4UP3A

Crystal structure of the mutant c140s,c286q thioredoxin reductase from entamoeba histolytica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
312
Chain Sequence
b'NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSASAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVQDRVYRQAIVAAGSGCMAALSCEKWLQTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 99
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4up3A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4up3A02
1ZDLA 2QCUA 4RSLA 3OZ2A 4BK2A 4EMIA 2R4JA 2XVIA 2W0HA 2WETA 1S3EA 4KPRA 1NHRA 3NH3X 2B9YA 4JNAA 2V61A 4D03A 4CCQA 2BS4A 3BNUA 1YQ4A 2C72A 1PJ6A 2JK6A 1O95A 4D04A 3DK4A 2WOWA 3SQPA 1XPQA 4OVIA 2BK4A 1N4UA 3BHFA 4U8LA 1LJ1A 3PO7A 3QSEA 1ZMDA 4H2QA 4H50A 3AECA 1LPFA 2WP5A 3CGBA 3UKPA 3IC9A 2BYBA 3ALLA 2R0PA 3GSIA 4U8OA 4TM0A 1H7XA 1IUXA 2NVKX 5KOWA 2FJEA 5BULA 1PN0A 2RGHA 4RG4A 1PJ7A 2C3DA 1IJHA 1KF6A 1H7WA 1GTEA 2IVEA 4K22A 2X8CA 5FS6A 1LQUA 1FCDA 2C70A 1JEHA 1NHPA 2WHDA 4REKA 3CIRA 1H6VA 1NG4A 1B5QA 1PJ5A 1KDGA 2XCGA 1B4VA 2YG5A 3ALJA 1JNZA 3EAOA 1CJCA 3AEBA 2BXSA 3GD3A 3T37A 1F8RA 4OPLA 3CGDA 3RNMA 2WESA 3R9UA 2DKHA 2CDUA 1GRBA 2VVMA 2IVDA 4YSZA 2XFNA 2OLOA 1CJ3A 2AR8A 3NK2X 1E1KA 2XDOA 5IQ1A 5M10A 1RYIA 1CJ4A 2ARDA 3AEFA 2R4EA 4C74A 2FJDA 5JCIA 1B37A 1TDFA 4HA6A 2BCGG 3RP8A 3UOVA 5EB5A 2R46A 3AWIA 1W4XA 2XLUA 1KFYA 1D4CA 4FK1C 4NTCA 3UKAA 2EQ6A 4JY2A 4YXDA 2B7SA 1NEKA 3C96A 3FPZA 2DKIA 2YM2A 3LZWA 2ZBWA 1N4WA 3O0HA 3NT6A 4IA5A 3AE4A 4K7ZA 5FS9A 4H4UA 4XWZA 1TRBA 4NEWA 4XWRA 3NIXA 3B3RA 5FS7A 2R45A 5L46A 3FMWA 3I6DA 1S2QA 1GERA 3IWAA 4NTDA 3RHAA 4CNJA 3LADA 3NGCX 1PDHA 5U25A 3NTAA 1KSUA 1MOKA 4BURA 2AAQA 1REOA 3E1TA 4A65A 2GR0A 4U2LA 4UP3A 4DSHA 2A89A 1GT8A 3GD4A 1CHUA 1L9DA 3AYJA 4H4VA 3UTEA 2GQWA 3M0OA 3EANA 3V76A 1D7YA 1Q1WA 3AE5A 2BC0A 4J34A 2WQYA 3GMBA 2C7GA 2RGJA 1ZY8A 1CJ2A 3DJDA 2YLTA 3UKQA 1RP0A 1Y0PA 3VRAA 3EPTA 2WPCA 1PBDA 1BKWA 4EQRA 2EQ7A 3GMCA 2GR3A 3CNPA 3CPJG 1O94A 1NG3A 2WP6A 4YWOA 5KWFA 3DK9A 2VVLA 1DJNA 4ADWA 2ZZ0A 4PAAA 3COXA 3NG7X 4U8MA 2XVEA 3H8IA 4H2NA 3BI4A 2YG6A 2IIDA 3NYEA 1RSGA 4H4YA 3CNTA 3F8RA 1JOAA 2JAEA 3ITJA 4GDEA 3G5RA 3ABVA 2C76A 3H4KA 3CNDA 4YSHA 4Z2UA 2J3NA 1KSSA 4WCTA 1K0JA 2XFQA 4YTPA 2GAHB 2XVHA 4UDRA 4YT0A 2YWLA 1AOGA 3BNMA 2JB3A 3ICRA 3NK1X 5EBKA 1DOCA 5FS8A 5JCNA 2BCPA 2VRMA 2EQ8A 1DJQA 3AE9A 3URHA 2APGA 2OAMA 1DNCA 3AD9B 3IHGA 3KPFA 1ZP0A 2BABA 3BI2A 1L9CA 4Z2RA 1TYTA 2X50A 2YG7A 1LVLA 2WDQA 1NPXA 1LV0A 2UZZA 4B67A 1VDCA 4Y4MA 2GR2A 3OC4A 1CF3A 3L1RA 4H4RA 4CY8A 1TYPA 3ICSA 4TM3A 3M12A 5EB4A 1EL9A 3ATQA 3VR9A 2EQ9A 1FEAA 1QLBA 1PHHA 2QAEA 1D7LA 4USRA 2BACA 2C64A 5KVHA 1GRTA 3RP7A 1F6MA 2XFPA 4TM1A 1JU2A 1F8WA 4C77A 1OJTA 1VQWA 4U8NA 2ACZA 1Y56B 3AE6A 1IUVA 3CGEA 3CPIG 3DA1A 3GRSA 4H2RA 2WOIA 2GV8A 2XLPA 2V3BA 3LOVA 3M13A 4UDQA 2XFOA 5GSNA 4CNKA 5KOXA 3NYCA 2GEWA 1NAAA 2YVFA 1NHQA 4LU6A 1FL2A 4B69A 1NENA 1E1MA 1PBCA 3AE7A 5HHFA 5KVIA 2YVGA 2VVLG 3NN0X 2TMDA 1N4VA 1L9EA 1GESA 3LJPA 3QVPA 3GWFA 4U2TA 1Q9IA 4H4QA 4EM4A 2BC1A 1S2YA 2YG3A 3D8XA 4JN9A 4YSYA 4C3XA 1M6IA 3K7QX 1Y56A 2V3AA 4GF7A 4CCRA 4EMJA 2VQ7A 1TDKA 1BGJA 5J60A 3P4PA 3Q6JA 3IF9A 2X8HA 2PHHA 1K0LA 2B76A 4EQWA 4GCMA 1MO9A 3FIMB 5U63A 2Z5YA 1NDAA 1BGNA 4OPUA 1GTHA 2C3CA 4EIQA 4YKGA 1P2EA 4Z24A 1FOHA 1CBOA 4H4ZA 1VG9A 2QA1A 1ZMCA 3NKSA 3P4RA 4EM3A 3ZYXA 3UOXA 1E39A 1Q1RA 4TLXA 2Y6RA 1DXLA 1D5TA 1OJ9A 2JKCA 3HZLA 3Q9TA 2WOVA 1CC4A 3ALMA 2JB1A 2X3NA 3DJGX 2VQBA 2CULA 1PXBA 2QA2A 4I58A 2JBVA 1IUTA 1LTXR 2C66A 3KD9A 1EL7A 1SEZA 5JCMA 4ZN0A 4OPCA 3II4A 3ADAB 2YR4A 3CNJA 4X4JA 4Y4LA 3SFEA 1Z6LA 4FK1A 3LZXA 4ZCCA 4AT0A 3DMEA 4RG3A 2WDRA 2C65A 3GYJA 5LV9A 2GQFA 5C2TA 4AOSA 3UKLA 4H2PA 2YLRA 1NHSA 1GETA 2XVFA 2O9ZA 3AE3A 3LB8A 3K7MX 4A5LA 2OLNA 4OPTA 1O5WA 4U8KA 2Y6QA 2B9XA 1XANA 2X99A 3IHMA 1H83A 1H82A 4K2XA 1D4EA 2CFYA 3SFDA 2GMHA 1N1PA 2GVCA 3NK0X 4A79A 2X8GA 4WX1A 3FG2P 2YVJA 3P4SA 4H4WA 2VZ2A 4O5QA 2VRLA 2WU5A 2E1MA 4B66A 2BS3A 4PABA 3GDPA 3AD7B 5DBJA 2H89A 3AYLA 3ZDNA 4BV6A 1E6EA 2Q7VA 3ICTA 2YAUA 4B64A 3CGCA 4CRTA 2BA9A 1BWCA 4DNAA 4LA1A 5KRQA 1YQZA 1KNPA 1H84A 2V60A 3QFAA 1IUWA 1E1NA 2YR6A 4JQ9A 3KLJA 3SM8A 4B68A 4NZHA 1GEUA 2WPEA 3NNEA 4BK1A 2YR5A 1ZKQA 4ECHA 1GRAA 1GPEA 4I59A 2GH5A 3AYIA 3QSMA 3WE0A 3UKKA 4J56A 4O5UA 4E0VA 2Z5XA 4B1BA 3VRBA 1EL5A 3DJEA 2BK5A 4OPDA 3KU9A 1GXFA 3AB1A 4OPIA 3B6DA 4AOXA 3QFBA 3C4NA 4EIPA 3KVEA 2NPXA 2WU2A 1ZX9A 3AEDA 3DGHA 1F8SA 3I3LA 1COYA 1TDOA 1PXCA 5CKUA 1ELIA 3JSKA 2GB0A 3UP4A 1CC2A 3P9UA 1QO8A 5BRTA 2YQUA 1IUUA 3VR8A 3K7TA 2C73A 3NYFA 5HYMA 1TDEA 2RABA 2B7RA 2YM1A 4GRTA 5EOWA 3UTFA 4IA6A 4JNQA 2FJBA 3AD8B 4IV9A 3AXBA 4BJYA 2GMJA 4UDPA 2HQMA 3G5QA 4N9XA 4BJZA 1GREA 4JY3A 2Q0LA 3CTYA 2WP9A 4J57A 1IUSA 3ISHA 4H4PA 1PBEA 5TR3A 3VRDB 2GR1A 4U8IA 1E7PA 2XFUA 4LIIA 4EQXA 4HB9A 4J36A 2I0ZA 3K30A 2VOUA 3GDNA 4U2SA 2YLSA 2GF3A 4NTEA 4USQA 3LXDA 3S5WA 4GR1A 5JCKA 4OPGA 5GRTA 5C3JA 1E1LA 4FDCB 3ATRA 5J7XA 3KA7A 3PVCA 5U1OA 4TLZA 5ER0A 1P2HA 1X31B 2GAGB 1JNRA 4JDRA 1FEBA 1PBBA 4P9SA 1H86A 4TM4A 2GRTA 5KXJA 1DODA 1PS9A 1K4QA 4X9NA 5HXIA 2F5ZA 5HY5A 1GRGA 3P4QA 3DH9A 1OJCA 2A87A 2Q6UA 1YQ3A 3REDA 3SGLA 4Z2TA 4APNA 1GV4A 4DGKA 1ZOVA 1TDNA 2WS3A 1GRFA 1VRQB 2WBAA 4NEVA 1DOEA 1FECA 3AE2A 2YLXA 3EF6A 1KNRA 4BK3A 4Y4NA 3NN6X 3UCLA 2BS2A 1K0IA 1BF3A 2C67A 2WEUA 3V3NA 3VQRA 5IQ4A 3KKJA 3UKHA 1M64A 2BXRA 1JRXA 3F8DA 4X9MA 2ZZCA 4ZCDA 3DJJA 5JCLA 2OA1A 4H4TA 3UKFA 3UOYA 2TPRA 3GWDA 4Z43A 2RGOA 4AT2A 1EBDA 5M0ZA 2Q0KA 1L0VA 5BUKA 4H7UA 5CQFA 4YSXA 2ZZBA 4KX6A 1H81A 1YKJA 4OCGA 2C75A 2XVJA 1F3PA 4A6NB 4EQSA 3UTGA 3AEGA 4DSGA 4Z25A 1CC6A 3GRTA 4H4SA 1EL8A 1XDIA 1GNDA 2XLSA 4YTMA 4B65A 1S3BA 1GRHA 4ICYA 3GYIA 1V59A 4IVMB 4MJWA 1HYUA 1PBFA 2OALA 3BI5A 3NHOX 4M52A 3V3OA 4YKFA 3UP5A 3H8LA 4GDPA 1UKVG 1B8SA 1QJDA 2YLZA 2V5ZA 4A6NA 4Z26A 3L8KA 2FBWA 2R0CA 3BHKA 2XLTA 4EMWA 3NRNA 3QVRA 3F8PA 4FX9A 2YLWA 3NLCA 4C3YA 4CBQA 4A9WA 4U8JA 2B9WA 4AP1A 4Z44A 2R9ZA 3AEAA 3S61A 1YY5A 3CNSA 3D1CA 2CVJA 2FJAA 2V6OA 4K8DA 3UTHA 1GALA 2XYOA 3AEEA 4GUVA 4J31A 4C5OA 1JRYA 1DOBA 1PXAA 4K5RA 2AQJA 3P1WA 4IVOB 4K5SA 3C4AA 2A8XA 2WPFA 1ZOYA 1GSNA 1VG0A 4YTNA 2BK3A 3AE8A 3AE1A 3QSSA 4A99A 5IPYA 1OJDA 5FMHA 1BZLA 3CPHG 1D4DA 1MXTA 1JRZA 2E5VA 2E4GA 2PYXA 2XLRA 1LQTA 3UOZA 4AP3A 4B63A 3QJ4A 2JB2A 3PS9A 1ZK7A 4CY6A 4A7AA 5BVAA 1GOSA 4H4XA 4J2WA 4J33A 2YG4A 2H88A 3RP6A 1ONFA 3FBSA 4XXGA 3CN8A 2R0GA 3G5SA 1XHCA 3DGZA 3NTDA 1OJAA 1CL0A 2WDVA 3DK8A 4U8PA
chains in the Genus database with same CATH superfamily
1ZDLA 2QCUA 4RSLA 3OZ2A 4BK2A 4EMIA 2R4JA 2XVIA 2W0HA 2WETA 3SYIA 1S3EA 4KPRA 1NHRA 3NH3X 2B9YA 4JNAA 2V61A 4D03A 4CCQA 2BS4A 3BNUA 1YQ4A 2C72A 1PJ6A 2JK6A 1O95A 4D04A 3DK4A 2WOWA 3SQPA 1XPQA 4OVIA 2BK4A 1N4UA 3BHFA 4U8LA 1LJ1A 3PO7A 3QSEA 1ZMDA 4H2QA 4H50A 3AECA 1LPFA 2WP5A 3CGBA 3UKPA 3IC9A 2BYBA 3ALLA 2R0PA 3GSIA 4U8OA 4TM0A 1H7XA 1IUXA 2NVKX 5KOWA 2FJEA 5BULA 1PN0A 2RGHA 4RG4A 1PJ7A 2C3DA 1IJHA 1KF6A 1H7WA 1GTEA 2IVEA 4K22A 2X8CA 5FS6A 1LQUA 1FCDA 2C70A 1JEHA 1NHPA 2WHDA 4G6GA 4REKA 4II3A 3CIRA 1H6VA 1NG4A 1B5QA 1PJ5A 1KDGA 2XCGA 1B4VA 2YG5A 3ALJA 1JNZA 3EAOA 1CJCA 3AEBA 2BXSA 3GD3A 3T37A 1F8RA 4OPLA 3CGDA 3RNMA 2WESA 3R9UA 2DKHA 2CDUA 1GRBA 2VVMA 2IVDA 4YSZA 2XFNA 2OLOA 3SZCA 1CJ3A 2AR8A 3NK2X 1E1KA 2XDOA 5IQ1A 5M10A 1RYIA 1CJ4A 2ARDA 3AEFA 2R4EA 4C74A 2FJDA 5JCIA 1B37A 1TDFA 4HA6A 2BCGG 3RP8A 3UOVA 5EB5A 2R46A 3AWIA 1W4XA 2XLUA 1KFYA 1D4CA 4FK1C 4NTCA 3UKAA 2EQ6A 4JY2A 4YXDA 2B7SA 1NEKA 3C96A 3FPZA 2DKIA 2YM2A 3LZWA 2ZBWA 1N4WA 3O0HA 3NT6A 4IA5A 3AE4A 4K7ZA 5FS9A 4H4UA 4XWZA 1TRBA 4NEWA 4XWRA 3NIXA 3SZWA 3B3RA 5FS7A 2R45A 5L46A 3FMWA 3I6DA 1S2QA 1GERA 3IWAA 4NTDA 3RHAA 4CNJA 3LADA 3NGCX 1PDHA 5U25A 3NTAA 1KSUA 1MOKA 4BURA 2AAQA 1REOA 3E1TA 4A65A 2GR0A 4U2LA 4UP3A 4DSHA 2A89A 1GT8A 3GD4A 1CHUA 1L9DA 3AYJA 4H4VA 3UTEA 2GQWA 3M0OA 3EANA 3V76A 1D7YA 1Q1WA 3AE5A 2BC0A 4J34A 2WQYA 3GMBA 2C7GA 2RGJA 1ZY8A 5KMPA 1CJ2A 3DJDA 2YLTA 3UKQA 1RP0A 1Y0PA 3VRAA 3EPTA 2WPCA 1PBDA 1BKWA 4EQRA 2EQ7A 3GMCA 2BRAA 2GR3A 3CNPA 3CPJG 1O94A 1NG3A 2WP6A 4YWOA 5KWFA 3DK9A 2VVLA 1DJNA 4ADWA 2ZZ0A 4PAAA 3COXA 3NG7X 4U8MA 2XVEA 3H8IA 4H2NA 5KMRA 3BI4A 3SZ0A 2YG6A 2IIDA 3NYEA 1RSGA 4H4YA 3CNTA 3F8RA 1JOAA 2JAEA 3ITJA 4GDEA 3G5RA 3ABVA 3SY4A 2C76A 3H4KA 3CNDA 4GAPA 4YSHA 4Z2UA 2J3NA 1KSSA 4WCTA 1K0JA 2XFQA 4YTPA 2GAHB 2XVHA 4UDRA 4YT0A 2YWLA 1AOGA 3BNMA 2JB3A 3ICRA 3NK1X 5EBKA 1DOCA 5FS8A 3HYVA 5JCNA 2BCPA 2VRMA 2EQ8A 1DJQA 3AE9A 3URHA 2APGA 2OAMA 1DNCA 3AD9B 3IHGA 3KPFA 1ZP0A 2BABA 4NWZA 3BI2A 1L9CA 4Z2RA 1TYTA 2X50A 2YG7A 1LVLA 2WDQA 1NPXA 1LV0A 2UZZA 4B67A 1VDCA 4Y4MA 2GR2A 3OC4A 1CF3A 3L1RA 4H4RA 4CY8A 1TYPA 3ICSA 4TM3A 3M12A 5EB4A 1EL9A 3ATQA 3VR9A 2EQ9A 1FEAA 1QLBA 1PHHA 2QAEA 1D7LA 4USRA 2BACA 2C64A 5KVHA 1GRTA 3RP7A 1F6MA 4G74A 2XFPA 4TM1A 1JU2A 1F8WA 4C77A 1OJTA 1VQWA 4U8NA 2ACZA 1Y56B 3AE6A 1IUVA 3CGEA 3CPIG 3DA1A 3GRSA 4H2RA 2WOIA 2GV8A 2XLPA 2V3BA 3LOVA 3M13A 4UDQA 2XFOA 5GSNA 4CNKA 5KOXA 3NYCA 2GEWA 1NAAA 2YVFA 1NHQA 4LU6A 1FL2A 4B69A 1NENA 1E1MA 1PBCA 3AE7A 5HHFA 5KVIA 2YVGA 2VVLG 3NN0X 2TMDA 1N4VA 1L9EA 1GESA 3LJPA 3QVPA 3GWFA 4U2TA 1Q9IA 4H4QA 4EM4A 2BC1A 1S2YA 2YG3A 3D8XA 4JN9A 5KMSA 5KNLA 4YSYA 3T31A 4C3XA 1M6IA 3K7QX 1Y56A 2V3AA 4GF7A 4CCRA 4EMJA 2VQ7A 1TDKA 1BGJA 5J60A 3P4PA 3Q6JA 3IF9A 2X8HA 2BRYA 2PHHA 1K0LA 2B76A 4EQWA 4GCMA 1MO9A 3FIMB 5U63A 2Z5YA 4NNJA 1NDAA 1BGNA 4OPUA 1GTHA 2C3CA 4EIQA 4YKGA 1P2EA 4Z24A 1FOHA 1CBOA 4H4ZA 1VG9A 2QA1A 1ZMCA 3NKSA 3P4RA 4EM3A 3ZYXA 3UOXA 1E39A 1Q1RA 4TLXA 2Y6RA 1DXLA 1D5TA 1OJ9A 2JKCA 3HZLA 3Q9TA 3T2KA 2WOVA 1CC4A 3ALMA 2JB1A 2X3NA 3DJGX 2VQBA 2CULA 1PXBA 2QA2A 4I58A 2JBVA 1IUTA 1LTXR 2C66A 3KD9A 1EL7A 1SEZA 5JCMA 4ZN0A 4OPCA 3II4A 3ADAB 2YR4A 3CNJA 4X4JA 4Y4LA 3SFEA 1Z6LA 3HYXA 4FK1A 3LZXA 4ZCCA 4AT0A 3DMEA 4RG3A 2WDRA 2C65A 3GYJA 5LV9A 2GQFA 5C2TA 4AOSA 3UKLA 4H2PA 2YLRA 1NHSA 1GETA 2XVFA 2O9ZA 3AE3A 3LB8A 3K7MX 3SZFA 2OLNA 4OPTA 1O5WA 4U8KA 4A5LA 2Y6QA 2B9XA 1XANA 2X99A 3IHMA 1H83A 1H82A 4G9KA 4K2XA 1D4EA 2CFYA 3SFDA 2GMHA 1N1PA 2GVCA 3NK0X 4A79A 2X8GA 4WX1A 3FG2P 2YVJA 3P4SA 4H4WA 4G73A 2VZ2A 4O5QA 2VRLA 2WU5A 2E1MA 4B66A 2BS3A 4PABA 3GDPA 3AD7B 5DBJA 2H89A 3AYLA 3ZDNA 4BV6A 1E6EA 2Q7VA 3ICTA 2YAUA 4B64A 3CGCA 4CRTA 2BA9A 1BWCA 4DNAA 4LA1A 5KRQA 1YQZA 1KNPA 1H84A 2V60A 3QFAA 1IUWA 1E1NA 2YR6A 4JQ9A 3KLJA 3SM8A 4B68A 4NZHA 1GEUA 2WPEA 3NNEA 4BK1A 2YR5A 2C4CA 1ZKQA 4ECHA 1GRAA 1GPEA 4I59A 2GH5A 3AYIA 3QSMA 3WE0A 3UKKA 4J56A 4O5UA 4E0VA 2Z5XA 4B1BA 3VRBA 1EL5A 3DJEA 2BK5A 4OPDA 3KU9A 1GXFA 3AB1A 4OPIA 3B6DA 4AOXA 3QFBA 3C4NA 4EIPA 3KVEA 2NPXA 2WU2A 1ZX9A 3AEDA 3DGHA 1F8SA 3I3LA 1COYA 1TDOA 1PXCA 5CKUA 1ELIA 3JSKA 2GB0A 3UP4A 1CC2A 3P9UA 1QO8A 5BRTA 2YQUA 1IUUA 3VR8A 3K7TA 2C73A 3NYFA 5HYMA 1TDEA 2RABA 2B7RA 2YM1A 4GRTA 5EOWA 3UTFA 4IA6A 4JNQA 2FJBA 3AD8B 4IV9A 3AXBA 4BJYA 3KPKA 2GMJA 4UDPA 2HQMA 3G5QA 4N9XA 4BJZA 1GREA 4JY3A 2Q0LA 3CTYA 2WP9A 4J57A 1IUSA 3ISHA 4H4PA 1PBEA 5TR3A 3VRDB 2GR1A 4U8IA 1E7PA 2XFUA 4LIIA 4EQXA 4HB9A 4J36A 2I0ZA 3K30A 2VOUA 3GDNA 4U2SA 2YLSA 2GF3A 4NTEA 4USQA 3HYWA 3LXDA 3S5WA 4GR1A 5JCKA 4OPGA 5GRTA 5C3JA 1E1LA 4FDCB 3ATRA 5J7XA 3KA7A 3PVCA 5U1OA 4TLZA 5ER0A 1P2HA 1X31B 2GAGB 1JNRA 4JDRA 1FEBA 1PBBA 3T14A 4P9SA 1H86A 4TM4A 2GRTA 5KXJA 1DODA 1PS9A 1K4QA 4X9NA 5HXIA 2F5ZA 5HY5A 1GRGA 3P4QA 3DH9A 1OJCA 2A87A 2Q6UA 1YQ3A 3REDA 3SGLA 3SX6A 4APNA 4Z2TA 1GV4A 4DGKA 1ZOVA 1TDNA 2WS3A 1GRFA 1VRQB 2WBAA 4G6HA 1DOEA 3GYXA 1FECA 4NEVA 3AE2A 2YLXA 3EF6A 1KNRA 4BK3A 4Y4NA 3NN6X 3UCLA 2BS2A 1K0IA 1BF3A 2C67A 2WEUA 4II2A 3V3NA 3VQRA 3KKJA 3UKHA 5IQ4A 1M64A 2BXRA 1JRXA 3F8DA 4X9MA 2ZZCA 4ZCDA 3DJJA 5JCLA 4GAVA 2OA1A 4H4TA 3UKFA 3UOYA 2TPRA 3GWDA 4Z43A 2RGOA 4AT2A 1EBDA 5M0ZA 2Q0KA 1L0VA 5BUKA 4H7UA 5CQFA 4YSXA 2ZZBA 4KX6A 1H81A 1YKJA 4OCGA 2C75A 2XVJA 1F3PA 4A6NB 4EQSA 3UTGA 3AEGA 4DSGA 4Z25A 1CC6A 3GRTA 4H4SA 1EL8A 1XDIA 1GNDA 2XLSA 4YTMA 4B65A 1S3BA 1GRHA 4ICYA 3GYIA 1V59A 4IVMB 4MJWA 1HYUA 1PBFA 2OALA 3BI5A 3NHOX 4M52A 3V3OA 4YKFA 3UP5A 3H8LA 4GDPA 1UKVG 1B8SA 1QJDA 2YLZA 2V5ZA 4A6NA 4Z26A 3L8KA 2FBWA 2R0CA 3BHKA 2XLTA 4EMWA 3NRNA 3QVRA 3F8PA 4FX9A 2YLWA 3NLCA 4C3YA 4CBQA 4A9WA 4U8JA 2B9WA 4AP1A 4Z44A 2R9ZA 3AEAA 3S61A 1YY5A 3CNSA 3D1CA 2CVJA 2FJAA 2V6OA 4K8DA 3T0KA 1GALA 3UTHA 2XYOA 3AEEA 4GUVA 4J31A 4C5OA 1JRYA 1DOBA 1PXAA 4K5RA 2AQJA 3P1WA 4IVOB 5KMQA 4K5SA 3T2ZA 3C4AA 2A8XA 2WPFA 1ZOYA 1GSNA 1VG0A 4YTNA 2BK3A 3AE8A 3AE1A 3QSSA 4A99A 5IPYA 3SXIA 1OJDA 5FMHA 1BZLA 3CPHG 1D4DA 1MXTA 1JRZA 2E5VA 2E4GA 2PYXA 2XLRA 1LQTA 3T2YA 3UOZA 4AP3A 4B63A 3QJ4A 2JB2A 3PS9A 1ZK7A 3CMMA 4CY6A 4A7AA 5BVAA 1GOSA 4H4XA 4J2WA 4J33A 2YG4A 2H88A 3RP6A 1ONFA 3FBSA 4XXGA 3CN8A 2R0GA 3G5SA 1XHCA 3DGZA 3NTDA 1OJAA 1CL0A 2WDVA 3DK8A 4U8PA
chains in the Genus database with same CATH topology
1ZDLA 2QCUA 4RSLA 3OZ2A 4BK2A 4EMIA 2R4JA 2XVIA 2W0HA 2WETA 3SYIA 1S3EA 4KPRA 1NHRA 3NH3X 2B9YA 4JNAA 2V61A 4D03A 4CCQA 2BS4A 3BNUA 1YQ4A 2C72A 1PJ6A 2JK6A 1O95A 4D04A 3DK4A 2WOWA 3SQPA 1XPQA 4OVIA 2BK4A 1N4UA 3BHFA 4U8LA 1LJ1A 3PO7A 3QSEA 1ZMDA 4H2QA 4H50A 3AECA 1LPFA 2WP5A 3CGBA 3UKPA 3IC9A 2BYBA 3ALLA 2R0PA 3GSIA 4U8OA 4TM0A 1H7XA 1IUXA 2NVKX 5KOWA 2FJEA 5BULA 1PN0A 2RGHA 4RG4A 1PJ7A 2C3DA 1IJHA 1KF6A 1H7WA 1GTEA 2IVEA 4K22A 2X8CA 5FS6A 1LQUA 1FCDA 2C70A 1JEHA 1NHPA 2WHDA 4G6GA 4REKA 4II3A 3CIRA 1H6VA 1NG4A 1B5QA 1PJ5A 1KDGA 2XCGA 1B4VA 2YG5A 3ALJA 1JNZA 3EAOA 1CJCA 3AEBA 2BXSA 3GD3A 3T37A 1F8RA 4OPLA 3CGDA 3RNMA 2WESA 3R9UA 2DKHA 2CDUA 1GRBA 2VVMA 2IVDA 4YSZA 2XFNA 2OLOA 3SZCA 1CJ3A 2AR8A 3NK2X 1E1KA 2XDOA 5IQ1A 5M10A 1RYIA 1CJ4A 2ARDA 3AEFA 2R4EA 4C74A 2FJDA 5JCIA 1B37A 1TDFA 4HA6A 2BCGG 3RP8A 3UOVA 5EB5A 2R46A 3AWIA 1W4XA 2XLUA 1KFYA 1D4CA 4FK1C 4NTCA 3UKAA 2EQ6A 4JY2A 4YXDA 2B7SA 1NEKA 3C96A 3FPZA 2DKIA 2YM2A 3LZWA 2ZBWA 1N4WA 3O0HA 3NT6A 4IA5A 3AE4A 4K7ZA 5FS9A 4H4UA 4XWZA 1TRBA 4NEWA 4XWRA 3NIXA 3SZWA 3B3RA 5FS7A 2R45A 5L46A 3FMWA 3I6DA 1S2QA 1GERA 3IWAA 4NTDA 3RHAA 4CNJA 3LADA 3NGCX 1PDHA 5U25A 3NTAA 1KSUA 1MOKA 4BURA 2AAQA 1REOA 3E1TA 4A65A 2GR0A 4U2LA 4UP3A 4DSHA 2A89A 1GT8A 3GD4A 1CHUA 1L9DA 3AYJA 4H4VA 3UTEA 2GQWA 3M0OA 3EANA 3V76A 1D7YA 1Q1WA 3AE5A 2BC0A 4J34A 2WQYA 3GMBA 2C7GA 2RGJA 1ZY8A 5KMPA 1CJ2A 3DJDA 2YLTA 3UKQA 1RP0A 1Y0PA 3VRAA 3EPTA 2WPCA 1PBDA 1BKWA 4EQRA 2EQ7A 3GMCA 2BRAA 2GR3A 3CNPA 3CPJG 1O94A 1NG3A 2WP6A 4YWOA 5KWFA 3DK9A 2VVLA 1DJNA 4ADWA 2ZZ0A 4PAAA 3COXA 3NG7X 4U8MA 2XVEA 3H8IA 4H2NA 5KMRA 3BI4A 3SZ0A 2YG6A 2IIDA 3NYEA 1RSGA 4H4YA 3CNTA 3F8RA 1JOAA 2JAEA 3ITJA 4GDEA 3G5RA 3ABVA 3SY4A 2C76A 3H4KA 3CNDA 4GAPA 4YSHA 4Z2UA 2J3NA 1KSSA 4WCTA 1K0JA 2XFQA 4YTPA 2GAHB 2XVHA 4UDRA 4YT0A 2YWLA 1AOGA 3BNMA 2JB3A 3ICRA 3NK1X 5EBKA 1DOCA 5FS8A 3HYVA 5JCNA 2BCPA 2VRMA 2EQ8A 1DJQA 3AE9A 3URHA 2APGA 2OAMA 1DNCA 3AD9B 3IHGA 3KPFA 1ZP0A 2BABA 4NWZA 3BI2A 1L9CA 4Z2RA 1TYTA 2X50A 2YG7A 1LVLA 2WDQA 1NPXA 1LV0A 2UZZA 4B67A 1VDCA 4Y4MA 2GR2A 3OC4A 1CF3A 3L1RA 4H4RA 4CY8A 1TYPA 3ICSA 4TM3A 3M12A 5EB4A 1EL9A 3ATQA 3VR9A 2EQ9A 1FEAA 1QLBA 1PHHA 2QAEA 1D7LA 4USRA 2BACA 2C64A 5KVHA 1GRTA 3RP7A 1F6MA 4G74A 2XFPA 4TM1A 1JU2A 1F8WA 4C77A 1OJTA 1VQWA 4U8NA 2ACZA 1Y56B 3AE6A 1IUVA 3CGEA 3CPIG 3DA1A 3GRSA 4H2RA 2WOIA 2GV8A 2XLPA 2V3BA 3LOVA 3M13A 4UDQA 2XFOA 5GSNA 4CNKA 5KOXA 3NYCA 2GEWA 1NAAA 2YVFA 1NHQA 4LU6A 1FL2A 4B69A 1NENA 1E1MA 1PBCA 3AE7A 5HHFA 5KVIA 2YVGA 2VVLG 3NN0X 2TMDA 1N4VA 1L9EA 1GESA 3LJPA 3QVPA 3GWFA 4U2TA 1Q9IA 4H4QA 4EM4A 2BC1A 1S2YA 2YG3A 3D8XA 4JN9A 5KMSA 5KNLA 4YSYA 3T31A 4C3XA 1M6IA 3K7QX 1Y56A 2V3AA 4GF7A 4CCRA 4EMJA 2VQ7A 1TDKA 1BGJA 5J60A 3P4PA 3Q6JA 3IF9A 2X8HA 2BRYA 2PHHA 1K0LA 2B76A 4EQWA 4GCMA 1MO9A 3FIMB 5U63A 2Z5YA 4NNJA 1NDAA 1BGNA 4OPUA 1GTHA 2C3CA 4EIQA 4YKGA 1P2EA 4Z24A 1FOHA 1CBOA 4H4ZA 1VG9A 2QA1A 1ZMCA 3NKSA 3P4RA 4EM3A 3ZYXA 3UOXA 1E39A 1Q1RA 4TLXA 2Y6RA 1DXLA 1D5TA 1OJ9A 2JKCA 3HZLA 3Q9TA 3T2KA 2WOVA 1CC4A 3ALMA 2JB1A 2X3NA 3DJGX 2VQBA 2CULA 1PXBA 2QA2A 4I58A 2JBVA 1IUTA 1LTXR 2C66A 3KD9A 1EL7A 1SEZA 5JCMA 4ZN0A 4OPCA 3II4A 3ADAB 2YR4A 3CNJA 4X4JA 4Y4LA 3SFEA 1Z6LA 3HYXA 4FK1A 3LZXA 4ZCCA 4AT0A 3DMEA 4RG3A 2WDRA 2C65A 3GYJA 5LV9A 2GQFA 5C2TA 4AOSA 3UKLA 4H2PA 2YLRA 1NHSA 1GETA 2XVFA 2O9ZA 3AE3A 3LB8A 3K7MX 3SZFA 2OLNA 4OPTA 1O5WA 4U8KA 4A5LA 2Y6QA 2B9XA 1XANA 2X99A 3IHMA 1H83A 1H82A 4G9KA 4K2XA 1D4EA 2CFYA 3SFDA 2GMHA 1N1PA 2GVCA 3NK0X 4A79A 2X8GA 4WX1A 3FG2P 2YVJA 3P4SA 4H4WA 4G73A 2VZ2A 4O5QA 2VRLA 2WU5A 2E1MA 4B66A 2BS3A 4PABA 3GDPA 3AD7B 5DBJA 2H89A 3AYLA 3ZDNA 4BV6A 1E6EA 2Q7VA 3ICTA 2YAUA 4B64A 3CGCA 4CRTA 2BA9A 1BWCA 4DNAA 4LA1A 5KRQA 1YQZA 1KNPA 1H84A 2V60A 3QFAA 1IUWA 1E1NA 2YR6A 4JQ9A 3KLJA 3SM8A 4B68A 4NZHA 1GEUA 2WPEA 3NNEA 4BK1A 2YR5A 2C4CA 1ZKQA 4ECHA 1GRAA 1GPEA 4I59A 2GH5A 3AYIA 3QSMA 3WE0A 3UKKA 4J56A 4O5UA 4E0VA 2Z5XA 4B1BA 3VRBA 1EL5A 3DJEA 2BK5A 4OPDA 3KU9A 1GXFA 3AB1A 4OPIA 3B6DA 4AOXA 3QFBA 3C4NA 4EIPA 3KVEA 2NPXA 2WU2A 1ZX9A 3AEDA 3DGHA 1F8SA 3I3LA 1COYA 1TDOA 1PXCA 5CKUA 1ELIA 3JSKA 2GB0A 3UP4A 1CC2A 3P9UA 1QO8A 5BRTA 2YQUA 1IUUA 3VR8A 3K7TA 2C73A 3NYFA 5HYMA 1TDEA 2RABA 2B7RA 2YM1A 4GRTA 5EOWA 3UTFA 4IA6A 4JNQA 2FJBA 3AD8B 4IV9A 3AXBA 4BJYA 3KPKA 2GMJA 4UDPA 2HQMA 3G5QA 4N9XA 4BJZA 1GREA 4JY3A 2Q0LA 3CTYA 2WP9A 4J57A 1IUSA 3ISHA 4H4PA 1PBEA 5TR3A 3VRDB 2GR1A 4U8IA 1E7PA 2XFUA 4LIIA 4EQXA 4HB9A 4J36A 2I0ZA 3K30A 2VOUA 3GDNA 4U2SA 2YLSA 2GF3A 4NTEA 4USQA 3HYWA 3LXDA 3S5WA 4GR1A 5JCKA 4OPGA 5GRTA 5C3JA 1E1LA 4FDCB 3ATRA 5J7XA 3KA7A 3PVCA 5U1OA 4TLZA 5ER0A 1P2HA 1X31B 2GAGB 1JNRA 4JDRA 1FEBA 1PBBA 3T14A 4P9SA 1H86A 4TM4A 2GRTA 5KXJA 1DODA 1PS9A 1K4QA 4X9NA 5HXIA 2F5ZA 5HY5A 1GRGA 3P4QA 3DH9A 1OJCA 2A87A 2Q6UA 1YQ3A 3REDA 3SGLA 3SX6A 4APNA 4Z2TA 1GV4A 4DGKA 1ZOVA 1TDNA 2WS3A 1GRFA 1VRQB 2WBAA 4G6HA 1DOEA 3GYXA 1FECA 4NEVA 3AE2A 2YLXA 3EF6A 1KNRA 4BK3A 4Y4NA 3NN6X 3UCLA 2BS2A 1K0IA 1BF3A 2C67A 2WEUA 4II2A 3V3NA 3VQRA 3KKJA 3UKHA 5IQ4A 1M64A 2BXRA 1JRXA 3F8DA 4X9MA 2ZZCA 4ZCDA 3DJJA 5JCLA 4GAVA 2OA1A 4H4TA 3UKFA 3UOYA 2TPRA 3GWDA 4Z43A 2RGOA 4AT2A 1EBDA 5M0ZA 2Q0KA 1L0VA 5BUKA 4H7UA 5CQFA 4YSXA 2ZZBA 4KX6A 1H81A 1YKJA 4OCGA 2C75A 2XVJA 1F3PA 4A6NB 4EQSA 3UTGA 3AEGA 4DSGA 4Z25A 1CC6A 3GRTA 4H4SA 1EL8A 1XDIA 1GNDA 2XLSA 4YTMA 4B65A 1S3BA 1GRHA 4ICYA 3GYIA 1V59A 4IVMB 4MJWA 1HYUA 1PBFA 2OALA 3BI5A 3NHOX 4M52A 3V3OA 4YKFA 3UP5A 3H8LA 4GDPA 1UKVG 1B8SA 1QJDA 2YLZA 2V5ZA 4A6NA 4Z26A 3L8KA 2FBWA 2R0CA 3BHKA 2XLTA 4EMWA 3NRNA 3QVRA 3F8PA 4FX9A 2YLWA 3NLCA 4C3YA 4CBQA 4A9WA 4U8JA 2B9WA 4AP1A 4Z44A 2R9ZA 3AEAA 3S61A 1YY5A 3CNSA 3D1CA 2CVJA 2FJAA 2V6OA 4K8DA 3T0KA 1GALA 3UTHA 2XYOA 3AEEA 4GUVA 4J31A 4C5OA 1JRYA 1DOBA 1PXAA 4K5RA 2AQJA 3P1WA 4IVOB 5KMQA 4K5SA 3T2ZA 3C4AA 2A8XA 2WPFA 1ZOYA 1GSNA 1VG0A 4YTNA 2BK3A 3AE8A 3AE1A 3QSSA 4A99A 5IPYA 3SXIA 1OJDA 5FMHA 1BZLA 3CPHG 1D4DA 1MXTA 1JRZA 2E5VA 2E4GA 2PYXA 2XLRA 1LQTA 3T2YA 3UOZA 4AP3A 4B63A 3QJ4A 2JB2A 3PS9A 1ZK7A 3CMMA 4CY6A 4A7AA 5BVAA 1GOSA 4H4XA 4J2WA 4J33A 2YG4A 2H88A 3RP6A 1ONFA 3FBSA 4XXGA 3CN8A 2R0GA 3G5SA 1XHCA 3DGZA 3NTDA 1OJAA 1CL0A 2WDVA 3DK8A 4U8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZDL A;  2QCU A;  4RSL A;  3OZ2 A;  4BK2 A;  4EMI A;  2R4J A;  2XVI A;  2W0H A;  2WET A;  1S3E A;  4KPR A;  1NHR A;  3NH3 X;  2B9Y A;  4JNA A;  2V61 A;  4D03 A;  4CCQ A;  2BS4 A;  3BNU A;  1YQ4 A;  2C72 A;  1PJ6 A;  2JK6 A;  1O95 A;  4D04 A;  3DK4 A;  2WOW A;  3SQP A;  1XPQ A;  4OVI A;  2BK4 A;  1N4U A;  3BHF A;  4U8L A;  1LJ1 A;  3PO7 A;  3QSE A;  1ZMD A;  4H2Q A;  4H50 A;  3AEC A;  1LPF A;  2WP5 A;  3CGB A;  3UKP A;  3IC9 A;  2BYB A;  3ALL A;  2R0P A;  3GSI A;  4U8O A;  4TM0 A;  1H7X A;  1IUX A;  2NVK X;  5KOW A;  2FJE A;  5BUL A;  1PN0 A;  2RGH A;  4RG4 A;  1PJ7 A;  2C3D A;  1IJH A;  1KF6 A;  1H7W A;  1GTE A;  2IVE A;  4K22 A;  2X8C A;  5FS6 A;  1LQU A;  1FCD A;  2C70 A;  1JEH A;  1NHP A;  2WHD A;  4REK A;  3CIR A;  1H6V A;  1NG4 A;  1B5Q A;  1PJ5 A;  1KDG A;  2XCG A;  1B4V A;  2YG5 A;  3ALJ A;  1JNZ A;  3EAO A;  1CJC A;  3AEB A;  2BXS A;  3GD3 A;  3T37 A;  1F8R A;  4OPL A;  3CGD A;  3RNM A;  2WES A;  3R9U A;  2DKH A;  2CDU A;  1GRB A;  2VVM A;  2IVD A;  4YSZ A;  2XFN A;  2OLO A;  1CJ3 A;  2AR8 A;  3NK2 X;  1E1K A;  2XDO A;  5IQ1 A;  5M10 A;  1RYI A;  1CJ4 A;  2ARD A;  3AEF A;  2R4E A;  4C74 A;  2FJD A;  5JCI A;  1B37 A;  1TDF A;  4HA6 A;  2BCG G;  3RP8 A;  3UOV A;  5EB5 A;  2R46 A;  3AWI A;  1W4X A;  2XLU A;  1KFY A;  1D4C A;  4FK1 C;  4NTC A;  3UKA A;  2EQ6 A;  4JY2 A;  4YXD A;  2B7S A;  1NEK A;  3C96 A;  3FPZ A;  2DKI A;  2YM2 A;  3LZW A;  2ZBW A;  1N4W A;  3O0H A;  3NT6 A;  4IA5 A;  3AE4 A;  4K7Z A;  5FS9 A;  4H4U A;  4XWZ A;  1TRB A;  4NEW A;  4XWR A;  3NIX A;  3B3R A;  5FS7 A;  2R45 A;  5L46 A;  3FMW A;  3I6D A;  1S2Q A;  1GER A;  3IWA A;  4NTD A;  3RHA A;  4CNJ A;  3LAD A;  3NGC X;  1PDH A;  5U25 A;  3NTA A;  1KSU A;  1MOK A;  4BUR A;  2AAQ A;  1REO A;  3E1T A;  4A65 A;  2GR0 A;  4U2L A;  4UP3 A;  4DSH A;  2A89 A;  1GT8 A;  3GD4 A;  1CHU A;  1L9D A;  3AYJ A;  4H4V A;  3UTE A;  2GQW A;  3M0O A;  3EAN A;  3V76 A;  1D7Y A;  1Q1W A;  3AE5 A;  2BC0 A;  4J34 A;  2WQY A;  3GMB A;  2C7G A;  2RGJ A;  1ZY8 A;  1CJ2 A;  3DJD A;  2YLT A;  3UKQ A;  1RP0 A;  1Y0P A;  3VRA A;  3EPT A;  2WPC A;  1PBD A;  1BKW A;  4EQR A;  2EQ7 A;  3GMC A;  2GR3 A;  3CNP A;  3CPJ G;  1O94 A;  1NG3 A;  2WP6 A;  4YWO A;  5KWF A;  3DK9 A;  2VVL A;  1DJN A;  4ADW A;  2ZZ0 A;  4PAA A;  3COX A;  3NG7 X;  4U8M A;  2XVE A;  3H8I A;  4H2N A;  3BI4 A;  2YG6 A;  2IID A;  3NYE A;  1RSG A;  4H4Y A;  3CNT A;  3F8R A;  1JOA A;  2JAE A;  3ITJ A;  4GDE A;  3G5R A;  3ABV A;  2C76 A;  3H4K A;  3CND A;  4YSH A;  4Z2U A;  2J3N A;  1KSS A;  4WCT A;  1K0J A;  2XFQ A;  4YTP A;  2GAH B;  2XVH A;  4UDR A;  4YT0 A;  2YWL A;  1AOG A;  3BNM A;  2JB3 A;  3ICR A;  3NK1 X;  5EBK A;  1DOC A;  5FS8 A;  5JCN A;  2BCP A;  2VRM A;  2EQ8 A;  1DJQ A;  3AE9 A;  3URH A;  2APG A;  2OAM A;  1DNC A;  3AD9 B;  3IHG A;  3KPF A;  1ZP0 A;  2BAB A;  3BI2 A;  1L9C A;  4Z2R A;  1TYT A;  2X50 A;  2YG7 A;  1LVL A;  2WDQ A;  1NPX A;  1LV0 A;  2UZZ A;  4B67 A;  1VDC A;  4Y4M A;  2GR2 A;  3OC4 A;  1CF3 A;  3L1R A;  4H4R A;  4CY8 A;  1TYP A;  3ICS A;  4TM3 A;  3M12 A;  5EB4 A;  1EL9 A;  3ATQ A;  3VR9 A;  2EQ9 A;  1FEA A;  1QLB A;  1PHH A;  2QAE A;  1D7L A;  4USR A;  2BAC A;  2C64 A;  5KVH A;  1GRT A;  3RP7 A;  1F6M A;  2XFP A;  4TM1 A;  1JU2 A;  1F8W A;  4C77 A;  1OJT A;  1VQW A;  4U8N A;  2ACZ A;  1Y56 B;  3AE6 A;  1IUV A;  3CGE A;  3CPI G;  3DA1 A;  3GRS A;  4H2R A;  2WOI A;  2GV8 A;  2XLP A;  2V3B A;  3LOV A;  3M13 A;  4UDQ A;  2XFO A;  5GSN A;  4CNK A;  5KOX A;  3NYC A;  2GEW A;  1NAA A;  2YVF A;  1NHQ A;  4LU6 A;  1FL2 A;  4B69 A;  1NEN A;  1E1M A;  1PBC A;  3AE7 A;  5HHF A;  5KVI A;  2YVG A;  2VVL G;  3NN0 X;  2TMD A;  1N4V A;  1L9E A;  1GES A;  3LJP A;  3QVP A;  3GWF A;  4U2T A;  1Q9I A;  4H4Q A;  4EM4 A;  2BC1 A;  1S2Y A;  2YG3 A;  3D8X A;  4JN9 A;  4YSY A;  4C3X A;  1M6I A;  3K7Q X;  1Y56 A;  2V3A A;  4GF7 A;  4CCR A;  4EMJ A;  2VQ7 A;  1TDK A;  1BGJ A;  5J60 A;  3P4P A;  3Q6J A;  3IF9 A;  2X8H A;  2PHH A;  1K0L A;  2B76 A;  4EQW A;  4GCM A;  1MO9 A;  3FIM B;  5U63 A;  2Z5Y A;  1NDA A;  1BGN A;  4OPU A;  1GTH A;  2C3C A;  4EIQ A;  4YKG A;  1P2E A;  4Z24 A;  1FOH A;  1CBO A;  4H4Z A;  1VG9 A;  2QA1 A;  1ZMC A;  3NKS A;  3P4R A;  4EM3 A;  3ZYX A;  3UOX A;  1E39 A;  1Q1R A;  4TLX A;  2Y6R A;  1DXL A;  1D5T A;  1OJ9 A;  2JKC A;  3HZL A;  3Q9T A;  2WOV A;  1CC4 A;  3ALM A;  2JB1 A;  2X3N A;  3DJG X;  2VQB A;  2CUL A;  1PXB A;  2QA2 A;  4I58 A;  2JBV A;  1IUT A;  1LTX R;  2C66 A;  3KD9 A;  1EL7 A;  1SEZ A;  5JCM A;  4ZN0 A;  4OPC A;  3II4 A;  3ADA B;  2YR4 A;  3CNJ A;  4X4J A;  4Y4L A;  3SFE A;  1Z6L A;  4FK1 A;  3LZX A;  4ZCC A;  4AT0 A;  3DME A;  4RG3 A;  2WDR A;  2C65 A;  3GYJ A;  5LV9 A;  2GQF A;  5C2T A;  4AOS A;  3UKL A;  4H2P A;  2YLR A;  1NHS A;  1GET A;  2XVF A;  2O9Z A;  3AE3 A;  3LB8 A;  3K7M X;  4A5L A;  2OLN A;  4OPT A;  1O5W A;  4U8K A;  2Y6Q A;  2B9X A;  1XAN A;  2X99 A;  3IHM A;  1H83 A;  1H82 A;  4K2X A;  1D4E A;  2CFY A;  3SFD A;  2GMH A;  1N1P A;  2GVC A;  3NK0 X;  4A79 A;  2X8G A;  4WX1 A;  3FG2 P;  2YVJ A;  3P4S A;  4H4W A;  2VZ2 A;  4O5Q A;  2VRL A;  2WU5 A;  2E1M A;  4B66 A;  2BS3 A;  4PAB A;  3GDP A;  3AD7 B;  5DBJ A;  2H89 A;  3AYL A;  3ZDN A;  4BV6 A;  1E6E A;  2Q7V A;  3ICT A;  2YAU A;  4B64 A;  3CGC A;  4CRT A;  2BA9 A;  1BWC A;  4DNA A;  4LA1 A;  5KRQ A;  1YQZ A;  1KNP A;  1H84 A;  2V60 A;  3QFA A;  1IUW A;  1E1N A;  2YR6 A;  4JQ9 A;  3KLJ A;  3SM8 A;  4B68 A;  4NZH A;  1GEU A;  2WPE A;  3NNE A;  4BK1 A;  2YR5 A;  1ZKQ A;  4ECH A;  1GRA A;  1GPE A;  4I59 A;  2GH5 A;  3AYI A;  3QSM A;  3WE0 A;  3UKK A;  4J56 A;  4O5U A;  4E0V A;  2Z5X A;  4B1B A;  3VRB A;  1EL5 A;  3DJE A;  2BK5 A;  4OPD A;  3KU9 A;  1GXF A;  3AB1 A;  4OPI A;  3B6D A;  4AOX A;  3QFB A;  3C4N A;  4EIP A;  3KVE A;  2NPX A;  2WU2 A;  1ZX9 A;  3AED A;  3DGH A;  1F8S A;  3I3L A;  1COY A;  1TDO A;  1PXC A;  5CKU A;  1ELI A;  3JSK A;  2GB0 A;  3UP4 A;  1CC2 A;  3P9U A;  1QO8 A;  5BRT A;  2YQU A;  1IUU A;  3VR8 A;  3K7T A;  2C73 A;  3NYF A;  5HYM A;  1TDE A;  2RAB A;  2B7R A;  2YM1 A;  4GRT A;  5EOW A;  3UTF A;  4IA6 A;  4JNQ A;  2FJB A;  3AD8 B;  4IV9 A;  3AXB A;  4BJY A;  2GMJ A;  4UDP A;  2HQM A;  3G5Q A;  4N9X A;  4BJZ A;  1GRE A;  4JY3 A;  2Q0L A;  3CTY A;  2WP9 A;  4J57 A;  1IUS A;  3ISH A;  4H4P A;  1PBE A;  5TR3 A;  3VRD B;  2GR1 A;  4U8I A;  1E7P A;  2XFU A;  4LII A;  4EQX A;  4HB9 A;  4J36 A;  2I0Z A;  3K30 A;  2VOU A;  3GDN A;  4U2S A;  2YLS A;  2GF3 A;  4NTE A;  4USQ A;  3LXD A;  3S5W A;  4GR1 A;  5JCK A;  4OPG A;  5GRT A;  5C3J A;  1E1L A;  4FDC B;  3ATR A;  5J7X A;  3KA7 A;  3PVC A;  5U1O A;  4TLZ A;  5ER0 A;  1P2H A;  1X31 B;  2GAG B;  1JNR A;  4JDR A;  1FEB A;  1PBB A;  4P9S A;  1H86 A;  4TM4 A;  2GRT A;  5KXJ A;  1DOD A;  1PS9 A;  1K4Q A;  4X9N A;  5HXI A;  2F5Z A;  5HY5 A;  1GRG A;  3P4Q A;  3DH9 A;  1OJC A;  2A87 A;  2Q6U A;  1YQ3 A;  3RED A;  3SGL A;  4Z2T A;  4APN A;  1GV4 A;  4DGK A;  1ZOV A;  1TDN A;  2WS3 A;  1GRF A;  1VRQ B;  2WBA A;  4NEV A;  1DOE A;  1FEC A;  3AE2 A;  2YLX A;  3EF6 A;  1KNR A;  4BK3 A;  4Y4N A;  3NN6 X;  3UCL A;  2BS2 A;  1K0I A;  1BF3 A;  2C67 A;  2WEU A;  3V3N A;  3VQR A;  5IQ4 A;  3KKJ A;  3UKH A;  1M64 A;  2BXR A;  1JRX A;  3F8D A;  4X9M A;  2ZZC A;  4ZCD A;  3DJJ A;  5JCL A;  2OA1 A;  4H4T A;  3UKF A;  3UOY A;  2TPR A;  3GWD A;  4Z43 A;  2RGO A;  4AT2 A;  1EBD A;  5M0Z A;  2Q0K A;  1L0V A;  5BUK A;  4H7U A;  5CQF A;  4YSX A;  2ZZB A;  4KX6 A;  1H81 A;  1YKJ A;  4OCG A;  2C75 A;  2XVJ A;  1F3P A;  4A6N B;  4EQS A;  3UTG A;  3AEG A;  4DSG A;  4Z25 A;  1CC6 A;  3GRT A;  4H4S A;  1EL8 A;  1XDI A;  1GND A;  2XLS A;  4YTM A;  4B65 A;  1S3B A;  1GRH A;  4ICY A;  3GYI A;  1V59 A;  4IVM B;  4MJW A;  1HYU A;  1PBF A;  2OAL A;  3BI5 A;  3NHO X;  4M52 A;  3V3O A;  4YKF A;  3UP5 A;  3H8L A;  4GDP A;  1UKV G;  1B8S A;  1QJD A;  2YLZ A;  2V5Z A;  4A6N A;  4Z26 A;  3L8K A;  2FBW A;  2R0C A;  3BHK A;  2XLT A;  4EMW A;  3NRN A;  3QVR A;  3F8P A;  4FX9 A;  2YLW A;  3NLC A;  4C3Y A;  4CBQ A;  4A9W A;  4U8J A;  2B9W A;  4AP1 A;  4Z44 A;  2R9Z A;  3AEA A;  3S61 A;  1YY5 A;  3CNS A;  3D1C A;  2CVJ A;  2FJA A;  2V6O A;  4K8D A;  3UTH A;  1GAL A;  2XYO A;  3AEE A;  4GUV A;  4J31 A;  4C5O A;  1JRY A;  1DOB A;  1PXA A;  4K5R A;  2AQJ A;  3P1W A;  4IVO B;  4K5S A;  3C4A A;  2A8X A;  2WPF A;  1ZOY A;  1GSN A;  1VG0 A;  4YTN A;  2BK3 A;  3AE8 A;  3AE1 A;  3QSS A;  4A99 A;  5IPY A;  1OJD A;  5FMH A;  1BZL A;  3CPH G;  1D4D A;  1MXT A;  1JRZ A;  2E5V A;  2E4G A;  2PYX A;  2XLR A;  1LQT A;  3UOZ A;  4AP3 A;  4B63 A;  3QJ4 A;  2JB2 A;  3PS9 A;  1ZK7 A;  4CY6 A;  4A7A A;  5BVA A;  1GOS A;  4H4X A;  4J2W A;  4J33 A;  2YG4 A;  2H88 A;  3RP6 A;  1ONF A;  3FBS A;  4XXG A;  3CN8 A;  2R0G A;  3G5S A;  1XHC A;  3DGZ A;  3NTD A;  1OJA A;  1CL0 A;  2WDV A;  3DK8 A;  4U8P A; 
#chains in the Genus database with same CATH topology
 1ZDL A;  2QCU A;  4RSL A;  3OZ2 A;  4BK2 A;  4EMI A;  2R4J A;  2XVI A;  2W0H A;  2WET A;  3SYI A;  1S3E A;  4KPR A;  1NHR A;  3NH3 X;  2B9Y A;  4JNA A;  2V61 A;  4D03 A;  4CCQ A;  2BS4 A;  3BNU A;  1YQ4 A;  2C72 A;  1PJ6 A;  2JK6 A;  1O95 A;  4D04 A;  3DK4 A;  2WOW A;  3SQP A;  1XPQ A;  4OVI A;  2BK4 A;  1N4U A;  3BHF A;  4U8L A;  1LJ1 A;  3PO7 A;  3QSE A;  1ZMD A;  4H2Q A;  4H50 A;  3AEC A;  1LPF A;  2WP5 A;  3CGB A;  3UKP A;  3IC9 A;  2BYB A;  3ALL A;  2R0P A;  3GSI A;  4U8O A;  4TM0 A;  1H7X A;  1IUX A;  2NVK X;  5KOW A;  2FJE A;  5BUL A;  1PN0 A;  2RGH A;  4RG4 A;  1PJ7 A;  2C3D A;  1IJH A;  1KF6 A;  1H7W A;  1GTE A;  2IVE A;  4K22 A;  2X8C A;  5FS6 A;  1LQU A;  1FCD A;  2C70 A;  1JEH A;  1NHP A;  2WHD A;  4G6G A;  4REK A;  4II3 A;  3CIR A;  1H6V A;  1NG4 A;  1B5Q A;  1PJ5 A;  1KDG A;  2XCG A;  1B4V A;  2YG5 A;  3ALJ A;  1JNZ A;  3EAO A;  1CJC A;  3AEB A;  2BXS A;  3GD3 A;  3T37 A;  1F8R A;  4OPL A;  3CGD A;  3RNM A;  2WES A;  3R9U A;  2DKH A;  2CDU A;  1GRB A;  2VVM A;  2IVD A;  4YSZ A;  2XFN A;  2OLO A;  3SZC A;  1CJ3 A;  2AR8 A;  3NK2 X;  1E1K A;  2XDO A;  5IQ1 A;  5M10 A;  1RYI A;  1CJ4 A;  2ARD A;  3AEF A;  2R4E A;  4C74 A;  2FJD A;  5JCI A;  1B37 A;  1TDF A;  4HA6 A;  2BCG G;  3RP8 A;  3UOV A;  5EB5 A;  2R46 A;  3AWI A;  1W4X A;  2XLU A;  1KFY A;  1D4C A;  4FK1 C;  4NTC A;  3UKA A;  2EQ6 A;  4JY2 A;  4YXD A;  2B7S A;  1NEK A;  3C96 A;  3FPZ A;  2DKI A;  2YM2 A;  3LZW A;  2ZBW A;  1N4W A;  3O0H A;  3NT6 A;  4IA5 A;  3AE4 A;  4K7Z A;  5FS9 A;  4H4U A;  4XWZ A;  1TRB A;  4NEW A;  4XWR A;  3NIX A;  3SZW A;  3B3R A;  5FS7 A;  2R45 A;  5L46 A;  3FMW A;  3I6D A;  1S2Q A;  1GER A;  3IWA A;  4NTD A;  3RHA A;  4CNJ A;  3LAD A;  3NGC X;  1PDH A;  5U25 A;  3NTA A;  1KSU A;  1MOK A;  4BUR A;  2AAQ A;  1REO A;  3E1T A;  4A65 A;  2GR0 A;  4U2L A;  4UP3 A;  4DSH A;  2A89 A;  1GT8 A;  3GD4 A;  1CHU A;  1L9D A;  3AYJ A;  4H4V A;  3UTE A;  2GQW A;  3M0O A;  3EAN A;  3V76 A;  1D7Y A;  1Q1W A;  3AE5 A;  2BC0 A;  4J34 A;  2WQY A;  3GMB A;  2C7G A;  2RGJ A;  1ZY8 A;  5KMP A;  1CJ2 A;  3DJD A;  2YLT A;  3UKQ A;  1RP0 A;  1Y0P A;  3VRA A;  3EPT A;  2WPC A;  1PBD A;  1BKW A;  4EQR A;  2EQ7 A;  3GMC A;  2BRA A;  2GR3 A;  3CNP A;  3CPJ G;  1O94 A;  1NG3 A;  2WP6 A;  4YWO A;  5KWF A;  3DK9 A;  2VVL A;  1DJN A;  4ADW A;  2ZZ0 A;  4PAA A;  3COX A;  3NG7 X;  4U8M A;  2XVE A;  3H8I A;  4H2N A;  5KMR A;  3BI4 A;  3SZ0 A;  2YG6 A;  2IID A;  3NYE A;  1RSG A;  4H4Y A;  3CNT A;  3F8R A;  1JOA A;  2JAE A;  3ITJ A;  4GDE A;  3G5R A;  3ABV A;  3SY4 A;  2C76 A;  3H4K A;  3CND A;  4GAP A;  4YSH A;  4Z2U A;  2J3N A;  1KSS A;  4WCT A;  1K0J A;  2XFQ A;  4YTP A;  2GAH B;  2XVH A;  4UDR A;  4YT0 A;  2YWL A;  1AOG A;  3BNM A;  2JB3 A;  3ICR A;  3NK1 X;  5EBK A;  1DOC A;  5FS8 A;  3HYV A;  5JCN A;  2BCP A;  2VRM A;  2EQ8 A;  1DJQ A;  3AE9 A;  3URH A;  2APG A;  2OAM A;  1DNC A;  3AD9 B;  3IHG A;  3KPF A;  1ZP0 A;  2BAB A;  4NWZ A;  3BI2 A;  1L9C A;  4Z2R A;  1TYT A;  2X50 A;  2YG7 A;  1LVL A;  2WDQ A;  1NPX A;  1LV0 A;  2UZZ A;  4B67 A;  1VDC A;  4Y4M A;  2GR2 A;  3OC4 A;  1CF3 A;  3L1R A;  4H4R A;  4CY8 A;  1TYP A;  3ICS A;  4TM3 A;  3M12 A;  5EB4 A;  1EL9 A;  3ATQ A;  3VR9 A;  2EQ9 A;  1FEA A;  1QLB A;  1PHH A;  2QAE A;  1D7L A;  4USR A;  2BAC A;  2C64 A;  5KVH A;  1GRT A;  3RP7 A;  1F6M A;  4G74 A;  2XFP A;  4TM1 A;  1JU2 A;  1F8W A;  4C77 A;  1OJT A;  1VQW A;  4U8N A;  2ACZ A;  1Y56 B;  3AE6 A;  1IUV A;  3CGE A;  3CPI G;  3DA1 A;  3GRS A;  4H2R A;  2WOI A;  2GV8 A;  2XLP A;  2V3B A;  3LOV A;  3M13 A;  4UDQ A;  2XFO A;  5GSN A;  4CNK A;  5KOX A;  3NYC A;  2GEW A;  1NAA A;  2YVF A;  1NHQ A;  4LU6 A;  1FL2 A;  4B69 A;  1NEN A;  1E1M A;  1PBC A;  3AE7 A;  5HHF A;  5KVI A;  2YVG A;  2VVL G;  3NN0 X;  2TMD A;  1N4V A;  1L9E A;  1GES A;  3LJP A;  3QVP A;  3GWF A;  4U2T A;  1Q9I A;  4H4Q A;  4EM4 A;  2BC1 A;  1S2Y A;  2YG3 A;  3D8X A;  4JN9 A;  5KMS A;  5KNL A;  4YSY A;  3T31 A;  4C3X A;  1M6I A;  3K7Q X;  1Y56 A;  2V3A A;  4GF7 A;  4CCR A;  4EMJ A;  2VQ7 A;  1TDK A;  1BGJ A;  5J60 A;  3P4P A;  3Q6J A;  3IF9 A;  2X8H A;  2BRY A;  2PHH A;  1K0L A;  2B76 A;  4EQW A;  4GCM A;  1MO9 A;  3FIM B;  5U63 A;  2Z5Y A;  4NNJ A;  1NDA A;  1BGN A;  4OPU A;  1GTH A;  2C3C A;  4EIQ A;  4YKG A;  1P2E A;  4Z24 A;  1FOH A;  1CBO A;  4H4Z A;  1VG9 A;  2QA1 A;  1ZMC A;  3NKS A;  3P4R A;  4EM3 A;  3ZYX A;  3UOX A;  1E39 A;  1Q1R A;  4TLX A;  2Y6R A;  1DXL A;  1D5T A;  1OJ9 A;  2JKC A;  3HZL A;  3Q9T A;  3T2K A;  2WOV A;  1CC4 A;  3ALM A;  2JB1 A;  2X3N A;  3DJG X;  2VQB A;  2CUL A;  1PXB A;  2QA2 A;  4I58 A;  2JBV A;  1IUT A;  1LTX R;  2C66 A;  3KD9 A;  1EL7 A;  1SEZ A;  5JCM A;  4ZN0 A;  4OPC A;  3II4 A;  3ADA B;  2YR4 A;  3CNJ A;  4X4J A;  4Y4L A;  3SFE A;  1Z6L A;  3HYX A;  4FK1 A;  3LZX A;  4ZCC A;  4AT0 A;  3DME A;  4RG3 A;  2WDR A;  2C65 A;  3GYJ A;  5LV9 A;  2GQF A;  5C2T A;  4AOS A;  3UKL A;  4H2P A;  2YLR A;  1NHS A;  1GET A;  2XVF A;  2O9Z A;  3AE3 A;  3LB8 A;  3K7M X;  3SZF A;  2OLN A;  4OPT A;  1O5W A;  4U8K A;  4A5L A;  2Y6Q A;  2B9X A;  1XAN A;  2X99 A;  3IHM A;  1H83 A;  1H82 A;  4G9K A;  4K2X A;  1D4E A;  2CFY A;  3SFD A;  2GMH A;  1N1P A;  2GVC A;  3NK0 X;  4A79 A;  2X8G A;  4WX1 A;  3FG2 P;  2YVJ A;  3P4S A;  4H4W A;  4G73 A;  2VZ2 A;  4O5Q A;  2VRL A;  2WU5 A;  2E1M A;  4B66 A;  2BS3 A;  4PAB A;  3GDP A;  3AD7 B;  5DBJ A;  2H89 A;  3AYL A;  3ZDN A;  4BV6 A;  1E6E A;  2Q7V A;  3ICT A;  2YAU A;  4B64 A;  3CGC A;  4CRT A;  2BA9 A;  1BWC A;  4DNA A;  4LA1 A;  5KRQ A;  1YQZ A;  1KNP A;  1H84 A;  2V60 A;  3QFA A;  1IUW A;  1E1N A;  2YR6 A;  4JQ9 A;  3KLJ A;  3SM8 A;  4B68 A;  4NZH A;  1GEU A;  2WPE A;  3NNE A;  4BK1 A;  2YR5 A;  2C4C A;  1ZKQ A;  4ECH A;  1GRA A;  1GPE A;  4I59 A;  2GH5 A;  3AYI A;  3QSM A;  3WE0 A;  3UKK A;  4J56 A;  4O5U A;  4E0V A;  2Z5X A;  4B1B A;  3VRB A;  1EL5 A;  3DJE A;  2BK5 A;  4OPD A;  3KU9 A;  1GXF A;  3AB1 A;  4OPI A;  3B6D A;  4AOX A;  3QFB A;  3C4N A;  4EIP A;  3KVE A;  2NPX A;  2WU2 A;  1ZX9 A;  3AED A;  3DGH A;  1F8S A;  3I3L A;  1COY A;  1TDO A;  1PXC A;  5CKU A;  1ELI A;  3JSK A;  2GB0 A;  3UP4 A;  1CC2 A;  3P9U A;  1QO8 A;  5BRT A;  2YQU A;  1IUU A;  3VR8 A;  3K7T A;  2C73 A;  3NYF A;  5HYM A;  1TDE A;  2RAB A;  2B7R A;  2YM1 A;  4GRT A;  5EOW A;  3UTF A;  4IA6 A;  4JNQ A;  2FJB A;  3AD8 B;  4IV9 A;  3AXB A;  4BJY A;  3KPK A;  2GMJ A;  4UDP A;  2HQM A;  3G5Q A;  4N9X A;  4BJZ A;  1GRE A;  4JY3 A;  2Q0L A;  3CTY A;  2WP9 A;  4J57 A;  1IUS A;  3ISH A;  4H4P A;  1PBE A;  5TR3 A;  3VRD B;  2GR1 A;  4U8I A;  1E7P A;  2XFU A;  4LII A;  4EQX A;  4HB9 A;  4J36 A;  2I0Z A;  3K30 A;  2VOU A;  3GDN A;  4U2S A;  2YLS A;  2GF3 A;  4NTE A;  4USQ A;  3HYW A;  3LXD A;  3S5W A;  4GR1 A;  5JCK A;  4OPG A;  5GRT A;  5C3J A;  1E1L A;  4FDC B;  3ATR A;  5J7X A;  3KA7 A;  3PVC A;  5U1O A;  4TLZ A;  5ER0 A;  1P2H A;  1X31 B;  2GAG B;  1JNR A;  4JDR A;  1FEB A;  1PBB A;  3T14 A;  4P9S A;  1H86 A;  4TM4 A;  2GRT A;  5KXJ A;  1DOD A;  1PS9 A;  1K4Q A;  4X9N A;  5HXI A;  2F5Z A;  5HY5 A;  1GRG A;  3P4Q A;  3DH9 A;  1OJC A;  2A87 A;  2Q6U A;  1YQ3 A;  3RED A;  3SGL A;  3SX6 A;  4APN A;  4Z2T A;  1GV4 A;  4DGK A;  1ZOV A;  1TDN A;  2WS3 A;  1GRF A;  1VRQ B;  2WBA A;  4G6H A;  1DOE A;  3GYX A;  1FEC A;  4NEV A;  3AE2 A;  2YLX A;  3EF6 A;  1KNR A;  4BK3 A;  4Y4N A;  3NN6 X;  3UCL A;  2BS2 A;  1K0I A;  1BF3 A;  2C67 A;  2WEU A;  4II2 A;  3V3N A;  3VQR A;  3KKJ A;  3UKH A;  5IQ4 A;  1M64 A;  2BXR A;  1JRX A;  3F8D A;  4X9M A;  2ZZC A;  4ZCD A;  3DJJ A;  5JCL A;  4GAV A;  2OA1 A;  4H4T A;  3UKF A;  3UOY A;  2TPR A;  3GWD A;  4Z43 A;  2RGO A;  4AT2 A;  1EBD A;  5M0Z A;  2Q0K A;  1L0V A;  5BUK A;  4H7U A;  5CQF A;  4YSX A;  2ZZB A;  4KX6 A;  1H81 A;  1YKJ A;  4OCG A;  2C75 A;  2XVJ A;  1F3P A;  4A6N B;  4EQS A;  3UTG A;  3AEG A;  4DSG A;  4Z25 A;  1CC6 A;  3GRT A;  4H4S A;  1EL8 A;  1XDI A;  1GND A;  2XLS A;  4YTM A;  4B65 A;  1S3B A;  1GRH A;  4ICY A;  3GYI A;  1V59 A;  4IVM B;  4MJW A;  1HYU A;  1PBF A;  2OAL A;  3BI5 A;  3NHO X;  4M52 A;  3V3O A;  4YKF A;  3UP5 A;  3H8L A;  4GDP A;  1UKV G;  1B8S A;  1QJD A;  2YLZ A;  2V5Z A;  4A6N A;  4Z26 A;  3L8K A;  2FBW A;  2R0C A;  3BHK A;  2XLT A;  4EMW A;  3NRN A;  3QVR A;  3F8P A;  4FX9 A;  2YLW A;  3NLC A;  4C3Y A;  4CBQ A;  4A9W A;  4U8J A;  2B9W A;  4AP1 A;  4Z44 A;  2R9Z A;  3AEA A;  3S61 A;  1YY5 A;  3CNS A;  3D1C A;  2CVJ A;  2FJA A;  2V6O A;  4K8D A;  3T0K A;  1GAL A;  3UTH A;  2XYO A;  3AEE A;  4GUV A;  4J31 A;  4C5O A;  1JRY A;  1DOB A;  1PXA A;  4K5R A;  2AQJ A;  3P1W A;  4IVO B;  5KMQ A;  4K5S A;  3T2Z A;  3C4A A;  2A8X A;  2WPF A;  1ZOY A;  1GSN A;  1VG0 A;  4YTN A;  2BK3 A;  3AE8 A;  3AE1 A;  3QSS A;  4A99 A;  5IPY A;  3SXI A;  1OJD A;  5FMH A;  1BZL A;  3CPH G;  1D4D A;  1MXT A;  1JRZ A;  2E5V A;  2E4G A;  2PYX A;  2XLR A;  1LQT A;  3T2Y A;  3UOZ A;  4AP3 A;  4B63 A;  3QJ4 A;  2JB2 A;  3PS9 A;  1ZK7 A;  3CMM A;  4CY6 A;  4A7A A;  5BVA A;  1GOS A;  4H4X A;  4J2W A;  4J33 A;  2YG4 A;  2H88 A;  3RP6 A;  1ONF A;  3FBS A;  4XXG A;  3CN8 A;  2R0G A;  3G5S A;  1XHC A;  3DGZ A;  3NTD A;  1OJA A;  1CL0 A;  2WDV A;  3DK8 A;  4U8P A; 
#chains in the Genus database with same CATH homology
 1ZDL A;  2QCU A;  4RSL A;  3OZ2 A;  4BK2 A;  4EMI A;  2R4J A;  2XVI A;  2W0H A;  2WET A;  3SYI A;  1S3E A;  4KPR A;  1NHR A;  3NH3 X;  2B9Y A;  4JNA A;  2V61 A;  4D03 A;  4CCQ A;  2BS4 A;  3BNU A;  1YQ4 A;  2C72 A;  1PJ6 A;  2JK6 A;  1O95 A;  4D04 A;  3DK4 A;  2WOW A;  3SQP A;  1XPQ A;  4OVI A;  2BK4 A;  1N4U A;  3BHF A;  4U8L A;  1LJ1 A;  3PO7 A;  3QSE A;  1ZMD A;  4H2Q A;  4H50 A;  3AEC A;  1LPF A;  2WP5 A;  3CGB A;  3UKP A;  3IC9 A;  2BYB A;  3ALL A;  2R0P A;  3GSI A;  4U8O A;  4TM0 A;  1H7X A;  1IUX A;  2NVK X;  5KOW A;  2FJE A;  5BUL A;  1PN0 A;  2RGH A;  4RG4 A;  1PJ7 A;  2C3D A;  1IJH A;  1KF6 A;  1H7W A;  1GTE A;  2IVE A;  4K22 A;  2X8C A;  5FS6 A;  1LQU A;  1FCD A;  2C70 A;  1JEH A;  1NHP A;  2WHD A;  4G6G A;  4REK A;  4II3 A;  3CIR A;  1H6V A;  1NG4 A;  1B5Q A;  1PJ5 A;  1KDG A;  2XCG A;  1B4V A;  2YG5 A;  3ALJ A;  1JNZ A;  3EAO A;  1CJC A;  3AEB A;  2BXS A;  3GD3 A;  3T37 A;  1F8R A;  4OPL A;  3CGD A;  3RNM A;  2WES A;  3R9U A;  2DKH A;  2CDU A;  1GRB A;  2VVM A;  2IVD A;  4YSZ A;  2XFN A;  2OLO A;  3SZC A;  1CJ3 A;  2AR8 A;  3NK2 X;  1E1K A;  2XDO A;  5IQ1 A;  5M10 A;  1RYI A;  1CJ4 A;  2ARD A;  3AEF A;  2R4E A;  4C74 A;  2FJD A;  5JCI A;  1B37 A;  1TDF A;  4HA6 A;  2BCG G;  3RP8 A;  3UOV A;  5EB5 A;  2R46 A;  3AWI A;  1W4X A;  2XLU A;  1KFY A;  1D4C A;  4FK1 C;  4NTC A;  3UKA A;  2EQ6 A;  4JY2 A;  4YXD A;  2B7S A;  1NEK A;  3C96 A;  3FPZ A;  2DKI A;  2YM2 A;  3LZW A;  2ZBW A;  1N4W A;  3O0H A;  3NT6 A;  4IA5 A;  3AE4 A;  4K7Z A;  5FS9 A;  4H4U A;  4XWZ A;  1TRB A;  4NEW A;  4XWR A;  3NIX A;  3SZW A;  3B3R A;  5FS7 A;  2R45 A;  5L46 A;  3FMW A;  3I6D A;  1S2Q A;  1GER A;  3IWA A;  4NTD A;  3RHA A;  4CNJ A;  3LAD A;  3NGC X;  1PDH A;  5U25 A;  3NTA A;  1KSU A;  1MOK A;  4BUR A;  2AAQ A;  1REO A;  3E1T A;  4A65 A;  2GR0 A;  4U2L A;  4UP3 A;  4DSH A;  2A89 A;  1GT8 A;  3GD4 A;  1CHU A;  1L9D A;  3AYJ A;  4H4V A;  3UTE A;  2GQW A;  3M0O A;  3EAN A;  3V76 A;  1D7Y A;  1Q1W A;  3AE5 A;  2BC0 A;  4J34 A;  2WQY A;  3GMB A;  2C7G A;  2RGJ A;  1ZY8 A;  5KMP A;  1CJ2 A;  3DJD A;  2YLT A;  3UKQ A;  1RP0 A;  1Y0P A;  3VRA A;  3EPT A;  2WPC A;  1PBD A;  1BKW A;  4EQR A;  2EQ7 A;  3GMC A;  2BRA A;  2GR3 A;  3CNP A;  3CPJ G;  1O94 A;  1NG3 A;  2WP6 A;  4YWO A;  5KWF A;  3DK9 A;  2VVL A;  1DJN A;  4ADW A;  2ZZ0 A;  4PAA A;  3COX A;  3NG7 X;  4U8M A;  2XVE A;  3H8I A;  4H2N A;  5KMR A;  3BI4 A;  3SZ0 A;  2YG6 A;  2IID A;  3NYE A;  1RSG A;  4H4Y A;  3CNT A;  3F8R A;  1JOA A;  2JAE A;  3ITJ A;  4GDE A;  3G5R A;  3ABV A;  3SY4 A;  2C76 A;  3H4K A;  3CND A;  4GAP A;  4YSH A;  4Z2U A;  2J3N A;  1KSS A;  4WCT A;  1K0J A;  2XFQ A;  4YTP A;  2GAH B;  2XVH A;  4UDR A;  4YT0 A;  2YWL A;  1AOG A;  3BNM A;  2JB3 A;  3ICR A;  3NK1 X;  5EBK A;  1DOC A;  5FS8 A;  3HYV A;  5JCN A;  2BCP A;  2VRM A;  2EQ8 A;  1DJQ A;  3AE9 A;  3URH A;  2APG A;  2OAM A;  1DNC A;  3AD9 B;  3IHG A;  3KPF A;  1ZP0 A;  2BAB A;  4NWZ A;  3BI2 A;  1L9C A;  4Z2R A;  1TYT A;  2X50 A;  2YG7 A;  1LVL A;  2WDQ A;  1NPX A;  1LV0 A;  2UZZ A;  4B67 A;  1VDC A;  4Y4M A;  2GR2 A;  3OC4 A;  1CF3 A;  3L1R A;  4H4R A;  4CY8 A;  1TYP A;  3ICS A;  4TM3 A;  3M12 A;  5EB4 A;  1EL9 A;  3ATQ A;  3VR9 A;  2EQ9 A;  1FEA A;  1QLB A;  1PHH A;  2QAE A;  1D7L A;  4USR A;  2BAC A;  2C64 A;  5KVH A;  1GRT A;  3RP7 A;  1F6M A;  4G74 A;  2XFP A;  4TM1 A;  1JU2 A;  1F8W A;  4C77 A;  1OJT A;  1VQW A;  4U8N A;  2ACZ A;  1Y56 B;  3AE6 A;  1IUV A;  3CGE A;  3CPI G;  3DA1 A;  3GRS A;  4H2R A;  2WOI A;  2GV8 A;  2XLP A;  2V3B A;  3LOV A;  3M13 A;  4UDQ A;  2XFO A;  5GSN A;  4CNK A;  5KOX A;  3NYC A;  2GEW A;  1NAA A;  2YVF A;  1NHQ A;  4LU6 A;  1FL2 A;  4B69 A;  1NEN A;  1E1M A;  1PBC A;  3AE7 A;  5HHF A;  5KVI A;  2YVG A;  2VVL G;  3NN0 X;  2TMD A;  1N4V A;  1L9E A;  1GES A;  3LJP A;  3QVP A;  3GWF A;  4U2T A;  1Q9I A;  4H4Q A;  4EM4 A;  2BC1 A;  1S2Y A;  2YG3 A;  3D8X A;  4JN9 A;  5KMS A;  5KNL A;  4YSY A;  3T31 A;  4C3X A;  1M6I A;  3K7Q X;  1Y56 A;  2V3A A;  4GF7 A;  4CCR A;  4EMJ A;  2VQ7 A;  1TDK A;  1BGJ A;  5J60 A;  3P4P A;  3Q6J A;  3IF9 A;  2X8H A;  2BRY A;  2PHH A;  1K0L A;  2B76 A;  4EQW A;  4GCM A;  1MO9 A;  3FIM B;  5U63 A;  2Z5Y A;  4NNJ A;  1NDA A;  1BGN A;  4OPU A;  1GTH A;  2C3C A;  4EIQ A;  4YKG A;  1P2E A;  4Z24 A;  1FOH A;  1CBO A;  4H4Z A;  1VG9 A;  2QA1 A;  1ZMC A;  3NKS A;  3P4R A;  4EM3 A;  3ZYX A;  3UOX A;  1E39 A;  1Q1R A;  4TLX A;  2Y6R A;  1DXL A;  1D5T A;  1OJ9 A;  2JKC A;  3HZL A;  3Q9T A;  3T2K A;  2WOV A;  1CC4 A;  3ALM A;  2JB1 A;  2X3N A;  3DJG X;  2VQB A;  2CUL A;  1PXB A;  2QA2 A;  4I58 A;  2JBV A;  1IUT A;  1LTX R;  2C66 A;  3KD9 A;  1EL7 A;  1SEZ A;  5JCM A;  4ZN0 A;  4OPC A;  3II4 A;  3ADA B;  2YR4 A;  3CNJ A;  4X4J A;  4Y4L A;  3SFE A;  1Z6L A;  3HYX A;  4FK1 A;  3LZX A;  4ZCC A;  4AT0 A;  3DME A;  4RG3 A;  2WDR A;  2C65 A;  3GYJ A;  5LV9 A;  2GQF A;  5C2T A;  4AOS A;  3UKL A;  4H2P A;  2YLR A;  1NHS A;  1GET A;  2XVF A;  2O9Z A;  3AE3 A;  3LB8 A;  3K7M X;  3SZF A;  2OLN A;  4OPT A;  1O5W A;  4U8K A;  4A5L A;  2Y6Q A;  2B9X A;  1XAN A;  2X99 A;  3IHM A;  1H83 A;  1H82 A;  4G9K A;  4K2X A;  1D4E A;  2CFY A;  3SFD A;  2GMH A;  1N1P A;  2GVC A;  3NK0 X;  4A79 A;  2X8G A;  4WX1 A;  3FG2 P;  2YVJ A;  3P4S A;  4H4W A;  4G73 A;  2VZ2 A;  4O5Q A;  2VRL A;  2WU5 A;  2E1M A;  4B66 A;  2BS3 A;  4PAB A;  3GDP A;  3AD7 B;  5DBJ A;  2H89 A;  3AYL A;  3ZDN A;  4BV6 A;  1E6E A;  2Q7V A;  3ICT A;  2YAU A;  4B64 A;  3CGC A;  4CRT A;  2BA9 A;  1BWC A;  4DNA A;  4LA1 A;  5KRQ A;  1YQZ A;  1KNP A;  1H84 A;  2V60 A;  3QFA A;  1IUW A;  1E1N A;  2YR6 A;  4JQ9 A;  3KLJ A;  3SM8 A;  4B68 A;  4NZH A;  1GEU A;  2WPE A;  3NNE A;  4BK1 A;  2YR5 A;  2C4C A;  1ZKQ A;  4ECH A;  1GRA A;  1GPE A;  4I59 A;  2GH5 A;  3AYI A;  3QSM A;  3WE0 A;  3UKK A;  4J56 A;  4O5U A;  4E0V A;  2Z5X A;  4B1B A;  3VRB A;  1EL5 A;  3DJE A;  2BK5 A;  4OPD A;  3KU9 A;  1GXF A;  3AB1 A;  4OPI A;  3B6D A;  4AOX A;  3QFB A;  3C4N A;  4EIP A;  3KVE A;  2NPX A;  2WU2 A;  1ZX9 A;  3AED A;  3DGH A;  1F8S A;  3I3L A;  1COY A;  1TDO A;  1PXC A;  5CKU A;  1ELI A;  3JSK A;  2GB0 A;  3UP4 A;  1CC2 A;  3P9U A;  1QO8 A;  5BRT A;  2YQU A;  1IUU A;  3VR8 A;  3K7T A;  2C73 A;  3NYF A;  5HYM A;  1TDE A;  2RAB A;  2B7R A;  2YM1 A;  4GRT A;  5EOW A;  3UTF A;  4IA6 A;  4JNQ A;  2FJB A;  3AD8 B;  4IV9 A;  3AXB A;  4BJY A;  3KPK A;  2GMJ A;  4UDP A;  2HQM A;  3G5Q A;  4N9X A;  4BJZ A;  1GRE A;  4JY3 A;  2Q0L A;  3CTY A;  2WP9 A;  4J57 A;  1IUS A;  3ISH A;  4H4P A;  1PBE A;  5TR3 A;  3VRD B;  2GR1 A;  4U8I A;  1E7P A;  2XFU A;  4LII A;  4EQX A;  4HB9 A;  4J36 A;  2I0Z A;  3K30 A;  2VOU A;  3GDN A;  4U2S A;  2YLS A;  2GF3 A;  4NTE A;  4USQ A;  3HYW A;  3LXD A;  3S5W A;  4GR1 A;  5JCK A;  4OPG A;  5GRT A;  5C3J A;  1E1L A;  4FDC B;  3ATR A;  5J7X A;  3KA7 A;  3PVC A;  5U1O A;  4TLZ A;  5ER0 A;  1P2H A;  1X31 B;  2GAG B;  1JNR A;  4JDR A;  1FEB A;  1PBB A;  3T14 A;  4P9S A;  1H86 A;  4TM4 A;  2GRT A;  5KXJ A;  1DOD A;  1PS9 A;  1K4Q A;  4X9N A;  5HXI A;  2F5Z A;  5HY5 A;  1GRG A;  3P4Q A;  3DH9 A;  1OJC A;  2A87 A;  2Q6U A;  1YQ3 A;  3RED A;  3SGL A;  3SX6 A;  4APN A;  4Z2T A;  1GV4 A;  4DGK A;  1ZOV A;  1TDN A;  2WS3 A;  1GRF A;  1VRQ B;  2WBA A;  4G6H A;  1DOE A;  3GYX A;  1FEC A;  4NEV A;  3AE2 A;  2YLX A;  3EF6 A;  1KNR A;  4BK3 A;  4Y4N A;  3NN6 X;  3UCL A;  2BS2 A;  1K0I A;  1BF3 A;  2C67 A;  2WEU A;  4II2 A;  3V3N A;  3VQR A;  3KKJ A;  3UKH A;  5IQ4 A;  1M64 A;  2BXR A;  1JRX A;  3F8D A;  4X9M A;  2ZZC A;  4ZCD A;  3DJJ A;  5JCL A;  4GAV A;  2OA1 A;  4H4T A;  3UKF A;  3UOY A;  2TPR A;  3GWD A;  4Z43 A;  2RGO A;  4AT2 A;  1EBD A;  5M0Z A;  2Q0K A;  1L0V A;  5BUK A;  4H7U A;  5CQF A;  4YSX A;  2ZZB A;  4KX6 A;  1H81 A;  1YKJ A;  4OCG A;  2C75 A;  2XVJ A;  1F3P A;  4A6N B;  4EQS A;  3UTG A;  3AEG A;  4DSG A;  4Z25 A;  1CC6 A;  3GRT A;  4H4S A;  1EL8 A;  1XDI A;  1GND A;  2XLS A;  4YTM A;  4B65 A;  1S3B A;  1GRH A;  4ICY A;  3GYI A;  1V59 A;  4IVM B;  4MJW A;  1HYU A;  1PBF A;  2OAL A;  3BI5 A;  3NHO X;  4M52 A;  3V3O A;  4YKF A;  3UP5 A;  3H8L A;  4GDP A;  1UKV G;  1B8S A;  1QJD A;  2YLZ A;  2V5Z A;  4A6N A;  4Z26 A;  3L8K A;  2FBW A;  2R0C A;  3BHK A;  2XLT A;  4EMW A;  3NRN A;  3QVR A;  3F8P A;  4FX9 A;  2YLW A;  3NLC A;  4C3Y A;  4CBQ A;  4A9W A;  4U8J A;  2B9W A;  4AP1 A;  4Z44 A;  2R9Z A;  3AEA A;  3S61 A;  1YY5 A;  3CNS A;  3D1C A;  2CVJ A;  2FJA A;  2V6O A;  4K8D A;  3T0K A;  1GAL A;  3UTH A;  2XYO A;  3AEE A;  4GUV A;  4J31 A;  4C5O A;  1JRY A;  1DOB A;  1PXA A;  4K5R A;  2AQJ A;  3P1W A;  4IVO B;  5KMQ A;  4K5S A;  3T2Z A;  3C4A A;  2A8X A;  2WPF A;  1ZOY A;  1GSN A;  1VG0 A;  4YTN A;  2BK3 A;  3AE8 A;  3AE1 A;  3QSS A;  4A99 A;  5IPY A;  3SXI A;  1OJD A;  5FMH A;  1BZL A;  3CPH G;  1D4D A;  1MXT A;  1JRZ A;  2E5V A;  2E4G A;  2PYX A;  2XLR A;  1LQT A;  3T2Y A;  3UOZ A;  4AP3 A;  4B63 A;  3QJ4 A;  2JB2 A;  3PS9 A;  1ZK7 A;  3CMM A;  4CY6 A;  4A7A A;  5BVA A;  1GOS A;  4H4X A;  4J2W A;  4J33 A;  2YG4 A;  2H88 A;  3RP6 A;  1ONF A;  3FBS A;  4XXG A;  3CN8 A;  2R0G A;  3G5S A;  1XHC A;  3DGZ A;  3NTD A;  1OJA A;  1CL0 A;  2WDV A;  3DK8 A;  4U8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...