2WP6 A;  1BGJ A;  1L9C A;  4H4T A;  5KNL A;  1H81 A;  4AT0 A;  3ICR A;  1QLB A;  1F8S A;  2X8C A;  4A79 A;  4Z24 A;  3KA7 A;  4EIP A;  1LQU A;  2VVL G;  4LU6 A;  4YJD A;  2GMJ A;  4C5O A;  4G74 A;  1K0I A;  1CJ4 A;  2GF3 A;  4A99 A;  3K7T A;  1REO A;  1K0L A;  4YJG B;  2GRT A;  4I59 A;  4CY8 A;  3HYV A;  1E1N A;  1XDI A;  4H4Q A;  1D4D A;  1VRQ B;  5FS8 A;  4OPL A;  3UKP A;  4K5S A;  1Y56 B;  3DME A;  3UTG A;  2BS3 A;  2RAB A;  4O5U A;  3CN8 A;  4RG4 A;  3G5S A;  3I3L A;  5FMH A;  3VR9 A;  2O9Z A;  3BNU A;  3IWA A;  1EVI A;  2IID A;  1GSN A;  2V60 A;  4DSG A;  2JBV A;  3BI2 A;  3AWI A;  3W4K A;  1OJC A;  3UKL A;  1ZOY A;  4U8M A;  4ZCC A;  3CGE A;  4YSX A;  3BI4 A;  4CCR A;  4K7Z A;  4N9X A;  4OVI A;  2RGJ A;  2Q7V A;  2AR8 A;  4TM0 A;  4QFC A;  4YSH A;  2A8X A;  1PBB A;  4H4W A;  3T2K A;  2GMH A;  4X4J A;  4B65 A;  1AOG A;  3QSE A;  2XVF A;  1BKW A;  1C0K A;  1ZMD A;  2XDO A;  4K2X A;  2DU8 A;  3T2Z A;  2VRM A;  2V61 A;  3ABV A;  4H4V A;  4NNJ A;  3P4Q A;  4OCG A;  4PAB A;  4ZN0 A;  3CNS A;  1YQZ A;  4NZH A;  1GRH A;  2VVL A;  3LJP A;  5CQF A;  3DK8 A;  4EQS A;  1D7Y A;  1L9D A;  2ZZB A;  2C66 A;  4B69 A;  1W4X A;  4YTN A;  5U1O A;  4OPU A;  3AD8 B;  3LAD A;  2C7G A;  4FX9 A;  2JK6 A;  4IVM B;  3FG2 P;  2YG7 A;  2X8G A;  5HY5 A;  4KPR A;  2JKC A;  4H7U A;  1DOC A;  3QSS A;  3B6D A;  2R9Z A;  3RP7 A;  1FEB A;  1CJ2 A;  1MOK A;  3F8D A;  4OPG A;  3AEE A;  1N4U A;  2APG A;  2Z5X A;  3NNE A;  2YLW A;  3P9U A;  4H4Z A;  1F8W A;  3RP6 A;  2VRL A;  2CUL A;  3RP8 A;  4FDC B;  1IUW A;  1DJQ A;  2BRY A;  4B68 A;  1IUT A;  3P4R A;  3FPZ A;  1IUU A;  2TMD A;  3NHO X;  4Y4M A;  4H2P A;  4C77 A;  3NTA A;  3UOX A;  3L8K A;  3AEB A;  3AE4 A;  4D04 A;  3NG7 X;  2WPF A;  3HZL A;  4IVO B;  4MJW A;  1K4Q A;  2WS3 A;  4CCQ A;  3NIX A;  4A7A A;  1C0L A;  3CNJ A;  2FBW A;  4A6N B;  4NEW A;  4O5Q A;  4AT2 A;  4EM3 A;  4BJZ A;  3SQP A;  1GRB A;  5FS9 A;  1GER A;  2XVI A;  2BC1 A;  2XYO A;  3VQR A;  3BNM A;  4YJF B;  1BZL A;  3AE6 A;  1F6M A;  3P1W A;  4HA6 A;  2WES A;  1GV4 A;  4Y4L A;  1GXF A;  3UP5 A;  4J56 A;  3AB1 A;  5EBK A;  1H7X A;  3KPF A;  3HYX A;  2QA1 A;  4GDP A;  5J60 A;  4ICY A;  2BAB A;  1LVL A;  3EPT A;  2C3C A;  1DOD A;  1N1P A;  4E0V A;  4H4U A;  4AP1 A;  3ICT A;  1O95 A;  1V59 A;  3F8R A;  1EL7 A;  1E1K A;  3DK9 A;  2PHH A;  1NHS A;  3ITJ A;  3NTD A;  2EQ8 A;  1ELI A;  4U8K A;  4CY6 A;  3PVC A;  4U2L A;  3URH A;  1E1M A;  2HQM A;  2Q0K A;  3DGZ A;  1CL0 A;  2YG5 A;  2GQW A;  2GV8 A;  3DGH A;  3GYJ A;  5KMS A;  3KPK A;  5DBJ A;  1LPF A;  1RSG A;  3UOZ A;  4AP3 A;  1IJH A;  5KMP A;  1CC4 A;  3GDP A;  4A9W A;  3CMM A;  3C96 A;  1EL5 A;  4BK3 A;  4B67 A;  3FBS A;  3CGB A;  4BK1 A;  3NYC A;  1QJD A;  2YVJ A;  2H88 A;  4JY3 A;  1K0J A;  2JAE A;  1JNR A;  3EAO A;  3DA1 A;  1RYI A;  2FJA A;  4ADW A;  3AE7 A;  1NHQ A;  3FIM B;  4EQW A;  2WDR A;  2PYX A;  2X3N A;  2JB1 A;  5C3J A;  2VOU A;  2TPR A;  2V3B A;  2GAG B;  2BCP A;  2C70 A;  2WP5 A;  2C64 A;  1CC2 A;  2EQ6 A;  1VQW A;  1CJ3 A;  3CIR A;  3DH9 A;  4G9K A;  3DJD A;  3NYE A;  2W0H A;  4H4R A;  2YG4 A;  5HXI A;  1JU2 A;  2YLS A;  2GR0 A;  3Q9T A;  3CGD A;  3KKJ A;  1H86 A;  1NAA A;  5J7X A;  1H7W A;  4HB9 A;  4YT0 A;  5M10 A;  1ZY8 A;  5U63 A;  1PBC A;  3BI5 A;  4A65 A;  1LJ1 A;  1FL2 A;  1B5Q A;  4XWZ A;  1GTE A;  2GAH B;  2GB0 A;  3GRT A;  3ZYX A;  3CGC A;  3AE9 A;  5JCI A;  4GDE A;  2YLT A;  3RHA A;  3UTF A;  3G3E A;  1XAN A;  3R9U A;  3K7M X;  3GRS A;  4QFD A;  1D4C A;  4BV6 A;  3I6D A;  3QFB A;  1TDF A;  2QCU A;  2WU2 A;  1BF3 A;  5M0Z A;  4U8J A;  3CNT A;  4YWO A;  1GRE A;  4DGK A;  1PS9 A;  1FCD A;  4UDQ A;  2UZZ A;  3T0K A;  3T37 A;  1KIF A;  1PBF A;  4EIQ A;  3AEF A;  3DJJ A;  2H89 A;  1EL8 A;  2GH5 A;  1O94 A;  3ATR A;  1PN0 A;  2OLO A;  2XFO A;  4XWR A;  4H2N A;  4EM4 A;  5ER0 A;  4NTE A;  5HHF A;  1LV0 A;  4H2R A;  2E1M A;  4Z43 A;  3SGL A;  2XFN A;  4TM4 A;  1H6V A;  4UP3 A;  3S61 A;  1PXA A;  3ICS A;  4NTC A;  3G5R A;  1F3P A;  3QSM A;  1YQ3 A;  2WU5 A;  4CNJ A;  4JDR A;  2EQ9 A;  2R0G A;  4RG3 A;  4NTD A;  3H4K A;  3ISH A;  1NPX A;  1PXB A;  3PO7 A;  4BUR A;  3GDN A;  1X31 B;  2R0C A;  2C75 A;  2BCG G;  4YSY A;  3M0O A;  1GEU A;  3GWF A;  4LA1 A;  5KOX A;  3AEA A;  1HYU A;  3UTH A;  2BK4 A;  4U8L A;  1CHU A;  1Z6L A;  2B7S A;  3C4N A;  2B9Y A;  2WET A;  1COY A;  4YJH A;  4H4Y A;  2YLR A;  3Q6J A;  1IUS A;  3ATQ A;  1S3B A;  4II2 A;  5JCN A;  3AE1 A;  3IF9 A;  1H82 A;  2YVF A;  3FMW A;  4BK2 A;  1CF3 A;  2BA9 A;  2VZ2 A;  2B9X A;  2WHD A;  2VVM A;  2XLT A;  2E49 A;  4B64 A;  3WGT A;  3CPI G;  2XVE A;  2R4E A;  1GRA A;  4XXG A;  2V5Z A;  4Z2R A;  3SZW A;  1VE9 A;  2YM2 A;  2E4G A;  1OJD A;  3ZNO A;  3P4S A;  5EB5 A;  3UTE A;  1M6I A;  4AOX A;  4APN A;  1Q1W A;  1OJT A;  2GR2 A;  3PS9 A;  2QA2 A;  4YKG A;  3LB8 A;  2XLS A;  4G6G A;  3GD3 A;  4JY2 A;  3SZ0 A;  2E48 A;  3GD4 A;  1PDH A;  2R45 A;  2C73 A;  2AQJ A;  2XLU A;  3UOV A;  5FS6 A;  5KOW A;  1CBO A;  2Q6U A;  1GET A;  3E1T A;  2WOV A;  4OPI A;  3SX6 A;  4U2T A;  3SYI A;  3RNM A;  4GCM A;  3GMC A;  1TDK A;  1MXT A;  2BXS A;  1B8S A;  4EQR A;  3SFE A;  3KU9 A;  3AE3 A;  1PXC A;  2BRA A;  2IVD A;  3ADA B;  5JCK A;  2WP9 A;  3C4A A;  3UCL A;  1KSS A;  4U8O A;  1B37 A;  1VDC A;  3NK2 X;  4J57 A;  5U25 A;  1N4V A;  1KFY A;  3V76 A;  3SXI A;  4EQX A;  2YM1 A;  3QFA A;  1GTH A;  5JCL A;  4B1B A;  1B4V A;  1DDO A;  5EOW A;  1NEN A;  2BS2 A;  2ZBW A;  4G73 A;  1S3E A;  2GVC A;  4H2Q A;  4J33 A;  3BHF A;  3SFD A;  5BVA A;  1XHC A;  4DNA A;  4Z2T A;  5TR3 A;  3OC4 A;  3SZF A;  4X9M A;  4WCT A;  1JOA A;  1RP0 A;  2VQ7 A;  4YJG A;  2WPE A;  3W4I A;  1GAL A;  4K8D A;  4C3Y A;  3ZDN A;  1IUX A;  4H4P A;  4EMW A;  1Y56 A;  1KSU A;  3VRB A;  1ZDL A;  2YWL A;  1YY5 A;  2C76 A;  4C74 A;  4OPD A;  5KMR A;  1OJ9 A;  5KVI A;  3WE0 A;  2XVH A;  3GYX A;  1Q9I A;  4YXD A;  3KVE A;  3QVR A;  3KD9 A;  3CUK A;  4EMJ A;  3AYJ A;  4WX1 A;  4USR A;  2XFP A;  3NRN A;  1VG9 A;  3EAN A;  3DK4 A;  4J36 A;  1KDG A;  1O5W A;  2YR5 A;  2GQF A;  3T2Y A;  3V3O A;  2B7R A;  5GRT A;  3ZNN A;  2EQ7 A;  2FJD A;  2Q0L A;  3LZX A;  1VG0 A;  4KX6 A;  4UDR A;  4OPC A;  4G6H A;  1ZKQ A;  1GOS A;  5IQ1 A;  4IA6 A;  2OAM A;  4Z44 A;  1ZK7 A;  3AE5 A;  2B76 A;  1ZP0 A;  2OLN A;  3UKQ A;  1NEK A;  2Y6Q A;  5BRT A;  4CNK A;  2BK5 A;  1NDA A;  4J34 A;  3NH3 X;  3UP4 A;  1JNZ A;  1YKJ A;  2GR1 A;  3UKF A;  4DSH A;  3AXB A;  2GEW A;  1NHR A;  4U8P A;  1ZOV A;  3SZC A;  4BJY A;  1DOE A;  3AYI A;  1D4E A;  1D7L A;  3EF6 A;  3V3N A;  1EL9 A;  1QO8 A;  1JEH A;  4UDP A;  3II4 A;  5CKU A;  1L9E A;  1JRZ A;  1LQT A;  1ZMC A;  2YLZ A;  4GF7 A;  3L1R A;  3NN0 X;  4CBQ A;  1JRX A;  4AOS A;  1YQ4 A;  3IHM A;  1PBD A;  2YG3 A;  3VRA A;  3IC9 A;  3NK1 X;  4Y4N A;  2Y6R A;  3AE8 A;  1TRB A;  3NYF A;  4GUV A;  2DKH A;  2V6O A;  2A87 A;  2C72 A;  1OJA A;  2A89 A;  3CPJ G;  3T31 A;  3COX A;  2I0Z A;  5L46 A;  1LTX R;  3NKS A;  4FK1 A;  1FEC A;  4U8N A;  4ZCD A;  4TM1 A;  2BC0 A;  1E7P A;  5C2T A;  4IA5 A;  1D5T A;  5HYM A;  5KRQ A;  1GT8 A;  2E5V A;  4A6N A;  4K22 A;  3AD9 B;  2WEU A;  1GPE A;  3UOY A;  3LZW A;  1BGN A;  1PHH A;  4P9S A;  3DJG X;  1NG4 A;  2C3D A;  4H4X A;  4YJF A;  2NPX A;  4U8I A;  4GAP A;  4YTM A;  2C4C A;  3OZ2 A;  3VR8 A;  4K5R A;  3GWD A;  3M12 A;  3IHG A;  3AEC A;  1P2H A;  3NN6 X;  1P2E A;  3VRD B;  4J31 A;  5FS7 A;  1IUV A;  1M64 A;  2QAE A;  3CNP A;  2YR6 A;  5KWF A;  1KNR A;  1S2Y A;  2WQY A;  3CPH G;  3KLJ A;  5IPY A;  1FOH A;  3CND A;  2GR3 A;  2BK3 A;  1MO9 A;  4GAV A;  5LV9 A;  3AED A;  4TLZ A;  3LXD A;  4X9N A;  1NG3 A;  1DAO A;  1CJC A;  3JSK A;  2YR4 A;  3CTY A;  4OPT A;  3NGC X;  4JQ9 A;  1AN9 A;  2JB2 A;  1TDO A;  3ALL A;  1L0V A;  3UKK A;  3QVP A;  1PJ5 A;  3NK0 X;  3GYI A;  4PAA A;  3BHK A;  3QJ4 A;  4H50 A;  1GND A;  2YG6 A;  1Q1R A;  4JNA A;  5GSN A;  2RGH A;  3P4P A;  2XFQ A;  3K30 A;  3H8L A;  1S2Q A;  3K7Q X;  4U2S A;  4A5L A;  3SM8 A;  1GRT A;  4TLX A;  2BAC A;  3ALJ A;  4EMI A;  3ALM A;  5BUL A;  1TDE A;  2XLP A;  3D8X A;  3M13 A;  2AAQ A;  5EB4 A;  2XLR A;  2BYB A;  2R4J A;  1NHP A;  3LOV A;  1CC6 A;  3W4J A;  1GRF A;  2VQB A;  2ZZC A;  3B3R A;  4I58 A;  4TM3 A;  3AYL A;  1TDN A;  3T14 A;  1GRG A;  1PJ7 A;  2YQU A;  1FEA A;  2BXR A;  3GMB A;  2WDQ A;  4II3 A;  1DXL A;  1SEZ A;  2WOI A;  4H4S A;  4NWZ A;  5IQ4 A;  2CDU A;  1E6E A;  1Y0P A;  4YKF A;  2J3N A;  2FJE A;  2OAL A;  5KVH A;  1PJ6 A;  1TYT A;  4FK1 C;  1KF6 A;  1BWC A;  2X8H A;  4YJH B;  2NVK X;  4Z25 A;  1EBD A;  2B9W A;  4Z2U A;  2IVE A;  3ZNP A;  2C67 A;  1F8R A;  3NT6 A;  2JB3 A;  2XVJ A;  3H8I A;  1E1L A;  2WDV A;  1H84 A;  2WPC A;  5BUK A;  3UKH A;  1C0P A;  5KMQ A;  2R46 A;  2X50 A;  3GSI A;  4GR1 A;  2CVJ A;  4IV9 A;  1ONF A;  2WBA A;  4GRT A;  2F5Z A;  4CRT A;  2R0P A;  2V3A A;  3NLC A;  2XFU A;  4M52 A;  4USQ A;  2ZZ0 A;  3F8P A;  3AEG A;  4LII A;  2RGO A;  3HYW A;  2YVG A;  1XPQ A;  3SY4 A;  2ARD A;  2Z5Y A;  4ECH A;  3AE2 A;  3G5Q A;  4B66 A;  1UKV G;  1DJN A;  1JRY A;  3D1C A;  4NEV A;  2E4A A;  2FJB A;  4JN9 A;  1DNC A;  2YAU A;  3UKA A;  1H83 A;  2C65 A;  3DJE A;  2YLX A;  4J2W A;  1N4W A;  4D03 A;  2XCG A;  4JNQ A;  4REK A;  4Z26 A;  3AD7 B;  1E39 A;  2DKI A;  4B63 A;  2X99 A;  1ZX9 A;  1PBE A;  2ACZ A;  3RED A;  1TYP A;  4YSZ A;  4C3X A;  3S5W A;  1GES A;  2OA1 A;  5KXJ A; 
#chains in the Genus database with same CATH homology
 2BS4 A;  1KNP A;  4RSL A;  3O0H A;  2CFY A;  2WOW A;  4YTP A;  1DOB A;  5JCM A;  2WP6 A;  1BGJ A;  1L9C A;  4H4T A;  5KNL A;  1H81 A;  4AT0 A;  3ICR A;  1QLB A;  1F8S A;  2X8C A;  4A79 A;  4Z24 A;  3KA7 A;  4EIP A;  1LQU A;  2VVL G;  4LU6 A;  2GMJ A;  4C5O A;  4G74 A;  1K0I A;  1CJ4 A;  2GF3 A;  4A99 A;  3K7T A;  1REO A;  1K0L A;  2GRT A;  4I59 A;  4CY8 A;  3HYV A;  1E1N A;  1XDI A;  4H4Q A;  1D4D A;  1VRQ B;  5FS8 A;  4OPL A;  3UKP A;  1Y56 B;  3DME A;  3UTG A;  2BS3 A;  2RAB A;  4O5U A;  3CN8 A;  4RG4 A;  3G5S A;  3I3L A;  5FMH A;  3VR9 A;  2O9Z A;  3BNU A;  3IWA A;  2IID A;  1GSN A;  2V60 A;  4DSG A;  2JBV A;  3BI2 A;  3AWI A;  1OJC A;  3UKL A;  1ZOY A;  4U8M A;  4ZCC A;  3CGE A;  4YSX A;  3BI4 A;  4CCR A;  4K7Z A;  4N9X A;  4OVI A;  2RGJ A;  2Q7V A;  2AR8 A;  4TM0 A;  4YSH A;  2A8X A;  1PBB A;  4H4W A;  3T2K A;  2GMH A;  4X4J A;  4B65 A;  1AOG A;  2XVF A;  3QSE A;  1BKW A;  1ZMD A;  2XDO A;  4K2X A;  3T2Z A;  2VRM A;  2V61 A;  3ABV A;  4H4V A;  4NNJ A;  3P4Q A;  4OCG A;  4PAB A;  4ZN0 A;  3CNS A;  1YQZ A;  4NZH A;  1GRH A;  2VVL A;  3LJP A;  5CQF A;  3DK8 A;  4EQS A;  1D7Y A;  1L9D A;  2ZZB A;  2C66 A;  4B69 A;  1W4X A;  4YTN A;  5U1O A;  4OPU A;  3AD8 B;  3LAD A;  2C7G A;  4FX9 A;  2JK6 A;  4IVM B;  3FG2 P;  2YG7 A;  2X8G A;  5HY5 A;  4KPR A;  2JKC A;  4H7U A;  1DOC A;  3VQR A;  3QSS A;  3B6D A;  2R9Z A;  3RP7 A;  1FEB A;  1CJ2 A;  1MOK A;  3F8D A;  4OPG A;  3AEE A;  1N4U A;  2APG A;  2Z5X A;  3NNE A;  2YLW A;  3P9U A;  4H4Z A;  1F8W A;  3RP6 A;  2VRL A;  2CUL A;  3RP8 A;  4FDC B;  1IUW A;  1DJQ A;  2BRY A;  4B68 A;  1IUT A;  3P4R A;  3FPZ A;  1IUU A;  2TMD A;  3NHO X;  4Y4M A;  4H2P A;  4C77 A;  3NTA A;  3UOX A;  3L8K A;  3AEB A;  3AE4 A;  4D04 A;  3NG7 X;  2WPF A;  3HZL A;  4IVO B;  4MJW A;  1K4Q A;  2WS3 A;  4CCQ A;  3NIX A;  4A7A A;  3CNJ A;  2FBW A;  4A6N B;  4NEW A;  4O5Q A;  4AT2 A;  4EM3 A;  4BJZ A;  3SQP A;  1GRB A;  5FS9 A;  1GER A;  2XVI A;  2BC1 A;  2XYO A;  3BNM A;  4HA6 A;  1BZL A;  4K5S A;  3AE6 A;  1F6M A;  3P1W A;  4Y4L A;  2WES A;  1GV4 A;  1GXF A;  3UP5 A;  4J56 A;  3AB1 A;  5EBK A;  1H7X A;  3KPF A;  3HYX A;  2QA1 A;  4GDP A;  5J60 A;  4ICY A;  2BAB A;  1LVL A;  3EPT A;  2C3C A;  1DOD A;  1N1P A;  4E0V A;  4H4U A;  4AP1 A;  3ICT A;  1O95 A;  1V59 A;  3F8R A;  1EL7 A;  1E1K A;  3DK9 A;  2PHH A;  1NHS A;  3ITJ A;  3NTD A;  2EQ8 A;  1ELI A;  4U8K A;  4CY6 A;  3PVC A;  4U2L A;  3URH A;  1E1M A;  2HQM A;  2Q0K A;  3DGZ A;  1CL0 A;  2YG5 A;  2GQW A;  2GV8 A;  3DGH A;  3GYJ A;  5KMS A;  3KPK A;  5DBJ A;  1LPF A;  1RSG A;  3UOZ A;  4AP3 A;  1IJH A;  5KMP A;  1CC4 A;  3GDP A;  4A9W A;  3CMM A;  3C96 A;  4BK3 A;  1EL5 A;  4B67 A;  3FBS A;  3CGB A;  4BK1 A;  1QJD A;  3NYC A;  2YVJ A;  2H88 A;  4JY3 A;  1K0J A;  2JAE A;  1JNR A;  3EAO A;  2FJA A;  1RYI A;  3DA1 A;  4ADW A;  3AE7 A;  1NHQ A;  3FIM B;  4EQW A;  2WDR A;  2PYX A;  2X3N A;  2JB1 A;  5C3J A;  2VOU A;  2TPR A;  2V3B A;  2GAG B;  2BCP A;  2C70 A;  2WP5 A;  2C64 A;  1CC2 A;  2EQ6 A;  1VQW A;  1CJ3 A;  3CIR A;  3DH9 A;  4G9K A;  3DJD A;  2W0H A;  3NYE A;  4H4R A;  2YG4 A;  5HXI A;  1JU2 A;  2YLS A;  2GR0 A;  3Q9T A;  3CGD A;  3KKJ A;  1H86 A;  1NAA A;  5J7X A;  1H7W A;  4HB9 A;  4YT0 A;  5M10 A;  1ZY8 A;  5U63 A;  1PBC A;  3BI5 A;  4A65 A;  1LJ1 A;  1FL2 A;  1B5Q A;  4XWZ A;  1GTE A;  2GAH B;  2GB0 A;  3GRT A;  3ZYX A;  3CGC A;  3AE9 A;  5JCI A;  4GDE A;  2YLT A;  3RHA A;  3UTF A;  1XAN A;  3R9U A;  3K7M X;  3GRS A;  1D4C A;  4BV6 A;  3I6D A;  3QFB A;  1TDF A;  2QCU A;  2WU2 A;  1BF3 A;  5M0Z A;  4U8J A;  3CNT A;  4YWO A;  1GRE A;  4DGK A;  1PS9 A;  1FCD A;  4UDQ A;  2UZZ A;  3T0K A;  3T37 A;  1PBF A;  4EIQ A;  3AEF A;  3DJJ A;  2H89 A;  1EL8 A;  2GH5 A;  1O94 A;  3ATR A;  1PN0 A;  2OLO A;  2XFO A;  4XWR A;  4H2N A;  4EM4 A;  5ER0 A;  4NTE A;  5HHF A;  1LV0 A;  4H2R A;  2E1M A;  4Z43 A;  3SGL A;  2XFN A;  4TM4 A;  1H6V A;  4UP3 A;  3S61 A;  1PXA A;  3ICS A;  4NTC A;  3G5R A;  1F3P A;  1YQ3 A;  3QSM A;  2WU5 A;  4CNJ A;  4JDR A;  2EQ9 A;  2R0G A;  4RG3 A;  4NTD A;  3H4K A;  3ISH A;  1NPX A;  1PXB A;  3PO7 A;  4BUR A;  3GDN A;  2R0C A;  1X31 B;  2C75 A;  2BCG G;  4YSY A;  3M0O A;  1GEU A;  3GWF A;  4LA1 A;  5KOX A;  3AEA A;  1HYU A;  3UTH A;  2BK4 A;  4U8L A;  1CHU A;  1Z6L A;  2B7S A;  2WET A;  2B9Y A;  3C4N A;  1COY A;  4H4Y A;  2YLR A;  3Q6J A;  1IUS A;  3ATQ A;  1S3B A;  4II2 A;  5JCN A;  3AE1 A;  1H82 A;  2YVF A;  3FMW A;  3IF9 A;  4BK2 A;  1CF3 A;  2BA9 A;  2VZ2 A;  2B9X A;  2WHD A;  2VVM A;  2XLT A;  4B64 A;  3CPI G;  2XVE A;  2R4E A;  1GRA A;  4XXG A;  2V5Z A;  4Z2R A;  3SZW A;  2YM2 A;  2E4G A;  1OJD A;  3P4S A;  5EB5 A;  3UTE A;  1M6I A;  4AOX A;  4APN A;  1Q1W A;  1OJT A;  2GR2 A;  3PS9 A;  2QA2 A;  4YKG A;  3LB8 A;  2XLS A;  4G6G A;  3GD3 A;  4JY2 A;  3SZ0 A;  3GD4 A;  1PDH A;  2R45 A;  2C73 A;  2AQJ A;  2XLU A;  3UOV A;  5FS6 A;  5KOW A;  1CBO A;  1GET A;  2Q6U A;  3E1T A;  2WOV A;  4OPI A;  3SX6 A;  4U2T A;  3SYI A;  3RNM A;  4GCM A;  3GMC A;  1TDK A;  1MXT A;  2BXS A;  1B8S A;  4EQR A;  3SFE A;  3KU9 A;  3AE3 A;  1PXC A;  2BRA A;  2IVD A;  3ADA B;  5JCK A;  2WP9 A;  3C4A A;  3UCL A;  1KSS A;  4U8O A;  1B37 A;  1VDC A;  3NK2 X;  4J57 A;  5U25 A;  1N4V A;  1KFY A;  3V76 A;  3SXI A;  4EQX A;  2YM1 A;  3QFA A;  1GTH A;  5JCL A;  4B1B A;  1B4V A;  5EOW A;  1NEN A;  2BS2 A;  2ZBW A;  4G73 A;  1S3E A;  2GVC A;  4H2Q A;  4J33 A;  3BHF A;  3SFD A;  5BVA A;  1XHC A;  4DNA A;  4Z2T A;  5TR3 A;  3OC4 A;  3SZF A;  1RP0 A;  1JOA A;  2VQ7 A;  4WCT A;  4X9M A;  2WPE A;  1GAL A;  4K8D A;  4C3Y A;  3ZDN A;  1IUX A;  4H4P A;  4EMW A;  1Y56 A;  1KSU A;  3VRB A;  1ZDL A;  2YWL A;  1YY5 A;  2C76 A;  4C74 A;  4OPD A;  5KMR A;  1OJ9 A;  5KVI A;  3WE0 A;  2XVH A;  3GYX A;  1Q9I A;  4YXD A;  3KVE A;  3QVR A;  3KD9 A;  4EMJ A;  3AYJ A;  4WX1 A;  4USR A;  2XFP A;  3NRN A;  1VG9 A;  3EAN A;  3DK4 A;  4J36 A;  1KDG A;  1O5W A;  2YR5 A;  2GQF A;  3T2Y A;  3V3O A;  2B7R A;  5GRT A;  2EQ7 A;  2FJD A;  2Q0L A;  3LZX A;  4KX6 A;  1VG0 A;  4UDR A;  4OPC A;  4G6H A;  1ZKQ A;  1GOS A;  5IQ1 A;  4IA6 A;  2OAM A;  4Z44 A;  1ZK7 A;  3AE5 A;  2B76 A;  1ZP0 A;  2OLN A;  3UKQ A;  1NEK A;  2Y6Q A;  5BRT A;  4CNK A;  2BK5 A;  1NDA A;  4J34 A;  3NH3 X;  3UP4 A;  1JNZ A;  1YKJ A;  2GR1 A;  3UKF A;  4DSH A;  2GEW A;  3AXB A;  1NHR A;  4U8P A;  1ZOV A;  3SZC A;  4BJY A;  1DOE A;  3AYI A;  1D4E A;  1D7L A;  3EF6 A;  3V3N A;  1EL9 A;  1QO8 A;  1JEH A;  4UDP A;  3II4 A;  5CKU A;  1JRZ A;  1L9E A;  1LQT A;  1ZMC A;  2YLZ A;  4GF7 A;  3L1R A;  3NN0 X;  4CBQ A;  1JRX A;  4AOS A;  1YQ4 A;  3IHM A;  1PBD A;  2YG3 A;  3VRA A;  3IC9 A;  3NK1 X;  4Y4N A;  2Y6R A;  3AE8 A;  1TRB A;  3NYF A;  4GUV A;  2DKH A;  2V6O A;  2A87 A;  2C72 A;  1OJA A;  2A89 A;  3CPJ G;  3T31 A;  3COX A;  2I0Z A;  3NKS A;  1LTX R;  4U8N A;  4FK1 A;  1FEC A;  4ZCD A;  5L46 A;  4TM1 A;  2BC0 A;  1E7P A;  5C2T A;  4IA5 A;  1D5T A;  5HYM A;  5KRQ A;  1GT8 A;  2E5V A;  4A6N A;  4K22 A;  2WEU A;  3AD9 B;  1GPE A;  3UOY A;  3LZW A;  1BGN A;  1PHH A;  4P9S A;  3DJG X;  1NG4 A;  2C3D A;  4H4X A;  4YTM A;  2NPX A;  4U8I A;  4GAP A;  2C4C A;  3OZ2 A;  3VR8 A;  4K5R A;  3GWD A;  3M12 A;  3IHG A;  3AEC A;  1P2H A;  3NN6 X;  1P2E A;  3VRD B;  4J31 A;  5FS7 A;  1IUV A;  1M64 A;  2QAE A;  3CNP A;  2YR6 A;  5KWF A;  1KNR A;  1S2Y A;  2WQY A;  3CPH G;  3KLJ A;  5IPY A;  1FOH A;  3CND A;  2GR3 A;  2BK3 A;  1MO9 A;  4GAV A;  5LV9 A;  3AED A;  4TLZ A;  3LXD A;  4X9N A;  1NG3 A;  1CJC A;  3JSK A;  4OPT A;  2YR4 A;  3CTY A;  3NGC X;  4JQ9 A;  2JB2 A;  1TDO A;  3ALL A;  1L0V A;  3UKK A;  3QVP A;  1PJ5 A;  3NK0 X;  3GYI A;  3QJ4 A;  3BHK A;  4H50 A;  4PAA A;  1GND A;  2YG6 A;  1Q1R A;  4JNA A;  5GSN A;  2RGH A;  3P4P A;  2XFQ A;  3K30 A;  3H8L A;  1S2Q A;  3K7Q X;  4U2S A;  4A5L A;  3SM8 A;  1GRT A;  4TLX A;  2BAC A;  3ALJ A;  4EMI A;  3ALM A;  5BUL A;  1TDE A;  2XLP A;  3D8X A;  3M13 A;  2AAQ A;  5EB4 A;  2XLR A;  2BYB A;  2R4J A;  1NHP A;  3LOV A;  1CC6 A;  1GRF A;  2VQB A;  2ZZC A;  3B3R A;  4I58 A;  4TM3 A;  3AYL A;  1TDN A;  3T14 A;  1GRG A;  1PJ7 A;  2YQU A;  1FEA A;  2BXR A;  3GMB A;  2WDQ A;  4II3 A;  1DXL A;  1SEZ A;  2WOI A;  4H4S A;  4NWZ A;  5IQ4 A;  2CDU A;  1E6E A;  1Y0P A;  4YKF A;  2J3N A;  2FJE A;  2OAL A;  5KVH A;  1PJ6 A;  1TYT A;  4FK1 C;  1KF6 A;  1BWC A;  2X8H A;  2NVK X;  4Z25 A;  1EBD A;  2B9W A;  4Z2U A;  2IVE A;  2C67 A;  1F8R A;  3NT6 A;  2JB3 A;  2XVJ A;  3H8I A;  1E1L A;  2WDV A;  1H84 A;  2WPC A;  5BUK A;  3UKH A;  5KMQ A;  2R46 A;  2X50 A;  3GSI A;  4GR1 A;  2CVJ A;  4IV9 A;  1ONF A;  2WBA A;  4GRT A;  2F5Z A;  4CRT A;  2R0P A;  2V3A A;  3NLC A;  2XFU A;  4M52 A;  4USQ A;  2ZZ0 A;  3F8P A;  3AEG A;  4LII A;  2RGO A;  3HYW A;  2YVG A;  1XPQ A;  3SY4 A;  2ARD A;  2Z5Y A;  4ECH A;  3AE2 A;  3G5Q A;  4B66 A;  1UKV G;  1DJN A;  1JRY A;  3D1C A;  4NEV A;  2FJB A;  4JN9 A;  3UKA A;  1DNC A;  2YAU A;  1H83 A;  2C65 A;  2YLX A;  3DJE A;  4J2W A;  1N4W A;  4D03 A;  2XCG A;  4JNQ A;  4REK A;  4Z26 A;  3AD7 B;  1E39 A;  2DKI A;  4B63 A;  2X99 A;  1ZX9 A;  1PBE A;  2ACZ A;  3RED A;  1TYP A;  4YSZ A;  4C3X A;  3S5W A;  1GES A;  2OA1 A;  5KXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...