1TRBA

Convergent evolution of similar function in two structurally divergent enzymes
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(flavoenzyme)
molecule keywords THIOREDOXIN REDUCTASE
publication title Convergent evolution of similar function in two structurally divergent enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1991-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA02
4U2LA 3UOZA 4H50A 4K8DA 3K7QX 2EQ8A 4J33A 4YTNA 1Z6LA 3KPFA 4YWOA 2XFUA 3UOYA 1H6VA 5FS6A 3ATQA 2BK3A 1IUSA 5JCKA 3LXDA 3CNJA 4Z2TA 3EF6A 2YLXA 4TM1A 1DODA 1YQ4A 3BNUA 2CVJA 4H4YA 2GMHA 1D5TA 1XPQA 3NK1X 1K4QA 3UTEA 1OJ9A 3AXBA 1N4VA 3M13A 4A5LA 4Z26A 2DKIA 1PS9A 3NLCA 3VRDB 1BGNA 2YLZA 3L1RA 4H2QA 4O5UA 3C4AA 3NN6X 1ZMDA 1TDOA 3LB8A 1JEHA 2YR4A 3SGLA 1E39A 4U2SA 3AE4A 3NG7X 1NG4A 2BYBA 3DGHA 3F8PA 2R4JA 4U8KA 3FG2P 1MXTA 4OPCA 4ZCCA 3V3OA 1H84A 2B9YA 2WPCA 1VQWA 3NYCA 3BHKA 2YM1A 3DMEA 4YTPA 1MO9A 1VG0A 2E5VA 1RYIA 3PVCA 2PHHA 2WU2A 5FS9A 1RP0A 1PBBA 3IWAA 1GT8A 2IVEA 2XLUA 3DJDA 2BXSA 3AE8A 3QSSA 3NYEA 1K0JA 1CBOA 2JK6A 3UP4A 3M0OA 2BXRA 1GESA 2GV8A 5DBJA 3P4SA 1CC6A 1O94A 1Q9IA 3F8RA 2EQ9A 4OPGA 1XANA 4NTDA 3GD4A 4NZHA 3AD8B 3H4KA 1KNPA 4K2XA 1W4XA 2Q7VA 4B67A 1NEKA 1SEZA 3G5QA 1LV0A 2IVDA 4BJYA 1QO8A 1N4UA 3ATRA 4FK1A 1D7YA 1GRBA 2JB3A 3P9UA 1O5WA 4UDQA 2JB2A 5KRQA 5BVAA 1H86A 3AE9A 4XWRA 5JCNA 2DKHA 5FMHA 4JNAA 4U8PA 1GTHA 1BKWA 4N9XA 2XVHA 4CBQA 3S61A 4E0VA 1TRBA 2AAQA 4I58A 1OJAA 3QVPA 3DJJA 3AEDA 2RGHA 4LA1A 1UKVG 2XCGA 2Q6UA 1TYPA 5KVHA 2C64A 2Y6QA 3EAOA 4LIIA 4UDRA 3UKAA 1K0LA 3LADA 2R0GA 4H4WA 4CY6A 4C3YA 5JCLA 4Y4LA 4D03A 3K30A 1DJQA 3II4A 2Z5XA 4JQ9A 2GR0A 1TDEA 2GR1A 4JNQA 4GDPA 2XFQA 1FEAA 4H2PA 1GRAA 1M6IA 1CJ3A 4H2NA 1LJ1A 4P9SA 3UKPA 3UCLA 3ICTA 2A8XA 1M64A 1CHUA 2OA1A 1PBEA 3VRAA 4YT0A 2HQMA 3CGBA 2Y6RA 3DGZA 4H4UA 2C65A 2GF3A 3DK9A 2W0HA 1BGJA 2YLRA 3G5RA 4NEWA 2BS4A 2V61A 2TPRA 2GAGB 3K7TA 1JOAA 3AYJA 1JRXA 1GETA 4Z44A 2R0PA 2IIDA 2YR6A 1EL8A 4WX1A 4A9WA 2WPFA 2WOWA 3CPJG 3CNSA 1F8RA 2TMDA 3NK0X 2H89A 1ZOYA 1XHCA 2V5ZA 1H82A 3CGEA 4J34A 4KPRA 1VDCA 3SM8A 1ZP0A 2F5ZA 2FJAA 1EL9A 2C7GA 2GH5A 3AE5A 1BWCA 3R9UA 2B7RA 1OJCA 4OPDA 4IA5A 3NTAA 3EPTA 1GALA 1E7PA 2WDVA 3GDPA 2VOUA 1KSSA 2BCGG 2EQ6A 3UP5A 2C75A 3HZLA 1F8SA 4Z2UA 2ARDA 4YSZA 1GPEA 2BCPA 2WDRA 4B66A 3CPHG 2WBAA 4Z43A 5ER0A 5KWFA 3NN0X 1GRTA 1LTXR 1PXCA 1LQTA 2BK4A 3AYLA 3P1WA 5M0ZA 3CNTA 4Z24A 1BF3A 3AEFA 5U63A 5EB5A 1MOKA 3AE2A 3NKSA 4U8IA 4A99A 2WOVA 5LV9A 2ZZBA 3GSIA 3RP7A 1PBFA 1YQZA 5HYMA 1O95A 1V59A 4I59A 3CTYA 5GSNA 1NHPA 2YG4A 4OPTA 1ZOVA 4HA6A 3REDA 3E1TA 5CKUA 1REOA 4WCTA 2EQ7A 3FPZA 1TDFA 2WESA 1E1KA 4J31A 4YKGA 3PO7A 4YXDA 4A6NA 1D7LA 1RSGA 2OAMA 3CNPA 4OVIA 4H7UA 3V76A 1NHQA 3FMWA 4JY2A 3ABVA 2YQUA 2C3CA 3NIXA 3NK2X 1ZKQA 2WU5A 3ALLA 4IVOB 4J2WA 3ITJA 3S5WA 1PJ6A 4BURA 4ZN0A 3H8LA 4H4PA 4H4XA 3SFDA 1GV4A 4B65A 1DNCA 3AE3A 3AE6A 1Y56A 3DA1A 1FEBA 3GRSA 5BULA 5IPYA 1CJCA 2GEWA 4REKA 3AB1A 1NHRA 2PYXA 3CIRA 5EOWA 1L0VA 4Z25A 1IUXA 1N4WA 3NGCX 4OPIA 3KA7A 4TLZA 1B37A 2FJDA 1PN0A 2YM2A 2VZ2A 3GMBA 1P2EA 1DJNA 4K7ZA 2QAEA 5J60A 3UTFA 1ZK7A 3NH3X 2XLPA 4O5QA 4BJZA 2ZZCA 3CN8A 4LU6A 2JB1A 4BV6A 3AYIA 4GF7A 3DK4A 3P4QA 1GRHA 3ALMA 4TLXA 3F8DA 3IHGA 1L9DA 3ISHA 5JCIA 4Z2RA 1JRYA 2E1MA 2JBVA 4X9NA 2APGA 3IF9A 2YG5A 1B4VA 5CQFA 5M10A 4MJWA 3Q9TA 3AWIA 5IQ1A 1H7XA 4B68A 4A65A 1PHHA 4U8MA 1H83A 1S3EA 4U2TA 3LJPA 2VVLG 1TDNA 2J3NA 3GYIA 3C96A 5U25A 2BACA 2WPEA 2ZBWA 3VR8A 1ZY8A 1X31B 2GR2A 4B1BA 4EMJA 1KDGA 4OCGA 4AT2A 1E1NA 2GAHB 4AP3A 3CPIG 2NVKX 2Q0LA 1K0IA 1VG9A 3DK8A 3CGDA 1ZMCA 3DH9A 1VRQB 2ZZ0A 3BNMA 5J7XA 3GYJA 3UKQA 3EANA 2BC1A 3VRBA 4AT0A 3DJGX 2E4GA 2VQ7A 2XVIA 3BI4A 1GERA 1QLBA 4K5SA 2WP9A 3VR9A 3GRTA 3FIMB 1JNRA 4H4VA 4USRA 1ZDLA 4K22A 1COYA 1D4EA 1YY5A 1GSNA 2XLRA 4X4JA 2FBWA 5IQ4A 2A87A 4U8NA 3L8KA 2I0ZA 3WE0A 2GQFA 1NHSA 2Z5YA 2A89A 3ICRA 2X50A 4U8LA 3UKHA 2V6OA 2XFPA 4A79A 3Q6JA 2R45A 4EQRA 3KLJA 4AOXA 3LOVA 2WQYA 4DSHA 2FJBA 3UKFA 1NPXA 2YG6A 3COXA 4GRTA 3UTGA 1FECA 2V3BA 4UP3A 2UZZA 2XLSA 1B8SA 4GUVA 4IVMB 4XWZA 3PS9A 1H7WA 5KVIA 5C3JA 2XVEA 4GDEA 2V3AA 1D4CA 1LPFA 2BS2A 4YSYA 5JCMA 4YKFA 3C4NA 2YAUA 2XFOA 4EMIA 1BZLA 1E6EA 1CL0A 3OC4A 1JRZA 2XDOA 4U8OA 1NENA 4YSHA 1EBDA 4ECHA 2OLOA 1CJ4A 1Y0PA 4PABA 5L46A 4JN9A 4EQXA 3UOVA 2WS3A 2WDQA 3AE1A 4AP1A 4B64A 1LQUA 3B6DA 1IUVA 3CGCA 2WEUA 1ZX9A 4RG3A 1L9CA 1H81A 1PXAA 1F8WA 2WETA 4DNAA 1PDHA 2YLTA 1EL7A 4OPUA 3RP8A 3FBSA 1NG3A 2QA1A 1TDKA 3NNEA 2B9XA 1ONFA 4C3XA 3SFEA 4C74A 5HXIA 2WP6A 1KSUA 3CNDA 4IV9A 3UKLA 2B7SA 1FCDA 1GRGA 5U1OA 2VRLA 2C3DA 4CNKA 3V3NA 2VVMA 1CF3A 4RSLA 1N1PA 4M52A 4YSXA 3T37A 4CRTA 3AEGA 4EIPA 2QA2A 2R46A 1OJDA 4A6NB 2FJEA 5EB4A 3NYFA 4H4TA 4CNJA 1GEUA 3G5SA 3I3LA 4FX9A 2BABA 2QCUA 2GR3A 4OPLA 5EBKA 3BI5A 2X99A 2X8CA 1S3BA 2CFYA 3AD7B 3GWDA 4J36A 3JSKA 3LZWA 2WHDA 3NTDA 1PJ7A 5HHFA 2R4EA 5BRTA 1YQ3A 2VRMA 3AEAA 1Y56B 5GRTA 1B5QA 3K7MX 4C5OA 3GMCA 2R9ZA 4H4RA 1DOCA 2OALA 1P2HA 3ADAB 3VQRA 4XXGA 4PAAA 2WOIA 1S2YA 1PJ5A 5KOXA 3AEBA 4H2RA 1JU2A 2GMJA 2YLWA 2B76A 1LVLA 4B63A 2C76A 2YVJA 2XVFA 4K5RA 3AD9B 4HB9A 4JY3A 4NEVA 3H8IA 2YVFA 3QVRA 2YWLA 1CC2A 1E1MA 2BA9A 1FL2A 4FDCB 4H4SA 4NTEA 4EIQA 1CC4A 4EMWA 2AR8A 4APNA 4KX6A 1IUTA 4AOSA 2B9WA 3M12A 3NHOX 1NDAA 1GRFA 2JKCA 3QJ4A 1KNRA 4TM4A 1F3PA 1OJTA 3O0HA 4RG4A 4X9MA 2BS3A 2VVLA 2Q0KA 4ADWA 2GB0A 4A7AA 3UKKA 1F6MA 2XVJA 4J57A 3B3RA 3RNMA 4B69A 3SQPA 2RABA 2R0CA 1GOSA 1TYTA 3QFAA 3KKJA 2YLSA 2NPXA 4J56A 1GREA 3QFBA 3IHMA 1AOGA 3KVEA 2BK5A 4EQSA 4TM3A 3NRNA 4CY8A 1PBDA 2CULA 2OLNA 3AE7A 2JAEA 2YG3A 2WP5A 4EM4A 2YR5A 3D8XA 5C2TA 4JDRA 2X3NA 1GTEA 4GCMA 2C70A 1DOEA 2C67A 3D1CA 2GQWA 4Y4NA 3P4RA 1GXFA 1HYUA 1QJDA 1XDIA 2GRTA 4U8JA 4C77A 4DSGA 4D04A 1KF6A 3BI2A 4DGKA 1PBCA 4BK1A 4USQA 4CCQA 4EQWA 3RHAA 3OZ2A 2YVGA 3KU9A 1L9EA 3GD3A 3DJEA 1IUUA 2V60A 3P4PA 3IC9A 3QSMA 2ACZA 4H4ZA 1CJ2A 4NTCA 1IUWA 3RP6A 2H88A 1PXBA 2AQJA 3LZXA 3BHFA 5KXJA 1KFYA 2YG7A 2CDUA 4H4QA 1E1LA 1EL5A 3I6DA 3KD9A 4ICYA 4Y4MA 3GDNA 5FS7A 1Q1WA 5HY5A 3URHA 1Q1RA 4UDPA 2XYOA 1D4DA 4ZCDA 2C72A 1ELIA 3GWFA 2C66A 1DOBA 3ZYXA 3ALJA 1S2QA 2BC0A 2XFNA 4TM0A 1JNZA 2O9ZA 3UTHA 3ZDNA 3ICSA 4BK3A 1FOHA 5FS8A 5KOWA 2C73A 3NT6A 1GNDA 4YTMA 2RGOA 4FK1C 2VQBA 1IJHA 1NAAA 3AECA 3AEEA 4GR1A 4IA6A 4CCRA 2GVCA 1DXLA 5TR3A 2X8HA 5BUKA 4BK2A 2RGJA 4EM3A 2X8GA 2XLTA 3UOXA 1YKJA 3QSEA
chains in the Genus database with same CATH superfamily
4U2LA 3UOZA 4H50A 4K8DA 3K7QX 2EQ8A 4J33A 4YTNA 1Z6LA 3KPFA 3HYVA 4YWOA 2XFUA 3UOYA 1H6VA 5FS6A 3ATQA 2BK3A 1IUSA 5JCKA 3LXDA 3CNJA 4Z2TA 3EF6A 5KMSA 2YLXA 4TM1A 1DODA 1YQ4A 3BNUA 2CVJA 4H4YA 2GMHA 1D5TA 1XPQA 3NK1X 1K4QA 3UTEA 1OJ9A 3AXBA 1N4VA 3M13A 4A5LA 4Z26A 5KNLA 2DKIA 1PS9A 3NLCA 3VRDB 1BGNA 2YLZA 3L1RA 4H2QA 4O5UA 3C4AA 3NN6X 1ZMDA 1TDOA 3LB8A 1JEHA 2YR4A 4II3A 3SGLA 1E39A 4U2SA 3AE4A 3NG7X 1NG4A 2BYBA 3DGHA 3F8PA 2R4JA 4U8KA 3FG2P 1MXTA 4OPCA 4ZCCA 3V3OA 1H84A 2B9YA 2WPCA 1VQWA 3NYCA 3BHKA 4GAVA 2YM1A 3DMEA 4YTPA 1MO9A 1VG0A 2E5VA 1RYIA 3PVCA 2PHHA 2WU2A 5FS9A 1RP0A 1PBBA 3IWAA 1GT8A 2IVEA 2XLUA 3DJDA 2BXSA 3AE8A 3QSSA 3NYEA 1K0JA 1CBOA 2JK6A 3UP4A 3M0OA 2BXRA 1GESA 2GV8A 5DBJA 3P4SA 1CC6A 1O94A 1Q9IA 3F8RA 2EQ9A 4OPGA 1XANA 4NTDA 3GD4A 4NZHA 3AD8B 3H4KA 1KNPA 4K2XA 1W4XA 2Q7VA 4B67A 1NEKA 1SEZA 3G5QA 1LV0A 2IVDA 4BJYA 1QO8A 3T2YA 1N4UA 3ATRA 4FK1A 1D7YA 1GRBA 2JB3A 3P9UA 1O5WA 4UDQA 2JB2A 5KRQA 5BVAA 1H86A 3AE9A 4XWRA 5JCNA 2DKHA 5FMHA 4JNAA 4U8PA 1GTHA 1BKWA 4N9XA 2XVHA 4CBQA 3S61A 4E0VA 1TRBA 2AAQA 4I58A 4G6HA 1OJAA 3QVPA 3DJJA 3AEDA 2RGHA 4LA1A 1UKVG 2XCGA 2Q6UA 1TYPA 5KVHA 2C64A 2Y6QA 3EAOA 4LIIA 4UDRA 3UKAA 1K0LA 3LADA 2R0GA 4H4WA 4CY6A 4C3YA 5JCLA 4Y4LA 4D03A 3K30A 1DJQA 3II4A 2Z5XA 4JQ9A 2GR0A 1TDEA 2GR1A 4G6GA 4JNQA 4GDPA 2XFQA 1FEAA 4H2PA 1GRAA 1M6IA 1CJ3A 4H2NA 1LJ1A 4P9SA 3UKPA 3UCLA 3ICTA 2A8XA 1M64A 1CHUA 2OA1A 1PBEA 4NWZA 3VRAA 4YT0A 2HQMA 3CGBA 2Y6RA 3DGZA 4H4UA 2C65A 2GF3A 3DK9A 2W0HA 1BGJA 2YLRA 3G5RA 5KMQA 4NEWA 2BS4A 2V61A 2TPRA 2GAGB 3K7TA 3T14A 1JOAA 3AYJA 1JRXA 1GETA 4Z44A 2R0PA 2IIDA 2YR6A 1EL8A 4WX1A 4A9WA 2WPFA 2WOWA 3CPJG 3CNSA 1F8RA 2TMDA 3NK0X 2H89A 1ZOYA 1XHCA 2V5ZA 1H82A 3CGEA 4J34A 4KPRA 1VDCA 3SM8A 1ZP0A 2F5ZA 2FJAA 1EL9A 2C7GA 2GH5A 3AE5A 1BWCA 3R9UA 2B7RA 4G9KA 1OJCA 4OPDA 4IA5A 3NTAA 3T2KA 3EPTA 1GALA 1E7PA 2WDVA 3GDPA 2VOUA 1KSSA 2BCGG 2EQ6A 3UP5A 2C75A 3HZLA 1F8SA 4Z2UA 2ARDA 4YSZA 1GPEA 2BCPA 2WDRA 4B66A 3CPHG 2WBAA 4Z43A 5ER0A 5KWFA 3NN0X 1GRTA 1LTXR 1PXCA 1LQTA 2BK4A 3AYLA 3P1WA 5M0ZA 3CNTA 4Z24A 1BF3A 3AEFA 5U63A 5EB5A 1MOKA 3AE2A 3NKSA 4U8IA 4A99A 2WOVA 5LV9A 2ZZBA 3GSIA 3RP7A 1PBFA 1YQZA 5HYMA 1O95A 1V59A 4I59A 3CTYA 5GSNA 1NHPA 2YG4A 4OPTA 1ZOVA 4HA6A 3REDA 3E1TA 5CKUA 1REOA 4WCTA 2EQ7A 3FPZA 1TDFA 2WESA 3SZFA 1E1KA 4J31A 4YKGA 3PO7A 4YXDA 4A6NA 1D7LA 1RSGA 2OAMA 3CNPA 4OVIA 4H7UA 3V76A 1NHQA 3FMWA 4JY2A 3ABVA 2YQUA 2C3CA 3NIXA 3NK2X 1ZKQA 2WU5A 3ALLA 4IVOB 4J2WA 3ITJA 4GAPA 1PJ6A 3S5WA 4BURA 4ZN0A 3H8LA 4H4PA 4H4XA 3SX6A 3SFDA 1GV4A 4B65A 1DNCA 3AE3A 3AE6A 1Y56A 3DA1A 1FEBA 3GRSA 5BULA 5IPYA 1CJCA 2GEWA 4REKA 3AB1A 1NHRA 2PYXA 3CIRA 5EOWA 1L0VA 4Z25A 1IUXA 1N4WA 3NGCX 4OPIA 3KA7A 4TLZA 1B37A 2FJDA 1PN0A 2YM2A 2VZ2A 3GMBA 1P2EA 1DJNA 4K7ZA 2QAEA 5J60A 3UTFA 1ZK7A 3NH3X 2XLPA 4O5QA 4BJZA 2ZZCA 3CN8A 4LU6A 2JB1A 4BV6A 3AYIA 4GF7A 3DK4A 3P4QA 1GRHA 3ALMA 4TLXA 3F8DA 3IHGA 1L9DA 3ISHA 5JCIA 4Z2RA 1JRYA 4NNJA 2E1MA 2JBVA 4X9NA 2APGA 3IF9A 2YG5A 1B4VA 5CQFA 5M10A 4MJWA 3Q9TA 3AWIA 5IQ1A 1H7XA 4B68A 4A65A 1PHHA 4U8MA 1H83A 1S3EA 4U2TA 3LJPA 2VVLG 1TDNA 2J3NA 3GYIA 3C96A 5U25A 2BACA 2WPEA 2ZBWA 3VR8A 1ZY8A 1X31B 2GR2A 4B1BA 4EMJA 1KDGA 4OCGA 4AT2A 1E1NA 3T0KA 2GAHB 4AP3A 3CPIG 2NVKX 2Q0LA 1K0IA 1VG9A 3DK8A 3CGDA 1ZMCA 3DH9A 1VRQB 2ZZ0A 3BNMA 5J7XA 3GYJA 3UKQA 3EANA 2BC1A 3VRBA 4AT0A 3DJGX 2E4GA 2VQ7A 2XVIA 3BI4A 1GERA 1QLBA 4K5SA 2WP9A 3VR9A 3SY4A 3GRTA 3FIMB 1JNRA 4H4VA 4USRA 1ZDLA 4K22A 1COYA 1D4EA 1YY5A 1GSNA 2XLRA 4X4JA 2FBWA 5IQ4A 2A87A 4U8NA 3L8KA 2I0ZA 3WE0A 2GQFA 1NHSA 2Z5YA 2A89A 3ICRA 2X50A 4U8LA 3UKHA 3KPKA 2V6OA 2XFPA 4A79A 3Q6JA 2R45A 4EQRA 3KLJA 4AOXA 3LOVA 2WQYA 4DSHA 2FJBA 3UKFA 5KMRA 1NPXA 2YG6A 3COXA 4GRTA 3UTGA 1FECA 2V3BA 4UP3A 2UZZA 2XLSA 1B8SA 4GUVA 4IVMB 4XWZA 4II2A 3SZCA 3PS9A 1H7WA 5KVIA 5C3JA 2XVEA 4GDEA 2V3AA 1D4CA 1LPFA 2BS2A 4YSYA 5JCMA 4YKFA 3C4NA 3SZWA 2YAUA 2XFOA 4EMIA 1BZLA 1E6EA 1CL0A 3OC4A 1JRZA 2XDOA 4U8OA 1NENA 4YSHA 1EBDA 4ECHA 2OLOA 1CJ4A 1Y0PA 4PABA 5L46A 4JN9A 4EQXA 3UOVA 2WS3A 2WDQA 3AE1A 4AP1A 4B64A 1LQUA 3B6DA 1IUVA 3CGCA 3T31A 2WEUA 1ZX9A 4RG3A 1L9CA 1H81A 1PXAA 1F8WA 2WETA 4DNAA 1PDHA 2YLTA 1EL7A 4OPUA 3RP8A 3FBSA 1NG3A 2QA1A 1TDKA 3NNEA 2B9XA 1ONFA 4C3XA 3SFEA 4C74A 5HXIA 2WP6A 1KSUA 3CNDA 4IV9A 3UKLA 2B7SA 1FCDA 1GRGA 5U1OA 2VRLA 2C3DA 4CNKA 3V3NA 2VVMA 1CF3A 4RSLA 1N1PA 4M52A 4YSXA 3T37A 4CRTA 3AEGA 4EIPA 2QA2A 2R46A 1OJDA 4A6NB 2FJEA 5EB4A 3NYFA 4H4TA 4CNJA 1GEUA 3G5SA 3I3LA 4FX9A 2BABA 2QCUA 2GR3A 4OPLA 5EBKA 3BI5A 2X99A 2X8CA 1S3BA 2CFYA 3AD7B 3GWDA 4J36A 3JSKA 3GYXA 3LZWA 2WHDA 3NTDA 1PJ7A 5HHFA 2R4EA 5BRTA 1YQ3A 2VRMA 3AEAA 1Y56B 5GRTA 1B5QA 3K7MX 4C5OA 3GMCA 2R9ZA 4H4RA 1DOCA 2OALA 1P2HA 3ADAB 3VQRA 4XXGA 4PAAA 2WOIA 1S2YA 1PJ5A 5KOXA 3AEBA 4H2RA 1JU2A 2GMJA 2YLWA 2B76A 1LVLA 2C4CA 4B63A 2C76A 2YVJA 2XVFA 4K5RA 3AD9B 4HB9A 4JY3A 4NEVA 3SYIA 3H8IA 2YVFA 3QVRA 2YWLA 1CC2A 1E1MA 2BA9A 1FL2A 4FDCB 4H4SA 4NTEA 4EIQA 1CC4A 4EMWA 2AR8A 4APNA 4KX6A 1IUTA 4AOSA 2B9WA 3M12A 3NHOX 1NDAA 1GRFA 2JKCA 3QJ4A 1KNRA 4TM4A 1F3PA 1OJTA 3O0HA 4RG4A 4X9MA 2BS3A 2VVLA 2Q0KA 3T2ZA 4ADWA 2GB0A 4A7AA 3UKKA 1F6MA 2XVJA 4J57A 3B3RA 3RNMA 4B69A 3SQPA 2RABA 2R0CA 1GOSA 1TYTA 3QFAA 3KKJA 2YLSA 2NPXA 4J56A 1GREA 3QFBA 3IHMA 1AOGA 3KVEA 2BK5A 4EQSA 4TM3A 3NRNA 4CY8A 1PBDA 2CULA 2OLNA 3AE7A 2JAEA 2YG3A 3SZ0A 4G74A 4G73A 2WP5A 4EM4A 3HYWA 3HYXA 2YR5A 3D8XA 5C2TA 4JDRA 2X3NA 1GTEA 4GCMA 2C70A 1DOEA 2C67A 3D1CA 2GQWA 4Y4NA 3P4RA 1GXFA 1HYUA 1QJDA 1XDIA 2GRTA 4U8JA 4C77A 4DSGA 4D04A 1KF6A 3BI2A 4DGKA 1PBCA 4BK1A 4USQA 4CCQA 4EQWA 3RHAA 3OZ2A 2YVGA 3KU9A 1L9EA 3GD3A 3DJEA 1IUUA 2V60A 3P4PA 3IC9A 3QSMA 2ACZA 4H4ZA 1CJ2A 4NTCA 1IUWA 3RP6A 2H88A 1PXBA 2AQJA 2BRAA 3BHFA 3CMMA 3LZXA 5KXJA 1KFYA 2YG7A 2CDUA 4H4QA 1E1LA 1EL5A 3I6DA 3KD9A 4ICYA 4Y4MA 3GDNA 5FS7A 1Q1WA 5HY5A 3URHA 1Q1RA 4UDPA 2XYOA 1D4DA 4ZCDA 2C72A 1ELIA 3GWFA 2C66A 1DOBA 3ZYXA 3ALJA 1S2QA 2BC0A 2XFNA 4TM0A 1JNZA 2O9ZA 3UTHA 3ZDNA 2BRYA 3ICSA 4BK3A 1FOHA 5FS8A 5KOWA 2C73A 3NT6A 3SXIA 1GNDA 4YTMA 2RGOA 4FK1C 2VQBA 1IJHA 1NAAA 3AECA 3AEEA 4GR1A 4IA6A 4CCRA 2GVCA 1DXLA 5TR3A 2X8HA 5BUKA 4BK2A 5KMPA 2RGJA 4EM3A 2X8GA 2XLTA 3UOXA 1YKJA 3QSEA
chains in the Genus database with same CATH topology
4U2LA 3UOZA 4H50A 4K8DA 3K7QX 2EQ8A 4J33A 4YTNA 1Z6LA 3KPFA 3HYVA 4YWOA 2XFUA 3UOYA 1H6VA 5FS6A 3ATQA 2BK3A 1IUSA 5JCKA 3LXDA 3CNJA 4Z2TA 3EF6A 5KMSA 2YLXA 4TM1A 1DODA 1YQ4A 3BNUA 2CVJA 4H4YA 2GMHA 1D5TA 1XPQA 3NK1X 1K4QA 3UTEA 1OJ9A 3AXBA 1N4VA 3M13A 4A5LA 4Z26A 5KNLA 2DKIA 1PS9A 3NLCA 3VRDB 1BGNA 2YLZA 3L1RA 4H2QA 4O5UA 3C4AA 3NN6X 1ZMDA 1TDOA 3LB8A 1JEHA 2YR4A 4II3A 3SGLA 1E39A 4U2SA 3AE4A 3NG7X 1NG4A 2BYBA 3DGHA 3F8PA 2R4JA 4U8KA 3FG2P 1MXTA 4OPCA 4ZCCA 3V3OA 1H84A 2B9YA 2WPCA 1VQWA 3NYCA 3BHKA 4GAVA 2YM1A 3DMEA 4YTPA 1MO9A 1VG0A 2E5VA 1RYIA 3PVCA 2PHHA 2WU2A 5FS9A 1RP0A 1PBBA 3IWAA 1GT8A 2IVEA 2XLUA 3DJDA 2BXSA 3AE8A 3QSSA 3NYEA 1K0JA 1CBOA 2JK6A 3UP4A 3M0OA 2BXRA 1GESA 2GV8A 5DBJA 3P4SA 1CC6A 1O94A 1Q9IA 3F8RA 2EQ9A 4OPGA 1XANA 4NTDA 3GD4A 4NZHA 3AD8B 3H4KA 1KNPA 4K2XA 1W4XA 2Q7VA 4B67A 1NEKA 1SEZA 3G5QA 1LV0A 2IVDA 4BJYA 1QO8A 3T2YA 1N4UA 3ATRA 4FK1A 1D7YA 1GRBA 2JB3A 3P9UA 1O5WA 4UDQA 2JB2A 5KRQA 5BVAA 1H86A 3AE9A 4XWRA 5JCNA 2DKHA 5FMHA 4JNAA 4U8PA 1GTHA 1BKWA 4N9XA 2XVHA 4CBQA 3S61A 4E0VA 1TRBA 2AAQA 4I58A 4G6HA 1OJAA 3QVPA 3DJJA 3AEDA 2RGHA 4LA1A 1UKVG 2XCGA 2Q6UA 1TYPA 5KVHA 2C64A 2Y6QA 3EAOA 4LIIA 4UDRA 3UKAA 1K0LA 3LADA 2R0GA 4H4WA 4CY6A 4C3YA 5JCLA 4Y4LA 4D03A 3K30A 1DJQA 3II4A 2Z5XA 4JQ9A 2GR0A 1TDEA 2GR1A 4G6GA 4JNQA 4GDPA 2XFQA 1FEAA 4H2PA 1GRAA 1M6IA 1CJ3A 4H2NA 1LJ1A 4P9SA 3UKPA 3UCLA 3ICTA 2A8XA 1M64A 1CHUA 2OA1A 1PBEA 4NWZA 3VRAA 4YT0A 2HQMA 3CGBA 2Y6RA 3DGZA 4H4UA 2C65A 2GF3A 3DK9A 2W0HA 1BGJA 2YLRA 3G5RA 5KMQA 4NEWA 2BS4A 2V61A 2TPRA 2GAGB 3K7TA 3T14A 1JOAA 3AYJA 1JRXA 1GETA 4Z44A 2R0PA 2IIDA 2YR6A 1EL8A 4WX1A 4A9WA 2WPFA 2WOWA 3CPJG 3CNSA 1F8RA 2TMDA 3NK0X 2H89A 1ZOYA 1XHCA 2V5ZA 1H82A 3CGEA 4J34A 4KPRA 1VDCA 3SM8A 1ZP0A 2F5ZA 2FJAA 1EL9A 2C7GA 2GH5A 3AE5A 1BWCA 3R9UA 2B7RA 4G9KA 1OJCA 4OPDA 4IA5A 3NTAA 3T2KA 3EPTA 1GALA 1E7PA 2WDVA 3GDPA 2VOUA 1KSSA 2BCGG 2EQ6A 3UP5A 2C75A 3HZLA 1F8SA 4Z2UA 2ARDA 4YSZA 1GPEA 2BCPA 2WDRA 4B66A 3CPHG 2WBAA 4Z43A 5ER0A 5KWFA 3NN0X 1GRTA 1LTXR 1PXCA 1LQTA 2BK4A 3AYLA 3P1WA 5M0ZA 3CNTA 4Z24A 1BF3A 3AEFA 5U63A 5EB5A 1MOKA 3AE2A 3NKSA 4U8IA 4A99A 2WOVA 5LV9A 2ZZBA 3GSIA 3RP7A 1PBFA 1YQZA 5HYMA 1O95A 1V59A 4I59A 3CTYA 5GSNA 1NHPA 2YG4A 4OPTA 1ZOVA 4HA6A 3REDA 3E1TA 5CKUA 1REOA 4WCTA 2EQ7A 3FPZA 1TDFA 2WESA 3SZFA 1E1KA 4J31A 4YKGA 3PO7A 4YXDA 4A6NA 1D7LA 1RSGA 2OAMA 3CNPA 4OVIA 4H7UA 3V76A 1NHQA 3FMWA 4JY2A 3ABVA 2YQUA 2C3CA 3NIXA 3NK2X 1ZKQA 2WU5A 3ALLA 4IVOB 4J2WA 3ITJA 4GAPA 1PJ6A 3S5WA 4BURA 4ZN0A 3H8LA 4H4PA 4H4XA 3SX6A 3SFDA 1GV4A 4B65A 1DNCA 3AE3A 3AE6A 1Y56A 3DA1A 1FEBA 3GRSA 5BULA 5IPYA 1CJCA 2GEWA 4REKA 3AB1A 1NHRA 2PYXA 3CIRA 5EOWA 1L0VA 4Z25A 1IUXA 1N4WA 3NGCX 4OPIA 3KA7A 4TLZA 1B37A 2FJDA 1PN0A 2YM2A 2VZ2A 3GMBA 1P2EA 1DJNA 4K7ZA 2QAEA 5J60A 3UTFA 1ZK7A 3NH3X 2XLPA 4O5QA 4BJZA 2ZZCA 3CN8A 4LU6A 2JB1A 4BV6A 3AYIA 4GF7A 3DK4A 3P4QA 1GRHA 3ALMA 4TLXA 3F8DA 3IHGA 1L9DA 3ISHA 5JCIA 4Z2RA 1JRYA 4NNJA 2E1MA 2JBVA 4X9NA 2APGA 3IF9A 2YG5A 1B4VA 5CQFA 5M10A 4MJWA 3Q9TA 3AWIA 5IQ1A 1H7XA 4B68A 4A65A 1PHHA 4U8MA 1H83A 1S3EA 4U2TA 3LJPA 2VVLG 1TDNA 2J3NA 3GYIA 3C96A 5U25A 2BACA 2WPEA 2ZBWA 3VR8A 1ZY8A 1X31B 2GR2A 4B1BA 4EMJA 1KDGA 4OCGA 4AT2A 1E1NA 3T0KA 2GAHB 4AP3A 3CPIG 2NVKX 2Q0LA 1K0IA 1VG9A 3DK8A 3CGDA 1ZMCA 3DH9A 1VRQB 2ZZ0A 3BNMA 5J7XA 3GYJA 3UKQA 3EANA 2BC1A 3VRBA 4AT0A 3DJGX 2E4GA 2VQ7A 2XVIA 3BI4A 1GERA 1QLBA 4K5SA 2WP9A 3VR9A 3SY4A 3GRTA 3FIMB 1JNRA 4H4VA 4USRA 1ZDLA 4K22A 1COYA 1D4EA 1YY5A 1GSNA 2XLRA 4X4JA 2FBWA 5IQ4A 2A87A 4U8NA 3L8KA 2I0ZA 3WE0A 2GQFA 1NHSA 2Z5YA 2A89A 3ICRA 2X50A 4U8LA 3UKHA 3KPKA 2V6OA 2XFPA 4A79A 3Q6JA 2R45A 4EQRA 3KLJA 4AOXA 3LOVA 2WQYA 4DSHA 2FJBA 3UKFA 5KMRA 1NPXA 2YG6A 3COXA 4GRTA 3UTGA 1FECA 2V3BA 4UP3A 2UZZA 2XLSA 1B8SA 4GUVA 4IVMB 4XWZA 4II2A 3SZCA 3PS9A 1H7WA 5KVIA 5C3JA 2XVEA 4GDEA 2V3AA 1D4CA 1LPFA 2BS2A 4YSYA 5JCMA 4YKFA 3C4NA 3SZWA 2YAUA 2XFOA 4EMIA 1BZLA 1E6EA 1CL0A 3OC4A 1JRZA 2XDOA 4U8OA 1NENA 4YSHA 1EBDA 4ECHA 2OLOA 1CJ4A 1Y0PA 4PABA 5L46A 4JN9A 4EQXA 3UOVA 2WS3A 2WDQA 3AE1A 4AP1A 4B64A 1LQUA 3B6DA 1IUVA 3CGCA 3T31A 2WEUA 1ZX9A 4RG3A 1L9CA 1H81A 1PXAA 1F8WA 2WETA 4DNAA 1PDHA 2YLTA 1EL7A 4OPUA 3RP8A 3FBSA 1NG3A 2QA1A 1TDKA 3NNEA 2B9XA 1ONFA 4C3XA 3SFEA 4C74A 5HXIA 2WP6A 1KSUA 3CNDA 4IV9A 3UKLA 2B7SA 1FCDA 1GRGA 5U1OA 2VRLA 2C3DA 4CNKA 3V3NA 2VVMA 1CF3A 4RSLA 1N1PA 4M52A 4YSXA 3T37A 4CRTA 3AEGA 4EIPA 2QA2A 2R46A 1OJDA 4A6NB 2FJEA 5EB4A 3NYFA 4H4TA 4CNJA 1GEUA 3G5SA 3I3LA 4FX9A 2BABA 2QCUA 2GR3A 4OPLA 5EBKA 3BI5A 2X99A 2X8CA 1S3BA 2CFYA 3AD7B 3GWDA 4J36A 3JSKA 3GYXA 3LZWA 2WHDA 3NTDA 1PJ7A 5HHFA 2R4EA 5BRTA 1YQ3A 2VRMA 3AEAA 1Y56B 5GRTA 1B5QA 3K7MX 4C5OA 3GMCA 2R9ZA 4H4RA 1DOCA 2OALA 1P2HA 3ADAB 3VQRA 4XXGA 4PAAA 2WOIA 1S2YA 1PJ5A 5KOXA 3AEBA 4H2RA 1JU2A 2GMJA 2YLWA 2B76A 1LVLA 2C4CA 4B63A 2C76A 2YVJA 2XVFA 4K5RA 3AD9B 4HB9A 4JY3A 4NEVA 3SYIA 3H8IA 2YVFA 3QVRA 2YWLA 1CC2A 1E1MA 2BA9A 1FL2A 4FDCB 4H4SA 4NTEA 4EIQA 1CC4A 4EMWA 2AR8A 4APNA 4KX6A 1IUTA 4AOSA 2B9WA 3M12A 3NHOX 1NDAA 1GRFA 2JKCA 3QJ4A 1KNRA 4TM4A 1F3PA 1OJTA 3O0HA 4RG4A 4X9MA 2BS3A 2VVLA 2Q0KA 3T2ZA 4ADWA 2GB0A 4A7AA 3UKKA 1F6MA 2XVJA 4J57A 3B3RA 3RNMA 4B69A 3SQPA 2RABA 2R0CA 1GOSA 1TYTA 3QFAA 3KKJA 2YLSA 2NPXA 4J56A 1GREA 3QFBA 3IHMA 1AOGA 3KVEA 2BK5A 4EQSA 4TM3A 3NRNA 4CY8A 1PBDA 2CULA 2OLNA 3AE7A 2JAEA 2YG3A 3SZ0A 4G74A 4G73A 2WP5A 4EM4A 3HYWA 3HYXA 2YR5A 3D8XA 5C2TA 4JDRA 2X3NA 1GTEA 4GCMA 2C70A 1DOEA 2C67A 3D1CA 2GQWA 4Y4NA 3P4RA 1GXFA 1HYUA 1QJDA 1XDIA 2GRTA 4U8JA 4C77A 4DSGA 4D04A 1KF6A 3BI2A 4DGKA 1PBCA 4BK1A 4USQA 4CCQA 4EQWA 3RHAA 3OZ2A 2YVGA 3KU9A 1L9EA 3GD3A 3DJEA 1IUUA 2V60A 3P4PA 3IC9A 3QSMA 2ACZA 4H4ZA 1CJ2A 4NTCA 1IUWA 3RP6A 2H88A 1PXBA 2AQJA 2BRAA 3BHFA 3CMMA 3LZXA 5KXJA 1KFYA 2YG7A 2CDUA 4H4QA 1E1LA 1EL5A 3I6DA 3KD9A 4ICYA 4Y4MA 3GDNA 5FS7A 1Q1WA 5HY5A 3URHA 1Q1RA 4UDPA 2XYOA 1D4DA 4ZCDA 2C72A 1ELIA 3GWFA 2C66A 1DOBA 3ZYXA 3ALJA 1S2QA 2BC0A 2XFNA 4TM0A 1JNZA 2O9ZA 3UTHA 3ZDNA 2BRYA 3ICSA 4BK3A 1FOHA 5FS8A 5KOWA 2C73A 3NT6A 3SXIA 1GNDA 4YTMA 2RGOA 4FK1C 2VQBA 1IJHA 1NAAA 3AECA 3AEEA 4GR1A 4IA6A 4CCRA 2GVCA 1DXLA 5TR3A 2X8HA 5BUKA 4BK2A 5KMPA 2RGJA 4EM3A 2X8GA 2XLTA 3UOXA 1YKJA 3QSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U2L A;  3UOZ A;  4H50 A;  4K8D A;  3K7Q X;  2EQ8 A;  4J33 A;  4YTN A;  1Z6L A;  3KPF A;  4YWO A;  2XFU A;  3UOY A;  1H6V A;  5FS6 A;  3ATQ A;  2BK3 A;  1IUS A;  5JCK A;  3LXD A;  3CNJ A;  4Z2T A;  3EF6 A;  2YLX A;  4TM1 A;  1DOD A;  1YQ4 A;  3BNU A;  2CVJ A;  4H4Y A;  2GMH A;  1D5T A;  1XPQ A;  3NK1 X;  1K4Q A;  3UTE A;  1OJ9 A;  3AXB A;  1N4V A;  3M13 A;  4A5L A;  4Z26 A;  2DKI A;  1PS9 A;  3NLC A;  3VRD B;  1BGN A;  2YLZ A;  3L1R A;  4H2Q A;  4O5U A;  3C4A A;  3NN6 X;  1ZMD A;  1TDO A;  3LB8 A;  1JEH A;  2YR4 A;  3SGL A;  1E39 A;  4U2S A;  3AE4 A;  3NG7 X;  1NG4 A;  2BYB A;  3DGH A;  3F8P A;  2R4J A;  4U8K A;  3FG2 P;  1MXT A;  4OPC A;  4ZCC A;  3V3O A;  1H84 A;  2B9Y A;  2WPC A;  1VQW A;  3NYC A;  3BHK A;  2YM1 A;  3DME A;  4YTP A;  1MO9 A;  1VG0 A;  2E5V A;  1RYI A;  3PVC A;  2PHH A;  2WU2 A;  5FS9 A;  1RP0 A;  1PBB A;  3IWA A;  1GT8 A;  2IVE A;  2XLU A;  3DJD A;  2BXS A;  3AE8 A;  3QSS A;  3NYE A;  1K0J A;  1CBO A;  2JK6 A;  3UP4 A;  3M0O A;  2BXR A;  1GES A;  2GV8 A;  5DBJ A;  3P4S A;  1CC6 A;  1O94 A;  1Q9I A;  3F8R A;  2EQ9 A;  4OPG A;  1XAN A;  4NTD A;  3GD4 A;  4NZH A;  3AD8 B;  3H4K A;  1KNP A;  4K2X A;  1W4X A;  2Q7V A;  4B67 A;  1NEK A;  1SEZ A;  3G5Q A;  1LV0 A;  2IVD A;  4BJY A;  1QO8 A;  1N4U A;  3ATR A;  4FK1 A;  1D7Y A;  1GRB A;  2JB3 A;  3P9U A;  1O5W A;  4UDQ A;  2JB2 A;  5KRQ A;  5BVA A;  1H86 A;  3AE9 A;  4XWR A;  5JCN A;  2DKH A;  5FMH A;  4JNA A;  4U8P A;  1GTH A;  1BKW A;  4N9X A;  2XVH A;  4CBQ A;  3S61 A;  4E0V A;  1TRB A;  2AAQ A;  4I58 A;  1OJA A;  3QVP A;  3DJJ A;  3AED A;  2RGH A;  4LA1 A;  1UKV G;  2XCG A;  2Q6U A;  1TYP A;  5KVH A;  2C64 A;  2Y6Q A;  3EAO A;  4LII A;  4UDR A;  3UKA A;  1K0L A;  3LAD A;  2R0G A;  4H4W A;  4CY6 A;  4C3Y A;  5JCL A;  4Y4L A;  4D03 A;  3K30 A;  1DJQ A;  3II4 A;  2Z5X A;  4JQ9 A;  2GR0 A;  1TDE A;  2GR1 A;  4JNQ A;  4GDP A;  2XFQ A;  1FEA A;  4H2P A;  1GRA A;  1M6I A;  1CJ3 A;  4H2N A;  1LJ1 A;  4P9S A;  3UKP A;  3UCL A;  3ICT A;  2A8X A;  1M64 A;  1CHU A;  2OA1 A;  1PBE A;  3VRA A;  4YT0 A;  2HQM A;  3CGB A;  2Y6R A;  3DGZ A;  4H4U A;  2C65 A;  2GF3 A;  3DK9 A;  2W0H A;  1BGJ A;  2YLR A;  3G5R A;  4NEW A;  2BS4 A;  2V61 A;  2TPR A;  2GAG B;  3K7T A;  1JOA A;  3AYJ A;  1JRX A;  1GET A;  4Z44 A;  2R0P A;  2IID A;  2YR6 A;  1EL8 A;  4WX1 A;  4A9W A;  2WPF A;  2WOW A;  3CPJ G;  3CNS A;  1F8R A;  2TMD A;  3NK0 X;  2H89 A;  1ZOY A;  1XHC A;  2V5Z A;  1H82 A;  3CGE A;  4J34 A;  4KPR A;  1VDC A;  3SM8 A;  1ZP0 A;  2F5Z A;  2FJA A;  1EL9 A;  2C7G A;  2GH5 A;  3AE5 A;  1BWC A;  3R9U A;  2B7R A;  1OJC A;  4OPD A;  4IA5 A;  3NTA A;  3EPT A;  1GAL A;  1E7P A;  2WDV A;  3GDP A;  2VOU A;  1KSS A;  2BCG G;  2EQ6 A;  3UP5 A;  2C75 A;  3HZL A;  1F8S A;  4Z2U A;  2ARD A;  4YSZ A;  1GPE A;  2BCP A;  2WDR A;  4B66 A;  3CPH G;  2WBA A;  4Z43 A;  5ER0 A;  5KWF A;  3NN0 X;  1GRT A;  1LTX R;  1PXC A;  1LQT A;  2BK4 A;  3AYL A;  3P1W A;  5M0Z A;  3CNT A;  4Z24 A;  1BF3 A;  3AEF A;  5U63 A;  5EB5 A;  1MOK A;  3AE2 A;  3NKS A;  4U8I A;  4A99 A;  2WOV A;  5LV9 A;  2ZZB A;  3GSI A;  3RP7 A;  1PBF A;  1YQZ A;  5HYM A;  1O95 A;  1V59 A;  4I59 A;  3CTY A;  5GSN A;  1NHP A;  2YG4 A;  4OPT A;  1ZOV A;  4HA6 A;  3RED A;  3E1T A;  5CKU A;  1REO A;  4WCT A;  2EQ7 A;  3FPZ A;  1TDF A;  2WES A;  1E1K A;  4J31 A;  4YKG A;  3PO7 A;  4YXD A;  4A6N A;  1D7L A;  1RSG A;  2OAM A;  3CNP A;  4OVI A;  4H7U A;  3V76 A;  1NHQ A;  3FMW A;  4JY2 A;  3ABV A;  2YQU A;  2C3C A;  3NIX A;  3NK2 X;  1ZKQ A;  2WU5 A;  3ALL A;  4IVO B;  4J2W A;  3ITJ A;  3S5W A;  1PJ6 A;  4BUR A;  4ZN0 A;  3H8L A;  4H4P A;  4H4X A;  3SFD A;  1GV4 A;  4B65 A;  1DNC A;  3AE3 A;  3AE6 A;  1Y56 A;  3DA1 A;  1FEB A;  3GRS A;  5BUL A;  5IPY A;  1CJC A;  2GEW A;  4REK A;  3AB1 A;  1NHR A;  2PYX A;  3CIR A;  5EOW A;  1L0V A;  4Z25 A;  1IUX A;  1N4W A;  3NGC X;  4OPI A;  3KA7 A;  4TLZ A;  1B37 A;  2FJD A;  1PN0 A;  2YM2 A;  2VZ2 A;  3GMB A;  1P2E A;  1DJN A;  4K7Z A;  2QAE A;  5J60 A;  3UTF A;  1ZK7 A;  3NH3 X;  2XLP A;  4O5Q A;  4BJZ A;  2ZZC A;  3CN8 A;  4LU6 A;  2JB1 A;  4BV6 A;  3AYI A;  4GF7 A;  3DK4 A;  3P4Q A;  1GRH A;  3ALM A;  4TLX A;  3F8D A;  3IHG A;  1L9D A;  3ISH A;  5JCI A;  4Z2R A;  1JRY A;  2E1M A;  2JBV A;  4X9N A;  2APG A;  3IF9 A;  2YG5 A;  1B4V A;  5CQF A;  5M10 A;  4MJW A;  3Q9T A;  3AWI A;  5IQ1 A;  1H7X A;  4B68 A;  4A65 A;  1PHH A;  4U8M A;  1H83 A;  1S3E A;  4U2T A;  3LJP A;  2VVL G;  1TDN A;  2J3N A;  3GYI A;  3C96 A;  5U25 A;  2BAC A;  2WPE A;  2ZBW A;  3VR8 A;  1ZY8 A;  1X31 B;  2GR2 A;  4B1B A;  4EMJ A;  1KDG A;  4OCG A;  4AT2 A;  1E1N A;  2GAH B;  4AP3 A;  3CPI G;  2NVK X;  2Q0L A;  1K0I A;  1VG9 A;  3DK8 A;  3CGD A;  1ZMC A;  3DH9 A;  1VRQ B;  2ZZ0 A;  3BNM A;  5J7X A;  3GYJ A;  3UKQ A;  3EAN A;  2BC1 A;  3VRB A;  4AT0 A;  3DJG X;  2E4G A;  2VQ7 A;  2XVI A;  3BI4 A;  1GER A;  1QLB A;  4K5S A;  2WP9 A;  3VR9 A;  3GRT A;  3FIM B;  1JNR A;  4H4V A;  4USR A;  1ZDL A;  4K22 A;  1COY A;  1D4E A;  1YY5 A;  1GSN A;  2XLR A;  4X4J A;  2FBW A;  5IQ4 A;  2A87 A;  4U8N A;  3L8K A;  2I0Z A;  3WE0 A;  2GQF A;  1NHS A;  2Z5Y A;  2A89 A;  3ICR A;  2X50 A;  4U8L A;  3UKH A;  2V6O A;  2XFP A;  4A79 A;  3Q6J A;  2R45 A;  4EQR A;  3KLJ A;  4AOX A;  3LOV A;  2WQY A;  4DSH A;  2FJB A;  3UKF A;  1NPX A;  2YG6 A;  3COX A;  4GRT A;  3UTG A;  1FEC A;  2V3B A;  4UP3 A;  2UZZ A;  2XLS A;  1B8S A;  4GUV A;  4IVM B;  4XWZ A;  3PS9 A;  1H7W A;  5KVI A;  5C3J A;  2XVE A;  4GDE A;  2V3A A;  1D4C A;  1LPF A;  2BS2 A;  4YSY A;  5JCM A;  4YKF A;  3C4N A;  2YAU A;  2XFO A;  4EMI A;  1BZL A;  1E6E A;  1CL0 A;  3OC4 A;  1JRZ A;  2XDO A;  4U8O A;  1NEN A;  4YSH A;  1EBD A;  4ECH A;  2OLO A;  1CJ4 A;  1Y0P A;  4PAB A;  5L46 A;  4JN9 A;  4EQX A;  3UOV A;  2WS3 A;  2WDQ A;  3AE1 A;  4AP1 A;  4B64 A;  1LQU A;  3B6D A;  1IUV A;  3CGC A;  2WEU A;  1ZX9 A;  4RG3 A;  1L9C A;  1H81 A;  1PXA A;  1F8W A;  2WET A;  4DNA A;  1PDH A;  2YLT A;  1EL7 A;  4OPU A;  3RP8 A;  3FBS A;  1NG3 A;  2QA1 A;  1TDK A;  3NNE A;  2B9X A;  1ONF A;  4C3X A;  3SFE A;  4C74 A;  5HXI A;  2WP6 A;  1KSU A;  3CND A;  4IV9 A;  3UKL A;  2B7S A;  1FCD A;  1GRG A;  5U1O A;  2VRL A;  2C3D A;  4CNK A;  3V3N A;  2VVM A;  1CF3 A;  4RSL A;  1N1P A;  4M52 A;  4YSX A;  3T37 A;  4CRT A;  3AEG A;  4EIP A;  2QA2 A;  2R46 A;  1OJD A;  4A6N B;  2FJE A;  5EB4 A;  3NYF A;  4H4T A;  4CNJ A;  1GEU A;  3G5S A;  3I3L A;  4FX9 A;  2BAB A;  2QCU A;  2GR3 A;  4OPL A;  5EBK A;  3BI5 A;  2X99 A;  2X8C A;  1S3B A;  2CFY A;  3AD7 B;  3GWD A;  4J36 A;  3JSK A;  3LZW A;  2WHD A;  3NTD A;  1PJ7 A;  5HHF A;  2R4E A;  5BRT A;  1YQ3 A;  2VRM A;  3AEA A;  1Y56 B;  5GRT A;  1B5Q A;  3K7M X;  4C5O A;  3GMC A;  2R9Z A;  4H4R A;  1DOC A;  2OAL A;  1P2H A;  3ADA B;  3VQR A;  4XXG A;  4PAA A;  2WOI A;  1S2Y A;  1PJ5 A;  5KOX A;  3AEB A;  4H2R A;  1JU2 A;  2GMJ A;  2YLW A;  2B76 A;  1LVL A;  4B63 A;  2C76 A;  2YVJ A;  2XVF A;  4K5R A;  3AD9 B;  4HB9 A;  4JY3 A;  4NEV A;  3H8I A;  2YVF A;  3QVR A;  2YWL A;  1CC2 A;  1E1M A;  2BA9 A;  1FL2 A;  4FDC B;  4H4S A;  4NTE A;  4EIQ A;  1CC4 A;  4EMW A;  2AR8 A;  4APN A;  4KX6 A;  1IUT A;  4AOS A;  2B9W A;  3M12 A;  3NHO X;  1NDA A;  1GRF A;  2JKC A;  3QJ4 A;  1KNR A;  4TM4 A;  1F3P A;  1OJT A;  3O0H A;  4RG4 A;  4X9M A;  2BS3 A;  2VVL A;  2Q0K A;  4ADW A;  2GB0 A;  4A7A A;  3UKK A;  1F6M A;  2XVJ A;  4J57 A;  3B3R A;  3RNM A;  4B69 A;  3SQP A;  2RAB A;  2R0C A;  1GOS A;  1TYT A;  3QFA A;  3KKJ A;  2YLS A;  2NPX A;  4J56 A;  1GRE A;  3QFB A;  3IHM A;  1AOG A;  3KVE A;  2BK5 A;  4EQS A;  4TM3 A;  3NRN A;  4CY8 A;  1PBD A;  2CUL A;  2OLN A;  3AE7 A;  2JAE A;  2YG3 A;  2WP5 A;  4EM4 A;  2YR5 A;  3D8X A;  5C2T A;  4JDR A;  2X3N A;  1GTE A;  4GCM A;  2C70 A;  1DOE A;  2C67 A;  3D1C A;  2GQW A;  4Y4N A;  3P4R A;  1GXF A;  1HYU A;  1QJD A;  1XDI A;  2GRT A;  4U8J A;  4C77 A;  4DSG A;  4D04 A;  1KF6 A;  3BI2 A;  4DGK A;  1PBC A;  4BK1 A;  4USQ A;  4CCQ A;  4EQW A;  3RHA A;  3OZ2 A;  2YVG A;  3KU9 A;  1L9E A;  3GD3 A;  3DJE A;  1IUU A;  2V60 A;  3P4P A;  3IC9 A;  3QSM A;  2ACZ A;  4H4Z A;  1CJ2 A;  4NTC A;  1IUW A;  3RP6 A;  2H88 A;  1PXB A;  2AQJ A;  3LZX A;  3BHF A;  5KXJ A;  1KFY A;  2YG7 A;  2CDU A;  4H4Q A;  1E1L A;  1EL5 A;  3I6D A;  3KD9 A;  4ICY A;  4Y4M A;  3GDN A;  5FS7 A;  1Q1W A;  5HY5 A;  3URH A;  1Q1R A;  4UDP A;  2XYO A;  1D4D A;  4ZCD A;  2C72 A;  1ELI A;  3GWF A;  2C66 A;  1DOB A;  3ZYX A;  3ALJ A;  1S2Q A;  2BC0 A;  2XFN A;  4TM0 A;  1JNZ A;  2O9Z A;  3UTH A;  3ZDN A;  3ICS A;  4BK3 A;  1FOH A;  5FS8 A;  5KOW A;  2C73 A;  3NT6 A;  1GND A;  4YTM A;  2RGO A;  4FK1 C;  2VQB A;  1IJH A;  1NAA A;  3AEC A;  3AEE A;  4GR1 A;  4IA6 A;  4CCR A;  2GVC A;  1DXL A;  5TR3 A;  2X8H A;  5BUK A;  4BK2 A;  2RGJ A;  4EM3 A;  2X8G A;  2XLT A;  3UOX A;  1YKJ A;  3QSE A; 
#chains in the Genus database with same CATH topology
 4U2L A;  3UOZ A;  4H50 A;  4K8D A;  3K7Q X;  2EQ8 A;  4J33 A;  4YTN A;  1Z6L A;  3KPF A;  3HYV A;  4YWO A;  2XFU A;  3UOY A;  1H6V A;  5FS6 A;  3ATQ A;  2BK3 A;  1IUS A;  5JCK A;  3LXD A;  3CNJ A;  4Z2T A;  3EF6 A;  5KMS A;  2YLX A;  4TM1 A;  1DOD A;  1YQ4 A;  3BNU A;  2CVJ A;  4H4Y A;  2GMH A;  1D5T A;  1XPQ A;  3NK1 X;  1K4Q A;  3UTE A;  1OJ9 A;  3AXB A;  1N4V A;  3M13 A;  4A5L A;  4Z26 A;  5KNL A;  2DKI A;  1PS9 A;  3NLC A;  3VRD B;  1BGN A;  2YLZ A;  3L1R A;  4H2Q A;  4O5U A;  3C4A A;  3NN6 X;  1ZMD A;  1TDO A;  3LB8 A;  1JEH A;  2YR4 A;  4II3 A;  3SGL A;  1E39 A;  4U2S A;  3AE4 A;  3NG7 X;  1NG4 A;  2BYB A;  3DGH A;  3F8P A;  2R4J A;  4U8K A;  3FG2 P;  1MXT A;  4OPC A;  4ZCC A;  3V3O A;  1H84 A;  2B9Y A;  2WPC A;  1VQW A;  3NYC A;  3BHK A;  4GAV A;  2YM1 A;  3DME A;  4YTP A;  1MO9 A;  1VG0 A;  2E5V A;  1RYI A;  3PVC A;  2PHH A;  2WU2 A;  5FS9 A;  1RP0 A;  1PBB A;  3IWA A;  1GT8 A;  2IVE A;  2XLU A;  3DJD A;  2BXS A;  3AE8 A;  3QSS A;  3NYE A;  1K0J A;  1CBO A;  2JK6 A;  3UP4 A;  3M0O A;  2BXR A;  1GES A;  2GV8 A;  5DBJ A;  3P4S A;  1CC6 A;  1O94 A;  1Q9I A;  3F8R A;  2EQ9 A;  4OPG A;  1XAN A;  4NTD A;  3GD4 A;  4NZH A;  3AD8 B;  3H4K A;  1KNP A;  4K2X A;  1W4X A;  2Q7V A;  4B67 A;  1NEK A;  1SEZ A;  3G5Q A;  1LV0 A;  2IVD A;  4BJY A;  1QO8 A;  3T2Y A;  1N4U A;  3ATR A;  4FK1 A;  1D7Y A;  1GRB A;  2JB3 A;  3P9U A;  1O5W A;  4UDQ A;  2JB2 A;  5KRQ A;  5BVA A;  1H86 A;  3AE9 A;  4XWR A;  5JCN A;  2DKH A;  5FMH A;  4JNA A;  4U8P A;  1GTH A;  1BKW A;  4N9X A;  2XVH A;  4CBQ A;  3S61 A;  4E0V A;  1TRB A;  2AAQ A;  4I58 A;  4G6H A;  1OJA A;  3QVP A;  3DJJ A;  3AED A;  2RGH A;  4LA1 A;  1UKV G;  2XCG A;  2Q6U A;  1TYP A;  5KVH A;  2C64 A;  2Y6Q A;  3EAO A;  4LII A;  4UDR A;  3UKA A;  1K0L A;  3LAD A;  2R0G A;  4H4W A;  4CY6 A;  4C3Y A;  5JCL A;  4Y4L A;  4D03 A;  3K30 A;  1DJQ A;  3II4 A;  2Z5X A;  4JQ9 A;  2GR0 A;  1TDE A;  2GR1 A;  4G6G A;  4JNQ A;  4GDP A;  2XFQ A;  1FEA A;  4H2P A;  1GRA A;  1M6I A;  1CJ3 A;  4H2N A;  1LJ1 A;  4P9S A;  3UKP A;  3UCL A;  3ICT A;  2A8X A;  1M64 A;  1CHU A;  2OA1 A;  1PBE A;  4NWZ A;  3VRA A;  4YT0 A;  2HQM A;  3CGB A;  2Y6R A;  3DGZ A;  4H4U A;  2C65 A;  2GF3 A;  3DK9 A;  2W0H A;  1BGJ A;  2YLR A;  3G5R A;  5KMQ A;  4NEW A;  2BS4 A;  2V61 A;  2TPR A;  2GAG B;  3K7T A;  3T14 A;  1JOA A;  3AYJ A;  1JRX A;  1GET A;  4Z44 A;  2R0P A;  2IID A;  2YR6 A;  1EL8 A;  4WX1 A;  4A9W A;  2WPF A;  2WOW A;  3CPJ G;  3CNS A;  1F8R A;  2TMD A;  3NK0 X;  2H89 A;  1ZOY A;  1XHC A;  2V5Z A;  1H82 A;  3CGE A;  4J34 A;  4KPR A;  1VDC A;  3SM8 A;  1ZP0 A;  2F5Z A;  2FJA A;  1EL9 A;  2C7G A;  2GH5 A;  3AE5 A;  1BWC A;  3R9U A;  2B7R A;  4G9K A;  1OJC A;  4OPD A;  4IA5 A;  3NTA A;  3T2K A;  3EPT A;  1GAL A;  1E7P A;  2WDV A;  3GDP A;  2VOU A;  1KSS A;  2BCG G;  2EQ6 A;  3UP5 A;  2C75 A;  3HZL A;  1F8S A;  4Z2U A;  2ARD A;  4YSZ A;  1GPE A;  2BCP A;  2WDR A;  4B66 A;  3CPH G;  2WBA A;  4Z43 A;  5ER0 A;  5KWF A;  3NN0 X;  1GRT A;  1LTX R;  1PXC A;  1LQT A;  2BK4 A;  3AYL A;  3P1W A;  5M0Z A;  3CNT A;  4Z24 A;  1BF3 A;  3AEF A;  5U63 A;  5EB5 A;  1MOK A;  3AE2 A;  3NKS A;  4U8I A;  4A99 A;  2WOV A;  5LV9 A;  2ZZB A;  3GSI A;  3RP7 A;  1PBF A;  1YQZ A;  5HYM A;  1O95 A;  1V59 A;  4I59 A;  3CTY A;  5GSN A;  1NHP A;  2YG4 A;  4OPT A;  1ZOV A;  4HA6 A;  3RED A;  3E1T A;  5CKU A;  1REO A;  4WCT A;  2EQ7 A;  3FPZ A;  1TDF A;  2WES A;  3SZF A;  1E1K A;  4J31 A;  4YKG A;  3PO7 A;  4YXD A;  4A6N A;  1D7L A;  1RSG A;  2OAM A;  3CNP A;  4OVI A;  4H7U A;  3V76 A;  1NHQ A;  3FMW A;  4JY2 A;  3ABV A;  2YQU A;  2C3C A;  3NIX A;  3NK2 X;  1ZKQ A;  2WU5 A;  3ALL A;  4IVO B;  4J2W A;  3ITJ A;  4GAP A;  1PJ6 A;  3S5W A;  4BUR A;  4ZN0 A;  3H8L A;  4H4P A;  4H4X A;  3SX6 A;  3SFD A;  1GV4 A;  4B65 A;  1DNC A;  3AE3 A;  3AE6 A;  1Y56 A;  3DA1 A;  1FEB A;  3GRS A;  5BUL A;  5IPY A;  1CJC A;  2GEW A;  4REK A;  3AB1 A;  1NHR A;  2PYX A;  3CIR A;  5EOW A;  1L0V A;  4Z25 A;  1IUX A;  1N4W A;  3NGC X;  4OPI A;  3KA7 A;  4TLZ A;  1B37 A;  2FJD A;  1PN0 A;  2YM2 A;  2VZ2 A;  3GMB A;  1P2E A;  1DJN A;  4K7Z A;  2QAE A;  5J60 A;  3UTF A;  1ZK7 A;  3NH3 X;  2XLP A;  4O5Q A;  4BJZ A;  2ZZC A;  3CN8 A;  4LU6 A;  2JB1 A;  4BV6 A;  3AYI A;  4GF7 A;  3DK4 A;  3P4Q A;  1GRH A;  3ALM A;  4TLX A;  3F8D A;  3IHG A;  1L9D A;  3ISH A;  5JCI A;  4Z2R A;  1JRY A;  4NNJ A;  2E1M A;  2JBV A;  4X9N A;  2APG A;  3IF9 A;  2YG5 A;  1B4V A;  5CQF A;  5M10 A;  4MJW A;  3Q9T A;  3AWI A;  5IQ1 A;  1H7X A;  4B68 A;  4A65 A;  1PHH A;  4U8M A;  1H83 A;  1S3E A;  4U2T A;  3LJP A;  2VVL G;  1TDN A;  2J3N A;  3GYI A;  3C96 A;  5U25 A;  2BAC A;  2WPE A;  2ZBW A;  3VR8 A;  1ZY8 A;  1X31 B;  2GR2 A;  4B1B A;  4EMJ A;  1KDG A;  4OCG A;  4AT2 A;  1E1N A;  3T0K A;  2GAH B;  4AP3 A;  3CPI G;  2NVK X;  2Q0L A;  1K0I A;  1VG9 A;  3DK8 A;  3CGD A;  1ZMC A;  3DH9 A;  1VRQ B;  2ZZ0 A;  3BNM A;  5J7X A;  3GYJ A;  3UKQ A;  3EAN A;  2BC1 A;  3VRB A;  4AT0 A;  3DJG X;  2E4G A;  2VQ7 A;  2XVI A;  3BI4 A;  1GER A;  1QLB A;  4K5S A;  2WP9 A;  3VR9 A;  3SY4 A;  3GRT A;  3FIM B;  1JNR A;  4H4V A;  4USR A;  1ZDL A;  4K22 A;  1COY A;  1D4E A;  1YY5 A;  1GSN A;  2XLR A;  4X4J A;  2FBW A;  5IQ4 A;  2A87 A;  4U8N A;  3L8K A;  2I0Z A;  3WE0 A;  2GQF A;  1NHS A;  2Z5Y A;  2A89 A;  3ICR A;  2X50 A;  4U8L A;  3UKH A;  3KPK A;  2V6O A;  2XFP A;  4A79 A;  3Q6J A;  2R45 A;  4EQR A;  3KLJ A;  4AOX A;  3LOV A;  2WQY A;  4DSH A;  2FJB A;  3UKF A;  5KMR A;  1NPX A;  2YG6 A;  3COX A;  4GRT A;  3UTG A;  1FEC A;  2V3B A;  4UP3 A;  2UZZ A;  2XLS A;  1B8S A;  4GUV A;  4IVM B;  4XWZ A;  4II2 A;  3SZC A;  3PS9 A;  1H7W A;  5KVI A;  5C3J A;  2XVE A;  4GDE A;  2V3A A;  1D4C A;  1LPF A;  2BS2 A;  4YSY A;  5JCM A;  4YKF A;  3C4N A;  3SZW A;  2YAU A;  2XFO A;  4EMI A;  1BZL A;  1E6E A;  1CL0 A;  3OC4 A;  1JRZ A;  2XDO A;  4U8O A;  1NEN A;  4YSH A;  1EBD A;  4ECH A;  2OLO A;  1CJ4 A;  1Y0P A;  4PAB A;  5L46 A;  4JN9 A;  4EQX A;  3UOV A;  2WS3 A;  2WDQ A;  3AE1 A;  4AP1 A;  4B64 A;  1LQU A;  3B6D A;  1IUV A;  3CGC A;  3T31 A;  2WEU A;  1ZX9 A;  4RG3 A;  1L9C A;  1H81 A;  1PXA A;  1F8W A;  2WET A;  4DNA A;  1PDH A;  2YLT A;  1EL7 A;  4OPU A;  3RP8 A;  3FBS A;  1NG3 A;  2QA1 A;  1TDK A;  3NNE A;  2B9X A;  1ONF A;  4C3X A;  3SFE A;  4C74 A;  5HXI A;  2WP6 A;  1KSU A;  3CND A;  4IV9 A;  3UKL A;  2B7S A;  1FCD A;  1GRG A;  5U1O A;  2VRL A;  2C3D A;  4CNK A;  3V3N A;  2VVM A;  1CF3 A;  4RSL A;  1N1P A;  4M52 A;  4YSX A;  3T37 A;  4CRT A;  3AEG A;  4EIP A;  2QA2 A;  2R46 A;  1OJD A;  4A6N B;  2FJE A;  5EB4 A;  3NYF A;  4H4T A;  4CNJ A;  1GEU A;  3G5S A;  3I3L A;  4FX9 A;  2BAB A;  2QCU A;  2GR3 A;  4OPL A;  5EBK A;  3BI5 A;  2X99 A;  2X8C A;  1S3B A;  2CFY A;  3AD7 B;  3GWD A;  4J36 A;  3JSK A;  3GYX A;  3LZW A;  2WHD A;  3NTD A;  1PJ7 A;  5HHF A;  2R4E A;  5BRT A;  1YQ3 A;  2VRM A;  3AEA A;  1Y56 B;  5GRT A;  1B5Q A;  3K7M X;  4C5O A;  3GMC A;  2R9Z A;  4H4R A;  1DOC A;  2OAL A;  1P2H A;  3ADA B;  3VQR A;  4XXG A;  4PAA A;  2WOI A;  1S2Y A;  1PJ5 A;  5KOX A;  3AEB A;  4H2R A;  1JU2 A;  2GMJ A;  2YLW A;  2B76 A;  1LVL A;  2C4C A;  4B63 A;  2C76 A;  2YVJ A;  2XVF A;  4K5R A;  3AD9 B;  4HB9 A;  4JY3 A;  4NEV A;  3SYI A;  3H8I A;  2YVF A;  3QVR A;  2YWL A;  1CC2 A;  1E1M A;  2BA9 A;  1FL2 A;  4FDC B;  4H4S A;  4NTE A;  4EIQ A;  1CC4 A;  4EMW A;  2AR8 A;  4APN A;  4KX6 A;  1IUT A;  4AOS A;  2B9W A;  3M12 A;  3NHO X;  1NDA A;  1GRF A;  2JKC A;  3QJ4 A;  1KNR A;  4TM4 A;  1F3P A;  1OJT A;  3O0H A;  4RG4 A;  4X9M A;  2BS3 A;  2VVL A;  2Q0K A;  3T2Z A;  4ADW A;  2GB0 A;  4A7A A;  3UKK A;  1F6M A;  2XVJ A;  4J57 A;  3B3R A;  3RNM A;  4B69 A;  3SQP A;  2RAB A;  2R0C A;  1GOS A;  1TYT A;  3QFA A;  3KKJ A;  2YLS A;  2NPX A;  4J56 A;  1GRE A;  3QFB A;  3IHM A;  1AOG A;  3KVE A;  2BK5 A;  4EQS A;  4TM3 A;  3NRN A;  4CY8 A;  1PBD A;  2CUL A;  2OLN A;  3AE7 A;  2JAE A;  2YG3 A;  3SZ0 A;  4G74 A;  4G73 A;  2WP5 A;  4EM4 A;  3HYW A;  3HYX A;  2YR5 A;  3D8X A;  5C2T A;  4JDR A;  2X3N A;  1GTE A;  4GCM A;  2C70 A;  1DOE A;  2C67 A;  3D1C A;  2GQW A;  4Y4N A;  3P4R A;  1GXF A;  1HYU A;  1QJD A;  1XDI A;  2GRT A;  4U8J A;  4C77 A;  4DSG A;  4D04 A;  1KF6 A;  3BI2 A;  4DGK A;  1PBC A;  4BK1 A;  4USQ A;  4CCQ A;  4EQW A;  3RHA A;  3OZ2 A;  2YVG A;  3KU9 A;  1L9E A;  3GD3 A;  3DJE A;  1IUU A;  2V60 A;  3P4P A;  3IC9 A;  3QSM A;  2ACZ A;  4H4Z A;  1CJ2 A;  4NTC A;  1IUW A;  3RP6 A;  2H88 A;  1PXB A;  2AQJ A;  2BRA A;  3BHF A;  3CMM A;  3LZX A;  5KXJ A;  1KFY A;  2YG7 A;  2CDU A;  4H4Q A;  1E1L A;  1EL5 A;  3I6D A;  3KD9 A;  4ICY A;  4Y4M A;  3GDN A;  5FS7 A;  1Q1W A;  5HY5 A;  3URH A;  1Q1R A;  4UDP A;  2XYO A;  1D4D A;  4ZCD A;  2C72 A;  1ELI A;  3GWF A;  2C66 A;  1DOB A;  3ZYX A;  3ALJ A;  1S2Q A;  2BC0 A;  2XFN A;  4TM0 A;  1JNZ A;  2O9Z A;  3UTH A;  3ZDN A;  2BRY A;  3ICS A;  4BK3 A;  1FOH A;  5FS8 A;  5KOW A;  2C73 A;  3NT6 A;  3SXI A;  1GND A;  4YTM A;  2RGO A;  4FK1 C;  2VQB A;  1IJH A;  1NAA A;  3AEC A;  3AEE A;  4GR1 A;  4IA6 A;  4CCR A;  2GVC A;  1DXL A;  5TR3 A;  2X8H A;  5BUK A;  4BK2 A;  5KMP A;  2RGJ A;  4EM3 A;  2X8G A;  2XLT A;  3UOX A;  1YKJ A;  3QSE A; 
#chains in the Genus database with same CATH homology
 4U2L A;  3UOZ A;  4H50 A;  4K8D A;  3K7Q X;  2EQ8 A;  4J33 A;  4YTN A;  1Z6L A;  3KPF A;  3HYV A;  4YWO A;  2XFU A;  3UOY A;  1H6V A;  5FS6 A;  3ATQ A;  2BK3 A;  1IUS A;  5JCK A;  3LXD A;  3CNJ A;  4Z2T A;  3EF6 A;  5KMS A;  2YLX A;  4TM1 A;  1DOD A;  1YQ4 A;  3BNU A;  2CVJ A;  4H4Y A;  2GMH A;  1D5T A;  1XPQ A;  3NK1 X;  1K4Q A;  3UTE A;  1OJ9 A;  3AXB A;  1N4V A;  3M13 A;  4A5L A;  4Z26 A;  5KNL A;  2DKI A;  1PS9 A;  3NLC A;  3VRD B;  1BGN A;  2YLZ A;  3L1R A;  4H2Q A;  4O5U A;  3C4A A;  3NN6 X;  1ZMD A;  1TDO A;  3LB8 A;  1JEH A;  2YR4 A;  4II3 A;  3SGL A;  1E39 A;  4U2S A;  3AE4 A;  3NG7 X;  1NG4 A;  2BYB A;  3DGH A;  3F8P A;  2R4J A;  4U8K A;  3FG2 P;  1MXT A;  4OPC A;  4ZCC A;  3V3O A;  1H84 A;  2B9Y A;  2WPC A;  1VQW A;  3NYC A;  3BHK A;  4GAV A;  2YM1 A;  3DME A;  4YTP A;  1MO9 A;  1VG0 A;  2E5V A;  1RYI A;  3PVC A;  2PHH A;  2WU2 A;  5FS9 A;  1RP0 A;  1PBB A;  3IWA A;  1GT8 A;  2IVE A;  2XLU A;  3DJD A;  2BXS A;  3AE8 A;  3QSS A;  3NYE A;  1K0J A;  1CBO A;  2JK6 A;  3UP4 A;  3M0O A;  2BXR A;  1GES A;  2GV8 A;  5DBJ A;  3P4S A;  1CC6 A;  1O94 A;  1Q9I A;  3F8R A;  2EQ9 A;  4OPG A;  1XAN A;  4NTD A;  3GD4 A;  4NZH A;  3AD8 B;  3H4K A;  1KNP A;  4K2X A;  1W4X A;  2Q7V A;  4B67 A;  1NEK A;  1SEZ A;  3G5Q A;  1LV0 A;  2IVD A;  4BJY A;  1QO8 A;  3T2Y A;  1N4U A;  3ATR A;  4FK1 A;  1D7Y A;  1GRB A;  2JB3 A;  3P9U A;  1O5W A;  4UDQ A;  2JB2 A;  5KRQ A;  5BVA A;  1H86 A;  3AE9 A;  4XWR A;  5JCN A;  2DKH A;  5FMH A;  4JNA A;  4U8P A;  1GTH A;  1BKW A;  4N9X A;  2XVH A;  4CBQ A;  3S61 A;  4E0V A;  1TRB A;  2AAQ A;  4I58 A;  4G6H A;  1OJA A;  3QVP A;  3DJJ A;  3AED A;  2RGH A;  4LA1 A;  1UKV G;  2XCG A;  2Q6U A;  1TYP A;  5KVH A;  2C64 A;  2Y6Q A;  3EAO A;  4LII A;  4UDR A;  3UKA A;  1K0L A;  3LAD A;  2R0G A;  4H4W A;  4CY6 A;  4C3Y A;  5JCL A;  4Y4L A;  4D03 A;  3K30 A;  1DJQ A;  3II4 A;  2Z5X A;  4JQ9 A;  2GR0 A;  1TDE A;  2GR1 A;  4G6G A;  4JNQ A;  4GDP A;  2XFQ A;  1FEA A;  4H2P A;  1GRA A;  1M6I A;  1CJ3 A;  4H2N A;  1LJ1 A;  4P9S A;  3UKP A;  3UCL A;  3ICT A;  2A8X A;  1M64 A;  1CHU A;  2OA1 A;  1PBE A;  4NWZ A;  3VRA A;  4YT0 A;  2HQM A;  3CGB A;  2Y6R A;  3DGZ A;  4H4U A;  2C65 A;  2GF3 A;  3DK9 A;  2W0H A;  1BGJ A;  2YLR A;  3G5R A;  5KMQ A;  4NEW A;  2BS4 A;  2V61 A;  2TPR A;  2GAG B;  3K7T A;  3T14 A;  1JOA A;  3AYJ A;  1JRX A;  1GET A;  4Z44 A;  2R0P A;  2IID A;  2YR6 A;  1EL8 A;  4WX1 A;  4A9W A;  2WPF A;  2WOW A;  3CPJ G;  3CNS A;  1F8R A;  2TMD A;  3NK0 X;  2H89 A;  1ZOY A;  1XHC A;  2V5Z A;  1H82 A;  3CGE A;  4J34 A;  4KPR A;  1VDC A;  3SM8 A;  1ZP0 A;  2F5Z A;  2FJA A;  1EL9 A;  2C7G A;  2GH5 A;  3AE5 A;  1BWC A;  3R9U A;  2B7R A;  4G9K A;  1OJC A;  4OPD A;  4IA5 A;  3NTA A;  3T2K A;  3EPT A;  1GAL A;  1E7P A;  2WDV A;  3GDP A;  2VOU A;  1KSS A;  2BCG G;  2EQ6 A;  3UP5 A;  2C75 A;  3HZL A;  1F8S A;  4Z2U A;  2ARD A;  4YSZ A;  1GPE A;  2BCP A;  2WDR A;  4B66 A;  3CPH G;  2WBA A;  4Z43 A;  5ER0 A;  5KWF A;  3NN0 X;  1GRT A;  1LTX R;  1PXC A;  1LQT A;  2BK4 A;  3AYL A;  3P1W A;  5M0Z A;  3CNT A;  4Z24 A;  1BF3 A;  3AEF A;  5U63 A;  5EB5 A;  1MOK A;  3AE2 A;  3NKS A;  4U8I A;  4A99 A;  2WOV A;  5LV9 A;  2ZZB A;  3GSI A;  3RP7 A;  1PBF A;  1YQZ A;  5HYM A;  1O95 A;  1V59 A;  4I59 A;  3CTY A;  5GSN A;  1NHP A;  2YG4 A;  4OPT A;  1ZOV A;  4HA6 A;  3RED A;  3E1T A;  5CKU A;  1REO A;  4WCT A;  2EQ7 A;  3FPZ A;  1TDF A;  2WES A;  3SZF A;  1E1K A;  4J31 A;  4YKG A;  3PO7 A;  4YXD A;  4A6N A;  1D7L A;  1RSG A;  2OAM A;  3CNP A;  4OVI A;  4H7U A;  3V76 A;  1NHQ A;  3FMW A;  4JY2 A;  3ABV A;  2YQU A;  2C3C A;  3NIX A;  3NK2 X;  1ZKQ A;  2WU5 A;  3ALL A;  4IVO B;  4J2W A;  3ITJ A;  4GAP A;  1PJ6 A;  3S5W A;  4BUR A;  4ZN0 A;  3H8L A;  4H4P A;  4H4X A;  3SX6 A;  3SFD A;  1GV4 A;  4B65 A;  1DNC A;  3AE3 A;  3AE6 A;  1Y56 A;  3DA1 A;  1FEB A;  3GRS A;  5BUL A;  5IPY A;  1CJC A;  2GEW A;  4REK A;  3AB1 A;  1NHR A;  2PYX A;  3CIR A;  5EOW A;  1L0V A;  4Z25 A;  1IUX A;  1N4W A;  3NGC X;  4OPI A;  3KA7 A;  4TLZ A;  1B37 A;  2FJD A;  1PN0 A;  2YM2 A;  2VZ2 A;  3GMB A;  1P2E A;  1DJN A;  4K7Z A;  2QAE A;  5J60 A;  3UTF A;  1ZK7 A;  3NH3 X;  2XLP A;  4O5Q A;  4BJZ A;  2ZZC A;  3CN8 A;  4LU6 A;  2JB1 A;  4BV6 A;  3AYI A;  4GF7 A;  3DK4 A;  3P4Q A;  1GRH A;  3ALM A;  4TLX A;  3F8D A;  3IHG A;  1L9D A;  3ISH A;  5JCI A;  4Z2R A;  1JRY A;  4NNJ A;  2E1M A;  2JBV A;  4X9N A;  2APG A;  3IF9 A;  2YG5 A;  1B4V A;  5CQF A;  5M10 A;  4MJW A;  3Q9T A;  3AWI A;  5IQ1 A;  1H7X A;  4B68 A;  4A65 A;  1PHH A;  4U8M A;  1H83 A;  1S3E A;  4U2T A;  3LJP A;  2VVL G;  1TDN A;  2J3N A;  3GYI A;  3C96 A;  5U25 A;  2BAC A;  2WPE A;  2ZBW A;  3VR8 A;  1ZY8 A;  1X31 B;  2GR2 A;  4B1B A;  4EMJ A;  1KDG A;  4OCG A;  4AT2 A;  1E1N A;  3T0K A;  2GAH B;  4AP3 A;  3CPI G;  2NVK X;  2Q0L A;  1K0I A;  1VG9 A;  3DK8 A;  3CGD A;  1ZMC A;  3DH9 A;  1VRQ B;  2ZZ0 A;  3BNM A;  5J7X A;  3GYJ A;  3UKQ A;  3EAN A;  2BC1 A;  3VRB A;  4AT0 A;  3DJG X;  2E4G A;  2VQ7 A;  2XVI A;  3BI4 A;  1GER A;  1QLB A;  4K5S A;  2WP9 A;  3VR9 A;  3SY4 A;  3GRT A;  3FIM B;  1JNR A;  4H4V A;  4USR A;  1ZDL A;  4K22 A;  1COY A;  1D4E A;  1YY5 A;  1GSN A;  2XLR A;  4X4J A;  2FBW A;  5IQ4 A;  2A87 A;  4U8N A;  3L8K A;  2I0Z A;  3WE0 A;  2GQF A;  1NHS A;  2Z5Y A;  2A89 A;  3ICR A;  2X50 A;  4U8L A;  3UKH A;  3KPK A;  2V6O A;  2XFP A;  4A79 A;  3Q6J A;  2R45 A;  4EQR A;  3KLJ A;  4AOX A;  3LOV A;  2WQY A;  4DSH A;  2FJB A;  3UKF A;  5KMR A;  1NPX A;  2YG6 A;  3COX A;  4GRT A;  3UTG A;  1FEC A;  2V3B A;  4UP3 A;  2UZZ A;  2XLS A;  1B8S A;  4GUV A;  4IVM B;  4XWZ A;  4II2 A;  3SZC A;  3PS9 A;  1H7W A;  5KVI A;  5C3J A;  2XVE A;  4GDE A;  2V3A A;  1D4C A;  1LPF A;  2BS2 A;  4YSY A;  5JCM A;  4YKF A;  3C4N A;  3SZW A;  2YAU A;  2XFO A;  4EMI A;  1BZL A;  1E6E A;  1CL0 A;  3OC4 A;  1JRZ A;  2XDO A;  4U8O A;  1NEN A;  4YSH A;  1EBD A;  4ECH A;  2OLO A;  1CJ4 A;  1Y0P A;  4PAB A;  5L46 A;  4JN9 A;  4EQX A;  3UOV A;  2WS3 A;  2WDQ A;  3AE1 A;  4AP1 A;  4B64 A;  1LQU A;  3B6D A;  1IUV A;  3CGC A;  3T31 A;  2WEU A;  1ZX9 A;  4RG3 A;  1L9C A;  1H81 A;  1PXA A;  1F8W A;  2WET A;  4DNA A;  1PDH A;  2YLT A;  1EL7 A;  4OPU A;  3RP8 A;  3FBS A;  1NG3 A;  2QA1 A;  1TDK A;  3NNE A;  2B9X A;  1ONF A;  4C3X A;  3SFE A;  4C74 A;  5HXI A;  2WP6 A;  1KSU A;  3CND A;  4IV9 A;  3UKL A;  2B7S A;  1FCD A;  1GRG A;  5U1O A;  2VRL A;  2C3D A;  4CNK A;  3V3N A;  2VVM A;  1CF3 A;  4RSL A;  1N1P A;  4M52 A;  4YSX A;  3T37 A;  4CRT A;  3AEG A;  4EIP A;  2QA2 A;  2R46 A;  1OJD A;  4A6N B;  2FJE A;  5EB4 A;  3NYF A;  4H4T A;  4CNJ A;  1GEU A;  3G5S A;  3I3L A;  4FX9 A;  2BAB A;  2QCU A;  2GR3 A;  4OPL A;  5EBK A;  3BI5 A;  2X99 A;  2X8C A;  1S3B A;  2CFY A;  3AD7 B;  3GWD A;  4J36 A;  3JSK A;  3GYX A;  3LZW A;  2WHD A;  3NTD A;  1PJ7 A;  5HHF A;  2R4E A;  5BRT A;  1YQ3 A;  2VRM A;  3AEA A;  1Y56 B;  5GRT A;  1B5Q A;  3K7M X;  4C5O A;  3GMC A;  2R9Z A;  4H4R A;  1DOC A;  2OAL A;  1P2H A;  3ADA B;  3VQR A;  4XXG A;  4PAA A;  2WOI A;  1S2Y A;  1PJ5 A;  5KOX A;  3AEB A;  4H2R A;  1JU2 A;  2GMJ A;  2YLW A;  2B76 A;  1LVL A;  2C4C A;  4B63 A;  2C76 A;  2YVJ A;  2XVF A;  4K5R A;  3AD9 B;  4HB9 A;  4JY3 A;  4NEV A;  3SYI A;  3H8I A;  2YVF A;  3QVR A;  2YWL A;  1CC2 A;  1E1M A;  2BA9 A;  1FL2 A;  4FDC B;  4H4S A;  4NTE A;  4EIQ A;  1CC4 A;  4EMW A;  2AR8 A;  4APN A;  4KX6 A;  1IUT A;  4AOS A;  2B9W A;  3M12 A;  3NHO X;  1NDA A;  1GRF A;  2JKC A;  3QJ4 A;  1KNR A;  4TM4 A;  1F3P A;  1OJT A;  3O0H A;  4RG4 A;  4X9M A;  2BS3 A;  2VVL A;  2Q0K A;  3T2Z A;  4ADW A;  2GB0 A;  4A7A A;  3UKK A;  1F6M A;  2XVJ A;  4J57 A;  3B3R A;  3RNM A;  4B69 A;  3SQP A;  2RAB A;  2R0C A;  1GOS A;  1TYT A;  3QFA A;  3KKJ A;  2YLS A;  2NPX A;  4J56 A;  1GRE A;  3QFB A;  3IHM A;  1AOG A;  3KVE A;  2BK5 A;  4EQS A;  4TM3 A;  3NRN A;  4CY8 A;  1PBD A;  2CUL A;  2OLN A;  3AE7 A;  2JAE A;  2YG3 A;  3SZ0 A;  4G74 A;  4G73 A;  2WP5 A;  4EM4 A;  3HYW A;  3HYX A;  2YR5 A;  3D8X A;  5C2T A;  4JDR A;  2X3N A;  1GTE A;  4GCM A;  2C70 A;  1DOE A;  2C67 A;  3D1C A;  2GQW A;  4Y4N A;  3P4R A;  1GXF A;  1HYU A;  1QJD A;  1XDI A;  2GRT A;  4U8J A;  4C77 A;  4DSG A;  4D04 A;  1KF6 A;  3BI2 A;  4DGK A;  1PBC A;  4BK1 A;  4USQ A;  4CCQ A;  4EQW A;  3RHA A;  3OZ2 A;  2YVG A;  3KU9 A;  1L9E A;  3GD3 A;  3DJE A;  1IUU A;  2V60 A;  3P4P A;  3IC9 A;  3QSM A;  2ACZ A;  4H4Z A;  1CJ2 A;  4NTC A;  1IUW A;  3RP6 A;  2H88 A;  1PXB A;  2AQJ A;  2BRA A;  3BHF A;  3CMM A;  3LZX A;  5KXJ A;  1KFY A;  2YG7 A;  2CDU A;  4H4Q A;  1E1L A;  1EL5 A;  3I6D A;  3KD9 A;  4ICY A;  4Y4M A;  3GDN A;  5FS7 A;  1Q1W A;  5HY5 A;  3URH A;  1Q1R A;  4UDP A;  2XYO A;  1D4D A;  4ZCD A;  2C72 A;  1ELI A;  3GWF A;  2C66 A;  1DOB A;  3ZYX A;  3ALJ A;  1S2Q A;  2BC0 A;  2XFN A;  4TM0 A;  1JNZ A;  2O9Z A;  3UTH A;  3ZDN A;  2BRY A;  3ICS A;  4BK3 A;  1FOH A;  5FS8 A;  5KOW A;  2C73 A;  3NT6 A;  3SXI A;  1GND A;  4YTM A;  2RGO A;  4FK1 C;  2VQB A;  1IJH A;  1NAA A;  3AEC A;  3AEE A;  4GR1 A;  4IA6 A;  4CCR A;  2GVC A;  1DXL A;  5TR3 A;  2X8H A;  5BUK A;  4BK2 A;  5KMP A;  2RGJ A;  4EM3 A;  2X8G A;  2XLT A;  3UOX A;  1YKJ A;  3QSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...