4A65A

Crystal structure of the thioredoxin reductase from entamoeba histolytica with aucn
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
IHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 89
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a65A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a65A02
2FJAA 4JN9A 1ZDLA 5KXJA 1CJ2A 3ATQA 2R4EA 1K0LA 2B7SA 2Q7VA 2B76A 2E4GA 2X99A 4I59A 3EAOA 1MOKA 1E1NA 2VQBA 1YQ4A 3FMWA 1L9DA 3LJPA 1P2EA 4LU6A 2C65A 4H4PA 3LOVA 1JNRA 5J7XA 3V76A 4EQSA 5FS9A 3P1WA 4H50A 1DJNA 4Z25A 1NENA 4EQWA 3S61A 4ECHA 1NG3A 2GR0A 3F8RA 3VRBA 4CY8A 3CIRA 3GWFA 3K7MX 1JEHA 3LZXA 2GRTA 4H4RA 1YQ3A 4OCGA 4LA1A 2BYBA 3DMEA 4D04A 1F8WA 1ZY8A 2JBVA 2JB2A 2EQ6A 4UP3A 4BK2A 2VVMA 1M6IA 4H2QA 3C4NA 1KDGA 3DJGX 1S3EA 1E1KA 3GMCA 1D5TA 4U8LA 5GRTA 3C96A 3COXA 4HB9A 3P4RA 3ICTA 1DOBA 3GYIA 1N4WA 4B63A 1FOHA 1DXLA 2R9ZA 3QSMA 1PDHA 4A5LA 3P4QA 4BURA 2EQ8A 1CBOA 2WS3A 1PHHA 4UDPA 4EMJA 2YR5A 1JRZA 2JK6A 4OPUA 1HYUA 1ZX9A 1Y0PA 4H2PA 4CNKA 3F8PA 1CC6A 2C66A 1XPQA 4NTEA 2VRLA 4U8JA 4YSZA 3SFDA 1DJQA 1EL5A 1H81A 3LB8A 1W4XA 2IVEA 3B3RA 4EM4A 4U8IA 4A65A 2C3DA 1D7YA 5HYMA 3UKPA 2GAHB 3BNUA 1H86A 2WQYA 3VR9A 3NK2X 2GVCA 2V60A 4ADWA 2YQUA 3GDNA 4H2RA 4ZCDA 2YAUA 4KX6A 3QVRA 4Z43A 1LQTA 3NN6X 1LV0A 2H88A 3UKHA 5JCLA 3NT6A 5JCMA 1TYTA 2C73A 2GR1A 4NTCA 3NN0X 1FCDA 2YG3A 3H8LA 3CGBA 1LPFA 3FPZA 2ZBWA 1PXAA 2J3NA 3AE9A 3GDPA 1ONFA 4JNAA 2YG4A 1TDKA 5KRQA 4BJYA 3WE0A 1TDNA 3KPFA 4U2TA 5JCNA 3DH9A 3K30A 3AE2A 2X8HA 4DGKA 3AXBA 4Y4NA 3UKAA 4DNAA 5HY5A 2NPXA 3EPTA 2JB1A 1TRBA 5BUKA 4JNQA 5DBJA 4YTPA 1CHUA 1MXTA 4U2SA 3CGEA 3E1TA 4IV9A 1RSGA 1YKJA 2BK4A 2XVEA 3ADAB 3AE8A 3PO7A 3KKJA 1IUVA 1XDIA 3AE7A 2PHHA 3I3LA 4H4UA 4Y4MA 4YTNA 2BK5A 2DKIA 2WPCA 3NYFA 3AEBA 3VR8A 4J34A 3PVCA 3DA1A 4EMIA 3LADA 4H4WA 2XVHA 4A79A 1BGJA 2XVFA 1JNZA 2WDQA 1BF3A 3OC4A 2BS2A 1B8SA 2AAQA 5CQFA 1OJCA 2Z5YA 1F3PA 1O5WA 4H4XA 5IQ1A 1O95A 3ALJA 4B64A 2BS4A 3NIXA 2YM2A 3CNJA 3KA7A 4U2LA 4OPTA 1PJ7A 4TLXA 2WP9A 4J33A 3GD3A 2B9WA 2OAMA 3UP4A 4P9SA 2C76A 1ZMDA 2WP6A 1GERA 1F8RA 2XCGA 4IVOB 3RP7A 4JQ9A 1PBDA 3RHAA 5EOWA 1Y56A 3QFAA 2GAGB 4GF7A 4J56A 2RGJA 1H7WA 3NNEA 2Z5XA 3V3OA 2AQJA 1B5QA 1KFYA 1ZK7A 2VOUA 3GRTA 2GB0A 2YLSA 4IA5A 3KU9A 1TDOA 5M0ZA 1ELIA 1RYIA 3CNPA 3KD9A 2WESA 4H4TA 3SFEA 5BVAA 3AYLA 2RGOA 1BZLA 1OJAA 3HZLA 4K22A 1XANA 3M12A 3DJDA 3B6DA 3UKQA 2ARDA 1QO8A 3AECA 4NTDA 4GCMA 3AE5A 3VRDB 4PABA 4REKA 3NRNA 4C77A 4B66A 3DK8A 1Q1RA 1E1MA 2YG6A 1CJ3A 3O0HA 1BWCA 4H7UA 1DODA 2YG7A 2AR8A 3AD7B 1FEAA 1LVLA 2BABA 5JCIA 4TLZA 2BC0A 4J57A 4XXGA 3K7TA 3RP6A 1IJHA 3NHOX 1ZOVA 2YVFA 3EF6A 3GD4A 1L9CA 2WU2A 4H4SA 4U8KA 1JRYA 5BRTA 1F6MA 1LTXR 3AEEA 2JB3A 4J36A 1BKWA 3CPHG 1OJDA 2A8XA 2I0ZA 1FEBA 5KVHA 3H8IA 4K2XA 2WU5A 3G5QA 1XHCA 3NYCA 2OA1A 1LJ1A 2YLTA 2Y6RA 4HA6A 1CC4A 5KWFA 1GXFA 1CJCA 3DGZA 2YVJA 4WCTA 2OALA 3S5WA 2UZZA 2WOWA 4ICYA 2TPRA 1GESA 3FG2P 2FJBA 1EL9A 2R4JA 3G5SA 3IHMA 5U25A 4B65A 1H7XA 4OPCA 1QLBA 3K7QX 4PAAA 3GRSA 4APNA 2QAEA 4B69A 2WOVA 2CFYA 2EQ9A 5FS7A 3DGHA 4H2NA 4AP3A 1FECA 4GR1A 3R9UA 1ZKQA 1H84A 5KVIA 2GMHA 2XLRA 3KLJA 1N4VA 2XLPA 3I6DA 3AWIA 3NKSA 1IUSA 2R0PA 3M0OA 2C7GA 2R45A 2X8CA 2YR4A 4A6NB 1NEKA 3G5RA 2ZZCA 2CULA 3ICRA 4H4QA 1OJ9A 2Q0LA 3CGCA 2WDRA 1GRHA 3AD8B 1P2HA 1S2QA 1X31B 3UOYA 1GALA 2O9ZA 1D7LA 3BHKA 3LXDA 2XFQA 3BI5A 3QSEA 2YLWA 4IA6A 3SGLA 2C3CA 1PBCA 5FMHA 3UTFA 2GF3A 3P4SA 1IUTA 2V3BA 4OVIA 2X3NA 3UOZA 4AT2A 1H6VA 1Q1WA 3KVEA 4I58A 1PBEA 4IVMB 3CTYA 2BCPA 2C70A 4Z26A 3AE3A 1NG4A 4H4YA 2BA9A 3VRAA 3IWAA 4J31A 2R46A 2YR6A 1K0IA 3L8KA 4EIPA 4BK1A 5EB4A 3QSSA 1Z6LA 3AE1A 1M64A 2IIDA 4YKGA 3QFBA 4ZN0A 3D8XA 1VQWA 3FBSA 3NK0X 1GT8A 2WOIA 2C67A 1GOSA 3H4KA 3ISHA 3AD9B 1PS9A 2X50A 3UOXA 3AEDA 4YXDA 2WPFA 4RG4A 5JCKA 2HQMA 4EQXA 2R0GA 2WPEA 2WEUA 4KPRA 2PYXA 1GNDA 3CN8A 2EQ7A 1GRGA 4EIQA 3L1RA 5U1OA 4B67A 3CGDA 3ZDNA 3AEAA 1NAAA 2B9XA 2NVKX 1PXBA 1GPEA 2RGHA 4AT0A 3AYIA 4BJZA 4N9XA 1MO9A 3C4AA 4M52A 4X9MA 1ZP0A 1TDFA 2YM1A 3T37A 3UKKA 1TYPA 2A89A 3M13A 3PS9A 4C3YA 2Y6QA 2VZ2A 4JY2A 3GWDA 2VVLA 3NGCX 2BK3A 4O5UA 2XLTA 1CJ4A 3GMBA 3QJ4A 2YLZA 2V5ZA 1PBBA 4EQRA 4U8PA 3CNSA 5KOWA 4B1BA 2DKHA 1DOCA 4FK1A 1FL2A 5EBKA 2BC1A 2RABA 3NLCA 4UDQA 4X4JA 1KF6A 4YWOA 3CPIG 3UP5A 3VQRA 4E0VA 5M10A 4O5QA 4CCQA 4FX9A 1NDAA 2FBWA 1JRXA 1JOAA 3CNTA 3P4PA 2WHDA 4DSHA 3RNMA 2XFNA 4H4VA 4NEVA 3JSKA 4A7AA 2ZZBA 3AB1A 3AYJA 5C3JA 4TM0A 3ALLA 4NZHA 2JAEA 4AOSA 3UTHA 2XFOA 3NTDA 1SEZA 4TM1A 4CNJA 2ACZA 3AEGA 4C74A 3REDA 1EL7A 4LIIA 1E1LA 3ALMA 2ZZ0A 2XDOA 1REOA 4Z2UA 3Q6JA 3ABVA 2A87A 2XYOA 1UKVG 3UKLA 4K5SA 5CKUA 4D03A 2CVJA 4UDRA 4Z2RA 1VDCA 1OJTA 1AOGA 1D4DA 4K7ZA 3II4A 4U8MA 4C3XA 1JU2A 1KSUA 1H82A 4TM3A 2CDUA 1COYA 3CPJG 3UTEA 2X8GA 1VG0A 1GRAA 4CY6A 1K4QA 2R0CA 3NG7X 4RSLA 4GDEA 1B4VA 2JKCA 1GEUA 4XWZA 5U63A 3SM8A 3ATRA 1BGNA 3ICSA 4BK3A 2V61A 3BNMA 4XWRA 4K5RA 1PN0A 3D1CA 2BS3A 3CNDA 4OPIA 4AOXA 4U8OA 1VG9A 2BXRA 1H83A 2TMDA 1S3BA 4YT0A 1KNRA 1N1PA 4ZCCA 2B9YA 2GMJA 2YG5A 2GQWA 3QVPA 4GRTA 4J2WA 4MJWA 4Y4LA 2BCGG 1NPXA 2QCUA 3BI2A 2C75A 2C64A 2GR3A 3AE4A 3UKFA 5BULA 3NTAA 3F8DA 1E6EA 2VQ7A 2C72A 2IVDA 3OZ2A 2VRMA 3SQPA 1PBFA 4CRTA 1K0JA 1B37A 1GRTA 5TR3A 2WETA 2VVLG 3UOVA 1D4EA 2GQFA 2XLSA 2BXSA 2WP5A 1EL8A 4B68A 3IHGA 1DOEA 2YWLA 1Q9IA 1L0VA 1CF3A 2YLRA 4Z24A 4Z44A 1LQUA 5C2TA 2WBAA 2XLUA 2XVIA 2WDVA 4OPDA 4YSXA 1RP0A 5EB5A 5ER0A 4C5OA 2GR2A 2QA1A 3UTGA 2Q6UA 2XVJA 3P9UA 1EBDA 2B7RA 4JDRA 3LZWA 1QJDA 4FK1C 2V3AA 3NYEA 1IUUA 4GDPA 1N4UA 4OPLA 3DJJA 1S2YA 2E1MA 4YSHA 1GV4A 3V3NA 1V59A 1GETA 3EANA 1E7PA 4EM3A 1CC2A 1GRBA 3DK4A 3IF9A 2FJEA 4WX1A 1YY5A 4K8DA 4A99A 5L46A 4TM4A 4Z2TA 1NHPA 1IUWA 3BI4A 4A9WA 4AP1A 1CL0A 4DSGA 1Y56B 1NHRA 1NHQA 5J60A 4X9NA 5GSNA 2GEWA 5IQ4A 1D4CA 1KNPA 1NHSA 5LV9A 2XFUA 4A6NA 2E5VA 4YSYA 1F8SA 2QA2A 3Q9TA 1DNCA 2F5ZA 4OPGA 4RG3A 1GREA 2APGA 3AE6A 2Q0KA 4CBQA 2YLXA 1GRFA 4USRA 1TDEA 4FDCB 4USQA 5HHFA 3ITJA 4H4ZA 3BHFA 3URHA 1GTEA 2FJDA 3DK9A 3NH3X 1IUXA 3UCLA 2OLNA 2V6OA 3FIMB 4YKFA 4EMWA 1PJ6A 1GSNA 1KSSA 1ZOYA 2GV8A 3GYJA 4YTMA 2GH5A 5FS6A 3RP8A 3ZYXA 4JY3A 4CCRA 3AEFA 3NK1X 4GUVA 5KOXA 2BACA 1L9EA 1E39A 2W0HA 4U8NA 5FS8A 2H89A 3IC9A 4BV6A 1VRQB 2YVGA 1PXCA 1YQZA 2OLOA 3GSIA 5HXIA 2XFPA 1O94A 1GTHA 1ZMCA 5IPYA 3DJEA 4NEWA 1PJ5A
chains in the Genus database with same CATH superfamily
2FJAA 4JN9A 1ZDLA 5KXJA 1CJ2A 3ATQA 2R4EA 1K0LA 2B7SA 2Q7VA 2B76A 2E4GA 2X99A 4I59A 3EAOA 1MOKA 1E1NA 2VQBA 1YQ4A 3FMWA 1L9DA 3LJPA 1P2EA 4LU6A 2C65A 4H4PA 3LOVA 1JNRA 5J7XA 3V76A 4EQSA 5FS9A 3P1WA 4H50A 1DJNA 4Z25A 1NENA 4EQWA 3S61A 4ECHA 1NG3A 2GR0A 3F8RA 3VRBA 4CY8A 3CIRA 3GWFA 3K7MX 1JEHA 3LZXA 2GRTA 4H4RA 1YQ3A 4GAVA 4OCGA 4LA1A 2BYBA 3DMEA 4D04A 1F8WA 1ZY8A 2JBVA 2JB2A 2EQ6A 4UP3A 3HYVA 4BK2A 2VVMA 1M6IA 4H2QA 3C4NA 1KDGA 3DJGX 1S3EA 1E1KA 3GMCA 1D5TA 4U8LA 5GRTA 3C96A 3COXA 4HB9A 3P4RA 3ICTA 1DOBA 3GYIA 1N4WA 4B63A 1FOHA 1DXLA 2R9ZA 3QSMA 1PDHA 4A5LA 3P4QA 3SXIA 2EQ8A 1CBOA 2WS3A 1PHHA 4UDPA 4EMJA 2YR5A 1JRZA 2JK6A 4OPUA 1HYUA 1ZX9A 1Y0PA 4H2PA 4CNKA 3F8PA 1CC6A 2C66A 1XPQA 4NTEA 2VRLA 4U8JA 4YSZA 3SFDA 1DJQA 1EL5A 1H81A 3LB8A 1W4XA 2IVEA 3B3RA 4EM4A 4U8IA 4A65A 2C3DA 1D7YA 5HYMA 3UKPA 2GAHB 3BNUA 1H86A 2WQYA 3VR9A 3NK2X 2GVCA 2V60A 4ADWA 3T2KA 2YQUA 3GDNA 4H2RA 4ZCDA 2YAUA 2BRYA 4KX6A 3QVRA 4Z43A 1LQTA 3NN6X 1LV0A 2H88A 3UKHA 5JCLA 3NT6A 5JCMA 1TYTA 2C73A 2GR1A 4NTCA 3NN0X 1FCDA 2YG3A 3H8LA 3CGBA 1LPFA 3FPZA 2ZBWA 1PXAA 2J3NA 3AE9A 3GDPA 1ONFA 4JNAA 2YG4A 1TDKA 5KRQA 4BJYA 3WE0A 1TDNA 3KPFA 4U2TA 5JCNA 3DH9A 3K30A 3AE2A 2X8HA 4DGKA 3AXBA 4Y4NA 3UKAA 4DNAA 5HY5A 2NPXA 3EPTA 5KMQA 2JB1A 1TRBA 5BUKA 4JNQA 5DBJA 4YTPA 1CHUA 1MXTA 4U2SA 3CGEA 3E1TA 4IV9A 1RSGA 1YKJA 2BK4A 2XVEA 3ADAB 3AE8A 3PO7A 3KKJA 1IUVA 1XDIA 3AE7A 2PHHA 3I3LA 4H4UA 4Y4MA 4YTNA 2BK5A 2DKIA 2WPCA 3NYFA 3AEBA 3VR8A 3SZWA 4J34A 3PVCA 3DA1A 4EMIA 3LADA 4H4WA 2XVHA 4A79A 1BGJA 2XVFA 3HYWA 1JNZA 2WDQA 1BF3A 5KNLA 3OC4A 2BS2A 1B8SA 2AAQA 2C4CA 1OJCA 2Z5YA 5CQFA 1F3PA 1O5WA 4H4XA 5IQ1A 1O95A 3ALJA 4B64A 2BS4A 3NIXA 2YM2A 3CNJA 3KA7A 4U2LA 4OPTA 1PJ7A 4TLXA 2WP9A 4J33A 3GD3A 2B9WA 2OAMA 3UP4A 4P9SA 5KMRA 2C76A 1ZMDA 2WP6A 3SX6A 1GERA 1F8RA 2XCGA 4IVOB 3RP7A 4JQ9A 1PBDA 3RHAA 5EOWA 1Y56A 3QFAA 2GAGB 4GF7A 4J56A 2RGJA 1H7WA 3NNEA 2Z5XA 3V3OA 2AQJA 1B5QA 1KFYA 1ZK7A 4GAPA 2VOUA 3GRTA 2GB0A 2YLSA 4IA5A 3KU9A 1TDOA 5M0ZA 1ELIA 1RYIA 3CNPA 3KD9A 2WESA 4H4TA 3T14A 3SFEA 5BVAA 3AYLA 2RGOA 1BZLA 1OJAA 3HZLA 4K22A 1XANA 3M12A 3DJDA 3B6DA 3UKQA 2ARDA 1QO8A 3AECA 4NTDA 4GCMA 3SZ0A 3AE5A 3VRDB 4PABA 4REKA 3NRNA 4C77A 4B66A 3DK8A 1Q1RA 1E1MA 2YG6A 1CJ3A 3O0HA 1BWCA 4H7UA 1DODA 2YG7A 2AR8A 3AD7B 1FEAA 1LVLA 2BABA 5JCIA 4TLZA 2BC0A 4J57A 4XXGA 3K7TA 3RP6A 1IJHA 3NHOX 1ZOVA 2YVFA 3EF6A 3GD4A 1L9CA 2WU2A 4H4SA 4BURA 4G74A 4U8KA 1JRYA 5BRTA 1F6MA 1LTXR 3AEEA 2JB3A 4J36A 1BKWA 3CPHG 1OJDA 2A8XA 2I0ZA 1FEBA 5KVHA 3H8IA 4K2XA 2WU5A 3G5QA 3T0KA 1XHCA 3NYCA 2OA1A 1LJ1A 2YLTA 2Y6RA 4G6GA 1CC4A 4HA6A 1GXFA 5KWFA 1CJCA 3DGZA 2YVJA 4WCTA 2OALA 3S5WA 2UZZA 2WOWA 4ICYA 2TPRA 1GESA 3FG2P 3GYXA 2FJBA 1EL9A 2R4JA 3G5SA 3IHMA 5U25A 3T2ZA 4B65A 1H7XA 4OPCA 1QLBA 3K7QX 4PAAA 3GRSA 4APNA 2QAEA 4B69A 2WOVA 2CFYA 2EQ9A 5FS7A 3DGHA 4H2NA 4AP3A 1FECA 4GR1A 3SZCA 3R9UA 1ZKQA 1H84A 5KVIA 2GMHA 2XLRA 3KLJA 1N4VA 2XLPA 3I6DA 3AWIA 3NKSA 1IUSA 2R0PA 3M0OA 2C7GA 2R45A 2X8CA 2YR4A 4A6NB 1NEKA 3G5RA 2ZZCA 2CULA 3ICRA 4H4QA 1OJ9A 2Q0LA 3CGCA 2WDRA 1GRHA 3AD8B 1P2HA 1S2QA 1X31B 3SZFA 3UOYA 1GALA 2O9ZA 1D7LA 3BHKA 3LXDA 2XFQA 3BI5A 3QSEA 2YLWA 4IA6A 3SGLA 2C3CA 1PBCA 5FMHA 3UTFA 2GF3A 3P4SA 1IUTA 2V3BA 4OVIA 2X3NA 3UOZA 4AT2A 1H6VA 1Q1WA 3KVEA 4I58A 1PBEA 4IVMB 3CTYA 2BCPA 2C70A 4Z26A 3AE3A 1NG4A 3T2YA 4H4YA 2BA9A 3SYIA 3VRAA 3IWAA 4J31A 2R46A 2YR6A 1K0IA 3L8KA 4EIPA 4BK1A 5EB4A 3QSSA 1Z6LA 3AE1A 1M64A 2IIDA 4YKGA 3QFBA 4ZN0A 3D8XA 1VQWA 3FBSA 3NK0X 4G6HA 1GT8A 2WOIA 2C67A 1GOSA 3H4KA 3HYXA 3ISHA 3AD9B 1PS9A 2X50A 3UOXA 3AEDA 4YXDA 2WPFA 4RG4A 5JCKA 2HQMA 4EQXA 2R0GA 2WPEA 2WEUA 4KPRA 2PYXA 1GNDA 3CN8A 2EQ7A 1GRGA 4EIQA 3L1RA 5U1OA 4B67A 3CGDA 3ZDNA 3AEAA 1NAAA 2B9XA 2NVKX 1PXBA 1GPEA 2RGHA 4AT0A 3AYIA 4BJZA 4N9XA 1MO9A 3C4AA 4M52A 4X9MA 1ZP0A 1TDFA 2YM1A 3T37A 3UKKA 1TYPA 2A89A 3M13A 3PS9A 4C3YA 2Y6QA 2VZ2A 4JY2A 3GWDA 2VVLA 3NGCX 2BK3A 4O5UA 2XLTA 1CJ4A 3GMBA 3QJ4A 2YLZA 2V5ZA 1PBBA 4EQRA 4U8PA 3CNSA 5KOWA 4B1BA 2DKHA 1DOCA 4FK1A 1FL2A 5EBKA 2BC1A 2RABA 3NLCA 4UDQA 4X4JA 1KF6A 4YWOA 3CPIG 3UP5A 3VQRA 4E0VA 5M10A 4O5QA 4CCQA 4FX9A 1NDAA 2FBWA 1JRXA 1JOAA 3CNTA 3P4PA 2WHDA 4II3A 3RNMA 2XFNA 4H4VA 4NEVA 3JSKA 4A7AA 2ZZBA 4DSHA 3AB1A 3AYJA 5C3JA 4TM0A 3ALLA 4NZHA 2JAEA 4AOSA 3UTHA 2XFOA 3NTDA 1SEZA 2BRAA 4TM1A 4CNJA 2ACZA 3AEGA 4C74A 3REDA 1EL7A 4LIIA 1E1LA 3ALMA 2ZZ0A 2XDOA 1REOA 4Z2UA 3Q6JA 3ABVA 2A87A 2XYOA 1UKVG 3UKLA 4K5SA 5CKUA 4D03A 2CVJA 3SY4A 4UDRA 4Z2RA 1VDCA 1OJTA 1AOGA 1D4DA 3CMMA 3II4A 4K7ZA 4U8MA 4C3XA 1JU2A 1KSUA 1H82A 4G73A 4TM3A 2CDUA 1COYA 3CPJG 3UTEA 2X8GA 1VG0A 1GRAA 4CY6A 1K4QA 2R0CA 3NG7X 4RSLA 4GDEA 1B4VA 2JKCA 1GEUA 4XWZA 5U63A 3SM8A 3ATRA 1BGNA 3ICSA 4BK3A 2V61A 3BNMA 4XWRA 4K5RA 1PN0A 3D1CA 2BS3A 3CNDA 4OPIA 4AOXA 4U8OA 1VG9A 2BXRA 1H83A 2TMDA 1S3BA 4YT0A 1KNRA 1N1PA 4ZCCA 2B9YA 2GMJA 2YG5A 2GQWA 3QVPA 4GRTA 3KPKA 4J2WA 4MJWA 4Y4LA 2BCGG 1NPXA 2QCUA 3BI2A 2C75A 2C64A 2GR3A 3AE4A 3UKFA 5BULA 5KMSA 3NTAA 3F8DA 1E6EA 2VQ7A 2C72A 2IVDA 3OZ2A 2VRMA 3SQPA 1PBFA 4CRTA 1K0JA 1B37A 1GRTA 5TR3A 2WETA 2VVLG 3UOVA 1D4EA 2GQFA 2XLSA 2BXSA 2WP5A 1EL8A 4B68A 3IHGA 1DOEA 2YWLA 5KMPA 1Q9IA 1L0VA 1CF3A 2YLRA 4Z24A 4Z44A 1LQUA 5C2TA 2WBAA 2XLUA 2XVIA 2WDVA 4OPDA 4YSXA 1RP0A 5EB5A 4II2A 5ER0A 2GR2A 2QA1A 3UTGA 4C5OA 2Q6UA 2XVJA 3P9UA 1EBDA 2B7RA 4JDRA 3LZWA 1QJDA 4FK1C 2V3AA 3NYEA 1IUUA 4GDPA 1N4UA 4OPLA 3DJJA 1S2YA 2E1MA 4YSHA 1GV4A 3V3NA 1V59A 1GETA 3EANA 1E7PA 4EM3A 1CC2A 1GRBA 3DK4A 3IF9A 2FJEA 4WX1A 1YY5A 4K8DA 4A99A 5L46A 4TM4A 4Z2TA 1NHPA 1IUWA 3BI4A 4A9WA 4AP1A 1CL0A 4DSGA 1Y56B 1NHRA 1NHQA 5J60A 4X9NA 5GSNA 4NWZA 2GEWA 5IQ4A 1D4CA 1KNPA 1NHSA 5LV9A 2XFUA 4A6NA 2E5VA 4YSYA 1F8SA 2QA2A 3Q9TA 1DNCA 2F5ZA 4OPGA 4RG3A 1GREA 2APGA 3AE6A 2Q0KA 4G9KA 4CBQA 2YLXA 1GRFA 4USRA 1TDEA 4FDCB 4USQA 5HHFA 3ITJA 4H4ZA 3BHFA 3URHA 1GTEA 2FJDA 3DK9A 3NH3X 1IUXA 3UCLA 2OLNA 2V6OA 3FIMB 4YKFA 4EMWA 1PJ6A 1GSNA 1KSSA 1ZOYA 2GV8A 3GYJA 4YTMA 2GH5A 5FS6A 3RP8A 3ZYXA 4JY3A 4CCRA 3AEFA 3NK1X 4GUVA 5KOXA 2BACA 1L9EA 1E39A 2W0HA 4U8NA 5FS8A 2H89A 3IC9A 4BV6A 1VRQB 2YVGA 1PXCA 1YQZA 2OLOA 4NNJA 3GSIA 5HXIA 2XFPA 1O94A 3T31A 1GTHA 1ZMCA 5IPYA 3DJEA 4NEWA 1PJ5A
chains in the Genus database with same CATH topology
2FJAA 4JN9A 1ZDLA 5KXJA 1CJ2A 3ATQA 2R4EA 1K0LA 2B7SA 2Q7VA 2B76A 2E4GA 2X99A 4I59A 3EAOA 1MOKA 1E1NA 2VQBA 1YQ4A 3FMWA 1L9DA 3LJPA 1P2EA 4LU6A 2C65A 4H4PA 3LOVA 1JNRA 5J7XA 3V76A 4EQSA 5FS9A 3P1WA 4H50A 1DJNA 4Z25A 1NENA 4EQWA 3S61A 4ECHA 1NG3A 2GR0A 3F8RA 3VRBA 4CY8A 3CIRA 3GWFA 3K7MX 1JEHA 3LZXA 2GRTA 4H4RA 1YQ3A 4GAVA 4OCGA 4LA1A 2BYBA 3DMEA 4D04A 1F8WA 1ZY8A 2JBVA 2JB2A 2EQ6A 4UP3A 3HYVA 4BK2A 2VVMA 1M6IA 4H2QA 3C4NA 1KDGA 3DJGX 1S3EA 1E1KA 3GMCA 1D5TA 4U8LA 5GRTA 3C96A 3COXA 4HB9A 3P4RA 3ICTA 1DOBA 3GYIA 1N4WA 4B63A 1FOHA 1DXLA 2R9ZA 3QSMA 1PDHA 4A5LA 3P4QA 3SXIA 2EQ8A 1CBOA 2WS3A 1PHHA 4UDPA 4EMJA 2YR5A 1JRZA 2JK6A 4OPUA 1HYUA 1ZX9A 1Y0PA 4H2PA 4CNKA 3F8PA 1CC6A 2C66A 1XPQA 4NTEA 2VRLA 4U8JA 4YSZA 3SFDA 1DJQA 1EL5A 1H81A 3LB8A 1W4XA 2IVEA 3B3RA 4EM4A 4U8IA 4A65A 2C3DA 1D7YA 5HYMA 3UKPA 2GAHB 3BNUA 1H86A 2WQYA 3VR9A 3NK2X 2GVCA 2V60A 4ADWA 3T2KA 2YQUA 3GDNA 4H2RA 4ZCDA 2YAUA 2BRYA 4KX6A 3QVRA 4Z43A 1LQTA 3NN6X 1LV0A 2H88A 3UKHA 5JCLA 3NT6A 5JCMA 1TYTA 2C73A 2GR1A 4NTCA 3NN0X 1FCDA 2YG3A 3H8LA 3CGBA 1LPFA 3FPZA 2ZBWA 1PXAA 2J3NA 3AE9A 3GDPA 1ONFA 4JNAA 2YG4A 1TDKA 5KRQA 4BJYA 3WE0A 1TDNA 3KPFA 4U2TA 5JCNA 3DH9A 3K30A 3AE2A 2X8HA 4DGKA 3AXBA 4Y4NA 3UKAA 4DNAA 5HY5A 2NPXA 3EPTA 5KMQA 2JB1A 1TRBA 5BUKA 4JNQA 5DBJA 4YTPA 1CHUA 1MXTA 4U2SA 3CGEA 3E1TA 4IV9A 1RSGA 1YKJA 2BK4A 2XVEA 3ADAB 3AE8A 3PO7A 3KKJA 1IUVA 1XDIA 3AE7A 2PHHA 3I3LA 4H4UA 4Y4MA 4YTNA 2BK5A 2DKIA 2WPCA 3NYFA 3AEBA 3VR8A 3SZWA 4J34A 3PVCA 3DA1A 4EMIA 3LADA 4H4WA 2XVHA 4A79A 1BGJA 2XVFA 3HYWA 1JNZA 2WDQA 1BF3A 5KNLA 3OC4A 2BS2A 1B8SA 2AAQA 2C4CA 1OJCA 2Z5YA 5CQFA 1F3PA 1O5WA 4H4XA 5IQ1A 1O95A 3ALJA 4B64A 2BS4A 3NIXA 2YM2A 3CNJA 3KA7A 4U2LA 4OPTA 1PJ7A 4TLXA 2WP9A 4J33A 3GD3A 2B9WA 2OAMA 3UP4A 4P9SA 5KMRA 2C76A 1ZMDA 2WP6A 3SX6A 1GERA 1F8RA 2XCGA 4IVOB 3RP7A 4JQ9A 1PBDA 3RHAA 5EOWA 1Y56A 3QFAA 2GAGB 4GF7A 4J56A 2RGJA 1H7WA 3NNEA 2Z5XA 3V3OA 2AQJA 1B5QA 1KFYA 1ZK7A 4GAPA 2VOUA 3GRTA 2GB0A 2YLSA 4IA5A 3KU9A 1TDOA 5M0ZA 1ELIA 1RYIA 3CNPA 3KD9A 2WESA 4H4TA 3T14A 3SFEA 5BVAA 3AYLA 2RGOA 1BZLA 1OJAA 3HZLA 4K22A 1XANA 3M12A 3DJDA 3B6DA 3UKQA 2ARDA 1QO8A 3AECA 4NTDA 4GCMA 3SZ0A 3AE5A 3VRDB 4PABA 4REKA 3NRNA 4C77A 4B66A 3DK8A 1Q1RA 1E1MA 2YG6A 1CJ3A 3O0HA 1BWCA 4H7UA 1DODA 2YG7A 2AR8A 3AD7B 1FEAA 1LVLA 2BABA 5JCIA 4TLZA 2BC0A 4J57A 4XXGA 3K7TA 3RP6A 1IJHA 3NHOX 1ZOVA 2YVFA 3EF6A 3GD4A 1L9CA 2WU2A 4H4SA 4BURA 4G74A 4U8KA 1JRYA 5BRTA 1F6MA 1LTXR 3AEEA 2JB3A 4J36A 1BKWA 3CPHG 1OJDA 2A8XA 2I0ZA 1FEBA 5KVHA 3H8IA 4K2XA 2WU5A 3G5QA 3T0KA 1XHCA 3NYCA 2OA1A 1LJ1A 2YLTA 2Y6RA 4G6GA 1CC4A 4HA6A 1GXFA 5KWFA 1CJCA 3DGZA 2YVJA 4WCTA 2OALA 3S5WA 2UZZA 2WOWA 4ICYA 2TPRA 1GESA 3FG2P 3GYXA 2FJBA 1EL9A 2R4JA 3G5SA 3IHMA 5U25A 3T2ZA 4B65A 1H7XA 4OPCA 1QLBA 3K7QX 4PAAA 3GRSA 4APNA 2QAEA 4B69A 2WOVA 2CFYA 2EQ9A 5FS7A 3DGHA 4H2NA 4AP3A 1FECA 4GR1A 3SZCA 3R9UA 1ZKQA 1H84A 5KVIA 2GMHA 2XLRA 3KLJA 1N4VA 2XLPA 3I6DA 3AWIA 3NKSA 1IUSA 2R0PA 3M0OA 2C7GA 2R45A 2X8CA 2YR4A 4A6NB 1NEKA 3G5RA 2ZZCA 2CULA 3ICRA 4H4QA 1OJ9A 2Q0LA 3CGCA 2WDRA 1GRHA 3AD8B 1P2HA 1S2QA 1X31B 3SZFA 3UOYA 1GALA 2O9ZA 1D7LA 3BHKA 3LXDA 2XFQA 3BI5A 3QSEA 2YLWA 4IA6A 3SGLA 2C3CA 1PBCA 5FMHA 3UTFA 2GF3A 3P4SA 1IUTA 2V3BA 4OVIA 2X3NA 3UOZA 4AT2A 1H6VA 1Q1WA 3KVEA 4I58A 1PBEA 4IVMB 3CTYA 2BCPA 2C70A 4Z26A 3AE3A 1NG4A 3T2YA 4H4YA 2BA9A 3SYIA 3VRAA 3IWAA 4J31A 2R46A 2YR6A 1K0IA 3L8KA 4EIPA 4BK1A 5EB4A 3QSSA 1Z6LA 3AE1A 1M64A 2IIDA 4YKGA 3QFBA 4ZN0A 3D8XA 1VQWA 3FBSA 3NK0X 4G6HA 1GT8A 2WOIA 2C67A 1GOSA 3H4KA 3HYXA 3ISHA 3AD9B 1PS9A 2X50A 3UOXA 3AEDA 4YXDA 2WPFA 4RG4A 5JCKA 2HQMA 4EQXA 2R0GA 2WPEA 2WEUA 4KPRA 2PYXA 1GNDA 3CN8A 2EQ7A 1GRGA 4EIQA 3L1RA 5U1OA 4B67A 3CGDA 3ZDNA 3AEAA 1NAAA 2B9XA 2NVKX 1PXBA 1GPEA 2RGHA 4AT0A 3AYIA 4BJZA 4N9XA 1MO9A 3C4AA 4M52A 4X9MA 1ZP0A 1TDFA 2YM1A 3T37A 3UKKA 1TYPA 2A89A 3M13A 3PS9A 4C3YA 2Y6QA 2VZ2A 4JY2A 3GWDA 2VVLA 3NGCX 2BK3A 4O5UA 2XLTA 1CJ4A 3GMBA 3QJ4A 2YLZA 2V5ZA 1PBBA 4EQRA 4U8PA 3CNSA 5KOWA 4B1BA 2DKHA 1DOCA 4FK1A 1FL2A 5EBKA 2BC1A 2RABA 3NLCA 4UDQA 4X4JA 1KF6A 4YWOA 3CPIG 3UP5A 3VQRA 4E0VA 5M10A 4O5QA 4CCQA 4FX9A 1NDAA 2FBWA 1JRXA 1JOAA 3CNTA 3P4PA 2WHDA 4II3A 3RNMA 2XFNA 4H4VA 4NEVA 3JSKA 4A7AA 2ZZBA 4DSHA 3AB1A 3AYJA 5C3JA 4TM0A 3ALLA 4NZHA 2JAEA 4AOSA 3UTHA 2XFOA 3NTDA 1SEZA 2BRAA 4TM1A 4CNJA 2ACZA 3AEGA 4C74A 3REDA 1EL7A 4LIIA 1E1LA 3ALMA 2ZZ0A 2XDOA 1REOA 4Z2UA 3Q6JA 3ABVA 2A87A 2XYOA 1UKVG 3UKLA 4K5SA 5CKUA 4D03A 2CVJA 3SY4A 4UDRA 4Z2RA 1VDCA 1OJTA 1AOGA 1D4DA 3CMMA 3II4A 4K7ZA 4U8MA 4C3XA 1JU2A 1KSUA 1H82A 4G73A 4TM3A 2CDUA 1COYA 3CPJG 3UTEA 2X8GA 1VG0A 1GRAA 4CY6A 1K4QA 2R0CA 3NG7X 4RSLA 4GDEA 1B4VA 2JKCA 1GEUA 4XWZA 5U63A 3SM8A 3ATRA 1BGNA 3ICSA 4BK3A 2V61A 3BNMA 4XWRA 4K5RA 1PN0A 3D1CA 2BS3A 3CNDA 4OPIA 4AOXA 4U8OA 1VG9A 2BXRA 1H83A 2TMDA 1S3BA 4YT0A 1KNRA 1N1PA 4ZCCA 2B9YA 2GMJA 2YG5A 2GQWA 3QVPA 4GRTA 3KPKA 4J2WA 4MJWA 4Y4LA 2BCGG 1NPXA 2QCUA 3BI2A 2C75A 2C64A 2GR3A 3AE4A 3UKFA 5BULA 5KMSA 3NTAA 3F8DA 1E6EA 2VQ7A 2C72A 2IVDA 3OZ2A 2VRMA 3SQPA 1PBFA 4CRTA 1K0JA 1B37A 1GRTA 5TR3A 2WETA 2VVLG 3UOVA 1D4EA 2GQFA 2XLSA 2BXSA 2WP5A 1EL8A 4B68A 3IHGA 1DOEA 2YWLA 5KMPA 1Q9IA 1L0VA 1CF3A 2YLRA 4Z24A 4Z44A 1LQUA 5C2TA 2WBAA 2XLUA 2XVIA 2WDVA 4OPDA 4YSXA 1RP0A 5EB5A 4II2A 5ER0A 2GR2A 2QA1A 3UTGA 4C5OA 2Q6UA 2XVJA 3P9UA 1EBDA 2B7RA 4JDRA 3LZWA 1QJDA 4FK1C 2V3AA 3NYEA 1IUUA 4GDPA 1N4UA 4OPLA 3DJJA 1S2YA 2E1MA 4YSHA 1GV4A 3V3NA 1V59A 1GETA 3EANA 1E7PA 4EM3A 1CC2A 1GRBA 3DK4A 3IF9A 2FJEA 4WX1A 1YY5A 4K8DA 4A99A 5L46A 4TM4A 4Z2TA 1NHPA 1IUWA 3BI4A 4A9WA 4AP1A 1CL0A 4DSGA 1Y56B 1NHRA 1NHQA 5J60A 4X9NA 5GSNA 4NWZA 2GEWA 5IQ4A 1D4CA 1KNPA 1NHSA 5LV9A 2XFUA 4A6NA 2E5VA 4YSYA 1F8SA 2QA2A 3Q9TA 1DNCA 2F5ZA 4OPGA 4RG3A 1GREA 2APGA 3AE6A 2Q0KA 4G9KA 4CBQA 2YLXA 1GRFA 4USRA 1TDEA 4FDCB 4USQA 5HHFA 3ITJA 4H4ZA 3BHFA 3URHA 1GTEA 2FJDA 3DK9A 3NH3X 1IUXA 3UCLA 2OLNA 2V6OA 3FIMB 4YKFA 4EMWA 1PJ6A 1GSNA 1KSSA 1ZOYA 2GV8A 3GYJA 4YTMA 2GH5A 5FS6A 3RP8A 3ZYXA 4JY3A 4CCRA 3AEFA 3NK1X 4GUVA 5KOXA 2BACA 1L9EA 1E39A 2W0HA 4U8NA 5FS8A 2H89A 3IC9A 4BV6A 1VRQB 2YVGA 1PXCA 1YQZA 2OLOA 4NNJA 3GSIA 5HXIA 2XFPA 1O94A 3T31A 1GTHA 1ZMCA 5IPYA 3DJEA 4NEWA 1PJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJA A;  4JN9 A;  1ZDL A;  5KXJ A;  1CJ2 A;  3ATQ A;  2R4E A;  1K0L A;  2B7S A;  2Q7V A;  2B76 A;  2E4G A;  2X99 A;  4I59 A;  3EAO A;  1MOK A;  1E1N A;  2VQB A;  1YQ4 A;  3FMW A;  1L9D A;  3LJP A;  1P2E A;  4LU6 A;  2C65 A;  4H4P A;  3LOV A;  1JNR A;  5J7X A;  3V76 A;  4EQS A;  5FS9 A;  3P1W A;  4H50 A;  1DJN A;  4Z25 A;  1NEN A;  4EQW A;  3S61 A;  4ECH A;  1NG3 A;  2GR0 A;  3F8R A;  3VRB A;  4CY8 A;  3CIR A;  3GWF A;  3K7M X;  1JEH A;  3LZX A;  2GRT A;  4H4R A;  1YQ3 A;  4OCG A;  4LA1 A;  2BYB A;  3DME A;  4D04 A;  1F8W A;  1ZY8 A;  2JBV A;  2JB2 A;  2EQ6 A;  4UP3 A;  4BK2 A;  2VVM A;  1M6I A;  4H2Q A;  3C4N A;  1KDG A;  3DJG X;  1S3E A;  1E1K A;  3GMC A;  1D5T A;  4U8L A;  5GRT A;  3C96 A;  3COX A;  4HB9 A;  3P4R A;  3ICT A;  1DOB A;  3GYI A;  1N4W A;  4B63 A;  1FOH A;  1DXL A;  2R9Z A;  3QSM A;  1PDH A;  4A5L A;  3P4Q A;  4BUR A;  2EQ8 A;  1CBO A;  2WS3 A;  1PHH A;  4UDP A;  4EMJ A;  2YR5 A;  1JRZ A;  2JK6 A;  4OPU A;  1HYU A;  1ZX9 A;  1Y0P A;  4H2P A;  4CNK A;  3F8P A;  1CC6 A;  2C66 A;  1XPQ A;  4NTE A;  2VRL A;  4U8J A;  4YSZ A;  3SFD A;  1DJQ A;  1EL5 A;  1H81 A;  3LB8 A;  1W4X A;  2IVE A;  3B3R A;  4EM4 A;  4U8I A;  4A65 A;  2C3D A;  1D7Y A;  5HYM A;  3UKP A;  2GAH B;  3BNU A;  1H86 A;  2WQY A;  3VR9 A;  3NK2 X;  2GVC A;  2V60 A;  4ADW A;  2YQU A;  3GDN A;  4H2R A;  4ZCD A;  2YAU A;  4KX6 A;  3QVR A;  4Z43 A;  1LQT A;  3NN6 X;  1LV0 A;  2H88 A;  3UKH A;  5JCL A;  3NT6 A;  5JCM A;  1TYT A;  2C73 A;  2GR1 A;  4NTC A;  3NN0 X;  1FCD A;  2YG3 A;  3H8L A;  3CGB A;  1LPF A;  3FPZ A;  2ZBW A;  1PXA A;  2J3N A;  3AE9 A;  3GDP A;  1ONF A;  4JNA A;  2YG4 A;  1TDK A;  5KRQ A;  4BJY A;  3WE0 A;  1TDN A;  3KPF A;  4U2T A;  5JCN A;  3DH9 A;  3K30 A;  3AE2 A;  2X8H A;  4DGK A;  3AXB A;  4Y4N A;  3UKA A;  4DNA A;  5HY5 A;  2NPX A;  3EPT A;  2JB1 A;  1TRB A;  5BUK A;  4JNQ A;  5DBJ A;  4YTP A;  1CHU A;  1MXT A;  4U2S A;  3CGE A;  3E1T A;  4IV9 A;  1RSG A;  1YKJ A;  2BK4 A;  2XVE A;  3ADA B;  3AE8 A;  3PO7 A;  3KKJ A;  1IUV A;  1XDI A;  3AE7 A;  2PHH A;  3I3L A;  4H4U A;  4Y4M A;  4YTN A;  2BK5 A;  2DKI A;  2WPC A;  3NYF A;  3AEB A;  3VR8 A;  4J34 A;  3PVC A;  3DA1 A;  4EMI A;  3LAD A;  4H4W A;  2XVH A;  4A79 A;  1BGJ A;  2XVF A;  1JNZ A;  2WDQ A;  1BF3 A;  3OC4 A;  2BS2 A;  1B8S A;  2AAQ A;  5CQF A;  1OJC A;  2Z5Y A;  1F3P A;  1O5W A;  4H4X A;  5IQ1 A;  1O95 A;  3ALJ A;  4B64 A;  2BS4 A;  3NIX A;  2YM2 A;  3CNJ A;  3KA7 A;  4U2L A;  4OPT A;  1PJ7 A;  4TLX A;  2WP9 A;  4J33 A;  3GD3 A;  2B9W A;  2OAM A;  3UP4 A;  4P9S A;  2C76 A;  1ZMD A;  2WP6 A;  1GER A;  1F8R A;  2XCG A;  4IVO B;  3RP7 A;  4JQ9 A;  1PBD A;  3RHA A;  5EOW A;  1Y56 A;  3QFA A;  2GAG B;  4GF7 A;  4J56 A;  2RGJ A;  1H7W A;  3NNE A;  2Z5X A;  3V3O A;  2AQJ A;  1B5Q A;  1KFY A;  1ZK7 A;  2VOU A;  3GRT A;  2GB0 A;  2YLS A;  4IA5 A;  3KU9 A;  1TDO A;  5M0Z A;  1ELI A;  1RYI A;  3CNP A;  3KD9 A;  2WES A;  4H4T A;  3SFE A;  5BVA A;  3AYL A;  2RGO A;  1BZL A;  1OJA A;  3HZL A;  4K22 A;  1XAN A;  3M12 A;  3DJD A;  3B6D A;  3UKQ A;  2ARD A;  1QO8 A;  3AEC A;  4NTD A;  4GCM A;  3AE5 A;  3VRD B;  4PAB A;  4REK A;  3NRN A;  4C77 A;  4B66 A;  3DK8 A;  1Q1R A;  1E1M A;  2YG6 A;  1CJ3 A;  3O0H A;  1BWC A;  4H7U A;  1DOD A;  2YG7 A;  2AR8 A;  3AD7 B;  1FEA A;  1LVL A;  2BAB A;  5JCI A;  4TLZ A;  2BC0 A;  4J57 A;  4XXG A;  3K7T A;  3RP6 A;  1IJH A;  3NHO X;  1ZOV A;  2YVF A;  3EF6 A;  3GD4 A;  1L9C A;  2WU2 A;  4H4S A;  4U8K A;  1JRY A;  5BRT A;  1F6M A;  1LTX R;  3AEE A;  2JB3 A;  4J36 A;  1BKW A;  3CPH G;  1OJD A;  2A8X A;  2I0Z A;  1FEB A;  5KVH A;  3H8I A;  4K2X A;  2WU5 A;  3G5Q A;  1XHC A;  3NYC A;  2OA1 A;  1LJ1 A;  2YLT A;  2Y6R A;  4HA6 A;  1CC4 A;  5KWF A;  1GXF A;  1CJC A;  3DGZ A;  2YVJ A;  4WCT A;  2OAL A;  3S5W A;  2UZZ A;  2WOW A;  4ICY A;  2TPR A;  1GES A;  3FG2 P;  2FJB A;  1EL9 A;  2R4J A;  3G5S A;  3IHM A;  5U25 A;  4B65 A;  1H7X A;  4OPC A;  1QLB A;  3K7Q X;  4PAA A;  3GRS A;  4APN A;  2QAE A;  4B69 A;  2WOV A;  2CFY A;  2EQ9 A;  5FS7 A;  3DGH A;  4H2N A;  4AP3 A;  1FEC A;  4GR1 A;  3R9U A;  1ZKQ A;  1H84 A;  5KVI A;  2GMH A;  2XLR A;  3KLJ A;  1N4V A;  2XLP A;  3I6D A;  3AWI A;  3NKS A;  1IUS A;  2R0P A;  3M0O A;  2C7G A;  2R45 A;  2X8C A;  2YR4 A;  4A6N B;  1NEK A;  3G5R A;  2ZZC A;  2CUL A;  3ICR A;  4H4Q A;  1OJ9 A;  2Q0L A;  3CGC A;  2WDR A;  1GRH A;  3AD8 B;  1P2H A;  1S2Q A;  1X31 B;  3UOY A;  1GAL A;  2O9Z A;  1D7L A;  3BHK A;  3LXD A;  2XFQ A;  3BI5 A;  3QSE A;  2YLW A;  4IA6 A;  3SGL A;  2C3C A;  1PBC A;  5FMH A;  3UTF A;  2GF3 A;  3P4S A;  1IUT A;  2V3B A;  4OVI A;  2X3N A;  3UOZ A;  4AT2 A;  1H6V A;  1Q1W A;  3KVE A;  4I58 A;  1PBE A;  4IVM B;  3CTY A;  2BCP A;  2C70 A;  4Z26 A;  3AE3 A;  1NG4 A;  4H4Y A;  2BA9 A;  3VRA A;  3IWA A;  4J31 A;  2R46 A;  2YR6 A;  1K0I A;  3L8K A;  4EIP A;  4BK1 A;  5EB4 A;  3QSS A;  1Z6L A;  3AE1 A;  1M64 A;  2IID A;  4YKG A;  3QFB A;  4ZN0 A;  3D8X A;  1VQW A;  3FBS A;  3NK0 X;  1GT8 A;  2WOI A;  2C67 A;  1GOS A;  3H4K A;  3ISH A;  3AD9 B;  1PS9 A;  2X50 A;  3UOX A;  3AED A;  4YXD A;  2WPF A;  4RG4 A;  5JCK A;  2HQM A;  4EQX A;  2R0G A;  2WPE A;  2WEU A;  4KPR A;  2PYX A;  1GND A;  3CN8 A;  2EQ7 A;  1GRG A;  4EIQ A;  3L1R A;  5U1O A;  4B67 A;  3CGD A;  3ZDN A;  3AEA A;  1NAA A;  2B9X A;  2NVK X;  1PXB A;  1GPE A;  2RGH A;  4AT0 A;  3AYI A;  4BJZ A;  4N9X A;  1MO9 A;  3C4A A;  4M52 A;  4X9M A;  1ZP0 A;  1TDF A;  2YM1 A;  3T37 A;  3UKK A;  1TYP A;  2A89 A;  3M13 A;  3PS9 A;  4C3Y A;  2Y6Q A;  2VZ2 A;  4JY2 A;  3GWD A;  2VVL A;  3NGC X;  2BK3 A;  4O5U A;  2XLT A;  1CJ4 A;  3GMB A;  3QJ4 A;  2YLZ A;  2V5Z A;  1PBB A;  4EQR A;  4U8P A;  3CNS A;  5KOW A;  4B1B A;  2DKH A;  1DOC A;  4FK1 A;  1FL2 A;  5EBK A;  2BC1 A;  2RAB A;  3NLC A;  4UDQ A;  4X4J A;  1KF6 A;  4YWO A;  3CPI G;  3UP5 A;  3VQR A;  4E0V A;  5M10 A;  4O5Q A;  4CCQ A;  4FX9 A;  1NDA A;  2FBW A;  1JRX A;  1JOA A;  3CNT A;  3P4P A;  2WHD A;  4DSH A;  3RNM A;  2XFN A;  4H4V A;  4NEV A;  3JSK A;  4A7A A;  2ZZB A;  3AB1 A;  3AYJ A;  5C3J A;  4TM0 A;  3ALL A;  4NZH A;  2JAE A;  4AOS A;  3UTH A;  2XFO A;  3NTD A;  1SEZ A;  4TM1 A;  4CNJ A;  2ACZ A;  3AEG A;  4C74 A;  3RED A;  1EL7 A;  4LII A;  1E1L A;  3ALM A;  2ZZ0 A;  2XDO A;  1REO A;  4Z2U A;  3Q6J A;  3ABV A;  2A87 A;  2XYO A;  1UKV G;  3UKL A;  4K5S A;  5CKU A;  4D03 A;  2CVJ A;  4UDR A;  4Z2R A;  1VDC A;  1OJT A;  1AOG A;  1D4D A;  4K7Z A;  3II4 A;  4U8M A;  4C3X A;  1JU2 A;  1KSU A;  1H82 A;  4TM3 A;  2CDU A;  1COY A;  3CPJ G;  3UTE A;  2X8G A;  1VG0 A;  1GRA A;  4CY6 A;  1K4Q A;  2R0C A;  3NG7 X;  4RSL A;  4GDE A;  1B4V A;  2JKC A;  1GEU A;  4XWZ A;  5U63 A;  3SM8 A;  3ATR A;  1BGN A;  3ICS A;  4BK3 A;  2V61 A;  3BNM A;  4XWR A;  4K5R A;  1PN0 A;  3D1C A;  2BS3 A;  3CND A;  4OPI A;  4AOX A;  4U8O A;  1VG9 A;  2BXR A;  1H83 A;  2TMD A;  1S3B A;  4YT0 A;  1KNR A;  1N1P A;  4ZCC A;  2B9Y A;  2GMJ A;  2YG5 A;  2GQW A;  3QVP A;  4GRT A;  4J2W A;  4MJW A;  4Y4L A;  2BCG G;  1NPX A;  2QCU A;  3BI2 A;  2C75 A;  2C64 A;  2GR3 A;  3AE4 A;  3UKF A;  5BUL A;  3NTA A;  3F8D A;  1E6E A;  2VQ7 A;  2C72 A;  2IVD A;  3OZ2 A;  2VRM A;  3SQP A;  1PBF A;  4CRT A;  1K0J A;  1B37 A;  1GRT A;  5TR3 A;  2WET A;  2VVL G;  3UOV A;  1D4E A;  2GQF A;  2XLS A;  2BXS A;  2WP5 A;  1EL8 A;  4B68 A;  3IHG A;  1DOE A;  2YWL A;  1Q9I A;  1L0V A;  1CF3 A;  2YLR A;  4Z24 A;  4Z44 A;  1LQU A;  5C2T A;  2WBA A;  2XLU A;  2XVI A;  2WDV A;  4OPD A;  4YSX A;  1RP0 A;  5EB5 A;  5ER0 A;  4C5O A;  2GR2 A;  2QA1 A;  3UTG A;  2Q6U A;  2XVJ A;  3P9U A;  1EBD A;  2B7R A;  4JDR A;  3LZW A;  1QJD A;  4FK1 C;  2V3A A;  3NYE A;  1IUU A;  4GDP A;  1N4U A;  4OPL A;  3DJJ A;  1S2Y A;  2E1M A;  4YSH A;  1GV4 A;  3V3N A;  1V59 A;  1GET A;  3EAN A;  1E7P A;  4EM3 A;  1CC2 A;  1GRB A;  3DK4 A;  3IF9 A;  2FJE A;  4WX1 A;  1YY5 A;  4K8D A;  4A99 A;  5L46 A;  4TM4 A;  4Z2T A;  1NHP A;  1IUW A;  3BI4 A;  4A9W A;  4AP1 A;  1CL0 A;  4DSG A;  1Y56 B;  1NHR A;  1NHQ A;  5J60 A;  4X9N A;  5GSN A;  2GEW A;  5IQ4 A;  1D4C A;  1KNP A;  1NHS A;  5LV9 A;  2XFU A;  4A6N A;  2E5V A;  4YSY A;  1F8S A;  2QA2 A;  3Q9T A;  1DNC A;  2F5Z A;  4OPG A;  4RG3 A;  1GRE A;  2APG A;  3AE6 A;  2Q0K A;  4CBQ A;  2YLX A;  1GRF A;  4USR A;  1TDE A;  4FDC B;  4USQ A;  5HHF A;  3ITJ A;  4H4Z A;  3BHF A;  3URH A;  1GTE A;  2FJD A;  3DK9 A;  3NH3 X;  1IUX A;  3UCL A;  2OLN A;  2V6O A;  3FIM B;  4YKF A;  4EMW A;  1PJ6 A;  1GSN A;  1KSS A;  1ZOY A;  2GV8 A;  3GYJ A;  4YTM A;  2GH5 A;  5FS6 A;  3RP8 A;  3ZYX A;  4JY3 A;  4CCR A;  3AEF A;  3NK1 X;  4GUV A;  5KOX A;  2BAC A;  1L9E A;  1E39 A;  2W0H A;  4U8N A;  5FS8 A;  2H89 A;  3IC9 A;  4BV6 A;  1VRQ B;  2YVG A;  1PXC A;  1YQZ A;  2OLO A;  3GSI A;  5HXI A;  2XFP A;  1O94 A;  1GTH A;  1ZMC A;  5IPY A;  3DJE A;  4NEW A;  1PJ5 A; 
#chains in the Genus database with same CATH topology
 2FJA A;  4JN9 A;  1ZDL A;  5KXJ A;  1CJ2 A;  3ATQ A;  2R4E A;  1K0L A;  2B7S A;  2Q7V A;  2B76 A;  2E4G A;  2X99 A;  4I59 A;  3EAO A;  1MOK A;  1E1N A;  2VQB A;  1YQ4 A;  3FMW A;  1L9D A;  3LJP A;  1P2E A;  4LU6 A;  2C65 A;  4H4P A;  3LOV A;  1JNR A;  5J7X A;  3V76 A;  4EQS A;  5FS9 A;  3P1W A;  4H50 A;  1DJN A;  4Z25 A;  1NEN A;  4EQW A;  3S61 A;  4ECH A;  1NG3 A;  2GR0 A;  3F8R A;  3VRB A;  4CY8 A;  3CIR A;  3GWF A;  3K7M X;  1JEH A;  3LZX A;  2GRT A;  4H4R A;  1YQ3 A;  4GAV A;  4OCG A;  4LA1 A;  2BYB A;  3DME A;  4D04 A;  1F8W A;  1ZY8 A;  2JBV A;  2JB2 A;  2EQ6 A;  4UP3 A;  3HYV A;  4BK2 A;  2VVM A;  1M6I A;  4H2Q A;  3C4N A;  1KDG A;  3DJG X;  1S3E A;  1E1K A;  3GMC A;  1D5T A;  4U8L A;  5GRT A;  3C96 A;  3COX A;  4HB9 A;  3P4R A;  3ICT A;  1DOB A;  3GYI A;  1N4W A;  4B63 A;  1FOH A;  1DXL A;  2R9Z A;  3QSM A;  1PDH A;  4A5L A;  3P4Q A;  3SXI A;  2EQ8 A;  1CBO A;  2WS3 A;  1PHH A;  4UDP A;  4EMJ A;  2YR5 A;  1JRZ A;  2JK6 A;  4OPU A;  1HYU A;  1ZX9 A;  1Y0P A;  4H2P A;  4CNK A;  3F8P A;  1CC6 A;  2C66 A;  1XPQ A;  4NTE A;  2VRL A;  4U8J A;  4YSZ A;  3SFD A;  1DJQ A;  1EL5 A;  1H81 A;  3LB8 A;  1W4X A;  2IVE A;  3B3R A;  4EM4 A;  4U8I A;  4A65 A;  2C3D A;  1D7Y A;  5HYM A;  3UKP A;  2GAH B;  3BNU A;  1H86 A;  2WQY A;  3VR9 A;  3NK2 X;  2GVC A;  2V60 A;  4ADW A;  3T2K A;  2YQU A;  3GDN A;  4H2R A;  4ZCD A;  2YAU A;  2BRY A;  4KX6 A;  3QVR A;  4Z43 A;  1LQT A;  3NN6 X;  1LV0 A;  2H88 A;  3UKH A;  5JCL A;  3NT6 A;  5JCM A;  1TYT A;  2C73 A;  2GR1 A;  4NTC A;  3NN0 X;  1FCD A;  2YG3 A;  3H8L A;  3CGB A;  1LPF A;  3FPZ A;  2ZBW A;  1PXA A;  2J3N A;  3AE9 A;  3GDP A;  1ONF A;  4JNA A;  2YG4 A;  1TDK A;  5KRQ A;  4BJY A;  3WE0 A;  1TDN A;  3KPF A;  4U2T A;  5JCN A;  3DH9 A;  3K30 A;  3AE2 A;  2X8H A;  4DGK A;  3AXB A;  4Y4N A;  3UKA A;  4DNA A;  5HY5 A;  2NPX A;  3EPT A;  5KMQ A;  2JB1 A;  1TRB A;  5BUK A;  4JNQ A;  5DBJ A;  4YTP A;  1CHU A;  1MXT A;  4U2S A;  3CGE A;  3E1T A;  4IV9 A;  1RSG A;  1YKJ A;  2BK4 A;  2XVE A;  3ADA B;  3AE8 A;  3PO7 A;  3KKJ A;  1IUV A;  1XDI A;  3AE7 A;  2PHH A;  3I3L A;  4H4U A;  4Y4M A;  4YTN A;  2BK5 A;  2DKI A;  2WPC A;  3NYF A;  3AEB A;  3VR8 A;  3SZW A;  4J34 A;  3PVC A;  3DA1 A;  4EMI A;  3LAD A;  4H4W A;  2XVH A;  4A79 A;  1BGJ A;  2XVF A;  3HYW A;  1JNZ A;  2WDQ A;  1BF3 A;  5KNL A;  3OC4 A;  2BS2 A;  1B8S A;  2AAQ A;  2C4C A;  1OJC A;  2Z5Y A;  5CQF A;  1F3P A;  1O5W A;  4H4X A;  5IQ1 A;  1O95 A;  3ALJ A;  4B64 A;  2BS4 A;  3NIX A;  2YM2 A;  3CNJ A;  3KA7 A;  4U2L A;  4OPT A;  1PJ7 A;  4TLX A;  2WP9 A;  4J33 A;  3GD3 A;  2B9W A;  2OAM A;  3UP4 A;  4P9S A;  5KMR A;  2C76 A;  1ZMD A;  2WP6 A;  3SX6 A;  1GER A;  1F8R A;  2XCG A;  4IVO B;  3RP7 A;  4JQ9 A;  1PBD A;  3RHA A;  5EOW A;  1Y56 A;  3QFA A;  2GAG B;  4GF7 A;  4J56 A;  2RGJ A;  1H7W A;  3NNE A;  2Z5X A;  3V3O A;  2AQJ A;  1B5Q A;  1KFY A;  1ZK7 A;  4GAP A;  2VOU A;  3GRT A;  2GB0 A;  2YLS A;  4IA5 A;  3KU9 A;  1TDO A;  5M0Z A;  1ELI A;  1RYI A;  3CNP A;  3KD9 A;  2WES A;  4H4T A;  3T14 A;  3SFE A;  5BVA A;  3AYL A;  2RGO A;  1BZL A;  1OJA A;  3HZL A;  4K22 A;  1XAN A;  3M12 A;  3DJD A;  3B6D A;  3UKQ A;  2ARD A;  1QO8 A;  3AEC A;  4NTD A;  4GCM A;  3SZ0 A;  3AE5 A;  3VRD B;  4PAB A;  4REK A;  3NRN A;  4C77 A;  4B66 A;  3DK8 A;  1Q1R A;  1E1M A;  2YG6 A;  1CJ3 A;  3O0H A;  1BWC A;  4H7U A;  1DOD A;  2YG7 A;  2AR8 A;  3AD7 B;  1FEA A;  1LVL A;  2BAB A;  5JCI A;  4TLZ A;  2BC0 A;  4J57 A;  4XXG A;  3K7T A;  3RP6 A;  1IJH A;  3NHO X;  1ZOV A;  2YVF A;  3EF6 A;  3GD4 A;  1L9C A;  2WU2 A;  4H4S A;  4BUR A;  4G74 A;  4U8K A;  1JRY A;  5BRT A;  1F6M A;  1LTX R;  3AEE A;  2JB3 A;  4J36 A;  1BKW A;  3CPH G;  1OJD A;  2A8X A;  2I0Z A;  1FEB A;  5KVH A;  3H8I A;  4K2X A;  2WU5 A;  3G5Q A;  3T0K A;  1XHC A;  3NYC A;  2OA1 A;  1LJ1 A;  2YLT A;  2Y6R A;  4G6G A;  1CC4 A;  4HA6 A;  1GXF A;  5KWF A;  1CJC A;  3DGZ A;  2YVJ A;  4WCT A;  2OAL A;  3S5W A;  2UZZ A;  2WOW A;  4ICY A;  2TPR A;  1GES A;  3FG2 P;  3GYX A;  2FJB A;  1EL9 A;  2R4J A;  3G5S A;  3IHM A;  5U25 A;  3T2Z A;  4B65 A;  1H7X A;  4OPC A;  1QLB A;  3K7Q X;  4PAA A;  3GRS A;  4APN A;  2QAE A;  4B69 A;  2WOV A;  2CFY A;  2EQ9 A;  5FS7 A;  3DGH A;  4H2N A;  4AP3 A;  1FEC A;  4GR1 A;  3SZC A;  3R9U A;  1ZKQ A;  1H84 A;  5KVI A;  2GMH A;  2XLR A;  3KLJ A;  1N4V A;  2XLP A;  3I6D A;  3AWI A;  3NKS A;  1IUS A;  2R0P A;  3M0O A;  2C7G A;  2R45 A;  2X8C A;  2YR4 A;  4A6N B;  1NEK A;  3G5R A;  2ZZC A;  2CUL A;  3ICR A;  4H4Q A;  1OJ9 A;  2Q0L A;  3CGC A;  2WDR A;  1GRH A;  3AD8 B;  1P2H A;  1S2Q A;  1X31 B;  3SZF A;  3UOY A;  1GAL A;  2O9Z A;  1D7L A;  3BHK A;  3LXD A;  2XFQ A;  3BI5 A;  3QSE A;  2YLW A;  4IA6 A;  3SGL A;  2C3C A;  1PBC A;  5FMH A;  3UTF A;  2GF3 A;  3P4S A;  1IUT A;  2V3B A;  4OVI A;  2X3N A;  3UOZ A;  4AT2 A;  1H6V A;  1Q1W A;  3KVE A;  4I58 A;  1PBE A;  4IVM B;  3CTY A;  2BCP A;  2C70 A;  4Z26 A;  3AE3 A;  1NG4 A;  3T2Y A;  4H4Y A;  2BA9 A;  3SYI A;  3VRA A;  3IWA A;  4J31 A;  2R46 A;  2YR6 A;  1K0I A;  3L8K A;  4EIP A;  4BK1 A;  5EB4 A;  3QSS A;  1Z6L A;  3AE1 A;  1M64 A;  2IID A;  4YKG A;  3QFB A;  4ZN0 A;  3D8X A;  1VQW A;  3FBS A;  3NK0 X;  4G6H A;  1GT8 A;  2WOI A;  2C67 A;  1GOS A;  3H4K A;  3HYX A;  3ISH A;  3AD9 B;  1PS9 A;  2X50 A;  3UOX A;  3AED A;  4YXD A;  2WPF A;  4RG4 A;  5JCK A;  2HQM A;  4EQX A;  2R0G A;  2WPE A;  2WEU A;  4KPR A;  2PYX A;  1GND A;  3CN8 A;  2EQ7 A;  1GRG A;  4EIQ A;  3L1R A;  5U1O A;  4B67 A;  3CGD A;  3ZDN A;  3AEA A;  1NAA A;  2B9X A;  2NVK X;  1PXB A;  1GPE A;  2RGH A;  4AT0 A;  3AYI A;  4BJZ A;  4N9X A;  1MO9 A;  3C4A A;  4M52 A;  4X9M A;  1ZP0 A;  1TDF A;  2YM1 A;  3T37 A;  3UKK A;  1TYP A;  2A89 A;  3M13 A;  3PS9 A;  4C3Y A;  2Y6Q A;  2VZ2 A;  4JY2 A;  3GWD A;  2VVL A;  3NGC X;  2BK3 A;  4O5U A;  2XLT A;  1CJ4 A;  3GMB A;  3QJ4 A;  2YLZ A;  2V5Z A;  1PBB A;  4EQR A;  4U8P A;  3CNS A;  5KOW A;  4B1B A;  2DKH A;  1DOC A;  4FK1 A;  1FL2 A;  5EBK A;  2BC1 A;  2RAB A;  3NLC A;  4UDQ A;  4X4J A;  1KF6 A;  4YWO A;  3CPI G;  3UP5 A;  3VQR A;  4E0V A;  5M10 A;  4O5Q A;  4CCQ A;  4FX9 A;  1NDA A;  2FBW A;  1JRX A;  1JOA A;  3CNT A;  3P4P A;  2WHD A;  4II3 A;  3RNM A;  2XFN A;  4H4V A;  4NEV A;  3JSK A;  4A7A A;  2ZZB A;  4DSH A;  3AB1 A;  3AYJ A;  5C3J A;  4TM0 A;  3ALL A;  4NZH A;  2JAE A;  4AOS A;  3UTH A;  2XFO A;  3NTD A;  1SEZ A;  2BRA A;  4TM1 A;  4CNJ A;  2ACZ A;  3AEG A;  4C74 A;  3RED A;  1EL7 A;  4LII A;  1E1L A;  3ALM A;  2ZZ0 A;  2XDO A;  1REO A;  4Z2U A;  3Q6J A;  3ABV A;  2A87 A;  2XYO A;  1UKV G;  3UKL A;  4K5S A;  5CKU A;  4D03 A;  2CVJ A;  3SY4 A;  4UDR A;  4Z2R A;  1VDC A;  1OJT A;  1AOG A;  1D4D A;  3CMM A;  3II4 A;  4K7Z A;  4U8M A;  4C3X A;  1JU2 A;  1KSU A;  1H82 A;  4G73 A;  4TM3 A;  2CDU A;  1COY A;  3CPJ G;  3UTE A;  2X8G A;  1VG0 A;  1GRA A;  4CY6 A;  1K4Q A;  2R0C A;  3NG7 X;  4RSL A;  4GDE A;  1B4V A;  2JKC A;  1GEU A;  4XWZ A;  5U63 A;  3SM8 A;  3ATR A;  1BGN A;  3ICS A;  4BK3 A;  2V61 A;  3BNM A;  4XWR A;  4K5R A;  1PN0 A;  3D1C A;  2BS3 A;  3CND A;  4OPI A;  4AOX A;  4U8O A;  1VG9 A;  2BXR A;  1H83 A;  2TMD A;  1S3B A;  4YT0 A;  1KNR A;  1N1P A;  4ZCC A;  2B9Y A;  2GMJ A;  2YG5 A;  2GQW A;  3QVP A;  4GRT A;  3KPK A;  4J2W A;  4MJW A;  4Y4L A;  2BCG G;  1NPX A;  2QCU A;  3BI2 A;  2C75 A;  2C64 A;  2GR3 A;  3AE4 A;  3UKF A;  5BUL A;  5KMS A;  3NTA A;  3F8D A;  1E6E A;  2VQ7 A;  2C72 A;  2IVD A;  3OZ2 A;  2VRM A;  3SQP A;  1PBF A;  4CRT A;  1K0J A;  1B37 A;  1GRT A;  5TR3 A;  2WET A;  2VVL G;  3UOV A;  1D4E A;  2GQF A;  2XLS A;  2BXS A;  2WP5 A;  1EL8 A;  4B68 A;  3IHG A;  1DOE A;  2YWL A;  5KMP A;  1Q9I A;  1L0V A;  1CF3 A;  2YLR A;  4Z24 A;  4Z44 A;  1LQU A;  5C2T A;  2WBA A;  2XLU A;  2XVI A;  2WDV A;  4OPD A;  4YSX A;  1RP0 A;  5EB5 A;  4II2 A;  5ER0 A;  2GR2 A;  2QA1 A;  3UTG A;  4C5O A;  2Q6U A;  2XVJ A;  3P9U A;  1EBD A;  2B7R A;  4JDR A;  3LZW A;  1QJD A;  4FK1 C;  2V3A A;  3NYE A;  1IUU A;  4GDP A;  1N4U A;  4OPL A;  3DJJ A;  1S2Y A;  2E1M A;  4YSH A;  1GV4 A;  3V3N A;  1V59 A;  1GET A;  3EAN A;  1E7P A;  4EM3 A;  1CC2 A;  1GRB A;  3DK4 A;  3IF9 A;  2FJE A;  4WX1 A;  1YY5 A;  4K8D A;  4A99 A;  5L46 A;  4TM4 A;  4Z2T A;  1NHP A;  1IUW A;  3BI4 A;  4A9W A;  4AP1 A;  1CL0 A;  4DSG A;  1Y56 B;  1NHR A;  1NHQ A;  5J60 A;  4X9N A;  5GSN A;  4NWZ A;  2GEW A;  5IQ4 A;  1D4C A;  1KNP A;  1NHS A;  5LV9 A;  2XFU A;  4A6N A;  2E5V A;  4YSY A;  1F8S A;  2QA2 A;  3Q9T A;  1DNC A;  2F5Z A;  4OPG A;  4RG3 A;  1GRE A;  2APG A;  3AE6 A;  2Q0K A;  4G9K A;  4CBQ A;  2YLX A;  1GRF A;  4USR A;  1TDE A;  4FDC B;  4USQ A;  5HHF A;  3ITJ A;  4H4Z A;  3BHF A;  3URH A;  1GTE A;  2FJD A;  3DK9 A;  3NH3 X;  1IUX A;  3UCL A;  2OLN A;  2V6O A;  3FIM B;  4YKF A;  4EMW A;  1PJ6 A;  1GSN A;  1KSS A;  1ZOY A;  2GV8 A;  3GYJ A;  4YTM A;  2GH5 A;  5FS6 A;  3RP8 A;  3ZYX A;  4JY3 A;  4CCR A;  3AEF A;  3NK1 X;  4GUV A;  5KOX A;  2BAC A;  1L9E A;  1E39 A;  2W0H A;  4U8N A;  5FS8 A;  2H89 A;  3IC9 A;  4BV6 A;  1VRQ B;  2YVG A;  1PXC A;  1YQZ A;  2OLO A;  4NNJ A;  3GSI A;  5HXI A;  2XFP A;  1O94 A;  3T31 A;  1GTH A;  1ZMC A;  5IPY A;  3DJE A;  4NEW A;  1PJ5 A; 
#chains in the Genus database with same CATH homology
 2FJA A;  4JN9 A;  1ZDL A;  5KXJ A;  1CJ2 A;  3ATQ A;  2R4E A;  1K0L A;  2B7S A;  2Q7V A;  2B76 A;  2E4G A;  2X99 A;  4I59 A;  3EAO A;  1MOK A;  1E1N A;  2VQB A;  1YQ4 A;  3FMW A;  1L9D A;  3LJP A;  1P2E A;  4LU6 A;  2C65 A;  4H4P A;  3LOV A;  1JNR A;  5J7X A;  3V76 A;  4EQS A;  5FS9 A;  3P1W A;  4H50 A;  1DJN A;  4Z25 A;  1NEN A;  4EQW A;  3S61 A;  4ECH A;  1NG3 A;  2GR0 A;  3F8R A;  3VRB A;  4CY8 A;  3CIR A;  3GWF A;  3K7M X;  1JEH A;  3LZX A;  2GRT A;  4H4R A;  1YQ3 A;  4GAV A;  4OCG A;  4LA1 A;  2BYB A;  3DME A;  4D04 A;  1F8W A;  1ZY8 A;  2JBV A;  2JB2 A;  2EQ6 A;  4UP3 A;  3HYV A;  4BK2 A;  2VVM A;  1M6I A;  4H2Q A;  3C4N A;  1KDG A;  3DJG X;  1S3E A;  1E1K A;  3GMC A;  1D5T A;  4U8L A;  5GRT A;  3C96 A;  3COX A;  4HB9 A;  3P4R A;  3ICT A;  1DOB A;  3GYI A;  1N4W A;  4B63 A;  1FOH A;  1DXL A;  2R9Z A;  3QSM A;  1PDH A;  4A5L A;  3P4Q A;  3SXI A;  2EQ8 A;  1CBO A;  2WS3 A;  1PHH A;  4UDP A;  4EMJ A;  2YR5 A;  1JRZ A;  2JK6 A;  4OPU A;  1HYU A;  1ZX9 A;  1Y0P A;  4H2P A;  4CNK A;  3F8P A;  1CC6 A;  2C66 A;  1XPQ A;  4NTE A;  2VRL A;  4U8J A;  4YSZ A;  3SFD A;  1DJQ A;  1EL5 A;  1H81 A;  3LB8 A;  1W4X A;  2IVE A;  3B3R A;  4EM4 A;  4U8I A;  4A65 A;  2C3D A;  1D7Y A;  5HYM A;  3UKP A;  2GAH B;  3BNU A;  1H86 A;  2WQY A;  3VR9 A;  3NK2 X;  2GVC A;  2V60 A;  4ADW A;  3T2K A;  2YQU A;  3GDN A;  4H2R A;  4ZCD A;  2YAU A;  2BRY A;  4KX6 A;  3QVR A;  4Z43 A;  1LQT A;  3NN6 X;  1LV0 A;  2H88 A;  3UKH A;  5JCL A;  3NT6 A;  5JCM A;  1TYT A;  2C73 A;  2GR1 A;  4NTC A;  3NN0 X;  1FCD A;  2YG3 A;  3H8L A;  3CGB A;  1LPF A;  3FPZ A;  2ZBW A;  1PXA A;  2J3N A;  3AE9 A;  3GDP A;  1ONF A;  4JNA A;  2YG4 A;  1TDK A;  5KRQ A;  4BJY A;  3WE0 A;  1TDN A;  3KPF A;  4U2T A;  5JCN A;  3DH9 A;  3K30 A;  3AE2 A;  2X8H A;  4DGK A;  3AXB A;  4Y4N A;  3UKA A;  4DNA A;  5HY5 A;  2NPX A;  3EPT A;  5KMQ A;  2JB1 A;  1TRB A;  5BUK A;  4JNQ A;  5DBJ A;  4YTP A;  1CHU A;  1MXT A;  4U2S A;  3CGE A;  3E1T A;  4IV9 A;  1RSG A;  1YKJ A;  2BK4 A;  2XVE A;  3ADA B;  3AE8 A;  3PO7 A;  3KKJ A;  1IUV A;  1XDI A;  3AE7 A;  2PHH A;  3I3L A;  4H4U A;  4Y4M A;  4YTN A;  2BK5 A;  2DKI A;  2WPC A;  3NYF A;  3AEB A;  3VR8 A;  3SZW A;  4J34 A;  3PVC A;  3DA1 A;  4EMI A;  3LAD A;  4H4W A;  2XVH A;  4A79 A;  1BGJ A;  2XVF A;  3HYW A;  1JNZ A;  2WDQ A;  1BF3 A;  5KNL A;  3OC4 A;  2BS2 A;  1B8S A;  2AAQ A;  2C4C A;  1OJC A;  2Z5Y A;  5CQF A;  1F3P A;  1O5W A;  4H4X A;  5IQ1 A;  1O95 A;  3ALJ A;  4B64 A;  2BS4 A;  3NIX A;  2YM2 A;  3CNJ A;  3KA7 A;  4U2L A;  4OPT A;  1PJ7 A;  4TLX A;  2WP9 A;  4J33 A;  3GD3 A;  2B9W A;  2OAM A;  3UP4 A;  4P9S A;  5KMR A;  2C76 A;  1ZMD A;  2WP6 A;  3SX6 A;  1GER A;  1F8R A;  2XCG A;  4IVO B;  3RP7 A;  4JQ9 A;  1PBD A;  3RHA A;  5EOW A;  1Y56 A;  3QFA A;  2GAG B;  4GF7 A;  4J56 A;  2RGJ A;  1H7W A;  3NNE A;  2Z5X A;  3V3O A;  2AQJ A;  1B5Q A;  1KFY A;  1ZK7 A;  4GAP A;  2VOU A;  3GRT A;  2GB0 A;  2YLS A;  4IA5 A;  3KU9 A;  1TDO A;  5M0Z A;  1ELI A;  1RYI A;  3CNP A;  3KD9 A;  2WES A;  4H4T A;  3T14 A;  3SFE A;  5BVA A;  3AYL A;  2RGO A;  1BZL A;  1OJA A;  3HZL A;  4K22 A;  1XAN A;  3M12 A;  3DJD A;  3B6D A;  3UKQ A;  2ARD A;  1QO8 A;  3AEC A;  4NTD A;  4GCM A;  3SZ0 A;  3AE5 A;  3VRD B;  4PAB A;  4REK A;  3NRN A;  4C77 A;  4B66 A;  3DK8 A;  1Q1R A;  1E1M A;  2YG6 A;  1CJ3 A;  3O0H A;  1BWC A;  4H7U A;  1DOD A;  2YG7 A;  2AR8 A;  3AD7 B;  1FEA A;  1LVL A;  2BAB A;  5JCI A;  4TLZ A;  2BC0 A;  4J57 A;  4XXG A;  3K7T A;  3RP6 A;  1IJH A;  3NHO X;  1ZOV A;  2YVF A;  3EF6 A;  3GD4 A;  1L9C A;  2WU2 A;  4H4S A;  4BUR A;  4G74 A;  4U8K A;  1JRY A;  5BRT A;  1F6M A;  1LTX R;  3AEE A;  2JB3 A;  4J36 A;  1BKW A;  3CPH G;  1OJD A;  2A8X A;  2I0Z A;  1FEB A;  5KVH A;  3H8I A;  4K2X A;  2WU5 A;  3G5Q A;  3T0K A;  1XHC A;  3NYC A;  2OA1 A;  1LJ1 A;  2YLT A;  2Y6R A;  4G6G A;  1CC4 A;  4HA6 A;  1GXF A;  5KWF A;  1CJC A;  3DGZ A;  2YVJ A;  4WCT A;  2OAL A;  3S5W A;  2UZZ A;  2WOW A;  4ICY A;  2TPR A;  1GES A;  3FG2 P;  3GYX A;  2FJB A;  1EL9 A;  2R4J A;  3G5S A;  3IHM A;  5U25 A;  3T2Z A;  4B65 A;  1H7X A;  4OPC A;  1QLB A;  3K7Q X;  4PAA A;  3GRS A;  4APN A;  2QAE A;  4B69 A;  2WOV A;  2CFY A;  2EQ9 A;  5FS7 A;  3DGH A;  4H2N A;  4AP3 A;  1FEC A;  4GR1 A;  3SZC A;  3R9U A;  1ZKQ A;  1H84 A;  5KVI A;  2GMH A;  2XLR A;  3KLJ A;  1N4V A;  2XLP A;  3I6D A;  3AWI A;  3NKS A;  1IUS A;  2R0P A;  3M0O A;  2C7G A;  2R45 A;  2X8C A;  2YR4 A;  4A6N B;  1NEK A;  3G5R A;  2ZZC A;  2CUL A;  3ICR A;  4H4Q A;  1OJ9 A;  2Q0L A;  3CGC A;  2WDR A;  1GRH A;  3AD8 B;  1P2H A;  1S2Q A;  1X31 B;  3SZF A;  3UOY A;  1GAL A;  2O9Z A;  1D7L A;  3BHK A;  3LXD A;  2XFQ A;  3BI5 A;  3QSE A;  2YLW A;  4IA6 A;  3SGL A;  2C3C A;  1PBC A;  5FMH A;  3UTF A;  2GF3 A;  3P4S A;  1IUT A;  2V3B A;  4OVI A;  2X3N A;  3UOZ A;  4AT2 A;  1H6V A;  1Q1W A;  3KVE A;  4I58 A;  1PBE A;  4IVM B;  3CTY A;  2BCP A;  2C70 A;  4Z26 A;  3AE3 A;  1NG4 A;  3T2Y A;  4H4Y A;  2BA9 A;  3SYI A;  3VRA A;  3IWA A;  4J31 A;  2R46 A;  2YR6 A;  1K0I A;  3L8K A;  4EIP A;  4BK1 A;  5EB4 A;  3QSS A;  1Z6L A;  3AE1 A;  1M64 A;  2IID A;  4YKG A;  3QFB A;  4ZN0 A;  3D8X A;  1VQW A;  3FBS A;  3NK0 X;  4G6H A;  1GT8 A;  2WOI A;  2C67 A;  1GOS A;  3H4K A;  3HYX A;  3ISH A;  3AD9 B;  1PS9 A;  2X50 A;  3UOX A;  3AED A;  4YXD A;  2WPF A;  4RG4 A;  5JCK A;  2HQM A;  4EQX A;  2R0G A;  2WPE A;  2WEU A;  4KPR A;  2PYX A;  1GND A;  3CN8 A;  2EQ7 A;  1GRG A;  4EIQ A;  3L1R A;  5U1O A;  4B67 A;  3CGD A;  3ZDN A;  3AEA A;  1NAA A;  2B9X A;  2NVK X;  1PXB A;  1GPE A;  2RGH A;  4AT0 A;  3AYI A;  4BJZ A;  4N9X A;  1MO9 A;  3C4A A;  4M52 A;  4X9M A;  1ZP0 A;  1TDF A;  2YM1 A;  3T37 A;  3UKK A;  1TYP A;  2A89 A;  3M13 A;  3PS9 A;  4C3Y A;  2Y6Q A;  2VZ2 A;  4JY2 A;  3GWD A;  2VVL A;  3NGC X;  2BK3 A;  4O5U A;  2XLT A;  1CJ4 A;  3GMB A;  3QJ4 A;  2YLZ A;  2V5Z A;  1PBB A;  4EQR A;  4U8P A;  3CNS A;  5KOW A;  4B1B A;  2DKH A;  1DOC A;  4FK1 A;  1FL2 A;  5EBK A;  2BC1 A;  2RAB A;  3NLC A;  4UDQ A;  4X4J A;  1KF6 A;  4YWO A;  3CPI G;  3UP5 A;  3VQR A;  4E0V A;  5M10 A;  4O5Q A;  4CCQ A;  4FX9 A;  1NDA A;  2FBW A;  1JRX A;  1JOA A;  3CNT A;  3P4P A;  2WHD A;  4II3 A;  3RNM A;  2XFN A;  4H4V A;  4NEV A;  3JSK A;  4A7A A;  2ZZB A;  4DSH A;  3AB1 A;  3AYJ A;  5C3J A;  4TM0 A;  3ALL A;  4NZH A;  2JAE A;  4AOS A;  3UTH A;  2XFO A;  3NTD A;  1SEZ A;  2BRA A;  4TM1 A;  4CNJ A;  2ACZ A;  3AEG A;  4C74 A;  3RED A;  1EL7 A;  4LII A;  1E1L A;  3ALM A;  2ZZ0 A;  2XDO A;  1REO A;  4Z2U A;  3Q6J A;  3ABV A;  2A87 A;  2XYO A;  1UKV G;  3UKL A;  4K5S A;  5CKU A;  4D03 A;  2CVJ A;  3SY4 A;  4UDR A;  4Z2R A;  1VDC A;  1OJT A;  1AOG A;  1D4D A;  3CMM A;  3II4 A;  4K7Z A;  4U8M A;  4C3X A;  1JU2 A;  1KSU A;  1H82 A;  4G73 A;  4TM3 A;  2CDU A;  1COY A;  3CPJ G;  3UTE A;  2X8G A;  1VG0 A;  1GRA A;  4CY6 A;  1K4Q A;  2R0C A;  3NG7 X;  4RSL A;  4GDE A;  1B4V A;  2JKC A;  1GEU A;  4XWZ A;  5U63 A;  3SM8 A;  3ATR A;  1BGN A;  3ICS A;  4BK3 A;  2V61 A;  3BNM A;  4XWR A;  4K5R A;  1PN0 A;  3D1C A;  2BS3 A;  3CND A;  4OPI A;  4AOX A;  4U8O A;  1VG9 A;  2BXR A;  1H83 A;  2TMD A;  1S3B A;  4YT0 A;  1KNR A;  1N1P A;  4ZCC A;  2B9Y A;  2GMJ A;  2YG5 A;  2GQW A;  3QVP A;  4GRT A;  3KPK A;  4J2W A;  4MJW A;  4Y4L A;  2BCG G;  1NPX A;  2QCU A;  3BI2 A;  2C75 A;  2C64 A;  2GR3 A;  3AE4 A;  3UKF A;  5BUL A;  5KMS A;  3NTA A;  3F8D A;  1E6E A;  2VQ7 A;  2C72 A;  2IVD A;  3OZ2 A;  2VRM A;  3SQP A;  1PBF A;  4CRT A;  1K0J A;  1B37 A;  1GRT A;  5TR3 A;  2WET A;  2VVL G;  3UOV A;  1D4E A;  2GQF A;  2XLS A;  2BXS A;  2WP5 A;  1EL8 A;  4B68 A;  3IHG A;  1DOE A;  2YWL A;  5KMP A;  1Q9I A;  1L0V A;  1CF3 A;  2YLR A;  4Z24 A;  4Z44 A;  1LQU A;  5C2T A;  2WBA A;  2XLU A;  2XVI A;  2WDV A;  4OPD A;  4YSX A;  1RP0 A;  5EB5 A;  4II2 A;  5ER0 A;  2GR2 A;  2QA1 A;  3UTG A;  4C5O A;  2Q6U A;  2XVJ A;  3P9U A;  1EBD A;  2B7R A;  4JDR A;  3LZW A;  1QJD A;  4FK1 C;  2V3A A;  3NYE A;  1IUU A;  4GDP A;  1N4U A;  4OPL A;  3DJJ A;  1S2Y A;  2E1M A;  4YSH A;  1GV4 A;  3V3N A;  1V59 A;  1GET A;  3EAN A;  1E7P A;  4EM3 A;  1CC2 A;  1GRB A;  3DK4 A;  3IF9 A;  2FJE A;  4WX1 A;  1YY5 A;  4K8D A;  4A99 A;  5L46 A;  4TM4 A;  4Z2T A;  1NHP A;  1IUW A;  3BI4 A;  4A9W A;  4AP1 A;  1CL0 A;  4DSG A;  1Y56 B;  1NHR A;  1NHQ A;  5J60 A;  4X9N A;  5GSN A;  4NWZ A;  2GEW A;  5IQ4 A;  1D4C A;  1KNP A;  1NHS A;  5LV9 A;  2XFU A;  4A6N A;  2E5V A;  4YSY A;  1F8S A;  2QA2 A;  3Q9T A;  1DNC A;  2F5Z A;  4OPG A;  4RG3 A;  1GRE A;  2APG A;  3AE6 A;  2Q0K A;  4G9K A;  4CBQ A;  2YLX A;  1GRF A;  4USR A;  1TDE A;  4FDC B;  4USQ A;  5HHF A;  3ITJ A;  4H4Z A;  3BHF A;  3URH A;  1GTE A;  2FJD A;  3DK9 A;  3NH3 X;  1IUX A;  3UCL A;  2OLN A;  2V6O A;  3FIM B;  4YKF A;  4EMW A;  1PJ6 A;  1GSN A;  1KSS A;  1ZOY A;  2GV8 A;  3GYJ A;  4YTM A;  2GH5 A;  5FS6 A;  3RP8 A;  3ZYX A;  4JY3 A;  4CCR A;  3AEF A;  3NK1 X;  4GUV A;  5KOX A;  2BAC A;  1L9E A;  1E39 A;  2W0H A;  4U8N A;  5FS8 A;  2H89 A;  3IC9 A;  4BV6 A;  1VRQ B;  2YVG A;  1PXC A;  1YQZ A;  2OLO A;  4NNJ A;  3GSI A;  5HXI A;  2XFP A;  1O94 A;  3T31 A;  1GTH A;  1ZMC A;  5IPY A;  3DJE A;  4NEW A;  1PJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...