4GF7A

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco), unliganded form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 127
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4gf7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gf7A01
2JAEA 4OPUA 2BS3A 2YG7A 4H4SA 3URHA 3NKSA 3CNDA 1YQ4A 2J3NA 1D4DA 3DK8A 3GRTA 1DXLA 1YKJA 4J31A 3AE1A 3AD9B 4GR1A 2BC1A 2C76A 3LOVA 5L46A 2GVCA 2GF3A 4PABA 5TR3A 1GTHA 2EQ8A 1H84A 1GRTA 2WP9A 3M0OA 3GYJA 5J7XA 2YM2A 4GDPA 3AD7B 1FECA 2WDQA 2WDVA 2WPCA 4APNA 1XDIA 3LADA 2WU5A 3BHFA 3M13A 1BF3A 4YTMA 5CKUA 4EQSA 2QA1A 4Z2UA 2APGA 5ER0A 1KNPA 1H6VA 4DGKA 3L1RA 2PYXA 1TDNA 1CBOA 2WP6A 2TMDA 3ADAB 2OLNA 1E1KA 3ICSA 1GSNA 1FOHA 2YVJA 4H2NA 3DK4A 1UKVG 2C73A 1EL5A 1CJ2A 1LTXR 2B9WA 3H8LA 3OZ2A 2RABA 2WDRA 1ZP0A 1BGNA 3EAOA 4HA6A 1ZOYA 2XCGA 1TDFA 4D03A 1L9EA 2GQWA 3SQPA 2QAEA 4IV9A 1JRYA 1NHRA 2WOWA 3AEFA 2HQMA 1E6EA 2JB2A 2XFPA 3AXBA 3CNSA 3DGZA 1JRZA 2V6OA 3D1CA 2Z5XA 1Y0PA 2JB3A 1KSSA 2BACA 3KD9A 3VRAA 5IQ4A 5JCKA 5KOWA 3UP5A 1JOAA 3NT6A 1N1PA 1OJCA 4K5RA 4KPRA 1GRGA 3AE2A 5HHFA 1BZLA 2DKHA 2VQBA 2R0CA 4K5SA 2FJEA 4TM1A 5U1OA 3P4PA 3UTEA 1H7WA 3IWAA 4A99A 4H2PA 3VR8A 4C77A 2UZZA 3ICRA 4GRTA 3V3OA 3KVEA 1GALA 1GPEA 3RP8A 4CCQA 2C3DA 1LV0A 1K0LA 4U8LA 4YKGA 4BJZA 2GR2A 3LZWA 4EIQA 1VG9A 4PAAA 2XLSA 3FMWA 3DGHA 4GDEA 1O5WA 5BULA 5J60A 1JNRA 4Y4NA 2R45A 1LQTA 2X50A 2YG6A 1CL0A 4A7AA 3ATQA 3QFBA 2Q0LA 2XLRA 3NH3X 3ABVA 3SGLA 2ZZ0A 3DJDA 3COXA 3CGEA 3EF6A 2A89A 2ZZCA 3NGCX 1ONFA 2YG3A 3AEBA 2A8XA 3LJPA 1N4VA 3BI4A 1M6IA 1LQUA 1MO9A 2R46A 1RSGA 3NK0X 4J33A 4NZHA 1NHPA 3DK9A 5KXJA 2VQ7A 1YY5A 1VRQB 2OALA 1QJDA 1N4WA 2C72A 2X8HA 3F8DA 1ZDLA 3SM8A 3NYFA 3NN0X 1COYA 2XDOA 1FEAA 4Z44A 2NPXA 2C7GA 1PN0A 1Y56A 3KA7A 3GDNA 2GAHB 3AE6A 2C65A 3IC9A 1DJNA 3FPZA 3Q9TA 4H4TA 4U8PA 1F8WA 1DNCA 1K4QA 3AE4A 3NRNA 4I59A 5M0ZA 1IUVA 4B1BA 2X99A 1CJ3A 3PS9A 1O95A 3UOYA 1EL9A 3NNEA 3UKHA 2XFUA 4BV6A 4JY3A 4NTCA 4ICYA 3UKLA 3KPFA 4OPGA 4TM0A 1TYPA 5KVHA 2R4EA 1GEUA 1ZY8A 1K0IA 4C3YA 2O9ZA 4E0VA 1PBEA 3ICTA 2BK3A 2CULA 4B64A 1PBCA 2VVLA 2XVEA 3P4QA 5FS9A 4A79A 4B63A 1CJ4A 2GEWA 3AEAA 3DJJA 5FS7A 3NG7X 4TLZA 1CC2A 2VOUA 2TPRA 1CC4A 4H4YA 2EQ9A 3NIXA 1B37A 1EBDA 2H88A 1GETA 5KVIA 2YG4A 1GRFA 1OJDA 2IVEA 3CNTA 3LZXA 4WCTA 3VR9A 4BK3A 3GWFA 1GRHA 4X4JA 5KRQA 1ELIA 5U63A 3V76A 1IUUA 2B7SA 4FDCB 3VRBA 4B67A 3WE0A 1D7YA 3EPTA 4IVOB 4P9SA 2Q0KA 1BKWA 3AYJA 3RP6A 2CVJA 3ZDNA 3AEEA 3GMCA 5U25A 5HXIA 4H4XA 2BABA 3S61A 3UTHA 4JY2A 4DNAA 3S5WA 4U8JA 1S3EA 2WP5A 1V59A 2WU2A 1QO8A 4DSHA 4C3XA 4EMIA 2YG5A 1KSUA 2FJDA 2B9XA 3K7MX 4YKFA 2BXRA 2IVDA 2YR5A 3UOXA 3H8IA 1IUWA 5JCNA 3FG2P 5M10A 4XWZA 2VRLA 2XVIA 3K7TA 3QSEA 1GT8A 1LJ1A 1E1MA 3CIRA 4TM4A 2Y6RA 4OPIA 4Z24A 4A9WA 1TDOA 2GR0A 3AD8B 3HZLA 4AT2A 1PBBA 4YSYA 4H4QA 1E39A 1OJTA 3G5QA 1NEKA 2WOVA 4CBQA 3B6DA 2I0ZA 2Q6UA 1KDGA 3GD4A 4TLXA 1XHCA 1IUXA 1F8RA 3P1WA 5DBJA 1VG0A 3IHGA 5FS6A 2CDUA 3RNMA 3VRDB 1L9DA 4MJWA 4D04A 1B5QA 2JKCA 4EIPA 4A6NA 3QVRA 2DKIA 4YSHA 3GMBA 3AECA 2BA9A 1NHQA 2YLZA 3RHAA 3PVCA 4U8MA 2GMJA 3BI5A 1PJ7A 4OPLA 3L8KA 4CNKA 2GB0A 3G5RA 4EMJA 2JK6A 3CGDA 4IA5A 2WPEA 2WBAA 2XFOA 5FMHA 4J56A 3UKFA 4BK2A 4ZCCA 1H86A 5EB4A 2JB1A 2YM1A 4OPDA 2YLTA 2E1MA 2YR4A 4CY6A 1IJHA 3SFEA 1F8SA 2YLWA 3QSSA 1NAAA 1E1NA 3GDPA 3JSKA 3CTYA 1H81A 3E1TA 3DJGX 3C4NA 4RSLA 4CNJA 1AOGA 2GR1A 1NHSA 1EL8A 3KKJA 2NVKX 2WPFA 4A5LA 1NENA 1ZKQA 1OJAA 3UTGA 3Q6JA 4GCMA 3CGBA 2ZBWA 2YWLA 4ADWA 2JBVA 1DJQA 2ARDA 2YLXA 4GF7A 1Q1WA 5JCLA 3T37A 1TYTA 3LB8A 1IUSA 1W4XA 2C66A 3GSIA 1L0VA 3AWIA 1Z6LA 4K7ZA 4LIIA 2V5ZA 2V3BA 2YLRA 2E5VA 4YWOA 1P2EA 1Q9IA 3H4KA 1H82A 3AE7A 4OPTA 5KOXA 1TDKA 1PS9A 1M64A 4CCRA 1GREA 4H2QA 4USQA 1PHHA 2BS2A 4U2TA 4OVIA 5FS8A 2RGJA 1CC6A 4IA6A 1DODA 3ISHA 4AP3A 4H7UA 2XFNA 2E4GA 1KF6A 3CNPA 2WESA 4B66A 2YAUA 4AP1A 4EM4A 3BNUA 2BXSA 1K0JA 3IF9A 3P4SA 4YTPA 4J57A 1TDEA 2BS4A 3LXDA 2X8CA 1PXCA 2YVGA 3AB1A 3UOZA 2R0GA 4LA1A 4JDRA 3DA1A 2GRTA 3B3RA 2BK5A 5CQFA 1FEBA 1GV4A 1Q1RA 4YSZA 2QCUA 1B4VA 4Z43A 4RG3A 2BYBA 3ALMA 3F8PA 4K22A 2YVFA 2XLPA 3DH9A 2OLOA 3FBSA 1JNZA 1LPFA 4FK1A 1RP0A 1GOSA 2C70A 2Y6QA 4JNAA 1MXTA 4U8NA 2FJAA 3AE3A 3OC4A 4H4RA 2BCGG 2B7RA 1NPXA 1XPQA 3QSMA 4Z25A 1ZX9A 2GR3A 3O0HA 4YSXA 4H50A 5HY5A 3G5SA 2YLSA 4H4UA 3VQRA 3CPHG 4H4PA 4NEVA 1O94A 3UTFA 1ZMCA 1N4UA 2Z5YA 1F6MA 5KWFA 1ZK7A 3AE5A 2VVMA 4K8DA 3UCLA 4J2WA 1BGJA 2PHHA 4ZN0A 2AQJA 3AE8A 3AE9A 4JN9A 3REDA 1HYUA 4JQ9A 4ZCDA 1BWCA 3AEGA 2XVJA 5EOWA 3SFDA 3NHOX 4O5UA 3ATRA 2AR8A 4C74A 1DOCA 3UP4A 5IQ1A 2X8GA 3PO7A 4UDPA 3AYIA 1SEZA 2B9YA 3AEDA 2XFQA 5C2TA 1VDCA 1NG3A 1B8SA 1GRBA 1S2QA 2H89A 5JCIA 1H7XA 1D4EA 2BC0A 3FIMB 4UDRA 4U2SA 3BI2A 1E7PA 4H4VA 4AT0A 2C3CA 3ITJA 4Y4MA 4IVMB 3GRSA 2VZ2A 1H83A 3QFAA 3QJ4A 2R0PA 3RP7A 1PJ6A 3UKQA 2ACZA 4YTNA 1DOBA 1CHUA 2WOIA 2WS3A 3F8RA 1GERA 3EANA 1JEHA 4B68A 4M52A 1PXBA 4UP3A 3NK1X 4B65A 1FL2A 1PJ5A 2V3AA 1TRBA 1GESA 5C3JA 2R9ZA 4UDQA 3UKAA 3GYIA 2BCPA 3NYCA 2WEUA 1F3PA 1D4CA 1XANA 2YQUA 4A65A 2WETA 3UKPA 2XVHA 1ZMDA 4NTDA 4GUVA 2C67A 4Y4LA 2VRMA 4REKA 3BNMA 5BUKA 3K30A 3ALJA 4JNQA 3NK2X 2V60A 3GD3A 5GRTA 4NTEA 3UKKA 4EQXA 3QVPA 1YQ3A 2FBWA 3CNJA 4NEWA 4U8OA 1E1LA 1Y56B 3II4A 5GSNA 4CRTA 1NG4A 2QA2A 4HB9A 3CGCA 5JCMA 2RGHA 4DSGA 1GXFA 3D8XA 1EL7A 3NLCA 3CPIG 1L9CA 2B76A 1GRAA 3UOVA 5BRTA 4LU6A 1PBDA 2BK4A 4USRA 3C4AA 4XWRA 1D5TA 3BHKA 3I3LA 4X9NA 2RGOA 3CPJG 4H2RA 1P2HA 3DMEA 5EBKA 4EM3A 1PBFA 3NTAA 4YT0A 2XYOA 4U2LA 1RYIA 2F5ZA 4J36A 3DJEA 4U8KA 1S2YA 3ZYXA 2WHDA 3NTDA 2OA1A 2AAQA 2OAMA 4OCGA 1MOKA 4CY8A 4I58A 4XXGA 1X31B 4EMWA 1CF3A 1NDAA 1OJ9A 1QLBA 3NYEA 1CJCA 2EQ6A 5BVAA 4WX1A 3ALLA 2C64A 4X9MA 2GMHA 2FJBA 4RG4A 4K2XA 5EB5A 4H4ZA 2X3NA 1S3BA 1IUTA 1GNDA 1VQWA 1D7LA 4O5QA 3NN6X 1JU2A 2WQYA 1DOEA 1FCDA 3IHMA 1PXAA 4Z2RA 3R9UA 2IIDA 4YXDA 3M12A 4ECHA 2W0HA 4N9XA 4FK1C 4TM3A 2CFYA 2XVFA 5LV9A 3P9UA 3KU9A 1LVLA 2V61A 1PDHA 1KNRA 3GWDA 1ZOVA 4EQWA 3K7QX 2ZZBA 4C5OA 3V3NA 3KLJA 3P4RA 2XLUA 3CN8A 4Z2TA 4AOSA 2YR6A 4OPCA 2R4JA 2EQ7A 2GV8A 3I6DA 1YQZA 2C75A 4Z26A 3AYLA 2XLTA 3C96A 2GAGB 1KFYA 4FX9A 4J34A 4KX6A 2GH5A 4AOXA 5IPYA 4H4WA 2Q7VA 4BURA 2A87A 4BK1A 5HYMA 4B69A 1REOA 1GTEA 4U8IA 2GQFA 4A6NB 4EQRA 4BJYA 2VVLG 1JRXA
chains in the Genus database with same CATH superfamily
2JAEA 4OPUA 2BS3A 3T2ZA 2YG7A 4H4SA 3URHA 3NKSA 3CNDA 1YQ4A 2J3NA 1D4DA 3DK8A 3GRTA 1DXLA 1YKJA 4J31A 3AE1A 3AD9B 4GR1A 2BC1A 2C76A 3LOVA 5L46A 2GVCA 2GF3A 4PABA 5TR3A 1GTHA 2EQ8A 1H84A 1GRTA 3M0OA 2WP9A 3GYJA 5J7XA 2YM2A 4GDPA 3AD7B 1FECA 2WDQA 2WDVA 2WPCA 3CMMA 1XDIA 3LADA 2WU5A 4APNA 3BHFA 3M13A 1BF3A 4YTMA 5CKUA 4EQSA 2QA1A 4Z2UA 2APGA 5ER0A 1KNPA 1H6VA 4DGKA 3L1RA 2PYXA 1TDNA 1CBOA 3ADAB 2TMDA 2WP6A 2OLNA 1E1KA 3ICSA 1GSNA 1FOHA 2YVJA 4H2NA 3DK4A 1UKVG 2C73A 1EL5A 1CJ2A 1LTXR 2B9WA 3H8LA 3OZ2A 2RABA 2WDRA 1ZP0A 1BGNA 3EAOA 4HA6A 5KMPA 3SY4A 1ZOYA 2XCGA 1TDFA 4D03A 1L9EA 2GQWA 3SQPA 2QAEA 4IV9A 1JRYA 1NHRA 2WOWA 3AEFA 2HQMA 1E6EA 3AXBA 2JB2A 2XFPA 3CNSA 3DGZA 1JRZA 2V6OA 3D1CA 2Z5XA 1Y0PA 2JB3A 1KSSA 2BACA 3KD9A 3VRAA 5IQ4A 5JCKA 5KOWA 3UP5A 1JOAA 3NT6A 1N1PA 1OJCA 4K5RA 4KPRA 1GRGA 3AE2A 5HHFA 2BRAA 1BZLA 2DKHA 2VQBA 2R0CA 4K5SA 2FJEA 4TM1A 5U1OA 4YJFA 3P4PA 3UTEA 1H7WA 3IWAA 4A99A 4H2PA 3VR8A 3SYIA 4C77A 2UZZA 3ICRA 4GRTA 3V3OA 3KVEA 1GALA 3RP8A 1GPEA 4CCQA 2C3DA 1LV0A 1K0LA 4U8LA 4YKGA 4BJZA 2GR2A 3LZWA 4EIQA 1VG9A 4PAAA 2XLSA 3FMWA 3DGHA 4GDEA 1O5WA 5BULA 5J60A 3SZCA 5KMSA 1JNRA 4Y4NA 2R45A 1LQTA 2X50A 2YG6A 1CL0A 4A7AA 5KNLA 3ATQA 3QFBA 2Q0LA 2XLRA 3NH3X 3ABVA 3SGLA 2ZZ0A 3DJDA 3COXA 3CGEA 3EF6A 2A89A 2ZZCA 3NGCX 1ONFA 2YG3A 3AEBA 2A8XA 3LJPA 4BJYA 1N4VA 1M6IA 1LQUA 2R46A 1MO9A 1RSGA 3BI4A 3NK0X 4J33A 4NZHA 1NHPA 3DK9A 4YJGA 2VQ7A 5KXJA 1YY5A 1VRQB 2OALA 1QJDA 1N4WA 2C72A 3SM8A 2X8HA 1ZDLA 3F8DA 3NYFA 3NN0X 1COYA 2XDOA 1FEAA 4Z44A 3T14A 2NPXA 1PN0A 2C7GA 1Y56A 3KA7A 3GDNA 2GAHB 3AE6A 2C65A 3IC9A 1DJNA 3FPZA 3Q9TA 4H4TA 4U8PA 1F8WA 1DNCA 1K4QA 1C0LA 3AE4A 3NRNA 4I59A 5M0ZA 1IUVA 4B1BA 2X99A 1CJ3A 1DDOA 3PS9A 3T31A 1O95A 3UOYA 1EL9A 3NNEA 3UKHA 2XFUA 4BV6A 4JY3A 3ZNQA 4NTCA 4ICYA 3UKLA 3KPFA 4OPGA 4TM0A 1TYPA 5KVHA 2R4EA 1GEUA 1ZY8A 1K0IA 4C3YA 2O9ZA 4E0VA 1PBEA 3WGTA 2BK3A 2CULA 3ICTA 1PBCA 2VVLA 2XVEA 3P4QA 5FS9A 4A79A 4B63A 1CJ4A 2GEWA 3AEAA 3DJJA 5FS7A 3NG7X 4TLZA 1CC2A 2VOUA 2TPRA 1CC4A 4H4YA 4YJHA 2EQ9A 3NIXA 1B37A 4II2A 1EBDA 2H88A 1GETA 5KVIA 2YG4A 1GRFA 1OJDA 4BK3A 2IVEA 4WCTA 3CNTA 3LZXA 3VR9A 3GWFA 1GRHA 4X4JA 5KRQA 1ELIA 5U63A 3V76A 1IUUA 1EVIA 2B7SA 4FDCB 3VRBA 4B67A 3WE0A 4P9SA 3EPTA 3W4JA 1D7YA 2Q0KA 1BKWA 4IVOB 3RP6A 3AYJA 2CVJA 3ZDNA 3AEEA 3GMCA 5U25A 5HXIA 4H4XA 1VE9A 2BABA 3S61A 3UTHA 4JY2A 4G6HA 3S5WA 4U8JA 4DNAA 1S3EA 2WP5A 1V59A 2WU2A 1QO8A 3ZNOA 4C3XA 4DSHA 4EMIA 3W4IA 2YG5A 1KSUA 2FJDA 2B9XA 3K7MX 4YKFA 2BXRA 2IVDA 2YR5A 3UOXA 3H8IA 1IUWA 3SZFA 5JCNA 3HYWA 3FG2P 5M10A 4XWZA 2VRLA 2XVIA 2E82A 3QSEA 3K7TA 1GT8A 1LJ1A 1E1MA 3CIRA 4TM4A 2Y6RA 3G3EA 4OPIA 4Z24A 4YJFB 3AD8B 3HZLA 1TDOA 2GR0A 1PBBA 4A9WA 4AT2A 4YSYA 4H4QA 1E39A 1OJTA 3G5QA 1NEKA 2WOVA 4CBQA 3B6DA 2I0ZA 3T2YA 2Q6UA 1KDGA 3GD4A 4TLXA 1XHCA 1IUXA 1F8RA 3P1WA 5DBJA 1VG0A 3IHGA 5FS6A 2CDUA 3RNMA 3VRDB 1L9DA 2E48A 4MJWA 4D04A 1B5QA 2JKCA 4EIPA 4A6NA 3QVRA 2DKIA 4YSHA 3GMBA 3AECA 2BA9A 1NHQA 2YLZA 3RHAA 3PVCA 4U8MA 2GMJA 3BI5A 1PJ7A 4OPLA 3L8KA 4CNKA 2GB0A 3G5RA 4EMJA 2JK6A 3CGDA 4IA5A 2WPEA 2WBAA 1C0IA 2XFOA 5FMHA 4J56A 3UKFA 4BK2A 4ZCCA 1H86A 5EB4A 2JB1A 2YM1A 4OPDA 2YLTA 2E1MA 2YR4A 3SZWA 4CY6A 1IJHA 3SFEA 1F8SA 3QSSA 2YLWA 2DU8A 1NAAA 1E1NA 3GDPA 3JSKA 3CTYA 3E1TA 1H81A 4RSLA 3C4NA 3DJGX 4CNJA 1AOGA 2GR1A 1NHSA 1EL8A 3KKJA 2NVKX 2WPFA 4A5LA 3T0KA 1NENA 1ZKQA 1OJAA 3UTGA 3Q6JA 4GCMA 3CGBA 4G9KA 2ZBWA 2YWLA 4ADWA 2JBVA 1DJQA 2ARDA 2YLXA 4GF7A 1Q1WA 2E4AA 5JCLA 1AN9A 3T37A 1TYTA 3LB8A 1IUSA 3GSIA 1W4XA 2C66A 1L0VA 3AWIA 1Z6LA 4K7ZA 4LIIA 2V5ZA 2V3BA 2YLRA 2E5VA 4YWOA 1P2EA 1Q9IA 3H4KA 1H82A 3AE7A 4OPTA 5KOXA 1TDKA 1PS9A 1DAOA 1M64A 4CCRA 1GREA 4H2QA 4QFCA 4USQA 1PHHA 4GAPA 2BS2A 4U2TA 4OVIA 5FS8A 2RGJA 1CC6A 4IA6A 1DODA 3ISHA 4AP3A 4H7UA 2XFNA 4YJDA 2E4GA 1KF6A 3CNPA 2WESA 4B66A 2YAUA 4AP1A 4EM4A 3BNUA 2BXSA 1K0JA 3IF9A 3P4SA 4YTPA 4J57A 1TDEA 2BS4A 3LXDA 2X8CA 1PXCA 2YVGA 3AB1A 3UOZA 2R0GA 4LA1A 4JDRA 4G74A 3DA1A 2GRTA 3B3RA 2BK5A 5CQFA 1FEBA 1GV4A 1Q1RA 4YSZA 2QCUA 1B4VA 4Z43A 4RG3A 2BYBA 3ALMA 3F8PA 4K22A 2YVFA 2XLPA 3DH9A 2OLOA 3FBSA 1JNZA 1LPFA 4FK1A 1RP0A 1GOSA 2C70A 2Y6QA 4JNAA 1MXTA 4U8NA 2FJAA 3AE3A 3OC4A 4H4RA 2BCGG 2B7RA 3QSMA 1NPXA 1XPQA 4Z25A 1ZX9A 2GR3A 3O0HA 4YSXA 3HYXA 4H50A 5HY5A 3G5SA 2YLSA 4H4UA 3VQRA 3CPHG 4H4PA 4NEVA 1O94A 3UTFA 1ZMCA 1N4UA 2Z5YA 1F6MA 5KWFA 1ZK7A 3AE5A 2VVMA 4K8DA 3UCLA 4J2WA 1BGJA 2PHHA 4QFDA 4ZN0A 2AQJA 3AE8A 3AE9A 4JN9A 3REDA 1HYUA 4JQ9A 4ZCDA 1BWCA 3AEGA 4G6GA 2XVJA 5EOWA 3SFDA 3NHOX 4O5UA 3ATRA 2AR8A 4C74A 1DOCA 3UP4A 5IQ1A 2X8GA 3PO7A 4UDPA 3AYIA 1SEZA 2B9YA 3AEDA 2XFQA 5C2TA 1VDCA 1NG3A 1B8SA 1GRBA 1S2QA 2H89A 5JCIA 5KMRA 1H7XA 1D4EA 2BC0A 3FIMB 4UDRA 4U2SA 3BI2A 1E7PA 4H4VA 4AT0A 2C3CA 1KIFA 3ITJA 4Y4MA 4IVMB 3GRSA 2VZ2A 1H83A 3QFAA 3QJ4A 2R0PA 3RP7A 1PJ6A 3UKQA 2ACZA 4YTNA 1DOBA 1CHUA 2WOIA 2WS3A 3F8RA 1GERA 3EANA 1JEHA 4B68A 4M52A 1PXBA 4UP3A 3GYXA 3NK1X 4B65A 1FL2A 1PJ5A 2V3AA 1TRBA 1GESA 5C3JA 2R9ZA 4UDQA 3UKAA 3GYIA 3NYCA 2BCPA 2WEUA 1F3PA 1D4CA 1XANA 2YQUA 4A65A 2WETA 3UKPA 2XVHA 1ZMDA 4NTDA 4GUVA 2C67A 4Y4LA 5KMQA 2VRMA 4REKA 4YJGB 3BNMA 5BUKA 3K30A 3ALJA 4JNQA 3NK2X 2V60A 3GD3A 5GRTA 4NTEA 3UKKA 4EQXA 3QVPA 1YQ3A 2FBWA 3CNJA 4NEWA 4U8OA 1E1LA 1Y56B 3II4A 5GSNA 4CRTA 1NG4A 2QA2A 4HB9A 3CGCA 5JCMA 2RGHA 3T2KA 4DSGA 1GXFA 3D8XA 1EL7A 3NLCA 3CPIG 1L9CA 2B76A 3SXIA 1GRAA 3UOVA 5BRTA 3KPKA 4LU6A 1PBDA 2BK4A 4USRA 3C4AA 4XWRA 3BHKA 1D5TA 3I3LA 4X9NA 2RGOA 3CPJG 1C0PA 4H2RA 1P2HA 3DMEA 5EBKA 4EM3A 1PBFA 3ZNPA 3NTAA 4YT0A 2XYOA 4U2LA 1RYIA 2F5ZA 4J36A 3DJEA 4U8KA 1S2YA 3ZYXA 2WHDA 3NTDA 2OA1A 2AAQA 2OAMA 4YJHB 4OCGA 1MOKA 4CY8A 4I58A 4XXGA 1X31B 4EMWA 1CF3A 1NDAA 1OJ9A 3NYEA 1QLBA 1CJCA 2EQ6A 5BVAA 4WX1A 1C0KA 3ALLA 4X9MA 2C64A 2GMHA 2FJBA 4RG4A 4K2XA 5EB5A 4H4ZA 2X3NA 1S3BA 1IUTA 1GNDA 1VQWA 1D7LA 4GAVA 3NN6X 4O5QA 1JU2A 2WQYA 1DOEA 3IHMA 1FCDA 1PXAA 4Z2RA 3R9UA 2IIDA 4YXDA 3M12A 4ECHA 2W0HA 4N9XA 4NWZA 4FK1C 4TM3A 2CFYA 2XVFA 5LV9A 2BRYA 4II3A 3P9UA 3ZNNA 3KU9A 2E49A 1LVLA 2V61A 1PDHA 3CUKA 1KNRA 3GWDA 3SZ0A 1ZOVA 3W4KA 4B64A 4EQWA 3K7QX 2ZZBA 4C5OA 3V3NA 3KLJA 3P4RA 2XLUA 2C4CA 3CN8A 4Z2TA 4AOSA 2YR6A 3SX6A 4G73A 4OPCA 2R4JA 2EQ7A 2GV8A 3I6DA 1YQZA 2C75A 3HYVA 3AYLA 2XLTA 4Z26A 3C96A 2GAGB 1KFYA 4FX9A 4J34A 4KX6A 2GH5A 4AOXA 5IPYA 4H4WA 2Q7VA 4BURA 2A87A 4BK1A 5HYMA 4B69A 1REOA 4NNJA 1GTEA 4U8IA 2GQFA 4A6NB 4EQRA 2VVLG 1JRXA
chains in the Genus database with same CATH topology
2JAEA 4OPUA 2BS3A 3T2ZA 2YG7A 4H4SA 3URHA 3NKSA 3CNDA 1YQ4A 2J3NA 1D4DA 3DK8A 3GRTA 1DXLA 1YKJA 4J31A 3AE1A 3AD9B 4GR1A 2BC1A 2C76A 3LOVA 5L46A 2GVCA 2GF3A 4PABA 5TR3A 1GTHA 2EQ8A 1H84A 1GRTA 2WP9A 3M0OA 3GYJA 5J7XA 2YM2A 4GDPA 3AD7B 1FECA 2WDQA 2WDVA 2WPCA 3CMMA 1XDIA 3LADA 2WU5A 4APNA 3BHFA 3M13A 1BF3A 4YTMA 5CKUA 4EQSA 2QA1A 4Z2UA 2APGA 5ER0A 1KNPA 1H6VA 4DGKA 3L1RA 2PYXA 1TDNA 1CBOA 2WP6A 2TMDA 3ADAB 2OLNA 1E1KA 3ICSA 1GSNA 1FOHA 2YVJA 4H2NA 3DK4A 1UKVG 2C73A 1EL5A 1CJ2A 1LTXR 2B9WA 3H8LA 3OZ2A 2RABA 2WDRA 1ZP0A 1BGNA 3EAOA 4HA6A 5KMPA 3SY4A 1ZOYA 2XCGA 1TDFA 4D03A 1L9EA 2GQWA 3SQPA 2QAEA 4IV9A 1JRYA 1NHRA 2WOWA 3AEFA 2HQMA 1E6EA 2JB2A 2XFPA 3AXBA 3CNSA 3DGZA 1JRZA 2V6OA 3D1CA 2Z5XA 1Y0PA 2JB3A 1KSSA 2BACA 3KD9A 3VRAA 5IQ4A 5JCKA 5KOWA 3UP5A 1JOAA 3NT6A 1N1PA 1OJCA 4K5RA 4KPRA 1GRGA 3AE2A 5HHFA 2BRAA 1BZLA 2DKHA 2VQBA 2R0CA 4K5SA 2FJEA 4TM1A 5U1OA 3P4PA 3UTEA 1H7WA 3IWAA 4A99A 4H2PA 3VR8A 3SYIA 4C77A 2UZZA 3ICRA 4GRTA 3V3OA 3KVEA 1GALA 3RP8A 1GPEA 4CCQA 2C3DA 1LV0A 1K0LA 4U8LA 4YKGA 4BJZA 2GR2A 3LZWA 4EIQA 1VG9A 4PAAA 2XLSA 3FMWA 3DGHA 4GDEA 1O5WA 5BULA 5J60A 3SZCA 5KMSA 1JNRA 4Y4NA 2R45A 1LQTA 2X50A 2YG6A 1CL0A 4A7AA 5KNLA 3ATQA 3QFBA 2Q0LA 2XLRA 3NH3X 3ABVA 3SGLA 2ZZ0A 3DJDA 3COXA 3CGEA 3EF6A 2A89A 2ZZCA 3NGCX 1ONFA 2YG3A 3AEBA 2A8XA 3LJPA 4BJYA 1N4VA 1M6IA 1LQUA 1MO9A 2R46A 1RSGA 3BI4A 3NK0X 4J33A 4NZHA 1NHPA 3DK9A 5KXJA 2VQ7A 1YY5A 1VRQB 2OALA 1QJDA 1N4WA 2C72A 2X8HA 3F8DA 1ZDLA 3SM8A 3NYFA 3NN0X 1COYA 2XDOA 1FEAA 4Z44A 3T14A 2NPXA 2C7GA 1PN0A 1Y56A 3KA7A 3GDNA 2GAHB 3AE6A 2C65A 3IC9A 1DJNA 3FPZA 3Q9TA 4H4TA 4U8PA 1F8WA 1DNCA 1K4QA 3AE4A 3NRNA 4I59A 5M0ZA 1IUVA 4B1BA 2X99A 1CJ3A 3PS9A 3T31A 1O95A 3UOYA 1EL9A 3NNEA 3UKHA 2XFUA 4BV6A 4JY3A 4NTCA 4ICYA 3UKLA 3KPFA 4OPGA 4TM0A 1TYPA 5KVHA 2R4EA 1GEUA 1ZY8A 1K0IA 4C3YA 2O9ZA 4E0VA 1PBEA 3ICTA 2BK3A 2CULA 4B64A 1PBCA 2VVLA 2XVEA 3P4QA 5FS9A 4A79A 4B63A 1CJ4A 2GEWA 3AEAA 3DJJA 5FS7A 3NG7X 4TLZA 1CC2A 2VOUA 2TPRA 1CC4A 4H4YA 2EQ9A 3NIXA 1B37A 4II2A 1EBDA 2H88A 1GETA 5KVIA 2YG4A 1GRFA 1OJDA 4BK3A 2IVEA 3CNTA 3LZXA 4WCTA 3VR9A 3GWFA 1GRHA 4X4JA 5KRQA 1ELIA 5U63A 3V76A 1IUUA 2B7SA 4FDCB 3VRBA 4B67A 3WE0A 1D7YA 3EPTA 4IVOB 4P9SA 2Q0KA 1BKWA 3RP6A 3AYJA 2CVJA 3ZDNA 3AEEA 3GMCA 5U25A 5HXIA 4H4XA 2BABA 3S61A 3UTHA 4JY2A 4G6HA 3S5WA 4U8JA 4DNAA 1S3EA 2WP5A 1V59A 2WU2A 1QO8A 4DSHA 4C3XA 4EMIA 2YG5A 1KSUA 2FJDA 2B9XA 3K7MX 4YKFA 2BXRA 2IVDA 2YR5A 3UOXA 3H8IA 1IUWA 3SZFA 5JCNA 3HYWA 3FG2P 5M10A 4XWZA 2VRLA 2XVIA 3K7TA 3QSEA 1GT8A 1LJ1A 1E1MA 3CIRA 4TM4A 2Y6RA 4OPIA 4Z24A 4A9WA 1TDOA 2GR0A 3AD8B 3HZLA 4AT2A 1PBBA 4YSYA 4H4QA 1E39A 1OJTA 3G5QA 1NEKA 2WOVA 4CBQA 3B6DA 2I0ZA 3T2YA 2Q6UA 1KDGA 3GD4A 4TLXA 1XHCA 1IUXA 1F8RA 3P1WA 5DBJA 1VG0A 3IHGA 5FS6A 2CDUA 3RNMA 3VRDB 1L9DA 4MJWA 4D04A 1B5QA 2JKCA 4EIPA 4A6NA 3QVRA 2DKIA 4YSHA 3GMBA 3AECA 2BA9A 1NHQA 2YLZA 3RHAA 3PVCA 4U8MA 2GMJA 3BI5A 1PJ7A 4OPLA 3L8KA 4CNKA 2GB0A 3G5RA 4EMJA 2JK6A 3CGDA 4IA5A 2WPEA 2WBAA 2XFOA 5FMHA 4J56A 3UKFA 4BK2A 4ZCCA 1H86A 5EB4A 2JB1A 2YM1A 4OPDA 2YLTA 2E1MA 2YR4A 3SZWA 4CY6A 1IJHA 3SFEA 1F8SA 2YLWA 3QSSA 1NAAA 1E1NA 3GDPA 3JSKA 3CTYA 3E1TA 1H81A 3DJGX 3C4NA 4RSLA 4CNJA 1AOGA 2GR1A 1NHSA 1EL8A 3KKJA 2NVKX 2WPFA 4A5LA 3T0KA 1NENA 1ZKQA 1OJAA 3UTGA 3Q6JA 4GCMA 3CGBA 4G9KA 2ZBWA 2YWLA 4ADWA 2JBVA 1DJQA 2ARDA 2YLXA 4GF7A 1Q1WA 5JCLA 3T37A 1TYTA 3LB8A 1IUSA 1W4XA 2C66A 3GSIA 1L0VA 3AWIA 1Z6LA 4K7ZA 4LIIA 2V5ZA 2V3BA 2YLRA 2E5VA 4YWOA 1P2EA 1Q9IA 3H4KA 1H82A 3AE7A 4OPTA 5KOXA 1TDKA 1PS9A 1M64A 4CCRA 1GREA 4H2QA 4USQA 1PHHA 4GAPA 2BS2A 4U2TA 4OVIA 5FS8A 2RGJA 1CC6A 4IA6A 1DODA 3ISHA 4AP3A 4H7UA 2XFNA 2E4GA 1KF6A 3CNPA 2WESA 4B66A 2YAUA 4AP1A 4EM4A 3BNUA 2BXSA 1K0JA 3IF9A 3P4SA 4YTPA 4J57A 1TDEA 2BS4A 3LXDA 2X8CA 1PXCA 2YVGA 3AB1A 3UOZA 2R0GA 4LA1A 4JDRA 4G74A 3DA1A 2GRTA 3B3RA 2BK5A 5CQFA 1FEBA 1GV4A 1Q1RA 4YSZA 2QCUA 1B4VA 4Z43A 4RG3A 2BYBA 3ALMA 3F8PA 4K22A 2YVFA 2XLPA 3DH9A 2OLOA 3FBSA 1JNZA 1LPFA 4FK1A 1RP0A 1GOSA 2C70A 2Y6QA 4JNAA 1MXTA 4U8NA 2FJAA 3AE3A 3OC4A 4H4RA 2BCGG 2B7RA 1NPXA 1XPQA 3QSMA 4Z25A 1ZX9A 2GR3A 3O0HA 4YSXA 3HYXA 4H50A 5HY5A 3G5SA 2YLSA 4H4UA 3VQRA 3CPHG 4H4PA 4NEVA 1O94A 3UTFA 1ZMCA 1N4UA 2Z5YA 1F6MA 5KWFA 1ZK7A 3AE5A 2VVMA 4K8DA 3UCLA 4J2WA 1BGJA 2PHHA 4ZN0A 2AQJA 3AE8A 3AE9A 4JN9A 3REDA 1HYUA 4JQ9A 4ZCDA 1BWCA 3AEGA 4G6GA 2XVJA 5EOWA 3SFDA 3NHOX 4O5UA 3ATRA 2AR8A 4C74A 1DOCA 3UP4A 5IQ1A 2X8GA 3PO7A 4UDPA 3AYIA 1SEZA 2B9YA 3AEDA 2XFQA 5C2TA 1VDCA 1NG3A 1B8SA 1GRBA 1S2QA 2H89A 5JCIA 5KMRA 1H7XA 1D4EA 2BC0A 3FIMB 4UDRA 4U2SA 3BI2A 1E7PA 4H4VA 4AT0A 2C3CA 3ITJA 4Y4MA 4IVMB 3GRSA 2VZ2A 1H83A 3QFAA 3QJ4A 2R0PA 3RP7A 1PJ6A 3UKQA 2ACZA 4YTNA 1DOBA 1CHUA 2WOIA 2WS3A 3F8RA 1GERA 3EANA 1JEHA 4B68A 4M52A 1PXBA 4UP3A 3GYXA 3NK1X 4B65A 1FL2A 1PJ5A 2V3AA 1TRBA 1GESA 5C3JA 2R9ZA 4UDQA 3UKAA 3GYIA 2BCPA 3NYCA 2WEUA 1F3PA 1D4CA 1XANA 2YQUA 4A65A 2WETA 3UKPA 2XVHA 1ZMDA 4NTDA 4GUVA 2C67A 4Y4LA 5KMQA 2VRMA 4REKA 3BNMA 5BUKA 3K30A 3ALJA 4JNQA 3NK2X 2V60A 3GD3A 5GRTA 4NTEA 3UKKA 4EQXA 3QVPA 1YQ3A 2FBWA 3CNJA 4NEWA 4U8OA 1E1LA 1Y56B 3II4A 5GSNA 4CRTA 1NG4A 2QA2A 4HB9A 3CGCA 5JCMA 2RGHA 3T2KA 4DSGA 1GXFA 3D8XA 1EL7A 3NLCA 3CPIG 1L9CA 2B76A 3SXIA 1GRAA 3UOVA 5BRTA 3KPKA 4LU6A 1PBDA 2BK4A 4USRA 3C4AA 4XWRA 1D5TA 3BHKA 3I3LA 4X9NA 2RGOA 3CPJG 4H2RA 1P2HA 3DMEA 5EBKA 4EM3A 1PBFA 3NTAA 4YT0A 2XYOA 4U2LA 1RYIA 2F5ZA 4J36A 3DJEA 4U8KA 1S2YA 3ZYXA 2WHDA 3NTDA 2OA1A 2AAQA 2OAMA 4OCGA 1MOKA 4CY8A 4I58A 4XXGA 1X31B 4EMWA 1CF3A 1NDAA 1OJ9A 1QLBA 3NYEA 1CJCA 2EQ6A 5BVAA 4WX1A 3ALLA 2C64A 4X9MA 2GMHA 2FJBA 4RG4A 4K2XA 5EB5A 4H4ZA 2X3NA 1S3BA 1IUTA 1GNDA 1VQWA 1D7LA 4GAVA 3NN6X 4O5QA 1JU2A 2WQYA 1DOEA 3IHMA 1FCDA 1PXAA 4Z2RA 3R9UA 2IIDA 4YXDA 3M12A 4ECHA 2W0HA 4N9XA 4NWZA 4FK1C 4TM3A 2CFYA 2XVFA 5LV9A 2BRYA 4II3A 3P9UA 3KU9A 1LVLA 2V61A 1PDHA 1KNRA 3GWDA 3SZ0A 1ZOVA 4EQWA 3K7QX 2ZZBA 4C5OA 3V3NA 3KLJA 3P4RA 2XLUA 2C4CA 3CN8A 4Z2TA 4AOSA 2YR6A 3SX6A 4G73A 4OPCA 2R4JA 2EQ7A 2GV8A 3I6DA 1YQZA 2C75A 3HYVA 3AYLA 2XLTA 4Z26A 3C96A 2GAGB 1KFYA 4FX9A 4J34A 4KX6A 2GH5A 4AOXA 5IPYA 4H4WA 2Q7VA 4BURA 2A87A 4BK1A 5HYMA 4B69A 1REOA 4NNJA 1GTEA 4U8IA 2GQFA 4A6NB 4EQRA 2VVLG 1JRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAE A;  4OPU A;  2BS3 A;  2YG7 A;  4H4S A;  3URH A;  3NKS A;  3CND A;  1YQ4 A;  2J3N A;  1D4D A;  3DK8 A;  3GRT A;  1DXL A;  1YKJ A;  4J31 A;  3AE1 A;  3AD9 B;  4GR1 A;  2BC1 A;  2C76 A;  3LOV A;  5L46 A;  2GVC A;  2GF3 A;  4PAB A;  5TR3 A;  1GTH A;  2EQ8 A;  1H84 A;  1GRT A;  2WP9 A;  3M0O A;  3GYJ A;  5J7X A;  2YM2 A;  4GDP A;  3AD7 B;  1FEC A;  2WDQ A;  2WDV A;  2WPC A;  4APN A;  1XDI A;  3LAD A;  2WU5 A;  3BHF A;  3M13 A;  1BF3 A;  4YTM A;  5CKU A;  4EQS A;  2QA1 A;  4Z2U A;  2APG A;  5ER0 A;  1KNP A;  1H6V A;  4DGK A;  3L1R A;  2PYX A;  1TDN A;  1CBO A;  2WP6 A;  2TMD A;  3ADA B;  2OLN A;  1E1K A;  3ICS A;  1GSN A;  1FOH A;  2YVJ A;  4H2N A;  3DK4 A;  1UKV G;  2C73 A;  1EL5 A;  1CJ2 A;  1LTX R;  2B9W A;  3H8L A;  3OZ2 A;  2RAB A;  2WDR A;  1ZP0 A;  1BGN A;  3EAO A;  4HA6 A;  1ZOY A;  2XCG A;  1TDF A;  4D03 A;  1L9E A;  2GQW A;  3SQP A;  2QAE A;  4IV9 A;  1JRY A;  1NHR A;  2WOW A;  3AEF A;  2HQM A;  1E6E A;  2JB2 A;  2XFP A;  3AXB A;  3CNS A;  3DGZ A;  1JRZ A;  2V6O A;  3D1C A;  2Z5X A;  1Y0P A;  2JB3 A;  1KSS A;  2BAC A;  3KD9 A;  3VRA A;  5IQ4 A;  5JCK A;  5KOW A;  3UP5 A;  1JOA A;  3NT6 A;  1N1P A;  1OJC A;  4K5R A;  4KPR A;  1GRG A;  3AE2 A;  5HHF A;  1BZL A;  2DKH A;  2VQB A;  2R0C A;  4K5S A;  2FJE A;  4TM1 A;  5U1O A;  3P4P A;  3UTE A;  1H7W A;  3IWA A;  4A99 A;  4H2P A;  3VR8 A;  4C77 A;  2UZZ A;  3ICR A;  4GRT A;  3V3O A;  3KVE A;  1GAL A;  1GPE A;  3RP8 A;  4CCQ A;  2C3D A;  1LV0 A;  1K0L A;  4U8L A;  4YKG A;  4BJZ A;  2GR2 A;  3LZW A;  4EIQ A;  1VG9 A;  4PAA A;  2XLS A;  3FMW A;  3DGH A;  4GDE A;  1O5W A;  5BUL A;  5J60 A;  1JNR A;  4Y4N A;  2R45 A;  1LQT A;  2X50 A;  2YG6 A;  1CL0 A;  4A7A A;  3ATQ A;  3QFB A;  2Q0L A;  2XLR A;  3NH3 X;  3ABV A;  3SGL A;  2ZZ0 A;  3DJD A;  3COX A;  3CGE A;  3EF6 A;  2A89 A;  2ZZC A;  3NGC X;  1ONF A;  2YG3 A;  3AEB A;  2A8X A;  3LJP A;  1N4V A;  3BI4 A;  1M6I A;  1LQU A;  1MO9 A;  2R46 A;  1RSG A;  3NK0 X;  4J33 A;  4NZH A;  1NHP A;  3DK9 A;  5KXJ A;  2VQ7 A;  1YY5 A;  1VRQ B;  2OAL A;  1QJD A;  1N4W A;  2C72 A;  2X8H A;  3F8D A;  1ZDL A;  3SM8 A;  3NYF A;  3NN0 X;  1COY A;  2XDO A;  1FEA A;  4Z44 A;  2NPX A;  2C7G A;  1PN0 A;  1Y56 A;  3KA7 A;  3GDN A;  2GAH B;  3AE6 A;  2C65 A;  3IC9 A;  1DJN A;  3FPZ A;  3Q9T A;  4H4T A;  4U8P A;  1F8W A;  1DNC A;  1K4Q A;  3AE4 A;  3NRN A;  4I59 A;  5M0Z A;  1IUV A;  4B1B A;  2X99 A;  1CJ3 A;  3PS9 A;  1O95 A;  3UOY A;  1EL9 A;  3NNE A;  3UKH A;  2XFU A;  4BV6 A;  4JY3 A;  4NTC A;  4ICY A;  3UKL A;  3KPF A;  4OPG A;  4TM0 A;  1TYP A;  5KVH A;  2R4E A;  1GEU A;  1ZY8 A;  1K0I A;  4C3Y A;  2O9Z A;  4E0V A;  1PBE A;  3ICT A;  2BK3 A;  2CUL A;  4B64 A;  1PBC A;  2VVL A;  2XVE A;  3P4Q A;  5FS9 A;  4A79 A;  4B63 A;  1CJ4 A;  2GEW A;  3AEA A;  3DJJ A;  5FS7 A;  3NG7 X;  4TLZ A;  1CC2 A;  2VOU A;  2TPR A;  1CC4 A;  4H4Y A;  2EQ9 A;  3NIX A;  1B37 A;  1EBD A;  2H88 A;  1GET A;  5KVI A;  2YG4 A;  1GRF A;  1OJD A;  2IVE A;  3CNT A;  3LZX A;  4WCT A;  3VR9 A;  4BK3 A;  3GWF A;  1GRH A;  4X4J A;  5KRQ A;  1ELI A;  5U63 A;  3V76 A;  1IUU A;  2B7S A;  4FDC B;  3VRB A;  4B67 A;  3WE0 A;  1D7Y A;  3EPT A;  4IVO B;  4P9S A;  2Q0K A;  1BKW A;  3AYJ A;  3RP6 A;  2CVJ A;  3ZDN A;  3AEE A;  3GMC A;  5U25 A;  5HXI A;  4H4X A;  2BAB A;  3S61 A;  3UTH A;  4JY2 A;  4DNA A;  3S5W A;  4U8J A;  1S3E A;  2WP5 A;  1V59 A;  2WU2 A;  1QO8 A;  4DSH A;  4C3X A;  4EMI A;  2YG5 A;  1KSU A;  2FJD A;  2B9X A;  3K7M X;  4YKF A;  2BXR A;  2IVD A;  2YR5 A;  3UOX A;  3H8I A;  1IUW A;  5JCN A;  3FG2 P;  5M10 A;  4XWZ A;  2VRL A;  2XVI A;  3K7T A;  3QSE A;  1GT8 A;  1LJ1 A;  1E1M A;  3CIR A;  4TM4 A;  2Y6R A;  4OPI A;  4Z24 A;  4A9W A;  1TDO A;  2GR0 A;  3AD8 B;  3HZL A;  4AT2 A;  1PBB A;  4YSY A;  4H4Q A;  1E39 A;  1OJT A;  3G5Q A;  1NEK A;  2WOV A;  4CBQ A;  3B6D A;  2I0Z A;  2Q6U A;  1KDG A;  3GD4 A;  4TLX A;  1XHC A;  1IUX A;  1F8R A;  3P1W A;  5DBJ A;  1VG0 A;  3IHG A;  5FS6 A;  2CDU A;  3RNM A;  3VRD B;  1L9D A;  4MJW A;  4D04 A;  1B5Q A;  2JKC A;  4EIP A;  4A6N A;  3QVR A;  2DKI A;  4YSH A;  3GMB A;  3AEC A;  2BA9 A;  1NHQ A;  2YLZ A;  3RHA A;  3PVC A;  4U8M A;  2GMJ A;  3BI5 A;  1PJ7 A;  4OPL A;  3L8K A;  4CNK A;  2GB0 A;  3G5R A;  4EMJ A;  2JK6 A;  3CGD A;  4IA5 A;  2WPE A;  2WBA A;  2XFO A;  5FMH A;  4J56 A;  3UKF A;  4BK2 A;  4ZCC A;  1H86 A;  5EB4 A;  2JB1 A;  2YM1 A;  4OPD A;  2YLT A;  2E1M A;  2YR4 A;  4CY6 A;  1IJH A;  3SFE A;  1F8S A;  2YLW A;  3QSS A;  1NAA A;  1E1N A;  3GDP A;  3JSK A;  3CTY A;  1H81 A;  3E1T A;  3DJG X;  3C4N A;  4RSL A;  4CNJ A;  1AOG A;  2GR1 A;  1NHS A;  1EL8 A;  3KKJ A;  2NVK X;  2WPF A;  4A5L A;  1NEN A;  1ZKQ A;  1OJA A;  3UTG A;  3Q6J A;  4GCM A;  3CGB A;  2ZBW A;  2YWL A;  4ADW A;  2JBV A;  1DJQ A;  2ARD A;  2YLX A;  4GF7 A;  1Q1W A;  5JCL A;  3T37 A;  1TYT A;  3LB8 A;  1IUS A;  1W4X A;  2C66 A;  3GSI A;  1L0V A;  3AWI A;  1Z6L A;  4K7Z A;  4LII A;  2V5Z A;  2V3B A;  2YLR A;  2E5V A;  4YWO A;  1P2E A;  1Q9I A;  3H4K A;  1H82 A;  3AE7 A;  4OPT A;  5KOX A;  1TDK A;  1PS9 A;  1M64 A;  4CCR A;  1GRE A;  4H2Q A;  4USQ A;  1PHH A;  2BS2 A;  4U2T A;  4OVI A;  5FS8 A;  2RGJ A;  1CC6 A;  4IA6 A;  1DOD A;  3ISH A;  4AP3 A;  4H7U A;  2XFN A;  2E4G A;  1KF6 A;  3CNP A;  2WES A;  4B66 A;  2YAU A;  4AP1 A;  4EM4 A;  3BNU A;  2BXS A;  1K0J A;  3IF9 A;  3P4S A;  4YTP A;  4J57 A;  1TDE A;  2BS4 A;  3LXD A;  2X8C A;  1PXC A;  2YVG A;  3AB1 A;  3UOZ A;  2R0G A;  4LA1 A;  4JDR A;  3DA1 A;  2GRT A;  3B3R A;  2BK5 A;  5CQF A;  1FEB A;  1GV4 A;  1Q1R A;  4YSZ A;  2QCU A;  1B4V A;  4Z43 A;  4RG3 A;  2BYB A;  3ALM A;  3F8P A;  4K22 A;  2YVF A;  2XLP A;  3DH9 A;  2OLO A;  3FBS A;  1JNZ A;  1LPF A;  4FK1 A;  1RP0 A;  1GOS A;  2C70 A;  2Y6Q A;  4JNA A;  1MXT A;  4U8N A;  2FJA A;  3AE3 A;  3OC4 A;  4H4R A;  2BCG G;  2B7R A;  1NPX A;  1XPQ A;  3QSM A;  4Z25 A;  1ZX9 A;  2GR3 A;  3O0H A;  4YSX A;  4H50 A;  5HY5 A;  3G5S A;  2YLS A;  4H4U A;  3VQR A;  3CPH G;  4H4P A;  4NEV A;  1O94 A;  3UTF A;  1ZMC A;  1N4U A;  2Z5Y A;  1F6M A;  5KWF A;  1ZK7 A;  3AE5 A;  2VVM A;  4K8D A;  3UCL A;  4J2W A;  1BGJ A;  2PHH A;  4ZN0 A;  2AQJ A;  3AE8 A;  3AE9 A;  4JN9 A;  3RED A;  1HYU A;  4JQ9 A;  4ZCD A;  1BWC A;  3AEG A;  2XVJ A;  5EOW A;  3SFD A;  3NHO X;  4O5U A;  3ATR A;  2AR8 A;  4C74 A;  1DOC A;  3UP4 A;  5IQ1 A;  2X8G A;  3PO7 A;  4UDP A;  3AYI A;  1SEZ A;  2B9Y A;  3AED A;  2XFQ A;  5C2T A;  1VDC A;  1NG3 A;  1B8S A;  1GRB A;  1S2Q A;  2H89 A;  5JCI A;  1H7X A;  1D4E A;  2BC0 A;  3FIM B;  4UDR A;  4U2S A;  3BI2 A;  1E7P A;  4H4V A;  4AT0 A;  2C3C A;  3ITJ A;  4Y4M A;  4IVM B;  3GRS A;  2VZ2 A;  1H83 A;  3QFA A;  3QJ4 A;  2R0P A;  3RP7 A;  1PJ6 A;  3UKQ A;  2ACZ A;  4YTN A;  1DOB A;  1CHU A;  2WOI A;  2WS3 A;  3F8R A;  1GER A;  3EAN A;  1JEH A;  4B68 A;  4M52 A;  1PXB A;  4UP3 A;  3NK1 X;  4B65 A;  1FL2 A;  1PJ5 A;  2V3A A;  1TRB A;  1GES A;  5C3J A;  2R9Z A;  4UDQ A;  3UKA A;  3GYI A;  2BCP A;  3NYC A;  2WEU A;  1F3P A;  1D4C A;  1XAN A;  2YQU A;  4A65 A;  2WET A;  3UKP A;  2XVH A;  1ZMD A;  4NTD A;  4GUV A;  2C67 A;  4Y4L A;  2VRM A;  4REK A;  3BNM A;  5BUK A;  3K30 A;  3ALJ A;  4JNQ A;  3NK2 X;  2V60 A;  3GD3 A;  5GRT A;  4NTE A;  3UKK A;  4EQX A;  3QVP A;  1YQ3 A;  2FBW A;  3CNJ A;  4NEW A;  4U8O A;  1E1L A;  1Y56 B;  3II4 A;  5GSN A;  4CRT A;  1NG4 A;  2QA2 A;  4HB9 A;  3CGC A;  5JCM A;  2RGH A;  4DSG A;  1GXF A;  3D8X A;  1EL7 A;  3NLC A;  3CPI G;  1L9C A;  2B76 A;  1GRA A;  3UOV A;  5BRT A;  4LU6 A;  1PBD A;  2BK4 A;  4USR A;  3C4A A;  4XWR A;  1D5T A;  3BHK A;  3I3L A;  4X9N A;  2RGO A;  3CPJ G;  4H2R A;  1P2H A;  3DME A;  5EBK A;  4EM3 A;  1PBF A;  3NTA A;  4YT0 A;  2XYO A;  4U2L A;  1RYI A;  2F5Z A;  4J36 A;  3DJE A;  4U8K A;  1S2Y A;  3ZYX A;  2WHD A;  3NTD A;  2OA1 A;  2AAQ A;  2OAM A;  4OCG A;  1MOK A;  4CY8 A;  4I58 A;  4XXG A;  1X31 B;  4EMW A;  1CF3 A;  1NDA A;  1OJ9 A;  1QLB A;  3NYE A;  1CJC A;  2EQ6 A;  5BVA A;  4WX1 A;  3ALL A;  2C64 A;  4X9M A;  2GMH A;  2FJB A;  4RG4 A;  4K2X A;  5EB5 A;  4H4Z A;  2X3N A;  1S3B A;  1IUT A;  1GND A;  1VQW A;  1D7L A;  4O5Q A;  3NN6 X;  1JU2 A;  2WQY A;  1DOE A;  1FCD A;  3IHM A;  1PXA A;  4Z2R A;  3R9U A;  2IID A;  4YXD A;  3M12 A;  4ECH A;  2W0H A;  4N9X A;  4FK1 C;  4TM3 A;  2CFY A;  2XVF A;  5LV9 A;  3P9U A;  3KU9 A;  1LVL A;  2V61 A;  1PDH A;  1KNR A;  3GWD A;  1ZOV A;  4EQW A;  3K7Q X;  2ZZB A;  4C5O A;  3V3N A;  3KLJ A;  3P4R A;  2XLU A;  3CN8 A;  4Z2T A;  4AOS A;  2YR6 A;  4OPC A;  2R4J A;  2EQ7 A;  2GV8 A;  3I6D A;  1YQZ A;  2C75 A;  4Z26 A;  3AYL A;  2XLT A;  3C96 A;  2GAG B;  1KFY A;  4FX9 A;  4J34 A;  4KX6 A;  2GH5 A;  4AOX A;  5IPY A;  4H4W A;  2Q7V A;  4BUR A;  2A87 A;  4BK1 A;  5HYM A;  4B69 A;  1REO A;  1GTE A;  4U8I A;  2GQF A;  4A6N B;  4EQR A;  4BJY A;  2VVL G;  1JRX A; 
#chains in the Genus database with same CATH topology
 2JAE A;  4OPU A;  2BS3 A;  3T2Z A;  2YG7 A;  4H4S A;  3URH A;  3NKS A;  3CND A;  1YQ4 A;  2J3N A;  1D4D A;  3DK8 A;  3GRT A;  1DXL A;  1YKJ A;  4J31 A;  3AE1 A;  3AD9 B;  4GR1 A;  2BC1 A;  2C76 A;  3LOV A;  5L46 A;  2GVC A;  2GF3 A;  4PAB A;  5TR3 A;  1GTH A;  2EQ8 A;  1H84 A;  1GRT A;  3M0O A;  2WP9 A;  3GYJ A;  5J7X A;  2YM2 A;  4GDP A;  3AD7 B;  1FEC A;  2WDQ A;  2WDV A;  2WPC A;  3CMM A;  1XDI A;  3LAD A;  2WU5 A;  4APN A;  3BHF A;  3M13 A;  1BF3 A;  4YTM A;  5CKU A;  4EQS A;  2QA1 A;  4Z2U A;  2APG A;  5ER0 A;  1KNP A;  1H6V A;  4DGK A;  3L1R A;  2PYX A;  1TDN A;  1CBO A;  3ADA B;  2TMD A;  2WP6 A;  2OLN A;  1E1K A;  3ICS A;  1GSN A;  1FOH A;  2YVJ A;  4H2N A;  3DK4 A;  1UKV G;  2C73 A;  1EL5 A;  1CJ2 A;  1LTX R;  2B9W A;  3H8L A;  3OZ2 A;  2RAB A;  2WDR A;  1ZP0 A;  1BGN A;  3EAO A;  4HA6 A;  5KMP A;  3SY4 A;  1ZOY A;  2XCG A;  1TDF A;  4D03 A;  1L9E A;  2GQW A;  3SQP A;  2QAE A;  4IV9 A;  1JRY A;  1NHR A;  2WOW A;  3AEF A;  2HQM A;  1E6E A;  3AXB A;  2JB2 A;  2XFP A;  3CNS A;  3DGZ A;  1JRZ A;  2V6O A;  3D1C A;  2Z5X A;  1Y0P A;  2JB3 A;  1KSS A;  2BAC A;  3KD9 A;  3VRA A;  5IQ4 A;  5JCK A;  5KOW A;  3UP5 A;  1JOA A;  3NT6 A;  1N1P A;  1OJC A;  4K5R A;  4KPR A;  1GRG A;  3AE2 A;  5HHF A;  2BRA A;  1BZL A;  2DKH A;  2VQB A;  2R0C A;  4K5S A;  2FJE A;  4TM1 A;  5U1O A;  4YJF A;  3P4P A;  3UTE A;  1H7W A;  3IWA A;  4A99 A;  4H2P A;  3VR8 A;  3SYI A;  4C77 A;  2UZZ A;  3ICR A;  4GRT A;  3V3O A;  3KVE A;  1GAL A;  3RP8 A;  1GPE A;  4CCQ A;  2C3D A;  1LV0 A;  1K0L A;  4U8L A;  4YKG A;  4BJZ A;  2GR2 A;  3LZW A;  4EIQ A;  1VG9 A;  4PAA A;  2XLS A;  3FMW A;  3DGH A;  4GDE A;  1O5W A;  5BUL A;  5J60 A;  3SZC A;  5KMS A;  1JNR A;  4Y4N A;  2R45 A;  1LQT A;  2X50 A;  2YG6 A;  1CL0 A;  4A7A A;  5KNL A;  3ATQ A;  3QFB A;  2Q0L A;  2XLR A;  3NH3 X;  3ABV A;  3SGL A;  2ZZ0 A;  3DJD A;  3COX A;  3CGE A;  3EF6 A;  2A89 A;  2ZZC A;  3NGC X;  1ONF A;  2YG3 A;  3AEB A;  2A8X A;  3LJP A;  4BJY A;  1N4V A;  1M6I A;  1LQU A;  2R46 A;  1MO9 A;  1RSG A;  3BI4 A;  3NK0 X;  4J33 A;  4NZH A;  1NHP A;  3DK9 A;  4YJG A;  2VQ7 A;  5KXJ A;  1YY5 A;  1VRQ B;  2OAL A;  1QJD A;  1N4W A;  2C72 A;  3SM8 A;  2X8H A;  1ZDL A;  3F8D A;  3NYF A;  3NN0 X;  1COY A;  2XDO A;  1FEA A;  4Z44 A;  3T14 A;  2NPX A;  1PN0 A;  2C7G A;  1Y56 A;  3KA7 A;  3GDN A;  2GAH B;  3AE6 A;  2C65 A;  3IC9 A;  1DJN A;  3FPZ A;  3Q9T A;  4H4T A;  4U8P A;  1F8W A;  1DNC A;  1K4Q A;  1C0L A;  3AE4 A;  3NRN A;  4I59 A;  5M0Z A;  1IUV A;  4B1B A;  2X99 A;  1CJ3 A;  1DDO A;  3PS9 A;  3T31 A;  1O95 A;  3UOY A;  1EL9 A;  3NNE A;  3UKH A;  2XFU A;  4BV6 A;  4JY3 A;  3ZNQ A;  4NTC A;  4ICY A;  3UKL A;  3KPF A;  4OPG A;  4TM0 A;  1TYP A;  5KVH A;  2R4E A;  1GEU A;  1ZY8 A;  1K0I A;  4C3Y A;  2O9Z A;  4E0V A;  1PBE A;  3WGT A;  2BK3 A;  2CUL A;  3ICT A;  1PBC A;  2VVL A;  2XVE A;  3P4Q A;  5FS9 A;  4A79 A;  4B63 A;  1CJ4 A;  2GEW A;  3AEA A;  3DJJ A;  5FS7 A;  3NG7 X;  4TLZ A;  1CC2 A;  2VOU A;  2TPR A;  1CC4 A;  4H4Y A;  4YJH A;  2EQ9 A;  3NIX A;  1B37 A;  4II2 A;  1EBD A;  2H88 A;  1GET A;  5KVI A;  2YG4 A;  1GRF A;  1OJD A;  4BK3 A;  2IVE A;  4WCT A;  3CNT A;  3LZX A;  3VR9 A;  3GWF A;  1GRH A;  4X4J A;  5KRQ A;  1ELI A;  5U63 A;  3V76 A;  1IUU A;  1EVI A;  2B7S A;  4FDC B;  3VRB A;  4B67 A;  3WE0 A;  4P9S A;  3EPT A;  3W4J A;  1D7Y A;  2Q0K A;  1BKW A;  4IVO B;  3RP6 A;  3AYJ A;  2CVJ A;  3ZDN A;  3AEE A;  3GMC A;  5U25 A;  5HXI A;  4H4X A;  1VE9 A;  2BAB A;  3S61 A;  3UTH A;  4JY2 A;  4G6H A;  3S5W A;  4U8J A;  4DNA A;  1S3E A;  2WP5 A;  1V59 A;  2WU2 A;  1QO8 A;  3ZNO A;  4C3X A;  4DSH A;  4EMI A;  3W4I A;  2YG5 A;  1KSU A;  2FJD A;  2B9X A;  3K7M X;  4YKF A;  2BXR A;  2IVD A;  2YR5 A;  3UOX A;  3H8I A;  1IUW A;  3SZF A;  5JCN A;  3HYW A;  3FG2 P;  5M10 A;  4XWZ A;  2VRL A;  2XVI A;  2E82 A;  3QSE A;  3K7T A;  1GT8 A;  1LJ1 A;  1E1M A;  3CIR A;  4TM4 A;  2Y6R A;  3G3E A;  4OPI A;  4Z24 A;  4YJF B;  3AD8 B;  3HZL A;  1TDO A;  2GR0 A;  1PBB A;  4A9W A;  4AT2 A;  4YSY A;  4H4Q A;  1E39 A;  1OJT A;  3G5Q A;  1NEK A;  2WOV A;  4CBQ A;  3B6D A;  2I0Z A;  3T2Y A;  2Q6U A;  1KDG A;  3GD4 A;  4TLX A;  1XHC A;  1IUX A;  1F8R A;  3P1W A;  5DBJ A;  1VG0 A;  3IHG A;  5FS6 A;  2CDU A;  3RNM A;  3VRD B;  1L9D A;  2E48 A;  4MJW A;  4D04 A;  1B5Q A;  2JKC A;  4EIP A;  4A6N A;  3QVR A;  2DKI A;  4YSH A;  3GMB A;  3AEC A;  2BA9 A;  1NHQ A;  2YLZ A;  3RHA A;  3PVC A;  4U8M A;  2GMJ A;  3BI5 A;  1PJ7 A;  4OPL A;  3L8K A;  4CNK A;  2GB0 A;  3G5R A;  4EMJ A;  2JK6 A;  3CGD A;  4IA5 A;  2WPE A;  2WBA A;  1C0I A;  2XFO A;  5FMH A;  4J56 A;  3UKF A;  4BK2 A;  4ZCC A;  1H86 A;  5EB4 A;  2JB1 A;  2YM1 A;  4OPD A;  2YLT A;  2E1M A;  2YR4 A;  3SZW A;  4CY6 A;  1IJH A;  3SFE A;  1F8S A;  3QSS A;  2YLW A;  2DU8 A;  1NAA A;  1E1N A;  3GDP A;  3JSK A;  3CTY A;  3E1T A;  1H81 A;  4RSL A;  3C4N A;  3DJG X;  4CNJ A;  1AOG A;  2GR1 A;  1NHS A;  1EL8 A;  3KKJ A;  2NVK X;  2WPF A;  4A5L A;  3T0K A;  1NEN A;  1ZKQ A;  1OJA A;  3UTG A;  3Q6J A;  4GCM A;  3CGB A;  4G9K A;  2ZBW A;  2YWL A;  4ADW A;  2JBV A;  1DJQ A;  2ARD A;  2YLX A;  4GF7 A;  1Q1W A;  2E4A A;  5JCL A;  1AN9 A;  3T37 A;  1TYT A;  3LB8 A;  1IUS A;  3GSI A;  1W4X A;  2C66 A;  1L0V A;  3AWI A;  1Z6L A;  4K7Z A;  4LII A;  2V5Z A;  2V3B A;  2YLR A;  2E5V A;  4YWO A;  1P2E A;  1Q9I A;  3H4K A;  1H82 A;  3AE7 A;  4OPT A;  5KOX A;  1TDK A;  1PS9 A;  1DAO A;  1M64 A;  4CCR A;  1GRE A;  4H2Q A;  4QFC A;  4USQ A;  1PHH A;  4GAP A;  2BS2 A;  4U2T A;  4OVI A;  5FS8 A;  2RGJ A;  1CC6 A;  4IA6 A;  1DOD A;  3ISH A;  4AP3 A;  4H7U A;  2XFN A;  4YJD A;  2E4G A;  1KF6 A;  3CNP A;  2WES A;  4B66 A;  2YAU A;  4AP1 A;  4EM4 A;  3BNU A;  2BXS A;  1K0J A;  3IF9 A;  3P4S A;  4YTP A;  4J57 A;  1TDE A;  2BS4 A;  3LXD A;  2X8C A;  1PXC A;  2YVG A;  3AB1 A;  3UOZ A;  2R0G A;  4LA1 A;  4JDR A;  4G74 A;  3DA1 A;  2GRT A;  3B3R A;  2BK5 A;  5CQF A;  1FEB A;  1GV4 A;  1Q1R A;  4YSZ A;  2QCU A;  1B4V A;  4Z43 A;  4RG3 A;  2BYB A;  3ALM A;  3F8P A;  4K22 A;  2YVF A;  2XLP A;  3DH9 A;  2OLO A;  3FBS A;  1JNZ A;  1LPF A;  4FK1 A;  1RP0 A;  1GOS A;  2C70 A;  2Y6Q A;  4JNA A;  1MXT A;  4U8N A;  2FJA A;  3AE3 A;  3OC4 A;  4H4R A;  2BCG G;  2B7R A;  3QSM A;  1NPX A;  1XPQ A;  4Z25 A;  1ZX9 A;  2GR3 A;  3O0H A;  4YSX A;  3HYX A;  4H50 A;  5HY5 A;  3G5S A;  2YLS A;  4H4U A;  3VQR A;  3CPH G;  4H4P A;  4NEV A;  1O94 A;  3UTF A;  1ZMC A;  1N4U A;  2Z5Y A;  1F6M A;  5KWF A;  1ZK7 A;  3AE5 A;  2VVM A;  4K8D A;  3UCL A;  4J2W A;  1BGJ A;  2PHH A;  4QFD A;  4ZN0 A;  2AQJ A;  3AE8 A;  3AE9 A;  4JN9 A;  3RED A;  1HYU A;  4JQ9 A;  4ZCD A;  1BWC A;  3AEG A;  4G6G A;  2XVJ A;  5EOW A;  3SFD A;  3NHO X;  4O5U A;  3ATR A;  2AR8 A;  4C74 A;  1DOC A;  3UP4 A;  5IQ1 A;  2X8G A;  3PO7 A;  4UDP A;  3AYI A;  1SEZ A;  2B9Y A;  3AED A;  2XFQ A;  5C2T A;  1VDC A;  1NG3 A;  1B8S A;  1GRB A;  1S2Q A;  2H89 A;  5JCI A;  5KMR A;  1H7X A;  1D4E A;  2BC0 A;  3FIM B;  4UDR A;  4U2S A;  3BI2 A;  1E7P A;  4H4V A;  4AT0 A;  2C3C A;  1KIF A;  3ITJ A;  4Y4M A;  4IVM B;  3GRS A;  2VZ2 A;  1H83 A;  3QFA A;  3QJ4 A;  2R0P A;  3RP7 A;  1PJ6 A;  3UKQ A;  2ACZ A;  4YTN A;  1DOB A;  1CHU A;  2WOI A;  2WS3 A;  3F8R A;  1GER A;  3EAN A;  1JEH A;  4B68 A;  4M52 A;  1PXB A;  4UP3 A;  3GYX A;  3NK1 X;  4B65 A;  1FL2 A;  1PJ5 A;  2V3A A;  1TRB A;  1GES A;  5C3J A;  2R9Z A;  4UDQ A;  3UKA A;  3GYI A;  3NYC A;  2BCP A;  2WEU A;  1F3P A;  1D4C A;  1XAN A;  2YQU A;  4A65 A;  2WET A;  3UKP A;  2XVH A;  1ZMD A;  4NTD A;  4GUV A;  2C67 A;  4Y4L A;  5KMQ A;  2VRM A;  4REK A;  4YJG B;  3BNM A;  5BUK A;  3K30 A;  3ALJ A;  4JNQ A;  3NK2 X;  2V60 A;  3GD3 A;  5GRT A;  4NTE A;  3UKK A;  4EQX A;  3QVP A;  1YQ3 A;  2FBW A;  3CNJ A;  4NEW A;  4U8O A;  1E1L A;  1Y56 B;  3II4 A;  5GSN A;  4CRT A;  1NG4 A;  2QA2 A;  4HB9 A;  3CGC A;  5JCM A;  2RGH A;  3T2K A;  4DSG A;  1GXF A;  3D8X A;  1EL7 A;  3NLC A;  3CPI G;  1L9C A;  2B76 A;  3SXI A;  1GRA A;  3UOV A;  5BRT A;  3KPK A;  4LU6 A;  1PBD A;  2BK4 A;  4USR A;  3C4A A;  4XWR A;  3BHK A;  1D5T A;  3I3L A;  4X9N A;  2RGO A;  3CPJ G;  1C0P A;  4H2R A;  1P2H A;  3DME A;  5EBK A;  4EM3 A;  1PBF A;  3ZNP A;  3NTA A;  4YT0 A;  2XYO A;  4U2L A;  1RYI A;  2F5Z A;  4J36 A;  3DJE A;  4U8K A;  1S2Y A;  3ZYX A;  2WHD A;  3NTD A;  2OA1 A;  2AAQ A;  2OAM A;  4YJH B;  4OCG A;  1MOK A;  4CY8 A;  4I58 A;  4XXG A;  1X31 B;  4EMW A;  1CF3 A;  1NDA A;  1OJ9 A;  3NYE A;  1QLB A;  1CJC A;  2EQ6 A;  5BVA A;  4WX1 A;  1C0K A;  3ALL A;  4X9M A;  2C64 A;  2GMH A;  2FJB A;  4RG4 A;  4K2X A;  5EB5 A;  4H4Z A;  2X3N A;  1S3B A;  1IUT A;  1GND A;  1VQW A;  1D7L A;  4GAV A;  3NN6 X;  4O5Q A;  1JU2 A;  2WQY A;  1DOE A;  3IHM A;  1FCD A;  1PXA A;  4Z2R A;  3R9U A;  2IID A;  4YXD A;  3M12 A;  4ECH A;  2W0H A;  4N9X A;  4NWZ A;  4FK1 C;  4TM3 A;  2CFY A;  2XVF A;  5LV9 A;  2BRY A;  4II3 A;  3P9U A;  3ZNN A;  3KU9 A;  2E49 A;  1LVL A;  2V61 A;  1PDH A;  3CUK A;  1KNR A;  3GWD A;  3SZ0 A;  1ZOV A;  3W4K A;  4B64 A;  4EQW A;  3K7Q X;  2ZZB A;  4C5O A;  3V3N A;  3KLJ A;  3P4R A;  2XLU A;  2C4C A;  3CN8 A;  4Z2T A;  4AOS A;  2YR6 A;  3SX6 A;  4G73 A;  4OPC A;  2R4J A;  2EQ7 A;  2GV8 A;  3I6D A;  1YQZ A;  2C75 A;  3HYV A;  3AYL A;  2XLT A;  4Z26 A;  3C96 A;  2GAG B;  1KFY A;  4FX9 A;  4J34 A;  4KX6 A;  2GH5 A;  4AOX A;  5IPY A;  4H4W A;  2Q7V A;  4BUR A;  2A87 A;  4BK1 A;  5HYM A;  4B69 A;  1REO A;  4NNJ A;  1GTE A;  4U8I A;  2GQF A;  4A6N B;  4EQR A;  2VVL G;  1JRX A; 
#chains in the Genus database with same CATH homology
 2JAE A;  4OPU A;  2BS3 A;  3T2Z A;  2YG7 A;  4H4S A;  3URH A;  3NKS A;  3CND A;  1YQ4 A;  2J3N A;  1D4D A;  3DK8 A;  3GRT A;  1DXL A;  1YKJ A;  4J31 A;  3AE1 A;  3AD9 B;  4GR1 A;  2BC1 A;  2C76 A;  3LOV A;  5L46 A;  2GVC A;  2GF3 A;  4PAB A;  5TR3 A;  1GTH A;  2EQ8 A;  1H84 A;  1GRT A;  2WP9 A;  3M0O A;  3GYJ A;  5J7X A;  2YM2 A;  4GDP A;  3AD7 B;  1FEC A;  2WDQ A;  2WDV A;  2WPC A;  3CMM A;  1XDI A;  3LAD A;  2WU5 A;  4APN A;  3BHF A;  3M13 A;  1BF3 A;  4YTM A;  5CKU A;  4EQS A;  2QA1 A;  4Z2U A;  2APG A;  5ER0 A;  1KNP A;  1H6V A;  4DGK A;  3L1R A;  2PYX A;  1TDN A;  1CBO A;  2WP6 A;  2TMD A;  3ADA B;  2OLN A;  1E1K A;  3ICS A;  1GSN A;  1FOH A;  2YVJ A;  4H2N A;  3DK4 A;  1UKV G;  2C73 A;  1EL5 A;  1CJ2 A;  1LTX R;  2B9W A;  3H8L A;  3OZ2 A;  2RAB A;  2WDR A;  1ZP0 A;  1BGN A;  3EAO A;  4HA6 A;  5KMP A;  3SY4 A;  1ZOY A;  2XCG A;  1TDF A;  4D03 A;  1L9E A;  2GQW A;  3SQP A;  2QAE A;  4IV9 A;  1JRY A;  1NHR A;  2WOW A;  3AEF A;  2HQM A;  1E6E A;  2JB2 A;  2XFP A;  3AXB A;  3CNS A;  3DGZ A;  1JRZ A;  2V6O A;  3D1C A;  2Z5X A;  1Y0P A;  2JB3 A;  1KSS A;  2BAC A;  3KD9 A;  3VRA A;  5IQ4 A;  5JCK A;  5KOW A;  3UP5 A;  1JOA A;  3NT6 A;  1N1P A;  1OJC A;  4K5R A;  4KPR A;  1GRG A;  3AE2 A;  5HHF A;  2BRA A;  1BZL A;  2DKH A;  2VQB A;  2R0C A;  4K5S A;  2FJE A;  4TM1 A;  5U1O A;  3P4P A;  3UTE A;  1H7W A;  3IWA A;  4A99 A;  4H2P A;  3VR8 A;  3SYI A;  4C77 A;  2UZZ A;  3ICR A;  4GRT A;  3V3O A;  3KVE A;  1GAL A;  3RP8 A;  1GPE A;  4CCQ A;  2C3D A;  1LV0 A;  1K0L A;  4U8L A;  4YKG A;  4BJZ A;  2GR2 A;  3LZW A;  4EIQ A;  1VG9 A;  4PAA A;  2XLS A;  3FMW A;  3DGH A;  4GDE A;  1O5W A;  5BUL A;  5J60 A;  3SZC A;  5KMS A;  1JNR A;  4Y4N A;  2R45 A;  1LQT A;  2X50 A;  2YG6 A;  1CL0 A;  4A7A A;  5KNL A;  3ATQ A;  3QFB A;  2Q0L A;  2XLR A;  3NH3 X;  3ABV A;  3SGL A;  2ZZ0 A;  3DJD A;  3COX A;  3CGE A;  3EF6 A;  2A89 A;  2ZZC A;  3NGC X;  1ONF A;  2YG3 A;  3AEB A;  2A8X A;  3LJP A;  4BJY A;  1N4V A;  1M6I A;  1LQU A;  1MO9 A;  2R46 A;  1RSG A;  3BI4 A;  3NK0 X;  4J33 A;  4NZH A;  1NHP A;  3DK9 A;  5KXJ A;  2VQ7 A;  1YY5 A;  1VRQ B;  2OAL A;  1QJD A;  1N4W A;  2C72 A;  2X8H A;  3F8D A;  1ZDL A;  3SM8 A;  3NYF A;  3NN0 X;  1COY A;  2XDO A;  1FEA A;  4Z44 A;  3T14 A;  2NPX A;  2C7G A;  1PN0 A;  1Y56 A;  3KA7 A;  3GDN A;  2GAH B;  3AE6 A;  2C65 A;  3IC9 A;  1DJN A;  3FPZ A;  3Q9T A;  4H4T A;  4U8P A;  1F8W A;  1DNC A;  1K4Q A;  3AE4 A;  3NRN A;  4I59 A;  5M0Z A;  1IUV A;  4B1B A;  2X99 A;  1CJ3 A;  3PS9 A;  3T31 A;  1O95 A;  3UOY A;  1EL9 A;  3NNE A;  3UKH A;  2XFU A;  4BV6 A;  4JY3 A;  4NTC A;  4ICY A;  3UKL A;  3KPF A;  4OPG A;  4TM0 A;  1TYP A;  5KVH A;  2R4E A;  1GEU A;  1ZY8 A;  1K0I A;  4C3Y A;  2O9Z A;  4E0V A;  1PBE A;  3ICT A;  2BK3 A;  2CUL A;  4B64 A;  1PBC A;  2VVL A;  2XVE A;  3P4Q A;  5FS9 A;  4A79 A;  4B63 A;  1CJ4 A;  2GEW A;  3AEA A;  3DJJ A;  5FS7 A;  3NG7 X;  4TLZ A;  1CC2 A;  2VOU A;  2TPR A;  1CC4 A;  4H4Y A;  2EQ9 A;  3NIX A;  1B37 A;  4II2 A;  1EBD A;  2H88 A;  1GET A;  5KVI A;  2YG4 A;  1GRF A;  1OJD A;  4BK3 A;  2IVE A;  3CNT A;  3LZX A;  4WCT A;  3VR9 A;  3GWF A;  1GRH A;  4X4J A;  5KRQ A;  1ELI A;  5U63 A;  3V76 A;  1IUU A;  2B7S A;  4FDC B;  3VRB A;  4B67 A;  3WE0 A;  1D7Y A;  3EPT A;  4IVO B;  4P9S A;  2Q0K A;  1BKW A;  3RP6 A;  3AYJ A;  2CVJ A;  3ZDN A;  3AEE A;  3GMC A;  5U25 A;  5HXI A;  4H4X A;  2BAB A;  3S61 A;  3UTH A;  4JY2 A;  4G6H A;  3S5W A;  4U8J A;  4DNA A;  1S3E A;  2WP5 A;  1V59 A;  2WU2 A;  1QO8 A;  4DSH A;  4C3X A;  4EMI A;  2YG5 A;  1KSU A;  2FJD A;  2B9X A;  3K7M X;  4YKF A;  2BXR A;  2IVD A;  2YR5 A;  3UOX A;  3H8I A;  1IUW A;  3SZF A;  5JCN A;  3HYW A;  3FG2 P;  5M10 A;  4XWZ A;  2VRL A;  2XVI A;  3K7T A;  3QSE A;  1GT8 A;  1LJ1 A;  1E1M A;  3CIR A;  4TM4 A;  2Y6R A;  4OPI A;  4Z24 A;  4A9W A;  1TDO A;  2GR0 A;  3AD8 B;  3HZL A;  4AT2 A;  1PBB A;  4YSY A;  4H4Q A;  1E39 A;  1OJT A;  3G5Q A;  1NEK A;  2WOV A;  4CBQ A;  3B6D A;  2I0Z A;  3T2Y A;  2Q6U A;  1KDG A;  3GD4 A;  4TLX A;  1XHC A;  1IUX A;  1F8R A;  3P1W A;  5DBJ A;  1VG0 A;  3IHG A;  5FS6 A;  2CDU A;  3RNM A;  3VRD B;  1L9D A;  4MJW A;  4D04 A;  1B5Q A;  2JKC A;  4EIP A;  4A6N A;  3QVR A;  2DKI A;  4YSH A;  3GMB A;  3AEC A;  2BA9 A;  1NHQ A;  2YLZ A;  3RHA A;  3PVC A;  4U8M A;  2GMJ A;  3BI5 A;  1PJ7 A;  4OPL A;  3L8K A;  4CNK A;  2GB0 A;  3G5R A;  4EMJ A;  2JK6 A;  3CGD A;  4IA5 A;  2WPE A;  2WBA A;  2XFO A;  5FMH A;  4J56 A;  3UKF A;  4BK2 A;  4ZCC A;  1H86 A;  5EB4 A;  2JB1 A;  2YM1 A;  4OPD A;  2YLT A;  2E1M A;  2YR4 A;  3SZW A;  4CY6 A;  1IJH A;  3SFE A;  1F8S A;  2YLW A;  3QSS A;  1NAA A;  1E1N A;  3GDP A;  3JSK A;  3CTY A;  3E1T A;  1H81 A;  3DJG X;  3C4N A;  4RSL A;  4CNJ A;  1AOG A;  2GR1 A;  1NHS A;  1EL8 A;  3KKJ A;  2NVK X;  2WPF A;  4A5L A;  3T0K A;  1NEN A;  1ZKQ A;  1OJA A;  3UTG A;  3Q6J A;  4GCM A;  3CGB A;  4G9K A;  2ZBW A;  2YWL A;  4ADW A;  2JBV A;  1DJQ A;  2ARD A;  2YLX A;  4GF7 A;  1Q1W A;  5JCL A;  3T37 A;  1TYT A;  3LB8 A;  1IUS A;  1W4X A;  2C66 A;  3GSI A;  1L0V A;  3AWI A;  1Z6L A;  4K7Z A;  4LII A;  2V5Z A;  2V3B A;  2YLR A;  2E5V A;  4YWO A;  1P2E A;  1Q9I A;  3H4K A;  1H82 A;  3AE7 A;  4OPT A;  5KOX A;  1TDK A;  1PS9 A;  1M64 A;  4CCR A;  1GRE A;  4H2Q A;  4USQ A;  1PHH A;  4GAP A;  2BS2 A;  4U2T A;  4OVI A;  5FS8 A;  2RGJ A;  1CC6 A;  4IA6 A;  1DOD A;  3ISH A;  4AP3 A;  4H7U A;  2XFN A;  2E4G A;  1KF6 A;  3CNP A;  2WES A;  4B66 A;  2YAU A;  4AP1 A;  4EM4 A;  3BNU A;  2BXS A;  1K0J A;  3IF9 A;  3P4S A;  4YTP A;  4J57 A;  1TDE A;  2BS4 A;  3LXD A;  2X8C A;  1PXC A;  2YVG A;  3AB1 A;  3UOZ A;  2R0G A;  4LA1 A;  4JDR A;  4G74 A;  3DA1 A;  2GRT A;  3B3R A;  2BK5 A;  5CQF A;  1FEB A;  1GV4 A;  1Q1R A;  4YSZ A;  2QCU A;  1B4V A;  4Z43 A;  4RG3 A;  2BYB A;  3ALM A;  3F8P A;  4K22 A;  2YVF A;  2XLP A;  3DH9 A;  2OLO A;  3FBS A;  1JNZ A;  1LPF A;  4FK1 A;  1RP0 A;  1GOS A;  2C70 A;  2Y6Q A;  4JNA A;  1MXT A;  4U8N A;  2FJA A;  3AE3 A;  3OC4 A;  4H4R A;  2BCG G;  2B7R A;  1NPX A;  1XPQ A;  3QSM A;  4Z25 A;  1ZX9 A;  2GR3 A;  3O0H A;  4YSX A;  3HYX A;  4H50 A;  5HY5 A;  3G5S A;  2YLS A;  4H4U A;  3VQR A;  3CPH G;  4H4P A;  4NEV A;  1O94 A;  3UTF A;  1ZMC A;  1N4U A;  2Z5Y A;  1F6M A;  5KWF A;  1ZK7 A;  3AE5 A;  2VVM A;  4K8D A;  3UCL A;  4J2W A;  1BGJ A;  2PHH A;  4ZN0 A;  2AQJ A;  3AE8 A;  3AE9 A;  4JN9 A;  3RED A;  1HYU A;  4JQ9 A;  4ZCD A;  1BWC A;  3AEG A;  4G6G A;  2XVJ A;  5EOW A;  3SFD A;  3NHO X;  4O5U A;  3ATR A;  2AR8 A;  4C74 A;  1DOC A;  3UP4 A;  5IQ1 A;  2X8G A;  3PO7 A;  4UDP A;  3AYI A;  1SEZ A;  2B9Y A;  3AED A;  2XFQ A;  5C2T A;  1VDC A;  1NG3 A;  1B8S A;  1GRB A;  1S2Q A;  2H89 A;  5JCI A;  5KMR A;  1H7X A;  1D4E A;  2BC0 A;  3FIM B;  4UDR A;  4U2S A;  3BI2 A;  1E7P A;  4H4V A;  4AT0 A;  2C3C A;  3ITJ A;  4Y4M A;  4IVM B;  3GRS A;  2VZ2 A;  1H83 A;  3QFA A;  3QJ4 A;  2R0P A;  3RP7 A;  1PJ6 A;  3UKQ A;  2ACZ A;  4YTN A;  1DOB A;  1CHU A;  2WOI A;  2WS3 A;  3F8R A;  1GER A;  3EAN A;  1JEH A;  4B68 A;  4M52 A;  1PXB A;  4UP3 A;  3GYX A;  3NK1 X;  4B65 A;  1FL2 A;  1PJ5 A;  2V3A A;  1TRB A;  1GES A;  5C3J A;  2R9Z A;  4UDQ A;  3UKA A;  3GYI A;  2BCP A;  3NYC A;  2WEU A;  1F3P A;  1D4C A;  1XAN A;  2YQU A;  4A65 A;  2WET A;  3UKP A;  2XVH A;  1ZMD A;  4NTD A;  4GUV A;  2C67 A;  4Y4L A;  5KMQ A;  2VRM A;  4REK A;  3BNM A;  5BUK A;  3K30 A;  3ALJ A;  4JNQ A;  3NK2 X;  2V60 A;  3GD3 A;  5GRT A;  4NTE A;  3UKK A;  4EQX A;  3QVP A;  1YQ3 A;  2FBW A;  3CNJ A;  4NEW A;  4U8O A;  1E1L A;  1Y56 B;  3II4 A;  5GSN A;  4CRT A;  1NG4 A;  2QA2 A;  4HB9 A;  3CGC A;  5JCM A;  2RGH A;  3T2K A;  4DSG A;  1GXF A;  3D8X A;  1EL7 A;  3NLC A;  3CPI G;  1L9C A;  2B76 A;  3SXI A;  1GRA A;  3UOV A;  5BRT A;  3KPK A;  4LU6 A;  1PBD A;  2BK4 A;  4USR A;  3C4A A;  4XWR A;  1D5T A;  3BHK A;  3I3L A;  4X9N A;  2RGO A;  3CPJ G;  4H2R A;  1P2H A;  3DME A;  5EBK A;  4EM3 A;  1PBF A;  3NTA A;  4YT0 A;  2XYO A;  4U2L A;  1RYI A;  2F5Z A;  4J36 A;  3DJE A;  4U8K A;  1S2Y A;  3ZYX A;  2WHD A;  3NTD A;  2OA1 A;  2AAQ A;  2OAM A;  4OCG A;  1MOK A;  4CY8 A;  4I58 A;  4XXG A;  1X31 B;  4EMW A;  1CF3 A;  1NDA A;  1OJ9 A;  1QLB A;  3NYE A;  1CJC A;  2EQ6 A;  5BVA A;  4WX1 A;  3ALL A;  2C64 A;  4X9M A;  2GMH A;  2FJB A;  4RG4 A;  4K2X A;  5EB5 A;  4H4Z A;  2X3N A;  1S3B A;  1IUT A;  1GND A;  1VQW A;  1D7L A;  4GAV A;  3NN6 X;  4O5Q A;  1JU2 A;  2WQY A;  1DOE A;  3IHM A;  1FCD A;  1PXA A;  4Z2R A;  3R9U A;  2IID A;  4YXD A;  3M12 A;  4ECH A;  2W0H A;  4N9X A;  4NWZ A;  4FK1 C;  4TM3 A;  2CFY A;  2XVF A;  5LV9 A;  2BRY A;  4II3 A;  3P9U A;  3KU9 A;  1LVL A;  2V61 A;  1PDH A;  1KNR A;  3GWD A;  3SZ0 A;  1ZOV A;  4EQW A;  3K7Q X;  2ZZB A;  4C5O A;  3V3N A;  3KLJ A;  3P4R A;  2XLU A;  2C4C A;  3CN8 A;  4Z2T A;  4AOS A;  2YR6 A;  3SX6 A;  4G73 A;  4OPC A;  2R4J A;  2EQ7 A;  2GV8 A;  3I6D A;  1YQZ A;  2C75 A;  3HYV A;  3AYL A;  2XLT A;  4Z26 A;  3C96 A;  2GAG B;  1KFY A;  4FX9 A;  4J34 A;  4KX6 A;  2GH5 A;  4AOX A;  5IPY A;  4H4W A;  2Q7V A;  4BUR A;  2A87 A;  4BK1 A;  5HYM A;  4B69 A;  1REO A;  4NNJ A;  1GTE A;  4U8I A;  2GQF A;  4A6N B;  4EQR A;  2VVL G;  1JRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...