1TRBA

Convergent evolution of similar function in two structurally divergent enzymes
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Convergent evolution of similar function in two structurally divergent enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
total genus 93
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1991-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1trbA02
1M6IA 3ICSA 4B1BA 3ICTA 2R45A 3AEAA 3CN8A 3KLJA 4AP1A 2GH5A 1TDFA 4OPUA 2RABA 3DH9A 1L9DA 2WS3A 1RYIA 2EQ6A 3DGHA 2BCPA 3E1TA 2IVEA 2YLSA 4H4TA 2OALA 3BHKA 3C96A 2GMHA 5FS8A 5HY5A 4EQSA 4BK3A 4H7UA 2VZ2A 3AYIA 2BK4A 3UKFA 2C64A 1M64A 2ZBWA 4YT0A 3S61A 3M12A 4H2RA 3M13A 2XLSA 4IVOB 4K8DA 1N1PA 2VVMA 2WU2A 2AAQA 4EMIA 5KXJA 3KKJA 2YM1A 3UCLA 5CQFA 1PJ7A 4GCMA 2BC0A 3HZLA 4BJYA 5FS9A 1JRYA 1PXCA 2JAEA 2I0ZA 1B8SA 4BJZA 4D03A 3KA7A 3CGCA 1PBCA 3RP8A 3UOVA 2WU5A 4AOSA 3ITJA 3DA1A 3GMBA 4EMWA 5LV9A 2V3AA 4EIPA 1IJHA 1D7LA 1PXBA 2BCGG 1GV4A 1GEUA 2V6OA 3DGZA 4LA1A 3UTHA 4J56A 3QJ4A 2QAEA 2WP9A 1O95A 4A99A 1CC6A 1KDGA 4Z2UA 3AEGA 1OJ9A 2JK6A 4H4PA 4HA6A 4U8KA 1GOSA 4OPCA 5DBJA 2R0PA 1S2QA 4B64A 3UP4A 2IVDA 1E39A 1K0IA 1N4WA 2XVIA 1GT8A 5IQ1A 4A9WA 2R46A 3P9UA 3CPIG 1KFYA 4U2SA 2YLWA 1CHUA 4H4QA 3KVEA 2NPXA 3CIRA 4RG4A 5KRQA 1N4VA 2JBVA 1CJCA 1ZK7A 2F5ZA 3FPZA 4B68A 5KVHA 5HYMA 2H89A 1YQ4A 2J3NA 3AE7A 1GXFA 1TYPA 1ONFA 2BS3A 1RSGA 4H50A 5JCKA 1EBDA 4ADWA 1PHHA 2B7SA 2OA1A 4AOXA 3GWDA 3Q6JA 4ICYA 4PAAA 1H6VA 2C65A 3P4RA 4C3XA 2C67A 2R4EA 3CPJG 2WHDA 3NYEA 2YR4A 3QVRA 1MXTA 1GSNA 5IPYA 1TDEA 2TMDA 2GV8A 3K7TA 3PVCA 4GR1A 2A89A 3H8IA 2JKCA 2Q0KA 5EB5A 1O5WA 3GYJA 2B9WA 3I3LA 1Y56B 3UKQA 2Y6RA 1EL5A 4JN9A 1E7PA 2C7GA 3II4A 4P9SA 1GNDA 4J36A 3BI5A 4Y4MA 4WCTA 3Q9TA 4K5RA 2ZZBA 4NZHA 1GPEA 4A6NA 2YR6A 3AB1A 2GQFA 4KPRA 3VQRA 4CCQA 5BULA 1KNRA 2WQYA 3DJDA 4BURA 1DODA 2PYXA 4CRTA 3NK1X 3ABVA 3NHOX 4ECHA 2WPCA 4OPGA 3RP7A 3NKSA 1MO9A 3URHA 3SGLA 1ELIA 2UZZA 4CY6A 4Z43A 1D4DA 5EOWA 3QSSA 1PS9A 2GRTA 4K2XA 1RP0A 1VG9A 4HB9A 1FEBA 1PJ5A 1KSUA 2BK5A 4Z26A 2VOUA 2YLRA 5BVAA 1Q1WA 2JB1A 3GDNA 4Y4LA 3AD8B 4UDRA 3GDPA 1IUSA 1PN0A 3AE2A 2WP5A 2CDUA 3SM8A 1JRZA 2XVHA 3AXBA 3LOVA 2E5VA 2XVJA 1DNCA 2VRMA 1E6EA 3IHGA 1NG4A 2RGHA 2W0HA 2O9ZA 3LB8A 4J34A 4H4VA 2R0GA 1EL9A 1GRHA 1DOEA 1B5QA 3ALJA 2X50A 2CFYA 4I58A 3UTEA 2YM2A 2WDRA 1P2HA 1PBEA 3GRSA 2Q6UA 2B9YA 4XWRA 3V3NA 4CY8A 2BYBA 1D4EA 1W4XA 2GB0A 3NYFA 1NDAA 2GVCA 1LVLA 4GF7A 2IIDA 4OVIA 1O94A 4NTDA 4FK1C 4K22A 4NTEA 3NYCA 3CNPA 3LADA 2XYOA 4H4WA 4TM3A 5GRTA 1KF6A 1YQZA 1ZOYA 2XLTA 4NTCA 4ZCDA 1BWCA 4YSXA 1ZKQA 1PXAA 3ALMA 3AEFA 1H86A 1PBDA 2TPRA 4EM3A 1DJNA 2RGOA 2QA2A 1SEZA 2EQ9A 1TDKA 1ZX9A 4OPDA 1ZMCA 2BXSA 4N9XA 5J60A 2WEUA 3DK4A 2YVJA 3SFDA 4U8LA 2YLTA 2YLXA 4H4YA 3ISHA 1JNRA 4FX9A 4J57A 1GERA 4DSGA 1B4VA 3NN0X 4D04A 3VRDB 3LZXA 3UKAA 2XVEA 1E1LA 4U2LA 4IA6A 3G5QA 3BNMA 3AD9B 2XFOA 2C76A 1BGNA 3UKLA 2X8GA 3AWIA 4TLZA 1JEHA 2OLNA 2C3DA 2GQWA 4H2QA 4U8NA 5HHFA 4AP3A 2VRLA 2PHHA 2XFQA 3KD9A 2C66A 3BHFA 2APGA 1IUWA 2XLUA 3M0OA 3H8LA 3NTAA 3RNMA 3AYJA 2E4GA 1E1NA 2BA9A 5U1OA 2B7RA 1IUVA 5L46A 1QJDA 1FCDA 1JU2A 1CJ3A 2C73A 3AE1A 3NK0X 3KPFA 3DMEA 2GAHB 2XFNA 3GWFA 2V60A 1GRGA 2Q0LA 1LTXR 1EL7A 1DOCA 1VQWA 1ZDLA 2ZZ0A 4CNKA 2GEWA 4USRA 4APNA 5C2TA 3AE3A 1ZOVA 4CNJA 4H4ZA 1REOA 4X9NA 3G5SA 3SFEA 2X8CA 1JNZA 5BUKA 2R4JA 5U63A 4A65A 3NIXA 3CNSA 4YXDA 2WBAA 1H83A 4IVMB 5JCIA 1LJ1A 4C3YA 2JB2A 1F8RA 3UP5A 2FJEA 3ALLA 3EANA 5EB4A 4H4RA 4JY3A 2H88A 2HQMA 3IF9A 3NK2X 3GMCA 4JNAA 3GD4A 3ZYXA 3UOXA 2YG6A 1NHSA 1V59A 3JSKA 3OC4A 4AT2A 1FL2A 4GDPA 1XDIA 1ZP0A 2Y6QA 2WOWA 1K0LA 4JY2A 4U8IA 5JCMA 2C70A 3BNUA 1OJDA 1GRBA 2QCUA 2AQJA 3D1CA 4Z44A 5M0ZA 1GTEA 3B6DA 4EIQA 4YSZA 1YQ3A 4Y4NA 1Q9IA 4H4XA 4Z25A 4A79A 1XHCA 1TRBA 3CNDA 2YAUA 3AE6A 1NHRA 3DJEA 4LU6A 1TDNA 4B67A 3NLCA 1KSSA 4U2TA 3LXDA 1IUTA 3SQPA 4B65A 1UKVG 4J2WA 4KX6A 4BK1A 4A6NB 1NENA 1F8SA 2Z5XA 1F3PA 1YY5A 3UKKA 3VRBA 5KWFA 3L1RA 1XANA 2XLPA 3EPTA 1Z6LA 3UOYA 2WETA 1GETA 1L0VA 3S5WA 4Z2RA 2BXRA 5BRTA 4J31A 3F8PA 4H2PA 2R0CA 2NVKX 3H4KA 1OJAA 2YG3A 3LJPA 3FMWA 5FS7A 1FECA 3R9UA 3REDA 3ZDNA 4C77A 3QFBA 1CBOA 4DGKA 2JB3A 3VR8A 1CJ2A 3P1WA 3PS9A 4UP3A 4H4UA 1OJTA 1GRTA 3OZ2A 4USQA 3NNEA 3AECA 2ARDA 4XXGA 4C5OA 4BV6A 4X4JA 1VG0A 4A7AA 2FBWA 4MJWA 1ZY8A 2E1MA 4NEVA 1FEAA 3UKPA 4TM0A 4Z2TA 5U25A 4U8PA 1HYUA 3UTGA 2A87A 1VRQB 3BI4A 3NTDA 1S2YA 4UDQA 1GESA 1BGJA 1NHPA 2C3CA 3GD3A 3P4QA 1Q1RA 4FDCB 4U8MA 3FG2P 5M10A 5FS6A 1PBFA 2BK3A 2XVFA 3D8XA 2WOIA 4K7ZA 1H7XA 2OLOA 1CF3A 2BC1A 1CC2A 5JCLA 1IUXA 2BS4A 1NPXA 3IWAA 4YTNA 4RG3A 1H81A 3AE4A 3AEBA 1H84A 4GRTA 2YLZA 1DOBA 4IV9A 1L9CA 2BABA 4WX1A 2A8XA 2CVJA 1NAAA 3AE9A 3V76A 2BS2A 3PO7A 3ADAB 5KOXA 2RGJA 4XWZA 2XFUA 1JOAA 3UOZA 4JDRA 3QFAA 3RP6A 2X3NA 1AOGA 2WPEA 4GDEA 4M52A 3P4SA 4UDPA 3NRNA 1CJ4A 1OJCA 1LQTA 2BACA 3CPHG 2YG7A 3VRAA 1LQUA 4E0VA 2V5ZA 4CBQA 1YKJA 1ZMDA 3O0HA 3CGBA 1GTHA 3CNTA 4RSLA 4JNQA 3UTFA 4K5SA 1F6MA 2VQ7A 4B63A 4EQXA 5IQ4A 1E1MA 1FOHA 1LV0A 5J7XA 2DKHA 3F8DA 4BK2A 3ATRA 4U8OA 3DK8A 5KOWA 2C72A 2Q7VA 3AEEA 2VQBA 1DJQA 1S3EA 2WPFA 4DSHA 1D5TA 2FJAA 4OPIA 3B3RA 4YKGA 2YVFA 3QVPA 4DNAA 1GALA 1NG3A 1NEKA 1XPQA 2VVLA 4ZN0A 2B76A 3K7QX 4NEWA 4B69A 4X9MA 2YR5A 2FJBA 3CGEA 4EM4A 1CL0A 2WDVA 1CC4A 4ZCCA 4EQWA 1GRFA 2GMJA 3FBSA 2Z5YA 3G5RA 4H2NA 3NN6X 1F8WA 4O5UA 1BKWA 1X31B 4YSHA 2V3BA 3DJJA 4H4SA 3P4PA 3ATQA 2C75A 3AD7B 3GSIA 1PJ6A 2XFPA 1B37A 3IHMA 1PBBA 4LIIA 4OCGA 4YTPA 3AYLA 1MOKA 5TR3A 1Y56A 1PDHA 3QSMA 1N4UA 1H82A 2ZZCA 3LZWA 1IUUA 2WP6A 3AEDA 2XCGA 2YVGA 2V61A 4OPLA 3WE0A 5JCNA 4JQ9A 1K4QA 5ER0A 1KNPA 1QO8A 1COYA 1GREA 4YWOA 2XDOA 4YSYA 3CNJA 2R9ZA 4I59A 3AE8A 2XLRA 1TDOA 2EQ7A 2GAGB 1DXLA 2OAMA 1D7YA 3DJGX 3NH3X 4FK1A 3VR9A 4Z24A 3UKHA 3L8KA 3DK9A 1VDCA 1NHQA 4GUVA 2YG5A 5EBKA 4IA5A 2YWLA 5HXIA 3K30A 1JRXA 3I6DA 3C4AA 2ACZA 3IC9A 3ICRA 3NT6A 4OPTA 1LPFA 3EF6A 4TLXA 4PABA 2FJDA 3RHAA 2YG4A 3EAOA 3KU9A 2GF3A 2QA1A 4J33A 3GYIA 5GSNA 2B9XA 3V3OA 5C3JA 3GRTA 3QSEA 1TYTA 2EQ8A 1H7WA 2WESA 5CKUA 1P2EA 4AT0A 2YQUA 4YKFA 1EL8A 2WDQA 4TM1A 5FMHA 4EQRA 3NG7X 4C74A 4TM4A 1BF3A 1E1KA 3BI2A 2CULA 1K0JA 1BZLA 2GR1A 3K7MX 3T37A 3CTYA 2X8HA 2AR8A 1S3BA 4B66A 4EMJA 3CGDA 2WOVA 2DKIA 2VVLG 1D4CA 4O5QA 1L9EA 1Y0PA 3C4NA 3NGCX 2X99A 4A5LA 4YTMA 5KVIA 3COXA 1QLBA 4U8JA 2GR0A 2GR3A 3AE5A 4CCRA 1GRAA 2GR2A 3FIMB 3F8RA 4REKA
chains in the Genus database with same CATH superfamily
1M6IA 3ICSA 4B1BA 3ICTA 2R45A 3AEAA 3CN8A 3KLJA 4AP1A 2GH5A 1TDFA 4OPUA 2RABA 3DH9A 1L9DA 2WS3A 1RYIA 2EQ6A 3DGHA 2BCPA 3E1TA 2IVEA 3T2KA 2YLSA 4H4TA 2OALA 3BHKA 4II3A 3C96A 2GMHA 5FS8A 5HY5A 4EQSA 4BK3A 4H7UA 2VZ2A 3AYIA 3T2YA 2BK4A 3UKFA 2C64A 1M64A 2ZBWA 4YT0A 3S61A 3M12A 4H2RA 3M13A 2XLSA 4IVOB 4K8DA 4II2A 1N1PA 2VVMA 2WU2A 2AAQA 4EMIA 5KXJA 3KKJA 2YM1A 3UCLA 5CQFA 1PJ7A 4GCMA 2BC0A 3HZLA 4BJYA 3GYXA 1JRYA 5FS9A 1PXCA 2JAEA 2I0ZA 1B8SA 4BJZA 3SY4A 3KA7A 4D03A 4NWZA 3CGCA 1PBCA 3RP8A 3UOVA 2WU5A 4AOSA 3ITJA 4G6HA 3SZFA 3DA1A 3GMBA 4EMWA 5LV9A 2V3AA 4EIPA 1IJHA 1D7LA 1PXBA 2BCGG 1GV4A 1GEUA 2V6OA 3DGZA 4LA1A 3UTHA 4J56A 3QJ4A 2QAEA 2WP9A 1O95A 4A99A 1CC6A 1KDGA 3KPKA 3T2ZA 4Z2UA 3AEGA 1OJ9A 2JK6A 4H4PA 4HA6A 4U8KA 1GOSA 4G9KA 4OPCA 2R0PA 5DBJA 1S2QA 4B64A 3UP4A 2IVDA 1E39A 1K0IA 1N4WA 2XVIA 1GT8A 5IQ1A 4A9WA 2R46A 3P9UA 3CPIG 1KFYA 4U2SA 2YLWA 1CHUA 4H4QA 3KVEA 2NPXA 3CIRA 4RG4A 5KRQA 1N4VA 2JBVA 1CJCA 1ZK7A 2F5ZA 3FPZA 4B68A 5KVHA 5HYMA 3T0KA 2H89A 1YQ4A 2J3NA 3AE7A 1GXFA 1TYPA 1ONFA 2BS3A 1RSGA 4H50A 5JCKA 1EBDA 4ADWA 1PHHA 2B7SA 2OA1A 4AOXA 3GWDA 3Q6JA 4ICYA 4PAAA 1H6VA 2C65A 3P4RA 4C3XA 2C67A 2R4EA 3CPJG 2WHDA 3NYEA 2YR4A 3QVRA 1MXTA 1GSNA 5IPYA 1TDEA 2TMDA 2GV8A 3K7TA 3PVCA 4GR1A 2A89A 3H8IA 2JKCA 2Q0KA 5EB5A 1O5WA 3GYJA 2B9WA 3I3LA 1Y56B 3UKQA 2Y6RA 1EL5A 4JN9A 1E7PA 2C7GA 3II4A 4P9SA 1GNDA 4J36A 3BI5A 4Y4MA 4WCTA 3Q9TA 4K5RA 4G74A 2ZZBA 4NZHA 1GPEA 4A6NA 2YR6A 3AB1A 2GQFA 4KPRA 3VQRA 4CCQA 5BULA 1KNRA 2WQYA 3DJDA 4BURA 1DODA 2PYXA 3T31A 4CRTA 3NK1X 3ABVA 3NHOX 4ECHA 2WPCA 4OPGA 3RP7A 3NKSA 1MO9A 3URHA 3SZ0A 3SGLA 1ELIA 2UZZA 4CY6A 4Z43A 1D4DA 5EOWA 3QSSA 1PS9A 2GRTA 4K2XA 3SZWA 1RP0A 1VG9A 4HB9A 1FEBA 1PJ5A 1KSUA 2BK5A 4Z26A 2VOUA 2YLRA 5BVAA 1Q1WA 2JB1A 3GDNA 4Y4LA 3AD8B 4UDRA 3GDPA 3HYXA 1IUSA 1PN0A 3AE2A 2WP5A 2CDUA 3SM8A 1JRZA 2XVHA 3AXBA 3LOVA 2E5VA 2XVJA 1DNCA 2VRMA 1E6EA 3IHGA 1NG4A 2RGHA 2W0HA 2O9ZA 3LB8A 4J34A 4H4VA 2R0GA 1EL9A 1GRHA 1DOEA 1B5QA 3ALJA 2X50A 2CFYA 4I58A 3UTEA 2YM2A 2WDRA 1P2HA 1PBEA 3GRSA 2Q6UA 2B9YA 4XWRA 3V3NA 4CY8A 2BYBA 1D4EA 1W4XA 2GB0A 3NYFA 1NDAA 2GVCA 1LVLA 4GF7A 2IIDA 4OVIA 1O94A 4NTDA 4FK1C 4K22A 4NTEA 4NNJA 5KNLA 3NYCA 3CNPA 3LADA 2XYOA 4H4WA 4TM3A 5GRTA 1KF6A 1YQZA 1ZOYA 2XLTA 4NTCA 4ZCDA 1BWCA 4YSXA 1ZKQA 1PXAA 3ALMA 3AEFA 1H86A 1PBDA 2TPRA 4EM3A 1DJNA 2RGOA 2QA2A 4G73A 1SEZA 2EQ9A 1TDKA 1ZX9A 4OPDA 1ZMCA 2BXSA 4N9XA 5J60A 2WEUA 3DK4A 2YVJA 3SFDA 4U8LA 2YLTA 2YLXA 4H4YA 3ISHA 1JNRA 4FX9A 4J57A 1GERA 4DSGA 1B4VA 3NN0X 4D04A 3VRDB 3LZXA 3UKAA 2XVEA 1E1LA 4U2LA 4IA6A 3G5QA 3BNMA 3AD9B 5KMRA 2XFOA 2C76A 1BGNA 3UKLA 2X8GA 3AWIA 4TLZA 1JEHA 2OLNA 2C3DA 2GQWA 4H2QA 4U8NA 5HHFA 4AP3A 2VRLA 2PHHA 2XFQA 3KD9A 2C66A 3BHFA 2APGA 1IUWA 2XLUA 3M0OA 3H8LA 3NTAA 3RNMA 3AYJA 2E4GA 1E1NA 2BA9A 5U1OA 2B7RA 1IUVA 5L46A 1QJDA 1FCDA 1JU2A 1CJ3A 2C73A 3AE1A 3NK0X 3KPFA 3DMEA 2GAHB 2XFNA 3GWFA 2V60A 1GRGA 2Q0LA 1LTXR 1EL7A 1DOCA 1VQWA 1ZDLA 2ZZ0A 4CNKA 2GEWA 4USRA 4APNA 5C2TA 3AE3A 1ZOVA 4CNJA 4H4ZA 1REOA 4GAVA 3G5SA 4X9NA 2X8CA 1JNZA 3SFEA 3SXIA 5BUKA 2R4JA 5U63A 4A65A 3NIXA 3CNSA 4YXDA 2WBAA 1H83A 4IVMB 5JCIA 1LJ1A 4C3YA 2JB2A 1F8RA 3UP5A 2FJEA 3ALLA 3EANA 5EB4A 4H4RA 4JY3A 2H88A 2HQMA 3IF9A 3NK2X 3GMCA 4JNAA 3GD4A 3ZYXA 3UOXA 2YG6A 1NHSA 1V59A 3JSKA 3OC4A 4AT2A 3SZCA 1FL2A 4GDPA 1XDIA 1ZP0A 2Y6QA 2WOWA 1K0LA 4JY2A 4U8IA 5JCMA 2C70A 3BNUA 1OJDA 1GRBA 2QCUA 2AQJA 3D1CA 4Z44A 5M0ZA 1GTEA 3B6DA 4EIQA 4YSZA 1YQ3A 4Y4NA 1Q9IA 4H4XA 4Z25A 4A79A 1XHCA 1TRBA 3CNDA 2YAUA 3AE6A 1NHRA 3DJEA 3HYVA 4LU6A 1TDNA 4B67A 3NLCA 1KSSA 4U2TA 3LXDA 3CMMA 1IUTA 3SQPA 4B65A 1UKVG 4J2WA 4KX6A 4BK1A 4A6NB 1NENA 1F8SA 2Z5XA 1F3PA 1YY5A 3UKKA 3VRBA 5KWFA 3L1RA 1XANA 2XLPA 3EPTA 1Z6LA 3UOYA 2WETA 1GETA 1L0VA 3S5WA 4Z2RA 2BXRA 5BRTA 4J31A 3F8PA 4H2PA 2R0CA 2NVKX 3H4KA 1OJAA 2YG3A 3LJPA 3FMWA 5FS7A 1FECA 3R9UA 3REDA 3ZDNA 4C77A 3QFBA 1CBOA 4DGKA 2JB3A 3VR8A 1CJ2A 3P1WA 3PS9A 4UP3A 4H4UA 1OJTA 1GRTA 3OZ2A 4USQA 3NNEA 3AECA 2ARDA 4XXGA 4C5OA 4BV6A 4X4JA 1VG0A 4A7AA 2FBWA 4MJWA 1ZY8A 2E1MA 4NEVA 1FEAA 3UKPA 4TM0A 4Z2TA 5U25A 4U8PA 1HYUA 3UTGA 2A87A 1VRQB 3BI4A 3NTDA 1S2YA 4UDQA 1GESA 1BGJA 1NHPA 2C3CA 3GD3A 3P4QA 1Q1RA 4FDCB 4U8MA 3FG2P 5M10A 5FS6A 1PBFA 2BK3A 2XVFA 3D8XA 2WOIA 4K7ZA 1H7XA 2OLOA 1CF3A 2BC1A 1CC2A 4G6GA 1IUXA 5JCLA 2BS4A 1NPXA 3IWAA 4YTNA 4RG3A 1H81A 3AE4A 3SYIA 3AEBA 1H84A 4GRTA 2YLZA 1DOBA 4IV9A 1L9CA 2BABA 4WX1A 2A8XA 2CVJA 2C4CA 1NAAA 3AE9A 3V76A 2BS2A 3PO7A 3ADAB 5KOXA 2RGJA 4XWZA 2XFUA 1JOAA 3SX6A 3UOZA 4JDRA 3QFAA 3RP6A 2X3NA 1AOGA 2WPEA 4GDEA 4M52A 3P4SA 4UDPA 3NRNA 1CJ4A 1OJCA 1LQTA 2BACA 3CPHG 2YG7A 3VRAA 1LQUA 4E0VA 2V5ZA 4CBQA 1YKJA 1ZMDA 3O0HA 3CGBA 1GTHA 3CNTA 4RSLA 4JNQA 3UTFA 4K5SA 1F6MA 2VQ7A 4B63A 4EQXA 5IQ4A 1E1MA 1FOHA 4GAPA 1LV0A 5J7XA 2DKHA 3F8DA 4BK2A 3ATRA 4U8OA 3HYWA 3T14A 3DK8A 5KOWA 2C72A 2Q7VA 3AEEA 2VQBA 1DJQA 1S3EA 2WPFA 4DSHA 1D5TA 2FJAA 4OPIA 2BRAA 3B3RA 2BRYA 4YKGA 2YVFA 3QVPA 4DNAA 1GALA 1NG3A 1NEKA 1XPQA 2VVLA 4ZN0A 2B76A 3K7QX 4NEWA 4B69A 4X9MA 2YR5A 2FJBA 3CGEA 4EM4A 1CL0A 2WDVA 1CC4A 4ZCCA 4EQWA 1GRFA 2GMJA 3FBSA 2Z5YA 3G5RA 4H2NA 3NN6X 1F8WA 4O5UA 1BKWA 1X31B 4YSHA 2V3BA 3DJJA 4H4SA 3P4PA 3ATQA 2C75A 3AD7B 3GSIA 1PJ6A 2XFPA 1B37A 3IHMA 1PBBA 4LIIA 4OCGA 4YTPA 3AYLA 1MOKA 5TR3A 1Y56A 1PDHA 3QSMA 1N4UA 1H82A 2ZZCA 3LZWA 1IUUA 2WP6A 3AEDA 2XCGA 2YVGA 2V61A 4OPLA 3WE0A 5JCNA 4JQ9A 1K4QA 5ER0A 1KNPA 1QO8A 1COYA 1GREA 4YWOA 2XDOA 4YSYA 3CNJA 2R9ZA 4I59A 3AE8A 2XLRA 1TDOA 5KMQA 5KMPA 2EQ7A 2GAGB 1DXLA 2OAMA 1D7YA 3DJGX 3NH3X 4FK1A 3VR9A 4Z24A 3UKHA 3L8KA 3DK9A 1VDCA 1NHQA 4GUVA 2YG5A 5EBKA 5KMSA 4IA5A 2YWLA 5HXIA 3K30A 1JRXA 3I6DA 3C4AA 2ACZA 3IC9A 3ICRA 3NT6A 4OPTA 1LPFA 3EF6A 4TLXA 4PABA 2FJDA 3RHAA 2YG4A 3EAOA 3KU9A 2GF3A 2QA1A 4J33A 3GYIA 5GSNA 2B9XA 3V3OA 5C3JA 3GRTA 3QSEA 1TYTA 2EQ8A 1H7WA 2WESA 5CKUA 1P2EA 4AT0A 2YQUA 4YKFA 1EL8A 2WDQA 4TM1A 5FMHA 4EQRA 3NG7X 4C74A 4TM4A 1BF3A 1E1KA 3BI2A 2CULA 1K0JA 1BZLA 2GR1A 3K7MX 3T37A 3CTYA 2X8HA 2AR8A 1S3BA 4B66A 4EMJA 3CGDA 2WOVA 2DKIA 2VVLG 1D4CA 4O5QA 1L9EA 1Y0PA 3C4NA 3NGCX 2X99A 4A5LA 4YTMA 5KVIA 3COXA 1QLBA 4U8JA 2GR0A 2GR3A 3AE5A 4CCRA 1GRAA 2GR2A 3FIMB 3F8RA 4REKA
chains in the Genus database with same CATH topology
1M6IA 3ICSA 4B1BA 3ICTA 2R45A 3AEAA 3CN8A 3KLJA 4AP1A 2GH5A 1TDFA 4OPUA 2RABA 3DH9A 1L9DA 2WS3A 1RYIA 2EQ6A 3DGHA 2BCPA 3E1TA 2IVEA 3T2KA 2YLSA 4H4TA 2OALA 3BHKA 4II3A 3C96A 2GMHA 5FS8A 5HY5A 4EQSA 4BK3A 4H7UA 2VZ2A 3AYIA 3T2YA 2BK4A 3UKFA 2C64A 1M64A 2ZBWA 4YT0A 3S61A 3M12A 4H2RA 3M13A 2XLSA 4IVOB 4K8DA 4II2A 1N1PA 2VVMA 2WU2A 2AAQA 4EMIA 5KXJA 3KKJA 2YM1A 3UCLA 5CQFA 1PJ7A 4GCMA 2BC0A 3HZLA 4BJYA 3GYXA 1JRYA 5FS9A 1PXCA 2JAEA 2I0ZA 1B8SA 4BJZA 3SY4A 3KA7A 4D03A 4NWZA 3CGCA 1PBCA 3RP8A 3UOVA 2WU5A 4AOSA 3ITJA 4G6HA 3SZFA 3DA1A 3GMBA 4EMWA 5LV9A 2V3AA 4EIPA 1IJHA 1D7LA 1PXBA 2BCGG 1GV4A 1GEUA 2V6OA 3DGZA 4LA1A 3UTHA 4J56A 3QJ4A 2QAEA 2WP9A 1O95A 4A99A 1CC6A 1KDGA 3KPKA 3T2ZA 4Z2UA 3AEGA 1OJ9A 2JK6A 4H4PA 4HA6A 4U8KA 1GOSA 4G9KA 4OPCA 2R0PA 5DBJA 1S2QA 4B64A 3UP4A 2IVDA 1E39A 1K0IA 1N4WA 2XVIA 1GT8A 5IQ1A 4A9WA 2R46A 3P9UA 3CPIG 1KFYA 4U2SA 2YLWA 1CHUA 4H4QA 3KVEA 2NPXA 3CIRA 4RG4A 5KRQA 1N4VA 2JBVA 1CJCA 1ZK7A 2F5ZA 3FPZA 4B68A 5KVHA 5HYMA 3T0KA 2H89A 1YQ4A 2J3NA 3AE7A 1GXFA 1TYPA 1ONFA 2BS3A 1RSGA 4H50A 5JCKA 1EBDA 4ADWA 1PHHA 2B7SA 2OA1A 4AOXA 3GWDA 3Q6JA 4ICYA 4PAAA 1H6VA 2C65A 3P4RA 4C3XA 2C67A 2R4EA 3CPJG 2WHDA 3NYEA 2YR4A 3QVRA 1MXTA 1GSNA 5IPYA 1TDEA 2TMDA 2GV8A 3K7TA 3PVCA 4GR1A 2A89A 3H8IA 2JKCA 2Q0KA 5EB5A 1O5WA 3GYJA 2B9WA 3I3LA 1Y56B 3UKQA 2Y6RA 1EL5A 4JN9A 1E7PA 2C7GA 3II4A 4P9SA 1GNDA 4J36A 3BI5A 4Y4MA 4WCTA 3Q9TA 4K5RA 4G74A 2ZZBA 4NZHA 1GPEA 4A6NA 2YR6A 3AB1A 2GQFA 4KPRA 3VQRA 4CCQA 5BULA 1KNRA 2WQYA 3DJDA 4BURA 1DODA 2PYXA 3T31A 4CRTA 3NK1X 3ABVA 3NHOX 4ECHA 2WPCA 4OPGA 3RP7A 3NKSA 1MO9A 3URHA 3SZ0A 3SGLA 1ELIA 2UZZA 4CY6A 4Z43A 1D4DA 5EOWA 3QSSA 1PS9A 2GRTA 4K2XA 3SZWA 1RP0A 1VG9A 4HB9A 1FEBA 1PJ5A 1KSUA 2BK5A 4Z26A 2VOUA 2YLRA 5BVAA 1Q1WA 2JB1A 3GDNA 4Y4LA 3AD8B 4UDRA 3GDPA 3HYXA 1IUSA 1PN0A 3AE2A 2WP5A 2CDUA 3SM8A 1JRZA 2XVHA 3AXBA 3LOVA 2E5VA 2XVJA 1DNCA 2VRMA 1E6EA 3IHGA 1NG4A 2RGHA 2W0HA 2O9ZA 3LB8A 4J34A 4H4VA 2R0GA 1EL9A 1GRHA 1DOEA 1B5QA 3ALJA 2X50A 2CFYA 4I58A 3UTEA 2YM2A 2WDRA 1P2HA 1PBEA 3GRSA 2Q6UA 2B9YA 4XWRA 3V3NA 4CY8A 2BYBA 1D4EA 1W4XA 2GB0A 3NYFA 1NDAA 2GVCA 1LVLA 4GF7A 2IIDA 4OVIA 1O94A 4NTDA 4FK1C 4K22A 4NTEA 4NNJA 5KNLA 3NYCA 3CNPA 3LADA 2XYOA 4H4WA 4TM3A 5GRTA 1KF6A 1YQZA 1ZOYA 2XLTA 4NTCA 4ZCDA 1BWCA 4YSXA 1ZKQA 1PXAA 3ALMA 3AEFA 1H86A 1PBDA 2TPRA 4EM3A 1DJNA 2RGOA 2QA2A 4G73A 1SEZA 2EQ9A 1TDKA 1ZX9A 4OPDA 1ZMCA 2BXSA 4N9XA 5J60A 2WEUA 3DK4A 2YVJA 3SFDA 4U8LA 2YLTA 2YLXA 4H4YA 3ISHA 1JNRA 4FX9A 4J57A 1GERA 4DSGA 1B4VA 3NN0X 4D04A 3VRDB 3LZXA 3UKAA 2XVEA 1E1LA 4U2LA 4IA6A 3G5QA 3BNMA 3AD9B 5KMRA 2XFOA 2C76A 1BGNA 3UKLA 2X8GA 3AWIA 4TLZA 1JEHA 2OLNA 2C3DA 2GQWA 4H2QA 4U8NA 5HHFA 4AP3A 2VRLA 2PHHA 2XFQA 3KD9A 2C66A 3BHFA 2APGA 1IUWA 2XLUA 3M0OA 3H8LA 3NTAA 3RNMA 3AYJA 2E4GA 1E1NA 2BA9A 5U1OA 2B7RA 1IUVA 5L46A 1QJDA 1FCDA 1JU2A 1CJ3A 2C73A 3AE1A 3NK0X 3KPFA 3DMEA 2GAHB 2XFNA 3GWFA 2V60A 1GRGA 2Q0LA 1LTXR 1EL7A 1DOCA 1VQWA 1ZDLA 2ZZ0A 4CNKA 2GEWA 4USRA 4APNA 5C2TA 3AE3A 1ZOVA 4CNJA 4H4ZA 1REOA 4GAVA 3G5SA 4X9NA 2X8CA 1JNZA 3SFEA 3SXIA 5BUKA 2R4JA 5U63A 4A65A 3NIXA 3CNSA 4YXDA 2WBAA 1H83A 4IVMB 5JCIA 1LJ1A 4C3YA 2JB2A 1F8RA 3UP5A 2FJEA 3ALLA 3EANA 5EB4A 4H4RA 4JY3A 2H88A 2HQMA 3IF9A 3NK2X 3GMCA 4JNAA 3GD4A 3ZYXA 3UOXA 2YG6A 1NHSA 1V59A 3JSKA 3OC4A 4AT2A 3SZCA 1FL2A 4GDPA 1XDIA 1ZP0A 2Y6QA 2WOWA 1K0LA 4JY2A 4U8IA 5JCMA 2C70A 3BNUA 1OJDA 1GRBA 2QCUA 2AQJA 3D1CA 4Z44A 5M0ZA 1GTEA 3B6DA 4EIQA 4YSZA 1YQ3A 4Y4NA 1Q9IA 4H4XA 4Z25A 4A79A 1XHCA 1TRBA 3CNDA 2YAUA 3AE6A 1NHRA 3DJEA 3HYVA 4LU6A 1TDNA 4B67A 3NLCA 1KSSA 4U2TA 3LXDA 3CMMA 1IUTA 3SQPA 4B65A 1UKVG 4J2WA 4KX6A 4BK1A 4A6NB 1NENA 1F8SA 2Z5XA 1F3PA 1YY5A 3UKKA 3VRBA 5KWFA 3L1RA 1XANA 2XLPA 3EPTA 1Z6LA 3UOYA 2WETA 1GETA 1L0VA 3S5WA 4Z2RA 2BXRA 5BRTA 4J31A 3F8PA 4H2PA 2R0CA 2NVKX 3H4KA 1OJAA 2YG3A 3LJPA 3FMWA 5FS7A 1FECA 3R9UA 3REDA 3ZDNA 4C77A 3QFBA 1CBOA 4DGKA 2JB3A 3VR8A 1CJ2A 3P1WA 3PS9A 4UP3A 4H4UA 1OJTA 1GRTA 3OZ2A 4USQA 3NNEA 3AECA 2ARDA 4XXGA 4C5OA 4BV6A 4X4JA 1VG0A 4A7AA 2FBWA 4MJWA 1ZY8A 2E1MA 4NEVA 1FEAA 3UKPA 4TM0A 4Z2TA 5U25A 4U8PA 1HYUA 3UTGA 2A87A 1VRQB 3BI4A 3NTDA 1S2YA 4UDQA 1GESA 1BGJA 1NHPA 2C3CA 3GD3A 3P4QA 1Q1RA 4FDCB 4U8MA 3FG2P 5M10A 5FS6A 1PBFA 2BK3A 2XVFA 3D8XA 2WOIA 4K7ZA 1H7XA 2OLOA 1CF3A 2BC1A 1CC2A 4G6GA 1IUXA 5JCLA 2BS4A 1NPXA 3IWAA 4YTNA 4RG3A 1H81A 3AE4A 3SYIA 3AEBA 1H84A 4GRTA 2YLZA 1DOBA 4IV9A 1L9CA 2BABA 4WX1A 2A8XA 2CVJA 2C4CA 1NAAA 3AE9A 3V76A 2BS2A 3PO7A 3ADAB 5KOXA 2RGJA 4XWZA 2XFUA 1JOAA 3SX6A 3UOZA 4JDRA 3QFAA 3RP6A 2X3NA 1AOGA 2WPEA 4GDEA 4M52A 3P4SA 4UDPA 3NRNA 1CJ4A 1OJCA 1LQTA 2BACA 3CPHG 2YG7A 3VRAA 1LQUA 4E0VA 2V5ZA 4CBQA 1YKJA 1ZMDA 3O0HA 3CGBA 1GTHA 3CNTA 4RSLA 4JNQA 3UTFA 4K5SA 1F6MA 2VQ7A 4B63A 4EQXA 5IQ4A 1E1MA 1FOHA 4GAPA 1LV0A 5J7XA 2DKHA 3F8DA 4BK2A 3ATRA 4U8OA 3HYWA 3T14A 3DK8A 5KOWA 2C72A 2Q7VA 3AEEA 2VQBA 1DJQA 1S3EA 2WPFA 4DSHA 1D5TA 2FJAA 4OPIA 2BRAA 3B3RA 2BRYA 4YKGA 2YVFA 3QVPA 4DNAA 1GALA 1NG3A 1NEKA 1XPQA 2VVLA 4ZN0A 2B76A 3K7QX 4NEWA 4B69A 4X9MA 2YR5A 2FJBA 3CGEA 4EM4A 1CL0A 2WDVA 1CC4A 4ZCCA 4EQWA 1GRFA 2GMJA 3FBSA 2Z5YA 3G5RA 4H2NA 3NN6X 1F8WA 4O5UA 1BKWA 1X31B 4YSHA 2V3BA 3DJJA 4H4SA 3P4PA 3ATQA 2C75A 3AD7B 3GSIA 1PJ6A 2XFPA 1B37A 3IHMA 1PBBA 4LIIA 4OCGA 4YTPA 3AYLA 1MOKA 5TR3A 1Y56A 1PDHA 3QSMA 1N4UA 1H82A 2ZZCA 3LZWA 1IUUA 2WP6A 3AEDA 2XCGA 2YVGA 2V61A 4OPLA 3WE0A 5JCNA 4JQ9A 1K4QA 5ER0A 1KNPA 1QO8A 1COYA 1GREA 4YWOA 2XDOA 4YSYA 3CNJA 2R9ZA 4I59A 3AE8A 2XLRA 1TDOA 5KMQA 5KMPA 2EQ7A 2GAGB 1DXLA 2OAMA 1D7YA 3DJGX 3NH3X 4FK1A 3VR9A 4Z24A 3UKHA 3L8KA 3DK9A 1VDCA 1NHQA 4GUVA 2YG5A 5EBKA 5KMSA 4IA5A 2YWLA 5HXIA 3K30A 1JRXA 3I6DA 3C4AA 2ACZA 3IC9A 3ICRA 3NT6A 4OPTA 1LPFA 3EF6A 4TLXA 4PABA 2FJDA 3RHAA 2YG4A 3EAOA 3KU9A 2GF3A 2QA1A 4J33A 3GYIA 5GSNA 2B9XA 3V3OA 5C3JA 3GRTA 3QSEA 1TYTA 2EQ8A 1H7WA 2WESA 5CKUA 1P2EA 4AT0A 2YQUA 4YKFA 1EL8A 2WDQA 4TM1A 5FMHA 4EQRA 3NG7X 4C74A 4TM4A 1BF3A 1E1KA 3BI2A 2CULA 1K0JA 1BZLA 2GR1A 3K7MX 3T37A 3CTYA 2X8HA 2AR8A 1S3BA 4B66A 4EMJA 3CGDA 2WOVA 2DKIA 2VVLG 1D4CA 4O5QA 1L9EA 1Y0PA 3C4NA 3NGCX 2X99A 4A5LA 4YTMA 5KVIA 3COXA 1QLBA 4U8JA 2GR0A 2GR3A 3AE5A 4CCRA 1GRAA 2GR2A 3FIMB 3F8RA 4REKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M6I A;  3ICS A;  4B1B A;  3ICT A;  2R45 A;  3AEA A;  3CN8 A;  3KLJ A;  4AP1 A;  2GH5 A;  1TDF A;  4OPU A;  2RAB A;  3DH9 A;  1L9D A;  2WS3 A;  1RYI A;  2EQ6 A;  3DGH A;  2BCP A;  3E1T A;  2IVE A;  2YLS A;  4H4T A;  2OAL A;  3BHK A;  3C96 A;  2GMH A;  5FS8 A;  5HY5 A;  4EQS A;  4BK3 A;  4H7U A;  2VZ2 A;  3AYI A;  2BK4 A;  3UKF A;  2C64 A;  1M64 A;  2ZBW A;  4YT0 A;  3S61 A;  3M12 A;  4H2R A;  3M13 A;  2XLS A;  4IVO B;  4K8D A;  1N1P A;  2VVM A;  2WU2 A;  2AAQ A;  4EMI A;  5KXJ A;  3KKJ A;  2YM1 A;  3UCL A;  5CQF A;  1PJ7 A;  4GCM A;  2BC0 A;  3HZL A;  4BJY A;  5FS9 A;  1JRY A;  1PXC A;  2JAE A;  2I0Z A;  1B8S A;  4BJZ A;  4D03 A;  3KA7 A;  3CGC A;  1PBC A;  3RP8 A;  3UOV A;  2WU5 A;  4AOS A;  3ITJ A;  3DA1 A;  3GMB A;  4EMW A;  5LV9 A;  2V3A A;  4EIP A;  1IJH A;  1D7L A;  1PXB A;  2BCG G;  1GV4 A;  1GEU A;  2V6O A;  3DGZ A;  4LA1 A;  3UTH A;  4J56 A;  3QJ4 A;  2QAE A;  2WP9 A;  1O95 A;  4A99 A;  1CC6 A;  1KDG A;  4Z2U A;  3AEG A;  1OJ9 A;  2JK6 A;  4H4P A;  4HA6 A;  4U8K A;  1GOS A;  4OPC A;  5DBJ A;  2R0P A;  1S2Q A;  4B64 A;  3UP4 A;  2IVD A;  1E39 A;  1K0I A;  1N4W A;  2XVI A;  1GT8 A;  5IQ1 A;  4A9W A;  2R46 A;  3P9U A;  3CPI G;  1KFY A;  4U2S A;  2YLW A;  1CHU A;  4H4Q A;  3KVE A;  2NPX A;  3CIR A;  4RG4 A;  5KRQ A;  1N4V A;  2JBV A;  1CJC A;  1ZK7 A;  2F5Z A;  3FPZ A;  4B68 A;  5KVH A;  5HYM A;  2H89 A;  1YQ4 A;  2J3N A;  3AE7 A;  1GXF A;  1TYP A;  1ONF A;  2BS3 A;  1RSG A;  4H50 A;  5JCK A;  1EBD A;  4ADW A;  1PHH A;  2B7S A;  2OA1 A;  4AOX A;  3GWD A;  3Q6J A;  4ICY A;  4PAA A;  1H6V A;  2C65 A;  3P4R A;  4C3X A;  2C67 A;  2R4E A;  3CPJ G;  2WHD A;  3NYE A;  2YR4 A;  3QVR A;  1MXT A;  1GSN A;  5IPY A;  1TDE A;  2TMD A;  2GV8 A;  3K7T A;  3PVC A;  4GR1 A;  2A89 A;  3H8I A;  2JKC A;  2Q0K A;  5EB5 A;  1O5W A;  3GYJ A;  2B9W A;  3I3L A;  1Y56 B;  3UKQ A;  2Y6R A;  1EL5 A;  4JN9 A;  1E7P A;  2C7G A;  3II4 A;  4P9S A;  1GND A;  4J36 A;  3BI5 A;  4Y4M A;  4WCT A;  3Q9T A;  4K5R A;  2ZZB A;  4NZH A;  1GPE A;  4A6N A;  2YR6 A;  3AB1 A;  2GQF A;  4KPR A;  3VQR A;  4CCQ A;  5BUL A;  1KNR A;  2WQY A;  3DJD A;  4BUR A;  1DOD A;  2PYX A;  4CRT A;  3NK1 X;  3ABV A;  3NHO X;  4ECH A;  2WPC A;  4OPG A;  3RP7 A;  3NKS A;  1MO9 A;  3URH A;  3SGL A;  1ELI A;  2UZZ A;  4CY6 A;  4Z43 A;  1D4D A;  5EOW A;  3QSS A;  1PS9 A;  2GRT A;  4K2X A;  1RP0 A;  1VG9 A;  4HB9 A;  1FEB A;  1PJ5 A;  1KSU A;  2BK5 A;  4Z26 A;  2VOU A;  2YLR A;  5BVA A;  1Q1W A;  2JB1 A;  3GDN A;  4Y4L A;  3AD8 B;  4UDR A;  3GDP A;  1IUS A;  1PN0 A;  3AE2 A;  2WP5 A;  2CDU A;  3SM8 A;  1JRZ A;  2XVH A;  3AXB A;  3LOV A;  2E5V A;  2XVJ A;  1DNC A;  2VRM A;  1E6E A;  3IHG A;  1NG4 A;  2RGH A;  2W0H A;  2O9Z A;  3LB8 A;  4J34 A;  4H4V A;  2R0G A;  1EL9 A;  1GRH A;  1DOE A;  1B5Q A;  3ALJ A;  2X50 A;  2CFY A;  4I58 A;  3UTE A;  2YM2 A;  2WDR A;  1P2H A;  1PBE A;  3GRS A;  2Q6U A;  2B9Y A;  4XWR A;  3V3N A;  4CY8 A;  2BYB A;  1D4E A;  1W4X A;  2GB0 A;  3NYF A;  1NDA A;  2GVC A;  1LVL A;  4GF7 A;  2IID A;  4OVI A;  1O94 A;  4NTD A;  4FK1 C;  4K22 A;  4NTE A;  3NYC A;  3CNP A;  3LAD A;  2XYO A;  4H4W A;  4TM3 A;  5GRT A;  1KF6 A;  1YQZ A;  1ZOY A;  2XLT A;  4NTC A;  4ZCD A;  1BWC A;  4YSX A;  1ZKQ A;  1PXA A;  3ALM A;  3AEF A;  1H86 A;  1PBD A;  2TPR A;  4EM3 A;  1DJN A;  2RGO A;  2QA2 A;  1SEZ A;  2EQ9 A;  1TDK A;  1ZX9 A;  4OPD A;  1ZMC A;  2BXS A;  4N9X A;  5J60 A;  2WEU A;  3DK4 A;  2YVJ A;  3SFD A;  4U8L A;  2YLT A;  2YLX A;  4H4Y A;  3ISH A;  1JNR A;  4FX9 A;  4J57 A;  1GER A;  4DSG A;  1B4V A;  3NN0 X;  4D04 A;  3VRD B;  3LZX A;  3UKA A;  2XVE A;  1E1L A;  4U2L A;  4IA6 A;  3G5Q A;  3BNM A;  3AD9 B;  2XFO A;  2C76 A;  1BGN A;  3UKL A;  2X8G A;  3AWI A;  4TLZ A;  1JEH A;  2OLN A;  2C3D A;  2GQW A;  4H2Q A;  4U8N A;  5HHF A;  4AP3 A;  2VRL A;  2PHH A;  2XFQ A;  3KD9 A;  2C66 A;  3BHF A;  2APG A;  1IUW A;  2XLU A;  3M0O A;  3H8L A;  3NTA A;  3RNM A;  3AYJ A;  2E4G A;  1E1N A;  2BA9 A;  5U1O A;  2B7R A;  1IUV A;  5L46 A;  1QJD A;  1FCD A;  1JU2 A;  1CJ3 A;  2C73 A;  3AE1 A;  3NK0 X;  3KPF A;  3DME A;  2GAH B;  2XFN A;  3GWF A;  2V60 A;  1GRG A;  2Q0L A;  1LTX R;  1EL7 A;  1DOC A;  1VQW A;  1ZDL A;  2ZZ0 A;  4CNK A;  2GEW A;  4USR A;  4APN A;  5C2T A;  3AE3 A;  1ZOV A;  4CNJ A;  4H4Z A;  1REO A;  4X9N A;  3G5S A;  3SFE A;  2X8C A;  1JNZ A;  5BUK A;  2R4J A;  5U63 A;  4A65 A;  3NIX A;  3CNS A;  4YXD A;  2WBA A;  1H83 A;  4IVM B;  5JCI A;  1LJ1 A;  4C3Y A;  2JB2 A;  1F8R A;  3UP5 A;  2FJE A;  3ALL A;  3EAN A;  5EB4 A;  4H4R A;  4JY3 A;  2H88 A;  2HQM A;  3IF9 A;  3NK2 X;  3GMC A;  4JNA A;  3GD4 A;  3ZYX A;  3UOX A;  2YG6 A;  1NHS A;  1V59 A;  3JSK A;  3OC4 A;  4AT2 A;  1FL2 A;  4GDP A;  1XDI A;  1ZP0 A;  2Y6Q A;  2WOW A;  1K0L A;  4JY2 A;  4U8I A;  5JCM A;  2C70 A;  3BNU A;  1OJD A;  1GRB A;  2QCU A;  2AQJ A;  3D1C A;  4Z44 A;  5M0Z A;  1GTE A;  3B6D A;  4EIQ A;  4YSZ A;  1YQ3 A;  4Y4N A;  1Q9I A;  4H4X A;  4Z25 A;  4A79 A;  1XHC A;  1TRB A;  3CND A;  2YAU A;  3AE6 A;  1NHR A;  3DJE A;  4LU6 A;  1TDN A;  4B67 A;  3NLC A;  1KSS A;  4U2T A;  3LXD A;  1IUT A;  3SQP A;  4B65 A;  1UKV G;  4J2W A;  4KX6 A;  4BK1 A;  4A6N B;  1NEN A;  1F8S A;  2Z5X A;  1F3P A;  1YY5 A;  3UKK A;  3VRB A;  5KWF A;  3L1R A;  1XAN A;  2XLP A;  3EPT A;  1Z6L A;  3UOY A;  2WET A;  1GET A;  1L0V A;  3S5W A;  4Z2R A;  2BXR A;  5BRT A;  4J31 A;  3F8P A;  4H2P A;  2R0C A;  2NVK X;  3H4K A;  1OJA A;  2YG3 A;  3LJP A;  3FMW A;  5FS7 A;  1FEC A;  3R9U A;  3RED A;  3ZDN A;  4C77 A;  3QFB A;  1CBO A;  4DGK A;  2JB3 A;  3VR8 A;  1CJ2 A;  3P1W A;  3PS9 A;  4UP3 A;  4H4U A;  1OJT A;  1GRT A;  3OZ2 A;  4USQ A;  3NNE A;  3AEC A;  2ARD A;  4XXG A;  4C5O A;  4BV6 A;  4X4J A;  1VG0 A;  4A7A A;  2FBW A;  4MJW A;  1ZY8 A;  2E1M A;  4NEV A;  1FEA A;  3UKP A;  4TM0 A;  4Z2T A;  5U25 A;  4U8P A;  1HYU A;  3UTG A;  2A87 A;  1VRQ B;  3BI4 A;  3NTD A;  1S2Y A;  4UDQ A;  1GES A;  1BGJ A;  1NHP A;  2C3C A;  3GD3 A;  3P4Q A;  1Q1R A;  4FDC B;  4U8M A;  3FG2 P;  5M10 A;  5FS6 A;  1PBF A;  2BK3 A;  2XVF A;  3D8X A;  2WOI A;  4K7Z A;  1H7X A;  2OLO A;  1CF3 A;  2BC1 A;  1CC2 A;  5JCL A;  1IUX A;  2BS4 A;  1NPX A;  3IWA A;  4YTN A;  4RG3 A;  1H81 A;  3AE4 A;  3AEB A;  1H84 A;  4GRT A;  2YLZ A;  1DOB A;  4IV9 A;  1L9C A;  2BAB A;  4WX1 A;  2A8X A;  2CVJ A;  1NAA A;  3AE9 A;  3V76 A;  2BS2 A;  3PO7 A;  3ADA B;  5KOX A;  2RGJ A;  4XWZ A;  2XFU A;  1JOA A;  3UOZ A;  4JDR A;  3QFA A;  3RP6 A;  2X3N A;  1AOG A;  2WPE A;  4GDE A;  4M52 A;  3P4S A;  4UDP A;  3NRN A;  1CJ4 A;  1OJC A;  1LQT A;  2BAC A;  3CPH G;  2YG7 A;  3VRA A;  1LQU A;  4E0V A;  2V5Z A;  4CBQ A;  1YKJ A;  1ZMD A;  3O0H A;  3CGB A;  1GTH A;  3CNT A;  4RSL A;  4JNQ A;  3UTF A;  4K5S A;  1F6M A;  2VQ7 A;  4B63 A;  4EQX A;  5IQ4 A;  1E1M A;  1FOH A;  1LV0 A;  5J7X A;  2DKH A;  3F8D A;  4BK2 A;  3ATR A;  4U8O A;  3DK8 A;  5KOW A;  2C72 A;  2Q7V A;  3AEE A;  2VQB A;  1DJQ A;  1S3E A;  2WPF A;  4DSH A;  1D5T A;  2FJA A;  4OPI A;  3B3R A;  4YKG A;  2YVF A;  3QVP A;  4DNA A;  1GAL A;  1NG3 A;  1NEK A;  1XPQ A;  2VVL A;  4ZN0 A;  2B76 A;  3K7Q X;  4NEW A;  4B69 A;  4X9M A;  2YR5 A;  2FJB A;  3CGE A;  4EM4 A;  1CL0 A;  2WDV A;  1CC4 A;  4ZCC A;  4EQW A;  1GRF A;  2GMJ A;  3FBS A;  2Z5Y A;  3G5R A;  4H2N A;  3NN6 X;  1F8W A;  4O5U A;  1BKW A;  1X31 B;  4YSH A;  2V3B A;  3DJJ A;  4H4S A;  3P4P A;  3ATQ A;  2C75 A;  3AD7 B;  3GSI A;  1PJ6 A;  2XFP A;  1B37 A;  3IHM A;  1PBB A;  4LII A;  4OCG A;  4YTP A;  3AYL A;  1MOK A;  5TR3 A;  1Y56 A;  1PDH A;  3QSM A;  1N4U A;  1H82 A;  2ZZC A;  3LZW A;  1IUU A;  2WP6 A;  3AED A;  2XCG A;  2YVG A;  2V61 A;  4OPL A;  3WE0 A;  5JCN A;  4JQ9 A;  1K4Q A;  5ER0 A;  1KNP A;  1QO8 A;  1COY A;  1GRE A;  4YWO A;  2XDO A;  4YSY A;  3CNJ A;  2R9Z A;  4I59 A;  3AE8 A;  2XLR A;  1TDO A;  2EQ7 A;  2GAG B;  1DXL A;  2OAM A;  1D7Y A;  3DJG X;  3NH3 X;  4FK1 A;  3VR9 A;  4Z24 A;  3UKH A;  3L8K A;  3DK9 A;  1VDC A;  1NHQ A;  4GUV A;  2YG5 A;  5EBK A;  4IA5 A;  2YWL A;  5HXI A;  3K30 A;  1JRX A;  3I6D A;  3C4A A;  2ACZ A;  3IC9 A;  3ICR A;  3NT6 A;  4OPT A;  1LPF A;  3EF6 A;  4TLX A;  4PAB A;  2FJD A;  3RHA A;  2YG4 A;  3EAO A;  3KU9 A;  2GF3 A;  2QA1 A;  4J33 A;  3GYI A;  5GSN A;  2B9X A;  3V3O A;  5C3J A;  3GRT A;  3QSE A;  1TYT A;  2EQ8 A;  1H7W A;  2WES A;  5CKU A;  1P2E A;  4AT0 A;  2YQU A;  4YKF A;  1EL8 A;  2WDQ A;  4TM1 A;  5FMH A;  4EQR A;  3NG7 X;  4C74 A;  4TM4 A;  1BF3 A;  1E1K A;  3BI2 A;  2CUL A;  1K0J A;  1BZL A;  2GR1 A;  3K7M X;  3T37 A;  3CTY A;  2X8H A;  2AR8 A;  1S3B A;  4B66 A;  4EMJ A;  3CGD A;  2WOV A;  2DKI A;  2VVL G;  1D4C A;  4O5Q A;  1L9E A;  1Y0P A;  3C4N A;  3NGC X;  2X99 A;  4A5L A;  4YTM A;  5KVI A;  3COX A;  1QLB A;  4U8J A;  2GR0 A;  2GR3 A;  3AE5 A;  4CCR A;  1GRA A;  2GR2 A;  3FIM B;  3F8R A;  4REK A; 
#chains in the Genus database with same CATH topology
 1M6I A;  3ICS A;  4B1B A;  3ICT A;  2R45 A;  3AEA A;  3CN8 A;  3KLJ A;  4AP1 A;  2GH5 A;  1TDF A;  4OPU A;  2RAB A;  3DH9 A;  1L9D A;  2WS3 A;  1RYI A;  2EQ6 A;  3DGH A;  2BCP A;  3E1T A;  2IVE A;  3T2K A;  2YLS A;  4H4T A;  2OAL A;  3BHK A;  4II3 A;  3C96 A;  2GMH A;  5FS8 A;  5HY5 A;  4EQS A;  4BK3 A;  4H7U A;  2VZ2 A;  3AYI A;  3T2Y A;  2BK4 A;  3UKF A;  2C64 A;  1M64 A;  2ZBW A;  4YT0 A;  3S61 A;  3M12 A;  4H2R A;  3M13 A;  2XLS A;  4IVO B;  4K8D A;  4II2 A;  1N1P A;  2VVM A;  2WU2 A;  2AAQ A;  4EMI A;  5KXJ A;  3KKJ A;  2YM1 A;  3UCL A;  5CQF A;  1PJ7 A;  4GCM A;  2BC0 A;  3HZL A;  4BJY A;  3GYX A;  1JRY A;  5FS9 A;  1PXC A;  2JAE A;  2I0Z A;  1B8S A;  4BJZ A;  3SY4 A;  3KA7 A;  4D03 A;  4NWZ A;  3CGC A;  1PBC A;  3RP8 A;  3UOV A;  2WU5 A;  4AOS A;  3ITJ A;  4G6H A;  3SZF A;  3DA1 A;  3GMB A;  4EMW A;  5LV9 A;  2V3A A;  4EIP A;  1IJH A;  1D7L A;  1PXB A;  2BCG G;  1GV4 A;  1GEU A;  2V6O A;  3DGZ A;  4LA1 A;  3UTH A;  4J56 A;  3QJ4 A;  2QAE A;  2WP9 A;  1O95 A;  4A99 A;  1CC6 A;  1KDG A;  3KPK A;  3T2Z A;  4Z2U A;  3AEG A;  1OJ9 A;  2JK6 A;  4H4P A;  4HA6 A;  4U8K A;  1GOS A;  4G9K A;  4OPC A;  2R0P A;  5DBJ A;  1S2Q A;  4B64 A;  3UP4 A;  2IVD A;  1E39 A;  1K0I A;  1N4W A;  2XVI A;  1GT8 A;  5IQ1 A;  4A9W A;  2R46 A;  3P9U A;  3CPI G;  1KFY A;  4U2S A;  2YLW A;  1CHU A;  4H4Q A;  3KVE A;  2NPX A;  3CIR A;  4RG4 A;  5KRQ A;  1N4V A;  2JBV A;  1CJC A;  1ZK7 A;  2F5Z A;  3FPZ A;  4B68 A;  5KVH A;  5HYM A;  3T0K A;  2H89 A;  1YQ4 A;  2J3N A;  3AE7 A;  1GXF A;  1TYP A;  1ONF A;  2BS3 A;  1RSG A;  4H50 A;  5JCK A;  1EBD A;  4ADW A;  1PHH A;  2B7S A;  2OA1 A;  4AOX A;  3GWD A;  3Q6J A;  4ICY A;  4PAA A;  1H6V A;  2C65 A;  3P4R A;  4C3X A;  2C67 A;  2R4E A;  3CPJ G;  2WHD A;  3NYE A;  2YR4 A;  3QVR A;  1MXT A;  1GSN A;  5IPY A;  1TDE A;  2TMD A;  2GV8 A;  3K7T A;  3PVC A;  4GR1 A;  2A89 A;  3H8I A;  2JKC A;  2Q0K A;  5EB5 A;  1O5W A;  3GYJ A;  2B9W A;  3I3L A;  1Y56 B;  3UKQ A;  2Y6R A;  1EL5 A;  4JN9 A;  1E7P A;  2C7G A;  3II4 A;  4P9S A;  1GND A;  4J36 A;  3BI5 A;  4Y4M A;  4WCT A;  3Q9T A;  4K5R A;  4G74 A;  2ZZB A;  4NZH A;  1GPE A;  4A6N A;  2YR6 A;  3AB1 A;  2GQF A;  4KPR A;  3VQR A;  4CCQ A;  5BUL A;  1KNR A;  2WQY A;  3DJD A;  4BUR A;  1DOD A;  2PYX A;  3T31 A;  4CRT A;  3NK1 X;  3ABV A;  3NHO X;  4ECH A;  2WPC A;  4OPG A;  3RP7 A;  3NKS A;  1MO9 A;  3URH A;  3SZ0 A;  3SGL A;  1ELI A;  2UZZ A;  4CY6 A;  4Z43 A;  1D4D A;  5EOW A;  3QSS A;  1PS9 A;  2GRT A;  4K2X A;  3SZW A;  1RP0 A;  1VG9 A;  4HB9 A;  1FEB A;  1PJ5 A;  1KSU A;  2BK5 A;  4Z26 A;  2VOU A;  2YLR A;  5BVA A;  1Q1W A;  2JB1 A;  3GDN A;  4Y4L A;  3AD8 B;  4UDR A;  3GDP A;  3HYX A;  1IUS A;  1PN0 A;  3AE2 A;  2WP5 A;  2CDU A;  3SM8 A;  1JRZ A;  2XVH A;  3AXB A;  3LOV A;  2E5V A;  2XVJ A;  1DNC A;  2VRM A;  1E6E A;  3IHG A;  1NG4 A;  2RGH A;  2W0H A;  2O9Z A;  3LB8 A;  4J34 A;  4H4V A;  2R0G A;  1EL9 A;  1GRH A;  1DOE A;  1B5Q A;  3ALJ A;  2X50 A;  2CFY A;  4I58 A;  3UTE A;  2YM2 A;  2WDR A;  1P2H A;  1PBE A;  3GRS A;  2Q6U A;  2B9Y A;  4XWR A;  3V3N A;  4CY8 A;  2BYB A;  1D4E A;  1W4X A;  2GB0 A;  3NYF A;  1NDA A;  2GVC A;  1LVL A;  4GF7 A;  2IID A;  4OVI A;  1O94 A;  4NTD A;  4FK1 C;  4K22 A;  4NTE A;  4NNJ A;  5KNL A;  3NYC A;  3CNP A;  3LAD A;  2XYO A;  4H4W A;  4TM3 A;  5GRT A;  1KF6 A;  1YQZ A;  1ZOY A;  2XLT A;  4NTC A;  4ZCD A;  1BWC A;  4YSX A;  1ZKQ A;  1PXA A;  3ALM A;  3AEF A;  1H86 A;  1PBD A;  2TPR A;  4EM3 A;  1DJN A;  2RGO A;  2QA2 A;  4G73 A;  1SEZ A;  2EQ9 A;  1TDK A;  1ZX9 A;  4OPD A;  1ZMC A;  2BXS A;  4N9X A;  5J60 A;  2WEU A;  3DK4 A;  2YVJ A;  3SFD A;  4U8L A;  2YLT A;  2YLX A;  4H4Y A;  3ISH A;  1JNR A;  4FX9 A;  4J57 A;  1GER A;  4DSG A;  1B4V A;  3NN0 X;  4D04 A;  3VRD B;  3LZX A;  3UKA A;  2XVE A;  1E1L A;  4U2L A;  4IA6 A;  3G5Q A;  3BNM A;  3AD9 B;  5KMR A;  2XFO A;  2C76 A;  1BGN A;  3UKL A;  2X8G A;  3AWI A;  4TLZ A;  1JEH A;  2OLN A;  2C3D A;  2GQW A;  4H2Q A;  4U8N A;  5HHF A;  4AP3 A;  2VRL A;  2PHH A;  2XFQ A;  3KD9 A;  2C66 A;  3BHF A;  2APG A;  1IUW A;  2XLU A;  3M0O A;  3H8L A;  3NTA A;  3RNM A;  3AYJ A;  2E4G A;  1E1N A;  2BA9 A;  5U1O A;  2B7R A;  1IUV A;  5L46 A;  1QJD A;  1FCD A;  1JU2 A;  1CJ3 A;  2C73 A;  3AE1 A;  3NK0 X;  3KPF A;  3DME A;  2GAH B;  2XFN A;  3GWF A;  2V60 A;  1GRG A;  2Q0L A;  1LTX R;  1EL7 A;  1DOC A;  1VQW A;  1ZDL A;  2ZZ0 A;  4CNK A;  2GEW A;  4USR A;  4APN A;  5C2T A;  3AE3 A;  1ZOV A;  4CNJ A;  4H4Z A;  1REO A;  4GAV A;  3G5S A;  4X9N A;  2X8C A;  1JNZ A;  3SFE A;  3SXI A;  5BUK A;  2R4J A;  5U63 A;  4A65 A;  3NIX A;  3CNS A;  4YXD A;  2WBA A;  1H83 A;  4IVM B;  5JCI A;  1LJ1 A;  4C3Y A;  2JB2 A;  1F8R A;  3UP5 A;  2FJE A;  3ALL A;  3EAN A;  5EB4 A;  4H4R A;  4JY3 A;  2H88 A;  2HQM A;  3IF9 A;  3NK2 X;  3GMC A;  4JNA A;  3GD4 A;  3ZYX A;  3UOX A;  2YG6 A;  1NHS A;  1V59 A;  3JSK A;  3OC4 A;  4AT2 A;  3SZC A;  1FL2 A;  4GDP A;  1XDI A;  1ZP0 A;  2Y6Q A;  2WOW A;  1K0L A;  4JY2 A;  4U8I A;  5JCM A;  2C70 A;  3BNU A;  1OJD A;  1GRB A;  2QCU A;  2AQJ A;  3D1C A;  4Z44 A;  5M0Z A;  1GTE A;  3B6D A;  4EIQ A;  4YSZ A;  1YQ3 A;  4Y4N A;  1Q9I A;  4H4X A;  4Z25 A;  4A79 A;  1XHC A;  1TRB A;  3CND A;  2YAU A;  3AE6 A;  1NHR A;  3DJE A;  3HYV A;  4LU6 A;  1TDN A;  4B67 A;  3NLC A;  1KSS A;  4U2T A;  3LXD A;  3CMM A;  1IUT A;  3SQP A;  4B65 A;  1UKV G;  4J2W A;  4KX6 A;  4BK1 A;  4A6N B;  1NEN A;  1F8S A;  2Z5X A;  1F3P A;  1YY5 A;  3UKK A;  3VRB A;  5KWF A;  3L1R A;  1XAN A;  2XLP A;  3EPT A;  1Z6L A;  3UOY A;  2WET A;  1GET A;  1L0V A;  3S5W A;  4Z2R A;  2BXR A;  5BRT A;  4J31 A;  3F8P A;  4H2P A;  2R0C A;  2NVK X;  3H4K A;  1OJA A;  2YG3 A;  3LJP A;  3FMW A;  5FS7 A;  1FEC A;  3R9U A;  3RED A;  3ZDN A;  4C77 A;  3QFB A;  1CBO A;  4DGK A;  2JB3 A;  3VR8 A;  1CJ2 A;  3P1W A;  3PS9 A;  4UP3 A;  4H4U A;  1OJT A;  1GRT A;  3OZ2 A;  4USQ A;  3NNE A;  3AEC A;  2ARD A;  4XXG A;  4C5O A;  4BV6 A;  4X4J A;  1VG0 A;  4A7A A;  2FBW A;  4MJW A;  1ZY8 A;  2E1M A;  4NEV A;  1FEA A;  3UKP A;  4TM0 A;  4Z2T A;  5U25 A;  4U8P A;  1HYU A;  3UTG A;  2A87 A;  1VRQ B;  3BI4 A;  3NTD A;  1S2Y A;  4UDQ A;  1GES A;  1BGJ A;  1NHP A;  2C3C A;  3GD3 A;  3P4Q A;  1Q1R A;  4FDC B;  4U8M A;  3FG2 P;  5M10 A;  5FS6 A;  1PBF A;  2BK3 A;  2XVF A;  3D8X A;  2WOI A;  4K7Z A;  1H7X A;  2OLO A;  1CF3 A;  2BC1 A;  1CC2 A;  4G6G A;  1IUX A;  5JCL A;  2BS4 A;  1NPX A;  3IWA A;  4YTN A;  4RG3 A;  1H81 A;  3AE4 A;  3SYI A;  3AEB A;  1H84 A;  4GRT A;  2YLZ A;  1DOB A;  4IV9 A;  1L9C A;  2BAB A;  4WX1 A;  2A8X A;  2CVJ A;  2C4C A;  1NAA A;  3AE9 A;  3V76 A;  2BS2 A;  3PO7 A;  3ADA B;  5KOX A;  2RGJ A;  4XWZ A;  2XFU A;  1JOA A;  3SX6 A;  3UOZ A;  4JDR A;  3QFA A;  3RP6 A;  2X3N A;  1AOG A;  2WPE A;  4GDE A;  4M52 A;  3P4S A;  4UDP A;  3NRN A;  1CJ4 A;  1OJC A;  1LQT A;  2BAC A;  3CPH G;  2YG7 A;  3VRA A;  1LQU A;  4E0V A;  2V5Z A;  4CBQ A;  1YKJ A;  1ZMD A;  3O0H A;  3CGB A;  1GTH A;  3CNT A;  4RSL A;  4JNQ A;  3UTF A;  4K5S A;  1F6M A;  2VQ7 A;  4B63 A;  4EQX A;  5IQ4 A;  1E1M A;  1FOH A;  4GAP A;  1LV0 A;  5J7X A;  2DKH A;  3F8D A;  4BK2 A;  3ATR A;  4U8O A;  3HYW A;  3T14 A;  3DK8 A;  5KOW A;  2C72 A;  2Q7V A;  3AEE A;  2VQB A;  1DJQ A;  1S3E A;  2WPF A;  4DSH A;  1D5T A;  2FJA A;  4OPI A;  2BRA A;  3B3R A;  2BRY A;  4YKG A;  2YVF A;  3QVP A;  4DNA A;  1GAL A;  1NG3 A;  1NEK A;  1XPQ A;  2VVL A;  4ZN0 A;  2B76 A;  3K7Q X;  4NEW A;  4B69 A;  4X9M A;  2YR5 A;  2FJB A;  3CGE A;  4EM4 A;  1CL0 A;  2WDV A;  1CC4 A;  4ZCC A;  4EQW A;  1GRF A;  2GMJ A;  3FBS A;  2Z5Y A;  3G5R A;  4H2N A;  3NN6 X;  1F8W A;  4O5U A;  1BKW A;  1X31 B;  4YSH A;  2V3B A;  3DJJ A;  4H4S A;  3P4P A;  3ATQ A;  2C75 A;  3AD7 B;  3GSI A;  1PJ6 A;  2XFP A;  1B37 A;  3IHM A;  1PBB A;  4LII A;  4OCG A;  4YTP A;  3AYL A;  1MOK A;  5TR3 A;  1Y56 A;  1PDH A;  3QSM A;  1N4U A;  1H82 A;  2ZZC A;  3LZW A;  1IUU A;  2WP6 A;  3AED A;  2XCG A;  2YVG A;  2V61 A;  4OPL A;  3WE0 A;  5JCN A;  4JQ9 A;  1K4Q A;  5ER0 A;  1KNP A;  1QO8 A;  1COY A;  1GRE A;  4YWO A;  2XDO A;  4YSY A;  3CNJ A;  2R9Z A;  4I59 A;  3AE8 A;  2XLR A;  1TDO A;  5KMQ A;  5KMP A;  2EQ7 A;  2GAG B;  1DXL A;  2OAM A;  1D7Y A;  3DJG X;  3NH3 X;  4FK1 A;  3VR9 A;  4Z24 A;  3UKH A;  3L8K A;  3DK9 A;  1VDC A;  1NHQ A;  4GUV A;  2YG5 A;  5EBK A;  5KMS A;  4IA5 A;  2YWL A;  5HXI A;  3K30 A;  1JRX A;  3I6D A;  3C4A A;  2ACZ A;  3IC9 A;  3ICR A;  3NT6 A;  4OPT A;  1LPF A;  3EF6 A;  4TLX A;  4PAB A;  2FJD A;  3RHA A;  2YG4 A;  3EAO A;  3KU9 A;  2GF3 A;  2QA1 A;  4J33 A;  3GYI A;  5GSN A;  2B9X A;  3V3O A;  5C3J A;  3GRT A;  3QSE A;  1TYT A;  2EQ8 A;  1H7W A;  2WES A;  5CKU A;  1P2E A;  4AT0 A;  2YQU A;  4YKF A;  1EL8 A;  2WDQ A;  4TM1 A;  5FMH A;  4EQR A;  3NG7 X;  4C74 A;  4TM4 A;  1BF3 A;  1E1K A;  3BI2 A;  2CUL A;  1K0J A;  1BZL A;  2GR1 A;  3K7M X;  3T37 A;  3CTY A;  2X8H A;  2AR8 A;  1S3B A;  4B66 A;  4EMJ A;  3CGD A;  2WOV A;  2DKI A;  2VVL G;  1D4C A;  4O5Q A;  1L9E A;  1Y0P A;  3C4N A;  3NGC X;  2X99 A;  4A5L A;  4YTM A;  5KVI A;  3COX A;  1QLB A;  4U8J A;  2GR0 A;  2GR3 A;  3AE5 A;  4CCR A;  1GRA A;  2GR2 A;  3FIM B;  3F8R A;  4REK A; 
#chains in the Genus database with same CATH homology
 1M6I A;  3ICS A;  4B1B A;  3ICT A;  2R45 A;  3AEA A;  3CN8 A;  3KLJ A;  4AP1 A;  2GH5 A;  1TDF A;  4OPU A;  2RAB A;  3DH9 A;  1L9D A;  2WS3 A;  1RYI A;  2EQ6 A;  3DGH A;  2BCP A;  3E1T A;  2IVE A;  3T2K A;  2YLS A;  4H4T A;  2OAL A;  3BHK A;  4II3 A;  3C96 A;  2GMH A;  5FS8 A;  5HY5 A;  4EQS A;  4BK3 A;  4H7U A;  2VZ2 A;  3AYI A;  3T2Y A;  2BK4 A;  3UKF A;  2C64 A;  1M64 A;  2ZBW A;  4YT0 A;  3S61 A;  3M12 A;  4H2R A;  3M13 A;  2XLS A;  4IVO B;  4K8D A;  4II2 A;  1N1P A;  2VVM A;  2WU2 A;  2AAQ A;  4EMI A;  5KXJ A;  3KKJ A;  2YM1 A;  3UCL A;  5CQF A;  1PJ7 A;  4GCM A;  2BC0 A;  3HZL A;  4BJY A;  3GYX A;  1JRY A;  5FS9 A;  1PXC A;  2JAE A;  2I0Z A;  1B8S A;  4BJZ A;  3SY4 A;  3KA7 A;  4D03 A;  4NWZ A;  3CGC A;  1PBC A;  3RP8 A;  3UOV A;  2WU5 A;  4AOS A;  3ITJ A;  4G6H A;  3SZF A;  3DA1 A;  3GMB A;  4EMW A;  5LV9 A;  2V3A A;  4EIP A;  1IJH A;  1D7L A;  1PXB A;  2BCG G;  1GV4 A;  1GEU A;  2V6O A;  3DGZ A;  4LA1 A;  3UTH A;  4J56 A;  3QJ4 A;  2QAE A;  2WP9 A;  1O95 A;  4A99 A;  1CC6 A;  1KDG A;  3KPK A;  3T2Z A;  4Z2U A;  3AEG A;  1OJ9 A;  2JK6 A;  4H4P A;  4HA6 A;  4U8K A;  1GOS A;  4G9K A;  4OPC A;  2R0P A;  5DBJ A;  1S2Q A;  4B64 A;  3UP4 A;  2IVD A;  1E39 A;  1K0I A;  1N4W A;  2XVI A;  1GT8 A;  5IQ1 A;  4A9W A;  2R46 A;  3P9U A;  3CPI G;  1KFY A;  4U2S A;  2YLW A;  1CHU A;  4H4Q A;  3KVE A;  2NPX A;  3CIR A;  4RG4 A;  5KRQ A;  1N4V A;  2JBV A;  1CJC A;  1ZK7 A;  2F5Z A;  3FPZ A;  4B68 A;  5KVH A;  5HYM A;  3T0K A;  2H89 A;  1YQ4 A;  2J3N A;  3AE7 A;  1GXF A;  1TYP A;  1ONF A;  2BS3 A;  1RSG A;  4H50 A;  5JCK A;  1EBD A;  4ADW A;  1PHH A;  2B7S A;  2OA1 A;  4AOX A;  3GWD A;  3Q6J A;  4ICY A;  4PAA A;  1H6V A;  2C65 A;  3P4R A;  4C3X A;  2C67 A;  2R4E A;  3CPJ G;  2WHD A;  3NYE A;  2YR4 A;  3QVR A;  1MXT A;  1GSN A;  5IPY A;  1TDE A;  2TMD A;  2GV8 A;  3K7T A;  3PVC A;  4GR1 A;  2A89 A;  3H8I A;  2JKC A;  2Q0K A;  5EB5 A;  1O5W A;  3GYJ A;  2B9W A;  3I3L A;  1Y56 B;  3UKQ A;  2Y6R A;  1EL5 A;  4JN9 A;  1E7P A;  2C7G A;  3II4 A;  4P9S A;  1GND A;  4J36 A;  3BI5 A;  4Y4M A;  4WCT A;  3Q9T A;  4K5R A;  4G74 A;  2ZZB A;  4NZH A;  1GPE A;  4A6N A;  2YR6 A;  3AB1 A;  2GQF A;  4KPR A;  3VQR A;  4CCQ A;  5BUL A;  1KNR A;  2WQY A;  3DJD A;  4BUR A;  1DOD A;  2PYX A;  3T31 A;  4CRT A;  3NK1 X;  3ABV A;  3NHO X;  4ECH A;  2WPC A;  4OPG A;  3RP7 A;  3NKS A;  1MO9 A;  3URH A;  3SZ0 A;  3SGL A;  1ELI A;  2UZZ A;  4CY6 A;  4Z43 A;  1D4D A;  5EOW A;  3QSS A;  1PS9 A;  2GRT A;  4K2X A;  3SZW A;  1RP0 A;  1VG9 A;  4HB9 A;  1FEB A;  1PJ5 A;  1KSU A;  2BK5 A;  4Z26 A;  2VOU A;  2YLR A;  5BVA A;  1Q1W A;  2JB1 A;  3GDN A;  4Y4L A;  3AD8 B;  4UDR A;  3GDP A;  3HYX A;  1IUS A;  1PN0 A;  3AE2 A;  2WP5 A;  2CDU A;  3SM8 A;  1JRZ A;  2XVH A;  3AXB A;  3LOV A;  2E5V A;  2XVJ A;  1DNC A;  2VRM A;  1E6E A;  3IHG A;  1NG4 A;  2RGH A;  2W0H A;  2O9Z A;  3LB8 A;  4J34 A;  4H4V A;  2R0G A;  1EL9 A;  1GRH A;  1DOE A;  1B5Q A;  3ALJ A;  2X50 A;  2CFY A;  4I58 A;  3UTE A;  2YM2 A;  2WDR A;  1P2H A;  1PBE A;  3GRS A;  2Q6U A;  2B9Y A;  4XWR A;  3V3N A;  4CY8 A;  2BYB A;  1D4E A;  1W4X A;  2GB0 A;  3NYF A;  1NDA A;  2GVC A;  1LVL A;  4GF7 A;  2IID A;  4OVI A;  1O94 A;  4NTD A;  4FK1 C;  4K22 A;  4NTE A;  4NNJ A;  5KNL A;  3NYC A;  3CNP A;  3LAD A;  2XYO A;  4H4W A;  4TM3 A;  5GRT A;  1KF6 A;  1YQZ A;  1ZOY A;  2XLT A;  4NTC A;  4ZCD A;  1BWC A;  4YSX A;  1ZKQ A;  1PXA A;  3ALM A;  3AEF A;  1H86 A;  1PBD A;  2TPR A;  4EM3 A;  1DJN A;  2RGO A;  2QA2 A;  4G73 A;  1SEZ A;  2EQ9 A;  1TDK A;  1ZX9 A;  4OPD A;  1ZMC A;  2BXS A;  4N9X A;  5J60 A;  2WEU A;  3DK4 A;  2YVJ A;  3SFD A;  4U8L A;  2YLT A;  2YLX A;  4H4Y A;  3ISH A;  1JNR A;  4FX9 A;  4J57 A;  1GER A;  4DSG A;  1B4V A;  3NN0 X;  4D04 A;  3VRD B;  3LZX A;  3UKA A;  2XVE A;  1E1L A;  4U2L A;  4IA6 A;  3G5Q A;  3BNM A;  3AD9 B;  5KMR A;  2XFO A;  2C76 A;  1BGN A;  3UKL A;  2X8G A;  3AWI A;  4TLZ A;  1JEH A;  2OLN A;  2C3D A;  2GQW A;  4H2Q A;  4U8N A;  5HHF A;  4AP3 A;  2VRL A;  2PHH A;  2XFQ A;  3KD9 A;  2C66 A;  3BHF A;  2APG A;  1IUW A;  2XLU A;  3M0O A;  3H8L A;  3NTA A;  3RNM A;  3AYJ A;  2E4G A;  1E1N A;  2BA9 A;  5U1O A;  2B7R A;  1IUV A;  5L46 A;  1QJD A;  1FCD A;  1JU2 A;  1CJ3 A;  2C73 A;  3AE1 A;  3NK0 X;  3KPF A;  3DME A;  2GAH B;  2XFN A;  3GWF A;  2V60 A;  1GRG A;  2Q0L A;  1LTX R;  1EL7 A;  1DOC A;  1VQW A;  1ZDL A;  2ZZ0 A;  4CNK A;  2GEW A;  4USR A;  4APN A;  5C2T A;  3AE3 A;  1ZOV A;  4CNJ A;  4H4Z A;  1REO A;  4GAV A;  3G5S A;  4X9N A;  2X8C A;  1JNZ A;  3SFE A;  3SXI A;  5BUK A;  2R4J A;  5U63 A;  4A65 A;  3NIX A;  3CNS A;  4YXD A;  2WBA A;  1H83 A;  4IVM B;  5JCI A;  1LJ1 A;  4C3Y A;  2JB2 A;  1F8R A;  3UP5 A;  2FJE A;  3ALL A;  3EAN A;  5EB4 A;  4H4R A;  4JY3 A;  2H88 A;  2HQM A;  3IF9 A;  3NK2 X;  3GMC A;  4JNA A;  3GD4 A;  3ZYX A;  3UOX A;  2YG6 A;  1NHS A;  1V59 A;  3JSK A;  3OC4 A;  4AT2 A;  3SZC A;  1FL2 A;  4GDP A;  1XDI A;  1ZP0 A;  2Y6Q A;  2WOW A;  1K0L A;  4JY2 A;  4U8I A;  5JCM A;  2C70 A;  3BNU A;  1OJD A;  1GRB A;  2QCU A;  2AQJ A;  3D1C A;  4Z44 A;  5M0Z A;  1GTE A;  3B6D A;  4EIQ A;  4YSZ A;  1YQ3 A;  4Y4N A;  1Q9I A;  4H4X A;  4Z25 A;  4A79 A;  1XHC A;  1TRB A;  3CND A;  2YAU A;  3AE6 A;  1NHR A;  3DJE A;  3HYV A;  4LU6 A;  1TDN A;  4B67 A;  3NLC A;  1KSS A;  4U2T A;  3LXD A;  3CMM A;  1IUT A;  3SQP A;  4B65 A;  1UKV G;  4J2W A;  4KX6 A;  4BK1 A;  4A6N B;  1NEN A;  1F8S A;  2Z5X A;  1F3P A;  1YY5 A;  3UKK A;  3VRB A;  5KWF A;  3L1R A;  1XAN A;  2XLP A;  3EPT A;  1Z6L A;  3UOY A;  2WET A;  1GET A;  1L0V A;  3S5W A;  4Z2R A;  2BXR A;  5BRT A;  4J31 A;  3F8P A;  4H2P A;  2R0C A;  2NVK X;  3H4K A;  1OJA A;  2YG3 A;  3LJP A;  3FMW A;  5FS7 A;  1FEC A;  3R9U A;  3RED A;  3ZDN A;  4C77 A;  3QFB A;  1CBO A;  4DGK A;  2JB3 A;  3VR8 A;  1CJ2 A;  3P1W A;  3PS9 A;  4UP3 A;  4H4U A;  1OJT A;  1GRT A;  3OZ2 A;  4USQ A;  3NNE A;  3AEC A;  2ARD A;  4XXG A;  4C5O A;  4BV6 A;  4X4J A;  1VG0 A;  4A7A A;  2FBW A;  4MJW A;  1ZY8 A;  2E1M A;  4NEV A;  1FEA A;  3UKP A;  4TM0 A;  4Z2T A;  5U25 A;  4U8P A;  1HYU A;  3UTG A;  2A87 A;  1VRQ B;  3BI4 A;  3NTD A;  1S2Y A;  4UDQ A;  1GES A;  1BGJ A;  1NHP A;  2C3C A;  3GD3 A;  3P4Q A;  1Q1R A;  4FDC B;  4U8M A;  3FG2 P;  5M10 A;  5FS6 A;  1PBF A;  2BK3 A;  2XVF A;  3D8X A;  2WOI A;  4K7Z A;  1H7X A;  2OLO A;  1CF3 A;  2BC1 A;  1CC2 A;  4G6G A;  1IUX A;  5JCL A;  2BS4 A;  1NPX A;  3IWA A;  4YTN A;  4RG3 A;  1H81 A;  3AE4 A;  3SYI A;  3AEB A;  1H84 A;  4GRT A;  2YLZ A;  1DOB A;  4IV9 A;  1L9C A;  2BAB A;  4WX1 A;  2A8X A;  2CVJ A;  2C4C A;  1NAA A;  3AE9 A;  3V76 A;  2BS2 A;  3PO7 A;  3ADA B;  5KOX A;  2RGJ A;  4XWZ A;  2XFU A;  1JOA A;  3SX6 A;  3UOZ A;  4JDR A;  3QFA A;  3RP6 A;  2X3N A;  1AOG A;  2WPE A;  4GDE A;  4M52 A;  3P4S A;  4UDP A;  3NRN A;  1CJ4 A;  1OJC A;  1LQT A;  2BAC A;  3CPH G;  2YG7 A;  3VRA A;  1LQU A;  4E0V A;  2V5Z A;  4CBQ A;  1YKJ A;  1ZMD A;  3O0H A;  3CGB A;  1GTH A;  3CNT A;  4RSL A;  4JNQ A;  3UTF A;  4K5S A;  1F6M A;  2VQ7 A;  4B63 A;  4EQX A;  5IQ4 A;  1E1M A;  1FOH A;  4GAP A;  1LV0 A;  5J7X A;  2DKH A;  3F8D A;  4BK2 A;  3ATR A;  4U8O A;  3HYW A;  3T14 A;  3DK8 A;  5KOW A;  2C72 A;  2Q7V A;  3AEE A;  2VQB A;  1DJQ A;  1S3E A;  2WPF A;  4DSH A;  1D5T A;  2FJA A;  4OPI A;  2BRA A;  3B3R A;  2BRY A;  4YKG A;  2YVF A;  3QVP A;  4DNA A;  1GAL A;  1NG3 A;  1NEK A;  1XPQ A;  2VVL A;  4ZN0 A;  2B76 A;  3K7Q X;  4NEW A;  4B69 A;  4X9M A;  2YR5 A;  2FJB A;  3CGE A;  4EM4 A;  1CL0 A;  2WDV A;  1CC4 A;  4ZCC A;  4EQW A;  1GRF A;  2GMJ A;  3FBS A;  2Z5Y A;  3G5R A;  4H2N A;  3NN6 X;  1F8W A;  4O5U A;  1BKW A;  1X31 B;  4YSH A;  2V3B A;  3DJJ A;  4H4S A;  3P4P A;  3ATQ A;  2C75 A;  3AD7 B;  3GSI A;  1PJ6 A;  2XFP A;  1B37 A;  3IHM A;  1PBB A;  4LII A;  4OCG A;  4YTP A;  3AYL A;  1MOK A;  5TR3 A;  1Y56 A;  1PDH A;  3QSM A;  1N4U A;  1H82 A;  2ZZC A;  3LZW A;  1IUU A;  2WP6 A;  3AED A;  2XCG A;  2YVG A;  2V61 A;  4OPL A;  3WE0 A;  5JCN A;  4JQ9 A;  1K4Q A;  5ER0 A;  1KNP A;  1QO8 A;  1COY A;  1GRE A;  4YWO A;  2XDO A;  4YSY A;  3CNJ A;  2R9Z A;  4I59 A;  3AE8 A;  2XLR A;  1TDO A;  5KMQ A;  5KMP A;  2EQ7 A;  2GAG B;  1DXL A;  2OAM A;  1D7Y A;  3DJG X;  3NH3 X;  4FK1 A;  3VR9 A;  4Z24 A;  3UKH A;  3L8K A;  3DK9 A;  1VDC A;  1NHQ A;  4GUV A;  2YG5 A;  5EBK A;  5KMS A;  4IA5 A;  2YWL A;  5HXI A;  3K30 A;  1JRX A;  3I6D A;  3C4A A;  2ACZ A;  3IC9 A;  3ICR A;  3NT6 A;  4OPT A;  1LPF A;  3EF6 A;  4TLX A;  4PAB A;  2FJD A;  3RHA A;  2YG4 A;  3EAO A;  3KU9 A;  2GF3 A;  2QA1 A;  4J33 A;  3GYI A;  5GSN A;  2B9X A;  3V3O A;  5C3J A;  3GRT A;  3QSE A;  1TYT A;  2EQ8 A;  1H7W A;  2WES A;  5CKU A;  1P2E A;  4AT0 A;  2YQU A;  4YKF A;  1EL8 A;  2WDQ A;  4TM1 A;  5FMH A;  4EQR A;  3NG7 X;  4C74 A;  4TM4 A;  1BF3 A;  1E1K A;  3BI2 A;  2CUL A;  1K0J A;  1BZL A;  2GR1 A;  3K7M X;  3T37 A;  3CTY A;  2X8H A;  2AR8 A;  1S3B A;  4B66 A;  4EMJ A;  3CGD A;  2WOV A;  2DKI A;  2VVL G;  1D4C A;  4O5Q A;  1L9E A;  1Y0P A;  3C4N A;  3NGC X;  2X99 A;  4A5L A;  4YTM A;  5KVI A;  3COX A;  1QLB A;  4U8J A;  2GR0 A;  2GR3 A;  3AE5 A;  4CCR A;  1GRA A;  2GR2 A;  3FIM B;  3F8R A;  4REK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...