4GF7A

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco), unliganded form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
total genus 127
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4gf7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gf7A01
4C74A 3NKSA 4U2LA 3RHAA 3AD8B 1MOKA 3DMEA 2ACZA 3II4A 1LQTA 1ELIA 5JCLA 1PXAA 2FJEA 1X31B 1GRTA 3QSMA 3COXA 4I58A 4YSHA 1Z6LA 3FPZA 3UTEA 1Q9IA 4K8DA 4C3YA 1EL7A 1ZOVA 1JNZA 4D03A 2XLSA 2WP9A 4O5QA 4P9SA 4UDQA 3AYLA 1D7YA 2X8HA 2GMJA 3UKKA 1VG0A 4A99A 3ALMA 2GVCA 3KU9A 2OALA 2Z5YA 4RG4A 2RGJA 2YM2A 3CPJG 4OPUA 3F8PA 1CJ3A 4XWZA 1IUWA 3UOYA 2RGHA 1JRZA 2Z5XA 4JDRA 2NPXA 1CF3A 1P2EA 3P4RA 4LU6A 3NYCA 2C75A 3DK8A 3BI5A 3M0OA 1NHSA 4OPTA 1FEAA 3PVCA 5FS7A 1Y56B 2GAHB 4BK1A 3AE1A 2RABA 4H2NA 2VOUA 1H7WA 4B63A 1BGJA 4WCTA 4AP3A 3GDNA 1ONFA 3NN6X 3IHGA 5TR3A 2JB2A 1DOEA 1GESA 1O94A 1DJNA 2BK3A 2NVKX 2YG4A 4JQ9A 5LV9A 4OPDA 3SFDA 1CC2A 1YY5A 2BA9A 2YLTA 5U63A 2GB0A 3UCLA 1XPQA 3KKJA 3NTDA 1CBOA 3ZDNA 1D7LA 4H4QA 4LA1A 3UKPA 2J3NA 3AXBA 3LADA 1ZOYA 4YSZA 4ZCDA 4A6NA 5C2TA 2IVDA 3AD9B 4FDCB 3T37A 1LVLA 1TDFA 1IUTA 2H89A 3DJDA 5M0ZA 4EIQA 4XXGA 1GPEA 1PBFA 1ZKQA 1OJAA 3H4KA 4KPRA 4H4RA 1LPFA 4Y4LA 1GEUA 2B76A 4CCQA 1GXFA 2UZZA 2R0GA 2WEUA 1DOCA 4U8IA 1TYPA 4B69A 4H4VA 4Z26A 5JCKA 1M6IA 3NK1X 4OPIA 4Z25A 4K2XA 4A7AA 4EQRA 4JNQA 1CJ4A 4ZN0A 3NTAA 4J34A 5JCIA 2XFOA 1P2HA 3ICSA 3CNDA 4EQSA 2GMHA 5U25A 3BHKA 3G5SA 3H8LA 4ZCCA 1D4DA 5KOXA 3KVEA 1QO8A 4H4ZA 4UP3A 3B3RA 4EIPA 4U2TA 3AEGA 4KX6A 1JRXA 2X99A 3AWIA 3AEBA 3QVPA 4OCGA 1GTHA 3FBSA 5BVAA 3ITJA 2JAEA 2IIDA 2VRMA 2YG3A 4IV9A 2WDVA 4J56A 2XVHA 2B9WA 2BXSA 4XWRA 4AP1A 4YKGA 2YR6A 3UTGA 1ZK7A 4H4UA 4H4TA 2W0HA 1AOGA 3AEAA 1RYIA 2PHHA 2BXRA 4Z2UA 2JBVA 5M10A 2ZZCA 1Y0PA 2Q6UA 3ADAB 1DXLA 1FECA 1GT8A 1KNPA 3DK4A 4YXDA 2WU2A 3NH3X 3M13A 2XFQA 4TM0A 2YVGA 2A87A 4GF7A 2O9ZA 3Q6JA 4D04A 2FBWA 2VQBA 3JSKA 3VQRA 1OJTA 3AE6A 4TLXA 2YVJA 2YQUA 3C4NA 3PO7A 2WDRA 4H2QA 3C4AA 1L9CA 4CBQA 2WOVA 1L9EA 4H4PA 5ER0A 2Q0KA 3EANA 4HA6A 4BJZA 4OVIA 2GV8A 3ICTA 1GOSA 2WOIA 4B66A 2AAQA 3F8DA 3AEFA 3AB1A 1K0IA 3EF6A 1JEHA 1QLBA 3QJ4A 5KOWA 4A79A 5CKUA 1CJCA 1ZX9A 4YSXA 1GRAA 3QFAA 4GDPA 2V3BA 3HZLA 3K30A 4YSYA 1NHPA 5FS6A 4U8OA 2B9YA 3NK0X 3NNEA 1KSSA 3AEDA 1BGNA 2H88A 4JN9A 1B8SA 2OA1A 3L1RA 3F8RA 2R0PA 3FMWA 4RG3A 2R4EA 1D4CA 4X9MA 4J33A 2XFPA 4GCMA 5HXIA 2TPRA 1JRYA 2C3DA 2E1MA 2VVLA 5IQ1A 3K7TA 1NHQA 2A8XA 1RSGA 2RGOA 4K5SA 4C77A 4Z2RA 1F8RA 1QJDA 3BI2A 3AYJA 5HYMA 2WP5A 2WHDA 2R46A 4GDEA 2R45A 4BJYA 2BS2A 1XDIA 3CNPA 4EQWA 1Y56A 3LOVA 1N1PA 1VQWA 1D5TA 3BHFA 4NEVA 3FG2P 5L46A 1TRBA 2JK6A 5IQ4A 1PHHA 1PS9A 2EQ9A 4FK1A 3LZXA 1TDOA 3GD4A 1CJ2A 3KA7A 3ZYXA 2JKCA 4OPCA 2GR3A 1KFYA 4YTPA 1S3EA 3GWFA 3LJPA 2WOWA 3NT6A 3P4QA 1F3PA 5EB5A 3OC4A 4H7UA 2Q7VA 1ZDLA 2YLSA 2CVJA 3LB8A 5GRTA 4Z24A 2VQ7A 3QSSA 4Z44A 4EM3A 1L9DA 1YQZA 2C7GA 2F5ZA 3EAOA 4RSLA 2XLUA 2BS4A 4U8LA 1TDKA 1VG9A 1ZP0A 3FIMB 1NENA 1KDGA 2APGA 2XDOA 2YLRA 3SQPA 5KXJA 1JNRA 3DJJA 4DGKA 3NGCX 1REOA 1H82A 4U2SA 3VRBA 1EL8A 1NG3A 4Y4MA 3AEEA 4C5OA 2VRLA 1K0LA 4CY8A 2OLOA 1GETA 4USQA 2XVIA 4NEWA 2YG6A 2X8GA 2XLTA 5J7XA 5FS9A 2XFNA 1TDEA 2V6OA 4ADWA 2B9XA 2AQJA 2BS3A 3G5QA 2GAGB 2GR1A 1B4VA 3CGCA 3CN8A 1GRBA 2BCPA 2Y6RA 1GREA 3WE0A 1LV0A 4PABA 5KRQA 3NYEA 4K22A 1FCDA 3CNJA 3CTYA 4J31A 1CC4A 2VVLG 2CDUA 1PXCA 5JCNA 1E1LA 2WPEA 4HB9A 4DNAA 2GRTA 5FMHA 3AE5A 3GRTA 1IJHA 3SGLA 2IVEA 5CQFA 5EB4A 1ZMDA 2QCUA 1GALA 2ZBWA 3OZ2A 4B64A 1BKWA 4FX9A 3CNSA 3BI4A 3UTFA 4BURA 4UDPA 2R4JA 1O5WA 2QAEA 3RP6A 3VRDB 1ZY8A 4EMJA 4M52A 2DKIA 3ATRA 2PYXA 1LQUA 3B6DA 3I6DA 4ECHA 2X8CA 3AD7B 4IA6A 1MO9A 1IUSA 2R9ZA 1PJ7A 4H4XA 4K7ZA 2EQ7A 1V59A 1ZMCA 5HHFA 1TYTA 4GUVA 1K4QA 2WESA 1GRGA 1XHCA 4CNKA 4BV6A 2XVJA 2WBAA 4K5RA 1IUUA 3GYIA 1OJDA 3UKAA 4U8MA 4YTMA 4BK2A 1PBEA 3CPHG 2V60A 1SEZA 1MXTA 2R0CA 3Q9TA 4AOSA 3D1CA 2GF3A 3IC9A 1L0VA 1RP0A 2BK4A 2DKHA 4OPLA 1E1KA 2GQWA 3V3NA 1BWCA 4DSGA 1GV4A 2YR5A 4EMWA 2FJAA 1COYA 1E6EA 4B68A 5KVIA 1YQ4A 3DK9A 2BCGG 1FL2A 4AOXA 2YWLA 4N9XA 3UP5A 4YTNA 5DBJA 1F8WA 1DODA 2YG5A 2JB3A 4NZHA 4CNJA 1GRHA 3ICRA 3IF9A 4APNA 2YR4A 3ISHA 1PBCA 2C3CA 4IVOB 1TDNA 2YG7A 2BC0A 2FJBA 4CY6A 3ALJA 4JNAA 2TMDA 1NEKA 4TM4A 4BK3A 3AE3A 1BF3A 1N4UA 3DH9A 1DNCA 4U8PA 4H2RA 4AT2A 4B67A 4CRTA 4UDRA 1YQ3A 3R9UA 3ALLA 3SFEA 1GERA 5HY5A 1OJCA 1E1MA 4Y4NA 3E1TA 4E0VA 1S3BA 3PS9A 4Z2TA 3CPIG 2GH5A 3GWDA 5C3JA 2HQMA 3CGDA 4USRA 3P4PA 1NAAA 3DGZA 5EBKA 1XANA 3URHA 4B65A 4U8JA 1S2QA 1H83A 3C96A 3NN0X 3AE9A 3O0HA 2WQYA 1JU2A 2XLRA 2XVFA 4REKA 3NLCA 1LJ1A 1NG4A 4TM3A 2OAMA 3L8KA 2EQ8A 2YAUA 5J60A 2C70A 2GEWA 3GSIA 3CGEA 1E39A 3NHOX 2XFUA 2E4GA 2XVEA 1B37A 2BACA 4IVMB 1PXBA 4FK1C 1M64A 3QVRA 2C76A 3UOXA 5BULA 2QA2A 4WX1A 1GTEA 2ARDA 2ZZ0A 3CNTA 3NIXA 1Q1RA 3LXDA 3CIRA 1E1NA 4EQXA 2JB1A 2WU5A 3NYFA 4I59A 3VRAA 2YVFA 1CHUA 2E5VA 2GR0A 3M12A 3EPTA 4NTEA 4TLZA 3UKHA 2V3AA 3UKQA 4YWOA 1F8SA 2CFYA 4A5LA 4J2WA 3NK2X 2WDQA 3GYJA 4GRTA 2CULA 2ZZBA 3CGBA 1GRFA 3GMBA 2XCGA 3P1WA 4GR1A 1NPXA 3KPFA 1UKVG 3QFBA 3IHMA 3GD3A 4A9WA 1IUVA 4A6NB 5U1OA 1PJ6A 4Z43A 2XYOA 3DGHA 3LZWA 3S5WA 3AECA 4JY3A 4H4SA 3KLJA 1H81A 4X9NA 1BZLA 1OJ9A 4NTCA 3RP8A 2C65A 5JCMA 4NTDA 5KWFA 2WPFA 2FJDA 2YLZA 3IWAA 3K7MX 3UKLA 3BNMA 2QA1A 1LTXR 5BRTA 2EQ6A 1DJQA 2GQFA 4PAAA 1O95A 4ICYA 4B1BA 3ABVA 3REDA 1IUXA 3RP7A 2B7SA 3UKFA 4EMIA 1D4EA 1PN0A 1EBDA 3P9UA 3BNUA 5KVHA 1H7XA 1NHRA 1DOBA 1YKJA 2C66A 3DJGX 3NRNA 4X4JA 4H4WA 4DSHA 4IA5A 2YLWA 3S61A 4TM1A 4A65A 5GSNA 5IPYA 2A89A 1F6MA 1PDHA 2C64A 2WETA 3AE7A 3AE4A 1HYUA 3KD9A 1FEBA 4O5UA 4U8KA 3UOZA 1W4XA 2BC1A 2X3NA 2C73A 3I3LA 4CCRA 1KF6A 3UP4A 3UOVA 4H4YA 3ATQA 3RNMA 1K0JA 1Q1WA 1PJ5A 3GMCA 2I0ZA 2VVMA 2VZ2A 3UTHA 3V3OA 3VR9A 2C72A 3GRSA 3DJEA 1VDCA 2C67A 1CC6A 1S2YA 4H50A 1NDAA 2Y6QA 2AR8A 4YT0A 1N4VA 3K7QX 3NG7X 1EL9A 4C3XA 1FOHA 1PBDA 1B5QA 1JOAA 2BK5A 4MJWA 2B7RA 3AE2A 1CL0A 2V61A 3P4SA 3V76A 4J57A 2BABA 4LIIA 3D8XA 3H8IA 1VRQB 3QSEA 5BUKA 2BYBA 3DA1A 2YM1A 4AT0A 4H2PA 2OLNA 1GSNA 1H6VA 1KNRA 4OPGA 2WP6A 3SM8A 2GR2A 4J36A 2XLPA 2X50A 2WS3A 3AE8A 4EM4A 2YLXA 1KSUA 1EL5A 4YKFA 1H84A 1N4WA 2WPCA 5EOWA 5FS8A 1PBBA 3AYIA 3GDPA 4U8NA 1GNDA 2Q0LA 1E7PA 1H86A 4JY2A 2V5ZA 3VR8A 3G5RA
chains in the Genus database with same CATH superfamily
4C74A 3NKSA 4U2LA 3RHAA 3AD8B 3DMEA 1MOKA 2ACZA 3II4A 1LQTA 1ELIA 5JCLA 1PXAA 2FJEA 1X31B 3QSMA 1GRTA 3COXA 4I58A 4YSHA 1Z6LA 3FPZA 3UTEA 1Q9IA 4K8DA 4C3YA 1EL7A 1ZOVA 1JNZA 4D03A 2XLSA 2WP9A 4O5QA 4P9SA 4UDQA 3AYLA 1D7YA 2X8HA 2GMJA 3CMMA 4G9KA 3UKKA 1VG0A 4A99A 3ALMA 2GVCA 3KU9A 2OALA 2Z5YA 4RG4A 2RGJA 2YM2A 3CPJG 4OPUA 3F8PA 1CJ3A 4XWZA 1IUWA 3UOYA 2RGHA 1JRZA 2Z5XA 4JDRA 2NPXA 1CF3A 1P2EA 3P4RA 4LU6A 3NYCA 3M0OA 1AN9A 2C75A 3BI5A 1NHSA 3DK8A 4OPTA 3PVCA 4BK1A 1FEAA 1Y56B 2GAHB 5FS7A 3AE1A 2VOUA 4H2NA 2RABA 1H7WA 4B63A 1BGJA 4WCTA 4AP3A 3GDNA 1ONFA 3NN6X 3IHGA 5TR3A 2JB2A 1DOEA 1GESA 1O94A 1DJNA 2BK3A 2NVKX 2YG4A 4JQ9A 5LV9A 4OPDA 3SFDA 1CC2A 1YY5A 2BA9A 2YLTA 5U63A 2GB0A 3UCLA 1XPQA 3KKJA 3NTDA 1CBOA 3ZDNA 2C4CA 1D7LA 4H4QA 4LA1A 3UKPA 2J3NA 3AXBA 3LADA 1ZOYA 4YSZA 4ZCDA 4A6NA 5C2TA 2IVDA 3AD9B 4FDCB 3T37A 1LVLA 3ZNPA 3DJDA 1IUTA 1TDFA 2H89A 5M0ZA 4EIQA 4XXGA 1PBFA 1GPEA 1ZKQA 4II2A 1OJAA 3H4KA 4KPRA 4H4RA 1LPFA 4Y4LA 1GEUA 2B76A 3GYXA 5KMSA 1DAOA 4CCQA 2UZZA 2DU8A 1GXFA 2R0GA 2WEUA 1DOCA 4U8IA 1TYPA 4B69A 4H4VA 4Z26A 5JCKA 1M6IA 4GAPA 3NK1X 4OPIA 4Z25A 4K2XA 4A7AA 4EQRA 4JNQA 1C0PA 1CJ4A 4ZN0A 3NTAA 4J34A 5JCIA 2XFOA 1P2HA 3ICSA 3CNDA 4EQSA 2GMHA 5U25A 3BHKA 3G5SA 3H8LA 4ZCCA 1D4DA 5KOXA 3KVEA 1QO8A 4H4ZA 4UP3A 4QFDA 4EIPA 3B3RA 4U2TA 3AEGA 4KX6A 3AWIA 1JRXA 2X99A 3AEBA 3QVPA 4OCGA 1GTHA 3FBSA 3SZCA 5BVAA 3ITJA 2JAEA 2IIDA 2VRMA 2YG3A 4IV9A 2WDVA 4J56A 2XVHA 2B9WA 2BXSA 4XWRA 4AP1A 4YKGA 2YR6A 3UTGA 1ZK7A 4H4UA 4H4TA 2W0HA 4G6HA 1AOGA 3AEAA 1RYIA 2PHHA 2BXRA 4Z2UA 2JBVA 5M10A 2ZZCA 2Q6UA 1Y0PA 3ADAB 1DXLA 1FECA 1GT8A 1KNPA 3DK4A 4YXDA 2WU2A 4QFCA 3NH3X 3M13A 2XFQA 4TM0A 2YVGA 2A87A 4GF7A 2O9ZA 3Q6JA 4D04A 2FBWA 2VQBA 3T2KA 3JSKA 3VQRA 1OJTA 3AE6A 4TLXA 2YVJA 2YQUA 3C4NA 3PO7A 2WDRA 4H2QA 3C4AA 1L9CA 4CBQA 2WOVA 1L9EA 4H4PA 5ER0A 2Q0KA 3EANA 4HA6A 3SX6A 4BJZA 4OVIA 2GV8A 3T2YA 3ICTA 1GOSA 2WOIA 4B66A 2AAQA 3F8DA 3AEFA 3AB1A 1K0IA 2E48A 3EF6A 1JEHA 1QLBA 3QJ4A 5KOWA 4A79A 5CKUA 1CJCA 1ZX9A 4YSXA 1GRAA 3QFAA 4GDPA 2V3BA 3HZLA 3K30A 4YSYA 1NHPA 5FS6A 4U8OA 2B9YA 3NK0X 3NNEA 1KSSA 2E82A 3AEDA 1BGNA 4G6GA 2H88A 4JN9A 1B8SA 2OA1A 3L1RA 3F8RA 2R0PA 1C0KA 3FMWA 3SZFA 4RG3A 2R4EA 1D4CA 4X9MA 4J33A 2XFPA 4GCMA 5HXIA 2TPRA 1JRYA 2C3DA 2E1MA 2VVLA 5IQ1A 3K7TA 1NHQA 2A8XA 1RSGA 2RGOA 4K5SA 4C77A 4Z2RA 1F8RA 1QJDA 3BI2A 5HYMA 3AYJA 2WP5A 2WHDA 2R46A 4GDEA 3T2ZA 2R45A 4BJYA 2BS2A 1XDIA 3CNPA 4EQWA 1Y56A 3LOVA 1N1PA 1VQWA 3BHFA 1D5TA 4NEVA 3FG2P 5L46A 1TRBA 2JK6A 5IQ4A 1PHHA 1PS9A 2EQ9A 4FK1A 3LZXA 1TDOA 3GD4A 1CJ2A 3KA7A 2BRYA 2JKCA 4OPCA 3ZYXA 2GR3A 4G73A 1KFYA 4YTPA 1S3EA 3GWFA 3LJPA 2WOWA 3NT6A 3P4QA 1F3PA 5EB5A 3OC4A 4H7UA 2Q7VA 1ZDLA 2YLSA 2CVJA 3LB8A 5GRTA 4Z24A 3QSSA 2VQ7A 4Z44A 4EM3A 1L9DA 1YQZA 2C7GA 2BRAA 2F5ZA 3EAOA 4RSLA 2XLUA 2BS4A 4U8LA 1TDKA 1VG9A 1ZP0A 3G3EA 3FIMB 1NENA 1KDGA 2APGA 2XDOA 2YLRA 3SQPA 5KXJA 1JNRA 3DJJA 4DGKA 3NGCX 1REOA 1H82A 4U2SA 3VRBA 1EL8A 1NG3A 4Y4MA 3AEEA 4C5OA 2VRLA 1K0LA 4CY8A 2OLOA 1GETA 4USQA 2XVIA 4NEWA 2YG6A 2X8GA 2XLTA 5J7XA 3ZNQA 5FS9A 2XFNA 1TDEA 2V6OA 4ADWA 2B9XA 2AQJA 2BS3A 3G5QA 2GAGB 2GR1A 3CUKA 1B4VA 3CGCA 3CN8A 1GRBA 2BCPA 2Y6RA 1GREA 3WE0A 4PABA 1LV0A 5KRQA 3NYEA 4K22A 1FCDA 3W4IA 3CNJA 3CTYA 3SXIA 4J31A 1CC4A 2VVLG 2CDUA 1PXCA 5JCNA 1E1LA 2WPEA 4HB9A 4DNAA 2GRTA 4YJGA 5FMHA 3AE5A 4YJGB 3GRTA 3SGLA 1IJHA 3T31A 2IVEA 5CQFA 5EB4A 1ZMDA 2QCUA 1GALA 2ZBWA 3OZ2A 4B64A 1BKWA 4FX9A 3CNSA 4YJFA 4YJDA 3BI4A 3UTFA 4YJFB 4BURA 4UDPA 2R4JA 1O5WA 3RP6A 2QAEA 3ZNNA 3VRDB 2E49A 1ZY8A 4EMJA 4M52A 2DKIA 3ATRA 3HYWA 2PYXA 1LQUA 3B6DA 3I6DA 4ECHA 3AD7B 4IA6A 2X8CA 1MO9A 1IUSA 2R9ZA 1PJ7A 4H4XA 4K7ZA 1V59A 1ZMCA 2EQ7A 5HHFA 1TYTA 4GUVA 1K4QA 2WESA 1GRGA 1XHCA 4CNKA 4BV6A 2XVJA 2WBAA 4K5RA 1IUUA 3GYIA 1OJDA 4BK2A 4U8MA 4YTMA 3UKAA 1PBEA 3CPHG 3ZNOA 2V60A 1SEZA 1MXTA 2R0CA 3Q9TA 3T14A 3D1CA 2GF3A 3IC9A 1L0VA 4AOSA 1RP0A 2BK4A 3HYXA 2DKHA 4OPLA 1E1KA 2GQWA 3V3NA 1BWCA 4DSGA 1GV4A 2YR5A 4EMWA 2FJAA 1COYA 1E6EA 4B68A 2E4AA 5KVIA 1YQ4A 3DK9A 2BCGG 1FL2A 4AOXA 2YWLA 4N9XA 3UP5A 4YTNA 5DBJA 1F8WA 1DODA 2YG5A 2JB3A 4NZHA 4CNJA 1GRHA 3ICRA 3IF9A 4APNA 3SZ0A 2YR4A 3ISHA 1PBCA 2C3CA 4IVOB 1TDNA 2YG7A 2BC0A 4YJHB 2FJBA 4CY6A 3ALJA 4JNAA 2TMDA 1NEKA 4TM4A 4BK3A 3AE3A 4NNJA 1BF3A 1N4UA 3DH9A 1DNCA 4U8PA 4H2RA 4AT2A 4B67A 4CRTA 4UDRA 1YQ3A 3R9UA 3ALLA 3SFEA 1GERA 5HY5A 1OJCA 1E1MA 4Y4NA 3E1TA 4E0VA 1S3BA 3PS9A 4Z2TA 3CPIG 2GH5A 3GWDA 5C3JA 2HQMA 3CGDA 4USRA 3P4PA 1NAAA 3DGZA 5EBKA 1XANA 3URHA 4B65A 4U8JA 1S2QA 1H83A 3C96A 3NN0X 3AE9A 3O0HA 2WQYA 1JU2A 2XLRA 2XVFA 4REKA 3NLCA 1LJ1A 3HYVA 1NG4A 4TM3A 2OAMA 3L8KA 2EQ8A 2YAUA 5J60A 2C70A 3GSIA 2GEWA 3CGEA 3WGTA 1E39A 3NHOX 2XFUA 2E4GA 2XVEA 1B37A 2BACA 4IVMB 1PXBA 4FK1C 1M64A 3QVRA 2C76A 3UOXA 5BULA 2QA2A 4WX1A 1GTEA 2ARDA 2ZZ0A 3CNTA 3NIXA 1Q1RA 3LXDA 3CIRA 1E1NA 4EQXA 2JB1A 3NYFA 2WU5A 4I59A 3VRAA 2YVFA 1CHUA 2E5VA 3M12A 2GR0A 3EPTA 4NTEA 4TLZA 3UKHA 2V3AA 3UKQA 4YWOA 1F8SA 2CFYA 4A5LA 4J2WA 3NK2X 2WDQA 3GYJA 3W4JA 4GRTA 2CULA 1EVIA 2ZZBA 3CGBA 1GRFA 3GMBA 2XCGA 3P1WA 4GR1A 1NPXA 3KPFA 1UKVG 3QFBA 3IHMA 3GD3A 4A9WA 1IUVA 4A6NB 5U1OA 1PJ6A 4Z43A 2XYOA 3DGHA 3LZWA 5KMQA 3S5WA 3AECA 4JY3A 4H4SA 3KLJA 1H81A 4X9NA 1OJ9A 1BZLA 4NTCA 3RP8A 2C65A 5JCMA 4NTDA 5KWFA 1C0LA 2WPFA 2FJDA 2YLZA 3IWAA 5KMRA 3K7MX 3UKLA 3BNMA 2QA1A 1LTXR 5BRTA 2EQ6A 4PAAA 1DJQA 2GQFA 1O95A 4ICYA 4B1BA 3ABVA 3REDA 3SZWA 1IUXA 3RP7A 2B7SA 1KIFA 3UKFA 1D4EA 4EMIA 1PN0A 1EBDA 3P9UA 3BNUA 5KVHA 1H7XA 1YKJA 1DOBA 1NHRA 2C66A 3DJGX 3NRNA 4X4JA 4H4WA 4DSHA 4IA5A 2YLWA 3S61A 4TM1A 4A65A 4G74A 5GSNA 5IPYA 3SYIA 2A89A 1PDHA 1F6MA 2C64A 2WETA 3AE7A 3AE4A 1HYUA 3KD9A 1FEBA 4O5UA 4U8KA 3UOZA 1W4XA 2BC1A 2X3NA 2C73A 3I3LA 3KPKA 4CCRA 1KF6A 3UP4A 3UOVA 4H4YA 3ATQA 4NWZA 1K0JA 3RNMA 1Q1WA 1PJ5A 3GMCA 1DDOA 2I0ZA 2VVMA 2VZ2A 3UTHA 3V3OA 3VR9A 2C72A 3GRSA 3DJEA 1VDCA 3W4KA 2C67A 1CC6A 1S2YA 4H50A 5KNLA 1NDAA 2Y6QA 3T0KA 2AR8A 4YT0A 1N4VA 3K7QX 3NG7X 1EL9A 4C3XA 1FOHA 1PBDA 1B5QA 3SY4A 1JOAA 2BK5A 4MJWA 5KMPA 2B7RA 3AE2A 1CL0A 2V61A 3P4SA 3V76A 4J57A 2BABA 4LIIA 3D8XA 3H8IA 1VRQB 3QSEA 5BUKA 2BYBA 1C0IA 3DA1A 2YM1A 4GAVA 4AT0A 4H2PA 2OLNA 1GSNA 1H6VA 1KNRA 4OPGA 2WP6A 3SM8A 2GR2A 4J36A 2XLPA 2X50A 2WS3A 3AE8A 4EM4A 2YLXA 1KSUA 1EL5A 4YKFA 4YJHA 1H84A 1N4WA 2WPCA 5EOWA 5FS8A 1PBBA 3AYIA 3GDPA 1VE9A 4II3A 4U8NA 1GNDA 2Q0LA 1E7PA 1H86A 4JY2A 2V5ZA 3VR8A 3G5RA
chains in the Genus database with same CATH topology
4C74A 3NKSA 4U2LA 3RHAA 3AD8B 1MOKA 3DMEA 2ACZA 3II4A 1LQTA 1ELIA 5JCLA 1PXAA 2FJEA 1X31B 1GRTA 3QSMA 3COXA 4I58A 4YSHA 1Z6LA 3FPZA 3UTEA 1Q9IA 4K8DA 4C3YA 1EL7A 1ZOVA 1JNZA 4D03A 2XLSA 2WP9A 4O5QA 4P9SA 4UDQA 3AYLA 1D7YA 2X8HA 2GMJA 3CMMA 4G9KA 3UKKA 1VG0A 4A99A 3ALMA 2GVCA 3KU9A 2OALA 2Z5YA 4RG4A 2RGJA 2YM2A 3CPJG 4OPUA 3F8PA 1CJ3A 4XWZA 1IUWA 3UOYA 2RGHA 1JRZA 2Z5XA 4JDRA 2NPXA 1CF3A 1P2EA 3P4RA 4LU6A 3NYCA 2C75A 3DK8A 3BI5A 3M0OA 1NHSA 4OPTA 1FEAA 4BK1A 3PVCA 1Y56B 2GAHB 5FS7A 3AE1A 2VOUA 4H2NA 2RABA 1H7WA 4B63A 1BGJA 4WCTA 4AP3A 3GDNA 1ONFA 3NN6X 3IHGA 5TR3A 2JB2A 1DOEA 1GESA 1O94A 1DJNA 2BK3A 2NVKX 2YG4A 4JQ9A 5LV9A 4OPDA 3SFDA 1CC2A 1YY5A 2BA9A 2YLTA 5U63A 2GB0A 3UCLA 1XPQA 3KKJA 3NTDA 1CBOA 3ZDNA 2C4CA 1D7LA 4H4QA 4LA1A 3UKPA 2J3NA 3AXBA 3LADA 1ZOYA 4YSZA 4ZCDA 4A6NA 5C2TA 2IVDA 3AD9B 4FDCB 3T37A 1LVLA 1TDFA 1IUTA 2H89A 3DJDA 5M0ZA 4EIQA 4XXGA 1GPEA 1PBFA 1ZKQA 4II2A 1OJAA 3H4KA 4KPRA 4H4RA 1LPFA 4Y4LA 1GEUA 2B76A 3GYXA 5KMSA 4CCQA 1GXFA 2UZZA 2R0GA 2WEUA 1DOCA 4U8IA 1TYPA 4B69A 4H4VA 4Z26A 5JCKA 1M6IA 4GAPA 3NK1X 4OPIA 4Z25A 4K2XA 4A7AA 4EQRA 4JNQA 1CJ4A 4ZN0A 3NTAA 4J34A 5JCIA 2XFOA 1P2HA 3ICSA 3CNDA 4EQSA 2GMHA 5U25A 3BHKA 3G5SA 3H8LA 4ZCCA 1D4DA 5KOXA 3KVEA 1QO8A 4H4ZA 4UP3A 3B3RA 4EIPA 4U2TA 3AEGA 4KX6A 1JRXA 2X99A 3AWIA 3AEBA 3QVPA 4OCGA 1GTHA 3FBSA 3SZCA 5BVAA 3ITJA 2JAEA 2IIDA 2VRMA 2YG3A 4IV9A 2WDVA 4J56A 2XVHA 2B9WA 2BXSA 4XWRA 4AP1A 4YKGA 2YR6A 3UTGA 1ZK7A 4H4UA 4H4TA 2W0HA 4G6HA 1AOGA 3AEAA 1RYIA 2PHHA 2BXRA 4Z2UA 2JBVA 5M10A 2ZZCA 1Y0PA 2Q6UA 3ADAB 1DXLA 1FECA 1GT8A 1KNPA 3DK4A 4YXDA 2WU2A 3NH3X 3M13A 2XFQA 4TM0A 2YVGA 2A87A 4GF7A 2O9ZA 3Q6JA 4D04A 2FBWA 2VQBA 3T2KA 3JSKA 3VQRA 1OJTA 3AE6A 4TLXA 2YVJA 2YQUA 3C4NA 3PO7A 2WDRA 4H2QA 3C4AA 1L9CA 4CBQA 2WOVA 1L9EA 4H4PA 5ER0A 2Q0KA 3EANA 4HA6A 3SX6A 4BJZA 4OVIA 2GV8A 3T2YA 3ICTA 1GOSA 2WOIA 4B66A 2AAQA 3F8DA 3AEFA 3AB1A 1K0IA 3EF6A 1JEHA 1QLBA 3QJ4A 5KOWA 4A79A 5CKUA 1CJCA 1ZX9A 4YSXA 1GRAA 3QFAA 4GDPA 2V3BA 3HZLA 3K30A 4YSYA 1NHPA 5FS6A 4U8OA 2B9YA 3NK0X 3NNEA 1KSSA 3AEDA 4G6GA 1BGNA 2H88A 4JN9A 1B8SA 2OA1A 3L1RA 3F8RA 2R0PA 3FMWA 3SZFA 4RG3A 2R4EA 1D4CA 4X9MA 4J33A 2XFPA 4GCMA 5HXIA 2TPRA 1JRYA 2C3DA 2E1MA 2VVLA 5IQ1A 3K7TA 1NHQA 2A8XA 1RSGA 2RGOA 4K5SA 4C77A 4Z2RA 1F8RA 1QJDA 3BI2A 5HYMA 3AYJA 2WP5A 2WHDA 2R46A 4GDEA 3T2ZA 2R45A 4BJYA 2BS2A 1XDIA 3CNPA 4EQWA 1Y56A 3LOVA 1N1PA 1VQWA 1D5TA 3BHFA 4NEVA 3FG2P 5L46A 1TRBA 2JK6A 5IQ4A 1PHHA 1PS9A 2EQ9A 4FK1A 3LZXA 1TDOA 3GD4A 1CJ2A 3KA7A 2BRYA 2JKCA 4OPCA 3ZYXA 2GR3A 4G73A 1KFYA 4YTPA 1S3EA 3GWFA 3LJPA 2WOWA 3NT6A 3P4QA 1F3PA 5EB5A 3OC4A 4H7UA 2Q7VA 1ZDLA 2YLSA 2CVJA 3LB8A 5GRTA 4Z24A 2VQ7A 3QSSA 4Z44A 4EM3A 1L9DA 1YQZA 2C7GA 2BRAA 2F5ZA 3EAOA 4RSLA 2XLUA 2BS4A 4U8LA 1TDKA 1VG9A 1ZP0A 3FIMB 1NENA 1KDGA 2APGA 2XDOA 2YLRA 3SQPA 5KXJA 1JNRA 3DJJA 4DGKA 3NGCX 1REOA 1H82A 4U2SA 3VRBA 1EL8A 1NG3A 4Y4MA 3AEEA 4C5OA 2VRLA 1K0LA 4CY8A 2OLOA 1GETA 4USQA 2XVIA 4NEWA 2YG6A 2X8GA 2XLTA 5J7XA 5FS9A 2XFNA 1TDEA 2V6OA 4ADWA 2B9XA 2AQJA 2BS3A 3G5QA 2GAGB 2GR1A 1B4VA 3CGCA 3CN8A 1GRBA 2BCPA 2Y6RA 1GREA 3WE0A 1LV0A 4PABA 5KRQA 3NYEA 4K22A 1FCDA 3CNJA 3CTYA 3SXIA 4J31A 1CC4A 2VVLG 2CDUA 1PXCA 5JCNA 1E1LA 2WPEA 4HB9A 4DNAA 2GRTA 5FMHA 3AE5A 3GRTA 1IJHA 3SGLA 3T31A 2IVEA 5CQFA 5EB4A 1ZMDA 2QCUA 1GALA 2ZBWA 3OZ2A 4B64A 1BKWA 4FX9A 3CNSA 3BI4A 3UTFA 4BURA 4UDPA 2R4JA 1O5WA 3RP6A 2QAEA 3VRDB 1ZY8A 4EMJA 4M52A 2DKIA 3ATRA 3HYWA 2PYXA 1LQUA 3B6DA 3I6DA 4ECHA 4IA6A 2X8CA 3AD7B 1MO9A 1IUSA 2R9ZA 1PJ7A 4H4XA 4K7ZA 1V59A 1ZMCA 2EQ7A 5HHFA 1TYTA 4GUVA 1K4QA 2WESA 1GRGA 1XHCA 4CNKA 4BV6A 2XVJA 2WBAA 4K5RA 1IUUA 3GYIA 1OJDA 4BK2A 4U8MA 4YTMA 3UKAA 1PBEA 3CPHG 2V60A 1SEZA 1MXTA 2R0CA 3Q9TA 3T14A 3D1CA 2GF3A 3IC9A 1L0VA 4AOSA 1RP0A 2BK4A 3HYXA 2DKHA 4OPLA 1E1KA 2GQWA 3V3NA 1BWCA 4DSGA 1GV4A 2YR5A 4EMWA 2FJAA 1COYA 1E6EA 4B68A 5KVIA 1YQ4A 3DK9A 2BCGG 1FL2A 4AOXA 2YWLA 4N9XA 3UP5A 4YTNA 5DBJA 1F8WA 1DODA 2YG5A 2JB3A 4NZHA 4CNJA 1GRHA 3ICRA 3IF9A 4APNA 3SZ0A 2YR4A 3ISHA 1PBCA 2C3CA 4IVOB 1TDNA 2YG7A 2BC0A 2FJBA 4CY6A 3ALJA 4JNAA 2TMDA 1NEKA 4TM4A 4BK3A 3AE3A 4NNJA 1BF3A 1N4UA 3DH9A 1DNCA 4U8PA 4H2RA 4AT2A 4B67A 4CRTA 4UDRA 1YQ3A 3R9UA 3ALLA 3SFEA 1GERA 5HY5A 1OJCA 1E1MA 4Y4NA 3E1TA 4E0VA 1S3BA 3PS9A 4Z2TA 3CPIG 2GH5A 3GWDA 5C3JA 2HQMA 3CGDA 4USRA 3P4PA 1NAAA 3DGZA 5EBKA 1XANA 3URHA 4B65A 4U8JA 1S2QA 1H83A 3C96A 3NN0X 3AE9A 3O0HA 2WQYA 1JU2A 2XLRA 2XVFA 4REKA 3NLCA 1LJ1A 3HYVA 1NG4A 4TM3A 2OAMA 3L8KA 2EQ8A 2YAUA 5J60A 2C70A 2GEWA 3GSIA 3CGEA 1E39A 3NHOX 2XFUA 2E4GA 2XVEA 1B37A 2BACA 4IVMB 1PXBA 4FK1C 1M64A 3QVRA 2C76A 3UOXA 5BULA 2QA2A 4WX1A 1GTEA 2ARDA 2ZZ0A 3CNTA 3NIXA 1Q1RA 3LXDA 3CIRA 1E1NA 4EQXA 2JB1A 2WU5A 3NYFA 4I59A 3VRAA 2YVFA 1CHUA 2E5VA 2GR0A 3M12A 3EPTA 4NTEA 4TLZA 3UKHA 2V3AA 3UKQA 4YWOA 1F8SA 2CFYA 4A5LA 4J2WA 3NK2X 2WDQA 3GYJA 4GRTA 2CULA 2ZZBA 3CGBA 1GRFA 3GMBA 2XCGA 3P1WA 4GR1A 1NPXA 3KPFA 1UKVG 3QFBA 3IHMA 3GD3A 4A9WA 1IUVA 4A6NB 5U1OA 1PJ6A 4Z43A 2XYOA 3DGHA 3LZWA 5KMQA 3S5WA 3AECA 4JY3A 4H4SA 3KLJA 1H81A 4X9NA 1BZLA 1OJ9A 4NTCA 3RP8A 2C65A 5JCMA 4NTDA 5KWFA 2WPFA 2FJDA 2YLZA 3IWAA 5KMRA 3K7MX 3UKLA 3BNMA 2QA1A 1LTXR 5BRTA 2EQ6A 1DJQA 2GQFA 4PAAA 1O95A 4ICYA 4B1BA 3ABVA 3REDA 3SZWA 3RP7A 1IUXA 2B7SA 3UKFA 4EMIA 1D4EA 1PN0A 1EBDA 3P9UA 3BNUA 5KVHA 1H7XA 1NHRA 1DOBA 1YKJA 2C66A 3DJGX 3NRNA 4X4JA 4H4WA 4DSHA 4IA5A 2YLWA 3S61A 4TM1A 4A65A 4G74A 5GSNA 5IPYA 3SYIA 2A89A 1F6MA 1PDHA 2C64A 2WETA 3AE7A 3AE4A 1HYUA 3KD9A 1FEBA 4O5UA 4U8KA 3UOZA 1W4XA 2BC1A 2X3NA 2C73A 3I3LA 3KPKA 4CCRA 1KF6A 3UP4A 3UOVA 4H4YA 3ATQA 4NWZA 1K0JA 3RNMA 1Q1WA 1PJ5A 3GMCA 2I0ZA 2VVMA 2VZ2A 3UTHA 3V3OA 3VR9A 2C72A 3GRSA 3DJEA 1VDCA 2C67A 1CC6A 1S2YA 4H50A 5KNLA 1NDAA 2Y6QA 3T0KA 2AR8A 4YT0A 1N4VA 3K7QX 3NG7X 1EL9A 4C3XA 1FOHA 1PBDA 1B5QA 3SY4A 2BK5A 1JOAA 4MJWA 5KMPA 2B7RA 3AE2A 1CL0A 2V61A 3P4SA 3V76A 4J57A 2BABA 4LIIA 3D8XA 3H8IA 1VRQB 3QSEA 5BUKA 2BYBA 3DA1A 2YM1A 4GAVA 4AT0A 4H2PA 2OLNA 1GSNA 1H6VA 1KNRA 4OPGA 2WP6A 3SM8A 2GR2A 4J36A 2XLPA 2X50A 2WS3A 3AE8A 4EM4A 2YLXA 1KSUA 1EL5A 4YKFA 1H84A 1N4WA 2WPCA 5EOWA 5FS8A 1PBBA 3AYIA 3GDPA 4II3A 4U8NA 1GNDA 2Q0LA 1E7PA 1H86A 4JY2A 2V5ZA 3VR8A 3G5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C74 A;  3NKS A;  4U2L A;  3RHA A;  3AD8 B;  1MOK A;  3DME A;  2ACZ A;  3II4 A;  1LQT A;  1ELI A;  5JCL A;  1PXA A;  2FJE A;  1X31 B;  1GRT A;  3QSM A;  3COX A;  4I58 A;  4YSH A;  1Z6L A;  3FPZ A;  3UTE A;  1Q9I A;  4K8D A;  4C3Y A;  1EL7 A;  1ZOV A;  1JNZ A;  4D03 A;  2XLS A;  2WP9 A;  4O5Q A;  4P9S A;  4UDQ A;  3AYL A;  1D7Y A;  2X8H A;  2GMJ A;  3UKK A;  1VG0 A;  4A99 A;  3ALM A;  2GVC A;  3KU9 A;  2OAL A;  2Z5Y A;  4RG4 A;  2RGJ A;  2YM2 A;  3CPJ G;  4OPU A;  3F8P A;  1CJ3 A;  4XWZ A;  1IUW A;  3UOY A;  2RGH A;  1JRZ A;  2Z5X A;  4JDR A;  2NPX A;  1CF3 A;  1P2E A;  3P4R A;  4LU6 A;  3NYC A;  2C75 A;  3DK8 A;  3BI5 A;  3M0O A;  1NHS A;  4OPT A;  1FEA A;  3PVC A;  5FS7 A;  1Y56 B;  2GAH B;  4BK1 A;  3AE1 A;  2RAB A;  4H2N A;  2VOU A;  1H7W A;  4B63 A;  1BGJ A;  4WCT A;  4AP3 A;  3GDN A;  1ONF A;  3NN6 X;  3IHG A;  5TR3 A;  2JB2 A;  1DOE A;  1GES A;  1O94 A;  1DJN A;  2BK3 A;  2NVK X;  2YG4 A;  4JQ9 A;  5LV9 A;  4OPD A;  3SFD A;  1CC2 A;  1YY5 A;  2BA9 A;  2YLT A;  5U63 A;  2GB0 A;  3UCL A;  1XPQ A;  3KKJ A;  3NTD A;  1CBO A;  3ZDN A;  1D7L A;  4H4Q A;  4LA1 A;  3UKP A;  2J3N A;  3AXB A;  3LAD A;  1ZOY A;  4YSZ A;  4ZCD A;  4A6N A;  5C2T A;  2IVD A;  3AD9 B;  4FDC B;  3T37 A;  1LVL A;  1TDF A;  1IUT A;  2H89 A;  3DJD A;  5M0Z A;  4EIQ A;  4XXG A;  1GPE A;  1PBF A;  1ZKQ A;  1OJA A;  3H4K A;  4KPR A;  4H4R A;  1LPF A;  4Y4L A;  1GEU A;  2B76 A;  4CCQ A;  1GXF A;  2UZZ A;  2R0G A;  2WEU A;  1DOC A;  4U8I A;  1TYP A;  4B69 A;  4H4V A;  4Z26 A;  5JCK A;  1M6I A;  3NK1 X;  4OPI A;  4Z25 A;  4K2X A;  4A7A A;  4EQR A;  4JNQ A;  1CJ4 A;  4ZN0 A;  3NTA A;  4J34 A;  5JCI A;  2XFO A;  1P2H A;  3ICS A;  3CND A;  4EQS A;  2GMH A;  5U25 A;  3BHK A;  3G5S A;  3H8L A;  4ZCC A;  1D4D A;  5KOX A;  3KVE A;  1QO8 A;  4H4Z A;  4UP3 A;  3B3R A;  4EIP A;  4U2T A;  3AEG A;  4KX6 A;  1JRX A;  2X99 A;  3AWI A;  3AEB A;  3QVP A;  4OCG A;  1GTH A;  3FBS A;  5BVA A;  3ITJ A;  2JAE A;  2IID A;  2VRM A;  2YG3 A;  4IV9 A;  2WDV A;  4J56 A;  2XVH A;  2B9W A;  2BXS A;  4XWR A;  4AP1 A;  4YKG A;  2YR6 A;  3UTG A;  1ZK7 A;  4H4U A;  4H4T A;  2W0H A;  1AOG A;  3AEA A;  1RYI A;  2PHH A;  2BXR A;  4Z2U A;  2JBV A;  5M10 A;  2ZZC A;  1Y0P A;  2Q6U A;  3ADA B;  1DXL A;  1FEC A;  1GT8 A;  1KNP A;  3DK4 A;  4YXD A;  2WU2 A;  3NH3 X;  3M13 A;  2XFQ A;  4TM0 A;  2YVG A;  2A87 A;  4GF7 A;  2O9Z A;  3Q6J A;  4D04 A;  2FBW A;  2VQB A;  3JSK A;  3VQR A;  1OJT A;  3AE6 A;  4TLX A;  2YVJ A;  2YQU A;  3C4N A;  3PO7 A;  2WDR A;  4H2Q A;  3C4A A;  1L9C A;  4CBQ A;  2WOV A;  1L9E A;  4H4P A;  5ER0 A;  2Q0K A;  3EAN A;  4HA6 A;  4BJZ A;  4OVI A;  2GV8 A;  3ICT A;  1GOS A;  2WOI A;  4B66 A;  2AAQ A;  3F8D A;  3AEF A;  3AB1 A;  1K0I A;  3EF6 A;  1JEH A;  1QLB A;  3QJ4 A;  5KOW A;  4A79 A;  5CKU A;  1CJC A;  1ZX9 A;  4YSX A;  1GRA A;  3QFA A;  4GDP A;  2V3B A;  3HZL A;  3K30 A;  4YSY A;  1NHP A;  5FS6 A;  4U8O A;  2B9Y A;  3NK0 X;  3NNE A;  1KSS A;  3AED A;  1BGN A;  2H88 A;  4JN9 A;  1B8S A;  2OA1 A;  3L1R A;  3F8R A;  2R0P A;  3FMW A;  4RG3 A;  2R4E A;  1D4C A;  4X9M A;  4J33 A;  2XFP A;  4GCM A;  5HXI A;  2TPR A;  1JRY A;  2C3D A;  2E1M A;  2VVL A;  5IQ1 A;  3K7T A;  1NHQ A;  2A8X A;  1RSG A;  2RGO A;  4K5S A;  4C77 A;  4Z2R A;  1F8R A;  1QJD A;  3BI2 A;  3AYJ A;  5HYM A;  2WP5 A;  2WHD A;  2R46 A;  4GDE A;  2R45 A;  4BJY A;  2BS2 A;  1XDI A;  3CNP A;  4EQW A;  1Y56 A;  3LOV A;  1N1P A;  1VQW A;  1D5T A;  3BHF A;  4NEV A;  3FG2 P;  5L46 A;  1TRB A;  2JK6 A;  5IQ4 A;  1PHH A;  1PS9 A;  2EQ9 A;  4FK1 A;  3LZX A;  1TDO A;  3GD4 A;  1CJ2 A;  3KA7 A;  3ZYX A;  2JKC A;  4OPC A;  2GR3 A;  1KFY A;  4YTP A;  1S3E A;  3GWF A;  3LJP A;  2WOW A;  3NT6 A;  3P4Q A;  1F3P A;  5EB5 A;  3OC4 A;  4H7U A;  2Q7V A;  1ZDL A;  2YLS A;  2CVJ A;  3LB8 A;  5GRT A;  4Z24 A;  2VQ7 A;  3QSS A;  4Z44 A;  4EM3 A;  1L9D A;  1YQZ A;  2C7G A;  2F5Z A;  3EAO A;  4RSL A;  2XLU A;  2BS4 A;  4U8L A;  1TDK A;  1VG9 A;  1ZP0 A;  3FIM B;  1NEN A;  1KDG A;  2APG A;  2XDO A;  2YLR A;  3SQP A;  5KXJ A;  1JNR A;  3DJJ A;  4DGK A;  3NGC X;  1REO A;  1H82 A;  4U2S A;  3VRB A;  1EL8 A;  1NG3 A;  4Y4M A;  3AEE A;  4C5O A;  2VRL A;  1K0L A;  4CY8 A;  2OLO A;  1GET A;  4USQ A;  2XVI A;  4NEW A;  2YG6 A;  2X8G A;  2XLT A;  5J7X A;  5FS9 A;  2XFN A;  1TDE A;  2V6O A;  4ADW A;  2B9X A;  2AQJ A;  2BS3 A;  3G5Q A;  2GAG B;  2GR1 A;  1B4V A;  3CGC A;  3CN8 A;  1GRB A;  2BCP A;  2Y6R A;  1GRE A;  3WE0 A;  1LV0 A;  4PAB A;  5KRQ A;  3NYE A;  4K22 A;  1FCD A;  3CNJ A;  3CTY A;  4J31 A;  1CC4 A;  2VVL G;  2CDU A;  1PXC A;  5JCN A;  1E1L A;  2WPE A;  4HB9 A;  4DNA A;  2GRT A;  5FMH A;  3AE5 A;  3GRT A;  1IJH A;  3SGL A;  2IVE A;  5CQF A;  5EB4 A;  1ZMD A;  2QCU A;  1GAL A;  2ZBW A;  3OZ2 A;  4B64 A;  1BKW A;  4FX9 A;  3CNS A;  3BI4 A;  3UTF A;  4BUR A;  4UDP A;  2R4J A;  1O5W A;  2QAE A;  3RP6 A;  3VRD B;  1ZY8 A;  4EMJ A;  4M52 A;  2DKI A;  3ATR A;  2PYX A;  1LQU A;  3B6D A;  3I6D A;  4ECH A;  2X8C A;  3AD7 B;  4IA6 A;  1MO9 A;  1IUS A;  2R9Z A;  1PJ7 A;  4H4X A;  4K7Z A;  2EQ7 A;  1V59 A;  1ZMC A;  5HHF A;  1TYT A;  4GUV A;  1K4Q A;  2WES A;  1GRG A;  1XHC A;  4CNK A;  4BV6 A;  2XVJ A;  2WBA A;  4K5R A;  1IUU A;  3GYI A;  1OJD A;  3UKA A;  4U8M A;  4YTM A;  4BK2 A;  1PBE A;  3CPH G;  2V60 A;  1SEZ A;  1MXT A;  2R0C A;  3Q9T A;  4AOS A;  3D1C A;  2GF3 A;  3IC9 A;  1L0V A;  1RP0 A;  2BK4 A;  2DKH A;  4OPL A;  1E1K A;  2GQW A;  3V3N A;  1BWC A;  4DSG A;  1GV4 A;  2YR5 A;  4EMW A;  2FJA A;  1COY A;  1E6E A;  4B68 A;  5KVI A;  1YQ4 A;  3DK9 A;  2BCG G;  1FL2 A;  4AOX A;  2YWL A;  4N9X A;  3UP5 A;  4YTN A;  5DBJ A;  1F8W A;  1DOD A;  2YG5 A;  2JB3 A;  4NZH A;  4CNJ A;  1GRH A;  3ICR A;  3IF9 A;  4APN A;  2YR4 A;  3ISH A;  1PBC A;  2C3C A;  4IVO B;  1TDN A;  2YG7 A;  2BC0 A;  2FJB A;  4CY6 A;  3ALJ A;  4JNA A;  2TMD A;  1NEK A;  4TM4 A;  4BK3 A;  3AE3 A;  1BF3 A;  1N4U A;  3DH9 A;  1DNC A;  4U8P A;  4H2R A;  4AT2 A;  4B67 A;  4CRT A;  4UDR A;  1YQ3 A;  3R9U A;  3ALL A;  3SFE A;  1GER A;  5HY5 A;  1OJC A;  1E1M A;  4Y4N A;  3E1T A;  4E0V A;  1S3B A;  3PS9 A;  4Z2T A;  3CPI G;  2GH5 A;  3GWD A;  5C3J A;  2HQM A;  3CGD A;  4USR A;  3P4P A;  1NAA A;  3DGZ A;  5EBK A;  1XAN A;  3URH A;  4B65 A;  4U8J A;  1S2Q A;  1H83 A;  3C96 A;  3NN0 X;  3AE9 A;  3O0H A;  2WQY A;  1JU2 A;  2XLR A;  2XVF A;  4REK A;  3NLC A;  1LJ1 A;  1NG4 A;  4TM3 A;  2OAM A;  3L8K A;  2EQ8 A;  2YAU A;  5J60 A;  2C70 A;  2GEW A;  3GSI A;  3CGE A;  1E39 A;  3NHO X;  2XFU A;  2E4G A;  2XVE A;  1B37 A;  2BAC A;  4IVM B;  1PXB A;  4FK1 C;  1M64 A;  3QVR A;  2C76 A;  3UOX A;  5BUL A;  2QA2 A;  4WX1 A;  1GTE A;  2ARD A;  2ZZ0 A;  3CNT A;  3NIX A;  1Q1R A;  3LXD A;  3CIR A;  1E1N A;  4EQX A;  2JB1 A;  2WU5 A;  3NYF A;  4I59 A;  3VRA A;  2YVF A;  1CHU A;  2E5V A;  2GR0 A;  3M12 A;  3EPT A;  4NTE A;  4TLZ A;  3UKH A;  2V3A A;  3UKQ A;  4YWO A;  1F8S A;  2CFY A;  4A5L A;  4J2W A;  3NK2 X;  2WDQ A;  3GYJ A;  4GRT A;  2CUL A;  2ZZB A;  3CGB A;  1GRF A;  3GMB A;  2XCG A;  3P1W A;  4GR1 A;  1NPX A;  3KPF A;  1UKV G;  3QFB A;  3IHM A;  3GD3 A;  4A9W A;  1IUV A;  4A6N B;  5U1O A;  1PJ6 A;  4Z43 A;  2XYO A;  3DGH A;  3LZW A;  3S5W A;  3AEC A;  4JY3 A;  4H4S A;  3KLJ A;  1H81 A;  4X9N A;  1BZL A;  1OJ9 A;  4NTC A;  3RP8 A;  2C65 A;  5JCM A;  4NTD A;  5KWF A;  2WPF A;  2FJD A;  2YLZ A;  3IWA A;  3K7M X;  3UKL A;  3BNM A;  2QA1 A;  1LTX R;  5BRT A;  2EQ6 A;  1DJQ A;  2GQF A;  4PAA A;  1O95 A;  4ICY A;  4B1B A;  3ABV A;  3RED A;  1IUX A;  3RP7 A;  2B7S A;  3UKF A;  4EMI A;  1D4E A;  1PN0 A;  1EBD A;  3P9U A;  3BNU A;  5KVH A;  1H7X A;  1NHR A;  1DOB A;  1YKJ A;  2C66 A;  3DJG X;  3NRN A;  4X4J A;  4H4W A;  4DSH A;  4IA5 A;  2YLW A;  3S61 A;  4TM1 A;  4A65 A;  5GSN A;  5IPY A;  2A89 A;  1F6M A;  1PDH A;  2C64 A;  2WET A;  3AE7 A;  3AE4 A;  1HYU A;  3KD9 A;  1FEB A;  4O5U A;  4U8K A;  3UOZ A;  1W4X A;  2BC1 A;  2X3N A;  2C73 A;  3I3L A;  4CCR A;  1KF6 A;  3UP4 A;  3UOV A;  4H4Y A;  3ATQ A;  3RNM A;  1K0J A;  1Q1W A;  1PJ5 A;  3GMC A;  2I0Z A;  2VVM A;  2VZ2 A;  3UTH A;  3V3O A;  3VR9 A;  2C72 A;  3GRS A;  3DJE A;  1VDC A;  2C67 A;  1CC6 A;  1S2Y A;  4H50 A;  1NDA A;  2Y6Q A;  2AR8 A;  4YT0 A;  1N4V A;  3K7Q X;  3NG7 X;  1EL9 A;  4C3X A;  1FOH A;  1PBD A;  1B5Q A;  1JOA A;  2BK5 A;  4MJW A;  2B7R A;  3AE2 A;  1CL0 A;  2V61 A;  3P4S A;  3V76 A;  4J57 A;  2BAB A;  4LII A;  3D8X A;  3H8I A;  1VRQ B;  3QSE A;  5BUK A;  2BYB A;  3DA1 A;  2YM1 A;  4AT0 A;  4H2P A;  2OLN A;  1GSN A;  1H6V A;  1KNR A;  4OPG A;  2WP6 A;  3SM8 A;  2GR2 A;  4J36 A;  2XLP A;  2X50 A;  2WS3 A;  3AE8 A;  4EM4 A;  2YLX A;  1KSU A;  1EL5 A;  4YKF A;  1H84 A;  1N4W A;  2WPC A;  5EOW A;  5FS8 A;  1PBB A;  3AYI A;  3GDP A;  4U8N A;  1GND A;  2Q0L A;  1E7P A;  1H86 A;  4JY2 A;  2V5Z A;  3VR8 A;  3G5R A; 
#chains in the Genus database with same CATH topology
 4C74 A;  3NKS A;  4U2L A;  3RHA A;  3AD8 B;  3DME A;  1MOK A;  2ACZ A;  3II4 A;  1LQT A;  1ELI A;  5JCL A;  1PXA A;  2FJE A;  1X31 B;  3QSM A;  1GRT A;  3COX A;  4I58 A;  4YSH A;  1Z6L A;  3FPZ A;  3UTE A;  1Q9I A;  4K8D A;  4C3Y A;  1EL7 A;  1ZOV A;  1JNZ A;  4D03 A;  2XLS A;  2WP9 A;  4O5Q A;  4P9S A;  4UDQ A;  3AYL A;  1D7Y A;  2X8H A;  2GMJ A;  3CMM A;  4G9K A;  3UKK A;  1VG0 A;  4A99 A;  3ALM A;  2GVC A;  3KU9 A;  2OAL A;  2Z5Y A;  4RG4 A;  2RGJ A;  2YM2 A;  3CPJ G;  4OPU A;  3F8P A;  1CJ3 A;  4XWZ A;  1IUW A;  3UOY A;  2RGH A;  1JRZ A;  2Z5X A;  4JDR A;  2NPX A;  1CF3 A;  1P2E A;  3P4R A;  4LU6 A;  3NYC A;  3M0O A;  1AN9 A;  2C75 A;  3BI5 A;  1NHS A;  3DK8 A;  4OPT A;  3PVC A;  4BK1 A;  1FEA A;  1Y56 B;  2GAH B;  5FS7 A;  3AE1 A;  2VOU A;  4H2N A;  2RAB A;  1H7W A;  4B63 A;  1BGJ A;  4WCT A;  4AP3 A;  3GDN A;  1ONF A;  3NN6 X;  3IHG A;  5TR3 A;  2JB2 A;  1DOE A;  1GES A;  1O94 A;  1DJN A;  2BK3 A;  2NVK X;  2YG4 A;  4JQ9 A;  5LV9 A;  4OPD A;  3SFD A;  1CC2 A;  1YY5 A;  2BA9 A;  2YLT A;  5U63 A;  2GB0 A;  3UCL A;  1XPQ A;  3KKJ A;  3NTD A;  1CBO A;  3ZDN A;  2C4C A;  1D7L A;  4H4Q A;  4LA1 A;  3UKP A;  2J3N A;  3AXB A;  3LAD A;  1ZOY A;  4YSZ A;  4ZCD A;  4A6N A;  5C2T A;  2IVD A;  3AD9 B;  4FDC B;  3T37 A;  1LVL A;  3ZNP A;  3DJD A;  1IUT A;  1TDF A;  2H89 A;  5M0Z A;  4EIQ A;  4XXG A;  1PBF A;  1GPE A;  1ZKQ A;  4II2 A;  1OJA A;  3H4K A;  4KPR A;  4H4R A;  1LPF A;  4Y4L A;  1GEU A;  2B76 A;  3GYX A;  5KMS A;  1DAO A;  4CCQ A;  2UZZ A;  2DU8 A;  1GXF A;  2R0G A;  2WEU A;  1DOC A;  4U8I A;  1TYP A;  4B69 A;  4H4V A;  4Z26 A;  5JCK A;  1M6I A;  4GAP A;  3NK1 X;  4OPI A;  4Z25 A;  4K2X A;  4A7A A;  4EQR A;  4JNQ A;  1C0P A;  1CJ4 A;  4ZN0 A;  3NTA A;  4J34 A;  5JCI A;  2XFO A;  1P2H A;  3ICS A;  3CND A;  4EQS A;  2GMH A;  5U25 A;  3BHK A;  3G5S A;  3H8L A;  4ZCC A;  1D4D A;  5KOX A;  3KVE A;  1QO8 A;  4H4Z A;  4UP3 A;  4QFD A;  4EIP A;  3B3R A;  4U2T A;  3AEG A;  4KX6 A;  3AWI A;  1JRX A;  2X99 A;  3AEB A;  3QVP A;  4OCG A;  1GTH A;  3FBS A;  3SZC A;  5BVA A;  3ITJ A;  2JAE A;  2IID A;  2VRM A;  2YG3 A;  4IV9 A;  2WDV A;  4J56 A;  2XVH A;  2B9W A;  2BXS A;  4XWR A;  4AP1 A;  4YKG A;  2YR6 A;  3UTG A;  1ZK7 A;  4H4U A;  4H4T A;  2W0H A;  4G6H A;  1AOG A;  3AEA A;  1RYI A;  2PHH A;  2BXR A;  4Z2U A;  2JBV A;  5M10 A;  2ZZC A;  2Q6U A;  1Y0P A;  3ADA B;  1DXL A;  1FEC A;  1GT8 A;  1KNP A;  3DK4 A;  4YXD A;  2WU2 A;  4QFC A;  3NH3 X;  3M13 A;  2XFQ A;  4TM0 A;  2YVG A;  2A87 A;  4GF7 A;  2O9Z A;  3Q6J A;  4D04 A;  2FBW A;  2VQB A;  3T2K A;  3JSK A;  3VQR A;  1OJT A;  3AE6 A;  4TLX A;  2YVJ A;  2YQU A;  3C4N A;  3PO7 A;  2WDR A;  4H2Q A;  3C4A A;  1L9C A;  4CBQ A;  2WOV A;  1L9E A;  4H4P A;  5ER0 A;  2Q0K A;  3EAN A;  4HA6 A;  3SX6 A;  4BJZ A;  4OVI A;  2GV8 A;  3T2Y A;  3ICT A;  1GOS A;  2WOI A;  4B66 A;  2AAQ A;  3F8D A;  3AEF A;  3AB1 A;  1K0I A;  2E48 A;  3EF6 A;  1JEH A;  1QLB A;  3QJ4 A;  5KOW A;  4A79 A;  5CKU A;  1CJC A;  1ZX9 A;  4YSX A;  1GRA A;  3QFA A;  4GDP A;  2V3B A;  3HZL A;  3K30 A;  4YSY A;  1NHP A;  5FS6 A;  4U8O A;  2B9Y A;  3NK0 X;  3NNE A;  1KSS A;  2E82 A;  3AED A;  1BGN A;  4G6G A;  2H88 A;  4JN9 A;  1B8S A;  2OA1 A;  3L1R A;  3F8R A;  2R0P A;  1C0K A;  3FMW A;  3SZF A;  4RG3 A;  2R4E A;  1D4C A;  4X9M A;  4J33 A;  2XFP A;  4GCM A;  5HXI A;  2TPR A;  1JRY A;  2C3D A;  2E1M A;  2VVL A;  5IQ1 A;  3K7T A;  1NHQ A;  2A8X A;  1RSG A;  2RGO A;  4K5S A;  4C77 A;  4Z2R A;  1F8R A;  1QJD A;  3BI2 A;  5HYM A;  3AYJ A;  2WP5 A;  2WHD A;  2R46 A;  4GDE A;  3T2Z A;  2R45 A;  4BJY A;  2BS2 A;  1XDI A;  3CNP A;  4EQW A;  1Y56 A;  3LOV A;  1N1P A;  1VQW A;  3BHF A;  1D5T A;  4NEV A;  3FG2 P;  5L46 A;  1TRB A;  2JK6 A;  5IQ4 A;  1PHH A;  1PS9 A;  2EQ9 A;  4FK1 A;  3LZX A;  1TDO A;  3GD4 A;  1CJ2 A;  3KA7 A;  2BRY A;  2JKC A;  4OPC A;  3ZYX A;  2GR3 A;  4G73 A;  1KFY A;  4YTP A;  1S3E A;  3GWF A;  3LJP A;  2WOW A;  3NT6 A;  3P4Q A;  1F3P A;  5EB5 A;  3OC4 A;  4H7U A;  2Q7V A;  1ZDL A;  2YLS A;  2CVJ A;  3LB8 A;  5GRT A;  4Z24 A;  3QSS A;  2VQ7 A;  4Z44 A;  4EM3 A;  1L9D A;  1YQZ A;  2C7G A;  2BRA A;  2F5Z A;  3EAO A;  4RSL A;  2XLU A;  2BS4 A;  4U8L A;  1TDK A;  1VG9 A;  1ZP0 A;  3G3E A;  3FIM B;  1NEN A;  1KDG A;  2APG A;  2XDO A;  2YLR A;  3SQP A;  5KXJ A;  1JNR A;  3DJJ A;  4DGK A;  3NGC X;  1REO A;  1H82 A;  4U2S A;  3VRB A;  1EL8 A;  1NG3 A;  4Y4M A;  3AEE A;  4C5O A;  2VRL A;  1K0L A;  4CY8 A;  2OLO A;  1GET A;  4USQ A;  2XVI A;  4NEW A;  2YG6 A;  2X8G A;  2XLT A;  5J7X A;  3ZNQ A;  5FS9 A;  2XFN A;  1TDE A;  2V6O A;  4ADW A;  2B9X A;  2AQJ A;  2BS3 A;  3G5Q A;  2GAG B;  2GR1 A;  3CUK A;  1B4V A;  3CGC A;  3CN8 A;  1GRB A;  2BCP A;  2Y6R A;  1GRE A;  3WE0 A;  4PAB A;  1LV0 A;  5KRQ A;  3NYE A;  4K22 A;  1FCD A;  3W4I A;  3CNJ A;  3CTY A;  3SXI A;  4J31 A;  1CC4 A;  2VVL G;  2CDU A;  1PXC A;  5JCN A;  1E1L A;  2WPE A;  4HB9 A;  4DNA A;  2GRT A;  4YJG A;  5FMH A;  3AE5 A;  4YJG B;  3GRT A;  3SGL A;  1IJH A;  3T31 A;  2IVE A;  5CQF A;  5EB4 A;  1ZMD A;  2QCU A;  1GAL A;  2ZBW A;  3OZ2 A;  4B64 A;  1BKW A;  4FX9 A;  3CNS A;  4YJF A;  4YJD A;  3BI4 A;  3UTF A;  4YJF B;  4BUR A;  4UDP A;  2R4J A;  1O5W A;  3RP6 A;  2QAE A;  3ZNN A;  3VRD B;  2E49 A;  1ZY8 A;  4EMJ A;  4M52 A;  2DKI A;  3ATR A;  3HYW A;  2PYX A;  1LQU A;  3B6D A;  3I6D A;  4ECH A;  3AD7 B;  4IA6 A;  2X8C A;  1MO9 A;  1IUS A;  2R9Z A;  1PJ7 A;  4H4X A;  4K7Z A;  1V59 A;  1ZMC A;  2EQ7 A;  5HHF A;  1TYT A;  4GUV A;  1K4Q A;  2WES A;  1GRG A;  1XHC A;  4CNK A;  4BV6 A;  2XVJ A;  2WBA A;  4K5R A;  1IUU A;  3GYI A;  1OJD A;  4BK2 A;  4U8M A;  4YTM A;  3UKA A;  1PBE A;  3CPH G;  3ZNO A;  2V60 A;  1SEZ A;  1MXT A;  2R0C A;  3Q9T A;  3T14 A;  3D1C A;  2GF3 A;  3IC9 A;  1L0V A;  4AOS A;  1RP0 A;  2BK4 A;  3HYX A;  2DKH A;  4OPL A;  1E1K A;  2GQW A;  3V3N A;  1BWC A;  4DSG A;  1GV4 A;  2YR5 A;  4EMW A;  2FJA A;  1COY A;  1E6E A;  4B68 A;  2E4A A;  5KVI A;  1YQ4 A;  3DK9 A;  2BCG G;  1FL2 A;  4AOX A;  2YWL A;  4N9X A;  3UP5 A;  4YTN A;  5DBJ A;  1F8W A;  1DOD A;  2YG5 A;  2JB3 A;  4NZH A;  4CNJ A;  1GRH A;  3ICR A;  3IF9 A;  4APN A;  3SZ0 A;  2YR4 A;  3ISH A;  1PBC A;  2C3C A;  4IVO B;  1TDN A;  2YG7 A;  2BC0 A;  4YJH B;  2FJB A;  4CY6 A;  3ALJ A;  4JNA A;  2TMD A;  1NEK A;  4TM4 A;  4BK3 A;  3AE3 A;  4NNJ A;  1BF3 A;  1N4U A;  3DH9 A;  1DNC A;  4U8P A;  4H2R A;  4AT2 A;  4B67 A;  4CRT A;  4UDR A;  1YQ3 A;  3R9U A;  3ALL A;  3SFE A;  1GER A;  5HY5 A;  1OJC A;  1E1M A;  4Y4N A;  3E1T A;  4E0V A;  1S3B A;  3PS9 A;  4Z2T A;  3CPI G;  2GH5 A;  3GWD A;  5C3J A;  2HQM A;  3CGD A;  4USR A;  3P4P A;  1NAA A;  3DGZ A;  5EBK A;  1XAN A;  3URH A;  4B65 A;  4U8J A;  1S2Q A;  1H83 A;  3C96 A;  3NN0 X;  3AE9 A;  3O0H A;  2WQY A;  1JU2 A;  2XLR A;  2XVF A;  4REK A;  3NLC A;  1LJ1 A;  3HYV A;  1NG4 A;  4TM3 A;  2OAM A;  3L8K A;  2EQ8 A;  2YAU A;  5J60 A;  2C70 A;  3GSI A;  2GEW A;  3CGE A;  3WGT A;  1E39 A;  3NHO X;  2XFU A;  2E4G A;  2XVE A;  1B37 A;  2BAC A;  4IVM B;  1PXB A;  4FK1 C;  1M64 A;  3QVR A;  2C76 A;  3UOX A;  5BUL A;  2QA2 A;  4WX1 A;  1GTE A;  2ARD A;  2ZZ0 A;  3CNT A;  3NIX A;  1Q1R A;  3LXD A;  3CIR A;  1E1N A;  4EQX A;  2JB1 A;  3NYF A;  2WU5 A;  4I59 A;  3VRA A;  2YVF A;  1CHU A;  2E5V A;  3M12 A;  2GR0 A;  3EPT A;  4NTE A;  4TLZ A;  3UKH A;  2V3A A;  3UKQ A;  4YWO A;  1F8S A;  2CFY A;  4A5L A;  4J2W A;  3NK2 X;  2WDQ A;  3GYJ A;  3W4J A;  4GRT A;  2CUL A;  1EVI A;  2ZZB A;  3CGB A;  1GRF A;  3GMB A;  2XCG A;  3P1W A;  4GR1 A;  1NPX A;  3KPF A;  1UKV G;  3QFB A;  3IHM A;  3GD3 A;  4A9W A;  1IUV A;  4A6N B;  5U1O A;  1PJ6 A;  4Z43 A;  2XYO A;  3DGH A;  3LZW A;  5KMQ A;  3S5W A;  3AEC A;  4JY3 A;  4H4S A;  3KLJ A;  1H81 A;  4X9N A;  1OJ9 A;  1BZL A;  4NTC A;  3RP8 A;  2C65 A;  5JCM A;  4NTD A;  5KWF A;  1C0L A;  2WPF A;  2FJD A;  2YLZ A;  3IWA A;  5KMR A;  3K7M X;  3UKL A;  3BNM A;  2QA1 A;  1LTX R;  5BRT A;  2EQ6 A;  4PAA A;  1DJQ A;  2GQF A;  1O95 A;  4ICY A;  4B1B A;  3ABV A;  3RED A;  3SZW A;  1IUX A;  3RP7 A;  2B7S A;  1KIF A;  3UKF A;  1D4E A;  4EMI A;  1PN0 A;  1EBD A;  3P9U A;  3BNU A;  5KVH A;  1H7X A;  1YKJ A;  1DOB A;  1NHR A;  2C66 A;  3DJG X;  3NRN A;  4X4J A;  4H4W A;  4DSH A;  4IA5 A;  2YLW A;  3S61 A;  4TM1 A;  4A65 A;  4G74 A;  5GSN A;  5IPY A;  3SYI A;  2A89 A;  1PDH A;  1F6M A;  2C64 A;  2WET A;  3AE7 A;  3AE4 A;  1HYU A;  3KD9 A;  1FEB A;  4O5U A;  4U8K A;  3UOZ A;  1W4X A;  2BC1 A;  2X3N A;  2C73 A;  3I3L A;  3KPK A;  4CCR A;  1KF6 A;  3UP4 A;  3UOV A;  4H4Y A;  3ATQ A;  4NWZ A;  1K0J A;  3RNM A;  1Q1W A;  1PJ5 A;  3GMC A;  1DDO A;  2I0Z A;  2VVM A;  2VZ2 A;  3UTH A;  3V3O A;  3VR9 A;  2C72 A;  3GRS A;  3DJE A;  1VDC A;  3W4K A;  2C67 A;  1CC6 A;  1S2Y A;  4H50 A;  5KNL A;  1NDA A;  2Y6Q A;  3T0K A;  2AR8 A;  4YT0 A;  1N4V A;  3K7Q X;  3NG7 X;  1EL9 A;  4C3X A;  1FOH A;  1PBD A;  1B5Q A;  3SY4 A;  1JOA A;  2BK5 A;  4MJW A;  5KMP A;  2B7R A;  3AE2 A;  1CL0 A;  2V61 A;  3P4S A;  3V76 A;  4J57 A;  2BAB A;  4LII A;  3D8X A;  3H8I A;  1VRQ B;  3QSE A;  5BUK A;  2BYB A;  1C0I A;  3DA1 A;  2YM1 A;  4GAV A;  4AT0 A;  4H2P A;  2OLN A;  1GSN A;  1H6V A;  1KNR A;  4OPG A;  2WP6 A;  3SM8 A;  2GR2 A;  4J36 A;  2XLP A;  2X50 A;  2WS3 A;  3AE8 A;  4EM4 A;  2YLX A;  1KSU A;  1EL5 A;  4YKF A;  4YJH A;  1H84 A;  1N4W A;  2WPC A;  5EOW A;  5FS8 A;  1PBB A;  3AYI A;  3GDP A;  1VE9 A;  4II3 A;  4U8N A;  1GND A;  2Q0L A;  1E7P A;  1H86 A;  4JY2 A;  2V5Z A;  3VR8 A;  3G5R A; 
#chains in the Genus database with same CATH homology
 4C74 A;  3NKS A;  4U2L A;  3RHA A;  3AD8 B;  1MOK A;  3DME A;  2ACZ A;  3II4 A;  1LQT A;  1ELI A;  5JCL A;  1PXA A;  2FJE A;  1X31 B;  1GRT A;  3QSM A;  3COX A;  4I58 A;  4YSH A;  1Z6L A;  3FPZ A;  3UTE A;  1Q9I A;  4K8D A;  4C3Y A;  1EL7 A;  1ZOV A;  1JNZ A;  4D03 A;  2XLS A;  2WP9 A;  4O5Q A;  4P9S A;  4UDQ A;  3AYL A;  1D7Y A;  2X8H A;  2GMJ A;  3CMM A;  4G9K A;  3UKK A;  1VG0 A;  4A99 A;  3ALM A;  2GVC A;  3KU9 A;  2OAL A;  2Z5Y A;  4RG4 A;  2RGJ A;  2YM2 A;  3CPJ G;  4OPU A;  3F8P A;  1CJ3 A;  4XWZ A;  1IUW A;  3UOY A;  2RGH A;  1JRZ A;  2Z5X A;  4JDR A;  2NPX A;  1CF3 A;  1P2E A;  3P4R A;  4LU6 A;  3NYC A;  2C75 A;  3DK8 A;  3BI5 A;  3M0O A;  1NHS A;  4OPT A;  1FEA A;  4BK1 A;  3PVC A;  1Y56 B;  2GAH B;  5FS7 A;  3AE1 A;  2VOU A;  4H2N A;  2RAB A;  1H7W A;  4B63 A;  1BGJ A;  4WCT A;  4AP3 A;  3GDN A;  1ONF A;  3NN6 X;  3IHG A;  5TR3 A;  2JB2 A;  1DOE A;  1GES A;  1O94 A;  1DJN A;  2BK3 A;  2NVK X;  2YG4 A;  4JQ9 A;  5LV9 A;  4OPD A;  3SFD A;  1CC2 A;  1YY5 A;  2BA9 A;  2YLT A;  5U63 A;  2GB0 A;  3UCL A;  1XPQ A;  3KKJ A;  3NTD A;  1CBO A;  3ZDN A;  2C4C A;  1D7L A;  4H4Q A;  4LA1 A;  3UKP A;  2J3N A;  3AXB A;  3LAD A;  1ZOY A;  4YSZ A;  4ZCD A;  4A6N A;  5C2T A;  2IVD A;  3AD9 B;  4FDC B;  3T37 A;  1LVL A;  1TDF A;  1IUT A;  2H89 A;  3DJD A;  5M0Z A;  4EIQ A;  4XXG A;  1GPE A;  1PBF A;  1ZKQ A;  4II2 A;  1OJA A;  3H4K A;  4KPR A;  4H4R A;  1LPF A;  4Y4L A;  1GEU A;  2B76 A;  3GYX A;  5KMS A;  4CCQ A;  1GXF A;  2UZZ A;  2R0G A;  2WEU A;  1DOC A;  4U8I A;  1TYP A;  4B69 A;  4H4V A;  4Z26 A;  5JCK A;  1M6I A;  4GAP A;  3NK1 X;  4OPI A;  4Z25 A;  4K2X A;  4A7A A;  4EQR A;  4JNQ A;  1CJ4 A;  4ZN0 A;  3NTA A;  4J34 A;  5JCI A;  2XFO A;  1P2H A;  3ICS A;  3CND A;  4EQS A;  2GMH A;  5U25 A;  3BHK A;  3G5S A;  3H8L A;  4ZCC A;  1D4D A;  5KOX A;  3KVE A;  1QO8 A;  4H4Z A;  4UP3 A;  3B3R A;  4EIP A;  4U2T A;  3AEG A;  4KX6 A;  1JRX A;  2X99 A;  3AWI A;  3AEB A;  3QVP A;  4OCG A;  1GTH A;  3FBS A;  3SZC A;  5BVA A;  3ITJ A;  2JAE A;  2IID A;  2VRM A;  2YG3 A;  4IV9 A;  2WDV A;  4J56 A;  2XVH A;  2B9W A;  2BXS A;  4XWR A;  4AP1 A;  4YKG A;  2YR6 A;  3UTG A;  1ZK7 A;  4H4U A;  4H4T A;  2W0H A;  4G6H A;  1AOG A;  3AEA A;  1RYI A;  2PHH A;  2BXR A;  4Z2U A;  2JBV A;  5M10 A;  2ZZC A;  1Y0P A;  2Q6U A;  3ADA B;  1DXL A;  1FEC A;  1GT8 A;  1KNP A;  3DK4 A;  4YXD A;  2WU2 A;  3NH3 X;  3M13 A;  2XFQ A;  4TM0 A;  2YVG A;  2A87 A;  4GF7 A;  2O9Z A;  3Q6J A;  4D04 A;  2FBW A;  2VQB A;  3T2K A;  3JSK A;  3VQR A;  1OJT A;  3AE6 A;  4TLX A;  2YVJ A;  2YQU A;  3C4N A;  3PO7 A;  2WDR A;  4H2Q A;  3C4A A;  1L9C A;  4CBQ A;  2WOV A;  1L9E A;  4H4P A;  5ER0 A;  2Q0K A;  3EAN A;  4HA6 A;  3SX6 A;  4BJZ A;  4OVI A;  2GV8 A;  3T2Y A;  3ICT A;  1GOS A;  2WOI A;  4B66 A;  2AAQ A;  3F8D A;  3AEF A;  3AB1 A;  1K0I A;  3EF6 A;  1JEH A;  1QLB A;  3QJ4 A;  5KOW A;  4A79 A;  5CKU A;  1CJC A;  1ZX9 A;  4YSX A;  1GRA A;  3QFA A;  4GDP A;  2V3B A;  3HZL A;  3K30 A;  4YSY A;  1NHP A;  5FS6 A;  4U8O A;  2B9Y A;  3NK0 X;  3NNE A;  1KSS A;  3AED A;  4G6G A;  1BGN A;  2H88 A;  4JN9 A;  1B8S A;  2OA1 A;  3L1R A;  3F8R A;  2R0P A;  3FMW A;  3SZF A;  4RG3 A;  2R4E A;  1D4C A;  4X9M A;  4J33 A;  2XFP A;  4GCM A;  5HXI A;  2TPR A;  1JRY A;  2C3D A;  2E1M A;  2VVL A;  5IQ1 A;  3K7T A;  1NHQ A;  2A8X A;  1RSG A;  2RGO A;  4K5S A;  4C77 A;  4Z2R A;  1F8R A;  1QJD A;  3BI2 A;  5HYM A;  3AYJ A;  2WP5 A;  2WHD A;  2R46 A;  4GDE A;  3T2Z A;  2R45 A;  4BJY A;  2BS2 A;  1XDI A;  3CNP A;  4EQW A;  1Y56 A;  3LOV A;  1N1P A;  1VQW A;  1D5T A;  3BHF A;  4NEV A;  3FG2 P;  5L46 A;  1TRB A;  2JK6 A;  5IQ4 A;  1PHH A;  1PS9 A;  2EQ9 A;  4FK1 A;  3LZX A;  1TDO A;  3GD4 A;  1CJ2 A;  3KA7 A;  2BRY A;  2JKC A;  4OPC A;  3ZYX A;  2GR3 A;  4G73 A;  1KFY A;  4YTP A;  1S3E A;  3GWF A;  3LJP A;  2WOW A;  3NT6 A;  3P4Q A;  1F3P A;  5EB5 A;  3OC4 A;  4H7U A;  2Q7V A;  1ZDL A;  2YLS A;  2CVJ A;  3LB8 A;  5GRT A;  4Z24 A;  2VQ7 A;  3QSS A;  4Z44 A;  4EM3 A;  1L9D A;  1YQZ A;  2C7G A;  2BRA A;  2F5Z A;  3EAO A;  4RSL A;  2XLU A;  2BS4 A;  4U8L A;  1TDK A;  1VG9 A;  1ZP0 A;  3FIM B;  1NEN A;  1KDG A;  2APG A;  2XDO A;  2YLR A;  3SQP A;  5KXJ A;  1JNR A;  3DJJ A;  4DGK A;  3NGC X;  1REO A;  1H82 A;  4U2S A;  3VRB A;  1EL8 A;  1NG3 A;  4Y4M A;  3AEE A;  4C5O A;  2VRL A;  1K0L A;  4CY8 A;  2OLO A;  1GET A;  4USQ A;  2XVI A;  4NEW A;  2YG6 A;  2X8G A;  2XLT A;  5J7X A;  5FS9 A;  2XFN A;  1TDE A;  2V6O A;  4ADW A;  2B9X A;  2AQJ A;  2BS3 A;  3G5Q A;  2GAG B;  2GR1 A;  1B4V A;  3CGC A;  3CN8 A;  1GRB A;  2BCP A;  2Y6R A;  1GRE A;  3WE0 A;  1LV0 A;  4PAB A;  5KRQ A;  3NYE A;  4K22 A;  1FCD A;  3CNJ A;  3CTY A;  3SXI A;  4J31 A;  1CC4 A;  2VVL G;  2CDU A;  1PXC A;  5JCN A;  1E1L A;  2WPE A;  4HB9 A;  4DNA A;  2GRT A;  5FMH A;  3AE5 A;  3GRT A;  1IJH A;  3SGL A;  3T31 A;  2IVE A;  5CQF A;  5EB4 A;  1ZMD A;  2QCU A;  1GAL A;  2ZBW A;  3OZ2 A;  4B64 A;  1BKW A;  4FX9 A;  3CNS A;  3BI4 A;  3UTF A;  4BUR A;  4UDP A;  2R4J A;  1O5W A;  3RP6 A;  2QAE A;  3VRD B;  1ZY8 A;  4EMJ A;  4M52 A;  2DKI A;  3ATR A;  3HYW A;  2PYX A;  1LQU A;  3B6D A;  3I6D A;  4ECH A;  4IA6 A;  2X8C A;  3AD7 B;  1MO9 A;  1IUS A;  2R9Z A;  1PJ7 A;  4H4X A;  4K7Z A;  1V59 A;  1ZMC A;  2EQ7 A;  5HHF A;  1TYT A;  4GUV A;  1K4Q A;  2WES A;  1GRG A;  1XHC A;  4CNK A;  4BV6 A;  2XVJ A;  2WBA A;  4K5R A;  1IUU A;  3GYI A;  1OJD A;  4BK2 A;  4U8M A;  4YTM A;  3UKA A;  1PBE A;  3CPH G;  2V60 A;  1SEZ A;  1MXT A;  2R0C A;  3Q9T A;  3T14 A;  3D1C A;  2GF3 A;  3IC9 A;  1L0V A;  4AOS A;  1RP0 A;  2BK4 A;  3HYX A;  2DKH A;  4OPL A;  1E1K A;  2GQW A;  3V3N A;  1BWC A;  4DSG A;  1GV4 A;  2YR5 A;  4EMW A;  2FJA A;  1COY A;  1E6E A;  4B68 A;  5KVI A;  1YQ4 A;  3DK9 A;  2BCG G;  1FL2 A;  4AOX A;  2YWL A;  4N9X A;  3UP5 A;  4YTN A;  5DBJ A;  1F8W A;  1DOD A;  2YG5 A;  2JB3 A;  4NZH A;  4CNJ A;  1GRH A;  3ICR A;  3IF9 A;  4APN A;  3SZ0 A;  2YR4 A;  3ISH A;  1PBC A;  2C3C A;  4IVO B;  1TDN A;  2YG7 A;  2BC0 A;  2FJB A;  4CY6 A;  3ALJ A;  4JNA A;  2TMD A;  1NEK A;  4TM4 A;  4BK3 A;  3AE3 A;  4NNJ A;  1BF3 A;  1N4U A;  3DH9 A;  1DNC A;  4U8P A;  4H2R A;  4AT2 A;  4B67 A;  4CRT A;  4UDR A;  1YQ3 A;  3R9U A;  3ALL A;  3SFE A;  1GER A;  5HY5 A;  1OJC A;  1E1M A;  4Y4N A;  3E1T A;  4E0V A;  1S3B A;  3PS9 A;  4Z2T A;  3CPI G;  2GH5 A;  3GWD A;  5C3J A;  2HQM A;  3CGD A;  4USR A;  3P4P A;  1NAA A;  3DGZ A;  5EBK A;  1XAN A;  3URH A;  4B65 A;  4U8J A;  1S2Q A;  1H83 A;  3C96 A;  3NN0 X;  3AE9 A;  3O0H A;  2WQY A;  1JU2 A;  2XLR A;  2XVF A;  4REK A;  3NLC A;  1LJ1 A;  3HYV A;  1NG4 A;  4TM3 A;  2OAM A;  3L8K A;  2EQ8 A;  2YAU A;  5J60 A;  2C70 A;  2GEW A;  3GSI A;  3CGE A;  1E39 A;  3NHO X;  2XFU A;  2E4G A;  2XVE A;  1B37 A;  2BAC A;  4IVM B;  1PXB A;  4FK1 C;  1M64 A;  3QVR A;  2C76 A;  3UOX A;  5BUL A;  2QA2 A;  4WX1 A;  1GTE A;  2ARD A;  2ZZ0 A;  3CNT A;  3NIX A;  1Q1R A;  3LXD A;  3CIR A;  1E1N A;  4EQX A;  2JB1 A;  2WU5 A;  3NYF A;  4I59 A;  3VRA A;  2YVF A;  1CHU A;  2E5V A;  2GR0 A;  3M12 A;  3EPT A;  4NTE A;  4TLZ A;  3UKH A;  2V3A A;  3UKQ A;  4YWO A;  1F8S A;  2CFY A;  4A5L A;  4J2W A;  3NK2 X;  2WDQ A;  3GYJ A;  4GRT A;  2CUL A;  2ZZB A;  3CGB A;  1GRF A;  3GMB A;  2XCG A;  3P1W A;  4GR1 A;  1NPX A;  3KPF A;  1UKV G;  3QFB A;  3IHM A;  3GD3 A;  4A9W A;  1IUV A;  4A6N B;  5U1O A;  1PJ6 A;  4Z43 A;  2XYO A;  3DGH A;  3LZW A;  5KMQ A;  3S5W A;  3AEC A;  4JY3 A;  4H4S A;  3KLJ A;  1H81 A;  4X9N A;  1BZL A;  1OJ9 A;  4NTC A;  3RP8 A;  2C65 A;  5JCM A;  4NTD A;  5KWF A;  2WPF A;  2FJD A;  2YLZ A;  3IWA A;  5KMR A;  3K7M X;  3UKL A;  3BNM A;  2QA1 A;  1LTX R;  5BRT A;  2EQ6 A;  1DJQ A;  2GQF A;  4PAA A;  1O95 A;  4ICY A;  4B1B A;  3ABV A;  3RED A;  3SZW A;  3RP7 A;  1IUX A;  2B7S A;  3UKF A;  4EMI A;  1D4E A;  1PN0 A;  1EBD A;  3P9U A;  3BNU A;  5KVH A;  1H7X A;  1NHR A;  1DOB A;  1YKJ A;  2C66 A;  3DJG X;  3NRN A;  4X4J A;  4H4W A;  4DSH A;  4IA5 A;  2YLW A;  3S61 A;  4TM1 A;  4A65 A;  4G74 A;  5GSN A;  5IPY A;  3SYI A;  2A89 A;  1F6M A;  1PDH A;  2C64 A;  2WET A;  3AE7 A;  3AE4 A;  1HYU A;  3KD9 A;  1FEB A;  4O5U A;  4U8K A;  3UOZ A;  1W4X A;  2BC1 A;  2X3N A;  2C73 A;  3I3L A;  3KPK A;  4CCR A;  1KF6 A;  3UP4 A;  3UOV A;  4H4Y A;  3ATQ A;  4NWZ A;  1K0J A;  3RNM A;  1Q1W A;  1PJ5 A;  3GMC A;  2I0Z A;  2VVM A;  2VZ2 A;  3UTH A;  3V3O A;  3VR9 A;  2C72 A;  3GRS A;  3DJE A;  1VDC A;  2C67 A;  1CC6 A;  1S2Y A;  4H50 A;  5KNL A;  1NDA A;  2Y6Q A;  3T0K A;  2AR8 A;  4YT0 A;  1N4V A;  3K7Q X;  3NG7 X;  1EL9 A;  4C3X A;  1FOH A;  1PBD A;  1B5Q A;  3SY4 A;  2BK5 A;  1JOA A;  4MJW A;  5KMP A;  2B7R A;  3AE2 A;  1CL0 A;  2V61 A;  3P4S A;  3V76 A;  4J57 A;  2BAB A;  4LII A;  3D8X A;  3H8I A;  1VRQ B;  3QSE A;  5BUK A;  2BYB A;  3DA1 A;  2YM1 A;  4GAV A;  4AT0 A;  4H2P A;  2OLN A;  1GSN A;  1H6V A;  1KNR A;  4OPG A;  2WP6 A;  3SM8 A;  2GR2 A;  4J36 A;  2XLP A;  2X50 A;  2WS3 A;  3AE8 A;  4EM4 A;  2YLX A;  1KSU A;  1EL5 A;  4YKF A;  1H84 A;  1N4W A;  2WPC A;  5EOW A;  5FS8 A;  1PBB A;  3AYI A;  3GDP A;  4II3 A;  4U8N A;  1GND A;  2Q0L A;  1E7P A;  1H86 A;  4JY2 A;  2V5Z A;  3VR8 A;  3G5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...