1TRBA

Convergent evolution of similar function in two structurally divergent enzymes
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Convergent evolution of similar function in two structurally divergent enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
molecule keywords THIOREDOXIN REDUCTASE
total genus 93
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1991-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA02
2GR2A 3K7TA 2BA9A 2VOUA 5JCMA 2VQBA 4KPRA 2F5ZA 2GQWA 5LV9A 1LQTA 3NYEA 3F8RA 4A5LA 1H7XA 1CBOA 4EM3A 1D4EA 1GOSA 4M52A 3UP5A 1RP0A 4EQRA 1CC4A 1YQ4A 2JKCA 2YVFA 1DJQA 3AEAA 1NHSA 4H50A 4OPCA 2FBWA 4AOXA 4AT0A 1F8RA 5FMHA 4YTMA 4U2SA 4OPGA 1Q1WA 1IUVA 4EMJA 1IUTA 1FCDA 4BK3A 1DXLA 1H82A 1YY5A 4C3XA 2GF3A 1KSSA 2YR5A 1H83A 2BS3A 2JB2A 1QJDA 1OJ9A 3BI2A 4LA1A 1S3EA 2WP6A 2QAEA 1DNCA 3M0OA 2R0CA 1PXAA 2WS3A 2YVJA 2XYOA 3EF6A 3K7MX 2C7GA 4IVOB 1XDIA 4XXGA 2B7RA 2IVDA 1CHUA 4JY3A 3V3NA 3H8LA 3LOVA 4TM4A 1NHRA 3WE0A 3QSSA 4I58A 4J34A 4X9MA 3DGZA 2Z5YA 1GNDA 3FG2P 3JSKA 4H4ZA 4UDRA 5EOWA 3REDA 5JCLA 1F8SA 2JK6A 3PVCA 3AYIA 5KXJA 2GAGB 1LVLA 1X31B 4DNAA 5L46A 2E5VA 4PAAA 4IA5A 3V3OA 1JRZA 3DJEA 5BVAA 1LJ1A 2R0PA 3UKKA 1FECA 2B9YA 2R4JA 4O5QA 2WPCA 2EQ9A 5HXIA 1BZLA 1JNZA 1QLBA 2Y6RA 2HQMA 4OPIA 3B6DA 1E7PA 3GDPA 3CGCA 4CCRA 1GTHA 2V5ZA 2TMDA 2YLXA 1GPEA 1XANA 2OLOA 3CNTA 4BJYA 3Q6JA 1NAAA 3NYFA 5IQ1A 4NTDA 4YXDA 1KSUA 2BK4A 2YAUA 2XLRA 4NTEA 4AP3A 4EM4A 4Z2RA 4B69A 3V76A 2RGJA 2CDUA 4WCTA 1XPQA 4H4TA 2E4GA 4ECHA 1H84A 4H4XA 3GD4A 3GDNA 3AE9A 2VQ7A 3AE1A 2GH5A 4XWRA 1N4UA 4C5OA 2WEUA 4U8IA 5TR3A 4REKA 4B63A 4PABA 2ZZCA 1H81A 1PBEA 3I6DA 2C67A 3L1RA 2YLRA 3IHMA 3CNJA 1ZX9A 3DJDA 1GV4A 5U1OA 4A99A 4K8DA 5KOWA 1NG3A 1MXTA 4H4VA 1O95A 2AAQA 2XDOA 5GRTA 3AEDA 4ADWA 1H7WA 3IHGA 1NG4A 1NHQA 4UP3A 1D7YA 2B7SA 4BJZA 3G5RA 4CCQA 4H4WA 5M0ZA 3UKLA 3CNPA 1DOBA 1S2YA 1TDOA 3SFEA 3IC9A 1PXBA 3NN6X 2JBVA 2CULA 4U8LA 2X8CA 4FK1A 4USQA 1S2QA 3CPIG 1TDEA 1YQ3A 4A6NB 1IUWA 4YSZA 3PO7A 5JCNA 3B3RA 4JY2A 2YLTA 3NNEA 1CC2A 4H4PA 3S5WA 2VVLG 3NIXA 4C77A 1Z6LA 1PXCA 1H86A 4K7ZA 2GR0A 1JU2A 4A65A 4A6NA 1NPXA 1FEBA 4U8KA 3NT6A 2GQFA 1N1PA 4FDCB 2YM1A 4JNAA 1KF6A 4RSLA 2NVKX 4Z2TA 3CN8A 3FBSA 4J56A 1B8SA 3CPJG 3LB8A 1GRTA 2RGOA 1ZMCA 3FIMB 3ICTA 2BK3A 4XWZA 2XLSA 3KVEA 3K7QX 3P1WA 4GDEA 4K5SA 5BUKA 4B64A 1DJNA 4YKGA 4IVMB 1Y56B 1MO9A 3NHOX 5EBKA 5ER0A 2QA2A 3GWDA 2VVLA 3K30A 1CC6A 3KLJA 3NN0X 3QVPA 3SM8A 1Q1RA 4WX1A 4D04A 3II4A 1ELIA 2PHHA 1GRBA 2YG4A 4U8MA 3UP4A 3UOXA 4O5UA 4BV6A 5FS7A 2XCGA 4GRTA 3DK4A 3UTGA 3DJGX 2CFYA 2Q7VA 4YWOA 2J3NA 1TDFA 2XVJA 4OVIA 4Y4MA 1CJ4A 1L9EA 1GXFA 2GVCA 2WOWA 4J33A 3R9UA 3SFDA 1GRFA 3UTFA 4CY8A 3M13A 1YQZA 1KNRA 2B9WA 3L8KA 4YKFA 2Q6UA 2WDVA 3GYIA 3NK2X 3CGBA 2AR8A 2O9ZA 3FMWA 1EL5A 2BYBA 2C75A 2YR6A 5BULA 1ZK7A 1NHPA 2QCUA 3GSIA 3BNMA 2WOVA 2WU5A 4TLXA 4UDPA 4EQSA 4Z43A 3VRAA 2I0ZA 1K4QA 2JB3A 1D7LA 1P2EA 3NLCA 5FS6A 2ZBWA 3UKQA 3DMEA 5J60A 4D03A 4EQXA 2WP5A 1HYUA 1RYIA 1E1KA 2DKIA 2OLNA 2R4EA 4GR1A 5KVHA 2WHDA 2TPRA 1DODA 5M10A 5KWFA 5HY5A 3BHFA 4Y4NA 4AP1A 2YG5A 1NDAA 3NRNA 3VR9A 1XHCA 2BCGG 1KDGA 5KOXA 3BI5A 1GREA 3DH9A 2V6OA 3E1TA 2V3AA 3EANA 2UZZA 5HHFA 1FL2A 3CGDA 1TDKA 2GAHB 1ZKQA 3ICRA 3LZWA 1BGNA 4H4UA 2QA1A 3C4NA 4J2WA 3RP8A 4CNKA 1D4CA 3AE8A 3AE2A 4J36A 2X8GA 3CTYA 1PJ5A 4B68A 1NENA 2Q0KA 3AE6A 1PBBA 1DOEA 3UKHA 3LXDA 3QJ4A 2GMHA 4BK2A 1L0VA 4NEWA 5IPYA 4CY6A 4OPDA 1JRYA 4U2TA 1E39A 1P2HA 3UOVA 1REOA 4X9NA 2BS4A 2VRLA 2WBAA 5IQ4A 3KD9A 3Q9TA 1PDHA 4E0VA 3GRTA 2GB0A 2WPFA 1CJCA 3LJPA 3P4PA 2YLWA 2GV8A 2H89A 3ITJA 1H6VA 3KU9A 4EIPA 3RP7A 1CJ3A 1GEUA 2XVIA 2C3CA 2V60A 3AXBA 2BABA 3BNUA 1L9CA 2EQ6A 1FEAA 4JNQA 3AE3A 4U8PA 4NTCA 1VDCA 4EMWA 2ZZBA 4YTNA 1ZP0A 4RG4A 1E1MA 3DK8A 2AQJA 3KPFA 3G5SA 1TDNA 2IIDA 3GYJA 2B76A 2NPXA 2E1MA 1LPFA 5DBJA 1Q9IA 3NKSA 3CIRA 3AB1A 5FS9A 3F8PA 4FK1C 4TM3A 1B37A 1O5WA 2V61A 1TYTA 1GSNA 1S3BA 1D4DA 4DSGA 1BGJA 3FPZA 2C76A 2XVFA 3AE5A 4H4SA 2XVEA 3URHA 2XLUA 1ONFA 3UOZA 2X3NA 3NK1X 4B67A 4LU6A 3D1CA 3AEFA 3QFBA 1F3PA 4OPTA 4ZCDA 2YR4A 4NEVA 4X4JA 3ATQA 2WOIA 2WP9A 3P9UA 1O94A 2YG3A 3O0HA 4LIIA 2YLSA 3RHAA 3RP6A 1K0IA 4DGKA 1TYPA 2R0GA 3ISHA 4CBQA 4MJWA 3UKFA 3ZYXA 2YLZA 2VZ2A 2BXRA 4EMIA 4IV9A 1BWCA 4H2PA 4H4QA 3UTHA 3AWIA 4H2RA 3GRSA 3VQRA 4CNJA 4JQ9A 1DOCA 3ABVA 4ZN0A 1GTEA 1F6MA 2RABA 3CNDA 5C2TA 4C74A 2WU2A 3NYCA 3UKAA 2BACA 3NGCX 3ALJA 2C3DA 1JNRA 3T37A 2YWLA 3DGHA 2WQYA 3OZ2A 1CF3A 1GETA 2R46A 4UDQA 2FJBA 1JRXA 2XLPA 4J31A 2A8XA 1PS9A 1GRHA 2GR3A 1OJCA 3UOYA 1EL9A 3C4AA 3GD3A 4B65A 3OC4A 1PN0A 1BKWA 2H88A 5JCKA 2X99A 3QFAA 2XFPA 1N4WA 1D5TA 1JEHA 3AE7A 2C65A 3I3LA 2C70A 1IUXA 5HYMA 1YKJA 2BS2A 2YG6A 5GSNA 1JOAA 2XFQA 4K22A 5FS8A 2WDRA 3ZDNA 3M12A 3C96A 2YVGA 3COXA 1M6IA 3GMCA 1E6EA 1LQUA 2DKHA 4GF7A 4YT0A 3ICSA 1UKVG 3AEBA 1ZOYA 1OJDA 4HA6A 2CVJA 4YSHA 4U8OA 1IUUA 3DA1A 1ZOVA 3G5QA 4Z2UA 2XFNA 4I59A 1RSGA 5CKUA 2PYXA 3VR8A 1PBFA 1VG9A 5EB5A 4U8NA 4EQWA 1ZDLA 1GESA 3NK0X 1ZY8A 1KNPA 2GEWA 2XVHA 4BURA 4GUVA 4DSHA 1QO8A 3AD9B 3CGEA 2GRTA 2RGHA 2IVEA 1CL0A 3QSMA 4TLZA 4TM1A 3SQPA 5BRTA 1SEZA 2BCPA 4JDRA 1COYA 4NZHA 1GERA 2YG7A 1OJAA 2ZZ0A 1V59A 4H2NA 4OPLA 3VRBA 3LADA 2XFUA 2JAEA 3ATRA 3NTDA 1Y56A 3S61A 3UCLA 1K0LA 1M64A 1KFYA 1B4VA 1OJTA 3HZLA 4H4RA 2X8HA 4Z44A 3AECA 3RNMA 4YTPA 3F8DA 2A87A 3BI4A 3H4KA 3IF9A 4USRA 4Z25A 2Z5XA 4B1BA 1PBDA 1K0JA 4EIQA 1VRQB 2X50A 3NH3X 1CJ2A 3IWAA 3AE4A 2WPEA 1EL7A 4N9XA 3ALMA 3DJJA 4K5RA 1MOKA 5U25A 4ICYA 3GWFA 3EAOA 2ARDA 2WESA 2R45A 3P4QA 4H7UA 4AOSA 3AD8B 1PJ7A 2FJEA 4CRTA 4Z26A 4U2LA 1GT8A 3GMBA 3CPHG 5KVIA 1LV0A 2V3BA 1EL8A 1AOGA 4OCGA 2A89A 3UTEA 1GALA 5J7XA 3P4RA 4Y4LA 1B5QA 2XFOA 2B9XA 4C3YA 4P9SA 4Z24A 2BC0A 2WETA 1FOHA 2OA1A 1Y0PA 4U8JA 1E1LA 2EQ8A 4H2QA 4JN9A 3DK9A 4YSYA 3KA7A 4KX6A 1PJ6A 3QVRA 2OAMA 3EPTA 2JB1A 1BF3A 3AEGA 4FX9A 4H4YA 4A79A 4AT2A 1L9DA 4TM0A 4B66A 2R9ZA 4ZCCA 2FJAA 5EB4A 3BHKA 2APGA 1LTXR 1VG0A 4BK1A 4YSXA 1F8WA 1N4VA 1NEKA 1IUSA 3NG7X 2BC1A 2YM2A 4K2XA 3CNSA 1EBDA 3H8IA 5CQFA 4IA6A 4OPUA 3NTAA 2Q0LA 1IJHA 4J57A 3AYLA 2W0HA 5U63A 3AYJA 2FJDA 3AD7B 3PS9A 5KRQA 2WDQA 1GRGA 2ACZA 3UKPA 2BK5A 3D8XA 2EQ7A 3LZXA 1VQWA 3AEEA 4HB9A 3ALLA 4GCMA 1TRBA 2VVMA 3KKJA 4APNA 4A9WA 2YQUA 4RG3A 1W4XA 3QSEA 2GR1A 2VRMA 3ADAB 1PBCA 2OALA 2XLTA 2C73A 2C66A 5C3JA 4GDPA 2Y6QA 1GRAA 2GMJA 4A7AA 5JCIA 3VRDB 1PHHA 2C64A 2BXSA 1E1NA 3SGLA 1ZMDA 2C72A 3P4SA
chains in the Genus database with same CATH superfamily
2GR2A 3K7TA 2BA9A 2VOUA 5JCMA 2VQBA 4KPRA 2F5ZA 2GQWA 5LV9A 1LQTA 3NYEA 3F8RA 4GAVA 4A5LA 1H7XA 1CBOA 4EM3A 1D4EA 1GOSA 4M52A 3UP5A 1RP0A 4EQRA 1CC4A 1YQ4A 2JKCA 2YVFA 1DJQA 3AEAA 1NHSA 4H50A 4OPCA 2FBWA 4AOXA 4AT0A 1F8RA 5FMHA 4YTMA 4U2SA 4OPGA 1Q1WA 1IUVA 4EMJA 1IUTA 1FCDA 4G6HA 4BK3A 1DXLA 1H82A 1YY5A 5KMQA 4C3XA 2GF3A 1KSSA 2YR5A 1H83A 2BS3A 2JB2A 1QJDA 1OJ9A 3BI2A 4LA1A 1S3EA 2WP6A 2QAEA 1DNCA 3M0OA 2R0CA 1PXAA 2WS3A 2YVJA 2XYOA 3EF6A 3K7MX 2C7GA 4IVOB 1XDIA 4XXGA 2B7RA 2IVDA 1CHUA 4JY3A 3V3NA 3H8LA 3LOVA 4NWZA 4TM4A 4II2A 1NHRA 3WE0A 3QSSA 4I58A 4J34A 4X9MA 3DGZA 2Z5YA 1GNDA 3FG2P 3JSKA 4H4ZA 4UDRA 5EOWA 3REDA 5JCLA 1F8SA 2JK6A 3PVCA 3AYIA 5KXJA 2GAGB 1LVLA 1X31B 4DNAA 5L46A 2E5VA 4PAAA 4IA5A 3V3OA 1JRZA 3DJEA 5BVAA 1LJ1A 2R0PA 3UKKA 1FECA 2B9YA 2R4JA 4O5QA 2WPCA 2EQ9A 5HXIA 1BZLA 1JNZA 1QLBA 2Y6RA 2HQMA 4OPIA 3SY4A 3B6DA 4G74A 1E7PA 3GDPA 3CGCA 4CCRA 1GTHA 2V5ZA 2TMDA 2YLXA 1GPEA 1XANA 2OLOA 3CNTA 4BJYA 3Q6JA 1NAAA 3NYFA 5IQ1A 4NTDA 4YXDA 1KSUA 2BK4A 2YAUA 2XLRA 4NTEA 4AP3A 4EM4A 4Z2RA 4B69A 3V76A 2RGJA 2CDUA 3HYWA 1XPQA 4H4TA 4WCTA 5KMPA 2E4GA 4ECHA 1H84A 4H4XA 3GD4A 3GDNA 3AE9A 2VQ7A 3AE1A 2GH5A 4XWRA 1N4UA 4C5OA 2WEUA 4U8IA 5TR3A 4REKA 4B63A 4PABA 2ZZCA 1H81A 1PBEA 3I6DA 2C67A 3L1RA 2YLRA 3IHMA 3CNJA 1ZX9A 3DJDA 1GV4A 5U1OA 4A99A 4K8DA 5KOWA 1NG3A 1MXTA 4H4VA 1O95A 2AAQA 2XDOA 5GRTA 3AEDA 4ADWA 1H7WA 3IHGA 1NG4A 1NHQA 4UP3A 1D7YA 2B7SA 4BJZA 3G5RA 4CCQA 4H4WA 5M0ZA 3UKLA 3CNPA 1DOBA 1S2YA 1TDOA 3SFEA 3IC9A 1PXBA 3NN6X 2JBVA 2CULA 4U8LA 2X8CA 4FK1A 4USQA 1S2QA 3CPIG 1TDEA 1YQ3A 3GYXA 1IUWA 4A6NB 4YSZA 3PO7A 5JCNA 3B3RA 4JY2A 2YLTA 3NNEA 1CC2A 4H4PA 3S5WA 2VVLG 3NIXA 4C77A 1Z6LA 1PXCA 1H86A 4K7ZA 2GR0A 1JU2A 4A65A 4A6NA 1NPXA 1FEBA 4U8KA 3NT6A 2GQFA 1N1PA 4FDCB 2YM1A 4JNAA 1KF6A 4RSLA 2NVKX 4Z2TA 5KNLA 3CN8A 3FBSA 4J56A 3T2YA 3SZ0A 1B8SA 3CPJG 3LB8A 1GRTA 2RGOA 1ZMCA 3FIMB 3ICTA 2BK3A 4XWZA 2XLSA 3KVEA 3K7QX 3P1WA 4GDEA 4K5SA 3SXIA 5BUKA 4B64A 1DJNA 4YKGA 4IVMB 1Y56B 1MO9A 3NHOX 4GAPA 5EBKA 5ER0A 2QA2A 3GWDA 2VVLA 3K30A 1CC6A 3KLJA 3NN0X 3QVPA 3SM8A 1Q1RA 4WX1A 4D04A 3II4A 1ELIA 2PHHA 1GRBA 2YG4A 4U8MA 3UP4A 3UOXA 4O5UA 4BV6A 5FS7A 2XCGA 4GRTA 3DK4A 3UTGA 3DJGX 2CFYA 2Q7VA 4YWOA 2J3NA 1TDFA 2XVJA 4OVIA 4Y4MA 1CJ4A 1L9EA 1GXFA 2GVCA 2WOWA 4J33A 3R9UA 3SFDA 1GRFA 3UTFA 4CY8A 3M13A 1YQZA 1KNRA 2B9WA 3L8KA 4YKFA 2Q6UA 2WDVA 3GYIA 3NK2X 3CGBA 2AR8A 2O9ZA 3FMWA 1EL5A 2BYBA 2C75A 2YR6A 5BULA 1ZK7A 1NHPA 2QCUA 3GSIA 3BNMA 2WOVA 2WU5A 2C4CA 4TLXA 4UDPA 3T0KA 3VRAA 4EQSA 4Z43A 2I0ZA 1K4QA 2JB3A 1D7LA 1P2EA 3NLCA 5FS6A 2ZBWA 3UKQA 3DMEA 5J60A 4D03A 4EQXA 2WP5A 1HYUA 1RYIA 3SYIA 1E1KA 2DKIA 2OLNA 2R4EA 4GR1A 5KVHA 2WHDA 2TPRA 3SZCA 1DODA 5M10A 3KPKA 5KWFA 5HY5A 3BHFA 4Y4NA 4AP1A 2YG5A 1NDAA 3NRNA 3VR9A 1XHCA 2BCGG 1KDGA 5KOXA 3BI5A 1GREA 3DH9A 2V6OA 3E1TA 2V3AA 3EANA 2UZZA 5HHFA 1FL2A 3CGDA 1TDKA 2GAHB 1ZKQA 3ICRA 3LZWA 1BGNA 4H4UA 2QA1A 3C4NA 5KMRA 4J2WA 3RP8A 4CNKA 1D4CA 3AE8A 3AE2A 4J36A 2BRYA 2X8GA 3CTYA 1PJ5A 4B68A 1NENA 2Q0KA 3AE6A 1PBBA 1DOEA 3UKHA 3LXDA 3QJ4A 2GMHA 4BK2A 1L0VA 4NEWA 5IPYA 4CY6A 4OPDA 1JRYA 4U2TA 1E39A 1P2HA 3UOVA 1REOA 4X9NA 2BS4A 2VRLA 2WBAA 5IQ4A 3KD9A 3Q9TA 1PDHA 4E0VA 3GRTA 2GB0A 2WPFA 1CJCA 3LJPA 3P4PA 2YLWA 2GV8A 2H89A 3T2KA 3ITJA 1H6VA 3KU9A 4EIPA 3SX6A 3RP7A 1CJ3A 1GEUA 2XVIA 2C3CA 2V60A 3AXBA 2BABA 3BNUA 1L9CA 2EQ6A 1FEAA 4JNQA 3AE3A 4U8PA 4NTCA 1VDCA 4EMWA 2ZZBA 4YTNA 1ZP0A 4RG4A 1E1MA 3DK8A 2AQJA 3KPFA 3G5SA 1TDNA 2IIDA 3GYJA 2B76A 2NPXA 2E1MA 1LPFA 5DBJA 1Q9IA 3NKSA 3CIRA 3AB1A 5FS9A 3F8PA 4FK1C 4TM3A 1B37A 1O5WA 2V61A 1TYTA 1GSNA 1S3BA 1D4DA 4G9KA 1BGJA 3FPZA 4DSGA 2C76A 2XVFA 3AE5A 4H4SA 2XVEA 3URHA 2XLUA 1ONFA 3UOZA 2X3NA 3NK1X 4B67A 4LU6A 3D1CA 3AEFA 3QFBA 1F3PA 4OPTA 4ZCDA 2YR4A 4NEVA 4X4JA 3ATQA 2WOIA 2WP9A 3P9UA 1O94A 2YG3A 3O0HA 4LIIA 2YLSA 3RHAA 3RP6A 1K0IA 4DGKA 1TYPA 2R0GA 3ISHA 4CBQA 4MJWA 3UKFA 3ZYXA 2YLZA 2VZ2A 2BXRA 4EMIA 4IV9A 1BWCA 4H2PA 4H4QA 3UTHA 3AWIA 4H2RA 3GRSA 3VQRA 4CNJA 4JQ9A 1DOCA 3ABVA 4ZN0A 1GTEA 1F6MA 2RABA 3CNDA 5C2TA 4C74A 2WU2A 3NYCA 3UKAA 2BACA 3NGCX 3ALJA 2C3DA 1JNRA 3T37A 2YWLA 3DGHA 2WQYA 3OZ2A 1CF3A 1GETA 2R46A 4UDQA 2FJBA 1JRXA 2XLPA 4J31A 2A8XA 1PS9A 1GRHA 2GR3A 1OJCA 3UOYA 1EL9A 3CMMA 3C4AA 3GD3A 4B65A 3OC4A 1PN0A 1BKWA 2H88A 5JCKA 2X99A 3QFAA 2XFPA 1N4WA 1D5TA 1JEHA 3AE7A 2C65A 3I3LA 2C70A 4NNJA 1IUXA 5HYMA 1YKJA 2BS2A 2YG6A 5GSNA 1JOAA 2XFQA 4K22A 5FS8A 2WDRA 3ZDNA 3M12A 3C96A 2YVGA 3COXA 1M6IA 3GMCA 1E6EA 1LQUA 2DKHA 4GF7A 4YT0A 3ICSA 1UKVG 3AEBA 1ZOYA 1OJDA 4HA6A 2CVJA 4YSHA 4U8OA 1IUUA 3DA1A 1ZOVA 3G5QA 4Z2UA 2XFNA 4I59A 1RSGA 5CKUA 2PYXA 3VR8A 1PBFA 1VG9A 5EB5A 4U8NA 4EQWA 1ZDLA 1GESA 3NK0X 1ZY8A 1KNPA 2GEWA 2XVHA 4BURA 4GUVA 4DSHA 1QO8A 3T2ZA 3AD9B 3CGEA 2GRTA 2RGHA 2IVEA 1CL0A 3QSMA 4TLZA 4TM1A 3SQPA 4II3A 1SEZA 5BRTA 2BCPA 4JDRA 1COYA 4NZHA 1GERA 2YG7A 1OJAA 2ZZ0A 1V59A 4H2NA 4OPLA 3VRBA 3LADA 2XFUA 2JAEA 3ATRA 3NTDA 1Y56A 3S61A 3UCLA 1K0LA 1M64A 1KFYA 1B4VA 1OJTA 3HZLA 4H4RA 2X8HA 4Z44A 3AECA 3RNMA 4YTPA 3F8DA 2A87A 3BI4A 3H4KA 3IF9A 4USRA 4Z25A 2Z5XA 4B1BA 1PBDA 3SZWA 1K0JA 4EIQA 1VRQB 2X50A 3NH3X 1CJ2A 3IWAA 3AE4A 2WPEA 1EL7A 4N9XA 3ALMA 3DJJA 4K5RA 1MOKA 5U25A 4ICYA 3GWFA 3EAOA 2ARDA 2WESA 2R45A 3P4QA 4H7UA 4AOSA 3AD8B 1PJ7A 2FJEA 4CRTA 4Z26A 4U2LA 1GT8A 3GMBA 3T14A 3CPHG 5KVIA 1LV0A 3HYVA 2V3BA 1EL8A 4G73A 1AOGA 4OCGA 2A89A 3UTEA 1GALA 5J7XA 3P4RA 4Y4LA 1B5QA 2XFOA 2B9XA 4C3YA 4P9SA 4Z24A 2BC0A 2BRAA 2WETA 3HYXA 1FOHA 2OA1A 1Y0PA 4U8JA 1E1LA 2EQ8A 4H2QA 4JN9A 3DK9A 4YSYA 3KA7A 4KX6A 1PJ6A 3QVRA 2OAMA 3T31A 3EPTA 2JB1A 1BF3A 3AEGA 4FX9A 4H4YA 4A79A 4AT2A 1L9DA 4TM0A 4B66A 2R9ZA 4ZCCA 2FJAA 5EB4A 3BHKA 2APGA 1LTXR 1VG0A 4BK1A 4YSXA 1F8WA 1N4VA 1NEKA 1IUSA 3NG7X 2BC1A 2YM2A 4K2XA 3CNSA 1EBDA 3H8IA 5CQFA 4IA6A 4OPUA 3NTAA 2Q0LA 1IJHA 4J57A 3AYLA 2W0HA 5U63A 3AYJA 2FJDA 3AD7B 3PS9A 5KRQA 2WDQA 1GRGA 3SZFA 4G6GA 2ACZA 3UKPA 2BK5A 3D8XA 2EQ7A 3LZXA 1VQWA 3AEEA 4HB9A 3ALLA 4GCMA 1TRBA 2VVMA 3KKJA 4APNA 4A9WA 2YQUA 4RG3A 1W4XA 3QSEA 2GR1A 2VRMA 3ADAB 1PBCA 2OALA 2XLTA 2C73A 2C66A 5C3JA 4GDPA 2Y6QA 1GRAA 2GMJA 4A7AA 5JCIA 3VRDB 1PHHA 2C64A 5KMSA 2BXSA 1E1NA 3SGLA 1ZMDA 2C72A 3P4SA
chains in the Genus database with same CATH topology
2GR2A 3K7TA 2BA9A 2VOUA 5JCMA 2VQBA 4KPRA 2F5ZA 2GQWA 5LV9A 1LQTA 3NYEA 3F8RA 4GAVA 4A5LA 1H7XA 1CBOA 4EM3A 1D4EA 1GOSA 4M52A 3UP5A 1RP0A 4EQRA 1CC4A 1YQ4A 2JKCA 2YVFA 1DJQA 3AEAA 1NHSA 4H50A 4OPCA 2FBWA 4AOXA 4AT0A 1F8RA 5FMHA 4YTMA 4U2SA 4OPGA 1Q1WA 1IUVA 4EMJA 1IUTA 1FCDA 4G6HA 4BK3A 1DXLA 1H82A 1YY5A 5KMQA 4C3XA 2GF3A 1KSSA 2YR5A 1H83A 2BS3A 2JB2A 1QJDA 1OJ9A 3BI2A 4LA1A 1S3EA 2WP6A 2QAEA 1DNCA 3M0OA 2R0CA 1PXAA 2WS3A 2YVJA 2XYOA 3EF6A 3K7MX 2C7GA 4IVOB 1XDIA 4XXGA 2B7RA 2IVDA 1CHUA 4JY3A 3V3NA 3H8LA 3LOVA 4NWZA 4TM4A 4II2A 1NHRA 3WE0A 3QSSA 4I58A 4J34A 4X9MA 3DGZA 2Z5YA 1GNDA 3FG2P 3JSKA 4H4ZA 4UDRA 5EOWA 3REDA 5JCLA 1F8SA 2JK6A 3PVCA 3AYIA 5KXJA 2GAGB 1LVLA 1X31B 4DNAA 5L46A 2E5VA 4PAAA 4IA5A 3V3OA 1JRZA 3DJEA 5BVAA 1LJ1A 2R0PA 3UKKA 1FECA 2B9YA 2R4JA 4O5QA 2WPCA 2EQ9A 5HXIA 1BZLA 1JNZA 1QLBA 2Y6RA 2HQMA 4OPIA 3SY4A 3B6DA 4G74A 1E7PA 3GDPA 3CGCA 4CCRA 1GTHA 2V5ZA 2TMDA 2YLXA 1GPEA 1XANA 2OLOA 3CNTA 4BJYA 3Q6JA 1NAAA 3NYFA 5IQ1A 4NTDA 4YXDA 1KSUA 2BK4A 2YAUA 2XLRA 4NTEA 4AP3A 4EM4A 4Z2RA 4B69A 3V76A 2RGJA 2CDUA 3HYWA 1XPQA 4H4TA 4WCTA 5KMPA 2E4GA 4ECHA 1H84A 4H4XA 3GD4A 3GDNA 3AE9A 2VQ7A 3AE1A 2GH5A 4XWRA 1N4UA 4C5OA 2WEUA 4U8IA 5TR3A 4REKA 4B63A 4PABA 2ZZCA 1H81A 1PBEA 3I6DA 2C67A 3L1RA 2YLRA 3IHMA 3CNJA 1ZX9A 3DJDA 1GV4A 5U1OA 4A99A 4K8DA 5KOWA 1NG3A 1MXTA 4H4VA 1O95A 2AAQA 2XDOA 5GRTA 3AEDA 4ADWA 1H7WA 3IHGA 1NG4A 1NHQA 4UP3A 1D7YA 2B7SA 4BJZA 3G5RA 4CCQA 4H4WA 5M0ZA 3UKLA 3CNPA 1DOBA 1S2YA 1TDOA 3SFEA 3IC9A 1PXBA 3NN6X 2JBVA 2CULA 4U8LA 2X8CA 4FK1A 4USQA 1S2QA 3CPIG 1TDEA 1YQ3A 3GYXA 1IUWA 4A6NB 4YSZA 3PO7A 5JCNA 3B3RA 4JY2A 2YLTA 3NNEA 1CC2A 4H4PA 3S5WA 2VVLG 3NIXA 4C77A 1Z6LA 1PXCA 1H86A 4K7ZA 2GR0A 1JU2A 4A65A 4A6NA 1NPXA 1FEBA 4U8KA 3NT6A 2GQFA 1N1PA 4FDCB 2YM1A 4JNAA 1KF6A 4RSLA 2NVKX 4Z2TA 5KNLA 3CN8A 3FBSA 4J56A 3T2YA 3SZ0A 1B8SA 3CPJG 3LB8A 1GRTA 2RGOA 1ZMCA 3FIMB 3ICTA 2BK3A 4XWZA 2XLSA 3KVEA 3K7QX 3P1WA 4GDEA 4K5SA 3SXIA 5BUKA 4B64A 1DJNA 4YKGA 4IVMB 1Y56B 1MO9A 3NHOX 4GAPA 5EBKA 5ER0A 2QA2A 3GWDA 2VVLA 3K30A 1CC6A 3KLJA 3NN0X 3QVPA 3SM8A 1Q1RA 4WX1A 4D04A 3II4A 1ELIA 2PHHA 1GRBA 2YG4A 4U8MA 3UP4A 3UOXA 4O5UA 4BV6A 5FS7A 2XCGA 4GRTA 3DK4A 3UTGA 3DJGX 2CFYA 2Q7VA 4YWOA 2J3NA 1TDFA 2XVJA 4OVIA 4Y4MA 1CJ4A 1L9EA 1GXFA 2GVCA 2WOWA 4J33A 3R9UA 3SFDA 1GRFA 3UTFA 4CY8A 3M13A 1YQZA 1KNRA 2B9WA 3L8KA 4YKFA 2Q6UA 2WDVA 3GYIA 3NK2X 3CGBA 2AR8A 2O9ZA 3FMWA 1EL5A 2BYBA 2C75A 2YR6A 5BULA 1ZK7A 1NHPA 2QCUA 3GSIA 3BNMA 2WOVA 2WU5A 2C4CA 4TLXA 4UDPA 3T0KA 3VRAA 4EQSA 4Z43A 2I0ZA 1K4QA 2JB3A 1D7LA 1P2EA 3NLCA 5FS6A 2ZBWA 3UKQA 3DMEA 5J60A 4D03A 4EQXA 2WP5A 1HYUA 1RYIA 3SYIA 1E1KA 2DKIA 2OLNA 2R4EA 4GR1A 5KVHA 2WHDA 2TPRA 3SZCA 1DODA 5M10A 3KPKA 5KWFA 5HY5A 3BHFA 4Y4NA 4AP1A 2YG5A 1NDAA 3NRNA 3VR9A 1XHCA 2BCGG 1KDGA 5KOXA 3BI5A 1GREA 3DH9A 2V6OA 3E1TA 2V3AA 3EANA 2UZZA 5HHFA 1FL2A 3CGDA 1TDKA 2GAHB 1ZKQA 3ICRA 3LZWA 1BGNA 4H4UA 2QA1A 3C4NA 5KMRA 4J2WA 3RP8A 4CNKA 1D4CA 3AE8A 3AE2A 4J36A 2BRYA 2X8GA 3CTYA 1PJ5A 4B68A 1NENA 2Q0KA 3AE6A 1PBBA 1DOEA 3UKHA 3LXDA 3QJ4A 2GMHA 4BK2A 1L0VA 4NEWA 5IPYA 4CY6A 4OPDA 1JRYA 4U2TA 1E39A 1P2HA 3UOVA 1REOA 4X9NA 2BS4A 2VRLA 2WBAA 5IQ4A 3KD9A 3Q9TA 1PDHA 4E0VA 3GRTA 2GB0A 2WPFA 1CJCA 3LJPA 3P4PA 2YLWA 2GV8A 2H89A 3T2KA 3ITJA 1H6VA 3KU9A 4EIPA 3SX6A 3RP7A 1CJ3A 1GEUA 2XVIA 2C3CA 2V60A 3AXBA 2BABA 3BNUA 1L9CA 2EQ6A 1FEAA 4JNQA 3AE3A 4U8PA 4NTCA 1VDCA 4EMWA 2ZZBA 4YTNA 1ZP0A 4RG4A 1E1MA 3DK8A 2AQJA 3KPFA 3G5SA 1TDNA 2IIDA 3GYJA 2B76A 2NPXA 2E1MA 1LPFA 5DBJA 1Q9IA 3NKSA 3CIRA 3AB1A 5FS9A 3F8PA 4FK1C 4TM3A 1B37A 1O5WA 2V61A 1TYTA 1GSNA 1S3BA 1D4DA 4G9KA 1BGJA 3FPZA 4DSGA 2C76A 2XVFA 3AE5A 4H4SA 2XVEA 3URHA 2XLUA 1ONFA 3UOZA 2X3NA 3NK1X 4B67A 4LU6A 3D1CA 3AEFA 3QFBA 1F3PA 4OPTA 4ZCDA 2YR4A 4NEVA 4X4JA 3ATQA 2WOIA 2WP9A 3P9UA 1O94A 2YG3A 3O0HA 4LIIA 2YLSA 3RHAA 3RP6A 1K0IA 4DGKA 1TYPA 2R0GA 3ISHA 4CBQA 4MJWA 3UKFA 3ZYXA 2YLZA 2VZ2A 2BXRA 4EMIA 4IV9A 1BWCA 4H2PA 4H4QA 3UTHA 3AWIA 4H2RA 3GRSA 3VQRA 4CNJA 4JQ9A 1DOCA 3ABVA 4ZN0A 1GTEA 1F6MA 2RABA 3CNDA 5C2TA 4C74A 2WU2A 3NYCA 3UKAA 2BACA 3NGCX 3ALJA 2C3DA 1JNRA 3T37A 2YWLA 3DGHA 2WQYA 3OZ2A 1CF3A 1GETA 2R46A 4UDQA 2FJBA 1JRXA 2XLPA 4J31A 2A8XA 1PS9A 1GRHA 2GR3A 1OJCA 3UOYA 1EL9A 3CMMA 3C4AA 3GD3A 4B65A 3OC4A 1PN0A 1BKWA 2H88A 5JCKA 2X99A 3QFAA 2XFPA 1N4WA 1D5TA 1JEHA 3AE7A 2C65A 3I3LA 2C70A 4NNJA 1IUXA 5HYMA 1YKJA 2BS2A 2YG6A 5GSNA 1JOAA 2XFQA 4K22A 5FS8A 2WDRA 3ZDNA 3M12A 3C96A 2YVGA 3COXA 1M6IA 3GMCA 1E6EA 1LQUA 2DKHA 4GF7A 4YT0A 3ICSA 1UKVG 3AEBA 1ZOYA 1OJDA 4HA6A 2CVJA 4YSHA 4U8OA 1IUUA 3DA1A 1ZOVA 3G5QA 4Z2UA 2XFNA 4I59A 1RSGA 5CKUA 2PYXA 3VR8A 1PBFA 1VG9A 5EB5A 4U8NA 4EQWA 1ZDLA 1GESA 3NK0X 1ZY8A 1KNPA 2GEWA 2XVHA 4BURA 4GUVA 4DSHA 1QO8A 3T2ZA 3AD9B 3CGEA 2GRTA 2RGHA 2IVEA 1CL0A 3QSMA 4TLZA 4TM1A 3SQPA 4II3A 1SEZA 5BRTA 2BCPA 4JDRA 1COYA 4NZHA 1GERA 2YG7A 1OJAA 2ZZ0A 1V59A 4H2NA 4OPLA 3VRBA 3LADA 2XFUA 2JAEA 3ATRA 3NTDA 1Y56A 3S61A 3UCLA 1K0LA 1M64A 1KFYA 1B4VA 1OJTA 3HZLA 4H4RA 2X8HA 4Z44A 3AECA 3RNMA 4YTPA 3F8DA 2A87A 3BI4A 3H4KA 3IF9A 4USRA 4Z25A 2Z5XA 4B1BA 1PBDA 3SZWA 1K0JA 4EIQA 1VRQB 2X50A 3NH3X 1CJ2A 3IWAA 3AE4A 2WPEA 1EL7A 4N9XA 3ALMA 3DJJA 4K5RA 1MOKA 5U25A 4ICYA 3GWFA 3EAOA 2ARDA 2WESA 2R45A 3P4QA 4H7UA 4AOSA 3AD8B 1PJ7A 2FJEA 4CRTA 4Z26A 4U2LA 1GT8A 3GMBA 3T14A 3CPHG 5KVIA 1LV0A 3HYVA 2V3BA 1EL8A 4G73A 1AOGA 4OCGA 2A89A 3UTEA 1GALA 5J7XA 3P4RA 4Y4LA 1B5QA 2XFOA 2B9XA 4C3YA 4P9SA 4Z24A 2BC0A 2BRAA 2WETA 3HYXA 1FOHA 2OA1A 1Y0PA 4U8JA 1E1LA 2EQ8A 4H2QA 4JN9A 3DK9A 4YSYA 3KA7A 4KX6A 1PJ6A 3QVRA 2OAMA 3T31A 3EPTA 2JB1A 1BF3A 3AEGA 4FX9A 4H4YA 4A79A 4AT2A 1L9DA 4TM0A 4B66A 2R9ZA 4ZCCA 2FJAA 5EB4A 3BHKA 2APGA 1LTXR 1VG0A 4BK1A 4YSXA 1F8WA 1N4VA 1NEKA 1IUSA 3NG7X 2BC1A 2YM2A 4K2XA 3CNSA 1EBDA 3H8IA 5CQFA 4IA6A 4OPUA 3NTAA 2Q0LA 1IJHA 4J57A 3AYLA 2W0HA 5U63A 3AYJA 2FJDA 3AD7B 3PS9A 5KRQA 2WDQA 1GRGA 3SZFA 4G6GA 2ACZA 3UKPA 2BK5A 3D8XA 2EQ7A 3LZXA 1VQWA 3AEEA 4HB9A 3ALLA 4GCMA 1TRBA 2VVMA 3KKJA 4APNA 4A9WA 2YQUA 4RG3A 1W4XA 3QSEA 2GR1A 2VRMA 3ADAB 1PBCA 2OALA 2XLTA 2C73A 2C66A 5C3JA 4GDPA 2Y6QA 1GRAA 2GMJA 4A7AA 5JCIA 3VRDB 1PHHA 2C64A 5KMSA 2BXSA 1E1NA 3SGLA 1ZMDA 2C72A 3P4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR2 A;  3K7T A;  2BA9 A;  2VOU A;  5JCM A;  2VQB A;  4KPR A;  2F5Z A;  2GQW A;  5LV9 A;  1LQT A;  3NYE A;  3F8R A;  4A5L A;  1H7X A;  1CBO A;  4EM3 A;  1D4E A;  1GOS A;  4M52 A;  3UP5 A;  1RP0 A;  4EQR A;  1CC4 A;  1YQ4 A;  2JKC A;  2YVF A;  1DJQ A;  3AEA A;  1NHS A;  4H50 A;  4OPC A;  2FBW A;  4AOX A;  4AT0 A;  1F8R A;  5FMH A;  4YTM A;  4U2S A;  4OPG A;  1Q1W A;  1IUV A;  4EMJ A;  1IUT A;  1FCD A;  4BK3 A;  1DXL A;  1H82 A;  1YY5 A;  4C3X A;  2GF3 A;  1KSS A;  2YR5 A;  1H83 A;  2BS3 A;  2JB2 A;  1QJD A;  1OJ9 A;  3BI2 A;  4LA1 A;  1S3E A;  2WP6 A;  2QAE A;  1DNC A;  3M0O A;  2R0C A;  1PXA A;  2WS3 A;  2YVJ A;  2XYO A;  3EF6 A;  3K7M X;  2C7G A;  4IVO B;  1XDI A;  4XXG A;  2B7R A;  2IVD A;  1CHU A;  4JY3 A;  3V3N A;  3H8L A;  3LOV A;  4TM4 A;  1NHR A;  3WE0 A;  3QSS A;  4I58 A;  4J34 A;  4X9M A;  3DGZ A;  2Z5Y A;  1GND A;  3FG2 P;  3JSK A;  4H4Z A;  4UDR A;  5EOW A;  3RED A;  5JCL A;  1F8S A;  2JK6 A;  3PVC A;  3AYI A;  5KXJ A;  2GAG B;  1LVL A;  1X31 B;  4DNA A;  5L46 A;  2E5V A;  4PAA A;  4IA5 A;  3V3O A;  1JRZ A;  3DJE A;  5BVA A;  1LJ1 A;  2R0P A;  3UKK A;  1FEC A;  2B9Y A;  2R4J A;  4O5Q A;  2WPC A;  2EQ9 A;  5HXI A;  1BZL A;  1JNZ A;  1QLB A;  2Y6R A;  2HQM A;  4OPI A;  3B6D A;  1E7P A;  3GDP A;  3CGC A;  4CCR A;  1GTH A;  2V5Z A;  2TMD A;  2YLX A;  1GPE A;  1XAN A;  2OLO A;  3CNT A;  4BJY A;  3Q6J A;  1NAA A;  3NYF A;  5IQ1 A;  4NTD A;  4YXD A;  1KSU A;  2BK4 A;  2YAU A;  2XLR A;  4NTE A;  4AP3 A;  4EM4 A;  4Z2R A;  4B69 A;  3V76 A;  2RGJ A;  2CDU A;  4WCT A;  1XPQ A;  4H4T A;  2E4G A;  4ECH A;  1H84 A;  4H4X A;  3GD4 A;  3GDN A;  3AE9 A;  2VQ7 A;  3AE1 A;  2GH5 A;  4XWR A;  1N4U A;  4C5O A;  2WEU A;  4U8I A;  5TR3 A;  4REK A;  4B63 A;  4PAB A;  2ZZC A;  1H81 A;  1PBE A;  3I6D A;  2C67 A;  3L1R A;  2YLR A;  3IHM A;  3CNJ A;  1ZX9 A;  3DJD A;  1GV4 A;  5U1O A;  4A99 A;  4K8D A;  5KOW A;  1NG3 A;  1MXT A;  4H4V A;  1O95 A;  2AAQ A;  2XDO A;  5GRT A;  3AED A;  4ADW A;  1H7W A;  3IHG A;  1NG4 A;  1NHQ A;  4UP3 A;  1D7Y A;  2B7S A;  4BJZ A;  3G5R A;  4CCQ A;  4H4W A;  5M0Z A;  3UKL A;  3CNP A;  1DOB A;  1S2Y A;  1TDO A;  3SFE A;  3IC9 A;  1PXB A;  3NN6 X;  2JBV A;  2CUL A;  4U8L A;  2X8C A;  4FK1 A;  4USQ A;  1S2Q A;  3CPI G;  1TDE A;  1YQ3 A;  4A6N B;  1IUW A;  4YSZ A;  3PO7 A;  5JCN A;  3B3R A;  4JY2 A;  2YLT A;  3NNE A;  1CC2 A;  4H4P A;  3S5W A;  2VVL G;  3NIX A;  4C77 A;  1Z6L A;  1PXC A;  1H86 A;  4K7Z A;  2GR0 A;  1JU2 A;  4A65 A;  4A6N A;  1NPX A;  1FEB A;  4U8K A;  3NT6 A;  2GQF A;  1N1P A;  4FDC B;  2YM1 A;  4JNA A;  1KF6 A;  4RSL A;  2NVK X;  4Z2T A;  3CN8 A;  3FBS A;  4J56 A;  1B8S A;  3CPJ G;  3LB8 A;  1GRT A;  2RGO A;  1ZMC A;  3FIM B;  3ICT A;  2BK3 A;  4XWZ A;  2XLS A;  3KVE A;  3K7Q X;  3P1W A;  4GDE A;  4K5S A;  5BUK A;  4B64 A;  1DJN A;  4YKG A;  4IVM B;  1Y56 B;  1MO9 A;  3NHO X;  5EBK A;  5ER0 A;  2QA2 A;  3GWD A;  2VVL A;  3K30 A;  1CC6 A;  3KLJ A;  3NN0 X;  3QVP A;  3SM8 A;  1Q1R A;  4WX1 A;  4D04 A;  3II4 A;  1ELI A;  2PHH A;  1GRB A;  2YG4 A;  4U8M A;  3UP4 A;  3UOX A;  4O5U A;  4BV6 A;  5FS7 A;  2XCG A;  4GRT A;  3DK4 A;  3UTG A;  3DJG X;  2CFY A;  2Q7V A;  4YWO A;  2J3N A;  1TDF A;  2XVJ A;  4OVI A;  4Y4M A;  1CJ4 A;  1L9E A;  1GXF A;  2GVC A;  2WOW A;  4J33 A;  3R9U A;  3SFD A;  1GRF A;  3UTF A;  4CY8 A;  3M13 A;  1YQZ A;  1KNR A;  2B9W A;  3L8K A;  4YKF A;  2Q6U A;  2WDV A;  3GYI A;  3NK2 X;  3CGB A;  2AR8 A;  2O9Z A;  3FMW A;  1EL5 A;  2BYB A;  2C75 A;  2YR6 A;  5BUL A;  1ZK7 A;  1NHP A;  2QCU A;  3GSI A;  3BNM A;  2WOV A;  2WU5 A;  4TLX A;  4UDP A;  4EQS A;  4Z43 A;  3VRA A;  2I0Z A;  1K4Q A;  2JB3 A;  1D7L A;  1P2E A;  3NLC A;  5FS6 A;  2ZBW A;  3UKQ A;  3DME A;  5J60 A;  4D03 A;  4EQX A;  2WP5 A;  1HYU A;  1RYI A;  1E1K A;  2DKI A;  2OLN A;  2R4E A;  4GR1 A;  5KVH A;  2WHD A;  2TPR A;  1DOD A;  5M10 A;  5KWF A;  5HY5 A;  3BHF A;  4Y4N A;  4AP1 A;  2YG5 A;  1NDA A;  3NRN A;  3VR9 A;  1XHC A;  2BCG G;  1KDG A;  5KOX A;  3BI5 A;  1GRE A;  3DH9 A;  2V6O A;  3E1T A;  2V3A A;  3EAN A;  2UZZ A;  5HHF A;  1FL2 A;  3CGD A;  1TDK A;  2GAH B;  1ZKQ A;  3ICR A;  3LZW A;  1BGN A;  4H4U A;  2QA1 A;  3C4N A;  4J2W A;  3RP8 A;  4CNK A;  1D4C A;  3AE8 A;  3AE2 A;  4J36 A;  2X8G A;  3CTY A;  1PJ5 A;  4B68 A;  1NEN A;  2Q0K A;  3AE6 A;  1PBB A;  1DOE A;  3UKH A;  3LXD A;  3QJ4 A;  2GMH A;  4BK2 A;  1L0V A;  4NEW A;  5IPY A;  4CY6 A;  4OPD A;  1JRY A;  4U2T A;  1E39 A;  1P2H A;  3UOV A;  1REO A;  4X9N A;  2BS4 A;  2VRL A;  2WBA A;  5IQ4 A;  3KD9 A;  3Q9T A;  1PDH A;  4E0V A;  3GRT A;  2GB0 A;  2WPF A;  1CJC A;  3LJP A;  3P4P A;  2YLW A;  2GV8 A;  2H89 A;  3ITJ A;  1H6V A;  3KU9 A;  4EIP A;  3RP7 A;  1CJ3 A;  1GEU A;  2XVI A;  2C3C A;  2V60 A;  3AXB A;  2BAB A;  3BNU A;  1L9C A;  2EQ6 A;  1FEA A;  4JNQ A;  3AE3 A;  4U8P A;  4NTC A;  1VDC A;  4EMW A;  2ZZB A;  4YTN A;  1ZP0 A;  4RG4 A;  1E1M A;  3DK8 A;  2AQJ A;  3KPF A;  3G5S A;  1TDN A;  2IID A;  3GYJ A;  2B76 A;  2NPX A;  2E1M A;  1LPF A;  5DBJ A;  1Q9I A;  3NKS A;  3CIR A;  3AB1 A;  5FS9 A;  3F8P A;  4FK1 C;  4TM3 A;  1B37 A;  1O5W A;  2V61 A;  1TYT A;  1GSN A;  1S3B A;  1D4D A;  4DSG A;  1BGJ A;  3FPZ A;  2C76 A;  2XVF A;  3AE5 A;  4H4S A;  2XVE A;  3URH A;  2XLU A;  1ONF A;  3UOZ A;  2X3N A;  3NK1 X;  4B67 A;  4LU6 A;  3D1C A;  3AEF A;  3QFB A;  1F3P A;  4OPT A;  4ZCD A;  2YR4 A;  4NEV A;  4X4J A;  3ATQ A;  2WOI A;  2WP9 A;  3P9U A;  1O94 A;  2YG3 A;  3O0H A;  4LII A;  2YLS A;  3RHA A;  3RP6 A;  1K0I A;  4DGK A;  1TYP A;  2R0G A;  3ISH A;  4CBQ A;  4MJW A;  3UKF A;  3ZYX A;  2YLZ A;  2VZ2 A;  2BXR A;  4EMI A;  4IV9 A;  1BWC A;  4H2P A;  4H4Q A;  3UTH A;  3AWI A;  4H2R A;  3GRS A;  3VQR A;  4CNJ A;  4JQ9 A;  1DOC A;  3ABV A;  4ZN0 A;  1GTE A;  1F6M A;  2RAB A;  3CND A;  5C2T A;  4C74 A;  2WU2 A;  3NYC A;  3UKA A;  2BAC A;  3NGC X;  3ALJ A;  2C3D A;  1JNR A;  3T37 A;  2YWL A;  3DGH A;  2WQY A;  3OZ2 A;  1CF3 A;  1GET A;  2R46 A;  4UDQ A;  2FJB A;  1JRX A;  2XLP A;  4J31 A;  2A8X A;  1PS9 A;  1GRH A;  2GR3 A;  1OJC A;  3UOY A;  1EL9 A;  3C4A A;  3GD3 A;  4B65 A;  3OC4 A;  1PN0 A;  1BKW A;  2H88 A;  5JCK A;  2X99 A;  3QFA A;  2XFP A;  1N4W A;  1D5T A;  1JEH A;  3AE7 A;  2C65 A;  3I3L A;  2C70 A;  1IUX A;  5HYM A;  1YKJ A;  2BS2 A;  2YG6 A;  5GSN A;  1JOA A;  2XFQ A;  4K22 A;  5FS8 A;  2WDR A;  3ZDN A;  3M12 A;  3C96 A;  2YVG A;  3COX A;  1M6I A;  3GMC A;  1E6E A;  1LQU A;  2DKH A;  4GF7 A;  4YT0 A;  3ICS A;  1UKV G;  3AEB A;  1ZOY A;  1OJD A;  4HA6 A;  2CVJ A;  4YSH A;  4U8O A;  1IUU A;  3DA1 A;  1ZOV A;  3G5Q A;  4Z2U A;  2XFN A;  4I59 A;  1RSG A;  5CKU A;  2PYX A;  3VR8 A;  1PBF A;  1VG9 A;  5EB5 A;  4U8N A;  4EQW A;  1ZDL A;  1GES A;  3NK0 X;  1ZY8 A;  1KNP A;  2GEW A;  2XVH A;  4BUR A;  4GUV A;  4DSH A;  1QO8 A;  3AD9 B;  3CGE A;  2GRT A;  2RGH A;  2IVE A;  1CL0 A;  3QSM A;  4TLZ A;  4TM1 A;  3SQP A;  5BRT A;  1SEZ A;  2BCP A;  4JDR A;  1COY A;  4NZH A;  1GER A;  2YG7 A;  1OJA A;  2ZZ0 A;  1V59 A;  4H2N A;  4OPL A;  3VRB A;  3LAD A;  2XFU A;  2JAE A;  3ATR A;  3NTD A;  1Y56 A;  3S61 A;  3UCL A;  1K0L A;  1M64 A;  1KFY A;  1B4V A;  1OJT A;  3HZL A;  4H4R A;  2X8H A;  4Z44 A;  3AEC A;  3RNM A;  4YTP A;  3F8D A;  2A87 A;  3BI4 A;  3H4K A;  3IF9 A;  4USR A;  4Z25 A;  2Z5X A;  4B1B A;  1PBD A;  1K0J A;  4EIQ A;  1VRQ B;  2X50 A;  3NH3 X;  1CJ2 A;  3IWA A;  3AE4 A;  2WPE A;  1EL7 A;  4N9X A;  3ALM A;  3DJJ A;  4K5R A;  1MOK A;  5U25 A;  4ICY A;  3GWF A;  3EAO A;  2ARD A;  2WES A;  2R45 A;  3P4Q A;  4H7U A;  4AOS A;  3AD8 B;  1PJ7 A;  2FJE A;  4CRT A;  4Z26 A;  4U2L A;  1GT8 A;  3GMB A;  3CPH G;  5KVI A;  1LV0 A;  2V3B A;  1EL8 A;  1AOG A;  4OCG A;  2A89 A;  3UTE A;  1GAL A;  5J7X A;  3P4R A;  4Y4L A;  1B5Q A;  2XFO A;  2B9X A;  4C3Y A;  4P9S A;  4Z24 A;  2BC0 A;  2WET A;  1FOH A;  2OA1 A;  1Y0P A;  4U8J A;  1E1L A;  2EQ8 A;  4H2Q A;  4JN9 A;  3DK9 A;  4YSY A;  3KA7 A;  4KX6 A;  1PJ6 A;  3QVR A;  2OAM A;  3EPT A;  2JB1 A;  1BF3 A;  3AEG A;  4FX9 A;  4H4Y A;  4A79 A;  4AT2 A;  1L9D A;  4TM0 A;  4B66 A;  2R9Z A;  4ZCC A;  2FJA A;  5EB4 A;  3BHK A;  2APG A;  1LTX R;  1VG0 A;  4BK1 A;  4YSX A;  1F8W A;  1N4V A;  1NEK A;  1IUS A;  3NG7 X;  2BC1 A;  2YM2 A;  4K2X A;  3CNS A;  1EBD A;  3H8I A;  5CQF A;  4IA6 A;  4OPU A;  3NTA A;  2Q0L A;  1IJH A;  4J57 A;  3AYL A;  2W0H A;  5U63 A;  3AYJ A;  2FJD A;  3AD7 B;  3PS9 A;  5KRQ A;  2WDQ A;  1GRG A;  2ACZ A;  3UKP A;  2BK5 A;  3D8X A;  2EQ7 A;  3LZX A;  1VQW A;  3AEE A;  4HB9 A;  3ALL A;  4GCM A;  1TRB A;  2VVM A;  3KKJ A;  4APN A;  4A9W A;  2YQU A;  4RG3 A;  1W4X A;  3QSE A;  2GR1 A;  2VRM A;  3ADA B;  1PBC A;  2OAL A;  2XLT A;  2C73 A;  2C66 A;  5C3J A;  4GDP A;  2Y6Q A;  1GRA A;  2GMJ A;  4A7A A;  5JCI A;  3VRD B;  1PHH A;  2C64 A;  2BXS A;  1E1N A;  3SGL A;  1ZMD A;  2C72 A;  3P4S A; 
#chains in the Genus database with same CATH topology
 2GR2 A;  3K7T A;  2BA9 A;  2VOU A;  5JCM A;  2VQB A;  4KPR A;  2F5Z A;  2GQW A;  5LV9 A;  1LQT A;  3NYE A;  3F8R A;  4GAV A;  4A5L A;  1H7X A;  1CBO A;  4EM3 A;  1D4E A;  1GOS A;  4M52 A;  3UP5 A;  1RP0 A;  4EQR A;  1CC4 A;  1YQ4 A;  2JKC A;  2YVF A;  1DJQ A;  3AEA A;  1NHS A;  4H50 A;  4OPC A;  2FBW A;  4AOX A;  4AT0 A;  1F8R A;  5FMH A;  4YTM A;  4U2S A;  4OPG A;  1Q1W A;  1IUV A;  4EMJ A;  1IUT A;  1FCD A;  4G6H A;  4BK3 A;  1DXL A;  1H82 A;  1YY5 A;  5KMQ A;  4C3X A;  2GF3 A;  1KSS A;  2YR5 A;  1H83 A;  2BS3 A;  2JB2 A;  1QJD A;  1OJ9 A;  3BI2 A;  4LA1 A;  1S3E A;  2WP6 A;  2QAE A;  1DNC A;  3M0O A;  2R0C A;  1PXA A;  2WS3 A;  2YVJ A;  2XYO A;  3EF6 A;  3K7M X;  2C7G A;  4IVO B;  1XDI A;  4XXG A;  2B7R A;  2IVD A;  1CHU A;  4JY3 A;  3V3N A;  3H8L A;  3LOV A;  4NWZ A;  4TM4 A;  4II2 A;  1NHR A;  3WE0 A;  3QSS A;  4I58 A;  4J34 A;  4X9M A;  3DGZ A;  2Z5Y A;  1GND A;  3FG2 P;  3JSK A;  4H4Z A;  4UDR A;  5EOW A;  3RED A;  5JCL A;  1F8S A;  2JK6 A;  3PVC A;  3AYI A;  5KXJ A;  2GAG B;  1LVL A;  1X31 B;  4DNA A;  5L46 A;  2E5V A;  4PAA A;  4IA5 A;  3V3O A;  1JRZ A;  3DJE A;  5BVA A;  1LJ1 A;  2R0P A;  3UKK A;  1FEC A;  2B9Y A;  2R4J A;  4O5Q A;  2WPC A;  2EQ9 A;  5HXI A;  1BZL A;  1JNZ A;  1QLB A;  2Y6R A;  2HQM A;  4OPI A;  3SY4 A;  3B6D A;  4G74 A;  1E7P A;  3GDP A;  3CGC A;  4CCR A;  1GTH A;  2V5Z A;  2TMD A;  2YLX A;  1GPE A;  1XAN A;  2OLO A;  3CNT A;  4BJY A;  3Q6J A;  1NAA A;  3NYF A;  5IQ1 A;  4NTD A;  4YXD A;  1KSU A;  2BK4 A;  2YAU A;  2XLR A;  4NTE A;  4AP3 A;  4EM4 A;  4Z2R A;  4B69 A;  3V76 A;  2RGJ A;  2CDU A;  3HYW A;  1XPQ A;  4H4T A;  4WCT A;  5KMP A;  2E4G A;  4ECH A;  1H84 A;  4H4X A;  3GD4 A;  3GDN A;  3AE9 A;  2VQ7 A;  3AE1 A;  2GH5 A;  4XWR A;  1N4U A;  4C5O A;  2WEU A;  4U8I A;  5TR3 A;  4REK A;  4B63 A;  4PAB A;  2ZZC A;  1H81 A;  1PBE A;  3I6D A;  2C67 A;  3L1R A;  2YLR A;  3IHM A;  3CNJ A;  1ZX9 A;  3DJD A;  1GV4 A;  5U1O A;  4A99 A;  4K8D A;  5KOW A;  1NG3 A;  1MXT A;  4H4V A;  1O95 A;  2AAQ A;  2XDO A;  5GRT A;  3AED A;  4ADW A;  1H7W A;  3IHG A;  1NG4 A;  1NHQ A;  4UP3 A;  1D7Y A;  2B7S A;  4BJZ A;  3G5R A;  4CCQ A;  4H4W A;  5M0Z A;  3UKL A;  3CNP A;  1DOB A;  1S2Y A;  1TDO A;  3SFE A;  3IC9 A;  1PXB A;  3NN6 X;  2JBV A;  2CUL A;  4U8L A;  2X8C A;  4FK1 A;  4USQ A;  1S2Q A;  3CPI G;  1TDE A;  1YQ3 A;  3GYX A;  1IUW A;  4A6N B;  4YSZ A;  3PO7 A;  5JCN A;  3B3R A;  4JY2 A;  2YLT A;  3NNE A;  1CC2 A;  4H4P A;  3S5W A;  2VVL G;  3NIX A;  4C77 A;  1Z6L A;  1PXC A;  1H86 A;  4K7Z A;  2GR0 A;  1JU2 A;  4A65 A;  4A6N A;  1NPX A;  1FEB A;  4U8K A;  3NT6 A;  2GQF A;  1N1P A;  4FDC B;  2YM1 A;  4JNA A;  1KF6 A;  4RSL A;  2NVK X;  4Z2T A;  5KNL A;  3CN8 A;  3FBS A;  4J56 A;  3T2Y A;  3SZ0 A;  1B8S A;  3CPJ G;  3LB8 A;  1GRT A;  2RGO A;  1ZMC A;  3FIM B;  3ICT A;  2BK3 A;  4XWZ A;  2XLS A;  3KVE A;  3K7Q X;  3P1W A;  4GDE A;  4K5S A;  3SXI A;  5BUK A;  4B64 A;  1DJN A;  4YKG A;  4IVM B;  1Y56 B;  1MO9 A;  3NHO X;  4GAP A;  5EBK A;  5ER0 A;  2QA2 A;  3GWD A;  2VVL A;  3K30 A;  1CC6 A;  3KLJ A;  3NN0 X;  3QVP A;  3SM8 A;  1Q1R A;  4WX1 A;  4D04 A;  3II4 A;  1ELI A;  2PHH A;  1GRB A;  2YG4 A;  4U8M A;  3UP4 A;  3UOX A;  4O5U A;  4BV6 A;  5FS7 A;  2XCG A;  4GRT A;  3DK4 A;  3UTG A;  3DJG X;  2CFY A;  2Q7V A;  4YWO A;  2J3N A;  1TDF A;  2XVJ A;  4OVI A;  4Y4M A;  1CJ4 A;  1L9E A;  1GXF A;  2GVC A;  2WOW A;  4J33 A;  3R9U A;  3SFD A;  1GRF A;  3UTF A;  4CY8 A;  3M13 A;  1YQZ A;  1KNR A;  2B9W A;  3L8K A;  4YKF A;  2Q6U A;  2WDV A;  3GYI A;  3NK2 X;  3CGB A;  2AR8 A;  2O9Z A;  3FMW A;  1EL5 A;  2BYB A;  2C75 A;  2YR6 A;  5BUL A;  1ZK7 A;  1NHP A;  2QCU A;  3GSI A;  3BNM A;  2WOV A;  2WU5 A;  2C4C A;  4TLX A;  4UDP A;  3T0K A;  3VRA A;  4EQS A;  4Z43 A;  2I0Z A;  1K4Q A;  2JB3 A;  1D7L A;  1P2E A;  3NLC A;  5FS6 A;  2ZBW A;  3UKQ A;  3DME A;  5J60 A;  4D03 A;  4EQX A;  2WP5 A;  1HYU A;  1RYI A;  3SYI A;  1E1K A;  2DKI A;  2OLN A;  2R4E A;  4GR1 A;  5KVH A;  2WHD A;  2TPR A;  3SZC A;  1DOD A;  5M10 A;  3KPK A;  5KWF A;  5HY5 A;  3BHF A;  4Y4N A;  4AP1 A;  2YG5 A;  1NDA A;  3NRN A;  3VR9 A;  1XHC A;  2BCG G;  1KDG A;  5KOX A;  3BI5 A;  1GRE A;  3DH9 A;  2V6O A;  3E1T A;  2V3A A;  3EAN A;  2UZZ A;  5HHF A;  1FL2 A;  3CGD A;  1TDK A;  2GAH B;  1ZKQ A;  3ICR A;  3LZW A;  1BGN A;  4H4U A;  2QA1 A;  3C4N A;  5KMR A;  4J2W A;  3RP8 A;  4CNK A;  1D4C A;  3AE8 A;  3AE2 A;  4J36 A;  2BRY A;  2X8G A;  3CTY A;  1PJ5 A;  4B68 A;  1NEN A;  2Q0K A;  3AE6 A;  1PBB A;  1DOE A;  3UKH A;  3LXD A;  3QJ4 A;  2GMH A;  4BK2 A;  1L0V A;  4NEW A;  5IPY A;  4CY6 A;  4OPD A;  1JRY A;  4U2T A;  1E39 A;  1P2H A;  3UOV A;  1REO A;  4X9N A;  2BS4 A;  2VRL A;  2WBA A;  5IQ4 A;  3KD9 A;  3Q9T A;  1PDH A;  4E0V A;  3GRT A;  2GB0 A;  2WPF A;  1CJC A;  3LJP A;  3P4P A;  2YLW A;  2GV8 A;  2H89 A;  3T2K A;  3ITJ A;  1H6V A;  3KU9 A;  4EIP A;  3SX6 A;  3RP7 A;  1CJ3 A;  1GEU A;  2XVI A;  2C3C A;  2V60 A;  3AXB A;  2BAB A;  3BNU A;  1L9C A;  2EQ6 A;  1FEA A;  4JNQ A;  3AE3 A;  4U8P A;  4NTC A;  1VDC A;  4EMW A;  2ZZB A;  4YTN A;  1ZP0 A;  4RG4 A;  1E1M A;  3DK8 A;  2AQJ A;  3KPF A;  3G5S A;  1TDN A;  2IID A;  3GYJ A;  2B76 A;  2NPX A;  2E1M A;  1LPF A;  5DBJ A;  1Q9I A;  3NKS A;  3CIR A;  3AB1 A;  5FS9 A;  3F8P A;  4FK1 C;  4TM3 A;  1B37 A;  1O5W A;  2V61 A;  1TYT A;  1GSN A;  1S3B A;  1D4D A;  4G9K A;  1BGJ A;  3FPZ A;  4DSG A;  2C76 A;  2XVF A;  3AE5 A;  4H4S A;  2XVE A;  3URH A;  2XLU A;  1ONF A;  3UOZ A;  2X3N A;  3NK1 X;  4B67 A;  4LU6 A;  3D1C A;  3AEF A;  3QFB A;  1F3P A;  4OPT A;  4ZCD A;  2YR4 A;  4NEV A;  4X4J A;  3ATQ A;  2WOI A;  2WP9 A;  3P9U A;  1O94 A;  2YG3 A;  3O0H A;  4LII A;  2YLS A;  3RHA A;  3RP6 A;  1K0I A;  4DGK A;  1TYP A;  2R0G A;  3ISH A;  4CBQ A;  4MJW A;  3UKF A;  3ZYX A;  2YLZ A;  2VZ2 A;  2BXR A;  4EMI A;  4IV9 A;  1BWC A;  4H2P A;  4H4Q A;  3UTH A;  3AWI A;  4H2R A;  3GRS A;  3VQR A;  4CNJ A;  4JQ9 A;  1DOC A;  3ABV A;  4ZN0 A;  1GTE A;  1F6M A;  2RAB A;  3CND A;  5C2T A;  4C74 A;  2WU2 A;  3NYC A;  3UKA A;  2BAC A;  3NGC X;  3ALJ A;  2C3D A;  1JNR A;  3T37 A;  2YWL A;  3DGH A;  2WQY A;  3OZ2 A;  1CF3 A;  1GET A;  2R46 A;  4UDQ A;  2FJB A;  1JRX A;  2XLP A;  4J31 A;  2A8X A;  1PS9 A;  1GRH A;  2GR3 A;  1OJC A;  3UOY A;  1EL9 A;  3CMM A;  3C4A A;  3GD3 A;  4B65 A;  3OC4 A;  1PN0 A;  1BKW A;  2H88 A;  5JCK A;  2X99 A;  3QFA A;  2XFP A;  1N4W A;  1D5T A;  1JEH A;  3AE7 A;  2C65 A;  3I3L A;  2C70 A;  4NNJ A;  1IUX A;  5HYM A;  1YKJ A;  2BS2 A;  2YG6 A;  5GSN A;  1JOA A;  2XFQ A;  4K22 A;  5FS8 A;  2WDR A;  3ZDN A;  3M12 A;  3C96 A;  2YVG A;  3COX A;  1M6I A;  3GMC A;  1E6E A;  1LQU A;  2DKH A;  4GF7 A;  4YT0 A;  3ICS A;  1UKV G;  3AEB A;  1ZOY A;  1OJD A;  4HA6 A;  2CVJ A;  4YSH A;  4U8O A;  1IUU A;  3DA1 A;  1ZOV A;  3G5Q A;  4Z2U A;  2XFN A;  4I59 A;  1RSG A;  5CKU A;  2PYX A;  3VR8 A;  1PBF A;  1VG9 A;  5EB5 A;  4U8N A;  4EQW A;  1ZDL A;  1GES A;  3NK0 X;  1ZY8 A;  1KNP A;  2GEW A;  2XVH A;  4BUR A;  4GUV A;  4DSH A;  1QO8 A;  3T2Z A;  3AD9 B;  3CGE A;  2GRT A;  2RGH A;  2IVE A;  1CL0 A;  3QSM A;  4TLZ A;  4TM1 A;  3SQP A;  4II3 A;  1SEZ A;  5BRT A;  2BCP A;  4JDR A;  1COY A;  4NZH A;  1GER A;  2YG7 A;  1OJA A;  2ZZ0 A;  1V59 A;  4H2N A;  4OPL A;  3VRB A;  3LAD A;  2XFU A;  2JAE A;  3ATR A;  3NTD A;  1Y56 A;  3S61 A;  3UCL A;  1K0L A;  1M64 A;  1KFY A;  1B4V A;  1OJT A;  3HZL A;  4H4R A;  2X8H A;  4Z44 A;  3AEC A;  3RNM A;  4YTP A;  3F8D A;  2A87 A;  3BI4 A;  3H4K A;  3IF9 A;  4USR A;  4Z25 A;  2Z5X A;  4B1B A;  1PBD A;  3SZW A;  1K0J A;  4EIQ A;  1VRQ B;  2X50 A;  3NH3 X;  1CJ2 A;  3IWA A;  3AE4 A;  2WPE A;  1EL7 A;  4N9X A;  3ALM A;  3DJJ A;  4K5R A;  1MOK A;  5U25 A;  4ICY A;  3GWF A;  3EAO A;  2ARD A;  2WES A;  2R45 A;  3P4Q A;  4H7U A;  4AOS A;  3AD8 B;  1PJ7 A;  2FJE A;  4CRT A;  4Z26 A;  4U2L A;  1GT8 A;  3GMB A;  3T14 A;  3CPH G;  5KVI A;  1LV0 A;  3HYV A;  2V3B A;  1EL8 A;  4G73 A;  1AOG A;  4OCG A;  2A89 A;  3UTE A;  1GAL A;  5J7X A;  3P4R A;  4Y4L A;  1B5Q A;  2XFO A;  2B9X A;  4C3Y A;  4P9S A;  4Z24 A;  2BC0 A;  2BRA A;  2WET A;  3HYX A;  1FOH A;  2OA1 A;  1Y0P A;  4U8J A;  1E1L A;  2EQ8 A;  4H2Q A;  4JN9 A;  3DK9 A;  4YSY A;  3KA7 A;  4KX6 A;  1PJ6 A;  3QVR A;  2OAM A;  3T31 A;  3EPT A;  2JB1 A;  1BF3 A;  3AEG A;  4FX9 A;  4H4Y A;  4A79 A;  4AT2 A;  1L9D A;  4TM0 A;  4B66 A;  2R9Z A;  4ZCC A;  2FJA A;  5EB4 A;  3BHK A;  2APG A;  1LTX R;  1VG0 A;  4BK1 A;  4YSX A;  1F8W A;  1N4V A;  1NEK A;  1IUS A;  3NG7 X;  2BC1 A;  2YM2 A;  4K2X A;  3CNS A;  1EBD A;  3H8I A;  5CQF A;  4IA6 A;  4OPU A;  3NTA A;  2Q0L A;  1IJH A;  4J57 A;  3AYL A;  2W0H A;  5U63 A;  3AYJ A;  2FJD A;  3AD7 B;  3PS9 A;  5KRQ A;  2WDQ A;  1GRG A;  3SZF A;  4G6G A;  2ACZ A;  3UKP A;  2BK5 A;  3D8X A;  2EQ7 A;  3LZX A;  1VQW A;  3AEE A;  4HB9 A;  3ALL A;  4GCM A;  1TRB A;  2VVM A;  3KKJ A;  4APN A;  4A9W A;  2YQU A;  4RG3 A;  1W4X A;  3QSE A;  2GR1 A;  2VRM A;  3ADA B;  1PBC A;  2OAL A;  2XLT A;  2C73 A;  2C66 A;  5C3J A;  4GDP A;  2Y6Q A;  1GRA A;  2GMJ A;  4A7A A;  5JCI A;  3VRD B;  1PHH A;  2C64 A;  5KMS A;  2BXS A;  1E1N A;  3SGL A;  1ZMD A;  2C72 A;  3P4S A; 
#chains in the Genus database with same CATH homology
 2GR2 A;  3K7T A;  2BA9 A;  2VOU A;  5JCM A;  2VQB A;  4KPR A;  2F5Z A;  2GQW A;  5LV9 A;  1LQT A;  3NYE A;  3F8R A;  4GAV A;  4A5L A;  1H7X A;  1CBO A;  4EM3 A;  1D4E A;  1GOS A;  4M52 A;  3UP5 A;  1RP0 A;  4EQR A;  1CC4 A;  1YQ4 A;  2JKC A;  2YVF A;  1DJQ A;  3AEA A;  1NHS A;  4H50 A;  4OPC A;  2FBW A;  4AOX A;  4AT0 A;  1F8R A;  5FMH A;  4YTM A;  4U2S A;  4OPG A;  1Q1W A;  1IUV A;  4EMJ A;  1IUT A;  1FCD A;  4G6H A;  4BK3 A;  1DXL A;  1H82 A;  1YY5 A;  5KMQ A;  4C3X A;  2GF3 A;  1KSS A;  2YR5 A;  1H83 A;  2BS3 A;  2JB2 A;  1QJD A;  1OJ9 A;  3BI2 A;  4LA1 A;  1S3E A;  2WP6 A;  2QAE A;  1DNC A;  3M0O A;  2R0C A;  1PXA A;  2WS3 A;  2YVJ A;  2XYO A;  3EF6 A;  3K7M X;  2C7G A;  4IVO B;  1XDI A;  4XXG A;  2B7R A;  2IVD A;  1CHU A;  4JY3 A;  3V3N A;  3H8L A;  3LOV A;  4NWZ A;  4TM4 A;  4II2 A;  1NHR A;  3WE0 A;  3QSS A;  4I58 A;  4J34 A;  4X9M A;  3DGZ A;  2Z5Y A;  1GND A;  3FG2 P;  3JSK A;  4H4Z A;  4UDR A;  5EOW A;  3RED A;  5JCL A;  1F8S A;  2JK6 A;  3PVC A;  3AYI A;  5KXJ A;  2GAG B;  1LVL A;  1X31 B;  4DNA A;  5L46 A;  2E5V A;  4PAA A;  4IA5 A;  3V3O A;  1JRZ A;  3DJE A;  5BVA A;  1LJ1 A;  2R0P A;  3UKK A;  1FEC A;  2B9Y A;  2R4J A;  4O5Q A;  2WPC A;  2EQ9 A;  5HXI A;  1BZL A;  1JNZ A;  1QLB A;  2Y6R A;  2HQM A;  4OPI A;  3SY4 A;  3B6D A;  4G74 A;  1E7P A;  3GDP A;  3CGC A;  4CCR A;  1GTH A;  2V5Z A;  2TMD A;  2YLX A;  1GPE A;  1XAN A;  2OLO A;  3CNT A;  4BJY A;  3Q6J A;  1NAA A;  3NYF A;  5IQ1 A;  4NTD A;  4YXD A;  1KSU A;  2BK4 A;  2YAU A;  2XLR A;  4NTE A;  4AP3 A;  4EM4 A;  4Z2R A;  4B69 A;  3V76 A;  2RGJ A;  2CDU A;  3HYW A;  1XPQ A;  4H4T A;  4WCT A;  5KMP A;  2E4G A;  4ECH A;  1H84 A;  4H4X A;  3GD4 A;  3GDN A;  3AE9 A;  2VQ7 A;  3AE1 A;  2GH5 A;  4XWR A;  1N4U A;  4C5O A;  2WEU A;  4U8I A;  5TR3 A;  4REK A;  4B63 A;  4PAB A;  2ZZC A;  1H81 A;  1PBE A;  3I6D A;  2C67 A;  3L1R A;  2YLR A;  3IHM A;  3CNJ A;  1ZX9 A;  3DJD A;  1GV4 A;  5U1O A;  4A99 A;  4K8D A;  5KOW A;  1NG3 A;  1MXT A;  4H4V A;  1O95 A;  2AAQ A;  2XDO A;  5GRT A;  3AED A;  4ADW A;  1H7W A;  3IHG A;  1NG4 A;  1NHQ A;  4UP3 A;  1D7Y A;  2B7S A;  4BJZ A;  3G5R A;  4CCQ A;  4H4W A;  5M0Z A;  3UKL A;  3CNP A;  1DOB A;  1S2Y A;  1TDO A;  3SFE A;  3IC9 A;  1PXB A;  3NN6 X;  2JBV A;  2CUL A;  4U8L A;  2X8C A;  4FK1 A;  4USQ A;  1S2Q A;  3CPI G;  1TDE A;  1YQ3 A;  3GYX A;  1IUW A;  4A6N B;  4YSZ A;  3PO7 A;  5JCN A;  3B3R A;  4JY2 A;  2YLT A;  3NNE A;  1CC2 A;  4H4P A;  3S5W A;  2VVL G;  3NIX A;  4C77 A;  1Z6L A;  1PXC A;  1H86 A;  4K7Z A;  2GR0 A;  1JU2 A;  4A65 A;  4A6N A;  1NPX A;  1FEB A;  4U8K A;  3NT6 A;  2GQF A;  1N1P A;  4FDC B;  2YM1 A;  4JNA A;  1KF6 A;  4RSL A;  2NVK X;  4Z2T A;  5KNL A;  3CN8 A;  3FBS A;  4J56 A;  3T2Y A;  3SZ0 A;  1B8S A;  3CPJ G;  3LB8 A;  1GRT A;  2RGO A;  1ZMC A;  3FIM B;  3ICT A;  2BK3 A;  4XWZ A;  2XLS A;  3KVE A;  3K7Q X;  3P1W A;  4GDE A;  4K5S A;  3SXI A;  5BUK A;  4B64 A;  1DJN A;  4YKG A;  4IVM B;  1Y56 B;  1MO9 A;  3NHO X;  4GAP A;  5EBK A;  5ER0 A;  2QA2 A;  3GWD A;  2VVL A;  3K30 A;  1CC6 A;  3KLJ A;  3NN0 X;  3QVP A;  3SM8 A;  1Q1R A;  4WX1 A;  4D04 A;  3II4 A;  1ELI A;  2PHH A;  1GRB A;  2YG4 A;  4U8M A;  3UP4 A;  3UOX A;  4O5U A;  4BV6 A;  5FS7 A;  2XCG A;  4GRT A;  3DK4 A;  3UTG A;  3DJG X;  2CFY A;  2Q7V A;  4YWO A;  2J3N A;  1TDF A;  2XVJ A;  4OVI A;  4Y4M A;  1CJ4 A;  1L9E A;  1GXF A;  2GVC A;  2WOW A;  4J33 A;  3R9U A;  3SFD A;  1GRF A;  3UTF A;  4CY8 A;  3M13 A;  1YQZ A;  1KNR A;  2B9W A;  3L8K A;  4YKF A;  2Q6U A;  2WDV A;  3GYI A;  3NK2 X;  3CGB A;  2AR8 A;  2O9Z A;  3FMW A;  1EL5 A;  2BYB A;  2C75 A;  2YR6 A;  5BUL A;  1ZK7 A;  1NHP A;  2QCU A;  3GSI A;  3BNM A;  2WOV A;  2WU5 A;  2C4C A;  4TLX A;  4UDP A;  3T0K A;  3VRA A;  4EQS A;  4Z43 A;  2I0Z A;  1K4Q A;  2JB3 A;  1D7L A;  1P2E A;  3NLC A;  5FS6 A;  2ZBW A;  3UKQ A;  3DME A;  5J60 A;  4D03 A;  4EQX A;  2WP5 A;  1HYU A;  1RYI A;  3SYI A;  1E1K A;  2DKI A;  2OLN A;  2R4E A;  4GR1 A;  5KVH A;  2WHD A;  2TPR A;  3SZC A;  1DOD A;  5M10 A;  3KPK A;  5KWF A;  5HY5 A;  3BHF A;  4Y4N A;  4AP1 A;  2YG5 A;  1NDA A;  3NRN A;  3VR9 A;  1XHC A;  2BCG G;  1KDG A;  5KOX A;  3BI5 A;  1GRE A;  3DH9 A;  2V6O A;  3E1T A;  2V3A A;  3EAN A;  2UZZ A;  5HHF A;  1FL2 A;  3CGD A;  1TDK A;  2GAH B;  1ZKQ A;  3ICR A;  3LZW A;  1BGN A;  4H4U A;  2QA1 A;  3C4N A;  5KMR A;  4J2W A;  3RP8 A;  4CNK A;  1D4C A;  3AE8 A;  3AE2 A;  4J36 A;  2BRY A;  2X8G A;  3CTY A;  1PJ5 A;  4B68 A;  1NEN A;  2Q0K A;  3AE6 A;  1PBB A;  1DOE A;  3UKH A;  3LXD A;  3QJ4 A;  2GMH A;  4BK2 A;  1L0V A;  4NEW A;  5IPY A;  4CY6 A;  4OPD A;  1JRY A;  4U2T A;  1E39 A;  1P2H A;  3UOV A;  1REO A;  4X9N A;  2BS4 A;  2VRL A;  2WBA A;  5IQ4 A;  3KD9 A;  3Q9T A;  1PDH A;  4E0V A;  3GRT A;  2GB0 A;  2WPF A;  1CJC A;  3LJP A;  3P4P A;  2YLW A;  2GV8 A;  2H89 A;  3T2K A;  3ITJ A;  1H6V A;  3KU9 A;  4EIP A;  3SX6 A;  3RP7 A;  1CJ3 A;  1GEU A;  2XVI A;  2C3C A;  2V60 A;  3AXB A;  2BAB A;  3BNU A;  1L9C A;  2EQ6 A;  1FEA A;  4JNQ A;  3AE3 A;  4U8P A;  4NTC A;  1VDC A;  4EMW A;  2ZZB A;  4YTN A;  1ZP0 A;  4RG4 A;  1E1M A;  3DK8 A;  2AQJ A;  3KPF A;  3G5S A;  1TDN A;  2IID A;  3GYJ A;  2B76 A;  2NPX A;  2E1M A;  1LPF A;  5DBJ A;  1Q9I A;  3NKS A;  3CIR A;  3AB1 A;  5FS9 A;  3F8P A;  4FK1 C;  4TM3 A;  1B37 A;  1O5W A;  2V61 A;  1TYT A;  1GSN A;  1S3B A;  1D4D A;  4G9K A;  1BGJ A;  3FPZ A;  4DSG A;  2C76 A;  2XVF A;  3AE5 A;  4H4S A;  2XVE A;  3URH A;  2XLU A;  1ONF A;  3UOZ A;  2X3N A;  3NK1 X;  4B67 A;  4LU6 A;  3D1C A;  3AEF A;  3QFB A;  1F3P A;  4OPT A;  4ZCD A;  2YR4 A;  4NEV A;  4X4J A;  3ATQ A;  2WOI A;  2WP9 A;  3P9U A;  1O94 A;  2YG3 A;  3O0H A;  4LII A;  2YLS A;  3RHA A;  3RP6 A;  1K0I A;  4DGK A;  1TYP A;  2R0G A;  3ISH A;  4CBQ A;  4MJW A;  3UKF A;  3ZYX A;  2YLZ A;  2VZ2 A;  2BXR A;  4EMI A;  4IV9 A;  1BWC A;  4H2P A;  4H4Q A;  3UTH A;  3AWI A;  4H2R A;  3GRS A;  3VQR A;  4CNJ A;  4JQ9 A;  1DOC A;  3ABV A;  4ZN0 A;  1GTE A;  1F6M A;  2RAB A;  3CND A;  5C2T A;  4C74 A;  2WU2 A;  3NYC A;  3UKA A;  2BAC A;  3NGC X;  3ALJ A;  2C3D A;  1JNR A;  3T37 A;  2YWL A;  3DGH A;  2WQY A;  3OZ2 A;  1CF3 A;  1GET A;  2R46 A;  4UDQ A;  2FJB A;  1JRX A;  2XLP A;  4J31 A;  2A8X A;  1PS9 A;  1GRH A;  2GR3 A;  1OJC A;  3UOY A;  1EL9 A;  3CMM A;  3C4A A;  3GD3 A;  4B65 A;  3OC4 A;  1PN0 A;  1BKW A;  2H88 A;  5JCK A;  2X99 A;  3QFA A;  2XFP A;  1N4W A;  1D5T A;  1JEH A;  3AE7 A;  2C65 A;  3I3L A;  2C70 A;  4NNJ A;  1IUX A;  5HYM A;  1YKJ A;  2BS2 A;  2YG6 A;  5GSN A;  1JOA A;  2XFQ A;  4K22 A;  5FS8 A;  2WDR A;  3ZDN A;  3M12 A;  3C96 A;  2YVG A;  3COX A;  1M6I A;  3GMC A;  1E6E A;  1LQU A;  2DKH A;  4GF7 A;  4YT0 A;  3ICS A;  1UKV G;  3AEB A;  1ZOY A;  1OJD A;  4HA6 A;  2CVJ A;  4YSH A;  4U8O A;  1IUU A;  3DA1 A;  1ZOV A;  3G5Q A;  4Z2U A;  2XFN A;  4I59 A;  1RSG A;  5CKU A;  2PYX A;  3VR8 A;  1PBF A;  1VG9 A;  5EB5 A;  4U8N A;  4EQW A;  1ZDL A;  1GES A;  3NK0 X;  1ZY8 A;  1KNP A;  2GEW A;  2XVH A;  4BUR A;  4GUV A;  4DSH A;  1QO8 A;  3T2Z A;  3AD9 B;  3CGE A;  2GRT A;  2RGH A;  2IVE A;  1CL0 A;  3QSM A;  4TLZ A;  4TM1 A;  3SQP A;  4II3 A;  1SEZ A;  5BRT A;  2BCP A;  4JDR A;  1COY A;  4NZH A;  1GER A;  2YG7 A;  1OJA A;  2ZZ0 A;  1V59 A;  4H2N A;  4OPL A;  3VRB A;  3LAD A;  2XFU A;  2JAE A;  3ATR A;  3NTD A;  1Y56 A;  3S61 A;  3UCL A;  1K0L A;  1M64 A;  1KFY A;  1B4V A;  1OJT A;  3HZL A;  4H4R A;  2X8H A;  4Z44 A;  3AEC A;  3RNM A;  4YTP A;  3F8D A;  2A87 A;  3BI4 A;  3H4K A;  3IF9 A;  4USR A;  4Z25 A;  2Z5X A;  4B1B A;  1PBD A;  3SZW A;  1K0J A;  4EIQ A;  1VRQ B;  2X50 A;  3NH3 X;  1CJ2 A;  3IWA A;  3AE4 A;  2WPE A;  1EL7 A;  4N9X A;  3ALM A;  3DJJ A;  4K5R A;  1MOK A;  5U25 A;  4ICY A;  3GWF A;  3EAO A;  2ARD A;  2WES A;  2R45 A;  3P4Q A;  4H7U A;  4AOS A;  3AD8 B;  1PJ7 A;  2FJE A;  4CRT A;  4Z26 A;  4U2L A;  1GT8 A;  3GMB A;  3T14 A;  3CPH G;  5KVI A;  1LV0 A;  3HYV A;  2V3B A;  1EL8 A;  4G73 A;  1AOG A;  4OCG A;  2A89 A;  3UTE A;  1GAL A;  5J7X A;  3P4R A;  4Y4L A;  1B5Q A;  2XFO A;  2B9X A;  4C3Y A;  4P9S A;  4Z24 A;  2BC0 A;  2BRA A;  2WET A;  3HYX A;  1FOH A;  2OA1 A;  1Y0P A;  4U8J A;  1E1L A;  2EQ8 A;  4H2Q A;  4JN9 A;  3DK9 A;  4YSY A;  3KA7 A;  4KX6 A;  1PJ6 A;  3QVR A;  2OAM A;  3T31 A;  3EPT A;  2JB1 A;  1BF3 A;  3AEG A;  4FX9 A;  4H4Y A;  4A79 A;  4AT2 A;  1L9D A;  4TM0 A;  4B66 A;  2R9Z A;  4ZCC A;  2FJA A;  5EB4 A;  3BHK A;  2APG A;  1LTX R;  1VG0 A;  4BK1 A;  4YSX A;  1F8W A;  1N4V A;  1NEK A;  1IUS A;  3NG7 X;  2BC1 A;  2YM2 A;  4K2X A;  3CNS A;  1EBD A;  3H8I A;  5CQF A;  4IA6 A;  4OPU A;  3NTA A;  2Q0L A;  1IJH A;  4J57 A;  3AYL A;  2W0H A;  5U63 A;  3AYJ A;  2FJD A;  3AD7 B;  3PS9 A;  5KRQ A;  2WDQ A;  1GRG A;  3SZF A;  4G6G A;  2ACZ A;  3UKP A;  2BK5 A;  3D8X A;  2EQ7 A;  3LZX A;  1VQW A;  3AEE A;  4HB9 A;  3ALL A;  4GCM A;  1TRB A;  2VVM A;  3KKJ A;  4APN A;  4A9W A;  2YQU A;  4RG3 A;  1W4X A;  3QSE A;  2GR1 A;  2VRM A;  3ADA B;  1PBC A;  2OAL A;  2XLT A;  2C73 A;  2C66 A;  5C3J A;  4GDP A;  2Y6Q A;  1GRA A;  2GMJ A;  4A7A A;  5JCI A;  3VRD B;  1PHH A;  2C64 A;  5KMS A;  2BXS A;  1E1N A;  3SGL A;  1ZMD A;  2C72 A;  3P4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...