4A65A

Crystal structure of the thioredoxin reductase from entamoeba histolytica with aucn
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
IHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 89
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a65A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a65A02
1NPXA 1RYIA 1CL0A 5BVAA 5BULA 1SEZA 4GR1A 3AECA 4BURA 4B64A 1CJCA 3DGZA 2AR8A 2V5ZA 2C72A 1PXCA 3CN8A 2QCUA 4KPRA 1GSNA 1N4VA 2XVHA 3AE7A 3ALMA 3REDA 1GRAA 1FEAA 1RP0A 4NEVA 3SGLA 1GESA 2O9ZA 5JCKA 4AP3A 1Z6LA 4YTPA 1GERA 3OC4A 4EM4A 4EQSA 4YSYA 4K22A 2V3AA 3F8PA 2GRTA 5HHFA 1KDGA 1H83A 4TM0A 1TDOA 4OCGA 2XFOA 1IUSA 2WETA 4AT2A 1AOGA 4U8IA 5FS9A 3II4A 4Y4LA 1KSSA 3UOXA 4A6NA 1PDHA 4EQRA 1DJNA 2BC0A 1EBDA 3CNSA 4GDPA 4C3XA 1LJ1A 3ITJA 4C77A 2C7GA 4Z2TA 3NHOX 1ZMDA 3CNJA 4J57A 1P2HA 4A5LA 3C96A 2HQMA 3AEAA 4N9XA 3CPJG 1GV4A 3QSEA 3CNTA 1PBDA 2YG5A 2V6OA 4H2RA 4A7AA 3P4PA 3KD9A 1OJDA 1FL2A 3FBSA 4TM4A 4NTEA 3IHMA 4O5UA 5KOWA 2B9XA 2DKHA 3EAOA 2FBWA 2YQUA 1GT8A 4XXGA 4NEWA 2Q0LA 1H6VA 2JBVA 3AWIA 3DJJA 4IA6A 3PVCA 2GF3A 2YLXA 2YVGA 3AXBA 1NHRA 1YQ4A 5EB5A 1W4XA 3PO7A 2R4JA 3UTEA 2C67A 4I59A 3S61A 5U1OA 4M52A 1PS9A 5M10A 3NLCA 1E1MA 1DOCA 2RGJA 2UZZA 4XWRA 2FJEA 1BGNA 5FMHA 3UP4A 1ZKQA 1YY5A 1KFYA 1F3PA 2C76A 3KLJA 1K0JA 1N4WA 1OJ9A 2A89A 2R4EA 5KRQA 2BS4A 3ZDNA 3DJEA 2GR2A 4D03A 1MOKA 3QFAA 2CULA 3BHFA 2VQ7A 3QSMA 4TLZA 1GALA 2XVJA 3ICSA 5L46A 3AE8A 5JCLA 4D04A 5HYMA 3ZYXA 1D4EA 3QJ4A 4B66A 1JRXA 1ONFA 2V3BA 3LXDA 4Z26A 2JB2A 3KU9A 1IJHA 4RSLA 3UTHA 4UP3A 4ADWA 2GH5A 1IUWA 1GNDA 3BI2A 1PBEA 4FDCB 1LPFA 3VQRA 1Y0PA 2E5VA 2NVKX 4BK3A 4MJWA 4K5RA 3GYIA 3PS9A 3AE2A 3IWAA 1OJAA 2CVJA 4BK2A 3NRNA 2WP9A 1YKJA 3ICRA 4Z25A 5TR3A 2AAQA 3I3LA 1CJ3A 3LADA 4YXDA 1E1KA 2BK4A 2OA1A 1LV0A 3NNEA 5IPYA 1Q9IA 4EMJA 2WPFA 1PJ7A 4GCMA 1JNZA 1B37A 1ZDLA 2GEWA 2H88A 3UOVA 4U8JA 5JCIA 2F5ZA 4Z24A 3H8IA 4JY3A 3NK1X 2Q0KA 4YKGA 1OJCA 4AT0A 3AYLA 1QO8A 1ZY8A 3GWFA 3UP5A 1FCDA 3K30A 4ICYA 3O0HA 2A87A 4X4JA 4EMIA 2NPXA 1KNPA 1TDNA 1L0VA 2XLUA 2GQFA 4H2QA 2BCGG 4JNAA 5KWFA 1Y56A 4LA1A 2WDVA 5ER0A 2PHHA 1YQZA 2YG7A 3NYFA 4C3YA 4H50A 5JCNA 5KXJA 4A9WA 1CJ2A 3GD4A 4WCTA 3BNMA 3KVEA 1TYTA 3AD7B 4H4RA 1ELIA 1XHCA 4ZCCA 1E6EA 2WU5A 1LVLA 3CGBA 3K7QX 4U8OA 3VRBA 4FK1A 1PXAA 4H2PA 1V59A 2JAEA 2TMDA 4JY2A 4USRA 4X9NA 1TDKA 1RSGA 4YTMA 2VVMA 2C64A 1TDEA 1S2QA 2CDUA 1PXBA 3EANA 5J60A 1BGJA 4EQXA 4HB9A 2WOIA 3BNUA 2YG6A 2ZBWA 3NIXA 2B9YA 1NDAA 3KPFA 4ZCDA 1ZOVA 3CNDA 3GD3A 4J2WA 3P1WA 3SM8A 3NYEA 1GRHA 2EQ6A 1DXLA 4DSGA 1ZMCA 1B5QA 2YM2A 5KVHA 3UKFA 4B67A 3LJPA 1VG9A 3LOVA 3QSSA 1MO9A 2X3NA 3UKPA 3I6DA 2ARDA 1P2EA 3G5SA 3NH3X 4TM3A 3UKAA 3IF9A 1S3BA 1HYUA 4YT0A 3CGDA 2R9ZA 2XVEA 2WHDA 3ALLA 5BUKA 2FJBA 4H4XA 3NGCX 1CC2A 1LTXR 4O5QA 1H81A 4CNJA 1PBBA 2VVLG 1GEUA 2C75A 3EF6A 3P4RA 2Q7VA 5HY5A 1F6MA 2BS2A 2WOVA 1E39A 2YR4A 1K0IA 1GOSA 4C74A 1NHPA 2XVFA 2R45A 4RG3A 2VVLA 2YWLA 1NHSA 3UKLA 4DSHA 3C4AA 1PN0A 5LV9A 1GETA 3Q9TA 4ZN0A 3URHA 3AEDA 1F8WA 4U8LA 5C3JA 4YSXA 2YLRA 2XFNA 1FOHA 3GYJA 3G5QA 4BJZA 4OVIA 4JQ9A 2BYBA 2QAEA 4B1BA 4B68A 1H84A 5C2TA 1PBFA 2GQWA 3CNPA 5J7XA 4IVOB 2E1MA 2GR0A 2XDOA 2GAGB 2WPEA 3K7TA 4J36A 2WP5A 3D1CA 3NKSA 4PAAA 5BRTA 4DNAA 4IA5A 3CTYA 2RGHA 2BXSA 5FS7A 2X8GA 4K5SA 1EL9A 3RP7A 4U8NA 1NG3A 1K4QA 2C3CA 4B69A 4PABA 1GRGA 3HZLA 1JNRA 2XFUA 3AYIA 4A79A 1D7LA 2X8HA 5IQ1A 3FG2P 3VRAA 5HXIA 4CRTA 2V60A 4H4SA 2BACA 5FS6A 2GB0A 3V3NA 4CBQA 4EIPA 3F8DA 1D4DA 4U8KA 1CF3A 1JRZA 1L9DA 4K7ZA 1D4CA 2IVEA 3DK4A 2YAUA 3AYJA 5CQFA 2BS3A 2YVFA 2XFQA 3AEGA 4LU6A 1L9CA 1NEKA 1BWCA 3RHAA 3DK8A 3SQPA 4JN9A 4YTNA 1PJ5A 3DJGX 4AP1A 3R9UA 1NG4A 2YR5A 2BK3A 2WPCA 3GMBA 1TDFA 2I0ZA 2XCGA 1D5TA 4U2SA 1UKVG 1D7YA 5U25A 2EQ9A 3KKJA 1KF6A 2YLSA 4K2XA 3C4NA 1IUUA 2FJAA 2YM1A 2YVJA 4H4VA 2GMHA 3RP6A 3DK9A 4GRTA 1VRQB 1H86A 1K0LA 3COXA 1GPEA 3AEEA 2WOWA 2XLTA 3AB1A 3NN0X 4REKA 3L8KA 2GMJA 4H4ZA 2OLNA 2C70A 4YSZA 4JNQA 4OPTA 1N1PA 3AE1A 2E4GA 3B6DA 3CGCA 3NYCA 1PBCA 1GREA 2TPRA 3AEFA 1IUXA 4A99A 2A8XA 1H82A 1JEHA 2QA2A 2WU2A 2VQBA 2R46A 3ATRA 1TRBA 1Q1RA 1COYA 2WDQA 3GRSA 3K7MX 2JB1A 1EL8A 4J31A 4LIIA 2WQYA 1MXTA 3UTGA 1NHQA 2BCPA 3AD9B 4OPIA 1DODA 4UDRA 3GWDA 2YR6A 4NTDA 3AE4A 3M0OA 3QVPA 3GDPA 2BK5A 3GMCA 3LZWA 2WP6A 1H7WA 3AE5A 1JRYA 2WESA 5U63A 2GR3A 3ALJA 4X9MA 2VZ2A 4U8MA 2WDRA 2PYXA 3DA1A 3M12A 4USQA 4CCQA 4GF7A 3SFDA 3GSIA 4U2TA 3QFBA 2OAMA 3LB8A 2YG4A 4CNKA 3FPZA 4YWOA 4RG4A 5DBJA 5JCMA 3RNMA 4U8PA 4J33A 4A65A 2YLZA 4K8DA 1NAAA 2VOUA 1FECA 1DJQA 4Y4MA 2YLWA 2BA9A 3Q6JA 1S2YA 1IUTA 1DOBA 1Y56B 1JOAA 2Q6UA 2OALA 4GDEA 3V76A 3BI5A 5EOWA 1CHUA 2X99A 1KNRA 2Z5XA 4UDPA 5EB4A 5CKUA 3UKQA 3V3OA 3AEBA 4IV9A 3JSKA 2XVIA 2VRLA 4AOSA 4CY8A 3WE0A 1ZOYA 2R0PA 4GUVA 4FK1C 4H4UA 5FS8A 1F8SA 3NK0X 1O5WA 1S3EA 2C66A 4BV6A 4DGKA 4H2NA 1GTHA 3ICTA 2Z5YA 2X8CA 3BHKA 4IVMB 1LQUA 2XLPA 1N4UA 1X31B 2R0CA 4B65A 3RP8A 2WEUA 1BF3A 1PHHA 3DJDA 1GRTA 1VDCA 3P4SA 1L9EA 1OJTA 1CJ4A 4U2LA 3H8LA 4A6NB 1B8SA 3NG7X 3NN6X 3IC9A 2ACZA 1GRBA 3F8RA 3FIMB 2EQ7A 2GAHB 3B3RA 3IHGA 2V61A 1DOEA 2GR1A 2B9WA 1M64A 1F8RA 4I58A 3VRDB 2R0GA 3UTFA 4BK1A 2RGOA 3VR9A 4E0VA 1M6IA 4ECHA 3CGEA 2DKIA 4NTCA 1JU2A 2C65A 4Y4NA 1E7PA 2EQ8A 4OPGA 1FEBA 4APNA 5KOXA 4YSHA 1H7XA 4H4PA 1EL5A 4XWZA 3UCLA 4JDRA 4BJYA 3NTAA 2W0HA 3S5WA 3T37A 3EPTA 3CPIG 3AE6A 1ZX9A 2RABA 2OLOA 2ZZCA 1YQ3A 1GRFA 1ZK7A 4NZHA 1E1LA 1BKWA 4H4QA 3NT6A 2B7SA 4CY6A 2QA1A 1B4VA 3E1TA 4OPCA 3G5RA 4EMWA 3BI4A 1O95A 4CCRA 2ZZ0A 2IVDA 1REOA 3CPHG 4EM3A 2J3NA 1XPQA 4H4YA 3ATQA 1PJ6A 3DGHA 1CC4A 4Z2UA 3D8XA 4OPDA 2C3DA 5EBKA 4HA6A 1LQTA 2B7RA 1XDIA 4H4WA 2X50A 3CIRA 1CC6A 2BABA 3ADAB 3AD8B 3ABVA 4OPUA 4EIQA 1O94A 2AQJA 4H7UA 3UOZA 5IQ4A 2CFYA 3KA7A 2ZZBA 3AE9A 3VR8A 2YLTA 3NK2X 4Z43A 4AOXA 3GDNA 4OPLA 4J56A 4TM1A 3P9UA 4J34A 1TYPA 5GSNA 1KSUA 2JB3A 2WS3A 1GTEA 3ISHA 1XANA 2BC1A 2XYOA 4KX6A 3SFEA 1BZLA 1E1NA 2GV8A 3L1RA 2YG3A 2VRMA 4TLXA 4WX1A 5M0ZA 3UKHA 2FJDA 2APGA 2IIDA 4H4TA 3UOYA 4YKFA 2XLSA 1EL7A 4FX9A 3FMWA 1GXFA 4B63A 5KVIA 3OZ2A 1VQWA 1IUVA 1NENA 1CBOA 3NTDA 1VG0A 3M13A 3LZXA 4EQWA 1QJDA 3AE3A 4P9SA 4UDQA 2XFPA 3UKKA 2C73A 1Q1WA 3H4KA 2JKCA 3QVRA 4Z44A 2Y6RA 2XLRA 1DNCA 5GRTA 2BXRA 2H89A 2WBAA 1ZP0A 2JK6A 2B76A 3P4QA 4C5OA 2Y6QA 3DMEA 1QLBA 4Z2RA 2GVCA 3GRTA 3DH9A
chains in the Genus database with same CATH superfamily
1NPXA 1RYIA 1CL0A 5BVAA 5BULA 1SEZA 4GR1A 3AECA 4BURA 4B64A 1CJCA 3DGZA 2AR8A 2V5ZA 2C72A 1PXCA 3CN8A 2QCUA 4KPRA 1GSNA 1N4VA 2XVHA 3AE7A 3ALMA 3SZWA 3REDA 1GRAA 1FEAA 1RP0A 4NEVA 3SGLA 1GESA 2O9ZA 5JCKA 4AP3A 1Z6LA 4YTPA 1GERA 3OC4A 4EM4A 4EQSA 4YSYA 4K22A 2V3AA 3F8PA 2GRTA 5HHFA 1KDGA 1H83A 4TM0A 1TDOA 4OCGA 2XFOA 1IUSA 2WETA 4AT2A 1AOGA 4U8IA 5FS9A 3II4A 4Y4LA 1KSSA 3UOXA 4A6NA 1PDHA 4EQRA 1DJNA 2BC0A 1EBDA 3CNSA 4GDPA 4C3XA 1LJ1A 3ITJA 4C77A 2C7GA 4Z2TA 3NHOX 1ZMDA 3CNJA 4J57A 1P2HA 4A5LA 3C96A 2HQMA 3AEAA 4N9XA 3CPJG 1GV4A 3CMMA 3QSEA 3CNTA 1PBDA 2YG5A 2V6OA 4H2RA 4A7AA 4G74A 3P4PA 3KD9A 1OJDA 1FL2A 3FBSA 4TM4A 4NTEA 3IHMA 4O5UA 5KOWA 2B9XA 2DKHA 3EAOA 2FBWA 2YQUA 1GT8A 4XXGA 4NEWA 2Q0LA 1H6VA 2JBVA 3SZCA 3AWIA 3DJJA 4IA6A 3PVCA 2GF3A 2YLXA 2YVGA 3AXBA 1NHRA 1YQ4A 5EB5A 1W4XA 3PO7A 2R4JA 3UTEA 2C67A 4I59A 3S61A 5U1OA 4M52A 1PS9A 5M10A 3NLCA 1E1MA 1DOCA 2RGJA 2UZZA 4XWRA 2FJEA 1BGNA 5FMHA 3UP4A 1ZKQA 1YY5A 1KFYA 1F3PA 2C76A 3KLJA 1K0JA 1N4WA 1OJ9A 2C4CA 2A89A 2R4EA 5KRQA 2BS4A 3ZDNA 3DJEA 2GR2A 3HYVA 4D03A 1MOKA 3QFAA 2CULA 3BHFA 2VQ7A 3QSMA 4TLZA 1GALA 2XVJA 3ICSA 5L46A 3AE8A 5JCLA 4D04A 5HYMA 3ZYXA 1D4EA 3QJ4A 4B66A 1JRXA 1ONFA 2V3BA 3LXDA 4Z26A 2JB2A 3KU9A 1IJHA 4RSLA 3UTHA 4UP3A 4ADWA 2GH5A 1IUWA 1GNDA 3BI2A 1PBEA 4FDCB 1LPFA 3VQRA 1Y0PA 2E5VA 2NVKX 4BK3A 4MJWA 4K5RA 3GYIA 3PS9A 3AE2A 3IWAA 1OJAA 3SZ0A 2CVJA 4BK2A 3NRNA 2WP9A 1YKJA 3ICRA 4Z25A 5TR3A 2AAQA 3I3LA 1CJ3A 3LADA 4YXDA 1E1KA 2BK4A 2OA1A 1LV0A 3NNEA 5IPYA 1Q9IA 4EMJA 2WPFA 1PJ7A 4GCMA 3T31A 1JNZA 1B37A 1ZDLA 2GEWA 2H88A 3UOVA 4U8JA 5JCIA 2F5ZA 4Z24A 3H8IA 4JY3A 3NK1X 2Q0KA 4YKGA 1OJCA 4AT0A 3AYLA 1QO8A 1ZY8A 3GWFA 3UP5A 1FCDA 3K30A 4ICYA 3O0HA 2A87A 4X4JA 4EMIA 2NPXA 1KNPA 1TDNA 1L0VA 2XLUA 2GQFA 4H2QA 2BCGG 4JNAA 5KWFA 1Y56A 4LA1A 2WDVA 5ER0A 2PHHA 1YQZA 2YG7A 3NYFA 4C3YA 4H50A 5JCNA 5KXJA 4A9WA 1CJ2A 3GD4A 4WCTA 3BNMA 3KVEA 1TYTA 3AD7B 4H4RA 1ELIA 1XHCA 4ZCCA 1E6EA 2WU5A 1LVLA 3CGBA 3K7QX 4U8OA 3VRBA 4FK1A 1PXAA 4H2PA 1V59A 2JAEA 2TMDA 4JY2A 4USRA 4X9NA 1TDKA 1RSGA 4YTMA 2VVMA 2C64A 1TDEA 1S2QA 2CDUA 1PXBA 3EANA 5J60A 1BGJA 4EQXA 4HB9A 2WOIA 3BNUA 2YG6A 2ZBWA 3NIXA 2B9YA 1NDAA 3KPFA 4ZCDA 1ZOVA 3CNDA 3GD3A 4J2WA 3P1WA 3SM8A 3NYEA 1GRHA 2EQ6A 1DXLA 4DSGA 1ZMCA 1B5QA 2YM2A 5KVHA 3UKFA 4B67A 3LJPA 1VG9A 3LOVA 3QSSA 1MO9A 2X3NA 3UKPA 3I6DA 2ARDA 1P2EA 3G5SA 3NH3X 4TM3A 3UKAA 3IF9A 1S3BA 1HYUA 4YT0A 3CGDA 2R9ZA 2XVEA 3T2KA 2WHDA 3ALLA 5BUKA 5KMSA 2FJBA 4H4XA 3KPKA 3NGCX 1CC2A 1LTXR 4O5QA 1H81A 4CNJA 1PBBA 2VVLG 1GEUA 2C75A 3EF6A 3P4RA 2Q7VA 5HY5A 1F6MA 2BS2A 2WOVA 1E39A 2YR4A 1K0IA 1GOSA 4C74A 1NHPA 2XVFA 2R45A 4RG3A 2VVLA 2YWLA 1NHSA 3UKLA 4DSHA 3C4AA 1PN0A 5LV9A 1GETA 3Q9TA 4ZN0A 3URHA 3AEDA 1F8WA 4U8LA 5C3JA 4YSXA 2YLRA 2XFNA 1FOHA 3GYJA 3G5QA 4BJZA 4OVIA 4JQ9A 2BYBA 2QAEA 4B1BA 4B68A 1H84A 5C2TA 1PBFA 2GQWA 3CNPA 5J7XA 4IVOB 2E1MA 2GR0A 2XDOA 2GAGB 2WPEA 3K7TA 4NNJA 4J36A 2WP5A 3D1CA 3NKSA 4PAAA 5BRTA 4DNAA 4IA5A 3CTYA 2RGHA 3SYIA 2BXSA 5FS7A 2X8GA 4K5SA 1EL9A 3RP7A 4U8NA 1NG3A 1K4QA 2C3CA 4B69A 4PABA 1GRGA 3HZLA 1JNRA 2XFUA 3AYIA 4NWZA 1D7LA 2X8HA 5IQ1A 3FG2P 3VRAA 4A79A 4CRTA 2V60A 4H4SA 2BACA 5FS6A 2GB0A 4II3A 3V3NA 4CBQA 4EIPA 3F8DA 1D4DA 4U8KA 1CF3A 1JRZA 1L9DA 4K7ZA 1D4CA 2IVEA 3DK4A 2YAUA 3AYJA 3HYXA 5CQFA 2BS3A 2YVFA 2XFQA 3AEGA 4LU6A 3T0KA 1L9CA 1NEKA 1BWCA 3RHAA 3DK8A 3SQPA 4JN9A 4YTNA 1PJ5A 3DJGX 4GAPA 3R9UA 4AP1A 1NG4A 2YR5A 2BK3A 2WPCA 3GMBA 1TDFA 2I0ZA 2XCGA 2BRYA 4U2SA 1UKVG 1D7YA 5U25A 2EQ9A 3KKJA 1KF6A 2YLSA 4K2XA 3C4NA 1IUUA 2FJAA 2YM1A 2YVJA 4H4VA 2GMHA 3RP6A 3DK9A 4GRTA 1VRQB 1H86A 1K0LA 3COXA 1GPEA 3AEEA 2WOWA 2XLTA 3AB1A 3NN0X 4G73A 4REKA 3L8KA 2GMJA 4H4ZA 2OLNA 2C70A 4YSZA 4JNQA 4OPTA 1N1PA 3AE1A 2E4GA 3B6DA 3CGCA 3GYXA 3NYCA 1PBCA 1GREA 2TPRA 3AEFA 1IUXA 4A99A 2A8XA 5KMPA 1H82A 1JEHA 2QA2A 2WU2A 2VQBA 2R46A 3ATRA 1TRBA 1Q1RA 1COYA 2WDQA 3GRSA 3K7MX 4G6GA 2JB1A 1EL8A 4J31A 4LIIA 2WQYA 1MXTA 4GAVA 1NHQA 2BCPA 3AD9B 3UTGA 4OPIA 1DODA 4UDRA 3GWDA 2YR6A 4NTDA 3AE4A 3M0OA 3QVPA 3GDPA 2BK5A 3GMCA 3LZWA 2WP6A 1H7WA 3AE5A 3T14A 1JRYA 2WESA 5U63A 2GR3A 3ALJA 4X9MA 2VZ2A 4U8MA 2WDRA 2PYXA 3DA1A 3M12A 4USQA 4CCQA 4GF7A 3SFDA 3GSIA 4U2TA 3QFBA 2OAMA 3LB8A 2YG4A 4CNKA 3FPZA 4YWOA 4RG4A 5DBJA 5JCMA 3RNMA 4U8PA 4J33A 3SX6A 4A65A 2YLZA 4K8DA 1NAAA 2VOUA 1FECA 1DJQA 4Y4MA 2YLWA 2BA9A 3T2ZA 3Q6JA 1S2YA 1IUTA 1DOBA 1Y56B 1JOAA 2Q6UA 2OALA 4GDEA 3V76A 3BI5A 5EOWA 1CHUA 2X99A 1KNRA 2Z5XA 4UDPA 5EB4A 5CKUA 5KNLA 3UKQA 3V3OA 3AEBA 4IV9A 3JSKA 5HXIA 2XVIA 2VRLA 4AOSA 4CY8A 3WE0A 1ZOYA 2R0PA 4GUVA 4FK1C 4H4UA 5FS8A 1F8SA 3NK0X 1O5WA 1S3EA 2C66A 4BV6A 4DGKA 4H2NA 1GTHA 3ICTA 2Z5YA 2X8CA 3BHKA 4G6HA 4IVMB 1LQUA 3SXIA 2XLPA 5KMRA 1N4UA 1X31B 2R0CA 4B65A 3RP8A 2WEUA 1BF3A 1PHHA 3DJDA 1GRTA 1VDCA 3P4SA 1L9EA 1OJTA 1CJ4A 4U2LA 3H8LA 4A6NB 1B8SA 3NG7X 3NN6X 3IC9A 2ACZA 1GRBA 3F8RA 3FIMB 2EQ7A 2GAHB 3B3RA 3IHGA 2V61A 1DOEA 2GR1A 2B9WA 1M64A 1F8RA 4I58A 3VRDB 2R0GA 3UTFA 4BK1A 2RGOA 3VR9A 4E0VA 1M6IA 4ECHA 3CGEA 2DKIA 4NTCA 1JU2A 2C65A 4Y4NA 1E7PA 2EQ8A 4OPGA 1FEBA 4APNA 5KOXA 2BRAA 4YSHA 1H7XA 4H4PA 3SY4A 1EL5A 4XWZA 3UCLA 4JDRA 4BJYA 3NTAA 2W0HA 3S5WA 3T37A 3EPTA 3CPIG 3AE6A 1ZX9A 2RABA 2OLOA 2ZZCA 1YQ3A 1GRFA 1ZK7A 4NZHA 1E1LA 1BKWA 4H4QA 3NT6A 2B7SA 4CY6A 2QA1A 1B4VA 3E1TA 4OPCA 3G5RA 4EMWA 3BI4A 1O95A 4CCRA 2ZZ0A 2IVDA 1REOA 3CPHG 3SZFA 4EM3A 2J3NA 1XPQA 4H4YA 3ATQA 3T2YA 1PJ6A 3DGHA 1CC4A 4Z2UA 3D8XA 4OPDA 2C3DA 5EBKA 4HA6A 4G9KA 1LQTA 2B7RA 1XDIA 4H4WA 2X50A 3CIRA 1CC6A 2BABA 3ADAB 3AD8B 3ABVA 4OPUA 4EIQA 1O94A 2AQJA 4H7UA 3UOZA 5IQ4A 2CFYA 3KA7A 4II2A 2ZZBA 3AE9A 3VR8A 2YLTA 3NK2X 4Z43A 4AOXA 3GDNA 4OPLA 4J56A 4TM1A 3P9UA 4J34A 1TYPA 5GSNA 1KSUA 2JB3A 2WS3A 1GTEA 3ISHA 1XANA 2BC1A 2XYOA 4KX6A 3SFEA 1BZLA 1E1NA 2GV8A 3L1RA 2YG3A 2VRMA 4TLXA 4WX1A 5M0ZA 3HYWA 2GVCA 2FJDA 2APGA 2IIDA 4H4TA 3UKHA 3UOYA 4YKFA 2XLSA 1EL7A 4FX9A 3FMWA 1GXFA 4B63A 5KVIA 3OZ2A 1VQWA 1IUVA 1NENA 1CBOA 3NTDA 1VG0A 3M13A 3LZXA 4EQWA 1QJDA 3AE3A 4P9SA 4UDQA 2XFPA 3UKKA 2C73A 5KMQA 1Q1WA 3H4KA 2JKCA 3QVRA 4Z44A 2Y6RA 2XLRA 1DNCA 5GRTA 2BXRA 2H89A 2WBAA 1ZP0A 2JK6A 2B76A 3P4QA 4C5OA 2Y6QA 3DMEA 1QLBA 4Z2RA 1D5TA 3GRTA 3DH9A
chains in the Genus database with same CATH topology
1NPXA 1RYIA 1CL0A 5BVAA 5BULA 1SEZA 4GR1A 3AECA 4BURA 4B64A 1CJCA 3DGZA 2AR8A 2V5ZA 2C72A 1PXCA 3CN8A 2QCUA 4KPRA 1GSNA 1N4VA 2XVHA 3AE7A 3ALMA 3SZWA 3REDA 1GRAA 1FEAA 1RP0A 4NEVA 3SGLA 1GESA 2O9ZA 5JCKA 4AP3A 1Z6LA 4YTPA 1GERA 3OC4A 4EM4A 4EQSA 4YSYA 4K22A 2V3AA 3F8PA 2GRTA 5HHFA 1KDGA 1H83A 4TM0A 1TDOA 4OCGA 2XFOA 1IUSA 2WETA 4AT2A 1AOGA 4U8IA 5FS9A 3II4A 4Y4LA 1KSSA 3UOXA 4A6NA 1PDHA 4EQRA 1DJNA 2BC0A 1EBDA 3CNSA 4GDPA 4C3XA 1LJ1A 3ITJA 4C77A 2C7GA 4Z2TA 3NHOX 1ZMDA 3CNJA 4J57A 1P2HA 4A5LA 3C96A 2HQMA 3AEAA 4N9XA 3CPJG 1GV4A 3CMMA 3QSEA 3CNTA 1PBDA 2YG5A 2V6OA 4H2RA 4A7AA 4G74A 3P4PA 3KD9A 1OJDA 1FL2A 3FBSA 4TM4A 4NTEA 3IHMA 4O5UA 5KOWA 2B9XA 2DKHA 3EAOA 2FBWA 2YQUA 1GT8A 4XXGA 4NEWA 2Q0LA 1H6VA 2JBVA 3SZCA 3AWIA 3DJJA 4IA6A 3PVCA 2GF3A 2YLXA 2YVGA 3AXBA 1NHRA 1YQ4A 5EB5A 1W4XA 3PO7A 2R4JA 3UTEA 2C67A 4I59A 3S61A 5U1OA 4M52A 1PS9A 5M10A 3NLCA 1E1MA 1DOCA 2RGJA 2UZZA 4XWRA 2FJEA 1BGNA 5FMHA 3UP4A 1ZKQA 1YY5A 1KFYA 1F3PA 2C76A 3KLJA 1K0JA 1N4WA 1OJ9A 2C4CA 2A89A 2R4EA 5KRQA 2BS4A 3ZDNA 3DJEA 2GR2A 3HYVA 4D03A 1MOKA 3QFAA 2CULA 3BHFA 2VQ7A 3QSMA 4TLZA 1GALA 2XVJA 3ICSA 5L46A 3AE8A 5JCLA 4D04A 5HYMA 3ZYXA 1D4EA 3QJ4A 4B66A 1JRXA 1ONFA 2V3BA 3LXDA 4Z26A 2JB2A 3KU9A 1IJHA 4RSLA 3UTHA 4UP3A 4ADWA 2GH5A 1IUWA 1GNDA 3BI2A 1PBEA 4FDCB 1LPFA 3VQRA 1Y0PA 2E5VA 2NVKX 4BK3A 4MJWA 4K5RA 3GYIA 3PS9A 3AE2A 3IWAA 1OJAA 3SZ0A 2CVJA 4BK2A 3NRNA 2WP9A 1YKJA 3ICRA 4Z25A 5TR3A 2AAQA 3I3LA 1CJ3A 3LADA 4YXDA 1E1KA 2BK4A 2OA1A 1LV0A 3NNEA 5IPYA 1Q9IA 4EMJA 2WPFA 1PJ7A 4GCMA 3T31A 1JNZA 1B37A 1ZDLA 2GEWA 2H88A 3UOVA 4U8JA 5JCIA 2F5ZA 4Z24A 3H8IA 4JY3A 3NK1X 2Q0KA 4YKGA 1OJCA 4AT0A 3AYLA 1QO8A 1ZY8A 3GWFA 3UP5A 1FCDA 3K30A 4ICYA 3O0HA 2A87A 4X4JA 4EMIA 2NPXA 1KNPA 1TDNA 1L0VA 2XLUA 2GQFA 4H2QA 2BCGG 4JNAA 5KWFA 1Y56A 4LA1A 2WDVA 5ER0A 2PHHA 1YQZA 2YG7A 3NYFA 4C3YA 4H50A 5JCNA 5KXJA 4A9WA 1CJ2A 3GD4A 4WCTA 3BNMA 3KVEA 1TYTA 3AD7B 4H4RA 1ELIA 1XHCA 4ZCCA 1E6EA 2WU5A 1LVLA 3CGBA 3K7QX 4U8OA 3VRBA 4FK1A 1PXAA 4H2PA 1V59A 2JAEA 2TMDA 4JY2A 4USRA 4X9NA 1TDKA 1RSGA 4YTMA 2VVMA 2C64A 1TDEA 1S2QA 2CDUA 1PXBA 3EANA 5J60A 1BGJA 4EQXA 4HB9A 2WOIA 3BNUA 2YG6A 2ZBWA 3NIXA 2B9YA 1NDAA 3KPFA 4ZCDA 1ZOVA 3CNDA 3GD3A 4J2WA 3P1WA 3SM8A 3NYEA 1GRHA 2EQ6A 1DXLA 4DSGA 1ZMCA 1B5QA 2YM2A 5KVHA 3UKFA 4B67A 3LJPA 1VG9A 3LOVA 3QSSA 1MO9A 2X3NA 3UKPA 3I6DA 2ARDA 1P2EA 3G5SA 3NH3X 4TM3A 3UKAA 3IF9A 1S3BA 1HYUA 4YT0A 3CGDA 2R9ZA 2XVEA 3T2KA 2WHDA 3ALLA 5BUKA 5KMSA 2FJBA 4H4XA 3KPKA 3NGCX 1CC2A 1LTXR 4O5QA 1H81A 4CNJA 1PBBA 2VVLG 1GEUA 2C75A 3EF6A 3P4RA 2Q7VA 5HY5A 1F6MA 2BS2A 2WOVA 1E39A 2YR4A 1K0IA 1GOSA 4C74A 1NHPA 2XVFA 2R45A 4RG3A 2VVLA 2YWLA 1NHSA 3UKLA 4DSHA 3C4AA 1PN0A 5LV9A 1GETA 3Q9TA 4ZN0A 3URHA 3AEDA 1F8WA 4U8LA 5C3JA 4YSXA 2YLRA 2XFNA 1FOHA 3GYJA 3G5QA 4BJZA 4OVIA 4JQ9A 2BYBA 2QAEA 4B1BA 4B68A 1H84A 5C2TA 1PBFA 2GQWA 3CNPA 5J7XA 4IVOB 2E1MA 2GR0A 2XDOA 2GAGB 2WPEA 3K7TA 4NNJA 4J36A 2WP5A 3D1CA 3NKSA 4PAAA 5BRTA 4DNAA 4IA5A 3CTYA 2RGHA 3SYIA 2BXSA 5FS7A 2X8GA 4K5SA 1EL9A 3RP7A 4U8NA 1NG3A 1K4QA 2C3CA 4B69A 4PABA 1GRGA 3HZLA 1JNRA 2XFUA 3AYIA 4NWZA 1D7LA 2X8HA 5IQ1A 3FG2P 3VRAA 4A79A 4CRTA 2V60A 4H4SA 2BACA 5FS6A 2GB0A 4II3A 3V3NA 4CBQA 4EIPA 3F8DA 1D4DA 4U8KA 1CF3A 1JRZA 1L9DA 4K7ZA 1D4CA 2IVEA 3DK4A 2YAUA 3AYJA 3HYXA 5CQFA 2BS3A 2YVFA 2XFQA 3AEGA 4LU6A 3T0KA 1L9CA 1NEKA 1BWCA 3RHAA 3DK8A 3SQPA 4JN9A 4YTNA 1PJ5A 3DJGX 4GAPA 3R9UA 4AP1A 1NG4A 2YR5A 2BK3A 2WPCA 3GMBA 1TDFA 2I0ZA 2XCGA 2BRYA 4U2SA 1UKVG 1D7YA 5U25A 2EQ9A 3KKJA 1KF6A 2YLSA 4K2XA 3C4NA 1IUUA 2FJAA 2YM1A 2YVJA 4H4VA 2GMHA 3RP6A 3DK9A 4GRTA 1VRQB 1H86A 1K0LA 3COXA 1GPEA 3AEEA 2WOWA 2XLTA 3AB1A 3NN0X 4G73A 4REKA 3L8KA 2GMJA 4H4ZA 2OLNA 2C70A 4YSZA 4JNQA 4OPTA 1N1PA 3AE1A 2E4GA 3B6DA 3CGCA 3GYXA 3NYCA 1PBCA 1GREA 2TPRA 3AEFA 1IUXA 4A99A 2A8XA 5KMPA 1H82A 1JEHA 2QA2A 2WU2A 2VQBA 2R46A 3ATRA 1TRBA 1Q1RA 1COYA 2WDQA 3GRSA 3K7MX 4G6GA 2JB1A 1EL8A 4J31A 4LIIA 2WQYA 1MXTA 4GAVA 1NHQA 2BCPA 3AD9B 3UTGA 4OPIA 1DODA 4UDRA 3GWDA 2YR6A 4NTDA 3AE4A 3M0OA 3QVPA 3GDPA 2BK5A 3GMCA 3LZWA 2WP6A 1H7WA 3AE5A 3T14A 1JRYA 2WESA 5U63A 2GR3A 3ALJA 4X9MA 2VZ2A 4U8MA 2WDRA 2PYXA 3DA1A 3M12A 4USQA 4CCQA 4GF7A 3SFDA 3GSIA 4U2TA 3QFBA 2OAMA 3LB8A 2YG4A 4CNKA 3FPZA 4YWOA 4RG4A 5DBJA 5JCMA 3RNMA 4U8PA 4J33A 3SX6A 4A65A 2YLZA 4K8DA 1NAAA 2VOUA 1FECA 1DJQA 4Y4MA 2YLWA 2BA9A 3T2ZA 3Q6JA 1S2YA 1IUTA 1DOBA 1Y56B 1JOAA 2Q6UA 2OALA 4GDEA 3V76A 3BI5A 5EOWA 1CHUA 2X99A 1KNRA 2Z5XA 4UDPA 5EB4A 5CKUA 5KNLA 3UKQA 3V3OA 3AEBA 4IV9A 3JSKA 5HXIA 2XVIA 2VRLA 4AOSA 4CY8A 3WE0A 1ZOYA 2R0PA 4GUVA 4FK1C 4H4UA 5FS8A 1F8SA 3NK0X 1O5WA 1S3EA 2C66A 4BV6A 4DGKA 4H2NA 1GTHA 3ICTA 2Z5YA 2X8CA 3BHKA 4G6HA 4IVMB 1LQUA 3SXIA 2XLPA 5KMRA 1N4UA 1X31B 2R0CA 4B65A 3RP8A 2WEUA 1BF3A 1PHHA 3DJDA 1GRTA 1VDCA 3P4SA 1L9EA 1OJTA 1CJ4A 4U2LA 3H8LA 4A6NB 1B8SA 3NG7X 3NN6X 3IC9A 2ACZA 1GRBA 3F8RA 3FIMB 2EQ7A 2GAHB 3B3RA 3IHGA 2V61A 1DOEA 2GR1A 2B9WA 1M64A 1F8RA 4I58A 3VRDB 2R0GA 3UTFA 4BK1A 2RGOA 3VR9A 4E0VA 1M6IA 4ECHA 3CGEA 2DKIA 4NTCA 1JU2A 2C65A 4Y4NA 1E7PA 2EQ8A 4OPGA 1FEBA 4APNA 5KOXA 2BRAA 4YSHA 1H7XA 4H4PA 3SY4A 1EL5A 4XWZA 3UCLA 4JDRA 4BJYA 3NTAA 2W0HA 3S5WA 3T37A 3EPTA 3CPIG 3AE6A 1ZX9A 2RABA 2OLOA 2ZZCA 1YQ3A 1GRFA 1ZK7A 4NZHA 1E1LA 1BKWA 4H4QA 3NT6A 2B7SA 4CY6A 2QA1A 1B4VA 3E1TA 4OPCA 3G5RA 4EMWA 3BI4A 1O95A 4CCRA 2ZZ0A 2IVDA 1REOA 3CPHG 3SZFA 4EM3A 2J3NA 1XPQA 4H4YA 3ATQA 3T2YA 1PJ6A 3DGHA 1CC4A 4Z2UA 3D8XA 4OPDA 2C3DA 5EBKA 4HA6A 4G9KA 1LQTA 2B7RA 1XDIA 4H4WA 2X50A 3CIRA 1CC6A 2BABA 3ADAB 3AD8B 3ABVA 4OPUA 4EIQA 1O94A 2AQJA 4H7UA 3UOZA 5IQ4A 2CFYA 3KA7A 4II2A 2ZZBA 3AE9A 3VR8A 2YLTA 3NK2X 4Z43A 4AOXA 3GDNA 4OPLA 4J56A 4TM1A 3P9UA 4J34A 1TYPA 5GSNA 1KSUA 2JB3A 2WS3A 1GTEA 3ISHA 1XANA 2BC1A 2XYOA 4KX6A 3SFEA 1BZLA 1E1NA 2GV8A 3L1RA 2YG3A 2VRMA 4TLXA 4WX1A 5M0ZA 3HYWA 2GVCA 2FJDA 2APGA 2IIDA 4H4TA 3UKHA 3UOYA 4YKFA 2XLSA 1EL7A 4FX9A 3FMWA 1GXFA 4B63A 5KVIA 3OZ2A 1VQWA 1IUVA 1NENA 1CBOA 3NTDA 1VG0A 3M13A 3LZXA 4EQWA 1QJDA 3AE3A 4P9SA 4UDQA 2XFPA 3UKKA 2C73A 5KMQA 1Q1WA 3H4KA 2JKCA 3QVRA 4Z44A 2Y6RA 2XLRA 1DNCA 5GRTA 2BXRA 2H89A 2WBAA 1ZP0A 2JK6A 2B76A 3P4QA 4C5OA 2Y6QA 3DMEA 1QLBA 4Z2RA 1D5TA 3GRTA 3DH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPX A;  1RYI A;  1CL0 A;  5BVA A;  5BUL A;  1SEZ A;  4GR1 A;  3AEC A;  4BUR A;  4B64 A;  1CJC A;  3DGZ A;  2AR8 A;  2V5Z A;  2C72 A;  1PXC A;  3CN8 A;  2QCU A;  4KPR A;  1GSN A;  1N4V A;  2XVH A;  3AE7 A;  3ALM A;  3RED A;  1GRA A;  1FEA A;  1RP0 A;  4NEV A;  3SGL A;  1GES A;  2O9Z A;  5JCK A;  4AP3 A;  1Z6L A;  4YTP A;  1GER A;  3OC4 A;  4EM4 A;  4EQS A;  4YSY A;  4K22 A;  2V3A A;  3F8P A;  2GRT A;  5HHF A;  1KDG A;  1H83 A;  4TM0 A;  1TDO A;  4OCG A;  2XFO A;  1IUS A;  2WET A;  4AT2 A;  1AOG A;  4U8I A;  5FS9 A;  3II4 A;  4Y4L A;  1KSS A;  3UOX A;  4A6N A;  1PDH A;  4EQR A;  1DJN A;  2BC0 A;  1EBD A;  3CNS A;  4GDP A;  4C3X A;  1LJ1 A;  3ITJ A;  4C77 A;  2C7G A;  4Z2T A;  3NHO X;  1ZMD A;  3CNJ A;  4J57 A;  1P2H A;  4A5L A;  3C96 A;  2HQM A;  3AEA A;  4N9X A;  3CPJ G;  1GV4 A;  3QSE A;  3CNT A;  1PBD A;  2YG5 A;  2V6O A;  4H2R A;  4A7A A;  3P4P A;  3KD9 A;  1OJD A;  1FL2 A;  3FBS A;  4TM4 A;  4NTE A;  3IHM A;  4O5U A;  5KOW A;  2B9X A;  2DKH A;  3EAO A;  2FBW A;  2YQU A;  1GT8 A;  4XXG A;  4NEW A;  2Q0L A;  1H6V A;  2JBV A;  3AWI A;  3DJJ A;  4IA6 A;  3PVC A;  2GF3 A;  2YLX A;  2YVG A;  3AXB A;  1NHR A;  1YQ4 A;  5EB5 A;  1W4X A;  3PO7 A;  2R4J A;  3UTE A;  2C67 A;  4I59 A;  3S61 A;  5U1O A;  4M52 A;  1PS9 A;  5M10 A;  3NLC A;  1E1M A;  1DOC A;  2RGJ A;  2UZZ A;  4XWR A;  2FJE A;  1BGN A;  5FMH A;  3UP4 A;  1ZKQ A;  1YY5 A;  1KFY A;  1F3P A;  2C76 A;  3KLJ A;  1K0J A;  1N4W A;  1OJ9 A;  2A89 A;  2R4E A;  5KRQ A;  2BS4 A;  3ZDN A;  3DJE A;  2GR2 A;  4D03 A;  1MOK A;  3QFA A;  2CUL A;  3BHF A;  2VQ7 A;  3QSM A;  4TLZ A;  1GAL A;  2XVJ A;  3ICS A;  5L46 A;  3AE8 A;  5JCL A;  4D04 A;  5HYM A;  3ZYX A;  1D4E A;  3QJ4 A;  4B66 A;  1JRX A;  1ONF A;  2V3B A;  3LXD A;  4Z26 A;  2JB2 A;  3KU9 A;  1IJH A;  4RSL A;  3UTH A;  4UP3 A;  4ADW A;  2GH5 A;  1IUW A;  1GND A;  3BI2 A;  1PBE A;  4FDC B;  1LPF A;  3VQR A;  1Y0P A;  2E5V A;  2NVK X;  4BK3 A;  4MJW A;  4K5R A;  3GYI A;  3PS9 A;  3AE2 A;  3IWA A;  1OJA A;  2CVJ A;  4BK2 A;  3NRN A;  2WP9 A;  1YKJ A;  3ICR A;  4Z25 A;  5TR3 A;  2AAQ A;  3I3L A;  1CJ3 A;  3LAD A;  4YXD A;  1E1K A;  2BK4 A;  2OA1 A;  1LV0 A;  3NNE A;  5IPY A;  1Q9I A;  4EMJ A;  2WPF A;  1PJ7 A;  4GCM A;  1JNZ A;  1B37 A;  1ZDL A;  2GEW A;  2H88 A;  3UOV A;  4U8J A;  5JCI A;  2F5Z A;  4Z24 A;  3H8I A;  4JY3 A;  3NK1 X;  2Q0K A;  4YKG A;  1OJC A;  4AT0 A;  3AYL A;  1QO8 A;  1ZY8 A;  3GWF A;  3UP5 A;  1FCD A;  3K30 A;  4ICY A;  3O0H A;  2A87 A;  4X4J A;  4EMI A;  2NPX A;  1KNP A;  1TDN A;  1L0V A;  2XLU A;  2GQF A;  4H2Q A;  2BCG G;  4JNA A;  5KWF A;  1Y56 A;  4LA1 A;  2WDV A;  5ER0 A;  2PHH A;  1YQZ A;  2YG7 A;  3NYF A;  4C3Y A;  4H50 A;  5JCN A;  5KXJ A;  4A9W A;  1CJ2 A;  3GD4 A;  4WCT A;  3BNM A;  3KVE A;  1TYT A;  3AD7 B;  4H4R A;  1ELI A;  1XHC A;  4ZCC A;  1E6E A;  2WU5 A;  1LVL A;  3CGB A;  3K7Q X;  4U8O A;  3VRB A;  4FK1 A;  1PXA A;  4H2P A;  1V59 A;  2JAE A;  2TMD A;  4JY2 A;  4USR A;  4X9N A;  1TDK A;  1RSG A;  4YTM A;  2VVM A;  2C64 A;  1TDE A;  1S2Q A;  2CDU A;  1PXB A;  3EAN A;  5J60 A;  1BGJ A;  4EQX A;  4HB9 A;  2WOI A;  3BNU A;  2YG6 A;  2ZBW A;  3NIX A;  2B9Y A;  1NDA A;  3KPF A;  4ZCD A;  1ZOV A;  3CND A;  3GD3 A;  4J2W A;  3P1W A;  3SM8 A;  3NYE A;  1GRH A;  2EQ6 A;  1DXL A;  4DSG A;  1ZMC A;  1B5Q A;  2YM2 A;  5KVH A;  3UKF A;  4B67 A;  3LJP A;  1VG9 A;  3LOV A;  3QSS A;  1MO9 A;  2X3N A;  3UKP A;  3I6D A;  2ARD A;  1P2E A;  3G5S A;  3NH3 X;  4TM3 A;  3UKA A;  3IF9 A;  1S3B A;  1HYU A;  4YT0 A;  3CGD A;  2R9Z A;  2XVE A;  2WHD A;  3ALL A;  5BUK A;  2FJB A;  4H4X A;  3NGC X;  1CC2 A;  1LTX R;  4O5Q A;  1H81 A;  4CNJ A;  1PBB A;  2VVL G;  1GEU A;  2C75 A;  3EF6 A;  3P4R A;  2Q7V A;  5HY5 A;  1F6M A;  2BS2 A;  2WOV A;  1E39 A;  2YR4 A;  1K0I A;  1GOS A;  4C74 A;  1NHP A;  2XVF A;  2R45 A;  4RG3 A;  2VVL A;  2YWL A;  1NHS A;  3UKL A;  4DSH A;  3C4A A;  1PN0 A;  5LV9 A;  1GET A;  3Q9T A;  4ZN0 A;  3URH A;  3AED A;  1F8W A;  4U8L A;  5C3J A;  4YSX A;  2YLR A;  2XFN A;  1FOH A;  3GYJ A;  3G5Q A;  4BJZ A;  4OVI A;  4JQ9 A;  2BYB A;  2QAE A;  4B1B A;  4B68 A;  1H84 A;  5C2T A;  1PBF A;  2GQW A;  3CNP A;  5J7X A;  4IVO B;  2E1M A;  2GR0 A;  2XDO A;  2GAG B;  2WPE A;  3K7T A;  4J36 A;  2WP5 A;  3D1C A;  3NKS A;  4PAA A;  5BRT A;  4DNA A;  4IA5 A;  3CTY A;  2RGH A;  2BXS A;  5FS7 A;  2X8G A;  4K5S A;  1EL9 A;  3RP7 A;  4U8N A;  1NG3 A;  1K4Q A;  2C3C A;  4B69 A;  4PAB A;  1GRG A;  3HZL A;  1JNR A;  2XFU A;  3AYI A;  4A79 A;  1D7L A;  2X8H A;  5IQ1 A;  3FG2 P;  3VRA A;  5HXI A;  4CRT A;  2V60 A;  4H4S A;  2BAC A;  5FS6 A;  2GB0 A;  3V3N A;  4CBQ A;  4EIP A;  3F8D A;  1D4D A;  4U8K A;  1CF3 A;  1JRZ A;  1L9D A;  4K7Z A;  1D4C A;  2IVE A;  3DK4 A;  2YAU A;  3AYJ A;  5CQF A;  2BS3 A;  2YVF A;  2XFQ A;  3AEG A;  4LU6 A;  1L9C A;  1NEK A;  1BWC A;  3RHA A;  3DK8 A;  3SQP A;  4JN9 A;  4YTN A;  1PJ5 A;  3DJG X;  4AP1 A;  3R9U A;  1NG4 A;  2YR5 A;  2BK3 A;  2WPC A;  3GMB A;  1TDF A;  2I0Z A;  2XCG A;  1D5T A;  4U2S A;  1UKV G;  1D7Y A;  5U25 A;  2EQ9 A;  3KKJ A;  1KF6 A;  2YLS A;  4K2X A;  3C4N A;  1IUU A;  2FJA A;  2YM1 A;  2YVJ A;  4H4V A;  2GMH A;  3RP6 A;  3DK9 A;  4GRT A;  1VRQ B;  1H86 A;  1K0L A;  3COX A;  1GPE A;  3AEE A;  2WOW A;  2XLT A;  3AB1 A;  3NN0 X;  4REK A;  3L8K A;  2GMJ A;  4H4Z A;  2OLN A;  2C70 A;  4YSZ A;  4JNQ A;  4OPT A;  1N1P A;  3AE1 A;  2E4G A;  3B6D A;  3CGC A;  3NYC A;  1PBC A;  1GRE A;  2TPR A;  3AEF A;  1IUX A;  4A99 A;  2A8X A;  1H82 A;  1JEH A;  2QA2 A;  2WU2 A;  2VQB A;  2R46 A;  3ATR A;  1TRB A;  1Q1R A;  1COY A;  2WDQ A;  3GRS A;  3K7M X;  2JB1 A;  1EL8 A;  4J31 A;  4LII A;  2WQY A;  1MXT A;  3UTG A;  1NHQ A;  2BCP A;  3AD9 B;  4OPI A;  1DOD A;  4UDR A;  3GWD A;  2YR6 A;  4NTD A;  3AE4 A;  3M0O A;  3QVP A;  3GDP A;  2BK5 A;  3GMC A;  3LZW A;  2WP6 A;  1H7W A;  3AE5 A;  1JRY A;  2WES A;  5U63 A;  2GR3 A;  3ALJ A;  4X9M A;  2VZ2 A;  4U8M A;  2WDR A;  2PYX A;  3DA1 A;  3M12 A;  4USQ A;  4CCQ A;  4GF7 A;  3SFD A;  3GSI A;  4U2T A;  3QFB A;  2OAM A;  3LB8 A;  2YG4 A;  4CNK A;  3FPZ A;  4YWO A;  4RG4 A;  5DBJ A;  5JCM A;  3RNM A;  4U8P A;  4J33 A;  4A65 A;  2YLZ A;  4K8D A;  1NAA A;  2VOU A;  1FEC A;  1DJQ A;  4Y4M A;  2YLW A;  2BA9 A;  3Q6J A;  1S2Y A;  1IUT A;  1DOB A;  1Y56 B;  1JOA A;  2Q6U A;  2OAL A;  4GDE A;  3V76 A;  3BI5 A;  5EOW A;  1CHU A;  2X99 A;  1KNR A;  2Z5X A;  4UDP A;  5EB4 A;  5CKU A;  3UKQ A;  3V3O A;  3AEB A;  4IV9 A;  3JSK A;  2XVI A;  2VRL A;  4AOS A;  4CY8 A;  3WE0 A;  1ZOY A;  2R0P A;  4GUV A;  4FK1 C;  4H4U A;  5FS8 A;  1F8S A;  3NK0 X;  1O5W A;  1S3E A;  2C66 A;  4BV6 A;  4DGK A;  4H2N A;  1GTH A;  3ICT A;  2Z5Y A;  2X8C A;  3BHK A;  4IVM B;  1LQU A;  2XLP A;  1N4U A;  1X31 B;  2R0C A;  4B65 A;  3RP8 A;  2WEU A;  1BF3 A;  1PHH A;  3DJD A;  1GRT A;  1VDC A;  3P4S A;  1L9E A;  1OJT A;  1CJ4 A;  4U2L A;  3H8L A;  4A6N B;  1B8S A;  3NG7 X;  3NN6 X;  3IC9 A;  2ACZ A;  1GRB A;  3F8R A;  3FIM B;  2EQ7 A;  2GAH B;  3B3R A;  3IHG A;  2V61 A;  1DOE A;  2GR1 A;  2B9W A;  1M64 A;  1F8R A;  4I58 A;  3VRD B;  2R0G A;  3UTF A;  4BK1 A;  2RGO A;  3VR9 A;  4E0V A;  1M6I A;  4ECH A;  3CGE A;  2DKI A;  4NTC A;  1JU2 A;  2C65 A;  4Y4N A;  1E7P A;  2EQ8 A;  4OPG A;  1FEB A;  4APN A;  5KOX A;  4YSH A;  1H7X A;  4H4P A;  1EL5 A;  4XWZ A;  3UCL A;  4JDR A;  4BJY A;  3NTA A;  2W0H A;  3S5W A;  3T37 A;  3EPT A;  3CPI G;  3AE6 A;  1ZX9 A;  2RAB A;  2OLO A;  2ZZC A;  1YQ3 A;  1GRF A;  1ZK7 A;  4NZH A;  1E1L A;  1BKW A;  4H4Q A;  3NT6 A;  2B7S A;  4CY6 A;  2QA1 A;  1B4V A;  3E1T A;  4OPC A;  3G5R A;  4EMW A;  3BI4 A;  1O95 A;  4CCR A;  2ZZ0 A;  2IVD A;  1REO A;  3CPH G;  4EM3 A;  2J3N A;  1XPQ A;  4H4Y A;  3ATQ A;  1PJ6 A;  3DGH A;  1CC4 A;  4Z2U A;  3D8X A;  4OPD A;  2C3D A;  5EBK A;  4HA6 A;  1LQT A;  2B7R A;  1XDI A;  4H4W A;  2X50 A;  3CIR A;  1CC6 A;  2BAB A;  3ADA B;  3AD8 B;  3ABV A;  4OPU A;  4EIQ A;  1O94 A;  2AQJ A;  4H7U A;  3UOZ A;  5IQ4 A;  2CFY A;  3KA7 A;  2ZZB A;  3AE9 A;  3VR8 A;  2YLT A;  3NK2 X;  4Z43 A;  4AOX A;  3GDN A;  4OPL A;  4J56 A;  4TM1 A;  3P9U A;  4J34 A;  1TYP A;  5GSN A;  1KSU A;  2JB3 A;  2WS3 A;  1GTE A;  3ISH A;  1XAN A;  2BC1 A;  2XYO A;  4KX6 A;  3SFE A;  1BZL A;  1E1N A;  2GV8 A;  3L1R A;  2YG3 A;  2VRM A;  4TLX A;  4WX1 A;  5M0Z A;  3UKH A;  2FJD A;  2APG A;  2IID A;  4H4T A;  3UOY A;  4YKF A;  2XLS A;  1EL7 A;  4FX9 A;  3FMW A;  1GXF A;  4B63 A;  5KVI A;  3OZ2 A;  1VQW A;  1IUV A;  1NEN A;  1CBO A;  3NTD A;  1VG0 A;  3M13 A;  3LZX A;  4EQW A;  1QJD A;  3AE3 A;  4P9S A;  4UDQ A;  2XFP A;  3UKK A;  2C73 A;  1Q1W A;  3H4K A;  2JKC A;  3QVR A;  4Z44 A;  2Y6R A;  2XLR A;  1DNC A;  5GRT A;  2BXR A;  2H89 A;  2WBA A;  1ZP0 A;  2JK6 A;  2B76 A;  3P4Q A;  4C5O A;  2Y6Q A;  3DME A;  1QLB A;  4Z2R A;  2GVC A;  3GRT A;  3DH9 A; 
#chains in the Genus database with same CATH topology
 1NPX A;  1RYI A;  1CL0 A;  5BVA A;  5BUL A;  1SEZ A;  4GR1 A;  3AEC A;  4BUR A;  4B64 A;  1CJC A;  3DGZ A;  2AR8 A;  2V5Z A;  2C72 A;  1PXC A;  3CN8 A;  2QCU A;  4KPR A;  1GSN A;  1N4V A;  2XVH A;  3AE7 A;  3ALM A;  3SZW A;  3RED A;  1GRA A;  1FEA A;  1RP0 A;  4NEV A;  3SGL A;  1GES A;  2O9Z A;  5JCK A;  4AP3 A;  1Z6L A;  4YTP A;  1GER A;  3OC4 A;  4EM4 A;  4EQS A;  4YSY A;  4K22 A;  2V3A A;  3F8P A;  2GRT A;  5HHF A;  1KDG A;  1H83 A;  4TM0 A;  1TDO A;  4OCG A;  2XFO A;  1IUS A;  2WET A;  4AT2 A;  1AOG A;  4U8I A;  5FS9 A;  3II4 A;  4Y4L A;  1KSS A;  3UOX A;  4A6N A;  1PDH A;  4EQR A;  1DJN A;  2BC0 A;  1EBD A;  3CNS A;  4GDP A;  4C3X A;  1LJ1 A;  3ITJ A;  4C77 A;  2C7G A;  4Z2T A;  3NHO X;  1ZMD A;  3CNJ A;  4J57 A;  1P2H A;  4A5L A;  3C96 A;  2HQM A;  3AEA A;  4N9X A;  3CPJ G;  1GV4 A;  3CMM A;  3QSE A;  3CNT A;  1PBD A;  2YG5 A;  2V6O A;  4H2R A;  4A7A A;  4G74 A;  3P4P A;  3KD9 A;  1OJD A;  1FL2 A;  3FBS A;  4TM4 A;  4NTE A;  3IHM A;  4O5U A;  5KOW A;  2B9X A;  2DKH A;  3EAO A;  2FBW A;  2YQU A;  1GT8 A;  4XXG A;  4NEW A;  2Q0L A;  1H6V A;  2JBV A;  3SZC A;  3AWI A;  3DJJ A;  4IA6 A;  3PVC A;  2GF3 A;  2YLX A;  2YVG A;  3AXB A;  1NHR A;  1YQ4 A;  5EB5 A;  1W4X A;  3PO7 A;  2R4J A;  3UTE A;  2C67 A;  4I59 A;  3S61 A;  5U1O A;  4M52 A;  1PS9 A;  5M10 A;  3NLC A;  1E1M A;  1DOC A;  2RGJ A;  2UZZ A;  4XWR A;  2FJE A;  1BGN A;  5FMH A;  3UP4 A;  1ZKQ A;  1YY5 A;  1KFY A;  1F3P A;  2C76 A;  3KLJ A;  1K0J A;  1N4W A;  1OJ9 A;  2C4C A;  2A89 A;  2R4E A;  5KRQ A;  2BS4 A;  3ZDN A;  3DJE A;  2GR2 A;  3HYV A;  4D03 A;  1MOK A;  3QFA A;  2CUL A;  3BHF A;  2VQ7 A;  3QSM A;  4TLZ A;  1GAL A;  2XVJ A;  3ICS A;  5L46 A;  3AE8 A;  5JCL A;  4D04 A;  5HYM A;  3ZYX A;  1D4E A;  3QJ4 A;  4B66 A;  1JRX A;  1ONF A;  2V3B A;  3LXD A;  4Z26 A;  2JB2 A;  3KU9 A;  1IJH A;  4RSL A;  3UTH A;  4UP3 A;  4ADW A;  2GH5 A;  1IUW A;  1GND A;  3BI2 A;  1PBE A;  4FDC B;  1LPF A;  3VQR A;  1Y0P A;  2E5V A;  2NVK X;  4BK3 A;  4MJW A;  4K5R A;  3GYI A;  3PS9 A;  3AE2 A;  3IWA A;  1OJA A;  3SZ0 A;  2CVJ A;  4BK2 A;  3NRN A;  2WP9 A;  1YKJ A;  3ICR A;  4Z25 A;  5TR3 A;  2AAQ A;  3I3L A;  1CJ3 A;  3LAD A;  4YXD A;  1E1K A;  2BK4 A;  2OA1 A;  1LV0 A;  3NNE A;  5IPY A;  1Q9I A;  4EMJ A;  2WPF A;  1PJ7 A;  4GCM A;  3T31 A;  1JNZ A;  1B37 A;  1ZDL A;  2GEW A;  2H88 A;  3UOV A;  4U8J A;  5JCI A;  2F5Z A;  4Z24 A;  3H8I A;  4JY3 A;  3NK1 X;  2Q0K A;  4YKG A;  1OJC A;  4AT0 A;  3AYL A;  1QO8 A;  1ZY8 A;  3GWF A;  3UP5 A;  1FCD A;  3K30 A;  4ICY A;  3O0H A;  2A87 A;  4X4J A;  4EMI A;  2NPX A;  1KNP A;  1TDN A;  1L0V A;  2XLU A;  2GQF A;  4H2Q A;  2BCG G;  4JNA A;  5KWF A;  1Y56 A;  4LA1 A;  2WDV A;  5ER0 A;  2PHH A;  1YQZ A;  2YG7 A;  3NYF A;  4C3Y A;  4H50 A;  5JCN A;  5KXJ A;  4A9W A;  1CJ2 A;  3GD4 A;  4WCT A;  3BNM A;  3KVE A;  1TYT A;  3AD7 B;  4H4R A;  1ELI A;  1XHC A;  4ZCC A;  1E6E A;  2WU5 A;  1LVL A;  3CGB A;  3K7Q X;  4U8O A;  3VRB A;  4FK1 A;  1PXA A;  4H2P A;  1V59 A;  2JAE A;  2TMD A;  4JY2 A;  4USR A;  4X9N A;  1TDK A;  1RSG A;  4YTM A;  2VVM A;  2C64 A;  1TDE A;  1S2Q A;  2CDU A;  1PXB A;  3EAN A;  5J60 A;  1BGJ A;  4EQX A;  4HB9 A;  2WOI A;  3BNU A;  2YG6 A;  2ZBW A;  3NIX A;  2B9Y A;  1NDA A;  3KPF A;  4ZCD A;  1ZOV A;  3CND A;  3GD3 A;  4J2W A;  3P1W A;  3SM8 A;  3NYE A;  1GRH A;  2EQ6 A;  1DXL A;  4DSG A;  1ZMC A;  1B5Q A;  2YM2 A;  5KVH A;  3UKF A;  4B67 A;  3LJP A;  1VG9 A;  3LOV A;  3QSS A;  1MO9 A;  2X3N A;  3UKP A;  3I6D A;  2ARD A;  1P2E A;  3G5S A;  3NH3 X;  4TM3 A;  3UKA A;  3IF9 A;  1S3B A;  1HYU A;  4YT0 A;  3CGD A;  2R9Z A;  2XVE A;  3T2K A;  2WHD A;  3ALL A;  5BUK A;  5KMS A;  2FJB A;  4H4X A;  3KPK A;  3NGC X;  1CC2 A;  1LTX R;  4O5Q A;  1H81 A;  4CNJ A;  1PBB A;  2VVL G;  1GEU A;  2C75 A;  3EF6 A;  3P4R A;  2Q7V A;  5HY5 A;  1F6M A;  2BS2 A;  2WOV A;  1E39 A;  2YR4 A;  1K0I A;  1GOS A;  4C74 A;  1NHP A;  2XVF A;  2R45 A;  4RG3 A;  2VVL A;  2YWL A;  1NHS A;  3UKL A;  4DSH A;  3C4A A;  1PN0 A;  5LV9 A;  1GET A;  3Q9T A;  4ZN0 A;  3URH A;  3AED A;  1F8W A;  4U8L A;  5C3J A;  4YSX A;  2YLR A;  2XFN A;  1FOH A;  3GYJ A;  3G5Q A;  4BJZ A;  4OVI A;  4JQ9 A;  2BYB A;  2QAE A;  4B1B A;  4B68 A;  1H84 A;  5C2T A;  1PBF A;  2GQW A;  3CNP A;  5J7X A;  4IVO B;  2E1M A;  2GR0 A;  2XDO A;  2GAG B;  2WPE A;  3K7T A;  4NNJ A;  4J36 A;  2WP5 A;  3D1C A;  3NKS A;  4PAA A;  5BRT A;  4DNA A;  4IA5 A;  3CTY A;  2RGH A;  3SYI A;  2BXS A;  5FS7 A;  2X8G A;  4K5S A;  1EL9 A;  3RP7 A;  4U8N A;  1NG3 A;  1K4Q A;  2C3C A;  4B69 A;  4PAB A;  1GRG A;  3HZL A;  1JNR A;  2XFU A;  3AYI A;  4NWZ A;  1D7L A;  2X8H A;  5IQ1 A;  3FG2 P;  3VRA A;  4A79 A;  4CRT A;  2V60 A;  4H4S A;  2BAC A;  5FS6 A;  2GB0 A;  4II3 A;  3V3N A;  4CBQ A;  4EIP A;  3F8D A;  1D4D A;  4U8K A;  1CF3 A;  1JRZ A;  1L9D A;  4K7Z A;  1D4C A;  2IVE A;  3DK4 A;  2YAU A;  3AYJ A;  3HYX A;  5CQF A;  2BS3 A;  2YVF A;  2XFQ A;  3AEG A;  4LU6 A;  3T0K A;  1L9C A;  1NEK A;  1BWC A;  3RHA A;  3DK8 A;  3SQP A;  4JN9 A;  4YTN A;  1PJ5 A;  3DJG X;  4GAP A;  3R9U A;  4AP1 A;  1NG4 A;  2YR5 A;  2BK3 A;  2WPC A;  3GMB A;  1TDF A;  2I0Z A;  2XCG A;  2BRY A;  4U2S A;  1UKV G;  1D7Y A;  5U25 A;  2EQ9 A;  3KKJ A;  1KF6 A;  2YLS A;  4K2X A;  3C4N A;  1IUU A;  2FJA A;  2YM1 A;  2YVJ A;  4H4V A;  2GMH A;  3RP6 A;  3DK9 A;  4GRT A;  1VRQ B;  1H86 A;  1K0L A;  3COX A;  1GPE A;  3AEE A;  2WOW A;  2XLT A;  3AB1 A;  3NN0 X;  4G73 A;  4REK A;  3L8K A;  2GMJ A;  4H4Z A;  2OLN A;  2C70 A;  4YSZ A;  4JNQ A;  4OPT A;  1N1P A;  3AE1 A;  2E4G A;  3B6D A;  3CGC A;  3GYX A;  3NYC A;  1PBC A;  1GRE A;  2TPR A;  3AEF A;  1IUX A;  4A99 A;  2A8X A;  5KMP A;  1H82 A;  1JEH A;  2QA2 A;  2WU2 A;  2VQB A;  2R46 A;  3ATR A;  1TRB A;  1Q1R A;  1COY A;  2WDQ A;  3GRS A;  3K7M X;  4G6G A;  2JB1 A;  1EL8 A;  4J31 A;  4LII A;  2WQY A;  1MXT A;  4GAV A;  1NHQ A;  2BCP A;  3AD9 B;  3UTG A;  4OPI A;  1DOD A;  4UDR A;  3GWD A;  2YR6 A;  4NTD A;  3AE4 A;  3M0O A;  3QVP A;  3GDP A;  2BK5 A;  3GMC A;  3LZW A;  2WP6 A;  1H7W A;  3AE5 A;  3T14 A;  1JRY A;  2WES A;  5U63 A;  2GR3 A;  3ALJ A;  4X9M A;  2VZ2 A;  4U8M A;  2WDR A;  2PYX A;  3DA1 A;  3M12 A;  4USQ A;  4CCQ A;  4GF7 A;  3SFD A;  3GSI A;  4U2T A;  3QFB A;  2OAM A;  3LB8 A;  2YG4 A;  4CNK A;  3FPZ A;  4YWO A;  4RG4 A;  5DBJ A;  5JCM A;  3RNM A;  4U8P A;  4J33 A;  3SX6 A;  4A65 A;  2YLZ A;  4K8D A;  1NAA A;  2VOU A;  1FEC A;  1DJQ A;  4Y4M A;  2YLW A;  2BA9 A;  3T2Z A;  3Q6J A;  1S2Y A;  1IUT A;  1DOB A;  1Y56 B;  1JOA A;  2Q6U A;  2OAL A;  4GDE A;  3V76 A;  3BI5 A;  5EOW A;  1CHU A;  2X99 A;  1KNR A;  2Z5X A;  4UDP A;  5EB4 A;  5CKU A;  5KNL A;  3UKQ A;  3V3O A;  3AEB A;  4IV9 A;  3JSK A;  5HXI A;  2XVI A;  2VRL A;  4AOS A;  4CY8 A;  3WE0 A;  1ZOY A;  2R0P A;  4GUV A;  4FK1 C;  4H4U A;  5FS8 A;  1F8S A;  3NK0 X;  1O5W A;  1S3E A;  2C66 A;  4BV6 A;  4DGK A;  4H2N A;  1GTH A;  3ICT A;  2Z5Y A;  2X8C A;  3BHK A;  4G6H A;  4IVM B;  1LQU A;  3SXI A;  2XLP A;  5KMR A;  1N4U A;  1X31 B;  2R0C A;  4B65 A;  3RP8 A;  2WEU A;  1BF3 A;  1PHH A;  3DJD A;  1GRT A;  1VDC A;  3P4S A;  1L9E A;  1OJT A;  1CJ4 A;  4U2L A;  3H8L A;  4A6N B;  1B8S A;  3NG7 X;  3NN6 X;  3IC9 A;  2ACZ A;  1GRB A;  3F8R A;  3FIM B;  2EQ7 A;  2GAH B;  3B3R A;  3IHG A;  2V61 A;  1DOE A;  2GR1 A;  2B9W A;  1M64 A;  1F8R A;  4I58 A;  3VRD B;  2R0G A;  3UTF A;  4BK1 A;  2RGO A;  3VR9 A;  4E0V A;  1M6I A;  4ECH A;  3CGE A;  2DKI A;  4NTC A;  1JU2 A;  2C65 A;  4Y4N A;  1E7P A;  2EQ8 A;  4OPG A;  1FEB A;  4APN A;  5KOX A;  2BRA A;  4YSH A;  1H7X A;  4H4P A;  3SY4 A;  1EL5 A;  4XWZ A;  3UCL A;  4JDR A;  4BJY A;  3NTA A;  2W0H A;  3S5W A;  3T37 A;  3EPT A;  3CPI G;  3AE6 A;  1ZX9 A;  2RAB A;  2OLO A;  2ZZC A;  1YQ3 A;  1GRF A;  1ZK7 A;  4NZH A;  1E1L A;  1BKW A;  4H4Q A;  3NT6 A;  2B7S A;  4CY6 A;  2QA1 A;  1B4V A;  3E1T A;  4OPC A;  3G5R A;  4EMW A;  3BI4 A;  1O95 A;  4CCR A;  2ZZ0 A;  2IVD A;  1REO A;  3CPH G;  3SZF A;  4EM3 A;  2J3N A;  1XPQ A;  4H4Y A;  3ATQ A;  3T2Y A;  1PJ6 A;  3DGH A;  1CC4 A;  4Z2U A;  3D8X A;  4OPD A;  2C3D A;  5EBK A;  4HA6 A;  4G9K A;  1LQT A;  2B7R A;  1XDI A;  4H4W A;  2X50 A;  3CIR A;  1CC6 A;  2BAB A;  3ADA B;  3AD8 B;  3ABV A;  4OPU A;  4EIQ A;  1O94 A;  2AQJ A;  4H7U A;  3UOZ A;  5IQ4 A;  2CFY A;  3KA7 A;  4II2 A;  2ZZB A;  3AE9 A;  3VR8 A;  2YLT A;  3NK2 X;  4Z43 A;  4AOX A;  3GDN A;  4OPL A;  4J56 A;  4TM1 A;  3P9U A;  4J34 A;  1TYP A;  5GSN A;  1KSU A;  2JB3 A;  2WS3 A;  1GTE A;  3ISH A;  1XAN A;  2BC1 A;  2XYO A;  4KX6 A;  3SFE A;  1BZL A;  1E1N A;  2GV8 A;  3L1R A;  2YG3 A;  2VRM A;  4TLX A;  4WX1 A;  5M0Z A;  3HYW A;  2GVC A;  2FJD A;  2APG A;  2IID A;  4H4T A;  3UKH A;  3UOY A;  4YKF A;  2XLS A;  1EL7 A;  4FX9 A;  3FMW A;  1GXF A;  4B63 A;  5KVI A;  3OZ2 A;  1VQW A;  1IUV A;  1NEN A;  1CBO A;  3NTD A;  1VG0 A;  3M13 A;  3LZX A;  4EQW A;  1QJD A;  3AE3 A;  4P9S A;  4UDQ A;  2XFP A;  3UKK A;  2C73 A;  5KMQ A;  1Q1W A;  3H4K A;  2JKC A;  3QVR A;  4Z44 A;  2Y6R A;  2XLR A;  1DNC A;  5GRT A;  2BXR A;  2H89 A;  2WBA A;  1ZP0 A;  2JK6 A;  2B76 A;  3P4Q A;  4C5O A;  2Y6Q A;  3DME A;  1QLB A;  4Z2R A;  1D5T A;  3GRT A;  3DH9 A; 
#chains in the Genus database with same CATH homology
 1NPX A;  1RYI A;  1CL0 A;  5BVA A;  5BUL A;  1SEZ A;  4GR1 A;  3AEC A;  4BUR A;  4B64 A;  1CJC A;  3DGZ A;  2AR8 A;  2V5Z A;  2C72 A;  1PXC A;  3CN8 A;  2QCU A;  4KPR A;  1GSN A;  1N4V A;  2XVH A;  3AE7 A;  3ALM A;  3SZW A;  3RED A;  1GRA A;  1FEA A;  1RP0 A;  4NEV A;  3SGL A;  1GES A;  2O9Z A;  5JCK A;  4AP3 A;  1Z6L A;  4YTP A;  1GER A;  3OC4 A;  4EM4 A;  4EQS A;  4YSY A;  4K22 A;  2V3A A;  3F8P A;  2GRT A;  5HHF A;  1KDG A;  1H83 A;  4TM0 A;  1TDO A;  4OCG A;  2XFO A;  1IUS A;  2WET A;  4AT2 A;  1AOG A;  4U8I A;  5FS9 A;  3II4 A;  4Y4L A;  1KSS A;  3UOX A;  4A6N A;  1PDH A;  4EQR A;  1DJN A;  2BC0 A;  1EBD A;  3CNS A;  4GDP A;  4C3X A;  1LJ1 A;  3ITJ A;  4C77 A;  2C7G A;  4Z2T A;  3NHO X;  1ZMD A;  3CNJ A;  4J57 A;  1P2H A;  4A5L A;  3C96 A;  2HQM A;  3AEA A;  4N9X A;  3CPJ G;  1GV4 A;  3CMM A;  3QSE A;  3CNT A;  1PBD A;  2YG5 A;  2V6O A;  4H2R A;  4A7A A;  4G74 A;  3P4P A;  3KD9 A;  1OJD A;  1FL2 A;  3FBS A;  4TM4 A;  4NTE A;  3IHM A;  4O5U A;  5KOW A;  2B9X A;  2DKH A;  3EAO A;  2FBW A;  2YQU A;  1GT8 A;  4XXG A;  4NEW A;  2Q0L A;  1H6V A;  2JBV A;  3SZC A;  3AWI A;  3DJJ A;  4IA6 A;  3PVC A;  2GF3 A;  2YLX A;  2YVG A;  3AXB A;  1NHR A;  1YQ4 A;  5EB5 A;  1W4X A;  3PO7 A;  2R4J A;  3UTE A;  2C67 A;  4I59 A;  3S61 A;  5U1O A;  4M52 A;  1PS9 A;  5M10 A;  3NLC A;  1E1M A;  1DOC A;  2RGJ A;  2UZZ A;  4XWR A;  2FJE A;  1BGN A;  5FMH A;  3UP4 A;  1ZKQ A;  1YY5 A;  1KFY A;  1F3P A;  2C76 A;  3KLJ A;  1K0J A;  1N4W A;  1OJ9 A;  2C4C A;  2A89 A;  2R4E A;  5KRQ A;  2BS4 A;  3ZDN A;  3DJE A;  2GR2 A;  3HYV A;  4D03 A;  1MOK A;  3QFA A;  2CUL A;  3BHF A;  2VQ7 A;  3QSM A;  4TLZ A;  1GAL A;  2XVJ A;  3ICS A;  5L46 A;  3AE8 A;  5JCL A;  4D04 A;  5HYM A;  3ZYX A;  1D4E A;  3QJ4 A;  4B66 A;  1JRX A;  1ONF A;  2V3B A;  3LXD A;  4Z26 A;  2JB2 A;  3KU9 A;  1IJH A;  4RSL A;  3UTH A;  4UP3 A;  4ADW A;  2GH5 A;  1IUW A;  1GND A;  3BI2 A;  1PBE A;  4FDC B;  1LPF A;  3VQR A;  1Y0P A;  2E5V A;  2NVK X;  4BK3 A;  4MJW A;  4K5R A;  3GYI A;  3PS9 A;  3AE2 A;  3IWA A;  1OJA A;  3SZ0 A;  2CVJ A;  4BK2 A;  3NRN A;  2WP9 A;  1YKJ A;  3ICR A;  4Z25 A;  5TR3 A;  2AAQ A;  3I3L A;  1CJ3 A;  3LAD A;  4YXD A;  1E1K A;  2BK4 A;  2OA1 A;  1LV0 A;  3NNE A;  5IPY A;  1Q9I A;  4EMJ A;  2WPF A;  1PJ7 A;  4GCM A;  3T31 A;  1JNZ A;  1B37 A;  1ZDL A;  2GEW A;  2H88 A;  3UOV A;  4U8J A;  5JCI A;  2F5Z A;  4Z24 A;  3H8I A;  4JY3 A;  3NK1 X;  2Q0K A;  4YKG A;  1OJC A;  4AT0 A;  3AYL A;  1QO8 A;  1ZY8 A;  3GWF A;  3UP5 A;  1FCD A;  3K30 A;  4ICY A;  3O0H A;  2A87 A;  4X4J A;  4EMI A;  2NPX A;  1KNP A;  1TDN A;  1L0V A;  2XLU A;  2GQF A;  4H2Q A;  2BCG G;  4JNA A;  5KWF A;  1Y56 A;  4LA1 A;  2WDV A;  5ER0 A;  2PHH A;  1YQZ A;  2YG7 A;  3NYF A;  4C3Y A;  4H50 A;  5JCN A;  5KXJ A;  4A9W A;  1CJ2 A;  3GD4 A;  4WCT A;  3BNM A;  3KVE A;  1TYT A;  3AD7 B;  4H4R A;  1ELI A;  1XHC A;  4ZCC A;  1E6E A;  2WU5 A;  1LVL A;  3CGB A;  3K7Q X;  4U8O A;  3VRB A;  4FK1 A;  1PXA A;  4H2P A;  1V59 A;  2JAE A;  2TMD A;  4JY2 A;  4USR A;  4X9N A;  1TDK A;  1RSG A;  4YTM A;  2VVM A;  2C64 A;  1TDE A;  1S2Q A;  2CDU A;  1PXB A;  3EAN A;  5J60 A;  1BGJ A;  4EQX A;  4HB9 A;  2WOI A;  3BNU A;  2YG6 A;  2ZBW A;  3NIX A;  2B9Y A;  1NDA A;  3KPF A;  4ZCD A;  1ZOV A;  3CND A;  3GD3 A;  4J2W A;  3P1W A;  3SM8 A;  3NYE A;  1GRH A;  2EQ6 A;  1DXL A;  4DSG A;  1ZMC A;  1B5Q A;  2YM2 A;  5KVH A;  3UKF A;  4B67 A;  3LJP A;  1VG9 A;  3LOV A;  3QSS A;  1MO9 A;  2X3N A;  3UKP A;  3I6D A;  2ARD A;  1P2E A;  3G5S A;  3NH3 X;  4TM3 A;  3UKA A;  3IF9 A;  1S3B A;  1HYU A;  4YT0 A;  3CGD A;  2R9Z A;  2XVE A;  3T2K A;  2WHD A;  3ALL A;  5BUK A;  5KMS A;  2FJB A;  4H4X A;  3KPK A;  3NGC X;  1CC2 A;  1LTX R;  4O5Q A;  1H81 A;  4CNJ A;  1PBB A;  2VVL G;  1GEU A;  2C75 A;  3EF6 A;  3P4R A;  2Q7V A;  5HY5 A;  1F6M A;  2BS2 A;  2WOV A;  1E39 A;  2YR4 A;  1K0I A;  1GOS A;  4C74 A;  1NHP A;  2XVF A;  2R45 A;  4RG3 A;  2VVL A;  2YWL A;  1NHS A;  3UKL A;  4DSH A;  3C4A A;  1PN0 A;  5LV9 A;  1GET A;  3Q9T A;  4ZN0 A;  3URH A;  3AED A;  1F8W A;  4U8L A;  5C3J A;  4YSX A;  2YLR A;  2XFN A;  1FOH A;  3GYJ A;  3G5Q A;  4BJZ A;  4OVI A;  4JQ9 A;  2BYB A;  2QAE A;  4B1B A;  4B68 A;  1H84 A;  5C2T A;  1PBF A;  2GQW A;  3CNP A;  5J7X A;  4IVO B;  2E1M A;  2GR0 A;  2XDO A;  2GAG B;  2WPE A;  3K7T A;  4NNJ A;  4J36 A;  2WP5 A;  3D1C A;  3NKS A;  4PAA A;  5BRT A;  4DNA A;  4IA5 A;  3CTY A;  2RGH A;  3SYI A;  2BXS A;  5FS7 A;  2X8G A;  4K5S A;  1EL9 A;  3RP7 A;  4U8N A;  1NG3 A;  1K4Q A;  2C3C A;  4B69 A;  4PAB A;  1GRG A;  3HZL A;  1JNR A;  2XFU A;  3AYI A;  4NWZ A;  1D7L A;  2X8H A;  5IQ1 A;  3FG2 P;  3VRA A;  4A79 A;  4CRT A;  2V60 A;  4H4S A;  2BAC A;  5FS6 A;  2GB0 A;  4II3 A;  3V3N A;  4CBQ A;  4EIP A;  3F8D A;  1D4D A;  4U8K A;  1CF3 A;  1JRZ A;  1L9D A;  4K7Z A;  1D4C A;  2IVE A;  3DK4 A;  2YAU A;  3AYJ A;  3HYX A;  5CQF A;  2BS3 A;  2YVF A;  2XFQ A;  3AEG A;  4LU6 A;  3T0K A;  1L9C A;  1NEK A;  1BWC A;  3RHA A;  3DK8 A;  3SQP A;  4JN9 A;  4YTN A;  1PJ5 A;  3DJG X;  4GAP A;  3R9U A;  4AP1 A;  1NG4 A;  2YR5 A;  2BK3 A;  2WPC A;  3GMB A;  1TDF A;  2I0Z A;  2XCG A;  2BRY A;  4U2S A;  1UKV G;  1D7Y A;  5U25 A;  2EQ9 A;  3KKJ A;  1KF6 A;  2YLS A;  4K2X A;  3C4N A;  1IUU A;  2FJA A;  2YM1 A;  2YVJ A;  4H4V A;  2GMH A;  3RP6 A;  3DK9 A;  4GRT A;  1VRQ B;  1H86 A;  1K0L A;  3COX A;  1GPE A;  3AEE A;  2WOW A;  2XLT A;  3AB1 A;  3NN0 X;  4G73 A;  4REK A;  3L8K A;  2GMJ A;  4H4Z A;  2OLN A;  2C70 A;  4YSZ A;  4JNQ A;  4OPT A;  1N1P A;  3AE1 A;  2E4G A;  3B6D A;  3CGC A;  3GYX A;  3NYC A;  1PBC A;  1GRE A;  2TPR A;  3AEF A;  1IUX A;  4A99 A;  2A8X A;  5KMP A;  1H82 A;  1JEH A;  2QA2 A;  2WU2 A;  2VQB A;  2R46 A;  3ATR A;  1TRB A;  1Q1R A;  1COY A;  2WDQ A;  3GRS A;  3K7M X;  4G6G A;  2JB1 A;  1EL8 A;  4J31 A;  4LII A;  2WQY A;  1MXT A;  4GAV A;  1NHQ A;  2BCP A;  3AD9 B;  3UTG A;  4OPI A;  1DOD A;  4UDR A;  3GWD A;  2YR6 A;  4NTD A;  3AE4 A;  3M0O A;  3QVP A;  3GDP A;  2BK5 A;  3GMC A;  3LZW A;  2WP6 A;  1H7W A;  3AE5 A;  3T14 A;  1JRY A;  2WES A;  5U63 A;  2GR3 A;  3ALJ A;  4X9M A;  2VZ2 A;  4U8M A;  2WDR A;  2PYX A;  3DA1 A;  3M12 A;  4USQ A;  4CCQ A;  4GF7 A;  3SFD A;  3GSI A;  4U2T A;  3QFB A;  2OAM A;  3LB8 A;  2YG4 A;  4CNK A;  3FPZ A;  4YWO A;  4RG4 A;  5DBJ A;  5JCM A;  3RNM A;  4U8P A;  4J33 A;  3SX6 A;  4A65 A;  2YLZ A;  4K8D A;  1NAA A;  2VOU A;  1FEC A;  1DJQ A;  4Y4M A;  2YLW A;  2BA9 A;  3T2Z A;  3Q6J A;  1S2Y A;  1IUT A;  1DOB A;  1Y56 B;  1JOA A;  2Q6U A;  2OAL A;  4GDE A;  3V76 A;  3BI5 A;  5EOW A;  1CHU A;  2X99 A;  1KNR A;  2Z5X A;  4UDP A;  5EB4 A;  5CKU A;  5KNL A;  3UKQ A;  3V3O A;  3AEB A;  4IV9 A;  3JSK A;  5HXI A;  2XVI A;  2VRL A;  4AOS A;  4CY8 A;  3WE0 A;  1ZOY A;  2R0P A;  4GUV A;  4FK1 C;  4H4U A;  5FS8 A;  1F8S A;  3NK0 X;  1O5W A;  1S3E A;  2C66 A;  4BV6 A;  4DGK A;  4H2N A;  1GTH A;  3ICT A;  2Z5Y A;  2X8C A;  3BHK A;  4G6H A;  4IVM B;  1LQU A;  3SXI A;  2XLP A;  5KMR A;  1N4U A;  1X31 B;  2R0C A;  4B65 A;  3RP8 A;  2WEU A;  1BF3 A;  1PHH A;  3DJD A;  1GRT A;  1VDC A;  3P4S A;  1L9E A;  1OJT A;  1CJ4 A;  4U2L A;  3H8L A;  4A6N B;  1B8S A;  3NG7 X;  3NN6 X;  3IC9 A;  2ACZ A;  1GRB A;  3F8R A;  3FIM B;  2EQ7 A;  2GAH B;  3B3R A;  3IHG A;  2V61 A;  1DOE A;  2GR1 A;  2B9W A;  1M64 A;  1F8R A;  4I58 A;  3VRD B;  2R0G A;  3UTF A;  4BK1 A;  2RGO A;  3VR9 A;  4E0V A;  1M6I A;  4ECH A;  3CGE A;  2DKI A;  4NTC A;  1JU2 A;  2C65 A;  4Y4N A;  1E7P A;  2EQ8 A;  4OPG A;  1FEB A;  4APN A;  5KOX A;  2BRA A;  4YSH A;  1H7X A;  4H4P A;  3SY4 A;  1EL5 A;  4XWZ A;  3UCL A;  4JDR A;  4BJY A;  3NTA A;  2W0H A;  3S5W A;  3T37 A;  3EPT A;  3CPI G;  3AE6 A;  1ZX9 A;  2RAB A;  2OLO A;  2ZZC A;  1YQ3 A;  1GRF A;  1ZK7 A;  4NZH A;  1E1L A;  1BKW A;  4H4Q A;  3NT6 A;  2B7S A;  4CY6 A;  2QA1 A;  1B4V A;  3E1T A;  4OPC A;  3G5R A;  4EMW A;  3BI4 A;  1O95 A;  4CCR A;  2ZZ0 A;  2IVD A;  1REO A;  3CPH G;  3SZF A;  4EM3 A;  2J3N A;  1XPQ A;  4H4Y A;  3ATQ A;  3T2Y A;  1PJ6 A;  3DGH A;  1CC4 A;  4Z2U A;  3D8X A;  4OPD A;  2C3D A;  5EBK A;  4HA6 A;  4G9K A;  1LQT A;  2B7R A;  1XDI A;  4H4W A;  2X50 A;  3CIR A;  1CC6 A;  2BAB A;  3ADA B;  3AD8 B;  3ABV A;  4OPU A;  4EIQ A;  1O94 A;  2AQJ A;  4H7U A;  3UOZ A;  5IQ4 A;  2CFY A;  3KA7 A;  4II2 A;  2ZZB A;  3AE9 A;  3VR8 A;  2YLT A;  3NK2 X;  4Z43 A;  4AOX A;  3GDN A;  4OPL A;  4J56 A;  4TM1 A;  3P9U A;  4J34 A;  1TYP A;  5GSN A;  1KSU A;  2JB3 A;  2WS3 A;  1GTE A;  3ISH A;  1XAN A;  2BC1 A;  2XYO A;  4KX6 A;  3SFE A;  1BZL A;  1E1N A;  2GV8 A;  3L1R A;  2YG3 A;  2VRM A;  4TLX A;  4WX1 A;  5M0Z A;  3HYW A;  2GVC A;  2FJD A;  2APG A;  2IID A;  4H4T A;  3UKH A;  3UOY A;  4YKF A;  2XLS A;  1EL7 A;  4FX9 A;  3FMW A;  1GXF A;  4B63 A;  5KVI A;  3OZ2 A;  1VQW A;  1IUV A;  1NEN A;  1CBO A;  3NTD A;  1VG0 A;  3M13 A;  3LZX A;  4EQW A;  1QJD A;  3AE3 A;  4P9S A;  4UDQ A;  2XFP A;  3UKK A;  2C73 A;  5KMQ A;  1Q1W A;  3H4K A;  2JKC A;  3QVR A;  4Z44 A;  2Y6R A;  2XLR A;  1DNC A;  5GRT A;  2BXR A;  2H89 A;  2WBA A;  1ZP0 A;  2JK6 A;  2B76 A;  3P4Q A;  4C5O A;  2Y6Q A;  3DME A;  1QLB A;  4Z2R A;  1D5T A;  3GRT A;  3DH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...