4A65A

Crystal structure of the thioredoxin reductase from entamoeba histolytica with aucn
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
IHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
total genus 89
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a65A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a65A02
3AE1A 1CC2A 2BK5A 2Y6QA 4B69A 5KWFA 1E39A 2Y6RA 2ZBWA 3CN8A 4Z2RA 3V3NA 1NHQA 4H4UA 5EOWA 1E1NA 5U1OA 3GSIA 3UOVA 4A7AA 5HXIA 3NGCX 4GRTA 1V59A 1H6VA 1B5QA 2WPFA 3NHOX 1UKVG 2BXRA 1JRYA 3GD4A 3L1RA 2R45A 3LADA 5JCMA 2QAEA 4H4ZA 2GB0A 1BGNA 2GQWA 3FG2P 3K7QX 2GR3A 3BNUA 1BF3A 1KDGA 4H4PA 4EM4A 2XFNA 4ZN0A 1IUVA 1Y56A 2TPRA 4GR1A 1TYPA 2C73A 1P2EA 4YKGA 1FEAA 1ELIA 3LJPA 4B66A 4EIPA 2WP9A 2VRLA 2WDVA 1GTEA 1NDAA 2GR0A 3DMEA 3EAOA 1VRQB 2CDUA 4IVOB 2XLSA 4AT2A 2C64A 4KPRA 2YLWA 3CIRA 1L9CA 5HYMA 3CNTA 2APGA 2V5ZA 4H4WA 3GYJA 4EQSA 2XCGA 1PDHA 4H4RA 2YG4A 4U8KA 3KLJA 3NG7X 2EQ8A 3F8RA 3NYFA 3KKJA 3RHAA 2XFOA 2YWLA 3CGEA 3M12A 3UTGA 4M52A 1ZDLA 4Y4NA 4YWOA 1ZK7A 2JB3A 2YVGA 3UKFA 4Z25A 1DJQA 4B65A 4IA5A 2GVCA 1GXFA 1H83A 4OCGA 3UKAA 1CJ2A 3VRBA 2WOWA 3RNMA 3CPIG 3ICSA 2YVFA 2B9WA 2EQ9A 4N9XA 3FIMB 2BK3A 4DSGA 3AD7B 1QLBA 2Q0LA 2WESA 4C5OA 3GRTA 4JN9A 2VQBA 5FS8A 3K7TA 3OZ2A 3RP7A 3D1CA 2JBVA 4KX6A 1TDNA 4J31A 1ZOYA 4UDPA 2C3DA 1E1LA 2YG6A 3CNSA 2XLRA 3CPJG 2IVDA 5BVAA 1P2HA 4JQ9A 3REDA 2BACA 2QA2A 2YAUA 3C4NA 3AD8B 3PS9A 3SFEA 3NK0X 4BV6A 1OJTA 1DXLA 3ABVA 2CVJA 5GRTA 1F8SA 1GRHA 4OPIA 3VRDB 3IC9A 1JNRA 4EQRA 2RABA 3GWDA 4ICYA 2ARDA 3AE9A 3UTHA 3NYCA 3KPFA 4AP3A 3GMBA 4B64A 4RG3A 1GRAA 5TR3A 1S3EA 1VQWA 4H2QA 4APNA 2WHDA 2WS3A 1O95A 2B7SA 4YTMA 3C4AA 2GAGB 4U2TA 4TM3A 4OPDA 1M6IA 3UTFA 3IF9A 3SGLA 3UKLA 2FJAA 1D7LA 3AD9B 4D03A 3ISHA 4FDCB 3NNEA 4X9MA 3P1WA 1X31B 2GR2A 1OJDA 4AP1A 2WEUA 5JCLA 1K0IA 1PBEA 3WE0A 1H84A 5FMHA 4YT0A 1K0JA 1YKJA 2VRMA 1EL7A 2X99A 3RP8A 3VQRA 2YM1A 5BUKA 1K4QA 2Q6UA 4A6NB 1D4EA 4USQA 2VQ7A 2JK6A 2V60A 1LJ1A 5M0ZA 4AOSA 5EB5A 4U8IA 2XVFA 1PBFA 1TDOA 3ATRA 1KSSA 1NENA 1TRBA 3CPHG 5M10A 4Z2UA 1PN0A 2BK4A 2JAEA 4CCRA 2YQUA 3UKPA 4EMIA 2AQJA 1Z6LA 2O9ZA 1AOGA 1E7PA 1SEZA 3AE4A 4TM0A 2XLUA 4BJZA 1JNZA 4JNQA 3JSKA 4HB9A 1GTHA 1QJDA 1PXBA 2C72A 4BK2A 3NK1X 4B67A 4U2LA 3SFDA 3ICRA 4YXDA 5ER0A 2NVKX 5HY5A 2BS4A 1EBDA 2R0GA 2B9YA 3IHMA 1GESA 4A65A 1JEHA 1JRXA 1GEUA 4IV9A 3FMWA 2OAMA 2OA1A 1NG3A 3BI2A 1DOEA 3AE8A 1QO8A 3P4RA 1CF3A 4H4SA 4IA6A 3R9UA 1IJHA 1GRBA 4Y4MA 2V3AA 4UDRA 3ATQA 4K2XA 1S2QA 4J56A 5EB4A 4Z44A 4J34A 1H7XA 3AEBA 3BNMA 4U8MA 2V3BA 2B76A 3P4SA 2YLXA 3C96A 3F8PA 3CGDA 5KVHA 4JDRA 3F8DA 2R4EA 2GRTA 3AEDA 2GH5A 1LTXR 1Q9IA 2E1MA 3ZDNA 4C3XA 1K0LA 3AEGA 3NH3X 3QJ4A 1NG4A 3ADAB 2C75A 1GALA 2IIDA 2Q0KA 1XPQA 4B68A 3K30A 1CJCA 1D4CA 2Z5XA 1BKWA 2E4GA 3AE6A 2VOUA 3DJDA 4JNAA 1GOSA 3NK2X 4CBQA 3UKHA 4D04A 3DGHA 1L9EA 3IHGA 2ACZA 4WCTA 2F5ZA 5GSNA 4EMWA 5KXJA 1GT8A 2C3CA 1DJNA 4J57A 1HYUA 2YLTA 4CY8A 2YLRA 1OJCA 1PJ6A 3LB8A 1H81A 4C3YA 4H4TA 1E1MA 1H86A 2EQ7A 4BK1A 4YKFA 3ALMA 1PS9A 2BXSA 4GF7A 3CTYA 2WP5A 2RGJA 1DNCA 4C74A 2EQ6A 2VVMA 4AOXA 4GCMA 1ZMCA 2WDRA 2YM2A 1XANA 2BABA 3H8IA 1EL5A 4OPGA 3L8KA 4MJWA 2GQFA 1BGJA 2XFQA 5KVIA 1COYA 2C70A 2R0CA 2JB2A 4A5LA 3M0OA 1CJ4A 1TYTA 3EF6A 1B37A 1XHCA 4Z26A 1LQUA 4YSYA 1KSUA 2FJEA 4TM4A 1F8WA 4TLXA 3UTEA 3DJJA 2GR1A 1IUWA 4H4YA 2VVLG 3NRNA 2GV8A 1PBCA 2TMDA 1JRZA 4LIIA 4LU6A 4K5RA 4BJYA 1NHPA 2AAQA 3G5QA 3O0HA 2B7RA 1L9DA 2YR4A 2RGOA 2NPXA 1PXCA 3GWFA 4J33A 3S5WA 1VG0A 3Q9TA 4U8NA 5U63A 2R4JA 4XXGA 2C7GA 3UCLA 3NKSA 2OALA 2V61A 4YSHA 1CJ3A 2VZ2A 3FPZA 3T37A 3GYIA 1TDFA 4Z43A 2WBAA 1OJ9A 4GDEA 3PVCA 3DK4A 3V3OA 2WOVA 4C77A 4K7ZA 3UKKA 2WPCA 1KNPA 1VG9A 5CKUA 1BWCA 1GRGA 1Q1WA 2Q7VA 4DNAA 4XWZA 3AEFA 1OJAA 2C76A 2BCPA 3DA1A 3RP6A 2JKCA 2W0HA 3NYEA 3HZLA 1MXTA 4O5QA 1DODA 1N4VA 1GRFA 2X8GA 4J2WA 4X9NA 3NTAA 4Y4LA 5FS9A 1NHRA 1PBDA 3H4KA 4FK1A 4EQWA 1H82A 1PBBA 2BS2A 2X8CA 2X50A 2XDOA 1D5TA 4TLZA 3UP4A 3LXDA 2QA1A 1GNDA 4DGKA 1KF6A 3AE5A 4RSLA 3UOZA 1LQTA 1W4XA 3B6DA 4H7UA 2R0PA 2R46A 4NEVA 3BI5A 3P9UA 3ALLA 3VR9A 1B8SA 2BC1A 1KNRA 1FCDA 2AR8A 3AWIA 1LV0A 4LA1A 4NEWA 1S3BA 2ZZBA 5IQ1A 4USRA 2PHHA 2I0ZA 2YVJA 4CNKA 1LVLA 2CULA 4GUVA 4EIQA 2Z5YA 2XVIA 3LOVA 2E5VA 1VDCA 2A8XA 2YR5A 3FBSA 2PYXA 3SM8A 3AYLA 1PJ7A 4PABA 4H2NA 3QSEA 4OPCA 2XLPA 1IUTA 5JCKA 3GRSA 2HQMA 4I58A 3UKQA 5LV9A 4YSZA 4B1BA 5EBKA 2YG7A 3AECA 4H2PA 5HHFA 3LZXA 4WX1A 3P4PA 1IUXA 1D4DA 3I3LA 2OLOA 4UP3A 1CHUA 3ZYXA 5BULA 3UOXA 1XDIA 1PXAA 1E1KA 4U2SA 5C3JA 2DKHA 2GEWA 1YQZA 3VR8A 2BYBA 1ZMDA 3V76A 1GREA 3NTDA 1GV4A 2A87A 3NIXA 1ZKQA 1REOA 1DOCA 3CNJA 4YTNA 1PHHA 4CNJA 4I59A 5JCIA 3GDPA 3NLCA 4OVIA 2C66A 3AE2A 1RP0A 1MO9A 1ZX9A 2H89A 4HA6A 4OPLA 1D7YA 1TDEA 4TM1A 3COXA 2J3NA 1ZY8A 2GMJA 3H8LA 1S2YA 2YG3A 1H7WA 5FS7A 1N4UA 2DKIA 4H4VA 1O5WA 1YY5A 2WU5A 4A9WA 1ZOVA 4UDQA 5J7XA 4K8DA 1L0VA 3CGBA 4A99A 4U8LA 3GDNA 1LPFA 2H88A 3KD9A 3Q6JA 1CBOA 2FJBA 2ZZCA 1GERA 1NHSA 4OPUA 3KA7A 4U8PA 4YTPA 3AXBA 2C65A 2GMHA 1CL0A 3I6DA 3M13A 3URHA 2BCGG 4BURA 2UZZA 4EMJA 1ZP0A 1M64A 3GD3A 4NTDA 4JY2A 2C67A 3DK8A 1NPXA 2WU2A 4ECHA 4BK3A 2YLZA 2WOIA 3CGCA 1F8RA 2XVHA 2WPEA 4OPTA 5L46A 5IQ4A 3ICTA 3S61A 3B3RA 3CNDA 2YG5A 4PAAA 4REKA 3AEEA 4AT0A 3K7MX 3QSSA 3E1TA 4P9SA 1JU2A 3OC4A 1CC4A 1GRTA 1RSGA 1JOAA 4EQXA 3KVEA 4ZCDA 1FOHA 4FX9A 2WP6A 4H50A 4ZCCA 3D8XA 1B4VA 3SQPA 1BZLA 2BA9A 1Q1RA 1E6EA 1MOKA 2QCUA 2RGHA 5JCNA 2XFUA 3AYIA 4O5UA 4K22A 4U8JA 4Z2TA 2XVEA 4K5SA 4H4QA 3AEAA 4YSXA 5CQFA 5KOWA 5IPYA 2JB1A 3DK9A 3QVPA 3QVRA 2A89A 2V6OA 3PO7A 4NTCA 2R9ZA 3DJGX 2XFPA 3ITJA 4J36A 2GF3A 1TDKA 4NTEA 5U25A 4Z24A 1O94A 2WDQA 3AE3A 1KFYA 4IVMB 4GDPA 4ADWA 2XVJA 4E0VA 5C2TA 2BC0A 1GETA 3IWAA 1EL9A 3UP5A 4CRTA 4B63A 1CC6A 1N1PA 2BS3A 2IVEA 3CNPA 2WQYA 3QSMA 3VRAA 4CCQA 4EM3A 3EANA 2FBWA 4H4XA 1GPEA 3AB1A 3NN6X 2FJDA 1Y0PA 3ALJA 4XWRA 3KU9A 4NZHA 3II4A 3AE7A 2XYOA 5KRQA 1F3PA 5KOXA 5DBJA 3G5RA 3DH9A 1FL2A 1PJ5A 2CFYA 3QFBA 1NAAA 3DJEA 5J60A 1EL8A 4A79A 3BI4A 3G5SA 3UOYA 2B9XA 3NT6A 3QFAA 3BHKA 4CY6A 1FEBA 1Y56B 2OLNA 2YLSA 3AYJA 3DGZA 1RYIA 4H2RA 4U8OA 4RG4A 1FECA 3EPTA 5FS6A 1NEKA 2X3NA 2VVLA 2X8HA 1IUSA 3LZWA 2XLTA 1YQ3A 2GAHB 4DSHA 5BRTA 3P4QA 3NN0X 1N4WA 4FK1C 1GSNA 2YR6A 4JY3A 4X4JA 4A6NA 2WETA 1IUUA 1F6MA 1DOBA 1YQ4A 3BHFA 3GMCA 1ONFA 2ZZ0A
chains in the Genus database with same CATH superfamily
3AE1A 1CC2A 2BK5A 2Y6QA 4B69A 5KWFA 1E39A 2Y6RA 2ZBWA 3CN8A 4Z2RA 3V3NA 1NHQA 4H4UA 5EOWA 1E1NA 5U1OA 3GSIA 3UOVA 4A7AA 5HXIA 3SYIA 3NGCX 4GRTA 1V59A 1H6VA 1B5QA 2WPFA 3NHOX 1UKVG 2BXRA 1JRYA 3GD4A 3L1RA 2R45A 3LADA 5JCMA 2QAEA 4H4ZA 2GB0A 1BGNA 2GQWA 3FG2P 3K7QX 2GR3A 3BNUA 1BF3A 1KDGA 4H4PA 4EM4A 2XFNA 4ZN0A 1IUVA 1Y56A 2TPRA 4GR1A 1TYPA 2C73A 1P2EA 4YKGA 1FEAA 1ELIA 3LJPA 4B66A 4EIPA 2WP9A 2VRLA 2WDVA 1GTEA 1NDAA 2GR0A 3DMEA 3EAOA 1VRQB 2CDUA 4IVOB 2XLSA 4AT2A 2C64A 4KPRA 2YLWA 3CIRA 1L9CA 5HYMA 3CNTA 2APGA 2V5ZA 4H4WA 3GYJA 4EQSA 2XCGA 1PDHA 4H4RA 2YG4A 4U8KA 3KLJA 3NG7X 2EQ8A 3F8RA 3NYFA 3KKJA 3RHAA 2XFOA 2YWLA 3SY4A 3CGEA 3M12A 3UTGA 4M52A 3T2KA 1ZDLA 4Y4NA 4YWOA 2BRYA 1ZK7A 2JB3A 2YVGA 3UKFA 4Z25A 1DJQA 4B65A 4IA5A 2GVCA 1GXFA 1H83A 4OCGA 3UKAA 1CJ2A 3VRBA 2WOWA 4G6HA 3RNMA 3CPIG 3ICSA 2YVFA 2B9WA 2EQ9A 4N9XA 3FIMB 2BK3A 4DSGA 3AD7B 1QLBA 2Q0LA 2WESA 4C5OA 3GRTA 4JN9A 2VQBA 5FS8A 3K7TA 3SZWA 3OZ2A 3RP7A 3D1CA 2JBVA 4KX6A 1TDNA 4J31A 1ZOYA 4UDPA 2C3DA 1E1LA 2YG6A 3CNSA 2XLRA 3CPJG 2IVDA 5BVAA 1P2HA 4JQ9A 3REDA 2BACA 2QA2A 2YAUA 3C4NA 3AD8B 3PS9A 3SFEA 3NK0X 4BV6A 1OJTA 1DXLA 3ABVA 2CVJA 5GRTA 1F8SA 1GRHA 4OPIA 3VRDB 3IC9A 1JNRA 4EQRA 2RABA 3GWDA 4ICYA 2ARDA 3AE9A 3UTHA 3NYCA 3KPFA 4AP3A 3GMBA 4B64A 4RG3A 1GRAA 5TR3A 1S3EA 1VQWA 4H2QA 4APNA 2WHDA 2WS3A 1O95A 2B7SA 4YTMA 2BRAA 2GAGB 3C4AA 4TM3A 4U2TA 4OPDA 1M6IA 3UTFA 3IF9A 3SGLA 3UKLA 2FJAA 1D7LA 3AD9B 4D03A 3ISHA 4FDCB 3NNEA 4X9MA 3P1WA 1X31B 2GR2A 1OJDA 4AP1A 2WEUA 5JCLA 1K0IA 1PBEA 3WE0A 1H84A 5FMHA 4YT0A 1K0JA 1YKJA 2VRMA 1EL7A 2X99A 3RP8A 3VQRA 2YM1A 5BUKA 1K4QA 2Q6UA 4A6NB 1D4EA 4USQA 3SX6A 2VQ7A 2JK6A 2V60A 1LJ1A 5M0ZA 4AOSA 5EB5A 4U8IA 2XVFA 1PBFA 1TDOA 3ATRA 1KSSA 1NENA 1TRBA 3CPHG 5M10A 4Z2UA 1PN0A 2BK4A 2JAEA 4CCRA 2YQUA 3UKPA 4EMIA 2AQJA 1Z6LA 2O9ZA 3HYVA 1AOGA 1E7PA 1SEZA 3AE4A 4TM0A 2XLUA 4BJZA 1JNZA 4JNQA 3JSKA 4HB9A 1GTHA 5KMSA 1QJDA 1PXBA 2C72A 4BK2A 3NK1X 4II3A 4U2LA 4B67A 3SFDA 3ICRA 4YXDA 5ER0A 2NVKX 5HY5A 2BS4A 1EBDA 5KMQA 2R0GA 2B9YA 3IHMA 1GESA 4A65A 1JEHA 1JRXA 1GEUA 4IV9A 3FMWA 2OAMA 2OA1A 1NG3A 3BI2A 1DOEA 3AE8A 1QO8A 3P4RA 1CF3A 4H4SA 4IA6A 3R9UA 1IJHA 1GRBA 4Y4MA 3T0KA 2V3AA 4UDRA 3ATQA 4K2XA 1S2QA 4J56A 5EB4A 4Z44A 4J34A 1H7XA 3AEBA 3BNMA 4U8MA 2V3BA 2C4CA 2B76A 3P4SA 2YLXA 3C96A 3F8PA 3CGDA 5KVHA 4JDRA 3F8DA 2R4EA 2GRTA 3AEDA 2GH5A 1LTXR 1Q9IA 2E1MA 3T31A 3ZDNA 4C3XA 1K0LA 3AEGA 3NH3X 3QJ4A 1NG4A 3ADAB 2C75A 1GALA 2IIDA 2Q0KA 1XPQA 4B68A 3K30A 1CJCA 1D4CA 2Z5XA 1BKWA 2E4GA 3AE6A 2VOUA 3DJDA 4JNAA 1GOSA 3NK2X 4CBQA 3UKHA 4D04A 3DGHA 1L9EA 3IHGA 2ACZA 4WCTA 2F5ZA 5GSNA 4EMWA 5KXJA 1GT8A 2C3CA 1DJNA 4J57A 1HYUA 2YLTA 4CY8A 2YLRA 1OJCA 1PJ6A 3LB8A 1H81A 3SZ0A 4C3YA 4H4TA 1E1MA 1H86A 2EQ7A 4BK1A 4YKFA 3ALMA 1PS9A 2BXSA 4GF7A 3CTYA 2WP5A 2RGJA 3HYXA 1DNCA 4C74A 2EQ6A 2VVMA 3T2YA 4AOXA 4GCMA 1ZMCA 2WDRA 2YM2A 1XANA 2BABA 3H8IA 1EL5A 4OPGA 3L8KA 4MJWA 2GQFA 1BGJA 2XFQA 5KVIA 1COYA 2C70A 2R0CA 2JB2A 4A5LA 3M0OA 1CJ4A 1TYTA 3EF6A 1B37A 3SXIA 4NWZA 1XHCA 4Z26A 1LQUA 4YSYA 1KSUA 2FJEA 4TM4A 1F8WA 4TLXA 3UTEA 3DJJA 2GR1A 1IUWA 4H4YA 2VVLG 3NRNA 4G6GA 2GV8A 1PBCA 2TMDA 1JRZA 4LIIA 4LU6A 4K5RA 4BJYA 1NHPA 2AAQA 3G5QA 3O0HA 2B7RA 1L9DA 2YR4A 2RGOA 2NPXA 1PXCA 3GWFA 4J33A 3S5WA 1VG0A 3Q9TA 4U8NA 5U63A 2R4JA 4XXGA 2C7GA 3UCLA 3NKSA 2OALA 2V61A 4YSHA 4NNJA 1CJ3A 2VZ2A 3FPZA 3T37A 3GYIA 1TDFA 4Z43A 2WBAA 1OJ9A 4GDEA 3PVCA 3DK4A 3V3OA 2WOVA 4C77A 4K7ZA 3UKKA 2WPCA 1KNPA 1VG9A 5CKUA 1BWCA 1GRGA 1Q1WA 2Q7VA 4DNAA 4XWZA 3AEFA 1OJAA 2C76A 3SZCA 2BCPA 3DA1A 3RP6A 2JKCA 2W0HA 3NYEA 3HZLA 1MXTA 4O5QA 1DODA 1N4VA 1GRFA 2X8GA 4J2WA 4X9NA 3NTAA 4Y4LA 5FS9A 1NHRA 1PBDA 4G73A 3H4KA 4FK1A 4EQWA 1H82A 1PBBA 2BS2A 2X8CA 2X50A 2XDOA 1D5TA 4TLZA 3UP4A 3LXDA 2QA1A 1GNDA 4DGKA 1KF6A 3AE5A 4RSLA 3UOZA 1LQTA 1W4XA 3B6DA 4H7UA 2R0PA 2R46A 4NEVA 3BI5A 3P9UA 3ALLA 3VR9A 1B8SA 2BC1A 1KNRA 1FCDA 2AR8A 3AWIA 1LV0A 4LA1A 4NEWA 1S3BA 2ZZBA 5IQ1A 4USRA 5KNLA 2PHHA 2I0ZA 2YVJA 4CNKA 1LVLA 2CULA 3T2ZA 4GUVA 4EIQA 2Z5YA 2XVIA 3LOVA 2E5VA 1VDCA 2A8XA 2YR5A 3FBSA 2PYXA 3SM8A 3AYLA 1PJ7A 3GYXA 4PABA 4H2NA 3QSEA 4OPCA 2XLPA 5KMRA 1IUTA 5JCKA 3GRSA 2HQMA 4I58A 3UKQA 5LV9A 4YSZA 4B1BA 5EBKA 2YG7A 3AECA 4H2PA 5HHFA 3LZXA 4WX1A 3P4PA 1IUXA 1D4DA 3I3LA 4G74A 2OLOA 4GAVA 4UP3A 1CHUA 3ZYXA 3KPKA 5BULA 3UOXA 1XDIA 1PXAA 1E1KA 4U2SA 5C3JA 2DKHA 2GEWA 1YQZA 3VR8A 2BYBA 1ZMDA 3V76A 1GREA 3NTDA 1GV4A 2A87A 3NIXA 1ZKQA 1REOA 1DOCA 3CNJA 4YTNA 1PHHA 4CNJA 4I59A 5JCIA 3GDPA 3NLCA 4OVIA 5KMPA 2C66A 3AE2A 1RP0A 1MO9A 1ZX9A 2H89A 4HA6A 4OPLA 1D7YA 1TDEA 4TM1A 3COXA 2J3NA 1ZY8A 2GMJA 3H8LA 1S2YA 2YG3A 1H7WA 5FS7A 1N4UA 2DKIA 4H4VA 1O5WA 1YY5A 2WU5A 4A9WA 1ZOVA 4UDQA 5J7XA 4K8DA 1L0VA 3CGBA 4A99A 4U8LA 3GDNA 1LPFA 2H88A 3KD9A 3Q6JA 1CBOA 4GAPA 2FJBA 2ZZCA 1GERA 1NHSA 4OPUA 3KA7A 4U8PA 4YTPA 3AXBA 2C65A 2GMHA 1CL0A 3I6DA 3M13A 3URHA 2BCGG 4BURA 2UZZA 4EMJA 1ZP0A 1M64A 3GD3A 4NTDA 4JY2A 2C67A 3DK8A 1NPXA 2WU2A 4ECHA 4BK3A 2YLZA 2WOIA 3CGCA 1F8RA 2XVHA 2WPEA 4OPTA 5L46A 5IQ4A 3ICTA 3S61A 3B3RA 3CNDA 2YG5A 4PAAA 4REKA 3AEEA 4AT0A 3K7MX 3QSSA 3E1TA 4P9SA 1JU2A 3OC4A 1CC4A 1GRTA 1RSGA 1JOAA 4EQXA 3KVEA 4ZCDA 1FOHA 4FX9A 2WP6A 4H50A 4ZCCA 3D8XA 1B4VA 4G9KA 3SQPA 1BZLA 2BA9A 1Q1RA 1E6EA 1MOKA 2QCUA 2RGHA 5JCNA 2XFUA 3AYIA 4O5UA 4K22A 4U8JA 4Z2TA 2XVEA 4K5SA 4H4QA 3AEAA 4YSXA 5CQFA 5KOWA 5IPYA 2JB1A 3DK9A 3QVPA 3QVRA 2A89A 2V6OA 3PO7A 4NTCA 2R9ZA 3DJGX 2XFPA 3ITJA 4J36A 2GF3A 1TDKA 4NTEA 5U25A 4Z24A 1O94A 2WDQA 3CMMA 3HYWA 3AE3A 1KFYA 4IVMB 4GDPA 4II2A 4ADWA 2XVJA 4E0VA 5C2TA 3SZFA 2BC0A 1GETA 3IWAA 1EL9A 3UP5A 4CRTA 4B63A 1CC6A 1N1PA 2BS3A 2IVEA 3CNPA 2WQYA 3QSMA 3VRAA 4CCQA 4EM3A 3EANA 2FBWA 4H4XA 1GPEA 3AB1A 3NN6X 2FJDA 1Y0PA 3ALJA 4XWRA 3KU9A 4NZHA 3II4A 3AE7A 2XYOA 5KRQA 1F3PA 5KOXA 5DBJA 3G5RA 3DH9A 1FL2A 1PJ5A 2CFYA 3QFBA 1NAAA 3DJEA 5J60A 1EL8A 4A79A 3BI4A 3G5SA 3UOYA 2B9XA 3NT6A 3QFAA 3BHKA 4CY6A 1FEBA 1Y56B 2OLNA 2YLSA 3AYJA 3DGZA 1RYIA 4H2RA 4U8OA 4RG4A 1FECA 3EPTA 5FS6A 1NEKA 2X3NA 3T14A 2VVLA 2X8HA 1IUSA 3LZWA 2XLTA 1YQ3A 2GAHB 4DSHA 5BRTA 3P4QA 3NN0X 1N4WA 4FK1C 1GSNA 2YR6A 4JY3A 4X4JA 4A6NA 2WETA 1IUUA 1F6MA 1DOBA 1YQ4A 3BHFA 3GMCA 1ONFA 2ZZ0A
chains in the Genus database with same CATH topology
3AE1A 1CC2A 2BK5A 2Y6QA 4B69A 5KWFA 1E39A 2Y6RA 2ZBWA 3CN8A 4Z2RA 3V3NA 1NHQA 4H4UA 5EOWA 1E1NA 5U1OA 3GSIA 3UOVA 4A7AA 5HXIA 3SYIA 3NGCX 4GRTA 1V59A 1H6VA 1B5QA 2WPFA 3NHOX 1UKVG 2BXRA 1JRYA 3GD4A 3L1RA 2R45A 3LADA 5JCMA 2QAEA 4H4ZA 2GB0A 1BGNA 2GQWA 3FG2P 3K7QX 2GR3A 3BNUA 1BF3A 1KDGA 4H4PA 4EM4A 2XFNA 4ZN0A 1IUVA 1Y56A 2TPRA 4GR1A 1TYPA 2C73A 1P2EA 4YKGA 1FEAA 1ELIA 3LJPA 4B66A 4EIPA 2WP9A 2VRLA 2WDVA 1GTEA 1NDAA 2GR0A 3DMEA 3EAOA 1VRQB 2CDUA 4IVOB 2XLSA 4AT2A 2C64A 4KPRA 2YLWA 3CIRA 1L9CA 5HYMA 3CNTA 2APGA 2V5ZA 4H4WA 3GYJA 4EQSA 2XCGA 1PDHA 4H4RA 2YG4A 4U8KA 3KLJA 3NG7X 2EQ8A 3F8RA 3NYFA 3KKJA 3RHAA 2XFOA 2YWLA 3SY4A 3CGEA 3M12A 3UTGA 4M52A 3T2KA 1ZDLA 4Y4NA 4YWOA 2BRYA 1ZK7A 2JB3A 2YVGA 3UKFA 4Z25A 1DJQA 4B65A 4IA5A 2GVCA 1GXFA 1H83A 4OCGA 3UKAA 1CJ2A 3VRBA 2WOWA 4G6HA 3RNMA 3CPIG 3ICSA 2YVFA 2B9WA 2EQ9A 4N9XA 3FIMB 2BK3A 4DSGA 3AD7B 1QLBA 2Q0LA 2WESA 4C5OA 3GRTA 4JN9A 2VQBA 5FS8A 3K7TA 3SZWA 3OZ2A 3RP7A 3D1CA 2JBVA 4KX6A 1TDNA 4J31A 1ZOYA 4UDPA 2C3DA 1E1LA 2YG6A 3CNSA 2XLRA 3CPJG 2IVDA 5BVAA 1P2HA 4JQ9A 3REDA 2BACA 2QA2A 2YAUA 3C4NA 3AD8B 3PS9A 3SFEA 3NK0X 4BV6A 1OJTA 1DXLA 3ABVA 2CVJA 5GRTA 1F8SA 1GRHA 4OPIA 3VRDB 3IC9A 1JNRA 4EQRA 2RABA 3GWDA 4ICYA 2ARDA 3AE9A 3UTHA 3NYCA 3KPFA 4AP3A 3GMBA 4B64A 4RG3A 1GRAA 5TR3A 1S3EA 1VQWA 4H2QA 4APNA 2WHDA 2WS3A 1O95A 2B7SA 4YTMA 2BRAA 2GAGB 3C4AA 4TM3A 4U2TA 4OPDA 1M6IA 3UTFA 3IF9A 3SGLA 3UKLA 2FJAA 1D7LA 3AD9B 4D03A 3ISHA 4FDCB 3NNEA 4X9MA 3P1WA 1X31B 2GR2A 1OJDA 4AP1A 2WEUA 5JCLA 1K0IA 1PBEA 3WE0A 1H84A 5FMHA 4YT0A 1K0JA 1YKJA 2VRMA 1EL7A 2X99A 3RP8A 3VQRA 2YM1A 5BUKA 1K4QA 2Q6UA 4A6NB 1D4EA 4USQA 3SX6A 2VQ7A 2JK6A 2V60A 1LJ1A 5M0ZA 4AOSA 5EB5A 4U8IA 2XVFA 1PBFA 1TDOA 3ATRA 1KSSA 1NENA 1TRBA 3CPHG 5M10A 4Z2UA 1PN0A 2BK4A 2JAEA 4CCRA 2YQUA 3UKPA 4EMIA 2AQJA 1Z6LA 2O9ZA 3HYVA 1AOGA 1E7PA 1SEZA 3AE4A 4TM0A 2XLUA 4BJZA 1JNZA 4JNQA 3JSKA 4HB9A 1GTHA 5KMSA 1QJDA 1PXBA 2C72A 4BK2A 3NK1X 4II3A 4U2LA 4B67A 3SFDA 3ICRA 4YXDA 5ER0A 2NVKX 5HY5A 2BS4A 1EBDA 5KMQA 2R0GA 2B9YA 3IHMA 1GESA 4A65A 1JEHA 1JRXA 1GEUA 4IV9A 3FMWA 2OAMA 2OA1A 1NG3A 3BI2A 1DOEA 3AE8A 1QO8A 3P4RA 1CF3A 4H4SA 4IA6A 3R9UA 1IJHA 1GRBA 4Y4MA 3T0KA 2V3AA 4UDRA 3ATQA 4K2XA 1S2QA 4J56A 5EB4A 4Z44A 4J34A 1H7XA 3AEBA 3BNMA 4U8MA 2V3BA 2C4CA 2B76A 3P4SA 2YLXA 3C96A 3F8PA 3CGDA 5KVHA 4JDRA 3F8DA 2R4EA 2GRTA 3AEDA 2GH5A 1LTXR 1Q9IA 2E1MA 3T31A 3ZDNA 4C3XA 1K0LA 3AEGA 3NH3X 3QJ4A 1NG4A 3ADAB 2C75A 1GALA 2IIDA 2Q0KA 1XPQA 4B68A 3K30A 1CJCA 1D4CA 2Z5XA 1BKWA 2E4GA 3AE6A 2VOUA 3DJDA 4JNAA 1GOSA 3NK2X 4CBQA 3UKHA 4D04A 3DGHA 1L9EA 3IHGA 2ACZA 4WCTA 2F5ZA 5GSNA 4EMWA 5KXJA 1GT8A 2C3CA 1DJNA 4J57A 1HYUA 2YLTA 4CY8A 2YLRA 1OJCA 1PJ6A 3LB8A 1H81A 3SZ0A 4C3YA 4H4TA 1E1MA 1H86A 2EQ7A 4BK1A 4YKFA 3ALMA 1PS9A 2BXSA 4GF7A 3CTYA 2WP5A 2RGJA 3HYXA 1DNCA 4C74A 2EQ6A 2VVMA 3T2YA 4AOXA 4GCMA 1ZMCA 2WDRA 2YM2A 1XANA 2BABA 3H8IA 1EL5A 4OPGA 3L8KA 4MJWA 2GQFA 1BGJA 2XFQA 5KVIA 1COYA 2C70A 2R0CA 2JB2A 4A5LA 3M0OA 1CJ4A 1TYTA 3EF6A 1B37A 3SXIA 4NWZA 1XHCA 4Z26A 1LQUA 4YSYA 1KSUA 2FJEA 4TM4A 1F8WA 4TLXA 3UTEA 3DJJA 2GR1A 1IUWA 4H4YA 2VVLG 3NRNA 4G6GA 2GV8A 1PBCA 2TMDA 1JRZA 4LIIA 4LU6A 4K5RA 4BJYA 1NHPA 2AAQA 3G5QA 3O0HA 2B7RA 1L9DA 2YR4A 2RGOA 2NPXA 1PXCA 3GWFA 4J33A 3S5WA 1VG0A 3Q9TA 4U8NA 5U63A 2R4JA 4XXGA 2C7GA 3UCLA 3NKSA 2OALA 2V61A 4YSHA 4NNJA 1CJ3A 2VZ2A 3FPZA 3T37A 3GYIA 1TDFA 4Z43A 2WBAA 1OJ9A 4GDEA 3PVCA 3DK4A 3V3OA 2WOVA 4C77A 4K7ZA 3UKKA 2WPCA 1KNPA 1VG9A 5CKUA 1BWCA 1GRGA 1Q1WA 2Q7VA 4DNAA 4XWZA 3AEFA 1OJAA 2C76A 3SZCA 2BCPA 3DA1A 3RP6A 2JKCA 2W0HA 3NYEA 3HZLA 1MXTA 4O5QA 1DODA 1N4VA 1GRFA 2X8GA 4J2WA 4X9NA 3NTAA 4Y4LA 5FS9A 1NHRA 1PBDA 4G73A 3H4KA 4FK1A 4EQWA 1H82A 1PBBA 2BS2A 2X8CA 2X50A 2XDOA 1D5TA 4TLZA 3UP4A 3LXDA 2QA1A 1GNDA 4DGKA 1KF6A 3AE5A 4RSLA 3UOZA 1LQTA 1W4XA 3B6DA 4H7UA 2R0PA 2R46A 4NEVA 3BI5A 3P9UA 3ALLA 3VR9A 1B8SA 2BC1A 1KNRA 1FCDA 2AR8A 3AWIA 1LV0A 4LA1A 4NEWA 1S3BA 2ZZBA 5IQ1A 4USRA 5KNLA 2PHHA 2I0ZA 2YVJA 4CNKA 1LVLA 2CULA 3T2ZA 4GUVA 4EIQA 2Z5YA 2XVIA 3LOVA 2E5VA 1VDCA 2A8XA 2YR5A 3FBSA 2PYXA 3SM8A 3AYLA 1PJ7A 3GYXA 4PABA 4H2NA 3QSEA 4OPCA 2XLPA 5KMRA 1IUTA 5JCKA 3GRSA 2HQMA 4I58A 3UKQA 5LV9A 4YSZA 4B1BA 5EBKA 2YG7A 3AECA 4H2PA 5HHFA 3LZXA 4WX1A 3P4PA 1IUXA 1D4DA 3I3LA 4G74A 2OLOA 4GAVA 4UP3A 1CHUA 3ZYXA 3KPKA 5BULA 3UOXA 1XDIA 1PXAA 1E1KA 4U2SA 5C3JA 2DKHA 2GEWA 1YQZA 3VR8A 2BYBA 1ZMDA 3V76A 1GREA 3NTDA 1GV4A 2A87A 3NIXA 1ZKQA 1REOA 1DOCA 3CNJA 4YTNA 1PHHA 4CNJA 4I59A 5JCIA 3GDPA 3NLCA 4OVIA 5KMPA 2C66A 3AE2A 1RP0A 1MO9A 1ZX9A 2H89A 4HA6A 4OPLA 1D7YA 1TDEA 4TM1A 3COXA 2J3NA 1ZY8A 2GMJA 3H8LA 1S2YA 2YG3A 1H7WA 5FS7A 1N4UA 2DKIA 4H4VA 1O5WA 1YY5A 2WU5A 4A9WA 1ZOVA 4UDQA 5J7XA 4K8DA 1L0VA 3CGBA 4A99A 4U8LA 3GDNA 1LPFA 2H88A 3KD9A 3Q6JA 1CBOA 4GAPA 2FJBA 2ZZCA 1GERA 1NHSA 4OPUA 3KA7A 4U8PA 4YTPA 3AXBA 2C65A 2GMHA 1CL0A 3I6DA 3M13A 3URHA 2BCGG 4BURA 2UZZA 4EMJA 1ZP0A 1M64A 3GD3A 4NTDA 4JY2A 2C67A 3DK8A 1NPXA 2WU2A 4ECHA 4BK3A 2YLZA 2WOIA 3CGCA 1F8RA 2XVHA 2WPEA 4OPTA 5L46A 5IQ4A 3ICTA 3S61A 3B3RA 3CNDA 2YG5A 4PAAA 4REKA 3AEEA 4AT0A 3K7MX 3QSSA 3E1TA 4P9SA 1JU2A 3OC4A 1CC4A 1GRTA 1RSGA 1JOAA 4EQXA 3KVEA 4ZCDA 1FOHA 4FX9A 2WP6A 4H50A 4ZCCA 3D8XA 1B4VA 4G9KA 3SQPA 1BZLA 2BA9A 1Q1RA 1E6EA 1MOKA 2QCUA 2RGHA 5JCNA 2XFUA 3AYIA 4O5UA 4K22A 4U8JA 4Z2TA 2XVEA 4K5SA 4H4QA 3AEAA 4YSXA 5CQFA 5KOWA 5IPYA 2JB1A 3DK9A 3QVPA 3QVRA 2A89A 2V6OA 3PO7A 4NTCA 2R9ZA 3DJGX 2XFPA 3ITJA 4J36A 2GF3A 1TDKA 4NTEA 5U25A 4Z24A 1O94A 2WDQA 3CMMA 3HYWA 3AE3A 1KFYA 4IVMB 4GDPA 4II2A 4ADWA 2XVJA 4E0VA 5C2TA 3SZFA 2BC0A 1GETA 3IWAA 1EL9A 3UP5A 4CRTA 4B63A 1CC6A 1N1PA 2BS3A 2IVEA 3CNPA 2WQYA 3QSMA 3VRAA 4CCQA 4EM3A 3EANA 2FBWA 4H4XA 1GPEA 3AB1A 3NN6X 2FJDA 1Y0PA 3ALJA 4XWRA 3KU9A 4NZHA 3II4A 3AE7A 2XYOA 5KRQA 1F3PA 5KOXA 5DBJA 3G5RA 3DH9A 1FL2A 1PJ5A 2CFYA 3QFBA 1NAAA 3DJEA 5J60A 1EL8A 4A79A 3BI4A 3G5SA 3UOYA 2B9XA 3NT6A 3QFAA 3BHKA 4CY6A 1FEBA 1Y56B 2OLNA 2YLSA 3AYJA 3DGZA 1RYIA 4H2RA 4U8OA 4RG4A 1FECA 3EPTA 5FS6A 1NEKA 2X3NA 3T14A 2VVLA 2X8HA 1IUSA 3LZWA 2XLTA 1YQ3A 2GAHB 4DSHA 5BRTA 3P4QA 3NN0X 1N4WA 4FK1C 1GSNA 2YR6A 4JY3A 4X4JA 4A6NA 2WETA 1IUUA 1F6MA 1DOBA 1YQ4A 3BHFA 3GMCA 1ONFA 2ZZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE1 A;  1CC2 A;  2BK5 A;  2Y6Q A;  4B69 A;  5KWF A;  1E39 A;  2Y6R A;  2ZBW A;  3CN8 A;  4Z2R A;  3V3N A;  1NHQ A;  4H4U A;  5EOW A;  1E1N A;  5U1O A;  3GSI A;  3UOV A;  4A7A A;  5HXI A;  3NGC X;  4GRT A;  1V59 A;  1H6V A;  1B5Q A;  2WPF A;  3NHO X;  1UKV G;  2BXR A;  1JRY A;  3GD4 A;  3L1R A;  2R45 A;  3LAD A;  5JCM A;  2QAE A;  4H4Z A;  2GB0 A;  1BGN A;  2GQW A;  3FG2 P;  3K7Q X;  2GR3 A;  3BNU A;  1BF3 A;  1KDG A;  4H4P A;  4EM4 A;  2XFN A;  4ZN0 A;  1IUV A;  1Y56 A;  2TPR A;  4GR1 A;  1TYP A;  2C73 A;  1P2E A;  4YKG A;  1FEA A;  1ELI A;  3LJP A;  4B66 A;  4EIP A;  2WP9 A;  2VRL A;  2WDV A;  1GTE A;  1NDA A;  2GR0 A;  3DME A;  3EAO A;  1VRQ B;  2CDU A;  4IVO B;  2XLS A;  4AT2 A;  2C64 A;  4KPR A;  2YLW A;  3CIR A;  1L9C A;  5HYM A;  3CNT A;  2APG A;  2V5Z A;  4H4W A;  3GYJ A;  4EQS A;  2XCG A;  1PDH A;  4H4R A;  2YG4 A;  4U8K A;  3KLJ A;  3NG7 X;  2EQ8 A;  3F8R A;  3NYF A;  3KKJ A;  3RHA A;  2XFO A;  2YWL A;  3CGE A;  3M12 A;  3UTG A;  4M52 A;  1ZDL A;  4Y4N A;  4YWO A;  1ZK7 A;  2JB3 A;  2YVG A;  3UKF A;  4Z25 A;  1DJQ A;  4B65 A;  4IA5 A;  2GVC A;  1GXF A;  1H83 A;  4OCG A;  3UKA A;  1CJ2 A;  3VRB A;  2WOW A;  3RNM A;  3CPI G;  3ICS A;  2YVF A;  2B9W A;  2EQ9 A;  4N9X A;  3FIM B;  2BK3 A;  4DSG A;  3AD7 B;  1QLB A;  2Q0L A;  2WES A;  4C5O A;  3GRT A;  4JN9 A;  2VQB A;  5FS8 A;  3K7T A;  3OZ2 A;  3RP7 A;  3D1C A;  2JBV A;  4KX6 A;  1TDN A;  4J31 A;  1ZOY A;  4UDP A;  2C3D A;  1E1L A;  2YG6 A;  3CNS A;  2XLR A;  3CPJ G;  2IVD A;  5BVA A;  1P2H A;  4JQ9 A;  3RED A;  2BAC A;  2QA2 A;  2YAU A;  3C4N A;  3AD8 B;  3PS9 A;  3SFE A;  3NK0 X;  4BV6 A;  1OJT A;  1DXL A;  3ABV A;  2CVJ A;  5GRT A;  1F8S A;  1GRH A;  4OPI A;  3VRD B;  3IC9 A;  1JNR A;  4EQR A;  2RAB A;  3GWD A;  4ICY A;  2ARD A;  3AE9 A;  3UTH A;  3NYC A;  3KPF A;  4AP3 A;  3GMB A;  4B64 A;  4RG3 A;  1GRA A;  5TR3 A;  1S3E A;  1VQW A;  4H2Q A;  4APN A;  2WHD A;  2WS3 A;  1O95 A;  2B7S A;  4YTM A;  3C4A A;  2GAG B;  4U2T A;  4TM3 A;  4OPD A;  1M6I A;  3UTF A;  3IF9 A;  3SGL A;  3UKL A;  2FJA A;  1D7L A;  3AD9 B;  4D03 A;  3ISH A;  4FDC B;  3NNE A;  4X9M A;  3P1W A;  1X31 B;  2GR2 A;  1OJD A;  4AP1 A;  2WEU A;  5JCL A;  1K0I A;  1PBE A;  3WE0 A;  1H84 A;  5FMH A;  4YT0 A;  1K0J A;  1YKJ A;  2VRM A;  1EL7 A;  2X99 A;  3RP8 A;  3VQR A;  2YM1 A;  5BUK A;  1K4Q A;  2Q6U A;  4A6N B;  1D4E A;  4USQ A;  2VQ7 A;  2JK6 A;  2V60 A;  1LJ1 A;  5M0Z A;  4AOS A;  5EB5 A;  4U8I A;  2XVF A;  1PBF A;  1TDO A;  3ATR A;  1KSS A;  1NEN A;  1TRB A;  3CPH G;  5M10 A;  4Z2U A;  1PN0 A;  2BK4 A;  2JAE A;  4CCR A;  2YQU A;  3UKP A;  4EMI A;  2AQJ A;  1Z6L A;  2O9Z A;  1AOG A;  1E7P A;  1SEZ A;  3AE4 A;  4TM0 A;  2XLU A;  4BJZ A;  1JNZ A;  4JNQ A;  3JSK A;  4HB9 A;  1GTH A;  1QJD A;  1PXB A;  2C72 A;  4BK2 A;  3NK1 X;  4B67 A;  4U2L A;  3SFD A;  3ICR A;  4YXD A;  5ER0 A;  2NVK X;  5HY5 A;  2BS4 A;  1EBD A;  2R0G A;  2B9Y A;  3IHM A;  1GES A;  4A65 A;  1JEH A;  1JRX A;  1GEU A;  4IV9 A;  3FMW A;  2OAM A;  2OA1 A;  1NG3 A;  3BI2 A;  1DOE A;  3AE8 A;  1QO8 A;  3P4R A;  1CF3 A;  4H4S A;  4IA6 A;  3R9U A;  1IJH A;  1GRB A;  4Y4M A;  2V3A A;  4UDR A;  3ATQ A;  4K2X A;  1S2Q A;  4J56 A;  5EB4 A;  4Z44 A;  4J34 A;  1H7X A;  3AEB A;  3BNM A;  4U8M A;  2V3B A;  2B76 A;  3P4S A;  2YLX A;  3C96 A;  3F8P A;  3CGD A;  5KVH A;  4JDR A;  3F8D A;  2R4E A;  2GRT A;  3AED A;  2GH5 A;  1LTX R;  1Q9I A;  2E1M A;  3ZDN A;  4C3X A;  1K0L A;  3AEG A;  3NH3 X;  3QJ4 A;  1NG4 A;  3ADA B;  2C75 A;  1GAL A;  2IID A;  2Q0K A;  1XPQ A;  4B68 A;  3K30 A;  1CJC A;  1D4C A;  2Z5X A;  1BKW A;  2E4G A;  3AE6 A;  2VOU A;  3DJD A;  4JNA A;  1GOS A;  3NK2 X;  4CBQ A;  3UKH A;  4D04 A;  3DGH A;  1L9E A;  3IHG A;  2ACZ A;  4WCT A;  2F5Z A;  5GSN A;  4EMW A;  5KXJ A;  1GT8 A;  2C3C A;  1DJN A;  4J57 A;  1HYU A;  2YLT A;  4CY8 A;  2YLR A;  1OJC A;  1PJ6 A;  3LB8 A;  1H81 A;  4C3Y A;  4H4T A;  1E1M A;  1H86 A;  2EQ7 A;  4BK1 A;  4YKF A;  3ALM A;  1PS9 A;  2BXS A;  4GF7 A;  3CTY A;  2WP5 A;  2RGJ A;  1DNC A;  4C74 A;  2EQ6 A;  2VVM A;  4AOX A;  4GCM A;  1ZMC A;  2WDR A;  2YM2 A;  1XAN A;  2BAB A;  3H8I A;  1EL5 A;  4OPG A;  3L8K A;  4MJW A;  2GQF A;  1BGJ A;  2XFQ A;  5KVI A;  1COY A;  2C70 A;  2R0C A;  2JB2 A;  4A5L A;  3M0O A;  1CJ4 A;  1TYT A;  3EF6 A;  1B37 A;  1XHC A;  4Z26 A;  1LQU A;  4YSY A;  1KSU A;  2FJE A;  4TM4 A;  1F8W A;  4TLX A;  3UTE A;  3DJJ A;  2GR1 A;  1IUW A;  4H4Y A;  2VVL G;  3NRN A;  2GV8 A;  1PBC A;  2TMD A;  1JRZ A;  4LII A;  4LU6 A;  4K5R A;  4BJY A;  1NHP A;  2AAQ A;  3G5Q A;  3O0H A;  2B7R A;  1L9D A;  2YR4 A;  2RGO A;  2NPX A;  1PXC A;  3GWF A;  4J33 A;  3S5W A;  1VG0 A;  3Q9T A;  4U8N A;  5U63 A;  2R4J A;  4XXG A;  2C7G A;  3UCL A;  3NKS A;  2OAL A;  2V61 A;  4YSH A;  1CJ3 A;  2VZ2 A;  3FPZ A;  3T37 A;  3GYI A;  1TDF A;  4Z43 A;  2WBA A;  1OJ9 A;  4GDE A;  3PVC A;  3DK4 A;  3V3O A;  2WOV A;  4C77 A;  4K7Z A;  3UKK A;  2WPC A;  1KNP A;  1VG9 A;  5CKU A;  1BWC A;  1GRG A;  1Q1W A;  2Q7V A;  4DNA A;  4XWZ A;  3AEF A;  1OJA A;  2C76 A;  2BCP A;  3DA1 A;  3RP6 A;  2JKC A;  2W0H A;  3NYE A;  3HZL A;  1MXT A;  4O5Q A;  1DOD A;  1N4V A;  1GRF A;  2X8G A;  4J2W A;  4X9N A;  3NTA A;  4Y4L A;  5FS9 A;  1NHR A;  1PBD A;  3H4K A;  4FK1 A;  4EQW A;  1H82 A;  1PBB A;  2BS2 A;  2X8C A;  2X50 A;  2XDO A;  1D5T A;  4TLZ A;  3UP4 A;  3LXD A;  2QA1 A;  1GND A;  4DGK A;  1KF6 A;  3AE5 A;  4RSL A;  3UOZ A;  1LQT A;  1W4X A;  3B6D A;  4H7U A;  2R0P A;  2R46 A;  4NEV A;  3BI5 A;  3P9U A;  3ALL A;  3VR9 A;  1B8S A;  2BC1 A;  1KNR A;  1FCD A;  2AR8 A;  3AWI A;  1LV0 A;  4LA1 A;  4NEW A;  1S3B A;  2ZZB A;  5IQ1 A;  4USR A;  2PHH A;  2I0Z A;  2YVJ A;  4CNK A;  1LVL A;  2CUL A;  4GUV A;  4EIQ A;  2Z5Y A;  2XVI A;  3LOV A;  2E5V A;  1VDC A;  2A8X A;  2YR5 A;  3FBS A;  2PYX A;  3SM8 A;  3AYL A;  1PJ7 A;  4PAB A;  4H2N A;  3QSE A;  4OPC A;  2XLP A;  1IUT A;  5JCK A;  3GRS A;  2HQM A;  4I58 A;  3UKQ A;  5LV9 A;  4YSZ A;  4B1B A;  5EBK A;  2YG7 A;  3AEC A;  4H2P A;  5HHF A;  3LZX A;  4WX1 A;  3P4P A;  1IUX A;  1D4D A;  3I3L A;  2OLO A;  4UP3 A;  1CHU A;  3ZYX A;  5BUL A;  3UOX A;  1XDI A;  1PXA A;  1E1K A;  4U2S A;  5C3J A;  2DKH A;  2GEW A;  1YQZ A;  3VR8 A;  2BYB A;  1ZMD A;  3V76 A;  1GRE A;  3NTD A;  1GV4 A;  2A87 A;  3NIX A;  1ZKQ A;  1REO A;  1DOC A;  3CNJ A;  4YTN A;  1PHH A;  4CNJ A;  4I59 A;  5JCI A;  3GDP A;  3NLC A;  4OVI A;  2C66 A;  3AE2 A;  1RP0 A;  1MO9 A;  1ZX9 A;  2H89 A;  4HA6 A;  4OPL A;  1D7Y A;  1TDE A;  4TM1 A;  3COX A;  2J3N A;  1ZY8 A;  2GMJ A;  3H8L A;  1S2Y A;  2YG3 A;  1H7W A;  5FS7 A;  1N4U A;  2DKI A;  4H4V A;  1O5W A;  1YY5 A;  2WU5 A;  4A9W A;  1ZOV A;  4UDQ A;  5J7X A;  4K8D A;  1L0V A;  3CGB A;  4A99 A;  4U8L A;  3GDN A;  1LPF A;  2H88 A;  3KD9 A;  3Q6J A;  1CBO A;  2FJB A;  2ZZC A;  1GER A;  1NHS A;  4OPU A;  3KA7 A;  4U8P A;  4YTP A;  3AXB A;  2C65 A;  2GMH A;  1CL0 A;  3I6D A;  3M13 A;  3URH A;  2BCG G;  4BUR A;  2UZZ A;  4EMJ A;  1ZP0 A;  1M64 A;  3GD3 A;  4NTD A;  4JY2 A;  2C67 A;  3DK8 A;  1NPX A;  2WU2 A;  4ECH A;  4BK3 A;  2YLZ A;  2WOI A;  3CGC A;  1F8R A;  2XVH A;  2WPE A;  4OPT A;  5L46 A;  5IQ4 A;  3ICT A;  3S61 A;  3B3R A;  3CND A;  2YG5 A;  4PAA A;  4REK A;  3AEE A;  4AT0 A;  3K7M X;  3QSS A;  3E1T A;  4P9S A;  1JU2 A;  3OC4 A;  1CC4 A;  1GRT A;  1RSG A;  1JOA A;  4EQX A;  3KVE A;  4ZCD A;  1FOH A;  4FX9 A;  2WP6 A;  4H50 A;  4ZCC A;  3D8X A;  1B4V A;  3SQP A;  1BZL A;  2BA9 A;  1Q1R A;  1E6E A;  1MOK A;  2QCU A;  2RGH A;  5JCN A;  2XFU A;  3AYI A;  4O5U A;  4K22 A;  4U8J A;  4Z2T A;  2XVE A;  4K5S A;  4H4Q A;  3AEA A;  4YSX A;  5CQF A;  5KOW A;  5IPY A;  2JB1 A;  3DK9 A;  3QVP A;  3QVR A;  2A89 A;  2V6O A;  3PO7 A;  4NTC A;  2R9Z A;  3DJG X;  2XFP A;  3ITJ A;  4J36 A;  2GF3 A;  1TDK A;  4NTE A;  5U25 A;  4Z24 A;  1O94 A;  2WDQ A;  3AE3 A;  1KFY A;  4IVM B;  4GDP A;  4ADW A;  2XVJ A;  4E0V A;  5C2T A;  2BC0 A;  1GET A;  3IWA A;  1EL9 A;  3UP5 A;  4CRT A;  4B63 A;  1CC6 A;  1N1P A;  2BS3 A;  2IVE A;  3CNP A;  2WQY A;  3QSM A;  3VRA A;  4CCQ A;  4EM3 A;  3EAN A;  2FBW A;  4H4X A;  1GPE A;  3AB1 A;  3NN6 X;  2FJD A;  1Y0P A;  3ALJ A;  4XWR A;  3KU9 A;  4NZH A;  3II4 A;  3AE7 A;  2XYO A;  5KRQ A;  1F3P A;  5KOX A;  5DBJ A;  3G5R A;  3DH9 A;  1FL2 A;  1PJ5 A;  2CFY A;  3QFB A;  1NAA A;  3DJE A;  5J60 A;  1EL8 A;  4A79 A;  3BI4 A;  3G5S A;  3UOY A;  2B9X A;  3NT6 A;  3QFA A;  3BHK A;  4CY6 A;  1FEB A;  1Y56 B;  2OLN A;  2YLS A;  3AYJ A;  3DGZ A;  1RYI A;  4H2R A;  4U8O A;  4RG4 A;  1FEC A;  3EPT A;  5FS6 A;  1NEK A;  2X3N A;  2VVL A;  2X8H A;  1IUS A;  3LZW A;  2XLT A;  1YQ3 A;  2GAH B;  4DSH A;  5BRT A;  3P4Q A;  3NN0 X;  1N4W A;  4FK1 C;  1GSN A;  2YR6 A;  4JY3 A;  4X4J A;  4A6N A;  2WET A;  1IUU A;  1F6M A;  1DOB A;  1YQ4 A;  3BHF A;  3GMC A;  1ONF A;  2ZZ0 A; 
#chains in the Genus database with same CATH topology
 3AE1 A;  1CC2 A;  2BK5 A;  2Y6Q A;  4B69 A;  5KWF A;  1E39 A;  2Y6R A;  2ZBW A;  3CN8 A;  4Z2R A;  3V3N A;  1NHQ A;  4H4U A;  5EOW A;  1E1N A;  5U1O A;  3GSI A;  3UOV A;  4A7A A;  5HXI A;  3SYI A;  3NGC X;  4GRT A;  1V59 A;  1H6V A;  1B5Q A;  2WPF A;  3NHO X;  1UKV G;  2BXR A;  1JRY A;  3GD4 A;  3L1R A;  2R45 A;  3LAD A;  5JCM A;  2QAE A;  4H4Z A;  2GB0 A;  1BGN A;  2GQW A;  3FG2 P;  3K7Q X;  2GR3 A;  3BNU A;  1BF3 A;  1KDG A;  4H4P A;  4EM4 A;  2XFN A;  4ZN0 A;  1IUV A;  1Y56 A;  2TPR A;  4GR1 A;  1TYP A;  2C73 A;  1P2E A;  4YKG A;  1FEA A;  1ELI A;  3LJP A;  4B66 A;  4EIP A;  2WP9 A;  2VRL A;  2WDV A;  1GTE A;  1NDA A;  2GR0 A;  3DME A;  3EAO A;  1VRQ B;  2CDU A;  4IVO B;  2XLS A;  4AT2 A;  2C64 A;  4KPR A;  2YLW A;  3CIR A;  1L9C A;  5HYM A;  3CNT A;  2APG A;  2V5Z A;  4H4W A;  3GYJ A;  4EQS A;  2XCG A;  1PDH A;  4H4R A;  2YG4 A;  4U8K A;  3KLJ A;  3NG7 X;  2EQ8 A;  3F8R A;  3NYF A;  3KKJ A;  3RHA A;  2XFO A;  2YWL A;  3SY4 A;  3CGE A;  3M12 A;  3UTG A;  4M52 A;  3T2K A;  1ZDL A;  4Y4N A;  4YWO A;  2BRY A;  1ZK7 A;  2JB3 A;  2YVG A;  3UKF A;  4Z25 A;  1DJQ A;  4B65 A;  4IA5 A;  2GVC A;  1GXF A;  1H83 A;  4OCG A;  3UKA A;  1CJ2 A;  3VRB A;  2WOW A;  4G6H A;  3RNM A;  3CPI G;  3ICS A;  2YVF A;  2B9W A;  2EQ9 A;  4N9X A;  3FIM B;  2BK3 A;  4DSG A;  3AD7 B;  1QLB A;  2Q0L A;  2WES A;  4C5O A;  3GRT A;  4JN9 A;  2VQB A;  5FS8 A;  3K7T A;  3SZW A;  3OZ2 A;  3RP7 A;  3D1C A;  2JBV A;  4KX6 A;  1TDN A;  4J31 A;  1ZOY A;  4UDP A;  2C3D A;  1E1L A;  2YG6 A;  3CNS A;  2XLR A;  3CPJ G;  2IVD A;  5BVA A;  1P2H A;  4JQ9 A;  3RED A;  2BAC A;  2QA2 A;  2YAU A;  3C4N A;  3AD8 B;  3PS9 A;  3SFE A;  3NK0 X;  4BV6 A;  1OJT A;  1DXL A;  3ABV A;  2CVJ A;  5GRT A;  1F8S A;  1GRH A;  4OPI A;  3VRD B;  3IC9 A;  1JNR A;  4EQR A;  2RAB A;  3GWD A;  4ICY A;  2ARD A;  3AE9 A;  3UTH A;  3NYC A;  3KPF A;  4AP3 A;  3GMB A;  4B64 A;  4RG3 A;  1GRA A;  5TR3 A;  1S3E A;  1VQW A;  4H2Q A;  4APN A;  2WHD A;  2WS3 A;  1O95 A;  2B7S A;  4YTM A;  2BRA A;  2GAG B;  3C4A A;  4TM3 A;  4U2T A;  4OPD A;  1M6I A;  3UTF A;  3IF9 A;  3SGL A;  3UKL A;  2FJA A;  1D7L A;  3AD9 B;  4D03 A;  3ISH A;  4FDC B;  3NNE A;  4X9M A;  3P1W A;  1X31 B;  2GR2 A;  1OJD A;  4AP1 A;  2WEU A;  5JCL A;  1K0I A;  1PBE A;  3WE0 A;  1H84 A;  5FMH A;  4YT0 A;  1K0J A;  1YKJ A;  2VRM A;  1EL7 A;  2X99 A;  3RP8 A;  3VQR A;  2YM1 A;  5BUK A;  1K4Q A;  2Q6U A;  4A6N B;  1D4E A;  4USQ A;  3SX6 A;  2VQ7 A;  2JK6 A;  2V60 A;  1LJ1 A;  5M0Z A;  4AOS A;  5EB5 A;  4U8I A;  2XVF A;  1PBF A;  1TDO A;  3ATR A;  1KSS A;  1NEN A;  1TRB A;  3CPH G;  5M10 A;  4Z2U A;  1PN0 A;  2BK4 A;  2JAE A;  4CCR A;  2YQU A;  3UKP A;  4EMI A;  2AQJ A;  1Z6L A;  2O9Z A;  3HYV A;  1AOG A;  1E7P A;  1SEZ A;  3AE4 A;  4TM0 A;  2XLU A;  4BJZ A;  1JNZ A;  4JNQ A;  3JSK A;  4HB9 A;  1GTH A;  5KMS A;  1QJD A;  1PXB A;  2C72 A;  4BK2 A;  3NK1 X;  4II3 A;  4U2L A;  4B67 A;  3SFD A;  3ICR A;  4YXD A;  5ER0 A;  2NVK X;  5HY5 A;  2BS4 A;  1EBD A;  5KMQ A;  2R0G A;  2B9Y A;  3IHM A;  1GES A;  4A65 A;  1JEH A;  1JRX A;  1GEU A;  4IV9 A;  3FMW A;  2OAM A;  2OA1 A;  1NG3 A;  3BI2 A;  1DOE A;  3AE8 A;  1QO8 A;  3P4R A;  1CF3 A;  4H4S A;  4IA6 A;  3R9U A;  1IJH A;  1GRB A;  4Y4M A;  3T0K A;  2V3A A;  4UDR A;  3ATQ A;  4K2X A;  1S2Q A;  4J56 A;  5EB4 A;  4Z44 A;  4J34 A;  1H7X A;  3AEB A;  3BNM A;  4U8M A;  2V3B A;  2C4C A;  2B76 A;  3P4S A;  2YLX A;  3C96 A;  3F8P A;  3CGD A;  5KVH A;  4JDR A;  3F8D A;  2R4E A;  2GRT A;  3AED A;  2GH5 A;  1LTX R;  1Q9I A;  2E1M A;  3T31 A;  3ZDN A;  4C3X A;  1K0L A;  3AEG A;  3NH3 X;  3QJ4 A;  1NG4 A;  3ADA B;  2C75 A;  1GAL A;  2IID A;  2Q0K A;  1XPQ A;  4B68 A;  3K30 A;  1CJC A;  1D4C A;  2Z5X A;  1BKW A;  2E4G A;  3AE6 A;  2VOU A;  3DJD A;  4JNA A;  1GOS A;  3NK2 X;  4CBQ A;  3UKH A;  4D04 A;  3DGH A;  1L9E A;  3IHG A;  2ACZ A;  4WCT A;  2F5Z A;  5GSN A;  4EMW A;  5KXJ A;  1GT8 A;  2C3C A;  1DJN A;  4J57 A;  1HYU A;  2YLT A;  4CY8 A;  2YLR A;  1OJC A;  1PJ6 A;  3LB8 A;  1H81 A;  3SZ0 A;  4C3Y A;  4H4T A;  1E1M A;  1H86 A;  2EQ7 A;  4BK1 A;  4YKF A;  3ALM A;  1PS9 A;  2BXS A;  4GF7 A;  3CTY A;  2WP5 A;  2RGJ A;  3HYX A;  1DNC A;  4C74 A;  2EQ6 A;  2VVM A;  3T2Y A;  4AOX A;  4GCM A;  1ZMC A;  2WDR A;  2YM2 A;  1XAN A;  2BAB A;  3H8I A;  1EL5 A;  4OPG A;  3L8K A;  4MJW A;  2GQF A;  1BGJ A;  2XFQ A;  5KVI A;  1COY A;  2C70 A;  2R0C A;  2JB2 A;  4A5L A;  3M0O A;  1CJ4 A;  1TYT A;  3EF6 A;  1B37 A;  3SXI A;  4NWZ A;  1XHC A;  4Z26 A;  1LQU A;  4YSY A;  1KSU A;  2FJE A;  4TM4 A;  1F8W A;  4TLX A;  3UTE A;  3DJJ A;  2GR1 A;  1IUW A;  4H4Y A;  2VVL G;  3NRN A;  4G6G A;  2GV8 A;  1PBC A;  2TMD A;  1JRZ A;  4LII A;  4LU6 A;  4K5R A;  4BJY A;  1NHP A;  2AAQ A;  3G5Q A;  3O0H A;  2B7R A;  1L9D A;  2YR4 A;  2RGO A;  2NPX A;  1PXC A;  3GWF A;  4J33 A;  3S5W A;  1VG0 A;  3Q9T A;  4U8N A;  5U63 A;  2R4J A;  4XXG A;  2C7G A;  3UCL A;  3NKS A;  2OAL A;  2V61 A;  4YSH A;  4NNJ A;  1CJ3 A;  2VZ2 A;  3FPZ A;  3T37 A;  3GYI A;  1TDF A;  4Z43 A;  2WBA A;  1OJ9 A;  4GDE A;  3PVC A;  3DK4 A;  3V3O A;  2WOV A;  4C77 A;  4K7Z A;  3UKK A;  2WPC A;  1KNP A;  1VG9 A;  5CKU A;  1BWC A;  1GRG A;  1Q1W A;  2Q7V A;  4DNA A;  4XWZ A;  3AEF A;  1OJA A;  2C76 A;  3SZC A;  2BCP A;  3DA1 A;  3RP6 A;  2JKC A;  2W0H A;  3NYE A;  3HZL A;  1MXT A;  4O5Q A;  1DOD A;  1N4V A;  1GRF A;  2X8G A;  4J2W A;  4X9N A;  3NTA A;  4Y4L A;  5FS9 A;  1NHR A;  1PBD A;  4G73 A;  3H4K A;  4FK1 A;  4EQW A;  1H82 A;  1PBB A;  2BS2 A;  2X8C A;  2X50 A;  2XDO A;  1D5T A;  4TLZ A;  3UP4 A;  3LXD A;  2QA1 A;  1GND A;  4DGK A;  1KF6 A;  3AE5 A;  4RSL A;  3UOZ A;  1LQT A;  1W4X A;  3B6D A;  4H7U A;  2R0P A;  2R46 A;  4NEV A;  3BI5 A;  3P9U A;  3ALL A;  3VR9 A;  1B8S A;  2BC1 A;  1KNR A;  1FCD A;  2AR8 A;  3AWI A;  1LV0 A;  4LA1 A;  4NEW A;  1S3B A;  2ZZB A;  5IQ1 A;  4USR A;  5KNL A;  2PHH A;  2I0Z A;  2YVJ A;  4CNK A;  1LVL A;  2CUL A;  3T2Z A;  4GUV A;  4EIQ A;  2Z5Y A;  2XVI A;  3LOV A;  2E5V A;  1VDC A;  2A8X A;  2YR5 A;  3FBS A;  2PYX A;  3SM8 A;  3AYL A;  1PJ7 A;  3GYX A;  4PAB A;  4H2N A;  3QSE A;  4OPC A;  2XLP A;  5KMR A;  1IUT A;  5JCK A;  3GRS A;  2HQM A;  4I58 A;  3UKQ A;  5LV9 A;  4YSZ A;  4B1B A;  5EBK A;  2YG7 A;  3AEC A;  4H2P A;  5HHF A;  3LZX A;  4WX1 A;  3P4P A;  1IUX A;  1D4D A;  3I3L A;  4G74 A;  2OLO A;  4GAV A;  4UP3 A;  1CHU A;  3ZYX A;  3KPK A;  5BUL A;  3UOX A;  1XDI A;  1PXA A;  1E1K A;  4U2S A;  5C3J A;  2DKH A;  2GEW A;  1YQZ A;  3VR8 A;  2BYB A;  1ZMD A;  3V76 A;  1GRE A;  3NTD A;  1GV4 A;  2A87 A;  3NIX A;  1ZKQ A;  1REO A;  1DOC A;  3CNJ A;  4YTN A;  1PHH A;  4CNJ A;  4I59 A;  5JCI A;  3GDP A;  3NLC A;  4OVI A;  5KMP A;  2C66 A;  3AE2 A;  1RP0 A;  1MO9 A;  1ZX9 A;  2H89 A;  4HA6 A;  4OPL A;  1D7Y A;  1TDE A;  4TM1 A;  3COX A;  2J3N A;  1ZY8 A;  2GMJ A;  3H8L A;  1S2Y A;  2YG3 A;  1H7W A;  5FS7 A;  1N4U A;  2DKI A;  4H4V A;  1O5W A;  1YY5 A;  2WU5 A;  4A9W A;  1ZOV A;  4UDQ A;  5J7X A;  4K8D A;  1L0V A;  3CGB A;  4A99 A;  4U8L A;  3GDN A;  1LPF A;  2H88 A;  3KD9 A;  3Q6J A;  1CBO A;  4GAP A;  2FJB A;  2ZZC A;  1GER A;  1NHS A;  4OPU A;  3KA7 A;  4U8P A;  4YTP A;  3AXB A;  2C65 A;  2GMH A;  1CL0 A;  3I6D A;  3M13 A;  3URH A;  2BCG G;  4BUR A;  2UZZ A;  4EMJ A;  1ZP0 A;  1M64 A;  3GD3 A;  4NTD A;  4JY2 A;  2C67 A;  3DK8 A;  1NPX A;  2WU2 A;  4ECH A;  4BK3 A;  2YLZ A;  2WOI A;  3CGC A;  1F8R A;  2XVH A;  2WPE A;  4OPT A;  5L46 A;  5IQ4 A;  3ICT A;  3S61 A;  3B3R A;  3CND A;  2YG5 A;  4PAA A;  4REK A;  3AEE A;  4AT0 A;  3K7M X;  3QSS A;  3E1T A;  4P9S A;  1JU2 A;  3OC4 A;  1CC4 A;  1GRT A;  1RSG A;  1JOA A;  4EQX A;  3KVE A;  4ZCD A;  1FOH A;  4FX9 A;  2WP6 A;  4H50 A;  4ZCC A;  3D8X A;  1B4V A;  4G9K A;  3SQP A;  1BZL A;  2BA9 A;  1Q1R A;  1E6E A;  1MOK A;  2QCU A;  2RGH A;  5JCN A;  2XFU A;  3AYI A;  4O5U A;  4K22 A;  4U8J A;  4Z2T A;  2XVE A;  4K5S A;  4H4Q A;  3AEA A;  4YSX A;  5CQF A;  5KOW A;  5IPY A;  2JB1 A;  3DK9 A;  3QVP A;  3QVR A;  2A89 A;  2V6O A;  3PO7 A;  4NTC A;  2R9Z A;  3DJG X;  2XFP A;  3ITJ A;  4J36 A;  2GF3 A;  1TDK A;  4NTE A;  5U25 A;  4Z24 A;  1O94 A;  2WDQ A;  3CMM A;  3HYW A;  3AE3 A;  1KFY A;  4IVM B;  4GDP A;  4II2 A;  4ADW A;  2XVJ A;  4E0V A;  5C2T A;  3SZF A;  2BC0 A;  1GET A;  3IWA A;  1EL9 A;  3UP5 A;  4CRT A;  4B63 A;  1CC6 A;  1N1P A;  2BS3 A;  2IVE A;  3CNP A;  2WQY A;  3QSM A;  3VRA A;  4CCQ A;  4EM3 A;  3EAN A;  2FBW A;  4H4X A;  1GPE A;  3AB1 A;  3NN6 X;  2FJD A;  1Y0P A;  3ALJ A;  4XWR A;  3KU9 A;  4NZH A;  3II4 A;  3AE7 A;  2XYO A;  5KRQ A;  1F3P A;  5KOX A;  5DBJ A;  3G5R A;  3DH9 A;  1FL2 A;  1PJ5 A;  2CFY A;  3QFB A;  1NAA A;  3DJE A;  5J60 A;  1EL8 A;  4A79 A;  3BI4 A;  3G5S A;  3UOY A;  2B9X A;  3NT6 A;  3QFA A;  3BHK A;  4CY6 A;  1FEB A;  1Y56 B;  2OLN A;  2YLS A;  3AYJ A;  3DGZ A;  1RYI A;  4H2R A;  4U8O A;  4RG4 A;  1FEC A;  3EPT A;  5FS6 A;  1NEK A;  2X3N A;  3T14 A;  2VVL A;  2X8H A;  1IUS A;  3LZW A;  2XLT A;  1YQ3 A;  2GAH B;  4DSH A;  5BRT A;  3P4Q A;  3NN0 X;  1N4W A;  4FK1 C;  1GSN A;  2YR6 A;  4JY3 A;  4X4J A;  4A6N A;  2WET A;  1IUU A;  1F6M A;  1DOB A;  1YQ4 A;  3BHF A;  3GMC A;  1ONF A;  2ZZ0 A; 
#chains in the Genus database with same CATH homology
 3AE1 A;  1CC2 A;  2BK5 A;  2Y6Q A;  4B69 A;  5KWF A;  1E39 A;  2Y6R A;  2ZBW A;  3CN8 A;  4Z2R A;  3V3N A;  1NHQ A;  4H4U A;  5EOW A;  1E1N A;  5U1O A;  3GSI A;  3UOV A;  4A7A A;  5HXI A;  3SYI A;  3NGC X;  4GRT A;  1V59 A;  1H6V A;  1B5Q A;  2WPF A;  3NHO X;  1UKV G;  2BXR A;  1JRY A;  3GD4 A;  3L1R A;  2R45 A;  3LAD A;  5JCM A;  2QAE A;  4H4Z A;  2GB0 A;  1BGN A;  2GQW A;  3FG2 P;  3K7Q X;  2GR3 A;  3BNU A;  1BF3 A;  1KDG A;  4H4P A;  4EM4 A;  2XFN A;  4ZN0 A;  1IUV A;  1Y56 A;  2TPR A;  4GR1 A;  1TYP A;  2C73 A;  1P2E A;  4YKG A;  1FEA A;  1ELI A;  3LJP A;  4B66 A;  4EIP A;  2WP9 A;  2VRL A;  2WDV A;  1GTE A;  1NDA A;  2GR0 A;  3DME A;  3EAO A;  1VRQ B;  2CDU A;  4IVO B;  2XLS A;  4AT2 A;  2C64 A;  4KPR A;  2YLW A;  3CIR A;  1L9C A;  5HYM A;  3CNT A;  2APG A;  2V5Z A;  4H4W A;  3GYJ A;  4EQS A;  2XCG A;  1PDH A;  4H4R A;  2YG4 A;  4U8K A;  3KLJ A;  3NG7 X;  2EQ8 A;  3F8R A;  3NYF A;  3KKJ A;  3RHA A;  2XFO A;  2YWL A;  3SY4 A;  3CGE A;  3M12 A;  3UTG A;  4M52 A;  3T2K A;  1ZDL A;  4Y4N A;  4YWO A;  2BRY A;  1ZK7 A;  2JB3 A;  2YVG A;  3UKF A;  4Z25 A;  1DJQ A;  4B65 A;  4IA5 A;  2GVC A;  1GXF A;  1H83 A;  4OCG A;  3UKA A;  1CJ2 A;  3VRB A;  2WOW A;  4G6H A;  3RNM A;  3CPI G;  3ICS A;  2YVF A;  2B9W A;  2EQ9 A;  4N9X A;  3FIM B;  2BK3 A;  4DSG A;  3AD7 B;  1QLB A;  2Q0L A;  2WES A;  4C5O A;  3GRT A;  4JN9 A;  2VQB A;  5FS8 A;  3K7T A;  3SZW A;  3OZ2 A;  3RP7 A;  3D1C A;  2JBV A;  4KX6 A;  1TDN A;  4J31 A;  1ZOY A;  4UDP A;  2C3D A;  1E1L A;  2YG6 A;  3CNS A;  2XLR A;  3CPJ G;  2IVD A;  5BVA A;  1P2H A;  4JQ9 A;  3RED A;  2BAC A;  2QA2 A;  2YAU A;  3C4N A;  3AD8 B;  3PS9 A;  3SFE A;  3NK0 X;  4BV6 A;  1OJT A;  1DXL A;  3ABV A;  2CVJ A;  5GRT A;  1F8S A;  1GRH A;  4OPI A;  3VRD B;  3IC9 A;  1JNR A;  4EQR A;  2RAB A;  3GWD A;  4ICY A;  2ARD A;  3AE9 A;  3UTH A;  3NYC A;  3KPF A;  4AP3 A;  3GMB A;  4B64 A;  4RG3 A;  1GRA A;  5TR3 A;  1S3E A;  1VQW A;  4H2Q A;  4APN A;  2WHD A;  2WS3 A;  1O95 A;  2B7S A;  4YTM A;  2BRA A;  2GAG B;  3C4A A;  4TM3 A;  4U2T A;  4OPD A;  1M6I A;  3UTF A;  3IF9 A;  3SGL A;  3UKL A;  2FJA A;  1D7L A;  3AD9 B;  4D03 A;  3ISH A;  4FDC B;  3NNE A;  4X9M A;  3P1W A;  1X31 B;  2GR2 A;  1OJD A;  4AP1 A;  2WEU A;  5JCL A;  1K0I A;  1PBE A;  3WE0 A;  1H84 A;  5FMH A;  4YT0 A;  1K0J A;  1YKJ A;  2VRM A;  1EL7 A;  2X99 A;  3RP8 A;  3VQR A;  2YM1 A;  5BUK A;  1K4Q A;  2Q6U A;  4A6N B;  1D4E A;  4USQ A;  3SX6 A;  2VQ7 A;  2JK6 A;  2V60 A;  1LJ1 A;  5M0Z A;  4AOS A;  5EB5 A;  4U8I A;  2XVF A;  1PBF A;  1TDO A;  3ATR A;  1KSS A;  1NEN A;  1TRB A;  3CPH G;  5M10 A;  4Z2U A;  1PN0 A;  2BK4 A;  2JAE A;  4CCR A;  2YQU A;  3UKP A;  4EMI A;  2AQJ A;  1Z6L A;  2O9Z A;  3HYV A;  1AOG A;  1E7P A;  1SEZ A;  3AE4 A;  4TM0 A;  2XLU A;  4BJZ A;  1JNZ A;  4JNQ A;  3JSK A;  4HB9 A;  1GTH A;  5KMS A;  1QJD A;  1PXB A;  2C72 A;  4BK2 A;  3NK1 X;  4II3 A;  4U2L A;  4B67 A;  3SFD A;  3ICR A;  4YXD A;  5ER0 A;  2NVK X;  5HY5 A;  2BS4 A;  1EBD A;  5KMQ A;  2R0G A;  2B9Y A;  3IHM A;  1GES A;  4A65 A;  1JEH A;  1JRX A;  1GEU A;  4IV9 A;  3FMW A;  2OAM A;  2OA1 A;  1NG3 A;  3BI2 A;  1DOE A;  3AE8 A;  1QO8 A;  3P4R A;  1CF3 A;  4H4S A;  4IA6 A;  3R9U A;  1IJH A;  1GRB A;  4Y4M A;  3T0K A;  2V3A A;  4UDR A;  3ATQ A;  4K2X A;  1S2Q A;  4J56 A;  5EB4 A;  4Z44 A;  4J34 A;  1H7X A;  3AEB A;  3BNM A;  4U8M A;  2V3B A;  2C4C A;  2B76 A;  3P4S A;  2YLX A;  3C96 A;  3F8P A;  3CGD A;  5KVH A;  4JDR A;  3F8D A;  2R4E A;  2GRT A;  3AED A;  2GH5 A;  1LTX R;  1Q9I A;  2E1M A;  3T31 A;  3ZDN A;  4C3X A;  1K0L A;  3AEG A;  3NH3 X;  3QJ4 A;  1NG4 A;  3ADA B;  2C75 A;  1GAL A;  2IID A;  2Q0K A;  1XPQ A;  4B68 A;  3K30 A;  1CJC A;  1D4C A;  2Z5X A;  1BKW A;  2E4G A;  3AE6 A;  2VOU A;  3DJD A;  4JNA A;  1GOS A;  3NK2 X;  4CBQ A;  3UKH A;  4D04 A;  3DGH A;  1L9E A;  3IHG A;  2ACZ A;  4WCT A;  2F5Z A;  5GSN A;  4EMW A;  5KXJ A;  1GT8 A;  2C3C A;  1DJN A;  4J57 A;  1HYU A;  2YLT A;  4CY8 A;  2YLR A;  1OJC A;  1PJ6 A;  3LB8 A;  1H81 A;  3SZ0 A;  4C3Y A;  4H4T A;  1E1M A;  1H86 A;  2EQ7 A;  4BK1 A;  4YKF A;  3ALM A;  1PS9 A;  2BXS A;  4GF7 A;  3CTY A;  2WP5 A;  2RGJ A;  3HYX A;  1DNC A;  4C74 A;  2EQ6 A;  2VVM A;  3T2Y A;  4AOX A;  4GCM A;  1ZMC A;  2WDR A;  2YM2 A;  1XAN A;  2BAB A;  3H8I A;  1EL5 A;  4OPG A;  3L8K A;  4MJW A;  2GQF A;  1BGJ A;  2XFQ A;  5KVI A;  1COY A;  2C70 A;  2R0C A;  2JB2 A;  4A5L A;  3M0O A;  1CJ4 A;  1TYT A;  3EF6 A;  1B37 A;  3SXI A;  4NWZ A;  1XHC A;  4Z26 A;  1LQU A;  4YSY A;  1KSU A;  2FJE A;  4TM4 A;  1F8W A;  4TLX A;  3UTE A;  3DJJ A;  2GR1 A;  1IUW A;  4H4Y A;  2VVL G;  3NRN A;  4G6G A;  2GV8 A;  1PBC A;  2TMD A;  1JRZ A;  4LII A;  4LU6 A;  4K5R A;  4BJY A;  1NHP A;  2AAQ A;  3G5Q A;  3O0H A;  2B7R A;  1L9D A;  2YR4 A;  2RGO A;  2NPX A;  1PXC A;  3GWF A;  4J33 A;  3S5W A;  1VG0 A;  3Q9T A;  4U8N A;  5U63 A;  2R4J A;  4XXG A;  2C7G A;  3UCL A;  3NKS A;  2OAL A;  2V61 A;  4YSH A;  4NNJ A;  1CJ3 A;  2VZ2 A;  3FPZ A;  3T37 A;  3GYI A;  1TDF A;  4Z43 A;  2WBA A;  1OJ9 A;  4GDE A;  3PVC A;  3DK4 A;  3V3O A;  2WOV A;  4C77 A;  4K7Z A;  3UKK A;  2WPC A;  1KNP A;  1VG9 A;  5CKU A;  1BWC A;  1GRG A;  1Q1W A;  2Q7V A;  4DNA A;  4XWZ A;  3AEF A;  1OJA A;  2C76 A;  3SZC A;  2BCP A;  3DA1 A;  3RP6 A;  2JKC A;  2W0H A;  3NYE A;  3HZL A;  1MXT A;  4O5Q A;  1DOD A;  1N4V A;  1GRF A;  2X8G A;  4J2W A;  4X9N A;  3NTA A;  4Y4L A;  5FS9 A;  1NHR A;  1PBD A;  4G73 A;  3H4K A;  4FK1 A;  4EQW A;  1H82 A;  1PBB A;  2BS2 A;  2X8C A;  2X50 A;  2XDO A;  1D5T A;  4TLZ A;  3UP4 A;  3LXD A;  2QA1 A;  1GND A;  4DGK A;  1KF6 A;  3AE5 A;  4RSL A;  3UOZ A;  1LQT A;  1W4X A;  3B6D A;  4H7U A;  2R0P A;  2R46 A;  4NEV A;  3BI5 A;  3P9U A;  3ALL A;  3VR9 A;  1B8S A;  2BC1 A;  1KNR A;  1FCD A;  2AR8 A;  3AWI A;  1LV0 A;  4LA1 A;  4NEW A;  1S3B A;  2ZZB A;  5IQ1 A;  4USR A;  5KNL A;  2PHH A;  2I0Z A;  2YVJ A;  4CNK A;  1LVL A;  2CUL A;  3T2Z A;  4GUV A;  4EIQ A;  2Z5Y A;  2XVI A;  3LOV A;  2E5V A;  1VDC A;  2A8X A;  2YR5 A;  3FBS A;  2PYX A;  3SM8 A;  3AYL A;  1PJ7 A;  3GYX A;  4PAB A;  4H2N A;  3QSE A;  4OPC A;  2XLP A;  5KMR A;  1IUT A;  5JCK A;  3GRS A;  2HQM A;  4I58 A;  3UKQ A;  5LV9 A;  4YSZ A;  4B1B A;  5EBK A;  2YG7 A;  3AEC A;  4H2P A;  5HHF A;  3LZX A;  4WX1 A;  3P4P A;  1IUX A;  1D4D A;  3I3L A;  4G74 A;  2OLO A;  4GAV A;  4UP3 A;  1CHU A;  3ZYX A;  3KPK A;  5BUL A;  3UOX A;  1XDI A;  1PXA A;  1E1K A;  4U2S A;  5C3J A;  2DKH A;  2GEW A;  1YQZ A;  3VR8 A;  2BYB A;  1ZMD A;  3V76 A;  1GRE A;  3NTD A;  1GV4 A;  2A87 A;  3NIX A;  1ZKQ A;  1REO A;  1DOC A;  3CNJ A;  4YTN A;  1PHH A;  4CNJ A;  4I59 A;  5JCI A;  3GDP A;  3NLC A;  4OVI A;  5KMP A;  2C66 A;  3AE2 A;  1RP0 A;  1MO9 A;  1ZX9 A;  2H89 A;  4HA6 A;  4OPL A;  1D7Y A;  1TDE A;  4TM1 A;  3COX A;  2J3N A;  1ZY8 A;  2GMJ A;  3H8L A;  1S2Y A;  2YG3 A;  1H7W A;  5FS7 A;  1N4U A;  2DKI A;  4H4V A;  1O5W A;  1YY5 A;  2WU5 A;  4A9W A;  1ZOV A;  4UDQ A;  5J7X A;  4K8D A;  1L0V A;  3CGB A;  4A99 A;  4U8L A;  3GDN A;  1LPF A;  2H88 A;  3KD9 A;  3Q6J A;  1CBO A;  4GAP A;  2FJB A;  2ZZC A;  1GER A;  1NHS A;  4OPU A;  3KA7 A;  4U8P A;  4YTP A;  3AXB A;  2C65 A;  2GMH A;  1CL0 A;  3I6D A;  3M13 A;  3URH A;  2BCG G;  4BUR A;  2UZZ A;  4EMJ A;  1ZP0 A;  1M64 A;  3GD3 A;  4NTD A;  4JY2 A;  2C67 A;  3DK8 A;  1NPX A;  2WU2 A;  4ECH A;  4BK3 A;  2YLZ A;  2WOI A;  3CGC A;  1F8R A;  2XVH A;  2WPE A;  4OPT A;  5L46 A;  5IQ4 A;  3ICT A;  3S61 A;  3B3R A;  3CND A;  2YG5 A;  4PAA A;  4REK A;  3AEE A;  4AT0 A;  3K7M X;  3QSS A;  3E1T A;  4P9S A;  1JU2 A;  3OC4 A;  1CC4 A;  1GRT A;  1RSG A;  1JOA A;  4EQX A;  3KVE A;  4ZCD A;  1FOH A;  4FX9 A;  2WP6 A;  4H50 A;  4ZCC A;  3D8X A;  1B4V A;  4G9K A;  3SQP A;  1BZL A;  2BA9 A;  1Q1R A;  1E6E A;  1MOK A;  2QCU A;  2RGH A;  5JCN A;  2XFU A;  3AYI A;  4O5U A;  4K22 A;  4U8J A;  4Z2T A;  2XVE A;  4K5S A;  4H4Q A;  3AEA A;  4YSX A;  5CQF A;  5KOW A;  5IPY A;  2JB1 A;  3DK9 A;  3QVP A;  3QVR A;  2A89 A;  2V6O A;  3PO7 A;  4NTC A;  2R9Z A;  3DJG X;  2XFP A;  3ITJ A;  4J36 A;  2GF3 A;  1TDK A;  4NTE A;  5U25 A;  4Z24 A;  1O94 A;  2WDQ A;  3CMM A;  3HYW A;  3AE3 A;  1KFY A;  4IVM B;  4GDP A;  4II2 A;  4ADW A;  2XVJ A;  4E0V A;  5C2T A;  3SZF A;  2BC0 A;  1GET A;  3IWA A;  1EL9 A;  3UP5 A;  4CRT A;  4B63 A;  1CC6 A;  1N1P A;  2BS3 A;  2IVE A;  3CNP A;  2WQY A;  3QSM A;  3VRA A;  4CCQ A;  4EM3 A;  3EAN A;  2FBW A;  4H4X A;  1GPE A;  3AB1 A;  3NN6 X;  2FJD A;  1Y0P A;  3ALJ A;  4XWR A;  3KU9 A;  4NZH A;  3II4 A;  3AE7 A;  2XYO A;  5KRQ A;  1F3P A;  5KOX A;  5DBJ A;  3G5R A;  3DH9 A;  1FL2 A;  1PJ5 A;  2CFY A;  3QFB A;  1NAA A;  3DJE A;  5J60 A;  1EL8 A;  4A79 A;  3BI4 A;  3G5S A;  3UOY A;  2B9X A;  3NT6 A;  3QFA A;  3BHK A;  4CY6 A;  1FEB A;  1Y56 B;  2OLN A;  2YLS A;  3AYJ A;  3DGZ A;  1RYI A;  4H2R A;  4U8O A;  4RG4 A;  1FEC A;  3EPT A;  5FS6 A;  1NEK A;  2X3N A;  3T14 A;  2VVL A;  2X8H A;  1IUS A;  3LZW A;  2XLT A;  1YQ3 A;  2GAH B;  4DSH A;  5BRT A;  3P4Q A;  3NN0 X;  1N4W A;  4FK1 C;  1GSN A;  2YR6 A;  4JY3 A;  4X4J A;  4A6N A;  2WET A;  1IUU A;  1F6M A;  1DOB A;  1YQ4 A;  3BHF A;  3GMC A;  1ONF A;  2ZZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...