1TRBA

Convergent evolution of similar function in two structurally divergent enzymes
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Convergent evolution of similar function in two structurally divergent enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
molecule keywords THIOREDOXIN REDUCTASE
total genus 93
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1991-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA02
4AT2A 2HQMA 2X8GA 5FS7A 3JSKA 4TM3A 4DSHA 1D5TA 1GESA 3LXDA 4ZCDA 5FS8A 1GRTA 3FIMB 4AP1A 3AEEA 2C67A 2ZZBA 4NEVA 2XVIA 4GUVA 3NGCX 3URHA 2YR4A 1FOHA 2F5ZA 4YSZA 2XFPA 4D03A 1VRQB 2ARDA 3IWAA 3B6DA 3BNMA 3F8RA 4YTNA 3UOVA 1XDIA 5KXJA 2IIDA 3D1CA 4YKGA 5C2TA 3H8IA 2C70A 1K4QA 1GREA 2Q0LA 3GYJA 3QSSA 2FJAA 4D04A 1TRBA 3DJGX 3RNMA 3P4SA 2YWLA 1OJDA 1DOEA 4WX1A 1IUXA 4B69A 4CNKA 3IHGA 4ZN0A 2APGA 4M52A 1DXLA 2C7GA 1EL7A 3CGBA 2FBWA 1E1MA 2RABA 1GTEA 3FBSA 1VQWA 1NG3A 3F8DA 1EL8A 2XDOA 4TLXA 3LZXA 3P1WA 1ZOVA 4PABA 1W4XA 2B9XA 3AEDA 4JY3A 1YKJA 2GH5A 3ICTA 1TYTA 2XCGA 1REOA 1JRYA 1VG0A 3CNJA 4ZCCA 3VRAA 1KSSA 4ADWA 2VVLG 3C4NA 3ADAB 5L46A 2V6OA 5KVHA 4K22A 1LPFA 4H4QA 1ZX9A 3AE8A 1VG9A 1V59A 3DMEA 1O5WA 3QSMA 4YT0A 1CC6A 2YVGA 2YM2A 1K0LA 2R45A 1FL2A 3Q6JA 3LADA 2YR5A 1ZY8A 2YLSA 5JCKA 1TDNA 2JAEA 2BACA 3UOXA 2XFUA 5BRTA 1B37A 1GRBA 2BABA 3M12A 4A7AA 2JB2A 4TM0A 3SQPA 3QFBA 2YLZA 1Y56B 4EMWA 4ECHA 5BUKA 4WCTA 3Q9TA 2AR8A 3FMWA 2EQ9A 4TM4A 3UTEA 1IJHA 1GRGA 2PYXA 5J60A 2GV8A 3ATRA 3G5SA 4OPCA 3UKPA 3GSIA 4TM1A 3GMCA 4H7UA 3NTAA 1NPXA 4C74A 4Z25A 3SFDA 1XANA 3NN0X 1ZDLA 4CY8A 3VR9A 3NT6A 2YLTA 3KPFA 2X50A 2C64A 3P4RA 3AXBA 1NEKA 4EQSA 4BV6A 1LQUA 2XVHA 4J57A 5U63A 1CJ3A 2J3NA 5KWFA 2GMHA 3GWDA 2GB0A 5HYMA 3GRTA 4NTDA 3BI2A 5HHFA 4Z2TA 1F6MA 2V5ZA 1NENA 1E1LA 4B68A 2Y6RA 1MOKA 1PJ6A 3GD3A 2GEWA 3AEBA 4J31A 3CPIG 2WDQA 2YLWA 2CDUA 2XLRA 3CN8A 2X8HA 3ALJA 4BK1A 2UZZA 3AYIA 3AEAA 4A65A 1K0JA 2GQWA 2R0PA 2BCGG 2XVFA 2YG6A 4YSXA 1NHSA 3EPTA 2BXRA 3DK4A 3K7TA 4JDRA 4K5SA 3AYLA 1CC2A 2IVDA 2BXSA 2CVJA 1SEZA 3QVRA 4YSHA 4Z24A 1NHRA 4O5QA 3M13A 1CHUA 3M0OA 4B1BA 1CBOA 4JQ9A 2QA2A 3K7MX 1P2EA 3ATQA 4U8NA 2XLSA 2XLTA 1EL5A 3G5RA 1NDAA 2VQ7A 1PS9A 1XPQA 1H7XA 1NAAA 3V76A 1K0IA 1CL0A 3NYEA 4U8PA 2C76A 2YG7A 1F8RA 4KPRA 3FG2P 2NVKX 3S61A 4YTPA 1D4EA 1PBBA 1Y0PA 3DJEA 3NTDA 2GR0A 1LVLA 2X3NA 2R9ZA 2YLRA 2WDVA 3BHFA 1JNRA 2Q7VA 3IC9A 1QLBA 4P9SA 5KVIA 2Z5YA 4IV9A 3S5WA 1QO8A 2R0GA 4OPLA 3GYIA 2GQFA 3IHMA 1KF6A 2WU5A 3AE4A 5M0ZA 2GRTA 1X31B 1IUUA 2BYBA 1E39A 2YG5A 3D8XA 1B8SA 1CJ4A 3NIXA 1BGNA 2OALA 1GRHA 4RG4A 4U8OA 1GT8A 1RP0A 2QCUA 1Q1WA 4UP3A 2GF3A 4H50A 1F3PA 2C3DA 3CNPA 2AAQA 1EBDA 1M64A 2FJDA 4YKFA 1DJQA 1ZMDA 2OA1A 3UCLA 5M10A 4U2LA 3OZ2A 2X99A 5J7XA 4Y4LA 4Z26A 4YXDA 1ONFA 4H4VA 5ER0A 4JNAA 1D7YA 4FX9A 2B9WA 2XFQA 5KRQA 2WESA 3AYJA 3ABVA 3AECA 4H4RA 2GVCA 3VRBA 4EIPA 2TMDA 4CBQA 3DH9A 2WOWA 2V3AA 1CC4A 3CPJG 1LJ1A 4B63A 3UKLA 1GTHA 3DGZA 1S2YA 3NK2X 4U8IA 4B66A 1OJAA 3AE7A 4FK1C 4HB9A 4NEWA 1NG4A 3CGEA 2YLXA 2ACZA 2FJEA 3P4QA 4NTEA 2VRLA 2VOUA 4OCGA 2GAHB 2YQUA 2EQ7A 2DKHA 3CNTA 1KDGA 1L9EA 4O5UA 4REKA 2PHHA 2R4EA 3ICSA 2XFNA 4AP3A 2GR1A 1H84A 1GETA 2R46A 4OPUA 4B67A 1N1PA 1DNCA 1PXCA 2VQBA 4K5RA 3VR8A 2Q6UA 5FS9A 4A79A 1D4DA 2YVFA 4EM4A 4C77A 4IA5A 1VDCA 1OJ9A 2YR6A 4U2TA 3VRDB 3EAOA 3UTGA 1GEUA 4J36A 3E1TA 4BK2A 3AD9B 1Y56A 3HZLA 1KNPA 1CJCA 4GR1A 1FCDA 3GMBA 4H4XA 5EB5A 1GALA 1S3BA 1P2HA 2E1MA 1QJDA 3AD8B 1ZK7A 3T37A 2V60A 4U8JA 1DJNA 4EM3A 1Q9IA 2O9ZA 1L9DA 1L0VA 4I59A 2BC1A 2OLOA 2BS4A 4J2WA 4GDPA 4J33A 2VZ2A 2BS3A 3PS9A 2YG3A 2WEUA 3QVPA 2DKIA 1COYA 1YQZA 4OPTA 1PN0A 1TYPA 3UKQA 3BI4A 1KSUA 2B9YA 3CTYA 4C5OA 1DOBA 4EIQA 3AEGA 5C3JA 1GERA 1JNZA 1PDHA 2WP5A 4IVMB 2BC0A 1IUTA 3UOYA 1FECA 4IA6A 3QSEA 5HY5A 3ISHA 5JCMA 3C96A 2RGHA 3RP8A 3LZWA 3NKSA 5GRTA 3R9UA 5EB4A 3SM8A 1TDFA 3CPHG 1M6IA 3KLJA 3KVEA 2B7RA 1DOCA 4HA6A 4CCRA 5EOWA 2ZZCA 3I6DA 3OC4A 1RYIA 2VRMA 4DGKA 4EMJA 2JB1A 4A6NA 3NH3X 1ELIA 1GV4A 1L9CA 1Q1RA 2B76A 2C66A 4A99A 1PJ5A 3NK0X 2X8CA 1BWCA 1PXBA 2YG4A 1IUWA 2OLNA 4DNAA 3SFEA 3K30A 2C65A 4B65A 4H2PA 4C3YA 4J34A 2JBVA 2GR2A 2AQJA 4XWRA 2BCPA 2WHDA 1E6EA 1GOSA 5LV9A 1KNRA 2CFYA 4BJYA 4BURA 4U8MA 4USRA 2QA1A 4MJWA 2XVJA 1ZP0A 2WS3A 4H4SA 3NRNA 4X9NA 3UKHA 3NYCA 3II4A 4K2XA 4U2SA 5U1OA 3WE0A 4AOSA 4XXGA 3REDA 1AOGA 1F8WA 4PAAA 4YSYA 2E4GA 3LOVA 4BJZA 1GNDA 5JCNA 1BKWA 3NNEA 5JCLA 3DK8A 1H6VA 2Y6QA 4YTMA 4GCMA 1N4UA 2BK5A 3ZDNA 3KKJA 1GXFA 1TDKA 1D7LA 2XVEA 5TR3A 3SGLA 5BULA 4NZHA 3ALMA 3AE6A 1O94A 4U8LA 3P9UA 2A8XA 3LJPA 2E5VA 4J56A 3EANA 2RGJA 4CNJA 1JRZA 2YVJA 4H2RA 2FJBA 4Z2RA 1LQTA 3L1RA 1GPEA 3H4KA 2JKCA 2WPEA 4X9MA 1H82A 5CKUA 3P4PA 4CY6A 2ZBWA 3CIRA 4A9WA 3C4AA 3GRSA 1IUVA 1TDOA 2WQYA 1H7WA 5FMHA 4TLZA 2VVMA 3VQRA 4E0VA 3NK1X 4OPDA 3RP6A 3AWIA 4H4PA 3NYFA 5IPYA 1JOAA 3UKKA 3UP4A 1MXTA 1E1NA 1NHQA 3KA7A 4H4YA 1XHCA 4XWZA 2EQ6A 1IUSA 5EBKA 5U25A 3NN6X 3DJDA 3COXA 4JNQA 1BZLA 1GSNA 4B64A 4H4TA 1LTXR 4OVIA 2W0HA 1EL9A 1ZOYA 3ITJA 2WOIA 1LV0A 2TPRA 2B7SA 4LA1A 3AE5A 2WBAA 3AE1A 4H4ZA 2XLPA 3L8KA 5DBJA 2A87A 4LIIA 1OJCA 4KX6A 2YAUA 1N4VA 1YQ4A 1JU2A 3ICRA 4GDEA 3UP5A 3QFAA 4BK3A 2BA9A 1JRXA 3I3LA 4GRTA 1UKVG 2QAEA 3IF9A 2CULA 2R0CA 4UDRA 2I0ZA 2BK3A 2C75A 3FPZA 4APNA 3UOZA 2OAMA 4CRTA 2R4JA 1GRAA 1MO9A 4OPIA 3RHAA 1F8SA 3ALLA 3KD9A 1ZKQA 2BS2A 4H2QA 4K8DA 1B4VA 4U8KA 3KU9A 4AT0A 3NLCA 5FS6A 2RGOA 4EQXA 4H4UA 3DGHA 2VVLA 1OJTA 3GDNA 3K7QX 1ZMCA 3G5QA 3CGCA 4Z43A 2EQ8A 3PVCA 3H8LA 2WP6A 2Z5XA 4EQRA 1KFYA 4I58A 4JY2A 2GR3A 1H81A 1E7PA 3AD7B 2C72A 1YY5A 1GRFA 3BI5A 1JEHA 3AB1A 3CNDA 4ICYA 2IVEA 3AE3A 4UDQA 4AOXA 3NG7X 1PXAA 4DSGA 4Z2UA 3V3OA 1H86A 3V3NA 2WPCA 1S3EA 4GF7A 3UTHA 4A6NB 2V3BA 3BNUA 3DJJA 3F8PA 1O95A 3AEFA 5CQFA 3ZYXA 5BVAA 1BF3A 3UTFA 4LU6A 5KOWA 4Y4NA 3NHOX 4FDCB 1N4WA 1PBFA 1S2QA 3BHKA 3EF6A 3PO7A 3DA1A 3CNSA 4H2NA 4JN9A 5GSNA 3GD4A 1PHHA 1RSGA 1YQ3A 2V61A 2WETA 2XFOA 1FEAA 3AE9A 3DK9A 3LB8A 4A5LA 1PBEA 2ZZ0A 4EMIA 2WDRA 4RG3A 1TDEA 2XYOA 1D4CA 1PJ7A 2WOVA 2GAGB 2JB3A 4C3XA 3GDPA 1Z6LA 3O0HA 4RSLA 5IQ1A 1BGJA 1H83A 2C73A 2C3CA 2WPFA 2BK4A 3QJ4A 4H4WA 4IVOB 4X4JA 2H88A 1HYUA 2GMJA 1B5QA 2YM1A 4FK1A 3UKFA 3GWFA 5HXIA 1E1KA 2H89A 2A89A 2JK6A 4YWOA 4EQWA 4USQA 1DODA 3CGDA 4Y4MA 2WP9A 3RP7A 4N9XA 1CJ2A 2WU2A 4UDPA 3UKAA 3AE2A 4CCQA 2XLUA 1NHPA 1PBCA 4K7ZA 5KOXA 2Q0KA 2NPXA 5JCIA 1CF3A 1FEBA 4OPGA 4Z44A 5IQ4A 1PBDA 4NTCA 3B3RA
chains in the Genus database with same CATH superfamily
4AT2A 2HQMA 2X8GA 5FS7A 3JSKA 4TM3A 4DSHA 1D5TA 1GESA 3LXDA 4ZCDA 5FS8A 1GRTA 3FIMB 4AP1A 3AEEA 2C67A 2ZZBA 4NEVA 2XVIA 4GUVA 3NGCX 3URHA 4NNJA 2YR4A 1FOHA 2F5ZA 4YSZA 2XFPA 4D03A 1VRQB 2ARDA 3IWAA 3B6DA 3BNMA 3F8RA 4YTNA 3UOVA 1XDIA 5KXJA 2IIDA 3D1CA 4YKGA 5C2TA 3H8IA 2C70A 1K4QA 1GREA 2Q0LA 3GYJA 3QSSA 5KMRA 2FJAA 4D04A 1TRBA 3DJGX 3RNMA 3P4SA 2YWLA 1OJDA 1DOEA 4WX1A 1IUXA 4B69A 4CNKA 3IHGA 4ZN0A 2APGA 4M52A 1DXLA 3T2YA 2C7GA 1EL7A 3CGBA 2FBWA 1E1MA 2RABA 1GTEA 3FBSA 1VQWA 1NG3A 3F8DA 1EL8A 2XDOA 4TLXA 3LZXA 3P1WA 1ZOVA 4PABA 1W4XA 2B9XA 3AEDA 4JY3A 1YKJA 2GH5A 3ICTA 1TYTA 2XCGA 1REOA 1JRYA 1VG0A 3CNJA 4ZCCA 3VRAA 1KSSA 4ADWA 2VVLG 3C4NA 3ADAB 5L46A 2V6OA 5KVHA 4K22A 1LPFA 4H4QA 1ZX9A 3AE8A 1VG9A 1V59A 3DMEA 1O5WA 3QSMA 3SZCA 1CC6A 2YVGA 2YM2A 4YT0A 1K0LA 2R45A 1FL2A 3Q6JA 3LADA 2YR5A 1ZY8A 2YLSA 3SZ0A 1TDNA 5JCKA 2JAEA 2BACA 3UOXA 2XFUA 5BRTA 1B37A 1GRBA 2BABA 3M12A 4A7AA 2JB2A 4TM0A 3SQPA 3QFBA 2YLZA 1Y56B 4EMWA 4ECHA 5BUKA 4WCTA 3Q9TA 2AR8A 3FMWA 2EQ9A 4TM4A 3UTEA 1IJHA 1GRGA 2PYXA 5J60A 2GV8A 3ATRA 3G5SA 4OPCA 3UKPA 3GSIA 4TM1A 3GMCA 4H7UA 3NTAA 1NPXA 4C74A 4Z25A 3SFDA 1XANA 3NN0X 1ZDLA 4CY8A 3VR9A 3NT6A 2YLTA 3KPFA 2X50A 2C64A 3P4RA 3AXBA 1NEKA 4EQSA 4BV6A 1LQUA 2XVHA 4J57A 5U63A 3SYIA 1CJ3A 2J3NA 5KWFA 2GMHA 3GWDA 2GB0A 5HYMA 3GRTA 4NTDA 3BI2A 5HHFA 4Z2TA 1F6MA 2V5ZA 3HYWA 1NENA 1E1LA 4B68A 2Y6RA 1MOKA 1PJ6A 3GD3A 2GEWA 3AEBA 4J31A 3CPIG 2WDQA 2YLWA 2CDUA 2XLRA 3CN8A 2X8HA 3ALJA 4BK1A 2UZZA 3AYIA 3AEAA 4A65A 1K0JA 2GQWA 2R0PA 2BCGG 2XVFA 2YG6A 4YSXA 1NHSA 3EPTA 2BXRA 3DK4A 3K7TA 4JDRA 4K5SA 3AYLA 1CC2A 2IVDA 2BXSA 2CVJA 1SEZA 3QVRA 4G6GA 4YSHA 4Z24A 1NHRA 4O5QA 3M13A 1CHUA 3M0OA 4B1BA 1CBOA 4JQ9A 2QA2A 3K7MX 1P2EA 3ATQA 4U8NA 2XLSA 2XLTA 1EL5A 3G5RA 1NDAA 2VQ7A 1PS9A 1XPQA 1H7XA 1NAAA 3V76A 1K0IA 1CL0A 3NYEA 4U8PA 2C76A 2YG7A 1F8RA 4GAPA 4KPRA 3FG2P 2NVKX 3S61A 4YTPA 1D4EA 1PBBA 1Y0PA 3DJEA 3NTDA 2GR0A 1LVLA 2X3NA 2R9ZA 2YLRA 2WDVA 3BHFA 1JNRA 2Q7VA 3IC9A 1QLBA 4P9SA 5KVIA 2Z5YA 4IV9A 3S5WA 1QO8A 2R0GA 4OPLA 3GYIA 2GQFA 3T2KA 3IHMA 1KF6A 2WU5A 3AE4A 5M0ZA 2GRTA 1X31B 1IUUA 2BYBA 1E39A 2YG5A 3D8XA 3T0KA 1B8SA 1CJ4A 3NIXA 1BGNA 2OALA 1GRHA 4RG4A 4U8OA 1GT8A 1RP0A 2QCUA 1Q1WA 4UP3A 2GF3A 4H50A 1F3PA 2C3DA 3CNPA 3SZWA 2AAQA 1EBDA 1M64A 2FJDA 4YKFA 4GAVA 1DJQA 1ZMDA 2OA1A 4G9KA 3UCLA 5M10A 4U2LA 3OZ2A 2X99A 5J7XA 4Y4LA 4Z26A 4YXDA 1ONFA 4H4VA 5ER0A 4JNAA 1D7YA 4FX9A 2B9WA 2XFQA 5KRQA 2WESA 3AYJA 3ABVA 3AECA 4H4RA 2GVCA 3VRBA 4EIPA 2TMDA 4CBQA 3DH9A 2WOWA 2V3AA 1CC4A 3CPJG 1LJ1A 4B63A 3UKLA 1GTHA 3DGZA 1S2YA 3NK2X 4U8IA 4B66A 1OJAA 3AE7A 4FK1C 4HB9A 4NEWA 1NG4A 3CGEA 2YLXA 2ACZA 2FJEA 3P4QA 4NTEA 2VRLA 2VOUA 4OCGA 2GAHB 2YQUA 2EQ7A 2DKHA 3CNTA 1KDGA 1L9EA 4O5UA 4REKA 2PHHA 2R4EA 3ICSA 2XFNA 4AP3A 2GR1A 1H84A 1GETA 2R46A 4OPUA 4B67A 1N1PA 1DNCA 1PXCA 2VQBA 4K5RA 3VR8A 2Q6UA 5FS9A 5KMQA 4A79A 1D4DA 2YVFA 4EM4A 4C77A 4IA5A 1VDCA 1OJ9A 2YR6A 4U2TA 3VRDB 3EAOA 3UTGA 1GEUA 4J36A 3E1TA 4BK2A 3AD9B 1Y56A 3HZLA 1KNPA 1CJCA 4GR1A 1FCDA 3GMBA 4H4XA 5EB5A 1GALA 3KPKA 1S3BA 3SXIA 1P2HA 3SX6A 2E1MA 1QJDA 3AD8B 1ZK7A 3T37A 2V60A 4U8JA 1DJNA 4EM3A 1Q9IA 2O9ZA 1L9DA 1L0VA 4I59A 2BC1A 2OLOA 3GYXA 2BS4A 4J2WA 4GDPA 4J33A 2VZ2A 2BS3A 3PS9A 2YG3A 2WEUA 3QVPA 2DKIA 1COYA 1YQZA 4OPTA 1PN0A 1TYPA 3UKQA 3BI4A 4II2A 1KSUA 2B9YA 3CTYA 4C5OA 1DOBA 4EIQA 3AEGA 5C3JA 1GERA 1JNZA 1PDHA 2WP5A 4IVMB 2BC0A 1IUTA 3UOYA 1FECA 4IA6A 3QSEA 5HY5A 3ISHA 5JCMA 3C96A 2RGHA 3RP8A 3LZWA 3NKSA 5GRTA 3R9UA 5EB4A 3SM8A 1TDFA 3CPHG 1M6IA 3KLJA 3KVEA 2B7RA 1DOCA 4HA6A 4CCRA 5EOWA 2ZZCA 3I6DA 3OC4A 1RYIA 2VRMA 4DGKA 4EMJA 2JB1A 4A6NA 3NH3X 1ELIA 1GV4A 1L9CA 1Q1RA 2B76A 2C66A 4A99A 1PJ5A 3NK0X 2X8CA 1BWCA 1PXBA 2YG4A 3SZFA 3SY4A 1IUWA 2OLNA 4DNAA 3SFEA 3K30A 2C65A 4B65A 4H2PA 4C3YA 4J34A 2JBVA 2GR2A 2AQJA 4XWRA 2BCPA 2WHDA 1E6EA 1GOSA 5LV9A 1KNRA 2CFYA 4BJYA 4BURA 4U8MA 4USRA 2QA1A 4MJWA 2XVJA 1ZP0A 2WS3A 4H4SA 3NRNA 4X9NA 4NWZA 3UKHA 3NYCA 3II4A 4K2XA 4U2SA 5U1OA 3WE0A 4AOSA 4XXGA 3REDA 1AOGA 1F8WA 4PAAA 4YSYA 2E4GA 3LOVA 4BJZA 1GNDA 5JCNA 1BKWA 3NNEA 5JCLA 3DK8A 1H6VA 2Y6QA 4YTMA 4GCMA 1N4UA 2BK5A 3ZDNA 3KKJA 1GXFA 1TDKA 1D7LA 2XVEA 5TR3A 3SGLA 5BULA 4NZHA 3ALMA 3AE6A 1O94A 4U8LA 3P9UA 2A8XA 3LJPA 2E5VA 4J56A 3EANA 2RGJA 4CNJA 1JRZA 2YVJA 4H2RA 2FJBA 4Z2RA 1LQTA 3L1RA 1GPEA 3H4KA 2JKCA 2WPEA 4X9MA 1H82A 5CKUA 3P4PA 4CY6A 2ZBWA 3CIRA 4A9WA 3C4AA 3GRSA 1IUVA 1TDOA 2WQYA 1H7WA 5FMHA 4G73A 4TLZA 2VVMA 3VQRA 2BRAA 4E0VA 3NK1X 4OPDA 3RP6A 2BRYA 3AWIA 4H4PA 3T14A 3NYFA 5IPYA 1JOAA 3UKKA 3UP4A 1MXTA 1E1NA 1NHQA 3KA7A 4H4YA 1XHCA 4XWZA 2EQ6A 1IUSA 5EBKA 5U25A 3NN6X 2C4CA 3DJDA 3COXA 4JNQA 5KNLA 1BZLA 1GSNA 4B64A 4H4TA 1LTXR 4OVIA 2W0HA 1EL9A 1ZOYA 3ITJA 2WOIA 1LV0A 2TPRA 2B7SA 4LA1A 3AE5A 2WBAA 3AE1A 4H4ZA 2XLPA 3L8KA 5DBJA 2A87A 4LIIA 4G74A 1OJCA 4KX6A 2YAUA 1N4VA 1YQ4A 1JU2A 3ICRA 3T2ZA 4GDEA 3UP5A 3QFAA 4BK3A 2BA9A 1JRXA 3I3LA 4GRTA 1UKVG 2QAEA 3IF9A 2CULA 2R0CA 4UDRA 2I0ZA 2BK3A 2C75A 3FPZA 4APNA 3UOZA 2OAMA 4CRTA 2R4JA 1GRAA 1MO9A 4OPIA 3RHAA 1F8SA 3ALLA 3KD9A 1ZKQA 2BS2A 4H2QA 4K8DA 1B4VA 4U8KA 3KU9A 4AT0A 3NLCA 5FS6A 2RGOA 4EQXA 4H4UA 3DGHA 2VVLA 4II3A 1OJTA 3GDNA 3K7QX 1ZMCA 3G5QA 3CGCA 4Z43A 2EQ8A 3PVCA 3H8LA 2WP6A 2Z5XA 4EQRA 1KFYA 4I58A 4JY2A 2GR3A 1H81A 1E7PA 3AD7B 3HYXA 2C72A 1YY5A 1GRFA 3BI5A 1JEHA 3AB1A 3CNDA 4ICYA 2IVEA 3AE3A 4UDQA 3CMMA 4AOXA 3NG7X 1PXAA 4DSGA 4Z2UA 3V3OA 1H86A 3V3NA 5KMSA 2WPCA 1S3EA 4GF7A 3UTHA 4A6NB 2V3BA 3BNUA 3DJJA 3F8PA 1O95A 3AEFA 5CQFA 3ZYXA 5BVAA 1BF3A 3UTFA 4LU6A 5KOWA 4Y4NA 3NHOX 4FDCB 1N4WA 1PBFA 1S2QA 3BHKA 3EF6A 3PO7A 3DA1A 3CNSA 4H2NA 4JN9A 5GSNA 3GD4A 1PHHA 1RSGA 1YQ3A 2V61A 2WETA 2XFOA 1FEAA 3AE9A 3DK9A 3LB8A 4A5LA 1PBEA 2ZZ0A 4EMIA 2WDRA 4RG3A 1TDEA 2XYOA 1D4CA 1PJ7A 2WOVA 2GAGB 2JB3A 4C3XA 3GDPA 1Z6LA 3O0HA 4RSLA 5IQ1A 1BGJA 3T31A 1H83A 2C73A 2C3CA 2WPFA 2BK4A 3QJ4A 4H4WA 4IVOB 4X4JA 2H88A 1HYUA 2GMJA 1B5QA 2YM1A 4FK1A 3UKFA 3GWFA 5HXIA 1E1KA 2H89A 2A89A 2JK6A 4YWOA 4EQWA 4USQA 1DODA 3CGDA 4Y4MA 2WP9A 3RP7A 5KMPA 4N9XA 1CJ2A 2WU2A 4UDPA 3UKAA 3AE2A 4CCQA 2XLUA 1NHPA 1PBCA 4K7ZA 5KOXA 2Q0KA 2NPXA 5JCIA 1CF3A 1FEBA 4OPGA 3HYVA 4G6HA 4Z44A 5IQ4A 1PBDA 4NTCA 3B3RA
chains in the Genus database with same CATH topology
4AT2A 2HQMA 2X8GA 5FS7A 3JSKA 4TM3A 4DSHA 1D5TA 1GESA 3LXDA 4ZCDA 5FS8A 1GRTA 3FIMB 4AP1A 3AEEA 2C67A 2ZZBA 4NEVA 2XVIA 4GUVA 3NGCX 3URHA 4NNJA 2YR4A 1FOHA 2F5ZA 4YSZA 2XFPA 4D03A 1VRQB 2ARDA 3IWAA 3B6DA 3BNMA 3F8RA 4YTNA 3UOVA 1XDIA 5KXJA 2IIDA 3D1CA 4YKGA 5C2TA 3H8IA 2C70A 1K4QA 1GREA 2Q0LA 3GYJA 3QSSA 5KMRA 2FJAA 4D04A 1TRBA 3DJGX 3RNMA 3P4SA 2YWLA 1OJDA 1DOEA 4WX1A 1IUXA 4B69A 4CNKA 3IHGA 4ZN0A 2APGA 4M52A 1DXLA 3T2YA 2C7GA 1EL7A 3CGBA 2FBWA 1E1MA 2RABA 1GTEA 3FBSA 1VQWA 1NG3A 3F8DA 1EL8A 2XDOA 4TLXA 3LZXA 3P1WA 1ZOVA 4PABA 1W4XA 2B9XA 3AEDA 4JY3A 1YKJA 2GH5A 3ICTA 1TYTA 2XCGA 1REOA 1JRYA 1VG0A 3CNJA 4ZCCA 3VRAA 1KSSA 4ADWA 2VVLG 3C4NA 3ADAB 5L46A 2V6OA 5KVHA 4K22A 1LPFA 4H4QA 1ZX9A 3AE8A 1VG9A 1V59A 3DMEA 1O5WA 3QSMA 3SZCA 1CC6A 2YVGA 2YM2A 4YT0A 1K0LA 2R45A 1FL2A 3Q6JA 3LADA 2YR5A 1ZY8A 2YLSA 3SZ0A 1TDNA 5JCKA 2JAEA 2BACA 3UOXA 2XFUA 5BRTA 1B37A 1GRBA 2BABA 3M12A 4A7AA 2JB2A 4TM0A 3SQPA 3QFBA 2YLZA 1Y56B 4EMWA 4ECHA 5BUKA 4WCTA 3Q9TA 2AR8A 3FMWA 2EQ9A 4TM4A 3UTEA 1IJHA 1GRGA 2PYXA 5J60A 2GV8A 3ATRA 3G5SA 4OPCA 3UKPA 3GSIA 4TM1A 3GMCA 4H7UA 3NTAA 1NPXA 4C74A 4Z25A 3SFDA 1XANA 3NN0X 1ZDLA 4CY8A 3VR9A 3NT6A 2YLTA 3KPFA 2X50A 2C64A 3P4RA 3AXBA 1NEKA 4EQSA 4BV6A 1LQUA 2XVHA 4J57A 5U63A 3SYIA 1CJ3A 2J3NA 5KWFA 2GMHA 3GWDA 2GB0A 5HYMA 3GRTA 4NTDA 3BI2A 5HHFA 4Z2TA 1F6MA 2V5ZA 3HYWA 1NENA 1E1LA 4B68A 2Y6RA 1MOKA 1PJ6A 3GD3A 2GEWA 3AEBA 4J31A 3CPIG 2WDQA 2YLWA 2CDUA 2XLRA 3CN8A 2X8HA 3ALJA 4BK1A 2UZZA 3AYIA 3AEAA 4A65A 1K0JA 2GQWA 2R0PA 2BCGG 2XVFA 2YG6A 4YSXA 1NHSA 3EPTA 2BXRA 3DK4A 3K7TA 4JDRA 4K5SA 3AYLA 1CC2A 2IVDA 2BXSA 2CVJA 1SEZA 3QVRA 4G6GA 4YSHA 4Z24A 1NHRA 4O5QA 3M13A 1CHUA 3M0OA 4B1BA 1CBOA 4JQ9A 2QA2A 3K7MX 1P2EA 3ATQA 4U8NA 2XLSA 2XLTA 1EL5A 3G5RA 1NDAA 2VQ7A 1PS9A 1XPQA 1H7XA 1NAAA 3V76A 1K0IA 1CL0A 3NYEA 4U8PA 2C76A 2YG7A 1F8RA 4GAPA 4KPRA 3FG2P 2NVKX 3S61A 4YTPA 1D4EA 1PBBA 1Y0PA 3DJEA 3NTDA 2GR0A 1LVLA 2X3NA 2R9ZA 2YLRA 2WDVA 3BHFA 1JNRA 2Q7VA 3IC9A 1QLBA 4P9SA 5KVIA 2Z5YA 4IV9A 3S5WA 1QO8A 2R0GA 4OPLA 3GYIA 2GQFA 3T2KA 3IHMA 1KF6A 2WU5A 3AE4A 5M0ZA 2GRTA 1X31B 1IUUA 2BYBA 1E39A 2YG5A 3D8XA 3T0KA 1B8SA 1CJ4A 3NIXA 1BGNA 2OALA 1GRHA 4RG4A 4U8OA 1GT8A 1RP0A 2QCUA 1Q1WA 4UP3A 2GF3A 4H50A 1F3PA 2C3DA 3CNPA 3SZWA 2AAQA 1EBDA 1M64A 2FJDA 4YKFA 4GAVA 1DJQA 1ZMDA 2OA1A 4G9KA 3UCLA 5M10A 4U2LA 3OZ2A 2X99A 5J7XA 4Y4LA 4Z26A 4YXDA 1ONFA 4H4VA 5ER0A 4JNAA 1D7YA 4FX9A 2B9WA 2XFQA 5KRQA 2WESA 3AYJA 3ABVA 3AECA 4H4RA 2GVCA 3VRBA 4EIPA 2TMDA 4CBQA 3DH9A 2WOWA 2V3AA 1CC4A 3CPJG 1LJ1A 4B63A 3UKLA 1GTHA 3DGZA 1S2YA 3NK2X 4U8IA 4B66A 1OJAA 3AE7A 4FK1C 4HB9A 4NEWA 1NG4A 3CGEA 2YLXA 2ACZA 2FJEA 3P4QA 4NTEA 2VRLA 2VOUA 4OCGA 2GAHB 2YQUA 2EQ7A 2DKHA 3CNTA 1KDGA 1L9EA 4O5UA 4REKA 2PHHA 2R4EA 3ICSA 2XFNA 4AP3A 2GR1A 1H84A 1GETA 2R46A 4OPUA 4B67A 1N1PA 1DNCA 1PXCA 2VQBA 4K5RA 3VR8A 2Q6UA 5FS9A 5KMQA 4A79A 1D4DA 2YVFA 4EM4A 4C77A 4IA5A 1VDCA 1OJ9A 2YR6A 4U2TA 3VRDB 3EAOA 3UTGA 1GEUA 4J36A 3E1TA 4BK2A 3AD9B 1Y56A 3HZLA 1KNPA 1CJCA 4GR1A 1FCDA 3GMBA 4H4XA 5EB5A 1GALA 3KPKA 1S3BA 3SXIA 1P2HA 3SX6A 2E1MA 1QJDA 3AD8B 1ZK7A 3T37A 2V60A 4U8JA 1DJNA 4EM3A 1Q9IA 2O9ZA 1L9DA 1L0VA 4I59A 2BC1A 2OLOA 3GYXA 2BS4A 4J2WA 4GDPA 4J33A 2VZ2A 2BS3A 3PS9A 2YG3A 2WEUA 3QVPA 2DKIA 1COYA 1YQZA 4OPTA 1PN0A 1TYPA 3UKQA 3BI4A 4II2A 1KSUA 2B9YA 3CTYA 4C5OA 1DOBA 4EIQA 3AEGA 5C3JA 1GERA 1JNZA 1PDHA 2WP5A 4IVMB 2BC0A 1IUTA 3UOYA 1FECA 4IA6A 3QSEA 5HY5A 3ISHA 5JCMA 3C96A 2RGHA 3RP8A 3LZWA 3NKSA 5GRTA 3R9UA 5EB4A 3SM8A 1TDFA 3CPHG 1M6IA 3KLJA 3KVEA 2B7RA 1DOCA 4HA6A 4CCRA 5EOWA 2ZZCA 3I6DA 3OC4A 1RYIA 2VRMA 4DGKA 4EMJA 2JB1A 4A6NA 3NH3X 1ELIA 1GV4A 1L9CA 1Q1RA 2B76A 2C66A 4A99A 1PJ5A 3NK0X 2X8CA 1BWCA 1PXBA 2YG4A 3SZFA 3SY4A 1IUWA 2OLNA 4DNAA 3SFEA 3K30A 2C65A 4B65A 4H2PA 4C3YA 4J34A 2JBVA 2GR2A 2AQJA 4XWRA 2BCPA 2WHDA 1E6EA 1GOSA 5LV9A 1KNRA 2CFYA 4BJYA 4BURA 4U8MA 4USRA 2QA1A 4MJWA 2XVJA 1ZP0A 2WS3A 4H4SA 3NRNA 4X9NA 4NWZA 3UKHA 3NYCA 3II4A 4K2XA 4U2SA 5U1OA 3WE0A 4AOSA 4XXGA 3REDA 1AOGA 1F8WA 4PAAA 4YSYA 2E4GA 3LOVA 4BJZA 1GNDA 5JCNA 1BKWA 3NNEA 5JCLA 3DK8A 1H6VA 2Y6QA 4YTMA 4GCMA 1N4UA 2BK5A 3ZDNA 3KKJA 1GXFA 1TDKA 1D7LA 2XVEA 5TR3A 3SGLA 5BULA 4NZHA 3ALMA 3AE6A 1O94A 4U8LA 3P9UA 2A8XA 3LJPA 2E5VA 4J56A 3EANA 2RGJA 4CNJA 1JRZA 2YVJA 4H2RA 2FJBA 4Z2RA 1LQTA 3L1RA 1GPEA 3H4KA 2JKCA 2WPEA 4X9MA 1H82A 5CKUA 3P4PA 4CY6A 2ZBWA 3CIRA 4A9WA 3C4AA 3GRSA 1IUVA 1TDOA 2WQYA 1H7WA 5FMHA 4G73A 4TLZA 2VVMA 3VQRA 2BRAA 4E0VA 3NK1X 4OPDA 3RP6A 2BRYA 3AWIA 4H4PA 3T14A 3NYFA 5IPYA 1JOAA 3UKKA 3UP4A 1MXTA 1E1NA 1NHQA 3KA7A 4H4YA 1XHCA 4XWZA 2EQ6A 1IUSA 5EBKA 5U25A 3NN6X 2C4CA 3DJDA 3COXA 4JNQA 5KNLA 1BZLA 1GSNA 4B64A 4H4TA 1LTXR 4OVIA 2W0HA 1EL9A 1ZOYA 3ITJA 2WOIA 1LV0A 2TPRA 2B7SA 4LA1A 3AE5A 2WBAA 3AE1A 4H4ZA 2XLPA 3L8KA 5DBJA 2A87A 4LIIA 4G74A 1OJCA 4KX6A 2YAUA 1N4VA 1YQ4A 1JU2A 3ICRA 3T2ZA 4GDEA 3UP5A 3QFAA 4BK3A 2BA9A 1JRXA 3I3LA 4GRTA 1UKVG 2QAEA 3IF9A 2CULA 2R0CA 4UDRA 2I0ZA 2BK3A 2C75A 3FPZA 4APNA 3UOZA 2OAMA 4CRTA 2R4JA 1GRAA 1MO9A 4OPIA 3RHAA 1F8SA 3ALLA 3KD9A 1ZKQA 2BS2A 4H2QA 4K8DA 1B4VA 4U8KA 3KU9A 4AT0A 3NLCA 5FS6A 2RGOA 4EQXA 4H4UA 3DGHA 2VVLA 4II3A 1OJTA 3GDNA 3K7QX 1ZMCA 3G5QA 3CGCA 4Z43A 2EQ8A 3PVCA 3H8LA 2WP6A 2Z5XA 4EQRA 1KFYA 4I58A 4JY2A 2GR3A 1H81A 1E7PA 3AD7B 3HYXA 2C72A 1YY5A 1GRFA 3BI5A 1JEHA 3AB1A 3CNDA 4ICYA 2IVEA 3AE3A 4UDQA 3CMMA 4AOXA 3NG7X 1PXAA 4DSGA 4Z2UA 3V3OA 1H86A 3V3NA 5KMSA 2WPCA 1S3EA 4GF7A 3UTHA 4A6NB 2V3BA 3BNUA 3DJJA 3F8PA 1O95A 3AEFA 5CQFA 3ZYXA 5BVAA 1BF3A 3UTFA 4LU6A 5KOWA 4Y4NA 3NHOX 4FDCB 1N4WA 1PBFA 1S2QA 3BHKA 3EF6A 3PO7A 3DA1A 3CNSA 4H2NA 4JN9A 5GSNA 3GD4A 1PHHA 1RSGA 1YQ3A 2V61A 2WETA 2XFOA 1FEAA 3AE9A 3DK9A 3LB8A 4A5LA 1PBEA 2ZZ0A 4EMIA 2WDRA 4RG3A 1TDEA 2XYOA 1D4CA 1PJ7A 2WOVA 2GAGB 2JB3A 4C3XA 3GDPA 1Z6LA 3O0HA 4RSLA 5IQ1A 1BGJA 3T31A 1H83A 2C73A 2C3CA 2WPFA 2BK4A 3QJ4A 4H4WA 4IVOB 4X4JA 2H88A 1HYUA 2GMJA 1B5QA 2YM1A 4FK1A 3UKFA 3GWFA 5HXIA 1E1KA 2H89A 2A89A 2JK6A 4YWOA 4EQWA 4USQA 1DODA 3CGDA 4Y4MA 2WP9A 3RP7A 5KMPA 4N9XA 1CJ2A 2WU2A 4UDPA 3UKAA 3AE2A 4CCQA 2XLUA 1NHPA 1PBCA 4K7ZA 5KOXA 2Q0KA 2NPXA 5JCIA 1CF3A 1FEBA 4OPGA 3HYVA 4G6HA 4Z44A 5IQ4A 1PBDA 4NTCA 3B3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT2 A;  2HQM A;  2X8G A;  5FS7 A;  3JSK A;  4TM3 A;  4DSH A;  1D5T A;  1GES A;  3LXD A;  4ZCD A;  5FS8 A;  1GRT A;  3FIM B;  4AP1 A;  3AEE A;  2C67 A;  2ZZB A;  4NEV A;  2XVI A;  4GUV A;  3NGC X;  3URH A;  2YR4 A;  1FOH A;  2F5Z A;  4YSZ A;  2XFP A;  4D03 A;  1VRQ B;  2ARD A;  3IWA A;  3B6D A;  3BNM A;  3F8R A;  4YTN A;  3UOV A;  1XDI A;  5KXJ A;  2IID A;  3D1C A;  4YKG A;  5C2T A;  3H8I A;  2C70 A;  1K4Q A;  1GRE A;  2Q0L A;  3GYJ A;  3QSS A;  2FJA A;  4D04 A;  1TRB A;  3DJG X;  3RNM A;  3P4S A;  2YWL A;  1OJD A;  1DOE A;  4WX1 A;  1IUX A;  4B69 A;  4CNK A;  3IHG A;  4ZN0 A;  2APG A;  4M52 A;  1DXL A;  2C7G A;  1EL7 A;  3CGB A;  2FBW A;  1E1M A;  2RAB A;  1GTE A;  3FBS A;  1VQW A;  1NG3 A;  3F8D A;  1EL8 A;  2XDO A;  4TLX A;  3LZX A;  3P1W A;  1ZOV A;  4PAB A;  1W4X A;  2B9X A;  3AED A;  4JY3 A;  1YKJ A;  2GH5 A;  3ICT A;  1TYT A;  2XCG A;  1REO A;  1JRY A;  1VG0 A;  3CNJ A;  4ZCC A;  3VRA A;  1KSS A;  4ADW A;  2VVL G;  3C4N A;  3ADA B;  5L46 A;  2V6O A;  5KVH A;  4K22 A;  1LPF A;  4H4Q A;  1ZX9 A;  3AE8 A;  1VG9 A;  1V59 A;  3DME A;  1O5W A;  3QSM A;  4YT0 A;  1CC6 A;  2YVG A;  2YM2 A;  1K0L A;  2R45 A;  1FL2 A;  3Q6J A;  3LAD A;  2YR5 A;  1ZY8 A;  2YLS A;  5JCK A;  1TDN A;  2JAE A;  2BAC A;  3UOX A;  2XFU A;  5BRT A;  1B37 A;  1GRB A;  2BAB A;  3M12 A;  4A7A A;  2JB2 A;  4TM0 A;  3SQP A;  3QFB A;  2YLZ A;  1Y56 B;  4EMW A;  4ECH A;  5BUK A;  4WCT A;  3Q9T A;  2AR8 A;  3FMW A;  2EQ9 A;  4TM4 A;  3UTE A;  1IJH A;  1GRG A;  2PYX A;  5J60 A;  2GV8 A;  3ATR A;  3G5S A;  4OPC A;  3UKP A;  3GSI A;  4TM1 A;  3GMC A;  4H7U A;  3NTA A;  1NPX A;  4C74 A;  4Z25 A;  3SFD A;  1XAN A;  3NN0 X;  1ZDL A;  4CY8 A;  3VR9 A;  3NT6 A;  2YLT A;  3KPF A;  2X50 A;  2C64 A;  3P4R A;  3AXB A;  1NEK A;  4EQS A;  4BV6 A;  1LQU A;  2XVH A;  4J57 A;  5U63 A;  1CJ3 A;  2J3N A;  5KWF A;  2GMH A;  3GWD A;  2GB0 A;  5HYM A;  3GRT A;  4NTD A;  3BI2 A;  5HHF A;  4Z2T A;  1F6M A;  2V5Z A;  1NEN A;  1E1L A;  4B68 A;  2Y6R A;  1MOK A;  1PJ6 A;  3GD3 A;  2GEW A;  3AEB A;  4J31 A;  3CPI G;  2WDQ A;  2YLW A;  2CDU A;  2XLR A;  3CN8 A;  2X8H A;  3ALJ A;  4BK1 A;  2UZZ A;  3AYI A;  3AEA A;  4A65 A;  1K0J A;  2GQW A;  2R0P A;  2BCG G;  2XVF A;  2YG6 A;  4YSX A;  1NHS A;  3EPT A;  2BXR A;  3DK4 A;  3K7T A;  4JDR A;  4K5S A;  3AYL A;  1CC2 A;  2IVD A;  2BXS A;  2CVJ A;  1SEZ A;  3QVR A;  4YSH A;  4Z24 A;  1NHR A;  4O5Q A;  3M13 A;  1CHU A;  3M0O A;  4B1B A;  1CBO A;  4JQ9 A;  2QA2 A;  3K7M X;  1P2E A;  3ATQ A;  4U8N A;  2XLS A;  2XLT A;  1EL5 A;  3G5R A;  1NDA A;  2VQ7 A;  1PS9 A;  1XPQ A;  1H7X A;  1NAA A;  3V76 A;  1K0I A;  1CL0 A;  3NYE A;  4U8P A;  2C76 A;  2YG7 A;  1F8R A;  4KPR A;  3FG2 P;  2NVK X;  3S61 A;  4YTP A;  1D4E A;  1PBB A;  1Y0P A;  3DJE A;  3NTD A;  2GR0 A;  1LVL A;  2X3N A;  2R9Z A;  2YLR A;  2WDV A;  3BHF A;  1JNR A;  2Q7V A;  3IC9 A;  1QLB A;  4P9S A;  5KVI A;  2Z5Y A;  4IV9 A;  3S5W A;  1QO8 A;  2R0G A;  4OPL A;  3GYI A;  2GQF A;  3IHM A;  1KF6 A;  2WU5 A;  3AE4 A;  5M0Z A;  2GRT A;  1X31 B;  1IUU A;  2BYB A;  1E39 A;  2YG5 A;  3D8X A;  1B8S A;  1CJ4 A;  3NIX A;  1BGN A;  2OAL A;  1GRH A;  4RG4 A;  4U8O A;  1GT8 A;  1RP0 A;  2QCU A;  1Q1W A;  4UP3 A;  2GF3 A;  4H50 A;  1F3P A;  2C3D A;  3CNP A;  2AAQ A;  1EBD A;  1M64 A;  2FJD A;  4YKF A;  1DJQ A;  1ZMD A;  2OA1 A;  3UCL A;  5M10 A;  4U2L A;  3OZ2 A;  2X99 A;  5J7X A;  4Y4L A;  4Z26 A;  4YXD A;  1ONF A;  4H4V A;  5ER0 A;  4JNA A;  1D7Y A;  4FX9 A;  2B9W A;  2XFQ A;  5KRQ A;  2WES A;  3AYJ A;  3ABV A;  3AEC A;  4H4R A;  2GVC A;  3VRB A;  4EIP A;  2TMD A;  4CBQ A;  3DH9 A;  2WOW A;  2V3A A;  1CC4 A;  3CPJ G;  1LJ1 A;  4B63 A;  3UKL A;  1GTH A;  3DGZ A;  1S2Y A;  3NK2 X;  4U8I A;  4B66 A;  1OJA A;  3AE7 A;  4FK1 C;  4HB9 A;  4NEW A;  1NG4 A;  3CGE A;  2YLX A;  2ACZ A;  2FJE A;  3P4Q A;  4NTE A;  2VRL A;  2VOU A;  4OCG A;  2GAH B;  2YQU A;  2EQ7 A;  2DKH A;  3CNT A;  1KDG A;  1L9E A;  4O5U A;  4REK A;  2PHH A;  2R4E A;  3ICS A;  2XFN A;  4AP3 A;  2GR1 A;  1H84 A;  1GET A;  2R46 A;  4OPU A;  4B67 A;  1N1P A;  1DNC A;  1PXC A;  2VQB A;  4K5R A;  3VR8 A;  2Q6U A;  5FS9 A;  4A79 A;  1D4D A;  2YVF A;  4EM4 A;  4C77 A;  4IA5 A;  1VDC A;  1OJ9 A;  2YR6 A;  4U2T A;  3VRD B;  3EAO A;  3UTG A;  1GEU A;  4J36 A;  3E1T A;  4BK2 A;  3AD9 B;  1Y56 A;  3HZL A;  1KNP A;  1CJC A;  4GR1 A;  1FCD A;  3GMB A;  4H4X A;  5EB5 A;  1GAL A;  1S3B A;  1P2H A;  2E1M A;  1QJD A;  3AD8 B;  1ZK7 A;  3T37 A;  2V60 A;  4U8J A;  1DJN A;  4EM3 A;  1Q9I A;  2O9Z A;  1L9D A;  1L0V A;  4I59 A;  2BC1 A;  2OLO A;  2BS4 A;  4J2W A;  4GDP A;  4J33 A;  2VZ2 A;  2BS3 A;  3PS9 A;  2YG3 A;  2WEU A;  3QVP A;  2DKI A;  1COY A;  1YQZ A;  4OPT A;  1PN0 A;  1TYP A;  3UKQ A;  3BI4 A;  1KSU A;  2B9Y A;  3CTY A;  4C5O A;  1DOB A;  4EIQ A;  3AEG A;  5C3J A;  1GER A;  1JNZ A;  1PDH A;  2WP5 A;  4IVM B;  2BC0 A;  1IUT A;  3UOY A;  1FEC A;  4IA6 A;  3QSE A;  5HY5 A;  3ISH A;  5JCM A;  3C96 A;  2RGH A;  3RP8 A;  3LZW A;  3NKS A;  5GRT A;  3R9U A;  5EB4 A;  3SM8 A;  1TDF A;  3CPH G;  1M6I A;  3KLJ A;  3KVE A;  2B7R A;  1DOC A;  4HA6 A;  4CCR A;  5EOW A;  2ZZC A;  3I6D A;  3OC4 A;  1RYI A;  2VRM A;  4DGK A;  4EMJ A;  2JB1 A;  4A6N A;  3NH3 X;  1ELI A;  1GV4 A;  1L9C A;  1Q1R A;  2B76 A;  2C66 A;  4A99 A;  1PJ5 A;  3NK0 X;  2X8C A;  1BWC A;  1PXB A;  2YG4 A;  1IUW A;  2OLN A;  4DNA A;  3SFE A;  3K30 A;  2C65 A;  4B65 A;  4H2P A;  4C3Y A;  4J34 A;  2JBV A;  2GR2 A;  2AQJ A;  4XWR A;  2BCP A;  2WHD A;  1E6E A;  1GOS A;  5LV9 A;  1KNR A;  2CFY A;  4BJY A;  4BUR A;  4U8M A;  4USR A;  2QA1 A;  4MJW A;  2XVJ A;  1ZP0 A;  2WS3 A;  4H4S A;  3NRN A;  4X9N A;  3UKH A;  3NYC A;  3II4 A;  4K2X A;  4U2S A;  5U1O A;  3WE0 A;  4AOS A;  4XXG A;  3RED A;  1AOG A;  1F8W A;  4PAA A;  4YSY A;  2E4G A;  3LOV A;  4BJZ A;  1GND A;  5JCN A;  1BKW A;  3NNE A;  5JCL A;  3DK8 A;  1H6V A;  2Y6Q A;  4YTM A;  4GCM A;  1N4U A;  2BK5 A;  3ZDN A;  3KKJ A;  1GXF A;  1TDK A;  1D7L A;  2XVE A;  5TR3 A;  3SGL A;  5BUL A;  4NZH A;  3ALM A;  3AE6 A;  1O94 A;  4U8L A;  3P9U A;  2A8X A;  3LJP A;  2E5V A;  4J56 A;  3EAN A;  2RGJ A;  4CNJ A;  1JRZ A;  2YVJ A;  4H2R A;  2FJB A;  4Z2R A;  1LQT A;  3L1R A;  1GPE A;  3H4K A;  2JKC A;  2WPE A;  4X9M A;  1H82 A;  5CKU A;  3P4P A;  4CY6 A;  2ZBW A;  3CIR A;  4A9W A;  3C4A A;  3GRS A;  1IUV A;  1TDO A;  2WQY A;  1H7W A;  5FMH A;  4TLZ A;  2VVM A;  3VQR A;  4E0V A;  3NK1 X;  4OPD A;  3RP6 A;  3AWI A;  4H4P A;  3NYF A;  5IPY A;  1JOA A;  3UKK A;  3UP4 A;  1MXT A;  1E1N A;  1NHQ A;  3KA7 A;  4H4Y A;  1XHC A;  4XWZ A;  2EQ6 A;  1IUS A;  5EBK A;  5U25 A;  3NN6 X;  3DJD A;  3COX A;  4JNQ A;  1BZL A;  1GSN A;  4B64 A;  4H4T A;  1LTX R;  4OVI A;  2W0H A;  1EL9 A;  1ZOY A;  3ITJ A;  2WOI A;  1LV0 A;  2TPR A;  2B7S A;  4LA1 A;  3AE5 A;  2WBA A;  3AE1 A;  4H4Z A;  2XLP A;  3L8K A;  5DBJ A;  2A87 A;  4LII A;  1OJC A;  4KX6 A;  2YAU A;  1N4V A;  1YQ4 A;  1JU2 A;  3ICR A;  4GDE A;  3UP5 A;  3QFA A;  4BK3 A;  2BA9 A;  1JRX A;  3I3L A;  4GRT A;  1UKV G;  2QAE A;  3IF9 A;  2CUL A;  2R0C A;  4UDR A;  2I0Z A;  2BK3 A;  2C75 A;  3FPZ A;  4APN A;  3UOZ A;  2OAM A;  4CRT A;  2R4J A;  1GRA A;  1MO9 A;  4OPI A;  3RHA A;  1F8S A;  3ALL A;  3KD9 A;  1ZKQ A;  2BS2 A;  4H2Q A;  4K8D A;  1B4V A;  4U8K A;  3KU9 A;  4AT0 A;  3NLC A;  5FS6 A;  2RGO A;  4EQX A;  4H4U A;  3DGH A;  2VVL A;  1OJT A;  3GDN A;  3K7Q X;  1ZMC A;  3G5Q A;  3CGC A;  4Z43 A;  2EQ8 A;  3PVC A;  3H8L A;  2WP6 A;  2Z5X A;  4EQR A;  1KFY A;  4I58 A;  4JY2 A;  2GR3 A;  1H81 A;  1E7P A;  3AD7 B;  2C72 A;  1YY5 A;  1GRF A;  3BI5 A;  1JEH A;  3AB1 A;  3CND A;  4ICY A;  2IVE A;  3AE3 A;  4UDQ A;  4AOX A;  3NG7 X;  1PXA A;  4DSG A;  4Z2U A;  3V3O A;  1H86 A;  3V3N A;  2WPC A;  1S3E A;  4GF7 A;  3UTH A;  4A6N B;  2V3B A;  3BNU A;  3DJJ A;  3F8P A;  1O95 A;  3AEF A;  5CQF A;  3ZYX A;  5BVA A;  1BF3 A;  3UTF A;  4LU6 A;  5KOW A;  4Y4N A;  3NHO X;  4FDC B;  1N4W A;  1PBF A;  1S2Q A;  3BHK A;  3EF6 A;  3PO7 A;  3DA1 A;  3CNS A;  4H2N A;  4JN9 A;  5GSN A;  3GD4 A;  1PHH A;  1RSG A;  1YQ3 A;  2V61 A;  2WET A;  2XFO A;  1FEA A;  3AE9 A;  3DK9 A;  3LB8 A;  4A5L A;  1PBE A;  2ZZ0 A;  4EMI A;  2WDR A;  4RG3 A;  1TDE A;  2XYO A;  1D4C A;  1PJ7 A;  2WOV A;  2GAG B;  2JB3 A;  4C3X A;  3GDP A;  1Z6L A;  3O0H A;  4RSL A;  5IQ1 A;  1BGJ A;  1H83 A;  2C73 A;  2C3C A;  2WPF A;  2BK4 A;  3QJ4 A;  4H4W A;  4IVO B;  4X4J A;  2H88 A;  1HYU A;  2GMJ A;  1B5Q A;  2YM1 A;  4FK1 A;  3UKF A;  3GWF A;  5HXI A;  1E1K A;  2H89 A;  2A89 A;  2JK6 A;  4YWO A;  4EQW A;  4USQ A;  1DOD A;  3CGD A;  4Y4M A;  2WP9 A;  3RP7 A;  4N9X A;  1CJ2 A;  2WU2 A;  4UDP A;  3UKA A;  3AE2 A;  4CCQ A;  2XLU A;  1NHP A;  1PBC A;  4K7Z A;  5KOX A;  2Q0K A;  2NPX A;  5JCI A;  1CF3 A;  1FEB A;  4OPG A;  4Z44 A;  5IQ4 A;  1PBD A;  4NTC A;  3B3R A; 
#chains in the Genus database with same CATH topology
 4AT2 A;  2HQM A;  2X8G A;  5FS7 A;  3JSK A;  4TM3 A;  4DSH A;  1D5T A;  1GES A;  3LXD A;  4ZCD A;  5FS8 A;  1GRT A;  3FIM B;  4AP1 A;  3AEE A;  2C67 A;  2ZZB A;  4NEV A;  2XVI A;  4GUV A;  3NGC X;  3URH A;  4NNJ A;  2YR4 A;  1FOH A;  2F5Z A;  4YSZ A;  2XFP A;  4D03 A;  1VRQ B;  2ARD A;  3IWA A;  3B6D A;  3BNM A;  3F8R A;  4YTN A;  3UOV A;  1XDI A;  5KXJ A;  2IID A;  3D1C A;  4YKG A;  5C2T A;  3H8I A;  2C70 A;  1K4Q A;  1GRE A;  2Q0L A;  3GYJ A;  3QSS A;  5KMR A;  2FJA A;  4D04 A;  1TRB A;  3DJG X;  3RNM A;  3P4S A;  2YWL A;  1OJD A;  1DOE A;  4WX1 A;  1IUX A;  4B69 A;  4CNK A;  3IHG A;  4ZN0 A;  2APG A;  4M52 A;  1DXL A;  3T2Y A;  2C7G A;  1EL7 A;  3CGB A;  2FBW A;  1E1M A;  2RAB A;  1GTE A;  3FBS A;  1VQW A;  1NG3 A;  3F8D A;  1EL8 A;  2XDO A;  4TLX A;  3LZX A;  3P1W A;  1ZOV A;  4PAB A;  1W4X A;  2B9X A;  3AED A;  4JY3 A;  1YKJ A;  2GH5 A;  3ICT A;  1TYT A;  2XCG A;  1REO A;  1JRY A;  1VG0 A;  3CNJ A;  4ZCC A;  3VRA A;  1KSS A;  4ADW A;  2VVL G;  3C4N A;  3ADA B;  5L46 A;  2V6O A;  5KVH A;  4K22 A;  1LPF A;  4H4Q A;  1ZX9 A;  3AE8 A;  1VG9 A;  1V59 A;  3DME A;  1O5W A;  3QSM A;  3SZC A;  1CC6 A;  2YVG A;  2YM2 A;  4YT0 A;  1K0L A;  2R45 A;  1FL2 A;  3Q6J A;  3LAD A;  2YR5 A;  1ZY8 A;  2YLS A;  3SZ0 A;  1TDN A;  5JCK A;  2JAE A;  2BAC A;  3UOX A;  2XFU A;  5BRT A;  1B37 A;  1GRB A;  2BAB A;  3M12 A;  4A7A A;  2JB2 A;  4TM0 A;  3SQP A;  3QFB A;  2YLZ A;  1Y56 B;  4EMW A;  4ECH A;  5BUK A;  4WCT A;  3Q9T A;  2AR8 A;  3FMW A;  2EQ9 A;  4TM4 A;  3UTE A;  1IJH A;  1GRG A;  2PYX A;  5J60 A;  2GV8 A;  3ATR A;  3G5S A;  4OPC A;  3UKP A;  3GSI A;  4TM1 A;  3GMC A;  4H7U A;  3NTA A;  1NPX A;  4C74 A;  4Z25 A;  3SFD A;  1XAN A;  3NN0 X;  1ZDL A;  4CY8 A;  3VR9 A;  3NT6 A;  2YLT A;  3KPF A;  2X50 A;  2C64 A;  3P4R A;  3AXB A;  1NEK A;  4EQS A;  4BV6 A;  1LQU A;  2XVH A;  4J57 A;  5U63 A;  3SYI A;  1CJ3 A;  2J3N A;  5KWF A;  2GMH A;  3GWD A;  2GB0 A;  5HYM A;  3GRT A;  4NTD A;  3BI2 A;  5HHF A;  4Z2T A;  1F6M A;  2V5Z A;  3HYW A;  1NEN A;  1E1L A;  4B68 A;  2Y6R A;  1MOK A;  1PJ6 A;  3GD3 A;  2GEW A;  3AEB A;  4J31 A;  3CPI G;  2WDQ A;  2YLW A;  2CDU A;  2XLR A;  3CN8 A;  2X8H A;  3ALJ A;  4BK1 A;  2UZZ A;  3AYI A;  3AEA A;  4A65 A;  1K0J A;  2GQW A;  2R0P A;  2BCG G;  2XVF A;  2YG6 A;  4YSX A;  1NHS A;  3EPT A;  2BXR A;  3DK4 A;  3K7T A;  4JDR A;  4K5S A;  3AYL A;  1CC2 A;  2IVD A;  2BXS A;  2CVJ A;  1SEZ A;  3QVR A;  4G6G A;  4YSH A;  4Z24 A;  1NHR A;  4O5Q A;  3M13 A;  1CHU A;  3M0O A;  4B1B A;  1CBO A;  4JQ9 A;  2QA2 A;  3K7M X;  1P2E A;  3ATQ A;  4U8N A;  2XLS A;  2XLT A;  1EL5 A;  3G5R A;  1NDA A;  2VQ7 A;  1PS9 A;  1XPQ A;  1H7X A;  1NAA A;  3V76 A;  1K0I A;  1CL0 A;  3NYE A;  4U8P A;  2C76 A;  2YG7 A;  1F8R A;  4GAP A;  4KPR A;  3FG2 P;  2NVK X;  3S61 A;  4YTP A;  1D4E A;  1PBB A;  1Y0P A;  3DJE A;  3NTD A;  2GR0 A;  1LVL A;  2X3N A;  2R9Z A;  2YLR A;  2WDV A;  3BHF A;  1JNR A;  2Q7V A;  3IC9 A;  1QLB A;  4P9S A;  5KVI A;  2Z5Y A;  4IV9 A;  3S5W A;  1QO8 A;  2R0G A;  4OPL A;  3GYI A;  2GQF A;  3T2K A;  3IHM A;  1KF6 A;  2WU5 A;  3AE4 A;  5M0Z A;  2GRT A;  1X31 B;  1IUU A;  2BYB A;  1E39 A;  2YG5 A;  3D8X A;  3T0K A;  1B8S A;  1CJ4 A;  3NIX A;  1BGN A;  2OAL A;  1GRH A;  4RG4 A;  4U8O A;  1GT8 A;  1RP0 A;  2QCU A;  1Q1W A;  4UP3 A;  2GF3 A;  4H50 A;  1F3P A;  2C3D A;  3CNP A;  3SZW A;  2AAQ A;  1EBD A;  1M64 A;  2FJD A;  4YKF A;  4GAV A;  1DJQ A;  1ZMD A;  2OA1 A;  4G9K A;  3UCL A;  5M10 A;  4U2L A;  3OZ2 A;  2X99 A;  5J7X A;  4Y4L A;  4Z26 A;  4YXD A;  1ONF A;  4H4V A;  5ER0 A;  4JNA A;  1D7Y A;  4FX9 A;  2B9W A;  2XFQ A;  5KRQ A;  2WES A;  3AYJ A;  3ABV A;  3AEC A;  4H4R A;  2GVC A;  3VRB A;  4EIP A;  2TMD A;  4CBQ A;  3DH9 A;  2WOW A;  2V3A A;  1CC4 A;  3CPJ G;  1LJ1 A;  4B63 A;  3UKL A;  1GTH A;  3DGZ A;  1S2Y A;  3NK2 X;  4U8I A;  4B66 A;  1OJA A;  3AE7 A;  4FK1 C;  4HB9 A;  4NEW A;  1NG4 A;  3CGE A;  2YLX A;  2ACZ A;  2FJE A;  3P4Q A;  4NTE A;  2VRL A;  2VOU A;  4OCG A;  2GAH B;  2YQU A;  2EQ7 A;  2DKH A;  3CNT A;  1KDG A;  1L9E A;  4O5U A;  4REK A;  2PHH A;  2R4E A;  3ICS A;  2XFN A;  4AP3 A;  2GR1 A;  1H84 A;  1GET A;  2R46 A;  4OPU A;  4B67 A;  1N1P A;  1DNC A;  1PXC A;  2VQB A;  4K5R A;  3VR8 A;  2Q6U A;  5FS9 A;  5KMQ A;  4A79 A;  1D4D A;  2YVF A;  4EM4 A;  4C77 A;  4IA5 A;  1VDC A;  1OJ9 A;  2YR6 A;  4U2T A;  3VRD B;  3EAO A;  3UTG A;  1GEU A;  4J36 A;  3E1T A;  4BK2 A;  3AD9 B;  1Y56 A;  3HZL A;  1KNP A;  1CJC A;  4GR1 A;  1FCD A;  3GMB A;  4H4X A;  5EB5 A;  1GAL A;  3KPK A;  1S3B A;  3SXI A;  1P2H A;  3SX6 A;  2E1M A;  1QJD A;  3AD8 B;  1ZK7 A;  3T37 A;  2V60 A;  4U8J A;  1DJN A;  4EM3 A;  1Q9I A;  2O9Z A;  1L9D A;  1L0V A;  4I59 A;  2BC1 A;  2OLO A;  3GYX A;  2BS4 A;  4J2W A;  4GDP A;  4J33 A;  2VZ2 A;  2BS3 A;  3PS9 A;  2YG3 A;  2WEU A;  3QVP A;  2DKI A;  1COY A;  1YQZ A;  4OPT A;  1PN0 A;  1TYP A;  3UKQ A;  3BI4 A;  4II2 A;  1KSU A;  2B9Y A;  3CTY A;  4C5O A;  1DOB A;  4EIQ A;  3AEG A;  5C3J A;  1GER A;  1JNZ A;  1PDH A;  2WP5 A;  4IVM B;  2BC0 A;  1IUT A;  3UOY A;  1FEC A;  4IA6 A;  3QSE A;  5HY5 A;  3ISH A;  5JCM A;  3C96 A;  2RGH A;  3RP8 A;  3LZW A;  3NKS A;  5GRT A;  3R9U A;  5EB4 A;  3SM8 A;  1TDF A;  3CPH G;  1M6I A;  3KLJ A;  3KVE A;  2B7R A;  1DOC A;  4HA6 A;  4CCR A;  5EOW A;  2ZZC A;  3I6D A;  3OC4 A;  1RYI A;  2VRM A;  4DGK A;  4EMJ A;  2JB1 A;  4A6N A;  3NH3 X;  1ELI A;  1GV4 A;  1L9C A;  1Q1R A;  2B76 A;  2C66 A;  4A99 A;  1PJ5 A;  3NK0 X;  2X8C A;  1BWC A;  1PXB A;  2YG4 A;  3SZF A;  3SY4 A;  1IUW A;  2OLN A;  4DNA A;  3SFE A;  3K30 A;  2C65 A;  4B65 A;  4H2P A;  4C3Y A;  4J34 A;  2JBV A;  2GR2 A;  2AQJ A;  4XWR A;  2BCP A;  2WHD A;  1E6E A;  1GOS A;  5LV9 A;  1KNR A;  2CFY A;  4BJY A;  4BUR A;  4U8M A;  4USR A;  2QA1 A;  4MJW A;  2XVJ A;  1ZP0 A;  2WS3 A;  4H4S A;  3NRN A;  4X9N A;  4NWZ A;  3UKH A;  3NYC A;  3II4 A;  4K2X A;  4U2S A;  5U1O A;  3WE0 A;  4AOS A;  4XXG A;  3RED A;  1AOG A;  1F8W A;  4PAA A;  4YSY A;  2E4G A;  3LOV A;  4BJZ A;  1GND A;  5JCN A;  1BKW A;  3NNE A;  5JCL A;  3DK8 A;  1H6V A;  2Y6Q A;  4YTM A;  4GCM A;  1N4U A;  2BK5 A;  3ZDN A;  3KKJ A;  1GXF A;  1TDK A;  1D7L A;  2XVE A;  5TR3 A;  3SGL A;  5BUL A;  4NZH A;  3ALM A;  3AE6 A;  1O94 A;  4U8L A;  3P9U A;  2A8X A;  3LJP A;  2E5V A;  4J56 A;  3EAN A;  2RGJ A;  4CNJ A;  1JRZ A;  2YVJ A;  4H2R A;  2FJB A;  4Z2R A;  1LQT A;  3L1R A;  1GPE A;  3H4K A;  2JKC A;  2WPE A;  4X9M A;  1H82 A;  5CKU A;  3P4P A;  4CY6 A;  2ZBW A;  3CIR A;  4A9W A;  3C4A A;  3GRS A;  1IUV A;  1TDO A;  2WQY A;  1H7W A;  5FMH A;  4G73 A;  4TLZ A;  2VVM A;  3VQR A;  2BRA A;  4E0V A;  3NK1 X;  4OPD A;  3RP6 A;  2BRY A;  3AWI A;  4H4P A;  3T14 A;  3NYF A;  5IPY A;  1JOA A;  3UKK A;  3UP4 A;  1MXT A;  1E1N A;  1NHQ A;  3KA7 A;  4H4Y A;  1XHC A;  4XWZ A;  2EQ6 A;  1IUS A;  5EBK A;  5U25 A;  3NN6 X;  2C4C A;  3DJD A;  3COX A;  4JNQ A;  5KNL A;  1BZL A;  1GSN A;  4B64 A;  4H4T A;  1LTX R;  4OVI A;  2W0H A;  1EL9 A;  1ZOY A;  3ITJ A;  2WOI A;  1LV0 A;  2TPR A;  2B7S A;  4LA1 A;  3AE5 A;  2WBA A;  3AE1 A;  4H4Z A;  2XLP A;  3L8K A;  5DBJ A;  2A87 A;  4LII A;  4G74 A;  1OJC A;  4KX6 A;  2YAU A;  1N4V A;  1YQ4 A;  1JU2 A;  3ICR A;  3T2Z A;  4GDE A;  3UP5 A;  3QFA A;  4BK3 A;  2BA9 A;  1JRX A;  3I3L A;  4GRT A;  1UKV G;  2QAE A;  3IF9 A;  2CUL A;  2R0C A;  4UDR A;  2I0Z A;  2BK3 A;  2C75 A;  3FPZ A;  4APN A;  3UOZ A;  2OAM A;  4CRT A;  2R4J A;  1GRA A;  1MO9 A;  4OPI A;  3RHA A;  1F8S A;  3ALL A;  3KD9 A;  1ZKQ A;  2BS2 A;  4H2Q A;  4K8D A;  1B4V A;  4U8K A;  3KU9 A;  4AT0 A;  3NLC A;  5FS6 A;  2RGO A;  4EQX A;  4H4U A;  3DGH A;  2VVL A;  4II3 A;  1OJT A;  3GDN A;  3K7Q X;  1ZMC A;  3G5Q A;  3CGC A;  4Z43 A;  2EQ8 A;  3PVC A;  3H8L A;  2WP6 A;  2Z5X A;  4EQR A;  1KFY A;  4I58 A;  4JY2 A;  2GR3 A;  1H81 A;  1E7P A;  3AD7 B;  3HYX A;  2C72 A;  1YY5 A;  1GRF A;  3BI5 A;  1JEH A;  3AB1 A;  3CND A;  4ICY A;  2IVE A;  3AE3 A;  4UDQ A;  3CMM A;  4AOX A;  3NG7 X;  1PXA A;  4DSG A;  4Z2U A;  3V3O A;  1H86 A;  3V3N A;  5KMS A;  2WPC A;  1S3E A;  4GF7 A;  3UTH A;  4A6N B;  2V3B A;  3BNU A;  3DJJ A;  3F8P A;  1O95 A;  3AEF A;  5CQF A;  3ZYX A;  5BVA A;  1BF3 A;  3UTF A;  4LU6 A;  5KOW A;  4Y4N A;  3NHO X;  4FDC B;  1N4W A;  1PBF A;  1S2Q A;  3BHK A;  3EF6 A;  3PO7 A;  3DA1 A;  3CNS A;  4H2N A;  4JN9 A;  5GSN A;  3GD4 A;  1PHH A;  1RSG A;  1YQ3 A;  2V61 A;  2WET A;  2XFO A;  1FEA A;  3AE9 A;  3DK9 A;  3LB8 A;  4A5L A;  1PBE A;  2ZZ0 A;  4EMI A;  2WDR A;  4RG3 A;  1TDE A;  2XYO A;  1D4C A;  1PJ7 A;  2WOV A;  2GAG B;  2JB3 A;  4C3X A;  3GDP A;  1Z6L A;  3O0H A;  4RSL A;  5IQ1 A;  1BGJ A;  3T31 A;  1H83 A;  2C73 A;  2C3C A;  2WPF A;  2BK4 A;  3QJ4 A;  4H4W A;  4IVO B;  4X4J A;  2H88 A;  1HYU A;  2GMJ A;  1B5Q A;  2YM1 A;  4FK1 A;  3UKF A;  3GWF A;  5HXI A;  1E1K A;  2H89 A;  2A89 A;  2JK6 A;  4YWO A;  4EQW A;  4USQ A;  1DOD A;  3CGD A;  4Y4M A;  2WP9 A;  3RP7 A;  5KMP A;  4N9X A;  1CJ2 A;  2WU2 A;  4UDP A;  3UKA A;  3AE2 A;  4CCQ A;  2XLU A;  1NHP A;  1PBC A;  4K7Z A;  5KOX A;  2Q0K A;  2NPX A;  5JCI A;  1CF3 A;  1FEB A;  4OPG A;  3HYV A;  4G6H A;  4Z44 A;  5IQ4 A;  1PBD A;  4NTC A;  3B3R A; 
#chains in the Genus database with same CATH homology
 4AT2 A;  2HQM A;  2X8G A;  5FS7 A;  3JSK A;  4TM3 A;  4DSH A;  1D5T A;  1GES A;  3LXD A;  4ZCD A;  5FS8 A;  1GRT A;  3FIM B;  4AP1 A;  3AEE A;  2C67 A;  2ZZB A;  4NEV A;  2XVI A;  4GUV A;  3NGC X;  3URH A;  4NNJ A;  2YR4 A;  1FOH A;  2F5Z A;  4YSZ A;  2XFP A;  4D03 A;  1VRQ B;  2ARD A;  3IWA A;  3B6D A;  3BNM A;  3F8R A;  4YTN A;  3UOV A;  1XDI A;  5KXJ A;  2IID A;  3D1C A;  4YKG A;  5C2T A;  3H8I A;  2C70 A;  1K4Q A;  1GRE A;  2Q0L A;  3GYJ A;  3QSS A;  5KMR A;  2FJA A;  4D04 A;  1TRB A;  3DJG X;  3RNM A;  3P4S A;  2YWL A;  1OJD A;  1DOE A;  4WX1 A;  1IUX A;  4B69 A;  4CNK A;  3IHG A;  4ZN0 A;  2APG A;  4M52 A;  1DXL A;  3T2Y A;  2C7G A;  1EL7 A;  3CGB A;  2FBW A;  1E1M A;  2RAB A;  1GTE A;  3FBS A;  1VQW A;  1NG3 A;  3F8D A;  1EL8 A;  2XDO A;  4TLX A;  3LZX A;  3P1W A;  1ZOV A;  4PAB A;  1W4X A;  2B9X A;  3AED A;  4JY3 A;  1YKJ A;  2GH5 A;  3ICT A;  1TYT A;  2XCG A;  1REO A;  1JRY A;  1VG0 A;  3CNJ A;  4ZCC A;  3VRA A;  1KSS A;  4ADW A;  2VVL G;  3C4N A;  3ADA B;  5L46 A;  2V6O A;  5KVH A;  4K22 A;  1LPF A;  4H4Q A;  1ZX9 A;  3AE8 A;  1VG9 A;  1V59 A;  3DME A;  1O5W A;  3QSM A;  3SZC A;  1CC6 A;  2YVG A;  2YM2 A;  4YT0 A;  1K0L A;  2R45 A;  1FL2 A;  3Q6J A;  3LAD A;  2YR5 A;  1ZY8 A;  2YLS A;  3SZ0 A;  1TDN A;  5JCK A;  2JAE A;  2BAC A;  3UOX A;  2XFU A;  5BRT A;  1B37 A;  1GRB A;  2BAB A;  3M12 A;  4A7A A;  2JB2 A;  4TM0 A;  3SQP A;  3QFB A;  2YLZ A;  1Y56 B;  4EMW A;  4ECH A;  5BUK A;  4WCT A;  3Q9T A;  2AR8 A;  3FMW A;  2EQ9 A;  4TM4 A;  3UTE A;  1IJH A;  1GRG A;  2PYX A;  5J60 A;  2GV8 A;  3ATR A;  3G5S A;  4OPC A;  3UKP A;  3GSI A;  4TM1 A;  3GMC A;  4H7U A;  3NTA A;  1NPX A;  4C74 A;  4Z25 A;  3SFD A;  1XAN A;  3NN0 X;  1ZDL A;  4CY8 A;  3VR9 A;  3NT6 A;  2YLT A;  3KPF A;  2X50 A;  2C64 A;  3P4R A;  3AXB A;  1NEK A;  4EQS A;  4BV6 A;  1LQU A;  2XVH A;  4J57 A;  5U63 A;  3SYI A;  1CJ3 A;  2J3N A;  5KWF A;  2GMH A;  3GWD A;  2GB0 A;  5HYM A;  3GRT A;  4NTD A;  3BI2 A;  5HHF A;  4Z2T A;  1F6M A;  2V5Z A;  3HYW A;  1NEN A;  1E1L A;  4B68 A;  2Y6R A;  1MOK A;  1PJ6 A;  3GD3 A;  2GEW A;  3AEB A;  4J31 A;  3CPI G;  2WDQ A;  2YLW A;  2CDU A;  2XLR A;  3CN8 A;  2X8H A;  3ALJ A;  4BK1 A;  2UZZ A;  3AYI A;  3AEA A;  4A65 A;  1K0J A;  2GQW A;  2R0P A;  2BCG G;  2XVF A;  2YG6 A;  4YSX A;  1NHS A;  3EPT A;  2BXR A;  3DK4 A;  3K7T A;  4JDR A;  4K5S A;  3AYL A;  1CC2 A;  2IVD A;  2BXS A;  2CVJ A;  1SEZ A;  3QVR A;  4G6G A;  4YSH A;  4Z24 A;  1NHR A;  4O5Q A;  3M13 A;  1CHU A;  3M0O A;  4B1B A;  1CBO A;  4JQ9 A;  2QA2 A;  3K7M X;  1P2E A;  3ATQ A;  4U8N A;  2XLS A;  2XLT A;  1EL5 A;  3G5R A;  1NDA A;  2VQ7 A;  1PS9 A;  1XPQ A;  1H7X A;  1NAA A;  3V76 A;  1K0I A;  1CL0 A;  3NYE A;  4U8P A;  2C76 A;  2YG7 A;  1F8R A;  4GAP A;  4KPR A;  3FG2 P;  2NVK X;  3S61 A;  4YTP A;  1D4E A;  1PBB A;  1Y0P A;  3DJE A;  3NTD A;  2GR0 A;  1LVL A;  2X3N A;  2R9Z A;  2YLR A;  2WDV A;  3BHF A;  1JNR A;  2Q7V A;  3IC9 A;  1QLB A;  4P9S A;  5KVI A;  2Z5Y A;  4IV9 A;  3S5W A;  1QO8 A;  2R0G A;  4OPL A;  3GYI A;  2GQF A;  3T2K A;  3IHM A;  1KF6 A;  2WU5 A;  3AE4 A;  5M0Z A;  2GRT A;  1X31 B;  1IUU A;  2BYB A;  1E39 A;  2YG5 A;  3D8X A;  3T0K A;  1B8S A;  1CJ4 A;  3NIX A;  1BGN A;  2OAL A;  1GRH A;  4RG4 A;  4U8O A;  1GT8 A;  1RP0 A;  2QCU A;  1Q1W A;  4UP3 A;  2GF3 A;  4H50 A;  1F3P A;  2C3D A;  3CNP A;  3SZW A;  2AAQ A;  1EBD A;  1M64 A;  2FJD A;  4YKF A;  4GAV A;  1DJQ A;  1ZMD A;  2OA1 A;  4G9K A;  3UCL A;  5M10 A;  4U2L A;  3OZ2 A;  2X99 A;  5J7X A;  4Y4L A;  4Z26 A;  4YXD A;  1ONF A;  4H4V A;  5ER0 A;  4JNA A;  1D7Y A;  4FX9 A;  2B9W A;  2XFQ A;  5KRQ A;  2WES A;  3AYJ A;  3ABV A;  3AEC A;  4H4R A;  2GVC A;  3VRB A;  4EIP A;  2TMD A;  4CBQ A;  3DH9 A;  2WOW A;  2V3A A;  1CC4 A;  3CPJ G;  1LJ1 A;  4B63 A;  3UKL A;  1GTH A;  3DGZ A;  1S2Y A;  3NK2 X;  4U8I A;  4B66 A;  1OJA A;  3AE7 A;  4FK1 C;  4HB9 A;  4NEW A;  1NG4 A;  3CGE A;  2YLX A;  2ACZ A;  2FJE A;  3P4Q A;  4NTE A;  2VRL A;  2VOU A;  4OCG A;  2GAH B;  2YQU A;  2EQ7 A;  2DKH A;  3CNT A;  1KDG A;  1L9E A;  4O5U A;  4REK A;  2PHH A;  2R4E A;  3ICS A;  2XFN A;  4AP3 A;  2GR1 A;  1H84 A;  1GET A;  2R46 A;  4OPU A;  4B67 A;  1N1P A;  1DNC A;  1PXC A;  2VQB A;  4K5R A;  3VR8 A;  2Q6U A;  5FS9 A;  5KMQ A;  4A79 A;  1D4D A;  2YVF A;  4EM4 A;  4C77 A;  4IA5 A;  1VDC A;  1OJ9 A;  2YR6 A;  4U2T A;  3VRD B;  3EAO A;  3UTG A;  1GEU A;  4J36 A;  3E1T A;  4BK2 A;  3AD9 B;  1Y56 A;  3HZL A;  1KNP A;  1CJC A;  4GR1 A;  1FCD A;  3GMB A;  4H4X A;  5EB5 A;  1GAL A;  3KPK A;  1S3B A;  3SXI A;  1P2H A;  3SX6 A;  2E1M A;  1QJD A;  3AD8 B;  1ZK7 A;  3T37 A;  2V60 A;  4U8J A;  1DJN A;  4EM3 A;  1Q9I A;  2O9Z A;  1L9D A;  1L0V A;  4I59 A;  2BC1 A;  2OLO A;  3GYX A;  2BS4 A;  4J2W A;  4GDP A;  4J33 A;  2VZ2 A;  2BS3 A;  3PS9 A;  2YG3 A;  2WEU A;  3QVP A;  2DKI A;  1COY A;  1YQZ A;  4OPT A;  1PN0 A;  1TYP A;  3UKQ A;  3BI4 A;  4II2 A;  1KSU A;  2B9Y A;  3CTY A;  4C5O A;  1DOB A;  4EIQ A;  3AEG A;  5C3J A;  1GER A;  1JNZ A;  1PDH A;  2WP5 A;  4IVM B;  2BC0 A;  1IUT A;  3UOY A;  1FEC A;  4IA6 A;  3QSE A;  5HY5 A;  3ISH A;  5JCM A;  3C96 A;  2RGH A;  3RP8 A;  3LZW A;  3NKS A;  5GRT A;  3R9U A;  5EB4 A;  3SM8 A;  1TDF A;  3CPH G;  1M6I A;  3KLJ A;  3KVE A;  2B7R A;  1DOC A;  4HA6 A;  4CCR A;  5EOW A;  2ZZC A;  3I6D A;  3OC4 A;  1RYI A;  2VRM A;  4DGK A;  4EMJ A;  2JB1 A;  4A6N A;  3NH3 X;  1ELI A;  1GV4 A;  1L9C A;  1Q1R A;  2B76 A;  2C66 A;  4A99 A;  1PJ5 A;  3NK0 X;  2X8C A;  1BWC A;  1PXB A;  2YG4 A;  3SZF A;  3SY4 A;  1IUW A;  2OLN A;  4DNA A;  3SFE A;  3K30 A;  2C65 A;  4B65 A;  4H2P A;  4C3Y A;  4J34 A;  2JBV A;  2GR2 A;  2AQJ A;  4XWR A;  2BCP A;  2WHD A;  1E6E A;  1GOS A;  5LV9 A;  1KNR A;  2CFY A;  4BJY A;  4BUR A;  4U8M A;  4USR A;  2QA1 A;  4MJW A;  2XVJ A;  1ZP0 A;  2WS3 A;  4H4S A;  3NRN A;  4X9N A;  4NWZ A;  3UKH A;  3NYC A;  3II4 A;  4K2X A;  4U2S A;  5U1O A;  3WE0 A;  4AOS A;  4XXG A;  3RED A;  1AOG A;  1F8W A;  4PAA A;  4YSY A;  2E4G A;  3LOV A;  4BJZ A;  1GND A;  5JCN A;  1BKW A;  3NNE A;  5JCL A;  3DK8 A;  1H6V A;  2Y6Q A;  4YTM A;  4GCM A;  1N4U A;  2BK5 A;  3ZDN A;  3KKJ A;  1GXF A;  1TDK A;  1D7L A;  2XVE A;  5TR3 A;  3SGL A;  5BUL A;  4NZH A;  3ALM A;  3AE6 A;  1O94 A;  4U8L A;  3P9U A;  2A8X A;  3LJP A;  2E5V A;  4J56 A;  3EAN A;  2RGJ A;  4CNJ A;  1JRZ A;  2YVJ A;  4H2R A;  2FJB A;  4Z2R A;  1LQT A;  3L1R A;  1GPE A;  3H4K A;  2JKC A;  2WPE A;  4X9M A;  1H82 A;  5CKU A;  3P4P A;  4CY6 A;  2ZBW A;  3CIR A;  4A9W A;  3C4A A;  3GRS A;  1IUV A;  1TDO A;  2WQY A;  1H7W A;  5FMH A;  4G73 A;  4TLZ A;  2VVM A;  3VQR A;  2BRA A;  4E0V A;  3NK1 X;  4OPD A;  3RP6 A;  2BRY A;  3AWI A;  4H4P A;  3T14 A;  3NYF A;  5IPY A;  1JOA A;  3UKK A;  3UP4 A;  1MXT A;  1E1N A;  1NHQ A;  3KA7 A;  4H4Y A;  1XHC A;  4XWZ A;  2EQ6 A;  1IUS A;  5EBK A;  5U25 A;  3NN6 X;  2C4C A;  3DJD A;  3COX A;  4JNQ A;  5KNL A;  1BZL A;  1GSN A;  4B64 A;  4H4T A;  1LTX R;  4OVI A;  2W0H A;  1EL9 A;  1ZOY A;  3ITJ A;  2WOI A;  1LV0 A;  2TPR A;  2B7S A;  4LA1 A;  3AE5 A;  2WBA A;  3AE1 A;  4H4Z A;  2XLP A;  3L8K A;  5DBJ A;  2A87 A;  4LII A;  4G74 A;  1OJC A;  4KX6 A;  2YAU A;  1N4V A;  1YQ4 A;  1JU2 A;  3ICR A;  3T2Z A;  4GDE A;  3UP5 A;  3QFA A;  4BK3 A;  2BA9 A;  1JRX A;  3I3L A;  4GRT A;  1UKV G;  2QAE A;  3IF9 A;  2CUL A;  2R0C A;  4UDR A;  2I0Z A;  2BK3 A;  2C75 A;  3FPZ A;  4APN A;  3UOZ A;  2OAM A;  4CRT A;  2R4J A;  1GRA A;  1MO9 A;  4OPI A;  3RHA A;  1F8S A;  3ALL A;  3KD9 A;  1ZKQ A;  2BS2 A;  4H2Q A;  4K8D A;  1B4V A;  4U8K A;  3KU9 A;  4AT0 A;  3NLC A;  5FS6 A;  2RGO A;  4EQX A;  4H4U A;  3DGH A;  2VVL A;  4II3 A;  1OJT A;  3GDN A;  3K7Q X;  1ZMC A;  3G5Q A;  3CGC A;  4Z43 A;  2EQ8 A;  3PVC A;  3H8L A;  2WP6 A;  2Z5X A;  4EQR A;  1KFY A;  4I58 A;  4JY2 A;  2GR3 A;  1H81 A;  1E7P A;  3AD7 B;  3HYX A;  2C72 A;  1YY5 A;  1GRF A;  3BI5 A;  1JEH A;  3AB1 A;  3CND A;  4ICY A;  2IVE A;  3AE3 A;  4UDQ A;  3CMM A;  4AOX A;  3NG7 X;  1PXA A;  4DSG A;  4Z2U A;  3V3O A;  1H86 A;  3V3N A;  5KMS A;  2WPC A;  1S3E A;  4GF7 A;  3UTH A;  4A6N B;  2V3B A;  3BNU A;  3DJJ A;  3F8P A;  1O95 A;  3AEF A;  5CQF A;  3ZYX A;  5BVA A;  1BF3 A;  3UTF A;  4LU6 A;  5KOW A;  4Y4N A;  3NHO X;  4FDC B;  1N4W A;  1PBF A;  1S2Q A;  3BHK A;  3EF6 A;  3PO7 A;  3DA1 A;  3CNS A;  4H2N A;  4JN9 A;  5GSN A;  3GD4 A;  1PHH A;  1RSG A;  1YQ3 A;  2V61 A;  2WET A;  2XFO A;  1FEA A;  3AE9 A;  3DK9 A;  3LB8 A;  4A5L A;  1PBE A;  2ZZ0 A;  4EMI A;  2WDR A;  4RG3 A;  1TDE A;  2XYO A;  1D4C A;  1PJ7 A;  2WOV A;  2GAG B;  2JB3 A;  4C3X A;  3GDP A;  1Z6L A;  3O0H A;  4RSL A;  5IQ1 A;  1BGJ A;  3T31 A;  1H83 A;  2C73 A;  2C3C A;  2WPF A;  2BK4 A;  3QJ4 A;  4H4W A;  4IVO B;  4X4J A;  2H88 A;  1HYU A;  2GMJ A;  1B5Q A;  2YM1 A;  4FK1 A;  3UKF A;  3GWF A;  5HXI A;  1E1K A;  2H89 A;  2A89 A;  2JK6 A;  4YWO A;  4EQW A;  4USQ A;  1DOD A;  3CGD A;  4Y4M A;  2WP9 A;  3RP7 A;  5KMP A;  4N9X A;  1CJ2 A;  2WU2 A;  4UDP A;  3UKA A;  3AE2 A;  4CCQ A;  2XLU A;  1NHP A;  1PBC A;  4K7Z A;  5KOX A;  2Q0K A;  2NPX A;  5JCI A;  1CF3 A;  1FEB A;  4OPG A;  3HYV A;  4G6H A;  4Z44 A;  5IQ4 A;  1PBD A;  4NTC A;  3B3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...