4UP3A

Crystal structure of the mutant c140s,c286q thioredoxin reductase from entamoeba histolytica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
312
Chain Sequence
NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSASAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVQDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 99
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4up3A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4up3A02
5BULA 4LU6A 1GOSA 4ADWA 4J36A 1OJAA 2H88A 1CHUA 4BJZA 4H2QA 2B9YA 2BA9A 2YAUA 4FDCB 4JDRA 4U8MA 4WX1A 5ER0A 3UP5A 3KU9A 3NHOX 1E7PA 4U8JA 3UTEA 4J34A 2JB1A 4AOXA 2BABA 3CGBA 4B65A 3B6DA 1XANA 4IVOB 5JCNA 1GNDA 1JRXA 3BNMA 1IUXA 5LV9A 2BCPA 3URHA 1XHCA 2FJEA 1PS9A 3CPIG 1L9CA 1CL0A 1VDCA 4H4WA 3NG7X 1PXCA 2GEWA 4UDRA 4KPRA 5FMHA 1O95A 2YG4A 2C3CA 4U8KA 5L46A 4CRTA 3AE7A 3ATRA 1GEUA 1TDFA 3AE2A 1D7YA 1H82A 2Q6UA 5FS8A 2XVJA 1TYPA 2Z5YA 4EMJA 2WP9A 1ZOVA 2O9ZA 5IQ1A 2GV8A 1H6VA 2C75A 3H8IA 4J57A 3K7MX 4RG3A 2GF3A 1RYIA 4CCQA 3RHAA 2JB2A 3KKJA 3NYFA 3QVPA 5TR3A 4DSHA 4Z2UA 1PBBA 2XLRA 2R0PA 5CQFA 2QA1A 4B1BA 2XFNA 3G5RA 3DH9A 4H4PA 1LQTA 4IA6A 2CFYA 3LZXA 2JBVA 1H7XA 4Z24A 2Q0KA 4LIIA 1N4WA 3P9UA 2V5ZA 1IJHA 4BJYA 1H83A 3AYLA 4TLXA 4OPUA 3GRTA 2OAMA 3FIMB 4OPGA 2YVGA 2AQJA 4NTDA 2C73A 2Q7VA 1LV0A 3DJDA 3CNTA 3IF9A 3ALLA 4H4TA 4USRA 2C70A 4IV9A 1YKJA 2BS2A 1PJ7A 1XPQA 2GVCA 3FPZA 3EF6A 1F8WA 2F5ZA 2YWLA 2OLOA 2YM2A 1LTXR 1VQWA 2AAQA 3KD9A 4PABA 5U63A 4C3XA 4EQRA 1B4VA 1VG9A 3H4KA 2VVMA 3K30A 1B37A 1LJ1A 3I3LA 4N9XA 4XXGA 1GRFA 1YQ4A 3OZ2A 1NDAA 2B7RA 4NEWA 2YLTA 1IUUA 3UTGA 2NVKX 4RG4A 1NHPA 3DA1A 4C74A 3CNSA 4Z26A 4GCMA 5KWFA 3G5QA 2XFUA 4H2RA 2XFQA 1BF3A 2JB3A 5KOWA 3P4PA 4OPLA 3CPHG 1GRBA 4GDPA 3EAOA 3F8DA 3AECA 2WPFA 3WE0A 1QJDA 2J3NA 4UDPA 2WQYA 1F6MA 2YG3A 5KVIA 1H7WA 3SFEA 2APGA 4UP3A 1GREA 1GTEA 2YQUA 3P1WA 1LVLA 4H2NA 1B8SA 3AD7B 4H4UA 1PBFA 3D8XA 1EL7A 1GT8A 1HYUA 1OJCA 1M6IA 2WPEA 2YR5A 1YQZA 2A87A 3DK9A 1BGNA 3ISHA 3QSEA 4EMIA 4YSHA 1DOCA 4U2SA 1NHQA 4TM4A 4YKGA 4FK1C 3GD4A 2H89A 1XDIA 1GRTA 3II4A 2GAGB 3NN0X 2C66A 4H4VA 2R4EA 1GTHA 4H4RA 1L0VA 4CBQA 2ACZA 4OPIA 3ICTA 3OC4A 3ZYXA 3V3OA 2Q0LA 2EQ9A 3VRAA 1FECA 2GMJA 3GD3A 4JN9A 4AT0A 3COXA 3AE1A 4PAAA 5J7XA 4EIQA 1GETA 2ZZCA 1IUSA 1DJNA 3QFAA 5M0ZA 2BXSA 3Q9TA 2GMHA 5FS7A 5JCIA 1KDGA 3F8RA 1O94A 2WDRA 3L8KA 3G5SA 2ZZBA 3ICSA 3M0OA 4J33A 1QLBA 2OA1A 2FJAA 2GR1A 1ZDLA 2XFOA 1IUWA 2XLPA 2E1MA 3AEBA 4HA6A 2XVFA 1RSGA 2GR3A 5KOXA 2WEUA 3UKHA 1S3EA 3L1RA 3VR9A 2JAEA 1E1MA 3GDPA 1GERA 2R4JA 4EQXA 5U25A 1X31B 3NK1X 4H4ZA 4H2PA 3DJJA 1TRBA 2WOVA 1CC4A 2WU5A 2TPRA 2XVHA 4U8NA 2E5VA 3UOZA 1JNZA 4A5LA 4DSGA 4B67A 4EQSA 3UKQA 2BS3A 1BZLA 4H4SA 2YG7A 2JKCA 3NYCA 3UOYA 1N4VA 3CNDA 2YR6A 4DGKA 5M10A 1F3PA 2QA2A 4BK2A 4ICYA 1GALA 2PYXA 3QFBA 5CKUA 1O5WA 3NLCA 4JNAA 3R9UA 3AE3A 1NHSA 1NG4A 3IHGA 2YLRA 3VQRA 4DNAA 2ARDA 3RP7A 2XLTA 4BURA 1Y56B 1TDKA 1Z6LA 2RGHA 2X8HA 4X9NA 1GRGA 2XVEA 2R0GA 3V3NA 4REKA 2VRLA 2CVJA 3NH3X 1ZP0A 3CGDA 4ZCCA 3UOVA 5IQ4A 4J56A 1Q1RA 4ECHA 1PBDA 4X9MA 1F8SA 1GV4A 1KNPA 4K5RA 1UKVG 3GYJA 4GUVA 4GRTA 3RP8A 4OCGA 4YSYA 4OVIA 3CNJA 4YTMA 2X99A 3DGHA 4OPTA 2BK5A 4B64A 4H4QA 1K4QA 2C72A 5JCKA 2BCGG 4UDQA 2W0HA 2XDOA 1JRYA 1D4DA 1SEZA 5EBKA 1V59A 1JU2A 2XYOA 2UZZA 3ITJA 3NT6A 3JSKA 1PJ6A 3QSMA 1QO8A 4XWRA 2VZ2A 3GSIA 3B3RA 3NKSA 3AWIA 2X50A 2X3NA 1FOHA 2CDUA 1BWCA 3CNPA 4WCTA 1IUVA 3P4QA 1DNCA 5FS9A 2V3AA 1KFYA 1KSUA 2GH5A 3NNEA 4YTPA 1DODA 3I6DA 1Y56A 1L9EA 2XLUA 2WESA 2GQWA 1DJQA 4B66A 2A8XA 2IVEA 3FG2P 4K8DA 2YM1A 3AYJA 3GRSA 3NK2X 4U2LA 1VRQB 2EQ7A 3AE5A 1DXLA 3CPJG 2R9ZA 3C4NA 1NPXA 3GWFA 3SQPA 3S5WA 3BI5A 2V61A 1E39A 3LOVA 1LQUA 3REDA 4Z2RA 2V60A 4U2TA 1M64A 1ZX9A 2RABA 4JNQA 3P4RA 2YVFA 4CY6A 4EQWA 3IC9A 4B69A 2QAEA 3V76A 4HB9A 1NHRA 4D04A 2WOWA 1K0IA 2GR2A 4IA5A 3DJGX 3KVEA 1E1NA 2C7GA 4H7UA 4AT2A 1PBEA 2JK6A 3BHKA 5KRQA 2Y6RA 3AEFA 4YT0A 1KF6A 3T37A 3UP4A 2CULA 4BK1A 1EBDA 5EB5A 2GB0A 3AE8A 2BS4A 2XCGA 4U8OA 4IVMB 1H86A 2WETA 2WP5A 4USQA 3VRDB 4Y4NA 1CJCA 3AEDA 1GRHA 2WHDA 3ABVA 3NTAA 3GMCA 4Z44A 3CGEA 1CBOA 3GMBA 1VG0A 4OPCA 4CNKA 2FJBA 5U1OA 1ONFA 1ZKQA 3BNUA 2EQ6A 5EB4A 3VR8A 4ZN0A 2FJDA 3ADAB 3BI2A 4C5OA 3QJ4A 4TLZA 2R46A 1ELIA 3H8LA 4J2WA 5GSNA 1FCDA 4YSZA 4NTCA 1COYA 4GR1A 4BK3A 4BV6A 1FEAA 2DKHA 5KVHA 2YLSA 5DBJA 3NK0X 4Z43A 2QCUA 2R0CA 2RGOA 1EL5A 2BC0A 2WDVA 4EMWA 1L9DA 2XFPA 4D03A 1N4UA 2BACA 4YKFA 2AR8A 2YLXA 1DOEA 3DK8A 2RGJA 4A7AA 3GWDA 1Y0PA 3SGLA 3BI4A 1EL9A 3SM8A 3LXDA 3FBSA 1DOBA 4E0VA 2V3BA 5JCMA 1S2YA 2X8CA 3ALJA 3M13A 5HY5A 4H4XA 3NTDA 1OJ9A 3RP6A 3UTFA 2C64A 1JRZA 2X8GA 3CGCA 3ICRA 3UKKA 5HYMA 3AB1A 2A89A 1GRAA 4K2XA 4H4YA 5C3JA 2NPXA 3NIXA 2GR0A 3UCLA 5FS6A 2C3DA 4TM1A 4JQ9A 4O5QA 1F8RA 1GXFA 1JNRA 3M12A 3UOXA 4A6NB 1PHHA 1B5QA 3UTHA 4CCRA 3D1CA 1JEHA 2PHHA 4A65A 1KSSA 2YVJA 2Y6QA 3QSSA 3LADA 3LJPA 3KA7A 3AEGA 3QVRA 2YR4A 1H84A 1ZMDA 2WPCA 3AD8B 1PJ5A 2V6OA 2VVLA 3AEAA 2YG6A 3F8PA 2FBWA 2WP6A 3ZDNA 2BK4A 2OLNA 2C65A 1N1PA 2BC1A 2WBAA 4JY3A 4NTEA 3AYIA 2IIDA 1D4EA 2WDQA 1S2QA 2BYBA 3IHMA 4AOSA 1K0JA 2WOIA 4EM4A 1E1KA 1PXBA 3AXBA 4H50A 1MO9A 1PXAA 2VRMA 3KPFA 4U8LA 4TM3A 2VQ7A 3AE6A 3LZWA 1CJ4A 1REOA 4A6NA 2B9WA 3LB8A 4A9WA 4RSLA 3C96A 1Q1WA 4FK1A 1YQ3A 1KNRA 4YTNA 2B7SA 1CJ2A 1K0LA 1PBCA 3UKPA 5JCLA 3IWAA 1NAAA 3PS9A 4J31A 4OPDA 4MJWA 1W4XA 4I59A 3NGCX 4C3YA 2TMDA 3AE4A 3NRNA 2OALA 3AEEA 1BKWA 4LA1A 1AOGA 5EOWA 2YLZA 5HXIA 1CF3A 2B9XA 2BXRA 3P4SA 3AE9A 4TM0A 3RNMA 4CNJA 3CIRA 4ZCDA 1D5TA 1NENA 1E6EA 3NN6X 1FL2A 4P9SA 3UKLA 4YSXA 4YXDA 2GRTA 2VVLG 1E1LA 1TDOA 4CY8A 2VQBA 4GDEA 4K5SA 2B76A 2E4GA 5KXJA 1GESA 3DJEA 1D4CA 3SFDA 2HQMA 4U8PA 3K7QX 4B63A 3EPTA 1CJ3A 2Z5XA 3GDNA 5BRTA 2WS3A 3HZLA 2VOUA 1MXTA 2XLSA 2IVDA 1CC2A 4C77A 2I0ZA 4A79A 2YLWA 3ALMA 4M52A 1P2HA 4Z2TA 4APNA 3PVCA 1ZY8A 1H81A 1PN0A 3CN8A 1OJTA 1IUTA 3K7TA 5GRTA 3EANA 4NEVA 4KX6A 5BUKA 3FMWA 4GF7A 4XWZA 1TYTA 4AP3A 3NYEA 3S61A 2ZZ0A 4B68A 3PO7A 1D7LA 3KLJA 3Q6JA 1GSNA 3VRBA 1Q9IA 4A99A 3C4AA 1BGJA 1OJDA 2R45A 1ZK7A 2WU2A 4Y4MA 1YY5A 1NEKA 2C76A 2ZBWA 4Z25A 4YWOA 1CC6A 1MOKA 4JY2A 3GYIA 3E1TA 4Y4LA 1JOAA 4FX9A 4X4JA 2XVIA 2GAHB 4U8IA 3UKFA 4K7ZA 2BK3A 5HHFA 1TDEA 1NG3A 3CTYA 2DKIA 4EIPA 1ZOYA 1GPEA 5J60A 3DGZA 4NZHA 3DMEA 1ZMCA 2GQFA 3O0HA 4K22A 3UKAA 2EQ8A 1S3BA 5IPYA 3DK4A 4I58A 1LPFA 1TDNA 5C2TA 1RP0A 2YG5A 3AD9B 4AP1A 1EL8A 4O5UA 1FEBA 3BHFA 5BVAA 3ATQA 4EM3A 2C67A 1P2EA 1PDHA
chains in the Genus database with same CATH superfamily
5BULA 4LU6A 1GOSA 4ADWA 4J36A 1OJAA 2H88A 1CHUA 4BJZA 4H2QA 2B9YA 2BA9A 2YAUA 4FDCB 4JDRA 4U8MA 4WX1A 5ER0A 3SZCA 3UP5A 3KU9A 3NHOX 1E7PA 4U8JA 3UTEA 4J34A 2JB1A 4AOXA 2BABA 3CGBA 4B65A 3B6DA 1XANA 4IVOB 5JCNA 1GNDA 1JRXA 3BNMA 1IUXA 5LV9A 2BCPA 3URHA 1XHCA 2FJEA 1PS9A 3CPIG 1L9CA 1CL0A 1VDCA 4H4WA 3NG7X 1PXCA 2GEWA 4II3A 4UDRA 4KPRA 5KNLA 5FMHA 1O95A 2YG4A 2C3CA 4U8KA 5L46A 4CRTA 3AE7A 3ATRA 1GEUA 1TDFA 3AE2A 1D7YA 1H82A 2Q6UA 5FS8A 2XVJA 1TYPA 2Z5YA 4EMJA 2WP9A 1ZOVA 2O9ZA 5IQ1A 2GV8A 1H6VA 2C75A 3H8IA 4J57A 3K7MX 4RG3A 2GF3A 1RYIA 4CCQA 3RHAA 2JB2A 3KKJA 3NYFA 3QVPA 5TR3A 4DSHA 4Z2UA 1PBBA 2XLRA 2R0PA 5CQFA 2QA1A 4B1BA 3GYXA 2XFNA 3G5RA 4GAPA 3DH9A 4H4PA 1LQTA 4IA6A 2CFYA 3LZXA 2JBVA 1H7XA 4Z24A 2Q0KA 4LIIA 1N4WA 3P9UA 2V5ZA 1IJHA 4BJYA 1H83A 3AYLA 4TLXA 4OPUA 3SZ0A 3CMMA 3GRTA 2OAMA 3FIMB 4OPGA 2YVGA 2C4CA 2AQJA 4NTDA 2C73A 2Q7VA 1LV0A 3DJDA 3CNTA 3IF9A 3ALLA 4H4TA 4USRA 2C70A 4IV9A 1YKJA 2BS2A 1PJ7A 1XPQA 2GVCA 3FPZA 3T2YA 3EF6A 1F8WA 2F5ZA 2YWLA 2OLOA 2YM2A 1LTXR 1VQWA 2AAQA 3KD9A 4PABA 5U63A 4C3XA 4EQRA 1B4VA 1VG9A 3H4KA 2VVMA 3K30A 1B37A 1LJ1A 3I3LA 4N9XA 4NNJA 4XXGA 1GRFA 1YQ4A 3OZ2A 1NDAA 2B7RA 4NEWA 3T31A 2YLTA 1IUUA 3UTGA 2NVKX 4RG4A 1NHPA 3DA1A 4C74A 3CNSA 4Z26A 4GCMA 5KWFA 3G5QA 2XFUA 4H2RA 2XFQA 1BF3A 2JB3A 5KOWA 3P4PA 4OPLA 3CPHG 1GRBA 3T0KA 4GDPA 3EAOA 3F8DA 3AECA 2WPFA 3WE0A 3HYVA 1QJDA 2J3NA 4UDPA 2WQYA 1F6MA 2YG3A 5KVIA 1H7WA 3SFEA 2APGA 4UP3A 1GREA 1GTEA 2YQUA 3P1WA 1LVLA 3HYXA 4H2NA 1B8SA 3AD7B 4H4UA 1PBFA 3D8XA 1EL7A 1GT8A 1HYUA 1OJCA 1M6IA 2WPEA 2YR5A 1YQZA 2A87A 3DK9A 1BGNA 3ISHA 3QSEA 4EMIA 4YSHA 1DOCA 4II2A 4U2SA 1NHQA 4TM4A 4YKGA 4FK1C 3GD4A 2H89A 1XDIA 1GRTA 3II4A 2GAGB 3NN0X 2C66A 4H4VA 2R4EA 1GTHA 4H4RA 1L0VA 4CBQA 2ACZA 4OPIA 3ICTA 3OC4A 3ZYXA 3V3OA 2Q0LA 2EQ9A 3VRAA 1FECA 2GMJA 3GD3A 4JN9A 4AT0A 3SYIA 3COXA 3T2ZA 3AE1A 4PAAA 5J7XA 4EIQA 1GETA 2ZZCA 1IUSA 1DJNA 3QFAA 5M0ZA 2BXSA 3Q9TA 2GMHA 5FS7A 5JCIA 1KDGA 3F8RA 1O94A 2WDRA 3L8KA 3G5SA 2ZZBA 3ICSA 3M0OA 4G9KA 4J33A 1QLBA 2OA1A 2FJAA 2GR1A 1ZDLA 2XFOA 1IUWA 2XLPA 2E1MA 3AEBA 4HA6A 2XVFA 1RSGA 2GR3A 5KOXA 2WEUA 3UKHA 1S3EA 3L1RA 3VR9A 2JAEA 1E1MA 3GDPA 1GERA 2R4JA 4EQXA 5U25A 1X31B 3NK1X 4H4ZA 4H2PA 3DJJA 1TRBA 2WOVA 1CC4A 2WU5A 2TPRA 2XVHA 4U8NA 2E5VA 3UOZA 1JNZA 4A5LA 4DSGA 4B67A 4EQSA 3UKQA 2BS3A 1BZLA 4H4SA 2YG7A 2JKCA 3NYCA 3UOYA 1N4VA 3CNDA 2YR6A 4G73A 4DGKA 5M10A 1F3PA 2QA2A 4BK2A 4ICYA 1GALA 2PYXA 3QFBA 5CKUA 1O5WA 3NLCA 4JNAA 3R9UA 3AE3A 1NHSA 1NG4A 3IHGA 2YLRA 3VQRA 4DNAA 2ARDA 3RP7A 2XLTA 4BURA 1Y56B 1TDKA 1Z6LA 2RGHA 2X8HA 4X9NA 1GRGA 2XVEA 2R0GA 3V3NA 4REKA 2VRLA 2CVJA 3NH3X 1ZP0A 3CGDA 4ZCCA 3UOVA 5IQ4A 4J56A 1Q1RA 4ECHA 1PBDA 4X9MA 1F8SA 1GV4A 1KNPA 4K5RA 1UKVG 3GYJA 4GUVA 4GRTA 3RP8A 4OCGA 4YSYA 4OVIA 3CNJA 4YTMA 2X99A 3DGHA 4OPTA 2BK5A 4B64A 4H4QA 1K4QA 2C72A 5JCKA 2BCGG 4UDQA 2W0HA 2XDOA 1JRYA 1D4DA 1SEZA 5EBKA 1V59A 1JU2A 2XYOA 2UZZA 3ITJA 2BRAA 3NT6A 3JSKA 1PJ6A 3QSMA 1QO8A 4XWRA 2VZ2A 3GSIA 3B3RA 3NKSA 3AWIA 2X50A 2X3NA 1FOHA 2CDUA 1BWCA 3CNPA 4WCTA 1IUVA 3P4QA 1DNCA 5FS9A 2V3AA 1KFYA 1KSUA 2GH5A 3NNEA 4YTPA 1DODA 3I6DA 1Y56A 1L9EA 2XLUA 2WESA 2GQWA 1DJQA 4B66A 2A8XA 2IVEA 3FG2P 4K8DA 2YM1A 3AYJA 3GRSA 3NK2X 4NWZA 4U2LA 1VRQB 2EQ7A 3AE5A 1DXLA 3CPJG 2R9ZA 3C4NA 1NPXA 3GWFA 3SQPA 3S5WA 3BI5A 2V61A 1E39A 3LOVA 1LQUA 3REDA 4Z2RA 2V60A 4U2TA 1M64A 1ZX9A 2RABA 4JNQA 3P4RA 2YVFA 3SX6A 4CY6A 4EQWA 3IC9A 4B69A 2QAEA 3V76A 4HB9A 1NHRA 4D04A 2WOWA 1K0IA 2GR2A 4IA5A 3DJGX 3KVEA 1E1NA 2C7GA 4H7UA 4AT2A 1PBEA 2JK6A 3BHKA 5KRQA 2BRYA 2Y6RA 3AEFA 4YT0A 1KF6A 3T37A 3UP4A 2CULA 4BK1A 1EBDA 5EB5A 2GB0A 3AE8A 2BS4A 2XCGA 4U8OA 4IVMB 1H86A 2WETA 2WP5A 4USQA 3VRDB 4Y4NA 1CJCA 3AEDA 1GRHA 2WHDA 3ABVA 3NTAA 3GMCA 4Z44A 3CGEA 1CBOA 3GMBA 1VG0A 4OPCA 4CNKA 2FJBA 5U1OA 4GAVA 1ONFA 1ZKQA 3BNUA 2EQ6A 5EB4A 3VR8A 4ZN0A 2FJDA 3ADAB 3BI2A 4C5OA 3QJ4A 4TLZA 2R46A 1ELIA 3H8LA 4J2WA 5GSNA 1FCDA 4YSZA 4NTCA 1COYA 4GR1A 4BK3A 4BV6A 1FEAA 2DKHA 5KVHA 2YLSA 5KMPA 5DBJA 3NK0X 3SXIA 4Z43A 2QCUA 2R0CA 2RGOA 1EL5A 2BC0A 2WDVA 3SY4A 4EMWA 1L9DA 2XFPA 4D03A 1N4UA 2BACA 4YKFA 2AR8A 2YLXA 1DOEA 3DK8A 2RGJA 4A7AA 3GWDA 5KMQA 1Y0PA 3SGLA 3BI4A 1EL9A 3SM8A 3LXDA 3FBSA 1DOBA 4E0VA 3SZWA 2V3BA 5JCMA 1S2YA 2X8CA 3ALJA 3M13A 5HY5A 4H4XA 3NTDA 1OJ9A 3RP6A 3UTFA 2C64A 1JRZA 2X8GA 3CGCA 3ICRA 3UKKA 5HYMA 3AB1A 2A89A 1GRAA 4K2XA 4H4YA 5C3JA 2NPXA 3NIXA 2GR0A 3UCLA 5FS6A 2C3DA 4TM1A 4JQ9A 4O5QA 1F8RA 1GXFA 1JNRA 3M12A 3UOXA 4A6NB 1PHHA 1B5QA 3UTHA 4CCRA 3D1CA 1JEHA 2PHHA 4A65A 1KSSA 2YVJA 2Y6QA 3QSSA 5KMRA 3LADA 3LJPA 4G6HA 3KA7A 3AEGA 3QVRA 2YR4A 1H84A 3KPKA 1ZMDA 2WPCA 3AD8B 4G74A 1PJ5A 2V6OA 2VVLA 3AEAA 2YG6A 3F8PA 2FBWA 2WP6A 3ZDNA 2BK4A 2OLNA 2C65A 1N1PA 2BC1A 2WBAA 4JY3A 4NTEA 3AYIA 2IIDA 1D4EA 2WDQA 1S2QA 2BYBA 3IHMA 4AOSA 1K0JA 2WOIA 4EM4A 1E1KA 1PXBA 3AXBA 4H50A 1MO9A 1PXAA 2VRMA 3KPFA 4U8LA 4TM3A 2VQ7A 3AE6A 3LZWA 1CJ4A 1REOA 4A6NA 2B9WA 3LB8A 4A9WA 4RSLA 3C96A 1Q1WA 4FK1A 1YQ3A 1KNRA 4YTNA 2B7SA 1CJ2A 1K0LA 1PBCA 3UKPA 5JCLA 3IWAA 3T2KA 1NAAA 3PS9A 4J31A 4OPDA 4MJWA 1W4XA 4I59A 3NGCX 4C3YA 2TMDA 3AE4A 3NRNA 2OALA 3AEEA 1BKWA 4LA1A 1AOGA 5EOWA 2YLZA 5HXIA 1CF3A 2B9XA 2BXRA 3P4SA 3AE9A 3SZFA 4TM0A 3RNMA 4CNJA 3CIRA 4ZCDA 1D5TA 1NENA 1E6EA 3NN6X 5KMSA 1FL2A 4P9SA 3UKLA 4YSXA 4YXDA 2GRTA 2VVLG 1E1LA 1TDOA 4CY8A 2VQBA 4GDEA 4K5SA 2B76A 2E4GA 5KXJA 1GESA 3DJEA 1D4CA 3SFDA 2HQMA 4U8PA 3K7QX 4B63A 3EPTA 1CJ3A 2Z5XA 3GDNA 5BRTA 2WS3A 3HZLA 2VOUA 1MXTA 2XLSA 2IVDA 1CC2A 4C77A 2I0ZA 4A79A 2YLWA 3ALMA 4M52A 1P2HA 4Z2TA 4APNA 3PVCA 1ZY8A 1H81A 1PN0A 3CN8A 1OJTA 1IUTA 3K7TA 5GRTA 3EANA 4NEVA 4KX6A 5BUKA 3FMWA 4GF7A 4XWZA 1TYTA 4AP3A 3NYEA 3S61A 2ZZ0A 4B68A 3PO7A 1D7LA 3KLJA 3Q6JA 1GSNA 3VRBA 1Q9IA 4A99A 3C4AA 1BGJA 1OJDA 3HYWA 2R45A 1ZK7A 2WU2A 4Y4MA 1YY5A 1NEKA 2C76A 2ZBWA 4Z25A 4YWOA 4G6GA 1CC6A 1MOKA 4JY2A 3GYIA 3E1TA 4Y4LA 1JOAA 3T14A 4FX9A 4X4JA 2XVIA 2GAHB 4U8IA 3UKFA 4K7ZA 2BK3A 5HHFA 1TDEA 1NG3A 3CTYA 2DKIA 4EIPA 1ZOYA 1GPEA 5J60A 3DGZA 4NZHA 3DMEA 1ZMCA 2GQFA 3O0HA 4K22A 3UKAA 2EQ8A 1S3BA 5IPYA 3DK4A 4I58A 1LPFA 1TDNA 5C2TA 1RP0A 2YG5A 3AD9B 4AP1A 1EL8A 4O5UA 1FEBA 3BHFA 5BVAA 3ATQA 4EM3A 2C67A 1P2EA 1PDHA
chains in the Genus database with same CATH topology
5BULA 4LU6A 1GOSA 4ADWA 4J36A 1OJAA 2H88A 1CHUA 4BJZA 4H2QA 2B9YA 2BA9A 2YAUA 4FDCB 4JDRA 4U8MA 4WX1A 5ER0A 3SZCA 3UP5A 3KU9A 3NHOX 1E7PA 4U8JA 3UTEA 4J34A 2JB1A 4AOXA 2BABA 3CGBA 4B65A 3B6DA 1XANA 4IVOB 5JCNA 1GNDA 1JRXA 3BNMA 1IUXA 5LV9A 2BCPA 3URHA 1XHCA 2FJEA 1PS9A 3CPIG 1L9CA 1CL0A 1VDCA 4H4WA 3NG7X 1PXCA 2GEWA 4II3A 4UDRA 4KPRA 5KNLA 5FMHA 1O95A 2YG4A 2C3CA 4U8KA 5L46A 4CRTA 3AE7A 3ATRA 1GEUA 1TDFA 3AE2A 1D7YA 1H82A 2Q6UA 5FS8A 2XVJA 1TYPA 2Z5YA 4EMJA 2WP9A 1ZOVA 2O9ZA 5IQ1A 2GV8A 1H6VA 2C75A 3H8IA 4J57A 3K7MX 4RG3A 2GF3A 1RYIA 4CCQA 3RHAA 2JB2A 3KKJA 3NYFA 3QVPA 5TR3A 4DSHA 4Z2UA 1PBBA 2XLRA 2R0PA 5CQFA 2QA1A 4B1BA 3GYXA 2XFNA 3G5RA 4GAPA 3DH9A 4H4PA 1LQTA 4IA6A 2CFYA 3LZXA 2JBVA 1H7XA 4Z24A 2Q0KA 4LIIA 1N4WA 3P9UA 2V5ZA 1IJHA 4BJYA 1H83A 3AYLA 4TLXA 4OPUA 3SZ0A 3CMMA 3GRTA 2OAMA 3FIMB 4OPGA 2YVGA 2C4CA 2AQJA 4NTDA 2C73A 2Q7VA 1LV0A 3DJDA 3CNTA 3IF9A 3ALLA 4H4TA 4USRA 2C70A 4IV9A 1YKJA 2BS2A 1PJ7A 1XPQA 2GVCA 3FPZA 3T2YA 3EF6A 1F8WA 2F5ZA 2YWLA 2OLOA 2YM2A 1LTXR 1VQWA 2AAQA 3KD9A 4PABA 5U63A 4C3XA 4EQRA 1B4VA 1VG9A 3H4KA 2VVMA 3K30A 1B37A 1LJ1A 3I3LA 4N9XA 4NNJA 4XXGA 1GRFA 1YQ4A 3OZ2A 1NDAA 2B7RA 4NEWA 3T31A 2YLTA 1IUUA 3UTGA 2NVKX 4RG4A 1NHPA 3DA1A 4C74A 3CNSA 4Z26A 4GCMA 5KWFA 3G5QA 2XFUA 4H2RA 2XFQA 1BF3A 2JB3A 5KOWA 3P4PA 4OPLA 3CPHG 1GRBA 3T0KA 4GDPA 3EAOA 3F8DA 3AECA 2WPFA 3WE0A 3HYVA 1QJDA 2J3NA 4UDPA 2WQYA 1F6MA 2YG3A 5KVIA 1H7WA 3SFEA 2APGA 4UP3A 1GREA 1GTEA 2YQUA 3P1WA 1LVLA 3HYXA 4H2NA 1B8SA 3AD7B 4H4UA 1PBFA 3D8XA 1EL7A 1GT8A 1HYUA 1OJCA 1M6IA 2WPEA 2YR5A 1YQZA 2A87A 3DK9A 1BGNA 3ISHA 3QSEA 4EMIA 4YSHA 1DOCA 4II2A 4U2SA 1NHQA 4TM4A 4YKGA 4FK1C 3GD4A 2H89A 1XDIA 1GRTA 3II4A 2GAGB 3NN0X 2C66A 4H4VA 2R4EA 1GTHA 4H4RA 1L0VA 4CBQA 2ACZA 4OPIA 3ICTA 3OC4A 3ZYXA 3V3OA 2Q0LA 2EQ9A 3VRAA 1FECA 2GMJA 3GD3A 4JN9A 4AT0A 3SYIA 3COXA 3T2ZA 3AE1A 4PAAA 5J7XA 4EIQA 1GETA 2ZZCA 1IUSA 1DJNA 3QFAA 5M0ZA 2BXSA 3Q9TA 2GMHA 5FS7A 5JCIA 1KDGA 3F8RA 1O94A 2WDRA 3L8KA 3G5SA 2ZZBA 3ICSA 3M0OA 4G9KA 4J33A 1QLBA 2OA1A 2FJAA 2GR1A 1ZDLA 2XFOA 1IUWA 2XLPA 2E1MA 3AEBA 4HA6A 2XVFA 1RSGA 2GR3A 5KOXA 2WEUA 3UKHA 1S3EA 3L1RA 3VR9A 2JAEA 1E1MA 3GDPA 1GERA 2R4JA 4EQXA 5U25A 1X31B 3NK1X 4H4ZA 4H2PA 3DJJA 1TRBA 2WOVA 1CC4A 2WU5A 2TPRA 2XVHA 4U8NA 2E5VA 3UOZA 1JNZA 4A5LA 4DSGA 4B67A 4EQSA 3UKQA 2BS3A 1BZLA 4H4SA 2YG7A 2JKCA 3NYCA 3UOYA 1N4VA 3CNDA 2YR6A 4G73A 4DGKA 5M10A 1F3PA 2QA2A 4BK2A 4ICYA 1GALA 2PYXA 3QFBA 5CKUA 1O5WA 3NLCA 4JNAA 3R9UA 3AE3A 1NHSA 1NG4A 3IHGA 2YLRA 3VQRA 4DNAA 2ARDA 3RP7A 2XLTA 4BURA 1Y56B 1TDKA 1Z6LA 2RGHA 2X8HA 4X9NA 1GRGA 2XVEA 2R0GA 3V3NA 4REKA 2VRLA 2CVJA 3NH3X 1ZP0A 3CGDA 4ZCCA 3UOVA 5IQ4A 4J56A 1Q1RA 4ECHA 1PBDA 4X9MA 1F8SA 1GV4A 1KNPA 4K5RA 1UKVG 3GYJA 4GUVA 4GRTA 3RP8A 4OCGA 4YSYA 4OVIA 3CNJA 4YTMA 2X99A 3DGHA 4OPTA 2BK5A 4B64A 4H4QA 1K4QA 2C72A 5JCKA 2BCGG 4UDQA 2W0HA 2XDOA 1JRYA 1D4DA 1SEZA 5EBKA 1V59A 1JU2A 2XYOA 2UZZA 3ITJA 2BRAA 3NT6A 3JSKA 1PJ6A 3QSMA 1QO8A 4XWRA 2VZ2A 3GSIA 3B3RA 3NKSA 3AWIA 2X50A 2X3NA 1FOHA 2CDUA 1BWCA 3CNPA 4WCTA 1IUVA 3P4QA 1DNCA 5FS9A 2V3AA 1KFYA 1KSUA 2GH5A 3NNEA 4YTPA 1DODA 3I6DA 1Y56A 1L9EA 2XLUA 2WESA 2GQWA 1DJQA 4B66A 2A8XA 2IVEA 3FG2P 4K8DA 2YM1A 3AYJA 3GRSA 3NK2X 4NWZA 4U2LA 1VRQB 2EQ7A 3AE5A 1DXLA 3CPJG 2R9ZA 3C4NA 1NPXA 3GWFA 3SQPA 3S5WA 3BI5A 2V61A 1E39A 3LOVA 1LQUA 3REDA 4Z2RA 2V60A 4U2TA 1M64A 1ZX9A 2RABA 4JNQA 3P4RA 2YVFA 3SX6A 4CY6A 4EQWA 3IC9A 4B69A 2QAEA 3V76A 4HB9A 1NHRA 4D04A 2WOWA 1K0IA 2GR2A 4IA5A 3DJGX 3KVEA 1E1NA 2C7GA 4H7UA 4AT2A 1PBEA 2JK6A 3BHKA 5KRQA 2BRYA 2Y6RA 3AEFA 4YT0A 1KF6A 3T37A 3UP4A 2CULA 4BK1A 1EBDA 5EB5A 2GB0A 3AE8A 2BS4A 2XCGA 4U8OA 4IVMB 1H86A 2WETA 2WP5A 4USQA 3VRDB 4Y4NA 1CJCA 3AEDA 1GRHA 2WHDA 3ABVA 3NTAA 3GMCA 4Z44A 3CGEA 1CBOA 3GMBA 1VG0A 4OPCA 4CNKA 2FJBA 5U1OA 4GAVA 1ONFA 1ZKQA 3BNUA 2EQ6A 5EB4A 3VR8A 4ZN0A 2FJDA 3ADAB 3BI2A 4C5OA 3QJ4A 4TLZA 2R46A 1ELIA 3H8LA 4J2WA 5GSNA 1FCDA 4YSZA 4NTCA 1COYA 4GR1A 4BK3A 4BV6A 1FEAA 2DKHA 5KVHA 2YLSA 5KMPA 5DBJA 3NK0X 3SXIA 4Z43A 2QCUA 2R0CA 2RGOA 1EL5A 2BC0A 2WDVA 3SY4A 4EMWA 1L9DA 2XFPA 4D03A 1N4UA 2BACA 4YKFA 2AR8A 2YLXA 1DOEA 3DK8A 2RGJA 4A7AA 3GWDA 5KMQA 1Y0PA 3SGLA 3BI4A 1EL9A 3SM8A 3LXDA 3FBSA 1DOBA 4E0VA 3SZWA 2V3BA 5JCMA 1S2YA 2X8CA 3ALJA 3M13A 5HY5A 4H4XA 3NTDA 1OJ9A 3RP6A 3UTFA 2C64A 1JRZA 2X8GA 3CGCA 3ICRA 3UKKA 5HYMA 3AB1A 2A89A 1GRAA 4K2XA 4H4YA 5C3JA 2NPXA 3NIXA 2GR0A 3UCLA 5FS6A 2C3DA 4TM1A 4JQ9A 4O5QA 1F8RA 1GXFA 1JNRA 3M12A 3UOXA 4A6NB 1PHHA 1B5QA 3UTHA 4CCRA 3D1CA 1JEHA 2PHHA 4A65A 1KSSA 2YVJA 2Y6QA 3QSSA 5KMRA 3LADA 3LJPA 4G6HA 3KA7A 3AEGA 3QVRA 2YR4A 1H84A 3KPKA 1ZMDA 2WPCA 3AD8B 4G74A 1PJ5A 2V6OA 2VVLA 3AEAA 2YG6A 3F8PA 2FBWA 2WP6A 3ZDNA 2BK4A 2OLNA 2C65A 1N1PA 2BC1A 2WBAA 4JY3A 4NTEA 3AYIA 2IIDA 1D4EA 2WDQA 1S2QA 2BYBA 3IHMA 4AOSA 1K0JA 2WOIA 4EM4A 1E1KA 1PXBA 3AXBA 4H50A 1MO9A 1PXAA 2VRMA 3KPFA 4U8LA 4TM3A 2VQ7A 3AE6A 3LZWA 1CJ4A 1REOA 4A6NA 2B9WA 3LB8A 4A9WA 4RSLA 3C96A 1Q1WA 4FK1A 1YQ3A 1KNRA 4YTNA 2B7SA 1CJ2A 1K0LA 1PBCA 3UKPA 5JCLA 3IWAA 3T2KA 1NAAA 3PS9A 4J31A 4OPDA 4MJWA 1W4XA 4I59A 3NGCX 4C3YA 2TMDA 3AE4A 3NRNA 2OALA 3AEEA 1BKWA 4LA1A 1AOGA 5EOWA 2YLZA 5HXIA 1CF3A 2B9XA 2BXRA 3P4SA 3AE9A 3SZFA 4TM0A 3RNMA 4CNJA 3CIRA 4ZCDA 1D5TA 1NENA 1E6EA 3NN6X 5KMSA 1FL2A 4P9SA 3UKLA 4YSXA 4YXDA 2GRTA 2VVLG 1E1LA 1TDOA 4CY8A 2VQBA 4GDEA 4K5SA 2B76A 2E4GA 5KXJA 1GESA 3DJEA 1D4CA 3SFDA 2HQMA 4U8PA 3K7QX 4B63A 3EPTA 1CJ3A 2Z5XA 3GDNA 5BRTA 2WS3A 3HZLA 2VOUA 1MXTA 2XLSA 2IVDA 1CC2A 4C77A 2I0ZA 4A79A 2YLWA 3ALMA 4M52A 1P2HA 4Z2TA 4APNA 3PVCA 1ZY8A 1H81A 1PN0A 3CN8A 1OJTA 1IUTA 3K7TA 5GRTA 3EANA 4NEVA 4KX6A 5BUKA 3FMWA 4GF7A 4XWZA 1TYTA 4AP3A 3NYEA 3S61A 2ZZ0A 4B68A 3PO7A 1D7LA 3KLJA 3Q6JA 1GSNA 3VRBA 1Q9IA 4A99A 3C4AA 1BGJA 1OJDA 3HYWA 2R45A 1ZK7A 2WU2A 4Y4MA 1YY5A 1NEKA 2C76A 2ZBWA 4Z25A 4YWOA 4G6GA 1CC6A 1MOKA 4JY2A 3GYIA 3E1TA 4Y4LA 1JOAA 3T14A 4FX9A 4X4JA 2XVIA 2GAHB 4U8IA 3UKFA 4K7ZA 2BK3A 5HHFA 1TDEA 1NG3A 3CTYA 2DKIA 4EIPA 1ZOYA 1GPEA 5J60A 3DGZA 4NZHA 3DMEA 1ZMCA 2GQFA 3O0HA 4K22A 3UKAA 2EQ8A 1S3BA 5IPYA 3DK4A 4I58A 1LPFA 1TDNA 5C2TA 1RP0A 2YG5A 3AD9B 4AP1A 1EL8A 4O5UA 1FEBA 3BHFA 5BVAA 3ATQA 4EM3A 2C67A 1P2EA 1PDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BUL A;  4LU6 A;  1GOS A;  4ADW A;  4J36 A;  1OJA A;  2H88 A;  1CHU A;  4BJZ A;  4H2Q A;  2B9Y A;  2BA9 A;  2YAU A;  4FDC B;  4JDR A;  4U8M A;  4WX1 A;  5ER0 A;  3UP5 A;  3KU9 A;  3NHO X;  1E7P A;  4U8J A;  3UTE A;  4J34 A;  2JB1 A;  4AOX A;  2BAB A;  3CGB A;  4B65 A;  3B6D A;  1XAN A;  4IVO B;  5JCN A;  1GND A;  1JRX A;  3BNM A;  1IUX A;  5LV9 A;  2BCP A;  3URH A;  1XHC A;  2FJE A;  1PS9 A;  3CPI G;  1L9C A;  1CL0 A;  1VDC A;  4H4W A;  3NG7 X;  1PXC A;  2GEW A;  4UDR A;  4KPR A;  5FMH A;  1O95 A;  2YG4 A;  2C3C A;  4U8K A;  5L46 A;  4CRT A;  3AE7 A;  3ATR A;  1GEU A;  1TDF A;  3AE2 A;  1D7Y A;  1H82 A;  2Q6U A;  5FS8 A;  2XVJ A;  1TYP A;  2Z5Y A;  4EMJ A;  2WP9 A;  1ZOV A;  2O9Z A;  5IQ1 A;  2GV8 A;  1H6V A;  2C75 A;  3H8I A;  4J57 A;  3K7M X;  4RG3 A;  2GF3 A;  1RYI A;  4CCQ A;  3RHA A;  2JB2 A;  3KKJ A;  3NYF A;  3QVP A;  5TR3 A;  4DSH A;  4Z2U A;  1PBB A;  2XLR A;  2R0P A;  5CQF A;  2QA1 A;  4B1B A;  2XFN A;  3G5R A;  3DH9 A;  4H4P A;  1LQT A;  4IA6 A;  2CFY A;  3LZX A;  2JBV A;  1H7X A;  4Z24 A;  2Q0K A;  4LII A;  1N4W A;  3P9U A;  2V5Z A;  1IJH A;  4BJY A;  1H83 A;  3AYL A;  4TLX A;  4OPU A;  3GRT A;  2OAM A;  3FIM B;  4OPG A;  2YVG A;  2AQJ A;  4NTD A;  2C73 A;  2Q7V A;  1LV0 A;  3DJD A;  3CNT A;  3IF9 A;  3ALL A;  4H4T A;  4USR A;  2C70 A;  4IV9 A;  1YKJ A;  2BS2 A;  1PJ7 A;  1XPQ A;  2GVC A;  3FPZ A;  3EF6 A;  1F8W A;  2F5Z A;  2YWL A;  2OLO A;  2YM2 A;  1LTX R;  1VQW A;  2AAQ A;  3KD9 A;  4PAB A;  5U63 A;  4C3X A;  4EQR A;  1B4V A;  1VG9 A;  3H4K A;  2VVM A;  3K30 A;  1B37 A;  1LJ1 A;  3I3L A;  4N9X A;  4XXG A;  1GRF A;  1YQ4 A;  3OZ2 A;  1NDA A;  2B7R A;  4NEW A;  2YLT A;  1IUU A;  3UTG A;  2NVK X;  4RG4 A;  1NHP A;  3DA1 A;  4C74 A;  3CNS A;  4Z26 A;  4GCM A;  5KWF A;  3G5Q A;  2XFU A;  4H2R A;  2XFQ A;  1BF3 A;  2JB3 A;  5KOW A;  3P4P A;  4OPL A;  3CPH G;  1GRB A;  4GDP A;  3EAO A;  3F8D A;  3AEC A;  2WPF A;  3WE0 A;  1QJD A;  2J3N A;  4UDP A;  2WQY A;  1F6M A;  2YG3 A;  5KVI A;  1H7W A;  3SFE A;  2APG A;  4UP3 A;  1GRE A;  1GTE A;  2YQU A;  3P1W A;  1LVL A;  4H2N A;  1B8S A;  3AD7 B;  4H4U A;  1PBF A;  3D8X A;  1EL7 A;  1GT8 A;  1HYU A;  1OJC A;  1M6I A;  2WPE A;  2YR5 A;  1YQZ A;  2A87 A;  3DK9 A;  1BGN A;  3ISH A;  3QSE A;  4EMI A;  4YSH A;  1DOC A;  4U2S A;  1NHQ A;  4TM4 A;  4YKG A;  4FK1 C;  3GD4 A;  2H89 A;  1XDI A;  1GRT A;  3II4 A;  2GAG B;  3NN0 X;  2C66 A;  4H4V A;  2R4E A;  1GTH A;  4H4R A;  1L0V A;  4CBQ A;  2ACZ A;  4OPI A;  3ICT A;  3OC4 A;  3ZYX A;  3V3O A;  2Q0L A;  2EQ9 A;  3VRA A;  1FEC A;  2GMJ A;  3GD3 A;  4JN9 A;  4AT0 A;  3COX A;  3AE1 A;  4PAA A;  5J7X A;  4EIQ A;  1GET A;  2ZZC A;  1IUS A;  1DJN A;  3QFA A;  5M0Z A;  2BXS A;  3Q9T A;  2GMH A;  5FS7 A;  5JCI A;  1KDG A;  3F8R A;  1O94 A;  2WDR A;  3L8K A;  3G5S A;  2ZZB A;  3ICS A;  3M0O A;  4J33 A;  1QLB A;  2OA1 A;  2FJA A;  2GR1 A;  1ZDL A;  2XFO A;  1IUW A;  2XLP A;  2E1M A;  3AEB A;  4HA6 A;  2XVF A;  1RSG A;  2GR3 A;  5KOX A;  2WEU A;  3UKH A;  1S3E A;  3L1R A;  3VR9 A;  2JAE A;  1E1M A;  3GDP A;  1GER A;  2R4J A;  4EQX A;  5U25 A;  1X31 B;  3NK1 X;  4H4Z A;  4H2P A;  3DJJ A;  1TRB A;  2WOV A;  1CC4 A;  2WU5 A;  2TPR A;  2XVH A;  4U8N A;  2E5V A;  3UOZ A;  1JNZ A;  4A5L A;  4DSG A;  4B67 A;  4EQS A;  3UKQ A;  2BS3 A;  1BZL A;  4H4S A;  2YG7 A;  2JKC A;  3NYC A;  3UOY A;  1N4V A;  3CND A;  2YR6 A;  4DGK A;  5M10 A;  1F3P A;  2QA2 A;  4BK2 A;  4ICY A;  1GAL A;  2PYX A;  3QFB A;  5CKU A;  1O5W A;  3NLC A;  4JNA A;  3R9U A;  3AE3 A;  1NHS A;  1NG4 A;  3IHG A;  2YLR A;  3VQR A;  4DNA A;  2ARD A;  3RP7 A;  2XLT A;  4BUR A;  1Y56 B;  1TDK A;  1Z6L A;  2RGH A;  2X8H A;  4X9N A;  1GRG A;  2XVE A;  2R0G A;  3V3N A;  4REK A;  2VRL A;  2CVJ A;  3NH3 X;  1ZP0 A;  3CGD A;  4ZCC A;  3UOV A;  5IQ4 A;  4J56 A;  1Q1R A;  4ECH A;  1PBD A;  4X9M A;  1F8S A;  1GV4 A;  1KNP A;  4K5R A;  1UKV G;  3GYJ A;  4GUV A;  4GRT A;  3RP8 A;  4OCG A;  4YSY A;  4OVI A;  3CNJ A;  4YTM A;  2X99 A;  3DGH A;  4OPT A;  2BK5 A;  4B64 A;  4H4Q A;  1K4Q A;  2C72 A;  5JCK A;  2BCG G;  4UDQ A;  2W0H A;  2XDO A;  1JRY A;  1D4D A;  1SEZ A;  5EBK A;  1V59 A;  1JU2 A;  2XYO A;  2UZZ A;  3ITJ A;  3NT6 A;  3JSK A;  1PJ6 A;  3QSM A;  1QO8 A;  4XWR A;  2VZ2 A;  3GSI A;  3B3R A;  3NKS A;  3AWI A;  2X50 A;  2X3N A;  1FOH A;  2CDU A;  1BWC A;  3CNP A;  4WCT A;  1IUV A;  3P4Q A;  1DNC A;  5FS9 A;  2V3A A;  1KFY A;  1KSU A;  2GH5 A;  3NNE A;  4YTP A;  1DOD A;  3I6D A;  1Y56 A;  1L9E A;  2XLU A;  2WES A;  2GQW A;  1DJQ A;  4B66 A;  2A8X A;  2IVE A;  3FG2 P;  4K8D A;  2YM1 A;  3AYJ A;  3GRS A;  3NK2 X;  4U2L A;  1VRQ B;  2EQ7 A;  3AE5 A;  1DXL A;  3CPJ G;  2R9Z A;  3C4N A;  1NPX A;  3GWF A;  3SQP A;  3S5W A;  3BI5 A;  2V61 A;  1E39 A;  3LOV A;  1LQU A;  3RED A;  4Z2R A;  2V60 A;  4U2T A;  1M64 A;  1ZX9 A;  2RAB A;  4JNQ A;  3P4R A;  2YVF A;  4CY6 A;  4EQW A;  3IC9 A;  4B69 A;  2QAE A;  3V76 A;  4HB9 A;  1NHR A;  4D04 A;  2WOW A;  1K0I A;  2GR2 A;  4IA5 A;  3DJG X;  3KVE A;  1E1N A;  2C7G A;  4H7U A;  4AT2 A;  1PBE A;  2JK6 A;  3BHK A;  5KRQ A;  2Y6R A;  3AEF A;  4YT0 A;  1KF6 A;  3T37 A;  3UP4 A;  2CUL A;  4BK1 A;  1EBD A;  5EB5 A;  2GB0 A;  3AE8 A;  2BS4 A;  2XCG A;  4U8O A;  4IVM B;  1H86 A;  2WET A;  2WP5 A;  4USQ A;  3VRD B;  4Y4N A;  1CJC A;  3AED A;  1GRH A;  2WHD A;  3ABV A;  3NTA A;  3GMC A;  4Z44 A;  3CGE A;  1CBO A;  3GMB A;  1VG0 A;  4OPC A;  4CNK A;  2FJB A;  5U1O A;  1ONF A;  1ZKQ A;  3BNU A;  2EQ6 A;  5EB4 A;  3VR8 A;  4ZN0 A;  2FJD A;  3ADA B;  3BI2 A;  4C5O A;  3QJ4 A;  4TLZ A;  2R46 A;  1ELI A;  3H8L A;  4J2W A;  5GSN A;  1FCD A;  4YSZ A;  4NTC A;  1COY A;  4GR1 A;  4BK3 A;  4BV6 A;  1FEA A;  2DKH A;  5KVH A;  2YLS A;  5DBJ A;  3NK0 X;  4Z43 A;  2QCU A;  2R0C A;  2RGO A;  1EL5 A;  2BC0 A;  2WDV A;  4EMW A;  1L9D A;  2XFP A;  4D03 A;  1N4U A;  2BAC A;  4YKF A;  2AR8 A;  2YLX A;  1DOE A;  3DK8 A;  2RGJ A;  4A7A A;  3GWD A;  1Y0P A;  3SGL A;  3BI4 A;  1EL9 A;  3SM8 A;  3LXD A;  3FBS A;  1DOB A;  4E0V A;  2V3B A;  5JCM A;  1S2Y A;  2X8C A;  3ALJ A;  3M13 A;  5HY5 A;  4H4X A;  3NTD A;  1OJ9 A;  3RP6 A;  3UTF A;  2C64 A;  1JRZ A;  2X8G A;  3CGC A;  3ICR A;  3UKK A;  5HYM A;  3AB1 A;  2A89 A;  1GRA A;  4K2X A;  4H4Y A;  5C3J A;  2NPX A;  3NIX A;  2GR0 A;  3UCL A;  5FS6 A;  2C3D A;  4TM1 A;  4JQ9 A;  4O5Q A;  1F8R A;  1GXF A;  1JNR A;  3M12 A;  3UOX A;  4A6N B;  1PHH A;  1B5Q A;  3UTH A;  4CCR A;  3D1C A;  1JEH A;  2PHH A;  4A65 A;  1KSS A;  2YVJ A;  2Y6Q A;  3QSS A;  3LAD A;  3LJP A;  3KA7 A;  3AEG A;  3QVR A;  2YR4 A;  1H84 A;  1ZMD A;  2WPC A;  3AD8 B;  1PJ5 A;  2V6O A;  2VVL A;  3AEA A;  2YG6 A;  3F8P A;  2FBW A;  2WP6 A;  3ZDN A;  2BK4 A;  2OLN A;  2C65 A;  1N1P A;  2BC1 A;  2WBA A;  4JY3 A;  4NTE A;  3AYI A;  2IID A;  1D4E A;  2WDQ A;  1S2Q A;  2BYB A;  3IHM A;  4AOS A;  1K0J A;  2WOI A;  4EM4 A;  1E1K A;  1PXB A;  3AXB A;  4H50 A;  1MO9 A;  1PXA A;  2VRM A;  3KPF A;  4U8L A;  4TM3 A;  2VQ7 A;  3AE6 A;  3LZW A;  1CJ4 A;  1REO A;  4A6N A;  2B9W A;  3LB8 A;  4A9W A;  4RSL A;  3C96 A;  1Q1W A;  4FK1 A;  1YQ3 A;  1KNR A;  4YTN A;  2B7S A;  1CJ2 A;  1K0L A;  1PBC A;  3UKP A;  5JCL A;  3IWA A;  1NAA A;  3PS9 A;  4J31 A;  4OPD A;  4MJW A;  1W4X A;  4I59 A;  3NGC X;  4C3Y A;  2TMD A;  3AE4 A;  3NRN A;  2OAL A;  3AEE A;  1BKW A;  4LA1 A;  1AOG A;  5EOW A;  2YLZ A;  5HXI A;  1CF3 A;  2B9X A;  2BXR A;  3P4S A;  3AE9 A;  4TM0 A;  3RNM A;  4CNJ A;  3CIR A;  4ZCD A;  1D5T A;  1NEN A;  1E6E A;  3NN6 X;  1FL2 A;  4P9S A;  3UKL A;  4YSX A;  4YXD A;  2GRT A;  2VVL G;  1E1L A;  1TDO A;  4CY8 A;  2VQB A;  4GDE A;  4K5S A;  2B76 A;  2E4G A;  5KXJ A;  1GES A;  3DJE A;  1D4C A;  3SFD A;  2HQM A;  4U8P A;  3K7Q X;  4B63 A;  3EPT A;  1CJ3 A;  2Z5X A;  3GDN A;  5BRT A;  2WS3 A;  3HZL A;  2VOU A;  1MXT A;  2XLS A;  2IVD A;  1CC2 A;  4C77 A;  2I0Z A;  4A79 A;  2YLW A;  3ALM A;  4M52 A;  1P2H A;  4Z2T A;  4APN A;  3PVC A;  1ZY8 A;  1H81 A;  1PN0 A;  3CN8 A;  1OJT A;  1IUT A;  3K7T A;  5GRT A;  3EAN A;  4NEV A;  4KX6 A;  5BUK A;  3FMW A;  4GF7 A;  4XWZ A;  1TYT A;  4AP3 A;  3NYE A;  3S61 A;  2ZZ0 A;  4B68 A;  3PO7 A;  1D7L A;  3KLJ A;  3Q6J A;  1GSN A;  3VRB A;  1Q9I A;  4A99 A;  3C4A A;  1BGJ A;  1OJD A;  2R45 A;  1ZK7 A;  2WU2 A;  4Y4M A;  1YY5 A;  1NEK A;  2C76 A;  2ZBW A;  4Z25 A;  4YWO A;  1CC6 A;  1MOK A;  4JY2 A;  3GYI A;  3E1T A;  4Y4L A;  1JOA A;  4FX9 A;  4X4J A;  2XVI A;  2GAH B;  4U8I A;  3UKF A;  4K7Z A;  2BK3 A;  5HHF A;  1TDE A;  1NG3 A;  3CTY A;  2DKI A;  4EIP A;  1ZOY A;  1GPE A;  5J60 A;  3DGZ A;  4NZH A;  3DME A;  1ZMC A;  2GQF A;  3O0H A;  4K22 A;  3UKA A;  2EQ8 A;  1S3B A;  5IPY A;  3DK4 A;  4I58 A;  1LPF A;  1TDN A;  5C2T A;  1RP0 A;  2YG5 A;  3AD9 B;  4AP1 A;  1EL8 A;  4O5U A;  1FEB A;  3BHF A;  5BVA A;  3ATQ A;  4EM3 A;  2C67 A;  1P2E A;  1PDH A; 
#chains in the Genus database with same CATH topology
 5BUL A;  4LU6 A;  1GOS A;  4ADW A;  4J36 A;  1OJA A;  2H88 A;  1CHU A;  4BJZ A;  4H2Q A;  2B9Y A;  2BA9 A;  2YAU A;  4FDC B;  4JDR A;  4U8M A;  4WX1 A;  5ER0 A;  3SZC A;  3UP5 A;  3KU9 A;  3NHO X;  1E7P A;  4U8J A;  3UTE A;  4J34 A;  2JB1 A;  4AOX A;  2BAB A;  3CGB A;  4B65 A;  3B6D A;  1XAN A;  4IVO B;  5JCN A;  1GND A;  1JRX A;  3BNM A;  1IUX A;  5LV9 A;  2BCP A;  3URH A;  1XHC A;  2FJE A;  1PS9 A;  3CPI G;  1L9C A;  1CL0 A;  1VDC A;  4H4W A;  3NG7 X;  1PXC A;  2GEW A;  4II3 A;  4UDR A;  4KPR A;  5KNL A;  5FMH A;  1O95 A;  2YG4 A;  2C3C A;  4U8K A;  5L46 A;  4CRT A;  3AE7 A;  3ATR A;  1GEU A;  1TDF A;  3AE2 A;  1D7Y A;  1H82 A;  2Q6U A;  5FS8 A;  2XVJ A;  1TYP A;  2Z5Y A;  4EMJ A;  2WP9 A;  1ZOV A;  2O9Z A;  5IQ1 A;  2GV8 A;  1H6V A;  2C75 A;  3H8I A;  4J57 A;  3K7M X;  4RG3 A;  2GF3 A;  1RYI A;  4CCQ A;  3RHA A;  2JB2 A;  3KKJ A;  3NYF A;  3QVP A;  5TR3 A;  4DSH A;  4Z2U A;  1PBB A;  2XLR A;  2R0P A;  5CQF A;  2QA1 A;  4B1B A;  3GYX A;  2XFN A;  3G5R A;  4GAP A;  3DH9 A;  4H4P A;  1LQT A;  4IA6 A;  2CFY A;  3LZX A;  2JBV A;  1H7X A;  4Z24 A;  2Q0K A;  4LII A;  1N4W A;  3P9U A;  2V5Z A;  1IJH A;  4BJY A;  1H83 A;  3AYL A;  4TLX A;  4OPU A;  3SZ0 A;  3CMM A;  3GRT A;  2OAM A;  3FIM B;  4OPG A;  2YVG A;  2C4C A;  2AQJ A;  4NTD A;  2C73 A;  2Q7V A;  1LV0 A;  3DJD A;  3CNT A;  3IF9 A;  3ALL A;  4H4T A;  4USR A;  2C70 A;  4IV9 A;  1YKJ A;  2BS2 A;  1PJ7 A;  1XPQ A;  2GVC A;  3FPZ A;  3T2Y A;  3EF6 A;  1F8W A;  2F5Z A;  2YWL A;  2OLO A;  2YM2 A;  1LTX R;  1VQW A;  2AAQ A;  3KD9 A;  4PAB A;  5U63 A;  4C3X A;  4EQR A;  1B4V A;  1VG9 A;  3H4K A;  2VVM A;  3K30 A;  1B37 A;  1LJ1 A;  3I3L A;  4N9X A;  4NNJ A;  4XXG A;  1GRF A;  1YQ4 A;  3OZ2 A;  1NDA A;  2B7R A;  4NEW A;  3T31 A;  2YLT A;  1IUU A;  3UTG A;  2NVK X;  4RG4 A;  1NHP A;  3DA1 A;  4C74 A;  3CNS A;  4Z26 A;  4GCM A;  5KWF A;  3G5Q A;  2XFU A;  4H2R A;  2XFQ A;  1BF3 A;  2JB3 A;  5KOW A;  3P4P A;  4OPL A;  3CPH G;  1GRB A;  3T0K A;  4GDP A;  3EAO A;  3F8D A;  3AEC A;  2WPF A;  3WE0 A;  3HYV A;  1QJD A;  2J3N A;  4UDP A;  2WQY A;  1F6M A;  2YG3 A;  5KVI A;  1H7W A;  3SFE A;  2APG A;  4UP3 A;  1GRE A;  1GTE A;  2YQU A;  3P1W A;  1LVL A;  3HYX A;  4H2N A;  1B8S A;  3AD7 B;  4H4U A;  1PBF A;  3D8X A;  1EL7 A;  1GT8 A;  1HYU A;  1OJC A;  1M6I A;  2WPE A;  2YR5 A;  1YQZ A;  2A87 A;  3DK9 A;  1BGN A;  3ISH A;  3QSE A;  4EMI A;  4YSH A;  1DOC A;  4II2 A;  4U2S A;  1NHQ A;  4TM4 A;  4YKG A;  4FK1 C;  3GD4 A;  2H89 A;  1XDI A;  1GRT A;  3II4 A;  2GAG B;  3NN0 X;  2C66 A;  4H4V A;  2R4E A;  1GTH A;  4H4R A;  1L0V A;  4CBQ A;  2ACZ A;  4OPI A;  3ICT A;  3OC4 A;  3ZYX A;  3V3O A;  2Q0L A;  2EQ9 A;  3VRA A;  1FEC A;  2GMJ A;  3GD3 A;  4JN9 A;  4AT0 A;  3SYI A;  3COX A;  3T2Z A;  3AE1 A;  4PAA A;  5J7X A;  4EIQ A;  1GET A;  2ZZC A;  1IUS A;  1DJN A;  3QFA A;  5M0Z A;  2BXS A;  3Q9T A;  2GMH A;  5FS7 A;  5JCI A;  1KDG A;  3F8R A;  1O94 A;  2WDR A;  3L8K A;  3G5S A;  2ZZB A;  3ICS A;  3M0O A;  4G9K A;  4J33 A;  1QLB A;  2OA1 A;  2FJA A;  2GR1 A;  1ZDL A;  2XFO A;  1IUW A;  2XLP A;  2E1M A;  3AEB A;  4HA6 A;  2XVF A;  1RSG A;  2GR3 A;  5KOX A;  2WEU A;  3UKH A;  1S3E A;  3L1R A;  3VR9 A;  2JAE A;  1E1M A;  3GDP A;  1GER A;  2R4J A;  4EQX A;  5U25 A;  1X31 B;  3NK1 X;  4H4Z A;  4H2P A;  3DJJ A;  1TRB A;  2WOV A;  1CC4 A;  2WU5 A;  2TPR A;  2XVH A;  4U8N A;  2E5V A;  3UOZ A;  1JNZ A;  4A5L A;  4DSG A;  4B67 A;  4EQS A;  3UKQ A;  2BS3 A;  1BZL A;  4H4S A;  2YG7 A;  2JKC A;  3NYC A;  3UOY A;  1N4V A;  3CND A;  2YR6 A;  4G73 A;  4DGK A;  5M10 A;  1F3P A;  2QA2 A;  4BK2 A;  4ICY A;  1GAL A;  2PYX A;  3QFB A;  5CKU A;  1O5W A;  3NLC A;  4JNA A;  3R9U A;  3AE3 A;  1NHS A;  1NG4 A;  3IHG A;  2YLR A;  3VQR A;  4DNA A;  2ARD A;  3RP7 A;  2XLT A;  4BUR A;  1Y56 B;  1TDK A;  1Z6L A;  2RGH A;  2X8H A;  4X9N A;  1GRG A;  2XVE A;  2R0G A;  3V3N A;  4REK A;  2VRL A;  2CVJ A;  3NH3 X;  1ZP0 A;  3CGD A;  4ZCC A;  3UOV A;  5IQ4 A;  4J56 A;  1Q1R A;  4ECH A;  1PBD A;  4X9M A;  1F8S A;  1GV4 A;  1KNP A;  4K5R A;  1UKV G;  3GYJ A;  4GUV A;  4GRT A;  3RP8 A;  4OCG A;  4YSY A;  4OVI A;  3CNJ A;  4YTM A;  2X99 A;  3DGH A;  4OPT A;  2BK5 A;  4B64 A;  4H4Q A;  1K4Q A;  2C72 A;  5JCK A;  2BCG G;  4UDQ A;  2W0H A;  2XDO A;  1JRY A;  1D4D A;  1SEZ A;  5EBK A;  1V59 A;  1JU2 A;  2XYO A;  2UZZ A;  3ITJ A;  2BRA A;  3NT6 A;  3JSK A;  1PJ6 A;  3QSM A;  1QO8 A;  4XWR A;  2VZ2 A;  3GSI A;  3B3R A;  3NKS A;  3AWI A;  2X50 A;  2X3N A;  1FOH A;  2CDU A;  1BWC A;  3CNP A;  4WCT A;  1IUV A;  3P4Q A;  1DNC A;  5FS9 A;  2V3A A;  1KFY A;  1KSU A;  2GH5 A;  3NNE A;  4YTP A;  1DOD A;  3I6D A;  1Y56 A;  1L9E A;  2XLU A;  2WES A;  2GQW A;  1DJQ A;  4B66 A;  2A8X A;  2IVE A;  3FG2 P;  4K8D A;  2YM1 A;  3AYJ A;  3GRS A;  3NK2 X;  4NWZ A;  4U2L A;  1VRQ B;  2EQ7 A;  3AE5 A;  1DXL A;  3CPJ G;  2R9Z A;  3C4N A;  1NPX A;  3GWF A;  3SQP A;  3S5W A;  3BI5 A;  2V61 A;  1E39 A;  3LOV A;  1LQU A;  3RED A;  4Z2R A;  2V60 A;  4U2T A;  1M64 A;  1ZX9 A;  2RAB A;  4JNQ A;  3P4R A;  2YVF A;  3SX6 A;  4CY6 A;  4EQW A;  3IC9 A;  4B69 A;  2QAE A;  3V76 A;  4HB9 A;  1NHR A;  4D04 A;  2WOW A;  1K0I A;  2GR2 A;  4IA5 A;  3DJG X;  3KVE A;  1E1N A;  2C7G A;  4H7U A;  4AT2 A;  1PBE A;  2JK6 A;  3BHK A;  5KRQ A;  2BRY A;  2Y6R A;  3AEF A;  4YT0 A;  1KF6 A;  3T37 A;  3UP4 A;  2CUL A;  4BK1 A;  1EBD A;  5EB5 A;  2GB0 A;  3AE8 A;  2BS4 A;  2XCG A;  4U8O A;  4IVM B;  1H86 A;  2WET A;  2WP5 A;  4USQ A;  3VRD B;  4Y4N A;  1CJC A;  3AED A;  1GRH A;  2WHD A;  3ABV A;  3NTA A;  3GMC A;  4Z44 A;  3CGE A;  1CBO A;  3GMB A;  1VG0 A;  4OPC A;  4CNK A;  2FJB A;  5U1O A;  4GAV A;  1ONF A;  1ZKQ A;  3BNU A;  2EQ6 A;  5EB4 A;  3VR8 A;  4ZN0 A;  2FJD A;  3ADA B;  3BI2 A;  4C5O A;  3QJ4 A;  4TLZ A;  2R46 A;  1ELI A;  3H8L A;  4J2W A;  5GSN A;  1FCD A;  4YSZ A;  4NTC A;  1COY A;  4GR1 A;  4BK3 A;  4BV6 A;  1FEA A;  2DKH A;  5KVH A;  2YLS A;  5KMP A;  5DBJ A;  3NK0 X;  3SXI A;  4Z43 A;  2QCU A;  2R0C A;  2RGO A;  1EL5 A;  2BC0 A;  2WDV A;  3SY4 A;  4EMW A;  1L9D A;  2XFP A;  4D03 A;  1N4U A;  2BAC A;  4YKF A;  2AR8 A;  2YLX A;  1DOE A;  3DK8 A;  2RGJ A;  4A7A A;  3GWD A;  5KMQ A;  1Y0P A;  3SGL A;  3BI4 A;  1EL9 A;  3SM8 A;  3LXD A;  3FBS A;  1DOB A;  4E0V A;  3SZW A;  2V3B A;  5JCM A;  1S2Y A;  2X8C A;  3ALJ A;  3M13 A;  5HY5 A;  4H4X A;  3NTD A;  1OJ9 A;  3RP6 A;  3UTF A;  2C64 A;  1JRZ A;  2X8G A;  3CGC A;  3ICR A;  3UKK A;  5HYM A;  3AB1 A;  2A89 A;  1GRA A;  4K2X A;  4H4Y A;  5C3J A;  2NPX A;  3NIX A;  2GR0 A;  3UCL A;  5FS6 A;  2C3D A;  4TM1 A;  4JQ9 A;  4O5Q A;  1F8R A;  1GXF A;  1JNR A;  3M12 A;  3UOX A;  4A6N B;  1PHH A;  1B5Q A;  3UTH A;  4CCR A;  3D1C A;  1JEH A;  2PHH A;  4A65 A;  1KSS A;  2YVJ A;  2Y6Q A;  3QSS A;  5KMR A;  3LAD A;  3LJP A;  4G6H A;  3KA7 A;  3AEG A;  3QVR A;  2YR4 A;  1H84 A;  3KPK A;  1ZMD A;  2WPC A;  3AD8 B;  4G74 A;  1PJ5 A;  2V6O A;  2VVL A;  3AEA A;  2YG6 A;  3F8P A;  2FBW A;  2WP6 A;  3ZDN A;  2BK4 A;  2OLN A;  2C65 A;  1N1P A;  2BC1 A;  2WBA A;  4JY3 A;  4NTE A;  3AYI A;  2IID A;  1D4E A;  2WDQ A;  1S2Q A;  2BYB A;  3IHM A;  4AOS A;  1K0J A;  2WOI A;  4EM4 A;  1E1K A;  1PXB A;  3AXB A;  4H50 A;  1MO9 A;  1PXA A;  2VRM A;  3KPF A;  4U8L A;  4TM3 A;  2VQ7 A;  3AE6 A;  3LZW A;  1CJ4 A;  1REO A;  4A6N A;  2B9W A;  3LB8 A;  4A9W A;  4RSL A;  3C96 A;  1Q1W A;  4FK1 A;  1YQ3 A;  1KNR A;  4YTN A;  2B7S A;  1CJ2 A;  1K0L A;  1PBC A;  3UKP A;  5JCL A;  3IWA A;  3T2K A;  1NAA A;  3PS9 A;  4J31 A;  4OPD A;  4MJW A;  1W4X A;  4I59 A;  3NGC X;  4C3Y A;  2TMD A;  3AE4 A;  3NRN A;  2OAL A;  3AEE A;  1BKW A;  4LA1 A;  1AOG A;  5EOW A;  2YLZ A;  5HXI A;  1CF3 A;  2B9X A;  2BXR A;  3P4S A;  3AE9 A;  3SZF A;  4TM0 A;  3RNM A;  4CNJ A;  3CIR A;  4ZCD A;  1D5T A;  1NEN A;  1E6E A;  3NN6 X;  5KMS A;  1FL2 A;  4P9S A;  3UKL A;  4YSX A;  4YXD A;  2GRT A;  2VVL G;  1E1L A;  1TDO A;  4CY8 A;  2VQB A;  4GDE A;  4K5S A;  2B76 A;  2E4G A;  5KXJ A;  1GES A;  3DJE A;  1D4C A;  3SFD A;  2HQM A;  4U8P A;  3K7Q X;  4B63 A;  3EPT A;  1CJ3 A;  2Z5X A;  3GDN A;  5BRT A;  2WS3 A;  3HZL A;  2VOU A;  1MXT A;  2XLS A;  2IVD A;  1CC2 A;  4C77 A;  2I0Z A;  4A79 A;  2YLW A;  3ALM A;  4M52 A;  1P2H A;  4Z2T A;  4APN A;  3PVC A;  1ZY8 A;  1H81 A;  1PN0 A;  3CN8 A;  1OJT A;  1IUT A;  3K7T A;  5GRT A;  3EAN A;  4NEV A;  4KX6 A;  5BUK A;  3FMW A;  4GF7 A;  4XWZ A;  1TYT A;  4AP3 A;  3NYE A;  3S61 A;  2ZZ0 A;  4B68 A;  3PO7 A;  1D7L A;  3KLJ A;  3Q6J A;  1GSN A;  3VRB A;  1Q9I A;  4A99 A;  3C4A A;  1BGJ A;  1OJD A;  3HYW A;  2R45 A;  1ZK7 A;  2WU2 A;  4Y4M A;  1YY5 A;  1NEK A;  2C76 A;  2ZBW A;  4Z25 A;  4YWO A;  4G6G A;  1CC6 A;  1MOK A;  4JY2 A;  3GYI A;  3E1T A;  4Y4L A;  1JOA A;  3T14 A;  4FX9 A;  4X4J A;  2XVI A;  2GAH B;  4U8I A;  3UKF A;  4K7Z A;  2BK3 A;  5HHF A;  1TDE A;  1NG3 A;  3CTY A;  2DKI A;  4EIP A;  1ZOY A;  1GPE A;  5J60 A;  3DGZ A;  4NZH A;  3DME A;  1ZMC A;  2GQF A;  3O0H A;  4K22 A;  3UKA A;  2EQ8 A;  1S3B A;  5IPY A;  3DK4 A;  4I58 A;  1LPF A;  1TDN A;  5C2T A;  1RP0 A;  2YG5 A;  3AD9 B;  4AP1 A;  1EL8 A;  4O5U A;  1FEB A;  3BHF A;  5BVA A;  3ATQ A;  4EM3 A;  2C67 A;  1P2E A;  1PDH A; 
#chains in the Genus database with same CATH homology
 5BUL A;  4LU6 A;  1GOS A;  4ADW A;  4J36 A;  1OJA A;  2H88 A;  1CHU A;  4BJZ A;  4H2Q A;  2B9Y A;  2BA9 A;  2YAU A;  4FDC B;  4JDR A;  4U8M A;  4WX1 A;  5ER0 A;  3SZC A;  3UP5 A;  3KU9 A;  3NHO X;  1E7P A;  4U8J A;  3UTE A;  4J34 A;  2JB1 A;  4AOX A;  2BAB A;  3CGB A;  4B65 A;  3B6D A;  1XAN A;  4IVO B;  5JCN A;  1GND A;  1JRX A;  3BNM A;  1IUX A;  5LV9 A;  2BCP A;  3URH A;  1XHC A;  2FJE A;  1PS9 A;  3CPI G;  1L9C A;  1CL0 A;  1VDC A;  4H4W A;  3NG7 X;  1PXC A;  2GEW A;  4II3 A;  4UDR A;  4KPR A;  5KNL A;  5FMH A;  1O95 A;  2YG4 A;  2C3C A;  4U8K A;  5L46 A;  4CRT A;  3AE7 A;  3ATR A;  1GEU A;  1TDF A;  3AE2 A;  1D7Y A;  1H82 A;  2Q6U A;  5FS8 A;  2XVJ A;  1TYP A;  2Z5Y A;  4EMJ A;  2WP9 A;  1ZOV A;  2O9Z A;  5IQ1 A;  2GV8 A;  1H6V A;  2C75 A;  3H8I A;  4J57 A;  3K7M X;  4RG3 A;  2GF3 A;  1RYI A;  4CCQ A;  3RHA A;  2JB2 A;  3KKJ A;  3NYF A;  3QVP A;  5TR3 A;  4DSH A;  4Z2U A;  1PBB A;  2XLR A;  2R0P A;  5CQF A;  2QA1 A;  4B1B A;  3GYX A;  2XFN A;  3G5R A;  4GAP A;  3DH9 A;  4H4P A;  1LQT A;  4IA6 A;  2CFY A;  3LZX A;  2JBV A;  1H7X A;  4Z24 A;  2Q0K A;  4LII A;  1N4W A;  3P9U A;  2V5Z A;  1IJH A;  4BJY A;  1H83 A;  3AYL A;  4TLX A;  4OPU A;  3SZ0 A;  3CMM A;  3GRT A;  2OAM A;  3FIM B;  4OPG A;  2YVG A;  2C4C A;  2AQJ A;  4NTD A;  2C73 A;  2Q7V A;  1LV0 A;  3DJD A;  3CNT A;  3IF9 A;  3ALL A;  4H4T A;  4USR A;  2C70 A;  4IV9 A;  1YKJ A;  2BS2 A;  1PJ7 A;  1XPQ A;  2GVC A;  3FPZ A;  3T2Y A;  3EF6 A;  1F8W A;  2F5Z A;  2YWL A;  2OLO A;  2YM2 A;  1LTX R;  1VQW A;  2AAQ A;  3KD9 A;  4PAB A;  5U63 A;  4C3X A;  4EQR A;  1B4V A;  1VG9 A;  3H4K A;  2VVM A;  3K30 A;  1B37 A;  1LJ1 A;  3I3L A;  4N9X A;  4NNJ A;  4XXG A;  1GRF A;  1YQ4 A;  3OZ2 A;  1NDA A;  2B7R A;  4NEW A;  3T31 A;  2YLT A;  1IUU A;  3UTG A;  2NVK X;  4RG4 A;  1NHP A;  3DA1 A;  4C74 A;  3CNS A;  4Z26 A;  4GCM A;  5KWF A;  3G5Q A;  2XFU A;  4H2R A;  2XFQ A;  1BF3 A;  2JB3 A;  5KOW A;  3P4P A;  4OPL A;  3CPH G;  1GRB A;  3T0K A;  4GDP A;  3EAO A;  3F8D A;  3AEC A;  2WPF A;  3WE0 A;  3HYV A;  1QJD A;  2J3N A;  4UDP A;  2WQY A;  1F6M A;  2YG3 A;  5KVI A;  1H7W A;  3SFE A;  2APG A;  4UP3 A;  1GRE A;  1GTE A;  2YQU A;  3P1W A;  1LVL A;  3HYX A;  4H2N A;  1B8S A;  3AD7 B;  4H4U A;  1PBF A;  3D8X A;  1EL7 A;  1GT8 A;  1HYU A;  1OJC A;  1M6I A;  2WPE A;  2YR5 A;  1YQZ A;  2A87 A;  3DK9 A;  1BGN A;  3ISH A;  3QSE A;  4EMI A;  4YSH A;  1DOC A;  4II2 A;  4U2S A;  1NHQ A;  4TM4 A;  4YKG A;  4FK1 C;  3GD4 A;  2H89 A;  1XDI A;  1GRT A;  3II4 A;  2GAG B;  3NN0 X;  2C66 A;  4H4V A;  2R4E A;  1GTH A;  4H4R A;  1L0V A;  4CBQ A;  2ACZ A;  4OPI A;  3ICT A;  3OC4 A;  3ZYX A;  3V3O A;  2Q0L A;  2EQ9 A;  3VRA A;  1FEC A;  2GMJ A;  3GD3 A;  4JN9 A;  4AT0 A;  3SYI A;  3COX A;  3T2Z A;  3AE1 A;  4PAA A;  5J7X A;  4EIQ A;  1GET A;  2ZZC A;  1IUS A;  1DJN A;  3QFA A;  5M0Z A;  2BXS A;  3Q9T A;  2GMH A;  5FS7 A;  5JCI A;  1KDG A;  3F8R A;  1O94 A;  2WDR A;  3L8K A;  3G5S A;  2ZZB A;  3ICS A;  3M0O A;  4G9K A;  4J33 A;  1QLB A;  2OA1 A;  2FJA A;  2GR1 A;  1ZDL A;  2XFO A;  1IUW A;  2XLP A;  2E1M A;  3AEB A;  4HA6 A;  2XVF A;  1RSG A;  2GR3 A;  5KOX A;  2WEU A;  3UKH A;  1S3E A;  3L1R A;  3VR9 A;  2JAE A;  1E1M A;  3GDP A;  1GER A;  2R4J A;  4EQX A;  5U25 A;  1X31 B;  3NK1 X;  4H4Z A;  4H2P A;  3DJJ A;  1TRB A;  2WOV A;  1CC4 A;  2WU5 A;  2TPR A;  2XVH A;  4U8N A;  2E5V A;  3UOZ A;  1JNZ A;  4A5L A;  4DSG A;  4B67 A;  4EQS A;  3UKQ A;  2BS3 A;  1BZL A;  4H4S A;  2YG7 A;  2JKC A;  3NYC A;  3UOY A;  1N4V A;  3CND A;  2YR6 A;  4G73 A;  4DGK A;  5M10 A;  1F3P A;  2QA2 A;  4BK2 A;  4ICY A;  1GAL A;  2PYX A;  3QFB A;  5CKU A;  1O5W A;  3NLC A;  4JNA A;  3R9U A;  3AE3 A;  1NHS A;  1NG4 A;  3IHG A;  2YLR A;  3VQR A;  4DNA A;  2ARD A;  3RP7 A;  2XLT A;  4BUR A;  1Y56 B;  1TDK A;  1Z6L A;  2RGH A;  2X8H A;  4X9N A;  1GRG A;  2XVE A;  2R0G A;  3V3N A;  4REK A;  2VRL A;  2CVJ A;  3NH3 X;  1ZP0 A;  3CGD A;  4ZCC A;  3UOV A;  5IQ4 A;  4J56 A;  1Q1R A;  4ECH A;  1PBD A;  4X9M A;  1F8S A;  1GV4 A;  1KNP A;  4K5R A;  1UKV G;  3GYJ A;  4GUV A;  4GRT A;  3RP8 A;  4OCG A;  4YSY A;  4OVI A;  3CNJ A;  4YTM A;  2X99 A;  3DGH A;  4OPT A;  2BK5 A;  4B64 A;  4H4Q A;  1K4Q A;  2C72 A;  5JCK A;  2BCG G;  4UDQ A;  2W0H A;  2XDO A;  1JRY A;  1D4D A;  1SEZ A;  5EBK A;  1V59 A;  1JU2 A;  2XYO A;  2UZZ A;  3ITJ A;  2BRA A;  3NT6 A;  3JSK A;  1PJ6 A;  3QSM A;  1QO8 A;  4XWR A;  2VZ2 A;  3GSI A;  3B3R A;  3NKS A;  3AWI A;  2X50 A;  2X3N A;  1FOH A;  2CDU A;  1BWC A;  3CNP A;  4WCT A;  1IUV A;  3P4Q A;  1DNC A;  5FS9 A;  2V3A A;  1KFY A;  1KSU A;  2GH5 A;  3NNE A;  4YTP A;  1DOD A;  3I6D A;  1Y56 A;  1L9E A;  2XLU A;  2WES A;  2GQW A;  1DJQ A;  4B66 A;  2A8X A;  2IVE A;  3FG2 P;  4K8D A;  2YM1 A;  3AYJ A;  3GRS A;  3NK2 X;  4NWZ A;  4U2L A;  1VRQ B;  2EQ7 A;  3AE5 A;  1DXL A;  3CPJ G;  2R9Z A;  3C4N A;  1NPX A;  3GWF A;  3SQP A;  3S5W A;  3BI5 A;  2V61 A;  1E39 A;  3LOV A;  1LQU A;  3RED A;  4Z2R A;  2V60 A;  4U2T A;  1M64 A;  1ZX9 A;  2RAB A;  4JNQ A;  3P4R A;  2YVF A;  3SX6 A;  4CY6 A;  4EQW A;  3IC9 A;  4B69 A;  2QAE A;  3V76 A;  4HB9 A;  1NHR A;  4D04 A;  2WOW A;  1K0I A;  2GR2 A;  4IA5 A;  3DJG X;  3KVE A;  1E1N A;  2C7G A;  4H7U A;  4AT2 A;  1PBE A;  2JK6 A;  3BHK A;  5KRQ A;  2BRY A;  2Y6R A;  3AEF A;  4YT0 A;  1KF6 A;  3T37 A;  3UP4 A;  2CUL A;  4BK1 A;  1EBD A;  5EB5 A;  2GB0 A;  3AE8 A;  2BS4 A;  2XCG A;  4U8O A;  4IVM B;  1H86 A;  2WET A;  2WP5 A;  4USQ A;  3VRD B;  4Y4N A;  1CJC A;  3AED A;  1GRH A;  2WHD A;  3ABV A;  3NTA A;  3GMC A;  4Z44 A;  3CGE A;  1CBO A;  3GMB A;  1VG0 A;  4OPC A;  4CNK A;  2FJB A;  5U1O A;  4GAV A;  1ONF A;  1ZKQ A;  3BNU A;  2EQ6 A;  5EB4 A;  3VR8 A;  4ZN0 A;  2FJD A;  3ADA B;  3BI2 A;  4C5O A;  3QJ4 A;  4TLZ A;  2R46 A;  1ELI A;  3H8L A;  4J2W A;  5GSN A;  1FCD A;  4YSZ A;  4NTC A;  1COY A;  4GR1 A;  4BK3 A;  4BV6 A;  1FEA A;  2DKH A;  5KVH A;  2YLS A;  5KMP A;  5DBJ A;  3NK0 X;  3SXI A;  4Z43 A;  2QCU A;  2R0C A;  2RGO A;  1EL5 A;  2BC0 A;  2WDV A;  3SY4 A;  4EMW A;  1L9D A;  2XFP A;  4D03 A;  1N4U A;  2BAC A;  4YKF A;  2AR8 A;  2YLX A;  1DOE A;  3DK8 A;  2RGJ A;  4A7A A;  3GWD A;  5KMQ A;  1Y0P A;  3SGL A;  3BI4 A;  1EL9 A;  3SM8 A;  3LXD A;  3FBS A;  1DOB A;  4E0V A;  3SZW A;  2V3B A;  5JCM A;  1S2Y A;  2X8C A;  3ALJ A;  3M13 A;  5HY5 A;  4H4X A;  3NTD A;  1OJ9 A;  3RP6 A;  3UTF A;  2C64 A;  1JRZ A;  2X8G A;  3CGC A;  3ICR A;  3UKK A;  5HYM A;  3AB1 A;  2A89 A;  1GRA A;  4K2X A;  4H4Y A;  5C3J A;  2NPX A;  3NIX A;  2GR0 A;  3UCL A;  5FS6 A;  2C3D A;  4TM1 A;  4JQ9 A;  4O5Q A;  1F8R A;  1GXF A;  1JNR A;  3M12 A;  3UOX A;  4A6N B;  1PHH A;  1B5Q A;  3UTH A;  4CCR A;  3D1C A;  1JEH A;  2PHH A;  4A65 A;  1KSS A;  2YVJ A;  2Y6Q A;  3QSS A;  5KMR A;  3LAD A;  3LJP A;  4G6H A;  3KA7 A;  3AEG A;  3QVR A;  2YR4 A;  1H84 A;  3KPK A;  1ZMD A;  2WPC A;  3AD8 B;  4G74 A;  1PJ5 A;  2V6O A;  2VVL A;  3AEA A;  2YG6 A;  3F8P A;  2FBW A;  2WP6 A;  3ZDN A;  2BK4 A;  2OLN A;  2C65 A;  1N1P A;  2BC1 A;  2WBA A;  4JY3 A;  4NTE A;  3AYI A;  2IID A;  1D4E A;  2WDQ A;  1S2Q A;  2BYB A;  3IHM A;  4AOS A;  1K0J A;  2WOI A;  4EM4 A;  1E1K A;  1PXB A;  3AXB A;  4H50 A;  1MO9 A;  1PXA A;  2VRM A;  3KPF A;  4U8L A;  4TM3 A;  2VQ7 A;  3AE6 A;  3LZW A;  1CJ4 A;  1REO A;  4A6N A;  2B9W A;  3LB8 A;  4A9W A;  4RSL A;  3C96 A;  1Q1W A;  4FK1 A;  1YQ3 A;  1KNR A;  4YTN A;  2B7S A;  1CJ2 A;  1K0L A;  1PBC A;  3UKP A;  5JCL A;  3IWA A;  3T2K A;  1NAA A;  3PS9 A;  4J31 A;  4OPD A;  4MJW A;  1W4X A;  4I59 A;  3NGC X;  4C3Y A;  2TMD A;  3AE4 A;  3NRN A;  2OAL A;  3AEE A;  1BKW A;  4LA1 A;  1AOG A;  5EOW A;  2YLZ A;  5HXI A;  1CF3 A;  2B9X A;  2BXR A;  3P4S A;  3AE9 A;  3SZF A;  4TM0 A;  3RNM A;  4CNJ A;  3CIR A;  4ZCD A;  1D5T A;  1NEN A;  1E6E A;  3NN6 X;  5KMS A;  1FL2 A;  4P9S A;  3UKL A;  4YSX A;  4YXD A;  2GRT A;  2VVL G;  1E1L A;  1TDO A;  4CY8 A;  2VQB A;  4GDE A;  4K5S A;  2B76 A;  2E4G A;  5KXJ A;  1GES A;  3DJE A;  1D4C A;  3SFD A;  2HQM A;  4U8P A;  3K7Q X;  4B63 A;  3EPT A;  1CJ3 A;  2Z5X A;  3GDN A;  5BRT A;  2WS3 A;  3HZL A;  2VOU A;  1MXT A;  2XLS A;  2IVD A;  1CC2 A;  4C77 A;  2I0Z A;  4A79 A;  2YLW A;  3ALM A;  4M52 A;  1P2H A;  4Z2T A;  4APN A;  3PVC A;  1ZY8 A;  1H81 A;  1PN0 A;  3CN8 A;  1OJT A;  1IUT A;  3K7T A;  5GRT A;  3EAN A;  4NEV A;  4KX6 A;  5BUK A;  3FMW A;  4GF7 A;  4XWZ A;  1TYT A;  4AP3 A;  3NYE A;  3S61 A;  2ZZ0 A;  4B68 A;  3PO7 A;  1D7L A;  3KLJ A;  3Q6J A;  1GSN A;  3VRB A;  1Q9I A;  4A99 A;  3C4A A;  1BGJ A;  1OJD A;  3HYW A;  2R45 A;  1ZK7 A;  2WU2 A;  4Y4M A;  1YY5 A;  1NEK A;  2C76 A;  2ZBW A;  4Z25 A;  4YWO A;  4G6G A;  1CC6 A;  1MOK A;  4JY2 A;  3GYI A;  3E1T A;  4Y4L A;  1JOA A;  3T14 A;  4FX9 A;  4X4J A;  2XVI A;  2GAH B;  4U8I A;  3UKF A;  4K7Z A;  2BK3 A;  5HHF A;  1TDE A;  1NG3 A;  3CTY A;  2DKI A;  4EIP A;  1ZOY A;  1GPE A;  5J60 A;  3DGZ A;  4NZH A;  3DME A;  1ZMC A;  2GQF A;  3O0H A;  4K22 A;  3UKA A;  2EQ8 A;  1S3B A;  5IPY A;  3DK4 A;  4I58 A;  1LPF A;  1TDN A;  5C2T A;  1RP0 A;  2YG5 A;  3AD9 B;  4AP1 A;  1EL8 A;  4O5U A;  1FEB A;  3BHF A;  5BVA A;  3ATQ A;  4EM3 A;  2C67 A;  1P2E A;  1PDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...